3TARA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-6) position
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tarA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tarA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tarA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tarA01
2PYLA 2XCPA 3EWAA 4CJ4A 1ZQXA 1D5AA 1RILA 3RR8A 4DQPA 1JLFA 5DBBA 2BCSA 2PYJA 1L3TA 4Q0BA 2FPKA 1UAXA 3AVCA 2WONA 1QSYA 3RB6A 4RQ3A 2EHGA 3OJUA 1WNSA 1VSHA 1LW2A 1DGSA 4N76A 2YNIA 3H08A 4FBTA 3VQCA 4TSXA 3TANA 3V6KA 2Z1HA 4CJTA 5DQHA 5C24A 2W9MA 4FJNA 2KQ2A 3WNHA 3UXPA 3C2MA 2PI4A 1TL3A 3NHGA 5DG9A 3LZIA 5KG7A 3OYKA 2BKEA 4FZXC 3PW4A 1SL1A 4NYFA 4FJHA 1NOMA 1JLCA 3L3VA 3NF9A 4F50A 1RCHA 4Q44A 1LWEA 3KHHA 4OJRA 1ZQLA 4KLMA 4DTMA 3O4QA 4NCAA 5KFMA 1S5JA 4CGIA 3L2UA 4KLHA 1X9MA 3OYEA 3C2LA 3ISBA 1MSWD 4QWBA 1DLOA 3F73A 3ZDBA 8ICEA 4ECTA 1T4GA 3ZDAA 1RPLA 1YTAA 4YFKA 2R8HA 5DG7A 1WLJA 5D4BA 4LSNA 3O4NA 5J0QA 2C2DA 5KFXA 4FM1A 1NKEA 3L2VA 4ZTJA 4TUQA 5DGBA 3QINA 4R66A 2BPGA 2E4LA 7ICUA 2HHVA 1K1SA 3OS2A 3RMBA 3T1AA 3V9WA 9ICMA 1TK0A 1RT6A 4E7KA 2W9AA 4TQRA 4M45A 2W9CA 5KT7A 2X74A 4QZBA 1JLEA 2XHBA 3AVHA 5KFAA 3HX0A 3RAQA 3RH4A 1KFTA 1TKTA 4KREA 4JS5A 4GXIA 4EBDA 3QO9A 3TAEA 2BCQA 3NF7A 4X5VA 4I28A 1MQ2A 3V72A 5J2FA 1GOBA 2NRTA 4CHZA 2ASLA 4J2AA 3PW5A 1BL3A 4L8RB 4QZIA 4ED7A 2ATQA 4J9SA 1CXQA 4HUFA 4IDKA 3DRSA 4PA1A 1TGOA 4UAWA 5FRNA 1V9PA 1ZQVA 3ETLA 1Z25A 3L2RA 4M9LA 5HROA 4KLTA 1JL1A 4ECXA 2XC9A 1T7PA 4CF1A 5FRMA 3HJFA 3U3YA 4AHTA 3MXIA 3V9UA 1A77A 5DGAA 1NJWA 1KCFA 3Q8KA 4ED3A 2RDJA 2IA6A 4O9MA 1FKPA 3B6PA 2BQ3A 1S97A 3IG1A 1BIZA 4FO6A 5J0YA 1HYVA 3ZT0A 2P1JA 4OKKA 5J2CA 5C25A 1J53A 3LDAA 3TQ1A 3OHBA 4NLNA 5J2GA 4CK1A 4EZ9A 4IRKA 1SUQA 1ZQIA 3PO5A 5KFVA 1BHLA 4LZDA 3ORYA 5DQIA 4MFFA 3Q8LA 4I2DA 4AHCA 5J2IA 3TFSA 3OYCA 3PX6A 3L8BA 4B9MA 4I2CA 4KHWA 4I2EA 3AO4A 1ZQCA 3TAQA 3LANA 1XC9A 2OPSA 1JL2A 1TAUA 3M9MB 4FS2A 1S9EA 8ICTA 1JLAA 4B9TA 1HQUA 5BOMA 2BCVA 4FVMA 3NH1A 3K5NA 8ICKA 4ID5A 4YD2A 1VSIA 1RBVA 1ZQWA 5DB8A 1BISA 2LSNA 3KTQA 4Z4HA 4W5OA 2A1RA 2RKIA 3DYAA 4CJPA 4OGEA 2QXFA 4CFCA 4KB1A 3PV8A 5DLFA 4M6WB 3OYLA 3JYTA 3NDKA 4W5QA 1TVAA 2MAXA 1TV6A 4DQQA 5J0TA 1EKEA 4FZYA 4QZAA 4YMOA 1JLBA 4FJ8A 3GV8B 3DMJA 4JK1A 3S9HA 4LZGA 4EBEA 4QZCA 4JUZA 3PY8A 1ZJNA 9ICBA 4FLYA 8ICAA 1T05A 1XI1A 2Y1JA 2KTQA 1N6QA 3LP1A 4RUAA 4B9VA 3DLGA 1WSGA 4F8RA 3OYAA 3SPYA 4CEQA 3ZD9A 2PFQA 4O5CA 2KZZA 4JRQA 4M3UA 5KI6A 3NH2A 1EX4A 4O55A 4O3PA 1X9WA 1R0AA 1SL2A 1JKHA 1WN7A 1S0VA 2XY5A 2DPJA 5HRPA 2IS3A 3DOKA 4XUSA 4Z6CA 1TV9A 3IAYA 5J0PA 3BDPA 4ED6A 3V81A 1BI4B 3AVKA 5KFGA 1VRUA 2R8IA 1EXNA 4CF8A 1KLNA 2KZ3A 1T3NA 1VK0A 1LWCA 2IBKA 4RW4A 4F4ZA 1L5UA 4OPJA 1K1QA 3ZCMA 5E41A 1ZQRA 1ZQNA 9ICRA 1Q8IA 3SQ2A 1S6PA 1RBUA 3NGZA 3OS1A 5DQGA 1ZBHA 5J2QA 3AVGA 4FLWA 3HP9A 8ICRA 2I1QA 4EP5A 4DS4A 1KVBA 1WCNA 4I2BA 2BQUA 1KEJA 2FLPA 3B6OA 3K58A 4B08A 1WAFA 2QKBA 4OPKA 3AU2A 2FMSA 2HHSA 3LWLA 4Z0UA 3P5JA 3OYGA 4MF2A 3SNNA 4DL6A 1N48A 3V1RA 4NLKA 4ECUA 5KFHA 5DK5A 8ICZA 4DQSA 4K4IA 3JPOA 4CIFA 2A1JA 3KLFA 3C5FA 2AQ0A 5DMRA 3MFHA 4M04A 3SQ1A 2VWJA 1RXVA 4H4OA 3GIJA 2ZTEA 3OHAA 3OY9A 1S0OA 4RT3A 3M9NB 9ICFA 2FPMA 2ZTDA 1JXLA 3D45A 3OYIA 4YXJA 4R5PA 4DMNA 4Z4GA 4R8UA 4I2FA 4OKJA 3RBDA 3KKSA 1ZYQA 3GFKB 2NRWA 4Q8EA 5KFBA 3ZDCA 3SI6A 4ECSA 8ICPA 3EPIA 1XU4A 3V7KA 1JXEA 4CF2A 2BDPA 1RTHA 3ISNC 4O3QA 3Q8RB 3MEGA 3T5KA 1JIHA 4HCBA 4FW1A 1A5VA 1DTTA 3OJSA 3UQ0A 2BPCA 1C0UA 2JGUA 3DRPA 1WSIA 4QW8A 1ZQUA 4FJ5A 2FBXA 2FLNA 2MUTA 3G6VA 5DBCA 4IFVA 4IG3A 2OZMA 2FPLA 4KLFA 4E7HA 3MR6A 5CWRA 4CEAA 1COOA 3H4BA 1KLMA 3BJYA 1VSJA 2B4JA 4XIUA 2HHWA 1UT5A 4Z6DA 4NLGA 3V9XA 1BGXT 2FBYA 5J0UA 1ZQEA 4KLOA 5J0WA 4GXJA 4DQIA 3PMNA 4F3TA 5KT2A 3GIKA 4TUPA 3CM5A 4MFAA 4LD0A 2ASJA 4DLGA 5KFPA 1ZJMA 4DTUA 3LAMA 5TZVA 2XGQA 4KTWA 4Q45A 4J9PA 4QZDA 2OYQA 5J2PA 4DSEA 4RQ4A 2W8LA 4EEYA 1CLQA 3DI6A 4M2YA 3OGUA 1BPXA 3TFRA 4DFPA 1WSJA 3O3GA 3NF8A 4ZTFA 4HUEA 1D9DA 2V4QA 4CHNA 1RTJA 4FJ9A 3O3FA 4LVSA 4FXDA 1NK0A 4F5QA 1HUOA 4CGGA 4RU9A 1H38A 1IKVA 4DTPA 2Y1IA 4PH5A 9ICQA 4IKFA 4RW8A 1UA0A 1L3UA 4M9HA 3EW9A 4BE0A 1FK9A 4YMMA 1CEZA 2ITGA 4E1NA 4CJSA 4LY7A 1S10A 1BPDA 2AU0A 3TWHA 1QTMA 9ICJA 1IM4A 4KLLA 5J2BA 4I2IA 5L9XA 5IIIA 4OVLA 4ID1A 4CJKA 3ALYA 4RNMA 2ZUDA 2C2RA 4IRCA 3MFIA 4UQGA 9ICWA 5KG2A 1LWFA 1HYSA 4F2SA 2XCAA 5KG6A 8ICUA 5KFCA 3KLEA 4KHYA 1ZQGA 4AHVA 4FJLA 3L3UA 3DLBA 3RJKA 4C8KA 3KHGA 3MBYA 5D3GA 1LB2B 3C21A 3T3FA 2F1JA 4BE2A 3TARA 3HP6A 5L1LA 1BPZA 1Q9XA 3H40A 5IINA 3JSMA 1JLQA 1RDAA 3AA2A 4Y1DA 1KDHA 4KLEA 2VANA 4N47A 3SJJA 4M3TA 8ICNA 1IKWA 4RQ0A 3QE9Y 3V1QA 4PHAA 1FKOA 3OYBA 2FC0A 3P83D 2NRVA 1B92A 3SUQA 2I5JA 1ZQAA 4KKOA 2WOMA 2OPQA 4RNNA 3K4GA 1SZPA 2PFNA 1RT3A 3AO3A 2JZBB 3RH6A 4LH4A 4J9NA 2IHMA 1RDBA 1K6YA 7ICIA 3KHLA 4QWAA 2BE2A 1TAQA 3HPGA 2G8IA 1IKXA 1XHXA 2IDOA 4P2HA 4KI4A 1S0MA 4YMNA 5J2MA 3I0SA 4QCLA 4CJ3A 3C2KA 4GXKA 2D0CA 3QIOA 2ISOA 4EYIB 3CFPA 5L1IA 1C1BA 5KFYA 4Z6EA 4M3RA 3PW0A 3PW7A 3S3MA 2YHBA 1U47A 5KFWA 4M9NA 1ZQSA 1U4BA 4NCBA 5JS1A 2JEJA 3BQ0A 4BDPA 2HMIA 2IHNA 2PI5A 3K59A 2G8FA 9ICNA 2ZJAA 3VQ5A 3QEWA 5J0SA 4GLXA 3IHQB 4NYNA 1C1AA 1JXBA 3RB4A 4NLZA 4PUOA 2R8GA 4K8XA 4I9QA 2ETJA 1D8YA 3CFRA 3KK3A 4R65A 3AUOA 4RW9A 4RQ6A 3KIOA 4FK4A 4M3ZA 3H7IA 4KLJA 1RT4A 2Z1JA 4UAZA 8ICIA 2OZSA 5KRTA 4KB0A 1T03A 2C2EA 1SL0A 2A1SA 4CCHA 3AVBA 9ICLA 4RPXA 2FLLA 2W42A 4J9RA 8ICLA 5IILA 1QS4A 3BQTA 4W5NA 3Q8PB 5DLGA 1Q9YA 2PY5A 4KAZA 4F4KA 3PMLA 4FJGA 4PGYA 4M6WA 3GQCA 1GOAA 2P6UA 3QERA 4CK2A 3HO1A 3BQ2A 4DWIA 2JLEA 3HYFA 3D0PA 4AILC 4RQ7A 2J6SA 4CJEA 4J9LA 1LV5A 3HL8A 2F96A 5CB1A 3TAMA 4YR0A 5T7BA 3SUNA 3SUOA 4YQWA 2R8KA 3LDSA 5KFIA 3SZ2A 1BPYA 1KSPA 3C6UA 2ZUBA 5KFDA 2YHAA 2BPFA 4QZHA 2BQRA 5I42A 1BPBA 3H8JA 3ZD8A 2G8VA 4ECYA 3KJVA 1TL1A 1Y88A 3QEIA 3CFOA 4YR3A 3NTUA 1IXRA 4M3WA 4CJFA 4KHUA 2EX3A 1WSHA 7ICTA 2GUIA 5EWFA 3K5LA 4DOAA 3C1YA 4J9KA 5CYMA 9ICHA 1A5XA 3UXNA 3V9SA 3AA5X 4K8ZA 4I29A 2FBTA 4DL3A 2RDIA 3LZJA 1QHTA 1Z26A 2DFHA 3TABA 2V4RA 5CA7A 1HPZA 1SKSA 1ZBFA 3FYHA 4RZRA 4Z4EA 1BVSA 1ZQZA 4DSFA 1HNIA 2XRIA 4DU1A 3HK2A 8ICSA 1C7YA 3S3NA 4CJRA 3MEEA 2G8KA 5HHHA 4ELTA 1X9SA 4MF8A 2PFPA 3MR3A 7ICOA 4I2GA 1VSKA 3RMDA 4QZGA 3K75D 4RNOA 2HVHA 7ICHA 1ZQDA 5CHGA 2AJQA 3QIPA 2AQ4A 3TAFA 4KO0A 4J2DA 9ICVA 3VQAA 3AVFA 3LAKA 1UA1A 3T5LA 1HJPA 4PPXA 4GVMA 4DSKA 3N4MB 4DFMA 4QWDA 1U48A 5IIMA 3K57A 4BE1A 4RW6A 5KFLA 3VQQA 3NGIA 3RJIA 4UBCA 2JEIA 3RRHA 3LPUA 3CQ8A 3M9OB 2P5GA 3SV4A 3RH5A 3VQ9A 4Q43A 3E01A 3Q8MA 2IC3A 1JN3A 3KK1A 4P4OA 2ZE2A 4CFAA 3ZDDA 2XY6A 4CEFA 4FJMA 3C5GA 3LPTA 2A1JB 4UB2A 1TKXA 4CIEA 3L2WA 4O3RA 1EP4A 4YP3A 4CHQA 3ZT3A 4CEDA 3P1GA 4CFDA 3KD1E 7ICEA 1VSMA 4B9SA 4M9JA 1ZQHA 4N5SA 3AU6A 5I3UA 3TR8A 2DY4A 1A76A 2P5OA 3RTVA 1NOZA 2P51A 4UBBA 1RBRA 4CEOA 2VA3A 2HNDA 3GV7B 3SCXA 4NM2A 4C8NA 4IRDA 3ZSVA 1T8EA 2J6TA 5HMLA 1LW0A 3QZ7A 4ELVA 2FBVA 4Z4FA 1RT1A 4C8LA 5KFOA 4M42A 2HVIA 4G1QA 7ICJA 4Y1CA 2O4GA 1BCMA 5KT3A 3HW8A 4JS4A 1QQCA 1UT8A 4CJLA 4DTXA 4ELUA 5KG5A 1B9FA 4E7JA 2Q3SA 3ZSXA 2X6NA 3AO1A 2UVVA 4H4MA 3TAPA 3AO5A 1HNVA 1TK5A 3ZSZA 1TK8A 4QAGA 1FXXA 3ZDEA 3HXMA 1ZQBA 2JEFA 1CXUA 1F21A 3RJJA 3RJFA 4DSLA 3JPQA 4O0JA 2R7YA 2PXIA 3MECA 3SQ4A 1XWLA 7ICKA 5HP1A 4I2AA 3DM2A 4R64A 4CHOA 4CJ5A 5FDLA 4CJQA 1BCOA 1KVCA 4E1MA 2B6AA 1RTDA 4CEZA 4B8CA 5DBAA 3PX0A 1NOYA 2BGGA 4KHNA 2ZJ5A 3WNFA 1IH7A 3DLHA 1BQNA 1W9HA 8ICWA 4Z4CA 4KTZA 4DTOA 4C8OA 3NAEA 4UB4A 3IS9A 5D49A 3DLEA 1DTQA 4PY5A 5F9LA 4OKEA 3QEVA 1Z00A 1AROP 1S1XA 2HHTA 4UB1A 1TKZA 2D5RA 1KRPA 4N41A 3RAXA 3MEDA 5BOLA 4YD1A 4G3IA 4J2EA 8ICFA 3HVTA 3ISDA 5HRRA 4N56A 3KK2A 1REVA 3V7LA 5KFRA 4BACA 4O44A 5KRSA 3AVJA 1ZQFA 7ICMA 3GIIA 4O5BA 7ICGA 2X6SA 5KFQA 4KHSA 3AVAA 2YKMA 4JV2A 4YFUA 4KTQA 2OWOA 4NXZA 5DDYA 1IG9A 4MEXA 3I8DA 3HT3A 2XGPA 5KG1A 4KV8A 1ZQQA 3PUFA 5L1KA 5KTQA 4FK2A 2VG7A 5C42A 3GDXA 1SV5A 3NGDA 4DTRA 2DPIA 4KPYA 4CGDA 4I27A 5KT4A 4J9MA 1XS9D 4I2PA 4O5EA 1EETA 5DB6A 3JPPA 3Q8SB 3ISCA 9ICSA 4FM2A 2C28A 4IR1A 3V9ZA 3G6YA 1RT7A 3VQPA 4JRPA 3VN5A 4DOBA 1RZTA 3H8WA 1B43A 5J2NA 4M47A 1ZQOA 4CJWA 3SQ0A 3OYNA 3C1ZA 3MGHA 3K5MA 2WTFA 2KN7A 1NK7A 4DF8A 3ZSRA 2QK9A 4QOZB 3WNEA 1RBTA 3I0RA 2VG5A 4FJIA 8ICBA 3EY1A 3FFIA 3OVNA 4MFCA 4DL2A 4CF0A 3B0YA 3HPOA 4ECRA 2W9BB 1JLGA 1S0NA 2B5JA 3WNGA 5D46A 4FW2A 3HPHA 4JLHA 3ZSYA 4O3SA 1QLNA 3U3GA 1JMSA 1NJZA 1HQEA 2IMWP 1X1PA 3F9KA 1C0TA 2G8HA 4F92B 1S6QA 4F91B 9ICPA 2VA2A 1KFDA 3GV5B 2YNHA 7ICVA 1HJRA 4EYHB 3M8PA 3KHRA 4IQVA 1YT3A 5KG4A 1YVUA 3ASMA 4E0DA 4FLTA 1ZETA 3M8QA 5HHIA 4Z4IA 4F3OA 2E6MA 1ZQYA 3RB3A 4KITB 4BXOB 5J2DA 2KFZA 4OGCA 2DFFA 3JPSA 4CEEA 3MXJA 1GOCA 4E7IA 5J29A 3E2EA 4MEYA 2JEGA 2RPIA 1L3VA 1RYSA 1ZQKA 3AA4A 4XA5A 3VQ4A 4O0IA 4DTJA 4F4YA 3PR4A 4CJVA 3OYDA 3TAGA 3M8RA 5EWGA 5KGXA 1SKWA 4F93B 1D9FA 3QETA 2AGQA 4FZZA 4FM0A 3AVIA 5KFNA 4EBCA 4RQ2A 3G10A 5DB9A 5J2JA 3KLGA 4CECA 3AO2A 4DOCA 1S76D 3OS0A 4B3OA 5DDMA 5HRSA 7ICQA 3PO4A 5KFTA 4ZHRA 3LK9A 1NK8A 4WE1A 4F4XA 4E19A 3ZSWA 3CYMA 4P4PA 2RF2A 3VA0A 2VWKA 3ZT2A 4ECQA 3HM9A 4UB5A 4CK3A 4J2BA 1RT2A 4FJJA 4DU3A 4IQTA 4RT2A 8ICMA 3NE6A 1YTUA 4Q5VA 2G8UA 1WSFA 3MGIA 5DG8A 1S9FA 4NCGA 1C1CA 2HNYA 1NK4A 3TI0A 3KLHA 3MAQA 5J0RA 5IIKA 3MR5A 2ZTCA 2HW3A 4IQUA 1EXQA 1J54A 5SWMA 5HBMA 5KT6A 4CGJA 4LH5A 3G6XA 3QZ8A 4IFYA 1ZQMA 4HTUA 3PW2A 3CM6A 4NY8A 1B22A 3T5HA 3PR5B 3OYHA 5KFFA 4I7FA 1UOCA 8ICYA 2KFNA 5KG3A 1RT5A 3BGRA 8ICHA 4DTNA 4R63A 2NRZA 1NJYA 1I39A 3K5OA 1G15A 3MDAA 5KGWA 1Z3EB 2KW4A 4O3OA 3V6HA 1W0HA 4MFBA 2XO7A 4RQ5A 4DFJA 4YNQA 5EOZA 4CJUA 4F5OA 4ICLA 3PVXA 4YG2A 3ITHA 2J6UA 1HUZA 4HUGA 3MDCA 1WSEA 4BWMA 2W8KA 4YCXA 4J9QA 3OYFA 4UB3A 4CHYA 3RBEA 3ULDA 2W9BA 3AVNA 3NFAA 4I2QA 3V4IA 3KD5E 4DO9A 4FCYA 3ZT4A 4RW7A 3ZSOA 8ICGA 3VA3A 3H4DA 2H5XA 3OSPA 4KRFA 1HRHA 3UPQA 4DS5A 2HNZA 7ICNA 4UAYA 3LP0A 4QZ9A 3VQ6A 3QESA 4B9NA 1RDCA 4XQ8A 1IKYA 2PZSA 3OYMA 1DOQA 3MABA 4FJXA 2C22A 1VSEA 4HYKA 4DFKA 2YNFA 2IGIA 4K4GA 4BGDA 3KLIA 8ICQA 1Y97A 2GV9A 1RTIA 4DF4A 1CZBA 2ISPA 1HYZA 3VQEA 2BANA 1LAWA 3B0XA 4JWMA 3S3OA 2I9GA 2P6RA 3C23A 2LYHA 1O1WA 4JWNA 2V9WA 4FK0A 1I3AA 3DRRA 4ZH4A 5CR0A 2BCUA 3HWTA 1ZQJA 5IIOA 4KN7A 4DLEA 4CHPA 1JX4A 2BGWA 2Q0ZX 8ICJA 1BIUA 4KN4A 4I2JA 9ICGA 5CP2A 4DL4A 4JV1A 3H8SA 3THVA 3QNNA 2AGPA 5EU7A 1N56A 2PFOA 2ASDA 2QKKA 3JPRA 4O5KA 1XHZA 2ZQBA 4KLIA 3SYZA 4FYDA 4DSIA 3DOLA 9ICCA 4GW6A 5BPCA 1NK5A 2W9CB 3V1OA 9ICXA 3AV9A 3AA3A 4ED8A 1ASVA 5CZ2A 4E7LA 2XY7A 4OLAA 4I2HA 3VQ7A 4ECZA 4FLUA 4PGQA 3UXOA 4KFBA 2F1HA 3C94A 1CUKA 1BPEA 3LWMA 2NRXA 4RQ1A 1PZNA 4C8MA 4TURA 2Z1GA 4BXOA 1QSSA 8ICXA 1RDDA 2JZBA 2UVUA 4NM1A 5J0XA 3OSNA 3O3HA 5K14A 3T5JA 3SV3A 2VG6A 5J2EA 4KLDA 5HNKA 8ICOA 3G0ZA 4FLZA 1U49A 3BQ1A 1BQMA 4ECVA 3RRGA 4EZ6A 1MU2A 2OPRA 8ICVA 5HMMA 2XY8A 4M41A 4FLVA 4B8AB 4QZEA 5HP4A 2B21A 4ED2A 4DEZA 4BDYA 1C0MA 1ZQTA 1NK6A 4M3XA 3C95A 3GILA 4KI6A 4CESA 2ZD1A 3JPTA 3QEBZ 4CERA 3EPGA 3NGYA 4M3YA 3MR2A 4Q8FA 1VRTA 1ASWA 4F5RA 3HVRA 2IAJA 4QZ8A 5KT5A 4CIGA 5KFUA 3SPZA 2MUTB 4RG8A 1UWBA 1ZBUA 5KFZA 7ICPA 2KZMA 4KLSA 3SUPA 2HHXA 4QWEA 4MQ3A 5HRNA 4O4GA 4DSJA 1XO1A 1RBSA 2ALZA 4AHUA 4F2RA 1WCLA 4LSLA 4BDZA 3V6DA 3LALA 4FJKA 4FLXA 1NKCA 3PNCA 1J5OA 1KVAA 2FMPA 5L1JA 5F9NA 9ICEA 5J2HA 2F1IA 4DL5A 4I9LA 3EYZA 3IM1A 1RXWA 4AH9A 1X2IA 3T19A 1ASUA 9ICUA 4CGFA 1ZBLA 3RJHA 3HSTB 2HHUA 1QE1A 3AVMA 3M8SA 5CJ7A 3NF6A 5HLFA 1D8LA 1XSPA 2YKNA 4TUSA 9ICKA 3QNOA 1VSDA 3EZ5A 2D0AA 4HHTA 1KTQA 3RB0A 2M9NA 5J1EA 3RJEA 1S1TA 3OYJA 5J2KA 1TFRA 3V7JA 7ICSA 4EP4A 2OA8A 2DFLA 4J9OA 4M9GA 7ICLA 4YXMA 3K2PA 4ED1A 4BWJA 1XSLA 3A2FA 1L3SA 2GWSA 5CZ1A 3DLRA 3LP2A 7ICRA 1U04A 3VQ8A 4CEBA 4RQ8A 3IRXA 4IQWA 4KLQA 1S1UA 4F5NA 2X78A 5FROA 2DTUA 5J2AA 9ICTA 3QEXA 3LP3A 4O3NA 1N5YA 3L2QA 5JS2A 2UVWA 4PQUA 2O4IA 1HMVA 4HCCA 2ZJ8A 1ZQPA 4XRHA 3PX4A 4KLUA 4QWCA 5DKWA 1TVRA 2FMQA 4CGHA 1MC8A 2ATLA 2AGOA 4KMUA 3SI8A 1S1VA 1Z00B 5KFJA 4RPYA 2HHQA 1QSLA 3VQBA 2ZUCA 2NUBA 3GIMA 4QW9A 1BI4A 2YNGA 4ECWA 1U9LA 3U6FA 5JUMA 5KFKA 1S1WA 3MXMA 4PHPA 3NCIA 4PGXA 3FDSA 4P4MA 3NH0A 1KFSA 5SZTA 2F8SA 1U45A 1CZ9A 3C6TA 4E3SA 4F5PA 2BR0A 4RPZA 9ICOA 3RWUA 4YR2A 2IOCA 2BCRA 4Z6FA 1WAJA 4DG1A 3NBPA 4E89A 2VA8A 4IBNA 4KLGA 1SKRA 4HVJA 4FBUA 3ZT1A 4B9UA 2DFEA 3QLHA 2F8TA 5CYQA 3QEAZ 5KFEA 5KG0A 4RUCA 4JV0A 1VSLA 5CY4A 3V6JA 1NJXA 3Q8QB 1S77D 4OLBA 4QZFA 4TQSA 9ICIA 4H8KA 1B9DA 9ICAA 4CFBA 4GC6A 4M0AA 4YN4A 5KFSA 3RR7A 4CE9A 4IR9A 4PHEA 1C6VA 4B9LA 4CF9A 1IO2A 4GMJB 3AVLA 4W5RA 4DTSA 3RMAA 1RNHA 5C5JA 3JPNA 2Z1IA 3RJGA 1XSNA 4R8UB 4F4WA 1ITGA 3RMCA 3VQDA 4ED0A 2E6LA 2D0BA 3ZSQA 4PWDA 4GC7A 1RYRA 2P66A 7ICFA 2OPPA 4PHDA 4IG0A 4FS1A 2UVRA 2R8JA 4K4HA 3UIQA 4DU4A 3CG7A 1J9AA 2RN2A 4YVZA 1MQ3A 4FJ7A 5IIJA 3DLKA 1NKBA 2HB5A 8ICCA 1NK9A 5J0OA 1VSFA 3UQ2A 3N97B 4DQRA 1ZBIA 2YV0X 1S9GA 4AHRA 4AHSA 2GBZA 2BHNA 4DL7A 1TKDA 1LAVA 5EWEA 4KHQA 4W5TA 5DB7A 3KKRA 2G8WA 1A5WA 3QEPA
chains in the Genus database with same CATH superfamily
4IC9A 1P6TA 2EAMA 2ROPA 1JLFA 2BCSA 2W3SA 2QGFB 2FLOA 4NLCA 1HBUB 4Q0BA 2FPKA 2V94A 3G87A 4RQ3A 1VHXA 4G9ZA 1MW7A 4IH7A 3GSDA 3MOZA 2DO0A 2LXFA 3ET6B 1LW2A 3JAMU 5M1FA 4BX9C 5IV3A 5D0EA 5KOWA 1XQIA 3TJ8A 2FJAB 1E4FT 3NUQA 2B51A 3CCRS 1EWRA 5U47A 1R0AB 4EWTA 3MF5A 3QYPA 1KW4A 3EE9A 4GFJA 2DT9A 2GX9A 2IRYA 4DV0F 1RAAB 4YY3K 3CT9A 5KL1B 4FJHA 3NF9A 3BEGB 2Z2LA 4C11B 4DR4J 1ZQLA 4OYAA 2ZJRQ 3CEDA 4C0BA 3IGVA 3F53A 1TMJA 4ENOA 1FE4A 4DR4F 2KIWA 1T4GA 3PDNA 5JJBA 2NQPA 3M6WA 2XULA 4JEPA 5DG7A 1SV4A 5D4BA 4LSNA 5HANA 3AQEA 5KFXA 1NKEA 2BJEA 1K9MO 2YWGA 1T03B 2YX7A 3NGTA 5DDQC 1K8KB 1Z2ZA 4B3SF 3THWA 3SBGA 2GAHC 1I94F 3ZTOA 3QIPB 3T1AA 9ICMA 2W9AA 1N5YB 3QSYB 1U2FA 2M7SA 3CJ9A 3AVHA 3J7YU 5ALOA 3S1TA 3GR0A 4NPOA 2Q3PA 3RAQA 4Y2PA 2ADCA 3JTPA 3T1YF 5K8MA 4EBDA 3DFEA 4B3OB 3NF7A 4I28A 4O4RA 5J2FA 4DBQA 2ASLA 4EX7A 2F5GA 2MJNA 2KVSA 2G0CA 1FI4A 2WFAA 3R6LB 1OH8A 1Z19A 3DDKA 1CXQA 4HUFA 4QYZJ 1I94J 3DRSA 4PA1A 4UAWA 4B02A 5F0WA 5FRNA 1V9PA 2ZWOA 3ETLA 1JNRB 2WSCC 1Z25A 3N7SC 1UVNA 5GTHU 5DM6L 3MX2A 4LSZB 1WC3A 5ALWA 4M9LA 4KLTA 2R7TA 1LKYA 1XR7A 3CUNA 1T7PA 3VZHA 3EZOA 1UAWA 3TZXA 1A77A 1MDUB 2IA6A 4O9MA 2F40A 1R7IA 1K0TA 5ETQA 3CMES 2W2QP 2H3VA 1RHJB 3L0QA 2P1JA 5K9FA 5C25A 4KJIA 3ILJA 3TQ1A 3CJAA 4CK1A 5JU5A 1IBMF 1S1XB 2C2MB 4GO5X 4CLLA 3OUYB 3ORYA 1N0VC 2Y8YA 5AFUA 3Q8LA 2HCFA 2VONA 1RT5B 4YHHF 2JX2A 3FC9A 3L8BA 2MQNA 4I2EA 3VEOA 1HL6A 3LANA 4QIVA 1XC9A 2OPSA 1Q86O 3TSQA 3NAIA 2JXJA 4YDUA 2HMXA 3LGHA 1N33K 3C8YA 5GTIU 1HQUA 2XNRA 3VAHA 2BCVA 4ZCIA 1RBVA 5EN1A 4Y2AA 3EUNA 1BISA 5HP1B 5CR4A 4A4JA 2WVEA 3PTWA 4AE5A 3MN9A 4LFBK 4CFCA 2R2UA 3PV8A 4M6WB 1SJQA 3THWB 3R27A 1PO6A 3NDKA 1XR6A 5AQWA 1EETB 2LBOA 2BACA 3I6PA 4DQQA 1NDLA 4DR7F 4ILHA 2ZKUA 3D4JA 1ZM2A 3UO0A 5AKKA 2FZGB 3DMJA 1KS2A 5AXMA 3Q89A 4LSNB 4JUZA 1OH7A 1ZJNA 1R31A 5IOLA 3L4QA 4Y0WA 3G2XA 3PJWA 4JI4K 2DNYA 2K89A 2K4EA 4C0HA 3CCVS 1ATNA 3CO9A 4JHDA 1XNQK 4JKHA 2M88A 4CEQA 2E1EA 2KZZA 4JRQA 2FHJD 4M3UA 2H5IB 3GR1A 1EX4A 1IWGA 4O55A 4O3PA 1X9WA 4WFNL 2LMIA 2MKCA 2RS8A 1R0AA 1JKHA 5GADI 4USWA 2DH9A 2JH7A 1F2HA 1F5CA 3GG0A 2M70A 5HRPA 1IJEB 1ZOLA 3BBFA 1XNSA 3D2EB 4ZS6A 5GAGU 2B0CA 1VJWA 1RAHB 1NAQA 3AVKA 5KFGA 1RHUB 1VRUA 2M0NA 1EXNA 3FZHA 2V69A 4DR1F 4CLFA 1KLNA 3AAPA 4GVEA 2YB4A 4UARA 2RB7A 4PQUB 3IMQJ 4RW4A 2CPYA 2B56A 5CZXA 2Y0SF 2ZUAA 1CS4B 9ICRA 4CF5A 3SQ2A 2JH3A 3TZYA 1RBUA 3NGZA 4YUDA 2DHAA 3D68A 5J2QA 2DH7A 3O9RA 3UDVA 3AVGA 2JVRA 3HP9A 1UWAA 2C2KB 5D8HB 8ICRA 2MJUA 2DIUA 1TTHB 4EP5A 3D1QA 4IG0B 5GMDA 4ES3A 1WCNA 4I2BA 2KSOA 3F0NA 4LFAJ 2FLPA 2DR5A 3K58A 1NGAA 4YORA 4ZOHC 2QKBA 1NMEB 4WU2A 3LWLA 3BBBA 3P5JA 4H4KA 3EICA 3SNNA 1XJWB 2FVPA 4WPAA 4FWKA 5A8KB 1QVGM 2BRLA 3CXCR 1N32F 2FVRA 4OZ0A 4LF4F 3M8PB 2GC8A 3C5FA 5CE3A 4FE3A 3MFHA 2H9ZA 3SQ1A 2VWJA 1RXVA 1JNZB 3QO9B 1GLAG 2YCHA 2FDNA 2FPMA 3HZGA 2RQCA 2QLBB 2EC2A 2YY6A 4QU6A 4DMNA 1WACA 4X64J 4I2FA 4I64A 4XH5A 1OS5A 5GIPA 3C19A 1F5AA 3ZDCA 1XMOK 1AT1B 1V38A 3EPIA 2Z2YB 2AP1A 1P7DA 3Q8RB 4LF4J 2DGSA 2Y9UA 1JIHA 5FP0A 3R9KA 4PRFA 3CW2C 4LFAF 4HCBA 1X4GA 2HBMA 4UB6U 3OJSA 4YB7A 5ALEA 4QW8A 2G2YA 4MKBA 3KVGA 1H3DA 1IBLJ 2HBZB 2MUTA 3G6VA 1G3OA 4U7UD 2VFSA 4IG3A 2GWKA 1X3MA 4E7HA 3MR6A 1HBUA 4HLBA 4Q0BB 3E9LA 3GG4A 1KLMA 2YKAA 1VSJA 4XIUA 2HHWA 1UT5A 4Z6DA 4LRBA 1LXJA 1A6LA 1WF1A 3IP0A 5J0UA 1OVYA 1BMQB 3PMNA 3OLAA 4UY8T 2YJFA 4F3TA 3VCDA 3OQ2A 3VCBA 4F3QA 5HO4A 3CM5A 4LD0A 1WWHA 2BKNA 2B4PA 5ADZA 1HI1A 4F26A 2IVYA 3TX8A 1ZJMA 4DTUA 3R5GA 1VQ6S 3VEXA 2HWIA 4CTAA 2D3UA 4ZLLA 4Q45A 4QPTA 2AW0A 2BXJA 2XVTA 4CH1A 4S0MA 1M5PC 4RQ4A 4EEYA 4X4TA 1AUDA 3DI6A 3J7A1 1WC5A 3OFHA 2W4PA 3GJRB 1WSJA 5AQSA 4ZTFA 4HUEA 4IFEA 1OMSA 4RWXA 3DHWC 4NLRA 3TUPA 2YI1A 1FJGF 3HVTB 4F5QA 4OZ3A 2OEHA 3DXMB 3QXGA 1WC6A 3DGPA 4DTPA 2Y1IA 4PH5A 1CJTB 4RW8A 2VKQA 2MSSA 3EW9A 4YMMA 3GLJA 2ITGA 2JNJA 4ZVRB 4LY7A 1S10A 5AHXA 1IR1A 3HFVA 3WC2A 3N0VA 1URRA 1YJ7A 2DHSA 3OTOK 3H7HB 4OVLA 4LQ3A 3ALYA 2ZUDA 2E88A 3MFIA 1DGKN 9ICWA 1BA0A 3U9DA 5ETVA 1A9NB 2XCAA 4C7YA 5ETLA 2FVSA 3FZFA 3PYEA 5KFCA 2XNQA 3GFXA 4LFCJ 1ZQGA 4KHYA 1FXDA 2YMMA 4FJLA 2K2PA 3H5XA 3OFFA 4DV1J 1KN5A 4BS2A 1LB2B 3EGZA 4E1JA 3C14A 2VQFK 2QMXA 2EAPA 5CYJA 1KC8O 1JRPA 2ZIVB 3QAEA 1HKAA 3TJ9A 3H40A 3SSRA 2AIRB 3A8KA 2IDEA 1RDAA 3HOSA 4J9UE 4A8QA 4N47A 3SJJA 3M6KA 1JCGA 2RQ4A 1DXSA 4MTPA 4RBTA 2I5JA 1UL3A 3KHYA 4IOAL 4RNNA 2B0GA 2PFNA 1SZPA 1O51A 4LH4A 1GO3F 4P0PB 5AQPA 3ILLA 2O6KA 2QB0A 2KJ8A 2E9ZA 2O67A 2DHGA 1M5HA 3Q83A 2DNZA 3KNAA 2P9CA 3MZIA 1RWPB 3PRDA 1N5TA 2ISOA 4WQ4A 2D6FC 2K1RB 5L1IA 4K5SA 1C1BA 3SD7A 2YPZA 3NNAA 5ALXA 2WTUA 3PW0A 3LGNA 5D6GA 3MGJA 2WBMA 4NCBA 5JS1A 2JEJA 1KQFB 3TVYA 4OI6A 4UUXA 1SJFA 2Q1LA 1AFJA 2XZDB 2G8FA 1Y3KA 1RT3B 9ICNA 3SCJE 2R7SA 4LVOP 3R7BB 4MFBB 2IC3B 3OLBA 4NYNA 1GX5A 3RB4A 3G71N 4C4RA 2R8GA 1S8OA 2G06A 1D8YA 3CFRA 3KK3A 1YITS 4R65A 1RWUA 4CF4A 4M3ZA 2G08A 4KLJA 3AOBA 1RT4A 6AT1B 2OZSA 2V9KA 4KB0A 2QA2A 2D0OA 2C2EA 4UASA 1M5SA 2CQ1A 3B54A 8ICLA 1YJWS 1QS4A 4W5NA 5DLGA 3SR6A 2BA9A 2B7BB 1OIAA 2XQCA 4CVNE 2ILZA 9RUBA 1YVNA 1GOAA 2KHOA 3QERA 4CK2A 4WXOA 2MGZB 2KXFA 2FIUA 3H45C 1JJCB 4AILC 1EQYA 3M2RB 4ZVPB 1LV5A 3J81U 5CB1A 3TAMA 4WE1B 2EZXA 2KM8B 2J4RA 4KGKA 1EKRA 2F9DA 4QR0A 1HWUA 5KFIA 5AJ3K 5K4LA 1ZZFA 3VGSA 3VAFA 1GMWD 1KSPA 2ZUBA 5H9FJ 2YHAA 4PL2A 3D6RA 3OPXA 2BQRA 1BPBA 3ZD8A 4PEOA 2G8VA 2VH7A 4CLTA 3CFOA 2HS0A 4PYAA 3NWGA 2ZM6J 3VMFB 4Y2JA 2F44A 2EX3A 5ALLA 3KLHB 4DCCA 1N5SA 2GUIA 4H0TB 4CJ7A 5JVGL 4DOAA 4PABA 5IQ6A 3C1YA 3QNMA 1T94A 4K4VA 1SJRA 3UXNA 4LBHA 2C2NA 3I28A 1RM6C 3EGWB 4K8ZA 2H3IA 4DL3A 2HZCA 4F02A 1Z26A 3I1YA 3OXLA 3TABA 2HI0A 1W97L 4OV6A 3PYFA 3DXMA 3MI7X 1QQOA 1ZQZA 3HK2A 2XRIA 1C7YA 3AT1B 4J9VA 4HH1A 3UMBA 1S4EA 4DPYA 4CP5A 4NA3A 3FFKB 3MEEA 1PAEX 4MF8A 4GKKF 5D4NA 1VSKA 4C4TA 3K75D 7ICHA 4AT1B 5FJ4A 2AQ4A 1Y11A 4JKDA 2D1CA 1VQMS 1HD0A 4KO0A 2M5YA 4J2DA 9ICVA 3HHNB 1J2VA 2WVBA 5I42B 4K4XA 5C7PA 1RWNB 5AQZA 5J2QB 4O5FA 4GY2B 4PPXA 4EHUA 1S7IA 4QWDA 7FDRA 1W26A 2RKIB 2YKPA 3I5CA 2DEJA 4RU2A 1Q16B 1HHSA 2HFZA 3RJIA 3I87A 4UBCA 2W2OP 3M9OB 2P5GA 3MUTP 3SV4A 4JI6F 4Q43A 3E01A 4QYZK 3ADAC 1ACMB 2KFYA 2E8NA 3UD5A 3HOTA 1CULA 3BN4A 2VIXA 1RTIB 1A0PA 2R9LA 1TKXA 4FVUA 4DR1J 1EP4A 2LU2A 4YP3A 4H5RA 5BR9A 1GLJO 4C4SA 1KC8T 1X9XA 2DNHA 3M6GA 5LJWA 4CEDA 1UHUA 2O8CB 2KO1A 1WNEA 3KD1E 4B9SA 4OX9J 3NVVA 4M9JA 4N5SA 1XK8A 4URGA 3TR8A 1FRXA 5D77A 1FXLA 2P5OA 1NOZA 2KT3A 1SXLA 4DV7K 2AJFE 5EGYA 3T69A 2VA3A 1YJ9S 2KRBA 2ZVIA 4IRDA 5T41A 5T7LA 2FBVA 4Z4FA 1RT1A 4AQYF 4M42A 5DZ7A 4CBXA 7ICJA 1WOSA 4AL7A 2O4GA 5DO2A 3HW8A 1YRUA 5AQUA 2A19A 1N32J 4MKYA 4WKYA 3HHLD 3H2UB 5E2QA 4ZLNA 4E7JA 2Q3SA 4ZVGA 3A1YG 3A5OC 5E3RA 4DUZJ 2J0XA 4NEYA 5ALIA 3LA0A 5H1SV 2RD5C 5A8RA 1T9YA 1TK8A 3RG6A 2MHNA 3P39A 2XG8A 1ZQBA 1CXUA 3POTA 2JMGA 4GIBA 5C2FA 4JI0F 4NZ6A 4DFDA 4R64A 3IFEA 5BR8F 2FHJA 2YTCA 3BS5B 4B8CA 4DB3A 4PWDB 2BGGA 1HBMA 4KHNA 2LP4A 4CZKA 5B0FA 2Q6BA 1BQNA 2Z0GA 8ICWA 3CDEA 3KG4A 5BPNA 3TNVA 2HBQB 4DTOA 4BRIA 3QWPA 4B1YB 4UB4A 2HQDA 2OTJS 1Q78A 4A59A 5F9LA 3GBTA 4OKEA 3C66A 1AROP 5BREA 1PGZA 2E5HA 2NYVA 4CE6A 1KRPA 4N41A 2D5RA 4U6PA 2VUGA 5IV4A 8ICFA 3M2VA 3M30B 3F5AA 3ISDA 5HRRA 4MYTA 1J5EK 3V7LA 4PJ0U 3K9JA 3WKDA 2UXBK 4DV2J 5B8HA 2XMAA 1KXPA 3ZX2A 3CIZA 2KVIA 3CCES 2K1RA 2Y8WA 3AVAA 2YKMA 3A3NB 3HILA 2OIHA 3I9ZA 2ACMA 3I8DA 1SPBP 2I38A 2QL5B 3PUFA 1ZAWA 4LF4K 3O80A 4OCZA 5EHHA 5G0RB 3P4IA 4KRWA 1DKGD 1SV5A 1FRLA 5T7LB 4KPYA 4LJXA 5AXKA 1XS9D 1SVDA 4O5EA 1L7NA 1IKWB 4HKQA 5DB6A 2BOAA 1JCEA 2BOPA 9ICSA 3JAMY 5F0XA 1QAIA 4X4QA 4IR1A 1Q81T 1K44A 3V9ZA 4FYWB 4LFCF 3NNHA 1RZTA 4PUOB 5B66U 1ZQOA 2MLXA 3K5MA 1NK7A 3E66A 5GAEI 5B0CA 2VG5A 3EY1A 3FFIA 4DDFA 1EQ0A 4DL2A 4CF0A 1HW9A 2W9BB 2B5JA 3HPHA 1OH6A 4CZCA 2IMWP 3MMJA 2B6AB 3F9KA 4C98A 3KWIA 5CEHA 3L9ZA 1S6QA 4F91B 4RL1A 3I31A 3ZX3A 3K1ZA 4URSA 3KUEA 3MUMP 1HNWJ 2V5HG 2YNHA 1HJRA 4EYHB 1GLBG 3M8PA 4J90A 3KHRA 4IQVA 4V1Ak 4R0EA 3THYB 3OD2A 5KG4A 4CNZA 1YVUA 2ZE2B 3HHLC 4FLTA 2OAUA 1ZETA 1U2RA 3C29A 3S7RA 5IQQA 2ZJPL 4KITB 3WK4A 5CHCB 4BC2A 2XTJP 4Y65A 4BRKA 4LF9J 2LYAA 3K1RB 4PG6A 2H54B 2LM1A 3QT8A 1VQ6N 2X3GA 4FPBA 2CPIA 2HMIB 4F4YA 1CRXA 3QGPA 2V2QA 3OYDA 3KLIB 1S3XA 1KHVA 1D9FA 2OHDA 3LM2A 2MQLA 1I3OB 2HNDB 4RQ2A 2CFXA 1TL4A 3HULA 5J2JA 2HFUA 3KLGA 1TQLA 1S76D 1ATRA 4KX3A 2DY9A 2Q79A 3NMRA 4DR6J 5KFTA 3OA9A 5ELZA 3NAHA 3LK9A 1HNXK 2RUGA 4WE1A 4A2AA 2GHWA 3BR8A 2JRSA 4C80A 2WBRA 2MGZA 5DJBA 2VWKA 4NLXA 3ZT2A 1VOMA 3HM9A 3SMZA 4B3MK 4YOVA 1RZMA 2VGNA 1UEUA 1RWWB 3GE1A 2CH6A 1WD6A 5AE3A 2CJQA 4DU3A 4Q5VA 2W4CA 3Q7CA 5HR6A 4JYAF 3QJLA 1NK4A 4BR9A 3MAQA 3MHYA 2OFHX 1IQTA 4BC5A 3MR5A 3V4IB 1GAOA 5HVGA 1JXVA 2UUWA 5SWMA 5EX0A 2VJUA 1E6VA 3MDFA 3G6XA 2DNKA 2E1FA 1ZQMA 2G0AA 5E79U 4BRAA 1F5BA 3AN1A 4BG9A 5LMUF 2DR7A 5KFFA 2HHHF 4WQ5A 2P8IA 3CQXA 8ICYA 3DLJA 4F71A 4JB8B 1RT5A 2BUNA 3PRVA 3R5DA 2ZWHA 2BX6A 2BANB 3MN5A 2KW4A 4DCJB 4PKHA 4CJUA 4F5OA 4K0KF 2J9EA 5J2NB 3PVXA 2W7AA 1HUZA 3MDCA 1WSEA 3JQMA 4BWMA 2W8KA 4YCXA 4WYBA 4UB3A 3GL1A 1SXEA 3AJ2A 1BO5O 1NLVA 4FCYA 2MRLA 3UE2A 2CNOB 1MA7A 2NSCA 4DJBA 3BO3A 3MMCB 2LMRA 3UPQA 4ZOSA 2HNZA 3EDQB 2X51A 1B7YB 4UAYA 1EB0A 2ZHAA 1CQMA 4Y2XA 1FDAA 2IYIA 3QESA 3J7Z5 1RHQB 2HOEA 4XQ8A 2HF4A 1P27B 2IM2A 2BJDA 2D7SA 3CCJS 3JTOA 3MPDA 2C22A 2NXJA 3MMAA 4H5VA 3HHLB 2RRBA 2E2NA 2WK4A 1CZBA 3HD2A 1GLLO 1TELA 4QS8A 1LAWA 1OY9A 5E84A 3MM7B 1FD8A 3N6MA 2P6RA 2LYHA 5TKYA 2OI2A 3DRRA 5EDWA 2VJ4A 1AUSL 2RP5A 2FHMA 1K5OA 2CQIA 3QFPA 3CDWA 2I6XA 5FLXO 3GTYX 5IIOA 4KN7A 4DLEA 5HJXA 2CRXA 1JX4A 3ZO7A 3AHPA 1BIUA 3QAUA 3G82B 5CP2A 5HL7L 4DL4A 3H8SA 2AGPA 2K3KA 3CGIA 1NLKL 1UVMA 4IH5A 3ZZYA 4NLVA 1FF2A 3G8TA 1XHZA 5LL6d 5AQRA 2ZQBA 4JAXA 3SYZA 2KVCA 3N6NA 1BQNB 2M52A 1UEVA 1NI3A 4LF7F 3KKAA 4YB6A 2W9CB 1FWPA 2CVIA 9ICXA 3AV9A 5GAGP 3AA3A 5I9EB 3QT5A 4LFBJ 4C6AA 4Q2LA 4DR5F 2WBNA 2YNHB 4LC9B 3CE8A 4WFZA 1XO0A 3D7SB 1BDGA 5AKYA 3O08A 2KICA 4X62K 1D3WA 2FB0A 4P2SA 3VESA 4RQ1A 2R42A 4C8MA 3QICA 1QSSA 5IS2A 4P10A 4Y6IA 1S6PB 4NM1A 2KVQE 3QUTA 1M90O 4LF9K 4MJKA 2GMJA 1PVQA 4FLZA 4AFFA 3U26A 4ECVA 5IWAF 1VQPS 2OTLS 4H0OA 3SFUA 1MROB 1WHVA 2SXLA 1DGJA 8ICVA 4M41A 3CCQS 1V3RA 3WKAA 4FLVA 3UVJA 2G13A 2B21A 3MMBB 4DR3J 1NNEA 1RWVB 4BDYA 3DOLB 1ZQTA 1ZM4A 3W9HA 1HHQA 2YX4A 2WHEA 4Z94A 1CJUA 4QIWD 1TL7B 3QEBZ 1VQLN 4IO9Q 4CERA 3D3BJ 1OYDA 3NGYA 4M3YA 1RAFB 3NGKA 4MT1A 2Q0RA 1HPMA 3MR2A 3UD4P 1ZD2P 1S1VB 1TKTB 2CZ4A 2IAJA 3GYNA 4QU7A 2QYGA 5KT5A 4CIGA 1UWBA 1KVKA 1ZBUA 2KZMA 2YKNB 4JI0J 2QWMA 1VDHA 2QA4S 2L08A 4WK1A 1BD6A 1KKHA 4FF3A 4DSJA 4DR6K 3WUHA 3HKZF 1EP4B 3TEHB 3TTDA 5G5HA 5JLHA 5C10A 2XBPA 2GQQA 4EENA 2QV6A 3E9PA 3V6DA 3LALA 2HOIA 1X4EA 1LKYB 1QVGR 1F44A 3PNCA 1MN8A 1X4FA 3G86A 1J5OA 1KVAA 2FMPA 3CMQA 3F5EA 1O5JA 2UZAA 1OO0B 1R3NA 3ZZPA 2X1GA 3PXGa 1WHXA 3QQCD 4QBUA 4JKAA 1YJWN 4CGFA 1ZBLA 3RJHA 2HBRB 3M8SA 1RQ0A 3CIPA 1X9JA 3UFCX 5L9NA 2ZH1A 1R6VA 4TUSA 9ICKA 3P31A 2APOA 3OTCA 3GFHA 1KTQA 2HFSA 2P35A 4C0OC 3RJEA 3AFGA 2QWOA 2BBEA 3N5FA 1Z4OA 7ICSA 2OA8A 2D1KA 2XEXA 4NXMJ 2DFLA 3IAM9 4YMEA 2AD9A 1P90A 2LEAA 3K2PA 4YXMA 3ZX0A 4ED1A 5LM7E 3A2FA 3A3PB 2GWSA 1FX2A 4NXMF 5CZ1A 3LP2A 3MMCA 2G0JA 1U04A 1RTHB 3VQ8A 3ISZA 3H3OB 2DXFA 3D9BA 3WHIA 4IQWA 1QE1B 1VQOS 2ROEA 4JMUA 2DTUA 1C20A 1DTTB 2C42A 2ZIVA 1DURA 1X6JA 4FF2A 1TZ0A 2O4IA 2XYHB 1LW0B 4X66J 1ZQPA 3FQKA 2O66A 4H03B 4KMUA 1Z00B 3OBIA 3MCOA 4RPYA 3OT9A 4YOWA 1IV0A 5DS7A 3VQBA 4Y2YA 1LWEB 2DPNA 3TZZA 5LMNF 1KDNA 4QW9A 4QYRA 1U9LA 1SBRA 4K41A 2V8GA 1B7FA 2E1MC 1S1WA 3QMQA 3MM8B 3O2IA 1T05B 4ZVOB 5AKLA 1RHRB 3FDSA 5ALPA 3F2BA 2HOQA 2CJAA 5SUHA 2A2CA 2K06A 1PJ6A 1CZ9A 3C6TA 4F5PA 3K0JA 3BV8A 2WVFA 4PL8A 4RPZA 1SAZA 4YR2A 5B09A 2FC8A 2BCRA 3ALRA 4Z6FA 1WAJA 4DG1A 1H2TZ 4E89A 4C9DA 3CTRA 1SKRA 2JFKA 4JHDB 4FBUA 2OD6A 2J5AA 2ZD1B 2O8BB 3MCMA 3EVWA 1KP6A 2VG7B 3TP2A 3QEAZ 1KAZA 4WKRA 5KG0A 5AQQA 1VQ5S 5CY4A 4IFYB 1XMOJ 4N8NA 2JGAA 1NJXA 5C2DA 1VQSA 4OLBA 3TAMB 2VC1A 4TQSA 3J7ZT 2JFDA 5B0GA 2QRRA 4YN4A 4A8KA 2D0PA 5KFSA 3RR7A 3THXA 4IR9A 1NO8A 4B9LA 3IS9B 1IO2A 4KHRA 3AVLA 2BZFA 2YX6A 2KN4A 3W8GA 2VF3A 1LWXA 1JWWA 3TX0A 4B1UB 1PCAA 1A0OB 2C3UA 5AZIA 1ITGA 1F9HA 4WWSA 4PWDA 1RYRA 7ICFA 2OPPA 2OANA 2H3ZA 4FS1A 2UVRA 2QC3A 1RKJA 1UZHA 4DU4A 5KPRA 1J9AA 1MQ3A 3P5BP 4FJ7A 2ZOMA 3UW1A 4ZN1A 2HB5A 4M5JA 3CPWR 2CG8A 4M5GA 8ICCA 3B82A 4CLUA 3N97B 1VSFA 3VEVA 3DLEB 4BRLA 1RFQA 1H73A 1S9GA 4UAVA 1H7WA 1MWZA 4HDGA 2GBZA 1D8BA 3CJKA 1D8ZA 4KHQA 3F5TA 4WJBA 3EL2A 3CJBA 2P9UA 2WVDA 4KV8B 1EX8A 4JV5J 1A5WA 3BGOP 2FTRA 4X4OA 4H4OB 4BQLA 2XCPA 2MB0B 3NGUA 1D5AA 3RR8A 4DQPA 2UXBJ 1YWXA 3AVCA 4DU7A 2DBBA 1G4CA 3M1FA 1YIJN 3HKZD 1IR0A 1KL9A 2NCKL 2ZC4A 3QU7A 5AZJB 2YNIA 3IKMA 4TSXA 3O1WA 3PFEA 1QM9A 1SJ1A 2O1PA 5EOYA 1SV5B 4RR5A 5CQGA 5JRTA 4JI5K 2Y0SC 5DQHA 2W1BA 3PIOQ 2GTDA 2IIHA 1U2CA 3KBBA 1TL3A 2B7CB 3I4HX 1K73T 5DG9A 2PMWA 3LZIA 1IJFB 2HPUA 3MURP 2BKEA 1JLCA 1LWEA 3FRZA 3A0IX 3E3XA 3KHHA 4OJOA 3FVYA 3TA0A 3FAHA 4DTMA 2DKZA 1HYSB 4B3TK 4DUYF 3L2UA 3PYGA 3IMXA 5KQDA 4IG3B 1Q86T 4C7ZA 3F73A 4YDDB 4ECTA 4ZJLA 3TYTA 3AD9C 4M5KA 2HHPA 1DZ5A 5J0QA 4OO1J 1J97A 3ZFVA 4FM1A 4K4WA 4ZPAA 3L2VA 2DD8S 1QUPA 5FPMA 5DGBA 2E1PA 4R66A 2PIIA 2BPGA 2WCXA 3RBXA 4JI4J 3GJSB 2BKPA 2E4LA 2F8HA 4O44B 7ICUA 4OX7A 2EAOA 4YEAA 3OS2A 3RMBA 5CH7B 1TK0A 4E7KA 1GT8A 1EAYC 5JMVA 3KG0A 2W9CA 4M45A 4QZBA 2G2ZA 3IM8A 4PZVA 5G5GA 4EGLA 3RH4A 1KFTA 1TKTA 3IP4B 5AICA 3QO9A 4BRFA 3NWRA 3TAEA 3CCLS 3QDKA 5F8LA 4H54A 1GOBA 1N5WA 3KNGA 3PNIA 4ER8A 2XYGB 1TYQB 5EX3A 4ED7A 1UMJA 4IDKA 2ZBRA 4FOIA 3NMUA 1TGOA 4B3RJ 1COKA 1MLAA 1SCJB 4P52A 2DNQA 4ZKAA 3IBFB 2KJWA 1FNXH 1WUAA 3L7UA 1NWKA 1DEJA 3ATUA 4AHTA 3CNHA 2YKQA 1IUJA 1X8DA 3UCGA 1KCFA 5A76A 2D3DA 3NS6A 3B6PA 1C0UB 3P49B 4USIA 1HBMB 2RE1A 1Q8KA 1NSPA 5J0YA 4UUWA 1HYVA 2IM0A 3SEIA 3EKSA 2BRKA 4XH4A 1J53A 3LDAA 3OHBA 2YQ3A 1BHNA 1QZ6A 4DV5F 3U9ZA 1NMNA 2VHGA 1SUQA 4HT7A 3W2WB 4F9OA 1MWKA 2LXIA 4K4ZA 5KFVA 4FYXB 2ZIXB 1T3QA 4I2DA 2A3JA 1TL7A 5J2IA 3TFSA 3BGLA 4RBUA 3OYCA 5CAAA 3MPUB 1WJ9A 1W2BM 3AO4A 1ZQCA 1HHTP 1JL2A 2VODA 5E3PA 3M9MB 3HSDA 4DL0C 2KJ9A 3Q8VA 2Z4PA 3EXYA 2WRMA 2OD4A 1ZBSA 1Q46A 3MN6A 4EELA 2QIFA 3K5NA 5HROB 3HSJA 2WAQD 3CJQA 1SQGA 5DB8A 3ZZZA 1K8AT 1IKXB 2Z2MA 4W5OA 1Y5IB 3VGLA 3QRRA 4OGEA 4KB1A 3ICXA 4P2MA 7FD1A 2QWNA 4CT8A 1NGBA 3H6EA 1V3ZA 2E7XA 3K2YA 3KJFB 1TV6A 5J0TA 1CULB 3RZAA 3UKUB 1EKEA 1SI9A 2XYPB 2IHR1 4AYBD 5B08A 4RWWA 5EE0A 4IUFA 4CM0A 1DTQB 3S9HA 4LZGA 3WKBA 2AYEA 1ZPVA 2Y9TA 4JV5K 5K14B 4FLYA 4QZVB 3PFOA 4ITSA 1XI1A 1R0CB 1SIJA 4RW4B 1WOOA 4CO2A 3Q23A 2HKEA 4U96A 1U1PA 1Q82T 4GV6A 3DLGA 4F8RA 1WC4A 4DG1B 1X60A 2CNKB 2GCFA 2PFQA 4O5CA 1Q53A 3MMAB 3NH2A 3VOVA 4KT0C 1NHVA 4RNHA 2Y1LB 2Z57B 1S0VA 2XY5A 2DPJA 4IO9L 1S7HA 1X5TA 3DOKA 4Z6CA 1TV9A 2UU9J 2ABYA 3IAYA 5J0PA 3BDPA 3DGVA 1KQSM 4DV2K 3BBCA 1C0FA 3MDQA 2VWBA 1FJGJ 4DX6A 4J5OA 2GGPA 4OZNA 4N8OA 2Q36A 2E5LK 2X7IA 2KZ3A 4I6MB 3LQVA 3PACA 4Y2MA 1LWCA 2KKVA 2IBKA 5M1KA 1KBUA 1H2VZ 5IM0B 3QJJA 1L5UA 3CDAA 4OPJA 3T9NA 3ZTQA 1T9TA 1K1QA 3NLCA 3A0HU 3R6MA 1DK2A 2VBYA 1RLDA 4DPWA 3MUVP 3QT7A 1VCTA 3KWMA 5DQGA 2RHKA 1FFVA 2LA4A 4IZ9A 3CF5L 5ALSA 4FLWA 2QTDA 1HKGA 2CWXA 1U6BA 4IYQA 2I0XA 2GFFA 1KQKA 1N88A 1QY7A 2R7WA 4KHPK 2BQUA 2FHOB 3S6JA 3TWZA 4OJ1A 1NHKL 2FMSA 4HH0A 2Z58B 4Z0UA 3VVUA 2CKWA 2RUSA 1O13A 4DV3K 1TL5A 1VYAA 2DGOA 4I56A 3JS6A 4P0QA 8ICZA 4K4IA 3JPOA 3AJ1A 4CIFA 3KLFA 1HQ2A 4OJGA 2KB2A 5DM6Q 1U0HB 3H3NO 3GIJA 3OHAA 2IJFA 2JC0A 3OY9A 4UZBA 2E1RA 3PM9A 5AZIB 2ZGYA 2ZTDA 5DM7L 4B1VA 1JXLA 3D45A 3OYIA 2IMOA 4LIRA 4YXJA 1WKLA 4NLYA 4R5PA 4EAHD 2GH1A 5F1XA 4R8UA 3KD3A 5AR0A 3MM9A 3RBDA 3MMBA 3MPYA 3GFKB 1HKCA 4BQZA 5B0EA 5AQMA 4ECSA 1XU4A 1VQ5N 4FDFA 4CF2A 3ISNC 3CPWM 1X5SA 1HNWF 1Q95G 2ZJPQ 2XI3A 3SIPB 2GO9A 5BJRA 3FCVA 1ZQUA 4ED5A 1Y3JA 4TY8B 4FJ5A 2FBXA 3FMWA 2FLNA 5DBCA 5KPZA 1XN9A 2FPLA 3ID6A 4KLFA 1COOA 1QTNB 3QT6A 2QWLA 2ZFHA 4NLPA 5J2MB 4M8LA 4WK3A 4NLGA 1KHWA 3V9XA 2KMDA 3D2FA 1VQLS 2FBYA 5J0WA 3CCJN 3NOGA 3CJ1A 4LF8K 3R3TA 4PCQA 2ASJA 1N5XA 5TZVA 4KTWA 4BR5A 2WW8A 2DHHA 4OYOA 3M7DA 4QZDA 3I0RB 2OYQA 1YLXA 1Z4NA 4PG7A 4JN4A 1CLQA 4KH4A 1G7CB 1SH0A 1MWMA 1X66A 4ZVTB 1ITPA 2V63A 4JK8A 4M7XA 2V4QA 2UXDF 4M5LA 1WTBA 4PZOA 2JOQA 4FXDA 1YSJA 1U0SA 3OFGA 2E5JA 3CWJA 3H8YA 2E8PA 3WK6A 3CNQP 3UDLA 2LA6A 3U8XA 4CD3A 3T6BA 1UPMB 1UWBB 3J7AN 4ILGB 4GMKA 1FHTA 4IKFA 4M5NA 1UA0A 1L3UA 4M9HA 4WP3A 1MMDA 5K20B 2CXEA 1VQ4N 1IM4A 3PKYA 5J2BA 4HHUA 4Y2IA 4RNMA 4IRCA 5HVHA 4UQGA 1REGX 1LWFA 5KG2A 1HYSA 4JI8F 3GYXB 4DN9A 3VF4A 3VAGA 4GKJF 5AQKA 8ICUA 3DJCA 1U1NA 1SC3B 2AJ2A 4JNEA 1WUDA 3B8HA 3MBYA 3HZEA 3IWLA 3AL0B 2UYTA 3DV9A 3C21A 2W4DA 2ZM6F 3A4TA 2F1JA 4BE2A 3TARA 3HP6A 5L1LA 2UUCF 4JI7J 1Q9XA 4DR7J 1RT7B 3RU0A 3U1MA 3TRGA 1V85A 4Y1DA 4OI2A 2E20A 4NOHA 1Z1VA 3AODA 1WF2A 5CXTA 4RQ0A 3QE9Y 5C25B 4TNOA 3SUQA 1ZQAA 1UCVA 1LXNA 3J7YI 1FJEB 2GOLA 2OPQA 3IBPA 5IT9O 2JZBB 5LJ5Y 4DUYJ 3D0HE 1NZAA 4CYUB 4J9NA 2HK2A 1RDBA 7ICIA 1IKXA 1XHXA 1KLMB 1S0MA 3DOMA 4CJ3A 4GXKA 3FM9A 1K0VA 4CZHA 4HTLA 5KFYA 3PW7A 3S3MA 2YHBA 1U47A 1A6SA 2Q4TA 3E58A 1P1LA 1U2VA 2KP7A 1L8LA 2JRZA 3BQ0A 2XS2A 4OJ5A 4CW7B 2UUCJ 3ISND 3FZ2A 1JJ2R 1DQ8A 2CQ0A 2PI5A 1YBUA 3CD7A 1KQQA 1QQMA 5ALVA 4Y2SA 2E5GA 2ZJAA 1NPRA 4F0KA 3GE9A 4UQTA 2OEJA 4KSEB 1JXBA 2I1RA 4KR0B 3W9JA 1PUZA 1WG8A 3F9MA 2F4VF 4RW9A 2KHQA 4RQ6A 4O4GB 4FK4A 1RHKB 3H7IA 4NXNK 4A48A 2KHCA 3VEWA 3C15A 8ICIA 2CQ4A 5IT4A 1RP5A 1T03A 1SL0A 4CCHA 2F4VJ 2DR9A 4Y00A 4RPXA 2W42A 3MECB 1F9EB 4JKGB 5IILA 3R2DJ 2W7OA 1CPZA 2GO8A 3BF1A 4LF7J 3Q8PB 4NI2B 3QRQA 4FOEA 3ILOA 1Q9YA 4F4KA 3FSXA 1CJKB 4KB7A 3E8OA 1KAYA 1JKHB 1SXDA 3G96A 3BQ2A 4DWIA 5EE3A 3PRBA 4D3GA 1J27A 4RQ7A 5M1QA 2H65B 3Q8UA 4U8YA 1VHIA 2WW4A 1FTRA 1C1CB 4YR0A 5T7BA 4MIWA 3BREA 1JUDA 4CBUA 3HVAA 3O5BA 5C15A 1BPYA 2NXNA 3C6UA 5ETPA 4U67L 5KFDA 4DV6J 2PBDA 4QZHA 1N36K 1TL1A 1Y88A 2PSZA 4YR3A 5E3AA 3SBMA 3N6LA 5ALYA 2VKRA 4K4UA 4FWLA 5F8HA 2N7CA 1OW5A 1WSHA 4ZVSB 2UUBK 4M5MA 3K5LA 3ZTRA 2NUHA 2CIMA 3RSEA 4FF4A 4A5AA 3MCPA 3AA5X 2GIFA 5AK5A 3BS5A 1WF0A 4I29A 1HWKA 3WZ0A 1QHTA 2CXYA 1ILYA 2D3OR 2M8DB 5A0YA 1HPZA 1BG3A 1SKSA 4X64F 5AIBA 4RZRA 4L72B 5L8RC 4DSFA 1HNIA 4DU1A 5HLFB 4WFAQ 3S3NA 4OPHA 5T14A 1R89A 1RB0A 2K4PA 4FPAA 3VZIA 5HHHA 2JL9A 1T9VA 5HN0A 2PFPA 2OPSB 4I2GA 3RMDA 1F2GA 2AZ3A 3QIPA 1N62A 2ASOA 3TAFA 1MROA 2YWKA 1K9MT 4HHJA 4X65K 3AVFA 3KJVB 1UA1A 2WAQC 1IBKF 1KOHA 1IBLF 2YHYA 1X6IA 2QO3A 4QJFB 1FFWB 2CN1A 1RT4B 4FNIA 4U9RA 1O08A 1CBKA 2IFXA 1QVFR 1EIYB 1UVJA 3MWBA 2ITMA 3LPUA 3NNCA 1SQFA 1LEOA 1VQ9S 2R2SA 4PKGA 1JN3A 5AM5A 2HQFA 4KHPJ 2F7TA 4P4OA 2ZE2A 4CFAA 3ZDDA 2XY6A 4BC3A 2HBLA 2NS1B 3QGIA 4DQ8A 3LYSA 4CIEA 3L2WA 2VOPA 4Y28C 4C0ZA 3O9SA 2KXHA 3R7NB 2UXCK 4CHQA 3ZT3A 3ONNA 3EWGA 2X1FA 2WF7A 3O4WA 3P1GA 4JKGA 1C4CA 1VSMA 5HK4A 5LJVA 3CETA 3DOMB 3WK8A 3MEKA 1VC0A 3D6TB 1HLUA 2DY4A 4Y2QA 4DHVA 4FN5A 1RBRA 2HNDA 2F1FA 2RU9A 3ZSVA 4PAAA 2J6TA 5D4PA 5HMLA 2ASYA 4ELVA 3FCWA 5K5MA 5E3QA 3D66A 4ES1A 2MZSA 4BVOA 4CRJA 1UPPA 3EXCX 4RJVA 4R0JA 1TUWA 3NBPB 2R7RA 1NZBA 4Y1CA 1V97A 3GU0A 1BCMA 1TP7A 1QQCA 4CM2A 2P9KA 2YJEA 1AB8A 2GWJA 4CJLA 4DTXA 1KONA 3D2QA 2FF3B 3RW7A 3M8WA 4EK2A 1TFWA 5HQ8A 3MD1A 4H4MA 2UVVA 5D0GA 4DR3K 2LXUA 3CIMA 1TK5A 3ZDEA 2R3VA 3T1YJ 1F60B 3NRBA 3G8QA 1FO1A 5F0UA 1AW0A 3DHXA 2LI6A 5DM7Q 3RJJA 2N4CA 2RMLA 4F04B 3JPQA 2V8PA 5D3GB 2R7YA 3SQ4A 1XWLA 5HP1A 4I2AA 1YZ6A 3DM2A 2BJ7A 4CHOA 4DHYA 4Q7AA 3SXLA 2BE2B 4E1MA 2B6AA 4CEZA 3PX0A 2ZJ5A 2RT3A 4NYOA 2MKSA 3WNFA 2AWZA 4J37A 1IH7A 3PZPA 1NGGA 3MXHP 3G4SS 5K8NA 3TZWA 2BTFA 5HMYA 3FUYA 4Z4CA 4ZPCA 2VQEF 2G09A 4OMFG 2RQMA 2NO5A 4GNIA 2ASPA 3KMSA 3UCUP 4P7TA 3BSAA 3BH7B 5AQYA 1N5VA 3FJ2A 4UZCA 2W54A 1GMWA 4ANDA 1YI2S 1Z00A 1S1XA 1PC5A 2HHTA 4OQJA 3M32A 4DUZK 1B3TA 3SEOA 3RAXA 3F56A 4K2XA 3HVTA 3AY0A 1Q18A 4WF9Q 1FT8A 1B4SA 5E26A 5KFRA 3ZEUA 3GMGA 3FSIA 4IWVA 4OJ3A 2RLTA 4JYAJ 4A61A 4JV2A 2NZ4A 4LRDA 2DB1A 4CO1A 5AKIA 1F1BB 2EFQA 4NXZA 5DDYA 3HT3A 4DV6K 2V34A 4GKJJ 3RSEB 1FKAF 2JWLA 5KTQA 2VG7A 1VLBA 2IIRA 4L3KA 2QSWA 2DEIA 3J81O 4DTRA 4FP9A 5AQNA 3UKUA 4CGDA 5ADXH 1VRTB 2P9IB 3G9CA 2F8KA 2V4JA 3MX5A 3JPPA 3Q8SB 1HPZB 2PN6A 2YNIB 3H2LA 4ZCKA 3LGMA 2XLKA 2M2BA 2UUBF 3G6YA 1RT7A 1VIXA 3L5KA 4JRPA 2AV5A 4DOBA 2CNNB 3NGRA 5J2NA 5HBMB 2MHEA 3M30A 3AQOA 3SQ0A 3C1ZA 3ZSRA 4F36A 4QOZB 3WNEA 4MH8A 1VQMN 2R2TA 3AH6A 5AK4A 2XMJA 3OVNA 4M5DB 4MFCA 1EJ7L 2QG9B 4CZEA 3WXMB 1Y64A 3B0YA 5C42B 3CCVN 2NRRA 2ACYA 2IOFA 4IOXA 3GIRA 3WNGA 5D46A 1QLNA 3U3GA 3QUBA 2X3DA 4BROA 1HQEA 4X64K 1FDDA 4MK9A 1X1PA 2G8HA 3AAQA 9ICPA 3LDNA 3BKTA 3US5A 2NNWA 1DLOB 2W40A 3W2VA 2O8EA 4CLPA 1WI6A 3K7RA 4C1NI 2GJ2A 1IM6A 2KG5A 4E0DA 4O8KA 1FVSA 4TVAB 3WKCA 5THWA 1X4CA 1TUGB 3I0SB 2E6MA 4QIFA 1VLOA 4FWNA 2D4WA 4I6AA 4OGCA 4B1WB 2YMLA 2DFFA 3W65A 4IKAA 4GVBA 2FD2A 4K25A 4CEEA 3MXJA 1GOCA 3T7ZA 2PMZD 4E7IA 3BN7A 3O5TB 4CI0B 3E2EA 5HR7A 1JLGB 1W2IA 4GV9A 1ZQKA 5ALNA 3AA4A 2JZ5A 4M5DA 4HACB 4O0IA 4DTJA 1LK7A 5EWGA 2PMHA 5JVGQ 2P9NB 4FZZA 2DL0A 3AXMA 1VDVA 2OO4A 3AVIA 3AB4B 2EWSA 5AI4A 4A8OA 3C16A 2HSTA 4UY85 4NLSA 5DDMA 2CGLA 5HRSA 1HJOA 7ICQA 2Q0UA 1ZXIA 1U0HA 2V0NA 5HI7A 2YX8A 3KZXA 4E19A 3ZSWA 2X1AA 4P4PA 3VA0A 1I6JA 5L38A 2F9JA 4ECQA 1HKBA 2FVQA 1UEKA 1L6NA 2R4FA 3DRRB 1U8SA 1IBCB 4LRAA 5G4DA 1RABB 3JTNA 1P8GA 8ICMA 3MAAA 4JP8A 3NE6A 4BRHA 2M0GB 1WELA 3D3CJ 2CWKA 1NBWA 1C1CA 4ZN3A 3FEXB 3KLHA 1ROFA 5IIKA 4XEIA 2XI9A 2HW3A 2ZXHA 2N3LA 1J54A 3ET6A 1EXQA 1VGYA 3E01B 4CGJA 1FRHA 4LH5A 3ZI4A 4F0HA 4R25A 3CM6A 1FDBA 1RDRA 4MMOA 1O03A 2QFIA 2LKZA 5B5EU 2AXTU 2YY3A 5KG3A 3BH6B 2F9WA 4I6MA 2LQ9A 4ETZA 8ICHA 3OVAA 4DTNA 4R63A 1NJYA 3DDNA 2OSQA 3I33A 2UUCK 5AK3A 1LCUA 1W0HA 4DFJA 4YNQA 3PIPL 4X84A 4QS9A 2ZM6K 3AQFA 4ICLA 4GKKJ 3ITHA 1GXTA 3M4XA 2W04A 2J6UA 3MEEB 2E8MA 4CO4A 1TYQA 3OYFA 1TKXB 4YDXA 3VGVA 3NMAA 3RBEA 1LFPA 4I2QA 4DO9A 2KSOB 4RW7A 2IBOA 1ZOTA 4JI6J 3ZSOA 8ICGA 5AM3A 2OFGX 1J2MA 4EMDA 3H4DA 2H5XA 4KRFA 2LQ8A 2RE2A 4DS5A 1NUEA 4LF8J 3BS7A 4CBWA 1PIEA 4P9SA 4ZLPA 1CJUB 1JMTA 3LP0A 4ZVFA 2B9EA 3ULEB 2XWXA 4B9NA 3QU5A 2JR5A 3M6XA 2G5IB 5M2PA 1RDCA 2PZSA 2MZ1A 4QIWF 2VPYB 3TSUA 4XAKA 1VSEA 4DFKA 2YNFA 1SUQB 3KLIA 4ZHRB 8ICQA 4TU8A 1Y97A 1W2BR 5E0OA 1RTIA 3EUB2 4NRUA 2GVZB 5M1PA 3KZBA 3T79A 5LMUK 3VQEA 2BANA 2P9SA 2A3ZA 3LP1B 2ROGA 4XDDA 3C23A 2CQ2A 3K8WA 2AYBA 2H3GX 4JWNA 1NEEA 4FK0A 1I3AA 2ZBPA 3FR0A 3F2KA 5BR8J 5CR0A 2BCUA 2UUAJ 2VL1A 2BW2A 3GWCA 3K9KA 3CD0A 5FDLB 2FYXA 1GTHA 2EC0A 5A6PA 1R8AA 8ICJA 4I6YA 4JI1J 4XK8C 3D2WA 2KH9A 4I2JA 1V5VA 3UCZP 3ZZUA 3GOIA 4JV1A 2VZ9A 2OM6A 2ZDPA 5EU7A 1Q4RA 2P5VA 2BE9B 1F0XA 2D9PA 2W03A 4O5KA 3SQGA 4KLIA 1SIWB 3KOOA 1TL3B 4QNLA 3DU6A 9ICCA 3QB0A 2ASMA 3CCUS 2VB6A 3T1HK 4LF2A 2A2DA 4NL9A 4E7LA 1AYEA 3CC2N 2L9DA 2XMKA 2MEWA 2V51B 3J7ZO 4I2HA 3VQ7A 4FLUA 3CPEA 1A7GE 3BGRB 5AKJA 4KFBA 2F3JA 1F9FA 3C94A 1BPEA 2K3IA 5J8YA 5I3QA 2FVCA 5ALMA 5C2GA 3G71S 2NRXA 1PZNA 2Z1GA 3AMZA 8ICXA 2RSQA 1HNWK 5J0XA 3OSNA 4OZJA 3IWXA 2PFUA 4UOHA 3T5JA 1NDCA 1Q1KA 5LSOA 4I4BA 4JI1K 5HNKA 4RQMA 3PG9A 3DI6B 3RRGA 4EZ6A 3ED5A 4F0MA 2E1AA 3R5JB 2OPRA 5DDPC 3ENVA 2XY8A 4USTA 4B8AB 5HP4A 1NCLA 2KXNB 4DEZA 1RAEB 1PKUA 2HSEB 2E9TA 1NK6A 4M3XA 3KKAC 4ANEA 2OP5A 4A8YA 3C95A 3H42A 3FRYA 3R1HA 2DGXA 1MA9B 1YJ9N 2ZD1A 2O8BA 2XMMA 1VQ9N 4W92B 3MEGB 4DU8A 1R8BA 1VRTA 1ASWA 1VHFA 3HVRA 4KBOA 2P9EA 1L8OA 5AKGA 3FC4A 2XSJA 3GFZA 1EWQA 2UXCJ 2M9KA 4LBIA 7ICPA 5AXNA 1B4FA 9ATCB 3SUPA 1ZD3A 3GJQB 4LREA 2VQEJ 5HMZA 2I7NA 3DRSB 4MQ3A 4DV1F 1GX6A 4O4GA 5BRDA 2XMVA 1XO1A 1ZS6A 5LMNJ 4OX9K 2GQ2A 4X4UA 3CDUA 2FJVA 2GS8A 4F2RA 1BWVA 2GX8A 3P6YC 1JJ2M 2W2NP 4BDZA 4FLXA 2DHXA 4ZCMA 4H5WA 3TEGA 3V4MA 3W7BA 3N4PA 3D6FB 4H0PA 9ICEA 1V5IB 4O8UA 2MTLA 4WQ4C 5J2HA 4DL5A 2BV3A 5KNIA 4TYAA 1NGFA 5C12A 4AH9A 3SDEA 3O8WA 3JYTB 1RISA 4WCEQ 3HSTB 4CZGA 4CO3A 1QE1A 3AVMA 3CCUN 3CXCM 3ILIA 1RTZA 4FF1A 1D8LA 3QNOA 2R7OA 1VSDA 4OL8A 2QTWA 3IBCB 1U1QA 2H51B 3AD8C 2M9NA 4K4SA 1SIZA 3D2EA 3GCWP 3I56N 1S1TA 2ZF5O 1GMVA 3W1YC 1TFRA 2QB0B 3ITHB 2U1AA 1UQVA 4L75A 1R43A 1ICEB 3N01A 3VAKA 1ZH5A 3TUIC 7ICLA 1EZZB 3VF6A 3M6ZA 2UXBF 1FK9B 4BWJA 3FFIB 1VC5A 1YJVA 2A1BA 3NVWA 4B3SJ 4M63C 3H25A 4KGZB 3VF0B 1T3VA 4JK9A 3E1YA 1EHWA 2VG6B 1WYGA 1S1UA 2MSTA 3TKAA 2ZH3A 4F5NA 2X78A 3SDEB 1NB2A 2C3YA 5FROA 3WBZA 2EZZA 2HF3A 4IOAQ 9ICTA 1YDLA 3QEXA 4O3NA 3FQLA 4JI3J 3L2QA 5JS2A 2UVWA 1LNQA 4HTJA 2ZJ8A 4XRHA 2MYFA 1HI8A 3SI8A 1U1LA 1FESA 2ZOFA 5LSRA 2GVZA 5ETKA 1BI4A 3GJTB 3U6FA 4OLPA 2J9CA 1JLCB 4UOFA 2UV8G 3WK5A 1XMQK 1RBOB 3NCIA 4PGXA 1SKUB 4P4MA 4URQU 4JI0K 2YHWA 2F8SA 5FLXY 3FEZA 1ZQ1C 5AI0A 2VBZA 9ICOA 2VICA 2IOCA 2X1BA 3U7JA 5HMXA 4AD6A 4NCGB 2VA8A 4ZIVA 4HVJA 4RW7B 5D15A 3VR1A 2IM1A 3HSGA 1TVRB 2VDHA 3QLHA 3MPWA 2I5HA 2CJXB 2YQ1A 2XZTB 1XIQA 5BYQA 4RUCA 1Q8LA 1VSLA 3V6JA 3LVVA 5IT0A 1XR5A 2NZCA 5AIAA 4QZFA 3OTQA 4H8KA 9ICIA 4KC5A 5HATA 1RU1A 4GC6A 4OZ1A 4WTOB 3W3DA 4CE9A 4PHEA 1C6VA 1VIOA 4AP9A 4NEZA 2MQOA 4GMJB 3FBFA 1RNHA 2HBJA 2IOFK 5C5JA 1GLEG 1LQ9A 1WEZA 3C16B 1ZRNA 1FERA 2UUTA 5IM0A 1FNOA 1LW2B 2V50A 3AJDA 1GLFO 2MY7A 4U7UK 2J7KA 4F4WA 1S79A 3LP0B 3VQDA 2V8HA 4KGMA 4KQZA 2VYPA 4PHDA 4IG0A 3D6JA 3SAGA 3WXJA 1WG5A 2A10A 3L7PA 5IIJA 4BR2A 1NXIA 1NKBA 1U1KA 2GLEA 5ALFA 4ID5B 5H2FU 2QSFA 1ZBIA 2JDJA 1N34F 1IQZA 4XTTA 1LAVA 3TVZA 4W5TA 4FXVA 5DB7A 2ZBCA 4WZMA 3MD3A 2G8WA 4M95A 3BZKA 4CJ4A 2L5YA 1H6KX 1RILA 4US8A 4NZ7A 4LF6F 2PYJA 4DV5J 2H4WB 1QSYA 1RA7A 4LQ9A 3I32A 2EHGA 4IEIA 3TTFA 4MIAA 5KAIU 1WNSA 4RWTA 5H9EJ 3HHEA 1VSHA 3T9ZA 1DGSA 3BY5A 5DDOC 3H08A 3VQCA 2CPHA 1TL1B 4P2FA 3SMSA 2O01C 3V6KA 2XO6A 4DXLA 2Z1HA 2DNGA 4CJTA 1KN6A 5C24A 2W9MA 3R5AA 4FJNA 2OH2A 5AQGA 3WNHA 3C2MA 2PI4A 3L4IA 2DY1A 2VGMA 5KG7A 1PAUB 2WVCA 1U1MA 1SL1A 2KDOA 3WDOA 2GELA 4F50A 1RCHA 4Q44A 2P2CB 2W2MP 4KBIA 2CPXA 4PPZA 2XB2D 2IY5B 1NU0A 4NCAA 3O4QA 4H0VB 2DGUA 4CGIA 4KLHA 2QEXN 1FEEA 5LOQA 3OYEA 3C2LA 4TXSA 4JI5J 3ISBA 5IC6B 4QWBA 5CABA 1DLOA 2ZOGA 4BR7A 1HWLA 3ZDBA 3M1VA 1N33J 2LQBA 3O9UA 2MQPA 3OW2R 2AJ4A 4YFKA 2R8HA 1GQEA 3O4NA 3VALA 2PA8D 5ETNA 3DMJB 3C2PA 4FZLA 4ZTJA 3VGUA 1OSDA 3KDOA 4GVBB 5AI6A 5CZVA 1K1SA 3JSMB 3V9WA 2BW7A 5JXSA 5KT7A 2HBKA 3RGIA 3OFEA 2X74A 3VETA 4P7VA 1QQNA 5ETSA 2J7WA 2P9PA 1FTCA 1K47A 1F3FA 2YWFA 4G9BA 2EDUA 4K8RA 1TE2A 3TOQA 2ZZNA 4UOCA 4A8MP 3QBXA 4C11A 3V72A 3Q2SC 3CCQN 2NRTA 4CHZA 3VV2B 4PWUA 1T9XA 4C4WA 4I6WA 1Z6RA 4L8RB 2VBWA 2AEJA 1QDUB 1FA0A 5F2RA 2B43A 3OR2A 3KKFA 2LPEA 2FQQB 2HWTA 2LYBA 2I6WA 5BN8A 3M8YA 2DCLA 1ZQVA 3E0FA 1BY9A 1ZAVA 4Z37A 3L2RA 2EFGA 1IBKJ 4ECXA 2OYYA 2DITA 1R0BG 4CF1A 3HJFA 4DR3F 3OL9A 1NHUA 1BQMB 3MXIA 4ILLA 4Y2UA 4DUZF 2HRTA 1HBOA 2XWYA 1NJWA 3BZQA 2RS2A 1UJ5A 4JBCA 4RBVA 2RDJA 2ZJQQ 2DCUB 1RDWX 4EIAA 1BIZA 4GV3A 4FO6A 2FY1A 3ZT0A 5ETRA 1HBNA 2RNEA 5J2CA 1QZ5A 1UZDA 3SMVA 2PAVA 4NLNA 3QWUA 4HHHA 3BO2A 5J2GA 1LWCB 4IRKA 1QD1A 1HIWA 5AQOA 4FL9A 5AM1A 1WWUA 2EEYA 3D28A 1BHLA 2VFTA 1X7VA 4Y2KA 1NRKA 3O6QA 2F8LA 1X31C 1BNOA 4RPFA 5AFUH 3CCMN 3PX6A 3H1VX 4I2CA 2B4UA 3TAQA 1H1VA 2DR8A 3AA9A 3WC0A 2VJVA 1NGEA 4PG8A 1RGIA 1TAUA 3EZWA 4P74A 8ICTA 1JLAA 3AGKA 4YDUC 4YOEA 4B9TA 5D0RA 5BOMA 4KMOB 8ICKA 3AA8A 4WFNQ 2BE7D 4WIIA 3FLCO 4YD2A 2AZ1A 2GW8A 4IO8A 1V9OA 3L09A 3OTEA 2AX0A 5B0BA 3VGTA 1WG1A 2HRUA 4CLWA 4X65J 2HQ3A 3FSYA 4Z4HA 1NGDA 2AEFA 3R9PA 1S4FA 5LMNK 4RW6B 3DYAA 4CJPA 5DLFA 3OYLA 1IXKA 4USKA 1S1WB 4W5QA 1TVAA 4BLGA 4KGXB 4RNFA 1IKVB 5LY3A 2YWHA 5DZ6A 2QWPA 3CCMS 4ERDA 3TA1A 4FZYA 4ZP8A 4QZAA 3IR6B 1DJ0A 4G1IA 1JLBA 3HHLA 4FJ8A 3W0LA 3GV8B 4JK1A 2KHDA 4EBEA 1IBLK 4QZCA 1X4HA 3ENBA 3PY8A 2OCEA 2ZWPA 5E33A 8ICAA 4X65F 3MM8A 1T05A 2NREA 2Y1JA 2KTQA 2VC0A 3PSTA 3LP1A 3V2UC 4RUAA 2YWEA 4DV4J 3CMEN 1ZZNA 3U1NA 2OHFA 3NOCA 1M6YA 1BNPA 3OTOF 3ZD9A 4QQBA 5AI5A 1FXRA 2LDYA 1VC6A 2YNFB 1HEKA