3TARA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-6) position
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tarA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tarA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tarA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tarA01
5KRTA 4F2SA 4NCGA 4CFDA 5KG4A 4HYKA 3KK1A 3L2RA 2C2EA 3ZSRA 3KKRA 2KTQA 3N97B 3DLGA 9ICFA 3C2KA 1CZ9A 5J2JA 4JLHA 5C5JA 3AVNA 2W9AA 9ICVA 1S9EA 3MABA 4IDKA 3SUNA 4C8NA 7ICMA 3DM2A 3VQ4A 4I2GA 3WNEA 4PQUA 1JLBA 3V7LA 4J2AA 4KTQA 4CFBA 1BPYA 2FPKA 1BPEA 5KFMA 3PUFA 1TV6A 3RH5A 1BPZA 5L1IA 4GMJB 2XC9A 4AHUA 2P1JA 5J2HA 4BE0A 3KTQA 3KK2A 5KFRA 5C24A 3IAYA 5L1KA 4IQVA 1UA1A 3NF8A 5CB1A 2BE2A 1A5VA 1CUKA 3BJYA 1FXXA 4HCBA 1ZQMA 1RBVA 2QKBA 5HHIA 4YFKA 3HM9A 4KN4A 4YMMA 2LYHA 3PVXA 2C22A 3ZCMA 1ZYQA 4Y1CA 3DI6A 1HNVA 3M9NB 3V4IA 2AQ0A 1XO1A 5IIJA 1ZQSA 5F9LA 8ICJA 1NOMA 3E2EA 5DG8A 4KO0A 3NHGA 4DL7A 2FMSA 4QAGA 4YD2A 2VA3A 4FJIA 4ELUA 3B6PA 4IRDA 4G1QA 4TUSA 4CEBA 4M6WB 4EYIB 4KN7A 1GOBA 5HRSA 3ZT2A 5KFSA 3OYDA 5K14A 4I2BA 4ED8A 4TUPA 1RTHA 4IR1A 1UAXA 5J0XA 3OYCA 3H40A 1EXNA 4I2DA 3OJSA 1NKBA 5JS2A 4RW7A 2WOMA 4I29A 2HW3A 3K75D 1XHZA 1Z00B 3ULDA 1ASWA 4EBCA 1LAVA 3OS1A 4CEDA 2HHWA 4K4HA 4QZDA 4I2JA 5J0SA 4XQ8A 9ICOA 4CK3A 3QEVA 5DQIA 2BPFA 1VSLA 3SUQA 4TUQA 1CLQA 4DSEA 4PGQA 1NKEA 1MQ3A 4LVSA 4M41A 1PZNA 5HMMA 3GV7B 1L3UA 4CJUA 1ZQDA 1EP4A 3DLRA 3DLHA 8ICLA 4CGIA 4ECSA 3V9UA 4F91B 4CERA 1HYSA 3TAMA 1BI4A 4DLEA 3NF9A 4ECTA 3GDXA 4ZHRA 5HNKA 4Z0UA 3LDSA 4E7KA 5EWGA 2A1JA 2XGPA 3L2UA 3IM1A 4J9NA 5L9XA 2I5JA 4R64A 3OJUA 1RT1A 4KLGA 8ICHA 3M8PA 5C25A 5E41A 3K58A 3SPZA 5KFQA 4EBDA 5FRMA 1REVA 2XRIA 5DBAA 5FRNA 4LZDA 2KQ2A 4CJTA 4RW8A 5KTQA 3P83D 5FDLA 1JKHA 3VQCA 1MU2A 4EZ6A 3MAQA 1ZQPA 3LPUA 4DG1A 2O4IA 2IC3A 1NJXA 4FBUA 2XHBA 2BPGA 3KHLA 1JXEA 4DO9A 1SKSA 1S9GA 1N5YA 5SZTA 1RBUA 2P5GA 1EXQA 1B43A 9ICTA 3HJFA 3HL8A 3NH2A 5J0TA 2UVWA 3VQ6A 1NJZA 1ZQZA 4RPXA 1ZQXA 3H4DA 2JGUA 4RQ7A 2W9BB 4JS4A 2AGPA 2IGIA 3V6KA 1MSWD 3VQBA 4F4XA 3THVA 1L3SA 3DLEA 2AJQA 1LAWA 3M8SA 4I27A 5KT5A 3Q8MA 1VSJA 5KFBA 4CK1A 2GV9A 2Q3SA 4QWDA 4RPZA 3RBEA 3C1ZA 9ICWA 3NDKA 4RPYA 3ISBA 3SJJA 4MFAA 1JXBA 2UVRA 3CFPA 1IXRA 4Q44A 1TK0A 4RNNA 3M8QA 4O55A 1I39A 1SKWA 4FLUA 1NK0A 4KLMA 1T03A 2VWKA 4DTMA 4ED2A 1TKDA 1KVAA 2FC0A 3C5GA 1C1BA 4FLYA 4P2HA 4Q43A 4IG0A 2G8WA 2QK9A 3SQ2A 1LB2B 3AO5A 4KI4A 2HMIA 2BANA 3KLEA 1ZQQA 3AVJA 3DMJA 1NOYA 3KD1E 2VA2A 5J2GA 3V81A 1BISA 4F5QA 3OYLA 2BHNA 2W8LA 5D49A 2FMQA 1B22A 5KFLA 4K8XA 5KG3A 3T19A 4ED3A 1ZBFA 2G8KA 4DSLA 1BPBA 1U04A 3AA4A 3VQEA 5J2MA 3LZJA 4MFCA 2KFZA 1V9PA 3M8RA 4CHOA 4BGDA 2X78A 5KFEA 1JLGA 4J9PA 4YNQA 2RPIA 5EWFA 9ICSA 4JS5A 4HUGA 3PX0A 4CJPA 3OHAA 3L2QA 1VRUA 4JRPA 4FZZA 4EP4A 4QWEA 5CWRA 1Z26A 3O3FA 4GLXA 4I2EA 1JIHA 3BGRA 4N56A 1UOCA 1FKOA 3AVBA 4FO6A 5FROA 1LW0A 4KLUA 1IM4A 4NY8A 1RDBA 2WTFA 4LZGA 5DB7A 3PY8A 1X9MA 1T8EA 2FPMA 1LW2A 3NFAA 2ITGA 1MQ2A 1IKWA 2XCAA 2BCSA 4KLQA 1ASUA 1B92A 1IKXA 4GC7A 3V6JA 7ICJA 2G8VA 3O3HA 3OYHA 4BE2A 2J6TA 4R66A 4R8UB 4E7HA 2VWJA 3SI6A 5BOMA 4BWJA 3LP3A 4KTWA 3C94A 4E19A 4I2CA 4KRFA 3OYEA 5CYQA 3HX0A 4IFYA 1NK4A 1ZQGA 1ZQEA 3RAQA 3ITHA 3TAFA 4CK2A 1S6PA 8ICMA 2YNFA 3RTVA 4B3OA 1SZPA 2PXIA 1RCHA 4RQ6A 1GOCA 3CFRA 1VSKA 2ATLA 3MR5A 4QWCA 2XGQA 3PW2A 4ED0A 3MR3A 3UPQA 3SV4A 5F9NA 3HP6A 3LP0A 4HTUA 4KLTA 2BDPA 1Z25A 4J9SA 1JX4A 4KLJA 2OPPA 3DRPA 1QE1A 2HNDA 1N6QA 3ZSXA 2W8KA 4KI6A 4Z4EA 4IR9A 4KKOA 1AROP 4QZAA 4KLEA 4BDYA 7ICGA 4FJ8A 4J9KA 4CEQA 1HQEA 4M2YA 2ETJA 1S1VA 4C8LA 3ZT4A 5J2CA 3CYMA 1TVRA 5KFUA 5DDMA 5J0QA 1D8LA 3C95A 4IRKA 5BPCA 2YNHA 1YTUA 1NJWA 3JPOA 4LY7A 2PFOA 4DU1A 3SCXA 4UB2A 4Z4IA 3OS2A 3OYKA 4KHQA 3KIOA 4YG2A 2JZBA 9ICHA 3DRRA 1X1PA 1TAUA 4J2EA 4EP5A 1YVUA 1G15A 9ICMA 4M9LA 4DQRA 3MGHA 4L8RB 1CXUA 5HROA 1TV9A 2KZZA 3AU6A 3OYFA 1WCNA 5J29A 1SL1A 2M9NA 1COOA 1TKTA 3GIMA 1IG9A 1WAJA 1XI1A 4KLLA 3TR8A 2NRTA 2YKNA 1Q9XA 1T7PA 8ICBA 1BPXA 5KGWA 4O0IA 4FS1A 2RDJA 1KFDA 1RILA 5KT4A 1HQUA 3L8BA 4DSIA 1ZQYA 2ZJAA 4JUZA 3NGYA 3AVFA 3QIOA 1HJPA 4HHTA 3QIPA 4ECUA 4MF2A 2G8UA 4P4MA 3AU2A 3HXMA 3MDCA 2H5XA 3MR6A 1TKXA 2C2RA 4DTRA 1QSSA 3JPQA 4I9LA 4P4PA 1WN7A 4O0JA 4HUFA 4E3SA 4K8ZA 1Q9YA 4B9NA 3S3NA 2ZE2A 2AGQA 3G0ZA 3EYZA 4EBEA 3DRSA 2FBYA 3DYAA 1CEZA 1SUQA 4C8KA 3WNGA 3RJFA 4CHZA 2X74A 1JLAA 5KT7A 2NRVA 4ID1A 3RRGA 8ICCA 5J0YA 4RW6A 4E1MA 1RBRA 3KHRA 1RBTA 3U6FA 4GXKA 4I2FA 7ICVA 3L3UA 4CJ5A 8ICEA 3AVHA 9ICNA 3OGUA 2DY4A 4FLWA 4KHSA 3AVCA 3OSNA 2DFHA 4NXZA 3IS9A 3D0PA 3QERA 2P5OA 8ICGA 3V1RA 3AO4A 3MXMA 1NK5A 4C8OA 2C28A 4K4GA 5DQGA 3VQ5A 3MBYA 3TAQA 2UVUA 5TZVA 2RKIA 4MFFA 3DOKA 4DF8A 1BIZA 4Q45A 1EX4A 1HYZA 3KKSA 4DFPA 3LP2A 3PW5A 1ZQHA 3MEEA 3QZ8A 1TK8A 5HRPA 3QINA 3VQQA 3T5JA 2ZTEA 5IILA 1A5XA 2BQ3A 4QZBA 2ZD1A 4YXMA 3U3YA 1HPZA 1BHLA 1Z3EB 3HYFA 4WE1A 5KFDA 2FLLA 2BQRA 4M3YA 2HVIA 4EEYA 3ZD8A 1UT5A 3T1AA 1LWEA 3OVNA 4CJWA 3IHQB 3PMNA 1RTDA 2HVHA 1C7YA 2LSNA 4FLTA 8ICRA 5KFZA 3B6OA 8ICYA 4R63A 2QKKA 4F8RA 4RNOA 8ICSA 3HPOA 4RZRA 4M9NA 4OGEA 4FJNA 5KFXA 3G6XA 1DTQA 3V6HA 4KLOA 4O5BA 2YHAA 1BCOA 1TAQA 1ZJMA 2VA8A 3RJGA 3L2VA 4M9JA 4RG8A 2O4GA 3K5LA 9ICCA 4DF4A 1IKYA 2YNIA 5HP1A 4ELTA 1JN3A 2GWSA 2W9CA 3VA3A 4GXJA 9ICLA 3QZ7A 4O3SA 3VQPA 4DOCA 3NH1A 2R7YA 9ICJA 2BCVA 1ZQKA 5I42A 1A5WA 4KB1A 2DPIA 3C6TA 2G8FA 3LAKA 5CZ1A 1VSIA 2ALZA 1JLFA 3NE6A 2HNZA 5DDYA 5KFVA 1S1WA 3C1YA 1ZQLA 3QEAZ 5EU7A 2BGWA 1U49A 2V4RA 2V9WA 7ICTA 4NLGA 1JL1A 3CM5A 4O9MA 4CJSA 4UBCA 4UB1A 2OPQA 4E1NA 4KHUA 4DL2A 4F5NA 4OKKA 1S1TA 3HPGA 2FPLA 4DTUA 5KFIA 3RMCA 4KB0A 4QZFA 3RB3A 3EW9A 4JK1A 3P1GA 2W9MA 4UBBA 3SV3A 3MDAA 4H4MA 3ZSOA 2R8HA 3PNCA 2C2DA 1JL2A 9ICQA 4CJRA 3RJEA 1KLMA 4BDZA 4YD1A 2ZJ5A 1CXQA 4YVZA 2R8KA 4KAZA 3H8SA 5DBBA 2FMPA 2MAXA 1XSNA 3KHHA 2JLEA 1D5AA 7ICQA 3SYZA 2E6MA 3QNOA 5J0WA 4LH4A 4KLDA 4E7IA 1MC8A 4CEZA 3PMLA 4YN4A 3UXPA 1C0TA 2QXFA 3F73A 3A2FA 7ICLA 2XO7A 4YR3A 4XRHA 4I2IA 5DB8A 4F3OA 2EHGA 3C23A 1NK7A 5DKWA 3G10A 4OVLA 1DOQA 4BDPA 1HRHA 2D0CA 1N48A 8ICOA 3QETA 3CFOA 2I9GA 1R0AA 5KFYA 3LK9A 2R8IA 2P6UA 4OKEA 3SPYA 1KTQA 3V9WA 1WLJA 3NGIA 4M9HA 4I2QA 3I0SA 4CEEA 3OYIA 1WSGA 3MFHA 1ZQVA 4KHYA 4DFKA 3HO1A 3GQCA 3GV8B 4FLZA 4IQWA 1K1QA 4MFBA 2IHNA 4YCXA 2R8JA 9ICRA 4FM0A 4ZH4A 2NUBA 2HNYA 3ISNC 3SUOA 1WSFA 4FJ5A 2P51A 5KFJA 1RBSA 2OZSA 4RNMA 3O4QA 4NLZA 4O44A 3RB0A 3TFRA 2Z1HA 9ICKA 4DQIA 3G6YA 4CFCA 8ICTA 3ZSWA 4JRQA 3ZDCA 2J6SA 5CHGA 4XA5A 4RUCA 3V1OA 3V6DA 4JWNA 4CJKA 2ATQA 3VQAA 4JWMA 3T5HA 3KLIA 4O3PA 4YFUA 2DFLA 8ICZA 3UQ2A 1BI4B 1S10A 4PHDA 3C2MA 8ICPA 4LD0A 2A1JB 3TABA 3ZT0A 2YNGA 4CEAA 4R65A 1TKZA 2NRWA 4M42A 5KFCA 3AVKA 4DTOA 4IRCA 3T5LA 1RT5A 4JV1A 3NF7A 4YP3A 1Q8IA 2PYJA 3RWUA 4FCYA 3QO9A 1RDCA 2XCPA 1C1CA 4GW6A 2F96A 3LPTA 3QE9Y 3S3OA 3IRXA 4IBNA 1EKEA 2KZ3A 3RR7A 3AVGA 2B5JA 2RN2A 3RJIA 3TI0A 3AVLA 5HRNA 2ZQBA 5KG7A 3C5FA 4ECVA 4RT3A 4CGDA 4FJLA 4W5QA 5KRSA 8ICXA 2PFQA 4ECXA 3UIQA 1RT2A 4M3ZA 2VG6A 4NM2A 2OWOA 4BXOA 4PUOA 2A1RA 4FS2A 4DSFA 4G3IA 4O4GA 1ZQNA 4W5OA 1FKPA 3H8WA 4ECQA 9ICUA 2E6LA 1S1UA 3K4GA 3CQ8A 4Q8EA 3DOLA 2OPSA 5DBCA 4FJKA 3N4MB 4I2AA 5HHHA 3EPIA 4FM1A 4JV0A 5J1EA 4F4YA 3JPPA 2PFPA 4FJ7A 3LANA 3VA0A 3K5OA 5CJ7A 3SZ2A 3ISCA 4ZTJA 3LDAA 3LZIA 2AQ4A 3QEXA 4DL5A 3O4NA 4F92B 2JEIA 3D45A 5HBMA 4TQSA 3PO4A 5IIIA 4F4WA 1F21A 2J6UA 4R5PA 2MUTA 4O3NA 3JPNA 2XY6A 4CF0A 3OYJA 5DG7A 4IKFA 4DOAA 4QZEA 4QWAA 1XU4A 4DSJA 4EYHB 4PHPA 4IQUA 2BPCA 4I28A 3MECA 4EZ9A 2BKEA 1LWCA 3V1QA 4F5RA 4CE9A 4CJQA 4NLKA 5DMRA 1BVSA 4RQ2A 3IG1A 8ICIA 4Z4HA 1RNHA 3V9SA 1J54A 4ZTFA 5KFNA 2YV0X 4UAWA 4TQRA 3JYTA 4BE1A 2XY5A 1KDHA 1XWLA 1RYSA 4KFBA 3ETLA 5J2PA 4DQPA 2BQUA 4M3RA 4ID5A 3NTUA 1BPDA 3AO1A 2Y1IA 3GFKB 5J2QA 3KK3A 2F1IA 4F2RA 5KG2A 3DLKA 3GIJA 3TAGA 2ZUBA 1B9FA 2KW4A 3O3GA 1YTAA 5EWEA 2ZTCA 4ECYA 5J0RA 3MFIA 1J53A 5HRRA 5DLGA 5DQHA 2F1JA 3HK2A 1A77A 1XC9A 4DTSA 3MXIA 4DWIA 4LSLA 2FBXA 3RR8A 4C8MA 2DFFA 3FFIA 4E89A 4B9LA 4KREA 4AHVA 3H08A 5CR0A 1WAFA 3VQ8A 5I3UA 1SKRA 1NKCA 3I0RA 1VSDA 3C2LA 3H7IA 4F5OA 4J9RA 1D9FA 5HP4A 3PR5B 4FW2A 1XS9D 1C0UA 3E01A 2X6SA 4IFVA 3TANA 4PA1A 4NYFA 4M6WA 3MR2A 1X2IA 5KG1A 3RH6A 4DTXA 3JSMA 4ED6A 4KHNA 8ICUA 2HHSA 1DTTA 4RQ5A 3OY9A 4ED7A 1QLNA 3B0XA 8ICAA 3AA5X 3ISDA 3RMDA 3SUPA 4BACA 1KVBA 3L2WA 4F5PA 1RXWA 4XIUA 1Z00A 3UQ0A 2HHXA 4ICLA 4IQTA 4CJFA 1O1WA 1H38A 4YMOA 2EX3A 3HWTA 3K5MA 4YXJA 3H4BA 3VN5A 4AILC 5J2EA 1KLNA 4CF9A 2YHBA 1FK9A 2VG5A 1ZQUA 3AO2A 8ICQA 4OGCA 3ZDBA 1K1SA 4I7FA 1RXVA 4CJ4A 2DPJA 4TSXA 2HHVA 3HVTA 9ICBA 1HNIA 4Z6CA 3ZD9A 3QNNA 1RDDA 3M9OB 4DL4A 2B6AA 4Q8FA 3BDPA 2JEJA 2P6RA 4OLBA 1Y88A 4B9VA 3Q8PB 4FLXA 4UB3A 1W0HA 4Q5VA 3SQ4A 4KLSA 4CJ3A 5KG6A 1C0MA 1B9DA 1DGSA 1KVCA 5J2DA 4PGYA 3OS0A 3EZ5A 3K57A 5D4BA 3BQ2A 1WSHA 5J2BA 2AGOA 4H8KA 5CZ2A 4FYDA 1NOZA 4PH5A 1KCFA 3RH4A 1XHXA 1QQCA 3RB6A 2G8IA 3NH0A 4AHSA 2GBZA 2Z1JA 4N76A 1S5JA 3NGZA 3SQ0A 3AA2A 1JXLA 2NRZA 3WNHA 5DG9A 1HUOA 2D0AA 2BR0A 4CGJA 4DQSA 4RQ8A 4DTJA 3PO5A 3G6VA 3Q8KA 4O5EA 1TL3A 4CHQA 3Q8RB 4RUAA 2V4QA 4Z4GA 1T4GA 3JPSA 3GIIA 2HHUA 2JZBB 4FJ9A 1UWBA 1ZQBA 3NAEA 9ICGA 5CP2A 4DL3A 4Q0BA 4FJXA 1ZQWA 5KFFA 1GOAA 1X9SA 4CCHA 3QESA 2W9BA 3P5JA 3NF6A 8ICWA 3HW8A 4KTZA 3RRHA 1XSPA 3RB4A 4YR2A 2Z1IA 4Z4CA 3NGDA 1C6VA 7ICPA 3KD5E 5KI6A 2IS3A 1S1XA 1ZQCA 3UXNA 4ED1A 1S6QA 1CZBA 3AA3A 4CJVA 7ICUA 4W5NA 2D0BA 3B0YA 4O3OA 2FBTA 4I2HA 4FK4A 1ZQOA 4W5RA 4DSKA 3MGIA 4MEYA 4DU4A 5KT2A 4KITB 2OYQA 4GXIA 1QS4A 1SL0A 3KJVA 3KLFA 5KFAA 3SQ1A 2B4JA 4PY5A 3C21A 4XUSA 3HPHA 4Z6FA 1I3AA 1ZQIA 1BQNA 2RDIA 4KV8A 3MEDA 4ELVA 3KHGA 2FBVA 3V9XA 4BWMA 9ICXA 5C42A 4F3TA 3OYGA 4CIGA 4DMNA 4I9QA 5KFKA 5DB9A 3T3FA 3JPRA 4J9MA 1HMVA 5KFTA 1WNSA 1RT6A 4O5KA 1TK5A 2VG7A 1BL3A 3OYBA 3K5NA 4AHRA 5HMLA 1SV5A 4CHYA 2UVVA 4CECA 4KPYA 2HB5A 2R8GA 5DGBA 4NCBA 3RAXA 4MQ3A 1VSEA 1VK0A 3NBPA 5J2KA 1NK9A 3CG7A 3EPGA 5KG0A 1ZQJA 2FLNA 2Q0ZX 4KLFA 2KN7A 5J2AA 4PPXA 4FVMA 3ZSZA 3AVIA 1U9LA 5T7BA 1T05A 5BOLA 3LALA 2XY8A 4OPJA 4FJMA 5L1LA 2JEGA 4HCCA 8ICVA 2X6NA 5KGXA 7ICEA 1RT4A 3BQTA 4NCAA 4NYNA 2W42A 4J2BA 3GIKA 1U48A 4FJHA 5J2IA 4OKJA 4CF2A 4B9UA 4M0AA 4DFJA 1S77D 1JLCA 2ZTDA 4N41A 4Y1DA 3QEIA 4F50A 2HHTA 1RDAA 4M45A 4O3RA 4YMNA 1VSFA 4E0DA 2RF2A 5J2NA 9ICPA 3AO3A 2BGGA 2IAJA 7ICRA 3PV8A 2ZUDA 4M3WA 4QZCA 1S0MA 4YQWA 3EWAA 3EY1A 4CHPA 5DLFA 4LSNA 4RQ1A 4YR0A 3ASMA 4R8UA 7ICNA 4AHCA 4J9QA 1HUZA 3ALYA 4QZHA 4PHAA 4QZGA 1WSIA 4GVMA 5SWMA 1BQMA 1J5OA 2Z1GA 1IO2A 2PY5A 2ZJ8A 2BCUA 3H8JA 5IINA 4CESA 7ICKA 4OJRA 8ICKA 5D3GA 2IHMA 2KZMA 2B21A 3JPTA 2W9CB 5L1JA 2FLPA 1J9AA 4N47A 2HHQA 3V9ZA 1JMSA 1L3TA 2PZSA 3SI8A 4PWDA 3HVRA 4M3TA 4QWBA 4J9LA 1KRPA 3DLBA 3I8DA 3OSPA 1VSMA 1W9HA 4FM2A 7ICOA 1HJRA 5J0UA 3ZSQA 5KT6A 4KLIA 5J2FA 4F93B 3KLHA 4QZ8A 1RYRA 4O3QA 2PFNA 1ZQTA 3RMBA 4DU3A 4Z6EA 3WNFA 4RW9A 2P66A 4FJGA 4M3XA 1NK6A 3L3VA 1LWFA 2XY7A 3UXOA 1VSHA 3ZSYA 5DK5A 1S0NA 4AH9A 4MF8A 4UAYA 2GUIA 4M47A 3TFSA 4X5VA 3PW4A 1JLQA 4DTPA 4MEXA 3V7KA 5JUMA 7ICHA 4DL6A 1TL1A 3LWMA 2BCQA 5IIKA 2A1SA 4B8CA 1RZTA 1ZBIA 1LV5A 2IA6A 4DQQA 5KFGA 3V7JA 4B08A 2F1HA 3CM6A 4FJJA 3PX6A 3AVAA 4Z4FA 3RJKA 1A76A 3M9MB 4PHEA 1KSPA 4M04A 4CEOA 1L5UA 5KFHA 4DS4A 3OYNA 4ECRA 3VQDA 4QW8A 4RT2A 3QLHA 4QOZB 3Q8SB 7ICSA 2BCRA 4QZ9A 3AUOA 9ICAA 3PW7A 3TAPA 4KLHA 3T5KA 3ZDAA 4CFAA 3Q8QB 4H4OA 4DTNA 1WCLA 2IOCA 4FZYA 1ZQFA 5KFWA 1WSJA 4UAZA 4CEFA 3NCIA 1S76D 2F8TA 4RQ3A 1ASVA 3HT3A 3TWHA 3RJJA 5J0OA 3LAMA 1TFRA 8ICFA 2PI4A 3VQ7A 1ZJNA 3AV9A 1ZBHA 4K4IA 2NRXA 4AHTA 1QTMA 1Y97A 3TQ1A 5EOZA 3ZT1A 2OA8A 2KFNA 4DLGA 3FDSA 4ECZA 4KMUA 1BGXT 3KLGA 4UB4A 3SNNA 4CJLA 3PR4A 4QW9A 3TAEA 1QSLA 2ISOA 4QCLA 4DOBA 5CY4A 4CHNA 1L3VA 3S9HA 5KFOA 1X9WA 1QSYA 8ICNA 1HYVA 4IG3A 1TVAA 3K59A 9ICIA 3LP1A 1U47A 4B9TA 4FK2A 5CA7A 4FZXC 4CGFA 4UB5A 2PI5A 7ICFA 1BIUA 1ZBLA 4O5CA 2AU0A 4PGXA 4QZIA 5IIMA 1S0VA 4M3UA 4KHWA 1RTIA 4LH5A 4RW4A 4CF8A 4CJEA 3HP9A 5D46A 3QEWA 1UT8A 1WSEA 1TGOA 1BCMA 1NJYA 1T3NA 5JS1A 2OZMA 5HLFA 4RU9A 1DLOA 1D8YA 1IKVA 3RMAA 1D9DA 3OHBA 3ORYA 1K6YA 4I2PA 3C6UA 3ZDEA 3TARA 1SL2A 9ICEA 2ISPA 3MEGA 2IBKA 7ICIA 5KFPA 3QEPA 3BQ0A 4P4OA 2F8SA 5CYMA 2WONA 5DB6A 4DEZA 1QHTA 1XSLA 1S0OA 4HVJA 1IH7A 1ZBUA 3GILA 3ZT3A 3AVMA 2JEFA 2D5RA 1UA0A 3U3GA 3ZSVA 3BQ1A 1ZQRA 1JLEA 3Q8LA 4RQ0A 4CGGA 2E4LA 5J0PA 2ASJA 4E7LA 2VANA 4DS5A 4RQ4A 2Y1JA 1ZQAA 4BXOB 2OPRA 4ECWA 4B9SA 1NK8A 3GV5B 4FLVA 1U45A 5KG5A 3QEBZ 2DFEA 4CIFA 1U4BA 4NLNA 3MXJA 4OLAA 4TURA 1RTJA 3ZDDA 1KFTA 4OPKA 2IMWP 2IDOA 4CIEA 2I1QA 1RPLA 4F4ZA 1S9FA 3RBDA 3PX4A 4FXDA 3S3MA 4E7JA 1ZETA 4FBTA 3VQ9A 4HUEA 1KFSA 3OYAA 4F4KA 2ZUCA 4DFMA 4FW1A 2G8HA 5IIOA 2ASLA 2PYLA 1VRTA 2ASDA 4CGHA 3PW0A 3V72A 4GC6A 4NM1A 1ITGA 4FK0A 1EETA 2MUTB 5KT3A 4N5SA 3RJHA 3OYMA 4M9GA 3HSTB 3K2PA 4J2DA 1S97A 4Z6DA 1KEJA 1RT3A 3LWLA 2YKMA 1C1AA 4B8AB 3F9KA 3FYHA 1YT3A 4B9MA 4J9OA 4UQGA 4JV2A 1N56A 1RT7A 2DTUA 4CF1A 4W5TA 5DGAA
chains in the Genus database with same CATH superfamily
3F41A 3R8EA 3KK1A 3L2RA 2C2EA 3KKRA 2KTQA 1GXLA 3SEOA 1DKGD 3H8YA 2EAOA 2W9AA 4LMZA 4DCOB 1QQ6A 3MABA 4IDKA 3VQ4A 4I2GA 3C16A 3BV8A 3D3BJ 4A8FA 3C15A 4PQUA 5J2PB 2XSJB 3ENQA 2WMMA 3PYEA 3PUFA 1TV6A 5E7OB 2HGMA 3UCZP 4G6VB 3KK3B 2XYHB 1BPZA 1PO6A 2GTDA 4GMJB 4OHZA 2V7ZA 4BE0A 3UDVA 1H1VA 4FWNA 2KG5A 5CB1A 3DNCA 1A5VA 3BDEA 2H51B 4HCBA 1Y5NB 2LYHA 2C22A 8RUCA 2E1PA 2DGUA 4Y1CA 4YOTA 3DI6A 4X4NA 1MROB 2AQ0A 3A5MC 3JXOA 1RAJA 3LUYA 3CC4S 1XO1A 4EEKA 1ZQSA 1EWQA 8ICJA 1NOMA 1S59A 3NOGA 4GKJK 2DGQA 4DL7A 3A4TA 3ETMA 3EXCX 4CZCA 1CQNA 1XMBA 3RFAA 4TUSA 1NB7A 1COKA 4YN3B 3FVYA 3QSIA 4OHXA 4IFEA 4CZFA 5HRSA 2LKYA 2N82B 2ZM6J 3N7SC 4WFXA 4I2BA 4ED8A 4IR1A 3H40A 1X4BA 3S8SA 4I2DA 1NKBA 3DXSX 3NLCA 4I29A 4IWVA 4NLPA 3IN5A 1YGYA 1SAZA 2EWSA 2AA4A 3ULDA 4EBCA 1WDTA 4BC5A 4CEDA 2O8DA 1HNWF 3HI0A 4YEAA 1WWVA 4I2JA 4XQ8A 3CO9A 9ICOA 2HRTA 2P35A 5DQIA 1VSLA 2HBJA 1L3KA 4M5NA 1PZNA 4WPAA 3Q22A 1ZQDA 3HLUA 1EP4A 1H2TZ 1KQQA 4CGIA 4F91B 3OL8A 3QU9A 1PJ5A 3J8AA 3RSEB 2VBXA 1KBRA 5ALVA 2DY9A 5THWA 2V51B 4ZHRA 3IO1A 5TISU 1IM6A 3CNQP 4C3MA 4E7KA 5EWGA 2O8BA 2XGPA 3IFRA 3DXMB 1DXSA 2OHDA 2W43A 4B9QA 2YWWA 1GLEG 2Z7JA 3PIPL 5C25A 5AQKA 4BR4A 5KFQA 3TOQA 2FLOA 4ZCIA 2HAFA 1T95A 5FRNA 2GO8A 2KQ2A 5B08A 1ZAXA 2CFXA 4FWMA 1B70B 3M7DA 3P83D 2HBMA 2A18A 3GP9A 4BS2A 3EGWB 3CPWR 4EZ6A 1Q5YA 1VQ4N 4DG1A 2GOLA 4JYAK 1IR0A 1SB3C 2P5VA 3NOCA 5HVHA 5M1FA 1SKSA 2DL0A 8AT1B 3H0LB 4ZITA 2P5GA 1CC7A 1HEKA 3MPVA 5FLXO 2KM8B 5J0TA 2WAQC 5HMZA 3CCUN 1YF5L 2AZ3A 1X7VA 3N01A 1ZQXA 3HDSA 1V3SA 1Y7PA 1WEYA 3N4QA 1GK8A 4NZ6A 3EE8A 1MSWD 1N34J 1ATSA 5KT5A 1F5SA 2AKWB 5AZJB 2J9DA 1VSJA 3J80Y 2H5EA 3RW6A 4RPZA 3RBEA 1GO3F 1U0HA 1HJOA 2AMCB 3ISBA 3GU3A 1T9XA 3QU7A 4MFAA 1AZSB 1YLXA 1N32K 1JXBA 4ICAA 2UVRA 1PVPA 2RE2A 1Z4UA 1RUSA 5F8HA 1N8RT 4Y2KA 4AQYK 3F53A 4F36A 5AKHA 1HKAA 3IG5A 2P6SA 5I42B 1U2FA 2BZFA 3AOCA 1Q7LB 2HMPA 1R8AA 4CP5A 1GEHA 2CNKB 2M9KA 4M95A 5F0XA 5F8JA 2VWKA 1U26A 4LRCA 3R2CJ 1KVAA 4PKHA 3FZKA 1NSQA 4USMA 4Q43A 2QK9A 2G8WA 3FBEA 3NRBA 3PSPA 4A8KA 2IA0A 3EVOA 2EFGA 2EZZA 1ZQQA 2QA4S 3DMJA 1X4CA 1S57A 2W8LA 1HW8A 4NLUA 1YJ9S 4PL7A 3P8BB 4QNLA 1X4EA 4FWPA 3CC4N 1NGJA 4EIAA 3DN9A 4BR9A 1SJ3P 2MPUA 2F9DA 1CSJA 2DNMA 1U04A 4LF4F 3NBPB 3QUTA 4ZJOA 4CIOA 2OEKA 1ZOTA 2HVEA 3NXZA 4K4VA 4PWWA 3C29A 1KDNA 4YNQA 1BMQB 4BC4A 4IYQA 2C1EB 1PYOB 2G0IA 5E3AA 1SV0C 2VODA 4CJPA 3W61A 4JRPA 4EP4A 5AKXA 1AW0A 4NYOA 4KAIA 1RHUB 3JSYA 4KGXB 2CJYB 2IIHA 2LEPA 1SV0A 4I2EA 1MWZA 3IKMA 1UOCA 5ADZA 1FKOA 2AF6A 1D0EA 3IRUA 3AVBA 1CJVB 3DDKA 1FA0A 1RDBA 1FJGK 4J91A 2WTFA 4JYAF 3PY8A 3MPYA 4BLGA 3O3LA 5AJ3J 3LA0A 3L95X 1O5JA 2DUYA 4LJXA 3V6JA 4RLEA 2AWZA 3O3HA 3F5TA 1KAXA 4EELA 5AIBA 4TLQA 2G09A 3GG0A 1GT8A 2DHHA 3MZIA 3TO8A 2KIVA 1QAJA 4NA2A 3M32B 3NGKA 3W2WB 4LF8J 5AM3A 2PFFB 2HNYB 2FPHX 2IM3A 4I2CA 1E6YA 2MMYA 4KRFA 1KNZA 3OYEA 2MKIA 1OVQA 1T11A 1RGVA 4GY2B 1LQ9A 1HWLA 1HI1A 3L4IA 1FNXH 2OIHA 5F8NA 3W60A 4P0PB 2IVYA 4QJFB 3UN2A 2CPIA 5RUBA 3KZBA 3LW5C 3UPQA 4OD0A 4DCHA 5CQGA 1Y11A 4C3LA 2YY6A 2KJWA 3NGRA 3DRPA 4KLJA 2HNDA 5AICA 4EHTA 3PFOA 5F3ZA 1U1RA 4I69A 4JKEA 2W8KA 2UU9J 1F60B 4A8SA 4IR9A 1PK3A 3GFHA 7ICGA 1JLQB 2AJ2A 1RWXB 2F9TA 2KKZA 3ZETA 1YRXA 2XSJA 2J7WA 1KONA 3KK7A 4M2YA 2UV8A 2HG4A 2DNQA 2H4YB 3ZT4A 3US5A 2PD1A 4USTA 1S48A 5B66U 4CVNE 5DDMA 2MU2A 3H1VX 2E1MC 2AX1A 3H0PA 2CQHA 1BG3A 1MNEA 1Q95G 2DJWA 3DJCA 3JPOA 5JICA 2PFOA 3FFKB 1P6TA 4C11B 2JZBA 3CCQS 1TAUA 3H42A 4J2EA 1YZ7A 3CCES 5T7LA 1YVUA 4XPCA 5AQPA 3QLHB 1QH9A 3RGIA 1CXUA 2DD8S 4DJBA 1HI8A 3T1YJ 2KZZA 1UW9A 5CD4H 3AU6A 1GX5A 3D2EA 3KOOA 2HK2A 3SBTA 5JMVA 4HTJA 3HSDA 1WF2A 4BUGA 3TR8A 1B0XA 5JXSA 3UDEA 2ZIWA 8ICBA 4A5BA 2RDJA 2QA4N 1RILA 3PKMA 1ZQYA 3ZZUA 4HACB 4GO7X 2V94A 4USJC 2YH1A 3AVFA 2NXCA 4HHTA 3QIPA 4ECUA 4MF2A 2G8UA 3MM9B 4LR7A 1YJ9N 3OL7A 4JI3K 2FHJD 1B0PA 3LGMA 1TKXA 2IVFB 4Y2JA 2EFOA 3JPQA 4P4PA 4O0JA 4K8ZA 4NXNK 1Q9YA 4B9NA 3S3NA 1M1KO 2GHPA 2ZE2A 4NB4A 3EYZA 4EBEA 4MKVA 1T44A 5IWAK 5EHHA 1CEZA 3WNGA 3RJFA 4B3TJ 2X74A 2OEMA 1GNKA 4RW6A 1VBKA 5F0WA 2L08A 2HHHF 1RBTA 3W3DA 4GXKA 4PJ0U 2WRMA 4DR4K 2R7QA 3EKUA 2ITMA 3UVJB 9ICNA 3KFWX 2DRAA 3E9PA 2VFRA 4USWA 5AJ3F 1AUDA 5AKIA 4J5OA 3PIOQ 1J5EJ 2ILYA 1JJCB 3D0PA 2P5OA 3KBBA 2YMMA 1NK5A 3T9NA 3WU2U 5DQGA 3VQ5A 5GAEP 3TAQA 1QAIA 2UVUA 2B51A 4MFFA 1YJNS 4ZPVR 2GJIA 4WFAL 2BTFA 4LF8F 1FNOA 4Q45A 2JFKA 3AJDA 1EX4A 4DFPA 1R6YA 3QZ8A 4USKA 3G8TA 1WACA 5ALTA 2ZTEA 1FXRA 1A5XA 4X66J 2VASA 1WKJA 4CZMA 2ZD1A 2UUBJ 2HOIA 2XMWA 1R3NA 2EH9A 2VYPA 1YRUA 4CO3A 3GFZA 1HPZA 1OUQA 2IOHA 1JJ4A 1Z3EB 3EZOA 3QB0A 4WE1A 4DHVA 2FLLA 2O5DA 4U7BA 2VFVA 1NGCA 1UT5A 3D9BA 2ZUAA 1LWEA 1KC8O 3J7AN 3R7BB 3I82A 2F4VJ 4CJWA 3PSFA 2ZJRL 4Z94A 5KL8B 2CN1A 3LQVA 3FBCA 4FLTA 5E0OA 5KFZA 1ZBSA 4BQZA 3TUZC 5HQLA 3AJ2A 5B0BA 2B4UA 4BR2A 3HPOA 3NNHA 4OGEA 5KFXA 1NU4A 1UVMA 5AZJA 4KLOA 1DQ8A 5JVHL 3MCSA 1YDLA 3CMES 1DQAA 1P8ZA 3ID8A 2O4GA 1ZQ1C 1Z6RA 1AZSA 2OUGA 2E9TA 4JI6F 2VQFJ 4I6MB 2FI1A 5AK5A 1SJFA 1JN3A 3VA3A 2ZJPL 1F1BB 5ETOA 3R5GA 2Y1LB 3O9UA 3O1BA 1XMOF 5I42A 2QMWA 3M2RB 2A41A 1NGEA 2O66A 5MLCQ 5CZ1A 4B02A 3UKRB 1S1WA 1ZQLA 5D6GA 2BKOA 1RT3B 2BGWA 4DUYF 1JL1A 2FB0A 1VR6A 4A62A 4CJSA 5IQQA 5JLFA 1WORA 1VQ8N 3CCQN 2QX0A 4JI2K 3CCEN 4FF3A 2MRLA 3HX9A 3HPGA 2KRRA 3TQEA 3RMCA 4PYAA 2BBEA 4KB0A 1M90O 5EDWA 1R59O 3QXGA 2R8HA 3H8MA 3IUCA 1KVKA 3A8EA 4WK1A 4NL9C 1KLMA 2QYGA 2P9LA 5BRHA 3MX2A 1CXQA 3BY5A 2QWOA 2EPIA 4NL9A 2B4VA 4U9RA 5ETKA 1CS4B 3MCAB 3BSAA 1AXQA 1Z1BA 2EC2A 1XSNA 2J8SA 1U09A 4YB7A 1D5AA 4Y2UA 7ICQA 1D4XA 1S8OA 3FRZA 2E6MA 3QNOA 3MGVA 3AL0B 2FVCA 1R8BA 3ETOA 4M5DA 4B3TF 2FUG9 4X2BA 4E7IA 1MC8A 2ZKUA 1O13A 4MYUA 2BE2B 1IBLK 1HWKA 4JOUA 2Z2YB 3OTOJ 3EZUA 2XMTA 2XHCA 1C0TA 3R1XA 3A2FA 2OGUA 4CZGA 2XO7A 4X4PA 4XRHA 4CF3A 5DB8A 2QO3A 5BPLA 1EIYB 3C23A 4HT7A 2KHQA 5CH7B 5DKWA 3G10A 1HRHA 4DV4J 3KG1A 2D0CA 1GLLO 4FWQA 2R9LA 1J5EF 1WOPA 1XNQJ 3SBMA 2I9GA 2BJEA 5KFYA 3LK9A 2R8IA 2NPIA 3AXKA 2F40A 5ETSA 4ZMMA 5A6WA 1KTQA 4ACOA 1IG8A 4WU2A 3TU5A 4CBXA 1S6QB 4AYBC 3VGSA 1J97A 5K14B 1YTYA 2VBYA 3DHXA 1WTFA 2K3IA 3NWRA 3FQLA 3GQCA 1CI4A 4RW7B 3I32A 2IHNA 4ZH4A 3BS5A 2HNYA 4FE3A 4X66F 5LXYA 1YJNN 4OZLA 4WF9L 2P51A 5FPMA 4FVUA 2ZZMA 4P2FA 4OI2A 2W7AA 3EGVA 2YKPA 5L1MA 3TFRA 9ICKA 4DZDA 1VDVA 3G6YA 5A8KB 4RO0A 4JRQA 2EG2A 1VQ6S 1KW4A 3HM8A 1B7FA 4XA5A 1YJVA 4JWNA 4LF9J 4CJKA 2JH7A 3KLIA 2X1GA 4FF2A 1V9OA 6FDRA 1HYSB 3MX5A 3TAMB 3ENVA 4PG7A 1S10A 1I1GA 1Z4NA 2XMVA 3TABA 3ENHA 4R65A 3JTNA 4M42A 1BY9A 4K8RA 3AA8A 1GLAG 3KWIA 3NAHA 5DM6L 3M8PB 2VQFF 4MH8A 2DKOB 2F96A 3QE9Y 3SD7A 1IBKJ 2EVZA 4IBNA 2KXNB 3DDIA 3IGNA 3OXGA 5FDLB 1NMEB 1MU2B 3RJIA 4R0EA 4G9BA 3AVLA 5A76A 5HRNA 1RU1A 2XTJP 4OL8A 2C2MB 4ECVA 4CGDA 4FJLA 3UN5A 3OXFA 3WK4A 4M3ZA 1N5YB 3N4WA 4NM2A 3BS9A 4PUOA 3HMJG 4OV6A 4PXBA 2A1RA 4EU0A 4DI6A 3C0BA 3BZCA 3GCXP 4X4SA 2MQ8A 3AQEA 3H8WA 4ECQA 9ICUA 2H3IA 3AM9A 3K4GA 2QWRA 1N4LA 2AH5A 3QGGA 1F2GA 2OPSA 3BH6B 3ILJA 3EPIA 1R0CB 3OT9A 2XS7A 2B56A 2CXYA 3W8GA 4F4YA 3EX7B 4DV7F 4FJ7A 2OM6A 2DCLA 4X64J 2N4DA 2CQ0A 5KAFU 3LANA 3VA0A 2XI3A 3K5OA 1E6VB 4C6AA 4ZTJA 3LZIA 3BSNA 3MM9A 4ITSA 3QEXA 3I76A 1VMBA 4I6AA 3W65A 2OSQA 3OBWA 1NDPA 3DDNA 4QS9A 5AI8A 2JEIA 1N5WA 3EN9A 3PO4A 4ZVSB 4F4WA 4CW7B 5HN0A 3M8QB 4CO2A 3OYJA 3OHRA 2XM3A 4F0MA 1QQNA 1RI7A 4LBIA 2J0SD 2XICA 3OTOF 3Q7BA 5FP0A 4KGKA 4IQUA 4NEYA 1NB2A 2BPCA 1OPZA 5ELZA 1FRMA 3KJFB 4EZ9A 4LR9A 1NPPA 1FJEB 1YAGA 5ETRA 4DV4F 3M30B 4NLKA 4HWIA 1XNQF 4NA3A 1X4HA 4JI7F 5LJWA 3CI5A 1D8ZA 1RNHA 2KHVA 2ZIUA 5KFNA 1Q78A 3OW2M 4TQRA 4BE1A 2EZXA 1KDHA 1NHUA 1RYSA 4KFBA 4DQPA 1I5OB 5LJVA 4M3RA 2MB0B 4UOCA 1N5XA 3NTUA 1Q4RA 2VQEJ 3GFKB 4PWUA 2IYGA 5J2QA 5D15A 5AQNA 4F2RA 4KX3A 1WNEA 3LM9A 3CMQA 1KQFB 5KG2A 3DLKA 4UW9A 1XMQJ 2SXLA 2XI2A 4PXDA 4CBWA 3QMQA 2DR6A 3O3GA 4N7TA 1F0MA 2MKCA 2ZTCA 4ECYA 5J0RA 3MFIA 1J53A 5DLGA 4ED5A 2WBMA 9RUBA 5DS7A 1A77A 1OH7A 3F5EA 2FBXA 3A8YA 1WYGA 4C8MA 3VAKA 3FFIA 4B9LA 3EICA 3EUB2 5CR0A 2GIQA 3I9ZA 1WAFA 2H5JB 3AMZA 4LF9F 1NKCA 2V63A 3AODA 2W7OA 4F5OA 3PR5B 1F9HA 4CRXA 5ALRA 2H48B 3CGIA 1K5OA 1LW0B 2K1RB 4WBFA 4M6WA 3MR2A 2O01C 1VQ6N 3JSMA 5LSRA 4ED6A 4KHNA 5I4MA 2XMJA 3NVMA 1LW2B 4CRJA 1IKWB 1NSPA 4ED7A 2W6LA 3EEQA 1HBUA 1V38A 4WP9A 4BACA 1KVBA 1A6SA 3L2WA 3CJKB 1IBKF 2HHXA 4ICLA 2C2ZB 3IDWA 1RG6A 1H38A 5AE3A 3H4BA 5B0AA 4QR0A 4JI8K 4TY8B 4BRDA 1N0UA 3AO2A 3M2RA 2HZAA 1VQOS 3FMWA 1WHYA 4TU8A 3HFVA 2DPJA 3G25A 2HKEA 4TSXA 2HHVA 1S6PB 3NVVA 2Q31A 5AM0A 2BMBA 4YOYA 4B3OB 4Z6CA 4D3GA 5AK3A 3UKRA 4K25A 1FE0A 1DRZA 2P6RA 3ATUA 2FTRA 3CMAN 3D6TB 1F5CA 5CXTA 4FLXA 4UB3A 1IV0A 2GQQA 2AYBA 1PK1B 5KG6A 2X3DA 5AE1A 2DTJA 5J2DA 3W9JA 1A0OB 1QE1B 3K57A 1N6QB 3UDCA 1IXKA 1GLFO 4X64F 1SH3A 1HHTP 4KKOB 1XR6A 2CJAA 2P2CB 3R6LB 4GMKA 2V68A 3U1LA 2K8CB 4JBCA 3NGZA 4C0HA 3AAWB 1TVRB 3AARA 3SQ0A 1IR2A 1JXLA 1CS4A 2GHVC 5DG9A 1HUOA 2DNRA 4CGJA 2KI2A 3D68A 3MF5A 4DQSA 2DNLA 4WXOA 2HQ3A 5KAKA 3PO5A 3QBCA 3Q8KA 2I9SA 2VKZG 3FKBA 3Q8RB 3N5FA 4JB3A 1KS2A 1X6JA 4OYAA 3W7BA 3GIIA 3LM2A 2HFNA 4FJ9A 4KH1B 2JRZA 2P9NB 1R6VA 4FJXA 5G5GA 1GOAA 2VPZB 4WU3A 3EM1A 2KL8A 2HIYA 5HROB 5K5MA 3NNAA 5CABA 1S12A 1DK2A 4KTZA 3RRHA 3J7ZT 4BG8A 3V4MA 3M2VA 3AH6A 5HSPA 4W92B 1C6VA 7ICPA 1TKTB 1G7CB 2VQEF 1MWMA 1ZQCA 2YKNB 3UXNA 1OQ6A 1Y9OA 4ED1A 2CNOB 1S6QA 2NYHA 2QB1A 3QT7A 1RHJB 3ZYYX 4EMDA 1XMQF 2K2PA 3IM9A 1SH2A 1RAHB 1PIEA 2K8GA 2RT3A 3OL9A 2ZM6K 4I2HA 4FK4A 1ZQOA 4W5RA 2FC9A 5GMDA 3SQIA 5KPRA 1QS4A 2MJUA 4CNZA 2LMIA 2FDRA 3EO3A 1I94J 4CDIA 5LL6d 4PY5A 2CPHA 3F0NA 3H2VE 1SJ1A 3HPHA 2EC0A 2GMLA 4KV8A 1LOTB 3MEDA 5ALOA 3THWA 3KHGA 1KD1T 5ALKA 2FBVA 4YHHF 4X62J 3WBZA 2OTLN 3CWJA 2DHAA 5IT9Y 1ZXOA 4DMNA 1HKCA 2WSCC 2YB4A 2RHSB 1WHVA 3PZPA 2NS1B 1RT6A 1WNSA 3ULHA 2GVZA 4RTFD 2E2NA 1TK5A 4FOEA 1BL3A 4US9A 1Q18A 4AHRA 5HMLA 1WJ9A 1NI3A 2BJDA 2DK2A 1U6BA 1NO8A 1UVLA 2R8GA 5DGBA 4Q2MA 2QFIA 3M8YA 2ZHOA 3RBXA 2J0XA 5J2KA 2DGWA 3KWMA 1Y64A 3U9ZA 2JR5A 4F3MA 5J2AA 2X1FA 2A6AA 5BJRA 5FJ4A 3AVIA 1CJUA 2M5YA 3QBWA 4OCZA 5L1LA 2JEGA 3MEEB 1EX8A 3WIVA 1IUJA 2H4WB 1RXOB 4NCAA 3C6AA 3A8IA 2GAGC 2XZTB 4B9UA 4M0AA 1KAZA 1S77D 4N41A 4F50A 2Z57B 1VQON 2JZ5A 3CB4A 1A7GE 1DEJA 4E0DA 2GVDB 2D1CA 2RF2A 1A0PA 1P1TA 2K7KA 5J2NA 3SBGA 9ICPA 1PYSB 3MXHP 1X40A 1DHMA 2WF7A 2RUSA 2ZUDA 2XZDB 1U1KA 1KN5A 4YQWA 1X5OA 3GMGA 3NCQA 5BR8J 4QU7A 5LOQA 3FC4A 1FRHA 1HUZA 4QZHA 3TA0A 1FD8A 1J5OA 1N34K 4V19S 2ZJ8A 2BCUA 3OQ2A 1FDAA 2ZH8A 2GGPA 1IKYB 2IHMA 1JRPA 1FFWB 5HP1B 2YQEA 5L1JA 2ZITA 2P9IB 1J9AA 3VGLA 9ATCB 2OLWA 1L3TA 3R9PA 4JB8B 4BRHA 5T14A 1WKLA 1KRPA 5EN1A 2QKQA 1FDBA 2KHDA 3T1HJ 1OYEA 1RAAB 4KLIA 3HBTA 4F93B 3KLHA 3ZX3A 1RYRA 3RMBA 4DU3A 4Z6EA 3WNFA 2P66A 1UJ5A 4JI1F 3O5BA 4FJGA 2FY8A 2V8PA 1VSHA 3ZSYA 4WYWA 1SC6A 5DK5A 3P4IA 4C4SA 4AH9A 4MF8A 2OPQB 2RS8A 3TTDA 3BM7A 2H65B 4UAYA 1X4DA 4WFNL 1UZDA 4OI0A 2LA6A 4PR6A 1XR7A 4DTPA 2BV3A 4MEXA 5C2CA 1VK3A 4M5GA 7ICHA 4NX9A 4A2BA 5CZVA 4AL5A 4H4MB 2B9YA 5GTHU 4DN0A 4XH1A 2IA6A 3LO3A 1REGX 1XBWA 7FD1A 4OJ6A 5M2RA 2Q0RA 2F1HA 5B09A 4ILGB 1KQGB 1I94F 3D2WA 4Z4FA 3SSSA 2O1PA 2HFOA 1X4AA 3M9MB 2RU9A 3M3ZA 5AKGA 3D6HB 3KYLA 4OPHA 1TQLA 4K5SA 2HFZA 2OMOA 4NLTA 3FMBA 2XLIA 7ICSA 2BCRA 4QZ9A 3MM7B 4EFHA 3WXJA 2HIQA 3S6EA 4B17A 4BCAA 1WCLA 2HMXA 2IOCA 4FZYA 4IKAA 4NO7A 1Y00A 3PEHA 1WSJA 1J2VA 2HBKA 1S76D 3D1QA 1LFPA 1ASVA 2V8VA 2XMKA 4QQBA 2BUPA 1I51B 3TWHA 4DV5K 3R5JB 1R0AB 2P9PB 3BF4A 4PCQA 2PI4A 2LYBA 1ZJNA 3SSQA 3AV9A 2EQYA 4K41A 1KHVA 3VPZA 2NRXA 1FE4A 3I0SB 1GMWA 3BO3A 3ZTSA 1Y97A 5AE2A 3TNVA 5EOZA 4BRLA 4XDCA 1V85A 1V97A 2KIWA 2W03A 4U7UD 3FDSA 2JMGA 3WXMB 2ZDPA 5CCMA 3ICXA 2V34A 2UP1A 2ISOA 2VB6A 4DOBA 2MSTA 3KHYA 4JN4A 1S4FA 2VHGA 4OZ1A 4CHNA 5KFOA 3D2FA 2A10A 4IG3A 1TVAA 9ICIA 3JAMY 4ISEA 4FZXC 2PI5A 4IG0B 5AKLA 4RR5A 5AQYA 1PYTA 2AU0A 3MR7A 3D28A 2RRNA 1RE1B 3CDEA 2DXEA 2F65A 3MUMP 4MMOA 4YDXA 2I6XA 3PJXA 1WKKA 4IOCL 5D46A 2NRHA 3TJ8A 4GO5X 5C2GA 5BR8F 1HFEL 1TGOA 3PJWA 1B3TA 2QLWA 2YNGB 1T3NA 2MLXA 1DLOA 1KOHA 1D8YA 1IKVA 5BXIA 2EAMA 3K2YA 3VOVA 4OHVA 1ZD3A 3TKAA 3C6UA 5M1OA 2CADA 4YY3J 4C48A 3VENA 3QO9B 5KFPA 3QEPA 3BQ0A 3W2VB 3GOIA 4IOXA 3K5PA 4P4OA 1C1CB 3L9ZA 4PG8A 2WZ1A 4FYVB 2CPFA 5CEHA 2E1CA 3VEOA 2B5JB 5BYQA 1IH7A 3T1HF 4JV5J 3ZSVA 3TX0A 1OYDA 4OLPA 2PMZC 3Q8LA 2EFPA 1WD6A 4EFAC 3C65A 2NCKL 4P74A 1Y10A 3P4UB 3KG4A 4DS5A 4RQ4A 2G2OA 2VG6B 5B0GA 1VAZA 3R5AA 1KQSR 4DPYA 3HD2A 2I6WA 4GIBA 4HLBA 5A8RA 4K4XA 1CPZA 2VPXB 3D1OA 2OI2A 1PJ7A 1YBUA 2MJNA 1IKXB 3T1YK 4F4ZA 1S9FA 3PX4A 2JLFA 2G2ZA 4RUBA 3VF6A 2L48A 3FGVA 3J7YU 2HZCA 2IVOA 3V5RA 4TY9A 4RNHA 1YG0A 3VGKA 3K17A 4PHTX 2BX6A 2PEHA 4FF4A 1PBUA 2PYLA 1RM6C 3PW0A 4CTAA 4DCPB 5EXWA 3SQGB 4R5PB 2FIUA 3E9LA 1U1MA 4JKBA 5JU5A 2UYTA 3K2PA 4NWBA 3OVBA 4P2XA 4I4BA 4DV2J 4JK8A 4Q7AA 1NDLA 4B9MA 4J9OA 2QE5A 1N56A 2O8CA 4NCGA 4CFDA 3QRPA 4HYKA 4DXLA 2RMLA 2JH1A 2GX9A 2NPFA 4LF5J 4RWXA 2C3UA 3N97B 3DLGA 9ICFA 5I9EB 1PILA 4FWLA 2D3DA 3PXGa 1S4EA 3C2KA 2VFSA 3W5XA 1CZ9A 4JLHA 5C5JA 2J7UA 1XNRJ 3DM2A 7ICMA 1VQNS 4P75A 2CJXB 4KHPK 1JLBA 4J2AA 4KTQA 4CFBA 2W25A 1VLBA 3B9JA 5KFMA 2W2MP 4ID5B 3P3DA 3RBZA 3JSBA 3PDNA 4M1KA 1XTZA 2XC9A 2CGLA 2YWEA 1O08A 5M1NA 2JC0A 3KK2A 4ZPBA 2HVDA 1VQPS 5KFRA 5C24A 2XWYA 2P9UB 2E5IA 2M52A 2CPEA 4IQVA 1E4GT 3KMQA 1CUKA 1ILYA 4J03A 4PABA 3RUBL 4OMFG 2H3GX 3HM9A 4KN4A 1DY3A 4LSLB 4YMMA 4ZCLA 5GIPA 3Q7CA 2BJ3A 1ZYQA 4OYBA 3L3FX 3FZBA 3D2QA 3V4IA 3D1HA 2DO0A 2UUBK 2FDNA 5F9LA 2QT7A 1SVDA 5DG8A 4KO0A 4C0OC 4DUZK 3W63A 3C8YA 4G1QA 2WTUA 4CEBA 1RADB 3KKAC 4L74A 2PEBA 4Y3CA 4EYIB 5EUHA 4KN7A 3PJ9A 3QUBA 3ZT2A 1N5QA 5KFSA 3OYDA 3B82A 3OYCA 5J0XA 3KKAA 1EXNA 3MMBB 3OJSA 4YY3F 2GIRA 2XHWA 1DBDA 3H0MB 4QIWC 2QSFA 2HW3A 1R8HA 1T94A 4UUWA 1NWKA 5GINA 5MLCV 2HSZA 1Z00B 3ZTOA 2DPNA 4DL0C 2MQNA 2FHOB 4DR6J 4ISGA 1VISA 3MDQA 4HVZA 3DYAB 3EL2A 3EGZA 4KGVB 4CK3A 1ZS6A 2BPFA 2AEJA 2OJ3A 1ROFA 2EAPA 2A42A 1CLQA 4DSEA 1NKEA 5H9EK 4LVSA 5HMMA 3FZHA 3D67A 3GV7B 2I38A 4ECSA 4IOAL 4DR2K 4RWWA 3X1LB 2FJAB 4DR3J 4LBHA 3UB5A 1BI4A 2IFXA 4ECTA 4Z0UA 3LDSA 4MIAA 3WXLA 2A1JA 4LREA 4PYDA 4ZJQA 4ZS6A 3SENA 2I5JA 5AQXA 3L4BC 4GVEA 1HKGA 1N5TA 2W7PA 2HRYA 2AYGA 3CD7A 4A8YA 1ITPA 1M1KT 4KLGA 8ICHA 5J1PA 4L6V3 2BABA 3R6GB 4Y2VA 1SXDA 2F8KA 3CDAA 3NMUA 2K4HA 2FZCB 2XRIA 1ZM3A 3GE9A 2DEJA 3K7RA 2GX8A 4TYBA 4C1NK 3CF5Q 1ZQPA 2ZJQQ 2KJ5A 4FBUA 2XHBA 5L9NA 4WZMA 3QIDA 1JXEA 2UXBK 2V52B 4DO9A 2HWIA 1S9GA 3TACB 3OFGA 2NO5A 1KKXA 1PAEX 4DV2F 5SZTA 1YRTA 3HJFA 3QT6A 4C4RA 4F9OA 4LUBA 3TZZA 4B3MJ 2NRRA 1I6JA 1UWBB 3MM7A 4Q0BB 2JGUA 3AAPA 1N88A 3ZZOA 4JS4A 4PPDA 2AGPA 3V6KA 4XTTA 4U95A 4OYPA 4F4XA 4EK2A 1XNRF 1XJWB 4I27A 4FWOA 3MCNA 1ESVA 1P9QC 1GXTA 2LEAA 2GV9A 4O8UA 5I3QA 2K60A 3O9SA 1V5VA 5HVFA 4ISFA 3NDKA 1S1XB 3M6VA 2EANA 3OR2B 4Y2RA 2W24A 3RU0A 3BSCA 5F1XA 4A5AA 3ENOA 4ILRA 4FSVA 1NGHA 1RWWB 4F0HA 5AI5A 3LTOA 1QQOA 1KC8T 1RAEB 3FQKA 4O55A 1VQNN 2UUAK 2H54B 3PIPQ 2FE9A 4K5RA 1RJJA 2WF8A 3VF0B 1FEHA 4JI4J 1SKWA 1GTEA 2IM0A 4I1TA 5CYJA 3KJVB 4FLUA 1VK8A 1T03A 3O1LA 5A0LA 1TKDA 4LF1A 1FW6A 3I56S 1HPMA 2H3ZA 2MXYA 1VQPN 4USUA 2LCWA 4IG0A 3UD5A 3AO5A 2HMIA 3GCWP 3P49B 2BANA 5C42B 3KLEA 3R5CA 2Q6BA 2IYIA 5DRKA 2QA1A 5J2GA 1HLWA 3ZXWA 2V8HA 1UEVA 2Y1RI 3C14B 2BHNA 1NGGA 5GADU 5AXKA 3QUQA 2FMQA 2P9SB 4DX7A 2VG7B 3PM9A 5KG3A 5ALDA 3CCZA 4RJVA 1SV5B 3TWZA 2RB7A 4CWBA 3KWGA 4LRBA 1BPBA 4DV6F 1ZXIA 2YCHA 5J2MA 3AA4A 3VQEA 2I5HA 1AQ6A 1GFWB 3LZJA 2KFZA 1V9PA 3M8RA 1C20A 4BGDA 2HURA 4H5WA 1N33K 1JLGA 3TPQA 5EWFA 2M0GB 2PSZA 1T05B 1T0TV 4YB1P 3PX0A 2M2BA 4FPAA 4FZZA 4JEPA 2ZGYA 3CW2C 3FZLA 3HVWA 1M90T 4GLXA 2B9XA 4N56A 4WJ3B 5FROA 3AFGA 4GKKJ 4KSEB 4KLUA 5C15A 4D3HA 1TL4A 2LXIA 4XK8C 4WKYA 1Y3KA 2E5GA 2KJ9A 4NLYA 3RJMB 3NFAA 2ITGA 2A1AA 1B0TA 2VDIA 3GIRA 3I31A 1NNEA 3GFYA 1SQEA 1IKXA 1WF1A 4GC7A 7ICJA 4ANDA 3CPEA 3D66A 3AD9C 3A1YG 4JHDA 1FFVA 2CXEA 5C2FA 4E7HA 2KSOA 3UMCA 2WF9A 5JRTA 4KHMA 3SI6A 2K8BB 5BPNA 4FZMA 3VAFA 2R2SA 2NSCA 4IQMA 3LP3A 2WHOA 3NY0A 2CGKA 1FERA 2BJ8A 3MK6A 1DT9A 4DV3K 2YN4A 2YKOA 2HVZA 2R7OA 1ZQGA 4LFBF 5AQHA 4JAXA 3U1NA 3TAFA 3M05A 3MM8B 8ICMA 2H5IB 1S7HA 1RCHA 4RQ6A 2DRDA 1GOCA 4PWDB 4DX5A 4B3MF 3C66A 1RBAA 4A8MP 4MYTA 4QWCA 1EQ0A 3PW2A 4ED0A 4NLSA 2FGCA 3SV4A 5F9NA 1TL7A 1G6BA 4HTUA 3R9KA 2A5XA 4GVBB 1YUWA 4BGAA 4MKBA 1FVSA 2GNKA 4UOHA 4C7ZA 3ZSXA 1K8KB 1X66A 4KT0C 2XMMA 4BDYA 5I3PA 3MM6A 2H9ZA 1SZ2A 4CH1A 1RT5B 2P9KA 1HQEA 5AZIB 5IZHA 2E9RX 3HSCA 1BDGA 2PE8A 1S1VA 2ETJA 2EBGA 5KFUA 5HR6A 2E2OA 1NGIA 3PCOB 2FHMA 4IXCA 1AT1B 1D8LA 5AQFA 4IRKA 3HKWA 5BPCA 2YNHA 5AKYA 2YWKA 5BRFA 3FNNA 5IV3A 1VYAA 3IWXA 4OYMA 3SCXA 1Q46A 4Z4IA 1UEUA 4YG2A 3DRRA 2DY1A 4J8FA 3Q2TC 4EP5A 1MMLA 4M9LA 1U2VB 2YHYA 4KGZB 2G13A 3KZIU 2XMUA 2Z2LA 4OHWA 1FO4A 1WCNA 3DOLB 3BEGB 1SL1A 1X4GA 1COOA 1TAMA 2X51A 1IG9A 2YTCA 1J2MA 4KLLA 2QLTA 1VQ9S 2V67A 5ALNA 3TSPA 4UB6U 1JCEA 1KFDA 1LNQA 5KT4A 5HR7A 4DSIA 5AI6A 4AM6A 2VC1A 3NGYA 1LOUA 2W4CA 2ASMA 2CPYA 4P4MA 2F8MA 3HXMA 2XLJA 3MDCA 3MR6A 3J80U 4I9LA 2W2OP 1UFWA 1VJWA 4F3QA 5ALXA 2AGQA 1DK3A 2A19A 2NV3A 2FBYA 3DYAA 1F9EB 3KOAA 4NLCA 2VF3A 1DAXA 3MOZA 4RNFA 4I6YA 2DH7A 3EDQB 4CHZA 5D4NA 4BRCA 3UWTA 3ET6B 1JLAA 2ILZA 4OYIA 3MM5B 2J9EA 5K4LA 3KHRA 3GDQA 3U6FA 3LP1B 4LRFA 4GKKF 7ICVA 3L3UA 4CJ5A 8ICEA 3G87A 2WFBA 2IDEA 4MLEA 4DOZA 2RIJA 3AVCA 1UKUA 4EWTA 3JYTB 4DV1J 4RW4B 2DFHA 2VJUA 4CM0A 8ICGA 2QL9B 3V1RA 4GV3A 3JXUA 1RFQA 3MXMA 4DKWA 2ZEJA 4K4GA 3MBYA 4MN4C 1U8SA 4Y0WA 4B3SJ 2GUPA 3GSDA 1HBMA 4QBUA 1BIZA 3CQXA 3RYLA 3LP2A 3PW5A 1ZQHA 3UO0A 1TK8A 4NOHA 4QIVA 2FJ6A 3B8HA 1SIWB 3ILIA 3QINA 1H3DA 4ANCA 1M5VC 2ZXHA 3G71S 4K4TA 2LFVA 1UWAA 5AT1B 2QWLA 5IM0B 3CCRS 3WK8A 3BKFA 1ZZNA 2BQRA 2HVIA 3ZD8A 1U1OA 3LDQA 2CG4A 1MW7A 5EVZA 5F3TA 3C7NB 4AT1B 1EARA 4AL6A 3IHQB 3PMNA 2HSEB 1RTDA 5HMYA 2RU3A 2RE1A 1N2XA 1K47A 3B6OA 2QKKA 2F9JA 3O6WA 2KV2A 2HS3A 1T6DA 4M9NA 4NI2A 2HI0A 3V6HA 1RTJB 2Y3YA 1TAQA 3EE9A 2W4PA 1ZJMA 1LCUA 3RJGA 1X9XA 3OTEA 1NZPA 3SMPA 2YNIA 3CXCM 4ZVQB 1UJ6A 5FD1A 1YXQA 1HNZJ 2H3EB 3QZ7A 4O3SA 5KL1B 4DOCA 3NH1A 3SCLE 2R2TA 2R7YA 4F25A 5GAEU 4O4RA 3M6XA 4KB1A 1RWVB 4IS7A 3HHLB 2I7PA 2B7CB 3K0SA 3O6QA 1EETB 5GAHU 2MDAA 2ALZA 1SJQA 1JLFA 2KLAA 1SB6A 2ALYB 5KFVA 3QEAZ 2Q43A 4BRAA 1V6HA 5DDRC 2VV5A 7ICTA 2MSSA 3CM5A 3QU4A 2LLZA 2G5HB 3N0VA 4BC3A 4KHUA 5E3PA 3CCMN 3BKTA 2V8GA 1ZPVA 4X62K 2QMUB 3QNMA 3KK1B 4DR5F 4LF2A 5KFIA 1NBWA 4BROA 4JK1A 2VUGA 3MTKA 3P1GA 1W7WA 5LMNJ 3PRVA 5DZ7A 2D8CA 4UBBA 3SV3A 3MDAA 1C4AA 4IDKB 2C2DA 3OPKA 1NLVA 4M5JA 3C16B 3IXQA 1GX6A 4CJRA 3C15B 4PQUB 3P6YC 1ICEB 2OFHX 4BDZA 4NMXA 3PYFA 1TV6B 1VQ9N 1O03A 2Y0BB 1KVJA 4KAZA 2IMOA 4OYXA 3EGNA 2K4EA 5DBBA 4CZJA 3UN3A 2E5JA 3KHHA 2WB1D 2CG8A 2J8AA 2E8MA 2IJRA 3JQJA 1QUPA 4ZVPB 4CEZA 3J80O 2CPJA 3VEVA 4ZLJA 4YN4A 3F73A 4ER8A 2FJDB 2ZJPQ 3SFGA 4C97A 4DX8H 5LJ3Y 3DI6B 2EHGA 5AQVA 3UM9A 1NK7A 1C0GA 2KG1A 1HHSA 4OVLA 4OZ3A 2BOAA 2FVRA 2BRKA 4DV1F 2B8QA 4J9UE 5AXLA 3CFOA 4A61A 2QMXA 4FWSA 3S7RA 3K0JA 2KVSA 2P6UA 1S5ZA 4O5FA 3SPYA 3V9WA 3NGIA 2DEIA 4M9HA 4B3SF 3OYIA 2M8DB 1WSGA 2YJFA 5HJXA 3MFHA 1ZQVA 1VOMA 3IG8A 2W2PP 4ZDNA 1TUYA 3GV8B 4IQWA 1K1QA 2WB1F 4KGMA 3BGFA 3MWPA 9ICRA 3KKFA 1WSFA 4FJ5A 2MGZA 3MMVA 5KFJA 2KNJA 2OZSA 4RNMA 2O8DB 4F4AA 4NLZA 4O44A 1LXJA 3NS1A 2XMAA 3DCAA 3ZSWA 2E7XA 5AXNA 4B1WB 1QY7A 1RK8A 3G71N 3IA0A 4LVOP 2ZF5O 1EP4B 4FKXA 2A6MA 3VQAA 3T5HA 3H0RB 3K9KA 3G86A 1NPKA 4DV0K 2M7SA 2DFLA 1YVFA 3IR7B 4DU8A 4ZHRB 4PHDA 3CCRN 5ALZA 1R0BG 5DDPC 2LP4A 3I6PA 2O8BB 2RAQA 2VKQA 4NLQA 3ZZRA 1K44A 2NUUG 1Q5VA 3KMSA 4OYZA 1Z2ZA 5F2RA 3NCRA 1RT5A 2NZ4A 3CJ2A 2WVBA 5C25B 3NF7A 4Y2PA 2PYJA 1HNZF 3TUJC 3QBXA 3HI9A 4C8ZA 2C2OB 3HRGA 4NRUA 2JV3A 2MEWA 3G82A 3TI0A 3SQOP 3O4WA 2HBYB 4DG1B 3P38A 2C42A 4UAVA 2IVMA 2IRYA 2ZC4A 2HFVA 1QD1A 2VOOA 1QDUB 1RDWX 4OZ0A 8ICXA 3RW7A 2LQJA 2PO4A 4H5RA 4RKUC 2J76E 4G3IA 1WDDA 4O4GA 2QW9A 1FKPA 1YWXA 4ZVEA 3QAUA 4MDAA 3CQ8A 4DPWA 4Q8EA 3DOLA 3GZFA 5DBCA 5LMNF 1SCJB 5HHHA 2CA9A 3V2UC 4FM1A 2LDIA 4NLDA 4NLBA 2OSRA 4JV0A 2LYAA 5J1EA 2ERRA 2CQBA 2X7IA 4LR8A 2ZDOA 2VH7A 1U0HB 5GAGI 3SXLA 4LF6K 4F92B 1N36F 2FSJA 4TLRA 5HBMA 5IIIA 3DGVA 1WSVA 3GZ7A 2GMJA 1M6YA 2VFUA 1R8PA 3U1MA 3UNYA 2MUTA 5LMUF 2P9GA 4IKFA 4DOAA 1RAIB 1SJRA 2W3SA 1RLCL 3PRBA 3MECA 2RQ5A 8ATCB 3JTOA 1RWUA 1H73A 4ILJA 1Q53A 4ZLNA 1Y5IB 5DMRA 5IFMA 1BVSA 1W2BR 2P6TA 2KT5A 3DMJB 1M5SA 1NDKA 2MZTA 3ZFVA 4IEIA 5HO4A 2UZAA 3JYTA 1PBAA 2GO9A 4MHVA 2BQUA 2LYVA 1X4FA 5HATA 4EUVA 2Y1IA 2D7SA 2HPUA 3S01A 2ZH9A 3IFEA 6FD1A 3WDOA 3GLJA 2A0FB 3H5YA 2GLEA 1R27B 2ESEA 2CYYA 2B8PA 4MIWA 2L41A 2WFAA 1UFKA 3W5ZA 3CC2S 5DQHA 3PIOL 4DTSA 1FIQA 2HYIB 2JWKA 4Y2CA 2M0NA 2BE7D 2DFFA 4TNOA 1DURA 5I3UA 1SKRA 2MHEA 1HNWJ 2KB2A 1QZ6A 2AYEA 3I0RA 1VSDA 3M6WA 1PC5A 3H7IA 1S6OA 1D9FA 4X4UA 5U47A 5LM7E 3C46A 1B0VA 3ENAA 1XS9D 1C0UA 2MZRA 3MWTA 4JV5K 3AXMA 4B6JA 1FKOB 4NZ0A 3E01A 4RBUA 4IFVA 2QIFA 2E1ZA 1K8AO 1HX1A 1ZA2B 4NYFA 3OTBA 2UUCF 1X2IA 5KG1A 2RVJA 2AJ0A 4PL2A 4NLVA 1DTTA 4RQ5A 2RHKA 3OY9A 1QLNA 3TTFA 3BN4A 3R3LA 1YJTA 3ZZYA 4F5PA 1RXWA 2DHGA 2PDAA 1VQ4S 1G3OA 1HNXJ 3VESA 2CH5A 5J1NA 3JSRA 1O1WA 1YJUA 4YMOA 3G8SA 3VN5A 4AILC 4KRWA 3VV2B 1FK9A 2VG5A 1ZQUA 1YX2A 1E6YB 1Q8BA 4H54A 3ZDBA 1K0VA 3BR9A 4I7FA 3UMGA 3CT9A 3BR8A 4M7XA 3HVTA 4IDHA 1HNIA 3W62A 4ZVOB 2DR5A 3M9OB 1O51A 2B6AA 4A8EA 3TJ9A 4CQ1A 4O0NA 1Y88A 4B9VA 3Q8PB 4UB8U 4YDUC 2LXFA 3D7SB 2MYFA 4KLSA 2IOFA 3FC9A 5BN9A 3BZQA 4RBTA 4FPBA 3HZ6A 4YDUA 1WI6A 3DRPB 4BRQA 5KOXA 1ZD5A 2HNDB 2DT9A 2KVQE 4EX7A 4FF1A 3BQ2A 2FHJA 2KVIA 1DFDA 2AGOA 4PH5A 3RH4A 1XHXA 4LF5K 4P2SA 3RB6A 1ED1A 1ELOA 1GTHA 3KJQB 4ZPWR 5ETLA 3ZETB 1HUXA 1FX4A 1H7WA 4AHSA 4PZVA 2PA3A 4HDHA 3FCHA 2XB2D 1S5JA 4CZEA 1Q86T 1T3VA 2V6AA 2HBQB 3PFEA 3ILOA 2ZIVA 2MLYA 2NRZA 3WNHA 2DBYA 1U24A 2BA9A 4LBPA 2PGCA 4DTJA 1VIXA 3G6VA 3ZC4A 4GKJJ 1HL6A 1TL3A 4CHQA 5KPTA 2V4QA 1N5VA 2YXLA 2EI5A 2PBDA 1T4GA 1ZD4A 3RRKA 3JPSA 3UCUP 1XO0A 5HAOA 2HHUA 2JZBB 1GMUA 9ICGA 1WSRA 5T7LB 2UXCK 5HVGA 1F3VA 2W9BA 3A5OC 4ZCKA 1F5AA 2Y0SC 3D2NA 1HR0K 8ICWA 3HW8A 1YHQS 4ILLA 1L7OA 1W25A 3VTIA 1XSPA 3RB4A 4YR2A 2ZBCA 2MHNA 3EUNA 3D2EB 4Z4CA 5JTIA 3S41A 1RU2A 4CT8A 2ZIWB 3IMXA 3H45C 4GVLA 1CZBA 1FXLA 1PVQA 2W01A 4CJVA 4PG5A 3DXBA 3RVCA 2QA4G 4KH5A 3QIPB 3JQMA 3MCPA 5G0RA 4MEYA 4LF7F 4KITB 2OYQA 2JLGA 4GXIA 1WUAA 2NZTA 3J7A1 1TKXB 4LF4J 4XPEA 3W9IA 2K4PA 1JCFA 2ZE2B 3IMQJ 4Z6FA 1ZQIA 1BQNA 4LQ9A 4OO1J 3SFUA 4ELVA 4OX9K 3KLVA 3DOMA 2HZVA 4DR6K 1XN9A 1NHVA 2QXLA 2MKHA 2JXJA 3CC2N 4F3TA 1JJHA 4CIGA 4RW6B 1NH7A 3FE1A 3T3FA 1LEOA 1T3QA 3I5CA 4J9MA 2EFNA 4O5KA 1YZ6A 2NREA 4QZVB 3GSIA 2HS4A 4HR2A 3M8ZA 2HQDA 3WEEA 4DR3K 4C8YA 2D4WA 4WWSA 4AF1A 3HCXA 4KPYA 2HB5A 4JYAJ 4M94A 3TZXA 2R2UA 3HSZA 1HNXF 1VK0A 1VLOA 3A8KA 1JQGA 4U67L 1LK5A 5KG0A 2FLNA 3VC8A 4F71A 4DR1F 1S3XA 3ZSZA 4JI5K 3NKYA 4CLWA 5T7BA 1QVFR 1HBNB 1P1LA 3PYDA 1BXNA 3GJRB 2X6NA 7ICEA 2QC3A 5L8RC 3OLAA 2E8PA 4ANEA 4NYNA 4B1ZA 2W42A 5H9FK 2EFVA 2E44A 2ZD1B 4J2BA 4F02A 1U48A 4OKJA 4DFJA 3JTPA 1JLCA 3DKDA 1HPZB 2KYXA 1P9YA 2ZTDA 3EMTA 4WE1B 1RCXB 2U1AA 2HHTA 1RDAA 4YMNA 1LWEB 2NLXA 1N32J 3Q0AA 2IAJA 7ICRA 1S79A 3AOAA 4JKGA 4K2JA 4QZCA 1VIOA 4AQYJ 2XVTA 4MAKA 2KKPA 3EWAA 5G5HA 1ZOLA 3AT1B 1UVIA 3GG4A 5DLFA 4LSNA 2N1RA 4RQ1A 3QDKA 3ASMA 4R8UA 4AHCA 1KKHA 4GVMA 3ALYA 2Q2RA 4PHAA 4BVOA 5SWMA 1BQMA 3ID6A 4DHYA 3R2DJ 2PY5A 3THXA 3H8JA 2V69A 5IINA 2JVOA 4ZOSA 1TELA 4DX6A 4CESA 7ICKA 4FP9A 5D3GA 4WCEQ 2B21A 4TKTA 3TYTA 1WC0A 2FLPA 2KG0A 1CULA 4GKJF 3HZEA 3M1VB 4NLRA 4UZCA 4ZP6A 2KHOA 4R0JA 3P96A 3O9TA 4FZLA 2P9CA 4M3TA 1EKRA 1VSMA 3B4DA 4Y0FA 5J0UA 3ZSQA 3D2SA 5KT6A 2YWFA 2VKRA 4JI4K 5AK4A 4QZ8A 4K4UA 1PC4A 4RW9A 1S1WB 4IL6U 4B3RK 2Q3PA 1NK6A 5L38A 2DITA 1LWFA 2QV6A 5E2QA 3CCSS 1ZH5A 5ALHA 2LM4A 2GUIA 2V4JA 3UI3A 5ALWA 1ZRNA 3POTA 3PW4A 1AYEA 1CG2A 1JNZB 1PAUB 2B7BB 2VGNA 2GMHA 3WKEA 3H5XA 1AA1B 2HHPA 3TTCA 1TL1A 1YHQN 1L7NA 2IJFA 1RQ0A 2J0QD 2ZHAA 1KLMB 1JKHB 5KFGA 5BREA 2P9LB 3CPWM 3V7JA 1B4FA 5ETVA 5L39A 3RJKA 3N4PA 2C3YA 1APSA 1KSPA 5IXUA 4O23A 2M8HA 2WW4A 4CEOA 2WBRA 1FJGJ 2Q6CA 1URJA 1YBTA 2BRLA 2ZUGA 3DDHA 3BGUA 4M5DB 4TXSA 4QW8A 3L0QA 3Q8SB 1RHMB 2BXJA 4ZP8A 3AUOA 3D5MA 3D0GE 4PKDB 1C0TB 4CZLA 3T5KA 3Q8QB 4H4OA 3E0FA 1FX2A 3DU6A 2HHHJ 3NCIA 4CEFA 4RQ3A 1DARA 1QVGR 3WK6A 4ZLLA 2HK3A 4I64A 1UPPA 2DKZA 2GQ2A 2GJFA 3LAMA 4UQTA 1TFRA 2CQ4A 2MQMA 2A2CA 4C4TA 1T02A 4K4IA 2YH0A 2HQGA 3HTVA 4QOTA 3A0IX 1QTMA 2BM1A 3SSRA 2A40A 3PNIA 3TQ1A 3A3PB 2QTDA 3F9MA 4WK3A 2YHWA 2QB0A 4HAIA 5H2FU 2X1BA 1FRXA 2E8NA 2F76X 2DGOA 1S7IA 4ECZA 1BGXT 3BS5B 4CJLA 4WP8A 4QW9A 2R7TA 1FDNA 4QCLA 3O44A 3LYSA 2CRXA 2Z0GA 1L3VA 2B43A 1OKJA 1QSYA 3FUYA 2CQPA 1SXLA 5CA7A 2E2PA 2MTLA 3E51A 7ICFA 4ZN1A 4TU7A 4CO1A 1ZBLA 4O5CA 4PGXA 5IIMA 1N32F 2QARA 5DDOC 3OA9A 2WF5A 1RTIA 4LH5A 3TA2A 4ETZA 4RUHA 4LFAK 3KLIB 4CF8A 4AQYF 2CQDA 3QEWA 1WSEA 3T6JA 5IT9U 1BCMA 5FPEA 1BQXA 5JS1A 2OZMA 5IC6B 4RU9A 1V4TA 3RMAA 2AJFE 2HF3A 1UPMB 4I2PA 4WFBQ 3ZDEA 2EBEA 9ICEA 1ZA1B 1FTCA 2ISPA 3MEGA 5MAOA 2IBKA 2AIRB 3MAAA 2WONA 5EX0A 5DB6A 4DEZA 4JI6J 1S0OA 4HVJA 4IUFA 3MUTP 7AT1B 3FEYB 1ZBUA 1VC5A 2E7VA 1U6FA 3L7OA 3SAFA 3AVMA 2DYAA 5ALLA 1X8DA 2NLWA 1XMOJ 1JLEA 3FZFA 2W55A 1NUEA 1Q81O 4RQ0A 2DIUA 2E4LA 4QIFA 2VIXA 3ONQA 1FFSB 1VQ8S 2VANA 3VHQA 2XWXA 2Y1JA 4K0KK 4L75A 1ZQAA 4PUOB 2OPRA 1WG4A 3A8JA 2GFFA 4ECWA 4B9SA 2JRSA 5ALQA 2QWMA 4FLVA 4DUYJ 2DFEA 4NLNA 3MXJA 5HMXA 4OLAA 4QYRA 2OPSB 2ODGA 2IMWP 2IDOA 5AQSA 2I1QA 3OPXA 1RPLA 2KOBA 3RBDA 4FXDA 2KJ8A 4C0ZA 1KXPA 1TFWA 2D9OA 4IZ9A 3CCSN 3WZ0A 4UY85 3L3CA 5AHXA 2Z4PA 3KJNB 2D41A 5EE9A 4FW1A 5AI4A 2G8HA 2ZWOA 5D0HA 2CPXA 1VRTA 2ASDA 4CGHA 2UXDK 4JI0K 1FJGF 1Q79A 3ITHB 1J27A 4I67A 1U2RA 3CRXA 3TEGA 3OYMA 4M9GA 3HSTB 1F6TA 3F2DA 1B4SA 2KN4A 4TN2A 2YX1A 2YKMA 3J81Y 3F9KA 2VBWA 4JV2A 3CTRA 1RT7A 3KG0A 3LP0B 4YD1A 5KRTA 2QSWA 2D69A 3P31A 1RISA 4CF4A 1ZRMA 2JJ4D 1OW5A 3ZSRA 2K7JA 3KUGA 4LFCK 4XAKA 3I4PA 3R5BA 3AN1A 5J2JA 1FCAA 4HEA9 3TEHB 2ZIUB 2ZFHA 9ICVA 1S9EA 2N4CA 3SUNA 4C8NA 4KFBB 1ZZFA 3WNEA 4BC2A 4DR7K 2JH3A 4F67A 2CZ4A 4X65K 2FPKA 3RZAA 4K7QA 5J2QB 2OO4A 3RH5A 3MCOA 3AB4B 3DLKB 2ES6A 1XR5A 2Y0SD 4ZIWA 2P1JA 4JNEA 3TVKA 4NYPA 3KTQA 5HQMA 4NEZA 3GBTA 3MDFA 3NVZA 1HBNA 3NF8A 1WHWA 4IOBA 1DJ0A 4Z7CA 3BJYA 4BRNA 1RBVA 4FO0A 2XULA 5A0YA 4YFKA 3VGUA 2EWHA 2GCFA 3PVXA 3ZCMA 3FFIB 2JDJA 2VOPA 1HNVA 3OBIA 3M9NB 2D6FC 2KYZA 5IIJA 2POKA 3AGRA 3NHGA 2F9WA 4QAGA 4YD2A 2VA3A 4ELUA 3B6PA 2FXUA 3QNWB 3EJMA 5EE0A 4M6WB 4PEOA 1GOBA 3JSMB 1WC5A 4YOEA 2GELA 1Q1KA 2H3VA 1RTHA 1I3OB 4Z37A 4OFZA 1X9JA 2MA1A 2MZQA 3TZWA 2Y0SF 5JS2A 2WOMA 1HBUB 5ALEA 2R4FA 2IM2A 4PXCA 4X4OA 1N54B 2H1YA 5IT9O 3K75D 2CZ9A 1O8BA 1XHZA 5BPMA 1LAVA 3OS1A 4ICLB 3RAMA 2G08A 5KAIU 1EHWA 4K4HA 3M1VA 5KOWA 2N7YA 4QZDA 1DRGA 2AV5A 4E2FB 4CLLA 3M2UA 3RF9A 4PGQA 1MQ3A 4M41A 4CZIA 1L3UA 4BRIA 3DLHA 3DLRA 2W1BA 3MMAA 2E1RA 2D0PA 3TUIC 3UE2A 4BGBA 2CQ3A 3GDXA 4JI3F 3MD3A 2FHKA 2XQCA 4UY8O 4X4RA 2VBZA 4IO1A 3JAMU 5M2PA 1MMNA 5L9XA 4OI1A 2PAVA 4R64A 4NXNF 4G65A 2R3VA 1IV8A 1D3WA 3WC2A 1WG8A 5GVQA 4M5IA 2ZH3A 3K58A 5IWAF 4EENA 4EI2A 1REVA 4JKCA 1IBLJ 4LZDA 1BOTO 3L4PA 2P8IA 5KTQA 4DV7J 1KOOA 1JKHA 4DR4F 2OEJA 3LPUA 1IG6A 2IC3A 1NJXA 1T9VA 2BPGA 1IBMK 1M5KC 5GMEA 1JB0C 1VBXA 3BO2A 2CJKA 1UJ4A 3AY9A 3TW0A 1RBUA 3GWCA 5FPNA 1B43A 1NEEA 5GMKa 3HL8A 1HBOA 2QLFB 4ZVFA 3NVWA 1D09B 3I8BA 3NH2A 3ISND 4WXWA 2YI1A 2Q79A 3ZNUA 4URGA 2KO1A 3H4DA 4EGLA 3THVA 3DLEA 2AJQA 3ZEUA 1X3MA 3PTWA 1DTQB 4JI7J 3M2VB 4K2XA 5KFBA 2XLKA 2ZWHA 4IOAQ 5DO2A 2BKNA 3R27A 9ICWA 4RPYA 3SJJA 2AHOB 5AIAA 3CFPA 4U6PA 4IEEA 4Q44A 4DU7A 1WEZA 3DLLQ 2JWLA 4BR7A 4OJ3A 2VICA 3ICLA 5GAGP 3J7Z5 3NS5A 5AFUH 2FC0A 3U27A 2ZG6A 3C6HA 3C5GA 3S6JA 1C1BA 4P2HA 4KV8B 4FLYA 2E5LK 3MEDB 3THWB 1SS6A 3SQ2A 1EAYC 1LB2B 4KI4A 2L5YA 1HWUA 1NAQA