3TARA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-6) position
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
molecule tags Transferase/dna
source organism Geobacillus
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tarA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tarA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tarA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tarA01
4O9MA 4J2EA 5JUMA 3K5NA 2O4GA 3V9WA 4KHWA 3JPQA 3ZDEA 4DF4A 2BANA 4QZHA 4KITB 4KMUA 9ICEA 2FMPA 1HYVA 5J2GA 2ASJA 4RQ3A 3OS1A 4CEZA 3GV5B 4W5RA 3NAEA 3LP1A 1TL3A 4RU9A 5KFVA 1SV5A 2OPSA 1ZETA 3ZSWA 4UB5A 4K4HA 3KLGA 5CHGA 4FZZA 8ICGA 1S6PA 4UBCA 1ZQAA 5KFPA 4P4PA 1RDCA 3G10A 8ICCA 2MUTA 2IS3A 1TKTA 2F96A 4IR1A 1HMVA 5HP4A 3OYIA 4FS2A 5CZ1A 1HJPA 3GIIA 1EXQA 4RQ0A 3GDXA 2VG6A 7ICHA 4ID5A 3EPGA 4DEZA 1KFTA 3OJSA 1KLNA 3QE9Y 1RYRA 4FVMA 3RAQA 3OYFA 5KFKA 4J9OA 2DY4A 4UB3A 3RR8A 4F5OA 4XIUA 2IDOA 3KJVA 1HQEA 1ZQQA 1D8YA 5I42A 8ICTA 2DFLA 3RJIA 4ELTA 2HNDA 4N47A 4C8MA 3RH4A 1RDBA 3MABA 2WTFA 3SV3A 2UVRA 4I9LA 3V6DA 4FK2A 4BDYA 4UAWA 4M41A 5L1LA 4DL5A 4ECWA 4J2DA 2JEGA 4F92B 3LZJA 4NCAA 4PHPA 3KTQA 4DS4A 3L8BA 4RNMA 2XY7A 5KFAA 4KLDA 4CGGA 1L5UA 3L3UA 3BGRA 2ISOA 3CM5A 1U04A 4XA5A 4PGXA 7ICLA 3LAKA 4P2HA 3V9UA 1CXUA 2P6UA 5I3UA 3KHRA 8ICXA 1D5AA 5KFSA 1WSFA 4O3PA 5DBBA 3HSTB 4LZDA 3HK2A 4O3QA 5J2DA 3DOKA 4RNOA 1L3TA 4DTXA 3AVLA 3OYEA 4N41A 2AGQA 4M3YA 4AHVA 3F73A 5DDMA 3HXMA 1BPDA 2P1JA 2JLEA 3SZ2A 3QEWA 3JPNA 2AJQA 3ISBA 4M9HA 2P5GA 4RT2A 3E01A 1DOQA 4KREA 4CHQA 1UT5A 2W9MA 4CJ4A 4TSXA 2PYLA 5J2EA 2ASDA 4G3IA 8ICMA 1BCOA 5CYMA 2R8JA 3ZT1A 1EXNA 3RMDA 1I3AA 3MEEA 1TL1A 1ZQWA 2Y1JA 4CHZA 1S9GA 1XWLA 4ED3A 1RZTA 4NLZA 3ZD9A 1UAXA 4DOBA 2HVHA 1D9DA 3PY8A 4DSFA 1KVBA 1JLGA 4RQ5A 3RJGA 1WLJA 3CQ8A 1ZQKA 3ORYA 4QZ8A 4E1NA 4M45A 5KFCA 4YN4A 3LZIA 2FC0A 4B9NA 3UQ2A 4CF2A 5IIJA 3M9NB 3RRHA 3OYHA 2PI5A 3DRSA 1LV5A 3G6XA 5KT3A 1ASUA 2C2EA 1JLQA 4DO9A 4XRHA 3AVGA 4CJRA 1R0AA 5CP2A 3A2FA 5J2MA 1Q8IA 4KI4A 3V9SA 4PY5A 2NRXA 4AHTA 4IRDA 5KFRA 4I2HA 2DFEA 4DTNA 1ASWA 1IKVA 1B43A 5KFEA 4M04A 3C6UA 3AVFA 4H4OA 4OKEA 3TAGA 5IIIA 4KLGA 3C5GA 3IRXA 8ICBA 2WONA 3V81A 4Z4EA 4RZRA 1RDDA 1NK4A 4ECXA 3T3FA 3T1AA 1IXRA 3CM6A 3PO5A 3PW2A 1JXLA 4QZEA 2VA8A 2BGGA 1ZQVA 4M6WB 4RPXA 3QNNA 4KLTA 2P51A 4NLNA 3TAPA 5C25A 5KRTA 2F1IA 3NTUA 1COOA 3HYFA 5T7BA 4I2AA 1JIHA 1JLEA 4Z4FA 4NLKA 2D0BA 1A5XA 2X6NA 1U9LA 1WCNA 4QZBA 5J2QA 4I2GA 4EYIB 7ICQA 4Y1DA 1S9EA 2HNZA 1MSWD 3SUOA 2GBZA 3RB0A 1IG9A 3ZT2A 3RH6A 4G1QA 1KEJA 3LP3A 2C22A 3GIKA 2ZUDA 2YKNA 1TAQA 4FBTA 4YMOA 3QERA 1UWBA 4ED8A 1TK0A 9ICUA 1C6VA 2JZBA 4KLLA 3AVKA 4RQ4A 1VSIA 1T05A 3VQEA 2BQ3A 4E7HA 1GOCA 4BGDA 3BQ2A 3PO4A 4O5CA 2HHUA 3HVTA 5KFOA 4CHPA 1AROP 3AA2A 3DYAA 4FLTA 1S0OA 3C1ZA 2OZSA 2XRIA 2I9GA 4J9PA 4FJMA 4DTMA 4F4WA 2ATLA 4M3XA 2W42A 1HYSA 4PGQA 1ZQXA 3ZT4A 3C1YA 3Q8PB 3PW7A 2IOCA 1I39A 1VSLA 3OYNA 4W5TA 1Z00B 3HWTA 4LH4A 4MFCA 3MGHA 3ZDAA 5J2NA 3QEAZ 4DOAA 9ICWA 3NFAA 1ZQHA 4DFPA 3CFOA 4ED0A 1JMSA 1VSEA 3U6FA 9ICNA 3B0YA 4E7KA 3PR5B 1VSMA 1NKBA 3JYTA 1BIZA 5J2HA 4KHSA 4KLIA 3DI6A 1DTQA 1JLFA 2D0AA 5J0TA 2ZJ5A 3E2EA 2XCPA 4RT3A 4DFJA 4PHEA 4F3OA 1D8LA 4J2AA 2XY8A 1WSIA 4CHOA 1BVSA 1TGOA 4DTUA 2C2DA 3QEIA 5KFUA 2ZTCA 1ZQBA 2GV9A 4M3ZA 2PFOA 4YMNA 7ICKA 4RW9A 4M42A 4UAZA 2Z1IA 3M8RA 8ICAA 8ICNA 8ICHA 3P1GA 1ZQJA 5KGXA 3MDAA 5DG9A 4J9SA 5HHIA 2F1JA 2A1RA 3AVHA 4JWNA 2YNGA 4DL2A 3ZSXA 3TAEA 3AO3A 1NJZA 2X6SA 3LWMA 3HP9A 5BOMA 2R7YA 2B5JA 3HW8A 4F4YA 1J53A 2EHGA 4FK4A 4NM1A 4QZAA 3QETA 2HHWA 4CJEA 1JLAA 3TR8A 5J2IA 2I1QA 4IQWA 4CIGA 4FJJA 5BOLA 1BPEA 2XC9A 4CJKA 1Q9YA 1UT8A 1S1VA 2RDIA 1QTMA 3OVNA 4CJUA 4GXIA 3OGUA 4CK3A 3SYZA 4CGJA 4B9VA 4KFBA 2OYQA 7ICJA 3IM1A 4EEYA 2P66A 3PR4A 4CFAA 1SUQA 4KO0A 4F93B 4DS5A 3VN5A 4EBCA 1JLCA 5J2FA 4M9GA 3VQ8A 1EX4A 3KK3A 3CFPA 4YR2A 4RG8A 1CXQA 1X1PA 4YCXA 1XSNA 3OHBA 5J2KA 3K59A 1L3SA 1NOZA 1RXWA 4QWEA 2BGWA 2V9WA 3U3YA 4CJSA 3GQCA 4UQGA 4B9SA 3ISCA 2XGPA 3RB3A 1BHLA 2W9BB 5J2AA 2XGQA 3JPOA 1UOCA 7ICSA 2BDPA 4FJXA 9ICCA 1XU4A 1XI1A 3LPTA 3IG1A 3AVCA 3MR5A 4KLOA 4CJWA 3Q8SB 2YKMA 1B9DA 2ZTDA 1NKCA 1CZ9A 5DB7A 1H38A 2IGIA 3QINA 3V9ZA 3KK2A 9ICOA 1SL2A 1MC8A 4CCHA 3AA3A 5KFHA 4DQQA 2OZMA 2G8WA 2GUIA 1ZBFA 4DSEA 3UIQA 1RYSA 1NK9A 5DG8A 5F9LA 8ICQA 2W8KA 5J2CA 8ICSA 4CESA 1VSDA 1IKXA 2EX3A 3DLRA 2BHNA 4PH5A 1GOAA 1JL2A 5DK5A 4QAGA 1S1WA 4M3WA 8ICFA 2F1HA 5J0XA 5KG1A 4ICLA 4W5OA 1T4GA 8ICPA 3KK1A 3HT3A 4CEAA 4PGYA 4M9NA 4I9QA 4KHYA 3BDPA 4JK1A 1ZQIA 2QKKA 4FW2A 5L1IA 3PUFA 1QHTA 1ZBUA 3DMJA 5KFXA 3C94A 4EBEA 1BI4A 4O5KA 2HW3A 2HHSA 5J2BA 2V4QA 1RT2A 1VSKA 2I5JA 4M0AA 3H08A 3MR6A 4HUEA 1S9FA 4FBUA 5BPCA 4I2JA 2YHAA 2YNFA 3S9HA 3SNNA 4KV8A 4M6WA 4F50A 1NK0A 3RBEA 3H4DA 4FW1A 3S3NA 4I7FA 5KFLA 4ECUA 8ICOA 2IHNA 1S76D 3AO1A 2KZZA 4OPKA 2B4JA 1XSPA 4OKKA 3VQDA 5J0WA 4ECYA 3ZT0A 4DTJA 3K5LA 1JL1A 2VA3A 4KLSA 4BDZA 4ECTA 4X5VA 4L8RB 4EZ9A 1NJWA 1TAUA 3RTVA 3SUNA 2HNYA 3OYLA 1KSPA 4DFMA 3OYCA 3KLIA 1C0MA 3NBPA 3LAMA 2NRWA 2FLNA 1TKZA 1T3NA 3RMCA 2HVIA 4O5BA 2BKEA 3FDSA 2A1JA 4I29A 1KFSA 1HYZA 3UQ0A 2Q0ZX 3EPIA 3V7JA 4Z4IA 5KTQA 3H7IA 4IRCA 3QEXA 2PI4A 1WAJA 4J9NA 4LH5A 2DFFA 4DU3A 4I2QA 1CEZA 4O44A 4UB4A 4FJGA 4QWAA 3FYHA 1ZYQA 1X2IA 4IG0A 4DOCA 2UVWA 3TFSA 1T03A 5DBAA 1RXVA 4KLEA 4IQUA 1WCLA 4HUFA 4E0DA 3TQ1A 4YXJA 4LY7A 3EY1A 5HRSA 4FK0A 3HVRA 3SUQA 3M8SA 1XSLA 4Q5VA 3T5KA 4DQPA 3IAYA 1C0UA 8ICRA 2BQRA 1ZQCA 3ASMA 5C24A 3V6HA 4M9LA 2W8LA 3V6KA 4PHAA 3O3HA 2X78A 4J9MA 4CF9A 1EETA 1NOYA 1EKEA 1ASVA 3NHGA 4DG1A 2Z1GA 5FRNA 1RBVA 3IS9A 1JXEA 1V9PA 5KT5A 3WNHA 2FMQA 1TK8A 4BWJA 2E4LA 2HHQA 2GWSA 3B6PA 3KLEA 4I2DA 2FBXA 4Z4CA 4CEFA 3O3GA 2V4RA 3OYMA 3V1OA 1BQNA 3HL8A 1FK9A 3GIJA 5J0YA 4CJLA 4B9MA 9ICBA 4CJ5A 2HHVA 4QZ9A 9ICJA 1KVAA 1ZJNA 3T5LA 3SPZA 3O4NA 4GXKA 4DL6A 1QSLA 3M9OB 3AVNA 3L2UA 3AO5A 3B6OA 3CG7A 5CB1A 3OYKA 3MEDA 5CWRA 4JS5A 1LWFA 4GC7A 1RPLA 3H8WA 5HHHA 1WSEA 2W9AA 5EWFA 4I28A 1JX4A 1EP4A 3H8JA 3ZSVA 4CE9A 5DKWA 8ICEA 7ICMA 1C1AA 5DQIA 3D0PA 2W9CA 4YD2A 2G8HA 2X74A 3H40A 2XY5A 4KPYA 1C7YA 3V9XA 4NCBA 4OGEA 1A76A 3KKSA 4QWBA 3SI8A 1K1QA 5CY4A 3TANA 4YMMA 2VWKA 3C2MA 3NGDA 1S5JA 1BISA 4DF8A 1LAWA 5KFIA 2KFZA 2OPQA 4KHUA 4IQVA 4CJPA 1ZQLA 4B9TA 3BJYA 4BXOA 1BCMA 4NLGA 3LDSA 4GW6A 5JS2A 3EW9A 1RNHA 4QW8A 5J0SA 4AILC 3RR7A 4QZIA 1B92A 5E41A 4IDKA 4GXJA 3SQ0A 4ED2A 3NGIA 5D3GA 3Q8LA 1ZBHA 3ZT3A 2RDJA 2KN7A 3MFIA 3SQ1A 5C5JA 4M2YA 4DLEA 1BIUA 4UBBA 3BQTA 1TVRA 4M3UA 3LWLA 4QZFA 3IHQB 5HMLA 4IR9A 1TV6A 4JV2A 3VQ5A 1HUZA 1T8EA 4ID1A 3HO1A 4FLWA 3SI6A 3V1RA 4F5NA 2D0CA 4CGHA 5FROA 2G8KA 3K5MA 4NY8A 1RBSA 4FJ7A 4H4MA 4Z6CA 1VRUA 1ITGA 4AHCA 4DWIA 1ZQDA 1RT4A 3CFRA 3QEPA 4M3RA 4O3NA 5KFZA 4XUSA 2XCAA 3EWAA 2JEIA 2R8HA 5EOZA 5IINA 2AQ4A 4Q45A 3L2RA 4F5PA 5HRNA 9ICVA 4KAZA 4ZH4A 2YNHA 3UPQA 1KFDA 9ICHA 4JV0A 1KVCA 3LP2A 4Z4HA 4E3SA 4DQIA 2P5OA 4ZHRA 3H4BA 4JWMA 4E7JA 1B22A 3AA5X 3EZ5A 3LALA 4KTZA 4O55A 2VWJA 1KDHA 1J54A 3OSPA 4AHUA 4KLJA 2B6AA 2Z1HA 4EP5A 4FM2A 4KRFA 3RMBA 4PUOA 4FJ8A 4R8UA 2IAJA 1U4BA 3SJJA 3AVIA 1QE1A 3KLHA 3RWUA 3TAMA 3TAFA 4ED7A 5DLFA 9ICIA 9ICXA 3LDAA 2Y1IA 4DL7A 4F3TA 5KG4A 3SV4A 2R8KA 4EYHB 8ICUA 4Z0UA 1XHZA 4M47A 9ICQA 2JEJA 2BCQA 4DSLA 7ICEA 1VK0A 3JPTA 3GFKB 4O3OA 3LK9A 4LVSA 4M9JA 4KB0A 5FDLA 1XC9A 3OHAA 5HROA 5EWEA 3VA0A 3JPSA 3RMAA 5KFWA 4R66A 1RT6A 3TFRA 3MAQA 3KKRA 3NF6A 4KB1A 4CEQA 1WSHA 2OPPA 1ZQFA 7ICFA 1TVAA 4CGDA 3DRRA 4R64A 4BDPA 2PYJA 1SZPA 1HRHA 4GMJB 3AA4A 3Q8MA 2FPKA 7ICUA 9ICRA 1RDAA 2KQ2A 4JUZA 1BPBA 5DB9A 3C6TA 1KLMA 1RTJA 4KTWA 4DTPA 4R8UB 1X9SA 4ELUA 3AO2A 3VQ9A 3NF8A 4OJRA 5FRMA 1S1TA 2PY5A 1NJYA 2IBKA 5D49A 4Q8FA 1QSYA 1DTTA 4CFDA 1ZBLA 1BGXT 4DQSA 3PW0A 3PW4A 5L1JA 4E7IA 4HCCA 3RJJA 4DL4A 2WOMA 4N5SA 3AV9A 4CIEA 1ZQPA 5IIKA 3DOLA 1Q9XA 3HP6A 5DB6A 2G8IA 3D45A 4P4OA 1RBUA 3OS2A 4MF2A 1J5OA 1A5WA 4CHNA 4HYKA 2ZUCA 1C1CA 2R8GA 2NRZA 3ULDA 4C8OA 3OYGA 1FKPA 5L1KA 3L2WA 2BCVA 1ZQOA 4QWDA 2ZD1A 3PNCA 5KT7A 2G8FA 1JXBA 9ICLA 3OYDA 2UVUA 5EWGA 2F8TA 4JS4A 3L2VA 4I2CA 2ZTEA 2BPGA 5HBMA 4RUCA 1C0TA 2LSNA 3NGYA 2IMWP 3RJFA 3ISNC 1SKRA 5J29A 4IG3A 7ICIA 4AHRA 3KHLA 4IFVA 4AH9A 1IH7A 1RTHA 3VQ7A 1N48A 1S0MA 4OLAA 4FO6A 1REVA 3RJHA 4TURA 4FXDA 7ICGA 4LD0A 2KFNA 3QLHA 3OYJA 2C28A 4F4ZA 1TV9A 4CEBA 4RW8A 2F8SA 5CZ2A 4CERA 2RN2A 4AHSA 3P83D 4CJTA 4GVMA 3GV7B 4MFBA 1TKDA 3HPGA 3Q8KA 2BQUA 4IFYA 5KFTA 1S0NA 1NOMA 1KCFA 5DQGA 1RTIA 1UA0A 3QO9A 4Z6DA 2BPCA 4TQRA 8ICKA 3TABA 4KHNA 3NF9A 1RCHA 1W9HA 5KFGA 4FLYA 4HCBA 1QS4A 4TQSA 1HNVA 3QEVA 1S97A 2LYHA 4Q44A 5KFBA 3DLEA 1O1WA 4RW4A 1UA1A 4KLUA 3VQ4A 7ICNA 4RNNA 3SQ2A 1A77A 4F5QA 4O0JA 4CHYA 4I2IA 4RPYA 3PX6A 4Q8EA 4FLXA 5KFFA 1SKWA 9ICGA 3FFIA 1N5YA 3THVA 2J6TA 3BQ1A 1S77D 4YFKA 3K4GA 4GC6A 1NJXA 5SZTA 1RBTA 1VRTA 4DTRA 4FJ5A 5D4BA 4IKFA 3V7LA 2XHBA 3ZD8A 2ZE2A 3SQ4A 4YQWA 4E7LA 2ZJAA 1ZQUA 3C21A 4I2PA 4E19A 3JPRA 1QQCA 1QSSA 3DLGA 2HHXA 7ICTA 2FBVA 3H8SA 1J9AA 3AVAA 4PHDA 1ZQYA 1Y88A 2ALZA 4CJFA 5L9XA 5HP1A 4EBDA 4Q43A 2PFNA 1S1UA 4JV1A 4BE1A 4JRQA 5KG0A 2PFPA 3DLHA 4I2BA 8ICLA 1D9FA 4DTOA 3PV8A 4YR3A 2IC3A 4QCLA 5KT4A 3PMNA 4CGFA 5DMRA 4UB1A 8ICZA 3PVXA 2A1SA 4LSNA 3C2LA 3MXIA 5CA7A 5J2JA 3PMLA 3ZSYA 1IKWA 2DFHA 1WAFA 2DPJA 1RTDA 4DL3A 4H8KA 4MFAA 5CR0A 5IILA 1RILA 9ICSA 4ED1A 5KFJA 4PPXA 4R65A 4QW9A 2YV0X 1W0HA 4QZGA 1KRPA 1IKYA 8ICYA 2R8IA 3QESA 4RUAA 3SPYA 2DPIA 4O5EA 3OJUA 3TI0A 3P5JA 3UXPA 3ZSZA 4IBNA 5DLGA 8ICIA 3NDKA 3NCIA 4IQTA 3QIOA 4Q0BA 2DTUA 1WSJA 3JSMA 4Z6EA 1BPZA 2PFQA 2JEFA 2YNIA 4ED6A 3OY9A 4UAYA 2ASLA 5HNKA 4Y1CA 2YHBA 4QOZB 2BR0A 1WSGA 4CK2A 1FXXA 5J0PA 1ZQTA 3K5OA 4CF0A 3C2KA 3ETLA 3ISDA 4N56A 1HNIA 4KHQA 4YR0A 1HPZA 4QZDA 2NRTA 4QZCA 4MEXA 5KI6A 4KLMA 3LPUA 3T5JA 3KLFA 1MQ2A 3VA3A 3EYZA 2FMSA 2AGPA 1FKOA 2G8UA 7ICVA 1MQ3A 5DBCA 9ICKA 3WNFA 1TFRA 4B08A 4JLHA 3RAXA 7ICRA 1U47A 2FLPA 1XO1A 4BACA 4DU4A 5KG5A 1WNSA 4BE2A 2VANA 4ECRA 2FPLA 5KG2A 3T19A 2HMIA 2RF2A 5J0QA 2C2RA 4FJHA 3RJKA 4C8KA 4LZGA 4RW6A 5EU7A 4KN4A 1YTAA 3GILA 3NE6A 4O4GA 3OSNA 4M3TA 1BL3A 3GV8B 8ICJA 4PQUA 5F9NA 4N76A 2E6MA 3Q8RB 1BI4B 2G8VA 5KT6A 4MEYA 2NUBA 5DDYA 2O4IA 4P4MA 5IIOA 2RPIA 1IM4A 3K75D 2PZSA 2OWOA 4J9QA 1ZJMA 1F21A 3NH2A 1YTUA 4RQ6A 4CEDA 4ZTJA 4J9LA 3UXNA 4FJKA 4FJNA 3G0ZA 2JZBB 5HLFA 4PWDA 3VQ6A 3RRGA 1LW2A 1Z26A 1WN7A 4YFUA 3ALYA 2P6RA 1RT5A 3VQQA 2NRVA 5TZVA 2QKBA 3AVMA 5C42A 2M9NA 1HQUA 3AVJA 4F8RA 2Q3SA 4ECSA 8ICVA 3ZDCA 1S10A 4FJIA 5DGAA 3DRPA 3L3VA 3HX0A 1BQMA 2KTQA 3ZSRA 5KG7A 2OPRA 2ZQBA 1VSJA 1LB2B 2ISPA 5DGBA 1RT3A 4UB2A 4YD1A 2W9CB 3JPPA 4FLUA 5KG3A 1XS9D 1NK8A 3V7KA 4K8ZA 3GIMA 1BPYA 3M8PA 7ICOA 4DU1A 4NXZA 2FPMA 3MBYA 4CGIA 1JN3A 3OYBA 1CZBA 5HRRA 1U49A 3RH5A 4CF8A 4NYFA 4CF1A 1KTQA 2ETJA 2H5XA 4TUPA 5J2PA 1N6QA 4FZYA 2ZJ8A 4CJ3A 4NM2A 1Z00A 1TK5A 4DSKA 3AU6A 4FZXC 1ZQGA 3I8DA 4J9RA 4OGCA 2BE2A 1LWEA 1SL1A 1S1XA 4FCYA 2VG5A 4O3SA 1CUKA 4CFCA 2ZUBA 4CEOA 5KT2A 1S6QA 4OKJA 4TUQA 3MR3A 2HHTA 3ZSOA 5KFDA 5K14A 2AGOA 1U45A 2AU0A 3UXOA 3C5FA 5DQHA 3LANA 4B8AB 5HMMA 3SUPA 2PXIA 4WE1A 3MXMA 4F2RA 3N4MB 5KFMA 4Z4GA 4FJ9A 3HPHA 1NK5A 1L3UA 3CYMA 1PZNA 4R5PA 3KHHA 1K1SA 3QNOA 3K2PA 3NGZA 2UVVA 1Y97A 2XY6A 4EP4A 4I2EA 3KD1E 4F4KA 1CLQA 3B0XA 3MDCA 3V4IA 3MXJA 5KFYA 3S3MA 1G15A 2MUTB 4Z6FA 5KRSA 5KFNA 4W5QA 4JRPA 1N56A 3K57A 2QXFA 3V6JA 1X9MA 1HJRA 4OPJA 4FS1A 3MFHA 3I0RA 5J0UA 3NF7A 1MU2A 2QK9A 4E89A 1X9WA 1NK7A 3O3FA 2VA2A 3ZDBA 4RQ8A 4YP3A 2E6LA 3TWHA 4O3RA 4MF8A 3VQAA 3HM9A 4ECZA 1B9FA 3K58A 3HJFA 4FLVA 3C23A 5HRPA 3AUOA 1C1BA 3WNGA 4XQ8A 2J6SA 1NKEA 4QWCA 4KN7A 4F5RA 3VQPA 4KLHA 4DFKA 3PW5A 5J0RA 3M8QA 2KW4A 2VG7A 2IA6A 4LSLA 4FJLA 3DLKA 3N97B 1RT1A 4MFFA 3QZ8A 4FYDA 1GOBA 4CEEA 4B8CA 9ICTA 4K4GA 3HPOA 1ZQRA 4GLXA 4I27A 3AU2A 4C8LA 4BE0A 5CYQA 3MGIA 5SWMA 2BCSA 2B21A 2BCUA 1RT7A 9ICMA 3F9KA 5DG7A 4ECQA 1Z25A 5JS1A 5J1EA 4CIFA 3NH1A 4FLZA 4FM1A 4IRKA 4YG2A 5D46A 4CK1A 3G6VA 4F4XA 1DLOA 3NH0A 3DM2A 1ZQMA 1LAVA 2FLLA 3QZ7A 3C95A 3OS0A 3KD5E 1K6YA 1BPXA 2KZ3A 4DLGA 1LWCA 4OVLA 4K4IA 3Q8QB 3TARA 5KGWA 3S3OA 4K8XA 5KFQA 2OA8A 1ZQZA 3MECA 4B9LA 4B3OA 4ECVA 5IIMA 3RBDA 4W5NA 1RBRA 2ITGA 4CECA 2W9BA 1SL0A 4DSIA 4NYNA 1ZBIA 4BWMA 3QEBZ 1HUOA 3RJEA 1T7PA 3QIPA 1QLNA 1L3VA 9ICFA 1YVUA 3AO4A 3ITHA 2JGUA 4DQRA 3O4QA 4O0IA 3MR2A 1ZQSA 1IO2A 2D5RA 4F91B 4KKOA 4CJQA 2FBYA 7ICPA 3V72A 4HVJA 5CJ7A 2J6UA 2BCRA 3MEGA 3TAQA 4RW7A 4J9KA 3AVBA 2Z1JA 4HTUA 4E1MA 1LW0A 4KLQA 4PA1A 4DTSA 3V1QA 1VSFA 3VQCA 4J2BA 1TKXA 4R63A 2XO7A 4OLBA 3WNEA 3RB6A 2IHMA 3G6YA 4TUSA 2KZMA 2BPFA 3PX4A 4DSJA 4RQ1A 4ZTFA 3I0SA 4KTQA 1JLBA 4YVZA 4RQ2A 4I2FA 1A5VA 2AQ0A 3U3GA 3ZCMA 3OYAA 1JKHA 4B9UA 2MAXA 2ATQA 5DB8A 4YXMA 5J0OA 2FBTA 4CFBA 1ZQNA 1SKSA 4EZ6A 1Z3EB 4C8NA 1NK6A 2HB5A 4BXOB 4YNQA 4F2SA 4DMNA 1YT3A 3KIOA 3VQBA 3SCXA 4FM0A 1XHXA 3L2QA 1DGSA 3LP0A 4CJVA 4KLFA 1VSHA 4NCGA 3PX0A 5KG6A 1S0VA 1ZQEA 9ICAA 1U48A 4ELVA 4RQ7A 2RKIA 3ZSQA 3RB4A 2A1JB 8ICWA 4MQ3A 3M9MB 4HUGA 3T5HA 3BQ0A 3ZDDA 9ICPA 3KHGA 3DLBA 4RPZA 4HHTA 4KI6A
chains in the Genus database with same CATH superfamily
1FRKA 2FHKA 5BXIA 2E5SA 1CPZA 3OL6A 3V9WA 4DF4A 3OQ2A 4QZHA 4KMUA 1X40A 4AP9A 2QM1A 3MXHP 3QGIA 5K8MA 2FMPA 3M6ZA 1HYVA 4MKVA 5J2GA 3PJ9A 3UKRB 2ASJA 4RQ3A 5E3RA 4CEZA 5AQPA 3OS1A 3LP1A 1SJ4P 3PRVA 3I9ZA 3O1BA 1JNZB 1ZETA 4HH1A 2YX6A 4FF3A 3KZBA 1GLEG 2LQJA 2PC6A 4DHYA 3KLGA 1IBMF 2IJRA 3G10A 2YVSA 4MAKA 2IS3A 5HP4A 2L9WA 5AICA 3CI5A 4EHUA 4DV4J 1JMTA 4RQ0A 3GDXA 3DOKB 3AOCA 3TVKA 5AQZA 2CYYA 4YORA 3EPGA 5L38A 3G6EN 4CD1A 4PKIA 1ZAXA 1KLNA 1RYRA 3FBBA 3SFGA 1IKVB 2V9KA 2DBYA 1HNZK 1VLYA 3VGKA 4F5OA 1PO6A 4ZHRB 1OW5A 2IDOA 1HQEA 2IC3B 1ZQQA 1NMDA 2A42A 8ICTA 3RJIA 4AD6A 2HNDA 4MH8A 4C8MA 2IM1A 4OI4A 3MABA 4RBUA 2ZIVB 4BBYA 2JL9A 1KQSM 3KOAA 4CT8A 3V5RA 2R7TA 2PEHA 3NGSA 4UAWA 3MMCB 1MWMA 4M41A 4LC9B 3CQYA 1HWUA 2JEGA 5AM3A 4F92B 2VPZB 3HKZC 4W98A 2VQFJ 4PHPA 3KTQA 3O8WA 4RNMA 3PSFA 2XY7A 3L3UA 3UR0A 3TADC 2ISOA 4YOEA 4DPYA 2VONA 4PGXA 3QJPA 2F4VK 1VQON 3V9UA 4OJOA 3KHRA 2KYXA 4DUZJ 3I0SB 4CF4A 2XEXA 1KBRA 4NLUA 3N0VA 1VDVA 3M3ZA 3HK2A 4O3QA 1X42A 2P9SA 3AVLA 5L1MA 4M3YA 5EE1A 4AHVA 1HW8A 3NG8A 5E33A 5C10A 1PVRA 3SAGA 4MIAA 4M9HA 3EVWA 1ZOLA 5E3CA 3B9JA 1UT5A 1HI1A 3LP0B 4K4WA 2ASDA 2VJ5A 1O08A 4OLOA 4XPCA 4YDDB 5DM6L 4OX9J 3PJWA 3PSPA 1KQKA 2DHSA 4DL0C 1S49A 3WZ0A 4CO0A 1UAXA 2O8BA 2RS8A 2LQ9A 1KVBA 2QX0A 1JLGA 4V1Ak 3HHNB 1WLJA 2QTWA 1HHSA 2W4PA 3VZHA 3W0LA 3CCVN 3ORYA 4UARA 1UETA 3ZX3A 2KU7A 5GINA 4QZ8A 1N0VC 2KIVA 4C9DA 4H4MB 2ZH6A 4YN4A 1CJVB 4CD3A 2FC0A 1OY8A 3A8JA 3RRHA 3KUEA 3ULHA 3LO3A 5AIBA 1LV5A 3RFAA 3CD6S 1RWWB 4NEYA 4DO9A 1RLDA 4CT9A 1HWJA 5J2MA 1Q8IA 3V9SA 3VF4A 4PY5A 4AHTA 4LMZA 2DFEA 3GJRB 3EKSA 3LDLA 2FC9A 2HMIB 2K8CB 4BR9A 4WYWA 3I5BA 2QL5B 2FPHX 4M94A 4LF4J 3IP0A 4DU7A 1P1TA 1IXRA 3CM6A 4MDBA 2ROGA 3PO5A 3PW2A 4DV7F 2VA8A 1MWZA 1ZQVA 1U8SA 5JVGL 3LDOA 2P51A 4NLNA 3MUMP 2HRYA 5KRTA 3NTUA 3NUQA 2KJ8A 1FRHA 1LFPA 5T7BA 2W7OA 4I2AA 1JLEA 2D0BA 4FPAA 4QZBA 1IQTA 1ATNA 4W90B 3CCUN 3LTOA 4Y1DA 3LW5C 5DZ6A 5E2QA 2WCXA 2FJ6A 4ACOA 2RJZA 2QSFA 4NWBA 4GKKF 2HK3A 2OEMA 3RBXA 3PKMA 4RBVA 5AXMA 4JI3K 5AKJA 3GIKA 4UB6U 2ZIUB 1VHFA 1NHKL 4OV1A 3KUHA 4M63C 3X1LB 4DPUA 1Z2LA 3AVKA 4NA2A 1S72N 1KHVA 4E7HA 1V3ZA 2AT1B 5HROB 3U9ZA 1GOCA 4DV2F 2HHUA 3HVTA 1XNRF 1VYAA 3N5FA 5F8IA 4RWWA 5IT0A 3N28A 2B43A 4A2BA 5LXRA 3AA2A 3CIMA 1W25A 2QYCA 1RYUA 1S0OA 4C3LA 3VERA 1QAYA 3C66A 1Z6RA 4J9PA 1S7IA 3CC7N 2IYIA 2RUGA 1J97A 4F4WA 2W42A 4PGQA 4CIOA 3J7ZO 1GK8A 1KOOA 3PW7A 3IWNC 2YNGB 4W5TA 4Y28C 3L7UA 3UN3A 2YH0A 3HWTA 1DY3A 3ZDAA 3M30A 2P9LA 1K8KA 4ILJA 2VPYB 4USUA 2BJ9A 3CHWA 1U24A 4PJ0U 4JI3J 1Q95G 3DJCA 3DM2B 2ZJRL 4DV5K 1BIZA 2DISA 3FRZA 2BVZA 5J0TA 1YIJN 3CCSN 3NVZA 5EE0A 2AYBA 4RT3A 2QV6A 5DM7Q 1KD1T 1WSIA 5E0OA 1TGOA 2E1MC 3CCES 1SJQA 5KFUA 2OSRA 3U4LA 4Y2VA 3ZTQA 4CLTA 1SQFA 2VHGA 1PK1A 5BJRA 4F02A 4RW9A 4F0KA 4ZK7M 3CC2S 3FEXB 1KAXA 4UAZA 3OXLA 4LQ3A 3CMAN 2OCEA 1CJKA 1ZQJA 3MDAA 3NS7B 3L09A 4YMEA 3P49B 3MM7B 3M8QB 4JWNA 2YNGA 4C3KA 5A2QU 4JI1J 2ACYA 3AO3A 1NJZA 3BH6B 5BOMA 2B5JA 3HW8A 3SAFA 4AYBD 4QZAA 1BLUA 1OPZA 5C42B 3OBYA 3WXIA 2IVMA 5J2IA 1BE4A 2CJXB 2XC9A 2MHEA 3UMGA 3O5TB 1HD1A 1CC8A 4ZP7A 3A0HU 3H3OB 4B9VA 4J9UE 2DNZA 3PIOQ 2LI6A 1VQ4S 1MU2B 2B51A 1H2TZ 3ZNJ1 5F0XA 3OFHA 3ZZ0A 2QLJB 1F5SA 2LFVA 3LQVA 1WC0A 3TW0A 3CPWR 4NXNK 3RF9A 4JHDA 2DNYA 3W5YA 1KVIA 5LSRA 3IMXA 1N5QA 1NOZA 2BGWA 3FEYB 2N3OA 4DV3K 3UI3A 3GDQA 4UQGA 4B9SA 3UD4P 1BHLA 3ULEB 2KXNB 3JPOA 2BDPA 3KVGA 2MKKA 3HLUA 1OY6A 4FP9A 3J7AN 2E66A 1SZ2A 4WCEL 1XO0A 3AVCA 4KLOA 2EANA 3TQEA 5AJ3J 5DB7A 1H38A 2IGIA 3QINA 3OBWA 2FHOB 3OL9A 4CNZA 3VETA 3B8HA 2ZJPQ 1GEHA 2C3PA 4DQQA 2NPIA 2OZMA 4BJQA 3E9OA 2G8WA 2GUIA 3QUQA 2V68A 4A8OA 1HKBA 2W8KA 3TACB 5J2CA 8ICSA 3FCWA 4R25A 3MMAA 3G71N 1VSDA 2EX3A 4YY3J 2KVQE 2V34A 2GW8A 4QAGA 1AZSB 2YHXA 4U67L 2YMPA 4RUBA 4WYBA 4ICLA 8ICPA 4Y00A 4B3MF 2WMMA 2O8EB 1FVQA 3I96A 1EO1A 4PGYA 4KHYA 3BEGB 3BDPA 4DPOA 4USIA 1TKZB 3MCOA 1N34J 3EE3A 2BKNA 3OUYB 2QA4S 4JB8B 2F63A 3SQOP 3PUFA 1QHTA 4DR5J 5D0RA 1LW0B 1KAYA 1GXLA 4EBEA 1Z1ZA 4HTLA 4JAXA 2ZNYA 1GMVA 3BKTA 3MR6A 3G87A 5BPCA 4I2JA 1OIAA 4NZ7A 2YNFA 1N63A 1Q81T 4WU2A 5ETKA 1JLAB 4FW1A 3AY0A 8ICOA 1PAEX 4FOEA 1HR0F 2B4JA 3OTBA 2N7CA 3VZIA 3DLJA 2DRAA 3MWPA 3EZUA 4CZIA 4RNFA 4U7CA 2XS2A 4ZIWA 1HNWK 2J9DA 3H5XA 4IYQA 2VA3A 4CTAB 4H5VA 1TAUA 1JNRB 3TADA 3PJXA 3ENVA 4DR1K 1YJWN 3KKAC 2LU1A 1ZA1B 1WI6A 2MKIA 1OH8A 2QMWA 3OYCA 4QZVB 3VAFA 2COLA 3NBPA 2KHDA 2Q1NA 2NRWA 2O8CA 1RHKB 3DLEB 2IM3A 4ZPBA 4DV6F 4YEAA 3OFEA 4I29A 2GUPA 3EZOA 1HYZA 3EPIA 2APOA 3V7JA 4HLBA 5CYJA 3ZI4A 2YMLA 4QR0A 2YX4A 2GVZB 4CH1A 3FFIB 2G1DA 1CEZA 1RCOB 4UB4A 2Y1RI 4QWAA 3FYHA 3H6EA 1FNOA 4DOCA 1X0FA 1T03A 3FVYA 5DBAA 1JROA 2XQCA 1LKYA 4Y6IA 4HUFA 1DK2A 3WK4A 3EY1A 3VMFB 2KJVA 3IGNA 2YMMA 5M1OA 3CCJS 1XSLA 3BBFA 4OZ3A 4BC5A 5A6PA 4UY8T 4LUBA 4NLWA 1YSJA 1SH2A 5C24A 3DXMB 3BZKA 2LQBA 4B1YB 1FDDA 3DGVA 4BC3A 1U2RA 4J9MA 3P6YC 2K8GA 2YPYA 2XO6A 1ASVA 4ID8A 3M32B 2E2NA 1S1WB 3KZIU 1JXEA 1NGAA 4BRQA 2DXDA 3QNWB 4X62F 1P7DA 1VQ5S 1ZPWX 4DV2K 2HHQA 2LMRA 5K8OA 3G8TA 3KLEA 1W26A 3BS7A 2QW9A 4CNYA 1COKA 2V4RA 2K7JA 3M1VA 3OYMA 2H1YA 2CIMA 9ICBA 4QZ9A 3F5AA 5I4MA 4LVOP 1KVAA 1ZJNA 5DETA 4K25A 4Q2LA 2LDYA 3KJNB 4ANEA 2QJ3A 3R7SB 3CPEA 1DURA 3O4NA 2HI0A 3WUHA 1T9TA 1QSLA 3AVNA 5HMXA 3DLLQ 4FWKA 3CG7A 3WK7A 7AT1B 2Q66A 2OMLA 5CWRA 2V52B 1LWFA 4GC7A 5HHHA 4OPHA 4DR7F 2UXDF 1S6UA 4BRFA 8ICEA 7ICMA 1FJ7A 1C1AA 3R6GB 3W8GA 2G8HA 1X6JA 2X74A 3H40A 4S0MA 1NDCA 2XY5A 1T9YA 3TUIC 5KPZA 1R27B 1AUSL 5C2GA 2E5IA 2ZZMA 1PJ6A 2DKXA 3KKSA 3AAWB 3GP9A 3UD3P 3KDOA 2QEXS 4WF9L 3QSIA 4FO0A 4YMMA 1QDUB 4OI3A 2VH7A 1BQXA 1LAWA 3H45C 2KFZA 2OPQA 1BUXA 3DDNA 2XMWA 4YHHK 4ISFA 3BJYA 4NLGA 2BZFA 5K8NA 3HSDA 3I32A 1RNHA 1E4GT 4HI1A 1HX1A 2M88A 3B78A 4NLXA 3DXKB 4GXJA 5AXLA 1T9XA 2E8NA 3G86A 1Z4UA 3NGIA 2M8DB 3VTIA 4ETXA 3RAMA 3HOSA 2RDJA 3R3TA 3SQ1A 1YAGA 2X1FA 3BO4A 4X4QA 1WG5A 3CCEN 4M2YA 3TX8A 5GVQA 1WSVA 3MMBB 1H73A 4I2PB 3TZWA 2ZVSA 1Z05A 3BQTA 1TVRA 1BXNA 2X1GA 2ZG6A 2LA6A 4FVUA 5HMLA 1OPIA 3AFGA 3VQ5A 3R27A 1FXRA 3W1YC 4NX9A 2RVJA 3BEXA 3HO1A 2GC8A 2D0CA 4CGHA 3SMPA 4PABA 5FROA 2G8KA 4LFAJ 2WOMB 4DCCA 1RBSA 4H4MA 4QIVA 4DV7J 3QEPA 1RT4A 1QQNA 3MMAB 4M3RA 2JJ4D 3OVSA 3NVKA 5KFZA 1V3SA 4PKDB 4O4RA 3EWAA 3FK4A 1TZ0A 2HS4A 4BRKA 2CH5A 3WBZA 2AQ4A 1BA1A 1RWPB 4Q45A 2OHFA 3MEGB 4KGVB 1I1GA 1WBDA 9ICVA 3N5BA 3TUPA 1GTHA 1U2CA 1NZ8A 4HACB 1XMBA 3UPQA 3D67A 3BS5A 1KFDA 2UUCK 3D2EA 3P45B 2HS0A 4E3SA 2P5OA 1ATRA 4A8QA 4ZHRA 3H4BA 2MZQA 4CZGA 3Q23A 2PBDA 4H03B 1U6BA 2I8EA 4Y0WA 5H1SQ 2E5LK 1X5TA 2HF4A 4Z7CA 1LOUA 3LALA 4KTZA 4UASA 2BUNA 1KDHA 3J7YP 1J54A 4UAVA 4ZVFA 3J81Y 2PMWA 1V6HA 5AR0A 4PL1A 1TYQA 4AHUA 5B0BA 1U1MA 2F2AB 2CG8A 1NZBA 4PHTX 3N7RC 3P5TL 3AB4B 4ALZA 4KRFA 3M2VA 3OA9A 4DR2K 1V3RA 2MHNA 5AJ3K 1QE1A 2DR9A 3KLHA 1NB2A 2FZGB 3RWUA 3CD5A 4KRWA 4V19X 1QE1B 2NXCA 4ZP8A 3LDAA 1Q7LB 3CJAA 1HNWF 3CD0A 3D1QA 3PRBA 2R8KA 2YB1A 4OHVA 4Z0UA 3KWMA 1XHZA 4ILHA 4YY3K 1DQ8A 2F9TA 3BM7A 3SXLA 3QJLA 1JI7A 2AJ0A 4ZCLA 3OTOJ 1C0TB 2ZFHA 2QWLA 4MK8A 7ICEA 1VK0A 3JPTA 3GFKB 4DV5J 3A5MC 4M9JA 1MG7A 4HVZA 2JXJA 1FEHA 2RD5C 4DOZA 4MO4A 4NLRA 3C2PA 5CAAA 5KFWA 4R66A 4QQBA 3TPQA 4IC9A 4BGAA 3ID8A 1RHQB 1WB9A 2V67A 3NF6A 4CEQA 4KHMA 1ZQFA 4AXJA 7ICFA 1TVAA 4KQZA 2PYJA 4GMJB 2NQPA 3C6TA 1RTJA 4GKKK 2QYGA 4ELUA 4ANDA 3AO2A 2W40A 1UVKA 3HVWA 2KEYA 3TEHB 3CCLN 2PY5A 1NJYA 1FWPA 3P4IA 3CJQA 2IBKA 3ZXWA 2EXUA 5HQLA 4WZQA 1QSYA 2IHR1 4CFDA 3T6BA 3PW0A 3TEGA 5HMWA 2WOMA 3AV9A 2EZZA 1GH8A 3SENA 1NNLA 2P9SB 5GADP 3NRWA 4QR2A 3KJVB 2CJAA 3MX2A 1HNXK 5J8YC 3TAMB 2YJFA 1FFVA 3VAJA 1MA9B 1RAOA 3CJTA 1JJHA 1RA6A 1U6ZA 2F8HA 2ZIXB 2QE5A 3ULDA 3OYGA 1OSDA 3EDRB 1FKPA 2MQMA 5L1KA 1SVDA 4BRHA 3L2WA 2BCVA 1ZM3A 2YMQA 4A62A 5KT7A 3RG6A 5DO2A 3SEIA 1J5EF 1JXBA 3OYDA 1T03B 3MOJB 2MEWA 1HNVB 4I2CA 2YHYA 3CJ8A 2CPJA 4GO7X 1N5WA 1OVQA 2IMWP 3JXUA 3ISNC 2XLKA 4YN3B 1OYDA 3FM9A 4IG3A 2MDAA 2R18A 1UHUA 3BR9A 1IH7A 2QB0B 1HKCA 3RJHA 2V50A 2KH9A 1VRQC 2FSKA 3WQTA 2V8PA 1UPHA 3WHIA 3VCDA 4QS9A 3OYJA 2ZOMA 1RDRA 1WYGA 2D9PA 2WUSA 4R79A 1TV9A 4NI2A 5AI6A 4CEBA 5B0GA 3R6MA 4Y2TA 2RN2A 2PKEA 3D6MB 2F7VA 2RT3A 3EGNA 2KI2A 4CJTA 3GV7B 4MFBA 3MCAB 2BQUA 3QT8A 4IFYA 2R2SA 3HX9A 4PYAA 3QAUA 5IWAJ 2Y8YA 4DUYF 2UU9K 2BPCA 1W2BR 4GY2B 4A59A 2JRZA 1TL5A 2AHOB 2HEKA 3NF9A 4N7TA 1U0SA 1PC5A 2CDQA 3DDIA 4P2XA 1EWRA 1FDBA 4HCBA 2HOFA 3AAPA 2OEJA 4TQSA 3T6JA 3KKAA 2A40A 3D28A 1HNVA 2DO0A 1S97A 3NL0A 3VWSA 4Q44A 4RW4A 1NMEB 1P9YA 3GJQB 4DPTA 2YTUA 7ICNA 2RHQB 3IR7B 4RNNA 3KWGA 3CJ3A 3R7NB 3VEOA 1A77A 3C0BA 3OUYA 5KFFA 9ICGA 1N5YA 3OTOF 3THVA 1S77D 1S4FA 2Y9TA 3VQSA 5SZTA 4C0OC 2KMDA 2IJNA 2E8PA 1IUJA 2CZ9A 4DTRA 3CCVS 1EHWA 2KG1A 3ZD8A 2ZE2A 4AQYJ 3T1YJ 1FXLA 5AKEA 3O6WA 3KD3A 4E7LA 2B4UA 3CCUS 1ZQUA 3C21A 3KHYA 2ROEA 2RHKA 2Y9UA 3R8EA 4PG4A 3QMQA 1NLKL 2FBVA 2MPUA 2YQ0A 2LMIA 2GHWA 2BJDA 4HDHA 2FVCA 4CJFA 2GWKA 5ALXA 2UU9J 5L9XA 1BD6A 2AJ2A 1ZXIA 3H0LB 1M5HA 1S1UA 4JV1A 2E1YA 2HMXA 4DCHA 4BE1A 1V97A 3LGNA 2P35A 8ICLA 1XMQK 1M1KT 2HAFA 4QCLA 4NB4A 3ENWA 2E7VA 3H25A 4C8ZA 4UB1A 2KT5A 2QMUB 4LSNA 3C2LA 1M90T 2IIHA 2PMZD 2NV3A 5CA7A 4IFEA 2A2DA 5J2JA 3PMLA 1IKWA 3DLKB 1WAFA 3ZZYA 1YITS 5CR0A 3FR0A 1SJFA 5H9FJ 5LJ5Y 4RW9B 5KFJA 4PXCA 4QW9A 3QU4A 3ZZUA 5AQNA 4Y2AA 3QESA 4OJ5A 1FDAA 4QIFA 2GGPB 3VV2B 4O5EA 3TI0A 3PYDA 2B9YA 3NDKA 3NCIA 4IQTA 5IC6B 3CJKA 2DTUA 2ZM6J 1Y7PA 4QBUA 1UEUA 2KIWA 1BPZA 3MM9A 4EUVA 4ED6A 1E6YA 3TTCA 4BLGA 4UAYA 2ASLA 4XDDA 5FD1A 3HMJG 1WSGA 4CK2A 4PG6A 4YDUC 2Q97A 3K5OA 3BP8A 5GADI 4CF0A 1IJJA 4HL9A 1UCNA 3QGHA 3IWXA 3CJ7A 4RBTA 3GE9A 1HNIA 3R5JB 2BABA 1RT4B 2ILZA 4YR0A 1RE1B 4I1TA 2GLEA 3LH2S 4TU8A 4QZCA 2KXFA 4KLMA 3LPUA 1X4GA 1MQ2A 1LW2B 3NLCA 2NPFA 1P9QC 3FGVA 2G8UA 4U6PA 4F72A 7ICVA 3TVYA 3WNFA 4JLHA 5MAOA 4R5PB 2HGMA 4DV4F 4OQJA 3N79A 2ZIXA 5A0LA 2B6AB 2FJXA 4Z7YA 1ZTWA 4DDFA 3ZO7A 3VAIA 2GTDA 2DRBA 3RJKA 2FHMA 1PK3A 1T6CA 2CFXA 3OLBA 1UQVA 2E8AA 2FJAB 4PZVA 3CJ9A 1BL3A 4DR6F 3GV8B 2O6KA 5AKZA 4LFBJ 2PAVA 4O4GB 5KT6A 2K7KA 2P9GA 5GAGI 4MEYA 4US9A 2NUBA 5DDYA 3HCXA 5LY3A 3HD1A 4P4MA 2RPIA 2PZSA 3K75D 3KG4A 5HP1B 2DH8A 2VDIA 3NOCA 5ETVA 3KYLA 1F21A 4CEDA 2CRLA 2GJIA 4AT1B 5JJBA 5FDLB 1MN9A 1YVNA 5DM6Q 3OD2A 3CIZA 2ZZTA 1WEYA 4J8FA 3NP5A 3ALYA 4IUFA 1ZM2A 2RLTA 2F4FA 2R2UA 2CGKA 1VJWA 2QKBA 5C42A 2M9NA 1HQUA 3S7RA 1QAXA 4YDXA 2CH6A 4F8RA 2E1AA 2FY1A 4ECSA 3DRPA 1W2BM 3ZLJA 2VU5A 4IH5A 2KM8B 2ZQBA 1ECWA 4BR4A 2QG9B 1SXEA 3GYGA 5EN1A 1RAFB 3DAWA 3IKMA 4OHWA 2XM3A 4IOCQ 1BWFO 2KRBA 3V7KA 2B4VA 1BPYA 7ICOA 4MK9A 4NXZA 4BX9C 3UE2A 5AZJB 1DKGD 3OYBA 1HEKA 3RH5A 3D2FA 2HSEB 4CF1A 3CETA 1Y5LB 1KTQA 4WPAA 4V19J 1S3XA 2RE2A 3MMBA 1N6QA 2ZJ8A 4CJ3A 3I8DA 1N52B 2IIRA 1AT1B 1TKTB 1DGKN 4YHHJ 1SL1A 2YX7A 1CUKA 1H6KX 4ZPTR 1HR0K 2VG7B 5C0YA 5F8GA 4TUQA 2FTRA 3W66A 2HHTA 1ACMB 4J7CA 5K14A 2AGOA 1SAZA 2AEMA 3THPA 5ITHA 4RNHA 2ZH3A 4GNIA 1N36J 2IVFB 3C5FA 3LANA 1RACB 3SUPA 2K89A 3HZEA 1F1BB 4WE1A 2A3JA 2GO8A 3THTA 3LL3A 3CC7S 3L6QA 3HPHA 1FWKA 1L3UA 3LA0A 1DEJA 3KHHA 3QB0A 4O44B 1K1SA 4B1ZA 1MROB 4B1VA 4M5NA 5CHCB 2AW0A 2UVVA 5GTIU 4F4AA 4RWXA 5AXNA 4FWMA 4I2EA 4QIWC 2RHSB 2CZ4A 3IAM9 2Z57B 1KOHA 4F3QA 1K8AT 4DB3A 1RTHB 5BYRA 3D2NA 2KNJA 3S3MA 2MUTB 1HBUA 5KRSA 5AK3A 2L08A 2ZXIA 4JRPA 1N56A 2QXFA 3V6JA 2XB2D 1MU2A 5LM7E 1PGZA 3SMVA 1X3NA 2VKRA 4L76A 3ZDBA 4RQ8A 4K7QA 2D6FC 3CPWM 4O3RA 3KWIA 4ECZA 4HWIA 3K58A 4I0WA 5D6GA 3C23A 5HRPA 4LREA 2IVNA 5KAFU 4JKGB 4KX5A 4QWCA 2XICA 3FQLA 4F5RA 2F3JA 4DFKA 5ALQA 3M8QA 5J0RA 1JALA 1CC7A 1LNQA 2RHFA 4ILGB 2ZUAA 1U02A 3K0JA 1CULA 1WSRA 3VGSA 2CJ9A 4Y2YA 2QEXN 2EK1A 3E0FA 3M6GA 1UZHA 3C28A 4LF7J 4JD2B 5B0CA 3HPOA 5BR8K 4I27A 1OJ4A 4WQ4C 5DZ7A 1NSAA 2XVTA 5SWMA 1TFWA 2BCUA 1RT7A 2PE8A 5C2DA 4NLBA 1CJTA 3F9KA 5C24B 1TR0A 1Z25A 5JS1A 2RAQA 2GHPA 2C2NA 3GCWP 3LDPA 4CZLA 1M5KC 4TY8B 1FFWB 4CIFA 5CRXA 4FM1A 4CK1A 2Z2LA 5HMZA 4MHVA 1SKUB 1DLOA 3NH0A 2MQLA 1T0TV 3DM2A 3OTOK 2YKMB 5ETOA 4IWVA 2VUGA 3W9IA 3QZ7A 3NNCA 3C95A 1U0HB 1JLEB 2MYFA 1HA1A 1BPXA 4DLGA 3TARA 3S3OA 5KFQA 2QLFB 3MECA 1NB7A 2QL9B 1S8OA 3O1WA 1RBRA 1IKWB 2ZH7A 4ZITA 5BR9A 4DSIA 2FZCB 5TKYA 1T94A 1XNQF 3QEBZ 1HBNA 2HBKA 3RJEA 2DBBA 2Y1LB 2K3KA 3QIPA 2BRKA 4WFNL 9ICFA 1URRA 1KNZA 1QVFR 1UAWA 4DQRA 1M5SA 3AN1A 1Q5VA 1VLOA 3QYPA 4CJQA 1I6JA 2BUPA 4IJAA 5CJ7A 2WVBA 3NKYA 2VKZG 1M1GA 3MEGA 2A6MA 2VYPA 4RW7A 1UFKA 1DTTB 3AARA 3C65A 7FD1A 2E3TA 3PNIA 3JXOA 2OIHA 3THYA 3W5XA 3TUZC 1AQ6A 2WAQF 4PQUB 5BPNA 4PL7A 1Z1VA 1H7WA 4DR7J 1JCFA 4F7VA 3ENHA 1LWXA 1GXTA 2H9ZA 2BPFA 3PX4A 2GV1A 4ZPVR 1PBUA 1JLCB 4WK1A 4AYBF 4NLTA 1KP6A 2EKYA 3Q2TC 3I0SA 2QGFB 1JLBA 3OTDA 3BB5A 4NXMK 2LYVA 4WXOA 2YWKA 2K1RB 4M5DA 2DPNA 4CGZA 2FBTA 2ZH1A 4CFBA 2HRTA 4C8NA 1NK6A 1VMBA 4YHHF 2HB5A 3CERA 2U1AA 4F2SA 1WF0A 4DMNA 1YT3A 1XHXA 3L2QA 3LP0A 1EARA 4KLFA 1TUUA 3FZ2A 1FE4A 2JWNA 4CBWA 1EP4B 2RKIA 3ZSQA 1X4HA 1JUDA 3M8WA 2EH9A 3PCOB 3Q7CA 3KHGA 1HLUA 3IC1A 3UO0A 3DLBA 4KI6A 3MPDA 3HHDA 2FE9A 3K5NA 2FIUA 1LXJA 4KHWA 3ZDEA 1FI4A 3I5CA 1DBDA 3DRYA 9ICEA 2YJEA 1F3FA 1K8AO 1IN0A 1U2FA 1H3DA 5AZJA 3GV5B 4L74A 5BREA 3RGIA 4K4HA 4KB7A 3I82A 4FZZA 4PXBA 3UDCA 3DHXA 5BN8A 4UBCA 2JC1A 3UN5A 2MUTA 1QHAA 4OD0A 3PDNA 2OYYA 5HK4A 3DYAB 4Y2UA 2A0FB 3OYIA 4FS2A 5CZ1A 4NLCA 1VLBA 2VG6A 4YDUA 4Y2QA 7ICHA 2V8DA 4ID5A 4AF1A 3EICA 1KFTA 1HFEL 3QE9Y 3RAQA 5ALKA 4LF6F 4J9OA 3M1VB 2JVRA 1KWMA 1XMQJ 3HZ6A 4WE1B 2KKPA 4XIUA 2D7SA 2ZVIA 4NZ6A 1CVJA 1T6DA 2WBNA 2A6OA 3PSTA 2DIVA 3RH4A 5AM4A 6FD1A 1KBUA 1R8CA 3O9SA 3NS1A 3UWTA 1J2VA 4ZJOA 5TKWA 4FK2A 5L1LA 4PUOB 2J0WA 3ATVA 1L7NA 2DGQA 3LZJA 5KAKA 4NCAA 4DS4A 1YBTA 3L8BA 2DR7A 3ET6A 3BGRA 4MTPA 2RS2A 1Q16B 4USHA 3LAKA 3I4HX 1K73O 4DV2J 2XZTB 4L3NA 8ICXA 3KNAA 1SCJB 2LXUA 2NNWA 5ETLA 5DBBA 3POTA 4DR4J 3HSTB 1CJTB 1RQ0A 2UUWA 4JK8A 1X5SA 1L3TA 4DTXA 2IJFA 5EDWA 1X7VA 2AGQA 1UFLA 3T1YF 3F73A 5A0YA 4DV0J 5DDQC 2ASMA 1FESA 5HVGA 1BPDA 2JLEA 1X9XA 5G5GA 5ETPA 1GFWB 1KEKA 3ISBA 2P5GA 1UW4A 3E01A 1B99A 2P9IB 1DOQA 3Q24A 5AE1A 3E01B 4CZKA 1UTAA 2FB0A 4TSXA 2I7PA 2QLTA 2BZ2A 1BCOA 2G0JA 1XR6A 2ZDPA 5KQDA 1YKWA 4LSLB 5BN9A 3ZT1A 1EXNA 4M63A 5HATA 1RGVA 3CJ5A 3IRXB 1WTBA 1TL1A 3OR2A 2AWZA 2Q2RA 3U27A 1S9GA 1HYSB 4NLZA 1Q81O 1BO5O 1H98A 2ZWPA 4CZEA 2ZH2A 1Y9OA 2E88A 1U8WA 1HPMA 1D9DA 4XO0A 3O2IA 4DSFA 4JKCA 3TTDA 2G1HA 1ZD2P 1NGDA 3RJGA 5ALOA 3CIPA 1FX4A 5HR6A 4PEOA 1ZQKA 2XI3A 4UB8U 4KIAA 5M1QA 3QPIA 1K8KB 4E1NA 1NSKL 1Q86T 4M45A 5KFCA 4P0PB 4TLQA 4WQ4A 2IOFK 1V9OA 3ILLA 2QLWA 1KR4A 3UQ2A 4CF2A 2N3LA 2I6XA 2MLZA 4ILMA 2V69A 3G6XA 5J2MB 1ASUA 4X66K 1WELA 4XRHA 4P9SA 4CJRA 1VQLN 1R0AA 2ITMA 3A2FA 4K0KF 3QUTA 3H3NO 1BWVA 2VQEJ 1IM6A 2NRXA 4IRDA 3BYRA 3E1YA 3J7AP 4I2HA 1RISA 3K0SA 4NV0A 2LXIA 3GLJA 3JQJA 2C1EB 5KFEA 3C6UA 4OKEA 4MN4C 4BVOA 4KLGA 1N2XA 3C15B 3HFZB 3V81A 3LOUA 1HKGA 1NK4A 1NBWA 3I8BA 1Y0HA 2OHDA 1N33K 2D1KA 2HFVA 1SI9A 2AV5A 2OGUA 4EENA 2Q36A 3BKUA 2W24A 2D1CA 4M6WB 4JI6J 1SXLA 5CYMB 1WG1A 2QSWA 3TAPA 2GVDA 3VEVA 4YS2A 5C25A 3WEEB 3LVWA 2HQIA 1AZSA 1RFQA 4Z4FA 4NLKA 4UOHA 5CYQB 2M5YA 4X84A 4I2GA 1NAQA 1QZ5A 1OQ3A 5JVGQ 1S9EA 2HNZA 1MSWD 3SUOA 2XNRA 1IG9A 4FWRA 3EGZA 3IWLA 1X60A 2YNHB 2PMHA 3BS5B 3OPXA 2H5IB 1U1NA 4C4SA 3CW2C 9ICUA 1C6VA 2JZBA 4QS7A 3KLVA 1Q79A 3O44A 4RQ4A 4P10A 1VSIA 2BQ3A 3RU0A 5AKLA 4D3GA 5LOQA 5M1PA 4BGDA 2E5LJ 5AQIA 3ZC4A 5CZXA 4CHPA 3I9V9 3K8WA 4JV5J 2Z56B 3CCRS 3MTKA 4B6JA 1NEEA 4FLTA 3MWBA 4RW8B 3C1ZA 4JI0F 2H5JB 2OZSA 2XRIA 3C14A 3M2RB 1X31C 4FJMA 3HKWA 3R2CJ 4DTMA 1EQ0A 5D0EA 1R7IA 4M3XA 1K9MT 2EBGA 4JI4F 3NNHA 1U1QA 3Q8PB 3C19A 2IOCA 1I39A 1VSLA 4DV3F 2D74B 2NXEA 2CGLA 4MFCA 1HBOB 2LLZA 3NY0A 5ALLA 2B8QA 5J2NA 3OTQA 2KXHA 4PL8A 4ILRA 2HWTA 4F0HA 4H0OA 1TE2A 3HHLB 3C6TB 1HR0J 4ED0A 2MLYA 5IWAK 3MMCA 9ICNA 1GLBG 3B0YA 3LDQA 4E7KA 3THWB 2W7PA 1NJIT 2KO1A 2R7OA 1RZMA 3OXGA 1HD0A 2MKCA 3W65A 3JYTA 1C4AA 2UUAK 5J2HA 2Y8WA 4KHSA 2WF9A 2W2QP 5B0EA 5CCMA 1U2VA 2VG5B 2XCPA 4DFJA 4PHEA 1D8LA 2E8OA 4NXMJ 4EAHD 2RE1A 1BVSA 4Y2IA 3UCUP 2C2DA 2YKNB 2EFVA 2DEIA 2GV9A 2PFOA 5KPRA 2Z1IA 2EWHA 2UXBJ 8ICHA 2Q43A 2HMPA 4J9SA 4GIBA 5HHIA 1B3TA 3O5BA 2A1RA 2WF6A 4DV5F 2VQFK 4KMOB 4RUHA 2HOIA 2X6SA 2KG0A 2AP6A 3TA2A 2EHGA 4HTJA 4OJ6A 3QETA 2VCPA 3D4JA 2HHWA 5M2PA 1XNQK 3IBCB 2Z2MA 3GU3A 4CIGA 1VQ8N 2CKWA 5BOLA 1UT8A 2CPFA 1HBMA 1QTMA 2F3NA 4CJUA 1TL4A 4DCPB 4X4VA 1TL7A 1CQMA 3EN9A 2G4BA 4IFYB 4FPRA 1HMVB 4A5BA 2OYQA 2JRSA 3IM1A 4CFAA 3PSIA 4CO1A 4DS5A 5AZIB 4NI2B 4EBCA 2V63A 3MPVA 4GV3A 2DR5A 5IQ6A 4JK9A 1SB6A 2ERRA 1VR6A 1XJWB 3OHBA 3K59A 3UR3C 3TSQA 1VJ5A 3B4DA 4QWEA 3HVTB 4BC7A 3U3YA 5BR8J 5IM0B 2P5VA 2XGPA 5HN0A 4ZKAA 1FCAA 1FJGK 5J2AA 2M3DA 4KT0C 4FJXA 3C14B 3DRPB 3M2RA 4JYAK 2XSFA 1XI1A 3GONA 3U02A 2AX0A 2V7ZA 1NJIO 3Q8SB 1NH7A 4P0QB 3NAHA 1RKIA 3V9ZA 3KK2A 9ICOA 5LJWA 4WP8A 1IR1A 4B1WB 1SL2A 1MC8A 5KFHA 3TRGA 2RRDA 3V2UC 5AI4A 4JV5F 3ENAA 2HBLA 2ODGA 3RBZA 4NASA 4CZHA 1WKJA 3UIQA 1RYSA 1NK9A 1SJ1A 3A0BU 1B0PA 2ZEJA 4YUDA 3BS9A 3QBXA 3MMVA 1IKXA 2W11A 2BHNA 2UUTA 4PH5A 3R7BB 1GOAA 5DK5A 2Y0SF 3MDFA 1S1WA 3EWGA 1L8OA 4M3WA 1U09A 1WG4A 5J0XA 4X4OA 3BR8A 4W5OA 2YWWA 5CR4A 1DGJA 5ALMA 4RJVA 1JLQB 4HT5A 4M9NA 1IBLJ 4I9QA 1U1RA 1MMNA 3J80O 4JK1A 5L46A 4G1QB 4FW2A 4FN5A 3D2EB 3OLAA 1N4LA 1ZA2B 1DZ5A 2ZH9A 1DHMA 4WFXA 3HSGA 4HEA9 4V19S 3CDBA 5KQ8A 4O5KA 1CJKB 3UDEA 2J9DE 2HW3A 2HHSA 2Y0SD 5J2BA 2V4QA 2I5JA 3KG1A 3H08A 4HUEA 1SWVA 2P9KB 1I94J 3S9HA 1V38A 4F50A 4I7FB 3D7EO 5H9FK 3H4DA 4JK7A 4I7FA 5KFLA 3O9QA 2AZ1A 1S76D 2W7AA 1V5IB 2ZOGA 4ZA1A 4RR5A 2CVEA 2KHVA 2GAHC 5DDPC 2IRXA 2WVFA 1WBBA 2B0GA 5J0WA 4ECYA 1S5ZA 4KLSA 2EAPA 4BDZA 4ECTA 4LJMA 4IXCA 2CGJA 1SQEA 4L8RB 3CJSA 3M8YA 1NJWA 1XMOK 2MA1A 3OYLA 3J80Y 3I28A 2M9KA 5D4OA 1C0MA 2OUGA 5A2QO 3M30B 3LAMA 5KOWA 2FLNA 3SEOA 3HRDD 2HVIA 4G9BA 4IOAL 3FDSA 1KFSA 2O8CB 3D6TB 1JXVA 2Q0ZX 3WK9A 3NWRA 2ZHAA 4IRCA 1K47A 2PI4A 1WAJA 2L3MA 2HDOA 1TP7A 3H1QA 4DU3A 1R3NA 1N5YB 3AMZA 3TZZA 1DFDA 4P74A 3G4SS 3T1HK 1ZYQA 1X2IA 3JS9A 2UVWA 2HFUA 1WACA 4X62J 3G6ES 5ALIA 1KLMB 4KLEA 4IQUA 4KYZA 1GLLO 2CAJA 2CJKA 1T02A 4YXJA 3JSRA 4FK0A 3SUQA 3KMSA 1X9JA 3UNGC 2LECA 2YY6A 3O9UA 2R9LA 8ICRA 2DY9A 3QGPA 4DR6K 4K0KJ 3V6HA 4Y2MA 2D9OA 3CJBA 4J03A 2X78A 1TQLA 4CF9A 4DG1A 3WC0A 4LFBK 2Z1GA 2CQ1A 3IS9A 2PDAA 1AW0A 4P2MA 3FSIA 5B7WA 3QT7A 2E4LA 3VGLA 1VGYA 4LBIA 5AT1B 2XWXA 2JR5A 1P6TA 2OAUA 4QIEA 4I2DA 2NUHA 1GMWA 3PFEA 3NVYA 3DXKA 3V1OA 2CN1A 4WJBA 5K9FA 2NYVA 1Q0NA 4A48A 2JOQA 2DQNB 4M1KA 4A8SA 4CJ5A 1S4EA 3QU7A 2G08A 2VBXA 3ET6B 4KH6A 5BR8F 1KONA 4ZPCA 4DL6A 5HOOA 1HJOA 3L2UA 3R5DA 3V6DB 3AOBA 2PGCA 3AODA 5M2RA 2FVPA 1S6OA 2ZZNA 3MEDA 3AGRA 3OYKA 4JS5A 2L9DA 1VQ7N 2ZDOA 2P9UA 2KLAA 3VGMA 2ZXHA 4EK2A 2AJFE 3IBWA 5DQIA 2W9CA 4DV0K 4G9ZA 2H5EA 3OPKA 1LFWA 4DV1J 1RAHB 2W1BA 1QUPA 1I94F 1VQPN 3V9XA 4IQXA 4NCBA 5AFUA 5AM2A 2AYMA 4KGXB 4KHPF 3SI8A 1D4XA 1B0VA 1BY9A 4Y2CA 5CY4A 1KKXA 3TANA 3NGDA 1BNPA 4DG1B 4DF8A 5KFIA 3P4UB 4IQVA 2GO9A 2VFSA 3IFRA 1XNSA 4FYXB 2GVZA 1R0AB 1BCMA 3F2DA 1YX2A 2R2TA 2XSJA 3LDSA 4ICAA 5JS2A 3EW9A 4NRUA 2CVIA 2ZBPA 1O51A 4AILC 3RR7A 5CQGA 3AA9A 4LF2A 4IDKA 1XIQA 4JYAF 2NR0A 3SQ0A 2DYAA 5B8HA 2KP7A 4DR2F 1ZBHA 3CJ2A 3ZT3A 3CCZA 3IMQJ 2KN7A 3MD1A 1QUVA 1F44A 5C5JA 3FSXA 4DLEA 1NG9A 1VQNN 2QA4G 2Y3YA 2DO4A 4M3UA 4OYPA 3H5YA 3R9PA 3WKEA 1YHQN 3DCAA 2V8VA 4N77A 3IR5B 4NXMF 4FLWA 3MHYA 3V1RA 2UXCK 3K5MA 3T41A 3LVVA 4Z6CA 2P9UB 2G5HB 1ITGA 1ZQDA 3CFRA 3TU5A 5JLHA 4O3NA 3LUYA 3BUZB 3F5TA 4XUSA 1H74A 2H54B 2JEIA 1ZH5A 4C0BA 3LGMA 3JTPA 5BYQA 1S57A 1HLWA 3QX7A 2PN6A 5AM0A 1RWXB 2CQ4A 4JI7K 4ID5B 1KVJA 1HIYA 4H5NA 5AKHA 2YNHA 2WRMA 2R2RA 1IV8A 4JV0A 1KVCA 2I0XA 4WKRA 4CLSA 2DTJA 1H2UX 4ERDA 3IG8A 4FVCA 1B22A 2NSCA 4H5WA 3QT5A 1OH5A 1P8GA 3QYYA 1EX8A 2J9CA 2R4FA 4O55A 3ZNUA 2VWJA 5ETTA 3ILJA 2E5LF 4WIQA 2ASOA 1Q4RA 5FLXY 2P9EA 4GO5X 3IG1B 2H48B 2E2PA 4ZOSA 4GVLA 4FJ8A 4IDKB 3NNAA 4Z37A 2E9ZA 4RL1A 1HI0P 3FMWA 3SJJA 3AVIA 3MM9B 3TAFA 2ZKTA 5DLFA 1TL1B 2VL1A 4USAA 2ZGZA 9ICIA 9ICXA 4DL7A 4OI2A 3SV4A 1VAZA 1S6QB 8ICUA 5RUBA 1Q1KA 2FDRA 1C0UB 2LQ5A 3WXKA 4M47A 3FKBA 3A4TA 2SXLA 2MKHA 4K8RA 1ZD3A 4MLEA 4Y3CA 1B0TA 1V4TA 1YITN 4WKYA 5EWEA 4B1XB 2HVZA 2RRAA 1CI4A 1IXKA 5LXYA 5JTIA 1F3VA 1R43A 4DV0F 4KB1A 1QD1A 3DRRA 4R64A 1SZPA 2MMYA 3WK5A 1W7WA 2FPKA 2DXFA 3I56S 2KQ2A 1RBLA 1N8RO 4BRMA 4JUZA 3HDSA 1KLMA 3WQUA 1KQQA 4KTWA 1KXPA 4RX6A 4C6AA 4ZCKA 3VQTA 3VQ9A 2KK0A 3QFUA 1YGYA 4OHZA 3SSQA 4OJRA 1S1TA 1KW4A 3M8ZA 4OYOA 3UMBA 2B4OA 4JEPA 1DTTA 3MM6B 3W8PA 3DXMA 4HCCA 2J5AA 1VRUB 4N5SA 1ZQPA 3DOLA 1Q9XA 1P27B 3UVJA 4DU8A 3LYSA 5ALRA 4IOBA 4RKUC 3FE1A 5G4DA 3TX0A 2DRDA 2BOPA 4MF2A 1W2IA 2R7VA 1RT5B 4OLPA 2IVYA 3GCXP 5AK4A 1C1CA 1UVJA 4KPCA 4C8OA 2B4PA 3I55N 3PZPA 3EX7B 1X6IA 3QSYB 4QWDA 1WNEA 1KAZA 4NJ8A 2G8FA 3S6JA 4OJLA 2ZTEA 5HBMA 1M5PC 2YHWA 5D4LA 3R3LA 3C6UB 1VRTB 3TZYA 3RJFA 4RW4B 5IV3A 4O8UA 3FZKA 1F2GA 3Q86A 1SKRA 3IM8A 3DMJB 3H0MB 4GKJJ 3LM2A 3TVZA 4AHRA 3U7JA 3KHLA 3G82B 3M6XA 4Y2SA 3VQ7A 1N48A 1REVA 4B3SK 2RDDA 4X62K 5G0RA 3UM9A 3FUYA 4TY8A 2PSZA 1RWUA 4X64J 3OHRA 3E3XA 5DRKA 1MMDA 3NAIA 2C28A 3MEDB 3UNYA 1YJTA 2BOAA 4TNOA 4L3QA 2F8SA 2HZCA 5CZ2A 4C0ZA 2E5GA 4AHSA 5A76A 4JI4J 3HPGA 3Q8KA 5AQJA 1VK3A 4J91A 3DRSB 5DQGA 5GMKa 1UA0A 3L9ZA 3QO9A 3FBEA 2DKZA 1YWXA 5B0DA 4CZCA 2C3UA 3VGVA 4KH1B 1FKAF 5HI7A 5KFGA 1QS4A 2XLIA 4BRAA 3QEVA 2E8MA 5ETSA 1RT3B 1T3QA 2LYHA 1M0SA 1RT1B 1VQ5N 2AIRB 1UA1A 3KK1B 2FDNA 3SQ2A 4ETZA 2KHQA 5IM0A 4CHYA 4I2IA 3PX6A 1JJCB 3C7NB 4NPOA 3D3CJ 4Q8EA 3UFCX 3FFIA 3BQ1A 1SH0A 2OMOA 3E9PA 1NJXA 3UKRA 1NGIA 4P2SA 1RBTA 2CNNB 3RSEA 4LF6J 5D4BA 2BA9A 4ZPDA 3CO9A 4P71A 2RQMA 3CDEA 3MCNA 2UU9F 2I5JB 1TMMA 5T14A 2O01C 4E19A 2LP4A 1U1KA 1QSSA 4BS2A 5L8RC 7ICTA 1QQ5A 1T3OA 1ZQYA 1GNKA 1MLAA 2G2ZA 3MN6A 1B7YB 1ZAVA 2DNGA 4MK7A 4TY9A 5HP1A 4Q43A 1ZXOA 2KN4A 1U1LA 5GTHU 1RAIB 4MKBA 4IO1A 2ASYA 3R5BA 5IXUA 2BM0A 2GMHA 3DLHA 3C16B 3QBCA 3PV8A 1HW9A 5AKYA 3PMNA 4CGFA 3JQKA 5DMRA 1S5LU 4JKGA 1DQ9A 3CC4N 1TL7B 8ICZA 2VJ4A 1F9FA 3M5RA 4EI2A 4Y2XA 5EXWA 3A3OB 2YNFB 1O8BA 2MKJA 1RTDA 4H8KA 1G99A 2LM4A 4O23A 3LF0A 4ED1A 2HIQA 3HFKA 3QUBA 4DCJB 1SIWB 5HL7Q 4JI1K 4PPXA 3ID6A 4QZGA 3QWUA 2HBZB 1IKYA 8ICYA 3T7ZA 5AM5A 3C8YA 3SBMA 4FWSA 1GO3F 4RUAA 1A6SA 2KB2A 1S7HA 2N1RA 1RT6B 4FWPA 1N8RT 3UXPA 3IUCA 3OBIA 3ZSZA 3H2LA 2YI1A 3GR0A 2PA8D 2FUG9 2IAJB 4H5TA 4RU2A 4DR4K 3EUB2 3SQGB 3J7YI 5A0YB 1JB0C 2DUYA 5AKGA 2M4MA 2H3QA 3D6HB 2KM8C 3GG4A 2YNIA 3OY9A 2YKQA 1GT8A 2YHBA 2BR0A 3HTVA 4B3OB 1PYTA 5J0PA 1TV6B 2UXCJ 3I31A 1UPMB 2CXEA 4U9RA 3C2KA 1XR7A 2E9TA 1GLCG 4IEIA 1H1VA 4N56A 4NA3A 4QZDA 2NRTA 5LMUF 3I76A 5KI6A 5HO4A 3T5JA 3KLFA 1Q82O 1IKXB 5AI0A 4OFZA 4WP3A 1VFJA 2FMSA 2KDOA 1FKOA 4BC4A 2DH7A 1HBOA 1XC3A 3MN9A 5DBCA 2FC8A 1NCLA 3ATUA 4CI0B 1WOOA 4B3TF 1NDKA 1K0TA 2BX6A 4DU4A 1WF2A 5KG5A 4BE2A 2FPLA 2BJ7A 3N7PD 1E6VB 2A1BA 3GSIA 4I6MB 3T19A 2V5HG 3H59A 2HMIA 4RWTA 2LYAA 3KK7A 5J0QA 2W54A 1VQPS 2GFFA 3ZZOA 4YOVA 4LZGA 5EU7A 4KN4A 3GILA 3NE6A 3W2WB 4RLEA 3R9LA 4O4GA 1HHTP 4M3TA 4CLUA 1VCTA 3DI6B 3OW2R 8ICJA 4PQUA 5F9NA 2JDJA 4FYVB 2HQDA 3VF0B 3AQPA 3MCPA 1V85A 3ZTRA 3VAMA 2GEMA 4NXNF 4C11A 2YQ3A 3D54A 4KO0B 1YZ6A 3QLHB 2GA7A 1D1UA 1ZJMA 1EKRA 4YY3F 2KT2A 1NH8A 3JSMB 4FJKA 4XEIA 1LEOA 3G0ZA 4PWDA 2OJ3A 4ICLB 4DV1K 1PCAA 2DJWA 4JI6F 1LW2A 1Z26A 3JQMA 4WK3A 3H20A 3CGIA 1WHVA 2KVIA 3VQQA 5TZVA 3O4WA 1VQ6N 3QO9B 5GMDA 2WSEC 2E2OA 2Q3SA 4FJIA 3ZDCA 1S10A 2YKPA 4ANCA 2XI2A 3HX0A 2KTQA 3H0PA 1VSJA 2H51B 5A8KB 1LB2B 2N4CA 1OY9A 2O8DA 4C4TA 1HBUB 4NL9A 4YD1A 1WDDA 3NMAA 3DXSX 2W9CB 4DBQA 3CCMN 1NNEA 3QGGA 3CD6N 2F77X 5KG3A 3ONNA 1FD2A 1SH3A 3IA0A 1Z4OA 1T11A 4C23A 1S99A 4TXSA 2Q79A 2WVCA 2WFAA 4FFDA 1GXUA 5DDOC 2ILYA 5ALNA 4NYFA 4ZMMA 3W3SA 4JB3A 1OUQA 2CNKB 1PIEA 4PG8A 5J2PA 4FZYA 2F4VF 4TU9A 1M5OC 3D1HA 1TK5A 3AU6A 3E9LA 4FZXC 1ZQGA 4Y65A 1IBKJ 4OGCA 2DGZA 1LWEA 3WXJA 2VG5A 5ETQA 4CFCA 5KT2A 1S6QA 3M2UA 3P38A 3MR3A 1Y00A 3ZSOA 1SBRA 4NO7A 2ZGYA 3THWA 5HMMA 2D3ZA 2PXIA 3BGUA 1WC3A 3MXMA 3N4MB 4JN4A 4I67A 3Q2SC 2BANB 3A8EA 4KBIA 2XMVA 4PCQA 2JWKA 4NLVA 3CSKA 1TUGB 2V2ZA 4ZDNA 3K2PA 5MLCQ 3NGZA 4EGLA 3FZHA 4IEEA 1XERA 1FEEA 2PA3A 1Y97A 2XY6A 4EP4A 3CNHA 1WTFA 3KD1E 2F9JA 4DX6A 4M5IA 5CCLA 2QWRA 2IOFA 1RGIA 6FDRA 2PFUA 4LFCJ 3S6EA 3MI7X 5JICA 3MXJA 1WG8A 2LKYA 1QQ7A 1CJVA 4EMDA 3J81U 4W5QA 3AD9C 3G25A 4OJ3A 1QAIA 3N9UC 4DUZF 2QXLA 4E89A 1X9WA 3O3FA 2DHHA 2VC1A 1NSQA 4BREA 4ZVUB 4CZJA 2E6LA 4MF8A 2F8KA 4Q0BB 4LFCF 4DUZK 4OJGA 3HJFA 2K4PA 2BDUA 3VESA 3AGKA 1C1BA 4GV6A 2F5GA 2UXBK 4KN7A 2VICA 3GL1A 2DL0A 3C6HA 5F3ZA 3PW5A 4LVNP 2VG7A 3IN5A 3NMRA 2DHXA 3N97B 1ZZFA 2J0SD 4CRXA 2B8PA 9ICTA 1TTHB 4ZPWR 4A47A 3WEEA 4K4GA 4JBCA 1Y10A 4CTAA 1PVQA 1C0FA 5CYQA 4F3MA 4CLPA 4OYIA 2BCSA 2B21A 9ICMA 3ONQA 1UPPA 1XR5A 4A57A 4ECQA 5J1EA 5E26A 4FLZA 4IRKA 4YB6A 2F8MA 4QNLA 1RWMB 4D3HA 4OZ0A 1VC0A 1LAVA 3OS0A 1NMNA 2EFPA 2Z58B 1TU0B 2IM2A 2KZ3A 3Q8QB 3QRRA 5K8PA 5KGWA 3GFHA 1FRJA 3VEWA 4ECVA 5IIMA 4OZ5A 1UVIA 4M7XA 2I1RA 3PYGA 4XAKA 4CLLA 4CECA 1WWHA 3HSCA 3AAQA 2WK4A 2VOPA 2V94A 5GMEA 4A46A 2K8BB 4OYXA 1T7PA 1S79A 4UOGA 1YK9A 3DDKA 2QA4N 2OPQB 2RNEA 2ADBA 2HQFA 2HSTA 4O0IA 2M0GB 3JSYA 4WIIA 1WUAA 1ZQSA 3GG1A 1WHXA 2D5RA 1FVSA 4EFHA 4F91B 5D77A 1KTVA 3HVAA 7ICPA 1MWQA 3V72A 4NYZA 4QR1A 3UCZP 3AM9A 2J6UA 1X4BA 1SIJA 1E6VA 3CF5Q 2V51B 2LPEA 5HVFA 2F9WA 3TAQA 4M5MA 3AVBA 4HTUA 1M1KO 4E1MA 4PA1A 4DTSA 4USVA 2JH3A 1VSFA 2A5XA 4R63A 5AQYA 5KNIA 4OJ1A 4UOCA 2IHMA 1UJ5A 4UY8O 4JI8J 2G09A 3OFGA 5A8WB 2LM1A 1ZRNA 3G6YA 5GAEU 1TUVA 1F9HA 2DR6A 4NMXA 4WP9A 5AE3A 4KV8B 4ZCMA 2BE9B 2O1PA 2ZM6K 3VAGA 4BROA 4KX3A 3AY9A 2H3ZA 2YCHA 2KSOA 2HOEA 2V2VA 1XEZA 2YWHA 4X66J 4I2FA 1VQ7S 3ZCMA 1AA1B 1RBOB 2CPEA 2MAXA 3ISZA 2ATQA 4PWWA 1PK1B 4YXMA 5J0OA 4EZ6A 3CMEN 4BXOB 1RUSA 2FJDB 4YNQA 2BBEA 4ZVEA 3UDVA 4YOUA 3KIOA 1FNMA 4DUYJ 2VIXA 2CQPA 4R0JA 1S1XB 2BJ3A 4P2FA 2MKYA 1AFJA 4ELVA 2WBMA 1EZZB 5MLCV 4W92B 2CWKA 3GPAA 4MQ3A 5AQUA 4MKYA 3M9MB 3QU5A 3ICXA 2R7UA 3D2SA 2KD1A 3VPZA 1RHRB 2LHTA 5IOLA 4O9MA 3R1LA 5JUMA 4UQTA 3H8MA 1EWQA 1VQ4N 4MLHA 3JPQA 4LF5F 2DNNA 3DNCA 1JJ2M 5EE3A 2P9LB 4LF9K 2G0IA 3CE8A 4JP8A 2VQEF 1K5OA 4LF6K 5M2UA 1G3OA 1HUXA 3N6MA 3CCQN 2K4IA 1IR0A 5EGYA 1SV5A 2YN4A 1S6PB 3ZSWA 3GZ7A 2PO4A 2QA2A 5CHGA 3VHQA 5KFPA 1RDCA 3GWCA 3CMAS 3GIIA 4JKHA 4C98A 5D3GB 2ZUGA 2LCWA 5KFKA 2DY4A 3CJ1A 3RR8A 4UATA 1ZBSA 2CPIA 1MA7A 3ENBA 3KJVA 2VFUA 2CQ2A 4ELTA 1R8BA 2RQ5A 2KE7A 4ZLPA 3NRZA 4N47A 3HFVA 1YJNS 2K06A 4UUWA 1RDBA 1WORA 1SC1B 5DJBA 4DR5F 3SV3A 3IBPA 1WC5A 4JI1F 3JS6A 4A8YA 2YWFA 2UVRA 3SK3A 4AL6A 2RU9A 5A8KA 4I6MA 4DL5A 1UCVA 4ECWA 4J2DA 3OXFA 2XMTA 1J6ZA 1XQIA 1HBMB 5KFAA 2MTLA 1L5UA 2FGCA 1PKUA 1B7FA 1U04A 5E79U 2C2OB 2VGMA 7ICLA 4ZVTB 4P2HA 1HI8A 1AYEA 3UPFA 2KKHA 5F8HA 2VASA 2L41A 3D0HE 1NU4A 2IRYA 1GX5A 5I3UB 1WSFA 4LZDA 2D4WA 4JKDA 2AD9A 3DOKA 1R31A 3GIRA 2BTFA 4N41A 3C15A 2C2ZB 1VQSA 3HHEA 5DDMA 4P75A 3HXMA 2Y0BB 2P1JA 3NXZA 3SZ2A 4FOIA 3JPNA 2DXEA 2WB4A 3SCIE 2UUCJ 3UD5A 2VFRA 4CHQA 2RU3A 3GMGA 1YJNN 2W9MA 2F40A 1V5VA 4DR3J 4CJ4A 5J2EA 4G3IA 2LEPA 2VG6B 2XS7A 1FF2A 2JFDA 2RRNA 4PWUA 1VHXA 3RMDA 4C97A 1I3AA 3MDQA 3MEEA 3MZIA 5AQMA 2HG4A 3DGPA 2Y1JA 4X65J 3F41A 1RZTA 1YVFA 3ZD9A 1DQAA 4JI2J 2HQCA 2D8CA 1LK5A 4JI6K 2HVHA 5CZVA 3HJEA 3BGRB 1WKKA 2XMMA 4RQ5A 2E9RX 3DRXA 5K20B 4B3RF 5J2NB 3DFEA 1NXIA 5D0GA 3EE9A 4OYWA 4NYOA 4B9NA 3MD3A 2A6AA 4YB7A 1OSCA 3M9NB 1X4FA 1DXSA 3OYHA 1XNRK 5KT3A 3AVGA 3K7RA 2BH1A 1RP5A 2CPHA 4QOTA 2DCLA 3HJVA 5FPEA 4J90A 2NLWA 4BHQA 1LQ9A 2AX1A 2HBYB 1ASWA 1B43A 2RF2B 3AD7C 4DV3J 1RDUA 3ICLA 4M04A 3AVFA 4H4OA 1T9UA 3TAGA 5IIIA 2KT3A 4G65A 3ITHB 1KS2A 1FERA 4Z4EA 4RZRA 4ECXA 3P31A 1YRXA 3M7DA 2GMJA 3T1AA 3CXCR 4LRFA 3Q89A 4QZEA 1KHWA 3M6VA 3ILIA 4RPXA 2CJBA 3BREA 4FZVA 2V2KA 3CWJA 2F1IA 1COOA 3HYFA