3TARA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-6) position
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tarA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tarA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tarA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tarA01
2XY7A 5FROA 8ICEA 4W5NA 3SUPA 3ORYA 5J2AA 4DL5A 2JEFA 4DOCA 5KFWA 1RBVA 4KMUA 3IRXA 3GIJA 1XHXA 2YNIA 3M8PA 4QZ9A 2OZSA 2X74A 4YXJA 1DOQA 4IR9A 3AO5A 3OYIA 4EBCA 4EYIB 2UVUA 4JV1A 9ICTA 3OYNA 5HMMA 4J9SA 1RTDA 3ZT0A 5KFAA 2DY4A 3ZCMA 4MQ3A 2XGQA 3IS9A 1FXXA 4GW6A 4BE2A 4QZCA 3QINA 4EZ9A 3LP0A 4F5NA 3AVCA 3ZSYA 4UAWA 1CLQA 3GFKB 8ICUA 1F21A 3QO9A 3OYHA 4DTMA 3L2VA 4FZZA 2BHNA 9ICIA 5KFDA 3K57A 9ICVA 3ULDA 1S1XA 2FBVA 2KTQA 3C5GA 4K8ZA 4DTRA 1WSGA 4NLKA 2B4JA 3RH6A 1BPXA 4R8UB 5KFMA 2BQ3A 1ZQTA 3AO1A 2IDOA 1TVRA 2ATLA 4EZ6A 4YD1A 2XGPA 3Q8QB 4IQTA 4KLJA 1ZQEA 3LALA 4RW8A 3MGHA 4RQ8A 3K5OA 4KHUA 4DQQA 2DFHA 3AVHA 2G8FA 1D9FA 5J2GA 5KT3A 4J9LA 4LH4A 3ZD9A 3H40A 1ZQDA 4EBEA 5J0SA 2MUTA 4QWEA 3L3UA 2QXFA 4KLMA 4ZHRA 1S9FA 3EPIA 2X78A 4BXOB 4DO9A 4F5RA 8ICZA 1B9FA 1ZQNA 3CQ8A 8ICQA 3MR2A 2ALZA 7ICJA 5F9NA 1ASUA 3OYLA 1L3VA 3NGDA 4M2YA 1ASVA 2D0BA 3I8DA 3ZSQA 2G8IA 4I2AA 3NH2A 4CEFA 2OPSA 4MF8A 2R8HA 2BCRA 1X9WA 4R66A 1RDAA 5CR0A 3NF7A 4DFJA 4E7HA 1ITGA 3FYHA 2HNDA 3S9HA 4CJRA 4ECUA 4Z4GA 4ED6A 1KVCA 3QEWA 4QWDA 3BQ0A 2FBYA 4IFVA 4KLEA 4Z6EA 4CJVA 4M9GA 1IKXA 3D45A 4UBBA 2R8KA 3HVRA 3RWUA 5IIIA 2FLLA 4CK1A 2JGUA 2PXIA 2AGPA 2YNFA 3O3FA 1C1AA 1KCFA 2RKIA 4RQ7A 1JLFA 3PX4A 1NK0A 5HROA 4OLBA 4LZDA 5J0PA 2JZBA 1RT6A 4M3WA 3I0RA 4RW9A 2BGWA 4K4IA 8ICRA 1UOCA 4I2PA 5J0XA 1Q9YA 3F73A 4LSLA 2FMPA 5DKWA 2W9CB 3E01A 2HVIA 4FJ7A 1X1PA 1WNSA 7ICLA 4KREA 5D4BA 1SKRA 2HVHA 5KG4A 4DQSA 4KN4A 3H7IA 3C2LA 3MABA 4M3RA 1LAWA 4RT2A 1MQ3A 1W0HA 1BI4A 4KITB 1S0NA 1U48A 4CERA 1VSMA 3DLKA 4K4HA 1Z00A 3NCIA 4DL6A 9ICGA 1RT5A 4DMNA 1RBUA 4FJ8A 5DB8A 2W9BB 4AHSA 4I2GA 4LVSA 1UT5A 4NLGA 4RZRA 3WNFA 2IMWP 3NAEA 2RDIA 1S97A 1S10A 1KSPA 1ZQWA 5KFRA 4AHCA 4EEYA 4J2EA 2V4RA 2DFEA 4PQUA 3UPQA 4N56A 3OS2A 4DSEA 3V7KA 4ECWA 2WTFA 3MBYA 8ICOA 9ICHA 5J2BA 4NYNA 3QNOA 4DTNA 4RUAA 9ICNA 1HJRA 5CZ1A 4CFAA 2FBTA 4B9TA 1NJYA 4N5SA 2RF2A 3MR3A 3QETA 1EXQA 4DFKA 3AO2A 2IHMA 2ITGA 2HMIA 4B8CA 5C25A 5BOLA 3G10A 4ECQA 1MSWD 4RNNA 2PYJA 3QEAZ 4DU1A 1O1WA 5KFUA 3NBPA 1BPYA 3DYAA 4ED3A 4M0AA 3DMJA 3VQAA 2R8IA 5HP1A 3BQTA 2HB5A 4CHZA 5HHIA 2Z1IA 1CZ9A 3NE6A 3LDSA 5KFCA 4QZHA 9ICAA 1A5WA 4Z4HA 2G8KA 3ZSVA 3T5KA 2C22A 2HNZA 2F1HA 3RAQA 1T4GA 3KIOA 5FRMA 1JLAA 2KZ3A 4I2FA 5KFYA 4CHNA 4FK4A 3V9UA 4CJUA 1BHLA 3KTQA 2P5OA 3RJEA 1ZQOA 3UXOA 4ED1A 3UQ2A 5KFLA 3RBDA 2MAXA 4F2SA 3OVNA 3TI0A 2V9WA 4W5QA 4DG1A 4NXZA 2JEIA 3HSTB 4YMOA 3VN5A 3CFPA 2NRTA 1C7YA 9ICCA 1TK0A 2LSNA 4KI6A 4IBNA 4FJHA 3JPNA 3GIIA 3SZ2A 3HPHA 2YV0X 4F4YA 4IKFA 3PO5A 4HTUA 4DTPA 1UAXA 3SV4A 3ZT2A 5EWFA 2J6SA 3V1QA 3TQ1A 4HVJA 3OGUA 4CGIA 4IG0A 3C94A 4CFBA 1TFRA 2C2EA 2R8GA 3VQ7A 3MEGA 5DQGA 5DG8A 8ICGA 4DOBA 5KFVA 2XHBA 3SI8A 4Y1DA 1EETA 5L1JA 3L2RA 2HHUA 4J2AA 4RQ3A 2X6NA 4CIFA 1VSLA 5J2EA 3TFRA 4KLHA 3AVMA 1T3NA 4Y1CA 1XI1A 1MC8A 4YFUA 5J2KA 2KZMA 4I2HA 1RCHA 1PZNA 5FRNA 4FLYA 5C24A 4JS5A 4I9QA 4HUFA 4CGHA 3MR6A 3KJVA 2AQ4A 4IQVA 4QZFA 5JS1A 2VA2A 1ZQLA 3SQ1A 4JWNA 3RMDA 5JUMA 3ISCA 3HM9A 4YP3A 4FXDA 5DBAA 2DTUA 2VA3A 1ZQPA 1JXLA 4P4MA 4GVMA 3OS1A 3K5NA 3VQ8A 3ZT3A 4UB2A 3JPOA 3AO3A 4FZYA 5KT2A 1IH7A 2FPMA 4O5EA 4F92B 4RNMA 1JL1A 1X9MA 1NK4A 2GV9A 2NRZA 2NRXA 4FJJA 3UIQA 4UB5A 4CJ5A 1XSLA 4CJSA 4FJXA 1B22A 1ZJMA 2KFZA 4PA1A 1BIZA 3KLIA 4FJKA 4UAZA 1ZQBA 1N48A 4C8OA 1QSYA 4W5OA 5J2HA 1EXNA 4J9OA 3RB3A 7ICRA 5KFIA 4Z0UA 4QZGA 3MR5A 1VSDA 3FFIA 3QEXA 4LZGA 4CIEA 5KFTA 9ICRA 1R0AA 3Q8RB 1HMVA 1ZBUA 4DSKA 4CEOA 2W42A 4XQ8A 4FCYA 1RYSA 2A1RA 1S1VA 4GXIA 4Q5VA 3H4BA 1S0MA 3Q8MA 1ZJNA 2MUTB 4O4GA 1KFDA 1RXVA 2XRIA 4RG8A 5KFQA 4B9NA 3KLFA 1KDHA 1HPZA 7ICHA 4CFDA 7ICKA 3NH0A 2C2DA 4O3RA 5F9LA 3MGIA 4YFKA 4EBDA 5CJ7A 3V7LA 1RDCA 5KG3A 5J0WA 4FJ5A 4KAZA 3DOLA 2P6RA 1U47A 2G8UA 1ZQSA 3VQEA 3CG7A 4CEZA 2WOMA 4DU4A 4UB4A 1V9PA 5KGWA 2AJQA 1S1UA 3JPPA 3UXNA 5KG5A 1Z3EB 4ZTJA 1TK8A 4RW6A 3V9XA 1BPZA 3TAMA 4F5OA 3SYZA 1CUKA 4Z6DA 3OHAA 3OJSA 4XIUA 4O9MA 4F2RA 4B08A 8ICWA 1Y88A 4C8LA 4FJGA 1NKEA 3AVKA 3KKRA 5KG1A 4JK1A 2ISPA 4PHEA 7ICQA 3MFIA 3T1AA 2JZBB 4NM2A 5TZVA 7ICSA 3IAYA 4M42A 4UBCA 4J9PA 5J2FA 3LK9A 1WAFA 1LAVA 4FYDA 2DPIA 7ICEA 3KD1E 2X6SA 4DQPA 4I7FA 2OWOA 4FBUA 3VQDA 2FBXA 5J2JA 3VQQA 1BI4B 3U3YA 2BR0A 3OYMA 3TANA 5EWGA 3VQCA 4HYKA 4CHQA 4O3NA 1Z00B 1XO1A 4CEAA 4KLDA 2Q3SA 9ICQA 4FLVA 3TWHA 3BQ2A 4DS5A 9ICUA 4NYFA 4QZEA 3ZSWA 4KTWA 3VA3A 4CE9A 3DLHA 1LB2B 3GILA 2UVWA 3O4QA 4E19A 3PV8A 1RYRA 1TKZA 3PVXA 4KPYA 2G8WA 3H4DA 1J54A 4R5PA 2W8KA 3SUNA 3JPRA 4Q0BA 5KRTA 1K1SA 3ISNC 1C1CA 4FJIA 5J2NA 2BQUA 3G0ZA 3GIMA 2UVVA 3PW4A 3QERA 3JPSA 4I28A 1XU4A 3LWMA 2PFQA 1HUZA 1C0UA 3MXJA 4OPKA 4FLZA 5SWMA 2BE2A 3RH5A 1ZQIA 2HHQA 3PY8A 3PR5B 1LW2A 4DFPA 2BCSA 1Z25A 2XO7A 3NDKA 3F9KA 2G8VA 5KFHA 4ECYA 4Q44A 1A5XA 5BPCA 3HJFA 3TR8A 1S0OA 7ICGA 1GOBA 1ZYQA 1LW0A 1NOYA 4CF8A 5J2QA 1RILA 1QE1A 2G8HA 3S3MA 1YTUA 2HHTA 2F1JA 1ZQAA 2BANA 4E89A 2GUIA 5KFEA 3KLEA 5J0YA 2O4IA 5JS2A 4O0JA 4FLWA 2RPIA 4BACA 4B9MA 4PHAA 1SV5A 2KN7A 9ICEA 1NKCA 1X2IA 3T3FA 3H8JA 1T7PA 4PHDA 4DOAA 3SV3A 1TL1A 4HUEA 2JEJA 4CEDA 8ICXA 4NLNA 5KFSA 5DDYA 4LH5A 5DGBA 5HHHA 4Z4FA 4I27A 1T03A 2ZTDA 3V6JA 4M9HA 1G15A 4DFMA 1NOMA 4UAYA 4RQ5A 3NGZA 4F4KA 3DOKA 1TAQA 4BDZA 4CJLA 3ZDCA 4M47A 4E1MA 4F93B 3RMAA 4QW8A 3V1RA 3AVJA 4DTUA 3ZT4A 3SUOA 4NCAA 1NKBA 1JKHA 3SQ2A 4FK0A 3ZSRA 4O3SA 3PX6A 3PW0A 2P66A 1ZBIA 3PMLA 2D0AA 4I2CA 4FLUA 1BPEA 2VWKA 5KFJA 4ED0A 3QEBZ 3PW7A 2HHVA 3SUQA 1DLOA 4RUCA 3V6KA 4Q8FA 5KI6A 1S6QA 4C8NA 4KFBA 3KK2A 4R64A 1RDBA 4FLTA 3D0PA 3V4IA 2BDPA 1IO2A 1BIUA 1C0MA 1RT1A 1WSEA 3N97B 4IDKA 4K8XA 4ECSA 4ED7A 3DRRA 4CEBA 4JRQA 2HHWA 1REVA 4CJKA 7ICFA 2OA8A 4MFAA 4DSLA 5IIMA 5KFBA 3V9SA 1NK6A 4YR3A 2AQ0A 5DMRA 3NTUA 5DK5A 1Z26A 9ICXA 4YMMA 2XC9A 3I0SA 3K5MA 9ICOA 1ZQZA 5KFZA 2ZQBA 1KRPA 1NOZA 1XSNA 4KLGA 3MXIA 4R8UA 3LANA 2E6LA 4RQ4A 2F96A 1H38A 1EX4A 8ICBA 3KD5E 3DLRA 2PFOA 3KHGA 4UB1A 4OKKA 4M3UA 3ZDDA 3WNHA 3ZT1A 4FJLA 1UWBA 3JYTA 1QS4A 5IIJA 4FLXA 4CK2A 1ZBHA 3V72A 4OPJA 4BE0A 4F4WA 2VANA 1Q9XA 1WAJA 1NJXA 2HHXA 1JN3A 4OKJA 4LSNA 8ICNA 4F91B 1JXEA 1QHTA 1N6QA 4DS4A 3SNNA 4NY8A 4YXMA 4DSFA 3OS0A 4ZH4A 1ZQMA 2QK9A 8ICIA 2R7YA 4CJWA 1T05A 3T5HA 3T5JA 3NF6A 4QOZB 3DI6A 3DRSA 5HRRA 1YTAA 3P83D 5HRNA 4B9LA 1ZQVA 4DLEA 5CZ2A 1D8YA 1JXBA 3IG1A 2IGIA 5DLFA 4M45A 4GLXA 2J6UA 3ALYA 2HNYA 4B3OA 1RBSA 8ICPA 1XWLA 4DF4A 2ZD1A 4PPXA 1VSKA 4KLUA 4M3ZA 4DL4A 9ICLA 3QNNA 3U6FA 4F4ZA 4DL3A 1KFSA 4CGGA 3OYAA 2D5RA 3KLGA 1RTHA 4OJRA 5CY4A 1L3SA 3C5FA 3VQ4A 4XA5A 4DL2A 2FC0A 3O4NA 3P1GA 1BVSA 4O3PA 4J9KA 4KHYA 3RMCA 3H8SA 4M04A 4CEEA 2F1IA 3HW8A 2ZUBA 4DSJA 3CYMA 1FKPA 3M8SA 2EX3A 1TV6A 2ATQA 1K1QA 2BCUA 5IINA 1ZQKA 1JLEA 3CFOA 4FW2A 4RQ6A 4DF8A 1J9AA 5D49A 3VQ5A 4TURA 4ID5A 5IIKA 4YMNA 4MF2A 4E7LA 1ZQCA 2F8SA 9ICPA 4OKEA 3KK3A 4UQGA 2B5JA 4IFYA 1L3TA 9ICJA 2P5GA 4MFFA 5HNKA 4L8RB 1XHZA 3C1ZA 3ZD8A 3AA3A 2BKEA 1S77D 4WE1A 4TUPA 1RT2A 3M8RA 4KLTA 3SQ4A 2PI5A 4FO6A 1JX4A 2P1JA 1LV5A 3MECA 4PHPA 3OYDA 1COOA 3DRPA 4M9JA 1RPLA 1N5YA 2XY8A 3HL8A 3G6YA 3EWAA 3L2UA 1TV9A 4FS1A 1S9GA 2ZE2A 1BPDA 4QAGA 1WSHA 3C95A 3AO4A 3H08A 2OPPA 4EP4A 3GV7B 2RN2A 1B9DA 2XY6A 4KB1A 4QWAA 3PR4A 3Q8LA 4X5VA 5C42A 1RZTA 2M9NA 1CEZA 3NH1A 4KHSA 2BPGA 4YR0A 4F50A 1U45A 1UA0A 4NLZA 2BCVA 2YKNA 1KLMA 1BQMA 4MFBA 4P4OA 5KT5A 3AVNA 4ELVA 1MU2A 2FLPA 2ZJAA 4IRKA 7ICUA 2W8LA 3VQ6A 5KG6A 1D5AA 2V4QA 4AHUA 5J2MA 4KLOA 1DGSA 4CCHA 1A5VA 2ZJ8A 1BCOA 3IM1A 4FJNA 3DM2A 4IQWA 4BDYA 3SPZA 2AU0A 3V1OA 2BCQA 1SKWA 1ZETA 3OYGA 3LPUA 3P5JA 2IBKA 4FS2A 1VSIA 3ASMA 3SPYA 4RW7A 4CF1A 3C2KA 1TKDA 4F8RA 5KFPA 3MFHA 3RTVA 3HP9A 4O3QA 2ETJA 3HWTA 8ICYA 3AA5X 1LWEA 3O3HA 3B0XA 3RB4A 9ICKA 2VWJA 3BDPA 3WNEA 1ZQXA 3PO4A 4JWMA 4NM1A 1QLNA 2BPCA 4TQSA 3GIKA 1ZQQA 1EKEA 3SJJA 1HQEA 1QTMA 4P2HA 3V6DA 2HW3A 5KFGA 1RBTA 1L5UA 1T8EA 1HUOA 1RBRA 3QZ8A 3DLBA 3JPQA 3JSMA 5HRSA 1JL2A 2KFNA 1K6YA 5BOMA 4UB3A 2UVRA 3GV5B 2YNHA 8ICMA 1S9EA 3VQPA 1SKSA 3MXMA 4KO0A 4O5BA 4Z6CA 3RJGA 4IR1A 9ICSA 3L2QA 1NJWA 4FZXC 3CM5A 1B92A 5IILA 2QKKA 2YHAA 5IIOA 1NK9A 8ICAA 3GDXA 5HBMA 2Z1JA 3OYEA 4DLGA 4XRHA 2DFLA 5CA7A 5DG9A 4O44A 3QIPA 4O5CA 3NFAA 4CGDA 3FDSA 3M8QA 2Q0ZX 5KG0A 1DTQA 4J9QA 3V9WA 1TL3A 3AVIA 4RQ2A 9ICFA 3B6OA 4NCBA 4O0IA 4DSIA 4AILC 1I39A 4F5PA 4O55A 4OGCA 1NK8A 2FMSA 2P51A 2A1JA 4ID1A 3SCXA 2HHSA 4CJTA 4HUGA 3N4MB 1S76D 4F3OA 3HT3A 1QQCA 4HCCA 1RTIA 3LDAA 4J9NA 2F8TA 2FMQA 4J9MA 4QZAA 4DL7A 4I2EA 5J0TA 2ZUDA 5KFNA 3ZDEA 4ECVA 3RJFA 1FKOA 4M3XA 4FVMA 4PGQA 4BDPA 3AV9A 4B9VA 1J5OA 8ICCA 5J0QA 3RJJA 1C1BA 1WSIA 3RB6A 4CFCA 1C6VA 4RQ0A 2YKMA 4CESA 4CIGA 4DU3A 4CHYA 4J2DA 3HP6A 3K59A 4JUZA 4PGXA 3RAXA 3ISBA 4E7KA 1TGOA 1HNIA 2YNGA 3OHBA 3GV8B 3ZSXA 4FJMA 4Z4CA 4CK3A 2WONA 3RB0A 1ZQYA 3OYJA 4YNQA 1KFTA 4Q45A 4OLAA 4YCXA 3HXMA 8ICLA 3KLHA 7ICMA 3LP3A 4JRPA 4TUQA 1BL3A 4B9SA 4BWMA 3QESA 3L8BA 3HPGA 4M6WA 1XC9A 1WSFA 2FPLA 1BCMA 1JMSA 3PW5A 4LD0A 1S1TA 3HPOA 1U49A 4DQIA 3QIOA 4ECTA 3WNGA 9ICBA 2ISOA 4IQUA 1RT3A 5CWRA 2DPJA 1VSFA 8ICTA 5L9XA 2IC3A 2VG7A 4I9LA 4YQWA 1SZPA 4JV0A 5DLGA 1D9DA 4OGEA 5KGXA 2LYHA 4I2IA 3C21A 4I2DA 2EHGA 5J1EA 1LWFA 4CJPA 2D0CA 3EPGA 3HX0A 1BQNA 4ECXA 1HNVA 3QEPA 3TAQA 5DGAA 2FLNA 1SL1A 2PI4A 1CXQA 4DTSA 2KQ2A 4AHVA 5J0UA 5CP2A 1DTTA 8ICKA 3QEIA 3DLEA 1BPBA 3HVTA 3KKSA 3PUFA 2R8JA 3OYBA 4RW4A 1IM4A 1Y97A 3VQ9A 3TFSA 2AGOA 3V6HA 3HYFA 3O3GA 2KW4A 1IG9A 1RXWA 3MDCA 1IKWA 3TAFA 1TAUA 1HQUA 4YN4A 4W5TA 4KI4A 3OYFA 2Z1GA 2IHNA 3AA2A 5KRSA 4ED8A 3EW9A 5D3GA 1RT7A 7ICNA 1RT4A 1FK9A 7ICPA 4P4PA 1U4BA 1VRTA 4OVLA 4H8KA 1D8LA 4RU9A 3MAQA 2XY5A 3LZIA 5CHGA 2C28A 3AU2A 1ASWA 1SL2A 3V9ZA 4QZBA 2I1QA 3T5LA 7ICOA 3VQBA 1S1WA 4KLLA 4QZIA 8ICSA 7ICTA 2BGGA 5T7BA 1U9LA 2ASDA 5KG2A 5D46A 3C23A 4KLQA 4W5RA 3OYCA 1X9SA 3L2WA 1JLCA 4IRCA 1A76A 3G6XA 1RTJA 3K2PA 3ISDA 4CF9A 1UA1A 3GQCA 4H4OA 2GWSA 3ITHA 4JS4A 2XCAA 4JLHA 8ICHA 4G1QA 4I2BA 3NGYA 3B6PA 4M41A 4GXKA 3C1YA 4CECA 2W9AA 3NF9A 1B43A 4HCBA 4RPYA 2PY5A 3JPTA 4QCLA 4ELUA 3RRGA 3LP1A 1JIHA 2ZTEA 1CZBA 4CF0A 3BQ1A 3V7JA 4FBTA 5CYMA 3LP2A 5K14A 5KTQA 3IHQB 1MQ2A 3M9OB 1VSEA 1GOAA 3LWLA 4Z6FA 1TK5A 3KHRA 3LAMA 5EWEA 4M3YA 3ZSZA 4QZDA 3ETLA 4DQRA 3HK2A 3EYZA 2IS3A 1ZBLA 4E0DA 5KT4A 4QWCA 1A77A 2O4GA 3QEVA 4DWIA 3T19A 3M9MB 4PH5A 2PFPA 4E3SA 4CJ3A 3KHLA 2VG5A 4M3TA 1HRHA 1NJZA 4F4XA 3RH4A 4Q43A 5HLFA 4ICLA 3TARA 4DTOA 1ZQUA 4BXOA 5L1LA 1IKVA 4FM0A 4PY5A 2C2RA 3L3VA 1UT8A 4O5KA 2H5XA 3QLHA 3PW2A 4B9UA 2I5JA 3VA0A 1KVAA 4KLSA 5DG7A 5HMLA 1C0TA 5FDLA 5DB7A 3SQ0A 1XS9D 3CFRA 4KLIA 2IA6A 4G3IA 8ICJA 2E6MA 3BGRA 1HYSA 4MFCA 4RQ1A 1HJPA 2ZJ5A 4CEQA 4PWDA 1EP4A 2IOCA 3AVAA 4YD2A 2KZZA 3AU6A 3AVLA 1WLJA 2P6UA 4CJEA 1KVBA 3ZDBA 4I2JA 1S6PA 4KRFA 4HHTA 3NHGA 2BQRA 4KN7A 3H8WA 3Q8SB 5DBBA 4ECZA 3TAPA 1JLBA 3OY9A 4ELTA 1HYZA 2FPKA 4YVZA 1NK5A 5J29A 3SI6A 1KEJA 2NUBA 2J6TA 3C6UA 1CXUA 2W9CA 1NK7A 4PGYA 1WSJA 4CGFA 1Q8IA 3HO1A 4C8MA 5KT6A 2Z1HA 2VG6A 2ASLA 1QSLA 5E41A 4BGDA 4B8AB 5KT7A 3A2FA 3OSNA 3RR7A 4AHTA 4H4MA 4KHNA 1SUQA 4F5QA 1RNHA 2QKBA 3CM6A 4FK2A 1WCNA 3KK1A 4TQRA 4QW9A 4I2QA 5DB6A 3QZ7A 3AVBA 4NCGA 1JLGA 2W9BA 3BJYA 3EZ5A 2AGQA 2PYLA 1QSSA 1KLNA 4E7JA 2XCPA 4FM2A 1YVUA 3RMBA 4IRDA 4ED2A 4E7IA 7ICIA 2B21A 5KG7A 1ZQJA 4KLFA 2E4LA 4DTXA 1HYVA 2JLEA 1XSPA 3AVGA 3NGIA 4FW1A 4QZ8A 1IXRA 3TAEA 5KFXA 1SL0A 4YR2A 4R63A 4RNOA 3RR8A 3PNCA 2NRWA 2A1JB 3C2MA 5KFFA 1ZQFA 1ZBFA 9ICWA 4F3TA 5HP4A 3RJHA 4MEXA 1VSJA 4I29A 2OYQA 4QWBA 1AROP 2OPQA 4M9LA 5KFKA 4IG3A 4KV8A 4AH9A 4CGJA 5J2CA 3S3NA 4BWJA 1JLQA 4FM1A 4N41A 4BE1A 3AA4A 1U04A 4AHRA 1S0VA 1ZQHA 3MEDA 2BPFA 2OZMA 5EU7A 4KB0A 4MEYA 5CB1A 3MDAA 4KTZA 2IAJA 3ZSOA 3M9NB 5CYQA 4J2BA 2YHBA 1VSHA 1VRUA 3Q8PB 5DDMA 2A1SA 2W9MA 4EP5A 1S5JA 4CJ4A 1BGXT 1LWCA 4RPZA 3MEEA 1J53A 4KHWA 4EYHB 4GC7A 3NF8A 3OSPA 1TVAA 3PMNA 1KTQA 5HRPA 4E1NA 5C5JA 4CJQA 3RBEA 4JV2A 2GBZA 1YT3A 4M6WB 4Z4IA 1ZQGA 3THVA 3K4GA 3V81A 3Q8KA 3K75D 1WCLA 1ZQRA 2ZUCA 4K4GA 5I42A 3PX0A 2I9GA 7ICVA 2OPRA 2PFNA 5DBCA 3AUOA 3OJUA 5KFOA 2ASJA 5SZTA 3UQ0A 1VK0A 2RDJA 4KHQA 5EOZA 4GXJA 2ZTCA 5J0OA 4ECRA 5L1IA 1RDDA 2B6AA 4PUOA 4RT3A 4GMJB 4DTJA 5J2PA 4J9RA 5J0RA 3ZDAA 4RPXA 5DB9A 1I3AA 4CJFA 4DEZA 3RJIA 1W9HA 1L3UA 4ZTFA 3LAKA 1IKYA 3LPTA 1BISA 5J2IA 2Y1JA 4CHOA 5I3UA 4Q8EA 2PZSA 1N56A 4KKOA 4XUSA 3LZJA 4TUSA 3UXPA 3C6TA 5L1KA 4N76A 3QE9Y 5DQIA 3AVFA 4TSXA 4FJ9A 3OYKA 4KTQA 2NRVA 2JEGA 3E2EA 3DLGA 4LY7A 4M9NA 3KHHA 3RRHA 3RJKA 4YG2A 9ICMA 8ICVA 3EY1A 3K58A 3TAGA 4Z4EA 3U3GA 2DFFA 5J2DA 4CHPA 1TKTA 4CF2A 2VA8A 8ICFA 4C8KA 3K5LA 4GC6A 4O3OA 5DQHA 4N47A 1WN7A 3S3OA 1TKXA 1GOCA 4R65A 3TABA 2Y1IA 3G6VA 3B0YA
chains in the Genus database with same CATH superfamily
1DXSA 8ICEA 3SUPA 1JKHB 4DPTA 2EWHA 2JEFA 4DOCA 5KFWA 1FVSA 1VS3A 1RBVA 3IV6A 3JAMY 2HK2A 2LYAA 3GIJA 2YNIA 1XHXA 2P9NB 3IG8A 4QZ9A 1WOSA 1DOQA 2UP1A 3AO5A 1JLCB 3Q22A 3CERA 4EYIB 4KHPK 3SCIE 4DV3K 2ZUGA 1BO5O 2RQ4A 4J9SA 2Q6BA 3RVCA 3ZT0A 5KFAA 1YDLA 3A5NC 2ROEA 3IS9A 3DHXA 1FXXA 4PKDB 4GW6A 3BDEA 1U1MA 3QINA 3GCWP 2HMXA 2GZOA 1X4HA 1PGZA 3M32B 1F21A 2R42A 3OYHA 4DTMA 5BPLA 2BHNA 9ICIA 2DXDA 3OXLA 3Q83A 4GRSA 9ICVA 4JI2J 1MWKA 3ULDA 1S1XA 2DF4B 3C5GA 4O5FA 2E1RA 5LOQA 4BC2A 2Z2LA 2IDOA 1TVRA 2ZH8A 2ATLA 1EKRA 3ZZPA 4NX9A 2XS5A 3ULHA 3LALA 1IJJA 4RQ8A 1VOMA 1XMQJ 2D4WA 1NPKA 2ZVSA 2DFHA 5LMUF 5KT3A 4IJNA 2IYGA 1ZQDA 2VPYB 5HLFB 2KFYA 4QWEA 3SBMA 3GYNA 3EPIA 2FJBB 5DDQC 4DO9A 1HNZJ 4UASA 3NASA 1TTHB 2P9SA 1IKVB 5CYJA 3CF5Q 8ICQA 3MR2A 3ENHA 2GNKA 4DUYK 3NP5A 1L3VA 3K5PA 2E1YA 5AM2A 2QX0A 2C2OB 3I8DA 1PYOB 2F77X 3IGVA 2OPSA 4GKJK 5AKGA 1KC8T 1VJQA 2F9JA 2CJYB 1TYQB 4B1XB 1RA7A 2EBEA 2QMUB 3FBFA 3PSFA 4BQLA 3BGRB 1V9OA 4TKTA 4CJRA 3CPWM 1F60B 5AQLA 4ED6A 4JV5K 3A4TA 5IWAJ 2FBYA 3BQ0A 1RWWB 3FC9A 4WJBA 4FWNA 5ALJA 4ZKAA 1RAHB 3RWUA 4CK1A 5HJXA 2JGUA 3O3FA 2AGPA 4NRTA 4BRHA 3LA0A 5BJRA 1JLFA 1NK0A 1NDPA 2Y0BB 4CDGA 2D3DA 2LXUA 2EK6A 2E20A 4P2MA 1UOCA 2Z4PA 4JI7F 4U67Q 5AQWA 4CNZA 3ONNA 3PACA 3HT0A 4CBUA 2G2OA 5DS7A 4FJ7A 1PUZA 4UB8U 2JV3A 7ICLA 4KREA 5D4BA 2HVHA 4DQSA 1BE4A 3GB0A 2HQCA 3VVTA 2LQ9A 2VJVA 3UKRB 4M3RA 1S4EA 4XK8C 1W0HA 1PILA 1U48A 5KQDA 3DLKA 4ACOA 4BR7A 4B3TJ 4I2QB 2YKOA 1SQEA 2CG4A 1VC5A 9ICGA 5ALFA 3WBZA 1U25A 3WKEA 1OS5A 1RT2B 4AHSA 1N34J 1UT5A 2ZZMA 4ANCA 1NGFA 2O8BB 4RZRA 3RUBL 2IMWP 3NAEA 1OH7A 3JS6A 1Q1KA 4HTIA 3MN7A 4JBCA 2QARA 4U7UD 3SLCA 2B56A 3TSPA 1TE2A 3UPQA 1FD2A 3WZ0A 1X40A 1UMJA 1C4AA 4MO4A 5J2BA 4C23A 4BRNA 4DTNA 1N36J 1SC6A 2DNNA 4U9RA 2HVZA 1QY7A 2RF2A 3MR3A 3N6MA 4NZ0A 3AO2A 2ITGA 3FJ2A 5C25A 4DV7F 2CQIA 5F41A 1V85A 1TQLA 4NWBA 4BJQA 3QEAZ 2CJBA 3WKBA 3BR8A 1MN8A 1BPYA 3DYAA 4PG4A 3VQAA 2R8IA 1VQLS 4JI1K 3KMQA 4OZLA 5AQXA 2YX7A 1YJ9S 5HP1A 2G08A 2AEJA 2LDYA 4CHZA 3MEDB 1BLUA 3D6MB 2Z1IA 3U9DA 4P0QB 5CYQB 9ICAA 3ENAA 2GVZA 1VRUB 1N8RT 2OTLS 2OCEA 3W8PA 2G8KA 1A7GE 3ZSVA 3G4SN 4MO5A 4PZNA 3JSBA 4I2FA 4RNFA 2NUHA 2ZH1A 4FK4A 4LFAJ 4FNHA 1BHLA 4IFEA 2KM8C 1JWWA 2H5IB 3UXOA 3FZHA 1YG0A 3UQ2A 5KFLA 1T94A 2NYVA 4F2SA 5HO4A 3V6DB 3KDOA 7AT1B 4NXZA 2JX2A 3ZTSA 4NRUA 3C6HA 2W01A 2VOOA 4LF2A 5BXIA 4YMOA 3I4HX 3A5MC 9ICCA 1TK0A 1KAZA 4UUWA 2E2QA 4HI2A 2R4FA 1M90T 3CJAA 3D2WA 3IR6B 2CGLA 5AHXA 2YV0X 4F4YA 4IKFA 2HBLA 3PO5A 2JOQA 2XSJA 1ZOTA 3LDPA 1A0PA 1H2UX 4JKBA 1OPZA 2J6SA 1NI3A 3KG1A 3WT0A 5AKJA 4ZIVA 4DB3A 3I56N 4QPTA 2R8GA 1CQNA 3AN1A 4X66J 2CPIA 1YXQA 5DQGA 3UPFA 2JZ5A 3PSIA 2VKQA 4IDHA 3HHKA 4H5NA 4LF9J 2F76X 2GX8A 1H3DA 4CIFA 1D8BA 3AAWB 3F41A 3TFRA 4YY3F 4JI3K 4LT6A 1ZQ1C 2FC8A 1QAYA 4E1JA 4WU3A 3AVMA 3QUQA 2NV3A 2FY8A 1PK3A 1TKTB 3W1YC 5IS2A 3LDLA 1XI1A 4LRAA 4GO7X 3JB9k 3TTFA 2R7VA 5L9NA 4WIQA 3ALRA 4LQ9A 4TLRA 4JS5A 4I9QA 1J97A 1M5SA 4CGHA 3L3CA 3MR6A 2M7SA 3PIOQ 4QU7A 1KD1O 1AB8A 4BR5A 3HKWA 3M8PB 2YMMA 2WAQF 3BZQA 2MKHA 4I56A 5D0RA 3HM9A 1YKWA 3W66A 1SH2A 2DTUA 1C1BB 3K5NA 4FZYA 1QAJA 1BWEA 3IWNC 1X9MA 1NBEB 2NRZA 5KAFU 4RUHA 4YOEA 2WONB 3HHLA 4UB5A 1B22A 2V2ZA 1HARA 4FJKA 2HOQA 4UAZA 2QMXA 4C8OA 1N34F 2DBYA 3Q8YA 4HH1A 3M1VB 1N33K 4USWA 1URJA 5AM4A 4Z0UA 4QZGA 2KEYA 4CO0A 4H0PA 2B43A 2CADA 1IBKF 2ZIWA 2P35A 1R0AA 2KXHA 2F7TA 4RW8B 2MZRA 3VAJA 2HZVA 3OL9A 2W42A 5GAHU 4AT1B 2HHPA 1QVFR 3CUNA 1H7XA 3D0IE 1PK1A 5CHCB 3TYTA 2CPYA 2XZTB 2XLJA 2DNGA 1KFDA 1UEUA 3VOVA 1KVKA 1FRIA 1DARA 1CULB 1UL3A 2M0NA 4FPIA 1YHQS 2V8HA 4Y2YA 1RADB 1T95A 3CRXA 3R6LB 3G6EN 5F9LA 3LDQA 1WBDA 1UVNA 4Y2SA 3MGIA 2IBOA 4P73A 2PT0A 3VHQA 1RKJA 3T79A 4CO2A 3DOLA 2FUG9 1U47A 2ZNZA 2G8UA 1VBYA 3QNWB 4Y0FA 3WKCA 4UB4A 2D7SA 3AGKA 5CXTA 1V9PA 4XPEA 4LF7J 2W2NP 3E9OA 3UXNA 1T9YA 5KG5A 2FJXA 1TK8A 3P4IA 4RW6A 1BPZA 2OGUA 3TAMA 3OW2R 4Z6DA 3OJSA 4XIUA 4CDIA 1FK9B 1NEEA 4ILLA 3IFRA 2CJ9A 2H1YA 1SAZA 1VRTB 3D7SB 1GXUA 4MT1A 4C8LA 4FJGA 3AVKA 5ALNA 3KK7A 3HKZC 4PHEA 5HROB 2R7WA 3I9ZA 3MFIA 2JZBB 2B8PA 5TZVA 4RW9B 2FJEB 3PYEA 7ICSA 4M42A 3NL0A 3EE9A 4K0KF 2I38A 3K9KA 1SV0C 2E8OA 4FYDA 2JC1A 1VQ4N 4CVNE 2X6SA 2ZXIA 1JNRB 4I7FA 5GAHI 4H54A 5E0OA 2BJ7A 2Q0RA 2QL9B 1DFDA 4FYVB 2J8AA 2BBEA 4MKVA 4ES2A 3WUHA 4CLYA 5J2JA 4WIIA 3VF0B 1BI4B 1QJHA 1YJNN 4HYKA 4IOCQ 4CHQA 2BJ3A 2FJDB 1Z00B 4OI1A 2Y9UA 9ICQA 1HWUA 2MKYA 4ID8A 5F2RA 4NYFA 4BC4A 2AD9A 4KTWA 2E5HA 2QT7A 3H46O 3VERA 2XI2A 2N3OA 3H7HB 4ALZA 3DRXA 2QRRA 1ULRA 4BR0A 3U4LA 3PV8A 1DQ8A 4MLHA 2GJ2A 1TKZA 2FTRA 2LEBA 3CPEA 3TOQA 5I3QA 4PQUB 1PIEA 3JPRA 4Q0BA 3ISNC 3E0FA 2MTLA 4IEEA 2VBXA 3IWXA 2VPZB 3QERA 3LWMA 2FYXA 1Q86T 1HUZA 1O13A 4TY9A 4NEZA 4P75A 5SWMA 1ZQIA 3J80Y 2HHQA 3Q23A 2EG1A 4DFPA 3CO9A 4A57A 2MQPA 2HMIB 3AAPA 1RLDA 4YDDB 2GHVC 3QLHB 2DNMA 1SIZA 2G8VA 5KFHA 3SMZA 3CC4N 2ZVIA 2AYGA 3DMJB 3ENVA 1FJEB 2F4VJ 2CH6A 1S0OA 7ICGA 2KIWA 1GOBA 3MWPA 1ZQAA 2GV1A 1YJWS 1N62A 2O4IA 5J0YA 1IBMF 4AYBC 2DYAA 3F5EA 1S22A 4FLWA 4B9MA 9ICEA 1NKCA 3CJRA 1DHMA 4EI2A 1WSRA 2G2YA 3H8JA 1T7PA 2J9DE 2OKQA 3SV3A 3R5BA 3UDEA 2ZWPA 4CEDA 4JI7K 3BSCA 4LR7A 2J9DA 5KFSA 2ZIXA 3N7SC 5DDYA 1JLBB 3A12A 4OYIA 5HHHA 3R8EA 4GY2B 3C16A 2ZTDA 2CFXA 3CEDA 4XDDA 1G15A 2EZZA 2XMWA 3NGZA 4FOIA 1WHYA 3L4IA 2V8DA 4BDZA 2IIRA 4CJLA 4M47A 5FPMA 3MM7A 3CJ8A 3C14B 3NGKA 4JI0K 5C0YA 4IH7A 3V1RA 3SQ2A 1K0TA 2ZBIA 3TUZC 4WYBA 4NYPA 3PW0A 2P66A 1SUQB 4I2CA 2OELA 3EXYA 1BPEA 2ZHAA 5HSPA 3QEBZ 4ITSA 3PW7A 1H0HB 2HHVA 3E58A 5KI6A 3W2WA 2FDRA 1E4GT 4K4ZA 1YTYA 1APSA 3D0PA 3A8KA 1RA6A 3D3CJ 3V4IA 4M5JA 2BUPA 2BDPA 1IWGA 1IO2A 1XJWB 4E2FB 1WSEA 3N97B 3ETOA 4CEBA 4JRQA 3QRPA 5T14A 2IJFA 3Q8UA 4LRBA 3S8SA 1TUUA 4YR3A 5DK5A 4ICAA 9ICXA 1TL7B 3B8AX 2XC9A 5IT9U 3I0SA 4KPCA 3SAFA 9ICOA 2IJRA 2O8EB 4BCAA 1XSNA 4KLGA 4R8UA 4OJLA 4QBUA 4DV7K 5AK4A 2KVSA 4RQ4A 1GLAG 1R3NA 1EX4A 2FGOA 8ICBA 3KD5E 2UXCF 1FA0A 4TYBA 5AT1B 3VGMA 1V6HA 4MN4C 2GH1A 2QL7B 5BREA 3ZDDA 3HHLC 1OQ6A 3ZFVA 3JYTA 4QU6A 2OM6A 4C11A 4FLXA 4NYOA 1VQ6S 3C2PA 1FO4A 2VANA 1Q9XA 2KG1A 1HKBA 1ZM9A 3N79A 5GMDA 5AFUH 8ICNA 2M8DB 4DS4A 3SNNA 3NGUA 3R5JB 1ZQMA 2QK9A 3T1YJ 3O2IA 1KKHA 2R7YA 3K17A 3T5HA 4CT8A 2QKQA 3T5JA 4O4RA 3PSTA 2WSFC 3VEXA 3MEEB 2YWKA 2CNOB 3DRSA 5HRNA 3L4QA 3ZTQA 3GR1A 2WFBA 3ZO7A 3IG1A 2IGIA 3TTCA 2ZFHA 4GLXA 1NH7A 3UCGA 3VEZA 2HNYA 2OFHX 4K4VA 3FFIB 4B3OA 1RBSA 4DF4A 2ZD1A 1SZHA 1XK8A 4KRWA 2YWEA 4KB7A 3SXLA 3BN4A 2FSNA 3U6FA 3DU5A 1YBUA 1GX5A 4CGGA 3OYAA 3JSRA 5IC6B 1KWMA 3THYA 4PKHA 1UVKA 4UOCA 2LDIA 5CY4A 3VQ4A 3AJ2A 3UCUP 2FC0A 4O3PA 2KM8B 4KHYA 3S1TA 3RMCA 4M04A 4LBIA 1PVRA 3HW8A 4JHDB 4DSJA 5M1OA 1NDKA 1VQMS 1KHWA 1Q5VA 2BCUA 5DDOC 2B0GA 1I3OB 3PHTA 1RG6A 2F2AB 4JK8A 1MROB 3H5UA 3P6YC 2QL5B 2OANA 4YY3K 2P9IA 1RDFA 3RW7A 4ID5A 5IWAK 4Y2CA 2F4VF 4YMNA 3KK3A 4QIWD 4IFYA 1QUVA 2P5GA 4NJ8A 4MFFA 5HNKA 3BPDA 1S1UB 1S77D 4TUPA 3M8RA 5GADP 2CYYA 2PI5A 3ULEA 3FZMA 3FGVA 4WFNQ 1Q16B 2DH9A 2VOPA 2KIVA 3JQKA 3CJKB 2VODA 2AJ0A 3JSYA 3Q0AA 3EWAA 1NGGA 2NQPA 1WG5A 2I6WA 5EOYA 3WEEA 2ZE2A 2ZH2A 1PVPA 4C2MA 1XNRJ 1VQLN 1HA1A 3L7OA 2CRXA 4EP4A 1K5OA 4FF3A 1YJ9N 3QPIA 4IH6A 2BW2A 4PYDA 1B9DA 4CO4A 4KB1A 2MA1A 1RTZA 4KHSA 4C9DA 4YR0A 2KXNB 4OFZA 3VEYA 3BGFA 1KLMA 1BQMA 3N0VA 4IQMA 2PKEA 4P4OA 1B99A 2IHR1 1N34K 1MU2A 4NXMJ 1RWKB 1M5VC 4IRKA 4USIA 5A2QY 3PIOL 2W8LA 3FQLA 4RPFA 5AIBA 4AHUA 4KLOA 2ZJ8A 5ETRA 4ZJQA 1OH6A 1IBKK 1FO1A 4IQWA 3SPZA 4B02A 3TADA 4PXBA 3KLVA 3NRWA 3UDLA 1YITN 1ZETA 3W0LA 1QTNB 4MIBA 3LPUA 5C2DA 4FS2A 2QTWA 3U02A 1TVRB 3X3UA 1VSIA 3ASMA 3NAIA 1B4FA 3WK7A 2YN4A 1I5OB 1L6NA 3E8OA 4F8RA 1NNLA 3D28A 1JJCB 4R5PB 4O3QA 2ETJA 1Q82T 4CWBA 2VASA 3R9LA 2J0WA 3O3HA 2Q4TA 1WHWA 3FSXA 5CCMA 3PO4A 2NZCA 1VLOA 1KP6A 1EKEA 1HQEA 4P2HA 1NNEA 1C0UB 1PJ6A 5BPMA 2HW3A 2BE2B 3ENOA 1HUOA 2P9SB 3SMVA 3JSMA 2MHEA 4ANEA 3UD3P 2UU9F 2YNHA 2UVRA 2K3KA 3SCJE 1S9EA 1NZPA 1GQEA 2OPSB 3HZGA 3VQPA 1GTHA 4P2XA 3E51A 3ET6B 4KO0A 3H2LA 3FSIA 2VQEJ 2W03A 2FVRA 1S12A 3RJGA 3G82A 3VGSA 1VDVA 1LW0B 1TP7A 1M5HA 3CM5A 4P74A 2VBZA 1B92A 4LFAK 2BANB 2QO3A 3UQSA 2YHAA 4Q2MA 3TVYA 3R97A 2JRZA 4DX7A 4JN4A 3GDXA 4DR4F 3OYEA 4XRHA 2XLKA 3LOUA 1AA1B 2KVCA 4USVA 3QIPA 4O5CA 1Y00A 3NFAA 1TL1B 2PEBA 4CGDA 5HI7A 1WC0A 4K0KK 3IP0A 3FDSA 2HMPA 4A61A 1OY9A 3NS6A 3VR1A 4H0XB 1YK9A 4RQ2A 2JWNA 4NCBA 4Q2LA 4DSIA 1LQ9A 1I39A 5JRTA 2FMSA 2P51A 2YQ0A 1SIJA 3M2UA 4ID1A 3WDOA 4CJTA 4US9A 2CZ4A 1S72S 3NRBA 2D0PA 1YVFA 4I6AA 3SCKE 2FMQA 4QZAA 1HL6A 1TR0A 3ZDEA 2RD5C 4M3XA 5HN0A 4PGQA 3AV9A 4B9VA 1Z19A 4P0PA 8ICCA 5J0QA 4NLRA 3WU2U 3RJJA 5KPZA 2GMHA 4CFCA 2E8MA 3DNCA 4M5IA 3EGZA 4K50A 3HP6A 4JUZA 4DV0F 5B0EA 3DRRB 4NLWA 4YEAA 2DUYA 1G99A 3RB0A 3OYJA 2V2QA 4OLAA 5AZIA 3L6QA 1YQHA 3CDWA 2D3OR 2VKZG 4IOCL 1E4FT 4B9SA 1HBNB 2E7VA 3QESA 3TZZA 3G8TA 4M6WA 1XC9A 2O8FA 1RGVA 2Q6CA 5AXKA 4UTGA 1LK7A 3HPOA 1HIWA 2DKZA 3QJLA 2RHSB 3QIOA 2K1RA 1I51B 1HNWJ 3WNGA 2VBYA 2ISOA 3MMVA 3KBBA 1B0TA 1DQAA 2VG7A 3MD1A 2NXEA 5DLGA 3KMSA 1IBMK 3M6KA 2R7UA 4OGEA 2F4FA 2DPNA 1CBKA 1BG3A 1DT9A 3C21A 3BR9A 4OI4A 2H5JB 1LWFA 4F9OA 3HX0A 2ATCB 5HP1B 4LSNB 2P6TA 4M1KA 4WP3A 3NXZA 2H3EB 1IJFB 2GVDA 1N6QB 2V0NA 4CI0B 2PI4A 1CXQA 4DTSA 4DR6F 3DU6A 3CB4A 1A6SA 4A46A 1WORA 1DTTA 2FSJA 5CZVA 3O8WA 3TSUA 3KKSA 1W7WA 5F8GA 3HKZF 2QLBB 3OYBA 1MWMA 4HR2A 1JJ4A 3HYFA 4JKAA 2L48A 2KW4A 3OUYA 4PXDA 1PYSB 2NLWA 4M5MA 4OHWA 2QWQA 1UVJA 3TZWA 1TAUA 2F9TA 1HQUA 3VAKA 3TZYA 4WU2A 1UZHA 4BR2A 5AQIA 4NI2A 5AQNA 4L3NA 3EW9A 4AL6A 1LWXA 3O9UA 2BJ8A 1N88A 1PJ7A 2ZWOA 5ALKA 5G4DA 4F0MA 2Z2YB 2Z56B 1U4BA 4Z7CA 5JVHL 3UD4P 2DY9A 4OVLA 3IMXA 4B3MJ 4C8YA 3IR5B 5CHGA 1RTHB 1SL2A 1E3MA 4ZMMA 1GO3F 2CQ2A 7ICOA 3VQBA 2H51B 5BYQA 4NASA 5F8LA 2E29A 1U9LA 3BH6B 1R0BG 4B3SJ 5D46A 4KLQA 3OYCA 1U2VA 3OLAA 1N5TA 5GVQA 3MD3A 4WJ3B 3N28A 3CJ7A 4LF6F 4YHHJ 4OI2A 1RHQB 4U7BA 4LF7K 3OBYA 2YY6A 4H4OA 4JS4A 4M5DA 3B82A 2X1GA 3NGYA 2CJAA 2KU7A 3DC2A 2KT2A 5KNIA 3C1YA 2N4CA 3QUBA 3RG6A 5B0FA 2DISA 3VQSA 2VFVA 1SWWA 4DHVA 1XNSA 2V68A 2BKPA 1G6BA 3LP1A 5I3PA 1DEJA 3BQ1A 5CYMA 4DV1F 2UXCK 3LP2A 2XMUA 5K14A 4CLZA 4QS9A 4IO8A 1VSEA 5K8MA 4KC5A 2H9ZA 1URNA 5M1QA 3ZSZA 3NGRA 2RQMA 2CNNB 4A8YA 3EYZA 4B3RJ 2E1PA 2DCLA 4JKGB 2N3LA 2R2TA 4PQAA 1X5TA 1YLXA 2LXFA 3T19A 3MC1A 1UJ6A 3M9MB 3H90A 3WXIA 4E98A 5IOLA 1YJWN 4F4XA 3RH4A 3GJRB 3D2QA 4AYBF 2PIIA 3EDRB 4DTOA 1LK5A 3TADC 3OR2B 2D69A 2P8IA 1MN7A 2OYYA 1ILYA 1D1UA 1Q81O 2KK0A 3ZNUA 3PW2A 4CRJA 3VA0A 5IQQA 2R7TA 3HHLB 1W97L 4A59A 5DG7A 5K4LA 5J2MB 2QFJA 1CJUB 2HVEA 1OYDA 4CM0A 5LL6Z 1IBCB 5AI4A 4OV6A 4KLIA 2IA6A 4CLLA 5D15A 3VWSA 2W7PA 4RQ1A 2B9XA 1FEZA 4FL9A 3AU6A 1RBAA 2GCFA 2ZIWB 2X3DA 4LFBF 4I2JA 1S6PA 3BB5A 1R0AB 1GH8A 3NHGA 2BQRA 3HFVA 1D9AA 2FZCB 3TAPA 2F7VA 1M1HA 4I69A 2UUBJ 2HOEA 3BF1A 5AQZA 4YVZA 3SSRA 2YJFA 3ZZYA 5JLHA 4JI4J 4ZIWA 2NUBA 2NS1B 3CCQS 3BS7A 2F4VK 1RK8A 1LFWA 5GTIU 2NYHA 4GKKF 3UMGA 1N54B 1TUWA 2IM3A 2VJUA 2B7CB 5KT6A 2Z1HA 2VG6A 5E26A 2ASLA 1Y0HA 2NR0A 2W4PA 3UR3C 5CD4A 1VBKA 3RR7A 5HMYA 2VWBA 3BF3A 3W63A 5FJ4A 1KAYA 5GMKa 4W90B 4FK2A 2GUPA 1YRXA 3GSIA 4DCJB 1OY8A 3N6LA 4TQRA 2GHWA 5DB6A 2Q79A 3P39A 2FJAB 4K4XA 5GTHU 5HBMB 1JLGA 3M7DA 1R27B 3TAMB 1XO0A 2E5IA 1IG8A 1QSSA 5CRXA 1KLNA 1KL9A 4LFCF 3QSIA 1YVUA 4BHQA 4IRDA 4ED2A 2ZEJA 5AQPA 2B21A 1OJ4A 4MYTA 4NLQA 2OH2A 4AQYJ 4RQNA 3A0IX 4CI6A 2MQQA 4QOTA 1IXRA 3TAEA 1SL0A 5G0RA 2P9GA 4YR2A 4R63A 2MZQA 1H98A 2H4YB 2NRWA 2A1JB 2IA0A 4M5HA 5B66U 4C0HA 4PABA 1ZC6A 2WF6A 3HSCA 1IR2A 4URSA 2EAPA 5HVHA 3KKAC 4NA1A 5HP4A 3E66A 2KO1A 4MEXA 2OYQA 2OPQA 1XNQF 1S6UA 1YGYA 2MY8A 4CH0S 5JVGQ 1X4AA 2DO4A 1GLDG 1J5OB 1FXDA 1B70B 5J2CA 2RSQA 4BWJA 5B7WA 5D4LA 2M5YA 4UY8T 1ZQHA 2BKOA 5CB1A 4AD6A 3OXFA 3ZSOA 4ZP8A 3M9NB 3ZEUA 1VSHA 2YNGB 4J9UE 4QR2A 3J7ZO 2V8PA 2Q31A 3PZPA 2W9MA 3H42A 1HR0J 2M0GB 1LWCA 4DV4F 3ICXA 2DXFA 4GC7A 1HJOA 4QYRA 4LF5F 3TPQA 3UKUA 1TVAA 4CJ7A 1UKUA 4QYZJ 4MDBA 5C5JA 1RJJA 1RLCL 2GBZA 4OYPA 3TJAA 1RACB 1BY9A 3NEKA 4J91A 3Q8KA 2Q66A 4K4GA 1N32F 3PX0A 4WKYA 4C1NI 7ICVA 3A3NB 2LM1A 2PFNA 2I7NA 4B1VA 5DBCA 2RUGA 3NOGA 3UQ0A 3T1YK 4G1PA 2HKEA 1IWAA 3BKUA 2KKPA 5J0OA 4ECRA 4F0KA 4RTFD 4DR4K 2B6AA 4NLBA 4RT3A 3CQYA 1HNVB 1S79A 5J2PA 3ZDAA 1K47A 2E66A 3HVAA 4RPXA 2ZIUA 1YIJS 5DB9A 1I3AA 4UUXA 1BMQB 4DEZA 1L3UA 4ZTFA 3LAKA 4C97A 1GMUA 3D2SA 1T3QA 3DLEB 1QD1A 3ZXWA 3F2BA 5D0GA 5I3UA 4CHOA 4Q8EA 2PZSA 1VJ5A 2ZBRA 4RW4B 3POTA 5AZJA 4KKOA 4XUSA 3AM9A 5L1KA 3QE9Y 5LT5A 5DQIA 1I6JA 5AKIA 3AVFA 2JGAA 1NSKL 3DLGA 1P1TA 1HD1A 4M9NA 4F72A 1NGBA 1RISA 3RJKA 4YG2A 2LQ5A 1BC6A 9ICMA 8ICVA 2AP1A 2XYHB 4Z4EA 1WC4A 5EX0A 1RT7B 2AZ1A 1MMDA 3KOAA 1XERA 4RBUA 1TKXA 2CQCA 4FKYA 3MM7B 4FZVA 1NO8A 3AXMA 2DJWA 3WKDA 3D5MA 2FI1A 3CMQA 2HHHF 3GZFA 2O5DA 3EDQB 3GYGA 3ORYA 5J2AA 2X1BA 3O8MA 1NM2A 4ZN1A 3AQEA 1FT8A 4HLBA 3UN2A 3DWLA 2OZSA 2X74A 4YXJA 2JR5A 3GL1A 5K5MA 3OYIA 2HZCA 2UVUA 3W2WB 2OTJS 1RTJB 4JV1A 9ICTA 2Y0SD 5HMMA 1RTDA 2DY4A 1G2EA 1HEKA 4MH8A 4NMXA 2B6GA 2OMLA 4DN9A 4EZ9A 1KAXA 3CJ5A 3LM2A 3ZSYA 4UAWA 2CQDA 1XTZA 3QGGA 1CLQA 2FHJD 3QO9A 8ICUA 2KSOB 3MTJA 3BY5A 3L2VA 2XZDB 2KYXA 2A6OA 5KFDA 2O67A 3I0SB 2O66A 1Q79A 1RHUB 2QGFB 4K8ZA 4PEOA 2B4JA 4R8UB 3R5DA 2E1MC 1VQ5N 4IKAA 4EZ6A 4YD1A 4ZPAA 3Q8QB 4IQTA 3VEWA 2DWQA 1E6VB 5HL7L 1ZQEA 3GYXB 5C12A 3CCRS 4KHUA 3CMAN 1D9FA 5J2GA 4NXMK 1XQIA 4DR6K 2FF6A 3C15B 3NS5A 3JYTB 3ZD9A 3H40A 4C11B 2VG5B 3AAQA 3LH2S 2JWLA 4KLMA 4C80A 1S9FA 3KG0A 4BXOB 3TEGA 4OZ2A 3QMLA 2ILYA 2RRNA 4A47A 4PWWA 2W2QP 3NOCA 4A48A 5F9NA 1F9FA 3NGDA 1WB9A 2C3YA 4GV9A 1P9YA 1ASVA 2D0BA 1BWVA 3H8MA 2G8IA 1VMBA 4I2AA 4CEFA 1C0TB 2R18A 4OJ5A 2W04A 5B0CA 3NF7A 3V5RA 4CZLA 1HYSB 2DGOA 3JAMO 3IG1B 3SSQA 4E7HA 3EVOA 2HNDA 3S9HA 1RWXB 1EP4B 4ECUA 3QEWA 2WFAA 1HBUB 1TUYA 1COKA 4KLEA 4Z6EA 4IO1A 4CJVA 4OZ0A 1IKXA 3D45A 5IIIA 2FLLA 1AQ6A 2PXIA 2YNFA 1C1AA 1T0TV 2Q1NA 2RKIA 4RQ7A 3MM5A 4NLSA 4OLBA 5A8KA 4LF6K 1RT6A 1Y7PA 3I0RA 4WPAA 1I94F 1NGJA 2VQEK 3T9ZA 3F73A 4LSLA 1NWKA 3IAS9 2FMPA 2IOFK 1JCEA 3E01A 5EN1A 1WNSA 1C0FA 1V38A 3EX7B 3QNMA 5KG4A 4DV1K 4RO0A 1YJ7A 2K7JA 5KOXA 1ELOA 4MLEA 1F5BA 3MABA 4RT2A 1XC3A 3VZHA 2YXLA 4DPUA 3MCPA 4DL6A 3FBCA 2VUGA 1RT5A 4UOGA 4NCGB 5DM7Q 2DO0A 3MPVA 5DB8A 1Q46A 2EQYA 4WF9Q 4DOZA 1FRJA 4LVSA 2EI5A 3C8YA 3P96A 3CD0A 3K2YA 4ANDA 3MMCB 1Q7YO 4EEYA 1U8WA 2ZE2B 2VFRA 2HLTA 3K0JA 1VLYA 3MM9A 2QWNA 2EC2A 1NMDA 4DI6A 3QIDA 1M5KC 3CVKA 3MBYA 5M1NA 8ICOA 4S0MA 4NYNA 1SJ1A 4PRFA 9ICNA 2OSQA 2Y1RI 4B9TA 4XEIA 5AQHA 1EXQA 4M5LA 4KGKA 2L9WA 4B8CA 5BOLA 1UVMA 3G10A 2BJ9A 2PYJA 2AJ2A 3AT1B 4BC5A 5KFUA 3NBPA 3BSOA 1KVJA 3FZFA 4EX7A 4EK2A 4A62A 1NJIT 5M1PA 4K2JA 4ERDA 2BZ2A 4LFBK 3KZXA 1VHXA 1R43A 1EQMA 1CZ9A 3TKAA 5K8NA 3GJQB 1EKSA 4BY9C 4YOVA 1A5WA 2JWKA 5J8YA 1VK8A 4ZVUB 2C22A 5JXSA 3DLLQ 1TELA 2F1HA 1H74A 1HNWK 1XMOJ 1X6IA 4RUBA 4GKKK 5FP0A 2O8DA 1ZQOA 4OZ1A 2CPHA 3RW6A 4KH1B 2ZH5A 4DPXA 2MAXA 1MWZA 3V81B 4IEIA 1X6JA 5E5NA 2ZXHA 4Y00A 1P90A 1BD6A 4OIXA 3T6BA 1H2TZ 1Z1VA 3HSTB 3VN5A 1JRPA 4A8FA 3CFPA 2BTFA 2NRTA 1WNEA 2XSFA 2Y9HA 2EWSA 4KI6A 3RYLA 3WHIA 3UNGC 4IBNA 2KNJA 1SXDA 3BV8A 1UCVA 4FJHA 4M95A 1HNXJ 3SZ2A 1IUJA 3O1BA 1S9EB 5ALZA 3HOTA 5AJ3F 4HTUA 4K59A 2FDNA 3D6FB 1U8SA 2MKIA 1UAXA 1XMBA 4USAA 3JXUA 3EUB2 4F3QA 4A5AA 5DM6L 3PKYA 3G71S 3TQ1A 4HVJA 4I6MA 1IKYB 1FFGB 4KH6A 3MEGA 4FYYB 4DOBA 2V50A 2XHBA 3CDEA 4OX6A 4Z7YA 5L1JA 3CJ4A 3L2RA 2W54A 4RQ3A 2X6NA 3HHDA 4QS7A 4B3MK 1PVQA 3HILA 3HD2A 1X4EA 1SKUB 4EX6A 2H3QA 3WK5A 2W3SA 3QT5A 2EZXA 3VF6A 2QSWA 5AK6A 3G8QA 2KJ5A 4YFUA 3D2EA 1YRTA 5CH7B 1N4LA 1XNQK 4B3SK 4PWUA 3PFOA 2GIRA 5AM5A 2ZM6J 5C24A 3RBXA 4LIRA 1NM1A 4YHHK 3CP8A 3C29A 2ASMA 4IQVA 4QZFA 3R1LA 3IRXB 2VA2A 1O51A 3UE5A 3RFAA 1BUPA 3SQ1A 4GNIA 3RMDA 3D0GE 3FAHA 1UQVA 1YZ7A 3ISCA 1EO1A 3CTRA 2YJEA 5TKWA 2F3NA 2AYEA 3O6QA 1ZQPA 1JXLA 4P4MA 4GVMA 3OS1A 4DV4K 5AKHA 2DH8A 3VQ8A 3ZT3A 2J5AA 4LF5K 5KT2A 3N5FA 1S5LU 2DR7A 4O5EA 4F92B 1JL1A 3J8AA 2KKHA 1Q78A 4FJJA 2HWIA 3UIQA 1UFLA 3D1OA 3CCVS 4PA1A 1BIZA 5AZIB 2YHWA 4B3RK 2A3VA 3ENBA 5B0DA 4V1Ak 2FB0A 1VYAA 2Z58B 3EVWA 2IFXA 3C7NB 2CRLA 2UUAJ 4FFDA 5L46A 3RB3A 3WXKA 3ID8A 3W5XA 3OR1B 1VSDA 3BS5A 2L08A 2O8FB 4H03B 4JYAJ 2N7CA 4CIEA 5KFTA 2ZOGA 4JKFA 4N7TA 1M1GA 1GK8A 1MMLA 5ALGA 1Q7LB 2QI2A 3Q8RB 3S01A 1T3OA 1RYUA 4DSKA 4XQ8A 5G5GA 2DITA 4LR9A 4Q5VA 1U2FA 3Q8MA 2PDAA 2MUTB 2VGNA 2XRIA 1R8PA 4B1YB 4IC9A 2EFGA 1OH8A 7ICHA 5K20B 4CFDA 1U1NA 3P3DA 1CZAN 2GVDB 5AXLA 5ALRA 1NU4A 3LDNA 4OHZA 5CJ7A 1C4CA 4DR2F 1S99A 2K4HA 3V7LA 3RSEA 5J0WA 1W2BR 3I32A 2B51A 4IOXA 1ZQSA 2G4BA 1RCOB 5DJBA 4CEZA 1ZA1B 3JXOA 2UUBK 1J5EF 2AJQA 4CM2A 1EB0A 4FOEA 4NI2B 2KVIA 1ZS6A 5ALDA 3UMCA 2HHHK 1Z3EB 2QTDA 3V9XA 3SYZA 3OHAA 1O0PA 4JI8J 2LI6A 2WVFA 8ICWA 4WQ4A 3W2VB 4U8VA 5HVGA 3KKRA 5ETPA 2P9PA 3D6RA 3CD5A 3MDQA 3T1AA 2WAQD 2VIXA 3CCZA 1F5CA 3FE1A 3PXGa 1PBUA 4J9PA 2F8EX 4RWWA 2DNHA 4F67A 4I2PB 5F8JA 3LK9A 1U2VB 3CJ1A 2KJVA 3KFWX 5GADU 3AY9A 4WCEL 3EGNA 1OKJA 7ICEA 4USJC 4DQPA 1F44A 2DIVA 3MI7X 4FBUA 1WEXA 1HD0A 5LJVA 1FE4A 2LU1A 2XWXA 3O1WA 3BGLA 4OV1A 1R6YA 3OYMA 5EWGA 1L8LA 4JI5F 1XO1A 3NVVA 2UXBJ 4K8RA 1WUAA 2EFPA 3UDVA 1FESA 3CC7N 4AQYK 4DS5A 9ICUA 2IDEA 3JAMU 4BC7A 1T9WA 5K14B 2M70A 3NWRA 2GAGC 4YOXA 3OD2A 2OD4A 3DXMA 3DLHA 5AQOA 3SSSA 1LB2B 2B9WA 1UAWA 1LFPA 3GILA 2DNZA 1RYRA 4MKBA 3QFPA 4DV3F 3PVXA 1S59A 1R8BA 3IM9A 2E5LJ 4C4SA 3PIPL 4X4QA 2QZ8A 3BSNA 4FKXA 5J2NA 3GIMA 1YJVA 3PW4A 2MSSA 1YIJN 4I28A 4QIWC 1DZ5A 4NXNJ 3MXJA 2LHTA 4FLZA 3PTWA 3DGPA 3BBFA 1REGX 3HLUA 3PY8A 3N6NA 3GR0A 1Z25A 1P1LA 3FEXB 4YDUA 3NDKA 2OXOA 1JXVA 3OTDA 4NV0A 3ZZTA 1RWVB 4F26A 1A5XA 3I55N 5BPCA 3PKMA 1HR0K 5BR8F 3BO4A 3SAHA 5GADI 2OHFA 4QYZK 5J2QA 1HFEL 2RAQA 3S3MA 2F1JA 2DIUA 4E89A 2GUIA 1WC6A 4J37A 5HANA 2QLTA 1F3VA 2MKSA 5FIIA 4BACA 2YMQA 3HHEA 1SV5A 4ES1A 2HNZB 2QA4S 3KHYA 3GFHA 1I94K 8RUCA 1S6PB 1Q0NA 2JEJA 4DUYF 3D1QA 5DGBA 1TL5A 1WELA 4DV2J 4I27A 1FXRA 4EUVA 4EU0A 2LMRA 3V6JA 4M9HA 4CZIA 2J9CA 1BNOA 2E7XA 4DFMA 3SFUA 2K4PA 4DPWA 5D6GA 3IR7B 2GTDA 3DOKA 1Y4ZB 3TJ9A 4ZJOA 1IJEB 1SB6A 4QW8A 3G4SS 3M2VA 4RX6A 5M2UA 4JMUA 4NCAA 1NKBA 4JV5F 4FK0A 3BBCA 5JLFA 4O3SA 4H5WA 2NXNA 2DK2A 2Z57B 1ZBIA 3PMLA 3ZETA 4U96A 2C2ZB 2D0AA 2XMJA 1CG2A 5IT9Y 1D09B 3SUQA 1DLOA 3ELHA 3VGTA 2GQQA 1RUSA 3OA9A 2PSZA 2QMWA 4Q8FA 3QJPA 5CE3A 1VR6A 3MN9A 3KK2A 4R64A 1NGDA 3CT9A 4LRCA 2F8LA 1N0UA 2OEHA 1RT1A 3P45B 3KOOA 4IDKA 4K8XA 5ETNA 3J80O 5A6PA 4TYAA 4ECSA 1DRZA 2DRAA 1R59O 3SENA 7ICFA 4WZMA 1ZXOA 3LYSA 2E5GA 5IIMA 5KFBA 3V9SA 1NK6A 1X9XA 1TMJA 1OVYA 5DMRA 2AQ0A 2BJEA 1X42A 1FFWB 4HACA 1Z26A 4AL5A 4ZVHA 3EVMA 4FVCA 1FF2A 4WF9L 2VHGA 2NREA 2E6LA 2F96A 5ALSA 2OJ3A 2E88A 5D0HA 1QZ6A 5AK5A 3AEVA 1M1KO 3OTQA 2AH5A 4DR1F 3P31A 1ZH5A 4DUZJ 1K8AO 4OKKA 5FLXY 3NLCA 2YX1A 5AR0A 2C3MA 3MGVA 5K9FA 2B7BB 1ZBHA 3V72A 2A6AA 4OPJA 1NJXA 1JN3A 2ZC3A 2WVCA 4XTTA 1RAJA 1QHTA 2F9DA 4NY8A 4YXMA 2WB1C 4A8KA 4ZH4A 4X62F 1E6YA 1F9HA 2MGZB 1T05A 3QBWA 1VQKN 2J0XA 4QOZB 1LWCB 3IMQJ 3KLIB 3DI6A 4C7ZA 3UKUB 3LW5C 3FRYA 2W4DA 1D8YA 3AL0B 2CZ9A 2PN6A 5A8WB 1JXBA 2E44A 5DLFA 3M8WA 2J6UA 3B9JA 2BEFA 4YB6A 4LF8J 4JI1F 8ICPA 2DKOB 1VSKA 2E5SA 4M3ZA 9ICLA 3QNNA 2VC0A 2ZHBA 3HZEA 1Q8BA 3GG0A 1WBBA 4DL3A 4K5SA 1KFSA 4K4SA 2D5RA 4OJRA 1S1VB 3CDBA 1CRXA 4XAKA 1U0SA 4WQ5A 2ZUBA 3CYMA 1FKPA 2B6AB 3GE9A 1M5OC 3M8SA 2EX3A 3KLFB 1L7NA 4M5GA 1HPZB 5J2PB 5IINA 2HBKA 1ZQKA 2DTJA 3D6HB 4HTLA 3CFOA 3SQGB 2HPUA 5IM0A 5AM1A 4CP5A 1IR1A 2G0AA 5D49A 3VQ5A 3IUCA 5LXYA 1RAFB 1HKAA 1AZSB 4MF2A 4B6JA 4WQ4C 1BNPA 1ZQCA 1QDUB 9ICPA 4OKEA 2CQGA 3CNHA 3MMBA 2LBOA 3CJ3A 4HAIA 2KI2A 2CDQA 4L8RB 4QR1A 3CJBA 1RZMA 3J81Y 4WE1A 3TZXA 4DV5J 3CDUA 3W7BA 4DV6F 4L74A 5DDPC 5GAGP 2DNPA 5AQRA 3NAHA 3DRPA 3G6ES 1RPLA 3ICLA 5H9EJ 2XY8A 3G6YA 2HRTA 1S6OA 4DV2F 3L2UA 1TV9A 1S9GA 3BEGB 3C95A 5AI0A 3H2UB 2LM4A 5EHHA 3H08A 2OEJA 1X0PA 1RBLA 2GJFA 1Q3VA 3IAM9 2NYIA 2XY6A 3PRDA 4KSEB 3C46A 3MM8A 5AKEA 2KHQA 1RZTA 1CEZA 3A8EA 2AJ4A 3HSDA 2CQHA 4M63A 1NDCA 1ICEB 1V4SA 2F5GA 2BPGA 1WACA 4F50A 4L75A 4P7TA 1U45A 2YKNA 1KXPA 2VV5A 2QB0B 4DPOA 4MFBA 2Q36A 3THWA 1LEOA 4B1ZA 7ICUA 4TLQA 5LJ5Y 3VQ6A 5KG6A 5E3AA 1D5AA 3QO9B 1BHNA 1NLKL 4FJNA 2KV2A 3UN5A 4RR5A 2AU0A 2G2ZA 3THTA 3V1OA 1FEEA 2BCQA 1YUWA 1SKWA 4ED4A 4ETZA 1VQ4S 6FDRA 3OYGA 3P5JA 2IBKA 3ZI4A 4ZP6A 2U1AA 3M6WA 5EE3A 4DUTA 1TAMA 1VI7A 1FNXH 2QB1A 1WYGA 3HP9A 2V63A 1ATSA 1C1CB 1LWEA 3B0XA 2VWJA 3BDPA 3WNEA 1X5SA 3IBCB 4JWMA 3NMRA 5EDWA 3SJJA 4TQSA 2E7WA 1C0GA 3G71N 2KHDA 3IG5A 1OSDA 1UFKA 4OX9J 4WP9A 2ZH7A 4DR2K 3V4MA 3L0QA 2EAOA 1R0CB 1CC7A 2RDDA 4L73A 1RBTA 2CXYA 1L5UA 3IWLA 4EFHA 1SQKA 1LW2B 1N33F 3M2RA 1RQNA 1J5EK 4KBOA 3KUEA 1K6YA 2UZAA 1QUPA 2OEKA 4CYUB 1OO0B 1NLVA 2ZZTA 4CO5A 1AXQA 9ICSA 4IR1A 3L2QA 4OYZA 3QGIA 1CJKB 4Y6IA 2FHJA 1XMOK 2R7QA 1QE1B 2Q3PA 3DJCA 1GXTA 2XYGB 2C3OA 2HNDB 5SUHA 3KLEB 1U6FA 5C7PA 5ALPA 3LDOA 3NVKA 2DFLA 5CA7A 5DG9A 2YX4A 1WI8A 4O44A 3DEEA 2B9YA 3FZLA 4CO1A 3DDKA 2YNFB 4WFYA 3CC4S 3M8QA 2DHAA 3MM5B 5KG0A 1DTQA 1TL3A 5A2QO 1R8CA 3QT6A 2ZDPA 3I0RB 3AVIA 1JMTA 4AILC 2DGXA 3UVJB 2RLTA 5DETA 1YJTA 2HHSA 4LSLB 4HUGA 3NMAA 7FD1A 1W2BM 5JICA 3PJWA 2P9LA 2VFUA 4PL1A 1S76D 2XTJP 5C2FA 4R0EA 3OL6A 4JI5K 4F3OA 2UUCF 1VLBA 1K73T 3LDAA 4J9NA 2YH1A 4DL7A 1KBUA 3CCVN 2MRLA 3M5RA 2XYPB 5ALOA 4ECVA 4KHRA 3RJFA 1DBDA 3KFUF 1O6XA 4NWIA 4FVMA 4IOBA 4MJKA 2XLIA 4BDPA 1WOQA 1X3MA 2D3UA 4AM7A 1HW8A 1S6QB 2JFDA 3RB6A 4G9BA 1QQ7A 2CKWA 1RT5B 2M9KA 2VPXB 1N5VA 4J2DA 2QYCA 5AKYA 2PA8D 3D2FA 5M2PA 1KQSR 4CZFA 4PGXA 4R79A 3ISBA 3QDKA 1TGOA 3TX0A 3SEIA 1HNIA 4U7UK 4FJMA 4Z4CA 4CK3A 4YNQA 3U1NA 3TEHB 2CVEA 4Q45A 4YCXA 7ICMA 1ESVA 4A8WA 4PR6A 3MM9B 4TUQA 3HFZB 4BWMA 2HIYA 3ONQA 5EUHA 4G65A 3Q2SC 4JNEA 3HFKA 3OTOJ 4RL1A 4CLTA 4OHXA 4FYWB 2NXUA 5EE9A 1S1TA 1U49A 4DQIA 3DOMB 5BR8K 4ECTA 5D4PA 1U1OA 2Z2MA 4UZCA 5CWRA 2QYGA 1VSFA 4DFDA 2IC3A 4I9LA 4GFJA 2CPDA 3VC8A 3MTKA 2NPIA 1D9DA 3ZLJA 2LYHA 2EHGA 5J1EA 4GMKA 4OZ3A 4ECXA 2HRUA 3OPKA 2FLNA 2BXJA 2NPFA 2G1HA 5J0UA 2UUAK 3EKSA 3QEIA 4EFAC 4X4UA 1BPBA 3HVTA 2CVIA 1WUUA 1NBWA 1C20A 2R8JA 1EHWA 4BR4A 4RLEA 1Y97A 3VQ9A 3TFSA 3V6HA 4LREA 5D78A 3A3OB 3W9HA 1KONA 1X4GA 3R5CA 5E79U 4DZDA 3MDCA 2W3RA 3K1RB 4WQ5C 3IC1A 3VETA 1S3XA 4GO5X 1SH0A 2BE7D 3KJNB 1QAIA 4WFBQ 4NL5A 7ICNA 1RT4A 1YRUA 7ICPA 2NXJA 3EM1A 1CQMA 2KN4A 3O9QA 3X1LB 1JQGA 1NG9A 3KLGB 3F2KA 2LEAA 3UW1A 1ASWA 2FF3B 3J81j 4I68A 5CHIA 4UF4A 3I5AA 4C6AA 2RT3A 1S1WA 2HI0A 4KLLA 4QZIA 8ICSA 2XBPA 2QLJB 4Y2RA 2P9NA 5KG2A 1N5QA 3NVMA 8AT1B 1JLEB 4C1NK 1JLCA 1A76A 2ZG6A 4R0JA 2DNOA 2CPZA 5L38A 3ISDA 1G7CB 3TSQA 2H3FA 1B64A 3GQCA 1N52B 3ITHA 2KRRA 4G1QA 4X64F 3CIZA 4B1UB 3CXCR 2XMVA 4DR7F 4JI8K 3VGUA 2B5JB 2I8EA 3OQ2A 5IC4B 4JI0F 4DL0C 1FJGF 3DKDA 3SR6A 4MK9A 4H0VB 3M32A 2ZHOA 4QIWF 3MHYA 1TZ0A 3GSDA 2GWKA 2WK4A 4JI6J 2ILZA 4CF0A 2HBZB 5KTQA 1HWLA 4DR1K 5KOWA 1MQ2A 4NEYA 3MECB 3NVWA 3M9OB 1GOAA 4O0NA 1TK5A 4KT0C 3KHRA 2NZTA 2XULA 5EWEA 2YQEA 2K8AA 4QZDA 3ETLA 2QEXS 3KVGA 3HK2A 1IG6A 2ZIVA 1TUVA 1SIWB 1LCUA 3CJCA 2EAMA 4X65F 4E0DA 3M8ZA 4MYUA 5KT4A 2OPPB 2N4DA 3IDWA 1DURA 2K2PA 4PH5A 3CIPA 3H3NO 5BR9A 2PFPA 1RU2A 5C42B 2EH9A 1UVIA 4X62K 2C3UA 4A8XA 4Z37A 2VONA 3I4PA 5HLFA 2ROGA 1YI2S 1FJ7A 5L1LA 3BM7A 4G6VB 2QA4N 1QQ6A 1IKVA 1H6KX 3CMEN 4FM0A 2QLFB 2FVSA 3BGOP 2E8PA 3H0RB 1MW7A 1WTBA 1KVAA 5T41A 4X4VA 3TA2A 5HMLA 3I87A 5DB7A 3GG4A 3DM2B 1SXLA 1LOTB 2E5LK 2WMMA 4G3IA 2E6MA 3BGRA 3Q7CA 1SV4A 1FRLA 3R7BB 2C2MB 1HJPA 4JB3A 4PWDA 3GPAA 4DR3J 2ZGZA 3AVAA 3UD5A 3ZZRA 2BH1A 1UEVA 4RW7B 1WLJA 4KGZB 3OHRA 1U1LA 1WDTA 2W2OP 2GOLA 1PBAA 1U24A 4JI2F 4UOHA 2Y0SC 3Q8SB 1LKYA 1QHAA 2O01C 3UN3A 3OY9A 4ELTA 2FPKA 1NK5A 1C2PA 1KEJA 2NCKL 2RHFA 3AQOA 3WIUA 3FLCO 2ZWHA 3CCWA 1YITS 4JAXA 1XMQF 2DY1A 4F04B 2MQMA 1CI4A 3MCOA 1WDDA 4DKWA 4PGYA 2HQFA 4KGMA 4CGFA 2HFZA 1NGEA 5E41A 4BGDA 4CLFA 5A76A 2RJZA 3RSEB 5DRKA 4AHTA 4DV6K 4KHNA 3PCOB 1WKKA 1HNZF 3TTDA 3HF5A 3GTYX 5CABA 4TU9A 1F0MA 3TVZA 2YWGA 3IDHA 4I2QA 3QU2A 4QW9A 1YSJA 2ZJPQ 3QZ7A 2ZJQQ 3AVBA 4KHPJ 5A0YA 4DV2K 3MWBA 2FLOA 4IS7A 2YB1A 3H8YA 2AGQA 4O23A 4K4TA 4CF5A 2KE7A 2XCPA 3FVYA 4E7JA 2LYBA 2EK1A 3RMBA 4AUKA 4UARA 7ICIA 1NHUA 3HRDD 5KG7A 2E4LA 4KLFA 4KJIA 2P9PB 3QUCA 1CJVB 4CQ1A 2JLEA 4TY8B 1HYVA 5IWAF 3AVGA 3NGIA 4FW1A 2HSZA 5HK4A 1T44A 5AFUA 3RR8A 4AYBD 1F3FA 2KLAA 3SQOP 1ROFA 2WW8A 1F0XA 4CTAB 4FSVA 4FVUA 2WB1F 2OD6A 1ZBFA 2D6FC 1RTIB 2QWOA 3RJHA 1VSJA 1VRQC 2J7UA 3EJMA 3QSYB 5C10A 4M9LA 3AARA 1FKOB 3WKAA 1GX6A 2Z8QA 4H5TA 2XNQA 3S3NA 3GG1A 1RM6C 2YKQA 3PYFA 4FM1A 3HI9A 1H7WA 4BE1A 2GS8A 1U04A 3C65A 2HBJA 3MEDA 2BJ1A 5ADXH 1JJ2R 1VQON 2OZMA 2GQCA 1DY3A 4P0QA 3DXMB 3NNCA 4J2BA 5CYQA 2AJFE 1GFWB 1VRUA 3Q8PB 2RHQB 2CJXB 4B3TF 5E3QA 2V51B 3U8XA 2NO5A 2LA6A 4GKJJ 2KHOA 2XZWA 3S6JA 2NZ4A 1J53A 4JI6F 4KHWA 1RGIA 2Y8YA 4EYHB 5GIOA 4CF4A 3BKTA 2ZBCA 2IVFB 4E1NA 3UM9A 1WTFA 3RBEA 2NSBA 4G1IA 5A2QU 4IWVA 3MGJA 1YT3A 1RXOB 2OEMA 4XO0A 1XQSC 3THVA 1FXLA 3K75D 1WCLA 2PMZC 2ZUCA 3DGPB 1RAAB 4ZA1A 5ETMA 5A6WA 3GU3A 3EXCX 1RT3B 1G3OA 2HVDA 4O8KA 3R9KA 3AUOA 5KFOA 1UCNA 3I6PA 3R3TA 1VQ7S 4KHQA 4GXJA 1N36F 1P9QC 3QJJA 4PUOA 4GMJB 2MMYA 5J0RA 4FPRA 1FTRA 5J2QB 1W9HA 3VGLA 5J1NA 4HVZA 2KP7A 3LPTA 5AE1A 3M30B 4V19J 1FFSB 1SV5B 3VGVA 4YMEA 2D0OA 3LZJA 4TUSA 1T6CA 3LGHA 4K5RA 1SI9A 4CT9A 4UW9A 3OYKA 2WBRA 3TR5A 1RFQA 2NRVA 4LY7A 4O3MA 4J9VA 1TMMA 1Y10A 3EY1A 3K58A 3L95X 2Z2ZA 2UUCK 2LECA 5D3GB 2DFFA 5J2DA 4CHPA 3L3FX 1TKTA 2E2OA 4CF2A 2VA8A 3K5LA 4O3OA 2K4IA 5DQHA 4N47A 1WN7A 4LFAF 4R65A 3BQ7A 4NOHA 4FWSA 1X8DA 4PPDA 5ALQA 2XMAA 1DK3A 5FROA 4W5NA 2H3IA 2IVOA 1K9MO 3DFEA 1ZZNA 3ZETB 2MKCA 2K06A 1U2CA 3M8PA 2ZITA 1YF5L 1Z05A 4OD0A 2BA9A 3OL7A 5ALXA 4IR9A 4EBCA 3O6WA 3NNHA 3HHNB 4JKHA 2DRDA 4OZNA 3OYNA 2CA9A 4MQ3A 2XGQA 2ZUAA 5M1FA 4WP8A 1CS4A 2GMJA 3HCXA 4IDKB 2PFDA 4QZCA 1HHSA 5HMZA 3LP0A 5H9EK 1Q3UA 2EFQA 3AVCA 2CQBA 3T7ZA 1FRHA 1SC1B 4F25A 1W25A 3GFKB 5HVFA 4X66F 3CJ0A 4JD2A 4FF4A 4HACB 4W4MA 1B7YB 3K57A 2W2PP 1RDRA 3O4WA 5L1MA 3M1VA 4LF9F 2VC1A 2FBVA 5B0GA 2KTQA 3OFHA 1WSGA 3RH6A 1BPXA 1ZQTA 3AO1A 2HOFA 1IBLJ 4NB4A 3FKBA 3O08A 2DR9A 4DQ8A 4NMLA 4KLJA 4OJPA 1RCXB 2IDLA 4RW8A 3EZUA 4Y2QA 3WK6A 4DQQA 2KRBA 3AVHA 3R6MA 3A0HU 2G8FA 4J9LA 4LH4A 3MCMA 2KT3A 3F5AA 4EBEA 4X4SA 2GQ2A 5J0SA 5T7LB 2DNRA 2QXFA 1WOPA 4ZHRA 2X78A 8ICZA 3ATUA 1SJ4P 2CPFA 5AE3A 1B9FA 2O8CA 1ZQNA 3CQ8A 3WXJA 2E1FA 7ICJA 2BRLA 4ZVOB 3M05A 1ASUA 1E6YB 2I5JB 1T05B 1EARA 3VEVA 3ZSQA 4BRAA 3NH2A 3J7A1 2OHDA 5FDLB 4MF8A 4HDHA 3DI6B 3D54A 2BCRA 4R66A 3BP8A 1RDAA 3QU4A 3QQCD 1ITGA 1ZD3A 3FYHA 5LSOA 4OJ3A 3BGUA 4IZ9A 1VGYA 4Z4GA 3A8YA 1F2GA 1ZBTA 3CF5L 2CQ4A 1RHJB 4IFVA 4OX9K 2HF4A 1NPRA 2R8KA 5AQVA 2IRUA 2IM2A 1AFJA 3BN7A 3D3BJ 4JI3J 3E3XA 1KC8O 3PX4A 5HROA 5F8NA 4DN0A 3WK4A 2JZBA 4DU7A 4M3WA 4A8SA 4RW9A 1B0VA 2HZAA 3ETRA 1FKPB 4K4IA 4X64K 4CRXA 3JTOA 3NKYA 4DR7K 1Q9YA 2GAHC 5LMNJ 5DKWA 1K8KB 1FJGK 4ZVSB 2FJVA 2W9CB 2HVIA 1NHKL 5IXUA 3H45C 4EGLA 4JEPA 4RQMA 4DX8H 4H4MB 3H7IA 3NRZA 1LAWA 2FJ6A 1H1VA 4NE9C 3RAMA 1BI4A 2YKAA 3MCAB 4RWTA 4CERA 4DR5J 2UXDJ 4K4HA 3KK1B 1Z00A 3HD1A 1KOHA 3ZZZA 3BS9A 4U67L 2B8QA 4DMNA 2Z7JA 4HL9A 4FJ8A 2W9BB 4X65K 4CZKA 4OJHA 1WEYA 3WNFA 2RDIA 1S10A 2ZBPA 4AHCA 2ZBQA 1DKGD 3CETA 1R8AA 2KH9A 3FFKB 4LF7F 3P8BB 2DNQA 2Y9TA 3GIRA 1PYTA 4PQUA 5H1SV 4N56A 3OS2A 3C6AA 2MLZA 4DSEA 2HS0A 3OTEA 3V7KA 4ECWA 4F0HA 2WTFA 3F53A 3MM8B 1PSDA 3I5CA 4LVOP 4CFAA 4DU8A 2FBTA 2CQ3A 5FPDA 1WD6A 3D66A 1OPIA 4BRPA 3M6GA 3QETA 3S6EA 3G25A 1QQ5A 2HMIA 5H1SQ 2XICA 4RNNA 2I5HA 4KV8B 5ETKA 4DU1A 1O1WA 4M0AA 3DMJA 4D3GA 3MEKA 1YX2A 4WKRA 5AQJA 1FCAA 1SJQA 2GGPA 2D9OA 3C66A 3O5BA 4NL9A 4JI2K 1P7DA 1ECWA 3LDSA 3F44A 3NMUA 1HWIA 2F9WA 3RU0A 2IY5B 4MKAA 3J7YP 1T3VA 2IVMA 3I8BA 3OTOK 3K7RA 2MZ1A 4FZLA 3QT7A 1DGJA 3RAQA 2XS2A 3FCVA 2FXUA