3TARA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-6) position
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tarA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tarA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tarA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tarA01
1C0TA 3TFRA 4J2EA 4OKKA 1GOCA 3ZDBA 1HNIA 2G8HA 4FLTA 1A77A 1S6PA 2ISOA 2RKIA 2DY4A 3K5LA 3ETLA 4DQIA 2D0BA 3MEEA 1HYVA 1HMVA 2KZZA 3IAYA 1WSJA 3DLHA 1IM4A 1RYRA 3MAQA 3JPQA 2AQ0A 4M2YA 3MEDA 4FZXC 1S1WA 1ZYQA 2D0CA 2PYLA 3U6FA 1QHTA 5KFGA 1D8YA 2OZMA 4OVLA 5KT4A 3NF6A 3MXMA 3QETA 1AROP 8ICWA 3KK1A 5J0XA 1CUKA 2ZE2A 2I1QA 4PGYA 4ZHRA 4I2HA 3AVIA 5J2KA 1ZQJA 7ICUA 1IKVA 1T05A 2JZBA 4H4OA 3WNHA 1KVCA 3SNNA 4PWDA 3LANA 1TFRA 4EP5A 3HVRA 1RT6A 4M3UA 3Q8SB 3LZIA 4I2JA 3V6HA 3M8SA 3NDKA 1RT7A 3KLHA 3ZD8A 5T7BA 8ICFA 5J2FA 3OYBA 3V6JA 2OPQA 4CJKA 1RT4A 5E41A 1V9PA 5KFFA 1U47A 3DLRA 9ICAA 4DWIA 1YVUA 2BPFA 3WNGA 8ICTA 4FBUA 4J9PA 3TAQA 3DRPA 3HT3A 1NJZA 4N76A 3AA4A 1HPZA 1VSHA 5IIJA 2DPIA 5K14A 4F4KA 3ZT4A 4KB1A 4M3RA 4UBCA 3AVJA 3S9HA 4KLFA 2YNHA 5JUMA 3T5LA 5FRMA 3ZDDA 4ELTA 4CJEA 3JYTA 4FYDA 1K1QA 1REVA 4CIEA 1NOZA 4CK1A 3AO1A 4CK3A 3VQQA 3JPPA 4JV1A 3AA2A 5KFXA 5KG3A 5DGBA 1L3SA 4DQSA 4DSKA 3O3HA 2HVHA 1KFDA 7ICQA 1WAJA 4YXJA 2BQRA 4Z4IA 3OS1A 4M0AA 3A2FA 4NYFA 4CF9A 4DLGA 4F4YA 1BQMA 4M9GA 5IIKA 3EWAA 3KK2A 4FM0A 2P5OA 4RW6A 5J2MA 1KFTA 2LYHA 1IKYA 4P4OA 4O5EA 4IR1A 4KFBA 4I2FA 4GXJA 1S1UA 3HPOA 1RBSA 3PW4A 3OYNA 3TFSA 4Q5VA 3QEWA 4CHOA 4OJRA 3DMJA 4MFBA 1WSFA 4N56A 5J0YA 4DOBA 3SQ2A 4EBDA 1VRTA 3T1AA 3V9ZA 4C8KA 4CHQA 3QESA 3T5HA 1J53A 4ZTFA 5L1KA 2O4IA 3GV7B 1RXWA 1JLFA 4I2GA 1U04A 4AHCA 4DS4A 3HP9A 5KT3A 1U48A 4KV8A 2BANA 3ZDCA 1S0OA 5J2PA 2Z1JA 3AVHA 7ICLA 2KN7A 3UQ0A 1S0NA 3AO3A 4KHQA 3BDPA 4IR9A 1JLQA 4JWNA 4O3OA 3ULDA 2WOMA 1HQEA 4XA5A 5HNKA 2A1RA 3UQ2A 3MDCA 3RB0A 3PMLA 3QINA 2R8IA 1SL1A 3TI0A 2JEIA 3LK9A 1JMSA 3VQ9A 4FW1A 1ZBFA 1LAWA 4E7IA 4PUOA 4CHNA 3K4GA 3L2VA 4J9RA 3RB4A 2WONA 1MSWD 1ZQQA 2J6TA 4EYHB 3RWUA 5DBCA 4B9SA 1W9HA 1QLNA 4ECRA 4R65A 7ICEA 3NF9A 1VSLA 4DEZA 5KFUA 2BKEA 5KG5A 1TAUA 2UVRA 4RW4A 3MBYA 4LH5A 4FJ5A 3HO1A 2MUTB 4Z0UA 5KFLA 4FK2A 1VSFA 3RJKA 4CJUA 2ZJ8A 3OGUA 2FLNA 4DF8A 1ZJMA 1H38A 3DYAA 3OYLA 3RH6A 2ZJAA 4FJNA 5EWGA 4P4MA 3V1QA 4RQ0A 2JEGA 1B9FA 5BOLA 4RQ8A 5HROA 4RU9A 3HVTA 3M9NB 1SKSA 1ITGA 4Z4FA 1R0AA 4FLVA 2IC3A 4O5KA 4NLZA 4MF2A 5KFZA 2G8FA 4KO0A 3OHAA 5J0TA 5KFVA 4FJGA 5KFRA 3RBEA 2QXFA 4H4MA 4KREA 2DFEA 2ATQA 1DTTA 4DTOA 2Y1JA 3PO4A 3V9UA 4ECUA 1ZBIA 3PW7A 3SQ4A 2OPRA 4CEQA 1C1CA 4M47A 4BWMA 1S9EA 4HYKA 1WCNA 1SKRA 3C2KA 4LZDA 1S1XA 3TAPA 4FZYA 2XGPA 1JXLA 3IS9A 8ICCA 4QZ8A 1IH7A 4YR0A 1A5WA 2HNDA 4CESA 4KI6A 4DQRA 1BPYA 4OKEA 2FLLA 5KG2A 5IILA 3ZSWA 2YNIA 4CE9A 9ICBA 4ELUA 3PY8A 3RH4A 4FLZA 3RRGA 4W5TA 2YKNA 3VQDA 1ZBHA 2YKMA 2E4LA 2FC0A 9ICSA 4W5NA 5DQHA 4DSJA 1VSIA 3SV3A 3SQ1A 1BPZA 3OSNA 2ETJA 4F2SA 4E0DA 4IG0A 5I42A 1TKZA 1ZQCA 1RTDA 4DLEA 2YV0X 4DU3A 4QZFA 4ECQA 2P66A 4HVJA 2NUBA 3KD5E 1RT1A 1TL1A 1JLEA 1ZQFA 5KFEA 3PNCA 2BQUA 3RAXA 5J0SA 2AGQA 1X9SA 2Z1GA 3V6DA 4DO9A 2DFLA 5C25A 5FDLA 4IQUA 1G15A 5DKWA 4RW7A 1PZNA 4QZ9A 2J6UA 2FPMA 4PHDA 4CEOA 5KGXA 4KMUA 1ZQYA 1Z3EB 1UOCA 3O3FA 1KLNA 4Z6FA 4FZZA 3L2RA 3ZCMA 8ICHA 9ICRA 3CM6A 1KVBA 3VQPA 3V4IA 4FO6A 5KFSA 3SYZA 3K58A 1EETA 2R8HA 4NXZA 1NK7A 1A5VA 2UVWA 1HJPA 4NM1A 3LPTA 4ED0A 1RT5A 1ZQAA 3BQ0A 3KKRA 3QERA 2D5RA 5HP4A 4LSNA 4WE1A 3V7JA 3L2WA 5KFJA 4DFKA 4B8AB 1ZQMA 2E6MA 4FJ8A 2F1IA 3C2MA 1RZTA 7ICPA 2V4QA 2PFPA 3KHRA 1UWBA 4M9HA 2BCSA 1ZETA 3UXOA 2BHNA 2W9MA 1KTQA 2ISPA 3HWTA 4CCHA 2W42A 5J2EA 4CHPA 4CJLA 1CLQA 2B21A 2ASDA 4KLEA 1N5YA 3LP0A 2O4GA 4I9LA 4YXMA 4NCBA 4DTSA 5KGWA 4E7HA 5KG6A 3V7KA 2F8SA 2FPLA 1C0MA 5L9XA 2NRTA 3NGDA 3KKSA 4ECTA 5KFMA 2AU0A 5CA7A 4PH5A 8ICUA 2ZUBA 1ZQKA 5KI6A 2GBZA 3AA3A 7ICOA 2FBVA 5J0UA 3V81A 4F4WA 4DSEA 4CF2A 3NE6A 4RUCA 3C21A 4I2BA 1CXQA 4E1NA 3RJJA 3HM9A 4BE2A 8ICKA 3QO9A 2G8KA 3ZT1A 1ZQRA 4KLJA 5C24A 4N5SA 3ZSZA 2IBKA 3H7IA 1RDAA 4CEDA 4X5VA 1HYZA 2VWJA 2FBTA 4FS1A 3O4QA 4B9MA 4IKFA 3RBDA 4B9LA 3SUQA 4IG3A 2ZTDA 4UB2A 3BQ2A 3DRRA 4RNNA 4CJ4A 1RBTA 4DTPA 1ZQSA 3B0YA 4W5RA 4E89A 9ICVA 4CGIA 3OYEA 3G6VA 4NY8A 2BQ3A 3H8JA 5J2GA 4E1MA 4UAZA 2FMSA 4O0JA 3AA5X 2RDJA 3HX0A 4FLWA 2ALZA 2BCVA 4M9NA 4CEAA 1N6QA 7ICJA 2XHBA 1C6VA 2XCPA 3LPUA 1TAQA 5J0OA 1I39A 8ICGA 8ICMA 2G8UA 3H08A 2HNZA 4LY7A 4KHWA 4YVZA 4DF4A 2AGPA 4KPYA 5J2DA 3SUNA 5KG1A 2VA8A 5L1JA 2XY7A 1RNHA 2RPIA 3JPRA 2AGOA 8ICZA 4B3OA 5L1IA 4JS4A 1XI1A 3KLGA 1ZQHA 4UB1A 1XS9D 1ASWA 1S9FA 5HRRA 3EW9A 1UA0A 3U3YA 4FJ9A 4J9LA 2DFHA 2UVVA 1XO1A 3AVGA 4FJHA 9ICJA 4B9UA 4HCCA 3PR4A 2KQ2A 2IAJA 4RT2A 4UB3A 5FRNA 4QZAA 1ZBUA 9ICPA 4R66A 3L2QA 1U9LA 5KG7A 3CM5A 4F91B 4DL2A 3CYMA 3H4BA 3VN5A 5JS1A 3GQCA 3QEIA 5KRTA 3DOKA 2PI4A 5TZVA 4GLXA 4R63A 1TK5A 3AVKA 4NLGA 4FCYA 3CQ8A 4Q8EA 4DL5A 3VQAA 2HVIA 4YFUA 1XSLA 4Q45A 5J2IA 4I2EA 5KFIA 1VSJA 4O5BA 5DG7A 1RBRA 3GFKB 9ICOA 8ICLA 1BCOA 4M6WA 4FJLA 1NKEA 4RQ5A 5D49A 2YHAA 3DLKA 3OYKA 4K4HA 4CIGA 2ASJA 4AHVA 3ISNC 4CK2A 3PX6A 4DL4A 1Q9YA 1IKWA 4Y1DA 4JS5A 4KLSA 9ICHA 8ICXA 2C22A 1DLOA 1Z26A 1WSHA 2JLEA 3LAKA 3V9SA 4F5OA 5SWMA 1BL3A 3AU2A 5KT7A 1J54A 1JXBA 4YQWA 2XY6A 4DMNA 4LH4A 2VG5A 4YD1A 3VQBA 3C95A 3PR5B 3V6KA 3RB6A 4GC6A 3AUOA 4KLMA 2HB5A 3RMAA 1B22A 4F4ZA 3TAGA 3V9XA 1D9DA 3MEGA 4DL6A 1HNVA 3QEVA 1S6QA 2J6SA 4OGEA 4BE0A 9ICTA 4RQ1A 4RQ3A 4QZEA 3OYAA 2HMIA 5HHIA 2W9CB 4F3TA 4DG1A 4CF8A 1BVSA 2C2RA 1ASUA 4IQTA 8ICOA 1ZQWA 4RW8A 1JLBA 4CF0A 9ICCA 3NGIA 4CGFA 2OA8A 4RNMA 2Z1IA 4KAZA 4OLAA 4MFAA 3V1RA 3EY1A 4ZH4A 5F9NA 3S3MA 3TABA 2V9WA 4PA1A 1S1TA 1S1VA 2IMWP 4DTMA 4KTZA 5KFBA 2HW3A 3OYJA 1JLCA 4YD2A 1QSYA 4R5PA 3CFRA 3LAMA 1KSPA 2QKBA 3SPYA 2PY5A 4KLIA 4E7KA 5HP1A 5EU7A 2XY5A 3KD1E 2BE2A 3I0RA 5CR0A 4O5CA 1KLMA 3NH1A 3T3FA 1SL2A 4DSLA 5J29A 2G8IA 4R64A 4TUSA 4RT3A 2PFOA 1JL1A 2XO7A 3C6TA 1Z00A 3MR2A 1WSEA 1MC8A 4J2DA 3KTQA 4E7LA 2YHBA 3NFAA 1U45A 4HUEA 1J9AA 4I2CA 4RG8A 1JX4A 4DU1A 4UB4A 2BCUA 4KTQA 2Q0ZX 1EKEA 4OLBA 3MFHA 2IA6A 3B0XA 1W0HA 4KHSA 4FVMA 4QAGA 1VSEA 3ITHA 3AVCA 1DGSA 4RPYA 3T19A 4DTUA 2OPPA 1VSMA 4KN4A 3AVNA 1EXQA 4KLTA 4GC7A 4F8RA 4Q43A 1VRUA 3IRXA 7ICGA 3VQ7A 5HRSA 1JN3A 4ED1A 1T3NA 4EEYA 2RN2A 2AJQA 4KHNA 1UAXA 5HBMA 2ZD1A 1KCFA 3OYDA 3LP1A 2PZSA 2X6NA 5CB1A 5DMRA 4H8KA 4KLQA 3T5JA 3M9MB 2HHXA 1T8EA 8ICNA 1XC9A 5J0RA 3SUOA 4BE1A 1NKBA 4QZIA 1D9FA 5KT6A 4FJ7A 4Z4HA 1CZBA 3GV8B 3MABA 5KG0A 1XHXA 3AO4A 2W8LA 8ICAA 1GOAA 4AHSA 4CJSA 4PHEA 4PPXA 3LDSA 4LZGA 5DG9A 3MGIA 1BI4B 1NK8A 4JV0A 5J2JA 2IOCA 2VANA 3E01A 4M3XA 5J0WA 3MGHA 3LALA 4XIUA 4QWBA 3Q8MA 3M8PA 1QSSA 4RQ4A 3OJSA 1RCHA 4BXOB 2F96A 4F5NA 5KTQA 4JWMA 5KFOA 5DB9A 4YP3A 3MECA 3L3UA 4QWAA 3QIPA 4LSLA 2F8TA 2W8KA 3RH5A 2BDPA 2PI5A 3ISDA 4NLNA 3F9KA 1BIZA 4CJ3A 4CHYA 5KRSA 2PYJA 1HJRA 4CECA 2YNFA 5KFWA 2F1JA 3PMNA 1N56A 4CFDA 3QNOA 3AV9A 1ZQGA 1Y97A 9ICLA 1T7PA 1TGOA 3UXNA 4AHUA 3JPNA 3OYGA 3C1ZA 3M9OB 3ZT0A 4HUFA 3NH2A 4CJFA 4YN4A 3ZSOA 4KHUA 4XQ8A 2XGQA 1O1WA 1UT8A 3ZSVA 4L8RB 1Y88A 4FLYA 3GIIA 2JZBB 4BDPA 3DM2A 4ECSA 3P1GA 4N47A 3OYHA 3TAMA 5KFNA 9ICIA 5CZ2A 3WNEA 4HCBA 4EZ6A 4R8UA 2UVUA 2VG6A 1KFSA 1UA1A 3M8QA 2KFNA 5J2QA 2QKKA 4IBNA 1X2IA 4FS2A 3RJEA 1JLAA 5DLFA 1BQNA 2Z1HA 1ZQXA 1SUQA 5CWRA 3P5JA 3LDAA 4FM2A 1LW2A 1Q8IA 1XSNA 5IIMA 2ZUCA 4ELVA 4O3NA 8ICSA 7ICVA 4Z4EA 4F5QA 3OSPA 1NKCA 1NK4A 4GVMA 2PXIA 3NF8A 4W5QA 4TUQA 9ICNA 4DQQA 2R8KA 2NRXA 3DOLA 4I7FA 1VSKA 5CYMA 3SV4A 4C8MA 1ZQZA 1NJXA 1BCMA 3MR6A 5KFAA 3ZDAA 1RDDA 4RPZA 4O3PA 3V7LA 4ED6A 5J1EA 4BDZA 3PUFA 8ICYA 3ISBA 5CP2A 4TURA 2VA2A 4O3RA 3NGZA 2A1JA 1WCLA 4PGQA 5C5JA 1X1PA 4IDKA 5HMLA 4KN7A 4O4GA 3B6OA 4P4PA 4DL7A 3G0ZA 3AVLA 5HRNA 2BGGA 5D4BA 1SV5A 1C7YA 1QTMA 3OYFA 3NF7A 1BPXA 4E19A 3VQ5A 2GWSA 3PX4A 4CIFA 3PVXA 2YNGA 1ZQBA 3MXJA 4BGDA 4FJKA 1YT3A 1NK6A 3JPOA 1TKTA 4QWDA 5JS2A 4I2PA 8ICEA 3AO2A 3Q8RB 1YTAA 4YMNA 1RDBA 3HK2A 3OVNA 3GILA 3TR8A 1QQCA 5J2HA 4B8CA 1FKOA 1WSIA 4CEFA 3GIJA 4J2AA 1ZQTA 3C94A 3K5MA 4P2HA 4CJTA 4N41A 4M9JA 2IHNA 1NOMA 4CJRA 4RPXA 3AO5A 4IRKA 5KFCA 1KRPA 4JV2A 2X6SA 3TQ1A 3CFPA 2FMPA 3KK3A 1ZQPA 2HHUA 4KB0A 2D0AA 1U49A 2FBYA 4TQRA 3NCIA 3MR3A 4ED2A 1TKXA 1TVAA 3GIKA 2ITGA 4DS5A 7ICTA 3H8WA 4O44A 3RJIA 4GXKA 4M42A 2VA3A 4NLKA 2KZMA 1RILA 3K59A 2G8WA 3WNFA 3L8BA 4KLUA 4DFPA 1X9MA 3RJGA 4AH9A 4O55A 4ECZA 3KHLA 4YNQA 4OPKA 3BGRA 2XCAA 3UXPA 4QCLA 4M9LA 4J9MA 3G10A 4XRHA 4FK4A 7ICFA 2HHTA 4MFCA 3HJFA 3CFOA 4GW6A 1ZQNA 3QNNA 2P5GA 4CJPA 9ICMA 2ZTEA 4I2QA 9ICUA 3KLEA 3SPZA 3L2UA 1JIHA 3MXIA 3LP3A 3NHGA 4E7JA 3SUPA 2IS3A 4UB5A 4NCAA 4F3OA 5EOZA 4Z6CA 2C2EA 3QEBZ 2R8JA 2NRWA 1HYSA 4OPJA 5CYQA 8ICBA 1EP4A 4TSXA 1ZQIA 4MQ3A 1LWCA 3V1OA 4KRFA 2I9GA 3AVAA 3THVA 2MAXA 3QZ8A 5KFDA 1BPDA 2C2DA 2E6LA 3QIOA 2PFQA 4I28A 3RMBA 2BPGA 3TWHA 3UPQA 1HRHA 1HQUA 3NGYA 4CJVA 3S3NA 5IIIA 1XSPA 1ZBLA 3VA3A 4I2DA 4MEYA 3KLIA 4ED3A 4CERA 4CEBA 2P6UA 3KLFA 3ASMA 4CGJA 1LWFA 3MR5A 1RT3A 1X9WA 3O3GA 3NTUA 1VK0A 5IIOA 2IDOA 4M3WA 3PW2A 4NM2A 4OGCA 1MU2A 3V9WA 4E3SA 4TQSA 3MFIA 5BOMA 2IGIA 4F93B 4ECVA 4KLLA 4DTXA 4CFAA 4K8ZA 4B9TA 3OYCA 4MF8A 1S76D 5J2AA 2V4RA 2BGWA 4F5RA 3C1YA 3ZT3A 4F2RA 4J2BA 4IQVA 1RBUA 1B92A 1ASVA 3SJJA 4YMMA 3ISCA 2DFFA 3EPGA 4QZBA 4I2AA 4KKOA 3RRHA 3OS2A 3RTVA 4YR3A 3NAEA 4CEEA 2B4JA 1XWLA 4Z6DA 4DQPA 2MUTA 1BIUA 4LVSA 4YFKA 5L1LA 2ASLA 2XC9A 4CGGA 1IXRA 4I2IA 4O3QA 3VQ6A 1S10A 3FFIA 3NH0A 4AILC 4ICLA 1RDCA 3K5NA 2DTUA 7ICKA 9ICFA 2Y1IA 4IQWA 4BWJA 5J2CA 5DDMA 2BR0A 4CFCA 4QZGA 3LZJA 3K2PA 3ZDEA 4C8OA 4KITB 1Z00B 3H40A 4YR2A 3PV8A 3U3GA 3AU6A 3ZSYA 4Z4CA 3AVBA 4QWEA 4F4XA 3SCXA 3CG7A 3Q8QB 3S3OA 3VA0A 3JPSA 4KLDA 3HYFA 3BQTA 3I0SA 1ZQDA 3I8DA 1KEJA 2X74A 4NCGA 5KFKA 2OWOA 2ZJ5A 1L3VA 1EXNA 5C42A 2R8GA 5KFTA 1FKPA 3AVFA 1WN7A 3RB3A 3IG1A 5KT5A 4ED7A 3E2EA 4RW9A 4EP4A 4O3SA 4IFVA 3JSMA 3GV5B 4YMOA 5J0PA 1ZQEA 4EBCA 5KG4A 4J9KA 2HNYA 1VSDA 4DSFA 2KZ3A 4KLOA 4JRPA 3LWLA 1XU4A 3L3VA 2X78A 4K8XA 3GDXA 2I5JA 2W9BB 3VQEA 3BJYA 4PHAA 3HL8A 3HXMA 4KLGA 4RQ6A 4FW2A 1RT2A 3C5FA 2XRIA 3T5KA 5IINA 1TV9A 1RTIA 4PHPA 5HHHA 2OPSA 4NYNA 8ICIA 1A76A 4AHTA 4UBBA 7ICRA 3ZSRA 2ATLA 3LP2A 3OYIA 4MEXA 4DFJA 3D0PA 1JL2A 5EWEA 4HTUA 2EHGA 3O4NA 2RDIA 8ICVA 7ICHA 1RYSA 4EYIB 4RNOA 1T03A 9ICKA 4FJMA 1RTHA 4KTWA 1NK9A 4Q44A 2DPJA 1RTJA 3OS0A 4XUSA 1UT5A 2HHQA 1WNSA 1LB2B 2NRZA 4UAYA 8ICQA 5D46A 3SZ2A 3FYHA 5EWFA 4ECXA 5DK5A 4EZ9A 3AVMA 4CJ5A 4GMJB 1DOQA 4FLXA 3Q8PB 1FXXA 4BACA 4UQGA 4BXOA 1K6YA 8ICRA 3RMDA 1ZQUA 3F73A 1NK0A 1L3TA 1D5AA 2JGUA 3HW8A 1C1AA 3UIQA 4IFYA 4M3YA 5J2BA 2VG7A 3ZSQA 2AQ4A 3PO5A 4W5OA 4Z4GA 3NBPA 5KT2A 5FROA 3ZT2A 3H4DA 4KHYA 1WAFA 3TANA 3OJUA 2JEFA 3HSTB 1TK8A 3Q8KA 4M04A 1BHLA 2B5JA 5DB7A 3VQ4A 4I29A 3H8SA 3RAQA 3SI6A 3C2LA 4JUZA 4OKJA 3TAEA 3OY9A 4FK0A 3MDAA 5KFYA 5CJ7A 3FDSA 4ID1A 1ZJNA 4UAWA 4FXDA 2WTFA 3DRSA 4DOAA 4RUAA 4CGHA 3QZ7A 1B9DA 5J2NA 1S0MA 4JLHA 3V72A 3Q8LA 4ECYA 5HLFA 1Z25A 1WLJA 1K1SA 3RMCA 3DLBA 1U4BA 4HUGA 4F5PA 1RPLA 1SL0A 2EX3A 3JPTA 2FLPA 1XHZA 1NOYA 2OYQA 4IRCA 2P6RA 3QE9Y 4LD0A 1HUZA 1NK5A 4MFFA 3C6UA 4RZRA 4CEZA 1LW0A 3LWMA 4EBEA 3ALYA 1LV5A 4AHRA 1COOA 5DGAA 3EZ5A 4C8LA 1GOBA 2IHMA 1MQ3A 2W9BA 3EPIA 1BISA 2GUIA 1CZ9A 4PY5A 5DQGA 3KHGA 4FJJA 1ZQLA 3DI6A 4DTJA 2A1JB 1LWEA 4I9QA 1YTUA 4C8NA 1C0UA 4CFBA 4QW8A 8ICJA 1RBVA 5DBAA 3QEPA 4J9OA 1QS4A 5BPCA 4O0IA 4QW9A 3QLHA 3G6YA 3PW5A 4GXIA 2FPKA 3BQ1A 2Q3SA 1BI4A 1BGXT 3RJFA 4TUPA 4G1QA 3VQ8A 7ICMA 1SKWA 1NJWA 2C28A 3GIMA 1S0VA 3KJVA 2GV9A 1S77D 1QSLA 5DDYA 3RR8A 2W9AA 3ZSXA 2BPCA 1EX4A 4ZTJA 5HMMA 4B9VA 3KIOA 3G6XA 1LAVA 2NRVA 2P1JA 3N97B 4KI4A 1L3UA 3C23A 4K4GA 3DLEA 3SQ0A 4FM1A 4J9NA 4QZDA 4CGDA 3HP6A 3DLGA 4B08A 4DFMA 1JLGA 1KDHA 3TAFA 4ED8A 2VWKA 4QOZB 5DG8A 4CJWA 3IM1A 4R8UB 2KTQA 2B6AA 1ZQVA 4I27A 4O9MA 2M9NA 4ECWA 5CZ1A 4Q0BA 9ICXA 2JEJA 3P83D 2BCQA 4M3ZA 4G3IA 2PFNA 5I3UA 9ICEA 1BPEA 1L5UA 3QEAZ 5DB8A 4PGXA 1TVRA 3K57A 1IKXA 1IO2A 3OHBA 2F1HA 4DU4A 4Z6EA 2H5XA 3B6PA 1IG9A 4JRQA 3K75D 3OYMA 4M6WB 4J9QA 4DSIA 1WSGA 9ICWA 4J9SA 2BCRA 1MQ2A 5DLGA 1KVAA 2G8VA 2HHSA 3ORYA 4YG2A 1SZPA 1QE1A 3K5OA 1A5XA 1D8LA 1C1BA 4QZHA 1S5JA 4DTRA 5DQIA 1I3AA 5KFPA 1BPBA 1TKDA 2R7YA 3N4MB 3HPGA 4FJIA 5DB6A 1FK9A 3EYZA 5CY4A 3HPHA 4QWCA 4BDYA 4FJXA 7ICIA 3PW0A 4IRDA 1J5OA 2KFZA 5D3GA 3QEXA 4DOCA 4QZCA 2RF2A 1NJYA 4CHZA 2ZUDA 4M45A 3VQCA 3RR7A 3RJHA 1S97A 2LSNA 4B9NA 1CEZA 4F50A 4RQ7A 1ZQOA 1TL3A 1T4GA 1N48A 1RXVA 2FMQA 4RQ2A 2A1SA 5CHGA 1TV6A 4HHTA 1F21A 4YCXA 9ICGA 4F92B 4KLHA 2P51A 4FBTA 4FLUA 4Q8FA 3TARA 4JK1A 3KHHA 2FBXA 5KFQA 1TK0A 4M41A 4PQUA 7ICNA 4M3TA 2ZQBA 2W9CA 4CF1A 3PX0A 5DBBA 2OZSA 9ICQA 1DTQA 3ZD9A 1HUOA 5HRPA 2QK9A 3SI8A 3M8RA 5KFHA 1CXUA 4Y1CA 1B43A 8ICPA 4K4IA 1S9GA 4CJQA 2ZTCA 5J0QA 4DL3A 2HHVA 3C5GA 5SZTA 2KW4A 1JXEA 1JKHA 5F9LA 3IHQB 2HHWA 1Q9XA 4DTNA 2XY8A 3D45A 4ID5A 7ICSA
chains in the Genus database with same CATH superfamily
4ANCA 4PL8A 1QY7A 2W6LA 2E5JA 1EWQA 3ZDBA 3IM8A 1RKIA 1Q8LA 2CNNB 4N8NA 2GEMA 1A77A 4FYXB 4BR4A 4B3SK 3E0FA 2XNRA 2DY4A 4WP3A 3K5LA 4MIAA 5AM2A 4DQIA 2D0BA 4JI6K 2QV6A 1HMVA 3R2CJ 3NRZA 2KZZA 4LC9B 2B7CB 3QFWA 1RYRA 3TSQA 5EE3A 2ZBIA 3HLUA 2AQ0A 3MEDA 2F63A 4WXOA 2JR5A 1UQVA 3GMGA 4A47A 1ZYQA 4BRPA 1HWKA 3DLEB 1QHTA 2JH7A 3H20A 1SUQB 1BNOA 5C2CA 2OGUA 2DKOB 2OZMA 2FVRA 5BPMA 3PXGa 4JI1F 2OLWA 5KT4A 3MXMA 2B0CA 1VDVA 8ICWA 2EAPA 3DHXA 3AY9A 3HZEA 2DH7A 3MMJA 1RHKB 4I2HA 5J2KA 3BN4A 1BA1A 4C9DA 3BGFA 1T05A 3MWTA 1GLDG 4QBUA 2VONA 3T9NA 3J7ZT 3WNHA 4PWDA 5AK6A 1F3VA 3WHIA 3AOAA 4LRFA 5AQHA 5AQNA 2Y0BB 3C46A 3Q8SB 4M63C 1QVFM 2W4DA 2VOPA 2UXCF 1YWXA 3MWPA 1T11A 3D9BA 3TADC 4WZQA 2X1GA 4USVA 2UP1A 1Z05A 3MMCA 2E2PA 5K8PA 4FZLA 5J2FA 1SJ3P 1T94A 5E41A 4KFBB 5KFFA 5ELZA 2UXBK 1DZ5A 1MNEA 1YVUA 3WNGA 5BYSA 1IBLK 3IGVA 3DRPA 3HT3A 3DOLB 5BRDA 1VSHA 4QJFB 5LOQA 3FSXA 2E1EA 4LFCF 3AVJA 1Z1VA 3S9HA 5EGYA 5JUMA 3CD5A 2GO9A 4ELTA 4CJEA 1KN6A 3NAIA 1H73A 2IVFB 3GZ7A 1NDKA 2HQFA 1NPPA 5ALYA 3VQQA 1DY3A 5JVGL 3H90A 2KHCA 5KG3A 4DR3J 2FVCA 4DSKA 5ETKA 4TLQA 2HVHA 2G5IB 1YG0A 3CNHA 5TISU 3GLJA 1VC6A 4Z4IA 3OS1A 2BA9A 3A2FA 4URQU 4NYFA 4OZNA 2MZSA 1KQGB 4ZOSA 2J9CA 5EDWA 2CVEA 2MKYA 4FM0A 3QU5A 3DRPB 2MU2A 5J2MA 5AI5A 4A8MP 4LREA 5AICA 2XI3A 1Z2ZA 1AUDA 2C2OB 4KFBA 4GXJA 3A8YA 2JSXA 1HPMA 3TFSA 1ZA2B 4AFFA 2V8DA 3EXCX 4KV8B 1RCOB 1VJQA 1VRTA 3KVGA 3T1AA 3ENWA 4IDHA 1FEHA 3UCZP 1J53A 1FJGK 3NS6A 2VH7A 4H0OA 4RR5A 5GAEI 2UU9J 1KN5A 1JLFA 3O80A 4HVZA 2FSKA 1U48A 2P2CB 4AE5A 2Z0GA 1Q7YO 1MLAA 5J2PA 7ICLA 4WE1B 4WWSA 2KVCA 4I0WA 1S0NA 5B8HA 2WVEA 2UXDK 2D41A 2BZFA 1HQEA 3LDNA 4XA5A 1RLDA 1U02A 5A6PA 2VKQA 5G0RB 4ZPTR 3E01B 4F3MA 4C3LA 5L46A 2K8BB 3KK2B 2FF6A 3O9SA 5I9EB 3JAMO 2AW0A 1UP1A 4M5GA 2ITMA 1WOQA 2E1PA 1JMSA 1WBDA 1HBUB 2RQ5A 4J7CA 3NGUA 3W5ZA 1J6ZA 3H3OB 2MJNA 5DETA 3H2UB 4OJGA 2GO7A 3M8YA 4JD2A 2HAFA 1G4CA 1NHVA 4Y6IA 5AQTA 1WNEA 4EMDA 1QLNA 2IVYA 2W2MP 3RAMA 1Q81T 1U1NA 1UWAA 3UKUB 3NF9A 3BEXA 3W1YC 1QVGM 2W25A 4DEZA 4OI6A 5KG5A 4FYWB 1N8RT 3T7ZA 2UVRA 5JRTA 4RW4A 3MBYA 2MKIA 2IM3A 2VCPA 5HR6A 3O1BA 4X66F 4FK2A 2VGNA 2VFRA 4ATNA 2VIXA 4M95A 1XBWA 4DUZJ 4A8EA 1KWMA 2KL8A 1B9FA 2C3OA 2NXEA 5HROA 3HVTA 4HTLA 4DV0F 4U67Q 4GKJJ 2LKZA 1SKSA 1Y7PA 4Z4FA 5ETQA 3M2VA 4FLVA 1B64A 4O5KA 5CE3A 2I2YA 1EJ7L 2Q6BA 4NXNJ 3WBZA 4WBFA 4KO0A 3OHAA 4M1KA 2V52B 2NUHA 2QXFA 3LDPA 2UUAJ 1J2NA 3F2CA 2ATQA 2Y1JA 1BWEA 2BJ9A 2KJ5A 4X66J 3DN9A 4JI4F 3UDVA 3D54A 1VBKA 3FMWA 3MPDA 2NRRA 1C1CA 1S9EA 2KVIA 3AT1B 2JMGA 4HYKA 4DV4J 3GONA 2EZZA 1WCNA 4FF4A 4FZYA 2XGPA 1RKJA 1JXLA 3ZFVA 2VGMA 8ICCA 4OL8A 2QW9A 2VBYA 4NCGB 2R2SA 1MN7A 4CESA 1RGVA 1BPYA 5L9NA 4OKEA 3HCXA 3L4PA 2Y1RI 4LIWA 3PY8A 1R27B 2ZM6F 2RHFA 3WKAA 4IYQA 3VQDA 1WSVA 3OW2R 1VGYA 1K73T 5H9EJ 4MMOA 3G8SA 2FC0A 4MK9A 3CCRN 4M5KA 4FWNA 3TA0A 3TVKA 1DTTB 1IR1A 3SV3A 4H0VB 4UF4A 3SQ1A 5CQGA 2W7AA 2R7UA 5I42A 2ASOA 2Q97A 1TKZA 5AQXA 3BKFA 2VPWB 1RTDA 4DU3A 4TU9A 1SB6A 4ECQA 5CR4A 1PJ7A 4JKCA 4HVJA 1HBNB 2MQOA 3KD5E 2NXNA 2ROPA 3THWA 1H2TZ 5LMUF 1W2BR 2Z1GA 2ZJPL 2DFLA 1NH8A 2IM0A 4N77A 3DYAB 4U8VA 1FO1A 4GVBA 4YB1P 3FM9A 3CO9A 3KMSA 1G15A 5M1OA 1TKXB 5GAHI 3BSAA 5ADXA 4I7FB 2FPMA 2KICA 3HHDA 4FNIA 3WXJA 3O3FA 4AXJA 3L9ZA 2O5DA 1KLMB 3WIVA 3CM6A 5AKEA 2DF4B 1SIJA 3C19A 4FVUA 1DGKN 2R8HA 1X4CA 1NK7A 1HHSA 1HJPA 4NM1A 2QO3A 4P73A 5DO2A 5LMUJ 2WAQC 2D4WA 1GLLO 3K5PA 3B9JA 4LSNA 3V7JA 1RP5A 2OPRB 4AM7A 3R1XA 1O0PA 4HHJA 5EX5A 4B3OB 4YEAA 1Q3UA 3LM9A 2F40A 2EK6A 4F36A 3T1YK 1Q8KA 3FCHA 4IWVA 4KGVB 1Q82T 2BHNA 2W9MA 2H9ZA 2ISPA 2AYGA 3MN6A 3HWTA 3WK6A 2C2KB 3KUHA 3D2FA 3ZNUA 2KH9A 2WB1F 2JJ4D 1VMBA 3R7NB 4KLEA 1YJWN 2NPIA 3LP0A 2O4GA 4I9LA 4EFHA 2V67A 2RDDA 1HNWK 4DCHA 5M1KA 1RWVB 2FPLA 5AJ3J 3F9MA 3HT0A 1RM6C 2I7NA 1BD6A 3KKSA 1CC7A 5KL1B 3I55N 1X8DA 3FZHA 5KFMA 1FESA 3QT7A 4LR7A 4DR5K 4FKYA 2IDLA 3OBWA 2W1BA 4UY8T 3WC2A 5HQMA 2PEHA 3ZZ0A 2VDIA 3V81A 1HI0P 1QQ7A 4UW9A 4BC9A 2C2NA 3BF4A 1JLGB 4E1NA 1OO0B 1QDUB 1YJNS 4DQ8A 3HM9A 5ALZA 3UR0A 1OW5A 4JKGA 4TYBA 2P9SA 3QO9A 3DFEA 4EENA 3G25A 4ETZA 3FR0A 2A40A 3ZSZA 4B1XB 2ASYA 5L39A 3ZEUA 1DURA 5BREA 1IWAA 4X5VA 5AJ3F 2QC3A 4FS1A 4LF4J 3B4MA 3RBDA 1N52B 2OTLS 2MHEA 2DO4A 2JH1A 4UB2A 3MPVA 1IQZA 2MKHA 4L73A 2P5VA 4Y2XA 3JTOA 4DTPA 4AXIA 3FCWA 2YY6A 1YBAA 3OYEA 3F0NA 4E1MA 2FMSA 2E5LJ 4BRGA 1VC0A 2RDJA 3O1WA 3CMAS 3MCPA 1EIYB 5AQKA 2XHBA 3DWLA 1C6VA 4F4AA 4DDFA 4NV0A 2G07A 1NNLA 1BWFO 1UAWA 5J0OA 3HHEA 8ICMA 1KXPA 3OTOK 3TNVA 4YVZA 3D5MA 4C0HA 5J2DA 4C6AA 5AQUA 1RNHA 2RPIA 2M0NA 3WXIA 4JS4A 1LEOA 1PYSB 4FPAA 2J5AA 1N5YB 3KLGA 2JWLA 4OYWA 4GO5X 3K17A 1VQNN 2CGKA 5HRRA 4DFDA 1XR5A 4WZMA 1FFVA 4J9LA 1JCFA 2WBRA 2DO0A 1CULA 1HNXK 1JLCB 4RT2A 5FRNA 4ICAA 3D1QA 1ZBUA 3TR5A 1KOHA 1P9QC 1N8RO 4JV5K 4WKRA 4CLTA 3H4BA 3KLIB 4BVPA 2UXCJ 5TZVA 4GLXA 4CRJA 1TK5A 4RL1A 4D3HA 2ZJQQ 4DL5A 2PMZD 1SXLA 2Y8WA 2V51B 2PN6A 2J0WA 4ZPCA 4YDXA 2P9SB 1C0TB 2L5YA 4IOXA 2X1FA 4YHHK 3J7ZO 3G8TA 1EETB 5DG7A 1HI8A 2P9LA 5HQ8A 1RBRA 3WK8A 1X3NA 5E3PA 1BCOA 2XQCA 3AMZA 1R59O 4EGLA 5D49A 4LFCJ 5F41A 3OYKA 3H0PA 5F8IA 2KG0A 5ALVA 1QUVA 4K41A 4W92B 1VQMS 2YHYA 3KJNB 4OI2A 4Y1DA 4JS5A 1UJ5A 9ICHA 2C22A 1NGDA 2K3KA 1Z26A 2NNWA 1X5PA 4F5OA 2ZD1B 3D2SA 4KX5A 2QLTA 1IJJA 3KNAA 2VG5A 2A6MA 1N32J 1L8LA 1VYAA 3PR5B 1R8PA 3RB6A 3AUOA 4KLMA 4R25A 5KQ8A 1B22A 1TV6B 1WF2A 1D9DA 3AA9A 2OP5A 4UOCA 4DL6A 1HNVA 1LXJA 3UN5A 5I3PA 4B3SJ 4ZLLA 2HK2A 2CQGA 4BX9C 1GMUA 3FC4A 2GIRA 2W9CB 3AQEA 4ZN1A 3J7YU 4CF8A 1RADB 5HQLA 4P9SA 2C2RA 2AV5A 4FF2A 1S1XB 1ZQWA 4RWTA 4CGFA 1SB3C 2OA8A 4RNMA 5ALQA 2CDRB 2Z1IA 2DGSA 4K4ZA 4OLAA 3V1RA 3EY1A 4ZH4A 2CJBA 4P52A 3TQEA 4KHPK 3CDEA 2BE2B 3JXOA 4KGXB 2MQMA 2IMWP 4OYOA 4DTMA 4KTZA 5KFBA 5MLCV 3QRRA 3OYJA 4RQMA 2M3DA 4R5PA 1KSPA 4HT5A 2ABYA 2NREA 2EEYA 4Y2CA 5EU7A 2U1AA 3CCRS 1HYSB 2F3NA 3T6BA 4O5CA 1KLMA 2F7TA 3NH1A 3R2DJ 1SL2A 4DSLA 2QT7A 1VHIA 4DOZA 4TUSA 4RT3A 2PFOA 1JL1A 2ZBRA 5AQIA 3C6TA 4P75A 2JXJA 5ALFA 2VG5B 2R3VA 1WSEA 3JQJA 5B0EA 4YDUA 4A5AA 4CE6A 1T9YA 2XWYA 2E5GA 4PL2A 3CNQP 4DX5A 5DDPC 3O0FA 2Q0ZX 3HZGA 4F26A 2LLZA 1W0HA 2WCXA 4PL1A 1N2XA 1DGSA 3A8KA 3AVCA 2V5HG 1GQEA 3DMJB 1N36K 5H1SQ 4KN4A 3AVNA 2P6SA 4ZA1A 3SAFA 4GC7A 4CD1A 4Q43A 3VQ7A 1QAJA 3M32B 4EEYA 3W61A 2FD2A 4KHNA 1S6OA 3B54A 4OV1A 4P71A 5AQMA 3MPYA 4DPTA 3J81U 3UW1A 2D6FC 3NRWA 2BM1A 1N36F 1D9FA 5KT6A 2IBOA 3DLKB 3L5KA 3MABA 5KG0A 3VHQA 3AO4A 2W8LA 5GMKa 3HRGA 3LDSA 1VQ6N 4DR5J 1K0VA 1NK8A 2PAVA 4JV0A 4M3XA 3LALA 2DK2A 4C4WA 4P7VA 1NM1A 3WEEA 2AEFA 3M8PA 3BYPA 2BW2A 4CO0A 3G71S 3ZZPA 1OY8A 2OH2A 3TVYA 3C16A 4NLCA 4QWAA 3M30A 1M5SA 2F8TA 3C7NB 3E9OA 3RH5A 5D8HB 2BDPA 8RUCA 3CJ2A 3KJFB 3ISDA 4NXNF 1E6YA 4M5IA 3F9KA 3PFEA 1KAYA 4OX8A 2PYJA 1RA6A 3R6LB 1NSKL 3FZKA 2WSFC 3W9IA 2QSWA 4MO5A 4F0KA 1G2EA 2HMXA 1ZQGA 5L38A 1B4SA 1GLEG 4FL9A 3QRQA 1WD6A 3BEGB 3ZT0A 1UFWA 3ZSOA 5I3UB 1C2PA 4LF5J 3H98A 4X4UA 5D4NA 3KLEB 4XQ8A 2XGQA 3M05A 3TUJC 2LHTA 1WG1A 5LJ5Y 3VVUA 2IRYA 3H59A 4KE5A 1X5OA 2HWIA 4L8RB 4E8UA 5D0EA 4D3GA 1YJNN 3GIIA 4BDPA 1IG6A 2H48B 2MXYA 2E9RX 2YWHA 4NWBA 4QIFA 4B6JA 5KFNA 4EZ6A 4R8UA 1RWWB 4JI5J 1X3MA 1UA1A 4G6VB 4XO0A 3C66A 3EKSA 2KFNA 1X2IA 3RJEA 1JLAA 1U1QA 3WKCA 2E5IA 2CJQA 3PM9A 3M2RB 1ZQXA 4B3RF 2GX8A 5CWRA 1KC8O 3LDAA 3BO2A 1HX1A 4MIWA 1LW2A 1Q8IA 3G82A 2QRRA 4JD2B 3ONNA 5HVHA 4O3NA 2BH1A 2LDIA 2KOBA 1WEZA 4Z4EA 2NSCA 4ZVRB 4USHA 4ILRA 1NKCA 4NO7A 1Y64A 4C4TA 1BE4A 4GVMA 3VOVA 2ROGA 2V0NA 1URNA 3NF8A 4W5QA 4TUQA 2I38A 3Q22A 4R0JA 2JHEA 3W62A 4GMKA 5CYMA 5JVGQ 1HNIB 5DZ7A 2EW9A 3TZWA 1RDDA 1S5LU 3H5UA 5ALKA 1RZMA 3U1NA 4TURA 1VCTA 1W7WA 4CM2A 2V6AA 3PIPL 4IDKA 4O4GA 4CQ1A 4NWIA 3TKAA 1A0OB 4DX8H 1JLFB 2QWLA 2BGGA 4FF1A 1DGJA 1EZZB 4H4OB 4X4TA 2IIHA 2RD5C 3OTOJ 2DNZA 3T69A 3VQ5A 4CIFA 1Z4NA 3DV9A 4ZCMA 4JP8A 4ZPDA 1S57A 4UT4A 4HH0A 4FJKA 1NK6A 1Z4UA 2NQPA 4ZMMA 4CO3A 4QWDA 4C11A 1MU2B 3CCSS 4I2PA 2IY5B 2YMPA 1F5AA 1HBOA 1S7HA 5F3XB 2HNDB 5DZ6A 3H42A 3AO2A 3N28A 3UE5A 3EM1A 2VDHA 5J2MB 3OVNA 4BGBA 3GILA 2NS1B 3J7YI 3WKEA 1WSIA 3I5BA 3GDQA 5ETVA 5AFUA 4LSLB 2P9KA 4BC3A 1K73O 4P2HA 4CJRA 1G1XA 2OTLN 2D3OR 3EDRB 1HR0J 4WQ5A 5BN9A 1PBUA 2HMPA 5IQQA 1HQUB 4CLYA 3CFPA 2FMPA 1IWGA 2EANA 1Y00A 1BO5O 5EE9A 3UVJB 4Y2QA 4TQRA 2DGXA 3EGWB 4ED2A 1WHXA 1TKXA 3W8PA 2ITGA 4C7YA 3A1YG 4DS5A 3H8WA 4O44A 1NGJA 2JZ5A 1UVNA 2Q31A 2VA3A 2KZMA 4MO4A 2K60A 4KBIA 5CYQB 3QGIA 1KVIA 4KLUA 5HVFA 1X9MA 1HNVB 3KMQA 3EDQB 2KKPA 3MM6B 1SPBP 2XCAA 3IWXA 3UDLA 7ICFA 4DCJB 2CPIA 4HKQA 5HL7L 3QNNA 1ZQNA 4WTYA 4PZOA 4KKOB 4I2QA 9ICUA 2K1RA 4EHUA 3EE9A 5GAEU 2JX2A 2JFKA 3IWNC 3LP3A 4E7JA 3SUPA 4KH0B 3JAMY 3THYA 4MDBA 3HHLD 2XYGB 3UDEA 3QUQA 3MD3A 2PBDA 8ICBA 4H4KC 3IG8A 3VENA 5GADU 1P1TA 1ZQIA 3M6ZA 2I9GA 5KFDA 1BPDA 5ALPA 1Y5IB 4IH5A 4PWDB 1B0TA 2QMUB 2E6LA 4I28A 3VGUA 3CIPA 2BPGA 4QS9A 3TWHA 4DV5F 1JJ2M 1VQ5S 4CJVA 3D6FB 2QLFB 5AQPA 1C1CB 4H5WA 3S3NA 5IIIA 4IFVB 5B0DA 4MEYA 1MW7A 3KLIA 5D4OA 5HO4A 4CERA 3HOSA 3QUBA 5C12A 5C2DA 2OHDA 4CGJA 3BZKA 2KKHA 3MR5A 4GNIA 1X9WA 1VK0A 5IIOA 2IDOA 4M3WA 3A8JA 3FGUA 1UFLA 1VC5A 1E6VA 2V50A 3VGTA 2VC0A 5FPEA 3A0HU 4TQSA 3PHEA 5BOMA 3GFZA 4F93B 4ECVA 4KLLA 2HGLA 1U24A 2XMUA 3WKBA 2J8SA 3CCUS 3O6WA 1UVIA 2OD4A 1S76D 4LF6J 2R7SA 4F5RA 4WJBA 1LOUA 2Q36A 2DPNA 5F8HA 1N60A 4TY8A 4J2BA 2EBEA 4A8FA 1IV8A 4X62J 1C1BB 3ISCA 4N8OA 4E2FB 2ADCA 3OL7A 3S8SA 4CEEA 1ILYA 3OTCA 1BIUA 1LOTB 5L1LA 1S6QB 1KBRA 1TFYA 4MH8A 2XC9A 3LVVA 4CGGA 1XR6A 4I2IA 3PJ9A 3VQ6A 4DV0K 2JLGA 3NH0A 4NLXA 3MM7B 4AILC 1RDCA 2FJVA 2CQPA 1S4FA 4BWJA 4IQWA 4IC9A 3BH6B 5L8RC 3K2PA 4OJ3A 1EO1A 3NCQA 4KITB 3WK5A 1Z00B 3IR7B 3PDNA 2LYAA 3AU6A 2NXCA 3ZSYA 2PA8D 3ED5A 4FXWA 4CTAB 2DEJA 5HJXA 3SCXA 3CG7A 3FE1A 3VA0A 3MN5A 3I8DA 2W3RA 1LK7A 3NMRA 2D69A 3ZEUB 3DDIA 1EXNA 5KFTA 2KM8C 2WK4A 3MDFA 3AVFA 3LVWA 1J97A 3BH7B 1RJJA 3FBCA 3E2EA 2RE2A 1YJUA 2CPHA 5AXMA 4IFVA 4LFBJ 2Z8QA 2HDOA 5J0PA 1RDUA 4EBCA 5KG4A 3P8BB 4J9KA 2Z4PA 2DBYA 3CDBA 3NWGA 4JRPA 1CJTB 5ETMA 3L3VA 1WTFA 3L09A 2IJFA 2W9BB 3LDLA 3MWBA 3SMSA 1QQOA 5AE1A 4RQ6A 2BW7A 3FFKB 3N4PA 2DIUA 2F8MA 3C5FA 1QAYA 4PHPA 1VIXA 2VJVA 2OPSA 4JKAA 4M5MA 3VAGA 1IJFB 1A76A 3O5BA 3LP2A 2BKOA 4OHWA 1JL2A 3PIOQ 1RT7B 3Q2TC 5AE2A 4HTUA 3I6PA 1GLFO 2FHMA 5BR8K 3O4NA 4M5HA 5J1EB 8ICVA 4ES3A 4W98A 2YNFB 5GADP 7ICHA 4EYIB 2K7KA 3OR1B 1ZPWX 1ROFA 4JI3F 4KTWA 1NK9A 4Q44A 2FLOA 5AI9A 4XUSA 1RHQB 2R7OA 4RBVA 4FZMA 1KR4A 1YLXA 2NRZA 3K0JA 1L7OA 2CQ2A 2W7PA 4HHUA 1SZHA 4AT1B 2O8EA 1HI1A 3AVMA 4CJ5A 2DCUB 3Q8PB 3JSMB 4CW7B 2F44A 1YZ7A 3TTCA 4NEZA 3POTA 3ETOA 3F73A 1NK0A 2MMYA 4WYBA 4ZN3A 3SFUA 3N4QA 2KB2A 4IFYA 4Z7YA 4RW6B 5HMYA 1YF5L 2VG7A 2AQ4A 2PIIA 2XNQA 3ZT2A 3H4DA 3QWPA 4KHYA 4DHVA 2NZ4A 2MDAA 3NNAA 4F67A 2O8EB 3Q8KA 4EX7A 5ADXH 4NZ7A 2B5JA 3TAMB 4ZIWA 2VFTA 3H8SA 3TAEA 1PK1A 3OY9A 1EAYC 2DGUA 3FDSA 2BVZA 4DV3J 1ZJNA 3SDEB 4UAWA 3NVKA 3DRSA 3LP1B 3AAPA 2LP4A 3IRWP 5BPNA 4IO9L 4C7QA 3J7Z5 2Z7JA 1TFWA 3C0BA 3IC1A 2MEWA 1Z25A 1WLJA 3C29A 1U4BA 3QGHA 4F5PA 2DL0A 2WRMA 3RRKA 3BS5A 1N36J 5MLCQ 1FFWB 3IUCA 1BUXA 1X4FA 3H6EA 1S12A 4WPAA 1HD1A 4LD0A 1HUZA 3L0QA 1S8OA 3QATA 1M1HA 4CEZA 1LW0A 1LV5A 1RBLA 3OTQA 5E79U 4MKYA 3WK7A 1GOBA 2W9BA 2E5HA 5ETLA 5IT9O 3QSYB 3RU0A 3RW6A 2B9EA 2W4PA 3AODA 1F2HA 3KHGA 4OJ6A 4OZLA 4ZVEA 4JB3A 4PG7A 1ZQLA 4DTJA 2LQ5A 3QNMA 4B02A 1YBUA 4C8NA 4OYAA 3SQGB 4LF8J 1C0UA 4CFBA 4QW8A 2W55A 1Q1KA 8ICJA 3THPA 3HVWA 3H5XA 3QU9A 1H6KX 1WC1A 3ISZA 1GMWD 4QW9A 2C42A 1PG5B 2HSZA 4H5VA 3BQ1A 3HHKA 4M5NA 1N33K 3HILA 3THXB 3GIMA 3JQMA 3MEDB 2MKKA 1S0VA 4U8YA 4IL6U 1NLVA 3M2UA 1FA0A 2H4WB 1S77D 2GV9A 5DDYA 1IQTA 2BKNA 1RBAA 2FHJD 5D0RA 1FDBA 3ZSXA 3CJ3A 1GO3F 1M0SA 1EX4A 4BREA 4B9VA 3FUYA 1XMOJ 1LW2B 1QAIA 4J03A 3Q0AA 2IYGA 2E29A 5C25B 4WU3A 3C23A 4KO0B 4J9NA 3V6DB 5CCMA 4A48A 2QN6B 4Y34A 3P45B 4ED8A 3FSIA 3M2VB 1K44A 3D7EO 1BU6O 2Y3YA 4R8UB 3AB4B 1X6IA 2KTQA 2DHHA 4OZ5A 2ALYB 4O9MA 3N5BA 2O6KA 3QYYA 2M9NA 1ZC6A 4ECWA 2DHAA 5CZ1A 3EWGA 4GFJA 4JI8K 4IG0B 4Q0BA 9ICXA 3P83D 2BCQA 2N4CA 3ZZZA 2ZNYA 4M3ZA 4MTPA 4MDAA 3QFPA 2P9IA 4U7UK 9ICEA 5I3UA 3NS1A 2YQ3A 1GX6A 3QEAZ 5KPTA 3IRXB 3K57A 4X65J 3CGIA 3FEZA 1IKXA 3W60A 3QNWB 3NEKA 4NASA 2C3PA 2PE8A 4LF2A 2QARB 1X7VA 5AI6A 1N54B 4Z6EA 2H5XA 3B6PA 4CI6A 3OYMA 3MMVA 3D2QA 2R7WA 2GJIA 2BCRA 2B9YA 3K9KA 4JHDB 2G8VA 1N33J 1O5JA 2G1HA 3ORYA 4QIWF 1A5XA 1D8LA 1C1BA 5LSOA 1G7CB 5IS2A 2CIMA 2UUTA 1TMMA 1I3AA 3MN9A 5KFPA 2Z2ZA 2X3DA 1JMTA 2ZE2B 2WF8A 2P9PA 4FJIA 3CIZA 4LF9K 3Q2SC 3CPEA 4OFZA 3EYZA 5IXUA 2RILA 1UVMA 2YY3A 1MWKA 4QZCA 3WQTA 2RF2A 2H65B 1FRJA 1HJOA 4AQYF 3MHYA 2ZUDA 3WX4A 4M45A 3FMBA 1F9FA 2LSNA 1S1WB 3KLVA 1TUYA 3A8IA 4F50A 2B9XA 4X4NA 4HHTA 2CKWA 4YCXA 2MSSA 9ICGA 1F21A 3G9CA 1FJCA 2GOLA 2AP1A 4LF7K 4JKFA 1R8CA 1KAXA 3M6XA 3MMBA 4Q8FA 1ZPVA 2XMKA 3TARA 2QJ3A 3QFUA 2Q79A 1TK0A 1HFEL 4M41A 5E7OB 2OZSA 3HZ6A 4EFAC 5HRPA 1NGHA 3M8RA 5KFHA 2GELA 1B43A 2M8DB 2I9SA 2VQFK 8ICPA 4K4IA 3KG1A 3O3LA 2ZTCA 3HD1A 1N88A 3CJ9A 1VQPS 3EL2A 4C0BA 3HF5A 2R4FA 4ID5A 7ICSA 3PYDA 4PCQA 3TFRA 2Q43A 1HA1A 1MMDA 4B3MK 4I2QB 3CCMS 2G8HA 4ZLNA 4FLTA 3GWCA 1VBZA 1TTHB 3MPUB 2V4JA 4M5DA 4DV1F 1F9HA 1MROB 3K9JA 2GGPB 4PKIA 3I5AA 2XG8A 3MEEA 3DXMB 4OHYA 4IOAL 2H5EA 3NP5A 3DLHA 4P2MA 4LF8K 1T3VA 1IM4A 2ZM6K 3EGNA 2DH8A 1KTVA 4FZXC 3AJ1A 4GRSA 4DV1K 5EE0A 1D8YA 5BR8J 1X66A 3IDWA 4OVLA 2ACMA 2AXTU 4USTA 2XSFA 5AQWA 1TQLA 3KK1A 3OUYB 2GHWA 2JOQA 2CPFA 4WP9A 2LQ8A 1YZ6A 2I1QA 3OL8A 4DR2F 4KIAA 4ZHRA 2HCFA 4BQLA 3TUIC 3DM2B 1QZ6A 4H4OA 5A0YA 3BKTA 1DK2A 2F9JA 4NA2A 2PKEA 4DX7A 3SNNA 4LBIA 4EP5A 1LWCB 4JK7A 2KP7A 4WK3A 3LZIA 3J7A1 3M8SA 1WF0A 1RT7A 2Y9UA 3QUTA 1B99A 4K7QA 4PXBA 4FWPA 4CD3A 8ICFA 4P2SA 2BBEA 3OYBA 3V6JA 1CJVA 3D2NA 2B8QA 3OW2M 3ZZYA 2E1AA 4YB5A 1HIWA 2EI5A 1U47A 3DLRA 9ICAA 4YORA 1NDLA 2ZUAA 3SD7A 3TAQA 4NEYA 2MTLA 4N76A 3B82A 3AA4A 1HPZA 3GG1A 3C65A 4LR8A 4F4KA 4M3RA 4I68A 4NLTA 3QT5A 2WVFA 5FRMA 3ZDDA 2O8DB 2J9DE 4LF6F 1DFDA 1REVA 1BG3A 2C3MA 1NOZA 3DLJA 4QR0A 4JV1A 2LEAA 3M4XA 3LQVA 2QM1A 2KYXA 1L3SA 4DQSA 2GQCA 3TZZA 2E1MC 4E1JA 4GVLA 1UFKA 1WAJA 2FF3B 1NMNA 2VJ4A 4CTAA 4AUKA 3NVWA 4FE3A 3ONQA 4DLGA 3IXQA 3ILJA 3G82B 4M9GA 1HD0A 5IIKA 4K2JA 3MAAB 1XO0A 2W11A 1IKYA 3DXKA 2N82B 4I2FA 3CD6N 3IMQJ 4UUXA 4ANEA 3AGRA 1F44A 1N34F 2HF4A 2FZGB 3QEWA 4CHOA 2HFOA 3CD7A 3CCUN 4MFBA 1HKCA 3SQ2A 5T14A 4X4OA 4C8KA 1SV0A 3T5HA 4K0KK 5CABA 1YIJS 4K4UA 2QB0A 2FSJA 4I2GA 4J9VA 4G1PA 4WF9Q 1MWZA 1YRXA 1IKVB 2R2UA 2RUGA 1U04A 1BQXA 4DS4A 3HP9A 5KT3A 4WFXA 4LFAJ 2RT3A 1S0OA 1FE0A 1WUAA 2HS3A 3AVHA 3CCJS 4ZCIA 3BDPA 3I0RB 4O3OA 4USKA 2YKOA 2YBVA 4OO1J 2HK3A 1E6VB 1E4FT 3RB0A 1VQYA 4C98A 3QINA 1SL1A 2GQ2A 1CJUB 2D9PA 2HI0A 4ZJQA 2NO4A 4H54A 4MAKA 2HBLA 5GIOA 5FD1A 2RQCA 3LK9A 4LF9F 3VQ9A 3DOMB 2RAQA 3VR1A 5GVQA 4KH4A 1LAWA 3U26A 1KHVA 2RVJA 4E7IA 1R8BA 5IM0A 5F0UA 3AD8C 1ZQQA 2PMWA 2B51A 2Y0SF 3H0MB 1IBMF 3TU5A 2E5LK 1S72N 1YVFA 1YVNA 1WELA 2XMTA 3E1YA 2LVWA 4R65A 3VGVA 2P8IA 1APSA 2A18A 4DCPB 1P8ZA 4H5TA 2FQQB 3H25A 3V5RA 3AAWB 1I1GA 4CZCA 4DR1J 2DNLA 1EQ0A 1TAUA 2ODGA 3VV2B 1VISA 3FZFA 4LH5A 4LQ9A 1V5IB 5KFLA 1B0VA 3GJTB 2LM1A 2ZJ8A 3OGUA 3JXUA 2DR9A 2F4FA 3D28A 3IWLA 3CMEN 4PQUB 2EZXA 2ZIUA 4BG8A 1W25A 5EWGA 2CVIA 3IR5B 1GLAG 1KAZA 5BOLA 4P2XA 2E9TA 2M70A 2KIVA 2UXDF 1R0AA 3AFGA 3H5YA 3CJ7A 4BRFA 1SXDA 5KFZA 3ULHA 2KXNB 1ZQ1C 2G8FA 3AGKA 2GTDA 4QR1A 4DV3F 1VQ9N 5LJVA 3CPWR 5M1NA 4TXSA 3V9UA 3VF6A 4ECUA 1QD1A 1ZBIA 2UUCF 5AKZA 3MECB 2HNYB 1H98A 2OPRA 3IAM9 4HACA 4OLPA 3RSEB 2N3LA 3U9ZA 2R7XA 2I7PA 3C2KA 4LZDA 1S1XA 2Z2MA 3TAPA 4Y2VA 1VRQC 3F5EA 2XS2A 4R5PB 4QZ8A 1O8BA 2HNDA 5AZJA 2UUCK 4DQRA 1LWFB 2FLLA 2F4VK 1Y11A 1ZD2P 2QL7B 4MT1A 4FLZA 4Y0WA 3RRGA 2JVOA 3UD3P 2YKNA 1ZBHA 2HS4A 3OD2A 4JI1J 2YKMA 2UUCJ 3ZZRA 1YJ7A 1F9EB 2DNNA 3LUYA 5AQOA 4DSJA 1VSIA 1RWOB 4A8SA 3U8XA 3VAMA 2GUPA 4URGA 3OSNA 4E0DA 2ZNZA 1JRPA 2UV8G 1Q18A 5FIIA 3LL3A 3D7SB 1ZQCA 4DLEA 4O4GB 4Z37A 2DNOA 3MM5A 3PSPA 2P66A 1VQSA 1FFUA 2XIDA 4ZCKA 1GNKA 3ZTQA 3W0LA 1JLEA 1TKZB 3MF5A 5KFEA 3PNCA 4NX9A 1ZTTA 3AOBA 3NMUA 3RAXA 2N1RA 5J0SA 2AGQA 4LUBA 5JJBA 5HK4A 4DO9A 1RHJB 3GYNA 1TELA 2QA2A 3PJXA 5DKWA 1LWXA 1PZNA 4OD0A 1Z1BA 4Y2TA 4ZCLA 2J6UA 4ZJOA 1KLNA 1SAZA 7FD1A 4W4MA 4RPFA 2Z30B 3L2RA 2LEPA 2X1AA 8ICHA 1T3QA 2ZJPQ 3VQPA 5B0FA 4FO6A 3SYZA 2BJ3A 1EETA 5EY4A 5C24B 2HPUA 1UVJA 2RF2B 2FI1A 2V2ZA 1G99A 3LPTA 2GVDA 3KKRA 1PUZA 3J8AA 5HP4A 2KI2A 5I4MA 1UKUA 2H5IB 3L2WA 3TRGA 1XTZA 5KFJA 1RACB 4B8AB 1ZQMA 2ZH9A 1TL4A 3KWIA 1KOOA 5IFMA 5FLXU 5K9FA 1HARA 3L4QA 3CW2C 3UXOA 1KTQA 2FHKA 3HHNB 1NJIT 2EAOA 3RZAA 4CCHA 2KRRA 5AZIA 5J2EA 4K2XA 4DV4K 1N5VA 3JSRA 2CPDA 1UHUA 3WX8A 3R5CA 3BV8A 3D4JA 2B21A 2ASDA 3KLGB 1N5YA 3Q83A 4NCBA 3L95X 4OPHA 4DTSA 4E7HA 5KG6A 3V7KA 2DBBA 1C0MA 5L9XA 4BG9A 2NRTA 1X4GA 4UOHA 3T1YJ 4ECTA 5IT9Y 3DHWC 4AQYJ 2U2FA 2G2YA 4K4XA 2XS7A 1C4CA 3QGPA 3NL0A 3K1ZA 4ZVSB 3M30B 3H0LB 3W2VA 3CSKA 3O44A 2DKZA 4F4WA 1WC0A 1PIEA 2V8VA 4X4QA 2E1RA 4CF2A 4RUCA 3RJMB 4PEOA 4I56A 5GINA 3C21A 3F41A 4J9UE 4WIQA 2E88A 3GR0A 3QU7A 3M8PB 3TYTA 3QT6A 1A6LA 2D8CA 3PKMA 2DQNB 2Q2RA 3ZT1A 3VPZA 5C24A 4I1TA 3QJPA 3H7IA 1RDAA 2P9EA 1HYZA 2FBTA 2CQDA 2EK1A 3BY5A 1Z19A 2ILZA 3JYTB 2NSBA 1XNSA 3EN9A 5L1MA 3FBBA 2ZTDA 2OANA 4CJ4A 2LEBA 4BRNA 3NNCA 1PK3A 2P9GA 5J2GA 1FXLA 1V3RA 3AA5X 2BCVA 4M9NA 1TYQA 4JKGB 2XHCA 5AXKA 3M32A 1REVB 3C6AA 7ICJA 5ETSA 5H9FK 3LF0A 1MWMA 4BRDA 3HSJA 8ICGA 2G8UA 2ZHOA 2HNZA 2YMLA 4DF4A 3CC4N 4KPYA 5KG1A 2KVSA 3CULA 2KM8B 1OVQA 5BRHA 2LU2A 5GIPA 5AM4A 4B3OA 2QLJB 1XI1A 2YKMB 5ALRA 4UB1A 4LSNB 4LFAK 4CZKA 3NY0A 3THTA 1Q7LB 3U3YA 4JN4A 5B0AA 4R79A 4BY9C 1UMJA 2IJNA 1X4BA 4DU7A 4HCCA 1FJGJ 2GMLA 2G0CA 4LJXA 1IR2A 2ZWHA 4QZAA 9ICPA 3NVZA 1MWYA 1EKRA 1YTYA 4R66A 4F91B 4DL2A 4J5OA 3GQCA 3DRRB 3QEIA 2PI4A 4R63A 1ZA1B 4WFAQ 2QYGA 3OUYA 3KK1B 3CRXA 2O67A 3R9PA 4JI4J 2B4OA 2E66A 4M7YA 3PLAA 2DH9A 2ZH7A 4DN0A 1VQLS 2MQNA 2K4PA 3P4UB 4Q45A 2FB0A 3PFOA 3UKRA 2QA4N 2O1PA 2A3VA 4I6MB 4M63A 1T6DA 5J1NA 1NKEA 2YHAA 5K8OA 3KDNA 1XIQA 4FXVA 2OELA 5A2QY 4AHVA 3ISNC 1DQ8A 3AEVA 3PX6A 5KPRA 4DL4A 1IKWA 4DUYF 1PBAA 4K0KF 1FTCA 2VHGA 1Q82O 1RAEB 8ICXA 1GLBG 2ZIUB 4IEEA 1WSHA 2JLEA 4FWSA 5A6WA 2K7JA 3GE1A 1BL3A 4BRIA 2FJ6A 2F7VA 1WF1A 1JXBA 5E26A 4YQWA 2XY6A 4XH4A 4YD1A 3CJSA 3VQBA 3C95A 3THWB 1FW6A 3TACB 1H74A 3OFGA 1I94K 3LP2B 2FDRA 3QRPA 2K8CB 3CCJN 3P96A 4BE0A 1YRTA 4RQ1A 2WF7A 4DPUA 3SCJE 1VK8A 1FDNA 2VV5A 4MKVA 1HNXJ 3IGNA 1ZD5A 1RT3B 3KFWX 4AYBD 1KKHA 3OTDA 1N5TA 3WXKA 1ASUA 4IQTA 5AKJA 4L74A 1Q7YT 5AQSA 1K5OA 1JLBA 4CF0A 5IM0B 3O9QA 3W65A 3R5GA 3X3UA 1FK9B 5AQRA 4JB8B 2CQCA 1X9XA 5F9NA 3ZO7A 3TABA 3GCWP 2V9WA 2DRAA 5F0XA 2BTFA 4LT6A 2LYBA 4CP5A 3J81j 4CM0A 1JLCA 1ZOLA 1QSYA 4JNEA 2DEIA 1CJUA 3HSGA 1Q79A 5JMNA 2CH6A 3M6VA 4CH0S 3Q7BA 4RBTA 3KD1E 3I0RA 3F44A 3EZWA 4JI2F 3M3ZA 2ZWOA 2ES6A 1HHTP 2PFUA 1TVRB 1Z00A 4O5FA 1MC8A 4J2DA 3M7VA 4E7LA 2YHBA 1OWXA 2KKZA 4HUEA 5B09A 4I2CA 1U1RA 3ID8A 1E4GT 3D6JA 5AKLA 1Y5LB 2E2NA 3QB0A 3ZX0A 1VRUB 3B8HA 4DB3A 4OJLA 3EX7B 4YMEA 1VSEA 4LF9J 3FSYA 3ITHA 2F8LA 3SQOP 1KNZA 4RPYA 4DTUA 2OPPA 2CXEA 4UB8U 3CC2S 3SLCA 4KLTA 3P6YC 3AB2B 3HSDA 3IRXA 5HRSA 1WHYA 3G6ES 4ED1A 2RN2A 2AJQA 2DNQA 1BHNA 1FEZA 5HBMA 1UAXA 1KCFA 3OYDA 3UMCA 2YX4A 2HRYA 1IBMJ 1Q78A 1QQNA 1OPIA 3B4DA 4KLQA 3H5SA 5AQYA 5EUHA 3QJLA 4PG8A 1T8EA 2QE5A 1B4FA 1XC9A 5J0RA 4RW4B 4BE1A 1NKBA 3TZXA 4QZIA 3EE3A 4WKYA 3DOKB 2UUBF 4DR1F 1F2GA 2D0PA 1GOAA 8ICAA 2W2PP 4NPOA 3UKUA 5DDQC 4CJSA 4KH5A 2H3QA 2ZIXA 3H8MA 5DG9A 2ROEA 1BI4B 1PC4A 5EVZA 3E01A 4ED4A 2W43A 2VANA 2J7KA 2Q6CA 3QLHB 2CJAA 3QO9B 2VBXA 3KWGA 4QWBA 3Q8MA 5G4DA 3I96A 4F72A 3CHWA 3D68A 1QSSA 4FWOA 4ITSA 4KHPJ 4BXOB 2F96A 2KXFA 1U8WA 4F5NA 1OH5A 2YI1A 5KFOA 2M4MA 2QL5B 2Y0SD 1PGZA 3I56S 4J8FA 2R2TA 2E8MA 2W8KA 4LF1A 2PI5A 4NLNA 1BIZA 4A61A 1FRIA 3KZIU 5AIAA 1SQFA 4WU2A 2FJBB 3N6MA 1BWVA 5DS7A 2KK0A 3UXNA 4AHUA 2PO4A 3JPNA 1HWIA 1O13A 2BMBA 1TU0B 4ILMA 2ZH5A 4AP9A 3NH2A 3L3CA 2O01C 3ENAA 4KHUA 1SV4A 2CNOB 4HTIA 2WUSA 1SH3A 4WFNL 3ZSVA 3DM2A 1TL5A 4L75A 1HNZK 4ECSA 3OYHA 5CZ2A 3WNEA 2UVUA 2WVDA 4B1YB 3EUNA 4H5RA 2J7WA 4JOUA 1UEVA 2RP5A 2QKKA 3NG8A 2MY7A 4KMOB 5DLFA 2Z1HA 2KSOB 1WI6A 4O44B 1JUDA 2JL9A 2YJEA 5GAHP 2M7SA 3P5JA 2BJ1A 3IMXA 4FM2A 2WONB 4NXMF 1XSNA 5IIMA 4V19S 3GFXA 1FX4A 2KRBA 5AJ3K 4KGZB 5JXSA 7ICVA 3VVTA 2IVMA 4BLGA 4GV6A 5LJWA 2VG6B 5CYJA 2N3OA 2L9DA 3KJVB 9ICNA 4L6V3 4DQQA 3ICXA 2ZG6A 4M5DB 2R8KA 3KOOA 3DOLA 4I7FA 4MJKA 1ESVA 4KRWA 1ZQZA 2CJ9A 3MR6A 3SMPA 1ED1A 5KFAA 3CD0A 4OJOA 2RQ4A 4HLBA 4ED6A 3NVVA 3PUFA 8ICYA 3ISBA 1PCAA 4O3RA 1QQ5A 3HMJG 1X42A 2A1JA 1LWEB 1PAEX 4PGQA 5ALDA 1X1PA 2QXLA 5HMLA 4KN7A 5MAOA 5AKXA 3B6OA 3G0ZA 3DRXA 4XTTA 4C0ZA 4OX7A 2JRZA 3CCMN 5D4BA 4BC4A 4AL5A 1KQSM 3MM9A 3ZX2A 4E19A 2NCKL 2GWSA 3MDQA 1T6CA 3HOTA 2VUGA 3C15A 2YNGA 1ZBTA 5HMZA 3FEYB 2VJUA 2CPYA 1N32F 3D3CJ 5AKKA 1TKTA 4IOBA 2O8FA 2EDUA 4CWBA 2F9WA 1KVJA 1TUWA 8ICEA 3HKZF 3Q8RB 4YMNA 1WWUA 1UWBB 4PG4A 1HWLA 2MZRA 5CYMB 4KAIA 3CCQS 4DZDA 1NPKA 4B8CA 4PAAA 1VQ7S 2EFVA 1PVQA 1T05B 3GIJA 4J2AA 1S1TB 3F56A 4CO4A 3K5MA 4CJTA 3U9DA 4M9JA 4ZP8A 4RPXA 1R3NA 4IRKA 2P9PB 4OIXA 4TNOA 2X6SA 1SBRA 3GB0A 1CVJA 3NBPB 2C1EB 3KK3A 2HHUA 4KB0A 2XI2A 1BOTO 3MR3A 2VPXB 1TVAA 4DR3F 2NV3A 3I9V9 3T1YF 2J0SD 2IPOB 4GXKA 3K59A 3L7OA 2HFSA 1JI7A 2ZXHA 4DJBA 4DR6F 2IOFA 4ECZA 4YNQA 3BGRA 3UXPA 2QLBB 4J9MA 3G10A 2YQ0A 2BJDA 4MFCA 3H1QA 3O1LA 3FRZA 2AEMA 4I67A 4CJPA 2LXUA 3FCVA 9ICMA 2ZTEA 3AN1A 2M2BA 1R89A 4BR5A 3KLEA 3SPZA 3I9ZA 4CO1A 3VETA 2RHQB 4F3OA 1FRKA 4Z6CA 3QEBZ 1AZSB 5EN1A 3QPIA 4OPJA 3H46O 4OJPA 1EP4A 4TSXA 4IH7A 4KRFA 2Y9TA 1GEHA 3THVA 1X0PA 3QZ8A 3A4TA 2BEFA 2JLFA 2V69A 3A3OB 3FZLA 2KE7A 4ILHA 5LXRA 2CXYA 4DI6A 2RRNA 2CGJA 1HWJA 4M7XA 3NGYA 2ZOMA 1KL9A 4FNHA 4NMLA 4CVNE 3Q23A 5HMXA 2EFQA 2ZOFA 1XSPA 1HR0K 2CH5A 3KK7A 4ED3A 4XPCA 2P6UA 4Z94A 2CJXB 3MUVP 3KZBA 3R5AA 2ZFHA 3ZYYX 1VBXA 3PW2A 2AJ2A 5AQGA 4PG6A 2V7ZA 1R7IA 4NM2A 4C4SA 4E3SA 3MFIA 3D0IE 2IGIA 3GZFA 2M0GB 2YTCA 5F8MA 4K8ZA 1WDTA 1COKA 2V4RA 3A12A 1WBBA 1GTEA 4F2RA 1VQKS 3R27A 3SJJA 5FP0A 3WKDA 3I87A 5CD4A 2BJ8A 1U8SA 3OS2A 1WDDA 4YR3A 2B4JA 3MMAA 1AB8A 2W3SA 1SWWA 4NLYA 4LVSA 3MZIA 4YFKA 4PG5A 4RWWA 3MXHP 2ASLA 3J80O 2ILYA 3BGRB 4EO6A 3LGNA 3JTNA 4Y2UA 1IXRA 2PD1A 2GFFA 2MGZA 1S10A 1V38A 1ZOTA 2DGTA 7ICKA 4BRLA 1V6HA 5J2CA 5DDMA 2XYPB 1GTHA 4DUZF 2PA3A 4M5LA 1VBYA 3SDEA 2A42A 2BUNA 1RA7A 2OUGA 4DV0J 2KJ8A 4NB4A 3P39A 4MK8A 4LF7J 4F4XA 1WYGA 2HWTA 3ZTRA 4IZ9A 1D3WA 3JPSA 3BQTA 5F2RA 1HUXA 1KEJA 3OVSA 1RWPB 2UUAF 4UUWA 2E7WA 5KFKA 3UFCX 4X4VA 4ZK7M 2OWOA 2BX6A 4U9RA 5HMWA 2YXLA 4Y2IA 4IUFA 4K4WA 2GWKA 5A2QU 1WN7A 3J80Y 4PKHA 4RW9A 5KT5A 5AXLA 1FNXH 1PC5A 4QYRA 3JSMA 3GV5B 3EE8A 2WSEC 3C8YA 3MTJA 1XMQK 1VSDA 4KLOA 3TWZA 2QA4G 3OBIA 1FT8A 1FXDA 2X78A 3OR2B 1NPRA 3GDXA 2I5JA 4ID8A 1S22A 5B0CA 4PHAA 1V85A 1IBKK 4FW2A 2XRIA 1WKLA 2QA4S 3T5KA 1TV9A 2W01A 1RTIA 5HHHA 3N0VA 7AT1B 3M7DA 4UTGA 1JLQB 5E0OA 3WC0A 3CE8A 3BZQA 4UBBA 3WQUA 3ZSRA 2ATLA 2ZH1A 3DI6B 3K1RB 2EWSA 5EWEA 3ZETA 2FE9A 3RVCA 3HSZA 2LU1A 1YUWA 1DRGA 3SSQA 2GIQA 4YB6A 1FFGB 1T03A 3AA8A 2IRUA 1S6UA 4P0QA 4O8UA 4XH1A 2DPJA 1YX2A 1RTJA 3OS0A 2HHQA 1WNSA 2X51A 3AOCA 8ICQA 5D46A 2HNZB 4IDKB 1Q5YA 1AFIA 4PKDB 4PABA 2BXJA 2DR6A 1DOQA 3I5CA 2QEXS 3ZC4A 1FXXA 4BXOA 1K6YA 3RMDA 1OH6A 1AT1B 4KY3A 1L3TA 3IDHA 3VF4A 1D5AA 2JGUA 3HW8A 4B3RK 3NLCA 2E2OA 3UIQA 4CZHA 4M3YA 2VD3A 1FFSB 1SS6A 4ZP9A 4WXWA 4JI3K 1XNRK 3PO5A 2EFNA 2UXBJ 2V9KA 4PUOB 2Q1LA 3AY0A 5GAGP 1TK8A 4TVAB 1BHLA 5DB7A 4I29A 3RAQA 4NLWA 3E66A 4WFZA 2IMOA 3MDAA 2CZVC 2HBMA 4FXDA 4DOAA 4RUAA 2F76X 3QZ7A 1B9DA 5J2NA 1S0MA 3M2RA 3CXCR 2LYVA 4JLHA 2VQEJ 4L72B 1LQ9A 3MM7A 1K1SA 1KP6A 1DK3A 3RMCA 2OD6A 1KC8T 4NL9C 4HUGA 1RPLA 1N61A 1SL0A 3JPTA 3BGOP 1NOYA 4IRCA 1OSCA 2UXBF 4U6PA 3ILLA 2Q0UA 3C6UA 4RZRA 2EWHA 2E1ZA 1N5QA 3DNCA 1SV5B 3ALYA 4NZ0A 1COOA 3N7RC 5DGAA 3TSUA 3EZ5A 4C8LA 2IHMA 2KLAA 1BISA 4QIWC 4NLQA 2F77X 2P9CA 1CZ9A 3G4SS 5DQGA 4ES1A 1MA7A 2RU9A 4IQMA 2G08A 1YTUA 1NEEA 4WFAL 3NRBA 5HL7Q 2CQ0A 1Q8BA 1RBVA 1XQIA 5AR0A 2DKXA 1QS4A 5GMDA 3QLHA 2VQEK 2F8KA 1Q3VA 2J8AA 2AJ0A 4GXIA 4GIBA 1BI4A 3RJFA 4TUPA 2JH3A 1A9NB 3R1HA 5D3GB 2E7VA 4I4BA 1RDRA 2A3JA 1QSLA 1KDNA 3R1LA 1GMWA 1X4HA 1NZ8A 1W26A 2VQFJ 1XUPO 4FZVA 2RJZA 3UD4P 3RUBL 2NRVA 2XSJB 4MKBA 3GBTA 5AM0A 2P1JA 4JEPA 4KI4A 4K4GA 2KXHA 4NE9C 4EWTA 2RIJA 4QZDA 4YS2A 5A8KB 2LQ9A 4B3TJ 1JLGA 1KDHA 4M94A 2W4CA 2JRSA 1B3TA 1HKGA 4CJWA 3IM1A 1T0TV 2B6AA 3NGTA 4I27A 4GO7X 1S72S 2CWXA 4EHTA 1UVKA 1IG8A 1C0GA 4Y2RA 2E5LF 1AUSL 2ZZTA 1DQAA 1Q86O 2JEJA 3I55S 2K1RB 2F8EX 3I8BA 4H0PA 1L5UA 3TUPA 3RBXA 1TVRA 4HDGA 3D6RA 2JWKA 2VKZG 3KLHB 2F1HA 4QIGA 4DU4A 1CLFA 1V3SA 4JRQA 3K75D 4USAA 4EX6A 3T79A 2A6AA 3G4SN 9ICWA 1MQ2A 3VTHA 5DLGA 1WEYA 3GSIA 1T44A 2KEYA 4YG2A 5FPMA 1VQOS 1RAGB 1HHQA 1S79A 3ZTPA 1P6TA 1S5JA 4ED5A 2EZYA 5DQIA 3U7JA 4K4VA 3KLFB 1H7WA 2R7YA 2CJKA 1NAQA 1FK9A 4FOEA 2OEMA 3SSSA 5CY4A 3L7PA 4BDYA 2WF5A 3IG1B 3PW0A 4U7CA 1WJ9A 3FBEA 4KX3A 1HBMA 3EVMA 4G1QB 3GG4A 3RR7A 4CLKA 4C8ZA 4CLWA 1SC4B 1CEZA 4UOFA 1HBOB 4PWUA 1ECWA 4YOXA 4I2PB 4NZ6A 1TL3A 4RQ2A 2A1SA 2DGVA 2HOEA 1KKXA 4JYAJ 4FBTA 4JK1A 4LFBF 3GE9A 3PACA 5KFQA 3JAMU 2LMRA 4MLEA 4GVBB 1XR7A 2W9CA 1JROA 4NLPA 3WZ0A 4DV3K 2MSTA 3LM2A 4W90B 9ICQA 1DTQA 1T9TA 3ZD9A 1JB0C 2XTJP 1IKWB 4Y00A 2QK9A 5FPNA 1N5SA 1CXUA 2ADBA 5AM5A 2G0IA 1REGX 1K9MO 2GC8A 1VQNS 4CJQA 2EAMA 2KW4A 3IHQB 3UM9A 4DTNA 5I42B 2HRUA 2VASA 1TYQB 3WQPA 1EKSA 4J2EA 4OKKA 2HOIA 1WUUA 1GOCA 1AYEA 1FJEB 1HNIA 2EC0A 1QM9A 1S6PA 3HKZD 3SMVA 3QU4A 3ETLA 2G2ZA 1RHUB 1HYVA 2ZHBA 2XICA 1WSJA 4LF6K 1HNWF 3K89A 9RUBA 1NGFA 3JPQA 3R3TA 3MI7X 4M2YA 3H2VE 5A8KA 4TU8A 2EKNA 2VFSA 3R6MA 3U6FA 3KWMA 1RLCL 1L7NA 2XSJA 3HBTA 1UEUA 5CHCB 3KHYA 2WOMB 2WVBA 2WW8A 1LVHA 3NF6A 1W2IA 3VZIA 5F3TA 2BANB 3I28A 3AVIA 1QQ6A 5IV3A 1UZDA 4J91A 3DLLQ 2C3YA 1TFRA 5TKWA 2O8BB 4AQYK 1KW4A 5T7LB 2NLWA 1Q4RA 4DV6K 2MLXA 1RT6A 2VODA 5K4LA 5E3AA 1Q46A 1L7PA 3QAUA 3BS9A 5M1FA 2CG8A 3VCBA 3KLHA 2UXCK 3ZD8A 1D9AA 1NG9A 4FZNA 4KHMA 2OPQA 4CJKA 1RT4A 4YOTA 5B7WA 5KPZA 1FWPA 3H7HB 3PTWA 4C0OC 2BPFA 1EB0A 4FBUA 4J9PA 1OQ6A 2JV3A 1NJZA 2AIRB 1JXVA 1S3XA 1J2MA 5IIJA 2DPIA 3HJVA 5K14A 5C2GA 2EQYA 3ZT4A 4G9ZA 4UBCA 4RTFD 1OS5A 3T5LA 1NCLA 4ZVOB 2CRLA 2KD1A 1NZAA 3JB9k 3JYTA 3H3NO 4FYDA 2J9DA 2ZHAA 1P9YA 1K1QA 2K4HA 4CIEA 1Y3JA 2GVDB 3NOGA 2EC2A 4PWWA 3NGKA 4CK1A 3AO1A 3JPPA 3DEEA 5C42B 4LQ3A 3VAIA 5KFXA 2IA0A 4AL6A 1X9JA 1OXJA 2ZIWA 2V8PA 1KFDA 1I3OB 7ICQA 4YXJA 2MZTA 2MY8A 2G4BA 4M0AA 1HBUA 1SJ1A 2XULA 4Q2MA 4EELA 3KNGA 3PRDA 1BQMA 1IBCB 1NLKL 2HBYB 2CPXA 1IBMK 4WCEL 3KK2A 2P5OA 2CPJA 1WOOA 4V1Ak 2LYHA 4NOHA 1XMOF 4IR1A 2ERRA 4HI2A 3ULEB 2IOHA 5ALXA 3N4WA 1V9OA 1JKHB 1RBSA 3PW4A 2CRXA 3GPAA 1KQKA 5BR9A 4Q5VA 4OJRA 3DMJA 3LO3A 1WSFA 4LF7F 3R7BB 4H0YB 4V19J 3V81B 4DOBA 4EBDA 1JNZB 4CHQA 5AIBA 2XMVA 2B6GA 2GV1A 1NI3A 1RAIB 1OY9A 3IAS9 2O4IA 3SCKE 2APOA 2HVEA 5IT9U 1MA9B 2YX6A 2HKEA 4KV8A 1JCEA 2KHQA 3C6TB 2BANA 1QAXA 1R43A 2I6XA 5BPLA 3D1OA 3AL0B 3KBBA 4PJ0U 2KN7A 3UQ0A 4KHQA 3FGVA 1FD8A 1JLQA 1SIWB 4X65F 3WT0A 4JWNA 4RNHA 3ULDA 2L48A 2WOMA 1AW0A 3MOZA 2GQQA 3ILIA 5D6GA 3UQ2A 5J2NB 1J5EJ 1RISA 2H3FA 4WF9L 2RRDA 3P4IA 3KKAA 3TI0A 4HTJA 2JEIA 2XI9A 2RRAA 1N33F 2HOFA 3NGSA 3T1HK 3S1TA 4JI5F 5AT1B 3FZMA 2QA1A 3A0IX 4PUOA 1NGCA 4X4PA 2WAQD 3L3FX 3IG5A 3L2VA 2DNKA 1SCJB 3JS9A 2GH1A 4EYHB 3RWUA 2K06A 2K8GA 4OX9K 2A2DA 1QE1B 4USMA 1RE1B 4ECRA 5LMNJ 1D4XA 4CF4A 2HFNA 4FDFA 1VSLA 4DKWA 1Q16B 1O6XA 3TX8A 1I94J 4OQJA 5KFUA 2PDAA 3UN2A 3MEEB 3DXMA 4FJ5A 2Z2LA 3CD6S 2J4RA 4WJ3B 2MUTB 2V2KA 1HNZJ 4CYUA 4Z0UA 3NXZA 3RJKA 4JI8F 2FLNA 2YX1A 3DYAA 5AKGA 3RH6A 1MN8A 4ID5B 1YHQN 3V1QA 2F4VF 3W9HA 2PMZC 2BM0A 5M1PA 4RQ8A 1SJQA 2EG2A