3TARA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-6) position
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tarA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tarA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tarA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tarA01
4BDZA 3AVGA 3AVMA 4KLUA 4E1MA 2A1SA 1QLNA 3RMCA 5DB7A 3V81A 5KT6A 1JIHA 5J0SA 1ZJNA 3GIIA 2A1RA 5KGXA 5KG7A 1RBVA 4K4GA 3TAMA 4O3OA 4TQSA 1X1PA 3QO9A 4CHYA 3K59A 3S3NA 1T3NA 2C2EA 4J9KA 4KLIA 5EU7A 1NOZA 1LAVA 4FZZA 4DU3A 3T5JA 3L2VA 3HSTB 2YNHA 4NLKA 3C1YA 3SZ2A 4CJTA 4O0IA 2KQ2A 4RUAA 5IILA 3M8PA 4PGYA 4I2IA 4J9LA 2PYJA 3KK3A 3AVLA 1JXBA 1LW2A 3HPHA 4Q8EA 3P5JA 4LVSA 1UT5A 2BGWA 4N56A 4IRKA 5KFYA 1WSGA 4LH4A 3ISDA 4ED1A 4J9SA 1NJXA 2JEFA 4NM2A 3ZDDA 3RJGA 4H8KA 4I9LA 3ZSXA 1HRHA 1TK5A 4NY8A 2RN2A 3ZD8A 2ZUBA 1W9HA 4M3TA 2W8KA 2GBZA 1S9EA 4IRCA 4RT3A 4YNQA 4P4MA 5IIMA 9ICSA 2Z1HA 4M9NA 4ICLA 1AROP 2VG5A 4DOCA 2OYQA 8ICSA 4J9MA 5KI6A 4QZIA 1Q9YA 1UWBA 1TKXA 8ICXA 1C6VA 3DRRA 4CFAA 1WSHA 1KVBA 4JV0A 3Q8LA 2DPJA 3TFRA 3MFIA 5C5JA 4R8UA 4QZ9A 2KW4A 3M9MB 5HBMA 2I1QA 2W9CB 9ICVA 1KFTA 3RJKA 2G8VA 3VA3A 3DMJA 5J2EA 1S5JA 1JLGA 3MFHA 3SYZA 3DLHA 4O3SA 4WE1A 3V72A 1S77D 3I0RA 1C0UA 3NFAA 3O4QA 4FS2A 3EZ5A 1Z00A 4DSFA 3ZT1A 4PUOA 2YHAA 3G0ZA 1VSLA 5J2FA 3ZDCA 4QZHA 1ZQTA 2ASJA 2EHGA 9ICCA 4E19A 5J2AA 2IS3A 5DDMA 1T7PA 1RTJA 5L1IA 3VQ5A 2C28A 4F3TA 2YNGA 4O5CA 4HYKA 3ZDEA 3QEBZ 4KLMA 3V9UA 4FJLA 4DFKA 7ICLA 4FBTA 4ZH4A 5EWEA 4TUSA 1ZQEA 1FKPA 3PUFA 3JPRA 2D5RA 3AVBA 4M9JA 4F4YA 4OLBA 3L3UA 2C22A 4ECTA 3RH6A 3V1OA 3OYGA 4PGXA 4XQ8A 5HP4A 4DQIA 4E1NA 5SWMA 2ATQA 4DF8A 4DO9A 5F9LA 2HHQA 3V6HA 1B9DA 3F73A 4J9QA 1TAQA 8ICRA 4IFVA 3TAPA 7ICSA 1EXNA 3QLHA 1DLOA 4C8KA 4CGDA 3BQ2A 3P83D 3JPQA 3CYMA 3OGUA 4DSKA 3ZSQA 3ZD9A 1SZPA 1NK9A 3SI6A 4ECRA 3RB0A 1FKOA 4CFBA 1HNIA 4I2JA 2BPGA 4DQQA 5C24A 3OSNA 5J0OA 4RZRA 1RT6A 1RBTA 3NAEA 5I3UA 1TKTA 3ALYA 3E01A 3VQ6A 3NCIA 3C2MA 2XY6A 1HMVA 4LSNA 3HJFA 3JPSA 3DOKA 3HL8A 1B9FA 1XHZA 2ZD1A 5HP1A 4O3PA 2RDJA 1T8EA 4JV1A 4AH9A 1FK9A 4BDYA 3OYHA 4W5OA 2HHXA 3V9WA 4GLXA 8ICOA 8ICWA 2XCPA 4NYNA 4F4XA 4PHDA 4M9GA 5SZTA 1BCOA 2RF2A 4M3WA 4KTZA 4CIFA 5KFWA 1L3SA 3LP0A 1YTAA 4CEEA 4DQPA 1ZQIA 1NK0A 2IBKA 5KG1A 5KFJA 5IIJA 4HUFA 1SKRA 4R66A 5KFLA 4RQ3A 1XS9D 2QKBA 3EW9A 5CP2A 3LDSA 7ICMA 2IA6A 4FCYA 4UB4A 3T5HA 2ALZA 3RJFA 1J5OA 4O5EA 1ZQXA 9ICRA 4YXMA 4GVMA 1KVAA 3KIOA 4J2DA 3HVTA 1CLQA 5HNKA 5DLGA 9ICFA 5J2CA 3KD1E 4IDKA 4JS5A 4CF0A 4DMNA 4IFYA 4KMUA 4ED7A 2PFOA 1L5UA 1S76D 4RQ8A 1S97A 2QKKA 4QCLA 1S1TA 3C23A 2HMIA 2R8IA 1TV9A 4Z4IA 4OKEA 2HNZA 4JRQA 5J2DA 4OVLA 4FJKA 3B0XA 1Y88A 3L2RA 3I0SA 3VQQA 3NTUA 4OPJA 3N4MB 4XIUA 5J0TA 4Z4GA 1A76A 1T05A 2BHNA 1YT3A 1X9WA 1QSYA 2OPSA 2ISOA 1TVAA 1VSFA 1LWCA 3GIKA 3C6UA 2F1JA 1KSPA 1JLQA 2MUTA 2DPIA 1ZQCA 9ICQA 2QK9A 4W5QA 2F96A 1MQ2A 1TKZA 3T3FA 4DTNA 4F93B 1BQMA 4NLNA 1BIZA 3V7LA 3M8SA 9ICAA 3AA5X 1ZQNA 1FXXA 3IAYA 4N47A 9ICMA 3VQ9A 3ZSRA 3PX4A 4FJ8A 4O9MA 4FJNA 3MR5A 2PXIA 4FLYA 4ZHRA 3BGRA 1QHTA 1B22A 4RG8A 3T19A 4E7JA 2NRXA 1NKEA 1KLMA 1S6QA 3V6DA 4DOAA 2DY4A 4NXZA 3KHGA 2P1JA 4FM2A 4UB5A 4CJLA 4NYFA 3Q8KA 2W8LA 1G15A 4DLGA 1XO1A 1NJWA 3TARA 4CHPA 3OYIA 1MU2A 2AQ0A 3UXPA 7ICGA 4EBDA 4FLVA 3AO3A 2X6NA 3KJVA 4PHPA 4BXOB 4R8UB 1S1WA 3MXMA 4F5QA 4I2HA 8ICNA 3UIQA 5KT4A 3ISCA 4I9QA 1WCNA 4O5KA 4F91B 4P2HA 1S9FA 1RXVA 3BDPA 1KCFA 4RT2A 3NHGA 4CF1A 5KG4A 2IMWP 4AHUA 4EP5A 4W5RA 5IIIA 3HYFA 4XUSA 3HO1A 4QWAA 3T5LA 4CEDA 2VANA 9ICWA 3E2EA 3ISBA 5HRSA 5DB6A 5DB8A 3EPIA 4KI6A 1VSEA 3K4GA 3SUQA 1A5XA 3KLHA 1SKSA 2MUTB 4OLAA 3OYEA 1N56A 9ICLA 4CCHA 2DFEA 5J2GA 2ZE2A 4MFBA 3Q8PB 3AVHA 8ICAA 4DL4A 3FFIA 3Q8QB 3TAEA 4E3SA 1NOMA 5HHHA 4ZTFA 3F9KA 1ZQMA 3V1QA 4RPYA 4O0JA 2KZZA 3K5MA 1WSIA 1EP4A 4BGDA 2IOCA 1WAFA 4J9RA 4F4ZA 3Q8RB 2HVIA 4R65A 3OYNA 4YN4A 1N5YA 1YTUA 5KFGA 3ITHA 1S0VA 2W9CA 1U49A 3EPGA 4GC7A 5KT5A 4B9VA 4I2BA 3LK9A 1ZQAA 3AO5A 1ASUA 4DG1A 3KHRA 4KLOA 1BPYA 4HTUA 4CJFA 3S3MA 4ECVA 5EWFA 5BOLA 2DFLA 4MEYA 3C2KA 5KG3A 5HHIA 4PHAA 4QZBA 4JWMA 4DTRA 9ICKA 3O3GA 4MF8A 1WLJA 4KB0A 1C7YA 5CA7A 4MFFA 5EOZA 5F9NA 3LDAA 5CR0A 2F8TA 3RTVA 1RYSA 3VQ8A 4CJ4A 2OPRA 1NK8A 2G8IA 1NK4A 2B4JA 3G6VA 4PGQA 3HW8A 3TFSA 3RRHA 4Q8FA 1IXRA 1A5VA 4CF2A 3M9OB 4QZFA 3THVA 3OS2A 3V6JA 3UXOA 2ZUDA 4RPXA 3NH1A 1VRTA 3K58A 4NLGA 1ZQUA 4M3XA 8ICQA 3OYCA 4FJGA 3KKRA 3PR4A 5DBBA 3SUPA 1NK6A 4BWMA 5KRTA 2XCAA 2IHMA 3MDCA 4M9HA 5DGBA 2WTFA 2KZMA 4XA5A 5D46A 3OJUA 2V9WA 3FDSA 3H08A 4ELUA 3PV8A 3NF6A 4I2PA 4CGIA 1S6PA 5J0UA 4ECXA 4G3IA 4I2DA 4MFAA 3LPTA 2AGPA 4Q44A 1JL1A 1ZBHA 3IRXA 4GW6A 5D3GA 5IIKA 3V7JA 1KLNA 3OYBA 3S9HA 3T1AA 2WOMA 3AU2A 1ZQRA 3VQ4A 1ZBLA 7ICOA 1U45A 4DF4A 1U48A 2M9NA 2R8KA 2JLEA 2AQ4A 5TZVA 3RJIA 4FVMA 1WSEA 4AILC 4YR3A 4C8NA 4X5VA 4LY7A 5KRSA 2BE2A 4QWBA 1ZQYA 3PMLA 4DS4A 3DOLA 3D45A 3KK1A 3SQ1A 2DFFA 3MGIA 3C94A 3AA3A 2FBTA 4QW8A 4BE1A 2ISPA 4CJQA 3NGYA 4MQ3A 1Q9XA 1J54A 2E4LA 3GV5B 1K1SA 2VG7A 1UA1A 4IQVA 2YNFA 3RRGA 4O4GA 4IQTA 3TI0A 2VWKA 1ZQZA 4TQRA 3KTQA 3VQBA 4FJIA 3K75D 4UQGA 1BPBA 2XY8A 3MEDA 5DLFA 1VSMA 4AHTA 4JUZA 1Q8IA 5FDLA 4B8AB 4KLJA 3V7KA 1LW0A 3EWAA 4Q43A 4YVZA 2OA8A 3PW5A 2WONA 3PX0A 4KPYA 5T7BA 4QZGA 4Z6EA 3NGZA 4KLLA 2BCVA 4EZ6A 3IM1A 4GXIA 4E7KA 4Z4EA 1TFRA 3OSPA 1JL2A 2Z1JA 2AJQA 3KLIA 4J2EA 4I2QA 3ASMA 8ICYA 4CJEA 5DGAA 3QEXA 3DLBA 4PA1A 5J0QA 2DTUA 1A5WA 5KFPA 1HJRA 4K4IA 1HUOA 4YXJA 2HHSA 9ICUA 1F21A 7ICJA 5J0YA 4UBBA 4NLZA 4KO0A 2P5GA 1ZQDA 4CEFA 3TANA 5CJ7A 3N97B 1JLCA 3PR5B 4RQ5A 8ICKA 4DS5A 3DYAA 2BQUA 3WNHA 4ECZA 1V9PA 1XHXA 1O1WA 2A1JA 2BKEA 4RQ1A 4M2YA 4OKJA 2X74A 1NJZA 3GFKB 3ZDBA 4FJHA 1SL1A 3PO5A 4Z0UA 1XI1A 5J2BA 4ECYA 2G8FA 3O3FA 5KFOA 1ZQHA 2PFNA 5DQHA 1I39A 4CJWA 4DTXA 1IO2A 2H5XA 7ICEA 1LWEA 1JMSA 5J2JA 2ATLA 4J9PA 2F8SA 9ICXA 1GOCA 4FM1A 4N41A 1UOCA 3HWTA 4DL3A 4DOBA 3HP6A 4O55A 2Q0ZX 4RQ2A 9ICOA 1BISA 2FLLA 5KFAA 1HJPA 7ICNA 4UB2A 4F5PA 3DRSA 4RW9A 4C8MA 2HW3A 4M04A 4EEYA 3SCXA 2UVRA 4ED0A 3CM5A 3M8RA 1ZQPA 3U3GA 5L1KA 4ED8A 3MXJA 1C1AA 3DLGA 2NRWA 3JPTA 1T03A 2AGOA 4KHQA 2FBYA 3TAQA 1C0MA 3CQ8A 4M3YA 4PH5A 4NCBA 3SI8A 1Y97A 5KFRA 4H4OA 4B9TA 3C6TA 1R0AA 9ICBA 4JS4A 2IC3A 4E0DA 8ICEA 1D9DA 1TL1A 3CFRA 3U6FA 4BE2A 4YFUA 1COOA 1GOBA 4Q45A 2VG6A 4UAWA 2B21A 4EP4A 1XSLA 3SPYA 3VQ7A 3I8DA 3AVJA 3QINA 2VA2A 3VA0A 3QNOA 2IAJA 4ECUA 1RT4A 1U47A 2BQ3A 1NOYA 4M0AA 3NGDA 4GC6A 1NKBA 3HT3A 3DLKA 1TVRA 1KDHA 1RBSA 2YKMA 3AO2A 1UAXA 5KFQA 1ZQQA 4QOZB 4RPZA 4CK2A 4KITB 4OKKA 3ZSWA 2ETJA 4M9LA 1RPLA 1MSWD 3BQTA 4BDPA 2E6MA 1RDBA 3GIMA 3GILA 4K8XA 4IG3A 5KFMA 2NUBA 4CHQA 4F50A 4Z6DA 4KLGA 4FLUA 9ICTA 1QQCA 1K6YA 3C21A 1CXQA 1EETA 1IM4A 4I2FA 4I28A 3OYMA 7ICUA 8ICIA 3QEPA 5FRNA 1EKEA 4KI4A 3MABA 4DQSA 5KGWA 5DG9A 2PY5A 2VA3A 5JS1A 3KLEA 4F4KA 3TABA 4Z6CA 4BXOA 4YFKA 4DSEA 3MR6A 4FK2A 4DTOA 3GDXA 4QWEA 2ZJ8A 4I27A 4K4HA 3SV3A 1RTHA 4NCGA 1HUZA 4YR0A 4O5BA 4GXKA 1ZBUA 3IHQB 3KK2A 1GOAA 1HQUA 4LD0A 1CXUA 5BPCA 5J2PA 3JYTA 1KVCA 2KN7A 3RR8A 2NRZA 4FW2A 1ZBFA 3AVKA 4DFPA 5KG0A 1ITGA 4AHSA 3AA2A 2PI5A 2X78A 3OYFA 4PQUA 4LZGA 1BQNA 3RJEA 3GQCA 3C95A 3AVCA 1VSIA 4KHUA 4M6WB 4QZCA 4CJKA 4KTQA 4J2AA 3H8JA 5HMLA 4RW6A 1VSDA 4CFCA 1VRUA 4CESA 3ZSZA 3SUNA 2PZSA 4DL7A 2P5OA 1YVUA 2G8WA 4B3OA 2C2DA 2R8JA 4MFCA 2XGPA 1S10A 1D8LA 4DU4A 3BQ1A 5CWRA 3L8BA 4CJUA 4CJSA 4UAYA 4DL2A 3OYKA 1JX4A 1JN3A 4DWIA 4HCBA 2BPFA 1W0HA 2IGIA 3MECA 4KB1A 3SQ4A 4ED3A 5CY4A 2R7YA 2BCQA 4UB1A 4CHZA 3NF7A 3CG7A 4HVJA 3LWLA 3U3YA 4FJMA 4CEQA 4HCCA 4EZ9A 3RBEA 1PZNA 3LAMA 4PHEA 1XSNA 4ID5A 3PO4A 9ICJA 3BQ0A 3MR3A 3OY9A 1DOQA 2NRTA 5KT7A 7ICRA 2O4GA 3ZT0A 3V9SA 3P1GA 2GWSA 2HHVA 4DFMA 4IBNA 3RH4A 1K1QA 7ICPA 1JKHA 7ICQA 5CZ1A 4CEOA 1RNHA 3DLEA 1WSFA 3RJJA 4JV2A 3G10A 4YR2A 9ICPA 3C1ZA 3OYLA 4CE9A 4FJ5A 4NCAA 3NF8A 2YKNA 2BANA 4NM1A 5DQGA 3HX0A 4F2SA 2P66A 3ZSYA 4YD1A 1ZQFA 4O3QA 3LANA 3LP3A 2RDIA 2FMPA 1KTQA 4CJ5A 1ZQSA 1ZQVA 4ED6A 4CF8A 4YMNA 1SL0A 2Q3SA 4IQUA 2FBVA 7ICVA 1TV6A 3B0YA 1QE1A 8ICFA 4E7LA 4J9NA 3Q8MA 4RNNA 1QSSA 1HPZA 1CUKA 4KLEA 2QXFA 1CEZA 3FYHA 2R8HA 3LPUA 1Z3EB 4C8LA 3AV9A 2ZTEA 5HRPA 3OYJA 1Z25A 3K5LA 4DSJA 5J0RA 5E41A 4F5RA 4N5SA 1BI4B 3OHAA 1C1BA 3UPQA 4ECSA 3PNCA 1RBUA 3ZSOA 4KHSA 4ED2A 4P4PA 3KHHA 4C8OA 5DK5A 4DTMA 5BOMA 5DB9A 2W9BA 4B8CA 4ECWA 1RDCA 4KN7A 4Z6FA 7ICHA 3VQAA 4B08A 3RB4A 3NF9A 1HYSA 2HNDA 4CGGA 4DEZA 2UVWA 4P4OA 4CGFA 3C2LA 3KHLA 3QNNA 1RT2A 3AO1A 4IR9A 2ZTDA 2D0BA 2A1JB 4RQ7A 1ZQWA 3OYAA 2Z1GA 3NGIA 4FXDA 2V4QA 4FZYA 4ZTJA 4FK4A 3OVNA 3LAKA 3NH0A 5KG2A 3PW0A 2W9AA 3D0PA 4CHOA 1L3VA 9ICIA 3MBYA 4CJ3A 5I42A 4HUGA 5KFFA 2BGGA 3M8QA 1RT5A 4FO6A 1TAUA 4CEAA 1S0OA 1C1CA 1ZQJA 1NK5A 4TSXA 4KHYA 3H4BA 4OJRA 4CK3A 3AUOA 1ZYQA 4DSLA 1J53A 4CGJA 2IDOA 5KFKA 1QTMA 4F3OA 3ULDA 4KHWA 4N76A 4OPKA 3A2FA 4LH5A 3C5FA 2HVHA 4KN4A 4CJVA 3HPOA 5DG7A 1C0TA 2IHNA 3JPNA 2PI4A 3K5OA 1ZQLA 4G1QA 9ICHA 2XY7A 3V1RA 5KFTA 1X2IA 2BR0A 1RTIA 1BIUA 1A77A 1SUQA 4QZ8A 4E7HA 1XWLA 2ZTCA 3PY8A 3AO4A 2J6TA 1WAJA 8ICJA 4F92B 4QZEA 4QZDA 1L3TA 4CJPA 4O3RA 2FPMA 4AHRA 3RMDA 3MXIA 5IINA 2P6RA 3VN5A 4L8RB 8ICUA 4YD2A 1WSJA 3H8WA 1BPDA 1SV5A 5JUMA 4KLDA 5DKWA 4CHNA 5J0XA 5KG5A 4DL6A 4F4WA 4DQRA 4DU1A 4Z4FA 1IG9A 3PVXA 1MQ3A 2X6SA 5CZ2A 2ZJ5A 4TUPA 3GIJA 3OYDA 4FLXA 4YMOA 3RAQA 1H38A 4RQ0A 1N6QA 4TUQA 4H4MA 4KLFA 8ICHA 4IG0A 2OZSA 2HB5A 4KKOA 1HNVA 1TL3A 4BWJA 4I2EA 4FLZA 4QAGA 3TWHA 2GUIA 5CB1A 1RBRA 3UXNA 3QIPA 3NBPA 5KTQA 4KHNA 3LP2A 3KLFA 4CFDA 4B9NA 4F8RA 2ZUCA 2BPCA 3KD5E 4FK0A 4R5PA 2W9MA 5J2MA 4FW1A 1Z26A 1I3AA 1RDDA 2YV0X 4RNMA 3IG1A 3SQ2A 3CFOA 3H7IA 5DQIA 3CM6A 3DLRA 1VSHA 2G8HA 2BCUA 4M3ZA 4QW9A 4M3UA 4YP3A 3QETA 1NK7A 4Y1DA 4FLWA 3DM2A 1D8YA 5FROA 3ZT3A 4KV8A 4M41A 3BJYA 2P6UA 2RPIA 3OJSA 3RWUA 1U4BA 2ZQBA 3V9XA 1RZTA 5HLFA 3QZ7A 4CEZA 5D4BA 3WNEA 3MEGA 4GXJA 1SL2A 1X9SA 4M42A 2JZBA 3AVAA 3K57A 4FM0A 1RTDA 3MDAA 2G8KA 3NH2A 3K2PA 3VQCA 1IKXA 3QEWA 4FJJA 1HYZA 4I7FA 4I29A 4KLQA 5DDYA 2ASDA 5CYMA 3L2QA 3QERA 2PFQA 4KLHA 2BCRA 2PYLA 2OWOA 5KFVA 3LALA 3IS9A 2UVUA 5KFEA 5C42A 4E7IA 4UAZA 2E6LA 2FPLA 3JPPA 3WNGA 2FC0A 4B9MA 1RXWA 2KFZA 2Y1IA 4I2GA 4KFBA 2FBXA 4IR1A 3KLGA 7ICKA 3UQ0A 5KFBA 8ICGA 1JLFA 3H40A 1JLBA 3MEEA 4ECQA 1RCHA 2UVVA 3QESA 3PW7A 2Y1JA 3AVFA 4OGEA 2AU0A 2GV9A 3TQ1A 3GV7B 4CK1A 4HUEA 2FMSA 3PMNA 4J9OA 3ISNC 2YNIA 2PFPA 5KFZA 4KREA 4I2AA 4ID1A 4R63A 3AA4A 4E89A 4W5NA 2JEIA 1DTQA 3DI6A 4DL5A 3DRPA 5KT3A 1ASVA 4RQ4A 2XO7A 2EX3A 5KFSA 1U9LA 1UA0A 1RT7A 3TR8A 1HQEA 5KFHA 1REVA 4OGCA 1KFDA 4Y1CA 4HHTA 2C2RA 1N48A 3PW2A 4Z4CA 2XRIA 1ZQBA 2FMQA 1BHLA 5DBCA 3M9NB 4M45A 1ZETA 5J2QA 2VA8A 4RNOA 3PX6A 3OHBA 3H8SA 2LSNA 1BVSA 1DTTA 1NKCA 1RDAA 4CF9A 3PW4A 3V9ZA 3H4DA 3NE6A 3MAQA 4UBCA 1NJYA 1IH7A 4KLTA 4UB3A 1J9AA 2D0AA 2DFHA 1TKDA 3RMAA 5FRMA 5J0WA 3HPGA 3OS0A 3ZT4A 4BACA 2JEGA 1BGXT 3QE9Y 8ICVA 3QEVA 1XC9A 9ICEA 8ICZA 3NDKA 2KZ3A 3LWMA 4FS1A 3V4IA 2XY5A 1XU4A 4RUCA 4KTWA 5J2HA 3HXMA 4FBUA 1LV5A 2BDPA 4JRPA 3Q8SB 5HRRA 3SUOA 2W42A 5KFCA 4CECA 2XGQA 4F5NA 1L3UA 4CIEA 3OS1A 3ZDAA 1S0MA 3K5NA 4LSLA 2LYHA 4FJ7A 4LZDA 3T5KA 3VQDA 1Z00B 4KLSA 2G8UA 5HRNA 2B6AA 1IKVA 1ASWA 4MEXA 3B6PA 4BE0A 1KRPA 7ICTA 5KFDA 5KFUA 1WN7A 2Z1IA 3L2UA 4RQ6A 3EYZA 3G6YA 5HMMA 4B9UA 4CJRA 2HHTA 1BPEA 3QZ8A 2FLPA 1BCMA 3MGHA 1KFSA 4JLHA 2NRVA 1QS4A 3CFPA 3HK2A 4YCXA 1LAWA 7ICIA 4ELVA 3L2WA 4FJXA 4FZXC 5DG8A 3SPZA 3HVRA 9ICNA 2BCSA 4J2BA 2XC9A 1LB2B 4FLTA 4DTJA 3EY1A 4DTPA 4TURA 4IRDA 2I9GA 3RMBA 5J2KA 1S1UA 5L1JA 1WCLA 1S1VA 1ZQOA 4PY5A 5DBAA 3AVNA 3TAGA 3O4NA 5KFXA 2KFNA 3SV4A 1S0NA 4RW8A 1SKWA 4W5TA 2ASLA 2AGQA 8ICCA 4FYDA 1X9MA 4FJ9A 1ZQGA 3O3HA 4Q5VA 2D0CA 2HNYA 3QEIA 4EYHB 3ETLA 3LZIA 2OZMA 2FLNA 3G6XA 5C25A 1S1XA 4KRFA 1S9GA 1CZ9A 4F2RA 4YQWA 1ZJMA 5DMRA 4Q0BA 2B5JA 5J1EA 1BL3A 1JXLA 1EX4A 2HHUA 2R8GA 1UT8A 5J2IA 5J2NA 2JGUA 1XSPA 2F1HA 3S3OA 4EBEA 2J6UA 3SJJA 3LP1A 3JSMA 4EBCA 4AHVA 3QEAZ 4RU9A 4CIGA 2J6SA 8ICBA 1ZBIA 1DGSA 3RB6A 4B9LA 4XRHA 3LZJA 1IKWA 1D9FA 3KKSA 2OPQA 3VQEA 2ITGA 8ICPA 8ICMA 4IKFA 4Z4HA 2O4IA 4B9SA 5CYQA 1WNSA 5D49A 4DSIA 4JWNA 2XHBA 4QWDA 4EYIB 3RBDA 4RW7A 4R64A 2JEJA 2YHBA 3RB3A 4MF2A 4RW4A 3SNNA 2RKIA 1RT3A 4JK1A 5KT2A 3AVIA 5J0PA 5K14A 2V4RA 2FPKA 1BI4A 3ORYA 1VSJA 4DFJA 9ICGA 1BPXA 3C5GA 1VSKA 4M3RA 4YG2A 2OPPA 1JXEA 3RAXA 4AHCA 4QWCA 1T4GA 2W9BB 4I2CA 1B43A 4O3NA 4IQWA 5HROA 3QIOA 5L1LA 2I5JA 4PWDA 4ELTA 1D5AA 5CHGA 2MAXA 3HM9A 8ICTA 4CEBA 4QZAA 1IKYA 4GMJB 2KTQA 3TAFA 1RYRA 1MC8A 2F1IA 5KFNA 1LWFA 1B92A 3ZCMA 1TK0A 3GV8B 2HHWA 1RILA 5IIOA 4K8ZA 4KAZA 3RJHA 3RR7A 1QSLA 3HP9A 1RT1A 4YMMA 1BPZA 1JLEA 1U04A 2P51A 4CGHA 7ICFA 2JZBB 3JPOA 3B6OA 3L3VA 2ZJAA 5JS2A 3WNFA 1VK0A 3SQ0A 2VWJA 4M6WA 4PPXA 4DLEA 1KEJA 5KG6A 3MR2A 1CZBA 5L9XA 3UQ2A 4F5OA 1TK8A 5KFIA 4O44A 5EWGA 1EXQA 3VQPA 4CERA 8ICLA 3AU6A 3V6KA 3ZSVA 5J29A 1HYVA 1JLAA 1ZQKA 2BQRA 3RH5A 4M47A 3ZT2A 4DTUA 1TGOA 4DTSA
chains in the Genus database with same CATH superfamily
3JXUA 3AVGA 5G5HA 3THWA 1QLNA 5DB7A 5KT6A 3W66A 2F3NA 2QE5A 3FE1A 3DLGB 4QIWD 2WFAA 2QMUB 2CQGA 2A6AA 3HFVA 5AZIB 3OL6A 3V4IB 2Y1RI 1SC6A 4TQSA 2WAQD 4E8UA 4CLKA 3O2IA 1QQNA 3SAHA 1CVJA 3QUTA 3AD7C 3MM8A 1T3NA 4UAUA 4B02A 1LAVA 3JSMB 1OVQA 1SV5B 5G0RB 4YHHF 2YNHA 4NLKA 2Q97A 2VPYB 3R6LB 5KAFU 5IILA 3CJ3A 3L7PA 3CCVN 1LW2A 3HPHA 4Q8EA 3THYB 4LVSA 4X62F 2D4WA 3I33A 1GQEA 4O8KA 4F25A 4JI8K 2D8CA 5KFYA 3ISDA 2W43A 2CZ4A 1PC5A 1NJXA 2JEFA 3R6MA 3GR1A 2CH6A 4H8KA 1RI7A 3ZSXA 4GKJJ 1XJWB 2RN2A 2QB1A 2FSNA 1Q82O 4QS7A 1WELA 3P6YC 4P4MA 4UQTA 3GJSB 2Z1HA 3ENBA 2H4WB 1R8BA 4ICLA 4C2MA 4DOCA 1NSAA 1KBRA 8ICSA 3TJ9A 5KI6A 4CZCA 2M9KA 1TKXA 1JUDA 2Q6BA 3TSUA 4JV0A 3O1LA 2CNKB 5C5JA 3N6MA 2FSJA 3M9MB 2I1QA 2WONB 5DDQC 1KFTA 4A8SA 4QIWC 3HKWA 2F9WA 3RJKA 3WKBA 5A8RA 3A1YG 2YH0A 4QIGA 1JLGA 1S5JA 3FZFA 2KKHA 2QYCA 4GIBA 4X4NA 3T79A 1S77D 3I0RA 3J8AA 3O4QA 3EZ5A 1Z00A 2AEFA 2YHAA 5D0GA 3G0ZA 4H5RA 3CD6N 4P2FA 5ALHA 3CJKA 4FPRA 3EDRB 2ASJA 9ICCA 4NXMJ 2H3VA 1R8CA 2MZQA 3VQ5A 2C28A 3HI9A 2ZJPL 5K8NA 2WB1F 4ZIVA 2HIYA 1RT2B 3D1OA 3I5CA 3QEBZ 4FJLA 4DFKA 2WB4A 3CCMN 2Z58B 3IDWA 3D67A 4TUSA 2CUYA 1WG1A 3PUFA 2R3VA 1DXSA 3CT9A 1EP4B 4RTFD 2A1BA 1X40A 3PFEA 4FZNA 4B3TK 4J9UE 2IVFB 3DEEA 3CJQA 5AQXA 5HP4A 1NLVA 4BRLA 2P9NA 4E1NA 5L9NA 4NJ8A 3MK6A 5F9LA 2HOIA 2C3OA 1EIYB 3PJ9A 1BWEA 2WAQC 4ZPTR 1TAQA 4IFVA 3TAPA 7ICSA 1CI4A 3W2WA 4ZIWA 4NA2A 1HPMA 1B7FA 1IBLK 2FYXA 2B4PA 4DSKA 3ZSQA 3ZD9A 2R2SA 4ECRA 3QSYB 3HHLB 2HK3A 4YOYA 3CUNA 3AA9A 1RKJA 3ELHA 3OSNA 4CLPA 4H0TB 2HFSA 3KOAA 1RBTA 5BR8F 1B70B 3C2MA 4OZNA 1HMVA 4LSNA 3JPSA 1S9GB 3MWTA 1KEKA 4LFCJ 2I2YA 4RW6B 1MU2B 4RQNA 1IBMJ 2IC3B 4O3PA 2RDJA 3FM9A 4JV1A 4MIBA 1SGGA 2LKZA 4JYAJ 4GLXA 2XCPA 3TJ8A 4H0VB 2VOOA 1BCOA 2I1RA 2RF2A 3VETA 1WF0A 4FN5A 3AHPA 2DEJA 4KTZA 4O4GB 5AZJA 5KFWA 4NLPA 3LP0A 3MDFA 4DQPA 1ZQIA 1Y64A 1WSVA 2MY7A 5FLXY 5KFJA 2QKBA 5KFLA 1TVRB 2ERRA 3HJVA 1RZMA 4ID5B 1BNPA 5AK4A 3BBFA 3QDKA 3ZXWA 4ZVQB 2QARA 2BRKA 4I7FB 5AT1B 3S01A 5A8RB 3KIOA 1MROA 3HHNB 1Q86O 1FJ7A 2V63A 2F65A 3KD1E 4JS5A 5K8MA 3SIPB 5GAHI 1FRHA 4ILMA 3H5XA 4V1Ak 2PFOA 4F67A 1MW7A 4QCLA 1S1TA 2OFHX 3C23A 1T03B 4BC9A 3SMZA 2JNJA 1FJGK 4JI0K 4JRQA 1IN0A 3ALRA 5J2DA 2ZHBA 4OVLA 4FJKA 3B0XA 2QSWA 3NNHA 5DO2A 3D2EB 1RWUA 5C2CA 1UJ4A 1QAJA 3I5AA 3CJ5A 3AB4B 3DHWC 5HP1B 4UB8U 1A76A 3UNGC 3KG4A 2DT9A 3VHQA 2CJ9A 1YT3A 2CPRA 3GWCA 1TVAA 3THTA 1DTQB 1O0PA 2KDOA 4H5WA 2Z30B 2UUWA 2JMGA 4IFVB 2G07A 1ZQCA 1U24A 3P96A 2RUSA 4W5QA 3GSDA 4ZCIA 2DKZA 4DXLA 1BIZA 5CEHA 2BE9B 3SDEA 4X4RA 5LMUF 1FTCA 1JROA 3AA5X 3NOGA 2E2NA 2W11A 1FXXA 3LDNA 3EL2A 3ZSRA 4IG3B 3H45C 4FWMA 1PBAA 1BOTO 4DZDA 4KGXB 4AL5A 3RSEB 2VIXA 5AQNA 4RG8A 2NRXA 1WC4A 4M7XA 4B1VA 5D0EA 4B9QA 2QWOA 4DOAA 4KFBB 1SBRA 1CC7A 4CJLA 3BPSP 1VBYA 3VEOA 3OR1B 3Q8KA 3M6KA 5BRFA 4DLGA 3DRRB 2NLWA 1NJWA 4CHPA 4WFBL 4KB7A 5AM2A 7ICGA 3D6TB 4FLVA 3KJVA 2YMPA 2H54B 3MXMA 1S1WA 4WYBA 2WRMA 4F5QA 5AQZA 4A57A 3JAMO 4I2HA 3OXFA 3GJRB 3ISCA 3DOMB 3KDNA 2CRLA 2E1RA 4CLUA 4I9QA 4HDGA 1WCNA 5ALIA 2DD8S 4QIFA 2PC6A 1VHFA 2WVBA 2A3ZA 2VG6B 4NLVA 1D8ZA 4P2HA 4PXCA 1S9FA 2A0FB 1XQIA 1Z1VA 4AHUA 5IT9Y 4XUSA 4JK8A 2GX9A 1Q7YO 3T5LA 3NS1A 3C65A 3R6GB 3N6LA 1HKBA 3E2EA 5HRSA 2KXHA 2BOAA 1XK8A 2GO8A 3TUIC 4OLAA 3O44A 4LF4J 1O03A 2GGPA 2VDIA 3U4LA 2I7NA 2A6MA 4OHWA 2ZXHA 4BRDA 3TAEA 4FKYA 2PEHA 5A8WA 3D6MB 3GZ7A 1NOMA 4U8VA 5HHHA 3M6GA 3W61A 5ALZA 4LF7K 2QL9B 2F8HA 2E1YA 4O0JA 2MKIA 1UCNA 2KLAA 1J5EK 4JI0J 4CE6A 3K9KA 4BGDA 2IOCA 5ALOA 4K41A 3Q8RB 3A13A 4AT1B 1A9NB 3WC0A 3ZTPA 3J7YI 1IKYB 4JI7J 1ZQAA 1FJEB 3AO5A 1BUPA 4HTJA 4WE1B 3TSQA 3OQ2A 4KT0C 5CYJA 5EWFA 4MEYA 4FOEA 1VC6A 3C6UB 5KG3A 1HI1A 4NXNF 3M8YA 3TVZA 2E2OA 4YY3K 2BM0A 1WTBA 2G9OA 2EC2A 3BYPA 9ICKA 5D4OA 3WU2U 1WLJA 1S48A 4L3QA 4CZMA 4KB0A 2FC9A 3WK6A 1TUWA 5F8IA 4ILHA 5EOZA 5C25B 4LFCF 1IBMF 1RYSA 1NZAA 1NK8A 3EO3A 3RRHA 2A41A 4Q8FA 3OFGA 1IXRA 1A5VA 3PYDA 4CF2A 5C15A 2ZDPA 4RPXA 3K58A 3CCWA 2I8EA 3OYCA 5AKJA 2K8AA 2KYZA 3N7PD 4PXEA 2IVNA 3UFCX 4BWMA 4HEA9 2XCAA 4M9HA 2KZMA 2V9WA 1PILA 2L3MA 3AMZA 3FDSA 2WVEA 2XI2A 2R7VA 3L3FX 1LXNA 3NF6A 2W25A 1ZQ1C 1OQ6A 5J0UA 4F9OA 4G3IA 4FOIA 4HH0A 2E7VA 5AKIA 2DGQA 2P9SA 5IIKA 3V7JA 2WF9A 1KLNA 2NXNA 2CFXA 3S9HA 4JBCA 3K0JA 2WOMA 3AU2A 3TA0A 2AEJA 3CERA 2OFGX 2AQ4A 2JLEA 4CH0S 4PQUB 3IFRA 4MDBA 4X5VA 4WQ4A 4ATNA 4LY7A 4M5KA 4QWBA 1I94F 3RU0A 4KE5A 1W2BR 1KD1T 4MHVA 3AXKA 4M5MA 2KM8C 3ZI4A 1Q18A 4QW8A 4BE1A 4MQ3A 2KHCA 1Q9XA 3LYSA 1J54A 1K73T 2E4LA 2LQ8A 4OV6A 3C2PA 1K1SA 2W3RA 4IQVA 1SZHA 2BJ8A 2HAFA 3RRGA 3LP1B 2DGSA 2GMLA 4O4GA 5AZJB 2E5LK 3TI0A 3PZPA 2H48B 3CCTA 3NGTA 3W8GA 1T11A 1BDGA 4UQGA 3AM9A 4AP9A 2EBGA 3QX7A 4Y2AA 3MEDA 5DLFA 4JYAK 4BLGA 4YDUA 5DZ7A 1N34K 1Q8IA 4KLJA 3KFUF 3EWAA 4KJIA 2QARB 3K17A 3SMVA 2F9DA 4KC5A 2H51B 3PW5A 1A6SA 3KKAC 5T7BA 5LMUJ 2WCXA 3X1LB 3QJJA 2VIHA 4KLLA 4RW4B 3W62A 3WX8A 2JVOA 2KVCA 1RT3B 1M90O 2CQ1A 4OI4A 4AYBF 4GXIA 3IRXB 2CVEA 2KXNB 1VRQC 4NPOA 2YX4A 4HKQA 1RHRB 5DGAA 5HANA 2DTUA 4K4WA 1U1NA 1ZD5A 1Q81O 5AI5A 3OR1A 4CRXA 1ACMB 1MNEA 3LDQA 4ZN1A 1F21A 3W0LA 5ETSA 7ICJA 4LSNB 3M30B 2P5GA 5BRHA 3I28A 1YBAA 1F5SA 2KD1A 1JLCA 5CJ7A 1OH6A 4HT5A 2DIUA 1VQ7S 3PR5B 3H8YA 2LEAA 4OCZA 3UKUA 3DYAA 3VPZA 3A0BU 1XHXA 2FVSA 2CWKA 1O1WA 4GKJK 1FRMA 2W6LA 2ZXIA 1MMNA 4KAIA 4NRTA 5AQYA 4FWRA 5IM0B 2X74A 1NJZA 1SL1A 3SBMA 2VJUA 4ECYA 3CDWA 5KFOA 5EX5A 1MA9B 2H5XA 1UPMB 1JMSA 5B5EU 4DR2K 2IRYA 1VQ8S 5IT9O 3M1YA 4G1IA 4FM1A 3U1LA 1RB0A 4ILJA 3D2WA 1UOCA 3HWTA 4DOBA 3HP6A 1ZC6A 2YWWA 3TW0A 2A40A 1U2FA 1P90A 1BISA 3MWPA 2FLLA 5KFAA 3OW2R 3QUQA 2P9KA 2F2AB 3DRSA 3W3SA 4C8MA 1T0TV 3JAMY 2HW3A 4JI0F 4LFBJ 3VEWA 1NGJA 1ZQPA 4CTAA 1C1AA 3H1QA 3JPTA 1T03A 2AGOA 4M3YA 2HFNA 4PH5A 2RUGA 3ZO7A 3C6TA 1R0AA 4ED5A 4TU9A 1UTAA 2HQDA 4E0DA 3W8PA 4C48A 4BE2A 3QGHA 3U6FA 4YFUA 1ZBSA 2JDJA 3TADA 3C14B 2IRUA 2VG6A 4EI2A 4JN4A 2B21A 2R7QA 2CN1A 5KNIA 4ED4A 3MPWA 4O5FA 3CQXA 3UE5A 2YX7A 1RT4A 1GTHA 5J2PB 5KQ8A 3CJ4A 4GC6A 1AYEA 1NHKL 3EE3A 1KDHA 1RBSA 3MM7A 5KFQA 1WUUA 3FBBA 5ALUA 1T44A 3CPEA 4CK2A 3OL8A 4P2MA 4OKKA 1YHQS 3E0FA 1F6TA 2ETJA 1RPLA 4OI0A 1EWQA 1YAGA 2OELA 3WIUA 5B66U 5FLXO 1RDBA 1L7PA 4IG3A 3RYLA 3DRYA 4Z6DA 9ICTA 1K6YA 5DM6L 1XMOF 1IM4A 3PSPA 3OYMA 3KDOA 5AKLA 2KT2A 2VL1A 2DXFA 3V6DB 2MZ1A 1V9OA 3D3BJ 2E9RX 3QEPA 5FRNA 3WDOA 5D0RA 3UDLA 2PEBA 1IR1A 2GMJA 2B9XA 4ZCKA 5KGWA 1HPZB 3D1HA 1WKLA 2ZBPA 2VA3A 3EGVA 3KLEA 4Z6CA 2PDAA 3UKUB 4BXOA 4M5IA 1PG5B 3BP8A 4FK2A 2BZFA 2FTRA 1TL7A 1AZSA 4NCGA 1Q95G 2CJBA 1GH8A 1FNMA 1LCUA 2HBJA 2GA7A 1GOAA 1FEZA 4JEPA 1HHTP 2VD3A 4BROA 2KN7A 3RR8A 4WU3A 2ADCA 2I0XA 3SEOA 1HLWA 3AA2A 3R9KA 4PQUA 5BR8J 3H7HB 3MR7A 3GQCA 3C95A 3ZZTA 3IP4B 3IBPA 1YX2A 1RHQB 3CCJS 2PMZF 4CJKA 4CO3A 2DH8A 3H8JA 2F1FA 4H03B 1KQSM 3JAMU 2J7WA 1H72C 1TUUA 1VQ9S 4KHPJ 2UXCF 1QAIA 2EI5A 3LGMA 4XPCA 2BABA 3BQ1A 4CJUA 1NGCA 2IA0A 4CJSA 1QHAA 3KLFB 1UW4A 2Y3YA 2V68A 1RG6A 1TV6B 1JX4A 1JN3A 1KQQA 4DWIA 4HCBA 2BPFA 1VQ8N 5KOXA 2KSOB 3DU5A 2BCQA 3D6JA 3CG7A 1Y5IB 4FJMA 1YTYA 9ICJA 4ZOHC 1U1QA 2VF3A 3NGRA 7ICRA 1S57A 1VQKS 4DU8A 3QFPA 2HHVA 2CKWA 2G1HA 3JQMA 1I51B 2B0CA 2HRTA 4DFMA 3IMQJ 1FIQA 4X4TA 2P9UA 4NMXA 4DQ8A 2V2QA 3M5RA 4DV6J 2E66A 1XMQK 4KHRA 1WSFA 5H2FU 3ENQA 3DLKB 3M2VB 5A8KB 3C1ZA 1BWVA 2E29A 4QS9A 2ODGA 4NWIA 4NCAA 3FLCO 5JVHL 3NF8A 1P1LA 4CIOA 4TLQA 2O1PA 4F2SA 1HBNA 2NNWA 1I94K 4NZ6A 1FO4A 1X6JA 3CD6S 2EKYA 2G06A 3MHYA 1NSQA 4F04B 1TR0A 9RUBA 2FY1A 3FFKB 1ZQVA 4ED6A 3B54A 1YLXA 3KUHA 4LF1A 2Q3SA 1SH0A 3DWLA 1QE1A 3FMWA 4F36A 4E7LA 3FBFA 4J9NA 3Q8MA 1MG7A 3BEXA 4QOTA 1HPZA 1T9WA 4WQ5A 1VDHA 3HX9A 4WFNL 3FZ2A 1T3OA 1CEZA 3FYHA 2HWTA 2VJVA 3CRXA 4C8LA 4ER8A 5HRPA 5J0RA 5E41A 1K8KB 1V3SA 2HAIA 3UPQA 2F5GA 4A48A 2IJNA 3NMUA 3QFHA 3PNCA 1QVFM 4KHSA 4ED2A 4WYWA 4LF6F 3ZX3A 1KXPA 5DK5A 2V4JB 3ONNA 2P2CB 4PWWA 2W9BA 4XPEA 1SV4A 3HSCA 4KHPK 3RB4A 1PGZA 3G71N 2XULA 3HOTA 4X4OA 3C2LA 3QNNA 2QC3A 1AUDA 3VF0B 3QU4A 1WKJA 1H1VA 3AAPA 5ALEA 2ZF5O 2A1JB 3ZETA 5LSRA 2V67A 2Z1GA 1KVJA 2V4QA 4YY3F 4FZYA 1Q1KA 2XMTA 2AIRB 4FK4A 4W92B 1RQ0A 5GAGU 4BRCA 3NH0A 4JKFA 3FJ2A 4YORA 3C19A 5BYSA 1N5WA 4IS7A 4CHOA 2BW2A 1L3VA 3HKZD 3J7YU 3IWNC 1Q8KA 4FO6A 4CEAA 4OZ3A 1WBBA 5FPNA 2IM0A 3TTDA 1C1CA 2H3QA 2OO4A 2AZ1A 2ZJPQ 1NK5A 5F8MA 3H4BA 3MPYA 4P0PB 4V19S 3W63A 5BPNA 1HNWF 4DSLA 1WF2A 2DR5A 5F8NA 1QTMA 3BKFA 2LYBA 5K4LA 3ULDA 2YMQA 3ILLA 2AJ2A 4LH5A 3WKEA 3C5FA 4DB3A 3HPOA 1SWVA 4NMLA 3JPNA 3MUMP 2YKPA 2V94A 2YI1A 3VAFA 4QIWF 4LIRA 2BANB 3QFWA 1EAYC 1RTIA 1BIUA 1SUQA 5BREA 4E7HA 1XWLA 1PYTA 2JLGA 2IOFK 1NGAA 2J6TA 3M1VA 1WAJA 8ICJA 2EFNA 2WW4A 2XMMA 5EN1A 2JRSA 1YI2S 1EQYA 3Q8VA 4O3RA 5AQWA 2OD4A 4NCGB 2WBNA 4L8RB 8ICUA 1NO8A 1MWMA 2MHEA 1WSJA 2O8FB 4XAKA 1RT4B 4FP9A 3ATUA 1SV5A 5JUMA 2BA9A 5J0XA 5KG5A 4X64J 3NP5A 4CO1A 1XEZA 3BYRA 4NXNJ 5CABA 3M8PB 2BJ7A 3PKMA 3MMJA 2K60A 1IG9A 2PMZC 1FJGJ 2CZVC 4WZQA 1YRXA 3KG1A 3M4XA 3R5CA 2J8AA 3A12A 4TUPA 4L72B 4FLXA 4XO0A 4YOTA 1XC3A 2CQ4A 1S1VB 4XDCA 5CYMB 1HW8A 1RJJA 5GIPA 4P71A 1MROB 1FHTA 3TWHA 4KHPF 1FE0A 2FSKA 5CB1A 2RS2A 1RBRA 5KTQA 3LP2A 2P9PA 1N34F 2BVZA 5JXSA 2ZUCA 5L1MA 2NYIA 1UWBB 2W3SA 3SFUA 4OZ0A 2D6FC 4DR5K 4RQMA 3SQ2A 3IFEA 3QGIA 2NRRA 4OX7A 5DQIA 3BZQA 4DV3F 3PRVA 3D2EA 3DLRA 1TL7B 2R9LA 4OHYA 1X9JA 2G8HA 2HSEB 4QW9A 1OH7A 1FRIA 2CGJA 4C4RA 2V6AA 5ETPA 2RPIA 3D2QA 4OZ5A 1U4BA 2ZQBA 2OTLN 5AQVA 3QZ7A 2X51A 1H2TZ 1VQYA 3SQOP 3AQPA 4KX5A 4Y6IA 4DV0J 1SJ4P 3NAIA 3WNEA 2YWKA 3DXKB 2FF3B 2ZJQL 4ZPCA 1DARA 1ECWA 3M2VA 4OLPA 4FYXB 3CC2N 2JZBA 1AA1B 3MDAA 5DM6Q 3K2PA 3F53A 1F5AA 1HNXK 3QEWA 3ZZRA 2EC0A 4I7FA 5IOLA 4I29A 4F0HA 2VPWB 5AI6A 4BVPA 5LY3A 2BOPA 2NYVA 1K9MT 2BV3A 4KLHA 4KKOB 2OWOA 1APSA 3LALA 3IS9A 1U2VB 5KFEA 4E7IA 3BZCA 3F0NA 2F40A 4B9MA 2KFZA 3N9UC 4KFBA 4WP9A 4DHVA 8ICGA 2KRRA 1JLBA 4ECQA 2R2RA 4EELA 5ALKA 2DGWA 1NNLA 4ZCLA 1RCHA 3SAFA 2UVVA 3PW7A 3OFFA 1Y7PA 2DVIA 2E8NA 3H2UB 1X0PA 3GV7B 2VKRA 4CK1A 4OYAA 1ZM9A 4HUEA 2FI1A 3PMNA 4J9OA 3ISNC 1WWVA 3OUYB 4UUXA 4KREA 4DR7F 4ZP8A 4R63A 1DGKN 1DTQA 3DI6A 4CM2A 2A42A 4KR0B 1ASVA 2MQLA 4RQ4A 4LF6J 4BRGA 2EX3A 4X65J 3T1YF 2E9TA 1UA0A 5HAOA 2ZKTA 2CJKA 1REVA 2MKCA 3KLHB 1NM2A 1RHMB 4ID8A 4Y1CA 2C2RA 4ZLJA 2Q1NA 1N48A 4M63C 3Q8UA 2Y9HA 4Z4CA 2DPNA 3O9RA 4P7TA 1XMQJ 3M9NB 1QZ5A 4TU8A 3PX6A 3R8EA 3H8SA 3C15B 1M5KC 2LSNA 3WXKA 1NKCA 4CF9A 2E1EA 3PSFA 3V9ZA 3NE6A 5JLFA 2RF2B 2C3MA 1KNZA 3JSRA 2B43A 2HS3A 2DFHA 3WUHA 3V81B 1TKDA 1VQ4S 2JEGA 3LL3A 2AA4A 2ZKUA 3QE9Y 8ICVA 3T9NA 2DNGA 3JS9A 2E44A 4BVOA 2O6KA 1ZAVA 3H3OB 2IIHA 4RUCA 3VGLA 5J2HA 3HXMA 4FBUA 5BN8A 4EIAA 1Q53A 4NL9A 3PIOL 4DV0K 5LMNJ 4JRPA 3Q8SB 3P5TL 3PLAA 4ANDA 5AQIA 4F5NA 1C1BB 2VHGA 4BG9A 3UR0A 4PABA 3DV9A 2MXYA 3G6EN 2JZ5A 4WIIA 3E66A 4LFBF 3T5KA 2BM1A 3VQDA 3O9SA 1PVQA 5ETTA 4QPXA 5HRNA 2KNJA 3ZYYX 4MEXA 4BE0A 2B3TB 4NOHA 5KFDA 3I55S 4PG4A 5AR0A 2OEMA 3VEZA 3G6YA 1FCAA 3KLVA 2OTLS 1N36K 4CJRA 2OTJN 3QZ8A 1D3WA 3IS9B 3ISZA 1VBZA 2DHAA 4DV5F 3LDLA 2JL9A 3D2SA 2RU3A 2NRVA 1HL6A 3QAEA 4FJXA 3HTVA 3L2WA 1HBMB 4QNLA 4RJVA 2Q43A 3D1QA 3SPZA 5ALXA 3MURP 4W90B 4MDAA 5D8HB 9ICNA 3QJPA 2XC9A 1RAJA 4FYVB 4DTJA 4FYYB 4TURA 3N4QA 3MOJB 3VALA 1RP5A 1X5OA 1HHSA 3RMBA 2MRLA 5AQFA 2RNEA 1UVIA 1GLCG 3N0VA 4PY5A 2DR8A 3SCLE 3TAGA 2D69A 2F8MA 2BJ1A 3CJ8A 1SKWA 5E3CA 4U95A 2AGQA 1T9YA 1DQAA 2DNRA 4ISEA 4JV5J 4FYDA 2DNHA 1GX5A 2YQ0A 1XMOJ 5F0WA 1RWNB 3A5LC 1KL9A 4EENA 1REVB 3QEIA 3LZIA 2OZMA 1VDVA 5IS2A 5C25A 4OI3A 4AXIA 1VK3A 1ZTWA 4DV3J 2M0NA 4Q0BA 1F3FA 2B5JA 4LR7A 1JXLA 3M6XA 1U02A 2IOFA 2LU2A 4WQ4C 1XSPA 1SWWA 2ZOGA 3VWSA 1CLFA 3LP1A 3FBEA 2GIFA 4QIEA 4RU9A 5IQ6A 2QFJA 1NZPA 4BRNA 2HBKA 2UUBJ 3RUBL 3TPQA 2O8CB 3GCXP 2OLWA 4C4TA 3CDEA 2O5DA 2JFKA 2YWEA 4Z4HA 1LQ9A 3QLHB 1Q7YT 4B9SA 2O4IA 5CCLA 1FX4A 2ZNYA 2XHBA 4B1UB 3OLAA 4EU0A 2V8VA 3GFZA 4R64A 2YH1A 3W60A 4K42A 5AHXA 4DPYA 4CI0B 1KDNA 4RW4A 3SNNA 2RKIA 3OW2M 2P8IA 1RT3A 5CZXA 3VCDA 2AYEA 2V4RA 2YTCA 4DFJA 1R27B 3OD2A 4HH1A 3G9CA 5AQMA 2LQ5A 3D0GE 4WCEL 2YWFA 3HBTA 3M7DA 2MSSA 1VGYA 3CCQN 4J37A 2PMZD 2OSRA 2VG5B 1IKVB 2ZUAA 1JLBB 5HROA 4LF8F 4DR2J 3UDVA 4NX9A 5BYQA 1S1XB 5E3QA 4ZVPB 3FQLA 1D0EA 4PWDA 1IR0A 4HHHA 5AXNA 5MLCQ 4I1TA 2M5YA 2VYPA 1HR0F 4GFJA 8ICTA 1IKYA 5AQKA 2KTQA 5LJVA 1QVGR 2KVIA 1MC8A 4ZPDA 1RAHB 2DRAA 4ZP6A 4CLZA 1ZOLA 1RTHB 1ICEB 6FDRA 1B92A 4PKGA 3VTHA 2V7ZA 2GWKA 2V52B 1WEYA 4DR7J 2HHWA 1RILA 5AQOA 4XEIA 3A8YA 3FZHA 3QWPA 1W25A 4KAZA 1QSLA 2APOA 2OH2A 4K5SA 3CIPA 1OH5A 2DNLA 1BPZA 2P51A 3BQ7A 1C0FA 4CGHA 2JZBB 2HQFA 3CD5A 4Z2XA 1GAOA 1FXDA 3GJTB 2Y0SD 4M6WA 2LXFA 5AKGA 4PPXA 4DLEA 1S6UA 2DCLA 2DNMA 4NYOA 5E26A 1S5LU 2W55A 3F9MA 1BUXA 4TY9A 3M6WA 2EAPA 4LMZA 2GX8A 4CERA 4MKBA 8ICLA 4RW8B 3J7A1 3H20A 3Q7BA 1JLAA 2KFYA 2G5IB 5KPTA 5U47A 4DTUA 2B9EA 2HLUA 1C2PA 3AVMA 2NXCA 1WORA 4MTPA 3HDSA 1HARA 4YEAA 3RMCA 2AT1B 3V81A 4JI5J 5J0SA 1ZJNA 3GIIA 5BN9A 4A47A 2XHCA 5BPMA 2A1RA 5KG7A 3AT1B 1RBVA 1T9TA 1RWMB 1JXVA 3TAMA 1S6PB 1X1PA 1U1RA 2ZNZA 3CHWA 2CZ9A 1IJFB 2GVZB 3ZTRA 2DNQA 3CCES 2E7XA 2ZC3A 3S3NA 2DHHA 3RG6A 4DG1B 5B0DA 4KLIA 2DK2A 4FZZA 4OX9F 3QRRA 4CBWA 3RRKA 2K3IA 3L2VA 1N52B 2A6OA 3FEZA 3SZ2A 3PIPQ 4O0IA 2KQ2A 2W2NP 4RUAA 3RJMB 1FEHA 4I2IA 2PYJA 1V3ZA 1FVSA 1N2XA 2BGWA 2BUPA 2A2CA 1S7HA 1RTJB 4EEKA 1WSGA 1DKGD 2YNGB 4DV4K 4LF6K 3MM6B 3M32A 4PHTX 1TK5A 1QM9A 1TFWA 5F8LA 4QU6A 4C4SA 4WK3A 2KXFA 4M5DA 3AEVA 2J9DE 1T3VA 2GBZA 4FDFA 1M5OC 1DFDA 3OPKA 4YNQA 4ZP7A 5ALGA 5IIMA 3DDHA 1HR0K 4M9NA 4QQBA 1T94A 4FPBA 4J9MA 8ICXA 1WSHA 2N4CA 2K8CB 3IGNA 1KVBA 4P2SA 2LDYA 3Q8LA 5AKYA 3O5TB 3MFIA 4DR7K 4LBHA 1UCVA 2ASYA 2NRHA 5HBMA 3CCVS 4RKUC 3W9JA 4JK9A 2PIIA 2K8GA 4ACOA 3TQEA 1DJ0A 2AMCB 3AOBA 3THXA 3DMJA 2OMOA 3WIVA 3DAWA 4WYLA 3FQKA 3DLHA 3OUYA 4O3SA 5LJ3Y 1V5IB 3T1HF 3NFAA 4K4XA 3ZT1A 4PUOA 5DJBA 4A8WA 1S79A 2ZZNA 1ZQTA 1J2MA 4OYXA 2C2NA 4E19A 2CPYA 2ZWOA 2QO3A 1FFWB 4IO9L 4MN4C 4LF4F 5AK5A 2V8DA 3QT6A 2RQKA 3J81j 1TYQA 1ESVA 1OPIA 4Q0BB 1N5QA 4KLMA 2VG7B 4IUFA 4ZH4A 2HBLA 4GMKA 2KICA 1ZQEA 1U8SA 5AKKA 2LA6A 3JPRA 4ZPBA 2AYBA 1Q86T 4QJVA 4YOVA 4AYBD 5AQJA 4OLBA 2HDOA 4IH7A 3L3UA 3RH6A 4JI2K 5I9EB 4PGXA 1VIXA 4XQ8A 5SWMA 2IBOA 4X64F 4OHVA 1HNZJ 1V4SA 3MEKA 1IVZA 5J1NA 1BLUA 2O8CA 5ALNA 5ETQA 5E7OB 4DCCA 5A6WA 4DDFA 1FJGF 8ICRA 1J5OB 3KLEB 3PCOB 1EXNA 3SQIA 3QLHA 3O1BA 1KQGB 3BQ2A 3E8OA 3QU7A 3JPQA 2FVRA 3K8WA 2H3IA 3CYMA 3OGUA 4ILRA 1XQSC 2YNIB 1E6VA 3OXLA 1NK9A 3SI6A 4QPTA 2DIVA 3PRDA 1U1KA 4NLXA 3BPDA 3E9LA 2HZAA 5C24A 3BM7A 4RZRA 4F71A 3SD7A 2IHR1 3KHYA 3NVYA 3NAEA 1TKTA 3ALYA 3PKYA 2KO1A 1NH7A 3HJFA 2QW9A 3DOKA 2F7TA 3H5UA 4JV5K 1G1XA 3NGSA 1XMOK 1HR0J 1B9FA 4JOUA 5HP1A 1T8EA 4AH9A 4W5OA 1Y5NB 2M4MA 2HSZA 2I9SA 2ASPA 1U26A 2OI2A 4DV3K 4HTLA 4X2BA 1T3QA 4CIFA 3IRUA 2B56A 2CPIA 3GSIA 4DR6J 2P9NB 2CJYB 5K20B 5KG1A 4B1XB 1JQGA 4HUFA 3DNCA 4RQ3A 2IA6A 4M5LA 4UB4A 3NGUA 2EFVA 5GAHP 2ALZA 3RJFA 3AFGA 3F5TA 4C0BA 1K9MO 4ZJQA 3GBTA 9ICRA 3CQYA 3THXB 4GVMA 4NLDA 3FC4A 2ZVIA 3DLLL 3R5BA 3LPEA 4CLYA 3G8SA 5CE3A 9ICFA 1SAZA 4UASA 1NI3A 1BG3A 3HHLA 4CF0A 1CJVA 4IFYA 4KMUA 3AJDA 2Q79A 1S97A 5A8KA 3S6JA 4Z4IA 2V2VA 4OKEA 3OBYA 2D3O1 1B0XA 2LQBA 4PAAA 1TL1B 3L2RA 3A0HU 4JI3F 2IDLA 3NTUA 2GQQA 3N4MB 5J0TA 1KWMA 3M2RB 4B1WB 1JK9B 4L3KA 4RR5A 3R1HA 2RDDA 2AF6A 2YNFB 2EK6A 1H7XA 1YSJA 1QSYA 3C28A 2OPSA 4RX6A 3H2VE 2AYMA 2OGUA 1JJHA 1LWCA 3FMBA 3NEKA 4LF2A 5J8YA 2RE2A 1PAUB 3LVVA 3BSAA 4X65F 3LH2S 2FZCB 2HVDA 4K2JA 3NVMA 2DPIA 1PYOB 3WXMB 9ICQA 1ZA2B 3MM5A 2MKHA 2NS1B 2F96A 4DTNA 4B6JA 4F93B 3UWTA 1F5BA 3C6AA 2KE7A 4NLNA 2E5JA 2ROPA 2J9DA 1ZZNA 2HMPA 2VBWA 4DCHA 1E6VB 2ILYA 3IAYA 4RLEA 1LWXA 2A3VA 2RKIB 1T95A 5J1PA 2KT5A 2MEWA 3QB0A 3EUB2 2HZCA 1FT8A 5ETNA 3BGRA 5CCMA 2GEMA 3T19A 2ZOMA 2RH3A 2CQ0A 2BE7D 4X4PA 2DY4A 2P1JA 3KHGA 2L48A 2FGCA 2KT3A 1RU2A 2MY8A 4NYFA 2HMIB 2W8LA 1G15A 1XERA 1XO1A 2Y0SC 2KSOA 3TARA 1VQKN 2JVRA 4C0HA 4ZVEA 4EBDA 1Y9OA 2V9KA 4PHPA 2X6NA 1Y11A 4DR1K 3TZYA 3NGKA 3UIQA 2HF4A 3SK3A 3MM9A 1OQ3A 1TMJA 4JKDA 3NNCA 2NUHA 3SLCA 1N36J 2X1AA 2HF3A 2O8FA 1RXVA 1KCFA 1M90T 5M1OA 4W5RA 4EP5A 4LJMA 2VJ4A 2Y8YA 3TWZA 2BW7A 4LF5K 2VANA 9ICWA 3ISBA 4CD3A 2KP7A 4KI6A 1COKA 1N56A 2CPHA 4CCHA 1KOOA 5HN0A 4DR5J 5CYQB 2BJDA 4WBFA 2ADBA 5J2GA 1RACB 4MFBA 4MO5A 1N8RO 3Q8PB 4FXVA 8ICAA 2ZBCA 3FFIA 5HQ8A 3Q8QB 4JB3A 3SJHA 4E3SA 1J5EF 4Z37A 3F9KA 1CJVB 4IFYB 2VBXA 1ZQMA 1YKWA 1HFEL 3V1QA 4B3RK 1WSIA 3PM9A 4PXDA 3EVMA 3FZMA 1QVFR 1JJ2R 3R7SB 1HNZF 4J9RA 2UXCK 2XTJP 4ZOSA 3OYNA 4FVCA 1U8WA 4OJGA 1SUQB 3IDHA 1N5YA 2ZIWA 3ITHA 1S0VA 2W9CA 4I0WA 2YN4A 1R8AA 1U1OA 3I9V9 3EPGA 3TEHB 3AARA 4JHDB 4GC7A 1S1UB 4UW9A 3WXJA 2WAQF 3MTKA 2KVQE 2UU9K 4DZ6A 3WC2A 4I2BA 4ISFA 4L74A 2JHEA 2RQ4A 1QTNB 4UTGA 1VQ5N 4DG1A 3H8MA 3IR5B 2L08A 4PHAA 2J9CA 1U1LA 2JWLA 1ZXIA 4DTRA 3O3GA 2J4RA 5JICA 1C7YA 3W7BA 1V85A 2YBVA 1YUWA 4MFFA 1GO3F 2LMIA 3O6QA 3N4PA 5IWAF 2YQ3A 2D0OA 3JSBA 2A10A 4M8LA 1NK4A 2OEKA 3EGZA 2B4JA 1ATRA 4IQMA 5AKZA 3HW8A 2OUGA 4YDUC 5LXYA 4BRKA 1S4EA 4QZFA 3DC2A 3THVA 3V6JA 4IL6U 2ZUDA 4NLWA 4DX7A 1VRTA 3NH1A 4CVNE 4NLGA 1WF1A 2DGUA 5JTIA 4MJKA 3KKAA 1VQON 3I4PA 1NUEA 3PR4A 5EX0A 5DBBA 1CJKA 5BJRA 4I6YA 5KRTA 3T1YK 4ELUA 3PV8A 3HRDD 3KFWX 4ECXA 3JSYA 3LPTA 2HBQB 3FGVA 5HVGA 4Q44A 2LLZA 4LF5J 2QMXA 2W1BA 2WMMA 3IRXA 2GCFA 3H5YA 3OYBA 3KK2B 2F9TA 1ZQRA 3MEGB 4UOGA 3PTWA 4IWVA 2LP4A 3DXBA 1JKHB 1D1UA 2K1RB 4DF4A 1U48A 1SXDA 4TYBA 5TZVA 3RJIA 5KL1B 2PN6A 1UZDA 2NSCA 4C8NA 5T7LB 1NWKA 5KRSA 3QUBA 1ZQYA 1Q0NA 1FWLA 2ZE2B 4DR2F 4DS4A 1H7WA 3SQ1A 3AA3A 3RF9A 3SSQA 4JKEA 3TSPA 2UXBK 2EW9A 2ISPA 3KWIA 4CZHA 3GG1A 3IKMA 2L9WA 3GV5B 4J9VA 4KGZB 2LMRA 2UXCJ 1X4AA 2YNFA 3C3LA 5TKYA 1GLDG 5ALLA 2XMVA 4IQTA 4M63A 3QAUA 2VWKA 2YXLA 1ZQZA 4TQRA 2YX8A 4FSVA 3G87A 1Q81T 4NA1A 4Q2LA 4NRUA 1FE4A 4NL5A 4JUZA 3MPDA 3OL9A 1WOPA 4B8AB 3O4WA 3FGUA 5AIBA 4IEIA 1KOHA 5CZVA 4QZGA 1WEZA 3CJBA 1NU0A 3CJRA 1F5CA 4EZ6A 5A2QU 2NLXA 1NNEA 3IR6B 4FO0A 1I5OB 3OSPA 1JL2A 2Z1JA 3ULHA 3J80O 3MMCB 2R7TA 3ZZPA 2BMBA 1Q8BA 1Y00A 5DS7A 1PYSB 4PA1A 5J0QA 2QLFB 1HNWK 2WB1D 1A5WA 5KFPA 4K4TA 2ZOFA 4K4IA 3TUJC 1HUOA 2ZITA 1EARA 2W7OA 4IH6A 2KIWA 2WSEC 9ICUA 2KHQA 2W2OP 3CWJA 3F2BA 3KK1B 1ZQDA 2E8MA 2YTUA 3QSIA 4RQ5A 8ICKA 4DV4J 2KG0A 4UF4A 4CZEA 4HLBA 4CNZA 1HD0A 2BQUA 1V9PA 3L0QA 2BH1A 3G71S 4RQ1A 4M2YA 2WW8A 4YHHJ 1WEXA 5AIAA 4FJHA 1FD2A 4M5NA 3K9JA 1IM6A 1XI1A 2KKPA 4LF4K 2HEKA 3CF5Q 1VLYA 2CQHA 3H25A 1IO2A 4OPHA 1LWEA 5J2JA 5F3TA 4DR5F 2F8SA 2UP1A 5LL6d 1X9XA 3PYEA 4CF4A 4IG0B 4LF7J 2QL5B 4Q2MA 4O55A 2G5HB 4YDDB 4Q7AA 3QU9A 1J5EJ 4BR0A 1GLJO 4L73A 4F5PA 5AXMA 1HKCA 5D77A 4CO4A 2DKOB 1FFGB 3CM5A 3RW6A 1MMLA 3U3GA 2Q4TA 1SJRA 5L1KA 3T9ZA 1DURA 2C2KB 1RDWX 3MXJA 3DLGA 3CNHA 3ZNUA 3MAAA 1I3OB 3OFEA 4MKAA 1U0HB 3DU6A 9ICBA 4JS4A 4H5TA 4YOWA 2ZIVA 1TL1A 3CFRA 1Z1ZA 1COOA 1GOBA 4Q45A 3OHRA 4LREA 4UAWA 4LQ9A 3D2NA 3UPFA 5ALJA 5GMEA 4DV2J 2HFZA 4YY3J 2CQDA 3QINA 3QNOA 2Y0SF 2IAJA 4ECUA 3PDNA 1N5VA 4GV9A 1WG8A 1M5PC 1B3TA 4JI2J 3NGDA 2JJ4D 3CJAA 1YJTA 5E3AA 2JWNA 2XYHB 3LA0A 3HT3A 1HNZK 1TVRA 5IV4A 4OJ3A 5E33A 3ISND 2R7RA 3CMES 2XLIA 1RBAA 3ZSWA 1VRUB 4X66K 2HQIA 2XSJA 1MSWD 3CIMA 4QS8A 2WVCA 3OTBA 1EJ7L 2XNRA 4PZOA 2MJUA 4IOCL 1HNWJ 2DTJA 3GIMA 2RRAA 1LXJA 5I4MA 1XNQK 1UEKA 2FB0A 4CHQA 4F50A 4KLGA 4RW9B 2N4DA 4AYBC 2EWHA 4I2FA 2P9CA 3VAKA 1LOUA 3U9DA 7ICUA 8ICIA 2G1DA 1C0GA 4PKIA 2W2PP 2QEXN 4KI4A 1R43A 3MABA 2I5JB 4WPAA 3ULEB 5DG9A 2PY5A 4I69A 3LQVA 5ETMA 5JVHQ 4F4KA 2F4VF 1SJ1A 1ATSA 4YFKA 5ADXH 2CXYA 3MR6A 2GJ2A 3CCLN 2DO4A 4DTOA 2HIQA 4EFAC 2ZJ8A 1FA0A 1RTHA 4CZKA 4FPAA 4IOAL 1HUZA 4YR0A 4K4SA 2MQQA 4TN2A 1ZBUA 3KK2A 1OYEA 1HQUA 4JB8B 2DXEA 1CXUA 4P73A 5JVGL 2HYIB 5J2PA 3M2UA 1KVCA 4CZIA 1P8GA 2NRZA 4FW2A 2DY9A 2GO9A 1ZBFA 1VQNS 3AVKA 3CXCR 1H2UX 2UXDF 1MMDA 2HPUA 3BGOP 1VAZA 3SAGA 4ZJOA 1VSIA 2V8PA 5F3ZA 3M8WA 3HJEA 4M6WB 4QZCA 3CVKA 1F9EB 5KAIU 3K1ZA 4RW6A 1CSJA 4HDHA 1QQ6A 1UFKA 2CPFA 4DL7A 2D7SA 3TTFA 2P5OA 5HL7L 2B7BB 1Z4OA 3ZNJ1 2P35A 2C2DA 2XGPA 1BO5O 1KD1O 4WQ5C 4DU4A 4FWPA 1Q3UA 1XTZA 2Z0GA 1TFYA 3FSYA 1N34J 4JI1K 3OYKA 4TKTA 1LKYB 1RXOB 1W0HA 3MECA 4KB1A 5CY4A 5HJYA 2FVPA 2R7YA 2AX1A 1RBOB 2QA4G 2DGZA 3RBEA 1QAXA 1QUPA 1RA7A 3LAMA 4TNOA 1XSNA 4ID5A 3VR1A 3PO4A 4B3MJ 5HR6A 2UUTA 3CP8A 5BPLA 5CA5A 5KT7A 2O4GA 1AZSB 2GWSA 2NR0A 4IBNA 4JI3K 2YVSA 3GPAA 2NXUA 3VAJA 1H6KX 1IBLJ 3KUEA 1K1QA 4I2QB 4OJHA 1NMEB 4DV0F 1GMWA 1UZHA 3DLEA 4BGAA 5L8RC 4GNIA 1RWWB 4USJC 1S72S 2OD6A 2GHWA 3MCMA 1SZ2A 4CE9A 2C3PA 1RWOB 2XI9A 3A8EA 4DL0C 4ZVSB 4DR1F 4NM1A 2QKQA 5DQGA 3HX0A 2P66A 1LK5A 2RHQB 3WHIA 3DXMA 3VENA 1YG0A 2E1MC 2IJRA 2YKOA 3UD5A 4CJ5A 2ASMA 4EO6A 2KV2A 4H54A 4Y65A 4CF8A 4E98A 1K44A 1SL0A 1T9XA 4UT4A 3CC7N 4FZLA 1TV6A 3ADAC 2X1FA 3B0YA 2I7PA 1FESA 8ICFA 4UOCA 3HZGA 1QSSA 1JJCB 3TAMB 1CUKA 4RWTA 2UUCJ 5JJBA 4X4SA 2OHDA 4IO9Q 3NL0A 2LI6A 3UE2A 4DPTA 1Z3EB 3BGFA 4LF7F 3AV9A 4MK8A 3TOQA 4ETZA 2WTUA 4QYRA 2AHOB 3K5LA 2LEBA 1Z25A 3H3NO 2F4FA 7FDRA 1VQLS 4DX5A 1SJFA 4K4ZA 2RLTA 2KJ9A 3I32A 2UUAJ 4C8OA 4DTMA 2O67A 1KP6A 5BOMA 4B8CA 3G4SN 3ZLJA 4OX6A 4ECWA 1RDCA 1GMUA 3SBTA 3NWGA 3VQAA 3CMAN 2RAQA 4H0YB 2NPFA 1HYSA 5D6GA 2DR6A 2IY5B 4Y2TA 1H0HB 4DEZA 3IA0A 1WBDA 2UVWA 3M1VB 2FD2A 1V3RA 4CDGA 3QRPA 2KHVA 3DLJA 4IR9A 1SH3A 1DTTB 4Y0WA 4RBTA 1I1GA 2NV3A 3J7Z5 1N36F 4KV8B 4DV2F 3UDEA 4AXJA 4L76A 3NS5A 4ZA1A 3KMQA 4IDHA 4BX9C 3EM1A 2MGZA 1UAWA 3PW0A 4CLTA 2W9AA 4B3MK 3MBYA 2F44A 4CLFA 2Q1LA 2M8HA 3M8QA 1D09B 5GAEP 1TAUA 3ENVA 4CP5A 3L7OA 1G2EA 3QMQA 4RW7B 5DM7Q 1S0OA 1ZQJA 1WC1A 2ZVSA 3MI7X 1S12A 2DISA 2XSJB 4OJRA 1GXUA 1WC0A 2U1AA 4LF9J 1WC5A 5JMNA 1J53A 2UU9J 4CGJA 2IDOA 2OHFA 2AWZA 4F3OA 2ZIUB 4KHWA 3A2FA 1UP1A 3W2VA 2HVHA 3UKRA 5AQLA 2JH1A 5DG7A 1VYAA 3D9BA 3UD4P 4G1QA 3O8MA 4CT8A 9ICHA 4RCHA 2XY7A 3V1RA 4K7QA 3H42A 1SB6A 1X2IA 2LQJA 4QZ8A 4JI6J 2OSQA 5IT4A 1YJWN 2AZ3A 3MN5A 1BC6A 5IFMA 4F92B 4QZDA 2E1AA 4JI7F 4CJPA 2FPMA 4AHRA 2AP6A 3P3DA 5JLHA 3MXIA 2P6RA 4AD6A 2LCWA 4YD2A 3WX4A 1N54B 1Y3KA 4WFXA 1BPDA 4AL6A 4CHNA 4DL6A 2F3JA 4DU1A 1U0SA 4K0KJ 1OWXA 3DRPB 1BA0A 4Z4FA 2UXDJ 1MQ3A 1RTDB 5HR7A 5H9FJ 3GCWP 3IAM9 2NPIA 2ZJ5A 3MC1A 3GIJA 3OYDA 3VF2A 1WC3A 1H38A 3U8XA 1S22A 2EH9A 3TZZA 1N6QA 5GTHU 4TUQA 4H4MA 3VGVA 4BJQA 1ED1A 1T02A 8ICHA 4IG0A 2OZSA 5F8JA 1HNVA 2YB1A 2LYVA 4US9A 4NWBA 1VQOS 4Y2RA 2Q3PA 3ICLA 4I68A 3MX2A 2VGMA 3UXNA 2OANA 2N7YA 5JU5A 3IBWA 1HBUA 1J6ZA 3OTOK 5IC6B 3EXYA 2HHHK 2IFXA 4YB1P 5AM5A 4R5PA 3ENHA 5J2MA 1Z26A 1S8OA 1RDDA 2YV0X 3HHLC 3NVWA 3CFOA 3N28A 5D4PA 2C3UA 2BCUA 4M3UA 5EE3A 1HWIA 1R0CB 3TZXA 1NK7A 4FLWA 5KAKA 1D8YA 3VVTA 4KV8A 4M41A 2P6UA 3M3ZA 5B0CA 1HQUB 2W01A 5HLFA 2AJ4A 3R5JB 4CEZA 2BXJA 3JB9k 2N3LA 4USIA 4CYUB 4A8QA 4F26A 2GIRA 2UUBF 3BEGB 3HFZB 1ITPA 3MMVA 4CJ7A 4DKWA 2GS8A 1RCXB 3TZWA 4ZS6A 2P9LB 4M42A 1EKSA 4UOFA 5FJ4A 4FM0A 4Y00A 1E6YB 4WKRA 1I94J 2Q2RA 3J81Y 3VQCA 2EK1A 1IKXA 1LFWA 4DR1J 2H4YB 1HYZA 1F60B 1UJ5A 2R2TA 4KLQA 3GB0A 2DXDA 5FPEA 2QM1A 3L2QA 2BTFA 3QERA 1SIJA 4OIXA 2VOPA 5ETVA 4WP3A 2MZTA 3VF6A 3B9JA 2ZIUA 1SC1B 1VK8A 4Y2SA 2UVUA 2HRUA 2JFDA 1EZZB 2ZH1A 1L8OA 2GELA 3QWUA 1HBOB 3UKRB 3LP2B 4P9SA 3G25A 1GTEA 5GVQA 2YCHA 4NL9C 2BJ9A 3K7RA 1N0VC 5KFBA 2WFBA 1RWKB 1K73O 5AK3A 1VQ5S 3K2YA 2VH7A 2DJWA 1U6BA 1AB8A 3AVFA 4MO4A 4IJAA 1FW6A 2VQEJ 3TQ1A 2KMDA 4WFAQ 4PL7A 2MQNA 2KVSA 3SSSA 3GONA 2YNIA 4U67L 4BRPA 2RT3A 4I2AA 3IAS9 4ID1A 4W5NA 3H0MB 4A59A 4PG7A 4JKBA 4A8EA 4DL5A 2ZM6F 3VEVA 4HWIA 2DH9A 2XO7A 2UUAF 1YJ7A 4U7CA 3TR8A 3MM7B 5KFHA 4TY8B 1G3OA 3R3LA 4GVBA 3DOKB 4LUBA 1HYSB 4H4MB 1ZQBA 5DBCA 1ZETA 3Q22A 5J2QA 2VA8A 3OHBA 5ETKA 3MCNA 1UVJA 3AN1A 4USUA 5J1EB 1FI4A 3CGIA 1RDAA 5C12A 2IM2A 3QIPB 1OY9A 3NBPB 1N61A 4I6AA 3PW4A 3MAQA 4UBCA 1KQKA 1NJYA 1W7AA 2KYXA 5A76A 4CZLA 3B82A 4UB3A 1J9AA 4DV7K 4R5PB 2DHSA 3NMRA 5FRMA 1Z6RA 3EZWA 3HPGA 3OS0A 4WF9L 2QA1A 8ICZA 2KZ3A 3LWMA 1ZPWX 3LDPA 1XU4A 4KTWA 5EE9A 4B3SK 1FFUA 4FZMA 2Z56B 2LBOA 3B78A 3CCSS 2C2OB 2PMHA 4LF9F 4CECA 2UU9F 2ROEA 1KHVA 3MN9A 2UUCK 4CZGA 4H5VA 4OX9J 1PJ5A 5G0RA 2C42A 3K5NA 4FJ7A 1BE4A 3MWBA 8AT1B 3R9LA 1SJQA 3L09A 3J80U 3THYA 1U1PA 1F9FA 2B6AA 5B08A 4CBUA 5ETLA 5AE2A 7ICTA 5AKXA 5F0XA 1SPBP 2FJBB 2ZH7A 5KFUA 1WN7A 1AFJA 1DRGA 3HHKA 4RQ6A 3EYZA 3C6TB 5HMMA 3TVKA 4C3MA 4EUVA 4B9UA 2NZTA 2RHSB 2HHTA 1BCMA 3O6WA 4IOAQ 4RNFA 1KFSA 8ATCB 4BS2A 3FEXB 5ADXA 3LP0B 3CFPA 4M5JA 3N01A 4FL9A 7ICIA 4ELVA 4JI2F 3JQJA 3KMSA 3HVRA 4DI6A 5DDPC 4BGBA 2BCSA 4J2BA 4CF5A 2MZSA 1KVIA 2XYGB 4IRDA 4OYBA 4IOXA 5L1JA 4AQYK 1RGVA 3O9UA 3THPA 1JNZB 2HOEA 3UB5A 3IBCB 5KFXA 4PWUA 2KFNA 2RU9A 4CW7B 4PG8A 3SV4A 2XICA 1S0NA 1TTHB 4A8XA 4PRFA 2EKNA 1HNIB 8ICCA 3UMCA 2WF8A 1GXTA 3G86A 2QB0B 1X9MA 1ZQGA 2J76E 4AFFA 4Q5VA 4CD1A 1M1KO 2CQIA 3GFYA 4BR4A 4RU2A 1S1XA 3HHEA 3VQTA 5BXIA 4F0MA 1S9GA 3BS5A 5AZIA 3O0FA 4F2RA 4YQWA 1ZJMA 5DMRA 5J1EA 4DPWA 1TAMA 2E5HA 3QO9B 1JRPA 4NI2A 4KRWA 2DHXA 3T7ZA 4F7VA 1ZBTA 4LFCK 1UT8A 5J2IA 5J2NA 1U6ZA 3MMAA 3S3OA 5D0HA 3UW1A 1U2RA 4CWBA 4KQZA 5LL6Z 1WOQA 3JSMA 4EBCA 4K50A 2CGLA 4AHVA 3C16A 2J6SA 2AEMA 1NRKA 2O66A 4B3SJ 3BF4A 4XRHA 3LZJA 1D9FA 2QYGA 3VQEA 5ALRA 8ICPA 4JI1F 1NBWA 1AXQA 1ZAXA 4ES2A 3CD7A 2GJIA 2BKOA 1K8AT 5CYQA 4I6MB 1WNSA 1N32F 4JWNA 5C0YA 2D74B 1NLKL 4DX8H 4MFBB 1VQ9N 2FJWA 3KG0A 4A5BA 3RBDA 4RW7A 1NH8A 2PA3A 2W2MP 2YHBA 4MF2A 1P6TA 5A0YB 1TQLA 4DJBA 3BO2A 2ZWHA 3AVIA 5CXTA 4C8YA 2FPKA 4DUYJ 3HD2A 2YHXA 3EJMA 3G82A 2X1GA 3Q83A 2RQCA 3C5GA 1VSKA 5AE3A 1QD1A 7AT1B 4M3RA 2MJNA 1JXEA 4CF3A 1IG8A 2CDRB 2HRYA 4OFZA 1WHWA 4ENOA 3OVSA 5T7LA 3Q24A 3MX5A 1B43A 1C0TB 4G1QB 2KN4A 4P74A 4F02A 1RWVB 4YOXA 2N3OA 3ZTSA 3CCSN 2MSNA 2HNDB 3HVWA 1B7YB 2VQEF 1X4DA 3HM9A 1W97L 1X3MA 2QSFA 2F1IA 1NAQA 2XMAA 2B4UA 3ZCMA 4CLWA 2CADA 4G6VB 3NS6A 3GV8B 1F1BB 2ZDOA 5M2UA 1JALA 1WOSA 4K8ZA 3RR7A 4X84A 3JYTB 2DRBA 2ILZA 2ZM6J 2KM8B 5HI7A 3ZZOA 1RT1A 3KK3B 4DV6F 4AQYJ 1JLEA 4PPDA 1RA6A 3B6OA 3L3VA 5JS2A 1P7DA 3WNFA 5M2PA 3MGVA 3SQ0A 1S59A 3OV7A 5A0LA 2VCPA 5KG6A 3UQ2A 4F5OA 1TK8A 5KFIA 4P0PA 2DCUB 3VZHA 2M2BA 2Z2LA 3TU5A 3I4HX 2XS7A 3V6KA 3KLIB 5J29A 1TL3B 1S9EB 1HYVA 3DDNA 4J91A 1ZQKA 1VS3A 3ZT2A 4WFBQ 3POTA 4DTSA 2FPHX 2LM1A 3ICXA 3VCBA 2HNYB 3DGPA 4KLUA 2DEIA 5CQGA 2A1SA 5BR9A 4EWTA 3GMGA 1JIHA 2XEXA 3AOCA 3M8ZA 1RTIB 4ZVHA 3KYLA 2V2KA 4K4GA 2UUCF 4MT1A 1Q7LB 2DY1A 3NVZA 3QO9A 2HBMA 2XZTB 3K59A 5AQUA 2FE9A 2XBPA 3DOMA 4OZLA 1RSCA 4Y28C 2C2EA 2OAUA 4OJ5A 3Q0AA 4NLRA 4DU3A 4C7ZA 1S72N 1MN7A 2Z2MA 1T9UA 2GWJA 2CPXA 4JP8A 1GMVA 2KH9A 2PD1A 4CJTA 1UW9A 4CYUA 4EK2A 3M8PA 5LSOA 4J9LA 3HFKA 3AVLA 3IUCA 4YB7A 2V4JA 4N56A 3R5GA 3FSIA 4DV6K 1VJWA 4LH4A 2OIHA 2JC0A 4NM2A 2VFTA 3RJGA 2VODA 2OKQA 2JR5A 4I9LA 2HWHA 2ZD1B 4Y2XA 1HRHA 2QV6A 1G6BA 3ZD8A 1W9HA 4M3TA 2D3DA 2LPEA 4N77A 4RT3A 9ICSA 4P7VA 3BV8A 1G7CB 5AQQA 2GNKA 5DRKA 1AROP 1RQNA 2OYQA 2QJ3A 4QZIA 2FZGB 3KLGB 1UWBA 3DRRA 4CFAA 4HR2A 1YJ9S 4LSZB 2WHEA 2DPJA 4I56A 3IG1B 3MZIA 4GKKF 1S1WB 4QZ9A 2KW4A 4DV7J 3D6RA 5H9EK 1YQHA 2XI3A 4CH1A 2QMWA 2IRXA 1WHVA 3RW7A 2G8VA 3VA3A 2VICA 3SYZA 4LRBA 5LJWA 1YVNA 3PIPL 4WE1A 4YB5A 3V72A 5C24B 2ZBIA 1C0UA 4YS2A 4FS2A 4DSFA 3DXKA 3LDOA 2EBEA 1FNXH 1VSLA 3PXGa 2BRLA 4WFNQ 1ILYA 5HL7Q 4BR7A 3AJ1A 3LW5C 1RTJA 5L1IA 4A46A 4DUZK 4CNQA 2YNGA 3PYFA 4UZCA 4F3TA 3QNWB 1DAXA 4JI6F 4HYKA 2V8GA 3V9UA 7ICLA 4FBTA 1VBKA 3D0IE 1U2VA 2EAMA 2M52A 2J0XA 1X5SA 2GJFA 1OO0B 3S41A 2XWYA 3QYPA 2IVOA 2C22A 2AJ1A 1RDFA 4ECTA 3C16B 2G13A 2NREA 3C29A 3VAMA 1HWLA 1N63A 1VCTA 4DF8A 1MWYA 3CO9A 3QFUA 3V6HA 2HFOA 1Q5YA 1RHJB 1WDDA 3AB2B 3HZ6A 3AY0A 2MA1A 1DLOA 2UZAA 1SQFA 5AQTA 3K0SA 4WFZA 2KJ8A 4H0PA 3LVWA 4W98A 5A0YA 2RHKA 1K0VA 2XWXA 1JCFA 1SZPA 4CO5A 1SXEA 2LQ9A 3RB0A 1HI8A 1RAOA 4CFBA 1HNIA 1JNRB 1KHWA 4QU7A 3NS7B 4DQQA 4BBYA 1M1GA 3CF5L 3K89A 3PACA 3HMJG 2FHOB 1OSCA 5H1SQ 2GIQA 3C7NB 3CEDA 5I3UA 3UNYA 5IT0A