3TARA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-6) position
Total Genus 204
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
204
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
total genus 204
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tarA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tarA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tarA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tarA01
2Z1JA 3SUQA 4KHUA 1C0TA 2VA2A 4M3UA 9ICXA 4M3RA 2ZJ8A 2HHXA 1YVUA 2BQ3A 4BDZA 4DFMA 4B9NA 2IDOA 3AO3A 4O4GA 4EZ6A 1MQ3A 3PR5B 1ZQMA 3Q8SB 3NH1A 3SQ1A 3ISDA 2BCRA 5DBCA 4CHYA 4CEOA 3SUOA 4I2HA 8ICXA 1YT3A 2RN2A 3C95A 4YN4A 5CHGA 3OJSA 2QK9A 1VSDA 3TQ1A 1V9PA 4KLSA 3Q8RB 3V7LA 2P1JA 3U3YA 5F9NA 4JRQA 1S0MA 2WONA 4JWMA 8ICPA 2A1JA 4O3QA 4BDYA 2PZSA 4O0JA 4PHDA 4I2IA 1LWCA 3TR8A 5KFFA 4DF8A 4CHOA 4UAWA 2DFFA 1XSNA 5HHHA 1S1UA 3PUFA 3N97B 1N48A 1ZQNA 1ZQVA 4BXOB 4KAZA 4CK3A 1XC9A 3G0ZA 3SCXA 1T8EA 3T5LA 4RT2A 3JPTA 4LSNA 2WTFA 4M0AA 4JS5A 4K4GA 4F2SA 4ECXA 4M2YA 3NF6A 4EBEA 3DLHA 1JL1A 2ZE2A 4CIGA 4QZBA 4J9OA 4MFCA 4DMNA 4I2EA 4DSLA 4F3TA 3V9UA 2FPMA 3TFSA 4O0IA 4CJ5A 1S97A 3RRGA 2JGUA 4F4WA 1CXQA 3QO9A 3RMCA 4C8NA 4KLMA 1SKSA 1BI4A 1C0UA 4BE0A 5HRNA 2I9GA 4RPZA 4C8LA 1ZQEA 3C21A 4CF8A 3VQEA 5SWMA 3MFHA 4FO6A 4Q8EA 4GMJB 4RNNA 4DSJA 3KLHA 9ICMA 1L3TA 3AV9A 1K6YA 1B22A 2QKBA 4QZ8A 1NKEA 8ICJA 1BL3A 1NK7A 1X2IA 3OGUA 5DB8A 3NAEA 5J2CA 1UA0A 2BGGA 9ICCA 3AVAA 2XY7A 3ZDDA 2DTUA 2XHBA 1KVBA 2XY5A 7ICUA 3DLKA 1HYSA 1HQUA 2IBKA 4DTPA 2IGIA 1TV6A 1HMVA 4I2AA 1TK0A 3Q8MA 5F9LA 3ZSRA 3QETA 3C5GA 5KRTA 4JLHA 1RDAA 2B6AA 4N5SA 1RT6A 3Q8KA 4DTRA 4J2DA 4E7KA 3HX0A 4DQRA 5KT7A 1NK6A 4TQSA 4I2DA 2FBYA 3DLGA 4Z4EA 1TV9A 3O4NA 4ED8A 3OS0A 3HWTA 2OPSA 4B9LA 1NJZA 4FZYA 3MDCA 4QZGA 3UIQA 4Z4HA 3CFRA 2BHNA 3V6HA 4JV2A 1YTUA 4UB2A 4FS1A 4KREA 3RH6A 8ICQA 3OYKA 3NH0A 3NGYA 3NF9A 3UXPA 8ICIA 4KB1A 3SJJA 5C25A 4DL5A 4EP4A 3AVMA 2VG6A 5J0WA 4FJGA 5KT5A 3H7IA 2JLEA 4QW8A 1COOA 1Q9XA 9ICOA 4W5NA 4N56A 3PVXA 3SPZA 4IDKA 1HJPA 3RJJA 2W9CA 2D0CA 1UOCA 4EBDA 1GOBA 8ICWA 2GWSA 3U6FA 1ZQUA 5KFEA 4NLZA 3RAQA 3NGIA 4CF2A 1WSJA 3MR3A 4ED6A 4OJRA 3QE9Y 5KFCA 3SQ0A 4E1NA 4PH5A 1NJXA 3ETLA 1JXEA 4BE2A 1JL2A 2F1HA 1JLQA 1J54A 3G6XA 3P5JA 3Q8LA 7ICNA 1ZQWA 2P6RA 5C42A 3OYNA 2UVVA 4UB3A 4KN4A 2A1SA 2HB5A 1ZQGA 4IR9A 4NCAA 1D9FA 3C5FA 3ALYA 3NTUA 4XIUA 4CJUA 1ZBFA 4QZHA 4QZAA 1X9MA 3AO2A 8ICMA 2X6SA 3GILA 2ATQA 4KLLA 1BPXA 8ICGA 5DBAA 3THVA 2OPPA 4FLUA 2V9WA 1TFRA 4B08A 4QCLA 3IM1A 2A1JB 5DDYA 1ZBUA 4GW6A 2FLPA 4OKJA 5C5JA 4YQWA 4FS2A 3AVJA 4CF9A 2ZD1A 4RQ8A 4CHNA 3TAQA 2HVHA 3ZSYA 4E19A 3AO1A 4NLKA 4KLUA 3OYGA 4J9RA 4M6WA 3G6YA 1XSPA 2I1QA 4P4OA 2ITGA 1B9FA 7ICEA 3ASMA 3K59A 1TKTA 1A5VA 1WLJA 5KGWA 4M04A 1X1PA 4I2GA 4OLBA 3CYMA 3V81A 3QIOA 4W5TA 4HCCA 5DKWA 3TABA 2AGPA 3AVBA 3NF7A 3H4DA 8ICEA 3L2QA 4CFBA 2W9MA 3HM9A 1TKZA 4KLJA 3LDSA 4M3WA 3PR4A 1J53A 1NOYA 1A5WA 3GFKB 1BPEA 4QZIA 1WSIA 1BI4B 5KGXA 3I0SA 4JV0A 4RQ4A 1KVCA 3WNHA 4KLTA 4PHAA 4L8RB 3HO1A 3TAPA 3PX0A 1LB2B 3C2LA 5KTQA 1S1VA 4MF8A 3ORYA 3TANA 1QHTA 9ICQA 1REVA 4FJLA 4DQSA 4RZRA 1ZQYA 3ZT2A 4DQPA 4E1MA 3OSPA 4KLEA 1NK4A 2VG5A 4CJTA 2Z1IA 4KLGA 4DFKA 1RTDA 5DBBA 1U45A 1WSHA 8ICNA 3VA3A 4HUEA 4DTXA 2HMIA 3VQCA 4YXMA 3C1ZA 2OPRA 1IKWA 4CEAA 2EHGA 4B9VA 4F92B 2Y1IA 3F9KA 4R63A 1O1WA 4KITB 5KG1A 3JPSA 1RCHA 2LSNA 4O5BA 5KG0A 1RZTA 4KB0A 2R8GA 2P5GA 3L3UA 1XSLA 2X74A 3H08A 5KT2A 5KFQA 4KFBA 4B9MA 3O4QA 4DL7A 4ELTA 2AGQA 3T5JA 5KFPA 4RQ6A 4KV8A 1VRTA 1S6PA 3V7JA 4RG8A 3MXIA 4K8ZA 1ZQOA 9ICHA 4FM2A 5KT3A 1TKXA 2G8VA 2Z1HA 5J0YA 1RT5A 2VWKA 5DB9A 3D0PA 4F4KA 4UB4A 2XY6A 2MUTA 4DS4A 3KLGA 8ICOA 2KZMA 4E7IA 4NLNA 2XO7A 2OA8A 8ICBA 4TSXA 1ITGA 1XO1A 4P4MA 2JZBA 1ASWA 1VSEA 4FK2A 2GV9A 1QQCA 5J2PA 1ZQJA 4CEEA 2YNIA 3V9XA 4F8RA 1VSLA 4DSEA 1RTIA 3KK2A 2R8JA 3RJKA 3QZ7A 4PHPA 1WAFA 5JS1A 4QWDA 3JPOA 5KFXA 4NXZA 4KPYA 4X5VA 1VK0A 4QAGA 1ZQDA 3V6DA 1HUZA 4LVSA 4ZH4A 5J2FA 1HNVA 2AJQA 3MXJA 2ZTDA 4CE9A 3LPTA 1VSJA 4G1QA 4KLFA 3PV8A 2X6NA 4ID5A 5HBMA 1TVAA 1JN3A 3C1YA 4FLTA 4QZEA 4FJIA 4YCXA 1L3UA 3LALA 3OYFA 4ZTJA 5CJ7A 4KKOA 3RMAA 3MEEA 2QXFA 4J2AA 3UPQA 3H4BA 4FZZA 1XS9D 3ZT4A 1S1XA 3QESA 4CEZA 3I8DA 3AU2A 2NRWA 3H40A 3RH4A 2C28A 9ICFA 2RDJA 5CY4A 4AH9A 1EP4A 3WNEA 1JXBA 2J6TA 2J6SA 4FW1A 4W5RA 5DQHA 1RT7A 5KG4A 1RXVA 4ZHRA 3K2PA 4ICLA 5KFDA 4J9PA 4ELVA 1TAUA 1HQEA 2O4GA 4YD1A 3RBEA 3HPOA 4PY5A 5HP4A 4ECZA 3PMLA 2RF2A 2KFNA 5IIIA 3C6TA 4CGDA 3QEAZ 4CHQA 1ZETA 5K14A 4NCBA 3LZIA 4BACA 5BOMA 2E6LA 5HRPA 4PHEA 4F3OA 4FVMA 3C94A 2ZUCA 1BCMA 3O3GA 2ZTEA 5FRMA 2BCVA 3BQTA 3BGRA 4CEBA 4F5OA 4YXJA 2XRIA 3VQAA 2W8KA 3LWMA 4CJ4A 3K5NA 3RB3A 4F2RA 4DTOA 5KFOA 1Q8IA 3DRPA 3V1OA 3L2UA 2HW3A 2C2RA 4CGHA 4KHSA 5BPCA 4M6WB 4M42A 4RU9A 4MFBA 4BWJA 1X9SA 5J29A 3PW2A 4M3TA 4O3OA 5JUMA 3LP3A 3DLRA 5J2MA 1N6QA 4TUSA 2J6UA 5J2NA 8ICZA 2XCAA 1SUQA 3LP0A 3OYLA 5DLGA 3L3VA 2GUIA 4DOAA 3T1AA 4M9HA 5KFWA 2XGQA 4KLHA 2C22A 2YKMA 3TAEA 4KO0A 8ICFA 3O3FA 5CB1A 4YVZA 2W8LA 4IQWA 4NYFA 1TK5A 9ICJA 4O3SA 3MXMA 2FMSA 2JEIA 4PA1A 4CK2A 2NRTA 5CWRA 4ECVA 1IM4A 2ZJAA 2W9BA 7ICRA 8ICTA 4E7LA 2HNDA 3SI6A 4AHVA 1ZJNA 4CJEA 1TL1A 4GLXA 2FBVA 4CFDA 2HHWA 5J2HA 2IHMA 4GVMA 3H8WA 4M3XA 3PX4A 4DSKA 4O5EA 3GIJA 4B9TA 4CCHA 3M9MB 4K8XA 1RT2A 1T7PA 2KTQA 3QEXA 5KG5A 1BVSA 1NJWA 1I3AA 4M47A 5DMRA 3JPRA 3ITHA 4CJFA 4YFKA 1SKRA 4OLAA 4CJVA 3FDSA 1DTTA 3I0RA 3QINA 4Q43A 3NGDA 2HHQA 4YR0A 5KFUA 5CZ1A 3LAKA 2G8UA 4DL3A 2ETJA 2HNYA 4DTJA 3AUOA 5CA7A 2VA8A 2IC3A 4FLVA 2F96A 2ASLA 3K75D 1JX4A 3ZDCA 4WE1A 4HTUA 2OWOA 4BDPA 2ISPA 2BCSA 2EX3A 9ICUA 3O3HA 4PGXA 3M8SA 2YKNA 1Y88A 1RBSA 4BWMA 4E0DA 3OYCA 1SL1A 3JYTA 2MUTB 4G3IA 1UAXA 3V6KA 4QWEA 1ZQQA 2M9NA 2F8TA 4DTUA 4W5QA 3ZSVA 3HK2A 1KEJA 2JZBB 3NE6A 3DLBA 5J2EA 4ED1A 1IKXA 3GQCA 1J9AA 3QZ8A 1D8YA 4K4IA 3Q8QB 1ZQCA 1NOMA 3L2VA 1S5JA 4W5OA 4Z6FA 3LZJA 4CECA 3SV3A 1JLEA 3MR6A 4EBCA 3HJFA 7ICSA 4Y1CA 1D8LA 2PYLA 1VSMA 1N56A 4GC7A 2IHNA 3NGZA 3P1GA 5J0TA 2HHUA 4DQIA 3GIKA 4RW8A 5L1LA 2W42A 4O3RA 1RTHA 9ICIA 4OGEA 3VQ4A 4QZDA 7ICQA 1WCLA 3MR5A 7ICGA 2YHAA 2G8WA 2F8SA 2NRVA 4RQ0A 3S9HA 1Q9YA 3OS2A 2JEFA 4H4MA 1UT8A 2PI5A 3C2MA 7ICJA 4HUFA 3BDPA 1ZBHA 3ZD8A 2Z1GA 1EXQA 4KLIA 4ED3A 1VSIA 1XWLA 5CZ2A 3JPPA 5HRSA 4FJ9A 3HYFA 1EKEA 1WAJA 3ZT0A 3KIOA 4FK0A 1C1AA 4KLQA 3KJVA 2YNFA 3RWUA 3PO4A 2BPFA 3DRRA 5J2IA 1CZ9A 4I2PA 1TGOA 2PI4A 4FBTA 2KQ2A 4B9UA 1IH7A 3B6OA 2OZSA 4M3ZA 1EETA 2OZMA 2C2DA 3ZD9A 3OYMA 5KFZA 3JSMA 1C0MA 3KLIA 3AU6A 8ICUA 3RJHA 4BE1A 2BCUA 4HHTA 3VA0A 4IQTA 4Z4CA 3VQPA 3PY8A 2YNHA 3EZ5A 1RDDA 3QNNA 3C23A 1IG9A 3GV7B 4CF0A 1R0AA 1KVAA 5HMMA 1ZQAA 4CESA 4H4OA 1Z25A 4KN7A 2IS3A 4DFPA 1CZBA 4FM1A 4C8OA 2XC9A 4YMNA 1LAWA 3AVIA 4FJJA 2Q3SA 2KZ3A 2BPCA 2HVIA 4M41A 5FROA 1KLNA 3OYDA 1EXNA 4UB5A 1NOZA 2KN7A 1RYSA 3K57A 1JLAA 1FXXA 4FW2A 5J2KA 1BISA 1XHXA 5FDLA 4R5PA 5EU7A 1A77A 3DRSA 4QWBA 3S3OA 1KFTA 3KHRA 4CJRA 9ICAA 4N47A 3RH5A 4BGDA 4CK1A 1CUKA 4RQ5A 4F5QA 4I28A 4MFFA 4CFCA 2BQUA 1ASVA 2R8KA 1MU2A 4B9SA 1G15A 4CGJA 1W9HA 5EOZA 3T5KA 1KCFA 1BPBA 4B8AB 2W9BB 4YG2A 4DOCA 2BE2A 3AVGA 5J0XA 7ICKA 4IQVA 1S1WA 4NLGA 3EWAA 3RR7A 4PPXA 3C2KA 3HP6A 1X9WA 3ZSWA 3RMBA 4NCGA 4I2FA 5IIOA 5J0OA 8ICSA 3SUNA 2XY8A 3P83D 5KT4A 3RAXA 1MQ2A 4FJXA 2LYHA 4NY8A 4TURA 5DB6A 4YFUA 2G8HA 4DS5A 5D4BA 4KLOA 2RKIA 5KFTA 3RB4A 1B9DA 2H5XA 3IAYA 4I7FA 5I3UA 4ELUA 1JXLA 3OJUA 5HNKA 1QSLA 1RBUA 3DOKA 3KTQA 4R64A 1T4GA 3V7KA 5DQIA 4UQGA 3S3MA 4O5CA 3UQ0A 5DG7A 3OHBA 2IMWP 4FJ7A 3MBYA 4F4YA 5HLFA 3QEWA 5HROA 1RDBA 5KFSA 3MR2A 4ECQA 2IA6A 3RBDA 2P6UA 5J0UA 2PFOA 1BIZA 4CHPA 4YMOA 1KFDA 1U48A 3V72A 3PW5A 1KFSA 3B0XA 1KTQA 2AQ4A 1C6VA 3HPGA 3K4GA 2WOMA 4O5KA 5IINA 4JV1A 1ZQIA 4NYNA 7ICMA 2GBZA 4RW9A 3KHHA 3AO4A 4O9MA 1ZQXA 3PO5A 5HRRA 1ZQPA 3HXMA 9ICVA 4RQ7A 3SQ2A 3AA5X 5L9XA 3EW9A 3H8JA 4KHNA 3JPNA 4DU4A 1BHLA 1IO2A 4CJQA 3V9ZA 4ED2A 1HPZA 4CF1A 3BQ0A 4HYKA 2ZQBA 1IKYA 4CERA 1TVRA 1DGSA 4O55A 1NK9A 3OYJA 2AU0A 4TUPA 5KG3A 2BQRA 2OPQA 2G8KA 3FYHA 3ISBA 1ZQFA 2PFPA 4MFAA 1S9FA 3ISNC 4CEQA 2UVRA 4MQ3A 3DM2A 2F1IA 3FFIA 3SV4A 1DOQA 5CYMA 4CEDA 5J0SA 4KRFA 2ZUBA 5EWEA 1LV5A 3OYEA 4FJMA 4DU1A 3QERA 8ICYA 1RBRA 3VQ6A 3QEIA 2DPIA 2FBXA 3VQ8A 1VSHA 3RJGA 4M9GA 1Z3EB 3F73A 9ICSA 4F5PA 1TL3A 4KHWA 3M9NB 3QLHA 4KTQA 3TFRA 5J0RA 3MFIA 5I42A 2W9AA 2DPJA 2W9CB 4ECSA 7ICLA 5KFMA 4DF4A 4KI4A 1ZQTA 4Y1DA 4ED0A 1S76D 3SQ4A 5KFKA 3AVNA 2FLLA 3VQ7A 4Z6EA 1C7YA 3Q8PB 3HSTB 2X78A 5SZTA 2VG7A 1ASUA 4CFAA 4HVJA 1S0VA 5D49A 5EWFA 1PZNA 4DSFA 1FKPA 2E6MA 2KFZA 1BQNA 2ZUDA 1J5OA 5KFVA 2JEJA 2YHBA 4LZDA 3EPGA 1JLBA 5L1IA 3MEDA 2B4JA 8ICVA 2VA3A 4J2BA 8ICRA 5CYQA 4FLZA 3TARA 1SKWA 4N76A 1S77D 5EWGA 3KLFA 3SYZA 1S9EA 1Z26A 4YNQA 3RB0A 3S3NA 1RILA 1NJYA 4R66A 4I9QA 4KTZA 4IBNA 1C1CA 1ZQSA 3LAMA 3OYIA 1S10A 2PYJA 4QWAA 4AHCA 4F5NA 2YV0X 5KRSA 1UA1A 7ICPA 3V9WA 4QZFA 1BGXT 4JS4A 5KFHA 3MGHA 2AQ0A 5KG7A 4YR3A 3VQ9A 4RW7A 4KI6A 2G8IA 7ICFA 3OYHA 3AVHA 1LAVA 1LWEA 5KFIA 2BPGA 4CJSA 5C24A 4IG3A 4Z0UA 2I5JA 4F4ZA 4FJKA 4CJWA 3ZSZA 3V1QA 4CIFA 4J2EA 4DL4A 1QSYA 2P51A 4R8UA 4UAZA 3PW7A 1I39A 1SV5A 3WNFA 4HUGA 4ID1A 4E7HA 4RW6A 1GOCA 1QSSA 4O3NA 4Z4FA 2DY4A 1QLNA 4DL2A 3NDKA 5J2QA 2BGWA 2ATLA 3CM5A 3VQDA 3OVNA 4RUAA 2R7YA 1IXRA 3TAGA 3SNNA 5CP2A 4DU3A 1F21A 4GXIA 1QTMA 3SI8A 2ASJA 3MEGA 2D0BA 1WCNA 3D45A 2BCQA 2FLNA 2FBTA 3V1RA 3TAFA 1WN7A 1NK8A 2VANA 4YD2A 3BQ2A 2RDIA 4R65A 4YR2A 1HNIA 4TQRA 4XQ8A 4FYDA 4HCBA 2PXIA 4ECTA 3H8SA 3LWLA 9ICLA 4Z4IA 1HYZA 3ULDA 3HVTA 1YTAA 4TUQA 4OKEA 1RPLA 2FMQA 1S6QA 2XCPA 4OGCA 4P2HA 9ICPA 4LH4A 3QNOA 4LZGA 5JS2A 1BQMA 1RBVA 1ZBIA 3HP9A 4FLYA 3VQBA 3M8QA 2ZTCA 3G10A 5KFGA 3KD1E 4I2JA 4DLEA 3LPUA 3L2RA 3MABA 3AO5A 4AHSA 3RRHA 4UBBA 3NHGA 4CGFA 4Q5VA 3AVCA 5KFRA 5KI6A 3MAQA 2FC0A 9ICRA 5DDMA 1BCOA 4IFVA 3DYAA 1S0NA 1L3SA 2NRXA 4RQ1A 4RPXA 4PGYA 2FPLA 4EZ9A 4IRDA 3IG1A 8ICCA 4J9SA 9ICKA 3UXNA 1A5XA 4XUSA 5TZVA 4M9LA 1U47A 4FJ8A 3KKRA 3DI6A 4MEYA 1JLCA 4ECUA 3K5LA 4RNOA 3V6JA 4I27A 3KK1A 4OPKA 4KMUA 2UVWA 2DFEA 4DLGA 3RB6A 4IFYA 2FPKA 4LY7A 4KLDA 3BQ1A 1UT5A 4J9MA 5DK5A 1Z00A 2PFQA 1VSKA 3UXOA 4DEZA 5J0QA 3EYZA 1RYRA 4CGIA 3T3FA 1T03A 3TAMA 5FRNA 4RQ3A 4LH5A 3LANA 1S1TA 2OYQA 1XI1A 4Z6CA 5IIKA 1AROP 2G8FA 1IKVA 2P5OA 1K1SA 3AA2A 4AHUA 1TK8A 1HJRA 3HVRA 2MAXA 4CEFA 4AHTA 9ICTA 4GC6A 3AVLA 3RJEA 3CFOA 4LSLA 4ED7A 3ZT3A 3OYAA 3OS1A 3T5HA 4DFJA 4FBUA 5J2BA 3OYBA 4C8MA 4DTMA 4IQUA 3KLEA 3GIMA 4M9JA 1S9GA 2ZJ5A 4DTSA 4UBCA 4JWNA 3KKSA 5D3GA 5DG8A 4FZXC 1RT1A 3QEVA 3B0YA 3T19A 4CJ3A 1NK5A 3NFAA 4FCYA 4CJLA 3AVFA 1L3VA 1RTJA 1XU4A 2B5JA 2PY5A 1NKCA 4CJKA 3V9SA 2BKEA 4Q0BA 2DFHA 5BOLA 3GDXA 1D5AA 5IILA 3IRXA 9ICNA 7ICHA 4IRCA 1C1BA 1JLFA 3A2FA 3RR8A 4E7JA 4QZ9A 3LDAA 1GOAA 4F93B 1SZPA 4EYIB 2V4QA 3L8BA 3MGIA 1ZBLA 5T7BA 3SUPA 3JPQA 1RDCA 5DB7A 2HHVA 3LP1A 1ZJMA 2AGOA 4NM1A 4PGQA 1BPYA 4YMMA 4M45A 4NM2A 4JRPA 3BJYA 3AVKA 5KFYA 3GIIA 4B8CA 1CEZA 5KFNA 1WNSA 3KHGA 4RNMA 1JIHA 8ICKA 2BANA 1ZQRA 4O44A 2A1RA 4O3PA 5DGBA 3M8RA 1KSPA 4QWCA 3ZSQA 2FMPA 3WNGA 4CGGA 1Y97A 4IG0A 4XRHA 1U49A 1U04A 4CIEA 3GV8B 1MC8A 1DTQA 4RUCA 2KZZA 4QZCA 3AA4A 4CJPA 3NBPA 1ZQHA 9ICBA 4EYHB 4R8UB 4DQQA 4RT3A 3AA3A 3QEPA 3OY9A 4FXDA 8ICAA 3M9OB 4F91B 1FKOA 1LW2A 3OHAA 3L2WA 4J9NA 3IS9A 3ZSXA 4KHYA 1QS4A 3NH2A 3KHLA 1T05A 5J2AA 3ISCA 2PFNA 3SPYA 4DTNA 4PWDA 4FK4A 5J0PA 2IOCA 4OKKA 4AILC 3K58A 1WSFA 3KD5E 4PUOA 3ZCMA 4UAYA 3UQ2A 4ECYA 1S0OA 3ZDBA 4ECRA 1RT3A 2IAJA 4BXOA 1L5UA 3QIPA 2C2EA 2HNZA 3PMNA 1FK9A 4M3YA 4OVLA 3ZT1A 3MDAA 3CFPA 5J1EA 1LW0A 2Q0ZX 1T3NA 1EX4A 5J2DA 3GV5B 1HYVA 2BR0A 3K5OA 3ZDEA 4DSIA 4UB1A 1ZQZA 4IR1A 4LD0A 1A76A 4P4PA 4MF2A 3PX6A 5J2GA 5DGAA 3TI0A 1UWBA 4DG1A 4I2BA 4B3OA 1B92A 3LP2A 4E89A 4GXKA 9ICWA 4Z4GA 4Z6DA 4IRKA 5D46A 5KFBA 5IIMA 3SZ2A 5KFLA 7ICTA 2R8IA 3E01A 5HP1A 3EY1A 3CM6A 1D9DA 1RT4A 5J2JA 3KK3A 1RNHA 4JK1A 5HHIA 1ZQLA 1NK0A 2XGPA 3VN5A 1H38A 4I2CA 1MSWD 4Q44A 3RJFA 1DLOA 4J9KA 1ZQBA 4OPJA 2B21A 4F5RA 4FJ5A 1HRHA 4M9NA 2D5RA 4EP5A 3G6VA 4K4HA 4YP3A 5DQGA 4I9LA 5L1KA 3E2EA 3NCIA 4J9LA 1RXWA 5KFAA 1KDHA 2RPIA 3IHQB 5L1JA 1JMSA 5DLFA 3ZDAA 4C8KA 4CHZA 4QW9A 1BPDA 1Z00B 2R8HA 5IIJA 8ICLA 1KRPA 1RBTA 2DFLA 1ZYQA 3HT3A 3CG7A 2NRZA 3LK9A 3V4IA 1NKBA 1KLMA 4Q45A 1WSEA 3DLEA 3TWHA 4KHQA 3DOLA 1XHZA 3PW4A 3HL8A 5KFJA 4XA5A 2KW4A 4DWIA 1K1QA 1W0HA 3B6PA 4RPYA 3QEBZ 4AHRA 2YNGA 1QE1A 3OSNA 4GXJA 3DMJA 2Y1JA 4IKFA 9ICGA 3ZSOA 2ISOA 3EPIA 1U4BA 4FM0A 2ALZA 2HHTA 1VSFA 3MECA 4J9QA 5HMLA 1WSGA 1JLGA 3NF8A 4ZTFA 4F50A 4FJNA 3PW0A 2F1JA 3HPHA 3N4MB 4KTWA 7ICIA 2UVUA 2HHSA 1ZQKA 3K5MA 5KG6A 1TAQA 1VRUA 4I29A 4N41A 4QOZB 4DOBA 5KG2A 7ICVA 2NUBA 3RJIA 4E3SA 4RQ2A 1BIUA 5DG9A 2D0AA 2V4RA 1U9LA 9ICEA 4JUZA 4MEXA 1CLQA 4DL6A 4I2QA 4DO9A 1SL0A 5E41A 3U3GA 3RMDA 1JKHA 7ICOA 2BDPA 1N5YA 4FJHA 1BPZA 2E4LA 2P66A 3HW8A 3RTVA 1B43A 4ECWA 4RW4A 4F4XA 2ASDA 1LWFA 8ICHA 1CXUA 3M8PA 4FLWA 1HUOA 4PQUA 4Q8FA 5CR0A 1SL2A 4FLXA 4EEYA 2VWJA 1TKDA 2O4IA 3CQ8A 3PNCA 2QKKA 2JEGA 3VQ5A 5KT6A 3C6UA 3VQQA 4H8KA
chains in the Genus database with same CATH superfamily
4IG0B 2Z1JA 1KKXA 4JNEA 2B9YA 3TEGA 3MCNA 4FKXA 2ZJ8A 2HHXA 1YVUA 1DTQB 4UZBA 4HACB 1MN7A 4IOXA 3AO3A 2XM3A 3ZTPA 3PR5B 2JC1A 3Q8SB 5F1XA 1ZA2B 4R5PB 3NBPB 4ATNA 4BVOA 4B1ZA 1OO0B 3EZOA 3N4PA 3DRSB 3SUOA 1YT3A 2MLXA 2FJDB 3O6WA 2QK9A 2M52A 2DR9A 2Z7JA 3NCRA 5GIOA 3U4LA 1VIXA 4KLSA 4OCZA 3V7LA 2HSTA 2P1JA 3U3YA 2G5IB 1S0MA 1VQ6S 1O6XA 3P49B 2J8SA 3WHIA 1REGX 3GG1A 2F4VF 3AA8A 4BDYA 4QR2A 4O0JA 4ZMMA 2R7VA 1KNZA 3H1VX 2DFFA 3DKDA 3WQTA 1B0XA 2D1CA 3PEJA 2VFRA 1IR1A 1AB8A 5DRKA 1N48A 5E26A 4TLRA 1ZQVA 2FC8A 5IM0B 1MA9B 2ADCA 3E58A 3SCXA 3T5LA 4HKQA 2WTFA 5J1EB 4K4GA 4F2SA 4M2YA 1B3TA 2PMZF 4DV4K 5BPLA 2G4BA 2ZJPL 3DLHA 3UMBA 2H3VA 5E0OA 2RRNA 4CIGA 1SB6A 2KG1A 2IJRA 4MIBA 4ISGA 4DMNA 4DSLA 3GONA 3W5YA 3W3SA 4F3TA 3V9UA 3NWRA 1QAXA 3TFSA 3JSYA 2JGUA 2OTJS 3ZEUB 4F4WA 1GX6A 3LP2B 2WB1C 1E4GT 3JTNA 4KLMA 3VEZA 1K8KB 1V97A 3A8KA 3G8TA 4CNYA 1LNQA 2P35A 2DH9A 4MH8A 2HFVA 1ZQEA 3C21A 3WKAA 2E1PA 3MFHA 4Q8EA 4MO5A 2E5LK 4F02A 3S6EA 3A4TA 1RHJB 3AAQA 2MQ8A 2QLBB 3AV9A 2ASMA 1B22A 1XEZA 4P2SA 1WOQA 2VKRA 3NGSA 5ETLA 5EUHA 2VGNA 4ID8A 4ETXA 1IUJA 8ICJA 5B0DA 2QARB 1X2IA 3OR1A 4M5DB 1SGGA 2N4CA 4GKKF 3R8YA 5C12A 1FDDA 2ZIXB 1IM6A 1W2IA 4FSVA 3AVAA 1RXOB 1OVQA 1VQSA 4FXWA 2XHBA 4FDFA 4PEOA 4JB3A 2XY5A 2F9JA 3DLKA 2VZ9A 5JU5A 1DRZA 4DTPA 2IGIA 2H65B 2KJVA 2ZXIA 4HTJA 3I28A 3AARA 1EWQA 2JXJA 2J9CA 3GP9A 3ZSRA 3NNAA 3CXCR 5KRTA 1KLMB 1R8HA 3NCQA 5GADP 4N5SA 1RT6A 3Q8KA 3D6JA 4DTRA 4E7KA 5GTHU 3ZZUA 1DAXA 4CZMA 5EX5A 4K7QA 4FF1A 4RJVA 2V69A 3O4NA 4ED8A 5HO4A 1VHFA 3HVAA 4P2MA 1NG9A 2MQPA 4B9LA 3OD2A 3UPFA 1JLGB 1RG6A 3ELHA 1WWVA 5H9EK 2OTLS 4QZGA 1HLWA 4OX7A 3CFRA 4DR2K 2HRTA 1I6JA 1YTUA 4K50A 2WVBA 1ZBTA 3NF9A 1YGYA 3UXPA 5E7OB 1HW9A 2HBJA 4Y2YA 1LFWA 3OBWA 2BMBA 4ES3A 4IOAL 5EE9A 2HF3A 4YOWA 3UD3P 4DL5A 2QWQA 4EP4A 3AVMA 3D7SB 2CXEA 3VGTA 3H7IA 2WF8A 2JLEA 1SJ4P 3R5DA 1O13A 4FPRA 4I2QB 1VJWA 1NM2A 4NLOA 1VYAA 2VIHA 5AQMA 4G6VB 3LDQA 3CCRS 3KZIU 2W9CA 2CQ4A 2H3IA 3DRXA 8ICWA 4K8RA 2GHVC 3U6FA 3OFGA 1KQSR 1ZQUA 2ZIVB 3LOUA 1PYOB 3RAQA 2EZZA 4CF2A 4OJRA 3GJRB 1IBLK 3W3DA 4M5JA 3ULHA 3O9QA 2DXEA 3SQ0A 3KLVA 4X4NA 4BG8A 4E1NA 3WT0A 3ETLA 1VS3A 1F0XA 1JL2A 2F1HA 4CI6A 2DGOA 3G6XA 4DXLA 2HOEA 1C0TB 2VPWB 3Q8LA 2G0CA 5C42A 5IQ6A 2XMWA 1NZPA 3GU3A 2LEAA 2P9CA 3MM6A 1ZQGA 3O8WA 1FJGK 1V5IB 2R7XA 1Q1KA 3NTUA 2R18A 4LF5K 2YX6A 1ZBFA 1X9MA 3J7YU 1F3VA 4WPAA 2XYPB 2K4IA 4OJHA 4KLLA 1YUWA 1KQKA 2XI3A 4WZQA 4WQ4A 2A1JB 1G99A 1NSPA 4Y2XA 3POTA 2E8NA 2KK0A 2QLJB 3HSDA 2HVHA 4OYXA 4E19A 5JLHA 5L8RC 3CJ0A 4K5SA 2E1CA 4EIAA 1OH7A 4Y65A 3OYGA 3PYGA 3G6YA 1XSPA 4P4OA 1B0TA 2L08A 1N63A 1UHUA 1GTEA 1ACMB 3ASMA 3RW6A 3HFKA 4LSNB 1F44A 1A5VA 1ELOA 4L76A 5KGWA 1X1PA 2UUBJ 3CPWM 3CDWA 2X3DA 2D69A 1IR2A 3QIOA 3HKZC 1X4GA 2ZUGA 4JI2K 5DKWA 3A3NB 2KIVA 3HM9A 1TKZA 1D0EA 4M3WA 2A1AA 4LIWA 4KH6A 3PR4A 1NOYA 1A5WA 3CRXA 1WSIA 1VQ4S 2AP1A 4PHAA 3ILOA 3PX0A 5EGYA 1S1VA 5HR6A 4MF8A 4L74A 1SJ3P 1QHTA 1REVA 4FYYB 4LQ3A 4JI6J 1ZQYA 5IV4A 4DQPA 4E1MA 3OV7A 3UCZP 3D6HB 2Z1IA 2GQQA 1HKGA 2FVSA 2CDQA 2QO3A 1U45A 2HHHK 1WSHA 2HK2A 3VA3A 4HUEA 1ZM2A 4J9UE 3VQCA 2N4DA 1VISA 4ISEA 4B9VA 4F92B 4KITB 5KG1A 2LSNA 4O5BA 5DZ6A 2MHNA 2P9IB 3ET6B 4KB0A 1KBUA 5GAHU 5BN8A 3MMAB 1TV6B 3L3UA 5CR4A 5KT2A 1HMVB 3N6MA 1D4XA 4EK2A 3NS6A 5B8HA 2AGQA 2NXCA 4RQ6A 3THPA 5B0FA 3OL7A 2CH5A 1XMQK 1G4CA 1CZAN 4KQZA 4ZIVA 5HL7L 3TZWA 3PTWA 4DS4A 3DLGB 3KLGA 3VAKA 3MMBA 3HJEA 1YRTA 4TSXA 4Y2SA 1ITGA 1HBMA 4P4MA 2OPSB 1UCVA 1QCKA 3NG8A 1ZQJA 4CEEA 1RAAB 1JI7A 3QFPA 4PG6A 4DSEA 1RTIA 4CZCA 4PHPA 2F2AB 3JPOA 2KT2A 4KPYA 2O3DA 4X5VA 3WEEB 4XH5A 4QAGA 3BGUA 5HANA 3CDAA 2P9KB 3IA0A 3PSPA 1YJ7A 2KM8C 3TZXA 2CXYA 1G7CB 3LPTA 4JEPA 2RB7A 5HBMA 2X6NA 5DM6L 1TVAA 3I76A 2CPEA 1L3UA 2BOAA 2LXIA 2F8EX 3FZKA 3B8AX 2F76X 3RMAA 2DNLA 3VMFB 3ED5A 2QXFA 2MKJA 4JI7K 1GXTA 2EDUA 5H9FK 3UPQA 2YMMA 1XS9D 2YBVA 2NRWA 2F65A 5C2DA 3H7HB 2BJ8A 9ICFA 3BP8A 5D4PA 5CY4A 2KYZA 2OD6A 4FOEA 2Y0BB 3CO9A 1TL7B 2FY1A 5DQHA 1Z6RA 5AKIA 5KG4A 4I68A 1RXVA 4DR6K 1JLQB 7AT1B 1X31C 2JZ5A 4ZHRA 4ELVA 4M5HA 4OMFG 1WNEA 1M1KO 1HQEA 2MYFA 2O4GA 5HMWA 4P0QB 4ENOA 4K4VA 3HPOA 2VD3A 4Y0FA 1VGYA 1J2VA 4YB5A 3PXGa 2L9WA 2RF2A 2MZJA 5IIIA 5ALNA 4A8FA 2I8EA 4CGDA 2VDIA 2ADBA 2AEMA 5HRPA 4WZMA 4WYBA 2ZZMA 4PHEA 2ASOA 2ZUCA 5LSLA 4B3MK 1BCMA 1AXQA 2ZTEA 5FRMA 3GL1A 1TU0B 4M5NA 4CLYA 3E9OA 4YXJA 3VQAA 4CJ4A 2FHMA 3MOJB 2PSZA 3H98A 4MDBA 3V1OA 3DXKB 4GIBA 3OTBA 3AD8C 4I6MB 1KHVA 3IS9B 3H46O 1GMVA 2MHEA 2YPYA 2NSCA 4MFBA 2UUBF 1SBRA 2EBGA 5J2MA 3DLRA 3I6PA 2FVRA 5B0CA 2D3UA 4OX9K 3QGGA 2QIFA 2QTWA 2IY5B 2XCAA 3OYLA 4DUZK 4X62K 3UDVA 3PIPL 4CQ1A 1N36J 1BHNA 1R8AA 4C4TA 3T1AA 2QMUB 2MSNA 5KFWA 1WKJA 4KO0A 3MEKA 3I56S 2DNYA 2W8LA 4NYFA 1NCLA 4F7VA 4O3SA 4IFEA 4LF8J 4DR3J 2F44A 4PA1A 1SH3A 1R59O 5H1SQ 4TKTA 2NXNA 1IM4A 1CJKB 3CPWR 7ICRA 3QU9A 2KVQE 3CJ2A 3UVJB 3ULEB 4MKYA 1ZJNA 4JI6F 2OKQA 4GLXA 3GBTA 3CDEA 4CZGA 2IHMA 4GVMA 2JRZA 4K4SA 2D3ZA 1IWGA 1NPPA 3E01B 4CCHA 2CJQA 2NYIA 2AJ0A 4E2FB 3U1LA 2GQCA 1N0UA 2LKYA 1RTDB 3L6QA 3QT8A 2P2CB 1ZXIA 4FZNA 4M47A 1V38A 3ITHA 1LKYA 1IKWB 1U1KA 4ZPDA 2KKPA 3HHLB 4Q43A 5KFUA 1QDUB 5CZ1A 2F40A 3AGRA 1RTZA 3LAKA 4NL5A 2RH3A 2XI9A 1TL4A 2ETJA 4A8WA 1EQ0A 2F8LA 3CP8A 3AUOA 3C66A 3Q7BA 1K8AO 1F1BB 3WC0A 4ZLPA 2VFTA 2F96A 4Q7AA 4KFBB 3OR2A 3K75D 2VBYA 2W04A 2HRYA 3MM7B 5A2QO 1XK8A 4KV8B 2H54B 5JTIA 1YJWN 1FRMA 4JKCA 5U47A 1IBCB 2CPFA 2EX3A 9ICUA 2NZ4A 2JJ4D 1CJVB 4PGXA 3M8SA 3KNGA 4Z7CA 1RT5B 2QFIA 3E66A 4BWMA 2MUTB 3UKRB 1J5EJ 1UAXA 2W24A 5H1SV 4RUBA 2M9NA 2F8TA 3UD4P 1KEJA 2JZBB 3EKSA 2IVOA 3NE6A 2GA7A 5J2EA 3R9PA 3AAWB 5KAIU 4CD3A 1PIEA 3GQCA 4RCHA 1S5JA 2NPFA 5C2FA 4Z6FA 3TVZA 3LZJA 2KRBA 3Q8UA 3V6DB 1U7LA 1HNVB 3MR6A 1NGDA 5LJ5Y 3MN5A 1VQON 5AQXA 1EX8A 3EGZA 4LUBA 1HD1A 7ICSA 4DCHA 2PYLA 1VSMA 1N56A 2IHNA 3W5ZA 4ID5B 5A0YA 2HHUA 3RUBL 1UFLA 2KG0A 4RW8A 4KKOB 4O3RA 5IXUA 1RTHA 5ALGA 2D9PA 2XMAA 1WCLA 5M1PA 1CRXA 1YX2A 2G8WA 4UAUA 1NDLA 3FBBA 2ZH5A 3RU0A 4X66K 1Q9YA 4RWWA 1EARA 4IQXA 2K4PA 4EFAC 5DM7L 1O03A 1SQFA 1N5YB 3BDPA 3ZD8A 5HQ8A 3R2DJ 3HOSA 4KLIA 1GMWD 4WKRA 4JK9A 3HYFA 4LVOP 2E2OA 1YJRA 4FK0A 1C1AA 3A0BU 4KLQA 4DV1J 4ICLB 5T14A 2YNFA 3FGVA 3PO4A 3DRRA 3FSXA 5CXTA 2HGMA 4FBTA 2GHWA 4DCJB 1U1PA 4LF4K 3BYPA 2OZMA 1Z19A 2B43A 2E2QA 3DFEA 3KLIA 1UP1A 5AQRA 3TTCA 3KMQA 4NLSA 3RJHA 4BE1A 5LL6Z 3VA0A 3VHQA 1GO3F 3C14B 5ADZA 3BGRB 3C23A 4CF0A 1KVAA 2FJBB 5HMMA 1ZQAA 1SIZA 4CESA 4H4OA 4DFPA 3AVIA 2PFFB 2Q3SA 1VCTA 4LRFA 2HVIA 4WWSA 2FJEB 4M41A 5FROA 3OYDA 3KYLA 2Q3PA 1VK8A 2KN7A 1RYSA 3IMQJ 1N36F 1FXXA 5BRHA 5J2KA 4B3SJ 3PKMA 4R5PA 4IOCL 1JJ2M 1N6QB 5M1NA 5EU7A 3EDRB 1A77A 3DRSA 4G1PA 1UJ6A 1KFTA 3IP4B 4LRBA 4CJRA 3SEOA 1TTHB 1T9WA 9ICAA 4N47A 4LF8F 4DR3F 4NASA 3RH5A 4BGDA 3IUCA 2YKMB 4CK1A 3M4XA 3TQEA 1SH0A 2ZHBA 2BQUA 2NUHA 2V5HG 2VYPA 2DNHA 1OPZA 2ES6A 5CHIA 1A0OB 3OPKA 1PJ6A 3CWJA 3W65A 4B8AB 3NRZA 2J9EA 3C6HA 4YG2A 4KGKA 3TP2A 5J0XA 4EUVA 2HNDB 4IQVA 4YOTA 3IDHA 2D1KA 4P10A 3ATVA 1NNDA 1QUPA 2BJ1A 2HPUA 3ALRA 5J0OA 2AYGA 1DK3A 3SUNA 4XPCA 3P83D 3GG4A 1MQ2A 2AX1A 2CFXA 4NY8A 4YFUA 4L75A 1RI7A 1PGZA 5F3XB 3RB4A 2H5XA 2KN4A 2WUSA 5HNKA 1QSLA 4QZVB 3IGNA 3IKMA 2XZWA 4IQMA 4ZVUB 1B0PA 4MHVA 5DQIA 1P9YA 3T69A 3S3MA 5ALHA 3ZEUA 3I0RB 4FJ7A 3QFHA 1HX1A 2ZDOA 3QEWA 3PFOA 5AT1B 3U1MA 3CJTA 2MQNA 1RDBA 2LM1A 3EXYA 2A42A 1N34J 1YWXA 2CPJA 1K9MO 5J0UA 1BIZA 1ZD3A 4IH7A 3GJTB 4PHTX 4CHPA 1QTNB 2GO9A 1WHXA 3PW5A 3AGKA 3QSYB 3B0XA 5AKEA 4WE1B 3HPGA 5J1NA 3NKYA 2R3VA 4O5KA 1FI4A 1P1LA 1J5EF 1ZQIA 4HHUA 5FPDA 5G5HA 4NA3A 1ZQXA 3WXJA 1U1RA 4OV1A 1ZS6A 9ICVA 4BR5A 4ZVSB 2P9SA 1WDTA 2A5XA 3JYTB 2Q0UA 3Q7CA 4ED4A 4P73A 3SQ2A 2ZH1A 1HQ2A 4MKAA 2FSNA 3MM8B 4KHNA 4H4KA 4QR1A 2FTRA 2LMRA 3V9ZA 5FPMA 2D6FC 4CF1A 3BQ0A 5CHCB 4QYZK 1CLFA 1DXSA 2ZQBA 1TVRA 4DKWA 2DB1A 1DGSA 5KNIA 1NK9A 3OYJA 2AU0A 3SJHA 3R3TA 2ZHOA 2KLAA 3FYHA 2JRSA 4UASA 2I7PA 1S9FA 3A13A 3ISNC 4DR5J 3DM2A 2DRDA 2DBBA 5GADI 4LMZA 5AZIA 4EHTA 4USHA 4CEDA 1H6KX 1S8OA 2ZUBA 5EWEA 3OYEA 3H45C 4R0EA 3PHEA 5EX0A 1ZZNA 2QB1A 2ZH3A 1RBRA 2KVSA 3QEIA 1H98A 3RJGA 4DV5K 3WKCA 2Q79A 1NBEB 2KFYA 1QQMA 3M9NB 1S6UA 3C0BA 1UKUA 3MUMP 2QLWA 3AJ2A 2JDJA 1FXRA 4KI4A 4DV1F 2J7UA 3US5A 3CUNA 4CE6A 4Y1DA 1YRXA 2HOQA 4TY9A 3D2EB 2HWIA 5KFKA 2FLLA 3RBXA 2WC9A 3U1NA 5M2RA 3W62A 3PACA 4WCEQ 4CFAA 1S0VA 5D49A 1PZNA 1Y0HA 4ZCMA 2KFZA 2DK2A 1BQNA 3VGLA 2GIQA 2DR7A 3MEDA 3L5KA 2BV3A 3KBBA 2VJVA 8ICRA 4LREA 3TARA 5AM1A 2W43A 1SKWA 1N8RO 3CGIA 3JSMB 3SYZA 1S9EA 3S3NA 1N61A 4R66A 3O9SA 1K5OA 4E8UA 4ZDNA 4ER8A 1HNXJ 4DL0C 2Y9UA 2YNHB 5GAEU 3HFVA 3RZAA 7ICPA 1HBOA 3QDKA 4QZFA 2AEFA 4JS4A 2P6TA 1MWKA 3MGHA 2AQ0A 3NCPA 3G71S 5KG7A 2ZOGA 4B3SF 2ZF5O 2OPPB 4NLDA 2VPZB 2GV1A 3M30B 3TX8A 2HOFA 3AVHA 3G86A 4PXDA 4CO2A 4KJIA 5KFIA 3X1LB 5ETKA 3LQVA 2K7KA 2N3OA 5C24A 5FDLB 4ZVEA 2L5YA 1X6IA 1W25A 1XMOJ 4F4ZA 3Q22A 3W7BA 1C0FA 2N7CA 2NS1B 1HNWJ 2P51A 1HIYA 2GNKA 5AQPA 4RW6A 1GOCA 2FVCA 5IT9Y 3VVUA 2ACMA 4DR4J 3QMLA 1JJ2R 2DY4A 1QLNA 4DL2A 2BGWA 2F4VK 1NXIA 3AXKA 4KX5A 4RUAA 2BE2B 1IXRA 3TAGA 3SNNA 1XIQA 1SQEA 2WAQC 3MCSA 3M32A 1NO8A 1F5BA 2FQQB 1EQYA 3M2RA 3D45A 1WN7A 2BJ9A 2ZBPA 3G8SA 1NK8A 2O8CB 1FEHA 4U7BA 5HSPA 3FCHA 3NRWA 2GUPA 2MU2A 2GWJA 3KKAC 4TU7A 2NCKL 4B02A 1DZ5A 3LWLA 9ICLA 3Q2TC 4CP5A 2RKIB 5F3TA 2OEHA 1ITPA 4OKEA 1RPLA 1MWQA 4L73A 1S6QA 1Q8KA 4PYAA 1N34F 4K0KJ 9ICPA 4ZJQA 4LH4A 3CCUN 1Y00A 1RBVA 4FWNA 4Y2PA 1N33J 3R6LB 3G10A 4O5FA 2QA4N 2OPRB 2QEXS 3EWGA 3THXA 4Q5VA 1RGVA 3S7RA 2RQKA 2XS2A 3JQKA 3GFHA 3CJ4A 3O08A 3LGMA 2UUCJ 1Q95G 1R0CB 1VQLS 3ICLA 4FWRA 4ZPVR 2XWYA 5AI6A 1RA6A 5A8WB 4I4BA 2GW8A 3MM9B 4RQ1A 2RUGA 5CZVA 2PMZD 5CAAA 4YDXA 4GKKK 1DJ0A 5C2GA 4B1YB 4BJQA 2IRXA 2QG9B 3J7A1 2R7OA 4FJ8A 5KPRA 4CD1A 3C7NA 1NHVA 4RNOA 4DR5F 4OPKA 4KMUA 3CCLS 4YN3B 4DLGA 3RB6A 4IFYA 1CQMA 2FPKA 4LY7A 1NM1A 1F9HA 1QQ7A 4ZN3A 1VSKA 1ZOLA 4DEZA 1RYRA 3EYZA 1H1VA 1YVNA 3N6LA 4LH5A 4PG7A 4A8MP 3FRZA 2P9LB 1SS6A 2IHR1 3D1OA 3MC1A 3VEWA 1DBDA 2ZBRA 1K1SA 4AHUA 1U2VA 4DB3A 3RJEA 3LVVA 1FERA 1MMNA 5HOOA 4FBUA 1YKWA 1PAEX 5G0RA 1MN8A 1TL3B 3WKEA 3AD9C 3PYEA 4DX6A 2J76E 3MTKA 4IQUA 4NV0A 3HD1A 5I42B 4OI2A 4M9JA 1RAGB 2ZJ5A 4DTSA 1Y7PA 5AKKA 5DG8A 1RT1A 3QEVA 3B0YA 4CJ3A 4Y2VA 1NK5A 4CZLA 3NFAA 3I4HX 1L3VA 1RTJA 3IBFB 1SV0C 2YH0A 2PY5A 3G82A 4ILHA 5F0UA 3DN9A 2GIRA 3O9RA 1AZSA 2BKEA 3EGVA 1OVYA 1TUYA 3PDNA 5EOYA 5AQTA 3IRXA 1M0SA 4Y2IA 9ICNA 2LDYA 1JLFA 3TJAA 3A2FA 3RR8A 1HNXF 4E7JA 4QZ9A 4PJ0U 4EYIB 2V4QA 2CQDA 2EEYA 3B4DA 5ALKA 1T11A 1RDCA 4QPXA 5DB7A 2HHVA 4NM1A 4UUWA 2PO4A 1NEEA 1RAIB 4JRPA 2LMIA 4UOGA 3MDQA 1RACB 1I3OB 1YVFA 5KFNA 3KHGA 2QB0A 3ZNUA 1JIHA 3TA1A 3PNIA 3KG1A 4C80A 4LSZB 3A8IA 4IDHA 2QL5B 1XMOF 5DGBA 1NNLA 1FDBA 1IBMJ 3WKDA 4CO1A 4K2JA 1LWEB 4K59A 1QVGR 1Y97A 2DHSA 1U49A 1HNWF 3GV8B 1MC8A 1HEKA 4KHMA 3VALA 2YHWA 3J7Z5 3S1TA 4DR7J 2BA9A 4LF9J 3IAS9 4DR4F 4U95A 3CJSA 1RM6C 3FQLA 2E1FA 4DCOB 4RT3A 1HHTP 3AA3A 3QEPA 2DISA 3OY9A 5IQQA 8ICAA 1NMDA 1MMDA 2AT1B 3SAFA 1NH8A 4OPAA 4WBFA 2PDAA 2F1FA 2XMKA 2GX9A 2WBNA 3IS9A 1QS4A 3W1YC 3OFEA 1YZ6A 4CO5A 2HBLA 5AI0A 5DS7A 3ISCA 2PFNA 4LBHA 4O4RA 1S99A 3M6KA 2P9NA 3H2VE 1BLUA 2WHEA 1LFPA 1RU1A 4ZLNA 3CCRN 4UAYA 3UQ2A 4W4MA 4KX3A 4QIEA 2QMXA 4X4QA 4K0KF 1UJ5A 3WK4A 2HNZA 3W66A 2ZH4A 3ZT1A 1NMNA 3T6BA 2Q0ZX 1N33F 1EJ7L 4NWBA 1ESVA 3HHLC 4BC5A 4Y2CA 3TNVA 3ETRA 1FHTA 2D0PA 1X60A 2V68A 1A76A 3PX6A 2DNMA 3QT7A 5GMEA 1UWBA 2VODA 1K0VA 4NLUA 1Q5VA 5HJXA 4DG1A 1RDFA 1BUPA 1SKUB 2W2NP 2UUCF 2YB1A 4GXKA 9ICWA 2HNYB 4TXSA 1NGIA 5D4LA 2RQMA 5D46A 2J0WA 7ICTA 2R8IA 1VBZA 5AQIA 1ZD4A 3NVZA 3E01A 3EY1A 3HVWA 1D9DA 4IFVB 5J2JA 1RT4A 3LO3A 2ZIWA 4JOUA 5HHIA 1ZQLA 4CO4A 5LJ3Y 3EZWA 1DLOA 2YPZA 4F5RA 3CNQP 2PFDA 1KC8T 1SPBP 7FD1A 1N5QA 2P6SA 1S4EA 3DRYA 3JAMO 3HI9A 4MT1A 1PKUA 4NLXA 3NCIA 2V8HA 2LKZA 1A6SA 2VKQA 1ZM4A 2JL9A 1VQ7S 3ZDAA 4C8KA 1PUZA 1PBAA 3PJXA 1FWPA 2HFSA 3GIRA 2YWWA 3E1YA 2DFLA 2C2ZB 4KH5A 2GC8A 3LYSA 3CERA 3CG7A 5IT0A 2VC0A 1S1TB 1X3NA 2CPDA 3LK9A 4OZLA 2ZGYA 5K5MA 1IKVB 4LRAA 3PW4A 3D3BJ 3UKRA 2KW4A 4DWIA 1W0HA 1I1GA 4AHRA 3DOMA 5DDPC 1BWVA 2ZH2A 5D15A 2CJYB 1OSCA 2GVZB 2DGWA 4IJAA 3EL2A 3GR1A 4I6YA 4NX9A 2HHTA 3MWBA 4X4SA 3KLEB 1VQ4N 5HMLA 2KMDA 1S9GB 1WSGA 4CLKA 3WU2U 4FYXB 1Z4UA 5D3GB 3J7AP 3RSEA 5D4OA 3HLUA 3K5MA 4CF3A 2KXHA 4I29A 3DXSX 1SXEA 3H90A 4QOZB 3MCOA 3O0FA 4MIWA 5KG2A 2KHQA 2NUBA 2WW8A 3W63A 2D0AA 5DG9A 5A6WA 1U9LA 1GT8A 3NL0A 3U26A 3ZTSA 2G0AA 4C23A 4JUZA 1SL0A 4B6JA 1UVMA 1JMTA 3MCMA 3KFUF 3LP1B 3OVSA 4ZVRB 1N5YA 3FZHA 1BPZA 2P66A 1HKCA 3HW8A 3IG5A 1N5VA 2WRMA 3MK6A 2E1RA 3OQ2A 1IBMF 1A7GE 1LK5A 2NXUA 1TKDA 1U1QA 2QKKA 4LF2A 5KT6A 3C6UA 3C19A 2XNRA 2JR5A 2WBRA 3NLCA 4DR7F 4LF9F 2ASPA 3J7ZT 3ENHA 2VA2A 4M3UA 2WFAA 2BQ3A 4OV6A 3C6AA 1VLOA 3KJNB 3CCVS 2DNPA 3PEHA 3ISDA 2W11A 1KONA 3NWGA 4OHVA 8ICXA 2W01A 2AV5A 4QJFB 1VSDA 4N77A 3TQ1A 1V9PA 3O5BA 5FPNA 3Q8RB 4EX6A 1LW2B 3OTOJ 3G6EN 3OT9A 8ICPA 5A6PA 2RUSA 2PD1A 3ZETB 2N1RA 4DPOA 4PHDA 4I2IA 3BO2A 5KFFA 4C0HA 2Z2MA 3EICA 2CPHA 1XSNA 5HHHA 2UUBK 1LXJA 2D7SA 3N9UC 3AAPA 3N97B 2YX8A 1URRA 1XR6A 2V7YA 4CK3A 5JVHL 1T8EA 4EEKA 3JPTA 1TUUA 2LYVA 3ID8A 3NMRA 2QT7A 3NF6A 2QN6B 4KBOA 2FJVA 4LFBJ 4XDDA 2M3DA 4QZBA 2AIRB 4J9OA 2MPUA 4MFCA 1L7NA 2DO4A 4I2EA 1T44A 2BW7A 3NVVA 3P96A 3NAHA 1C20A 1TFWA 1S97A 3RRGA 4NWIA 3QO9A 1W2BR 5F0WA 3CMQA 1SKSA 4JI6K 3U9ZA 1BI4A 1RAFB 1VK3A 4RPZA 4ZKAA 3HULA 4ED5A 2WSFC 5HP1B 3UO0A 4Y2TA 2VQFJ 3VQEA 3KK3B 5SWMA 2HQGA 2W2QP 4GMJB 1WB9A 2W3RA 2D9OA 2WOMB 9ICMA 3BO4A 4DX5A 2AA4A 1V85A 1PK1A 5SUHA 3M2UB 1JJHA 1BL3A 1NK7A 3OGUA 4CRXA 1AA1B 1Y3KA 2HSZA 4C7YA 3JSRA 1RFQA 5ALZA 2DKZA 4D3GA 4WYWA 2BGGA 4RQMA 1MROA 2V50A 2RU3A 3S8SA 1GLCG 5ETVA 1N5TA 3J81U 1KVBA 2KEYA 1HYSA 2EK6A 2IBKA 2HS0A 4DV6J 3CJKB 5K4LA 3H20A 4RWXA 2J7WA 4I2AA 4CZJA 3Q8MA 1BUXA 3IRUA 4Y2AA 4D3HA 4JLHA 3DOLB 1VRQC 3I56N 2RDDA 2WSCC 4J2DA 4DQRA 2QWOA 3W2WA 3DMJB 2B4PA 4TU8A 3Q8YA 4Z4EA 1SV4A 1TV9A 2KG5A 2IM1A 3MECB 3HWTA 2OJ3A 1F2GA 1OMSA 3WC2A 4UOHA 4DN0A 3VF0B 4WFBQ 3UIQA 3F53A 1QJHA 2BHNA 3V6HA 1RHQB 4UB2A 3UN5A 2PA3A 4KHRA 5AQGA 2EVZA 1IQZA 3UKUB 3SLCA 3BR9A 2YJFA 4ANEA 1KW4A 1Z2LA 3C2PA 2G08A 3L9ZA 2KE7A 2IVFB 1T95A 2V0NA 1HWUA 3DLLQ 5M1QA 4BC9A 1M5PC 3L7OA 3RJJA 1JKHB 1UOCA 1WUDA 4EBDA 3FZMA 4BR9A 2R4FA 1DARA 4USMA 5LMUJ 1BA1A 2GIFA 1SQGA 2M70A 3FVYA 3U9DA 1LWFB 3ZTQA 4JKGA 3MR3A 1T6DA 3M8PB 4ED6A 4P71A 1D09B 1NSQA 3A3PB 1ZAXA 3FSIA 2GELA 1U1MA 1FWLA 1JXEA 5A2QY 4ACOA 5AJ3J 3MMCB 1T9YA 1J54A 3D2SA 3QX7A 4GMKA 1LK7A 5B0BA 3VZHA 2DBYA 7ICNA 1SWWA 3KHYA 3UR3C 2P6RA 2GFFA 5ETTA 4JP8A 4U7UK 3V5RA 2W54A 3PYFA 1IJJA 2A1SA 3O1LA 4JKDA 4IR9A 4NCAA 3C5FA 3OTOF 5M2PA 4BC4A 2ZEJA 4XIUA 2COLA 5C7PA 2LQ9A 1CG2A 3QUBA 4I1TA 2X6SA 2ACYA 3B6BA 4OLOA 1FVSA 2ATQA 1P6TA 2YY6A 3THVA 2OPPA 1K73O 4OHWA 2PE8A 4FLUA 1TFRA 1CULA 5MLCV 4GW6A 2W4DA 4OKJA 1S48A 1UETA 4RQ8A 2ZD1A 3D54A 3ZZPA 3U7JA 1SC1B 1N36K 2V34A 4XTTA 4WU3A 2A6MA 2I1QA 2GAHC 2KT3A 4LFBF 1B9FA 7ICEA 2NYVA 3V2UC 2JWKA 1TKTA 1WLJA 4U7UD 3NGRA 3DDHA 4M04A 4ZPTR 2CH6A 4DR3K 4FPAA 4E98A 4LF8K 4I2GA 4OLBA 2ILZA 3MF5A 3CYMA 3V81A 1QUVA 5LMNJ 3HZGA 4W5TA 4X84A 2GJ2A 3TABA 3NF7A 5CD4H 2BE7D 4EGLA 8ICEA 4BRIA 3L2QA 2YCHA 4KLJA 2BEFA 1IR0A 2XZTB 3R7SB 3N5FA 1J53A 3GFKB 3KG4A 2VQFF 4UUXA 5G5GA 4RQ4A 2DIUA 3D6RA 4JKHA 1YITN 3NOCA 3FR0A 4ZCLA 1N5SA 2XG8A 3BPSP 2KO1A 2RJZA 1DQ9A 3ORYA 2DH8A 3Q23A 9ICQA 4DQ8A 3BS5A 2CAJA 1N32J 5AK4A 1ZD2P 2HIQA 1NK4A 4KH0B 2O8EA 4NLWA 4DFKA 1VDVA 5DBBA 3OR1B 5IFMA 4DHYA 2FLOA 3BEXA 4DTXA 2HMIA 2OPRA 2EHGA 3PRVA 4QBUA 4DV6F 2XHWA 3GMGA 5AXLA 3JPSA 1RCHA 5KG0A 5AQUA 2POKA 1RZTA 1OY9A 2XYGB 4PXBA 3R1LA 3DLKB 4BRHA 3HJVA 1ZAWA 3LA0A 1VC0A 3H08A 1NPRA 1ZTWA 3O4QA 1X5SA 1F5CA 4CLLA 2QX0A 3T5JA 4Y2MA 4V19J 1J5EK 4CTAA 1IIPA 2OSQA 3BGFA 4RG8A 3MXIA 4XH4A 3I9V9 4IS7A 1TKXA 4UAVA 4FYWB 3BZCA 2Z1HA 4UW2A 3Q83A 1MDUB 4F4KA 8ICOA 3D2WA 2KZMA 4NMXA 4NLNA 1ATRA 2OA8A 8ICBA 3N4QA 1B7FA 1VLYA 3VZIA 4WJBA 1EIYB 1NSKL 1HPMA 1V3ZA 4PL8A 2R7TA 4ES1A 5AQOA 5AQZA 2YNIA 2R8JA 1Q7LB 4XO0A 4QS8A 1WAFA 4QWDA 2H5EA 4NXZA 1VK0A 4NXNJ 3GOIA 5TKWA 4BRMA 1HUZA 3LH2S 3JTOA 4CE9A 1MWYA 4GVBA 2XS5A 3PV8A 1RHKB 3HF5A 1JN3A 3LALA 1KL9A 3OYFA 2YTCA 5LMUF 2AP6A 1Q0NA 2E66A 3KOAA 3VPZA 3BS7A 2A6OA 4J2AA 1FIQA 1XBWA 1S1XA 2M0GB 4N7TA 3U27A 4DV1K 3V4MA 3H40A 4H0OA 3RH4A 2IOHA 5AJ3F 1UVKA 4QIGA 1QZ5A 1KVKA 2J6TA 2J6SA 4W5RA 1NGEA 2YWHA 3ZZZA 1RT7A 3TUPA 4PQAA 2LYBA 4J9PA 2FUG9 3FM9A 4R25A 4OL8A 3BDEA 1GX5A 3AT1B 3RBEA 3SCJE 5C42B 4ECZA 3AN1A 1M5KC 3MM6B 4KR0B 2R2UA 1PG5B 3C6TA 4H54A 2BM0A 4CHQA 1OJ4A 1ZETA 4OI4A 4PAAA 3HOTA 4NCBA 1ICEB 2J9DA 1QZ6A 4BACA 2E6LA 1CQNA 2HRUA 1VQYA 1EB0A 3LGNA 4TYBA 5M1FA 5HJYA 4K4ZA 1WSRA 4Z94A 3G96A 3H5XA 3BQTA 2QRRA 2FHOB 1RGIA 3CETA 4PRFA 3P5BP 3H2LA 4B3SK 2XRIA 1HI1A 3GDQA 1U6ZA 4KIAA 3K5NA 4K2XA 1FKOB 3DRPA 3POTB 2CJKA 1NZ8A 3IWNC 2HW3A 3H2UB 4OHXA 4KHSA 2FZKB 5BPCA 4DX8H 1OW5A 2GTDA 4KE5A 2OMOA 4CNQA 4CLFA 1X9SA 3T41A 2AJ1A 3L7PA 5LMNF 4M3TA 3D6TB 3LP3A 5AI5A 4WYLA 1FFGB 3A3OB 5D78A 5J2NA 3QJPA 2O8DA 1SC4B 4WQ5C 4RNHA 5BPMA 1XQIA 2Z57B 4NJ8A 1FK9B 4DOAA 4OYZA 4M9HA 2C22A 2ZG6A 4AXIA 4ZVHA 2FJWA 2QL7B 1TK5A 4HDHA 2YVSA 3TSPA 2CPXA 2JX2A 2MRLA 2W9BA 1W97L 4TLQA 3R97A 4B3OB 2QLXA 3SI6A 4US9A 4FWMA 4B1UB 1N32F 1TL1A 1E3MA 2HHPA 2DNGA 3VTHA 1HHQA 2DGUA 1VC6A 1S1VB 1VQOS 3W5XA 4C4SA 5AZJA 1WEZA 3H8WA 1REVB 3HM8A 4J37A 3PX4A 1TYQA 4DSKA 2E1EA 3IDWA 4B9TA 2X1AA 1ROFA 2IJFA 1RT2A 3ETMA 2BABA 3A12A 2GMLA 1T7PA 1WC0A 2C2NA 3QEXA 1N34K 3MURP 1BVSA 1NJWA 1I3AA 4CZIA 3G71N 2CGLA 4YFKA 1SKRA 4OLAA 5THWA 1OYDA 5CYJA 1DTTA 5HR7A 1X4BA 2HHQA 3VAMA 4LRDA 5IV3A 3HZEA 4ES2A 3FRYA 3LPEA 2HNYA 4Y2QA 5CA7A 3P6YC 1E6VA 2IC3A 4O8KA 1UCNA 2BX6A 5ALOA 2Y9TA 2ASLA 2P9PA 4OI3A 4HTUA 4BDPA 1ZA1B 4X4UA 3AM9A 5G4DA 4DX7A 4KPCA 2UXCJ 1BOTO 5AFUH 4ZJOA 2QMWA 3EVMA 1IVZA 3OYCA 4ZPWR 3J80Y 3KLGB 4G3IA 3MMBB 5HN0A 3V6KA 4IUFA 4IC9A 4QWEA 2HGNA 1HBMB 3QBCA 4DR5K 4NXNF 4A5AA 3A1YG 4ZPBA 4DPWA 5IC4B 1IKXA 2MY8A 1D8YA 2HLUA 4QS9A 5GINA 1RTIB 3L2VA 3EKUA 4CO0A 2QLTA 1K8AT 3UI3A 1SI9A 3VF6A 3FZ2A 2YMQA 3SV3A 3EX7B 2F7VA 4EBCA 3HJFA 5DZ7A 4Y1CA 2B9EA 4GC7A 2VCPA 5HBMB 3NGZA 1L7OA 4DHVA 2CN1A 4DQIA 3PG9A 3F9MA 3ZNJ1 5L1LA 5IZHA 4OZNA 2W42A 4AE5A 2O66A 3L4PA 2Y0SD 5A8KA 1X5TA 2QEXN 3MR5A 7ICGA 3MAAA 2ODGA 2Q97A 2YHAA 5FLXU 2G2OA 2F8SA 1RUSA 1UEVA 2H3ZA 4KGZB 4RQ0A 1XO0A 2VBWA 3R8EA 4NL9C 2BE9B 2EAOA 4H4MA 2NRRA 7ICJA 2JWLA 5EHHA 2Z1GA 1EXQA 3PIOL 1XR7A 1XWLA 3JPPA 2CPIA 4WF9L 5HRSA 5LSRA 4FJ9A 4WU2A 1EKEA 1WAJA 4BQLA 2QXLA 3VEOA 3EE3A 3ILJA 2Y9HA 3RWUA 2PAVA 2OEKA 1HQEB 1XQSC 2PFUA 5CCMA 2BPFA 1J2NA 3CC4N 2CA9A 4OZ0A 4I2PA 1TGOA 2FGCA 1J6ZA 1HNXK 2PI4A 4WTOB 2KQ2A 4EFHA 1IH7A 1RABB 2BDUA 2RF2B 1NGBA 2Q43A 2IVYA 2N82B 4M3ZA 1FJEB 1EETA 3CCLN 2MKYA 4CLPA 3ZD9A 5KFZA 1C0MA 2YXLA 1SV0A 8ICUA 3E51A 1X40A 3IP0A 1HLUA 3M6XA 2D3DA 4C97A 2BKOA 4NLBA 2ZJPQ 2LLZA 4IQTA 4KB7A 1AFJA 3AODA 3ENBA 4M1KA 1RDDA 3QNNA 1IQTA 1YF5L 2MDAA 3VAIA 3L4BC 1VQPN 2LP4A 4YB6A 1XMOK 3S01A 1SH2A 2BOPA 3VERA 3P4IA 4YMNA 1ED1A 2KZ3A 1KLNA 4MKVA 3CDBA 1UFKA 1HNWK 1F6TA 1NOZA 1TUVA 3OBIA 2VQEJ 4MFBB 3K57A 2ZHAA 1BISA 5J2MB 3ZXWA 2C2MB 3S3OA 4DR4K 2BXJA 3C46A 3KHRA 3VEVA 2LDIA 2A18A 3ILIA 3HRDD 1CS4A 1XUPO 4RQ5A 2UUTA 4KO0B 4MFFA 1ASVA 1MU2A 2CPZA 3N4WA 1GTHA 4CGJA 1VQMN 1H7XA 5EOZA 1T3OA 1BPBA 4V19X 5JICA 3LUYA 1Z2ZA 4DOCA 3AVGA 2Q4TA 4ISFA 3WK5A 5IC6B 5ALQA 2KXNB 2VC1A 4CVNE 5KL8B 4NLGA 5GAGU 4B3RJ 1R8PA 4ZLLA 4GV6A 3C2KA 3HP6A 3PRDA 3ZSWA 4CF4A 2KHOA 4NCGA 1X42A 5IIOA 3CD5A 3R5GA 8ICSA 4K0KK 3HCXA 5KT4A 1PAUB 3RAXA 5DETA 4CM0A 2LYHA 2KKVA 2WVEA 2J0QD 1N33K 3K9JA 1YJTA 1B9DA 3IAYA 4I7FA 3KWMA 3KLHB 2RSQA 4FL9A 2LM4A 3ITHB 1LKYB 5ETQA 3HT0A 3UQ0A 3G9CA 2IMWP 2VWBA 4F4YA 5HROA 3VQSA 1PC4A 5KFSA 4JKBA 4ECQA 5HAOA 2VICA 2WSEC 2UUCK 1U8SA 3DGVA 5LM7E 2MKKA 1Z1BA 1WF1A 2UXCF 3MN6A 3OR2B 4YMOA 1U48A 5AE3A 2DTJA 2X51A 4CT9A 2V94A 2AQ4A 3SR6A 2WOMA 1ZH5A 4OI0A 4NYNA 4IOAQ 1WHYA 3KHHA 1FFVA 4Z2XA 1X9JA 4A62A 4O9MA 1M1GA 4MDAA 2B6AB 4ILGB 3MD1A 4NLYA 3AA5X 4CBUA 5L9XA 1H72C 2LHTA 3MMVA 3TJ8A 2LVWA 3M1VA 3HD2A 1HPZA 4FYVB 4HYKA 4OJ6A 2KHVA 2OFHX 3WXLA 3U8XA 2QWNA 3GR0A 1AT1B 2BQRA 2WZ1A 2LA6A 4MFAA 3HSGA 2AW0A 1HA1A 2KXFA 1QM9A 5CCLA 2DD8S 4KRFA 1KOOA 2UV8A 1G1XA 3HTVA 4JHDA 4FZLA 5A0YB 2UUAJ 3CCZA 4RW8B 2G5HB 1RCXB 1PJ7A 3DHXA 3FKBA 2HOIA 1RTHB 1WC6A 4C98A 4OJ3A 4NZ6A 2DPIA 3VQ8A 3LM2A 1VSHA 3KJFB 3MX2A 3F73A 1HUXA 2YKQA 1T9XA 5I3PA 4KTQA 3TACB 5J0RA 3TVYA 2VHGA 2DPJA 2BKNA 3ETOA 1ZQTA 5IOLA 3CD6N 2WBMA 1S76D 2NR0A 2H9ZA 1YJUA 2IVNA 2M0NA 1C7YA 3Q8PB 3HSTB 5SZTA 1ASUA 3KUEA 4J90A 4DSFA 5EDWA 1FKPA 2YNFB 3VEYA 3DRRB 2EFNA 5KFVA 5AQHA 3EPGA 5EXWA 4DV2J 2ZOMA 2O6KA 2VA3A 1WBBA 4KH1B 5CYQA 2IIRA 4N76A 3GFXA 1IBLJ 4Q2MA 1HL6A 2W7OA 3Q0AA 3KLIB 1SQKA 5AQJA 1XC3A 1RILA 2CZVC 2YKAA 2F3NA 3SIPB 4I9QA 4CZFA 4QYRA 2ATCB 2NRHA 2PYJA 1NHUA 1GFWB 1IBMK 3IGVA 3CCUS 3V9WA 4A8YA 2JLGA 2F8MA 1KQGB 2VQEF 4H4OB 3W8GA 2V52B 1LOTB 2QA4S 1R8BA 1S6OA 4RW7A 2V2QA 2CWXA 3B78A 4DR7K 3D7EO 1H3DA 4LF9K 3PYDA 3BKFA 3JAMU 4USJC 7ICFA 2C3PA 1PVQA 1LAVA 3QBWA 4F36A 4ZJLA 3L0QA 4KBIA 3NVKA 2EXUA 4BC7A 4IG3A 2XMVA 4Z0UA 2NO4A 3FLCO 2FVQA 3ADAC 1EHWA 4FJKA 4CJWA 1BXNA 2C3UA 1QSYA 5KOXA 1VJQA 2KH9A 2QWPA 3BV8A 4ID1A 4AM6A 1X4FA 4NLVA 1EKSA 4O3NA 1RQLA 4B3RF 1Q81O 3HRGA 5J2QA 3NDKA 5GVQA 3SD7A 5AXMA 2FIUA 2HS4A 4DU3A 1F21A 4GXIA 1QTMA 3WX4A 4M5IA 3SI8A 3BSNA 3MEGA 3QT5A 3BGLA 1YTYA 2YHXA 3IFRA 4AQYJ 3V1RA 2VANA 1BMQB 1N0VC 2W6LA 4YD2A 3CF5Q 2XB2D 2NNWA 2V8PA 2RDIA 4AD6A 2OEMA 2GJIA 1HNIA 4TQRA 2PXIA 4FNHA 4A2BA 4O3MA 2ZITA 4ECTA 2J8AA 4Z4IA 2OP5A 5B08A 2BH1A 1YTAA 3DV9A 5HL7Q 4TUQA 3FMWA 3GSIA 2XLKA 4QOTA 5AQKA 3QNOA 5JS2A 1EZZB 4WK3A 2VONA 1ZBIA 1RLCL 2Q1NA 1BQXA 1WOPA 5ALIA 1JCEA 4I2JA 5K8NA 4HL9A 3DGPA 1HKAA 2WMMA 4UBBA 3CCVN 5M1KA 2F3JA 4CGFA 4MMOA 3KKFA 3E3XA 3CJ5A 5KI6A 4ZLJA 2P5VA 5DDMA 2GCFA 2Q6BA 2M9KA 3TUIC 4C8YA 1L3SA 2FHJA 3QAUA 3T79A 5DM6Q 1SZ2A 1IWAA 2P9SB 2FPLA 1S6PB 1X4DA 5D77A 2MKSA 2CVEA 2E20A 3W9HA 5A8RB 2XMUA 9RUBA 3PLAA 1A5XA 5AK6A 5F8NA 3IXQA 3KKRA 1AW0A 3R9KA 1JLCA 1TP7A 1TVRB 1SCJB 2O5DA 3KK1A 2CQGA 3PHTA 5CQGA 2UVWA 1ZBSA 2VASA 1WBDA 2DFEA 1NH7A 1ZPVA 1KN5A 2R42A 2LQBA 4NPOA 2WVCA 2ZM6J 4JI5J 5DK5A 1Z00A 2PA8D 2PFQA 2UUAF 5GIPA 3OXLA 5J0QA 3DM2B 3DAWA 4CGIA 5JLFA 3T3FA 4NYPA 1T03A 2YX4A 3WXKA 5CABA 5AZIB 3MXHP 3LANA 1ZZFA 2OYQA 1XI1A 4Z6CA 2ABYA 4H0XB 2OM6A 4UB8U 1B0VA 5HATA 2RHQB 4HHJA 5ITHA 2G8FA 4FF4A 1HJRA 3HVRA 2MAXA 2M5YA 4CEFA 4AHTA 3AVLA 4IXCA 3NUQA 2ITMA 4ED7A 3ZT3A 3OS1A 3GLJA 4DFJA 1R31A 2HZAA 1EQMA 4C8MA 2LCWA 3O80A 4DUTA 3O1WA 2YQ0A 4UBCA 1HR0J 3TEHB 2IM2A 3ENWA 4ZPCA 4YMEA 4YOVA 3SFUA 3QWUA 4DV2F 3T19A 3I55N 1RWKB 4JK7A 2XYHB 1BQNB 3VCBA 4CJKA 1IBLF 3O4WA 2KP7A 2LU2A 3MEDB 3H5YA 2JLFA 4Q0BA 4LIRA 2DFHA 4RBVA 5BOLA 1EKRA 7ICHA 1C1BA 2E7XA 1GOAA 4F93B 3M2VA 8RUCA 1S9EB 4J8FA 3L8BA 3GG0A 2MXYA 3AY0A 4ZVTB 1X4CA 3SUPA 2HBZB 4Y34A 2AGOA 4I56A 3QFUA 4PGQA 1BPYA 2DRAA 3HX9A 3I9ZA 3AVKA 2O67A 1HBOB 2QSFA 1FRJA 2V2KA 3EZUA 1R0BG 2EK1A 3SBMA 4Y00A 8ICKA 1DQAA 2G13A 3C65A 3EE8A 1ZQRA 3K89A 1KSPA 4C1NI 2OHDA 2EPIA 2FMPA 4CGGA 2DGZA 4XRHA 1HKBA 4F26A 4A61A 5C24B 2PMZC 3K8VA 2FPHX 1PYTA 2A19A 4RUCA 4IO8A 1JRPA 5D8HB 2KZZA 4QZCA 3AA4A 3OTOK 4PL2A 4LR9A 2DNQA 4PXEA 3SSRA 4OJLA 2PIIA 2YQ1A 2F9DA 4C3KA 2R7QA 1WG5A 3LP0B 4RW6B 2I0XA 3H6EA 3GTYX 2I9SA 1OQ3A 1SXLA 3OLAA 1VQ8N 8ATCB 2IM0A 1FKOA 3VQTA 2JWNA 4P0PA 2GZOA 4AQYF 5HMZA 2WTUA 4USVA 1LKZA 3ZSXA 4KHYA 3NH2A 4B3TJ 1F3FA 3M32B 4BRPA 3M2RB 4FK4A 2XEXA 5J0PA 1ZRNA 3MUVP 1WSFA 4A8OA 4K42A 1YHQN 4LFBK 4PUOA 3L3FX 1S0OA 1KVIA 4ECRA 2OIHA 1RT3A 2IAJA 4BXOA 4F72A 5AE2A 3QIPA 2C2EA 3PMNA 1FK9A 2M8DB 5L46A 3MDAA 2D4WA 3A8YA 4YDUC 3CFPA 1LW0A 3H3NO 4H5TA 1S6QB 3GV5B 3GSDA 4QIWF 2DCLA 2AJ4A 5K9FA 2K3KA 1PVRA 1RWUA 1L8LA 1P7DA 2W7AA 2DY1A 4P4PA 1WI8A 2YX1A 5DGAA 3TI0A 2WB4A 3Q24A 3AOAA 1IG6A 4PYDA 4B3OA 4OI6A 2VQFK 3OUYA 4IEEA 4OI1A 4WFAL 1Y3JA 1U6FA 1N4LA 1YAGA 5AQYA 4Z4GA 2YWFA 1PILA 3R9LA 3THXB 2CPYA 3ZZOA 4IRKA 1U0SA 3LM9A 5IIMA 3SZ2A 2CNNB 1NNEA 5KFLA 4BX9C 4LVNP 2YKOA 5D0RA 1GLBG 2DIVA 1FW6A 3QU4A 4FPIA 4C1NK 3VN5A 2XGPA 4Q44A 4J9KA 1P9QC 4KYZA 4M9NA 2B9XA 1RDRA 1S3XA 2CNOB 2Q6CA 4AYBF 2D5RA 2YKNB 4EP5A 5DQGA 4DV6K 2ZM6F 5HQLA 4JI5F 4W90B 3KZXA 3C7NB 5GTIU 4J9LA 1VIOA 5KFAA 1DY3A 2MKCA 2RPIA 4RTFD 3GJSB 4IFYB 2UU9J 1JMSA 1KAYA 4USKA 3P5TL 4QW9A 3CJQA 1BPDA 2R8HA 8ICLA 5D4NA 3QUQA 1KRPA 5AKXA 3BSOA 2K8AA 1ZYQA 1FWKA 2AX0A 1NKBA 2MSSA 3AHPA 3V4IA 3AOCA 3TWHA 2EC2A 1IBKJ 1QQ5A 5KFJA 2YWEA 3KMSA 1D8BA 4EI2A 4IH6A 1U2VB 3B6PA 5LT5A 1QE1A 2ZWPA 3P39A 2Y1JA 4IKFA 2F9TA 5G0RB 3ZSOA 2C42A 5F3ZA 1HR0F 2B9WA 3EPIA 2ALZA 1Q82T 2D0OA 2CUYA 1Y9OA 5CRXA 3HHKA 3VGUA 1S22A 4FJNA 4JI4J 3F2KA 2GO7A 2W7PA 1H2VZ 1OH5A 2F1JA 4C7ZA 2CDRB 4KTWA 2MLYA 1RT1B 7ICIA 3G6ES 2QM1A 1ZQKA 5D0EA 2B7BB 2AH5A 5KG6A 4ITSA 1RTJB 1P8GA 1T02A 2H3EB 1UVNA 4NEZA 3G82B 2F7TA 4XEIA 3J81j 4DOBA 1AZSB 3PM9A 2XULA 2IMOA 3EO3A 7ICVA 2AJ2A 1FD8A 5LMUK 1BIUA 2MJNA 3IRXB 2V4RA 1JLFB 1UPPA 1DT9A 3D2FA 4IOCQ 2UZAA 4MEXA 3ID6A 1CLQA 2GAGC 1VC5A 4DL6A 1OY8A 5E41A 3U3GA 3UDLA 4Y6IA 2BDPA 4IOBA 5AKLA 2XBPA 3GCWP 2IOFA 2E4LA 5AJ3K 4DUYJ 3UR0A 4ECWA 4RW4A 2ASDA 4WFBL 8ICHA 2QB0B 2RILA 2BJDA 4EENA 1SL2A 5HVHA 3P4UB 3WQPA 2VWJA 3UNGC 3CQ8A 3PNCA 3VQ5A 4U9RA 1IG8A 1DRGA 3VF2A 3J81O 5K8PA 2ZBIA 4M5GA 9ICXA 1B70B 2PGCA 5EVZA 4KY3A 3G25A 1LVHA 4DFMA 4B9NA 2RQCA 4O4GA 1UFWA 4EZ6A 1MQ3A 2VPYB 2B0CA 5ETNA 4OHZA 4ZPAA 1ZQMA 4PWUA 3DLLL 5D0HA 4F3MA 1X7VA 2XIDA 2H48B 4CHYA 4I2HA 4UOFA 4US8A 4YN4A 3QBXA 4B3TF 4LR8A 5A0LA 1Z1ZA 2CQ2A 5F2RA 1WHVA 5LOQA 2X1FA 5F9NA 2HQIA 2WONA 4JWMA 3WZ0A 2MY7A 2N7YA 4MN4C 3TO8A 4O3QA 3SFGA 2PZSA 1LWCA 3TR8A 4DF8A 1LCUA 4NI2A 4ZVPB 2CRLA 4J91A 4UAWA 2CQIA 2MQLA 2P9NB 4FWKA 5LY3A 1S1UA 5LMNK 1S1WB 2VF3A 2DO0A 4ZITA 4KAZA 1ECWA 2BRKA 2HNZB 3KOOA 1XC9A 3G0ZA 4RT2A 3R7BB 1WDDA 3R2CJ 5E5NA 4ECXA 2JH1A 4OX8A 3ZZYA 2B4VA 2FE9A 1JL1A 2ZE2A 4V1Ak 1VQKN 1GLFO 1S72N 1UWBB 4O0IA 4DG1B 4JK8A 3EEQA 2H5IB 3CCQN 5EX3A 5H2FU 4WQ5A 2RRBA 3K0JA 1RQ0A 5FPEA 3RMCA 5ALSA 1N32K 3NS7B 2XICA 3SBGA 3IWXA 2DR6A 1C0UA 2ZZTA 3PCOB 1PVPA 1J27A 3SDEA 1KKHA 2I9GA 4C8LA 2E8OA 4GVLA 4ZVFA 4AXJA 1RT4B 2ZUAA 3AB4B 2ZIWB 4FO6A 1NSAA 2B8QA 4MJKA 3W2VA 1DLOB 4DSJA 3KLHA 1ATNA 2ZBCA 4FP9A 3A5OC 2OMLA 1FESA 4QZ8A 1NKEA 1Q86O 4BRAA 2RE1A 1JXVA 2UU9F 3JXUA 3J7YP 1L3KA 4ZN1A 2RQ4A 4C2MA 5DB8A 4BQZA 1T94A 1A0PA 1XNRJ 1UA0A 3SCLE 4YY3J 3LL3A 3CD0A 2XY7A 3ZDDA 3SQOP 2DTUA 4L72B 5HQMA 1HQUA 2V7ZA 1IBKF 2OXOA 1TK0A 4KGVB 4CLSA 5F9LA 3PJWA 3UDEA 3QETA 2J5AA 3FJ2A 2AF6A 2ASYA 2QWRA 1RDAA 4N8NA 2B6AA 1V4TA 4LF1A 1KOHA 4PPZA 4YOEA 4CGZA 3DOMB 3QRQA 3T1YJ 2O8FA 3HX0A 4ZCKA 4EELA 2L3MA 2FBYA 2GMHA 2KKZA 4JI4F 5CZXA 4NXNK 3O9TA 3OS0A 2ROGA 5J8YC 3QGHA 2QYCA 1N60A 4FZYA 3MDCA 4NA2A 3D3CJ 1LWXA 1PO6A 3H0PA 4JV2A 4CH0S 1W7AA 3EDQB 3RSEB 1DURA 1G6BA 1TFYA 2EFOA 4FWLA 3RH6A 3H3OB 3OYKA 1YG0A 3NH0A 1OWXA 3AB2B 5F8LA 2R7RA 5AIBA 3NS1A 1ZRMA 4KB1A 3SJJA 2DNRA 5C25A 2K60A 3NXZA 2B4OA 4BREA 2CNKB 2VG6A 1GLAG 4FF2A 4A47A 5KT5A 4QW8A 1COOA 4I64A 1Q9XA 4DUYF 4W5NA 4N56A 2Y8WA 2KM8B 1NGJA 4IDKA 2XSJA 2E5JA 2DGSA 2DXFA 2IIHA 2GWSA 5F0XA 5KQ8A 5KFEA 4NLZA 2KD1A 5AKZA 3NGIA 1WSJA 1QY7A 5GAHP 3OA9A 1NPKA 3EJMA 4PH5A 2KJ8A 1Y11A 3C6UB 3WXMB 4USAA 3NMUA 1X5OA 2DKXA 3IRWP 2Q36A 4LF7J 4JV5J 1YITS 1ZQWA 3OL8A 4H5NA 4IL6U 5LSOA 1KQFB 4KN4A 2HB5A 2CQHA 4U8YA 1ZOTA 4NOHA 1D9FA 1HW8A 4JI3J 1U26A 3GB0A 4QZAA 1JJ4A 8ICMA 3GILA 1B99A 1IJEB 3QSIA 2E5IA 8ICGA 3DC2A 1NJIT 3PJ9A 4A46A 2LPEA 2V9WA 3F5TA 4B08A 2HFUA 3IAM9 3IM1A 1AFIA 1ZBUA 5C5JA 5JMNA 1R6YA 3AVJA 1X66A 2KICA 8AT1B 3ZSYA 1TR0A 1UL3A 1KP6A 3AO1A 4KLUA 3EUB2 2G2YA 4J9RA 3AEVA