1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD51
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
2G77B 3LBIA 1L2TA 3FDSA 9ICUA 1XJ0A 4EKDA 2YC2C 2J3EA 4URUR 5DHFA 2GCPA 4B3CA 4RZRA 1CR0A 2WMOB 4F5QA 2YOFA 3VR6A 4RZ2A 4BECA 4YXMA 1IN5A 2Q9BA 1RRCA 1QHHA 3CZQA 5KT2A 2L0XA 4C7OB 1X2IA 1QDEA 4NM2A 2GBLA 4M1TA 2IWRA 4Z6DA 2O8FA 1J8MF 4DT1A 3HYTA 3IKJA 5KFAA 1E2PA 5HKKA 4LYAA 3OZXA 4B9SA 1ZMXA 1ZQMA 1YZNA 5FUXA 4I2AA 4ZV4A 2P65A 1N6PA 3C15C 7ICSA 4KFUA 4S2EA 3QF4B 4RUAA 1L8QA 1N3BA 2DPXA 2AN9A 4YC7A 3QBTA 3E2EA 2XZLA 2AL7A 2OILA 4F4CA 4O3SA 4NU0A 4RD1A 3VMFA 4DFPA 3LK9A 1ETUA 3MJHA 4RD3A 3K1JA 1P2VA 4HB4A 1XEWY 4M9LA 3VKHA 3R8FA 4QWCA 4ARZA 3EIHA 5KFLA 4BLOA 1G20E 2GKSA 4PO9A 4KLOA 1AGRA 1KRPA 2WWFA 3BWDD 5A4JA 3MFHA 3K75D 3Q5EA 4M1OA 3U4QA 2G3YA 5AUNB 1Q22A 3MDAA 2ZI5A 3DHWC 4ARZB 5CJPA 4ELTA 2VP2A 1M7GA 4EPRA 3V4FA 3WBJA 3ND8A 1IN4A 3GLFE 2O8FB 2GJ9A 2LKCA 1AS0A 2R44A 2NO6A 2A9KA 2GETA 1UT5A 2ASEA 2O8CA 3JPSA 1W36D 3H8JA 2WV9A 2IUUA 4ECQA 3SYZA 4W7SA 2NRWA 4J9KA 1EG7A 4PGYA 5EP2A 1VG9B 3MG9A 2QZ4A 4GNKA 2FWRA 3T12A 3T61A 3R9WA 1DGSA 1AN0A 3THXA 4QZFA 3VR4A 4J9MA 2J7PA 4A8JB 3CX7A 5HMLA 4EDHA 1EWRA 2JLQA 1XD2B 2UVVA 3PV0A 2H18A 4BLTA 3AVXA 5KFBA 4URYR 1ZM9A 4RNOA 2C5LA 2XZPA 3R7WA 3OJUA 3H2YA 1M6NA 2BBTA 4QXAA 5KFGA 4KLEA 1NLYA 4ECSA 1OHHD 2V54A 2XTNA 2NRTA 3AKEA 1LY1A 2ZTSA 3BERA 1HT2E 3QEAZ 7ICVA 1ZCBA 2AKYA 2Q0HA 3KFXA 4GRAA 4JYCA 4Q01A 4Q1CA 4TLDA 3HU1A 1ZQEA 2BC9A 4IQUA 3R20A 1GWNA 1XTRA 4YXWD 1NKTA 1VIYA 5E7IA 2ZITA 1Z6YA 1E2HA 4JLVA 2XOKD 4F4YA 2J7PD 4TQUS 1A82A 4V0ME 2GWHA 1XWIA 4L4UA 3BH6A 4DQQA 2AD5A 1OXUA 1J70A 4EFMA 2ZI7A 4H1UA 1UKVY 1QSLA 3RRGA 3BC1A 4Z54A 3GLIE 3GLFB 1XSNA 3KJIA 4B9TA 2A5JA 1X8KA 4HAUA 3WYFA 3WBKA 4BRUA 1T8UA 3RB0A 3M9MB 1TF2A 3BBPA 3RR7A 4N3NA 2IT1A 4NH0A 4GI7A 2BCJQ 1N5KA 2QP3A 3RS3A 5JJLA 1QHXA 4ECXA 1SVKA 3C2LA 4KTQA 221PA 1JN3A 1UFQA 3BQTA 4K8OA 5CLLA 3WYGA 1II8B 4M9HA 4MFCA 4Q1BA 4C0HA 3AP3A 1TQ4A 3OIUA 4DCNA 5TB5A 1U45A 1Q3TA 3BJIC 1ZYQA 2ZRBA 2R9VA 3B85A 2YJTD 1AS3A 1OFUX 3FVQA 4QZBA 2ZRIA 2ZRAA 1KKLA 5EQTA 4EPTA 1P73A 3U4QB 4DL6A 1YR9A 1X9MA 7ICIA 4HZUB 4XD7D 5JI3E 4I2JA 1IN7A 1HH4A 4LHWA 2XOKA 4NYJR 4RPXA 3REGA 3GJ6A 4EBCA 3T5GA 1HT1E 1Z6XA 5KFZA 2XEXA 4OHXA 3A6PC 2MSDB 4LPSA 4PC6A 3U44B 2JASA 3O8RA 2PFOA 5J0YA 2QQEA 1DAKA 2CK3A 3Q8RB 1TK0A 2P2LA 4ECZA 3SR0A 3SN6A 1BS1A 2QSYA 1KOFA 2NRXA 1TF7A 2ZS8A 2F9LA 5DBBA 4GZLA 1Z8FA 9ICBA 1GL6A 1U81A 2EW1A 3PUVA 2ERXA 4I1SA 3TH5A 2JAQA 4D6PA 3EA0A 3QVVA 1N6NA 2ZE7A 4MITA 3OHMA 1R5BA 3MAAC 1DAEA 3RR8A 2HHVA 3HDTA 4P31A 5J40A 4CT5A 1QLNA 3DMDA 1BPDA 2BKUA 3NEJA 1B23P 1RC8A 4EZ6A 2ATVA 2PH1A 5CK4A 1Z2CA 1CEEA 5KFXA 1TV9A 4YR0A 5IIJA 1Q1BA 4QHYA 1Q20A 2BJVA 4TTRA 2A5GA 3AB3A 2VTKA 5EZ5A 3MDCA 3I72A 3RBEA 2GWSA 2FMPA 1W5SA 4O2RA 1TEXA 2FX3A 4JS0A 3JVUA 4XSHA 3X1ZA 4DVGA 2J6SA 4Q4JA 1B43A 1ZD9A 4XD7A 4ECRA 1Q1QA 2ZRNA 2EQBA 3K9LA 3GLGB 1E2LA 5LD2C 1W0KD 5G3ZA 1XEWX 5JECA 1E2QA 4NCJA 2GA8A 3MUFA 5FBWB 3WHLA 1UBCA 1XPRA 2RAPA 2WVJA 4DCUA 1ONBA 2RB4A 4W5JA 4Z51A 5KFIA 3K8YA 1VYTA 1ZQZA 3UXPA 1NKSA 4D4MA 1W5TA 3GP8A 4ASUA 3I62A 4BLRA 4JVSB 4P4SB 4AI6A 2CBZA 4C7OA 3CRQA 1XZPA 4ECUA 4NBSA 2NGRA 1BGXT 4IW3B 4WXPA 2NPFA 4KCGA 1KEJA 5KFQA 1DVRA 2PLFA 3CB4A 3KB1A 2M9NA 2F3RA 1UEJA 3ZGXA 4LX0A 5EUQB 1S97A 4URWR 1DADA 2D3WA 1LNZA 5L3RA 4DC9A 4TUPA 4RNNA 5DB6A 4BXOB 2QT0A 2GCOA 5J4LA 3QZ7A 2ZSBA 1GRQA 1G3QA 1W4CA 4TLCA 1XPUA 3J81k 4FINA 1NK4A 2V8OA 1JR3D 1J7KA 3T5HA 2AHOA 1BMFA 1TL7C 3NTUA 2BV3A 1MQ3A 1V5WA 2GVDC 2QU8A 8ICQA 3KJHA 2QUZA 1DAMA 2XAUA 3AKYA 2ZRFA 5KTQA 2EWVA 2MSEB 2OAP1 3EZFA 3K0CC 1CTQA 4Z8XA 4NM1A 3CF6R 2QBYB 3LW8A 1LFDB 2ZVQX 1YU9A 5DISB 1E1QA 1OFHA 3G5UA 4LHYA 4R9UC 4HDOB 5FOVA 5IIKA 4NLNA 2I3BA 2ZAMA 3PEVA 2IHBA 4RSGA 1MC8A 1KJWA 4NLZA 4B2LA 4HUTA 4IEIA 4JLKA 1HTWA 4F2SA 4RFSB 4Y0VA 3RRZA 4YQWA 4F93B 2OZEA 2FV8A 2O0KA 3C1ZA 1X9SA 4ASUD 3Q8PB 2W83A 1FNNA 3MSXA 4M0LA 4PX9A 3SNHA 1ZQUA 3ASYA 2VSOA 2BPFA 3B82A 2IYVA 4G5SA 1NMYA 5IK2D 3CR7A 4UNQA 4QWEA 4JV0A 1AS2A 4HSEA 1G9XA 2HYIC 2ZETA 5J2BA 4I28A 2BHNA 1X6VA 4CEIB 4M8NE 4C3ZA 4UB2A 4V0OA 4IOJA 2DFLA 1WCLA 4ED0A 2QY9A 3PW4A 2P6UA 4TTQA 2ZVPX 2RCNA 3HWTA 1Z3IX 2VL7A 4TL6A 4R2IA 4PC1A 3TKLA 2NMVA 1E0KA 3CRW1 5F9HA 1GRNA 4ZH4A 4URXR 5KT3A 3GV5B 3RNLA 2Y8EA 3VHXA 1N6IA 4P4PA 7ICPA 4MF8A 1VG0B 2QI9C 3M8SA 5IILA 2YV5A 4J0QA 3WY9A 4UJ5A 4C0AC 5FR1A 4BPBA 3CZPA 5TY0A 1HYQA 2YYZA 4U00A 3RJKA 5JBQA 4LYHA 4JWNA 3QUSA 1S0NA 3PW0A 3E2IA 4PO1A 5KFWA 1G21E 2ZYUX 5LBIA 2QM7A 5CA7A 3RAQA 1NJXA 1GRRA 2NOAA 5J2EA 4RD4A 3U7EB 1QSSA 1IXZA 4HYKA 4X5VA 1F3OA 1G16A 5L1JA 2CHVA 4XVQA 1TAUA 3PEWA 1Z08A 1LF5A 5CWRA 3EZ5A 2ZRPA 2O8BA 4ZI2A 4B6EA 5JWOA 2BQUA 2KB0A 2BOVA 4DCTA 5JS7A 3LH5A 1WBDA 3MFYA 4LHXA 4ESVA 3ZIAA 4DF8A 3GFTA 3TFRA 4X8OA 4ABYA 1SL0A 1XO1A 4E07A 621PA 5J4HA 7ICOA 1ZNYA 2CLSA 1SHKA 3SOPA 4CEHA 2BCSA 4LHVA 3RS0A 2JJ2A 2D7CA 3NDBB 2QAGA 4GP7A 5JCPA 3KTQA 2JLWA 2N1BA 3A1SA 4O0IA 4PC7A 1S10A 4O3PA 4QZCA 2WJGA 1IM2A 3DVLA 2LWIA 1P75A 2FLLA 3QVUA 2DB3A 1MH1A 3C23A 4XRHA 4R2HA 1DG3A 3PX0A 4QZHA 4XVRA 1E4VA 2C8VA 3L43A 4NDZA 2HHSA 1MO6A 1ZQPA 2EYUA 2O0HA 1P2UA 1RYSA 5BWMA 4OI1A 2V4RA 3HPRA 5KG0A 1T4GA 4PHFA 4M0AA 2OESA 3PJRA 3ZS8A 7ICQA 3RRNA 4M9NA 4DIDA 7ICMA 2WJHA 3GJ3A 1KJYA 4P3YA 1XJCA 4URVR 4C8LA 2JJ2D 2GJ8A 1SXJD 3IEVA 1DOAA 2HHQA 4DLEA 2AK2A 2VEDA 4O2LA 2FSFA 1ELOA 2NTYC 2IYSA 3PENA 4GZMA 4YMSA 3I5YA 4MH0R 2JLRA 5FTJA 3SBEA 5DG9A 2RGNA 3SC3A 4DLXA 2ATXA 4WXRA 5IRCD 1U9IC 4CVNA 1VIAA 4C8KA 2GXUA 3FFBA 2JDID 3GLHE 1N56A 3NEYA 5EUMA 1COOA 4KODA 5DDMA 2OBLA 1II9A 5TVKA 2C9YA 4R71A 2RGGA 1QSYA 2HT1A 3PUYA 4DOAA 3QG1A 1R6BX 3NH6A 3OFND 3TAHA 4LUCA 4TQ9A 5FPTA 3WP0A 2I4IA 3SJZA 2QRZA 2GZAA 4KBFA 4TMKA 5JHHB 3PEYA 4TMXA 5TMPA 4A2PA 1UKEA 1WBBA 4KLSA 1GP2A 1XSPA 1RRPA 2R8RA 1ZM2A 1AGPA 1NK0A 4JWMA 2PBRA 4V0NA 3PY8A 2P6RA 1NBMD 3K09A 3WMEA 4B47A 1NLZA 3ISBA 1A1VA 4DO9A 9ICRA 2OFOA 1AKYA 3TSZA 2OLKA 3LY5A 2JLSA 2ZRKA 3EC1A 4DDVA 2BDPA 3OGUA 2QMUA 3UQ2A 2WWHA 2DFKB 1TNDA 2WWXA 2GZHA 4CW7A 1L3TA 5FR2A 3ASZA 3U6BA 4G3IA 5ELXA 1OJLA 3TJZA 2OLJA 3TAUA 5KFTA 4QZ8A 1P7CA 2HCBA 1S3GA 2A78A 4HZIA 8ICTA 2WHXA 5D3QA 2VSXA 4Q9KA 1WXQA 5EZ6B 1UADA 1GZSA 1CEZA 8ICOA 4TYWA 2BEKA 4ED2A 3I1FA 3I92A 4QC2A 3RWOA 4DL3A 4DLVA 1ODFA 1RXWA 3D3QA 4E03A 2C98A 5HKKD 2FSIA 2ZRLA 9ICIA 3QXJA 4YVZA 4R8UB 2VHTA 4UJ3A 2ZTEA 4DL2A 1CR2A 2VHQA 3CPJB 4HLUA 4JBXA 3EX7C 1LV5A 5KFYA 2H92A 2IF2A 3IILA 4JLNA 1CR4A 5FUVA 2GEDA 1PUIA 4R64A 1XFAA 5D46A 1YE8A 4A92A 1JQJC 1AZTA 3Q72A 4BFVA 1DAIA 4EPYA 4WVFA 1OKKA 1IXRA 2Q0ZX 3LRPA 1B0UA 1VECA 1FNMA 2C03A 4LY6A 2JLXA 4A2QA 4MKIA 1SGWA 1KDHA 9ICQA 1YRBA 3CNOA 4QOSA 4YXWA 1FPMA 1I2DA 2D2EA 5GJCA 4MYUA 5LB2A 1VCMA 2QSZA 4J9NA 4JUZA 3EAQA 1JI0A 4UB5A 2R6GA 3MMPA 5FI0B 1FQKA 3CWQA 5KPJA 3RS5A 2QP9X 2BCQA 2BBWA 3LNCA 2N46A 4RKFA 2VSFA 1TMKA 1SKYB 1E9EA 3S1AB 1CKEA 2KN7A 2IUTA 4M9JA 2XX3A 4DF4A 3RWMB 2BQRA 4BFWA 5SZKB 2CL6X 2YKGA 5HNKA 5KFPA 1XP8A 1VTKA 5B64A 3QEOA 4QW8A 1R0YA 1SVLA 3ZDDA 3VR1A 1J8YF 1S3SA 4XJXA 4JL6A 1TAQA 2BR0A 1NN3A 3L82B 1IXSB 1L3SA 2W9MA 3SV3A 2YINC 1FTNA 2PZGA 3K9GA 1S96A 2HJVA 3O8BA 4IDHA 4Q4AA 8ICGA 2Z83A 1IM4A 1D6JA 2VHUA 9ICMA 4DQPA 2FU5C 1DTSA 1OPXA 4EIWA 1PLJA 4C9BA 3Q8QB 3Q7PA 1YJ5A 1WB9A 1KDRA 3K0CA 3MGHA 5KSPA 3ZS9A 3G6XA 1KY2A 3TUIC 2CE7A 3ZDAA 4DQIA 1K5DA 1Z0FA 3LQRA 4W9MC 4GBMA 3A4MA 3T1VA 4ZDKA 3JPRA 3ND9A 4L8GA 4V0MA 4XTCS 1KI8A 5TARA 2NQ2C 2A5DA 4DL7A 8ICHA 2JEOA 3KDSE 4WZ6A 1NKBA 5BOLA 1XS9D 1NOMA 4MA4A 2OT3B 3EPHA 4Z6CA 1Z47A 2HF9A 721PA 3DKVA 1XMVA 4L15A 4FXPA 3GILA 3FWYA 4NKRA 5KDLA 2FDCA 3BQ0A 1XB2A 1ZINA 3CM0A 1S77D 4ZKDA 4OHVA 4BUJA 4RQ5A 2PJRA 2DPJA 3RS2A 1W0JD 3B9QA 3P1JA 4ECTA 2VA3A 3GEIA 4IOMA 4HLDA 1IJFA 3MWKA 4TZ6A 1GKUB 4ON9A 3K9HA 1WQ1R 4C0KA 4IQVA 5JCZA 1T3LA 1U8YA 3H4MA 4KU4A 3RSLA 3WHKA 4FWTA 3QI2A 4KYUA 1SVMA 3B7GA 1UBGA 5AJXA 5KDOA 2Z0MA 1RIFA 4ACBA 1KMHA 2WIAA 4AYWA 2W2TA 4V0KA 3RB3A 1JXOA 1F60A 3HYRA 5JI2E 3HP1A 1OSNA 5J2FA 4LJ8A 4R98A 1TVAA 3B5JA 4QZAA 4P2HA 4U5XA 4ZIRB 3U7FB 3UATA 5J0PA 2RGNC 4IDNA 4A36A 1CRPA 2F1IA 3V6HA 3GQBA 1W44A 4YN4A 2WOJA 4GT1A 3QZ8A 4B9LA 1XTKA 2KFNA 9ICXA 1IXRC 4ZCLA 3NDPA 4QM6A 1FP7A 2UVWA 3PG5A 5GJBA 1NKCA 4AKIA 4IVQA 5J2JA 2HVIA 5J0TA 3AF1A 3PITA 1P9WA 4I2GA 3BFKA 3QIAA 9ICOA 4ILEA 2R6CA 4JL5A 4QBHA 421PA 2F6RA 5E7JA 1OXVA 1UDWA 3U3MA 4YMWA 3RRMA 4BGDA 3V7LA 1SXJC 1ZQDA 2GILA 5F98A 1JPJA 4DIEA 3Q7QA 4NTZA 4GL2A 4EJSA 4OQXA 1GFIA 2ZROA 2ZJYA 4FMCB 1Z07A 2MUTB 4C2UA 1O3YA 4F4WA 3U7GA 4IFBA 5CJ2A 4IRKA 1NVUQ 1MO4A 4PPGA 4DJTA 3PR4A 1D9ZA 1ZD8A 4YCXA 4BRWA 1N5JA 2GF9A 3NIBA 2O8EB 1AQUA 2XY7A 1AKEA 4KAXA 3Q8KA 3KL4A 3DL0A 1W2GA 1HURA 1Y88A 1ZBDA 4DEZA 3U44A 4DSKA 3ZVRA 3IQWA 5E95A 3SI8A 1GG2A 2WJVA 4MRNA 5CYPA 2IS2A 4TWZA 1OIWA 2CXXA 3GEEA 1E9DA 3UK6A 3UMFA 2ALZA 2C2DA 2CDNA 4IKEA 4F4JA 2CNWD 1W36B 3H4DA 4YDHB 3GJ8A 3IQXA 2GJAA 5EWEA 3FKSA 2GXAA 4RJLA 4F7WA 1IY0A 1P2TA 3IM1A 1R8QA 2HV8A 3UWKA 4KLMA 1T0JB 4J9SA 5J0WA 5J2AA 4RQ6A 3NKVA 4D82A 4QM7A 5GJWC 3I61A 2WKPA 3UIEA 4NP6A 3ZVNA 1KI9A 3QKUA 3EPKA 2HXSA 2OAQ1 5JRZA 4XQ8A 5KO2A 4GP6A 3RH5A 5F9LA 4OK5A 2O8EA 5FL7D 4KLQA 4UXIA 5J0OA 1U94A 4KLTA 5FPSA 1E0SA 1XXHE 1ZIOA 4H9GA 3WYAA 2IA6A 1E2EA 3C5CA 4JLJA 1TAGA 4PAMA 4TQRA 4PQRA 4DFMA 2ASDA 9ICVA 2CJWA 2WMNB 4AIIA 4GFDA 2CCGA 3W6OA 2J5XA 1W36C 2FJUA 5KG4A 4M9XA 4ITRC 1KZGB 3AEZA 4GMXA 1OFIA 3QF4A 1QHGA 1W0KA 2AFHE 2BCGY 2BM1A 4LJ9A 3M1IA 2C2EA 4C2TA 1JJ7A 1H8HD 4W5WA 3PVXA 2D74A 1ZQCA 3FHOA 4LRWA 4M1SA 4NYIR 1VMAA 3QE0A 5DYGA 5JS8A 2HHWA 5KSYA 5KNDA 4YR2A 4F5NA 3GV8B 5EXTA 4LZZA 1XPOA 1XEFA 4XTRA 3WMGA 1EX6A 4M9ZA 2IYUA 1OT3A 3EZ9A 3ZLJA 1G6OA 2DFTA 8ICIA 1UF9A 2DYKA 1HV8A 2ORIA 4FBUA 3B9PA 4JZKA 5JHGB 3N2EA 1PVOA 3EWAA 4D0NA 4F91B 1R0XA 7ICHA 3NVAA 2XXAA 2QNRA 3HR7A 7ICRA 3RJIA 2ZAOA 2ISPA 1E1QD 4IRCA 3IPXA 3W5IA 1IJEA 4O25A 1FFHA 3U3JA 1VCNA 1KYIA 1H8HA 3PV8A 2KI5A 4B9NA 4M21A 3M9OB 3HR8A 1HE1C 4LGMA 2GJSA 1E2KA 3NBYC 4CIDA 5D4BA 1CU1A 4ZKEA 4NY8A 3W6PA 4I2CA 3KQHA 2ODEA 1WF3A 2XGJA 4HLCA 2HEIA 2IX3A 3VR3A 3VQTA 2FPLA 5DGAA 3TMKA 1VKJA 5L1KA 2RHMA 2ZRGA 4ACAA 4BWJA 2ZANA 1Y3AA 3EW9A 1QHIA 3U3OA 5F9NA 4FMDF 2CMKA 2QTVB 5CB6A 3EPLA 5CYOA 5KFNA 4O3NA 3KTAA 4WBSA 3AQ4A 2W6IA 3CNLA 4J9OA 4D26A 3WMFA 2GESA 4Z8YA 3U2QA 1COWA 3MFIA 9ICLA 2AD1A 1II0A 5D3MA 2WPDA 4AYXA 5FH9A 5M04A 3QY0A 1E2GA 3A1UA 2VLIA 3MR2A 4RFVA 4QZDA 1KSPA 1S9HA 2GK7A 2YWHA 3ZD7A 1TPZA 2FPMA 3SJAA 4Q8EA 5J2IA 1NI3A 4DFJA 3PUWA 2ZE8A 1N25A 5FOTA 2CLDX 2P0EA 4KN4A 3SU8A 2JJ1A 4L16A 2GXSA 3TANA 2BCVA 1E2NA 1D9FA 4FWIB 2BKEA 1SKRA 4EBDA 1ZQLA 4KI0A 3K70D 1KAOA 3AP1A 3TK1A 2MAXA 1W2HA 1CLUA 1KJZA 4BFTA 1SULA 3TW4A 4U7DA 4XIGS 5KFMA 3BH0A 3ZH9B 1OXXK 521PA 3G82C 1A7JA 4MKGA 3T1OA 2J0QA 5KG7A 3I73A 4YG2A 3UPQA 3CWZA 1KO5A 2OXCA 4PZLA 4Q4HA 5DGXA 5FI1B 3VTKA 3M6AA 1TEVA 2QENA 2DFNA 2JIZD 3NH9A 1NIPA 1T8TA 1S0OA 2BM0A 9ICSA 2H1LA 3IUYA 1MRSA 3O47A 4PSKA 4B3XA 2C78A 5FPKA 1S1MA 3TI0A 1R4AA 4B9MA 3CKLA 3CRMA 2RGDA 4JLPA 1CJKC 2I1QA 3RYTC 2V6JA 3MWYW 2G9NA 4TT3A 2F43A 4YP3A 3GMTA 3QPUA 5H70A 2KZ3A 2FEMA 3I4LA 1G3RA 3PUXA 4RQ7A 2HHUA 3WXMA 3K70B 2WSMA 1OIVA 1VYVA 4PPFA 1BPEA 2WJIA 2ODNA 3RJHA 1ZW6A 2QAGC 4D0GA 1NNEA 2BMJA 2CEAA 2J0UB 1W4AA 2ZS9A 4WOPA 2O8DA 1KI6B 1HUZA 1KKMA 1G8YA 2NO7A 3HU2A 4V03A 3AV0B 2E9SA 5KNBA 4P4OA 1KFTA 1X3SA 4LYJA 4Q1DA 4RT3A 4HUQB 4MRVA 5DHAA 4RU9A 5F2EA 1HUOA 1J2JA 3T5DA 5KPDA 3PO5A 2J45A 2QTFA 5F3WB 4F92B 1ZQYA 1MABA 2AK3A 3ZZTA 1NN1A 4D2IA 2ZJ5A 1CIPA 2JLVA 1M74A 5C46F 2BDTA 3L0SA 4I1VA 4M2LA 2XB4A 3ZDQA 4TMVA 3FHTA 2KFZA 5DQIA 4I99A 4LWZA 2ASLA 4OQLA 3N70A 4UNPA 3THVA 3H40A 3EZ6A 3PMNA 1F2TA 1IQPA 4BZPA 4CDGA 3V4RA 1ZD1A 4MDFA 4TQAA 4I2DA 4CCHA 8ICNA 1RKBA 2IBKA 1KK2A 4DLWA 1ZJNA 2WBLC 3TIFA 2JATA 4WW0A 1RYFA 4DLSA 3MLEA 3LA6A 3KQKA 5HZHA 3NHAA 3V7KA 3AP2A 4Q8FA 2IEZA 5KU1A 3RLFA 3ADKA 5L3VA 1NKEA 4RQ4A 1NBMA 5BN4A 3THWB 2AXPA 5C4GB 1ZC3A 4GC6A 3U61B 2PT7A 1ZQWA 4P0TA 4KLFA 3KQLA 3MR3A 1WA5A 1HEIA 3K09C 4BFUA 1JIHA 1JXLA 5HR5A 1R2QA 3AF4A 1XRJA 3GJ0A 4AURA 2Z43A 2RKOA 4PHTA 3OIYA 4TTPA 1XDBA 2KTQA 2V1UA 4FS2A 2DY1A 2IYQA 2I1VB 1MQ2A 3GQCA 5KT5A 3PNCA 4P33A 1GITA 3JPTA 5J4KA 1IN8A 3W3ZB 4LZDA 3BDPA 4Q43A 4I2EA 1EESA 1G17A 2ONJA 1NY6A 2BVNA 4FI3C 4Z1MA 4Q4JB 3JPOA 2ATLA 2PT5A 1C7YA 1KMQA 3PQCA 4MKFA 4YQFA 3B13B 1XCPA 4JSTA 4YMVA 3M8RA 4R65A 5BQ5A 2IHYA 4JLAA 4C30A 1RVDA 3ICQB 3I32A 1T3SA 2OCAA 5JJKA 1S4QA 4OI0A 4LV6A 5FL3A 4C8NA 3TSWA 2IYTA 1OKKD 1C1YA 4I29A 1NVXQ 4HB3A 2ZJZA 4L9WA 2J7KA 1ZQNA 2KBEA 4MRSA 4ESHA 4LZGA 1OW3B 2REOA 3WNBA 1Z29A 4Z6EA 4PZYA 4IQTA 2WWGA 5AUQA 3UG6A 4C0QC 5IT5A 2PMDA 2UKDA 2Z5FA 5FFMA 5KSOA 3W3AA 1X1SA 2W00A 1OYYA 5JSZA 2RGEA 2OCYC 3AVOA 1NSTA 3FMIA 3U3KA 1F48A 1LV7A 1VG1A 1G41A 1KHTA 4BFYA 5JRJA 2QROA 2H5XA 5J2HA 2QMHA 4KBGA 1Q1EA 4M04A 1W0JA 3BB1A 4GC7A 4RZXA 1N6HA 4TMZA 1TQDA 1D5CA 4TSFA 3UANA 8ICEA 2R8GA 1BPBA 2XCAA 3SYLA 4PGQA 1QHSA 2OBNA 3GFPA 5KT7A 1FP6A 2QL6A 2R65A 5DI3B 1JXEA 3S1AA 3WNCA 3FE2A 4I1UA 3A4LA 2BBSA 3SI7A 2PEZA 1CULC 1XMSA 3RTVA 2W58A 1YZKA 4RQ1A 2AJQA 1YVDA 1EFTA 4XWAA 1KGDA 3QJYA 1E2IA 5IIMA 4MDEA 1XTJA 3PMLA 1J90A 1HUQA 3BB4A 4JVLA 3C4JA 4Q03A 2YWGA 5DI9A 4Q4LA 7ICKA 3K0FB 3RH4A 3NBXX 4B6FA 2YC4C 3HPQA 4TSFD 3VAAA 4XUSA 2ZTCA 1XMJA 3B2EA 5AUPB 5BOMA 4CGZA 4I4LA 3T1QA 4IOLA 4F8RA 4O3MA 1ZVQA 2GCNA 2QMEA 1XU4A 3ZZUA 3BIFA 3GLGE 4RUCA 4UQGA 4UB4A 4ED8A 1JQLB 2WTFA 1KI6A 3NG1A 4LDJA 2B8TA 1X8LA 2E1RA 2WAYA 1M34E 3LDAA 1XC9A 3QKRA 4ZPXA 3R9IA 5P21A 1ZCAA 1T5IA 4HEJA 4L9SA 4YLGA 2C22A 2KZZA 3OSPA 5EE0A 1R7RA 1SVWA 4HLUC 2C95A 2FMXA 3DKPA 4DCSA 4RFSA 3VNVA 3GDXA 3T06B 1UKZA 2ZYWX 4HI0E 2P5SA 1T6NA 3RBDA 4G3XA 5EXPA 4I81A 1Z5ZA 4QW9A 8ICFA 4G5GA 4GPTA 3LQQA 4DLRA 1NJFA 3OAAA 4LJAA 4DCVA 5HZKA 1ZQOA 3V6KA 3F0TA 2NZJA 4C0BA 3RJFA 1W46A 4YMTA 1EWQA 2R8IA 4J9PA 4F38A 1S0MA 1Z2AA 2QBYA 3CH5A 4UQOA 2A1JB 1D2EA 1YZUA 1OFTA 1SKQA 2B7BA 2DWPA 1QBKC 3ZVLA 4KFRA 3VU9A 9ICFA 4KLGA 2QAGB 3ISDA 1NY5A 1Q3HA 3AUYA 2H7VA 1LS1A 1VHLA 4KMUA 1G1MA 3OHBA 2NRZA 4MKHA 1KI4A 1NG9A 3VX3A 1FTSA 2Q3MA 2H8KA 4HAWA 4KFSA 2IL1A 4KLHA 3KXKA 4B3BA 1W1WA 1TK8A 1U98A 5J4VA 3SFZA 2PZEA 5K8IA 1XMIA 2EVWX 3FMOB 3TGPA 1N6RA 3E5HA 5FTMA 1XNJA 2GEVA 4MGZR 2ZEJA 5DQHA 1ZQXA 3BJYA 7ICTA 5J47A 3Q8XB 7ICJA 4ZDWA 4OBEA 4DUGA 2VP5A 4QNMA 1ZQVA 4QJ4A 2OM2A 5DBAA 1X86B 4RQ3A 1JXMA 4YONB 1GILA 1N48A 4M2YA 2NO9A 4M6WA 2FFAA 4ECWA 1XBTA 2A30A 3K0EA 4O3QA 1MO5A 2JLUA 1BPXA 3VNUA 4FMBB 4JBYA 2IF0A 3EIEA 2V6IA 3THWA 4N1AA 1XJQA 5KFDA 2RGXA 1H8EA 1KTVA 5FOSA 1CJUC 3IDQA 4HB2A 2PLRA 3K4GA 2X2FA 3IEUA 4AG5A 2X2EA 1DAHA 5KG2A 2ANBA 1BOFA 2XSZD 4DHEA 4ED3A 3CO5A 4GMDA 5DQGA 4GXKA 1S76D 1QHHB 1NMXA 1DE0A 1ZM3A 1E9RA 3ZQJA 1WCV1 3BB3A 3FKSD 1Z63A 1ZQTA 2Q3HA 4ZO4A 2PCLA 2ZUDA 4DLYA 1E9SA 2GCOB 2IYYA 8ICBA 4PHEA 1NJYA 3GCGA 4Q9LA 4M9QA 3TVDA 5IIIA 4MEXA 1KLNA 5LB4A 3VHLB 5H68A 2W9AA 3QBVA 4DEXA 4X8HA 2AXNA 5L3QB 1ZU5A 2X19A 3THYA 2DHRA 2EFHB 3CLVA 1ZQKA 4HDQB 4NCIA 4I2IA 1EXNA 2OO7A 3UXMA 2J0SA 3HU3A 1E9FA 5AJYA 2FOLA 1YR8A 4NHOA 4IR1A 3K53A 4N0EA 1L7VC 5C5JA 2BIFA 2VYFA 2VHCA 4KSBA 4P32A 3C2MA 3T5LA 1KI2A 3WRYC 3EARA 5FOXA 4B48A 3THYB 3EC2A 3Q8SB 1F5NA 1ZQSA 1AM4D 4YMUA 1PLLA 5J2CA 3RANA 3IIKA 4A8JA 8ICSA 1KO1A 2W9CB 5B30A 4LOAA 2C9OA 1T3NA 2NO0A 1XD9A 2NPIA 1A4RA 1N5LA 2X8AA 3THOA 4YDSA 3SYKA 4DLZA 4OK6A 4MRRA 4PQFA 1XCMA 5KFHA 2F3TA 4DSOA 5L9XA 2GZDA 4IDQA 3AM1A 4TYQA 3OEED 3HW8A 2FE4A 3FKQA 2J41A 4PSVA 1FMJA 5IF9A 4TYYA 1NK7A 1RRGA 1FL9A 3MWLA 4LC0A 2IS1A 3PO4A 1VYUA 5DB9A 2PL3A 4IDPA 4TMTA 5DB8A 2VP0A 5C4MA 2Z4RA 2KWIA 1I4DD 3QEJA 4A6PA 4LV8B 1KK1A 1P5ZB 3BFXA 3E70C 4V02A 4UXHA 1E0AA 3KXLA 4OQNA 3GLFA 2RGAA 4YMMA 1Z0JA 2QPTA 3G0HA 1ZUIA 3OSNA 1ZETA 2KZMA 1SL2A 4EFLA 4OHYA 3D6TB 3PIRA 4DSNA 2FMSA 4RD6A 1NP6A 3F8TA 3LLMA 3ADBA 1E99A 4R63A 1KDPA 4OHZA 3IO5A 5CHGA 3WNDA 5KFCA 5E3HA 1HJPA 4I1OA 3WP1B 2AWNA 1DS6A 1N0VC 5KSZA 3EPGA 3VR2A 4DSLA 2QPAA 8ICVA 3IBYA 5BPCA 1PJRA 2LYHA 2Q9AA 3RS4A 4FIDA 4JMPA 4PC2A 1Z22A 4EYIB 1G5TA 1HQYE 2EU8A 2F1HA 4OK3A 4RZ3A 1U99A 4TYPA 3V72A 1C9KA 3EWSA 3X1WA 4CZ2A 2ZI4A 4EFNA 4OJQA 2ZJAA 2CLCX 2IUSA 4HAVA 4A0GA 3IO3A 4LBYA 4UNNA 1KSHA 4G01B 1U8ZA 2JDIA 4RZUA 1T8EA 4QJ5A 4WZAE 1UA1A 1Z6TA 4UAZA 3ETLA 4PHAA 1UPTA 2WAXA 2QAJA 2ORWA 3DMNA 2ODBA 3IPYA 3UXNA 2CE2X 3TBKA 1P9RA 1WE2A 4O5CA 1LTQA 3R9XA 4R7ZA 1I4TD 4U02A 3TQ1A 2WKQA 3DOFA 3A1TA 1JEEA 3AVTA 2ZRMA 4XOIA 5KT4A 1NN0A 4JJKA 2FFHA 2IXFA 2XXAB 1ZJ6A 5C18A 2ZS7A 4TYNA 4QZIA 3BFVA 4WZBE 1E1RD 3PVSA 4QBGB 1FQJA 3TR0A 4D81A 3PR1A 3FDIA 2P66A 2XO7A 5FPHA 2ZJBA 1NRJB 2BCUA 3AVPA 3GJXC 4JT2A 1L4YA 3B8HA 4KVGA 3QXSA 2O8BB 1OB2A 1TX4B 4NONA 3B1VA 3H86A 3RS7A 4Z6FA 1GL9B 4P4SA 3LBNA 1XXHA 4B74A 1JX4A 3Q8MA 1T7PA 8ICJA 1KDTA 1AZSC 1IAQA 1XTIA 2JZBA 4I2BA 1R5NA 5BYJA 4TT3D 3GEHA 1GL7A 4P4TA 3RABA 3CX8A 2FN4A 4F4IA 1T0HB 4YD2A 1KSJA 3FYHA 3GLGA 3ZVMA 4C0JA 1EFCA 3ZJYA 1E1RA 3NC0C 3KQUA 4WA7A 2ONKA 3UG7A 4DT1B 2EFGA 1YQTA 3MR6A 2ZSEA 3ECCA 5FBLB 2EFCB 4Q45A 9ICHA 3CH4B 4QGGA 4BZXA 2XY5A 1ZNWA 2ZU0C 3CPHA 3LV8A 4POAA 4PAQA 3I8SA 3H8SA 3H7IA 3X1XA 2NRVA 1G19A 3ISCA 1ZP6A 4DOBA 2O8CB 5JWHA 1Z06A 1W4RA 2OSBA 3CBQA 4PFSA 3ZDBA 1Q44A 2WIBA 2AQ4A 4JV1A 3QKSA 4EUNA 4TZ0A 1JAHA 5CP2A 4DS5A 3DM5A 4Q7JB 3GJ5A 3C1YA 1TQ2A 3MGCA 5L1IA 5TV2A 2IS6A 1ANKA 2VP9A 4QGHA 3BE4A 4LPKA 3OHAA 4RPZA 1QG2A 5CDFE 1LB1B 4US0R 1S9DA 2J1LA 1RJ9B 4UB1A 2Y1IA 4IXNA 5J5CA 3TLXA 1RPZA 3R7WB 1XTQA 3GV7B 2RMKA 2VP6A 4TURA 3WRXC 2PCJA 4DBLC 4MEYA 3MABA 1ZNZA 2FH5B 1Z00A 8ICKA 3RB4A 9ICEA 1AA9A 1X8JA 1HA3A 4MGKR 5J0XA 1P4SA 4Q4AB 3TR5A 2BWJA 3TUZC 4Q9JA 3VKGA 3OFNA 4XSGA 4BXOA 3QQ5A 5LDDC 8ICZA 4JV2A 4A82A 3GPLA 3O8DA 1E9AA 5GVSA 1SVOA 4DQRA 7ICEA 1ZUHA 1KK3A 4QNRA 3N97B 2J9RA 1UAAA 3RJJA 2DWOA 4DFKA 4KLLA 2BEJA 3CUEF 1U0JA 1K1SA 6Q21A 3GIIA 1MRNA 4Y0AA 3AVVA 2J46A 3A8TA 2V4ZA 3DM9B 2BHRA 4TL9A 3KX2A 1Q1ZA 4Q1FA 4WAUA 4YFKA 1OH7A 1KTQA 2N42A 4DDTA 2EWWA 2D7DA 2G0TA 4LJ5A 2BJWA 3PW7A 2ZR0A 4F5RA 2KJQA 2HLDD 4IJMA 4O5EA 4A9AA 5L8VA 3GLIB 2ZQ5A 2WZQA 2R62A 4RCZA 4M1WA 2FF7A 5CJ7A 5DKWA 2JEJA 2JCSA 4PHHA 2F7SA 2BPCA 1MV5A 5AJZA 2IC5A 4LHZA 1E2DA 5UKDA 1LS6A 5FBRB 2ODWA 5KG3A 1UEIA 1S2MA 3KHHA 2XCPA 1OF1A 1D9DA 2WJYA 3CW2A 3MJRA 1G5PA 2QP4A 5SZIA 1G7RA 4A0FA 3V6JA 1U47A 2VHJA 5FBQB 4BFSA 4PANA 4JJZA 1FOEB 1WRBA 4DS4A 3KKOA 1E2FA 4OHWA 4C8OA 2UZ3A 4PXAA 1K6MA 1KFSA 2YNMA 3BS4A 3F3YA 8ICWA 1NJZA 3Q9LA 3K0AB 4GSYA 3ZD9A 5CM9C 4ZCMA 1NSFA 2ZSDA 4EQ6A 4K46A 4K4GA 1CR1A 4E0DA 1MABB 2EYQA 4M53A 4JKYA 3T35A 2GDJA 4QZ9A 1L4UA 1JR6A 2RDIA 5KG6A 4G5RA 4DZZA 2V55B 1RXVA 2A1JA 4UBBA 3F5FA 2C9CA 1EFRD 4BLPA 5IINA 1BPZA 4URZR 2BMDA 1S0UA 3OAAD 4FCWA 1UJ2A 3GLIA 3AUOA 2GBLC 2BGWA 2VQSA 4QWDA 2AX4A 4NLKA 3TFSA 2JLZA 3ONWA 4MQBA 3RSOA 4ECYA 3ORYA 1Z6GA 1OV4A 4PPNA 1KI7A 1KSFX 3AU2A 4KXFB 1ZQGA 3L0PA 3QF7A 1N6OA 3I3SR 1YR6A 3PW2A 2ISOA 4A2WA 5L3SB 3U5ZB 3GJ7A 4FMCF 4JIMA 5DH9A 4BLQA 4O0MA 4PC3A 2GAOA 5G40A 3A4NA 1S1CA 4EAQA 2VF8A 3BXZA 1EFRA 1Z0IA 7ICGA 2PX0A 4DSEA 5TXGA 1QZXA 2FLPA 1MR3F 2HXYA 4KHZA 1G3MA 1ZYUA 1GOTA 1SKWA 5SZHB 2AGPA 2WSSD 2RH5A 3ZDEA 2R6DA 2H17A 2FLNA 3HPOA 4O9MA 1MSWD 2VA8A 1YR7A 2QRNA 2V1XA 3KTAB 3KKNA 3OE7A 4TL8A 1CJVC 3FOZA 1VCIA 4JLDA 5DI3A 3UQ0A 3U60B 5HTKA 4B2IA 4Q48A 4DXAA 1XXHB 4UKDA 1VHTA 4Q1AA 2W0MA 3ZZ0A 4FS1A 2AWOA 3AF2A 4H1VA 2Q6TA 3FHCB 1J99A 3A1WA 5KYKA 2JEFA 5G53C 1C4OA 1DEKA 3FTQA 4UBCA 8ICUA 1JECA 5DNYB 4MGIR 3UKDA 4DSUA 4C0LA 4M1YA 3QXCA 1GKIA 4KV9A 1ZQJA 1Q0UA 2CJWB 2J0UA 1Z0DA 3JZAA 4BASA 5HPYB 3I5XA 3L0OA 4EJSC 2D2FA 1E2JA 2QTHA 1Z83A 4ZCIA 8ICXA 4BQSA 4AYTA 4DKXA 3U7HB 4TLAA 1R10A 1JAIA 3BOSA 2IMWP 4ED1A 1M7HA 2V9WA 3C5FA 3MCAA 2HHXA 1QVAA 2IXEA 4XWKA 4MUAA 4KLIA 4QHSA 2GEUA 3C8UA 3FMFA 3T1TA 1RFLA 3L8ZA 4M22A 3TVTA 5JJIA 3B0XA 2XTZA 3TAQA 5JSZB 4AY2A 2QPOA 4R8UA 2MUTA 3W34A 2Q9CA 1KNQA 2X77A 5CK5A 2B92A 1N5IA 3Q85A 4FW9A 5KUTA 3RRHA 4PHGA 5AJWA 5J4YA 3JPNA 3PUZA 2AR7A 1ZQHA 1D8TA 3OE7D 4D4KA 2ZE6A 5B57C 2HDNB 1M1YE 2FMQA 2ZSFA 2AFIE 3C2KA 4F4XA 1CJTC 3LX5A 1OE0A 2IW3A 3RRYA 2CK3D 3VR5A 3BGWA 5KNCA 4DUGD 3BK7A 4MUBA 4BWYA 1G7CA 1MKYA 2FFBA 3KHRA 3C21A 1MT0A 1NVWQ 1KDOA 1KFDA 1PLKA 3LWLA 1SHZA 2YOHA 4M1KA 2AKAB 5EP1A 1D2MA 1FW6A 3MRSA 5J0RA 3L2OB 2BMFA 1KNXA 4Q4HB 2YVUA 1F2TB 1H8ED 4TMWA 1E96A 3SHWA 4ZDJA 3TSOA 5KDDA 5J0SA 3EASA 5DN6D 1E9BA 4O3OA 5KFSA 2OUKA 3LVQE 4JT4A 5CIWA 3OESA 1PUJA 5AJVB 1KO4A 4XH9B 4FD2A 2HUPA 2RDJA 2XGQA 2DR3A 3KUDA 2HYDA 5FBVB 4YMOA 5KFRA 1TU3A 1VPLA 5H1YA 3SJCA 4F2RA 5DYIA 4MFAA 1QVRA 2FNAA 2ZI6A 4LBWA 4OI4A 3K0SA 5DLGA 3K0AA 1GDDA 4KITB 1SQ5A 2FA9A 1JPNA 1MOZA 4BEBA 4A15A 2D06A 3DPUA 3NWJA 1OH8A 1ZJMA 5TZVA 3LFUA 4EPXA 3SHFA 3SQWA 2PFPA 1WCNA 2G6BA 2WJJA 2OEPA 1US8A 3QEBZ 4QG7A 2QQ0A 3A37A 3NHBA 4GLXA 1JR3A 1QTMA 2ZRDA 4IRDA 4E22A 3AKDA 5KFVA 4F4ZA 7ICNA 1G4UR 1G7TA 2WWWA 5AUOB 3LBHA 3LLUA 4IXMA 4BFXA 1P61B 2J0VA 2J87A 1FX0A 1D9XA 5AR1A 3SE0A 1R0ZA 4GDFA 3L8YA 3IHLA 5KOYA 3QXXA 5E4FA 4KYIB 2FZ4A 4US1R 5DN6A 2PI5A 1RW4A 2RGBA 5CDFA 2ZYVX 3AKCA 1T3HA 4M4SA 5ANRB 3TE6A 4XVUA 1FMLA 1NVVQ 9ICCA 4KSCA 4DWJA 3HJNA 1E69A 1U0HC 3TQCA 2ZXUA 3NC1C 3H8WA 3TAPA 2J59A 3REFA 3KJEA 4MF2A 3LWNA 4LYFA 4B44A 4IQWA 4BE7B 4MYCA 4V0LA 3RAXA 4AWXA 3W9YA 4JLOA 5KT6A 2JLYA 3Q3JB 5TDHA 2VRWA 2O5VA 5KTYA 3B0YA 1M2OB 1U49A 1GSIA 3NXSA 4RQ2A 2P67A 3W8NA 2A2ZA 4J9RA 2R6FA 1Z6AA 1SL1A 4HYYA 5BXQC 2QGZA 1OH5A 3DDCA 2CL7X 4K81B 1DOQA 1QRAA 4Q9HA 4OL0A 8ICYA 3ZYCA 2EFEB 3HX0A 2VH5R 4F4KA 3OEHD 3PR5B 4NYMR 4AKEA 9ICWA 1GNQA 5CITA 2GXQA 4RD2A 2F9MA 1BKDR 1KK0A 3RH6A 2UZIR 4II7A 1RE0A 4D4JA 4M9SA 1QHYA 3SQXA 5H8WA 4PSAA 1YZLA 1DAGA 3QKSB 2ZRHA 3V9PA 4LK2A 3AF0A 4O3RA 3NBFA 4NYJQ 121PA 2IHNA 4Q7LA 3G6VA 1IOZA 2WPDD 1ZAKA 3CIOA 1VDZA 3QE9Y 1I2MA 3JZMA 3QENA 4B34A 4P4MA 3SDZA 1ZQAA 2QN6A 3GLHB 5FTLA 4RKEA 2H57A 2ECKA 2KE5A 4FCVA 1KSGA 1Q57A 4DRZA 2NG1A 1P6XA 5FTKA 2WTUA 3CRRA 3JPPA 4B75A 3CR8A 4PZZA 3NBZC 5BN3A 3M0EA 8ICRA 1BYIA 2PEYA 2JEIA 4BFZA 4GOKA 1K8RA 2QE7D 3X1DA 1PZNA 1JALA 4JLMA 1JR3E 1W47A 1E6CA 2W6JD 5DBCA 2WICA 3DO6A 4CRWB 1E3MA 1BYUA 4LI0A 2IXGA 1P9NA 3U3RA 2QMOA 2XJ4A 3UMSA 2R6AA 4DSIA 1M7BA 3H1TA 3V7JA 3I8XA 5EE5B 4TUQA 3LX8A 5KFOA 4PTLA 3BQ1A 4UNSA 2JJ8A 3AU6A 3KQNA 4KFTA 3B1YA 3LAWA 4C8MA 1FUKA 1CJMA 4QGAA 2A5YB 5J29A 2Q3FA 3P4YA 2QG6A 5B58C 3IIMA 3EZ2A 4DQSA 1G8GA 9ICAA 1US8B 3KZ1E 3MBYA 5GVRA 2W8LA 1LF0A 3MD0A 4G1UC 4PR0A 1GKYA 3T34A 3AGPA 3ADCA 8ICAA 4B3DA 1NN5A 4ED6A 3PFIA 2AGQA 1SXJA 1NG1A 1DG1G 2XNDA 3AUXA 3K0FA 4PHPA 2V3CC 3BD9A 3T5KA 7ICFA 3QG5A 1W7AA 1NVVR 3SEAA 3B1XA 1FUUA 1GUAA 2VP4A 1NF3A 3TNFA 4B32A 1N0UA 4Z1MD 2B7CA 3EA5A 1ZNXA 2ZRCA 1BIFA 4DSJA 5G3YA 9ICPA 3TRFA 2W2XA 1NK9A 3PEUA 4CEJA 5AWFC 3MGIA 2OV2A 9ICJA 4A0RA 4K4IA 3LWMA 4J9QA 5KFFA 4KLJA 1GAJA 2OFXA 2XJ9A 9ICNA 3AH8A 3BAFA 3CPEA 1II8A 3EIQA 1T9HA 1L3UA 1TKDA 2IYLD 3KKMA 1BPYA 3AVYA 4PO8A 1F2UB 5EE9A 1DPFA 2W9BB 4FMDB 1X9WA 2CCJA 5J2KA 1T5LA 2XZOA 4OI2A 1DAFA 1P72A 5L3QA 1KMHB 2ORVA 2V7QA 1IN6A 4E5UA 1IHUA 3DZDA 4FO6A 1XX6A 5GJVC 5HHHA 3GD7A 2OE2A 2QA5A 3C16C 4LCBA 2ERYA 4Q47A 2IYZA 3W8RA 3PX4A 1QG4A 4B33A 4DSFA 3UWOA 2F1RA 4IHQA 2C77A 1D8LA 4RQ0A 3IHWA 3FPAA 4WIAA 3T15A 4ZDIA 2IK8A 2UVRA 1HQCA 2TMKA 3K70C 3KKQA 5KFEA 1GNPA 4DSTA 2JA1A 2QEQA 1NIJA 3KFVA 1RRFA 4MYHA 2KSQA 3EZ7A 3QPWA 4LJ7A 2WWIA 2GJKA 3N2IA 4TLEA 1U90A 1N2CE 1KO8A 2H16A 3AVWA 2F43B 3FGNA 4MFFA 1F2UA 5IIOA 1G3UA 1GTVA 4PHDA 2RGCA 4QKQA 5C2JB 4G5QA 3KJGA 2ZJ8A 2EFDB 4YMNA 3RDPA 5J2DA 3KKPA 4OQMA 1OB5A 5EWFA 2JEGA 1KY3A 3VFDA 1SVIA 5DDYA 5L3SA 1S0VA 3Q8LA 2VANA 2ZJ2A 4IFEA 4QGFA 3OIVA 2IWHA 2AGOA 2OG2A 2WOOA 4CEIA 4QL3A 3H0KA 5EOZA 3P32A 4ELUA 2AQ0A 1U0LA 2QM8A 4US2R 3PW5A 2CL0X 4CF7A 5CLQA 5DLFA 5KFKA 2HLDA 3FMPB 4JKIA 1EXMA 2FZLA 1ZQFA 4XA5A 2DWQA 3IIJA 3QKTA 2A5FA 2G88A 4QWBA 3KHGA 2W0SA 1ESNA 4HATA 5IDVA 4BLSA 2CVFA 2C99A 4XWOA 2GHIA 3SZ2A 2AU0A 2GVZC 2OCPA 2WM9B 2LCFA 3VX4A 1GIAA 5JMTA 2Z4SA 2WSSA 3AF3A 4Q9IA 1G5RA 3P27A 3JVVA 4DB4A 1WMSA 5DIFA 1PV4A 2B8WA 2REBA 2W9CA 1UA0A 4YD1A 3UXOA 2HF8A 4RPYA 4IR9A 3BORA 8ICPA 3W90A 4BWMA 2NO1A 1QF9A 3THXB 2XGPA 1ZRHA 4JBWA 4UNRA 3GJ4A 1QHNA 2W9BA 3DZ8A 5IK2A 3W5JA 1A77A 1NBME 4OQFA 1E0JA 5LD2B 2YOGA 3HWSA 2E87A 3B60A 8OHMA 2ZSAA 8ICLA 1T91A 4X8MA 3LO5A 1ZU4A 1S9FA 1OLOA 9ICKA 2ZI3A 5FOWA 4AKHA 1DBSA 3CRVA 1B22A 1MO3A 2XNSA 5AK0A 1BVSA 2CHQA 2K5UA 4HZUA 4RD0A 2ANCA 2WWYA 1RYHA 5EJEA 4QBFA 3IBGA 4A6XA 3CF0A 3SS8A 5EP3A 3GIJA 2PFQA 2ZRJA 1RZTA 2ZU6A 4ED7A 5JFGA 1DARA 1N6KA 1V9PA 4QJ3A 4QWAA 4ERNA 3QNUA 1A2KC 1W4BA 4A0HA 4JSYA 2QGNA 2NZ8A 4E09A 1JMSA 3CONA 5LPNA 2NIPA 2LKDA 5DG7A 3ICEA 3C7KA 3BQ2A 4B35A 1NK5A 1Z0KA 3DEFA 1UM8A 4PGXA 2YWEA 1E98A 4I2FA 2G83A 3E1SA 4TL7A 3TARA 3HP6A 1F6BA 4DEYA 5C1BA 2W8KA 3T5JA 3PX6A 4PAOA 2ASJA 1NLFA 2Q21A 2X1VA 5J0UA 1E32A 4UAWA 5JLJA 2O0JA 3BH7A 2IYRA 4HB0A 4Q1EA 3FFAA 3RJEA 4I2HA 4DL5A 5FUWA 3RC3A 4B76A 4OKSA 4RCYA 3AVUA 3Q5DA 4M9GA 7ICUA 4KVAA 4B3GA 4HAXA 5DO9A 1BO6A 1Y63A 3R8CA 3VU9B 3MR5A 2YHSA 1AJEA 3ZD6A 2HCJB 4NCKA 4A1FA 1NK6A 4GOJA 2O52A 5FOUA 1P2SA 2ZPTX 4M6WB 4QBIA 2O8DB 4ELVA 4O5KA 2MMGA 3LXRA 1SKSA 4QZGA 4LVSA 2HVHA 4JLBA 5K8UA 4ECVA 5KFJA 1DELA 2FEOA 4BZQA 1JBKA 5L1LA 1ZQRA 3JPQA 3QOFA 1OHHA 2C04A 2IS4A 2YWFA 1A76A 1WP9A 3P4XA 2FPKA 2C2HA 1V43A 1JNYA 5HE8A 4B71A 3D7MA 4EPVA 3O8CA 3KB2A 4UAYA 4KLZA 4J9LA 1NJWA 5FPYA 4DDWA 4KLDA 1YZGA 3LW7A 3KXIA 4M1MA 5A0FA 2PZFA 4AG6A 4NYIQ 3B78A 4X8LA 3LVRE 4Q00A 1FZQA 3ADDA 4B9VA 1G3IA 3EYZA 2DCUA 2GAAA 4Q5IA 1SKYE 1XEXA 3SYNA 2R8KA 1U9IA 2GTPA 5CB1A 4LJYA 1DO2A 3SV4A 3GIKA 4RQ8A 3D8BA 2G1KA 3DOEA 4FCTA 4KLNA 4OJKA 1EK0A 2D62A 3ZD8A 1D2NA 1ZM4A 5EE3A 1G291 4A8JC 2OCBA 1N6LA 2UVQA 4LBVA 1NJGA 1XZQA 3QKRB 1XD2A 2C28A 1K5GA 1G4AE 4KJZA 4F3OA 5K8LA 2PMKA 1CS4C 2I9GA 3P26A 1X1RA 1TK5A 2IBMA 4DDUA 3IHQB 3GIMA 1CRQA 2MSCB 2R2AA 4LJ6A 5CIQA 5CB8A 4AKGA 2CNWA 2BQ3A 1G6HA 2ZREA 4YR3A 4RNMA 4TUSA 1ZM7A 2FG5A 3QPVA 1CP2A 4PPXA 1U9LA 1EGAA 5CR0A 5D49A 1ZQIA 2VF7A 2OXRA 4L5BA 1SXJB 3TW8B 4RVCA 1TTTA 4LJ4A 1OXSC 5D3MB 4Q66C 2OFWA 3N4MB 3SZRA 1D8YA 4AK9A 4MRPA 4IEEA 5EE1A 4ZIRA 1U48A 1E9CA 2FGJA 3CX6A 4HDCA 1KAGA 3FB4A 2WKRA 2F55A 2IA5A 2VO1A 3AGQA 1G7SA 1ESMA 1XCGB 5DB7A 3GFKB 1LVGA 2XSZA 4JL8A 1OIXA 1UKYA 2HJGA 3CNNA 3L0IB 4N0DA 3PXGA 4AD8A 3EPJA 821PA 5JUMA 2P6NA 2H5EA 4DWIA 1YRAA 1R5OA 2CHGA 4FBTA 2XC9A 3KHLA 1RPLA 2BBOA 4I27A 3M9NB 1Q12A 1TQ6A 1W48A 1BMFD 5DSZA 3OEHA 5EP4A 1HE8B 4NCHA 2BPGA 2ZI9A 4C4PA 1G64A 1NK8A 1A5TA 3D31A 5DGBA 4PH5A 5DG8A 4UB3A 5G41A 4LBZA 4DLGA 1OH6A 2FSGA 1ZQQA 3AVQA 5BN5A 4IVPA 3A36A 1IBRA 1E2MA 4QZEA 4EBEA 3PCRB 5FUYA 1UT8A 3UPUA 1N0WA 4F5PA 1KI1A 1TFRA 2F1JA 4JK1A 2VA2A 1Z0AA 5HCIA 5HE9A 3V00A 5JEDA 4PPQA 5EWGA 4HUQA 1U4BA 3UMRA 1YZTA 2W2VA 5DLQC 1EFUA 4KO8A 2PXIA 4DLUA 1TU4A 3M4YA 2ZUCA 3RVBA 4W5HA 1GM5A 4GXJA 3LD9A 5GADl 2P3SA 1M8PA 2DBYA 1NL3A 4IOKA 3RHFA 4IDOA 4EJSB 4EPWA 1ZQBA 1DO0A 2ZE5A 2REXB 4JVMA 1LW7A 4NE2A 4OYHA 3GLHA 4S35A 3SBDA 2VIIA 4C0SA 4D80A 1G8PA 2GRJA 1Z3EB 2OBMA 1RYRA 1U2RA 1COWD 1YZQA 2ZJOA 4LC1A 4NMMA 1LB2B 1TF5A 4UXJA 3SFVA 5A5GA 2RHDA 2ZTDA 4NZYA 2KBFA 4F5OA 9ICTA 1IY1A 4EYHB 2V9PA 3OEEA 1O87A 2ZIAA 3P20A 1OXTA 3C5GA 3RB6A 4RT2A 1GNRA 1P60A 2IEYA 4Q7KA 4ZI3A 1AQYA 4JYBA 1KI3A 4QFMA 5IHPA 4HAZA 9ICGA 3CF2A 5HHIA 1AIPA 2BCRA 2JJ1D 3EG5A 4Q19A 2G1JA 1XSLA 4G5OA 1AROP 1A2BA 4Q7MB 1UBFA 2Z6VA 2G0NA 2FGKA 4KLUA 4LSGA 1KIMA 4CYMA 2ZR9A 1KO7A 1XD8A 4B3FX 3EPIA 2PFNA 2BMEA 3LXXA 3C41J 4CEJB 2ZYTX 2J6UA 4NL4H 2B21A 1G8HA 1TUIA 1L3VA 1HY3A 3B1WA 2CCKA 4IVRA 4QHTA 2XITA 2XB2A 1CF4A 1E79D 1NMZA 2OHFA 4DL4A 1EX7A 4Q21A 2GF0A 1JB1A 2HHTA 4NCNA 1JJVA 3C5HA 4AC9A 1R8SA 1I4LD 1R0WA 1SVSA 1CUKA 4Q02A 3QSYA 4MYTA 5KG5A 2W6JA 1WDTA 4B73A 4NXZA 3U6KA 1TUEA 5F9FA 2XTMA 3ZDCA 2V4QA 2A3RA 2C2RA 2R8HA 4R66A 4CEHB 4DB2A 5HMMA 4DOCA 3ZIAD 8ICCA 1SXJE 1JEDA 1ZUNB 4NPHA 4MGYR 5E7MA 5BW8A 1E79A 3N5CA 2JIZA 1U8AA 3OJSA 4KN7A 3MWJA 3EXAA 4LV5B 5DE3A 3GFOA 4K4HA 2C96A 1Q21A 3G6YA 1G8FA 1RZ3A 2QT1A 2QE7A 5EXXA 3A58B 1XEXB 4IRUB 1W49A 2ZR7A 3KUCA 1H65A 2GK6A 7ICLA 1E94E 4P4UA 5BYKA 5JEEA 2DPIA 1IY2A 4B2PA 4EQ6B 1VCOA 1Z28A 4B43A 2XNDD 2IYXA 3X1YA 1BH2A 1K1QA 2GNOA 1KZ7B 1L5UA 5EXSA 3IGFA 5KFUA 3W6NA 4F50A 2B6HA 4PQYA 1OYWA 3B1ZA 3TQFA 2P5TB 2R8JA 1G18A 5KHOC 4D0LB 2VBCA 3H84A 2JZBB 3X2SA 2W6ID 2JGNA 1Z00B 4DLTA 2IHMA 4GOXA 4RY2A 3H4BA 3NGDA 5HP4A 4BDPA 1P3JA 2MMCA 3T3FA 2QORA 3K9NA 3OIWA 4FN5A 2HW3A 1P62B 2Y1JA 4QRHA 5FL7A 4G0NA 2J6TA 1GVNB 3TUJC 2SHKA 4TQSA 4D25A 3SJBA 1SZPA 3BRWD 4M47A 5JWRA 3C14C 1CXZA 1UDXA 5KG1A 2PX3A 4BEJA 2CVHA 2FFQA 3B6EA 1RJ9A 3RC8A 2ZM5A 4EEYA 1E4YA 1YHNA 4B9UA 2IYWA 3QXHA 3VKWA 5JZVA 5B2ZA 2PJZA 4EZ9A 4NYMQ 4HAYA 4YXJA 3HT3A 1AK2A 4NLGA 1S8FA 2V7QD 4JVNA 3OF5A 2D4HA 4TN1A 5FTNA 5J2GA 3RAPR 4Q18A 5SZJA 4D4LA 5HCNA 1ZIPA 1CBUA 2OWOA 5J0QA 1IONA 8ICMA 4TLBA 1VG8A 1UBEA 3A1VA 4Q44A 2ZUBA 4CT4B 1XTSA 2XY6A 1XF9A 4A4DA 4HLQB 1ZC4A 2YZ2A 4GXIA 5K8TA 3RJGA 5CM8B 1XWLA 2HT6A 1H38A 2PI4A 1FX0B 1TADA 1YKSA 2UVUA 3ZQ6A 2A7QA 1EFHA 2FSHA 2VPPA
chains in the Genus database with same CATH superfamily
3LBIA 1L2TA 3FDSA 4ZCTA 3M1YA 3ILXA 5REQA 1NSYA 2IUEA 2HMTA 2QJRA 4RZRA 1ZJJA 2XYGA 4F5QA 2YOFA 3BGDA 2WVAA 3E9EA 2O7SA 4O63O 3IMFA 2DF4B 5GMOA 6AT1A 3A9UA 4IFTA 7REQA 1ENPA 3GJQA 2M0NA 4YN3A 4EB6A 1QHHA 3CZQA 5KOHB 5KT2A 2L0XA 3HJUA 4CMAA 4NM2A 4C4SA 4F3TA 3E2PA 5JXWA 4ICIA 2ZZMA 5CEJA 5FI5A 3IKJA 4EZIA 3SDBA 3QPAA 4L8FA 2HDOA 1IEXA 1KYVA 2BP7A 4GYYA 2JHGA 3A6ZA 3NIFB 5FUXA 1EBFA 1GUZA 1N6PA 2O7QA 3BD8A 3HDVA 3BZKA 3QF4B 1QB8A 2GN9A 5HRUA 1KE2A 1P1RA 2A9RA 2DPXA 4BQPA 4MXDA 3NI2A 1OI2A 2AN9A 4U7WA 2AL7A 1KRWA 5K3OA 5BOSA 5DW3A 3VMFA 4F86A 3GPBA 3ZH2A 1J9GA 4HB4A 1XEWY 2OQIA 3R8FA 1FMTA 2OHIA 4O1MA 1SXPA 3EIHA 4KN5A 2PRYA 2CVZA 3CEPB 2GKSA 4BLOA 4UQLA 2WWFA 3BWDD 4E21A 5A4JA 1EB8A 1ODLA 3K75D 2CXOA 5JTIA 2FUCA 2V98A 5L7YA 4YAIA 3R6GA 2G3YA 4HDNA 1FRZA 2ZI5A 3P9SA 3WLIA 3T7RA 2G63A 3BGOS 1V16A 3OIFA 4L75A 2NO6A 5DEIA 2A9KA 2ASEA 3URKA 1IVNA 1COZA 4X54A 1QP4A 5GV7A 3UJ6A 5BWBA 3H8JA 3QU5A 4JT8A 4W7SA 4B33A 3D9QX 2JH7A 1VG9B 2QZ4A 4S2UA 3TI7A 4R1LA 3W9UA 1BSVA 2J6HA 3R9WA 1AN0A 1Z73A 1X42A 1ECGA 1U8FO 1UXGA 1XAHA 5TPWB 1TZ2A 5TT1A 4HTFA 3LYUA 4NAUA 1X66A 4EDHA 5JPCA 1CZKA 2WUDA 2H18A 4ZGBA 1QGZA 1ZM9A 4RNOA 3F2DA 2XZPA 3FG9A 4ZJUA 2ZCJA 2IQIA 2BBTA 2NM0A 4QFCA 4KLEA 2XTNA 3AKEA 1EAMA 2QX7A 4MQ4A 4BVLA 2BI4A 2LIPA 4DCVA 7ICVA 2AKYA 4D6XA 1PJZA 2E4AA 4IH4A 1D5WA 1DJNA 4YROA 3IJ5A 4N0MA 5CAEA 1WW8A 5K0SA 4AVYA 4NU5A 1XTRA 4YXWD 2XODA 4FOOA 4E5NA 1NKTA 3MVEA 4NG4A 4W8GA 1E2HA 4JLVA 4IHJB 1ZR2A 3M6XA 1ZOSA 3O3OB 3OO0A 4KOAA 2GWHA 2PX5A 2JGMA 2W6PA 2LXNA 4DQQA 1FF9A 3BH6A 3NTQA 5G0VA 1HPLA 1X38A 1OXUA 2PFKA 3A25A 5FQNA 3ROXA 5JSFA 4G07A 4J0CA 1LPMA 1P2GA 4G1MB 5ALOA 4H1UA 4LZLA 1UKVY 1N2OA 3DBHB 4UBKA 5A2GA 3GLIE 3GW8A 4P0QA 3GLFB 2HIAA 2NAPA 5H16A 3LLVA 5JDIA 3JV7A 1SZHA 1DLJA 1LI4A 1P9LA 1JDPA 2A5JA 3F97A 4HAUA 1YVEI 3WYFA 4X61A 4LSZA 3ZK7A 4F4UA 1E5VA 1TF2A 5B1EA 4FONA 1SV0A 4GI7A 3CSSA 4PLHA 4Y0NA 4XPIB 3WYNA 3JWHA 3KVVA 2R7AA 5AXDA 2C84A 3WKEA 4ECXA 1YD7A 3C8HA 1KXZA 4LISA 4X66B 2ACEA 5DHSA 4NCBA 4M9HA 2RH8A 3G0IA 4HXFB 4Q1BA 3OTWA 3MGKA 5E1BA 5HJ7A 5BRNA 1HBJA 3WLJA 2CNBA 2XVMA 4L8YA 1N1DA 1Q3TA 4JC4A 3CR3C 3VGJA 4X44A 2C4WA 2WYUA 3REQA 4B45A 1YQUA 2NYVA 1P73A 1ODKA 5JO9A 1FFGA 3MGGA 4TN5A 7ICIA 1NZBA 1IN7A 5AHWA 1HH4A 2ZTUA 4NU8X 1GUDA 3GDFA 3U80A 3NHJA 4MWZA 4DTIA 4OVKA 2XOKA 1Q0ZA 4P7JA 1ND5A 1DRUA 3REGA 2K8CB 1PF7E 3O1LA 3ZDZB 1HT1E 1Z6XA 2XUIA 1FZTA 1ZGHA 3TEJA 4KN9S 2JVIA 2MSDB 3IEPA 4J0JA 4LK3A 5CA0B 3A6PC 1UWVA 3U44B 2PFOA 2VK1A 2P4EA 2CK3A 5EEGA 5TC4A 1AF4A 3UUFA 4QUJA 5JAOA 4I9HA 3SN6A 1K6IA 2DUNA 2O6LA 2RGWA 5AJTA 5EJAA 3NQ41 3T4PA 5I8ZA 3ZZNA 4NI5A 1G8MA 1MZVA 2QSYA 3MW8A 3X44A 4Q3EA 1FBNA 3TADA 4CLRB 4GXTA 5DBBA 1AUVA 1GL6A 2DGZA 3IDSA 3PUVA 4M55A 4YNBA 2ERXA 1VJGA 3CPSA 5L51A 2HPHA 3QVVA 3UW3A 1N6NA 3RVNA 5KYWA 1ZEJA 3U7IA 3MSCA 4F97A 2YZMA 3VV2A 1DAEA 2H7CA 4YJKA 5J40A 4CT5A 1WAMA 4TRNA 3O8RA 1BPDA 1Z45A 2G09A 2QKQA 2VAVA 3NEJA 4FBGA 5CK4A 3RFCA 3I2KA 2CLKB 4JEIA 1TV9A 4LQDA 5IIJA 3JQFC 2QNIA 5EZ5A 1NU6A 3GRZA 1FFUA 5ALLA 2GWSA 3EF1A 3I72A 3KKZA 4FE4A 4JS0A 1RP7A 1CIJA 1OU4A 4YIKA 3HXQA 4P86A 5BWCA 1M2JA 2ZLBA 1Z4OA 5KZMB 3R3YA 3MUFA 3EG9B 1ZK0A 4Q37A 3EAGA 2HZBA 2WVJA 1ONBA 2RB4A 4W5JA 1YGPA 5KFIA 1K6EA 2WC1A 3CURA 3JD2A 3KHTA 1DKLA 1IEWA 1K75A 1PT9A 4RXMA 4AKSA 2O2HA 3UXPA 2EARA 3E9NA 3IIIA 1Y9ZA 1W5TA 4AI6A 2J0EA 5C7LO 4FHZA 2CBZA 4UUBA 4C7OA 1E18A 4JGGA 2WI8A 3CRQA 1TM4E 1XZPA 3C97A 3I9KA 1DCKA 3A31A 5B7NA 1BGXT 2DUUA 4GXNA 1NQ5A 2CEKA 2AW3A 1DVRA 1DBVO 3EFOB 1OLXB 2O7RA 5HA5A 4QLBA 4F8YA 2KVCA 5IDXA 3E3AA 2IE8A 5EUQB 1I01A 1S97A 4PYJA 1GG5A 1KP3A 5CR9A 4FGUA 4DC9A 1V6SA 2WF5A 5KNDD 4DUZB 4BXOB 4MVCA 2QT0A 4PIMA 5J4LA 2A59A 3QZ7A 5DLDA 4CHGA 1ZN2A 2RLTA 3GMDA 3DAFA 4FEGA 4AUEA 3J81k 1BE0A 3QELB 1TGVA 3TNDA 2GASA 3QEOA 2GVDC 2PYIA 4CKXA 1XO0A 4YS6A 3X2EA 2YZKA 2R6ZA 1SPXA 2X0JA 3FTPA 1DLIA 5KTQA 2D5CA 4L7VA 1GGNA 1SHUX 3DCNA 1CTQA 4EHIA 4BMNA 4YUAA 5K6RA 3LW8A 4N39A 2RAFA 2ZVQX 2PPVA 1YU9A 5DISB 2Y1DA 1OFHA 4QVGA 3G5UA 4ML3A 4NLNA 4RSGA 2ZAMA 3NT2A 3FNIA 2IHBA 1KJWA 3AFNA 3H2KA 5HIKA 1ULTA 1CCWA 3NT4A 2RHOA 3C6ZA 2WSYB 2CBGA 4QAJA 3RRZA 1B16A 5KHLB 4F93B 3JSAA 2FV8A 2O0KA 4F1KA 4AXBA 4ASUD 3WKDA 5LJIA 1V45E 3MSXA 4M0LA 4PX9A 2WG0A 4FKBA 4ARIA 1TMYA 2HMUA 2Q5EA 2VSOA 3WGQA 5A9SB 2PKCA 1J8VA 3CR7A 3MQFA 5DWQA 4JV0A 3DQPA 4IIGA 3L7YA 4JX8A 3ZR4B 1J5EB 4UU8A 1QFXA 3LSTA 4QREA 2BHNA 3PDHA 2ZJFA 4V0OA 3OCVA 1WCLA 4ED0A 1PZHA 2QZZA 4LKRA 3R24A 1LPNA 2GBGA 3I9FA 3HWTA 2COEA 2VL7A 3LXUX 4TL6A 3TKLA 4E13A 1JEYB 1E0KA 3WSVA 1V47A 2AC7A 2K2QB 4BQEA 3TL3A 4ZH4A 5KYYB 2OECA 4KKVA 4CETA 5KT3A 3V42A 3ZWPA 3K35A 2Y8EA 4B85A 2QI9C 5EZYA 3WKCA 1WXDA 3M8SA 4EL0A 3OTIA 4QU8A 4UJ5A 4BIIA 4BPBA 5E0KB 1HYQA 3KT8A 4U00A 1SXGA 3OQBA 3L06A 2VDKB 1SCAA 1G4HA 1Y3DE 2CXSA 1S0NA 1ODTC 2K7ZA 3JWPA 5CA1F 1GD1O 1QQAA 1I3LA 3E2IA 2VK8A 3WRWA 5M5BA 1YTUA 1BA3A 3GGOA 3X0DA 5I48A 2N47A 4KMOB 2FVYA 4BNHA 1I0ZA 1A5BB 2NOAA 1NWCA 3BCUA 4EGAA 4EMTA 1IXZA 1F3OA 3R3VA 2CSUA 1RQXA 1TIPA 3OD1A 4CNBA 1OX5A 1LF5A 4AMVA 1I5RA 4YGXB 2FG7C 4Q3OA 2O8BA 2BFNA 4GLFA 3HWX1 1KPHA 3AIIA 3AM4A 4K88A 5DYNA 1YMUA 4J16A 4BPRA 4G0PA 3JARA 2BQUA 4RIHA 2BOVA 5GV8A 2B4TO 5K6AC 2OVBA 3NNSA 2O50A 3MFYA 5LR6A 1KC1A 2JHDA 5AKZA 4BVBA 3KZOA 4ZALA 3WGZA 1XAIA 3H7AA 1RYEA 1MA7A 4X8OA 1GVHA 1USIA 2GN6A 4E07A 2CLSA 1O95C 3TS1A 3HJEA 5LWHA 4OX9B 3UJ8A 4XAQA 5JCPA 2IP2A 1M5RA 3KTQA 1I6WA 1TCVA 5KTOA 3AERA 3WGNA 3D81A 4O3PA 1ZI6A 1ONPA 2M6KA 2IU6A 2WJGA 3ROTA 4Z53A 6GPBA 2ZGVA 3CNBA 5IAKA 2NNWB 3QVUA 4XRHA 4IBOA 2SECE 4QZHA 2C8VA 3RR2A 2HHSA 1MIOA 1MO6A 3DKRA 3F6BX 5LQMA 2EYUA 1OTXA 1P2UA 1Y1KE 2BUCA 1IM5A 3ER6A 1VE7A 3HLTA 4K9PA 1WEHA 2O8VA 3OMLA 3FCEA 3HMKA 2BR4A 4M9NA 5CHYA 2AFIA 2KLBA 2EGHA 3F5SA 4J1QA 4P7FA 3TLBA 1T6XA 3TRJA 4CDMA 5GIOE 2IH4A 3L49A 4RTKA 2CLIB 1C30A 1T2AA 2OOKA 4I6EA 2GJ8A 1GQQA 1LJUA 2WYIA 5FWYA 1EVEA 3EOBI 4ZEWA 1T0IA 3T94A 1GY8A 4GZMA 3PENA 2EANA 1AXGA 3HGQA 4LY9A 3K94A 5K0LA 3SC3A 4DLXA 5C32A 2F44A 3KUKA 2ATXA 4QUGA 3RT1A 4RA9A 1CRWG 3V97A 1A95A 2Z9BA 4DGSA 2IGTA 3QX8A 5B58C 4C8KA 5DYYA 3ZWKA 1COOA 2QZSA 5DDMA 1N5RA 1II9A 3U9SA 3ILSA 2RGGA 5BOVA 3OFSA 3PUYA 4UCXA 1BHJA 3UMYA 3OJWA 5JMWA 4KL8S 4TXJA 5IVPA 3MCWA 1FXWA 1XRPA 3IYLW 1N57A 1QFZA 2BF7A 4TMKA 4D45A 4JJ4A 3PEYA 4TMXA 3TFQA 3C39A 5TMPA 4KLSA 2FMFA 3FUWA 2R8RA 2D1SA 3QZUA 5HEKA 3SR3A 3WMEA 4D8YA 4B3GA 1NBMD 2RHHA 2H1WA 1NLZA 3ISBA 4LE0A 5A4FS 1A1VA 2OFOA 3CXRA 4M98A 3TSZA 5I8PA 4MK4A 1ZSNA 2BDPA 1ES9A 4I50F 4EB0A 4IZHA 2BSXA 3BJRA 2WWHA 3ZI0A 2WWXA 4TM8A 3PC7A 1R18A 1BEUB 4GZ6A 3GRPA 5L3ZA 3G8YA 5B7GA 4NE9A 2XQGA 5FR2A 1VIMA 1IUKA 2I6TA 4XB2A 4P1ZA 1HSOA 1K7SN 2OLJA 3SM3A 5KFTA 4QZ8A 2HCBA 1S3GA 4FLFA 3OX3A 4HGZA 5JNWA 3RFAA 1PFWA 1WXQA 4WKPA 1GZSA 1UM9B 3ETNA 8ICOA 2G5CA 3JRNA 4RSMA 5FOXA 3AEUB 3I92A 4XJVA 2DHEA 3V1TC 2ZWIA 5LQUA 3ZGZA 4KVZA 4GWGA 4YUYA 5JNUA 3PYLA 5B6IA 4YPOA 3WLOA 2C98A 1GZ7A 2PXAA 4WLNA 4R8UB 2FDXA 2YQZA 2ZTEA 1DTWB 3PF8A 1CR2A 3CPJB 4E70A 4B6PA 4ZYZA 2UVPA 1Z4NA 4LE1A 2IF2A 2JAWA 1LVHA 2GEDA 1PUIA 5LMCA 2BFBA 1ZUWA 3HYLA 1AZTA 1VMDA 2BSAA 2VNKA 1QH0A 3B51X 4IMPA 4OGGA 3D8UA 4EPYA 1P7WA 1IXRA 3LRPA 2YVAA 1CZUA 1T29A 3SEZA 2OWEA 5BT8A 4JQZA 2RGYA 4XFDA 2JLXA 5DB4A 1SGWA 2W2NA 4AJJA 5DULA 3RHTA 3RSZA 4YXWA 2CLLB 5HM8A 4BP9A 4Z0NA 2PWBA 1VCMA 2BT4A 3EAQA 2AI1A 1YVPA 2P9TA 2R6GA 1NBAA 1FQKA 3CWQA 3IKVA 2P35A 1AGNA 2BCQA 4C76A 3H1PA 1X1CA 4B6GA 3LNCA 1J6UA 1ECJA 2D1TA 3C7AA 1GZDA 1E9EA 1GTJ1 4WJLA 4LIPD 3S8EA 3ZU3A 1VZ3A 4BFWA 4M9JA 3RWMB 4UTVA 5ISMA 1NW9B 2ZWVA 1DKPA 1XP8A 1VTKA 2Z3WA 4MVJP 1VYHA 1J8YF 1BMTA 1EGVB 1NN3A 3L82B 1WG8A 3O74A 3OQVA 4JL6A 4WKCA 3STHA 3SV3A 4YV2A 1KBUA 1DOZA 4B2YA 4EM6A 1IDN1 2Z83A 3HCOA 3H9UA 1NPDA 1DWQA 9ICMA 1LBSA 2FU5C 3DBRB 3TPFA 1OPXA 3IELA 1J22A 4Q0MA 4R3UC 3QHQA 3L04A 3G5AA 2H85A 2KPOA 3MGHA 3G6XA 1R37A 4JELA 2IU4A 3PRYA 1DRVA 3I6MA 1OXJA 4QOFA 3IG8A 2NU7A 1TJPB 3JPRA 3A3KA 3DBLB 3NASA 4XTCS 5EQDA 3TZEA 5KJ1A 5A3JA 5E3IA 2FP4B 4RF5A 4BFCA 4WZ6A 1NKBA 1N5MA 3IR6A 3T9AA 3LKDA 1XS9D 3RS8A 1N5XA 1M1XB 1T3ZA 4Z6CA 3I04M 4N01A 4OQYA 1Z47A 2HF9A 2ID9A 4RHFA 5AJHA 5FXMA 1CFZA 4UU0A 1U65A 1XMVA 4L15A 2PUWA 3IUSA 2WT8A 1G8KA 1X7YA 1XB2A 1ZINA 1ZWKA 1KF0A 5KDLA 2FDCA 1W0JD 5DBHX 4CMCA 3BIWA 1YXMA 2VA3A 1OI4A 2EJWA 2NPOA 4IOMA 3IV6A 1K66A 3RTGA 1Z4KA 1Y5RA 2TMDA 3U4DA 3DFMA 3FYTA 4BEVA 4C0KA 1NI5A 1T3LA 1U8YA 1SQSA 3ICVA 3WR5A 5EJ9A 3L8HA 3ZCXA 2QGFA 5ICSA 1AKQA 3GEPA 3RBZA 2PGJA 3BD6A 2VRBA 4GI5A 2Z0MA 2WIAA 1L4BA 4MJ3A 4V0KA 5LQDA 4FGKA 3LCUA 4XWWA 1TJ3A 1NF9A 4BL5A 5KVSA 1EE2A 4IVNA 4R98A 5JQGF 1U2QA 4P2HA 1P5RA 2YJZA 4LECA 1HMPA 3R0XA 4U5XA 2RGNC 4IDNA 3N8KA 4DREA 3IA2A 2DAPA 2F1IA 3GG9A 3TIXB 4A36A 1YCGA 1W44A 2G9UA 4YN4A 1RCUA 3B3QA 3DEZA 3I64A 4B9LA 2V6BA 3NDIA 2PUTA 4EHNA 5KNCD 1P4JA 4ZCLA 4QM6A 4H3VA 2EKDA 3PG5A 1Y6JA 1NKCA 4G5YA 4AKIA 3SGLA 2VZLA 1UBHS 4QBHA 3BFKA 421PA 9ICOA 4EUSA 3QX7A 1J2MA 3W77A 2EKBA 1CUHA 4MWGA 3RRMA 4BGDA 4L5AA 2BGRA 3G13A 1JPJA 5A7HA 4IYRA 4NTZA 4E5SA 4F3KA 4OQXA 1LBEA 4FYVA 3OCJA 3NHMA 5ECGC 2ZROA 1J25A 2JFBA 3RUFA 5I7EA 1O3YA 3U7GA 4IFBA 4OXNA 3JCZA 4IRKA 1BN6A 4O3FA 1MO4A 4DJTA 5IM4A 2AZTA 3KQMA 1ZD8A 4YCXA 1N5JA 1CUSA 3Q6NA 3OZCA 2H4HA 3SBXA 3Q8KA 4D9KA 1OD6A 2ID8A 1T5SA 2ATIA 2PJUA 3U44A 1LQTA 1RPNA 3UJCA 4LZAA 2R00A 3WTBA 4NZPA 4P3OA 4P81A 3HL0A 3IQWA 3RASA 5IT0A 1YFKA 4ZOLA 4HNGA 3KQOA 4JC0A 5CYPA 4MRNA 3DEYX 2ZB4A 4TWIA 2HPZA 1E2BA 3LKVA 3UK6A 3T3PB 3ZY4A 4IKEA 3S29A 4ZVTA 1O95D 3BCSA 4E3ZA 3QQPA 4IJ5A 4ZFNA 1AQLA 1PFGA 2R84A 4J2HA 4MX8A 3ID6C 4WQMA 3VU0A 5K0EA 2O7NA 3IQXA 2GJAA 3T3HA 3LYSA 1QPBA 3HKCB 4F7WA 3WBFA 4WFJA 1GEGA 3IM1A 4JOQA 4DV1B 2HJRA 4AMBA 1T0JB 1INLA 2VA9A 3EYWA 1MQSA 5J2AA 4RQ6A 2G4VA 5GJWC 3C3AA 1Q84A 3HFGA 2FPGA 2X5NA 2YJ4A 4H1TA 4C7ZA 1RZRA 1KI9A 1QFYA 3RYIB 3EPKA 2YL2A 1WULS 3HCFA 1LLFA 4GP6A 2QLNA 4F1JA 5ITZB 3JQDA 2O8EA 3KBBA 1VLZA 3M6ZA 5LOVF 1H9AA 4IWXA 2Y0PA 3W5VA 5LIPA 2UYHA 1C3XA 1U94A 5FPSA 6REQA 3BS5B 4NAVA 2C59A 1HLPA 1ULHA 3QEKA 3V8BA 3ZTTA 3WQHA 2VK4A 4PQRA 4RO0A 1TAGA 2R6HA 5IUJC 2PUVA 3GZFA 1ORVA 1VLBA 1OLSB 3W4IA 3ZY2A 5J23A 1WUKS 2J5XA 2FJUA 1D3AA 3NRWA 1C9EA 5BSEA 5ILQA 3AEZA 4PVCA 4V0NA 3PNQA 2HX1A 3DSRA 2AFHE 2BCGY 3PFNA 3WKBA 3M1IA 4JQSA 1OYOA 1N75A 1UXKA 2RHBA 1SOVA 3E35A 1WPXA 1H8HD 1Q0HA 1QYWA 2Q3CA 1TZMA 3LYHA 2X4IA 4NYIR 4ED9A 2C9MA 4LRWA 2QX6A 4YAOA 3STVA 1VMAA 1I14A 1EWKA 5DYGA 3T3DA 3U7RA 2C5HA 4C0XA 5KNBH 5KNDA 3HXPA 5EXTA 1T3GA 1PK1B 1RBZA 1VKRA 2XIQA 3JS5A 4JP2A 1ZJWA 1ZVVA 3CIFA 5FHRA 1FQWA 1WXEA 4ZEMA 1FNSA 5AM1A 3OPVA 2Q45A 4MHTA 2YVQA 1OXBB 3SYRA 3S8YA 3K2QA 2CDBA 1PVOA 3N2EA 5BV1A 2I03A 5L6MB 3EWAA 5CT6A 4D0NA 4NQRA 2OEHA 7ICHA 3NVAA 1M34A 4D79A 3B89A 2GPSA 5JNTA 4IRCA 3JATA 1ZUNA 3VO2A 4BMPB 2Y6VA 4O25A 2OCDA 2EZXA 5EIHA 3V4FA 2JGDB 2C0CA 3HB1A 3HR8A 4ARSA 4R8LA 3NBYC 1E2KA 4CIDA 5KREA 5D4BA 1XP5A 3C3MA 4IKPA 4JNCA 4AJOA 4H0CA 1N1MA 1H2EA 1PVVA 2ODEA 2VYQA 3OA0A 4NK5A 4HLCA 4TV8A 2F67A 2XGJA 1JLKA 2HEIA 3FBTA 3VQTA 3FI9A 2R68A 4QLOA 5IYZB 2ZRGA 4ACAA 2ZYRA 4M37A 2XE8A 3WGHA 1CQWA 2QM3A 2QTVB 4FMDF 4FMPA 5CYOA 4BTVA 3KTAA 5CB6A 3RIMA 1HGXA 3JWJA 5FAKA 3CNLA 3FFTA 4J9UE 3O94A 4LZOA 1WV0A 2YYAA 2DQNB 1R6UA 1COWA 2O5EA 3ZIUA 3KT6A 5IJ9A 5FH9A 2QW8A 2VHYA 4HGOA 4FFPA 2N0SA 2CV2A 4LF7B 3TNYA 1PCXA 4QEDA 2GK7A 4ZOAA 5I3ZA 5M29A 2IBSA 5EWLA 1NKVA 5J2IA 4C2AA 2GRUA 4Q6BA 3PUWA 1ECWA 2ZE8A 3A10A 3CX4A 4KXYA