1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD51
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
1R5OA 3O8CA 5AR1A 5GJWC 2RKOA 3DEFA 2O52A 3D8BA 3OAAA 2QMUA 1L7VC 2ZTCA 2WWGA 3WRXC 2XZLA 3H4DA 4JL5A 3R20A 2RGNA 3P4XA 3PW7A 4Q4AA 2XB4A 2CL7X 4NBSA 1NK4A 3E70C 2ZJYA 1DADA 2Q3MA 3ZS8A 4F5OA 1W36C 2D4HA 4D81A 4J9MA 2V3CC 3IBYA 4MFAA 2UVWA 2EYUA 2RGEA 3AEZA 4ILEA 4AIIA 4DSTA 1RJ9B 4KLHA 2ZJZA 5D49A 1RE0A 3KKMA 4IDNA 1G1MA 4J9NA 2KBEA 1SKSA 2J0QA 2NPFA 5J47A 1K8RA 4R63A 3CBQA 5BYKA 2QPOA 4XTRA 3WNCA 3JVVA 2W9BA 1D5CA 1OH5A 4FXPA 2GETA 4ELUA 1QHIA 3BERA 3MWKA 4YR0A 1SULA 3ND9A 4IEEA 1IBRA 4LJAA 5KDDA 2OCYC 3PX0A 2KBFA 4DLEA 1SVWA 2ASJA 2RGCA 2RH5A 5HE8A 3V7JA 2IX3A 3U4QA 3NG1A 5J2JA 2ZEJA 2XXAB 3ZD6A 4I2FA 2JIZD 4I2CA 2RCNA 4O3MA 3UWOA 5KFSA 1G19A 3IEVA 3C7KA 5TMPA 3SZ2A 8ICMA 1D8LA 3PW4A 4MRVA 1X8KA 2BBSA 4HB3A 4WW0A 4HUQA 4KLEA 4RQ3A 4YXWD 2QGNA 5CM9C 4B3GA 2KN7A 3B0YA 1IXRC 2CL0X 1FL9A 4FS2A 3GJ0A 4Q7KA 3V4FA 1UT8A 2DHRA 2WAYA 3I62A 1ZIPA 2F1IA 3SI8A 4J9OA 1TAUA 4A0GA 2P66A 2RGGA 5FTMA 2ZSEA 1KOFA 3S1AA 4OHYA 5M04A 1T7PA 4NKRA 3CF0A 1RPLA 3A1WA 3GDXA 5EZ6B 4DF8A 9ICIA 1E1RA 1Z6AA 2GVZC 4ZH4A 4LBVA 4BASA 1T0HB 1NL3A 3KTAA 2FEOA 3LWLA 5EE9A 2WTFA 3L8YA 5JWOA 4P2HA 3AUOA 5GVSA 2J0UA 1D9FA 2V7QD 1N2CE 3PUYA 3RAPR 2WWWA 2CJWA 3PEWA 4QBGB 3B2EA 1S2MA 1GZSA 1AIPA 5DSZA 4R2HA 2J7PD 2OCPA 3GJ7A 1YU9A 221PA 5HHHA 4KLIA 2CNWD 1TKDA 5CR0A 2DPIA 4BZQA 2ISOA 3GV5B 1B43A 4Q18A 3KHGA 7ICRA 2XITA 3LXXA 4N3NA 4HB4A 4RZ2A 4YMSA 2QQEA 3QKSA 1U8ZA 2VBCA 4BFZA 1LFDB 2Z5FA 1P72A 5FUYA 3I32A 3W3AA 2ZRFA 4D0GA 3KFVA 4UNNA 3H8SA 4KLDA 4K81B 1W5SA 1GM5A 3KUDA 8ICYA 1XZQA 2ERXA 4OKSA 4PHHA 1ZQMA 3SQWA 1I4TD 4FW9A 3L0IB 1WBDA 5TY0A 3GV7B 1S77D 2FGKA 2ZRIA 1EXMA 4BFXA 2BCVA 3LBIA 4JVSB 3UQ2A 5CJPA 1XCGB 4PSVA 1CR2A 2GEVA 1XO1A 1E1QA 4V0KA 1R5BA 4HAZA 4IQTA 4QHYA 4QGFA 4DF4A 1L3SA 5CITA 4X5VA 5JWRA 1DO0A 3AVXA 2QU8A 1OXUA 8OHMA 8ICUA 3FHTA 4M9NA 4YR2A 1J90A 3TNFA 3FHOA 4LV5B 3WBKA 4F4YA 1LF0A 2GESA 3BFVA 1OIVA 3UMFA 3NBZC 1GIAA 2BQUA 5KO2A 5KG7A 4MKIA 4JV0A 1TADA 2FFAA 4PQFA 1NN1A 1T0JB 4ED1A 4TYQA 3IM1A 4CEIA 1F2TA 3O8RA 2FLNA 4G5GA 3RRMA 3T15A 5FBLB 4BRUA 2QSZA 2BCQA 1SHZA 3H1TA 5FL3A 3NKVA 1U94A 3H0KA 1H8EA 1LW7A 1NY5A 2UZ3A 2WOJA 4NCHA 2JLZA 4MFCA 3ZVMA 2WJHA 3IGFA 3Q8KA 4FIDA 2IXGA 1MSWD 1E9EA 4O3OA 1QHYA 2JEGA 2V9WA 4KO8A 3MFYA 3U6KA 1KTQA 4CF7A 1OB5A 4F91B 1NP6A 1FOEB 3IBGA 1SHKA 1XTRA 1EFRA 5D3QA 5TXGA 4ELVA 4TT3D 1ESMA 2QTFA 1VYUA 4RFSA 1YHNA 3OJUA 2VHUA 1ZQKA 3LW7A 4JLOA 4RQ4A 2IA6A 2UVVA 1AQYA 2AK2A 1ZQXA 2BQRA 1EGAA 5G53C 4EFMA 1IXRA 5L8VA 4FS1A 3C1ZA 4NCJA 2BCSA 2A5GA 2NMVA 1UEIA 3Q85A 3REGA 2GRJA 4KU4A 1K5DA 5KFWA 3TSWA 1TUIA 3TIFA 2CK3D 1NLFA 2C78A 3K9NA 4RSGA 2OAQ1 4US0R 1JX4A 3ZDEA 3AF1A 5KHOC 4M6WB 1W1WA 3GLGA 2VP2A 1W5TA 4M9JA 3CX6A 2REOA 5HR5A 4I99A 4G0NA 3OHBA 2DFNA 5J5CA 4EPVA 3U7GA 3L82B 4U7DA 2O8FB 1PZNA 1KI9A 1N0WA 5JEDA 1TF7A 5CM8B 3U44A 4X8MA 2QMEA 2YWHA 1S76D 3GLFE 4A6PA 2WWYA 1HE8B 2C77A 9ICNA 1Q1BA 4URYR 4A36A 4MH0R 5FBQB 3FFBA 2F43B 2X2EA 3IHWA 1N6PA 3C2KA 1W7AA 2QENA 2JATA 3GLGE 4ECUA 2WSSD 5HKKD 2WWFA 3CPHA 1FUUA 2C8VA 5JS8A 4DLYA 4RD0A 1FP7A 1ZM9A 4YFKA 1OXTA 1X9SA 2QT1A 4PZZA 4F5QA 5B58C 3NIBA 1OW3B 1CJUC 4YD1A 1Y63A 2QEQA 4ASUA 5EE3A 2WTUA 3PQCA 4RVCA 1T3LA 2PZEA 4FWIB 2QROA 3ECCA 4DFJA 3KXIA 1VHLA 1NNEA 2GEDA 2NRZA 3BBPA 4YP3A 3IQXA 3C5CA 5JJKA 4IJMA 1YE8A 2PMDA 2OCAA 2FMPA 2GJ8A 3JVUA 3IIKA 4C7OA 1I2MA 4F2RA 2VTKA 4O3QA 4TL7A 1DS6A 2ZR0A 4S35A 1M2OB 4DL4A 4R8UA 4XH9B 2MSCB 5FTLA 4QFMA 1BS1A 2JZBB 4M04A 2R8RA 4EPRA 2DWQA 3F3YA 5KDOA 1S9HA 2PCJA 4OYHA 3SU8A 1U90A 2VH5R 4P33A 4RZ3A 4MKHA 5FOUA 4NY8A 2EVWX 2ZRLA 4RD3A 4C4PA 3B13B 3QKRA 1R2QA 3M6AA 3PIRA 3CRRA 1SVSA 1XRJA 1LV5A 1WBBA 3ADKA 1OLOA 1Z3IX 1ETUA 5EQTA 1EFUA 3PITA 3TR5A 1OB2A 1NMZA 1F2UB 4KYIB 1TUEA 3QG5A 3UXMA 4UKDA 5GADl 2CHQA 4HI0E 1CUKA 4Q47A 3W8NA 1RYSA 1FX0B 2ZROA 4TMXA 1MOZA 1L2TA 621PA 1CJTC 2EQBA 4KMUA 4QWDA 4GXIA 1AZTA 4URWR 3MWYW 5FPHA 5HNKA 4BLTA 3RS2A 4RUAA 4F4WA 5EUMA 3RRNA 5KFLA 2W2TA 3FDSA 3C14C 1JAHA 1W0KA 3OF5A 1S0MA 4UXJA 5KT7A 4C8LA 2WJJA 2GVDC 3K53A 5TARA 1S97A 4YXMA 1S3GA 3CF6R 5FH9A 1KI2A 3R7WA 5IINA 4RJLA 3SI7A 3AVTA 1X86B 1LS6A 3NH6A 4IVRA 2AGPA 1EX7A 3CWQA 4D4KA 1Z3EB 3I5XA 4TURA 4NYJR 3LK9A 3RS3A 3TR0A 2W9CA 3GJ6A 4IFEA 2OHFA 2R8GA 5KG0A 1AS3A 3B60A 4TLDA 1FZQA 1KDTA 1PJRA 1QZXA 2R6DA 1LV7A 2BCUA 3PR5B 4YQWA 1WCLA 1GL6A 1RRGA 1WE2A 2FMXA 3CNNA 2CVHA 2C9OA 2IYWA 3LA6A 1A2KC 2WHXA 3CR8A 4TTQA 4XWAA 4O25A 1KK2A 1HQCA 3LBNA 4XSHA 4HZUB 2YOHA 4E0DA 3EARA 3A1UA 5J4VA 1SXJE 4RFVA 2C99A 1SKQA 1Z0FA 2CDNA 1EFTA 2FX3A 4D26A 3MJHA 4WA7A 4XQ8A 1O3YA 1BPXA 1NRJB 4DSUA 1N25A 4MQBA 4MGYR 4QNRA 4RD2A 1TTTA 3BQ0A 3PV8A 1OIXA 1NK9A 4QOSA 1E99A 3BB1A 4HLUA 4OK3A 3Q8RB 2KB0A 2OUKA 2LKDA 3SV4A 3RRGA 4FCWA 8ICQA 2AHOA 1OHHA 1RVDA 3L43A 1T3HA 1AJEA 2WIAA 1U47A 2OESA 3Q5EA 1Z6XA 4GMXA 3J81k 4TLAA 2R8KA 4US2R 4HSEA 1MABA 4RD1A 5J2IA 4LVSA 1GNRA 4F3OA 1XXHA 3CIOA 8ICNA 3NHBA 2HF9A 1E0KA 4B6EA 4Q4JA 2G83A 3KKNA 1WP9A 2VA3A 1QTMA 4Q7MB 3NEJA 1UDXA 4JLDA 8ICLA 3QSYA 2C2RA 1G6OA 3THWB 3B9QA 4BXOA 2G0TA 1ZQHA 4V03A 3K70C 3KX2A 1KMQA 4NH0A 4RT3A 3DKPA 4C8KA 1COWD 4PAMA 3CZQA 2BCRA 4I2DA 3TSOA 1C7YA 4EZ9A 3RBEA 3Q7PA 2XO7A 3V9PA 3CKLA 5KSPA 2FWRA 3TFSA 3GEEA 4GP7A 1N5JA 1VG1A 5DGBA 1BMFD 1XMIA 2X1VA 2Z0MA 4LCBA 4PHAA 3PW2A 1DEKA 1NSFA 2NQ2C 4OQNA 1ZQBA 2JJ1D 4PX9A 3R9XA 3I4LA 4IRDA 3QJYA 4NYMR 3T5KA 2P5SA 4RD6A 4TZ6A 4JJKA 1F5NA 3UANA 3PEVA 2NO9A 1CR1A 4F4IA 3UPUA 2XC9A 1HUQA 4MGZR 5C46F 2RDIA 5IHPA 1JECA 3ASZA 5KT4A 5BN3A 2Q9AA 2VF8A 2VP4A 4L5BA 3OEED 3HR7A 4TL6A 4ZO4A 5DNYB 1J70A 3NTUA 7ICLA 2QY9A 1ZQQA 3QF4A 1FPMA 2VYFA 4MUBA 3TLXA 1ZP6A 9ICMA 4ECWA 1GRQA 2JCSA 3KJHA 4W9MC 1NVUQ 1NN0A 4PHEA 1RXVA 1GITA 3THXB 4AI6A 3WYAA 2V8OA 5FI0B 5IK2D 4E22A 1L3TA 1MO5A 4GP6A 1QSSA 3RDPA 4G3IA 3IUYA 1E6CA 3RB0A 3W8RA 5CB8A 3CWZA 5L1KA 3AKYA 1OF1A 3RS7A 1VIYA 4C8OA 2YOGA 5AJWA 5ELXA 1XPUA 4TYYA 1FNMA 8ICSA 4M4SA 2G77B 2IHYA 4JLBA 4JSYA 2QBYB 4O5CA 1KI1A 2W9MA 2Q9CA 3IILA 3QPVA 3RH4A 4AYTA 1W4AA 2DB3A 3OAAD 2ZRMA 1HT2E 7ICEA 3K75D 4JYCA 2ZJ5A 4D80A 1E2NA 5JEEA 9ICKA 5KFKA 3KJEA 3I3SR 4X8LA 5EJEA 5CYPA 4D4MA 1XEXB 1HT1E 4B71A 4O5EA 2C03A 4FMDB 5DN6A 4PPXA 4QJ5A 2F7SA 4OQXA 2XGPA 2CXXA 1GKYA 1YZQA 2X19A 4F8RA 2WOOA 3G6VA 4BDPA 5H70A 5DGXA 3RR7A 9ICPA 1D6JA 5EP4A 3TARA 2KI5A 3EZ9A 3UG7A 3K0AB 2IS6A 4WZ6A 1L5UA 2GAAA 5CIWA 3VNUA 4FBTA 2IYYA 3T5GA 2DPXA 4JV2A 2HVHA 5H8WA 4LV6A 3T12A 2VSOA 1J99A 2JDID 4ECTA 4H1VA 4NHOA 4QRHA 3ZD8A 3EZFA 4BZPA 3EA5A 4B2LA 1DGSA 3HT3A 1SKYE 2KTQA 1KEJA 5KG3A 3MSXA 1JEEA 3MDCA 2OFOA 1FNNA 3RBDA 5FBWB 4DLXA 5EXSA 4EYIB 4MRRA 2ONJA 4RPXA 9ICRA 1V5WA 1S0OA 3OIUA 3RAQA 4DCSA 1KFDA 1J2JA 3H84A 4XJXA 3T34A 1D8YA 3A58B 1JBKA 2FZ4A 5FOTA 4DWIA 2AX4A 2ZITA 1G3RA 3MG9A 4IQWA 3JZMA 4M1KA 2O0KA 1G3QA 1XS9D 3KQNA 8ICVA 1ZQRA 4RQ6A 1ZD1A 2JLVA 4KLMA 3MCAA 2OAP1 3CW2A 3PEUA 2W00A 3X1XA 4A1FA 4QW8A 4IXNA 3N70A 5L3SB 1E2EA 2BHNA 4GOKA 2HHTA 2BHRA 2V54A 4HAXA 4KVGA 4V0ME 3VAAA 4ZV4A 3U61B 1S8FA 3SS8A 3I72A 1BYUA 1W4RA 3K8YA 3WYGA 3FYHA 2Q3HA 2WJVA 1JR3A 4LYHA 3SFZA 2W6JA 2IYSA 3GIKA 2D62A 4C3ZA 2ZRDA 3ZYCA 3ZVLA 1U2RA 1YRBA 4ACBA 2J87A 5FI1B 3TGPA 2NRXA 3ZLJA 1YR7A 1XTIA 1H65A 4P4UA 4NU0A 3LVQE 4IXMA 4C0JA 3I8SA 3GFPA 4C2TA 2MUTB 1VIAA 2GCOA 2ZJOA 3A8TA 2C2HA 4YMVA 4XRHA 5J4LA 5KYKA 4E09A 4X8OA 5DLFA 1OPXA 4Z6FA 3EPKA 2V55B 4NLZA 1G3IA 1Q1QA 4KV9A 1V43A 1ZIOA 3JPQA 5LD2B 3E1SA 3UK6A 1AS0A 1UBGA 1MT0A 4QZFA 4TQAA 5K8UA 3SV3A 1RIFA 3CRQA 5DB8A 4W5WA 1Z6GA 5BXQC 3RS0A 1NVVR 5JI3E 1E94E 2ATVA 2LKCA 4UB4A 121PA 4QGAA 3ZQJA 1I4LD 1YKSA 1HURA 4DQRA 3ZIAD 4YCXA 3AP1A 3W6NA 1N6RA 2YYZA 1NLYA 2WBLC 4KLQA 2ZAOA 2D2FA 3VX3A 1S1CA 4NONA 1KK1A 2IUUA 4EJSC 3HU1A 2ZYVX 4LZGA 2P67A 1XSPA 2ZYTX 4PPGA 1L3VA 1GNQA 5SZHB 1NJWA 5CB6A 4QZGA 3M9NB 1N6LA 3SNHA 3FE2A 3R8CA 3C4JA 4B47A 4B35A 3L8ZA 5JHHB 3PUZA 4LX0A 4IOLA 4JZKA 1L3UA 1IY2A 1XD2A 3WMFA 4I1SA 4B75A 1S0NA 4Z1MD 1ZQZA 1VKJA 4GI7A 4HAWA 3VMFA 4ESHA 1SVLA 1D9DA 2BMFA 3LW8A 1W36D 4M0AA 4M9HA 3AGPA 1GSIA 3A1TA 5BOMA 1CLUA 3BFXA 4B76A 2ZJAA 3KQUA 5JJLA 4F7WA 1P7CA 1TK8A 2WJIA 5KPDA 2BPCA 1Z2AA 2JJ2D 3EIHA 4KLJA 1RZ3A 2UZIR 1NLZA 5IILA 2J7KA 1Z07A 1KMHB 4BFSA 3LDAA 1DOAA 1S10A 1WXQA 1DBSA 3AUYA 1LF5A 5AJVB 5DB9A 2GDJA 4IDPA 1A5TA 4OHWA 2HYDA 4PSAA 1II0A 4TWZA 4DSJA 4KYUA 5GVRA 3FOZA 3LBHA 9ICGA 3LRPA 4UXIA 3SZRA 3OSPA 2J41A 2Q3FA 4B3XA 5J0XA 1KIMA 1KSHA 1Z63A 4ITRC 2ODWA 2CE2X 1KJYA 2MAXA 1E4VA 3EASA 5DBCA 1CTQA 4QZIA 1Z0IA 2ZRGA 3CRW1 2O8BB 4P4PA 5BOLA 1YZTA 3UMRA 2HV8A 1OYYA 4QWBA 3L0PA 8ICIA 4QZ8A 1K6MA 1NKTA 2ODBA 2PBRA 3LO5A 3H86A 2A5FA 3DOFA 2Z4RA 4LC1A 5FOSA 3AM1A 2R44A 2BDTA 1U81A 3CRVA 1VHTA 1F60A 2J0UB 2VHCA 1X1SA 2BM1A 2QNRA 2CHVA 1J7KA 3SR0A 1JPJA 4IW3B 4QBHA 2J59A 4OI1A 4JT2A 4A2QA 5HMMA 4DL3A 5KFMA 1P75A 5HTKA 2OO7A 4CT5A 5C18A 1TQ4A 5HMLA 1ZQFA 4UAYA 3EYZA 2B21A 3RJHA 1NOMA 3RJJA 2QRNA 2YINC 2R8JA 4DL6A 2GF9A 2ASDA 4IQUA 5JSZB 2E9SA 3QKSB 1KDOA 4KCGA 4NXZA 2CBZA 4N0EA 4BLRA 3QXXA 5KFFA 4ZIRA 5K8LA 4RQ8A 4HB2A 2FFQA 2ZM5A 3CH4B 1XP8A 2X2FA 4JVMA 3T1QA 4A15A 3TW8B 1TV9A 2ZRNA 5JJIA 1EESA 4KFTA 1VECA 1UKYA 4B9UA 4ECZA 3OIVA 4OI2A 1S96A 8ICRA 4I28A 1P2UA 2JAQA 4DDTA 1W4CA 1T91A 3B7GA 4AG6A 1EK0A 1N6KA 1MKYA 2PEZA 4UNPA 5FPKA 3FKSD 1T8UA 3QPUA 3RNLA 2NRWA 4F5NA 4LRWA 2VQSA 4RQ7A 5EP3A 2ZUCA 4F4JA 3QXJA 1QBKC 1TX4B 3LH5A 1LVGA 1JJ7A 1ZUIA 2FSFA 4RT2A 2GA8A 3SFVA 1JPNA 5FTNA 2RGBA 5IT5A 3TBKA 5B2ZA 4OQFA 5DIFA 4IOMA 3X1ZA 1RRCA 721PA 2VP6A 2ZRAA 1R5NA 1T6NA 3Q5DA 8ICCA 3NGDA 3AUXA 4NYIR 2OFXA 3THOA 8ICKA 5FPSA 5BN5A 8ICGA 1N6OA 3OEHA 3WRYC 4HDOB 5DI3A 4UB1A 1UJ2A 3ZGXA 4FI3C 4EJSA 5LB2A 2QBYA 3THYA 4CEIB 3T3FA 1ZC3A 3B6EA 1PUIA 3QUSA 1DVRA 3JPRA 1KI6B 2IK8A 2Q6TA 4WOPA 5J2CA 3QE9Y 3T35A 4N0DA 2KZMA 1ZNZA 4BFWA 2BVNA 4JBYA 4QBFA 4B9LA 3KKQA 3BB3A 1DAIA 4V0OA 2VO1A 4DSNA 2JLYA 1QDEA 1G20E 4DUGA 1UBEA 1KYIA 3B1WA 4URVR 2ZETA 4D4LA 2ORIA 1NY6A 1VG8A 2BM0A 4PFSA 3GV8B 1K1QA 4H1UA 5D3MB 5L3QA 4B48A 2IXEA 4ED0A 1E79D 2HF8A 2BWJA 2VLIA 3PEYA 2BBWA 5A0FA 3W5JA 3KJIA 1G291 4DXAA 4LBYA 4MGKR 3AVVA 2AQ0A 5IIKA 5KFOA 1NK6A 4A2PA 2REBA 2RGDA 5FUWA 4B44A 2IWRA 4MEXA 2Y1IA 2HJGA 1KDRA 3ZS9A 5KT2A 3X1YA 1ZM2A 2PJZA 3EG5A 3GLFB 2EU8A 2C2EA 1EX6A 2GXAA 1NJYA 5BN4A 2ZRJA 2XZPA 2JEJA 4Q8FA 3ZJYA 3G5UA 1F48A 1N5IA 4B32A 1FQKA 2WWXA 1ZQEA 3GLGB 4C9BA 4CEJB 1B23P 2VRWA 1TAQA 1ZQNA 3UKDA 2P2LA 3VR5A 3X1WA 2UKDA 3EZ6A 3MGCA 4TQ9A 1Q21A 3SJCA 3JPSA 4QJ4A 2ZSDA 3EPLA 1SGWA 1SXJD 4KLGA 1CEEA 4I4LA 5FL7D 1E2LA 2DFTA 1SVOA 3ASYA 3QPWA 7ICMA 8ICJA 2IHMA 3CRMA 3IKJA 4L8GA 3FFAA 4Q00A 4G5QA 2PFNA 4XOIA 3T06B 3JPNA 3TW4A 1TK0A 2D7CA 3GLIA 1M34E 4GL2A 1KJZA 2FFBA 5KNCA 5J2EA 2WM9B 3THVA 4DSEA 1E2DA 1W46A 2FSHA 2ATXA 4XVQA 3TVTA 3U2QA 3RB4A 4Q9JA 5B30A 4DLUA 4IDOA 2DFKB 1WQ1R 3IPYA 1R8QA 4KBFA 1XTSA 2IC5A 3WBJA 1D2EA 1Z83A 1AM4D 1Q1EA 3BE4A 1E2PA 4YVZA 1DELA 4TMTA 2AXNA 2F1RA 2ORWA 5FR1A 4EQ6A 4ZI3A 2C98A 4RCYA 2ISPA 2B6HA 1Z0KA 4P4SB 4Q19A 1GOTA 4UXHA 4L16A 3EW9A 1ZQWA 9ICJA 3O8BA 5KTQA 1CP2A 4O0MA 5KG5A 8ICAA 2NO1A 3AKEA 4AYWA 2VP0A 2ZPTX 2XSZA 4XD7D 1JQJC 9ICHA 2YWEA 1G18A 1P9RA 1UM8A 1II8B 4IQVA 3QEAZ 9ICFA 3V4RA 4GXKA 7ICVA 3TANA 3EZ5A 4DEZA 3CNOA 5DDYA 1RYRA 2HW3A 1N6NA 3WHKA 1JXEA 4DJTA 2NZJA 1QVAA 3PO4A 4CVNA 4J9QA 4R9UC 4M1MA 4LJ5A 2B8TA 2HXYA 2ZU6A 2J0VA 4M1OA 4YDHB 4R8UB 2FMSA 2XNDA 2ZUDA 1KK0A 2GKSA 4DQIA 4IVQA 1X8JA 4DT1A 1M6NA 4M9SA 2ZVQX 1TPZA 2JLUA 1G5TA 4R71A 3BJYA 4OI0A 2G9NA 1I4DD 8ICBA 5EE1A 5H1YA 3RYTC 4O3PA 3C2MA 1ZQUA 2BEJA 3PMNA 4C0AC 1ZQCA 2HCJB 2OG2A 4DDVA 1AGRA 4F2SA 3SJZA 3HU3A 4IRKA 1YVDA 4J9KA 1IONA 1OIWA 5IIMA 4TUSA 3ADCA 3TJZA 4D6PA 5FBVB 4LV8B 1KSFX 2QP3A 3CX8A 4DIDA 3U7HB 2C22A 2JLXA 2OBMA 3CZPA 1AN0A 2ASEA 3OIYA 5J40A 3GIIA 3DDCA 1LY1A 2IYZA 5JS7A 4Q1FA 5CYOA 4NDZA 5E7MA 1NMYA 3KXLA 1XZPA 4ED3A 1K5GA 4KLUA 4GPTA 8ICPA 1FUKA 3WP1B 2ZJ8A 1ZM4A 1RJ9A 3GJ4A 3T5JA 1Q3HA 1SVIA 3VTKA 4YMTA 5GJBA 1JNYA 4EBEA 1X2IA 3JPTA 4JL8A 2B8WA 1P62B 1SQ5A 3T5LA 1SXJB 1G17A 3SEAA 3ZVRA 4BEBA 4QW9A 1S9FA 3IDQA 4Q45A 3C5FA 2ALZA 3OIWA 4EFNA 4M9ZA 2XXAA 2BMDA 2XX3A 1LNZA 4LJ8A 2QUZA 2F1JA 1KDPA 1BOFA 3NBFA 4P0TA 4AY2A 5BW8A 1U8YA 2AN9A 2UVUA 4D25A 3T5HA 1E4YA 1JAIA 4HYKA 4EEYA 3RABA 3SYLA 3MWJA 3JPPA 2OT3B 4B3DA 3ICQB 2YOFA 3ADBA 5CDFA 4R98A 4Z6CA 4D82A 2JEFA 4AD8A 2ZRHA 5JHGB 3AKDA 2GAOA 3DM9B 5J29A 3Q8PB 5TB5A 2ZYUX 1P2TA 4URUR 4GZLA 9ICCA 4TQRA 1YZGA 2NTYC 2QRZA 4GOJA 1Q44A 2FMQA 7ICGA 2CL6X 4QJ3A 4DFKA 1YZLA 2GZAA 4KN4A 2VSXA 3V6KA 1NKSA 2ZS9A 3H8WA 3TQFA 4JIMA 4JSTA 1Q0UA 1NBMA 2RDJA 5AJZA 5KU1A 2PL3A 2R6CA 4ECVA 1JALA 4C0LA 1Z6TA 3G0HA 3L2OB 2KWIA 2ZU0C 1UBCA 1S9DA 3DZDA 2O0HA 4JLKA 1OYWA 2H5EA 3D6TB 2GXQA 4RD4A 3UG6A 1ZJMA 1IN7A 2B7BA 3Q8QB 3RC8A 2HLDD 3KHLA 3OESA 3GP8A 1QSLA 3HR8A 4RZRA 3QY0A 5G3ZA 4LI0A 4UBCA 4BXOB 2HHQA 5AUOB 2REXB 3AF2A 2FPKA 1HYQA 1TFRA 4Q02A 4M1WA 1Z8FA 3FWYA 3IEUA 1CJKC 3MGIA 2ZR9A 3D3QA 4IFBA 5KTYA 5KFYA 4DC9A 7ICNA 2F1HA 1A2BA 1ESNA 2P6RA 2CEAA 2R8HA 4C8MA 4L4UA 4XWOA 3CONA 3GLHB 4QXAA 4OJQA 4PC3A 1HUOA 5FR2A 3VX4A 2QORA 4KXFB 3QEBZ 2QE7D 3UPQA 2R6FA 2JLRA 2FU5C 4DB4A 2A2ZA 1W2HA 3K70D 2YC4C 4PXAA 3N5CA 2IHNA 4JLAA 1D8TA 2H7VA 4RUCA 1YR6A 3HYRA 1KSPA 1EFCA 1U0JA 4CDGA 1U49A 2XGQA 2BV3A 3BXZA 2VSFA 3VHXA 3WNDA 4O3RA 4PHPA 4DFPA 1UKVY 1UPTA 5G41A 3PX6A 2GJAA 1ZRHA 3ZDQA 2QZ4A 4AWXA 4BQSA 4NCNA 1G7RA 2IL1A 2H18A 4NLGA 1JJVA 4ZCIA 4DSKA 2O8EB 5FOWA 1H8HD 4QZEA 1QHHB 1DTSA 2Q21A 1P73A 2IEYA 1TAGA 1QVRA 2W2VA 3BGWA 5BYJA 3RVBA 3NBXX 1GVNB 1UKZA 3AVOA 1N5KA 5J2AA 2JIZA 4M21A 1N3BA 3JPOA 5DDMA 4Q9KA 2C5LA 2XNSA 3AB3A 1XJCA 2ZE7A 2ZVPX 4KAXA 2JLWA 2O8CB 1HEIA 3BQ2A 2H17A 3LV8A 4JK1A 4DL2A 1Z0JA 2I1QA 1KRPA 1ZU4A 1B0UA 4ERNA 1AKEA 5JLJA 1ZAKA 4JLMA 2E87A 4GOXA 4LDJA 3TRFA 4H9GA 2A9KA 4PPNA 1MQ2A 3QE0A 5KUTA 3HJNA 1ZQDA 4O2RA 4F93B 4K4GA 5GJVC 4I2HA 2QAJA 1YZNA 1ZYUA 4JMPA 4I1OA 4XWKA 1FP6A 1L8QA 3B9PA 1Z22A 1MC8A 5J2GA 2HHVA 2CMKA 2ZI3A 4HAVA 5E4FA 4F38A 1AKYA 5CHGA 4QBIA 1GAJA 4Q4HB 3KQHA 1ZQJA 4LPSA 4OHVA 2RGAA 5J2FA 3QF7A 3VU9A 2QM7A 3OFND 1CR4A 4KLZA 4KITB 2TMKA 2V7QA 2FF7A 7ICFA 3FGNA 4R64A 2PZFA 1RW4A 2J7PA 1Z0AA 4TMKA 2A30A 3Q8LA 3EX7C 2QMOA 4M1SA 4DZZA 3PJRA 2FDCA 1ZVQA 3SYNA 3FMFA 2DFLA 4F50A 4M6WA 9ICVA 2XJ9A 3C1YA 4D0LB 5LDDC 7ICTA 2NG1A 4PPFA 5D4BA 1E9DA 3BH7A 3GMTA 3B1ZA 3VR2A 1ZYQA 4V0LA 2ZTEA 3QI2A 5J0WA 4PC1A 1RC8A 5J2KA 3MFHA 3LWNA 4XVUA 3I61A 3MFIA 1YR9A 5CK4A 3WY9A 3BD9A 1NN5A 2YKGA 8ICZA 4LJYA 4YDSA 1S0VA 3C8UA 1US8B 3U60B 2AKYA 2PFPA 5SZJA 3CPJB 4HUTA 4TTPA 5J0RA 1MV5A 4M9LA 4Q44A 2F3TA 2F43A 2NRTA 4QM6A 4Q43A 2NPIA 4I1VA 5J2HA 1LB2B 1IXZA 2OILA 2HHUA 4OQLA 1KO5A 1ZM3A 5KDLA 3VKGA 4NYJQ 3A4NA 4ESVA 4RQ5A 5G40A 4DIEA 4DSLA 2AFIE 3ND8A 4LHWA 2AD1A 3H4BA 2ASLA 5KFQA 2KFZA 5TV2A 3SE0A 3AVWA 2GWHA 1XXHE 2ODNA 2IF2A 1D2MA 1U4BA 5F98A 1ANKA 4ECSA 1N56A 3RSOA 1BGXT 7ICSA 1Z47A 2N1BA 1E9SA 2GZHA 4OBEA 4HZIA 3R8FA 3RJEA 2IUTA 2QQ0A 3ICEA 2PH1A 3QXSA 3RHFA 1KNQA 4O2LA 5L9XA 4Q9HA 4DQSA 4TQUS 5C4GB 2D7DA 1KDHA 4DBLC 3HPOA 4LJ4A 4EPWA 4KSCA 2PEYA 2ZI7A 4II7A 4KVAA 1UADA 1G8YA 1X9MA 2AFHE 2KE5A 1ZQPA 2XY6A 3HU2A 5EE0A 5EP1A 4IKEA 3U6BA 2NGRA 1G8HA 4QZ9A 3OSNA 4ECRA 9ICXA 1QHXA 1VG9B 1Z28A 2C95A 2JLSA 5DQHA 5IIJA 2JZBA 4MEYA 5EWEA 1GL9B 1KAOA 2CCGA 2DCUA 3A36A 3LVRE 3PR1A 4D2IA 4DLTA 4GBMA 4K4IA 2H1LA 1VCOA 1OKKD 2CE7A 3GIJA 1G7CA 3K09C 4B73A 5KNBA 4UBBA 4QGHA 3K0FB 9ICAA 2G1KA 5FUVA 1CULC 1G5RA 1KGDA 3NHAA 4KJZA 4KFSA 4MKFA 2F9LA 1ONBA 2EFHB 2F6RA 4GFDA 5J0TA 2WJGA 3LXRA 1OH6A 1F2UA 5LB4A 5GJCA 4B9TA 5EZ5A 2ZXUA 1X1RA 2V6IA 2WMOB 3FMOB 4KLFA 3MJRA 2YWGA 1FX0A 2BKUA 3GFOA 2VHQA 2WPDA 2IA5A 1N5LA 2IEZA 2VEDA 1GILA 1Y88A 4RQ1A 4Y0AA 4BLPA 3EIQA 4HB0A 3EWAA 3PVXA 1WRBA 2BKEA 2A1JB 2PI4A 4DO9A 3C16C 4TSFA 4A2WA 2Q0ZX 1KSJA 4ZKDA 5DB6A 1Z00B 1A1VA 3X1DA 3OEHD 1AA9A 1XMJA 4RU9A 4JV1A 1G9XA 1KFTA 1VCIA 4NYMQ 2NO0A 2J45A 3KKOA 1FMJA 4Q7LA 4ED2A 5DO9A 1VYTA 5SZIA 2ZE6A 3OE7A 5EE5B 3U3KA 2XCAA 4LJ9A 4PAQA 4IR1A 4KHZA 2CLDX 3PR4A 2A5JA 4QZCA 3GJ5A 2DY1A 4DVGA 4L15A 4E07A 2W58A 3DHWC 2QAGC 4J9RA 5J0UA 4DQQA 1J8YF 2WSSA 4IDQA 5HKKA 4O5KA 4HZUA 5KT6A 1TNDA 3CX7A 2J46A 1XBTA 4PH5A 1RXWA 3PX4A 2IMWP 1B22A 3GFTA 4OHXA 4J0QA 4AC9A 4CIDA 2QG6A 2VL7A 1NJGA 3ZDDA 1KY3A 3AKCA 4U5XA 1R7RA 3B5JA 3RH5A 2Q0HA 4RNNA 2IYQA 4Q7JB 5FTJA 1CXZA 1SKRA 4JKYA 3VHLB 5AWFC 2BJWA 1KK3A 4ZDIA 4AYXA 4CEHB 1PVOA 1ZQAA 4DKXA 3H2YA 3LX5A 4QC2A 4R2IA 2O8DB 1RRPA 4I2JA 1BKDR 2G0NA 4ARZB 1ZQSA 1NJXA 1IN6A 2NZ8A 2GJ9A 3C15C 1G64A 5IDVA 3ZDAA 1GL7A 7ICIA 3D7MA 3VR6A 1WMSA 2XJ4A 5TZVA 2BQ3A 1VCMA 4UB3A 3BC1A 4A8JB 3GEIA 3EWSA 1E1RD 4MRPA 3KZ1E 3P27A 1RPZA 2P0EA 5AUQA 4F4ZA 1BPZA 3C5GA 1RYHA 1XTKA 4ZIRB 3K0CC 2GK7A 3NH9A 3ZZTA 4KI0A 3QOFA 3THWA 1SL2A 1JXMA 1COOA 2D74A 2RHDA 4M9XA 4PZYA 4AKHA 1N0VC 2IUSA 4ECXA 2YC2C 4M8NE 4A92A 5F9LA 3NEYA 2PCLA 1R0ZA 1YR8A 3BS4A 4I29A 5DBBA 1HH4A 2W9AA 1R8SA 2YV5A 3I8XA 1WB9A 4BECA 2V1XA 3DKVA 5KT5A 5KFNA 3TI0A 2ZTDA 4YR3A 1AQUA 5JCZA 5KNDA 3SYZA 2GJKA 3Q72A 4LPKA 3GD7A 4BFTA 3NVAA 5L1JA 2QA5A 1P6XA 3V6JA 2WKRA 4G1UC 5C2JB 4FWTA 1JR3E 1YZUA 2ZANA 3BH0A 3EIEA 3IIMA 7ICHA 3PVSA 4XA5A 3Q7QA 3QBVA 5DYGA 4B2PA 5HHIA 1N6IA 1SVMA 1S4QA 4RQ2A 2HXSA 3K09A 4NCKA 5KFZA 1RYFA 2FOLA 4Q4AB 5HPYB 5HZKA 4JS0A 3KFXA 3CR7A 5CK5A 1I2DA 3BIFA 1XX6A 3UXNA 2QL6A 4ZCLA 3M9OB 4YG2A 3V7LA 5HP4A 1GNPA 3B85A 2D2EA 1FTNA 5KFAA 2WICA 4UNRA 4Q9IA 3ONWA 1E1QD 3ZH9B 3FKQA 2JLQA 2NIPA 1MO6A 2BPGA 1NN3A 4NCIA 3MR5A 1G16A 4PAOA 2ZRBA 2GF0A 2C28A 2ZAMA 3N4MB 5LD2C 2W9BB 3THXA 2BMJA 2W0MA 4PO9A 4G01B 2YHSA 1P9NA 4DSIA 1Z08A 2ZE8A 3KQLA 4JL6A 2N42A 4KLLA 3KKPA 1W0JA 1OFTA 3U4QB 1AGPA 1AK2A 2A5YB 5KFHA 1T8TA 1IY1A 4GT1A 1NI3A 5JZVA 3LY5A 4XIGS 2R8IA 4ECQA 2ECKA 5CLQA 3FB4A 1Z5ZA 1H8ED 4CCHA 3IO5A 4HUQB 4LJ7A 1PLLA 3BK7A 3VQTA 4EZ6A 2PLFA 3L0OA 2ONKA 1SVKA 4DWJA 4M22A 2H57A 4F4CA 3AF0A 3PY8A 4NTZA 2QAGA 4QG7A 1GDDA 1U98A 5AJYA 1CKEA 4QZHA 2MSEB 5EXPA 1VTKA 5UKDA 2LYHA 2AQ4A 1U9LA 5DG8A 1NK7A 1II9A 2PT7A 4GNKA 4DCTA 1XD9A 1TQDA 4I2IA 4FMCF 5EXXA 1TU3A 3S1AB 4MDEA 7ICQA 2OV2A 3TAUA 1EFRD 3GPLA 2HT1A 2BEKA 2IW3A 2WMNB 3IHQB 2MMCA 1NVVQ 2AK3A 3UATA 4EPYA 4F4KA 1XMVA 4Q4LA 3TAHA 2H8KA 2ZQ5A 1OV4A 4JJZA 3KTAB 1ZNXA 1ZQLA 1W47A 4I1UA 4PHGA 1W49A 2RMKA 4QHTA 4LYFA 4QGGA 5HCNA 1E2IA 3CLVA 4URZR 3M8RA 2CJWB 2BR0A 1MO4A 4JUZA 4M1TA 4QL3A 1KKMA 2DWPA 4OL0A 1L4UA 5KG4A 2R62A 2ZI5A 1Z6YA 5IIOA 3W9YA 4CGZA 4ELTA 2QP9X 2FJUA 2W6IA 5DHFA 1G8GA 3QNUA 5CJ7A 3TE6A 3BOSA 2KJQA 4B34A 4CZ2A 3DVLA 1FTSA 4RPZA 2J1LA 3GCGA 4DLGA 2HHXA 5J4HA 1N0UA 2Z6VA 3KB1A 3K0CA 3G6YA 5EP2A 1BMFA 4PC2A 1CEZA 2NRVA 4UAWA 1LB1B 3DOEA 5E95A 3RANA 2JJ1A 1EWRA 2J6UA 2ZRCA 3P4YA 4PO1A 4W7SA 3M8SA 3K1JA 4A9AA 4DLRA 2GILA 1CR0A 3TVDA 2IYRA 1W48A 3QZ7A 4DQPA 4EBCA 1OT3A 4PANA 5L3SA 3AU6A 2FGJA 3DMNA 4EUNA 5KG1A 3QXCA 3AQ4A 3OEEA 3LQRA 3UWKA 3K4GA 3V72A 2PFOA 2HYIC 3U5ZB 4A0RA 4B9VA 4QZBA 1BO6A 1S0UA 2KFNA 1S3SA 1Z06A 1JQLB 4Q01A 5KFGA 4TUPA 1ZC4A 3MBYA 4TMWA 3BQTA 3X2SA 3KQKA 4G3XA 4R7ZA 3P1JA 4DLWA 2R6AA 4EIWA 5C4MA 5IK2A 9ICBA 4UJ5A 2VP9A 2RB4A 3TUJC 4Q9LA 3TUZC 3H4MA 5JCPA 2MUTA 4ASUD 1W36B 4DLZA 3W90A 2R65A 1ZCBA 1CF4A 2IF0A 4HLDA 4R65A 1E9RA 3V00A 5L1IA 1M1YE 1F2TB 1KKLA 1IY0A 4GC7A 2GEUA 3HWSA 4OK6A 2DR3A 4IVPA 4R66A 1GP2A 4PGQA 3EC1A 4U00A 5J0OA 1DAGA 1ZM7A 2WSMA 2HHWA 3AF3A 4GSYA 2WKPA 2O0JA 1T4GA 1IHUA 5KFBA 5KT3A 4QWCA 1UA1A 3WP0A 4F92B 3MR2A 3QVUA 4LK2A 4IRUB 1SL1A 1DG3A 3A1VA 1P9WA 1IN4A 3TMKA 4J9SA 3AF4A 3T61A 1NJFA 4CRWB 9ICQA 3ISDA 4URXR 8ICWA 4LYAA 4YMMA 1DPFA 1XEWX 2DBYA 421PA 2AJQA 2C96A 2GHIA 5BPCA 2H92A 2HEIA 2QT0A 2A78A 2P3SA 2WWIA 4TTRA 3K0SA 4RKEA 5JECA 4BUJA 1UDWA 4WBSA 2OXCA 4Q66C 2B7CA 3BB4A 1P5ZB 4RFSB 1J8MF 3FHCB 1JXLA 1ZCAA 1S1MA 2QPAA 2FLPA 1G4AE 4LHXA 4OHZA 3ETLA 4TLBA 4TL9A 1XJ0A 2JDIA 2SHKA 3PUWA 1MRSA 1ZBDA 4DOCA 2GJSA 2IHBA 3HP6A 4PSKA 1CBUA 4B9MA 1Q22A 3SYKA 1UAAA 1JXOA 3UXOA 2ZS8A 4DB2A 2XY5A 1JI0A 1HQYE 5EWGA 1N48A 1RKBA 2A5DA 2BDPA 3BJIC 3C2LA 1YRAA 2A3RA 2BGWA 1GRRA 1W0KD 3EA0A 4Q1DA 5L1LA 3AP3A 4NLNA 4LUCA 4O0IA 1KMHA 1GRNA 3U7EB 2HCBA 5IIIA 3RRHA 4DS4A 4NYIQ 1DAMA 1H38A 1R10A 1VG0B 2ANBA 5KFCA 2PFQA 3Q3JB 1XMSA 2XTNA 3U44B 1Q1ZA 1UF9A 3FVQA 2I9GA 4JVLA 4DRZA 1W4BA 5KFTA 3AH8A 1C9KA 5J0YA 4CYMA 4EKDA 4Q1AA 2JEOA 4RQ0A 1ZQIA 2HUPA 3KB2A 4Q1CA 2CLCX 4RKFA 3IPXA 2RGXA 2O8BA 3DL0A 4DFMA 1T3NA 1SKWA 2FN4A 4N1AA 2KZZA 2F3RA 1JR6A 4ABYA 4NM1A 2EFGA 1N6HA 3T1OA 1GTVA 5F3WB 4FBUA 4MITA 3ORYA 1E32A 2YZ2A 9ICLA 3REFA 4LSGA 4YXJA 2ZRPA 3EC2A 1A4RA 1NVWQ 4ZKEA 1TQ6A 4P4MA 3GLIE 3RH6A 5EUQB 5EXTA 4HDCA 5JWHA 4ZPXA 3H40A 1U8AA 2PI5A 1E2MA 3P26A 4AKEA 1OHHD 5JSZA 3K9LA 5JUMA 3ZZUA 5CA7A 4BWJA 3VKHA 3T1VA 3GQCA 4GZMA 1M7GA 3RB6A 3IQWA 3M4YA 4XVRA 4A82A 2WKQA 4FMBB 821PA 3ZD9A 5J0SA 4IR9A 1KLNA 1IN8A 1FQJA 4BFUA 4C7OB 1KSGA 2KZ3A 2L0XA 1XNJA 1KY2A 2PZGA 2QSYA 4S2EA 4BE7B 5DH9A 4OJKA 3NC1C 1D9XA 1L4YA 4HYYA 2W8KA 4LBZA 5B57C 3B1XA 4TLCA 1CS4C 3Q8SB 2CCKA 2ANCA 1NK0A 3SOPA 3RJGA 4F5PA 3I5YA 5LBIA 1WA5A 4JWNA 3ZIAA 4BPBA 1TMKA 7ICPA 4C0KA 2OXRA 1XTQA 3HP1A 3U3JA 1NIPA 1XSNA 1MH1A 2IBKA 1XB2A 2J5XA 1KI3A 3QKRB 3PW0A 1HJPA 2OBLA 2VIIA 1XCMA 4Z8YA 1NIJA 3AVYA 1P2VA 1QF9A 9ICOA 1U0HC 2BCJQ 5C5JA 1GFIA 3P32A 4WXRA 5L3RA 1DAHA 2IWHA 1QSYA 4O3SA 2ZJBA 4K8OA 1CJMA 4QM7A 4I2EA 1QHSA 2C9CA 4PHTA 4KLOA 1KI7A 1ZD9A 4OQMA 4Y0VA 2Y8EA 2W83A 7ICOA 4Z1MA 2YJTD 1X8LA 3O47A 1T9HA 1NK8A 1CRQA 2ZSAA 1PV4A 2XOKA 1VCNA 3GJ8A 2LWIA 4O3NA 2AU0A 4DEYA 4GDFA 4Q8EA 4JYBA 2JJ2A 1KI6A 2P5TB 2C04A 5AJXA 1FFHA 3VKWA 5CWRA 3E2EA 2V4RA 3LFUA 1KZGB 3R7WB 5E3HA 4P4TA 5JRJA 1DE0A 3U7FB 4PGYA 4Z6DA 4HAUA 1NK5A 3F5FA 1E0SA 2VANA 3BAFA 5E7IA 2FG5A 4BGDA 3AGQA 5FPTA 3I92A 3CPEA 2QTHA 5DGAA 2W9CB 1MRNA 1OSNA 5CB1A 1M7HA 1YJ5A 2E1RA 1VYVA 3MDAA 3PW5A 5FUXA 1E9AA 3PV0A 3OGUA 3AP2A 5C1BA 5D3MA 1OH8A 2FLLA 1XD8A 1EG7A 3HX0A 2JASA 1IJEA 4BFVA 1ZMXA 3QZ8A 4DSFA 4IOKA 1R6BX 3JZAA 3A4MA 3SC3A 1OXXK 2J6SA 5AUNB 2Z83A 2YVUA 5DHAA 3QEOA 3VU9B 3TQ1A 1ZJNA 1SXJC 3KHHA 1G8PA 5KFUA 1VMAA 4MA4A 3PXGA 2P65A 4E5UA 2XY7A 5DQIA 1X6VA 2PLRA 2WPDD 5JFGA 1DAEA 2JEIA 3QG1A 5DKWA 5H68A 3FDIA 3GLFA 4EBDA 3W5IA 1Z29A 1XCPA 1G21E 4B9NA 4NPHA 4JLNA 4RZUA 3H8JA 3R9IA 4MRSA 2NO7A 1IXSB 3SN6A 5AK0A 5DN6D 2WIBA 5KG6A 4BWMA 4CEJA 4TSFD 2VPPA 1NKEA 1M7BA 2ZREA 1ZNYA 4P32A 2V6JA 1DAFA 1Y3AA 1E0JA 2HJVA 4Q1EA 5BWMA 1XPOA 4MYHA 1XF9A 7ICJA 5CDFE 1MABB 3UIEA 2BJVA 2BMEA 4B43A 1XXHB 5CLLA 4MDFA 2OBNA 5KSYA 4Q4JB 2BIFA 4M53A 2IYTA 3OE7D 2P6NA 1E2HA 1HTWA 2ZJ2A 4AURA 3UMSA 1A82A 3T5DA 5J4KA 3I1FA 5DISB 1ZNWA 1Q3TA 1K1SA 1CU1A 1F3OA 1KO1A 2X77A 3GJXC 2R6GA 3PCRB 3PG5A 4MFFA 3FKSA 1T5LA 4HLUC 4C0SA 1NBME 5FFMA 5K8IA 3GFKB 2GXUA 4M0LA 1ZINA 3CUEF 4ACAA 1BPBA 4TYWA 8ICXA 4GLXA 2EWWA 2XAUA 4KFUA 4LJ6A 3B82A 3QEJA 1ZQTA 1DAKA 3TAPA 3HYTA 4HATA 4IEIA 3F8TA 4RZXA 2ZI9A 4LZZA 2FFHA 2DYKA 1OJLA 2OM2A 4IHQA 3RB3A 3G82C 4I27A 1D2NA 5EWFA 4P4SA 4US1R 5BQ5A 1HA3A 2CCJA 3B8HA 1OFUX 1KJWA 3N2IA 3MD0A 4PPQA 3FTQA 2ZR7A 3FPAA 4ZDKA 3EPJA 3BQ1A 3A1SA 3N97B 2HT6A 3FMPB 1II8A 4AKGA 4M1YA 4PR0A 5FPYA 3VR3A 1ZQOA 2FH5B 1AROP 2BC9A 3O8DA 4XSGA 2IYUA 2PX3A 3NDPA 2IT1A 2FNAA 4EDHA 5J0QA 4POAA 3LD9A 4Z54A 2PMKA 1W2GA 3QF4B 3KL4A 8ICFA 1JR3D 2BBTA 2W6JD 1MO3A 2ATLA 5KFXA 1WCNA 1AZSC 1CJVC 2KSQA 2Q9BA 3QIAA 4PHFA 4ZDJA 3MAAC 1KZ7B 4BLQA 3SHFA 3HW8A 5DG7A 1DG1G 3KHRA 3HDTA 1UEJA 4YMWA 3RLFA 4YLGA 5A4JA 1E79A 1BIFA 4HEJA 1PLJA 4WVFA 4YC7A 4Z8XA 2BOVA 4DLVA 1JMSA 4DL5A 4MKGA 2HVIA 1UFQA 1ZQYA 4ZI2A 6Q21A 4JBWA 3U3OA 4UAZA 4KLTA 2P6UA 4TL8A 1TEXA 3RR8A 1OXVA 2CVFA 3GEHA 4YXWA 1G7SA 2YNMA 2N46A 1G41A 4UB2A 1OE0A 1ZD8A 2AL7A 4F5RA 4P31A 2IS4A 1TQ2A 1A76A 1IN5A 4Q1BA 5DI9A 4RNOA 4MUAA 2Y1JA 4IOJA 4CT4B 3EPGA 2ZRKA 4QWAA 4M2LA 2ZUBA 2QTVB 1A7JA 1SKYB 1BPEA 4NLKA 3LNCA 4U02A 3W34A 3EPHA 4JWMA 4ECYA 3F0TA 1ZUHA 3VR1A 5KFDA 3LAWA 2FSIA 1QHNA 4MGIR 4EPTA 2ERYA 3IIJA 5KFPA 4LHZA 4EFLA 3LWMA 1SXJA 1Z2CA 4BZXA 1P3JA 1G3UA 5TDHA 5FL7A 3PUVA 1ELOA 4MYCA 5DE3A 5EOZA 1R4AA 2WJYA 1XEFA 2WVJA 8ICHA 4C2UA 3WMEA 1PUJA 3NC0C 4LC0A 2OE2A 3CH5A 3U3MA 4C8NA 1U9IC 1ZQGA 3OJSA 1NKCA 1U99A 2CNWA 4NL4H 4PC7A 2V1UA 2V4QA 4UJ3A 4WZBE 1JEDA 2I1VB 3RS4A 3K0EA 7ICUA 5IRCD 1W0JD 4MYUA 3H7IA 1PLKA 3HWTA 1BH2A 3K9GA 4GMDA 4Q5IA 3ZD7A 3BH6A 3OZXA 3RJKA 4KTQA 1ZQVA 3KUCA 2O8FA 2FPLA 2OWOA 1R0YA 2BBOA 2X8AA 4G5RA 2ZYWX 1FMLA 1Q20A 1XJQA 3NBYC 3QQ5A 2HHSA 1WF3A 2VF7A 2PT5A 3EZ2A 1X9WA 4C0QC 4QKQA 5TVKA 2GTPA 4JT4A 2QGZA 1G6HA 2W0SA 4A0FA 1NF3A 1E2JA 3CNLA 3GQBA 3B1VA 4HDQB 4L9WA 4B74A 4D0NA 3K70B 5F9FA 2EWVA 3B1YA 4BRWA 4XD7A 2VA2A 3PUXA 1E2FA 4B2IA 2V9PA 521PA 1U45A 2ODEA 4QNMA 5SZKB 4M9QA 4MF8A 4FO6A 1P2SA 5JBQA 1W44A 5KPJA 1MR3F 2FV8A 2GK6A 2XEXA 8ICEA 5J2BA 3C41J 4PZLA 5L3VA 1RFLA 4UB5A 4M2YA 1X3SA 3PENA 2R2AA 3SQXA 4NM2A 2NO6A 2QMHA 1G3MA 2H5XA 1NJZA 3K9HA 3SJAA 4QWEA 2D06A 2QPTA 3BORA 5AUPB 4DHEA 2IS1A 2Z43A 4G5SA 4XUSA 2O5VA 4B3CA 1XSLA 2DPJA 3RTVA 2IBMA 1E2GA 1G5PA 2I3BA 5KSZA 4B3FX 2GCOB 2W6ID 3MR6A 5FOXA 1T8EA 4X8HA 4FCTA 1GKUB 2ZIAA 4I81A 5JRZA 1SZPA 1UBFA 3GLHA 3RSLA 2CLSA 2ZTSA 4KLSA 2UVRA 4ON9A 5F2EA 4LHVA 2GCNA 2AXPA 5CP2A 3FMIA 1TF2A 4JLPA 3AVUA 3V7KA 1RRFA 2H16A 4DDWA 1IAQA 5DLGA 1QG2A 3WNBA 4I2AA 2ORVA 2OSBA 2FA9A 1BPDA 2C9YA 1JN3A 1JB1A 5KG2A 1T5IA 1KO7A 4TT3A 4Q03A 1ZJ6A 2AR7A 3SBDA 9ICWA 4P4OA 1UA0A 2J9RA 3EZ7A 4MRNA 4B6FA 5J0PA 3Q9LA 2GBLC 1OH7A 3RAXA 1M74A 3E2IA 1QHGA 3GLHE 5DB7A 2O8EA 4ZCMA 1QLNA 1D9ZA 4LHYA 2IYXA 1QHHA 1G8FA 4PO8A 4MF2A 3DM5A 1T3SA 5J2DA 4BEJA 4J9PA 2CK3A 1ODFA 5KFEA 1MQ3A 8ICOA 2XTZA 4B3BA 3UXPA 1KI4A 4FCVA 1XD2B 4YQFA 3QENA 4RPYA 4ED7A 5DYIA 5ANRB 2VA8A 2PJRA 3AVPA 9ICSA 2O8CA 4WXPA 2AGOA 2F55A 3M9MB 1YQTA 4LOAA 2FE4A 1Z0DA 5J4YA 2GXSA 3R9WA 1R0XA 3TSZA 4M9GA 2Z4SA 4PQYA 4O9MA 3WHLA 2I4IA 3A37A 4KFRA 3DMDA 2AKAB 5KFVA 3EPIA 1U9IA 8ICTA 1XU4A 3TKLA 2EFCB 4PQRA 2AWNA 4JVNA 4DSOA 4B9SA 1IQPA 4BLOA 3I73A 3SBEA 4DUGD 4TUQA 3IHLA 2QAGB 4NP6A 1QG4A 3BRWD 4A6XA 3RRYA 4ED8A 3CF2A 4B33A 2QN6A 4GC6A 4I2BA 3KJGA 1E9CA 4FMDF 3U3RA 3TFRA 5F9HA 2W2XA 4Q4HA 2RHMA 3QBTA 4DDUA 1CRPA 4J9LA 1XFAA 1KI8A 5JI2E 1XEWY 3RS5A 3AV0B 2ZS7A 7ICKA 2M9NA 5FTKA 3WXMA 4AKIA 2HLDA 3ADDA 4L9SA 4C30A 1NG1A 4Q48A 4EAQA 4KODA 4A0HA 3ZDCA 2VHTA 3PFIA 5JMTA 4P3YA 3KTQA 2OCBA 3VR4A 4TYNA 4AK9A 4UNSA 4V0NA 2OZEA 2PX0A 3LQQA 4ED6A 3CM0A 2EYQA 4EPXA 1E0AA 1A77A 4DLSA 1NSTA 2A7QA 2JA1A 1NVXQ 4DCUA 3C23A 1M8PA 4V0MA 1TK5A 5G3YA 4TMZA 2WAXA 4JKIA 2G3YA 2XCPA 3RC3A 4G5OA 1NMXA 1NKBA 5KFRA 1LTQA 1US8A 3A4LA 3L0SA 2QE7A 3ISCA 4HLQB 4A4DA 4UQGA 2G88A 1XC9A 1XPRA 1AS2A 1XTJA 4QZDA 3D31A 4PGXA 2JJ8A 1KFSA 3UQ0A 3OHMA 4TMVA 3VFDA 3W3ZB 3RJFA 1TL7C 4QHSA 4UQOA 4FN5A 4OI4A 3LX8A 2XGJA 3SJBA 1EXNA 3MGHA 4EYHB 1DOQA 2OFWA 3MABA 3T1TA 4CW7A 5IF9A 1DO2A 3AVQA 4NZYA 1F6BA 1OXSC 3LLUA 5FBRB 4A8JC 3MRSA 2J0SA 5E7JA 1E96A 1E9FA 1KAGA 1C1YA 2OLJA 3A6PC 4YN4A 3EXAA 3PO5A 1GUAA 1H8HA 4K4HA 3AU2A 5A5GA 3NXSA 2XTMA 1VDZA 3RRZA 4PTLA 2NOAA 4BFYA 4KLNA 1XWLA 5DBAA 4KSBA 3WMGA 1P4SA 1ZUNB 3WYFA 3KXKA 1CIPA 1QRAA 3EAQA 3QKUA 4RNMA 3TAQA 4F4XA 1KTVA 1TEVA 2UVQA 4K46A 4IRCA 2OEPA 3RJIA 2XSZD 5LPNA 1RZTA 3MLEA 2GBLA 4DEXA 1FW6A 2IYVA 5DI3B 4NE2A 5HCIA 3M1IA 4EJSB 4OK5A 4YMNA 3BDPA 1P61B 2EFEB 2VP5A 3THYB 4HLCA 4TZ0A 2ZI4A 3C5HA 1E9BA 3Q8XB 4W5JA 1E2KA 2GZDA 2EW1A 4V02A 3E5HA 2LCFA 5HE9A 2ZE5A 1E98A 4HAYA 2OLKA 4Q21A 2IXFA 4ZDWA 1ZU5A 2RGNC 3K0FA 2K5UA 1GKIA 1YZKA 3Q8MA 2XNDD 4BWYA 2J6TA 4WIAA 3DZ8A 4TN1A 1ZW6A 1DARA 3BWDD 4LBWA 3W6OA 2G1JA 4BLSA 5L3QB 2EFDB 3DPUA 1U0LA 4LY6A 3P20A 1E69A 3M0EA 3KDSE 3OFNA 2ZSBA 1HY3A 9ICEA 4RY2A 1VPLA 5DG9A 3QXHA 1WCV1 4LYJA 1KHTA 1HV8A 2BCGY 5DLQC 3B78A 2WWHA 4W5HA 5HZHA 2R9VA 1XEXA 1OFHA 2HDNB 2W8LA 2A1JA 3MR3A 4FMCB 4YONB 2GCPA 5F9NA 3MUFA 3OHAA 1UKEA 4QZAA 1XWIA 4DOAA 4UNQA 1Z00A 2XOKD 4M47A 1G7TA 5KFIA 1EFHA 1BPYA 1E2QA 5KSOA 4GXJA 1WDTA 3DO6A 1XDBA 1ZETA 3V6HA 1IOZA 3K0AA 2XZOA 4JLVA 2MSDB 4TYPA 3PMLA 3MMPA 2IS2A 1KO8A 2V4ZA 4FINA 1G4UR 3NDBB 2MMGA 5DQGA 3NWJA 3SDZA 1IM4A 3ZDBA 2B92A 3HPRA 3ZQ6A 1LS1A 3TUIC 3RWOA 1TF5A 2WV9A 2QP4A 1R0WA 2GNOA 4WAUA 4GRAA 4NMMA 5P21A 9ICTA 4I2GA 1COWA 2RAPA 4KBGA 2FZLA 4AG5A 3GLIB 4JBXA 4E03A 3BFKA 3QVVA 4TLEA 4WZAE 4XTCS 2J3EA 3B0XA 1JIHA 2G6BA 1KNXA 3PNCA 1Q12A 9ICUA 2FEMA 3GIMA 1EWQA 1TVAA 3CB4A 3CO5A 4LGMA 1U48A 1OFIA 2XB2A 3G6XA 1TU4A 3ZVNA 4KN7A 4Z6EA 4PC6A 2GWSA 3LLMA 2IYLD 4CEHA 2AWOA 2FSGA 4RCZA 2O8DA 3SHWA 4EQ6B 2FPMA 1O87A 4ARZA 5KOYA 3HPQA 3TK1A 2AGQA 4C0BA 1SL0A 4PHDA 3IO3A 2C2DA 1IM2A 2WZQA 4YD2A 3GJ3A 3QKTA 1C4OA 3GILA 1KO4A 4JLJA 4IDHA 4A8JA 1E3MA 1NBMD 5D46A 4DCVA 5K8TA 1IJFA 4YMOA 4YMUA 2YWFA 5FOVA 4DOBA 5KFJA 2JGNA 2QI9C 2VHJA 4MYTA 2F9MA 4DS5A 1GG2A 2QM8A 3TQCA 1OKKA 4DL7A 1UT5A 1BVSA 3ZZ0A 4C0HA 1GWNA 3ISBA 4LWZA 4DCNA 2ZI6A 2D3WA 3N2EA 2AD5A 2DWOA 5B64A 4TQSA 4FD2A 1HE1C 2PXIA 2CHGA 3W6PA 4DT1B 3MWLA 1NG9A 1V9PA 3C21A 1BYIA 4D4JA 1Q57A 2BPFA 4Z51A 3VNVA 5CJ2A 1P60A 1HUZA 4LZDA 3RWMB 2ZSFA 3TH5A 5CIQA
chains in the Genus database with same CATH superfamily
5AR1A 5H3HA 3DEFA 4U2BA 4RHCA 2HA2A 1UJCA 1GV1A 3VJRA 2H1SA 3E5MA 2WSBA 1CRLA 5SYMA 2WM3A 3HCEA 2HPHA 3PSAA 4M89A 5LZ4A 1QHIA 3UB4A 2Z3WA 2EKLA 2IX3A 4I2CA 4IR7A 4UOZA 8ICMA 3KB6A 4REOA 2KN7A 3Q88A 3RSFA 2QTCA 1N2OA 2Q3CA 2P66A 3DAOA 1MIHA 1LBIA 4TLMB 3OBIA 4BX0A 1CT9A 3DXZA 5ARDA 3NBQA 1Y8RA 3FTNA 4EB0A 2GYVA 1TKDA 5CR0A 2P62A 4RZ2A 1FSGA 2Z5FA 3C3BA 4MW9A 1ULUA 3KFVA 3GZNA 3GVCA 4WOCA 2YY7A 3SQWA 2XR1A 4INZA 5CGQB 4YJ2F 2ZRIA 4S1TA 1H2YA 3UNXA 4DF4A 2IPLA 4PLGA 1S2OA 3R7SA 2Y0EA 1GIAA 4OQYA 3WLRA 1KIFA 2Z09A 4TYQA 3V1NA 2O48X 2AYXA 3H1TA 1N5MA 3H0KA 3TPCA 2WJHA 1PWZA 1HSOA 1C3JA 1PK8A 4XDZA 5BVGA 2Y2VA 2BN4A 1JS1X 5KNBD 1J42A 1EFRA 3I01A 3HVJA 5BMOA 1AQYA 4YP9A 3E22B 5EJFA 2HQSA 3IEXA 3FM9A 1YVRA 2DM6A 2X7HA 3A3PA 2DT8A 3CMCO 2O6HA 4GIBA 3FNGA 5HS4A 2AMVA 4Z4GA 3KWFA 3OURA 2F77X 3O90A 5E1MA 9ICNA 1Q1BA 4ML3A 4A36A 4F5YA 1B14A 2XHEA 3M1LA 3OPQA 1ABFA 1CJUC 3LY8A 5TS3A 5G4KB 4R2XA 2QROA 3RBVA 5DTRA 2WTNA 2XEDA 4RYDA 2VSQA 3SXPA 4S05A 2VTKA 4QTTB 4TL7A 4R8UA 4JUFA 1PX2A 3CSSA 4KQJA 3C3MA 1FDOA 4P33A 3E4DA 3QKRA 3HN7A 4L78A 3I52A 3WLJA 2J4FA 1IG3A 3KLPX 1P9OA 2NTJA 3HKEB 1ZK4A 4FYVA 1CJTC 4GXIA 2C0CA 4WN3A 1NR5A 4LFBB 3ELUA 5TE9A 1Y1QA 2RFLA 4C8LA 1URPA 3KLNA 1TC1A 2PKEA 2AGPA 3CWQA 3S2ZA 5IAKA 3GJ6A 3L7DA 2XRZA 1AKWA 1Z88A 1GL6A 1GU0A 3CNNA 1I1OA 1GPJA 4QXOA 3CR8A 5EIOA 1HQCA 2YOHA 4E0DA 5J4VA 1QH9A 2VTBA 3REOA 2C99A 2HU5A 2QJWA 2BFCA 4E5PA 1NRJB 2RHBA 1FRVA 3ZTWA 1NK9A 4HADA 2VZLA 1K6IA 3IVRA 4X93A 3N76A 1RKXA 1NQOA 1MABA 4LVSA 1E0KA 2XMBA 4BV8A 1XQWA 1HXHA 4NEQA 1ZQHA 3K70C 1P7WA 2NACA 3PC3A 3OCVA 4ROSA 4MMYB 4I2DA 1WETA 4E1BA 3G17A 3UB2A 5JCOC 5LM3A 1TE2A 2ZB8A 3NM6B 5JY1A 4Y2SA 2P5SA 2WE7A 4ZEXA 2IPMA 2NO9A 5JYCA 3BKWA 3STUA 2ERCA 3PGJA 5KVAA 5DYWA 3MN1A 4PEVA 4EW6A 1WZNA 4BUCA 1RXVA 4AI6A 5FI0B 4NMHA 2H2WA 5AJWA 5AKEA 4OLBA 1IC6A 4B79A 1QGAA 1YS9A 4PXSA 4FBTA 1IY9A 4EA7A 3KB8A 2SKEA 4OM7A 5EQJB 5KNBH 4BQEA 3PNVA 1Q11A 1UOQA 2DSTA 4MP3A 1KFKB 2O2XA 3FYUA 5HGJA 2ZSIA 5A9SA 5CVEA 1JBKA 3ZDXB 4I7EA 5IAJA 3L0ZA 5LC1A 3N0WA 1AKQA 2DQKA 3KEGA 4EENA 4J91A 1SD1A 3P2MA 4ZV4A 3I72A 3SFZA 2JCGA 2QARA 4C3ZA 4IDEA 3GFPA 3OJOA 3DXYA 3ABRB 4WKBA 2WRZA 1FUEA 4QYTA 4GPZA 3OJCA 2DR2A 4PQGA 1P0CA 1JA0A 3DFKA 3K2IA 2YJGA 1T0UA 3Q7EA 2CFOA 3ZIAD 1HLGA 4JQCA 3OLZA 4OYRA 2B69A 3QFSA 3C1UA 1W35A 1IXKA 3PHCA 3I2KA 2XNJA 3KQUA 3C6XA 3CN9A 4K9NA 1FSSA 4X20A 1KPHA 3K4PA 4GWGA 3IDAA 4AP6A 2D5IA 3LRPA 4RTLA 4F6LA 2BFBB 3KEFA 1WDMA 5BOLA 4EJFA 2WQ6A 5FXMA 3DOFA 2R44A 2HCFA 6REQA 2BM1A 2C4WA 1RPTA 3VV3A 5JNRA 5M29A 5IBQA 1IB6A 2X2FA 1OXKB 3JATB 8ICRA 3RK0A 1YFZA 1RWMA 4UNPA 4DC1A 4BJQA 1G5IA 1YIOA 3LUBA 5FTNA 1UC8A 2YMLA 5IDQA 3Q5DA 3AR6A 1MX3A 2MIIA 1BEEA 4Y6SA 1ZC3A 4N0DA 1UMCA 3QX9A 5K05A 4DSNA 1G20E 3TTSA 4DAOA 4II2A 1KE2A 2Z8YM 2BWJA 4XIFA 5HX7A 1EDEA 4JBIA 5KFOA 4H7KA 4H6PA 4FNMA 3N75A 3OFSA 2EU8A 3GH3A 2GXAA 1NJYA 1OFVA 3AR7A 3LX6A 3QPWA 4OG2A 3PQ7A 2ZWAA 1M83A 1YS1X 5KNCA 2X22A 5CW1A 2GMWA 4DLUA 4IDOA 3SAFA 3L79A 4TM8A 3P9RA 1RAEA 3NIDB 4U6PA 4P4SB 4Z6KA 5I8PA 3DP7A 5JBIA 8ICAA 2XRMA 5A5FA 4IV0A 4IQVA 3CNOA 1XQVA 3I0ZA 1ZICA 3WE7A 3EEFA 2CHFA 4OHRA 4LJ5A 3BF8A 2J0VA 2QF7A 3UTCA 2HV9A 2ZUDA 4IVQA 1PEAA 1M6NA 3QI7A 4R71A 3CLSC 4Q9DA 4NJEB 1WZ2A 3JARA 3BWMA 5DGIA 2RRDA 1MLDA 3T0IA 1NMYA 4ARUA 4EMSA 5F2OA 1JNYA 3SF8A 4CCWA 1RYYA 4H1HA 4BEBA 4M1QA 4A8HA 2VNHA 3FGZA 1QVVA 5KAPA 2WA1A 5EWMA 3DVQX 4D82A 3NHLA 2CNBA 1Y6FA 1VGRA 2YRFA 3HGMA 9ICCA 4B46A 5T7BA 3K05A 7ICGA 3HZOA 4WRRA 5K6AC 4KN4A 4K40A 3IVCA 2HTEA 3OPYB 4JBNA 2W6MA 4TTSA 3V4PB 1RRMA 1Z6TA 2J9ZB 1PUZA 1U0TA 4EUSA 4HNTA 2B7BA 4RIEA 5A7FA 3A2KA 1BVRA 3TQQA 1K9VF 4B7AA 1Q6YA 4DC9A 4O1HA 3DLAA 4M46A 5FR2A 2P68A 2YC4C 5F7XA 3N5CA 2IHNA 4BV2A 3H9BA 1KSPA 2Y2UA 3D2SA 1VL8A 3RLIA 4AZ0A 1UKVY 5G41A 3I42A 5T4EA 3TMYA 4QZEA 3AERA 4UBKA 1DTSA 2Q21A 1TAGA 4B7ZA 3FWHA 4XUGB 1XN4A 2J3HA 3HWRA 1C0LA 2JLWA 4HX5A 1JDUA 1TVCA 4YT2A 1V2HE 3KZIU 3WLHA 3SHTA 1Q50A 4B4WA 1MQ2A 2WT8A 1FDVA 2XE7A 5GJVC 4I1OA 3J80A 1WDKA 5AO9A 5I9IA 4Q4HB 2HMUA 4KITB 3G0OA 5KWVA 4AMBA 1PJBA 4AT1A 4CXMA 1YUNA 2B35A 4GKAA 5D4BA 3BH7A 3UGKA 3FOFC 5F52A 5B12A 2Q1WA 3HNPA 2CLHB 1IULA 1PWXA 2O3RA 2H48A 4UMDA 4PYJA 2F43A 2HHUA 4OQLA 5KDLA 1M0TA 2JCBA 2Z2XA 1N56A 2A35A 3BMOB 2HWWA 3FIJA 3EBPA 2HQRA 5A05A 1AHNA 3DOOA 4II7A 3G02A 3EVDA 1W8DA 1M2OA 1Z28A 4GBMA 4Z9BA 9ICAA 1UIRA 2XE8A 2F6RA 5COQA 3NYWA 4X1IA 5LB4A 5GJCA 4M1ZA 1BJKA 1GCAA 5CD9A 2ZSHA 2IEZA 4HB0A 3VNBA 5I7HA 1KEPA 4DO9A 1M0EA 2FKAA 4LW8A 5K3AA 2Q5CA 2EJBA 3QOXA 4FOLA 2J45A 1BW9B 3U3KA 2DY1A 4FBLA 1NAHA 1S8NA 4JIGA 3I09A 3V42A 3GHHA 1MU0A 3LOQA 3KBBA 1TUBB 5JFOA 2OSVA 4K3UA 3BGVA 3G2QA 5KCMA 1E1RD 1SMKA 1ICIA 4QPZA 1HYBA 4DANA 4MXDA 1JZTA 3H5VA 2KOBA 1KOLA 1VHWA 4OFXA 4FWTA 3L77A 5DYGA 3GGSA 3GJQA 4YV1A 2W55A 5CK5A 3ZY4A 4UNRA 1X1EA 5FYDA 3WLOA 3AETA 2JMGA 1U11A 3P9IA 3THXA 1OFTA 2A5YB 4MV7A 2ZDGA 2IDZA 3DMFA 3UENA 3ZLBA 3FB4A 4N0MA 1JHAA 3BK7A 2PLFA 5EY5B 3AUFA 4DWJA 4ZGGA 4E31A 5EXPA 5UKDA 1CKEA 4TVSA 1TQDA 1V4NA 2IW3A 2AQKA 1E59A 2I2AA 1ZQLA 3QTLA 3CLVA 2M2IA 3MAJA 5IIOA 1QR6A 1HKUA 5CJ7A 3MPUA 2ZUEA 3D6AA 4ARCA 3R0IA 3HRDD 4UAWA 2ZRCA 2BFDB 4DLRA 2GILA 2DSNA 5L6LB 2HGZA 3F3SA 3KVRA 3IS3A 5I9MA 2PFOA 2WJ3A 3B2NA 3KQKA 4XR4A 2PGNA 3UT5A 3RTDA 4KK4A 5EA2A 2R65A 3TLBA 1JKXA 2XHZA 3IUJA 3TIIA 3BGIA 1LPOA 5IJAA 3RF9A 3SIRA 4BNJA 3G68A 4I9FA 2Q46A 421PA 1T2FA 2GAIA 1TW2A 3LT5A 4II3A 3UAVA 2X0IA 4AWXA 4PSKA 2XY5A 3V4OA 1KDZA 3WGJA 4TVBA 3PE4A 3KSAC 3D5EA 4IDGA 4FX5A 5BWLA 1JR2A 4MVJE 3U7EB 2ANBA 1XMSA 3UA4A 5IASA 1LLDA 4Y6QA 4R8LA 3P4UA 1ABBA 3F90A 2RGXA 1HQDA 2F3RA 2GCIA 4HRXA 4ZO6A 1N6HA 1U6JA 3NVZA 5DBIA 3ZDZB 1DT3A 3MBOA 4DJEC 1VRCA 4A82A 2P9HA 3HB9A 2KZ3A 1D2AA 5B57C 3SX4A 3I9OA 2AE1A 4CMBA 3K7EA 3FCCA 4RHUA 3HP1A 1XTQA 4YRLA 2R00C 1XSNA 1MH1A 3DBHA 4ZYTA 1Z4MA 4FE3A 2BSAA 5C5JA 3GEDA 3OZFA 2EFJA 2X6QA 2F4VB 1C2YA 1LDEA 1J1UA 4GDFA 3CZCA 4A16A 3MT9A 1KI6A 3VKUA 5LQMA 2YNMC 4AMZA 2W9CB 4J76A 4EA6A 1AV7A 4PNEA 3H65A 2DC1A 2I0FA 3E9NA 3BZKA 1DC8A 1DAEA 1EM8A 2ZBVA 4BNKA 3QLEA 5AJHA 5CDHA 4J43A 3CBGA 4P32A 4I2NA 4G37A 2IOFK 1K06A 2BJVA 4Q4JB 3CUKA 4AURA 1FRQA 1M8FA 3TOXA 2EWWA 4ZQCB 1Y8QA 3OJLA 3QEJA 3LQ4A 2ZI9A 3IT1A 2W2LD 1HA3A 2A33A 2CCJA 2ZTUA 2G71A 4DA6A 1ESDA 2FH5B 3GC6A 4GKKB 2IYUA 4QXMA 2IT1A 3PF8A 2VDLB 2WA2A 4BNZA 1GPYA 1FLAA 1MO3A 1WCNA 1QGOA 4MUJA 1UEJA 1RKUA 3E53A 2BOVA 2VPXA 2GPWA 4JBWA 2CVFA 1IZZA 2JIOA 5JT1A 1B00A 3NGMA 1SBHA 4LNHA 1JN0A 4O5OA 4MX8A 1SXJA 4FGJA 3VZRA 2Q2WA 1ELOA 4HOYA 5EZYA 3DS8A 1ULTA 3FWKA 2FN3A 3K0EA 1W0JD 3CKKA 1TD9A 2E49A 5KYTA 2OWOA 1SC6A 2VF7A 2JI8A 1OGYA 5F7JA 2EBWA 4HDQB 4NG5A 1PWHA 2QY6A 4JP8A 4M9QA 2HA3A 4KVFA 1ZMOA 2PYDA 3SQXA 4NM2A 4J16A 3SJAA 1LCIA 2Z43A 4WXEA 1GR0A 4N6NA 4RABA 5CVVA 1GAQA 4GW3A 5D6NA 4BMVA 3LO8A 5ALNA 3P97A 2ZTSA 4JLPA 3RHSA 3ILXA 2NVUA 1L5RA 3OQPA 1T5IA 1KO7A 5K4LA 3PI7A 4P1ZA 2G17A 3Q9LA 3PVCA 3FOEC 4NSNA 2O8EA 2XE6A 1NSYA 3S29A 1EGVB 3VNSA 1XLWA 4JI7B 1U5CA 1T10A 2FQXA 2XQJA 3UAOA 1WQ3A 4C2BA 1MQ9A 3BEOA 3A37A 1IHDA 1JAYA 3H17A 1XN1A 1U9IA 5IN4A 3O8OB 4Z7OB 4RSRA 3UAZA 2KHVA 4NP6A 2B4RO 4J9LA 2O3JA 1T2VA 5JO0A 1A9OA 2FZKA 4ZT2A 2FSSA 1GDHA 3A9TA 1YHZA 5GAJA 4DCCA 2CN1A 3LQQA 3A26A 4MJLA 1DUIA 1QU2A 3R6TA 5KOHB 5AJUA 4PCVA 1PAUA 1QWOA 2QX6A 1NMXA 1NKBA 5KFRA 1BROA 4TMVA 3OHMA 3LX8A 2XGJA 1EXNA 3JWHA 4UB8U 3ANXA 1M1YB 3RVDA 4H59A 1E9FA 3NGXA 1F3LA 4K4HA 3F5QA 3AR8A 3NVMB 4DIFA 2B25A 4QUHA 4D9EA 4KSBA 1OR8A 2IH2A 5M7EA 3OQ6A 3TAQA 2QBYB 1P61B 2P9YA 5LWHA 1AVTA 3T95A 1E98A 3B7PA 3DZFA 4G5HA 2WYIA 4BMXA 5JSYA 4TN1A 2J4CA 3G49A 3W6OA 2G1JA 4NIMA 1YR1A 5KQMA 3OFNA 1W88A 1IIPA 1WCV1 3VSBA 4W5HA 1KERA 3MR3A 1UKEA 1C0KA 4G26A 1WXWA 4QSMA 1HK7A 5T3UA 4H16A 3R40A 3R5FA 4TYPA 4HWSA 4M8KA 3ZQ6A 5D1NA 1XE3A 4H3HB 5FWAA 2FW7A 1Z6PA 1W52X 3GA0A 5HKLA 3H5IA 3DWEX 4EZBA 3C1TA 4O4HF 4P5EA 3A7EA 2BTQB 5EIEA 4EKYA 3ZX5A 2H06A 4JLJA 3S2IA 3DMPA 5IVPA 2KVSA 2YWFA 2JGNA 3H1FA 2BR5A 3RU9A 4BBPA 1E1NA 1LLUA 1DGQA 2DWOA 1Y37A 3BHJA 5B64A 1SG9A 3EULA 2ZSFA 3WIEA 3O8CA 1VE6A 1G8JA 2QMUA 5HQJA 1W1UA 2UV8A 3IAHA 3E70C 5B1IA 3M9LA 3PNKA 4KXMA 2QDKA 5TLSA 4UATA 3JD3A 1DDIA 3P9CA 2RH8A 2LYBA 1ZS9A 3UT6A 1KHHA 3JQDA 3JVVA 5KDDA 1SVWA 3V7JA 4P0PA 3WOVA 1ZN7A 4MRVA 4YT4A 2ILTA 3GJRA 4PTYA 5CM9C 4BWGA 2WJZB 3U4DA 1WPGA 1W25A 2O1SA 3CH6A 2FZVA 3ENVA 3CF0A 2CLOB 3EVCA 3AYZB 3NPAA 4TTAA 3HVIA 1SBIA 1F8UA 5GVSA 2J0UA 1T5HX 4L0QA 1FQOA 3HEAA 2QQEA 5KAFU 4G9GA 1CUAA 3HHEA 5BQ3A 1FA9A 3PTZA 2SNIE 3LWDA 4PHHA 1ZQMA 1MOPA 1I4TD 3M5PA 1H1TA 1EXMA 2BCVA 4CTKA 4YPVA 1CR2A 1ZW1A 1XO1A 3IQIX 3TL2A 3SHQA 4M0CA 4FHFA 4CQMB 4MEBA 1F4PA 5JCJA 1EUCA 3WBKA 3EGXA 3CZAA 3EZLA 3G9QA 1TADA 3C8HA 4NDNE 2ZGVA 4ZHQA 4Q6WA 1A27A 1PZHA 4MA5A 4KR2A 3COYA 1I7PA 2DJIA 3HRHA 1A7UA 1KTQA 2RHRA 5KC9A 3N0RA 2B0JA 4BB6A 4EFMA 4NCJA 2W90A 2H5LA 4JP3A 5HCUA 5I48A 3DG9A 3GBSA 4UQLA 4B7CA 1FXUA 1Z4OA 1EVEA 3E9RA 4E70A 3BQMB 4XM1A 2Y4OA 2OO3A 1OXTA 3AZPA 2BKLA 4IJKA 1OW3B 1TD1A 2FWPA 5T6MA 3VR4D 1BGVA 1E5TA 2WU3A 4YP3A 4I46A 3RW9A 5B1YA 4F72A 5DX8A 2FMPA 2GJ8A 3OPMA 2YCLA 4Z1OA 5L9AA 3OA0A 4GU5A 4Q15A 2MSCB 3EXHC 5CVJA 1RZRA 5ELLA 1I3KA 5KDOA 2PCJA 2O3UA 4E1VA 3VPGA 3T7CA 2EVWX 3PIRA 4BRZA 1HDXA 2C8LA 1EFUA 4LZAA 4N8DA 3GCDA 3PNLA 1E3WB 4GS5A 1KIAA 1DDOA 1MOZA 1K63A 3II6X 5FPHA 3TINA 2G9VA 3OF5A 3OM0A 4GC5A 1DO8A 2PA0A 2QSUA 5FH9A 2XA9A 1M5TA 1SH7A 2BZGA 3N3AC 3LK9A 3K1AA 3B60A 1V7ZA 2E5LB 1WCLA 4O25A 4K0RA 2BFOA 2XPCA 3CEAA 4EJ2A 1CDEA 4YI5A 5AM4A 3BMCA 3EIUA 3IEMA 3E84A 2WFMA 1OIXA 2OUKA 3OWXA 4F3KA 1RQRA 3JQ8B 2OESA 4HBGA 4US2R 1GJRA 3EW7A 3GUCA 3P71T 4QYSA 4WX2B 4MAMA 1EFPB 3LDFA 3KUXA 3LHIA 2V5AA 4NCBA 4C20A 3A6EA 1T9CA 3CW2C 2BCRA 2QRVB 3RBEA 3V9PA 3UJ8A 2OK7A 1Z2NX 1XALA 2NAPA 4UM7A 3U26A 3N2GB 4JUBA 4DR1B 1ED1A 3HO8A 1ADFA 2RDIA 5BN3A 5KT4A 3BFPA 2VF8A 1J70A 4MUBA 1FPMA 2CNNA 4JEUA 4Y6PA 2Q9UA 4DM7A 2AXQA 4R6WA 3AKYA 3NBAA 4F2PA 1YUMA 3T7SA 1FNMA 4QUGA 2ZXIA 2IIVA 3VDNB 3OAAD 4MR9B 1HT2E 5JEEA 1HE4A 2A1TS 4D4MA 1HT1E 3EDYA 5CA0F 4OQXA 4R9VA 2WOOA 4WZAB 4IRMA 2KI5A 2VF5X 2RGWA 3AI1A 4KK3A 1JA9A 4QU8A 1RPNA 4HGRA 2OFOA 2PSDA 2IP1A 3HFGA 3A9WA 1V5WA 3ZTTA 1TK2A 2PTHA 4R2WA 1YB5A 2PAAA 4AWAA 4GI1A 4AS2A 3EUFA 2EX1A 1GGEA 1QAMA 3K8YA 3D6HA 1QHEA 2C4UA 2C97A 1YR7A 3WJ2A 3NVDA 3A8TA 3SE7A 4E09A 1HZZC 2HJRA 4C2AA 2C3OA 4MKRA 3MRVA 4MEAA 3E1SA 3UV6A 1EWKA 4I1IA 2BHSA 2I54A 4M7OA 4ZOEA 3ZQJA 1N6RA 4CTJA 4LVUA 1MX1A 3ZI0A 1D0IA 2IUUA 1TC2A 5EMHA 1L3VA 3WGOA 1NJWA 1IL0A 2CHUA 4JZKA 4O59O 4GM4A 4GI7A 4ESHA 3Q2KA 1ONSA 2Y76A 3FKJA 4NAUA 1TK9A 4J9VA 2FZCA 4PNHA 1EZ4A 2Q8NA 1Q0QA 2P4SA 4DSJA 1RAAA 2Q3FA 5ECWA 5EJ6A 1H1LA 5J2TB 4E4YA 3WL5A 1J7KA 1JEJA 2IZ7A 1KZHA 1P75A 5KFMA 1EX1A 3RJHA 2YINC 4N0EA 5ALUA 2I4LA 1RI4A 2ATIA 1F17A 1X92A 3ROGA 1C1DA 1LZLA 5IFLA 4DY4A 4AO7A 4J49A 3S7TA 1T5DX 1NP7A 3GNLA 1LX6A 1JJ7A 2GA8A 3TTXA 5IT5A 3IN5A 2HZ7A 5JZBA 4JD5A 3WRYC 5DI3A 3HSSA 2BVNA 4ALKA 4QBFA 1W4LA 1DAIA 4PG5A 4AJOA 1Q0ZA 4HNSA 1R6UA 4OU5A 5KYVA 3PEYA 9MHTA 5A0FA 2CJPA 1RYUA 2GA9A 4QQFA 2PIAA 4LBYA 3OFKA 3V8VA 4OGGA 3UKOA 4A2PA 3Q10A 4N3CA 3DFZA 3ECAA 1TZKA 1L5QA 1GNVA 3G5UA 4GSKA 1UJ5A 3ASYA 4X7MA 1XTPA 2EBUA 2PFNA 4BU0A 3GLIA 4G0ZA 1KJZA 2QW0X 2V65A 3DCJA 4PVDA 2VNIA 1CEYA 4LGYA 3K6SB 3LBYA 5E9WA 3TW0A 1EM6A 2G72A 3D0KA 4EQ6A 3LPDA 3IIEA 1KEWA 3JR7A 5ALSA 1XDWA 3P9XA 2WKSA 2YWEA 1WTCA 3LZ6A 1RYRA 2F9FA 3OOSA 2V74B 1MN8A 2ZU6A 5IFKA 2FMSA 1ZUD1