1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD51
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
1WP9A 1GG2A 2Z43A 5FUYA 1OYYA 1RPLA 2J6TA 2HLDD 1X9SA 2W6ID 5BYJA 5ELXA 4RUCA 4L9WA 4GBMA 5SZIA 1FP6A 2VHJA 4J9NA 4B9NA 5CB1A 4O5KA 1XMIA 4MYCA 4IW3B 4U5XA 4WOPA 3RABA 4HEJA 2P6NA 3OE7D 4R98A 4FMCB 1XP8A 4KLTA 1ESMA 1S97A 4PFSA 2ZAMA 3LWLA 1T5IA 1II9A 5KT4A 1TNDA 1QVRA 2OESA 1L4UA 3RVBA 5KFQA 2ZU6A 4L9SA 2RGAA 2XTZA 4GMDA 4PGXA 3OJSA 2IYSA 3THVA 3RLFA 2JLXA 2QAJA 4RNNA 7ICPA 3ISCA 1N6RA 3ZDCA 1DTSA 3BFKA 6Q21A 1D8LA 2JEFA 1UBEA 3PEVA 2DR3A 4BFZA 5K8TA 3WMFA 1Z06A 5EE1A 4E07A 1TF7A 2HXSA 2IXFA 2AU0A 4PHEA 4PAMA 1Z2AA 4QWDA 4PSKA 2YHSA 3TAHA 4URWR 2XZLA 3AVTA 1M8PA 3U44A 1NK0A 4F50A 2QAGC 5BN3A 3V72A 3E70C 1S3GA 1ZBDA 4PAQA 1F2TA 5B58C 2KJQA 4DVGA 4YXJA 4B3CA 3BWDD 4RZ2A 3Q8LA 4C2UA 5CLQA 5A5GA 1X3SA 4P33A 2P6RA 2EYQA 4LBWA 4RVCA 4MGKR 2PH1A 4F4CA 4YXWA 4C0QC 1GSIA 2ZYWX 1OH6A 4XA5A 1BS1A 3CX7A 4TLEA 4B3GA 3OEED 4UNQA 2FGJA 1EGAA 4MGZR 2GJ8A 5FUWA 5FOVA 2P6UA 3MR3A 2WKPA 3CZPA 4R7ZA 3TAQA 1CRQA 3PX4A 4C0AC 1GP2A 3B1XA 4RD0A 1M6NA 4ON9A 3U4QB 2R2AA 3EZ9A 5HPYB 4C7OA 2ZVQX 1D9DA 3F8TA 1KMQA 4HATA 4P4SA 5KNDA 2ZSFA 5KSZA 3CLVA 2BKEA 4TYNA 5CP2A 2I1QA 1UJ2A 4OHWA 1RW4A 1XSLA 2ECKA 4AWXA 4DEXA 2VEDA 3GV5B 4L4UA 4ZH4A 4PAOA 2GWHA 3LLMA 2Z83A 4DFJA 1KSPA 2EU8A 2QU8A 1DELA 2PMKA 3DOFA 3SNHA 1LV5A 5FPKA 3B1WA 3GLGB 5J2BA 3U44B 3TVTA 1NKBA 4OQFA 2EFEB 5JUMA 5KYKA 4DBLC 5J2FA 1W36D 1LV7A 2FN4A 1E2MA 3WBKA 3W90A 2A5JA 1E9FA 2GNOA 2PCJA 2P5SA 1NJYA 3DPUA 3IEVA 4EPVA 2RGBA 2FMXA 3C1YA 1E4VA 2R8JA 1E2EA 2B7CA 3QEBZ 1SKWA 1YRBA 4QZHA 4ELUA 1R4AA 4QJ3A 4LJ4A 4V02A 2ZTCA 2GXUA 1JJ7A 4GNKA 5FR1A 3EA5A 2RGXA 3KUCA 4WVFA 1YR6A 4BQSA 5DGAA 4KLEA 4JL8A 4K4GA 1U81A 1WQ1R 3MG9A 4RZUA 4OHZA 3NDBB 4AK9A 2SHKA 4YR0A 2VP6A 4E03A 1UKZA 3SHWA 1E2PA 3SQWA 4ASUD 1T0JB 4EZ9A 1RXVA 4AYWA 4NHOA 1Z8FA 3WRYC 3ECCA 1BPDA 4PPFA 4DSNA 1PLKA 1P9NA 2VL7A 5KDOA 2NZ8A 2VH5R 3BK7A 2WZQA 5DB7A 4CCHA 3AH8A 4NLKA 3C41J 4DCSA 5FFMA 1EFCA 1Q20A 1ZQXA 2QROA 2VANA 4XH9B 2CE2X 3EWSA 5IILA 1UF9A 3RS4A 1UKEA 2P67A 1W2HA 4NCJA 3T5HA 2ZYVX 3GJ7A 5FUXA 4QZGA 3CRW1 1KI2A 4ECZA 5CB6A 1TK8A 1A5TA 3RS0A 3QEAZ 1NI3A 9ICGA 7ICIA 2DBYA 1BVSA 4M1TA 5UKDA 3WYAA 2OO7A 5FTNA 3GQCA 4KLSA 3P27A 2AX4A 5JJIA 1M1YE 4RQ6A 3L0SA 4AURA 1MC8A 4DFPA 1PJRA 4Q4AA 5BN4A 4DCTA 2CDNA 3AF3A 2ATXA 3JVUA 4I29A 1CR2A 3UWKA 2QBYB 1GNRA 1NVUQ 3IKJA 1S4QA 2JJ2D 5C5JA 2IUTA 3UXPA 3PR5B 4DFMA 2AK2A 2WM9B 2H5XA 5GVRA 2C2EA 1J99A 3ZDQA 2DB3A 2O8EB 2WKQA 2F1RA 5DDYA 4U00A 3GDXA 1BYUA 3KQHA 3K9GA 2QT0A 2GK7A 3RSLA 3X1XA 3ZIAA 2B8WA 1H8HA 2WTFA 5HHIA 3G0HA 2OZEA 1Z0AA 4JL5A 4Q47A 4UXIA 3SHFA 4QKQA 2H57A 4TZ6A 2R8RA 2GZAA 4IRKA 1FMJA 5CLLA 4X5VA 2NG1A 2PZEA 1P3JA 4YMNA 4MEXA 4GC6A 1KDPA 3RAPR 3TH5A 4BWMA 1OW3B 1MO5A 5KUTA 1VDZA 2NMVA 4QZ8A 3PV8A 1QBKC 3VMFA 5K8UA 3VR2A 4X8OA 4IQVA 2AXNA 2BPGA 5KTQA 2W00A 1NN0A 4C8OA 8ICVA 3NHBA 2J0SA 3QSYA 4KHZA 5IHPA 3AVPA 3PW7A 1XTIA 3D31A 4HAXA 3HPOA 4PO8A 5DYIA 3Q8KA 4LHVA 3A58B 4EEYA 4JLOA 3LY5A 4BFSA 5SZJA 4FWTA 3DM9B 4M21A 3FMFA 3AVWA 2RMKA 4QC2A 2AQ4A 2ODWA 1VCMA 1IBRA 1NN3A 3SS8A 4I4LA 3UQ2A 3L0IB 5E4FA 1HEIA 3DMNA 7ICTA 1F5NA 3TAUA 3WHLA 3A1SA 1K1QA 1KK2A 1KSGA 2WSSA 5KFWA 5DNYB 1GFIA 2VYFA 2RB4A 4A36A 2NRZA 4HLDA 3GIIA 3KXIA 3W6OA 2OE2A 1XO1A 5IINA 1TL7C 3B1YA 1KO5A 3CNNA 4L5BA 2MUTA 4BFXA 3OESA 5J4YA 4LYFA 4MGIR 1G4UR 4QZCA 3TK1A 3KKMA 4F4YA 2AGQA 2G83A 3JPTA 4B9SA 1VG0B 3THOA 3ADBA 1SKYB 3A8TA 2HCBA 4EFNA 2WOJA 4KN7A 2ZTEA 1FTSA 1QHXA 1GUAA 2IYQA 1TU4A 221PA 4ED0A 2R8KA 3BDPA 1UKYA 3CF6R 4ZCLA 2ZM5A 4C7OB 4Q8EA 2OAP1 3NWJA 1U99A 5GJVC 4OI1A 1BOFA 3PO5A 2PLRA 1E9RA 4DDWA 2C95A 4MFFA 3I92A 1IJEA 2ASLA 1GL9B 1M74A 3NG1A 1NKCA 3T5DA 4LV6A 3P32A 4MDEA 1Z22A 2ZUCA 3K75D 1ZJ6A 1D8TA 3GV7B 2ZRMA 3LV8A 5CDFE 3AB3A 3V9PA 5L3VA 2ZTDA 2GBLC 4ESVA 2BHRA 3M6AA 5EOZA 1OE0A 1VCIA 3CZQA 1R7RA 2GF9A 4K8OA 4B73A 2UVWA 5JCPA 2NO6A 2ORIA 3SC3A 1FW6A 4HYKA 4JWNA 1OF1A 2KE5A 1OHHA 3QENA 1HURA 1CJVC 5C1BA 4OQXA 3TRFA 4HUQB 4BE7B 4BLSA 3B82A 4KO8A 2ZI6A 2IHMA 1DAEA 1Q1QA 1XDBA 2ZRLA 4LSGA 3KKNA 4I99A 1IN5A 4B6FA 5KG7A 1NVWQ 3GIKA 1ZNXA 2A5YB 3LLUA 1KGDA 3TANA 3GLFE 1G8YA 4A0GA 4TMZA 3Q8MA 2I4IA 4R2IA 1L3UA 2M9NA 3JPPA 3GJ3A 2QPOA 3W34A 5KFMA 3RJFA 1FPMA 3PMNA 3KKQA 4FIDA 5TMPA 3CRVA 4HLCA 4J0QA 1ZM9A 4D0GA 3FFBA 3QPUA 4NLZA 3IO5A 4DQQA 3KL4A 4ERNA 2JZBA 3L8YA 3LK9A 3QF4B 1IM4A 1KI3A 4EDHA 3KFVA 2GDJA 3ZQJA 1V9PA 2QP3A 1KOFA 3TI0A 5G3YA 4TQUS 1C7YA 1MH1A 2HT1A 2OLKA 2DFLA 2HLDA 3KB1A 2KZMA 1NY6A 3PUVA 3OHBA 3LRPA 2J3EA 4I2FA 5FOTA 4IVPA 3VR3A 4DZZA 5EZ5A 8OHMA 2HHVA 4I81A 3MFHA 8ICFA 1ONBA 4Q8FA 3AUXA 4G0NA 4NDZA 1Q1EA 3LX8A 4ZO4A 1YQTA 2YWGA 3RB4A 3M8SA 5HHHA 1L2TA 2A3RA 3N2EA 1ZQUA 2UZIR 1Z0JA 3QBTA 4KFTA 2I9GA 3VR5A 2N42A 5KNCA 4V0NA 3QG5A 3EYZA 4DOCA 3OSPA 4A9AA 2ORWA 4BWYA 4PHTA 3I5XA 2GETA 4ILEA 5KDDA 2A78A 5FL7D 5FTKA 5DHFA 4KN4A 1TQ2A 1U49A 1N0VC 2V4RA 3KKPA 4L16A 5DDMA 1S1CA 1ZINA 2CHVA 2ZU0C 2AQ0A 4JVLA 2NO9A 2QSYA 2WIBA 3P1JA 1CF4A 3THWB 3QE9Y 2HHQA 1K6MA 3THYB 2HHWA 4BFTA 2WJHA 4V0KA 1IN6A 5FOUA 2ONJA 9ICLA 4UAWA 1UDWA 4JIMA 4BPBA 2ISPA 4BXOB 2HYIC 1OB5A 2CMKA 1NKSA 2A1JA 1LY1A 3FHOA 4IFEA 4UXHA 2NIPA 2FOLA 3MJRA 1E1QA 2GCPA 3CONA 2BMJA 2BCUA 2UKDA 1Q12A 1RYHA 1D5CA 2QQEA 4YMWA 3PO4A 4UNRA 4ARZA 1ZYUA 2G1KA 3KQNA 3MWLA 4AC9A 3TSOA 3RH4A 3V6JA 1TUEA 1GKUB 4KYUA 2VP4A 1CUKA 4K4IA 1I4TD 1XD8A 5L3QA 5KFLA 4ARZB 2MMGA 4EUNA 721PA 4NCHA 3LVRE 3ZIAD 4UB5A 2H5EA 2IUUA 4D2IA 5KFCA 1CR0A 1RYFA 9ICWA 2ASJA 1E2IA 2R6CA 4W7SA 3U7GA 2Q6TA 1E9BA 1E2KA 1YZKA 4Z8XA 2B21A 2WWHA 1KI7A 4GZMA 3PG5A 1RZ3A 4PPQA 2R8HA 5H8WA 3CX8A 3BFXA 5KTYA 5DLGA 1DPFA 2AFHE 2BV3A 1D2NA 3FTQA 1GILA 4KLNA 4HZIA 4KXFB 3ZVRA 2O8EA 9ICRA 3CF2A 4XVUA 3RAXA 4L15A 2FSHA 3KTQA 4TQRA 4Q01A 2GZDA 4F3OA 3CPHA 3QVUA 4I2JA 1ZQZA 3ISDA 4UQGA 2JLRA 4YVZA 1IHUA 1WCLA 4LUCA 2JLZA 3BQ2A 5IT5A 5DKWA 4UAYA 3VKWA 4KODA 4OHXA 1CP2A 2WSMA 3QI2A 2O0JA 4A0FA 4EQ6A 3MGCA 3IEUA 3PXGA 4RUAA 3LAWA 1NJFA 4LWZA 3AVXA 4RPXA 3MWJA 1EFHA 1PUIA 4IRCA 1CEZA 3T5JA 1SVOA 1AS2A 2DFKB 2ZETA 2YC2C 5J0RA 2CLCX 3L82B 1DGSA 3UPQA 1QHNA 4XVQA 5LPNA 4JLJA 3A1VA 3ZD9A 1U9IA 5GVSA 3T5KA 4EYHB 3RS2A 3I4LA 5JHGB 1T3NA 3Q8RB 1ESNA 1YU9A 5FBQB 2ZANA 9ICQA 3C4JA 1KDHA 1NOMA 4M53A 2J7PD 4HLQB 4TTPA 1CLUA 2GCOA 3QF4A 5CWRA 9ICSA 3KZ1E 3TQFA 2JZBB 3N97B 1BPYA 1VCNA 3LO5A 1TTTA 3K70B 4KSCA 1I2DA 3ND8A 4HAUA 4R64A 3Q7PA 1H8EA 4C0HA 1W4RA 5GJBA 2EWWA 5D3MA 2LWIA 5FOWA 4EPTA 8ICMA 2ATVA 1KFDA 1S0UA 4NL4H 2D4HA 4Q7MB 3AVOA 1BPEA 2E87A 3HYTA 4MRVA 2EFCB 1ETUA 8ICZA 4NM1A 3W8RA 2ZIAA 1YVDA 1R10A 3JPRA 1Q21A 2OILA 2W0MA 2J0QA 4JV0A 5KFUA 2WSSD 4HUQA 2VP5A 5TB5A 1RC8A 3MR2A 1Z00B 4F4XA 1P2VA 2VSFA 3MWYW 3JPNA 1R2QA 2IWRA 4DL3A 3P4YA 1E9AA 2R6GA 1SL2A 7ICMA 1LF0A 5J2HA 3W6PA 2G0TA 4XD7D 2YYZA 4AYTA 2CL7X 2RCNA 3TMKA 1U94A 2EWVA 2OBMA 1NKTA 3TLXA 2IA5A 3RBDA 3ZZ0A 2DWQA 1KI6B 4CF7A 3CNOA 4ESHA 2W83A 1KK3A 1II8B 4D25A 2P2LA 3EC2A 4MUBA 1JXOA 4LYAA 4QJ5A 5EP3A 4YMOA 1XMSA 3M9NB 1RRGA 3CPEA 3I61A 5KT6A 1FL9A 2DWPA 1G64A 1NVXQ 3OHAA 3IPYA 4MKHA 4TYYA 1Z3IX 4YONB 1KKMA 4G5RA 4PANA 3SJAA 5LBIA 4TWZA 1HQYE 2F9MA 5FBVB 5IRCD 2OHFA 1G8FA 3MFYA 3TW4A 1EK0A 1SVLA 3U60B 3Q8PB 1CULC 3T06B 1SL1A 2FLLA 4M47A 3U7FB 2ZSBA 4TYQA 1CJTC 4Y0AA 3W3ZB 4RJLA 5L1LA 2DPIA 4Q1DA 1IAQA 1J90A 2C9OA 9ICMA 1HE1C 4KJZA 5DG9A 2VA3A 4QZEA 1MQ3A 5KFVA 2HUPA 3BAFA 4S2EA 3QVVA 4Q9KA 1NMYA 2FNAA 2OCBA 4LPSA 5CIQA 4L8GA 4ZDKA 1VPLA 3FWYA 3LXXA 1HH4A 3C2KA 3PENA 3NBYC 5EE3A 2NRVA 8ICWA 1IY0A 4QZIA 1QVAA 5CK4A 1ZQBA 3ETLA 2A5DA 3D6TB 2XTMA 2AR7A 4FCWA 3N70A 2KTQA 3MWKA 5TVKA 2ZYUX 2ZJBA 3T5GA 1L3SA 4EAQA 3TUIC 1VCOA 2PFPA 4DSIA 1KSFX 3D3QA 4TL8A 3U61B 1ZIOA 3OIWA 1P72A 1W0JD 3IQWA 4B48A 1G3RA 1BGXT 3AVUA 2KBEA 3AF4A 3RRNA 3ASZA 2IS6A 1W2GA 1N6OA 1KDOA 1FX0A 1HA3A 1YE8A 1DBSA 2WIAA 3EZ2A 2Q0HA 4QGAA 2F1HA 2ZUBA 1ANKA 1KKLA 3EZFA 5HZHA 1T4GA 4OI0A 1Y3AA 3VHLB 1BMFA 1MABA 3LW7A 1XEXA 3ZZUA 2Q3FA 3TQ1A 5KFDA 1BMFD 2ZI5A 4XQ8A 1XCMA 4LJ7A 3T1TA 4QM7A 4EBDA 1P61B 2I3BA 4QGFA 3VQTA 1SVMA 4MYUA 1NN1A 2QE7A 3VX4A 5J0QA 1TK5A 2ZS7A 4JVMA 1QHIA 1ZM4A 3NH6A 2ZRDA 2FV8A 1E94E 4RY2A 1Z07A 5CJ2A 3B78A 2IW3A 3IDQA 1OH8A 1W0JA 4JLPA 4MKGA 1NBMA 2AN9A 4JLVA 4Q1AA 4R2HA 4PO9A 2AKYA 3B0YA 1NBMD 2IYXA 1CIPA 3A36A 2UZ3A 2W9AA 1E98A 4ZPXA 4HB4A 2Q3MA 2ZE6A 2IBKA 1CJUC 4WAUA 2VRWA 1ZUHA 5BYKA 3THYA 5FOSA 4JUZA 1L3VA 3SV3A 4PC2A 4Q4HA 4RFSB 4HYYA 4YMSA 3RRYA 4DWJA 4UB1A 2XCPA 4HZUA 1KLNA 1IY2A 1RRCA 1B22A 2XXAA 2QENA 4J9KA 4LV5B 1UPTA 5LDDC 1SHZA 4M1KA 2FH5B 4Q00A 4KMUA 2NZJA 3MSXA 1NLZA 4A92A 2JASA 2WWYA 3SZRA 5DBBA 1XPOA 3VU9B 4MKFA 3HPRA 4M2YA 2EW1A 2QN6A 1QSLA 3QKRA 4FMCF 2C28A 4KLFA 1WBBA 1ZQAA 3CX6A 5DQGA 2QGNA 5AJZA 4PQRA 3W6NA 4GOXA 2VP2A 4O3PA 2VLIA 2QRZA 2ZR9A 3KKOA 4EBCA 3K70C 1AZSC 4OHVA 1ZUNB 4UNPA 4Q18A 1NLFA 5EXSA 1Z0IA 1U8AA 4F91B 1FQKA 2KB0A 4Y0VA 4HDOB 5A0FA 3O8RA 1XJQA 5F3WB 3ZVLA 2V9PA 1TADA 3K0AB 2MSCB 4JZKA 4NTZA 2IL1A 4QGHA 4OJQA 4UKDA 3LBHA 5EP2A 1W4AA 4LC0A 2ZJOA 3GFTA 4IJMA 3WYFA 1KO7A 3C5HA 2W2TA 4NYIR 1GRRA 2DFNA 3RR8A 3OF5A 2V6JA 3NH9A 3K9LA 3C5GA 1LF5A 4IXNA 3LDAA 4Q66C 2OCAA 3HU3A 3IHWA 4HDCA 4DLVA 2FPKA 1CJKC 1XD2B 4R63A 2FZ4A 2BCJQ 4UAZA 4IXMA 1LB1B 4KLHA 4JS0A 4MH0R 3H0KA 1W36B 5B57C 1G5RA 3AKDA 2R6DA 1SGWA 2BDPA 3HU2A 3I5YA 1H65A 4B34A 1XWIA 2BC9A 3AF0A 5EXXA 1N48A 3GLGA 3Q8SB 3SV4A 1N6IA 3EIHA 3GD7A 4DQSA 2BPCA 5KT2A 4GMXA 4I2BA 2J7KA 5CDFA 4U7DA 3SN6A 4JWMA 3QXJA 4LI0A 3K53A 3KQLA 4LJ9A 2XSZD 3PUYA 3ZJYA 1JMSA 2HV8A 2XZPA 2ZRCA 1OXVA 3B1ZA 8ICJA 2F9LA 4P4SB 4US1R 1NSFA 4E5UA 3U3MA 2O52A 2OT3B 4HAVA 5DE3A 3PR1A 4NYIQ 5AUNB 4RZRA 2ASDA 2R8IA 4WXRA 4B35A 4PPXA 4DO9A 3MAAC 5IDVA 3S1AB 4I2IA 1SXJE 3C21A 2FSIA 2ZJZA 2QUZA 1S8FA 3ZDDA 2FPMA 2G77B 2WKRA 1OSNA 1IN8A 4IDPA 1HUZA 3OJUA 2J6SA 4HI0E 2AK3A 1EX6A 1G9XA 1LNZA 5E7IA 4JBWA 5TZVA 2PZFA 3GILA 4PC7A 2ANBA 3HWTA 1IXZA 3PUXA 4ELTA 1ZVQA 2ZRFA 4A0HA 3BB4A 4Q21A 1RYRA 2DCUA 3PMLA 1UBFA 1N0WA 4HB2A 4J9SA 1X8KA 2NO0A 3ZD7A 5D3QA 4GXKA 3U6BA 4QL3A 8ICGA 2WWGA 2GHIA 3IHQB 1P2SA 2WAXA 4URVR 5AUOB 4Q9HA 1FNNA 4F4WA 1L3TA 1DAIA 3AKYA 4GDFA 1Y63A 3CRMA 1NNEA 1E1RD 2Q9CA 1J2JA 1Z6YA 2KWIA 3P26A 4NCNA 3RR7A 4FD2A 5J2GA 3PR4A 3GLFA 7ICKA 4LBYA 3RSOA 4BWJA 1D8YA 5CA7A 1E9EA 1EX7A 4LCBA 5KFZA 1A7JA 1P2UA 1Q57A 2C78A 3W8NA 4ELVA 5IIMA 1B0UA 4HB0A 5KSOA 2D7DA 1UT8A 3BFVA 3IGFA 2VHQA 5DYGA 1RYSA 3DL0A 4YP3A 1VIYA 3QNUA 4B6EA 2XGPA 2NOAA 4TUSA 5EXTA 3QUSA 4GC7A 3KB2A 3B0XA 3E1SA 4G5SA 5JZVA 2GZHA 1CR4A 1P9WA 3JVVA 3QIAA 5BPCA 4JSTA 5EUMA 3THXB 2K5UA 2NTYC 3T61A 4AKIA 4B9UA 2XGJA 4B75A 3M4YA 3TARA 5B30A 4Z1MD 1OKKD 9ICKA 4B3DA 4QW9A 3K9NA 3BXZA 4C0KA 4AY2A 3Q8XB 4ZCIA 1OH5A 1TVAA 1NSTA 1G3UA 3B5JA 1SHKA 3ONWA 2FFQA 4LRWA 3OAAD 3A1TA 5KDLA 4B2IA 4C0LA 4KLMA 1XS9D 2JLQA 3G82C 4JV2A 5CYOA 2OWOA 3N2IA 1S0OA 1Z0KA 3SYKA 1NL3A 1G6OA 3RBEA 7ICVA 1QG2A 2BBSA 2IC5A 5DISB 5E7JA 5J2DA 2OXCA 3CWZA 3Q7QA 3UMFA 1JAHA 1OFHA 2QNRA 4U02A 5C4MA 2CHGA 3BORA 2PI4A 2YNMA 3AKCA 2IA6A 3QKTA 1HUQA 3FDIA 4BRUA 1ZIPA 1M7BA 2IYLD 3G6YA 4HAZA 4IQUA 3CNLA 4YG2A 5DGXA 4K46A 3BH0A 4DOBA 8ICNA 5GJWC 1QF9A 3NVAA 4FINA 1AA9A 3IILA 1ZQEA 2BCVA 3KXLA 2R8GA 1NK6A 4D82A 4O3MA 3KTAA 2I1VB 4I1UA 2OSBA 4DJTA 1F2UA 3M9MB 2UVRA 1ZCAA 7ICSA 2WMNB 4QGGA 4X8MA 4O9MA 1T8TA 1ZP6A 1E69A 4R71A 2JEIA 4UNSA 4RQ1A 4QG7A 4D26A 3IIJA 8ICCA 1WA5A 4J9RA 4O0IA 3TFRA 1LS1A 2WPDD 2ZSAA 3EC1A 1BPBA 4R8UA 1N0UA 4IHQA 1XBTA 3SYZA 2Z4SA 2BCRA 4LGMA 4OL0A 3H8JA 4QNRA 2NO1A 3BH6A 2ZQ5A 1GWNA 3GEHA 4J9OA 5JBQA 5D49A 3V4FA 3ICEA 4KSBA 5JJKA 2CL0X 9ICUA 3CO5A 1W36C 4Q02A 3B85A 1CS4C 1ZRHA 1XNJA 3T35A 1ZYQA 2QSZA 3AP2A 4CEIA 3R9XA 4DL7A 9ICVA 1KFTA 2WJIA 2KSQA 1W1WA 3O8DA 4V0LA 3AF2A 3M0EA 4JVSB 2H7VA 4M1YA 2D3WA 2JLVA 1PLJA 3SZ2A 4M1SA 1DAGA 4BFYA 4J9MA 4DOAA 1QTMA 7ICQA 5DG8A 1BO6A 1C1YA 1G7RA 2OEPA 4QRHA 5JSZA 1E96A 2O8DB 2FMPA 4BZPA 4ED7A 5IIOA 1JEDA 1GIAA 1YZLA 3GJ5A 5KFOA 4MFAA 4B74A 5HMMA 4DT1B 1WXQA 2IXGA 9ICFA 1TAGA 1A2KC 1L5UA 1XZQA 1SXJA 1A4RA 3RHFA 3VNUA 9ICEA 1Z6AA 3MR5A 4PH5A 1N5IA 1R5NA 4YMTA 2XNDA 1E1RA 2JLYA 1AIPA 4DB2A 2IMWP 2QAGB 4M0LA 3BC1A 3T5LA 4Q1CA 4V0MA 4WXPA 3UIEA 3VAAA 4D80A 4M9NA 1LFDB 1Z28A 3BIFA 5J4VA 3H4BA 4KVAA 3KQUA 1YRAA 3WP1B 3PX6A 1JAIA 2CEAA 3AKEA 3R7WA 2J0UB 5KOYA 2W9BB 2J46A 5E3HA 1CKEA 1WDTA 4NE2A 4I28A 2RGGA 3NDPA 4WW0A 2QMHA 4RKFA 2W2XA 1R0YA 1FQJA 3O8BA 3FHCB 4TYWA 4YMMA 2C77A 4ED8A 4Q48A 2J1LA 2BEJA 4RSGA 5HKKD 1RVDA 1E1QD 1E79D 2P65A 4ED6A 2BWJA 4O25A 2AL7A 4PHPA 1HV8A 1ZUIA 4MGYR 4YD1A 4P31A 5DLQC 1DG1G 1OIXA 4D4MA 2JGNA 4O3SA 1T3HA 4QHTA 4NCIA 3QBVA 2Q3HA 3K0FA 1DARA 4DLZA 4C0JA 2RGNA 4DEZA 1T9HA 3IIKA 4TT3D 4JLKA 3GLIA 4IVQA 4JMPA 1M34E 3WMGA 3AV0B 2W6JD 4M9QA 2OFXA 1M7GA 4FW9A 2V3CC 1N25A 3CB4A 5AUPB 1KTVA 1IN7A 1ZQDA 2H1LA 5HZKA 4IRDA 4ECQA 2DY1A 4QBIA 4C0SA 5J0YA 2WWFA 3GJ0A 4CT4B 2CL6X 1ZQYA 4DL4A 4PC6A 2DPXA 1HJPA 4TLCA 3NEYA 5AR1A 4M6WB 1QHHB 5CHGA 4O5CA 3E2IA 4DSFA 1NK4A 4GL2A 4FMBB 2J0UA 3J81k 1ZAKA 1G8GA 3EPLA 1P60A 4BASA 3PQCA 5JEDA 2FDCA 2BR0A 4RZ3A 4M9ZA 4YCXA 2REOA 4LX0A 4RD3A 3WNCA 4D0NA 3AP3A 3GEIA 1RPZA 4QXAA 3MABA 2ZJYA 4JJZA 4ZKEA 1S1MA 4OK3A 3AF1A 5E95A 4NLNA 3ZS8A 4PR0A 3I1FA 4F5PA 4LV8B 3ZZTA 5DHAA 1H8ED 4Q9JA 5DQHA 2JLSA 3HYRA 3ZGXA 4P4TA 1GKIA 4EYIB 1DAHA 1U0LA 1DAFA 2D06A 3C16C 4QZBA 4DLXA 4BDPA 2IHYA 4A2QA 4LJ5A 2R6AA 1NK5A 1RKBA 4PHHA 1U8ZA 2EYUA 2O5VA 2VA8A 1JBKA 3GJ8A 1S10A 4KLOA 4PO1A 1KTQA 1W44A 2JJ2A 5FR2A 4CVNA 3WYGA 5A4JA 3DO6A 4KU4A 4F93B 4IEEA 4P4PA 5DIFA 1TFRA 2BQUA 5KHOC 3CW2A 1NRJB 5DGBA 1MSWD 2GA8A 1ZETA 2R6FA 1K1SA 4LZGA 5L3SB 2YVUA 4DUGD 2O8FB 3FVQA 1X9MA 1QLNA 1YR9A 4HB3A 4M1WA 4DWIA 2XJ4A 2PMDA 2FA9A 3BE4A 4B9TA 3BJYA 8ICXA 1Z5ZA 9ICBA 9ICOA 3NBXX 5EP4A 5FUVA 5GJCA 3WBJA 5K8LA 3MRSA 3EPHA 2ZE8A 1RJ9B 1RE0A 5CJPA 1KFSA 4DSOA 2A30A 4PQFA 1G17A 1U45A 3CPJB 3FMOB 4DQIA 1KMHA 1Z0DA 2ATLA 5LD2C 3A4LA 4TLBA 2FFHA 3IO3A 8ICTA 521PA 1RRFA 5KPJA 2IUSA 3VKHA 5KFFA 5CB8A 4PQYA 4N3NA 4V03A 2P66A 4CW7A 4DC9A 4Z51A 1FMLA 3CRRA 1UEIA 3IPXA 2NO7A 3QXHA 4OJKA 4O3NA 2IWHA 1NVVQ 3VX3A 4A1FA 1TKDA 4TQAA 1SXJC 2BBWA 2C22A 2J59A 4TTRA 1YKSA 2XY6A 4KFUA 5J2JA 4A2PA 2YC4C 1UAAA 3RNLA 4MEYA 2VSOA 2GXAA 2ODNA 4II7A 4C2TA 4Q7KA 5KG6A 2NRTA 2B8TA 2GRJA 3SBDA 2YJTD 3QXCA 2JLWA 2BBTA 2C5LA 3HDTA 2PFQA 8ICLA 1TQ4A 4O3RA 3SI7A 4LJ6A 1XPRA 4RT3A 3DMDA 1G20E 2ZSDA 4UBCA 2A5GA 5TY0A 4KLIA 3B13B 4ZI3A 3F3YA 4BZQA 2ZRHA 4NXZA 2Y1JA 4I2AA 4CEHB 1NF3A 4IR1A 2GEVA 5HKKA 1A77A 2JATA 2YINC 3K0CC 2RGEA 1P2TA 2YOFA 3EARA 3GJ4A 2ZJ5A 1KAGA 3L2OB 4QNMA 4W5HA 2FLPA 2CJWB 1G3MA 1JB1A 3UXNA 4DCNA 1RIFA 4KITB 4A6PA 4IEIA 4IR9A 2X19A 3K8YA 5TARA 2XC9A 1RXWA 3CKLA 5FPYA 1QSSA 4LHYA 1TEXA 1YR7A 2HHXA 1NVVR 4WZ6A 4GPTA 2XAUA 1GNQA 2CBZA 2PEYA 3EASA 4HLUA 4TQSA 3PNCA 4BEBA 3EPGA 3EPKA 2FPLA 5CYPA 3TJZA 1M2OB 3A4MA 4CZ2A 4F38A 3RB3A 2J87A 2QORA 1XJ0A 3RJKA 4NLGA 1ZC4A 3OIVA 2RGCA 1P62B 4EJSA 4I2EA 2O8CA 4RQ7A 3QKSA 4PXAA 2R62A 3SEAA 1DEKA 2GTPA 4QZAA 5DG7A 4ECSA 1E0KA 3B1VA 2AHOA 1AGPA 1GTVA 4URYR 2JLUA 4RD2A 5IIKA 1PVOA 2BJWA 2QP9X 2VBCA 1JJVA 4TSFA 4OK5A 3TBKA 4YDHB 1ODFA 3PEYA 1OIWA 3SFZA 3LNCA 2GXSA 4LHZA 2ZVPX 5J5CA 4PZYA 1AZTA 3JZAA 5DBCA 4KLLA 4Q1EA 2DYKA 3UKDA 2CLDX 2ZRGA 1S3SA 2GJ9A 3QPWA 4GP7A 4C30A 3KHGA 1G16A 2J9RA 1NKEA 1XB2A 4P32A 4OI2A 4EFLA 1XJCA 1JQJC 4MRRA 1T8EA 4TL7A 3K0FB 2BCSA 2VA2A 1WMSA 4RD6A 5EE0A 5KT3A 3MGHA 1Q22A 2YOHA 4YMVA 2FG5A 9ICCA 1D2EA 1HT2E 2XNDD 4WIAA 4MF2A 4CDGA 4URUR 1XCGB 1WB9A 3QZ8A 5TV2A 2WJVA 1G8PA 4R9UC 1VECA 2XO7A 1P6XA 2C98A 5EZ6B 3T1VA 3H4MA 2Y1IA 1MO6A 4QZ9A 7ICUA 4TMXA 1Z2CA 3T34A 5J0UA 2DFTA 5KFTA 3AUYA 2H17A 4POAA 1K5DA 2FWRA 4X8HA 4YXMA 1RZTA 1G5TA 4Z6FA 1SVSA 1VG9B 1ZM7A 3B7GA 3PITA 3G6XA 3GQBA 4Q19A 4CGZA 2QM8A 3C23A 1KNXA 4GZLA 3R20A 2ZI4A 3VTKA 4P2HA 1ZMXA 1ZQOA 3FKSD 1KI4A 1U9IC 9ICPA 1D9XA 1X2IA 3Q72A 4EJSB 3KJEA 2WJGA 9ICJA 2REXB 4KBFA 3C14C 4Q9LA 1KHTA 3RB6A 3JPOA 3H2YA 2X8AA 7ICHA 2BEKA 1GOTA 3O47A 3B6EA 2MMCA 1L7VC 4AG6A 4PPGA 3X2SA 1A82A 1EESA 3TKLA 4BLRA 2ASEA 3PCRB 1BPZA 4GSYA 3K0CA 3U7EB 4TMTA 1S9HA 4JBXA 4CRWB 2FLNA 3BQ1A 4YR3A 1TF5A 2JJ1A 1OJLA 4LVSA 2OXRA 4IDHA 4FBTA 3PJRA 4DDUA 2O8DA 2FF7A 1E2DA 3B9QA 3ZQ6A 1Q44A 3OHMA 1P73A 4MF8A 3IM1A 2N1BA 5BW8A 3LXRA 4RQ3A 8ICOA 3HWSA 1ZQJA 3K09C 5KU1A 1ZQLA 5L3RA 4CEHA 3EZ5A 1Z47A 2RHMA 2W6IA 1SKRA 4NONA 4CEJA 2LKDA 2MSEB 4OQLA 1AROP 1AM4D 3GFPA 2FJUA 3IUYA 1T3SA 2PL3A 2GXQA 1N6KA 1OH7A 1DE0A 2KN7A 2E9SA 5KFGA 1GDDA 4DIDA 3KUDA 5L8VA 3PW4A 3LD9A 4P3YA 2XY5A 1XPUA 2QMEA 4JL6A 2GESA 2FMSA 1I2MA 1PUJA 2UVVA 4O3QA 4UB2A 3JPQA 1DADA 3QKRB 5DSZA 3UANA 1ZQVA 4QZDA 5J2IA 1U0HC 1V5WA 3C8UA 4JLDA 5FBWB 4DLTA 1LS6A 1CU1A 1F2UB 3RRGA 1XEWY 4B9LA 2EFHB 5AK0A 4LYJA 2BQ3A 1Q1ZA 5L9XA 1YJ5A 1KSJA 5FPSA 5HE8A 1GL7A 3AVQA 2IYTA 2FSGA 4B3BA 3O8CA 7ICGA 1W5SA 4B32A 4QWBA 3MR6A 1ELOA 3H8WA 2YV5A 3OEEA 4M9XA 1JEEA 1TQDA 2D62A 1ZQQA 4JLBA 4E0DA 4KLZA 5HTKA 4A8JA 4RFSA 3SU8A 4XD7A 1UT5A 4W9MC 1G8HA 4MYTA 4FMDF 2ZI9A 4RNMA 1JR3E 3ZD6A 2RDIA 1X8LA 2ODEA 2VO1A 3OFND 3V4RA 3SJZA 4FBUA 4N0DA 1XXHA 4A4DA 4UB4A 5BWMA 2W9MA 3K09A 1A76A 3NKVA 1UEJA 1SVIA 2IF2A 2GVZC 2UVQA 4QOSA 4DLYA 4FCTA 1ZC3A 1BPXA 5CR0A 3NIBA 5BQ5A 1H8HD 9ICIA 2F43B 1J8MF 3HW8A 4R66A 2OLJA 3C5FA 2A5FA 1UBGA 3EG5A 3EZ6A 2PT5A 4KFSA 4RD4A 1ZQGA 1YZGA 4RKEA 4A82A 4P4UA 4NH0A 4A8JB 3RYTC 3U5ZB 3N4MB 1LTQA 4FS1A 1ZQIA 3ASYA 3GLHA 1ZQHA 4RQ0A 4KYIB 3RJGA 3BD9A 4S35A 3U2QA 5KO2A 1U98A 1KI8A 5KG2A 2ANCA 4YQFA 5JS7A 4FXPA 2IYUA 4QHSA 1ZD8A 2QP4A 4KLJA 4HAYA 5AJYA 5HCNA 2WAYA 4M9LA 5J2EA 3RH5A 1BH2A 4Q4JA 4M9SA 2QMUA 1FX0B 2G88A 4YQWA 5KT7A 8ICKA 1I4DD 3NHAA 4V0ME 2GAOA 2VP9A 2CK3D 3LH5A 1FOEB 2J45A 4QJ4A 5DN6A 5EJEA 4M04A 2HCJB 3PW5A 2Y8EA 4GXJA 2FZLA 5HMLA 3BBPA 4BLTA 2G6BA 3SQXA 1KIMA 3BB3A 2O8BB 2YWHA 4DFKA 2ZREA 5GADl 1HQCA 2HW3A 1E79A 2QRNA 1OXXK 4G5OA 5J4LA 3FYHA 2QTFA 5JI2E 3WP0A 4Z6DA 1G291 4B33A 1G18A 5DI3B 3QJYA 3NTUA 2G3YA 1NJGA 2YWFA 5EWEA 1C4OA 4YD2A 4GFDA 3AP1A 3LFUA 3T15A 4MRSA 2D74A 1Z08A 5TXGA 4EPXA 3HT3A 1KAOA 5SZKB 4DEYA 3H84A 2JJ1D 1TQ6A 3REGA 1E2FA 4JSYA 1IXRA 4DLRA 4URZR 3ADCA 1NG1A 2CE7A 2GJSA 4QWCA 3PY8A 2D7CA 5JRJA 1ZNZA 2KZZA 4FWIB 4LHWA 4NPHA 2XEXA 3L0PA 3K0SA 1OKKA 3BQ0A 1NJXA 1US8A 4G5QA 8ICHA 4ZV4A 2RHDA 5LD2B 1SKQA 1G7TA 1XZPA 2IEYA 3NEJA 5DH9A 3S1AA 2XZOA 1NK7A 4TL9A 3FHTA 1IM2A 3ZYCA 1NIJA 2RH5A 1E9DA 3RANA 4C0BA 5DI9A 3R8FA 1SXJD 1P5ZB 3LA6A 1QSYA 1OXUA 2RDJA 4C8KA 8ICQA 4JYBA 3GP8A 1XTRA 3LQRA 4G3XA 2ONKA 2ZE5A 4BFUA 4C4PA 3QEJA 2W9BA 1HTWA 2HT6A 4C9BA 2WTUA 3K9HA 4I1SA 2W9CB 2W9CA 5FPTA 4DQRA 3R7WB 1II8A 3RS7A 4MA4A 1DG3A 1EXMA 1JNYA 1KI6A 2HF8A 3TSWA 4F5NA 1XX6A 2FX3A 1COOA 4RQ5A 1TX4B 5KFXA 5JFGA 5JS8A 2ZRPA 1KRPA 1N5LA 1SZPA 1XCPA 2OV2A 4PTLA 4XJXA 3ZS9A 4LYHA 4DL2A 5IK2D 5JWRA 3MGIA 3W5IA 2QPAA 3ZH9B 4YFKA 1KI9A 5FL3A 1O87A 1L8QA 1X86B 2AWOA 4Q7LA 4C3ZA 1KJWA 3UMRA 2X1VA 4G1UC 5KSYA 3UATA 4TYPA 4IDNA 1US8B 4JVNA 2RKOA 4F5QA 2ZJ2A 3I62A 5F98A 4DLGA 2JEJA 4AI6A 1WCV1 4DIEA 4DT1A 2GILA 2IYZA 5J0XA 1G7CA 3AU2A 1ZU5A 4CEIB 2MAXA 5KFPA 3DZ8A 1R5BA 3I8XA 3OEHD 1D6JA 4HDQB 2IHNA 1S0NA 1SKYE 2J41A 2RAPA 5DQIA 4IOLA 1FUKA 4Z54A 5BN5A 2IEZA 1JIHA 4IDQA 4KFRA 2QG6A 2BMDA 2YOGA 3GFKB 1W4BA 4LPKA 5KFSA 5JWHA 1NLYA 4I2DA 3MD0A 2CCJA 5G3ZA 3FKQA 3KFXA 5M04A 3TR0A 1HE8B 1S9FA 1S76D 1DO0A 3VFDA 2ERXA 1Q0UA 1BKDR 4TMVA 1KO1A 3AQ4A 4UNNA 2W8LA 3KJHA 4B47A 4M9JA 5HE9A 2NPFA 2O8BA 1UA1A 2AD5A 3SDZA 4JKIA 4LC1A 3U3RA 4XRHA 4GLXA 4PGQA 2VP0A 3K4GA 2X77A 1AN0A 3I8SA 4DB4A 1E2JA 4KCGA 5L1KA 1QHGA 1KI1A 4LY6A 1TAUA 3VU9A 4IRUB 3SJBA 3AGPA 5CK5A 3OE7A 3Q3JB 4I1OA 3V00A 2CNWD 4PHFA 3X1YA 4QBGB 7ICFA 1NP6A 1OXSC 2QTHA 1UM8A 2JA1A 3JZMA 4B3FX 1E0SA 5EWFA 2F1JA 9ICNA 2OFWA 2ZTSA 2OBLA 2ZRJA 3QE0A 2CJWA 1U2RA 1E99A 1KO4A 3K0EA 3TFSA 1P75A 2R44A 1B23P 3A1UA 4NBSA 4BZXA 1U9LA 2GAAA 1HUOA 4JJKA 5H70A 1IXRC 2F43A 1MO3A 3GPLA 5LB4A 2ZRKA 1R0ZA 2G9NA 1G41A 1TMKA 2C9YA 4NZYA 7ICNA 2AWNA 2RGDA 1LW7A 1N5KA 2C2RA 2L0XA 1U48A 2EFDB 2H16A 3HR8A 5KG3A 3BQTA 4DL6A 1ZQNA 1F3OA 2XNSA 1DO2A 8ICPA 1G5PA 4NCKA 5J2KA 2V54A 1Z6TA 2GCNA 3EAQA 4DCVA 5KFAA 2OFOA 4TQ9A 2BQRA 2HF9A 3THXA 1ZD1A 1OV4A 3VR4A 4LJAA 4D6PA 1EFRA 2ZRIA 4ED1A 3IBGA 4YN4A 1EG7A 3PVXA 2XOKA 2AJQA 2QL6A 3ADDA 2FU5C 4UXJA 4AYXA 2HEIA 2WJJA 3C2MA 2BPFA 4TMWA 2IS2A 2ZUDA 3RAQA 2HXYA 1KMHB 2R9VA 3KXKA 1ZQFA 3LW8A 4B43A 3GMTA 4F92B 3RJEA 4TLDA 2ZSEA 1RJ9A 3FDSA 2ZPTX 3IBYA 3GLFB 4DSKA 1N56A 4OQMA 4AKHA 3NXSA 3HR7A 4V0OA 2ZXUA 2GVDC 4IFBA 3ORYA 3TW8B 4M6WA 3MBYA 1QHHA 4E09A 3TSZA 2O8FA 1CRPA 3Q5DA 1X9WA 1JI0A 2V9WA 1ZM3A 4JT2A 3UMSA 3VR6A 5L3SA 2V4QA 3FGNA 3X1WA 4N0EA 3VHXA 1XF9A 4EZ6A 4I2CA 5IF9A 3C2LA 2BM0A 3EXAA 1FTNA 1G19A 4H1VA 4DLWA 9ICTA 1DOQA 2DPJA 5J29A 1XTJA 2F6RA 2GF0A 3P20A 3UG7A 4AKGA 4M9GA 1IQPA 1W4CA 4DDTA 4Z6CA 4DLEA 1KDTA 3MJHA 4M2LA 4B76A 5K8IA 1XEWX 1AK2A 3AEZA 3RDPA 1ZQWA 3HJNA 1S2MA 1NK8A 2PFNA 5C2JB 4W5JA 1NBME 2ZE7A 1IY1A 4LJ8A 5KFEA 3ISBA 3SFVA 2B6HA 1XMVA 4XIGS 7ICRA 4DSLA 2P0EA 4R65A 2Q9AA 3FKSA 4K4HA 3QOFA 1WRBA 3AGQA 1S0VA 2D2FA 3OIUA 4O2LA 4ZDJA 2PLFA 3ICQB 2BOVA 821PA 2A2ZA 5JECA 1T8UA 1O3YA 2VHCA 2VHTA 2FEMA 1TPZA 5AWFC 1VIAA 3U3OA 3TR5A 9ICAA 1GAJA 1K8RA 4PHAA 1W48A 2ZYTX 4JV1A 3GLGE 4Q44A 4ASUA 2PBRA 3RJJA 5JMTA 2GWSA 1WE2A 2ALZA 1T6NA 4RU9A 1TU3A 2OM2A 2QAGA 1GZSA 4GT1A 2J7PA 3DOEA 4DHEA 2OUKA 1FP7A 9ICXA 1Q1BA 2OCYC 1U4BA 1Z0FA 1ZM2A 4MKIA 5JEEA 4DF8A 2KFZA 4ECUA 2QPTA 1NMXA 2IK8A 2O0HA 4JT4A 4IOKA 1T91A 4WZBE 3SBEA 2C2DA 1XSNA 1GITA 1D2MA 1FNMA 2C04A 1JN3A 4OBEA 3T1OA 3W9YA 1DAMA 3SJCA 1SXJB 3A1WA 1Z6GA 4JKYA 3PW0A 2BBOA 2D2EA 2JIZD 3WHKA 3QZ7A 4LZDA 1KY3A 1KK1A 3TUZC 1VHLA 4QWAA 4ACAA 3QQ5A 3FFAA 5JSZB 1JR3A 4FMDB 1ZJMA 1W49A 2WICA 3C7KA 1BIFA 1MOZA 3CR7A 4ACBA 1E9CA 4HLUC 4ECVA 7ICOA 8ICSA 4BECA 1X6VA 4XWOA 4MFCA 3A4NA 4RQ8A 2IYWA 1LVGA 5KT5A 3QPVA 2ERYA 3DZDA 3Q85A 4W5WA 5DI3A 3E2EA 2GCOB 4FN5A 2ODBA 2AXPA 4IVRA 8ICIA 3Q5EA 4I2GA 4RPYA 1JX4A 3GIMA 3GJXC 1Q3HA 1GVNB 3V6KA 1KZ7B 2WWWA 3EZ7A 1E3MA 2QT1A 4BLOA 3KJIA 4O2RA 1KY2A 7ICLA 2ZEJA 5FBLB 4ECWA 2MUTB 1R5OA 4BFVA 4ITRC 2C96A 2IT1A 3UWOA 3WNBA 1XTSA 4J9QA 1F6BA 1LB2B 1G3QA 5J0SA 1MV5A 1N3BA 2P3SA 3GJ6A 3T12A 1IN4A 2AFIE 2WPDA 4F5OA 4QFMA 3CBQA 3KHRA 7ICJA 1R8SA 2HHSA 1U8YA 1E9SA 2PT7A 1JXLA 3DKPA 1OB2A 1WCNA 3MMPA 1EWRA 2AKAB 5DB8A 1VYVA 4E22A 4F4KA 4BUJA 1VG8A 1JALA 4XOIA 2QE7D 5HCIA 2XXAB 2PX0A 3A37A 4HZUB 2XTNA 3GLHB 4KLUA 1MRNA 2ZI7A 2GEDA 3TUJC 1W7AA 3N5CA 4N1AA 4Q4HB 3RS3A 1Z63A 4M0AA 2OG2A 4F4JA 3T3FA 3BERA 5D46A 5IIJA 2DHRA 1MT0A 1TK0A 1KO8A 3AVYA 4G3IA 4I1VA 2CXXA 5KFJA 4OK6A 2CK3A 3KQKA 1ZQKA 2V1XA 3CRQA 4XTCS 5J47A 3BH7A 1XXHB 5G40A 1DS6A 4CYMA 5FH9A 1XTQA 1UDXA 3DDCA 2PXIA 1OLOA 4KV9A 5L3QB 1C9KA 3OAAA 2V1UA 1SL0A 121PA 2GJAA 3SYNA 1OPXA 2V7QD 4R8UB 5EWGA 4XWKA 3H4DA 1T7PA 4DSTA 4IKEA 5CM8B 3GEEA 1G6HA 4Q03A 5FTMA 4NY8A 3FOZA 1XEXB 2KBFA 4RQ4A 4G5GA 5J40A 1XRJA 5C4GB 3AVVA 2F7SA 5JWOA 5JI3E 3NBZC 2Z0MA 5J0WA 2ZI3A 3KTAB 5FTJA 2GBLA 5JLJA 3U6KA 1E2GA 1U47A 1Z6XA 4ECXA 2HHTA 3CH4B 2PX3A 5KG4A 8ICUA 5J0TA 1S9DA 3KX2A 1WF3A 3QXSA 5EUQB 8ICAA 4MRNA 4ZI2A 5DN6D 1ZNWA 3FMPB 3UQ0A 3FB4A 3ZD8A 4OKSA 3DKVA 3V6HA 4Q4AB 4B44A 3MDAA 1KDRA 2ZR0A 2FE4A 4JBYA 2XOKD 4ECRA 4NKRA 5ANRB 2EQBA 5FBRB 4ZDWA 4B2PA 4D0LB 4YDSA 4O0MA 4EKDA 1COWD 3ADKA 1XFAA 4DLSA 3NC1C 4NYJR 3SOPA 1EFTA 4Q43A 2VPPA 2J6UA 4AG5A 4UJ5A 1IJFA 3WXMA 2N46A 1D9FA 1CJMA 3R8CA 4MITA 4OHYA 2VIIA 3I73A 4F4ZA 2F1IA 1JXEA 3HX0A 3L0OA 3BJIC 4IOMA 5F9LA 2QY9A 2NGRA 3H86A 1QHYA 2BJVA 2VTKA 4EPYA 2HYDA 2BMFA 4TUPA 1TAQA 4GP6A 2PJZA 4OYHA 4TTQA 2EVWX 4HSEA 2F3RA 1JPJA 4F2RA 2BIFA 4C8LA 4Q4LA 3ZVNA 4C8NA 4F4IA 3B2EA 2B92A 2XB4A 3VNVA 1B43A 3SI8A 3AUOA 3FPAA 2V4ZA 3IIMA 1ZQCA 1JXMA 4RPZA 5CJ7A 5F9NA 1VHTA 2IX3A 3UG6A 1JR6A 1VYUA 1M7HA 1OFIA 3FE2A 3PUWA 3G6VA 4LK2A 3TGPA 3BS4A 8ICBA 4JLNA 1N5JA 2Z5FA 5EP1A 1NIPA 2PFOA 2B7BA 2OCPA 4M8NE 2VSXA 2HVHA 2OAQ1 2JAQA 1E2NA 1U90A 1E2QA 4NYJQ 5CITA 3EWAA 1G21E 2JJ8A 3TVDA 4Q45A 3W5JA 1A1VA 1GM5A 1R6BX 4MYHA 1GKYA 3ZDEA 4I27A 4NMMA 5FI0B 3RC3A 3MFIA 3BB1A 3H1TA 4NU0A 2VHUA 4KVGA 4UQOA 4CIDA 1EWQA 4LZZA 5CIWA 1KNQA 3T1QA 3X1DA 4XSHA 3RJHA 1YZQA 5KPDA 1AJEA 1ZU4A 2X2FA 2P5TB 4D4JA 2QQ0A 4O3OA 3F0TA 2LCFA 3RTVA 1FUUA 3SR0A 2V6IA 4UJ3A 5F9HA 2QA5A 4DCUA 3GLIB 2BDTA 1SULA 2JCSA 5EE5B 2W58A 2JEOA 2ZR7A 2IXEA 4RFVA 5J4HA 2BMEA 4XVRA 5BXQC 5L1IA 5JRZA 2YWEA 5KG0A 4ECTA 1XEFA 3DM5A 4KTQA 3EW9A 3REFA 4GOKA 2PEZA 8ICRA 4DS4A 1N6HA 621PA 3RRHA 4FS2A 4Q1BA 2IHBA 4BGDA 2W8KA 2VQSA 3K0AA 5KFBA 1TF2A 3R9WA 5J2CA 4F7WA 3TIFA 2CVFA 5FI1B 4B9VA 1CBUA 3HP1A 1IOZA 1GL6A 4AIIA 3RH6A 1I4LD 4HUTA 4PC3A 4A2WA 2X2EA 5D4BA 5KFNA 4B71A 4EFMA 1UFQA 4DSEA 4ECYA 1F60A 2C2HA 4JLMA 4WZAE 3R9IA 5KG1A 2HDNB 5E7MA 2UVUA 4DF4A 4YMUA 2ZJ8A 2XX3A 3ND9A 5DBAA 2VF7A 3Q9LA 3LWMA 1J8YF 3KDSE 1ZJNA 4Q4JB 1RFLA 1T5LA 1Z29A 4JK1A 2FMQA 5G53C 3CIOA 2FFBA 3QG1A 3QKUA 3H7IA 4NP6A 1P9RA 2O0KA 4Q1FA 5IIIA 2WVJA 4PZZA 1XU4A 1V43A 4URXR 3KJGA 3Q8QB 4M22A 1ZQSA 5KSPA 3V7LA 2BCQA 4QZFA 2RGNC 5DB6A 4TURA 4F8RA 3VKGA 1DAKA 1ZQTA 4IOJA 1P4SA 2JEGA 3P4XA 4ED3A 3LBNA 2F55A 1GNPA 5F9FA 4GXIA 4M9HA 2C03A 4FCVA 4UBBA 4LJYA 1NG9A 1Z3EB 1F48A 1R0WA 1NN5A 2CHQA 2IYYA 3GFOA 4PSVA 4H9GA 2KFNA 4OQNA 2WWXA 2H18A 2WV9A 7ICEA 1QDEA 3GIJA 4ED2A 2QI9C 5IK2A 3A6PC 2Z6VA 3OIYA 3M9OB 2ORVA 5BOLA 1E32A 4EBEA 2KI5A 2GKSA 4TLAA 5EE9A 1SKSA 1II0A 3L43A 4QM6A 3I32A 3ZDBA 5J4KA 1NJZA 2Q9BA 1OFUX 4BFWA 1E4YA 1E0AA 3GCGA 4D81A 4YC7A 2PJRA 1MABB 1CEEA 1G3IA 2WWIA 3DHWC 2CCGA 1NJWA 2XY7A 1R0XA 2H8KA 3PV0A 3BRWD 3KHLA 4Q9IA 5FTLA 4DS5A 4NYMR 5KFIA 4HAWA 1UADA 1W0KD 3TE6A 2ZRNA 2XCAA 4DLUA 2XJ9A 4LDJA 5TDHA 3THWA 1DOAA 3EA0A 3WMEA 4KLQA 1YZNA 4RQ2A 4ZCMA 2BM1A 3I3SR 3OGUA 1EXNA 2IS1A 3U7HB 2TMKA 2QBYA 2JDID 4QWEA 5AJWA 5B2ZA 3OEHA 2LKCA 2CNWA 1S96A 2XSZA 2FSFA 3B8HA 3GV8B 3RRMA 3PVSA 4AKEA 5J2AA 3WNDA 1AS0A 4XWAA 4M1MA 2CVHA 4Z8YA 3GLIE 5FL7A 2IYRA 1SVKA 4B2LA 1KZGB 1NMZA 1OFTA 1E2LA 3RWMB 4EJSC 2QMOA 5FPHA 3UK6A 3UXMA 2OBNA 4CEJB 1G1MA 3CR8A 2C99A 4Z1MA 2LYHA 3QEOA 4IQTA 1ZW6A 2CCKA 5KG5A 1MQ2A 4DL5A 1XWLA 5JCZA 4PPNA 3B9PA 2FGKA 2ZS8A 5FOXA 1XTKA 5KFHA 1Q3TA 1TV9A 1N2CE 5KFYA 1OHHD 1QZXA 2HHUA 1PLLA 3TQCA 1BYIA 4MUAA 3RC8A 3K70D 5HP4A 1N6LA 1QHSA 4NYMQ 3MDCA 3ZDAA 3KHHA 1L4YA 3OZXA 5F2EA 1U0JA 1W47A 2NQ2C 421PA 4XTRA 4D4LA 4P0TA 1Y88A 3RJIA 5HNKA 4RT2A 1AGRA 5AJXA 2WBLC 3EIQA 2FEOA 4KI0A 4H1UA 1AKYA 2G0NA 3L8ZA 1EFRD 1IONA 1SQ5A 4PX9A 4PSAA 8ICEA 3M8RA 4IQWA 1J7KA 4G01B 2AGPA 4QHYA 5P21A 1ZQPA 3U3KA 5CM9C 1MR3F 2HJVA 3B60A 4RZXA 2AD1A 2GJKA 3SYLA 4AD8A 1W46A 3WY9A 1OYWA 1VTKA 3ZLJA 3H40A 1YHNA 3LVQE 1ZQRA 2ZRAA 3HPQA 3VR1A 2BHNA 1COWA 3NBFA 2WHXA 3PUZA 2XB2A 2BGWA 4B3XA 2IYVA 4KAXA 3SE0A 2XGQA 1NY5A 1T3LA 1X1SA 4GOJA 4GRAA 4US0R 4A8JC 1KJYA 3RRZA 4CT5A 1VKJA 1KEJA 1AQYA 1NK9A 2FFAA 3I72A 2V8OA 2C8VA 2GEUA 1R8QA 4OI4A 5LB2A 3EPIA 5C46F 3EX7C 2J0VA 1VMAA 2V55B 4TZ0A 1MKYA 4LOAA 3MUFA 3OFNA 5KNBA 4DSUA 2R65A 3CM0A 8ICYA 2QEQA 1CXZA 1JR3D 2REBA 4Q7JB 1UBCA 4ZKDA 4MDFA 1OXTA 4Q5IA 4EIWA 4I2HA 1IXSB 1FFHA 4YLGA 4DSJA 3K1JA 2ZITA 5AJVB 2IBMA 2DWOA 4F5RA 1MRSA 3EPJA 3U4QA 1XMJA 3LBIA 5DO9A 1YR8A 3G5UA 4K81B 2ISOA 3X1ZA 4DKXA 4A15A 3AU6A 1KJZA 3M1IA 1ZD9A 3E5HA 4XSGA 2F3TA 1H38A 1JQLB 2V7QA 3UXOA 3OSNA 4TUQA 3PW2A 3NC0C 1X8JA 5L1JA 1JPNA 4RCYA 3ZVMA 2GK6A 2QGZA 4DRZA 1P7CA 2QTVB 2NRWA 9ICHA 4MQBA 5HR5A 1E6CA 1ZQMA 3C15C 2NRXA 5KFKA 1F2TB 3QKSB 2HJGA 1HY3A 2ZS9A 5AUQA 3MCAA 3QY0A 1HYQA 2QZ4A 3D8BA 2O8CB 1KYIA 4LHXA 4PZLA 4WBSA 2NPIA 4C8MA 1DVRA 1ZNYA 4TN1A 1W0KA 4M4SA 4TL6A 4ZDIA 1Z00A 1ZCBA 1VYTA 1S77D 1TEVA 3IQXA 2CLSA 1GRNA 1XSPA 1PZNA 4PGYA 3H8SA 5DB9A 4FO6A 1S0MA 1KK0A 4PHDA 4QBFA 1Z83A 3NGDA 1XD2A 4LBVA 5H68A 1CTQA 2BVNA 1XC9A 1T0HB 2YZ2A 3WRXC 1G7SA 2WJYA 4TMKA 2ZJAA 5D3MB 3AM1A 2IF0A 5JJLA 5BOMA 4P4OA 1YZUA 1G4AE 3LWNA 2Z4RA 3PFIA 3PIRA 4GI7A 4B9MA 4LBZA 4X8LA 3GLHE 1E2HA 2PZGA 4RCZA 1AKEA 1K5GA 3V7KA 2BCGY 2AGOA 4EPWA 1N6PA 2W0SA 4XUSA 2W6JA 3CWQA 1E0JA 4QW8A 1QG4A 4WA7A 2ZAOA 2MSDB 4TT3A 1QRAA 1TUIA 4Z6EA 3DVLA 2VF8A 4A6XA 3CUEF 1X1RA 2PCLA 2QM7A 4FI3C 3W3AA 3MLEA 1UA0A 4KLDA 4D4KA 4YXWD 2W2VA 5DLFA 2ZRBA 3PX0A 4PHGA 1A2BA 5J0PA 4J9LA 4QBHA 4JYCA 2A7QA 3TNFA 2HVIA 2Q0ZX 3JPSA 3D7MA 3PEWA 1PV4A 2IS4A 3V7JA 1RRPA 4PC1A 1SVWA 4RNOA 2A1JB 4EQ6B 5G41A 1EFUA 4BXOA 2Q21A 3HU1A 4JLAA 3RWOA 4MRPA 4DDVA 1WBDA 4KBGA 4BLQA 3CF0A 4DUGA 3C1ZA 5J0OA 1OIVA 2WMOB 4P4MA 2JIZA 4A0RA 3C5CA 1AS3A 4RD1A 3QXXA 4ZIRB 5JHHB 1W5TA 4BLPA 3F5FA 5C18A 2A9KA 3PEUA 5H1YA 3DEFA 3EIEA 2EFGA 5SZHB 5EQTA 4M1OA 4EPRA 3RB0A 4BRWA 4UB3A 5B64A 4ZIRA 1KSHA 1N6NA 1VG1A 3BOSA 1XD9A 3BGWA 3U3JA 1HT1E 1UKVY 3IHLA 4IDOA 1AQUA 5KFRA 1OT3A 1J70A 2XITA 1D9ZA 2H92A 3TAPA 4ABYA 1CR1A 3FMIA 4BEJA 5EXPA 2J5XA 2PI5A 2JDIA 3UPUA 1XXHE 4NM2A 2ZROA 2G1JA 3LX5A 1GRQA 4TSFD 1MO4A 4US2R 4O5EA 3LQQA 4DQPA 4J9PA 2C9CA 4DXAA 3CH5A 3RS5A 4KLGA 2YKGA 1YZTA 4YR2A 3HP6A 4F2SA 2BKUA 2KZ3A 1FZQA 2E1RA 1JECA 3QF7A 2WOOA
chains in the Genus database with same CATH superfamily
5IDWA 1QCZA 2Z43A 2J6TA 2HLDD 1X9SA 2IDJA 5BYJA 1HQKA 2XMCA 4DNFA 5SZIA 3SS7X 1ZEJA 2EZYA 2C5EA 1NNUA 2Y66A 3V8MA 4KQ2A 4L3VA 3CB2A 4O5KA 3VJLA 2JIMA 4EAAA 2P6NA 2JBAA 4R98A 4ZTZB 1TLLA 4DE5A 4PFSA 4KLTA 1XZLA 5K3CA 2XTJA 3QVOA 3CLSC 2ZAMA 2IBTA 2UZ0A 3L18A 4NLCA 1II9A 1TNDA 1ZG3A 4XIFA 1T36B 3OU7A 1VL5A 3AKZA 4LQCA 6NULA 4J1TA 2I3AA 5KFQA 4L9SA 1V16B 2RGAA 2P68A 1RAFA 1U2PA 2XTZA 4PGXA 2RH4A 3OJSA 4UMFA 2CLHB 1NFQA 4URVR 3EEBA 3LP5A 1N6RA 1OJ7A 2BR5A 5AOAA 3ZDCA 5J2TF 4B3HA 6Q21A 1CUBA 4RV9A 3NIGB 2JEFA 1OC2A 1UBEA 3EC7A 4BL5A 3PEVA 3CLSD 4MCAA 4ZT4A 4BFZA 5C3MA 5EE1A 2QVZX 2HXSA 2IXFA 4JLWA 4PHEA 4MSUA 1Z2AA 3QQPA 4NK5A 4ZI5A 2KVCA 3HGTA 4CLEA 2QAGC 5BN3A 4DV0B 2YVLA 4WFJA 1QM5A 1F2TA 5B58C 5KS2A 1H05A 4DVGA 1QTQA 1U2GA 5JNUA 3ES9A 5A62A 5TEVA 5K45A 5CLQA 5A5GA 1X3SA 2M9MA 3HMKA 3GFRA 4J16C 1MJNA 4P33A 3R0QA 2OB1A 4PFKA 4RVGA 4TTTS 4URFA 3B48A 2BTOA 1IATA 4W99A 4WY5A 5HIJA 1GSIA 5BNWA 4F4CA 1OH6A 3CX7A 4TLEA 3DONA 1E0AA 1XDZA 3RROA 1E6UA 2KE7A 2J5RA 3HY6A 5AI9A 3C1AA 3CEPB 1NF2A 3ER9A 3C6MA 3VC1A 1SUDA 3DE3X 1Z12A 4FEGA 3PC3A 4V1CB 1NXPA 2ZVQX 4NEGA 4P4SA 4RY9A 4GQBA 3TMAA 1LDMA 4H3VA 5BPFA 5ALQA 5KSZA 1M34B 2FPGA 2PIAA 4DJ5X 2BKEA 4UBMA 4AWXA 1RW4A 1XSLA 4BVHA 2FDXA 1G2IA 3BZBA 3M5DA 2GWHA 1X7DA 5KBYA 3W2EA 3F71A 2BGLA 4XI9A 2OORA 2OMKA 1LV5A 2XMDA 3BVPA 3GRUA 4PWYA 4L9AA 4W1QA 3GLGB 1YFLA 1F8YA 3SHOA 4ML3A 3SJUA 4JFRA 2F64A 5KI6A 3BSYA 5JUMA 4AJNA 2I9PA 2KKVA 4MR9A 1NYQA 3TRDA 5HJ7A 1ECLA 5A02A 5A4IS 1E2MA 3IDFA 4V3BA 4YQZA 3FYUA 4YAWA 1ES9A 2GNOA 3KXDA 4ZODA 2P5SA 2DQZA 3WBKA 1EHYA 4E31A 3IEVA 1B73A 2RGBA 2FMXA 3SIPA 3VYTB 2R8JA 1E2EA 1Z82A 2YJZA 2VUHB 3QEBZ 4BJ3A 4C7ZA 1VQ1A 2X0JA 4DMGA 1M8JA 4IDCA 4LJ4A 2G9VA 4V02A 4QJ3A 3EG9B 4P6VF 1EGHA 4BQSA 4WVFA 1YR6A 3OZBA 1KQ3A 2C5SA 1U81A 5J9FA 5CB0A 1RQGA 1P4AA 3DFUA 4NR0A 4AK9A 1UDRA 2V6FA 1UKZA 1E2PA 4HNGA 4RHYA 2F3UA 1T0JB 5DBFA 4EZ9A 1E3LA 1PEYA 2X1HA 5ULLA 1RXVA 1QX3A 4NHOA 1Z8FA 1D8AA 4PPFA 1RADA 4TLLB 1M2KA 1P9NA 1DWQA 2NZ8A 4EO4A 1C8VB 3QWFA 3BK7A 3R5KA 2I6TA 4AXXA 1EK5A 3AH8A 2ZBFA 3NORA 4UCFA 4H7IA 5FFMA 4XH9B 1ZVKA 1ZQXA 3KPYA 2VANA 3CFYA 4H3KB 4WZZA 4BVBA 2OB2A 3GMIA 5AVJA 5JSYA 3E0FA 1R9JA 5BOSA 3C1TA 4HC4A 4RZIA 5CNIA 3T5HA 2BH2A 2CUZA 3V7YA 1N78A 4TKMA 5I7OA 4GYKA 3L0CA 4ECZA 1MLDA 3QKWA 3QZUA 3ZY5A 5CB6A 2VQEB 2IYFA 5AVXA 5CHYA 1A4UA 9ICGA 4GF5A 1BVSA 1LH0A 2BF4A 5DHSA 2CC2A 1UXKA 2OO7A 3LDUA 4KLSA 3P27A 4REQA 3VI3B 5BV1A 4MAFA 5EERA 5JJIA 2OZLA 4IAOA 3L0SA 2V03A 4AURA 1MC8A 2JGKA 2BFBA 4WFQA 1YQEA 3RT7A 4KG7A 1WX1A 2ATXA 2XKAA 3TINA 1UL1X 1P33A 3IKJA 1U3GA 1VFPA 2GZ3A 4KE9A 2M32A 2WM9B 1TM2A 2P7HA 2R7KA 5EJ8A 4WKPA 3AR4A 1NONA 3PC8A 4CM4B 5DDYA 4C2AA 4PNEA 3HXQA 4U00A 1Z8DA 5C81A 4M36A 4ODIA 3CCCA 2QT0A 2PUAA 1KFJB 3X1XA 3DCJA 3ZIAA 2B8WA 4I8XA 3T1HB 1H8HA 2WT8A 5HHIA 2NX2A 4G1CA 3ANLA 3EDQA 4EJ2A 1Z0AA 2WNIA 1DXHA 3O1JC 2P2ZA 3LCUA 4QKQA 2H57A 3OO1A 5LLTA 4UCQA 4IRKA 1FMJA 3FOWA 4X5VA 2NG1A 4FR5A 4AVYA 4Z9YA 1SCJA 3HJGA 4GC6A 1IBKB 3H5AA 4O4HA 3RAPR 3JX9A 3TH5A 1IMJA 1MO5A 1NU8A 3AIMA 4F86A 5KUTA 2VQDA 5AJHA 3RFTA 4Q1VA 3AHFA 3TTWA 5K8UA 2NMVA 3F7TA 5IJWA 2FLVA 4NOMA 2O7RA 3MJTA 4LE2A 1IB6A 2VRBA 1G66A 1ZIDA 2AJBA 3NHBA 3QOYA 4JN6B 4L57A 1D7OA 4E5VA 4LTDA 3EQ7A 3QSYA 2XGSA 5IHPA 3HKBB 3I2GA 3JQ7B 3PW7A 3GBSA 3OG9A 2CB9A 3U31A 4CLOA 1E63A 4D6XA 1SWVA 3WJAA 5A06A 5ADWA 4HAXA 1BNCA 2FF5A 3A0UA 1C30A 1GUYA 4W8OA 3NCHA 4I4CA 4RM3A 1ST3A 2HA6A 3LT2A 1WCIB 3HFSA 4QC2A 4BVFA 2GCIA 3B1KA 1SA0B 2H0AA 3NUGA 1VCMA 3O8NA 3P9IA 4PLPA 4RGBA 1G1AA 1NN3A 2HDOA 4I4LA 4D44A 1X1TA 1KE2A 2NYVA 2K7ZA 2I76A 1HEIA 1QCDA 4BV3A 3PGKA 1F5NA 3TAUA 3DDZX 5JDIC 1KSGA 4C89A 2DF4B 1A69A 1GFIA 1JV2B 3EH2A 3TJMA 3GIIA 2F00A 4QOIA 2WUDA 4EB6A 1TL7C 1Y8ZA 1WKBA 1TC1A 4YRBA 5MHTA 5CVVA 2DKFA 3TK1A 1QGYA 2HRDA 3SICE 4MW1A 4PYQA 1X7HA 1IQUA 3DHYA 5GOZA 3AQIA 3C7AA 3VYWA 5E9AA 4BLVA 3ADBA 2CSXA 1C2YA 1U8FO 2HCBA 3WSWA 3QELB 4J03A 3I6ZA 3VI4B 4BP9A 4FKZA 2ODGA 3DVAB 3TZBA 4B0OA 221PA 4ED0A 2P5YA 3BDPA 1U2QA 4FDUA 3RSZA 4GWLA 4Q8EA 2COKA 2PGLA 1U99A 4DCJA 1BOFA 1QTNA 3PO5A 1V96A 2C7VA 1ZJ4A 2JH9A 2Y2VA 3AFMA 4NS4A 4TTJA 3I92A 4G6ZA 4H1WA 1XCLA 4BNDA 3FBGA 4LV6A 1ADFA 1KL7A 1ABFA 2PVPA 4U7HA 3ZV5A 1V2GA 5CFQA 4CKEA 3T4EA 3ZPXA 1PS9A 4QOEA 1JRPA 1Z35A 2ZRMA 3C5EA 1PZMA 4EW2A 5CDFE 1J25A 1AKQA 4ESVA 3W2GA 1J9ZA 1E5VA 3M6AA 1OE0A 3U26A 2B1RA 3LVBA 1K1EA 1VCIA 4OB7A 4PJ0U 2G4VA 4B73A 2FI1A 4X7RA 1U6KA 2NO6A 2R00C 3H2SA 5LDHA 1FW6A 1RWNA 2X7HA 4XWWA 2JG3A 4NNOA 2LYBA 1DDGA 2VJMB 2KE5A 1CPYA 1OHHA 3QENA 1CJVC 3KOOA 1ZGAA 3O8QA 4BE7B 1U2DC 4CJXA 2FWNA 2NTNA 5F9MA 5LOVA 4LSGA 2PQMA 1PL6A 2V65A 4GGPA 1Z36A 4I99A 4G4IA 4N7JA 1NVWQ 4ND6A 1XSEA 3LLUA 4XGRA 2ZCUA 4B6FA 5LN1A 1P7PA 1KWKA 4A0GA 4FUQA 3H05A 1W35A 2HHCA 3GJ3A 3W34A 1QP8A 5FQOA 3IQIX 4HPWA 3PMNA 2DMRA 2G1UA 2W2KA 3KKQA 4FIDA 4P7BA 1IUPA 2BFWA 1K2VN 1ZM9A 2IYOA 4J0QA 4YJKA 3V4PB 4D0GA 4MXDA 4LZOA 2IIBA 4MPRA 4ERNA 1B42A 4UM9D 2SBTA 4X54A 1KI3A 4BVLA 4M7OA 4B3MB 3UBTA 4AQDA 2I2BA 1GU7A 3PJGA 5J2UA 3H18A 1D6MA 1P1KA 4Q3BA 1IZ9A 1C7YA 1MH1A 3HDQA 5BSHA 1XRPA 2JFZA 1NMEA 1G8JA 2I66A 3JQGB 3KB1A 3J7TA 3PE6A 4QPPA 2LBOA 5KVVA 2J3EA 4I2FA 4FZLA 3RYIB 2UVPA 4XASA 2YXBA 1Y1RA 5FNZA 2W90A 4QREA 5HFAA 3COJA 3NDJA 1HYGA 1I7DA 2G36A 3K72B 3LNTA 2YNMD 1YQTA 4OOEA 4Y1RB 1P1RA 4G67A 2M6SA 2QJWA 4DQUA 5JNLA 4CFZA 1JH8A 2X40A 4MIEA 3QG5A 1Y3DE 2CHEA 4BWYA 2BDUA 4I6GA 4PTYA 2G63A 5KDDA 3OJEA 4RQBA 2CWWA 3P71T 2HU2A 3KKAA 2V4RA 2JD2A 5DDMA 4L16A 1S1CA 4U7WA 2C4TA 2CHVA 3DOIA 4F84A 4LF9B 2AQ0A 1IHPA 1AKRA 2K4EA 1T2NA 1I0LA 2WINI 1FSFA 1DG9A 3BMCA 3GUCA 3JATA 3P1JA 3R3HA 2R8ZA 5KQSA 2DUYA 1Z33A 2IOFA 1IN6A 3AONB 2ONJA 3AL0B 2H4ZA 3P2OA 3NW9A 3IG8A 1OA0A 2ISPA 3O8LA 3UFXB 2A1JA 1IG3A 1MB4A 4MP8A 5CGZA 3DV9A 2NIPA 2FOLA 1CQJB 4NMHA 5CX1B 4DXDA 5IAAA 1IXYA 3O8OB 4PFJA 2XE6A 1U1EA 2BCUA 3P0HA 4KO2S 4Y9TA 2QHXA 1LCIA 4LGYA 3TCKA 3PXUA 5EKTA 1V26A 3BMOB 3TSOA 4C5BA 3I9V1 3NEPX 4ZOLB 1PW7A 4FKMA 3E9QA 1CUKA 1XD8A 4N49A 3FA2A 3DBRB 3KOWA 5L3QA 2I8CA 4PSDA 2PMZF 1I2BA 4NCHA 2KSOA 3OPXA 1LLCA 2IUUA 1XELA 4KBYA 3RVRA 4D2IA 2HNBA 2R6CA 3WDSA 4DYDA 4Z8XA 4A23A 3GAAA 1Q0QA 3UFXA 2IRWA 2MINA 6YASA 4GZMA 3QMPA 4Y9UA 1XZJA 1GGFA 2R8HA 3R3XA 4I3HA 4D8WA 3CX8A 4UTZA 4UU0A 3BS7A 3S70A 3SE7A 1O89A 2NU7B 2V6MA 4D56A 5A9TA 3MPOA 3WMWA 2O8EA 1WXXA 4KXFB 4E2FA 1EE2A 9ICRA 1GA4A 2JVJA 3AB8A 1JYSA 5D00A 1NFFA 3RSQA 4K6GA 1BOOA 1CUYA 4HRVA 2GZDA 4F3OA 5D5HA 1ZEMA 1T29A 2V96A 3NNNA 4XYMA 1S8OA 1K5OA 4UQGA 3ISDA 1I51A 2BY4A 2JLRA 2ZYDA 3BSSA 3JR3A 4QEDA 1WCLA 3GRRA 4RKQA 4GRDA 3IAHA 3VKWA 4G9EA 4OHXA 1CP2A 2WSMA 3E9NA 3I1IA 4IWXA 3RJ9A 3PXGA 3IEUA 4A0FA 5HKBA 1DXYA 1NJFA 4LWZA 1O0CA 3AVXA 3X0DA 4H3HB 5HF5A 4IRCA 1SV0C 1IUNA 4R01A 2OZPA 2JB9A 3NHFA 4HWSA 2ZETA 3EQ2A 2CLCX 3AM3A 3GGDA 1DGSA 3UPQA 3OFSA 4N7BA 5IVIA 5LPNA 4PYRA 2Q4TA 1PR6A 1RRMA 3A1VA 2B1GA 5FBZA 5JHGB 2VK4A 1QH1A 3I4LA 2W98A 2FZWA 1ESNA 4P5EA 4YQEA 2ZANA 1DKRA 4KMRA 4BKQA 4EA8A 4FGJA 4M53A 4OJLA 2J7PD 2GB4A 4N0MA 4RJTA 2ZTUA 1CLUA 1NVKA 1PEDA 1T94A 3RW9A 4P7GA 3EXEB 4AY5A 1ZJYA 5BNTA 4FE3A 5H80A 1PDVA 1W581 1CRLA 5E2AA 5JQWA 1I2DA 1ICIA 4R64A 4YCMA 4XR9A 1ACLA 5KL1B 3I9MA 2EWWA 3EUB2 3H2BA 5J59A 4E6EA 2C4NA 1RXUA 1W29A 1E6EA 1S0UA 1TM7E 2AF3C 4NL4H 2D4HA 2VPYA 1N2IA 1R4NA 1DLIA 1EVIA 2DBVO 4MLDA 5A2QA 5MDHA 2HSDA 1MXHA 8ICZA 5G2OA 3IKLA 2ZIAA 1YVDA 4X97A 1Q21A 2OILA 3R6LA 4ES6A 4AUEA 1VKZA 4RZHA 1TZ2A 2W5UA 4H59A 1XK7A 1Z00B 4KDRA 1SV0A 2VSFA 2AOVA 2IWRA 1G5QA 1BJRE 2O2XA 3DGFC 4GLOA 1NXOA 2XW6A 4TT8A 4BO8A 5J2HA 1NWCA 1JVNA 4PQGA 4XD7D 3KAPA 1ZOLA 4AYTA 1I4EB 2RCNA 1FFVA 2OKGA 3N6VA 4OJ6A 3F5QA 1NKTA 1OWNA 2B4YA 4KLRA 3E6AA 3TLXA 2A4KA 2PL5A 3NRBA 5M2QA 1QRUA 4HDKB 4YAIA 2FAXA 2DJIA 2P2LA 4WXMA 5EI5A 4PS1A 2I87A 3FTDA 3ROZA 5JO0A 3E1GA 2ETVA 2JD0A 1RPNA 3VO9A 4YIKA 3HNPA 2ZB7A 4S24A 1RRGA 4CKEB 1L7NA 5H3HA 4ZCPA 3CPEA 3TRHA 1IQ0A 2A94A 4R1PA 1RD4A 1FL9A 4W4TA 4CIVA 3I61A 1G64A 1NVXQ 1QIDA 4B1FA 1AH2A 3IPYA 3N2GB 3GUHA 4OJYA 4YONB 1EUCB 1KKMA 4TYYA 4G5RA 5LBIA 1RIIA 3G85A 1G8FA 3BS5A 1MX9A 1EP9A 1SVLA 4KQWA 1CULC 3R5SA 4LZLA 2J3MA 2LW7A 4ZZ0A 2YWCA 1G6Q1 4HGQA 4LECA 1YDFA 3LY8A 3AWIA 1KIFA 3U7FB 1EB8A 1TC2A 1K86A 2Q3BA 3W3ZB 4Q1DA 1Q8KA 4J0JA 2NO5A 4K6MA 3WGVA 2XWQA 3EGDA 9ICMA 1GUZA 1HE1C 1DBPA 1HDIA 3SKXA 3EQZA 3M4JA 2QF7A 5DG9A 1TK3A 4QZEA 2HUPA 2ZGVA 4Q3CA 2GLTA 3BQ7A 2KPOA 4MQ4A 1JMYA 4ZDKA 2NZUG 2G40A 3FWYA 3R0IA 2NU8B 5HOQA 5ILOA 4CV2A 1PK9A 1NVDA 2OY0A 4HO1X 4EVRA 5AW7A 4IWNA 2K2QB 4Z4EA 1MEJA 1V25A 3NBYC 5AI0A 1IY0A 4J16A 5CK4A 4QG3A 1EA5A 4MROA 1J1IA 3G2LA 2AR7A 4ROSA 3SIWA 4A8PA 2D1TA 2AFVA 1KAMA 3MWKA 2FSSA 2Q3LA 3DFZA 4IIXA 4QD3A 1VCOA 2P4SA 1TZKA 5A9SA 1P72A 2XKBA 1MA7A 4O02B 1BGXT 4BY9E 3AVUA 2KBEA 3RTCA 3WG9A 3COPA 3UGTA 3Q7TA 2IS6A 1N6OA 3F3MA 4JJ4A 1HDYA 2HWYA 5B36A 3K15A 1BA2A 3EZ2A 5KOIA 1UDAA 2F1HA 2ZUBA 1ANKA 1GSHA 1ZN7A 3MELA 3O31A 5AQ1A 1XLTA 3M6VA 4A6EA 3LW7A 5B7GA 3C6QA 3A9WA 1BCSB 1EE9A 1EA7A 2AE2A 1XCMA 3UPDA 5TJHA 3T1TA 3AUJB 2ADFA 3FIUA 4COKA 3PXBA 2X9VA 4CF6A 3S7ZA 5CVUA 4C4TA 1AY0A 2VK2A 1TK5A 4JVMA 3L1HA 5HZMA 3VO8A 3BFJA 3PDJA 4XCXA 5EWMB 4BNNA 4D8VA 4R31A 2IW3A 3SEZA 3D4LA 4MS1B 1NBMA 1HM5A 5JMPA 2PRIA 1B8NA 3LWBA 4OIFA 5T57A 2FMKA 4RL4A 2UZ3A 3C6YA 5E1BA 2YQ5A 4EI9A 3AQEA 1J07A 2JIOA 5H59A 5H82A 5CXQA 2CMDA 2WF5A 3GL9A 2XIDA 4M46A 3ANSA 3D3KA 1VGRA 2MYTA 4WAUA 2VRWA 1GQYA 3RLIA 4CM8B 2QJOA 4IS3A 4QU9A 3W6ZA 1VP9A 4IIGA 3VR6D 4JUZA 1L3VA 2NVWA 4F72A 1VI2A 4RFSB 3DOHA 4IX9A 1GVHA 2G5TA 3KTFA 1D7AA 1Q7BA 4PTZA 2AZTA 1PD1A 4HZUA 3DBVO 1RRCA 4ZCSA 4ZZ1A 5A4KA 2QENA 2WIFA 2R8XA 5J43A 5DASA 5F51A 3GT3A 1JEYB 1LZLA 1XA4A 4WKGA 1OI3A 4CR6A 1JI7A 5ALKA 3QTTA 1U3UA 4TS3A 1OAKA 1USIA 3C6BA 5E3JA 2WTEA 4MKFA 2F3PA 4CQLA 2FZKA 2EW1A 3G1TA 4BZZA 4DTIA 3N7PD 4B7CA 5DQGA 1UWCA 3IAFA 2FJ0A 5K05A 2VP2A 5FWAA 1EIZA 5FLYA 3SM9A 1B2LA 2B5VA 4EX6A 4OHBA 3LVVA 3L4BA 3IP8A 4Q18A 5EXSA 3PVZA 4Y0VA 3ZW8A 5JAZA 2O8EB 4AIRA 3SVLA 3O8RA 2XA9A 1Z4LA 3E7FA 3LBYA 1MX3A 1JQKA 3I64A 2IL1A 3RV3A 2ZIFA 5IVDA 2YUIA 3KZIU 2XNJA 5DM2A 1W4AA 1QH8A 4LC0A 5K3FB 3FSRA 4S04A 1PQWA 3JSAA 3VC7A 5GWXA 4J4BA 3GAMA 5I9TA 3BWXA 4B6QA 4M49A 2Q50A 3RR8A 3QLTA 4TV8A 2IH4A 4MMYB 2X0KA 3EB9A 3P0IA 2Q49A 2KG5A 1LF5A 2AB0A 3LDAA 3B3FA 4IXNA 4MR8B 2OCAA 4Q6WA 3IHWA 1VJ0A 2TSYB 3NAMA 5D6OA 2UYHA 1SZHA 1NPDA 2FPKA 2P41A 1T9GR 2QZ9A 3ROFA 1GXSB 4NCAA 5HTOA 2FZ4A 2VCHA 2KNJA 2BCJQ 2EJCA 2GZRA 2A9FA 2IELA 2ZZNA 1RQNA 2ALJA 4KLHA 3VGPA 3ABIA 1W36B 1SO8A 4RORA 1R16A 3KQYA 2D2VA 4JYAB 3AKDA 2R6DA 1NC1A 5MF6A 4PRZA 2RC5A 4B34A 2BC9A 3VSCA 4OBXA 2W6PA 4AZ0A 1PZHA 1EXWA 1Q74A 5BURA 2ECFA 3IH5A 1SBTA 3GLGA 1J5PA 3SV4A 1WDMA 1XYYA 1N6IA 5J2TA 2QR5A 1NOJA 1P5FA 3PSHA 1EINA 2KJ5A 4OYYA 4YX9A 2LMRA 3DEEA 5CDFA 4D9IA 3LE8A 3P9ZA 4JWMA 4LI0A 1KHHA 1YBHA 3A1EA 5C1PA 1HO3A 1RLMA 1TW3A 2XZPA 2EFYA 2I6XA 1QVZA 2LR0A 4P4SB 1MNAA 4JQCA 1NSFA 2P62A 3DT8A 2ZQYA 3OMWA 5I47A 2OT3B 3CLUD 4R9RA 2FN3A 2ZVJA 5DE3A 4DAOA 1TEZA 3KOYA 2A8YA 2XDQB 3PR1A 2PX6A 2HA2A 5I7HA 2ASDA 3G7NA 4B35A 4PPXA 4GLFA 1X6JA 3C21A 2PXCA 2ZJZA 2QUZA 4IDPA 1O9HA 2G77B 4D4JA 2AUNA 1Y6FA 1CQIB 2HK8A 3ZYZA 2J6SA 2QL7A 4ZVRA 2PFKA 1LNZA 2XY4A 4GYJA 3JQQA 1CY8A 5BVGA 1P8JA 3HWTA 1EFPB 3PUXA 1GQFA 1ADGA 4AJ2A 4E08A 3OSZA 1RQPA 4OQDA 3BB4A 4BNTA 2HIGA 4F4HA 4RTOA 2I4MA 1RLIA 1CFJA 4UHJA 1UBFA 5BO5A 8MHTA 3ZY6A 1A1SA 5JSKA 1K9VF 5CT9A 4DILA 3UMYA 3ZD7A 3HO6A