1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
b'MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD51
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
4WOPA 4DLYA 1H8HD 1T91A 2V6IA 1QHGA 2E9SA 3V6HA 1W44A 4JLNA 1W2GA 4MFCA 4XSGA 1KI6A 3U61B 2OHFA 2BBTA 1TMKA 2PCLA 3BJIC 4TLBA 4OBEA 4DQRA 2ASDA 1E2HA 4LHVA 3EIQA 3ZVNA 3UXNA 4UNQA 1OV4A 1COOA 2PJZA 4L5BA 2IBKA 4P33A 4QZCA 4K46A 4E09A 2ANCA 4JLKA 4HUQB 5KFYA 4LJYA 1S3GA 2C98A 5KSZA 3JPRA 2WHXA 1SZPA 4DSOA 3QXXA 3K70D 4YXWD 2J0QA 3FMPB 4LJ7A 1MH1A 3AVPA 5EWGA 1KRPA 3IHWA 3HJNA 2IBMA 1F48A 1P3JA 2CXXA 3EX7C 1XWIA 4GLXA 1U9LA 5KFCA 4L15A 3K0CC 5KU1A 4I2CA 4AYTA 4URWR 3SJAA 4M8NE 4DFJA 5JBQA 3AV0B 2J7PA 4TN1A 1ZNWA 4JVLA 1B43A 3RJEA 2KTQA 8ICGA 3GEEA 3UMFA 4Q1CA 3MGIA 2QNRA 1E3MA 1X1RA 2A5YB 2ZTCA 1NL3A 2CJWB 3QEOA 1E98A 3HWTA 1OSNA 5KFVA 1YZNA 1ZU5A 5FPYA 4GDFA 5KFRA 4DO9A 2XZPA 4KXFB 4TL9A 1ZQHA 3B2EA 2UVVA 4EKDA 5GJBA 8ICOA 1CS4C 4DIDA 3ZZUA 1MO6A 3J81k 2JLXA 2GXUA 1A2BA 1XEXA 4YXJA 2G3YA 3QEAZ 3G6XA 1YR7A 1TK0A 2R8KA 2XY6A 1VG9B 2RH5A 3NC1C 5EE1A 3SI7A 4IVPA 4XQ8A 3W8NA 1FTSA 2IYZA 4KLZA 1OIVA 3Q3JB 3EG5A 4F4JA 2JLWA 1GRRA 1FX0B 4D4MA 1XWLA 1J8YF 1XXHE 3KHRA 2FSIA 4XSHA 4M0LA 4XUSA 5CWRA 4Q66C 3WMFA 5HR5A 4TLAA 4LGMA 1VYUA 2O8DA 3HDTA 2FPLA 2ATVA 1DEKA 3SR0A 4Q01A 1G6HA 1YRAA 4KLOA 7ICEA 3PR4A 4PC2A 4F8RA 3TJZA 2DFLA 4M2LA 4BQSA 1G19A 5FI1B 3VFDA 3B60A 4DF8A 1FFHA 5J40A 1UBEA 3TAHA 5CM9C 1FNNA 2J9RA 1RRPA 5TZVA 2KFNA 5JHGB 2JIZA 1AA9A 5GVSA 1N5KA 1NF3A 2QZ4A 2C22A 4QBFA 5FOTA 1TNDA 2DWOA 3NEYA 3RRNA 8OHMA 2W6JD 5LPNA 4WAUA 4O9MA 3PCRB 4RY2A 1OW3B 4KFUA 3RNLA 5L3QB 3ADCA 4MGZR 2JZBB 5HMMA 2ZI3A 3Q8RB 4HB4A 2VL7A 3F0TA 2G6BA 1E2LA 2ZRIA 2I9GA 3JPNA 2WIBA 2YHSA 1DOQA 4NCNA 1VYVA 4J9SA 4F4XA 1UJ2A 3EZFA 3I92A 5HE9A 2E1RA 5B30A 1X8LA 2IYLD 4OHZA 3IEUA 1XEFA 3TARA 4Q1AA 4U5XA 4I29A 5BYJA 4F5RA 2Y8EA 4JLDA 3DVLA 3MWJA 4B3CA 1KO5A 1XSNA 3MRSA 4RZ3A 5TARA 3EZ9A 3REGA 4F5PA 1Z0KA 4M1OA 3THWB 1GTVA 4TYNA 4PZYA 4LZDA 5CDFA 2ZS8A 3ZIAA 2C95A 1K5DA 4XJXA 5FPKA 1OH8A 1NIJA 1AZSC 1M7BA 3I3SR 2IYXA 1SVWA 3RDPA 2BCRA 4PPFA 2AWNA 2D2FA 5DGBA 2ZITA 5KFWA 4MKHA 4NMMA 4HYKA 1BOFA 3P26A 4DDWA 221PA 5HZKA 9ICIA 1CR4A 1E9SA 2YYZA 4QRHA 4DSTA 1L7VC 1GDDA 2BMDA 5KT6A 2DHRA 1L3VA 3FTQA 4A0FA 1P75A 5KT3A 1KGDA 4NONA 2VHTA 5IINA 3VX4A 2GXAA 2QRNA 5KFLA 5DKWA 1R0WA 2PH1A 4IJMA 4ZKDA 3RB3A 1ZQDA 1QTMA 1NNEA 3OGUA 2O0JA 4O0MA 2JEFA 3C2KA 4YMWA 4EZ9A 1XEWX 4M9QA 4EBEA 1TEVA 4HB0A 1CU1A 5AWFC 1MQ2A 1IBRA 7ICKA 5K8IA 2XGJA 3NTUA 4C8KA 1J2JA 4Q1DA 1GNRA 4DLUA 3HX0A 3IBYA 2CK3A 3NWJA 3P20A 1Z8FA 2VA8A 3SYZA 1S10A 2KFZA 3SDZA 4UBCA 2QM7A 3KJIA 3RS7A 1V5WA 5SZHB 2VRWA 7ICVA 4G5QA 1KAOA 2IF0A 1A1VA 5KFZA 1P6XA 4KBGA 2YV5A 1XMIA 1XPUA 1PUJA 2WJVA 2XGPA 4V02A 3MJHA 1YQTA 5JJIA 4AC9A 4ECVA 3K9LA 5DLQC 1P2TA 1YR6A 2G83A 2WIAA 2ZE6A 3PX0A 1QG4A 5KG1A 1EWRA 2BBOA 1UM8A 2ZRFA 5FL3A 2IYUA 3GV5B 1O3YA 3KQLA 2HYIC 2GK7A 3NDBB 3DO6A 3H4DA 4UAWA 1DELA 2H8KA 2WZQA 5EZ5A 5F3WB 1BPEA 3MBYA 5J4VA 4R66A 4BE7B 1LY1A 1OF1A 5L1KA 1R0XA 1RKBA 4ED3A 3KUCA 3Q7QA 2Q6TA 1S4QA 4YVZA 4QZFA 2WBLC 5EP4A 3TKLA 2O8DB 2EQBA 4CRWB 2EYUA 4R71A 1E0AA 4TZ0A 4ED8A 4YMSA 2WWYA 3IPYA 4JLMA 4OI4A 2R44A 1P9WA 1TL7C 1A5TA 1T9HA 2UZ3A 3HWSA 3MWKA 2XNDA 1KNXA 4NPHA 2IA6A 3PEUA 2XJ9A 4HAZA 1U8AA 2OT3B 2ZQ5A 3QENA 4YG2A 4ZDWA 4MKIA 3TW8B 3AVVA 2IEYA 2KN7A 1GL7A 1NVVQ 2HXSA 2JLQA 3ZDDA 1UF9A 4TMZA 3W6PA 1LV5A 3KFXA 5HTKA 2AQ0A 3EZ5A 3D3QA 4RU9A 1N5IA 3ECCA 1XXHA 4Q4AA 1N0VC 5FPHA 4BLSA 3L0SA 4C7OA 3TVDA 4IQWA 1KFSA 4KLUA 4PO1A 2XO7A 4S2EA 3DL0A 1P2UA 4G1UC 4RFSA 2QE7A 3K75D 2GRJA 3EW9A 4MKGA 2O8FA 3EA0A 2ASEA 4IR9A 2R8JA 1XBTA 1OFUX 4R7ZA 1NRJB 5DQHA 3C15C 5KG3A 4ECUA 1KFTA 2AK2A 7ICLA 1VCMA 3MFYA 4PC1A 1N0WA 3QQ5A 2K5UA 3TSZA 2P6NA 5J2BA 4O5CA 1YKSA 2XTZA 1JEDA 2YJTD 2EWVA 2ZTSA 3PV8A 5DI9A 2O52A 1KI2A 5J2KA 2HEIA 4AKHA 3VKHA 4V0LA 4C3ZA 4EBCA 2J1LA 4UXJA 1TADA 2ZYUX 1UA0A 2BPGA 1I4DD 3GLFB 3K53A 1G3UA 2F1HA 5FTKA 421PA 5AJZA 1U47A 2HHWA 4A15A 4HYYA 1NJZA 4RUAA 4J9MA 1M34E 2ERYA 3OHMA 1E2FA 1VDZA 1ZD9A 3CRMA 4DCTA 2QSYA 4NYMQ 4FW9A 4V0MA 1CJUC 1JALA 1HE1C 5G3YA 2CLSA 2JCSA 5JFGA 4YFKA 4KHZA 2Q0ZX 4QGHA 1YZQA 2NO6A 4PHAA 3WNCA 1Z6TA 3ISDA 1ZQJA 3SZRA 5KPDA 3CX6A 4DOCA 4OHXA 1WXQA 2FH5B 2ZE7A 4DDTA 1YZUA 4ZIRA 1G8HA 4M04A 1JQJC 1W4RA 3PW5A 2ASJA 1XJ0A 3GJ5A 1CBUA 1FP6A 2ATXA 4LBWA 3C2LA 3OEHA 4LOAA 3FHTA 4JYCA 1TAGA 1SHKA 1IY0A 3EPLA 1E6CA 3QF4A 3CX8A 4EPTA 4YCXA 1KDOA 1PLJA 3VNUA 3ND8A 3GPLA 2PBRA 4PHHA 2Q3HA 4YD2A 4G3IA 3TSOA 4TSFA 2ZRMA 2FLNA 8ICYA 4G5GA 4JLJA 4FBUA 1BS1A 2O8CA 2AGPA 1W48A 4JL5A 1SQ5A 2HDNB 1U9IC 2BBWA 4URUR 2VSXA 3PXGA 4CF7A 4NYJR 4X8HA 1KO7A 1FMLA 1ZIOA 2AR7A 7ICHA 2JJ8A 3K1JA 2V7QD 2WAYA 3EWSA 9ICLA 1Z06A 2VP4A 4GMDA 4XOIA 1JMSA 3U3KA 3BWDD 1W0JA 4QNRA 3QKTA 2A5GA 3OIVA 1U99A 2QMEA 5L3SA 721PA 2IC5A 2GESA 1Q57A 3K0SA 4KI0A 2R9VA 3TAQA 3LFUA 2PCJA 1HT2E 3I4LA 1QSLA 3Q8MA 3TSWA 2G9NA 1L3SA 3AVXA 4PR0A 5AUPB 2CNWA 4ACBA 1NVWQ 5B64A 3R9XA 3PW7A 2C04A 3KXKA 3QG1A 821PA 4CGZA 1TFRA 1N5JA 1KSJA 9ICMA 1S2MA 2OESA 3GLHA 2KZ3A 4TMTA 4Q18A 4YMUA 5DBAA 3BXZA 1DAMA 1XXHB 4Q4AB 5CIWA 3H8WA 1VG0B 1G41A 4RZRA 5F9FA 1Z0JA 4DLEA 2R8GA 1NP6A 2IEZA 9ICQA 2NZ8A 4M6WA 2WKQA 3RB4A 1JXLA 4FCTA 2H5XA 4RFSB 4C0HA 3QKRB 3UXOA 3QE9Y 3RBDA 7ICTA 1VHTA 3Q72A 3QPWA 4CYMA 3WP1B 4M9SA 2FFHA 4EIWA 2O8FB 4MYCA 4B34A 1TF2A 2BBSA 4UB5A 1PLKA 4WBSA 3CWQA 2JJ2D 4ITRC 1G6OA 2VP9A 2EFGA 4ESHA 1UAAA 3GQCA 4JBYA 4UBBA 3PO4A 4D0GA 3AH8A 5D4BA 2CE7A 4H9GA 4IW3B 5FUWA 4NLNA 2BHNA 5DN6D 4QW9A 9ICNA 4TMVA 2AXNA 4WW0A 3M8RA 4DLXA 621PA 4XVQA 2ZR7A 1QHNA 2ZI9A 1I2MA 4KMUA 2Z43A 3TAUA 9ICKA 5EXSA 3ZZTA 2H7VA 1YZTA 3QVUA 4JL8A 3MR6A 3EIHA 4YQWA 2WPDD 2PEYA 5JWHA 4QZHA 3GDXA 5FI0B 4DCSA 3AP2A 1GOTA 4KVGA 2MMGA 4LJ5A 3M9NB 3OIYA 4Q21A 4QC2A 4AG6A 4F4ZA 1G5PA 2OILA 4F4IA 3LBNA 1CR2A 1E2MA 4HLQB 1T8TA 1CRQA 2VEDA 4C30A 4Y0VA 4RQ2A 4YC7A 4Q9JA 1R5NA 5IRCD 4AY2A 3RJGA 1NKCA 1IXRC 1OXUA 4C0JA 2OAP1 3RABA 1E9EA 4B74A 2DB3A 2NRZA 1P9NA 3B13B 3QZ8A 3K0FA 4X8MA 1TAUA 1JI0A 3I73A 4M9XA 2BV3A 2F9LA 3EXAA 2I4IA 4A8JC 4BWYA 4ECRA 3HYTA 3RJFA 2Y1JA 5F2EA 3A4LA 4NYIR 4W9MC 5KT2A 1L5UA 1PUIA 4GZLA 4PXAA 3GJ0A 3RJIA 4LYFA 1VCOA 1U0LA 1Z0AA 3CBQA 3W5IA 2FN4A 3WY9A 4F5OA 5KYKA 2B6HA 3FE2A 3SQWA 4KVAA 2OEPA 2HLDA 1F2UA 4NHOA 3FFBA 2P3SA 1UKZA 1UDXA 2YWGA 5CR0A 5J0WA 2P0EA 1MRSA 4RJLA 4KLNA 3TK1A 2YZ2A 4BEBA 4NYJQ 3E70C 3PV0A 2BHRA 3TQCA 1D5CA 4QKQA 2O8CB 3TI0A 3QBTA 2ZRKA 1GM5A 3T1OA 2JLVA 3PEWA 4EYHB 2DWPA 2VF8A 1WCV1 2PX3A 2DR3A 1T4GA 2REOA 4HAVA 4AYXA 1KNQA 3KHGA 3PY8A 4BLOA 3UK6A 1S9HA 1RYHA 4W5JA 4PZZA 1MO5A 4F50A 1I4TD 5KFOA 1ZAKA 2FWRA 4DCVA 1OFIA 3GIKA 3AU6A 3IO3A 4LUCA 2R6DA 3V4FA 5L3SB 3U44A 3LW7A 5KG6A 1ZNYA 4ZCMA 2ZJAA 4F38A 4QL3A 2AD1A 3OAAD 5CYPA 4M9NA 2OAQ1 1U49A 3BFKA 3B78A 1RC8A 3RB0A 3AUXA 1XDBA 3A8TA 3AUOA 1W46A 3ORYA 2P2LA 4PSAA 2JA1A 2JJ1D 1NJYA 2J7KA 3RWMB 4QZEA 3RAXA 1G3RA 1KK0A 2B8TA 4M1YA 4OQNA 3LD9A 1ZM9A 5FUYA 2GDJA 2G77B 4IDNA 4IDQA 3TH5A 2B21A 4NBSA 4ED7A 5KT4A 2CDNA 3EASA 4KSCA 3T15A 2IF2A 3TGPA 1KMQA 1NLFA 3OIUA 4ZI3A 4AKGA 4DCNA 5JJLA 2ZRGA 3GLGE 1KLNA 3TANA 2MSCB 4ED2A 4C8NA 1SL2A 4M6WB 2UVUA 1G20E 1QLNA 1DE0A 3RS4A 2G1KA 3G6YA 2XC9A 1ZQSA 2X77A 1IN4A 3B1XA 4AURA 4R63A 3DMDA 4DLZA 4HAWA 2ODWA 5FBWB 1NY5A 3MDCA 2B7BA 5KOYA 2G88A 3BDPA 1X1SA 1MO3A 2C03A 1ODFA 2GXSA 3JPPA 4LJAA 1OIXA 3BQ1A 1X3SA 3H84A 3BH0A 5EP2A 3OHBA 3SV3A 1OE0A 2ZSDA 2ZM5A 1TF5A 3HU1A 1NKEA 4M9JA 1G4AE 3K9NA 2DWQA 4O3RA 5FBLB 3CZPA 4IDHA 3ZQ6A 4TQSA 3IQXA 4FCWA 3FDIA 1S1CA 4PX9A 2FA9A 2I1QA 4ECZA 2CE2X 2FE4A 4Q03A 4DZZA 3HU3A 2D7CA 5KFKA 1KZGB 1MV5A 2GF0A 4JLBA 4TQ9A 4BLTA 4DXAA 1Y3AA 2OXCA 2W2VA 1XRJA 4JBWA 5IDVA 1E79D 2XITA 4JLVA 1GKUB 2XY7A 1NY6A 1M7GA 4K8OA 5FBQB 5KPJA 4WXRA 3R8FA 4PAOA 1P60A 3FB4A 4MRRA 3Q8XB 2EFDB 4TT3D 4BFSA 4NYIQ 4O3SA 1DAHA 1E9CA 3T06B 4MEYA 2ASLA 1FUUA 4J0QA 5DE3A 1SKQA 3FDSA 3KB2A 3O8DA 4YMTA 4ZI2A 1XTIA 1BPDA 4C4PA 5AUNB 4P4SA 2WTUA 5FTMA 3SJCA 2A78A 3EC2A 5E7MA 3NG1A 2BEJA 3GMTA 2WSSD 4LYJA 4TMWA 3U3RA 3Q8LA 1CXZA 2F9MA 4QJ4A 5HZHA 9ICEA 4TYPA 5CP2A 2CHQA 5GADl 2HW3A 4E03A 3B85A 2QI9C 1RZTA 5DLFA 3NVAA 2R8HA 2R6AA 1F2UB 2QTHA 3EZ2A 2H5EA 2KI5A 3KZ1E 1ETUA 3PEYA 1ZQEA 3RJKA 1Q1ZA 2ZRPA 3MUFA 4HZUA 4LYHA 8ICCA 4X8OA 2KE5A 1KZ7B 1VCNA 4IOKA 1F60A 5J2GA 4LBVA 5CB8A 1GKIA 4GSYA 4Q9IA 1G8PA 3KB1A 3LDAA 4LV5B 4YLGA 1G17A 3E5HA 1IY2A 2QTFA 1KDPA 4AWXA 4I2GA 1XS9D 1VG1A 1ZJMA 1U4BA 3AKCA 4PGQA 3SHFA 2W9BA 2G1JA 3A4NA 5DISB 1KFDA 2GEUA 2ZTDA 3UXPA 1ZQBA 5JCZA 2GCPA 4HB3A 1KO1A 2RMKA 4L4UA 3NDPA 2ZI6A 3SNHA 3U44B 2Q0HA 3C5CA 2DFTA 1MSWD 1ZD1A 1XD8A 3G5UA 4TMKA 3R7WA 5CB6A 4RPZA 1DVRA 3BQ2A 1KK3A 1JJ7A 1N6RA 3FMFA 4AYWA 5EE5B 1K1SA 1GKYA 3THXB 2M9NA 5BN3A 2ORWA 3GIJA 4IFBA 3CKLA 5EXTA 3V6JA 2EWWA 1GNPA 4GC7A 4ECXA 1SL1A 3N97B 3JVUA 3V7KA 4PO8A 2IS1A 5J0SA 1G18A 2B92A 3TNFA 4ECTA 4B73A 4BFWA 3UG6A 3VR2A 4RT3A 2J6SA 1Z0DA 3BS4A 4NL4H 1XTRA 4NCKA 1CKEA 4LV6A 3VU9A 2AU0A 2WJJA 4JVSB 5FOWA 1E96A 4E07A 2QQ0A 2REXB 4CEIA 5KDLA 1QVAA 4NXZA 5CDFE 1TU3A 1XD9A 5JS7A 1RVDA 2QQEA 5KSYA 1ESNA 1XCMA 3A1SA 3DEFA 3OSNA 1ZVQA 8ICRA 3AKDA 1KMHA 2OBNA 2ZROA 3F8TA 4XA5A 3I1FA 3LXRA 3N2IA 2NRWA 1XPOA 2NPIA 1S1MA 4Q1FA 2BPFA 3X1YA 3ZD6A 2W8LA 3LVRE 1XNJA 2AWOA 3BERA 4MKFA 4RT2A 4OJQA 4LJ9A 2Z4SA 2NRVA 1EFRD 4PHDA 3CZQA 4AK9A 3A36A 4PQFA 5DLGA 2X2FA 1XZQA 2IL1A 1UBGA 3CRQA 4YMMA 1LV7A 3IBGA 4XWKA 4NKRA 3GFKB 3GV7B 4F7WA 1RIFA 3GILA 1Z6GA 4XVUA 3NBXX 2GVDC 5IIKA 4P4UA 4Q00A 3QEBZ 1CTQA 4QG7A 1CRPA 4TLDA 3B0YA 4RKFA 3VR3A 2ZANA 4BLRA 3EPIA 3WHLA 4MF8A 1FL9A 1QSYA 3QVVA 3TR0A 1D9ZA 1RE0A 2FSFA 3NEJA 3OEED 4LPKA 3U4QA 5KFSA 1G291 2C8VA 3AF4A 3UQ2A 3QBVA 4LJ4A 3Q8QB 5DYGA 4A8JB 4A0RA 1NMXA 5KFIA 3WYFA 1SULA 5J2DA 2HYDA 2QA5A 3I72A 1H65A 4P31A 4NTZA 4C8OA 3AKYA 1HJPA 2ONJA 2H16A 8ICWA 1EFCA 1G7RA 2YNMA 5FTJA 5J0RA 2XOKA 5JEEA 3HPRA 2REBA 3C7KA 1G5RA 2PMDA 3VR4A 1HEIA 2ZUBA 2FDCA 3SBEA 9ICCA 1IQPA 1JR6A 3PUVA 2HHSA 4XRHA 2PZEA 4FMCB 4LWZA 2ODEA 2XEXA 2NIPA 5KFEA 1ZJ6A 4EFNA 1IM2A 1E1QD 1A2KC 2QP4A 4JMPA 2IUUA 3TQFA 4RUCA 1WCNA 4RQ7A 1KIMA 1MABA 3MD0A 2WKRA 2FEOA 4JT2A 4HDQB 2W6ID 4HZUB 1ZJNA 1BH2A 4ZV4A 1OKKA 2FNAA 1B0UA 5KG0A 3KJHA 3RAPR 5KFGA 2XSZD 4I2JA 1R8QA 1ZW6A 5EXXA 1FW6A 3ASZA 5KG4A 2HJVA 3LQQA 5FOVA 3E2IA 4TTRA 1YRBA 2QGZA 3A1UA 5KFJA 1D9DA 1ZQFA 7ICMA 5D3QA 3GJXC 2YVUA 1NJWA 3PO5A 2C2HA 2VP5A 3WYAA 1AK2A 4L8GA 4QJ5A 3B8HA 1U2RA 2GBLC 1T3SA 3CNOA 4OQXA 3EPKA 4BFZA 1DGSA 2O0HA 4GPTA 2HHQA 5CYOA 3QIAA 3QXCA 8ICZA 3RH6A 1RZ3A 2RAPA 4P4OA 5AJYA 3TFSA 4BEJA 1WE2A 4YN4A 1KO8A 4JJZA 2ANBA 3OFNA 4LX0A 4EPWA 1RXVA 1S9DA 4ECYA 2TMKA 1Z00A 2UVQA 2F1IA 4BUJA 4DLWA 4ZDKA 3SS8A 2QEQA 3CH5A 1XSLA 2GAAA 4U02A 3AVYA 5DDYA 3JZAA 5KFNA 3MMPA 4IVRA 1W47A 4BZPA 2GCOA 1BMFA 1XB2A 3U7HB 1DAKA 2GEDA 4KLSA 3L2OB 2ZVQX 1D8TA 1YHNA 3NKVA 4QJ3A 5SZJA 3DOEA 4J9QA 3AVWA 3EYZA 3QZ7A 3MGCA 4P4PA 1E32A 1NK6A 3ZYCA 3EWAA 4CT5A 1Q44A 2QT0A 2OLKA 3TFRA 1KMHB 5C18A 4H1VA 2DPIA 1NVVR 1FMJA 1Z6XA 2B8WA 2C9YA 2FMXA 5KFPA 4R2IA 3V9PA 1YR8A 1S3SA 3QEJA 8ICUA 4E5UA 3DMNA 3SYLA 4ABYA 2QBYB 2XXAA 4B9NA 3LK9A 1FQKA 4I2DA 5FL7D 4FS2A 1S76D 4EFLA 1KJYA 4I27A 3DOFA 5HKKD 2BQ3A 4F2SA 1ZCAA 4Q8FA 2QTVB 4BECA 4B3GA 4DQIA 4V0ME 2GK6A 3T1TA 2PI4A 2GZAA 4KYIB 3AP3A 1ZC3A 2IW3A 1JR3A 1XZPA 3CPHA 4LJ6A 5DYIA 3TIFA 3I8SA 2X2EA 4HLCA 1E0SA 4IVQA 1JECA 4CEJB 5CJ2A 2WOJA 2IHBA 3LRPA 1KEJA 2WJIA 5FBVB 1DAFA 1R5BA 3LY5A 4M1WA 3GLGB 2W8KA 5G3ZA 3RS2A 3U4QB 1OHHA 3KKOA 3LAWA 1ZNZA 2IA5A 4Q9HA 1BPZA 1GVNB 2IYYA 3CF6R 3U5ZB 2VHUA 4D4KA 4J9KA 3EZ7A 1E2GA 1VTKA 4A2PA 1KI6B 1W4CA 2WICA 1FUKA 2BC9A 2RGEA 8ICHA 5AK0A 1T0JB 4DUGD 3HR8A 3W34A 1Z2CA 4B43A 5JI2E 3WYGA 4JKIA 4HATA 1II9A 1I2DA 3EIEA 2PMKA 4TLCA 4NM1A 2ZETA 3GJ7A 1H8EA 4DL2A 3TBKA 2CHVA 3B1YA 3HPQA 5EE9A 4LHWA 1Y88A 5ELXA 5KUTA 4D4JA 3IIJA 2PFOA 4IEIA 3FVQA 3B0XA 3QY0A 1DAGA 5DGXA 2V7QA 4PPXA 1NKTA 2Z5FA 1NJFA 3RRHA 3M4YA 4FXPA 2RGXA 4G0NA 1SHZA 4NYMR 3VR1A 2HCJB 1CJMA 1ZQOA 2ZJZA 2KZMA 1MABB 3LO5A 4PQYA 3SYNA 2V1UA 1GNQA 4HI0E 4BFTA 3BK7A 3I62A 3QKUA 4GOJA 4KTQA 1BKDR 4QGGA 3LWLA 4DFPA 2R65A 4FIDA 3Q5DA 4QM6A 3LQRA 3GJ8A 4KYUA 4D26A 4EQ6A 4PPGA 2GBLA 3GP8A 4P32A 3EPJA 1NK0A 5IHPA 1FQJA 4RD3A 1S0MA 2ZJBA 4L16A 3VQTA 4Z51A 3A6PC 5J2EA 2VHQA 2VBCA 2J0VA 3KJGA 1SKYE 1XEXB 3AQ4A 3ZDAA 7ICGA 2IUSA 1P73A 4JK1A 4KLIA 3H40A 3SOPA 4RNNA 1N56A 2JDID 3AVQA 1F3OA 1TQDA 3KXLA 3H86A 1JXMA 4B6EA 5F9HA 3SE0A 3PMLA 4DC9A 2CCJA 3GLHE 1NOMA 3H4MA 3T5JA 5KFDA 3HYRA 2GJKA 2NMVA 3QPVA 5TVKA 2BDTA 9ICRA 2JEJA 4UQGA 4FI3C 3CX7A 4Z6FA 4Q7MB 5KNBA 1F6BA 1TKDA 1Z00B 3CWZA 3JVVA 4DSNA 1JNYA 2YWEA 2P67A 4UJ5A 5FPSA 3RJJA 4QW8A 2QUZA 3L82B 1GITA 4DF4A 2LKDA 1E4YA 2BMEA 4HEJA 3ZGXA 5BN4A 3TE6A 2YOHA 2IYVA 5C2JB 4M21A 4ECSA 4ECQA 2R8RA 2A3RA 1S0VA 5IIMA 1W7AA 1HT1E 3GIMA 2WV9A 2NGRA 2BKEA 1TK5A 3KHHA 3A1TA 1P4SA 1XEWY 2SHKA 4F4YA 2C28A 4IR1A 3O47A 4JVMA 4N0EA 4B3XA 5LB4A 1EXMA 2VHCA 2IHYA 1RPLA 1GL9B 1P61B 1EX6A 2WPDA 2BCQA 4TURA 8ICMA 2GF9A 3C5GA 9ICPA 4LV8B 1S0NA 1M1YE 3T1QA 3Q85A 4J9RA 4Q47A 4Z1MA 4GBMA 2J7PD 3BQ0A 1JEEA 2BCGY 5JLJA 4MFFA 4IQVA 2XXAB 2CMKA 1M74A 4N0DA 1FPMA 2MSDB 4IOJA 1U8ZA 3WMGA 2ZAOA 4I28A 9ICGA 4F4CA 4MQBA 1ZYUA 4DL6A 3NHBA 1LB2B 1Q3TA 4R9UC 4FINA 3UANA 4PPNA 3I5XA 3LWMA 4B9LA 2QGNA 4RZUA 1G9XA 4Q4JA 4DCUA 5EJEA 4IRKA 4ZDJA 3PG5A 2IS6A 1ZUIA 4WVFA 1H38A 5JSZA 4KODA 4R98A 3LH5A 5LBIA 1ZQRA 5KSPA 3JPTA 3RJHA 1AS2A 4UNRA 5UKDA 2CBZA 8ICFA 4DOAA 2AD5A 4QZBA 2GCNA 5J5CA 3FGNA 4CZ2A 3K9HA 4O3OA 3GJ6A 4AIIA 3Q8PB 1E2IA 4F3OA 3QPUA 1N6KA 4DS5A 3NBYC 2IXGA 3SU8A 3FKQA 1XU4A 3T5LA 1AROP 4E0DA 4DLTA 3PUWA 2OBLA 2F55A 3BQTA 3N2EA 4YDSA 3HW8A 3RRGA 2QAGA 2FV8A 4URVR 1PLLA 2AGQA 4IDOA 4RZ2A 9ICHA 4B47A 4MFAA 4DLVA 4NCIA 1A4RA 2NTYC 3ZD9A 1BYUA 4Q5IA 2IMWP 1RYFA 4DLSA 1D2EA 3WBKA 2OCPA 2GJSA 4OHYA 4LCBA 1A82A 2Q9AA 5AR1A 3R9IA 2QPOA 4JUZA 1D9FA 1ZM2A 1UEJA 2WJGA 5H1YA 4M9HA 5TV2A 1NI3A 4IXMA 4I1VA 4LVSA 1UT5A 2OZEA 3MABA 2X8AA 3AVUA 1DS6A 4B6FA 2HHTA 2ZS9A 2AKYA 1D8YA 4IKEA 1IN8A 4JWNA 2DFKB 1N6OA 1XO1A 2UZIR 3EPHA 4F5QA 2O8EA 4P4TA 1DADA 1KYIA 3CUEF 2N1BA 1Z3IX 2D74A 1Y63A 2ZJOA 8ICEA 3GJ3A 4BFUA 2OCYC 3LLMA 1EXNA 2BMFA 3HU2A 1UBFA 4C8MA 4FO6A 4PFSA 5AJVB 4EJSA 2FG5A 3KFVA 3P32A 4K4IA 1IJFA 1E2JA 1XMJA 1KI3A 2CL7X 2WVJA 5J2JA 3ZIAD 1NMYA 4GC6A 5FPTA 2XGQA 1U8YA 1IN6A 4PSVA 1NBMA 1GAJA 1HH4A 2BOVA 2J45A 2Z6VA 4NU0A 1EG7A 8ICNA 1ZQPA 2BMJA 1QZXA 3FKSA 4C0LA 2FMSA 4TQUS 4O25A 2HVHA 5J0PA 4OHWA 1NKBA 5DB9A 1G1MA 2EFCB 5DO9A 3TUIC 3IM1A 1NLYA 4Q1EA 1CR0A 1ZD8A 2ODNA 4L9WA 3U7GA 4KJZA 4LPSA 2FMPA 4CVNA 3H4BA 2XB2A 3R9WA 2F1RA 3NIBA 3MLEA 4B76A 1CJKC 1J90A 1R2QA 2Q21A 1YE8A 2WSMA 2X1VA 4FN5A 4RCYA 2ZRDA 2J46A 2WMNB 3M1IA 5AJXA 3WP0A 2NQ2C 5L3VA 4FMDF 5JRJA 2R62A 3SC3A 4O3MA 3OSPA 2Z0MA 4JZKA 1KSGA 4LC0A 3TUZC 4NZYA 9ICVA 2CK3D 5DI3A 3ZQJA 1U0JA 5IILA 4M47A 8ICQA 5B58C 2FZLA 4C7OB 1Q3HA 1A7JA 1G16A 1CIPA 3M6AA 1OXVA 1NLZA 5KT7A 1HYQA 1U81A 2J41A 2NZJA 2P5SA 3MFIA 1XJCA 3BB4A 3DM9B 4OJKA 4AD8A 1NJGA 2PI5A 4Z6EA 5CA7A 2AK3A 1E2EA 2O5VA 2GJ9A 2YWHA 4HDCA 4TT3A 1W0KA 2OSBA 2F3RA 4B9MA 2FGJA 2AGOA 4P2HA 1E9AA 1F5NA 1UEIA 9ICBA 4Z6DA 2C9OA 3WNBA 1WMSA 3RR8A 4ARZA 3PUXA 9ICSA 3H8JA 5BWMA 5CM8B 4C0QC 1DBSA 2NO1A 3OHAA 1XC9A 3EA5A 5JSZB 3T5GA 1M8PA 7ICJA 2GHIA 2R6FA 2XCAA 1ZUNB 4UNSA 4M1TA 4UXHA 4BFVA 5IK2A 3PX6A 4B33A 3R20A 3RHFA 1AGRA 2BGWA 1LF0A 1E9RA 5F9NA 3EC1A 3KTAA 1N6LA 1COWA 2C9CA 1DG1G 4TMXA 4QGFA 4UAZA 2GETA 5FR2A 3TAPA 1X8JA 1Z08A 4GP7A 4XD7A 4DBLC 4A4DA 2ZTEA 1OXSC 4TUSA 2BJWA 3BGWA 4LYAA 4XWOA 4QZDA 2IYQA 3RRMA 3H7IA 3OIWA 2D3WA 4YQFA 1NK8A 2HT6A 3EAQA 2GKSA 5KFTA 1IN5A 2OCAA 2MMCA 2VTKA 1Z47A 2QMOA 8ICVA 1EX7A 3UKDA 1T0HB 1UKEA 1XPRA 5TY0A 1P72A 3GQBA 1KDHA 1DARA 3IHQB 3NH6A 1ZQLA 8ICJA 4B2PA 2W9MA 1OFHA 2W00A 4JBXA 3VAAA 3ZZ0A 2V6JA 4ZIRB 3QXSA 2A9KA 1YU9A 2QROA 2CCGA 3VNVA 3HP6A 3F3YA 1VMAA 2VSFA 4Q7JB 2PFNA 3BOSA 5HCIA 1LFDB 3KTQA 1ZCBA 2QE7D 2ZAMA 3QF4B 4MA4A 4Z8XA 4DDUA 1SKWA 2ZSFA 3RWOA 4QBIA 4HZIA 1TV9A 1KTVA 2O8EB 1RW4A 4N1AA 4TYQA 4B2LA 2JLZA 3FMOB 3PUZA 3THYA 3KQKA 3OESA 1ZQGA 9ICTA 4V0OA 2AXPA 1CEZA 3K0AA 5TXGA 1ZRHA 4EJSB 4PHEA 1W49A 3SFVA 1SXJA 4KITB 3MDAA 2VP6A 2PXIA 1DO0A 1ZQVA 2QM8A 3UMRA 2IS2A 4W7SA 7ICOA 4LHXA 4RD6A 1ZQXA 3ETLA 8ICTA 1TX4B 2W9CA 1E0JA 1XCGB 1YJ5A 2WM9B 1JB1A 2IYRA 4MRVA 4AKEA 4I2HA 4EBDA 1WDTA 2VP0A 3UIEA 4MDFA 3BJYA 1JX4A 1PJRA 4GI7A 5DSZA 2LCFA 3NXSA 5LB2A 4PGXA 4IQUA 4GT1A 1OH6A 2HVIA 4GP6A 3H8SA 4M9GA 3W8RA 3K8YA 3ZVMA 4UXIA 4EPVA 4C2UA 1E99A 2QP9X 2PJRA 4LHZA 5KHOC 4DSJA 4R8UA 4CCHA 1SKYB 2FFAA 1GIAA 1T8EA 3ONWA 4JLPA 1N6IA 3W3ZB 4TZ6A 1NK7A 3QE0A 4I4LA 7ICFA 3GLHB 3ICQB 3UMSA 4EEYA 1D6JA 1RFLA 4ESVA 4A1FA 4YONB 1X6VA 5DI3B 3ADDA 3FMIA 3O8BA 2OUKA 5KFUA 3OEHD 2RGAA 3FHOA 4TL8A 4Z8YA 5HPYB 2O8BA 4OI2A 3K4GA 2PFPA 4RSGA 5BXQC 2ZJ5A 3THVA 1N25A 1M6NA 1YZLA 1H8HA 3B6EA 4Q7KA 5CK5A 3SFZA 4QGAA 6Q21A 4YR2A 3QOFA 3BAFA 2NO0A 5GJVC 2GAOA 3CB4A 4D80A 3AF1A 4TSFD 5L1IA 5DIFA 4WZBE 2V54A 2YOFA 5IIOA 5J4HA 3SN6A 5L1JA 9ICXA 2C96A 5DBCA 5DBBA 1ONBA 2H17A 2VPPA 3D31A 3KX2A 1P7CA 1Q1BA 3BB1A 3CPJB 3BC1A 4O2LA 4LSGA 5EOZA 5KG2A 4QZIA 3O8RA 4CEHA 2MUTA 5KFAA 1N6PA 4XIGS 2C2RA 1U45A 4FWIB 1F2TA 3A1VA 4GOKA 4YXWA 1ZQKA 5JECA 3O8CA 4B9UA 2JLUA 1FZQA 1N48A 1KO4A 2OLJA 3DDCA 1ZBDA 4TUPA 3L0IB 4DVGA 5EWEA 1W0JD 2OCBA 1CULC 2ISOA 3CF2A 1U98A 2PFQA 4QHTA 5DQGA 1ANKA 3AEZA 4B44A 4HDOB 1OB2A 3C2MA 3BE4A 3NC0C 1BIFA 5C5JA 2FSHA 3A1WA 3L8ZA 5K8LA 4G3XA 2KSQA 1IY1A 4DQPA 2XSZA 5KT5A 4Q45A 2IXFA 4ED6A 1ZMXA 4BWJA 3PW4A 1QG2A 2CNWD 1XF9A 2QU8A 5BOLA 1S0UA 1NK9A 1NG1A 2H1LA 2HHXA 9ICUA 3U60B 4IDPA 2FZ4A 3K0FB 4NY8A 4YDHB 3Q7PA 1PV4A 4KLHA 4I1UA 4J9LA 3RVBA 2GZDA 2R6CA 4ZKEA 2G0TA 4YXMA 2ZYVX 5LDDC 5TMPA 4KCGA 4AI6A 1CR1A 2RDIA 4M9ZA 1II8A 5M04A 3WXMA 4EPRA 3RR7A 3R8CA 3PW2A 2WAXA 1ZQTA 1DPFA 3UWOA 3K09A 3P4YA 1KY3A 3QI2A 1UADA 4MH0R 4DL4A 4KLJA 4JL6A 4Q48A 7ICQA 3VKGA 1DOAA 4KFTA 2V9WA 1LNZA 4HUQA 2XTMA 2W0MA 4KLLA 3CNLA 3AF0A 4FCVA 4B2IA 4LZZA 5H68A 4OHVA 3NGDA 4Q4HA 4RQ0A 1V43A 3CF0A 2W6JA 4MYUA 3U7FB 2KBEA 2FPKA 4NLGA 3M8SA 1US8A 2WWWA 2W9CB 3BD9A 4A2QA 2R8IA 2V1XA 1X86B 3OE7D 3X1ZA 5JRZA 2C2DA 5E95A 1T3LA 3AM1A 2XZLA 3AKEA 4URXR 4CW7A 1AKYA 4J9NA 3M9OB 1ZU4A 4OQFA 1PZNA 4B71A 2GJAA 1SL0A 2ZR9A 2ZJ2A 2J87A 2CJWA 4IOMA 1WRBA 4RD4A 2RGCA 3EPGA 1YR9A 1SVSA 8ICBA 1TU4A 2JEIA 2RGNA 2Y1IA 1Q1EA 4LI0A 5G53C 4MDEA 2Z4RA 4EAQA 1MT0A 2JEOA 1C9KA 5HMLA 1TQ4A 3PIRA 1JR3E 1W36B 3DPUA 5E7IA 4F91B 1NN5A 1W2HA 2XCPA 3TLXA 4O0IA 4BPBA 2KB0A 1T3HA 3ASYA 1FX0A 2UVRA 4GOXA 4HSEA 5FOUA 3UG7A 2ERXA 2O8BB 1BPYA 3C5HA 4KLGA 2BCJQ 1X2IA 4RPYA 2QORA 3H1TA 3WRYC 1SGWA 3EARA 4I99A 2HLDD 4B75A 4V0NA 1XX6A 2PX0A 2QMHA 2XY5A 3CW2A 4DL3A 2ORVA 1JPNA 2KBFA 4QOSA 7ICRA 3K0EA 4BLQA 3IGFA 2ZSEA 3KKQA 3VTKA 4EFMA 1LVGA 4II7A 3RB6A 1ZP6A 8ICXA 3X1DA 4KSBA 1WCLA 1E9BA 5CHGA 5EE3A 4NCHA 4JWMA 3U3OA 4CEHB 3KXIA 1LS6A 1CJVC 2MUTB 4CDGA 4JYBA 3K70B 2RKOA 2UKDA 3LBIA 1QHXA 4JVNA 2A1JA 2IT1A 2XX3A 4NCJA 2CVFA 1MO4A 2JEGA 1L4YA 2C78A 2DPXA 2KZZA 5JWOA 1ELOA 2PEZA 4DS4A 2QPAA 1WBBA 3C21A 3Q8SB 4IFEA 3GEIA 4Q7LA 4Q8EA 2JZBA 1OXTA 1U0HC 1FNMA 4Y0AA 3U3MA 4DRZA 5DB8A 2BR0A 4BDPA 2VIIA 3FPAA 4GFDA 4A6XA 1C1YA 1T3NA 2HF9A 2PT5A 4LJ8A 2ZI4A 5FFMA 2V4QA 3C14C 4EUNA 1Z63A 3GFOA 1AIPA 2GVZC 4C0SA 3U3JA 4DSUA 2RB4A 1E2KA 1QDEA 5G40A 4XVRA 2RHDA 5J0UA 4PHTA 3AVOA 7ICPA 1M7HA 1OFTA 2EFHB 2F43A 3DKVA 3A37A 2NO7A 4NE2A 4MRSA 1GUAA 4ASUD 2QG6A 2V3CC 3NBFA 4ZO4A 1ZQUA 4M4SA 2B7CA 4P4SB 4Q1BA 5B57C 5EQTA 3VMFA 2JASA 5H8WA 3T1VA 3RH5A 3SZ2A 3LX5A 5JWRA 3RRYA 5LD2B 2C5LA 3AB3A 3MFHA 2XZOA 1NKSA 3ZVRA 1II8B 1Q12A 4DB4A 1GG2A 5C4MA 5HNKA 2ZUDA 3E2EA 2IWRA 4QWDA 1KK1A 1SVOA 1DTSA 1R0ZA 1T8UA 2BJVA 2BQUA 1AQUA 1VPLA 3T12A 4RNMA 2NOAA 3CO5A 4Q19A 3W5JA 1SVKA 3QF7A 2BVNA 4I2IA 1I4LD 2XB4A 4A0HA 2RGDA 5JMTA 5BQ5A 1YZGA 4RNOA 5J2AA 5L1LA 1WF3A 2VANA 1Z6YA 3D6TB 4QZ8A 3UPQA 3HR7A 3MJRA 4DIEA 5BW8A 4F4KA 3IILA 5P21A 2WJYA 4Q4HB 4K4HA 3BRWD 5CK4A 3DZDA 1NVXQ 4HUTA 2AL7A 4A36A 2W9BB 2PLRA 2A7QA 5E4FA 5EE0A 1MQ3A 1R4AA 121PA 1Z2AA 3B5JA 1FOEB 4QZAA 1US8B 2ZXUA 4F2RA 3C1ZA 4RCZA 4DDVA 3BORA 2QAJA 3AUYA 2FMQA 1RPZA 5KFHA 3H0KA 1OJLA 2NPFA 1HUZA 3R7WB 3S1AA 1VG8A 3VR5A 3SJBA 1AJEA 1LS1A 3RBEA 3I32A 1CF4A 2VF7A 5FUXA 2Z83A 4ZDIA 2W9AA 5J0OA 3AF2A 3LW8A 3CRRA 1QHIA 1W4AA 4K4GA 2DFNA 4RD0A 4BZQA 1XTJA 1ZQWA 2WTFA 1N5LA 1YVDA 1TVAA 4GRAA 3HP1A 4O3QA 4O3NA 2WKPA 5AJWA 3FOZA 4DJTA 4L9SA 1ZQZA 2ZR0A 3RTVA 1AGPA 3VU9B 4RQ8A 4HLUA 1E2QA 4AKIA 2WWXA 4CEIB 1KJWA 2R6GA 1N6NA 1XTKA 1NSFA 2ZUCA 1HQCA 2GTPA 3GJ4A 2NG1A 4URYR 1PVOA 5CLQA 1TEXA 4NLKA 2Q9CA 1KDRA 3CRW1 2WWGA 4PAMA 1EFUA 5BN5A 4C9BA 1RYSA 5IF9A 2J0UA 3SJZA 2AHOA 1HA3A 1U90A 4US0R 1KSFX 3QJYA 5FR1A 1HURA 2W2TA 4LC1A 4QNMA 4URZR 3W6OA 9ICWA 2C77A 5ANRB 2AFHE 3VX3A 2FFBA 4R2HA 1MKYA 4W5WA 1JBKA 2AFIE 1G64A 4ZCLA 4JLOA 2FX3A 3ZJYA 5K8TA 4EZ6A 2A1JB 1ZQYA 1RYRA 1L2TA 1G5TA 5J4YA 5A0FA 5IIJA 3C5FA 3B1VA 4CIDA 5GJWC 2JLYA 5BPCA 3IHLA 1U48A 1IONA 4OI1A 1G8YA 3T5DA 1TQ2A 2BM1A 2WMOB 3V7JA 1RXWA 1M2OB 2D2EA 5FOXA 4MF2A 4XWAA 1K8RA 2HHVA 2H92A 4GMXA 3IIMA 2BIFA 3WHKA 1CUKA 3CPEA 5C1BA 1KI9A 4DB2A 1BO6A 1L8QA 2F43B 3OJUA 1XMVA 2RCNA 1SVIA 1NVUQ 2OG2A 4B32A 5JCPA 3PR5B 1S0OA 1S77D 5D3MA 2IK8A 4R65A 1DO2A 1E2DA 1KY2A 3WBJA 1JXEA 4I81A 2OBMA 2W0SA 4FMBB 3MAAC 2W83A 2YINC 1UBCA 3MSXA 4TLEA 1UKYA 1NBME 3GLFA 4QWAA 5KDOA 4DQSA 1C7YA 2QAGC 3OJSA 1G8GA 1VKJA 3BFVA 4MYTA 3KJEA 2QSZA 7ICNA 1Z0IA 3UXMA 4ILEA 1KI4A 2V4ZA 3ZD7A 5JI3E 1E1RD 1EESA 1J8MF 2A5FA 2BCSA 4G5RA 3K0CA 2J59A 4TYYA 3UQ0A 2HXYA 4P3YA 2D4HA 4UQOA 4GXJA 5B2ZA 3VHXA 2HT1A 2A5DA 3X1XA 2IHNA 1DAEA 1DAIA 1G7TA 1Z28A 3C41J 4NP6A 2QY9A 5HHHA 4IRUB 4B3DA 5KTYA 2GILA 4LDJA 2RGBA 4MGKR 1GP2A 4F93B 3G0HA 2IHMA 4HAYA 5J0XA 2ZRHA 4BWMA 3T34A 2I1VB 3BIFA 2D7DA 3PR1A 4I1OA 3RC3A 1UDWA 1Z22A 3ZDEA 2F3TA 1MC8A 2LYHA 4JIMA 3CR8A 3QKSA 3PQCA 3S1AB 4B35A 1E4VA 1G8FA 2IXEA 4DLGA 1XSPA 1S97A 1HUQA 4BGDA 4D4LA 2FEMA 4QWEA 1ZQAA 4I2AA 3KKNA 1CLUA 4DQQA 4LBYA 1QBKC 1O87A 4EJSC 3KQNA 4D0LB 3PFIA 2IUTA 1J99A 3CR7A 2D62A 3L8YA 4OKSA 2QT1A 2JJ2A 5L3RA 1KOFA 2XOKD 2L0XA 4WZAE 2JLSA 2GCOB 1VHLA 4DSKA 1ZUHA 4O2RA 1CJTC 3PVSA 5DN6A 2H18A 5AUOB 4F92B 3V6KA 4M1MA 5DG9A 2CEAA 3U7EB 4A0GA 2BCVA 1WB9A 9ICFA 4GNKA 2ZPTX 3VR6A 3C16C 2GA8A 1CEEA 5L8VA 5DG7A 5J4KA 2FLLA 3IDQA 4I2EA 1E2NA 1T6NA 1GSIA 3Q5EA 2ZREA 5J0YA 4QWCA 4O5KA 1J7KA 4KU4A 1KAGA 3B82A 2J0UB 2WWFA 5JHHB 1TAQA 3QSYA 3KHLA 4OK5A 5CJ7A 1XD2A 3DHWC 3T35A 2FPMA 3UWKA 1OKKD 1BGXT 1J70A 3LNCA 4Q44A 4JS0A 3BFXA 3LWNA 2FF7A 4YMNA 1QF9A 4DSEA 3ZS9A 1KJZA 1A77A 4I2FA 1KI1A 1WBDA 1TPZA 1NG9A 1RRCA 1TTTA 2BCUA 2OFOA 5CIQA 5J2IA 5CB1A 2GJ8A 5DQIA 4LBZA 3MR2A 1KK2A 4Q02A 4QFMA 1P2VA 3UATA 4Z6CA 5KFBA 1R6BX 3CIOA 2Q3FA 3G82C 4S35A 4DWJA 2H57A 3RSOA 1EFHA 5HHIA 3AU2A 2PLFA 2C2EA 4QZ9A 1ESMA 8ICAA 2D06A 2QENA 4DFMA 3RS5A 3HT3A 1QHYA 3FHCB 5TDHA 3GV8B 1LTQA 3CLVA 3IUYA 3P1JA 4UKDA 1NSTA 4UB4A 5K8UA 5HE8A 5EWFA 3QKRA 5FH9A 1CP2A 3OFND 2ISPA 2AKAB 2FJUA 1OT3A 1KKLA 3FYHA 2DYKA 3VKWA 4M22A 2ZSAA 2W2XA 5JZVA 4JKYA 3JPQA 5KFXA 1P5ZB 4ZH4A 5D3MB 5H70A 4US2R 1BMFD 1JAIA 1NMZA 2Q3MA 4V0KA 2J0SA 1UKVY 2JIZD 4RQ6A 3QG5A 1SXJE 4QBHA 5JJKA 2NRXA 3GLIE 4KLEA 2RHMA 3CNNA 1N0UA 1R10A 5GJCA 2RDJA 1NK5A 4TL7A 5JUMA 2QPTA 2P6UA 1R8SA 3ZD8A 3NBZC 4UB1A 9ICOA 3GFTA 4OYHA 4DFKA 3RRZA 1KSHA 2YWFA 2G0NA 2P5TB 4D25A 4LRWA 2ZIAA 2ORIA 3OAAA 1IM4A 4EQ6B 4HAUA 5JS8A 1G3QA 1X8KA 1OIWA 2V8OA 4ECWA 2XAUA 3K9GA 4R64A 3NH9A 3CONA 4BFYA 3OF5A 1B22A 3TRFA 4P4MA 5BOMA 1NN0A 2JJ1A 4PHFA 521PA 1A76A 2OFWA 2J3EA 1S9FA 1JR3D 2HJGA 4DT1A 2YKGA 4PQRA 1JIHA 4ELVA 2HV8A 3ZH9B 3I5YA 3ZS8A 2QN6A 2AQ4A 2VYFA 3CM0A 3RS3A 9ICJA 3KL4A 4ACAA 3QKSB 1XFAA 2FOLA 3RC8A 1EK0A 1Z83A 1OHHD 4Q4LA 4JV0A 4FD2A 4A82A 1BVSA 2ZRAA 4NDZA 3G6VA 3TW4A 3GD7A 4NH0A 3LXXA 3PX4A 1BPBA 1XMSA 5D46A 4G5OA 4TTPA 4MEXA 1SXJC 3L0OA 3D8BA 1LW7A 5J4LA 2YOGA 1Q21A 1G7SA 3JPOA 4G5SA 2EFEB 5DH9A 3T61A 4D82A 1LF5A 4GL2A 1JPJA 1H8ED 4X8LA 4B9SA 2FSGA 2ZYWX 4KLFA 1HTWA 4RQ3A 1ZNXA 1QSSA 2A5JA 4M9LA 1L3UA 1UFQA 2F7SA 3D7MA 3I8XA 4IEEA 3ZLJA 1D9XA 2EW1A 4PAQA 3C8UA 3SI8A 3P27A 4CT4B 3TR5A 4FS1A 4POAA 4TTQA 1OH5A 2ODBA 2VA2A 1X9MA 1EGAA 2BQRA 5FBRB 3V7LA 3IIKA 1XD2B 3ISCA 4LZGA 4YR0A 4MGIR 4GXIA 1E79A 1AKEA 3L43A 1Z6AA 4JT4A 4K81B 4Z54A 3BH7A 4TL6A 3MWLA 3U6KA 1ZQMA 4JLAA 1RJ9A 4JJKA 5DNYB 1W36C 4NLZA 2VP2A 4D0NA 2VSOA 4HB2A 4ERNA 3ND9A 5IIIA 4B48A 4C2TA 4Q4JB 2ZRBA 1II0A 1MR3F 2RGGA 2IYSA 4M2YA 2J6UA 4BZXA 1KKMA 4OL0A 4A92A 1P9RA 3RAQA 1E9FA 1NN1A 8ICIA 1JN3A 1SKRA 4YMVA 2WSSA 2PZGA 4QHSA 3IQWA 1UT8A 1L3TA 1N3BA 5IT5A 1TK8A 4QBGB 1OB5A 4HAXA 1IOZA 4FMDB 2BKUA 2ONKA 1S8FA 4J9OA 3LBHA 3PEVA 4PGYA 8ICPA 3WRXC 3M0EA 4U00A 4O5EA 2V9PA 1W5TA 2AX4A 3BH6A 4KN4A 4ZCIA 2XTNA 3N5CA 2J6TA 1ZC4A 4US1R 5DHAA 5CITA 3K70C 1HE8B 1BPXA 1QVRA 4XTRA 3TUJC 2QAGB 4MGYR 1MRNA 2XNDD 5E3HA 4DLRA 4EPYA 2AJQA 2ZYTX 3ADBA 1Q22A 3RSLA 5E7JA 2W58A 2GNOA 4MUAA 2YC4C 1TUIA 5KG5A 4GXKA 1GWNA 1YZKA 1UPTA 4XTCS 4EYIB 3ZDCA 5AUQA 4D2IA 3V4RA 4UAYA 4YD1A 3KKPA 1QHHA 4DEXA 2NO9A 5C4GB 5J2CA 2P66A 4B9TA 3RYTC 3OE7A 3ZVLA 4NM2A 2WWIA 3PW0A 5G41A 3SV4A 4Z1MD 4A6PA 4UNPA 2FGKA 2CHGA 4DEZA 2DPJA 2GXQA 3V00A 3W6NA 4PTLA 4RZXA 2N46A 3AVTA 1OYWA 3SBDA 3LLUA 3GCGA 3QXJA 4WIAA 3ZDQA 3PUYA 4UB2A 3IO5A 4D6PA 3BB3A 4RKEA 4F4WA 5J0TA 3MR3A 1ZM3A 1BYIA 4DHEA 2X19A 4QHYA 1IXZA 2F6RA 2WOOA 2FFQA 1GRNA 5LD2C 3M9MB 7ICIA 4AG5A 3N4MB 5F9LA 1G3MA 5HCNA 4DT1B 3RANA 2AN9A 4KO8A 1IXSB 1XCPA 2V4RA 1KHTA 2CVHA 2OXRA 3QUSA 1E2PA 4C0KA 3GLIA 4DEYA 4ED1A 3U2QA 1EWQA 4F5NA 1G3IA 3K09C 2GEVA 1VCIA 4JSYA 4UB3A 4IRDA 1U9IA 2VO1A 5KG7A 2R2AA 4KFSA 1P62B 4ON9A 2GWHA 3W90A 4BRUA 1E9DA 2ZJYA 5FOSA 3JPSA 2ZSBA 5TB5A 5KFMA 4D81A 5DGAA 4I2BA 2EVWX 3JZMA 4M53A 1AS3A 1OPXA 4TUQA 1HUOA 5HP4A 1EFRA 4DL5A 1NK4A 4FBTA 4DSLA 5A5GA 3KUDA 3OZXA 5EXPA 5DB7A 1U94A 1Z07A 1P2SA 5L9XA 2BEKA 1Z5ZA 2ZE8A 3WNDA 2QL6A 4RD2A 4KLMA 4DOBA 2EYQA 4DSFA 3VHLB 4MUBA 1ZQNA 3C4JA 3DM5A 4B9VA 4KFRA 3SEAA 2DY1A 4PPQA 4TWZA 4RQ4A 4PZLA 4IQTA 1E69A 3X1WA 5KTQA 2QP3A 3FWYA 2PZFA 2A2ZA 3V72A 1QRAA 3B9PA 4LK2A 4M0AA 3ICEA 1NN3A 3OEEA 1JJVA 4OQLA 2ZVPX 3MR5A 4Q43A 1KI8A 2RGNC 3KKMA 3P4XA 5EUMA 2IWHA 5KNCA 3MWYW 3THXA 2E87A 3C1YA 1EFTA 2JAQA 3E1SA 5GVRA 1X9WA 1VIYA 1RJ9B 2JLRA 3GFPA 2HUPA 3RH4A 1XP8A 4QZGA 2OM2A 2VLIA 8ICSA 4EDHA 4RPXA 2DBYA 5J2HA 3C23A 3MCAA 5KNDA 3RLFA 1NIPA 1K1QA 2KJQA 3WMEA 4ASUA 3B7GA 3B9QA 4UJ3A 4ARZB 4BRWA 3GIIA 3Q8KA 1OLOA 3PENA 2EU8A 2Q9BA 2I3BA 4OK6A 1L4UA 4QXAA 2ATLA 1E94E 1G4UR 1N6HA 2ZJ8A 1Q0UA 3DZ8A 3LX8A 2C99A 3X2SA 4LHYA 3QNUA 2OWOA 4RD1A 1E1QA 1NBMD 4MYHA 2J5XA 1OXXK 2O0KA 5JEDA 3FKSD 2DCUA 1AN0A 1AS0A 3KTAB 1RRGA 4PH5A 4GZMA 4RVCA 5DDMA 2W6IA 2CLCX 2GZHA 4O3PA 1ZIPA 5A4JA 1HV8A 2IX3A 4PC6A 3MGHA 4PHGA 1IAQA 2QMUA 1Q20A 8ICKA 3W9YA 2F1JA 4XH9B 2ZE5A 2N42A 3B1ZA 4FWTA 1ZM7A 4UNNA 1GZSA 4I1SA 3AP1A 3FFAA 3KQUA 4C8LA 3QXHA 2JATA 3UPUA 4BXOA 1Z0FA 1ZM4A 1QHHB 1WA5A 3T5KA 2CLDX 1QHSA 4DL7A 3ISBA 2V55B 3GEHA 4Q9LA 5EP1A 1HY3A 1IXRA 4B3BA 4E22A 5FUVA 1X9SA 5KFQA 3A4MA 2HF8A 1D8LA 2UVWA 4BASA 3AGQA 5KFFA 8ICLA 3AF3A 3TVTA 3U6BA 1LB1B 2KWIA 3W3AA 4JSTA 1AQYA 1T5LA 2VHJA 4A8JA 1T5IA 4U7DA 2VA3A 2A30A 5SZKB 4WZ6A 2ZU6A 3DKPA 4EPXA 1KSPA 3MG9A 5BYKA 1IHUA 4RQ5A 1E0KA 2VH5R 1GFIA 3Q9LA 1W0KD 4OI0A 4JV1A 4BFXA 1IN7A 3THYB 5EZ6B 5KO2A 3SQXA 3EZ6A 3K0AB 5EP3A 5C46F 5CLLA 1G21E 4RFVA 4OK3A 1SXJB 1TQ6A 4WXPA 1AZTA 3A58B 1JXOA 1VECA 2YC2C 3GLIB 1XTQA 3BBPA 3KQHA 1OH7A 1JAHA 5IK2D 3THOA 1SVMA 1ZQQA 2LKCA 1DG3A 4RQ1A 1S96A 3TMKA 1GRQA 2ZRNA 3H2YA 4LY6A 5CJPA 3TQ1A 4X5VA 4DKXA 1Z29A 1COWD 3CRVA 3LV8A 3LA6A 4MITA 3LVQE 3L0PA 3ADKA 2FLPA 1FTNA 4XD7D 4HLDA 2OV2A 1NJXA 4W5HA 4ZPXA 3PMNA 2OFXA 2XNSA 2ZEJA 1W1WA 4JV2A 5FL7A 3I61A 3N70A 1SKSA 2QRZA 5HKKA 1ZYQA 2ZU0C 5DB6A 2MAXA 4R8UB 4N3NA 5FTLA 1ZINA 5KDDA 5J0QA 2BWJA 1XTSA 5D49A 3KDSE 2ZRLA 4MRNA 4M1SA 1AM4D 2ECKA 4BLPA 4Q9KA 1ZETA 4IRCA 2ZI5A 5F98A 5DHFA 1IJEA 2JGNA 4KV9A 2XJ4A 4TQRA 5SZIA 3AGPA 4DSIA 3CH4B 2PL3A 4DWIA 1JQLB 1VYTA 5EUQB 2MSEB 1K6MA 9ICAA 3IKJA 2WJHA 4ELTA 4KBFA 1Z3EB 1UA1A 5DG8A 2GWSA 4ELUA 4A2WA 2CCKA 1RRFA 3PITA 4QM7A 4PSKA 4KLDA 3F5FA 4DUGA 2P65A 4HLUC 3PJRA 1GILA 1K5GA 3SYKA 2P6RA 4M1KA 4C0AC 5KSOA 1G7CA 2IYWA 4PC7A 1MOZA 4P0TA 1WP9A 1HQYE 4KN7A 1GL6A 1KDTA 4A9AA 1T7PA 4J9PA 1SXJD 5J47A 2FU5C 4PO9A 4C0BA 4ED0A 3T5HA 1OYYA 4YR3A 2BM0A 4MRPA 4PC3A 2HHUA 4V03A 5FTNA 1F2TB 4PHPA 4IHQA 2PT7A 3IPXA 1V9PA 1R0YA 1D2NA 3IEVA 7ICSA 1ZQIA 3NHAA 5L3QA 2ZRCA 3GLFE 1B23P 4IXNA 4YP3A 2CL0X 3RS0A 4OQMA 2NRTA 4KLTA 7ICUA 1E1RA 2ZS7A 4WA7A 1C4OA 1R5OA 1TF7A 2IS4A 2IYTA 2QBYA 3SHWA 4QWBA 1FP7A 2CL6X 1KTQA 3HPOA 4G01B 1W5SA 4KAXA 4TQAA 2ZRJA 4FMCF 2ALZA 5J29A 1WQ1R 1KI7A 1TUEA 1R7RA 2WWHA 3REFA 4BXOB 2LWIA 2OO7A 2ZI7A 1Q1QA 4B3FX 4IOLA 3T3FA 2JDIA 1W36D 4KLQA 1VIAA 3THWA 2VQSA 2HCBA 5J2FA 3PNCA 1ZQCA 1W4BA 4H1UA 2BPCA 4CEJA 4TYWA 2BDPA 1D2MA 1N2CE 1SVLA 4PANA 3GLGA 4YMOA 3ZDBA 3PVXA 3B1WA 2OE2A 1XJQA
chains in the Genus database with same CATH superfamily
2E9SA 4EYQA 3BJIC 3GO4A 3HRHA 1OV4A 2VDUE 1MG0A 3HMKA 5AXAA 2KX7A 1L5HA 3JPRA 3VH4A 2G5CA 1BD3A 3TLAA 4DO9A 1XAJA 5CXXA 4DIDA 1T9KA 4IIEA 1QB7A 5JSYA 4C22A 2IYZA 2I5PO 1IWOA 2NU6A 4MRAA 3KHRA 4NC9A 2CDRA 4FB4A 2XYRA 4BV2A 4ZD6A 1FCJA 2QV0A 3JZFA 3VBEA 4I3FA 1A0OA 4JDPA 4RY2A 3P2JA 4ID9A 1ADFA 4H6XA 3V55A 1PD1A 1O08A 4F71A 3M1AA 4JUCA 1T2UA 5A4MS 1X8LA 1CUSA 5F76A 3BICA 2RGWA 3THWB 2DM6A 3DD5A 1QG6A 1SVWA 2J6BA 2AWNA 4KPEC 3QFFA 1LD3A 4IF4A 5HZKA 2GFHA 3L06A 4NHEA 1GN8A 1T0UA 2QLLA 3GRFA 4XM2A 1CSEE 2J48A 1KQPA 3THSA 3VX4A 3S70A 1P1HA 1QTMA 1WWVA 4QULA 4B84A 3CW9A 1GNRA 1L5MA 1A9ZA 1H69A 4OUDA 3K2IA 2WHYA 1TCVA 2MJLA 3AUFA 3LUPA 4AC9A 3OJLA 5GM2A 1YR6A 1P17A 1SQSA 1DELA 2FPPA 1ZOLA 4W1QA 4ED3A 3IPAA 4QYWA 2DECA 4NQRA 2PL9A 4PN7A 2CD9A 3P7MA 1KNXA 3MTIA 1Q3VA 3RK0A 1U8AA 4FR0A 4ZDWA 3ZLBA 4ESEA 1F5SA 5T7BA 2QB0B 5ETJA 1ORTA 3BL5A 1O8BA 2BFDB 2B8JA 2AMJA 3MWEA 4BLSA 1BEEA 2XVAA 1KU6A 4II2A 5ES3A 2XQFA 1FRVA 4NBUA 5DQHA 3UWOA 4JR2A 4PC1A 1N0WA 2L82A 2ODQA 1YKSA 2H51A 4RTNA 5AHOA 1KI2A 3FMGA 4NLCA 2HWUA 3A3OA 1FJ2A 4YGYA 3DP7A 4DV5B 1M3SA 1E2FA 2IOFK 1THZA 1F0MA 3JARA 2EBWA 1NX9A 2WUFA 3T95A 3OQNA 4HDSB 5EL0A 4TSFA 4KIFA 5H2FU 4JLJA 2QZJA 1BS1A 2P5YA 2D2XA 4URUR 1DU4A 2AR7A 5IABA 2C0CA 4LWOA 3S27A 4GMDA 4QNRA 4PLVA 3Q8MA 4GC5A 5G4KA 2M2IA 2G9NA 2CNWA 2KK0A 4MUYA 4G24A 5DBAA 2NM0A 3H1BA 5I9NA 4OHFA 2QY6A 3GEDA 3Q72A 1SXIA 1KVQA 4J4BA 2EFGA 2MYUA 3LDGA 4NLNA 5LA6A 4DLXA 2AXNA 4WBXC 3IMKA 1JLMA 2EJUA 2E21A 4UNIA 4TS3A 3F67A 3CV3A 3FLBA 4HK4A 5JZ9A 5GMOA 3P9KA 5EUCA 3ZTYA 1T25A 3RRJA 4C30A 3I45A 2AF4C 4KDCA 1GPMA 2XQGA 2OAP1 1U6JA 3OLQA 4X8MA 2HU5A 1TVCA 1TXGA 2IZ7A 4BWYA 4I1IA 3EMBA 3SLGA 4LEIA 4E32A 3GJ0A 5KYKA 2QTTA 2ACWA 2OEPA 1F2UA 2P3SA 4H0CA 2YWGA 3BAZA 5F64A 4KW7A 1ZIYA 3AOEA 3O4RA 4OJMX 3TI0A 3BS5A 3QBTA 3T7RA 1R12A 1MP0A 2DWPA 1FFDA 3QWAA 5JZMA 2R1UA 4AJ4A 4FHGA 5JXHA 3K6SB 1ZXIA 4HEQA 1Z4IA 4QL3A 1N7JA 4MR9A 2PQ6A 1NQAO 4DRXA 5CCEA 3WQSB 2J7KA 2WV7A 1KK0A 3TW0A 3WK9A 1ZM9A 3LD9A 4P4LA 3DV0A 3WG9A 3G79A 1KE2A 2B21A 4NEHB 1U0OC 3S29A 4ED2A 2HRQA 4WH0A 5J2TA 3G6YA 2OV3A 2XVTA 2GEFA 1VE3A 3MDCA 2B7BA 5EWMB 2FKNA 2WU0A 2C03A 1E3SA 2FW0A 2M1XA 1X3SA 2ODGA 1J0EA 1L1EA 4GI5A 4RHYA 1EUQA 1WOYA 2QD3A 1R9MA 4YUWA 3IQXA 2I1QA 4F2PA 3VDXA 4CIYA 4JBWA 1SBCA 3K9QO 2YVLA 1YONA 3UCFA 4MS4B 4C7MA 1HLGA 1IY9A 1SV4A 3FDSA 4ARVA 2BFBA 3C29A 3U3RA 3M6MD 5JTTA 4YI3A 4EG3A 1Z2OX 3NO4A 4HZUA 4LBVA 1VCNA 4RGQA 4YLGA 3OIDA 3DFMA 4GM0A 3AI7A 1ZCJA 4BX8A 1XS9D 1ZJMA 2ZIUB 1IVNA 2G1JA 2ZYIA 3SWWA 1RYUA 2DX7A 3NDPA 1G2OA 3PQFA 4YJKA 1ZD1A 3CVVA 1AUVA 1QO0D 1GNPA 4GC7A 4M0FA 3W0LB 1KEEA 2D5AA 3CLUD 5JOQA 3BS4A 4MYSA 4EVRA 1T9BA 4MPTA 4LV6A 1AO3A 3VU9A 1ZXLA 3H0RB 1NVFA 3KOOA 1ZVQA 3AKDA 1KMHA 3N2IA 3WJ2A 4WXHA 4RT2A 5ITSA 3JYOA 4PQFA 1N4AA 4DGQA 1UBGA 4PS0A 3CRQA 2A94A 2CVZA 2YIVX 4B83A 3GDOA 5KKNB 1ZSNA 4TLDA 3B0YA 3TR0A 4D41A 2XWSA 3Q8QB 2W42A 1AUQA 4KN8A 1RYMA 2CDAA 4MW0A 2ADOA 4E4RA 4M1QA 1WNTA 3DEEA 1G5RA 4Q15A 4L8LA 3VYWA 3GB9A 5JTIA 4RUCA 5DGTA 2FMHA 3IP4B 4JT2A 4DYVA 1ZJNA 1B0UA 2XT6A 4W99A 5IM4A 3KYJB 3E2IA 1GEGA 1USWA 3DEIA 2VP3A 3KHSA 1UKBA 4IJUA 5AD1A 4MHOA 3MILA 1U2RA 1U0TA 2BE7A 1XV5A 1WE2A 1G5HA 4EMUA 4ECYA 4BUJA 4DLWA 1T9GR 4IVRA 2X5JO 3WRYA 2GCOA 4B81A 3CH6A 3RIHA 1ZNQO 5HJ7A 4W1RA 1PU2A 3TFRA 1NBHA 2H4YA 2HFJA 3QEJA 4OF4A 3VC8A 1C7RA 1RWBA 3DNFA 3U7RA 2XCRB 4EY4A 2ZWOA 5JCOA 2AOTA 2IOYA 3ANXA 4QQRA 3E2MA 1QAQA 3IJPA 2BDEA 3VDRA 5IUJC 4TTAA 2TS1A 3EXFB 1PJ2A 5EKTA 3HPQA 2F2AB 5B7NA 2EKQA 4ZRMA 3LO5A 2FEAA 1BKDR 3GMSA 2YWCA 4S0XA 3GP8A 1RM6C 4BB9A 2VBCA 5LQSA 3T5JA 3HYRA 5FWYA 3RPEA 3H0MB 5IDWA 5BN4A 3TE6A 3W8DA 2WV9A 1TK5A 2P7IA 3HG7A 3GUZA 3X1MA 2PX5A 2XMBA 2IHYA 1F51E 3GAMA 4LV8B 3T1QA 4M86A 4NESA 3BQ0A 5JLAA 3UH0A 4RVSA 4XPZA 1MVLA 4F4CA 1ZYUA 3E23A 2Y66A 1Q3TA 4RZUA 2MU1A 3BRSA 3QH4A 3T4UA 5DM2A 1XE3A 3BF7A 1H66A 1H2BA 1LJ8A 2IXGA 3DQPA 5C7IO 3ND6A 1AKVA 3FNQA 4MFAA 1C7ZA 4G67A 3K73O 1L3CA 1GTZA 3FMVA 2FQWA 1A88A 1ZM2A 5MFPA 3NHLA 3M1YA 3ZBTA 2RHFA 4LY3A 4E5SA 3H87A 8ICEA 1KARA 1MORA 1IJFA 5F78A 2X58A 3RLIA 4OHMA 4ZVRA 2FZ5A 5CXSA 1QZXA 3HY4A 4IAOA 2P4HX 5EEHA 5DO9A 1ZD8A 3W2EA 5CTJA 1SB8A 2HV9A 2JFVA 2QDXA 4CMIA 4DLPA 4JWKA 2K8BB 4X45A 4NVRA 3W9UA 4YJ2A 4ZTUB 1NZFA 3TUZC 3ZK8A 5DI3A 1A7JA 4NECA 2NZJA 2OC4A 5HFAA 1QYCA 4JP5A 1B73A 1W0KA 2IZ6A 4Z6DA 5F4BA 3ZBPA 1D4ZA 2FHSA 4JVOA 5IZCA 3EA5A 5JFTA 2KSOA 3VR6D 2AOVA 3RFFA 2BGWA 3KTAA 1N6LA 1ZK0A 4PCLA 4DBLC 4CJXA 4XD7A 1SJ9A 2GBCA 4M54A 3UB3A 4P3NA 5FLEX 3NTOA 4WLNA 1P8JA 2GKSA 1IN5A 1ZCZA 3W8FA 2MMCA 5EIEA 4B2PA 2Q8QA 1ZQLA 1OFHA 1VLLA 1TVMA 1VMAA 4G0XA 5K2OA 2ZAMA 4PZNA 1N75A 5JS1A 2PRSA 2G8LA 5P8WA 2QF7A 5JY6A 3OESA 5I9MA 3RVJA 4MW7A 2IS2A 2ONYA 1JB1A 4MDFA 4EGJA 5DSZA 2WFMA 4ENSA 1V16A 2QP9X 4CCHA 4MR7B 2MINA 7ICFA 4MZXA 4YONB 1X6VA 3EDRA 2NW6A 1CUGA 2OUKA 2O8BA 5CK5A 4FUTA 2I2DA 1I5RA 2VPPA 4QZIA 4H7DA 4FWIB 3TLBA 1W52X 1WTAA 5HZGA 1LFAA 5E2BA 2IZZA 3OF3A 3C3EA 3V4OA 3ETJA 5DEIA 4MUFA 4NY8A 1PJBA 2JGDB 2YNMC 3GDWA 1WJGA 3GW8A 4M46A 4MAAA 2W2LA 4KLLA 4OHVA 3NGDA 2HLPA 3IULA 4EYEA 1K27A 1MEEA 4C7YA 4WVLA 1X86B 2WD7A 3VNQA 4CW7A 1AKYA 2XCTB 5C1PA 1WOMA 1EFKA 3ONDA 2XE4A 5G53C 3HQ4O 3OE4A 3OZ7A 2EWMA 2CFRA 1C1DA 3WZ2A 2HZBA 1ZN8A 1TO1E 1EFPB 3K8ZA 1JSXA 4ZO7A 4EELA 3RB6A 1J25A 1R37A 1E9BA 1RNLA 3HKCB 5I51A 1F17A 4RACA 1SBNE 4LYYA 4RF5A 3PICA 5IWAB 1BHSA 2A9OA 4Y0AA 4A6XA 2KS6A 4CMHA 4RELA 1L5QA 3NEAA 3DKVA 4MRSA 2QG6A 3ENWA 2B7CA 2IE8A 3RH5A 3LX5A 4OV6B 1JLHA 4RM2A 1Q12A 1MFPA 4UMEA 4UUBA 3JW8A 1AQUA 5FWXA 1Q0TA 2XB4A 2VK8A 1W59A 3I4CA 3L92A 2H48A 3RAGA 5J2AA 3MJRA 1Q5PA 2H3IA 4PX2A 4LQCA 4HUTA 1GNSA 3DZDA 3H1FA 4D3XA 5EE0A 4X1KA 121PA 2QAJA 1FQOA 3KALA 3FA2A 3MQ4A 2ZPUA 5A9SA 1BVUA 3CRRA 3G49A 4PG4A 4E11A 2VJBA 2G9RA 1T1RA 3SM9A 3EFOB 1U1EA 1PVOA 3LKBA 2Y9PB 4JXZA 3M5PA 2UUPA 3ETCA 5IF9A 2CKMA 1Y7PA 3KV1A 3CE6A 2C77A 2GD1O 2PX8A 2FX3A 4UCXA 2RI1A 5JC8A 4KR9A 1YS9A 3H2BA 4UU1A 4TTIA 2CNKA 3LK6A 4UD6A 4OFWA 3KQVA 3G85A 4WZBB 5AXDA 3QA3E 3PI6A 1UAGA 3VPAA 4ZOLB 3WLAA 3GL9A 2W83A 4KRFA 3NVYA 5KKCA 2WAMA 7ICNA 4X41A 1PEYA 1KI4A 4OLBA 4JBIA 2FSPA 3X1XA 3C41J 4IRUB 4BTLA 1EM8A 4RWEA 2IHMA 3LRXA 2TMYA 1E6MA 5EZYA 4YLEA 4NU5A 1BQEA 4OU4A 2EJVA 5JS6A 2QT1A 2AXTU 5DN6A 1HZJA 4M1MA 3BPSA 5E9WA 3LKVA 5C0YA 2YL2A 4F9TA 4KXMA 3R3WA 2PUBA 3O90A 5CJ7A 1P1KA 3T35A 3UWKA 2SECE 1UBKS 2P1RA 2FF7A 4YMNA 2Q4OA 3HDJA 3O4IA 3UKJA 5CIQA 1NPTO 1B1AA 5K0SA 1QFXA 5K20A 3UATA 1R6BX 3VOBA 2G9VA 2VQ6A 1L9XA 4BNMA 2YB1A 1VBKA 1H2YA 8ICAA 3GLVA 5LIRA 3LQKA 2QRGA 3N6XA 4OIFA 3T3EA 5EHZA 3MK31 5EWFA 1MGPA 3C45A 4N5DA 1H3FA 3SC2B 1IJBA 3GOHA 3J80A 1NMZA 2QLTA 4RUKA 4QBHA 4ZCRA 4TXHA 4YFYA 1RE1A 1R10A 5AVKA 1UPCA 2JK0A 1B00A 4D25A 1IM4A 3GXOA 3VHXB 3QKIA 2IODA 1TO6A 2NUPB 5AVUA 4MWEA 1IC6A 1URPA 3TG8A 2BW0A 5MN6A 5ALIA 4L74A 2FUCA 1T9CA 4TTPA 3WOHA 2EKDA 3G0GA 4RLHA 2XBUA 1Z62A 3PCTA 5JY1A 3AM4A 5B7PA 3IDSA 5ALDA 4YDQA 4B85A 4Z4GA 5JVDA 2JRCA 4RANA 1J0AA 1ZI6A 1MQ9A 2O48X 3RAQA 1N3BA 3M5DA 4C4YA 1IOZA 1QB8A 3DWEX 2L5YA 2OUIA 4XTRA 1BPXA 2XNDD 3QWIA 3V4RA 5CM2Z 1B8NA 8AT1A 3WNVA 3LLUA 5J2UB 1ZM3A 3L18A 1IXZA 3MMZA 3WL5A 2G9QA 2C2XA 2OXRA 4KP7A 3ONVA 2XMGA 5CD9A 2PGNA 4UB3A 1U7HA 5FOSA 2EAUA 1HOXA 4B9EA 3A6JA 4ZT2A 4M53A 1HUOA 1S8AA 4FBTA 1GPJA 5A5GA 1T26A 3LXUX 4H7EA 4KG7A 3LCJA 1CZNA 1HLPA 4IQTA 3AEQB 1QP0A 5KTQA 4LK2A 4YJ3A 3LPCA 5KNCA 5GVRA 1I7PA 1BGVA 2P4SA 3OTOB 3WMEA 3VSDA 4ASUA 3C4VA 2EU8A 2XQKA 1GAQA 2ATLA 2FW9A 4MYHA 3HN2A 2O0KA 1IATA 2C0QA 2VVTA 4TN5A 1FW8A 3P19A 5IG2A 3IVRA 3SBXA 2Z3WA 3CLRD 1Q20A 1PVDA 5C1DA 3NI2A 4C7VA 2PKQO 3FOCA 1ZM4A 4ID3A 4BGVA 2EG9A 4ZC8A 3JWPA 1MC1A 3A4MA 3ZHYA 1P5JA 4KWCA 4U7DA 4BNXA 1FUEA 1RLIA 4EPXA 1KSPA 1CEYA 5I5GA 1X87A 2C9BA 5EP3A 1UXOA 4JJ4A 4GUDA 4QO7A 4WXPA 4EGQA 1JA9A 1NQXA 1KC3A 2D0PB 3CRVA 2V5AA 1OX4B 4QELA 3EUFA 4FE4A 1ULHA 4R8UB 4D56A 4KGDA 2JGNA 3LT4A 4BYMA 4PG5A 4MV4A 2RK3A 1B6SA 1JDUA 1K6MA 1QYDA 4DGSA 4NZ9A 2IX9A 2A0XA 3SD7A 1K5GA 4RIGA 4JJGA 2K4EA 5J47A 4PO9A 5HIJA 1VPTA 2ZYHA 1V9PA 2INGX 1D2NA 2O0LA 1TDJA 4L28A 4TMFA 4FSDA 4PAWA 1EWTA 4IIGA 4TOIA 3T3DA 2XYGA 2ZRJA 2FQ1A 3LUGA 2FZCA 3MOSA 2KOBA 1IL0A 2LWIA 1VIAA 4P2BA 2JW5A 5FR2A 3PDHA 3E53A 4WOPA 1AKQA 3C8DA 3WKAA 5JXWA 4RIEA 4TVBA 5B55A 4PGMA 3ZVNA 3UXNA 2WQZA 5GONB 2J0QA 4KJXA 4RTOA 1CEQA 2FVXA 4QXQA 5IPFA 5EQJB 4QQ8A 3E6AA 1X1RA 4R81A 2ZTCA 1NL3A 2FMTA 1RQNA 1YZNA 5FPYA 3TRJA 3T3IA 8ICOA 2IXTA 3ZZUA 4RLFA 1XEXA 1OVMA 3AV3A 2Q62A 4RK7A 3W8NA 2VYND 1V9CA 4EVIA 1JG2A 5CCBA 3BCSA 2X0KA 2E49A 3FI9A 4HTFA 4Z4EA 5CWRA 2OG1A 4BEVA 1VYUA 3GJTA 1G6HA 3DPIA 1NMQA 4BQSA 3QJGA 4KQ9A 4P0PB 2H4HA 2P1ZA 4ATNA 4M88A 2QXTA 4CRXA 2XUPA 3COVA 4TM8A 4HB4A 3HDYA 1I14A 4B9AA 3D0RA 3EXIA 2GDZA 2C4UA 2N47A 4H27A 1A8IA 2DHQA 5A7GA 2I55A 4RZ3A 3H17A 1XMOB 5DPMA 1C50A 4HFMA 4CF4A 3VR5H 3DEYX 1Y1SA 1AV7A 4BNWA 3WISA 3IC5A 2BMDA 4O2BF 2VUTA 2G5TA 3PWTA 5KT3A 1D7OA 1ZQDA 3C24A 3REOA 4Q1DA 5E9JA 1BNCA 5AMXA 7ICVA 5KFZA 1P6XA 3I2GA 1SOWA 3JPWA 3LKDA 5A06A 4C4SA 2P35A 2NAPA 4ND5A 3IP9A 1O94A 3T7DA 1QG4A 1M2VB 3FJYA 2HYIC 5LIPA 1A9QA 2D0DA 3TNJA 5F3WB 3OUTA 1OXKB 1R0XA 3KD3A 1JFLA 3B6ZA 5DNUA 3FROA 3CHYA 1KJJA 2XJ9A 4MKIA 3W6PA 5C80A 3HSKA 3CJRA 3K71B 5LCXA 1JR2A 1VE5A 2JI7A 2OAGA 1V11A 1YTLA 4R31A 1TB4A 4L2IA 4FDVA 4I1PA 4YX9A 3WKCA 4ETNA 5TX7A 1B14A 5JRTA 4LJLA 3HB0A 2VTBB 4V0LA 4ER0A 1PFUA 3FNRA 2C5FA 2X5OA 1G3UA 1T4CA 3TSAA 3QVOA 2X8JA 3TEMA 4XIYA 5AM1A 2CLSA 3K20A 2NO6A 4OHXA 1WXQA 1ISSA 4ZIRA 1H9CA 1G8HA 3DZCA 4QBTA 1ZIDA 4ERXA 1TAGA 1N1DA 3D6VA 1OFVA 1Q1AA 5F7ZA 2VKQA 3R3HA 1A8UA 1DOHA 1FMLA 2PKCA 3X2FA 1KEPA 9ICLA 2WHQA 3FSJX 1AA6A 1M0TA 3NU1A 1HC7A 3I4LA 3RJ5A 3LHFA 4MR8A 2Q1SA 1L3SA 3IUPA 1HXHA 3AY3A 4FZLA 3PW7A 3VTZA 3F5EA 4G4IA 1KC1A 3IAFA 4C0HA 2WKQA 3P52A 4ECEA 4EIWA 2HX1A 2GPBA 4IW3B 2BHNA 4QW9A 4IGFA 4EB6B 3D59A 2NTNA 2Z43A 3IPCA 4LRSB 1S02A 3CGWA 5JWHA 1BX1A 3M9NB 4Q9JA 4GF5A 1E9EA 3WGOA 1C0KA 2E4VA 3TLGA 3H3XA 4NYIR 3ESRA 4HV4A 2ZB7A 4TTVA 3LJKA 2MCFA 4IM7A 3GQVA 4FU0A 2O8CB 2DRIA 4WJZA 4OAPA 3F9CA 2FDRA 1AT1A 3UT0A 1WV0A 3DHVA 3OQPA 3F97A 3IQEA 4JYZA 5EKUA 3QUCA 3H83A 2EQYA 3QQPA 3R9XB 4PSAA 4UVEA 4UBJA 3RWMB 4OQNA 3GMDA 2G77B 3CYMA 4NBSA 4YV7A 3DOOA 2ID7A 1KMQA 4CMGA 3TANA 2CXQA 4RX1A 2Y2UA 4EH1A 4MDHA 4PZ0A 4OSPA 3OHSX 4E3WA 1KVRA 1ZN2A 3IV7A 2PLAA 4IS7A 5FKJA 3BRWA 2ZSDA 2ZM5A 3HU1A 3MUEA 5FBLB 1FP4B 3UMCA 4Q03A 2CE2X 4DMUB 2JR5A 4NY1A 2PA0A 3UF0A 1GKUB 1LJLA 1ZGCA 2PAAA 5FI5A 1JX6A 1HE2A 5T4BA 1PK1B 1XCBA 1Z36A 4QJ4A 5AQEA 4YP1A 4E03A 2R6AA 3HY3A 3KZ1E 3NYQA 3VH2A 1XVAA 2YX1A 3I0MA 4IOKA 1GKIA 3ZE1B 1PDOA 5KNDH 1DQSA 2PWZA 3GVPA 4AZ0A 1U3UA 4NS1A 3MTGA 4AJ1A 3DB2A 4L0QA 1K1SA 1L7QA 5EZQA 2P69A 3NWEA 2QRQA 1U2EA 3DFFA 3RC1A 3PSAA 4EZBA 3DTVA 4AROA 4QO8A 1H5NA 2QQ0A 1BXKA 4ZQEA 4CKBB 1MAHA 5JD4A 2IPOA 3OSNA 5DBFA 3MGAA 4G4SP 1CEXA 4KXUA 2DGZA 2IL1A 3GFKB 4DMCA 4CIWA 2CJPA 3ZGYA 4ZREA 5ENVA 5JC1A 4Y2RA 3IX7A 1T9GS 2FEWB 2WJZB 1NDUA 3L6RA 2XY4A 1V1RA 3WYFA 1HE4A 3R4VA 4FP9A 3URMA 3HPRA 5IC5A 3C7KA 3JWEA 9ICCA 1VM6A 2AZ4A 3UGJA 1ECBA 3VPHA 5CFZA 4D3YA 1WEHA 3WK7A 1V6SA 4O3FA 3HYSA 2Q1UA 4X1OA 2F3PA 4EATA 3PXDA 3M6VA 4GH5A 3N2YA 3OZIA 4ALMA 2O0HA 4GPTA 4JN6B 2R0QC 4J0FA 4ZTZB 4I7EA 4FKZA 3UUGA 2QEQA 3C7CB 4DYHA 4F97A 1DAKA 1YHNA 1LDMA 1JMYA 3R7NA 3HGMA 3HJHA 1QH0A 2QT0A 1DEAA 4TM7A 3HCNA 4QECA 4GP9A 5HBGA 1YZ3A 1YR8A 4UQPA 2V7UA 4GPBA 4L5YA 1C7JA 4WLEA 1RPNA 5HKKD