1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD51
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
9ICEA 2BPCA 3K70C 5FPHA 3X2SA 5LD2C 4ECZA 1XMSA 3DVLA 3DHWC 3Q85A 1JEEA 1Q1QA 4HYKA 2ZUDA 3S1AA 3FHTA 3EPGA 5F9LA 2A5FA 1TAQA 4V0OA 2GRJA 3CW2A 4EPTA 1L3TA 2GHIA 4BEBA 5KTQA 2WICA 1F5NA 4EPVA 3WY9A 3U2QA 3OIUA 3NTUA 2YV5A 1PUJA 2ISOA 1YQTA 5FPKA 3EPJA 3NXSA 3JPTA 2Z6VA 2FLLA 1FUUA 3L8YA 3PENA 3B2EA 1KSGA 1E3MA 3RS2A 4Q9IA 5EP4A 1Z29A 4GI7A 4BLSA 2G0TA 4TMVA 2FX3A 4GBMA 1Z3IX 1E2EA 3OAAA 1LY1A 1ZINA 4OBEA 1R8QA 2BC9A 4MGZR 5J4YA 1GFIA 2HDNB 2K5UA 4L4UA 5FOUA 1VG8A 3PW4A 1T9HA 3OHBA 1PUIA 1ZC4A 1ZQBA 3V72A 8ICUA 4Z54A 5J0PA 4GT1A 1PLLA 5C4MA 2QBYA 4RUAA 4QZIA 1P2TA 1XEXA 1R0XA 2WWIA 3K0AA 3H8WA 3NVAA 5DDYA 4TUQA 4D6PA 4KN4A 5SZHB 1B23P 5HCIA 5JZVA 1HJPA 3VU9B 5KT4A 2O0JA 4KU4A 4AYTA 3QY0A 2V4QA 4M9XA 4PPXA 5G3ZA 3VHXA 5F3WB 5KFOA 1TQ2A 3ZS8A 1RRGA 3HU3A 5H70A 4M1SA 4ED0A 3UMSA 2GCOB 3B7GA 3UG7A 4E5UA 1QLNA 3GFOA 3QF7A 1QHYA 1RW4A 2CNWD 3CNNA 2GXQA 1KSPA 4Z6EA 3HPOA 1IXSB 3LBHA 4F38A 1Z00B 9ICPA 1JQJC 2BBWA 4PPGA 3GJ4A 2DWOA 2ZSBA 3K4GA 2PI4A 1Z3EB 4OI4A 1VG1A 5KFKA 4AYXA 4PHPA 5TV2A 2JJ8A 1DPFA 5KT5A 3AQ4A 1DAEA 2H17A 5BN4A 1F2TB 4M21A 1VHLA 2BIFA 3GIIA 4TURA 3MFYA 2IWRA 3RH6A 1E2FA 1F48A 4KLEA 3NBFA 3NDPA 4TSFD 5DN6A 4BZXA 1Q21A 3U7EB 4MEYA 1S0VA 1KMHB 1UDXA 3SYZA 1NVVQ 2XSZD 1KI6A 4K4IA 5CA7A 4UB4A 1WBDA 3P4YA 4KLSA 4URUR 3ZGXA 4RZRA 4QWAA 3BQ1A 4DSFA 3V6KA 2C99A 2VSXA 3PCRB 3QKRB 1JR3E 4CEIB 3RB3A 4D25A 2W0MA 3C21A 1XNJA 4OHZA 1ZRHA 3KX2A 5D3MB 3WRXC 4IR1A 1KDTA 3PUYA 4BFXA 1XX6A 2BBTA 4NMMA 2ZRDA 1U2RA 5CJ2A 4F50A 4IQVA 3V6HA 5CIQA 5TXGA 3K8YA 2YWEA 3LX8A 2F43A 2ZXUA 1L3UA 4V0KA 2BBOA 4S2EA 5DBCA 1D6JA 2R2AA 9ICKA 2ONJA 1WE2A 2RGNA 3SU8A 5J2KA 3AVYA 4EYIB 7ICNA 1U98A 4M22A 1W1WA 1TEXA 1Z07A 3SZ2A 3A1TA 3ORYA 3K1JA 5DKWA 3QXSA 3M8SA 3LW7A 2J59A 1HE1C 2VRWA 3D31A 2YNMA 1P6XA 1OXSC 4UKDA 3N2EA 1Q22A 1UEJA 1UKZA 4LZDA 4J9OA 4Q9KA 3GIMA 3SQWA 4RPYA 1E9SA 3I4LA 3K0AB 1R0WA 1G6OA 2Q0HA 3FWYA 4M53A 1Y63A 5FOTA 1GVNB 1HV8A 3TLXA 1V9PA 3GJ3A 4LX0A 4O25A 8ICNA 4JUZA 1S3SA 1RRCA 4DDUA 2W2XA 1Z47A 3BE4A 4FN5A 5B64A 3T5JA 3H2YA 2FDCA 4KODA 2QROA 1GSIA 2JGNA 4OI2A 2NZJA 1BYIA 2C98A 4RSGA 4XWOA 3NWJA 4ESVA 3F3YA 4WIAA 5EE3A 4N3NA 2A30A 2GVZC 3AVQA 1IJEA 2OFWA 4KLQA 3RB0A 3MUFA 1FMJA 4LJ5A 4BFUA 1GNRA 3CNOA 1S0OA 2XXAA 3AKEA 4NYIR 1H8ED 4RNMA 2JEOA 4BLPA 4Q44A 4GXJA 5JEEA 1TAGA 3PVSA 2AKYA 4B2PA 3QVUA 4NY8A 3C41J 2RGGA 3HP6A 3K09C 4IVRA 2Q21A 1BPBA 2QENA 4LYJA 1OH6A 1WBBA 3C4JA 3HR8A 3BJYA 2GILA 2DFTA 4KLFA 2IMWP 5FI1B 3CR7A 4DL6A 2EFGA 3OIYA 4LHYA 3KFVA 3KKPA 4JL5A 5DHAA 4LHWA 2Q9CA 4RZ2A 2FGJA 2I3BA 3FHOA 5CJ7A 3QVVA 2RH5A 5E95A 3H84A 5K8LA 1E2JA 7ICTA 2NTYC 5L3SB 3CPEA 3MDCA 3DZDA 2ASJA 4I1SA 2QPTA 3ZZ0A 1ZQDA 1IM4A 2GEDA 2R9VA 5LPNA 1HH4A 4EFMA 1GOTA 3DM9B 1MV5A 1B43A 1COOA 4M9LA 3ND9A 2GF9A 4FO6A 2R44A 3T1OA 3GLGA 4O2LA 1R10A 2ZM5A 3U6KA 1PJRA 3REGA 3CRW1 4YMNA 3W3ZB 3K70B 1QRAA 3B13B 2QRNA 3U3KA 3KQNA 4P0TA 4URVR 1E9DA 3KL4A 3AVVA 1KI9A 3LXRA 3PW7A 1K5GA 1N6IA 4Q7LA 2A1JB 2J7KA 2ZRBA 2FOLA 4G5RA 5D3MA 3Q8SB 1IJFA 5KU1A 1QVRA 3A4NA 1Q1BA 2X1VA 2XTZA 4NYJQ 5TARA 4DLGA 4AG5A 3U5ZB 3OZXA 4BASA 1EFHA 1IY1A 1FP6A 2Y1JA 1XFAA 3QXJA 3TKLA 1AIPA 2WM9B 5JCZA 1UEIA 721PA 3KJIA 2O8CB 3QKTA 3RB4A 1EESA 1YRAA 4F4CA 3AF4A 2B7CA 5CIWA 4LJ7A 2W8KA 3A6PC 2DYKA 2OUKA 2GEUA 2QUZA 3PR4A 1XCPA 5IDVA 1W0JA 4XVUA 4PXAA 1OXXK 4WZAE 4NH0A 2GBLC 5DG9A 1S76D 3GIKA 4QZDA 3H4DA 2C77A 1G5RA 5GVSA 1X8JA 2JLVA 5DQHA 4QHYA 5EE1A 2CK3D 5G41A 3TAHA 2QA5A 3RJEA 1LVGA 5KFPA 3FKQA 3WYFA 4ED8A 3LAWA 3MGHA 1N6NA 3GFTA 3RS4A 1ZM4A 2NRZA 3SYLA 3IM1A 4IOMA 4H9GA 3DOFA 5UKDA 5J0YA 2ZSFA 4ERNA 2XTNA 1BPXA 4WBSA 4AKHA 1QSYA 1D2MA 1ZCAA 2ZTSA 3RHFA 3ADDA 3GDXA 4EQ6A 5EWEA 3PX6A 2JEGA 3BRWD 1P9WA 3OEHA 4LV5B 4R71A 3IEVA 3PR1A 4HZUB 2F1RA 1KI4A 4FWIB 1N2CE 2AWNA 3BERA 3KTAB 2QT0A 1ZQEA 3ADKA 4KLZA 3FOZA 3H4BA 2O52A 2PMDA 1GP2A 1G7CA 5DDMA 3L82B 4LC0A 4I2JA 4KSBA 1BYUA 1NKSA 4U00A 3E1SA 5BN5A 5JECA 2A7QA 4PSKA 5G3YA 2J9RA 4A4DA 1E9AA 1YE8A 3IO3A 4V0ME 1TU4A 1S9FA 4UQOA 2GAOA 4CW7A 2BV3A 3KHRA 3JVUA 2BQ3A 3UMRA 3TI0A 5DYIA 5IT5A 5HKKD 5L3SA 5IIMA 2BCGY 4B76A 4YMOA 4TMTA 1CULC 5JWRA 4Q4AB 1D8LA 1GILA 2YWHA 4XIGS 4J9PA 1KK0A 2XNDA 4U02A 1GKYA 4IOKA 5KFFA 3V4RA 3LNCA 4HLDA 4JLAA 2RGCA 2EFHB 2IYXA 5BYJA 5D3QA 3AVTA 4ZV4A 2WWFA 5DGXA 4D81A 1YZNA 3UG6A 5DB9A 3D8BA 8ICWA 3PMNA 2BBSA 3KB2A 2AR7A 2ZITA 3RC8A 1SGWA 3GJ8A 4MRSA 5C2JB 5JSZB 5K8IA 3T12A 2ZAOA 2XX3A 1KY3A 1VG0B 4G5OA 3R7WB 2ORVA 2J41A 5TVKA 5KNCA 4ECRA 2XGQA 4RD1A 4F5NA 1WA5A 2UVVA 4LJYA 1UA1A 3CX6A 1X8LA 2J45A 3W9YA 4LPKA 2DPXA 2ECKA 4MRNA 4WW0A 1H8HD 1UT5A 1S96A 3HX0A 2XJ4A 4GSYA 4JV0A 4JV2A 7ICPA 3Q72A 3VKGA 1NN1A 1ZVQA 2AD5A 4L8GA 4C8NA 1ANKA 4JVSB 3RRMA 4RPZA 8ICBA 3PFIA 2F6RA 3G6XA 1SHZA 3QPUA 3OIWA 4Q4HA 3THWA 4PO1A 1OH5A 4ZDKA 1AN0A 5CK4A 4GOXA 4P4SB 3SNHA 1T4GA 1E6CA 3RR8A 3GQCA 3AVPA 3MCAA 4WZ6A 4F4YA 1B0UA 1AKEA 4MUAA 5KG5A 2I1QA 3HU2A 4DFJA 4UB1A 4DSKA 2ZJ8A 4V0MA 3WMFA 2ZEJA 4YVZA 1KLNA 4TLCA 1K8RA 3Q8MA 3PUXA 4ZPXA 1OFIA 2G88A 3CONA 4DCVA 6Q21A 5BPCA 4DSEA 1OFHA 3OFNA 4QHTA 4A82A 5J0SA 1TK0A 5H8WA 4NCIA 5J4VA 3MR2A 2ZYTX 3H4MA 2FFBA 4KLNA 1KK2A 4K46A 4YCXA 1E1RA 3BXZA 5F2EA 3L0OA 4HZUA 2O0KA 5DI3B 1M7GA 2D74A 4HSEA 4NLNA 3QIAA 1S4QA 4DEZA 1WDTA 1YR9A 2VP4A 3FMPB 5F9HA 2GJ8A 1IXRA 4KLUA 1TUEA 3BAFA 4JZKA 3W90A 2AJQA 1J8YF 3CX8A 1NMXA 4HLCA 5AUOB 2Z4RA 1U9LA 3BWDD 2QGZA 4DLXA 4TQSA 4EZ9A 2BCUA 4CEJB 2W58A 1DAGA 1T3HA 1E2LA 5B58C 4W7SA 3THYA 5KFVA 3QEJA 5K8UA 3PUWA 2O5VA 4I2GA 1TUIA 3L0IB 4URWR 1ZW6A 3B1XA 4RD2A 4FINA 4DL2A 4TQ9A 3AB3A 5FOSA 4ECUA 4R64A 2PZFA 2LCFA 4C0HA 4NYMR 1OXTA 3TAUA 5D49A 1BH2A 2E9SA 2ZAMA 3GFKB 3SFZA 3KKMA 4AI6A 1NY5A 4TMKA 4JBXA 2D7DA 4GRAA 5JRJA 2GK6A 5BQ5A 1OB5A 1CIPA 2JZBB 2CE7A 4GDFA 1L7VC 1N6RA 5KG3A 2ZVPX 4PPFA 4PTLA 3HWTA 1TK5A 7ICEA 4TLEA 2ZTEA 3IIKA 1FQJA 3B60A 4DSOA 2ZRCA 4XWKA 2DHRA 2OBNA 1TVAA 2QPOA 4OJQA 8ICVA 5JI2E 1ZYUA 2EYUA 4RD6A 3Q7PA 4RT2A 1G9XA 4RUCA 1NK7A 3BH6A 3LH5A 1HUQA 4DQIA 9ICBA 3BORA 2A1JA 1KI6B 5FUVA 1SL0A 4DDWA 5KOYA 4ECWA 3C5HA 2ZRPA 4BE7B 3TGPA 2GZAA 4UXJA 2HV8A 1OHHD 2WBLC 2FJUA 3OSPA 1D5CA 3TQFA 2IS1A 4Q66C 3IIMA 5J0QA 4D4KA 5KPJA 1U8AA 2VSFA 3E70C 3VR5A 4IHQA 4B3XA 2OBLA 2XZLA 1AS3A 1QVAA 3ZQJA 2O8FA 1XC9A 1WB9A 4QKQA 4YMVA 4NM1A 1CR0A 1FZQA 3VKHA 2P5SA 3QG5A 3NH6A 2ISPA 4LDJA 1X8KA 4F5RA 3UXMA 5JJLA 4DIEA 5AJXA 5LDDC 3KQUA 1P73A 1ZAKA 1W0KA 2MSCB 1Z6YA 4NTZA 4FXPA 4UQGA 2BM0A 1CXZA 3IPXA 2RDIA 4RQ2A 5JHGB 2HHTA 2XOKA 2X8AA 2YJTD 4I2HA 3ZIAD 3EG5A 1EFTA 1FFHA 2YWFA 1D2NA 1MO6A 4R63A 1M7HA 3G82C 2X2FA 2DPJA 4HDQB 4II7A 5FBVB 5HR5A 3GLIA 2REXB 4KLOA 5J2EA 3U60B 2HHUA 5FUYA 1XSNA 3B5JA 3BB4A 5DLFA 1EWQA 3JPSA 4B3CA 3KDSE 2NZ8A 1R5BA 3GLIB 3GJ7A 3RTVA 1D9DA 1E1QA 1D8TA 1RYFA 4CYMA 1ESNA 2FFAA 4XD7A 2WJJA 2R8HA 1LB2B 2NO0A 5J2AA 2KE5A 4F91B 4IXMA 2QMOA 1GNPA 4QRHA 5AJZA 1KI7A 4NDZA 3AVUA 5KFAA 3QNUA 2I9GA 3V4FA 5JHHB 1XWLA 5J0XA 2RGEA 3GCGA 5FOVA 2HW3A 1TL7C 3ZJYA 2D3WA 3RS5A 1U0JA 4QW9A 1OHHA 4GXIA 4YC7A 2WIAA 2CDNA 1TF2A 4M2YA 5FOXA 2IWHA 4KLHA 1VYTA 5AUNB 1YR8A 4C30A 2X77A 3C5FA 5DISB 5KHOC 1JXLA 1XEWY 4BFSA 2C2DA 1G17A 3QZ7A 1WF3A 3AF3A 3PXGA 3UIEA 4TMWA 1CUKA 1E9BA 3PG5A 4V03A 2IEYA 1NKTA 3QXHA 4JVLA 4UJ5A 2NPIA 4QWBA 4QM6A 1SXJA 2VP0A 4DLZA 1XEFA 3FMOB 3RJHA 4HI0E 5HMMA 3QEBZ 5CHGA 2HXSA 2FLNA 1IXRC 2MMGA 2OCBA 7ICRA 4NLZA 4B3FX 3C2MA 1E2MA 4ON9A 4WOPA 4YMWA 1NK0A 2OFXA 5DI9A 2ZI5A 1ZD8A 1ZQQA 1NG9A 2C22A 1M74A 1BMFA 3I73A 1A76A 2RGXA 3G6VA 4J9RA 2KBFA 4BRUA 5EXPA 3Q5EA 1W47A 5HMLA 1TADA 4RCZA 4TL9A 4BRWA 3AU6A 2HHXA 1BPYA 1T3LA 5KFTA 5L1JA 5J0OA 4LGMA 3MR5A 5CP2A 1S8FA 2R65A 4XTRA 3R9IA 1DEKA 5CM8B 3TFRA 1OJLA 2PFPA 1T8UA 1UPTA 1XTRA 1YZLA 2C95A 2QEQA 4S35A 3TRFA 2E1RA 3HYRA 5AUQA 5IIOA 3ZQ6A 4TZ0A 5FR2A 4I2FA 1L2TA 4PSAA 2BDTA 2QI9C 4D0LB 5FTMA 1CBUA 2CLCX 2P5TB 3B82A 2CEAA 3CRQA 4R2HA 5E7MA 3FYHA 2ZTCA 4I81A 1E9EA 4HLQB 1ZQVA 5DB6A 4BPBA 3PO5A 1LW7A 3GFPA 1HY3A 3GJ0A 1I4LD 3FFAA 3PV0A 4NONA 4V02A 4GMDA 2ZYVX 3KUDA 4B34A 2KFNA 1KO7A 4E07A 1Z2AA 1II8B 3T5LA 1VDZA 1W4AA 3SYKA 4DLEA 3WNCA 1NKCA 2ZVQX 4D4LA 1HQYE 4DRZA 4UB3A 2GCOA 2QQ0A 3F0TA 4ZH4A 1T8EA 1G41A 4JBYA 3EAQA 2WPDA 3SJCA 1U49A 9ICOA 4PC6A 3OAAD 3KHHA 2QTVB 1FUKA 3RJJA 3AUOA 1U94A 5J2HA 3P4XA 5CWRA 5IINA 2OXCA 1C9KA 1W36B 4R65A 4GP6A 9ICWA 2CLSA 4HB3A 1K1QA 1P61B 3AKYA 4QZAA 3HWSA 2ZR9A 4P4OA 1U90A 2LWIA 3DDCA 2IL1A 3MD0A 4M1WA 4PHTA 4QWCA 1JN3A 1GL9B 8ICEA 5TB5A 3WP1B 2DY1A 4DJTA 3TJZA 2BJWA 4Q19A 5FL7D 1KJZA 4A2WA 5CB8A 4DHEA 4M4SA 4BFYA 4RQ1A 4ELVA 4BLOA 2W2TA 4QZ8A 2BM1A 1Z0JA 1L5UA 1WCLA 2BHNA 1S9HA 4P31A 2HF9A 5EP1A 2DR3A 1N6OA 5HNKA 7ICOA 4BWMA 2JJ1A 1WMSA 3PVXA 4RFVA 2P67A 4DSIA 2DPIA 1TK8A 1CU1A 1I2DA 1NVUQ 4DOCA 2DFNA 1P3JA 1RZ3A 3H1TA 2ZI6A 4LY6A 3TIFA 9ICFA 4E03A 1E2NA 4MRVA 3LD9A 2WZQA 3EIQA 4PHFA 4MGYR 5KFWA 3TQ1A 2IF2A 2OLJA 5EE5B 1FPMA 3GMTA 2H16A 5DH9A 3L8ZA 3R20A 1JB1A 3W3AA 2FEMA 1E99A 4K4GA 1X9WA 2GJSA 4PO8A 1RJ9B 4RD3A 2ZUCA 5SZJA 1Z0IA 2Y8EA 2CBZA 2A5DA 3KKOA 4M9ZA 2ZSEA 1XCGB 4O0MA 2EW1A 2B8WA 1OV4A 5AJYA 3WYAA 5ELXA 4M1OA 2RHMA 3FKSA 4FCVA 3UQ2A 1ZYQA 1CRQA 2VEDA 4MYUA 3MDAA 4PFSA 5DN6D 1NKEA 2RDJA 2HHQA 2G77B 3IO5A 3GV5B 2LKCA 2OSBA 4OHVA 4QGAA 4KLJA 1SKRA 3CIOA 1SVIA 2J0VA 4JVNA 4EDHA 3RH4A 2I4IA 3SV4A 4AY2A 4JL6A 2BOVA 2JA1A 1W36C 4DKXA 1YZKA 2PX3A 2REBA 2J7PA 1ZQHA 1W5TA 4AG6A 1N5LA 3RRYA 4DL5A 4QZHA 7ICFA 5FTNA 4PC1A 1OXVA 4DFKA 3GLHA 3SN6A 1QSSA 1JMSA 3O8DA 3UWKA 2CJWB 4EQ6B 1GTVA 3K9NA 3BQ0A 4JWMA 9ICQA 4TL8A 4V0LA 2FF7A 4NYMQ 4EJSA 2WSSD 3Q3JB 5KT7A 2BMFA 4DSJA 1SVSA 4JKIA 3VKWA 5JEDA 2HF8A 5J5CA 4ACAA 5EOZA 2BCJQ 4B9MA 5FBLB 3U7FB 1QBKC 2PX0A 5M04A 1OB2A 4C8KA 2ODWA 3CO5A 3T5KA 4ZCIA 2WWGA 5AR1A 4IRKA 5JRZA 1CEZA 1R4AA 2ERXA 4DWJA 4BXOA 4NCKA 2NOAA 2A5YB 2WJIA 1P62B 4C0LA 4QWEA 5FTLA 2YC2C 4N0EA 3NC1C 4B48A 4ASUA 5KT6A 3MWLA 1E96A 1ZQCA 4R2IA 4EFNA 2FNAA 4ZDIA 4ESHA 4ECYA 1NJYA 3QEAZ 2ZQ5A 4Q8EA 3CLVA 3RRZA 4YMMA 3Q8PB 1T3SA 2VO1A 1AS0A 4CT4B 1KRPA 2BR0A 4CEHB 4A9AA 4DQQA 3Q5DA 1NN5A 3U3JA 5DB8A 1ZQLA 2JLSA 4MFAA 1Z0DA 3ZVMA 2PCJA 1UBCA 2ZJ5A 5KFEA 2IHYA 4I27A 4G0NA 4ZDJA 4F4ZA 5L3QA 2VP6A 1XS9D 2IXEA 2MUTB 3QE0A 4RFSA 3MGIA 1XXHB 4BWYA 2KSQA 2QG6A 4OHXA 1WCNA 2PI5A 1C4OA 1QHHB 2HJGA 4CCHA 4HUQA 1RIFA 2VANA 3VR2A 2HYIC 4NCHA 1Q1ZA 4TN1A 4JLNA 4F4WA 2GKSA 2FE4A 5J0TA 1ZNWA 1ZQAA 5KNDA 2G6BA 1OLOA 3SHWA 4KVAA 521PA 4V0NA 2V6IA 2C9OA 4WXRA 2W6ID 2IUTA 3BQ2A 1E0SA 2VP9A 5LBIA 3EARA 4B6EA 3I62A 2F1HA 3PR5B 3MR3A 4LYAA 1FL9A 1P9NA 2Z83A 1UBEA 4I2CA 3X1YA 4DUGA 3THXA 1M1YE 1KSHA 3EWAA 1SKQA 4B73A 2N46A 4Q1BA 1NN0A 3RLFA 3OIVA 5FOWA 1KJYA 3WHKA 2MSEB 3UPUA 4MGKR 2HCJB 3ZDQA 2VIIA 4DLUA 4UNRA 3HP1A 3Q8QB 4J9LA 2J46A 1TX4B 3U44B 4KHZA 3QJYA 2C9CA 4PPQA 1GZSA 1ZQRA 3P32A 1S97A 1NK9A 1SKWA 2ZANA 1OH7A 3HR7A 1KDRA 3I92A 1LNZA 4OI1A 1CJVC 4DLRA 1XXHA 2AD1A 2QP9X 4KLIA 3VR1A 3IILA 1Q1EA 2O8BB 3OJSA 4KTQA 5FL3A 1GM5A 1BOFA 1M7BA 2WMNB 3OJUA 1TV9A 4TT3D 1EXNA 1D2EA 3AGQA 4FMCF 4XA5A 2R6GA 2GJ9A 1KFTA 2V54A 4EBEA 3CPHA 1MRSA 2XC9A 2HXYA 1F2UB 3HYTA 3O8RA 4LJAA 5CDFA 5IIIA 4TYWA 1IN7A 1GWNA 4RCYA 3HPRA 2ALZA 2C28A 1Y88A 1UDWA 4PGYA 4J9MA 4DL4A 3RJGA 4Q4JA 3ONWA 5DBAA 4B2IA 1E98A 1NG1A 4A0RA 4CZ2A 4EEYA 3UMFA 1T7PA 4AK9A 3ADCA 5KPDA 1N6HA 4JLOA 3X1XA 4JLDA 3RDPA 3LBIA 3VQTA 3KFXA 1NI3A 5HTKA 1ZQSA 4J9KA 1QZXA 4QBGB 3EASA 1W46A 4IEEA 4GOKA 2G9NA 3WRYC 1KYIA 2JLQA 3CWQA 8ICRA 4UJ3A 2O8DB 1NIJA 1SXJB 2CVFA 3NHAA 4JT2A 4HAYA 2PL3A 3OEHD 4JVMA 3RAQA 4PZZA 2NO1A 2ZYWX 2YC4C 2ZE8A 1E2IA 3RNLA 8ICOA 4AC9A 4DLWA 2PEYA 4I99A 3H7IA 2BQRA 1QHHA 4JSTA 5EZ6B 4CEIA 3JPPA 1DG3A 2B21A 4D2IA 2HVIA 1XF9A 2QZ4A 3SI7A 5J4HA 1WQ1R 2GAAA 4QG7A 1KKLA 1KI1A 4CDGA 4BUJA 1N5KA 1A82A 2VP5A 1OH8A 1S77D 2ZE5A 5JLJA 4RZ3A 1MQ3A 4Q8FA 4ZKDA 4MUBA 1BKDR 5L1LA 3ZZTA 3CNLA 5HKKA 4KO8A 1KK1A 1CR2A 4LOAA 2HHVA 4IRUB 1LV5A 4Z6CA 3T5GA 2JLWA 3EA5A 3B1WA 4Y0VA 2FPLA 2BQUA 1UKYA 2IA5A 2ODNA 3VR6A 1EG7A 2GCPA 1EFCA 3WBKA 4EKDA 4B9LA 1IM2A 2WAXA 4YXWA 4RQ7A 4LCBA 1GIAA 1RFLA 1WCV1 1FX0A 2F7SA 4DQSA 2G1KA 2N1BA 3QENA 4F7WA 2P3SA 1KY2A 4HYYA 1WP9A 2PCLA 5KO2A 4LZZA 3SJAA 4I2IA 2XNDD 2QSYA 1KO8A 4PGQA 4OHYA 1D9FA 1UKEA 3HJNA 1X3SA 4OQXA 1NNEA 4X5VA 4JBWA 1W49A 1P4SA 4KITB 1QHNA 4GNKA 3MAAC 1AA9A 5D4BA 2ATLA 1Q0UA 3MJRA 2NRXA 5KFNA 3B78A 3PV8A 9ICNA 3UWOA 2FEOA 3EZFA 5GJWC 5J2GA 5L1KA 2AQ4A 1CLUA 1JPNA 1NVXQ 3NBXX 5KT3A 2AGOA 4M1TA 3RR7A 1EWRA 1MR3F 3SBDA 1H8HA 1IN8A 2GVDC 2OAP1 1JNYA 5DQIA 2M9NA 3RS0A 5KFQA 5CYOA 1J70A 2PH1A 3QE9Y 3VR4A 1T3NA 4A0GA 4B2LA 5BW8A 4OQMA 3MWJA 4Q4JB 2RCNA 4X8OA 4LBVA 3AKCA 4MF2A 3QKSB 2JEJA 1GRQA 1HUZA 1G3QA 1TEVA 1Q20A 1OFTA 3LWNA 3UQ0A 3QQ5A 3SI8A 2W9CA 1XTQA 2H5EA 4UAYA 8ICFA 1U0HC 3IKJA 2REOA 2AFHE 3K75D 4A8JB 3QF4A 4HUQB 4RD4A 4I2EA 3BOSA 3CZPA 4PC7A 1TF7A 2GETA 5TMPA 2OAQ1 2V4ZA 7ICQA 1W4RA 1ZQGA 3RWMB 1N3BA 4BWJA 2Z0MA 4TL6A 4D4JA 4LBYA 1KNXA 4FBUA 3C16C 3LW8A 4WAUA 4H1UA 1OKKD 5JS8A 2JDIA 3O8CA 1JBKA 2IYQA 4NCJA 5L3RA 1JXEA 3RYTC 3NKVA 5AJVB 5DB7A 4LSGA 1KTQA 1T8TA 2D62A 3DZ8A 2AK3A 1EFRA 1R0YA 3SFVA 4NPHA 2WHXA 3BS4A 3EW9A 2VHJA 2IX3A 4FS1A 2UVUA 2XZOA 1SVMA 1OSNA 1YU9A 1Z63A 4YMUA 1W5SA 4YP3A 3M0EA 3MJHA 4DLSA 3FFBA 1VKJA 2ZRMA 4HLUA 2Q3HA 3PUZA 1AM4D 4PR0A 4X8MA 1TKDA 2I1VB 4GLXA 3FB4A 3PEUA 5KTYA 4CIDA 1L4UA 1XBTA 4HAWA 3J81k 4C0BA 1Z6TA 4KSCA 4A92A 4W5HA 2KI5A 4JYBA 3GPLA 3RS3A 3QKUA 4M9QA 5EJEA 2DB3A 3L2OB 4R8UA 1L3VA 2XCAA 4LYHA 4Q43A 3JPQA 1LV7A 3DM5A 1QDEA 2XCPA 2G0NA 1G7TA 2V7QA 3PNCA 2IHMA 3CF0A 5E7JA 3SYNA 2J0UA 3ICEA 1QTMA 4QJ3A 1NK8A 2WMOB 1KAOA 3M6AA 4AKGA 1KI8A 2YINC 4PQYA 2ANCA 4O3SA 3QUSA 4OQLA 8ICPA 3TUIC 2HJVA 2WWHA 3QG1A 3CRVA 4KYIB 3QBVA 4TTRA 5FI0B 3UXPA 4DT1B 2Q9AA 1ZM7A 4ZIRA 2IYTA 5JBQA 5KDDA 4O3PA 4YR0A 1P2SA 8ICYA 2AKAB 4RPXA 1YR7A 1N25A 3CKLA 4Q9JA 1G7RA 4M47A 3LQRA 1II0A 4B32A 2XSZA 5BYKA 4XVRA 2OESA 2J87A 1II8A 1X2IA 3KTQA 4DFMA 3IBGA 4J9SA 4F5PA 4QHSA 3MWKA 4JL8A 1CRPA 1VCOA 7ICMA 3EZ2A 3IQXA 4L9SA 9ICMA 3TVTA 1D8YA 3BIFA 1CEEA 3T3FA 2OFOA 4QBHA 5IHPA 1UBFA 1NIPA 3NBZC 4G3XA 1CJTC 1DS6A 1ZIPA 5JUMA 2ZROA 3SZRA 1US8B 4KLDA 3WXMA 7ICHA 4CGZA 2LKDA 1L8QA 4Q4LA 3TBKA 4A0HA 1X86B 4NBSA 5CYPA 5HZKA 1RJ9A 2C03A 3PX4A 1DVRA 1KGDA 2NPFA 1OT3A 4JLBA 1F2UA 4O3RA 3C14C 3LLUA 1KOFA 4MGIR 3X1DA 3LV8A 2FA9A 4CVNA 1ZQYA 4F93B 4DUGD 2JLXA 3ZDCA 2Y1IA 4PC3A 4NYIQ 5L1IA 3PEVA 4I1VA 3C23A 1CJKC 4US0R 3WMGA 5JCPA 2J6TA 5KFZA 1CS4C 4HATA 1NK5A 2HT1A 1RZTA 1IQPA 3VAAA 3FGNA 5KFXA 2OZEA 4OK3A 3PX0A 2QT1A 5KFBA 3MSXA 4O2RA 1M2OB 3NEJA 4G5GA 1KFSA 2Q3FA 4M2LA 4Q7KA 3UXNA 1ESMA 1KDOA 1GRNA 5DGAA 4RU9A 3A1VA 4FD2A 2IS6A 4F5QA 2QM7A 1R2QA 3QXXA 5C4GB 1DOQA 3R9WA 3KHGA 2NRTA 1NLFA 3QI2A 3M8RA 4IFBA 1OF1A 3GLFE 3BFXA 3AU2A 4OI0A 3FTQA 2HUPA 3IIJA 4FMCB 2O8DA 4IQUA 2KN7A 1J2JA 2HLDD 2G83A 4TLDA 3G0HA 2VTKA 1ZD9A 1NN3A 3PO4A 3AP3A 2CCGA 2WKRA 4A8JA 2C96A 3V7JA 4QJ5A 2VHUA 4Q5IA 4F4JA 4B3DA 1NJZA 7ICSA 4EPYA 3VNVA 3KJGA 2V9WA 2NIPA 2ZR7A 2OHFA 2QMEA 5CR0A 3ISDA 2WJGA 2ATVA 3T34A 1XU4A 2R6FA 3E2IA 5J29A 1G16A 4ILEA 2ZREA 3JVVA 4BZQA 3KTAA 3UANA 3BB3A 1GKUB 2FSIA 2N42A 3ISCA 3TSOA 5KDOA 3V7KA 1NVVR 2W8LA 1DGSA 1P5ZB 1S2MA 2Q6TA 1ZP6A 1JXMA 1E69A 2V55B 1ZQUA 3CX7A 5CJPA 1E4YA 4DT1A 3LWMA 2IYUA 4ECTA 1KFDA 1DTSA 3ZH9B 3AM1A 2C2RA 3EC2A 2XXAB 2RGBA 2H8KA 4TQRA 2XO7A 2IC5A 3EX7C 2W9MA 5DSZA 5KFLA 3KXLA 3TW4A 1RKBA 2R6AA 3A36A 2BCRA 4ABYA 5DG8A 4R8UB 2H92A 1HUOA 4DLVA 4BDPA 3MR6A 4NL4H 2ZYUX 4QZEA 4YMSA 1ZQIA 9ICCA 2RAPA 4DCUA 3H8SA 3MGCA 4YN4A 4CT5A 9ICHA 1LTQA 2QPAA 1H38A 1E79D 7ICLA 4WA7A 2IHBA 2XJ9A 3B0YA 4BFVA 4F5OA 4WVFA 1OFUX 5C1BA 3JPOA 3TFSA 1ZU4A 4US1R 4Z8YA 4O0IA 3LX5A 5J4LA 1E94E 2B6HA 3HDTA 4IEIA 3CRMA 1JJ7A 3MMPA 3ASZA 5F9NA 4QC2A 1IN4A 1ETUA 1Y3AA 1F60A 4M9HA 2EQBA 4N1AA 5JI3E 4KLGA 4Z6FA 4DOAA 1G21E 4JLPA 4LWZA 2OCYC 4P4PA 1ZM9A 2VH5R 2C78A 2JAQA 4JLKA 2AGPA 3RVBA 2W9AA 5FTKA 3HT3A 1OIWA 3I72A 1P2VA 2WTFA 1PLKA 2ZRGA 3I3SR 1ZQMA 1ZM2A 5KFCA 4RZUA 2V4RA 1EGAA 1RXVA 3RS7A 4PZYA 5J47A 3AUYA 5B2ZA 3V7LA 3QKRA 4XH9B 1OKKA 5KYKA 1E2PA 2J0UB 1AJEA 2BMEA 1S1CA 2JJ1D 3GLFA 2HHWA 2HLDA 3W5JA 4I2BA 1DAIA 4C7OB 4PSVA 4DC9A 1QHIA 4LI0A 1KI2A 4C8MA 1CJMA 1YZQA 3O47A 5IF9A 2ZETA 1EXMA 2FMSA 2RGNC 1FMLA 1XCMA 3W34A 3ETLA 2FPKA 1F2TA 3AP2A 4URYR 4BFZA 4DVGA 5HPYB 1ZQTA 3N5CA 2FSFA 3D3QA 4MF8A 3CR8A 4A8JC 2B92A 3TUZC 4O5CA 2EWWA 3IPYA 4DWIA 1JAHA 3LA6A 7ICKA 2DWPA 4HUTA 2WSMA 3BGWA 4KN7A 2QP3A 1ZBDA 3TUJC 3SDZA 2JDID 3I32A 4QNMA 8ICGA 2NO9A 4IDOA 5KFJA 4JYCA 3CF2A 3IDQA 2R62A 3BD9A 3RBEA 2ZR0A 3K9GA 1HQCA 4MH0R 4JIMA 3WP0A 1VIAA 4HAZA 5KNBA 2AGQA 3BJIC 1U8YA 4N0DA 2IBMA 4QZCA 1GG2A 3I5XA 1NF3A 1RYSA 3I8XA 5EUMA 4EUNA 3NBYC 4PQRA 4NCNA 4J9NA 4M9GA 2QTFA 2IYWA 2H18A 3OEEA 1S3GA 1U4BA 2R6DA 5EXXA 4BFWA 4YQFA 1JAIA 2J6UA 2MSDB 3WMEA 3K9LA 1EFRD 1Z28A 2C2EA 2QAJA 4A6XA 2KTQA 2KB0A 2ZI9A 1X1SA 3EZ6A 3THYB 2XZPA 5KG4A 2YZ2A 5IK2A 4DCNA 2AQ0A 1IHUA 5IIJA 621PA 3THVA 2H5XA 3AF1A 5KSZA 4I28A 3MWYW 4TMZA 4HDCA 9ICSA 4ED1A 1V5WA 1Z0FA 4HAVA 3TVDA 3FKSD 2JLUA 1XTIA 2VYFA 8ICZA 4MRRA 3K70D 1ZQJA 4OK5A 2EFEB 1SKSA 1ZC3A 5HCNA 9ICLA 4EBCA 1KZGB 3R8CA 3CWZA 4M9SA 4QOSA 4IJMA 4NHOA 4Q4HB 1JQLB 4XRHA 1S10A 1XPRA 3NIBA 1K1SA 3VFDA 1JR3D 4CF7A 1A2BA 2FPMA 4NLGA 2GK7A 1QHGA 5HE8A 2PLFA 2LYHA 1DBSA 4HDOB 1T5IA 2VF8A 3KKQA 3KXKA 3P20A 1AQUA 2ZJAA 3K09A 1A77A 2ZJBA 3JZMA 4PHEA 3RRNA 2QM8A 1UM8A 3OEED 3WYGA 1Q3HA 1QHSA 5E4FA 2BKUA 2ZSDA 1R8SA 3R7WA 4Q1EA 4B74A 1SVKA 5GJCA 5EZ5A 4YDHB 3W8RA 5JSZA 3M4YA 1RXWA 1NMZA 2ERYA 2IYLD 2NG1A 1E9CA 4Q9HA 1SXJC 3U4QB 4PHDA 4KVGA 5LD2B 3LWLA 5D46A 1XD2A 1ZUHA 5ANRB 5IRCD 4M1KA 2BHRA 4UBCA 2R8GA 4A1FA 5J2FA 2ZE7A 1VIYA 3W5IA 4G5QA 3RANA 3BFVA 2QMUA 4GC7A 2F1JA 3GD7A 1G8GA 1XWIA 5LB2A 1XMJA 5BOLA 3QPWA 1NBMA 3EIHA 3GIJA 5J2DA 2QNRA 5FBWB 5FPSA 4ZCLA 4TQUS 4B9SA 5JJKA 4QW8A 5BOMA 4ECQA 2BCSA 1Z5ZA 1CR1A 4OHWA 4DS5A 3SJBA 2F3TA 2GJAA 4B47A 2V1UA 1XO1A 4Q9LA 2OM2A 3CH5A 2PFQA 4PANA 4D82A 9ICTA 4HB4A 2BKEA 3KHLA 2ZRIA 3RH5A 3EPLA 4M1YA 3CPJB 3ADBA 1IBRA 3GLHB 4MRPA 3TANA 1NVWQ 3W6NA 4KYUA 1UBGA 4BZPA 4LHZA 1J90A 4PQFA 4M6WA 3V00A 4ARZB 221PA 5KFYA 1XJ0A 2WWXA 2FH5B 2IYSA 2YOGA 4GMXA 3X1ZA 2OWOA 1KZ7B 421PA 1MQ2A 4AIIA 3MBYA 1OE0A 1G3RA 1SVWA 2A3RA 2X2EA 2EFDB 3B1VA 2BPGA 3CZQA 1TQDA 3W6PA 4TL7A 2RB4A 5FUWA 3BH0A 3N2IA 2XY5A 1Z6XA 4TYQA 8ICMA 1YZUA 2RGDA 1SL1A 5HE9A 2PLRA 3THOA 1FTNA 4ELTA 3ZYCA 2JLZA 1A2KC 4UNNA 1W2HA 2GJKA 4EPWA 1VYUA 4O3NA 4YDSA 1HTWA 3DMNA 2CCKA 3I5YA 5TZVA 3A37A 4TTPA 8ICJA 3ICQB 3IBYA 1LB1B 1AZSC 1G6HA 3KJEA 2VLIA 3WBJA 1KK3A 5TDHA 3ZD9A 5C46F 3RBDA 2QAGC 1W7AA 4B35A 1YKSA 2ZPTX 4XUSA 2C8VA 2UKDA 2MUTA 3B1YA 4TMXA 1P75A 1NJFA 1MO4A 1DO2A 2KBEA 4B9VA 3MFIA 1G7SA 2ZJ2A 3BQTA 3NC0C 4BLQA 1OIVA 4HAXA 1N5IA 2D4HA 2V7QD 2QQEA 1YZGA 2YVUA 1OPXA 4M04A 3FHCB 5DHFA 2ASEA 2BEKA 4GL2A 1MO5A 5KG0A 3VR3A 1BGXT 1M8PA 5K8TA 4YD2A 1P9RA 1AKYA 2FLPA 3LFUA 4PGXA 2ASDA 4Q45A 2QGNA 3KUCA 4DLYA 1Q12A 1FX0B 1NSTA 1SKYB 2L0XA 1MH1A 2VL7A 1X9MA 3EXAA 1TAUA 1HYQA 1QF9A 3A1WA 4PH5A 3VX4A 4G3IA 4FMDF 4TT3A 5EQTA 3FPAA 1IN5A 1G5PA 1GKIA 4O3MA 3C8UA 4F92B 2PJRA 3B8HA 2O8FB 1E1QD 3T1QA 1FTSA 3PEYA 3ZD7A 4KFTA 4ECXA 2J3EA 5LB4A 2DCUA 2A5GA 1DG1G 1VECA 4DDVA 5L9XA 4M0AA 1AS2A 2WOJA 3RJFA 1X6VA 2QORA 3KQLA 4QZGA 2KZ3A 1JX4A 7ICVA 2NO7A 4FMBB 5CLQA 1IONA 2C9YA 3WNBA 2JIZD 2IW3A 1G64A 2SHKA 1GNQA 1Z08A 4ZIRB 2EVWX 5E7IA 3TR0A 2HCBA 1U9IC 2OEPA 4FMDB 2CL0X 2ZRKA 4NE2A 1BPDA 5KFHA 1XSPA 1O3YA 1VG9B 2QY9A 3DKVA 1TMKA 4JJZA 5A0FA 2C2HA 2ZUBA 3VNUA 4FI3C 3I8SA 3SEAA 1XXHE 1VCMA 4MDEA 4IDHA 3GLGB 5KG7A 2GA8A 4MA4A 2V9PA 3GLGE 3G6YA 2ASLA 4RKEA 3UKDA 4C0QC 4FIDA 4AWXA 4WZBE 1G19A 2F9MA 5EXTA 5G53C 1YZTA 2HVHA 5J4KA 1NK4A 4NYJR 4B71A 3JPRA 4Q1DA 5KFSA 2PJZA 2W6JD 2ORWA 2IUSA 3AGPA 3NEYA 5BXQC 4IW3B 1NJWA 1ZQFA 4C0KA 2R8JA 4Q4AA 1KMHA 1LS1A 4IDPA 2VA3A 1HT1E 4B43A 2GDJA 3PIRA 1Z8FA 4EJSC 4RQ5A 2F1IA 2CXXA 2QRZA 1BMFD 3H0KA 5EP2A 5EUQB 3ND8A 5KSPA 2FZLA 4LC1A 1ZJ6A 4YR3A 4KAXA 2AWOA 2IF0A 3IEUA 4XOIA 1VPLA 4YQWA 2ODBA 5TY0A 4KLLA 2FFHA 2QN6A 1OYYA 4BLRA 3ZD6A 4IDNA 4TUSA 1U47A 3EZ9A 5KFIA 4Q18A 1S0MA 1DAFA 4Q00A 1QG4A 5J0RA 4PZLA 4TYNA 1KHTA 2RKOA 4DQPA 2P0EA 3K53A 1CP2A 4YMTA 5FL7A 2PMKA 3AVOA 3IHWA 2MMCA 2FFQA 1TU3A 3AH8A 4C0AC 3ZVNA 2EWVA 4OK6A 1KDPA 1CJUC 3H40A 2ZJZA 2JASA 1E2QA 4LJ6A 3REFA 4Q47A 1AK2A 1SVOA 3EZ7A 4L15A 4DF4A 1UJ2A 4LJ8A 4B3BA 4DLTA 1GDDA 4C4PA 1KO4A 1OXUA 4KXFB 1XMIA 2OCPA 2AK2A 3GEEA 4P4SA 2WJVA 4ED6A 4F8RA 1G8PA 3QOFA 5GJVC 1IY0A 2RHDA 1N48A 3GJXC 2QBYB 8ICTA 2GNOA 4B6FA 4C8LA 2CL7X 2FN4A 2YHSA 1I2MA 1TQ6A 1T6NA 2GZDA 5EWGA 1ZQXA 2QSZA 1RYRA 3Q8KA 1TNDA 2QAGA 4B9NA 2F43B 2OE2A 3N97B 3FDIA 3VX3A 4QZFA 1F6BA 2XITA 3PUVA 2G1JA 4TZ6A 5KFUA 2WIBA 3C7KA 4P3YA 5CM9C 3ZVRA 2FV8A 4GC6A 1D9ZA 2H1LA 3CRRA 4IOJA 3BK7A 1AZTA 2BVNA 4HB0A 3TAPA 1N6KA 4XD7D 1HT2E 5AK0A 3CH4B 2XB4A 3EWSA 2D2FA 8ICLA 2J1LA 4L16A 2QP4A 4IXNA 3OSNA 4UB2A 1E2KA 1R5OA 2PZEA 1E0AA 4Z6DA 4ZI2A 4UNSA 4F4XA 3SHFA 3N70A 1RE0A 3T1TA 4LHVA 3HPQA 3VHLB 5B57C 1LF0A 4FWTA 4FCTA 1NP6A 2OXRA 1JXOA 1P7CA 4B75A 1XTJA 2WTUA 4C8OA 2IBKA 4ZI3A 3Q8LA 2C04A 4IQWA 2VSOA 3RAPR 4MKHA 1R5NA 4FW9A 3F5FA 1K6MA 5GJBA 4OL0A 4GOJA 2UZ3A 1HA3A 1H8EA 1JR6A 1BO6A 2PZGA 3GV7B 3T15A 3TMKA 1E9FA 1P60A 4NLKA 4JWNA 2XGJA 5J2BA 4TUPA 1NKBA 4EFLA 1NBMD 3PW2A 4DSLA 2Z43A 1ZUIA 2XTMA 2B8TA 3M1IA 4M0LA 3AVWA 1M34E 1E79A 4MKGA 3ZLJA 4UAZA 2W9BA 1G8HA 3CF6R 3Q9LA 3I1FA 2O0HA 3GQBA 1A1VA 4TTQA 3TK1A 1L4YA 3T1VA 5F98A 3FVQA 1A5TA 2OO7A 3RRHA 4IR9A 3X1WA 1G3IA 1GUAA 1KMQA 1E2HA 3T61A 2CVHA 3K0SA 1YR6A 1ZU5A 3MFHA 2X19A 1VYVA 4D4MA 3B6EA 2BMJA 1NOMA 3V6JA 8ICXA 3WNDA 5JJIA 1QG2A 3DEFA 4TWZA 3D7MA 4X8HA 4BQSA 4UBBA 3GLHE 2JLYA 4LBWA 4O5EA 1DOAA 1KSFX 4TYPA 4MITA 1SULA 4JK1A 2WKQA 4QXAA 2A9KA 2VA2A 4R7ZA 2GBLA 2BWJA 4C2UA 4ASUD 4RQ4A 2FZ4A 1N0VC 4MYTA 4I2DA 4LV8B 3B9PA 1LF5A 1KI3A 4H1VA 2ZJYA 1XEXB 4ED7A 3LY5A 1FP7A 5JS7A 5GADl 3RAXA 2J7PD 4TLAA 3QSYA 4RQ6A 3BFKA 2YYZA 2JEIA 2AL7A 4UNQA 5J40A 3ZS9A 2FMXA 1LS6A 2WJYA 4MFFA 1KTVA 4ELUA 1E0KA 2Q0ZX 1KSJA 4D26A 4EYHB 4JLJA 2B7BA 1W4CA 2PEZA 1S0UA 3RABA 5KSOA 1W48A 1T0JB 1P72A 1VCNA 4IVPA 4EPRA 1UA0A 1F3OA 3PMLA 3EIEA 1U8ZA 2XEXA 3E5HA 3LDAA 4KBFA 1SXJE 4GZLA 3SOPA 4YXWD 1JI0A 4DDTA 4XQ8A 8ICSA 4DSNA 2BGWA 3E2EA 2GTPA 2IYRA 1ZJMA 1N6LA 4RJLA 3UK6A 4R66A 2ZE6A 3T5DA 4JLVA 4P4TA 1NLYA 1ZNZA 3BC1A 3DKPA 4Z8XA 3AEZA 5CB1A 5EXSA 7ICJA 4K4HA 4GXKA 4Q1FA 4DEXA 1VCIA 4LJ9A 1OIXA 2ZSAA 3NH9A 1JR3A 3TH5A 3U3RA 2XY7A 1BPZA 2MAXA 1KEJA 1UFQA 4C0SA 4ECVA 1MRNA 3EPIA 1BIFA 5FR1A 4Q1CA 1U99A 4D0GA 4MFCA 1Z0AA 4RNOA 2ONKA 5IK2D 4ED2A 1Z22A 4HEJA 2FSHA 7ICGA 2IYZA 4DS4A 5A4JA 4ACBA 4RQ8A 3B0XA 4YD1A 3ECCA 3GEHA 4P33A 3KQHA 2WPDD 4NU0A 2YKGA 5KDLA 3C2KA 2IA6A 4QGGA 2WV9A 3ZDAA 3DOEA 4QFMA 4XJXA 1KIMA 4M6WB 3T06B 3LVQE 4KI0A 3LLMA 4BXOB 2ZU0C 1PLJA 1SHKA 2ZRAA 1JIHA 2IHNA 4KCGA 4NP6A 2PBRA 5J0UA 1COWA 4RT3A 4IOLA 1XJQA 4ZKEA 4M9JA 1R6BX 3S1AB 5FFMA 3F8TA 1B22A 1R7RA 2OBMA 1XZQA 3ISBA 2CLDX 2OT3B 3MABA 2JIZA 4CEHA 4IRCA 1ZQNA 1J99A 8OHMA 5J0WA 3AV0B 1TFRA 2JZBA 1ZJNA 2GCNA 3C5CA 4A15A 3KB1A 3R9XA 2BCVA 4KMUA 3LBNA 1XZPA 5A5GA 2CE2X 1T0HB 1J7KA 2CL6X 2J6SA 1ZQKA 4DF8A 4MQBA 2ZI4A 4DBLC 3EPHA 2BPFA 1AROP 2BEJA 4URXR 3RC3A 1KO5A 1KDHA 8ICQA 4JS0A 1YRBA 4XTCS 3NGDA 2W6JA 1GRRA 4O3QA 4JKYA 2O8EB 3ZD8A 4UXHA 5KFGA 3Q8RB 2FG5A 2P66A 3BH7A 4GFDA 3GV8B 1E9RA 3DMDA 5JMTA 2VHTA 3K0EA 1P2UA 1V43A 4FCWA 4JMPA 4Z1MA 2CJWA 3THXB 9ICVA 2QU8A 4HLUC 2YWGA 5FH9A 3H8JA 2UZIR 4C0JA 3I61A 4L9WA 5DI3A 4PO9A 1S9DA 1G291 1G4UR 1Z6GA 2P2LA 4HB2A 3TARA 1ZIOA 2FMPA 2V8OA 3KZ1E 3TSWA 4XSHA 3U44A 3RSOA 1DAHA 5FUXA 2G3YA 5DO9A 4LK2A 4URZR 4QGFA 4OJKA 2DWQA 3LK9A 1RC8A 1XD9A 2ZRLA 3PY8A 4EAQA 2ZTDA 8ICIA 1BVSA 1TF5A 4RQ3A 121PA 1IXZA 1XB2A 2GESA 1O87A 3CB4A 3TQCA 3FDSA 5KG6A 5IILA 1T91A 2IK8A 3GEIA 2W9BB 2JJ2A 3PW5A 2AFIE 2GF0A 2Z4SA 3W6OA 2FSGA 4ED3A 1JJVA 8ICCA 1SKYE 5HZHA 1RPLA 3OE7D 1UADA 4G01B 2GXAA 4E09A 1XJCA 1ONBA 1FNNA 5CLLA 4W9MC 3JZAA 1OYWA 4O9MA 1FOEB 9ICUA 1AQYA 4PAMA 1ODFA 4KV9A 3NDBB 1G8FA 9ICAA 3ASYA 4TSFA 4GZMA 1YVDA 1S0NA 4F3OA 2FGKA 2GWHA 4LVSA 1DAMA 1ELOA 3QXCA 1C7YA 1VHTA 3GJ6A 3L0PA 1N0UA 3LQQA 2IYVA 4XVQA 5KSYA 1NMYA 5FPTA 2CMKA 3VMFA 5H68A 4NM2A 3KJHA 2WKPA 2BJVA 4XSGA 3U7GA 4JV1A 4LPSA 2JLRA 4RFSB 4R98A 2IUUA 5EE9A 4FS2A 1SZPA 4YXMA 3C1ZA 2R8KA 2VF7A 1EFUA 1EK0A 1U45A 5AJWA 4POAA 1G5TA 5HHHA 5SZIA 3U6BA 2J0QA 1Z00A 2NGRA 1ZM3A 1E0JA 4RD0A 3ZDBA 1II9A 1LFDB 5J2CA 5JWOA 4Q02A 4P4UA 5DLGA 2HEIA 2O8CA 1M6NA 4IKEA 4DSUA 2OG2A 3AF2A 4TQAA 1XPUA 1SQ5A 2KZMA 4ZO4A 1W4BA 5KT2A 4BLTA 2ZRFA 4PAOA 3GLIE 1NY6A 2V6JA 3BB1A 2JEFA 1GL7A 2WJHA 4KFUA 4DSTA 3B85A 3VU9A 2DFLA 4DB4A 1CF4A 2CK3A 2VA8A 4EBDA 2HYDA 4JT4A 2UVRA 3QBTA 1XP8A 3LVRE 1L3SA 2YOHA 4O3OA 3DPUA 5FBRB 3RWOA 1MABA 1RPZA 3SJZA 4UNPA 1YHNA 2ATXA 2JJ2D 1CR4A 3T35A 5CITA 9ICIA 4Q03A 1NSFA 4B9UA 3SE0A 4EZ6A 3AP1A 1W0KD 3G5UA 4P32A 4P4MA 2VHCA 4B44A 2CHQA 3PJRA 1EX7A 2IT1A 4RKFA 3FMIA 1Z6AA 4RY2A 4LRWA 3D6TB 1XD8A 1ZQPA 4G5SA 2NMVA 4C9BA 4NXZA 2A78A 4BECA 4R9UC 2WVJA 2OLKA 3P27A 2VBCA 3IUYA 1OW3B 2ZJOA 5DLQC 3CBQA 4Q21A 4W5JA 5FPYA 5KUTA 2ORIA 4ARZA 5AWFC 2PT5A 3OHMA 1ZQZA 4KBGA 3R8FA 5BWMA 5L3QB 4TLBA 2YOFA 1XTSA 2C5LA 1D9XA 3TAQA 1J8MF 3BBPA 4OQFA 9ICGA 2FU5C 4U7DA 2RGAA 4KFSA 2P6NA 3U3OA 4QWDA 3TNFA 3UXOA 1XDBA 4I1OA 3OE7A 3U7HB 2R6CA 4B33A 1VTKA 4J0QA 1R0ZA 7ICIA 2IYYA 3C5GA 1ZETA 1MOZA 3B1ZA 4QGHA 4B9TA 3C15C 1G3UA 2VHQA 3CUEF 5H1YA 1W36D 2UVQA 4HAUA 2PXIA 1IOZA 1DO0A 4JJKA 1KO1A 4WXPA 3M9MB 2QE7D 1UKVY 4OQNA 4IFEA 3TSZA 5CDFE 2VQSA 1JEDA 4MDFA 3H86A 1XPOA 1HURA 5KFRA 4DL7A 4KLTA 4IRDA 1SL2A 1T5LA 2WAYA 4G1UC 2W00A 3GJ5A 4QBIA 3LRPA 2P6RA 1X9SA 4AYWA 4P2HA 4I4LA 1U9IA 2F9LA 1G18A 1QSLA 1RRFA 2ZS7A 2XGPA 2ODEA 5KG2A 3C2LA 2W0SA 1XMVA 9ICJA 1XSLA 2GZHA 1RYHA 2ZI7A 2WOOA 4F2RA 2R8IA 3A4LA 4J9QA 4MYCA 4A0FA 4C7OA 4MYHA 5L8VA 1KKMA 3GLFB 3RSLA 1XRJA 1A4RA 1NRJB 2ZIAA 4D0NA 4E22A 2CCJA 4GP7A 4A2QA 1ZQOA 3IQWA 2EFCB 3IHQB 4NKRA 1WXQA 3OFND 3ZVLA 3RRGA 2AXNA 2VPPA 5EP3A 2OCAA 3SR0A 3ZDDA 2F55A 3GILA 3QZ8A 2ZRNA 2ZS9A 2DBYA 2FMQA 4LJ4A 5IIKA 2NO6A 3RJKA 4QZ9A 4BFTA 8ICAA 3EYZA 3PW0A 2P65A 2PFNA 1RRPA 3NHBA 5BN3A 2H7VA 4GPTA 4PHAA 1Q57A 4QBFA 1NBME 2KJQA 3AUXA 2XY6A 5G40A 1MSWD 4AD8A 1Z83A 2V3CC 1W0JD 4ZCMA 2ANBA 4YG2A 1HEIA 2VP2A 2EYQA 3W8NA 1DADA 2Q3MA 4AKIA 1KNQA 1SXJD 4F4KA 4M9NA 2IS2A 4LUCA 4IQTA 2ZU6A 4Y0AA 1I4TD 2A2ZA 3OHAA 3FE2A 4DEYA 4US2R 5GVRA 1EX6A 4DIDA 4A36A 1ZNYA 4IDQA 4AURA 3FMFA 2O8EA 4RNNA 2CHGA 3JPNA 1W2GA 4DO9A 2AHOA 4YFKA 3M9NB 2IEZA 3MRSA 3K0CC 2AN9A 5KFDA 1COWD 3MG9A 3U3MA 4RQ0A 2BDPA 2PT7A 3B9QA 2GXUA 2Z5FA 4KFRA 1C1YA 1G8YA 4UAWA 3EA0A 5FTJA 4DCSA 4EJSB 3IHLA 4YONB 4Z1MD 5L3VA 4L5BA 4I2AA 3VTKA 4PHGA 1S1MA 4PPNA 5JFGA 1I4DD 1CTQA 4XWAA 3OF5A 4W5WA 4DFPA 2BMDA 1Z0KA 1DELA 2QMHA 1KAGA 4A6PA 1PZNA 2JATA 2GWSA 4JLMA 2F3RA 4DCTA 3TW8B 4I29A 1W44A 1E2GA 3PEWA 1NJXA 1U81A 3EC1A 8ICHA 4FBTA 1JALA 3QF4B 4C2TA 1UT8A 3UPQA 3T5HA 1NL3A 5KFMA 4QZBA 2V1XA 2XAUA 4Q01A 5B30A 3AVXA 1FW6A 4B3GA 2W9CB 1IAQA 1MT0A 3L0SA 3SQXA 3C1YA 2UVWA 4PX9A 9ICRA 1NJGA 1VMAA 2NRVA 2TMKA 2KWIA 1GITA 1US8A 5DNYB 1TTTA 4Q7JB 2DFKB 3QPVA 3RB6A 4LYFA 1Q44A 5DGBA 5CB6A 1E2DA 4DQRA 2H57A 2XOKD 2QTHA 5EE0A 3ZIAA 4M8NE 4EIWA 1DE0A 4RZXA 4LZGA 3Q8XB 2BCQA 4ZDWA 4I1UA 1E4VA 2D2EA 4MKFA 4RVCA 3SBEA 2QL6A 4MKIA 1CKEA 4KLMA 3SV3A 1DARA 1BPEA 5EWFA 3HW8A 2OV2A 1FNMA 3AKDA 3DL0A 4YR2A 7ICUA 1XD2B 2A5JA 1MKYA 1ZUNB 4F4IA 2XNSA 2IS4A 3U4QA 1AGPA 3CM0A 1Z2CA 2RMKA 2W6IA 1NLZA 2AU0A 5DBBA 2GXSA 2ZRHA 4NZYA 1ZD1A 2IXFA 3K0FB 5DQGA 3WHLA 4ECSA 5HP4A 1JECA 1K5DA 3QEOA 4DXAA 3TE6A 1TQ4A 3OESA 2P6UA 1U48A 4Q1AA 4DL3A 3O8BA 1ZCBA 2WWWA 4F2SA 3L43A 1AGRA 3K0FA 2E87A 4YXJA 4ITRC 3DO6A 1IN6A 1N6PA 4EPXA 2NRWA 3BDPA 2W83A 2CHVA 1G3MA 3P26A 4QJ4A 4PAQA 5DYGA 1IY2A 3M9OB 3SS8A 4A2PA 4TYYA 5DG7A 2WWYA 4CEJA 3Q7QA 4CRWB 1MC8A 2QAGB 4LBZA 1ZNXA 1TPZA 1N56A 1XEWX 3HU1A 5E3HA 4M1MA 4U5XA 3RJIA 2OILA 2KFZA 2HT6A 1MABB 1WRBA 3P1JA 5KG1A 1QHXA 5JWHA 4BGDA 1YJ5A 3A8TA 4K8OA 2XB2A 1G4AE 4HZIA 3K0CA 2EU8A 2KZZA 1A7JA 821PA 2ZS8A 5CK5A 4UXIA 5AUPB 1SVLA 3N4MB 1DAKA 2ZI3A 5DE3A 4QM7A 1PV4A 4E0DA 2AXPA 2PFOA 1G1MA 2FWRA 4LV6A 5F9FA 4OYHA 1UF9A 1E32A 1KJWA 4OKSA 3NG1A 1XTKA 3A58B 4Q48A 2HHSA 1GL6A 2WSSA 3SC3A 5DIFA 4Z51A 4PHHA 4DOBA 5J2JA 2J0SA 1U0LA 2IXGA 3EZ5A 4LHXA 3PQCA 3TR5A 4C3ZA 3ZZUA 8ICKA 3LXXA 4PC2A 3GP8A 2GEVA 2AX4A 2Q9BA 4K81B 2D7CA 4DB2A 1N0WA 4MEXA 4DZZA 3U61B 2O8BA 1JPJA 1Q3TA 3THWB 3KXIA 3QKSA 4X8LA 2R8RA 3PITA 1PVOA 5HHIA 1ZMXA 4UB5A 2D06A 3A4MA 4AKEA 3EPKA 1ZQWA 5FBQB 3AF0A 3K9HA 1FQKA 4BEJA 3KKNA 2J5XA 3OGUA 5J2IA 3IGFA 1G20E 3KQKA 2W2VA 3ZDEA 5C5JA 1Z06A 2JCSA 5P21A 1E1RD 2QE7A 3V9PA 1HE8B 5C18A 1X1RA 4IVQA 1NK6A 3A1UA 1BS1A 4KJZA 1N5JA 4D80A 2CNWA 3LO5A 3MLEA 1RVDA 4Q7MB 3UATA 1UAAA 4QNRA 1GAJA 2ZRJA 1H65A 3A1SA 2NQ2C 4YLGA 9ICXA 1MO3A 4JSYA 5SZKB 4O5KA 4QL3A
chains in the Genus database with same CATH superfamily
9ICEA 3K70C 3HG7A 3X2SA 4CF3A 5LQDA 2QR3A 4PNPA 1XMSA 3VZBA 3Q85A 4RU1A 4HYKA 1JVNA 3SM9A 5CNMA 5EIBD 4EPTA 5KMGA 4V0OA 2GRJA 3CW2A 1TZKA 1OTHA 3CUSA 4LMAA 5KL1B 4AWAA 2E4XA 1XRRA 5HR7A 2YRWA 4MCAA 2YV5A 1YQTA 3VYTB 3NXSA 3JPTA 2Z6VA 1FSPA 4M98A 3ZDFA 3B2EA 1KSGA 1FF9A 2HDHA 3FNQA 3N6XA 2P4UA 4FTWA 2G0TA 1ZGCA 3PSHA 4GI7A 3K16A 3VSDA 1XTVA 3RTEA 1ZA2A 1JEQA 2B1RA 4LY0A 2WJ3A 3MCTA 4OB6A 1GFIA 4MWTA 4BMSA 2ZZNA 2K5UA 1N4AA 1VG8A 3IT3A 3SPXA 1T9HA 3OHBA 3UZUA 1PUIA 1LH0A 5ICEA 2WUFA 3N28A 3DE1X 2BUAA 4Z54A 5BVHB 5J0PA 4JJ6A 4WNAB 3TQRA 3V7UA 3D4NA 2EBHX 4CIVA 5B3KA 1TB4A 3IAHA 3R5SA 1P2TA 3NVAA 5GIOE 5DDYA 1JDNA 3DL4A 4KN4A 4D6PA 3LWDA 4MVJF 5A3QA 3LHDA 3L4EA 1ZD4A 4X1IA 3HJRA 3O2JA 2PMBA 3QY0A 3SAGA 3OTOB 5ALEA 2WILA 3UHOA 1G66A 2XICA 5F3WB 4JK3A 3NNNA 1YQUA 3TM4A 4UAJA 5HQ3B 1X9XA 4ED0A 1KYQA 3UG7A 5ES4B 4IIYA 4YAOA 1IMOA 1SIJA 1QLNA 1HL3A 3JQBC 3LDFA 1MJ5A 1QHYA 3KQVA 1U2ZA 5I5GA 2H07A 3HPOA 3WMXA 1AX9A 1U65A 5FAXA 2PYIA 4F38A 4KKXB 1JQJC 2Q29A 3B48A 4FR0A 4YAFA 1OVGA 3IDSA 4PPGA 2DVMA 1PWZA 2OHIA 1C8KA 3GIWA 3C3AA 4KMMA 2EJUA 3FSJX 2DUWA 2OXTA 1Y6GA 1VHJA 2PI4A 1VP3A 5AKHA 2VVTA 4OI4A 5CVEA 5IW8A 2WY2D 1SG9A 5BWNA 3ONVA 1V1RA 3GGOA 3T9CA 1N60A 4PHPA 2G9RA 5TV2A 1SQFA 1JQ3A 3OT1B 3AQ4A 3FF1A 1TT5B 1DAEA 2GCEA 2H17A 5TPWA 3OCZA 3TACB 1M54A 2QN1A 1F6DA 3GFVA 5DTMA 5HZMA 3SZOA 1CVLA 1X14A 5EXEA 1VHLA 2VDVE 2Z2IA 4UDYX 4EK9A 3GIIA 4TURA 2J9YB 3LKDA 3RH6A 2DH6A 2I78A 1DX4A 1M0EA 3JD2A 4BZXA 5CDYA 1K6IA 4QT4A 1KMHB 4JBLA 3UGJA 3SYZA 3ZU5A 2OXFA 5AXBA 1F9EA 4UB4A 1WBDA 4F56A 5DTQA 3S2UA 1AUPA 2IZZA 4N82A 4URUR 3H65A 3KU4A 4BO4A 2C3UA 4KTVE 4KQEA 4F9FA 4CEIB 1CFJA 2Y1KA 4NV1A 3IAM1 2RE8A 1P74A 1ZRHA 1BRTA 1KDTA 3PUYA 3NHZA 4GUAA 4PM4A 4MEBA 2KM1A 4DCPA 1I6KA 2F8KA 2ZRDA 5CXSA 2JAUA 1YFZA 5JATA 1UC9A 2H1RA 4QDKA 5CIQA 1T5BA 3NHRA 1X7WA 4RA9B 4HVCA 2YWEA 3W5SA 3EVGA 3LX8A 2I80A 4UBLA 1N0HA 1YIDA 2BBOA 2FMHA 4MINA 4PZCA 5DBCA 1D6JA 2NZWA 2IDJA 4MO9A 1WE2A 3SU8A 3WSWA 1EVQA 1SHUX 4EYIB 7ICNA 1U98A 4KPUB 1E59A 1W1WA 1Z07A 3K1JA 2IU4A 3K5PA 1U1FA 3WTCA 5DM70 3M8SA 2W6OA 4ZALA 4DNOA 2JIOA 2YNMA 4CKBB 4D8WA 2EFJA 1UKZA 3ZOKA 3PT9A 2Y93A 1DI0A 5JZBA 1E9SA 4JJ7A 1R64A 1GPNA 1X1BA 1R0WA 2BFCB 2Q0HA 2WAAA 3BKXA 1Y63A 3K0AB 1HV8A 1V41E 3ACCA 1L4KA 1V9PA 4KIJA 4WERA 5LMCA 4Y2QA 4YV2A 1RRCA 1JDTA 1Z47A 3E1KA 1V35A 2QX6A 3A9TA 4KODA 1SH7A 2JXJA 1OZAA 1C7FA 5DBIA 4XWOA 4BC1A 4EF4A 2C4KA 4ESVA 3F3YA 3VO2A 5EE3A 5FX2A 2A30A 4BFUA 3MUFA 3ELBA 2WABA 3VVBA 1G38A 2PG3A 1GNRA 1S0OA 4EZIA 3AKEA 1T25A 4NYIR 3COZA 2JEOA 4M53A 4BLPA 1GXSB 4G2NA 5HS6A 3OC6A 5JEEA 4HXGA 3PVSA 3T94A 1RQNA 1GSAA 3R7AA 2QTCA 3WO0A 1PK9A 3R7BA 2HA2A 5TGDA 3HP6A 4IVRA 1H4VB 2AOTA 3MAGA 4FGWA 5F5NA 1WBBA 2PX5A 3C4JA 4JOQA 1U11A 2JGDB 3HR8A 4NEGA 2GILA 2DFTA 3SY8A 4KLFA 2IMWP 1IULA 1DJPA 3DE4X 4GC5A 2YJ6A 4Q16A 3OE4A 3ES9A 1YB4A 1Z5VA 3C2QA 2Q9CA 2FGJA 3DXZA 3UCEA 5CJ7A 1D09A 1TJ3A 1VBFA 1BCSA 2RH5A 3AFGA 2FFRA 4AYBC 1YDFA 1ZGGA 1JFLA 3BAZA 2IVZA 1K63A 5T4FA 2EKBA 4I1SA 2ASJA 2IEBA 4D97A 1IM4A 2GEDA 1RMQA 2QVYX 3R5HA 3ZWCA 5LPNA 1JKJB 3I52A 1GOTA 1F3LA 4WZBA 4BO7A 2Z09A 1CQPA 2P4QA 3D3KA 3ND9A 5CAEB 1J33A 2R44A 2NYAA 4O2LA 2ZM5A 3U6KA 1RRVA 2G0AA 1RM6C 3ORRA 1EM8A 3T0GA 1ZK0A 5AH0A 1QRAA 2A8YA 3B13B 3U3KA 1PQYA 3NOVA 3TSAA 5MN6A 1E9DA 1M66A 1POWA 2XUJA 4X3PA 1XQVA 4HYQA 4BV3A 3LXRA 1K5GA 2FOLA 3Q8SB 4HXEB 3AEKB 4B87A 3W5VA 1PEDA 1JU4A 2JHPA 4JEUA 4RTRA 4XZ3A 2JKZA 1X80B 4NYJQ 3WZLA 4AG5A 5C0YA 3V34A 2YXBA 4DM7A 3CN7A 3QXJA 1FP6A 5A7HA 3TKLA 1AIPA 2WM9B 4P22A 3ZTYA 5JCZA 2PT6A 2VJPA 3R74A 2J6IA 5C1OA 2Y99A 3AF4A 3C5VA 2A9VA 1DKMA 3IA2A 4PLGA 3VZQA 1EPUA 4LJ7A 4EGJA 5J58A 2AMYA 3NHFA 5BURA 4NOJA 1KEVA 1WVMA 4Y2YA 3PXXA 3TSYA 2OOSA 2BUBA 3LP8A 5IDVA 5BR8B 3NKLA 1R1DA 1DIBA 3ZE1B 5F73A 2FUG1 4EMUA 2C77A 1G5RA 1RWMA 3QFCA 2H06A 1X8JA 3BGIA 3JYNA 3T7EA 1ZN8A 3I4FA 1JSRA 4EHNA 2PS0A 5JAQA 2JLVA 2Q9UA 2P35A 4R51A 2IZ5A 3G79A 4IILA 2PMEA 3AFOA 1LVGA 5KFPA 2Q4BA 2YZKA 1E7QA 4TOIA 3AFNA 3WYFA 2BH9A 2YUIA 3LVBA 1R4NB 3LAWA 3HCCA 4PG4A 5DXJA 5IAKA 3ZR4B 4H3KB 4IOMA 2FF5A 2BGUA 1NR5A 2C4NA 2XDWA 2ZSFA 5M34A 4FLEA 2IU6A 4WBSA 1ZCAA 4NBWA 3VHQA 5KREA 2R8PA 4EGFA 2JEGA 3BRWD 4LWOA 4R71A 5HRUA 2P1DA 2ES4A 1PK7A 3IEVA 3PR1A 5IULC 4HZUB 3R7SA 2F1RA 2R6ZA 3RJ9A 3MOSA 1C50A 1N2CE 2AWNA 2CFRA 5A9SB 1CFZA 2ESRA 3OCVA 4HNVA 4OAPA 5I7VA 3FOZA 4AN0A 2IHUA 1LD3A 1FSZA 4KO2S 3D4OA 1G7CA 1FIUA 3L82B 1TM3E 4X41A 2XUHA 5BN5A 4PSKA 5DB4A 1KQNA 3S1SA 1RBQA 1SOAA 3DAOA 1S9FA 5AIBA 2NUAA 3PQ7A 1SGGA 2QLBA 3VNRA 2XMDA 3JD0A 3JVUA 2BQ3A 5IT5A 2Y27A 1RRKA 3C1UA 3IAS1 5IIMA 2AFVA 2BCGY 3ZX5A 4BJHB 4NV0A 2WF7A 4XIGS 1D8LA 4PL2A 4U8GA 4J9PA 2J3IA 2Y9PB 3MWFA 1KK0A 2XNDA 3KLBA 1OTYA 4WXEA 2XMRA 5DW3A 3WS7A 5F7XA 4HLDA 2O7SA 4USAA 3IUBA 3KSZO 4B8ZA 4B2YA 2BDUA 4ZV4A 1GLNA 3PHLA 3K9WA 2CNNA 4LKOA 3I04A 4XFKA 8ICWA 1RACA 3GZNB 4MVJP 3KB2A 2COEA 4IRMA 4E1VA 1BWQA 3D6JA 3RC8A 1SGWA 5C2JB 1GUZA 2MA1A 1JFFB 1IE3A 1X40A 1JA1A 1JWAB 1PTJC 1VG0B 1M1ZA 2HB6A 2XX3A 2ZAOA 5KNCA 3C74A 2QS9A 5FCDA 1P3Y1 1XZAA 2E0IA 4WZAA 2GD6A 4H7IA 3STHA 4Y2GA 2QY6A 4G23A 2UZ1A 3OQPA 5ADHA 4UEKA 1KZ1A 3HSKA 4CL3A 3LUAA 2J45A 3D54D 3R77A 4I55B 2DPXA 4LPKA 3W9YA 4MRNA 4C29A 5AT1A 4L6IA 1H8HD 1XVAA 2R1TB 4JV2A 2AHRA 2BSXA 3H83A 1NN1A 1ZVQA 2Q3BA 4TROA 3UMJA 5B6PA 2JKYA 4UM9B 3IAEA 1ANKA 4BIIA 1FRNA 4RUKA 4YH1A 1UMDB 2QX8A 2F6RA 3OUTA 1C20A 3QPUA 5LQSA 3STUA 4ZMSA 1F2VA 5E1DA 2O1EA 4HGZA 2ZQYA 1AN0A 3OJFA 4GOXA 2EJVA 1E6CA 4YRCA 5JAUA 3OMXA 3GQCA 1PU2A 3CJQA 4FYKA 4BZWA 3WWEA 2VJKA 2VCYA 3S8MA 1A8UA 1ILWA 1DMSA 3RVDA 1QP4A 2I1QA 1JHPA 3HU2A 1JLKA 2CKDA 2HQSA 3MQ2A 4I08A 4EHKA 3WGNA 1JLLB 2ZJ8A 2DFPA 2I6UA 3GLKA 4L95C 3BMCB 1QQ6A 2QNIA 3NHJA 3PTLA 5JCJA 1QTQA 4IUDS 1YA8A 5EIWA 4A03A 1JEQB 3KM0A 3UJPA 5AHXA 5BPCA 4DSEA 1N7HA 1OFHA 1QLHA 4H6WA 4L85A 4P35A 1OZFA 1SWVA 4JP5A 4QHTA 4QNNA 2OFFA 2CHFA 1EGVB 4N18A 4EFDA 2D13A 3VH2A 2ZYTX 4K46A 3G0GA 4YCXA 3BXZA 2KHVA 4EZEA 2XT6A 1HF3A 4D41A 3L0OA 4TKZA 4DBVO 2QD2A 1IIPA 3QGMA 5DI3B 5IZCC 2V5UA 4NLNA 4GDMA 3KFLA 5K0ZA 1S4QA 4DEZA 3IV7A 1U4NA 5LUBA 2GJ8A 1IXRA 5KWEA 4KLUA 4INPA 4EENA 1I2AA 4JZKA 4XPZA 5EMJA 1DXSA 3W90A 3CX8A 3CZRA 4HLCA 4RAOA 4DC0A 5FRDA 3ER8A 2Z4RA 1CDOA 4BDTA 3IJEB 1RC1A 5ADUS 1XELA 2BCUA 1Q6YA 1IM8A 2NU6B 3F4KA 5EPEA 1Y6RA 1AHNA 1T3HA 4C3UA 1E2LA 4QDTA 1O8CA 4W7SA 3U7QB 3O8OB 5B58C 3QLVA 2EZ9A 5H4GA 3H5VA 4CTKA 5KFVA 4O4LA 3V1MA 1L5NA 4RTOA 1ZOIA 4QPCA 4URWR 1ZR2A 1VLQA 2EC5A 5C5EA 4TQ9A 4XQ0A 1QOPB 5B7QA 4ECUA 1LVHA 4R64A 1O89A 2WB1C 2PZFA 4QRIA 4NYMR 1JDPA 5D49A 2VTEA 1GN8A 1G5FA 1RZVA 1SHLA 3GFKB 1Y9AA 3L3FX 1T2DA 2RAFA 2ZAMA 3CS3A 3HJCA 3KKMA 1Z0SA 3PPWA 1NTOA 2W6MA 4IDDA 4OP1A 2NUPB 1OB5A 3TCXB 3FLMA 2DOKA 4KVFA 4GDFA 1VMIA 1N6RA 1N5XA 1KR5A 4XR9A 2CFOA 4NICA 4ZK6A 5F35A 3TX2A 1QNFA 1PD0A 1FP4A 2NYUA 1FQJA 4KQCA 1G8SA 4XWKA 2PH3A 2FKAA 5GM1A 1YBMA 3G7UA 2QPOA 3RB8A 1DP4A 1ZYUA 3MGGA 4NU5A 1PFYA 5BY2A 1S01A 3AYXB 4WBNB 4Z9FA 2VQ3A 5A5VA 1SBIA 1ZUWA 2HWWA 3AM5A 9ICBA 4DDWA 3C5HA 3TGPA 2ZRPA 1EQAA 4UXJA 2AN1A 2A58A 4AROA 4QDOA 2BFMA 1H9AA 1QG0A 1EM6A 2PGNA 1PVDA 2EHDA 1D5CA 2Y1FA 3F6BX 4L0QA 1IZZA 3DZGA 3IIMA 3KR9A 4Q66C 3TQFA 2VSFA 3VR5A 3ZE7A 2KJ5A 4IHQA 1QIMA 2OBLA 4LZPA 1AS3A 1XC9A 2D8AA 2RARA 3CMMA 4PLWA 3SX2A 2P3OA 3OF2A 5IJ0B 3CXUA 4CNQA 1QBGA 4X66B 2VDKB 2XODA 2P5SA 3QG5A 4POOA 3NFRA 3DBLB 3VZCA 5CA1B 1D0SA 1YI0A 3UNXA 4FBLA 3OU7A 5LDDC 1DUIA 1O5OA 2MSCB 4NTZA 4FXPA 2BM0A 1CXZA 3JWPA 4XCQA 1A8IA 2PL5A 2CLKB 3MHTA 3X1WA 3CNHA 2FXIA 1FFHA 3EG5A 3RIXA 5IHXA 2PS3A 1BS2A 3AB7A 1M7HA 2PUDA 1JWBB 3VYUB 3TTUA 1U1DA 1ZA1A 3I28A 2PKQO 1SELA 4W8HA 1J1UA 2B0CA 3TKYA 1NU8A 2KEYA 3F2BA 2HHUA 2GA9A 2NO4A 1XSNA 2QX4A 5DLFA 1Y8AA 2HSGA 3BB4A 1IQ0A 3KDSE 2K2QB 4C07A 3IOYA 3KT6A 4D79A 1KH3A 3RTVA 1D9DA 4DMKA 1ZBQA 3LLVA 4MMZB 3KQYA 1D8TA 4YP1A 2EAOA 1K3TA 2M1XA 3RGGA 2ZDQA 2Z2XA 4BNYA 3MXTA 1EA7A 4XD7A 1R0BA 1Q11A 2COUA 1LB2B 4X1OA 1KYXA 3U7IA 3VR4D 4F5WA 2OTCA 4KXVA 2IQIA 2QWXA 2RHLA 5AJZA 4QRHA 2GN2A 3ED1A 1KI7A 2A86A 3RVQA 5KFAA 2I9GA 3QITA 1M0TA 3V4FA 4UASA 1G42A 2OB1A 1JMYA 4TUYA 5FLYA 5I7HA 1AQLA 2NSDA 3T99A 4OREX 2HW3A 1TL7C 1XDSA 4NXMB 4YRTA 4QW9A 4FGSA 5KTPA 2HLPA 5CEHA 1D5WA 4COOA 1U31A 3LPNA 3S55A 2KS6A 4M2YA 1UBKS 1H1DA 2QLLA 2Z95A 2HOIA 3F71A 4HRVA 4LHEA 3NTQA 4RF4A 3V6MA 4I4TF 4N4AA 4C30A 2X77A 1YDMA 1YR3A 5HQJA 3M7IA 2I65A 1DIHA 4IP0A 4BIMA 4MP8A 1WF3A 1SUDA 3UIEA 3KFUF 5JDIC 4TMWA 1Q7EA 4GE3A 3AKZA 3PDUA 4QM6A 4UJ5A 3L4KA 1U2DC 2B6NA 1SXJA 3HKZF 1XEFA 2WD7B 1H4TA 1E3SA 5ALVA 5JFTA 1ZIDA 3IJ5A 1U7TA 3GYGA 2F8LA 1DQYA 3DZCA 4ESOA 3C2MA 1HFWA 4WOPA 4KWIA 1NK0A 3HL4A 4HMQA 4QAJA 5DI9A 4ZD6A 1Z38A 3GL9A 5HIJA 2C22A 1M74A 3DV0A 1IVYA 3NVDA 3M6IA 3EY9A 1I8TA 4KL8S 3I73A 1A76A 1P0FA 4GLJA 3G6VA 4J9RA 1P4JA 2KBFA 1G55A 1N7GA 3WWOA 5HUQA 2W2NA 2OYYA 3Q5EA 3ZGOA 3L5KA 4WY8A 4AS1A 4RCZA 3BZUA 5KFTA 1DSSG 5J0OA 3MR5A 1MEJA 3PD7A 3IPLA 1S8FA 3R9IA 5A0VA 3TFRA 4BO8A 3D2NA 2PFPA 1IM5A 1NC1A 1TKBA 1UPTA 1VE3A 2BF4A 2OHGA 2QEQA 2VSNA 2WVAA 2FMKA 2B20A 3CSDA 3H2JA 4S35A 5U4QA 5BXYA 2XRZA 4DNFA 3HCFA 2HV9A 1VE7A 4Z3KA 4E2YA 3EQ8A 4PSAA 2KHZA 4LA4A 5B1EA 2DBQA 5EJ5A 3KSAC 2B4KA 4D0LB 1Z9BA 5FTMA 3AHEA 1XCJA 5F7JA 1BDBA 1P1KA 1CUSA 2ZTCA 1BMQA 1SA0A 1T4CA 2GBGA 1H2EA 2DLNA 5DB6A 2ZVDA 4N8DA 2O7NA 3MTDA 4L0DA 4K86A 4YR9A 1TZMA 3N9IA 1AF7A 1HY3A 4ZT4A 3ZBPA 1MJGM 3IBTA 4AQ7A 4KYTA 1CJSA 1SVNA 3LOUA 4E07A 2LI6A 3LQYA 1DC4A 1SUFA 3T5LA 1VDZA 4K6GA 4BMOB 5A03A 2WNHA 1NKCA 2DWCA 3F98A 1O94C 3M9WA 1ISHA 3WLLA 4DJJA 1UZMA 4RV4A 1T8EA 1G41A 3E3OA 5I9IA 1QF6A 2WPDA 1ARZA 3HVUA 3SJCA 4D8YA 1BG6A 4QTUB 1L4MA 1KTIA 3F1LA 3VH3A 9GPBA 2O2CA 4WKGA 2J67A 3ZWDA 4ZC8A 4N7RA 1E3WB 4JYZA 5KKNB 2WHYA 3QMVA 9ICWA 1NULA 5AVVA 1BCSB 1EXVA 5CD1A 5EMMA 4GWGA 1MUUA 3KEGA 1U90A 5CDGA 4OFBA 2FKNA 1L7QA 2V3VA 2GN6A 3DFMA 1UBOS 1ENPA 4QWCA 3LLSA 5AI5A 1BXGB 3CLSD 3QVWA 3TN7A 4DJTA 1K0UA 4WT7A 4Q19A 1L6NA 3PDWA 1EX1A 4QQFA 5FL7D 4A2WA 3COSA 4DHEA 3BF7A 4BFYA 4RQ1A 4ELVA 4MP3A 4EA6A 4BLOA 4QZ8A 1A9RA 3DQQA 2YWXA 2G1UA 5CCDA 1S9HA 4J0KA 4TMXA 1FSGA 1DTWB 3EB9A 4YUVA 4PZEA 4GOND 1B8PA 1U7ZA 1GXSA 3R23A 7ICOA 1XDWA 1WMSA 3QLTA 4WI1A 2QIOA 3QV2A 3SKXA 1FO4A 4REQB 1AXRA 1NVUQ 4QECA 4RADA 3X1MA 4CM3A 4LY6A 2MT9A 5ALHA 1E2NA 4MRVA 2VKTA 3S2EA 3OQOA 2Z4TA 3EIQA 1AKQA 1SCUB 3NIDB 4AMGA 5EE5B 2NUPA 3GMTA 2H16A 2M98A 1XHEA 1JB1A 4RQMA 1YD7A 2PLWA 3FIUA 3U48A 4BNJA 5CFOA 1PK3A 1Q8KA 2KNJA 1CZHA 2GJSA 1UP6A 2IU3A 2ZSJA 5L53A 1CUEA 2ZUCA 3LYSA 2OQ2A 1M72A 2V7BA 3TZBA 1SV0A 2G40A 1W6UA 2Y8EA 4J16C 4CMBA 1W6RA 1L4GA 2B8WA 2FUKA 1ID1A 4NJ8A 3ZH2A 4B7CA 5IAOA 3FKSA 4FCVA 3BMQB 1C2TA 4LMBA 3DKIA 1V8BA 2CLMB 4PFSA 2XE7A 2DZDA 3MRVA 5I4BA 3IBSA 3RBZA 2LKCA 2J85A 2AFHB 1YU6A 4HGOA 3B1KA 4UUBA 1Y9DA 2DT8A 2J0VA 4EDHA 1T3ZA 3B1FA 3U3DA 3IS3A 3UC9A 3O5AA 2EEZA 4TZTA 4KXLA 1ZD5A 1JV2B 4ARSA 1RYYA 1JFSA 1YZKA 1A7AA 2PX3A 3TLBA 2CXPA 1LQ2A 4D92A 5DTJA 3VOTA 4EZBA 1JIJA 2ZBVA 3RRYA 4DL5A 3NAZA 4RIGA 1XMOB 1T9AA 5FTNA 2AQ8A 2I8AA 4M37A 1UCFA 3L4PA 1OXVA 1O1YA 2M2IA 3RT1A 2WJWA 1YTUA 4DFKA 1ZG3A 3GLHA 4EQ6B 2XCTB 4ZZIA 2E82A 2CJWB 1YZYA 4P38A 4ZQBA 3KKZA 1NW5A 3Q6MA 3W5AA 1L5YA 4BO1A 4EMSA 2NPOA 3WIOA 5KT7A 4DSJA 4JKIA 5B4UA 2HF8A 3U4HA 3R3ZA 3LA8A 2BCJQ 3OZUA 4B9MA 1UWCA 2O8VA 2KIWA 1QBKC 3IH5A 4R41A 2ISCA 3SQOA 3VKFA 4BJ5A 1YS7A 4PNEA 3UJNA 1XMQB 1I1OA 3ZKWA 3CO5A 3D6AA 1CQIA 3DAYA 4OKNA 3ID6C 1BVYF 1SUAA 3NBKA