1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein RAD51
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
1ZD1A 2GZAA 821PA 2GZHA 3GEHA 2WTUA 4PHHA 2VP6A 2WICA 2ZAOA 3HU3A 4QZ8A 4OHZA 1SVIA 3KQLA 4C2UA 1TF2A 1IN8A 2OCAA 3RHFA 2WIBA 3OIUA 4QKQA 1Z29A 2FNAA 4TTPA 4DEYA 4B9MA 3OE7A 3QSYA 4Q8EA 3PITA 3EIEA 2GNOA 3M8SA 5DHFA 9ICXA 4TYWA 4JV0A 2ORVA 1XEWY 3AVPA 2F3RA 3GJ5A 5BYKA 2BKUA 2GAAA 1ANKA 4GI7A 1OXXK 5CM9C 4D4MA 2RHDA 2ZSDA 1KI3A 4IDHA 3WNDA 4A92A 2Z4SA 3QXSA 3THYA 3KJIA 2ZPTX 1F6BA 4ZCIA 3QE9Y 4F5PA 2VA3A 5JHHB 2JLZA 4E0DA 8ICAA 1G7RA 1R0YA 3IHLA 5EE0A 1U9IA 4KV9A 4B47A 4BFTA 2CMKA 2YWHA 1RJ9B 4M04A 1CR1A 3KKPA 4M21A 4AK9A 2IXGA 5DQGA 1QLNA 4URWR 2QTVB 5F9LA 3SYZA 3FHCB 3CPEA 3BE4A 4A2WA 4HLUA 5HCNA 2A5DA 1PUJA 4QZ9A 5A4JA 2N42A 4E5UA 4QZCA 3QVUA 1N0VC 2GXSA 4P31A 4Q8FA 1Z5ZA 2ZYWX 5E3HA 4PQFA 1DAKA 2Z0MA 2J6SA 2VHJA 1SKQA 2QP3A 4GDFA 1GKIA 1ZRHA 2ZITA 3I62A 4RFSA 3GLFB 2HLDA 4K81B 4LBYA 4RVCA 4ECWA 2QMEA 1ZQJA 1I4LD 2ZRAA 1QSLA 3B1XA 3TKLA 8ICHA 5IK2D 2ALZA 8ICPA 4KVAA 2ZAMA 2HCJB 8ICSA 4NXZA 2ERYA 1QHNA 3THYB 4KLGA 1KZGB 1XPRA 1UJ2A 1W49A 1P61B 5D3QA 4B9UA 4B73A 4HB2A 5IIOA 5J0UA 3H4DA 1ZJMA 3NGDA 5LDDC 4JT2A 1ZC3A 4Q4AA 1FQKA 1FX0A 1CRQA 1F2TA 5CHGA 4I2EA 4V0OA 3QY0A 1G16A 1E2PA 1XSNA 4O3RA 1OHHA 2IF2A 3FMPB 2IHMA 4V0KA 4ED8A 2CLSA 4WBSA 5HCIA 3KKOA 3BFVA 4IEEA 1KGDA 2GEUA 4X8LA 2QSZA 1NLZA 2C99A 3W34A 1E1QD 2AKAB 4UXIA 4F4XA 4G5QA 3B1YA 1U99A 2FFAA 5B57C 1IJEA 3QPWA 4DLGA 2RMKA 4IR9A 2OXCA 5JWOA 3BH7A 3THWB 1W46A 4O0MA 5FPYA 1J70A 1Z22A 3QG1A 3KZ1E 3ISCA 3L0PA 3SYNA 4XWKA 3QZ7A 4F4YA 4OKSA 2YC4C 4RD1A 8ICIA 1G3QA 1XJ0A 4YDHB 3LD9A 1KK1A 2IYQA 4PPNA 1KI6A 1E2NA 1SVKA 1V43A 2QENA 4D0LB 2RDJA 3GIMA 4J9PA 4DFJA 1KFDA 1DPFA 4G5OA 1ZQMA 4MRRA 1CRPA 3N2IA 1JQLB 5KNBA 3KQKA 3B0XA 4RQ0A 4LZGA 1ZQSA 1ZNXA 4PFSA 3WXMA 4DEZA 1G18A 2AU0A 2QN6A 1VECA 1EX6A 1YKSA 4ECZA 4Q4AB 4EPWA 1FX0B 1F2TB 5BQ5A 3AVWA 3GILA 5GJBA 5IIJA 5KG3A 3ZS8A 1JECA 1X9SA 2DCUA 5JI3E 1ESNA 3KXKA 9ICBA 2NGRA 3PUXA 3DPUA 4Z1MA 4DSNA 2QQEA 2FPLA 1A2BA 4C3ZA 1W0JA 1X8LA 4OJQA 1VTKA 2F1IA 4QWCA 3CRRA 4M1KA 1T8TA 4NL4H 1Q21A 3AF2A 2F1JA 3H8JA 1I2DA 2FWRA 3DKVA 4QNMA 1TAQA 3H40A 1WB9A 1WE2A 3RS5A 3QXHA 2IS1A 5HP4A 1VG9B 2V9WA 3VHLB 1WCNA 5HZHA 5FI0B 1BPZA 2C9YA 4RPYA 4NLGA 9ICEA 2OZEA 3UMSA 4G0NA 4QHYA 5JSZA 2BCVA 3V6KA 1KI6B 2HHUA 3JVVA 3PQCA 5DHAA 1TTTA 4HSEA 8ICJA 1E2GA 3C14C 5B58C 2ZI7A 3G6VA 2OWOA 1IXRC 1CLUA 4G3IA 1GDDA 1K5DA 3CZPA 3DKPA 1VMAA 5J29A 3KUCA 3SYLA 1TQDA 1AM4D 4Q1AA 2QMHA 8ICOA 2FPKA 1NN5A 4TL7A 2CE2X 2GBLC 1N6NA 1XFAA 5FOUA 4IQVA 4KLUA 1KI7A 5C2JB 4RKFA 3TSWA 1IJFA 4TYQA 3EC1A 1GNRA 2V6IA 3MLEA 4QZGA 9ICUA 1Z0FA 3HW8A 2EFEB 3KXIA 1Z00A 2W8KA 3M8RA 1IN7A 2ZI6A 2JJ8A 3LFUA 3LBNA 4RZRA 1J7KA 2P66A 1EK0A 4JL8A 4JLJA 4M1OA 2JEFA 1M7HA 2HJGA 3IBYA 2OFXA 3C23A 5KFYA 5J4YA 2XGPA 2RGNA 1F48A 4A2PA 1JXLA 3CX8A 4GMXA 2D4HA 2B21A 4I2IA 3RB4A 4DCUA 2XB4A 1P5ZB 4EBCA 1JXMA 3EA0A 5AUNB 3WNCA 5KFSA 3AKDA 4LYFA 5A0FA 2RB4A 5F3WB 1GRNA 2A5FA 4LJ4A 4QXAA 4R2HA 5EZ6B 4D81A 3NTUA 4PPGA 4RCYA 3MR6A 1OXUA 3HYTA 5FL3A 1OJLA 1DELA 2GJSA 2ZTSA 3FOZA 4CIDA 3JVUA 1FZQA 3EW9A 4U5XA 1DO0A 3GLIA 5CP2A 4ELVA 3RB6A 4DLXA 3SQWA 9ICAA 4DSKA 1KRPA 2VHQA 5ANRB 1E2HA 4PHEA 5EXTA 5CK4A 4QBGB 1Z00B 1S97A 2QAJA 4DRZA 7ICRA 4IRDA 1ZCBA 1D2NA 2ZIAA 3QPVA 1N6PA 1TQ2A 4JLAA 5IK2A 3SV3A 1F2UA 4DCTA 3N2EA 1ZQCA 1P2TA 1X8JA 2FE4A 3IIKA 2IS2A 3WRXC 1TADA 1QHHA 1D8LA 4PQRA 4PHGA 4JMPA 2GCPA 2ZI5A 3RRGA 4TSFA 5KOYA 2JJ1D 3AUOA 5DLGA 1SL2A 1ZVQA 4MEXA 2OE2A 2ZRFA 3B7GA 1SL1A 2C9CA 1Q3TA 4JLNA 4Z8YA 5GJVC 8ICBA 4JVLA 1JIHA 4D0GA 2ANCA 4EIWA 1E1QA 4P3YA 4HI0E 1NJYA 4RUAA 2FEOA 4FXPA 2GJKA 3NVAA 4RD2A 3ZQ6A 3ZDEA 4EJSC 4DLRA 2YZ2A 4OI1A 3CRW1 3MR3A 2DWQA 5E7JA 1FMLA 2QP4A 2YOHA 1XMVA 2O52A 4PO9A 3GLIB 1FQJA 5J2DA 1SXJE 2WWGA 1KSGA 5D46A 5DG8A 1NK7A 4JYCA 5CLQA 2JLUA 3UXNA 5EWEA 4ED0A 4CGZA 3V00A 2JLQA 3V72A 1F2UB 1GL9B 3K75D 1UDXA 4R98A 4TQ9A 3GLFE 1U9LA 2JEGA 2CE7A 4JL5A 4NYMQ 4WVFA 1P2SA 3RANA 1NG9A 2FF7A 2PI5A 1QHHB 4YMNA 1X6VA 4HAVA 1CKEA 1XX6A 2H5XA 4IRKA 1T5IA 2AK2A 2FEMA 2ODWA 3P4YA 4YC7A 4AIIA 3GFKB 5KFVA 1JNYA 1ZNWA 3BB4A 1RRGA 1XXHA 2ZSFA 1IAQA 5KFQA 3AU6A 1XRJA 3LA6A 4E09A 5HKKD 4KI0A 2JDID 1HV8A 3TVDA 4JV2A 2QGNA 3A4NA 5FFMA 1ZETA 1Q44A 3MGCA 4LJ6A 4BRWA 5DG9A 5J40A 5AUQA 1HT2E 4U7DA 4I2BA 3PW4A 2QSYA 3MFYA 4EYHB 2WKQA 4J9SA 3FHOA 4M1SA 1PJRA 1N0WA 3DO6A 1ZQAA 2VHTA 1UM8A 1Q1QA 1T3NA 1WA5A 1IXZA 1XSLA 1XD8A 3AVQA 3QKTA 5SZHB 3B9QA 4B74A 3N97B 3EPLA 3IEVA 3ONWA 1Q1BA 5KPJA 2KBEA 2C95A 3PV0A 2WIAA 4IEIA 2LWIA 3LBIA 2F6RA 9ICSA 3RSOA 4TLAA 4X5VA 1DOAA 4YR2A 1R5NA 4JJZA 4AURA 3I92A 5TVKA 5FPKA 1WMSA 1VCIA 4LJ8A 3CB4A 3WYFA 2BV3A 5KFZA 2IYZA 2QMUA 4KYIB 9ICIA 3PNCA 1CU1A 1R6BX 1XXHB 1E9EA 3R9XA 4GNKA 1S96A 4IDQA 2WKRA 4LRWA 4TN1A 4GOKA 1MT0A 1JJVA 4PGYA 1FL9A 1O87A 1P9RA 2NO7A 4UXHA 3VR6A 4HZUA 5J2IA 4C0QC 4EDHA 2JLSA 2V6JA 1NKSA 4QGAA 5HHHA 1EWRA 4I1SA 2Y1IA 4FI3C 1QRAA 3AGQA 4DSIA 1S77D 1DTSA 1TV9A 1E98A 1NRJB 3BFKA 4MRSA 3W6PA 4DEXA 1D9FA 4RT3A 3PXGA 4DSEA 8ICXA 1GSIA 4O5KA 1KO1A 2EFDB 2B7CA 2ZXUA 1G8FA 2OAP1 4DCSA 2BHNA 4YCXA 1TMKA 2AKYA 3GD7A 4PAMA 5C4GB 3WNBA 1UFQA 2B8WA 2CL6X 4KLIA 1Y63A 3LXXA 4NHOA 4UBBA 1ZQHA 2QPTA 1WQ1R 1GILA 4MUAA 1G291 2BEKA 2P5SA 3SU8A 1JAHA 1NVVQ 4S35A 4URYR 2O8EB 1AS0A 2NO9A 3OFND 5KFUA 5DBCA 4HB4A 3PEWA 2IEZA 2G1JA 2WOOA 4TYPA 3VNVA 1FOEB 2XEXA 2IEYA 4LJAA 5HR5A 2KE5A 5KG5A 4F4JA 4GOJA 1JXOA 3EXAA 5J47A 1KKMA 1MO3A 1XTJA 4A36A 4IOMA 3I5YA 4D6PA 1UA1A 1OIWA 3FDSA 2J7PD 3MG9A 4HZUB 2QRNA 1NL3A 8ICMA 1NI3A 3E2IA 8ICGA 5DLFA 1QZXA 4YMMA 1E9FA 4A0FA 3W5JA 1Y88A 4P4OA 1BIFA 3K0FA 4BQSA 2OBMA 4O3SA 3MD0A 2Q9CA 1G7CA 2Q6TA 4UKDA 2QM8A 1KDTA 4UNQA 1HUZA 1E2DA 2CCJA 2VYFA 1TQ4A 1FTNA 3PX0A 2CL0X 2PH1A 3KQUA 2BCQA 7ICIA 2JJ1A 4KBFA 1II8A 4ECYA 2P6RA 2HUPA 5JS7A 3SI7A 4CEJA 2WJIA 3RRMA 1BPEA 3QKSA 1BYIA 4JLKA 1FFHA 1OW3B 2J5XA 1KJZA 2XJ4A 1Q20A 5L3QA 2NOAA 2WJHA 4PC2A 5L3RA 1KKLA 4XVRA 4DB4A 3TVTA 2JATA 3VMFA 2CJWA 2AX4A 1ZW6A 1ZQDA 1GKYA 1IM2A 1QG2A 3HPRA 3PMLA 4JVMA 4DOAA 2GCNA 4GL2A 4NYIQ 3ZVLA 4C8MA 9ICQA 4DS4A 5KDLA 3PEUA 1Z0JA 2FSFA 4MRNA 3TUJC 3LH5A 4LZDA 2YOFA 2RGXA 5IHPA 3THVA 3FFAA 1DADA 3NWJA 1T3LA 3KTAA 5G40A 3WMFA 4YONB 4DVGA 3MGIA 2IA5A 4XWOA 4PHAA 2PJRA 4Z51A 1N6OA 5CA7A 5FL7D 3K0FB 5AJYA 1T8EA 3R7WA 4ASUD 1ESMA 2ZJZA 1LFDB 4CT5A 4KFTA 9ICOA 3FGNA 1N2CE 4YXWD 4EPYA 3TAQA 1ZP6A 3LXRA 2YJTD 3CWZA 4XTRA 3G6YA 2BQRA 3BJYA 1K5GA 2VBCA 4CZ2A 3ECCA 3AF3A 1II8B 4DL5A 5J0WA 1FMJA 4YXMA 1UKZA 2ZSBA 3N70A 2GESA 2OBNA 5HKKA 2J1LA 4CEJB 2JDIA 1LF5A 4CW7A 5DN6D 2YHSA 3QKSB 3RNLA 9ICWA 1IXSB 5CYPA 2HVHA 5F2EA 2R2AA 221PA 5L3QB 2WZQA 3B1VA 3Q8KA 2CJWB 3O8DA 1YZNA 2V4QA 1ZMXA 3IBGA 1BO6A 2J6TA 2QPAA 3MWLA 3I3SR 3BWDD 2JJ2D 1T91A 4NH0A 2HV8A 4ELUA 4Z8XA 1G8YA 2W9BA 1NN3A 4GXKA 2PLFA 1WXQA 2QAGA 3KTAB 3HWTA 3MSXA 5EXPA 1CJUC 4F93B 5CB1A 1AGPA 2VLIA 3R7WB 2WWWA 3X1DA 3FKSD 2J0QA 4LWZA 4FBUA 1KNXA 2LKCA 2R6DA 1ZQTA 1TVAA 2C03A 4MQBA 1NVUQ 2IYVA 4RQ2A 4V02A 4KLFA 3HT3A 4ZO4A 2AFIE 5J0PA 1QHSA 5KFLA 4MGKR 5EE3A 4C0HA 1NBME 1NJZA 3ADDA 2WBLC 3AVTA 3FPAA 4BLTA 1D2MA 3U7FB 4ECQA 1ZBDA 2BVNA 1W4RA 2EU8A 4LVSA 2PMDA 1OIXA 4PC6A 4DSJA 4H1UA 5FBQB 5C4MA 4G1UC 4EPVA 4QW8A 1UBFA 4YP3A 1GG2A 1SXJD 4UAYA 4J9MA 4OBEA 1ZJ6A 1KI1A 4TLCA 1TUEA 3P27A 4LHVA 3RJKA 2OBLA 4EPTA 3IHQB 1CJKC 1DE0A 3D3QA 4TUPA 4J9QA 3RRYA 5JEEA 2H1LA 3SFVA 1SVWA 1M7BA 2WWFA 1IHUA 3L2OB 1C4OA 2Q9AA 2V8OA 2K5UA 3BDPA 2GZDA 5FUVA 3OIWA 2W9BB 2ZS8A 4KLSA 3PR1A 1G9XA 5KFEA 3V6HA 3RB0A 3AVUA 4O5CA 4AWXA 3V7JA 4I1UA 2AGPA 2IHYA 4Q7JB 2AK3A 3U5ZB 2X1VA 5KFJA 4MGZR 1Z63A 4Z6FA 3OFNA 5TXGA 4KLLA 1F3OA 2PFPA 1N5JA 2HF8A 2Q21A 4M0AA 3F0TA 1UBCA 4KSCA 3REFA 3M9MB 2P5TB 4K46A 2C2EA 1NKCA 3KXLA 2GEVA 4DCNA 1XEFA 1HEIA 4QHTA 2HYDA 4ZKEA 4QC2A 3UXPA 3ISBA 5IINA 4AYWA 1LY1A 2PT7A 2J7PA 3C2MA 1E2QA 2QRZA 2DWPA 4PX9A 3BGWA 4ILEA 5DB9A 4Y0VA 1U8YA 1ZD9A 4KITB 1ZQQA 3GIJA 4A6XA 1KNQA 1NG1A 1ZCAA 3EZ9A 5KFTA 2DPIA 2RGEA 4KFUA 2GAOA 1E99A 1KSPA 2C5LA 4BLRA 2VHCA 4C8OA 4DLUA 5KG0A 4QWAA 3T5LA 1TK0A 3CRMA 3KJGA 3H86A 2HHVA 5E7IA 1G1MA 2ODEA 4ZDKA 2YKGA 2QUZA 1P2VA 1MQ3A 1RE0A 1A76A 3WMGA 1KO4A 2J59A 3ZDBA 4WXPA 1YZGA 5BOLA 2QROA 2W2TA 4YMSA 3UG7A 5J5CA 3NC1C 4CF7A 4EEYA 4MUBA 2R8JA 1HT1E 5D3MA 5EUQB 3RLFA 2ZJOA 2J3EA 2FFQA 5J0XA 1DS6A 1GM5A 1X8KA 1BPDA 4ED7A 4LSGA 4Q19A 1KYIA 2ZU6A 3KJEA 4Q00A 4ZH4A 2ERXA 4QL3A 3ZVRA 4US0R 2XTZA 4ABYA 3AP1A 4O9MA 2W9CB 1EG7A 4LOAA 4PSKA 3BERA 1S9FA 4WZBE 2CLDX 2V55B 4JBWA 4D4LA 1AZSC 5DKWA 1V9PA 4B9NA 5FL7A 2OHFA 1AN0A 2VF7A 4FN5A 1QSSA 2VHUA 1JB1A 1RYRA 4OI2A 4ASUA 2PI4A 2R8GA 1R5OA 2OT3B 2YWEA 4YXWA 4A0GA 2AGOA 2CL7X 5J2FA 1P73A 4PSVA 1LNZA 1US8B 2GXAA 1U0HC 1ZQOA 1QG4A 4W5WA 3TI0A 2EYUA 2AQ4A 4D25A 1HE1C 2VP0A 3ZDCA 3NKVA 2G83A 4L16A 3VAAA 2P67A 3VFDA 3CIOA 5DN6A 4A2QA 3CKLA 4DQRA 4DSFA 3MDCA 2R44A 3CO5A 2AL7A 2IUUA 3TUZC 1D5CA 3RVBA 5D3MB 1D8TA 3GJ4A 2AR7A 5DQHA 1U48A 2HJVA 1SKSA 3FKQA 5DE3A 1E1RD 121PA 1M1YE 3ZZTA 3U6KA 2JJ2A 3K70C 2Z4RA 1NJFA 3ND8A 4UQGA 2HT6A 4I81A 2HEIA 5B2ZA 4TURA 3MBYA 1D9DA 1BOFA 1DAIA 1WCV1 2IYRA 4NDZA 1FNMA 2EVWX 3QI2A 5CB8A 9ICLA 3SJBA 4NM2A 1GRRA 5H70A 1XJCA 4A8JC 4QRHA 1H65A 2BEJA 5D4BA 5DG7A 2V4ZA 3FKSA 2PEZA 1W7AA 4WAUA 4D80A 4YVZA 4NYJR 5FBWB 4A6PA 3AF1A 1G8HA 3PENA 3W3AA 4MKHA 4AY2A 2V7QD 4FW9A 2ODNA 5FR1A 2RGNC 1Z0IA 7ICGA 2FPMA 1I4DD 2WJGA 1A82A 3B60A 5DLQC 1ZM2A 9ICVA 1Q57A 4ELTA 1JAIA 1ZD8A 2EWWA 2F1RA 3FWYA 4DQSA 3T15A 1U8ZA 1LB2B 4KU4A 2XTNA 5EZ5A 3T1QA 5FH9A 5JZVA 5HHIA 1SXJA 2VP5A 2PFOA 3BH6A 2R8HA 4P33A 2G88A 4RCZA 2O5VA 4LUCA 4GFDA 1ZQZA 4B43A 4YMOA 2IW3A 2OFWA 1W36C 4DL2A 3GLFA 2OLKA 4FIDA 3UK6A 1T3SA 2GJAA 2IXFA 3GLHE 3VNUA 2IS6A 4BFVA 4Z6CA 5EOZA 3MRSA 4ZDJA 2W2XA 2OV2A 3DMDA 3UXMA 5KFGA 3RYTC 4RQ1A 1IN6A 1Z07A 1ZQVA 4W5JA 2ISOA 4FWIB 3QOFA 4ED2A 3RRNA 721PA 4DIDA 3UWKA 1E6CA 4ACBA 4ED1A 1DGSA 1A5TA 1FW6A 2I9GA 2KB0A 2NRZA 5JI2E 8ICNA 2RGGA 4NM1A 3SR0A 2EFGA 2R9VA 1YR6A 3VR5A 1XWLA 4BZPA 3KHRA 1Z3EB 1KLNA 2H16A 2ZJAA 1BPXA 4B48A 2GETA 2W0MA 4RD4A 4R71A 4DSLA 4GZMA 4D2IA 7ICSA 1SXJB 1YHNA 2IL1A 1XD2A 4XA5A 3K9NA 5BN5A 5K8IA 2ZEJA 3AUYA 1IN5A 4EBEA 2MUTA 1C1YA 3EIHA 1N56A 3DEFA 4B3BA 3THWA 3Q8PB 1EGAA 4QZHA 1M2OB 2GVDC 4HB3A 2GJ8A 3TQ1A 1QVAA 5KFBA 4M2LA 5HTKA 4C8LA 2IYWA 1DEKA 3VR1A 3DL0A 2H17A 3D7MA 4TLBA 3LDAA 1NBMD 2A5GA 1XMIA 1S76D 4F4CA 4PZLA 3RDPA 3JPNA 1OE0A 4F5OA 2H5EA 1DARA 2CHQA 2ZREA 3G5UA 2XY7A 1GNQA 3MMPA 4IXNA 3RTVA 2VRWA 3AEZA 4TUQA 3JPPA 2WWHA 4GPTA 2DHRA 2ZRHA 3QF7A 3H1TA 1TKDA 4JV1A 1PVOA 4PC3A 1G5RA 5BWMA 2IX3A 1W47A 2A78A 1ZU5A 5LD2B 4DB2A 4RT2A 4RKEA 4ZKDA 4JZKA 1WDTA 3RH4A 1NIPA 3B9PA 2O8BB 2VL7A 3EZ6A 3D31A 4OI0A 1CF4A 2VEDA 3Q7PA 1Q1EA 3ZDQA 2BGWA 2UVUA 1PLLA 1XD2B 1E9BA 2BBSA 4F5QA 9ICPA 2FMXA 2F9LA 2JASA 4DHEA 3VX4A 5DGXA 2MUTB 5KT2A 1E2EA 3W9YA 5E4FA 3OHAA 1Z0DA 2WJJA 3PVSA 5GJWC 4BLSA 2MMGA 4DIEA 9ICRA 2RGBA 4C0BA 3BQ1A 1ZQBA 4ESVA 4MDFA 2KFNA 2ONKA 2JA1A 4CYMA 1KI8A 4BLQA 3B8HA 3QKRB 2Q3MA 3CX6A 2PCJA 4FD2A 2L0XA 1DAEA 3GJ6A 3JPOA 1ZAKA 1U2RA 4KN4A 1QSYA 3JZAA 1KSHA 1AROP 1T0JB 1Z2CA 1Z3IX 4DQIA 3C4JA 3H84A 5UKDA 3SFZA 1S0VA 1VIYA 3NBYC 4YR0A 5DSZA 4ECRA 1SHZA 2E1RA 2REXB 2XITA 4I27A 5BXQC 1E1RA 3RS2A 4B2PA 1SVSA 2QE7D 1S1MA 2PMKA 1G3UA 5EE1A 3X2SA 2NTYC 2CHGA 2E87A 3I61A 1S2MA 4XQ8A 1Z6YA 4DSTA 5JWHA 4EFMA 2BPGA 4M9NA 5CK5A 1XPUA 4MFFA 2HHTA 4F7WA 1SKWA 3QEBZ 3EPJA 3FFBA 2D2EA 1T4GA 5DIFA 3WYGA 3L8YA 1C7YA 3QEJA 4B6FA 3U3JA 1UBEA 5TY0A 2IHNA 5EP1A 2O8FA 4UNSA 3KDSE 4HDQB 5L8VA 1AQYA 5KG4A 1KK3A 3A58B 3QG5A 1NMXA 2BBTA 4MFAA 3HU1A 4M53A 3FYHA 3WRYC 3F5FA 4P4PA 4IOLA 4O2LA 4OQMA 2V7QA 3C5HA 4N1AA 1XS9D 3HR8A 5KT3A 1VHTA 3TIFA 1KI9A 1RIFA 4V0ME 5B64A 2R6AA 8ICWA 4URXR 3K9HA 4R9UC 3GEEA 5HE8A 6Q21A 1LF0A 2F3TA 2RGAA 1CUKA 3EWSA 4FMDF 3U4QA 2FU5C 2QT0A 2A9KA 2ZROA 1DAGA 2FX3A 2FMQA 1KI4A 1G3RA 1X86B 5EXXA 2RGCA 5LPNA 7ICOA 4DF8A 1CJTC 1IY0A 2IXEA 2ZQ5A 3CM0A 5BYJA 1T5LA 5EXSA 1E2JA 1L4UA 2YOGA 1QHYA 3EPGA 1KAOA 2CHVA 3NG1A 1ZQRA 4YR3A 2ASEA 2NZJA 2ATLA 4X8HA 4A9AA 2J0SA 2VO1A 3IUYA 3MUFA 1BVSA 3I5XA 3BIFA 3LVQE 3EIQA 1KJWA 3KHLA 1G6HA 2CCGA 2P65A 2ZI3A 2QTFA 2ZVPX 3GFTA 1EESA 2A2ZA 2WMNB 3WHLA 5DB8A 4WW0A 1XD9A 2I1QA 3RS7A 3ZZ0A 3OHMA 4IFEA 4RNOA 1JQJC 3KX2A 4JJKA 2CBZA 1ZUHA 4PC7A 3W5IA 5HZKA 3K0EA 2O8FB 4OJKA 5FUYA 3N4MB 1IONA 3RAQA 3MFIA 3DVLA 4RNMA 1Q3HA 4CRWB 4URVR 1AS3A 2KWIA 4MH0R 3A6PC 3CPHA 2C28A 3VR2A 4GC6A 4P2HA 1KO7A 1XEXA 5CJ7A 2CNWD 3DZ8A 5KSPA 2Q3FA 2R6FA 3T5DA 5K8LA 3U4QB 1GTVA 1S9HA 4AKEA 4BGDA 5FOTA 4G5SA 3OSPA 4BFWA 4LV6A 3IHWA 2MSCB 2WMOB 3R8CA 4D82A 2ZVQX 2FG5A 3QBVA 4FMCB 4AG5A 1R10A 4GXIA 3PCRB 4L15A 4NTZA 2ZANA 2GILA 2JZBA 1SULA 1KO5A 1X3SA 3PO5A 3K09A 4B35A 1XTSA 5H68A 1OYWA 2HXYA 3WBJA 4XOIA 4US2R 1CIPA 3X1WA 1TL7C 1N25A 5ELXA 3JPSA 4L8GA 5DNYB 1OT3A 2VP9A 3AH8A 4M22A 2G9NA 1NBMA 1RKBA 1WRBA 4BASA 1E4YA 3IEUA 3SJZA 3T1TA 1JR3E 1RYFA 3VKHA 2CCKA 2HYIC 3RS0A 2OSBA 1XSPA 4F91B 1E2FA 1ZNZA 4HYYA 1RRCA 3T12A 4BXOB 3WHKA 2ASJA 4JYBA 5IRCD 4IQTA 1SKRA 1R2QA 1T6NA 1YE8A 3I8SA 3L82B 4LJ9A 2W0SA 5FOSA 3VTKA 4HLDA 4DDVA 1OIVA 1XEXB 1FUUA 2V4RA 3P26A 4MFCA 3QUSA 5J2KA 3TSZA 4F4ZA 4RUCA 3Q85A 1CR2A 4C0JA 4ECTA 1S0OA 3T3FA 2JEOA 4DLVA 2FGJA 4Q66C 3PEYA 5GJCA 3SJAA 1QBKC 4MYCA 2FA9A 1HQYE 2ZRPA 1L3VA 3TMKA 1E32A 5G41A 1HJPA 1H38A 2H18A 2JZBB 5BN3A 4N3NA 4ECVA 3DOEA 7ICPA 3RRZA 5JLJA 4F38A 2NPIA 1FPMA 3QXJA 2DPXA 4R64A 1L5UA 3KL4A 4HDCA 4BEBA 1R5BA 5H8WA 1FNNA 3SS8A 1MR3F 3RC8A 3D6TB 5KDOA 4ZCMA 2UKDA 4Q48A 4QM6A 3Q8MA 2J87A 2YWGA 3NH6A 1YZKA 3TGPA 3X1YA 1T8UA 4F4KA 1A7JA 4LYJA 5HPYB 4EQ6A 5A5GA 1YZUA 4KTQA 4E07A 2QAGC 4BUJA 5JRZA 2X2EA 4TT3D 4JLOA 2NPFA 1ZQLA 1R0WA 4BECA 3CH4B 4JLBA 4Q44A 4B3DA 3BH0A 3QNUA 4EKDA 2W8LA 2QE7A 3IDQA 2FSIA 2BQUA 3K1JA 3RJEA 3B78A 4QFMA 4US1R 1CEEA 1X1RA 1W4AA 4P4UA 5KTYA 3RR8A 2HVIA 2BCGY 1OH7A 5BW8A 1TFRA 4PHPA 3UPQA 1K6MA 4Q1FA 1S8FA 4PHFA 3K0AB 2C9OA 1HTWA 2Q3HA 1XO1A 1EFRD 4ZI3A 4YFKA 3KTQA 4KLEA 1TK5A 2VF8A 1UA0A 2WSMA 4IKEA 4RY2A 2V3CC 4L9WA 3GP8A 2QP9X 2C98A 2PZEA 2J0VA 3UANA 2R8KA 3C5GA 4J0QA 2QZ4A 3OJSA 2W2VA 4OHVA 2WVJA 1P3JA 2WAYA 3Q3JB 3CNOA 4LPSA 4X8MA 4DZZA 3ZD7A 2O8CB 8ICRA 1KDOA 5J4KA 1XU4A 4EQ6B 3ND9A 2NRXA 1G64A 1B0UA 2O8EA 2IUTA 3WP0A 1LV7A 2VP4A 3RH5A 4Q1BA 4QGHA 3FMIA 2ZTDA 2YC2C 4MGIR 2NZ8A 3NEYA 1XC9A 3QIAA 1KDPA 1JEDA 3UQ0A 2ZRIA 3AV0B 1S3SA 4HDOB 2FMSA 1HH4A 2B8TA 1KDHA 1T7PA 4KN7A 7ICNA 2GCOA 5J0SA 3GJ8A 1W4CA 2PT5A 5KFHA 1ZQFA 7ICVA 3A8TA 3A4MA 3M4YA 3LK9A 4EBDA 1EXNA 1UF9A 4RPZA 3KKQA 2H57A 2M9NA 1MO4A 5CIQA 5IILA 4C7OA 3KHHA 2NQ2C 7ICHA 1K1SA 5D49A 2IT1A 4V0NA 3IKJA 2R8IA 4P32A 4B44A 1BGXT 2E9SA 3R9WA 4RZ2A 2KFZA 1QF9A 4FINA 1ZNYA 4Q7KA 1I2MA 3QF4B 3ZD9A 5IIKA 1UBGA 1VHLA 4URZR 3K0CA 1UKEA 5LB2A 2AFHE 3O8CA 2QMOA 1CTQA 2PXIA 4JSTA 2CNWA 4XSGA 1DG3A 4BWMA 4QG7A 5KU1A 1EFHA 4OQLA 2ZETA 4RNNA 1PV4A 1KY3A 3MDAA 4BPBA 4HEJA 4XJXA 4RPXA 1NK8A 1XB2A 5TV2A 4GRAA 2VSOA 4J9NA 2ISPA 3A36A 4RJLA 3BFXA 3OIYA 1HUQA 4ZDWA 3KQNA 1ZJNA 4C0AC 2O8DB 1IXRA 2PLRA 2GCOB 3RJHA 1OB5A 1UPTA 3SQXA 1VIAA 4LHXA 1ZM4A 3WY9A 4DUGD 4ACAA 2JLWA 1NSTA 4M2YA 2OUKA 3MCAA 2GBLA 9ICHA 1P60A 4R7ZA 1XTIA 5KTQA 1P9WA 4TQAA 5KG1A 4PHDA 4B75A 4C7OB 5DGBA 4F8RA 4TMXA 5CDFE 3JPRA 1GNPA 4Q4JA 3I8XA 3DOFA 4CCHA 4HAXA 4F4WA 4EYIB 2GWHA 5KFPA 4RQ4A 4JIMA 4QW9A 2IA6A 3G0HA 4TWZA 1OSNA 1RW4A 3CH5A 3GV5B 4F50A 2W83A 3PEVA 3QXXA 4XD7D 3U3MA 1OXVA 3ZYCA 4DFMA 1H8HD 2A3RA 2G6BA 4TTRA 5FBRB 4IDNA 4A0HA 4QM7A 4GOXA 1E9SA 1U4BA 4M1TA 3GLHA 2FMPA 1S0UA 1P9NA 4KSBA 3IO5A 1E94E 1QHGA 3HPOA 1U0LA 3OIVA 3GFPA 4QNRA 5FPHA 1OV4A 1T3HA 4HLQB 3AB3A 2QI9C 4TLDA 1MO5A 3LWMA 3PUWA 1Z47A 3TQCA 1AKEA 3ASZA 1M34E 3PUZA 4MKIA 4RD6A 2MMCA 3B1WA 3KUDA 4Q9JA 4QJ4A 3DHWC 3ZGXA 3OESA 3LO5A 3VKGA 1HA3A 3I1FA 2BMFA 4G3XA 3EPIA 2GA8A 3T34A 1EX7A 2MSDB 2RKOA 3KKMA 5B30A 3OAAD 4Q4JB 3UXOA 4IQWA 4JLPA 4NE2A 2ZJ8A 3HYRA 4I1VA 2I4IA 1II0A 4TT3A 3T1OA 4BFYA 2KZ3A 1L8QA 2ZSAA 1G4AE 3AKCA 2FLPA 4AKGA 3PW2A 4GBMA 1DOQA 4DC9A 5JHGB 1NKEA 4RZUA 1W44A 3P20A 4IOJA 4YMTA 5KT5A 3EG5A 2C22A 1YR9A 4TMKA 1K8RA 3GLHB 4Q7LA 2XZLA 1VCOA 3TR5A 4Q9IA 5IDVA 2HF9A 1AJEA 3U3KA 4I29A 4DL4A 2DY1A 1EFRA 3ZQJA 4TZ6A 1R0ZA 3RJGA 2QL6A 1JR3D 4QGFA 4WZAE 5FOVA 4BFSA 3PR5B 2OLJA 4ECXA 2UZ3A 3TK1A 2DR3A 4IJMA 1JBKA 1KMQA 3MWKA 2XXAA 4N0DA 2VSFA 2OAQ1 5JECA 1IBRA 1XCMA 1COOA 4YQWA 5L1JA 2P6NA 2ZR0A 3IGFA 3LBHA 4A0RA 3L43A 5DH9A 8ICKA 5AUOB 3IPXA 3CF2A 3GFOA 3AP3A 3KHGA 4O0IA 4FS1A 1AA9A 3R9IA 3SE0A 3UWOA 3ZJYA 1SVOA 3UMRA 4A82A 2ZS9A 2DB3A 1CBUA 3V4RA 1GAJA 4KLZA 4LY6A 3JZMA 4E22A 1BYUA 3NBFA 4JUZA 2GVZC 2ONJA 3TJZA 8ICVA 4BDPA 5DQIA 2B7BA 1ZQNA 4GZLA 4LV5B 2G77B 2AWNA 1U9IC 4KJZA 3CF6R 3OF5A 5AJXA 4C8KA 3U3RA 4I2DA 2P0EA 4ESHA 2NO1A 3CLVA 2IHBA 2PCLA 3IM1A 3Q8RB 2J0UB 4HLUC 4Q4LA 2FV8A 1ZQUA 4NKRA 4HAWA 4XH9B 5BN4A 3TRFA 5JFGA 8ICTA 2FN4A 2IYUA 3DDCA 2R65A 5K8TA 2XXAB 1AGRA 2Z6VA 5FTNA 1HUOA 5EE9A 2KJQA 1GP2A 4EJSB 4QWBA 4AD8A 1G41A 1Z83A 5IIMA 2IMWP 2BHRA 2V9PA 4QZEA 1KK0A 2QORA 4JBXA 4C0KA 2WWYA 1S4QA 2N1BA 2JIZD 3AP2A 3ZD8A 1XDBA 4DKXA 4ED6A 3MJHA 2CDNA 4ECSA 1D8YA 5J2BA 2LCFA 4Q5IA 4Q02A 3EZFA 4GMDA 1U47A 1ZQEA 2D74A 1EWQA 3TAHA 4DCVA 1U90A 3RBEA 2JLYA 1VCNA 3HR7A 1BPYA 3T06B 3BD9A 4UQOA 4Q4HA 4DUGA 3CRQA 3ADBA 2W9CA 3WBKA 1P72A 1PZNA 4UB3A 2WPDD 4MRPA 4A4DA 1TU4A 2BIFA 2FJUA 1N6IA 4UB2A 2WSSD 4PQYA 1D2EA 3IQXA 4JL6A 3VHXA 4DDUA 7ICQA 5AJVB 2GJ9A 1OH5A 2F43A 2AHOA 4YG2A 4V0MA 1VYUA 2Y1JA 4F2SA 1UEIA 4IRUB 2OFOA 3LNCA 3HX0A 1XNJA 3OSNA 2WAXA 3P4XA 4U00A 4EFLA 4M9ZA 1WBDA 1OKKD 1GITA 2GK7A 2IYXA 3QEAZ 2ORIA 4TMZA 4DF4A 2IYYA 5SZJA 5GVSA 1US8A 5FOXA 1E96A 5JRJA 4XTCS 5AWFC 3HU2A 1AKYA 5KFKA 2GHIA 3C16C 4XD7A 1RFLA 1H8HA 2WM9B 4OK3A 4KLDA 3NBZC 4B9VA 1Q0UA 2ZE6A 1ZU4A 4NYMR 1BKDR 2F9MA 2X8AA 1RVDA 3C41J 2VIIA 3NH9A 1JX4A 1ZQKA 1AIPA 4L5BA 4MKGA 5IIIA 1Z6TA 2FGKA 4M6WB 3C2KA 3PO4A 1CXZA 1ETUA 4GP7A 4MYHA 2BKEA 1K1QA 5DISB 1R8QA 5FR2A 5KG6A 4UB5A 1UDWA 2JLVA 3MWYW 4XUSA 4AI6A 4Q4HB 5KT7A 1OPXA 3U61B 3HPQA 4DLZA 1MKYA 4MYTA 2YINC 3I72A 2GF9A 5KFWA 3IILA 3K4GA 2F43B 4LX0A 2AJQA 1GOTA 4OHXA 3W8NA 3OAAA 3GDXA 1SL0A 3M9OB 2BM1A 3RWMB 4O3PA 5KT6A 3KQHA 2CEAA 3SHWA 3T1VA 3C2LA 2KBFA 2NO6A 4PH5A 3SZ2A 1N6KA 4NLZA 1BPBA 3PIRA 3PG5A 3MR2A 2XJ9A 1Z8FA 4BRUA 1WF3A 4WIAA 1EFUA 3EZ7A 2BJWA 3U44B 1TK8A 3M9NB 4ED3A 1G19A 2H92A 2OCBA 4RFVA 1NY5A 1KTQA 1KDRA 2ZYTX 4HUQA 4DLWA 3U7GA 1LTQA 1E9DA 1GVNB 1Z6AA 3EASA 4KYUA 4RU9A 1P62B 4JKYA 2Z83A 3W6NA 2VA2A 1LVGA 1G5PA 1MABB 2ANBA 2BM0A 3RAXA 4FCWA 3MR5A 1JR3A 3IO3A 2BR0A 3OGUA 4YMVA 4FO6A 1E2IA 4RZXA 5HE9A 5JJKA 1R4AA 4II7A 2GF0A 1WCLA 4JLVA 4PPFA 1ZINA 1Z6GA 4X8OA 3EZ2A 5G3YA 4UJ3A 2ATVA 9ICMA 4J9RA 3FDIA 4IFBA 3SC3A 4K4GA 2HHXA 1KIMA 2NIPA 4KO8A 1OFIA 1DAFA 1R7RA 1XEWX 2W6ID 4PSAA 5TB5A 3VR3A 1Z06A 1NIJA 1SVMA 9ICGA 3MJRA 2A7QA 5CJ2A 3TBKA 3FB4A 4XRHA 3RH6A 2FDCA 1W1WA 5DYGA 1ZM9A 1RRFA 4W5HA 1AK2A 2DFTA 3NDBB 4B9TA 1HYQA 4HLCA 4Q9HA 2ZUCA 4R2IA 5KUTA 5KFNA 3GIIA 3GQBA 5DBAA 1Z6XA 4XIGS 4KLQA 3BJIC 1TU3A 4HUQB 5KFMA 1TEVA 3E1SA 4Q47A 3F8TA 3QEOA 2YWFA 4YLGA 1NVVR 9ICFA 2FFHA 2V54A 4ZV4A 4QGGA 1GZSA 1QVRA 3X1XA 4EZ9A 1N0UA 3C1ZA 9ICJA 5FTJA 3PV8A 4PPQA 4G5GA 1DO2A 3SN6A 2BBOA 1P4SA 3Q8QB 2BMDA 4K4HA 4OQNA 1G3IA 3AU2A 4M9SA 3B85A 1OFUX 4DFKA 3M6AA 3K70D 2ZRCA 2IK8A 4KLTA 1KMHA 2D7DA 3AVXA 1RYSA 2JIZA 1RPZA 3H8SA 2QNRA 1DVRA 2VP2A 1B43A 2NG1A 4U02A 1S0MA 4BZXA 2IYLD 4TZ0A 1GRQA 3PW7A 2ZE5A 4PGQA 4IOKA 4G01B 5J2CA 4LBVA 1N6RA 1F60A 2OCPA 4CT4B 1RPLA 1ZM7A 3AM1A 1NK0A 2O8BA 4O3QA 5CLLA 3IQWA 4C0LA 2WPDA 1OYYA 4PO8A 1KFTA 2WSSA 4TYNA 4B9LA 2ZRNA 3AKYA 4HZIA 1HE8B 5L1IA 4P4TA 8ICEA 2AQ0A 3GEIA 4A1FA 4EPRA 4YMUA 4NYIR 8ICQA 3LQRA 3RJJA 2ZRDA 3VQTA 2W9MA 1OKKA 1UEJA 5LB4A 1L7VC 1ZUNB 4Z54A 1QTMA 3ISDA 3QKRA 1FP7A 5KFIA 2XCAA 5J2GA 4QWDA 4LK2A 2XGJA 4JKIA 2UVRA 1TEXA 4C8NA 2QPOA 2Z5FA 1W36D 1AS2A 8OHMA 1KMHB 2LKDA 1JMSA 1YR8A 3BB3A 4FWTA 4P4MA 4ARZA 3GPLA 2NRWA 5EWFA 4OHWA 1A77A 2UVWA 5GADl 3ADCA 2BCUA 1NNEA 5J2HA 3I4LA 4QZFA 4IDOA 3P32A 4DOBA 4BLOA 4Q43A 4Q18A 3B0YA 1G4UR 3KKNA 4CEIA 2BMEA 1KJYA 4KLNA 3TFRA 2XNDD 2ZRMA 2Q9BA 3LLMA 3X1ZA 4I2AA 2XCPA 3T5KA 3GMTA 3GJXC 3SI8A 4DDTA 2IWRA 3B6EA 4UNRA 3GJ3A 1VKJA 1X1SA 1D6JA 3RABA 2V1UA 3Q5EA 1MC8A 5AJZA 2KN7A 4TSFD 4I2FA 1ZIPA 2BDPA 3T5HA 3CF0A 3NHAA 4RD3A 4I99A 1E2MA 4UNPA 5EQTA 1ZQIA 3AKEA 2WJYA 4B9SA 7ICFA 4M47A 4MF2A 4KBGA 3BQ2A 4PR0A 4XVQA 2F1HA 1RZTA 1SVLA 1FUKA 1YRBA 2D06A 4M9XA 3H4BA 5CJPA 2XOKD 1N5IA 5EP3A 4B6EA 1CR0A 2JCSA 1G6OA 2XO7A 1T9HA 2EFCB 4V0LA 3BOSA 4PANA 4ARZB 4PTLA 4D0NA 2UVQA 5L9XA 1NLYA 4PC1A 4DWIA 1J8MF 4RFSB 2QEQA 7ICTA 1J90A 5EWGA 4URUR 5CDFA 3SJCA 3GIKA 1ELOA 3AF4A 2XNSA 3U2QA 1G5TA 1SQ5A 1MRSA 4CEIB 2VPPA 3AUXA 2EQBA 1RRPA 4M4SA 1MO6A 3BB1A 4NPHA 4LHYA 1G17A 1KTVA 3RJIA 4DO9A 1X9WA 2FSGA 3WP1B 4DLEA 4DWJA 4R8UA 4CDGA 1XZPA 2VTKA 3JPQA 4FBTA 3E70C 3IPYA 3LLUA 1IY2A 4NMMA 4DOCA 1Z28A 4JWMA 3GJ7A 2W6IA 5DI9A 3ETLA 3VKWA 5KDDA 4DFPA 2NO0A 4MA4A 1A2KC 4QHSA 1JPJA 3TAPA 2G0TA 3MFHA 3DMNA 2ZTCA 1JPNA 3GCGA 3VR4A 1MH1A 4BLPA 4LHWA 7ICMA 1CEZA 2XTMA 7ICLA 1L2TA 3RSLA 1GUAA 1AQUA 421PA 5KFCA 621PA 3KFVA 1E3MA 1ZQWA 2A5YB 2FZ4A 3NHBA 2MSEB 1N6HA 1NVWQ 5TZVA 1S0NA 2QM7A 2P2LA 4OK5A 4NU0A 2P3SA 5SZKB 2XZOA 4DQQA 4LC0A 4UBCA 1VDZA 3K0CC 3BC1A 2SHKA 1E9RA 4GP6A 2D3WA 2JAQA 2IS4A 1OLOA 3THXA 3PW5A 1G3MA 3J81k 3L0OA 4S2EA 5IF9A 1NP6A 4OHYA 3I32A 3TSOA 3VX3A 2EFHB 4LJ7A 5M04A 2IBKA 3V6JA 1U49A 4YXJA 3RR7A 4F4IA 2XAUA 1UKYA 2PL3A 3FTQA 5CIWA 5L1KA 5DO9A 2FLLA 4YD2A 3QENA 3BQTA 4HAYA 1JXEA 4R8UB 9ICNA 2QTHA 2ZJ2A 4IVRA 4UAWA 2ZUBA 3KB1A 3EC2A 1E0AA 1G20E 4C9BA 5JEDA 3K8YA 3O8RA 3CWQA 3TLXA 4BXOA 2QU8A 4GT1A 1GL7A 4J9KA 1S3GA 4OYHA 4ZIRA 5DB6A 1B23P 1XJQA 1JN3A 4J9OA 1ZC4A 2CVFA 2GXQA 3E2EA 2B6HA 2A30A 2QA5A 2C2DA 7ICUA 2RGDA 2ZRGA 3GJ0A 3UATA 1P7CA 4A8JA 3PVXA 1IOZA 4B2LA 4Q9KA 4DLYA 1MV5A 4OQXA 3EPKA 1UAAA 1XMSA 2REBA 4HB0A 2RDIA 2J41A 4O5EA 1L3UA 5C46F 4MDEA 1QHIA 3L0SA 8ICLA 1JEEA 2RAPA 4EFNA 3THXB 2HHSA 2ZI4A 1N5LA 4AYXA 2Q0HA 3W3ZB 3ZIAD 4NLKA 3ZVMA 4LPKA 2XY6A 4JK1A 4Q7MB 5IT5A 2EYQA 2ZU0C 2DFLA 3LW8A 3DM5A 3P1JA 4LDJA 5DBBA 4Q01A 3SEAA 1U8AA 3W6OA 5F9FA 3T5JA 4M9JA 4M9HA 2H8KA 3CNLA 4JSYA 9ICKA 4I2HA 5JSZB 4IW3B 1SGWA 3E5HA 4DBLC 4RQ6A 3PY8A 4M9GA 2ZS7A 3C5CA 2IYTA 2PZGA 2CK3D 3K70B 2MAXA 1E0SA 1Z2AA 3U7EB 2D62A 1YRAA 5CWRA 2J46A 4L4UA 1GFIA 2O0KA 3U60B 4ZIRB 3CPJB 3PUYA 2RH5A 5DI3A 1NKTA 1TF7A 4PXAA 5G3ZA 3I73A 3Q5DA 3SBEA 1M7GA 5TDHA 2J7KA 3K0SA 4OQFA 4I2GA 1VYVA 3NIBA 5H1YA 2HHWA 4A8JB 3OEHD 4G5RA 2QBYA 3EX7C 5J2AA 3MWJA 3BXZA 3V4FA 3UPUA 4B2IA 5FTMA 1W0KD 5JJLA 5F9NA 1ZYUA 2XNDA 3EA5A 1LV5A 1GKUB 3K0AA 3QZ8A 3HJNA 2DWOA 2PEYA 4TLEA 5FUWA 3TW4A 1NK6A 5J0YA 4C4PA 5KG7A 5KNCA 4KLHA 3PJRA 4ECUA 3AVOA 2N46A 1EXMA 3CR8A 1SKYB 1YZLA 3B13B 4JBYA 4BWYA 3PW0A 1Q22A 3DM9B 5FUXA 4PGXA 3BORA 1W5SA 2ZM5A 3RRHA 5LBIA 2HT1A 1XTKA 2O8CA 2QG6A 1W36B 2F55A 1UADA 1COWD 5EJEA 2XOKA 3ZH9B 2YV5A 3C1YA 2GK6A 4KCGA 4PHTA 1XCPA 2A5JA 4AYTA 2IC5A 2W6JD 3O8BA 1XPOA 1ZYQA 5DI3B 4EUNA 1ZQYA 1W2GA 3QKUA 1BMFD 3ZDAA 1Q1ZA 2ZRLA 5FBLB 2QBYB 4EAQA 1Y3AA 3ADKA 3T35A 2V1XA 3TUIC 1WP9A 1M6NA 3KB2A 3TANA 4NY8A 3LX8A 1CP2A 3A4LA 1QHXA 4JT4A 4PPXA 9ICCA 1CJMA 1CULC 5FOWA 2AXNA 1LB1B 3LV8A 3LRPA 1ZM3A 1BH2A 2HHQA 1KSFX 7ICEA 1HY3A 1CS4C 1IQPA 5J0RA 4TL8A 1YVDA 1SHKA 3G82C 3QF4A 3V7KA 1GWNA 3LY5A 1IY1A 3AF0A 3CR7A 4NCJA 2IWHA 3TARA 1UT8A 2PFQA 4KLOA 3UQ2A 2ZE8A 2O0JA 4MF8A 1TF5A 1JALA 2D2FA 5KFXA 3R8FA 4E03A 3Q9LA 4IXMA 3FHTA 5JJIA 1KEJA 2KTQA 4TQRA 4F5RA 1W4BA 3IIMA 3LQQA 4N0EA 4D26A 2D7CA 4JLMA 2R6CA 4RZ3A 4TL6A 5DDMA 1A1VA 4H9GA 3H2YA 5P21A 2AN9A 1TAGA 3PR4A 4IR1A 1KOFA 1VG1A 1YQTA 2X77A 4WA7A 5F9HA 2O8DA 1Z0KA 2OCYC 4KFSA 1L3TA 4PO1A 1KI2A 1Z08A 4B3XA 3KFXA 5JMTA 3U7HB 2KSQA 2PX0A 2I3BA 3A1TA 5J2EA 1OFHA 2ATXA 3A1SA 4LBWA 4R63A 2BBWA 2XGQA 1RZ3A 3EZ5A 2W00A 3A37A 2CLCX 4Q1CA 1OH6A 4NCNA 3RBDA 2FFBA 2QT1A 3Q7QA 5CR0A 4L9SA 1BS1A 2GTPA 1PUIA 3THOA 1ZQXA 1E4VA 3GV7B 3ZDDA 1ODFA 2YYZA 5DGAA 2ZYVX 3F3YA 3SZRA 2BPCA 3TQFA 2Q0ZX 1QDEA 2ZJYA 4LYHA 1KO8A 1LS1A 4GSYA 2B92A 3HP1A 4NCHA 4F3OA 1N48A 4O3OA 4LJYA 4OL0A 3RB3A 2FLNA 2JGNA 3CBQA 2NRVA 2PBRA 3LWLA 4PAOA 3SBDA 4B3FX 2X19A 3V7LA 5L1LA 1NMZA 4IVPA 4WOPA 4NZYA 4NONA 3W90A 4QZBA 4PZZA 4R66A 1VG0B 2J9RA 5TARA 3W8RA 3U6BA 1EFCA 3PX6A 1S10A 1DAHA 1S1CA 3SHFA 1EFTA 3ZIAA 4JLDA 4HAUA 4NYJQ 2X2FA 4TUSA 4GC7A 2HCBA 3A1VA 4BFZA 3EPHA 3EYZA 4NLNA 5EUMA 4HUTA 2ZJ5A 1HQCA 4KVGA 4QWEA 3B2EA 1NLFA 4QZDA 4KODA 1TQ6A 1TUIA 5C18A 1UT5A 1XBTA 2F7SA 1A4RA 1E9CA 1D9ZA 5HMMA 3GLGA 5SZIA 1OXSC 2CK3A 2J45A 4QJ3A 1MQ2A 3JPTA 1R0XA 2FOLA 1NJGA 3IIJA 4Y0AA 4JVSB 3K9LA 4ON9A 1E79D 2JLRA 4RD0A 2HW3A 3QJYA 1P2UA 2BOVA 4XVUA 3NBXX 1J8YF 4UXJA 1J99A 1DG1G 7ICJA 3UG6A 3K53A 5FTLA 4RQ5A 3C15C 2GDJA 3M0EA 5J0TA 4OK6A 3H8WA 1DBSA 4BFXA 5JCZA 3OEHA 5FTKA 3BRWD 1D9XA 3RS3A 2C96A 4C0SA 2VANA 4F92B 2DBYA 4Q21A 3ASYA 3L0IB 2BDTA 4ITRC 1U98A 1RXWA 1W0KA 4TMVA 5KT4A 2XC9A 4DXAA 3GV8B 4I28A 1S9DA 1VPLA 4RQ3A 2XZPA 2ZE7A 5EP2A 3REGA 3SNHA 4F2RA 1CR4A 3ICEA 1E69A 5AUPB 5KFFA 4DS5A 1L4YA 4MITA 4A15A 4EPXA 3MABA 2WWXA 4JS0A 2R6GA 1OB2A 4TMTA 2WJVA 4DDWA 4W9MC 2DFNA 3KJHA 4M8NE 2AGQA 4LC1A 2UVVA 5L3VA 1O3YA 4B32A 1X2IA 3UIEA 3GLGB 2OG2A 2ORWA 3Q72A 1COWA 2OO7A 1JR6A 1II9A 4KFRA 5FI1B 5J4HA 4BFUA 1RXVA 1E0JA 4B33A 1GL6A 2Y8EA 2W6JA 4DSOA 2CXXA 3B1ZA 3UMFA 4QZAA 1BMFA 3NXSA 2C8VA 4V03A 3CRVA 4LJ5A 4P4SA 1PLJA 1H8ED 2ZSEA 1XWIA 3OEED 1NK5A 1YZTA 2G0NA 1ZUIA 2ZR7A 4DSUA 4NP6A 4LV8B 3HWSA 3ORYA 1NN0A 1NVXQ 1JJ7A 1NJXA 2H7VA 5J2JA 4KLJA 3B82A 2QGZA 4FMDB 521PA 2PZFA 1NMYA 2G1KA 1XTRA 4ZI2A 3EWAA 2J0UA 3BS4A 4TMWA 5KO2A 4LYAA 4LI0A 1SXJC 3FMFA 5KFAA 1XMJA 2EWVA 2P6UA 3LVRE 4AKHA 3QPUA 4KAXA 5JUMA 5DB7A 4M9LA 4HATA 3HP6A 2HXSA 2JEJA 4CEHA 5JBQA 2PX3A 4EJSA 2OEPA 1PLKA 1W48A 2YVUA 4UAZA 2ZYUX 5BOMA 1N5KA 3Q8SB 1ZIOA 4QOSA 2IF0A 1ZQPA 4UB1A 2TMKA 3C8UA 4B3CA 4C2TA 2KZZA 3AVVA 3QVVA 3BQ0A 3ZLJA 4KHZA 1SKYE 5F98A 5J4LA 4P0TA 1MOZA 2LYHA 1DAMA 1E2KA 4Q45A 4BEJA 4UB4A 3O47A 2VA8A 1NK9A 8ICUA 5FPTA 5KYKA 1TNDA 5G53C 4P4SB 2BJVA 3Q8LA 1KHTA 2IUSA 1X9MA 2ZI9A 4ZDIA 1NY6A 1UKVY 1OXTA 2OXRA 4NBSA 4AKIA 1KAGA 2IYSA 1HURA 1RYHA 1TAUA 1W5TA 1Z0AA 5E95A 2VSXA 5KPDA 3SOPA 4DT1A 4MYUA 1I4TD 2W58A 4RQ7A 5LD2C 3SV4A 3GLIE 4FMBB 5AK0A 1M74A 2XSZD 5JWRA 4I2CA 5GVRA 3N5CA 1YJ5A 3H7IA 3PMNA 5J4VA 3ZZUA 5KFOA 8ICCA 2PFNA 4TTQA 4YQFA 4D4JA 2XY5A 2ZUDA 5L3SA 5AR1A 2BMJA 1YU9A 3M1IA 3EARA 1KFSA 4QBFA 4CEHB 4DL7A 3ZD6A 2BC9A 5EP4A 3GQCA 3PFIA 1G7TA 3L8ZA 4QZIA 2ZRKA 3K9GA 4JWNA 3CX7A 2W9AA 3TAUA 3RWOA 2OILA 1M8PA 4AG6A 1G8PA 4I4LA 4J9LA 5AJWA 2FZLA 4DL6A 4KLMA 7ICKA 2WKPA 2YNMA 4O25A 3TH5A 4Q1EA 4M6WA 3NC0C 1XCGB 4B71A 1NOMA 3C5FA 3CZQA 3OE7D 5J0OA 4DQPA 5FPSA 4IVQA 5JS8A 4B34A 4DLSA 2JEIA 3TR0A 2OM2A 2QAGB 4AC9A 3SDZA 4HYKA 4B76A 3R20A 1CJVC 5HNKA 2OESA 2PJZA 4B3GA 1N6LA 4K8OA 5EE5B 1MRNA 4DT1B 1V5WA 5JCPA 2CVHA 3MGHA 3NEJA 4TQUS 1U45A 4I1OA 1AZTA 2Z43A 3ZVNA 3OJUA 1TX4B 4TQSA 2C2RA 2XX3A 1E79A 1OF1A 4M1MA 2A1JA 5CITA 5L3SB 3PX4A 3T5GA 1U94A 4BWJA 3HDTA 5CB6A 4R65A 9ICTA 3OHBA 2KZMA 1TPZA 4UNNA 4M0LA 4QBIA 5C1BA 1E0KA 4JVNA 1MSWD 3U44A 3QXCA 1W2HA 4LGMA 5CM8B 3CONA 4XWAA 2FH5B 1C9KA 5KG2A 4F5NA 3TFSA 4MEYA 3RJFA 2UZIR 5TMPA 1XXHE 1XZQA 1RC8A 4PZYA 4TYYA 1MABA 4KXFB 5HMLA 1U0JA 2DFKB 4Q1DA 2JLXA 3S1AA 2C78A 1XP8A 2HLDD 1VYTA 2BCJQ 2O0HA 4MGYR 4QJ5A 3RS4A 4ZCLA 2GWSA 5KHOC 2BCSA 4MRVA 2AWOA 2BWJA 5KSYA 5CYOA 3V9PA 4Z6EA 4Q9LA 3AVYA 1LW7A 3LAWA 1E2LA 1NN1A 1F5NA 2FSHA 4FCTA 3FVQA 4FMCF 1IN4A 4OI4A 4Q03A 4C30A 5KSOA 2ZTEA 3LWNA 1KK2A 2R8RA 2WHXA 4M9QA 2C2HA 4IHQA 1WBBA 2NMVA 2BPFA 4IQUA 3C21A 4GLXA 3CNNA 2A1JB 3SYKA 4BZQA 3BAFA 1J2JA 4YDSA 3MAAC 2I1VB 4DJTA 1OHHD 2ZJBA 3PUVA 5C5JA 2ASDA 2C04A 5KSZA 4YN4A 4TL9A 4LHZA 3EAQA 1T0HB 4UJ5A 1XF9A 2AD1A 1H8EA 4DL3A 3LW7A 3OEEA 3BK7A 5KNDA 1N3BA 4O3MA 4LZZA 3ZS9A 5FBVB 2C77A 4O3NA 1ZQGA 2ECKA 1JI0A 1B22A 1YR7A 2VH5R 4QBHA 4WZ6A 1L3SA 5DDYA 2BQ3A 1GIAA 1XTQA 4I2JA 1NK4A 4FCVA 4H1VA 2ODBA 4IRCA 2WWIA 4HAZA 4YMWA 3UKDA 5J0QA 1NKBA 1LS6A 1U81A 3FE2A 1FP6A 2GXUA 3QQ5A 3S1AB 2WTFA 5DYIA 3TW8B 2BCRA 2RCNA 3C7KA 8ICZA 3QBTA 4ERNA 1NF3A 2GRJA 2REOA 5BPCA 4M1YA 3WYAA 4Z6DA 2G3YA 2DYKA 1G7SA 1P6XA 3QE0A 4ZPXA 2WV9A 3ICQB 3OZXA 4XSHA 1IM4A 2GEDA 2ZRBA 4W7SA 4YD1A 4BE7B 1SZPA 3FMOB 1E9AA 2HDNB 3VU9A 4D4KA 4EZ6A 4K4IA 3A1WA 3AQ4A 2VQSA 5KFRA 1VCMA 3Q8XB 4KMUA 1NSFA 2GKSA 1Q12A 1P75A 1R8SA 2WOJA 3CUEF 3NDPA 4M1WA 3AGPA 4NCIA 4GXJA 1FTSA 2QQ0A 3RC3A 4CVNA 2ZR9A 3RAPR 3GLGE 1ONBA 3G6XA 4Z1MD 2XB2A 2AD5A 5KFDA 1KSJA 1W0JD 1VG8A 2ZRJA 2R62A 4RQ8A 2IBMA 4PAQA 2EW1A 8ICYA 4O2RA 3A1UA 4LBZA 4POAA 2QY9A 5E7MA 1OH8A 4FS2A 2ASLA 1NJWA 2XSZA 4IDPA 4WXRA 3TNFA 2J6UA 3H0KA 1KY2A 3TE6A 3H4MA 4DLTA 2RHMA 4MKFA 3U3OA 2NRTA 5K8UA 1KZ7B 1RJ9A 3BBPA 3D8BA 2DPJA 2KI5A 3CW2A 3DZDA 2AXPA 8ICFA 1G8GA 1G21E 3B5JA 3K09C 4NCKA 3WMEA 3T61A 1YZQA 4RSGA 3VU9B 4LCBA 3LX5A 1OFTA
chains in the Genus database with same CATH superfamily
3LCJA 2GZHA 2OB1A 3E7FA 1J2UA 3OE7A 1N7GA 3EIEA 1LBQA 5BWCA 1IBMB 1MEOA 1IHOA 3A9UA 1OXXK 1B0XA 4A92A 1GPUA 1LTKA 1RQRA 1JUDA 4HYQA 4KV9A 2KNJA 4M04A 1V5EA 2LDBA 4IFTA 3O9ZA 4L9AA 4URWR 3CPEA 4QZCA 5DM2A 5E3HA 3WC4A 4KPEC 2IPAB 3R5FA 2AJTA 1V1MB 5K0NA 2FPOA 3PD1A 2CF6A 1RRVA 1DWOA 3HMKA 1T36A 2PHZA 4AP9A 3JSAA 2ALZA 1QV7A 1QHNA 5EJ4A 3WB0A 1MA7A 1UDAA 2XUZA 1BXRB 4I50B 1MOPA 3KZ1E 5FTWA 1B6RA 1G3QA 4MYSA 2Q1SA 1ZIDA 2HK8A 1DPFA 3N2IA 4MQEA 3WO0A 2VHXA 4H08A 1ZNXA 2FPWA 4DLBA 3D2LA 1Z2DA 1JVBA 1WKBA 4ZHSA 1J00A 1IFXA 5F1KA 3HRDD 1IYZA 1XCBA 1FBNA 1BPZA 4LX8A 2CVOA 1KI6B 3C14C 1IH8A 3X2SA 4G3IA 5TQ2B 1IIBA 8ICOA 2EZUA 2CE2X 4FGZA 3U1BA 2IXTA 2V6IA 1Z00A 1SO8A 3DLIA 2UXCB 4GC9A 3NM6B 4A2PA 2R1VA 3CEHA 4DJFC 4GMXA 1P5ZB 1JSLA 2PUAA 1PGNA 2RLTA 4HQ0A 1IIRA 1E6UA 3RROA 1YVUA 5TQVA 1DO0A 2Q99A 5AXAA 2HIHA 2FX2A 2VHQA 2PH5A 3A1DA 3GRYA 4CG2A 5LIPA 1KYXA 1NDHA 1ADBA 1EK1A 4JLAA 5G1NA 1ZQCA 3KL2A 4IV8A 2HHLA 3S55A 5GM2A 4BP1A 2GCPA 4TSFA 3B7GA 4PO3X 4J76A 4Z8YA 2MU2A 4ZCPA 1Z12A 3HR4A 1DSSG 3P96A 1BAPA 3HCOA 3NHYA 1FQJA 1X9IA 4KBYA 2NTEA 3UA4A 1IM5A 5KINB 3MD9A 1F2UB 4EG7A 4NYMQ 1KEVA 1VXRA 2FEMA 4AIIA 3LQ2A 1XXHA 4AXXA 5KFQA 4B3MB 2OCXA 3G8CA 1Q77A 3NAMA 3QSGA 4L1KA 3ZXIA 2QB0A 3PW4A 1ZO8A 3EF0A 3BSFA 1E59A 2VHTA 3W8DA 4HEHA 1T15A 2FUG1 4OGWA 1UOQA 4NBTA 4YRDA 1CF2O 4AURA 4GGOA 3EGXA 1V16B 4B17A 1M2GA 5DJ5A 4BN0A 4J7CA 4WDQA 1JJVA 3VR6A 2XMPA 5JZSA 1NKSA 3QMWA 3OZSA 4QGBA 2C5AA 3AGQA 4DSIA 5K0BA 1JHZA 3H87A 4O5KA 4LTDA 2JW5A 4Z7OB 1O4VA 3U0BA 2XD4A 3AR3A 1G291 1NVEA 2BEKA 1P1CA 1QVWA 2GASA 2X5JO 3VNVA 1GXSA 3I4CA 2G28A 1XTJA 1Z45A 1IUOA 2J7PD 1U2QA 4BC0A 2W8BB 2O2GA 3RBAA 3JTEA 3MILA 4UKDA 4HN4B 2PH1A 4B31A 3TM4A 3ZWOA 1ZONA 4HTFA 1FFDA 2J5XA 1MGOA 3VMFA 1E18A 4KX3A 1AUQA 3CTMA 1YBFA 3B53X 3QITA 5KDLA 3FDFA 3TUJC 1XDZA 3FFAA 4RTJA 2ZSKA 3G6YA 2WUVA 10MHA 1QPBA 1SUEA 3W7AA 1X9XA 1II8B 1N75A 1FMJA 3TLAA 2J5KA 3FCYA 2FUG6 4RC9A 4BUCA 4QUJA 2W9BA 3GJQA 1AGPA 3EOZA 5COAA 2W2OA 2ZYIA 3L4KA 4ZO4A 3HT3A 3W3AD 3FRJA 5BSTA 4DSJA 4A6DA 4ISBA 4PBSA 4UAYA 4OBEA 2J07A 3Q9NA 1QP7A 5DULA 4LHVA 3IHQB 4B3IA 3CV3A 4YUZA 3A31A 3DE7X 1OOEA 6NULA 3DGFC 4KLSA 3PR1A 1RPTA 1ENPA 3F1LA 3WA7A 4O5CA 2P75A 5HM8A 1NJ5A 3LWDA 2HADA 3OFNA 3HEAA 3IAXA 1CYEA 2HF8A 3N2GB 2O14A 3P45A 1Z5WA 1M6HA 1XEFA 2FSPA 3FVRA 3ITEA 2FFJA 2P0AA 1AKTA 3M6KA 1U8YA 3NGMA 4HMOA 1R3UA 1H5UA 5JXWA 5DDIP 3OU2A 2DPIA 1REQA 1E1NA 3IT3A 2ODEA 1LPOA 1QIDA 3G2LA 4O4JF 1DX9A 3KP1A 2W2TA 4JDPA 1HT1E 3BWMA 4ZPJA 2WD7B 4US0R 3N3BC 4PSKA 4MDYA 4L85A 5CXXA 1SURA 2V55B 2GT1A 5DKWA 4ASUA 2HBQA 3EXG2 4KDRA 1R5OA 5LXTB 5J2FA 3DAYA 1NXSA 1HX7A 4PE5B 4DZRA 1YVEI 1M3SA 2AEEA 3KALA 3K1YA 2ID8A 2JJ2A 3DP9A 3P9CA 1YUNA 4K5QA 2QXYA 5CB8A 2ECQA 1XJCA 1VXOA 4H7HA 1H65A 4G4IA 3L8EA 1XOIA 3RTDA 1G8HA 3OTOB 4ZCRA 2GBGA 1ULHA 2OFWA 1W581 4P0QA 2TECE 1XAHA 1F6WA 4ED2A 2IW1A 1FE8A 1EIZA 4YFVA 3WGZA 4UEQA 2NZYA 2H16A 3MJEA 2C94A 3S44A 3K4QA 2I7CA 2LBOA 4R71A 4HPWA 2OR3A 4YREA 4B3BA 4KQHA 4KZKA 3TG8A 2GVDC 5EI5A 4M2LA 4XUCA 1VL2A 4QYTA 3LFHA 3DL0A 2H17A 1KS2A 4ZTBA 4DY6A 1OE0A 4MUNA 4IMJB 4R41A 1DINA 4QUEA 4RKEA 2BH9A 4DBVO 1NIPA 3SC2A 3GEPA 3Q7PA 3HG7A 3N9IA 1ZUWA 4JUDX 2GHRA 3W7VA 2D1SA 2WJJA 3PVSA 4I9FA 3G68A 3BQ1A 4G0PA 4J16C 1ZLXA 1UBOS 3C4JA 1PS0A 3NBYC 3OZEA 2E1RA 2REXB 5BXQC 1S1MA 3WV4A 1N36B 1ISHA 4MFFA 4BNYA 3SQOA 4FC7A 3L8YA 4FYJA 3BEDA 2CXQA 2G5TA 4P4PA 4FFDA 5KT3A 3UJNA 1RIFA 2R6AA 3KT8A 2RGAA 1D6MA 3NTQA 9ABPA 3CLRD 3GT4A 1CY0A 5U4XA 3ZLTA 5DXAA 2W6CX 1L4UA 1QHYA 2WVHA 1P0MA 4IIBA 1ORDA 2BM9A 2P35A 2E6UX 5BV0A 4JJKA 3N4MB 2YYSA 4RA9A 4P2HA 4X3OA 3FLEA 1Z13A 1M34B 4LV6A 3M33A 1GY8A 4QTYA 4CKBA 3S29A 2IV7A 4Y1RA 4UBMA 4XOIA 3NCHA 4RIIA 5CVTA 3N1UA 5ECDA 1OT3A 4ZXFA 3T1TA 3VKHA 4KQ9A 4WCFC 4HGPA 4KMMA 1FUUA 4AF7A 2EGHA 5AFSA 2YHIA 2WG1A 5ALUA 3OJXA 1LC3A 1HJPA 3RRZA 5EJ6A 1U31A 1FPMA 4FHEA 3QMMA 1JDTA 2UKDA 8ABPA 5A5GA 4FFLA 5T4HA 3GZNA 2OLEA 1B1CA 3E2PA 1TKAA 3GRUA 4HTAA 4FXOA 1CUDA 1U5AA 2K4PA 5B2FA 1IATA 2EANA 3ZQ4A 1KHHA 2JNWA 1RIIA 1RWQA 2CBGA 2QJTA 1KDOA 1S3FA 2JFPA 4P9NA 4Q1BA 2OTCA 2JZCA 3QIAA 4J0IA 2R97A 3N86A 1SIUA 4NZOA 3NV7A 1ZY2A 4L5YA 1SY7A 2NQ2C 4N65A 4P32A 1JKXA 1C8VB 1YACA 4CN9A 2RH4A 1TO6A 3WKEA 4RSRA 4WFIA 3SQXA 1VIAA 1TLLA 1XTIA 5IC4A 3ZHZA 4HAXA 4PYRA 4D3ZA 4JIMA 3MJSA 2Q6IA 1OSNA 3JVEA 1OXBB 3LJKA 4F72A 1PE0A 3MEQA 3K6SB 1N78A 2OUIA 2KKVA 1OWNA 1MO5A 1WULS 4OHUA 4G3XA 3B51X 4HWOA 5FYDA 4YAIA 1G63A 1DQSA 1V37A 4DYHA 2QHXA 1M8KA 1CUVA 1F8XA 4O4LA 1UIMA 2RC5A 4U2FA 1AG9A 3BZCA 4PLHA 5B7GA 5K3FA 2Z04A 4TZ6A 1NXQA 1YA4A 1JBKA 3U7JA 3RSZA 2KM1A 1SC4A 3LBHA 5REQB 2XYQA 1SBIA 2PFGA 3K5PA 2JGLA 3EAGA 1SFRA 3WWOA 1E8NA 4MINA 2ZUFA 1PS9A 1JQEA 4C6TB 4K6FA 1EVLA 4KJZA 1A0PA 2AOVA 1RM0A 5K8TA 5FLKA 1B15A 5JROA 2IZOA 2VK8A 1BQ3A 2WWYA 4OX9Y 3BS5B 2C59A 4FR2A 1JU4A 1UBHS 3N05A 5TF4A 1KXZA 1U47A 4IIYA 1AC5A 2Z8XA 1ECGA 1TU4A 1N6IA 2WQ6A 3QEKA 1TKCA 4FYYA 3LNCA 3HX0A 2WAXA 2PXAA 2CXRA 1OD6A 2OZKA 4W6ZA 1O94D 4XD7A 4Y2QA 2ZE6A 3AEKA 2Q62A 3AJEA 2I71A 1C7FA 4YHBA 5DISB 1ETUA 3R7BA 2A19A 4UASA 4I3FA 3PHLA 1COZA 3W8EA 3FC4A 4JY7A 3FI9A 4XX0B 2N0SA 4ZCQA 4BRUA 1M1UA 1FDTA 1X6IA 1Q7EA 1KDRA 4AT1A 1LTQA 1GVNB 4KYUA 5KTPA 1P62B 3BMCA 3MXOA 2FLWA 5B3AA 3L9XA 1SZHA 1DCFA 1R4AA 1ZH8A 2OP1A 4Z86A 5EERA 4KN5A 5KHAA 2GNAA 1C9NA 4C2AA 3R3UA 1YQ9A 3AEVA 1ZOOA 1C50A 2Y27A 2B8JA 5KFMA 3A6DA 4XASA 1DO2A 2W9XA 3VVLA 3JQ8A 4JYMA 3G2PA 1J39A 4PQEA 2G7ZA 4HNSA 1CVLA 3LUHA 2JIZA 3L40A 3OEYA 3E9RA 3BRCA 4EJ6A 1T3QA 3QOYA 3VGJA 1EWYA 2BP7B 4B84A 5DFAA 3PI7A 1XN1A 1OU4A 3WWPA 1UEJA 5LB4A 2R751 1EGQA 4XCXA 1TEXA 4GYJA 1HFEL 8OHMA 3JYLA 3BYZA 2QPLA 3LPNA 1D8AA 4ARZA 1A77A 5GADl 4DREA 1QDLB 1T5DX 3I4LA 3KKNA 1G4UR 2I3AA 4KLNA 2ZRMA 5ER6A 4I2AA 1SKUA 3NO4A 4R83A 3FETA 5YASA 3NHAA 4KX5A 4V0SA 3K31A 3UFXB 4ZGWA 1BW9A 4EF5A 1J8MF 4RFSB 4I8IA 2X9LA 3TZQA 1AUXA 2VPPA 3TDKA 2WY2D 4DO9A 2HOIA 4KLCA 3ZWNA 1ZOLA 4AX4A 3KWMA 3LLUA 2W03A 5BN1A 4DOCA 4DFPA 5IVPA 3TAPA 2G0TA 1MH1A 1CEZA 621PA 3L1UA 1FLDA 3RYHA 3Q2IA 2PXCA 3VCBA 3MJDA 3UF0A 1K08A 5AVTA 5A06A 1M2VA 2JJYA 2IYAA 2PL3A 1HL7A 3L4SO 2C7OA 2ZWAA 2I4RA 2AZMA 1SWWA 2QTHA 3KHTA 1G20E 4YRRA 1FTWA 1GV1A 1XJQA 2ZRQA 1W52X 2QA5A 4Z3KA 3WK6A 3ZTTA 1F3LA 2REBA 2G9UA 5C46F 3G9QA 3QWIA 3K6RA 1W87A 2ZI4A 3TACB 2ZU0C 1ZGHA 1MCZA 2PYDA 4RQ6A 4COOA 5DW3A 3O84A 4WTOA 2CK3D 1NFRA 1WIWA 3G8YA 4IIJF 3CPJB 5JT1A 3WYCA 2HHWA 3EX7C 5IUJC 3UPUA 1W0KD 3B1JA 2XNDA 1LV5A 4ODIA 1GAXA 4MKXA 2P1RA 4FDVA 1EXMA 4E5PA 1KYZA 3HC7A 4QTXA 1Q22A 5HZGA 3GLUA 2ZM5A 4BE4A 2JGDB 2QS9A 1E3QA 3HXTA 5JZ9A 1C0PA 2V59A 3FYDA 4QGSA 4FIZA 5DT2A 4EUNA 2VWPA 3QLVC 1G6Q1 5TEVA 2PGAA 4S3MA 4J0JA 1X87A 3I9FA 4HFJA 1EP2B 3EGEA 7ICEA 1HY3A 3C6XA 3F46A 2YXDA 1ZXBA 2AZDA 3GQVA 2JJMA 4I46A 2D2FA 1BVRA 2L19A 3IIMA 3AFOA 4X6LA 2B2XA 5B55A 2VCEA 3JD0A 5DSXA 1KI2A 4AULA 3IOCA 2AYYA 5J2EA 2JLAA 4INOA 4N8SA 4YRKA 2GTPA 1ODFA 3ZDDA 1IQUA 1L8XA 4MVJD 3V2IA 5A9TA 1VBKA 1Y1KE 2F2TA 4HN2A 2VDQB 4NZYA 5E6RB 2IEAA 5TARA 3U6BA 2IU6A 2P9CA 4QT4A 2VHEA 2YWRA 4WBNF 4GM1A 5BOSA 1XHFA 4Y0AA 3K9LA 4ECAA 5DTMA 5GONB 1EU1A 1THTA 4OK6A 3H8WA 3BRWD 4C0SA 4F92B 2IOYA 4TMVA 4QECA 5T5QA 1CUZA 4EHIA 1TYDE 4B09A 5JFTA 4DF3A 2V74B 3QX9A 1KVQA 5FI1B 3VZBA 3H5WA 2CV1A 3DOJA 4BQIA 2OBBA 3QLUA 1M2KA 4RVGA 2DERA 2YJGA 4EW6A 3D54D 2G1KA 1V39A 1JNXX 4TMWA 2FTKE 3T41A 1NONA 4ZV9A 3I1YA 4QKQA 3ZTYA 1ZQPA 4EG8A 1V7ZA 3SDBA 8ICUA 1O5IA 2ZI9A 3A9VA 5F7XA 4ALKA 1JPVA 3HFSA 2W58A 3FCCA 4YIKA 1D4AA 1E1CA 4JJ8A 3ZD6A 5TMDA 2P9YA 3SX4A 2TRSB 4XJVA 5IBQA 1FFXB 2UZ1B 4NEHB 3W04A 3NC0C 4KXYA 3A3PA 3CZQA 4DQPA 5I9BA 2VKTA 2VWQA 1GUYA 2PZAA 1KH1A 1UXIA 2W48A 3NEJA 5CFQA 3TPFA 4BNHA 5B4UA 4R2KA 4QYXA 4ZVMA 2G8NA 1W8IA 1U8XX 3CONA 1EDZA 2WB1C 5CBPA 4YO8A 2PWPA 5HMLA 4MGYR 3RUHA 4ZCLA 2HSEA 1FRVA 4R1SA 4X85A 2JFVA 4C30A 2ZTEA 1I2ZA 5EMLA 1KK2A 3WQSB 1MZPA 4YDSA 2QQGA 4DN6A 5C5JA 2ZR8A 4N5NA 2O3JA 2AD1A 4IYRA 2CF5A 4QBHA 1YR7A 3UJCA 3WG9A 4LGYA 3ESDA 3BZWA 3K8ZA 2ZAYA 1XFDA 2DYKA 2XYHA 4CHGA 3OZXA 4MTLA 1E9AA 2HHAA 2XMBA 4ZEMA 4RMNA 4UNNA 1F2VA 5T67A 4UHFA 4OXQA 3F2CA 2I1LA 1HOXA 1IEWA 4LE1A 2IBMA 4O2RA 2EBWA 3IP8A 3H1EA 4ENTA 1KZ7B 5K8UA 3E3NA 2VAPA 5JTUA 8ICFA 2BMAA 3R0JA 1ZD1A 1QG6A 3KQPA 3KQLA 4OHZA 3T3MB 1S7GA 2LXNA 3K92A 2DQKA 4L08A 4UHCA 1E62A 4DBLE 2P2ZA 5CM9C 2ZSDA 3VOBA 1JHOA 2EZ9A 1XU9A 5JU5A 2VAWA 1R0YA 3EMBA 2PR7A 4BFTA 1PUJA 4E6PA 3AIOA 4P2GA 1DAKA 4ND7A 2WYHA 2EDCA 3GLFB 4OUDA 2Y0SC 1QSLA 1BU5A 1SD1A 3WL6A 4IGKA 1WPXA 4B9UA 4BV8A 3DE6X 3AG5A 4AW9A 1E5LA 1YB7A 3V2GA 3LRXA 1GARA 3C29A 4WBSA 4ED8A 2RMKA 2OXCA 4YJ3B 1Z22A 5E6UB 2JRCA 1DG9A 1J2MA 1KK1A 1L5QA 1FP4B 4WA8A 3GIMA 2VWGA 2WIKA 4QO7A 3R3ZA 4Q4AB 4ECZA 1RU3A 3KSAC 1JECA 1C9MA 2K87A 2FXIA 1HLGA 3RV3A 2YS6A 1FNDA 3CRRA 4S0ZA 1I2DA 4IC9A 5BVHA 1ZGGA 4KV7A 3VHLB 2C9YA 1RXUA 3A0BU 4FNGA 4QSHA 5AIAA 1CLUA 2R18A 1XR3A 4RANA 1DC3A 4P3XA 1GCUA 5BURA 4KLUA 2Q3EA 4G8JA 5IMBA 4E7PA 1FDUA 2W8KA 2HWXA 3IBYA 4YO7A 1K6IA 1M2WA 2B21A 3JSXA 1HO3A 1FU7A 1YZ3A 3VU0A 1JFFB 3EZGA 4F96A 2Z2JA 4P3NA 1LH0A 5KQRA 4PZ9A 5DK4A 4DLXA 2K8BB 3HY3A 3IJPA 1UBKS 2E49A 4YBRA 1EXDA 1PVDA 2BPOA 5IK2A 4OA5A 2IS2A 2XGGA 4UU1A 1N5RA 1VSUA 2BI8A 1Q3TA 3GUHA 2KLHA 2RKWA 4BQFA 3UMCA 2O57A 4D0GA 3SVZA 3W1EA 4NBKA 1DC4A 3UOGA 4AN4A 1W5AA 2XCTB 4JYCA 3A25A 3UXNA 3LVBA 4II2A 2FHPA 4GICA 5A4MS 3ROQA 2C5HA 1W88B 1YU6A 1E1DA 2I99A 4LJ6A 1QU2A 1DDGA 1BCRB 1F12A 2GDZA 3EPLA 2YWDA 3UHJA 3U62A 2KBEA 2WIAA 2FZWA 3ADPA 3DB2A 1Y4SA 2HO5A 2VXBA 3WFIA 4EZIA 4GNKA 3MYYA 3ZU2A 1P9RA 4JC5A 4HZUA 1SCJA 4Y2TA 2BONA 2Y1IA 3WRYA 1EP3B 3RYCA 4KPUA 2OAP1 4S05A 5B4TA 1B14A 2VSYA 4UBBA 3PQDA 4QA9A 4M46A 3IMCA 4DA7A 2Y1EA 3PC8A 5C9ZA 3CE6A 4DM4A 4KMOB 3FDSA 3MG9A 3NDIA 5DLFA 5CNIA 2OD2A 1DKUA 1XTUA 2YJNA 2VYFA 3NEAA 1GU1A 2C3YA 3NOXA 3TZLA 4FTWA 1BPEA 2CD9A 1UPBA 5A3SA 2JATA 2AX4A 1O7JA 1XRRA 4C8MA 2FSFA 5D85A 5L9AA 3BJEA 3NWJA 2IA5A 3J81A 5FL7D 1T8EA 2VYQA 3IPCA 2JCGA 1Y8RA 5HQ3A 3TLEA 3N70A 2J1LA 1P74A 4F9GA 3DOUA 1Y1PA 3CZ5A 1NQAO 1ZMXA 2NTVA 2QPAA 2CLMB 5LKRA 1Z7YA 3EIUA 2QVXX 3CHYA 4C03A 3UFBA 3FN4A 4XGNA 3DBOB 2QD1A 5I7RA 4BBAA 4ALIA 4HS4A 5K5EA 1DO8A 2LKCA 4MGKR 3FPAA 4KWTA 2Y9UA 1OWMA 3ZWYA 3TL3A 1RADA 2CXYA 4IQFA 4FQ5A 3R5XA 2OZVA 4RA6B 2QX4A 4JDUA 4YAEA 2EDUA 3Q6MA 2GZDA 1PGJA 2IHYA 1ZESA 1ORIA 1XG5A 5KFJA 4KLLA 4R2MA 4M0AA 3I2IA 1AMOA 3EHDA 1UWVA 5HJEA 2PT7A 3UGJA 3SJUA 2ZJ7A 1KNQA 2V7EA 1V3UA 4PX5A 2X0IA 4FHCA 5BN4B 3JYPA 2W2NA 3MZ0A 2PKCA 4MQFB 5E7IA 3JYOA 5ALYA 2PQMA 2J59A 3ZDBA 1HC7A 4L0MA 3MC1A 1Y7TA 4D57A 5JSFA 2CLDX 3M5DA 4L02A 1DBVO 4BIIA 1TM1E 5LLDA 1QSSA 4YXWA 3MUOA 5K8CA 1O0BA 4YAWA 5H82A 4MJ3A 4A2QA 1XNGA 2ILVA 2XUJA 1NE7A 3GFBA 3IBFA 2XMRA 5JJ5A 4ZOEA 2IYRA 1FNMA 4IXTA 5A9SA 2E8PA 1Z8DA 3H8MA 4A23A 1UXOA 2J3QA 5DV9A 3B9RA 2PSFA 4LG1A 4XIYA 1GCOA 2PFOA 5EA2A 2JC3A 2H2GA 2C0PA 3TNYA 5CDSA 5EOZA 2OV2A 3DD1A 1Z07A 3LUPA 3GA5A 1SK8A 3UWKA 4ED1A 4MRMA 4R54A 8ICNA 3BSSA 5K3CA 3C6QA 4ND4A 2ZSUA 1MIOA 4QPCA 2FETA 4KPYA 5INTA 4H31A 3JYNA 1QVAA 4RIFA 4C8LA 3U26A 1SBHA 2CVZA 3K9WA 3GFGA 3RTVA 5I6DA 1EK5A 1MP0A 1CEXA 1GPKA 3RH4A 2UVPB 4OI0A 2OO5C 3FZQA 2GCIA 1XD2B 2Y05A 4O4HB 4FHZA 2X0DA 4L0CA 2EARA 3HKBA 3OHPA 1U11A 3QTBA 1DIAA 4D5EA 4NG4A 1YS7A 3KVNA 4KN4A 1KSHA 3O03A 1YQUA 2QE7D 4N9WA 2FW0A 4P7JA 4RTPA 1XVUA 1B4FA 3FOBA 2GEKA 1NVKA 4HDQB 3EEFA 4Q7EA 3ZDZB 1KBOA 4MPTA 1XS9D 2YN4A 1G59A 2IS1A 4NX2A 4MEBA 3OJ0A 1ABEA 5HE8A