1SZPA

A crystal structure of the rad51 filament
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
316
structure length
295
Chain Sequence
MVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYEDGVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA repair protein RAD51
publication title Crystal structure of a Rad51 filament.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 81
structure length 295
sequence length 316
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1szpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1szpA02
4KLLA 2IYTA 4I81A 1IJEA 3FWYA 5L3QB 1Q1EA 1YZUA 2D74A 3T15A 1AGPA 4TLEA 3AVPA 2JZBA 4UB5A 3AM1A 5KT2A 1IXZA 3M4YA 3EWAA 3THVA 2IT1A 3IHLA 3LY5A 3QBVA 4KODA 3LLMA 3SU8A 2OESA 5IF9A 5JUMA 2AHOA 4RZUA 1U4BA 1KSHA 2N42A 1N48A 2ERYA 4EDHA 2AKAB 5DQHA 3KKPA 2NO9A 5LB4A 1D6JA 4P3YA 4B9VA 4QOSA 1DARA 1Z0JA 1KSPA 4I2FA 4WZ6A 3VKGA 2ZANA 2ZITA 2OSBA 1PLLA 4YD1A 1NJWA 2BBOA 1LS6A 3D31A 3TAHA 3C2MA 2BPFA 2ZI7A 3F0TA 4OK3A 1U0HC 2R65A 3H4MA 4RQ4A 1BGXT 4F5QA 1N6KA 1QHIA 1QHHB 4O3OA 3DM5A 4NE2A 4C8NA 5EE1A 4EEYA 3OAAA 4UB2A 1EFRD 1HUQA 4KSBA 2WWWA 1IM2A 3WBKA 1W5TA 1SKRA 4P4SB 3KKNA 5F98A 3ONWA 3I8SA 4MEYA 3G6XA 1SKYB 1Z6TA 2ZE5A 4LHXA 2O8FA 2ODWA 4NYJR 3GIKA 3ZD9A 1OIVA 4K8OA 1ZQGA 4L5BA 4PFSA 3RRYA 2JLUA 3BB1A 3KUCA 2W9BB 1E79A 1OXTA 1N6IA 2PLFA 4MUBA 2RCNA 2VHCA 3CUEF 5SZIA 3HP1A 3PXGA 4U5XA 3RWOA 4PHGA 1P4SA 5E3HA 2HHVA 1WCNA 4O3RA 1OE0A 1PVOA 1SL0A 3LWNA 1ZQXA 1KKMA 2J7PA 1HQCA 5UKDA 3R9IA 3SI8A 3HU1A 2ONKA 3QKTA 1SKWA 2KFNA 2FWRA 4AYXA 1G3RA 2DBYA 3B13B 1J7KA 2B6HA 1ETUA 3HYTA 5G41A 5KFBA 4QZ9A 2PT7A 4US2R 4RT3A 1KZGB 5AJVB 4A9AA 4GOKA 2QPTA 1SVMA 3OFND 4JYCA 4PX9A 4XQ8A 4DRZA 2C99A 1F2TB 2HHQA 1LTQA 3QVVA 4V0MA 4DDVA 4NCNA 3EPIA 5KFVA 4OK5A 3GJ7A 2JJ2D 2ZRKA 4QW8A 3T5LA 2ZROA 2QT0A 1WQ1R 7ICVA 4V03A 1F2UA 1OFTA 2DPXA 2JEOA 2QEQA 2YWHA 1NKBA 2A5FA 4DSEA 4RD1A 3TK1A 4CIDA 4F4YA 1ZQIA 2H5EA 1HJPA 4NYJQ 4CEHA 1TL7C 2RGNC 2NPIA 1BMFA 1Z0DA 3W9YA 4JV2A 4AWXA 1TPZA 2DFLA 2UVWA 1E2LA 2ZYVX 4PZYA 1EG7A 1QF9A 1T3HA 3KFVA 3PEVA 1CUKA 2P67A 2WIAA 4XA5A 4QBHA 4Q8EA 3RRZA 2QE7A 2GXAA 3MFIA 4EQ6B 1ZQCA 1E2KA 5DG8A 2R2AA 2YKGA 4Q4JB 4QBIA 5CYPA 3KHGA 5LPNA 4E07A 6Q21A 1UF9A 4Q1EA 4AKEA 5KPDA 4MFCA 2ASDA 4MF2A 1YU9A 2VYFA 1QBKC 3V4RA 2G77B 2QBYA 3JPQA 2CCJA 1NIPA 4EPTA 2F9MA 2V7QA 2RGCA 3K9HA 4WA7A 1XXHE 3QE9Y 3B0YA 5EZ5A 3PY8A 4YMOA 1FQJA 1X1RA 5JECA 1ZQNA 2P66A 3TFSA 2GRJA 2W58A 1C4OA 3O8DA 1ZCBA 2XY6A 1MO4A 1KK0A 2PMKA 2QA5A 4PTLA 1KI9A 4R8UA 4HDQB 1XJ0A 2OBLA 4EZ9A 4P2HA 1HY3A 5J2BA 1GITA 4ZKDA 3J81k 4EYHB 1T6NA 1R2QA 1KI1A 2ORVA 2ZYTX 2AQ4A 4IVPA 3QF7A 3CWQA 1ZQDA 4KLJA 3BD9A 3LBNA 1T3LA 1HE1C 4CEJB 1OPXA 2P65A 4FXPA 1DAHA 2YOGA 1XBTA 1VIAA 2EYQA 5DB7A 2KBEA 4KLHA 4TL8A 5SZHB 2XGPA 3SJZA 4X8HA 3NBZC 3AKYA 2CXXA 4PO9A 3I92A 5LD2B 3PITA 4RQ2A 5SZJA 3ADBA 2JZBB 2MSCB 2RH5A 3PENA 1OB2A 4IXMA 4PR0A 2XTMA 5J0OA 4F5NA 1V5WA 3GPLA 4MKGA 4JLAA 5C1BA 1NK7A 1AIPA 3Q5DA 4D4KA 1IN4A 3HPOA 2BV3A 4JSYA 2R8KA 1FFHA 1CJUC 3RJJA 1P72A 1NNEA 5L1JA 1G7SA 5JRZA 3GLHA 4M22A 1DADA 4NY8A 3U3KA 1P9RA 2YNMA 4OI4A 4II7A 2I9GA 3GP8A 1EXMA 4KI0A 4NYIR 3A4LA 4GC7A 5H68A 2O8DB 3N5CA 1FTSA 1S9HA 2IHBA 2QGZA 2V54A 3P20A 5JZVA 2ZRFA 2UVUA 4ED6A 2ZJ8A 4C8OA 4RU9A 2D4HA 3EASA 4L4UA 4FWTA 9ICVA 2F7SA 2FU5C 3T61A 3DMDA 3LVRE 4LHYA 3SYLA 2WSSA 2XB2A 1ZQWA 3MUFA 3AVVA 9ICCA 5JS7A 5FL3A 2O8FB 2BCQA 3C21A 4A0RA 4A82A 2IYRA 3EZ7A 4E09A 3DOEA 1HT1E 4N3NA 4QJ5A 9ICNA 1MSWD 2FFBA 5C4MA 1QSSA 5F9NA 2RDIA 1P62B 4Q7LA 4TUPA 1NVUQ 2W2TA 3JVUA 1G18A 1RFLA 3KQUA 1R0ZA 2FMPA 4MYUA 3GLGB 2WOOA 4YMMA 4LGMA 4E5UA 4M9QA 2IS4A 4TTPA 1LFDB 4FD2A 3T12A 4TWZA 3PX4A 2P6NA 4G01B 4JBWA 2ZRIA 3A6PC 4XVUA 1NL3A 3WNDA 7ICUA 2RMKA 3NVAA 1SVKA 2ZI9A 3EIEA 4NYIQ 3U61B 2WWYA 3ZDDA 2QTVB 4O3NA 5E7IA 9ICMA 1Z00A 1YRBA 2MAXA 4DCUA 1W44A 4C8LA 1RIFA 4GPTA 1WE2A 1ZQVA 3KL4A 4EIWA 5L3VA 4E0DA 1TQ6A 1XPUA 4LV6A 5A0FA 5DG7A 3AUYA 1F2UB 1EX7A 4DLVA 3GLIB 2XCPA 1X2IA 1E96A 2OCBA 2AJQA 4DC9A 1U98A 1N0WA 3GFOA 4CCHA 1GZSA 1GSIA 3OE7D 4JLJA 5KNDA 1MABB 1PJRA 2FMXA 3MLEA 5HCNA 4B9LA 3CPHA 3IBGA 3Q3JB 4I2CA 4QFMA 4NLNA 2W0SA 2ZE7A 5AWFC 2CVFA 4HB4A 4YQFA 4Q44A 4GMXA 3CR8A 4P32A 5BOMA 1VG0B 3CWZA 5J0UA 3ZDQA 5FUXA 1L4UA 4QC2A 4LHZA 7ICNA 1II0A 2ZJ5A 3OJSA 2Q9CA 4FMCF 2P5SA 4GRAA 3T5KA 5J0TA 1H38A 1OFHA 3I62A 3V7LA 1YHNA 4XSGA 2PJRA 2WIBA 4UNRA 3QOFA 3I5XA 5J4HA 3GJXC 1E0KA 1CR4A 2IXFA 4XTRA 3GDXA 1XFAA 1W36C 3EZ9A 2ISOA 1GRNA 1VKJA 1LF0A 3HDTA 3U7EB 2P5TB 3RJIA 1IJFA 1S3GA 4ECSA 4CEIA 2GZAA 2VPPA 7ICTA 4PQRA 2FPKA 1NMXA 4KLQA 4KXFB 3VR1A 5J5CA 3W90A 3MBYA 3HWSA 1SVIA 3GLHB 3ZVLA 4DSUA 2DB3A 3LDAA 1II8B 1UJ2A 2P6UA 1VECA 2AXPA 4JLPA 5BN4A 5F9HA 1QHSA 2M9NA 3K09C 5H1YA 3T1VA 2FE4A 2J45A 2VLIA 3WYGA 1SVWA 2R6AA 4M9SA 5J2DA 3PW0A 3RTVA 3CLVA 3UXOA 1U9LA 1XNJA 5KT7A 2DFNA 3TVDA 5M04A 4JS0A 3HR7A 4NP6A 5FTNA 5CDFE 1TK5A 2NRZA 1GNRA 3U7FB 5JCZA 3H8JA 2H92A 4L15A 1VYTA 3BC1A 5FUVA 5KFJA 4IDHA 3H4BA 3ISDA 5J47A 3OSNA 5KTQA 1FP6A 3DEFA 2A30A 2J7KA 1U9IC 5FI0B 4DL4A 3CNNA 3TQFA 1W0JA 1XP8A 1WRBA 3UK6A 5DSZA 3UG7A 1NLYA 4PPNA 3T5DA 4ITRC 1G17A 5A4JA 3W8NA 5BN3A 3TR5A 4IHQA 2A5YB 3IBYA 2BMEA 4F2SA 5GJCA 1AS0A 4JWMA 1GWNA 2GXSA 3M6AA 2GKSA 9ICGA 1XJCA 5DBBA 4ECRA 4ED8A 1BH2A 2PLRA 4US1R 4RUCA 3WRXC 5DO9A 1KYIA 4O5CA 4WVFA 3OHBA 3EZ2A 3K53A 1BPYA 1UAAA 2XZPA 2ZJ2A 1X8KA 3MJRA 3FYHA 1E1QD 3TAQA 9ICBA 1S9DA 4LWZA 4BPBA 4B9UA 2ZRBA 5GVSA 4HYYA 2PI4A 4JL8A 1TEXA 1S0UA 4MYCA 1N5LA 3B1ZA 5J0QA 3TH5A 1FTNA 4AKIA 4I2DA 3QZ8A 3EPGA 1XZPA 1T9HA 1E9CA 2QMEA 3LXXA 4XVRA 4KFRA 4Q9JA 4C2UA 3RSOA 3U2QA 4PPXA 4LK2A 4DCVA 8ICRA 3GFTA 4DOAA 4G5GA 4J9OA 1NN3A 1QG2A 3C5CA 5J0WA 5J4KA 1Z00B 2WJGA 4IQTA 4RVCA 3B5JA 4ZPXA 3K9LA 2NO6A 4NMMA 4F4CA 1F6BA 3K0AA 3K0CA 4DQPA 4O0MA 4QGGA 4MUAA 4YXWD 1ZQJA 3AGQA 1I2DA 4ZIRA 1U94A 3U7GA 4M0AA 3X1ZA 2D7CA 4ZCIA 1SHKA 3E2EA 2F3TA 8ICCA 5E7JA 4EFNA 1N0UA 1G6OA 4M2YA 1U0JA 2QENA 3QXHA 3IM1A 4M4SA 4XTCS 4KHZA 4UAWA 5EQTA 5IK2A 3VTKA 3ZS8A 4DDWA 3BAFA 2QQ0A 1E2EA 4PC7A 3R8CA 4R63A 4D82A 4CGZA 4RJLA 4B71A 1CR1A 3CF6R 3IILA 3VKHA 3QBTA 3NC0C 3W6NA 4M1MA 3PW4A 3PV8A 5FBVB 2FFAA 4NCHA 5CK4A 5EUQB 3GV8B 1S9FA 2ZQ5A 2IW3A 3P1JA 4KLEA 1X86B 3RABA 1ONBA 4GZMA 5TVKA 2ZI4A 3Q8LA 4M9GA 3TQCA 4QBGB 2BDPA 5AUQA 5D3MB 3BDPA 1CKEA 5K8TA 5DQIA 2AK2A 3RB3A 4W5WA 1KDRA 3QPWA 2NO0A 5KSYA 1P2VA 4TMZA 1S1CA 3PV0A 3KQLA 3AUOA 1N5JA 4DCTA 3ZDBA 1KO4A 3BB4A 3SOPA 3C23A 1WP9A 2QU8A 2QROA 4URUR 1J70A 1P60A 3EPLA 3ZQJA 3IIKA 4PPQA 2JIZD 1COWD 1BS1A 2W00A 5FOTA 1TVAA 2Z4RA 4MGIR 4JT2A 2YOHA 5TB5A 3V7JA 3RNLA 4D26A 2ECKA 3GJ8A 3FMFA 2FF7A 4IQVA 5KFAA 4FCVA 3UMFA 4BDPA 3W3ZB 3PCRB 2H18A 2HDNB 3LBHA 4JLMA 5HHHA 2IK8A 4A0GA 2ZRDA 1U99A 3SV4A 3SR0A 5KFUA 2VHTA 2GEUA 1L7VC 1XEWY 3SQWA 5AK0A 1W7AA 4BXOA 8ICEA 1S0OA 3GJ4A 3SFZA 4DCNA 3PVXA 1JAIA 1QSLA 2FX3A 4TMKA 4H1VA 1KFSA 2BIFA 4AY2A 1B23P 4O9MA 1E0JA 4DIEA 4P4MA 1A4RA 1V43A 2GCPA 2IEYA 3AB3A 3MR3A 2BCJQ 5D3QA 5JRJA 2IYQA 3LAWA 2JGNA 2XO7A 1BYIA 3FMPB 4HI0E 4P4TA 1IN5A 4QZHA 3QI2A 2J59A 2IYZA 4KLOA 3CO5A 1SVOA 1TQ4A 3ZYCA 1Q20A 9ICUA 2VP5A 1JEEA 2W6ID 8ICLA 3A1UA 3DMNA 4HB3A 4HDOB 4TT3A 2BGWA 2ZSFA 5KG5A 2W6JD 5BWMA 3MABA 1CRPA 1XMVA 4RQ7A 1LV7A 4PO1A 3CH5A 3C7KA 4UXIA 2D3WA 5TV2A 3N2EA 5J2AA 4DFMA 5CM9C 1MO6A 3T06B 4Y0VA 3O8RA 4CVNA 3H1TA 3GEHA 2FLNA 2XB4A 4BLPA 1II9A 1T4GA 2JJ1D 1E9AA 2R8GA 1XSLA 2X8AA 1AKYA 4IQWA 3G6VA 5CA7A 3LXRA 1ZM3A 3NKVA 2REOA 2JLYA 5DE3A 3AUXA 5FTJA 4ZV4A 4MKIA 1S76D 4LBZA 4F4IA 1U45A 3IDQA 5KG0A 1JB1A 4LPKA 3VHLB 2NG1A 1VHTA 3FB4A 4MITA 3KXKA 3U6KA 2VQSA 3R20A 4Q19A 3SYKA 2GK6A 3RLFA 1R0XA 4DLTA 3DZDA 3CIOA 1FMLA 1U8ZA 2XCAA 4QZDA 5TDHA 4Z8XA 2QM8A 3F3YA 1Z2AA 4IW3B 4LZZA 4Z6CA 3CH4B 5HE9A 2IF2A 3DZ8A 4UBBA 1GG2A 3OHMA 3RRHA 2QGNA 1ZP6A 2QAGA 2JCSA 4QGHA 1HE8B 1GL9B 1S0VA 1YR9A 2PX0A 3UG6A 3IEVA 4TL6A 3QXSA 1FP7A 1TMKA 3FE2A 4NZYA 1OXVA 3RH6A 4Q02A 1XMSA 4UB1A 4MEXA 2ASJA 1U47A 4EQ6A 4KMUA 1SGWA 4MFFA 3NBXX 4QZIA 3QKRA 4PANA 5FOUA 2ZAOA 5EXSA 4RQ0A 1TAUA 2GVZC 3RWMB 4QZAA 4G5OA 4MF8A 2ODNA 1UBCA 3NHBA 2HVIA 4KVGA 3SE0A 5JS8A 3K70B 1TU3A 5CP2A 2KZMA 2AGQA 1RVDA 2WJVA 2O8CB 3KXIA 1LY1A 4IOMA 1NK8A 4WXRA 1YJ5A 5GJVC 2ZRCA 5AJWA 1VG1A 2TMKA 5CR0A 2B21A 4URZR 4YLGA 1KOFA 1NBMD 3GQBA 3K9NA 2RGAA 2ZTSA 5D49A 3Q8MA 2FJUA 3R8FA 1TAGA 2IYUA 1YR6A 3L43A 1Q22A 4QJ4A 5KFLA 3BK7A 4MRPA 5KSPA 1H8HD 3B9PA 1S10A 4IDNA 4ARZA 1TAQA 2LCFA 3VR4A 1G20E 1G6HA 2J87A 3L0PA 5BYKA 3QY0A 1OH5A 4DFJA 1CJVC 1HQYE 1W2GA 1RYHA 2SHKA 3W6PA 3KTAB 3B1YA 1XTSA 2EFCB 5BOLA 3THYA 3LA6A 2D2EA 4Q18A 4J9SA 4I2BA 4Q5IA 1XTIA 2QTHA 5AJXA 2CNWA 2XOKA 4LZDA 1VTKA 9ICTA 1UKVY 4BFUA 3G82C 1HA3A 2R6CA 1JEDA 3ADCA 5KNBA 4DHEA 3KX2A 3NG1A 2O0HA 1CTQA 2Q0HA 4HAXA 1F3OA 3K1JA 3RBEA 2C2RA 2BDTA 5ELXA 5DN6D 2WVJA 2PXIA 3QPVA 4Q1FA 2HW3A 3EIHA 4FINA 3KKMA 3MGCA 1CULC 4FI3C 4BFYA 1JPJA 4QZCA 5HNKA 4GC6A 1IXSB 2IUTA 2X1VA 4M1SA 5EXTA 4F7WA 1D8TA 1N6RA 4Z6FA 1SVSA 121PA 1DAKA 3BERA 4JVNA 1R5OA 2BWJA 3UPQA 2BMFA 3MD0A 4MRVA 3V4FA 2A1JA 4PC2A 3MGIA 3HPQA 4B76A 2AWOA 4B9SA 1XU4A 4F8RA 1TU4A 3C1YA 3TAUA 4IFBA 3GEEA 4KLFA 5K8LA 3QE0A 1D9DA 4YD2A 4P33A 4BASA 4HB2A 2FSFA 1G7TA 4HYKA 4TUQA 4ZO4A 1CS4C 4J9PA 2CHQA 3WY9A 1Z29A 3FHTA 3NDBB 4J9MA 1MT0A 8OHMA 4R9UC 5FBRB 3F8TA 4M9LA 5HTKA 1U2RA 5DGAA 4RPZA 2ZRNA 3PW7A 2RKOA 2FG5A 4RT2A 4WBSA 1N2CE 1U8AA 2JLVA 1XMJA 2RHDA 1RC8A 3H4DA 2NIPA 5JFGA 2XNDA 1TFRA 1Z0IA 1G3UA 2VSFA 3TGPA 2R8HA 1AN0A 2ZTDA 3I3SR 3W34A 4D6PA 1CR2A 5DB6A 1XRJA 1E9BA 5FI1B 3ECCA 1XS9D 8ICVA 4TUSA 3FVQA 3PO4A 3AF4A 4HUQA 1AQYA 3E5HA 5B2ZA 2YINC 3WHKA 1G291 2EFDB 2GJKA 8ICUA 3BQ0A 3CRW1 3NDPA 3H7IA 1KDOA 4I4LA 2O8BA 3CKLA 1MQ2A 1DE0A 8ICNA 2FSHA 3GJ3A 4PAMA 4YMVA 5J2KA 1VYVA 1US8A 2O8EA 1NKSA 821PA 2W2VA 2DPJA 1QHYA 3K0FA 1J8MF 4FMDB 1X9MA 4XOIA 1RZTA 1ZQLA 4KSCA 4DLGA 1ZJNA 1NBME 2Z4SA 2G1KA 2NMVA 3BS4A 1CJKC 2YOFA 2WWXA 1M2OB 4ZCLA 4M9JA 3HJNA 5CJ7A 4D81A 1Z2CA 2YYZA 1SKYE 4IEEA 1CXZA 1OHHD 4Q01A 1M1YE 1ZNWA 2R44A 1SXJB 2AX4A 4NLGA 3C1ZA 3I73A 3QKRB 3U4QA 1XXHA 2GDJA 5L8VA 1N6PA 2C2HA 1DPFA 1LS1A 2WV9A 521PA 5H8WA 5LB2A 3VHXA 2XXAA 1W4BA 1GL7A 3K0SA 3UQ2A 3U60B 2G0NA 2R8RA 4JLBA 1HUOA 2QP9X 5JSZA 1KI4A 2ZS7A 1HTWA 4KLMA 4D4LA 2ZSBA 1SXJC 4C2TA 4US0R 5FPHA 5J2HA 2C9YA 4XD7D 4KBGA 4OI1A 3UATA 1P9NA 3Q9LA 5EJEA 1KO5A 4QGAA 3X1XA 3PJRA 4QNRA 3NXSA 2VP9A 1ZAKA 3GIMA 1ZUHA 2YWFA 1EFRA 3ASYA 3PR1A 7ICGA 1J2JA 2A5DA 2CEAA 3TVTA 3MG9A 3SZRA 3ZJYA 1L8QA 2JAQA 4IJMA 3LRPA 2GJ9A 1NY6A 3I61A 1VCMA 4ESVA 4NBSA 4JKYA 4KO8A 3FPAA 4IRDA 1VHLA 4JVSB 4M9XA 3RAXA 4KVAA 4RD3A 2IYSA 4M9ZA 3ZZTA 4ZDIA 1JR3E 2UVVA 1D2EA 7ICOA 1JXMA 3REFA 1LW7A 2NO7A 2XZOA 4F50A 2J7PD 4OK6A 2YHSA 4KN7A 2FGJA 2D06A 2LKCA 3PNCA 3BQ2A 3I8XA 2KZZA 1LF5A 1UDWA 1X6VA 3AP1A 4F4ZA 1S77D 3LVQE 2ORIA 2J0UB 1JALA 3Q8PB 5HE8A 4ACBA 2C2EA 2XY5A 4TLBA 3SN6A 1OV4A 2QT1A 3E70C 2ONJA 1CF4A 3ASZA 3PO5A 4B34A 4Z54A 4MGZR 4QNMA 4ED3A 4I29A 1G64A 3OFNA 4DOCA 1JPNA 4ZKEA 5AUPB 2ZI6A 4LJ5A 1DO2A 5FUYA 2RHMA 2IHYA 2VBCA 2ZS9A 3BXZA 4PC3A 3U3JA 3MR2A 1TV9A 4K81B 2JJ2A 3RB6A 4NHOA 4DDUA 3Q8QB 1AM4D 1RRPA 5EP2A 5IIKA 4B9TA 1AGRA 3OEHD 3Q72A 5KSOA 3ADDA 2CDNA 4E03A 4X8MA 1NN1A 4WW0A 2MSDB 5JMTA 1T8UA 3VU9A 3QZ7A 2WAYA 4N1AA 4IVRA 1GM5A 1IXRA 3EZFA 4RPXA 1OF1A 4MGYR 2PCLA 3TSZA 1AA9A 3UANA 8ICQA 2OBMA 2Q3HA 4TSFD 3WP1B 1YZKA 1BOFA 2FLLA 2OAQ1 2CE2X 2QP4A 3QPUA 1M7GA 1NG1A 1XJQA 4KLDA 1N6OA 2G88A 4QZEA 4YMWA 2HHTA 4FCTA 4TQRA 4Q4AA 4KYUA 2J46A 4UNNA 3THWA 1XPOA 3GV5B 1VCNA 4UB3A 5KFOA 1S0NA 1I2MA 1W36D 1IONA 4ZDKA 5BPCA 1RE0A 3GCGA 4AC9A 2LKDA 3ZVNA 3PEYA 5GVRA 2C5LA 1DBSA 3TANA 3H8WA 4EJSA 4NCIA 5FR1A 3OJUA 1ZQEA 4M1TA 2ZUBA 2X19A 4DLSA 4PHEA 8ICIA 3VNUA 4J9QA 1LV5A 1ZCAA 2ZAMA 3EZ6A 4DSOA 2WWGA 2VF8A 1MV5A 3SHWA 4D25A 4BFVA 3G6YA 2J5XA 3U44B 3Q5EA 2O8BB 1E94E 2QAJA 4I1UA 1G5TA 1CP2A 4GDFA 4Q1BA 5LDDC 3C8UA 2ZU0C 1PUJA 2QM7A 2XTZA 7ICSA 5AUNB 4XSHA 3GILA 1KJWA 2GJ8A 1KO7A 1VG8A 4LC0A 3VFDA 5B64A 3IQXA 2CCKA 4X5VA 3DKVA 5DIFA 1R6BX 3UXMA 1NG9A 2CLCX 1XTQA 1AK2A 2HCBA 4HAZA 2XC9A 5LD2C 2IEZA 3SS8A 1QHXA 3U3MA 4DS5A 4ERNA 4IDQA 2QMHA 5FOXA 1P2SA 5AJZA 1D2NA 3SC3A 2D2FA 1IHUA 1OXSC 4D80A 2C28A 2FMQA 2XXAB 2ZR7A 3TLXA 3ORYA 1JECA 1CLUA 3KFXA 4B44A 1ZINA 1F48A 2H57A 5JSZB 3RH4A 4OI0A 5D46A 1GTVA 3EW9A 1E2PA 2KE5A 1UEIA 3GLGE 4DF8A 2DWQA 2G6BA 4ASUD 3AP2A 3AGPA 2DY1A 2QZ4A 4HAUA 5FBLB 1OT3A 1LB2B 2C95A 2OFOA 2ZE6A 3QENA 3PMLA 1COOA 4YR0A 3O8BA 4RFSA 1U90A 4LYHA 2X2FA 4AYWA 2IA5A 2JDID 3L2OB 4DDTA 3CRMA 9ICXA 4I2HA 1XWIA 3PUWA 2GK7A 1NLZA 4UNQA 4B47A 2JATA 4V0ME 3JPOA 3RJHA 2GCOA 1E99A 1KDPA 1G19A 2OT3B 5K8IA 5IIJA 1KO8A 1XDBA 2HJGA 4AIIA 5FOSA 3A8TA 2R6GA 3GLIE 2ORWA 2PT5A 3L0IB 1S0MA 1AJEA 5JHHB 4YR2A 1DVRA 1G5RA 1H8ED 5CDFA 4TQSA 2OLKA 4DL2A 1VYUA 2EWWA 4LJ9A 4NYMR 4LOAA 3TIFA 3V9PA 2ZRAA 4OKSA 4KCGA 3NTUA 3C5FA 3I72A 4PHDA 1B43A 2BEKA 4DSNA 4A8JA 5KG4A 4PHPA 3OEHA 4HLUA 2ZYUX 1NOMA 3PR5B 3TE6A 5FPKA 1E1RD 3IIMA 1C7YA 1Z6YA 2OCAA 1CIPA 1NK9A 2GESA 2MSEB 4BWJA 3A1VA 2W8KA 4G5SA 1P7CA 4NONA 4IQUA 5DG9A 4B2IA 4A92A 4DB4A 4RQ6A 3QKUA 2ZRLA 2ZVQX 4RD0A 1P6XA 4F5OA 4JSTA 4YXMA 4O5KA 4Q7MB 4R71A 1ZQHA 2OLJA 1DG1G 1W4RA 2GBLA 4OQNA 4CEHB 5HP4A 2HEIA 4M8NE 3GEIA 3KZ1E 4QHTA 9ICKA 1SL1A 2V4QA 4Q4HA 5CJ2A 3AQ4A 4YMTA 3KQHA 4TL7A 2XITA 4PHAA 2CL0X 4EUNA 5C46F 4L9WA 2P6RA 4RQ1A 1YE8A 3CX8A 1E0SA 4LRWA 4PAOA 3WHLA 4DT1A 3AVYA 2FZLA 3SJBA 3VU9B 2C2DA 1LNZA 3ZS9A 3ZD7A 4OJQA 3KTQA 4F3OA 3OE7A 2AGPA 7ICHA 1NSFA 2AL7A 4DIDA 1KK1A 2NO1A 4NYMQ 3K8YA 1BPEA 3SDZA 4IOJA 2QBYB 2NZ8A 5JCPA 4Z1MD 2WSMA 2EYUA 1T0JB 5JI2E 3GLHE 1ZQZA 1VPLA 1G1MA 3THWB 1E9EA 4PPFA 4Q4AB 4I28A 2PL3A 1SKQA 3TAPA 5GJBA 3RRGA 2AK3A 4G3IA 5KG2A 4LYAA 3L0SA 2WWHA 2WZQA 3TNFA 1MH1A 1WF3A 5TY0A 1T3NA 4OHYA 3FFAA 4R8UB 2A7QA 2ZEJA 3O47A 4EJSB 4KAXA 1IAQA 1YZLA 1ZM4A 5HKKD 5FL7D 4BLOA 3R9WA 2PZFA 2Y1IA 2CVHA 4D0GA 1W0KD 3LH5A 2V9WA 4DLXA 1ZC3A 4NL4H 2H17A 5J4LA 5DDYA 3AKEA 2VHQA 1UBFA 2ZSAA 4TL9A 4MGKR 2ZI5A 1U48A 2ZRMA 5KG7A 4LZGA 4DS4A 4DQIA 1IM4A 1TADA 1NK5A 2IC5A 3B6EA 3C41J 1XEFA 3KXLA 4RCZA 5EZ6B 3TUJC 4FN5A 2QUZA 1E3MA 1TUIA 4XWAA 5CK5A 621PA 2KB0A 4M1WA 4QW9A 1XD2A 9ICEA 1VMAA 3MFHA 2FSIA 2FFHA 4WZBE 2RDJA 5IDVA 1CU1A 1ZYQA 4DFKA 3RS0A 4N0DA 3MWKA 3OHAA 4LJ4A 1DEKA 1Z22A 4B6FA 4PSAA 2OWOA 2UZ3A 1BKDR 2QMOA 1G3MA 1ZUNB 1D5CA 1PZNA 2HXSA 5A5GA 4JKIA 1XCMA 4C7OA 2NQ2C 1KNQA 3EYZA 3OSPA 1QHNA 2CK3D 4RY2A 4QJ3A 3M9OB 1ELOA 3H86A 4P4OA 3CW2A 3K0EA 2QY9A 4LCBA 4ZH4A 2BQ3A 3CNOA 4B74A 1PV4A 4ECXA 2FOLA 2R9VA 5KT3A 3CRQA 2LWIA 5EP1A 1OKKD 4MDFA 1ZNYA 2V9PA 3ZVRA 5HZKA 3GJ6A 1YR7A 2QL6A 2HF8A 3Q7QA 3AH8A 4UNPA 2GZDA 2PBRA 4DL5A 1UADA 2G0TA 4G3XA 3AV0B 1RZ3A 3UWKA 1QLNA 3CNLA 4A2QA 4CF7A 3RHFA 1Q3HA 2HHXA 1Z6AA 1Q12A 1L3VA 3U7HB 1UDXA 1N6LA 3M9MB 4N0EA 4YFKA 4TTRA 2GCOB 5KPJA 2HT6A 4NLZA 5EWGA 1J99A 2OCYC 2BPCA 3C15C 3HX0A 3TMKA 3P4YA 4U00A 1B0UA 4P0TA 5J40A 2R8JA 4IRKA 2QP3A 4UB4A 3LWLA 2ERXA 3LX8A 5EE9A 3THXA 1TK8A 3JPSA 1Q44A 1E1QA 3QKSA 2JLWA 1KSJA 4POAA 5B30A 2FN4A 4YR3A 2B7BA 4WXPA 2BKEA 3OESA 2IA6A 4A8JB 5EWEA 1T5IA 1W49A 2F1JA 2VF7A 3X1DA 4JK1A 4MRNA 3CPEA 5J0SA 4BWMA 3TQ1A 3HW8A 2DFTA 4R2HA 4B3CA 2WOJA 1GRQA 3ICEA 4IDPA 4D4MA 3AKDA 3UXNA 3RSLA 3B9QA 4PAQA 4W5JA 2OV2A 3W3AA 4R65A 9ICAA 1XO1A 1G7CA 5HCIA 1L3UA 2XX3A 2XSZD 1QHGA 4LV8B 2ZTEA 1N3BA 1NRJB 2Y8EA 3P32A 4TMVA 4B43A 1Z5ZA 4Q4HB 3V00A 2WJHA 9ICPA 5C4GB 4YXWA 2GZHA 4BLSA 4BECA 4I27A 9ICSA 2AWNA 4AYTA 2GF9A 4ZDJA 2BM1A 2GAAA 2HLDD 1B22A 2QRZA 4DT1B 4C0QC 5KDLA 4QM7A 3KQNA 4BRUA 1DAEA 2H7VA 4KLNA 3RJFA 3CM0A 4OYHA 2GXQA 4FW9A 4M1YA 4A6XA 1NVVR 4V0OA 3QXCA 2F55A 2P2LA 3BH0A 3I4LA 5AR1A 4DLZA 3UPUA 2O0KA 5KG3A 5KT4A 2H1LA 1RYSA 1ZETA 1G3QA 2FPLA 2R6DA 2ZRJA 4C0LA 4ZI3A 4DLEA 1NKTA 2C04A 1Z0FA 2BMDA 1HEIA 2EVWX 3BRWD 1IN8A 4R2IA 2ZVPX 4GI7A 5KFMA 3A37A 3AF3A 2WPDD 2IYVA 4HLCA 5KFWA 3X1WA 3SZ2A 8ICKA 3PX6A 1VDZA 3MAAC 3KQKA 2D7DA 4BLTA 1BPDA 3EG5A 4CDGA 3MFYA 4UJ5A 5D4BA 2WWIA 5CJPA 2F9LA 5K8UA 4CEIB 4TTQA 3RS2A 1M34E 4RQ8A 4LJ7A 4BGDA 5G3ZA 1XC9A 1COWA 2JA1A 2JIZA 3AF0A 4QXAA 4LBVA 5J0XA 3B2EA 1FUUA 3ZGXA 4C8MA 4OHZA 3Q85A 4M1OA 1YQTA 4NKRA 4M04A 5CITA 4MDEA 2PEZA 5FOVA 5GJWC 4BQSA 3IHQB 5DGXA 2V6IA 5TXGA 1NVVQ 1XD2B 4JLNA 5J0YA 5KG6A 1Z0KA 3CRVA 4CRWB 3FDSA 1WCV1 2PMDA 2Q3FA 4EFMA 4P31A 4JV1A 4C8KA 3CZQA 1G41A 2MUTA 3MCAA 3LFUA 2KJQA 1ZM2A 3LW7A 4AURA 3D7MA 2ZYWX 5DHAA 4A1FA 1IQPA 4XVQA 1AROP 1N6NA 3LQRA 3C2LA 4NM1A 3QEBZ 1G4AE 2BBSA 1KI3A 5G53C 1GNQA 3ZQ6A 3KDSE 3IPXA 5DB9A 2REBA 3WXMA 5JI3E 3FKSD 2ZI3A 3Q8XB 4O0IA 5DH9A 4UXHA 1CJMA 4Q48A 5J4YA 5EE3A 5JBQA 3BBPA 8ICMA 1XSPA 2AU0A 5CB6A 4RD4A 1K1SA 4EBCA 1P73A 2G1JA 3BFKA 2W6IA 4R64A 1YZNA 4RQ5A 1U81A 2QG6A 4PHTA 1ZQFA 3ZH9B 2W6JA 4YDSA 3QG1A 9ICQA 3UIEA 1ODFA 1DOAA 1R4AA 1JBKA 2ZR9A 3EIQA 1KO1A 2WMNB 4JV0A 3Q8KA 5KFZA 1Q1QA 1XD9A 1KEJA 4IR1A 4F4WA 2ZSDA 3HYRA 5FH9A 2BM0A 1KTVA 1Q3TA 4MYHA 3IGFA 4H9GA 1KSFX 5L1KA 3LW8A 5BQ5A 2BHRA 4B6EA 4MH0R 4GLXA 2JJ1A 2JEIA 1P75A 3X1YA 4ECWA 4R66A 2WJIA 2J6TA 2WICA 3TFRA 5BYJA 4Z6EA 1KI8A 1O87A 3RRMA 7ICEA 3P4XA 3MWJA 3THXB 3EX7C 4F2RA 3KHLA 1PLJA 2PFPA 3PW2A 2CLDX 1VG9B 1DGSA 4JZKA 2FA9A 3AEZA 4DUGD 4ESHA 4G5QA 1JNYA 4GNKA 4DLYA 3QSYA 1C9KA 1X8LA 1UBGA 2FSGA 3K0AB 2C96A 5E95A 3GJ5A 1ZRHA 4QM6A 1P5ZB 5AUOB 2OXCA 2ZUCA 4ZIRB 1FQKA 4O5EA 4F91B 4YN4A 3CX7A 5KFYA 4LBYA 3VAAA 3GLIA 4LHVA 4DEZA 5IIIA 4Q45A 5KDOA 4S35A 4KTQA 4LYFA 4JLVA 2IHMA 1I4DD 3VX4A 3JPPA 4O25A 5L3QA 1V9PA 3K0CC 1SXJD 2NRTA 4OQMA 1G8FA 4HDCA 5EXPA 4B35A 1Z3IX 4CZ2A 3GLFA 9ICIA 4JBXA 2BPGA 5HZHA 5J2CA 4WAUA 5L3SA 2ZR0A 1TTTA 3PVSA 1JQJC 4KLSA 1S8FA 4ECUA 3U3OA 4DWJA 1DG3A 5KFPA 1UPTA 5FUWA 3VR3A 1FNMA 3AP3A 4B73A 3ZIAD 3K70C 1WB9A 4DBLC 1IY1A 4CYMA 3NH9A 5HR5A 2J6UA 2MMGA 2BEJA 4KLIA 2YJTD 1A77A 1NMZA 4RZRA 1EK0A 4TYNA 3WNBA 1QHHA 1BO6A 3BGWA 2F6RA 2IBKA 4LI0A 1NBMA 3MSXA 4U7DA 1E0AA 3KJHA 2A78A 1OB5A 5DKWA 3ICQB 1Z47A 2VP2A 4B2LA 1FOEB 2BBTA 2FH5B 4IVQA 2VA3A 9ICWA 1YRAA 5C18A 1UT5A 1H8HA 3R9XA 2WJYA 2Z43A 3QIAA 1ZNZA 2W9AA 2VHJA 3RRNA 1ZQQA 5KDDA 1R5BA 1ZQYA 2IUSA 2A2ZA 1ZYUA 2BJVA 1XCPA 2DFKB 2FDCA 3PEWA 2Y1JA 1Z6GA 2RGGA 2ZETA 4JUZA 2YV5A 4DVGA 1NI3A 1W4CA 1Z08A 4BXOB 1ZD1A 4QZ8A 3AU2A 2PCJA 4AG5A 4C3ZA 4A15A 1TKDA 3IHWA 4FBTA 1L3SA 5FPYA 2AXNA 3LO5A 2GAOA 3B1XA 4V0NA 1N25A 5J2IA 4NXZA 1T8EA 3KB1A 1J8YF 2OO7A 4Q03A 5CM8B 1CEEA 3ZD8A 1T5LA 3L82B 2HCJB 1JR3D 2EW1A 5DN6A 7ICPA 2MUTB 1OJLA 2OCPA 2W0MA 2RGNA 4JLOA 1JXLA 1XEXA 1KLNA 1RKBA 1W48A 4ECZA 4Q1AA 1T91A 2ANCA 1G9XA 1HURA 7ICIA 3DM9B 4YDHB 2VO1A 3CONA 4P4PA 1NIJA 1OFIA 221PA 4URXR 1AS3A 5JHGB 2XGJA 1RJ9A 3VR6A 3SV3A 1Q1ZA 5JLJA 2JEGA 2DCUA 5KFNA 2CHVA 3B7GA 4GP7A 9ICOA 4Y0AA 1E4YA 3PUZA 4MRRA 4DZZA 1HV8A 3AKCA 3KJIA 3OEED 1KZ7B 2KZ3A 4L8GA 1JQLB 2QRNA 4TMTA 3C14C 2O52A 1WBBA 4JL6A 1FNNA 3AVQA 4GMDA 5KTYA 1MC8A 1KFDA 1TF2A 2IYLD 3PUXA 1NK6A 3RAQA 1P3JA 1EFHA 2I1VB 4DWIA 5F2EA 1TQDA 4Q4JA 2ISPA 3BJYA 2QQEA 4BEBA 3SQXA 1KDHA 3UXPA 3QEAZ 1A2BA 1S2MA 2K5UA 2XTNA 4ACAA 4EPXA 1M7HA 2VH5R 4Q7JB 8ICAA 4JMPA 3TRFA 4BUJA 2J1LA 3B1WA 2QPAA 4Q9IA 4RNOA 2C03A 2WM9B 4C0JA 3ND9A 4BRWA 1R0WA 1E9FA 2AD5A 3T1TA 1FL9A 2BCRA 4HZIA 1SXJE 5H70A 2AR7A 3JZMA 4URVR 3T1QA 8ICPA 4Q00A 4F5PA 5ANRB 2WBLC 2G3YA 1PUIA 5J2GA 4LPSA 5J2EA 1VCIA 4LYJA 3DL0A 4UQOA 3QUSA 1Z63A 1OH8A 2QAGB 4KJZA 1EFCA 1OYYA 3CRRA 4QGFA 1ZQKA 5CB8A 2CHGA 2DWPA 4M47A 2ZE8A 4EPRA 3HP6A 4MKHA 3SBEA 4OHXA 4O3PA 3QEOA 4I2GA 2GJAA 4UAYA 2Q9BA 3E1SA 3VR2A 4LV5B 1J90A 1IN6A 4TZ0A 2CE7A 4PZLA 3T5HA 2QAGC 2NPFA 2EFGA 3K4GA 3FHCB 1AS2A 4PGQA 1GP2A 4S2EA 3HU3A 1XMIA 3MJHA 1FZQA 1OHHA 3A1TA 2KBFA 1ZQBA 4C0HA 3GLFB 1FPMA 4UKDA 3TW4A 5KFQA 4QL3A 5L3SB 8ICXA 4K4GA 2BMJA 4O2LA 2IYXA 3OAAD 4HZUA 1VIYA 4TLDA 1KNXA 1UFQA 1Z28A 2B8WA 2ATVA 2ZJBA 2CCGA 5TARA 4O3SA 4UXJA 3W5IA 4XIGS 1HUZA 4XD7A 1R8QA 5KFCA 2QSYA 4ARZB 2WTUA 2ODBA 1OH6A 3CPJB 2O8DA 4IKEA 3IKJA 3TSOA 4DEYA 1MKYA 4GZLA 1E79D 4GBMA 1ZC4A 2NZJA 4TYQA 4RNMA 3REGA 4B48A 4ECTA 4Q7KA 2XEXA 4FS2A 1IN7A 1Z6XA 3H8SA 1BYUA 4YP3A 5FTLA 4HATA 4B3DA 3THYB 1A1VA 1DELA 2L0XA 3T1OA 5DNYB 2IX3A 3DO6A 3EA5A 3AF2A 4I2AA 2UVQA 2WKPA 4NLKA 3WNCA 7ICLA 1WDTA 5EOZA 4JIMA 3RB4A 1X3SA 4AKGA 1QZXA 5KT5A 2ZPTX 3DHWC 2V1UA 2R8IA 2WKRA 5AJYA 1BPZA 5KFEA 1D2MA 2A5JA 4IFEA 5KFXA 3RH5A 4BZPA 1EX6A 4JVLA 2GTPA 3GLGA 1PLKA 5DBCA 4EBEA 1ZJMA 4M21A 4RKFA 4GL2A 2VEDA 2BQRA 4IRCA 4Q47A 2JEJA 1P2TA 1GIAA 1LVGA 3OIVA 4NTZA 2OFWA 4A2PA 3CBQA 3GQCA 3D6TB 4JLKA 5FFMA 4AD8A 3LD9A 3FGNA 4HAWA 8ICSA 1E2NA 1W47A 4ELUA 2ZIAA 5DHFA 2A1JB 4QWEA 2WHXA 4URYR 4YXJA 1H65A 1XF9A 1BIFA 2NOAA 1L4YA 1XEXB 1BMFD 2IHNA 2W83A 3HR8A 3M8RA 2REXB 4EAQA 5KFRA 3AVUA 4BFZA 2VANA 2PFOA 4ECVA 1KMHA 3B78A 4I2IA 4C0SA 2R62A 5L3RA 4M0LA 4V02A 2BJWA 4GP6A 1JXEA 1P9WA 2YWGA 4TQ9A 4X8OA 1K8RA 1Y3AA 1E9SA 1ZU4A 1ZM9A 4DO9A 2IYYA 2QE7D 3EC2A 1RJ9B 3KJEA 3LLUA 4I1VA 4NDZA 3JVVA 4PQFA 2XY7A 5EWFA 3KKOA 4RKEA 5CYOA 5KSZA 7ICJA 3UWOA 2OHFA 3L0OA 2BCUA 5KNCA 4YG2A 1MABA 3VR5A 9ICFA 3WMGA 3ZZUA 4Z6DA 5J29A 3B1VA 4FMCB 4LJ8A 4ED0A 1ESMA 4IEIA 4CT5A 5IRCD 2DR3A 1S97A 3FOZA 1JI0A 1NJFA 2V7QD 3EXAA 2IF0A 4TSFA 4TLAA 1E98A 4FCWA 1L5UA 4WIAA 5KOYA 4EPYA 3SFVA 1XB2A 1KY3A 4PHHA 4X8LA 1XTRA 2NGRA 3EPHA 4TQUS 2QNRA 2CL7X 1Z8FA 2YC2C 3GIIA 4QZFA 2Q3MA 4IDOA 4HUQB 3GD7A 2PX3A 2FNAA 4RCYA 1K6MA 8ICTA 3PIRA 3B82A 3RVBA 3Q8RB 4Q1CA 3QF4A 4DLUA 1KTQA 2Q0ZX 2O8EB 3THOA 3ZDEA 1M8PA 1US8B 2HHUA 3W5JA 4HB0A 1N0VC 2ZSEA 4HEJA 4NH0A 2VIIA 1K5DA 2OEPA 2GEVA 3T35A 3K0FB 5KYKA 4G5RA 4R7ZA 2WAXA 2H8KA 5B58C 2RGDA 1ZQAA 2RAPA 2RGBA 2AFHE 1AKEA 3KB2A 2ATLA 1U0LA 2KI5A 4A2WA 4BFXA 3RBDA 2FV8A 2EFHB 3K09A 4PQYA 1MR3F 3IO5A 2V1XA 2C77A 3LBIA 4LSGA 5GADl 2BOVA 2JLZA 1Y63A 1NJZA 5SZKB 1DTSA 3RYTC 5JJKA 1ZQSA 5KU1A 3B0XA 4ECYA 3RJKA 2FPMA 1UBEA 4PGYA 1XXHB 2B92A 2Z0MA 3CF0A 1II8A 5EP3A 2AFIE 1U49A 3T34A 4FMDF 1G8YA 5CLLA 2FZ4A 1QG4A 2VL7A 3GIJA 2ODEA 1U8YA 3BE4A 1GKUB 2HHWA 4Q9KA 4Z8YA 5DI9A 3TBKA 2J0SA 3LWMA 3VKWA 2YZ2A 2I3BA 4JLDA 3C2KA 1U9IA 3QVUA 3OIUA 2ZRGA 3NEJA 1KI6A 4YONB 4D4JA 5KG1A 4F4KA 1UA0A 4A4DA 4HZUB 4C30A 3BFXA 3DDCA 2QMUA 2ZJZA 2E1RA 3M1IA 4TN1A 3RANA 4ASUA 4C9BA 2WSSD 3OIWA 1D9XA 2EWVA 5CLQA 3LQQA 1E9DA 5CB1A 2Q6TA 1G8HA 1ZW6A 2XAUA 1N56A 1NJYA 3MGHA 3TARA 2J3EA 3WMEA 2V4ZA 2JDIA 4QG7A 4DQQA 1JXOA 5IIMA 2WKQA 1T0HB 1WBDA 2O0JA 4OQLA 1OIXA 1ZJ6A 5BN5A 1ZIPA 2NRVA 2VA2A 1NVXQ 2IYWA 1G8PA 3T5GA 5B57C 5BXQC 4LX0A 4CT4B 3U6BA 1KI7A 1EWQA 1GDDA 1HH4A 5EE0A 4BE7B 1GUAA 1ZVQA 2ASLA 1GVNB 4W9MC 3Q7PA 4DFPA 1RYRA 1NF3A 2OBNA 4KBFA 1E9RA 3NWJA 3AVWA 1QSYA 1H8EA 3FMIA 3N4MB 3W6OA 4HLDA 1TK0A 1D9ZA 3BH7A 3BOSA 3RS4A 4J9NA 4DLWA 4JYBA 3SJAA 3CF2A 4BWYA 2NRWA 1UM8A 2WWFA 3GJ0A 5L9XA 1DAIA 1E1RA 3K75D 3ZZ0A 4YCXA 5FR2A 4P4UA 4PO8A 3AVOA 3VMFA 2QSZA 2PH1A 3MWYW 2W8LA 3JPTA 2OE2A 1DAMA 4Q21A 4I2EA 1KMHB 4LC1A 4TMXA 1G16A 4DF4A 3N70A 2VP6A 1G21E 2ZM5A 4I2JA 5IILA 1UKYA 1W4AA 2GVDC 4RQ3A 3FDIA 1MRSA 2MMCA 2ZRHA 2W9CA 1Y88A 3PEUA 4ON9A 3SI7A 1E6CA 3ZD6A 3KJGA 4PSKA 3ADKA 5FBWB 1TF5A 4NCKA 4GXKA 4ZDWA 2ZJAA 3DOFA 1TUEA 4WZAE 2IXGA 4QHYA 1NJXA 2PJZA 4RZXA 2OAP1 2VTKA 1CJTC 4QWAA 1QVAA 5JWOA 4TLCA 3SBDA 1IXRC 5C2JB 3FKQA 2GNOA 1XPRA 3X2SA 4GFDA 3DVLA 4YMUA 5HMLA 2VSXA 3JZAA 2BR0A 2W2XA 2ZTCA 2BHNA 4Z1MA 3TJZA 4FIDA 1G3IA 4BFWA 2F1HA 5KFGA 1D8LA 1ZD9A 1KK2A 3ZLJA 1AZSC 5JWRA 4TZ6A 5D3MA 3V6JA 2F1RA 4Q9HA 1KDTA 2PZEA 8ICFA 3QXJA 4QWBA 1GOTA 1W36B 3P26A 2Z83A 1ZQOA 4DSLA 3KUDA 4EPVA 2FEMA 1UKEA 2F43A 2F3RA 2ANBA 4YMNA 3QF4B 1E2GA 1RXVA 4EJSC 2PEYA 4QRHA 1DS6A 3ISBA 1CBUA 1YR8A 1Z07A 5FL7A 421PA 4B32A 4DJTA 5HKKA 1G5PA 1JR6A 3LV8A 4RZ2A 2IWHA 1W0KA 5DGBA 1OW3B 2EQBA 3QNUA 4M6WA 2A5GA 4BEJA 4L9SA 4HAYA 1QDEA 1YZGA 2GILA 4DSIA 1NKEA 4RD2A 4ELVA 3RJGA 721PA 1T7PA 4Q43A 1MQ3A 8ICWA 2Z5FA 4UJ3A 2GA8A 3VQTA 4BLRA 1RRFA 3AVXA 5JJIA 4B3BA 2IS6A 1DOQA 2FEOA 4IOKA 4W5HA 3TSWA 3AU6A 9ICRA 1OXXK 2CMKA 4JJZA 3L8ZA 4KN4A 4TYYA 4K46A 5KFSA 5DYGA 2FMSA 4RNNA 1Q57A 2BC9A 3S1AA 4C0KA 1GL6A 1KJYA 2VSOA 2W9MA 2IS1A 3NBYC 3JPNA 1R7RA 4R98A 4QHSA 4TYPA 3UKDA 4B3FX 4KFSA 4J9KA 1TQ2A 8ICZA 1IBRA 4O3QA 4GXJA 4AKHA 3TKLA 2XZLA 1KI6B 2BVNA 2RGEA 1TEVA 1W0JD 2YC4C 3FMOB 3TR0A 3RR8A 4AK9A 4XWOA 1EESA 4KLGA 1EWRA 1WA5A 2UZIR 3IQWA 4D0NA 2A3RA 4RFSB 2CK3A 2I1QA 1KJZA 3O8CA 4XJXA 4EYIB 2H16A 3PW5A 1ZUIA 4IOLA 3C16C 4FS1A 3T5JA 1E2JA 1IY0A 3EZ5A 1DO0A 1OKKA 2HV8A 2WJJA 4B2PA 4KFUA 4OJKA 1OFUX 4NPHA 1KI2A 1WXQA 4PHFA 2AKYA 1X9WA 8ICJA 1C1YA 3I32A 1ZQRA 2QI9C 5KT6A 2CL6X 4RSGA 4TYWA 1HT2E 4TMWA 4DSTA 4LHWA 4XRHA 2NTYC 1Z83A 1JN3A 3GFKB 3H40A 7ICKA 5HHIA 1R10A 1W1WA 1M74A 2AN9A 2JLSA 3QEJA 1KSGA 4C0AC 4UBCA 2GWHA 1RRCA 2HVHA 2IUUA 3D3QA 5J2JA 3KHRA 4GT1A 4HSEA 3UMSA 4F4XA 2UVRA 1ZQMA 5KFKA 4UAZA 1GAJA 2KSQA 2VP0A 4IRUB 3F5FA 2OFXA 3M8SA 1A2KC 1N5IA 4M1KA 2UKDA 1A76A 1UKZA 2JLXA 3MWLA 1GRRA 1NMYA 5JJLA 4C0BA 2XJ4A 4B75A 3EARA 1RPZA 5L1LA 2HHSA 3WMFA 3T3FA 5DYIA 5CIQA 2OILA 4IR9A 2JEFA 5KFHA 1XX6A 5DI3A 3ETLA 4A8JC 3UMRA 1Q0UA 3G0HA 4HLUC 2VRWA 1A82A 1P2UA 2BCVA 3BH6A 1D8YA 3IPYA 4B33A 3PFIA 1NK4A 3OZXA 2AGOA 4MKFA 3RS5A 4KU4A 2ZUDA 1RW4A 2ALZA 5DLGA 1Z06A 3A4NA 1X1SA 4EFLA 2C78A 2IWRA 3TW8B 4A0FA 2AQ0A 1LB1B 2R6FA 5IK2D 2GBLC 3V6HA 2NRXA 4YQWA 2XSZA 1E2IA 3G5UA 5DDMA 4DL6A 5EUMA 1E69A 4JJKA 4EKDA 4M53A 4J9RA 4EPWA 3K70D 3A1SA 4DQSA 3N97B 2ZJOA 4OL0A 3SYZA 2W9CB 1L2TA 1XCGB 2X77A 4KV9A 1N5KA 1RRGA 5P21A 2Q21A 2GXUA 2HYIC 1MO3A 1ZIOA 4MFAA 4B9MA 4FWIB 4OHWA 3BJIC 2HLDA 4B3XA 4PGXA 3OF5A 3ZDCA 1UA1A 2HXYA 3SJCA 3BORA 5FBQB 4ED2A 4K4HA 2O8CA 1ZQUA 3SYNA 4J9LA 2G9NA 1R0YA 3IEUA 1RYFA 4BLQA 1XSNA 5C5JA 1W2HA 2N1BA 4KLZA 2J6SA 1OLOA 2P3SA 2ZREA 2HF9A 4BFSA 2DPIA 4KYIB 1E2MA 3TUIC 4DLRA 9ICHA 4HAVA 4RUAA 2WPDA 3U5ZB 3RB0A 5HPYB 1QRAA 2V4RA 1BPXA 4O3MA 2EFEB 1R8SA 3A36A 4KFTA 1AZTA 2I4IA 4MA4A 2HT1A 1AQUA 4KLUA 4OQXA 3U3RA 4ABYA 3EPJA 3I5YA 8ICHA 3C5GA 1KHTA 2F43B 3DKPA 4Z51A 4PZZA 1KFTA 2ZU6A 1XD8A 2CJWA 5KHOC 3ZVMA 3MDCA 4GXIA 1SVLA 2BKUA 1Q1BA 4UNSA 1T8TA 3KTAA 1F60A 1F5NA 3KHHA 5J0RA 1GFIA 4C4PA 4A0HA 4M6WB 5CWRA 3RAPR 1M6NA 3HPRA 3MDAA 1L3TA 4TURA 4G1UC 4ED1A 4NCJA 2JLRA 1I4TD 1QTMA 1DAGA 2LYHA 1SL2A 4JBYA 2J0QA 2OM2A 4DL3A 5JEEA 5KFDA 4XUSA 1G8GA 4GOXA 3AVTA 3LNCA 1FX0A 2QORA 2YVUA 5IHPA 4QKQA 3JPRA 2PI5A 1KGDA 2C8VA 1E4VA 4DXAA 4F93B 1NLFA 1ANKA 1ZQPA 2GEDA 2QN6A 3A4MA 2E87A 3S1AB 4L16A 1SZPA 4C7OB 1JJVA 3MMPA 4ILEA 1JX4A 4YVZA 3BQ1A 1P61B 2BCGY 2D62A 2OG2A 4AG6A 3IUYA 4I1SA 4PH5A 1S1MA 3BWDD 2C98A 3DPUA 1ZMXA 1A5TA 1DAFA 4Q66C 4TT3D 4B3GA 1ZQTA 3R7WA 3RR7A 4D2IA 3CB4A 4CW7A 3BB3A 1E2DA 2HJVA 1JJ7A 1UT8A 5G40A 4PXAA 3FKSA 1XTKA 3NBFA 4K4IA 3PMNA 3P27A 1O3YA 2GHIA 1KY2A 1NJGA 2Q9AA 3H84A 2J41A 4HLQB 4AI6A 4B9NA 1ESNA 1EGAA 3NGDA 2XGQA 1TX4B 4OQFA 4RFVA 2G83A 3ND8A 3GMTA 4F4JA 4UQGA 2FFQA 2J9RA 4DSKA 1SQ5A 2DYKA 4FBUA 4F38A 8ICYA 1JAHA 1IOZA 4J0QA 4PC1A 5J2FA 5KO2A 4BZXA 2OZEA 4LJYA 5CHGA 2XJ9A 4EBDA 1S4QA 1OH7A 5FPSA 5TMPA 3I1FA 3QKSB 2KN7A 4KLTA 1EFTA 3WBJA 3OIYA 9ICLA 1FMJA 3M9NB 1KAOA 1CR0A 2QTFA 5IT5A 1EXNA 3EPKA 5F3WB 4ED7A 1BVSA 7ICMA 4MQBA 2KFZA 2RGXA 3QQ5A 1JMSA 2V55B 2XNSA 5L1IA 3RS7A 3RC8A 4GOJA 5JWHA 3N2IA 3A1WA 1MOZA 9ICJA 2AD1A 1OIWA 1XZQA 3H2YA 4IXNA 4LBWA 4LDJA 3VNVA 4RPYA 2EU8A 4PPGA 3EWSA 1Z0AA 1M7BA 2YWEA 4FMBB 5DI3B 3GFPA 4NU0A 4DUGA 2HUPA 2IXEA 3B8HA 5J4VA 4F5RA 1YVDA 4Q4LA 3BQTA 2C9CA 3NH6A 2E9SA 4BFTA 4OI2A 4ZI2A 3SNHA 3KKQA 1QVRA 1W46A 5E7MA 3V72A 2ASEA 2GETA 2BCSA 4HUTA 5FOWA 3VX3A 1YZTA 2BQUA 3GV7B 3U4QB 5CIWA 1R5NA 1NN0A 4QWDA 1E32A 3QXXA 3FTQA 4JVMA 1X9SA 5KUTA 3QJYA 5EE5B 2KWIA 3TI0A 4DQRA 1G4UR 1SXJA 2C9OA 2GF0A 2Z6VA 4EZ6A 4I99A 4A36A 1S3SA 2J0VA 1XWLA 2ZRPA 3C4JA 2P0EA 3CR7A 5J0PA 2B7CA 4URWR 4DKXA 3WYFA 3WYAA 4DL7A 4DEXA 1FUKA 3NHAA 1JIHA 1KIMA 4G0NA 3Q8SB 4BZQA 8ICGA 1NN5A 3FHOA 4V0KA 5FPTA 5G3YA 7ICFA 1I4LD 1NP6A 3ZIAA 1KKLA 4P4SA 4JL5A 4ELTA 2V3CC 1KK3A 3SHFA 4DSJA 5F9FA 1S96A 2V6JA 5F9LA 1NK0A 3RJEA 2A9KA 2CBZA 1W5SA 1GKYA 2PZGA 3A58B 3PUVA 2VHUA 2W9BA 4ECQA 2IBMA 2PFNA 2ATXA 3V7KA 3PUYA 1FW6A 1K1QA 2X2EA 4LJ6A 5LBIA 2JASA 2RB4A 4OHVA 4LVSA 4DB2A 1XTJA 2PFQA 4DCSA 1Z3EB 3FFBA 4XH9B 3RDPA 1SKSA 3TUZC 1D9FA 5HMMA 2F1IA 2CNWD 2XOKD 2IL1A 2CJWB 3RC3A 5TZVA 1RXWA 3PQCA 5FTMA 2C22A 1WCLA 4V0LA 1NY5A 3WP0A 1CEZA 4E22A 3ZDAA 1XEWX 3NEYA 4TQAA 5DISB 1GKIA 3EA0A 3K9GA 4JT4A 1EFUA 2KTQA 4JWNA 8ICBA 1GNPA 4Q8FA 1OYWA 3E2IA 4LY6A 3C5HA 1IY2A 5DBAA 2FLPA 4QZGA 4U02A 2VA8A 1A7JA 4A6PA 1BPBA 1E2QA 1F2TA 1FX0B 2J0UA 2OXRA 4I1OA 1UEJA 4LUCA 2HYDA 5DLQC 4ZCMA 3PX0A 1G7RA 5EP4A 5BW8A 8ICOA 1KRPA 3AF1A 1JR3A 4F92B 4PC6A 4W7SA 4NM2A 4PSVA 3IIJA 1ZNXA 4QWCA 2WTFA 3RS3A 5IINA 4M9HA 7ICQA 5KFFA 1YZQA 1N6HA 4GSYA 4MYTA 4Q1DA 3R7WB 4M9NA 1WMSA 1K5GA 2O5VA 4FO6A 3BIFA 3SEAA 1TF7A 2ZXUA 1NSTA 2V8OA 3PG5A 4DSFA 3V6KA 3B85A 1ZBDA 3PR4A 5KFTA 3HWTA 1ZU5A 5DB8A 2JLQA 3H0KA 3NIBA 1Q21A 3IO3A 3LX5A 5IIOA 2B8TA 2VP4A 1E2HA 1SULA 2WMOB 4D0LB 3BFVA 1MO5A 2N46A 5JEDA 5E4FA 5FTKA 1CRQA 4YC7A 1MRNA 3OEEA 1KAGA 4O2RA 5EXXA 3HU2A 2BBWA 4LJAA 2GJSA 2XNDD 4DOBA 2H5XA 4MRSA 2IS2A 2IMWP 1T3SA 3LK9A 3W8RA 2GCNA 4QBFA 1ZM7A 3EC1A 3UQ0A 1OSNA 3CX6A 4H1UA 4OBEA 3OGUA 1SHZA 3HT3A 3MRSA 3L8YA 3ISCA 1TNDA 1KMQA 1X8JA 1OXUA 4QZBA 2ZS8A 4WOPA 1NVWQ 4KITB 1HYQA 5DLFA 2JJ8A 4RZ3A 1GILA 3GLFE 1E2FA 2DWOA 1YKSA 1VCOA 2CLSA 3CZPA 3MR5A 1NKCA 3QG5A 1ZD8A 3B60A 5DQGA 4XWKA 2QPOA 4Q9LA 2ZJYA 3MR6A 5KFIA 3D8BA 3EAQA 3NC1C 4CEJA 3M0EA 2DHRA 4RD6A 4YMSA 3WRYC 2OUKA 7ICRA 2FGKA 3U44A 1RPLA 2GWSA 4M2LA
chains in the Genus database with same CATH superfamily
4F3NA 4JUBA 5BRNA 3FPJA 3EHEA 4C4RA 4P4GA 4UB5A 2H08A 3EOZA 1XCBA 4MUJA 1T0IA 3RAEC 5B3AA 1IG3A 4QEKA 3B3GA 3ZI7A 5GONA 3VKGA 1DUSA 3MC1A 1H6DA 3P9YA 4A0QA 1E66A 2J67A 2H2WA 3GFGA 4TXHA 1EFRD 3OTHA 4IJUA 3RUDA 3KUCA 5HF5A 2X58A 3OIDA 4UZFA 3W78A 3IYLW 5KQGA 2FWRA 1AXRA 2DBYA 1G3RA 1XU7A 1CNMA 2ZYGA 4GOKA 3RRFA 5A5VA 1LTKA 3M1YA 4DMMA 2QEQA 4NYJQ 1UCVA 5EG5A 1ODTC 4PZYA 1EG7A 3NRWA 4JEIA 2R2AA 4ERXA 5LPNA 1OUMA 1D8AA 1TT5A 4AKEA 4D6YA 1NW5A 2B37A 2XXBA 2WHPB 1ZGAA 2W58A 2XE7A 1Z4NA 4K26A 1UPBA 5FNZA 4I6JA 1T6NA 3FPLA 1JRPA 2P65A 2EYQA 5DB7A 4UZSA 5LNK6 2RH5A 2VP3A 1GU0A 4FNOA 3WS7A 4G5YA 5IC5A 5IAJA 1NSYA 1EAYA 1RWQA 4UUOA 3LUCA 1Y3IA 1V6SA 3KWFA 3N5CA 1TKCA 1JIUA 4N7JA 1ITZA 4CKWB 3GARA 2WSSA 3NHPA 4CCYA 4MQEA 1QSSA 3OD1A 1PFGA 4AL4A 1GQOA 3NYRA 4PGGA 4PGHA 3U40A 1F0YA 3FWNA 3ZJVA 5A71A 3ZDZB 1SVKA 3RRBA 4DJAA 1NNI1 4ZJYA 3UJPA 2BR5A 3KL4A 4LV6A 3AHJA 5D87A 4UBNA 4MDHA 4JJIA 3E7DA 4RZSA 1JEJA 1MABB 3EODA 3MLEA 3PDCA 1J5PA 3OSUA 1MAAA 4Q44A 1MAVA 2D8AA 3V42A 3OJSA 1OW5A 8LDHA 1BCRB 5F1PA 3T5KA 1N0IA 1YHNA 1JFFA 1XFAA 3U7EB 4G1BA 2HHCA 1WB4A 1NV8A 2DB3A 3LDAA 4S3MA 4BO6A 1AUXA 3RTVA 1LLCA 3NBMA 2NRZA 4U3JA 4HMQA 1U9IC 3UG7A 3T3MB 3AIMA 4H0CA 2JCGA 1I7SB 4B3JA 1TU0A 4ZAXA 3EMKA 4YRZA 3OX3A 5I5EA 5GVSA 2PI4A 1W8IA 1B76A 4G63A 2FUG6 4NAUA 4B84A 4L6IA 1DFGA 3K9LA 3CLSC 4U2KA 4DQPA 2A1UA 3KQOA 4MWTA 1U8CB 2XKKA 4TS9A 1FYEA 2HU8A 2PAFA 1I1OA 2CV0A 2ETVA 4CQLA 1VI6A 4AZ3B 1KO4A 2ZBEA 5KYNA 3B7PA 5TB5A 5FOTA 4L76A 3FMFA 4UBIA 4HVCA 2ZRDA 3JZIA 1T13A 4Z9FA 1XEWY 2DBQA 3CJQA 4X71A 4C06A 3LPNA 2JGFA 5ICSA 3ELUA 5IKMA 1M34B 3TOZA 2XQKA 3EEQA 4KLOA 1TQ4A 4CKBA 1E0DA 3ZOKA 4D8VA 3MABA 4I6GA 4UXIA 3OLVA 3WIVA 1ECPA 2JH7A 4HHEA 3IODA 1RLOA 2FLNA 5C51B 2LIPA 3PEFA 3G6VA 1AGNA 3RB8A 4LBZA 2CJPA 3KZXA 4QATA 5JD6A 3DQZA 3DT8A 2XCAA 3T7IA 1Z2AA 1KJ8A 3MNFA 4HQFA 2RJOA 2HU2A 4HQ0A 1GL9B 4BV9A 4RK0A 2XUGA 1HL3A 1BVUA 1WCIB 3KR9A 2XDWA 1SGWA 4JZYA 1DKOA 1F7VA 3TLEA 3AXTA 1PR0A 2HVIA 1CT9A 2GK4A 4KR7A 2O8CB 1SB9A 1EFKA 2ZJ1A 3ETRA 5AJWA 4CL3A 1ZMRA 2JS7A 3R8XA 3UVEA 3IQDB 3TQHA 1NAHA 5BYKA 3FLMA 3W2IA 1MEOA 3KTAB 2ZXFA 4C89A 4DJJA 4I2BA 3Q3IA 5AJXA 5TPWA 3ADCA 3TEFA 2PT9A 2VPXA 4Q1FA 4PLPA 5EXTA 3FPFA 4DUPA 3OI7A 1OWPA 3HPQA 3HQ4O 1MW9X 4KPFC 4UASA 4AWBA 5KEIA 1QRTA 1O0SA 1CS4C 1BD3A 3ND5A 1ZCJA 1U2RA 3AESA 5CCEA 1L8LA 1ISMA 4GBGA 3V7FA 1XS9D 3S3TA 2PANA 1EZZA 5EAIA 3MD9A 4I4LA 1DGJA 1CZOA 3RQIA 2EP8A 3CTPA 3HA3A 5EJ8A 4ZAGA 4IH9A 5EWLA 3ST7A 5K6AA 3HJNA 1Z2CA 4M55A 2R44A 1N6PA 1S2NA 3DE0X 2JVJA 2DLCX 4MP8A 3W5SA 2YXBA 1N36B 4D4LA 1M1XB 4UM5A 2AX3A 1P9NA 4XX0B 1UOPA 4QGAA 3W3AH 3GQBB 1PFUA 4OA5A 3KWLA 2H2GA 4IRDA 4M8KA 4DRXA 5JASA 1TAHA 4IJ6A 3PNCA 3GPCA 1UDWA 3AFMA 1VMKA 3PXBA 1ZA2A 4OJYA 4RJ2A 2NPOA 4UFNA 3PUHA 5HE8A 2BZGA 3DBIA 4OX9B 3PO5A 3REQB 3MK31 5H7XA 2VBCA 2ZTVA 1EJ0A 2PMCA 1IV8A 3E18A 3L6EA 3HXTA 4I4TB 1R6VA 4TSFD 2QP4A 3ZLTA 1HK7A 3OLYA 3GV5B 3CGWA 1I2MA 5FADA 2LKDA 1I2ZA 1NHWA 1BXKA 2C2BA 4WLEA 4LYEA 1XWWA 4LX8A 1FLVA 4I1UA 4E2WA 3MYRA 2G72A 1MOQA 3SAHA 1TM3E 3SS8A 3LT5A 1ZD3A 5AKIA 4BB9A 1HR0B 3TLXA 1E2PA 3GLGE 3AGPA 4D4GA 4HAUA 3QU4A 2ZE6A 1HDOA 2JGEA 4E08A 1D0VA 3SICE 4LYHA 2JJYA 1ZGCA 3L2OB 4EYGA 3PRYA 5ERXA 4N7BA 1KDPA 2QSJA 4XIFA 2OC4A 1RI1A 5EFOA 4A8JA 4I4CA 4C7XA 1Z6YA 1CIPA 4AF6A 5DG9A 3ZE6A 1P6XA 4LAFA 4R71A 3IIEA 3DE4X 4KVZA 3PZPA 3L8EA 3D4BA 5DT2A 2FW1A 1CUFA 3TW8A 1QCYA 3KTOA 2XWBF 3VU9B 4BFCA 1C1XB 3INGA 4WADA 1NSFA 3IERA 3CX3A 4L51A 3N7AA 4DG9A 2KKVA 4KR6A 1QQBA 4MWGA 5GJBA 3E0FA 1F0NA 4EEXA 3BQ9A 1UPUA 3U48A 2ZSAA 1U48A 4CQMD 4DQIA 4CM1A 2QUZA 3HZZA 4IWXA 4PRLA 1Q6ZA 4AIRA 4FGJA 1ZYQA 4N0DA 1EINA 4L5AA 3MWKA 4Q3NA 1C30A 2WP0A 5H2FU 3G2HA 4FZ3A 1OX4A 5TPZA 2QJWA 1H2ZA 1GQQA 4MDFA 3QYPA 2V9PA 1TA0A 1K4KA 3UQYS 2GZDA 1MNQA 5EWMB 2B20A 2WTAA 1SAYA 1GT6A 3ROEA 1H93A 4NLZA 2MINA 3GIWA 2IEDA 2GCIA 3GA0A 3LWLA 3THXA 1TQ8A 4HAIA 1L4EA 1PN3A 4LQDA 3OESA 4RY9A 4WKCA 2F59A 4HXFB 3AXSA 3OX1A 2OL4A 1U0OC 1NVDA 2YMQA 3RD5A 1G7CA 4DWVA 1UJMA 4ZU3A 2HJSA 2O4UX 3KJNA 4PHCA 4EUEA 4ZDJA 2QRZA 3A4TA 4ABTA 1PYDA 3M3PA 3PS9A 1Z36A 4C0LA 2DFVA 2ZYIA 2M9MA 3ANNA 3RYIB 5KFWA 3RW9A 1YBFA 1R74A 1VDZA 3STUA 3JYQA 4CDGA 1IMOA 3TX2A 3D02A 4BGDA 2TECE 2AR9A 2PZBA 4Y2XA 4PIVA 4EG0A 4OB8A 4G41A 1L6NA 1BNOA 1M6VA 2HNBA 4XM1A 2BTOA 2Z6QA 1JX6A 1BKYA 2V9CA 3D7MA 3C2LA 3KDSE 3IPXA 2GEJA 4QELA 3EGVA 3WZMA 1K1SA 4P6VF 3I2HA 3GT4A 1PK3A 2W6JA 4F3RA 1ACLA 2BE9A 2HZ7A 1JBKA 2H4WA 3STXA 5KFZA 2ZSDA 4Z4CA 4OYYA 2QTGA 5JZBA 3OZEA 2NYRA 4Z6EA 3P4XA 1YMQA 5DNDA 4N40A 2OXTA 4EYQA 2A67A 3WLQA 4FHGA 1T8SA 5ESDA 4ZC8A 5KFYA 4AJOA 2VDWB 1H2XA 3K4QA 3X1KA 4ZT5A 3OQNA 3EFOA 4OQMA 1IVNA 3PXAA 2YRXA 3A6EA 4B3TB 5GIPE 5HZHA 3CISA 1GNVA 2GZ3A 3OP1A 1IY1A 2HK8A 2PMZC 3IDOA 5ADHA 4DWWA 1C9NA 1L9KA 4HPWA 1Y9EA 3R9XA 3UF0A 2X6RA 5KDDA 2J5QA 2I5HA 1TCAA 3IDAA 4KR3A 4LRUA 3RF6A 4TS4A 4QXMA 4GU5A 4BMXA 5LBTA 1BEEA 1J8YF 3ZWQA 4F8EA 3L82B 2MUTB 2Q99A 3B5IA 1RKBA 1RYBA 5JNUA 1G9XA 1HURA 4YDHB 2G25A 1NIJA 3DHYA 1JXAA 4Y0AA 3T7RA 1MPXA 2BE7A 4CN8A 1KZ7B 3MB5A 3M9XA 3OOYA 4GLOA 1TF2A 3PUXA 3GRFA 2K8AA 3UXPA 4BVLA 3B1WA 4EHKA 2FRDA 1VCIA 5TF4A 1SKMA 1CEXA 1YXMA 1V1JA 2BLLA 4TKUB 3LLVA 2Q6OA 3JV7A 1GP2A 4E5KA 2BGIA 5CB4B 5KTMA 3IRVA 3CSUA 1KQGA 5K7SA 5FBHA 3PC7A 2Z2ZA 4FR0A 4HZUA 4X1IB 5IEBA 2CCGA 2PS3A 3MRXA 2Q5LA 4NSNA 1IUOA 1PW5A 3B1FA 2GHTA 4FS2A 4Z0PA 3TPCA 5E2AA 1SIUA 3THYB 2ETXA 5ITSA 4FC7A 3AF2A 5GAJA 5EOZA 4P36A 3RVQA 1OAAA 5ALNA 2GTPA 1PLKA 2FZVA 2CXTA 1P2TA 4MVJD 4F06A 4GICA 1QLJA 1I80A 5ADUS 5DHFA 2A1JB 1JG3A 1L4YA 3PGKA 4EAQA 3TADC 4G0PA 5KFRA 4XRRA 3HKZC 3GLIA 3RARA 4PQFA 4H6PA 3V34A 3KKOA 5KSZA 4LFAB 4W5QA 2IF0A 3F4LA 4WIAA 1FDSA 5BV0A 1GYRA 3DPIA 3MTAA 2WY2D 4ZCQA 3OPNA 3RVBA 4Q1CA 2OEPA 3K0FB 4XFKA 3MILA 3S44A 2RGDA 1Q7BA 2C57A 5AVRA 1J2UA 1ZSVA 3F5MA 4RCVA 4UMFA 4DA6A 2XQGA 3F1LA 3OTWA 3RJKA 3OPYB 2D0OB 4P08A 3JQQA 2HO4A 1X0XA 4H1HA 4BMOB 3H1AA 3T3OA 3K7EA 3B2NA 5I9LA 1JHOA 4C9BA 4IIUA 1D9XA 3B3AA 1M3SA 4Z4QA 5KREA 4C88A 2UXCB 4DLBA 5T6MA 4G2TA 3OIGA 4B7AA 4QDTA 3RFAA 1W59A 1TK2A 1SOAA 2XB9A 3QLUA 1P91A 3CF2A 1J2EA 3L7DA 2VYVA 4YCXA 3V7YA 3WWZA 2J6CA 4KXLA 4H4DA 2JK1A 1YFZA 3I9V1 5ER9A 3EF1A 2WYWA 5IT4A 1WDMA 2KP7A 1UJ5A 1R15A 2OFPA 3SBDA 5C2JB 5MFPA 3GPBA 1T36A 5HMLA 3BTUA 4BFWA 1GSAA 1G4HA 2F1RA 2PWAA 2WINI 5A1TA 1QJCA 4EPVA 3SIPA 4YBZA 2F43A 2Q5QA 4EJSC 1SQSA 2HK9A 1QDEA 3VHRA 3RJGA 4BMPB 3BXEA 4ZOHC 3MJVA 4H27A 4E7OA 1DOQA 3TZBA 4NXMB 4C0KA 4RNNA 3JPNA 3I0ZA 4R98A 4PXYA 3T41A 3SOZA 4ZQHA 2RRDA 3U09A 4IMPA 4AUKA 2VWGA 2CL5A 1WA5A 2UZIR 2ICAA 1VHJA 4RXTA 2WJJA 4MXDA 5K0ZA 1S2DA 5FBVB 1KI2A 1IDOA 4TMWA 3TCXB 1MX3A 1SU7A 4XVCA 4UBCA 2GWHA 5KU1A 1Q17A 4GC9A 5C80A 3A9VA 4C0BA 1U2QA 4JITA 4C6SA 5DYIA 4ARVA 4IR9A 1VC2A 4L75A 4G07A 3FBWA 1P2UA 3CW8X 1PQYA 1EE2A 1NK4A 1YCFA 5E1DA 3U4IA 2CNDA 2V58A 5LZ2A 1UZLA 4I9GA 2EW8A 2BM9A 1XOIA 2M6LA 3UY4A 5A0TA 1NUQA 3NLLA 4R4JA 5CFQA 3I6MA 2W9XA 4G0YA 4KN8A 4KYIB 4DLRA 3U5ZB 2A58A 1BPXA 5K4AA 4MA4A 2GPAA 2EG9A 2PZAA 2A57A 2CJWA 1SVLA 1I10A 2X8JB 1WDKA 3FN4A 4TURA 4ED1A 3MMZA 1DWUA 5G1OA 1VL8A 5FI5A 2N9UA 3BMNB 4AG6A 1J2YA 2WWRA 4IX1A 3DPUA 1ZMXA 1OREA 4YACA 4RTPA 4PLHA 4MEBA 3HKEB 1GG5A 4QUDA 1TCVA 1TX4B 3NGDA 1HLPA 3F5EA 3GRYA 3KOUA 5EC8A 4BIIA 5ENZA 3BEOA 3KT3A 3A3OA 1SPXA 1EXNA 4MQBA 4IINA 4UHBA 3VVCA 2AD1A 1SXDA 1YB7A 4LDJA 2EU8A 5DI3B 4FMBB 4DUGA 4M87A 1YVDA 1Z5WA 1C0IA 4ZI2A 3KKQA 3V72A 1D2HA 2BCSA 4HUTA 2FP4B 3TJRA 4DR3B 2R1TB 1Z37A 3QGMA 3TI0A 1IUPA 4EZ6A 1XP5A 2MU2A 9ATCA 4WXYB 4YUVA 1JYFA 1FUKA 2Y9TA 1WMFA 1I4LD 2V3CC 4ELTA 4RQAA 2DAPA 2WF6A 1QB8A 2DPHA 3OZIA 2WFMA 2X2EA 4X6UA 3PFKA 3TUZC 3WLAA 2F1IA 3H1EA 4MW6A 1J8QA 1OVGA 1NY5A 4R5MA 4QX6A 1ZXBA 2JAWA 8ICBA 2M32A 4QZGA 2JGMA 3RSCA 4ZAVA 8ICOA 4IP0A 2AN1A 4R1UA 1FS5A 5EY5B 4M9NA 1TZBA 1B6TA 5E4FA 2EP7A 4D5GA 3IUEA 4S0XA 1RWVA 1I01A 3JAKA 4DOBA 2H1OA 3WJ2A 4MP3A 4MYDA 4Y9TA 1CUYA 5DHSA 3ISCA 2P9CA 2A94A 3KQVA 5DLFA 2JJ8A 3U1TA 1E2FA 1QORA 4Y7DA 1NKVA 2WSBA 1FW8A 4XWKA 3EAQA 4DFDA 5F5XA 4M2LA 2JKVA 4IGKA 1AGPA 5KT2A 3M4YA 4DLLA 2EL9A 3MEQA 4R40A 3L79A 4Y1GA 3M6XA 3L0BA 5DQHA 3FNBA 1UFKA 4V1CI 2PIDA 3F7TA 3UJBA 2IV2X 2RLTA 2ZI7A 2OZPA 1Y42X 1BGXT 1Y1KE 4F5QA 2BM8A 5EE1A 3WBKA 4F4HA 4L5BA 3HKCA 2ZQYA 2IP2A 1E4OA 3O8LA 2J9GA 2ONKA 5DYTA 3E61A 1UR5A 3TBHA 5G41A 1KZGB 2QXTA 5I4IA 2Y4NA 2HHQA 4DWOA 1H85A 1M10A 1AMOA 3MIZA 4V03A 3L0ZA 4RD1A 3JQBC 3WQSB 3IA2A 3QIVA 1ODLA 3QMWA 3W9YA 4EA6A 4GOOD 4KRFA 1MFZA 5HQ3B 4MVWA 4O4LF 1VPEA 4EVSA 2QE7A 3HP4A 1UQRA 1KPHA 1IRIA 4ILKA 1QQ6A 3T94A 4FFWA 5KPDA 5EYPA 4JSRA 5IFKA 2CCJA 2CSXA 4XDGA 3B12A 3H5VA 3PY8A 3FNHA 3L7MA 4NOKA 3GOQA 3EUAA 3KKKA 3A4YA 2ZYTX 2F1OA 3BD9A 3AL0C 1RI4A 1XBTA 5I7EA 2KBEA 3WGUA 4OU4A 3REOA 2QUKA 1DWOA 3JQ8B 4GGMX 1POXA 2BV3A 3C1TA 5AI6A 1KTIA 3W7VA 2PUVA 3GP8A 1EXMA 5H68A 1TVMA 1OAKA 4PYLA 2UVUA 3WU2U 4LE1A 3JWHA 5EUCA 2C5HA 4RTJA 1H69A 1VL2A 1FFGA 1K98A 1OGJA 5JS7A 1DGQA 3B2QA 1YDMA 4N3NA 1DEOA 4M1ZA 3X2EA 5AM5A 4FD2A 3A05A 1Y3FE 2XUDA 7ICUA 4NZNA 3U61B 4MZXA 4BQRA 1JQEA 2CYAA 4PLVA 3HJAA 1EWTA 1SXGA 2RH8A 5T6BA 3PPXA 5B4UA 2OB2A 2ZIVB 1U5AA 4HB4A 2QL7A 3QJGA 2PSHA 5D8DA 4OXXA 3EQ6A 2EQYA 2NN3C 3EZ9A 3KT8A 2C1ZA 2O2DA 1VKOA 1D0SA 5AP9A 1W4LA 1SVIA 2F3PA 3GLHB 3DHVA 5BN4A 5H1YA 3WYGA 3FDJA 4A7PA 3GOHA 2I7TA 3BL5A 5A04A 2DP4E 2ORYA 3P71T 4ZVNA 5FUVA 2P9YA 5AVKA 4K6GA 1XP8A 2X5NA 2NU8B 2A33A 2O8NA 1LLQA 1KXJA 4F2SA 4IUYA 3S27A 1X9XA 1RMTA 1BH2A 3OHBA 1N61A 4OKIA 1X8KA 1E1QD 4UUNA 3TAQA 2NZYA 3VOTA 3KWMA 3R3JA 4PTYA 4OP1A 2IPOA 1MDFA 2WJGA 3NJ8A 3B5JA 1F6BA 4Q9DA 6NULA 4O0MA 5U9CA 2WKWA 1Z35A 1ZQJA 3AGQA 1U94A 3E9YA 5K20A 2F3TA 4M2YA 3IM1A 3SFTA 2J08A 4NESA 3NJRA 2FFAA 1ONBA 1YS1X 2FZ5A 4BWVA 4QFCA 4CM5A 3NQ41 2AK2A 2OZKA 5C5EA 2WG1A 3R09A 2QNBA 2XXJA 5HBGA 4LJLA 2BEWB 1NUPA 2PBFA 2CSUA 1LPPA 1KP3A 2E4UA 4HGNA 3GVPA 5HHHA 4ND2A 3EZXA 4GL4A 3A0HU 4BXOA 4TTAA 1J42A 3GJ4A 4PYKA 1MIHA 1C2YA 1E0JA 3JQ7A 2REQB 3ERCA 3RC9A 1CIVA 4FIZA 4PRYA 3TO5A 2F76X 2CXUA 1SVOA 3KEFA 4O4LA 5I5GA 3LG2A 9ICUA 3VU8A 4CF4A 3GXOA 1LV7A 1RSZA 5G0SA 1KGSA 1MJFA 3MOGA 5K8CA 2D1SA 3NEPX 2JFUA 4DQ0A 1TUGA 4MVCA 2HFJA 3T9DA 3RLFA 1A71A 1OD6A 3PJGA 2VHEA 4UBBA 2QGNA 1OBCA 2JCSA 4P7BA 4UMDA 2PX0A 1XFDA 4FQ5A 3FOWA 4HTFA 1XDDA 4NDNE 1YRWA 5CFZA 4KMUA 4F9EA 3SJUA 4RBNA 2GVZC 5GZ6A 3T8YA 2HJHA 1G8KA 2G63A 2KZMA 4EY7A 4UEOA 5GJVC 4ND1A 3OU6A 2ZTSA 3HV0A 2KNJA 4N5NA 2R8ZA 1G20E 2J87A 3QY0A 4DFJA 3RJMA 1V7CA 2UU9B 2W11A 3NASA 4LZDA 2CNWA 3G82C 3RJZA 1IRXA 5LR6A 4HAXA 2C2RA 1BHSA 2PUTA 3CG4A 1M5TA 4R3NA 2PXIA 2IKSA 3H5LA 2HW3A 4NJOA 4K6HA 3KKMA 1U0RA 1SVSA 1DAKA 1GZ4A 3UPQA 2ZTHA 2XYPA 2AG0A 1UANA 5FXMA 4UE2A 1XU4A 4D9NA 3JW8A 1D9DA 4LF8B 4HYKA 4J9PA 1QPZA 3FHTA 3WY9A 4H3SA 3ER6A 2X0NA 4M9LA 2FPRA 3IDWA 4X0EA 3Q0EA 3T3EA 2ZTDA 2VJDA 5CH8A 2EF1A 1LSJA 3PO4A 5CW2A 2BP7A 4FFRA 5ALJA 2Q07A 1FDRA 3MAGA 1ATZA 1QHYA 3ACBA 2NMVA 4EX7A 1NT2A 1YZVA 1P8JA 1XQYA 1CXZA 3I73A 2GDJA 1OLSB 5H8WA 2A1IA 3VHXA 3U60B 3HKDB 4N3CA 3ULKA 2XYQA 4M8IA 2HQOA 5LU8A 4TV8F 4QNRA 3HUUA 3H4TA 2W7OA 2JRCA 3I2IA 1FFEA 4WKGA 1NXSA 3DC2A 2D06A 1ORVA 1NXQA 3FDXA 4ZODA 4IJQA 4ZMBA 1ZHOA 3Q8PB 2VSQA 4BS9A 2J09A 2TRSB 1QVVA 3AWIA 3P0EA 4ZALA 4R7GA 2XUHA 4RXUA 1Y81A 1NBHA 1YE5A 1WYGA 4OHOA 2VUTA 3LM8A 4FBMA 2PMFA 5T41A 1XJQA 2HHTA 4INOA 3UBTA 1X1TA 4NI5A 4E7PA 4AC9A 3PEYA 1KBQA 2ZUBA 4DLSA 3X1MA 3W9UA 4BFVA 3PGVA 1YZ3A 3KCQA 3GC6A 4RV5A 2ZJ3A