2GLEA

Solution structure of neurabin sam domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
GHMVHEWSVQQVSHWLVGLSLDQYVSEFSAQNISGEQLLQLDGNKLKALGMTSSQDRALVKKKLKEMKMSLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurabin-1
publication title Structural characterization of the neurabin SAM domain
rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 20
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2gleA00
1F0MA 2EANA 1PK1A 5JTIA 2D3DA 2QB0A 1SV0C 3H8MA 2QKQA 2ESEA 2KIVA 2E8PA 1KW4A 1X9XA 2B6GA 2EAPA 1SV4A 4MHVA 1LKYB 2KSOB 2KMDA 2QB1A 1JI7A 1X66A 1B0XA 4PZOA 1PK3A 2KG5A 2F8KA 2E8MA 5KNIA 2DKZA 2F44A 2QARB 3BQ7A 2LPEA 3BS5B 1WWVA 1SXDA 2DKXA 1LKYA 2KSOA 2D8CA 5J8YA 2LMRA 1RG6A 1X40A 2EAOA 2YTUA 3HILA 2Y9TA 3TADA 3SEIA 3K1RB 3BS7A 2QARA 3BS5A 3SENA 1UQVA 4NL9A 1SXEA 2E8NA 3KKAA 2KE7A 4RQNA 1OW5A 1SV0A 5JU5A 2GLEA 2K4PA 1OXJA 1V38A 2E8OA 4RQMA 4NL9C 2ES6A 1V85A 2JV3A 5L1MA 5J8YC 5F3XB 1COKA 1UCVA 3TACB 2DL0A 2K60A 1PK1B 1Z1VA 3TADC 2F3NA 2QB0B 4NJ8A 2EAMA 1WWUA 2L5YA 2FE9A 2Y9UA 1SGGA 3IDWA 4IS7A 4PZNA 1DXSA 5JRTA 1B4FA 3KKAC
chains in the Genus database with same CATH superfamily
3QUTA 9ICJA 1ZOLA 2IOHA 3TI0A 4PHPA 3HJEA 2ESEA 2JXJA 4O3PA 3L3FX 4M47A 1PVPA 5KFZA 1QSSA 1B43A 5L1LA 2FMPA 5KT5A 5AI9A 4DWIA 2EZYA 2KSOB 1P7DA 2HHXA 3NUQA 1BVSA 4DFDA 4RPYA 4NLKA 2YB4A 4J03A 3BQ2A 3AMZA 2A1AA 5KFMA 2JH1A 2ASDA 3PW7A 2XICA 2F76X 1XSNA 2W55A 2E3TA 2DF4B 2MAXA 3K1ZA 4DL3A 3T5HA 4B9TA 5KFJA 5AKZA 5J8YA 5J0TA 4RQ7A 1CI4A 1KSPA 2WF8A 1Q3VA 2IOFA 3V7KA 5A0LA 4BWMA 4R8UB 9ICVA 3MR5A 2DPJA 2ASLA 1BNOA 2YY6A 3H8SA 1ZQNA 5ALJA 5HHIA 4Q8EA 4A8EA 4ECXA 3PSFA 2KZMA 4I27A 5CHGA 4RNMA 2H3QA 4NM2A 3C28A 2E8OA 2ES6A 4DSFA 4MF2A 3HKZC 4I2AA 2ZIUA 5L1MA 5KFOA 4M6WA 1COKA 4QZ8A 2ZJ5A 2FPLA 3T79A 4DF4A 2F3NA 3NVWA 7ICGA 4C8LA 1MC8A 4B9SA 3SAHA 3QU4A 5AIAA 5AM5A 3AU6A 1TAMA 3RH5A 4X5VA 1RXVA 4ED0A 3ZDAA 5GTHU 5J0OA 3PO4A 3BQTA 3MC1A 2IBKA 3RJJA 2AH5A 1LVHA 1A0PA 4Z6EA 2GH1A 3R9KA 4DO9A 5BPCA 1ZD3A 2ZG6A 3WU2U 2QB1A 1SB3C 1JI7A 1KN5A 1B0XA 4KLHA 2HOQA 2ZTCA 5KFUA 2F1HA 4XA5A 1QH9A 3M9NB 4UB8U 2WF9A 1ZQUA 8ICKA 3V72A 4IQTA 2HHWA 2EAOA 1KL9A 1ZQGA 4KLEA 8ICEA 3M8RA 5KFRA 5J2DA 3I1YA 1NKEA 5AKJA 7ICMA 2C22A 4CNQA 2P66A 4Y2SA 3F2DA 3C2MA 4DQRA 5ALXA 4F2SA 5KT6A 4DS4A 3B0XA 5F9LA 9ICLA 2E8NA 1N5XA 3ETRA 1K1QA 4YD1A 4G3IA 2J6SA 5EE9A 1ZRMA 8ICBA 2XGQA 2AGQA 2HCFA 2H5XA 5IINA 3M6ZA 9ICPA 1LB2B 2PI4A 4UAWA 4UB3A 5ALZA 3KTQA 5AIBA 4F4ZA 1BPEA 5KFCA 4OJ6A 1C20A 5L1KA 1NJWA 1YZ6A 2L5YA 4DFMA 4IRKA 1U4BA 4HYKA 3K4GA 2A1JA 3KKAC 4QZDA 4KMOB 3RJFA 4DSIA 5KFKA 8ICFA 2AQ4A 5J0UA 8ICVA 2UVRA 4CGZA 1L7NA 2E8PA 2W8LA 3KBBA 2F2AB 4PL2A 4EEKA 1YZ7A 9ICWA 5ALOA 3L5KA 2ASJA 3K75D 3HPOA 2V4RA 2RP5A 3BJYA 4B9MA 2A19A 1X66A 2WTFA 3MDCA 4ED1A 4UATA 3WK5A 5TISU 3BQ0A 4AP9A 5J2JA 2FLNA 5AICA 3C1YA 1S0VA 4C8OA 3M9MB 2CRXA 1SL1A 3IG5A 1XNSA 1S5LU 3RRGA 4I2JA 9ICIA 5J0XA 4KMUA 3RR7A 4Y2UA 4DQIA 3H0MB 4RQ5A 1ZQPA 4LZGA 3RFAA 3GIMA 2F77X 2FPKA 5KFHA 5J2GA 1SL0A 4JWMA 4O9MA 5G5GA 4F4XA 1ZQMA 2Y0SC 1T94A 8ICGA 1N63A 2K8BB 3FM9A 1SKSA 2BPGA 3IV6A 5KL8B 1TK5A 5DKWA 1IIPA 4KLGA 3QXGA 3QNMA 4FZNA 3QU5A 5KG3A 2JH7A 3IN5A 2W9BA 1BGXT 1PK1B 1QSLA 2QB0B 4FO6A 2NO5A 3RRHA 4Q8FA 3Q8MA 5CB1A 1ZQAA 4DSJA 3UMBA 4WJ3B 5DLGA 3Q8SB 4DQSA 2GWSA 4FZMA 5DBAA 1XS9D 2D3DA 5AM3A 1D8YA 1YT3A 2W9CB 1IG6A 1L3VA 1KW4A 5KG5A 9ICSA 3ZD8A 3KHRA 2ZXHA 3HRDD 2HI0A 1KFDA 2Y0SF 2ZIWA 4MFFA 1L8LA 4BWJA 3C29A 5AI5A 4ECQA 4BXOB 3C2LA 8ICNA 1MN8A 2BCRA 4ELVA 2CN1A 1SWVA 5E79U 2WHEA 3PVXA 1ZQOA 3CW2C 4Q45A 4C0ZA 5DDYA 3N4MB 4KN4A 4J9KA 2NYVA 3EUB2 1ZJNA 2HW3A 4KITB 5KT2A 3PSTA 7ICRA 4PGXA 3EW9A 4QW8A 5DLFA 4I2BA 2Y1IA 3SEIA 5KAIU 5KFVA 5EWGA 4TQSA 4DL6A 1FFUA 2WAQC 2HVHA 1V97A 3MR3A 3QUQA 1KLNA 2GO7A 3SENA 4PGYA 1UQVA 4P0PB 2HHSA 7ICSA 3I28A 5ALLA 2AHOB 1NJYA 3BZCA 2XY5A 1OXJA 1V38A 2B21A 3LYSA 2JEIA 4IQUA 4NLZA 1C7YA 1DGSA 4BGDA 3CNHA 4M9NA 1NK7A 4BJQA 5AKYA 2G06A 1FO4A 4NM1A 4OJOA 2KV2A 1N62A 2G5HB 4NLBA 1JN3A 4QZGA 4R66A 2ZIXA 1KRPA 3JPRA 3UQ0A 3ORYA 5DB8A 1RXWA 2FLPA 8ICMA 3MGHA 4JV2A 5EE1A 2W11A 4U7CA 1S10A 3QZ8A 3QUCA 3RJIA 3FDSA 3UXOA 3DDHA 9ICOA 4KLOA 2KKVA 5JTIA 8ICUA 3SD7A 3NVVA 4LZDA 4UB6U 3C1ZA 2R8JA 1BPYA 4OJLA 1PVRA 4GFJA 1VLBA 2NRVA 4Y2YA 2IA6A 5TZVA 4QWEA 3C5FA 2E5SA 9ICQA 1Z1BA 1NI3A 4F5OA 4DF8A 2R8KA 1ZETA 2LM1A 4KLTA 1LKYA 2D8CA 5ALNA 4MF8A 1FFVA 1KFTA 3QUBA 1BPBA 3H8JA 2ALZA 2Y9TA 1ZQCA 3GV5B 4C8MA 4O3SA 1XO1A 4KLUA 5KFNA 5AKLA 1U45A 2I6XA 5J0SA 4IR9A 2K4IA 2NRXA 5J0YA 4BUGA 2ZIVB 1SV0A 3PO5A 5T14A 1S9FA 4DL5A 5AHXA 5KT4A 2PFQA 5DG7A 1L7PA 3PMNA 5J0QA 3BZKA 2NO4A 3QEAZ 5ALWA 1N60A 2ZUBA 1Q3UA 5AKEA 8ICJA 5EWFA 4RU9A 5KFPA 5F3XB 3PX0A 9ICUA 4QWDA 2UVVA 5GTIU 1ZQKA 4EBEA 1Q46A 2OM6A 3DV9A 4YG2A 3WKBA 3PZPA 1B4FA 1F0MA 4XQ8A 2A3VA 2XI9A 4G9BA 4C80A 4QW9A 1WCLA 1N56A 5F9NA 3KZXA 5ALIA 1RYSA 7ICKA 1HIWA 3OSPA 1U9LA 2KNJA 5EWEA 4CDGA 2HOFA 1ZRNA 3ED5A 5J2KA 4EYIB 4DSLA 4QZAA 3AM9A 5KNIA 2HBMA 4F4WA 4GLXA 3F2BA 3PW5A 8ICRA 2FJ6A 2ZXIA 4F5RA 2LMRA 1PZNA 3RTVA 5B66U 9ICFA 3RB3A 4ECSA 4UBCA 5HP4A 2HHUA 2KVSA 3G6VA 3MFHA 1KDHA 3Q8RB 3KHHA 4ECZA 3QU2A 1GO3F 3JPOA 1JMSA 3ZDBA 3WK7A 5CEHA 4O3OA 3ONNA 4R65A 4GIBA 2BR0A 4IL6U 5KFYA 2OH2A 2KEYA 2K8CB 3NRWA 1L6NA 3ALRA 1X2IA 1Q8KA 4F93B 4LJXA 1SIJA 5KT3A 4QZBA 2K60A 2BPFA 1HJPA 4ECYA 4NJ8A 4ZOHC 8ICSA 2K4HA 4UB1A 1RYUA 3BQ1A 7ICVA 2YMQA 4RQ8A 3PW4A 3N7PD 5KFXA 5JUMA 5KAFU 1L7OA 1SGGA 2O6KA 1TK0A 1HEKA 2DWQA 4F8RA 2VIXA 4J9LA 2KIWA 1RYRA 4P0QA 4BDPA 4KLDA 1NJZA 1Z00A 1FIQA 3KZIU 4KN7A 3M1YA 4J9OA 1QTMA 5IIJA 4Y2RA 8ICWA 2NRZA 1J2NA 3M7DA 7ICFA 2MUTB 5KFWA 4IRDA 1XC9A 7ICHA 2E8MA 9ICHA 2R18A 2G0AA 3UQ2A 5L9XA 3C5GA 2JHDA 3RJHA 2JZBA 4YXMA 2IHMA 3GIJA 2ZJAA 2I9GA 4UB2A 5KFDA 1NKBA 5HR7A 4FFDA 1JXEA 4ELUA 2NRWA 3PW2A 2BCVA 4C7ZA 5AK3A 1K1SA 1SWWA 4EX7A 3QZ7A 1S77D 5DDMA 2F1JA 1WG8A 4NL9A 2OYYA 4O0IA 2JEJA 2JR5A 4DSKA 2JRZA 3MR2A 3SV4A 4I2GA 9ICXA 4KLLA 4R64A 5AI8A 2XCPA 3M9OB 4MFAA 5ALSA 1L7MA 4I2DA 3F2CA 1ZQYA 3KD3A 4CF3A 5J8YC 1TAQA 1PUZA 1D9FA 7ICOA 1EXNA 4YMNA 8ICLA 3DEEA 4JMUA 1QLNA 3RBEA 4KX3A 4P4PA 4YCXA 4UQGA 5AM1A 5D46A 5J2AA 1X6IA 1ZQVA 5ALHA 4KLQA 1Z3EB 4USAA 3EYZA 5DB7A 2XCAA 2B6GA 3GV7B 2WF6A 2JGAA 2KHQA 2AJQA 3QX7A 3EWAA 3LVWA 2W7PA 4DQQA 3L4PA 4EEYA 4KLIA 4UASA 2R8HA 5DQIA 1V9PA 4F72A 1JUDA 2LPEA 3KHLA 1SXDA 1TFRA 4RQ0A 1ZJMA 1QQ6A 8ICOA 3H0RB 3TADA 4RUCA 2KD1A 3UPQA 5J2HA 9ICKA 2IMWP 4DL2A 4P2HA 3V7JA 1M6YA 2JEFA 1X9MA 2XO7A 9ICGA 1ZQEA 3J81j 5ALVA 2WF7A 2ZIUB 5H2FU 4M6WB 2M0NA 3UXNA 4MEYA 2FLLA 9ICAA 2LHTA 2HBLA 4ACOA 1JROA 1RM6C 4RQNA 1JX4A 1BPZA 2HDOA 4NL9C 5IIKA 2C28A 4DEZA 3H8WA 1L3SA 2ZUCA 2CPRA 2YMMA 3O0FA 1ZQZA 5KFFA 3TKAA 1QQ5A 1XU4A 4ED8A 5DG8A 3A0BU 4RNOA 2AXTU 9ICBA 4JV1A 2DBYA 3FAHA 2RDIA 2ZUDA 2XY6A 1X42A 1CRXA 1NNLA 5ALUA 3WKEA 1QCKA 2F8LA 5AKXA 1NK6A 5KFIA 1Z4OA 7ICNA 3SQIA 1S0NA 2KN7A 1XWLA 1T7PA 1IV8A 4DFJA 1NOMA 2P35A 5AM4A 4K4IA 2KMDA 3ISBA 4F5PA 4YR3A 4K4GA 3GQCA 2E1FA 2BQRA 4RQ6A 2P6RA 2KJ5A 1ZQTA 3LWLA 3AL0B 2J6UA 2BZFA 1JXLA 2AU0A 3BQ7A 4HAIA 2I1QA 3LDAA 4YVZA 1NK4A 3G6YA 5KFSA 4KLFA 4C7YA 3M8SA 4O5KA 4DOAA 3QU9A 5K4LA 3MGVA 4ECUA 3KHGA 4M9HA 4JUZA 3OPXA 4QWAA 5IIIA 1UHUA 4OJPA 4YMMA 3JPPA 5KFAA 2QARA 5DGBA 1QSYA 2BCQA 4FS2A 3BS5A 2KTQA 1LV5A 2V9WA 4Z6DA 5DB6A 4U6PA 4NXZA 3A0HU 3RJEA 8ICCA 2BQUA 2VKQA 1ZQXA 3AQEA 4FS1A 2H3ZA 2FPMA 2DPIA 3IHQB 3NVYA 5J2EA 3LK9A 3WK6A 2A1JB 4XRHA 1UCVA 2FDRA 2Q0ZX 2DL0A 4PH5A 2DFLA 3PMLA 2LBOA 1XSPA 3MBYA 5EE3A 4EX6A 3VC8A 2FE9A 2K89A 4I2FA 1DXSA 3T5JA 4Y2QA 1N2XA 2HOIA 2Q4TA 3GU3A 4I2IA 3OHBA 3ZDCA 8ICTA 3KOOA 1MA7A 3H4DA 2W43A 4E0DA 3H8MA 2RRDA 2KJ9A 1H38A 5KG6A 5ALDA 3ZI4A 3UM9A 3N97B 4NY8A 1NK5A 5KL1B 4KLMA 1ED1A 3C21A 3E58A 2LYBA 1U49A 4F5QA 4YQWA 3SR6A 5CWRA 1WYGA 5CRXA 3H4BA 4Z6FA 4NLGA 4F92B 4EZ6A 1Y88A 4RZRA 1CUKA 1HUZA 3NVZA 2KSOA 5C0YA 1L8OA 2VJ5A 3NS1A 3H7IA 5CR0A 4UAUA 4Y2VA 2PFPA 1ZQSA 4J9MA 1S8OA 2H3FA 4GC6A 5B5EU 4C4RA 4IC9A 4M04A 4QIWF 3NRZA 4NLNA 4US8A 2KE7A 1X6JA 3ZDEA 2E1EA 5KG0A 2W9BB 1COOA 3ISCA 5KFEA 3OJUA 4RQ1A 3MGIA 2XY7A 2LI6A 4MEXA 2YN4A 2W3SA 3T5LA 4R8UA 4RQ2A 3IG8A 3QEBZ 3GILA 4PGQA 2JEGA 1ZQQA 4B6JA 2JV3A 1UT8A 5ALYA 2XGPA 4B9LA 2UVUA 4F71A 3EPGA 2F1IA 3SAGA 8ICAA 5ALMA 5HHHA 4J9QA 4RQ4A 4P4MA 8ICPA 2Y9UA 4UARA 1JIHA 2ZIWB 3WKAA 2VA2A 3IP4B 1T3NA 3T5KA 5AI0A 4B9VA 4DL7A 1N61A 1CEZA 2DUYA 3SAFA 2FI1A 1Z4NA 2F8KA 2J6TA 9ICCA 5DBCA 1MQ2A 9ICMA 3AQFA 7ICUA 5J0RA 2MU2A 3WK4A 5KG2A 3AU2A 1URJA 3HW8A 3THVA 1A6SA 4ECTA 2HBJA 3K1RB 1OUQA 3BS7A 4KLJA 2PKEA 5AKHA 1BNPA 1B22A 2EH9A 2P6UA 2RDJA 2EZZA 4QZFA 3OGUA 2XC9A 4TUQA 1ZQIA 2CXYA 1L5UA 4ICAA 5EE0A 2ZIXB 3N7SC 5AKGA 2AGPA 3HX0A 1D8LA 4RT2A 2R8IA 2N1RA 1BPXA 2BKEA 4I2EA 5KFQA 3G6XA 1Z1VA 3V6JA 1KQQA 2XIDA 2EAMA 2HHVA 1K5OA 4US9A 3WKDA 4UAZA 3ISDA 2ZJ8A 3TFRA 5KG1A 3IDWA 3FC4A 4C8NA 5AK6A 1ZQFA 2KKPA 5KTQA 3H0LB 5CP2A 4ECRA 4YMOA 1SV0C 2LYHA 2KIVA 1X9XA 1DOQA 2HMXA 3B0YA 3F5EA 4YR0A 1SV4A 4RNNA 1LKYB 3F5AA 3LWMA 4O3RA 1S0MA 4NWIA 3NGDA 4RUAA 4M2YA 4PL1A 2KG5A 1NK0A 1TAUA 3WKCA 5C5JA 2BCUA 1WWVA 3TARA 3OJSA 1SZPA 3NTUA 3U26A 4PPXA 2OEHA 4B9UA 2PMZC 1NKCA 3PX6A 3HT3A 8ICQA 5ALGA 3TFSA 1RDFA 2MA1A 3E2EA 3PX4A 2WF5A 4TURA 1L3UA 4Q43A 1T8EA 1N5WA 4NV0A 4IQWA 4Q44A 3KKAA 2K8AA 3JPNA 4TQRA 2GOLA 2LKYA 3RAXA 3MDAA 2W03A 1ZYQA 2YMLA 4EELA 1WCNA 5BOMA 1F44A 4IR1A 8ICYA 2OWOA 3OTQA 2C2DA 4EBDA 1MSWD 4UAVA 4UW9A 2YB1A 1Z19A 3GFKB 4RT3A 1SL2A 3Q8QB 5D4BA 3CRXA 3OSNA 2OXOA 2KFNA 5BOLA 2WB1C 1WWUA 2YQEA 5J2CA 2PMZF 3SV3A 4PHAA 5JRTA 5DG9A 2B0CA 1N48A 2LM4A 5J2BA 2I5HA 3TAQA 3HKZF 5AK4A 2EANA 3TANA 1PK1A 2QB0A 3PW0A 4RQ3A 2QKQA 4CF5A 3RB0A 3OHAA 1UA0A 8ICXA 1TVAA 5KFGA 1O08A 4I2CA 4FZLA 3D2NA 3SI8A 4I29A 2UVWA 4F2RA 4NLCA 4QWCA 3QU7A 4KTQA 5HMMA 2RLTA 5DBBA 4YD2A 4PZOA 3GIKA 4O5EA 4KLSA 3HP6A 2W9CA 2VJ4A 1NK9A 3GDXA 1UA1A 1NJXA 1IXRA 5FP0A 4EBCA 3Q8PB 3D2SA 1RG6A 2WB1F 4BXOA 9ICTA 4YN4A 7ICEA 1T3QA 3RF9A 3GZFA 2OCEA 1RZTA 4R63A 5HR6A 2KZ3A 1XSLA 3SMVA 4I2HA 4XUSA 4JB3A 4UAYA 3D6JA 2PXIA 1VDVA 1TKDA 8ICHA 1S97A 2G08A 4QZHA 2YX8A 4DFKA 1NZPA 1O03A 1NZBA 1X9SA 5KFTA 3TQ1A 4F50A 4P0PA 4O3QA 4J9PA 4FBUA 1KFSA 5KFLA 9ICEA 3PSIA 2KOBA 1NK8A 4F91B 3PNCA 3Q8KA 1KBUA 4P0QB 4FBTA 2Z7JA 1Z00B 2W04A 4Y2JA 3QYPA 1A77A 1ZD5A 4ED6A 4YR2A 5L1JA 4ECWA 4IQVA 4DL4A 2KZZA 1TE2A 4MFCA 1BPDA 4RPXA 4DLGA 3UXPA 2EZXA 2PFNA 3HWTA 2C2EA 2AGOA 3CYMA 3RR8A 3JPTA 5DQGA 1DRGA 1TK8A 3RJGA 4K4HA 4O3NA 2EAPA 3MABA 5J29A 3N7RC 4MHVA 2JZBB 4PHEA 3V7LA 4QZ9A 2JMGA 4GXJA 3H40A 3PY8A 5AM2A 2G5IB 4JWNA 1PK3A 5D49A 5DGAA 2ATLA 2W7OA 2F44A 3PSPA 3QE9Y 9ICRA 4JK1A 2G09A 1J2MA 3RH6A 1S76D 5ALQA 4QWBA 4GXIA 3VCBA 2ISOA 3EZ5A 2W54A 1XO0A 2BGWA 2DQNB 2K4EA 3IM1A 1DK2A 2HSZA 5KG4A 3SZ2A 1JALA 4RPZA 2PFOA 2LYAA 4I28A 9ICNA 2R8GA 5J2FA 1J97A 2ODGA 2BDPA 3V6KA 2M9NA 3M6KA 5CJ7A 4F5NA 5AI4A 2W9MA 1ZQWA 3LVVA 1OW5A 1DK3A 1TV9A 1RQLA 2HVIA 4M9GA 1ZQDA 2ZTEA 4YXJA 4UB4A 4M9LA 4YP3A 4OD0A 1ZQ1C 1F5SA 2BDUA 1SZHA 2NRTA 1DGJA 4Y2TA 2DGZA 4TUSA 2ZIVA 3TADC 4GXKA 4FE3A 1WUDA 1FEZA 4AYBC 4F4KA 3RBDA 3GV8B 1ZQBA 3WK8A 3WK9A 4QZIA 2HHTA 2FMSA 3NASA 4PZNA 5ALPA 4Y2PA 4ED7A 2KVCA 5AM0A 1UPHA 2BPCA 4DOCA 4GC7A 5AK5A 2YMPA 3PV8A 2W9AA 1SKWA 7ICQA 2C2RA 1KTQA 4UBBA 4CE6A 4ED2A 1RQNA 1ZD4A 5KT7A 2FMQA 1IM4A 1L3TA 4C4SA 4ELTA 4J9NA 1A76A 3RB6A 2ISPA 3ZD9A 4PHDA 1U48A 1UT5A 2IOFK 5CA7A 4QIWC 4C8KA 1QQ7A 4DLEA 4QNLA 3JPSA 2H3IA 5DQHA 3T3FA 1T4GA 1MQ3A 4AYBF 1ZQJA 4OCZA 4O5CA 2Y1JA 1PVQA 5G5HA 1AQ6A 4LVSA 2H3VA 8ICIA 3RH4A 4QZEA 3Q8LA 2RQ5A 1SXEA 7ICPA 3AEVA 2VA3A 3JPQA 4F4YA 3KFUF 4YFKA 5IILA 3B9JA 4ED3A 2BCSA 3MFIA 5JU5A 2PI5A 4OO1J 2GLEA 5HMLA 1KKXA 4M9JA 5KG7A 3TAPA 1V85A 4P4OA 2WAQF 2EDUA 2BHNA 5EOZA 3PR5B 5ALEA 3C2KA 1RPLA 5ALKA 4QJFB 2MSNA 7ICIA 2NV3A 2QLTA 5IIOA 5AKIA 3CP8A 2XVTA 3RAQA 4C4TA 8ICZA 5IIMA 4DSEA 3SYZA 2EQYA 2D6FC 4KX5A 2RHFA 4IS7A 3UMCA 4QZCA 3I76A 4PJ0U 1ZD2P 4M0AA 3S6JA 4B9NA 3RJKA 4ZH4A 3ETLA 4DOBA 4J9SA 1VJ5A 7ICJA 2MRLA 4DQPA 5ALFA 2KP7A 2V4QA 5ALTA 2BQ3A 2KK0A 4DFPA 3AN1A 1D8BA 1ECWA 4O3MA 2KFZA 3D2QA 5KFBA 5HNKA 3IRUA 5ALRA 2KICA 3AUOA 4EYHB 1HUOA 2DKZA 1S0OA 3FYHA 1D9DA 5J0WA 2QARB 3ZDDA 4EENA 3F53A 1KEJA 3BS5B 1ZXIA 5L1IA 2DKXA 2KHVA 2G07A 4DCCA 4Z6CA 1X40A 1ZQLA 2YTUA 2MUTA 2ZTDA 3HILA 5AKKA 1ZQRA 4IRCA 2WFAA 2W3RA 3RB4A 2KJ8A 4TUPA 3ICXA 1SKRA 3C23A 2VA8A 4UB5A 1ZQHA 3GIIA 1JRPA 2HHQA 3EPIA 1AROP 7ICTA 2K4PA 3E0FA 4CF4A 5J2IA 4JV0A 4Y2XA 4RQMA 5J0PA 7ICLA 2AQ0A 3V6HA 2W8KA 3BDPA 4DS5A 3N28A 3TACB 5AI6A 4F3OA 4CRXA 3MR6A 4J9RA 2VANA 3PR4A 2IHNA 2HBKA 2OHFA 1U47A 4CCHA 4OJ5A 4ECVA 5DB9A 4EZ9A 1X9WA 4BX9C 3UMGA
chains in the Genus database with same CATH topology
1F0MA 2EANA 1PK1A 5JTIA 2D3DA 2QB0A 1SV0C 3H8MA 2QKQA 2ESEA 2KIVA 2E8PA 1KW4A 1X9XA 2B6GA 2EAPA 1SV4A 4MHVA 1LKYB 2KSOB 2KMDA 2QB1A 1JI7A 1X66A 1B0XA 4PZOA 1PK3A 2KG5A 2F8KA 2E8MA 5KNIA 2DKZA 2F44A 2QARB 3BQ7A 2LPEA 3BS5B 1WWVA 1SXDA 2DKXA 1LKYA 2KSOA 2D8CA 5J8YA 2LMRA 1RG6A 1X40A 2EAOA 2YTUA 3HILA 2Y9TA 3TADA 3SEIA 3K1RB 3BS7A 2QARA 3BS5A 3SENA 1UQVA 4NL9A 1SXEA 2E8NA 3KKAA 2KE7A 4RQNA 1OW5A 1SV0A 5JU5A 2GLEA 2K4PA 1OXJA 1V38A 2E8OA 4RQMA 4NL9C 2ES6A 1V85A 2JV3A 5L1MA 5J8YC 5F3XB 1COKA 1UCVA 3TACB 2DL0A 2K60A 1PK1B 1Z1VA 3TADC 2F3NA 2QB0B 4NJ8A 2EAMA 1WWUA 2L5YA 2FE9A 2Y9UA 1SGGA 3IDWA 4IS7A 4PZNA 1DXSA 5JRTA 1B4FA 3KKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0M A;  2EAN A;  1PK1 A;  5JTI A;  2D3D A;  2QB0 A;  1SV0 C;  3H8M A;  2QKQ A;  2ESE A;  2KIV A;  2E8P A;  1KW4 A;  1X9X A;  2B6G A;  2EAP A;  1SV4 A;  4MHV A;  1LKY B;  2KSO B;  2KMD A;  2QB1 A;  1JI7 A;  1X66 A;  1B0X A;  4PZO A;  1PK3 A;  2KG5 A;  2F8K A;  2E8M A;  5KNI A;  2DKZ A;  2F44 A;  2QAR B;  3BQ7 A;  2LPE A;  3BS5 B;  1WWV A;  1SXD A;  2DKX A;  1LKY A;  2KSO A;  2D8C A;  5J8Y A;  2LMR A;  1RG6 A;  1X40 A;  2EAO A;  2YTU A;  3HIL A;  2Y9T A;  3TAD A;  3SEI A;  3K1R B;  3BS7 A;  2QAR A;  3BS5 A;  3SEN A;  1UQV A;  4NL9 A;  1SXE A;  2E8N A;  3KKA A;  2KE7 A;  4RQN A;  1OW5 A;  1SV0 A;  5JU5 A;  2GLE A;  2K4P A;  1OXJ A;  1V38 A;  2E8O A;  4RQM A;  4NL9 C;  2ES6 A;  1V85 A;  2JV3 A;  5L1M A;  5J8Y C;  5F3X B;  1COK A;  1UCV A;  3TAC B;  2DL0 A;  2K60 A;  1PK1 B;  1Z1V A;  3TAD C;  2F3N A;  2QB0 B;  4NJ8 A;  2EAM A;  1WWU A;  2L5Y A;  2FE9 A;  2Y9U A;  1SGG A;  3IDW A;  4IS7 A;  4PZN A;  1DXS A;  5JRT A;  1B4F A;  3KKA C; 
#chains in the Genus database with same CATH topology
 3QUT A;  9ICJ A;  1ZOL A;  2IOH A;  3TI0 A;  4PHP A;  3HJE A;  2ESE A;  2JXJ A;  4O3P A;  3L3F X;  4M47 A;  1PVP A;  5KFZ A;  1QSS A;  1B43 A;  5L1L A;  2FMP A;  5KT5 A;  5AI9 A;  4DWI A;  2EZY A;  2KSO B;  1P7D A;  2HHX A;  3NUQ A;  1BVS A;  4DFD A;  4RPY A;  4NLK A;  2YB4 A;  4J03 A;  3BQ2 A;  3AMZ A;  2A1A A;  5KFM A;  2JH1 A;  2ASD A;  3PW7 A;  2XIC A;  2F76 X;  1XSN A;  2W55 A;  2E3T A;  2DF4 B;  2MAX A;  3K1Z A;  4DL3 A;  3T5H A;  4B9T A;  5KFJ A;  5AKZ A;  5J8Y A;  5J0T A;  4RQ7 A;  1CI4 A;  1KSP A;  2WF8 A;  1Q3V A;  2IOF A;  3V7K A;  5A0L A;  4BWM A;  4R8U B;  9ICV A;  3MR5 A;  2DPJ A;  2ASL A;  1BNO A;  2YY6 A;  3H8S A;  1ZQN A;  5ALJ A;  5HHI A;  4Q8E A;  4A8E A;  4ECX A;  3PSF A;  2KZM A;  4I27 A;  5CHG A;  4RNM A;  2H3Q A;  4NM2 A;  3C28 A;  2E8O A;  2ES6 A;  4DSF A;  4MF2 A;  3HKZ C;  4I2A A;  2ZIU A;  5L1M A;  5KFO A;  4M6W A;  1COK A;  4QZ8 A;  2ZJ5 A;  2FPL A;  3T79 A;  4DF4 A;  2F3N A;  3NVW A;  7ICG A;  4C8L A;  1MC8 A;  4B9S A;  3SAH A;  3QU4 A;  5AIA A;  5AM5 A;  3AU6 A;  1TAM A;  3RH5 A;  4X5V A;  1RXV A;  4ED0 A;  3ZDA A;  5GTH U;  5J0O A;  3PO4 A;  3BQT A;  3MC1 A;  2IBK A;  3RJJ A;  2AH5 A;  1LVH A;  1A0P A;  4Z6E A;  2GH1 A;  3R9K A;  4DO9 A;  5BPC A;  1ZD3 A;  2ZG6 A;  3WU2 U;  2QB1 A;  1SB3 C;  1JI7 A;  1KN5 A;  1B0X A;  4KLH A;  2HOQ A;  2ZTC A;  5KFU A;  2F1H A;  4XA5 A;  1QH9 A;  3M9N B;  4UB8 U;  2WF9 A;  1ZQU A;  8ICK A;  3V72 A;  4IQT A;  2HHW A;  2EAO A;  1KL9 A;  1ZQG A;  4KLE A;  8ICE A;  3M8R A;  5KFR A;  5J2D A;  3I1Y A;  1NKE A;  5AKJ A;  7ICM A;  2C22 A;  4CNQ A;  2P66 A;  4Y2S A;  3F2D A;  3C2M A;  4DQR A;  5ALX A;  4F2S A;  5KT6 A;  4DS4 A;  3B0X A;  5F9L A;  9ICL A;  2E8N A;  1N5X A;  3ETR A;  1K1Q A;  4YD1 A;  4G3I A;  2J6S A;  5EE9 A;  1ZRM A;  8ICB A;  2XGQ A;  2AGQ A;  2HCF A;  2H5X A;  5IIN A;  3M6Z A;  9ICP A;  1LB2 B;  2PI4 A;  4UAW A;  4UB3 A;  5ALZ A;  3KTQ A;  5AIB A;  4F4Z A;  1BPE A;  5KFC A;  4OJ6 A;  1C20 A;  5L1K A;  1NJW A;  1YZ6 A;  2L5Y A;  4DFM A;  4IRK A;  1U4B A;  4HYK A;  3K4G A;  2A1J A;  3KKA C;  4QZD A;  4KMO B;  3RJF A;  4DSI A;  5KFK A;  8ICF A;  2AQ4 A;  5J0U A;  8ICV A;  2UVR A;  4CGZ A;  1L7N A;  2E8P A;  2W8L A;  3KBB A;  2F2A B;  4PL2 A;  4EEK A;  1YZ7 A;  9ICW A;  5ALO A;  3L5K A;  2ASJ A;  3K75 D;  3HPO A;  2V4R A;  2RP5 A;  3BJY A;  4B9M A;  2A19 A;  1X66 A;  2WTF A;  3MDC A;  4ED1 A;  4UAT A;  3WK5 A;  5TIS U;  3BQ0 A;  4AP9 A;  5J2J A;  2FLN A;  5AIC A;  3C1Y A;  1S0V A;  4C8O A;  3M9M B;  2CRX A;  1SL1 A;  3IG5 A;  1XNS A;  1S5L U;  3RRG A;  4I2J A;  9ICI A;  5J0X A;  4KMU A;  3RR7 A;  4Y2U A;  4DQI A;  3H0M B;  4RQ5 A;  1ZQP A;  4LZG A;  3RFA A;  3GIM A;  2F77 X;  2FPK A;  5KFH A;  5J2G A;  1SL0 A;  4JWM A;  4O9M A;  5G5G A;  4F4X A;  1ZQM A;  2Y0S C;  1T94 A;  8ICG A;  1N63 A;  2K8B B;  3FM9 A;  1SKS A;  2BPG A;  3IV6 A;  5KL8 B;  1TK5 A;  5DKW A;  1IIP A;  4KLG A;  3QXG A;  3QNM A;  4FZN A;  3QU5 A;  5KG3 A;  2JH7 A;  3IN5 A;  2W9B A;  1BGX T;  1PK1 B;  1QSL A;  2QB0 B;  4FO6 A;  2NO5 A;  3RRH A;  4Q8F A;  3Q8M A;  5CB1 A;  1ZQA A;  4DSJ A;  3UMB A;  4WJ3 B;  5DLG A;  3Q8S B;  4DQS A;  2GWS A;  4FZM A;  5DBA A;  1XS9 D;  2D3D A;  5AM3 A;  1D8Y A;  1YT3 A;  2W9C B;  1IG6 A;  1L3V A;  1KW4 A;  5KG5 A;  9ICS A;  3ZD8 A;  3KHR A;  2ZXH A;  3HRD D;  2HI0 A;  1KFD A;  2Y0S F;  2ZIW A;  4MFF A;  1L8L A;  4BWJ A;  3C29 A;  5AI5 A;  4ECQ A;  4BXO B;  3C2L A;  8ICN A;  1MN8 A;  2BCR A;  4ELV A;  2CN1 A;  1SWV A;  5E79 U;  2WHE A;  3PVX A;  1ZQO A;  3CW2 C;  4Q45 A;  4C0Z A;  5DDY A;  3N4M B;  4KN4 A;  4J9K A;  2NYV A;  3EUB 2;  1ZJN A;  2HW3 A;  4KIT B;  5KT2 A;  3PST A;  7ICR A;  4PGX A;  3EW9 A;  4QW8 A;  5DLF A;  4I2B A;  2Y1I A;  3SEI A;  5KAI U;  5KFV A;  5EWG A;  4TQS A;  4DL6 A;  1FFU A;  2WAQ C;  2HVH A;  1V97 A;  3MR3 A;  3QUQ A;  1KLN A;  2GO7 A;  3SEN A;  4PGY A;  1UQV A;  4P0P B;  2HHS A;  7ICS A;  3I28 A;  5ALL A;  2AHO B;  1NJY A;  3BZC A;  2XY5 A;  1OXJ A;  1V38 A;  2B21 A;  3LYS A;  2JEI A;  4IQU A;  4NLZ A;  1C7Y A;  1DGS A;  4BGD A;  3CNH A;  4M9N A;  1NK7 A;  4BJQ A;  5AKY A;  2G06 A;  1FO4 A;  4NM1 A;  4OJO A;  2KV2 A;  1N62 A;  2G5H B;  4NLB A;  1JN3 A;  4QZG A;  4R66 A;  2ZIX A;  1KRP A;  3JPR A;  3UQ0 A;  3ORY A;  5DB8 A;  1RXW A;  2FLP A;  8ICM A;  3MGH A;  4JV2 A;  5EE1 A;  2W11 A;  4U7C A;  1S10 A;  3QZ8 A;  3QUC A;  3RJI A;  3FDS A;  3UXO A;  3DDH A;  9ICO A;  4KLO A;  2KKV A;  5JTI A;  8ICU A;  3SD7 A;  3NVV A;  4LZD A;  4UB6 U;  3C1Z A;  2R8J A;  1BPY A;  4OJL A;  1PVR A;  4GFJ A;  1VLB A;  2NRV A;  4Y2Y A;  2IA6 A;  5TZV A;  4QWE A;  3C5F A;  2E5S A;  9ICQ A;  1Z1B A;  1NI3 A;  4F5O A;  4DF8 A;  2R8K A;  1ZET A;  2LM1 A;  4KLT A;  1LKY A;  2D8C A;  5ALN A;  4MF8 A;  1FFV A;  1KFT A;  3QUB A;  1BPB A;  3H8J A;  2ALZ A;  2Y9T A;  1ZQC A;  3GV5 B;  4C8M A;  4O3S A;  1XO1 A;  4KLU A;  5KFN A;  5AKL A;  1U45 A;  2I6X A;  5J0S A;  4IR9 A;  2K4I A;  2NRX A;  5J0Y A;  4BUG A;  2ZIV B;  1SV0 A;  3PO5 A;  5T14 A;  1S9F A;  4DL5 A;  5AHX A;  5KT4 A;  2PFQ A;  5DG7 A;  1L7P A;  3PMN A;  5J0Q A;  3BZK A;  2NO4 A;  3QEA Z;  5ALW A;  1N60 A;  2ZUB A;  1Q3U A;  5AKE A;  8ICJ A;  5EWF A;  4RU9 A;  5KFP A;  5F3X B;  3PX0 A;  9ICU A;  4QWD A;  2UVV A;  5GTI U;  1ZQK A;  4EBE A;  1Q46 A;  2OM6 A;  3DV9 A;  4YG2 A;  3WKB A;  3PZP A;  1B4F A;  1F0M A;  4XQ8 A;  2A3V A;  2XI9 A;  4G9B A;  4C80 A;  4QW9 A;  1WCL A;  1N56 A;  5F9N A;  3KZX A;  5ALI A;  1RYS A;  7ICK A;  1HIW A;  3OSP A;  1U9L A;  2KNJ A;  5EWE A;  4CDG A;  2HOF A;  1ZRN A;  3ED5 A;  5J2K A;  4EYI B;  4DSL A;  4QZA A;  3AM9 A;  5KNI A;  2HBM A;  4F4W A;  4GLX A;  3F2B A;  3PW5 A;  8ICR A;  2FJ6 A;  2ZXI A;  4F5R A;  2LMR A;  1PZN A;  3RTV A;  5B66 U;  9ICF A;  3RB3 A;  4ECS A;  4UBC A;  5HP4 A;  2HHU A;  2KVS A;  3G6V A;  3MFH A;  1KDH A;  3Q8R B;  3KHH A;  4ECZ A;  3QU2 A;  1GO3 F;  3JPO A;  1JMS A;  3ZDB A;  3WK7 A;  5CEH A;  4O3O A;  3ONN A;  4R65 A;  4GIB A;  2BR0 A;  4IL6 U;  5KFY A;  2OH2 A;  2KEY A;  2K8C B;  3NRW A;  1L6N A;  3ALR A;  1X2I A;  1Q8K A;  4F93 B;  4LJX A;  1SIJ A;  5KT3 A;  4QZB A;  2K60 A;  2BPF A;  1HJP A;  4ECY A;  4NJ8 A;  4ZOH C;  8ICS A;  2K4H A;  4UB1 A;  1RYU A;  3BQ1 A;  7ICV A;  2YMQ A;  4RQ8 A;  3PW4 A;  3N7P D;  5KFX A;  5JUM A;  5KAF U;  1L7O A;  1SGG A;  2O6K A;  1TK0 A;  1HEK A;  2DWQ A;  4F8R A;  2VIX A;  4J9L A;  2KIW A;  1RYR A;  4P0Q A;  4BDP A;  4KLD A;  1NJZ A;  1Z00 A;  1FIQ A;  3KZI U;  4KN7 A;  3M1Y A;  4J9O A;  1QTM A;  5IIJ A;  4Y2R A;  8ICW A;  2NRZ A;  1J2N A;  3M7D A;  7ICF A;  2MUT B;  5KFW A;  4IRD A;  1XC9 A;  7ICH A;  2E8M A;  9ICH A;  2R18 A;  2G0A A;  3UQ2 A;  5L9X A;  3C5G A;  2JHD A;  3RJH A;  2JZB A;  4YXM A;  2IHM A;  3GIJ A;  2ZJA A;  2I9G A;  4UB2 A;  5KFD A;  1NKB A;  5HR7 A;  4FFD A;  1JXE A;  4ELU A;  2NRW A;  3PW2 A;  2BCV A;  4C7Z A;  5AK3 A;  1K1S A;  1SWW A;  4EX7 A;  3QZ7 A;  1S77 D;  5DDM A;  2F1J A;  1WG8 A;  4NL9 A;  2OYY A;  4O0I A;  2JEJ A;  2JR5 A;  4DSK A;  2JRZ A;  3MR2 A;  3SV4 A;  4I2G A;  9ICX A;  4KLL A;  4R64 A;  5AI8 A;  2XCP A;  3M9O B;  4MFA A;  5ALS A;  1L7M A;  4I2D A;  3F2C A;  1ZQY A;  3KD3 A;  4CF3 A;  5J8Y C;  1TAQ A;  1PUZ A;  1D9F A;  7ICO A;  1EXN A;  4YMN A;  8ICL A;  3DEE A;  4JMU A;  1QLN A;  3RBE A;  4KX3 A;  4P4P A;  4YCX A;  4UQG A;  5AM1 A;  5D46 A;  5J2A A;  1X6I A;  1ZQV A;  5ALH A;  4KLQ A;  1Z3E B;  4USA A;  3EYZ A;  5DB7 A;  2XCA A;  2B6G A;  3GV7 B;  2WF6 A;  2JGA A;  2KHQ A;  2AJQ A;  3QX7 A;  3EWA A;  3LVW A;  2W7P A;  4DQQ A;  3L4P A;  4EEY A;  4KLI A;  4UAS A;  2R8H A;  5DQI A;  1V9P A;  4F72 A;  1JUD A;  2LPE A;  3KHL A;  1SXD A;  1TFR A;  4RQ0 A;  1ZJM A;  1QQ6 A;  8ICO A;  3H0R B;  3TAD A;  4RUC A;  2KD1 A;  3UPQ A;  5J2H A;  9ICK A;  2IMW P;  4DL2 A;  4P2H A;  3V7J A;  1M6Y A;  2JEF A;  1X9M A;  2XO7 A;  9ICG A;  1ZQE A;  3J81 j;  5ALV A;  2WF7 A;  2ZIU B;  5H2F U;  4M6W B;  2M0N A;  3UXN A;  4MEY A;  2FLL A;  9ICA A;  2LHT A;  2HBL A;  4ACO A;  1JRO A;  1RM6 C;  4RQN A;  1JX4 A;  1BPZ A;  2HDO A;  4NL9 C;  5IIK A;  2C28 A;  4DEZ A;  3H8W A;  1L3S A;  2ZUC A;  2CPR A;  2YMM A;  3O0F A;  1ZQZ A;  5KFF A;  3TKA A;  1QQ5 A;  1XU4 A;  4ED8 A;  5DG8 A;  3A0B U;  4RNO A;  2AXT U;  9ICB A;  4JV1 A;  2DBY A;  3FAH A;  2RDI A;  2ZUD A;  2XY6 A;  1X42 A;  1CRX A;  1NNL A;  5ALU A;  3WKE A;  1QCK A;  2F8L A;  5AKX A;  1NK6 A;  5KFI A;  1Z4O A;  7ICN A;  3SQI A;  1S0N A;  2KN7 A;  1XWL A;  1T7P A;  1IV8 A;  4DFJ A;  1NOM A;  2P35 A;  5AM4 A;  4K4I A;  2KMD A;  3ISB A;  4F5P A;  4YR3 A;  4K4G A;  3GQC A;  2E1F A;  2BQR A;  4RQ6 A;  2P6R A;  2KJ5 A;  1ZQT A;  3LWL A;  3AL0 B;  2J6U A;  2BZF A;  1JXL A;  2AU0 A;  3BQ7 A;  4HAI A;  2I1Q A;  3LDA A;  4YVZ A;  1NK4 A;  3G6Y A;  5KFS A;  4KLF A;  4C7Y A;  3M8S A;  4O5K A;  4DOA A;  3QU9 A;  5K4L A;  3MGV A;  4ECU A;  3KHG A;  4M9H A;  4JUZ A;  3OPX A;  4QWA A;  5III A;  1UHU A;  4OJP A;  4YMM A;  3JPP A;  5KFA A;  2QAR A;  5DGB A;  1QSY A;  2BCQ A;  4FS2 A;  3BS5 A;  2KTQ A;  1LV5 A;  2V9W A;  4Z6D A;  5DB6 A;  4U6P A;  4NXZ A;  3A0H U;  3RJE A;  8ICC A;  2BQU A;  2VKQ A;  1ZQX A;  3AQE A;  4FS1 A;  2H3Z A;  2FPM A;  2DPI A;  3IHQ B;  3NVY A;  5J2E A;  3LK9 A;  3WK6 A;  2A1J B;  4XRH A;  1UCV A;  2FDR A;  2Q0Z X;  2DL0 A;  4PH5 A;  2DFL A;  3PML A;  2LBO A;  1XSP A;  3MBY A;  5EE3 A;  4EX6 A;  3VC8 A;  2FE9 A;  2K89 A;  4I2F A;  1DXS A;  3T5J A;  4Y2Q A;  1N2X A;  2HOI A;  2Q4T A;  3GU3 A;  4I2I A;  3OHB A;  3ZDC A;  8ICT A;  3KOO A;  1MA7 A;  3H4D A;  2W43 A;  4E0D A;  3H8M A;  2RRD A;  2KJ9 A;  1H38 A;  5KG6 A;  5ALD A;  3ZI4 A;  3UM9 A;  3N97 B;  4NY8 A;  1NK5 A;  5KL1 B;  4KLM A;  1ED1 A;  3C21 A;  3E58 A;  2LYB A;  1U49 A;  4F5Q A;  4YQW A;  3SR6 A;  5CWR A;  1WYG A;  5CRX A;  3H4B A;  4Z6F A;  4NLG A;  4F92 B;  4EZ6 A;  1Y88 A;  4RZR A;  1CUK A;  1HUZ A;  3NVZ A;  2KSO A;  5C0Y A;  1L8O A;  2VJ5 A;  3NS1 A;  3H7I A;  5CR0 A;  4UAU A;  4Y2V A;  2PFP A;  1ZQS A;  4J9M A;  1S8O A;  2H3F A;  4GC6 A;  5B5E U;  4C4R A;  4IC9 A;  4M04 A;  4QIW F;  3NRZ A;  4NLN A;  4US8 A;  2KE7 A;  1X6J A;  3ZDE A;  2E1E A;  5KG0 A;  2W9B B;  1COO A;  3ISC A;  5KFE A;  3OJU A;  4RQ1 A;  3MGI A;  2XY7 A;  2LI6 A;  4MEX A;  2YN4 A;  2W3S A;  3T5L A;  4R8U A;  4RQ2 A;  3IG8 A;  3QEB Z;  3GIL A;  4PGQ A;  2JEG A;  1ZQQ A;  4B6J A;  2JV3 A;  1UT8 A;  5ALY A;  2XGP A;  4B9L A;  2UVU A;  4F71 A;  3EPG A;  2F1I A;  3SAG A;  8ICA A;  5ALM A;  5HHH A;  4J9Q A;  4RQ4 A;  4P4M A;  8ICP A;  2Y9U A;  4UAR A;  1JIH A;  2ZIW B;  3WKA A;  2VA2 A;  3IP4 B;  1T3N A;  3T5K A;  5AI0 A;  4B9V A;  4DL7 A;  1N61 A;  1CEZ A;  2DUY A;  3SAF A;  2FI1 A;  1Z4N A;  2F8K A;  2J6T A;  9ICC A;  5DBC A;  1MQ2 A;  9ICM A;  3AQF A;  7ICU A;  5J0R A;  2MU2 A;  3WK4 A;  5KG2 A;  3AU2 A;  1URJ A;  3HW8 A;  3THV A;  1A6S A;  4ECT A;  2HBJ A;  3K1R B;  1OUQ A;  3BS7 A;  4KLJ A;  2PKE A;  5AKH A;  1BNP A;  1B22 A;  2EH9 A;  2P6U A;  2RDJ A;  2EZZ A;  4QZF A;  3OGU A;  2XC9 A;  4TUQ A;  1ZQI A;  2CXY A;  1L5U A;  4ICA A;  5EE0 A;  2ZIX B;  3N7S C;  5AKG A;  2AGP A;  3HX0 A;  1D8L A;  4RT2 A;  2R8I A;  2N1R A;  1BPX A;  2BKE A;  4I2E A;  5KFQ A;  3G6X A;  1Z1V A;  3V6J A;  1KQQ A;  2XID A;  2EAM A;  2HHV A;  1K5O A;  4US9 A;  3WKD A;  4UAZ A;  3ISD A;  2ZJ8 A;  3TFR A;  5KG1 A;  3IDW A;  3FC4 A;  4C8N A;  5AK6 A;  1ZQF A;  2KKP A;  5KTQ A;  3H0L B;  5CP2 A;  4ECR A;  4YMO A;  1SV0 C;  2LYH A;  2KIV A;  1X9X A;  1DOQ A;  2HMX A;  3B0Y A;  3F5E A;  4YR0 A;  1SV4 A;  4RNN A;  1LKY B;  3F5A A;  3LWM A;  4O3R A;  1S0M A;  4NWI A;  3NGD A;  4RUA A;  4M2Y A;  4PL1 A;  2KG5 A;  1NK0 A;  1TAU A;  3WKC A;  5C5J A;  2BCU A;  1WWV A;  3TAR A;  3OJS A;  1SZP A;  3NTU A;  3U26 A;  4PPX A;  2OEH A;  4B9U A;  2PMZ C;  1NKC A;  3PX6 A;  3HT3 A;  8ICQ A;  5ALG A;  3TFS A;  1RDF A;  2MA1 A;  3E2E A;  3PX4 A;  2WF5 A;  4TUR A;  1L3U A;  4Q43 A;  1T8E A;  1N5W A;  4NV0 A;  4IQW A;  4Q44 A;  3KKA A;  2K8A A;  3JPN A;  4TQR A;  2GOL A;  2LKY A;  3RAX A;  3MDA A;  2W03 A;  1ZYQ A;  2YML A;  4EEL A;  1WCN A;  5BOM A;  1F44 A;  4IR1 A;  8ICY A;  2OWO A;  3OTQ A;  2C2D A;  4EBD A;  1MSW D;  4UAV A;  4UW9 A;  2YB1 A;  1Z19 A;  3GFK B;  4RT3 A;  1SL2 A;  3Q8Q B;  5D4B A;  3CRX A;  3OSN A;  2OXO A;  2KFN A;  5BOL A;  2WB1 C;  1WWU A;  2YQE A;  5J2C A;  2PMZ F;  3SV3 A;  4PHA A;  5JRT A;  5DG9 A;  2B0C A;  1N48 A;  2LM4 A;  5J2B A;  2I5H A;  3TAQ A;  3HKZ F;  5AK4 A;  2EAN A;  3TAN A;  1PK1 A;  2QB0 A;  3PW0 A;  4RQ3 A;  2QKQ A;  4CF5 A;  3RB0 A;  3OHA A;  1UA0 A;  8ICX A;  1TVA A;  5KFG A;  1O08 A;  4I2C A;  4FZL A;  3D2N A;  3SI8 A;  4I29 A;  2UVW A;  4F2R A;  4NLC A;  4QWC A;  3QU7 A;  4KTQ A;  5HMM A;  2RLT A;  5DBB A;  4YD2 A;  4PZO A;  3GIK A;  4O5E A;  4KLS A;  3HP6 A;  2W9C A;  2VJ4 A;  1NK9 A;  3GDX A;  1UA1 A;  1NJX A;  1IXR A;  5FP0 A;  4EBC A;  3Q8P B;  3D2S A;  1RG6 A;  2WB1 F;  4BXO A;  9ICT A;  4YN4 A;  7ICE A;  1T3Q A;  3RF9 A;  3GZF A;  2OCE A;  1RZT A;  4R63 A;  5HR6 A;  2KZ3 A;  1XSL A;  3SMV A;  4I2H A;  4XUS A;  4JB3 A;  4UAY A;  3D6J A;  2PXI A;  1VDV A;  1TKD A;  8ICH A;  1S97 A;  2G08 A;  4QZH A;  2YX8 A;  4DFK A;  1NZP A;  1O03 A;  1NZB A;  1X9S A;  5KFT A;  3TQ1 A;  4F50 A;  4P0P A;  4O3Q A;  4J9P A;  4FBU A;  1KFS A;  5KFL A;  9ICE A;  3PSI A;  2KOB A;  1NK8 A;  4F91 B;  3PNC A;  3Q8K A;  1KBU A;  4P0Q B;  4FBT A;  2Z7J A;  1Z00 B;  2W04 A;  4Y2J A;  3QYP A;  1A77 A;  1ZD5 A;  4ED6 A;  4YR2 A;  5L1J A;  4ECW A;  4IQV A;  4DL4 A;  2KZZ A;  1TE2 A;  4MFC A;  1BPD A;  4RPX A;  4DLG A;  3UXP A;  2EZX A;  2PFN A;  3HWT A;  2C2E A;  2AGO A;  3CYM A;  3RR8 A;  3JPT A;  5DQG A;  1DRG A;  1TK8 A;  3RJG A;  4K4H A;  4O3N A;  2EAP A;  3MAB A;  5J29 A;  3N7R C;  4MHV A;  2JZB B;  4PHE A;  3V7L A;  4QZ9 A;  2JMG A;  4GXJ A;  3H40 A;  3PY8 A;  5AM2 A;  2G5I B;  4JWN A;  1PK3 A;  5D49 A;  5DGA A;  2ATL A;  2W7O A;  2F44 A;  3PSP A;  3QE9 Y;  9ICR A;  4JK1 A;  2G09 A;  1J2M A;  3RH6 A;  1S76 D;  5ALQ A;  4QWB A;  4GXI A;  3VCB A;  2ISO A;  3EZ5 A;  2W54 A;  1XO0 A;  2BGW A;  2DQN B;  2K4E A;  3IM1 A;  1DK2 A;  2HSZ A;  5KG4 A;  3SZ2 A;  1JAL A;  4RPZ A;  2PFO A;  2LYA A;  4I28 A;  9ICN A;  2R8G A;  5J2F A;  1J97 A;  2ODG A;  2BDP A;  3V6K A;  2M9N A;  3M6K A;  5CJ7 A;  4F5N A;  5AI4 A;  2W9M A;  1ZQW A;  3LVV A;  1OW5 A;  1DK3 A;  1TV9 A;  1RQL A;  2HVI A;  4M9G A;  1ZQD A;  2ZTE A;  4YXJ A;  4UB4 A;  4M9L A;  4YP3 A;  4OD0 A;  1ZQ1 C;  1F5S A;  2BDU A;  1SZH A;  2NRT A;  1DGJ A;  4Y2T A;  2DGZ A;  4TUS A;  2ZIV A;  3TAD C;  4GXK A;  4FE3 A;  1WUD A;  1FEZ A;  4AYB C;  4F4K A;  3RBD A;  3GV8 B;  1ZQB A;  3WK8 A;  3WK9 A;  4QZI A;  2HHT A;  2FMS A;  3NAS A;  4PZN A;  5ALP A;  4Y2P A;  4ED7 A;  2KVC A;  5AM0 A;  1UPH A;  2BPC A;  4DOC A;  4GC7 A;  5AK5 A;  2YMP A;  3PV8 A;  2W9A A;  1SKW A;  7ICQ A;  2C2R A;  1KTQ A;  4UBB A;  4CE6 A;  4ED2 A;  1RQN A;  1ZD4 A;  5KT7 A;  2FMQ A;  1IM4 A;  1L3T A;  4C4S A;  4ELT A;  4J9N A;  1A76 A;  3RB6 A;  2ISP A;  3ZD9 A;  4PHD A;  1U48 A;  1UT5 A;  2IOF K;  5CA7 A;  4QIW C;  4C8K A;  1QQ7 A;  4DLE A;  4QNL A;  3JPS A;  2H3I A;  5DQH A;  3T3F A;  1T4G A;  1MQ3 A;  4AYB F;  1ZQJ A;  4OCZ A;  4O5C A;  2Y1J A;  1PVQ A;  5G5H A;  1AQ6 A;  4LVS A;  2H3V A;  8ICI A;  3RH4 A;  4QZE A;  3Q8L A;  2RQ5 A;  1SXE A;  7ICP A;  3AEV A;  2VA3 A;  3JPQ A;  4F4Y A;  3KFU F;  4YFK A;  5IIL A;  3B9J A;  4ED3 A;  2BCS A;  3MFI A;  5JU5 A;  2PI5 A;  4OO1 J;  2GLE A;  5HML A;  1KKX A;  4M9J A;  5KG7 A;  3TAP A;  1V85 A;  4P4O A;  2WAQ F;  2EDU A;  2BHN A;  5EOZ A;  3PR5 B;  5ALE A;  3C2K A;  1RPL A;  5ALK A;  4QJF B;  2MSN A;  7ICI A;  2NV3 A;  2QLT A;  5IIO A;  5AKI A;  3CP8 A;  2XVT A;  3RAQ A;  4C4T A;  8ICZ A;  5IIM A;  4DSE A;  3SYZ A;  2EQY A;  2D6F C;  4KX5 A;  2RHF A;  4IS7 A;  3UMC A;  4QZC A;  3I76 A;  4PJ0 U;  1ZD2 P;  4M0A A;  3S6J A;  4B9N A;  3RJK A;  4ZH4 A;  3ETL A;  4DOB A;  4J9S A;  1VJ5 A;  7ICJ A;  2MRL A;  4DQP A;  5ALF A;  2KP7 A;  2V4Q A;  5ALT A;  2BQ3 A;  2KK0 A;  4DFP A;  3AN1 A;  1D8B A;  1ECW A;  4O3M A;  2KFZ A;  3D2Q A;  5KFB A;  5HNK A;  3IRU A;  5ALR A;  2KIC A;  3AUO A;  4EYH B;  1HUO A;  2DKZ A;  1S0O A;  3FYH A;  1D9D A;  5J0W A;  2QAR B;  3ZDD A;  4EEN A;  3F53 A;  1KEJ A;  3BS5 B;  1ZXI A;  5L1I A;  2DKX A;  2KHV A;  2G07 A;  4DCC A;  4Z6C A;  1X40 A;  1ZQL A;  2YTU A;  2MUT A;  2ZTD A;  3HIL A;  5AKK A;  1ZQR A;  4IRC A;  2WFA A;  2W3R A;  3RB4 A;  2KJ8 A;  4TUP A;  3ICX A;  1SKR A;  3C23 A;  2VA8 A;  4UB5 A;  1ZQH A;  3GII A;  1JRP A;  2HHQ A;  3EPI A;  1ARO P;  7ICT A;  2K4P A;  3E0F A;  4CF4 A;  5J2I A;  4JV0 A;  4Y2X A;  4RQM A;  5J0P A;  7ICL A;  2AQ0 A;  3V6H A;  2W8K A;  3BDP A;  4DS5 A;  3N28 A;  3TAC B;  5AI6 A;  4F3O A;  4CRX A;  3MR6 A;  4J9R A;  2VAN A;  3PR4 A;  2IHN A;  2HBK A;  2OHF A;  1U47 A;  4CCH A;  4OJ5 A;  4ECV A;  5DB9 A;  4EZ9 A;  1X9W A;  4BX9 C;  3UMG A; 
#chains in the Genus database with same CATH homology
 1F0M A;  2EAN A;  1PK1 A;  5JTI A;  2D3D A;  2QB0 A;  1SV0 C;  3H8M A;  2QKQ A;  2ESE A;  2KIV A;  2E8P A;  1KW4 A;  1X9X A;  2B6G A;  2EAP A;  1SV4 A;  4MHV A;  1LKY B;  2KSO B;  2KMD A;  2QB1 A;  1JI7 A;  1X66 A;  1B0X A;  4PZO A;  1PK3 A;  2KG5 A;  2F8K A;  2E8M A;  5KNI A;  2DKZ A;  2F44 A;  2QAR B;  3BQ7 A;  2LPE A;  3BS5 B;  1WWV A;  1SXD A;  2DKX A;  1LKY A;  2KSO A;  2D8C A;  5J8Y A;  2LMR A;  1RG6 A;  1X40 A;  2EAO A;  2YTU A;  3HIL A;  2Y9T A;  3TAD A;  3SEI A;  3K1R B;  3BS7 A;  2QAR A;  3BS5 A;  3SEN A;  1UQV A;  4NL9 A;  1SXE A;  2E8N A;  3KKA A;  2KE7 A;  4RQN A;  1OW5 A;  1SV0 A;  5JU5 A;  2GLE A;  2K4P A;  1OXJ A;  1V38 A;  2E8O A;  4RQM A;  4NL9 C;  2ES6 A;  1V85 A;  2JV3 A;  5L1M A;  5J8Y C;  5F3X B;  1COK A;  1UCV A;  3TAC B;  2DL0 A;  2K60 A;  1PK1 B;  1Z1V A;  3TAD C;  2F3N A;  2QB0 B;  4NJ8 A;  2EAM A;  1WWU A;  2L5Y A;  2FE9 A;  2Y9U A;  1SGG A;  3IDW A;  4IS7 A;  4PZN A;  1DXS A;  5JRT A;  1B4F A;  3KKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...