2GLEA

Solution structure of neurabin sam domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
GHMVHEWSVQQVSHWLVGLSLDQYVSEFSAQNISGEQLLQLDGNKLKALGMTSSQDRALVKKKLKEMKMSLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the neurabin SAM domain
rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Neurabin-1
total genus 20
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2gleA00
3SENA 2JV3A 2QKQA 2Y9TA 1X40A 2QB0B 2B6GA 1V38A 1PK1B 5J8YA 3KKAA 4NL9C 3TACB 2KIVA 2DKZA 1RG6A 2QB0A 1WWUA 4RQNA 2F44A 1KW4A 2KG5A 1LKYA 1PK3A 3KKAC 4NJ8A 1DXSA 2Y9UA 2KSOB 1UCVA 3BS5B 2QARA 2F3NA 4PZNA 2DL0A 2KMDA 2KSOA 3BS5A 1B4FA 3IDWA 2QARB 1COKA 1PK1A 4NL9A 1X9XA 1X66A 2L5YA 2FE9A 2E8PA 1SXDA 1SV0A 2KE7A 4MHVA 1LKYB 2E8NA 2GLEA 1OW5A 3BS7A 2LMRA 1WWVA 4RQMA 1F0MA 2ESEA 1OXJA 1SV0C 4IS7A 1B0XA 1V85A 1JI7A 5JTIA 2D3DA 2E8OA 1Z1VA 1SV4A 5L1MA 2K60A 2LPEA 5JU5A 5KNIA 2E8MA 3K1RB 3TADC 2K4PA 2DKXA 2YTUA 3SEIA 1SGGA 2F8KA 5JRTA 3H8MA 1SXEA 1UQVA 5F3XB 2EAOA 3BQ7A 3HILA 2QB1A 5J8YC 2EANA 2ES6A 2EAPA 3TADA 2D8CA 4PZOA 2EAMA
chains in the Genus database with same CATH superfamily
2RDIA 4DS4A 3ZDEA 2IHNA 1ZQAA 7ICJA 2KNJA 1ZQZA 2DUYA 1V38A 1Z3EB 4PHEA 3SZ2A 2JEFA 1L8OA 3ISBA 1LV5A 1ZQQA 3GIIA 5HP4A 1QTMA 2W43A 3FAHA 5KG6A 3SYZA 2KIWA 2BCSA 1DGSA 1UA0A 4DQIA 4YR0A 2WB1C 3EYZA 3UXOA 4ED1A 7ICTA 3NVZA 2Y9UA 2FI1A 3BS5B 5KT2A 2LHTA 5EE9A 4RQ7A 1ZOLA 3UXNA 2KN7A 8ICJA 5DQGA 3C21A 2AGOA 2DBYA 3IDWA 1ZJMA 1JROA 5AM2A 1RQLA 3QUTA 2BPGA 3BQ0A 4CF3A 2YX8A 2ASDA 2DF4B 3TANA 3ZDBA 8ICXA 3Q8QB 2KICA 2W7OA 3PO4A 2H3IA 1LKYB 9ICJA 5ALGA 1SL1A 7ICKA 5KG5A 1M6YA 2NV3A 1WYGA 1JXEA 1XWLA 2BQRA 2K60A 2HOIA 5TISU 3BJYA 5CEHA 5KG7A 2E5SA 3SEIA 1RPLA 1ECWA 1L7MA 2JH1A 3M1YA 4KN4A 5ALWA 2OH2A 4KLOA 3N7SC 4NY8A 5HHHA 1ZQJA 5KFDA 2AGPA 1PVQA 3ZD8A 2W55A 2EAPA 2K89A 4YFKA 4OD0A 4KLMA 2CN1A 2E3TA 1N5XA 1QQ7A 4O3SA 3Q8RB 2W04A 5KFOA 4DL2A 7ICVA 4YMNA 4QZEA 1U47A 1SZPA 3MFHA 3SV4A 4EZ6A 4JUZA 4EZ9A 1WG8A 3JPOA 3IG8A 1RYRA 2YB4A 5C0YA 2KD1A 5CJ7A 1ZQYA 4U7CA 3C2KA 1RG6A 5EE3A 9ICEA 4KLDA 2LYBA 4ECRA 2W9AA 2J6UA 5AI8A 4QWAA 5L9XA 5J0WA 3DDHA 4YXMA 1S9FA 3JPQA 2KMDA 1NNLA 1NK0A 3SV3A 4RNMA 2HBMA 1KL9A 5KG4A 3MC1A 4IC9A 3GU3A 2R8HA 5AK6A 3IRUA 3Q8LA 2ZUCA 5AI5A 3RB4A 4PL2A 5J2FA 4I2FA 2FLLA 5KFEA 1L7NA 3SD7A 5J2AA 3D6JA 2E8NA 4C4SA 2MSNA 1WCLA 1U9LA 2VKQA 5J0SA 4O3OA 3EPIA 1XO0A 2Q0ZX 1LB2B 1NKCA 4IS7A 5J2BA 2H3ZA 5KTQA 4DS5A 3ZDDA 8ICCA 2JR5A 3HRDD 4RQ0A 1SL2A 2K8CB 4TQSA 2R8IA 4Z6FA 3NRZA 2ZIXB 2EZYA 1C20A 3RBEA 5J2CA 3IG5A 4UB1A 3SI8A 5IILA 1RXVA 5F3XB 2DFLA 2CPRA 2WFAA 2G5IB 7ICEA 4FS1A 2EZZA 5J0XA 2EAMA 1ZQRA 2BDUA 5AIBA 2R8JA 4NLGA 3PY8A 4R63A 3F5AA 4ECXA 1HUZA 2DPIA 4M6WB 1JN3A 1ZQDA 3V6JA 5KFSA 3ISCA 3N4MB 1XSPA 1BPZA 2H3VA 3LDAA 3FM9A 3QU5A 4KITB 1LKYA 4DL5A 2YMMA 4Y2SA 2MUTB 4O3RA 4Z6CA 1FFVA 1IV8A 4QZ8A 1TV9A 4TUPA 1COKA 5DGBA 2KJ8A 5AKXA 1YT3A 5ALXA 3FC4A 5ALVA 4F5QA 4Y2VA 3KHRA 1Q3VA 1DK3A 9ICKA 5HMLA 4YQWA 4C4RA 3JPTA 4DWIA 4I2HA 9ICNA 4BJQA 1ZQMA 4DL4A 1QSLA 4O3MA 4YMMA 3WK6A 2ZTCA 4M9HA 4DOBA 3F53A 5KFMA 1SV0C 2K4HA 3RJFA 4O5EA 3LVWA 1IM4A 2I9GA 4PPXA 3MDAA 2HVIA 3AUOA 9ICXA 4USAA 3D2NA 4UB6U 3G6XA 2YTUA 5KFXA 2LM1A 3RJJA 1K1QA 1KQQA 1UQVA 4P0QA 3C1ZA 2ZUBA 4UAUA 5CRXA 4DQSA 3K75D 1KDHA 2UVUA 4KLUA 3C5GA 3H8WA 2KFZA 5KFFA 1PVPA 4PL1A 4ED6A 4QWBA 2JV3A 1XS9D 4KTQA 1S97A 5J2EA 3RH6A 3QU9A 4F72A 3LYSA 3M6KA 2ZIWA 3PO5A 3T79A 3GILA 2NRXA 4JWNA 2P35A 2PKEA 2QB0A 4UB2A 1Q46A 4JV0A 2RRDA 3ONNA 7ICRA 2MUTA 4FE3A 4RPXA 4C8LA 2VJ4A 5AKKA 4GXIA 2F3NA 3H0RB 9ICAA 4F8RA 1XO1A 1ZQTA 1VDVA 3M7DA 5HR7A 5DLGA 3IV6A 1NJYA 2WB1F 3TFSA 5BPCA 5AKZA 1BPEA 5KFZA 1BPXA 3FDSA 4QZFA 2ODGA 1ED1A 4QWEA 2XI9A 4QW8A 3HKZC 5KFHA 3BS7A 2K4IA 4NLNA 1N61A 2LMRA 1WWVA 2PFOA 4B9LA 1L3TA 3AN1A 4NM2A 1Y88A 1ZXIA 3NVYA 1X6JA 5L1MA 5E79U 2Y1IA 2W11A 5D49A 3MR2A 4M6WA 1BGXT 4EBCA 4DO9A 1SKRA 5DDMA 3WKBA 4XRHA 3AU2A 3M6ZA 4AYBC 1S77D 4PZOA 2ZIXA 2LKYA 3RB6A 3PSIA 2PI5A 9ICVA 2QKQA 1T3NA 4UBCA 4AP9A 2KOBA 4IRCA 5KFYA 5KG0A 3Q8KA 2JEJA 5CWRA 3C23A 3PNCA 3H4BA 4JWMA 3PMNA 1AQ6A 2KIVA 8ICPA 4F4ZA 1ZRNA 3V7LA 2NO5A 2BPFA 3T3FA 2I5HA 1KW4A 1B22A 2XVTA 2WF9A 5CP2A 5FP0A 2NRWA 3RAQA 4O0IA 1S0VA 5AI4A 1NI3A 4Y2QA 4C8NA 2G5HB 4F5PA 2HHVA 4BWJA 2AH5A 1BNOA 5B66U 3G6YA 1XSNA 2NYVA 8ICQA 3GIKA 3QNMA 4UB8U 2PFPA 3RJKA 9ICRA 2FMQA 2KHQA 3V6HA 3RH4A 4F2RA 1S0MA 1IIPA 3RBDA 3NUQA 1U4BA 5T14A 2JHDA 3OSPA 4EX6A 2E8MA 2IOFA 1NK7A 1SL0A 5F9NA 4P4OA 3OGUA 2Y0SC 3PR4A 4ELTA 1BPBA 2F1JA 1ZQHA 2KP7A 2UVVA 2AU0A 4C8KA 8ICFA 3ZDAA 2JXJA 1J97A 3I76A 4J9KA 3B0XA 1U45A 2FLPA 2IBKA 5IINA 3GZFA 5KFBA 4P2HA 5DDYA 3IHQB 2RLTA 3NASA 3ZD9A 4QWDA 3OJUA 3E2EA 2PFQA 5ALKA 4QW9A 2BQUA 4KLTA 2FMPA 1FFUA 3QZ8A 3BQ2A 3NGDA 2A3VA 8ICSA 2EH9A 3WKCA 3A0BU 2FDRA 3V7KA 4KLQA 2MAXA 1D9DA 5AK5A 5AM5A 4NJ8A 2KTQA 2VIXA 1UCVA 2J6SA 4I2IA 3U26A 5KAFU 4C8MA 2XY7A 2JRZA 3KHLA 3F2DA 1AROP 4XA5A 3HKZF 1X42A 4B9MA 1YZ6A 3VCBA 5J2GA 1SB3C 2GH1A 2BCRA 4I2EA 4FBTA 7ICSA 9ICFA 4ECVA 5AM4A 3KD3A 1K5OA 2PMZF 4G9BA 1C7YA 7ICHA 4JMUA 4GC6A 4XQ8A 3N7PD 8ICLA 3OHAA 5EOZA 1O08A 1OW5A 2IA6A 1MSWD 2RP5A 1CUKA 5AKJA 3RJGA 5IIIA 4RQMA 2HBKA 4U6PA 1D8BA 3QEAZ 1NK5A 2KHVA 5HMMA 4IQWA 8ICWA 2LPEA 4Z6EA 5KNIA 3TADC 3UMCA 8ICVA 3QZ7A 1TAMA 2F8KA 4ECZA 2MA1A 3JPNA 1HEKA 2KKPA 4QZGA 3NTUA 4BDPA 4DQQA 5JUMA 3LWLA 4Q44A 2ZTEA 1QQ6A 2G07A 2HBLA 3PW0A 2HMXA 3SENA 5J0OA 4DLEA 4DCCA 4WJ3B 1X40A 4IR1A 2B6GA 1A76A 3WKAA 5J8YA 8ICOA 3QU2A 5AKGA 3HW8A 3PW4A 3QE9Y 4QZ9A 4EEYA 5AM0A 5IIOA 2JZBB 4RPZA 2VJ5A 4Y2TA 3TARA 4JV1A 3JPSA 4PGYA 5ALNA 4F4XA 4RNNA 4P4MA 4KLSA 2KFNA 5J0TA 1BPYA 4C0ZA 3ALRA 4DL3A 3CP8A 4B9NA 5KFWA 4RQ1A 2RQ5A 8ICIA 2XGQA 2YQEA 3JPRA 1PK1A 3WK4A 4NL9A 1ZQXA 5J0PA 1Q8KA 3R9KA 2JH7A 4FFDA 4KLJA 1GO3F 4ELUA 3RR8A 4JV2A 2AHOB 4E0DA 5AICA 4M9LA 3B0YA 1L3VA 3OHBA 1ZD5A 5ALTA 1F0MA 1OXJA 4YR2A 4US9A 5AKLA 8ICNA 3OTQA 3HP6A 5AKEA 5ALJA 1NJXA 3AMZA 4IRKA 1NZBA 5ALQA 3RAXA 1ZQUA 2W3SA 3K1ZA 4YP3A 2BQ3A 3I1YA 3EZ5A 2ASJA 4EYHB 3GV7B 2BZFA 4FO6A 5H2FU 2Q4TA 3K4GA 4DSIA 4KLLA 4NLKA 3C28A 5J2IA 3TI0A 3ETLA 3IN5A 2W8LA 5KFCA 3IP4B 1N63A 5ALMA 3KZIU 1TFRA 1XU4A 4F91B 4EBDA 2VANA 3AQFA 4QJFB 4LZDA 3RH5A 2R8KA 4I2GA 3AEVA 2FLNA 5J29A 5CA7A 3T5KA 4PHDA 1PK3A 1QSSA 1N48A 3AM9A 8ICYA 2GOLA 4LVSA 5DBAA 1DXSA 1KEJA 1LVHA 4Y2YA 1SKWA 4M2YA 2KK0A 3PSTA 4FZMA 3V7JA 2F1IA 2FPKA 3SQIA 3PSFA 4ED0A 3BS5A 4QZBA 4YXJA 5AKIA 2NRVA 3ETRA 3EWAA 1U48A 3CYMA 4DL7A 1SXDA 3QXGA 1Z00A 2F2AB 4UAYA 4EYIB 4I28A 4MHVA 4Y2XA 1UHUA 4P0PB 3GV8B 4O3PA 2WAQC 1KN5A 3BQ1A 4LZGA 4QWCA 1RXWA 1EXNA 3RB0A 2Z7JA 4ED3A 3KHGA 1UT8A 4ICAA 1V85A 1NK8A 5A0LA 4K4HA 4J9RA 5AIAA 2F8LA 4ED8A 4KLHA 3SMVA 2YMPA 9ICCA 4A8EA 5JRTA 2WTFA 2BPCA 5KFJA 2ASLA 2EAOA 5DLFA 3T5LA 2ZUDA 4EENA 3WKDA 4P4PA 2MU2A 5IIMA 1TK8A 2PMZC 2FPLA 2ZJAA 5KT5A 3CRXA 3BZCA 1ZYQA 4C80A 5L1IA 4CGZA 1TK5A 2HSZA 4BXOA 3F2BA 1PK1B 3QUBA 5ALHA 2I6XA 5ALFA 2W7PA 3PW5A 4KMOB 4C7ZA 4Q8FA 3T5HA 4F4KA 4I27A 5AI9A 4RU9A 4IQUA 5EE1A 3HWTA 4B6JA 4US8A 5EWEA 1ZJNA 2EDUA 3DEEA 4MF2A 2KSOB 4G3IA 3M9NB 3DV9A 3E0FA 2QARA 1KSPA 4F71A 1VLBA 1COOA 4PZNA 4RUAA 4BGDA 2LM4A 1DOQA 4M9GA 2KJ5A 4BUGA 3RJIA 1D9FA 7ICIA 1H38A 1QSYA 1ZQNA 5ALIA 4GFJA 3PR5B 3UPQA 3ED5A 4FS2A 7ICGA 3AL0B 3WU2U 5CR0A 2E8PA 1X2IA 1SV0A 3RJEA 5AHXA 3G6VA 1BVSA 3PVXA 2W9CA 2JEIA 9ICOA 2GLEA 2XGPA 2PXIA 4Z6DA 2KZ3A 4P0PA 2RDJA 1N62A 3V6KA 2OEHA 5DG8A 1JI7A 2E8OA 4FZNA 4J9NA 4M9JA 1X9SA 2IOHA 4ECUA 3C5FA 8ICUA 1L8LA 4PGQA 1X9WA 4C8OA 4FZLA 2C2EA 7ICQA 2P6UA 4MEXA 4F92B 4M04A 2V4QA 1S76D 4B9UA 2QB1A 4J9SA 1BNPA 4DL6A 1V9PA 3WK5A 5KT4A 4TQRA 2HHQA 5KFGA 4EEKA 1FIQA 2KZMA 3TAQA 4DSEA 4KLGA 2V4RA 1Z4NA 4QZHA 4F5NA 3D2SA 7ICUA 5HHIA 4DFDA 2A1JA 4BXOB 4IL6U 4IR9A 5KFPA 1ZQCA 4F2SA 2K8BB 4RQNA 2H5XA 1MQ3A 1A77A 5AM3A 1K1SA 3H7IA 4Y2RA 1NKEA 1HIWA 3VC8A 2BCQA 1KKXA 3D2QA 4K4GA 3M9OB 3PW7A 2PFNA 2RHFA 3MR5A 2BCVA 2DGZA 1JUDA 1B4FA 2M9NA 3Q8MA 3E58A 1DRGA 3TFRA 1ZQ1C 2W9CB 4PJ0U 4O9MA 3BZKA 4RT3A 4YCXA 4KX3A 5J2DA 3GQCA 2IMWP 4PGXA 4TURA 1TK0A 4QZDA 2B0CA 1RQNA 1CEZA 3GDXA 2HHUA 1QH9A 2C22A 4QZCA 1Z00B 2C2RA 1Z4OA 3MR6A 5AKHA 4NXZA 3OJSA 2BR0A 3V72A 4FBUA 3ICXA 3MABA 3QX7A 3M9MB 3T5JA 2JGAA 4Y2PA 3C29A 1X9MA 4PHPA 2ZTDA 1HJPA 2R18A 1L7PA 4IQVA 5DQIA 4QZAA 3UMGA 1XSLA 2YMQA 4DQPA 8ICAA 7ICNA 2WHEA 4RUCA 3PSPA 3KTQA 5IIJA 1TE2A 1PUZA 1SWVA 2Y9TA 2A1JB 2BKEA 4F50A 7ICOA 4J9OA 1JX4A 3KKAA 4HYKA 4NL9C 4XUSA 5L1JA 1T3QA 4O3QA 2W3RA 2KEYA 1L3SA 4JB3A 3MR3A 2F77X 4LJXA 4O3NA 5L1LA 3TKAA 1IG6A 3O0FA 2F44A 2DPJA 1D8YA 5J0YA 2G0AA 2ZIUA 4C7YA 2VA8A 1NJWA 4DOCA 2HHXA 4I2AA 5KT6A 1ZQIA 4MEYA 5J0RA 2DQNB 1KFDA 4OJPA 2ZIVA 2EQYA 1UA1A 4O5CA 2H3QA 5KFTA 2Y1JA 3B9JA 2AQ4A 2F1HA 4BWMA 4DF4A 1KRPA 3BDPA 1KBUA 1URJA 4UARA 3KBBA 1N56A 5JTIA 1Z1VA 5JU5A 1Q3UA 1RDFA 4NLCA 4OJLA 3JPPA 4HAIA 1N2XA 4F4WA 4I2DA 1ZQGA 4KLIA 1P7DA 2W03A 3SAHA 3OPXA 3Q8SB 4RQ5A 1CI4A 2HW3A 9ICWA 5KFNA 2EZXA 2A1AA 4MFFA 8ICRA 2A19A 2FPMA 2M0NA 4O5KA 4J9QA 2XICA 1NZPA 2FJ6A 1S0NA 5ALZA 1UT5A 5B5EU 2ZIWB 2KVCA 2IHMA 2UVWA 2XCAA 7ICFA 3IM1A 3HPOA 4C4TA 4UATA 3AQEA 2BCUA 3SR6A 1ZQLA 2XY5A 1MQ2A 9ICUA 3QUCA 2E1EA 5KFQA 1WCNA 3M8RA 2OM6A 1CRXA 2OWOA 7ICPA 2WAQF 3TQ1A 2KG5A 4Q43A 2JEGA 4B9SA 1JALA 4UB4A 5EWFA 2K4EA 2G09A 1RM6C 5DB6A 3PV8A 1T4GA 2F76X 2OYYA 3C1YA 4M9NA 1N60A 5J2JA 9ICPA 5KFUA 3SAGA 5KFAA 1ZQFA 2PI4A 2AJQA 2FE9A 2ZXHA 4RT2A 3H8SA 1S5LU 1BPDA 2N1RA 2WF8A 4NLBA 3N97B 5ALDA 1MA7A 4M47A 4MF8A 4QIWC 4DSKA 3HJEA 5ALRA 4R8UB 5D46A 4Q45A 1U49A 3UM9A 1A0PA 4OCZA 1T8EA 5K4LA 2XC9A 1SV4A 5ALEA 4UBBA 9ICLA 3MGVA 2K4PA 1NK6A 1SGGA 3UMBA 1N5WA 2WF7A 4ELVA 3UQ2A 1SZHA 4GIBA 4OJ6A 1T94A 5KG2A 1J2MA 3H40A 5J8YC 2ES6A 2ZIUB 3TAPA 4UB5A 2FMSA 4YD2A 4UW9A 4GC7A 4ECSA 2BGWA 4IRDA 9ICIA 4RQ3A 1ZETA 3NS1A 4OJOA 4NWIA 4F3OA 5F9LA 1RZTA 3CW2C 9ICGA 1PZNA 3C2LA 3TACB 5KT3A 2ZIVB 4I2CA 4ECWA 3WK7A 4AYBF 2YMLA 1WWUA 4DSFA 3RJHA 4PHAA 4J03A 5AM1A 1DK2A 1S0OA 2WF6A 3KKAC 2HOQA 2H3FA 3FYHA 1HUOA 2VA3A 5J2KA 4CCHA 4ACOA 4RZRA 2DL0A 4J9PA 2HVHA 4ECTA 5AI6A 3F5EA 1F44A 2HDOA 4K4IA 2NO4A 3KHHA 4ECQA 4GXJA 1MN8A 2JMGA 5HR6A 5HNKA 4B9VA 2L5YA 3RRHA 1TAQA 3C2MA 4ED7A 9ICTA 4UQGA 2C2DA 1VJ5A 3RR7A 3A0HU 2KE7A 1RYUA 5J0UA 3MBYA 2QLTA 1RYSA 2IOFK 3Q8PB 1O03A 9ICHA 2ZXIA 5GTHU 4ED2A 3L3FX 7ICMA 3RB3A 4DSLA 7ICLA 1KFTA 3N7RC 5AK4A 2D3DA 1SKSA 2HCFA 3PW2A 3LVVA 5J0QA 2HHWA 4CF4A 1ZQVA 1ZD3A 4YG2A 5G5HA 4RQ4A 3L5KA 2HI0A 2CRXA 5EE0A 1NK4A 4QZIA 2YY6A 3BQ7A 2EANA 3GIMA 3EUB2 4CRXA 3EPGA 2D8CA 3KZXA 4KMUA 2HHSA 8ICHA 2WF5A 4RQ2A 4ZH4A 2J6TA 2LYHA 4KLFA 5BOMA 5KAIU 4F5RA 3QU7A 2K8AA 5KT7A 5DG9A 2OHFA 2W9MA 4J9MA 1ZRMA 5KG3A 3MFIA 1QCKA 3MGIA 4DFKA 5BOLA 4DLGA 3I28A 4YD1A 3PMLA 2P6RA 2JZBA 2GO7A 4ZOHC 4R8UA 1ZQEA 3ORYA 2DWQA 4F93B 1V97A 2OXOA 4QIWF 4DEZA 4UAZA 2GWSA 8ICBA 2XIDA 2XY6A 1X66A 1MC8A 4JK1A 4CNQA 4GXKA 5AK3A 4J9LA 3RRGA 5DGAA 2ISOA 4DF8A 2HBJA 4B9TA 2P66A 1L3UA 1QLNA 1YZ7A 5KFRA 3UQ0A 2D6FC 3N28A 4RNOA 4CF5A 1F5SA 2W8KA 8ICKA 2ESEA 2HHTA 1DGJA 4DOAA 3H8JA 3KOOA 3M8SA 3GFKB 4P0QB 1D8LA 2G06A 5ALUA 1JIHA 4CDGA 5DBBA 5DB8A 4R64A 3NVWA 4DQRA 4I2JA 4OJ5A 4F4YA 2YN4A 3H0MB 1WUDA 5IIKA 1JMSA 1S8OA 1NOMA 4PH5A 1ZQPA 1T7PA 3LWMA 4UASA 4YVZA 3WK8A 3HILA 3UXPA 1Z19A 2R8GA 1SWWA 3PX0A 3EW9A 3PX4A 2W54A 1JXLA 4MFAA 5KL8B 3BQTA 4R65A 5GTIU 3SAFA 2QB0B 5DKWA 5DQHA 1PVRA 2V9WA 1TAUA 2ZG6A 2LI6A 3RF9A 5C5JA 8ICGA 2KV2A 1J2NA 3QU4A 4EELA 4M0AA 2O6KA 2BDPA 1KTQA 2OCEA 2KKVA 4IQTA 4RPYA 2XO7A 3J81j 4I29A 5DG7A 5ALSA 1SIJA 1KLNA 4KLEA 5ALLA 3ZDCA 4YR3A 3KFUF 2ISPA 5KFIA 3QYPA 4UAVA 5D4BA 1A6SA 3RTVA 4DSJA 1ZQSA 3L4PA 4DFMA 5AI0A 4Y2JA 4X5VA 4I2BA 3WKEA 3HT3A 1Z1BA 2ZJ5A 2MRLA 4MFCA 2NRZA 1NK9A 1L7OA 1IXRA 5KFVA 4GLXA 2ALZA 1FO4A 9ICSA 2AXTU 5KFKA 2W9BA 5L1KA 3K1RB 9ICBA 1X6IA 2DKXA 1S10A 4UAWA 4Q8EA 3WK9A 1SXEA 3ISDA 9ICMA 4UB3A 9ICQA 1OUQA 1ZQBA 3MDCA 5DBCA 5EWGA 1ZQOA 2LYAA 5KL1B 4RQ8A 3S6JA 4DFJA 3LK9A 1ZD2P 4BX9C 2G08A 2ZJ8A 1B43A 4Y2UA 4EBEA 4NM1A 8ICTA 4YN4A 1TVAA 2DKZA 1UPHA 2NRTA 4CE6A 8ICEA 3H0LB 1KFSA 1FEZA 3NVVA 3THVA 4DFPA 2UVRA 3QUQA 5ALOA 3RFAA 5CHGA 2VA2A 1XC9A 4KN7A 1NJZA 3MGHA 3AU6A 1L5UA 2ATLA 2KZZA 2KSOA 3H4DA 3GIJA 1L6NA 2QARB 5DB9A 8ICMA 1NKBA 2Y0SF 4OO1J 1ZD4A 1X9XA 1ZQWA 4RQ6A 3ZI4A 4ECYA 5KG1A 1ZQKA 4QNLA 5TZVA 5ALYA 5G5GA 3NRWA 4KX5A 4EX7A 2AQ0A 4R66A 1JRPA 4TUSA 2E1FA 3F2CA 2AGQA 5ALPA 3PX6A 8ICZA 2XCPA 1B0XA 1TKDA 3OSNA 2KJ9A 2I1QA 2B21A 5AKYA 5CB1A 2KVSA 4NV0A 4NLZA 2C28A 3QEBZ 2LBOA 4YMOA 3HX0A 2W9BB 1QQ5A 3H8MA 5DB7A 4TUQA 4F5OA 3CNHA 3GV5B 2CXYA 5KFLA 3PZPA 1XNSA 2BHNA 3TADA 2YB1A 5J2HA 2HOFA
chains in the Genus database with same CATH topology
3SENA 2JV3A 2QKQA 2Y9TA 1X40A 2QB0B 2B6GA 1V38A 1PK1B 5J8YA 3KKAA 4NL9C 3TACB 2KIVA 2DKZA 1RG6A 2QB0A 1WWUA 4RQNA 2F44A 1KW4A 2KG5A 1LKYA 1PK3A 3KKAC 4NJ8A 1DXSA 2Y9UA 2KSOB 1UCVA 3BS5B 2QARA 2F3NA 4PZNA 2DL0A 2KMDA 2KSOA 3BS5A 1B4FA 3IDWA 2QARB 1COKA 1PK1A 4NL9A 1X9XA 1X66A 2L5YA 2FE9A 2E8PA 1SXDA 1SV0A 2KE7A 4MHVA 1LKYB 2E8NA 2GLEA 1OW5A 3BS7A 2LMRA 1WWVA 4RQMA 1F0MA 2ESEA 1OXJA 1SV0C 4IS7A 1B0XA 1V85A 1JI7A 5JTIA 2D3DA 2E8OA 1Z1VA 1SV4A 5L1MA 2K60A 2LPEA 5JU5A 5KNIA 2E8MA 3K1RB 3TADC 2K4PA 2DKXA 2YTUA 3SEIA 1SGGA 2F8KA 5JRTA 3H8MA 1SXEA 1UQVA 5F3XB 2EAOA 3BQ7A 3HILA 2QB1A 5J8YC 2EANA 2ES6A 2EAPA 3TADA 2D8CA 4PZOA 2EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEN A;  2JV3 A;  2QKQ A;  2Y9T A;  1X40 A;  2QB0 B;  2B6G A;  1V38 A;  1PK1 B;  5J8Y A;  3KKA A;  4NL9 C;  3TAC B;  2KIV A;  2DKZ A;  1RG6 A;  2QB0 A;  1WWU A;  4RQN A;  2F44 A;  1KW4 A;  2KG5 A;  1LKY A;  1PK3 A;  3KKA C;  4NJ8 A;  1DXS A;  2Y9U A;  2KSO B;  1UCV A;  3BS5 B;  2QAR A;  2F3N A;  4PZN A;  2DL0 A;  2KMD A;  2KSO A;  3BS5 A;  1B4F A;  3IDW A;  2QAR B;  1COK A;  1PK1 A;  4NL9 A;  1X9X A;  1X66 A;  2L5Y A;  2FE9 A;  2E8P A;  1SXD A;  1SV0 A;  2KE7 A;  4MHV A;  1LKY B;  2E8N A;  2GLE A;  1OW5 A;  3BS7 A;  2LMR A;  1WWV A;  4RQM A;  1F0M A;  2ESE A;  1OXJ A;  1SV0 C;  4IS7 A;  1B0X A;  1V85 A;  1JI7 A;  5JTI A;  2D3D A;  2E8O A;  1Z1V A;  1SV4 A;  5L1M A;  2K60 A;  2LPE A;  5JU5 A;  5KNI A;  2E8M A;  3K1R B;  3TAD C;  2K4P A;  2DKX A;  2YTU A;  3SEI A;  1SGG A;  2F8K A;  5JRT A;  3H8M A;  1SXE A;  1UQV A;  5F3X B;  2EAO A;  3BQ7 A;  3HIL A;  2QB1 A;  5J8Y C;  2EAN A;  2ES6 A;  2EAP A;  3TAD A;  2D8C A;  4PZO A;  2EAM A; 
#chains in the Genus database with same CATH topology
 2RDI A;  4DS4 A;  3ZDE A;  2IHN A;  1ZQA A;  7ICJ A;  2KNJ A;  1ZQZ A;  2DUY A;  1V38 A;  1Z3E B;  4PHE A;  3SZ2 A;  2JEF A;  1L8O A;  3ISB A;  1LV5 A;  1ZQQ A;  3GII A;  5HP4 A;  1QTM A;  2W43 A;  3FAH A;  5KG6 A;  3SYZ A;  2KIW A;  2BCS A;  1DGS A;  1UA0 A;  4DQI A;  4YR0 A;  2WB1 C;  3EYZ A;  3UXO A;  4ED1 A;  7ICT A;  3NVZ A;  2Y9U A;  2FI1 A;  3BS5 B;  5KT2 A;  2LHT A;  5EE9 A;  4RQ7 A;  1ZOL A;  3UXN A;  2KN7 A;  8ICJ A;  5DQG A;  3C21 A;  2AGO A;  2DBY A;  3IDW A;  1ZJM A;  1JRO A;  5AM2 A;  1RQL A;  3QUT A;  2BPG A;  3BQ0 A;  4CF3 A;  2YX8 A;  2ASD A;  2DF4 B;  3TAN A;  3ZDB A;  8ICX A;  3Q8Q B;  2KIC A;  2W7O A;  3PO4 A;  2H3I A;  1LKY B;  9ICJ A;  5ALG A;  1SL1 A;  7ICK A;  5KG5 A;  1M6Y A;  2NV3 A;  1WYG A;  1JXE A;  1XWL A;  2BQR A;  2K60 A;  2HOI A;  5TIS U;  3BJY A;  5CEH A;  5KG7 A;  2E5S A;  3SEI A;  1RPL A;  1ECW A;  1L7M A;  2JH1 A;  3M1Y A;  4KN4 A;  5ALW A;  2OH2 A;  4KLO A;  3N7S C;  4NY8 A;  5HHH A;  1ZQJ A;  5KFD A;  2AGP A;  1PVQ A;  3ZD8 A;  2W55 A;  2EAP A;  2K89 A;  4YFK A;  4OD0 A;  4KLM A;  2CN1 A;  2E3T A;  1N5X A;  1QQ7 A;  4O3S A;  3Q8R B;  2W04 A;  5KFO A;  4DL2 A;  7ICV A;  4YMN A;  4QZE A;  1U47 A;  1SZP A;  3MFH A;  3SV4 A;  4EZ6 A;  4JUZ A;  4EZ9 A;  1WG8 A;  3JPO A;  3IG8 A;  1RYR A;  2YB4 A;  5C0Y A;  2KD1 A;  5CJ7 A;  1ZQY A;  4U7C A;  3C2K A;  1RG6 A;  5EE3 A;  9ICE A;  4KLD A;  2LYB A;  4ECR A;  2W9A A;  2J6U A;  5AI8 A;  4QWA A;  5L9X A;  5J0W A;  3DDH A;  4YXM A;  1S9F A;  3JPQ A;  2KMD A;  1NNL A;  1NK0 A;  3SV3 A;  4RNM A;  2HBM A;  1KL9 A;  5KG4 A;  3MC1 A;  4IC9 A;  3GU3 A;  2R8H A;  5AK6 A;  3IRU A;  3Q8L A;  2ZUC A;  5AI5 A;  3RB4 A;  4PL2 A;  5J2F A;  4I2F A;  2FLL A;  5KFE A;  1L7N A;  3SD7 A;  5J2A A;  3D6J A;  2E8N A;  4C4S A;  2MSN A;  1WCL A;  1U9L A;  2VKQ A;  5J0S A;  4O3O A;  3EPI A;  1XO0 A;  2Q0Z X;  1LB2 B;  1NKC A;  4IS7 A;  5J2B A;  2H3Z A;  5KTQ A;  4DS5 A;  3ZDD A;  8ICC A;  2JR5 A;  3HRD D;  4RQ0 A;  1SL2 A;  2K8C B;  4TQS A;  2R8I A;  4Z6F A;  3NRZ A;  2ZIX B;  2EZY A;  1C20 A;  3RBE A;  5J2C A;  3IG5 A;  4UB1 A;  3SI8 A;  5IIL A;  1RXV A;  5F3X B;  2DFL A;  2CPR A;  2WFA A;  2G5I B;  7ICE A;  4FS1 A;  2EZZ A;  5J0X A;  2EAM A;  1ZQR A;  2BDU A;  5AIB A;  2R8J A;  4NLG A;  3PY8 A;  4R63 A;  3F5A A;  4ECX A;  1HUZ A;  2DPI A;  4M6W B;  1JN3 A;  1ZQD A;  3V6J A;  5KFS A;  3ISC A;  3N4M B;  1XSP A;  1BPZ A;  2H3V A;  3LDA A;  3FM9 A;  3QU5 A;  4KIT B;  1LKY A;  4DL5 A;  2YMM A;  4Y2S A;  2MUT B;  4O3R A;  4Z6C A;  1FFV A;  1IV8 A;  4QZ8 A;  1TV9 A;  4TUP A;  1COK A;  5DGB A;  2KJ8 A;  5AKX A;  1YT3 A;  5ALX A;  3FC4 A;  5ALV A;  4F5Q A;  4Y2V A;  3KHR A;  1Q3V A;  1DK3 A;  9ICK A;  5HML A;  4YQW A;  4C4R A;  3JPT A;  4DWI A;  4I2H A;  9ICN A;  4BJQ A;  1ZQM A;  4DL4 A;  1QSL A;  4O3M A;  4YMM A;  3WK6 A;  2ZTC A;  4M9H A;  4DOB A;  3F53 A;  5KFM A;  1SV0 C;  2K4H A;  3RJF A;  4O5E A;  3LVW A;  1IM4 A;  2I9G A;  4PPX A;  3MDA A;  2HVI A;  3AUO A;  9ICX A;  4USA A;  3D2N A;  4UB6 U;  3G6X A;  2YTU A;  5KFX A;  2LM1 A;  3RJJ A;  1K1Q A;  1KQQ A;  1UQV A;  4P0Q A;  3C1Z A;  2ZUB A;  4UAU A;  5CRX A;  4DQS A;  3K75 D;  1KDH A;  2UVU A;  4KLU A;  3C5G A;  3H8W A;  2KFZ A;  5KFF A;  1PVP A;  4PL1 A;  4ED6 A;  4QWB A;  2JV3 A;  1XS9 D;  4KTQ A;  1S97 A;  5J2E A;  3RH6 A;  3QU9 A;  4F72 A;  3LYS A;  3M6K A;  2ZIW A;  3PO5 A;  3T79 A;  3GIL A;  2NRX A;  4JWN A;  2P35 A;  2PKE A;  2QB0 A;  4UB2 A;  1Q46 A;  4JV0 A;  2RRD A;  3ONN A;  7ICR A;  2MUT A;  4FE3 A;  4RPX A;  4C8L A;  2VJ4 A;  5AKK A;  4GXI A;  2F3N A;  3H0R B;  9ICA A;  4F8R A;  1XO1 A;  1ZQT A;  1VDV A;  3M7D A;  5HR7 A;  5DLG A;  3IV6 A;  1NJY A;  2WB1 F;  3TFS A;  5BPC A;  5AKZ A;  1BPE A;  5KFZ A;  1BPX A;  3FDS A;  4QZF A;  2ODG A;  1ED1 A;  4QWE A;  2XI9 A;  4QW8 A;  3HKZ C;  5KFH A;  3BS7 A;  2K4I A;  4NLN A;  1N61 A;  2LMR A;  1WWV A;  2PFO A;  4B9L A;  1L3T A;  3AN1 A;  4NM2 A;  1Y88 A;  1ZXI A;  3NVY A;  1X6J A;  5L1M A;  5E79 U;  2Y1I A;  2W11 A;  5D49 A;  3MR2 A;  4M6W A;  1BGX T;  4EBC A;  4DO9 A;  1SKR A;  5DDM A;  3WKB A;  4XRH A;  3AU2 A;  3M6Z A;  4AYB C;  1S77 D;  4PZO A;  2ZIX A;  2LKY A;  3RB6 A;  3PSI A;  2PI5 A;  9ICV A;  2QKQ A;  1T3N A;  4UBC A;  4AP9 A;  2KOB A;  4IRC A;  5KFY A;  5KG0 A;  3Q8K A;  2JEJ A;  5CWR A;  3C23 A;  3PNC A;  3H4B A;  4JWM A;  3PMN A;  1AQ6 A;  2KIV A;  8ICP A;  4F4Z A;  1ZRN A;  3V7L A;  2NO5 A;  2BPF A;  3T3F A;  2I5H A;  1KW4 A;  1B22 A;  2XVT A;  2WF9 A;  5CP2 A;  5FP0 A;  2NRW A;  3RAQ A;  4O0I A;  1S0V A;  5AI4 A;  1NI3 A;  4Y2Q A;  4C8N A;  2G5H B;  4F5P A;  2HHV A;  4BWJ A;  2AH5 A;  1BNO A;  5B66 U;  3G6Y A;  1XSN A;  2NYV A;  8ICQ A;  3GIK A;  3QNM A;  4UB8 U;  2PFP A;  3RJK A;  9ICR A;  2FMQ A;  2KHQ A;  3V6H A;  3RH4 A;  4F2R A;  1S0M A;  1IIP A;  3RBD A;  3NUQ A;  1U4B A;  5T14 A;  2JHD A;  3OSP A;  4EX6 A;  2E8M A;  2IOF A;  1NK7 A;  1SL0 A;  5F9N A;  4P4O A;  3OGU A;  2Y0S C;  3PR4 A;  4ELT A;  1BPB A;  2F1J A;  1ZQH A;  2KP7 A;  2UVV A;  2AU0 A;  4C8K A;  8ICF A;  3ZDA A;  2JXJ A;  1J97 A;  3I76 A;  4J9K A;  3B0X A;  1U45 A;  2FLP A;  2IBK A;  5IIN A;  3GZF A;  5KFB A;  4P2H A;  5DDY A;  3IHQ B;  2RLT A;  3NAS A;  3ZD9 A;  4QWD A;  3OJU A;  3E2E A;  2PFQ A;  5ALK A;  4QW9 A;  2BQU A;  4KLT A;  2FMP A;  1FFU A;  3QZ8 A;  3BQ2 A;  3NGD A;  2A3V A;  8ICS A;  2EH9 A;  3WKC A;  3A0B U;  2FDR A;  3V7K A;  4KLQ A;  2MAX A;  1D9D A;  5AK5 A;  5AM5 A;  4NJ8 A;  2KTQ A;  2VIX A;  1UCV A;  2J6S A;  4I2I A;  3U26 A;  5KAF U;  4C8M A;  2XY7 A;  2JRZ A;  3KHL A;  3F2D A;  1ARO P;  4XA5 A;  3HKZ F;  1X42 A;  4B9M A;  1YZ6 A;  3VCB A;  5J2G A;  1SB3 C;  2GH1 A;  2BCR A;  4I2E A;  4FBT A;  7ICS A;  9ICF A;  4ECV A;  5AM4 A;  3KD3 A;  1K5O A;  2PMZ F;  4G9B A;  1C7Y A;  7ICH A;  4JMU A;  4GC6 A;  4XQ8 A;  3N7P D;  8ICL A;  3OHA A;  5EOZ A;  1O08 A;  1OW5 A;  2IA6 A;  1MSW D;  2RP5 A;  1CUK A;  5AKJ A;  3RJG A;  5III A;  4RQM A;  2HBK A;  4U6P A;  1D8B A;  3QEA Z;  1NK5 A;  2KHV A;  5HMM A;  4IQW A;  8ICW A;  2LPE A;  4Z6E A;  5KNI A;  3TAD C;  3UMC A;  8ICV A;  3QZ7 A;  1TAM A;  2F8K A;  4ECZ A;  2MA1 A;  3JPN A;  1HEK A;  2KKP A;  4QZG A;  3NTU A;  4BDP A;  4DQQ A;  5JUM A;  3LWL A;  4Q44 A;  2ZTE A;  1QQ6 A;  2G07 A;  2HBL A;  3PW0 A;  2HMX A;  3SEN A;  5J0O A;  4DLE A;  4DCC A;  4WJ3 B;  1X40 A;  4IR1 A;  2B6G A;  1A76 A;  3WKA A;  5J8Y A;  8ICO A;  3QU2 A;  5AKG A;  3HW8 A;  3PW4 A;  3QE9 Y;  4QZ9 A;  4EEY A;  5AM0 A;  5IIO A;  2JZB B;  4RPZ A;  2VJ5 A;  4Y2T A;  3TAR A;  4JV1 A;  3JPS A;  4PGY A;  5ALN A;  4F4X A;  4RNN A;  4P4M A;  4KLS A;  2KFN A;  5J0T A;  1BPY A;  4C0Z A;  3ALR A;  4DL3 A;  3CP8 A;  4B9N A;  5KFW A;  4RQ1 A;  2RQ5 A;  8ICI A;  2XGQ A;  2YQE A;  3JPR A;  1PK1 A;  3WK4 A;  4NL9 A;  1ZQX A;  5J0P A;  1Q8K A;  3R9K A;  2JH7 A;  4FFD A;  4KLJ A;  1GO3 F;  4ELU A;  3RR8 A;  4JV2 A;  2AHO B;  4E0D A;  5AIC A;  4M9L A;  3B0Y A;  1L3V A;  3OHB A;  1ZD5 A;  5ALT A;  1F0M A;  1OXJ A;  4YR2 A;  4US9 A;  5AKL A;  8ICN A;  3OTQ A;  3HP6 A;  5AKE A;  5ALJ A;  1NJX A;  3AMZ A;  4IRK A;  1NZB A;  5ALQ A;  3RAX A;  1ZQU A;  2W3S A;  3K1Z A;  4YP3 A;  2BQ3 A;  3I1Y A;  3EZ5 A;  2ASJ A;  4EYH B;  3GV7 B;  2BZF A;  4FO6 A;  5H2F U;  2Q4T A;  3K4G A;  4DSI A;  4KLL A;  4NLK A;  3C28 A;  5J2I A;  3TI0 A;  3ETL A;  3IN5 A;  2W8L A;  5KFC A;  3IP4 B;  1N63 A;  5ALM A;  3KZI U;  1TFR A;  1XU4 A;  4F91 B;  4EBD A;  2VAN A;  3AQF A;  4QJF B;  4LZD A;  3RH5 A;  2R8K A;  4I2G A;  3AEV A;  2FLN A;  5J29 A;  5CA7 A;  3T5K A;  4PHD A;  1PK3 A;  1QSS A;  1N48 A;  3AM9 A;  8ICY A;  2GOL A;  4LVS A;  5DBA A;  1DXS A;  1KEJ A;  1LVH A;  4Y2Y A;  1SKW A;  4M2Y A;  2KK0 A;  3PST A;  4FZM A;  3V7J A;  2F1I A;  2FPK A;  3SQI A;  3PSF A;  4ED0 A;  3BS5 A;  4QZB A;  4YXJ A;  5AKI A;  2NRV A;  3ETR A;  3EWA A;  1U48 A;  3CYM A;  4DL7 A;  1SXD A;  3QXG A;  1Z00 A;  2F2A B;  4UAY A;  4EYI B;  4I28 A;  4MHV A;  4Y2X A;  1UHU A;  4P0P B;  3GV8 B;  4O3P A;  2WAQ C;  1KN5 A;  3BQ1 A;  4LZG A;  4QWC A;  1RXW A;  1EXN A;  3RB0 A;  2Z7J A;  4ED3 A;  3KHG A;  1UT8 A;  4ICA A;  1V85 A;  1NK8 A;  5A0L A;  4K4H A;  4J9R A;  5AIA A;  2F8L A;  4ED8 A;  4KLH A;  3SMV A;  2YMP A;  9ICC A;  4A8E A;  5JRT A;  2WTF A;  2BPC A;  5KFJ A;  2ASL A;  2EAO A;  5DLF A;  3T5L A;  2ZUD A;  4EEN A;  3WKD A;  4P4P A;  2MU2 A;  5IIM A;  1TK8 A;  2PMZ C;  2FPL A;  2ZJA A;  5KT5 A;  3CRX A;  3BZC A;  1ZYQ A;  4C80 A;  5L1I A;  4CGZ A;  1TK5 A;  2HSZ A;  4BXO A;  3F2B A;  1PK1 B;  3QUB A;  5ALH A;  2I6X A;  5ALF A;  2W7P A;  3PW5 A;  4KMO B;  4C7Z A;  4Q8F A;  3T5H A;  4F4K A;  4I27 A;  5AI9 A;  4RU9 A;  4IQU A;  5EE1 A;  3HWT A;  4B6J A;  4US8 A;  5EWE A;  1ZJN A;  2EDU A;  3DEE A;  4MF2 A;  2KSO B;  4G3I A;  3M9N B;  3DV9 A;  3E0F A;  2QAR A;  1KSP A;  4F71 A;  1VLB A;  1COO A;  4PZN A;  4RUA A;  4BGD A;  2LM4 A;  1DOQ A;  4M9G A;  2KJ5 A;  4BUG A;  3RJI A;  1D9F A;  7ICI A;  1H38 A;  1QSY A;  1ZQN A;  5ALI A;  4GFJ A;  3PR5 B;  3UPQ A;  3ED5 A;  4FS2 A;  7ICG A;  3AL0 B;  3WU2 U;  5CR0 A;  2E8P A;  1X2I A;  1SV0 A;  3RJE A;  5AHX A;  3G6V A;  1BVS A;  3PVX A;  2W9C A;  2JEI A;  9ICO A;  2GLE A;  2XGP A;  2PXI A;  4Z6D A;  2KZ3 A;  4P0P A;  2RDJ A;  1N62 A;  3V6K A;  2OEH A;  5DG8 A;  1JI7 A;  2E8O A;  4FZN A;  4J9N A;  4M9J A;  1X9S A;  2IOH A;  4ECU A;  3C5F A;  8ICU A;  1L8L A;  4PGQ A;  1X9W A;  4C8O A;  4FZL A;  2C2E A;  7ICQ A;  2P6U A;  4MEX A;  4F92 B;  4M04 A;  2V4Q A;  1S76 D;  4B9U A;  2QB1 A;  4J9S A;  1BNP A;  4DL6 A;  1V9P A;  3WK5 A;  5KT4 A;  4TQR A;  2HHQ A;  5KFG A;  4EEK A;  1FIQ A;  2KZM A;  3TAQ A;  4DSE A;  4KLG A;  2V4R A;  1Z4N A;  4QZH A;  4F5N A;  3D2S A;  7ICU A;  5HHI A;  4DFD A;  2A1J A;  4BXO B;  4IL6 U;  4IR9 A;  5KFP A;  1ZQC A;  4F2S A;  2K8B B;  4RQN A;  2H5X A;  1MQ3 A;  1A77 A;  5AM3 A;  1K1S A;  3H7I A;  4Y2R A;  1NKE A;  1HIW A;  3VC8 A;  2BCQ A;  1KKX A;  3D2Q A;  4K4G A;  3M9O B;  3PW7 A;  2PFN A;  2RHF A;  3MR5 A;  2BCV A;  2DGZ A;  1JUD A;  1B4F A;  2M9N A;  3Q8M A;  3E58 A;  1DRG A;  3TFR A;  1ZQ1 C;  2W9C B;  4PJ0 U;  4O9M A;  3BZK A;  4RT3 A;  4YCX A;  4KX3 A;  5J2D A;  3GQC A;  2IMW P;  4PGX A;  4TUR A;  1TK0 A;  4QZD A;  2B0C A;  1RQN A;  1CEZ A;  3GDX A;  2HHU A;  1QH9 A;  2C22 A;  4QZC A;  1Z00 B;  2C2R A;  1Z4O A;  3MR6 A;  5AKH A;  4NXZ A;  3OJS A;  2BR0 A;  3V72 A;  4FBU A;  3ICX A;  3MAB A;  3QX7 A;  3M9M B;  3T5J A;  2JGA A;  4Y2P A;  3C29 A;  1X9M A;  4PHP A;  2ZTD A;  1HJP A;  2R18 A;  1L7P A;  4IQV A;  5DQI A;  4QZA A;  3UMG A;  1XSL A;  2YMQ A;  4DQP A;  8ICA A;  7ICN A;  2WHE A;  4RUC A;  3PSP A;  3KTQ A;  5IIJ A;  1TE2 A;  1PUZ A;  1SWV A;  2Y9T A;  2A1J B;  2BKE A;  4F50 A;  7ICO A;  4J9O A;  1JX4 A;  3KKA A;  4HYK A;  4NL9 C;  4XUS A;  5L1J A;  1T3Q A;  4O3Q A;  2W3R A;  2KEY A;  1L3S A;  4JB3 A;  3MR3 A;  2F77 X;  4LJX A;  4O3N A;  5L1L A;  3TKA A;  1IG6 A;  3O0F A;  2F44 A;  2DPJ A;  1D8Y A;  5J0Y A;  2G0A A;  2ZIU A;  4C7Y A;  2VA8 A;  1NJW A;  4DOC A;  2HHX A;  4I2A A;  5KT6 A;  1ZQI A;  4MEY A;  5J0R A;  2DQN B;  1KFD A;  4OJP A;  2ZIV A;  2EQY A;  1UA1 A;  4O5C A;  2H3Q A;  5KFT A;  2Y1J A;  3B9J A;  2AQ4 A;  2F1H A;  4BWM A;  4DF4 A;  1KRP A;  3BDP A;  1KBU A;  1URJ A;  4UAR A;  3KBB A;  1N56 A;  5JTI A;  1Z1V A;  5JU5 A;  1Q3U A;  1RDF A;  4NLC A;  4OJL A;  3JPP A;  4HAI A;  1N2X A;  4F4W A;  4I2D A;  1ZQG A;  4KLI A;  1P7D A;  2W03 A;  3SAH A;  3OPX A;  3Q8S B;  4RQ5 A;  1CI4 A;  2HW3 A;  9ICW A;  5KFN A;  2EZX A;  2A1A A;  4MFF A;  8ICR A;  2A19 A;  2FPM A;  2M0N A;  4O5K A;  4J9Q A;  2XIC A;  1NZP A;  2FJ6 A;  1S0N A;  5ALZ A;  1UT5 A;  5B5E U;  2ZIW B;  2KVC A;  2IHM A;  2UVW A;  2XCA A;  7ICF A;  3IM1 A;  3HPO A;  4C4T A;  4UAT A;  3AQE A;  2BCU A;  3SR6 A;  1ZQL A;  2XY5 A;  1MQ2 A;  9ICU A;  3QUC A;  2E1E A;  5KFQ A;  1WCN A;  3M8R A;  2OM6 A;  1CRX A;  2OWO A;  7ICP A;  2WAQ F;  3TQ1 A;  2KG5 A;  4Q43 A;  2JEG A;  4B9S A;  1JAL A;  4UB4 A;  5EWF A;  2K4E A;  2G09 A;  1RM6 C;  5DB6 A;  3PV8 A;  1T4G A;  2F76 X;  2OYY A;  3C1Y A;  4M9N A;  1N60 A;  5J2J A;  9ICP A;  5KFU A;  3SAG A;  5KFA A;  1ZQF A;  2PI4 A;  2AJQ A;  2FE9 A;  2ZXH A;  4RT2 A;  3H8S A;  1S5L U;  1BPD A;  2N1R A;  2WF8 A;  4NLB A;  3N97 B;  5ALD A;  1MA7 A;  4M47 A;  4MF8 A;  4QIW C;  4DSK A;  3HJE A;  5ALR A;  4R8U B;  5D46 A;  4Q45 A;  1U49 A;  3UM9 A;  1A0P A;  4OCZ A;  1T8E A;  5K4L A;  2XC9 A;  1SV4 A;  5ALE A;  4UBB A;  9ICL A;  3MGV A;  2K4P A;  1NK6 A;  1SGG A;  3UMB A;  1N5W A;  2WF7 A;  4ELV A;  3UQ2 A;  1SZH A;  4GIB A;  4OJ6 A;  1T94 A;  5KG2 A;  1J2M A;  3H40 A;  5J8Y C;  2ES6 A;  2ZIU B;  3TAP A;  4UB5 A;  2FMS A;  4YD2 A;  4UW9 A;  4GC7 A;  4ECS A;  2BGW A;  4IRD A;  9ICI A;  4RQ3 A;  1ZET A;  3NS1 A;  4OJO A;  4NWI A;  4F3O A;  5F9L A;  1RZT A;  3CW2 C;  9ICG A;  1PZN A;  3C2L A;  3TAC B;  5KT3 A;  2ZIV B;  4I2C A;  4ECW A;  3WK7 A;  4AYB F;  2YML A;  1WWU A;  4DSF A;  3RJH A;  4PHA A;  4J03 A;  5AM1 A;  1DK2 A;  1S0O A;  2WF6 A;  3KKA C;  2HOQ A;  2H3F A;  3FYH A;  1HUO A;  2VA3 A;  5J2K A;  4CCH A;  4ACO A;  4RZR A;  2DL0 A;  4J9P A;  2HVH A;  4ECT A;  5AI6 A;  3F5E A;  1F44 A;  2HDO A;  4K4I A;  2NO4 A;  3KHH A;  4ECQ A;  4GXJ A;  1MN8 A;  2JMG A;  5HR6 A;  5HNK A;  4B9V A;  2L5Y A;  3RRH A;  1TAQ A;  3C2M A;  4ED7 A;  9ICT A;  4UQG A;  2C2D A;  1VJ5 A;  3RR7 A;  3A0H U;  2KE7 A;  1RYU A;  5J0U A;  3MBY A;  2QLT A;  1RYS A;  2IOF K;  3Q8P B;  1O03 A;  9ICH A;  2ZXI A;  5GTH U;  4ED2 A;  3L3F X;  7ICM A;  3RB3 A;  4DSL A;  7ICL A;  1KFT A;  3N7R C;  5AK4 A;  2D3D A;  1SKS A;  2HCF A;  3PW2 A;  3LVV A;  5J0Q A;  2HHW A;  4CF4 A;  1ZQV A;  1ZD3 A;  4YG2 A;  5G5H A;  4RQ4 A;  3L5K A;  2HI0 A;  2CRX A;  5EE0 A;  1NK4 A;  4QZI A;  2YY6 A;  3BQ7 A;  2EAN A;  3GIM A;  3EUB 2;  4CRX A;  3EPG A;  2D8C A;  3KZX A;  4KMU A;  2HHS A;  8ICH A;  2WF5 A;  4RQ2 A;  4ZH4 A;  2J6T A;  2LYH A;  4KLF A;  5BOM A;  5KAI U;  4F5R A;  3QU7 A;  2K8A A;  5KT7 A;  5DG9 A;  2OHF A;  2W9M A;  4J9M A;  1ZRM A;  5KG3 A;  3MFI A;  1QCK A;  3MGI A;  4DFK A;  5BOL A;  4DLG A;  3I28 A;  4YD1 A;  3PML A;  2P6R A;  2JZB A;  2GO7 A;  4ZOH C;  4R8U A;  1ZQE A;  3ORY A;  2DWQ A;  4F93 B;  1V97 A;  2OXO A;  4QIW F;  4DEZ A;  4UAZ A;  2GWS A;  8ICB A;  2XID A;  2XY6 A;  1X66 A;  1MC8 A;  4JK1 A;  4CNQ A;  4GXK A;  5AK3 A;  4J9L A;  3RRG A;  5DGA A;  2ISO A;  4DF8 A;  2HBJ A;  4B9T A;  2P66 A;  1L3U A;  1QLN A;  1YZ7 A;  5KFR A;  3UQ0 A;  2D6F C;  3N28 A;  4RNO A;  4CF5 A;  1F5S A;  2W8K A;  8ICK A;  2ESE A;  2HHT A;  1DGJ A;  4DOA A;  3H8J A;  3KOO A;  3M8S A;  3GFK B;  4P0Q B;  1D8L A;  2G06 A;  5ALU A;  1JIH A;  4CDG A;  5DBB A;  5DB8 A;  4R64 A;  3NVW A;  4DQR A;  4I2J A;  4OJ5 A;  4F4Y A;  2YN4 A;  3H0M B;  1WUD A;  5IIK A;  1JMS A;  1S8O A;  1NOM A;  4PH5 A;  1ZQP A;  1T7P A;  3LWM A;  4UAS A;  4YVZ A;  3WK8 A;  3HIL A;  3UXP A;  1Z19 A;  2R8G A;  1SWW A;  3PX0 A;  3EW9 A;  3PX4 A;  2W54 A;  1JXL A;  4MFA A;  5KL8 B;  3BQT A;  4R65 A;  5GTI U;  3SAF A;  2QB0 B;  5DKW A;  5DQH A;  1PVR A;  2V9W A;  1TAU A;  2ZG6 A;  2LI6 A;  3RF9 A;  5C5J A;  8ICG A;  2KV2 A;  1J2N A;  3QU4 A;  4EEL A;  4M0A A;  2O6K A;  2BDP A;  1KTQ A;  2OCE A;  2KKV A;  4IQT A;  4RPY A;  2XO7 A;  3J81 j;  4I29 A;  5DG7 A;  5ALS A;  1SIJ A;  1KLN A;  4KLE A;  5ALL A;  3ZDC A;  4YR3 A;  3KFU F;  2ISP A;  5KFI A;  3QYP A;  4UAV A;  5D4B A;  1A6S A;  3RTV A;  4DSJ A;  1ZQS A;  3L4P A;  4DFM A;  5AI0 A;  4Y2J A;  4X5V A;  4I2B A;  3WKE A;  3HT3 A;  1Z1B A;  2ZJ5 A;  2MRL A;  4MFC A;  2NRZ A;  1NK9 A;  1L7O A;  1IXR A;  5KFV A;  4GLX A;  2ALZ A;  1FO4 A;  9ICS A;  2AXT U;  5KFK A;  2W9B A;  5L1K A;  3K1R B;  9ICB A;  1X6I A;  2DKX A;  1S10 A;  4UAW A;  4Q8E A;  3WK9 A;  1SXE A;  3ISD A;  9ICM A;  4UB3 A;  9ICQ A;  1OUQ A;  1ZQB A;  3MDC A;  5DBC A;  5EWG A;  1ZQO A;  2LYA A;  5KL1 B;  4RQ8 A;  3S6J A;  4DFJ A;  3LK9 A;  1ZD2 P;  4BX9 C;  2G08 A;  2ZJ8 A;  1B43 A;  4Y2U A;  4EBE A;  4NM1 A;  8ICT A;  4YN4 A;  1TVA A;  2DKZ A;  1UPH A;  2NRT A;  4CE6 A;  8ICE A;  3H0L B;  1KFS A;  1FEZ A;  3NVV A;  3THV A;  4DFP A;  2UVR A;  3QUQ A;  5ALO A;  3RFA A;  5CHG A;  2VA2 A;  1XC9 A;  4KN7 A;  1NJZ A;  3MGH A;  3AU6 A;  1L5U A;  2ATL A;  2KZZ A;  2KSO A;  3H4D A;  3GIJ A;  1L6N A;  2QAR B;  5DB9 A;  8ICM A;  1NKB A;  2Y0S F;  4OO1 J;  1ZD4 A;  1X9X A;  1ZQW A;  4RQ6 A;  3ZI4 A;  4ECY A;  5KG1 A;  1ZQK A;  4QNL A;  5TZV A;  5ALY A;  5G5G A;  3NRW A;  4KX5 A;  4EX7 A;  2AQ0 A;  4R66 A;  1JRP A;  4TUS A;  2E1F A;  3F2C A;  2AGQ A;  5ALP A;  3PX6 A;  8ICZ A;  2XCP A;  1B0X A;  1TKD A;  3OSN A;  2KJ9 A;  2I1Q A;  2B21 A;  5AKY A;  5CB1 A;  2KVS A;  4NV0 A;  4NLZ A;  2C28 A;  3QEB Z;  2LBO A;  4YMO A;  3HX0 A;  2W9B B;  1QQ5 A;  3H8M A;  5DB7 A;  4TUQ A;  4F5O A;  3CNH A;  3GV5 B;  2CXY A;  5KFL A;  3PZP A;  1XNS A;  2BHN A;  3TAD A;  2YB1 A;  5J2H A;  2HOF A; 
#chains in the Genus database with same CATH homology
 3SEN A;  2JV3 A;  2QKQ A;  2Y9T A;  1X40 A;  2QB0 B;  2B6G A;  1V38 A;  1PK1 B;  5J8Y A;  3KKA A;  4NL9 C;  3TAC B;  2KIV A;  2DKZ A;  1RG6 A;  2QB0 A;  1WWU A;  4RQN A;  2F44 A;  1KW4 A;  2KG5 A;  1LKY A;  1PK3 A;  3KKA C;  4NJ8 A;  1DXS A;  2Y9U A;  2KSO B;  1UCV A;  3BS5 B;  2QAR A;  2F3N A;  4PZN A;  2DL0 A;  2KMD A;  2KSO A;  3BS5 A;  1B4F A;  3IDW A;  2QAR B;  1COK A;  1PK1 A;  4NL9 A;  1X9X A;  1X66 A;  2L5Y A;  2FE9 A;  2E8P A;  1SXD A;  1SV0 A;  2KE7 A;  4MHV A;  1LKY B;  2E8N A;  2GLE A;  1OW5 A;  3BS7 A;  2LMR A;  1WWV A;  4RQM A;  1F0M A;  2ESE A;  1OXJ A;  1SV0 C;  4IS7 A;  1B0X A;  1V85 A;  1JI7 A;  5JTI A;  2D3D A;  2E8O A;  1Z1V A;  1SV4 A;  5L1M A;  2K60 A;  2LPE A;  5JU5 A;  5KNI A;  2E8M A;  3K1R B;  3TAD C;  2K4P A;  2DKX A;  2YTU A;  3SEI A;  1SGG A;  2F8K A;  5JRT A;  3H8M A;  1SXE A;  1UQV A;  5F3X B;  2EAO A;  3BQ7 A;  3HIL A;  2QB1 A;  5J8Y C;  2EAN A;  2ES6 A;  2EAP A;  3TAD A;  2D8C A;  4PZO A;  2EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...