2GLEA

Solution structure of neurabin sam domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
GHMVHEWSVQQVSHWLVGLSLDQYVSEFSAQNISGEQLLQLDGNKLKALGMTSSQDRALVKKKLKEMKMSLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Neurabin-1
publication title Structural characterization of the neurabin SAM domain
rcsb
source organism Rattus norvegicus
total genus 20
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2gleA00
2F3NA 2LPEA 1OXJA 2DKZA 2GLEA 5JTIA 2Y9UA 2KE7A 1V85A 4PZNA 2K60A 2QARA 1X9XA 2E8PA 2EAMA 2K4PA 1F0MA 1WWVA 3BS7A 1SV0A 4NL9A 1DXSA 1SV0C 1LKYB 4NL9C 2ES6A 3SENA 2QARB 3KKAA 1UCVA 3KKAC 3K1RB 2DL0A 5F3XB 1SV4A 3BQ7A 3IDWA 4PZOA 1LKYA 1V38A 3BS5B 4IS7A 1Z1VA 5JRTA 2EAPA 1PK3A 1PK1A 5J8YA 1OW5A 5KNIA 1SGGA 5JU5A 4NJ8A 2E8MA 5J8YC 3TADA 2B6GA 1X66A 2D3DA 3TADC 1PK1B 3BS5A 2EANA 5L1MA 2FE9A 2Y9TA 4RQMA 3H8MA 2KSOB 2LMRA 1UQVA 3SEIA 1SXEA 2QB0A 2KIVA 2QKQA 2ESEA 2EAOA 2F44A 2KMDA 3TACB 2JV3A 2F8KA 2YTUA 2QB0B 1WWUA 2QB1A 4RQNA 1JI7A 2KSOA 1SXDA 1X40A 2DKXA 1KW4A 2E8NA 1COKA 4MHVA 1B0XA 3HILA 2E8OA 2KG5A 1RG6A 1B4FA 2D8CA 2L5YA
chains in the Genus database with same CATH superfamily
5DBCA 5J2HA 2AHOB 8ICJA 4Y2TA 3T5JA 1S97A 9ICUA 1BPXA 4FZLA 3WKAA 2W7PA 5ALVA 4UB1A 2KE7A 2FPKA 2FLNA 7ICKA 1DOQA 3ZDDA 3RH6A 5GTHU 1SKSA 4AYBF 1JROA 3QX7A 5AM0A 2ATLA 3AM9A 5J0YA 2ZIUB 2IOFK 1MA7A 5L1LA 2VJ5A 3GV5B 2WAQC 1TKDA 4EX6A 1TE2A 4OJ5A 1N61A 5KFSA 1DGSA 5DDYA 1XS9D 1H38A 2DPIA 4ECRA 1ZQNA 4DOCA 1D9FA 2HSZA 2DUYA 2JZBA 2XY5A 2FI1A 2C2EA 1A0PA 4YP3A 3WK4A 5KFBA 3PR4A 9ICGA 1GO3F 7ICLA 2QB0A 1SWWA 3RJJA 4QW8A 5AKZA 2UVRA 3LYSA 3GIMA 3F2DA 1L7PA 3C1ZA 4DF4A 2BCVA 3M9MB 2E1EA 4Y2JA 4JWNA 3C2MA 4UASA 4O3SA 4RNOA 2PI4A 1MC8A 4FO6A 2KV2A 3N4MB 5A0LA 4DL4A 2NRTA 5KFIA 2W8LA 4ED0A 8ICZA 3PZPA 2JEJA 3SAHA 1OXJA 2C2DA 1UPHA 4EBEA 4LZDA 4KLOA 2F1HA 5J2GA 2KNJA 2K60A 8ICOA 3IN5A 4DSFA 4NLCA 4KLSA 3BQ0A 2NYVA 3SENA 7ICJA 5AKXA 2H3FA 3RJEA 4DEZA 1A77A 5AK5A 5KFEA 1Q46A 3MDAA 4QIWC 2HCFA 5AHXA 5KFHA 4CF5A 2JEIA 1UT8A 5KFPA 3QUTA 4Q45A 2J6TA 4ED2A 2ZIUA 5ALDA 3CNHA 4M04A 4QZDA 3AUOA 3Q8RB 1ZQCA 5CRXA 4GXKA 5BOLA 4R65A 2LBOA 2HOIA 3TANA 1Z4OA 2DPJA 8ICKA 3IV6A 4KLGA 4UAVA 2AXTU 8ICPA 2MRLA 5ALYA 2ZTDA 2AGOA 2KIVA 3TAQA 4OCZA 1BPDA 3QUCA 4BWMA 5AM3A 5HP4A 2F1IA 2HHVA 2KHVA 1V97A 2XICA 4C4RA 4DLGA 1PVPA 5AKJA 1K1QA 2LHTA 3NUQA 1PVQA 2AQ4A 4EBDA 1T4GA 3SAGA 1QH9A 3E0FA 5DG9A 2OH2A 2K4EA 2JR5A 4Y2YA 2W03A 4F2RA 7ICOA 2CRXA 2DF4B 3AQFA 2NRWA 1RG6A 3V6JA 4OJPA 5KFMA 4ED3A 4MEYA 3PX4A 5KG5A 3TQ1A 5AIAA 1KKXA 1Q8KA 2GLEA 2Y9UA 8ICQA 4PZNA 4F5QA 4BX9C 3OJUA 3EUB2 5DQHA 2VANA 4J9SA 5AM4A 1FIQA 7ICMA 3C23A 1A76A 3B0XA 3O0FA 4BJQA 2FMSA 2QARB 5KAFU 1ZQUA 1UCVA 1XWLA 2GOLA 4MEXA 4UBBA 4QIWF 7ICGA 3UM9A 5DQGA 3KOOA 4QZIA 2XCAA 4O5KA 4RNMA 3RFAA 3LDAA 3HWTA 1PK3A 3PW0A 1BPYA 1OW5A 1SGGA 9ICNA 1T3QA 4MFAA 3M9NB 2JRZA 1NZBA 5L1MA 5KG0A 4US9A 8ICBA 2Z7JA 3D2QA 2F1JA 4PL2A 3MR5A 3FC4A 3UMGA 4EZ9A 3NGDA 3SEIA 3T5LA 1SKWA 3SV3A 1BNPA 4F71A 7ICUA 2BQRA 1XU4A 4DSKA 5KT6A 3PSPA 3RR7A 2G0AA 2YMQA 2CPRA 1HUZA 1SXDA 3AN1A 1B43A 2BGWA 1KFTA 1Z00B 2KVCA 1NNLA 2P35A 3GIKA 3GV8B 4F91B 1Z19A 2H3QA 1B22A 5J2FA 4GC7A 4ECXA 5ALXA 2HOQA 1ZD5A 1F5SA 2XO7A 2P6RA 3FM9A 2L5YA 3I1YA 5GTIU 4IRCA 7ICEA 2V4RA 5JTIA 1SZPA 3NRZA 3M8SA 2ISPA 3PW4A 1L7NA 5CR0A 2BKEA 2ZIWA 2R8IA 1WYGA 4DSLA 1RXVA 1LKYB 1TFRA 3A0BU 1BPZA 5CEHA 2YMLA 3TAPA 1ZQTA 5DQIA 1RZTA 4I27A 2ALZA 3C5GA 3NVWA 3N97B 2BHNA 3PW2A 4EEKA 4KLEA 5AK4A 4UAWA 5L1KA 1RDFA 2E1FA 4JB3A 2BDPA 2EZYA 2UVUA 4QNLA 9ICEA 4UW9A 8ICAA 4RQ1A 8ICEA 4I2EA 2ZUBA 5KFJA 3BQ1A 2NRZA 4RQ0A 1D8YA 4EELA 3C2LA 3QEBZ 4EEYA 2HHUA 3ALRA 2WF7A 5AM5A 3HP6A 5AI8A 1VDVA 2A1AA 1X66A 2YN4A 1WG8A 1PK1B 5J0QA 1SWVA 2EANA 4HYKA 2BPFA 3C28A 3VCBA 1L8LA 5ALQA 4YCXA 4ELUA 3WK6A 4DF8A 4TURA 3ISBA 4FBTA 2WF8A 1KEJA 5EE0A 4UB4A 1BNOA 1SXEA 2H3ZA 1ZQ1C 3TACB 8ICVA 2LM1A 3H7IA 5ALSA 1Q3UA 1JRPA 1WWUA 5T14A 4YD1A 5ALNA 4EYIB 1ZQEA 5EWFA 2KKPA 1TVAA 4JWMA 3Q8SB 1B0XA 2VKQA 4UAUA 1NKCA 1SL0A 4P0PB 3MGIA 1NK4A 5HR7A 3RJFA 4NLZA 3BQ2A 2KICA 2W8KA 3QU9A 4J9PA 3HT3A 4KLFA 1OUQA 1L7MA 4KX5A 3Q8MA 1ZQSA 3LK9A 5TZVA 1Z00A 2AQ0A 4PH5A 4ECYA 1KLNA 2HOFA 3SAFA 2ZJ8A 5F9NA 1PUZA 4U6PA 1Z4NA 2LI6A 2XCPA 1JN3A 4C8OA 1X2IA 4K4IA 4ECWA 9ICIA 2G09A 3G6XA 1WCNA 4NL9C 3LVWA 3KKAA 5J0XA 4C4SA 3RB3A 1JXEA 3N7PD 5IIOA 3L3FX 1U9LA 2FPLA 5BOMA 3TI0A 1L7OA 4B9SA 3SI8A 2PXIA 2RP5A 1XO1A 2ZXIA 1LKYA 3GIJA 1L3SA 4P4PA 4BGDA 2R8HA 4UB6U 5KT7A 5AKLA 3PX0A 3KHHA 2KN7A 2JXJA 4RPZA 2E8MA 9ICXA 3EW9A 2ZTEA 2D3DA 3TADC 4F5PA 4KLIA 2WF5A 2F77X 1IG6A 1N5XA 3SR6A 2CXYA 5H2FU 4QWAA 1X9SA 1EXNA 4Z6DA 5DBBA 4YXJA 2J6UA 5KG1A 4F3OA 2ESEA 5B66U 3NVYA 1SZHA 4NY8A 1ZD4A 5KL8B 4FFDA 4JK1A 2OEHA 2QB0B 1NKEA 2KZMA 4DSIA 1S77D 3TFRA 4PJ0U 2WF9A 1U48A 3HPOA 2E8NA 5L9XA 1ZQHA 4IQWA 4ELVA 5J2KA 4ZOHC 3PSIA 4RQ2A 5AK6A 1NK5A 3LWLA 4JV2A 9ICHA 1XNSA 3MGHA 3IG5A 4ED8A 1B4FA 2W43A 5KFAA 2JEGA 2K8AA 2LPEA 2VJ4A 3GV7B 2I9GA 1JUDA 9ICVA 2I6XA 2FDRA 4P0PA 3Q8QB 5EE1A 2KFNA 4RQ4A 4JV0A 2ES6A 4P2HA 3S6JA 1ZQDA 3JPPA 5AI5A 4J9MA 3PR5B 4QZ8A 5AKYA 1COOA 2FLPA 1ZJNA 4EX7A 1ZXIA 5AKKA 4KLQA 5J2AA 3D6JA 1XC9A 3Q8KA 2IBKA 2KD1A 4F93B 5DDMA 1Z1VA 3BZKA 2EAPA 1JMSA 3WK9A 1RXWA 5J29A 3H8SA 7ICFA 2XY6A 1ZQIA 2KFZA 2FLLA 2RRDA 3MC1A 4XRHA 3V72A 2ZIXB 5IIKA 4ECUA 2G5IB 2G06A 3CW2C 3L4PA 3CP8A 4JMUA 3AEVA 2LMRA 1YZ6A 4TQSA 1J97A 2ODGA 2Q0ZX 1KFSA 2MUTB 1U47A 2KOBA 5CWRA 4O3RA 4F4WA 1JALA 2M0NA 3DV9A 4R8UA 5G5HA 2QB1A 3QXGA 1JI7A 4B9MA 5HR6A 1RPLA 4MHVA 3SQIA 1HIWA 4PHDA 3QU2A 2F2AB 3N28A 3IG8A 4UBCA 5J2IA 5AIBA 3L5KA 4KX3A 2WB1C 3G6VA 3TARA 4ECQA 4B9VA 1SIJA 3EWAA 1C7YA 1S9FA 2E3TA 4ECTA 3BQTA 1N63A 3ONNA 1S10A 3QU7A 3RBEA 3KBBA 4RT3A 3RJHA 2C28A 2DFLA 3ED5A 4TUQA 4MFCA 4G9BA 1RM6C 5DGBA 4DL5A 2FPMA 4DOAA 5DG7A 3ICXA 2HDOA 3EYZA 3OPXA 4RQ6A 4EBCA 3QE9Y 2RLTA 4ED1A 2JH1A 2EQYA 4NLBA 3JPTA 5DB8A 2H3IA 3H8WA 1J2MA 4BUGA 3IDWA 4PZOA 7ICTA 2OWOA 2P6UA 3V6HA 4RQ8A 5CP2A 5AM2A 4UQGA 1CUKA 4GC6A 3NRWA 2PFNA 3QZ8A 5ALWA 3KHLA 4IQUA 5KFCA 4FE3A 2WAQF 4DL3A 4KLMA 1ZQFA 4TUSA 1ECWA 3NVVA 1ZD3A 5HHHA 2KMDA 1CEZA 2ZIXA 5ALJA 5ALRA 3HKZC 4OJOA 4QZEA 3ZDBA 2R8JA 3MABA 4CE6A 3IHQB 3J81j 2JGAA 7ICIA 2HVIA 2MUTA 3OSPA 5CA7A 4M9GA 3DDHA 5HMMA 2ASLA 4F92B 4NM2A 3MR2A 4YD2A 5KG7A 2WB1F 3RBDA 3UQ2A 3LVVA 1ZQYA 4ZH4A 5DLGA 4YMNA 2HHQA 2W9CB 1NK8A 1TK8A 3B0YA 3D2SA 5DB9A 2VIXA 2MA1A 3MFHA 4I2FA 1AQ6A 8ICSA 5DGAA 5FP0A 4GXIA 4YVZA 1HJPA 1JIHA 4MF8A 2N1RA 5F9LA 5KT5A 4KITB 1WWVA 1SV0A 3V6KA 4I2IA 4EYHB 1L5UA 3KFUF 4C8KA 4Z6FA 1ZQLA 2ZIWB 5ALGA 1X6IA 4O5EA 2JMGA 5KFOA 4NLKA 3ISCA 4TQRA 4DQRA 9ICQA 2RQ5A 2PMZC 4QWBA 4IS7A 1J2NA 3PV8A 3ZDAA 4O5CA 5C0YA 3H4BA 1TK0A 3GFKB 2RDIA 5J8YA 1KRPA 1BPEA 3GDXA 9ICWA 2A3VA 7ICVA 2WFAA 4DFKA 4P0QB 3BZCA 1QSSA 5KT3A 8ICWA 1S0VA 2HBMA 4QWCA 4YG2A 1KL9A 4LJXA 8ICIA 3UXNA 1L3TA 4USAA 3UQ0A 4R66A 4DCCA 5AI6A 4DLEA 4Y2SA 3MR6A 2JV3A 2J6SA 1N62A 3JPQA 3ZD8A 4RQNA 4YN4A 1N60A 2HMXA 2KIWA 2MSNA 1S5LU 2VA2A 5DKWA 2ZJ5A 8ICUA 4GFJA 9ICOA 3RJIA 5AI9A 5CB1A 4C0ZA 2E8OA 2KG5A 1ZQRA 3Q8LA 5KL1B 2K4HA 3KHGA 4QWEA 4PGYA 1YT3A 4HAIA 3T79A 2LYHA 2W7OA 1S8OA 3N7RC 5KFGA 8ICTA 4F2SA 2F76X 5KFZA 1X9XA 2DBYA 5KFTA 2W9CA 1S0NA 1RQNA 3F5AA 2BQ3A 4J9QA 2CN1A 3KD3A 4K4GA 2PMZF 2G07A 3H0LB 1XSLA 3OSNA 4YR3A 4FS2A 4QZAA 5D49A 1LVHA 1ZQJA 4B9LA 1QSLA 2IHMA 3MBYA 2OYYA 4PHEA 1AROP 2ZTCA 4K4HA 4YMMA 1ZQVA 4J9OA 5IILA 1L3VA 1DK3A 2W54A 4F5NA 2KSOB 3RTVA 4NXZA 4FBUA 3VC8A 5J2EA 4P0QA 5AK3A 5KTQA 4UB3A 3ETLA 3IRUA 1V9PA 1PZNA 4CDGA 4O3PA 5C5JA 2F8LA 2DKXA 3ETRA 4QZGA 3IM1A 3QYPA 1DGJA 5J0PA 3QUQA 3E2EA 4C4TA 2H3VA 2RHFA 3CYMA 3OJSA 4RZRA 4DL2A 9ICSA 1N2XA 1ZD2P 2BCUA 3WK7A 1VJ5A 5DBAA 4KLUA 5KFLA 2G08A 1TAMA 1QQ5A 4F8RA 4Y2RA 4P4MA 2Q4TA 3M1YA 4YMOA 3T5HA 4US8A 1WUDA 1MQ3A 2K4PA 1KDHA 5J2JA 3IP4B 4DFJA 3M6KA 2JH7A 4RNNA 3K1RB 3RB4A 2DL0A 5J0UA 5EWGA 5AICA 4AP9A 2BPGA 1Y88A 1QQ7A 3FAHA 1X9WA 1SKRA 5DG8A 1RYRA 3SV4A 4LVSA 3JPNA 5J2CA 4RQ3A 2WF6A 2NO5A 2KZ3A 1T3NA 2AGQA 4O0IA 2FJ6A 3NS1A 4M2YA 3QUBA 4I29A 4R63A 2P66A 3QU4A 3JPOA 3PY8A 4M6WA 4RQ7A 4KLDA 1SL1A 1ZQOA 5KFXA 1XO0A 1QLNA 1ZQWA 2KSOA 3ORYA 3K1ZA 2RDJA 1X40A 3THVA 9ICMA 3I28A 4IL6U 4R8UB 2WHEA 2I5HA 4CCHA 4I2BA 2K8CB 3PVXA 1TAUA 4ECZA 7ICPA 1U49A 1TV9A 2HHWA 4WJ3B 7ICQA 3MR3A 4ED7A 3HW8A 1FO4A 4F5RA 7ICNA 4PHPA 2W55A 3G6YA 1DRGA 1D8LA 5DLFA 2HHXA 4ELTA 4I2JA 2NRVA 9ICJA 1KN5A 4RPYA 4DOBA 3RRGA 3KKAC 4QJFB 5F3XB 2ZJAA 2HHTA 4CRXA 1K5OA 4R64A 1FEZA 4M0AA 2JHDA 2OCEA 1QSYA 4UB5A 2FMQA 3WKDA 5CHGA 4M47A 3EPGA 1ZQMA 4DWIA 5IIMA 2HVHA 3AMZA 8ICXA 3RAQA 2ZXHA 4I28A 2AJQA 4Q43A 4GIBA 3ZI4A 2B21A 8ICNA 1JXLA 4RQMA 4ICAA 3H8MA 2KJ9A 3JPRA 1URJA 4KLTA 2JEFA 3GU3A 3PMNA 4DQPA 1ZOLA 2F44A 3HRDD 5ALOA 1C20A 2XIDA 2F8KA 2YTUA 2AU0A 4DL7A 1ZQXA 3SD7A 3H8JA 2V9WA 3H0MB 5KFQA 3OTQA 3C5FA 4Y2VA 4UATA 1U4BA 3UXPA 3B9JA 2QLTA 1NJXA 2KK0A 4PGQA 1VLBA 1KTQA 3C29A 1HUOA 1NK9A 2VA3A 1NK6A 4LZGA 3AQEA 3M6ZA 3C21A 4KLLA 2DKZA 1X9MA 4UARA 5KG2A 8ICYA 1Z1BA 4DQQA 4KLJA 4ECVA 3RH5A 3PMLA 4F50A 2GO7A 4NV0A 1DXSA 1N56A 4A8EA 3NTUA 5ALLA 7ICHA 5KT2A 1XSNA 1IM4A 4BWJA 4Y2UA 4I2CA 2W3RA 1A6SA 4XA5A 3TFSA 1V38A 5EE3A 4KN7A 4ED6A 3DEEA 2ZUCA 3UPQA 5JRTA 2KVSA 3ZDEA 4NLNA 2LYAA 2W11A 3MDCA 2BZFA 3MGVA 1D8BA 4NJ8A 2EZZA 5JUMA 1S76D 1N48A 2B0CA 3GZFA 4FZMA 4B6JA 1NKBA 5KFVA 4YFKA 4YQWA 4Q44A 1Z3EB 1DK2A 3GQCA 2GWSA 8ICFA 3RAXA 3RB6A 5HNKA 1ZYQA 3SYZA 4RUCA 5KFYA 1S0MA 1U45A 4YR2A 2LYBA 4DQSA 2EAOA 5AKHA 4J9LA 3FYHA 3KZIU 4C80A 2PFPA 4O3QA 2A19A 4ECSA 1ZQPA 1O03A 1FFUA 2AGPA 1P7DA 3D2NA 4O3OA 4Y2PA 3TKAA 2D6FC 5CJ7A 1ED1A 3C2KA 4OO1J 1MQ2A 5KT4A 3QNMA 4M9LA 2W9BB 4NM1A 5KFDA 4DSEA 4NLGA 9ICBA 4Y2XA 2PI5A 4TUPA 4DS4A 2HBJA 5DB6A 4I2DA 3H40A 2KKVA 2PFOA 5KG3A 4JUZA 2XY7A 2HHSA 4UAZA 4XUSA 1RYSA 9ICCA 2EAMA 4PL1A 3BS7A 1MN8A 3V7JA 1X6JA 5AKIA 3RJGA 3AU2A 1K1SA 2NV3A 5L1JA 5ALIA 4JV1A 5KFFA 3PO5A 5TISU 2A1JB 5HMLA 4QW9A 2DWQA 2Y1JA 2ZUDA 4J9NA 4QWDA 4M9HA 1IIPA 5J0TA 3WKEA 3F2CA 1KBUA 4CF4A 5KFUA 5D4BA 4DL6A 3M8RA 2GH1A 3F53A 3PSFA 3WKBA 5D46A 5KFWA 2M9NA 2KHQA 3F5EA 7ICSA 1KSPA 2OM6A 1D9DA 1UA1A 1RQLA 2YQEA 5KAIU 2DGZA 4CNQA 4UB8U 4Z6EA 2K8BB 2ZIVB 4B9TA 4PHAA 1KW4A 3RB0A 1COKA 1IXRA 3ZD9A 3HJEA 4KMUA 1TK5A 2HI0A 3RF9A 3R9KA 4F4ZA 1ZQQA 4U7CA 2IHNA 1ZQGA 5ALHA 3EPIA 3F2BA 3LWMA 2BPCA 4F4XA 2KJ5A 5KFKA 3SMVA 1RYUA 1PVRA 4ACOA 4X5VA 2HW3A 3HKZF 4OJ6A 2YY6A 1UA0A 5J0RA 4QZHA 2ISOA 4RU9A 1NK7A 5AI0A 2UVVA 2E8PA 1F0MA 2W9BA 2V4QA 3RR8A 5ALEA 4QZFA 1SV0C 1BPBA 1O08A 1ZQBA 2YB4A 3UXOA 2XC9A 2K89A 3PSTA 3UMBA 4YR0A 4QZ9A 1NJYA 3BJYA 4BXOB 3WU2U 1ZETA 1SV4A 1KFDA 3BQ7A 1LB2B 2XI9A 3ISDA 5J2DA 3KTQA 2BCRA 1M6YA 1UHUA 5E79U 3ZDCA 1S0OA 2E5SA 4RUAA 5ALKA 2Y0SC 2MAXA 4CF3A 8ICCA 1SB3C 4C7YA 5JU5A 4MFFA 5J8YC 3NVZA 2C2RA 4C8NA 3MFIA 2UVWA 2G5HB 3RJKA 5ALPA 4Q8FA 4O3NA 3WK5A 5IIJA 2A1JA 1N5WA 3K4GA 1F44A 4QZCA 8ICMA 5EE9A 3PW5A 2OXOA 4OJLA 9ICAA 4KTQA 1QTMA 1KQQA 2MU2A 2YMPA 9ICRA 3GIIA 2KJ8A 4C7ZA 2IOFA 2OHFA 4M6WB 3PNCA 3FDSA 4UB2A 3JPSA 2KTQA 2W3SA 5ALFA 5ALUA 4M9JA 5DB7A 8ICRA 3HILA 5L1IA 3AL0B 8ICGA 3N7SC 1MSWD 3T3FA 9ICKA 5ALZA 1JX4A 2HBKA 3T5KA 3QEAZ 5J2BA 4Z6CA 4DFMA 3WKCA 4GLXA 2ZIVA 5K4LA 3E58A 5KG6A 2KZZA 2F3NA 5AKEA 4IR9A 8ICLA 4XQ8A 3OGUA 5KFRA 3AU6A 5EWEA 4IR1A 3SZ2A 2QARA 2R8KA 3Q8PB 4NWIA 4NL9A 3HX0A 1FFVA 1WCLA 9ICLA 2EZXA 1ZQZA 4DO9A 4P4OA 8ICHA 4KN4A 5AKGA 3A0HU 4F72A 4FS1A 3M9OB 4IQVA 5IIIA 1ZJMA 9ICFA 3BS5B 2BCQA 1QQ6A 2Y0SF 4M9NA 4C8MA 1ZRNA 1L8OA 4E0DA 4O3MA 4BXOA 3PW7A 2EDUA 4UAYA 5KNIA 4B9NA 2R18A 3CRXA 5ALTA 3TADA 1BGXT 2ASDA 2EH9A 2Y9TA 1QCKA 2WTFA 3RRHA 3OHBA 2KP7A 3C1YA 1UQVA 4CGZA 1NI3A 1NK0A 4EENA 1T7PA 5KG4A 4I2GA 1ZQAA 1NJWA 2QKQA 1CI4A 4RT2A 2LKYA 5EOZA 9ICTA 3KZXA 4KMOB 5G5GA 2BQUA 2W9MA 2C22A 2BCSA 3NASA 4DQIA 7ICRA 4PGXA 2YB1A 2D8CA 1L3UA 1Q3VA 2R8GA 4IQTA 1BVSA 5B5EU 2KEYA 4IC9A 5KFNA 3EZ5A 3UMCA 1NJZA 4KLHA 2H5XA 4DFDA 3RH4A 2IA6A 1V85A 2HBLA 4MF2A 5J0SA 4IRDA 4B9UA 3U26A 4DSJA 1ZQKA 2ZG6A 4I2AA 4J03A 5J0OA 4C8LA 3OHAA 1NZPA 4AYBC 4YXMA 5J0WA 3H0RB 3PX6A 2LM4A 5AM1A 2IOHA 4OD0A 4O9MA 3V7LA 4BDPA 2YX8A 2K4IA 1IV8A 3KHRA 5AI4A 5ALMA 2ASJA 3QU5A 2JZBB 4GXJA 3K75D 4J9KA 2AH5A 2FMPA 2NO4A 1PK1A 4G3IA 2BDUA 1L6NA 1ZRMA 1T8EA 4Y2QA 2B6GA 2NRXA 2Y1IA 4F4YA 3BDPA 4PPXA 2XVTA 3BS5A 1XSPA 2FE9A 3QZ7A 1NOMA 5IINA 2XGQA 4QZBA 1TAQA 4EZ6A 1SL2A 2W9AA 2O6KA 2W04A 9ICPA 1CRXA 2VA8A 5HHIA 4J9RA 2BR0A 3H4DA 3M7DA 2DQNB 3I76A 5BPCA 4Q8EA 2PKEA 4RPXA 4IRKA 3GILA 4FZNA 1HEKA 3WK8A 1X42A 3V7KA 4F4KA 2I1QA 4RQ5A 3PO4A 4I2HA 4DS5A 2XGPA 1UT5A 1LV5A 2IMWP 2PFQA 1YZ7A 4DFPA 1T94A 4F5OA 2YMMA
chains in the Genus database with same CATH topology
2F3NA 2LPEA 1OXJA 2DKZA 2GLEA 5JTIA 2Y9UA 2KE7A 1V85A 4PZNA 2K60A 2QARA 1X9XA 2E8PA 2EAMA 2K4PA 1F0MA 1WWVA 3BS7A 1SV0A 4NL9A 1DXSA 1SV0C 1LKYB 4NL9C 2ES6A 3SENA 2QARB 3KKAA 1UCVA 3KKAC 3K1RB 2DL0A 5F3XB 1SV4A 3BQ7A 3IDWA 4PZOA 1LKYA 1V38A 3BS5B 4IS7A 1Z1VA 5JRTA 2EAPA 1PK3A 1PK1A 5J8YA 1OW5A 5KNIA 1SGGA 5JU5A 4NJ8A 2E8MA 5J8YC 3TADA 2B6GA 1X66A 2D3DA 3TADC 1PK1B 3BS5A 2EANA 5L1MA 2FE9A 2Y9TA 4RQMA 3H8MA 2KSOB 2LMRA 1UQVA 3SEIA 1SXEA 2QB0A 2KIVA 2QKQA 2ESEA 2EAOA 2F44A 2KMDA 3TACB 2JV3A 2F8KA 2YTUA 2QB0B 1WWUA 2QB1A 4RQNA 1JI7A 2KSOA 1SXDA 1X40A 2DKXA 1KW4A 2E8NA 1COKA 4MHVA 1B0XA 3HILA 2E8OA 2KG5A 1RG6A 1B4FA 2D8CA 2L5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3N A;  2LPE A;  1OXJ A;  2DKZ A;  2GLE A;  5JTI A;  2Y9U A;  2KE7 A;  1V85 A;  4PZN A;  2K60 A;  2QAR A;  1X9X A;  2E8P A;  2EAM A;  2K4P A;  1F0M A;  1WWV A;  3BS7 A;  1SV0 A;  4NL9 A;  1DXS A;  1SV0 C;  1LKY B;  4NL9 C;  2ES6 A;  3SEN A;  2QAR B;  3KKA A;  1UCV A;  3KKA C;  3K1R B;  2DL0 A;  5F3X B;  1SV4 A;  3BQ7 A;  3IDW A;  4PZO A;  1LKY A;  1V38 A;  3BS5 B;  4IS7 A;  1Z1V A;  5JRT A;  2EAP A;  1PK3 A;  1PK1 A;  5J8Y A;  1OW5 A;  5KNI A;  1SGG A;  5JU5 A;  4NJ8 A;  2E8M A;  5J8Y C;  3TAD A;  2B6G A;  1X66 A;  2D3D A;  3TAD C;  1PK1 B;  3BS5 A;  2EAN A;  5L1M A;  2FE9 A;  2Y9T A;  4RQM A;  3H8M A;  2KSO B;  2LMR A;  1UQV A;  3SEI A;  1SXE A;  2QB0 A;  2KIV A;  2QKQ A;  2ESE A;  2EAO A;  2F44 A;  2KMD A;  3TAC B;  2JV3 A;  2F8K A;  2YTU A;  2QB0 B;  1WWU A;  2QB1 A;  4RQN A;  1JI7 A;  2KSO A;  1SXD A;  1X40 A;  2DKX A;  1KW4 A;  2E8N A;  1COK A;  4MHV A;  1B0X A;  3HIL A;  2E8O A;  2KG5 A;  1RG6 A;  1B4F A;  2D8C A;  2L5Y A; 
#chains in the Genus database with same CATH topology
 5DBC A;  5J2H A;  2AHO B;  8ICJ A;  4Y2T A;  3T5J A;  1S97 A;  9ICU A;  1BPX A;  4FZL A;  3WKA A;  2W7P A;  5ALV A;  4UB1 A;  2KE7 A;  2FPK A;  2FLN A;  7ICK A;  1DOQ A;  3ZDD A;  3RH6 A;  5GTH U;  1SKS A;  4AYB F;  1JRO A;  3QX7 A;  5AM0 A;  2ATL A;  3AM9 A;  5J0Y A;  2ZIU B;  2IOF K;  1MA7 A;  5L1L A;  2VJ5 A;  3GV5 B;  2WAQ C;  1TKD A;  4EX6 A;  1TE2 A;  4OJ5 A;  1N61 A;  5KFS A;  1DGS A;  5DDY A;  1XS9 D;  1H38 A;  2DPI A;  4ECR A;  1ZQN A;  4DOC A;  1D9F A;  2HSZ A;  2DUY A;  2JZB A;  2XY5 A;  2FI1 A;  2C2E A;  1A0P A;  4YP3 A;  3WK4 A;  5KFB A;  3PR4 A;  9ICG A;  1GO3 F;  7ICL A;  2QB0 A;  1SWW A;  3RJJ A;  4QW8 A;  5AKZ A;  2UVR A;  3LYS A;  3GIM A;  3F2D A;  1L7P A;  3C1Z A;  4DF4 A;  2BCV A;  3M9M B;  2E1E A;  4Y2J A;  4JWN A;  3C2M A;  4UAS A;  4O3S A;  4RNO A;  2PI4 A;  1MC8 A;  4FO6 A;  2KV2 A;  3N4M B;  5A0L A;  4DL4 A;  2NRT A;  5KFI A;  2W8L A;  4ED0 A;  8ICZ A;  3PZP A;  2JEJ A;  3SAH A;  1OXJ A;  2C2D A;  1UPH A;  4EBE A;  4LZD A;  4KLO A;  2F1H A;  5J2G A;  2KNJ A;  2K60 A;  8ICO A;  3IN5 A;  4DSF A;  4NLC A;  4KLS A;  3BQ0 A;  2NYV A;  3SEN A;  7ICJ A;  5AKX A;  2H3F A;  3RJE A;  4DEZ A;  1A77 A;  5AK5 A;  5KFE A;  1Q46 A;  3MDA A;  4QIW C;  2HCF A;  5AHX A;  5KFH A;  4CF5 A;  2JEI A;  1UT8 A;  5KFP A;  3QUT A;  4Q45 A;  2J6T A;  4ED2 A;  2ZIU A;  5ALD A;  3CNH A;  4M04 A;  4QZD A;  3AUO A;  3Q8R B;  1ZQC A;  5CRX A;  4GXK A;  5BOL A;  4R65 A;  2LBO A;  2HOI A;  3TAN A;  1Z4O A;  2DPJ A;  8ICK A;  3IV6 A;  4KLG A;  4UAV A;  2AXT U;  8ICP A;  2MRL A;  5ALY A;  2ZTD A;  2AGO A;  2KIV A;  3TAQ A;  4OCZ A;  1BPD A;  3QUC A;  4BWM A;  5AM3 A;  5HP4 A;  2F1I A;  2HHV A;  2KHV A;  1V97 A;  2XIC A;  4C4R A;  4DLG A;  1PVP A;  5AKJ A;  1K1Q A;  2LHT A;  3NUQ A;  1PVQ A;  2AQ4 A;  4EBD A;  1T4G A;  3SAG A;  1QH9 A;  3E0F A;  5DG9 A;  2OH2 A;  2K4E A;  2JR5 A;  4Y2Y A;  2W03 A;  4F2R A;  7ICO A;  2CRX A;  2DF4 B;  3AQF A;  2NRW A;  1RG6 A;  3V6J A;  4OJP A;  5KFM A;  4ED3 A;  4MEY A;  3PX4 A;  5KG5 A;  3TQ1 A;  5AIA A;  1KKX A;  1Q8K A;  2GLE A;  2Y9U A;  8ICQ A;  4PZN A;  4F5Q A;  4BX9 C;  3OJU A;  3EUB 2;  5DQH A;  2VAN A;  4J9S A;  5AM4 A;  1FIQ A;  7ICM A;  3C23 A;  1A76 A;  3B0X A;  3O0F A;  4BJQ A;  2FMS A;  2QAR B;  5KAF U;  1ZQU A;  1UCV A;  1XWL A;  2GOL A;  4MEX A;  4UBB A;  4QIW F;  7ICG A;  3UM9 A;  5DQG A;  3KOO A;  4QZI A;  2XCA A;  4O5K A;  4RNM A;  3RFA A;  3LDA A;  3HWT A;  1PK3 A;  3PW0 A;  1BPY A;  1OW5 A;  1SGG A;  9ICN A;  1T3Q A;  4MFA A;  3M9N B;  2JRZ A;  1NZB A;  5L1M A;  5KG0 A;  4US9 A;  8ICB A;  2Z7J A;  3D2Q A;  2F1J A;  4PL2 A;  3MR5 A;  3FC4 A;  3UMG A;  4EZ9 A;  3NGD A;  3SEI A;  3T5L A;  1SKW A;  3SV3 A;  1BNP A;  4F71 A;  7ICU A;  2BQR A;  1XU4 A;  4DSK A;  5KT6 A;  3PSP A;  3RR7 A;  2G0A A;  2YMQ A;  2CPR A;  1HUZ A;  1SXD A;  3AN1 A;  1B43 A;  2BGW A;  1KFT A;  1Z00 B;  2KVC A;  1NNL A;  2P35 A;  3GIK A;  3GV8 B;  4F91 B;  1Z19 A;  2H3Q A;  1B22 A;  5J2F A;  4GC7 A;  4ECX A;  5ALX A;  2HOQ A;  1ZD5 A;  1F5S A;  2XO7 A;  2P6R A;  3FM9 A;  2L5Y A;  3I1Y A;  5GTI U;  4IRC A;  7ICE A;  2V4R A;  5JTI A;  1SZP A;  3NRZ A;  3M8S A;  2ISP A;  3PW4 A;  1L7N A;  5CR0 A;  2BKE A;  2ZIW A;  2R8I A;  1WYG A;  4DSL A;  1RXV A;  1LKY B;  1TFR A;  3A0B U;  1BPZ A;  5CEH A;  2YML A;  3TAP A;  1ZQT A;  5DQI A;  1RZT A;  4I27 A;  2ALZ A;  3C5G A;  3NVW A;  3N97 B;  2BHN A;  3PW2 A;  4EEK A;  4KLE A;  5AK4 A;  4UAW A;  5L1K A;  1RDF A;  2E1F A;  4JB3 A;  2BDP A;  2EZY A;  2UVU A;  4QNL A;  9ICE A;  4UW9 A;  8ICA A;  4RQ1 A;  8ICE A;  4I2E A;  2ZUB A;  5KFJ A;  3BQ1 A;  2NRZ A;  4RQ0 A;  1D8Y A;  4EEL A;  3C2L A;  3QEB Z;  4EEY A;  2HHU A;  3ALR A;  2WF7 A;  5AM5 A;  3HP6 A;  5AI8 A;  1VDV A;  2A1A A;  1X66 A;  2YN4 A;  1WG8 A;  1PK1 B;  5J0Q A;  1SWV A;  2EAN A;  4HYK A;  2BPF A;  3C28 A;  3VCB A;  1L8L A;  5ALQ A;  4YCX A;  4ELU A;  3WK6 A;  4DF8 A;  4TUR A;  3ISB A;  4FBT A;  2WF8 A;  1KEJ A;  5EE0 A;  4UB4 A;  1BNO A;  1SXE A;  2H3Z A;  1ZQ1 C;  3TAC B;  8ICV A;  2LM1 A;  3H7I A;  5ALS A;  1Q3U A;  1JRP A;  1WWU A;  5T14 A;  4YD1 A;  5ALN A;  4EYI B;  1ZQE A;  5EWF A;  2KKP A;  1TVA A;  4JWM A;  3Q8S B;  1B0X A;  2VKQ A;  4UAU A;  1NKC A;  1SL0 A;  4P0P B;  3MGI A;  1NK4 A;  5HR7 A;  3RJF A;  4NLZ A;  3BQ2 A;  2KIC A;  2W8K A;  3QU9 A;  4J9P A;  3HT3 A;  4KLF A;  1OUQ A;  1L7M A;  4KX5 A;  3Q8M A;  1ZQS A;  3LK9 A;  5TZV A;  1Z00 A;  2AQ0 A;  4PH5 A;  4ECY A;  1KLN A;  2HOF A;  3SAF A;  2ZJ8 A;  5F9N A;  1PUZ A;  4U6P A;  1Z4N A;  2LI6 A;  2XCP A;  1JN3 A;  4C8O A;  1X2I A;  4K4I A;  4ECW A;  9ICI A;  2G09 A;  3G6X A;  1WCN A;  4NL9 C;  3LVW A;  3KKA A;  5J0X A;  4C4S A;  3RB3 A;  1JXE A;  3N7P D;  5IIO A;  3L3F X;  1U9L A;  2FPL A;  5BOM A;  3TI0 A;  1L7O A;  4B9S A;  3SI8 A;  2PXI A;  2RP5 A;  1XO1 A;  2ZXI A;  1LKY A;  3GIJ A;  1L3S A;  4P4P A;  4BGD A;  2R8H A;  4UB6 U;  5KT7 A;  5AKL A;  3PX0 A;  3KHH A;  2KN7 A;  2JXJ A;  4RPZ A;  2E8M A;  9ICX A;  3EW9 A;  2ZTE A;  2D3D A;  3TAD C;  4F5P A;  4KLI A;  2WF5 A;  2F77 X;  1IG6 A;  1N5X A;  3SR6 A;  2CXY A;  5H2F U;  4QWA A;  1X9S A;  1EXN A;  4Z6D A;  5DBB A;  4YXJ A;  2J6U A;  5KG1 A;  4F3O A;  2ESE A;  5B66 U;  3NVY A;  1SZH A;  4NY8 A;  1ZD4 A;  5KL8 B;  4FFD A;  4JK1 A;  2OEH A;  2QB0 B;  1NKE A;  2KZM A;  4DSI A;  1S77 D;  3TFR A;  4PJ0 U;  2WF9 A;  1U48 A;  3HPO A;  2E8N A;  5L9X A;  1ZQH A;  4IQW A;  4ELV A;  5J2K A;  4ZOH C;  3PSI A;  4RQ2 A;  5AK6 A;  1NK5 A;  3LWL A;  4JV2 A;  9ICH A;  1XNS A;  3MGH A;  3IG5 A;  4ED8 A;  1B4F A;  2W43 A;  5KFA A;  2JEG A;  2K8A A;  2LPE A;  2VJ4 A;  3GV7 B;  2I9G A;  1JUD A;  9ICV A;  2I6X A;  2FDR A;  4P0P A;  3Q8Q B;  5EE1 A;  2KFN A;  4RQ4 A;  4JV0 A;  2ES6 A;  4P2H A;  3S6J A;  1ZQD A;  3JPP A;  5AI5 A;  4J9M A;  3PR5 B;  4QZ8 A;  5AKY A;  1COO A;  2FLP A;  1ZJN A;  4EX7 A;  1ZXI A;  5AKK A;  4KLQ A;  5J2A A;  3D6J A;  1XC9 A;  3Q8K A;  2IBK A;  2KD1 A;  4F93 B;  5DDM A;  1Z1V A;  3BZK A;  2EAP A;  1JMS A;  3WK9 A;  1RXW A;  5J29 A;  3H8S A;  7ICF A;  2XY6 A;  1ZQI A;  2KFZ A;  2FLL A;  2RRD A;  3MC1 A;  4XRH A;  3V72 A;  2ZIX B;  5IIK A;  4ECU A;  2G5I B;  2G06 A;  3CW2 C;  3L4P A;  3CP8 A;  4JMU A;  3AEV A;  2LMR A;  1YZ6 A;  4TQS A;  1J97 A;  2ODG A;  2Q0Z X;  1KFS A;  2MUT B;  1U47 A;  2KOB A;  5CWR A;  4O3R A;  4F4W A;  1JAL A;  2M0N A;  3DV9 A;  4R8U A;  5G5H A;  2QB1 A;  3QXG A;  1JI7 A;  4B9M A;  5HR6 A;  1RPL A;  4MHV A;  3SQI A;  1HIW A;  4PHD A;  3QU2 A;  2F2A B;  3N28 A;  3IG8 A;  4UBC A;  5J2I A;  5AIB A;  3L5K A;  4KX3 A;  2WB1 C;  3G6V A;  3TAR A;  4ECQ A;  4B9V A;  1SIJ A;  3EWA A;  1C7Y A;  1S9F A;  2E3T A;  4ECT A;  3BQT A;  1N63 A;  3ONN A;  1S10 A;  3QU7 A;  3RBE A;  3KBB A;  4RT3 A;  3RJH A;  2C28 A;  2DFL A;  3ED5 A;  4TUQ A;  4MFC A;  4G9B A;  1RM6 C;  5DGB A;  4DL5 A;  2FPM A;  4DOA A;  5DG7 A;  3ICX A;  2HDO A;  3EYZ A;  3OPX A;  4RQ6 A;  4EBC A;  3QE9 Y;  2RLT A;  4ED1 A;  2JH1 A;  2EQY A;  4NLB A;  3JPT A;  5DB8 A;  2H3I A;  3H8W A;  1J2M A;  4BUG A;  3IDW A;  4PZO A;  7ICT A;  2OWO A;  2P6U A;  3V6H A;  4RQ8 A;  5CP2 A;  5AM2 A;  4UQG A;  1CUK A;  4GC6 A;  3NRW A;  2PFN A;  3QZ8 A;  5ALW A;  3KHL A;  4IQU A;  5KFC A;  4FE3 A;  2WAQ F;  4DL3 A;  4KLM A;  1ZQF A;  4TUS A;  1ECW A;  3NVV A;  1ZD3 A;  5HHH A;  2KMD A;  1CEZ A;  2ZIX A;  5ALJ A;  5ALR A;  3HKZ C;  4OJO A;  4QZE A;  3ZDB A;  2R8J A;  3MAB A;  4CE6 A;  3IHQ B;  3J81 j;  2JGA A;  7ICI A;  2HVI A;  2MUT A;  3OSP A;  5CA7 A;  4M9G A;  3DDH A;  5HMM A;  2ASL A;  4F92 B;  4NM2 A;  3MR2 A;  4YD2 A;  5KG7 A;  2WB1 F;  3RBD A;  3UQ2 A;  3LVV A;  1ZQY A;  4ZH4 A;  5DLG A;  4YMN A;  2HHQ A;  2W9C B;  1NK8 A;  1TK8 A;  3B0Y A;  3D2S A;  5DB9 A;  2VIX A;  2MA1 A;  3MFH A;  4I2F A;  1AQ6 A;  8ICS A;  5DGA A;  5FP0 A;  4GXI A;  4YVZ A;  1HJP A;  1JIH A;  4MF8 A;  2N1R A;  5F9L A;  5KT5 A;  4KIT B;  1WWV A;  1SV0 A;  3V6K A;  4I2I A;  4EYH B;  1L5U A;  3KFU F;  4C8K A;  4Z6F A;  1ZQL A;  2ZIW B;  5ALG A;  1X6I A;  4O5E A;  2JMG A;  5KFO A;  4NLK A;  3ISC A;  4TQR A;  4DQR A;  9ICQ A;  2RQ5 A;  2PMZ C;  4QWB A;  4IS7 A;  1J2N A;  3PV8 A;  3ZDA A;  4O5C A;  5C0Y A;  3H4B A;  1TK0 A;  3GFK B;  2RDI A;  5J8Y A;  1KRP A;  1BPE A;  3GDX A;  9ICW A;  2A3V A;  7ICV A;  2WFA A;  4DFK A;  4P0Q B;  3BZC A;  1QSS A;  5KT3 A;  8ICW A;  1S0V A;  2HBM A;  4QWC A;  4YG2 A;  1KL9 A;  4LJX A;  8ICI A;  3UXN A;  1L3T A;  4USA A;  3UQ0 A;  4R66 A;  4DCC A;  5AI6 A;  4DLE A;  4Y2S A;  3MR6 A;  2JV3 A;  2J6S A;  1N62 A;  3JPQ A;  3ZD8 A;  4RQN A;  4YN4 A;  1N60 A;  2HMX A;  2KIW A;  2MSN A;  1S5L U;  2VA2 A;  5DKW A;  2ZJ5 A;  8ICU A;  4GFJ A;  9ICO A;  3RJI A;  5AI9 A;  5CB1 A;  4C0Z A;  2E8O A;  2KG5 A;  1ZQR A;  3Q8L A;  5KL1 B;  2K4H A;  3KHG A;  4QWE A;  4PGY A;  1YT3 A;  4HAI A;  3T79 A;  2LYH A;  2W7O A;  1S8O A;  3N7R C;  5KFG A;  8ICT A;  4F2S A;  2F76 X;  5KFZ A;  1X9X A;  2DBY A;  5KFT A;  2W9C A;  1S0N A;  1RQN A;  3F5A A;  2BQ3 A;  4J9Q A;  2CN1 A;  3KD3 A;  4K4G A;  2PMZ F;  2G07 A;  3H0L B;  1XSL A;  3OSN A;  4YR3 A;  4FS2 A;  4QZA A;  5D49 A;  1LVH A;  1ZQJ A;  4B9L A;  1QSL A;  2IHM A;  3MBY A;  2OYY A;  4PHE A;  1ARO P;  2ZTC A;  4K4H A;  4YMM A;  1ZQV A;  4J9O A;  5IIL A;  1L3V A;  1DK3 A;  2W54 A;  4F5N A;  2KSO B;  3RTV A;  4NXZ A;  4FBU A;  3VC8 A;  5J2E A;  4P0Q A;  5AK3 A;  5KTQ A;  4UB3 A;  3ETL A;  3IRU A;  1V9P A;  1PZN A;  4CDG A;  4O3P A;  5C5J A;  2F8L A;  2DKX A;  3ETR A;  4QZG A;  3IM1 A;  3QYP A;  1DGJ A;  5J0P A;  3QUQ A;  3E2E A;  4C4T A;  2H3V A;  2RHF A;  3CYM A;  3OJS A;  4RZR A;  4DL2 A;  9ICS A;  1N2X A;  1ZD2 P;  2BCU A;  3WK7 A;  1VJ5 A;  5DBA A;  4KLU A;  5KFL A;  2G08 A;  1TAM A;  1QQ5 A;  4F8R A;  4Y2R A;  4P4M A;  2Q4T A;  3M1Y A;  4YMO A;  3T5H A;  4US8 A;  1WUD A;  1MQ3 A;  2K4P A;  1KDH A;  5J2J A;  3IP4 B;  4DFJ A;  3M6K A;  2JH7 A;  4RNN A;  3K1R B;  3RB4 A;  2DL0 A;  5J0U A;  5EWG A;  5AIC A;  4AP9 A;  2BPG A;  1Y88 A;  1QQ7 A;  3FAH A;  1X9W A;  1SKR A;  5DG8 A;  1RYR A;  3SV4 A;  4LVS A;  3JPN A;  5J2C A;  4RQ3 A;  2WF6 A;  2NO5 A;  2KZ3 A;  1T3N A;  2AGQ A;  4O0I A;  2FJ6 A;  3NS1 A;  4M2Y A;  3QUB A;  4I29 A;  4R63 A;  2P66 A;  3QU4 A;  3JPO A;  3PY8 A;  4M6W A;  4RQ7 A;  4KLD A;  1SL1 A;  1ZQO A;  5KFX A;  1XO0 A;  1QLN A;  1ZQW A;  2KSO A;  3ORY A;  3K1Z A;  2RDJ A;  1X40 A;  3THV A;  9ICM A;  3I28 A;  4IL6 U;  4R8U B;  2WHE A;  2I5H A;  4CCH A;  4I2B A;  2K8C B;  3PVX A;  1TAU A;  4ECZ A;  7ICP A;  1U49 A;  1TV9 A;  2HHW A;  4WJ3 B;  7ICQ A;  3MR3 A;  4ED7 A;  3HW8 A;  1FO4 A;  4F5R A;  7ICN A;  4PHP A;  2W55 A;  3G6Y A;  1DRG A;  1D8L A;  5DLF A;  2HHX A;  4ELT A;  4I2J A;  2NRV A;  9ICJ A;  1KN5 A;  4RPY A;  4DOB A;  3RRG A;  3KKA C;  4QJF B;  5F3X B;  2ZJA A;  2HHT A;  4CRX A;  1K5O A;  4R64 A;  1FEZ A;  4M0A A;  2JHD A;  2OCE A;  1QSY A;  4UB5 A;  2FMQ A;  3WKD A;  5CHG A;  4M47 A;  3EPG A;  1ZQM A;  4DWI A;  5IIM A;  2HVH A;  3AMZ A;  8ICX A;  3RAQ A;  2ZXH A;  4I28 A;  2AJQ A;  4Q43 A;  4GIB A;  3ZI4 A;  2B21 A;  8ICN A;  1JXL A;  4RQM A;  4ICA A;  3H8M A;  2KJ9 A;  3JPR A;  1URJ A;  4KLT A;  2JEF A;  3GU3 A;  3PMN A;  4DQP A;  1ZOL A;  2F44 A;  3HRD D;  5ALO A;  1C20 A;  2XID A;  2F8K A;  2YTU A;  2AU0 A;  4DL7 A;  1ZQX A;  3SD7 A;  3H8J A;  2V9W A;  3H0M B;  5KFQ A;  3OTQ A;  3C5F A;  4Y2V A;  4UAT A;  1U4B A;  3UXP A;  3B9J A;  2QLT A;  1NJX A;  2KK0 A;  4PGQ A;  1VLB A;  1KTQ A;  3C29 A;  1HUO A;  1NK9 A;  2VA3 A;  1NK6 A;  4LZG A;  3AQE A;  3M6Z A;  3C21 A;  4KLL A;  2DKZ A;  1X9M A;  4UAR A;  5KG2 A;  8ICY A;  1Z1B A;  4DQQ A;  4KLJ A;  4ECV A;  3RH5 A;  3PML A;  4F50 A;  2GO7 A;  4NV0 A;  1DXS A;  1N56 A;  4A8E A;  3NTU A;  5ALL A;  7ICH A;  5KT2 A;  1XSN A;  1IM4 A;  4BWJ A;  4Y2U A;  4I2C A;  2W3R A;  1A6S A;  4XA5 A;  3TFS A;  1V38 A;  5EE3 A;  4KN7 A;  4ED6 A;  3DEE A;  2ZUC A;  3UPQ A;  5JRT A;  2KVS A;  3ZDE A;  4NLN A;  2LYA A;  2W11 A;  3MDC A;  2BZF A;  3MGV A;  1D8B A;  4NJ8 A;  2EZZ A;  5JUM A;  1S76 D;  1N48 A;  2B0C A;  3GZF A;  4FZM A;  4B6J A;  1NKB A;  5KFV A;  4YFK A;  4YQW A;  4Q44 A;  1Z3E B;  1DK2 A;  3GQC A;  2GWS A;  8ICF A;  3RAX A;  3RB6 A;  5HNK A;  1ZYQ A;  3SYZ A;  4RUC A;  5KFY A;  1S0M A;  1U45 A;  4YR2 A;  2LYB A;  4DQS A;  2EAO A;  5AKH A;  4J9L A;  3FYH A;  3KZI U;  4C80 A;  2PFP A;  4O3Q A;  2A19 A;  4ECS A;  1ZQP A;  1O03 A;  1FFU A;  2AGP A;  1P7D A;  3D2N A;  4O3O A;  4Y2P A;  3TKA A;  2D6F C;  5CJ7 A;  1ED1 A;  3C2K A;  4OO1 J;  1MQ2 A;  5KT4 A;  3QNM A;  4M9L A;  2W9B B;  4NM1 A;  5KFD A;  4DSE A;  4NLG A;  9ICB A;  4Y2X A;  2PI5 A;  4TUP A;  4DS4 A;  2HBJ A;  5DB6 A;  4I2D A;  3H40 A;  2KKV A;  2PFO A;  5KG3 A;  4JUZ A;  2XY7 A;  2HHS A;  4UAZ A;  4XUS A;  1RYS A;  9ICC A;  2EAM A;  4PL1 A;  3BS7 A;  1MN8 A;  3V7J A;  1X6J A;  5AKI A;  3RJG A;  3AU2 A;  1K1S A;  2NV3 A;  5L1J A;  5ALI A;  4JV1 A;  5KFF A;  3PO5 A;  5TIS U;  2A1J B;  5HML A;  4QW9 A;  2DWQ A;  2Y1J A;  2ZUD A;  4J9N A;  4QWD A;  4M9H A;  1IIP A;  5J0T A;  3WKE A;  3F2C A;  1KBU A;  4CF4 A;  5KFU A;  5D4B A;  4DL6 A;  3M8R A;  2GH1 A;  3F53 A;  3PSF A;  3WKB A;  5D46 A;  5KFW A;  2M9N A;  2KHQ A;  3F5E A;  7ICS A;  1KSP A;  2OM6 A;  1D9D A;  1UA1 A;  1RQL A;  2YQE A;  5KAI U;  2DGZ A;  4CNQ A;  4UB8 U;  4Z6E A;  2K8B B;  2ZIV B;  4B9T A;  4PHA A;  1KW4 A;  3RB0 A;  1COK A;  1IXR A;  3ZD9 A;  3HJE A;  4KMU A;  1TK5 A;  2HI0 A;  3RF9 A;  3R9K A;  4F4Z A;  1ZQQ A;  4U7C A;  2IHN A;  1ZQG A;  5ALH A;  3EPI A;  3F2B A;  3LWM A;  2BPC A;  4F4X A;  2KJ5 A;  5KFK A;  3SMV A;  1RYU A;  1PVR A;  4ACO A;  4X5V A;  2HW3 A;  3HKZ F;  4OJ6 A;  2YY6 A;  1UA0 A;  5J0R A;  4QZH A;  2ISO A;  4RU9 A;  1NK7 A;  5AI0 A;  2UVV A;  2E8P A;  1F0M A;  2W9B A;  2V4Q A;  3RR8 A;  5ALE A;  4QZF A;  1SV0 C;  1BPB A;  1O08 A;  1ZQB A;  2YB4 A;  3UXO A;  2XC9 A;  2K89 A;  3PST A;  3UMB A;  4YR0 A;  4QZ9 A;  1NJY A;  3BJY A;  4BXO B;  3WU2 U;  1ZET A;  1SV4 A;  1KFD A;  3BQ7 A;  1LB2 B;  2XI9 A;  3ISD A;  5J2D A;  3KTQ A;  2BCR A;  1M6Y A;  1UHU A;  5E79 U;  3ZDC A;  1S0O A;  2E5S A;  4RUA A;  5ALK A;  2Y0S C;  2MAX A;  4CF3 A;  8ICC A;  1SB3 C;  4C7Y A;  5JU5 A;  4MFF A;  5J8Y C;  3NVZ A;  2C2R A;  4C8N A;  3MFI A;  2UVW A;  2G5H B;  3RJK A;  5ALP A;  4Q8F A;  4O3N A;  3WK5 A;  5IIJ A;  2A1J A;  1N5W A;  3K4G A;  1F44 A;  4QZC A;  8ICM A;  5EE9 A;  3PW5 A;  2OXO A;  4OJL A;  9ICA A;  4KTQ A;  1QTM A;  1KQQ A;  2MU2 A;  2YMP A;  9ICR A;  3GII A;  2KJ8 A;  4C7Z A;  2IOF A;  2OHF A;  4M6W B;  3PNC A;  3FDS A;  4UB2 A;  3JPS A;  2KTQ A;  2W3S A;  5ALF A;  5ALU A;  4M9J A;  5DB7 A;  8ICR A;  3HIL A;  5L1I A;  3AL0 B;  8ICG A;  3N7S C;  1MSW D;  3T3F A;  9ICK A;  5ALZ A;  1JX4 A;  2HBK A;  3T5K A;  3QEA Z;  5J2B A;  4Z6C A;  4DFM A;  3WKC A;  4GLX A;  2ZIV A;  5K4L A;  3E58 A;  5KG6 A;  2KZZ A;  2F3N A;  5AKE A;  4IR9 A;  8ICL A;  4XQ8 A;  3OGU A;  5KFR A;  3AU6 A;  5EWE A;  4IR1 A;  3SZ2 A;  2QAR A;  2R8K A;  3Q8P B;  4NWI A;  4NL9 A;  3HX0 A;  1FFV A;  1WCL A;  9ICL A;  2EZX A;  1ZQZ A;  4DO9 A;  4P4O A;  8ICH A;  4KN4 A;  5AKG A;  3A0H U;  4F72 A;  4FS1 A;  3M9O B;  4IQV A;  5III A;  1ZJM A;  9ICF A;  3BS5 B;  2BCQ A;  1QQ6 A;  2Y0S F;  4M9N A;  4C8M A;  1ZRN A;  1L8O A;  4E0D A;  4O3M A;  4BXO A;  3PW7 A;  2EDU A;  4UAY A;  5KNI A;  4B9N A;  2R18 A;  3CRX A;  5ALT A;  3TAD A;  1BGX T;  2ASD A;  2EH9 A;  2Y9T A;  1QCK A;  2WTF A;  3RRH A;  3OHB A;  2KP7 A;  3C1Y A;  1UQV A;  4CGZ A;  1NI3 A;  1NK0 A;  4EEN A;  1T7P A;  5KG4 A;  4I2G A;  1ZQA A;  1NJW A;  2QKQ A;  1CI4 A;  4RT2 A;  2LKY A;  5EOZ A;  9ICT A;  3KZX A;  4KMO B;  5G5G A;  2BQU A;  2W9M A;  2C22 A;  2BCS A;  3NAS A;  4DQI A;  7ICR A;  4PGX A;  2YB1 A;  2D8C A;  1L3U A;  1Q3V A;  2R8G A;  4IQT A;  1BVS A;  5B5E U;  2KEY A;  4IC9 A;  5KFN A;  3EZ5 A;  3UMC A;  1NJZ A;  4KLH A;  2H5X A;  4DFD A;  3RH4 A;  2IA6 A;  1V85 A;  2HBL A;  4MF2 A;  5J0S A;  4IRD A;  4B9U A;  3U26 A;  4DSJ A;  1ZQK A;  2ZG6 A;  4I2A A;  4J03 A;  5J0O A;  4C8L A;  3OHA A;  1NZP A;  4AYB C;  4YXM A;  5J0W A;  3H0R B;  3PX6 A;  2LM4 A;  5AM1 A;  2IOH A;  4OD0 A;  4O9M A;  3V7L A;  4BDP A;  2YX8 A;  2K4I A;  1IV8 A;  3KHR A;  5AI4 A;  5ALM A;  2ASJ A;  3QU5 A;  2JZB B;  4GXJ A;  3K75 D;  4J9K A;  2AH5 A;  2FMP A;  2NO4 A;  1PK1 A;  4G3I A;  2BDU A;  1L6N A;  1ZRM A;  1T8E A;  4Y2Q A;  2B6G A;  2NRX A;  2Y1I A;  4F4Y A;  3BDP A;  4PPX A;  2XVT A;  3BS5 A;  1XSP A;  2FE9 A;  3QZ7 A;  1NOM A;  5IIN A;  2XGQ A;  4QZB A;  1TAQ A;  4EZ6 A;  1SL2 A;  2W9A A;  2O6K A;  2W04 A;  9ICP A;  1CRX A;  2VA8 A;  5HHI A;  4J9R A;  2BR0 A;  3H4D A;  3M7D A;  2DQN B;  3I76 A;  5BPC A;  4Q8E A;  2PKE A;  4RPX A;  4IRK A;  3GIL A;  4FZN A;  1HEK A;  3WK8 A;  1X42 A;  3V7K A;  4F4K A;  2I1Q A;  4RQ5 A;  3PO4 A;  4I2H A;  4DS5 A;  2XGP A;  1UT5 A;  1LV5 A;  2IMW P;  2PFQ A;  1YZ7 A;  4DFP A;  1T94 A;  4F5O A;  2YMM A; 
#chains in the Genus database with same CATH homology
 2F3N A;  2LPE A;  1OXJ A;  2DKZ A;  2GLE A;  5JTI A;  2Y9U A;  2KE7 A;  1V85 A;  4PZN A;  2K60 A;  2QAR A;  1X9X A;  2E8P A;  2EAM A;  2K4P A;  1F0M A;  1WWV A;  3BS7 A;  1SV0 A;  4NL9 A;  1DXS A;  1SV0 C;  1LKY B;  4NL9 C;  2ES6 A;  3SEN A;  2QAR B;  3KKA A;  1UCV A;  3KKA C;  3K1R B;  2DL0 A;  5F3X B;  1SV4 A;  3BQ7 A;  3IDW A;  4PZO A;  1LKY A;  1V38 A;  3BS5 B;  4IS7 A;  1Z1V A;  5JRT A;  2EAP A;  1PK3 A;  1PK1 A;  5J8Y A;  1OW5 A;  5KNI A;  1SGG A;  5JU5 A;  4NJ8 A;  2E8M A;  5J8Y C;  3TAD A;  2B6G A;  1X66 A;  2D3D A;  3TAD C;  1PK1 B;  3BS5 A;  2EAN A;  5L1M A;  2FE9 A;  2Y9T A;  4RQM A;  3H8M A;  2KSO B;  2LMR A;  1UQV A;  3SEI A;  1SXE A;  2QB0 A;  2KIV A;  2QKQ A;  2ESE A;  2EAO A;  2F44 A;  2KMD A;  3TAC B;  2JV3 A;  2F8K A;  2YTU A;  2QB0 B;  1WWU A;  2QB1 A;  4RQN A;  1JI7 A;  2KSO A;  1SXD A;  1X40 A;  2DKX A;  1KW4 A;  2E8N A;  1COK A;  4MHV A;  1B0X A;  3HIL A;  2E8O A;  2KG5 A;  1RG6 A;  1B4F A;  2D8C A;  2L5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...