2GLEA

Solution structure of neurabin sam domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
b'GHMVHEWSVQQVSHWLVGLSLDQYVSEFSAQNISGEQLLQLDGNKLKALGMTSSQDRALVKKKLKEMKMSLEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurabin-1
publication title Structural characterization of the neurabin SAM domain
rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 20
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2gleA00
2K60A 2LMRA 1B4FA 3SENA 2EAMA 2ES6A 3HILA 2JV3A 1B0XA 1PK1A 3KKAA 1KW4A 2Y9UA 5JRTA 5J8YA 1JI7A 2DKXA 1X40A 2F8KA 3K1RB 3BS5B 2LPEA 2EAPA 2KG5A 1SV0C 1PK1B 2DKZA 3BS7A 2QB0A 3TACB 2QARB 3TADA 1SXEA 3BS5A 1SXDA 2E8NA 2KE7A 2EANA 2KSOB 1DXSA 2QARA 2QB0B 1WWUA 4PZOA 2KSOA 2D8CA 5L1MA 1LKYB 2ESEA 1SV4A 2KIVA 4NL9C 2Y9TA 2F3NA 3IDWA 4PZNA 2E8OA 1Z1VA 1LKYA 1V38A 1OXJA 2B6GA 2L5YA 4IS7A 1SV0A 3SEIA 5JU5A 2FE9A 4MHVA 2D3DA 3H8MA 2QB1A 2YTUA 1X66A 1OW5A 4RQMA 3KKAC 1PK3A 5J8YC 4RQNA 2E8MA 1UQVA 5JTIA 2GLEA 2F44A 5F3XB 1COKA 1SGGA 2KMDA 5KNIA 2K4PA 1F0MA 3TADC 1X9XA 3BQ7A 1V85A 2DL0A 2EAOA 4NJ8A 1WWVA 4NL9A 1RG6A 2QKQA 2E8PA 1UCVA
chains in the Genus database with same CATH superfamily
5DKWA 2JEIA 3HKZC 9ICIA 1ZQMA 5IIOA 2Q4TA 4KLEA 2H3IA 5CJ7A 1QH9A 2J6SA 5KFHA 1UPHA 2DKXA 1ZJNA 2OCEA 5HHHA 3T3FA 4YR3A 5TZVA 1RXWA 3A0BU 3ISCA 9ICGA 1TAUA 4ED2A 4GXKA 4DLEA 3LVVA 1XSPA 1L7OA 3EWAA 4C8OA 3OTQA 4IRKA 2KIWA 4R63A 4J9MA 5KG7A 3C1ZA 1SL1A 3LK9A 2NV3A 1SKSA 4PZOA 1K1QA 3M6ZA 5ALFA 2Y1IA 1URJA 5J0YA 2V9WA 8ICJA 3TAPA 3Q8KA 4YVZA 2EZYA 1D9FA 4RUCA 3ZDDA 1NK5A 4F4WA 2KN7A 2NO5A 1ZD3A 4EEYA 4M04A 4YP3A 3HPOA 4I2IA 3KD3A 1TAQA 2M0NA 5EE9A 5TISU 3HT3A 2BQUA 1HJPA 3H7IA 8ICTA 2W11A 4Y2QA 1RYSA 4PH5A 2F44A 5BPCA 1UHUA 5IINA 2VA3A 4CGZA 1FIQA 1ZQAA 2C2EA 8ICHA 9ICTA 3MFIA 3PX0A 4YQWA 4DSIA 2QKQA 1N2XA 1YZ7A 3ISDA 1Z00B 1ZQLA 4F5PA 4QZ8A 4E0DA 3UXPA 3RR8A 1N61A 5KT7A 4GLXA 2CPRA 3ETLA 1U4BA 5J0RA 5EE3A 3TARA 4PHEA 4ECWA 5J2CA 2HBLA 5ALNA 3Q8SB 1BPEA 2K8BB 1RZTA 2ATLA 2WF9A 2WFAA 1TE2A 1FFVA 5AM2A 5KG1A 4TQSA 3GIMA 3HJEA 2JH7A 3VC8A 3GV7B 5AKGA 1NJYA 4IL6U 2XY6A 2XGPA 2XCPA 3VCBA 4MF2A 2LHTA 2W7PA 2KSOA 5J2HA 3E0FA 3WK7A 2XICA 8ICCA 9ICKA 4TURA 5EWGA 4J9PA 8ICMA 1LKYB 4I2EA 7ICNA 2ESEA 5C0YA 1U48A 2DQNB 5F9LA 3IDWA 3JPPA 9ICUA 3L5KA 1Q46A 1L6NA 3CW2C 3ICXA 2IHMA 4DQRA 8ICGA 2YTUA 4UB6U 8ICOA 5BOLA 8ICEA 2RDJA 3RBEA 3WKBA 2MUTA 9ICPA 1UQVA 2I9GA 4QZCA 3BDPA 2LI6A 2XY5A 2FPMA 2BR0A 1KTQA 4RUAA 2KJ5A 2BCQA 3KTQA 4XA5A 2G5IB 4CF5A 5KFRA 7ICKA 2RLTA 1F0MA 3BQ7A 3ZDEA 4OJOA 2GH1A 2WF7A 8ICZA 1A6SA 2AQ0A 4O5CA 5DQGA 4PHAA 5KFZA 4QW8A 4ECZA 2FMSA 3RFAA 3T5JA 1Q8KA 1SWVA 3PSTA 2CRXA 2ES6A 2HBMA 4R8UB 2JV3A 3PW5A 1RYRA 4I2GA 2H3FA 5KFBA 5AI4A 4J9KA 3T79A 2KFZA 5C5JA 2HMXA 1X40A 2IA6A 3RH6A 1ZD4A 2F8LA 2I6XA 1ZQNA 4NLCA 3SAFA 3K4GA 4JUZA 2QB0A 3TADA 4DO9A 3UQ2A 2AQ4A 4KLHA 5CEHA 2FI1A 3SV3A 3MGVA 4CRXA 1K1SA 4I2DA 5DB7A 5BOMA 4OCZA 4QZGA 1S97A 1BNOA 5KTQA 4FZMA 4B9SA 3GZFA 3UMBA 4F8RA 4RQ0A 2K8CB 2XGQA 2IOFA 4NM1A 4O5KA 1ZQSA 2XCAA 1ECWA 4F93B 1ZQVA 2FE9A 3O0FA 4QNLA 1SB3C 3QUBA 4DL2A 4R64A 2E8MA 4B9LA 1KN5A 1WUDA 4KLIA 4YG2A 3UXNA 3C21A 2GO7A 2GLEA 4ED6A 3PY8A 4DSEA 5EE1A 5KFUA 5ALDA 3OSNA 4KITB 3TADC 4NLGA 4P4OA 4QWDA 1N5XA 1ZD5A 3KZXA 4O3OA 3I76A 4DLGA 2G07A 4ED1A 4NL9A 1ZRMA 3PSFA 5FP0A 4UB4A 7ICRA 2E8PA 2K60A 4EYIB 3D2NA 4KLSA 3AL0B 4GXIA 3MDAA 1F44A 5DBBA 4UB5A 4EEKA 3V7KA 2JEGA 1CUKA 4MEXA 4PL1A 4O5EA 3GDXA 1DK2A 5AIBA 1Z00A 2HHVA 3FDSA 5H2FU 3V7LA 3T5HA 4NLBA 1NJXA 2F8KA 2HCFA 4EX6A 3T5LA 3B0XA 3SAHA 1MC8A 3WK8A 2ZJ5A 3SR6A 3KHRA 5DG7A 1S9FA 3B9JA 4ED0A 1ZQEA 4QWAA 2HSZA 5ALXA 1IM4A 1Y88A 4HYKA 1KKXA 3F5AA 4RQ8A 1Z19A 2W03A 3AN1A 2HVHA 1PUZA 4NL9C 1O03A 2LYHA 4TUSA 4U7CA 2XC9A 4M6WB 3JPNA 8ICUA 1BPZA 4O3PA 3PMLA 1KLNA 4EBDA 3BQTA 4Q44A 2DPJA 1L3UA 4F5QA 1HIWA 1X9MA 1LKYA 2B6GA 4DOAA 2ZUBA 4KLJA 3D6JA 4DWIA 5KFTA 3NASA 5JU5A 2PKEA 4MHVA 3ZD9A 3WU2U 4O0IA 4IQTA 1XS9D 4C4TA 5AIAA 2VJ4A 1RQLA 4JWNA 9ICNA 2G5HB 1SIJA 5J0SA 4RQ1A 9ICCA 4B9TA 4TUQA 8ICIA 4AP9A 3RTVA 1MQ2A 9ICFA 3E58A 5KG5A 5KFXA 5AM1A 1ZJMA 1F5SA 4US9A 1QQ6A 5DQIA 3IG8A 2YMMA 1UCVA 4QWEA 2LMRA 4KN7A 1JRPA 3MGHA 3GILA 3PZPA 1NK0A 5AM0A 4RT3A 3C1YA 2MU2A 3JPTA 5AI9A 1B43A 2AXTU 2JZBB 1B22A 1QSLA 5AI0A 8ICLA 3IM1A 5AI8A 3M1YA 4R8UA 2UVUA 1DGSA 2KVSA 5KL1B 1KEJA 2LM4A 3MR5A 2HOQA 1ZQKA 4M9HA 3IV6A 2H3ZA 2Y1JA 8ICFA 4GC6A 2ALZA 4I2CA 2H5XA 4ED3A 1BVSA 3SV4A 5DDMA 4PHDA 3NRZA 4P4MA 1C7YA 3SQIA 4YD2A 3DEEA 4KLFA 4Y2RA 2RQ5A 1RPLA 4KLMA 4KLLA 1Z4NA 5DQHA 2H3VA 3H4BA 4DS4A 2RHFA 4FZLA 4R65A 2DUYA 1QQ7A 1D8BA 1Z4OA 4A8EA 4GIBA 1WCNA 1NZBA 1JIHA 5J2IA 2K4HA 4ECTA 4KX5A 3ONNA 4YMOA 3HP6A 2L5YA 3BZKA 9ICMA 1SWWA 5L9XA 1T7PA 8ICSA 4JV1A 3QX7A 3QU4A 4Y2PA 3FAHA 5JTIA 3GV5B 2Q0ZX 5KFFA 4AYBC 4NWIA 2BQ3A 2MRLA 3THVA 1KDHA 1ZQOA 4F4XA 2NRXA 5AM5A 3H8JA 4KLTA 4DSLA 5K4LA 1T94A 5DG8A 3SENA 2EAMA 2UVWA 5L1IA 1XWLA 3HKZF 1NNLA 5KAFU 3LVWA 1H38A 2PI5A 2AGPA 1JXEA 2KKVA 4ECUA 4KLOA 1V9PA 1HUZA 2J6UA 3QU2A 4KMUA 2IMWP 5DGBA 1QTMA 3GIJA 3JPQA 5J29A 5KFPA 2O6KA 3RB3A 5KT6A 3H0MB 4Z6FA 1PVQA 5KFNA 3BS5B 3RJGA 5DDYA 2C28A 3BS7A 1L3VA 1CRXA 4DEZA 3RB4A 7ICUA 3WK6A 3WKDA 2WF6A 1SXEA 1NKCA 3OSPA 7ICHA 1SZHA 3PX6A 3ZDAA 2K4EA 4EYHB 3MDCA 2DPIA 2QB0B 5KFCA 2ZUCA 4Z6EA 1L7NA 3QU9A 2ZXIA 5B5EU 7ICGA 1X6JA 2UVRA 1NKEA 5AKIA 5KFVA 2FDRA 2W3SA 4QZBA 4DL4A 3H40A 2AH5A 4PZNA 2R8IA 4ECQA 3NRWA 4O3MA 4B9MA 3HW8A 5KG3A 1NI3A 4M2YA 4M6WA 2VIXA 4K4IA 3HRDD 4F92B 1JX4A 2UVVA 2IOHA 4JMUA 4ELVA 1XO0A 3M6KA 4JV2A 4J9RA 4BWMA 9ICVA 1VLBA 4BJQA 1S0VA 5HNKA 5ALOA 2YMPA 2DL0A 3N7SC 8ICKA 4I2HA 3T5KA 1TAMA 4EELA 4KTQA 3L4PA 5D4BA 4IQVA 4DQIA 4Q8FA 2EH9A 4EBCA 1ZQCA 5AKXA 2ODGA 2ZTEA 5AKYA 2KHVA 2K8AA 2PMZC 3FC4A 1XSLA 1X9SA 3RB6A 4FZNA 1SL0A 5J0QA 1N5WA 3MR2A 2MSNA 2JZBA 2LPEA 4YMNA 1ZXIA 3HX0A 3A0HU 1VDVA 1L5UA 5ALGA 4GC7A 5AKKA 2BPCA 3N4MB 2IBKA 1DRGA 1KL9A 2YY6A 4BX9C 1Z1BA 1COOA 3QNMA 3OHBA 2ASLA 4KMOB 7ICPA 1KBUA 3QYPA 4RNMA 3RJJA 1UA0A 5ALTA 2DWQA 4DFMA 3CYMA 2W9BB 9ICBA 3PW2A 4UAUA 4J9OA 1J2NA 5ALKA 5KG4A 4PL2A 4CF4A 2VA2A 5HR7A 5AM4A 3RH4A 4QIWC 9ICHA 1V97A 2BHNA 1XO1A 2WF8A 3NVVA 4F4YA 3GFKB 2XI9A 4UATA 9ICWA 2JXJA 5AHXA 2HW3A 3NVZA 4GFJA 1CEZA 3V72A 4PGQA 2R8HA 3PW0A 1AQ6A 1NOMA 5GTHU 1QLNA 2W9MA 5ALIA 3QEAZ 3N7PD 1L3TA 3MFHA 3FM9A 1QSSA 4RPZA 5J2EA 3I1YA 1S10A 3RBDA 4DL3A 2EZXA 1IG6A 2JGAA 4EBEA 2HBKA 2V4RA 4RQ4A 2BDUA 4I2AA 4M0AA 1TFRA 3RJIA 1S8OA 4EX7A 3EPIA 4P0PB 2QARB 2KEYA 2E1FA 3PSIA 3LWMA 3M9NB 1S0OA 3BS5A 3SZ2A 2H3QA 5KT3A 4JB3A 1M6YA 2YMLA 3F2BA 8ICWA 4PJ0U 2FPLA 1SKWA 2BGWA 2JR5A 4ECVA 3RJFA 4RPYA 3RJHA 2C22A 5KFDA 1TK0A 4ED7A 3QZ7A 1KQQA 3H0RB 3H8WA 5B66U 3NGDA 3IRUA 5KFMA 2KP7A 5ALRA 2KFNA 5DBCA 5IIJA 4UAZA 4USAA 2F2AB 1Z3EB 1T8EA 3F2DA 3ORYA 2XO7A 5ALUA 4QZDA 3UXOA 2HHSA 3FYHA 3SI8A 3C2MA 2F1HA 3MGIA 3K75D 4PPXA 4LVSA 2PFNA 4QWCA 2D6FC 1X9XA 2ZJAA 5CWRA 2WAQF 4DF4A 1RXVA 5GTIU 2OEHA 3GU3A 2HHUA 5J2KA 2G0AA 5AK6A 2KZMA 5KFAA 4IR1A 2PFQA 8ICPA 2LBOA 5KFOA 1KFDA 1WG8A 5KT4A 2WAQC 9ICQA 5J0UA 4C80A 2PXIA 2RP5A 4LZDA 2YN4A 5CR0A 3OGUA 3OPXA 4FBUA 2E5SA 2C2DA 4DL5A 1SKRA 3WKCA 4TUPA 4ELTA 4PGYA 1OUQA 3BQ1A 1SXDA 2E8NA 2K4IA 3ZDBA 4HAIA 3TI0A 2E3TA 2DFLA 7ICEA 5ALVA 1SL2A 4C7ZA 1AROP 3F2CA 5L1MA 9ICSA 1ZD2P 4NXZA 5AKEA 4RZRA 4CDGA 4OJ5A 4RU9A 4KLQA 1Z1VA 3CRXA 1A77A 4ECRA 3AQFA 5ALHA 5ALWA 4K4GA 4YN4A 1N48A 1X66A 2W9BA 3TKAA 3G6XA 1X9WA 5CHGA 3G6VA 4GXJA 5AKZA 4QZIA 3J81j 3QXGA 2YQEA 2CN1A 2VKQA 5AM3A 2Y0SC 4J9LA 8ICBA 2NRWA 3EW9A 3JPRA 2HDOA 2NRZA 5DBAA 1ZETA 5E79U 1WWVA 3Q8MA 9ICAA 3ZD8A 3C5FA 2LYAA 4UBBA 4IQUA 3AMZA 4QZHA 4RNNA 3HILA 4FBTA 1PK1A 1ZQ1C 5J2BA 3H0LB 2EQYA 3KKAA 3WK4A 5J0WA 4Y2YA 1JI7A 2HHTA 5DG9A 5DB6A 7ICMA 2KG5A 3RH5A 2VA8A 1BPYA 3CP8A 4RT2A 3UQ0A 2AGOA 5ALQA 5EWEA 4UB8U 3QEBZ 3I28A 5IIMA 4P0PA 3TQ1A 8ICNA 4JV0A 2QARA 3V6HA 1QQ5A 5KT5A 1YZ6A 2KNJA 3DDHA 3NVWA 3KHGA 4C7YA 2W8KA 1X6IA 1J2MA 4YCXA 5ALLA 2DBYA 5KFIA 1N60A 1XU4A 1KRPA 3GIIA 4IS7A 3R9KA 1BGXT 2ZTDA 4OD0A 4DL6A 4LJXA 4CNQA 3KKAC 2RRDA 5J0TA 1WYGA 1UT8A 2G08A 3AEVA 5AI6A 1HEKA 4J9SA 5G5GA 2KV2A 2YB1A 4YR0A 2W7OA 1JXLA 2W8LA 3SD7A 5CA7A 1IV8A 4ECXA 1D9DA 4AYBF 1NJZA 2KD1A 8ICVA 1NK8A 2NO4A 5J2AA 4RPXA 2R8JA 3F5EA 5DGAA 4FO6A 2NRTA 3N28A 1ZQTA 3AM9A 4Z6CA 4NY8A 4KX3A 4UB3A 9ICJA 2AU0A 2FLNA 7ICVA 2WTFA 1EXNA 2ZIWB 1KW4A 2Y9UA 2JMGA 3IP4B 3QE9Y 4Q43A 2R8KA 4O3NA 1ZQZA 2HVIA 1L7MA 4OJLA 3KBBA 3UM9A 4F4ZA 4UARA 4YMMA 1ZQHA 4XUSA 5J0PA 3WK5A 3AU6A 1MN8A 7ICIA 8ICYA 2ZG6A 5KFEA 5KFKA 4C4SA 3PO5A 4DQPA 3RB0A 3V6KA 1U47A 4MEYA 4IRDA 2OH2A 1D8LA 3AU2A 5JUMA 7ICJA 1ZQXA 4UAWA 4O3RA 2F3NA 2MAXA 4UB2A 1S0NA 5L1JA 1DK3A 2BCUA 3B0YA 4B9VA 2W9AA 4MF8A 9ICOA 1J97A 4ZOHC 3SEIA 1UA1A 4ECSA 1BPXA 4DCCA 2BPFA 4QJFB 4I27A 4RQMA 2KZ3A 3NS1A 1KFSA 2BKEA 3IHQB 2P6RA 4YD1A 1RYUA 4KLGA 5IILA 5HMMA 4P2HA 3DV9A 3QUCA 4CE6A 1ZQJA 3RAXA 3BQ0A 2I1QA 5KFYA 2HHWA 4BUGA 2HOIA 2XY7A 3KHHA 8ICQA 4C8KA 1BPBA 3RJKA 2HHQA 4DFJA 4KLUA 5J0OA 1ZQQA 2F1JA 4O3QA 5KFQA 3N7RC 4NV0A 1S76D 4F4KA 2W43A 4F50A 2PMZF 4ICAA 2P6UA 4FS2A 3K1RB 2B0CA 3QZ8A 3ALRA 2EAPA 4M9JA 1XSNA 4F91B 2XIDA 5DLGA 2XVTA 3ZDCA 2KOBA 3KZIU 1DXSA 2F77X 5DB8A 4RQ6A 3Q8RB 1ZQDA 2G06A 9ICRA 4UAVA 3EZ5A 1C20A 3OJSA 1WWUA 4B9UA 4UASA 3Q8LA 4Y2UA 5IIIA 7ICLA 4KLDA 4F2SA 4ELUA 4DQSA 4QWBA 2JH1A 2JRZA 1L3SA 1L7PA 1XC9A 3PW4A 1K5OA 1LB2B 3AQEA 4DSJA 5L1KA 3F53A 4UW9A 3H4DA 2JEFA 2G09A 4EZ9A 1HUOA 2W3RA 4UB1A 4QIWF 1IXRA 4Q8EA 2A1AA 3QUTA 7ICFA 4I2BA 2W04A 3UMGA 4RQ2A 5KG0A 4QW9A 5KFLA 2WB1F 1S5LU 3BZCA 1FEZA 1BPDA 2W54A 2BCVA 2P35A 4F71A 4Y2TA 3KHLA 4IRCA 4Y2JA 2OXOA 1MSWD 4K4HA 7ICQA 3TFRA 5AICA 2R8GA 1B0XA 4UQGA 1ZQPA 4M9LA 2WB1C 2Z7JA 3HWTA 2FLLA 3AUOA 4EENA 4F5RA 1RM6C 9ICEA 2F76X 3PR4A 4DFPA 1PVPA 1PK1B 1U45A 2ZIWA 2EZZA 1Q3VA 1DOQA 3K1ZA 2R18A 2LKYA 3LWLA 3QUQA 5AKHA 1X2IA 4YXJA 1ZQWA 4C4RA 4I29A 4NLZA 5ALYA 5KG2A 3C29A 1P7DA 5T14A 2KZZA 1YT3A 2Y9TA 2KKPA 3EYZA 1QSYA 4J03A 1L8LA 5ALZA 4O9MA 3IG5A 1V38A 4IQWA 1S77D 3QU5A 3SMVA 2W9CA 3M9MB 2RDIA 3OJUA 1A0PA 3WK9A 3MR6A 5HR6A 2ZTCA 5L1LA 3BQ2A 2PFPA 2A1JB 3SYZA 2A3VA 3NTUA 2BCSA 8ICAA 4C8MA 1RDFA 5AKJA 5J2GA 2BDPA 3RJEA 2K4PA 2GWSA 2GOLA 4TQRA 1ZRNA 2J6TA 3PR5B 5ALPA 2EDUA 5EE0A 4BDPA 4G3IA 4DFDA 4RQ3A 3MR3A 2WF5A 4P0QB 3PW7A 3C2LA 3UPQA 3PNCA 4NLKA 2ZUDA 4DOBA 2LYBA 4BWJA 2DF4B 2CXYA 2QLTA 3V7JA 1N63A 2FJ6A 2KJ9A 2YB4A 4MFCA 4KN4A 4B6JA 2FMPA 2ZIUB 4J9NA 3RRHA 3TANA 2OM6A 4PHPA 5HP4A 5EWFA 2KK0A 4BXOB 5IIKA 3KOOA 1L8OA 4ACOA 4DSFA 4I2JA 5KAIU 3GV8B 4M9GA 2BPGA 1X42A 2AGQA 5AK5A 1SZPA 1ZQFA 2VANA 2KTQA 4DQQA 3LDAA 2E1EA 2KVCA 2BCRA 3PO4A 1TKDA 2ISOA 2ASJA 2YMQA 2N1RA 4F5NA 4U6PA 2OYYA 3OHAA 7ICTA 5CRXA 2ZIVB 1NK4A 1N56A 3G6YA 1JUDA 4NM2A 1MQ3A 3C23A 3GIKA 2PFOA 1UT5A 4LZGA 5DB9A 2JHDA 1SV4A 1A76A 3U26A 3TAQA 3RRGA 2A19A 4CCHA 5J2JA 1OXJA 5CP2A 2PI4A 3M9OB 4QZ9A 1PVRA 2D3DA 1S0MA 5J0XA 3H8MA 4IR9A 4G9BA 1ZQGA 2LM1A 2IOFK 4ZH4A 4O3SA 1MA7A 2FPKA 2ZIXB 1NKBA 3N97B 1NK6A 2W55A 5KFWA 1JROA 4DOCA 5F3XB 3QU7A 2IHNA 2KMDA 5KNIA 2KICA 3S6JA 2KHQA 5D49A 2Y0SF 5ALEA 2HOFA 4YR2A 4Y2VA 1NK7A 1N62A 1GO3F 5AI5A 2AJQA 2B21A 3M8RA 1ZOLA 3RF9A 5KFJA 3M8SA 1ZQUA 1TK8A 1D8YA 1IIPA 1ZQIA 4Z6DA 3L3FX 3PVXA 1U9LA 3E2EA 3NUQA 1TVAA 5JRTA 3Q8QB 1NK9A 2FLPA 2HHXA 3D2SA 1FFUA 4RQ7A 5DLFA 3RR7A 5KT2A 1TK5A 5J2FA 1ZQYA 2JEJA 2OWOA 3TACB 2NYVA 4X5VA 4EZ6A 2F1IA 3IN5A 3WKEA 1NJWA 3M7DA 4J9QA 2C2RA 4NLNA 2MA1A 4CF3A 2VJ5A 4F3OA 4XRHA 2FMQA 3EUB2 4C0ZA 1ED1A 2D8CA 5HHIA 1LV5A 3C5GA 3Q8PB 3ED5A 3KFUF 2AHOB 3V6JA 5G5HA 3PMNA 3RAQA 3UMCA 7ICOA 1JMSA 5ALMA 5F9NA 5AKLA 3CNHA 1JALA 1DGJA 4F5OA 1XNSA 1SV0A 3JPOA 2KJ8A 3NVYA 4Q45A 2ZXHA 1T4GA 4M9NA 1OW5A 1ZYQA 2OHFA 4MFFA 1FO4A 4DL7A 9ICXA 4FS1A 5ALSA 2I5HA 4US8A 1U49A 4Y2SA 3EPGA 4FFDA 1COKA 1SGGA 5EOZA 2DGZA 2A1JA 8ICXA 5A0LA 3WKAA 4OO1J 1V85A 3C28A 2BQRA 4NJ8A 4WJ3B 4DS5A 3JPSA 4Y2XA 1VJ5A 2P66A 1B4FA 4XQ8A 2ASDA 3MC1A 4BGDA 5CB1A 3BJYA 4JK1A 3PV8A 4P0QA 3ETRA 4P4PA 4FE3A 1RQNA 3D2QA 4C8NA 3TFSA 4OJPA 5J8YA 2V4QA 4IC9A 4UBCA 4PGXA 4B9NA 1T3NA 2ZIUA 1O08A 4F2RA 4RQ5A 4QZAA 1SV0C 2DKZA 1CI4A 4BXOA 4OJ6A 2BZFA 8ICRA 5HMLA 3MABA 2KE7A 1T3QA 2EANA 2KSOB 4ECYA 2YX8A 1ZQRA 5AK3A 3ISBA 4QZEA 1LVHA 4I28A 1TV9A 1KFTA 4C8LA 3SAGA 1KSPA 2K89A 5D46A 4F72A 1Q3UA 2NRVA 1BNPA 2KIVA 3H8SA 2ZIVA 5KG6A 5KFGA 2ZJ8A 4YXMA 1NZPA 4M47A 2M9NA 2E8OA 4DFKA 4DSKA 1WCLA 4QZFA 3GQCA 2MUTB 3LYSA 5AK4A 2QB1A 4I2FA 4ED8A 4JWMA 1PK3A 7ICSA 5J8YC 4RQNA 3MBYA 5KL8B 9ICLA 4YFKA 2HBJA 4DF8A 2W9CB 3C2KA 1JN3A 2ISPA 1QCKA 5KFSA 5ALJA 3PSPA 1ZQBA 4R66A 2ZIXA 3PX4A 3ZI4A 2HI0A 2EAOA 5J2DA 1PZNA 4UAYA 4RNOA 1RG6A 2WHEA 4MFAA
chains in the Genus database with same CATH topology
2K60A 2LMRA 1B4FA 3SENA 2EAMA 2ES6A 3HILA 2JV3A 1B0XA 1PK1A 3KKAA 1KW4A 2Y9UA 5JRTA 5J8YA 1JI7A 2DKXA 1X40A 2F8KA 3K1RB 3BS5B 2LPEA 2EAPA 2KG5A 1SV0C 1PK1B 2DKZA 3BS7A 2QB0A 3TACB 2QARB 3TADA 1SXEA 3BS5A 1SXDA 2E8NA 2KE7A 2EANA 2KSOB 1DXSA 2QARA 2QB0B 1WWUA 4PZOA 2KSOA 2D8CA 5L1MA 1LKYB 2ESEA 1SV4A 2KIVA 4NL9C 2Y9TA 2F3NA 3IDWA 4PZNA 2E8OA 1Z1VA 1LKYA 1V38A 1OXJA 2B6GA 2L5YA 4IS7A 1SV0A 3SEIA 5JU5A 2FE9A 4MHVA 2D3DA 3H8MA 2QB1A 2YTUA 1X66A 1OW5A 4RQMA 3KKAC 1PK3A 5J8YC 4RQNA 2E8MA 1UQVA 5JTIA 2GLEA 2F44A 5F3XB 1COKA 1SGGA 2KMDA 5KNIA 2K4PA 1F0MA 3TADC 1X9XA 3BQ7A 1V85A 2DL0A 2EAOA 4NJ8A 1WWVA 4NL9A 1RG6A 2QKQA 2E8PA 1UCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K60 A;  2LMR A;  1B4F A;  3SEN A;  2EAM A;  2ES6 A;  3HIL A;  2JV3 A;  1B0X A;  1PK1 A;  3KKA A;  1KW4 A;  2Y9U A;  5JRT A;  5J8Y A;  1JI7 A;  2DKX A;  1X40 A;  2F8K A;  3K1R B;  3BS5 B;  2LPE A;  2EAP A;  2KG5 A;  1SV0 C;  1PK1 B;  2DKZ A;  3BS7 A;  2QB0 A;  3TAC B;  2QAR B;  3TAD A;  1SXE A;  3BS5 A;  1SXD A;  2E8N A;  2KE7 A;  2EAN A;  2KSO B;  1DXS A;  2QAR A;  2QB0 B;  1WWU A;  4PZO A;  2KSO A;  2D8C A;  5L1M A;  1LKY B;  2ESE A;  1SV4 A;  2KIV A;  4NL9 C;  2Y9T A;  2F3N A;  3IDW A;  4PZN A;  2E8O A;  1Z1V A;  1LKY A;  1V38 A;  1OXJ A;  2B6G A;  2L5Y A;  4IS7 A;  1SV0 A;  3SEI A;  5JU5 A;  2FE9 A;  4MHV A;  2D3D A;  3H8M A;  2QB1 A;  2YTU A;  1X66 A;  1OW5 A;  4RQM A;  3KKA C;  1PK3 A;  5J8Y C;  4RQN A;  2E8M A;  1UQV A;  5JTI A;  2GLE A;  2F44 A;  5F3X B;  1COK A;  1SGG A;  2KMD A;  5KNI A;  2K4P A;  1F0M A;  3TAD C;  1X9X A;  3BQ7 A;  1V85 A;  2DL0 A;  2EAO A;  4NJ8 A;  1WWV A;  4NL9 A;  1RG6 A;  2QKQ A;  2E8P A;  1UCV A; 
#chains in the Genus database with same CATH topology
 5DKW A;  2JEI A;  3HKZ C;  9ICI A;  1ZQM A;  5IIO A;  2Q4T A;  4KLE A;  2H3I A;  5CJ7 A;  1QH9 A;  2J6S A;  5KFH A;  1UPH A;  2DKX A;  1ZJN A;  2OCE A;  5HHH A;  3T3F A;  4YR3 A;  5TZV A;  1RXW A;  3A0B U;  3ISC A;  9ICG A;  1TAU A;  4ED2 A;  4GXK A;  4DLE A;  3LVV A;  1XSP A;  1L7O A;  3EWA A;  4C8O A;  3OTQ A;  4IRK A;  2KIW A;  4R63 A;  4J9M A;  5KG7 A;  3C1Z A;  1SL1 A;  3LK9 A;  2NV3 A;  1SKS A;  4PZO A;  1K1Q A;  3M6Z A;  5ALF A;  2Y1I A;  1URJ A;  5J0Y A;  2V9W A;  8ICJ A;  3TAP A;  3Q8K A;  4YVZ A;  2EZY A;  1D9F A;  4RUC A;  3ZDD A;  1NK5 A;  4F4W A;  2KN7 A;  2NO5 A;  1ZD3 A;  4EEY A;  4M04 A;  4YP3 A;  3HPO A;  4I2I A;  3KD3 A;  1TAQ A;  2M0N A;  5EE9 A;  5TIS U;  3HT3 A;  2BQU A;  1HJP A;  3H7I A;  8ICT A;  2W11 A;  4Y2Q A;  1RYS A;  4PH5 A;  2F44 A;  5BPC A;  1UHU A;  5IIN A;  2VA3 A;  4CGZ A;  1FIQ A;  1ZQA A;  2C2E A;  8ICH A;  9ICT A;  3MFI A;  3PX0 A;  4YQW A;  4DSI A;  2QKQ A;  1N2X A;  1YZ7 A;  3ISD A;  1Z00 B;  1ZQL A;  4F5P A;  4QZ8 A;  4E0D A;  3UXP A;  3RR8 A;  1N61 A;  5KT7 A;  4GLX A;  2CPR A;  3ETL A;  1U4B A;  5J0R A;  5EE3 A;  3TAR A;  4PHE A;  4ECW A;  5J2C A;  2HBL A;  5ALN A;  3Q8S B;  1BPE A;  2K8B B;  1RZT A;  2ATL A;  2WF9 A;  2WFA A;  1TE2 A;  1FFV A;  5AM2 A;  5KG1 A;  4TQS A;  3GIM A;  3HJE A;  2JH7 A;  3VC8 A;  3GV7 B;  5AKG A;  1NJY A;  4IL6 U;  2XY6 A;  2XGP A;  2XCP A;  3VCB A;  4MF2 A;  2LHT A;  2W7P A;  2KSO A;  5J2H A;  3E0F A;  3WK7 A;  2XIC A;  8ICC A;  9ICK A;  4TUR A;  5EWG A;  4J9P A;  8ICM A;  1LKY B;  4I2E A;  7ICN A;  2ESE A;  5C0Y A;  1U48 A;  2DQN B;  5F9L A;  3IDW A;  3JPP A;  9ICU A;  3L5K A;  1Q46 A;  1L6N A;  3CW2 C;  3ICX A;  2IHM A;  4DQR A;  8ICG A;  2YTU A;  4UB6 U;  8ICO A;  5BOL A;  8ICE A;  2RDJ A;  3RBE A;  3WKB A;  2MUT A;  9ICP A;  1UQV A;  2I9G A;  4QZC A;  3BDP A;  2LI6 A;  2XY5 A;  2FPM A;  2BR0 A;  1KTQ A;  4RUA A;  2KJ5 A;  2BCQ A;  3KTQ A;  4XA5 A;  2G5I B;  4CF5 A;  5KFR A;  7ICK A;  2RLT A;  1F0M A;  3BQ7 A;  3ZDE A;  4OJO A;  2GH1 A;  2WF7 A;  8ICZ A;  1A6S A;  2AQ0 A;  4O5C A;  5DQG A;  4PHA A;  5KFZ A;  4QW8 A;  4ECZ A;  2FMS A;  3RFA A;  3T5J A;  1Q8K A;  1SWV A;  3PST A;  2CRX A;  2ES6 A;  2HBM A;  4R8U B;  2JV3 A;  3PW5 A;  1RYR A;  4I2G A;  2H3F A;  5KFB A;  5AI4 A;  4J9K A;  3T79 A;  2KFZ A;  5C5J A;  2HMX A;  1X40 A;  2IA6 A;  3RH6 A;  1ZD4 A;  2F8L A;  2I6X A;  1ZQN A;  4NLC A;  3SAF A;  3K4G A;  4JUZ A;  2QB0 A;  3TAD A;  4DO9 A;  3UQ2 A;  2AQ4 A;  4KLH A;  5CEH A;  2FI1 A;  3SV3 A;  3MGV A;  4CRX A;  1K1S A;  4I2D A;  5DB7 A;  5BOM A;  4OCZ A;  4QZG A;  1S97 A;  1BNO A;  5KTQ A;  4FZM A;  4B9S A;  3GZF A;  3UMB A;  4F8R A;  4RQ0 A;  2K8C B;  2XGQ A;  2IOF A;  4NM1 A;  4O5K A;  1ZQS A;  2XCA A;  1ECW A;  4F93 B;  1ZQV A;  2FE9 A;  3O0F A;  4QNL A;  1SB3 C;  3QUB A;  4DL2 A;  4R64 A;  2E8M A;  4B9L A;  1KN5 A;  1WUD A;  4KLI A;  4YG2 A;  3UXN A;  3C21 A;  2GO7 A;  2GLE A;  4ED6 A;  3PY8 A;  4DSE A;  5EE1 A;  5KFU A;  5ALD A;  3OSN A;  4KIT B;  3TAD C;  4NLG A;  4P4O A;  4QWD A;  1N5X A;  1ZD5 A;  3KZX A;  4O3O A;  3I76 A;  4DLG A;  2G07 A;  4ED1 A;  4NL9 A;  1ZRM A;  3PSF A;  5FP0 A;  4UB4 A;  7ICR A;  2E8P A;  2K60 A;  4EYI B;  3D2N A;  4KLS A;  3AL0 B;  4GXI A;  3MDA A;  1F44 A;  5DBB A;  4UB5 A;  4EEK A;  3V7K A;  2JEG A;  1CUK A;  4MEX A;  4PL1 A;  4O5E A;  3GDX A;  1DK2 A;  5AIB A;  1Z00 A;  2HHV A;  3FDS A;  5H2F U;  3V7L A;  3T5H A;  4NLB A;  1NJX A;  2F8K A;  2HCF A;  4EX6 A;  3T5L A;  3B0X A;  3SAH A;  1MC8 A;  3WK8 A;  2ZJ5 A;  3SR6 A;  3KHR A;  5DG7 A;  1S9F A;  3B9J A;  4ED0 A;  1ZQE A;  4QWA A;  2HSZ A;  5ALX A;  1IM4 A;  1Y88 A;  4HYK A;  1KKX A;  3F5A A;  4RQ8 A;  1Z19 A;  2W03 A;  3AN1 A;  2HVH A;  1PUZ A;  4NL9 C;  1O03 A;  2LYH A;  4TUS A;  4U7C A;  2XC9 A;  4M6W B;  3JPN A;  8ICU A;  1BPZ A;  4O3P A;  3PML A;  1KLN A;  4EBD A;  3BQT A;  4Q44 A;  2DPJ A;  1L3U A;  4F5Q A;  1HIW A;  1X9M A;  1LKY A;  2B6G A;  4DOA A;  2ZUB A;  4KLJ A;  3D6J A;  4DWI A;  5KFT A;  3NAS A;  5JU5 A;  2PKE A;  4MHV A;  3ZD9 A;  3WU2 U;  4O0I A;  4IQT A;  1XS9 D;  4C4T A;  5AIA A;  2VJ4 A;  1RQL A;  4JWN A;  9ICN A;  2G5H B;  1SIJ A;  5J0S A;  4RQ1 A;  9ICC A;  4B9T A;  4TUQ A;  8ICI A;  4AP9 A;  3RTV A;  1MQ2 A;  9ICF A;  3E58 A;  5KG5 A;  5KFX A;  5AM1 A;  1ZJM A;  1F5S A;  4US9 A;  1QQ6 A;  5DQI A;  3IG8 A;  2YMM A;  1UCV A;  4QWE A;  2LMR A;  4KN7 A;  1JRP A;  3MGH A;  3GIL A;  3PZP A;  1NK0 A;  5AM0 A;  4RT3 A;  3C1Y A;  2MU2 A;  3JPT A;  5AI9 A;  1B43 A;  2AXT U;  2JZB B;  1B22 A;  1QSL A;  5AI0 A;  8ICL A;  3IM1 A;  5AI8 A;  3M1Y A;  4R8U A;  2UVU A;  1DGS A;  2KVS A;  5KL1 B;  1KEJ A;  2LM4 A;  3MR5 A;  2HOQ A;  1ZQK A;  4M9H A;  3IV6 A;  2H3Z A;  2Y1J A;  8ICF A;  4GC6 A;  2ALZ A;  4I2C A;  2H5X A;  4ED3 A;  1BVS A;  3SV4 A;  5DDM A;  4PHD A;  3NRZ A;  4P4M A;  1C7Y A;  3SQI A;  4YD2 A;  3DEE A;  4KLF A;  4Y2R A;  2RQ5 A;  1RPL A;  4KLM A;  4KLL A;  1Z4N A;  5DQH A;  2H3V A;  3H4B A;  4DS4 A;  2RHF A;  4FZL A;  4R65 A;  2DUY A;  1QQ7 A;  1D8B A;  1Z4O A;  4A8E A;  4GIB A;  1WCN A;  1NZB A;  1JIH A;  5J2I A;  2K4H A;  4ECT A;  4KX5 A;  3ONN A;  4YMO A;  3HP6 A;  2L5Y A;  3BZK A;  9ICM A;  1SWW A;  5L9X A;  1T7P A;  8ICS A;  4JV1 A;  3QX7 A;  3QU4 A;  4Y2P A;  3FAH A;  5JTI A;  3GV5 B;  2Q0Z X;  5KFF A;  4AYB C;  4NWI A;  2BQ3 A;  2MRL A;  3THV A;  1KDH A;  1ZQO A;  4F4X A;  2NRX A;  5AM5 A;  3H8J A;  4KLT A;  4DSL A;  5K4L A;  1T94 A;  5DG8 A;  3SEN A;  2EAM A;  2UVW A;  5L1I A;  1XWL A;  3HKZ F;  1NNL A;  5KAF U;  3LVW A;  1H38 A;  2PI5 A;  2AGP A;  1JXE A;  2KKV A;  4ECU A;  4KLO A;  1V9P A;  1HUZ A;  2J6U A;  3QU2 A;  4KMU A;  2IMW P;  5DGB A;  1QTM A;  3GIJ A;  3JPQ A;  5J29 A;  5KFP A;  2O6K A;  3RB3 A;  5KT6 A;  3H0M B;  4Z6F A;  1PVQ A;  5KFN A;  3BS5 B;  3RJG A;  5DDY A;  2C28 A;  3BS7 A;  1L3V A;  1CRX A;  4DEZ A;  3RB4 A;  7ICU A;  3WK6 A;  3WKD A;  2WF6 A;  1SXE A;  1NKC A;  3OSP A;  7ICH A;  1SZH A;  3PX6 A;  3ZDA A;  2K4E A;  4EYH B;  3MDC A;  2DPI A;  2QB0 B;  5KFC A;  2ZUC A;  4Z6E A;  1L7N A;  3QU9 A;  2ZXI A;  5B5E U;  7ICG A;  1X6J A;  2UVR A;  1NKE A;  5AKI A;  5KFV A;  2FDR A;  2W3S A;  4QZB A;  4DL4 A;  3H40 A;  2AH5 A;  4PZN A;  2R8I A;  4ECQ A;  3NRW A;  4O3M A;  4B9M A;  3HW8 A;  5KG3 A;  1NI3 A;  4M2Y A;  4M6W A;  2VIX A;  4K4I A;  3HRD D;  4F92 B;  1JX4 A;  2UVV A;  2IOH A;  4JMU A;  4ELV A;  1XO0 A;  3M6K A;  4JV2 A;  4J9R A;  4BWM A;  9ICV A;  1VLB A;  4BJQ A;  1S0V A;  5HNK A;  5ALO A;  2YMP A;  2DL0 A;  3N7S C;  8ICK A;  4I2H A;  3T5K A;  1TAM A;  4EEL A;  4KTQ A;  3L4P A;  5D4B A;  4IQV A;  4DQI A;  4Q8F A;  2EH9 A;  4EBC A;  1ZQC A;  5AKX A;  2ODG A;  2ZTE A;  5AKY A;  2KHV A;  2K8A A;  2PMZ C;  3FC4 A;  1XSL A;  1X9S A;  3RB6 A;  4FZN A;  1SL0 A;  5J0Q A;  1N5W A;  3MR2 A;  2MSN A;  2JZB A;  2LPE A;  4YMN A;  1ZXI A;  3HX0 A;  3A0H U;  1VDV A;  1L5U A;  5ALG A;  4GC7 A;  5AKK A;  2BPC A;  3N4M B;  2IBK A;  1DRG A;  1KL9 A;  2YY6 A;  4BX9 C;  1Z1B A;  1COO A;  3QNM A;  3OHB A;  2ASL A;  4KMO B;  7ICP A;  1KBU A;  3QYP A;  4RNM A;  3RJJ A;  1UA0 A;  5ALT A;  2DWQ A;  4DFM A;  3CYM A;  2W9B B;  9ICB A;  3PW2 A;  4UAU A;  4J9O A;  1J2N A;  5ALK A;  5KG4 A;  4PL2 A;  4CF4 A;  2VA2 A;  5HR7 A;  5AM4 A;  3RH4 A;  4QIW C;  9ICH A;  1V97 A;  2BHN A;  1XO1 A;  2WF8 A;  3NVV A;  4F4Y A;  3GFK B;  2XI9 A;  4UAT A;  9ICW A;  2JXJ A;  5AHX A;  2HW3 A;  3NVZ A;  4GFJ A;  1CEZ A;  3V72 A;  4PGQ A;  2R8H A;  3PW0 A;  1AQ6 A;  1NOM A;  5GTH U;  1QLN A;  2W9M A;  5ALI A;  3QEA Z;  3N7P D;  1L3T A;  3MFH A;  3FM9 A;  1QSS A;  4RPZ A;  5J2E A;  3I1Y A;  1S10 A;  3RBD A;  4DL3 A;  2EZX A;  1IG6 A;  2JGA A;  4EBE A;  2HBK A;  2V4R A;  4RQ4 A;  2BDU A;  4I2A A;  4M0A A;  1TFR A;  3RJI A;  1S8O A;  4EX7 A;  3EPI A;  4P0P B;  2QAR B;  2KEY A;  2E1F A;  3PSI A;  3LWM A;  3M9N B;  1S0O A;  3BS5 A;  3SZ2 A;  2H3Q A;  5KT3 A;  4JB3 A;  1M6Y A;  2YML A;  3F2B A;  8ICW A;  4PJ0 U;  2FPL A;  1SKW A;  2BGW A;  2JR5 A;  4ECV A;  3RJF A;  4RPY A;  3RJH A;  2C22 A;  5KFD A;  1TK0 A;  4ED7 A;  3QZ7 A;  1KQQ A;  3H0R B;  3H8W A;  5B66 U;  3NGD A;  3IRU A;  5KFM A;  2KP7 A;  5ALR A;  2KFN A;  5DBC A;  5IIJ A;  4UAZ A;  4USA A;  2F2A B;  1Z3E B;  1T8E A;  3F2D A;  3ORY A;  2XO7 A;  5ALU A;  4QZD A;  3UXO A;  2HHS A;  3FYH A;  3SI8 A;  3C2M A;  2F1H A;  3MGI A;  3K75 D;  4PPX A;  4LVS A;  2PFN A;  4QWC A;  2D6F C;  1X9X A;  2ZJA A;  5CWR A;  2WAQ F;  4DF4 A;  1RXV A;  5GTI U;  2OEH A;  3GU3 A;  2HHU A;  5J2K A;  2G0A A;  5AK6 A;  2KZM A;  5KFA A;  4IR1 A;  2PFQ A;  8ICP A;  2LBO A;  5KFO A;  1KFD A;  1WG8 A;  5KT4 A;  2WAQ C;  9ICQ A;  5J0U A;  4C80 A;  2PXI A;  2RP5 A;  4LZD A;  2YN4 A;  5CR0 A;  3OGU A;  3OPX A;  4FBU A;  2E5S A;  2C2D A;  4DL5 A;  1SKR A;  3WKC A;  4TUP A;  4ELT A;  4PGY A;  1OUQ A;  3BQ1 A;  1SXD A;  2E8N A;  2K4I A;  3ZDB A;  4HAI A;  3TI0 A;  2E3T A;  2DFL A;  7ICE A;  5ALV A;  1SL2 A;  4C7Z A;  1ARO P;  3F2C A;  5L1M A;  9ICS A;  1ZD2 P;  4NXZ A;  5AKE A;  4RZR A;  4CDG A;  4OJ5 A;  4RU9 A;  4KLQ A;  1Z1V A;  3CRX A;  1A77 A;  4ECR A;  3AQF A;  5ALH A;  5ALW A;  4K4G A;  4YN4 A;  1N48 A;  1X66 A;  2W9B A;  3TKA A;  3G6X A;  1X9W A;  5CHG A;  3G6V A;  4GXJ A;  5AKZ A;  4QZI A;  3J81 j;  3QXG A;  2YQE A;  2CN1 A;  2VKQ A;  5AM3 A;  2Y0S C;  4J9L A;  8ICB A;  2NRW A;  3EW9 A;  3JPR A;  2HDO A;  2NRZ A;  5DBA A;  1ZET A;  5E79 U;  1WWV A;  3Q8M A;  9ICA A;  3ZD8 A;  3C5F A;  2LYA A;  4UBB A;  4IQU A;  3AMZ A;  4QZH A;  4RNN A;  3HIL A;  4FBT A;  1PK1 A;  1ZQ1 C;  5J2B A;  3H0L B;  2EQY A;  3KKA A;  3WK4 A;  5J0W A;  4Y2Y A;  1JI7 A;  2HHT A;  5DG9 A;  5DB6 A;  7ICM A;  2KG5 A;  3RH5 A;  2VA8 A;  1BPY A;  3CP8 A;  4RT2 A;  3UQ0 A;  2AGO A;  5ALQ A;  5EWE A;  4UB8 U;  3QEB Z;  3I28 A;  5IIM A;  4P0P A;  3TQ1 A;  8ICN A;  4JV0 A;  2QAR A;  3V6H A;  1QQ5 A;  5KT5 A;  1YZ6 A;  2KNJ A;  3DDH A;  3NVW A;  3KHG A;  4C7Y A;  2W8K A;  1X6I A;  1J2M A;  4YCX A;  5ALL A;  2DBY A;  5KFI A;  1N60 A;  1XU4 A;  1KRP A;  3GII A;  4IS7 A;  3R9K A;  1BGX T;  2ZTD A;  4OD0 A;  4DL6 A;  4LJX A;  4CNQ A;  3KKA C;  2RRD A;  5J0T A;  1WYG A;  1UT8 A;  2G08 A;  3AEV A;  5AI6 A;  1HEK A;  4J9S A;  5G5G A;  2KV2 A;  2YB1 A;  4YR0 A;  2W7O A;  1JXL A;  2W8L A;  3SD7 A;  5CA7 A;  1IV8 A;  4ECX A;  1D9D A;  4AYB F;  1NJZ A;  2KD1 A;  8ICV A;  1NK8 A;  2NO4 A;  5J2A A;  4RPX A;  2R8J A;  3F5E A;  5DGA A;  4FO6 A;  2NRT A;  3N28 A;  1ZQT A;  3AM9 A;  4Z6C A;  4NY8 A;  4KX3 A;  4UB3 A;  9ICJ A;  2AU0 A;  2FLN A;  7ICV A;  2WTF A;  1EXN A;  2ZIW B;  1KW4 A;  2Y9U A;  2JMG A;  3IP4 B;  3QE9 Y;  4Q43 A;  2R8K A;  4O3N A;  1ZQZ A;  2HVI A;  1L7M A;  4OJL A;  3KBB A;  3UM9 A;  4F4Z A;  4UAR A;  4YMM A;  1ZQH A;  4XUS A;  5J0P A;  3WK5 A;  3AU6 A;  1MN8 A;  7ICI A;  8ICY A;  2ZG6 A;  5KFE A;  5KFK A;  4C4S A;  3PO5 A;  4DQP A;  3RB0 A;  3V6K A;  1U47 A;  4MEY A;  4IRD A;  2OH2 A;  1D8L A;  3AU2 A;  5JUM A;  7ICJ A;  1ZQX A;  4UAW A;  4O3R A;  2F3N A;  2MAX A;  4UB2 A;  1S0N A;  5L1J A;  1DK3 A;  2BCU A;  3B0Y A;  4B9V A;  2W9A A;  4MF8 A;  9ICO A;  1J97 A;  4ZOH C;  3SEI A;  1UA1 A;  4ECS A;  1BPX A;  4DCC A;  2BPF A;  4QJF B;  4I27 A;  4RQM A;  2KZ3 A;  3NS1 A;  1KFS A;  2BKE A;  3IHQ B;  2P6R A;  4YD1 A;  1RYU A;  4KLG A;  5IIL A;  5HMM A;  4P2H A;  3DV9 A;  3QUC A;  4CE6 A;  1ZQJ A;  3RAX A;  3BQ0 A;  2I1Q A;  5KFY A;  2HHW A;  4BUG A;  2HOI A;  2XY7 A;  3KHH A;  8ICQ A;  4C8K A;  1BPB A;  3RJK A;  2HHQ A;  4DFJ A;  4KLU A;  5J0O A;  1ZQQ A;  2F1J A;  4O3Q A;  5KFQ A;  3N7R C;  4NV0 A;  1S76 D;  4F4K A;  2W43 A;  4F50 A;  2PMZ F;  4ICA A;  2P6U A;  4FS2 A;  3K1R B;  2B0C A;  3QZ8 A;  3ALR A;  2EAP A;  4M9J A;  1XSN A;  4F91 B;  2XID A;  5DLG A;  2XVT A;  3ZDC A;  2KOB A;  3KZI U;  1DXS A;  2F77 X;  5DB8 A;  4RQ6 A;  3Q8R B;  1ZQD A;  2G06 A;  9ICR A;  4UAV A;  3EZ5 A;  1C20 A;  3OJS A;  1WWU A;  4B9U A;  4UAS A;  3Q8L A;  4Y2U A;  5III A;  7ICL A;  4KLD A;  4F2S A;  4ELU A;  4DQS A;  4QWB A;  2JH1 A;  2JRZ A;  1L3S A;  1L7P A;  1XC9 A;  3PW4 A;  1K5O A;  1LB2 B;  3AQE A;  4DSJ A;  5L1K A;  3F53 A;  4UW9 A;  3H4D A;  2JEF A;  2G09 A;  4EZ9 A;  1HUO A;  2W3R A;  4UB1 A;  4QIW F;  1IXR A;  4Q8E A;  2A1A A;  3QUT A;  7ICF A;  4I2B A;  2W04 A;  3UMG A;  4RQ2 A;  5KG0 A;  4QW9 A;  5KFL A;  2WB1 F;  1S5L U;  3BZC A;  1FEZ A;  1BPD A;  2W54 A;  2BCV A;  2P35 A;  4F71 A;  4Y2T A;  3KHL A;  4IRC A;  4Y2J A;  2OXO A;  1MSW D;  4K4H A;  7ICQ A;  3TFR A;  5AIC A;  2R8G A;  1B0X A;  4UQG A;  1ZQP A;  4M9L A;  2WB1 C;  2Z7J A;  3HWT A;  2FLL A;  3AUO A;  4EEN A;  4F5R A;  1RM6 C;  9ICE A;  2F76 X;  3PR4 A;  4DFP A;  1PVP A;  1PK1 B;  1U45 A;  2ZIW A;  2EZZ A;  1Q3V A;  1DOQ A;  3K1Z A;  2R18 A;  2LKY A;  3LWL A;  3QUQ A;  5AKH A;  1X2I A;  4YXJ A;  1ZQW A;  4C4R A;  4I29 A;  4NLZ A;  5ALY A;  5KG2 A;  3C29 A;  1P7D A;  5T14 A;  2KZZ A;  1YT3 A;  2Y9T A;  2KKP A;  3EYZ A;  1QSY A;  4J03 A;  1L8L A;  5ALZ A;  4O9M A;  3IG5 A;  1V38 A;  4IQW A;  1S77 D;  3QU5 A;  3SMV A;  2W9C A;  3M9M B;  2RDI A;  3OJU A;  1A0P A;  3WK9 A;  3MR6 A;  5HR6 A;  2ZTC A;  5L1L A;  3BQ2 A;  2PFP A;  2A1J B;  3SYZ A;  2A3V A;  3NTU A;  2BCS A;  8ICA A;  4C8M A;  1RDF A;  5AKJ A;  5J2G A;  2BDP A;  3RJE A;  2K4P A;  2GWS A;  2GOL A;  4TQR A;  1ZRN A;  2J6T A;  3PR5 B;  5ALP A;  2EDU A;  5EE0 A;  4BDP A;  4G3I A;  4DFD A;  4RQ3 A;  3MR3 A;  2WF5 A;  4P0Q B;  3PW7 A;  3C2L A;  3UPQ A;  3PNC A;  4NLK A;  2ZUD A;  4DOB A;  2LYB A;  4BWJ A;  2DF4 B;  2CXY A;  2QLT A;  3V7J A;  1N63 A;  2FJ6 A;  2KJ9 A;  2YB4 A;  4MFC A;  4KN4 A;  4B6J A;  2FMP A;  2ZIU B;  4J9N A;  3RRH A;  3TAN A;  2OM6 A;  4PHP A;  5HP4 A;  5EWF A;  2KK0 A;  4BXO B;  5IIK A;  3KOO A;  1L8O A;  4ACO A;  4DSF A;  4I2J A;  5KAI U;  3GV8 B;  4M9G A;  2BPG A;  1X42 A;  2AGQ A;  5AK5 A;  1SZP A;  1ZQF A;  2VAN A;  2KTQ A;  4DQQ A;  3LDA A;  2E1E A;  2KVC A;  2BCR A;  3PO4 A;  1TKD A;  2ISO A;  2ASJ A;  2YMQ A;  2N1R A;  4F5N A;  4U6P A;  2OYY A;  3OHA A;  7ICT A;  5CRX A;  2ZIV B;  1NK4 A;  1N56 A;  3G6Y A;  1JUD A;  4NM2 A;  1MQ3 A;  3C23 A;  3GIK A;  2PFO A;  1UT5 A;  4LZG A;  5DB9 A;  2JHD A;  1SV4 A;  1A76 A;  3U26 A;  3TAQ A;  3RRG A;  2A19 A;  4CCH A;  5J2J A;  1OXJ A;  5CP2 A;  2PI4 A;  3M9O B;  4QZ9 A;  1PVR A;  2D3D A;  1S0M A;  5J0X A;  3H8M A;  4IR9 A;  4G9B A;  1ZQG A;  2LM1 A;  2IOF K;  4ZH4 A;  4O3S A;  1MA7 A;  2FPK A;  2ZIX B;  1NKB A;  3N97 B;  1NK6 A;  2W55 A;  5KFW A;  1JRO A;  4DOC A;  5F3X B;  3QU7 A;  2IHN A;  2KMD A;  5KNI A;  2KIC A;  3S6J A;  2KHQ A;  5D49 A;  2Y0S F;  5ALE A;  2HOF A;  4YR2 A;  4Y2V A;  1NK7 A;  1N62 A;  1GO3 F;  5AI5 A;  2AJQ A;  2B21 A;  3M8R A;  1ZOL A;  3RF9 A;  5KFJ A;  3M8S A;  1ZQU A;  1TK8 A;  1D8Y A;  1IIP A;  1ZQI A;  4Z6D A;  3L3F X;  3PVX A;  1U9L A;  3E2E A;  3NUQ A;  1TVA A;  5JRT A;  3Q8Q B;  1NK9 A;  2FLP A;  2HHX A;  3D2S A;  1FFU A;  4RQ7 A;  5DLF A;  3RR7 A;  5KT2 A;  1TK5 A;  5J2F A;  1ZQY A;  2JEJ A;  2OWO A;  3TAC B;  2NYV A;  4X5V A;  4EZ6 A;  2F1I A;  3IN5 A;  3WKE A;  1NJW A;  3M7D A;  4J9Q A;  2C2R A;  4NLN A;  2MA1 A;  4CF3 A;  2VJ5 A;  4F3O A;  4XRH A;  2FMQ A;  3EUB 2;  4C0Z A;  1ED1 A;  2D8C A;  5HHI A;  1LV5 A;  3C5G A;  3Q8P B;  3ED5 A;  3KFU F;  2AHO B;  3V6J A;  5G5H A;  3PMN A;  3RAQ A;  3UMC A;  7ICO A;  1JMS A;  5ALM A;  5F9N A;  5AKL A;  3CNH A;  1JAL A;  1DGJ A;  4F5O A;  1XNS A;  1SV0 A;  3JPO A;  2KJ8 A;  3NVY A;  4Q45 A;  2ZXH A;  1T4G A;  4M9N A;  1OW5 A;  1ZYQ A;  2OHF A;  4MFF A;  1FO4 A;  4DL7 A;  9ICX A;  4FS1 A;  5ALS A;  2I5H A;  4US8 A;  1U49 A;  4Y2S A;  3EPG A;  4FFD A;  1COK A;  1SGG A;  5EOZ A;  2DGZ A;  2A1J A;  8ICX A;  5A0L A;  3WKA A;  4OO1 J;  1V85 A;  3C28 A;  2BQR A;  4NJ8 A;  4WJ3 B;  4DS5 A;  3JPS A;  4Y2X A;  1VJ5 A;  2P66 A;  1B4F A;  4XQ8 A;  2ASD A;  3MC1 A;  4BGD A;  5CB1 A;  3BJY A;  4JK1 A;  3PV8 A;  4P0Q A;  3ETR A;  4P4P A;  4FE3 A;  1RQN A;  3D2Q A;  4C8N A;  3TFS A;  4OJP A;  5J8Y A;  2V4Q A;  4IC9 A;  4UBC A;  4PGX A;  4B9N A;  1T3N A;  2ZIU A;  1O08 A;  4F2R A;  4RQ5 A;  4QZA A;  1SV0 C;  2DKZ A;  1CI4 A;  4BXO A;  4OJ6 A;  2BZF A;  8ICR A;  5HML A;  3MAB A;  2KE7 A;  1T3Q A;  2EAN A;  2KSO B;  4ECY A;  2YX8 A;  1ZQR A;  5AK3 A;  3ISB A;  4QZE A;  1LVH A;  4I28 A;  1TV9 A;  1KFT A;  4C8L A;  3SAG A;  1KSP A;  2K89 A;  5D46 A;  4F72 A;  1Q3U A;  2NRV A;  1BNP A;  2KIV A;  3H8S A;  2ZIV A;  5KG6 A;  5KFG A;  2ZJ8 A;  4YXM A;  1NZP A;  4M47 A;  2M9N A;  2E8O A;  4DFK A;  4DSK A;  1WCL A;  4QZF A;  3GQC A;  2MUT B;  3LYS A;  5AK4 A;  2QB1 A;  4I2F A;  4ED8 A;  4JWM A;  1PK3 A;  7ICS A;  5J8Y C;  4RQN A;  3MBY A;  5KL8 B;  9ICL A;  4YFK A;  2HBJ A;  4DF8 A;  2W9C B;  3C2K A;  1JN3 A;  2ISP A;  1QCK A;  5KFS A;  5ALJ A;  3PSP A;  1ZQB A;  4R66 A;  2ZIX A;  3PX4 A;  3ZI4 A;  2HI0 A;  2EAO A;  5J2D A;  1PZN A;  4UAY A;  4RNO A;  1RG6 A;  2WHE A;  4MFA A; 
#chains in the Genus database with same CATH homology
 2K60 A;  2LMR A;  1B4F A;  3SEN A;  2EAM A;  2ES6 A;  3HIL A;  2JV3 A;  1B0X A;  1PK1 A;  3KKA A;  1KW4 A;  2Y9U A;  5JRT A;  5J8Y A;  1JI7 A;  2DKX A;  1X40 A;  2F8K A;  3K1R B;  3BS5 B;  2LPE A;  2EAP A;  2KG5 A;  1SV0 C;  1PK1 B;  2DKZ A;  3BS7 A;  2QB0 A;  3TAC B;  2QAR B;  3TAD A;  1SXE A;  3BS5 A;  1SXD A;  2E8N A;  2KE7 A;  2EAN A;  2KSO B;  1DXS A;  2QAR A;  2QB0 B;  1WWU A;  4PZO A;  2KSO A;  2D8C A;  5L1M A;  1LKY B;  2ESE A;  1SV4 A;  2KIV A;  4NL9 C;  2Y9T A;  2F3N A;  3IDW A;  4PZN A;  2E8O A;  1Z1V A;  1LKY A;  1V38 A;  1OXJ A;  2B6G A;  2L5Y A;  4IS7 A;  1SV0 A;  3SEI A;  5JU5 A;  2FE9 A;  4MHV A;  2D3D A;  3H8M A;  2QB1 A;  2YTU A;  1X66 A;  1OW5 A;  4RQM A;  3KKA C;  1PK3 A;  5J8Y C;  4RQN A;  2E8M A;  1UQV A;  5JTI A;  2GLE A;  2F44 A;  5F3X B;  1COK A;  1SGG A;  2KMD A;  5KNI A;  2K4P A;  1F0M A;  3TAD C;  1X9X A;  3BQ7 A;  1V85 A;  2DL0 A;  2EAO A;  4NJ8 A;  1WWV A;  4NL9 A;  1RG6 A;  2QKQ A;  2E8P A;  1UCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...