3D2QA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
DRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, rna binding protein
molecule keywords Muscleblind-like protein 1
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2qA00
3D2SA 3D2NA 3D2QA 2E5SA
chains in the Genus database with same CATH superfamily
5AK4A 4DSEA 3H40A 4QZ9A 3MGVA 4DL3A 4HAIA 1BPXA 4M9LA 2KZMA 1MSWD 4DOAA 4KN4A 4UB5A 3OPXA 3H4DA 4I29A 4KLLA 2FE9A 3BQ7A 4F8RA 4KLFA 4NL9C 4RQ7A 4DL6A 4UB1A 1JUDA 2HMXA 4C4RA 2E8PA 3Q8PB 3A0HU 3EWAA 3SAGA 2C2DA 1X9MA 3JPNA 4R64A 2H3QA 1F0MA 1SKRA 3QYPA 2W3RA 5HR6A 1T8EA 4ELTA 1O08A 3LVWA 4Y2PA 4DQIA 2F1HA 1K1QA 4DF8A 2KICA 5AK5A 1V85A 1IXRA 4ECZA 4O3NA 2ISOA 4I2HA 2HVHA 2HI0A 3FAHA 3B0XA 2PI5A 3BZCA 2W9CA 1RZTA 3E0FA 3H8MA 2C22A 1PK3A 5IIIA 2E8MA 3JPPA 1WCLA 1L3TA 4DLGA 5AM1A 1KQQA 5KFXA 1KTQA 4CGZA 4UB2A 4PL1A 4YMNA 5AICA 1QSSA 4KLUA 2R8KA 2EQYA 5D49A 8ICKA 1Z1VA 1F44A 3NASA 1ZOLA 4F4ZA 3WK7A 4KITB 4BDPA 5ALJA 1IG6A 1X9WA 2RHFA 4CF5A 2A1JA 3IDWA 2JH7A 4I2BA 4O9MA 3HPOA 1BPEA 4QW9A 1ZQTA 4PPXA 4YR2A 3QEBZ 2JEFA 3OSPA 8ICMA 4GXKA 2JZBB 3B9JA 5CB1A 2BCVA 1OW5A 3ZDDA 3WU2U 1T3NA 3SENA 1U45A 5CEHA 2QARA 2W54A 2KK0A 2RP5A 4EYIB 2XI9A 1N63A 9ICMA 1B0XA 1NKBA 4C8LA 3MR6A 2AGPA 5CR0A 1IIPA 5AKYA 4B9TA 4UASA 3ZDAA 1ZQVA 9ICJA 1X6JA 1TV9A 3TI0A 5AI5A 9ICWA 4KLDA 8ICFA 1Z00B 2A1AA 5ALUA 4AYBC 1N62A 5KFZA 1RXWA 3C5GA 3ZDEA 2G5HB 3Q8QB 1RM6C 1NJZA 2NRVA 4Q43A 3SAFA 4M9GA 1Z3EB 2KZ3A 5DDYA 2DPIA 2W8LA 5DBBA 2W8KA 4YVZA 1ZQCA 2AH5A 1ZD2P 5F9NA 4B9NA 3SI8A 3N7SC 3ISDA 3JPOA 9ICPA 3DEEA 1S8OA 4GC6A 3BS5B 3UXPA 1TAUA 3TAPA 5KAFU 8ICCA 1RXVA 2J6TA 4TUSA 1ZQKA 1IV8A 5J0WA 2AHOB 4KLQA 2LYAA 4YMOA 2ZXIA 2Q0ZX 7ICJA 3CW2C 3S6JA 3QU4A 1V97A 4UB8U 1XO0A 4ED1A 1L8LA 2KOBA 3M9NB 4ECTA 2K89A 2K4HA 1ZQWA 8ICBA 2DFLA 3M6ZA 4Q44A 3T3FA 2HHXA 4NLCA 5B66U 1KBUA 2WF7A 2QKQA 1PUZA 2E8OA 2PFOA 4TURA 5ALKA 5KT3A 5T14A 2IA6A 3D6JA 1SL2A 2DPJA 2OHFA 3M9OB 3ONNA 2NO5A 2MSNA 3QU2A 3RH4A 2KD1A 2UVRA 1SZHA 4C8OA 4YCXA 5ALXA 4TQSA 4ZH4A 2HOIA 2XY7A 1UT8A 4NLBA 4DCCA 2WAQC 4PHPA 1T4GA 1ZQAA 1SXDA 4DO9A 2BPCA 4O3QA 7ICNA 4I2IA 4UB4A 8ICTA 4YN4A 3PSFA 1ZQQA 4NJ8A 4OJOA 2Y0SC 4BX9C 4MFAA 5IINA 1Q8KA 2EAOA 1U49A 5CP2A 2DKZA 4YXJA 3C29A 1JMSA 5KFYA 1PK1B 1BNPA 1N48A 4DQRA 3IG8A 1D8LA 4OD0A 3TARA 2PKEA 4J9MA 1KRPA 5J2DA 7ICVA 1L8OA 3T5LA 3OTQA 1QTMA 3EPGA 4QWEA 2A19A 3GFKB 2BCUA 2BDUA 4NL9A 4AYBF 4FZMA 4RU9A 7ICUA 1V9PA 2LI6A 5DBCA 3OHAA 1ZD3A 2W7PA 2DKXA 1NZBA 5FP0A 4ECUA 1M6YA 4JMUA 1NK8A 1KFTA 5KT7A 4K4GA 3RJKA 2W7OA 2PFNA 4UAUA 4DOCA 2EZYA 2P66A 3RJIA 4Y2YA 5KL1B 8ICIA 2JH1A 4BWMA 1ZQGA 5L9XA 3E58A 3D2QA 2FJ6A 2RLTA 3PSPA 2H3VA 2R8JA 1SWVA 2VKQA 4FBUA 5KG7A 4BXOB 5KL8B 4P4PA 3RFAA 3U26A 5KT6A 1KL9A 5J0OA 8ICUA 1S76D 3Q8MA 3DDHA 5ALRA 3EW9A 5G5GA 2W9CB 1DGJA 4FBTA 2V4RA 5AKLA 4NY8A 4BUGA 4KLJA 2ZTCA 5EWEA 2ZTDA 4KLMA 2RDJA 1KSPA 4QZIA 2LMRA 4Y2VA 1NJYA 2PMZC 4RUAA 3PY8A 3SAHA 2ASLA 1RPLA 4K4HA 3TQ1A 4M2YA 3HRDD 3H8SA 3NVWA 3SV3A 2E1FA 4YXMA 9ICQA 2W11A 5KG1A 5IIOA 4B9SA 1JN3A 1QSYA 3AQEA 2EAMA 2WF5A 2KP7A 1SXEA 5AKHA 4IS7A 4YG2A 3PW2A 2G0AA 3HW8A 2FMSA 2BZFA 3RR8A 5DB7A 3PX4A 2KEYA 4RNNA 2OYYA 2F3NA 8ICSA 3RAQA 1X42A 5ALGA 4KLTA 3DV9A 4IC9A 1QLNA 5ALZA 2H5XA 2LPEA 4EBEA 5KFFA 4F72A 1N61A 5KFTA 1ZQJA 3N4MB 5J0QA 1RDFA 1ZD4A 3ETRA 1T3QA 4ECVA 2VJ4A 2W9BB 1L7PA 4XQ8A 2ZIUB 4JWNA 4M9JA 5ALNA 2KIWA 3RF9A 1L3SA 4QJFB 3N97B 1HJPA 2M9NA 4FFDA 1QQ5A 4FE3A 2C2EA 2HW3A 4Q45A 4F4WA 3QXGA 4C8NA 2HHTA 3LVVA 4C80A 4I2AA 4ED2A 1NK5A 2G08A 1J2MA 5EWGA 3NVZA 3RR7A 3GIJA 5ALDA 3PW4A 3BS5A 3GQCA 4A8EA 4JV2A 2KFZA 2LYHA 5J0RA 2D8CA 1NK9A 5J2IA 4KLGA 1ZETA 4IRCA 5J8YC 5ALPA 3IG5A 2LM1A 1NK4A 4DL7A 4B9VA 8ICRA 5AM2A 3V6KA 4YR0A 3PO5A 3MGHA 5KNIA 3L3FX 3OJUA 3BZKA 4DSJA 4P0QA 3PMNA 1CUKA 2W04A 2OEHA 1CRXA 1KLNA 2KNJA 1TK0A 3MR2A 4UW9A 1UA1A 4NLNA 4JUZA 4I2FA 3Q8RB 1KFSA 4P0PB 4R8UB 4TUQA 2DWQA 5J2FA 4ACOA 1TK8A 4U6PA 2AXTU 4PH5A 2HHUA 5KFBA 4EELA 3WKBA 4OJ5A 1NKEA 4IRKA 2NRTA 4F5NA 1NI3A 4ED7A 2XC9A 2JXJA 7ICPA 1BGXT 4F5RA 2L5YA 3KHRA 4RQ8A 4NLGA 2K8AA 4YQWA 3BQ2A 4F4YA 5D46A 8ICQA 2ZIXA 2HBJA 2DF4B 3RH6A 5ALYA 2E5SA 1L3UA 1S77D 3FC4A 4US8A 2E1EA 5DKWA 3HJEA 1SV4A 3WKDA 4EX7A 4QWAA 4LVSA 2GLEA 4GLXA 4JWMA 8ICNA 2EDUA 3C1ZA 1NJXA 8ICLA 5C0YA 4UB6U 1MQ3A 5AK6A 3MGIA 3GIKA 1TK5A 4MEXA 2XICA 1ZQSA 3HP6A 5EE9A 3HT3A 1ZD5A 1L3VA 3JPRA 1SKWA 4EZ6A 2YMPA 2A1JB 3MDAA 4DL5A 4C8MA 1N5XA 3F5AA 9ICFA 5ALLA 4DSFA 7ICRA 2W9BA 4YP3A 4I2JA 1SGGA 3NTUA 2MUTB 4U7CA 4J9OA 9ICAA 4PGYA 1ZQOA 3PX6A 3C5FA 4P0QB 9ICXA 9ICLA 2G06A 4B9LA 3G6YA 3RJEA 3IM1A 1RG6A 3OSNA 3SMVA 2ZIVB 4OO1J 1Q46A 4MF2A 2GO7A 4KX5A 1B22A 8ICOA 3TANA 4DQQA 2YQEA 2C2RA 1T7PA 5J2CA 3RBDA 2JEGA 2LBOA 4F71A 3PSTA 1YZ6A 2HVIA 3I28A 3QU7A 5KG0A 5HHIA 2CRXA 5KFDA 3L5KA 4UAVA 5J2GA 5BPCA 3CNHA 4J9NA 3EYZA 3TFSA 4MHVA 3N7RC 3H0LB 1S0NA 5CJ7A 3ISBA 2JMGA 3OHBA 1VLBA 2KTQA 2LHTA 2KSOB 5KFAA 4FZNA 4O3PA 1SKSA 2G09A 2K4IA 3RB0A 2AGQA 2CN1A 2NRXA 2QLTA 1NNLA 2IOFK 4Y2XA 1X2IA 4TQRA 4LJXA 8ICJA 4QWDA 2YMLA 2KE7A 1ZQYA 3F2CA 2UVVA 2FLLA 4DL2A 1FEZA 8ICAA 2JEIA 3LWMA 1NK6A 5AKGA 2KN7A 2MA1A 1FFUA 3D2NA 1S97A 2KIVA 4O0IA 4CF3A 2ASDA 2KHQA 2ZJAA 1L6NA 4EBCA 4IQVA 3WKCA 4KN7A 1XS9D 5KFRA 2O6KA 5AIAA 3AQFA 8ICWA 3NVYA 2BQ3A 3UM9A 2DQNB 4KTQA 2EH9A 1XSLA 3V7JA 5DG8A 4GC7A 2KJ5A 5L1MA 4O5KA 5KG2A 2AQ4A 3N28A 4RT2A 2VANA 3VC8A 1JX4A 3QZ8A 4O5EA 3K75D 2QB0B 5AKIA 2EZXA 3GILA 1AROP 4Y2JA 1RYSA 9ICGA 1U48A 2WF8A 2PFQA 2ZUDA 3WK8A 1PZNA 5ALWA 4ICAA 5EWFA 5KFGA 4QZAA 1SV0C 5JTIA 4GIBA 1FFVA 3IHQB 3V6JA 3V7KA 2ZUBA 5DQGA 2HOFA 1JRPA 5KG5A 4J9QA 1DOQA 1MC8A 2W43A 1ZQMA 3O0FA 3K1RB 3MR5A 2W9MA 2YMQA 2P35A 2XY5A 2JRZA 3T5JA 3L4PA 2H3ZA 5ALIA 9ICKA 2KJ8A 1COOA 2MUTA 3Q8SB 3EZ5A 4F5QA 4M0AA 3MC1A 5J8YA 1NKCA 2PXIA 5DBAA 2NRWA 1KW4A 3Q8LA 5C5JA 2FMPA 3QUTA 2Y9TA 4EBDA 1J97A 2BPGA 3QE9Y 4J9SA 5D4BA 3GV7B 4M9NA 3QNMA 4OJ6A 3WKEA 2NYVA 5KFMA 3GZFA 2LKYA 4DQSA 1U4BA 1SL0A 5GTHU 4DS5A 2IOFA 4BJQA 2BGWA 3H0RB 1HEKA 4IRDA 7ICHA 4QZHA 5IIMA 4M47A 4E0DA 3JPTA 3AUOA 4KLHA 4QZBA 4NV0A 1X6IA 4LZGA 1N56A 3HWTA 5KT2A 5AHXA 5J29A 4I2EA 3SYZA 2NRZA 1ZQUA 3F2BA 2ZIXB 5CWRA 3THVA 1QH9A 4YMMA 3ALRA 4US9A 5J0XA 2MU2A 2C28A 5AI0A 3EPIA 4F5PA 1V38A 2H3FA 5HP4A 4G3IA 2D3DA 3NRZA 4R66A 7ICIA 5KFVA 5J2EA 2FLPA 1NOMA 3AU6A 1CEZA 5KFIA 3EUB2 1ZQPA 5AKEA 2JV3A 4P4OA 3ISCA 1K5OA 1L5UA 1IM4A 4EEYA 1TAMA 3K1ZA 4ED3A 2KKVA 2PMZF 2YB1A 2HCFA 5KFNA 2XIDA 2ODGA 1TFRA 2B6GA 1ZRNA 3M8RA 5DLGA 5KFKA 4DFKA 3BQTA 3NVVA 2HDOA 4PZOA 1MN8A 3MABA 1O03A 1XWLA 4EZ9A 4DWIA 3HKZF 3GU3A 5KFLA 5HR7A 5AK3A 4J9PA 3IV6A 4NXZA 5EOZA 7ICTA 4ECRA 5KFQA 2WB1F 2KFNA 2ATLA 9ICCA 3SEIA 1RYRA 5JU5A 2PFPA 3GV5B 9ICOA 4IQWA 2FLNA 1A6SA 5J0YA 4PZNA 4J03A 4JV1A 5DGBA 1ZQXA 1XSNA 4RQNA 2OH2A 5KFSA 4ELUA 5J2AA 5F9LA 9ICHA 2G5IB 3PO4A 1X9SA 8ICZA 4QZ8A 4JB3A 1OXJA 2KZZA 5GTIU 5ALTA 4ECXA 1LVHA 3M6KA 1ZRMA 1CI4A 1UT5A 3WK6A 3RJJA 4DOBA 4YFKA 3KOOA 3M9MB 3PX0A 2VJ5A 1HUZA 8ICPA 3CYMA 2GH1A 3C2MA 5TZVA 1L7MA 5L1IA 4DFDA 2ZIUA 3QZ7A 4I2CA 4PGXA 1ZQLA 3LK9A 4MEYA 2ZJ8A 4F92B 1SIJA 4Z6EA 3OGUA 3UXOA 5DG9A 3ZDBA 2W03A 1S0MA 1XU4A 5ALOA 1WG8A 3UMCA 2UVWA 1S9FA 2QB0A 2YN4A 3AMZA 5KG3A 3QU5A 2CXYA 4CE6A 1ED1A 2EAPA 1UCVA 4C8KA 4F2SA 1ZQRA 1ZJNA 4NWIA 1XC9A 5A0LA 3T5HA 4F4KA 3H8JA 5JRTA 1S10A 3A0BU 2IBKA 4OJLA 4F50A 3PNCA 2PI4A 8ICXA 1QQ7A 5J0UA 3BQ0A 4USAA 2EANA 9ICRA 1FIQA 4EX6A 2ALZA 1BPYA 9ICEA 2ZJ5A 1SZPA 5AKZA 4UB3A 2Z7JA 5DDMA 2BR0A 4EYHB 3TACB 2K8CB 3KKAC 2ZUCA 5KFWA 3NUQA 4DL4A 1SV0A 3ETLA 5AM3A 3C2LA 4IR1A 5L1KA 3I1YA 4QNLA 2ZTEA 1X9XA 5AKKA 5K4LA 3RB6A 4DSLA 3PW7A 5H2FU 4QZCA 5B5EU 3V7LA 2BQRA 3G6VA 1ZQZA 2BCQA 3SD7A 4DS4A 5DQHA 9ICVA 4RT3A 2F44A 5KFEA 7ICEA 1LB2B 5DB9A 4I2DA 2Y1JA 1ZQHA 3TKAA 2R8HA 3RJFA 2ZG6A 2ZIVA 2V9WA 3QU9A 5CRXA 1YT3A 2JHDA 1LKYB 2B21A 2EZZA 4ED8A 4RQ4A 3F53A 1TVAA 3M7DA 2N1RA 1J2NA 4IQUA 2MRLA 1PK1A 2RRDA 9ICIA 4CCHA 4PJ0U 5J2BA 7ICQA 4Z6DA 3KHHA 3T79A 4DFMA 1WCNA 2HSZA 4CF4A 2AGOA 5HMMA 2FPLA 5DQIA 4O5CA 4DSKA 2ZIWB 3QX7A 4UAZA 4FS2A 8ICYA 2BPFA 3V6HA 4I2GA 4F93B 4O3SA 2F2AB 2IOHA 1URJA 1KEJA 4DQPA 3LYSA 5J0SA 5HHHA 3J81j 3T5KA 5KFCA 1B4FA 4DF4A 1Z4NA 1MA7A 7ICFA 1NZPA 3RH5A 4RPZA 4O3RA 4Y2SA 1WWVA 4QZFA 4JK1A 4EENA 4ECSA 5KG4A 5AI4A 4BWJA 3MFHA 3JPQA 5L1JA 1TE2A 3GIIA 2VA8A 4WJ3B 2VA2A 2WFAA 5ALSA 8ICEA 1EXNA 2KV2A 2HBMA 4Q8FA 2AJQA 1JALA 1ZQBA 1WUDA 2F76X 3GV8B 2HOQA 4I27A 1H38A 2FI1A 2KSOA 4NLKA 4QZDA 4DSIA 3E2EA 4FZLA 3QEAZ 5DB6A 4KX3A 4NM1A 1C7YA 3KZIU 1VDVA 4PL2A 2AU0A 4CDGA 1F5SA 5ALHA 2GOLA 4F91B 4XA5A 3MR3A 4EEKA 5KT4A 1XSPA 2WAQF 3SV4A 1KN5A 2WB1C 2R8IA 4B9MA 4QWCA 2VA3A 1L7OA 3BDPA 1JROA 4DLEA 2F8KA 1S5LU 2DUYA 3H8WA 5AKJA 4DEZA 3ZD9A 9ICNA 1Q3UA 3SQIA 1JXLA 4FO6A 1HIWA 3C21A 5DB8A 4PGQA 1LKYA 5ALQA 3AL0B 4TUPA 2JGAA 4OJPA 1A77A 3HKZC 1AQ6A 4LZDA 4G9BA 3N7PD 7ICGA 4XUSA 2ESEA 2JZBA 2J6UA 4F5OA 1D9DA 1XNSA 3PMLA 5BOLA 7ICMA 2QARB 3RAXA 2LYBA 2ISPA 1KKXA 1X40A 2DBYA 2UVUA 3B0YA 2P6UA 1RQLA 3HX0A 1KFDA 4ECYA 3RJGA 2W9AA 2IHMA 1D9FA 4QWBA 4UBBA 3MBYA 4Y2UA 5EE0A 3PW5A 2HBKA 3V72A 2ES6A 1PVPA 4KLIA 3RB4A 8ICVA 3K4GA 1Z00A 2XCAA 3PR4A 5L1LA 2DL0A 3UXNA 4AP9A 4KLEA 3SZ2A 4RQ1A 2B0CA 2K60A 2XCPA 5AIBA 3NRWA 2NO4A 3KTQA 3ZDCA 3H7IA 3KBBA 5JUMA 1JIHA 3AM9A 1BNOA 2BQUA 4XRHA 3R9KA 3KKAA 4RPYA 2VIXA 4M6WA 5J2KA 7ICKA 4IR9A 5DLFA 4UAWA 2OCEA 4RPXA 1SWWA 5KAIU 2IMWP 1DK3A 3C28A 2HHWA 1U9LA 4R8UA 4M9HA 3RRHA 5AM4A 4J9KA 2ZIWA 4CNQA 3FYHA 5BOMA 2E3TA 4OCZA 4YR3A 4ED6A 3H4BA 4KMOB 3KHLA 2BKEA 5ALEA 2I1QA 3IRUA 4RQMA 3RTVA 5J0TA 1QSLA 1D8BA 1ZQDA 2KHVA 1COKA 1YZ7A 2P6RA 1BPDA 2BCRA 3M8SA 2FDRA 3FM9A 5CHGA 3CRXA 2YMMA 4CRXA 3RB3A 2BDPA 1K1SA 1Z19A 9ICUA 3BS7A 4ZOHC 3GIMA 9ICSA 3M1YA 1Q3VA 3I76A 3AU2A 5E79U 5G5HA 2F1IA 2XVTA 1NK0A 4PHAA 2FMQA 2WF6A 4C7ZA 3UQ0A 3RRGA 3VCBA 3KZXA 2R8GA 4ECWA 3GDXA 3ZD8A 2A3VA 3FDSA 2YB4A 5KTQA 1ZQFA 2RQ5A 4RUCA 3PSIA 5KG6A 2IHNA 5J2JA 4R63A 2ASJA 4PHEA 5J2HA 3NS1A 2OWOA 1ZYQA 3MDCA 1Z4OA 3TADC 2XGPA 5ALMA 2XGQA 2KKPA 1QQ6A 1WWUA 2YX8A 4YD2A 4Q8EA 1SL1A 5AI6A 4RNOA 3CP8A 2K4PA 3KFUF 4Y2QA 4Z6CA 2K4EA 2BHNA 4RQ0A 4UARA 4FS1A 4RQ3A 3WK9A 1UQVA 3AEVA 2I9GA 3IP4B 3BQ1A 4C4TA 3BJYA 4ED0A 3QUQA 5HMLA 1XO1A 4KLSA 3H0MB 1ZQEA 1N60A 7ICOA 5KFHA 2FPMA 3TAQA 4GXIA 3WK4A 1A76A 3KHGA 2XY6A 4J9RA 5EE1A 2JEJA 3RJHA 3OJSA 4QW8A 3C23A 3UMGA 1JXEA 1B43A 1FO4A 1VJ5A 4UAYA 2HHQA 1U47A 5KT5A 5AKXA 4J9LA 1HUOA 2KMDA 1ZQ1C 4ELVA 5AM5A 1DGSA 3LDAA 1NK7A 4O3MA 2ZXHA 4UATA 1PVQA 4RQ5A 2H3IA 7ICLA 4C7YA 4DFPA 4R65A 4PHDA 1WYGA 2FPKA 2R18A 1BVSA 4HYKA 4Z6FA 5IILA 2K8BB 4QIWF 2Y9UA 2KJ9A 2F77X 2KVCA 1TAQA 3SR6A 1ZQNA 3TFRA 3C1YA 3F5EA 5AM0A 3ED5A 5F3XB 4QIWC 4RQ2A 4QZEA 5CA7A 4X5VA 4BGDA 5KFPA 3Q8KA 4B9UA 1DK2A 1DXSA 4MFFA 1LV5A 1UA0A 7ICSA 3ICXA 3RBEA 4P4MA 3F2DA 4RZRA 4RNMA 3ZI4A 1MQ2A 5AI8A 1JI7A 4IQTA 5EE3A 1X66A 5DGAA 3WK5A 5HNKA 3PW0A 4B6JA 3WKAA 2GWSA 2WTFA 3QUCA 1KDHA 4IL6U 4BXOA 2Y0SF 4C4SA 2V4QA 2W3SA 2D6FC 2I6XA 3QUBA 1S0VA 1T94A 1N2XA 2OM6A 3D2SA 2MAXA 2OXOA 2E8NA 4UBCA 4ECQA 8ICGA 2JR5A 4F4XA 1OUQA 3KD3A 2Q4TA 1SB3C 2HHSA 2WHEA 1BPBA 4K4IA 5KFOA 5IIKA 1DRGA 2BCSA 4QZGA 2XO7A 1ECWA 2HBLA 5ALFA 2DGZA 4NLZA 4O3OA 5DG7A 1Z1BA 5KFUA 3G6XA 3TADA 3LWLA 4UQGA 2F1JA 1N5WA 3UQ2A 4P2HA 1D8YA 2Y1IA 3JPSA 4RQ6A 2RDIA 1ZQIA 2J6SA 1ZXIA 1QCKA 1P7DA 1ZJMA 1TKDA 3MFIA 3UMBA 5IIJA 2CPRA 4JV0A 4GFJA 3PV8A 9ICBA 3PVXA 4M6WB 5AI9A 4F2RA 2WF9A 1S0OA 1C20A 1BPZA 2NV3A 2M0NA 4GXJA 2QB1A 2YTUA 3UPQA 1UPHA 1NJWA 1GO3F 4MF8A 4C0ZA 1Y88A 4DFJA 3C2KA 5ALVA 1RYUA 1RQNA 4I28A 5J0PA 2AQ0A 8ICHA 4M04A 4P0PA 2F8LA 4F3OA 5TISU 5KFJA 4YD1A 3PZPA 1L7NA 2LM4A 1PVRA 4Y2TA 3NGDA 1UHUA 2G07A 4KMUA 4NM2A 2W55A 2KVSA 3PR5B 2HHVA 3AN1A 3ORYA 4MFCA 3HILA 2KG5A 2YY6A 2I5HA 3IN5A 9ICTA 1A0PA 4Y2RA 4KLOA
chains in the Genus database with same CATH topology
3HKZC 4JMUA 1DRGA 2KHVA 4NLCA 2H3FA 1ECWA 2HBLA 3N7PD 3O0FA 4OJ5A 1KBUA 3M6ZA 1ZQ1C 2DGZA 2JH7A 3N7RC 3H0LB 1Z1BA 3MGVA 2VJ4A 1XNSA 3CRXA 4CRXA 4O3MA 2JMGA 4QNLA 2W7OA 2ZXHA 2ZIUB 2LYBA 1PVQA 1Z19A 3M6KA 2H3IA 5T14A 2H3ZA 2K8AA 2LHTA 3RF9A 2KIWA 3OPXA 5KL1B 1Q3VA 4FZNA 4WJ3B 2JH1A 2HBJA 2ZIXA 2G09A 2R18A 2K4IA 2KJ8A 2VJ5A 4QJFB 2DF4B 3ONNA 3D2QA 2CN1A 3CYMA 3PSPA 2K8BB 4QIWF 2KV2A 2GH1A 2E5SA 2F77X 2HBMA 2KJ9A 2H3VA 2XVTA 2VKQA 4FE3A 2KVCA 2HBKA 1WUDA 2HMXA 5KL8B 2ZIUA 2E1EA 2F76X 1P7DA 2RP5A 2KD1A 2HOQA 2XI9A 3RFAA 3KZXA 3VCBA 1PVPA 1SZHA 3F2CA 2CPRA 3LVVA 3F5EA 1TAMA 3K1ZA 4GFJA 2KKVA 3SAGA 2ZG6A 2PMZF 2ZIVA 2G08A 2HOIA 2YB1A 2A3VA 2YB4A 5CRXA 1IIPA 1YT3A 2JHDA 4QIWC 2NV3A 2H3QA 2M0NA 2MA1A 3PSIA 4FZLA 4NLBA 5C0YA 3D2NA 2XIDA 2WAQC 4KX3A 5HR6A 4BUGA 2W03A 2KHQA 4OJ6A 1UPHA 1L6NA 3LVWA 3GZFA 3NRWA 3F53A 4A8EA 2XICA 4PL2A 4CDGA 3M7DA 2LKYA 2N1RA 4AYBC 1GO3F 2KICA 4C0ZA 2MRLA 3ICXA 3F2DA 3PSFA 1ED1A 2G5HB 2PMZC 4OJOA 2RRDA 2GOLA 2Y0SC 4BX9C 4BJQA 3SAHA 2KKPA 3H0RB 2WAQF 4NWIA 5A0LA 3AQFA 3F5AA 3HKZF 3SAFA 1HEKA 3GU3A 3T79A 2WB1C 2YX8A 2DQNB 5HR7A 2VIXA 4OJLA 3E0FA 2E1FA 2KJ5A 3IG5A 3C29A 4U7CA 3N7SC 3CP8A 2ZIWB 3AQEA 3DEEA 4P0QB 3KFUF 2K4EA 2Y0SF 3IG8A 2G06A 3L3FX 4P0PA 3C28A 4NV0A 3VC8A 2F8LA 2D6FC 2F2AB 2WB1F 2G0AA 1T94A 2ZIWA 3IP4B 4P0QA 1URJA 2OM6A 2W04A 3SMVA 1CRXA 3D2SA 2KNJA 2ZIVB 3PZPA 1Q3UA 4CGZA 2OXOA 3SQIA 1PVRA 4OO1J 4PL1A 2LYAA 2G07A 2KEYA 4KX5A 2ZXIA 2OYYA 3LYSA 2BDUA 4AYBF 3H0MB 4FZMA 3F2BA 4KMOB 1A6SA 2ZIXB 4ICAA 4IC9A 1HIWA 1F44A 1OUQA 4P0PB 2Z7JA 1XO0A 3ALRA 2Q4TA 3AL0B 2W7PA 4ACOA 4U6PA 2LBOA 2KOBA 3PSTA 1NZBA 1MA7A 2OH2A 2K8CB 2K89A 2JGAA 2RHFA 2K4HA 3IN5A 2HOFA 1D8BA 4OJPA 1A0PA 2CRXA 2G5IB 3NUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2S A;  3D2N A;  3D2Q A;  2E5S A; 
#chains in the Genus database with same CATH topology
 5AK4 A;  4DSE A;  3H40 A;  4QZ9 A;  3MGV A;  4DL3 A;  4HAI A;  1BPX A;  4M9L A;  2KZM A;  1MSW D;  4DOA A;  4KN4 A;  4UB5 A;  3OPX A;  3H4D A;  4I29 A;  4KLL A;  2FE9 A;  3BQ7 A;  4F8R A;  4KLF A;  4NL9 C;  4RQ7 A;  4DL6 A;  4UB1 A;  1JUD A;  2HMX A;  4C4R A;  2E8P A;  3Q8P B;  3A0H U;  3EWA A;  3SAG A;  2C2D A;  1X9M A;  3JPN A;  4R64 A;  2H3Q A;  1F0M A;  1SKR A;  3QYP A;  2W3R A;  5HR6 A;  1T8E A;  4ELT A;  1O08 A;  3LVW A;  4Y2P A;  4DQI A;  2F1H A;  1K1Q A;  4DF8 A;  2KIC A;  5AK5 A;  1V85 A;  1IXR A;  4ECZ A;  4O3N A;  2ISO A;  4I2H A;  2HVH A;  2HI0 A;  3FAH A;  3B0X A;  2PI5 A;  3BZC A;  2W9C A;  1RZT A;  3E0F A;  3H8M A;  2C22 A;  1PK3 A;  5III A;  2E8M A;  3JPP A;  1WCL A;  1L3T A;  4DLG A;  5AM1 A;  1KQQ A;  5KFX A;  1KTQ A;  4CGZ A;  4UB2 A;  4PL1 A;  4YMN A;  5AIC A;  1QSS A;  4KLU A;  2R8K A;  2EQY A;  5D49 A;  8ICK A;  1Z1V A;  1F44 A;  3NAS A;  1ZOL A;  4F4Z A;  3WK7 A;  4KIT B;  4BDP A;  5ALJ A;  1IG6 A;  1X9W A;  2RHF A;  4CF5 A;  2A1J A;  3IDW A;  2JH7 A;  4I2B A;  4O9M A;  3HPO A;  1BPE A;  4QW9 A;  1ZQT A;  4PPX A;  4YR2 A;  3QEB Z;  2JEF A;  3OSP A;  8ICM A;  4GXK A;  2JZB B;  3B9J A;  5CB1 A;  2BCV A;  1OW5 A;  3ZDD A;  3WU2 U;  1T3N A;  3SEN A;  1U45 A;  5CEH A;  2QAR A;  2W54 A;  2KK0 A;  2RP5 A;  4EYI B;  2XI9 A;  1N63 A;  9ICM A;  1B0X A;  1NKB A;  4C8L A;  3MR6 A;  2AGP A;  5CR0 A;  1IIP A;  5AKY A;  4B9T A;  4UAS A;  3ZDA A;  1ZQV A;  9ICJ A;  1X6J A;  1TV9 A;  3TI0 A;  5AI5 A;  9ICW A;  4KLD A;  8ICF A;  1Z00 B;  2A1A A;  5ALU A;  4AYB C;  1N62 A;  5KFZ A;  1RXW A;  3C5G A;  3ZDE A;  2G5H B;  3Q8Q B;  1RM6 C;  1NJZ A;  2NRV A;  4Q43 A;  3SAF A;  4M9G A;  1Z3E B;  2KZ3 A;  5DDY A;  2DPI A;  2W8L A;  5DBB A;  2W8K A;  4YVZ A;  1ZQC A;  2AH5 A;  1ZD2 P;  5F9N A;  4B9N A;  3SI8 A;  3N7S C;  3ISD A;  3JPO A;  9ICP A;  3DEE A;  1S8O A;  4GC6 A;  3BS5 B;  3UXP A;  1TAU A;  3TAP A;  5KAF U;  8ICC A;  1RXV A;  2J6T A;  4TUS A;  1ZQK A;  1IV8 A;  5J0W A;  2AHO B;  4KLQ A;  2LYA A;  4YMO A;  2ZXI A;  2Q0Z X;  7ICJ A;  3CW2 C;  3S6J A;  3QU4 A;  1V97 A;  4UB8 U;  1XO0 A;  4ED1 A;  1L8L A;  2KOB A;  3M9N B;  4ECT A;  2K89 A;  2K4H A;  1ZQW A;  8ICB A;  2DFL A;  3M6Z A;  4Q44 A;  3T3F A;  2HHX A;  4NLC A;  5B66 U;  1KBU A;  2WF7 A;  2QKQ A;  1PUZ A;  2E8O A;  2PFO A;  4TUR A;  5ALK A;  5KT3 A;  5T14 A;  2IA6 A;  3D6J A;  1SL2 A;  2DPJ A;  2OHF A;  3M9O B;  3ONN A;  2NO5 A;  2MSN A;  3QU2 A;  3RH4 A;  2KD1 A;  2UVR A;  1SZH A;  4C8O A;  4YCX A;  5ALX A;  4TQS A;  4ZH4 A;  2HOI A;  2XY7 A;  1UT8 A;  4NLB A;  4DCC A;  2WAQ C;  4PHP A;  1T4G A;  1ZQA A;  1SXD A;  4DO9 A;  2BPC A;  4O3Q A;  7ICN A;  4I2I A;  4UB4 A;  8ICT A;  4YN4 A;  3PSF A;  1ZQQ A;  4NJ8 A;  4OJO A;  2Y0S C;  4BX9 C;  4MFA A;  5IIN A;  1Q8K A;  2EAO A;  1U49 A;  5CP2 A;  2DKZ A;  4YXJ A;  3C29 A;  1JMS A;  5KFY A;  1PK1 B;  1BNP A;  1N48 A;  4DQR A;  3IG8 A;  1D8L A;  4OD0 A;  3TAR A;  2PKE A;  4J9M A;  1KRP A;  5J2D A;  7ICV A;  1L8O A;  3T5L A;  3OTQ A;  1QTM A;  3EPG A;  4QWE A;  2A19 A;  3GFK B;  2BCU A;  2BDU A;  4NL9 A;  4AYB F;  4FZM A;  4RU9 A;  7ICU A;  1V9P A;  2LI6 A;  5DBC A;  3OHA A;  1ZD3 A;  2W7P A;  2DKX A;  1NZB A;  5FP0 A;  4ECU A;  1M6Y A;  4JMU A;  1NK8 A;  1KFT A;  5KT7 A;  4K4G A;  3RJK A;  2W7O A;  2PFN A;  4UAU A;  4DOC A;  2EZY A;  2P66 A;  3RJI A;  4Y2Y A;  5KL1 B;  8ICI A;  2JH1 A;  4BWM A;  1ZQG A;  5L9X A;  3E58 A;  3D2Q A;  2FJ6 A;  2RLT A;  3PSP A;  2H3V A;  2R8J A;  1SWV A;  2VKQ A;  4FBU A;  5KG7 A;  4BXO B;  5KL8 B;  4P4P A;  3RFA A;  3U26 A;  5KT6 A;  1KL9 A;  5J0O A;  8ICU A;  1S76 D;  3Q8M A;  3DDH A;  5ALR A;  3EW9 A;  5G5G A;  2W9C B;  1DGJ A;  4FBT A;  2V4R A;  5AKL A;  4NY8 A;  4BUG A;  4KLJ A;  2ZTC A;  5EWE A;  2ZTD A;  4KLM A;  2RDJ A;  1KSP A;  4QZI A;  2LMR A;  4Y2V A;  1NJY A;  2PMZ C;  4RUA A;  3PY8 A;  3SAH A;  2ASL A;  1RPL A;  4K4H A;  3TQ1 A;  4M2Y A;  3HRD D;  3H8S A;  3NVW A;  3SV3 A;  2E1F A;  4YXM A;  9ICQ A;  2W11 A;  5KG1 A;  5IIO A;  4B9S A;  1JN3 A;  1QSY A;  3AQE A;  2EAM A;  2WF5 A;  2KP7 A;  1SXE A;  5AKH A;  4IS7 A;  4YG2 A;  3PW2 A;  2G0A A;  3HW8 A;  2FMS A;  2BZF A;  3RR8 A;  5DB7 A;  3PX4 A;  2KEY A;  4RNN A;  2OYY A;  2F3N A;  8ICS A;  3RAQ A;  1X42 A;  5ALG A;  4KLT A;  3DV9 A;  4IC9 A;  1QLN A;  5ALZ A;  2H5X A;  2LPE A;  4EBE A;  5KFF A;  4F72 A;  1N61 A;  5KFT A;  1ZQJ A;  3N4M B;  5J0Q A;  1RDF A;  1ZD4 A;  3ETR A;  1T3Q A;  4ECV A;  2VJ4 A;  2W9B B;  1L7P A;  4XQ8 A;  2ZIU B;  4JWN A;  4M9J A;  5ALN A;  2KIW A;  3RF9 A;  1L3S A;  4QJF B;  3N97 B;  1HJP A;  2M9N A;  4FFD A;  1QQ5 A;  4FE3 A;  2C2E A;  2HW3 A;  4Q45 A;  4F4W A;  3QXG A;  4C8N A;  2HHT A;  3LVV A;  4C80 A;  4I2A A;  4ED2 A;  1NK5 A;  2G08 A;  1J2M A;  5EWG A;  3NVZ A;  3RR7 A;  3GIJ A;  5ALD A;  3PW4 A;  3BS5 A;  3GQC A;  4A8E A;  4JV2 A;  2KFZ A;  2LYH A;  5J0R A;  2D8C A;  1NK9 A;  5J2I A;  4KLG A;  1ZET A;  4IRC A;  5J8Y C;  5ALP A;  3IG5 A;  2LM1 A;  1NK4 A;  4DL7 A;  4B9V A;  8ICR A;  5AM2 A;  3V6K A;  4YR0 A;  3PO5 A;  3MGH A;  5KNI A;  3L3F X;  3OJU A;  3BZK A;  4DSJ A;  4P0Q A;  3PMN A;  1CUK A;  2W04 A;  2OEH A;  1CRX A;  1KLN A;  2KNJ A;  1TK0 A;  3MR2 A;  4UW9 A;  1UA1 A;  4NLN A;  4JUZ A;  4I2F A;  3Q8R B;  1KFS A;  4P0P B;  4R8U B;  4TUQ A;  2DWQ A;  5J2F A;  4ACO A;  1TK8 A;  4U6P A;  2AXT U;  4PH5 A;  2HHU A;  5KFB A;  4EEL A;  3WKB A;  4OJ5 A;  1NKE A;  4IRK A;  2NRT A;  4F5N A;  1NI3 A;  4ED7 A;  2XC9 A;  2JXJ A;  7ICP A;  1BGX T;  4F5R A;  2L5Y A;  3KHR A;  4RQ8 A;  4NLG A;  2K8A A;  4YQW A;  3BQ2 A;  4F4Y A;  5D46 A;  8ICQ A;  2ZIX A;  2HBJ A;  2DF4 B;  3RH6 A;  5ALY A;  2E5S A;  1L3U A;  1S77 D;  3FC4 A;  4US8 A;  2E1E A;  5DKW A;  3HJE A;  1SV4 A;  3WKD A;  4EX7 A;  4QWA A;  4LVS A;  2GLE A;  4GLX A;  4JWM A;  8ICN A;  2EDU A;  3C1Z A;  1NJX A;  8ICL A;  5C0Y A;  4UB6 U;  1MQ3 A;  5AK6 A;  3MGI A;  3GIK A;  1TK5 A;  4MEX A;  2XIC A;  1ZQS A;  3HP6 A;  5EE9 A;  3HT3 A;  1ZD5 A;  1L3V A;  3JPR A;  1SKW A;  4EZ6 A;  2YMP A;  2A1J B;  3MDA A;  4DL5 A;  4C8M A;  1N5X A;  3F5A A;  9ICF A;  5ALL A;  4DSF A;  7ICR A;  2W9B A;  4YP3 A;  4I2J A;  1SGG A;  3NTU A;  2MUT B;  4U7C A;  4J9O A;  9ICA A;  4PGY A;  1ZQO A;  3PX6 A;  3C5F A;  4P0Q B;  9ICX A;  9ICL A;  2G06 A;  4B9L A;  3G6Y A;  3RJE A;  3IM1 A;  1RG6 A;  3OSN A;  3SMV A;  2ZIV B;  4OO1 J;  1Q46 A;  4MF2 A;  2GO7 A;  4KX5 A;  1B22 A;  8ICO A;  3TAN A;  4DQQ A;  2YQE A;  2C2R A;  1T7P A;  5J2C A;  3RBD A;  2JEG A;  2LBO A;  4F71 A;  3PST A;  1YZ6 A;  2HVI A;  3I28 A;  3QU7 A;  5KG0 A;  5HHI A;  2CRX A;  5KFD A;  3L5K A;  4UAV A;  5J2G A;  5BPC A;  3CNH A;  4J9N A;  3EYZ A;  3TFS A;  4MHV A;  3N7R C;  3H0L B;  1S0N A;  5CJ7 A;  3ISB A;  2JMG A;  3OHB A;  1VLB A;  2KTQ A;  2LHT A;  2KSO B;  5KFA A;  4FZN A;  4O3P A;  1SKS A;  2G09 A;  2K4I A;  3RB0 A;  2AGQ A;  2CN1 A;  2NRX A;  2QLT A;  1NNL A;  2IOF K;  4Y2X A;  1X2I A;  4TQR A;  4LJX A;  8ICJ A;  4QWD A;  2YML A;  2KE7 A;  1ZQY A;  3F2C A;  2UVV A;  2FLL A;  4DL2 A;  1FEZ A;  8ICA A;  2JEI A;  3LWM A;  1NK6 A;  5AKG A;  2KN7 A;  2MA1 A;  1FFU A;  3D2N A;  1S97 A;  2KIV A;  4O0I A;  4CF3 A;  2ASD A;  2KHQ A;  2ZJA A;  1L6N A;  4EBC A;  4IQV A;  3WKC A;  4KN7 A;  1XS9 D;  5KFR A;  2O6K A;  5AIA A;  3AQF A;  8ICW A;  3NVY A;  2BQ3 A;  3UM9 A;  2DQN B;  4KTQ A;  2EH9 A;  1XSL A;  3V7J A;  5DG8 A;  4GC7 A;  2KJ5 A;  5L1M A;  4O5K A;  5KG2 A;  2AQ4 A;  3N28 A;  4RT2 A;  2VAN A;  3VC8 A;  1JX4 A;  3QZ8 A;  4O5E A;  3K75 D;  2QB0 B;  5AKI A;  2EZX A;  3GIL A;  1ARO P;  4Y2J A;  1RYS A;  9ICG A;  1U48 A;  2WF8 A;  2PFQ A;  2ZUD A;  3WK8 A;  1PZN A;  5ALW A;  4ICA A;  5EWF A;  5KFG A;  4QZA A;  1SV0 C;  5JTI A;  4GIB A;  1FFV A;  3IHQ B;  3V6J A;  3V7K A;  2ZUB A;  5DQG A;  2HOF A;  1JRP A;  5KG5 A;  4J9Q A;  1DOQ A;  1MC8 A;  2W43 A;  1ZQM A;  3O0F A;  3K1R B;  3MR5 A;  2W9M A;  2YMQ A;  2P35 A;  2XY5 A;  2JRZ A;  3T5J A;  3L4P A;  2H3Z A;  5ALI A;  9ICK A;  2KJ8 A;  1COO A;  2MUT A;  3Q8S B;  3EZ5 A;  4F5Q A;  4M0A A;  3MC1 A;  5J8Y A;  1NKC A;  2PXI A;  5DBA A;  2NRW A;  1KW4 A;  3Q8L A;  5C5J A;  2FMP A;  3QUT A;  2Y9T A;  4EBD A;  1J97 A;  2BPG A;  3QE9 Y;  4J9S A;  5D4B A;  3GV7 B;  4M9N A;  3QNM A;  4OJ6 A;  3WKE A;  2NYV A;  5KFM A;  3GZF A;  2LKY A;  4DQS A;  1U4B A;  1SL0 A;  5GTH U;  4DS5 A;  2IOF A;  4BJQ A;  2BGW A;  3H0R B;  1HEK A;  4IRD A;  7ICH A;  4QZH A;  5IIM A;  4M47 A;  4E0D A;  3JPT A;  3AUO A;  4KLH A;  4QZB A;  4NV0 A;  1X6I A;  4LZG A;  1N56 A;  3HWT A;  5KT2 A;  5AHX A;  5J29 A;  4I2E A;  3SYZ A;  2NRZ A;  1ZQU A;  3F2B A;  2ZIX B;  5CWR A;  3THV A;  1QH9 A;  4YMM A;  3ALR A;  4US9 A;  5J0X A;  2MU2 A;  2C28 A;  5AI0 A;  3EPI A;  4F5P A;  1V38 A;  2H3F A;  5HP4 A;  4G3I A;  2D3D A;  3NRZ A;  4R66 A;  7ICI A;  5KFV A;  5J2E A;  2FLP A;  1NOM A;  3AU6 A;  1CEZ A;  5KFI A;  3EUB 2;  1ZQP A;  5AKE A;  2JV3 A;  4P4O A;  3ISC A;  1K5O A;  1L5U A;  1IM4 A;  4EEY A;  1TAM A;  3K1Z A;  4ED3 A;  2KKV A;  2PMZ F;  2YB1 A;  2HCF A;  5KFN A;  2XID A;  2ODG A;  1TFR A;  2B6G A;  1ZRN A;  3M8R A;  5DLG A;  5KFK A;  4DFK A;  3BQT A;  3NVV A;  2HDO A;  4PZO A;  1MN8 A;  3MAB A;  1O03 A;  1XWL A;  4EZ9 A;  4DWI A;  3HKZ F;  3GU3 A;  5KFL A;  5HR7 A;  5AK3 A;  4J9P A;  3IV6 A;  4NXZ A;  5EOZ A;  7ICT A;  4ECR A;  5KFQ A;  2WB1 F;  2KFN A;  2ATL A;  9ICC A;  3SEI A;  1RYR A;  5JU5 A;  2PFP A;  3GV5 B;  9ICO A;  4IQW A;  2FLN A;  1A6S A;  5J0Y A;  4PZN A;  4J03 A;  4JV1 A;  5DGB A;  1ZQX A;  1XSN A;  4RQN A;  2OH2 A;  5KFS A;  4ELU A;  5J2A A;  5F9L A;  9ICH A;  2G5I B;  3PO4 A;  1X9S A;  8ICZ A;  4QZ8 A;  4JB3 A;  1OXJ A;  2KZZ A;  5GTI U;  5ALT A;  4ECX A;  1LVH A;  3M6K A;  1ZRM A;  1CI4 A;  1UT5 A;  3WK6 A;  3RJJ A;  4DOB A;  4YFK A;  3KOO A;  3M9M B;  3PX0 A;  2VJ5 A;  1HUZ A;  8ICP A;  3CYM A;  2GH1 A;  3C2M A;  5TZV A;  1L7M A;  5L1I A;  4DFD A;  2ZIU A;  3QZ7 A;  4I2C A;  4PGX A;  1ZQL A;  3LK9 A;  4MEY A;  2ZJ8 A;  4F92 B;  1SIJ A;  4Z6E A;  3OGU A;  3UXO A;  5DG9 A;  3ZDB A;  2W03 A;  1S0M A;  1XU4 A;  5ALO A;  1WG8 A;  3UMC A;  2UVW A;  1S9F A;  2QB0 A;  2YN4 A;  3AMZ A;  5KG3 A;  3QU5 A;  2CXY A;  4CE6 A;  1ED1 A;  2EAP A;  1UCV A;  4C8K A;  4F2S A;  1ZQR A;  1ZJN A;  4NWI A;  1XC9 A;  5A0L A;  3T5H A;  4F4K A;  3H8J A;  5JRT A;  1S10 A;  3A0B U;  2IBK A;  4OJL A;  4F50 A;  3PNC A;  2PI4 A;  8ICX A;  1QQ7 A;  5J0U A;  3BQ0 A;  4USA A;  2EAN A;  9ICR A;  1FIQ A;  4EX6 A;  2ALZ A;  1BPY A;  9ICE A;  2ZJ5 A;  1SZP A;  5AKZ A;  4UB3 A;  2Z7J A;  5DDM A;  2BR0 A;  4EYH B;  3TAC B;  2K8C B;  3KKA C;  2ZUC A;  5KFW A;  3NUQ A;  4DL4 A;  1SV0 A;  3ETL A;  5AM3 A;  3C2L A;  4IR1 A;  5L1K A;  3I1Y A;  4QNL A;  2ZTE A;  1X9X A;  5AKK A;  5K4L A;  3RB6 A;  4DSL A;  3PW7 A;  5H2F U;  4QZC A;  5B5E U;  3V7L A;  2BQR A;  3G6V A;  1ZQZ A;  2BCQ A;  3SD7 A;  4DS4 A;  5DQH A;  9ICV A;  4RT3 A;  2F44 A;  5KFE A;  7ICE A;  1LB2 B;  5DB9 A;  4I2D A;  2Y1J A;  1ZQH A;  3TKA A;  2R8H A;  3RJF A;  2ZG6 A;  2ZIV A;  2V9W A;  3QU9 A;  5CRX A;  1YT3 A;  2JHD A;  1LKY B;  2B21 A;  2EZZ A;  4ED8 A;  4RQ4 A;  3F53 A;  1TVA A;  3M7D A;  2N1R A;  1J2N A;  4IQU A;  2MRL A;  1PK1 A;  2RRD A;  9ICI A;  4CCH A;  4PJ0 U;  5J2B A;  7ICQ A;  4Z6D A;  3KHH A;  3T79 A;  4DFM A;  1WCN A;  2HSZ A;  4CF4 A;  2AGO A;  5HMM A;  2FPL A;  5DQI A;  4O5C A;  4DSK A;  2ZIW B;  3QX7 A;  4UAZ A;  4FS2 A;  8ICY A;  2BPF A;  3V6H A;  4I2G A;  4F93 B;  4O3S A;  2F2A B;  2IOH A;  1URJ A;  1KEJ A;  4DQP A;  3LYS A;  5J0S A;  5HHH A;  3J81 j;  3T5K A;  5KFC A;  1B4F A;  4DF4 A;  1Z4N A;  1MA7 A;  7ICF A;  1NZP A;  3RH5 A;  4RPZ A;  4O3R A;  4Y2S A;  1WWV A;  4QZF A;  4JK1 A;  4EEN A;  4ECS A;  5KG4 A;  5AI4 A;  4BWJ A;  3MFH A;  3JPQ A;  5L1J A;  1TE2 A;  3GII A;  2VA8 A;  4WJ3 B;  2VA2 A;  2WFA A;  5ALS A;  8ICE A;  1EXN A;  2KV2 A;  2HBM A;  4Q8F A;  2AJQ A;  1JAL A;  1ZQB A;  1WUD A;  2F76 X;  3GV8 B;  2HOQ A;  4I27 A;  1H38 A;  2FI1 A;  2KSO A;  4NLK A;  4QZD A;  4DSI A;  3E2E A;  4FZL A;  3QEA Z;  5DB6 A;  4KX3 A;  4NM1 A;  1C7Y A;  3KZI U;  1VDV A;  4PL2 A;  2AU0 A;  4CDG A;  1F5S A;  5ALH A;  2GOL A;  4F91 B;  4XA5 A;  3MR3 A;  4EEK A;  5KT4 A;  1XSP A;  2WAQ F;  3SV4 A;  1KN5 A;  2WB1 C;  2R8I A;  4B9M A;  4QWC A;  2VA3 A;  1L7O A;  3BDP A;  1JRO A;  4DLE A;  2F8K A;  1S5L U;  2DUY A;  3H8W A;  5AKJ A;  4DEZ A;  3ZD9 A;  9ICN A;  1Q3U A;  3SQI A;  1JXL A;  4FO6 A;  1HIW A;  3C21 A;  5DB8 A;  4PGQ A;  1LKY A;  5ALQ A;  3AL0 B;  4TUP A;  2JGA A;  4OJP A;  1A77 A;  3HKZ C;  1AQ6 A;  4LZD A;  4G9B A;  3N7P D;  7ICG A;  4XUS A;  2ESE A;  2JZB A;  2J6U A;  4F5O A;  1D9D A;  1XNS A;  3PML A;  5BOL A;  7ICM A;  2QAR B;  3RAX A;  2LYB A;  2ISP A;  1KKX A;  1X40 A;  2DBY A;  2UVU A;  3B0Y A;  2P6U A;  1RQL A;  3HX0 A;  1KFD A;  4ECY A;  3RJG A;  2W9A A;  2IHM A;  1D9F A;  4QWB A;  4UBB A;  3MBY A;  4Y2U A;  5EE0 A;  3PW5 A;  2HBK A;  3V72 A;  2ES6 A;  1PVP A;  4KLI A;  3RB4 A;  8ICV A;  3K4G A;  1Z00 A;  2XCA A;  3PR4 A;  5L1L A;  2DL0 A;  3UXN A;  4AP9 A;  4KLE A;  3SZ2 A;  4RQ1 A;  2B0C A;  2K60 A;  2XCP A;  5AIB A;  3NRW A;  2NO4 A;  3KTQ A;  3ZDC A;  3H7I A;  3KBB A;  5JUM A;  1JIH A;  3AM9 A;  1BNO A;  2BQU A;  4XRH A;  3R9K A;  3KKA A;  4RPY A;  2VIX A;  4M6W A;  5J2K A;  7ICK A;  4IR9 A;  5DLF A;  4UAW A;  2OCE A;  4RPX A;  1SWW A;  5KAI U;  2IMW P;  1DK3 A;  3C28 A;  2HHW A;  1U9L A;  4R8U A;  4M9H A;  3RRH A;  5AM4 A;  4J9K A;  2ZIW A;  4CNQ A;  3FYH A;  5BOM A;  2E3T A;  4OCZ A;  4YR3 A;  4ED6 A;  3H4B A;  4KMO B;  3KHL A;  2BKE A;  5ALE A;  2I1Q A;  3IRU A;  4RQM A;  3RTV A;  5J0T A;  1QSL A;  1D8B A;  1ZQD A;  2KHV A;  1COK A;  1YZ7 A;  2P6R A;  1BPD A;  2BCR A;  3M8S A;  2FDR A;  3FM9 A;  5CHG A;  3CRX A;  2YMM A;  4CRX A;  3RB3 A;  2BDP A;  1K1S A;  1Z19 A;  9ICU A;  3BS7 A;  4ZOH C;  3GIM A;  9ICS A;  3M1Y A;  1Q3V A;  3I76 A;  3AU2 A;  5E79 U;  5G5H A;  2F1I A;  2XVT A;  1NK0 A;  4PHA A;  2FMQ A;  2WF6 A;  4C7Z A;  3UQ0 A;  3RRG A;  3VCB A;  3KZX A;  2R8G A;  4ECW A;  3GDX A;  3ZD8 A;  2A3V A;  3FDS A;  2YB4 A;  5KTQ A;  1ZQF A;  2RQ5 A;  4RUC A;  3PSI A;  5KG6 A;  2IHN A;  5J2J A;  4R63 A;  2ASJ A;  4PHE A;  5J2H A;  3NS1 A;  2OWO A;  1ZYQ A;  3MDC A;  1Z4O A;  3TAD C;  2XGP A;  5ALM A;  2XGQ A;  2KKP A;  1QQ6 A;  1WWU A;  2YX8 A;  4YD2 A;  4Q8E A;  1SL1 A;  5AI6 A;  4RNO A;  3CP8 A;  2K4P A;  3KFU F;  4Y2Q A;  4Z6C A;  2K4E A;  2BHN A;  4RQ0 A;  4UAR A;  4FS1 A;  4RQ3 A;  3WK9 A;  1UQV A;  3AEV A;  2I9G A;  3IP4 B;  3BQ1 A;  4C4T A;  3BJY A;  4ED0 A;  3QUQ A;  5HML A;  1XO1 A;  4KLS A;  3H0M B;  1ZQE A;  1N60 A;  7ICO A;  5KFH A;  2FPM A;  3TAQ A;  4GXI A;  3WK4 A;  1A76 A;  3KHG A;  2XY6 A;  4J9R A;  5EE1 A;  2JEJ A;  3RJH A;  3OJS A;  4QW8 A;  3C23 A;  3UMG A;  1JXE A;  1B43 A;  1FO4 A;  1VJ5 A;  4UAY A;  2HHQ A;  1U47 A;  5KT5 A;  5AKX A;  4J9L A;  1HUO A;  2KMD A;  1ZQ1 C;  4ELV A;  5AM5 A;  1DGS A;  3LDA A;  1NK7 A;  4O3M A;  2ZXH A;  4UAT A;  1PVQ A;  4RQ5 A;  2H3I A;  7ICL A;  4C7Y A;  4DFP A;  4R65 A;  4PHD A;  1WYG A;  2FPK A;  2R18 A;  1BVS A;  4HYK A;  4Z6F A;  5IIL A;  2K8B B;  4QIW F;  2Y9U A;  2KJ9 A;  2F77 X;  2KVC A;  1TAQ A;  3SR6 A;  1ZQN A;  3TFR A;  3C1Y A;  3F5E A;  5AM0 A;  3ED5 A;  5F3X B;  4QIW C;  4RQ2 A;  4QZE A;  5CA7 A;  4X5V A;  4BGD A;  5KFP A;  3Q8K A;  4B9U A;  1DK2 A;  1DXS A;  4MFF A;  1LV5 A;  1UA0 A;  7ICS A;  3ICX A;  3RBE A;  4P4M A;  3F2D A;  4RZR A;  4RNM A;  3ZI4 A;  1MQ2 A;  5AI8 A;  1JI7 A;  4IQT A;  5EE3 A;  1X66 A;  5DGA A;  3WK5 A;  5HNK A;  3PW0 A;  4B6J A;  3WKA A;  2GWS A;  2WTF A;  3QUC A;  1KDH A;  4IL6 U;  4BXO A;  2Y0S F;  4C4S A;  2V4Q A;  2W3S A;  2D6F C;  2I6X A;  3QUB A;  1S0V A;  1T94 A;  1N2X A;  2OM6 A;  3D2S A;  2MAX A;  2OXO A;  2E8N A;  4UBC A;  4ECQ A;  8ICG A;  2JR5 A;  4F4X A;  1OUQ A;  3KD3 A;  2Q4T A;  1SB3 C;  2HHS A;  2WHE A;  1BPB A;  4K4I A;  5KFO A;  5IIK A;  1DRG A;  2BCS A;  4QZG A;  2XO7 A;  1ECW A;  2HBL A;  5ALF A;  2DGZ A;  4NLZ A;  4O3O A;  5DG7 A;  1Z1B A;  5KFU A;  3G6X A;  3TAD A;  3LWL A;  4UQG A;  2F1J A;  1N5W A;  3UQ2 A;  4P2H A;  1D8Y A;  2Y1I A;  3JPS A;  4RQ6 A;  2RDI A;  1ZQI A;  2J6S A;  1ZXI A;  1QCK A;  1P7D A;  1ZJM A;  1TKD A;  3MFI A;  3UMB A;  5IIJ A;  2CPR A;  4JV0 A;  4GFJ A;  3PV8 A;  9ICB A;  3PVX A;  4M6W B;  5AI9 A;  4F2R A;  2WF9 A;  1S0O A;  1C20 A;  1BPZ A;  2NV3 A;  2M0N A;  4GXJ A;  2QB1 A;  2YTU A;  3UPQ A;  1UPH A;  1NJW A;  1GO3 F;  4MF8 A;  4C0Z A;  1Y88 A;  4DFJ A;  3C2K A;  5ALV A;  1RYU A;  1RQN A;  4I28 A;  5J0P A;  2AQ0 A;  8ICH A;  4M04 A;  4P0P A;  2F8L A;  4F3O A;  5TIS U;  5KFJ A;  4YD1 A;  3PZP A;  1L7N A;  2LM4 A;  1PVR A;  4Y2T A;  3NGD A;  1UHU A;  2G07 A;  4KMU A;  4NM2 A;  2W55 A;  2KVS A;  3PR5 B;  2HHV A;  3AN1 A;  3ORY A;  4MFC A;  3HIL A;  2KG5 A;  2YY6 A;  2I5H A;  3IN5 A;  9ICT A;  1A0P A;  4Y2R A;  4KLO A; 
#chains in the Genus database with same CATH homology
 3HKZ C;  4JMU A;  1DRG A;  2KHV A;  4NLC A;  2H3F A;  1ECW A;  2HBL A;  3N7P D;  3O0F A;  4OJ5 A;  1KBU A;  3M6Z A;  1ZQ1 C;  2DGZ A;  2JH7 A;  3N7R C;  3H0L B;  1Z1B A;  3MGV A;  2VJ4 A;  1XNS A;  3CRX A;  4CRX A;  4O3M A;  2JMG A;  4QNL A;  2W7O A;  2ZXH A;  2ZIU B;  2LYB A;  1PVQ A;  1Z19 A;  3M6K A;  2H3I A;  5T14 A;  2H3Z A;  2K8A A;  2LHT A;  3RF9 A;  2KIW A;  3OPX A;  5KL1 B;  1Q3V A;  4FZN A;  4WJ3 B;  2JH1 A;  2HBJ A;  2ZIX A;  2G09 A;  2R18 A;  2K4I A;  2KJ8 A;  2VJ5 A;  4QJF B;  2DF4 B;  3ONN A;  3D2Q A;  2CN1 A;  3CYM A;  3PSP A;  2K8B B;  4QIW F;  2KV2 A;  2GH1 A;  2E5S A;  2F77 X;  2HBM A;  2KJ9 A;  2H3V A;  2XVT A;  2VKQ A;  4FE3 A;  2KVC A;  2HBK A;  1WUD A;  2HMX A;  5KL8 B;  2ZIU A;  2E1E A;  2F76 X;  1P7D A;  2RP5 A;  2KD1 A;  2HOQ A;  2XI9 A;  3RFA A;  3KZX A;  3VCB A;  1PVP A;  1SZH A;  3F2C A;  2CPR A;  3LVV A;  3F5E A;  1TAM A;  3K1Z A;  4GFJ A;  2KKV A;  3SAG A;  2ZG6 A;  2PMZ F;  2ZIV A;  2G08 A;  2HOI A;  2YB1 A;  2A3V A;  2YB4 A;  5CRX A;  1IIP A;  1YT3 A;  2JHD A;  4QIW C;  2NV3 A;  2H3Q A;  2M0N A;  2MA1 A;  3PSI A;  4FZL A;  4NLB A;  5C0Y A;  3D2N A;  2XID A;  2WAQ C;  4KX3 A;  5HR6 A;  4BUG A;  2W03 A;  2KHQ A;  4OJ6 A;  1UPH A;  1L6N A;  3LVW A;  3GZF A;  3NRW A;  3F53 A;  4A8E A;  2XIC A;  4PL2 A;  4CDG A;  3M7D A;  2LKY A;  2N1R A;  4AYB C;  1GO3 F;  2KIC A;  4C0Z A;  2MRL A;  3ICX A;  3F2D A;  3PSF A;  1ED1 A;  2G5H B;  2PMZ C;  4OJO A;  2RRD A;  2GOL A;  2Y0S C;  4BX9 C;  4BJQ A;  3SAH A;  2KKP A;  3H0R B;  2WAQ F;  4NWI A;  5A0L A;  3AQF A;  3F5A A;  3HKZ F;  3SAF A;  1HEK A;  3GU3 A;  3T79 A;  2WB1 C;  2YX8 A;  2DQN B;  5HR7 A;  2VIX A;  4OJL A;  3E0F A;  2E1F A;  2KJ5 A;  3IG5 A;  3C29 A;  4U7C A;  3N7S C;  3CP8 A;  2ZIW B;  3AQE A;  3DEE A;  4P0Q B;  3KFU F;  2K4E A;  2Y0S F;  3IG8 A;  2G06 A;  3L3F X;  4P0P A;  3C28 A;  4NV0 A;  3VC8 A;  2F8L A;  2D6F C;  2F2A B;  2WB1 F;  2G0A A;  1T94 A;  2ZIW A;  3IP4 B;  4P0Q A;  1URJ A;  2OM6 A;  2W04 A;  3SMV A;  1CRX A;  3D2S A;  2KNJ A;  2ZIV B;  3PZP A;  1Q3U A;  4CGZ A;  2OXO A;  3SQI A;  1PVR A;  4OO1 J;  4PL1 A;  2LYA A;  2G07 A;  2KEY A;  4KX5 A;  2ZXI A;  2OYY A;  3LYS A;  2BDU A;  4AYB F;  3H0M B;  4FZM A;  3F2B A;  4KMO B;  1A6S A;  2ZIX B;  4ICA A;  4IC9 A;  1HIW A;  1F44 A;  1OUQ A;  4P0P B;  2Z7J A;  1XO0 A;  3ALR A;  2Q4T A;  3AL0 B;  2W7P A;  4ACO A;  4U6P A;  2LBO A;  2KOB A;  3PST A;  1NZB A;  1MA7 A;  2OH2 A;  2K8C B;  2K89 A;  2JGA A;  2RHF A;  2K4H A;  3IN5 A;  2HOF A;  1D8B A;  4OJP A;  1A0P A;  2CRX A;  2G5I B;  3NUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...