3D2QA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
DRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, rna binding protein
molecule keywords Muscleblind-like protein 1
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2qA00
3D2SA 2E5SA 3D2NA 3D2QA
chains in the Genus database with same CATH superfamily
3F2BA 5J0YA 3WK6A 4J9OA 4EBEA 2FI1A 3RTVA 5KFHA 1YZ7A 4QZIA 4R66A 3EUB2 3HRDD 1K1SA 1U4BA 3AU2A 4PPXA 2C2DA 2J6UA 5KFXA 5DB7A 5CA7A 1BPYA 4DQIA 3MGHA 1COKA 2KG5A 3EPGA 3TFRA 3L4PA 3HX0A 4DF4A 4KLGA 1UT8A 2K89A 3UXNA 1DGJA 2KMDA 3AMZA 3PMLA 5DDYA 4C7ZA 2WFAA 4KLUA 2VIXA 4LJXA 5KFQA 4U6PA 3E58A 3V72A 2XGQA 2KICA 1A77A 3TACB 4DL2A 2JZBA 4HAIA 1SZHA 3ISBA 1M6YA 3OSNA 2LHTA 3ZI4A 7ICOA 2XVTA 5AKJA 3KHLA 4DQSA 4RPXA 2YMPA 2R8GA 1OXJA 1S8OA 2W8KA 1ZQRA 2R18A 1Q8KA 3JPOA 4NLKA 2K4IA 4PHPA 5KFCA 1SWVA 4P0PA 4M9GA 1SV0C 2Y0SF 2R8KA 8ICSA 2EZXA 2PXIA 1ED1A 4M9JA 2WB1C 2A3VA 1TVAA 1H38A 4C8LA 3GILA 4DL7A 4KLTA 4J9PA 4KLDA 2HHWA 9ICWA 4J9NA 4DFDA 2MUTB 4FZMA 1FFVA 2LBOA 8ICUA 3G6YA 4NLBA 1KRPA 4PHDA 4M6WB 4DFJA 2DWQA 1J97A 4KLIA 1L8OA 4Q45A 4B9MA 3PSPA 2QLTA 3CYMA 3CP8A 4UB2A 3V6JA 4QZCA 4F2RA 4Y2VA 4RQ2A 3T5LA 4ED3A 4QZDA 4KX3A 3PO4A 1UQVA 5ALOA 2DKXA 2XGPA 3WKDA 3LVWA 4JWNA 4DO9A 5AI4A 1NK8A 4R65A 4I2FA 5DG9A 1T3QA 2E8OA 4I2BA 4YMMA 4TQSA 1ZQBA 1K1QA 5AI8A 3ISDA 3MFHA 3BDPA 2GWSA 1SXEA 4DS5A 5KFMA 2KFNA 5AICA 1N61A 4Y2UA 8ICZA 2YMLA 4ECZA 4RNOA 1PVRA 2VA8A 3PW0A 1TFRA 2RP5A 2E1EA 2KHQA 3JPQA 2YQEA 4DQRA 4KX5A 4MHVA 5DB6A 4DL5A 4DQPA 4ECTA 4Z6FA 3ZDEA 3KOOA 4GFJA 1RYUA 2A1JB 1O08A 5AKIA 1DOQA 1ZQVA 1X40A 2M0NA 2V9WA 4Y2QA 2YN4A 2UVRA 1KQQA 5J2FA 1MSWD 3UXPA 1XC9A 2P6RA 4EYHB 3QNMA 5ALKA 5ALSA 4K4IA 3HWTA 1TAMA 3RR7A 3S6JA 5HHIA 7ICUA 5J0PA 1DXSA 4O0IA 4UB5A 4IQWA 4M6WA 3QU9A 3VCBA 3FAHA 3QUBA 2W54A 3PO5A 4KTQA 4YN4A 2KSOA 3HKZC 2JH1A 5KNIA 2G5IB 4X5VA 5DQIA 2P6UA 1HIWA 1ZRNA 2G08A 3D2QA 3SV4A 8ICVA 2NRZA 1ZXIA 2DGZA 2OXOA 2ZTCA 3L5KA 1TE2A 1S5LU 2PFNA 2I6XA 1BGXT 2J6SA 5L1KA 2BPCA 4YVZA 4Z6EA 3M9MB 1CUKA 1QH9A 4QZBA 2K8AA 2LYBA 1CEZA 4EBDA 5IIMA 8ICLA 1SB3C 5L1JA 4QWAA 4NLZA 2HHUA 1BPZA 4A8EA 3TKAA 2LKYA 5CP2A 1PZNA 5KT5A 2G06A 4DEZA 4QZFA 3JPRA 3IP4B 3T3FA 4JMUA 3QUCA 4F72A 2IOFA 5L1MA 4TQRA 1ZETA 3RJHA 5DB9A 5J0RA 5KG3A 2HOQA 1PVPA 4KLOA 4PL1A 4UQGA 8ICYA 3SQIA 3V7KA 4TUQA 1CI4A 3RBDA 4ED7A 2HVHA 3MGVA 3PSIA 4YMOA 5L1IA 3OJSA 3AEVA 1KEJA 4F3OA 4F50A 3PY8A 5KFDA 5JTIA 4EELA 4RPYA 2BGWA 3SI8A 5IIOA 4WJ3B 4IRCA 3T5JA 4JUZA 4GC6A 3H40A 3T5HA 3PW2A 5ALWA 3PVXA 2IBKA 5ALIA 2KSOB 3ALRA 2QKQA 3MR3A 8ICIA 2NYVA 4GC7A 3BS5B 3GIKA 4MEXA 5FP0A 4B9LA 3MABA 5AK4A 5IINA 3WKBA 5ALDA 4YXJA 4C7YA 1RYSA 1MQ3A 5E79U 3J81j 2BQ3A 1FIQA 1X9WA 2BCQA 4J9KA 1DGSA 2F8LA 2W55A 4M47A 3H8JA 2W04A 2D8CA 2ZIWA 8ICJA 2ZJ5A 3NRWA 2FPMA 2PMZF 2YTUA 2ODGA 5J2IA 2LM4A 4BJQA 4RQNA 2IA6A 2ESEA 3BS5A 1L7PA 1N5WA 4F93B 2AJQA 5DBBA 8ICHA 8ICQA 1B0XA 1ZQSA 2BPGA 2KHVA 2RQ5A 3ETLA 1NKEA 3MFIA 1X66A 5EE0A 5KT4A 4OD0A 5KFYA 1Q3VA 1Y88A 3R9KA 4EEKA 3T79A 2B6GA 1S0VA 1N2XA 5AKHA 4NL9A 1LB2B 3T5KA 4KLHA 3LVVA 1ZQ1C 1SZPA 4RQ5A 1X9SA 4DLGA 1DK3A 4YXMA 2HHTA 3EPIA 4ED1A 1L5UA 3N7RC 4DQQA 3MC1A 4I2IA 4US9A 3Q8LA 3OGUA 4ED0A 1TK5A 1ZQNA 2KVCA 3QZ8A 1LV5A 3NTUA 1WWUA 1ZQGA 4C4TA 2XIDA 8ICBA 4RU9A 2EAPA 4ECRA 4KMOB 4C4RA 4J9LA 3WK9A 9ICOA 2QARA 5AKEA 2W8LA 1ZD3A 2W9MA 2E8MA 4PHEA 1S0MA 5J29A 2KIVA 4QZEA 2ES6A 4CGZA 2JEGA 1K5OA 3H8WA 4FBTA 4I2CA 5HHHA 3RH5A 4O3NA 1MA7A 2W9CA 9ICMA 3O0FA 5EE9A 2WHEA 3U26A 4I2EA 3UMCA 4F91B 1EXNA 4K4GA 4UAYA 1UA1A 4ELVA 3RH6A 3F53A 1XWLA 5KG6A 4RQ1A 1SV0A 3M6KA 4IL6U 9ICEA 3IHQB 3UMGA 2KOBA 1QTMA 3MDCA 5J2HA 3IG5A 4RZRA 1QLNA 2PMZC 4QZ8A 3JPSA 3C5FA 3PZPA 2BCUA 1TK8A 4XRHA 4BWMA 3BQ1A 2YMQA 2XCPA 7ICJA 5EE1A 2ZG6A 2NRVA 2Y9UA 5KFRA 3K1ZA 3NVVA 1T3NA 2MRLA 2B0CA 4XA5A 4EZ6A 4OCZA 2O6KA 7ICTA 8ICWA 4G3IA 3NS1A 2N1RA 3JPTA 2AGOA 1KFTA 5J2KA 3Q8RB 1AROP 5GTIU 3LWLA 2ZIXA 1IXRA 5L1LA 2VJ5A 2CPRA 2GOLA 2UVWA 2Z7JA 4RQMA 4UAVA 5KFGA 1AQ6A 2AQ4A 3N7SC 1XSNA 1KFSA 3TANA 1WUDA 4DWIA 4YR0A 4RT3A 3KD3A 2VKQA 1P7DA 3MGIA 4BXOA 2R8HA 4P0QB 1SWWA 3K1RB 1BPDA 2XICA 1ZQPA 4GXJA 5KL8B 2FMQA 4E0DA 5EE3A 5DBCA 5KFVA 1HJPA 3PW4A 9ICQA 2C2RA 1NI3A 2PI5A 2RDJA 3RAQA 2H3ZA 2MU2A 9ICGA 1X42A 3SENA 3QU7A 3HT3A 4DL4A 2BQUA 4B9NA 1BPBA 1X9XA 1U9LA 3N4MB 4M2YA 1L3UA 4MF2A 4UW9A 2LI6A 4PH5A 1KDHA 4F5NA 4B6JA 3H4DA 5JU5A 4F92B 2W03A 4UATA 1JRPA 4EBCA 4FZNA 5G5HA 2JH7A 1TV9A 1Z00B 2JZBB 1RQLA 4QZGA 5DLFA 4QZAA 3IN5A 7ICKA 3KKAC 3TI0A 2KKPA 2EZYA 5ALHA 3RB4A 3FM9A 1JIHA 4IQUA 2R8JA 2JEFA 4NM1A 1FO4A 1SV4A 1Z19A 1SIJA 4DL3A 4ED8A 3RF9A 2ZIXB 4EENA 5J0TA 4BGDA 3BZKA 4RNNA 8ICFA 4FZLA 1JX4A 3GU3A 5H2FU 2L5YA 5KT6A 3V6KA 1JMSA 1XNSA 2OH2A 5AI5A 4NJ8A 2KNJA 1SL2A 3SV3A 4C8OA 4IR9A 4NV0A 1IG6A 2ZIUA 1L8LA 2AGQA 1S9FA 4Y2RA 1XO0A 4ICAA 5J2JA 4ECSA 7ICVA 4Q43A 1HUZA 2AH5A 1COOA 1JUDA 4QZ9A 2YMMA 1PK1B 3WU2U 3GFKB 3C29A 1J2NA 5HMMA 4F2SA 3GV8B 2YX8A 4AYBF 4BX9C 5AIAA 1NJZA 2XY5A 3OHBA 4DFPA 4KLMA 2KVSA 3B0YA 4F4KA 4UARA 4OJPA 2E8PA 4DOBA 1ZQUA 4ECXA 3ETRA 2IOHA 4I28A 5IIIA 4JV2A 4UB4A 3OSPA 4UASA 2W9BA 5IILA 3RJKA 1ZD5A 1BNPA 4CCHA 4P4PA 3PSTA 5BOMA 2EH9A 4GLXA 1ZQLA 3IM1A 4O3SA 2IOFK 5ALQA 3HILA 3I1YA 4M9HA 3KZXA 2XO7A 2EZZA 5KFTA 2KZZA 2RRDA 4UB6U 2A1AA 3SAFA 3QXGA 2HOIA 3ED5A 3BQTA 3F2CA 1N60A 5DLGA 3RR8A 3WK5A 4I27A 1D8BA 2V4QA 4FS1A 1IM4A 2ZIUB 1NOMA 2EQYA 4NXZA 4NLCA 4FS2A 5CRXA 3M6ZA 4P4OA 3QU4A 2JMGA 2W3RA 1JXEA 1F44A 3QYPA 4DLEA 1XO1A 3RJIA 1SKSA 4ED2A 4KITB 2FE9A 2OYYA 5ALTA 2ASDA 3H8SA 4C8MA 5DB8A 1FFUA 2PFQA 3C23A 2CN1A 3QUQA 4OJLA 2QARB 1S76D 4PZOA 2BCVA 4IRKA 3BS7A 3RJFA 3M8SA 4BUGA 2C22A 4QWEA 2AGPA 4PGYA 1L7NA 4J9SA 2ZJAA 3OPXA 5EWEA 4O3RA 4F4ZA 3IDWA 5AIBA 3C2KA 1L3SA 2Y1JA 1WCLA 5KL1B 2KJ9A 3ZDAA 2HHQA 3AM9A 1ZQCA 5AM2A 3THVA 1NZPA 4Y2JA 7ICGA 1ZQXA 2HI0A 2YB1A 1S77D 2NRTA 1NK7A 4AYBC 3NVZA 1RZTA 4DS4A 1Z00A 1Z1BA 4CE6A 2HBJA 1C20A 3KFUF 1QSLA 3NVWA 2BR0A 1ZD4A 3GV7B 2F2AB 2HBKA 1ZQEA 4YR3A 4U7CA 7ICQA 4C8KA 4QWCA 9ICFA 5J8YC 1X6IA 3MDAA 4YD2A 5EWFA 2MUTA 4F5OA 2E5SA 3WK7A 1V38A 5J2AA 5J0XA 2OWOA 1NZBA 1L3TA 1V9PA 2NRWA 3ZDDA 5KAFU 3RRHA 3ZDCA 1ZQOA 2H3VA 4OO1J 3C1YA 2H3IA 5KFJA 5DQHA 3GQCA 4UBCA 4O9MA 3FYHA 2NV3A 4UAZA 2F1JA 3M9NB 2ISOA 2R8IA 1S0OA 2OM6A 4M9LA 3C2LA 1D9DA 1XSLA 3WK4A 2KEYA 1B4FA 1VDVA 5AKLA 8ICRA 2HHVA 1U49A 4I2GA 2D6FC 4DL6A 2G5HB 4USAA 5AKZA 3KZIU 4EEYA 5J0WA 3UMBA 2OCEA 4NM2A 2FMSA 7ICMA 3PR5B 4RPZA 3PX0A 9ICSA 2WF9A 3WKCA 2C28A 3RJGA 3Q8KA 1KTQA 7ICHA 9ICRA 1VJ5A 2KIWA 3PW5A 4QIWF 9ICPA 1OW5A 5DKWA 1RM6C 3UQ0A 5ALRA 2Y9TA 5AKGA 1Z4OA 3GIIA 9ICCA 3LWMA 2VA3A 4US8A 1Z4NA 4P2HA 2Q4TA 2XC9A 5TISU 4BXOB 5EOZA 3MR6A 5EWGA 3AQFA 1SXDA 2DFLA 3H0RB 3Q8SB 2G09A 1X2IA 3M1YA 5ALEA 1A76A 2I9GA 4KN4A 2JV3A 2AU0A 1ZQDA 1MQ2A 4UBBA 2ISPA 2FLNA 5JUMA 4JB3A 1HEKA 2F76X 4J03A 1NJYA 1FEZA 5DGBA 5AM0A 4LZGA 1NKCA 3BJYA 4QIWC 4I2HA 2KV2A 1UPHA 3RAXA 2OEHA 3OTQA 2FPKA 4O3MA 1Z1VA 4QW8A 3EYZA 3UXOA 4Z6DA 1L7MA 3DEEA 3SYZA 2NRXA 4O3OA 2KFZA 2HBMA 4I2JA 2QB0B 4ECQA 2HMXA 3IG8A 1GO3F 2MSNA 4CF3A 1UA0A 2BPFA 5KFWA 4QWBA 2E8NA 4J9MA 1XS9D 2F1HA 1NJWA 3LK9A 4B9SA 4LZDA 2K4HA 1D9FA 1V97A 3RB3A 4J9RA 1BPEA 2ZUCA 2BDPA 4NY8A 4K4HA 1JROA 4ELTA 1PVQA 3KBBA 2AHOB 4Y2XA 2DPJA 3C28A 1ZYQA 3ZD9A 3E0FA 2ZXIA 4YCXA 1RYRA 2K4PA 4B9UA 4OJOA 4PHAA 3NVYA 2ZUDA 2HSZA 3ZDBA 2GLEA 5AK3A 7ICNA 1ZQJA 1N48A 4KLJA 1NK4A 4DF8A 4Y2TA 4RQ3A 1SKWA 3F5AA 1RXWA 4NL9C 5KFAA 4EYIB 2OHFA 2I1QA 3QX7A 1TKDA 4KLEA 2IHNA 3G6VA 4O5EA 3EW9A 2F3NA 3FC4A 2BQRA 3Q8MA 5KFFA 5HP4A 5J0UA 1L6NA 3C21A 9ICJA 2P66A 4M0AA 1NJXA 4EX6A 2WF6A 1X9MA 3E2EA 2EAMA 3NASA 5AM5A 4DFMA 1DRGA 4FFDA 2I5HA 2WB1F 4IC9A 4ZH4A 5KFKA 5J2BA 4QZHA 2Y0SC 2ZIVA 1LKYB 3V6HA 5AI0A 4BDPA 2A19A 4Y2SA 4ACOA 4RNMA 3GV5B 4NLGA 3HJEA 5DQGA 1A6SA 4RQ8A 3RB0A 4P0PB 5AM4A 3SR6A 4J9QA 4KMUA 2C2EA 3C1ZA 3TAQA 3QU2A 3MR5A 1XSPA 5DG8A 1QQ6A 4XUSA 4DFKA 1NK5A 4JK1A 5A0LA 2ATLA 8ICNA 1TAQA 1SL0A 4KLSA 5BOLA 1T4GA 4JV1A 2W9CB 1QQ7A 2F8KA 4Y2YA 3V7LA 1LKYA 2ASLA 2Q0ZX 9ICKA 3TAPA 3M7DA 3EWAA 1XU4A 5KFEA 3QE9Y 9ICBA 4AP9A 3EZ5A 4R64A 2CRXA 4CF4A 4OJ6A 3PX4A 4UB1A 3PSFA 3PNCA 4F71A 1A0PA 2CXYA 2KTQA 5AK5A 4F8RA 5C0YA 3JPNA 2K8CB 4CRXA 7ICRA 3K75D 5AM3A 4IQTA 2QB0A 4HYKA 2K4EA 2V4RA 2KJ8A 4KN7A 5J8YA 4DCCA 3RJJA 3QU5A 1BNOA 3SMVA 3B0XA 2FMPA 1ZQZA 4ELUA 3A0HU 3F5EA 3AU6A 1TK0A 1B22A 3G6XA 3SAGA 5KG2A 5KG4A 2FLPA 4I2AA 5KTQA 3GZFA 4PL2A 2P35A 5J2GA 2BCSA 2MAXA 4F5PA 3TFSA 2JHDA 3HW8A 1URJA 2W3SA 2ZTDA 2D3DA 5AKXA 3TADC 1T8EA 9ICAA 2KZMA 5KT3A 2VA2A 3RRGA 1KBUA 3JPPA 1RG6A 3QUTA 4F5QA 3BQ0A 9ICTA 4XQ8A 1ZQIA 1S97A 1Q46A 3VC8A 4DSLA 2RDIA 3ORYA 5ALUA 5J0SA 4FE3A 2LMRA 7ICEA 2WF7A 5CHGA 5KG0A 2JEJA 4ECWA 3LDAA 2PKEA 4ECVA 5CEHA 2ZTEA 1ZJMA 4ECUA 3DV9A 2HVIA 3DDHA 4Q8FA 1ZQWA 4F5RA 2W7OA 1MN8A 3B9JA 4YG2A 5KAIU 1SGGA 1ZQAA 3A0BU 3OHAA 5HR6A 3Q8QB 4JWMA 3PR4A 3AQEA 1RPLA 4JV0A 4BWJA 5B5EU 1ZQFA 9ICXA 3FDSA 1D8LA 1YT3A 2WF5A 1KN5A 2EAOA 3CW2C 1ZQHA 4RQ0A 3PMNA 5ALYA 3HKZF 3L3FX 9ICUA 2W9BB 2K8BB 4NWIA 2DF4B 2HBLA 2RLTA 4YD1A 3N28A 1D8YA 2KD1A 1HUOA 3PW7A 2LYHA 5BPCA 1QCKA 1ECWA 2LM1A 9ICNA 4YQWA 2VJ4A 1VLBA 5KG1A 2BZFA 5DGAA 4G9BA 3ISCA 3D6JA 2FJ6A 1IV8A 3K4GA 3Q8PB 1L7OA 3SZ2A 1SL1A 2WTFA 1WG8A 5IIKA 8ICKA 1PUZA 1JI7A 3LYSA 3SD7A 4Q8EA 4ZOHC 1KSPA 2ASJA 1B43A 2XY6A 3WK8A 2WF8A 1DK2A 1PK3A 1S0NA 1IIPA 5CWRA 4YMNA 5ALGA 1QQ5A 1NK6A 2JEIA 1NNLA 9ICLA 2M9NA 1N63A 9ICVA 8ICPA 1N62A 7ICPA 8ICMA 1BVSA 9ICHA 3D2NA 3IV6A 4UB8U 1KFDA 3ICXA 8ICEA 5HMLA 5J0QA 4P4MA 5AKYA 1ZQKA 2B21A 4QWDA 2ZXHA 1QSYA 4UB3A 2YB4A 4Z6CA 1C7YA 2XCAA 1V85A 2MA1A 3I28A 5AHXA 5ALZA 1RXVA 1NK0A 4Q44A 2ZUBA 2AXTU 2BDUA 2KE7A 5CB1A 4PGXA 4PJ0U 4M04A 1L3VA 3MR2A 1KLNA 1KL9A 3HPOA 2HDOA 3NUQA 4CNQA 1UCVA 3HP6A 5K4LA 3KTQA 4KLLA 5AI9A 5AI6A 5F9NA 3ZD8A 5CJ7A 3OJUA 4CDGA 1ZQMA 3UM9A 3SEIA 3I76A 4DSEA 3MBYA 3QEBZ 3AUOA 2W7PA 8ICTA 4RT2A 5KFSA 4I2DA 2J6TA 4C8NA 5KG7A 2EDUA 2ZJ8A 5DG7A 4F4YA 4C80A 4FBUA 4ECYA 3M9OB 4RUAA 4NLNA 1WCNA 1U48A 1TAUA 3BZCA 4RQ6A 2XY7A 1ZD2P 3RH4A 5ALJA 5KG5A 1SKRA 3PV8A 2KKVA 8ICXA 4DSIA 3AN1A 4TUPA 4B9TA 2XI9A 3RFAA 4QW9A 1J2MA 2JGAA 1JALA 2BHNA 2RHFA 2VANA 5KFBA 5AM1A 2JR5A 3SAHA 2G0AA 2ZIVB 5DDMA 4RQ4A 7ICFA 3M8RA 1O03A 4R8UB 4MFCA 5CR0A 2WAQC 5KFNA 3QEAZ 3AL0B 1RDFA 5ALLA 1X6JA 4B9VA 2KK0A 2NO4A 1BPXA 5KFOA 1ZQQA 4DSKA 1NKBA 2LPEA 3BQ2A 4F4XA 1JXLA 3V7JA 4LVSA 5HR7A 1OUQA 7ICSA 1ZOLA 1S10A 5ALVA 5J2CA 1WWVA 1U45A 1Z3EB 2LYAA 5B66U 3UPQA 3RBEA 3WKEA 4IR1A 2HCFA 8ICOA 2PFPA 4P0QA 3QZ7A 1MC8A 1ZQTA 2ALZA 4DOAA 4IQVA 2UVVA 1UHUA 3TQ1A 5ALPA 4Y2PA 5KT7A 2K60A 3TADA 2IHMA 4QNLA 2BKEA 5AKKA 2KN7A 5F3XB 3ONNA 2PFOA 1F5SA 2QB1A 2W11A 3H8MA 2HOFA 2DBYA 4DSFA 4YFKA 4FO6A 2UVUA 2E1FA 5GTHU 2HHXA 5KT2A 5TZVA 3CRXA 2F77X 2H5XA 3KHHA 4QJFB 1ZQYA 3H0MB 3GDXA 3TARA 1Q3UA 1CRXA 3H0LB 2E3TA 2JXJA 3GIJA 8ICCA 1UT5A 5JRTA 8ICGA 2HHSA 1T94A 4KLFA 4IS7A 5D49A 2IMWP 5ALNA 2FLLA 4R63A 5T14A 2PI4A 4TURA 4O3QA 2F1IA 2FPLA 4C4SA 5AK6A 4TUSA 3RB6A 1LVHA 4CF5A 4YR2A 3H7IA 1NK9A 3RJEA 3N97B 2W9AA 4MF8A 1YZ6A 3PX6A 1PK1A 5DBAA 2G07A 5J2DA 5F9LA 1RQNA 4IRDA 3KHGA 4DSJA 2DKZA 4YP3A 4OJ5A 4C0ZA 3D2SA 2DL0A 5HNKA 3N7PD 1N5XA 4PZNA 3C5GA 4MFAA 4GXKA 4UAUA 3NRZA 7ICLA 4PGQA 5D4BA 4KLQA 2GH1A 4UAWA 2F44A 5D46A 4M9NA 2HW3A 1QSSA 4EZ9A 5G5GA 5J2EA 3BQ7A 5KFUA 5KFLA 1U47A 4DOCA 5C5JA 4RUCA 1KKXA 2JRZA 4EX7A 2YY6A 3KKAA 1KW4A 4O5KA 2AQ0A 5ALXA 4O5CA 5KFZA 7ICIA 4MFFA 4GXIA 1JN3A 4MEYA 5J0OA 2EANA 4GIBA 5IIJA 2W43A 3IRUA 2H3QA 2DPIA 9ICIA 2GO7A 3F2DA 2H3FA 4RQ7A 1ZRMA 3GIMA 1T7PA 3KHRA 1N56A 2NO5A 5L9XA 2KJ5A 3H4BA 2FDRA 2KZ3A 3WKAA 3CNHA 5ALFA 2DQNB 2A1JA 1ZJNA 4F4WA 2KP7A 3NGDA 3C2MA 1WYGA 2BCRA 5KFPA 5ALMA 2DUYA 2WAQF 5KFIA 2Y1IA 4ED6A 4R8UA 4O3PA 4I29A 2ZIWB 8ICAA 3UQ2A 1F0MA
chains in the Genus database with same CATH topology
2OXOA 2G07A 4KX3A 2KV2A 1UPHA 3F2BA 2XICA 1DRGA 1ECWA 5KL8B 4O3MA 3LVWA 2NV3A 3SMVA 2WB1F 2LYAA 4IC9A 2VJ4A 3C29A 3F5EA 2F8LA 2Y0SC 2ZIVA 4CDGA 4AYBF 2OM6A 2YX8A 2OYYA 4BX9C 3SAGA 2H3ZA 2K8AA 2LYBA 4OJ5A 4C0ZA 3DEEA 3D2SA 3GZFA 2W04A 4PL2A 2KEYA 4ACOA 4CGZA 3N7PD 2ZIWA 2CN1A 4P0QA 4OJPA 3NRWA 2HBMA 4OJLA 1A6SA 4A8EA 2PMZF 1MA7A 2JHDA 2W7PA 2HMXA 1URJA 2LKYA 3IG8A 4P0PB 1GO3F 2D6FC 3LYSA 3O0FA 4BJQA 2K89A 4QNLA 2G5HB 4BUGA 2G06A 1PVRA 2GH1A 1KBUA 2VIXA 2K4HA 4U6PA 3F53A 3ONNA 3IP4B 2RP5A 4JMUA 3M6KA 2E1EA 1IIPA 2KHQA 2W03A 3OPXA 2KICA 4KX5A 3VC8A 2KOBA 2KHVA 1SZHA 3PSTA 4FZNA 2LHTA 3IG5A 2JH7A 1PVQA 2XVTA 4FE3A 2HOQA 5A0LA 1PVPA 2HOFA 4PL1A 2PMZC 4GFJA 5KL1B 3SQIA 2KJ9A 2KIWA 2KKVA 4QIWF 3C28A 2E1FA 3IN5A 1Q3VA 3MGVA 2R18A 3PSIA 3T79A 2KKPA 3CRXA 3PZPA 2K4IA 2XI9A 2F77X 3RFAA 3E0FA 2ZXIA 4P0PA 2JGAA 2Y0SF 2YB1A 2W7OA 2RHFA 4QJFB 3D2NA 4OJOA 2ZG6A 3H0MB 3M7DA 4AYBC 2M0NA 3ICXA 3LVVA 3K1ZA 3KZXA 1Q3UA 4WJ3B 1ZQ1C 2Q4TA 1CRXA 1Z1BA 3H0LB 1ED1A 3SAHA 2MRLA 2WB1C 2A3VA 2HBJA 2G0AA 2RRDA 2H3QA 3KFUF 2CRXA 2ZIVB 5HR6A 3F2DA 3AQFA 4OJ6A 3SAFA 1T94A 3H0RB 1Z19A 2H3FA 2N1RA 2F2AB 2HBKA 2G09A 1TAMA 3AQEA 2ZIXB 3N7RC 3PSFA 3RF9A 4U7CA 2ZXHA 2HOIA 2YB4A 2KJ5A 3F5AA 1A0PA 3ALRA 3F2CA 4FZMA 2LBOA 3VCBA 1YT3A 2ZIXA 5C0YA 4NLBA 2MA1A 2DQNB 2K8CB 2KVCA 4FZLA 4CRXA 1D8BA 2WAQC 5T14A 3GU3A 3HKZC 2E5SA 2VJ5A 3AL0B 2JH1A 2BDUA 1XNSA 2ZIUB 2OH2A 2CPRA 2GOLA 2G5IB 3PSPA 1NZBA 2XIDA 2Z7JA 2KNJA 3HKZF 3L3FX 2WAQF 2K8BB 4NLCA 4NWIA 2DF4B 4NV0A 1HIWA 2HBLA 3N7SC 5CRXA 3CYMA 1WUDA 3CP8A 3NUQA 2ZIUA 1L6NA 1HEKA 2VKQA 2G08A 1P7DA 3M6ZA 3D2QA 1XO0A 2F76X 2K4EA 2H3VA 4ICAA 1OUQA 2KJ8A 2ZIWB 4P0QB 4OO1J 2JMGA 5HR7A 2H3IA 2KD1A 4KMOB 2DGZA 1F44A 4QIWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2S A;  2E5S A;  3D2N A;  3D2Q A; 
#chains in the Genus database with same CATH topology
 3F2B A;  5J0Y A;  3WK6 A;  4J9O A;  4EBE A;  2FI1 A;  3RTV A;  5KFH A;  1YZ7 A;  4QZI A;  4R66 A;  3EUB 2;  3HRD D;  1K1S A;  1U4B A;  3AU2 A;  4PPX A;  2C2D A;  2J6U A;  5KFX A;  5DB7 A;  5CA7 A;  1BPY A;  4DQI A;  3MGH A;  1COK A;  2KG5 A;  3EPG A;  3TFR A;  3L4P A;  3HX0 A;  4DF4 A;  4KLG A;  1UT8 A;  2K89 A;  3UXN A;  1DGJ A;  2KMD A;  3AMZ A;  3PML A;  5DDY A;  4C7Z A;  2WFA A;  4KLU A;  2VIX A;  4LJX A;  5KFQ A;  4U6P A;  3E58 A;  3V72 A;  2XGQ A;  2KIC A;  1A77 A;  3TAC B;  4DL2 A;  2JZB A;  4HAI A;  1SZH A;  3ISB A;  1M6Y A;  3OSN A;  2LHT A;  3ZI4 A;  7ICO A;  2XVT A;  5AKJ A;  3KHL A;  4DQS A;  4RPX A;  2YMP A;  2R8G A;  1OXJ A;  1S8O A;  2W8K A;  1ZQR A;  2R18 A;  1Q8K A;  3JPO A;  4NLK A;  2K4I A;  4PHP A;  5KFC A;  1SWV A;  4P0P A;  4M9G A;  1SV0 C;  2Y0S F;  2R8K A;  8ICS A;  2EZX A;  2PXI A;  1ED1 A;  4M9J A;  2WB1 C;  2A3V A;  1TVA A;  1H38 A;  4C8L A;  3GIL A;  4DL7 A;  4KLT A;  4J9P A;  4KLD A;  2HHW A;  9ICW A;  4J9N A;  4DFD A;  2MUT B;  4FZM A;  1FFV A;  2LBO A;  8ICU A;  3G6Y A;  4NLB A;  1KRP A;  4PHD A;  4M6W B;  4DFJ A;  2DWQ A;  1J97 A;  4KLI A;  1L8O A;  4Q45 A;  4B9M A;  3PSP A;  2QLT A;  3CYM A;  3CP8 A;  4UB2 A;  3V6J A;  4QZC A;  4F2R A;  4Y2V A;  4RQ2 A;  3T5L A;  4ED3 A;  4QZD A;  4KX3 A;  3PO4 A;  1UQV A;  5ALO A;  2DKX A;  2XGP A;  3WKD A;  3LVW A;  4JWN A;  4DO9 A;  5AI4 A;  1NK8 A;  4R65 A;  4I2F A;  5DG9 A;  1T3Q A;  2E8O A;  4I2B A;  4YMM A;  4TQS A;  1ZQB A;  1K1Q A;  5AI8 A;  3ISD A;  3MFH A;  3BDP A;  2GWS A;  1SXE A;  4DS5 A;  5KFM A;  2KFN A;  5AIC A;  1N61 A;  4Y2U A;  8ICZ A;  2YML A;  4ECZ A;  4RNO A;  1PVR A;  2VA8 A;  3PW0 A;  1TFR A;  2RP5 A;  2E1E A;  2KHQ A;  3JPQ A;  2YQE A;  4DQR A;  4KX5 A;  4MHV A;  5DB6 A;  4DL5 A;  4DQP A;  4ECT A;  4Z6F A;  3ZDE A;  3KOO A;  4GFJ A;  1RYU A;  2A1J B;  1O08 A;  5AKI A;  1DOQ A;  1ZQV A;  1X40 A;  2M0N A;  2V9W A;  4Y2Q A;  2YN4 A;  2UVR A;  1KQQ A;  5J2F A;  1MSW D;  3UXP A;  1XC9 A;  2P6R A;  4EYH B;  3QNM A;  5ALK A;  5ALS A;  4K4I A;  3HWT A;  1TAM A;  3RR7 A;  3S6J A;  5HHI A;  7ICU A;  5J0P A;  1DXS A;  4O0I A;  4UB5 A;  4IQW A;  4M6W A;  3QU9 A;  3VCB A;  3FAH A;  3QUB A;  2W54 A;  3PO5 A;  4KTQ A;  4YN4 A;  2KSO A;  3HKZ C;  2JH1 A;  5KNI A;  2G5I B;  4X5V A;  5DQI A;  2P6U A;  1HIW A;  1ZRN A;  2G08 A;  3D2Q A;  3SV4 A;  8ICV A;  2NRZ A;  1ZXI A;  2DGZ A;  2OXO A;  2ZTC A;  3L5K A;  1TE2 A;  1S5L U;  2PFN A;  2I6X A;  1BGX T;  2J6S A;  5L1K A;  2BPC A;  4YVZ A;  4Z6E A;  3M9M B;  1CUK A;  1QH9 A;  4QZB A;  2K8A A;  2LYB A;  1CEZ A;  4EBD A;  5IIM A;  8ICL A;  1SB3 C;  5L1J A;  4QWA A;  4NLZ A;  2HHU A;  1BPZ A;  4A8E A;  3TKA A;  2LKY A;  5CP2 A;  1PZN A;  5KT5 A;  2G06 A;  4DEZ A;  4QZF A;  3JPR A;  3IP4 B;  3T3F A;  4JMU A;  3QUC A;  4F72 A;  2IOF A;  5L1M A;  4TQR A;  1ZET A;  3RJH A;  5DB9 A;  5J0R A;  5KG3 A;  2HOQ A;  1PVP A;  4KLO A;  4PL1 A;  4UQG A;  8ICY A;  3SQI A;  3V7K A;  4TUQ A;  1CI4 A;  3RBD A;  4ED7 A;  2HVH A;  3MGV A;  3PSI A;  4YMO A;  5L1I A;  3OJS A;  3AEV A;  1KEJ A;  4F3O A;  4F50 A;  3PY8 A;  5KFD A;  5JTI A;  4EEL A;  4RPY A;  2BGW A;  3SI8 A;  5IIO A;  4WJ3 B;  4IRC A;  3T5J A;  4JUZ A;  4GC6 A;  3H40 A;  3T5H A;  3PW2 A;  5ALW A;  3PVX A;  2IBK A;  5ALI A;  2KSO B;  3ALR A;  2QKQ A;  3MR3 A;  8ICI A;  2NYV A;  4GC7 A;  3BS5 B;  3GIK A;  4MEX A;  5FP0 A;  4B9L A;  3MAB A;  5AK4 A;  5IIN A;  3WKB A;  5ALD A;  4YXJ A;  4C7Y A;  1RYS A;  1MQ3 A;  5E79 U;  3J81 j;  2BQ3 A;  1FIQ A;  1X9W A;  2BCQ A;  4J9K A;  1DGS A;  2F8L A;  2W55 A;  4M47 A;  3H8J A;  2W04 A;  2D8C A;  2ZIW A;  8ICJ A;  2ZJ5 A;  3NRW A;  2FPM A;  2PMZ F;  2YTU A;  2ODG A;  5J2I A;  2LM4 A;  4BJQ A;  4RQN A;  2IA6 A;  2ESE A;  3BS5 A;  1L7P A;  1N5W A;  4F93 B;  2AJQ A;  5DBB A;  8ICH A;  8ICQ A;  1B0X A;  1ZQS A;  2BPG A;  2KHV A;  2RQ5 A;  3ETL A;  1NKE A;  3MFI A;  1X66 A;  5EE0 A;  5KT4 A;  4OD0 A;  5KFY A;  1Q3V A;  1Y88 A;  3R9K A;  4EEK A;  3T79 A;  2B6G A;  1S0V A;  1N2X A;  5AKH A;  4NL9 A;  1LB2 B;  3T5K A;  4KLH A;  3LVV A;  1ZQ1 C;  1SZP A;  4RQ5 A;  1X9S A;  4DLG A;  1DK3 A;  4YXM A;  2HHT A;  3EPI A;  4ED1 A;  1L5U A;  3N7R C;  4DQQ A;  3MC1 A;  4I2I A;  4US9 A;  3Q8L A;  3OGU A;  4ED0 A;  1TK5 A;  1ZQN A;  2KVC A;  3QZ8 A;  1LV5 A;  3NTU A;  1WWU A;  1ZQG A;  4C4T A;  2XID A;  8ICB A;  4RU9 A;  2EAP A;  4ECR A;  4KMO B;  4C4R A;  4J9L A;  3WK9 A;  9ICO A;  2QAR A;  5AKE A;  2W8L A;  1ZD3 A;  2W9M A;  2E8M A;  4PHE A;  1S0M A;  5J29 A;  2KIV A;  4QZE A;  2ES6 A;  4CGZ A;  2JEG A;  1K5O A;  3H8W A;  4FBT A;  4I2C A;  5HHH A;  3RH5 A;  4O3N A;  1MA7 A;  2W9C A;  9ICM A;  3O0F A;  5EE9 A;  2WHE A;  3U26 A;  4I2E A;  3UMC A;  4F91 B;  1EXN A;  4K4G A;  4UAY A;  1UA1 A;  4ELV A;  3RH6 A;  3F53 A;  1XWL A;  5KG6 A;  4RQ1 A;  1SV0 A;  3M6K A;  4IL6 U;  9ICE A;  3IHQ B;  3UMG A;  2KOB A;  1QTM A;  3MDC A;  5J2H A;  3IG5 A;  4RZR A;  1QLN A;  2PMZ C;  4QZ8 A;  3JPS A;  3C5F A;  3PZP A;  2BCU A;  1TK8 A;  4XRH A;  4BWM A;  3BQ1 A;  2YMQ A;  2XCP A;  7ICJ A;  5EE1 A;  2ZG6 A;  2NRV A;  2Y9U A;  5KFR A;  3K1Z A;  3NVV A;  1T3N A;  2MRL A;  2B0C A;  4XA5 A;  4EZ6 A;  4OCZ A;  2O6K A;  7ICT A;  8ICW A;  4G3I A;  3NS1 A;  2N1R A;  3JPT A;  2AGO A;  1KFT A;  5J2K A;  3Q8R B;  1ARO P;  5GTI U;  3LWL A;  2ZIX A;  1IXR A;  5L1L A;  2VJ5 A;  2CPR A;  2GOL A;  2UVW A;  2Z7J A;  4RQM A;  4UAV A;  5KFG A;  1AQ6 A;  2AQ4 A;  3N7S C;  1XSN A;  1KFS A;  3TAN A;  1WUD A;  4DWI A;  4YR0 A;  4RT3 A;  3KD3 A;  2VKQ A;  1P7D A;  3MGI A;  4BXO A;  2R8H A;  4P0Q B;  1SWW A;  3K1R B;  1BPD A;  2XIC A;  1ZQP A;  4GXJ A;  5KL8 B;  2FMQ A;  4E0D A;  5EE3 A;  5DBC A;  5KFV A;  1HJP A;  3PW4 A;  9ICQ A;  2C2R A;  1NI3 A;  2PI5 A;  2RDJ A;  3RAQ A;  2H3Z A;  2MU2 A;  9ICG A;  1X42 A;  3SEN A;  3QU7 A;  3HT3 A;  4DL4 A;  2BQU A;  4B9N A;  1BPB A;  1X9X A;  1U9L A;  3N4M B;  4M2Y A;  1L3U A;  4MF2 A;  4UW9 A;  2LI6 A;  4PH5 A;  1KDH A;  4F5N A;  4B6J A;  3H4D A;  5JU5 A;  4F92 B;  2W03 A;  4UAT A;  1JRP A;  4EBC A;  4FZN A;  5G5H A;  2JH7 A;  1TV9 A;  1Z00 B;  2JZB B;  1RQL A;  4QZG A;  5DLF A;  4QZA A;  3IN5 A;  7ICK A;  3KKA C;  3TI0 A;  2KKP A;  2EZY A;  5ALH A;  3RB4 A;  3FM9 A;  1JIH A;  4IQU A;  2R8J A;  2JEF A;  4NM1 A;  1FO4 A;  1SV4 A;  1Z19 A;  1SIJ A;  4DL3 A;  4ED8 A;  3RF9 A;  2ZIX B;  4EEN A;  5J0T A;  4BGD A;  3BZK A;  4RNN A;  8ICF A;  4FZL A;  1JX4 A;  3GU3 A;  5H2F U;  2L5Y A;  5KT6 A;  3V6K A;  1JMS A;  1XNS A;  2OH2 A;  5AI5 A;  4NJ8 A;  2KNJ A;  1SL2 A;  3SV3 A;  4C8O A;  4IR9 A;  4NV0 A;  1IG6 A;  2ZIU A;  1L8L A;  2AGQ A;  1S9F A;  4Y2R A;  1XO0 A;  4ICA A;  5J2J A;  4ECS A;  7ICV A;  4Q43 A;  1HUZ A;  2AH5 A;  1COO A;  1JUD A;  4QZ9 A;  2YMM A;  1PK1 B;  3WU2 U;  3GFK B;  3C29 A;  1J2N A;  5HMM A;  4F2S A;  3GV8 B;  2YX8 A;  4AYB F;  4BX9 C;  5AIA A;  1NJZ A;  2XY5 A;  3OHB A;  4DFP A;  4KLM A;  2KVS A;  3B0Y A;  4F4K A;  4UAR A;  4OJP A;  2E8P A;  4DOB A;  1ZQU A;  4ECX A;  3ETR A;  2IOH A;  4I28 A;  5III A;  4JV2 A;  4UB4 A;  3OSP A;  4UAS A;  2W9B A;  5IIL A;  3RJK A;  1ZD5 A;  1BNP A;  4CCH A;  4P4P A;  3PST A;  5BOM A;  2EH9 A;  4GLX A;  1ZQL A;  3IM1 A;  4O3S A;  2IOF K;  5ALQ A;  3HIL A;  3I1Y A;  4M9H A;  3KZX A;  2XO7 A;  2EZZ A;  5KFT A;  2KZZ A;  2RRD A;  4UB6 U;  2A1A A;  3SAF A;  3QXG A;  2HOI A;  3ED5 A;  3BQT A;  3F2C A;  1N60 A;  5DLG A;  3RR8 A;  3WK5 A;  4I27 A;  1D8B A;  2V4Q A;  4FS1 A;  1IM4 A;  2ZIU B;  1NOM A;  2EQY A;  4NXZ A;  4NLC A;  4FS2 A;  5CRX A;  3M6Z A;  4P4O A;  3QU4 A;  2JMG A;  2W3R A;  1JXE A;  1F44 A;  3QYP A;  4DLE A;  1XO1 A;  3RJI A;  1SKS A;  4ED2 A;  4KIT B;  2FE9 A;  2OYY A;  5ALT A;  2ASD A;  3H8S A;  4C8M A;  5DB8 A;  1FFU A;  2PFQ A;  3C23 A;  2CN1 A;  3QUQ A;  4OJL A;  2QAR B;  1S76 D;  4PZO A;  2BCV A;  4IRK A;  3BS7 A;  3RJF A;  3M8S A;  4BUG A;  2C22 A;  4QWE A;  2AGP A;  4PGY A;  1L7N A;  4J9S A;  2ZJA A;  3OPX A;  5EWE A;  4O3R A;  4F4Z A;  3IDW A;  5AIB A;  3C2K A;  1L3S A;  2Y1J A;  1WCL A;  5KL1 B;  2KJ9 A;  3ZDA A;  2HHQ A;  3AM9 A;  1ZQC A;  5AM2 A;  3THV A;  1NZP A;  4Y2J A;  7ICG A;  1ZQX A;  2HI0 A;  2YB1 A;  1S77 D;  2NRT A;  1NK7 A;  4AYB C;  3NVZ A;  1RZT A;  4DS4 A;  1Z00 A;  1Z1B A;  4CE6 A;  2HBJ A;  1C20 A;  3KFU F;  1QSL A;  3NVW A;  2BR0 A;  1ZD4 A;  3GV7 B;  2F2A B;  2HBK A;  1ZQE A;  4YR3 A;  4U7C A;  7ICQ A;  4C8K A;  4QWC A;  9ICF A;  5J8Y C;  1X6I A;  3MDA A;  4YD2 A;  5EWF A;  2MUT A;  4F5O A;  2E5S A;  3WK7 A;  1V38 A;  5J2A A;  5J0X A;  2OWO A;  1NZB A;  1L3T A;  1V9P A;  2NRW A;  3ZDD A;  5KAF U;  3RRH A;  3ZDC A;  1ZQO A;  2H3V A;  4OO1 J;  3C1Y A;  2H3I A;  5KFJ A;  5DQH A;  3GQC A;  4UBC A;  4O9M A;  3FYH A;  2NV3 A;  4UAZ A;  2F1J A;  3M9N B;  2ISO A;  2R8I A;  1S0O A;  2OM6 A;  4M9L A;  3C2L A;  1D9D A;  1XSL A;  3WK4 A;  2KEY A;  1B4F A;  1VDV A;  5AKL A;  8ICR A;  2HHV A;  1U49 A;  4I2G A;  2D6F C;  4DL6 A;  2G5H B;  4USA A;  5AKZ A;  3KZI U;  4EEY A;  5J0W A;  3UMB A;  2OCE A;  4NM2 A;  2FMS A;  7ICM A;  3PR5 B;  4RPZ A;  3PX0 A;  9ICS A;  2WF9 A;  3WKC A;  2C28 A;  3RJG A;  3Q8K A;  1KTQ A;  7ICH A;  9ICR A;  1VJ5 A;  2KIW A;  3PW5 A;  4QIW F;  9ICP A;  1OW5 A;  5DKW A;  1RM6 C;  3UQ0 A;  5ALR A;  2Y9T A;  5AKG A;  1Z4O A;  3GII A;  9ICC A;  3LWM A;  2VA3 A;  4US8 A;  1Z4N A;  4P2H A;  2Q4T A;  2XC9 A;  5TIS U;  4BXO B;  5EOZ A;  3MR6 A;  5EWG A;  3AQF A;  1SXD A;  2DFL A;  3H0R B;  3Q8S B;  2G09 A;  1X2I A;  3M1Y A;  5ALE A;  1A76 A;  2I9G A;  4KN4 A;  2JV3 A;  2AU0 A;  1ZQD A;  1MQ2 A;  4UBB A;  2ISP A;  2FLN A;  5JUM A;  4JB3 A;  1HEK A;  2F76 X;  4J03 A;  1NJY A;  1FEZ A;  5DGB A;  5AM0 A;  4LZG A;  1NKC A;  3BJY A;  4QIW C;  4I2H A;  2KV2 A;  1UPH A;  3RAX A;  2OEH A;  3OTQ A;  2FPK A;  4O3M A;  1Z1V A;  4QW8 A;  3EYZ A;  3UXO A;  4Z6D A;  1L7M A;  3DEE A;  3SYZ A;  2NRX A;  4O3O A;  2KFZ A;  2HBM A;  4I2J A;  2QB0 B;  4ECQ A;  2HMX A;  3IG8 A;  1GO3 F;  2MSN A;  4CF3 A;  1UA0 A;  2BPF A;  5KFW A;  4QWB A;  2E8N A;  4J9M A;  1XS9 D;  2F1H A;  1NJW A;  3LK9 A;  4B9S A;  4LZD A;  2K4H A;  1D9F A;  1V97 A;  3RB3 A;  4J9R A;  1BPE A;  2ZUC A;  2BDP A;  4NY8 A;  4K4H A;  1JRO A;  4ELT A;  1PVQ A;  3KBB A;  2AHO B;  4Y2X A;  2DPJ A;  3C28 A;  1ZYQ A;  3ZD9 A;  3E0F A;  2ZXI A;  4YCX A;  1RYR A;  2K4P A;  4B9U A;  4OJO A;  4PHA A;  3NVY A;  2ZUD A;  2HSZ A;  3ZDB A;  2GLE A;  5AK3 A;  7ICN A;  1ZQJ A;  1N48 A;  4KLJ A;  1NK4 A;  4DF8 A;  4Y2T A;  4RQ3 A;  1SKW A;  3F5A A;  1RXW A;  4NL9 C;  5KFA A;  4EYI B;  2OHF A;  2I1Q A;  3QX7 A;  1TKD A;  4KLE A;  2IHN A;  3G6V A;  4O5E A;  3EW9 A;  2F3N A;  3FC4 A;  2BQR A;  3Q8M A;  5KFF A;  5HP4 A;  5J0U A;  1L6N A;  3C21 A;  9ICJ A;  2P66 A;  4M0A A;  1NJX A;  4EX6 A;  2WF6 A;  1X9M A;  3E2E A;  2EAM A;  3NAS A;  5AM5 A;  4DFM A;  1DRG A;  4FFD A;  2I5H A;  2WB1 F;  4IC9 A;  4ZH4 A;  5KFK A;  5J2B A;  4QZH A;  2Y0S C;  2ZIV A;  1LKY B;  3V6H A;  5AI0 A;  4BDP A;  2A19 A;  4Y2S A;  4ACO A;  4RNM A;  3GV5 B;  4NLG A;  3HJE A;  5DQG A;  1A6S A;  4RQ8 A;  3RB0 A;  4P0P B;  5AM4 A;  3SR6 A;  4J9Q A;  4KMU A;  2C2E A;  3C1Z A;  3TAQ A;  3QU2 A;  3MR5 A;  1XSP A;  5DG8 A;  1QQ6 A;  4XUS A;  4DFK A;  1NK5 A;  4JK1 A;  5A0L A;  2ATL A;  8ICN A;  1TAQ A;  1SL0 A;  4KLS A;  5BOL A;  1T4G A;  4JV1 A;  2W9C B;  1QQ7 A;  2F8K A;  4Y2Y A;  3V7L A;  1LKY A;  2ASL A;  2Q0Z X;  9ICK A;  3TAP A;  3M7D A;  3EWA A;  1XU4 A;  5KFE A;  3QE9 Y;  9ICB A;  4AP9 A;  3EZ5 A;  4R64 A;  2CRX A;  4CF4 A;  4OJ6 A;  3PX4 A;  4UB1 A;  3PSF A;  3PNC A;  4F71 A;  1A0P A;  2CXY A;  2KTQ A;  5AK5 A;  4F8R A;  5C0Y A;  3JPN A;  2K8C B;  4CRX A;  7ICR A;  3K75 D;  5AM3 A;  4IQT A;  2QB0 A;  4HYK A;  2K4E A;  2V4R A;  2KJ8 A;  4KN7 A;  5J8Y A;  4DCC A;  3RJJ A;  3QU5 A;  1BNO A;  3SMV A;  3B0X A;  2FMP A;  1ZQZ A;  4ELU A;  3A0H U;  3F5E A;  3AU6 A;  1TK0 A;  1B22 A;  3G6X A;  3SAG A;  5KG2 A;  5KG4 A;  2FLP A;  4I2A A;  5KTQ A;  3GZF A;  4PL2 A;  2P35 A;  5J2G A;  2BCS A;  2MAX A;  4F5P A;  3TFS A;  2JHD A;  3HW8 A;  1URJ A;  2W3S A;  2ZTD A;  2D3D A;  5AKX A;  3TAD C;  1T8E A;  9ICA A;  2KZM A;  5KT3 A;  2VA2 A;  3RRG A;  1KBU A;  3JPP A;  1RG6 A;  3QUT A;  4F5Q A;  3BQ0 A;  9ICT A;  4XQ8 A;  1ZQI A;  1S97 A;  1Q46 A;  3VC8 A;  4DSL A;  2RDI A;  3ORY A;  5ALU A;  5J0S A;  4FE3 A;  2LMR A;  7ICE A;  2WF7 A;  5CHG A;  5KG0 A;  2JEJ A;  4ECW A;  3LDA A;  2PKE A;  4ECV A;  5CEH A;  2ZTE A;  1ZJM A;  4ECU A;  3DV9 A;  2HVI A;  3DDH A;  4Q8F A;  1ZQW A;  4F5R A;  2W7O A;  1MN8 A;  3B9J A;  4YG2 A;  5KAI U;  1SGG A;  1ZQA A;  3A0B U;  3OHA A;  5HR6 A;  3Q8Q B;  4JWM A;  3PR4 A;  3AQE A;  1RPL A;  4JV0 A;  4BWJ A;  5B5E U;  1ZQF A;  9ICX A;  3FDS A;  1D8L A;  1YT3 A;  2WF5 A;  1KN5 A;  2EAO A;  3CW2 C;  1ZQH A;  4RQ0 A;  3PMN A;  5ALY A;  3HKZ F;  3L3F X;  9ICU A;  2W9B B;  2K8B B;  4NWI A;  2DF4 B;  2HBL A;  2RLT A;  4YD1 A;  3N28 A;  1D8Y A;  2KD1 A;  1HUO A;  3PW7 A;  2LYH A;  5BPC A;  1QCK A;  1ECW A;  2LM1 A;  9ICN A;  4YQW A;  2VJ4 A;  1VLB A;  5KG1 A;  2BZF A;  5DGA A;  4G9B A;  3ISC A;  3D6J A;  2FJ6 A;  1IV8 A;  3K4G A;  3Q8P B;  1L7O A;  3SZ2 A;  1SL1 A;  2WTF A;  1WG8 A;  5IIK A;  8ICK A;  1PUZ A;  1JI7 A;  3LYS A;  3SD7 A;  4Q8E A;  4ZOH C;  1KSP A;  2ASJ A;  1B43 A;  2XY6 A;  3WK8 A;  2WF8 A;  1DK2 A;  1PK3 A;  1S0N A;  1IIP A;  5CWR A;  4YMN A;  5ALG A;  1QQ5 A;  1NK6 A;  2JEI A;  1NNL A;  9ICL A;  2M9N A;  1N63 A;  9ICV A;  8ICP A;  1N62 A;  7ICP A;  8ICM A;  1BVS A;  9ICH A;  3D2N A;  3IV6 A;  4UB8 U;  1KFD A;  3ICX A;  8ICE A;  5HML A;  5J0Q A;  4P4M A;  5AKY A;  1ZQK A;  2B21 A;  4QWD A;  2ZXH A;  1QSY A;  4UB3 A;  2YB4 A;  4Z6C A;  1C7Y A;  2XCA A;  1V85 A;  2MA1 A;  3I28 A;  5AHX A;  5ALZ A;  1RXV A;  1NK0 A;  4Q44 A;  2ZUB A;  2AXT U;  2BDU A;  2KE7 A;  5CB1 A;  4PGX A;  4PJ0 U;  4M04 A;  1L3V A;  3MR2 A;  1KLN A;  1KL9 A;  3HPO A;  2HDO A;  3NUQ A;  4CNQ A;  1UCV A;  3HP6 A;  5K4L A;  3KTQ A;  4KLL A;  5AI9 A;  5AI6 A;  5F9N A;  3ZD8 A;  5CJ7 A;  3OJU A;  4CDG A;  1ZQM A;  3UM9 A;  3SEI A;  3I76 A;  4DSE A;  3MBY A;  3QEB Z;  3AUO A;  2W7P A;  8ICT A;  4RT2 A;  5KFS A;  4I2D A;  2J6T A;  4C8N A;  5KG7 A;  2EDU A;  2ZJ8 A;  5DG7 A;  4F4Y A;  4C80 A;  4FBU A;  4ECY A;  3M9O B;  4RUA A;  4NLN A;  1WCN A;  1U48 A;  1TAU A;  3BZC A;  4RQ6 A;  2XY7 A;  1ZD2 P;  3RH4 A;  5ALJ A;  5KG5 A;  1SKR A;  3PV8 A;  2KKV A;  8ICX A;  4DSI A;  3AN1 A;  4TUP A;  4B9T A;  2XI9 A;  3RFA A;  4QW9 A;  1J2M A;  2JGA A;  1JAL A;  2BHN A;  2RHF A;  2VAN A;  5KFB A;  5AM1 A;  2JR5 A;  3SAH A;  2G0A A;  2ZIV B;  5DDM A;  4RQ4 A;  7ICF A;  3M8R A;  1O03 A;  4R8U B;  4MFC A;  5CR0 A;  2WAQ C;  5KFN A;  3QEA Z;  3AL0 B;  1RDF A;  5ALL A;  1X6J A;  4B9V A;  2KK0 A;  2NO4 A;  1BPX A;  5KFO A;  1ZQQ A;  4DSK A;  1NKB A;  2LPE A;  3BQ2 A;  4F4X A;  1JXL A;  3V7J A;  4LVS A;  5HR7 A;  1OUQ A;  7ICS A;  1ZOL A;  1S10 A;  5ALV A;  5J2C A;  1WWV A;  1U45 A;  1Z3E B;  2LYA A;  5B66 U;  3UPQ A;  3RBE A;  3WKE A;  4IR1 A;  2HCF A;  8ICO A;  2PFP A;  4P0Q A;  3QZ7 A;  1MC8 A;  1ZQT A;  2ALZ A;  4DOA A;  4IQV A;  2UVV A;  1UHU A;  3TQ1 A;  5ALP A;  4Y2P A;  5KT7 A;  2K60 A;  3TAD A;  2IHM A;  4QNL A;  2BKE A;  5AKK A;  2KN7 A;  5F3X B;  3ONN A;  2PFO A;  1F5S A;  2QB1 A;  2W11 A;  3H8M A;  2HOF A;  2DBY A;  4DSF A;  4YFK A;  4FO6 A;  2UVU A;  2E1F A;  5GTH U;  2HHX A;  5KT2 A;  5TZV A;  3CRX A;  2F77 X;  2H5X A;  3KHH A;  4QJF B;  1ZQY A;  3H0M B;  3GDX A;  3TAR A;  1Q3U A;  1CRX A;  3H0L B;  2E3T A;  2JXJ A;  3GIJ A;  8ICC A;  1UT5 A;  5JRT A;  8ICG A;  2HHS A;  1T94 A;  4KLF A;  4IS7 A;  5D49 A;  2IMW P;  5ALN A;  2FLL A;  4R63 A;  5T14 A;  2PI4 A;  4TUR A;  4O3Q A;  2F1I A;  2FPL A;  4C4S A;  5AK6 A;  4TUS A;  3RB6 A;  1LVH A;  4CF5 A;  4YR2 A;  3H7I A;  1NK9 A;  3RJE A;  3N97 B;  2W9A A;  4MF8 A;  1YZ6 A;  3PX6 A;  1PK1 A;  5DBA A;  2G07 A;  5J2D A;  5F9L A;  1RQN A;  4IRD A;  3KHG A;  4DSJ A;  2DKZ A;  4YP3 A;  4OJ5 A;  4C0Z A;  3D2S A;  2DL0 A;  5HNK A;  3N7P D;  1N5X A;  4PZN A;  3C5G A;  4MFA A;  4GXK A;  4UAU A;  3NRZ A;  7ICL A;  4PGQ A;  5D4B A;  4KLQ A;  2GH1 A;  4UAW A;  2F44 A;  5D46 A;  4M9N A;  2HW3 A;  1QSS A;  4EZ9 A;  5G5G A;  5J2E A;  3BQ7 A;  5KFU A;  5KFL A;  1U47 A;  4DOC A;  5C5J A;  4RUC A;  1KKX A;  2JRZ A;  4EX7 A;  2YY6 A;  3KKA A;  1KW4 A;  4O5K A;  2AQ0 A;  5ALX A;  4O5C A;  5KFZ A;  7ICI A;  4MFF A;  4GXI A;  1JN3 A;  4MEY A;  5J0O A;  2EAN A;  4GIB A;  5IIJ A;  2W43 A;  3IRU A;  2H3Q A;  2DPI A;  9ICI A;  2GO7 A;  3F2D A;  2H3F A;  4RQ7 A;  1ZRM A;  3GIM A;  1T7P A;  3KHR A;  1N56 A;  2NO5 A;  5L9X A;  2KJ5 A;  3H4B A;  2FDR A;  2KZ3 A;  3WKA A;  3CNH A;  5ALF A;  2DQN B;  2A1J A;  1ZJN A;  4F4W A;  2KP7 A;  3NGD A;  3C2M A;  1WYG A;  2BCR A;  5KFP A;  5ALM A;  2DUY A;  2WAQ F;  5KFI A;  2Y1I A;  4ED6 A;  4R8U A;  4O3P A;  4I29 A;  2ZIW B;  8ICA A;  3UQ2 A;  1F0M A; 
#chains in the Genus database with same CATH homology
 2OXO A;  2G07 A;  4KX3 A;  2KV2 A;  1UPH A;  3F2B A;  2XIC A;  1DRG A;  1ECW A;  5KL8 B;  4O3M A;  3LVW A;  2NV3 A;  3SMV A;  2WB1 F;  2LYA A;  4IC9 A;  2VJ4 A;  3C29 A;  3F5E A;  2F8L A;  2Y0S C;  2ZIV A;  4CDG A;  4AYB F;  2OM6 A;  2YX8 A;  2OYY A;  4BX9 C;  3SAG A;  2H3Z A;  2K8A A;  2LYB A;  4OJ5 A;  4C0Z A;  3DEE A;  3D2S A;  3GZF A;  2W04 A;  4PL2 A;  2KEY A;  4ACO A;  4CGZ A;  3N7P D;  2ZIW A;  2CN1 A;  4P0Q A;  4OJP A;  3NRW A;  2HBM A;  4OJL A;  1A6S A;  4A8E A;  2PMZ F;  1MA7 A;  2JHD A;  2W7P A;  2HMX A;  1URJ A;  2LKY A;  3IG8 A;  4P0P B;  1GO3 F;  2D6F C;  3LYS A;  3O0F A;  4BJQ A;  2K89 A;  4QNL A;  2G5H B;  4BUG A;  2G06 A;  1PVR A;  2GH1 A;  1KBU A;  2VIX A;  2K4H A;  4U6P A;  3F53 A;  3ONN A;  3IP4 B;  2RP5 A;  4JMU A;  3M6K A;  2E1E A;  1IIP A;  2KHQ A;  2W03 A;  3OPX A;  2KIC A;  4KX5 A;  3VC8 A;  2KOB A;  2KHV A;  1SZH A;  3PST A;  4FZN A;  2LHT A;  3IG5 A;  2JH7 A;  1PVQ A;  2XVT A;  4FE3 A;  2HOQ A;  5A0L A;  1PVP A;  2HOF A;  4PL1 A;  2PMZ C;  4GFJ A;  5KL1 B;  3SQI A;  2KJ9 A;  2KIW A;  2KKV A;  4QIW F;  3C28 A;  2E1F A;  3IN5 A;  1Q3V A;  3MGV A;  2R18 A;  3PSI A;  3T79 A;  2KKP A;  3CRX A;  3PZP A;  2K4I A;  2XI9 A;  2F77 X;  3RFA A;  3E0F A;  2ZXI A;  4P0P A;  2JGA A;  2Y0S F;  2YB1 A;  2W7O A;  2RHF A;  4QJF B;  3D2N A;  4OJO A;  2ZG6 A;  3H0M B;  3M7D A;  4AYB C;  2M0N A;  3ICX A;  3LVV A;  3K1Z A;  3KZX A;  1Q3U A;  4WJ3 B;  1ZQ1 C;  2Q4T A;  1CRX A;  1Z1B A;  3H0L B;  1ED1 A;  3SAH A;  2MRL A;  2WB1 C;  2A3V A;  2HBJ A;  2G0A A;  2RRD A;  2H3Q A;  3KFU F;  2CRX A;  2ZIV B;  5HR6 A;  3F2D A;  3AQF A;  4OJ6 A;  3SAF A;  1T94 A;  3H0R B;  1Z19 A;  2H3F A;  2N1R A;  2F2A B;  2HBK A;  2G09 A;  1TAM A;  3AQE A;  2ZIX B;  3N7R C;  3PSF A;  3RF9 A;  4U7C A;  2ZXH A;  2HOI A;  2YB4 A;  2KJ5 A;  3F5A A;  1A0P A;  3ALR A;  3F2C A;  4FZM A;  2LBO A;  3VCB A;  1YT3 A;  2ZIX A;  5C0Y A;  4NLB A;  2MA1 A;  2DQN B;  2K8C B;  2KVC A;  4FZL A;  4CRX A;  1D8B A;  2WAQ C;  5T14 A;  3GU3 A;  3HKZ C;  2E5S A;  2VJ5 A;  3AL0 B;  2JH1 A;  2BDU A;  1XNS A;  2ZIU B;  2OH2 A;  2CPR A;  2GOL A;  2G5I B;  3PSP A;  1NZB A;  2XID A;  2Z7J A;  2KNJ A;  3HKZ F;  3L3F X;  2WAQ F;  2K8B B;  4NLC A;  4NWI A;  2DF4 B;  4NV0 A;  1HIW A;  2HBL A;  3N7S C;  5CRX A;  3CYM A;  1WUD A;  3CP8 A;  3NUQ A;  2ZIU A;  1L6N A;  1HEK A;  2VKQ A;  2G08 A;  1P7D A;  3M6Z A;  3D2Q A;  1XO0 A;  2F76 X;  2K4E A;  2H3V A;  4ICA A;  1OUQ A;  2KJ8 A;  2ZIW B;  4P0Q B;  4OO1 J;  2JMG A;  5HR7 A;  2H3I A;  2KD1 A;  4KMO B;  2DGZ A;  1F44 A;  4QIW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...