3D2QA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
DRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Muscleblind-like protein 1
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, rna binding protein
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2qA00
3D2QA 2E5SA 3D2NA 3D2SA
chains in the Genus database with same CATH superfamily
4IRDA 3WKCA 1NK4A 2HCFA 5ALDA 1N48A 2ES6A 5ALEA 3PX4A 4DL4A 5KFSA 3QEBZ 2G09A 4FO6A 3H8SA 1RXWA 4U6PA 2ZXIA 2QB0B 3GV5B 1ZQYA 7ICJA 3ETLA 4FZNA 3JPOA 2A1JA 4UAUA 1Z4OA 1N5WA 1RXVA 3V7JA 1QQ6A 4B9SA 2HHUA 1L6NA 4K4GA 2BCQA 5CRXA 2K8BB 4GXJA 5J2BA 2CN1A 1X40A 2H5XA 3GQCA 5DG8A 5G5HA 2KJ9A 2MA1A 4C8NA 3UQ2A 1XS9D 9ICAA 1N60A 3WU2U 3F2CA 2YMLA 5KFHA 1U4BA 1COOA 2GO7A 1JMSA 2ZJ5A 4DQRA 4USAA 8ICPA 8ICEA 3ED5A 1RYRA 5J0XA 5AKIA 1A77A 3N97B 3LWLA 2F8KA 2FPLA 3KKAC 3WK7A 3RB0A 4QJFB 3M8SA 2R8JA 5J2JA 3MABA 2CPRA 2DUYA 4KLFA 1NJXA 5L1IA 5AI9A 4F71A 4US9A 5ALKA 3MR3A 1COKA 1IIPA 1JIHA 2C2DA 3RR7A 3H0RB 4NV0A 3MR5A 4KLTA 4KN7A 8ICXA 9ICIA 1KW4A 2ODGA 3C21A 4KLSA 4RQMA 1RM6C 5KT6A 2YTUA 1L3SA 4P4PA 4IR1A 3HT3A 1SV0C 3TAQA 4RQ2A 2ZIWA 2OHFA 5J2DA 3C5FA 2LM4A 1BNPA 2HHTA 2R8IA 1ZQVA 1WG8A 3AN1A 1SXEA 3NVWA 2ISOA 4F5OA 4B9UA 5KT3A 5KFCA 4FBTA 3T5KA 4NLNA 3A0HU 2KFZA 3Q8SB 3QU7A 5DBCA 2E1FA 4O0IA 3LWMA 3RBEA 3BS5A 5DLFA 9ICPA 5KFAA 2JEGA 5L9XA 2RP5A 3JPQA 2AH5A 2UVUA 4EEKA 4ZOHC 1ZRNA 4LZGA 2CRXA 1XSPA 4ECUA 7ICVA 1C7YA 1BPBA 4QZBA 1FIQA 2GOLA 3QZ8A 2E8PA 2ZUDA 3SAFA 7ICOA 3IRUA 4EZ6A 5ALYA 3RJGA 4YFKA 3F5EA 2WFAA 4MFCA 3AL0B 3SMVA 4RUAA 5KAFU 3NS1A 4YR3A 2AGQA 2BPGA 1T8EA 2ASLA 3SEIA 3RRHA 2H3ZA 1NKBA 3L5KA 5HMLA 4C7YA 1ZQFA 2XGPA 2G0AA 1JRPA 2F2AB 1BPYA 3K4GA 4AYBF 2Z7JA 3H8WA 5IIMA 4RQ0A 4OJ5A 2UVRA 3RFAA 2NRTA 2RDIA 3EPGA 4RQNA 4RU9A 5DDMA 5KFBA 4KLLA 2A1JB 3EW9A 8ICYA 3IM1A 1JXLA 5DB9A 4LZDA 2E3TA 3KHGA 2JZBA 5J29A 4EYHB 2PFOA 4M9JA 3UMCA 1L3UA 2KNJA 4JMUA 1UPHA 3HPOA 1MN8A 2PKEA 3MGIA 4I2DA 1BPDA 1ZXIA 1OW5A 4KLMA 3TKAA 5AKEA 3PSIA 4FS2A 1NZPA 1J2NA 2PI4A 5IIIA 1RZTA 1V38A 5EWGA 2K60A 2MRLA 9ICKA 9ICXA 5AK3A 4DF4A 5J0UA 2PI5A 2G5IB 1VDVA 5IILA 4IQVA 7ICFA 3DV9A 4Z6EA 2BDPA 4GLXA 2XO7A 2ESEA 1TV9A 2JGAA 1WCLA 5AI8A 3HW8A 4PHAA 3JPSA 2FDRA 4JV2A 5B66U 4TUSA 2W9BA 7ICPA 4YG2A 1LVHA 1S5LU 1UA1A 4Y2QA 4DQSA 1XO0A 5KG4A 4RPXA 1TAMA 5ALSA 3ZD9A 1NKEA 3OJUA 4QWBA 1KLNA 1LKYA 4NY8A 2KE7A 3TARA 3QU9A 2ZIWB 3RJIA 1TKDA 4GXKA 3HKZF 3NRZA 2WAQF 5EWEA 3EPIA 2FMQA 1K1SA 2C2RA 4YN4A 1Z00A 4UB1A 1D8YA 5KFTA 4CCHA 3R9KA 2VA2A 4PPXA 3BS5B 1U48A 5J2HA 3J81j 3Q8KA 2F1IA 4HAIA 2B21A 3GZFA 3NGDA 4DSKA 3ISBA 2MUTA 2ZIXB 2F3NA 9ICTA 4ECXA 4LVSA 2LHTA 4J9MA 3RH6A 2W55A 4OJLA 5KFJA 3TFRA 3BQ7A 4MEYA 3FC4A 4M9LA 4KX3A 2K8AA 4QZ9A 2EZYA 2OXOA 5KG6A 3H40A 3LK9A 3PMLA 5KFEA 8ICUA 4J9QA 4KLQA 2G07A 3M8RA 3E2EA 1ZQXA 5EE9A 3C2KA 4OJ6A 1WWVA 5DG7A 5DBBA 4DL2A 3ISDA 3F2DA 4B9NA 3JPNA 4DOAA 4ECVA 1NZBA 1ZQCA 1HUZA 1HJPA 2HOIA 3MFIA 1CRXA 7ICHA 4O9MA 2XICA 2EH9A 3BQ2A 4DS4A 8ICSA 2JHDA 4BDPA 1N61A 2RDJA 3ALRA 4QWDA 5ALLA 3KTQA 3KKAA 3OHBA 3KOOA 3U26A 1UCVA 3Q8PB 1PK3A 2BPCA 2XIDA 4J9PA 5AK5A 3ZDAA 9ICJA 4NM2A 1S97A 5DGBA 1Z4NA 1K1QA 4ZH4A 3Q8QB 3KBBA 5L1KA 1ZYQA 4UB2A 5EWFA 3NASA 1SL0A 2YB1A 9ICFA 1GO3F 1SV0A 4OJPA 4QZCA 4Q44A 2KIWA 3L4PA 3T5HA 4UARA 4ED8A 4P0PA 1MQ3A 2KJ5A 1MC8A 3GDXA 4DOBA 3PX6A 3QNMA 4RZRA 1QCKA 3OSPA 2OH2A 3PSPA 2PMZC 3A0BU 2F8LA 1RQLA 2FLLA 1NNLA 3C5GA 5TISU 5HP4A 3RR8A 2VKQA 1ZQUA 3MGVA 4ECTA 3HP6A 5ALHA 5DGAA 3ONNA 2VJ5A 1A6SA 3B9JA 3C23A 3GU3A 2JEFA 2BQRA 1H38A 1QLNA 1N63A 1NK0A 4DSJA 5J2AA 4ACOA 1LKYB 1ECWA 4G9BA 4J9KA 3JPRA 3FYHA 5CEHA 4MF2A 1S8OA 5H2FU 4QZAA 3VC8A 8ICQA 4E0DA 3TANA 4R66A 4QZDA 1PK1A 3LDAA 3EZ5A 2W11A 1D8BA 8ICBA 1KL9A 2W3SA 1Z3EB 2DGZA 9ICEA 4CRXA 4C4RA 8ICRA 4Z6FA 4KLOA 4F4KA 2JV3A 1F0MA 5A0LA 1RPLA 2MUTB 5K4LA 5AM1A 4Y2RA 4YVZA 2P6RA 3ZI4A 4NWIA 3MFHA 1D9FA 5AM2A 3SI8A 1XSLA 3HILA 1X66A 2NO4A 3V7KA 4UW9A 2EZZA 4KLDA 2DL0A 1Y88A 1SGGA 5ALQA 4M04A 4UAWA 1XWLA 3MR6A 1PVRA 5AM3A 3GV8B 4DSLA 4YR2A 4AP9A 1FFUA 5DG9A 4MEXA 1NOMA 2LYBA 3WK8A 4QZHA 1N2XA 2HMXA 5ALFA 4DLGA 2XY7A 2E8MA 1QSYA 2Y0SC 1QQ5A 2AGPA 2Y1JA 1SIJA 5J0QA 4QIWC 1SKWA 3NVZA 5CHGA 5KFFA 4F2SA 5IIOA 2YQEA 4Y2XA 3QX7A 2KEYA 3TI0A 3QUCA 5GTHU 1T3NA 2VIXA 8ICZA 3UMBA 3BDPA 4B6JA 1ZD2P 2KK0A 1L7NA 4UB5A 2HBMA 4US8A 3MDAA 2FMSA 1HUOA 2IBKA 4ED1A 5IINA 9ICOA 4YR0A 5KFKA 1HEKA 2N1RA 1S0NA 4UAYA 1ZQPA 2ZIUA 3C1ZA 1U9LA 5CJ7A 3V6KA 4DL6A 4PHDA 3DEEA 2AHOB 2KICA 3ZDBA 2C2EA 5JTIA 4KX5A 2V4RA 4J9SA 4P0PB 3BQ0A 4TURA 1SZPA 1ZOLA 1JN3A 3RF9A 4JV0A 1SXDA 1S0MA 2FI1A 4QWCA 1Q3UA 5J2KA 5F9NA 1QSLA 2HSZA 2YMMA 2XCPA 2BR0A 7ICTA 4EBEA 4ICAA 1B22A 5AKXA 3QEAZ 1DRGA 9ICUA 4F4XA 1SKRA 5C0YA 5JUMA 3NVVA 2LPEA 3H4BA 4CNQA 3FM9A 2BCUA 2WB1C 4J9OA 5AI4A 5L1MA 2QB1A 2HVIA 2P66A 3ZDDA 5ALPA 1X2IA 1ZQIA 3CRXA 4M9GA 2R8HA 1TVAA 3AEVA 4RT3A 5KT4A 3C1YA 2XI9A 3QUTA 5KFRA 1BGXT 2XCAA 1PK1B 2AU0A 7ICUA 4TQRA 3KHRA 5J0SA 4B9TA 2RQ5A 7ICEA 1KDHA 2BQUA 1VJ5A 2YMQA 2VJ4A 5J2IA 3RBDA 3BQTA 3PW5A 4DL5A 2RRDA 1Z1VA 5CP2A 1ZQZA 5D46A 1DK3A 1ZETA 1ZJNA 3BS7A 4DSIA 1S0OA 2ASDA 3IG8A 8ICNA 4YMNA 2W7PA 4PZNA 4M9HA 4F2RA 5DLGA 4MFAA 5AI0A 4RNOA 9ICCA 5CWRA 5B5EU 4RQ1A 4GXIA 4QW9A 1EXNA 2MSNA 3WKBA 4DEZA 4UASA 1YZ6A 2XVTA 4PH5A 4QZGA 3AU2A 2NO5A 1KTQA 1NI3A 3QE9Y 2DBYA 4BWMA 3NRWA 1KSPA 1ZQQA 5FP0A 4UB4A 4K4IA 5KFZA 3PY8A 3ISCA 2ZTEA 3S6JA 4PHPA 4I2GA 1CUKA 4KLUA 2IOHA 2VANA 3IN5A 2IMWP 5KFPA 4FS1A 5ALTA 2H3IA 3AQEA 9ICHA 4R64A 1S0VA 2KSOA 2W54A 2EDUA 3GFKB 3AUOA 5KG5A 1Z1BA 4ED6A 4JWMA 2OWOA 4J9LA 3IV6A 4RQ6A 4I29A 2ZIUB 1S9FA 4TUQA 4DFMA 5JRTA 5AIBA 2KG5A 2I5HA 2KP7A 3C28A 2W7OA 2XGQA 4IRCA 1X9MA 3FAHA 4QWEA 1A0PA 3RRGA 1P7DA 1ZQJA 9ICLA 3LYSA 1S76D 1ZQWA 1OUQA 2K4IA 1RYUA 1V85A 3SAHA 3E0FA 3D6JA 2XC9A 2HHQA 3RB3A 1UQVA 1LB2B 4ED7A 4KMUA 1T3QA 1IG6A 3OSNA 4DQIA 1BVSA 5J0TA 2I6XA 5HR7A 4GFJA 2OCEA 3N4MB 1ZQOA 3O0FA 2DF4B 3CYMA 1MA7A 2HHWA 3RJFA 3K1ZA 1SB3C 5KFDA 4UQGA 4RNNA 2HHXA 5KG7A 4ELVA 1S77D 2J6UA 2FPMA 4C80A 2W9MA 3SQIA 3QUBA 4I2EA 5C5JA 1LV5A 2JEIA 4EENA 5BOMA 2KVCA 2WTFA 2LYAA 4F3OA 3TACB 5KFVA 4CF3A 4O3RA 1KFTA 4Q8EA 2UVWA 2HHVA 3M7DA 4F4YA 1UHUA 1T4GA 7ICGA 3T5JA 3T79A 1ZQEA 2B0CA 2BCRA 1PVQA 4ECZA 2G08A 4ELUA 4PHEA 1BPXA 2KZMA 1OXJA 4DSFA 4GC7A 3SENA 4IC9A 4Y2PA 4F92B 5J2GA 4DCCA 4U7CA 3I28A 3AM9A 5J0RA 1KKXA 1FO4A 3PW7A 2KIVA 3NUQA 3B0XA 2GH1A 4GC6A 1PVPA 5CA7A 1WUDA 2FPKA 4LJXA 2LM1A 4KLEA 3TADC 3GILA 3DDHA 4C8MA 4B9MA 3ETRA 7ICMA 4OO1J 4IQTA 1UA0A 1Q8KA 1MQ2A 3KFUF 2A19A 7ICIA 4QZEA 3UXNA 2VA8A 5HNKA 1NK5A 3PO5A 1ZQTA 7ICRA 2J6TA 2DFLA 2I1QA 2ZUBA 5KFMA 2D6FC 2KSOB 2QKQA 1ZQKA 8ICCA 3RB4A 1B4FA 4R8UA 4YCXA 4PGYA 5J0YA 2JZBB 2C28A 4WJ3B 2BDUA 3Q8MA 2HHSA 1U45A 3QU5A 4O3OA 2W8LA 5HHHA 2HBJA 9ICNA 3JPTA 1X9WA 2QB0A 7ICNA 8ICTA 4IQUA 4PJ0U 3V6HA 1KBUA 2YN4A 2E1EA 2JH1A 3IG5A 2PFQA 1V9PA 2DWQA 2W04A 4ECYA 1QH9A 1KFSA 2CXYA 4YXJA 5BPCA 5F9LA 3C2LA 1BPZA 3N7RC 5AM0A 5J2CA 8ICFA 1SZHA 2FLPA 2NRWA 4CF5A 4Y2SA 4EYIB 3NVYA 3H8JA 5JU5A 4XRHA 1ZQBA 2F44A 4O3MA 1ZQSA 1N56A 4C8OA 1TFRA 3CP8A 2OYYA 5ALXA 1L8OA 5DB8A 5J8YA 1YT3A 5AKGA 5KT7A 5D4BA 3V6JA 2BKEA 2W9BB 1NK6A 3SD7A 1DGSA 2HOFA 4NL9C 4GIBA 4C4SA 5J0PA 1Q46A 2FJ6A 2Y1IA 3BQ1A 4O3PA 2JEJA 7ICQA 2R18A 4R65A 3AU6A 1NKCA 1F44A 1S10A 1ZQ1C 3RH4A 1ZD4A 1XSNA 2WF9A 2VA3A 4DOCA 5DQGA 2W43A 3UQ0A 4EBCA 2XY5A 2HBLA 2YMPA 4DS5A 4F8RA 2DQNB 3IDWA 4BX9C 2FE9A 1U47A 2FLNA 4FFDA 1QSSA 5F3XB 1ZQGA 4B9VA 3PR4A 4DL3A 2D8CA 3HX0A 1Z00B 5AM4A 2H3VA 4ECRA 1JX4A 1FEZA 2V9WA 7ICSA 2Y9TA 2W03A 4FZMA 4NLCA 5KL1B 4F4WA 2K8CB 1C20A 4NLKA 2K4PA 2LKYA 1X42A 3M6KA 2D3DA 2QARA 2KVSA 4JV1A 4YD2A 5DBAA 4ELTA 4YMOA 1X9XA 2IOFA 4UATA 4AYBC 1SKSA 2WHEA 3I76A 3F53A 1L3VA 4I28A 2KKPA 2K89A 1ZQNA 4JB3A 1M6YA 4DO9A 4Y2JA 3I1YA 3PX0A 2LI6A 4KLJA 4XQ8A 1N5XA 3HWTA 4PGXA 4KLHA 4O5KA 1O03A 1O08A 2G5HB 2H3FA 4Z6DA 8ICVA 2V4QA 4EZ9A 2H3QA 3Q8LA 2W9CA 3OPXA 3F2BA 4Y2TA 3GIJA 3QU2A 2KZ3A 4PGQA 4EBDA 4FBUA 4I2HA 4F5NA 1NJZA 5E79U 1SV4A 1XC9A 3PNCA 1L7MA 2HDOA 5L1LA 2BCSA 2MU2A 8ICGA 3AQFA 4R8UB 3H8MA 3QUQA 1NK7A 2DPJA 3M9MB 3RJKA 2AQ4A 1N62A 2W9AA 2XY6A 1WWUA 2E8OA 1T7PA 1VLBA 4P4OA 3ZDEA 4Z6CA 4KTQA 1RG6A 4HYKA 5DKWA 2F1JA 2UVVA 2WF5A 5DQIA 1KFDA 4M47A 5AHXA 1ZD3A 1ZQRA 4ECSA 5J2EA 4CE6A 2NRZA 1AROP 5KL8B 2AXTU 9ICQA 4DSEA 4F5PA 3GIMA 1XNSA 1NJWA 3OGUA 2R8GA 5KFUA 1JROA 3KD3A 5G5GA 4DFKA 5KFXA 4IS7A 4EEYA 3RJJA 4CGZA 3SV3A 1ZRMA 3WK5A 8ICWA 4MF8A 3WKDA 4IRKA 3F5AA 4DLEA 8ICKA 5IIJA 2KHVA 2EZXA 1B43A 3HKZC 2WAQC 5ALVA 1RQNA 4QZIA 3GV7B 2ZIVA 3VCBA 2EAMA 4PL2A 3HRDD 3B0YA 1ZJMA 5KFWA 4Q8FA 2EANA 5BOLA 3BZKA 1L7PA 4QZ8A 1J2MA 3QU4A 5CR0A 1NJYA 2NRXA 2WF7A 3V72A 1ED1A 3G6VA 3SYZA 9ICGA 2K4EA 5KFIA 3L3FX 2KJ8A 1ZQMA 4G3IA 3H0LB 2Y9UA 3TADA 3QYPA 4RQ7A 3T3FA 3ZDCA 3KZIU 4CDGA 4EX7A 1L7OA 4JWNA 3CW2C 2HI0A 1T94A 3MGHA 2ZG6A 5J8YC 2PMZF 2DKXA 2QARB 2IHNA 2P35A 3SZ2A 4UBBA 4F50A 3BZCA 5ALMA 1UT5A 5EE0A 1XU4A 4DFDA 2MAXA 5J2FA 4I2AA 4QNLA 1L5UA 3K1RB 3D2SA 4DQQA 3T5LA 2RHFA 3RAXA 2JR5A 1NK8A 2P6UA 3ZD8A 8ICMA 3N7PD 2ZIXA 2W9CB 2KFNA 5ALZA 5EE1A 5ALGA 4C7ZA 3UPQA 4I2IA 4M2YA 1DGJA 4JK1A 2BGWA 2YX8A 1L8LA 2NYVA 5HHIA 4C8KA 3QXGA 4KLIA 4OD0A 5KFYA 2BCVA 4RQ3A 1CI4A 3H7IA 3M9OB 3Q8RB 1U49A 4UB3A 3M1YA 3MDCA 3TFSA 1X9SA 5AKHA 2PFNA 2L5YA 1RYSA 4NM1A 4I2CA 2OM6A 4XA5A 3AMZA 4RUCA 1MSWD 4ED2A 2WF8A 4P0QA 3G6YA 4F4ZA 2KZZA 4NL9A 5DB6A 3C29A 2OEHA 4Q45A 5KFQA 4KLGA 3MR2A 1RDFA 9ICRA 2AJQA 5ALUA 4NLGA 4YD1A 3WK9A 5J0OA 1IXRA 1ZQAA 5AKJA 3RJHA 5TZVA 4NXZA 9ICSA 3CNHA 3N7SC 1DOQA 1CEZA 2KHQA 2EQYA 4F72A 1B0XA 1JALA 5ALNA 3K75D 3EUB2 4DFJA 3G6XA 2HVHA 4IR9A 5HMMA 5ALRA 4BJQA 4M9NA 3PSFA 2KKVA 3PV8A 2EAOA 2F76X 5KG1A 5AICA 5KT5A 8ICOA 2Y0SF 2BPFA 1JI7A 5DDYA 8ICAA 4A8EA 4CF4A 4QIWF 5AK4A 4UB8U 3M6ZA 1X6IA 9ICBA 2ZIVB 1TE2A 2JXJA 2NRVA 2PFPA 1JUDA 4M0AA 5AKZA 2IHMA 7ICKA 3KZXA 2ZJAA 4UAZA 2LMRA 9ICVA 2R8KA 4I27A 1X6JA 4C4TA 4UAVA 1D9DA 1IM4A 2A3VA 4TUPA 2ATLA 2JMGA 3PMNA 2ZTDA 3IHQB 4MHVA 3SAGA 2KTQA 2FMPA 1PZNA 4RQ8A 4YP3A 1IV8A 3PO4A 2M9NA 1YZ7A 1WYGA 2B6GA 4BXOA 4M6WA 5KG2A 1AQ6A 1SWWA 2K4HA 3WK6A 4ECWA 3KHHA 3OJSA 4IQWA 1JXEA 5EOZA 1F5SA 2G06A 2JH7A 4Y2YA 3QZ7A 3C2MA 2KOBA 4DWIA 5D49A 5AI5A 4BUGA 2F1HA 1XO1A 4DF8A 1D8LA 2WB1F 4NLBA 2HW3A 5AKLA 1TK8A 4Y2UA 2KMDA 1DXSA 4OJOA 2YY6A 9ICWA 4FZLA 3D2NA 4KN4A 2JRZA 3TQ1A 1DK2A 4I2BA 1SL1A 4O5CA 5AKYA 4F5QA 2LYHA 5KG0A 3RB6A 4F93B 4IL6U 4F91B 5AIAA 3ORYA 5ALOA 3THVA 4YXMA 5J0WA 4XUSA 1HIWA 4I2JA 4K4HA 2W8KA 4RNMA 4J9NA 2F77X 2J6SA 3UXPA 4B9LA 3UM9A 2A1AA 5KFGA 4ECQA 2M0NA 3ICXA 3PW4A 2HBKA 2LBOA 1QTMA 3PW0A 5KAIU 3WKEA 4P0QB 5ALIA 1WCNA 2DKZA 4YMMA 3NTUA 1Z19A 1SL2A 5KFOA 5AKKA 2ZUCA 1UT8A 5GTIU 3UXOA 4EX6A 5AI6A 4UB6U 3PSTA 4O3SA 4ED0A 1QQ7A 4BGDA 5KTQA 1KN5A 5DB7A 3RH5A 2BZFA 1KEJA 1A76A 4I2FA 4NJ8A 4Q43A 1TAQA 4C8LA 3PZPA 8ICHA 5AK6A 4OCZA 2ALZA 4O5EA 2AQ0A 1J97A 4DL7A 1TAUA 5KFLA 8ICIA 1V97A 1ZQLA 2KN7A 2NV3A 2IA6A 4F5RA 3BJYA 4EELA 1TK0A 1BNOA 3RTVA 3M9NB 5ALJA 9ICMA 4TQSA 5T14A 1NK9A 5KG3A 3IP4B 4Y2VA 5L1JA 5IIKA 3V7LA 4RPZA 3OTQA 3GIKA 4O3NA 8ICLA 4J03A 1K5OA 5CB1A 5KFNA 4MFFA 1KRPA 4QWAA 1PUZA 3PW2A 4RT2A 2EAPA 2ZJ8A 2E8NA 3LVVA 4DQPA 3H4DA 4DFPA 4X5VA 5ALWA 4PZOA 4QW8A 3PR5B 3KHLA 4BXOB 4M6WB 2WF6A 2AGOA 3HJEA 2BHNA 2GWSA 2HOQA 2O6KA 2C22A 4P2HA 3MC1A 4ED3A 3LVWA 3EWAA 4YQWA 4R63A 3E58A 4FE3A 5HR6A 1SWVA 2QLTA 5EE3A 3GIIA 1ZQHA 3N28A 2GLEA 2RLTA 4KITB 1TK5A 1URJA 5KNIA 2W3RA 4RQ4A 3SV4A 2Q0ZX 4P4MA 3H0MB 2DPIA 1ZD5A 4C0ZA 3UMGA 4BWJA 3OHAA 1ZQDA 5DQHA 3RJEA 3WKAA 8ICJA 2ISPA 5KT2A 2BQ3A 2ZXHA 3PVXA 1Q3VA 1FFVA 2KV2A 2ZTCA 2KD1A 2Q4TA 1KQQA 3TAPA 1L3TA 2PXIA 7ICLA 3EYZA 2ASJA 3WK4A 4UBCA 4KMOB 2IOFK 2E5SA 4O3QA 4J9RA 3RAQA 3SR6A 4RQ5A 4PL1A 4JUZA 4QZFA 2YB4A 4RPYA 2I9GA 4NLZA 3JPPA 1BPEA 5AM5A 3MBYA 3FDSA 3D2QA
chains in the Genus database with same CATH topology
4NV0A 2D6FC 4A8EA 4QNLA 4QIWF 3D2SA 3SQIA 4ICAA 2YB1A 2W03A 4FZMA 3NRWA 4WJ3B 1DRGA 5KL8B 2BDUA 1GO3F 4NLCA 3M6ZA 2KVCA 2RHFA 2ZIVB 5KL1B 1XNSA 5C0YA 2K8CB 1HIWA 2LYAA 2KNJA 4OJPA 2LKYA 3M6KA 1UPHA 2G09A 4JMUA 2KIWA 2F77X 3LVVA 4P0PA 2WB1C 4CGZA 2ZIWA 2HBJA 2KJ5A 2ZXIA 4U6PA 2M0NA 3ICXA 3KZXA 3M7DA 2HBKA 3IN5A 1PVRA 3GZFA 2LBOA 2ZIXB 2OH2A 3PSPA 2PMZC 3N7PD 2A3VA 2ZIXA 4P0QB 3T79A 3F5AA 4FZNA 2F8LA 1KBUA 2E1EA 2JH1A 2H3IA 2JMGA 3AQEA 3IG5A 2LHTA 2LYBA 2HOQA 2KHVA 2W04A 3PSIA 1MA7A 1PVQA 3HKZC 2VKQA 4AYBC 3CRXA 2E1FA 2HMXA 1Z19A 2G08A 2WAQC 3F53A 4OJLA 3MGVA 2YX8A 2KKPA 3SAGA 1Z1BA 2Y0SC 2XI9A 2K89A 3N7RC 1L6NA 2ZIVA 3LVWA 3ONNA 3VCBA 2MRLA 2RP5A 2VJ5A 4KX3A 1SZHA 2K8AA 4PL2A 5CRXA 3PSTA 4FE3A 4QIWC 5HR6A 1A6SA 2K8BB 2OXOA 2CN1A 2G5IB 3GU3A 4IC9A 2ZIUB 2CRXA 2G5HB 1URJA 2H3FA 4O3MA 2KEYA 4U7CA 2KJ9A 3CP8A 2OYYA 3H0RB 2MA1A 2H3QA 2JGAA 3H0MB 4ACOA 2OM6A 2G07A 1ECWA 1YT3A 4C0ZA 4P0QA 2VJ4A 2GOLA 3OPXA 2VIXA 3F2BA 2K4HA 3C28A 1ED1A 2W7OA 2RRDA 4OJ6A 3NUQA 3SAFA 3C29A 3VC8A 3F2CA 2GH1A 2K4EA 1A0PA 3PZPA 2HOFA 3F2DA 2G06A 1P7DA 3F5EA 1NZBA 3LYSA 3L3FX 2JH7A 2HBMA 2KJ8A 2HOIA 2ZXHA 1PVPA 1Q3VA 2R18A 1CRXA 1WUDA 2KV2A 2KOBA 3H0LB 2K4IA 1OUQA 3AL0B 3SMVA 1F44A 2XICA 3IG8A 1ZQ1C 2KD1A 1XO0A 2Q4TA 3AQFA 1HEKA 2JHDA 2NV3A 2N1RA 4BUGA 3ALRA 2W7PA 3SAHA 3E0FA 1D8BA 1TAMA 2WB1F 4NLBA 2ZIUA 3N7SC 4OO1J 2KHQA 4CDGA 3DEEA 4KMOB 2KICA 2E5SA 2H3ZA 2HBLA 1T94A 2DGZA 2DQNB 2XIDA 2ZG6A 2PMZF 4BX9C 4QJFB 4KX5A 3KFUF 4CRXA 5T14A 4P0PB 4OJOA 5HR7A 4GFJA 2G0AA 2ZIWB 2F2AB 3IP4B 4BJQA 4FZLA 3D2NA 3PSFA 2KKVA 3O0FA 2DF4B 3CYMA 4PL1A 2XVTA 3HKZF 3K1ZA 3RF9A 2CPRA 2YB4A 2Z7JA 4AYBF 5A0LA 2WAQF 4OJ5A 2F76X 3RFAA 2Y0SF 1Q3UA 1IIPA 3D2QA 4NWIA 2H3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2Q A;  2E5S A;  3D2N A;  3D2S A; 
#chains in the Genus database with same CATH topology
 4IRD A;  3WKC A;  1NK4 A;  2HCF A;  5ALD A;  1N48 A;  2ES6 A;  5ALE A;  3PX4 A;  4DL4 A;  5KFS A;  3QEB Z;  2G09 A;  4FO6 A;  3H8S A;  1RXW A;  4U6P A;  2ZXI A;  2QB0 B;  3GV5 B;  1ZQY A;  7ICJ A;  3ETL A;  4FZN A;  3JPO A;  2A1J A;  4UAU A;  1Z4O A;  1N5W A;  1RXV A;  3V7J A;  1QQ6 A;  4B9S A;  2HHU A;  1L6N A;  4K4G A;  2BCQ A;  5CRX A;  2K8B B;  4GXJ A;  5J2B A;  2CN1 A;  1X40 A;  2H5X A;  3GQC A;  5DG8 A;  5G5H A;  2KJ9 A;  2MA1 A;  4C8N A;  3UQ2 A;  1XS9 D;  9ICA A;  1N60 A;  3WU2 U;  3F2C A;  2YML A;  5KFH A;  1U4B A;  1COO A;  2GO7 A;  1JMS A;  2ZJ5 A;  4DQR A;  4USA A;  8ICP A;  8ICE A;  3ED5 A;  1RYR A;  5J0X A;  5AKI A;  1A77 A;  3N97 B;  3LWL A;  2F8K A;  2FPL A;  3KKA C;  3WK7 A;  3RB0 A;  4QJF B;  3M8S A;  2R8J A;  5J2J A;  3MAB A;  2CPR A;  2DUY A;  4KLF A;  1NJX A;  5L1I A;  5AI9 A;  4F71 A;  4US9 A;  5ALK A;  3MR3 A;  1COK A;  1IIP A;  1JIH A;  2C2D A;  3RR7 A;  3H0R B;  4NV0 A;  3MR5 A;  4KLT A;  4KN7 A;  8ICX A;  9ICI A;  1KW4 A;  2ODG A;  3C21 A;  4KLS A;  4RQM A;  1RM6 C;  5KT6 A;  2YTU A;  1L3S A;  4P4P A;  4IR1 A;  3HT3 A;  1SV0 C;  3TAQ A;  4RQ2 A;  2ZIW A;  2OHF A;  5J2D A;  3C5F A;  2LM4 A;  1BNP A;  2HHT A;  2R8I A;  1ZQV A;  1WG8 A;  3AN1 A;  1SXE A;  3NVW A;  2ISO A;  4F5O A;  4B9U A;  5KT3 A;  5KFC A;  4FBT A;  3T5K A;  4NLN A;  3A0H U;  2KFZ A;  3Q8S B;  3QU7 A;  5DBC A;  2E1F A;  4O0I A;  3LWM A;  3RBE A;  3BS5 A;  5DLF A;  9ICP A;  5KFA A;  2JEG A;  5L9X A;  2RP5 A;  3JPQ A;  2AH5 A;  2UVU A;  4EEK A;  4ZOH C;  1ZRN A;  4LZG A;  2CRX A;  1XSP A;  4ECU A;  7ICV A;  1C7Y A;  1BPB A;  4QZB A;  1FIQ A;  2GOL A;  3QZ8 A;  2E8P A;  2ZUD A;  3SAF A;  7ICO A;  3IRU A;  4EZ6 A;  5ALY A;  3RJG A;  4YFK A;  3F5E A;  2WFA A;  4MFC A;  3AL0 B;  3SMV A;  4RUA A;  5KAF U;  3NS1 A;  4YR3 A;  2AGQ A;  2BPG A;  1T8E A;  2ASL A;  3SEI A;  3RRH A;  2H3Z A;  1NKB A;  3L5K A;  5HML A;  4C7Y A;  1ZQF A;  2XGP A;  2G0A A;  1JRP A;  2F2A B;  1BPY A;  3K4G A;  4AYB F;  2Z7J A;  3H8W A;  5IIM A;  4RQ0 A;  4OJ5 A;  2UVR A;  3RFA A;  2NRT A;  2RDI A;  3EPG A;  4RQN A;  4RU9 A;  5DDM A;  5KFB A;  4KLL A;  2A1J B;  3EW9 A;  8ICY A;  3IM1 A;  1JXL A;  5DB9 A;  4LZD A;  2E3T A;  3KHG A;  2JZB A;  5J29 A;  4EYH B;  2PFO A;  4M9J A;  3UMC A;  1L3U A;  2KNJ A;  4JMU A;  1UPH A;  3HPO A;  1MN8 A;  2PKE A;  3MGI A;  4I2D A;  1BPD A;  1ZXI A;  1OW5 A;  4KLM A;  3TKA A;  5AKE A;  3PSI A;  4FS2 A;  1NZP A;  1J2N A;  2PI4 A;  5III A;  1RZT A;  1V38 A;  5EWG A;  2K60 A;  2MRL A;  9ICK A;  9ICX A;  5AK3 A;  4DF4 A;  5J0U A;  2PI5 A;  2G5I B;  1VDV A;  5IIL A;  4IQV A;  7ICF A;  3DV9 A;  4Z6E A;  2BDP A;  4GLX A;  2XO7 A;  2ESE A;  1TV9 A;  2JGA A;  1WCL A;  5AI8 A;  3HW8 A;  4PHA A;  3JPS A;  2FDR A;  4JV2 A;  5B66 U;  4TUS A;  2W9B A;  7ICP A;  4YG2 A;  1LVH A;  1S5L U;  1UA1 A;  4Y2Q A;  4DQS A;  1XO0 A;  5KG4 A;  4RPX A;  1TAM A;  5ALS A;  3ZD9 A;  1NKE A;  3OJU A;  4QWB A;  1KLN A;  1LKY A;  4NY8 A;  2KE7 A;  3TAR A;  3QU9 A;  2ZIW B;  3RJI A;  1TKD A;  4GXK A;  3HKZ F;  3NRZ A;  2WAQ F;  5EWE A;  3EPI A;  2FMQ A;  1K1S A;  2C2R A;  4YN4 A;  1Z00 A;  4UB1 A;  1D8Y A;  5KFT A;  4CCH A;  3R9K A;  2VA2 A;  4PPX A;  3BS5 B;  1U48 A;  5J2H A;  3J81 j;  3Q8K A;  2F1I A;  4HAI A;  2B21 A;  3GZF A;  3NGD A;  4DSK A;  3ISB A;  2MUT A;  2ZIX B;  2F3N A;  9ICT A;  4ECX A;  4LVS A;  2LHT A;  4J9M A;  3RH6 A;  2W55 A;  4OJL A;  5KFJ A;  3TFR A;  3BQ7 A;  4MEY A;  3FC4 A;  4M9L A;  4KX3 A;  2K8A A;  4QZ9 A;  2EZY A;  2OXO A;  5KG6 A;  3H40 A;  3LK9 A;  3PML A;  5KFE A;  8ICU A;  4J9Q A;  4KLQ A;  2G07 A;  3M8R A;  3E2E A;  1ZQX A;  5EE9 A;  3C2K A;  4OJ6 A;  1WWV A;  5DG7 A;  5DBB A;  4DL2 A;  3ISD A;  3F2D A;  4B9N A;  3JPN A;  4DOA A;  4ECV A;  1NZB A;  1ZQC A;  1HUZ A;  1HJP A;  2HOI A;  3MFI A;  1CRX A;  7ICH A;  4O9M A;  2XIC A;  2EH9 A;  3BQ2 A;  4DS4 A;  8ICS A;  2JHD A;  4BDP A;  1N61 A;  2RDJ A;  3ALR A;  4QWD A;  5ALL A;  3KTQ A;  3KKA A;  3OHB A;  3KOO A;  3U26 A;  1UCV A;  3Q8P B;  1PK3 A;  2BPC A;  2XID A;  4J9P A;  5AK5 A;  3ZDA A;  9ICJ A;  4NM2 A;  1S97 A;  5DGB A;  1Z4N A;  1K1Q A;  4ZH4 A;  3Q8Q B;  3KBB A;  5L1K A;  1ZYQ A;  4UB2 A;  5EWF A;  3NAS A;  1SL0 A;  2YB1 A;  9ICF A;  1GO3 F;  1SV0 A;  4OJP A;  4QZC A;  4Q44 A;  2KIW A;  3L4P A;  3T5H A;  4UAR A;  4ED8 A;  4P0P A;  1MQ3 A;  2KJ5 A;  1MC8 A;  3GDX A;  4DOB A;  3PX6 A;  3QNM A;  4RZR A;  1QCK A;  3OSP A;  2OH2 A;  3PSP A;  2PMZ C;  3A0B U;  2F8L A;  1RQL A;  2FLL A;  1NNL A;  3C5G A;  5TIS U;  5HP4 A;  3RR8 A;  2VKQ A;  1ZQU A;  3MGV A;  4ECT A;  3HP6 A;  5ALH A;  5DGA A;  3ONN A;  2VJ5 A;  1A6S A;  3B9J A;  3C23 A;  3GU3 A;  2JEF A;  2BQR A;  1H38 A;  1QLN A;  1N63 A;  1NK0 A;  4DSJ A;  5J2A A;  4ACO A;  1LKY B;  1ECW A;  4G9B A;  4J9K A;  3JPR A;  3FYH A;  5CEH A;  4MF2 A;  1S8O A;  5H2F U;  4QZA A;  3VC8 A;  8ICQ A;  4E0D A;  3TAN A;  4R66 A;  4QZD A;  1PK1 A;  3LDA A;  3EZ5 A;  2W11 A;  1D8B A;  8ICB A;  1KL9 A;  2W3S A;  1Z3E B;  2DGZ A;  9ICE A;  4CRX A;  4C4R A;  8ICR A;  4Z6F A;  4KLO A;  4F4K A;  2JV3 A;  1F0M A;  5A0L A;  1RPL A;  2MUT B;  5K4L A;  5AM1 A;  4Y2R A;  4YVZ A;  2P6R A;  3ZI4 A;  4NWI A;  3MFH A;  1D9F A;  5AM2 A;  3SI8 A;  1XSL A;  3HIL A;  1X66 A;  2NO4 A;  3V7K A;  4UW9 A;  2EZZ A;  4KLD A;  2DL0 A;  1Y88 A;  1SGG A;  5ALQ A;  4M04 A;  4UAW A;  1XWL A;  3MR6 A;  1PVR A;  5AM3 A;  3GV8 B;  4DSL A;  4YR2 A;  4AP9 A;  1FFU A;  5DG9 A;  4MEX A;  1NOM A;  2LYB A;  3WK8 A;  4QZH A;  1N2X A;  2HMX A;  5ALF A;  4DLG A;  2XY7 A;  2E8M A;  1QSY A;  2Y0S C;  1QQ5 A;  2AGP A;  2Y1J A;  1SIJ A;  5J0Q A;  4QIW C;  1SKW A;  3NVZ A;  5CHG A;  5KFF A;  4F2S A;  5IIO A;  2YQE A;  4Y2X A;  3QX7 A;  2KEY A;  3TI0 A;  3QUC A;  5GTH U;  1T3N A;  2VIX A;  8ICZ A;  3UMB A;  3BDP A;  4B6J A;  1ZD2 P;  2KK0 A;  1L7N A;  4UB5 A;  2HBM A;  4US8 A;  3MDA A;  2FMS A;  1HUO A;  2IBK A;  4ED1 A;  5IIN A;  9ICO A;  4YR0 A;  5KFK A;  1HEK A;  2N1R A;  1S0N A;  4UAY A;  1ZQP A;  2ZIU A;  3C1Z A;  1U9L A;  5CJ7 A;  3V6K A;  4DL6 A;  4PHD A;  3DEE A;  2AHO B;  2KIC A;  3ZDB A;  2C2E A;  5JTI A;  4KX5 A;  2V4R A;  4J9S A;  4P0P B;  3BQ0 A;  4TUR A;  1SZP A;  1ZOL A;  1JN3 A;  3RF9 A;  4JV0 A;  1SXD A;  1S0M A;  2FI1 A;  4QWC A;  1Q3U A;  5J2K A;  5F9N A;  1QSL A;  2HSZ A;  2YMM A;  2XCP A;  2BR0 A;  7ICT A;  4EBE A;  4ICA A;  1B22 A;  5AKX A;  3QEA Z;  1DRG A;  9ICU A;  4F4X A;  1SKR A;  5C0Y A;  5JUM A;  3NVV A;  2LPE A;  3H4B A;  4CNQ A;  3FM9 A;  2BCU A;  2WB1 C;  4J9O A;  5AI4 A;  5L1M A;  2QB1 A;  2HVI A;  2P66 A;  3ZDD A;  5ALP A;  1X2I A;  1ZQI A;  3CRX A;  4M9G A;  2R8H A;  1TVA A;  3AEV A;  4RT3 A;  5KT4 A;  3C1Y A;  2XI9 A;  3QUT A;  5KFR A;  1BGX T;  2XCA A;  1PK1 B;  2AU0 A;  7ICU A;  4TQR A;  3KHR A;  5J0S A;  4B9T A;  2RQ5 A;  7ICE A;  1KDH A;  2BQU A;  1VJ5 A;  2YMQ A;  2VJ4 A;  5J2I A;  3RBD A;  3BQT A;  3PW5 A;  4DL5 A;  2RRD A;  1Z1V A;  5CP2 A;  1ZQZ A;  5D46 A;  1DK3 A;  1ZET A;  1ZJN A;  3BS7 A;  4DSI A;  1S0O A;  2ASD A;  3IG8 A;  8ICN A;  4YMN A;  2W7P A;  4PZN A;  4M9H A;  4F2R A;  5DLG A;  4MFA A;  5AI0 A;  4RNO A;  9ICC A;  5CWR A;  5B5E U;  4RQ1 A;  4GXI A;  4QW9 A;  1EXN A;  2MSN A;  3WKB A;  4DEZ A;  4UAS A;  1YZ6 A;  2XVT A;  4PH5 A;  4QZG A;  3AU2 A;  2NO5 A;  1KTQ A;  1NI3 A;  3QE9 Y;  2DBY A;  4BWM A;  3NRW A;  1KSP A;  1ZQQ A;  5FP0 A;  4UB4 A;  4K4I A;  5KFZ A;  3PY8 A;  3ISC A;  2ZTE A;  3S6J A;  4PHP A;  4I2G A;  1CUK A;  4KLU A;  2IOH A;  2VAN A;  3IN5 A;  2IMW P;  5KFP A;  4FS1 A;  5ALT A;  2H3I A;  3AQE A;  9ICH A;  4R64 A;  1S0V A;  2KSO A;  2W54 A;  2EDU A;  3GFK B;  3AUO A;  5KG5 A;  1Z1B A;  4ED6 A;  4JWM A;  2OWO A;  4J9L A;  3IV6 A;  4RQ6 A;  4I29 A;  2ZIU B;  1S9F A;  4TUQ A;  4DFM A;  5JRT A;  5AIB A;  2KG5 A;  2I5H A;  2KP7 A;  3C28 A;  2W7O A;  2XGQ A;  4IRC A;  1X9M A;  3FAH A;  4QWE A;  1A0P A;  3RRG A;  1P7D A;  1ZQJ A;  9ICL A;  3LYS A;  1S76 D;  1ZQW A;  1OUQ A;  2K4I A;  1RYU A;  1V85 A;  3SAH A;  3E0F A;  3D6J A;  2XC9 A;  2HHQ A;  3RB3 A;  1UQV A;  1LB2 B;  4ED7 A;  4KMU A;  1T3Q A;  1IG6 A;  3OSN A;  4DQI A;  1BVS A;  5J0T A;  2I6X A;  5HR7 A;  4GFJ A;  2OCE A;  3N4M B;  1ZQO A;  3O0F A;  2DF4 B;  3CYM A;  1MA7 A;  2HHW A;  3RJF A;  3K1Z A;  1SB3 C;  5KFD A;  4UQG A;  4RNN A;  2HHX A;  5KG7 A;  4ELV A;  1S77 D;  2J6U A;  2FPM A;  4C80 A;  2W9M A;  3SQI A;  3QUB A;  4I2E A;  5C5J A;  1LV5 A;  2JEI A;  4EEN A;  5BOM A;  2KVC A;  2WTF A;  2LYA A;  4F3O A;  3TAC B;  5KFV A;  4CF3 A;  4O3R A;  1KFT A;  4Q8E A;  2UVW A;  2HHV A;  3M7D A;  4F4Y A;  1UHU A;  1T4G A;  7ICG A;  3T5J A;  3T79 A;  1ZQE A;  2B0C A;  2BCR A;  1PVQ A;  4ECZ A;  2G08 A;  4ELU A;  4PHE A;  1BPX A;  2KZM A;  1OXJ A;  4DSF A;  4GC7 A;  3SEN A;  4IC9 A;  4Y2P A;  4F92 B;  5J2G A;  4DCC A;  4U7C A;  3I28 A;  3AM9 A;  5J0R A;  1KKX A;  1FO4 A;  3PW7 A;  2KIV A;  3NUQ A;  3B0X A;  2GH1 A;  4GC6 A;  1PVP A;  5CA7 A;  1WUD A;  2FPK A;  4LJX A;  2LM1 A;  4KLE A;  3TAD C;  3GIL A;  3DDH A;  4C8M A;  4B9M A;  3ETR A;  7ICM A;  4OO1 J;  4IQT A;  1UA0 A;  1Q8K A;  1MQ2 A;  3KFU F;  2A19 A;  7ICI A;  4QZE A;  3UXN A;  2VA8 A;  5HNK A;  1NK5 A;  3PO5 A;  1ZQT A;  7ICR A;  2J6T A;  2DFL A;  2I1Q A;  2ZUB A;  5KFM A;  2D6F C;  2KSO B;  2QKQ A;  1ZQK A;  8ICC A;  3RB4 A;  1B4F A;  4R8U A;  4YCX A;  4PGY A;  5J0Y A;  2JZB B;  2C28 A;  4WJ3 B;  2BDU A;  3Q8M A;  2HHS A;  1U45 A;  3QU5 A;  4O3O A;  2W8L A;  5HHH A;  2HBJ A;  9ICN A;  3JPT A;  1X9W A;  2QB0 A;  7ICN A;  8ICT A;  4IQU A;  4PJ0 U;  3V6H A;  1KBU A;  2YN4 A;  2E1E A;  2JH1 A;  3IG5 A;  2PFQ A;  1V9P A;  2DWQ A;  2W04 A;  4ECY A;  1QH9 A;  1KFS A;  2CXY A;  4YXJ A;  5BPC A;  5F9L A;  3C2L A;  1BPZ A;  3N7R C;  5AM0 A;  5J2C A;  8ICF A;  1SZH A;  2FLP A;  2NRW A;  4CF5 A;  4Y2S A;  4EYI B;  3NVY A;  3H8J A;  5JU5 A;  4XRH A;  1ZQB A;  2F44 A;  4O3M A;  1ZQS A;  1N56 A;  4C8O A;  1TFR A;  3CP8 A;  2OYY A;  5ALX A;  1L8O A;  5DB8 A;  5J8Y A;  1YT3 A;  5AKG A;  5KT7 A;  5D4B A;  3V6J A;  2BKE A;  2W9B B;  1NK6 A;  3SD7 A;  1DGS A;  2HOF A;  4NL9 C;  4GIB A;  4C4S A;  5J0P A;  1Q46 A;  2FJ6 A;  2Y1I A;  3BQ1 A;  4O3P A;  2JEJ A;  7ICQ A;  2R18 A;  4R65 A;  3AU6 A;  1NKC A;  1F44 A;  1S10 A;  1ZQ1 C;  3RH4 A;  1ZD4 A;  1XSN A;  2WF9 A;  2VA3 A;  4DOC A;  5DQG A;  2W43 A;  3UQ0 A;  4EBC A;  2XY5 A;  2HBL A;  2YMP A;  4DS5 A;  4F8R A;  2DQN B;  3IDW A;  4BX9 C;  2FE9 A;  1U47 A;  2FLN A;  4FFD A;  1QSS A;  5F3X B;  1ZQG A;  4B9V A;  3PR4 A;  4DL3 A;  2D8C A;  3HX0 A;  1Z00 B;  5AM4 A;  2H3V A;  4ECR A;  1JX4 A;  1FEZ A;  2V9W A;  7ICS A;  2Y9T A;  2W03 A;  4FZM A;  4NLC A;  5KL1 B;  4F4W A;  2K8C B;  1C20 A;  4NLK A;  2K4P A;  2LKY A;  1X42 A;  3M6K A;  2D3D A;  2QAR A;  2KVS A;  4JV1 A;  4YD2 A;  5DBA A;  4ELT A;  4YMO A;  1X9X A;  2IOF A;  4UAT A;  4AYB C;  1SKS A;  2WHE A;  3I76 A;  3F53 A;  1L3V A;  4I28 A;  2KKP A;  2K89 A;  1ZQN A;  4JB3 A;  1M6Y A;  4DO9 A;  4Y2J A;  3I1Y A;  3PX0 A;  2LI6 A;  4KLJ A;  4XQ8 A;  1N5X A;  3HWT A;  4PGX A;  4KLH A;  4O5K A;  1O03 A;  1O08 A;  2G5H B;  2H3F A;  4Z6D A;  8ICV A;  2V4Q A;  4EZ9 A;  2H3Q A;  3Q8L A;  2W9C A;  3OPX A;  3F2B A;  4Y2T A;  3GIJ A;  3QU2 A;  2KZ3 A;  4PGQ A;  4EBD A;  4FBU A;  4I2H A;  4F5N A;  1NJZ A;  5E79 U;  1SV4 A;  1XC9 A;  3PNC A;  1L7M A;  2HDO A;  5L1L A;  2BCS A;  2MU2 A;  8ICG A;  3AQF A;  4R8U B;  3H8M A;  3QUQ A;  1NK7 A;  2DPJ A;  3M9M B;  3RJK A;  2AQ4 A;  1N62 A;  2W9A A;  2XY6 A;  1WWU A;  2E8O A;  1T7P A;  1VLB A;  4P4O A;  3ZDE A;  4Z6C A;  4KTQ A;  1RG6 A;  4HYK A;  5DKW A;  2F1J A;  2UVV A;  2WF5 A;  5DQI A;  1KFD A;  4M47 A;  5AHX A;  1ZD3 A;  1ZQR A;  4ECS A;  5J2E A;  4CE6 A;  2NRZ A;  1ARO P;  5KL8 B;  2AXT U;  9ICQ A;  4DSE A;  4F5P A;  3GIM A;  1XNS A;  1NJW A;  3OGU A;  2R8G A;  5KFU A;  1JRO A;  3KD3 A;  5G5G A;  4DFK A;  5KFX A;  4IS7 A;  4EEY A;  3RJJ A;  4CGZ A;  3SV3 A;  1ZRM A;  3WK5 A;  8ICW A;  4MF8 A;  3WKD A;  4IRK A;  3F5A A;  4DLE A;  8ICK A;  5IIJ A;  2KHV A;  2EZX A;  1B43 A;  3HKZ C;  2WAQ C;  5ALV A;  1RQN A;  4QZI A;  3GV7 B;  2ZIV A;  3VCB A;  2EAM A;  4PL2 A;  3HRD D;  3B0Y A;  1ZJM A;  5KFW A;  4Q8F A;  2EAN A;  5BOL A;  3BZK A;  1L7P A;  4QZ8 A;  1J2M A;  3QU4 A;  5CR0 A;  1NJY A;  2NRX A;  2WF7 A;  3V72 A;  1ED1 A;  3G6V A;  3SYZ A;  9ICG A;  2K4E A;  5KFI A;  3L3F X;  2KJ8 A;  1ZQM A;  4G3I A;  3H0L B;  2Y9U A;  3TAD A;  3QYP A;  4RQ7 A;  3T3F A;  3ZDC A;  3KZI U;  4CDG A;  4EX7 A;  1L7O A;  4JWN A;  3CW2 C;  2HI0 A;  1T94 A;  3MGH A;  2ZG6 A;  5J8Y C;  2PMZ F;  2DKX A;  2QAR B;  2IHN A;  2P35 A;  3SZ2 A;  4UBB A;  4F50 A;  3BZC A;  5ALM A;  1UT5 A;  5EE0 A;  1XU4 A;  4DFD A;  2MAX A;  5J2F A;  4I2A A;  4QNL A;  1L5U A;  3K1R B;  3D2S A;  4DQQ A;  3T5L A;  2RHF A;  3RAX A;  2JR5 A;  1NK8 A;  2P6U A;  3ZD8 A;  8ICM A;  3N7P D;  2ZIX A;  2W9C B;  2KFN A;  5ALZ A;  5EE1 A;  5ALG A;  4C7Z A;  3UPQ A;  4I2I A;  4M2Y A;  1DGJ A;  4JK1 A;  2BGW A;  2YX8 A;  1L8L A;  2NYV A;  5HHI A;  4C8K A;  3QXG A;  4KLI A;  4OD0 A;  5KFY A;  2BCV A;  4RQ3 A;  1CI4 A;  3H7I A;  3M9O B;  3Q8R B;  1U49 A;  4UB3 A;  3M1Y A;  3MDC A;  3TFS A;  1X9S A;  5AKH A;  2PFN A;  2L5Y A;  1RYS A;  4NM1 A;  4I2C A;  2OM6 A;  4XA5 A;  3AMZ A;  4RUC A;  1MSW D;  4ED2 A;  2WF8 A;  4P0Q A;  3G6Y A;  4F4Z A;  2KZZ A;  4NL9 A;  5DB6 A;  3C29 A;  2OEH A;  4Q45 A;  5KFQ A;  4KLG A;  3MR2 A;  1RDF A;  9ICR A;  2AJQ A;  5ALU A;  4NLG A;  4YD1 A;  3WK9 A;  5J0O A;  1IXR A;  1ZQA A;  5AKJ A;  3RJH A;  5TZV A;  4NXZ A;  9ICS A;  3CNH A;  3N7S C;  1DOQ A;  1CEZ A;  2KHQ A;  2EQY A;  4F72 A;  1B0X A;  1JAL A;  5ALN A;  3K75 D;  3EUB 2;  4DFJ A;  3G6X A;  2HVH A;  4IR9 A;  5HMM A;  5ALR A;  4BJQ A;  4M9N A;  3PSF A;  2KKV A;  3PV8 A;  2EAO A;  2F76 X;  5KG1 A;  5AIC A;  5KT5 A;  8ICO A;  2Y0S F;  2BPF A;  1JI7 A;  5DDY A;  8ICA A;  4A8E A;  4CF4 A;  4QIW F;  5AK4 A;  4UB8 U;  3M6Z A;  1X6I A;  9ICB A;  2ZIV B;  1TE2 A;  2JXJ A;  2NRV A;  2PFP A;  1JUD A;  4M0A A;  5AKZ A;  2IHM A;  7ICK A;  3KZX A;  2ZJA A;  4UAZ A;  2LMR A;  9ICV A;  2R8K A;  4I27 A;  1X6J A;  4C4T A;  4UAV A;  1D9D A;  1IM4 A;  2A3V A;  4TUP A;  2ATL A;  2JMG A;  3PMN A;  2ZTD A;  3IHQ B;  4MHV A;  3SAG A;  2KTQ A;  2FMP A;  1PZN A;  4RQ8 A;  4YP3 A;  1IV8 A;  3PO4 A;  2M9N A;  1YZ7 A;  1WYG A;  2B6G A;  4BXO A;  4M6W A;  5KG2 A;  1AQ6 A;  1SWW A;  2K4H A;  3WK6 A;  4ECW A;  3KHH A;  3OJS A;  4IQW A;  1JXE A;  5EOZ A;  1F5S A;  2G06 A;  2JH7 A;  4Y2Y A;  3QZ7 A;  3C2M A;  2KOB A;  4DWI A;  5D49 A;  5AI5 A;  4BUG A;  2F1H A;  1XO1 A;  4DF8 A;  1D8L A;  2WB1 F;  4NLB A;  2HW3 A;  5AKL A;  1TK8 A;  4Y2U A;  2KMD A;  1DXS A;  4OJO A;  2YY6 A;  9ICW A;  4FZL A;  3D2N A;  4KN4 A;  2JRZ A;  3TQ1 A;  1DK2 A;  4I2B A;  1SL1 A;  4O5C A;  5AKY A;  4F5Q A;  2LYH A;  5KG0 A;  3RB6 A;  4F93 B;  4IL6 U;  4F91 B;  5AIA A;  3ORY A;  5ALO A;  3THV A;  4YXM A;  5J0W A;  4XUS A;  1HIW A;  4I2J A;  4K4H A;  2W8K A;  4RNM A;  4J9N A;  2F77 X;  2J6S A;  3UXP A;  4B9L A;  3UM9 A;  2A1A A;  5KFG A;  4ECQ A;  2M0N A;  3ICX A;  3PW4 A;  2HBK A;  2LBO A;  1QTM A;  3PW0 A;  5KAI U;  3WKE A;  4P0Q B;  5ALI A;  1WCN A;  2DKZ A;  4YMM A;  3NTU A;  1Z19 A;  1SL2 A;  5KFO A;  5AKK A;  2ZUC A;  1UT8 A;  5GTI U;  3UXO A;  4EX6 A;  5AI6 A;  4UB6 U;  3PST A;  4O3S A;  4ED0 A;  1QQ7 A;  4BGD A;  5KTQ A;  1KN5 A;  5DB7 A;  3RH5 A;  2BZF A;  1KEJ A;  1A76 A;  4I2F A;  4NJ8 A;  4Q43 A;  1TAQ A;  4C8L A;  3PZP A;  8ICH A;  5AK6 A;  4OCZ A;  2ALZ A;  4O5E A;  2AQ0 A;  1J97 A;  4DL7 A;  1TAU A;  5KFL A;  8ICI A;  1V97 A;  1ZQL A;  2KN7 A;  2NV3 A;  2IA6 A;  4F5R A;  3BJY A;  4EEL A;  1TK0 A;  1BNO A;  3RTV A;  3M9N B;  5ALJ A;  9ICM A;  4TQS A;  5T14 A;  1NK9 A;  5KG3 A;  3IP4 B;  4Y2V A;  5L1J A;  5IIK A;  3V7L A;  4RPZ A;  3OTQ A;  3GIK A;  4O3N A;  8ICL A;  4J03 A;  1K5O A;  5CB1 A;  5KFN A;  4MFF A;  1KRP A;  4QWA A;  1PUZ A;  3PW2 A;  4RT2 A;  2EAP A;  2ZJ8 A;  2E8N A;  3LVV A;  4DQP A;  3H4D A;  4DFP A;  4X5V A;  5ALW A;  4PZO A;  4QW8 A;  3PR5 B;  3KHL A;  4BXO B;  4M6W B;  2WF6 A;  2AGO A;  3HJE A;  2BHN A;  2GWS A;  2HOQ A;  2O6K A;  2C22 A;  4P2H A;  3MC1 A;  4ED3 A;  3LVW A;  3EWA A;  4YQW A;  4R63 A;  3E58 A;  4FE3 A;  5HR6 A;  1SWV A;  2QLT A;  5EE3 A;  3GII A;  1ZQH A;  3N28 A;  2GLE A;  2RLT A;  4KIT B;  1TK5 A;  1URJ A;  5KNI A;  2W3R A;  4RQ4 A;  3SV4 A;  2Q0Z X;  4P4M A;  3H0M B;  2DPI A;  1ZD5 A;  4C0Z A;  3UMG A;  4BWJ A;  3OHA A;  1ZQD A;  5DQH A;  3RJE A;  3WKA A;  8ICJ A;  2ISP A;  5KT2 A;  2BQ3 A;  2ZXH A;  3PVX A;  1Q3V A;  1FFV A;  2KV2 A;  2ZTC A;  2KD1 A;  2Q4T A;  1KQQ A;  3TAP A;  1L3T A;  2PXI A;  7ICL A;  3EYZ A;  2ASJ A;  3WK4 A;  4UBC A;  4KMO B;  2IOF K;  2E5S A;  4O3Q A;  4J9R A;  3RAQ A;  3SR6 A;  4RQ5 A;  4PL1 A;  4JUZ A;  4QZF A;  2YB4 A;  4RPY A;  2I9G A;  4NLZ A;  3JPP A;  1BPE A;  5AM5 A;  3MBY A;  3FDS A;  3D2Q A; 
#chains in the Genus database with same CATH homology
 4NV0 A;  2D6F C;  4A8E A;  4QNL A;  4QIW F;  3D2S A;  3SQI A;  4ICA A;  2YB1 A;  2W03 A;  4FZM A;  3NRW A;  4WJ3 B;  1DRG A;  5KL8 B;  2BDU A;  1GO3 F;  4NLC A;  3M6Z A;  2KVC A;  2RHF A;  2ZIV B;  5KL1 B;  1XNS A;  5C0Y A;  2K8C B;  1HIW A;  2LYA A;  2KNJ A;  4OJP A;  2LKY A;  3M6K A;  1UPH A;  2G09 A;  4JMU A;  2KIW A;  2F77 X;  3LVV A;  4P0P A;  2WB1 C;  4CGZ A;  2ZIW A;  2HBJ A;  2KJ5 A;  2ZXI A;  4U6P A;  2M0N A;  3ICX A;  3KZX A;  3M7D A;  2HBK A;  3IN5 A;  1PVR A;  3GZF A;  2LBO A;  2ZIX B;  2OH2 A;  3PSP A;  2PMZ C;  3N7P D;  2A3V A;  2ZIX A;  4P0Q B;  3T79 A;  3F5A A;  4FZN A;  2F8L A;  1KBU A;  2E1E A;  2JH1 A;  2H3I A;  2JMG A;  3AQE A;  3IG5 A;  2LHT A;  2LYB A;  2HOQ A;  2KHV A;  2W04 A;  3PSI A;  1MA7 A;  1PVQ A;  3HKZ C;  2VKQ A;  4AYB C;  3CRX A;  2E1F A;  2HMX A;  1Z19 A;  2G08 A;  2WAQ C;  3F53 A;  4OJL A;  3MGV A;  2YX8 A;  2KKP A;  3SAG A;  1Z1B A;  2Y0S C;  2XI9 A;  2K89 A;  3N7R C;  1L6N A;  2ZIV A;  3LVW A;  3ONN A;  3VCB A;  2MRL A;  2RP5 A;  2VJ5 A;  4KX3 A;  1SZH A;  2K8A A;  4PL2 A;  5CRX A;  3PST A;  4FE3 A;  4QIW C;  5HR6 A;  1A6S A;  2K8B B;  2OXO A;  2CN1 A;  2G5I B;  3GU3 A;  4IC9 A;  2ZIU B;  2CRX A;  2G5H B;  1URJ A;  2H3F A;  4O3M A;  2KEY A;  4U7C A;  2KJ9 A;  3CP8 A;  2OYY A;  3H0R B;  2MA1 A;  2H3Q A;  2JGA A;  3H0M B;  4ACO A;  2OM6 A;  2G07 A;  1ECW A;  1YT3 A;  4C0Z A;  4P0Q A;  2VJ4 A;  2GOL A;  3OPX A;  2VIX A;  3F2B A;  2K4H A;  3C28 A;  1ED1 A;  2W7O A;  2RRD A;  4OJ6 A;  3NUQ A;  3SAF A;  3C29 A;  3VC8 A;  3F2C A;  2GH1 A;  2K4E A;  1A0P A;  3PZP A;  2HOF A;  3F2D A;  2G06 A;  1P7D A;  3F5E A;  1NZB A;  3LYS A;  3L3F X;  2JH7 A;  2HBM A;  2KJ8 A;  2HOI A;  2ZXH A;  1PVP A;  1Q3V A;  2R18 A;  1CRX A;  1WUD A;  2KV2 A;  2KOB A;  3H0L B;  2K4I A;  1OUQ A;  3AL0 B;  3SMV A;  1F44 A;  2XIC A;  3IG8 A;  1ZQ1 C;  2KD1 A;  1XO0 A;  2Q4T A;  3AQF A;  1HEK A;  2JHD A;  2NV3 A;  2N1R A;  4BUG A;  3ALR A;  2W7P A;  3SAH A;  3E0F A;  1D8B A;  1TAM A;  2WB1 F;  4NLB A;  2ZIU A;  3N7S C;  4OO1 J;  2KHQ A;  4CDG A;  3DEE A;  4KMO B;  2KIC A;  2E5S A;  2H3Z A;  2HBL A;  1T94 A;  2DGZ A;  2DQN B;  2XID A;  2ZG6 A;  2PMZ F;  4BX9 C;  4QJF B;  4KX5 A;  3KFU F;  4CRX A;  5T14 A;  4P0P B;  4OJO A;  5HR7 A;  4GFJ A;  2G0A A;  2ZIW B;  2F2A B;  3IP4 B;  4BJQ A;  4FZL A;  3D2N A;  3PSF A;  2KKV A;  3O0F A;  2DF4 B;  3CYM A;  4PL1 A;  2XVT A;  3HKZ F;  3K1Z A;  3RF9 A;  2CPR A;  2YB4 A;  2Z7J A;  4AYB F;  5A0L A;  2WAQ F;  4OJ5 A;  2F76 X;  3RFA A;  2Y0S F;  1Q3U A;  1IIP A;  3D2Q A;  4NWI A;  2H3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...