3D2QA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'DRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Muscleblind-like protein 1
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, rna binding protein
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2qA00
2E5SA 3D2QA 3D2NA 3D2SA
chains in the Genus database with same CATH superfamily
5J0QA 4ED0A 1DK2A 4I27A 5J2CA 1A6SA 3SV4A 1OW5A 3RAQA 4FO6A 2Q0ZX 4O3QA 1ZRNA 1SKSA 4PPXA 2WB1F 2AXTU 4NM2A 3RJIA 4YR2A 3ZD9A 4IL6U 2W03A 3RJHA 2FMSA 3M9NB 2EZYA 2RQ5A 2K60A 4QZAA 2I5HA 3T79A 2V9WA 5J2GA 5AM5A 3MR6A 4YN4A 3RH5A 1C20A 1BPYA 1V9PA 2BPGA 5J8YC 4USAA 2F44A 3KD3A 5AKHA 2BPCA 5KFRA 4NL9C 8ICIA 1B4FA 1L3UA 2ZIWA 8ICBA 3H8JA 3V7KA 3AQFA 4GFJA 5J0WA 2YB4A 3AN1A 1NJYA 2R8GA 4G3IA 3C23A 4NWIA 5AK4A 4TUSA 5KFFA 5HNKA 4KMUA 3UMBA 3VC8A 3N28A 2P66A 2Y9UA 4KLQA 4KLGA 2G09A 5HHHA 3GV8B 2ZG6A 1SV0A 3PMLA 3B0XA 5EE3A 1U45A 5KFUA 5AM2A 4Y2VA 3TKAA 4PGYA 4EEYA 2WTFA 1F0MA 3EZ5A 2FLLA 2HHVA 1ZQGA 3C5FA 5KAIU 2IMWP 2G5HB 5ALUA 4M9HA 7ICNA 3MR3A 2YX8A 2BDUA 3N97B 3PSIA 1J2MA 3NGDA 4ECVA 3JPRA 9ICEA 4LZDA 5E79U 4DQSA 1URJA 3L5KA 3SI8A 2XY6A 3RFAA 2WF5A 3PVXA 4QZEA 2JZBB 7ICSA 1D8LA 7ICTA 5DGAA 4KITB 3QXGA 3TAPA 4I2AA 2KOBA 3T5HA 2NRTA 2DL0A 1KLNA 1FIQA 2DKXA 2IOFK 1NK5A 1UHUA 4RPYA 1DOQA 3M6KA 3TFSA 2D8CA 1WWVA 2IOFA 5EWEA 4DSFA 3B0YA 4Y2QA 3MR5A 1DXSA 1SL0A 2F1JA 3PW4A 3UXPA 2GO7A 1N48A 1J97A 3O0FA 3KHHA 3GV5B 1PK3A 3BZKA 9ICFA 2A3VA 1KL9A 4DSLA 4NY8A 4I2IA 3JPSA 5KG4A 1QH9A 2ASJA 3AL0B 2OYYA 1BPZA 2CXYA 4PZNA 5KG2A 8ICFA 4BWMA 4R8UA 4B9LA 4QZIA 3PR5B 1MQ3A 5AI0A 3IG5A 3DV9A 2ODGA 5F9NA 1FO4A 4QIWC 4DQIA 4M0AA 3C1YA 3UM9A 4I2CA 2HHWA 4FS1A 2XVTA 4FBTA 4F3OA 5J2FA 4IR1A 3WKEA 4RPXA 3E2EA 3UQ0A 5DB7A 3M8SA 2JV3A 1O03A 4K4GA 3TADA 3LWLA 4MF2A 3F2DA 4RZRA 4C8OA 5AKYA 4ED3A 3HKZF 3AQEA 2UVVA 4KLDA 2G08A 2HBJA 2KZ3A 3IN5A 5J2HA 4YXJA 2ALZA 3ZDAA 2ZIVB 3C1ZA 1IM4A 3K1RB 4YXMA 2JEGA 5AKZA 2ZTCA 2ZTDA 2ZIXB 1NKBA 2RDJA 5J2AA 5DBAA 2EAMA 5HHIA 2HSZA 5KT7A 4YD2A 1LVHA 2I6XA 2VJ5A 2MUTB 1TK0A 4MHVA 4FBUA 2EAPA 1ZQLA 2V4RA 5ALOA 1ZQJA 5HMMA 5KFZA 1A77A 3PX0A 2LKYA 2CPRA 3D6JA 4Y2RA 3QEAZ 1U4BA 4Z6CA 2AQ4A 7ICLA 1Z4OA 4DL6A 4EYHB 1T3QA 3BZCA 5AI5A 5KG1A 2RHFA 5DG9A 3BQ1A 4KLTA 1YT3A 4US9A 5ALPA 3C2MA 4DQRA 3EW9A 1U47A 4EZ9A 8ICVA 4IC9A 1UT8A 3EWAA 1ECWA 2BCUA 9ICVA 2HHSA 4C80A 4BGDA 2UVRA 4F8RA 1YZ6A 4CGZA 3FAHA 2A1JA 4EX7A 4PHDA 1ZJMA 3AMZA 3M1YA 3V7LA 5ALFA 2WAQC 1LKYA 5AM4A 5KFQA 1VDVA 4GC6A 2YMQA 1IIPA 2OXOA 1X9SA 2FJ6A 4UAZA 4KX5A 3PV8A 3UMGA 4J9SA 3OSNA 4GIBA 5L1KA 8ICYA 3H4DA 3K4GA 2OEHA 1XNSA 2IHMA 2W7OA 1X9MA 3WKBA 4CDGA 4DOCA 4JB3A 4DSIA 2BR0A 9ICCA 4NLNA 2DUYA 4ED6A 8ICJA 1TAUA 3AM9A 4Y2SA 4FZMA 1XSNA 4UAVA 4UAYA 4F4YA 4B9SA 4A8EA 2KIWA 3RR8A 5J8YA 7ICMA 3PO4A 3PY8A 3RB3A 4GLXA 4MFCA 4F5QA 4NL9A 4OJ6A 3V6KA 2FPMA 2EH9A 2K4IA 1S77D 8ICNA 2QB0A 1KTQA 1X6JA 3MR2A 3MFIA 4QNLA 1SXDA 1ZETA 2YMMA 3N4MB 4YFKA 5KG5A 3KKAC 3SZ2A 2K8BB 2NYVA 8ICMA 3NRWA 4EZ6A 3Q8SB 1BGXT 2Y0SF 1ZQDA 2KTQA 2ZIWB 3OPXA 2BZFA 1SWWA 2FDRA 5CB1A 4Y2PA 5AKXA 4PL1A 5JRTA 2W8KA 2WF7A 4DF8A 3JPPA 3IRUA 1AROP 4QIWF 3TFRA 1NK4A 1FEZA 4YMNA 3RJGA 3EUB2 4J9OA 4KLFA 4RQ0A 2BCQA 5IINA 4IRKA 3SD7A 2XCPA 5T14A 1XS9D 5J29A 3T5LA 4UB2A 3TI0A 3BS7A 2HMXA 4UATA 4F5NA 2AU0A 3IM1A 2KZZA 1P7DA 3HWTA 3V6HA 4UAWA 2YY6A 1RYSA 5DB9A 1PUZA 5DB6A 3PW5A 4QWCA 1SKWA 7ICVA 3LYSA 5KT4A 1HUOA 2ISOA 3GFKB 5JU5A 2ISPA 4NLCA 2XI9A 2W3SA 5B5EU 4IQWA 5J0PA 2QKQA 2G0AA 4CNQA 2D3DA 1TV9A 8ICKA 1QQ5A 5EWGA 1NNLA 3QNMA 3BS5A 2KKVA 5DB8A 4ZOHC 4CF3A 3ZDEA 4IR9A 7ICFA 3H7IA 3HILA 3C28A 1L3VA 5BOMA 3CNHA 5CR0A 1Q8KA 2ZUDA 3RBDA 1N5WA 3PW0A 3B9JA 3SAHA 3V72A 3PSFA 2DKZA 4R8UB 4MFAA 1ZQYA 2XIDA 3MGHA 2V4QA 1U9LA 8ICTA 1B0XA 4RQ2A 1NI3A 4ECSA 1JIHA 2OM6A 5AKEA 4UB4A 2KK0A 4OJOA 4RQ8A 3N7SC 3ISDA 4TUQA 7ICPA 2JGAA 5ALVA 4KLOA 5KFDA 5CP2A 5KFBA 2FMQA 5KFJA 5J2EA 2F2AB 5AKGA 5KFLA 2PFQA 2WAQF 4F72A 2FLNA 2JXJA 1ZQOA 2ZTEA 4LZGA 2KNJA 1A0PA 2KIVA 4R64A 2HHQA 9ICXA 3DDHA 1ZD5A 1MQ2A 3ORYA 3QX7A 3MFHA 4C8LA 4B9TA 2K8AA 3BQ0A 2KSOA 5TISU 1HUZA 1JN3A 4QZDA 5D4BA 4P0QA 4QWEA 2FE9A 3ALRA 5CRXA 1JXLA 1SGGA 3L3FX 4QZ8A 4P2HA 1ZD3A 4DL2A 9ICJA 1N62A 2KFZA 2Z7JA 4RQNA 3VCBA 2LYAA 3NTUA 2XGPA 1XSPA 4TUPA 5DLFA 4Q43A 2Y1JA 3PSPA 2VANA 9ICQA 1FFUA 5TZVA 4DSJA 1ZQUA 1F44A 3FM9A 2E3TA 4EBDA 1EXNA 4FFDA 5AHXA 1JALA 2KMDA 4CF4A 2LPEA 1BPXA 4Z6FA 5KFPA 3LDAA 1ZQSA 3SEIA 1D9FA 4Y2TA 2G06A 1BPBA 2ASDA 3AUOA 1S0MA 2KHVA 2HHUA 4O3PA 2A1JB 2DPJA 2HW3A 4YCXA 4P0PA 4KX3A 1ZQTA 2E5SA 2KZMA 8ICHA 1LKYB 3DEEA 3NVWA 1LV5A 2KG5A 5J0UA 4IRCA 4DFMA 2R18A 2NRXA 2ZXHA 4DSKA 4J9PA 4J9LA 3KOOA 2IHNA 4P4MA 4ELUA 2KEYA 2CRXA 1NK7A 3UXOA 2F1IA 2W9CA 4JK1A 3HX0A 4NV0A 4M04A 1MSWD 3HPOA 2BQUA 2WF6A 3PZPA 4I2FA 1S76D 1DGSA 4PHPA 2QARA 2JRZA 2P6RA 3GZFA 1NKCA 2HOFA 3L4PA 3M8RA 1X40A 9ICAA 1L3SA 2B6GA 4C8KA 5FP0A 2Y1IA 4K4HA 2H3FA 3KBBA 4U7CA 2FMPA 1X9XA 3KKAA 1L3TA 3RH6A 2Y0SC 1PVQA 2VA8A 3RJKA 5J0TA 5AK3A 3KZXA 4PGXA 1ZQAA 4OO1J 2HOIA 8ICAA 1QQ6A 3GIKA 4UBBA 2QB0B 1AQ6A 4QJFB 1RXWA 4RT2A 3H8MA 3JPNA 9ICIA 5J0OA 4KLJA 5AK6A 4DL3A 1BVSA 3PW2A 4QWDA 1U49A 1T3NA 4KMOB 4O5EA 1IV8A 4GC7A 1WWUA 1NZBA 3GQCA 2M9NA 9ICLA 4YMMA 5KFTA 3QU4A 5ALXA 4EX6A 4PH5A 1N63A 2AQ0A 3F2BA 1D8YA 5J0XA 1ZQNA 2BCSA 2H5XA 2L5YA 5CWRA 2E8MA 3WKDA 4QZHA 1D8BA 8ICGA 3AEVA 4DLEA 1Q3UA 5CJ7A 9ICPA 1TFRA 4OJ5A 2BQ3A 4RQ6A 9ICHA 4C4TA 1SB3C 1SZPA 1KFTA 3F2CA 3K75D 4B9VA 4BWJA 2O6KA 4QZBA 2PFNA 4F93B 4ED8A 4O3OA 4UB1A 2W9MA 5AM0A 3QU5A 4FZNA 1ZOLA 4KLHA 4XQ8A 1ZQQA 2B21A 3NVVA 2KJ8A 3C5GA 5L1IA 3ZDBA 2K4EA 3TARA 2EZXA 3T3FA 4KN7A 2C2RA 1WUDA 2F3NA 4JV2A 5CA7A 2F76X 1ZD2P 8ICEA 2ZJ8A 3PO5A 4ECWA 2C28A 2NRZA 4M2YA 4F4KA 1KEJA 5IIOA 1RQLA 5DKWA 2YMPA 5IIJA 4LJXA 2I1QA 5ALWA 3IP4B 3BS5B 1HEKA 3KFUF 2PFOA 5ALRA 3MDAA 3U26A 1Z1VA 4OJPA 1TK8A 3KHRA 2W9AA 2KFNA 2MA1A 4YG2A 2AH5A 2H3IA 3M9OB 9ICRA 2XCAA 5AICA 3LK9A 2H3ZA 2NO5A 1TAQA 5AKKA 3BQ2A 2A19A 1JROA 2J6SA 1WG8A 2GWSA 4DFDA 5AIAA 5DGBA 3OHAA 5KFIA 1VJ5A 1NJXA 2YQEA 3WU2U 4O3RA 9ICKA 4TQSA 2G07A 3MBYA 4GXKA 3EPIA 2DQNB 2NV3A 7ICGA 4C4RA 1Z19A 3H0MB 4KLSA 1ZQFA 4O5CA 5KFWA 4C8NA 4PZOA 2JHDA 1Z3EB 1DGJA 2B0CA 1ZQCA 2YB1A 2E8OA 1BNOA 5EE9A 3RR7A 1KSPA 4RUAA 4R66A 5CHGA 2JH1A 4QZCA 4F5OA 4YMOA 9ICBA 1UQVA 4RNOA 3Q8PB 4Q8FA 5EOZA 2KSOB 1XO0A 2F1HA 4GXJA 3I1YA 4P0QB 4EENA 9ICTA 4C8MA 4Q44A 4BDPA 1L8LA 1ZQPA 4QWAA 4IQUA 8ICWA 2PI4A 4EBCA 2JEIA 3N7PD 4PJ0U 4MF8A 2QLTA 4EELA 4DL7A 4Z6DA 9ICOA 2VA2A 4E0DA 2OHFA 1UCVA 2KV2A 3AU6A 1J2NA 4M9GA 3V6JA 1ED1A 2BQRA 4R63A 4C7YA 3KHGA 4F92B 1OXJA 2AGPA 2GOLA 2P35A 4M9NA 4P4PA 3BQ7A 4ECRA 5KT2A 2J6UA 2W3RA 3MGVA 4BXOA 5DDYA 1TK5A 4JWNA 5L1LA 3UMCA 3MC1A 5ALQA 5KNIA 5L1JA 4M47A 2F77X 4I2JA 3GIJA 2ZUBA 3SAFA 2XY7A 3SMVA 2AGOA 1T4GA 5EE1A 4P0PB 2DF4B 2LYHA 2HCFA 2M0NA 4U6PA 2HBKA 2OCEA 1WCLA 3MDCA 1TVAA 3NUQA 2ZXIA 3WKCA 4ECZA 9ICSA 3GILA 5KTQA 1TKDA 4F2RA 5KAFU 1T8EA 1RM6C 2W9CB 2F8LA 5ALGA 4TQRA 1UT5A 3LVVA 3LWMA 2RP5A 2QARB 2KP7A 4TURA 2ATLA 1JMSA 4OD0A 1WYGA 3ZDDA 1ZQIA 5KL8B 4G9BA 4C0ZA 5KFAA 3EYZA 4PGQA 4RNMA 1X9WA 5CEHA 2UVWA 5AKIA 3TAQA 4FE3A 4YR3A 3ZI4A 1NJZA 2E8PA 3HW8A 3QU2A 3HP6A 4DFPA 4F91B 1A76A 1T7PA 3QEBZ 4M9LA 4BUGA 5KFCA 1JXEA 4DL5A 2KN7A 5C0YA 1C7YA 3GIIA 3NVYA 1ZQWA 1S0OA 1WCNA 1XO1A 1Y88A 4RU9A 9ICWA 4J9KA 4ELTA 3RH4A 3JPOA 3SENA 5AI8A 3A0HU 4US8A 1K1SA 2EQYA 5AI4A 1NK9A 5EWFA 4C4SA 1SKRA 5HR6A 4M6WA 2DBYA 3Q8KA 5DG8A 3MABA 2J6TA 2MRLA 4O3NA 2JH7A 5DQHA 1BPDA 4WJ3B 1KRPA 4F50A 5ALLA 5ALDA 3NRZA 5J2BA 3PX6A 5HR7A 2RLTA 2PI5A 4O3SA 1PK1A 2ASLA 1NK8A 1V38A 2W9BA 5KG3A 2ZJ5A 4RQ3A 1RPLA 3PMNA 1HJPA 3K1ZA 2VKQA 2KVCA 4IQVA 1S97A 1ZQHA 1ZQZA 1DRGA 1NK6A 2R8JA 4J9NA 2PFPA 4KN4A 2W43A 4I2DA 1X66A 5J0SA 4JWMA 1RG6A 2HOQA 2MSNA 1RYRA 2KVSA 5JTIA 1KN5A 4ECQA 1XWLA 4DCCA 3KZIU 4UB8U 3KTQA 3E58A 3Q8MA 4NLZA 2FPLA 1ZQKA 4I2GA 4I2HA 5F3XB 5DBCA 1NK0A 3PR4A 5J0YA 3JPQA 2BCRA 3D2NA 1NOMA 3UPQA 5AI6A 3OTQA 1F5SA 1B43A 1N5XA 2EANA 3ED5A 4UBCA 2HVHA 3UQ2A 4Q45A 2PMZC 5F9LA 2YTUA 1D9DA 2F8KA 4ECYA 2G5IB 1SXEA 2KJ5A 3OJSA 5IILA 3IHQB 3GU3A 2HBMA 4O9MA 1GO3F 3WK8A 4F5PA 2ZIUA 2AHOB 4YR0A 3R9KA 2OWOA 4IS7A 7ICOA 1ZQMA 2Y9TA 5AKLA 2Q4TA 2P6UA 3I76A 2PXIA 2A1AA 2W7PA 8ICRA 4HYKA 4I29A 5KT3A 4MEXA 4UB5A 4KLUA 1CI4A 1QLNA 3WK5A 5KFEA 1L7NA 2IOHA 4BX9C 1X6IA 3QUQA 5ALEA 3WK9A 5IIKA 1CUKA 2JR5A 3FYHA 4I2EA 3FC4A 1JUDA 4MEYA 5J2JA 2DFLA 1Z4NA 2HHXA 1XSLA 4ELVA 2K4HA 3PNCA 4RPZA 3IV6A 1ZQVA 3THVA 2UVUA 2BDPA 1QQ7A 4YVZA 5DG7A 3RAXA 2D6FC 3H8WA 2PKEA 3ICXA 1RDFA 4AYBC 1KQQA 5ALSA 2KKPA 3ETLA 3Q8QB 4DS4A 3TANA 4ACOA 4OCZA 1PZNA 3C29A 5J2KA 3ISBA 1COOA 2KICA 5ALHA 1QSSA 1S0NA 3G6VA 1N56A 3QU9A 4P4OA 3T5JA 1MA7A 4QWBA 2ES6A 5BPCA 4J9MA 3F53A 3ISCA 4DQQA 2WF8A 2HVIA 3QZ7A 1SWVA 3A0BU 5IIMA 2BPFA 4C7ZA 3RJEA 3GIMA 1M6YA 4PL2A 2EAOA 2ZJAA 1ZXIA 9ICGA 1QCKA 1Z00B 3SAGA 1ZD4A 4R65A 3QE9Y 2CN1A 2YN4A 8ICPA 2VJ4A 3WK7A 2H3QA 3ETRA 4UB6U 7ICEA 1PVRA 2JMGA 2LM4A 4EYIB 4BXOB 2KD1A 4NM1A 1QTMA 5ALTA 8ICQA 1VLBA 4B9UA 2MAXA 2H3VA 4RNNA 2BKEA 3CYMA 3HJEA 3OSPA 4KLMA 3KHLA 1K5OA 3N7RC 3OGUA 8ICZA 5KFVA 4RT3A 3FDSA 2BCVA 1B22A 3H8SA 1QSYA 5K4LA 4IQTA 2HBLA 3H40A 4F5RA 2XY5A 3QUTA 5JUMA 1IG6A 2XGQA 2WHEA 1ZRMA 2XC9A 5ALNA 4QZFA 2NRVA 4Y2JA 5BOLA 5KFXA 2W04A 4UARA 2WF9A 9ICMA 2OH2A 8ICCA 4JMUA 7ICJA 4ICAA 1LB2B 3HRDD 3RJJA 3RRHA 1BPEA 4RQMA 3CP8A 9ICNA 2NRWA 4BJQA 4QZ9A 4I28A 2RDIA 3PX4A 1SV4A 3JPTA 1UPHA 5KFSA 1CRXA 3T5KA 4UB3A 4O5KA 3CRXA 1L7PA 4JV0A 3GDXA 3E0FA 4Z6EA 5G5GA 3H0LB 1KDHA 4YP3A 4Y2YA 3PSTA 2AGQA 4ED1A 5H2FU 2E8NA 4ECXA 2PMZF 4JV1A 2ESEA 1DK3A 1TE2A 3LVWA 5ALIA 4DOAA 2W8LA 1ZYQA 4M6WB 2NO4A 4F71A 5J0RA 4GXIA 2E1EA 3C21A 4NLKA 3IG8A 2EZZA 3EPGA 4O0IA 2DWQA 3RB4A 7ICHA 3WK6A 3G6XA 5AI9A 2GH1A 4XRHA 5G5HA 3BDPA 2KJ9A 2LYBA 1MC8A 2WFAA 1SV0C 2HHTA 1S0VA 3G6YA 2I9GA 2AJQA 4X5VA 5HMLA 8ICOA 3QUCA 4QW9A 1PK1B 2W55A 5ALJA 5B66U 2W9BB 2C2EA 4I2BA 4Q8EA 5DQGA 2WB1C 1S8OA 1RZTA 2JZBA 3BQTA 2R8IA 1PVPA 4DFKA 3MGIA 4F4XA 2DGZA 3RRGA 4CRXA 4M9JA 3ZDCA 4NXZA 3V7JA 2W54A 3M7DA 1SZHA 1KFSA 1ZQBA 4Y2XA 5D49A 5KFYA 1ZQ1C 4UAUA 5EE0A 2FLPA 3RB0A 5D46A 2R8KA 2HI0A 1X42A 4CF5A 4DFJA 2RRDA 3I28A 3D2QA 3RF9A 5A0LA 4NJ8A 4F2SA 1V97A 3QU7A 3J81j 1L8OA 1SL1A 3SQIA 5AM3A 2MU2A 4HAIA 3C2KA 4UASA 3Q8RB 3SR6A 5KG6A 4DEZA 4IRDA 4FZLA 4UW9A 1YZ7A 4AYBF 4QW8A 5KFGA 3HT3A 1JX4A 3CW2C 3GV7B 1Z1BA 2N1RA 1KKXA 1Z00A 2R8HA 5J2DA 4RQ1A 2DPIA 3QUBA 2W11A 3BJYA 3Q8LA 4OJLA 4QZGA 4XA5A 2BGWA 2KE7A 5KFMA 1TAMA 3RJFA 2FI1A 2KHQA 5L9XA 5DQIA 5KFNA 4RQ5A 2VIXA 5KT6A 3ONNA 5ALZA 4DOBA 5AK5A 1X2IA 8ICSA 3F5AA 2LM1A 4LVSA 4J9RA 1L7MA 1U48A 2JEFA 3H4BA 5KFHA 2ZIUB 4EEKA 3SV3A 5HP4A 2BHNA 3WK4A 5DBBA 4ECTA 5AM1A 4EBEA 2HDOA 4RUCA 3NVZA 1L6NA 5AIBA 3H0RB 5KG7A 1SL2A 4RQ4A 3RB6A 1JRPA 1O08A 1ZQRA 3QZ8A 7ICRA 3RBEA 4K4IA 1COKA 4DO9A 4DS5A 2QB1A 4FS2A 3TACB 4RQ7A 2ZIVA 1NZPA 5ALKA 3NS1A 2FPKA 2EDUA 4KTQA 1S5LU 3M9MB 1T94A 2ZIXA 1Q3VA 1H38A 1ZQEA 3TADC 5KFOA 1NKEA 1N60A 1UA1A 3QYPA 5IIIA 4PHAA 4F4WA 2MUTA 1SIJA 4ED7A 1Q46A 2LMRA 4DF4A 5J2IA 1ZQXA 1L7OA 5C5JA 4Y2UA 4DSEA 2C2DA 3SYZA 1FFVA 1CEZA 5L1MA 1XC9A 1V85A 2XICA 2YMLA 2C22A 2JEJA 8ICUA 4J03A 1IXRA 5DDMA 4YQWA 9ICUA 3OJUA 7ICIA 4B9NA 4NLBA 3UXNA 3S6JA 5DLGA 1JI7A 2GLEA 4CE6A 5AKJA 5GTIU 4XUSA 4J9QA 1QSLA 1RYUA 3IDWA 3C2LA 7ICQA 5GTHU 4JUZA 1BNPA 1HIWA 4DWIA 3NASA 1S10A 7ICUA 3F5EA 2IBKA 3AU2A 4AP9A 4KLEA 4B6JA 1OUQA 2LHTA 3OHBA 1ZJNA 2K4PA 5KFKA 4MFFA 5KG0A 4ED2A 1KFDA 2XO7A 4DQPA 2ZUCA 3ZD8A 8ICXA 4UQGA 3RTVA 1RXVA 2LI6A 4O3MA 1K1QA 1KBUA 4B9MA 2IA6A 4PHEA 2K8CB 3WKAA 2LBOA 1XU4A 4DLGA 4ZH4A 1RQNA 3D2SA 3PW7A 4KLIA 8ICLA 1UA0A 7ICKA 1KW4A 1N61A 4CCHA 5KT5A 3M6ZA 3HKZC 1N2XA 4NLGA 1NJWA 4DL4A 2K89A 5KL1B 1L5UA 2VA3A 4KLLA 3TQ1A 1MN8A 5ALMA 4ECUA 2E1FA 5ALYA 4YD1A 1S9FA 4F4ZA
chains in the Genus database with same CATH topology
2YX8A 2BDUA 4OJOA 1Q3VA 3C29A 3PSIA 3N7SC 3D2NA 5C0YA 1NZBA 2KV2A 2RRDA 1IIPA 2OXOA 2KICA 2JGAA 4OJPA 3D2QA 3RF9A 5A0LA 4KX5A 2W04A 1ED1A 1MA7A 2G06A 1URJA 3F2DA 2OH2A 1A6SA 2MA1A 4JMUA 3RFAA 3F53A 3SQIA 2WB1F 2GOLA 2F2AB 2KHVA 2H3IA 2PMZC 3AQEA 3HKZF 4ICAA 2G08A 3F2BA 2HBJA 3IN5A 4P0PA 4KX3A 2H3ZA 5T14A 4FZLA 2E5SA 2W03A 2G5IB 2WAQF 3CP8A 4PL2A 2ZIVB 4AYBF 2W7OA 1XNSA 1D8BA 4BJQA 3DEEA 4CDGA 1Q3UA 2KNJA 2KJ5A 5HR6A 1A0PA 3MGVA 2ZIXB 1UPHA 1CRXA 2HMXA 2R18A 4OJ5A 2XICA 1Z1BA 2KOBA 2N1RA 3CRXA 2ZXHA 3E0FA 3GU3A 3T79A 2HBMA 1GO3F 3SAGA 2MRLA 3H0LB 3M6KA 2JH7A 4FZMA 1P7DA 4NLBA 2KEYA 2F77X 2VJ5A 4WJ3B 2CN1A 2CRXA 4OJLA 2ZIUA 3PSTA 3F2CA 2G07A 3SAFA 2PMZF 2K8AA 3SMVA 2KIWA 4A8EA 1TAMA 2VJ4A 2DQNB 2NV3A 4NV0A 4P0PB 2DF4B 2H3QA 5HR7A 1HIWA 2KHQA 2LKYA 2CPRA 3LYSA 3PZPA 1Z19A 3H0MB 3F5EA 2VIXA 3ONNA 4P0QA 2JMGA 2M0NA 2Q4TA 4U6PA 1PVRA 3LVWA 3O0FA 2W7PA 3GZFA 2HBKA 4FZNA 2JHDA 2LHTA 2ZIWA 1OUQA 2A3VA 2KD1A 3ALRA 3F5AA 4NLCA 4OJ6A 2YB1A 2XI9A 2HOFA 5CRXA 3AQFA 2G0AA 4GFJA 3NUQA 2E1EA 2YB4A 2H3VA 2ZXIA 4BX9C 2K4IA 3L3FX 3AL0B 2JH1A 2OYYA 2RHFA 4NWIA 3CYMA 2KJ8A 3IG8A 2ZIUB 4QNLA 4O3MA 3N7RC 1KBUA 2K4EA 1YT3A 3VC8A 3K1ZA 2K8CB 2H3FA 2VKQA 2KVCA 2Z7JA 1WUDA 2KKVA 2F8LA 2GH1A 2K8BB 3IG5A 2LBOA 2KJ9A 2LYBA 3VCBA 4U7CA 1XO0A 4IC9A 3LVVA 2F76X 2LYAA 3NRWA 1DRGA 2RP5A 4QIWC 2G09A 4P0QB 2ZG6A 2Y0SF 3D2SA 2Y0SC 1ECWA 3C28A 1PVQA 1L6NA 3PSPA 3H0RB 2ZIWB 5KL8B 2K4HA 4C0ZA 2HBLA 3KZXA 4OO1J 3OPXA 2HOIA 2XVTA 1F44A 2HOQA 3M6ZA 2WB1C 4FE3A 4QJFB 3HKZC 4CGZA 3N7PD 4PL1A 3SAHA 1PVPA 2K89A 3PSFA 2D6FC 5KL1B 2DGZA 4CRXA 2XIDA 3ICXA 3IP4B 2ZIVA 2WAQC 3M7DA 1SZHA 4AYBC 2E1FA 1HEKA 2ZIXA 4KMOB 3KFUF 1ZQ1C 2KKPA 2OM6A 4BUGA 2G5HB 4ACOA 4QIWF 1T94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5S A;  3D2Q A;  3D2N A;  3D2S A; 
#chains in the Genus database with same CATH topology
 5J0Q A;  4ED0 A;  1DK2 A;  4I27 A;  5J2C A;  1A6S A;  3SV4 A;  1OW5 A;  3RAQ A;  4FO6 A;  2Q0Z X;  4O3Q A;  1ZRN A;  1SKS A;  4PPX A;  2WB1 F;  2AXT U;  4NM2 A;  3RJI A;  4YR2 A;  3ZD9 A;  4IL6 U;  2W03 A;  3RJH A;  2FMS A;  3M9N B;  2EZY A;  2RQ5 A;  2K60 A;  4QZA A;  2I5H A;  3T79 A;  2V9W A;  5J2G A;  5AM5 A;  3MR6 A;  4YN4 A;  3RH5 A;  1C20 A;  1BPY A;  1V9P A;  2BPG A;  5J8Y C;  4USA A;  2F44 A;  3KD3 A;  5AKH A;  2BPC A;  5KFR A;  4NL9 C;  8ICI A;  1B4F A;  1L3U A;  2ZIW A;  8ICB A;  3H8J A;  3V7K A;  3AQF A;  4GFJ A;  5J0W A;  2YB4 A;  3AN1 A;  1NJY A;  2R8G A;  4G3I A;  3C23 A;  4NWI A;  5AK4 A;  4TUS A;  5KFF A;  5HNK A;  4KMU A;  3UMB A;  3VC8 A;  3N28 A;  2P66 A;  2Y9U A;  4KLQ A;  4KLG A;  2G09 A;  5HHH A;  3GV8 B;  2ZG6 A;  1SV0 A;  3PML A;  3B0X A;  5EE3 A;  1U45 A;  5KFU A;  5AM2 A;  4Y2V A;  3TKA A;  4PGY A;  4EEY A;  2WTF A;  1F0M A;  3EZ5 A;  2FLL A;  2HHV A;  1ZQG A;  3C5F A;  5KAI U;  2IMW P;  2G5H B;  5ALU A;  4M9H A;  7ICN A;  3MR3 A;  2YX8 A;  2BDU A;  3N97 B;  3PSI A;  1J2M A;  3NGD A;  4ECV A;  3JPR A;  9ICE A;  4LZD A;  5E79 U;  4DQS A;  1URJ A;  3L5K A;  3SI8 A;  2XY6 A;  3RFA A;  2WF5 A;  3PVX A;  4QZE A;  2JZB B;  7ICS A;  1D8L A;  7ICT A;  5DGA A;  4KIT B;  3QXG A;  3TAP A;  4I2A A;  2KOB A;  3T5H A;  2NRT A;  2DL0 A;  1KLN A;  1FIQ A;  2DKX A;  2IOF K;  1NK5 A;  1UHU A;  4RPY A;  1DOQ A;  3M6K A;  3TFS A;  2D8C A;  1WWV A;  2IOF A;  5EWE A;  4DSF A;  3B0Y A;  4Y2Q A;  3MR5 A;  1DXS A;  1SL0 A;  2F1J A;  3PW4 A;  3UXP A;  2GO7 A;  1N48 A;  1J97 A;  3O0F A;  3KHH A;  3GV5 B;  1PK3 A;  3BZK A;  9ICF A;  2A3V A;  1KL9 A;  4DSL A;  4NY8 A;  4I2I A;  3JPS A;  5KG4 A;  1QH9 A;  2ASJ A;  3AL0 B;  2OYY A;  1BPZ A;  2CXY A;  4PZN A;  5KG2 A;  8ICF A;  4BWM A;  4R8U A;  4B9L A;  4QZI A;  3PR5 B;  1MQ3 A;  5AI0 A;  3IG5 A;  3DV9 A;  2ODG A;  5F9N A;  1FO4 A;  4QIW C;  4DQI A;  4M0A A;  3C1Y A;  3UM9 A;  4I2C A;  2HHW A;  4FS1 A;  2XVT A;  4FBT A;  4F3O A;  5J2F A;  4IR1 A;  3WKE A;  4RPX A;  3E2E A;  3UQ0 A;  5DB7 A;  3M8S A;  2JV3 A;  1O03 A;  4K4G A;  3TAD A;  3LWL A;  4MF2 A;  3F2D A;  4RZR A;  4C8O A;  5AKY A;  4ED3 A;  3HKZ F;  3AQE A;  2UVV A;  4KLD A;  2G08 A;  2HBJ A;  2KZ3 A;  3IN5 A;  5J2H A;  4YXJ A;  2ALZ A;  3ZDA A;  2ZIV B;  3C1Z A;  1IM4 A;  3K1R B;  4YXM A;  2JEG A;  5AKZ A;  2ZTC A;  2ZTD A;  2ZIX B;  1NKB A;  2RDJ A;  5J2A A;  5DBA A;  2EAM A;  5HHI A;  2HSZ A;  5KT7 A;  4YD2 A;  1LVH A;  2I6X A;  2VJ5 A;  2MUT B;  1TK0 A;  4MHV A;  4FBU A;  2EAP A;  1ZQL A;  2V4R A;  5ALO A;  1ZQJ A;  5HMM A;  5KFZ A;  1A77 A;  3PX0 A;  2LKY A;  2CPR A;  3D6J A;  4Y2R A;  3QEA Z;  1U4B A;  4Z6C A;  2AQ4 A;  7ICL A;  1Z4O A;  4DL6 A;  4EYH B;  1T3Q A;  3BZC A;  5AI5 A;  5KG1 A;  2RHF A;  5DG9 A;  3BQ1 A;  4KLT A;  1YT3 A;  4US9 A;  5ALP A;  3C2M A;  4DQR A;  3EW9 A;  1U47 A;  4EZ9 A;  8ICV A;  4IC9 A;  1UT8 A;  3EWA A;  1ECW A;  2BCU A;  9ICV A;  2HHS A;  4C80 A;  4BGD A;  2UVR A;  4F8R A;  1YZ6 A;  4CGZ A;  3FAH A;  2A1J A;  4EX7 A;  4PHD A;  1ZJM A;  3AMZ A;  3M1Y A;  3V7L A;  5ALF A;  2WAQ C;  1LKY A;  5AM4 A;  5KFQ A;  1VDV A;  4GC6 A;  2YMQ A;  1IIP A;  2OXO A;  1X9S A;  2FJ6 A;  4UAZ A;  4KX5 A;  3PV8 A;  3UMG A;  4J9S A;  3OSN A;  4GIB A;  5L1K A;  8ICY A;  3H4D A;  3K4G A;  2OEH A;  1XNS A;  2IHM A;  2W7O A;  1X9M A;  3WKB A;  4CDG A;  4DOC A;  4JB3 A;  4DSI A;  2BR0 A;  9ICC A;  4NLN A;  2DUY A;  4ED6 A;  8ICJ A;  1TAU A;  3AM9 A;  4Y2S A;  4FZM A;  1XSN A;  4UAV A;  4UAY A;  4F4Y A;  4B9S A;  4A8E A;  2KIW A;  3RR8 A;  5J8Y A;  7ICM A;  3PO4 A;  3PY8 A;  3RB3 A;  4GLX A;  4MFC A;  4F5Q A;  4NL9 A;  4OJ6 A;  3V6K A;  2FPM A;  2EH9 A;  2K4I A;  1S77 D;  8ICN A;  2QB0 A;  1KTQ A;  1X6J A;  3MR2 A;  3MFI A;  4QNL A;  1SXD A;  1ZET A;  2YMM A;  3N4M B;  4YFK A;  5KG5 A;  3KKA C;  3SZ2 A;  2K8B B;  2NYV A;  8ICM A;  3NRW A;  4EZ6 A;  3Q8S B;  1BGX T;  2Y0S F;  1ZQD A;  2KTQ A;  2ZIW B;  3OPX A;  2BZF A;  1SWW A;  2FDR A;  5CB1 A;  4Y2P A;  5AKX A;  4PL1 A;  5JRT A;  2W8K A;  2WF7 A;  4DF8 A;  3JPP A;  3IRU A;  1ARO P;  4QIW F;  3TFR A;  1NK4 A;  1FEZ A;  4YMN A;  3RJG A;  3EUB 2;  4J9O A;  4KLF A;  4RQ0 A;  2BCQ A;  5IIN A;  4IRK A;  3SD7 A;  2XCP A;  5T14 A;  1XS9 D;  5J29 A;  3T5L A;  4UB2 A;  3TI0 A;  3BS7 A;  2HMX A;  4UAT A;  4F5N A;  2AU0 A;  3IM1 A;  2KZZ A;  1P7D A;  3HWT A;  3V6H A;  4UAW A;  2YY6 A;  1RYS A;  5DB9 A;  1PUZ A;  5DB6 A;  3PW5 A;  4QWC A;  1SKW A;  7ICV A;  3LYS A;  5KT4 A;  1HUO A;  2ISO A;  3GFK B;  5JU5 A;  2ISP A;  4NLC A;  2XI9 A;  2W3S A;  5B5E U;  4IQW A;  5J0P A;  2QKQ A;  2G0A A;  4CNQ A;  2D3D A;  1TV9 A;  8ICK A;  1QQ5 A;  5EWG A;  1NNL A;  3QNM A;  3BS5 A;  2KKV A;  5DB8 A;  4ZOH C;  4CF3 A;  3ZDE A;  4IR9 A;  7ICF A;  3H7I A;  3HIL A;  3C28 A;  1L3V A;  5BOM A;  3CNH A;  5CR0 A;  1Q8K A;  2ZUD A;  3RBD A;  1N5W A;  3PW0 A;  3B9J A;  3SAH A;  3V72 A;  3PSF A;  2DKZ A;  4R8U B;  4MFA A;  1ZQY A;  2XID A;  3MGH A;  2V4Q A;  1U9L A;  8ICT A;  1B0X A;  4RQ2 A;  1NI3 A;  4ECS A;  1JIH A;  2OM6 A;  5AKE A;  4UB4 A;  2KK0 A;  4OJO A;  4RQ8 A;  3N7S C;  3ISD A;  4TUQ A;  7ICP A;  2JGA A;  5ALV A;  4KLO A;  5KFD A;  5CP2 A;  5KFB A;  2FMQ A;  5KFJ A;  5J2E A;  2F2A B;  5AKG A;  5KFL A;  2PFQ A;  2WAQ F;  4F72 A;  2FLN A;  2JXJ A;  1ZQO A;  2ZTE A;  4LZG A;  2KNJ A;  1A0P A;  2KIV A;  4R64 A;  2HHQ A;  9ICX A;  3DDH A;  1ZD5 A;  1MQ2 A;  3ORY A;  3QX7 A;  3MFH A;  4C8L A;  4B9T A;  2K8A A;  3BQ0 A;  2KSO A;  5TIS U;  1HUZ A;  1JN3 A;  4QZD A;  5D4B A;  4P0Q A;  4QWE A;  2FE9 A;  3ALR A;  5CRX A;  1JXL A;  1SGG A;  3L3F X;  4QZ8 A;  4P2H A;  1ZD3 A;  4DL2 A;  9ICJ A;  1N62 A;  2KFZ A;  2Z7J A;  4RQN A;  3VCB A;  2LYA A;  3NTU A;  2XGP A;  1XSP A;  4TUP A;  5DLF A;  4Q43 A;  2Y1J A;  3PSP A;  2VAN A;  9ICQ A;  1FFU A;  5TZV A;  4DSJ A;  1ZQU A;  1F44 A;  3FM9 A;  2E3T A;  4EBD A;  1EXN A;  4FFD A;  5AHX A;  1JAL A;  2KMD A;  4CF4 A;  2LPE A;  1BPX A;  4Z6F A;  5KFP A;  3LDA A;  1ZQS A;  3SEI A;  1D9F A;  4Y2T A;  2G06 A;  1BPB A;  2ASD A;  3AUO A;  1S0M A;  2KHV A;  2HHU A;  4O3P A;  2A1J B;  2DPJ A;  2HW3 A;  4YCX A;  4P0P A;  4KX3 A;  1ZQT A;  2E5S A;  2KZM A;  8ICH A;  1LKY B;  3DEE A;  3NVW A;  1LV5 A;  2KG5 A;  5J0U A;  4IRC A;  4DFM A;  2R18 A;  2NRX A;  2ZXH A;  4DSK A;  4J9P A;  4J9L A;  3KOO A;  2IHN A;  4P4M A;  4ELU A;  2KEY A;  2CRX A;  1NK7 A;  3UXO A;  2F1I A;  2W9C A;  4JK1 A;  3HX0 A;  4NV0 A;  4M04 A;  1MSW D;  3HPO A;  2BQU A;  2WF6 A;  3PZP A;  4I2F A;  1S76 D;  1DGS A;  4PHP A;  2QAR A;  2JRZ A;  2P6R A;  3GZF A;  1NKC A;  2HOF A;  3L4P A;  3M8R A;  1X40 A;  9ICA A;  1L3S A;  2B6G A;  4C8K A;  5FP0 A;  2Y1I A;  4K4H A;  2H3F A;  3KBB A;  4U7C A;  2FMP A;  1X9X A;  3KKA A;  1L3T A;  3RH6 A;  2Y0S C;  1PVQ A;  2VA8 A;  3RJK A;  5J0T A;  5AK3 A;  3KZX A;  4PGX A;  1ZQA A;  4OO1 J;  2HOI A;  8ICA A;  1QQ6 A;  3GIK A;  4UBB A;  2QB0 B;  1AQ6 A;  4QJF B;  1RXW A;  4RT2 A;  3H8M A;  3JPN A;  9ICI A;  5J0O A;  4KLJ A;  5AK6 A;  4DL3 A;  1BVS A;  3PW2 A;  4QWD A;  1U49 A;  1T3N A;  4KMO B;  4O5E A;  1IV8 A;  4GC7 A;  1WWU A;  1NZB A;  3GQC A;  2M9N A;  9ICL A;  4YMM A;  5KFT A;  3QU4 A;  5ALX A;  4EX6 A;  4PH5 A;  1N63 A;  2AQ0 A;  3F2B A;  1D8Y A;  5J0X A;  1ZQN A;  2BCS A;  2H5X A;  2L5Y A;  5CWR A;  2E8M A;  3WKD A;  4QZH A;  1D8B A;  8ICG A;  3AEV A;  4DLE A;  1Q3U A;  5CJ7 A;  9ICP A;  1TFR A;  4OJ5 A;  2BQ3 A;  4RQ6 A;  9ICH A;  4C4T A;  1SB3 C;  1SZP A;  1KFT A;  3F2C A;  3K75 D;  4B9V A;  4BWJ A;  2O6K A;  4QZB A;  2PFN A;  4F93 B;  4ED8 A;  4O3O A;  4UB1 A;  2W9M A;  5AM0 A;  3QU5 A;  4FZN A;  1ZOL A;  4KLH A;  4XQ8 A;  1ZQQ A;  2B21 A;  3NVV A;  2KJ8 A;  3C5G A;  5L1I A;  3ZDB A;  2K4E A;  3TAR A;  2EZX A;  3T3F A;  4KN7 A;  2C2R A;  1WUD A;  2F3N A;  4JV2 A;  5CA7 A;  2F76 X;  1ZD2 P;  8ICE A;  2ZJ8 A;  3PO5 A;  4ECW A;  2C28 A;  2NRZ A;  4M2Y A;  4F4K A;  1KEJ A;  5IIO A;  1RQL A;  5DKW A;  2YMP A;  5IIJ A;  4LJX A;  2I1Q A;  5ALW A;  3IP4 B;  3BS5 B;  1HEK A;  3KFU F;  2PFO A;  5ALR A;  3MDA A;  3U26 A;  1Z1V A;  4OJP A;  1TK8 A;  3KHR A;  2W9A A;  2KFN A;  2MA1 A;  4YG2 A;  2AH5 A;  2H3I A;  3M9O B;  9ICR A;  2XCA A;  5AIC A;  3LK9 A;  2H3Z A;  2NO5 A;  1TAQ A;  5AKK A;  3BQ2 A;  2A19 A;  1JRO A;  2J6S A;  1WG8 A;  2GWS A;  4DFD A;  5AIA A;  5DGB A;  3OHA A;  5KFI A;  1VJ5 A;  1NJX A;  2YQE A;  3WU2 U;  4O3R A;  9ICK A;  4TQS A;  2G07 A;  3MBY A;  4GXK A;  3EPI A;  2DQN B;  2NV3 A;  7ICG A;  4C4R A;  1Z19 A;  3H0M B;  4KLS A;  1ZQF A;  4O5C A;  5KFW A;  4C8N A;  4PZO A;  2JHD A;  1Z3E B;  1DGJ A;  2B0C A;  1ZQC A;  2YB1 A;  2E8O A;  1BNO A;  5EE9 A;  3RR7 A;  1KSP A;  4RUA A;  4R66 A;  5CHG A;  2JH1 A;  4QZC A;  4F5O A;  4YMO A;  9ICB A;  1UQV A;  4RNO A;  3Q8P B;  4Q8F A;  5EOZ A;  2KSO B;  1XO0 A;  2F1H A;  4GXJ A;  3I1Y A;  4P0Q B;  4EEN A;  9ICT A;  4C8M A;  4Q44 A;  4BDP A;  1L8L A;  1ZQP A;  4QWA A;  4IQU A;  8ICW A;  2PI4 A;  4EBC A;  2JEI A;  3N7P D;  4PJ0 U;  4MF8 A;  2QLT A;  4EEL A;  4DL7 A;  4Z6D A;  9ICO A;  2VA2 A;  4E0D A;  2OHF A;  1UCV A;  2KV2 A;  3AU6 A;  1J2N A;  4M9G A;  3V6J A;  1ED1 A;  2BQR A;  4R63 A;  4C7Y A;  3KHG A;  4F92 B;  1OXJ A;  2AGP A;  2GOL A;  2P35 A;  4M9N A;  4P4P A;  3BQ7 A;  4ECR A;  5KT2 A;  2J6U A;  2W3R A;  3MGV A;  4BXO A;  5DDY A;  1TK5 A;  4JWN A;  5L1L A;  3UMC A;  3MC1 A;  5ALQ A;  5KNI A;  5L1J A;  4M47 A;  2F77 X;  4I2J A;  3GIJ A;  2ZUB A;  3SAF A;  2XY7 A;  3SMV A;  2AGO A;  1T4G A;  5EE1 A;  4P0P B;  2DF4 B;  2LYH A;  2HCF A;  2M0N A;  4U6P A;  2HBK A;  2OCE A;  1WCL A;  3MDC A;  1TVA A;  3NUQ A;  2ZXI A;  3WKC A;  4ECZ A;  9ICS A;  3GIL A;  5KTQ A;  1TKD A;  4F2R A;  5KAF U;  1T8E A;  1RM6 C;  2W9C B;  2F8L A;  5ALG A;  4TQR A;  1UT5 A;  3LVV A;  3LWM A;  2RP5 A;  2QAR B;  2KP7 A;  4TUR A;  2ATL A;  1JMS A;  4OD0 A;  1WYG A;  3ZDD A;  1ZQI A;  5KL8 B;  4G9B A;  4C0Z A;  5KFA A;  3EYZ A;  4PGQ A;  4RNM A;  1X9W A;  5CEH A;  2UVW A;  5AKI A;  3TAQ A;  4FE3 A;  4YR3 A;  3ZI4 A;  1NJZ A;  2E8P A;  3HW8 A;  3QU2 A;  3HP6 A;  4DFP A;  4F91 B;  1A76 A;  1T7P A;  3QEB Z;  4M9L A;  4BUG A;  5KFC A;  1JXE A;  4DL5 A;  2KN7 A;  5C0Y A;  1C7Y A;  3GII A;  3NVY A;  1ZQW A;  1S0O A;  1WCN A;  1XO1 A;  1Y88 A;  4RU9 A;  9ICW A;  4J9K A;  4ELT A;  3RH4 A;  3JPO A;  3SEN A;  5AI8 A;  3A0H U;  4US8 A;  1K1S A;  2EQY A;  5AI4 A;  1NK9 A;  5EWF A;  4C4S A;  1SKR A;  5HR6 A;  4M6W A;  2DBY A;  3Q8K A;  5DG8 A;  3MAB A;  2J6T A;  2MRL A;  4O3N A;  2JH7 A;  5DQH A;  1BPD A;  4WJ3 B;  1KRP A;  4F50 A;  5ALL A;  5ALD A;  3NRZ A;  5J2B A;  3PX6 A;  5HR7 A;  2RLT A;  2PI5 A;  4O3S A;  1PK1 A;  2ASL A;  1NK8 A;  1V38 A;  2W9B A;  5KG3 A;  2ZJ5 A;  4RQ3 A;  1RPL A;  3PMN A;  1HJP A;  3K1Z A;  2VKQ A;  2KVC A;  4IQV A;  1S97 A;  1ZQH A;  1ZQZ A;  1DRG A;  1NK6 A;  2R8J A;  4J9N A;  2PFP A;  4KN4 A;  2W43 A;  4I2D A;  1X66 A;  5J0S A;  4JWM A;  1RG6 A;  2HOQ A;  2MSN A;  1RYR A;  2KVS A;  5JTI A;  1KN5 A;  4ECQ A;  1XWL A;  4DCC A;  3KZI U;  4UB8 U;  3KTQ A;  3E58 A;  3Q8M A;  4NLZ A;  2FPL A;  1ZQK A;  4I2G A;  4I2H A;  5F3X B;  5DBC A;  1NK0 A;  3PR4 A;  5J0Y A;  3JPQ A;  2BCR A;  3D2N A;  1NOM A;  3UPQ A;  5AI6 A;  3OTQ A;  1F5S A;  1B43 A;  1N5X A;  2EAN A;  3ED5 A;  4UBC A;  2HVH A;  3UQ2 A;  4Q45 A;  2PMZ C;  5F9L A;  2YTU A;  1D9D A;  2F8K A;  4ECY A;  2G5I B;  1SXE A;  2KJ5 A;  3OJS A;  5IIL A;  3IHQ B;  3GU3 A;  2HBM A;  4O9M A;  1GO3 F;  3WK8 A;  4F5P A;  2ZIU A;  2AHO B;  4YR0 A;  3R9K A;  2OWO A;  4IS7 A;  7ICO A;  1ZQM A;  2Y9T A;  5AKL A;  2Q4T A;  2P6U A;  3I76 A;  2PXI A;  2A1A A;  2W7P A;  8ICR A;  4HYK A;  4I29 A;  5KT3 A;  4MEX A;  4UB5 A;  4KLU A;  1CI4 A;  1QLN A;  3WK5 A;  5KFE A;  1L7N A;  2IOH A;  4BX9 C;  1X6I A;  3QUQ A;  5ALE A;  3WK9 A;  5IIK A;  1CUK A;  2JR5 A;  3FYH A;  4I2E A;  3FC4 A;  1JUD A;  4MEY A;  5J2J A;  2DFL A;  1Z4N A;  2HHX A;  1XSL A;  4ELV A;  2K4H A;  3PNC A;  4RPZ A;  3IV6 A;  1ZQV A;  3THV A;  2UVU A;  2BDP A;  1QQ7 A;  4YVZ A;  5DG7 A;  3RAX A;  2D6F C;  3H8W A;  2PKE A;  3ICX A;  1RDF A;  4AYB C;  1KQQ A;  5ALS A;  2KKP A;  3ETL A;  3Q8Q B;  4DS4 A;  3TAN A;  4ACO A;  4OCZ A;  1PZN A;  3C29 A;  5J2K A;  3ISB A;  1COO A;  2KIC A;  5ALH A;  1QSS A;  1S0N A;  3G6V A;  1N56 A;  3QU9 A;  4P4O A;  3T5J A;  1MA7 A;  4QWB A;  2ES6 A;  5BPC A;  4J9M A;  3F53 A;  3ISC A;  4DQQ A;  2WF8 A;  2HVI A;  3QZ7 A;  1SWV A;  3A0B U;  5IIM A;  2BPF A;  4C7Z A;  3RJE A;  3GIM A;  1M6Y A;  4PL2 A;  2EAO A;  2ZJA A;  1ZXI A;  9ICG A;  1QCK A;  1Z00 B;  3SAG A;  1ZD4 A;  4R65 A;  3QE9 Y;  2CN1 A;  2YN4 A;  8ICP A;  2VJ4 A;  3WK7 A;  2H3Q A;  3ETR A;  4UB6 U;  7ICE A;  1PVR A;  2JMG A;  2LM4 A;  4EYI B;  4BXO B;  2KD1 A;  4NM1 A;  1QTM A;  5ALT A;  8ICQ A;  1VLB A;  4B9U A;  2MAX A;  2H3V A;  4RNN A;  2BKE A;  3CYM A;  3HJE A;  3OSP A;  4KLM A;  3KHL A;  1K5O A;  3N7R C;  3OGU A;  8ICZ A;  5KFV A;  4RT3 A;  3FDS A;  2BCV A;  1B22 A;  3H8S A;  1QSY A;  5K4L A;  4IQT A;  2HBL A;  3H40 A;  4F5R A;  2XY5 A;  3QUT A;  5JUM A;  1IG6 A;  2XGQ A;  2WHE A;  1ZRM A;  2XC9 A;  5ALN A;  4QZF A;  2NRV A;  4Y2J A;  5BOL A;  5KFX A;  2W04 A;  4UAR A;  2WF9 A;  9ICM A;  2OH2 A;  8ICC A;  4JMU A;  7ICJ A;  4ICA A;  1LB2 B;  3HRD D;  3RJJ A;  3RRH A;  1BPE A;  4RQM A;  3CP8 A;  9ICN A;  2NRW A;  4BJQ A;  4QZ9 A;  4I28 A;  2RDI A;  3PX4 A;  1SV4 A;  3JPT A;  1UPH A;  5KFS A;  1CRX A;  3T5K A;  4UB3 A;  4O5K A;  3CRX A;  1L7P A;  4JV0 A;  3GDX A;  3E0F A;  4Z6E A;  5G5G A;  3H0L B;  1KDH A;  4YP3 A;  4Y2Y A;  3PST A;  2AGQ A;  4ED1 A;  5H2F U;  2E8N A;  4ECX A;  2PMZ F;  4JV1 A;  2ESE A;  1DK3 A;  1TE2 A;  3LVW A;  5ALI A;  4DOA A;  2W8L A;  1ZYQ A;  4M6W B;  2NO4 A;  4F71 A;  5J0R A;  4GXI A;  2E1E A;  3C21 A;  4NLK A;  3IG8 A;  2EZZ A;  3EPG A;  4O0I A;  2DWQ A;  3RB4 A;  7ICH A;  3WK6 A;  3G6X A;  5AI9 A;  2GH1 A;  4XRH A;  5G5H A;  3BDP A;  2KJ9 A;  2LYB A;  1MC8 A;  2WFA A;  1SV0 C;  2HHT A;  1S0V A;  3G6Y A;  2I9G A;  2AJQ A;  4X5V A;  5HML A;  8ICO A;  3QUC A;  4QW9 A;  1PK1 B;  2W55 A;  5ALJ A;  5B66 U;  2W9B B;  2C2E A;  4I2B A;  4Q8E A;  5DQG A;  2WB1 C;  1S8O A;  1RZT A;  2JZB A;  3BQT A;  2R8I A;  1PVP A;  4DFK A;  3MGI A;  4F4X A;  2DGZ A;  3RRG A;  4CRX A;  4M9J A;  3ZDC A;  4NXZ A;  3V7J A;  2W54 A;  3M7D A;  1SZH A;  1KFS A;  1ZQB A;  4Y2X A;  5D49 A;  5KFY A;  1ZQ1 C;  4UAU A;  5EE0 A;  2FLP A;  3RB0 A;  5D46 A;  2R8K A;  2HI0 A;  1X42 A;  4CF5 A;  4DFJ A;  2RRD A;  3I28 A;  3D2Q A;  3RF9 A;  5A0L A;  4NJ8 A;  4F2S A;  1V97 A;  3QU7 A;  3J81 j;  1L8O A;  1SL1 A;  3SQI A;  5AM3 A;  2MU2 A;  4HAI A;  3C2K A;  4UAS A;  3Q8R B;  3SR6 A;  5KG6 A;  4DEZ A;  4IRD A;  4FZL A;  4UW9 A;  1YZ7 A;  4AYB F;  4QW8 A;  5KFG A;  3HT3 A;  1JX4 A;  3CW2 C;  3GV7 B;  1Z1B A;  2N1R A;  1KKX A;  1Z00 A;  2R8H A;  5J2D A;  4RQ1 A;  2DPI A;  3QUB A;  2W11 A;  3BJY A;  3Q8L A;  4OJL A;  4QZG A;  4XA5 A;  2BGW A;  2KE7 A;  5KFM A;  1TAM A;  3RJF A;  2FI1 A;  2KHQ A;  5L9X A;  5DQI A;  5KFN A;  4RQ5 A;  2VIX A;  5KT6 A;  3ONN A;  5ALZ A;  4DOB A;  5AK5 A;  1X2I A;  8ICS A;  3F5A A;  2LM1 A;  4LVS A;  4J9R A;  1L7M A;  1U48 A;  2JEF A;  3H4B A;  5KFH A;  2ZIU B;  4EEK A;  3SV3 A;  5HP4 A;  2BHN A;  3WK4 A;  5DBB A;  4ECT A;  5AM1 A;  4EBE A;  2HDO A;  4RUC A;  3NVZ A;  1L6N A;  5AIB A;  3H0R B;  5KG7 A;  1SL2 A;  4RQ4 A;  3RB6 A;  1JRP A;  1O08 A;  1ZQR A;  3QZ8 A;  7ICR A;  3RBE A;  4K4I A;  1COK A;  4DO9 A;  4DS5 A;  2QB1 A;  4FS2 A;  3TAC B;  4RQ7 A;  2ZIV A;  1NZP A;  5ALK A;  3NS1 A;  2FPK A;  2EDU A;  4KTQ A;  1S5L U;  3M9M B;  1T94 A;  2ZIX A;  1Q3V A;  1H38 A;  1ZQE A;  3TAD C;  5KFO A;  1NKE A;  1N60 A;  1UA1 A;  3QYP A;  5III A;  4PHA A;  4F4W A;  2MUT A;  1SIJ A;  4ED7 A;  1Q46 A;  2LMR A;  4DF4 A;  5J2I A;  1ZQX A;  1L7O A;  5C5J A;  4Y2U A;  4DSE A;  2C2D A;  3SYZ A;  1FFV A;  1CEZ A;  5L1M A;  1XC9 A;  1V85 A;  2XIC A;  2YML A;  2C22 A;  2JEJ A;  8ICU A;  4J03 A;  1IXR A;  5DDM A;  4YQW A;  9ICU A;  3OJU A;  7ICI A;  4B9N A;  4NLB A;  3UXN A;  3S6J A;  5DLG A;  1JI7 A;  2GLE A;  4CE6 A;  5AKJ A;  5GTI U;  4XUS A;  4J9Q A;  1QSL A;  1RYU A;  3IDW A;  3C2L A;  7ICQ A;  5GTH U;  4JUZ A;  1BNP A;  1HIW A;  4DWI A;  3NAS A;  1S10 A;  7ICU A;  3F5E A;  2IBK A;  3AU2 A;  4AP9 A;  4KLE A;  4B6J A;  1OUQ A;  2LHT A;  3OHB A;  1ZJN A;  2K4P A;  5KFK A;  4MFF A;  5KG0 A;  4ED2 A;  1KFD A;  2XO7 A;  4DQP A;  2ZUC A;  3ZD8 A;  8ICX A;  4UQG A;  3RTV A;  1RXV A;  2LI6 A;  4O3M A;  1K1Q A;  1KBU A;  4B9M A;  2IA6 A;  4PHE A;  2K8C B;  3WKA A;  2LBO A;  1XU4 A;  4DLG A;  4ZH4 A;  1RQN A;  3D2S A;  3PW7 A;  4KLI A;  8ICL A;  1UA0 A;  7ICK A;  1KW4 A;  1N61 A;  4CCH A;  5KT5 A;  3M6Z A;  3HKZ C;  1N2X A;  4NLG A;  1NJW A;  4DL4 A;  2K89 A;  5KL1 B;  1L5U A;  2VA3 A;  4KLL A;  3TQ1 A;  1MN8 A;  5ALM A;  4ECU A;  2E1F A;  5ALY A;  4YD1 A;  1S9F A;  4F4Z A; 
#chains in the Genus database with same CATH homology
 2YX8 A;  2BDU A;  4OJO A;  1Q3V A;  3C29 A;  3PSI A;  3N7S C;  3D2N A;  5C0Y A;  1NZB A;  2KV2 A;  2RRD A;  1IIP A;  2OXO A;  2KIC A;  2JGA A;  4OJP A;  3D2Q A;  3RF9 A;  5A0L A;  4KX5 A;  2W04 A;  1ED1 A;  1MA7 A;  2G06 A;  1URJ A;  3F2D A;  2OH2 A;  1A6S A;  2MA1 A;  4JMU A;  3RFA A;  3F53 A;  3SQI A;  2WB1 F;  2GOL A;  2F2A B;  2KHV A;  2H3I A;  2PMZ C;  3AQE A;  3HKZ F;  4ICA A;  2G08 A;  3F2B A;  2HBJ A;  3IN5 A;  4P0P A;  4KX3 A;  2H3Z A;  5T14 A;  4FZL A;  2E5S A;  2W03 A;  2G5I B;  2WAQ F;  3CP8 A;  4PL2 A;  2ZIV B;  4AYB F;  2W7O A;  1XNS A;  1D8B A;  4BJQ A;  3DEE A;  4CDG A;  1Q3U A;  2KNJ A;  2KJ5 A;  5HR6 A;  1A0P A;  3MGV A;  2ZIX B;  1UPH A;  1CRX A;  2HMX A;  2R18 A;  4OJ5 A;  2XIC A;  1Z1B A;  2KOB A;  2N1R A;  3CRX A;  2ZXH A;  3E0F A;  3GU3 A;  3T79 A;  2HBM A;  1GO3 F;  3SAG A;  2MRL A;  3H0L B;  3M6K A;  2JH7 A;  4FZM A;  1P7D A;  4NLB A;  2KEY A;  2F77 X;  2VJ5 A;  4WJ3 B;  2CN1 A;  2CRX A;  4OJL A;  2ZIU A;  3PST A;  3F2C A;  2G07 A;  3SAF A;  2PMZ F;  2K8A A;  3SMV A;  2KIW A;  4A8E A;  1TAM A;  2VJ4 A;  2DQN B;  2NV3 A;  4NV0 A;  4P0P B;  2DF4 B;  2H3Q A;  5HR7 A;  1HIW A;  2KHQ A;  2LKY A;  2CPR A;  3LYS A;  3PZP A;  1Z19 A;  3H0M B;  3F5E A;  2VIX A;  3ONN A;  4P0Q A;  2JMG A;  2M0N A;  2Q4T A;  4U6P A;  1PVR A;  3LVW A;  3O0F A;  2W7P A;  3GZF A;  2HBK A;  4FZN A;  2JHD A;  2LHT A;  2ZIW A;  1OUQ A;  2A3V A;  2KD1 A;  3ALR A;  3F5A A;  4NLC A;  4OJ6 A;  2YB1 A;  2XI9 A;  2HOF A;  5CRX A;  3AQF A;  2G0A A;  4GFJ A;  3NUQ A;  2E1E A;  2YB4 A;  2H3V A;  2ZXI A;  4BX9 C;  2K4I A;  3L3F X;  3AL0 B;  2JH1 A;  2OYY A;  2RHF A;  4NWI A;  3CYM A;  2KJ8 A;  3IG8 A;  2ZIU B;  4QNL A;  4O3M A;  3N7R C;  1KBU A;  2K4E A;  1YT3 A;  3VC8 A;  3K1Z A;  2K8C B;  2H3F A;  2VKQ A;  2KVC A;  2Z7J A;  1WUD A;  2KKV A;  2F8L A;  2GH1 A;  2K8B B;  3IG5 A;  2LBO A;  2KJ9 A;  2LYB A;  3VCB A;  4U7C A;  1XO0 A;  4IC9 A;  3LVV A;  2F76 X;  2LYA A;  3NRW A;  1DRG A;  2RP5 A;  4QIW C;  2G09 A;  4P0Q B;  2ZG6 A;  2Y0S F;  3D2S A;  2Y0S C;  1ECW A;  3C28 A;  1PVQ A;  1L6N A;  3PSP A;  3H0R B;  2ZIW B;  5KL8 B;  2K4H A;  4C0Z A;  2HBL A;  3KZX A;  4OO1 J;  3OPX A;  2HOI A;  2XVT A;  1F44 A;  2HOQ A;  3M6Z A;  2WB1 C;  4FE3 A;  4QJF B;  3HKZ C;  4CGZ A;  3N7P D;  4PL1 A;  3SAH A;  1PVP A;  2K89 A;  3PSF A;  2D6F C;  5KL1 B;  2DGZ A;  4CRX A;  2XID A;  3ICX A;  3IP4 B;  2ZIV A;  2WAQ C;  3M7D A;  1SZH A;  4AYB C;  2E1F A;  1HEK A;  2ZIX A;  4KMO B;  3KFU F;  1ZQ1 C;  2KKP A;  2OM6 A;  4BUG A;  2G5H B;  4ACO A;  4QIW F;  1T94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...