3D2QA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
DRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding, rna binding protein
molecule keywords Muscleblind-like protein 1
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2qA00
3D2QA 3D2SA 3D2NA 2E5SA
chains in the Genus database with same CATH superfamily
4MF8A 2H3VA 3LK9A 1QLNA 4EBDA 8ICHA 5AKGA 4F2SA 3QYPA 1ZQ1C 2IMWP 5KFFA 4X5VA 2R8HA 1V97A 2YX8A 5ALYA 3PNCA 3DEEA 4C7YA 4BJQA 3B9JA 2RQ5A 4E0DA 5ALDA 1WCLA 4PHDA 3GIMA 1ECWA 2I9GA 1MSWD 2AGOA 5KT7A 1VLBA 5KFZA 3UMGA 1NK6A 4KLMA 2KZZA 1IG6A 4KLEA 3RH6A 5C0YA 1PZNA 2UVUA 4ECVA 2WB1F 3EW9A 8ICLA 1NOMA 4UB2A 3RJIA 1HJPA 3Q8MA 7ICIA 4BWJA 5KFOA 2K60A 5AM4A 4NM2A 1ZQGA 3GIJA 4PL1A 3RAQA 3SAGA 3Q8PB 5KFLA 2LHTA 1NK9A 1DXSA 4FBTA 3TADC 2NRVA 3OPXA 3MFHA 3KOOA 4NL9C 3PX0A 1B0XA 3V7JA 2A3VA 3GV7B 1U4BA 2JEJA 9ICXA 5L1JA 3RBDA 5ALOA 5AIAA 5J2GA 4O5CA 8ICJA 4J9RA 3BQ0A 1S9FA 2W8LA 4US8A 7ICRA 5DB7A 4ED0A 5DG8A 2R8GA 4FZLA 5AK5A 4UAWA 4DFPA 9ICLA 1QSYA 2OWOA 1ZJMA 1OW5A 4EBEA 1TK8A 2E1FA 5L9XA 8ICKA 3KFUF 1LKYA 4OJOA 4F8RA 5DG7A 2KSOA 4RT3A 3LYSA 4FS2A 2R8KA 1XO1A 3C28A 2RRDA 7ICFA 4CF4A 4M0AA 3JPOA 2KIWA 1J2MA 2WAQF 3UXPA 3BDPA 1FIQA 4M9LA 1QSSA 3NUQA 8ICEA 1ZQVA 4Q8FA 4BXOB 1BPEA 1KKXA 3EWAA 5KL1B 2EAMA 3RJJA 1FEZA 2HHTA 1Z4OA 2W11A 1S0OA 2PI5A 2LPEA 3JPTA 3D2QA 4QZGA 1AQ6A 3T5KA 4KMUA 3T3FA 3Q8KA 4CDGA 2NV3A 5AK4A 5KFRA 9ICCA 4ECRA 2Z7JA 2D3DA 2DBYA 4JV1A 1T3QA 5AM3A 2C22A 3RR8A 2JZBB 1RXWA 2ZUCA 2BPFA 4O3MA 4R63A 1D9FA 4K4HA 5J0TA 4GFJA 4QWBA 4M6WB 1ZQXA 4RPYA 4ED1A 3RJEA 1KBUA 4FO6A 1RQNA 1TAUA 2P6UA 4DF8A 4QW8A 3WK4A 2LM1A 3TKAA 3QNMA 1T94A 1UQVA 3L4PA 3UMCA 2AJQA 5DQGA 5ALPA 3KHLA 2OXOA 5KFYA 8ICIA 2F77X 8ICCA 9ICJA 2HHVA 5DQIA 2W03A 4DFJA 1ZQHA 9ICTA 1DOQA 5AKXA 5AKKA 4F71A 3H0MB 1JALA 3B0YA 2Y9UA 2KJ5A 3V7LA 5AI5A 3MR2A 4F92B 3LVVA 4Y2TA 3N7SC 4QWAA 3V6KA 5IINA 4F2RA 2IBKA 2AHOB 5KAIU 1SIJA 4NLNA 4EEKA 2JXJA 4QZCA 1X9MA 4C80A 1NK7A 5AKEA 4P0PA 4P4MA 1MA7A 3N28A 5J2CA 2HW3A 3JPRA 2F1IA 5EE9A 2ZG6A 3H8MA 4WJ3B 4KN7A 4QZBA 4YD2A 2ZXIA 5ALGA 4ECZA 5KFMA 1ZQRA 4GXIA 4UAUA 2P66A 4F4XA 4KLSA 4BGDA 3JPSA 1RZTA 4C8OA 4C4SA 1O03A 3HKZF 2A1JA 1S5LU 4I2GA 2KSOB 3NGDA 3E58A 4IQTA 3WK7A 1A77A 3V6HA 1COOA 4Z6CA 4YR2A 3PO4A 2GH1A 3WU2U 3OGUA 1LV5A 4QWCA 3PVXA 3ALRA 1ZQKA 2WF8A 3ICXA 2XGPA 3WK5A 3ZD8A 4YMMA 2VA8A 1ZQCA 3D2NA 3RH5A 3CNHA 2M9NA 3KTQA 4P2HA 1UCVA 5AKIA 4F5NA 4JV2A 1XO0A 1K5OA 1A76A 4RQ5A 5IIIA 3CP8A 3TACB 4YMOA 4DFKA 2G5HB 4KLDA 3GU3A 1N56A 3RB4A 3EYZA 2ZIVA 2KICA 1D8LA 3A0BU 1OUQA 4UW9A 4UASA 2RLTA 8ICQA 2H3ZA 2K4EA 4PGXA 5DLFA 2LYHA 3MDCA 2JEGA 1JI7A 4KLJA 1C20A 1VJ5A 5IIOA 3SZ2A 3NTUA 4ED2A 3V7KA 7ICLA 4J9KA 4R8UA 1IXRA 4EX7A 2F8LA 5KT4A 5J0PA 4R64A 2E8PA 1Z1VA 3MR3A 3PO5A 2RHFA 5KFTA 4KLTA 2BCVA 2FJ6A 1LVHA 4QZ9A 3PW5A 5AI0A 4R65A 1L3UA 1QH9A 3NASA 3WKAA 1DK3A 2HSZA 3SR6A 2D6FC 3TQ1A 5CJ7A 1Q8KA 4C8NA 1NK5A 7ICKA 3Q8RB 4RQMA 4QZFA 2HOQA 1PVPA 4NLGA 1SZHA 1L3SA 2BR0A 3SYZA 5J2FA 4ED8A 2MUTA 1KL9A 2NYVA 3RB0A 1HEKA 2Y1IA 4RQNA 2RDIA 2YB4A 2E5SA 4DF4A 2NO5A 5BOLA 2WB1C 3DDHA 1NJYA 3HP6A 1S8OA 3M1YA 3QU4A 3RAXA 4O3PA 9ICSA 2OEHA 2K4IA 9ICAA 2ZXHA 4YCXA 3RTVA 4DL3A 3GILA 3AM9A 3TAQA 3F5EA 1A0PA 3FC4A 5J2IA 2HBJA 3BZCA 1RYUA 4CNQA 4P0PB 1RDFA 3E2EA 1TV9A 2C28A 2DKZA 4NXZA 4KITB 1FFUA 3E0FA 4YXJA 3PR5B 4GIBA 3OHBA 3M6ZA 1ZQAA 4EX6A 3GIIA 4JUZA 4OJ5A 3KZXA 2HVIA 9ICOA 2HBMA 4UB3A 4M9HA 3HWTA 3LVWA 3NRWA 4DQIA 1X42A 2XC9A 3MC1A 4DL2A 5J0OA 5CR0A 1NI3A 2BPGA 3MGIA 5KFVA 2PKEA 1T3NA 1TKDA 4IL6U 1YZ6A 5AI8A 5J0XA 4KMOB 3IM1A 2H3FA 4NJ8A 1NJZA 3RJGA 2HDOA 4HAIA 4JWNA 5EWEA 1SWVA 5AI9A 1X6IA 4BWMA 4RPZA 4CGZA 5C5JA 1L7OA 2WAQC 4DCCA 2HHUA 1ZQJA 2HHSA 4OJ6A 2GLEA 3KZIU 4ZOHC 2RP5A 9ICWA 3H0LB 9ICUA 5F9LA 1SB3C 3ZDAA 3RJHA 4TQSA 2ZIVB 4I2FA 5KFPA 5EWFA 5ALMA 4MFCA 3T5HA 1NJWA 1QTMA 8ICTA 3KHGA 2HI0A 4FFDA 5J2JA 3MFIA 4R8UB 1DRGA 4TURA 2J6UA 5KFIA 1BNOA 3FYHA 2N1RA 3IRUA 1VDVA 5HR7A 1XC9A 4GC6A 2MSNA 1TK0A 4UB4A 4UAVA 1JXEA 1ZQBA 2K4PA 3TAPA 4K4IA 2ZTEA 4EENA 3LWLA 4UBCA 2IHMA 1X40A 3T5JA 3HT3A 3ED5A 4UAYA 3LWMA 2K4HA 2LYAA 2Y1JA 3OSPA 3GV8B 5KG6A 2EANA 2O6KA 5CA7A 3JPPA 3Q8LA 2Y9TA 2MUTB 2ZTDA 2A19A 5AM0A 2LI6A 8ICAA 2PFOA 3TANA 4UARA 5EOZA 7ICPA 2G06A 4KLGA 1ZQSA 5J2DA 2FPKA 1JX4A 1CRXA 4F3OA 1Y88A 3MGVA 2BCQA 1JMSA 3OSNA 1WCNA 2WHEA 4O3QA 1ZQTA 1D8YA 2YMMA 1F0MA 3HW8A 2YMQA 2QB0A 4M6WA 2OH2A 2P35A 3B0XA 2KJ8A 2E1EA 5DBAA 2QARA 4PHAA 5FP0A 1M6YA 1NNLA 1QSLA 2JRZA 4DEZA 2ALZA 3QZ7A 3SAFA 1SL1A 4PGQA 1NKCA 1TE2A 2F3NA 1XNSA 5HMMA 2E3TA 3ONNA 3KHRA 3ZD9A 1BNPA 1XSLA 2DQNB 5KFJA 3HKZC 3RJFA 1ZQWA 3N97B 5KAFU 5KFCA 4B6JA 4F72A 3G6YA 4YMNA 9ICKA 2ZUDA 3D6JA 1RXVA 2AH5A 4C8MA 2HHQA 4DL6A 5KFDA 2DPJA 1WWVA 5JRTA 3H40A 2ESEA 3PZPA 2FMPA 4PZNA 3FAHA 2PFNA 5J8YC 4B9MA 4MHVA 1V9PA 3ZDEA 5DLGA 4Y2JA 2FMSA 4B9UA 1X9XA 3HJEA 3PR4A 1Q46A 2KVSA 2XIDA 2BCSA 5ALHA 1NK4A 4KLLA 2IHNA 1JROA 2HBLA 5G5GA 2BKEA 3M8SA 1ZYQA 4DOCA 8ICRA 2VA3A 1OXJA 4MFAA 5GTIU 3U26A 4JK1A 3HX0A 4O5KA 1CUKA 5EE3A 5J0SA 4PPXA 4F91B 4F5PA 4G3IA 3LDAA 3J81j 4JB3A 3KKAA 4IR1A 3TI0A 3C29A 2BDUA 3N7PD 3GDXA 4B9NA 3BQTA 2Y0SF 4LVSA 2XI9A 2BGWA 2FPMA 1N48A 2KIVA 1NK8A 4GC7A 4J9OA 3QUQA 2XCPA 4DFMA 3QU9A 2ASJA 3RRHA 4AYBC 5TISU 4Y2RA 1MQ2A 4RNMA 3IDWA 3CRXA 1N63A 4GXJA 4RZRA 7ICSA 1ZQOA 5KFHA 4P4OA 5AKJA 2DUYA 5K4LA 2LYBA 4B9VA 1SGGA 2JR5A 2XY6A 2BZFA 2ZJ5A 2A1AA 4J9SA 3PV8A 2ZIUB 3M9OB 2W3SA 1A6SA 1K1SA 2FMQA 2QB0B 3IG8A 4KLIA 4LJXA 4R66A 3PW7A 2QARB 1TFRA 1URJA 4XQ8A 4B9LA 5BOMA 2K89A 1FFVA 5TZVA 5J2HA 1YT3A 2BDPA 2I1QA 1L8OA 4C4RA 2XO7A 1ZQMA 2UVWA 1RYSA 3WKDA 4DS5A 1ZQUA 3K4GA 2W9CA 3SEIA 5J29A 3BS7A 5J0QA 4RQ6A 2R18A 3PSIA 4J9NA 3K75D 2QB1A 4YXMA 2OM6A 2PMZF 1ZQYA 1ZQQA 4LZGA 3SENA 1Z00A 3F53A 5KT6A 4F4KA 2BCUA 2UVVA 2ES6A 4O5EA 2LMRA 4RPXA 3UQ2A 2JV3A 1S0NA 2G08A 2OHFA 4MEYA 2C2EA 2AXTU 4RQ7A 1U48A 9ICGA 3UMBA 4DQRA 4IRDA 1KRPA 4O3OA 8ICOA 4EYHB 3H8WA 2W43A 2F1JA 4ECYA 4XUSA 3PX4A 2IA6A 8ICGA 4UB1A 1ZOLA 2EAPA 4DOAA 2AU0A 3GZFA 4PL2A 2ZIWA 2DWQA 1MC8A 3TFRA 3QUCA 3HRDD 2MAXA 3OJUA 1RQLA 1RYRA 3O0FA 1XS9D 4DOBA 3MGHA 1DGSA 5J0RA 9ICQA 5DG9A 1KFDA 4BDPA 1F5SA 3KKAC 2E8OA 4ECWA 2XICA 5KFSA 2V4RA 1K1QA 4AP9A 5G5HA 2EZXA 2HBKA 1N60A 2W9AA 2PFQA 2F2AB 7ICUA 3IG5A 2HCFA 4XRHA 4RNOA 3QU7A 3ETLA 4O3SA 3AEVA 5ALLA 3L5KA 4CE6A 2ASDA 1DK2A 2MA1A 4QZIA 1BPDA 2GWSA 3H7IA 1RM6C 3R9KA 4DSEA 1SV4A 2KV2A 2ZJAA 4ED3A 7ICGA 2YB1A 4I2IA 2P6RA 4O3RA 3NVWA 7ICEA 5KG0A 4PHPA 3RRGA 2W9BA 4IR9A 2DL0A 1D8BA 1J97A 5KFNA 4RQ0A 4NLKA 1QQ6A 5JUMA 3H4BA 5AICA 4JWMA 4DS4A 4EYIB 3M6KA 5DBBA 1U45A 1Q3VA 4I2EA 3EPIA 5EE0A 3PY8A 1ZETA 3BJYA 8ICPA 3C2LA 4I2DA 5KT5A 8ICWA 2W9CB 4DL7A 5ALRA 8ICVA 2OYYA 2W04A 3AQFA 2E8NA 5J0UA 1KEJA 1B4FA 1DGJA 4ED7A 4PH5A 4C8KA 2FLPA 2K8CB 2ODGA 2H3QA 1Z00B 3ZI4A 3T79A 4DLEA 3PMLA 1SZPA 3QZ8A 4KLFA 1COKA 4Z6DA 4C0ZA 4RQ4A 1IIPA 5J0WA 4QZHA 4CF3A 5DGBA 2H5XA 1KLNA 4A8EA 4OJLA 4TQRA 3RJKA 2IOFA 3F2BA 4Q43A 1BPXA 2JMGA 1O08A 4PJ0U 2J6SA 4F5RA 4F5QA 2MRLA 4QWDA 5D49A 3MR6A 1C7YA 2EDUA 5DGAA 2KJ9A 3Q8QB 3NVVA 1Q3UA 2VKQA 2C2RA 1IM4A 1KDHA 4TUPA 1JUDA 3C23A 4GLXA 4YR3A 3H4DA 3FM9A 4GXKA 2ZIWB 4QJFB 2R8IA 7ICNA 2YMLA 3AQEA 2XY7A 4B9SA 3KD3A 2KG5A 3C2MA 5JU5A 4OCZA 2IOFK 4TUSA 3SV4A 3SQIA 4UB6U 1RPLA 1JN3A 3PW0A 4QNLA 9ICVA 2AQ0A 5ALXA 3UXOA 1SKRA 1BPYA 2DFLA 4DO9A 2CRXA 2PFPA 4P4PA 1T7PA 4BUGA 2AQ4A 4RT2A 2HVHA 3ORYA 2Y0SC 1UT8A 4ELVA 4QIWF 1XWLA 4K4GA 2JEFA 8ICXA 2AGPA 4KN4A 2BHNA 5KFUA 3TADA 3ETRA 4EZ6A 4ED6A 2ATLA 1N5WA 3H8SA 2XVTA 1QCKA 3FDSA 3AU6A 5T14A 1L8LA 2KOBA 2KZ3A 2W9BB 4NY8A 1N2XA 2W3RA 2EZZA 5L1KA 8ICYA 4M04A 2EH9A 3I28A 2KHVA 1B43A 2HOFA 3QE9Y 4F5OA 1NKEA 5CEHA 4C7ZA 1SWWA 2NRZA 5ALWA 5CB1A 2DF4B 4EBCA 2FLLA 5J2AA 4QZ8A 3RR7A 3GIKA 1IV8A 5AK3A 4QZAA 3SMVA 2EZYA 2DKXA 2KNJA 5KFXA 2QLTA 3M9NB 5KG4A 1X2IA 3D2SA 2B6GA 1ZXIA 2GOLA 4J9MA 9ICEA 4DQQA 5CRXA 3AU2A 2JHDA 4YN4A 5AK6A 1UA1A 4RUAA 4J9PA 4Y2YA 2PXIA 4ELTA 3M7DA 4DSKA 4YVZA 3THVA 3V72A 1SXEA 2PMZC 1PK1A 4J9LA 1X66A 4Y2QA 3H8JA 3ZDDA 2KFNA 3UQ0A 2XCAA 1SV0A 3ISBA 5J2BA 8ICUA 1ED1A 4F93B 1UA0A 5JTIA 2WTFA 4DQPA 3BQ1A 1KFSA 5DB9A 5AKYA 1CEZA 4IQVA 2ZIUA 2HHXA 3QU2A 4FZMA 5A0LA 1QQ7A 1SXDA 1UHUA 1TVAA 4FBUA 1TAQA 3RFAA 3T5LA 2ASLA 4Z6EA 3NRZA 4PHEA 1H38A 2NO4A 4UBBA 2HMXA 2VA2A 2DPIA 3WKEA 1FO4A 1ZRMA 5EE1A 5KFQA 5AHXA 5ALQA 4UQGA 3F2CA 3UM9A 4M47A 1JXLA 3A0HU 4ICAA 4Y2XA 3AN1A 5CHGA 1V38A 3UPQA 1NKBA 4YG2A 4NLCA 5KG3A 4RQ2A 2G07A 2EQYA 2BPCA 5ALVA 1QQ5A 2JH7A 5D46A 3F5AA 5AKZA 1ZQDA 1BGXT 4HYKA 2R8JA 1NZPA 3MR5A 9ICBA 3VCBA 4OJPA 4FE3A 4CRXA 8ICSA 4NLZA 4I2BA 1XSPA 4J9QA 5F3XB 2RDJA 4B9TA 7ICHA 3PW4A 3QXGA 1JIHA 4OO1J 1N5XA 4F4WA 3G6VA 3V6JA 2WF5A 3SV3A 2QKQA 1L3VA 5AM5A 1L3TA 3GFKB 1Z3EB 4I27A 5ALKA 5E79U 8ICNA 3WKCA 5GTHU 4RNNA 2FI1A 1ZD4A 2BQRA 1S0MA 3JPQA 7ICOA 3SD7A 1PUZA 3AUOA 4ELUA 1NJXA 2KE7A 1MQ3A 5KFAA 1S97A 5DB6A 4DL4A 4KX3A 2GO7A 4FS1A 1SKWA 3EUB2 8ICFA 9ICPA 4IRCA 1P7DA 2UVRA 2D8CA 2I6XA 7ICVA 1N62A 2ISPA 4QZEA 4I28A 4Q45A 5IIKA 5AM2A 3QU5A 1GO3F 1U47A 4DFDA 3M9MB 5KG2A 1PK1B 2LKYA 5IIMA 3OTQA 2K8BB 1ZQLA 1T4GA 5H2FU 5ALJA 4UATA 5F9NA 2AGQA 4YFKA 2V4QA 5AM1A 2WF7A 3C2KA 5CP2A 4FZNA 4Y2UA 3ZDCA 5DBCA 3QUBA 3BS5A 3IHQB 3BQ7A 4EELA 1HIWA 2BQUA 2W9MA 1SV0C 4KLHA 3PSFA 4OD0A 2IOHA 5KNIA 4C8LA 3PMNA 3WK8A 1XU4A 1CI4A 2E8MA 2B0CA 5ALNA 9ICHA 3F2DA 1BPBA 3CYMA 2ZTCA 4Y2PA 4UAZA 1BPZA 4ECSA 1WYGA 2ISOA 5IIJA 5ALZA 2WF6A 1KFTA 5HP4A 2KK0A 2ZIXA 3CW2C 3MDAA 2KTQA 3ISCA 3AMZA 3H0RB 5AKLA 3GV5B 3ZDBA 3IV6A 5DDMA 2XGQA 1B22A 1PVRA 1NK0A 1TK5A 4O3NA 3BZKA 4DLGA 9ICIA 2W7PA 3RF9A 4MEXA 4CCHA 4QIWC 1ZQZA 3UXNA 3BQ2A 2JEIA 4J03A 5KFWA 2YQEA 5AI6A 1SL2A 3PW2A 1L7NA 4US9A 1ZD2P 4KLQA 5B66U 2K8AA 1TAMA 1D9DA 5KG7A 3M8RA 4I29A 4I2HA 4DWIA 3NVZA 2M0NA 4IRKA 1L5UA 4M9GA 4QW9A 1J2NA 2W8KA 2OCEA 1SKSA 2FLNA 1U9LA 3QUTA 3L3FX 4YQWA 1KTQA 3EPGA 5KL8B 3WKBA 4QWEA 4C4TA 8ICMA 2CN1A 4U6PA 4RQ8A 2VIXA 5DB8A 2KMDA 2CXYA 3ISDA 5AKHA 2HHWA 2XY5A 4ACOA 3RBEA 2NRWA 3TFSA 4M2YA 1LKYB 2JH1A 2G5IB 1WUDA 2B21A 4KTQA 5KT2A 2NRXA 1ZJNA 4F4YA 3RB3A 5L1IA 4RU9A 5HMLA 4IS7A 3PSPA 2WFAA 1UPHA 2VJ4A 2VJ5A 3MBYA 3C21A 3HPOA 3RB6A 4I2AA 3RH4A 1ZRNA 1XSNA 2J6TA 3TARA 4I2JA 1ZQEA 2LBOA 5BPCA 1S76D 5EWGA 3S6JA 3K1RB 3BS5B 1X9SA 3HILA 4MF2A 4LZDA 2MU2A 4Q8EA 4XA5A 4IC9A 1LB2B 2NRTA 3KBBA 5ALUA 2W54A 2KFZA 2FE9A 4ECXA 5ALFA 4PGYA 3QEAZ 5B5EU 1UT5A 3WK9A 1MN8A 4TUQA 5AIBA 4P0QA 1S10A 5D4BA 1V85A 2ZIXB 3NS1A 2VANA 4M9NA 3I76A 3C1ZA 1T8EA 4EEYA 1HUOA 2L5YA 1YZ7A 3GQCA 4AYBF 4DSJA 5DDYA 4G9BA 1EXNA 4YP3A 4RQ3A 4YR0A 2KKPA 2LM4A 2FPLA 1SL0A 4JMUA 2KD1A 5L1LA 1AROP 5KFGA 3PSTA 4UB5A 1ZQFA 3AL0B 3C5GA 4DSFA 4ECUA 3NVYA 3QX7A 3IP4B 4M9JA 5ALIA 3JPNA 4MFFA 4NLBA 5L1MA 1WWUA 1RG6A 2EAOA 2FDRA 2PI4A 2JGAA 2KKVA 4JV0A 5J2EA 3Q8SB 8ICZA 2BCRA 1Z4NA 5KG1A 2HOIA 3OHAA 1HUZA 5J0YA 2ZJ8A 2KP7A 2KVCA 2F44A 1NZBA 2F8KA 5IILA 1ZD3A 2C2DA 5AI4A 2F76X 2YN4A 4I2CA 2YMPA 2A1JB 2KN7A 4IQUA 1L7PA 9ICFA 1L6NA 4IQWA 5HHIA 4PZOA 2YY6A 5ALEA 8ICBA 5CWRA 9ICRA 1PK3A 3OJSA 2KZMA 1KW4A 7ICQA 5J8YA 7ICJA 3G6XA 4NL9A 3SI8A 5HHHA 1KN5A 2W55A 1ZQNA 1S77D 4DSLA 4Y2VA 5KG5A 5KFEA 5ALSA 4DSIA 4KLUA 3DV9A 1PVQA 5J2KA 2KHQA 2Q4TA 3VC8A 2G09A 2DGZA 2I5HA 4U7CA 2BQ3A 4EZ9A 7ICMA 1N61A 2CPRA 2YTUA 4UB8U 2KEYA 1ZQIA 2WF9A 2W7OA 1F44A 4F4ZA 3QEBZ 2ZUBA 2V9WA 4P0QB 4YD1A 4RUCA 9ICNA 4DL5A 3C5FA 1U49A 4NV0A 1Z19A 9ICMA 3MABA 3N4MB 4O9MA 3N7RC 1Z1BA 5DQHA 7ICTA 1KSPA 1S0VA 5KT3A 5ALTA 4Y2SA 4ZH4A 4BX9C 1BVSA 1ZD5A 1X9WA 1ZQPA 2G0AA 3EZ5A 3K1ZA 3I1YA 5HNKA 4BXOA 4ECQA 2F1HA 5KFKA 3WK6A 1KQQA 1X6JA 4Z6FA 4RQ1A 5HR6A 4USAA 3PX6A 5KFBA 3IN5A 4QZDA 1JRPA 4CF5A 1WG8A 4O0IA 2H3IA 5KTQA 4DQSA 4NM1A 4F50A 1L7MA 5DKWA 2Q0ZX 4KLOA 3SAHA 3KHHA 4KX5A 4ECTA 2JZBA 3C1YA 4Q44A 4NWIA
chains in the Genus database with same CATH topology
3H0MB 2RRDA 2VKQA 2H3VA 2KJ5A 2JH7A 2G06A 2KNJA 4AYBF 3F5AA 2CN1A 4U6PA 1HIWA 1ZQ1C 2KIWA 2VIXA 2MA1A 4KMOB 2WAQF 3LVVA 1CRXA 3D2SA 2R18A 3PSIA 2H3FA 2GOLA 3N7SC 3PSFA 3MGVA 2F8LA 2KHQA 2KKPA 1PVQA 5CRXA 3VCBA 4OJPA 4ACOA 2YX8A 2ZIWB 2JHDA 2KV2A 4FE3A 4QJFB 4CRXA 2OM6A 2Q4TA 3VC8A 3DEEA 2G09A 2DGZA 2JH1A 3AQEA 2G5IB 2PMZF 2RHFA 2BDUA 2KD1A 2YB1A 3N7PD 4JMUA 1WUDA 4BJQA 4P0PA 4U7CA 1MA7A 5KL1B 3SQIA 4CGZA 3F2DA 4OO1J 2ZG6A 1ECWA 3F53A 2WAQC 4WJ3B 3M7DA 2CPRA 3CYMA 3PSTA 4OJ6A 2KEYA 3AL0B 4QNLA 2Y0SF 2RP5A 1D8BA 3PSPA 3D2QA 2D6FC 3H0LB 1UPHA 2G08A 2W7OA 2ZXIA 1F44A 2PMZC 2OH2A 3IP4B 2VJ4A 2XI9A 4CDGA 5C0YA 2VJ5A 5KL8B 2KJ8A 2E1EA 2NV3A 2ZIVB 2CRXA 4NLBA 2WB1F 4P0QB 3NUQA 3M6KA 4NV0A 2HOQA 2ZIXA 1Z19A 4BUGA 1PVPA 2Z7JA 1Q3VA 1SZHA 2JGAA 3HKZF 3SAFA 2Y0SC 4AYBC 2KKVA 3N7RC 2LBOA 1Z1BA 1ED1A 3H0RB 4QIWF 1XNSA 1HEKA 4PL1A 3SAGA 4O3MA 2YB4A 3CRXA 2LHTA 2E5SA 3ONNA 2WB1C 2HOIA 1PVRA 3OPXA 2ZIUA 4GFJA 4FZMA 2DQNB 5A0LA 2GH1A 4BX9C 3C29A 3HKZC 2KVCA 4KX3A 2K4IA 2W7PA 1DRGA 2OYYA 1NZBA 2G0AA 2W04A 3AQFA 3RF9A 2A3VA 2ZXHA 3GZFA 4QIWC 3RFAA 3ALRA 2N1RA 3K1ZA 4PL2A 2ZIWA 3F5EA 1P7DA 2LYBA 3ICXA 1KBUA 2F76X 4IC9A 5HR7A 2HMXA 2K8CB 1A0PA 2XVTA 2HBJA 4P0PB 3D2NA 3O0FA 2H3QA 5T14A 3T79A 1L6NA 2KOBA 3PZPA 1XO0A 1Q3UA 2ZIUB 3E0FA 2K8AA 1TAMA 3SMVA 1GO3F 3F2CA 5HR6A 3CP8A 1A6SA 3M6ZA 2G5HB 4FZLA 3GU3A 1IIPA 1T94A 2KHVA 3IG8A 4OJ5A 4C0ZA 3KZXA 3IN5A 2HOFA 2LKYA 2HBMA 2XICA 4ICAA 4OJLA 4A8EA 2K8BB 2ZIVA 2H3IA 2OXOA 3LVWA 2K4HA 2M0NA 3NRWA 4P0QA 1URJA 2KICA 2LYAA 2F77X 3F2BA 1OUQA 2HBKA 2E1FA 2XIDA 2DF4B 2K89A 2W03A 2ZIXB 3KFUF 2JMGA 3SAHA 2F2AB 4FZNA 4OJOA 3IG5A 2MRLA 4NLCA 2HBLA 4KX5A 3L3FX 1YT3A 2G07A 3LYSA 2H3ZA 2K4EA 2KJ9A 4NWIA 3C28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2Q A;  3D2S A;  3D2N A;  2E5S A; 
#chains in the Genus database with same CATH topology
 4MF8 A;  2H3V A;  3LK9 A;  1QLN A;  4EBD A;  8ICH A;  5AKG A;  4F2S A;  3QYP A;  1ZQ1 C;  2IMW P;  5KFF A;  4X5V A;  2R8H A;  1V97 A;  2YX8 A;  5ALY A;  3PNC A;  3DEE A;  4C7Y A;  4BJQ A;  3B9J A;  2RQ5 A;  4E0D A;  5ALD A;  1WCL A;  4PHD A;  3GIM A;  1ECW A;  2I9G A;  1MSW D;  2AGO A;  5KT7 A;  1VLB A;  5KFZ A;  3UMG A;  1NK6 A;  4KLM A;  2KZZ A;  1IG6 A;  4KLE A;  3RH6 A;  5C0Y A;  1PZN A;  2UVU A;  4ECV A;  2WB1 F;  3EW9 A;  8ICL A;  1NOM A;  4UB2 A;  3RJI A;  1HJP A;  3Q8M A;  7ICI A;  4BWJ A;  5KFO A;  2K60 A;  5AM4 A;  4NM2 A;  1ZQG A;  3GIJ A;  4PL1 A;  3RAQ A;  3SAG A;  3Q8P B;  5KFL A;  2LHT A;  1NK9 A;  1DXS A;  4FBT A;  3TAD C;  2NRV A;  3OPX A;  3MFH A;  3KOO A;  4NL9 C;  3PX0 A;  1B0X A;  3V7J A;  2A3V A;  3GV7 B;  1U4B A;  2JEJ A;  9ICX A;  5L1J A;  3RBD A;  5ALO A;  5AIA A;  5J2G A;  4O5C A;  8ICJ A;  4J9R A;  3BQ0 A;  1S9F A;  2W8L A;  4US8 A;  7ICR A;  5DB7 A;  4ED0 A;  5DG8 A;  2R8G A;  4FZL A;  5AK5 A;  4UAW A;  4DFP A;  9ICL A;  1QSY A;  2OWO A;  1ZJM A;  1OW5 A;  4EBE A;  1TK8 A;  2E1F A;  5L9X A;  8ICK A;  3KFU F;  1LKY A;  4OJO A;  4F8R A;  5DG7 A;  2KSO A;  4RT3 A;  3LYS A;  4FS2 A;  2R8K A;  1XO1 A;  3C28 A;  2RRD A;  7ICF A;  4CF4 A;  4M0A A;  3JPO A;  2KIW A;  1J2M A;  2WAQ F;  3UXP A;  3BDP A;  1FIQ A;  4M9L A;  1QSS A;  3NUQ A;  8ICE A;  1ZQV A;  4Q8F A;  4BXO B;  1BPE A;  1KKX A;  3EWA A;  5KL1 B;  2EAM A;  3RJJ A;  1FEZ A;  2HHT A;  1Z4O A;  2W11 A;  1S0O A;  2PI5 A;  2LPE A;  3JPT A;  3D2Q A;  4QZG A;  1AQ6 A;  3T5K A;  4KMU A;  3T3F A;  3Q8K A;  4CDG A;  2NV3 A;  5AK4 A;  5KFR A;  9ICC A;  4ECR A;  2Z7J A;  2D3D A;  2DBY A;  4JV1 A;  1T3Q A;  5AM3 A;  2C22 A;  3RR8 A;  2JZB B;  1RXW A;  2ZUC A;  2BPF A;  4O3M A;  4R63 A;  1D9F A;  4K4H A;  5J0T A;  4GFJ A;  4QWB A;  4M6W B;  1ZQX A;  4RPY A;  4ED1 A;  3RJE A;  1KBU A;  4FO6 A;  1RQN A;  1TAU A;  2P6U A;  4DF8 A;  4QW8 A;  3WK4 A;  2LM1 A;  3TKA A;  3QNM A;  1T94 A;  1UQV A;  3L4P A;  3UMC A;  2AJQ A;  5DQG A;  5ALP A;  3KHL A;  2OXO A;  5KFY A;  8ICI A;  2F77 X;  8ICC A;  9ICJ A;  2HHV A;  5DQI A;  2W03 A;  4DFJ A;  1ZQH A;  9ICT A;  1DOQ A;  5AKX A;  5AKK A;  4F71 A;  3H0M B;  1JAL A;  3B0Y A;  2Y9U A;  2KJ5 A;  3V7L A;  5AI5 A;  3MR2 A;  4F92 B;  3LVV A;  4Y2T A;  3N7S C;  4QWA A;  3V6K A;  5IIN A;  4F2R A;  2IBK A;  2AHO B;  5KAI U;  1SIJ A;  4NLN A;  4EEK A;  2JXJ A;  4QZC A;  1X9M A;  4C80 A;  1NK7 A;  5AKE A;  4P0P A;  4P4M A;  1MA7 A;  3N28 A;  5J2C A;  2HW3 A;  3JPR A;  2F1I A;  5EE9 A;  2ZG6 A;  3H8M A;  4WJ3 B;  4KN7 A;  4QZB A;  4YD2 A;  2ZXI A;  5ALG A;  4ECZ A;  5KFM A;  1ZQR A;  4GXI A;  4UAU A;  2P66 A;  4F4X A;  4KLS A;  4BGD A;  3JPS A;  1RZT A;  4C8O A;  4C4S A;  1O03 A;  3HKZ F;  2A1J A;  1S5L U;  4I2G A;  2KSO B;  3NGD A;  3E58 A;  4IQT A;  3WK7 A;  1A77 A;  3V6H A;  1COO A;  4Z6C A;  4YR2 A;  3PO4 A;  2GH1 A;  3WU2 U;  3OGU A;  1LV5 A;  4QWC A;  3PVX A;  3ALR A;  1ZQK A;  2WF8 A;  3ICX A;  2XGP A;  3WK5 A;  3ZD8 A;  4YMM A;  2VA8 A;  1ZQC A;  3D2N A;  3RH5 A;  3CNH A;  2M9N A;  3KTQ A;  4P2H A;  1UCV A;  5AKI A;  4F5N A;  4JV2 A;  1XO0 A;  1K5O A;  1A76 A;  4RQ5 A;  5III A;  3CP8 A;  3TAC B;  4YMO A;  4DFK A;  2G5H B;  4KLD A;  3GU3 A;  1N56 A;  3RB4 A;  3EYZ A;  2ZIV A;  2KIC A;  1D8L A;  3A0B U;  1OUQ A;  4UW9 A;  4UAS A;  2RLT A;  8ICQ A;  2H3Z A;  2K4E A;  4PGX A;  5DLF A;  2LYH A;  3MDC A;  2JEG A;  1JI7 A;  4KLJ A;  1C20 A;  1VJ5 A;  5IIO A;  3SZ2 A;  3NTU A;  4ED2 A;  3V7K A;  7ICL A;  4J9K A;  4R8U A;  1IXR A;  4EX7 A;  2F8L A;  5KT4 A;  5J0P A;  4R64 A;  2E8P A;  1Z1V A;  3MR3 A;  3PO5 A;  2RHF A;  5KFT A;  4KLT A;  2BCV A;  2FJ6 A;  1LVH A;  4QZ9 A;  3PW5 A;  5AI0 A;  4R65 A;  1L3U A;  1QH9 A;  3NAS A;  3WKA A;  1DK3 A;  2HSZ A;  3SR6 A;  2D6F C;  3TQ1 A;  5CJ7 A;  1Q8K A;  4C8N A;  1NK5 A;  7ICK A;  3Q8R B;  4RQM A;  4QZF A;  2HOQ A;  1PVP A;  4NLG A;  1SZH A;  1L3S A;  2BR0 A;  3SYZ A;  5J2F A;  4ED8 A;  2MUT A;  1KL9 A;  2NYV A;  3RB0 A;  1HEK A;  2Y1I A;  4RQN A;  2RDI A;  2YB4 A;  2E5S A;  4DF4 A;  2NO5 A;  5BOL A;  2WB1 C;  3DDH A;  1NJY A;  3HP6 A;  1S8O A;  3M1Y A;  3QU4 A;  3RAX A;  4O3P A;  9ICS A;  2OEH A;  2K4I A;  9ICA A;  2ZXH A;  4YCX A;  3RTV A;  4DL3 A;  3GIL A;  3AM9 A;  3TAQ A;  3F5E A;  1A0P A;  3FC4 A;  5J2I A;  2HBJ A;  3BZC A;  1RYU A;  4CNQ A;  4P0P B;  1RDF A;  3E2E A;  1TV9 A;  2C28 A;  2DKZ A;  4NXZ A;  4KIT B;  1FFU A;  3E0F A;  4YXJ A;  3PR5 B;  4GIB A;  3OHB A;  3M6Z A;  1ZQA A;  4EX6 A;  3GII A;  4JUZ A;  4OJ5 A;  3KZX A;  2HVI A;  9ICO A;  2HBM A;  4UB3 A;  4M9H A;  3HWT A;  3LVW A;  3NRW A;  4DQI A;  1X42 A;  2XC9 A;  3MC1 A;  4DL2 A;  5J0O A;  5CR0 A;  1NI3 A;  2BPG A;  3MGI A;  5KFV A;  2PKE A;  1T3N A;  1TKD A;  4IL6 U;  1YZ6 A;  5AI8 A;  5J0X A;  4KMO B;  3IM1 A;  2H3F A;  4NJ8 A;  1NJZ A;  3RJG A;  2HDO A;  4HAI A;  4JWN A;  5EWE A;  1SWV A;  5AI9 A;  1X6I A;  4BWM A;  4RPZ A;  4CGZ A;  5C5J A;  1L7O A;  2WAQ C;  4DCC A;  2HHU A;  1ZQJ A;  2HHS A;  4OJ6 A;  2GLE A;  3KZI U;  4ZOH C;  2RP5 A;  9ICW A;  3H0L B;  9ICU A;  5F9L A;  1SB3 C;  3ZDA A;  3RJH A;  4TQS A;  2ZIV B;  4I2F A;  5KFP A;  5EWF A;  5ALM A;  4MFC A;  3T5H A;  1NJW A;  1QTM A;  8ICT A;  3KHG A;  2HI0 A;  4FFD A;  5J2J A;  3MFI A;  4R8U B;  1DRG A;  4TUR A;  2J6U A;  5KFI A;  1BNO A;  3FYH A;  2N1R A;  3IRU A;  1VDV A;  5HR7 A;  1XC9 A;  4GC6 A;  2MSN A;  1TK0 A;  4UB4 A;  4UAV A;  1JXE A;  1ZQB A;  2K4P A;  3TAP A;  4K4I A;  2ZTE A;  4EEN A;  3LWL A;  4UBC A;  2IHM A;  1X40 A;  3T5J A;  3HT3 A;  3ED5 A;  4UAY A;  3LWM A;  2K4H A;  2LYA A;  2Y1J A;  3OSP A;  3GV8 B;  5KG6 A;  2EAN A;  2O6K A;  5CA7 A;  3JPP A;  3Q8L A;  2Y9T A;  2MUT B;  2ZTD A;  2A19 A;  5AM0 A;  2LI6 A;  8ICA A;  2PFO A;  3TAN A;  4UAR A;  5EOZ A;  7ICP A;  2G06 A;  4KLG A;  1ZQS A;  5J2D A;  2FPK A;  1JX4 A;  1CRX A;  4F3O A;  1Y88 A;  3MGV A;  2BCQ A;  1JMS A;  3OSN A;  1WCN A;  2WHE A;  4O3Q A;  1ZQT A;  1D8Y A;  2YMM A;  1F0M A;  3HW8 A;  2YMQ A;  2QB0 A;  4M6W A;  2OH2 A;  2P35 A;  3B0X A;  2KJ8 A;  2E1E A;  5DBA A;  2QAR A;  4PHA A;  5FP0 A;  1M6Y A;  1NNL A;  1QSL A;  2JRZ A;  4DEZ A;  2ALZ A;  3QZ7 A;  3SAF A;  1SL1 A;  4PGQ A;  1NKC A;  1TE2 A;  2F3N A;  1XNS A;  5HMM A;  2E3T A;  3ONN A;  3KHR A;  3ZD9 A;  1BNP A;  1XSL A;  2DQN B;  5KFJ A;  3HKZ C;  3RJF A;  1ZQW A;  3N97 B;  5KAF U;  5KFC A;  4B6J A;  4F72 A;  3G6Y A;  4YMN A;  9ICK A;  2ZUD A;  3D6J A;  1RXV A;  2AH5 A;  4C8M A;  2HHQ A;  4DL6 A;  5KFD A;  2DPJ A;  1WWV A;  5JRT A;  3H40 A;  2ESE A;  3PZP A;  2FMP A;  4PZN A;  3FAH A;  2PFN A;  5J8Y C;  4B9M A;  4MHV A;  1V9P A;  3ZDE A;  5DLG A;  4Y2J A;  2FMS A;  4B9U A;  1X9X A;  3HJE A;  3PR4 A;  1Q46 A;  2KVS A;  2XID A;  2BCS A;  5ALH A;  1NK4 A;  4KLL A;  2IHN A;  1JRO A;  2HBL A;  5G5G A;  2BKE A;  3M8S A;  1ZYQ A;  4DOC A;  8ICR A;  2VA3 A;  1OXJ A;  4MFA A;  5GTI U;  3U26 A;  4JK1 A;  3HX0 A;  4O5K A;  1CUK A;  5EE3 A;  5J0S A;  4PPX A;  4F91 B;  4F5P A;  4G3I A;  3LDA A;  3J81 j;  4JB3 A;  3KKA A;  4IR1 A;  3TI0 A;  3C29 A;  2BDU A;  3N7P D;  3GDX A;  4B9N A;  3BQT A;  2Y0S F;  4LVS A;  2XI9 A;  2BGW A;  2FPM A;  1N48 A;  2KIV A;  1NK8 A;  4GC7 A;  4J9O A;  3QUQ A;  2XCP A;  4DFM A;  3QU9 A;  2ASJ A;  3RRH A;  4AYB C;  5TIS U;  4Y2R A;  1MQ2 A;  4RNM A;  3IDW A;  3CRX A;  1N63 A;  4GXJ A;  4RZR A;  7ICS A;  1ZQO A;  5KFH A;  4P4O A;  5AKJ A;  2DUY A;  5K4L A;  2LYB A;  4B9V A;  1SGG A;  2JR5 A;  2XY6 A;  2BZF A;  2ZJ5 A;  2A1A A;  4J9S A;  3PV8 A;  2ZIU B;  3M9O B;  2W3S A;  1A6S A;  1K1S A;  2FMQ A;  2QB0 B;  3IG8 A;  4KLI A;  4LJX A;  4R66 A;  3PW7 A;  2QAR B;  1TFR A;  1URJ A;  4XQ8 A;  4B9L A;  5BOM A;  2K89 A;  1FFV A;  5TZV A;  5J2H A;  1YT3 A;  2BDP A;  2I1Q A;  1L8O A;  4C4R A;  2XO7 A;  1ZQM A;  2UVW A;  1RYS A;  3WKD A;  4DS5 A;  1ZQU A;  3K4G A;  2W9C A;  3SEI A;  5J29 A;  3BS7 A;  5J0Q A;  4RQ6 A;  2R18 A;  3PSI A;  4J9N A;  3K75 D;  2QB1 A;  4YXM A;  2OM6 A;  2PMZ F;  1ZQY A;  1ZQQ A;  4LZG A;  3SEN A;  1Z00 A;  3F53 A;  5KT6 A;  4F4K A;  2BCU A;  2UVV A;  2ES6 A;  4O5E A;  2LMR A;  4RPX A;  3UQ2 A;  2JV3 A;  1S0N A;  2G08 A;  2OHF A;  4MEY A;  2C2E A;  2AXT U;  4RQ7 A;  1U48 A;  9ICG A;  3UMB A;  4DQR A;  4IRD A;  1KRP A;  4O3O A;  8ICO A;  4EYH B;  3H8W A;  2W43 A;  2F1J A;  4ECY A;  4XUS A;  3PX4 A;  2IA6 A;  8ICG A;  4UB1 A;  1ZOL A;  2EAP A;  4DOA A;  2AU0 A;  3GZF A;  4PL2 A;  2ZIW A;  2DWQ A;  1MC8 A;  3TFR A;  3QUC A;  3HRD D;  2MAX A;  3OJU A;  1RQL A;  1RYR A;  3O0F A;  1XS9 D;  4DOB A;  3MGH A;  1DGS A;  5J0R A;  9ICQ A;  5DG9 A;  1KFD A;  4BDP A;  1F5S A;  3KKA C;  2E8O A;  4ECW A;  2XIC A;  5KFS A;  2V4R A;  1K1Q A;  4AP9 A;  5G5H A;  2EZX A;  2HBK A;  1N60 A;  2W9A A;  2PFQ A;  2F2A B;  7ICU A;  3IG5 A;  2HCF A;  4XRH A;  4RNO A;  3QU7 A;  3ETL A;  4O3S A;  3AEV A;  5ALL A;  3L5K A;  4CE6 A;  2ASD A;  1DK2 A;  2MA1 A;  4QZI A;  1BPD A;  2GWS A;  3H7I A;  1RM6 C;  3R9K A;  4DSE A;  1SV4 A;  2KV2 A;  2ZJA A;  4ED3 A;  7ICG A;  2YB1 A;  4I2I A;  2P6R A;  4O3R A;  3NVW A;  7ICE A;  5KG0 A;  4PHP A;  3RRG A;  2W9B A;  4IR9 A;  2DL0 A;  1D8B A;  1J97 A;  5KFN A;  4RQ0 A;  4NLK A;  1QQ6 A;  5JUM A;  3H4B A;  5AIC A;  4JWM A;  4DS4 A;  4EYI B;  3M6K A;  5DBB A;  1U45 A;  1Q3V A;  4I2E A;  3EPI A;  5EE0 A;  3PY8 A;  1ZET A;  3BJY A;  8ICP A;  3C2L A;  4I2D A;  5KT5 A;  8ICW A;  2W9C B;  4DL7 A;  5ALR A;  8ICV A;  2OYY A;  2W04 A;  3AQF A;  2E8N A;  5J0U A;  1KEJ A;  1B4F A;  1DGJ A;  4ED7 A;  4PH5 A;  4C8K A;  2FLP A;  2K8C B;  2ODG A;  2H3Q A;  1Z00 B;  3ZI4 A;  3T79 A;  4DLE A;  3PML A;  1SZP A;  3QZ8 A;  4KLF A;  1COK A;  4Z6D A;  4C0Z A;  4RQ4 A;  1IIP A;  5J0W A;  4QZH A;  4CF3 A;  5DGB A;  2H5X A;  1KLN A;  4A8E A;  4OJL A;  4TQR A;  3RJK A;  2IOF A;  3F2B A;  4Q43 A;  1BPX A;  2JMG A;  1O08 A;  4PJ0 U;  2J6S A;  4F5R A;  4F5Q A;  2MRL A;  4QWD A;  5D49 A;  3MR6 A;  1C7Y A;  2EDU A;  5DGA A;  2KJ9 A;  3Q8Q B;  3NVV A;  1Q3U A;  2VKQ A;  2C2R A;  1IM4 A;  1KDH A;  4TUP A;  1JUD A;  3C23 A;  4GLX A;  4YR3 A;  3H4D A;  3FM9 A;  4GXK A;  2ZIW B;  4QJF B;  2R8I A;  7ICN A;  2YML A;  3AQE A;  2XY7 A;  4B9S A;  3KD3 A;  2KG5 A;  3C2M A;  5JU5 A;  4OCZ A;  2IOF K;  4TUS A;  3SV4 A;  3SQI A;  4UB6 U;  1RPL A;  1JN3 A;  3PW0 A;  4QNL A;  9ICV A;  2AQ0 A;  5ALX A;  3UXO A;  1SKR A;  1BPY A;  2DFL A;  4DO9 A;  2CRX A;  2PFP A;  4P4P A;  1T7P A;  4BUG A;  2AQ4 A;  4RT2 A;  2HVH A;  3ORY A;  2Y0S C;  1UT8 A;  4ELV A;  4QIW F;  1XWL A;  4K4G A;  2JEF A;  8ICX A;  2AGP A;  4KN4 A;  2BHN A;  5KFU A;  3TAD A;  3ETR A;  4EZ6 A;  4ED6 A;  2ATL A;  1N5W A;  3H8S A;  2XVT A;  1QCK A;  3FDS A;  3AU6 A;  5T14 A;  1L8L A;  2KOB A;  2KZ3 A;  2W9B B;  4NY8 A;  1N2X A;  2W3R A;  2EZZ A;  5L1K A;  8ICY A;  4M04 A;  2EH9 A;  3I28 A;  2KHV A;  1B43 A;  2HOF A;  3QE9 Y;  4F5O A;  1NKE A;  5CEH A;  4C7Z A;  1SWW A;  2NRZ A;  5ALW A;  5CB1 A;  2DF4 B;  4EBC A;  2FLL A;  5J2A A;  4QZ8 A;  3RR7 A;  3GIK A;  1IV8 A;  5AK3 A;  4QZA A;  3SMV A;  2EZY A;  2DKX A;  2KNJ A;  5KFX A;  2QLT A;  3M9N B;  5KG4 A;  1X2I A;  3D2S A;  2B6G A;  1ZXI A;  2GOL A;  4J9M A;  9ICE A;  4DQQ A;  5CRX A;  3AU2 A;  2JHD A;  4YN4 A;  5AK6 A;  1UA1 A;  4RUA A;  4J9P A;  4Y2Y A;  2PXI A;  4ELT A;  3M7D A;  4DSK A;  4YVZ A;  3THV A;  3V72 A;  1SXE A;  2PMZ C;  1PK1 A;  4J9L A;  1X66 A;  4Y2Q A;  3H8J A;  3ZDD A;  2KFN A;  3UQ0 A;  2XCA A;  1SV0 A;  3ISB A;  5J2B A;  8ICU A;  1ED1 A;  4F93 B;  1UA0 A;  5JTI A;  2WTF A;  4DQP A;  3BQ1 A;  1KFS A;  5DB9 A;  5AKY A;  1CEZ A;  4IQV A;  2ZIU A;  2HHX A;  3QU2 A;  4FZM A;  5A0L A;  1QQ7 A;  1SXD A;  1UHU A;  1TVA A;  4FBU A;  1TAQ A;  3RFA A;  3T5L A;  2ASL A;  4Z6E A;  3NRZ A;  4PHE A;  1H38 A;  2NO4 A;  4UBB A;  2HMX A;  2VA2 A;  2DPI A;  3WKE A;  1FO4 A;  1ZRM A;  5EE1 A;  5KFQ A;  5AHX A;  5ALQ A;  4UQG A;  3F2C A;  3UM9 A;  4M47 A;  1JXL A;  3A0H U;  4ICA A;  4Y2X A;  3AN1 A;  5CHG A;  1V38 A;  3UPQ A;  1NKB A;  4YG2 A;  4NLC A;  5KG3 A;  4RQ2 A;  2G07 A;  2EQY A;  2BPC A;  5ALV A;  1QQ5 A;  2JH7 A;  5D46 A;  3F5A A;  5AKZ A;  1ZQD A;  1BGX T;  4HYK A;  2R8J A;  1NZP A;  3MR5 A;  9ICB A;  3VCB A;  4OJP A;  4FE3 A;  4CRX A;  8ICS A;  4NLZ A;  4I2B A;  1XSP A;  4J9Q A;  5F3X B;  2RDJ A;  4B9T A;  7ICH A;  3PW4 A;  3QXG A;  1JIH A;  4OO1 J;  1N5X A;  4F4W A;  3G6V A;  3V6J A;  2WF5 A;  3SV3 A;  2QKQ A;  1L3V A;  5AM5 A;  1L3T A;  3GFK B;  1Z3E B;  4I27 A;  5ALK A;  5E79 U;  8ICN A;  3WKC A;  5GTH U;  4RNN A;  2FI1 A;  1ZD4 A;  2BQR A;  1S0M A;  3JPQ A;  7ICO A;  3SD7 A;  1PUZ A;  3AUO A;  4ELU A;  1NJX A;  2KE7 A;  1MQ3 A;  5KFA A;  1S97 A;  5DB6 A;  4DL4 A;  4KX3 A;  2GO7 A;  4FS1 A;  1SKW A;  3EUB 2;  8ICF A;  9ICP A;  4IRC A;  1P7D A;  2UVR A;  2D8C A;  2I6X A;  7ICV A;  1N62 A;  2ISP A;  4QZE A;  4I28 A;  4Q45 A;  5IIK A;  5AM2 A;  3QU5 A;  1GO3 F;  1U47 A;  4DFD A;  3M9M B;  5KG2 A;  1PK1 B;  2LKY A;  5IIM A;  3OTQ A;  2K8B B;  1ZQL A;  1T4G A;  5H2F U;  5ALJ A;  4UAT A;  5F9N A;  2AGQ A;  4YFK A;  2V4Q A;  5AM1 A;  2WF7 A;  3C2K A;  5CP2 A;  4FZN A;  4Y2U A;  3ZDC A;  5DBC A;  3QUB A;  3BS5 A;  3IHQ B;  3BQ7 A;  4EEL A;  1HIW A;  2BQU A;  2W9M A;  1SV0 C;  4KLH A;  3PSF A;  4OD0 A;  2IOH A;  5KNI A;  4C8L A;  3PMN A;  3WK8 A;  1XU4 A;  1CI4 A;  2E8M A;  2B0C A;  5ALN A;  9ICH A;  3F2D A;  1BPB A;  3CYM A;  2ZTC A;  4Y2P A;  4UAZ A;  1BPZ A;  4ECS A;  1WYG A;  2ISO A;  5IIJ A;  5ALZ A;  2WF6 A;  1KFT A;  5HP4 A;  2KK0 A;  2ZIX A;  3CW2 C;  3MDA A;  2KTQ A;  3ISC A;  3AMZ A;  3H0R B;  5AKL A;  3GV5 B;  3ZDB A;  3IV6 A;  5DDM A;  2XGQ A;  1B22 A;  1PVR A;  1NK0 A;  1TK5 A;  4O3N A;  3BZK A;  4DLG A;  9ICI A;  2W7P A;  3RF9 A;  4MEX A;  4CCH A;  4QIW C;  1ZQZ A;  3UXN A;  3BQ2 A;  2JEI A;  4J03 A;  5KFW A;  2YQE A;  5AI6 A;  1SL2 A;  3PW2 A;  1L7N A;  4US9 A;  1ZD2 P;  4KLQ A;  5B66 U;  2K8A A;  1TAM A;  1D9D A;  5KG7 A;  3M8R A;  4I29 A;  4I2H A;  4DWI A;  3NVZ A;  2M0N A;  4IRK A;  1L5U A;  4M9G A;  4QW9 A;  1J2N A;  2W8K A;  2OCE A;  1SKS A;  2FLN A;  1U9L A;  3QUT A;  3L3F X;  4YQW A;  1KTQ A;  3EPG A;  5KL8 B;  3WKB A;  4QWE A;  4C4T A;  8ICM A;  2CN1 A;  4U6P A;  4RQ8 A;  2VIX A;  5DB8 A;  2KMD A;  2CXY A;  3ISD A;  5AKH A;  2HHW A;  2XY5 A;  4ACO A;  3RBE A;  2NRW A;  3TFS A;  4M2Y A;  1LKY B;  2JH1 A;  2G5I B;  1WUD A;  2B21 A;  4KTQ A;  5KT2 A;  2NRX A;  1ZJN A;  4F4Y A;  3RB3 A;  5L1I A;  4RU9 A;  5HML A;  4IS7 A;  3PSP A;  2WFA A;  1UPH A;  2VJ4 A;  2VJ5 A;  3MBY A;  3C21 A;  3HPO A;  3RB6 A;  4I2A A;  3RH4 A;  1ZRN A;  1XSN A;  2J6T A;  3TAR A;  4I2J A;  1ZQE A;  2LBO A;  5BPC A;  1S76 D;  5EWG A;  3S6J A;  3K1R B;  3BS5 B;  1X9S A;  3HIL A;  4MF2 A;  4LZD A;  2MU2 A;  4Q8E A;  4XA5 A;  4IC9 A;  1LB2 B;  2NRT A;  3KBB A;  5ALU A;  2W54 A;  2KFZ A;  2FE9 A;  4ECX A;  5ALF A;  4PGY A;  3QEA Z;  5B5E U;  1UT5 A;  3WK9 A;  1MN8 A;  4TUQ A;  5AIB A;  4P0Q A;  1S10 A;  5D4B A;  1V85 A;  2ZIX B;  3NS1 A;  2VAN A;  4M9N A;  3I76 A;  3C1Z A;  1T8E A;  4EEY A;  1HUO A;  2L5Y A;  1YZ7 A;  3GQC A;  4AYB F;  4DSJ A;  5DDY A;  4G9B A;  1EXN A;  4YP3 A;  4RQ3 A;  4YR0 A;  2KKP A;  2LM4 A;  2FPL A;  1SL0 A;  4JMU A;  2KD1 A;  5L1L A;  1ARO P;  5KFG A;  3PST A;  4UB5 A;  1ZQF A;  3AL0 B;  3C5G A;  4DSF A;  4ECU A;  3NVY A;  3QX7 A;  3IP4 B;  4M9J A;  5ALI A;  3JPN A;  4MFF A;  4NLB A;  5L1M A;  1WWU A;  1RG6 A;  2EAO A;  2FDR A;  2PI4 A;  2JGA A;  2KKV A;  4JV0 A;  5J2E A;  3Q8S B;  8ICZ A;  2BCR A;  1Z4N A;  5KG1 A;  2HOI A;  3OHA A;  1HUZ A;  5J0Y A;  2ZJ8 A;  2KP7 A;  2KVC A;  2F44 A;  1NZB A;  2F8K A;  5IIL A;  1ZD3 A;  2C2D A;  5AI4 A;  2F76 X;  2YN4 A;  4I2C A;  2YMP A;  2A1J B;  2KN7 A;  4IQU A;  1L7P A;  9ICF A;  1L6N A;  4IQW A;  5HHI A;  4PZO A;  2YY6 A;  5ALE A;  8ICB A;  5CWR A;  9ICR A;  1PK3 A;  3OJS A;  2KZM A;  1KW4 A;  7ICQ A;  5J8Y A;  7ICJ A;  3G6X A;  4NL9 A;  3SI8 A;  5HHH A;  1KN5 A;  2W55 A;  1ZQN A;  1S77 D;  4DSL A;  4Y2V A;  5KG5 A;  5KFE A;  5ALS A;  4DSI A;  4KLU A;  3DV9 A;  1PVQ A;  5J2K A;  2KHQ A;  2Q4T A;  3VC8 A;  2G09 A;  2DGZ A;  2I5H A;  4U7C A;  2BQ3 A;  4EZ9 A;  7ICM A;  1N61 A;  2CPR A;  2YTU A;  4UB8 U;  2KEY A;  1ZQI A;  2WF9 A;  2W7O A;  1F44 A;  4F4Z A;  3QEB Z;  2ZUB A;  2V9W A;  4P0Q B;  4YD1 A;  4RUC A;  9ICN A;  4DL5 A;  3C5F A;  1U49 A;  4NV0 A;  1Z19 A;  9ICM A;  3MAB A;  3N4M B;  4O9M A;  3N7R C;  1Z1B A;  5DQH A;  7ICT A;  1KSP A;  1S0V A;  5KT3 A;  5ALT A;  4Y2S A;  4ZH4 A;  4BX9 C;  1BVS A;  1ZD5 A;  1X9W A;  1ZQP A;  2G0A A;  3EZ5 A;  3K1Z A;  3I1Y A;  5HNK A;  4BXO A;  4ECQ A;  2F1H A;  5KFK A;  3WK6 A;  1KQQ A;  1X6J A;  4Z6F A;  4RQ1 A;  5HR6 A;  4USA A;  3PX6 A;  5KFB A;  3IN5 A;  4QZD A;  1JRP A;  4CF5 A;  1WG8 A;  4O0I A;  2H3I A;  5KTQ A;  4DQS A;  4NM1 A;  4F50 A;  1L7M A;  5DKW A;  2Q0Z X;  4KLO A;  3SAH A;  3KHH A;  4KX5 A;  4ECT A;  2JZB A;  3C1Y A;  4Q44 A;  4NWI A; 
#chains in the Genus database with same CATH homology
 3H0M B;  2RRD A;  2VKQ A;  2H3V A;  2KJ5 A;  2JH7 A;  2G06 A;  2KNJ A;  4AYB F;  3F5A A;  2CN1 A;  4U6P A;  1HIW A;  1ZQ1 C;  2KIW A;  2VIX A;  2MA1 A;  4KMO B;  2WAQ F;  3LVV A;  1CRX A;  3D2S A;  2R18 A;  3PSI A;  2H3F A;  2GOL A;  3N7S C;  3PSF A;  3MGV A;  2F8L A;  2KHQ A;  2KKP A;  1PVQ A;  5CRX A;  3VCB A;  4OJP A;  4ACO A;  2YX8 A;  2ZIW B;  2JHD A;  2KV2 A;  4FE3 A;  4QJF B;  4CRX A;  2OM6 A;  2Q4T A;  3VC8 A;  3DEE A;  2G09 A;  2DGZ A;  2JH1 A;  3AQE A;  2G5I B;  2PMZ F;  2RHF A;  2BDU A;  2KD1 A;  2YB1 A;  3N7P D;  4JMU A;  1WUD A;  4BJQ A;  4P0P A;  4U7C A;  1MA7 A;  5KL1 B;  3SQI A;  4CGZ A;  3F2D A;  4OO1 J;  2ZG6 A;  1ECW A;  3F53 A;  2WAQ C;  4WJ3 B;  3M7D A;  2CPR A;  3CYM A;  3PST A;  4OJ6 A;  2KEY A;  3AL0 B;  4QNL A;  2Y0S F;  2RP5 A;  1D8B A;  3PSP A;  3D2Q A;  2D6F C;  3H0L B;  1UPH A;  2G08 A;  2W7O A;  2ZXI A;  1F44 A;  2PMZ C;  2OH2 A;  3IP4 B;  2VJ4 A;  2XI9 A;  4CDG A;  5C0Y A;  2VJ5 A;  5KL8 B;  2KJ8 A;  2E1E A;  2NV3 A;  2ZIV B;  2CRX A;  4NLB A;  2WB1 F;  4P0Q B;  3NUQ A;  3M6K A;  4NV0 A;  2HOQ A;  2ZIX A;  1Z19 A;  4BUG A;  1PVP A;  2Z7J A;  1Q3V A;  1SZH A;  2JGA A;  3HKZ F;  3SAF A;  2Y0S C;  4AYB C;  2KKV A;  3N7R C;  2LBO A;  1Z1B A;  1ED1 A;  3H0R B;  4QIW F;  1XNS A;  1HEK A;  4PL1 A;  3SAG A;  4O3M A;  2YB4 A;  3CRX A;  2LHT A;  2E5S A;  3ONN A;  2WB1 C;  2HOI A;  1PVR A;  3OPX A;  2ZIU A;  4GFJ A;  4FZM A;  2DQN B;  5A0L A;  2GH1 A;  4BX9 C;  3C29 A;  3HKZ C;  2KVC A;  4KX3 A;  2K4I A;  2W7P A;  1DRG A;  2OYY A;  1NZB A;  2G0A A;  2W04 A;  3AQF A;  3RF9 A;  2A3V A;  2ZXH A;  3GZF A;  4QIW C;  3RFA A;  3ALR A;  2N1R A;  3K1Z A;  4PL2 A;  2ZIW A;  3F5E A;  1P7D A;  2LYB A;  3ICX A;  1KBU A;  2F76 X;  4IC9 A;  5HR7 A;  2HMX A;  2K8C B;  1A0P A;  2XVT A;  2HBJ A;  4P0P B;  3D2N A;  3O0F A;  2H3Q A;  5T14 A;  3T79 A;  1L6N A;  2KOB A;  3PZP A;  1XO0 A;  1Q3U A;  2ZIU B;  3E0F A;  2K8A A;  1TAM A;  3SMV A;  1GO3 F;  3F2C A;  5HR6 A;  3CP8 A;  1A6S A;  3M6Z A;  2G5H B;  4FZL A;  3GU3 A;  1IIP A;  1T94 A;  2KHV A;  3IG8 A;  4OJ5 A;  4C0Z A;  3KZX A;  3IN5 A;  2HOF A;  2LKY A;  2HBM A;  2XIC A;  4ICA A;  4OJL A;  4A8E A;  2K8B B;  2ZIV A;  2H3I A;  2OXO A;  3LVW A;  2K4H A;  2M0N A;  3NRW A;  4P0Q A;  1URJ A;  2KIC A;  2LYA A;  2F77 X;  3F2B A;  1OUQ A;  2HBK A;  2E1F A;  2XID A;  2DF4 B;  2K89 A;  2W03 A;  2ZIX B;  3KFU F;  2JMG A;  3SAH A;  2F2A B;  4FZN A;  4OJO A;  3IG5 A;  2MRL A;  4NLC A;  2HBL A;  4KX5 A;  3L3F X;  1YT3 A;  2G07 A;  3LYS A;  2H3Z A;  2K4E A;  2KJ9 A;  4NWI A;  3C28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...