2EQYA

Solution structure of the arid domain of jarid1b protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
b'GSSGSSGEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTSDTKDKEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji, AT rich interactive domain 1B
publication title Solution structure of the ARID domain of Jarid1b protein
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2eqyA01
2JXJA 2JRZA 2YQEA 5CEHA 1KQQA 2EH9A 4LJXA 2EQYA 1IG6A 2LM1A 2KK0A 1KN5A 2LI6A 2OEHA 1KKXA 2CXYA 1RYUA 2RQ5A 1C20A 5K4LA
chains in the Genus database with same CATH superfamily
4YQWA 2V9WA 3ISDA 4TQRA 2D3DA 3EPIA 8ICUA 4KLGA 4LZGA 5J0PA 4PGXA 4UAYA 3ZDDA 4DO9A 3M9NB 1ZQBA 2W7PA 1L3TA 1D8BA 2BQRA 8ICSA 3MR5A 1Q8KA 5HP4A 2F77X 2KJ9A 2XY7A 4K4GA 4LZDA 4UB3A 5DBCA 1BPXA 5AKYA 5KFQA 2GLEA 1GO3F 1RQLA 3CRXA 4RQ3A 4DF8A 4I2CA 5KL8B 3V7KA 4EELA 3C23A 4RNNA 5ALRA 2RQ5A 4ELVA 4F50A 3H8JA 1SL2A 4IRKA 3BS5A 3PZPA 5D4BA 2XI9A 5J0RA 3MR2A 4GXJA 5D49A 4GXKA 7ICNA 3SR6A 1XNSA 4QZCA 4KLSA 4RZRA 3OSNA 2LM4A 4FZLA 4XQ8A 5JRTA 2XCAA 1WCLA 2LHTA 3KTQA 5AKJA 8ICMA 2KK0A 2JEIA 1O08A 3JPNA 4QNLA 2WHEA 4ECYA 2XC9A 2ASDA 1NK6A 3WK9A 4FFDA 4YR2A 2VA2A 4C8LA 5KG3A 2M0NA 3H8WA 4F4XA 5AKIA 4KMUA 1OW5A 2M9NA 4BDPA 5EE0A 3OPXA 2BQUA 4Z6EA 7ICSA 2CXYA 4PZNA 7ICEA 2MAXA 4CF3A 3KFUF 3HILA 4AP9A 5J2AA 4QZBA 2KG5A 2NRTA 4Z6CA 2R8KA 3Q8PB 2F2AB 2H3QA 1UA0A 2PI4A 1ZQWA 4EYHB 1ZQFA 4JV1A 3KKAA 2KE7A 2RHFA 5F9LA 3RH6A 1SV4A 1JXEA 4C80A 3UXNA 4TUPA 7ICJA 3N7RC 2ZIWA 4YVZA 1TKDA 8ICWA 2K4EA 2KHQA 3MBYA 3GIJA 1ECWA 5KFZA 1SZPA 1NOMA 2JH7A 4P0QA 1S0MA 4WJ3B 1KN5A 1IXRA 2LBOA 2VANA 4F71A 3EYZA 1S8OA 1D8LA 1VJ5A 1ZYQA 2MU2A 1U45A 4RQ6A 3CNHA 1U47A 1K5OA 4FS1A 3LK9A 4QZAA 5KFAA 4NM2A 2I6XA 3ONNA 4QW9A 4KLTA 4JB3A 5AI8A 5EWFA 9ICTA 5CRXA 2YB4A 1KTQA 3HKZF 1COKA 3V72A 5CEHA 2WAQC 2G07A 2PFOA 5IILA 1F0MA 1KW4A 4GIBA 1RQNA 4LJXA 2ZJAA 4B9SA 1BPYA 3N7SC 7ICFA 2XICA 9ICIA 5AM1A 4F92B 3AEVA 1JXLA 3BDPA 3RJFA 3ORYA 2DPIA 1S97A 5DDYA 1F44A 1ZQMA 3N7PD 2JRZA 2D6FC 2YQEA 4JK1A 2ZXHA 4JMUA 4RU9A 4KLUA 4US9A 4NY8A 4OJOA 4F5OA 4ED3A 1V38A 2ZTDA 2KIVA 5KNIA 4G3IA 5KG7A 3FC4A 1ZQKA 4M04A 8ICZA 5A0LA 1KDHA 2KICA 5KFUA 4RQ4A 2Z7JA 2B6GA 3C21A 3PSIA 4RQ7A 2EZXA 2AGQA 1SKRA 5KFMA 2LMRA 3THVA 8ICBA 1ZJMA 3RB4A 7ICHA 1B22A 4EX7A 1S10A 1T4GA 4MFCA 4RNMA 4RUCA 5AM0A 3BQ0A 4C7YA 4NM1A 4P0PA 3V6JA 2XGQA 2HOIA 5GTHU 1TV9A 5DB8A 1B4FA 2KHVA 3UQ0A 2UVRA 3HPOA 2A3VA 1ZQIA 5J2GA 1QH9A 1Z1VA 2HCFA 4J9KA 2JEJA 1ZQDA 2ES6A 5AKGA 1ZOLA 3QUQA 1L6NA 2KZZA 3SAFA 3QU7A 9ICNA 3NRWA 4ED2A 3WKCA 1N61A 4Q8FA 4O0IA 3QUCA 2KN7A 1C7YA 4ZH4A 5IINA 3F53A 4CE6A 5AKEA 1HEKA 2VA8A 4QIWC 4EBEA 3BQ7A 3FM9A 1JALA 2C2DA 1LKYA 5IIIA 1OUQA 4UASA 1NK7A 4KN7A 1IIPA 5K4LA 5B5EU 5ALUA 1ZQSA 4PZOA 1B43A 3OTQA 2WB1C 4UB6U 1X9XA 2DGZA 5DDMA 1TAQA 2E8MA 3H0LB 3K1ZA 5DQHA 4B9TA 4P4MA 1BVSA 2BKEA 5DKWA 4EEKA 4NJ8A 2KVCA 2F1HA 3ETRA 4RQ5A 4Y2QA 1Q3UA 2JZBA 1KKXA 2DBYA 4RNOA 3MDAA 5CB1A 2ODGA 3NTUA 4KLFA 3RAXA 8ICRA 4YMMA 3L5KA 3ZD9A 8ICLA 3UM9A 2JEFA 5JUMA 4QW8A 4QZGA 9ICVA 4M6WB 5J2HA 3V7LA 1FFUA 4DCCA 1KLNA 4O3PA 4J9PA 4P4OA 4AYBF 2IBKA 4O5EA 2RLTA 1HJPA 7ICQA 4DL5A 2ZJ8A 3PV8A 2G0AA 5KFTA 1XWLA 5L1JA 2AH5A 5IIKA 2QKQA 4DFDA 3MFHA 4OO1J 1ZQXA 1N60A 9ICGA 2OEHA 4EBDA 8ICOA 4NLGA 3UMGA 2F3NA 2H3IA 2ZXIA 3AQEA 3H8SA 2ZUCA 1N2XA 3WKDA 3JPRA 2FMPA 3JPSA 1T7PA 5AI9A 4J9OA 2OYYA 1XS9D 4RQMA 5ALSA 4RQ8A 3GFKB 2KJ8A 4CCHA 1NI3A 3ETLA 3J81j 5AKKA 5B66U 1SB3C 3NRZA 4DLEA 1WCNA 1S0OA 3RR7A 2MUTA 3IRUA 3MABA 3O0FA 2OWOA 4TURA 3OHBA 7ICMA 4DSIA 3BZKA 2KFZA 2FMSA 1ZQTA 5AIBA 4DOCA 3QE9Y 3CP8A 2LYAA 3JPTA 4DSFA 1IM4A 2AQ0A 4BX9C 1ZQQA 2YMPA 4B9MA 2IOHA 1QTMA 9ICLA 2BCSA 1PK1B 2ZJ5A 4I27A 2KZ3A 4YCXA 2KEYA 2FJ6A 4QIWF 4QZ8A 4XUSA 4C8MA 4EENA 2VKQA 3NASA 3M8SA 3QEBZ 1X9WA 3H7IA 1A6SA 1YZ6A 2PKEA 3T5HA 2H3FA 4F4ZA 5DGAA 2FPMA 4RQ2A 4GC6A 3JPPA 4ECQA 2FPLA 5AM4A 5ALKA 1QSSA 3C1YA 3GV5B 5KFCA 2KSOB 1QQ5A 1Y88A 3E0FA 8ICEA 2QB1A 2DPJA 1ZQZA 3KZIU 5AI4A 1Z4NA 1RYSA 2HHTA 4OCZA 2OM6A 1NZPA 4FE3A 2KZMA 1T94A 4R8UA 3QX7A 2YMMA 5TISU 4QWEA 9ICJA 2HDOA 3T5KA 2BPCA 3KHRA 1EXNA 2G09A 2DKXA 4NXZA 3IN5A 1ZRNA 1SWVA 4IQUA 4NLBA 5HNKA 4KLMA 3F2CA 2GO7A 3PVXA 2YMLA 2I9GA 4RT3A 5C0YA 5L1MA 4KITB 2HMXA 4M9NA 5J0UA 4Y2SA 2ZIUA 3S6JA 4KLJA 1N5WA 3I1YA 3HWTA 3RH4A 3SENA 1XSNA 2MA1A 4YP3A 2DFLA 4YMOA 2BGWA 4O3OA 2JV3A 3M7DA 1U49A 1L5UA 2Y9UA 3SAGA 3GILA 3H4DA 2AHOB 4ED0A 2IA6A 4RUAA 2J6UA 4Y2RA 5KFYA 1FIQA 2YB1A 1RG6A 3SV4A 2OXOA 3TFSA 2R8IA 1U9LA 4DL2A 4PJ0U 1MN8A 3EW9A 4MEYA 2HOQA 2JEGA 4DQRA 1RXVA 3TKAA 3TAQA 4ED8A 3KBBA 2BDUA 1BPBA 4UW9A 1QSLA 3FAHA 4P4PA 4B6JA 4Y2VA 4UARA 4R8UB 2HHWA 2YTUA 3AM9A 5CHGA 4J9SA 8ICHA 2HHUA 2DUYA 2LPEA 3ISBA 2E8OA 2AU0A 1L7OA 1KQQA 1HUOA 2HW3A 2XCPA 1ZQYA 2UVWA 2A1AA 4KLEA 4DSKA 2F8KA 2K4HA 3MC1A 5AIAA 2OHFA 3LVWA 1J97A 5AM5A 3KKAC 3T5JA 7ICUA 2JXJA 3TADA 1XSPA 1N48A 2ZIUB 4OJ6A 4IQWA 2ZUDA 3KHLA 3BS7A 9ICFA 2HHQA 4YR3A 5J8YC 5KFWA 2ZTEA 4RQ1A 2ASLA 2W3SA 1TK0A 2VA3A 5L1LA 3A0BU 5KG4A 1JRPA 1NKCA 2FMQA 2GH1A 3ZI4A 4O3RA 3QU9A 2ZTCA 2W54A 4ED6A 5BOLA 2P6RA 5KT7A 2E5SA 1NJXA 4DQPA 4QZ9A 2KKPA 2PMZC 4IRDA 2XGPA 1QQ7A 5DB6A 3WKAA 5EWEA 2W9BB 2NYVA 3KOOA 5ALZA 3WK4A 5IIMA 2MSNA 2Y0SC 2W43A 4NLZA 3HX0A 2NRZA 1L3VA 2R8HA 5J2FA 5CP2A 4MFFA 3M9MB 2H3ZA 5H2FU 8ICIA 2K4PA 5KFSA 3NS1A 5J8YA 4YD2A 4KTQA 1DXSA 1WUDA 4C0ZA 4DQIA 4NV0A 2E1FA 4Y2XA 3U26A 3NVZA 4X5VA 4PL1A 2BCRA 4O3SA 7ICOA 2VIXA 2CN1A 5BOMA 3N97B 3Q8KA 2HHVA 3Q8SB 1MC8A 5DQIA 2K89A 1RM6C 4QWBA 1X2IA 4BWMA 5JTIA 3TARA 1QCKA 9ICRA 1FFVA 3GV8B 4DF4A 4YD1A 3A0HU 3EUB2 3NGDA 3CYMA 3Q8RB 5ALIA 2V4QA 5AKXA 3WK7A 4Y2TA 4QZIA 2W55A 1A0PA 4OD0A 4PH5A 5IIOA 2XVTA 2XIDA 1IV8A 3AU6A 1NKEA 5G5GA 5HHIA 3SV3A 2Y1IA 4F4KA 2I1QA 1D9DA 4C7ZA 1SXDA 5ALHA 3G6VA 4EZ6A 4DSJA 4ECSA 1RZTA 1NJYA 3G6YA 4I2FA 4PL2A 2J6TA 8ICGA 3RJIA 1CEZA 4DL6A 3E2EA 9ICKA 4U7CA 4XRHA 1SGGA 5ALYA 4B9VA 5DG9A 4F5RA 5L9XA 4NLNA 4ECUA 4Y2PA 3E58A 5ALDA 5KG6A 3H8MA 3PSTA 2ZG6A 2FDRA 3UQ2A 4B9NA 3UXPA 2ZIXA 4M6WA 1Z3EB 5ALMA 5KAIU 4ACOA 3GIMA 1U48A 2KVSA 3RJEA 1DK2A 2F1IA 1S0VA 1LVHA 4Q44A 3OHAA 1N63A 4JV2A 2AGPA 4F4WA 4B9UA 5CR0A 4Y2YA 3H4BA 2ALZA 1UHUA 5BPCA 2KNJA 1ZETA 4QWDA 4DOBA 4GLXA 4UB2A 2WFAA 4ECZA 4LVSA 2DKZA 2NRWA 3H40A 1V9PA 5ALXA 2BCVA 9ICHA 4A8EA 2HOFA 4EX6A 2WF9A 1CRXA 1NKBA 1K1SA 5EWGA 5CA7A 4KMOB 3BQTA 2DF4B 1JIHA 2GOLA 5J0OA 1CI4A 2W8KA 1H38A 2KJ5A 2BR0A 8ICJA 5EOZA 4GC7A 2FPKA 2QB0A 5ALOA 4YN4A 3VCBA 1JROA 4DL4A 2HI0A 4USAA 4KLOA 1COOA 1K1QA 3MGHA 4O3MA 2G06A 3PW4A 2A19A 5CJ7A 4O9MA 1PVRA 2WAQF 5ALGA 1DGSA 2F44A 4OJ5A 2ISPA 4Z6DA 1RYRA 5J2JA 4CF5A 1SKSA 4C4RA 2R18A 2ZIXB 1PK1A 1J2MA 3GIIA 3G6XA 4DFPA 2HBKA 1LB2B 4DS4A 3ISCA 2A1JB 3QXGA 3AMZA 4DL3A 4F93B 1A77A 3RB3A 1BPZA 3HRDD 3QEAZ 2E8PA 4IQVA 5KFRA 4G9BA 4Z6FA 5IIJA 8ICKA 2RDJA 1L7MA 3PW5A 1PZNA 4ECXA 2KSOA 1ZJNA 3GV7B 3M8RA 3TI0A 4DQSA 2W9CB 5J0TA 1WWVA 1UA1A 2F8LA 5J0YA 3EZ5A 4KX5A 1C20A 1X42A 3M6KA 3QUBA 4I2DA 3HW8A 4NL9C 4QZFA 5KT5A 3PW2A 8ICTA 5AI6A 4Y2UA 2C2RA 4QJFB 2IHMA 1ZQAA 4CF4A 1CUKA 1N56A 4BXOA 3PO5A 4DSLA 3IP4B 1XSLA 2VJ4A 4OJLA 4I2BA 3B0YA 2O6KA 4EYIB 3I76A 2YN4A 3C1ZA 2QB0B 5D46A 2D8CA 3RJGA 3PY8A 4UQGA 1L8LA 3UPQA 3I28A 4Y2JA 3N4MB 4BJQA 3LWMA 4DQQA 4F8RA 4ELTA 3MFIA 3TAPA 4M9GA 3RH5A 2BZFA 2LI6A 1KRPA 5AICA 4K4HA 1VDVA 4NL9A 4HYKA 1PK3A 3WK5A 2IHNA 3D6JA 4KLQA 1PVQA 3QU5A 4O5KA 1BGXT 3ED5A 4YFKA 2E1EA 1Z1BA 3PR4A 2E8NA 1ZQGA 1SV0C 5JU5A 3KD3A 5F9NA 1ZD4A 4J9QA 3RBEA 2EAOA 1L7PA 2PI5A 2WB1F 2EAPA 3HT3A 1RYUA 4J9MA 1KFSA 2G08A 2CRXA 5DG7A 5KTQA 5EE1A 5DGBA 4F91B 8ICCA 2EDUA 2NRVA 1TFRA 4F72A 4DFKA 5AKZA 2JMGA 5DBAA 4RPXA 4DEZA 2UVVA 8ICVA 3Q8MA 9ICOA 5J2DA 3ALRA 1WWUA 3JPOA 1F5SA 5KG5A 2J6SA 5KFBA 5KT4A 5ALEA 3M6ZA 1PUZA 1ZQNA 3MR6A 4KLLA 3GU3A 4I2EA 5ALLA 5KFEA 3TACB 4IQTA 2JGAA 4TQSA 1SV0A 3K75D 1XO1A 4EBCA 4BXOB 4M9HA 1ZQCA 4M47A 2L5YA 1B0XA 3V6HA 5KFLA 4FBUA 1Z00B 4MF8A 2LM1A 3SMVA 5DQGA 1ED1A 4UB1A 2VJ5A 5ALTA 1MQ2A 5KG2A 4MF2A 3H0RB 5L1KA 2WTFA 3TQ1A 9ICXA 4I28A 2WF5A 4F5PA 2ASJA 3ZDAA 3T3FA 2BDPA 5HR6A 1X6IA 5J2EA 4RQ0A 3D2SA 7ICPA 3AN1A 1RDFA 2W9MA 2W9AA 4F2SA 3NVWA 4R66A 8ICPA 1QLNA 4RPZA 2QLTA 3RJHA 3Q8QB 4JUZA 1D8YA 1Z4OA 3RJJA 3C2LA 3PMNA 3DV9A 2IMWP 1S5LU 3TANA 5EE3A 1QQ6A 5J29A 2QARB 1U4BA 3IG8A 3RFAA 3M1YA 1N5XA 1NJZA 4PGQA 4C8NA 2V4RA 2W9BA 4HAIA 3PSFA 2KD1A 4YXJA 3D2NA 4F2RA 4O3NA 3TADC 5ALPA 5J0SA 4J03A 3B0XA 2ZIVA 3GQCA 5ALNA 4Q8EA 9ICBA 3DDHA 1YT3A 2GWSA 1X66A 5ALJA 5ALVA 4PHPA 5KFFA 4Q43A 5KFIA 1KFDA 3PW7A 2RP5A 1JI7A 3ICXA 3M9OB 2W11A 3NUQA 2F76X 4XA5A 3HKZC 3LVVA 3RAQA 7ICIA 1DRGA 2WF7A 5KFOA 3PO4A 2DL0A 3F2BA 2BPFA 4PHAA 4MFAA 5KFJA 3PR5B 4QZEA 4YXMA 1ZRMA 2EH9A 4F5QA 2PFQA 2K60A 3OJUA 2DQNB 4IC9A 4MHVA 3BZCA 5AK6A 5DLGA 1TE2A 2F1JA 2W03A 1BNPA 9ICPA 4CNQA 2KKVA 2KV2A 3OSPA 7ICLA 4FO6A 2FLPA 4UAZA 2BQ3A 1TAMA 3QNMA 3MDCA 4NLKA 2P35A 1SL1A 3IM1A 2H3VA 4TUQA 4PHDA 1MA7A 3UXOA 1UCVA 3RF9A 4B9LA 1ZD3A 5DBBA 5J2IA 2AGOA 1O03A 1TK5A 4EZ9A 3F5EA 1AROP 5KFHA 1BPDA 4DSEA 5KG0A 4C4SA 3MGIA 3GZFA 5AK5A 4DOAA 2G5HB 3LDAA 4KN4A 2ATLA 2R8JA 5KFNA 4QWCA 7ICVA 3IG5A 1NK4A 5AM3A 3V7JA 3FYHA 4TUSA 1NJWA 2ZIVB 5J2CA 3KHGA 3ZDEA 2EQYA 1ZQHA 2P66A 2Q4TA 3AUOA 3QYPA 2AQ4A 2LYBA 5DB7A 3D2QA 4PGYA 1DK3A 3WK8A 1LV5A 2H5XA 4DFJA 4EEYA 2KP7A 9ICAA 1T8EA 4YMNA 3QZ7A 3C2MA 3ZDCA 3WU2U 3RRHA 2I5HA 4IR1A 1X40A 4R64A 1X9MA 3GDXA 5KFGA 1A76A 3FDSA 2W8LA 2NO5A 2HBLA 2Y9TA 2HHSA 3BS5B 2UVUA 2HVIA 4QWAA 2P6UA 5GTIU 2NRXA 3QU4A 5ALWA 3H0MB 1KBUA 5KL1B 2N1RA 3R9KA 3WKEA 1OXJA 1RPLA 3PX6A 1Q46A 4RQNA 5J0QA 2EANA 3GIKA 4Q45A 1ZXIA 4DLGA 3C28A 8ICNA 3V6KA 4UAWA 1WG8A 2C22A 4FZMA 1VLBA 3EPGA 4I2GA 1P7DA 4KLDA 3C5FA 4NLCA 4R65A 4FS2A 5HMLA 2LYHA 2DWQA 4DL7A 1ZQEA 3WKBA 3HP6A 2BCUA 3ZD8A 3AL0B 2RRDA 2NV3A 7ICRA 3RJKA 2PXIA 4C8OA 4DS5A 5KFPA 4ELUA 2KOBA 4F5NA 4AYBC 3Q8LA 2EAMA 1NK5A 3C29A 1SKWA 1X9SA 4ECRA 1T3QA 3BQ2A 1PVPA 1NZBA 4IRCA 1XC9A 5KG1A 2IOFK 2AJQA 4I2HA 2ZIWB 5J2KA 3NVYA 9ICCA 2A1JA 2PFNA 9ICSA 3C2KA 4O3QA 5AI5A 2B0CA 5KFKA 4QZHA 4C4TA 2PMZF 5AI0A 4P0QB 2PFPA 5L1IA 4OJPA 1BPEA 2JR5A 5KFDA 3AQFA 1HUZA 2Y0SF 4ED7A 3SD7A 4ZOHC 1JX4A 2YMQA 2W9CA 1KEJA 5F3XB 2MRLA 4J9NA 3WK6A 1SWWA 4QZDA 1YZ7A 1NK8A 1DOQA 3KZXA 1SL0A 1IG6A 3VC8A 5DB9A 7ICKA 2BPGA 1SZHA 1L8OA 2EZZA 2W7OA 4UAVA 4PHEA 2K8BB 2NO4A 2G5IB 4R63A 5G5HA 5KAFU 2ISOA 5AK3A 3QUTA 5ALQA 4BGDA 1S77D 1SIJA 1X6JA 2Q0ZX 4I2JA 3UMBA 3RB0A 4M0AA 3IHQB 3K4GA 4KX3A 3F2DA 5C5JA 1L3SA 1S0NA 4KLHA 3DEEA 1TAUA 2KMDA 4E0DA 3RTVA 5J0WA 4O5CA 4ED1A 3N28A 1ZQRA 1XU4A 2IOFA 8ICQA 3K1RB 3ZDBA 3SAHA 3SI8A 1V85A 4F3OA 9ICMA 2HVHA 2ESEA 3JPQA 3BQ1A 5HMMA 1UT5A 2FLNA 1QSYA 2WF8A 4C8KA 2KTQA 3T79A 4P0PB 1ZQPA 4M9JA 2C2EA 3PNCA 3UMCA 4JV0A 4IS7A 4I2AA 3PX0A 5HR7A 4KLIA 2R8GA 3L3FX 1S9FA 1Q3VA 4CDGA 4GXIA 1ZQ1C 2W3RA 3LWLA 1JN3A 1TK8A 5KFVA 5EE9A 5E79U 2E3TA 4U6PA 2Y1JA 2K8AA 3PX4A 7ICGA 1NK9A 1Z00A 4DFMA 3F5AA 9ICQA 1V97A 1URJA 4BUGA 5KT6A 1NK0A 3TFRA 4ECVA 1L3UA 2BCQA 3OGUA 3SZ2A 4I29A 3PW0A 9ICWA 2YY6A 3HJEA 1JUDA 1M6YA 3OJSA 1Z19A 4RPYA 1HIWA 2CPRA 4GFJA 2XO7A 1J2NA 1N62A 1LKYB 2W04A 5DLFA 4P2HA 3RR8A 4K4IA 3C5GA 4UB5A 3QZ8A 1UT8A 4IL6U 4J9LA 5J2BA 9ICEA 3PMLA 2HBJA 4I2IA 1ZQOA 1UQVA 1S76D 9ICUA 2OH2A 5DG8A 3RB6A 2FI1A 8ICAA 3QU2A 1MQ3A 5AKLA 8ICFA 3NVVA 5TZVA 7ICTA 4ECWA 4M9LA 2JZBB 4MEXA 5HHHA 5AHXA 3MGVA 1DGJA 1ZD5A 1D9FA 4PPXA 3IV6A 2FE9A 1JMSA 2XY6A 2QARA 4JWNA 2AXTU 1ZQUA 5AK4A 3SEIA 2HSZA 5J0XA 1BNOA 3SQIA 4DWIA 2KFNA 5KT3A 1KSPA 4NWIA 8ICXA 2XY5A 3PSPA 4YR0A 3SYZA 2C28A 2K8CB 4YG2A 2JHDA 2BHNA 3B9JA 2YX8A 4UATA 1UPHA 2WF6A 1ZD2P 5KT2A 4M2YA 3L4PA 1ZQLA 1FEZA 4UBCA 4F4YA 2ZUBA 2OCEA 4FBTA 1SXEA 5KFXA 3T5LA 5ALFA 4ECTA 4JWMA 4BWJA 4ICAA 8ICYA 3CW2C 4RT2A 1KFTA 2HBMA 4CRXA 2JH1A 1AQ6A 2FLLA 3EWAA 5T14A 1WYGA 3AU2A 4FZNA 4IR9A 4UB4A 4UB8U 4US8A 5FP0A 2HHXA 2MUTB 2K4IA 1NNLA 3IDWA 4UAUA 3RRGA 3BJYA 5AM2A 2B21A 1L7NA 3KHHA 1FO4A 1ZQJA 1XO0A 5CWRA 1TVAA 2RDIA 1MSWD 2LKYA 4CGZA 3LYSA 1T3NA 1ZQVA 1RXWA 1KL9A 4J9RA 5AKHA 2KIWA 2EZYA 3RBDA 3MR3A 4UBBA
chains in the Genus database with same CATH topology
2JXJA 2JRZA 2YQEA 5CEHA 1KQQA 2EH9A 4LJXA 2EQYA 1IG6A 2LM1A 2KK0A 1KN5A 2LI6A 2OEHA 1KKXA 2CXYA 1RYUA 2RQ5A 1C20A 5K4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXJ A;  2JRZ A;  2YQE A;  5CEH A;  1KQQ A;  2EH9 A;  4LJX A;  2EQY A;  1IG6 A;  2LM1 A;  2KK0 A;  1KN5 A;  2LI6 A;  2OEH A;  1KKX A;  2CXY A;  1RYU A;  2RQ5 A;  1C20 A;  5K4L A; 
#chains in the Genus database with same CATH topology
 4YQW A;  2V9W A;  3ISD A;  4TQR A;  2D3D A;  3EPI A;  8ICU A;  4KLG A;  4LZG A;  5J0P A;  4PGX A;  4UAY A;  3ZDD A;  4DO9 A;  3M9N B;  1ZQB A;  2W7P A;  1L3T A;  1D8B A;  2BQR A;  8ICS A;  3MR5 A;  1Q8K A;  5HP4 A;  2F77 X;  2KJ9 A;  2XY7 A;  4K4G A;  4LZD A;  4UB3 A;  5DBC A;  1BPX A;  5AKY A;  5KFQ A;  2GLE A;  1GO3 F;  1RQL A;  3CRX A;  4RQ3 A;  4DF8 A;  4I2C A;  5KL8 B;  3V7K A;  4EEL A;  3C23 A;  4RNN A;  5ALR A;  2RQ5 A;  4ELV A;  4F50 A;  3H8J A;  1SL2 A;  4IRK A;  3BS5 A;  3PZP A;  5D4B A;  2XI9 A;  5J0R A;  3MR2 A;  4GXJ A;  5D49 A;  4GXK A;  7ICN A;  3SR6 A;  1XNS A;  4QZC A;  4KLS A;  4RZR A;  3OSN A;  2LM4 A;  4FZL A;  4XQ8 A;  5JRT A;  2XCA A;  1WCL A;  2LHT A;  3KTQ A;  5AKJ A;  8ICM A;  2KK0 A;  2JEI A;  1O08 A;  3JPN A;  4QNL A;  2WHE A;  4ECY A;  2XC9 A;  2ASD A;  1NK6 A;  3WK9 A;  4FFD A;  4YR2 A;  2VA2 A;  4C8L A;  5KG3 A;  2M0N A;  3H8W A;  4F4X A;  5AKI A;  4KMU A;  1OW5 A;  2M9N A;  4BDP A;  5EE0 A;  3OPX A;  2BQU A;  4Z6E A;  7ICS A;  2CXY A;  4PZN A;  7ICE A;  2MAX A;  4CF3 A;  3KFU F;  3HIL A;  4AP9 A;  5J2A A;  4QZB A;  2KG5 A;  2NRT A;  4Z6C A;  2R8K A;  3Q8P B;  2F2A B;  2H3Q A;  1UA0 A;  2PI4 A;  1ZQW A;  4EYH B;  1ZQF A;  4JV1 A;  3KKA A;  2KE7 A;  2RHF A;  5F9L A;  3RH6 A;  1SV4 A;  1JXE A;  4C80 A;  3UXN A;  4TUP A;  7ICJ A;  3N7R C;  2ZIW A;  4YVZ A;  1TKD A;  8ICW A;  2K4E A;  2KHQ A;  3MBY A;  3GIJ A;  1ECW A;  5KFZ A;  1SZP A;  1NOM A;  2JH7 A;  4P0Q A;  1S0M A;  4WJ3 B;  1KN5 A;  1IXR A;  2LBO A;  2VAN A;  4F71 A;  3EYZ A;  1S8O A;  1D8L A;  1VJ5 A;  1ZYQ A;  2MU2 A;  1U45 A;  4RQ6 A;  3CNH A;  1U47 A;  1K5O A;  4FS1 A;  3LK9 A;  4QZA A;  5KFA A;  4NM2 A;  2I6X A;  3ONN A;  4QW9 A;  4KLT A;  4JB3 A;  5AI8 A;  5EWF A;  9ICT A;  5CRX A;  2YB4 A;  1KTQ A;  3HKZ F;  1COK A;  3V72 A;  5CEH A;  2WAQ C;  2G07 A;  2PFO A;  5IIL A;  1F0M A;  1KW4 A;  4GIB A;  1RQN A;  4LJX A;  2ZJA A;  4B9S A;  1BPY A;  3N7S C;  7ICF A;  2XIC A;  9ICI A;  5AM1 A;  4F92 B;  3AEV A;  1JXL A;  3BDP A;  3RJF A;  3ORY A;  2DPI A;  1S97 A;  5DDY A;  1F44 A;  1ZQM A;  3N7P D;  2JRZ A;  2D6F C;  2YQE A;  4JK1 A;  2ZXH A;  4JMU A;  4RU9 A;  4KLU A;  4US9 A;  4NY8 A;  4OJO A;  4F5O A;  4ED3 A;  1V38 A;  2ZTD A;  2KIV A;  5KNI A;  4G3I A;  5KG7 A;  3FC4 A;  1ZQK A;  4M04 A;  8ICZ A;  5A0L A;  1KDH A;  2KIC A;  5KFU A;  4RQ4 A;  2Z7J A;  2B6G A;  3C21 A;  3PSI A;  4RQ7 A;  2EZX A;  2AGQ A;  1SKR A;  5KFM A;  2LMR A;  3THV A;  8ICB A;  1ZJM A;  3RB4 A;  7ICH A;  1B22 A;  4EX7 A;  1S10 A;  1T4G A;  4MFC A;  4RNM A;  4RUC A;  5AM0 A;  3BQ0 A;  4C7Y A;  4NM1 A;  4P0P A;  3V6J A;  2XGQ A;  2HOI A;  5GTH U;  1TV9 A;  5DB8 A;  1B4F A;  2KHV A;  3UQ0 A;  2UVR A;  3HPO A;  2A3V A;  1ZQI A;  5J2G A;  1QH9 A;  1Z1V A;  2HCF A;  4J9K A;  2JEJ A;  1ZQD A;  2ES6 A;  5AKG A;  1ZOL A;  3QUQ A;  1L6N A;  2KZZ A;  3SAF A;  3QU7 A;  9ICN A;  3NRW A;  4ED2 A;  3WKC A;  1N61 A;  4Q8F A;  4O0I A;  3QUC A;  2KN7 A;  1C7Y A;  4ZH4 A;  5IIN A;  3F53 A;  4CE6 A;  5AKE A;  1HEK A;  2VA8 A;  4QIW C;  4EBE A;  3BQ7 A;  3FM9 A;  1JAL A;  2C2D A;  1LKY A;  5III A;  1OUQ A;  4UAS A;  1NK7 A;  4KN7 A;  1IIP A;  5K4L A;  5B5E U;  5ALU A;  1ZQS A;  4PZO A;  1B43 A;  3OTQ A;  2WB1 C;  4UB6 U;  1X9X A;  2DGZ A;  5DDM A;  1TAQ A;  2E8M A;  3H0L B;  3K1Z A;  5DQH A;  4B9T A;  4P4M A;  1BVS A;  2BKE A;  5DKW A;  4EEK A;  4NJ8 A;  2KVC A;  2F1H A;  3ETR A;  4RQ5 A;  4Y2Q A;  1Q3U A;  2JZB A;  1KKX A;  2DBY A;  4RNO A;  3MDA A;  5CB1 A;  2ODG A;  3NTU A;  4KLF A;  3RAX A;  8ICR A;  4YMM A;  3L5K A;  3ZD9 A;  8ICL A;  3UM9 A;  2JEF A;  5JUM A;  4QW8 A;  4QZG A;  9ICV A;  4M6W B;  5J2H A;  3V7L A;  1FFU A;  4DCC A;  1KLN A;  4O3P A;  4J9P A;  4P4O A;  4AYB F;  2IBK A;  4O5E A;  2RLT A;  1HJP A;  7ICQ A;  4DL5 A;  2ZJ8 A;  3PV8 A;  2G0A A;  5KFT A;  1XWL A;  5L1J A;  2AH5 A;  5IIK A;  2QKQ A;  4DFD A;  3MFH A;  4OO1 J;  1ZQX A;  1N60 A;  9ICG A;  2OEH A;  4EBD A;  8ICO A;  4NLG A;  3UMG A;  2F3N A;  2H3I A;  2ZXI A;  3AQE A;  3H8S A;  2ZUC A;  1N2X A;  3WKD A;  3JPR A;  2FMP A;  3JPS A;  1T7P A;  5AI9 A;  4J9O A;  2OYY A;  1XS9 D;  4RQM A;  5ALS A;  4RQ8 A;  3GFK B;  2KJ8 A;  4CCH A;  1NI3 A;  3ETL A;  3J81 j;  5AKK A;  5B66 U;  1SB3 C;  3NRZ A;  4DLE A;  1WCN A;  1S0O A;  3RR7 A;  2MUT A;  3IRU A;  3MAB A;  3O0F A;  2OWO A;  4TUR A;  3OHB A;  7ICM A;  4DSI A;  3BZK A;  2KFZ A;  2FMS A;  1ZQT A;  5AIB A;  4DOC A;  3QE9 Y;  3CP8 A;  2LYA A;  3JPT A;  4DSF A;  1IM4 A;  2AQ0 A;  4BX9 C;  1ZQQ A;  2YMP A;  4B9M A;  2IOH A;  1QTM A;  9ICL A;  2BCS A;  1PK1 B;  2ZJ5 A;  4I27 A;  2KZ3 A;  4YCX A;  2KEY A;  2FJ6 A;  4QIW F;  4QZ8 A;  4XUS A;  4C8M A;  4EEN A;  2VKQ A;  3NAS A;  3M8S A;  3QEB Z;  1X9W A;  3H7I A;  1A6S A;  1YZ6 A;  2PKE A;  3T5H A;  2H3F A;  4F4Z A;  5DGA A;  2FPM A;  4RQ2 A;  4GC6 A;  3JPP A;  4ECQ A;  2FPL A;  5AM4 A;  5ALK A;  1QSS A;  3C1Y A;  3GV5 B;  5KFC A;  2KSO B;  1QQ5 A;  1Y88 A;  3E0F A;  8ICE A;  2QB1 A;  2DPJ A;  1ZQZ A;  3KZI U;  5AI4 A;  1Z4N A;  1RYS A;  2HHT A;  4OCZ A;  2OM6 A;  1NZP A;  4FE3 A;  2KZM A;  1T94 A;  4R8U A;  3QX7 A;  2YMM A;  5TIS U;  4QWE A;  9ICJ A;  2HDO A;  3T5K A;  2BPC A;  3KHR A;  1EXN A;  2G09 A;  2DKX A;  4NXZ A;  3IN5 A;  1ZRN A;  1SWV A;  4IQU A;  4NLB A;  5HNK A;  4KLM A;  3F2C A;  2GO7 A;  3PVX A;  2YML A;  2I9G A;  4RT3 A;  5C0Y A;  5L1M A;  4KIT B;  2HMX A;  4M9N A;  5J0U A;  4Y2S A;  2ZIU A;  3S6J A;  4KLJ A;  1N5W A;  3I1Y A;  3HWT A;  3RH4 A;  3SEN A;  1XSN A;  2MA1 A;  4YP3 A;  2DFL A;  4YMO A;  2BGW A;  4O3O A;  2JV3 A;  3M7D A;  1U49 A;  1L5U A;  2Y9U A;  3SAG A;  3GIL A;  3H4D A;  2AHO B;  4ED0 A;  2IA6 A;  4RUA A;  2J6U A;  4Y2R A;  5KFY A;  1FIQ A;  2YB1 A;  1RG6 A;  3SV4 A;  2OXO A;  3TFS A;  2R8I A;  1U9L A;  4DL2 A;  4PJ0 U;  1MN8 A;  3EW9 A;  4MEY A;  2HOQ A;  2JEG A;  4DQR A;  1RXV A;  3TKA A;  3TAQ A;  4ED8 A;  3KBB A;  2BDU A;  1BPB A;  4UW9 A;  1QSL A;  3FAH A;  4P4P A;  4B6J A;  4Y2V A;  4UAR A;  4R8U B;  2HHW A;  2YTU A;  3AM9 A;  5CHG A;  4J9S A;  8ICH A;  2HHU A;  2DUY A;  2LPE A;  3ISB A;  2E8O A;  2AU0 A;  1L7O A;  1KQQ A;  1HUO A;  2HW3 A;  2XCP A;  1ZQY A;  2UVW A;  2A1A A;  4KLE A;  4DSK A;  2F8K A;  2K4H A;  3MC1 A;  5AIA A;  2OHF A;  3LVW A;  1J97 A;  5AM5 A;  3KKA C;  3T5J A;  7ICU A;  2JXJ A;  3TAD A;  1XSP A;  1N48 A;  2ZIU B;  4OJ6 A;  4IQW A;  2ZUD A;  3KHL A;  3BS7 A;  9ICF A;  2HHQ A;  4YR3 A;  5J8Y C;  5KFW A;  2ZTE A;  4RQ1 A;  2ASL A;  2W3S A;  1TK0 A;  2VA3 A;  5L1L A;  3A0B U;  5KG4 A;  1JRP A;  1NKC A;  2FMQ A;  2GH1 A;  3ZI4 A;  4O3R A;  3QU9 A;  2ZTC A;  2W54 A;  4ED6 A;  5BOL A;  2P6R A;  5KT7 A;  2E5S A;  1NJX A;  4DQP A;  4QZ9 A;  2KKP A;  2PMZ C;  4IRD A;  2XGP A;  1QQ7 A;  5DB6 A;  3WKA A;  5EWE A;  2W9B B;  2NYV A;  3KOO A;  5ALZ A;  3WK4 A;  5IIM A;  2MSN A;  2Y0S C;  2W43 A;  4NLZ A;  3HX0 A;  2NRZ A;  1L3V A;  2R8H A;  5J2F A;  5CP2 A;  4MFF A;  3M9M B;  2H3Z A;  5H2F U;  8ICI A;  2K4P A;  5KFS A;  3NS1 A;  5J8Y A;  4YD2 A;  4KTQ A;  1DXS A;  1WUD A;  4C0Z A;  4DQI A;  4NV0 A;  2E1F A;  4Y2X A;  3U26 A;  3NVZ A;  4X5V A;  4PL1 A;  2BCR A;  4O3S A;  7ICO A;  2VIX A;  2CN1 A;  5BOM A;  3N97 B;  3Q8K A;  2HHV A;  3Q8S B;  1MC8 A;  5DQI A;  2K89 A;  1RM6 C;  4QWB A;  1X2I A;  4BWM A;  5JTI A;  3TAR A;  1QCK A;  9ICR A;  1FFV A;  3GV8 B;  4DF4 A;  4YD1 A;  3A0H U;  3EUB 2;  3NGD A;  3CYM A;  3Q8R B;  5ALI A;  2V4Q A;  5AKX A;  3WK7 A;  4Y2T A;  4QZI A;  2W55 A;  1A0P A;  4OD0 A;  4PH5 A;  5IIO A;  2XVT A;  2XID A;  1IV8 A;  3AU6 A;  1NKE A;  5G5G A;  5HHI A;  3SV3 A;  2Y1I A;  4F4K A;  2I1Q A;  1D9D A;  4C7Z A;  1SXD A;  5ALH A;  3G6V A;  4EZ6 A;  4DSJ A;  4ECS A;  1RZT A;  1NJY A;  3G6Y A;  4I2F A;  4PL2 A;  2J6T A;  8ICG A;  3RJI A;  1CEZ A;  4DL6 A;  3E2E A;  9ICK A;  4U7C A;  4XRH A;  1SGG A;  5ALY A;  4B9V A;  5DG9 A;  4F5R A;  5L9X A;  4NLN A;  4ECU A;  4Y2P A;  3E58 A;  5ALD A;  5KG6 A;  3H8M A;  3PST A;  2ZG6 A;  2FDR A;  3UQ2 A;  4B9N A;  3UXP A;  2ZIX A;  4M6W A;  1Z3E B;  5ALM A;  5KAI U;  4ACO A;  3GIM A;  1U48 A;  2KVS A;  3RJE A;  1DK2 A;  2F1I A;  1S0V A;  1LVH A;  4Q44 A;  3OHA A;  1N63 A;  4JV2 A;  2AGP A;  4F4W A;  4B9U A;  5CR0 A;  4Y2Y A;  3H4B A;  2ALZ A;  1UHU A;  5BPC A;  2KNJ A;  1ZET A;  4QWD A;  4DOB A;  4GLX A;  4UB2 A;  2WFA A;  4ECZ A;  4LVS A;  2DKZ A;  2NRW A;  3H40 A;  1V9P A;  5ALX A;  2BCV A;  9ICH A;  4A8E A;  2HOF A;  4EX6 A;  2WF9 A;  1CRX A;  1NKB A;  1K1S A;  5EWG A;  5CA7 A;  4KMO B;  3BQT A;  2DF4 B;  1JIH A;  2GOL A;  5J0O A;  1CI4 A;  2W8K A;  1H38 A;  2KJ5 A;  2BR0 A;  8ICJ A;  5EOZ A;  4GC7 A;  2FPK A;  2QB0 A;  5ALO A;  4YN4 A;  3VCB A;  1JRO A;  4DL4 A;  2HI0 A;  4USA A;  4KLO A;  1COO A;  1K1Q A;  3MGH A;  4O3M A;  2G06 A;  3PW4 A;  2A19 A;  5CJ7 A;  4O9M A;  1PVR A;  2WAQ F;  5ALG A;  1DGS A;  2F44 A;  4OJ5 A;  2ISP A;  4Z6D A;  1RYR A;  5J2J A;  4CF5 A;  1SKS A;  4C4R A;  2R18 A;  2ZIX B;  1PK1 A;  1J2M A;  3GII A;  3G6X A;  4DFP A;  2HBK A;  1LB2 B;  4DS4 A;  3ISC A;  2A1J B;  3QXG A;  3AMZ A;  4DL3 A;  4F93 B;  1A77 A;  3RB3 A;  1BPZ A;  3HRD D;  3QEA Z;  2E8P A;  4IQV A;  5KFR A;  4G9B A;  4Z6F A;  5IIJ A;  8ICK A;  2RDJ A;  1L7M A;  3PW5 A;  1PZN A;  4ECX A;  2KSO A;  1ZJN A;  3GV7 B;  3M8R A;  3TI0 A;  4DQS A;  2W9C B;  5J0T A;  1WWV A;  1UA1 A;  2F8L A;  5J0Y A;  3EZ5 A;  4KX5 A;  1C20 A;  1X42 A;  3M6K A;  3QUB A;  4I2D A;  3HW8 A;  4NL9 C;  4QZF A;  5KT5 A;  3PW2 A;  8ICT A;  5AI6 A;  4Y2U A;  2C2R A;  4QJF B;  2IHM A;  1ZQA A;  4CF4 A;  1CUK A;  1N56 A;  4BXO A;  3PO5 A;  4DSL A;  3IP4 B;  1XSL A;  2VJ4 A;  4OJL A;  4I2B A;  3B0Y A;  2O6K A;  4EYI B;  3I76 A;  2YN4 A;  3C1Z A;  2QB0 B;  5D46 A;  2D8C A;  3RJG A;  3PY8 A;  4UQG A;  1L8L A;  3UPQ A;  3I28 A;  4Y2J A;  3N4M B;  4BJQ A;  3LWM A;  4DQQ A;  4F8R A;  4ELT A;  3MFI A;  3TAP A;  4M9G A;  3RH5 A;  2BZF A;  2LI6 A;  1KRP A;  5AIC A;  4K4H A;  1VDV A;  4NL9 A;  4HYK A;  1PK3 A;  3WK5 A;  2IHN A;  3D6J A;  4KLQ A;  1PVQ A;  3QU5 A;  4O5K A;  1BGX T;  3ED5 A;  4YFK A;  2E1E A;  1Z1B A;  3PR4 A;  2E8N A;  1ZQG A;  1SV0 C;  5JU5 A;  3KD3 A;  5F9N A;  1ZD4 A;  4J9Q A;  3RBE A;  2EAO A;  1L7P A;  2PI5 A;  2WB1 F;  2EAP A;  3HT3 A;  1RYU A;  4J9M A;  1KFS A;  2G08 A;  2CRX A;  5DG7 A;  5KTQ A;  5EE1 A;  5DGB A;  4F91 B;  8ICC A;  2EDU A;  2NRV A;  1TFR A;  4F72 A;  4DFK A;  5AKZ A;  2JMG A;  5DBA A;  4RPX A;  4DEZ A;  2UVV A;  8ICV A;  3Q8M A;  9ICO A;  5J2D A;  3ALR A;  1WWU A;  3JPO A;  1F5S A;  5KG5 A;  2J6S A;  5KFB A;  5KT4 A;  5ALE A;  3M6Z A;  1PUZ A;  1ZQN A;  3MR6 A;  4KLL A;  3GU3 A;  4I2E A;  5ALL A;  5KFE A;  3TAC B;  4IQT A;  2JGA A;  4TQS A;  1SV0 A;  3K75 D;  1XO1 A;  4EBC A;  4BXO B;  4M9H A;  1ZQC A;  4M47 A;  2L5Y A;  1B0X A;  3V6H A;  5KFL A;  4FBU A;  1Z00 B;  4MF8 A;  2LM1 A;  3SMV A;  5DQG A;  1ED1 A;  4UB1 A;  2VJ5 A;  5ALT A;  1MQ2 A;  5KG2 A;  4MF2 A;  3H0R B;  5L1K A;  2WTF A;  3TQ1 A;  9ICX A;  4I28 A;  2WF5 A;  4F5P A;  2ASJ A;  3ZDA A;  3T3F A;  2BDP A;  5HR6 A;  1X6I A;  5J2E A;  4RQ0 A;  3D2S A;  7ICP A;  3AN1 A;  1RDF A;  2W9M A;  2W9A A;  4F2S A;  3NVW A;  4R66 A;  8ICP A;  1QLN A;  4RPZ A;  2QLT A;  3RJH A;  3Q8Q B;  4JUZ A;  1D8Y A;  1Z4O A;  3RJJ A;  3C2L A;  3PMN A;  3DV9 A;  2IMW P;  1S5L U;  3TAN A;  5EE3 A;  1QQ6 A;  5J29 A;  2QAR B;  1U4B A;  3IG8 A;  3RFA A;  3M1Y A;  1N5X A;  1NJZ A;  4PGQ A;  4C8N A;  2V4R A;  2W9B A;  4HAI A;  3PSF A;  2KD1 A;  4YXJ A;  3D2N A;  4F2R A;  4O3N A;  3TAD C;  5ALP A;  5J0S A;  4J03 A;  3B0X A;  2ZIV A;  3GQC A;  5ALN A;  4Q8E A;  9ICB A;  3DDH A;  1YT3 A;  2GWS A;  1X66 A;  5ALJ A;  5ALV A;  4PHP A;  5KFF A;  4Q43 A;  5KFI A;  1KFD A;  3PW7 A;  2RP5 A;  1JI7 A;  3ICX A;  3M9O B;  2W11 A;  3NUQ A;  2F76 X;  4XA5 A;  3HKZ C;  3LVV A;  3RAQ A;  7ICI A;  1DRG A;  2WF7 A;  5KFO A;  3PO4 A;  2DL0 A;  3F2B A;  2BPF A;  4PHA A;  4MFA A;  5KFJ A;  3PR5 B;  4QZE A;  4YXM A;  1ZRM A;  2EH9 A;  4F5Q A;  2PFQ A;  2K60 A;  3OJU A;  2DQN B;  4IC9 A;  4MHV A;  3BZC A;  5AK6 A;  5DLG A;  1TE2 A;  2F1J A;  2W03 A;  1BNP A;  9ICP A;  4CNQ A;  2KKV A;  2KV2 A;  3OSP A;  7ICL A;  4FO6 A;  2FLP A;  4UAZ A;  2BQ3 A;  1TAM A;  3QNM A;  3MDC A;  4NLK A;  2P35 A;  1SL1 A;  3IM1 A;  2H3V A;  4TUQ A;  4PHD A;  1MA7 A;  3UXO A;  1UCV A;  3RF9 A;  4B9L A;  1ZD3 A;  5DBB A;  5J2I A;  2AGO A;  1O03 A;  1TK5 A;  4EZ9 A;  3F5E A;  1ARO P;  5KFH A;  1BPD A;  4DSE A;  5KG0 A;  4C4S A;  3MGI A;  3GZF A;  5AK5 A;  4DOA A;  2G5H B;  3LDA A;  4KN4 A;  2ATL A;  2R8J A;  5KFN A;  4QWC A;  7ICV A;  3IG5 A;  1NK4 A;  5AM3 A;  3V7J A;  3FYH A;  4TUS A;  1NJW A;  2ZIV B;  5J2C A;  3KHG A;  3ZDE A;  2EQY A;  1ZQH A;  2P66 A;  2Q4T A;  3AUO A;  3QYP A;  2AQ4 A;  2LYB A;  5DB7 A;  3D2Q A;  4PGY A;  1DK3 A;  3WK8 A;  1LV5 A;  2H5X A;  4DFJ A;  4EEY A;  2KP7 A;  9ICA A;  1T8E A;  4YMN A;  3QZ7 A;  3C2M A;  3ZDC A;  3WU2 U;  3RRH A;  2I5H A;  4IR1 A;  1X40 A;  4R64 A;  1X9M A;  3GDX A;  5KFG A;  1A76 A;  3FDS A;  2W8L A;  2NO5 A;  2HBL A;  2Y9T A;  2HHS A;  3BS5 B;  2UVU A;  2HVI A;  4QWA A;  2P6U A;  5GTI U;  2NRX A;  3QU4 A;  5ALW A;  3H0M B;  1KBU A;  5KL1 B;  2N1R A;  3R9K A;  3WKE A;  1OXJ A;  1RPL A;  3PX6 A;  1Q46 A;  4RQN A;  5J0Q A;  2EAN A;  3GIK A;  4Q45 A;  1ZXI A;  4DLG A;  3C28 A;  8ICN A;  3V6K A;  4UAW A;  1WG8 A;  2C22 A;  4FZM A;  1VLB A;  3EPG A;  4I2G A;  1P7D A;  4KLD A;  3C5F A;  4NLC A;  4R65 A;  4FS2 A;  5HML A;  2LYH A;  2DWQ A;  4DL7 A;  1ZQE A;  3WKB A;  3HP6 A;  2BCU A;  3ZD8 A;  3AL0 B;  2RRD A;  2NV3 A;  7ICR A;  3RJK A;  2PXI A;  4C8O A;  4DS5 A;  5KFP A;  4ELU A;  2KOB A;  4F5N A;  4AYB C;  3Q8L A;  2EAM A;  1NK5 A;  3C29 A;  1SKW A;  1X9S A;  4ECR A;  1T3Q A;  3BQ2 A;  1PVP A;  1NZB A;  4IRC A;  1XC9 A;  5KG1 A;  2IOF K;  2AJQ A;  4I2H A;  2ZIW B;  5J2K A;  3NVY A;  9ICC A;  2A1J A;  2PFN A;  9ICS A;  3C2K A;  4O3Q A;  5AI5 A;  2B0C A;  5KFK A;  4QZH A;  4C4T A;  2PMZ F;  5AI0 A;  4P0Q B;  2PFP A;  5L1I A;  4OJP A;  1BPE A;  2JR5 A;  5KFD A;  3AQF A;  1HUZ A;  2Y0S F;  4ED7 A;  3SD7 A;  4ZOH C;  1JX4 A;  2YMQ A;  2W9C A;  1KEJ A;  5F3X B;  2MRL A;  4J9N A;  3WK6 A;  1SWW A;  4QZD A;  1YZ7 A;  1NK8 A;  1DOQ A;  3KZX A;  1SL0 A;  1IG6 A;  3VC8 A;  5DB9 A;  7ICK A;  2BPG A;  1SZH A;  1L8O A;  2EZZ A;  2W7O A;  4UAV A;  4PHE A;  2K8B B;  2NO4 A;  2G5I B;  4R63 A;  5G5H A;  5KAF U;  2ISO A;  5AK3 A;  3QUT A;  5ALQ A;  4BGD A;  1S77 D;  1SIJ A;  1X6J A;  2Q0Z X;  4I2J A;  3UMB A;  3RB0 A;  4M0A A;  3IHQ B;  3K4G A;  4KX3 A;  3F2D A;  5C5J A;  1L3S A;  1S0N A;  4KLH A;  3DEE A;  1TAU A;  2KMD A;  4E0D A;  3RTV A;  5J0W A;  4O5C A;  4ED1 A;  3N28 A;  1ZQR A;  1XU4 A;  2IOF A;  8ICQ A;  3K1R B;  3ZDB A;  3SAH A;  3SI8 A;  1V85 A;  4F3O A;  9ICM A;  2HVH A;  2ESE A;  3JPQ A;  3BQ1 A;  5HMM A;  1UT5 A;  2FLN A;  1QSY A;  2WF8 A;  4C8K A;  2KTQ A;  3T79 A;  4P0P B;  1ZQP A;  4M9J A;  2C2E A;  3PNC A;  3UMC A;  4JV0 A;  4IS7 A;  4I2A A;  3PX0 A;  5HR7 A;  4KLI A;  2R8G A;  3L3F X;  1S9F A;  1Q3V A;  4CDG A;  4GXI A;  1ZQ1 C;  2W3R A;  3LWL A;  1JN3 A;  1TK8 A;  5KFV A;  5EE9 A;  5E79 U;  2E3T A;  4U6P A;  2Y1J A;  2K8A A;  3PX4 A;  7ICG A;  1NK9 A;  1Z00 A;  4DFM A;  3F5A A;  9ICQ A;  1V97 A;  1URJ A;  4BUG A;  5KT6 A;  1NK0 A;  3TFR A;  4ECV A;  1L3U A;  2BCQ A;  3OGU A;  3SZ2 A;  4I29 A;  3PW0 A;  9ICW A;  2YY6 A;  3HJE A;  1JUD A;  1M6Y A;  3OJS A;  1Z19 A;  4RPY A;  1HIW A;  2CPR A;  4GFJ A;  2XO7 A;  1J2N A;  1N62 A;  1LKY B;  2W04 A;  5DLF A;  4P2H A;  3RR8 A;  4K4I A;  3C5G A;  4UB5 A;  3QZ8 A;  1UT8 A;  4IL6 U;  4J9L A;  5J2B A;  9ICE A;  3PML A;  2HBJ A;  4I2I A;  1ZQO A;  1UQV A;  1S76 D;  9ICU A;  2OH2 A;  5DG8 A;  3RB6 A;  2FI1 A;  8ICA A;  3QU2 A;  1MQ3 A;  5AKL A;  8ICF A;  3NVV A;  5TZV A;  7ICT A;  4ECW A;  4M9L A;  2JZB B;  4MEX A;  5HHH A;  5AHX A;  3MGV A;  1DGJ A;  1ZD5 A;  1D9F A;  4PPX A;  3IV6 A;  2FE9 A;  1JMS A;  2XY6 A;  2QAR A;  4JWN A;  2AXT U;  1ZQU A;  5AK4 A;  3SEI A;  2HSZ A;  5J0X A;  1BNO A;  3SQI A;  4DWI A;  2KFN A;  5KT3 A;  1KSP A;  4NWI A;  8ICX A;  2XY5 A;  3PSP A;  4YR0 A;  3SYZ A;  2C28 A;  2K8C B;  4YG2 A;  2JHD A;  2BHN A;  3B9J A;  2YX8 A;  4UAT A;  1UPH A;  2WF6 A;  1ZD2 P;  5KT2 A;  4M2Y A;  3L4P A;  1ZQL A;  1FEZ A;  4UBC A;  4F4Y A;  2ZUB A;  2OCE A;  4FBT A;  1SXE A;  5KFX A;  3T5L A;  5ALF A;  4ECT A;  4JWM A;  4BWJ A;  4ICA A;  8ICY A;  3CW2 C;  4RT2 A;  1KFT A;  2HBM A;  4CRX A;  2JH1 A;  1AQ6 A;  2FLL A;  3EWA A;  5T14 A;  1WYG A;  3AU2 A;  4FZN A;  4IR9 A;  4UB4 A;  4UB8 U;  4US8 A;  5FP0 A;  2HHX A;  2MUT B;  2K4I A;  1NNL A;  3IDW A;  4UAU A;  3RRG A;  3BJY A;  5AM2 A;  2B21 A;  1L7N A;  3KHH A;  1FO4 A;  1ZQJ A;  1XO0 A;  5CWR A;  1TVA A;  2RDI A;  1MSW D;  2LKY A;  4CGZ A;  3LYS A;  1T3N A;  1ZQV A;  1RXW A;  1KL9 A;  4J9R A;  5AKH A;  2KIW A;  2EZY A;  3RBD A;  3MR3 A;  4UBB A; 
#chains in the Genus database with same CATH homology
 2JXJ A;  2JRZ A;  2YQE A;  5CEH A;  1KQQ A;  2EH9 A;  4LJX A;  2EQY A;  1IG6 A;  2LM1 A;  2KK0 A;  1KN5 A;  2LI6 A;  2OEH A;  1KKX A;  2CXY A;  1RYU A;  2RQ5 A;  1C20 A;  5K4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...