2EQYA

Solution structure of the arid domain of jarid1b protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
GSSGSSGEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTSDTKDKEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji, AT rich interactive domain 1B
publication title Solution structure of the ARID domain of Jarid1b protein
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2eqyA01
2YQEA 5K4LA 2KK0A 2EQYA 2OEHA 1KN5A 1C20A 1IG6A 1KKXA 2JRZA 2CXYA 5CEHA 2RQ5A 2LI6A 4LJXA 1KQQA 2EH9A 2LM1A 1RYUA 2JXJA
chains in the Genus database with same CATH superfamily
2FLPA 3IHQB 1WCNA 2W3RA 4RPYA 3T79A 3GZFA 4ELUA 1NJZA 4MEXA 3AL0B 4JV2A 4ED3A 3F2CA 2KNJA 2JEFA 3AN1A 4NXZA 2OH2A 4MEYA 2QB0A 1JALA 5ALIA 3EPIA 2AJQA 3RJJA 5DG8A 1B43A 1KEJA 2KIWA 5K4LA 4F4KA 2NRWA 2VANA 2YMQA 4PZOA 4PPXA 1KW4A 2I5HA 2E3TA 3IP4B 4Q8FA 2EZZA 5JUMA 3PX6A 5KFTA 3DV9A 3U26A 2LBOA 1Q3UA 1NI3A 3H8MA 2JEIA 2JZBA 4QW9A 4KN7A 3RFAA 3IDWA 3BJYA 2PKEA 2WB1C 1SKWA 4RT2A 2ZJ8A 3FDSA 2HBKA 2QB1A 1QQ7A 2Y9UA 8ICQA 3RRGA 3NS1A 5IIKA 1JROA 1PK3A 2BPCA 1NKEA 3UXOA 8ICGA 1QH9A 1ZQAA 1OXJA 1J2NA 4Q8EA 4PGQA 4IQWA 5J0XA 8ICBA 1KBUA 1U48A 1XC9A 4DF4A 4DSEA 3RJIA 4ZOHC 1C20A 4RU9A 5AKHA 4HYKA 5DQGA 4F93B 2BCUA 4Y2YA 4FBUA 2F1IA 5BOLA 3TANA 1ZD5A 3JPQA 4XUSA 5J2DA 2AQ4A 2JH1A 4BXOB 3ZD9A 1COKA 4DL4A 1ZQPA 2IHMA 3M7DA 3RRHA 4ED7A 5AM1A 5J2GA 4US8A 2RDIA 5JTIA 4JUZA 9ICFA 2BDPA 2FPKA 1SB3C 1MSWD 2EDUA 3WKDA 4PHPA 2W7PA 3UM9A 3GV5B 2W55A 2LPEA 4FZNA 1L5UA 5EOZA 5IIMA 1SL1A 2W11A 4Y2QA 3MDCA 4EBCA 1ZQ1C 3MGHA 4DFMA 5DB7A 3JPSA 1N2XA 1TVAA 5L1JA 2K60A 1BPXA 4TUSA 3K4GA 2XIDA 3QZ8A 1WG8A 3GFKB 2F76X 3GILA 4C0ZA 3DDHA 4DOBA 1UPHA 8ICAA 1NK6A 1BNPA 1KKXA 3Q8MA 2IMWP 5AKZA 3SEIA 3V7LA 3QE9Y 4RQ6A 1LB2B 1NKBA 3D2SA 1X42A 4RUCA 4UB6U 3UMCA 2JEGA 1Z00B 2PFOA 1RDFA 3JPOA 4DQQA 3PSPA 2RLTA 1RQLA 4Y2JA 5ALXA 4O3RA 4UB2A 3RBEA 4I2FA 3PW2A 2JHDA 3RB6A 4DL7A 4RZRA 4JK1A 1T3QA 5AK5A 1X9MA 3HKZC 2FMPA 4ECTA 2H3FA 2H5XA 1X9WA 2W9CA 1XSNA 2W03A 2FPMA 1S77D 3GIJA 4RQNA 8ICLA 1CEZA 8ICVA 1V38A 5DLGA 1ZQMA 2FLLA 1P7DA 5CA7A 4Y2PA 1HJPA 3MGIA 3B0YA 4RQ1A 1Q3VA 4MFFA 4F4WA 1S5LU 2JXJA 5IIIA 5AI4A 1KL9A 3RJKA 2KHQA 2ZIWA 4DSJA 5J2FA 3K1ZA 3C5FA 3T3FA 2W9MA 2HHQA 3GIMA 4ED1A 1UHUA 2KJ5A 2W9BB 3F2BA 2G5HB 5C0YA 5AKLA 5ALUA 2F44A 4QWBA 5G5HA 1S97A 3S6JA 4UASA 4R8UB 2RDJA 1X9SA 5EWGA 1KFDA 1ZQTA 4BUGA 2ASJA 2BHNA 2KJ9A 2KP7A 1ZQSA 1F5SA 4I2DA 4M9NA 2L5YA 5ALVA 1NK7A 8ICFA 5F9NA 5KFSA 1TK8A 1T7PA 4EBDA 3HT3A 1ZD4A 2R18A 2NO5A 4FS2A 3HX0A 3E2EA 2VA2A 4UAVA 2QARA 4RPXA 1JN3A 3ZDBA 1WWUA 2JH7A 1IIPA 4M04A 4UATA 2A1AA 4ECZA 3FYHA 2MU2A 5A0LA 3SYZA 4DL3A 5IINA 4QZCA 3Q8QB 2PFNA 2AGOA 1HUOA 4JWNA 3LVWA 2KV2A 5H2FU 3KFUF 4K4HA 4DOCA 2W7OA 1HUZA 1BPYA 3HILA 2VJ5A 1L8LA 5DDYA 4F8RA 5AM2A 2F3NA 3SZ2A 4FZLA 4ECUA 5DKWA 3H0MB 4QWCA 1PVQA 2G09A 1S0NA 4Z6EA 3SAFA 2OHFA 5EE9A 4NV0A 4CF5A 1NKCA 5KFXA 4IL6U 2PI5A 5CJ7A 5AHXA 2EAOA 7ICQA 1ZJNA 4J9SA 4DLEA 4RQ3A 9ICOA 1K5OA 4QJFB 4KMUA 5KFYA 5KFWA 4DFJA 3LWLA 4ECYA 3OSPA 1TAQA 2V9WA 2AGPA 9ICPA 1PK1B 4NLNA 4O3QA 2EQYA 2H3VA 3PW5A 4Y2RA 4MHVA 4ED8A 1NK5A 4RPZA 4UB3A 1ZQNA 1QLNA 5KL8B 4EELA 3KHLA 5DLFA 4CRXA 5AIAA 4RQ7A 4RQ4A 1AROP 3OGUA 9ICXA 2ZTDA 5HMMA 2HMXA 4EENA 3J81j 2A19A 1ZYQA 4HAIA 4YCXA 2F8LA 3I1YA 3MFHA 4KLTA 3SMVA 3K75D 1L7NA 2RP5A 5J2HA 3ZDDA 1TAUA 3OSNA 3UMGA 3KD3A 8ICUA 1N60A 7ICIA 2KJ8A 4NM1A 3MDAA 4O0IA 5KG2A 2WB1F 7ICEA 2DF4B 3ETRA 2BQ3A 5DQIA 4DS5A 4Y2UA 4E0DA 5CRXA 1N62A 7ICSA 5J0PA 5ALOA 5AI5A 5JU5A 1NJXA 2ZIWB 4M6WB 4GC6A 3PO5A 2RRDA 4UB4A 2I9GA 1J97A 1FO4A 3IV6A 1QQ5A 3RH5A 1WYGA 4Q44A 2K4HA 4O3OA 2DKZA 4R63A 4X5VA 4QIWC 4KLGA 4Z6DA 5KFKA 4B9TA 2F1JA 2M9NA 4UBCA 2I1QA 5AI8A 4DOAA 4GLXA 4QZ9A 2KTQA 4DQIA 2VA3A 5KFOA 3QZ7A 1V85A 4NY8A 3L4PA 2AU0A 2A1JB 4USAA 3PMLA 4BXOA 4QW8A 7ICUA 2BCSA 1DK2A 1YT3A 3C1YA 4YQWA 4RQ2A 1PVRA 1YZ6A 4TUQA 3GIIA 1ZQEA 2BCRA 4DEZA 2WF8A 3WKEA 5IIOA 4J9QA 5KFRA 3WK7A 2G0AA 2EH9A 3N97B 2Q4TA 4PHEA 5KFBA 4JWMA 1NJWA 1JXLA 2J6UA 4ELTA 2P66A 1ZRNA 2BQRA 1NJYA 1SWVA 3RB4A 3NASA 1SIJA 4J9RA 3FAHA 3NUQA 2WHEA 2NV3A 5DDMA 1MC8A 2WTFA 3KOOA 4FFDA 1DGJA 1SGGA 5HHIA 2B0CA 3EZ5A 3ZI4A 4PGXA 1A77A 5DB8A 3V6HA 2LMRA 5AM3A 3O0FA 1ECWA 4IRDA 1Z00A 5CEHA 1ZQZA 1TK5A 3CW2C 1RM6C 4ICAA 3F5EA 1PUZA 3KKAA 3BZKA 2W8KA 2NRTA 4QZFA 5L1IA 2R8GA 3QEAZ 3RF9A 4YR0A 5HR7A 3M9MB 2AH5A 2VIXA 4KLMA 4QZ8A 2E8OA 5AIBA 3C2KA 3PV8A 2G5IB 3H4BA 4I2IA 1UT5A 2ATLA 3HKZF 1NK0A 5DGBA 2KK0A 2DQNB 3WKCA 1VJ5A 4PL2A 2UVWA 5KFPA 2KZZA 1QTMA 2HDOA 3M9OB 2MRLA 4O5EA 1SV0C 4QZHA 1LVHA 4O3NA 5EWEA 3RB0A 2GH1A 1L7MA 1JUDA 4YMNA 1QCKA 2W9BA 3GV8B 2R8IA 4DS4A 4QZAA 4CF3A 5J0SA 2KZMA 5J2EA 4AYBC 7ICFA 5KG6A 5KT6A 3PX4A 3H7IA 4R8UA 4IQTA 2HVIA 4DFKA 2EZYA 3SD7A 1NNLA 1B0XA 3TFRA 2I6XA 4GXKA 5ALWA 1U49A 4UQGA 4P4PA 2BPFA 7ICVA 1ZQWA 2RQ5A 1TKDA 5J8YC 1DK3A 1FFUA 3KBBA 4BWMA 2ISPA 5AI6A 4GFJA 1MQ3A 4J9OA 5J2CA 3C23A 2K8BB 5B5EU 4M9HA 3RR8A 4RT3A 4YMMA 5ALLA 4YP3A 4P0QB 3GIKA 4J9MA 2XGPA 1QSSA 3PR5B 2LKYA 9ICCA 2HW3A 1A6SA 3TQ1A 1RYSA 3MR5A 2MSNA 2MUTB 3B9JA 2PXIA 4NLCA 3BS5A 2UVVA 1ZQJA 3D2QA 2OEHA 2YTUA 5AKIA 4EEYA 1XWLA 3AQEA 4FS1A 2KEYA 2Q0ZX 3C2LA 2CXYA 1SV4A 5J2KA 1LKYB 4J9LA 5L1LA 1WWVA 3PZPA 5HP4A 4GXJA 3T5JA 4OJLA 1RYUA 3MR6A 1N63A 5GTIU 2GWSA 2O6KA 2ZIXB 4IQVA 1PZNA 2XCPA 3AMZA 2H3QA 1N61A 1XSLA 3HWTA 2UVRA 1SXDA 1PK1A 4KLQA 1SV0A 3Q8PB 2ASDA 5HR6A 4CCHA 3I76A 4OD0A 1L7OA 1Z3EB 3MFIA 3WK9A 3EYZA 4GIBA 2PMZC 4GXIA 4ECXA 1H38A 2BGWA 4C4TA 3H40A 1XSPA 4YXJA 2XY7A 1BNOA 3FC4A 4NL9C 1XO0A 1Z4NA 3F5AA 2ZIVB 3RH6A 3RAQA 2ALZA 3OPXA 1XO1A 8ICKA 1HEKA 3HJEA 3QUTA 3WKAA 1CRXA 3NRZA 8ICPA 5KFGA 9ICNA 3N7RC 4IR1A 4YR3A 1TFRA 2ZUBA 4QWDA 3CNHA 1UA1A 4KLEA 8ICIA 2E8NA 3OHAA 1SKSA 4KLDA 2OXOA 2QLTA 4BDPA 1SWWA 3GU3A 2WF7A 4M9JA 4R65A 5EWFA 4I2BA 2ZIUB 4I28A 2JMGA 5J8YA 4F71A 1Y88A 3F53A 4J9KA 4FZMA 5DG9A 1S10A 4M6WA 1KTQA 3ZDEA 3PSIA 4O9MA 7ICPA 4LZDA 3QUQA 5EE1A 4J9PA 2LYAA 2Y9TA 1SKRA 9ICLA 5J0YA 4LZGA 4KLUA 2YB4A 5EE3A 3SV3A 2C22A 1N5XA 2QKQA 4ECVA 4QIWF 4P4MA 2W9AA 4B9LA 3TFSA 1N5WA 2DFLA 3SI8A 4CE6A 3TADC 5J0WA 1D8YA 2A1JA 3RBDA 1BGXT 2AQ0A 8ICOA 3TARA 3C1ZA 2XY6A 1FEZA 4OJPA 1X2IA 2KVSA 3HPOA 4QWAA 1EXNA 2ZXHA 2EANA 5CB1A 2KFNA 2W04A 2M0NA 2HOQA 1QQ6A 5KG3A 1ZQIA 2WF5A 3M9NB 3ED5A 1T3NA 3MC1A 3L3FX 1KN5A 9ICRA 5AKYA 2H3IA 1FFVA 3OJSA 3EUB2 2H3ZA 4TQRA 3I28A 2EZXA 2E8MA 2F2AB 4IR9A 4F50A 2YY6A 4DO9A 4NLGA 4PHDA 4I2AA 4KLOA 8ICHA 3IG8A 4DQSA 4NL9A 1U45A 3BS5B 5E79U 2EAMA 3C2MA 4KX5A 3KTQA 1SL2A 3LYSA 2BQUA 4CF4A 3KZIU 2AGQA 3H4DA 1NK9A 3NRWA 2VA8A 5HNKA 2GLEA 2V4QA 2AXTU 3MR3A 1UA0A 3QNMA 1S0VA 7ICKA 4ED6A 5DGAA 5AKXA 2D3DA 5C5JA 5AKJA 4LVSA 1X9XA 1UCVA 5IIJA 3SAHA 3T5KA 3E58A 2YMMA 7ICMA 4FBTA 3UPQA 3T5LA 1L3VA 9ICKA 3SQIA 2D8CA 2C2DA 8ICRA 8ICZA 4NLBA 4RNMA 3QU2A 3PY8A 2GO7A 2FDRA 4G3IA 4B6JA 2ZXIA 4K4IA 1MN8A 5JRTA 4TQSA 5ALEA 1ZQXA 1RXVA 1BPEA 4TURA 4DL2A 2F77X 5ALQA 3TADA 2W3SA 3D2NA 8ICMA 3F2DA 3SENA 4DWIA 1WCLA 8ICWA 3Q8SB 3RAXA 3NVYA 4YMOA 3KKAC 3ONNA 2HBJA 1M6YA 2KE7A 3QU9A 4IQUA 4KMOB 7ICLA 3AEVA 5DG7A 4EYIB 2DBYA 4KLLA 3JPPA 4F4YA 3M8SA 9ICHA 1NK8A 5ALJA 2F8KA 3H8JA 2LM4A 2HCFA 4AYBF 1BPZA 2IA6A 4IS7A 3WKBA 3BQ1A 1O08A 3G6YA 4U6PA 3NGDA 4F5RA 4PH5A 2YMPA 4QZGA 1D8LA 1O03A 9ICIA 1FIQA 1KFSA 2BCQA 5D49A 2CPRA 5KFLA 4ECRA 5ALZA 2C2RA 4IRKA 4ELVA 4J9NA 4QNLA 2KFZA 1RQNA 5ALTA 9ICQA 3QUCA 4F3OA 4P0PB 5KG0A 2XI9A 1N48A 2NRZA 4AP9A 4R66A 3M8RA 2FMSA 5AKKA 2AHOB 1HIWA 2ESEA 2NRXA 4B9VA 3N4MB 4P0QA 3BQTA 4ED2A 2Y1JA 5CP2A 4BJQA 2WF9A 5KFUA 1JI7A 2KZ3A 4Y2XA 1BPDA 2KD1A 3BDPA 4I27A 3K1RB 2J6SA 2MUTA 4P2HA 2W54A 1L8OA 5FP0A 1DGSA 1OUQA 1GO3F 3A0HU 1RYRA 3MR2A 2XO7A 3TAPA 1IV8A 4QZDA 2LYHA 4F2RA 2C28A 5KT4A 2NYVA 3JPTA 2XGQA 1ZXIA 4O3SA 8ICNA 1LKYA 1D8BA 3EWAA 4B9MA 1T94A 3R9KA 4JMUA 3AU2A 4B9SA 2ZIXA 4FE3A 5T14A 5D4BA 5KT5A 4Q45A 4Z6CA 2ZUDA 4OJOA 3GDXA 1ZQCA 2FPLA 2ISOA 5J2IA 5AM5A 1BVSA 4ECWA 3G6VA 7ICJA 2OM6A 5KTQA 3NVZA 4GC7A 3PMNA 2IOHA 3UXNA 3BZCA 5ALKA 4UB1A 5L1KA 4JV1A 3LVVA 3H0LB 3RJEA 8ICJA 1LV5A 2HHWA 2N1RA 7ICOA 2F1HA 4OJ6A 2PMZF 2E5SA 3MABA 2ZIVA 1IXRA 3ZDAA 2FJ6A 3TI0A 3EW9A 4P4OA 4DSKA 4QWEA 1XS9D 3QU7A 5ALSA 2DPJA 1KRPA 3Q8KA 4MFCA 4FO6A 1ZD2P 3PSFA 5AK4A 3RB3A 4DQRA 9ICWA 4Y2SA 4JB3A 4ACOA 2VJ4A 3TACB 2J6TA 2P6UA 4PL1A 2IOFK 3WK6A 3LK9A 2XY5A 2P6RA 2HOFA 5KNIA 2XVTA 4NLZA 3ISCA 5ALFA 1TV9A 3V6KA 1KLNA 5KFIA 2ZIUA 2HSZA 1Z1VA 4DSLA 2HHUA 4NJ8A 1ZOLA 4B9UA 9ICMA 4EX6A 2G06A 4DSFA 3QU5A 2Z7JA 3LWMA 5HHHA 3CRXA 9ICJA 1RG6A 2DGZA 2HBMA 1ZQBA 4IRCA 1PVPA 3IM1A 4CNQA 9ICEA 1DXSA 2KICA 1TE2A 3QUBA 3C28A 3A0BU 5ALNA 2FI1A 2ZJ5A 1VLBA 3IG5A 2LHTA 4KX3A 4ECSA 2KMDA 2CRXA 3VCBA 5KAFU 2EAPA 3VC8A 4UAZA 1ZQGA 5F9LA 4C4SA 8ICEA 4RNOA 2LYBA 3TKAA 4DLGA 7ICGA 4NM2A 1D9FA 2HBLA 2K4IA 4C8LA 4YG2A 4BWJA 1SXEA 3GV7B 5AK6A 4ED0A 2KSOB 3IN5A 2NO4A 4QZEA 2UVUA 3BQ2A 4WJ3B 4DF8A 1ED1A 4Y2TA 5ALMA 3PNCA 3THVA 7ICNA 3QYPA 4NLKA 4BGDA 1NZBA 3E0FA 2YX8A 9ICAA 9ICSA 1NOMA 1SL0A 5AK3A 5ALPA 2YB1A 1A76A 1X6JA 2ODGA 4Z6FA 2E1FA 2XC9A 1Z19A 3V7JA 3WK8A 4I29A 3NVVA 1NZPA 3OJUA 2HHXA 3QX7A 5D46A 5DB9A 2FMQA 5BPCA 3RJGA 3AM9A 2K4PA 3NTUA 1URJA 5AKGA 1U9LA 2FE9A 4TUPA 3IRUA 3GQCA 4DL6A 4DFPA 1RZTA 1TAMA 1S0MA 2WF6A 2K89A 2IBKA 3KZXA 4UAWA 2KHVA 4KLFA 4Y2VA 2HOIA 9ICUA 4NWIA 2WFAA 5KG1A 3WK5A 2BDUA 5G5GA 8ICSA 1ZRMA 3OHBA 4MF2A 5GTHU 9ICTA 2K8CB 3ETLA 1U47A 2WAQC 3ISBA 1BPBA 1IM4A 5DQHA 5CR0A 1KQQA 5IILA 2ZTCA 4I2JA 4I2EA 2Y0SC 5KFEA 3PR4A 3DEEA 1ZQUA 3FM9A 4Q43A 2R8HA 1L7PA 2NRVA 1B22A 1JIHA 4KLIA 4F72A 4DSIA 1KSPA 4RQ8A 3WK4A 1V97A 3H8WA 2HHVA 1JXEA 7ICTA 2D6FC 4US9A 3RR7A 5KFCA 3RH4A 3PW0A 5F3XB 4CGZA 4RUAA 1QSYA 2YN4A 3ICXA 4M9GA 2QB0B 2JV3A 3H8SA 3N7PD 1DRGA 1XU4A 4MFAA 3PX0A 4YD2A 3QXGA 3TAQA 3CYMA 1UT8A 3BS7A 4F4ZA 5DBBA 1JX4A 2KN7A 5CWRA 5KFVA 4EEKA 3C21A 2BKEA 4G9BA 4PJ0U 1S76D 3WU2U 5AI0A 1OW5A 1K1QA 1SZHA 5CHGA 5KT7A 1K1SA 4OCZA 1X6IA 3AQFA 4O3PA 4ECQA 3M6ZA 5ALYA 1ZETA 3BQ0A 3PW4A 2JZBB 3CP8A 4P0PA 2BPGA 1B4FA 4UW9A 1L6NA 2ES6A 4O3MA 2ZUCA 5L1MA 4M47A 1ZQVA 1N56A 3M1YA 3Q8LA 4F2SA 1ZQQA 4JV0A 5ALDA 1D9DA 2YMLA 2E1EA 2W8LA 1AQ6A 4XQ8A 5J0UA 2R8JA 4C8KA 4B9NA 2GOLA 1ZQKA 1IG6A 5KL1B 5ALGA 2KG5A 2PFPA 2XCAA 1X66A 3PVXA 1ZQFA 5J0OA 2LI6A 5AI9A 1J2MA 1MQ2A 2DPIA 4EBEA 7ICHA 3MGVA 1ZQLA 4O5CA 2HVHA 3C5GA 2V4RA 3UMBA 3ALRA 4F92B 5J0RA 5J29A 3C29A 1U4BA 3PW7A 4IC9A 5KG4A 2OWOA 4U7CA 8ICYA 3SR6A 1ZQRA 5KFQA 2HI0A 2DWQA 2DUYA 5L9XA 3QU4A 1CUKA 5DBAA 3EPGA 3UXPA 4F4XA 4K4GA 4F5OA 2JR5A 2DL0A 2YQEA 4C8NA 3HW8A 4KLSA 4M0AA 3M6KA 1S8OA 2DKXA 2KOBA 1C7YA 7ICRA 4F5NA 4YFKA 5AKEA 1ZD3A 5ALRA 4QZIA 3HP6A 5KG7A 2KVCA 4EYHB 4O5KA 4UAUA 2IOFA 4DFDA 9ICVA 2Y1IA 1JMSA 5KFHA 3PSTA 4C4RA 1L3UA 2B6GA 4EX7A 5KT3A 4XRHA 3L5KA 2BR0A 4ZH4A 4C7YA 1MA7A 2JRZA 5ALHA 2IHNA 1CI4A 2E8PA 4OJ5A 2HHSA 4F5QA 2HHTA 5DB6A 1ZQOA 2ASLA 3RJFA 3AUOA 1NK4A 5DBCA 2A3VA 4RQ0A 1S9FA 2KIVA 3Q8RB 2B21A 3ZD8A 8ICXA 2OYYA 8ICCA 9ICBA 5KG5A 1Q8KA 2ZJAA 2G07A 3MBYA 2XICA 4I2HA 2PFQA 4OO1J 4KTQA 1S0OA 3HRDD 3RTVA 2W9CB 4CDGA 4RQ5A 4J03A 2K8AA 4PHAA 4YN4A 5J2BA 5TISU 3V6JA 2JGAA 1L3TA 4YD1A 2KKPA 1SZPA 4KLJA 3ISDA 2ZTEA 5AM4A 5J0TA 5J0QA 1F44A 4I2GA 4M2YA 4F91B 4YXMA 9ICGA 2KSOA 5J2AA 1QSLA 2PI4A 2G08A 3ORYA 3RJHA 1ZQDA 4UARA 3V7KA 3UQ2A 3JPNA 3UQ0A 4F5PA 3T5HA 2VKQA 1L3SA 8ICTA 4PGYA 1YZ7A 4YR2A 5TZVA 1DOQA 1KFTA 4C8OA 1JRPA 5KFZA 4PZNA 3KHGA 5KT2A 5B66U 3KHRA 3SV4A 2CN1A 2MA1A 5KFMA 5KFFA 1RXWA 3QEBZ 1VDVA 1A0PA 2KKVA 2C2EA 5KFJA 4C7ZA 5J2JA 1WUDA 5KFAA 3N7SC 2K4EA 4I2CA 2RHFA 2QARB 1TK0A 1ZQYA 1F0MA 3B0XA 3V72A 4XA5A 5EE0A 4KLHA 4RNNA 5HMLA 2ZG6A 1ZJMA 5AICA 3BQ7A 1UQVA 2R8KA 4DL5A 1ZQHA 4QZBA 1RPLA 3N28A 1X40A 3G6XA 4A8EA 3NVWA 5KFDA 4RQMA 3SAGA 1COOA 4YVZA 4BX9C 4EZ6A 3PO4A 3OTQA 4LJXA 2JEJA 4UAYA 4C80A 2FLNA 4R64A 5AM0A 4KN4A 3LDAA 4KITB 4MF8A 3KHHA 2BZFA 3ZDCA 2WAQF 1T8EA 4UBBA 1XNSA 1Q46A 4UB5A 3JPRA 2MAXA 2P35A 1Z4OA 4EZ9A 1V9PA 1Z1BA 4UB8U 4C8MA 5KFNA 2OCEA 4M9LA 2BCVA 2W43A 4DCCA 5BOMA 1KDHA 5KAIU 2Y0SF 3AU6A 2LM1A 1T4GA 3D6JA 3H0RB 4DQPA
chains in the Genus database with same CATH topology
2YQEA 5K4LA 2KK0A 2EQYA 2OEHA 1KN5A 1C20A 1IG6A 1KKXA 2JRZA 2CXYA 5CEHA 2RQ5A 2LI6A 4LJXA 1KQQA 2EH9A 2LM1A 1RYUA 2JXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQE A;  5K4L A;  2KK0 A;  2EQY A;  2OEH A;  1KN5 A;  1C20 A;  1IG6 A;  1KKX A;  2JRZ A;  2CXY A;  5CEH A;  2RQ5 A;  2LI6 A;  4LJX A;  1KQQ A;  2EH9 A;  2LM1 A;  1RYU A;  2JXJ A; 
#chains in the Genus database with same CATH topology
 2FLP A;  3IHQ B;  1WCN A;  2W3R A;  4RPY A;  3T79 A;  3GZF A;  4ELU A;  1NJZ A;  4MEX A;  3AL0 B;  4JV2 A;  4ED3 A;  3F2C A;  2KNJ A;  2JEF A;  3AN1 A;  4NXZ A;  2OH2 A;  4MEY A;  2QB0 A;  1JAL A;  5ALI A;  3EPI A;  2AJQ A;  3RJJ A;  5DG8 A;  1B43 A;  1KEJ A;  2KIW A;  5K4L A;  4F4K A;  2NRW A;  2VAN A;  2YMQ A;  4PZO A;  4PPX A;  1KW4 A;  2I5H A;  2E3T A;  3IP4 B;  4Q8F A;  2EZZ A;  5JUM A;  3PX6 A;  5KFT A;  3DV9 A;  3U26 A;  2LBO A;  1Q3U A;  1NI3 A;  3H8M A;  2JEI A;  2JZB A;  4QW9 A;  4KN7 A;  3RFA A;  3IDW A;  3BJY A;  2PKE A;  2WB1 C;  1SKW A;  4RT2 A;  2ZJ8 A;  3FDS A;  2HBK A;  2QB1 A;  1QQ7 A;  2Y9U A;  8ICQ A;  3RRG A;  3NS1 A;  5IIK A;  1JRO A;  1PK3 A;  2BPC A;  1NKE A;  3UXO A;  8ICG A;  1QH9 A;  1ZQA A;  1OXJ A;  1J2N A;  4Q8E A;  4PGQ A;  4IQW A;  5J0X A;  8ICB A;  1KBU A;  1U48 A;  1XC9 A;  4DF4 A;  4DSE A;  3RJI A;  4ZOH C;  1C20 A;  4RU9 A;  5AKH A;  4HYK A;  5DQG A;  4F93 B;  2BCU A;  4Y2Y A;  4FBU A;  2F1I A;  5BOL A;  3TAN A;  1ZD5 A;  3JPQ A;  4XUS A;  5J2D A;  2AQ4 A;  2JH1 A;  4BXO B;  3ZD9 A;  1COK A;  4DL4 A;  1ZQP A;  2IHM A;  3M7D A;  3RRH A;  4ED7 A;  5AM1 A;  5J2G A;  4US8 A;  2RDI A;  5JTI A;  4JUZ A;  9ICF A;  2BDP A;  2FPK A;  1SB3 C;  1MSW D;  2EDU A;  3WKD A;  4PHP A;  2W7P A;  3UM9 A;  3GV5 B;  2W55 A;  2LPE A;  4FZN A;  1L5U A;  5EOZ A;  5IIM A;  1SL1 A;  2W11 A;  4Y2Q A;  3MDC A;  4EBC A;  1ZQ1 C;  3MGH A;  4DFM A;  5DB7 A;  3JPS A;  1N2X A;  1TVA A;  5L1J A;  2K60 A;  1BPX A;  4TUS A;  3K4G A;  2XID A;  3QZ8 A;  1WG8 A;  3GFK B;  2F76 X;  3GIL A;  4C0Z A;  3DDH A;  4DOB A;  1UPH A;  8ICA A;  1NK6 A;  1BNP A;  1KKX A;  3Q8M A;  2IMW P;  5AKZ A;  3SEI A;  3V7L A;  3QE9 Y;  4RQ6 A;  1LB2 B;  1NKB A;  3D2S A;  1X42 A;  4RUC A;  4UB6 U;  3UMC A;  2JEG A;  1Z00 B;  2PFO A;  1RDF A;  3JPO A;  4DQQ A;  3PSP A;  2RLT A;  1RQL A;  4Y2J A;  5ALX A;  4O3R A;  4UB2 A;  3RBE A;  4I2F A;  3PW2 A;  2JHD A;  3RB6 A;  4DL7 A;  4RZR A;  4JK1 A;  1T3Q A;  5AK5 A;  1X9M A;  3HKZ C;  2FMP A;  4ECT A;  2H3F A;  2H5X A;  1X9W A;  2W9C A;  1XSN A;  2W03 A;  2FPM A;  1S77 D;  3GIJ A;  4RQN A;  8ICL A;  1CEZ A;  8ICV A;  1V38 A;  5DLG A;  1ZQM A;  2FLL A;  1P7D A;  5CA7 A;  4Y2P A;  1HJP A;  3MGI A;  3B0Y A;  4RQ1 A;  1Q3V A;  4MFF A;  4F4W A;  1S5L U;  2JXJ A;  5III A;  5AI4 A;  1KL9 A;  3RJK A;  2KHQ A;  2ZIW A;  4DSJ A;  5J2F A;  3K1Z A;  3C5F A;  3T3F A;  2W9M A;  2HHQ A;  3GIM A;  4ED1 A;  1UHU A;  2KJ5 A;  2W9B B;  3F2B A;  2G5H B;  5C0Y A;  5AKL A;  5ALU A;  2F44 A;  4QWB A;  5G5H A;  1S97 A;  3S6J A;  4UAS A;  4R8U B;  2RDJ A;  1X9S A;  5EWG A;  1KFD A;  1ZQT A;  4BUG A;  2ASJ A;  2BHN A;  2KJ9 A;  2KP7 A;  1ZQS A;  1F5S A;  4I2D A;  4M9N A;  2L5Y A;  5ALV A;  1NK7 A;  8ICF A;  5F9N A;  5KFS A;  1TK8 A;  1T7P A;  4EBD A;  3HT3 A;  1ZD4 A;  2R18 A;  2NO5 A;  4FS2 A;  3HX0 A;  3E2E A;  2VA2 A;  4UAV A;  2QAR A;  4RPX A;  1JN3 A;  3ZDB A;  1WWU A;  2JH7 A;  1IIP A;  4M04 A;  4UAT A;  2A1A A;  4ECZ A;  3FYH A;  2MU2 A;  5A0L A;  3SYZ A;  4DL3 A;  5IIN A;  4QZC A;  3Q8Q B;  2PFN A;  2AGO A;  1HUO A;  4JWN A;  3LVW A;  2KV2 A;  5H2F U;  3KFU F;  4K4H A;  4DOC A;  2W7O A;  1HUZ A;  1BPY A;  3HIL A;  2VJ5 A;  1L8L A;  5DDY A;  4F8R A;  5AM2 A;  2F3N A;  3SZ2 A;  4FZL A;  4ECU A;  5DKW A;  3H0M B;  4QWC A;  1PVQ A;  2G09 A;  1S0N A;  4Z6E A;  3SAF A;  2OHF A;  5EE9 A;  4NV0 A;  4CF5 A;  1NKC A;  5KFX A;  4IL6 U;  2PI5 A;  5CJ7 A;  5AHX A;  2EAO A;  7ICQ A;  1ZJN A;  4J9S A;  4DLE A;  4RQ3 A;  9ICO A;  1K5O A;  4QJF B;  4KMU A;  5KFY A;  5KFW A;  4DFJ A;  3LWL A;  4ECY A;  3OSP A;  1TAQ A;  2V9W A;  2AGP A;  9ICP A;  1PK1 B;  4NLN A;  4O3Q A;  2EQY A;  2H3V A;  3PW5 A;  4Y2R A;  4MHV A;  4ED8 A;  1NK5 A;  4RPZ A;  4UB3 A;  1ZQN A;  1QLN A;  5KL8 B;  4EEL A;  3KHL A;  5DLF A;  4CRX A;  5AIA A;  4RQ7 A;  4RQ4 A;  1ARO P;  3OGU A;  9ICX A;  2ZTD A;  5HMM A;  2HMX A;  4EEN A;  3J81 j;  2A19 A;  1ZYQ A;  4HAI A;  4YCX A;  2F8L A;  3I1Y A;  3MFH A;  4KLT A;  3SMV A;  3K75 D;  1L7N A;  2RP5 A;  5J2H A;  3ZDD A;  1TAU A;  3OSN A;  3UMG A;  3KD3 A;  8ICU A;  1N60 A;  7ICI A;  2KJ8 A;  4NM1 A;  3MDA A;  4O0I A;  5KG2 A;  2WB1 F;  7ICE A;  2DF4 B;  3ETR A;  2BQ3 A;  5DQI A;  4DS5 A;  4Y2U A;  4E0D A;  5CRX A;  1N62 A;  7ICS A;  5J0P A;  5ALO A;  5AI5 A;  5JU5 A;  1NJX A;  2ZIW B;  4M6W B;  4GC6 A;  3PO5 A;  2RRD A;  4UB4 A;  2I9G A;  1J97 A;  1FO4 A;  3IV6 A;  1QQ5 A;  3RH5 A;  1WYG A;  4Q44 A;  2K4H A;  4O3O A;  2DKZ A;  4R63 A;  4X5V A;  4QIW C;  4KLG A;  4Z6D A;  5KFK A;  4B9T A;  2F1J A;  2M9N A;  4UBC A;  2I1Q A;  5AI8 A;  4DOA A;  4GLX A;  4QZ9 A;  2KTQ A;  4DQI A;  2VA3 A;  5KFO A;  3QZ7 A;  1V85 A;  4NY8 A;  3L4P A;  2AU0 A;  2A1J B;  4USA A;  3PML A;  4BXO A;  4QW8 A;  7ICU A;  2BCS A;  1DK2 A;  1YT3 A;  3C1Y A;  4YQW A;  4RQ2 A;  1PVR A;  1YZ6 A;  4TUQ A;  3GII A;  1ZQE A;  2BCR A;  4DEZ A;  2WF8 A;  3WKE A;  5IIO A;  4J9Q A;  5KFR A;  3WK7 A;  2G0A A;  2EH9 A;  3N97 B;  2Q4T A;  4PHE A;  5KFB A;  4JWM A;  1NJW A;  1JXL A;  2J6U A;  4ELT A;  2P66 A;  1ZRN A;  2BQR A;  1NJY A;  1SWV A;  3RB4 A;  3NAS A;  1SIJ A;  4J9R A;  3FAH A;  3NUQ A;  2WHE A;  2NV3 A;  5DDM A;  1MC8 A;  2WTF A;  3KOO A;  4FFD A;  1DGJ A;  1SGG A;  5HHI A;  2B0C A;  3EZ5 A;  3ZI4 A;  4PGX A;  1A77 A;  5DB8 A;  3V6H A;  2LMR A;  5AM3 A;  3O0F A;  1ECW A;  4IRD A;  1Z00 A;  5CEH A;  1ZQZ A;  1TK5 A;  3CW2 C;  1RM6 C;  4ICA A;  3F5E A;  1PUZ A;  3KKA A;  3BZK A;  2W8K A;  2NRT A;  4QZF A;  5L1I A;  2R8G A;  3QEA Z;  3RF9 A;  4YR0 A;  5HR7 A;  3M9M B;  2AH5 A;  2VIX A;  4KLM A;  4QZ8 A;  2E8O A;  5AIB A;  3C2K A;  3PV8 A;  2G5I B;  3H4B A;  4I2I A;  1UT5 A;  2ATL A;  3HKZ F;  1NK0 A;  5DGB A;  2KK0 A;  2DQN B;  3WKC A;  1VJ5 A;  4PL2 A;  2UVW A;  5KFP A;  2KZZ A;  1QTM A;  2HDO A;  3M9O B;  2MRL A;  4O5E A;  1SV0 C;  4QZH A;  1LVH A;  4O3N A;  5EWE A;  3RB0 A;  2GH1 A;  1L7M A;  1JUD A;  4YMN A;  1QCK A;  2W9B A;  3GV8 B;  2R8I A;  4DS4 A;  4QZA A;  4CF3 A;  5J0S A;  2KZM A;  5J2E A;  4AYB C;  7ICF A;  5KG6 A;  5KT6 A;  3PX4 A;  3H7I A;  4R8U A;  4IQT A;  2HVI A;  4DFK A;  2EZY A;  3SD7 A;  1NNL A;  1B0X A;  3TFR A;  2I6X A;  4GXK A;  5ALW A;  1U49 A;  4UQG A;  4P4P A;  2BPF A;  7ICV A;  1ZQW A;  2RQ5 A;  1TKD A;  5J8Y C;  1DK3 A;  1FFU A;  3KBB A;  4BWM A;  2ISP A;  5AI6 A;  4GFJ A;  1MQ3 A;  4J9O A;  5J2C A;  3C23 A;  2K8B B;  5B5E U;  4M9H A;  3RR8 A;  4RT3 A;  4YMM A;  5ALL A;  4YP3 A;  4P0Q B;  3GIK A;  4J9M A;  2XGP A;  1QSS A;  3PR5 B;  2LKY A;  9ICC A;  2HW3 A;  1A6S A;  3TQ1 A;  1RYS A;  3MR5 A;  2MSN A;  2MUT B;  3B9J A;  2PXI A;  4NLC A;  3BS5 A;  2UVV A;  1ZQJ A;  3D2Q A;  2OEH A;  2YTU A;  5AKI A;  4EEY A;  1XWL A;  3AQE A;  4FS1 A;  2KEY A;  2Q0Z X;  3C2L A;  2CXY A;  1SV4 A;  5J2K A;  1LKY B;  4J9L A;  5L1L A;  1WWV A;  3PZP A;  5HP4 A;  4GXJ A;  3T5J A;  4OJL A;  1RYU A;  3MR6 A;  1N63 A;  5GTI U;  2GWS A;  2O6K A;  2ZIX B;  4IQV A;  1PZN A;  2XCP A;  3AMZ A;  2H3Q A;  1N61 A;  1XSL A;  3HWT A;  2UVR A;  1SXD A;  1PK1 A;  4KLQ A;  1SV0 A;  3Q8P B;  2ASD A;  5HR6 A;  4CCH A;  3I76 A;  4OD0 A;  1L7O A;  1Z3E B;  3MFI A;  3WK9 A;  3EYZ A;  4GIB A;  2PMZ C;  4GXI A;  4ECX A;  1H38 A;  2BGW A;  4C4T A;  3H40 A;  1XSP A;  4YXJ A;  2XY7 A;  1BNO A;  3FC4 A;  4NL9 C;  1XO0 A;  1Z4N A;  3F5A A;  2ZIV B;  3RH6 A;  3RAQ A;  2ALZ A;  3OPX A;  1XO1 A;  8ICK A;  1HEK A;  3HJE A;  3QUT A;  3WKA A;  1CRX A;  3NRZ A;  8ICP A;  5KFG A;  9ICN A;  3N7R C;  4IR1 A;  4YR3 A;  1TFR A;  2ZUB A;  4QWD A;  3CNH A;  1UA1 A;  4KLE A;  8ICI A;  2E8N A;  3OHA A;  1SKS A;  4KLD A;  2OXO A;  2QLT A;  4BDP A;  1SWW A;  3GU3 A;  2WF7 A;  4M9J A;  4R65 A;  5EWF A;  4I2B A;  2ZIU B;  4I28 A;  2JMG A;  5J8Y A;  4F71 A;  1Y88 A;  3F53 A;  4J9K A;  4FZM A;  5DG9 A;  1S10 A;  4M6W A;  1KTQ A;  3ZDE A;  3PSI A;  4O9M A;  7ICP A;  4LZD A;  3QUQ A;  5EE1 A;  4J9P A;  2LYA A;  2Y9T A;  1SKR A;  9ICL A;  5J0Y A;  4LZG A;  4KLU A;  2YB4 A;  5EE3 A;  3SV3 A;  2C22 A;  1N5X A;  2QKQ A;  4ECV A;  4QIW F;  4P4M A;  2W9A A;  4B9L A;  3TFS A;  1N5W A;  2DFL A;  3SI8 A;  4CE6 A;  3TAD C;  5J0W A;  1D8Y A;  2A1J A;  3RBD A;  1BGX T;  2AQ0 A;  8ICO A;  3TAR A;  3C1Z A;  2XY6 A;  1FEZ A;  4OJP A;  1X2I A;  2KVS A;  3HPO A;  4QWA A;  1EXN A;  2ZXH A;  2EAN A;  5CB1 A;  2KFN A;  2W04 A;  2M0N A;  2HOQ A;  1QQ6 A;  5KG3 A;  1ZQI A;  2WF5 A;  3M9N B;  3ED5 A;  1T3N A;  3MC1 A;  3L3F X;  1KN5 A;  9ICR A;  5AKY A;  2H3I A;  1FFV A;  3OJS A;  3EUB 2;  2H3Z A;  4TQR A;  3I28 A;  2EZX A;  2E8M A;  2F2A B;  4IR9 A;  4F50 A;  2YY6 A;  4DO9 A;  4NLG A;  4PHD A;  4I2A A;  4KLO A;  8ICH A;  3IG8 A;  4DQS A;  4NL9 A;  1U45 A;  3BS5 B;  5E79 U;  2EAM A;  3C2M A;  4KX5 A;  3KTQ A;  1SL2 A;  3LYS A;  2BQU A;  4CF4 A;  3KZI U;  2AGQ A;  3H4D A;  1NK9 A;  3NRW A;  2VA8 A;  5HNK A;  2GLE A;  2V4Q A;  2AXT U;  3MR3 A;  1UA0 A;  3QNM A;  1S0V A;  7ICK A;  4ED6 A;  5DGA A;  5AKX A;  2D3D A;  5C5J A;  5AKJ A;  4LVS A;  1X9X A;  1UCV A;  5IIJ A;  3SAH A;  3T5K A;  3E58 A;  2YMM A;  7ICM A;  4FBT A;  3UPQ A;  3T5L A;  1L3V A;  9ICK A;  3SQI A;  2D8C A;  2C2D A;  8ICR A;  8ICZ A;  4NLB A;  4RNM A;  3QU2 A;  3PY8 A;  2GO7 A;  2FDR A;  4G3I A;  4B6J A;  2ZXI A;  4K4I A;  1MN8 A;  5JRT A;  4TQS A;  5ALE A;  1ZQX A;  1RXV A;  1BPE A;  4TUR A;  4DL2 A;  2F77 X;  5ALQ A;  3TAD A;  2W3S A;  3D2N A;  8ICM A;  3F2D A;  3SEN A;  4DWI A;  1WCL A;  8ICW A;  3Q8S B;  3RAX A;  3NVY A;  4YMO A;  3KKA C;  3ONN A;  2HBJ A;  1M6Y A;  2KE7 A;  3QU9 A;  4IQU A;  4KMO B;  7ICL A;  3AEV A;  5DG7 A;  4EYI B;  2DBY A;  4KLL A;  3JPP A;  4F4Y A;  3M8S A;  9ICH A;  1NK8 A;  5ALJ A;  2F8K A;  3H8J A;  2LM4 A;  2HCF A;  4AYB F;  1BPZ A;  2IA6 A;  4IS7 A;  3WKB A;  3BQ1 A;  1O08 A;  3G6Y A;  4U6P A;  3NGD A;  4F5R A;  4PH5 A;  2YMP A;  4QZG A;  1D8L A;  1O03 A;  9ICI A;  1FIQ A;  1KFS A;  2BCQ A;  5D49 A;  2CPR A;  5KFL A;  4ECR A;  5ALZ A;  2C2R A;  4IRK A;  4ELV A;  4J9N A;  4QNL A;  2KFZ A;  1RQN A;  5ALT A;  9ICQ A;  3QUC A;  4F3O A;  4P0P B;  5KG0 A;  2XI9 A;  1N48 A;  2NRZ A;  4AP9 A;  4R66 A;  3M8R A;  2FMS A;  5AKK A;  2AHO B;  1HIW A;  2ESE A;  2NRX A;  4B9V A;  3N4M B;  4P0Q A;  3BQT A;  4ED2 A;  2Y1J A;  5CP2 A;  4BJQ A;  2WF9 A;  5KFU A;  1JI7 A;  2KZ3 A;  4Y2X A;  1BPD A;  2KD1 A;  3BDP A;  4I27 A;  3K1R B;  2J6S A;  2MUT A;  4P2H A;  2W54 A;  1L8O A;  5FP0 A;  1DGS A;  1OUQ A;  1GO3 F;  3A0H U;  1RYR A;  3MR2 A;  2XO7 A;  3TAP A;  1IV8 A;  4QZD A;  2LYH A;  4F2R A;  2C28 A;  5KT4 A;  2NYV A;  3JPT A;  2XGQ A;  1ZXI A;  4O3S A;  8ICN A;  1LKY A;  1D8B A;  3EWA A;  4B9M A;  1T94 A;  3R9K A;  4JMU A;  3AU2 A;  4B9S A;  2ZIX A;  4FE3 A;  5T14 A;  5D4B A;  5KT5 A;  4Q45 A;  4Z6C A;  2ZUD A;  4OJO A;  3GDX A;  1ZQC A;  2FPL A;  2ISO A;  5J2I A;  5AM5 A;  1BVS A;  4ECW A;  3G6V A;  7ICJ A;  2OM6 A;  5KTQ A;  3NVZ A;  4GC7 A;  3PMN A;  2IOH A;  3UXN A;  3BZC A;  5ALK A;  4UB1 A;  5L1K A;  4JV1 A;  3LVV A;  3H0L B;  3RJE A;  8ICJ A;  1LV5 A;  2HHW A;  2N1R A;  7ICO A;  2F1H A;  4OJ6 A;  2PMZ F;  2E5S A;  3MAB A;  2ZIV A;  1IXR A;  3ZDA A;  2FJ6 A;  3TI0 A;  3EW9 A;  4P4O A;  4DSK A;  4QWE A;  1XS9 D;  3QU7 A;  5ALS A;  2DPJ A;  1KRP A;  3Q8K A;  4MFC A;  4FO6 A;  1ZD2 P;  3PSF A;  5AK4 A;  3RB3 A;  4DQR A;  9ICW A;  4Y2S A;  4JB3 A;  4ACO A;  2VJ4 A;  3TAC B;  2J6T A;  2P6U A;  4PL1 A;  2IOF K;  3WK6 A;  3LK9 A;  2XY5 A;  2P6R A;  2HOF A;  5KNI A;  2XVT A;  4NLZ A;  3ISC A;  5ALF A;  1TV9 A;  3V6K A;  1KLN A;  5KFI A;  2ZIU A;  2HSZ A;  1Z1V A;  4DSL A;  2HHU A;  4NJ8 A;  1ZOL A;  4B9U A;  9ICM A;  4EX6 A;  2G06 A;  4DSF A;  3QU5 A;  2Z7J A;  3LWM A;  5HHH A;  3CRX A;  9ICJ A;  1RG6 A;  2DGZ A;  2HBM A;  1ZQB A;  4IRC A;  1PVP A;  3IM1 A;  4CNQ A;  9ICE A;  1DXS A;  2KIC A;  1TE2 A;  3QUB A;  3C28 A;  3A0B U;  5ALN A;  2FI1 A;  2ZJ5 A;  1VLB A;  3IG5 A;  2LHT A;  4KX3 A;  4ECS A;  2KMD A;  2CRX A;  3VCB A;  5KAF U;  2EAP A;  3VC8 A;  4UAZ A;  1ZQG A;  5F9L A;  4C4S A;  8ICE A;  4RNO A;  2LYB A;  3TKA A;  4DLG A;  7ICG A;  4NM2 A;  1D9F A;  2HBL A;  2K4I A;  4C8L A;  4YG2 A;  4BWJ A;  1SXE A;  3GV7 B;  5AK6 A;  4ED0 A;  2KSO B;  3IN5 A;  2NO4 A;  4QZE A;  2UVU A;  3BQ2 A;  4WJ3 B;  4DF8 A;  1ED1 A;  4Y2T A;  5ALM A;  3PNC A;  3THV A;  7ICN A;  3QYP A;  4NLK A;  4BGD A;  1NZB A;  3E0F A;  2YX8 A;  9ICA A;  9ICS A;  1NOM A;  1SL0 A;  5AK3 A;  5ALP A;  2YB1 A;  1A76 A;  1X6J A;  2ODG A;  4Z6F A;  2E1F A;  2XC9 A;  1Z19 A;  3V7J A;  3WK8 A;  4I29 A;  3NVV A;  1NZP A;  3OJU A;  2HHX A;  3QX7 A;  5D46 A;  5DB9 A;  2FMQ A;  5BPC A;  3RJG A;  3AM9 A;  2K4P A;  3NTU A;  1URJ A;  5AKG A;  1U9L A;  2FE9 A;  4TUP A;  3IRU A;  3GQC A;  4DL6 A;  4DFP A;  1RZT A;  1TAM A;  1S0M A;  2WF6 A;  2K89 A;  2IBK A;  3KZX A;  4UAW A;  2KHV A;  4KLF A;  4Y2V A;  2HOI A;  9ICU A;  4NWI A;  2WFA A;  5KG1 A;  3WK5 A;  2BDU A;  5G5G A;  8ICS A;  1ZRM A;  3OHB A;  4MF2 A;  5GTH U;  9ICT A;  2K8C B;  3ETL A;  1U47 A;  2WAQ C;  3ISB A;  1BPB A;  1IM4 A;  5DQH A;  5CR0 A;  1KQQ A;  5IIL A;  2ZTC A;  4I2J A;  4I2E A;  2Y0S C;  5KFE A;  3PR4 A;  3DEE A;  1ZQU A;  3FM9 A;  4Q43 A;  2R8H A;  1L7P A;  2NRV A;  1B22 A;  1JIH A;  4KLI A;  4F72 A;  4DSI A;  1KSP A;  4RQ8 A;  3WK4 A;  1V97 A;  3H8W A;  2HHV A;  1JXE A;  7ICT A;  2D6F C;  4US9 A;  3RR7 A;  5KFC A;  3RH4 A;  3PW0 A;  5F3X B;  4CGZ A;  4RUA A;  1QSY A;  2YN4 A;  3ICX A;  4M9G A;  2QB0 B;  2JV3 A;  3H8S A;  3N7P D;  1DRG A;  1XU4 A;  4MFA A;  3PX0 A;  4YD2 A;  3QXG A;  3TAQ A;  3CYM A;  1UT8 A;  3BS7 A;  4F4Z A;  5DBB A;  1JX4 A;  2KN7 A;  5CWR A;  5KFV A;  4EEK A;  3C21 A;  2BKE A;  4G9B A;  4PJ0 U;  1S76 D;  3WU2 U;  5AI0 A;  1OW5 A;  1K1Q A;  1SZH A;  5CHG A;  5KT7 A;  1K1S A;  4OCZ A;  1X6I A;  3AQF A;  4O3P A;  4ECQ A;  3M6Z A;  5ALY A;  1ZET A;  3BQ0 A;  3PW4 A;  2JZB B;  3CP8 A;  4P0P A;  2BPG A;  1B4F A;  4UW9 A;  1L6N A;  2ES6 A;  4O3M A;  2ZUC A;  5L1M A;  4M47 A;  1ZQV A;  1N56 A;  3M1Y A;  3Q8L A;  4F2S A;  1ZQQ A;  4JV0 A;  5ALD A;  1D9D A;  2YML A;  2E1E A;  2W8L A;  1AQ6 A;  4XQ8 A;  5J0U A;  2R8J A;  4C8K A;  4B9N A;  2GOL A;  1ZQK A;  1IG6 A;  5KL1 B;  5ALG A;  2KG5 A;  2PFP A;  2XCA A;  1X66 A;  3PVX A;  1ZQF A;  5J0O A;  2LI6 A;  5AI9 A;  1J2M A;  1MQ2 A;  2DPI A;  4EBE A;  7ICH A;  3MGV A;  1ZQL A;  4O5C A;  2HVH A;  3C5G A;  2V4R A;  3UMB A;  3ALR A;  4F92 B;  5J0R A;  5J29 A;  3C29 A;  1U4B A;  3PW7 A;  4IC9 A;  5KG4 A;  2OWO A;  4U7C A;  8ICY A;  3SR6 A;  1ZQR A;  5KFQ A;  2HI0 A;  2DWQ A;  2DUY A;  5L9X A;  3QU4 A;  1CUK A;  5DBA A;  3EPG A;  3UXP A;  4F4X A;  4K4G A;  4F5O A;  2JR5 A;  2DL0 A;  2YQE A;  4C8N A;  3HW8 A;  4KLS A;  4M0A A;  3M6K A;  1S8O A;  2DKX A;  2KOB A;  1C7Y A;  7ICR A;  4F5N A;  4YFK A;  5AKE A;  1ZD3 A;  5ALR A;  4QZI A;  3HP6 A;  5KG7 A;  2KVC A;  4EYH B;  4O5K A;  4UAU A;  2IOF A;  4DFD A;  9ICV A;  2Y1I A;  1JMS A;  5KFH A;  3PST A;  4C4R A;  1L3U A;  2B6G A;  4EX7 A;  5KT3 A;  4XRH A;  3L5K A;  2BR0 A;  4ZH4 A;  4C7Y A;  1MA7 A;  2JRZ A;  5ALH A;  2IHN A;  1CI4 A;  2E8P A;  4OJ5 A;  2HHS A;  4F5Q A;  2HHT A;  5DB6 A;  1ZQO A;  2ASL A;  3RJF A;  3AUO A;  1NK4 A;  5DBC A;  2A3V A;  4RQ0 A;  1S9F A;  2KIV A;  3Q8R B;  2B21 A;  3ZD8 A;  8ICX A;  2OYY A;  8ICC A;  9ICB A;  5KG5 A;  1Q8K A;  2ZJA A;  2G07 A;  3MBY A;  2XIC A;  4I2H A;  2PFQ A;  4OO1 J;  4KTQ A;  1S0O A;  3HRD D;  3RTV A;  2W9C B;  4CDG A;  4RQ5 A;  4J03 A;  2K8A A;  4PHA A;  4YN4 A;  5J2B A;  5TIS U;  3V6J A;  2JGA A;  1L3T A;  4YD1 A;  2KKP A;  1SZP A;  4KLJ A;  3ISD A;  2ZTE A;  5AM4 A;  5J0T A;  5J0Q A;  1F44 A;  4I2G A;  4M2Y A;  4F91 B;  4YXM A;  9ICG A;  2KSO A;  5J2A A;  1QSL A;  2PI4 A;  2G08 A;  3ORY A;  3RJH A;  1ZQD A;  4UAR A;  3V7K A;  3UQ2 A;  3JPN A;  3UQ0 A;  4F5P A;  3T5H A;  2VKQ A;  1L3S A;  8ICT A;  4PGY A;  1YZ7 A;  4YR2 A;  5TZV A;  1DOQ A;  1KFT A;  4C8O A;  1JRP A;  5KFZ A;  4PZN A;  3KHG A;  5KT2 A;  5B66 U;  3KHR A;  3SV4 A;  2CN1 A;  2MA1 A;  5KFM A;  5KFF A;  1RXW A;  3QEB Z;  1VDV A;  1A0P A;  2KKV A;  2C2E A;  5KFJ A;  4C7Z A;  5J2J A;  1WUD A;  5KFA A;  3N7S C;  2K4E A;  4I2C A;  2RHF A;  2QAR B;  1TK0 A;  1ZQY A;  1F0M A;  3B0X A;  3V72 A;  4XA5 A;  5EE0 A;  4KLH A;  4RNN A;  5HML A;  2ZG6 A;  1ZJM A;  5AIC A;  3BQ7 A;  1UQV A;  2R8K A;  4DL5 A;  1ZQH A;  4QZB A;  1RPL A;  3N28 A;  1X40 A;  3G6X A;  4A8E A;  3NVW A;  5KFD A;  4RQM A;  3SAG A;  1COO A;  4YVZ A;  4BX9 C;  4EZ6 A;  3PO4 A;  3OTQ A;  4LJX A;  2JEJ A;  4UAY A;  4C80 A;  2FLN A;  4R64 A;  5AM0 A;  4KN4 A;  3LDA A;  4KIT B;  4MF8 A;  3KHH A;  2BZF A;  3ZDC A;  2WAQ F;  1T8E A;  4UBB A;  1XNS A;  1Q46 A;  4UB5 A;  3JPR A;  2MAX A;  2P35 A;  1Z4O A;  4EZ9 A;  1V9P A;  1Z1B A;  4UB8 U;  4C8M A;  5KFN A;  2OCE A;  4M9L A;  2BCV A;  2W43 A;  4DCC A;  5BOM A;  1KDH A;  5KAI U;  2Y0S F;  3AU6 A;  2LM1 A;  1T4G A;  3D6J A;  3H0R B;  4DQP A; 
#chains in the Genus database with same CATH homology
 2YQE A;  5K4L A;  2KK0 A;  2EQY A;  2OEH A;  1KN5 A;  1C20 A;  1IG6 A;  1KKX A;  2JRZ A;  2CXY A;  5CEH A;  2RQ5 A;  2LI6 A;  4LJX A;  1KQQ A;  2EH9 A;  2LM1 A;  1RYU A;  2JXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...