2EQYA

Solution structure of the arid domain of jarid1b protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
GSSGSSGEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTSDTKDKEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ARID domain of Jarid1b protein
rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Jumonji, AT rich interactive domain 1B
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2eqyA01
2JXJA 2LM1A 2EH9A 1IG6A 2OEHA 1KKXA 5K4LA 1C20A 1RYUA 2CXYA 2EQYA 2LI6A 2RQ5A 2YQEA 4LJXA 2JRZA 2KK0A 5CEHA 1KN5A 1KQQA
chains in the Genus database with same CATH superfamily
5CP2A 3UPQA 1A6SA 4GLXA 3EZ5A 1X40A 2A19A 3HPOA 2I5HA 4DFJA 4RNNA 2W9CA 1WWVA 5JRTA 3RJJA 1U9LA 4C4SA 1JUDA 2LM1A 4YXMA 3SV3A 2WB1F 4I2DA 2GOLA 1XSLA 4QZCA 2IHMA 1NJZA 2CPRA 3GFKB 1N61A 3ISBA 2JZBB 3RH6A 4TQSA 2B21A 9ICXA 2QB0B 2FDRA 4FS2A 3K4GA 4NLCA 4PZOA 5KFHA 1AROP 2FLLA 4KLEA 1N56A 5J8YA 4IR1A 4P4MA 2D3DA 3VCBA 1K5OA 1HEKA 4Y2YA 1X42A 4O3MA 3UMGA 1PVQA 5FP0A 1KL9A 3HRDD 4CRXA 3SMVA 3OJUA 3T5JA 4NJ8A 4F4WA 2IMWP 4OJPA 7ICIA 1B4FA 4RQ2A 2YB4A 5J29A 3SR6A 2JHDA 3UXNA 3QU9A 3PX0A 4RQ8A 5DB8A 4RPXA 4UARA 4QW8A 9ICBA 2ZIWA 3ZDDA 4MFCA 1DK3A 3TADC 8ICVA 3B9JA 3JPNA 5L1JA 3QNMA 4P0QB 4QZFA 3L4PA 4TUSA 4ECQA 7ICVA 1ZQ1C 9ICUA 5G5HA 3QU5A 3ONNA 5IIMA 2KNJA 2BZFA 1NK6A 4O3SA 1ZQIA 5J2IA 3N28A 3WKDA 2EZXA 4QJFB 4JMUA 2Y1JA 4I2AA 1HUZA 3IN5A 1LV5A 2YMLA 1COOA 4R65A 1SGGA 4UAUA 1SV0C 1QQ6A 4DF8A 3G6XA 4I2CA 5KFLA 5DBCA 5KFFA 2VIXA 2FJ6A 1RYSA 4KLHA 2NV3A 4YMMA 4RNMA 1XC9A 8ICCA 4J9OA 3KBBA 2XGPA 4YN4A 4UAVA 3WKAA 5KFEA 1ZD3A 3KZIU 3VC8A 1S0NA 4Z6CA 4Y2PA 1QSLA 1WG8A 5J2JA 1IV8A 2FLNA 4J9RA 3T5KA 1ZD4A 1IM4A 3RBDA 3MDAA 4YMOA 4G3IA 2KTQA 2KMDA 2VKQA 3N7RC 3RRHA 1Q3UA 5ALUA 1QH9A 4UW9A 1S77D 3PNCA 4M9HA 4U7CA 5IIJA 3N7PD 1T3QA 4DSLA 4ECTA 1T3NA 9ICQA 2WAQC 3J81j 5CR0A 1XWLA 1XO0A 5DB9A 2ZG6A 5J2CA 4JWMA 3C1YA 2FLPA 3ORYA 1ZOLA 7ICEA 4Y2TA 3H0LB 5JUMA 1T7PA 1ZQVA 5AI9A 1NOMA 5AKHA 3PW4A 3NRZA 2W9BA 2KFNA 2NRXA 4YFKA 2HCFA 3M6ZA 4KLGA 1D9FA 5ALOA 5ALEA 2JV3A 4C7ZA 3QEBZ 3K1RB 7ICRA 3F2DA 1RG6A 3KZXA 2OEHA 5DG7A 1JX4A 1A76A 2KV2A 3BS5B 2F8LA 4P2HA 4UQGA 3HX0A 2KVSA 2PMZC 3R9KA 5KT5A 1C7YA 2GO7A 2NRWA 5KG2A 4C4RA 4BGDA 3EUB2 3NASA 2Z7JA 5GTHU 2YTUA 3AU2A 1N63A 4CF5A 4KTQA 3RRGA 5D4BA 3BJYA 1U47A 3MR6A 3PSIA 3HJEA 1IIPA 4QZ9A 1NJWA 2KZMA 2W3RA 4Y2QA 2K89A 5CRXA 3RJEA 1JALA 2YN4A 4BJQA 2EH9A 5HR6A 2KICA 2ISPA 1TKDA 2KFZA 4ECUA 2AXTU 1QQ7A 8ICMA 1HUOA 4PGQA 3MGIA 4UB6U 2RLTA 5IIOA 2K4HA 1L3UA 4PPXA 1FIQA 3NRWA 2HBKA 1S0MA 4Q44A 2ZUBA 4KN7A 4IQWA 4ECVA 3V72A 2K8CB 5HP4A 1U45A 1ZQLA 3TADA 2XY6A 4EYIB 2OXOA 9ICJA 4B9UA 3JPSA 4PL2A 4KLSA 2KE7A 1HIWA 8ICIA 3AM9A 5DQIA 2DPIA 5JU5A 3T3FA 3KOOA 4ZOHC 5KFWA 4C8LA 1SV4A 3GIKA 3HWTA 3H8WA 5ALPA 5DLGA 5TISU 8ICYA 3GIIA 2ZIXB 3IM1A 1ZQZA 5G5GA 2K8AA 1YT3A 3PMNA 5KL1B 3UM9A 2W8KA 5J8YC 3CP8A 3PX6A 1DK2A 1F44A 3G6YA 1F0MA 3AQFA 2DGZA 5AKEA 5L1LA 2HHQA 1SL0A 1KKXA 3M8SA 2PXIA 3ZDBA 1B22A 4RT2A 2H3VA 4IC9A 1KLNA 3RJIA 2BQRA 1BNPA 1OW5A 8ICPA 4QZBA 4NV0A 3UQ2A 3ED5A 1SV0A 9ICCA 4NLZA 1MQ2A 4RQ0A 2ZJ8A 3MR5A 4DL7A 2AJQA 3NS1A 5EOZA 3Q8LA 1S10A 4JV0A 3C2MA 3TANA 2E5SA 1X6IA 2H5XA 5AKLA 1QSSA 2ZIXA 2V4RA 4IL6U 3F2BA 4UB4A 2EAPA 4ELUA 2IOHA 2Y9UA 2R8HA 4DCCA 1BPZA 3MDCA 2YX8A 2G07A 2A1JB 4DOBA 3N97B 4PJ0U 3V6KA 4FBUA 4DSKA 1N5WA 2EAOA 2MA1A 1WCLA 2NRZA 3QZ7A 7ICLA 5KL8B 2AQ4A 4HAIA 5J0SA 5AK4A 3QZ8A 5ALFA 3QU4A 2ZXIA 4B9LA 2F2AB 3QXGA 4R8UA 3RH5A 4LVSA 4P0PB 2HHSA 4F5QA 5AM2A 2HOFA 1IXRA 3AN1A 4YP3A 3C5FA 7ICPA 5T14A 1EXNA 3C23A 1O08A 4PHPA 1DXSA 4HYKA 4RQ7A 2EQYA 8ICKA 1BVSA 3C21A 1CI4A 3IDWA 2DKZA 1X9MA 3AUOA 5HR7A 5J0RA 4C8NA 5DQHA 4J03A 1XSPA 1ZQMA 5J2EA 1TK8A 3KKAA 1D8LA 1L7MA 2B0CA 2F1IA 2BQUA 1NNLA 1ZQKA 2W7OA 3LWLA 3V7JA 1SXDA 2LKYA 4KLFA 5KFNA 1ZQXA 1UA1A 2KD1A 5KG1A 3WK5A 1UA0A 1N5XA 3SI8A 4DS4A 4FS1A 4RQ6A 1KFSA 5AM1A 3KHGA 3WU2U 2QLTA 3QUTA 2VANA 3AU6A 1Z1BA 5CEHA 3SV4A 4DWIA 1N2XA 4BXOA 5CWRA 5ALSA 1ZQOA 1UQVA 5CB1A 3D6JA 1NJYA 1LVHA 5HMLA 2LBOA 4CF3A 4K4GA 4M9NA 4P0QA 2OWOA 3PW0A 5AM3A 4Y2XA 2JEFA 1N62A 4U6PA 2ZTCA 4XQ8A 1BGXT 3BS7A 1UCVA 2ZIWB 2C2DA 2EDUA 2HSZA 5IILA 5DB7A 3EW9A 1SKSA 4DFMA 3DDHA 4ED6A 3EWAA 1ZJMA 4GXJA 2FPKA 1LB2B 1ZD5A 4Y2JA 3RH4A 1KN5A 1JI7A 1TVAA 1KDHA 1OXJA 4J9PA 4DQIA 1WWUA 1RM6C 7ICQA 1KRPA 8ICSA 3ICXA 9ICFA 2OM6A 5AK3A 1RPLA 5ALNA 3SAFA 5K4LA 2BCQA 4F5RA 1UHUA 2QB1A 1BPEA 2MUTB 9ICHA 3QU7A 2HHWA 9ICKA 5KFMA 3BZKA 2G06A 1SZPA 1Q8KA 2KHVA 2B6GA 1ZQWA 4JWNA 5ALXA 1ED1A 3GZFA 2XVTA 2HHVA 2E8PA 1PUZA 4OD0A 4XRHA 2AGOA 3C28A 5DG9A 4NLGA 4QZAA 4QIWF 4UB1A 2MUTA 1L7OA 1V9PA 5BPCA 1F5SA 2QARA 3BQ2A 5AKGA 2ZIUA 3CRXA 4M6WA 3SZ2A 1X9WA 3IHQB 4CCHA 8ICUA 4DLEA 4KLQA 1IG6A 7ICUA 8ICGA 5AKKA 2XCPA 5ALLA 2ASLA 4UAYA 4GXKA 4C4TA 2J6UA 2LI6A 1MN8A 3E0FA 3RB3A 4EELA 2HW3A 4US9A 2BPGA 2UVUA 2BDUA 2W54A 1S8OA 1Q46A 4DFDA 2RDIA 2K4IA 2RQ5A 4F4YA 4I2BA 3OSNA 5IIKA 4DQSA 2DL0A 2HDOA 2Q4TA 2GH1A 3QYPA 4FZLA 3WK9A 3PO5A 3IV6A 3Q8MA 2JZBA 3GIJA 5KG7A 3JPRA 1FEZA 2ASDA 2ESEA 4YXJA 5D46A 2KIWA 4F4KA 4BWMA 1PK3A 1SWVA 5KFOA 2KKPA 3TQ1A 4QWCA 5KT7A 8ICXA 3QUQA 2XO7A 5E79U 4NWIA 2WAQF 3M6KA 1L7PA 4EX6A 2W04A 4BUGA 4F5PA 5AM0A 2OHFA 4F3OA 3QX7A 4P4OA 5TZVA 4M9GA 4DF4A 2XY5A 5CHGA 1PZNA 1TAMA 2AHOB 3LDAA 4GXIA 2KSOA 3OJSA 2W11A 4RPZA 1SWWA 8ICRA 8ICZA 3JPPA 4UASA 3V7KA 2R8JA 2JRZA 3IRUA 9ICSA 4I29A 3QEAZ 1QTMA 1KFTA 4FBTA 4O3NA 3A0HU 4MEYA 4IQVA 4UAZA 2LPEA 2FMPA 2ZUCA 4Q45A 5ALQA 4P0PA 2HBJA 1LKYB 3OSPA 2DWQA 5KFTA 4IQTA 1KBUA 4NLBA 3H0RB 2OH2A 2JR5A 3N7SC 1S5LU 1NZBA 4YD1A 3RF9A 2DKXA 7ICHA 5C5JA 9ICNA 3H8SA 1QQ5A 2W9AA 4ICAA 2FMQA 5ALVA 4ECSA 1QCKA 3JPOA 3WKCA 4QZDA 4F50A 4DOCA 3SAGA 4UAWA 5J0XA 4I28A 3RJHA 4DSFA 3GILA 1L8LA 4Q8EA 2BDPA 3KHRA 4PGYA 4DL6A 3RB6A 1D8BA 9ICPA 4CGZA 2KVCA 2W8LA 2PMZF 4DSIA 5HNKA 1NK4A 3NUQA 1NK5A 4WJ3B 1JRPA 4ELVA 5KG0A 5KT3A 2LYBA 1BPDA 3CW2C 2YMPA 1SB3C 4J9QA 5KAFU 3AEVA 2HHXA 3WK7A 4O5EA 2KZZA 1S76D 1NK8A 2JEGA 2P6UA 3TFSA 5AHXA 1ZXIA 4BX9C 4KITB 3GV8B 3F5EA 2AGQA 2BCSA 1MSWD 3H0MB 4DSJA 3RAXA 3GIMA 2HHUA 3Q8RB 1Z19A 1RYRA 3ETLA 4F5NA 3I76A 3ZDEA 3BZCA 2WFAA 5AK6A 4I2IA 5AI8A 2PKEA 2NO4A 3BQ0A 4QWEA 4O9MA 4QWDA 2IHNA 5B66U 2AU0A 2WTFA 9ICMA 5DGAA 2Q0ZX 1RXVA 4UATA 1Z4NA 2ZTDA 3DV9A 2KEYA 5KFPA 2BR0A 2AQ0A 3LK9A 2MU2A 4CF4A 4RT3A 4FO6A 1UPHA 2M0NA 3QUBA 4KLJA 2KK0A 2G09A 1NK9A 3BDPA 5L1IA 1TK5A 4AYBF 3GV7B 2LMRA 4RQ1A 1URJA 3HKZF 3ETRA 4XA5A 5AIBA 3F5AA 2F1HA 3Q8PB 1TV9A 3ZI4A 2CN1A 2R18A 4Y2VA 5J2FA 4ELTA 3D2QA 4TQRA 2W9MA 2HMXA 2DFLA 4C8MA 5AKIA 1X66A 4F5OA 4M47A 4J9SA 4YR2A 4RUAA 2G0AA 5AM4A 2BGWA 3LVWA 4DEZA 2EAMA 3H4DA 3NVWA 2RHFA 4C80A 5KT4A 4FZNA 3FDSA 4UB3A 3PR4A 3BS5A 3DEEA 4YQWA 4PL1A 2HBMA 4EEYA 2NRTA 3C29A 3NVZA 3SYZA 2VA8A 2KHQA 3M9MB 3RR7A 1ZJNA 5J2DA 3BQ1A 2HVHA 4O0IA 1L6NA 2BQ3A 4Y2UA 5AI6A 4GC6A 3H4BA 4R63A 2JEJA 2P35A 1ZQYA 9ICEA 3RBEA 2G08A 2WHEA 4UBBA 1XNSA 5J0TA 1L7NA 5KFQA 4KLLA 4C0ZA 3F2CA 4B9MA 2EANA 4PHEA 2R8IA 1ZQPA 9ICAA 2Y0SC 2Y0SF 2E8OA 2WF7A 1ECWA 4LJXA 3AL0B 2F77X 4M9LA 4UB5A 2J6TA 1ZQJA 5KFDA 1RZTA 2C2RA 1ZRNA 3ALRA 2F44A 3IP4B 2JGAA 5EWFA 3UQ0A 3G6VA 2N1RA 4B6JA 3RFAA 1L3SA 3M8RA 4DQQA 3KHLA 2AH5A 1X6JA 1SKRA 1RQNA 2PFPA 4UB2A 1V85A 5J0WA 3ZDAA 2HBLA 4UB8U 4CDGA 5EE1A 1T94A 4EBCA 1C20A 5AI5A 3PW2A 2K4PA 9ICVA 5IIIA 5F9NA 4J9KA 8ICLA 3M9OB 1D8YA 4M9JA 4YG2A 3WK6A 4RU9A 4X5VA 3TARA 1Q3VA 2DPJA 1B0XA 8ICFA 3FYHA 3WKBA 2JH1A 2ATLA 3S6JA 3TKAA 4OO1J 5BOLA 1KSPA 2DUYA 1MQ3A 4OJLA 1ZRMA 1JXLA 2R8GA 3CNHA 1U4BA 1JXEA 5AKXA 1TAUA 3C2LA 2A3VA 3UXOA 2XY7A 1ZQNA 3LWMA 3TACB 4MFFA 1GO3F 4ECYA 8ICEA 7ICKA 2H3ZA 4Z6DA 3B0XA 5DBBA 3I28A 1XSNA 3HILA 3PW5A 8ICQA 2E3TA 2WF8A 2ES6A 1JN3A 1NKBA 2BCRA 5KT2A 2D8CA 2ZIUB 2IOFA 2M9NA 5AK5A 1SIJA 3EPIA 3D2SA 5L1KA 1Z00B 3KKAC 3U26A 4DSEA 9ICRA 1TE2A 5B5EU 3LVVA 4QIWC 4MF8A 1B43A 5ALZA 1PVRA 5DDYA 4QZGA 2GLEA 4EZ9A 2WF9A 4O5KA 4I27A 3C5GA 1HJPA 1YZ6A 3NVYA 3QUCA 1XU4A 5ALYA 2MAXA 2KP7A 3O0FA 5KFJA 4F91B 1FO4A 5J0YA 5J2AA 4YR0A 3IG8A 4R66A 3Q8SB 1Y88A 5DB6A 3MC1A 4FE3A 4KX5A 5A0LA 2LHTA 3M9NB 1NK7A 4GC7A 5J0OA 4US8A 1U49A 3BQTA 1COKA 4NY8A 2I6XA 7ICMA 2XI9A 4EBEA 3RR8A 4YR3A 4OJ5A 4DLGA 4Y2SA 4O3RA 2KZ3A 5J0PA 4EENA 5IINA 4KLTA 5D49A 3T5HA 4O3QA 1NKEA 5DLFA 3OHAA 4DS5A 1SZHA 2Y1IA 4J9MA 4JK1A 1PK1B 8ICJA 2ZIVA 1Z3EB 5KFYA 4KLUA 2BCUA 5KFGA 1DOQA 2NYVA 4PH5A 2Y9TA 4M6WB 5JTIA 1PVPA 4BDPA 2LYHA 1J97A 1DGJA 3UMCA 4PGXA 5KFRA 3OHBA 3PV8A 4DQRA 2YMMA 3RJGA 2BPCA 4IQUA 2ALZA 4IS7A 5H2FU 3KFUF 2WF6A 4ECRA 3RB4A 5KG3A 1A77A 3H7IA 2F8KA 5CA7A 4Z6FA 1CRXA 4PZNA 5C0YA 1J2MA 3TAPA 4NM1A 4NM2A 2ZJ5A 1BNOA 8ICHA 7ICOA 4C7YA 1SXEA 4JB3A 4ED3A 1K1QA 4AP9A 4J9NA 1KFDA 1L8OA 2HHTA 3V6JA 2G5IB 2YQEA 5EWGA 1AQ6A 1NJXA 1MA7A 3WK8A 3WK4A 4ECWA 4ED2A 4NL9A 3CYMA 1WCNA 4IRDA 2PFNA 3TI0A 9ICTA 4O3PA 4K4IA 4K4HA 4TURA 2NO5A 3MGHA 4P4PA 2XGQA 1SKWA 4TUPA 1UT5A 3V7LA 3SQIA 3AQEA 2V9WA 3RB0A 2ASJA 3FC4A 1T8EA 2O6KA 1KQQA 2NRVA 4MHVA 1FFVA 4DQPA 3ZDCA 3PSFA 1XS9D 1S0OA 5F3XB 4CNQA 2AGPA 1WUDA 3L3FX 3QU2A 4EYHB 3MR3A 2W7PA 5AM5A 2XCAA 4BXOB 4EZ6A 1V38A 1SL2A 2JEIA 2PFOA 2DBYA 4QW9A 2L5YA 4F93B 1ZQQA 4RPYA 4AYBC 4YD2A 4LZGA 5AICA 1U48A 3M7DA 2OYYA 4DL3A 1BPYA 3I1YA 1S97A 2JMGA 2R8KA 5KFXA 5KFZA 4DOAA 4EBDA 1ZETA 4QZ8A 2C22A 3Q8KA 1VDVA 2YY6A 2BHNA 1KEJA 3KTQA 4ACOA 1ZQHA 4Y2RA 3NGDA 3HW8A 2V4QA 2UVVA 3WKEA 3BQ7A 2ODGA 4YMNA 4ZH4A 4GFJA 2FMSA 5KFAA 4B9TA 2XICA 1NK0A 7ICJA 4E0DA 1Z00A 4I2FA 5ALDA 1A0PA 2JXJA 3Q8QB 2W43A 2CRXA 1X2IA 4C8KA 2IOFK 1ZQRA 4ED7A 4MEXA 8ICNA 4XUSA 2K60A 7ICTA 3H8MA 2F76X 5EE3A 1TK0A 2H3QA 3HT3A 4NL9C 4EX7A 3FM9A 1YZ7A 2KKVA 5KG4A 5BOMA 3SEIA 4QZHA 1OUQA 5AKZA 2KOBA 4F4XA 1X9SA 1RQLA 2HVIA 3PO4A 4TUQA 8ICWA 1S9FA 5KFUA 3IG5A 1ZQAA 1CEZA 4GIBA 3GU3A 2A1AA 2PFQA 1BPBA 5AI0A 3SAHA 2ISOA 2ZTEA 3LYSA 7ICGA 2FPLA 1NKCA 4R64A 3SD7A 4DL2A 8ICBA 2DF4B 3F53A 5KFCA 2RRDA 2UVWA 3MFHA 5EE0A 2VJ4A 2J6SA 4MF2A 1ZQGA 3OTQA 5F9LA 3C2KA 1T4GA 1V97A 5J0UA 1VJ5A 3QE9Y 3D2NA 3K1ZA 5CJ7A 2HOQA 2F3NA 2RDJA 5ALRA 3T5LA 3H40A 4F2SA 3C1ZA 1ZD2P 4QNLA 4EEKA 4RQ5A 5J0QA 2KJ8A 4KN4A 5AIAA 1L5UA 3H8JA 4F8RA 2IA6A 3PY8A 1L3TA 1QLNA 5ALHA 3E2EA 2W9BB 2P6RA 7ICFA 2G5HB 4DL5A 8ICOA 4YCXA 1N60A 2H3IA 2W55A 2I1QA 1P7DA 5HMMA 4M0AA 1TAQA 3MR2A 2RP5A 2QKQA 2E8MA 4ED0A 2E8NA 4Q8FA 2KJ9A 2ZXHA 5AKJA 5KNIA 2BKEA 4R8UB 1ZQSA 2W3SA 3TAQA 3NTUA 3PZPA 3N4MB 3E58A 2D6FC 3HP6A 5KG5A 1NZPA 3EPGA 4Q43A 2EZYA 2YB1A 3A0BU 1RYUA 2CXYA 5EE9A 2DQNB 5DG8A 5DDMA 4JUZA 1WYGA 2LYAA 5ALMA 1JROA 4CE6A 4A8EA 2A1JA 4DO9A 5ALGA 3AMZA 3PSTA 4I2EA 2KIVA 5J2GA 3SENA 1SL1A 4F92B 5KAIU 3GV5B 1ZQEA 4IRCA 5HHHA 9ICGA 4UBCA 2WF5A 3FAHA 2KJ5A 3ISCA 1H38A 1QSYA 3RJFA 1ZQTA 1K1SA 3OGUA 2KN7A 4JV2A 1KW4A 5KFSA 1J2NA 2I9GA 4F4ZA 2IBKA 4BWJA 5J2KA 1ZQBA 4KMOB 4KLDA 2VA3A 3EYZA 5KFIA 4OCZA 4ED8A 4RUCA 5KFVA 3MABA 2ZJAA 4RNOA 1TFRA 5DBAA 4QWAA 4RQ3A 1KTQA 5AKYA 2XIDA 5ALKA 2VJ5A 3MBYA 2C28A 4FZMA 3MGVA 4KX3A 3K75D 5KFBA 1MC8A 4C8OA 3GDXA 1DGSA 2K8BB 1O03A 1ZQDA 4OJOA 9ICWA 2JH7A 1XO1A 7ICSA 1FFUA 4F2RA 5L1MA 5ALWA 4PHAA 1S0VA 4YVZA 1ZQCA 4O5CA 4G9BA 2KG5A 2H3FA 2ZUDA 4J9LA 1RXWA 8ICAA 2K4EA 2HI0A 3PW7A 1DRGA 3KHHA 2OCEA 5ALJA 3M1YA 2QB0A 1X9XA 2FE9A 5KG6A 2QARB 3ZD9A 1LKYA 4DL4A 3GQCA 3PX4A 4MFAA 5DGBA 3V6HA 5KT6A 4IR9A 2FPMA 4M2YA 3PR5B 1RDFA 4PHDA 5DQGA 2W9CB 3RTVA 2HOIA 1Z4OA 4IRKA 4M04A 1JIHA 4QZIA 3ISDA 1D9DA 5J2HA 4ECZA 4Z6EA 4RQ4A 1Z1VA 2YMQA 1UT8A 2GWSA 4KLOA 4DFPA 4B9NA 5ALTA 7ICNA 4F72A 4RQMA 4B9VA 9ICIA 5AI4A 3THVA 2UVRA 9ICLA 2E1EA 1CUKA 2MSNA 4FFDA 3UXPA 5KFKA 2BPFA 4I2GA 5HHIA 4B9SA 3RAQA 3KD3A 2F1JA 5EWEA 4F71A 2LM4A 2P66A 5GTIU 3ZD8A 4I2HA 4OJ6A 1BPXA 4NXZA 3JPQA 4ED1A 4LZDA 3NVVA 3T79A 4ECXA 4USAA 3PSPA 3TFRA 1NI3A 3PMLA 2C2EA 5KTQA 2ZIVB 4NLNA 1L3VA 4KMUA 1PK1A 4I2JA 1ZYQA 3PVXA 3L5KA 8ICTA 3B0YA 5J2BA 4KLIA 2XC9A 2VA2A 5DKWA 5ALIA 2PI5A 1M6YA 4JV1A 5L9XA 1ZQUA 4KLMA 2PI4A 3HKZC 2WB1C 3MFIA 4RQNA 2W03A 2MRLA 9ICOA 2FI1A 3JPTA 4NLKA 1JMSA 3UMBA 4DFKA 3RJKA 2BCVA 1N48A 2EZZA 1ZQFA 4RZRA 3OPXA 4QWBA 2KSOB 4QZEA 4O3OA 1VLBA 2E1FA
chains in the Genus database with same CATH topology
2JXJA 2LM1A 2EH9A 1IG6A 2OEHA 1KKXA 5K4LA 1C20A 1RYUA 2CXYA 2EQYA 2LI6A 2RQ5A 2YQEA 4LJXA 2JRZA 2KK0A 5CEHA 1KN5A 1KQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXJ A;  2LM1 A;  2EH9 A;  1IG6 A;  2OEH A;  1KKX A;  5K4L A;  1C20 A;  1RYU A;  2CXY A;  2EQY A;  2LI6 A;  2RQ5 A;  2YQE A;  4LJX A;  2JRZ A;  2KK0 A;  5CEH A;  1KN5 A;  1KQQ A; 
#chains in the Genus database with same CATH topology
 5CP2 A;  3UPQ A;  1A6S A;  4GLX A;  3EZ5 A;  1X40 A;  2A19 A;  3HPO A;  2I5H A;  4DFJ A;  4RNN A;  2W9C A;  1WWV A;  5JRT A;  3RJJ A;  1U9L A;  4C4S A;  1JUD A;  2LM1 A;  4YXM A;  3SV3 A;  2WB1 F;  4I2D A;  2GOL A;  1XSL A;  4QZC A;  2IHM A;  1NJZ A;  2CPR A;  3GFK B;  1N61 A;  3ISB A;  2JZB B;  3RH6 A;  4TQS A;  2B21 A;  9ICX A;  2QB0 B;  2FDR A;  4FS2 A;  3K4G A;  4NLC A;  4PZO A;  5KFH A;  1ARO P;  2FLL A;  4KLE A;  1N56 A;  5J8Y A;  4IR1 A;  4P4M A;  2D3D A;  3VCB A;  1K5O A;  1HEK A;  4Y2Y A;  1X42 A;  4O3M A;  3UMG A;  1PVQ A;  5FP0 A;  1KL9 A;  3HRD D;  4CRX A;  3SMV A;  3OJU A;  3T5J A;  4NJ8 A;  4F4W A;  2IMW P;  4OJP A;  7ICI A;  1B4F A;  4RQ2 A;  2YB4 A;  5J29 A;  3SR6 A;  2JHD A;  3UXN A;  3QU9 A;  3PX0 A;  4RQ8 A;  5DB8 A;  4RPX A;  4UAR A;  4QW8 A;  9ICB A;  2ZIW A;  3ZDD A;  4MFC A;  1DK3 A;  3TAD C;  8ICV A;  3B9J A;  3JPN A;  5L1J A;  3QNM A;  4P0Q B;  4QZF A;  3L4P A;  4TUS A;  4ECQ A;  7ICV A;  1ZQ1 C;  9ICU A;  5G5H A;  3QU5 A;  3ONN A;  5IIM A;  2KNJ A;  2BZF A;  1NK6 A;  4O3S A;  1ZQI A;  5J2I A;  3N28 A;  3WKD A;  2EZX A;  4QJF B;  4JMU A;  2Y1J A;  4I2A A;  1HUZ A;  3IN5 A;  1LV5 A;  2YML A;  1COO A;  4R65 A;  1SGG A;  4UAU A;  1SV0 C;  1QQ6 A;  4DF8 A;  3G6X A;  4I2C A;  5KFL A;  5DBC A;  5KFF A;  2VIX A;  2FJ6 A;  1RYS A;  4KLH A;  2NV3 A;  4YMM A;  4RNM A;  1XC9 A;  8ICC A;  4J9O A;  3KBB A;  2XGP A;  4YN4 A;  4UAV A;  3WKA A;  5KFE A;  1ZD3 A;  3KZI U;  3VC8 A;  1S0N A;  4Z6C A;  4Y2P A;  1QSL A;  1WG8 A;  5J2J A;  1IV8 A;  2FLN A;  4J9R A;  3T5K A;  1ZD4 A;  1IM4 A;  3RBD A;  3MDA A;  4YMO A;  4G3I A;  2KTQ A;  2KMD A;  2VKQ A;  3N7R C;  3RRH A;  1Q3U A;  5ALU A;  1QH9 A;  4UW9 A;  1S77 D;  3PNC A;  4M9H A;  4U7C A;  5IIJ A;  3N7P D;  1T3Q A;  4DSL A;  4ECT A;  1T3N A;  9ICQ A;  2WAQ C;  3J81 j;  5CR0 A;  1XWL A;  1XO0 A;  5DB9 A;  2ZG6 A;  5J2C A;  4JWM A;  3C1Y A;  2FLP A;  3ORY A;  1ZOL A;  7ICE A;  4Y2T A;  3H0L B;  5JUM A;  1T7P A;  1ZQV A;  5AI9 A;  1NOM A;  5AKH A;  3PW4 A;  3NRZ A;  2W9B A;  2KFN A;  2NRX A;  4YFK A;  2HCF A;  3M6Z A;  4KLG A;  1D9F A;  5ALO A;  5ALE A;  2JV3 A;  4C7Z A;  3QEB Z;  3K1R B;  7ICR A;  3F2D A;  1RG6 A;  3KZX A;  2OEH A;  5DG7 A;  1JX4 A;  1A76 A;  2KV2 A;  3BS5 B;  2F8L A;  4P2H A;  4UQG A;  3HX0 A;  2KVS A;  2PMZ C;  3R9K A;  5KT5 A;  1C7Y A;  2GO7 A;  2NRW A;  5KG2 A;  4C4R A;  4BGD A;  3EUB 2;  3NAS A;  2Z7J A;  5GTH U;  2YTU A;  3AU2 A;  1N63 A;  4CF5 A;  4KTQ A;  3RRG A;  5D4B A;  3BJY A;  1U47 A;  3MR6 A;  3PSI A;  3HJE A;  1IIP A;  4QZ9 A;  1NJW A;  2KZM A;  2W3R A;  4Y2Q A;  2K89 A;  5CRX A;  3RJE A;  1JAL A;  2YN4 A;  4BJQ A;  2EH9 A;  5HR6 A;  2KIC A;  2ISP A;  1TKD A;  2KFZ A;  4ECU A;  2AXT U;  1QQ7 A;  8ICM A;  1HUO A;  4PGQ A;  3MGI A;  4UB6 U;  2RLT A;  5IIO A;  2K4H A;  1L3U A;  4PPX A;  1FIQ A;  3NRW A;  2HBK A;  1S0M A;  4Q44 A;  2ZUB A;  4KN7 A;  4IQW A;  4ECV A;  3V72 A;  2K8C B;  5HP4 A;  1U45 A;  1ZQL A;  3TAD A;  2XY6 A;  4EYI B;  2OXO A;  9ICJ A;  4B9U A;  3JPS A;  4PL2 A;  4KLS A;  2KE7 A;  1HIW A;  8ICI A;  3AM9 A;  5DQI A;  2DPI A;  5JU5 A;  3T3F A;  3KOO A;  4ZOH C;  5KFW A;  4C8L A;  1SV4 A;  3GIK A;  3HWT A;  3H8W A;  5ALP A;  5DLG A;  5TIS U;  8ICY A;  3GII A;  2ZIX B;  3IM1 A;  1ZQZ A;  5G5G A;  2K8A A;  1YT3 A;  3PMN A;  5KL1 B;  3UM9 A;  2W8K A;  5J8Y C;  3CP8 A;  3PX6 A;  1DK2 A;  1F44 A;  3G6Y A;  1F0M A;  3AQF A;  2DGZ A;  5AKE A;  5L1L A;  2HHQ A;  1SL0 A;  1KKX A;  3M8S A;  2PXI A;  3ZDB A;  1B22 A;  4RT2 A;  2H3V A;  4IC9 A;  1KLN A;  3RJI A;  2BQR A;  1BNP A;  1OW5 A;  8ICP A;  4QZB A;  4NV0 A;  3UQ2 A;  3ED5 A;  1SV0 A;  9ICC A;  4NLZ A;  1MQ2 A;  4RQ0 A;  2ZJ8 A;  3MR5 A;  4DL7 A;  2AJQ A;  3NS1 A;  5EOZ A;  3Q8L A;  1S10 A;  4JV0 A;  3C2M A;  3TAN A;  2E5S A;  1X6I A;  2H5X A;  5AKL A;  1QSS A;  2ZIX A;  2V4R A;  4IL6 U;  3F2B A;  4UB4 A;  2EAP A;  4ELU A;  2IOH A;  2Y9U A;  2R8H A;  4DCC A;  1BPZ A;  3MDC A;  2YX8 A;  2G07 A;  2A1J B;  4DOB A;  3N97 B;  4PJ0 U;  3V6K A;  4FBU A;  4DSK A;  1N5W A;  2EAO A;  2MA1 A;  1WCL A;  2NRZ A;  3QZ7 A;  7ICL A;  5KL8 B;  2AQ4 A;  4HAI A;  5J0S A;  5AK4 A;  3QZ8 A;  5ALF A;  3QU4 A;  2ZXI A;  4B9L A;  2F2A B;  3QXG A;  4R8U A;  3RH5 A;  4LVS A;  4P0P B;  2HHS A;  4F5Q A;  5AM2 A;  2HOF A;  1IXR A;  3AN1 A;  4YP3 A;  3C5F A;  7ICP A;  5T14 A;  1EXN A;  3C23 A;  1O08 A;  4PHP A;  1DXS A;  4HYK A;  4RQ7 A;  2EQY A;  8ICK A;  1BVS A;  3C21 A;  1CI4 A;  3IDW A;  2DKZ A;  1X9M A;  3AUO A;  5HR7 A;  5J0R A;  4C8N A;  5DQH A;  4J03 A;  1XSP A;  1ZQM A;  5J2E A;  1TK8 A;  3KKA A;  1D8L A;  1L7M A;  2B0C A;  2F1I A;  2BQU A;  1NNL A;  1ZQK A;  2W7O A;  3LWL A;  3V7J A;  1SXD A;  2LKY A;  4KLF A;  5KFN A;  1ZQX A;  1UA1 A;  2KD1 A;  5KG1 A;  3WK5 A;  1UA0 A;  1N5X A;  3SI8 A;  4DS4 A;  4FS1 A;  4RQ6 A;  1KFS A;  5AM1 A;  3KHG A;  3WU2 U;  2QLT A;  3QUT A;  2VAN A;  3AU6 A;  1Z1B A;  5CEH A;  3SV4 A;  4DWI A;  1N2X A;  4BXO A;  5CWR A;  5ALS A;  1ZQO A;  1UQV A;  5CB1 A;  3D6J A;  1NJY A;  1LVH A;  5HML A;  2LBO A;  4CF3 A;  4K4G A;  4M9N A;  4P0Q A;  2OWO A;  3PW0 A;  5AM3 A;  4Y2X A;  2JEF A;  1N62 A;  4U6P A;  2ZTC A;  4XQ8 A;  1BGX T;  3BS7 A;  1UCV A;  2ZIW B;  2C2D A;  2EDU A;  2HSZ A;  5IIL A;  5DB7 A;  3EW9 A;  1SKS A;  4DFM A;  3DDH A;  4ED6 A;  3EWA A;  1ZJM A;  4GXJ A;  2FPK A;  1LB2 B;  1ZD5 A;  4Y2J A;  3RH4 A;  1KN5 A;  1JI7 A;  1TVA A;  1KDH A;  1OXJ A;  4J9P A;  4DQI A;  1WWU A;  1RM6 C;  7ICQ A;  1KRP A;  8ICS A;  3ICX A;  9ICF A;  2OM6 A;  5AK3 A;  1RPL A;  5ALN A;  3SAF A;  5K4L A;  2BCQ A;  4F5R A;  1UHU A;  2QB1 A;  1BPE A;  2MUT B;  9ICH A;  3QU7 A;  2HHW A;  9ICK A;  5KFM A;  3BZK A;  2G06 A;  1SZP A;  1Q8K A;  2KHV A;  2B6G A;  1ZQW A;  4JWN A;  5ALX A;  1ED1 A;  3GZF A;  2XVT A;  2HHV A;  2E8P A;  1PUZ A;  4OD0 A;  4XRH A;  2AGO A;  3C28 A;  5DG9 A;  4NLG A;  4QZA A;  4QIW F;  4UB1 A;  2MUT A;  1L7O A;  1V9P A;  5BPC A;  1F5S A;  2QAR A;  3BQ2 A;  5AKG A;  2ZIU A;  3CRX A;  4M6W A;  3SZ2 A;  1X9W A;  3IHQ B;  4CCH A;  8ICU A;  4DLE A;  4KLQ A;  1IG6 A;  7ICU A;  8ICG A;  5AKK A;  2XCP A;  5ALL A;  2ASL A;  4UAY A;  4GXK A;  4C4T A;  2J6U A;  2LI6 A;  1MN8 A;  3E0F A;  3RB3 A;  4EEL A;  2HW3 A;  4US9 A;  2BPG A;  2UVU A;  2BDU A;  2W54 A;  1S8O A;  1Q46 A;  4DFD A;  2RDI A;  2K4I A;  2RQ5 A;  4F4Y A;  4I2B A;  3OSN A;  5IIK A;  4DQS A;  2DL0 A;  2HDO A;  2Q4T A;  2GH1 A;  3QYP A;  4FZL A;  3WK9 A;  3PO5 A;  3IV6 A;  3Q8M A;  2JZB A;  3GIJ A;  5KG7 A;  3JPR A;  1FEZ A;  2ASD A;  2ESE A;  4YXJ A;  5D46 A;  2KIW A;  4F4K A;  4BWM A;  1PK3 A;  1SWV A;  5KFO A;  2KKP A;  3TQ1 A;  4QWC A;  5KT7 A;  8ICX A;  3QUQ A;  2XO7 A;  5E79 U;  4NWI A;  2WAQ F;  3M6K A;  1L7P A;  4EX6 A;  2W04 A;  4BUG A;  4F5P A;  5AM0 A;  2OHF A;  4F3O A;  3QX7 A;  4P4O A;  5TZV A;  4M9G A;  4DF4 A;  2XY5 A;  5CHG A;  1PZN A;  1TAM A;  2AHO B;  3LDA A;  4GXI A;  2KSO A;  3OJS A;  2W11 A;  4RPZ A;  1SWW A;  8ICR A;  8ICZ A;  3JPP A;  4UAS A;  3V7K A;  2R8J A;  2JRZ A;  3IRU A;  9ICS A;  4I29 A;  3QEA Z;  1QTM A;  1KFT A;  4FBT A;  4O3N A;  3A0H U;  4MEY A;  4IQV A;  4UAZ A;  2LPE A;  2FMP A;  2ZUC A;  4Q45 A;  5ALQ A;  4P0P A;  2HBJ A;  1LKY B;  3OSP A;  2DWQ A;  5KFT A;  4IQT A;  1KBU A;  4NLB A;  3H0R B;  2OH2 A;  2JR5 A;  3N7S C;  1S5L U;  1NZB A;  4YD1 A;  3RF9 A;  2DKX A;  7ICH A;  5C5J A;  9ICN A;  3H8S A;  1QQ5 A;  2W9A A;  4ICA A;  2FMQ A;  5ALV A;  4ECS A;  1QCK A;  3JPO A;  3WKC A;  4QZD A;  4F50 A;  4DOC A;  3SAG A;  4UAW A;  5J0X A;  4I28 A;  3RJH A;  4DSF A;  3GIL A;  1L8L A;  4Q8E A;  2BDP A;  3KHR A;  4PGY A;  4DL6 A;  3RB6 A;  1D8B A;  9ICP A;  4CGZ A;  2KVC A;  2W8L A;  2PMZ F;  4DSI A;  5HNK A;  1NK4 A;  3NUQ A;  1NK5 A;  4WJ3 B;  1JRP A;  4ELV A;  5KG0 A;  5KT3 A;  2LYB A;  1BPD A;  3CW2 C;  2YMP A;  1SB3 C;  4J9Q A;  5KAF U;  3AEV A;  2HHX A;  3WK7 A;  4O5E A;  2KZZ A;  1S76 D;  1NK8 A;  2JEG A;  2P6U A;  3TFS A;  5AHX A;  1ZXI A;  4BX9 C;  4KIT B;  3GV8 B;  3F5E A;  2AGQ A;  2BCS A;  1MSW D;  3H0M B;  4DSJ A;  3RAX A;  3GIM A;  2HHU A;  3Q8R B;  1Z19 A;  1RYR A;  3ETL A;  4F5N A;  3I76 A;  3ZDE A;  3BZC A;  2WFA A;  5AK6 A;  4I2I A;  5AI8 A;  2PKE A;  2NO4 A;  3BQ0 A;  4QWE A;  4O9M A;  4QWD A;  2IHN A;  5B66 U;  2AU0 A;  2WTF A;  9ICM A;  5DGA A;  2Q0Z X;  1RXV A;  4UAT A;  1Z4N A;  2ZTD A;  3DV9 A;  2KEY A;  5KFP A;  2BR0 A;  2AQ0 A;  3LK9 A;  2MU2 A;  4CF4 A;  4RT3 A;  4FO6 A;  1UPH A;  2M0N A;  3QUB A;  4KLJ A;  2KK0 A;  2G09 A;  1NK9 A;  3BDP A;  5L1I A;  1TK5 A;  4AYB F;  3GV7 B;  2LMR A;  4RQ1 A;  1URJ A;  3HKZ F;  3ETR A;  4XA5 A;  5AIB A;  3F5A A;  2F1H A;  3Q8P B;  1TV9 A;  3ZI4 A;  2CN1 A;  2R18 A;  4Y2V A;  5J2F A;  4ELT A;  3D2Q A;  4TQR A;  2W9M A;  2HMX A;  2DFL A;  4C8M A;  5AKI A;  1X66 A;  4F5O A;  4M47 A;  4J9S A;  4YR2 A;  4RUA A;  2G0A A;  5AM4 A;  2BGW A;  3LVW A;  4DEZ A;  2EAM A;  3H4D A;  3NVW A;  2RHF A;  4C80 A;  5KT4 A;  4FZN A;  3FDS A;  4UB3 A;  3PR4 A;  3BS5 A;  3DEE A;  4YQW A;  4PL1 A;  2HBM A;  4EEY A;  2NRT A;  3C29 A;  3NVZ A;  3SYZ A;  2VA8 A;  2KHQ A;  3M9M B;  3RR7 A;  1ZJN A;  5J2D A;  3BQ1 A;  2HVH A;  4O0I A;  1L6N A;  2BQ3 A;  4Y2U A;  5AI6 A;  4GC6 A;  3H4B A;  4R63 A;  2JEJ A;  2P35 A;  1ZQY A;  9ICE A;  3RBE A;  2G08 A;  2WHE A;  4UBB A;  1XNS A;  5J0T A;  1L7N A;  5KFQ A;  4KLL A;  4C0Z A;  3F2C A;  4B9M A;  2EAN A;  4PHE A;  2R8I A;  1ZQP A;  9ICA A;  2Y0S C;  2Y0S F;  2E8O A;  2WF7 A;  1ECW A;  4LJX A;  3AL0 B;  2F77 X;  4M9L A;  4UB5 A;  2J6T A;  1ZQJ A;  5KFD A;  1RZT A;  2C2R A;  1ZRN A;  3ALR A;  2F44 A;  3IP4 B;  2JGA A;  5EWF A;  3UQ0 A;  3G6V A;  2N1R A;  4B6J A;  3RFA A;  1L3S A;  3M8R A;  4DQQ A;  3KHL A;  2AH5 A;  1X6J A;  1SKR A;  1RQN A;  2PFP A;  4UB2 A;  1V85 A;  5J0W A;  3ZDA A;  2HBL A;  4UB8 U;  4CDG A;  5EE1 A;  1T94 A;  4EBC A;  1C20 A;  5AI5 A;  3PW2 A;  2K4P A;  9ICV A;  5III A;  5F9N A;  4J9K A;  8ICL A;  3M9O B;  1D8Y A;  4M9J A;  4YG2 A;  3WK6 A;  4RU9 A;  4X5V A;  3TAR A;  1Q3V A;  2DPJ A;  1B0X A;  8ICF A;  3FYH A;  3WKB A;  2JH1 A;  2ATL A;  3S6J A;  3TKA A;  4OO1 J;  5BOL A;  1KSP A;  2DUY A;  1MQ3 A;  4OJL A;  1ZRM A;  1JXL A;  2R8G A;  3CNH A;  1U4B A;  1JXE A;  5AKX A;  1TAU A;  3C2L A;  2A3V A;  3UXO A;  2XY7 A;  1ZQN A;  3LWM A;  3TAC B;  4MFF A;  1GO3 F;  4ECY A;  8ICE A;  7ICK A;  2H3Z A;  4Z6D A;  3B0X A;  5DBB A;  3I28 A;  1XSN A;  3HIL A;  3PW5 A;  8ICQ A;  2E3T A;  2WF8 A;  2ES6 A;  1JN3 A;  1NKB A;  2BCR A;  5KT2 A;  2D8C A;  2ZIU B;  2IOF A;  2M9N A;  5AK5 A;  1SIJ A;  3EPI A;  3D2S A;  5L1K A;  1Z00 B;  3KKA C;  3U26 A;  4DSE A;  9ICR A;  1TE2 A;  5B5E U;  3LVV A;  4QIW C;  4MF8 A;  1B43 A;  5ALZ A;  1PVR A;  5DDY A;  4QZG A;  2GLE A;  4EZ9 A;  2WF9 A;  4O5K A;  4I27 A;  3C5G A;  1HJP A;  1YZ6 A;  3NVY A;  3QUC A;  1XU4 A;  5ALY A;  2MAX A;  2KP7 A;  3O0F A;  5KFJ A;  4F91 B;  1FO4 A;  5J0Y A;  5J2A A;  4YR0 A;  3IG8 A;  4R66 A;  3Q8S B;  1Y88 A;  5DB6 A;  3MC1 A;  4FE3 A;  4KX5 A;  5A0L A;  2LHT A;  3M9N B;  1NK7 A;  4GC7 A;  5J0O A;  4US8 A;  1U49 A;  3BQT A;  1COK A;  4NY8 A;  2I6X A;  7ICM A;  2XI9 A;  4EBE A;  3RR8 A;  4YR3 A;  4OJ5 A;  4DLG A;  4Y2S A;  4O3R A;  2KZ3 A;  5J0P A;  4EEN A;  5IIN A;  4KLT A;  5D49 A;  3T5H A;  4O3Q A;  1NKE A;  5DLF A;  3OHA A;  4DS5 A;  1SZH A;  2Y1I A;  4J9M A;  4JK1 A;  1PK1 B;  8ICJ A;  2ZIV A;  1Z3E B;  5KFY A;  4KLU A;  2BCU A;  5KFG A;  1DOQ A;  2NYV A;  4PH5 A;  2Y9T A;  4M6W B;  5JTI A;  1PVP A;  4BDP A;  2LYH A;  1J97 A;  1DGJ A;  3UMC A;  4PGX A;  5KFR A;  3OHB A;  3PV8 A;  4DQR A;  2YMM A;  3RJG A;  2BPC A;  4IQU A;  2ALZ A;  4IS7 A;  5H2F U;  3KFU F;  2WF6 A;  4ECR A;  3RB4 A;  5KG3 A;  1A77 A;  3H7I A;  2F8K A;  5CA7 A;  4Z6F A;  1CRX A;  4PZN A;  5C0Y A;  1J2M A;  3TAP A;  4NM1 A;  4NM2 A;  2ZJ5 A;  1BNO A;  8ICH A;  7ICO A;  4C7Y A;  1SXE A;  4JB3 A;  4ED3 A;  1K1Q A;  4AP9 A;  4J9N A;  1KFD A;  1L8O A;  2HHT A;  3V6J A;  2G5I B;  2YQE A;  5EWG A;  1AQ6 A;  1NJX A;  1MA7 A;  3WK8 A;  3WK4 A;  4ECW A;  4ED2 A;  4NL9 A;  3CYM A;  1WCN A;  4IRD A;  2PFN A;  3TI0 A;  9ICT A;  4O3P A;  4K4I A;  4K4H A;  4TUR A;  2NO5 A;  3MGH A;  4P4P A;  2XGQ A;  1SKW A;  4TUP A;  1UT5 A;  3V7L A;  3SQI A;  3AQE A;  2V9W A;  3RB0 A;  2ASJ A;  3FC4 A;  1T8E A;  2O6K A;  1KQQ A;  2NRV A;  4MHV A;  1FFV A;  4DQP A;  3ZDC A;  3PSF A;  1XS9 D;  1S0O A;  5F3X B;  4CNQ A;  2AGP A;  1WUD A;  3L3F X;  3QU2 A;  4EYH B;  3MR3 A;  2W7P A;  5AM5 A;  2XCA A;  4BXO B;  4EZ6 A;  1V38 A;  1SL2 A;  2JEI A;  2PFO A;  2DBY A;  4QW9 A;  2L5Y A;  4F93 B;  1ZQQ A;  4RPY A;  4AYB C;  4YD2 A;  4LZG A;  5AIC A;  1U48 A;  3M7D A;  2OYY A;  4DL3 A;  1BPY A;  3I1Y A;  1S97 A;  2JMG A;  2R8K A;  5KFX A;  5KFZ A;  4DOA A;  4EBD A;  1ZET A;  4QZ8 A;  2C22 A;  3Q8K A;  1VDV A;  2YY6 A;  2BHN A;  1KEJ A;  3KTQ A;  4ACO A;  1ZQH A;  4Y2R A;  3NGD A;  3HW8 A;  2V4Q A;  2UVV A;  3WKE A;  3BQ7 A;  2ODG A;  4YMN A;  4ZH4 A;  4GFJ A;  2FMS A;  5KFA A;  4B9T A;  2XIC A;  1NK0 A;  7ICJ A;  4E0D A;  1Z00 A;  4I2F A;  5ALD A;  1A0P A;  2JXJ A;  3Q8Q B;  2W43 A;  2CRX A;  1X2I A;  4C8K A;  2IOF K;  1ZQR A;  4ED7 A;  4MEX A;  8ICN A;  4XUS A;  2K60 A;  7ICT A;  3H8M A;  2F76 X;  5EE3 A;  1TK0 A;  2H3Q A;  3HT3 A;  4NL9 C;  4EX7 A;  3FM9 A;  1YZ7 A;  2KKV A;  5KG4 A;  5BOM A;  3SEI A;  4QZH A;  1OUQ A;  5AKZ A;  2KOB A;  4F4X A;  1X9S A;  1RQL A;  2HVI A;  3PO4 A;  4TUQ A;  8ICW A;  1S9F A;  5KFU A;  3IG5 A;  1ZQA A;  1CEZ A;  4GIB A;  3GU3 A;  2A1A A;  2PFQ A;  1BPB A;  5AI0 A;  3SAH A;  2ISO A;  2ZTE A;  3LYS A;  7ICG A;  2FPL A;  1NKC A;  4R64 A;  3SD7 A;  4DL2 A;  8ICB A;  2DF4 B;  3F53 A;  5KFC A;  2RRD A;  2UVW A;  3MFH A;  5EE0 A;  2VJ4 A;  2J6S A;  4MF2 A;  1ZQG A;  3OTQ A;  5F9L A;  3C2K A;  1T4G A;  1V97 A;  5J0U A;  1VJ5 A;  3QE9 Y;  3D2N A;  3K1Z A;  5CJ7 A;  2HOQ A;  2F3N A;  2RDJ A;  5ALR A;  3T5L A;  3H40 A;  4F2S A;  3C1Z A;  1ZD2 P;  4QNL A;  4EEK A;  4RQ5 A;  5J0Q A;  2KJ8 A;  4KN4 A;  5AIA A;  1L5U A;  3H8J A;  4F8R A;  2IA6 A;  3PY8 A;  1L3T A;  1QLN A;  5ALH A;  3E2E A;  2W9B B;  2P6R A;  7ICF A;  2G5H B;  4DL5 A;  8ICO A;  4YCX A;  1N60 A;  2H3I A;  2W55 A;  2I1Q A;  1P7D A;  5HMM A;  4M0A A;  1TAQ A;  3MR2 A;  2RP5 A;  2QKQ A;  2E8M A;  4ED0 A;  2E8N A;  4Q8F A;  2KJ9 A;  2ZXH A;  5AKJ A;  5KNI A;  2BKE A;  4R8U B;  1ZQS A;  2W3S A;  3TAQ A;  3NTU A;  3PZP A;  3N4M B;  3E58 A;  2D6F C;  3HP6 A;  5KG5 A;  1NZP A;  3EPG A;  4Q43 A;  2EZY A;  2YB1 A;  3A0B U;  1RYU A;  2CXY A;  5EE9 A;  2DQN B;  5DG8 A;  5DDM A;  4JUZ A;  1WYG A;  2LYA A;  5ALM A;  1JRO A;  4CE6 A;  4A8E A;  2A1J A;  4DO9 A;  5ALG A;  3AMZ A;  3PST A;  4I2E A;  2KIV A;  5J2G A;  3SEN A;  1SL1 A;  4F92 B;  5KAI U;  3GV5 B;  1ZQE A;  4IRC A;  5HHH A;  9ICG A;  4UBC A;  2WF5 A;  3FAH A;  2KJ5 A;  3ISC A;  1H38 A;  1QSY A;  3RJF A;  1ZQT A;  1K1S A;  3OGU A;  2KN7 A;  4JV2 A;  1KW4 A;  5KFS A;  1J2N A;  2I9G A;  4F4Z A;  2IBK A;  4BWJ A;  5J2K A;  1ZQB A;  4KMO B;  4KLD A;  2VA3 A;  3EYZ A;  5KFI A;  4OCZ A;  4ED8 A;  4RUC A;  5KFV A;  3MAB A;  2ZJA A;  4RNO A;  1TFR A;  5DBA A;  4QWA A;  4RQ3 A;  1KTQ A;  5AKY A;  2XID A;  5ALK A;  2VJ5 A;  3MBY A;  2C28 A;  4FZM A;  3MGV A;  4KX3 A;  3K75 D;  5KFB A;  1MC8 A;  4C8O A;  3GDX A;  1DGS A;  2K8B B;  1O03 A;  1ZQD A;  4OJO A;  9ICW A;  2JH7 A;  1XO1 A;  7ICS A;  1FFU A;  4F2R A;  5L1M A;  5ALW A;  4PHA A;  1S0V A;  4YVZ A;  1ZQC A;  4O5C A;  4G9B A;  2KG5 A;  2H3F A;  2ZUD A;  4J9L A;  1RXW A;  8ICA A;  2K4E A;  2HI0 A;  3PW7 A;  1DRG A;  3KHH A;  2OCE A;  5ALJ A;  3M1Y A;  2QB0 A;  1X9X A;  2FE9 A;  5KG6 A;  2QAR B;  3ZD9 A;  1LKY A;  4DL4 A;  3GQC A;  3PX4 A;  4MFA A;  5DGB A;  3V6H A;  5KT6 A;  4IR9 A;  2FPM A;  4M2Y A;  3PR5 B;  1RDF A;  4PHD A;  5DQG A;  2W9C B;  3RTV A;  2HOI A;  1Z4O A;  4IRK A;  4M04 A;  1JIH A;  4QZI A;  3ISD A;  1D9D A;  5J2H A;  4ECZ A;  4Z6E A;  4RQ4 A;  1Z1V A;  2YMQ A;  1UT8 A;  2GWS A;  4KLO A;  4DFP A;  4B9N A;  5ALT A;  7ICN A;  4F72 A;  4RQM A;  4B9V A;  9ICI A;  5AI4 A;  3THV A;  2UVR A;  9ICL A;  2E1E A;  1CUK A;  2MSN A;  4FFD A;  3UXP A;  5KFK A;  2BPF A;  4I2G A;  5HHI A;  4B9S A;  3RAQ A;  3KD3 A;  2F1J A;  5EWE A;  4F71 A;  2LM4 A;  2P66 A;  5GTI U;  3ZD8 A;  4I2H A;  4OJ6 A;  1BPX A;  4NXZ A;  3JPQ A;  4ED1 A;  4LZD A;  3NVV A;  3T79 A;  4ECX A;  4USA A;  3PSP A;  3TFR A;  1NI3 A;  3PML A;  2C2E A;  5KTQ A;  2ZIV B;  4NLN A;  1L3V A;  4KMU A;  1PK1 A;  4I2J A;  1ZYQ A;  3PVX A;  3L5K A;  8ICT A;  3B0Y A;  5J2B A;  4KLI A;  2XC9 A;  2VA2 A;  5DKW A;  5ALI A;  2PI5 A;  1M6Y A;  4JV1 A;  5L9X A;  1ZQU A;  4KLM A;  2PI4 A;  3HKZ C;  2WB1 C;  3MFI A;  4RQN A;  2W03 A;  2MRL A;  9ICO A;  2FI1 A;  3JPT A;  4NLK A;  1JMS A;  3UMB A;  4DFK A;  3RJK A;  2BCV A;  1N48 A;  2EZZ A;  1ZQF A;  4RZR A;  3OPX A;  4QWB A;  2KSO B;  4QZE A;  4O3O A;  1VLB A;  2E1F A; 
#chains in the Genus database with same CATH homology
 2JXJ A;  2LM1 A;  2EH9 A;  1IG6 A;  2OEH A;  1KKX A;  5K4L A;  1C20 A;  1RYU A;  2CXY A;  2EQY A;  2LI6 A;  2RQ5 A;  2YQE A;  4LJX A;  2JRZ A;  2KK0 A;  5CEH A;  1KN5 A;  1KQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...