2EQYA

Solution structure of the arid domain of jarid1b protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
GSSGSSGEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTSDTKDKEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ARID domain of Jarid1b protein
rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords Jumonji, AT rich interactive domain 1B
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2eqyA01
1KKXA 1KN5A 2EQYA 2JXJA 2OEHA 2LM1A 1KQQA 5CEHA 5K4LA 2KK0A 1C20A 2EH9A 2RQ5A 2YQEA 4LJXA 1IG6A 2JRZA 1RYUA 2LI6A 2CXYA
chains in the Genus database with same CATH superfamily
1SZHA 4P0PB 1QQ7A 3ETRA 2KSOB 2G09A 5EE0A 3U26A 1XU4A 1K1SA 4UAYA 1RM6C 5J2HA 4NLGA 3ISCA 1MN8A 4I2GA 5L1LA 1N2XA 2ZIWA 1PK1A 3GDXA 4DEZA 4DFKA 2KJ5A 3TAPA 5AK6A 4Y2RA 2NO4A 2AJQA 3M9MB 5DDYA 4BUGA 4C80A 5JU5A 5IIJA 1CUKA 9ICWA 2KN7A 1FEZA 1S0NA 5J0RA 3UMCA 5B66U 5KFPA 3HRDD 4Y2PA 5KT4A 1D9FA 9ICFA 4UB6U 2VKQA 5ALRA 3SAFA 2NV3A 5K4LA 2LHTA 3ZDCA 1SV4A 3QNMA 2NRTA 3ICXA 3M6KA 5KT2A 5EE1A 5KNIA 5KT7A 2VJ5A 1NJZA 3V7LA 5KG2A 5HP4A 3VCBA 4F71A 2OXOA 5A0LA 5KFOA 1HIWA 4OJ5A 4PZOA 5DBBA 3OJUA 2GLEA 2KV2A 3B0YA 3PZPA 5J2JA 2WFAA 3H8SA 3EW9A 1C7YA 3H7IA 3NRZA 3QEAZ 3SV4A 1ZQFA 2YTUA 2DGZA 2ZIUB 3NGDA 8ICNA 3GIKA 4QZ8A 3MR6A 2D8CA 4NV0A 4P4OA 3SYZA 4QW8A 3WK4A 2FLLA 2JHDA 1UT8A 2VJ4A 4C8NA 3I28A 3PSFA 4IR9A 2V9WA 3RBDA 3CP8A 4OJLA 4DL6A 1WG8A 2UVRA 1SXDA 3H4DA 3CW2C 1T94A 1TFRA 3QU5A 2ATLA 4QW9A 1SGGA 3AN1A 3PR4A 3QX7A 2WF5A 2KP7A 4F4KA 1QH9A 3SR6A 2LBOA 3RJHA 3K4GA 1L7OA 4XA5A 1NKBA 4UAUA 7ICNA 5AM2A 5T14A 1TAMA 4PHPA 1FFUA 1BPZA 5CP2A 2WF8A 2QARB 2FE9A 2W9CA 4J9LA 4ECYA 4F3OA 2WAQF 2OHFA 3ETLA 2PFPA 5HR6A 5L9XA 4YXJA 4RQ1A 2P6RA 5J2GA 1ZQSA 3WKAA 3VC8A 3WK7A 4JB3A 4ZH4A 4ECXA 4KX3A 2W9BA 3OGUA 1C20A 4DSIA 2A19A 2KHVA 2ZTEA 3MDAA 7ICUA 5HHHA 4PL2A 1ZQIA 1PK3A 4PHDA 4JK1A 5AK5A 2ZXIA 1X9MA 4F4XA 2G08A 2WF7A 3IG8A 1A6SA 1JUDA 1N63A 1BPYA 5J0YA 3BQ2A 3RB0A 5IILA 1WYGA 5KFXA 4OCZA 4IQUA 1KSPA 4E0DA 1F44A 5KFBA 4BWJA 3C2MA 4F2RA 2KNJA 5CA7A 2VA8A 2XCAA 3RJIA 5DB9A 2ISOA 5L1MA 1L3SA 4PGQA 1J97A 4ZOHC 4USAA 2CN1A 3DDHA 2IOHA 2OWOA 1A76A 2DKZA 4X5VA 1ZJMA 3BZKA 3QU2A 1KN5A 2NYVA 1LKYA 3PVXA 4TUQA 2FMQA 3PW2A 2DPJA 2LM1A 3PX6A 3PX0A 4Y2QA 2R8JA 4J03A 2F44A 5CHGA 4YD1A 1OUQA 4RNOA 4ICAA 2NRVA 4KLQA 1UQVA 3OSNA 4O3SA 3NUQA 3SAGA 4QZHA 3TANA 1S76D 4I28A 3NS1A 3TQ1A 4YG2A 1PVQA 3GV5B 3TFSA 2A1JA 1T8EA 3ORYA 5ALEA 3KHHA 3SAHA 3C23A 9ICEA 4US9A 5L1IA 5DQHA 4DL4A 1QSYA 2ZJ5A 4F5PA 2H3VA 4QZAA 3BS5B 1X9WA 4UAZA 4J9SA 4OD0A 3ZI4A 4DF4A 4MFAA 1MQ2A 2DFLA 2G5HB 2ASLA 2W9BB 3BZCA 3PY8A 1SWWA 2BGWA 4EZ6A 2HVIA 4U6PA 3JPNA 5DG7A 2BPCA 3PW5A 1U9LA 3MR3A 1FO4A 3SZ2A 2HHSA 1NK4A 2HW3A 2HCFA 1RYUA 1GO3F 1YZ7A 3QU9A 4YMNA 5BOMA 4P0PA 4PZNA 5J2FA 3N7PD 3MR5A 4QZFA 3T5KA 4C4TA 1JROA 4J9KA 1QSLA 2H3ZA 3PR5B 3S6JA 5B5EU 3RTVA 3IV6A 2NRWA 5KFEA 4KTQA 1ZQVA 2E8PA 3BQ1A 5AKKA 3K75D 5JUMA 4RPYA 2BDPA 1Q3UA 2I6XA 2DF4B 1NOMA 3HILA 5DB8A 4I2IA 1S0VA 4I2CA 5AKHA 4M2YA 3RB3A 4UBCA 5AI5A 2V4QA 3M7DA 4JV1A 7ICGA 4CF5A 4B6JA 4K4IA 3UPQA 4IRDA 4YN4A 2KVCA 2J6SA 1D8YA 2W9AA 4PH5A 5KAFU 3QZ8A 3C21A 5KFTA 4UW9A 4DS4A 1V97A 2FMPA 2HI0A 4B9TA 4PGYA 1BNOA 4EZ9A 4O9MA 3GV8B 5G5GA 3LWMA 1ZQGA 3L3FX 1N62A 9ICNA 3T5LA 4IQVA 1UT5A 1Z4OA 2CXYA 3GQCA 2QKQA 4MEXA 8ICEA 5AKLA 3TADA 4MF2A 2K8BB 2W3SA 4I2EA 4Q8EA 3CYMA 2G5IB 1XC9A 5CEHA 1Z00A 3TARA 5EOZA 3JPSA 2WB1C 4DSKA 3C1YA 4KLOA 4C0ZA 5F9LA 2JEFA 3BQTA 4DFMA 1DK2A 2DWQA 3UQ0A 2ASDA 1V9PA 3JPQA 5KFUA 4CGZA 4ECWA 3ZDAA 2E1FA 3QUBA 4YQWA 2HBJA 3Q8LA 2A1JB 4EX6A 2HVHA 1ZETA 2XY7A 3MFIA 2RRDA 3SD7A 1ZQAA 2K89A 3RB6A 3WKBA 1RDFA 1RYRA 2FJ6A 2ZJAA 1S9FA 3V6HA 4C8OA 3NVZA 1SB3C 5AM1A 1P7DA 5HR7A 2ZTDA 5ALHA 1BNPA 3M9OB 5ALFA 2LM4A 2MU2A 3SI8A 2JH7A 5J29A 2AQ4A 2BZFA 2F1IA 5JTIA 2KKPA 2ZIWB 4M0AA 5AKGA 1JRPA 2XICA 5KT6A 3UQ2A 4QZGA 3G6VA 3D2SA 4JWMA 4M9NA 2BHNA 1ZYQA 2UVWA 2I1QA 3KBBA 5J0PA 2BCQA 1QLNA 4QZCA 5KFWA 3SQIA 9ICBA 3BQ7A 5AM3A 5DG9A 1TE2A 4NL9C 3ZDBA 3PMLA 4ED7A 3UXOA 4C8MA 2KMDA 3TAQA 5ALUA 1TVAA 1V85A 4EENA 2OEHA 3WK5A 3A0HU 3OHAA 5J0SA 3PX4A 1KFSA 4M47A 4PJ0U 1VLBA 1ZQXA 4I29A 7ICVA 2PXIA 4P0QA 4Z6CA 1ZRNA 2P66A 4RQMA 1O08A 1KQQA 3ISDA 1ZQDA 2VANA 2KIWA 2W55A 5DDMA 4F50A 3RFAA 5KFKA 4O3NA 1ZQRA 2W7PA 4O5CA 2AGQA 2RDJA 2IBKA 4I2BA 5DLGA 2M0NA 3EWAA 4CDGA 1SWVA 3PW4A 3IN5A 1TK5A 5KFJA 4RQ5A 2I5HA 2JZBA 2ZUDA 2W11A 3SV3A 1DRGA 2R8HA 2YMQA 3FDSA 3CRXA 2KSOA 3K1RB 4FZMA 2ZIUA 2E8MA 4P4MA 2BQUA 3BDPA 1J2MA 1IIPA 1XS9D 3RRGA 4OJ6A 1UHUA 4RT3A 2MRLA 1ZQEA 5KG0A 3RH4A 9ICTA 5KT5A 4I2DA 5EWGA 4C7YA 5J2KA 2K8AA 4O3OA 4B9NA 4LZDA 2H3IA 2RQ5A 4BGDA 1FIQA 4YXMA 1KRPA 2KOBA 2H3QA 2BCUA 3TKAA 5L1JA 1RYSA 8ICOA 1OXJA 1X6IA 3M8RA 4DQIA 2HHWA 5AI6A 4UB4A 2KE7A 9ICIA 5J2DA 4KLLA 1L3UA 1ZQYA 1ZD5A 4XQ8A 2KEYA 4I2HA 4KX5A 4C7ZA 5KG5A 4YCXA 1NZPA 3RJEA 3QXGA 1T7PA 1ZQNA 4I2JA 1SZPA 4ECRA 2KZZA 4R8UB 5DGAA 4QJFB 4AYBC 2WF6A 1Q3VA 2HHTA 1IV8A 3SMVA 5ALJA 3C29A 2EQYA 1ZQOA 4B9LA 3Q8KA 3OPXA 2K4PA 5KFMA 8ICLA 4KMOB 4GFJA 2ISPA 2JR5A 8ICCA 5TISU 2D3DA 9ICRA 5J0XA 2BR0A 1S97A 4UATA 7ICRA 3N7SC 4YR3A 2JZBB 4A8EA 8ICFA 1H38A 1JXLA 4RQ8A 3HKZC 5KFZA 4GXJA 1L7MA 4DOCA 1K1QA 2AU0A 4TQRA 1RG6A 2RLTA 5AKJA 3M8SA 2EZZA 5IINA 1L7PA 3EYZA 3FM9A 8ICSA 5IIMA 4ED3A 5KL8B 3R9KA 2GH1A 5KL1B 5L1KA 4ACOA 4ELVA 3ZD8A 5AM4A 1MQ3A 8ICMA 2JXJA 4TURA 1Z3EB 4Z6DA 3RJKA 2XVTA 1MSWD 3Q8SB 3EPIA 3MABA 5KFNA 3RR8A 1ZD2P 1N60A 4FZLA 2BDUA 5J8YC 3GIIA 4F8RA 5ALTA 3BQ0A 1WCNA 5J2BA 2P6UA 2HHVA 5D4BA 3BJYA 4DQPA 2Y9UA 4F91B 2XIDA 1JIHA 1KTQA 4Y2XA 5ALYA 3UXNA 4IRKA 2C22A 4DO9A 4YMOA 2H5XA 5DBAA 4JV0A 1MA7A 3AQFA 2HDOA 1COOA 1J2NA 2HOQA 3IRUA 5HMMA 4QZDA 2KFZA 5TZVA 1BPXA 4IQWA 5AM5A 3FC4A 1ZQHA 3OSPA 2K4EA 1XO1A 4Y2JA 2OM6A 1Z19A 1L8OA 4Y2UA 2Q0ZX 4UB3A 2QB0B 1BPBA 3H4BA 1KFDA 1UA1A 4BDPA 1URJA 1U47A 3SEIA 3KKAA 1ZQPA 8ICHA 4NY8A 4DLEA 3F5AA 2NRXA 2ES6A 4J9OA 2XC9A 1COKA 1BPEA 2KZ3A 3HPOA 1Z4NA 1N5XA 1ZQQA 5AKIA 2WB1F 1NK8A 1X9SA 4Y2TA 2A1AA 5AKZA 8ICYA 3PW7A 4U7CA 4JV2A 4DOBA 3HWTA 5EWFA 2GO7A 3O0FA 4M9JA 2W8LA 5J0TA 2NRZA 4K4HA 1ZD4A 3TFRA 9ICQA 8ICPA 2ODGA 2W54A 1PK1B 3H0RB 3MDCA 3UMBA 4NLKA 5AHXA 3QU7A 4YMMA 1SKRA 2KJ8A 2JRZA 3WKEA 2W03A 4B9SA 3AQEA 1QSSA 2IMWP 4DSEA 1QCKA 5KFVA 7ICTA 3IP4B 3UXPA 5HMLA 2HHQA 4ED0A 2C28A 4ECTA 2KD1A 4Q45A 3BS7A 3WU2U 4DWIA 1JALA 3NTUA 2EZXA 4XUSA 4KLUA 2ASJA 4RUCA 2DUYA 1CI4A 3QU4A 4YR0A 2K4HA 3T3FA 5AI9A 4UB1A 4QWEA 7ICEA 3F2CA 3UMGA 3JPPA 5DGBA 3D2NA 2FMSA 3NASA 4FS2A 4ED6A 3KFUF 4KN4A 3HW8A 3LVWA 4CNQA 2GOLA 4C8KA 5BOLA 4PL1A 5ALVA 2PFQA 2KG5A 3B0XA 1CRXA 2DQNB 5KFIA 8ICKA 2BQ3A 2PI5A 1VJ5A 9ICMA 3KHRA 2LI6A 9ICSA 4M9LA 3QZ7A 1KBUA 2YMPA 4OO1J 4BWMA 2ZG6A 4NLNA 2W7OA 1SKSA 1UA0A 2ZTCA 2LYHA 4OJOA 5ALNA 4DF8A 1RQLA 4F5NA 4YR2A 8ICVA 2EH9A 4ECZA 1TV9A 4FBTA 1SL2A 1MC8A 1K5OA 4M9GA 4F4WA 1L8LA 2GWSA 2BKEA 3IHQB 1DGSA 2HBLA 8ICQA 4UASA 3N7RC 5KFQA 4QZIA 1NK7A 2ZXHA 2PKEA 3H8MA 4KLFA 4ED1A 2EAPA 1HEKA 1B43A 4J9PA 1KLNA 4DS5A 1S10A 2FPMA 4RPXA 8ICIA 2AXTU 4YVZA 1RPLA 1NJXA 1ZQZA 1T3QA 2XI9A 3LWLA 3H40A 2ZIVA 4QZEA 2F3NA 2ZJ8A 1ZQBA 3DV9A 7ICFA 1O03A 4O3PA 2BCVA 1X42A 4P2HA 5ALGA 5DKWA 3AL0B 5ALIA 4RQ6A 1N5WA 4XRHA 2KKVA 2J6TA 1Z00B 3M9NB 4NWIA 2RHFA 8ICUA 3ISBA 3G6XA 8ICAA 5E79U 2UVUA 3WK9A 4QWDA 1ZOLA 3H0LB 5D46A 3TADC 5ALXA 4CCHA 4KLTA 4QIWC 3CNHA 4QWAA 4FFDA 2RDIA 5KFHA 1XSLA 4HYKA 2KIVA 4IRCA 4Y2VA 4NM2A 3ZDDA 4P0QB 1VDVA 2CPRA 4DFJA 4GXIA 4MHVA 5JRTA 5EE9A 4UB2A 5KFCA 1KDHA 1TAUA 4KMUA 1T3NA 4EEKA 3QE9Y 3IM1A 4J9QA 4MEYA 4RQNA 4O5EA 3Q8MA 5CB1A 1ECWA 2OYYA 2WAQC 4R64A 4CF3A 2Y9TA 2Z7JA 1BVSA 3MBYA 3GFKB 4NL9A 2KVSA 2R8IA 5AI0A 5AK4A 2YMMA 1YT3A 3NVYA 2OH2A 1ZQMA 1Z1BA 5KFGA 3RAXA 2YB1A 3T5JA 1ZD3A 5KG6A 4FBUA 1RZTA 7ICKA 5KG4A 3UM9A 3RR7A 4I2AA 5KG3A 3WKDA 4QWCA 5J8YA 2VA3A 1L3VA 2FI1A 3JPOA 3C5GA 1DGJA 4ED2A 2DPIA 4MFCA 4M6WB 3F5EA 2E1EA 2FLPA 3MGHA 4J9RA 2Y1IA 4DCCA 4O3MA 3PW0A 3H8JA 3WKCA 1A77A 5KFAA 3THVA 1LV5A 2DBYA 5AICA 1S77D 8ICTA 4C8LA 4EEYA 3ZDEA 3AUOA 2JEIA 3WK6A 4UAWA 1UPHA 4DL3A 2Y1JA 5J0OA 8ICRA 5D49A 3RJGA 1SIJA 4NXZA 5ALKA 3KOOA 9ICGA 3LYSA 4IL6U 1L5UA 4OJPA 4F4YA 4KLSA 5AKXA 1D8BA 3Q8PB 1WCLA 1ZQUA 9ICUA 2G06A 1B22A 4YP3A 1JI7A 1ZRMA 2K4IA 4JWNA 5H2FU 5F3XB 1NK5A 1RXVA 2HSZA 5BPCA 4RQ4A 2FDRA 1N61A 4Z6EA 1S5LU 4G3IA 1HJPA 5GTHU 3HT3A 4R66A 3GIMA 4UBBA 5AKEA 3C2LA 7ICSA 1HUZA 2MA1A 1WWUA 1ZJNA 3A0BU 5CJ7A 1ZQCA 4DFPA 3K1ZA 3GILA 2W9MA 2EZYA 3QUCA 3C5FA 2JV3A 1XSPA 4RQ3A 1Y88A 5ALOA 2YB4A 2XCPA 1N48A 1TK8A 4F5OA 2KJ9A 1L7NA 2VA2A 2BCRA 5KFRA 3D2QA 4YD2A 4BX9C 1TK0A 3PO5A 1AROP 4M6WA 2LYBA 4RZRA 4IQTA 1TAQA 2F76X 3NVVA 2G0AA 3NVWA 3LK9A 2K60A 2MUTA 2ALZA 2HMXA 4Q8FA 4KN7A 4LVSA 1UCVA 1OW5A 5CRXA 3OHBA 3HX0A 2HBMA 5KFFA 1JMSA 3RRHA 4NLCA 4O3RA 3RB4A 2E5SA 1IM4A 4Z6FA 3B9JA 5J0UA 4KLJA 3F53A 1X66A 3F2BA 1F0MA 3PSIA 5KG7A 4RQ7A 1CEZA 4KLDA 2LKYA 3T5HA 2IHNA 2I9GA 3FYHA 2PFNA 4B9UA 3QUTA 2ZUBA 3EZ5A 3V7KA 4RQ2A 5J2AA 4EX7A 1Z1VA 2C2RA 1IG6A 3G6YA 1NK9A 5F9NA 1HUOA 2XGPA 2HOFA 2WTFA 2L5YA 2YN4A 4BXOB 9ICHA 3F2DA 4B9VA 5DB6A 2BPFA 1ZQJA 1S0OA 5IIKA 2ZIVB 3KZIU 3TI0A 4DSJA 3RH5A 2FLNA 4KLHA 7ICOA 4B9MA 1BPDA 5C5JA 2F1HA 4NLBA 2XO7A 3V7JA 4F72A 2PFOA 3IG5A 1QQ6A 3L4PA 2ZUCA 3ED5A 1ZQKA 4FO6A 3N28A 3V6KA 9ICAA 4TUSA 4KLMA 4UQGA 1PUZA 4RU9A 5ALWA 5AM0A 5ALDA 5ALSA 5KFLA 2K8CB 5DLFA 1XWLA 1KFTA 4C4RA 3RJJA 2ZIXA 3IDWA 2ESEA 4C4SA 5ALZA 9ICPA 2C2DA 4IR1A 2IOFK 1ZXIA 2R8KA 1NZBA 4P4PA 1SXEA 2VIXA 4EELA 1WWVA 2PMZF 3FAHA 2RP5A 3MFHA 1SV0C 2HBKA 4RPZA 1F5SA 3PNCA 2H3FA 2B21A 3Q8QB 2Y0SF 4ELTA 1X40A 5DBCA 1S0MA 3ALRA 9ICLA 4AP9A 2P35A 5ALQA 3J81j 3RAQA 1M6YA 3LVVA 2EANA 2HOIA 4Q43A 1U49A 1YZ6A 4NJ8A 1IXRA 2B6GA 3Q8RB 2W3RA 3AU2A 2M9NA 4DQRA 4F92B 4F93B 4EBDA 1U48A 2IA6A 3I76A 3KHLA 4UB8U 3HJEA 2B0CA 2JMGA 2N1RA 5IIIA 9ICXA 3ONNA 3HP6A 2XY5A 2KK0A 2UVVA 2IOFA 3HKZF 4JUZA 4ECSA 4F2SA 3KD3A 4RNMA 7ICMA 2E3TA 3EPGA 5KTQA 1KKXA 1ED1A 1BGXT 8ICXA 3L5KA 2JEGA 1XO0A 4R63A 4R65A 4R8UA 1ZQLA 5KFYA 1DXSA 4QNLA 4KLGA 2KTQA 5AKYA 2W04A 8ICZA 5DQIA 7ICJA 2WF9A 4O3QA 1LB2B 2KICA 5KFSA 2O6KA 5J2EA 1ZQTA 1PZNA 7ICLA 4DSLA 8ICJA 4O0IA 1FFVA 3QUQA 4PGXA 2F77X 2PMZC 1B0XA 5KFDA 4F4ZA 1NK0A 4ECVA 5ALLA 4RNNA 2YY6A 4RQ0A 1LKYB 4YFKA 3N4MB 4K4GA 3N97B 4GLXA 2WHEA 4Y2SA 4DOAA 5HHIA 2FPKA 3GU3A 4CRXA 5AIAA 5AI8A 3PMNA 4FZNA 3H0MB 2BCSA 4DSFA 2QARA 3DEEA 2EDUA 2W9CB 3KTQA 1U4BA 2CRXA 2XY6A 4LZGA 1SV0A 5HNKA 3H8WA 3I1YA 1Q8KA 3MGIA 2A3VA 3PSPA 3AM9A 4RT2A 4CE6A 2AH5A 1QTMA 4CF4A 1LVHA 4UB5A 3JPRA 2QLTA 5J2CA 1ZQWA 2NO5A 4JMUA 1AQ6A 4DL2A 4Y2YA 4US8A 4GC6A 7ICHA 1X6JA 4IS7A 3WK8A 5KG1A 4NLZA 4DQSA 2AHOB 4KLEA 1NNLA 7ICQA 5CR0A 4AYBF 5AK3A 2FPLA 4BXOA 5IIOA 5GTIU 3RJFA 2R8GA 2F1JA 3AMZA 3RH6A 2ZIXB 1JX4A 1NJYA 3QEBZ 4KLIA 3RF9A 1QQ5A 1JN3A 3T79A 2QB0A 2XGQA 3EUB2 3M1YA 3GV7B 3TACB 3OJSA 5J0QA 4RUAA 7ICIA 4ECQA 3MR2A 2KFNA 3AEVA 2AGOA 4FS1A 3BS5A 1D8LA 4GC7A 1KEJA 2MUTB 4G9BA 2W43A 1DK3A 1PVPA 4EYIB 4GIBA 1NKEA 4UAVA 2BQRA 3ZD9A 1U45A 1T4GA 3AU6A 4Q44A 2MSNA 4TUPA 5KAIU 1ZQ1C 2OCEA 3SENA 5EWEA 1NK6A 1JXEA 1SL0A 4UARA 3KZXA 2MAXA 2DL0A 1B4FA 3E2EA 8ICGA 1KL9A 2DKXA 4ED8A 4PHAA 3QYPA 1XNSA 2Y0SC 2C2EA 4J9MA 9ICCA 3C1ZA 2F2AB 4PHEA 1WUDA 7ICPA 4IC9A 5J0WA 2LMRA 3C28A 3KHGA 2QB1A 1L3TA 4M9HA 2YQEA 1A0PA 1DOQA 4QIWF 2IHMA 3E58A 2HHUA 2E8OA 4O5KA 2W8KA 2KHQA 2LYAA 3MGVA 5G5HA 3D6JA 3V72A 4EBCA 4KITB 3PV8A 3JPTA 5CWRA 2JGAA 2J6UA 2Q4TA 2F8KA 5DB7A 4TQSA 3E0FA 3GZFA 5DQGA 1SL1A 1KW4A 2EAMA 4I2FA 1XSNA 4FE3A 1Q46A 4DL5A 4M04A 4NM1A 5AIBA 2YX8A 3RBEA 2EAOA 4DLGA 4ECUA 2HHXA 5AI4A 1SKWA 1RQNA 1X2IA 2JH1A 2LPEA 3GIJA 1RXWA 4F5QA 5C0YA 9ICJA 2R18A 2V4RA 5FP0A 4DL7A 9ICVA 2AQ0A 1L6NA 4EYHB 4QZ9A 5DG8A 4EBEA 1NI3A 1V38A 1NJWA 5KT3A 1S8OA 4F5RA 4WJ3B 4MFFA 3PO4A 4BJQA 2PI4A 4ELUA 3MC1A 2AGPA 1N56A 4MF8A 1D9DA 4QZBA 2JEJA 2BPGA 1X9XA 9ICOA 3KKAC 5ALPA 2E8NA 4PPXA 4J9NA 2KZMA 1PVRA 4DFDA 2G07A 4I27A 3M6ZA 5EE3A 4DQQA 1TKDA 3LDAA 3V6JA 8ICBA 2YMLA 2F8LA 3OTQA 3C2KA 1NKCA 4LJXA 8ICWA 1EXNA 2D6FC 5ALMA 4QWBA 4HAIA 3PSTA 9ICKA 5J2IA 4GXKA 3NRWA
chains in the Genus database with same CATH topology
1KKXA 1KN5A 2EQYA 2JXJA 2OEHA 2LM1A 1KQQA 5CEHA 5K4LA 2KK0A 1C20A 2EH9A 2RQ5A 2YQEA 4LJXA 1IG6A 2JRZA 1RYUA 2LI6A 2CXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKX A;  1KN5 A;  2EQY A;  2JXJ A;  2OEH A;  2LM1 A;  1KQQ A;  5CEH A;  5K4L A;  2KK0 A;  1C20 A;  2EH9 A;  2RQ5 A;  2YQE A;  4LJX A;  1IG6 A;  2JRZ A;  1RYU A;  2LI6 A;  2CXY A; 
#chains in the Genus database with same CATH topology
 1SZH A;  4P0P B;  1QQ7 A;  3ETR A;  2KSO B;  2G09 A;  5EE0 A;  3U26 A;  1XU4 A;  1K1S A;  4UAY A;  1RM6 C;  5J2H A;  4NLG A;  3ISC A;  1MN8 A;  4I2G A;  5L1L A;  1N2X A;  2ZIW A;  1PK1 A;  3GDX A;  4DEZ A;  4DFK A;  2KJ5 A;  3TAP A;  5AK6 A;  4Y2R A;  2NO4 A;  2AJQ A;  3M9M B;  5DDY A;  4BUG A;  4C80 A;  5JU5 A;  5IIJ A;  1CUK A;  9ICW A;  2KN7 A;  1FEZ A;  1S0N A;  5J0R A;  3UMC A;  5B66 U;  5KFP A;  3HRD D;  4Y2P A;  5KT4 A;  1D9F A;  9ICF A;  4UB6 U;  2VKQ A;  5ALR A;  3SAF A;  2NV3 A;  5K4L A;  2LHT A;  3ZDC A;  1SV4 A;  3QNM A;  2NRT A;  3ICX A;  3M6K A;  5KT2 A;  5EE1 A;  5KNI A;  5KT7 A;  2VJ5 A;  1NJZ A;  3V7L A;  5KG2 A;  5HP4 A;  3VCB A;  4F71 A;  2OXO A;  5A0L A;  5KFO A;  1HIW A;  4OJ5 A;  4PZO A;  5DBB A;  3OJU A;  2GLE A;  2KV2 A;  3B0Y A;  3PZP A;  5J2J A;  2WFA A;  3H8S A;  3EW9 A;  1C7Y A;  3H7I A;  3NRZ A;  3QEA Z;  3SV4 A;  1ZQF A;  2YTU A;  2DGZ A;  2ZIU B;  3NGD A;  8ICN A;  3GIK A;  4QZ8 A;  3MR6 A;  2D8C A;  4NV0 A;  4P4O A;  3SYZ A;  4QW8 A;  3WK4 A;  2FLL A;  2JHD A;  1UT8 A;  2VJ4 A;  4C8N A;  3I28 A;  3PSF A;  4IR9 A;  2V9W A;  3RBD A;  3CP8 A;  4OJL A;  4DL6 A;  1WG8 A;  2UVR A;  1SXD A;  3H4D A;  3CW2 C;  1T94 A;  1TFR A;  3QU5 A;  2ATL A;  4QW9 A;  1SGG A;  3AN1 A;  3PR4 A;  3QX7 A;  2WF5 A;  2KP7 A;  4F4K A;  1QH9 A;  3SR6 A;  2LBO A;  3RJH A;  3K4G A;  1L7O A;  4XA5 A;  1NKB A;  4UAU A;  7ICN A;  5AM2 A;  5T14 A;  1TAM A;  4PHP A;  1FFU A;  1BPZ A;  5CP2 A;  2WF8 A;  2QAR B;  2FE9 A;  2W9C A;  4J9L A;  4ECY A;  4F3O A;  2WAQ F;  2OHF A;  3ETL A;  2PFP A;  5HR6 A;  5L9X A;  4YXJ A;  4RQ1 A;  2P6R A;  5J2G A;  1ZQS A;  3WKA A;  3VC8 A;  3WK7 A;  4JB3 A;  4ZH4 A;  4ECX A;  4KX3 A;  2W9B A;  3OGU A;  1C20 A;  4DSI A;  2A19 A;  2KHV A;  2ZTE A;  3MDA A;  7ICU A;  5HHH A;  4PL2 A;  1ZQI A;  1PK3 A;  4PHD A;  4JK1 A;  5AK5 A;  2ZXI A;  1X9M A;  4F4X A;  2G08 A;  2WF7 A;  3IG8 A;  1A6S A;  1JUD A;  1N63 A;  1BPY A;  5J0Y A;  3BQ2 A;  3RB0 A;  5IIL A;  1WYG A;  5KFX A;  4OCZ A;  4IQU A;  1KSP A;  4E0D A;  1F44 A;  5KFB A;  4BWJ A;  3C2M A;  4F2R A;  2KNJ A;  5CA7 A;  2VA8 A;  2XCA A;  3RJI A;  5DB9 A;  2ISO A;  5L1M A;  1L3S A;  4PGQ A;  1J97 A;  4ZOH C;  4USA A;  2CN1 A;  3DDH A;  2IOH A;  2OWO A;  1A76 A;  2DKZ A;  4X5V A;  1ZJM A;  3BZK A;  3QU2 A;  1KN5 A;  2NYV A;  1LKY A;  3PVX A;  4TUQ A;  2FMQ A;  3PW2 A;  2DPJ A;  2LM1 A;  3PX6 A;  3PX0 A;  4Y2Q A;  2R8J A;  4J03 A;  2F44 A;  5CHG A;  4YD1 A;  1OUQ A;  4RNO A;  4ICA A;  2NRV A;  4KLQ A;  1UQV A;  3OSN A;  4O3S A;  3NUQ A;  3SAG A;  4QZH A;  3TAN A;  1S76 D;  4I28 A;  3NS1 A;  3TQ1 A;  4YG2 A;  1PVQ A;  3GV5 B;  3TFS A;  2A1J A;  1T8E A;  3ORY A;  5ALE A;  3KHH A;  3SAH A;  3C23 A;  9ICE A;  4US9 A;  5L1I A;  5DQH A;  4DL4 A;  1QSY A;  2ZJ5 A;  4F5P A;  2H3V A;  4QZA A;  3BS5 B;  1X9W A;  4UAZ A;  4J9S A;  4OD0 A;  3ZI4 A;  4DF4 A;  4MFA A;  1MQ2 A;  2DFL A;  2G5H B;  2ASL A;  2W9B B;  3BZC A;  3PY8 A;  1SWW A;  2BGW A;  4EZ6 A;  2HVI A;  4U6P A;  3JPN A;  5DG7 A;  2BPC A;  3PW5 A;  1U9L A;  3MR3 A;  1FO4 A;  3SZ2 A;  2HHS A;  1NK4 A;  2HW3 A;  2HCF A;  1RYU A;  1GO3 F;  1YZ7 A;  3QU9 A;  4YMN A;  5BOM A;  4P0P A;  4PZN A;  5J2F A;  3N7P D;  3MR5 A;  4QZF A;  3T5K A;  4C4T A;  1JRO A;  4J9K A;  1QSL A;  2H3Z A;  3PR5 B;  3S6J A;  5B5E U;  3RTV A;  3IV6 A;  2NRW A;  5KFE A;  4KTQ A;  1ZQV A;  2E8P A;  3BQ1 A;  5AKK A;  3K75 D;  5JUM A;  4RPY A;  2BDP A;  1Q3U A;  2I6X A;  2DF4 B;  1NOM A;  3HIL A;  5DB8 A;  4I2I A;  1S0V A;  4I2C A;  5AKH A;  4M2Y A;  3RB3 A;  4UBC A;  5AI5 A;  2V4Q A;  3M7D A;  4JV1 A;  7ICG A;  4CF5 A;  4B6J A;  4K4I A;  3UPQ A;  4IRD A;  4YN4 A;  2KVC A;  2J6S A;  1D8Y A;  2W9A A;  4PH5 A;  5KAF U;  3QZ8 A;  3C21 A;  5KFT A;  4UW9 A;  4DS4 A;  1V97 A;  2FMP A;  2HI0 A;  4B9T A;  4PGY A;  1BNO A;  4EZ9 A;  4O9M A;  3GV8 B;  5G5G A;  3LWM A;  1ZQG A;  3L3F X;  1N62 A;  9ICN A;  3T5L A;  4IQV A;  1UT5 A;  1Z4O A;  2CXY A;  3GQC A;  2QKQ A;  4MEX A;  8ICE A;  5AKL A;  3TAD A;  4MF2 A;  2K8B B;  2W3S A;  4I2E A;  4Q8E A;  3CYM A;  2G5I B;  1XC9 A;  5CEH A;  1Z00 A;  3TAR A;  5EOZ A;  3JPS A;  2WB1 C;  4DSK A;  3C1Y A;  4KLO A;  4C0Z A;  5F9L A;  2JEF A;  3BQT A;  4DFM A;  1DK2 A;  2DWQ A;  3UQ0 A;  2ASD A;  1V9P A;  3JPQ A;  5KFU A;  4CGZ A;  4ECW A;  3ZDA A;  2E1F A;  3QUB A;  4YQW A;  2HBJ A;  3Q8L A;  2A1J B;  4EX6 A;  2HVH A;  1ZET A;  2XY7 A;  3MFI A;  2RRD A;  3SD7 A;  1ZQA A;  2K89 A;  3RB6 A;  3WKB A;  1RDF A;  1RYR A;  2FJ6 A;  2ZJA A;  1S9F A;  3V6H A;  4C8O A;  3NVZ A;  1SB3 C;  5AM1 A;  1P7D A;  5HR7 A;  2ZTD A;  5ALH A;  1BNP A;  3M9O B;  5ALF A;  2LM4 A;  2MU2 A;  3SI8 A;  2JH7 A;  5J29 A;  2AQ4 A;  2BZF A;  2F1I A;  5JTI A;  2KKP A;  2ZIW B;  4M0A A;  5AKG A;  1JRP A;  2XIC A;  5KT6 A;  3UQ2 A;  4QZG A;  3G6V A;  3D2S A;  4JWM A;  4M9N A;  2BHN A;  1ZYQ A;  2UVW A;  2I1Q A;  3KBB A;  5J0P A;  2BCQ A;  1QLN A;  4QZC A;  5KFW A;  3SQI A;  9ICB A;  3BQ7 A;  5AM3 A;  5DG9 A;  1TE2 A;  4NL9 C;  3ZDB A;  3PML A;  4ED7 A;  3UXO A;  4C8M A;  2KMD A;  3TAQ A;  5ALU A;  1TVA A;  1V85 A;  4EEN A;  2OEH A;  3WK5 A;  3A0H U;  3OHA A;  5J0S A;  3PX4 A;  1KFS A;  4M47 A;  4PJ0 U;  1VLB A;  1ZQX A;  4I29 A;  7ICV A;  2PXI A;  4P0Q A;  4Z6C A;  1ZRN A;  2P66 A;  4RQM A;  1O08 A;  1KQQ A;  3ISD A;  1ZQD A;  2VAN A;  2KIW A;  2W55 A;  5DDM A;  4F50 A;  3RFA A;  5KFK A;  4O3N A;  1ZQR A;  2W7P A;  4O5C A;  2AGQ A;  2RDJ A;  2IBK A;  4I2B A;  5DLG A;  2M0N A;  3EWA A;  4CDG A;  1SWV A;  3PW4 A;  3IN5 A;  1TK5 A;  5KFJ A;  4RQ5 A;  2I5H A;  2JZB A;  2ZUD A;  2W11 A;  3SV3 A;  1DRG A;  2R8H A;  2YMQ A;  3FDS A;  3CRX A;  2KSO A;  3K1R B;  4FZM A;  2ZIU A;  2E8M A;  4P4M A;  2BQU A;  3BDP A;  1J2M A;  1IIP A;  1XS9 D;  3RRG A;  4OJ6 A;  1UHU A;  4RT3 A;  2MRL A;  1ZQE A;  5KG0 A;  3RH4 A;  9ICT A;  5KT5 A;  4I2D A;  5EWG A;  4C7Y A;  5J2K A;  2K8A A;  4O3O A;  4B9N A;  4LZD A;  2H3I A;  2RQ5 A;  4BGD A;  1FIQ A;  4YXM A;  1KRP A;  2KOB A;  2H3Q A;  2BCU A;  3TKA A;  5L1J A;  1RYS A;  8ICO A;  1OXJ A;  1X6I A;  3M8R A;  4DQI A;  2HHW A;  5AI6 A;  4UB4 A;  2KE7 A;  9ICI A;  5J2D A;  4KLL A;  1L3U A;  1ZQY A;  1ZD5 A;  4XQ8 A;  2KEY A;  4I2H A;  4KX5 A;  4C7Z A;  5KG5 A;  4YCX A;  1NZP A;  3RJE A;  3QXG A;  1T7P A;  1ZQN A;  4I2J A;  1SZP A;  4ECR A;  2KZZ A;  4R8U B;  5DGA A;  4QJF B;  4AYB C;  2WF6 A;  1Q3V A;  2HHT A;  1IV8 A;  3SMV A;  5ALJ A;  3C29 A;  2EQY A;  1ZQO A;  4B9L A;  3Q8K A;  3OPX A;  2K4P A;  5KFM A;  8ICL A;  4KMO B;  4GFJ A;  2ISP A;  2JR5 A;  8ICC A;  5TIS U;  2D3D A;  9ICR A;  5J0X A;  2BR0 A;  1S97 A;  4UAT A;  7ICR A;  3N7S C;  4YR3 A;  2JZB B;  4A8E A;  8ICF A;  1H38 A;  1JXL A;  4RQ8 A;  3HKZ C;  5KFZ A;  4GXJ A;  1L7M A;  4DOC A;  1K1Q A;  2AU0 A;  4TQR A;  1RG6 A;  2RLT A;  5AKJ A;  3M8S A;  2EZZ A;  5IIN A;  1L7P A;  3EYZ A;  3FM9 A;  8ICS A;  5IIM A;  4ED3 A;  5KL8 B;  3R9K A;  2GH1 A;  5KL1 B;  5L1K A;  4ACO A;  4ELV A;  3ZD8 A;  5AM4 A;  1MQ3 A;  8ICM A;  2JXJ A;  4TUR A;  1Z3E B;  4Z6D A;  3RJK A;  2XVT A;  1MSW D;  3Q8S B;  3EPI A;  3MAB A;  5KFN A;  3RR8 A;  1ZD2 P;  1N60 A;  4FZL A;  2BDU A;  5J8Y C;  3GII A;  4F8R A;  5ALT A;  3BQ0 A;  1WCN A;  5J2B A;  2P6U A;  2HHV A;  5D4B A;  3BJY A;  4DQP A;  2Y9U A;  4F91 B;  2XID A;  1JIH A;  1KTQ A;  4Y2X A;  5ALY A;  3UXN A;  4IRK A;  2C22 A;  4DO9 A;  4YMO A;  2H5X A;  5DBA A;  4JV0 A;  1MA7 A;  3AQF A;  2HDO A;  1COO A;  1J2N A;  2HOQ A;  3IRU A;  5HMM A;  4QZD A;  2KFZ A;  5TZV A;  1BPX A;  4IQW A;  5AM5 A;  3FC4 A;  1ZQH A;  3OSP A;  2K4E A;  1XO1 A;  4Y2J A;  2OM6 A;  1Z19 A;  1L8O A;  4Y2U A;  2Q0Z X;  4UB3 A;  2QB0 B;  1BPB A;  3H4B A;  1KFD A;  1UA1 A;  4BDP A;  1URJ A;  1U47 A;  3SEI A;  3KKA A;  1ZQP A;  8ICH A;  4NY8 A;  4DLE A;  3F5A A;  2NRX A;  2ES6 A;  4J9O A;  2XC9 A;  1COK A;  1BPE A;  2KZ3 A;  3HPO A;  1Z4N A;  1N5X A;  1ZQQ A;  5AKI A;  2WB1 F;  1NK8 A;  1X9S A;  4Y2T A;  2A1A A;  5AKZ A;  8ICY A;  3PW7 A;  4U7C A;  4JV2 A;  4DOB A;  3HWT A;  5EWF A;  2GO7 A;  3O0F A;  4M9J A;  2W8L A;  5J0T A;  2NRZ A;  4K4H A;  1ZD4 A;  3TFR A;  9ICQ A;  8ICP A;  2ODG A;  2W54 A;  1PK1 B;  3H0R B;  3MDC A;  3UMB A;  4NLK A;  5AHX A;  3QU7 A;  4YMM A;  1SKR A;  2KJ8 A;  2JRZ A;  3WKE A;  2W03 A;  4B9S A;  3AQE A;  1QSS A;  2IMW P;  4DSE A;  1QCK A;  5KFV A;  7ICT A;  3IP4 B;  3UXP A;  5HML A;  2HHQ A;  4ED0 A;  2C28 A;  4ECT A;  2KD1 A;  4Q45 A;  3BS7 A;  3WU2 U;  4DWI A;  1JAL A;  3NTU A;  2EZX A;  4XUS A;  4KLU A;  2ASJ A;  4RUC A;  2DUY A;  1CI4 A;  3QU4 A;  4YR0 A;  2K4H A;  3T3F A;  5AI9 A;  4UB1 A;  4QWE A;  7ICE A;  3F2C A;  3UMG A;  3JPP A;  5DGB A;  3D2N A;  2FMS A;  3NAS A;  4FS2 A;  4ED6 A;  3KFU F;  4KN4 A;  3HW8 A;  3LVW A;  4CNQ A;  2GOL A;  4C8K A;  5BOL A;  4PL1 A;  5ALV A;  2PFQ A;  2KG5 A;  3B0X A;  1CRX A;  2DQN B;  5KFI A;  8ICK A;  2BQ3 A;  2PI5 A;  1VJ5 A;  9ICM A;  3KHR A;  2LI6 A;  9ICS A;  4M9L A;  3QZ7 A;  1KBU A;  2YMP A;  4OO1 J;  4BWM A;  2ZG6 A;  4NLN A;  2W7O A;  1SKS A;  1UA0 A;  2ZTC A;  2LYH A;  4OJO A;  5ALN A;  4DF8 A;  1RQL A;  4F5N A;  4YR2 A;  8ICV A;  2EH9 A;  4ECZ A;  1TV9 A;  4FBT A;  1SL2 A;  1MC8 A;  1K5O A;  4M9G A;  4F4W A;  1L8L A;  2GWS A;  2BKE A;  3IHQ B;  1DGS A;  2HBL A;  8ICQ A;  4UAS A;  3N7R C;  5KFQ A;  4QZI A;  1NK7 A;  2ZXH A;  2PKE A;  3H8M A;  4KLF A;  4ED1 A;  2EAP A;  1HEK A;  1B43 A;  4J9P A;  1KLN A;  4DS5 A;  1S10 A;  2FPM A;  4RPX A;  8ICI A;  2AXT U;  4YVZ A;  1RPL A;  1NJX A;  1ZQZ A;  1T3Q A;  2XI9 A;  3LWL A;  3H40 A;  2ZIV A;  4QZE A;  2F3N A;  2ZJ8 A;  1ZQB A;  3DV9 A;  7ICF A;  1O03 A;  4O3P A;  2BCV A;  1X42 A;  4P2H A;  5ALG A;  5DKW A;  3AL0 B;  5ALI A;  4RQ6 A;  1N5W A;  4XRH A;  2KKV A;  2J6T A;  1Z00 B;  3M9N B;  4NWI A;  2RHF A;  8ICU A;  3ISB A;  3G6X A;  8ICA A;  5E79 U;  2UVU A;  3WK9 A;  4QWD A;  1ZOL A;  3H0L B;  5D46 A;  3TAD C;  5ALX A;  4CCH A;  4KLT A;  4QIW C;  3CNH A;  4QWA A;  4FFD A;  2RDI A;  5KFH A;  1XSL A;  4HYK A;  2KIV A;  4IRC A;  4Y2V A;  4NM2 A;  3ZDD A;  4P0Q B;  1VDV A;  2CPR A;  4DFJ A;  4GXI A;  4MHV A;  5JRT A;  5EE9 A;  4UB2 A;  5KFC A;  1KDH A;  1TAU A;  4KMU A;  1T3N A;  4EEK A;  3QE9 Y;  3IM1 A;  4J9Q A;  4MEY A;  4RQN A;  4O5E A;  3Q8M A;  5CB1 A;  1ECW A;  2OYY A;  2WAQ C;  4R64 A;  4CF3 A;  2Y9T A;  2Z7J A;  1BVS A;  3MBY A;  3GFK B;  4NL9 A;  2KVS A;  2R8I A;  5AI0 A;  5AK4 A;  2YMM A;  1YT3 A;  3NVY A;  2OH2 A;  1ZQM A;  1Z1B A;  5KFG A;  3RAX A;  2YB1 A;  3T5J A;  1ZD3 A;  5KG6 A;  4FBU A;  1RZT A;  7ICK A;  5KG4 A;  3UM9 A;  3RR7 A;  4I2A A;  5KG3 A;  3WKD A;  4QWC A;  5J8Y A;  2VA3 A;  1L3V A;  2FI1 A;  3JPO A;  3C5G A;  1DGJ A;  4ED2 A;  2DPI A;  4MFC A;  4M6W B;  3F5E A;  2E1E A;  2FLP A;  3MGH A;  4J9R A;  2Y1I A;  4DCC A;  4O3M A;  3PW0 A;  3H8J A;  3WKC A;  1A77 A;  5KFA A;  3THV A;  1LV5 A;  2DBY A;  5AIC A;  1S77 D;  8ICT A;  4C8L A;  4EEY A;  3ZDE A;  3AUO A;  2JEI A;  3WK6 A;  4UAW A;  1UPH A;  4DL3 A;  2Y1J A;  5J0O A;  8ICR A;  5D49 A;  3RJG A;  1SIJ A;  4NXZ A;  5ALK A;  3KOO A;  9ICG A;  3LYS A;  4IL6 U;  1L5U A;  4OJP A;  4F4Y A;  4KLS A;  5AKX A;  1D8B A;  3Q8P B;  1WCL A;  1ZQU A;  9ICU A;  2G06 A;  1B22 A;  4YP3 A;  1JI7 A;  1ZRM A;  2K4I A;  4JWN A;  5H2F U;  5F3X B;  1NK5 A;  1RXV A;  2HSZ A;  5BPC A;  4RQ4 A;  2FDR A;  1N61 A;  4Z6E A;  1S5L U;  4G3I A;  1HJP A;  5GTH U;  3HT3 A;  4R66 A;  3GIM A;  4UBB A;  5AKE A;  3C2L A;  7ICS A;  1HUZ A;  2MA1 A;  1WWU A;  1ZJN A;  3A0B U;  5CJ7 A;  1ZQC A;  4DFP A;  3K1Z A;  3GIL A;  2W9M A;  2EZY A;  3QUC A;  3C5F A;  2JV3 A;  1XSP A;  4RQ3 A;  1Y88 A;  5ALO A;  2YB4 A;  2XCP A;  1N48 A;  1TK8 A;  4F5O A;  2KJ9 A;  1L7N A;  2VA2 A;  2BCR A;  5KFR A;  3D2Q A;  4YD2 A;  4BX9 C;  1TK0 A;  3PO5 A;  1ARO P;  4M6W A;  2LYB A;  4RZR A;  4IQT A;  1TAQ A;  2F76 X;  3NVV A;  2G0A A;  3NVW A;  3LK9 A;  2K60 A;  2MUT A;  2ALZ A;  2HMX A;  4Q8F A;  4KN7 A;  4LVS A;  1UCV A;  1OW5 A;  5CRX A;  3OHB A;  3HX0 A;  2HBM A;  5KFF A;  1JMS A;  3RRH A;  4NLC A;  4O3R A;  3RB4 A;  2E5S A;  1IM4 A;  4Z6F A;  3B9J A;  5J0U A;  4KLJ A;  3F53 A;  1X66 A;  3F2B A;  1F0M A;  3PSI A;  5KG7 A;  4RQ7 A;  1CEZ A;  4KLD A;  2LKY A;  3T5H A;  2IHN A;  2I9G A;  3FYH A;  2PFN A;  4B9U A;  3QUT A;  2ZUB A;  3EZ5 A;  3V7K A;  4RQ2 A;  5J2A A;  4EX7 A;  1Z1V A;  2C2R A;  1IG6 A;  3G6Y A;  1NK9 A;  5F9N A;  1HUO A;  2XGP A;  2HOF A;  2WTF A;  2L5Y A;  2YN4 A;  4BXO B;  9ICH A;  3F2D A;  4B9V A;  5DB6 A;  2BPF A;  1ZQJ A;  1S0O A;  5IIK A;  2ZIV B;  3KZI U;  3TI0 A;  4DSJ A;  3RH5 A;  2FLN A;  4KLH A;  7ICO A;  4B9M A;  1BPD A;  5C5J A;  2F1H A;  4NLB A;  2XO7 A;  3V7J A;  4F72 A;  2PFO A;  3IG5 A;  1QQ6 A;  3L4P A;  2ZUC A;  3ED5 A;  1ZQK A;  4FO6 A;  3N28 A;  3V6K A;  9ICA A;  4TUS A;  4KLM A;  4UQG A;  1PUZ A;  4RU9 A;  5ALW A;  5AM0 A;  5ALD A;  5ALS A;  5KFL A;  2K8C B;  5DLF A;  1XWL A;  1KFT A;  4C4R A;  3RJJ A;  2ZIX A;  3IDW A;  2ESE A;  4C4S A;  5ALZ A;  9ICP A;  2C2D A;  4IR1 A;  2IOF K;  1ZXI A;  2R8K A;  1NZB A;  4P4P A;  1SXE A;  2VIX A;  4EEL A;  1WWV A;  2PMZ F;  3FAH A;  2RP5 A;  3MFH A;  1SV0 C;  2HBK A;  4RPZ A;  1F5S A;  3PNC A;  2H3F A;  2B21 A;  3Q8Q B;  2Y0S F;  4ELT A;  1X40 A;  5DBC A;  1S0M A;  3ALR A;  9ICL A;  4AP9 A;  2P35 A;  5ALQ A;  3J81 j;  3RAQ A;  1M6Y A;  3LVV A;  2EAN A;  2HOI A;  4Q43 A;  1U49 A;  1YZ6 A;  4NJ8 A;  1IXR A;  2B6G A;  3Q8R B;  2W3R A;  3AU2 A;  2M9N A;  4DQR A;  4F92 B;  4F93 B;  4EBD A;  1U48 A;  2IA6 A;  3I76 A;  3KHL A;  4UB8 U;  3HJE A;  2B0C A;  2JMG A;  2N1R A;  5III A;  9ICX A;  3ONN A;  3HP6 A;  2XY5 A;  2KK0 A;  2UVV A;  2IOF A;  3HKZ F;  4JUZ A;  4ECS A;  4F2S A;  3KD3 A;  4RNM A;  7ICM A;  2E3T A;  3EPG A;  5KTQ A;  1KKX A;  1ED1 A;  1BGX T;  8ICX A;  3L5K A;  2JEG A;  1XO0 A;  4R63 A;  4R65 A;  4R8U A;  1ZQL A;  5KFY A;  1DXS A;  4QNL A;  4KLG A;  2KTQ A;  5AKY A;  2W04 A;  8ICZ A;  5DQI A;  7ICJ A;  2WF9 A;  4O3Q A;  1LB2 B;  2KIC A;  5KFS A;  2O6K A;  5J2E A;  1ZQT A;  1PZN A;  7ICL A;  4DSL A;  8ICJ A;  4O0I A;  1FFV A;  3QUQ A;  4PGX A;  2F77 X;  2PMZ C;  1B0X A;  5KFD A;  4F4Z A;  1NK0 A;  4ECV A;  5ALL A;  4RNN A;  2YY6 A;  4RQ0 A;  1LKY B;  4YFK A;  3N4M B;  4K4G A;  3N97 B;  4GLX A;  2WHE A;  4Y2S A;  4DOA A;  5HHI A;  2FPK A;  3GU3 A;  4CRX A;  5AIA A;  5AI8 A;  3PMN A;  4FZN A;  3H0M B;  2BCS A;  4DSF A;  2QAR A;  3DEE A;  2EDU A;  2W9C B;  3KTQ A;  1U4B A;  2CRX A;  2XY6 A;  4LZG A;  1SV0 A;  5HNK A;  3H8W A;  3I1Y A;  1Q8K A;  3MGI A;  2A3V A;  3PSP A;  3AM9 A;  4RT2 A;  4CE6 A;  2AH5 A;  1QTM A;  4CF4 A;  1LVH A;  4UB5 A;  3JPR A;  2QLT A;  5J2C A;  1ZQW A;  2NO5 A;  4JMU A;  1AQ6 A;  4DL2 A;  4Y2Y A;  4US8 A;  4GC6 A;  7ICH A;  1X6J A;  4IS7 A;  3WK8 A;  5KG1 A;  4NLZ A;  4DQS A;  2AHO B;  4KLE A;  1NNL A;  7ICQ A;  5CR0 A;  4AYB F;  5AK3 A;  2FPL A;  4BXO A;  5IIO A;  5GTI U;  3RJF A;  2R8G A;  2F1J A;  3AMZ A;  3RH6 A;  2ZIX B;  1JX4 A;  1NJY A;  3QEB Z;  4KLI A;  3RF9 A;  1QQ5 A;  1JN3 A;  3T79 A;  2QB0 A;  2XGQ A;  3EUB 2;  3M1Y A;  3GV7 B;  3TAC B;  3OJS A;  5J0Q A;  4RUA A;  7ICI A;  4ECQ A;  3MR2 A;  2KFN A;  3AEV A;  2AGO A;  4FS1 A;  3BS5 A;  1D8L A;  4GC7 A;  1KEJ A;  2MUT B;  4G9B A;  2W43 A;  1DK3 A;  1PVP A;  4EYI B;  4GIB A;  1NKE A;  4UAV A;  2BQR A;  3ZD9 A;  1U45 A;  1T4G A;  3AU6 A;  4Q44 A;  2MSN A;  4TUP A;  5KAI U;  1ZQ1 C;  2OCE A;  3SEN A;  5EWE A;  1NK6 A;  1JXE A;  1SL0 A;  4UAR A;  3KZX A;  2MAX A;  2DL0 A;  1B4F A;  3E2E A;  8ICG A;  1KL9 A;  2DKX A;  4ED8 A;  4PHA A;  3QYP A;  1XNS A;  2Y0S C;  2C2E A;  4J9M A;  9ICC A;  3C1Z A;  2F2A B;  4PHE A;  1WUD A;  7ICP A;  4IC9 A;  5J0W A;  2LMR A;  3C28 A;  3KHG A;  2QB1 A;  1L3T A;  4M9H A;  2YQE A;  1A0P A;  1DOQ A;  4QIW F;  2IHM A;  3E58 A;  2HHU A;  2E8O A;  4O5K A;  2W8K A;  2KHQ A;  2LYA A;  3MGV A;  5G5H A;  3D6J A;  3V72 A;  4EBC A;  4KIT B;  3PV8 A;  3JPT A;  5CWR A;  2JGA A;  2J6U A;  2Q4T A;  2F8K A;  5DB7 A;  4TQS A;  3E0F A;  3GZF A;  5DQG A;  1SL1 A;  1KW4 A;  2EAM A;  4I2F A;  1XSN A;  4FE3 A;  1Q46 A;  4DL5 A;  4M04 A;  4NM1 A;  5AIB A;  2YX8 A;  3RBE A;  2EAO A;  4DLG A;  4ECU A;  2HHX A;  5AI4 A;  1SKW A;  1RQN A;  1X2I A;  2JH1 A;  2LPE A;  3GIJ A;  1RXW A;  4F5Q A;  5C0Y A;  9ICJ A;  2R18 A;  2V4R A;  5FP0 A;  4DL7 A;  9ICV A;  2AQ0 A;  1L6N A;  4EYH B;  4QZ9 A;  5DG8 A;  4EBE A;  1NI3 A;  1V38 A;  1NJW A;  5KT3 A;  1S8O A;  4F5R A;  4WJ3 B;  4MFF A;  3PO4 A;  4BJQ A;  2PI4 A;  4ELU A;  3MC1 A;  2AGP A;  1N56 A;  4MF8 A;  1D9D A;  4QZB A;  2JEJ A;  2BPG A;  1X9X A;  9ICO A;  3KKA C;  5ALP A;  2E8N A;  4PPX A;  4J9N A;  2KZM A;  1PVR A;  4DFD A;  2G07 A;  4I27 A;  3M6Z A;  5EE3 A;  4DQQ A;  1TKD A;  3LDA A;  3V6J A;  8ICB A;  2YML A;  2F8L A;  3OTQ A;  3C2K A;  1NKC A;  4LJX A;  8ICW A;  1EXN A;  2D6F C;  5ALM A;  4QWB A;  4HAI A;  3PST A;  9ICK A;  5J2I A;  4GXK A;  3NRW A; 
#chains in the Genus database with same CATH homology
 1KKX A;  1KN5 A;  2EQY A;  2JXJ A;  2OEH A;  2LM1 A;  1KQQ A;  5CEH A;  5K4L A;  2KK0 A;  1C20 A;  2EH9 A;  2RQ5 A;  2YQE A;  4LJX A;  1IG6 A;  2JRZ A;  1RYU A;  2LI6 A;  2CXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...