2EQYA

Solution structure of the arid domain of jarid1b protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
122
structure length
122
Chain Sequence
b'GSSGSSGEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTSDTKDKEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jumonji, AT rich interactive domain 1B
publication title Solution structure of the ARID domain of Jarid1b protein
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 22
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2eqyA01
2JRZA 1IG6A 2LI6A 5CEHA 1KQQA 4LJXA 2YQEA 5K4LA 2OEHA 1RYUA 2LM1A 2RQ5A 2KK0A 2CXYA 1C20A 2EQYA 1KN5A 2EH9A 1KKXA 2JXJA
chains in the Genus database with same CATH superfamily
3QNMA 3FC4A 4YD2A 4QZHA 4IQTA 3EPIA 2A1JB 1KQQA 4EBDA 3GU3A 2FJ6A 3JPQA 3WKCA 4J9PA 2XO7A 3M9OB 2RDIA 4EX7A 4M9JA 4KITB 2JEIA 4BXOA 1Z4NA 5ALYA 1PVPA 4I2HA 1QH9A 5CHGA 5JU5A 1XSPA 1A0PA 1ZQXA 3D2SA 5CEHA 3C21A 5KFJA 1L3VA 2ZIVB 1AROP 2BR0A 4PZOA 2RLTA 3AUOA 2WAQF 5J0XA 2E8NA 4O5EA 1RYUA 4C80A 3ETLA 4KN7A 4KN4A 4MEXA 2Y0SF 2JZBA 2YMMA 3E2EA 2QB0B 3SAGA 9ICCA 3ZDDA 7ICPA 3RJEA 4B9UA 5ALPA 1ZQRA 1ZQEA 5BOLA 5J0TA 3OPXA 3T5LA 1SGGA 2LHTA 2RP5A 1N62A 3QZ8A 4KLIA 4NLGA 4KMUA 4DL3A 4UB2A 1A77A 3AN1A 3HP6A 3GV8B 1UA1A 1MQ2A 4M9HA 4M2YA 2KFNA 4RQNA 2DL0A 1N61A 8ICPA 4PJ0U 5JTIA 5KG6A 2Y9UA 3HPOA 2XY5A 3UQ0A 3ED5A 4EZ6A 2WF6A 3OJUA 3RBEA 4UARA 5AKJA 5AK3A 4PHEA 1NJZA 1P7DA 4ED2A 3LWMA 5J0RA 5D4BA 2W04A 2KHVA 4BGDA 3UMCA 1ZQZA 1ZOLA 1DOQA 4EEYA 4DL7A 2WF7A 4BUGA 1ZQVA 2RRDA 2R8KA 4UAVA 1RYSA 9ICAA 1ZQHA 2VANA 1KL9A 4RT2A 1BPDA 1LVHA 5KG5A 2W9AA 3TKAA 1WCNA 7ICNA 1ZRMA 5K4LA 2KD1A 2MA1A 4ELTA 1V97A 2DKXA 3FM9A 3M8SA 3SAFA 1X9WA 2FE9A 2W55A 3MFHA 3EWAA 2NV3A 3GQCA 3TADA 3UMBA 3QU4A 4QWEA 1YZ6A 2KIWA 1DGJA 3WK5A 2KJ9A 5AM4A 3AU6A 4IR1A 1MA7A 4DFKA 3MR3A 5KFFA 3HJEA 1K1QA 1RXWA 4GC7A 3D2QA 4QZDA 3AQEA 5ALJA 3QEAZ 5TISU 1TK0A 3DV9A 3KKAA 1NZBA 3KHLA 4KLJA 9ICVA 4KLEA 5IIKA 3TANA 3C29A 3N7RC 2H3ZA 3K75D 1LKYA 9ICQA 2OYYA 1TV9A 1PK1B 9ICSA 1IV8A 5AKIA 3M6ZA 3RR7A 5KFUA 4BX9C 3TAQA 4EBCA 1X9SA 3BJYA 3GILA 2W3RA 2KKPA 3PW0A 1HUOA 5J2CA 3JPPA 9ICGA 5CA7A 2EZXA 2W7OA 5DQHA 2E8OA 5D49A 5J2HA 3C23A 2M9NA 3IG5A 3RH6A 2C2EA 2JV3A 2K4IA 2BCVA 3N97B 1DGSA 2G09A 3BQ0A 5J0YA 2C28A 2CXYA 3H0MB 2HHQA 3HILA 7ICIA 4KLUA 3D2NA 5DDMA 5EE3A 1Q3UA 4NWIA 2ZUDA 4C4RA 3F53A 4R64A 5DB6A 5F3XB 1L5UA 2KVSA 4NM2A 2V4RA 2OXOA 4U6PA 4TUQA 5IIIA 3PW2A 1OXJA 2ZJ8A 1ZD5A 2LPEA 2PXIA 3MGHA 4DSJA 1S0VA 2I6XA 5KT7A 1B43A 2F8LA 2ZJAA 2KV2A 4IC9A 4ZH4A 5J2BA 2Y9TA 5DQGA 5J2FA 1KKXA 2G5HB 2DF4B 4UAYA 4KLQA 7ICTA 1SXEA 3BZCA 3M1YA 2XCPA 1IG6A 4C4SA 5KL1B 5DKWA 4DO9A 1YT3A 4ED3A 2KHQA 5KFEA 5AKKA 3OSPA 5KAFU 3L5KA 3SI8A 5AM2A 1PK3A 2PFPA 4ZOHC 1KFDA 1QSSA 1IXRA 4M6WB 3ZDBA 1NZPA 3M6KA 2F76X 4LZGA 2ZG6A 4EELA 2CRXA 5HMMA 2IHNA 3V6KA 4NLZA 5HP4A 1L7PA 4DS4A 4RUCA 4JWNA 4LJXA 1BPZA 2ZTCA 3QE9Y 1ZQPA 1KSPA 2H3IA 2LBOA 5EWEA 2W8LA 4B9VA 2I5HA 9ICBA 2KK0A 5ALGA 1C20A 8ICLA 4FFDA 1F0MA 1RG6A 4TURA 7ICVA 1SZHA 3IRUA 2AXTU 1BPYA 3A0BU 4PHPA 4FBTA 4YQWA 3QX7A 3WK7A 4B6JA 3BQ7A 5ALEA 4RT3A 4F3OA 2FI1A 4BXOB 5KFYA 3N4MB 2HDOA 2ZIXA 1S10A 4O3NA 5KFGA 4JV2A 1NK8A 3IN5A 3ZI4A 3OHBA 3NVVA 3C1YA 2KJ5A 4B9MA 3N7SC 2J6TA 7ICSA 1K5OA 4PZNA 2W43A 3KTQA 4YG2A 2G07A 3H0RB 5KFPA 4KLSA 9ICFA 5IIJA 1T3QA 2EH9A 4UAWA 4KMOB 1ZQFA 1JRPA 5KFCA 3PMNA 3QUBA 8ICYA 4K4GA 1KW4A 2KZ3A 8ICUA 3HKZC 1RDFA 3SENA 4IR9A 2K8CB 5DB8A 4JK1A 3BZKA 3PW5A 1J2NA 4PGQA 4O9MA 2DQNB 2IOFA 4WJ3B 5AI4A 2G06A 5J0WA 4JMUA 4QNLA 1CUKA 4GC6A 8ICWA 5ALVA 1Z4OA 2D8CA 3F5EA 3GIIA 3FYHA 5GTIU 2XICA 5KG4A 4E0DA 4YMNA 2K60A 1U45A 3WK4A 2AHOB 4ED6A 3JPNA 3C5FA 3N28A 1NJXA 4KLOA 2R8JA 1B0XA 3MBYA 2EAMA 2HHUA 4C7ZA 4M9NA 2R18A 2VJ5A 2FMQA 2PI4A 2H3FA 4R8UA 4ELVA 7ICLA 3H40A 2QKQA 3OJSA 2YTUA 3QU2A 2GLEA 3T5HA 1MSWD 9ICEA 4YR0A 9ICWA 4Z6DA 4ECUA 5J0SA 8ICQA 5KT6A 1QSYA 2RHFA 2JH1A 1RPLA 1O03A 2EDUA 9ICLA 3L4PA 2YQEA 2LKYA 4MEYA 5EOZA 2EZZA 2LMRA 4FE3A 1SKSA 3QEBZ 1Z1BA 3GFKB 1SKRA 2KEYA 2F3NA 1X9XA 3QU7A 5DG8A 7ICJA 3ZD9A 4OJOA 3I1YA 2JEJA 3QUTA 8ICHA 1Z1VA 1MN8A 3RTVA 5JUMA 4YN4A 7ICUA 2HVIA 5AIAA 5DB7A 4P4PA 1ED1A 1OUQA 1AQ6A 1ZQYA 2A1AA 4MHVA 2VJ4A 4QJFB 1Z19A 4CF5A 5HNKA 4XRHA 2W54A 3NVZA 2FLNA 4KLTA 2H3QA 4Z6EA 4QWDA 1OW5A 1S9FA 4EEKA 3TFSA 5G5GA 3HT3A 4PGXA 4HYKA 1KBUA 4J9NA 2H5XA 5AM3A 3TARA 4DLGA 4O5KA 4RPYA 1O08A 2E1EA 3SD7A 2HBKA 4LVSA 5AICA 1WWUA 4Z6CA 4F2SA 3TADC 1D9FA 5IILA 2NYVA 3J81j 1TVAA 2EAPA 2ZTDA 1X40A 4KX3A 2MU2A 3PNCA 4BJQA 3BQTA 2LYBA 2F44A 2RDJA 2VA8A 1J2MA 1Q46A 3PX4A 2B6GA 2GOLA 2HOFA 3RJHA 2WB1C 3WK8A 1JI7A 2JRZA 4CF4A 1XO0A 1NKEA 4F2RA 2AGPA 2HBLA 1NK5A 3KKAC 1NKBA 4XUSA 2ZIUA 5L1IA 2HOQA 2E5SA 2IMWP 1N63A 4Y2XA 4QZIA 4XA5A 4EX6A 4ECYA 2MSNA 2P35A 3QXGA 1NJYA 3E58A 4Y2TA 2HBJA 3PR5B 3H8MA 4AP9A 7ICRA 2QB1A 2KICA 2K4EA 2P6UA 1J97A 3C1ZA 1FFVA 5KFNA 3FAHA 3TACB 4C0ZA 1BVSA 1LV5A 2VA3A 4YR2A 3PR4A 2ZTEA 1TAQA 9ICRA 2BGWA 5KL8B 3SV3A 4O0IA 2KOBA 5T14A 4UB4A 4DQIA 7ICOA 3PW4A 4F50A 1ECWA 2B0CA 4UB5A 5KG3A 3B0YA 2JGAA 4CNQA 4AYBC 4DL6A 5ALWA 4UW9A 2JH7A 2OCEA 4I2DA 4HAIA 1MQ3A 2ZIWA 2WHEA 3T3FA 4PPXA 4J9OA 1QQ5A 1SZPA 3FDSA 2BDUA 3EPGA 2KG5A 4EYIB 2EANA 3IV6A 1WWVA 3KOOA 5AKHA 3M9NB 4DL5A 4Q8FA 1SWWA 4ECRA 5AM0A 2HHTA 1V85A 4IRCA 5KFSA 4YFKA 2DBYA 7ICHA 1N5XA 1L6NA 3ISDA 3MR6A 4F92B 3C2LA 2FLPA 3PSIA 2HSZA 4KLFA 1Z3EB 3V7KA 5B66U 4ICAA 1S0OA 2G08A 1RYRA 4GXIA 1X2IA 3CP8A 4P0PA 2BKEA 3OHAA 2KTQA 2MUTA 4J9KA 4Y2SA 1BNPA 1MC8A 3THVA 3DEEA 4UBCA 8ICJA 1HJPA 3RRHA 2UVWA 2XY6A 1A6SA 3QYPA 3M9MB 1RQLA 1ZRNA 4GFJA 3Q8PB 4RPZA 3UPQA 3H0LB 2UVUA 8ICTA 4F91B 4R66A 5EWFA 2PMZF 3RAXA 9ICPA 9ICUA 2KSOA 4ECXA 5HR6A 9ICJA 1U48A 5KFWA 3EW9A 3G6VA 4F4KA 1KDHA 4UQGA 3MABA 3F5AA 2AGQA 1XC9A 4DOCA 3RH5A 4P0QB 2LYHA 1WYGA 1UT8A 2KN7A 2R8IA 4R8UB 5KFKA 4NLCA 1NKCA 2Y1JA 2DPJA 1ZQNA 3BS7A 1WG8A 2BQUA 4BWJA 4RPXA 4F5NA 5J2KA 1BPBA 1S77D 3H8JA 2YMPA 2ASLA 3PO4A 4I2GA 8ICRA 2OH2A 4CCHA 2K4HA 1IM4A 5KFTA 1L8OA 4K4IA 3GIKA 2FPLA 5KG0A 5L1MA 1VJ5A 4ECTA 2C22A 2W9BB 3UXPA 8ICIA 1PVRA 8ICFA 1Z00A 4MFAA 2F1HA 3N7PD 1KFTA 5ALMA 3U26A 3SV4A 2BPCA 2W9MA 1X6IA 3ZDAA 5AI5A 5AM5A 4I2AA 8ICCA 4UB1A 4Z6FA 2YB4A 5ALRA 3JPSA 3C2MA 1JUDA 5HR7A 2PMZC 2ZJ5A 4DCCA 5KNIA 2W9CB 5KT2A 5D46A 4B9LA 4UAUA 2ISOA 5AK5A 4B9NA 2NRTA 3GIJA 4QZEA 3GV7B 1JX4A 3BS5B 4EZ9A 1M6YA 4YR3A 4QZGA 1WCLA 4TUSA 3H8WA 2R8HA 3TFRA 2JMGA 5KG7A 3MC1A 5DDYA 1PZNA 4MF8A 8ICKA 3ORYA 1ZQQA 3UM9A 4CF3A 2HW3A 8ICGA 4GXKA 3WK6A 4IQVA 3SEIA 4R63A 3GIMA 4F5RA 4QZAA 2A1JA 4RNMA 5KFVA 1N2XA 4DOAA 4DSLA 1GO3F 3CRXA 1NI3A 4QWBA 5AK4A 2AGOA 7ICGA 2A3VA 3Q8RB 4UB6U 3PX0A 3HKZF 4Y2QA 1ZD2P 4NLBA 5AI9A 4QIWF 4UB8U 3RJJA 4DQRA 5KTQA 3DDHA 3LDAA 3C28A 1ZQKA 2ZIVA 4ECZA 2LM1A 2KNJA 2XGPA 2IOHA 1ZQMA 2BCUA 4KLLA 3AQFA 4IQUA 2F77X 4UBBA 1L8LA 1IIPA 4OJPA 1CRXA 1BPEA 5H2FU 3PMLA 5KG2A 2QB0A 1ZJMA 4ECVA 1NK4A 4F4WA 2O6KA 4TQRA 4US9A 1X66A 2ALZA 1Q8KA 4PL2A 3QZ7A 1FO4A 4CE6A 5J2IA 2XI9A 5ALDA 2C2DA 1BNOA 1KLNA 4F5OA 1DK2A 1JXLA 5HHIA 4ED0A 1RM6C 2F8KA 1KFSA 1NK9A 4C8MA 3RBDA 4YXJA 4R65A 1SV4A 3NRZA 2JZBB 2ASDA 4C8LA 4M04A 1VDVA 2HHXA 4J9MA 3B0XA 2KMDA 2NRXA 3WK9A 4Y2UA 3NGDA 4RQ7A 3Q8KA 2FDRA 3PSPA 2IHMA 1XWLA 5DBAA 1S5LU 1UPHA 1KEJA 3RH4A 1QQ7A 2NRVA 3SR6A 8ICVA 3RB4A 4NLNA 1BGXT 2OHFA 4C8NA 2OM6A 3ZD8A 4QIWC 2DWQA 4O3OA 1UT5A 4UB3A 1ZQSA 4UASA 5KT5A 3MR5A 5CJ7A 4DL4A 4J9LA 3WKDA 2XCAA 4DFMA 3AM9A 4MFFA 1U49A 3NRWA 2P66A 1L7NA 1ZQWA 2E8MA 2HMXA 4IRDA 2Z7JA 5KFOA 2ISPA 3PV8A 9ICIA 4NV0A 4FS1A 4Q45A 3SZ2A 5A0LA 3OGUA 3HW8A 2P6RA 2QLTA 5DG7A 4U7CA 7ICMA 1JIHA 5ALOA 5IINA 4TUPA 4FZNA 4P0PB 5DBCA 4DEZA 1X9MA 5KFBA 3HRDD 4DS5A 5DBBA 3LK9A 5L1JA 7ICQA 4DOBA 2FPKA 2GO7A 4GLXA 3KZXA 5E79U 1DRGA 3UMGA 1ZQBA 4Y2VA 4YP3A 1ZJNA 3F2BA 3PSTA 2V4QA 3SQIA 3RRGA 5EE0A 4F71A 4QZFA 3NASA 3JPRA 1ZQAA 1QSLA 4DFPA 2AU0A 2HHVA 1QQ6A 1ZQIA 5JRTA 3BQ1A 2WTFA 1NJWA 1PK1A 5IIOA 2WB1F 2ATLA 1RXVA 2FMPA 1S0NA 5DQIA 4EENA 3O0FA 2FMSA 1SB3C 1SL0A 3RJIA 3QU9A 4I2EA 3M7DA 3ZDEA 5ALFA 7ICFA 2Q4TA 8ICOA 3PX6A 3G6YA 3TAPA 1XO1A 3NTUA 5ALUA 4B9SA 3WKBA 2HCFA 3WKAA 1LKYB 3C2KA 4KLDA 5B5EU 3H8SA 4DWIA 4O3MA 1U4BA 4I27A 5AKEA 2KFZA 4F4ZA 4M47A 5KFHA 4RUAA 2ESEA 4G9BA 4O3QA 5CR0A 1ZD4A 4RNNA 4MF2A 4M9GA 3F2CA 2I9GA 4OJ5A 3MR2A 1L7MA 4OJ6A 1L3UA 4PH5A 8ICMA 2B21A 2XC9A 4AYBF 3Q8LA 2FLLA 2AH5A 4LZDA 4F93B 4I29A 3SAHA 2PFNA 3RFAA 1XSNA 4KLGA 5ALSA 3S6JA 5KFQA 2W7PA 5AKZA 1S97A 1TKDA 4J03A 3IDWA 1D8LA 4M6WA 5DGAA 1U47A 1D8BA 2J6UA 4J9QA 4YVZA 4ED1A 4US8A 1SV0A 1ZQJA 1S76D 4PL1A 2AQ0A 2XY7A 9ICKA 5ALXA 4Y2PA 4RZRA 3Q8MA 2HHSA 3I28A 1KN5A 4RQMA 1RZTA 1A76A 2F2AB 3ETRA 9ICOA 2IA6A 3V6HA 5J29A 5J8YA 1U9LA 3RJKA 2BCRA 1NOMA 3MGIA 2KZZA 4X5VA 2E1FA 3PW7A 1ZQGA 4IRKA 1SL1A 1FIQA 5C0YA 5GTHU 4UATA 1ZXIA 3SYZA 4Y2YA 3PO5A 3TI0A 1Y88A 4ECWA 4KLHA 4YMOA 2BCSA 1COKA 1COOA 4M0AA 2HI0A 4QWCA 1LB2B 1F5SA 5KFIA 3HWTA 1FFUA 3ONNA 3LVWA 4I2BA 3ICXA 3H4DA 1PVQA 4GXJA 5CP2A 2D3DA 3A0HU 4ED8A 1JMSA 3AU2A 3T5JA 1BPXA 3WKEA 4RQ8A 4PHDA 3OTQA 4C8OA 5DB9A 2K8BB 2JXJA 5CRXA 4IS7A 4FO6A 4DSEA 2YB1A 5KAIU 5AI6A 2Q0ZX 3G6XA 5AI0A 2W03A 5KT4A 1V9PA 2ZIXB 5AK6A 2KP7A 4Y2JA 3CNHA 4RQ4A 5J2AA 3AMZA 2DGZA 4O5CA 3D6JA 3I76A 4DF8A 2LYAA 4NL9A 2AQ4A 1DXSA 4FS2A 8ICBA 2JEFA 2XVTA 4JV1A 1SWVA 1ZQOA 2UVVA 2EAOA 3AEVA 2C2RA 3NS1A 4ED7A 4RQ3A 2EZYA 3MDCA 5IIMA 1DK3A 4G3IA 4I2FA 2ODGA 3ZDCA 4ACOA 9ICHA 1QTMA 1ZQDA 3RJFA 3VC8A 8ICSA 4I2JA 4NM1A 1X42A 4DSKA 1TAUA 2VA2A 5J2GA 3VCBA 2GWSA 2WAQC 2CN1A 5KFAA 2NO4A 3JPOA 1UCVA 2QARA 2ZUCA 4P4OA 2BPFA 2K89A 1K1SA 2XIDA 2Y0SC 3B9JA 3ISCA 3TQ1A 1URJA 3UXOA 1CI4A 2WF9A 3BQ2A 2ES6A 4IL6U 4MFCA 4EBEA 4M9LA 1QLNA 2MAXA 3JPTA 1N56A 3KHGA 5CB1A 3EUB2 2PFQA 5DLFA 2W11A 5G5HA 4K4HA 3GDXA 8ICZA 5J0QA 3C5GA 5KG1A 5F9NA 9ICXA 4QZ8A 3LYSA 5ALLA 2I1QA 1ZQTA 3CYMA 3Q8SB 3R9KA 2JR5A 8ICAA 3RJGA 1TE2A 4QZ9A 1TFRA 3V72A 5ALHA 1T3NA 4DQPA 2WFAA 4XQ8A 4RQ6A 1XS9D 2G0AA 2R8GA 5AHXA 2F1IA 3L3FX 3RB0A 4FZLA 5EE9A 3RB3A 2NO5A 4PHAA 4BDPA 2XGQA 5J2EA 3E0FA 5AKLA 4J9RA 3IP4B 1JROA 3T5KA 1T7PA 3ALRA 1H38A 1N60A 5ALNA 3H7IA 3RAQA 4RQ2A 3EZ5A 1KRPA 2LI6A 1S0MA 4JUZA 4QW9A 2ZUBA 4B9TA 1XU4A 2KJ8A 3GV5B 4I2CA 1HEKA 2HVHA 1D8YA 1X6JA 2VIXA 4JV0A 7ICKA 5KFXA 2BQRA 4Q8EA 4DF4A 4OO1J 2UVRA 3BDPA 4YD1A 5HHHA 4O3RA 4BWMA 4JWMA 5DLGA 3PY8A 2H3VA 2F1JA 2LM4A 4DSIA 3MFIA 2E8PA 2KIVA 4JB3A 3KBBA 3QU5A 3IHQB 1UQVA 4EYHB 1C7YA 3Q8QB 1HIWA 2ZXHA 5KFZA 3V6JA 1TK8A 4DSFA 1SL2A 5BOMA 3V7JA 2KKVA 2YY6A 9ICTA 2NRZA 1B4FA 3OSNA 1NK6A 5L1LA 5ALIA 2BCQA 2IBKA 2DUYA 5AM1A 5CWRA 4Q44A 4NJ8A 4PGYA 3RF9A 2WF8A 2ZIUB 3K1ZA 3CW2C 5KFMA 5EWGA 3V7LA 2GH1A 4QZCA 4QWAA 1NNLA 4P4MA 4DL2A 2DFLA 1NK7A 5J0UA 4QW8A 1SIJA 2BDPA 5KFLA 4UAZA 3GZFA 5ALQA 5EE1A 2WF5A 3M8RA 2ZXIA 1ZD3A 3KHRA 5KFRA 8ICEA 4F72A 4C8KA 4OCZA 5ALKA 2KVCA 2BZFA 5AKXA 4J9SA 4RNOA 1L3TA 4DFDA 2HHWA 4IQWA 4F4XA 4NY8A 3KHHA 3MDAA 2NRWA 1T4GA 4P2HA 2OEHA 1ZETA 2MRLA 1SV0C 2M0NA 2ZIWB 4RQ1A 2V9WA 2PKEA 2JEGA 1TAMA 2L5YA 4NXZA 4I28A 3IM1A 4I2IA 5C5JA 1T94A 2D6FC 4O3SA 4DFJA 5DGBA 4F4YA 2DPIA 2E3TA 3PZPA 3PVXA 1SKWA 4A8EA 5J8YC 2BHNA 2K8AA 4RQ0A 4YCXA 3HX0A 4KTQA 2HOIA 2N1RA 4ELUA 5DG9A 4C4TA 2RQ5A 4RU9A 5TZVA 2KZMA 2BPGA 9ICNA 1RQNA 3NVYA 4RQ5A 4QZBA 2YMQA 3PSFA 3MGVA 2JHDA 4FZMA 8ICXA 3AL0B 2MUTB 1D9DA 3ISBA 2BQ3A 1ZQLA 4P0QA 5AKYA 3NUQA 3SMVA 3QUCA 4TQSA 1UHUA 1WUDA 4FBUA 1ZQCA 1L7OA 7ICEA 3KD3A 1HUZA 4F5PA 5AI8A 4CRXA 2PFOA 1PUZA 2KSOB 2QARB 1B22A 5FP0A 3LVVA 3T79A 2ASJA 1QCKA 1L3SA 2KE7A 1N5WA 3RB6A 4GIBA 2OWOA 4NL9C 5HMLA 5AIBA 5J2JA 9ICMA 2YN4A 2W9BA 3RR8A 4Y2RA 1SXDA 2PI5A 5L1KA 3F2DA 4KLMA 4YXMA 2W3SA 1FEZA 2FPMA 5BPCA 2G5IB 1ZQ1C 1ZQUA 3IG8A 3UQ2A 3KZIU 5F9LA 5J2DA 4NLKA 2W9CA 4DQSA 5ALTA 4USAA 1S8OA 1V38A 1Q3VA 3NVWA 3LWLA 5L9XA 4DQQA 4OJLA 1JXEA 1YZ7A 3BS5A 1KTQA 5AKGA 1EXNA 2Y1IA 5J0OA 1JALA 2EQYA 4ECSA 1ZYQA 1N48A 1Z00B 2YMLA 4OD0A 3H4BA 2DKZA 8ICNA 1NK0A 4C7YA 2VKQA 2W8KA 4Q43A 3QUQA 3KFUF 3EYZA 3UXNA 4F8RA 1VLBA 1CEZA 3K1RB 1F44A 5ALZA 2IOFK 4ECQA 4CGZA 4DLEA 5J0PA 1T8EA 2AJQA 2J6SA 2HBMA 4CDGA 4O3PA 1XNSA 3WU2U 5KFDA 1UA0A 1TK5A 5KT3A 1XSLA 4KX5A 4YMMA 3K4GA 2YX8A 1JN3A 4F5QA 2A19A 2CPRA 2K4PA
chains in the Genus database with same CATH topology
2JRZA 1IG6A 2LI6A 5CEHA 1KQQA 4LJXA 2YQEA 5K4LA 2OEHA 1RYUA 2LM1A 2RQ5A 2KK0A 2CXYA 1C20A 2EQYA 1KN5A 2EH9A 1KKXA 2JXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRZ A;  1IG6 A;  2LI6 A;  5CEH A;  1KQQ A;  4LJX A;  2YQE A;  5K4L A;  2OEH A;  1RYU A;  2LM1 A;  2RQ5 A;  2KK0 A;  2CXY A;  1C20 A;  2EQY A;  1KN5 A;  2EH9 A;  1KKX A;  2JXJ A; 
#chains in the Genus database with same CATH topology
 3QNM A;  3FC4 A;  4YD2 A;  4QZH A;  4IQT A;  3EPI A;  2A1J B;  1KQQ A;  4EBD A;  3GU3 A;  2FJ6 A;  3JPQ A;  3WKC A;  4J9P A;  2XO7 A;  3M9O B;  2RDI A;  4EX7 A;  4M9J A;  4KIT B;  2JEI A;  4BXO A;  1Z4N A;  5ALY A;  1PVP A;  4I2H A;  1QH9 A;  5CHG A;  5JU5 A;  1XSP A;  1A0P A;  1ZQX A;  3D2S A;  5CEH A;  3C21 A;  5KFJ A;  1L3V A;  2ZIV B;  1ARO P;  2BR0 A;  4PZO A;  2RLT A;  3AUO A;  2WAQ F;  5J0X A;  2E8N A;  4O5E A;  1RYU A;  4C80 A;  3ETL A;  4KN7 A;  4KN4 A;  4MEX A;  2Y0S F;  2JZB A;  2YMM A;  3E2E A;  2QB0 B;  3SAG A;  9ICC A;  3ZDD A;  7ICP A;  3RJE A;  4B9U A;  5ALP A;  1ZQR A;  1ZQE A;  5BOL A;  5J0T A;  3OPX A;  3T5L A;  1SGG A;  2LHT A;  2RP5 A;  1N62 A;  3QZ8 A;  4KLI A;  4NLG A;  4KMU A;  4DL3 A;  4UB2 A;  1A77 A;  3AN1 A;  3HP6 A;  3GV8 B;  1UA1 A;  1MQ2 A;  4M9H A;  4M2Y A;  2KFN A;  4RQN A;  2DL0 A;  1N61 A;  8ICP A;  4PJ0 U;  5JTI A;  5KG6 A;  2Y9U A;  3HPO A;  2XY5 A;  3UQ0 A;  3ED5 A;  4EZ6 A;  2WF6 A;  3OJU A;  3RBE A;  4UAR A;  5AKJ A;  5AK3 A;  4PHE A;  1NJZ A;  1P7D A;  4ED2 A;  3LWM A;  5J0R A;  5D4B A;  2W04 A;  2KHV A;  4BGD A;  3UMC A;  1ZQZ A;  1ZOL A;  1DOQ A;  4EEY A;  4DL7 A;  2WF7 A;  4BUG A;  1ZQV A;  2RRD A;  2R8K A;  4UAV A;  1RYS A;  9ICA A;  1ZQH A;  2VAN A;  1KL9 A;  4RT2 A;  1BPD A;  1LVH A;  5KG5 A;  2W9A A;  3TKA A;  1WCN A;  7ICN A;  1ZRM A;  5K4L A;  2KD1 A;  2MA1 A;  4ELT A;  1V97 A;  2DKX A;  3FM9 A;  3M8S A;  3SAF A;  1X9W A;  2FE9 A;  2W55 A;  3MFH A;  3EWA A;  2NV3 A;  3GQC A;  3TAD A;  3UMB A;  3QU4 A;  4QWE A;  1YZ6 A;  2KIW A;  1DGJ A;  3WK5 A;  2KJ9 A;  5AM4 A;  3AU6 A;  4IR1 A;  1MA7 A;  4DFK A;  3MR3 A;  5KFF A;  3HJE A;  1K1Q A;  1RXW A;  4GC7 A;  3D2Q A;  4QZD A;  3AQE A;  5ALJ A;  3QEA Z;  5TIS U;  1TK0 A;  3DV9 A;  3KKA A;  1NZB A;  3KHL A;  4KLJ A;  9ICV A;  4KLE A;  5IIK A;  3TAN A;  3C29 A;  3N7R C;  2H3Z A;  3K75 D;  1LKY A;  9ICQ A;  2OYY A;  1TV9 A;  1PK1 B;  9ICS A;  1IV8 A;  5AKI A;  3M6Z A;  3RR7 A;  5KFU A;  4BX9 C;  3TAQ A;  4EBC A;  1X9S A;  3BJY A;  3GIL A;  2W3R A;  2KKP A;  3PW0 A;  1HUO A;  5J2C A;  3JPP A;  9ICG A;  5CA7 A;  2EZX A;  2W7O A;  5DQH A;  2E8O A;  5D49 A;  5J2H A;  3C23 A;  2M9N A;  3IG5 A;  3RH6 A;  2C2E A;  2JV3 A;  2K4I A;  2BCV A;  3N97 B;  1DGS A;  2G09 A;  3BQ0 A;  5J0Y A;  2C28 A;  2CXY A;  3H0M B;  2HHQ A;  3HIL A;  7ICI A;  4KLU A;  3D2N A;  5DDM A;  5EE3 A;  1Q3U A;  4NWI A;  2ZUD A;  4C4R A;  3F53 A;  4R64 A;  5DB6 A;  5F3X B;  1L5U A;  2KVS A;  4NM2 A;  2V4R A;  2OXO A;  4U6P A;  4TUQ A;  5III A;  3PW2 A;  1OXJ A;  2ZJ8 A;  1ZD5 A;  2LPE A;  2PXI A;  3MGH A;  4DSJ A;  1S0V A;  2I6X A;  5KT7 A;  1B43 A;  2F8L A;  2ZJA A;  2KV2 A;  4IC9 A;  4ZH4 A;  5J2B A;  2Y9T A;  5DQG A;  5J2F A;  1KKX A;  2G5H B;  2DF4 B;  4UAY A;  4KLQ A;  7ICT A;  1SXE A;  3BZC A;  3M1Y A;  2XCP A;  1IG6 A;  4C4S A;  5KL1 B;  5DKW A;  4DO9 A;  1YT3 A;  4ED3 A;  2KHQ A;  5KFE A;  5AKK A;  3OSP A;  5KAF U;  3L5K A;  3SI8 A;  5AM2 A;  1PK3 A;  2PFP A;  4ZOH C;  1KFD A;  1QSS A;  1IXR A;  4M6W B;  3ZDB A;  1NZP A;  3M6K A;  2F76 X;  4LZG A;  2ZG6 A;  4EEL A;  2CRX A;  5HMM A;  2IHN A;  3V6K A;  4NLZ A;  5HP4 A;  1L7P A;  4DS4 A;  4RUC A;  4JWN A;  4LJX A;  1BPZ A;  2ZTC A;  3QE9 Y;  1ZQP A;  1KSP A;  2H3I A;  2LBO A;  5EWE A;  2W8L A;  4B9V A;  2I5H A;  9ICB A;  2KK0 A;  5ALG A;  1C20 A;  8ICL A;  4FFD A;  1F0M A;  1RG6 A;  4TUR A;  7ICV A;  1SZH A;  3IRU A;  2AXT U;  1BPY A;  3A0B U;  4PHP A;  4FBT A;  4YQW A;  3QX7 A;  3WK7 A;  4B6J A;  3BQ7 A;  5ALE A;  4RT3 A;  4F3O A;  2FI1 A;  4BXO B;  5KFY A;  3N4M B;  2HDO A;  2ZIX A;  1S10 A;  4O3N A;  5KFG A;  4JV2 A;  1NK8 A;  3IN5 A;  3ZI4 A;  3OHB A;  3NVV A;  3C1Y A;  2KJ5 A;  4B9M A;  3N7S C;  2J6T A;  7ICS A;  1K5O A;  4PZN A;  2W43 A;  3KTQ A;  4YG2 A;  2G07 A;  3H0R B;  5KFP A;  4KLS A;  9ICF A;  5IIJ A;  1T3Q A;  2EH9 A;  4UAW A;  4KMO B;  1ZQF A;  1JRP A;  5KFC A;  3PMN A;  3QUB A;  8ICY A;  4K4G A;  1KW4 A;  2KZ3 A;  8ICU A;  3HKZ C;  1RDF A;  3SEN A;  4IR9 A;  2K8C B;  5DB8 A;  4JK1 A;  3BZK A;  3PW5 A;  1J2N A;  4PGQ A;  4O9M A;  2DQN B;  2IOF A;  4WJ3 B;  5AI4 A;  2G06 A;  5J0W A;  4JMU A;  4QNL A;  1CUK A;  4GC6 A;  8ICW A;  5ALV A;  1Z4O A;  2D8C A;  3F5E A;  3GII A;  3FYH A;  5GTI U;  2XIC A;  5KG4 A;  4E0D A;  4YMN A;  2K60 A;  1U45 A;  3WK4 A;  2AHO B;  4ED6 A;  3JPN A;  3C5F A;  3N28 A;  1NJX A;  4KLO A;  2R8J A;  1B0X A;  3MBY A;  2EAM A;  2HHU A;  4C7Z A;  4M9N A;  2R18 A;  2VJ5 A;  2FMQ A;  2PI4 A;  2H3F A;  4R8U A;  4ELV A;  7ICL A;  3H40 A;  2QKQ A;  3OJS A;  2YTU A;  3QU2 A;  2GLE A;  3T5H A;  1MSW D;  9ICE A;  4YR0 A;  9ICW A;  4Z6D A;  4ECU A;  5J0S A;  8ICQ A;  5KT6 A;  1QSY A;  2RHF A;  2JH1 A;  1RPL A;  1O03 A;  2EDU A;  9ICL A;  3L4P A;  2YQE A;  2LKY A;  4MEY A;  5EOZ A;  2EZZ A;  2LMR A;  4FE3 A;  1SKS A;  3QEB Z;  1Z1B A;  3GFK B;  1SKR A;  2KEY A;  2F3N A;  1X9X A;  3QU7 A;  5DG8 A;  7ICJ A;  3ZD9 A;  4OJO A;  3I1Y A;  2JEJ A;  3QUT A;  8ICH A;  1Z1V A;  1MN8 A;  3RTV A;  5JUM A;  4YN4 A;  7ICU A;  2HVI A;  5AIA A;  5DB7 A;  4P4P A;  1ED1 A;  1OUQ A;  1AQ6 A;  1ZQY A;  2A1A A;  4MHV A;  2VJ4 A;  4QJF B;  1Z19 A;  4CF5 A;  5HNK A;  4XRH A;  2W54 A;  3NVZ A;  2FLN A;  4KLT A;  2H3Q A;  4Z6E A;  4QWD A;  1OW5 A;  1S9F A;  4EEK A;  3TFS A;  5G5G A;  3HT3 A;  4PGX A;  4HYK A;  1KBU A;  4J9N A;  2H5X A;  5AM3 A;  3TAR A;  4DLG A;  4O5K A;  4RPY A;  1O08 A;  2E1E A;  3SD7 A;  2HBK A;  4LVS A;  5AIC A;  1WWU A;  4Z6C A;  4F2S A;  3TAD C;  1D9F A;  5IIL A;  2NYV A;  3J81 j;  1TVA A;  2EAP A;  2ZTD A;  1X40 A;  4KX3 A;  2MU2 A;  3PNC A;  4BJQ A;  3BQT A;  2LYB A;  2F44 A;  2RDJ A;  2VA8 A;  1J2M A;  1Q46 A;  3PX4 A;  2B6G A;  2GOL A;  2HOF A;  3RJH A;  2WB1 C;  3WK8 A;  1JI7 A;  2JRZ A;  4CF4 A;  1XO0 A;  1NKE A;  4F2R A;  2AGP A;  2HBL A;  1NK5 A;  3KKA C;  1NKB A;  4XUS A;  2ZIU A;  5L1I A;  2HOQ A;  2E5S A;  2IMW P;  1N63 A;  4Y2X A;  4QZI A;  4XA5 A;  4EX6 A;  4ECY A;  2MSN A;  2P35 A;  3QXG A;  1NJY A;  3E58 A;  4Y2T A;  2HBJ A;  3PR5 B;  3H8M A;  4AP9 A;  7ICR A;  2QB1 A;  2KIC A;  2K4E A;  2P6U A;  1J97 A;  3C1Z A;  1FFV A;  5KFN A;  3FAH A;  3TAC B;  4C0Z A;  1BVS A;  1LV5 A;  2VA3 A;  4YR2 A;  3PR4 A;  2ZTE A;  1TAQ A;  9ICR A;  2BGW A;  5KL8 B;  3SV3 A;  4O0I A;  2KOB A;  5T14 A;  4UB4 A;  4DQI A;  7ICO A;  3PW4 A;  4F50 A;  1ECW A;  2B0C A;  4UB5 A;  5KG3 A;  3B0Y A;  2JGA A;  4CNQ A;  4AYB C;  4DL6 A;  5ALW A;  4UW9 A;  2JH7 A;  2OCE A;  4I2D A;  4HAI A;  1MQ3 A;  2ZIW A;  2WHE A;  3T3F A;  4PPX A;  4J9O A;  1QQ5 A;  1SZP A;  3FDS A;  2BDU A;  3EPG A;  2KG5 A;  4EYI B;  2EAN A;  3IV6 A;  1WWV A;  3KOO A;  5AKH A;  3M9N B;  4DL5 A;  4Q8F A;  1SWW A;  4ECR A;  5AM0 A;  2HHT A;  1V85 A;  4IRC A;  5KFS A;  4YFK A;  2DBY A;  7ICH A;  1N5X A;  1L6N A;  3ISD A;  3MR6 A;  4F92 B;  3C2L A;  2FLP A;  3PSI A;  2HSZ A;  4KLF A;  1Z3E B;  3V7K A;  5B66 U;  4ICA A;  1S0O A;  2G08 A;  1RYR A;  4GXI A;  1X2I A;  3CP8 A;  4P0P A;  2BKE A;  3OHA A;  2KTQ A;  2MUT A;  4J9K A;  4Y2S A;  1BNP A;  1MC8 A;  3THV A;  3DEE A;  4UBC A;  8ICJ A;  1HJP A;  3RRH A;  2UVW A;  2XY6 A;  1A6S A;  3QYP A;  3M9M B;  1RQL A;  1ZRN A;  4GFJ A;  3Q8P B;  4RPZ A;  3UPQ A;  3H0L B;  2UVU A;  8ICT A;  4F91 B;  4R66 A;  5EWF A;  2PMZ F;  3RAX A;  9ICP A;  9ICU A;  2KSO A;  4ECX A;  5HR6 A;  9ICJ A;  1U48 A;  5KFW A;  3EW9 A;  3G6V A;  4F4K A;  1KDH A;  4UQG A;  3MAB A;  3F5A A;  2AGQ A;  1XC9 A;  4DOC A;  3RH5 A;  4P0Q B;  2LYH A;  1WYG A;  1UT8 A;  2KN7 A;  2R8I A;  4R8U B;  5KFK A;  4NLC A;  1NKC A;  2Y1J A;  2DPJ A;  1ZQN A;  3BS7 A;  1WG8 A;  2BQU A;  4BWJ A;  4RPX A;  4F5N A;  5J2K A;  1BPB A;  1S77 D;  3H8J A;  2YMP A;  2ASL A;  3PO4 A;  4I2G A;  8ICR A;  2OH2 A;  4CCH A;  2K4H A;  1IM4 A;  5KFT A;  1L8O A;  4K4I A;  3GIK A;  2FPL A;  5KG0 A;  5L1M A;  1VJ5 A;  4ECT A;  2C22 A;  2W9B B;  3UXP A;  8ICI A;  1PVR A;  8ICF A;  1Z00 A;  4MFA A;  2F1H A;  3N7P D;  1KFT A;  5ALM A;  3U26 A;  3SV4 A;  2BPC A;  2W9M A;  1X6I A;  3ZDA A;  5AI5 A;  5AM5 A;  4I2A A;  8ICC A;  4UB1 A;  4Z6F A;  2YB4 A;  5ALR A;  3JPS A;  3C2M A;  1JUD A;  5HR7 A;  2PMZ C;  2ZJ5 A;  4DCC A;  5KNI A;  2W9C B;  5KT2 A;  5D46 A;  4B9L A;  4UAU A;  2ISO A;  5AK5 A;  4B9N A;  2NRT A;  3GIJ A;  4QZE A;  3GV7 B;  1JX4 A;  3BS5 B;  4EZ9 A;  1M6Y A;  4YR3 A;  4QZG A;  1WCL A;  4TUS A;  3H8W A;  2R8H A;  3TFR A;  2JMG A;  5KG7 A;  3MC1 A;  5DDY A;  1PZN A;  4MF8 A;  8ICK A;  3ORY A;  1ZQQ A;  3UM9 A;  4CF3 A;  2HW3 A;  8ICG A;  4GXK A;  3WK6 A;  4IQV A;  3SEI A;  4R63 A;  3GIM A;  4F5R A;  4QZA A;  2A1J A;  4RNM A;  5KFV A;  1N2X A;  4DOA A;  4DSL A;  1GO3 F;  3CRX A;  1NI3 A;  4QWB A;  5AK4 A;  2AGO A;  7ICG A;  2A3V A;  3Q8R B;  4UB6 U;  3PX0 A;  3HKZ F;  4Y2Q A;  1ZD2 P;  4NLB A;  5AI9 A;  4QIW F;  4UB8 U;  3RJJ A;  4DQR A;  5KTQ A;  3DDH A;  3LDA A;  3C28 A;  1ZQK A;  2ZIV A;  4ECZ A;  2LM1 A;  2KNJ A;  2XGP A;  2IOH A;  1ZQM A;  2BCU A;  4KLL A;  3AQF A;  4IQU A;  2F77 X;  4UBB A;  1L8L A;  1IIP A;  4OJP A;  1CRX A;  1BPE A;  5H2F U;  3PML A;  5KG2 A;  2QB0 A;  1ZJM A;  4ECV A;  1NK4 A;  4F4W A;  2O6K A;  4TQR A;  4US9 A;  1X66 A;  2ALZ A;  1Q8K A;  4PL2 A;  3QZ7 A;  1FO4 A;  4CE6 A;  5J2I A;  2XI9 A;  5ALD A;  2C2D A;  1BNO A;  1KLN A;  4F5O A;  1DK2 A;  1JXL A;  5HHI A;  4ED0 A;  1RM6 C;  2F8K A;  1KFS A;  1NK9 A;  4C8M A;  3RBD A;  4YXJ A;  4R65 A;  1SV4 A;  3NRZ A;  2JZB B;  2ASD A;  4C8L A;  4M04 A;  1VDV A;  2HHX A;  4J9M A;  3B0X A;  2KMD A;  2NRX A;  3WK9 A;  4Y2U A;  3NGD A;  4RQ7 A;  3Q8K A;  2FDR A;  3PSP A;  2IHM A;  1XWL A;  5DBA A;  1S5L U;  1UPH A;  1KEJ A;  3RH4 A;  1QQ7 A;  2NRV A;  3SR6 A;  8ICV A;  3RB4 A;  4NLN A;  1BGX T;  2OHF A;  4C8N A;  2OM6 A;  3ZD8 A;  4QIW C;  2DWQ A;  4O3O A;  1UT5 A;  4UB3 A;  1ZQS A;  4UAS A;  5KT5 A;  3MR5 A;  5CJ7 A;  4DL4 A;  4J9L A;  3WKD A;  2XCA A;  4DFM A;  3AM9 A;  4MFF A;  1U49 A;  3NRW A;  2P66 A;  1L7N A;  1ZQW A;  2E8M A;  2HMX A;  4IRD A;  2Z7J A;  5KFO A;  2ISP A;  3PV8 A;  9ICI A;  4NV0 A;  4FS1 A;  4Q45 A;  3SZ2 A;  5A0L A;  3OGU A;  3HW8 A;  2P6R A;  2QLT A;  5DG7 A;  4U7C A;  7ICM A;  1JIH A;  5ALO A;  5IIN A;  4TUP A;  4FZN A;  4P0P B;  5DBC A;  4DEZ A;  1X9M A;  5KFB A;  3HRD D;  4DS5 A;  5DBB A;  3LK9 A;  5L1J A;  7ICQ A;  4DOB A;  2FPK A;  2GO7 A;  4GLX A;  3KZX A;  5E79 U;  1DRG A;  3UMG A;  1ZQB A;  4Y2V A;  4YP3 A;  1ZJN A;  3F2B A;  3PST A;  2V4Q A;  3SQI A;  3RRG A;  5EE0 A;  4F71 A;  4QZF A;  3NAS A;  3JPR A;  1ZQA A;  1QSL A;  4DFP A;  2AU0 A;  2HHV A;  1QQ6 A;  1ZQI A;  5JRT A;  3BQ1 A;  2WTF A;  1NJW A;  1PK1 A;  5IIO A;  2WB1 F;  2ATL A;  1RXV A;  2FMP A;  1S0N A;  5DQI A;  4EEN A;  3O0F A;  2FMS A;  1SB3 C;  1SL0 A;  3RJI A;  3QU9 A;  4I2E A;  3M7D A;  3ZDE A;  5ALF A;  7ICF A;  2Q4T A;  8ICO A;  3PX6 A;  3G6Y A;  3TAP A;  1XO1 A;  3NTU A;  5ALU A;  4B9S A;  3WKB A;  2HCF A;  3WKA A;  1LKY B;  3C2K A;  4KLD A;  5B5E U;  3H8S A;  4DWI A;  4O3M A;  1U4B A;  4I27 A;  5AKE A;  2KFZ A;  4F4Z A;  4M47 A;  5KFH A;  4RUA A;  2ESE A;  4G9B A;  4O3Q A;  5CR0 A;  1ZD4 A;  4RNN A;  4MF2 A;  4M9G A;  3F2C A;  2I9G A;  4OJ5 A;  3MR2 A;  1L7M A;  4OJ6 A;  1L3U A;  4PH5 A;  8ICM A;  2B21 A;  2XC9 A;  4AYB F;  3Q8L A;  2FLL A;  2AH5 A;  4LZD A;  4F93 B;  4I29 A;  3SAH A;  2PFN A;  3RFA A;  1XSN A;  4KLG A;  5ALS A;  3S6J A;  5KFQ A;  2W7P A;  5AKZ A;  1S97 A;  1TKD A;  4J03 A;  3IDW A;  1D8L A;  4M6W A;  5DGA A;  1U47 A;  1D8B A;  2J6U A;  4J9Q A;  4YVZ A;  4ED1 A;  4US8 A;  1SV0 A;  1ZQJ A;  1S76 D;  4PL1 A;  2AQ0 A;  2XY7 A;  9ICK A;  5ALX A;  4Y2P A;  4RZR A;  3Q8M A;  2HHS A;  3I28 A;  1KN5 A;  4RQM A;  1RZT A;  1A76 A;  2F2A B;  3ETR A;  9ICO A;  2IA6 A;  3V6H A;  5J29 A;  5J8Y A;  1U9L A;  3RJK A;  2BCR A;  1NOM A;  3MGI A;  2KZZ A;  4X5V A;  2E1F A;  3PW7 A;  1ZQG A;  4IRK A;  1SL1 A;  1FIQ A;  5C0Y A;  5GTH U;  4UAT A;  1ZXI A;  3SYZ A;  4Y2Y A;  3PO5 A;  3TI0 A;  1Y88 A;  4ECW A;  4KLH A;  4YMO A;  2BCS A;  1COK A;  1COO A;  4M0A A;  2HI0 A;  4QWC A;  1LB2 B;  1F5S A;  5KFI A;  3HWT A;  1FFU A;  3ONN A;  3LVW A;  4I2B A;  3ICX A;  3H4D A;  1PVQ A;  4GXJ A;  5CP2 A;  2D3D A;  3A0H U;  4ED8 A;  1JMS A;  3AU2 A;  3T5J A;  1BPX A;  3WKE A;  4RQ8 A;  4PHD A;  3OTQ A;  4C8O A;  5DB9 A;  2K8B B;  2JXJ A;  5CRX A;  4IS7 A;  4FO6 A;  4DSE A;  2YB1 A;  5KAI U;  5AI6 A;  2Q0Z X;  3G6X A;  5AI0 A;  2W03 A;  5KT4 A;  1V9P A;  2ZIX B;  5AK6 A;  2KP7 A;  4Y2J A;  3CNH A;  4RQ4 A;  5J2A A;  3AMZ A;  2DGZ A;  4O5C A;  3D6J A;  3I76 A;  4DF8 A;  2LYA A;  4NL9 A;  2AQ4 A;  1DXS A;  4FS2 A;  8ICB A;  2JEF A;  2XVT A;  4JV1 A;  1SWV A;  1ZQO A;  2UVV A;  2EAO A;  3AEV A;  2C2R A;  3NS1 A;  4ED7 A;  4RQ3 A;  2EZY A;  3MDC A;  5IIM A;  1DK3 A;  4G3I A;  4I2F A;  2ODG A;  3ZDC A;  4ACO A;  9ICH A;  1QTM A;  1ZQD A;  3RJF A;  3VC8 A;  8ICS A;  4I2J A;  4NM1 A;  1X42 A;  4DSK A;  1TAU A;  2VA2 A;  5J2G A;  3VCB A;  2GWS A;  2WAQ C;  2CN1 A;  5KFA A;  2NO4 A;  3JPO A;  1UCV A;  2QAR A;  2ZUC A;  4P4O A;  2BPF A;  2K89 A;  1K1S A;  2XID A;  2Y0S C;  3B9J A;  3ISC A;  3TQ1 A;  1URJ A;  3UXO A;  1CI4 A;  2WF9 A;  3BQ2 A;  2ES6 A;  4IL6 U;  4MFC A;  4EBE A;  4M9L A;  1QLN A;  2MAX A;  3JPT A;  1N56 A;  3KHG A;  5CB1 A;  3EUB 2;  2PFQ A;  5DLF A;  2W11 A;  5G5H A;  4K4H A;  3GDX A;  8ICZ A;  5J0Q A;  3C5G A;  5KG1 A;  5F9N A;  9ICX A;  4QZ8 A;  3LYS A;  5ALL A;  2I1Q A;  1ZQT A;  3CYM A;  3Q8S B;  3R9K A;  2JR5 A;  8ICA A;  3RJG A;  1TE2 A;  4QZ9 A;  1TFR A;  3V72 A;  5ALH A;  1T3N A;  4DQP A;  2WFA A;  4XQ8 A;  4RQ6 A;  1XS9 D;  2G0A A;  2R8G A;  5AHX A;  2F1I A;  3L3F X;  3RB0 A;  4FZL A;  5EE9 A;  3RB3 A;  2NO5 A;  4PHA A;  4BDP A;  2XGQ A;  5J2E A;  3E0F A;  5AKL A;  4J9R A;  3IP4 B;  1JRO A;  3T5K A;  1T7P A;  3ALR A;  1H38 A;  1N60 A;  5ALN A;  3H7I A;  3RAQ A;  4RQ2 A;  3EZ5 A;  1KRP A;  2LI6 A;  1S0M A;  4JUZ A;  4QW9 A;  2ZUB A;  4B9T A;  1XU4 A;  2KJ8 A;  3GV5 B;  4I2C A;  1HEK A;  2HVH A;  1D8Y A;  1X6J A;  2VIX A;  4JV0 A;  7ICK A;  5KFX A;  2BQR A;  4Q8E A;  4DF4 A;  4OO1 J;  2UVR A;  3BDP A;  4YD1 A;  5HHH A;  4O3R A;  4BWM A;  4JWM A;  5DLG A;  3PY8 A;  2H3V A;  2F1J A;  2LM4 A;  4DSI A;  3MFI A;  2E8P A;  2KIV A;  4JB3 A;  3KBB A;  3QU5 A;  3IHQ B;  1UQV A;  4EYH B;  1C7Y A;  3Q8Q B;  1HIW A;  2ZXH A;  5KFZ A;  3V6J A;  1TK8 A;  4DSF A;  1SL2 A;  5BOM A;  3V7J A;  2KKV A;  2YY6 A;  9ICT A;  2NRZ A;  1B4F A;  3OSN A;  1NK6 A;  5L1L A;  5ALI A;  2BCQ A;  2IBK A;  2DUY A;  5AM1 A;  5CWR A;  4Q44 A;  4NJ8 A;  4PGY A;  3RF9 A;  2WF8 A;  2ZIU B;  3K1Z A;  3CW2 C;  5KFM A;  5EWG A;  3V7L A;  2GH1 A;  4QZC A;  4QWA A;  1NNL A;  4P4M A;  4DL2 A;  2DFL A;  1NK7 A;  5J0U A;  4QW8 A;  1SIJ A;  2BDP A;  5KFL A;  4UAZ A;  3GZF A;  5ALQ A;  5EE1 A;  2WF5 A;  3M8R A;  2ZXI A;  1ZD3 A;  3KHR A;  5KFR A;  8ICE A;  4F72 A;  4C8K A;  4OCZ A;  5ALK A;  2KVC A;  2BZF A;  5AKX A;  4J9S A;  4RNO A;  1L3T A;  4DFD A;  2HHW A;  4IQW A;  4F4X A;  4NY8 A;  3KHH A;  3MDA A;  2NRW A;  1T4G A;  4P2H A;  2OEH A;  1ZET A;  2MRL A;  1SV0 C;  2M0N A;  2ZIW B;  4RQ1 A;  2V9W A;  2PKE A;  2JEG A;  1TAM A;  2L5Y A;  4NXZ A;  4I28 A;  3IM1 A;  4I2I A;  5C5J A;  1T94 A;  2D6F C;  4O3S A;  4DFJ A;  5DGB A;  4F4Y A;  2DPI A;  2E3T A;  3PZP A;  3PVX A;  1SKW A;  4A8E A;  5J8Y C;  2BHN A;  2K8A A;  4RQ0 A;  4YCX A;  3HX0 A;  4KTQ A;  2HOI A;  2N1R A;  4ELU A;  5DG9 A;  4C4T A;  2RQ5 A;  4RU9 A;  5TZV A;  2KZM A;  2BPG A;  9ICN A;  1RQN A;  3NVY A;  4RQ5 A;  4QZB A;  2YMQ A;  3PSF A;  3MGV A;  2JHD A;  4FZM A;  8ICX A;  3AL0 B;  2MUT B;  1D9D A;  3ISB A;  2BQ3 A;  1ZQL A;  4P0Q A;  5AKY A;  3NUQ A;  3SMV A;  3QUC A;  4TQS A;  1UHU A;  1WUD A;  4FBU A;  1ZQC A;  1L7O A;  7ICE A;  3KD3 A;  1HUZ A;  4F5P A;  5AI8 A;  4CRX A;  2PFO A;  1PUZ A;  2KSO B;  2QAR B;  1B22 A;  5FP0 A;  3LVV A;  3T79 A;  2ASJ A;  1QCK A;  1L3S A;  2KE7 A;  1N5W A;  3RB6 A;  4GIB A;  2OWO A;  4NL9 C;  5HML A;  5AIB A;  5J2J A;  9ICM A;  2YN4 A;  2W9B A;  3RR8 A;  4Y2R A;  1SXD A;  2PI5 A;  5L1K A;  3F2D A;  4KLM A;  4YXM A;  2W3S A;  1FEZ A;  2FPM A;  5BPC A;  2G5I B;  1ZQ1 C;  1ZQU A;  3IG8 A;  3UQ2 A;  3KZI U;  5F9L A;  5J2D A;  4NLK A;  2W9C A;  4DQS A;  5ALT A;  4USA A;  1S8O A;  1V38 A;  1Q3V A;  3NVW A;  3LWL A;  5L9X A;  4DQQ A;  4OJL A;  1JXE A;  1YZ7 A;  3BS5 A;  1KTQ A;  5AKG A;  1EXN A;  2Y1I A;  5J0O A;  1JAL A;  2EQY A;  4ECS A;  1ZYQ A;  1N48 A;  1Z00 B;  2YML A;  4OD0 A;  3H4B A;  2DKZ A;  8ICN A;  1NK0 A;  4C7Y A;  2VKQ A;  2W8K A;  4Q43 A;  3QUQ A;  3KFU F;  3EYZ A;  3UXN A;  4F8R A;  1VLB A;  1CEZ A;  3K1R B;  1F44 A;  5ALZ A;  2IOF K;  4ECQ A;  4CGZ A;  4DLE A;  5J0P A;  1T8E A;  2AJQ A;  2J6S A;  2HBM A;  4CDG A;  4O3P A;  1XNS A;  3WU2 U;  5KFD A;  1UA0 A;  1TK5 A;  5KT3 A;  1XSL A;  4KX5 A;  4YMM A;  3K4G A;  2YX8 A;  1JN3 A;  4F5Q A;  2A19 A;  2CPR A;  2K4P A; 
#chains in the Genus database with same CATH homology
 2JRZ A;  1IG6 A;  2LI6 A;  5CEH A;  1KQQ A;  4LJX A;  2YQE A;  5K4L A;  2OEH A;  1RYU A;  2LM1 A;  2RQ5 A;  2KK0 A;  2CXY A;  1C20 A;  2EQY A;  1KN5 A;  2EH9 A;  1KKX A;  2JXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...