3QUCA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with sulfate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHNGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 78
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qucA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qucA01
4JDPA 3N8GA 5AKYA 2ZXEA 1XPJA 1K1EA 4KYTA 4YH1A 5AKXA 1L7PA 2G80A 2HO4A 3ZX5A 3QUQA 3NANA 4HYTA 5AW1A 2DQSA 4Y2PA 2O2XA 3K1ZA 1RRCA 2R8EA 3S6JA 4XE5A 4UM5A 2B0CA 5AK3A 4E88A 4RETA 1Z4QA 3CNHA 5AK4A 2YJ5A 2C88A 2HI0A 3ZI4A 1Q91A 5AI9A 3QLEA 1QQ5A 5ALNA 3ZTWA 3IRUA 4C4SA 4H1WA 5AKZA 3PDWA 3E8MA 2D2VA 3L1UA 4OCZA 4QJBA 5ALTA 2RAVA 1CR6A 4Y2QA 2C9MA 2RARA 5AVYA 2ODAA 3QGMA 4UMEA 4FYPA 4HGPA 2I34A 4BNDA 4YGYA 4GIBA 3I1YA 3SHQA 3WKAA 3EPRA 2OBBA 3BWVA 1RMTA 3I76A 4NFLA 3SKXA 4F72A 1VFPA 1ZS9A 2ZBDA 2HX1A 3E58A 3IB6A 1RMYA 5AW0A 4YIKA 2YMMA 4XQ0A 4G63A 3L8GA 3UMCA 4HGQA 4BEVA 4JB3A 2JAWA 2HHLA 3WKBA 4YCMA 4IFTA 3PGVA 1U2TA 4FFDA 1Y8AA 4Y2RA 3ET4A 2YMLA 3ED5A 3U7EB 3GYGA 4XPZA 2JAOA 4EENA 2FEAA 5ALQA 3HLTA 2IYEA 2BY4A 3L5KA 2I7DA 5AW9A 3AR3A 2AGVA 2FI1A 4CE6A 3U13A 4UM7A 2GHTA 1L7MA 1U7PA 2GFHA 1SWWA 4OFZA 5ALDA 4HAIA 2RBKA 5ALMA 2W11A 3EWIA 4CF4A 1U02A 2W4MA 1L8OA 2YJ6A 5IT0A 1NRWA 3I6BA 3M1YA 1WVIA 4DW8A 2YMQA 3W5CA 3DV9A 2NO4A 3QXGA 1NNLA 1YMQA 2I55A 2P9JA 5AICA 4Y2XA 2MSNA 5ALHA 4Y2YA 1S2OA 3AR9A 2NO5A 1J97A 2MU1A 4ZEXA 3RFUA 1RQLA 3ONNA 2YFYA 4HGRA 4PNHA 5ALUA 3D6JA 3WK9A 3OPXA 5AW5A 2WF6A 2WFAA 4Y2SA 4ZEVA 2BDEA 3VAYA 4J03A 5AI6A 5AW3A 1RQNA 5ALSA 3F9RA 4CF3A 5AI0A 1RPZA 3MMZA 4KX5A 1KYTA 5AKHA 3KOOA 1SWVA 3QU4A 4UASA 4UU1A 5AKKA 2HOQA 3B9RA 2YJ4A 1LTQA 2BDUA 5AVRA 1WR8A 1LVHA 2R8ZA 1T5TA 5ALLA 5AM2A 4QQFA 4BX2A 5ALJA 5AW6A 4UARA 1ZD3A 3M9LA 5AVSA 3WK7A 3N07A 4DCCA 1RKUA 1ZD5A 4OD0A 3A1DA 3NRJA 4AP9A 3WKEA 3PCTA 3B8EA 1AQ6A 3BA6A 2JARA 1QH9A 2AUTA 1TJ3A 2GMWA 5AVWA 4NWIA 2I33A 2P27A 2VKQA 3DDHA 1L7NA 1ZRMA 3ZVNA 1YDFA 3OCWA 3ZU6A 5AM1A 3I28A 2I54A 4DWOA 2FPWA 3IJ5A 3J7TA 3OTQA 4FE3A 1RDFA 1QYIA 1Z5GA 2G0AA 2ZBFA 5A3QA 3U7FB 2P11A 5ALGA 3U7GA 2NYVA 2G1AA 5AW8A 4EZEA 3ZWDA 3WKCA 3WK6A 2C8KA 3MC1A 3KBBA 5AI4A 3E81A 2FDRA 3B9BA 3L8FA 2W43A 3ESQA 3FVVA 2OM6A 1ZD4A 3ET5A 3OCUA 5IS2A 2HEGA 3ZVLA 1Z4IA 3QU7A 1ZD2P 3DNPA 5AK5A 5AM4A 3R4CA 1L7OA 2R8YA 3A1CA 3AR2A 2FPXA 1FEZA 5ALFA 1RC8A 4BX3A 3HYCA 3WK4A 4UAUA 2YJ3A 1Z4JA 3L0YA 1Z5UA 4UU0A 2WF7A 3NIWA 3MN1A 3R9KA 5AVTA 3SMVA 3FPBA 2G09A 2MU2A 1TA0A 4Y2JA 5AESA 3MPOA 1VJ5A 5FP0A 3WGVA 3SD7A 1VJRA 3L8EA 4BKMA 3ZTYA 3L7YA 2WF5A 3U19A 3ZVMA 4UATA 3R09A 2WF9A 2PR7A 3N1UA 4Y3UA 4C4RA 1IWOA 3SKYA 5AKLA 5ALOA 1Z4LA 2Q4TA 1T9ZA 4KN8A 3QYPA 3E84A 4NV0A 1YNSA 1Z4NA 1TE2A 5AKIA 3WKDA 4EELA 2CFSA 3WK8A 4AS3A 4GXTA 1JUDA 5AI8A 5AW2A 1TJ4A 5AM3A 3AR6A 2JAUA 2Q4RA 3L0BA 5T41A 2GO7A 1MH9A 2ZBEA 4RESA 3W5BA 2FUCA 4IG4A 3KC2A 2B82A 3L8HA 1Z4PX 1XVIA 4UMFA 1L8LA 4UMDA 1N8NA 1XP5A 5ALWA 4DFDA 1EK2A 3P96A 5AKEA 2CFTA 4UMVA 5ALXA 3ZWKA 1U7OA 4OHFA 2EATA 5A3SA 4EX7A 2YN4A 3OCYA 1QQ6A 3KDPA 4I9FA 1T5SA 1WZCA 4BBJA 5AHXA 5A3RA 2G07A 4HGNA 3FPSA 4O8CA 3N5KA 1ZRNA 4EX6A 1SU4A 3WK5A 5AKGA 1YJ5A 2WM8A 5AVVA 3FZQA 1RKQA 2AMYA 3RF6A 4I9GA 1S8OA 5AK6A 4UAVA 3QUCA 3EF0A 3ZUPA 3AR8A 4UW9A 1Q92A 4YIHA 2B30A 1Z4MA 3AR7A 3NUQA 3QUTA 4KNWA 4CNQA 5AIAA 2YMPA 4AS2A 2OYCA 5ALRA 4BNDB 5AKJA 4G9BA 5JJBA 1RLOA 1CQZA 2OA0A 5ALEA 3QU5A 3W5DA 2EARA 2AH5A 5AI5A 2IA5A 2HF2A 1RLMA 5AW4A 2HSZA 1QQ7A 1Z4OA 2P69A 2HF7A 4C4TA 5AVUA 1L6RA 4J2TA 1O08A 2PQ0A 5E0OA 3QX7A 3A3YA 2FPUA 2PKEA 5ALIA 4MWOA 4NAVA 3NASA 4L6AA 4L57A 4YCLA 2WF8A 3PGLA 1YV9A 4ZEWA 2C8LA 3U7HB 3A1EA 5ALYA 3QU2A 1TJ5A 4HGOA 3EF1A 4BEWA 2CN1A 5AVQA 3WGUA 5AIBA 4F71A 3OCXA 3KD3A 3L1VA 2RB5A 4YCNA 3DAOA 3NALA 3FM9A 2IOFK 3ZW7A 2FPSA 2CFRA 4KX3A 2B1QA 2JGAA 3AR4A 1PW5A 2ZBGA 2B8JA 2EAUA 2G06A 1RLTA 1NF2A 1N9KA 2FUEA 2GHQA 4Y2VA 5AM0A 1U2SA 2O9JA 2ZOSA 2Q5EA 2IOFA 5AVZA 4BX0A 5ALZA 3KZXA 2WHEA 2I6XA 4NABA 3TLMA 3QNMA 2G08A 1F5SA 3OCVA 5ALPA 3L0CA 3UM9A 5IT4A 5AM5A 2B1RA 1EK1A 3U26A 4XOUA 5AVXA 4MUMA 2HCFA 3SF0A 2R8XA 4Y2UA 1RMQA 1WPGA 3UMGA 2B8EA 2QLTA 1ZJJA 5ALKA 2ZG6A 3AR5A 1RKVA 3N28A 4B6JA 2HDOA 2QYHA 1X42A 4EEKA 3OCZA 2YY6A 3ZX4A 4BYGA 2FPRA 3QU9A 3W5AA 3CZ4A 3ESRA 3QUBA 1YS9A 2X4DA 3SLRA 4KNVA 5AW7A 3NAMA 2IOHA 1Z4KA 4Y2TA 2C4NA 3UMBA 3FGOA 5ALVA 2YBDA 4L6CA 4CF5A 1Z88A 1J8DA 1ZOLA 1O03A
chains in the Genus database with same CATH superfamily
2G82A 4OKIA 4J2OA 4P3OA 2IU4A 3K9HA 3BXOA 1KP3A 2I4TA 1FUYB 2WJ4A 2Z5FA 3P9QA 4D3XA 3U7QB 2O7NA 4INOA 5F5XA 1UBTS 5LMNB 2JFZA 5TMEA 3RJMA 1KMNA 2XGOA 1CC1S 3QUQA 4MQFB 4P3KA 1GPJA 3FBGA 4JVLA 5FPPA 4XQGA 1IV8A 3UHOA 4Z7JA 1AMOA 1U5BB 2L19A 3I04A 3PFNA 5DTQA 1NK5A 4UM5A 4DMUB 5BVHA 2V4RA 5FI3A 4MWSA 2BSAA 4Q7QA 2LDXA 3KK0A 1VJCA 3EVEA 2NQ2C 2Q2WA 3LUBA 5J0UA 1I4DD 4RETA 4YCDA 4D0LB 3D3EA 3DDZX 3RJGA 1Z2OX 3B5EA 5T8KA 3V46A 2K60A 4UBBA 1DZIA 1ZIXA 2WJIA 5T5QA 3X0DA 4EBEA 3MERA 1D2RA 4M1TA 3O4VA 3JAKA 3UXEA 1B23P 4PPNA 5CYPA 3SVTA 4E70A 3JCZA 1ZICA 2IYPA 2VDRB 1OIVA 3AF1A 1C9KA 1QQ5A 2B92A 1VA5A 1R0XA 4EPTA 4TXMA 2G3YA 1QZ3A 1T91A 2DH6A 3CRXA 4G07A 2GI4A 2YINC 1E1YA 4ED0A 4L9RA 3PIIA 2FK8A 2NT4A 5JT1A 3H9CA 1DAOA 5L3QA 1Q7EA 3E8XA 2BOVA 2X86A 1A72A 1YIAA 4N12A 4BAUA 2RHRA 2XGPA 1BXGB 3UJ8A 3LL4A 5HGJA 1DMSA 3V4FA 3BUSA 1AQJA 2HW3A 3MLAA 2O54A 2RARA 1T1EA 2H1VA 4G4SP 4X90A 1RW4A 2C9DA 4MVJF 3SR4A 3MS4A 4L4ZA 1DPGA 3T9BA 4IIUA 1U8ZA 1WU7A 4ER5A 4RQUA 5JRDS 1P18A 2OENG 2ZWOA 4RLSA 4RLQA 1V16B 4D6YA 3SHQA 1BCSB 4HDSB 4PHTA 4M2LA 1RMTA 3U7FB 5IHXA 3JWGA 3BT7A 5C81A 1NZPA 3GIKA 4XXHA 2FEOA 1OXXK 1JLRA 1E4EA 4DLXA 4DSZA 2IHBA 2R96A 1PKEA 3DWGA 4F7DA 2PKXA 1RE0A 1BHSA 4ED8A 1AZLA 4M54A 5AW0A 1LDBA 5JMPA 1YQQA 4JV5B 1EINA 3EAGA 2ZI5A 3L8GA 1O96B 4HEA1 4NZMA 1RAAA 3FWYA 3WKBA 3RW9A 2V9WA 4FOTA 2IVFA 3IT2A 4E30A 2QBYA 2HBMA 5KT3A 3LT5A 1RP7A 1U8EA 1PJ8A 3QKSA 1P1FA 1CUBA 1W85B 2JJ1A 5AQEA 1XYGA 2JAOA 1F38A 4D5GA 3Q9SA 3O93A 3JPYA 4NOKA 2OYRA 4EBFA 4KWIA 1DTWA 1OW3B 3HDTA 1V7ZA 1AGNA 2FJPA 1IM5A 3BD9A 1LS6A 3K6SB 2KP7A 3WYEA 4KN4A 3AR3A 1NDUA 2H51A 2QQ0A 1ND6A 3O82A 4LGMA 3V7JA 1F1BA 4ND4A 4CKBB 2J30A 2B21A 1N48A 2C4TA 2C4MA 3PGMA 4FOSA 1ZCJA 4TRRA 2AG0A 1JIKA 3WMXA 3EWSA 4Z0TA 2X7XA 3C7TA 2VUUA 4NDNE 1E0JA 1P7ZA 3KSRA 4CF4A 1UBNA 3FLMA 3KPWA 4M0CA 3S28A 1E9AA 3HLYA 3CIOA 2A9QA 3N8KA 3NX4A 3WR5A 4D82A 1F8YA 3NIFB 1HDZA 4W5WA 4XFKA 4BJ6A 3A31A 3WL5A 4BLSA 3I6BA 5IHPA 1Q20A 1WNFA 2B6GA 4BTEA 4Z49A 1QC5A 2Z2JA 3KFXA 1S3GA 1UPHA 2IKQA 2XE6A 3DG9A 3IPLA 2VPYA 3A8TA 5SZJA 1M5TA 4Q4HB 2YMQA 1EH5A 1FRFS 1GCGA 2Q4DA 2W6MA 2ZITA 2W6ID 1OHHA 3D54D 3LL7A 4E2FA 1XKXA 3WLSA 3W8NA 3GLTA 3C1ZA 5FNVA 2BI8A 2FLWA 4V0NA 4JYAB 3A6KA 1EFLA 3S81A 4PLZA 3ZV3A 2VTVA 5D3MB 4KLHA 2IEIA 2NO5A 3H6KA 4FHZA 2ZBUA 3BWCA 1CEQA 3V1TC 1LY1A 1Z06A 3DXFA 5FLYA 4B8WA 3PT9A 2ZJBA 4ZEXA 4GKJB 1T10A 3ONNA 3VKUA 5BW4A 2A0YA 3FPEA 4E22A 4YRDA 3HBJA 5F23A 3ZWQA 1E69A 4GG1A 1HETA 2CCJA 3D2CA 3KOMA 1SD5A 3WK9A 1PFWA 3O91A 4CM9D 1QWSA 5TF0A 4PC2A 1S2NA 2QQFA 1CUGA 1E79D 4G0UA 2PXAA 2XA1A 1GVHA 1HE4A 3C15C 3NWEA 1IY2A 4MTLA 1KHHA 3IAFA 5U1PA 4UZSA 3IA7A 4O3PA 4TWRA 3V33A 4QYIA 3JD2A 1XJWA 3MMZA 1KRPA 4ENSA 5JVDF 3I9V6 1PVPA 1EXVA 4WBNF 2ZSAA 2W9XA 1UM9A 1DL5A 1UC8A 3BKWA 3KAKA 2HOQA 1U9IA 2EJBA 4REOA 4ND6A 3W6OA 1SURA 3LW8A 4Z2AA 2PMZC 1T9DA 3U6KA 4B3MB 3BGSA 3O8CA 2CDRA 3L7BA 2XSZA 4NU0A 4Q3EA 5JCZA 3Q8MA 4TMYA 1VJ1A 3S7TA 4RNDB 3ZWBA 2OVBA 2VAVA 4QSHA 5CX4A 4Q45A 1JMSA 2FY8A 3L9XA 4JT4A 5CBPA 4MYTA 4ZGBA 3TXYA 3LC0A 2SBTA 2QD2A 1XN4A 3RHZA 1MX3A 1N5JA 1FVXA 1SVIA 1XNJA 2AOUB 4M87A 3UJ7A 3EC2A 1EQUA 3NVKI 3HGQA 3BA6A 4J43A 4JOQA 4KRYA 3VJKA 1N2OA 1RHJA 2FSFA 2O1EA 5IDQA 3MJDA 4Q02A 4WOCA 3RSSA 1UXOA 2Z2IA 4IILA 4USAA 1Q74A 1R4ZA 5DBCA 3H3FA 1O96A 5GJBA 1SA0A 3R20A 9ICNA 4I2NA 3UJHA 4A6PA 4C7JA 3RYIB 1GUBA 3RJZA 4JCOA 3WOHA 1VLJA 5CB8A 3BK2A 1YONA 1K97A 1EUDA 2O3RA 2NZ2A 2WTEA 4D8UA 4IFIA 1K6XA 4O1HA 3HK2A 4UU8A 4DWJA 2PHZA 3MTBA 4UNRA 4U3JA 1A5AB 5JCOC 2VDPB 1AHHA 3UJPA 1UXHA 2JJQA 4UHBA 4GE0A 1V2GA 2DPIA 1P0IA 1W0KA 2QRKA 5TQVA 3WC4A 1XRRA 1M0TA 2G70A 4JJIA 1RJEA 4YRNA 1NX6A 4G0ZA 3PRJA 2IW1A 2FSUA 2VF4X 5BR4A 2IF0A 4UVIA 3TRFA 2QTVA 1V35A 3ER6A 2RHLA 3FZNA 3GQVA 4EBDA 1IULA 4MQMA 2ZIXA 2OXFA 3B60A 4MQUA 3N70A 4J1QA 2YHBA 3WK6A 3DBLB 4UFOA 2OZLB 1Z9BA 3K9LA 2LV8A 4HWGA 4CXMA 2FDRA 3L8FA 5A4MS 5TT0A 4QICA 3B0XA 1ZSNA 4P3NA 4JCCA 1GFIA 3SIRA 2QI9F 3SZRA 4M53A 1CBUA 1ZD4A 3VHLB 1VL5A 1M10A 1MORA 2XOKA 5LBUA 3EG5A 4PIPA 4YV2A 1DWQA 4ZOAA 3G0IA 3FA2A 4V0MA 4OHUA 1GZ5A 3F6BX 4XIJA 3VPSA 1KDZA 4CV2A 2VYQA 4DCNA 1OYWA 2JI7A 4IVRA 5HA5A 3CSDA 1E4OA 3DR5A 3H2ZA 4PLPA 4I1UA 2GRJA 5DYWA 3ONWA 3WS7A 5ALFA 3VZCA 4MULA 3JQAB 1YZ6A 5DB7A 1JEDA 3S2YA 4BNUA 4CMKA 3WK4A 1HE2A 3BIOA 1WHSA 1RAIA 2YJ3A 4GX2A 4MKHA 3EH1A 3FUCA 3B13B 4J29A 4MUYA 3ECCA 5DT9A 4QUHA 4RH0A 3KG2A 1HKHA 5JAIA 3DZKA 3IQDB 4C03A 2OV2A 4FS2A 3GR6A 3DL0A 3PE3A 4K28A 5A0LA 5CXUA 5B55A 5DP1A 2HRZA 8ICTA 4B71A 2H63A 4EB6B 2ZIUB 4OYYA 3SHTA 3U2QA 5DULA 4GZMA 1SVMA 5JJCA 2OCYC 3SD7A 3HYNA 3NMUF 2BTQA 4QIWF 2JI4A 3C41J 4K9PA 2IX3A 1RTTA 4FCVA 1I7NA 3GT4A 3UCEA 4PJ0U 1WQ1R 1NJWA 3JV7A 3F2BA 3U1VA 3PFIA 2G40A 5AFSA 2HQBA 3I9FA 4O2AF 2D0OB 3PQFA 4PZNA 2R1VA 1X70A 1OLSA 1X7GA 2WWGA 3AKDA 4G5FA 1TK5A 8ICVA 1S0NA 4RK5A 3W2IA 1U1GA 5I9SA 3A9UA 3F7MA 4P08A 5FEMA 5JALA 2XECA 3B1FA 5D3MA 4BDSA 1ULHA 2Z8ZA 1FXSA 3WKDA 2WYWA 5HIKA 2D0IA 3FBTA 2BGWA 2Q9UA 4NV3A 5CMLA 4JI5B 4KL8S 1IWBB 2C5AA 2R25B 3DGFC 3N86A 4IEIA 1BJKA 3ZLUA 2Z58A 4G5SA 5G40A 4YY3B 2W98A 1YRYE 1ZGGA 3L0BA 2VNHA 4MQ6A 4NATA 4DG9A 1QAQA 1QIDA 4XWKA 1G17A 2XCLA 3T0GA 2ASDA 2WHYA 2IV2X 3SYNA 4I2DA 3E9NA 4Z6CA 3P4YA 2O6KA 1JG1A 4J75A 1Z4PX 3H0EA 4DLNA 4YUXA 5A03A 4QNMA 4JI4B 5LOVA 4RVFA 4F84A 3L3BA 4PW0A 4DVJA 2N47A 4WOPA 4TT8A 1U0LA 4UJ5A 4LZLA 3CKMA 4E5KA 2JV3A 4AN4A 3CUUA 4FYHA 3JASA 4YI5A 4F92B 4OTZA 3L4JA 3I0NA 1ZQDA 3DPSA 4JY7A 2OFFA 2HHWA 5KFHA 4U2BA 4DIEA 2GBCA 2Y1WA 3KJZA 2ZSJA 1VPDA 5GINE 3HJEA 2ZSKA 2F9FA 3IUYA 1VC2A 1VMIA 4FMPA 4IL6U 2VUIB 1RYNA 2UV8A 2BEVA 4J16C 4AM8A 2H18A 1F2VA 2VA2A 2XH8A 4LV8B 5I9NA 1P9OA 3H75A 4RDIA 3PC6A 3MEQA 4OGWA 5BW5A 3TGPA 3QXXA 2R44A 3ZI7A 4AJ2A 3QXJA 2UUCB 4B32A 3P0HA 5BXQC 3ZBQA 3GIIA 4MRPA 4EYQA 3ONVA 2A33A 5JQWA 2YX8A 4HZIA 1PFUA 1Y5LA 4IIFA 3PX0A 1H2WA 3NOVA 3V48A 2WB1F 2V5UA 2FSVC 4DMCA 5KHOC 4ABTA 3OIUA 4IGAA 1JHMA 2I7TA 8ICQA 4G84A 5DV9A 1S4MA 2B35A 1KZ7B 1JHXA 2ANCA 1B14A 4MEBA 1SCQA 5F4BA 2PMWB 5LQCA 1B4FA 1ZQIA 1EIZA 1LQUA 2ZJOA 4JJZA 3BZCA 4V3BA 3GGOA 3MF4A 3IBYA 3RTBA 4EPXA 3WGMA 3NFYA 1C8VB 4NK4A 1PTKA 4RIEA 4KV9A 1E2LA 1UBSB 3IP5A 3VKFA 1QZTA 2Q6TA 3JYPA 3L7DA 4JJ7A 3VJMA 1E3TA 2P5YA 3K0FB 5AKJA 4DL3A 1V8FA 3NUGA 4CTJA 3RVJA 1TAQA 2QW1A 4DC9A 4L02A 3RADC 4MUIA 3DDNA 2GILA 3M1AA 3EQ7A 4Q48A 4IZHA 1RI1A 1KAQA 4AO6A 5A7FA 2WSLA 1SVUA 5EE3A 4ARSA 2ODTX 2R1UA 5AW4A 3IEVA 5E7JA 4EB6A 1G2OA 1R5OA 1Z25A 2XUFA 2O7SA 5F3XB 1GTVA 3K5IA 1NJ1A 1ISHA 3L5OA 4TMWA 3VOAA 2M98A 2ERXA 2BHNA 4WX2B 4AJLA 2NUBA 3ABIA 5JYCA 3USCS 2Y2VA 2NUPA 1IM8A 3MXOA 1TZBA 2BM9A 3Q6IA 1KDTA 1MOQA 1UMBA 1UBKS 1C0EA 1P39A 2YNMA 4X94A 3WL6A 1D1PA 4JLSA 4OGGA 3PBKA 3R5XA 5LYJA 1M5UA 2Y1FA 1Z2CA 1M0SA 3CXRA 3MGAA 2HHJA 2GCIA 5F1OA 5IM5A 1MJ5A 5AIBA 4OG2A 3OCXA 1D2MA 2WLTA 3VSEA 4NOJA 5AVJA 3TM4A 3EQZA 2FSVA 3KYJB 4XQCA 2OQ2A 5LUBA 2CUNA 1ELOA 3MRSA 4I2FA 2WAQF 3D6TB 3RJFA 2G88A 1ATIA 2PSHA 2JBAB 4ICAA 4AN1A 2AE1A 5FFFA 3AONB 2RB4A 2QLJA 1EX9A 1UMCB 5G4KB 4M8KA 1FL9A 2K5UA 4W8GA 3ZVKA 1EBFA 1NF2A 3KYDB 2GETA 4TTAA 4Y1RA 5AMXA 3FC4A 4AW9A 4JA2A 1L5YA 3T5CA 1WPRA 3I42A 2P9ZA 5BRNA 1T5BA 1F9EA 4J4BA 5BORA 1CERA 4OQEA 1GPYA 1RJDA 3K8QA 2RGCA 3SQNA 1M2OB 3AHIA 2I6XA 5GM1A 4DPLA 3ASYA 1O97C 3K9NA 5ENZA 2F43B 3QNMA 3QZ8A 2OB2A 1EDOA 2C2ZA 3QPVA 3E9DA 3C2LA 2EEPA 3OCVA 2M32A 4LY9A 3D7MA 4P7BA 5G53C 3TCNA 1NVEA 221PA 2NVOA 2R7AA 3E4CA 5DGXA 3AILA 2HCBA 5EJ9A 1K8YB 1WETA 3GGDA 3FTPA 1KO5A 2ZSUA 3FB1A 1Z3IX 4WFIA 5BYBA 1I7SB 4G2TA 2RK3A 1ITZA 1T2DA 2ZRFA 3SE0A 1CDEA 8ICFA 2IZ1A 1K6IA 1RS0A 1U11A 4C1NA 1PT7A 1XALA 5BNFA 1WPGA 2RHWA 2C97A 2DGDA 1ZCAA 1EVEA 3QFFA 4OJKA 1F4VA 4W9RA 4Y1EA 2G9RA 1IHXA 5SV2A 4EHBA 3VA7A 4UHFA 3WSTA 3TTYA 3VSBA 1QK3A 3MJVA 4BQEA 3C1OA 4PYJA 3LG2A 1TQDA 4QL3A 5FEUA 1JG6A 4IKEA 4R3NA 5FIUA 2B34A 3U1BA 4KG7A 1YXMA 2F64A 4LJ8A 5JPIA 4DCPA 3RFVA 2GPAA 3RF7A 3NBZC 1AU9A 4Z4HA 3FFBA 4Q4AB 1DRGA 4RANA 4RIGA 3LT1A 1NXTA 2QVZX 4B84A 2FPRA 2ZRNA 3BE4A 5A5VA 1I9CA 1XZDA 2MSKA 8ICEA 3ABSB 3HCNA 4OGFA 1ZA2A 4YJDA 3IJEB 3WGOA 4XUGB 3W7BA 1WXHA 1WXWA 3TACB 4XASA 1GXSB 4J3NA 3IUQA 3FGOA 3KO8A 3A0BU 3RUEA 3CSUA 3ETCA 3EZ7A 4MAAA 3RBEA 1J8DA 1EFUA 2WHXA 1D5WA 3DHYA 4IS7A 1MP0A 3LBAA 4Q4JB 5HILA 5THXA 4EB3A 4ZMBA 5EMKA 1DBSA 2OZVA 4AMYA 4D4MA 5CRXA 4CLOB 5LP6F 2ZSIA 2ASVA 3TJZA 1C50A 2ZTLA 2Q21A 2WEKA 3BIXA 4HDAA 4DEXA 5ILQA 4UHEA 4OKSA 4DV6B 1PIWA 3EVBA 4QEZA 5DNYB 3O75A 2BM0A 1A9OA 2PXIA 2AN1A 4RF2A 4X62B 1W0JA 3KV1A 5L6LB 4RU1A 2WMNB 4UJ3A 3WRXA 3DW3X 3OP4A 4YRQA 5J0PA 1R0WA 2VPIA 4HZGA 2KS6A 1TYDE 5KOHB 1J00A 1G20B 1TKDA 2OR3A 4S2EA 4AUNA 5IXJA 2PUCA 1DG3A 5CJ2A 3R7FA 2PBZA 1MO4A 1LLFA 2CKMA 4NM1A 3OFSA 2VTBA 1NK7A 1PGNA 2ZTEA 1YE3A 3W9YA 5EP2A 4AI6A 3H5IA 1IZZA 4J3JA 4Y30A 2QRMA 4F4UA 3CA8A 4PZ9A 4LZAA 4RV5A 4UREA 5IAOA 1Q91A 5GMOA 4BB0A 5KWIA 4ZAGA 1WF6A 4BPRA 4M9LA 3U9SA 4C80A 1NVFA 2G72A 4ND8A 5BSGA 1WHTA 3PR5B 1XZFA 2WSMA 2JGLA 4NR0A 4YQYA 1E3WB 1HGXA 4ZRMA 4B73A 3C2MA 5H70A 3NETA 2EIXA 1XHLA 2P3OA 4PNPA 4DSNA 1P81A 4A6XA 3L7IA 5KG0A 3SX0A 1ZQCA 5DYGA 4X64B 6NULA 4Z51A 1OZGA 3N0TA 4G81A 4OV6B 4E12A 1H05A 2C77A 4C0WA 5EJAA 2BGGA 3CRQA 3V8EA 4IH4A 4IG9A 4PHHA 4D81A 1AH2A 4W7HA 1JSXA 3LJKA 1J9EA 4O3RA 1FNMA 1S3IA 2H7CA 1E3EA 4YGYA 4PH5A 2XE8A 2C94A 2HYDA 2ZE7A 5P21A 4UD6A 1RI4A 3C8HA 4TQ9A 3L0OA 1NR5A 4BNWA 2RMKA 1ULUA 2HTFA 4WOKA 4JL6A 2BFAA 2C57A 3SKXA 4B9NA 3G5AA 1DKMA 2I6QA 1NJXA 4NCBA 5J2GA 1ORVA 1ZS9A 1T3NA 4GYJA 1I6WA 1JR3A 2NAFA 3OZGA 4UUAA 3TOZA 3V1NA 4MVJM 1KI9A 1LDGA 1JIVA 2AFHB 3DLAA 3EDQA 4YAKA 4OBBA 3Q2IA 3LCRA 4TL7A 3SC3A 3VDNB 3JAWA 2WY2D 1I0LA 2BR3A 4BWGA 4OLAA 1XWIA 2QRGA 3HCEA 1TVEA 1ARZA 5LPNA 4EJ6A 3COSA 5KZMB 5BSRA 4JOBA 5L3ZA 5JRJA 4CI9A 3ET4A 1I33A 2GEFA 3OQIB 2Q3HA 3PFBA 3JPSA 3U4IA 4KQFA 1L1QA 1QO0D 2E5FA 2A5FA 3RSFA 9MHTA 1E6KA 1E1RA 3QIVA 3FPFA 3PR1A 3SXPA 3TLMA 2WIDA 4MUBA 4OQXA 3QLUA 1S7CA 5CEJA 1A9QA 4ED6A 4YJFB 2TRSB 4LSZA 2W7OA 4DLPA 4HH0A 1AKNA 4QDTA 1ZR4A 1ZQXA 5I5GA 4I4LA 3UVEA 4UM7A 4WK6A 1L7MA 1ZJ4A 3GGGA 4AFNA 3M8RA 2PZBA 4RHYA 2R68A 4K4GA 5EIWA 1UKEA 2OLJA 2RBKA 2ZJ4A 2HRCA 3N6RA 1OCEA 3BFKA 3FZGA 4CTMA 5U9CA 1C0KA 3QFRA 2FSPA 1GGEA 3EEQA 4KK4A 5DHFA 7ICEA 3EJ6A 1NA5A 3C48A 1A1SA 2DF8A 3KLMX 4KQ1A 4N3BA 3JD1A 1H6BA 3T94A 2QI9C 4TUYA 1M6VB 1Z82A 2PJDA 4M99A 5KQMA 4ZREA 5THKA 3ANTA 5LP1A 5E4YA 2HCRA 4CGYA 2IIQA 4I66A 1N33B 2WUVA 3KQYA 3ZGOA 4WY5A 1J42A 4JS0A 1DO8A 4ZCRA 4C0QC 1E5DA 2NVUA 2XRMA 1DTWB 2CB9A 2FW9A 3G2HA 3OKPA 2KYRA 3I5MA 1Z83A 1X7WB 1YZFA 3LX4A 3FHLA 1ZHOA 1RLIA 3ACCA 2MU1A 5FR1A 4EDFA 1MKYA 3TK1A 5HMMA 4RKFA 3GF4A 3VO1A 1B3RA 5GZ1A 5IC4A 4KH0A 1H9BA 2AS0A 5ALUA 3GLIE 2BFCB 4WVLA 1WWVA 1JRPA 4DUPA 1KEWA 5CYOA 4ZI7B 4ZEVA 2ACVA 1QYCA 4CLEA 1DHTA 3QWFA 1TQ2A 2HCJB 3AOEA 4TMZA 3VVMA 4ZDIA 5J4LA 4LZJA 4E5DA 2NG1A 1RRKA 1VYTA 2YWCA 4RPGA 1BKSB 5C8XA 3SQXA 1MJGA 3BHNA 2B94A 2PEYA 4DXAA 4MPJA 3IKJA 3C3EA 2PUHA 3RKSA 1RPZA 3Q8KA 5DXJA 4CM8B 2GB4A 3P94A 2BGKA 1LZKA 2X7JA 5JISA 1SG6A 4UASA 1WCV1 1T9GS 4W6QA 2H8GA 4AQ7A 5A6SB 2WYHA 1ECGA 1T29A 2DFTA 3BXXA 2BDUA 1V6CA 1PEYA 3DMDA 1JI0A 3FVWA 4IDDA 1RXIA 1UM8A 3KOWA 3M4NA 1Q7CA 2W04A 3AX6A 2O14A 2QR5A 4GMGA 4N8SA 3BK7A 3C98A 1WULS 4JENA 3ZLJA 1I2MA 4CCAA 5C32A 3V4PB 4DQLA 4KQHA 5ALJA 3CVJA 2WD8A 2E8NA 2JJ8A 5A7HA 5DI3B 4QO7A 1G7RA 4Q19A 3UAZA 4B9SA 3QMWA 4EY7A 4RSHA 5C4GB 5AVSA 2VJMB 9ICTA 3VU3A 3RK4A 1V2HE 5KVQA 4G0PA 3D2NA 1TEHA 2FAXA 3V7WA 3MOSA 4M9HA 5CA0F 4B40A 3K73O 4CIYA 1OT3A 2XYPA 2ATVA 4G8BA 1C4OA 5AJXA 4DNOA 5CA1A 2QSJA 4FGLA 5LD2C 1CEYA 2GMWA 1LPPA 1M2FA 3DJFA 3LQQA 4ZPXA 1ZOPA 4NWIA 4KTVE 1XRQA 1AQLA 2P67A 4GX1A 3SJAA 4L76A 2IC5A 1JQEA 2V7GA 4K46A 2XICA 1L7NA 3DDHA 2BQRA 3Q7TA 4DNQA 3OCWA 2KJ8A 4KLDA 2Z1DA 1TJYA 3PW7A 3AESA 3EIOA 2G7MC 3LK7A 4R2WA 4UUOA 5E8JA 1CS0A 1U80A 1GT91 4G4GA 2HWWA 2W7TA 4Q9IA 1NVGA 1ZI6A 1H4TA 1L1EA 4JV0A 1Z5GA 3JZFA 1R64A 2ZBFA 3QA3E 4MYHA 4U02A 4Z0PA 1X14A 4C0JA 4ZYTA 2E8PA 3TTTA 3LM8A 4JFRA 3TSWA 2GN8A 4MEJA 3LGSA 3RVSA 2VIXA 4NLCA 3RB6A 2D3WA 4ND3A 4ZXFA 2KE5A 5SYAA 3ZUGA 2EZXA 3OOSA 4ALKA 1ZQTA 4EHJA 2CF5A 3B3JA 1BN7A 2EKLA 5EPUA 4ZK2A 5IARA 4JODA 3UJCA 5ICFA 4UOEA 4LF9B 2QLMA 1GNPA 1XVUA 4CU5A 4H7KA 1RXYA 2Y68A 4J0IA 4P3PA 2AWOA 1BOOA 3L6UA 1VHDA 4PTLA 5BWMA 1DQYA 1MW9X 2HQOA 1SA0B 1K4YA 3EZYA 2DT5A 1NXSA 2DUJA 3G2NA 2F3RA 5D51S 3REQA 3GMDA 3V5NA 4RQTA 5E6SB 1V5EA 1MB3A 1NMXA 1FA9A 1T8WA 2HEGA 4X85A 3LH5A 1VZ2A 3H9QA 3KQTA 1TZMA 1V48A 2W93A 1X7HA 1O1YA 3TGWA 5B5SA 4FWTA 5JO9A 1O4VA 2C2WA 3ZLBA 1EE2A 1R9NA 1Y4DE 3IP4B 1T6ZA 1M1YA 2ALZA 2PS0A 2X23A 2A7QA 2ZPTX 5IU6A 4DMLA 1VLZA 2X19A 2GR9A 3RBXA 2B7BA 1U3CA 2O23A 1XD9A 2DRIA 1JQ3A 1MX9A 1R4AA 3J80A 3L0IB 2DR0A 3TLZA 2PZAA 3EXHB 2Z1NA 3PI6A 1DI0A 4OYRA 3W5SA 2JJ2A 1PBTA 1WUIS 1POXA 1VLQA 2YN0A 2JDID 1N1MA 2WZQA 2ZRKA 1QV9A 2ZUVA 3EXIA 1A2QA 1L3VA 3ZKAA 2AOWA 4WLNA 1Z0KA 1E6CA 2B1GA 5B6JA 1DBVO 1P0FA 5BPCA 4RGYA 1IN5A 1S02A 2C7RA 2VAWA 3QY9A 3UAGA 1E7SA 1W4AA 4QGFA 5COBA 5ADUS 4TXHA 3OY7A 5F21A 5G1OA 2ADMA 2XD9A 4CQLA 2HJVA 2Z09A 2YFQA 4K9SA 3EIWA 3R24A 4EI7A 3COZA 4FOOA 4FW9A 5EJGA 2FJ0A 5IT5A 3KZIU 4DM3A 4K6KA 5CFPA 3AEUB 1P5FA 1L2TA 4NPAA 3R8FA 1W5BA 4XD7D 3UPUA 4RQAA 1G3RA 1RCTE 1YNOA 1CUJA 1Q0RA 3ANMA 3BGWA 4P84A 3ZCXA 3I2HA 4UZEA 5CW2A 1U48A 1ODLA 3HT3A 4ZT5A 4J07A 4YXFA 2N46A 3STTA 4OYHA 4R1SA 1X38A 3WK8A 1VI5A 5K0GA 4J2HA 1FUUA 4YBRA 2ZS9A 4MWTA 3T4PA 3OH8A 4EY3A 1QTNA 1WB4A 4GC5A 1QFJA 3ANXA 5MF6A 3HB0A 2WUFA 3RU7A 3ENKA 4GLLA 4RPZA 1GLVA 4HPJB 3LLVA 1KS9A 3AJAA 4P7GA 2OOKA 4QOSA 5HCIA 3WRYC 2IYXA 4IRKA 2A9OA 3F9CA 4R1PA 5EJFA 5KFZA 3KLOA 2FUCA 3ZN2A 8OHMA 4MCAA 1ZQUA 4REQA 1KETA 2Q8NA 1SBNE 1FNNA 4P53A 4KPUB 1W36B 3NVZA 2I5HA 1C4WA 9ICGA 1SHLA 1U6KA 3C4JA 3U4QA 4DFDA 1NU6A 2OO5C 3AERA 3SYKA 3DB2A 1W5SA 3HJNA 4MUAA 5M29A 5AKEA 4RK1A 3CZMA 4UBNA 4HEJA 1PSDA 4AYTA 1IOWA 1KYQA 3QUAA 5A6SA 1F0KA 1MQ9A 5EJ8A 5KAPA 2ROQA 3T5GA 3T3DA 3AU9A 2AKEA 2BFPA 1EWVA 3IA2A 5BN5A 3K6SA 3PHLA 3U1TA 4IWNA 4L4YA 1Z26A 1M2VA 2PD4A 3A9RA 4I9FA 4PCAA 4YCXA 5AHXA 1PJZA 1UP6A 2VBCA 4O8CA 3RRBA 5IUJC 4Q7KA 2H3HA 1H0KA 4WZBA 5BWBA 2UYHA 3PO5A 2D2FA 2WHQA 4NBRA 3VR6A 2XDYA 1NQXA 4D4HA 2PK3A 2PQ2A 1T6NA 1N2CA 2C3MA 1LNSA 1IHYA 1T43A 1JFLA 2CXNA 3ZJUA 1XKTA 4HN4B 1HDXA 1ZH0A 4F3NA 2CCGA 3TWOA 1GKKA 3DVQX 4N5DA 4WLEA 3KSBC 2XHZA 1Y0BA 2E89A 3S8YA 4K7JA 1Z5NA 4OXRA 2PXXA 1A9PA 2EX4A 2XNDD 3K2IA 1GLNA 2OCKA 1JQBA 4BMZA 4KGZA 1Q92A 2GPBA 3UGKA 2VOJA 3PD1A 2WJGA 1GNRA 1SR8A 3IUPA 1UK7A 3FIUA 4FCCA 2JCSA 2FQWA 5COQA 3B0YA 3D3KA 2OFPA 2GAOA 2WAOA 4RC9A 1LC0A 5ALRA 1M34A 3IELA 3VDRA 1GTSA 2HBKA 4DSEA 1JDTA 1WCXA 2QM0A 3GJ7A 4L8WB 2FG6C 3X1WA 1W5AA 2P8SA 3BXEA 2GEJA 4RK6A 3QFCA 3DMGA 2OH2A 1SCIA 4M0PA 1KY4A 4YT5A 1DKPA 5DYIA 5JAPA 3W5DA 2BFDA 1GCOA 4YMWA 2AHOA 1AK2A 2IPMA 2JGFA 3O4FA 2IPNA 1WY7A 3R5SA 4NZ9A 2LDBA 1RJ9B 3I05A 3CNQS 5CVJA 5CHYA 3EXIB 3DKKA 1SC1A 1KRHA 1NBOA 1SXJA 3UQ0A 4MGYR 2IH5A 1ZESA 2P3LA 4KU4A 4WV3A 1TGVA 3CF2A 3TBHA 1A8SA 2PLRA 1FFUA 5CFLA 1F8XA 4XDYA 2QRJA 5FOXA 4R1MA 1SXJE 4E5VA 1ISMA 3I2KA 3CY6A 3GYBA 3O6VA 5C0OE 3GIWA 5BYKA 5HQ3B 3PK0A 5AVQA 1IXSB 4HDNA 1WLYA 3W6UA 3HP1A 1T1SA 1R5NA 2BUBA 3QYFA 1ZISA 2R87A 2W2MA 3PUJA 3T7TA 3UPTA 1RZRD 4DYHA 3AVUA 4QGHA 4H0CA 2BHSA 4YQEA 5K5EA 3JSAA 3VXKA 2RCYA 3A6JA 4D56A 4F2RA 4G9EA 4F50A 2AOUA 4AO8A 3G9ZA 4I50A 3K6RA 1ZUNB 3P97A 3LXRA 3V2UA 5CR0A 1OAOC 3PL5A 3D2QA 3WHLA 1L5MA 1UQUA 4PINA 3ER8A 1S4QA 1RJGA 1OU0A 3M8KA 3OX2A 2WHEA 3HU5A 5KFOA 1IUPA 1MR3F 1ZK0A 2BIFA 3DZBA 3QOYA 4FNGA 3IEPA 2NU7B 3O84A 4V0OA 3MR6A 1J8VA 2FGJA 4J94A 5GGXA 3M6XA 2EERA 4DXHA 5KYXA 1N2CE 1NATA 3EY4A 3BQTA 1F5SA 4NJOA 4EUSA 5KPJA 1LC3A 5JQGF 1JHAA 5JOQA 5FI5A 1J2RA 4B3BA 1U3DA 2XIJA 4PGFA 5ICMA 2R6CA 4BFCA 2HSWA 4YRGA 3U26A 1NAIA 4XUEA 1R15A 5FR2A 3O92A 5DQGA 1F2DA 3C5WP 4WW0A 3MSXA 3A05A 4B35A 4A2WA 1DAMA 2REQA 4F38A 2JBAA 3MBIA 4XPIB 1B8OA 4G3XA 3GI1A 2BJHA 3A9VA 3CT4A 4UNIA 2I78A 3T7RA 4OL9A 1NXVA 4RULA 1QIFA 3M89A 3U81A 2OILA 3SIWA 2O0LA 3EMVA 4FJ1A 3A1WA 2C5LA 2XYHA 5KTRA 1L8QA 5KG1A 3PNQA 2V4MA 4NARA 3QTBA 3II6X 4R4JA 4BVEA 2PN1A 4ED7A 3KYIB 5CR9A 4YMIA 3M1IA 4BYGA 1MHPA 1P7VA 3PRYA 1EQAA 3NFRA 4ONEA 3RVOA 3OQMA 3W5AA 2PUFA 2ZJ8A 1CETA 3PD7A 4D0RA 2FWPA 3FZEA 5FRDA 1KW4A 3EDOA 1EK6A 2NXCA 4HO1X 1FP2A 4NL4H 1UFOA 1P9WA 2DTDA 3PI7A 4TGLA 2GSWA 1ORIA 3I6IA 2AK2A 3MJEA 1IMOA 1OI7A 1JIJA 1CY6A 1SMKA 5KFRA 2P9YA 4L0CA 4RA6A 3QHPA 1P45A 1JSZA 1YDGA 1VMKA 2VF5X 3PY8A 3IUMA 4O2BF 5BWNA 3E2EA 2G80A 2FHPA 5TGZA 5K45A 4B9LA 4YR0A 1DKOA 1KOJA 2P9BA 1G6OA 2HMUA 2QR2A 2BZ0A 2RHCA 3OJ0A 3QNWA 1R4MB 1YS4A 4K9DA 3H5AA 2BR0A 4FIDA 3P0IA 4HVCA 1KNXA 4PSKA 2SKDA 3DQPA 1NL3A 4Z54A 1GN9A 2CFOA 3C16C 3NTXA 2HHTA 4K40A 2ZBPA 4I2IA 3MUOA 4AMGA 1GGFA 2X8JA 2YVKA 4YP5A 2JGNA 1N1GA 4WKPA 2HW8A 2XO7A 1ZOIA 1JMKC 2JBWA 5H68A 1VCMA 1YULA 3RANA 8ICKA 2H54A 4HMQA 5DBGA 5I9MA 2F8SA 3CLVA 3Q6MA 3KKMA 2FK7A 1P6QA 2DHEA 1B6TA 5E9JA 3R7WA 2FMSA 1YR9A 2QJRA 2V7BA 3DLHA 2YFHA 1H69A 1G59A 1TQ8A 4MPTA 2FPPB 3S1AB 2B9EA 1WB6A 4C01A 4DN6A 2JHFA 4IVQA 4ZYYA 1IZ9A 1L3SA 2KBFA 1B2LA 3AVOA 4IAOA 2APJA 2KV2A 4IMJB 3PKIA 2HBJA 3PUVA 2A5LA 4G36A 4B85A 3RODA 4O33A 5CD9A 3PXBA 3WP0A 4YXWD 1OH8A 2XIDA 3AM5A 4CUJA 1AGRA 1DFIA 3GZFA 2FOIA 2SCUB 1O8BA 2QM7A 2RGBA 1XVLA 4H1VA 2CJYA 3I5YA 1Q0PA 1MQ8B 3MZ0A 2XE4A 5IAGA 4FFBB 4G65A 2LD4A 5B37A 1LJ8A 2CPRA 1IJEA 1QK4A 1X1BA 4KO3S 1XFDA 4PAGA 8ABPA 4JI7B 4LEIA 3F2VA 1IB0A 4GPD1 4HN2A 3SQIA 1NK9A 1N4AA 2FW6A 3WFJA 10MHA 1TC1A 4BU1A 1VBNA 3WKAA 1SC6A 4YUVA 2QB1A 4CG3A 3IVMA 4URZR 3LYSA 2NAPA 2F1OA 3VI4B 1ECLA 4CR8A 1SZHA 1VP3A 2YWGA 5ELXA 5H8WA 5C35A 1S6YA 3F5SA 1MZPA 4Z8XA 5E1DA 2XY7A 1VIAA 3P9SA 3IB6A 1KMQA 4QQ8A 1RMYA 3FYUA 4HX9A 3LLSA 3ODPA 4UUPA 4BL5A 3C2QA 4L74A 5C5CA 1RPTA 2VT3A 4AO7A 3PC3A 2ABWA 2ORIA 4XYLA 3ITDA 4OGLA 1CEEA 4AX8A 2JAWA 4RK4A 2X41A 4YS6A 2UZ1B 5MFPA 3UO8B 1NF9A 1N3BA 4ITVA 4YC7A 2G76A 2O6LA 4JEUA 3T3NA 3R6TA 5HS6A 3KKAA 3MTQA 3WNZA 1FP1D 1JHYA 3V2HA 5KIAA 4RPIA 3QI2A 4REMA 1V4BA 4LXYA 1ABFA 3VZBA 3HPOA 3G6XA 3N2IA 2NRXA 1N92A 1U1DA 2AC4A 2I3AA 2IA6A 2O2HA 3IXQA 2CNLA 4G4JA 1NTRA 1UBHS 4MI9A 4OAPA 5H3HA 1I24A 3VHRA 2GHIA 2HK9A 1MH1A 4CV0A 2FI1A 5GONA 5KYTA 3A1NA 3P0EA 2H06A 3HPRA 2QWXA 2VSNA 2GFHA 2Q5IA 4LCJA 4S1PA 5ARCA 1XI2A 1AUPA 1ZQ9A 4R6WA 3IHLA 4OQPA 3OQVA 1A82A 2A5JA 1QC5B 3P32A 2Z95A 3WWOA 4KXNA 1T2NA 3M6UA 1O77A 2OV3A 3HGMA 2DBQA 3PVCA 1ESDA 3WLQA 2YJ6A 4PRYA 5E3HA 1Q6ZA 4FSHA 4OLHA 4ZOHC 1G5FA 2I6UA 3DZGA 2R4UA 2EDCA 4I2AA 3DFKA 1SUWA 2PGNA 3MINB 2H9YA 2VHWA 3CJTA 1VXOA 3ELYA 1ONOA 4MVJD 4TKLA 2B7LA 4DKJA 1QG2A 5F9LA 4KSYA 4XDGA 3WWYA 1DIRA 3CRW1 1TIKA 1L7QA 3EXHA 4M1SA 1JDSA 4B34A 1C7EA 1IEQA 4HNSA 1TO6A 2ZUTA 4QZEA 4HV4A 4F97A 3Q1KA 4OHCA 4W5OA 2FQ1A 2REXB 4MS1A 3P2OA 1H9AA 5DBOA 1OI4A 1XELA 2P4SA 1J97A 4AN0A 5LXTF 2PMKA 3K0SA 1FS4A 1NHGA 1YIDA 2VTDA 2FJUA 3IAUA 1UQTA 1OLXA 2YFYA 5LVAA 3L4KA 4QC2A 1T2CA 4MZXA 2Z43A 3FUTA 1AKRA 1I4LD 3BSYA 4N54A 4WK2B 1QP0A 3ACDA 4TM8A 1JDUA 5CB4B 4X84A 4PYQA 3V9AA 2J08A 5DM70 5EIBC 5BV8A 3KUKA 2CXSA 4WINA 4R41A 4U63A 4WBNA 4S05A 1I3KA 3WLLA 2AXEA 5ALSA 3N74A 2CJWA 2NO6A 4X7RA 1C0LA 4B80A 3LZCA 4LWOA 2K4EA 2R6GA 3BJRA 2G83A 3DA8A 1C8BA 2DSTA 4CKEA 4KX5A 5B2EA 2ZPAA 4KR0A 5FOSA 3UAVA 4R0NA 1SQ0A 4C3UA 3TFWA 4MEXA 1XTRA 2QN8A 5E2AA 1NSFA 4BMDA 3K09A 1NX9A 3DDSA 3VH2A 3C1YA 4BLVA 4DA4A 1SUFA 2YJ4A 1X1RA 2GTHA 5DNDA 1SH7A 2HIGA 4LKOA 3CLUC 1M34B 5FH9A 1WS6A 3DLIA 3HVJA 1BS1A 3QYJA 4UXIA 4C22A 5J1SB 1LPSA 3I64A 1MO2A 1W7AA 2MSLA 3DCJA 4HTAA 1W2HA 4ACAA 5I01A 1TEVA 3AW8A 3TQ1A 5EJ5A 4DB4A 4E07A 1M2EA 5KUTA 5KSOA 1OWOA 2PKCA 4MLPA 5AW6A 3W7VA 2GJAA 2QTHA 3TB6A 4E1VA 3OF5A 4K9NA 4BB5A 3RAFC 1QLNA 2WK1A 4KDEA 3A1DA 4BNMA 3RVPA 5K3OA 3AU8A 5JIBA 2DJ5A 3CKYA 3GEPA 2QD1A 3PSFA 3JQ7A 4OU4A 2R79A 1E96A 2FFQA 2W2TA 5CJ7A 3RS9A 5KVCA 2C3OA 4AQYB 1NG9A 5ICCA 2ZU6A 4C0ZA 3EVAA 5LWQA 3CU5A 3VPXA 2VKQA 3MK31 3GJZA 1SVSA 2Q6LA 4FQ5A 5HZHA 1Z8HA 1MPTA 1OPRA 2PA3A 2VDUE 4Q01A 3WQBA 2ZTHA 1VE6A 1M73E 3IOCA 3AFOA 1P8JA 3RYHB 3UV3A 1CYEA 1COWA 3LKZA 1DK3A 3GPIA 3H0KA 3G2PA 3WIUA 5JZMA 3GJ3A 1GL3A 2FG7C 3GLIA 2I22A 3Q9LA 2VRCA 1CVIA 3PYMA 2IH4A 1SBIA 5EWFA 2ODEA 4A26A 2D00A 1M2OA 4EEXA 2EC5A 2XODA 5D3QA 3VU0A 1XG5A 5D1HA 2LVBA 3KJQA 4PX3A 3CNNA 3B5JA 5IMSA 2V7WA 1S3FA 4GEKA 2YV5A 4PZCA 2ZBRA 3DT8A 2OC9A 2W00A 3DOJA 4JI1B 1V6SA 2HJHA 3S44A 4ERXA 1N2BA 2WD7B 1DDGA 5CDSA 3AQ4A 4MGZR 1QLWA 7ICQA 3AIMA 3R3UA 4RKQA 1PFKA 5T4HA 1QH8B 2VF7A 4HZUB 3CH7A 5JG7A 1N61A 1U4BA 1JZTA 2VCEA 1XQ9A 5COAA 3PXGA 1AB5A 2JAHA 1B8NA 3KKLA 1PS8A 5JYBA 4BYMA 3AWDA 3DZCA 5ILOA 1U0JA 3V8BA 5AK5A 2WVGA 3GJ4A 3DQZA 4LRYA 3CLSD 2HRDA 4C3VA 4DRYA 1NR1A 2RLTA 2R8HA 2R8YA 3LNCA 4DDVA 5HYVA 1V7QA 2EFHB 3JWPA 2P78A 2A5GA 3D1JA 2P0EA 4AJ9A 4JWNA 2FPOA 1P9RA 1N6KA 2XITA 1G1MA 1YUMA 3DO5A 3VDXA 5GV7A 4C0LA 2VP5A 3GWGA 2X0DA 4NIMA 4XLZA 1NYRA 4MW9A 2BMFA 1NVTA 5IBPA 3HVUA 2OQRA 1PSWA 4KLAA 5A04A 3N3BC 2ZAOA 5I8ZA 1CD5A 3DE5X 2FP3A 3D3WB 4PSDA 1DUSA 3E3OA 2EKDA 1TA0A 2MU2A 1U2QA 1YZVA 4Y2JA 1J7JA 2J9RA 2JFVA 1S5LU 3NR2A 1BCRB 2XYVA 7ICOA 4NBVA 1ZH8A 4UUNA 5A71A 1CQJA 4HMOA 3F67A 3NTRA 3NC4A 2BCEA 4X8HA 2G9NA 3IYLW 3RR7A 4AZWA 2AFVA 1UT6A 2HZ7A 2JDIA 1MAVA 4HQFA 3THXB 3G2QA 4UATA 4ASUA 4BJ3A 7ABPA 1K7FB 3K92A 1NZBA 3FMOB 2E4ZA 2O3TA 2G9UA 4O1IA 2F55A 1YF3A 4UCWA 1MENA 1WD7A 1N5RA 2VT2A 4C21A 1T1JA 1ZP6A 5AKLA 2PT7A 1JR3E 2DLCX 3CRVA 3JQPA 1PR5A 1R0LA 4RORA 2C7OA 2K7ZA 1CIJA 1T8UA 1V1MB 4AULA 2KEYA 1I4TD 5BW8A 3F71A 1DGSA 1P7CA 4K9OA 4NV0A 1YJ8A 4GM1A 2IVZA 3VNSA 1FW6A 3WAGA 1GNSA 4A2PA 2C7VA 2QJWA 3GJ0A 3KSDO 4B46A 5FBLB 2DHCA 4E15A 3T52A 2GZHA 3GJRA 3AFNA 3CZAA 5I5EA 5KOJA 3HCPA 1B73A 2P2YA 2ZJFA 5CAEB 1EIWA 2QSYA 4RIIA 3VKGA 2ZRIA 4BAZA 5CCXA 2DEUA 1XCGB 4YMSA 1GKLA 1RCFA 3D2AA 4DBLC 3CG0A 1PK1A 2OGSA 4ZCPA 3BXPA 2BKUA 8ICXA 3KT6A 1XDUA 5KYVA 3CO5A 1FLDA 4IZ6A 1PL0A 3P27A 2P5SA 1ENOA 1XXHA 2NIPA 2XOEA 1YCFA 3GV5B 2BFNA 3ICVA 4W9NA 2A3VA 3SF8B 5EHXA 5M34A 5HPYB 1K7EB 4CUKA 3RPEA 5IAJA 4DIOA 1SCUA 2QX6A 2VXBA 1DRWA 1QXSA 3AYZB 3RAGA 2C7GA 3L0SA 2O1WA 3QXHA 2D1RA 1IJBA 3R0XA 5KX5A 1T4CB 1X19A 3TSCA 3OKAA 4KVZA 3QRWA 3C97A 4COOA 1PDOA 2IZ7A 3KAJA 5IJXA 4PN7A 2AXQA 3VJRA 4Q9LA 2FNAA 3L41A 3K1TA 4ELTA 2MJLA 4L4RA 1XA0A 1HDCA 1YJ5A 3JQFC 5AVVA 1LX7A 3FZQA 3MM4A 1BS9A 4JC0A 4C7OA 1E2UA 3UUEA 4ZFNA 3EZFA 4JV2A 3V8QA 1K8XB 1DINA 2MSCB 1CS4C 4XYGA 3R5FA 2J0UA 1X8KA 2EQAA 2ZXHA 3IMFA 2NSJA 3LXXA 5M04A 1M76A 1NNSA 4MITA 2PMDA 2Y66A 3P9PA 5L45A 2DETA 1F48A 1TT5B 3NONA 4JL8A 3W5IA 4G0NA 3UEOA 3PXAA 2JK0A 3FPAA 2Y1OA 5GJCA 2MT9A 2QD4A 2W4IA 3AP2A 4KLSA 4TTRA 4C78A 4DA0A 1MPXA 1IONA 2D8CA 1GADO 1THGA 3VR4A 4QJ3A 5BMVB 1YJBA 5I47A 1U5BA 2YMPA 1SV4A 1NUPA 4O4IA 5FYDA 3IQHX 5K3CA 2HXYA 3F9IA 4P3YA 3AJEA 1W87A 2JKYA 2RH5A 4GR9A 1M2NA 3CN9A 4F60A 1V8BA 3LBHA 4R01A 1J1UA 2NP7A 1SVLA 4CKWA 3FLEA 4ENUA 4IVPA 4E4RA 1R0RE 4L1KA 4P6VF 2KSQA 4YMMA 3PW4A 1LTKA 1TFUA 1MNAA 1SOWA 3DE3X 3A6PC 3K75D 2VS1A 1E9VA 1L6RA 4YRAA 1O08A 3QVKA 1WV1A 1D6JA 4BVHA 3A4YA 4N6GA 3SXUB 2C22A 2PKEA 1CIVA 1RWPA 5JNRA 3Q7RA 4LKRA 4QT4A 4CVNA 3HFSA 4L57A 4U3JB 4DJJA 2NLOA 4I55F 2C8LA 3A1EA 1O6GA 2P41A 5D01A 3RRHA 1XRPA 2GZ3A 4PXAA 2VO1A 1EZZA 1T6BY 1K88A 3QE0A 3DKPA 1PF7E 3INGA 4TMKA 3EZGA 1THMA 1WKCA 3RAQA 2LIPA 3DEFA 3TJRA 3X43A 4OB8A 4ZYUA 1NULA 4RJJA 1Q15A 4PN3A 2W9AA 5CFMA 4MMZB 5EYPA 5CD1A 1V5GA 4ARIA 3VV2A 3ZCTA 2IOFK 5HR6A 3EQ9A 1EFRA 1STOA 3FRJA 4JEMA 2Q41A 4BASA 4Y7DA 1SHKA 4YRPA 2O48X 5JXHA 4UDOA 3H8WA 1LRLA 3SX4A 2NRZA 4Z9BA 2QMYA 1TX4B 1PT6A 2D1FA 3OIDA 3KHGA 3RVNA 4G0VA 1JHDA 3HJRA 4A8TA 3W4IA 2GO1A 2OAEA 3QELB 4P7KA 4TUSA 2EYUA 1AZWA 2YXDA 3TI9A 5JADA 5L7TA 1JRLA 2JD0A 1B2RA 1DKRA 1JG4A 1E1QD 2QTBA 3B2EA 3PNPA 3ZU5A 4BMXA 5E4TA 5J5CA 3DC7A 1GTL1 1GITA 1QBGA 1GPH1 3DP7A 3E18A 3DBHA 3H5VA 3K9BA 4YMGA 1ZCZA 3PD0A 3I9JA 3UUGA 5KFKA 3EVCA 5I7UA 3N0XA 5MHTA 3D0RA 5B64A 1US8B 1DC3A 1Z2PX 4F9FA 1L3CA 5HZMA 4BXOB 1E60A 3OPQA 4HUQA 3G5UA 4CFZA 5KWSA 1U7WA 1TC2A 3T61A 3VBCA 4F91B 4I1OA 2QMOA 3DE4X 5IBQA 2DXIA 5C46F 2GWRA 3RS0A 1EFHA 5FX2A 2Z57A 3ZHXA 1P1HA 4QTXA 2HCFA 3FAKA 5AOAA 1KORA 1UMCA 5G4KA 1Z8NA 3VOSA 4GP6A 2FFRA 3WYDA 1NY5A 3SDZA 2VSFA 2PYIA 1I3LA 1DVRA 2JH8A 4EMBA 3MLEA 1ZJJA 3CUWA 1HE3A 5AOBA 1K7CA 1N7IA 1BEUB 4B9UA 4JXJA 2WFZA 3H4VA 1IATA 4XM1A 2VAMA 1XZLA 1EWTA 1NUAA 3UT5A 4AROA 4M46A 1MXHA 4RKWA 1F17A 2IXTA 2R47A 2RGUA 3CV3A 5AUQA 1F2TA 5FHRA 4ENWA 5DVZA 4L5JA 3RGGA 3KTFA 1DKLA 3ASUA 1LXCA 1IC6A 2VEDA 3JALB 3ZX4A 3RTAA 5LD2B 1E0AA 3CPHA 1GO2A 4V3CA 4DVGA 2WV9A 1E0SA 1ZQFA 3SXUA 2WVJA 4INJA 3SLRA 3EISA 3OZRA 3E48A 4CLXA 2H1CA 4PGMA 2Q7DA 1N8KA 4KFTA 2J6IA 4Z4FA 4LSGA 1ATZA 5CITA 2GEBA 3GVPA 3ST7A 3DKRA 1HTWA 2XC9A 1ZQEA 1KAOA 5CURA 1TU4A 3PX2A 3AFIA 4ZV4A 1AGYA 3IPRA 4C14A 5BSWA 4QHSA 4PF1A 3F96A 2ZI9A 4AF6A 1Q3VA 4DR4B 3TMKA 3NANA 3BMOB 3PLRA 3NC1C 2ZJYA 3OC0A 1S0MA 2H4ZA 4R9UC 3PWTA 2P75A 1QKJA 2VYFA 4DS5A 3A36A 1OROA 2GKGA 2RKOA 5DGCA 2MCFA 3ZK7A 5AK3A 4LY3A 5ESDA 3BC1A 5FO1A 1L7DA 2Q49A 3E7DA 5HQ3A 3RVBA 2R65A 4A5SA 5F9HA 4ICIA 3RS8A 1XNGA 2QW8A 4YREA 1V45E 3MJSA 1BAPA 2QBYB 2XGQA 5AI9A 5H7XA 1T15A 2XF2A 1UOPA 3JPPA 2ZTUA 5CGQB 1QJ4A 4P4SB 4CM8A 4UBCA 4N7MA 5DE3A 4ESOA 2IBMA 1NP6A 1NJSA 1ILEA 3EAQA 2Y6UA 1EFDN 3E8MA 1EX6A 2FF7A 5KFJA 2WB2A 3X3HA 1DTSA 4IYJA 4BZPA 3H9UA 1KAGA 3C74A 3ZZMA 5ALTA 3TZEA 4JP5A 4D3DA 6YASA 1HSOA 4L50A 3JQ9C 4AY3A 4FVTA 5KFCA 2WSBA 1HDEA 1RBYA 2DM6A 2VATA 4Y9UA 3URKA 1U0EA 5DB8A 1GQRA 1MX1A 2B6HA 2EKZA 3QFSA 1CQXA 3H83A 1D2AA 1VG8A 3KZVA 4L8FA 1H0RA 3Q15C 1S76D 1O94D 2WYOA 4PLWA 5CDYA 3SEIA 1QTMA 2J5QA 3B6EA 5F52A 4L4SA 2H2GA 3SSAA 3QBTA 5IDYA 4NL9A 3KJGA 3TW8B 4TL9A 4E31A 1UP7A 3AXSA 3U60B 1OAOA 3NP7A 2XGSA 3TR0A 2HN9A 3B1ZA 3L46A 3AFGA 4ZOQI 4TV8B 1GN8A 4XM0A 1ZVVA 4M60A 3W9UA 3WU2U 5BMVF 1KZ6A 1QR6A 1ECBA 1FYEA 3GLVA 4OMUA 3LHKA 4QOJA 3V4ZA 2BBSA 4HGQA 1YGYA 2HHLA 4DV7B 1X1TA 1N62A 3RU3A 1KYYA 5LA6B 3SU8A 2WILA 3UFXA 1MT3A 4ZYXA 3RM3A 2DH5A 1T8TA 2GBFA 5FPQA 3HP7A 4NL9C 3HP6A 1VE9A 4JX9A 3K7EA 3SZGA 3F2CA 3FVRA 3CVUA 5CWRA 4JGIA 4UNSA 4E94A 4JUZA 4Y9TA 4DF8A 3BF7A 4DF3A 1QVWA 1Y9ZA 2PV0A 2Y2UA 4HH4A 3M4YA 4IHJB 3DBRB 5F7ZA 3ESAA 1N5IA 2VK1A 3L5KA 2ZAIA 2PZKA 2QV0A 4B9AA 2O8EB 1IIBA 4WXRA 1CZLA 2F43A 1T3SA 2JAQA 4PY2A 3VU1A 3C6YA 1XMXA 2DULA 3GO4A 4ND5A 1UL1X 1E63A 3M6AA 3IBSA 4ZRNA 2Q0HA 3T1VA 3LIPA 1WMFA 4RTJA 4UHKA 1Q1QA 3DAFA 3GLSA 4QODA 2LE0A 3DLBA 4Z6FA 4EYIB 1OLUA 1ZNWA 2AXNA 3P8ZA 3R3SA 2EW8A 3ZE0B 3RH5A 1WB5A 1KXZA 2VDKB 2V7QD 5I9TA 3SC2B 3VKVA 2AQKA 4CM5A 3PPWA 4M49A 3A9TA 4DW8A 1H3FA 2CWWA 1V97A 1IM2A 2I1VB 1TW3A 2OORC 7ICKA 1VQ1A 2H2FA 3UCXA 3ZD9A 4DDUA 3PJEA 4RTSA 2KOBA 2AEJA 2X1HA 1N60A 4D42A 3RYFB 1LNZA 2PBLA 4HTFA 4LMAA 5PNTA 1U7HA 1PW7A 1J5XA 1IDOA 2J3KA 2O2YA 2P9FA 1AM4D 2QU8A 1TYCA 2VUHB 3EVTA 4NPHA 4Q1BA 3U49A 2FU5C 4Y2XA 1GQSA 1UKYA 4HL6A 1NJ2A 4QWAA 5FBRB 3S40A 2R6R1 4X41A 1XCBA 1IN1A 1PEKE 1U0HC 3O7MA 1V5IA 3QVGB 4DM4A 3FPGA 1A5TA 1IUKA 4WXEA 1U98A 5B1SA 3RFUA 3U31A 4E2WA 1SN7A 1Z7GA 3RQSA 1R6AA 3EGWA 4PNHA 2QZZA 4F7WA 1N57A 5B7NA 1MU0A 1UDXA 1OWPA 2LMRA 4X6UA 2WOOA 3I37X 2WF6A 5ULLA 2F8TA 2PFKA 5EKTA 2C9BA 4FP9A 1J9GA 5J4HA 2BKVA 3OU6A 3GLFB 2R18A 2OHHA 3E5RA 1P77A 3MELA 3OIGA 2LM4A 4JELA 1HUZA 1DHRA 2M1ZA 4ZYZA 3M3DA 2W8ZA 4M1WA 2Q3MA 4QFDA 5BV1A 2YICA 1KGSA 5DLPA 2JIZD 4V38A 1UMDA 1TMOA 4U2GA 4UU1A 1BXRB 1KYIA 4QW9A 1HT0A 1TVAA 4MRRA 3AM4A 4PHEA 1KXJA 4MR7A 1JI7A 3TLXA 3W1EA 4Y6SA 4D4LA 2ODNA 1AV7A 5HXAA 4E5UA 3C3MA 4QGGA 3VYRB 1IUNA 5JYEA 2VP0A 3S1LA 3ISJA 4PO3X 4X44A 4RHCA 2DQYA 1XN1A 2WW8A 4GMFA 4GRAA 4BGDA 4M1EA 1PS9A 4X97A 2ZXFA 4DNXA 2CE2X 4R2LA 5KPDA 2CLSA 1XAJA 3AI3A 1YA8A 3ENWA 4IIXA 5HP4A 5KG7A 2F1KA 2XUGA 4LDPA 4O5OA 5DWQA 1MUUA 5TEWA 4XJSA 2DVMA 2OHOA 3T5BA 1C9YA 4YRSA 2B5VA 5DNAA 3SYTA 1Q95A 1NOMA 3C85A 2C4WA 4MIOA 1W48A 3OM0A 2XB4A 2CJXA 4OHRA 1WCNA 2CDCA 5IF9A 4EG7A 3L1IA 4X00A 3SHFA 4QQNA 1OH5A 1G16A 5L1IA 3W5JA 1RQGA 1JQAA 1YK1A 2XY5A 5C52B 3LV8A 4KO1S 1BWPA 4TLEA 1VOTA 2Y1KA 3CWQA 5AOCA 4EG8A 5EJ2A 4DCOA 5LZ7A 2QZSA 4QDJA 2W0SA 1L3BA 3D6UA 1KFCB 3DYVA 4TWBA 2G0AA 1LK5A 3E9ZA 1HG0A 4RF3A 4BNFA 1AG9A 1KMMA 4DSKA 3CC8A 5JI2E 5K2MA 3SMQA 3S2SA 2IHVA 1M74A 1NXQA 4CM4B 2Q5FA 4TQGA 2O8BA 1EHIA 3OA0A 3VVLA 3TQFA 3WLRA 4C20A 5CLFA 1P3DA 1C30A 3S27A 1PWXA 4MROA 1IE3A 2PWYA 3TI7A 2YVUA 3TBFA 3EB9A 5FWXA 4BIMA 2OV6A 4BGVA 5KQRA 3TQSA 1DOQA 5JWRA 4RZXA 1M33A 4M8NE 1WXGA 3DKIA 3LA8A 4I27A 3NO4A 1P73A 2O20A 1WW2A 2J59A 3ZQ6A 1D0SA 5IKMA 3LX5A 1Q0SA 2AZTA 5HK8A 3T7EA 1CQIB 4O5EA 2NO1A 4UEQA 4NE2A 4RTKA 3A28A 4WKGA 4RV9A 3B1JA 4D96A 3FSEA 4NCKA 1NWCA 3WA7A 2B25A 2WAXA 5IW8A 1GPBA 1U1EA 4IQUA 3ZVRA 2LHTA 1IBLB 1NFQA 5KNBD 4F1KA 5CLGA 3AM9A 1TPYA 1ZUWA 3PEEA 4CMGA 1VMEA 3JRWA 1TM4E 4PO9A 3T35A 2IUTA 3K94A 1E2MA 1SKQA 2V9PA 4K26A 5D84A 3FE2A 4FTWA 4F9GA 3HCOA 1EWRA 4PGGA 1L5GB 3U4MA 1I2ZA 4QYSA 5EJ4A 3R9KA 3R23A 5AVTA 1HX7A 3FNBA 1IK4A 4G41A 3HB4X 4DNFA 1E3SA 4IICA 2ATLA 3OPYI 1GY8A 1P5JA 5FPYA 5LB4A 3T7AA 2J6BA 3A6EA 1ABBA 4X66B 1XJQA 2NYRA 1OBOA 4PGYA 1RLUA 3SXJA 1U3FA 2Q07A 1YQDA 2IYUA 2O0KA 2PBFA 4NBSA 1OXTA 2HSJA 3IP1A 2VHXA 3L7YA 2Y0SC 2GM3A 3F6SA 1KSHA 2MYPA 4EMUA 4U7DA 2ERCA 5KFAA 3EFEA 1CDOA 3N8NA 4RFSA 1BPEA 2TMYA 3TIGA 3PX7A 2J0SA 3WQHA 4FHDA 1TL7C 4LVOA 5DCYA 5IJ0A 5AJVB 5FDFA 1TLFA 3B3GA 4TQSA 2QNRA 2JATA 3I9MA 2AC7A 1RIFA 1HA3A 2CLCX 2ZI4A 5FKJA 4UTNA 3C3XA 3EWAA 2YJGA 1O3YA 2GCGA 1PR4A 1V39A 2VR1A 3DXZA 5BWCA 5LOVF 4F5OA 1HOXA 4I1RA 2OHIA 3T4UA 4M38A 4WEOA 2REOA 3Q12A 1ND5A 3AMVA 1JUDA 5EP1A 1XUOA 5T64A 3EXHC 3LYAA 4B7AA 5KFLA 2ZR7A 4IJUA 1U63A 5AM3A 2BCVA 4DS3A 2VRWA 5HHIA 1MF7A 2HQRA 3KJNA 3IG8A 4KXXA 3SZUA 4AC9A 2ZBEA 3ICEA 2I1WA 3RYCA 4NBNA 2UAGA 4NNJA 4Z9XA 2ZUDA 1O57A 2OBMA 3EFOA 4UVEA 3UJDA 3EDCA 5FWXB 1COZA 3ADKA 4CPDA 1Z28A 3N39C 4HUTA 2XCPA 1NN5A 2ESEA 3PO4A 1N8NA 5JNTA 1SUEA 4O6VA 3R44A 5ALWA 1UOOA 2OD2A 1EVKA 1XCPA 5JJKA 1JXMA 1EVIA 4ABYA 4CKCB 2HBZA 4DL6A 4I6GA 5HJ2A 3W3AH 3G0OA 3K0HA 5K6AC 2C96A 4R8KA 1H2AS 2W2NA 3CF0A 4JYCA 5IJ9A 1Z34A 5EUBA 1BPDA 4IC9A 2PBRA 1LLQA 1J24A 1KU6A 2QORA 3HCWA 3BK1A 4HPWA 4IUDS 2IPAB 1ZHHA 1S89A 1WZCA 2P3QA 4BQNA 4UHCA 4UPVA 5JI3E 3HS3A 1GPMA 3I8XA 3GIDA 3LXMA 3PL1A 4KO8A 4X1IA 1VRWA 4Z3KA 2XRZA 3NYRA 1R0ZA 5HF6A 2PLWA 3DL4A 3ILHA 3M6LA 5ARBA 2PLFA 3RIEA 2FPPA 1CJTC 4Q1CA 1DDOA 2IQ5A 2WHPB 2PUAA 1ZK2A 2Y8EA 4GOKA 2FHSA 3KIPA 3IPYA 1SBHA 1AOXA 5D85A 1HWYA 5ICGA 3NBKA 1APBA 2PUTA 4ALMA 3AR8A 4UW9A 2VJ5A 1GQOA 3IKMB 1M66A 2FH5B 3UH1A 1L4KA 1W36C 5EWJB 3M9MB 1DX6A 3B52X 1CEZA 4FSDA 4ZD6A 1WP9A 3B20A 2DL0A 3NVAA 3FUXA 2C78A 1RI3A 5JJBA 2YY7A 1CF4A 1Y63A 1VCIA 3PNSA 1PUZA 4YK7A 1KK2A 1LCIA 1UQRA 2DB3A 3OY2A 1NN1A 2V6JA 3JZIA 5KHAA 3R7BA 1GDDA 3CX3A 4RTPA 2IDKA 4H4EA 4JC4A 4IIBA 4W5HA 5BOSA 4J7CA 2V6MA 2A0XA 3ZDQA 2UUPA 4Q9NA 2VDMB 4R8UA 4C4TA 1QM5A 4HC4A 4P22A 4X3CA 4CMAA 1CJKC 4D4JA 5LQJA 2FZEA 2PQ0A 4LBZA 1Z1BA 4P34A 4ND8B 5EP3A 5LL6P 3IFSA 3PHCA 4EP1A 2ETVA 3NASA 3L02A 2XZOA 3GLFE 4POAA 4RXMA 3ZHOA 1G5RA 3A4IA 3FNGA 4DQPA 2GA8A 5DT2A 3I58A 1ZN2A 1JDVA 5FA8A 3H0RB 1N8TA 3NHJA 3UTDA 1BVYF 1FDTA 4TZKA 2HNAA 3FCSB 3TCKA 5DHRA 5H3CA 3U9TA 4G5HA 5TMDA 2WTAA 3HXKA 1U8YA 4EKIA 1F4LA 1ZQVA 1VE1A 1XDDA 2EG9A 5CM2Z 3A4LA 3HMKA 5D5PA 4HP8A 2B6NA 3CNEA 4RCVA 1XP8A 3HY6A 5EWMA 1U0FA 5JAOA 1WUDA 1B93A 5EXXA 3WGTA 4EFKA 4JBIA 1IXRA 3LT0A 4TTTS 3ZZUA 1N9GB 2EAPA 1KFSA 1PW5A 1U0RA 1V3QE 2FMQA 4QQKA 4GYKA 1RLTA 1GKUB 2WG1A 3HJGA 4Q7MB 5I8PA 2D5LA 3WMGA 1Z0SA 5JMWA 1ZIDA 4EUNA 3ALRA 1SZJG 3H5LA 3NHYA 2D7DA 2YXBA 4MS3B 4BX0A 1QYDA 5C9ZA 1KI2A 1US8A 2J5RA 5IG2A 4O3MA 9ICJA 3UXPA 4WWHA 3V7NA 4BU0A 1MSWD 1KQ3A 1BDJA 1KH2A 2AWNA 3D7RA 4U6QA 2KJ9A 4CG0A 3TTWA 4IIVA 3A58B 1JB9A 3D6MA 2B1RA 4MV9A 8ICUA 4X60A 3CSSA 4Q43A 1N6HA 1V41E 4JLOA 1TKBA 2N1BA 2F3TA 1PZXA 4NJMB 4XEHA 2CVOA 4KN9S 3OECA 1T9BA 3NV9A 3HKBA 5DFAA 5B3JA 3TJMA 1D3AA 4D4KA 2HLDA 4FBMA 3WGQA 3ZV6A 1SD2A 5LP6A 2IIPA 3CEAA 4BGIA 3D6HA 3QF4B 3ZS9A 2GJ8A 1TDJA 3FYDA 5E3IA 3PW5A 2F3NA 1VG1A 2BEKA 3DF9A 3E8SA 4MNTA 1USKA 1PFGA 1NN0A 1YQGA 3K2QA 1FNDA 1HM5A 1A9TA 1FSGA 2AZDA 2VHVA 4M0DA 1Z0UA 5SICE 5KSWB 2QYHA 3B48A 2JIDA 2HWYA 4XGQA 4EH1A 3MR3A 4ED3A 3AT1A 2CUZA 2N42A 1N7GA 3IDSA 3HB7A 1AZTA 4MRNA 2OD9A 4XIIA 5HBRA 4RZHA 5F2EA 3CZ4A 4LZZA 4A6DA 3QUBA 2B5WA 1V16A 1XL0A 5JZOA 4YAFA 1MC4A 3CB4A 4P2HA 1XXLA 5ALVA 3SWWA 1IU9A 4EW3A 3DWFA 2PH5A 5FOTA 4YJ2A 4TMVA 4EELA 5J0TA 4INAA 4X7BA 1JDZA 2EFJA 5DNWA 4BLOA 4ZN6A 2ZZMA 1ZD9A 4KYIB 2ZXEA 2GGSA 2HADA 3BAZA 3FY4A 2NP6A 4EFMA 1K0UA 1P4AA 2RHHA 3RGWS 1QYWA 3TI0A 5LNK1 4DTIA 4WQMA 3BRSA 5L4SA 3VX3A 5J4YA 3ZHBA 3JQEA 3ZD7A 3R74A 4RNMA 1AKTA 1FQOA 1E79A 2RDMA 3MD0A 1KR5A 3NG1A 4W4TA 5DN6A 5F7JA 5I7OA 1DG9A 3TXAA 1VHWA 1QMPA 2DU8A 4XDHA 4OHPA 1E0DA 3Q2OA 3KB6A 4X3PA 4KZKA 2C00A 3A1SA 4V24A 4PR3A 5BN1A 5CFRA 1P1BA 1U3GA 2GYYA 1T4BA 1UC5B 2Y0BA 4CMHA 2QUJA 2RJOA 4L0QA 1Z18A 1CDZA 2FB9A 1K2VN 3ND7A 3ZI4A 4JUDX 3G8AA 5LYYA 2BF7A 1P0PA 4MUFA 1HLDA 1CQIA 3IO5A 1BKYA 4LFCB 2V1UA 4BFYA 1PDVA 5I9BA 2XXJA 2A5YB 3IIEA 1ZWKA 3PG5A 3PQEA 4UCFA 3WLMA 3GCDA 4QLAA 1EFVA 2IYLD 4A3SA 1MMFB 4OCZA 1L7BA 1VJTA 2FUG6 2H11A 3PF9A 1NBMD 1S2LA 4TTQA 3KWJA 4DWIA 2HEIA 2PL5A 1TV9A 2PANA 3ZGLA 5KNBH 5HIMA 1A7UA 4RGBA 3CVYA 1K6EA 1A9RA 4BNGA 4G25A 2XRYA 3TUZC 4DLGA 2ZM6B 1OBFO 4IQFA 4RTQA 1KJJA 2PRZA 1JSLA 3GP3A 3VMMA 2INGX 4XGRA 4YI3A 1SKYE 3ISBA 1FFHA 4RPXA 2M6SA 4G5YA 4UC0A 3IV9A 1KERA 1KVUA 1VP9A 4JJ8A 5ER9A 5HRAA 4JYBA 4O4LB 1QHIA 1QRDA 2J31A 2VPWA 3B85A 3OTWA 5EJ6A 2ZCVA 3QJ5A 4GKAA 3QX9A 1KJYA 1E3QA 1LJUA 4G2NA 4OQLA 4D8VA 4CWAA 3OAAD 3WICA 1LUAA 1W47A 5THQA 2XVAA 1LVGA 1YI0A 2ZI3A 1Z1VA 1M34E 3PUKA 4IGFA 4EEZA 1DRJA 4GS5A 2NX2A 4LV5B 4XM2A 1L5QA 3EGXB 3WHIA 2IYSA 5L4NA 2KLBA 3P0RA 1E66A 2VSXA 3L6CA 1MB4A 1QFXA 1X8XA 2I6TA 4PG6A 2HLPA 3THOA 2GLEA 1OX5A 5AXAA 1NDHA 1P3Y1 1ML3A 1NGSA 3ZW8A 5ABPA 3GPDG 1Q1GA 3HN6A 4WUVA 4IIHA 4EZ6A 5H02A 4FLMA 2FPMA 5LZ8A 3QHQA 1NFFA 2BSQA 2O2SA 1PWHA 3KUCA 3WLNA 2X15A 3RFAA 4ZOLB 5K4AA 2NYAA 4B3XA 1YZHA 2QMUA 1BFUA 5G5GA 1KE2A 3HADA 3V32A 2OFXA 1R1DA 4B2YA 4JC5A 4MQEA 4R9VA 4B5KA 2PKRA 1YCHA 4HYYA 2GBLC 1LBTA 3LTEA 1CRXA 4G24A 3OUZA 5FUXA 3FNEA 3UQZA 4UAYA 1R66A 2BEWB 4L78A 3W4JA 1WCIA 4IMIB 1LDMA 3BKXA 1EDEA 2XADA 4TVSA 1QH1B 1H4SA 2Z56A 4O5KA 3CVVA 3Q3JB 1T0BA 2RDIA 1QHFA 1IM4A 1GPNA 2V74B 3AL0B 1KPHA 1CWUA 1WVGA 4WOBA 5ER6A 4DIBA 4O2BB 1T4DA 3ETJA 1ABEA 4HDMB 3VTFA 4F4CA 5T7BA 1UEXC 1QQAA 1GAEO 3SNKA 2CXPA 3RVRA 5GTDA 3LCUA 4JVNA 2UVRA 3JQRA 4Y6GB 1MEOA 4YB8A 2NU6B 2QQGA 2GZSA 3W3AA 2UVPA 2BGRA 3WV5A 4CM7A 2ZIWA 3OHAA 1XSEA 2VBIA 2YJTD 4WY2A 4PM4A 3COWA 2Q3DA 1O95C 3RE1A 5A4KA 4UUMA 7ICVA 5BP7A 1JAZA 1W75A 2JZNA 3NM4A 4I55B 5AT1A 721PA 2COEA 2B36A 5H83A 5JAHA 1CSEE 1N6OA 1YL7A 4S04A 1AZSC 1C1DB 3IKVA 3EC7A 5HG0A 3VYWA 4A8PA 5KX5B 1MJFA 5KFYA 3LWMA 1Y1TA 2VLIA 4Z99A 3URMA 2WWXA 4UD2A 4XJVA 3UPDA 5JSQA 4PSCA 5C5IA 4Y6QA 5JZ9A 5P8WA 4IWYA 2REQB 3UMSA 3Q98A 1O0BA 3ISVA 3CUVA 3ZZ1A 5JARA 3S3TA 3G6YA 5FB3A 3ND9A 4Q1FA 4ZU6X 5FI1B 3UN1A 1UC4B 5CYFA 1LV8A 1Q1EA 2HRBA 3NOQA 3WIOA 2VP3A 4KLJA 2CWDA 2J9XB 2H16A 3SAFA 1W29A 3PSHA 2O2CA 3PIRA 4AJPA 5C8YB 2ACEA 3B89A 1GVNB 1KF0A 1RAFA 3F3YA 3PITA 2XMDA 4RJTA 8GPBA 3RJTA 3F73A 1TUGA 2XWSA 1SKAA 1KPGA 3I9OA 4KDFA 5AVRA 4RHXA 1WR8A 3B9JA 3KQVA 2QDKA 2Z6AA 4GSLA 2Q50A 1WL8A 3CT6A 3VSCA 1KC3A 3P2IA 4YTEA 3JWJA 3V34A 2RIPA 3IHQB 1MFZA 8ICWA 1PD0A 3MJCA 1IVSA 1PJSA 1PU2A 4O5CA 2ID8A 2VJCA 5CLLA 3CTMA 2H1WA 1E9BA 1V11B 4IX9A 4JAVC 4OYLA 2H3VA 1E9RA 5BN4A 1ZIYA 4DCCA 1ZBDA 1NRIA 1YB7A 1GEEA 3NRJA 3O83A 2FP4B 4CEJA 2FUNB 4YPFA 4BS9A 1AQ6A 3I2GA 4PG7A 4Y7CA 4K9MA 4TS3A 1NNUA 2XVZA 3KXDA 1CLUA 4LDZA 3IUBA 4G6ZA 1YR8A 5DBEX 4E21A 2P35A 1A2BA 1O58A 2XWQA 4ON9A 2Q2NA 4EL0A 3QWBA 4PTZA 1P2GA 3ETHA 4S2UA 3RARA 4QECA 1VG9B 2QRPA 2B8TA 2DUUA 4MP6A 5FUWA 4A8HA 3GLGE 1QH0A 3KEOA 4GC9A 3O3OB 4AP5A 3WP1B 2CMHA 3OTQA 1WAMA 3OO0A 3AUYA 3GEGA 1X9XA 4CLHA 4JKOA 5ADVA 1QR2A 2AKAB 2WICA 3KEQA 4Q7JB 8ICAA 2MSDB 3W8FA 5FXMA 5I51A 1SB3C 2B98A 1MB9A 2O57A 4EM6A 3RV4A 1AS0A 4GD3Q 5JS2A 3RB4A 1V5WA 1QHSA 5E0KB 1CK4A 1FU8A 1GKYA 1QOZA 2IDMA 2UVUA 4HRVA 2DERA 3HYSA 5LOVB 1O4WA 5EOZA 1P0MA 3WRXC 2NTYC 5K3EA 1WZ2A 1FX0A 2GKSA 3EWNA 1J1IA 1RAGA 3MWDA 3EFOB 3GRVA 5HHTA 3MC1A