3QUCA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with sulfate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
225
structure length
225
Chain Sequence
b'HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHNGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 78
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qucA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qucA01
1YDFA 3N1UA 5AKYA 1O08A 4Y2YA 2G0AA 2B82A 4ZEWA 4BKMA 5AIAA 2YN4A 1EK2A 2EARA 3ZU6A 4YIHA 3UMBA 1RMQA 4KX3A 5AW5A 2DQSA 1Z88A 5AM5A 3NRJA 3MN1A 5ALYA 5IS2A 5T41A 2FPWA 2EATA 5ALHA 2YJ6A 1ZD4A 4RETA 5AW1A 2PKEA 4HGRA 5JJBA 1ZRMA 1SU4A 2FPSA 3L8FA 3OCZA 5AM2A 3W5BA 4UU0A 4UASA 5AICA 3NAMA 4O8CA 4HGQA 3KOOA 4Y2VA 4GXTA 1T5SA 3UM9A 2WF7A 1XP5A 3D6JA 3RFUA 3DAOA 1U02A 2FEAA 4XQ0A 4BX0A 2WM8A 3NANA 4YIKA 3ZTYA 3FPBA 3OCYA 5AI9A 3WKCA 5AVRA 4KX5A 4NV0A 2B8EA 5ALLA 4C4TA 4NFLA 1TJ4A 3N07A 4EENA 1CQZA 4YGYA 1TA0A 2CFTA 5AK6A 5ALNA 1Z4JA 3ED5A 2FUEA 3MMZA 3QLEA 4XE5A 2HDOA 1L7NA 2NYVA 3SKXA 3QU7A 5ALKA 2ZBFA 1L8LA 4OCZA 5ALUA 1XPJA 3SHQA 2P27A 3A3YA 4H1WA 5AESA 3EPRA 2C88A 3ZVNA 4QJBA 2MSNA 3ZUPA 2ODAA 4Y2UA 1LTQA 2B8JA 5AW8A 1CR6A 4Y2XA 3RF6A 2FPXA 3I28A 2B1QA 5AVXA 3ZX4A 2Q4TA 5AVUA 4UATA 3AR6A 4DCCA 4UM5A 2P69A 4E88A 5AVZA 2ZOSA 1Z4NA 2PR7A 1Q91A 2JAWA 2I7DA 3IB6A 3ET5A 3QGMA 4IG4A 2BDEA 2I6XA 3HYCA 3SD7A 1LVHA 4UAUA 3OCVA 4L6AA 3OTQA 4EEKA 1T9ZA 2AUTA 3ET4A 3B8EA 1Z4LA 5AI0A 4AP9A 3U26A 2I55A 5AKEA 3L1VA 3L8EA 1RKQA 2FI1A 4Y2RA 3WK6A 2W43A 5AW2A 1IWOA 4MUMA 3W5DA 1VJRA 2GO7A 5AI5A 2GHQA 5AKKA 4HGOA 4UMFA 1EK1A 3PCTA 2OYCA 2QLTA 4Y3UA 4HGNA 3WK4A 3TLMA 1ZD3A 3AR9A 5ALFA 5ALDA 4UW9A 2G08A 2B1RA 4BBJA 3L1UA 2HF2A 5AVVA 1J97A 1N9KA 4HAIA 4B6JA 5ALIA 1Y8AA 5AKXA 2VKQA 4UU1A 1WVIA 2FPRA 1QH9A 3WK7A 1RQLA 4CF5A 2ZBDA 3AR8A 4G9BA 2WF8A 5AKJA 2YJ5A 5ALJA 4YH1A 4YCNA 4BEVA 1X42A 3B9RA 4NABA 2QYHA 3A1EA 3PGVA 5AI6A 1PW5A 3SLRA 2WFAA 3WGUA 5AVSA 5ALPA 1T5TA 3ZWDA 2HI0A 2YFYA 3SF0A 2HHLA 2W11A 1YMQA 3FZQA 3UMGA 2JGAA 1YV9A 4FYPA 1RC8A 3QYPA 4BNDA 4BEWA 4Y2QA 3PGLA 2BDUA 4IFTA 4MWOA 2P11A 1Z5GA 2IYEA 1RKVA 3QXGA 5AI8A 3OCXA 3EWIA 5ALZA 2WF6A 3QUQA 1RMYA 4EX7A 2CN1A 2GMWA 1K1EA 2OM6A 1Z5UA 2YBDA 5AKHA 1QQ5A 2B30A 3KD3A 4UMEA 1RQNA 2MU1A 5ALGA 3PDWA 2BY4A 2IOHA 3QU2A 2Q5EA 3QUCA 2EAUA 4I9FA 1ZS9A 3QU5A 3WKAA 1NF2A 3ZI4A 2CFSA 2I34A 1Z4KA 2FDRA 2RAVA 3KZXA 1TJ3A 4Y2JA 3J7TA 3OCWA 4HYTA 1YJ5A 3DNPA 4Y2TA 1L8OA 3N8GA 2HEGA 3SMVA 4OFZA 4DWOA 3NASA 3MC1A 1L7MA 4UAVA 2R8XA 5AK5A 3ZVLA 3S6JA 3EF1A 3WKEA 2GHTA 5AKLA 3FPSA 3L0CA 1RLTA 3SKYA 1L7OA 2O9JA 5AW0A 3HLTA 3ZWKA 1SWVA 4CF3A 4CF4A 1U7PA 3U7GA 3E58A 3VAYA 4PNHA 5AW4A 5ALQA 3I6BA 2ZBGA 4EELA 3AR3A 4XOUA 1NNLA 1RKUA 2YJ3A 1YNSA 3R09A 4F72A 2YMLA 3OPXA 2G80A 5ALWA 4I9GA 4RESA 3A1DA 3L8GA 2ZXEA 1RRCA 3U7EB 5ALTA 3FGOA 4OHFA 4Y2SA 3WKBA 1U2TA 3R4CA 1RDFA 4C4SA 1MH9A 3KDPA 2AMYA 1XVIA 1TJ5A 2I33A 3OCUA 2C4NA 3U13A 5AVQA 2G1AA 1SWWA 5AM0A 3BA6A 3E8MA 4L57A 3NIWA 2NO5A 1Z4PX 5AK4A 1O03A 5AM3A 1FEZA 1VJ5A 4UMDA 3FM9A 3QU9A 3AR2A 1RMTA 5AHXA 4YCLA 2HF7A 3U19A 4DW8A 2HSZA 3K1ZA 2R8YA 3I1YA 3R9KA 2GFHA 3E81A 5AW3A 3L0BA 2G07A 2AH5A 4YCMA 1L6RA 2PQ0A 2RBKA 3U7FB 3N28A 1JUDA 3AR7A 2IOFA 2IA5A 2G09A 3M9LA 1S2OA 2YJ4A 5ALXA 2C8LA 2HCFA 1KYTA 4UMVA 2FPUA 1WZCA 2ZG6A 3I76A 3ZW7A 3QU4A 3ZX5A 5AW9A 3ZTWA 2YMMA 4ZEXA 3IJ5A 3DDHA 1QQ6A 5ALEA 4KNVA 3WK9A 2X4DA 1ZRNA 3M1YA 1L7PA 2CFRA 3WKDA 5AM4A 4KYTA 1VFPA 5IT4A 4KNWA 2JAOA 2OBBA 3NALA 1F5SA 4BNDB 3UMCA 3E84A 3WK5A 2C9MA 1NRWA 5IT0A 4C4RA 1Z4MA 2C8KA 3AR4A 1U2SA 4XPZA 3BWVA 3ONNA 2YY6A 4FFDA 5ALVA 5E0OA 5A3QA 2IOFK 5ALRA 3KBBA 1Z4IA 4G63A 1WPGA 3IRUA 1ZD5A 1RLOA 3CZ4A 5AKIA 4FE3A 2O2XA 2RB5A 2RARA 3ZVMA 4HGPA 5AVWA 3GYGA 3NUQA 2D2VA 4QQFA 4DFDA 2NO4A 1WR8A 3N5KA 4JDPA 5ALSA 4CNQA 3QX7A 2AGVA 5A3SA 4BX3A 3P96A 3WK8A 2HX1A 1AQ6A 2WF5A 5FP0A 4J2TA 5A3RA 3ESQA 5AVTA 5AKZA 2OA0A 3MPOA 3QNMA 4JB3A 2JARA 3B9BA 3L0YA 4ZEVA 4Y2PA 4OD0A 4CE6A 3ESRA 3DV9A 2B0CA 1Z4QA 4KN8A 2YMPA 3L5KA 3QUTA 4UARA 4EX6A 5ALOA 4F71A 1QYIA 4AS3A 2WF9A 1Q92A 2G06A 5ALMA 5AW7A 4BYGA 2HOQA 1ZJJA 1TE2A 4L6CA 5AM1A 1QQ7A 1YS9A 3WGVA 3EF0A 5AVYA 5AK3A 2FUCA 2MU2A 2HO4A 1J8DA 2YMQA 3A1CA 5AKGA 3U7HB 1ZD2P 1U7OA 5AI4A 3FVVA 4EZEA 4J03A 2JAUA 1N8NA 2WHEA 2R8ZA 2R8EA 4GIBA 1Z4OA 3W5AA 4NWIA 2ZBEA 3AR5A 1S8OA 2P9JA 3QUBA 1ZOLA 3KC2A 3CNHA 3L8HA 3F9RA 2I54A 4UM7A 5AW6A 5AIBA 2Q4RA 2W4MA 4BX2A 4NAVA 1RLMA 4AS2A 3L7YA 1RPZA 3W5CA
chains in the Genus database with same CATH superfamily
1TA4A 1O0SA 1SEVA 4UQGA 3K7EA 1UM9B 3FDZA 1KAHA 3KR2A 4XDHA 1O97C 2OQVA 4WVFA 4CCHA 2ID7A 5CX1B 2YJ6A 4L85A 4ESOA 4KXXA 4WK2B 1XEXB 3F8SA 4E3WA 4OBBA 4HD8A 3PWZA 4JYAB 4I0WB 3I5UA 4U5QA 3THWB 4BNGA 1JG3A 1OQAA 1XE3A 3KQNA 1T5LA 1D5CA 4RQTA 5D3KA 2H9AA 3LE8A 1WBBA 3RKSA 5I8WA 1W0KA 4TV9B 4FONA 4WNAB 4QWAA 3CRZA 2VPYA 3ROXA 3EHEA 1K8YB 3BZBA 3BWYA 2IV7A 3B5IA 3IJRA 4C7VA 3LTNC 1V6SA 3UXNA 4BFWA 1CUZA 3C6ZA 2JCYA 3STUA 5AVZA 2AC2A 2WIFA 2LKDA 2Q50A 4HT3B 1YJBA 4HXEB 4FHDA 4A7PA 2X23A 4IDHA 4GLOA 4MVJE 5CTAA 3LBFA 1H2BA 1UUFA 1UMBB 4LXGA 4E4TA 3S3TA 1O8BA 5GGYA 3PNVA 1RPAA 4DUZB 4WESA 1CS0B 3NBZC 3FDFA 3KUDA 4ZQFA 5EOVA 3ORSA 1MP0A 4L8WB 1M2HA 2C2BA 4E5DA 2XXAA 1XRSB 3LUKA 1CRLA 1N7HA 2Q29A 3AP3A 5CNIA 2ERYA 1IFXA 1VTKA 4D9HA 2YJ5A 1YUNA 3N2IA 1W2GA 2FWMX 3Q8XB 3TECE 2K8BB 1KI7A 3GRKA 2Q8PA 4IOMA 4FYPA 1Z6ZA 2CNWA 4TGLA 1P31A 5KNCH 3DBRB 2IYEA 1R5JA 1JXQA 2NU9B 3OPVA 1EXWA 3P4YA 4D57A 1PSWA 3OVMA 2YBDA 3R5KA 1E79A 4J76A 3H1FA 2F1OA 5A1TA 2ZSFA 3LM8A 3L6CA 5BQ3A 2MJLA 4JASB 5D6NA 3LPLA 5HHTA 4IWNA 1DBQA 3KG2A 5BPCA 1GXSB 1HLPA 1QFJA 1L7OA 1Q1BA 4HEA6 5F9MA 1EI9A 2W8LA 4ECRA 4JT4A 2ERXA 4D82A 3DEYX 1CY2A 4RTLA 1NMSA 2H7XA 2HPAA 1II0A 4CMKA 6Q21A 1GUFA 5C32A 3F98A 1JEDA 2VK1A 3DL2A 1YE3A 2BFCB 3JYPA 3KSZO 3IIIA 1H8EA 1MRZA 1CJBA 1HDXA 4IVPA 4HNGA 1U63A 2G1PA 2A3RA 4MPTA 3FHJA 2HSZA 2NRZA 2PX3A 3C3WA 3SQNA 3LF1A 1C3LA 4YRNA 2FSVC 2YZKA 2FFRA 2OFWA 3P9SA 2JLYA 4F56A 3BSFA 3SX0A 1M1ZA 4XSGA 1U7UA 5I51A 1E6MA 1FY2A 1NVTA 4KG7A 4LQLA 4GXNA 2WEKA 4EB6B 5A62A 1HURA 4HUQA 1F5SA 2QRKA 4ZFNA 1GZSA 4KVGA 3TTVA 1XVTA 3T4UA 2PMCA 4LK3A 2BUBA 2GBLA 5J8YA 1G8HA 3LAWA 3TANA 3DLAA 4C06A 1RLOA 1KIFA 2ANCA 4TTVA 3GY0A 4OFBA 1J4AA 1GGHA 1KP9A 2OLKA 5T4FA 3GOQA 3RHTA 5C1PA 3PSTA 3H7IA 5FO0A 3OZFA 3R3XA 5KT2A 1NKBA 1CTQA 2KD1A 2LCIA 1QV6A 2GERA 3CO0S 1NQWA 4FOPA 3ZHZA 1ZQGA 3OCCA 1RXIA 2D1FA 2PUTA 3LW7A 3C3AA 1Q7EA 2ISCA 4GHWA 2VRNA 4RHXA 2YHUA 1E2HA 3D2SA 3RU7A 4DSAA 4FSDA 2GN2A 2F1JA 2Z5GA 5KFNA 1ZD2P 2ZB7A 4KN5A 2GFIA 2J87A 2O2IA 2XUKA 4BO5A 5FAXA 2VP5A 1VPTA 2UVPA 3I2YX 3KQMA 1SKMA 5HS4A 3IA7A 4B8WA 4Z9BA 3IAEA 1X38A 3VM6A 2NMVA 3V1LA 4NZPA 3RM3A 5HF5A 2CC2A 4NR0A 2HWWA 5ER6A 2B6HA 4N5MA 4GE0A 4ZJPA 1OBVA 2PFGA 3CVWA 2CVHA 3COJA 5H3HA 3KO8A 1KDZA 3SU8A 1MJNA 3NRJA 3WGMA 4I2IA 4JJ6A 3GFSA 3GIIA 1K68A 2YQ5A 1TYDE 2XWSA 2LZ0A 5CYGA 3DAOA 1U02A 5J0OA 1SVSA 3PI6A 3EYZA 3D0OA 3T1OA 1XRNA 1XVUA 1QHYA 3KX2A 4G4IA 4XI9A 4F2HA 2WU4A 5DSTA 1CR4A 2ZB3A 1TC2A 3IERA 1X9HA 2J5KA 3TSZA 3SLKA 4IV5A 1KBZA 4HH1A 2XZOA 2JIZA 1NVVR 3CWCA 3DOUA 4TL8A 1HTTA 4HLDA 4RK6A 5J5VA 5FA5A 3M8KA 1LQ2A 2JJYA 3ORFA 3CX6A 3E7PA 4RHEA 3EB9A 3UJHA 1R6VA 3FYUC 2GCIA 3TQTA 2I3BA 2RIPA 1JF8A 4REMA 1PJ8A 3VNAA 4DA4A 3KQSA 4XWWA 2I6XA 5KAIU 3B8EA 3CEMA 1JHRA 5L9XA 3EGOA 4GI2A 2QMYA 3W5DA 3QJ5A 3VKWA 3UJ6A 2JEYA 1SC1A 4ZOLB 9ICNA 1F2UB 4U9HS 1Y1QA 1PJSA 2H7CA 4CN9A 3A6HA 4DV6B 3VKGA 5ALIA 4TZ0A 4P2GA 3A10A 4YLYA 3TL2A 3RUIA 1IWPB 4FFMA 2C83A 4O2AB 4LCJA 3H11A 3I9OA 2QMZA 1NK6A 1KO1A 4HGYA 1QYVA 3W1VA 4YRJA 1J2EA 3SZOA 1WCNA 2BDTA 4ND5A 1XTIA 1PZGA 3ANNA 3O3CA 3L5OA 2GLXA 3DULA 5DB8A 2YRFA 4QRHA 5WRFA 1XNSA 4BFUA 3AIMA 2I34A 4ZV7A 3GZNB 3BIWA 5SY6A 6REQA 1GLGA 2VJDA 4UOEA 3B6EA 4ARUA 4A0HA 4D9JA 2R4QA 4QL3A 3HZHA 2Q3FA 4B87A 2QSYA 1FCJA 5FNVB 1O6GA 1PWZA 4FFOA 4XR9A 5CDSA 2I9GA 4ZHQF 3U7GA 4DC9A 5HQTA 4Q4CA 2H2WA 1H6BA 1Z33A 2FR1A 4JLKA 3NU1A 2VHXA 1P2BA 3E5RA 1CS4C 3RD5A 3HJGA 1O2DA 2B6NA 3ZQ6A 4ZYYA 4L57A 3CRXA 1MNQA 3MJEA 2R44A 5L45A 3OFND 1P7DA 2PPVA 1LWOA 3BXXA 4H7PA 4J75A 5AOCA 5D86A 3PDCA 1L6RA 4C2TA 4ES6A 1JLMA 3IV6A 2CBZA 1ZA1A 3EUAA 4NLNA 2F77X 1BN7A 1EXNA 3GJQA 4LNAA 4I8IA 5LR6A 1NBMA 4ZQCB 4D43A 1Z8HA 3K70C 4FFDA 4OQEA 5F35A 3IRUA 5K8TA 3R76A 3EH2A 1IC6A 3G0OA 1ZQ1A 4J0HA 4FC7A 3K73O 4KLNA 3D3WB 2YVAA 4EA7A 1BS2A 1XK7A 2VOJA 4ZOQI 5K0CA 4XPIB 2V7UA 5E3IA 4PWZA 2VNAA 1YRQA 1QR6A 1I1QB 3HC7A 4DSZA 4GRIA 1GG9A 1I6KA 1C30A 1LC0A 3P9IA 2R1VB 4C7KA 4CMEA 2NTVA 4TV9F 1ML4A 3RTVA 2XIJA 1E7YA 2IUSA 1WXIA 3I8XA 1CQJA 1QOQB 1ISRA 5F3DA 1WP9A 3HKBB 9ICGA 4WNCA 3T4EA 4NE2A 2FRDC 1C0IA 3I0NA 2II6A 4MEBA 2HGSA 2CV1A 1RWQA 1IBMB 2DF4B 2G4VA 3UMMA 3OJSA 5J2UB 4QXQA 4AYXA 2ZAYA 1FDIA 3DEIA 3ORYA 3WYAA 1NNSA 4ZVMA 3LLMA 1K4MA 3PNPA 5TISU 3IE0A 2IKQA 4YO7A 4U6QA 3MTGA 1GCUA 3PWSA 2E3JA 5EXPA 5KFEA 1XJCA 3Q41A 3FE2A 3QJGA 3R3SA 5KJCA 2UXDB 5CBPB 1N33B 5F73A 1G21B 4PX5A 2QUBA 3ESCA 2JGIA 1XO0A 1L8XA 4O4JA 5F98A 3G2LA 1PHPA 5CW1A 5C1IA 1AKQA 3X1JA 1NKSA 3EVZA 3HWX1 5DWQA 2H3EA 5HR6A 2PMKA 3B9QA 3G13A 3JRWA 2J9XB 3NHUA 1CRWG 4OKSA 1TQ2A 1BHSA 5AVXA 3MF4A 2Q4TA 1HNWB 4I36A 1T8SA 2E4XA 3HB4X 3E18A 2CHQA 3HU3A 1U0EA 3LHIA 1IY8A 4W8GA 4Y9SA 1OFIA 1P7CA 3BZCA 2VP4A 4L6AA 1GTG1 3PSIA 3OQNA 1PVVA 3SHVA 3KHHA 1B6RA 3K71B 2GZSA 1PS0A 1B8OA 2G5TA 1XO1A 3K4GA 2PK3A 1YI0A 4UDXX 5JECA 3T5KA 2GHRA 4IGKA 4QWCA 2YS7A 4YAKA 3K05A 2C3MA 2DUYA 4BO0A 3KSDO 5DHSA 5CMLA 2ZIXA 5EOZA 1G19A 3UMRA 3V6KA 1R8YA 1U31A 4GPTA 4J9NA 2JGAA 1UKEA 5E9WA 3RB3A 4NENA 2PGAA 2DWPA 4N1AA 2E6UX 4M37A 4RZQA 3GDXA 4HI0E 3A9VA 1GD1O 2VBCA 3ZDEA 4HH0A 4TL9A 1QG4A 2Q9BA 1UK7A 3ORHA 3FUUA 3WLHA 4B9TA 4ND8B 3H99A 3TL3A 4C43A 4B09A 1OLXA 5LIPA 6AT1A 3T5DA 4O5AA 4C0BA 2H4FA 4FYJA 3T9FA 3HCCA 3FMGA 4CIDA 1BG6A 2DPHA 1D03A 4UAVA 2ZYWX 4MEXA 3T7IA 1W47A 3MOGA 1LKZA 1V4BA 2RGCA 1IIBA 5CNJA 5KYWB 2B4YA 4FK8A 4EG0A 1I8TA 4QG3A 2FVYA 1NR1A 4ETIA 3GD7A 3OPXA 3OMXA 1YQ9A 4CGZA 3HBFA 4RGVA 3LK6A 4P5DA 1QHGA 3FZYA 1U2TA 3P94A 2DBYA 2I33A 3IESA 3EZXA 4JBYA 4KLHA 4AP6A 3IMCA 1UFOA 2W9MA 4MUYA 1VJ5A 3AR2A 2OAGA 1JTEA 1UXOA 1X9IA 1M5RA 2AJDA 1E1DA 4P7JA 3HP6A 1I1HA 3AIIA 3T41A 3EDMA 2ZI7A 1U8UA 3N8KA 2R65A 1LB1B 1N4AA 5DTMA 1XHFA 2OV1A 4ENRA 1U0SY 4GSLA 4ZYVA 4Q43A 3D4LA 1EDOA 1QHNA 2EZ4A 1NNEA 3R3JA 3WG9A 5KQGA 5CIYA 4MEJA 2OVBA 2YWDA 3F7OA 3H04A 4FUTA 3IG8A 3OF5A 1MZPA 2XVYA 4IUDS 1Z0FA 2ZRIA 3NGMA 2EANA 4BWGA 4M0AA 3H3JA 2C2YA 4GPZA 4QREA 2MDTA 3OPYA 3W5HA 5JJLA 4V0SA 3RFFA 1V25A 3EGVA 4MWSA 4BJ5A 5ADHA 4MK4A 2LKCA 3NHBA 4EUKA 2AK2A 1FIUA 1TZBA 2QZJA 1TX4B 5FQOA 3VUFA 3MTEA 1J06A 2W2NA 3H87A 3AEKB 4V0MA 1U0OC 4MYDA 4B47A 4I66A 2OHHA 2WHQA 4L95C 3GLQA 2QQEA 3BS5A 3EZYA 2C2EA 4ROSA 4B6EA 4F11A 3AHHA 3HZRA 2RJOA 1S89A 4GWKA 4HYYA 3AIKA 3NP7A 5IULC 4AN0A 5DSZA 1PZNA 4H18A 2FSIA 3QA3E 4BTVA 4Q7LA 1HT1E 3FOBA 1A2BA 3THXB 3R44A 1N6IA 3B1WA 4D80A 2O3UA 1QVWA 3HRKA 4UC0A 3IKMB 1CP3A 4ZOEA 3KSBC 4WFKA 5IWAB 4JELA 3I6MA 2NP7A 2B92A 3LLSA 1JU4A 3RYCA 2L0XA 4FFNA 2NUBA 2VWHA 4JC4A 2L19A 1E1QD 5B55A 1LKYA 1D4AA 2OT3B 1T36A 4LF7B 1JEEA 2YNMA 5HF9A 1PTJA 1C1XB 1KYIA 1ECLA 1UOOA 1T2AA 5DHPA 4KMOB 1PT8A 2CVZA 3NGDA 1UKZA 3EX7C 5IVDA 3F96A 1QOZA 5FDFA 1WXWA 5CRIA 4MW2A 2OD7A 3GAZA 3T1YB 3W77A 5IABA 1E3MA 1OFUA 5E95A 4YN3A 1DVRA 2V03A 3PX7A 1CHDA 4O2AF 4EI9A 4NZNA 2W7OA 3OOSA 4ZXFA 1UBOS 3L4SO 5AVUA 4UATA 3ZD7A 4XA8A 2Z2KA 4WX2B 5KNDA 3K0FA 1V1RB 4I2EA 3RT9A 3IAS6 1QRUA 4LZJA 1W0KD 1B0AA 3PQDA 5J4KA 2A3VA 1WUHS 4ZREA 1HQYE 2EFCB 3OH8A 4WZAA 1WSBA 1N6NA 2IYAA 4QULA 8ICIA 4B2IA 5B3JC 4KP7A 2V6BA 1AB6A 4IQGA 1GGEA 1OH8A 3KAKA 2GHQA 1II8B 3O90A 2JGRA 1WHSA 5HSGA 2ZE5A 4O59O 1U9JA 3BWDD 3EVNA 5FNVF 2CYAA 2ZK7A 2BJVA 4DLEA 1QE0A 5FQNA 3ANXA 4E70A 2R25B 1ZCJA 4PPYA 4BEVA 2YHIA 1T4CB 4XUCA 4P5EA 5IIMA 1NXPA 3OIUA 1Q1ZA 1CY0A 2JKYA 1E94E 3CGGA 4YJ3B 4P3KA 3I6QA 3JD1A 3UH0A 1BKYA 3I9NA 4TQSA 1AQYA 1P2DA 5I6DA 1NHWA 3I2JA 3H9UA 5CK4A 3E2IA 2PSHA 4ARZB 4GMGA 5H3LA 1F4PA 2OXTA 4GT1A 4G81A 1DG1G 3FOWA 1Y9AA 1XDWA 5TQ2A 3JQ7A 2CNWD 4AG3A 2F3QA 1A1SA 2UYQA 3AXTA 2QHXA 4QOEA 3I34X 3KB1A 2QGNA 2KZZA 4D8YA 4RE5A 2GQ0A 3RJGA 1R4ZA 2KTQA 2ZIFA 1MQ3A 3CN7A 3PFBA 3V48A 1OILA 3ZI0A 1AQNA 4LJRA 4AC9A 3WLMA 4HVLA 3C2MA 5FX2A 1CF2O 3A4NA 3CRW1 1QORA 1ZBQA 5JADA 5AJHA 4KSBA 1T3SA 2V6FA 3RFAA 3I9V1 2DUUA 4U2CA 1MSWD 3FCEA 1PX0A 2R7LA 1K1QA 5JRTA 1CUSA 5HK9A 3HLYA 3E9ZA 3SZUA 4HX2A 5HOQA 4YMVA 3KJHA 1MQ2A 2ESEA 4KQKA 4G1MB 3VR3A 4WOBA 2KMDA 4M47A 3BC1A 4N8EA 4LYAA 3LH5A 4Y9TA 5LA6F 2FZLA 3TMKA 2HCFA 1P1FA 8ICGA 3IQGX 3AY7A 3VMMA 1G2PA 1H8ED 3ED1A 4OATA 3K72B 1C50A 5IT4A 2TMKA 5DHAA 1ECWA 3TAQA 1GQOA 3S1LA 5C37A 9LDTA 5A4AA 1Y9JA 3QMMA 1NW7A 4DWJA 2JCVA 2HLNA 2WJWA 2HSJA 1EESA 3VUEA 3ELWA 4CL0A 1YA6A 2WPNA 3NHZA 1AX9A 1DJLA 2QX8A 4CKCA 4US1R 4G8BA 2RSLA 5KG2A 2OLEA 2R4TA 5J2UF 8ABPA 3WISA 4PHGA 4JI6B 5D6OA 2KOBA 2I76A 2ESRA 3UMFA 1E32A 1WWVA 3HDJA 5EWLA 3ZHCA 4NV1A 3QWIA 4RPXA 2PSFA 4X8OA 2WDPA 1ZN9A 2C2GA 1ZU5A 2AYYA 1YS9A 5THKA 1Y7LA 1G5QA 4MMYB 4G5XA 1C7QA 5G53C 1OU0A 3LDFA 4Q9NA 2P9CA 1YAHA 3I42A 2E87A 2SKDA 3K2BA 4GUDA 4DL9A 1WZNA 2CL0X 2KB0A 5KSWB 3NHAA 1KO4A 5D8DA 2M6RA 1NBWB 4X3OA 3TD6A 1OA1A 1WY5A 1EGHA 1DT5A 1GDHA 1RG6A 4BOYA 3IAUA 3IHLA 4ENSA 5E7QA 4YMLA 1OXJA 5BN1A 2H92A 1GPUA 5HTKA 1YJQA 3AT1A 2YH2A 4HDKA 4P0QB 1JFTA 3FSRA 3O8LA 2PLFA 2WF7A 3S2UA 3BORA 5FOXA 1Z8DA 3QKRA 4CDGA 5CP2A 3PNLA 4D0SA 4C3UA 1CRZA 1H42A 2Y0DA 3JWHA 2CFOA 2ZRHA 4DS3A 3NBXX 3ZXYA 2ZUFA 2B8NA 1Z7WA 1WV1A 3PNQA 3L1HA 5FRDA 2OCEA 2RMKA 3AFOA 1NX9A 3F1KA 2PZJA 3I9MA 5JROA 4MV8A 1YR8A 4WK4B 1XLTA 2JJQA 2BFDB 4HQ6A 3CONA 1K8XB 3W0LB 1DDGA 4DKJA 4KXYA 4FEGA 2JFZA 4RD2A 4Q18A 2XZTA 5KQSA 3GLHB 2M9MA 4IQWA 2PU7A 4MI1A 3IAAA 4FCWA 1JJAA 3O95A 4EP1A 4UBBA 2Y1FA 4H4DA 1NOMA 1AGYA 3K92A 3CLHA 2J4CA 2JLUA 4ILEA 2VPZA 3IUQA 1E62A 3UWKA 1L5RA 4CLDA 5FWXA 4Z9AA 2NIPA 3Q7EA 2R7KA 1JGTA 3C8ZA 1E2JA 3R23A 4H3HB 3M9OB 3UMGA 5IM4A 3C6QA 2EQBA 4RW0A 3MWDA 1QK5A 1A88A 1QBGA 1BJKA 3MFHA 2REQB 2Q4OA 1NBHA 3D6HA 1UBJS 4A0SA 4PHCA 3FTNA 3FROA 4M7OA 5HZGA 1P5FA 2O8NA 5IJXA 4JNCA 3GRZA 1VB5A 5KFCA 5CH5A 2XMQA 4WLEA 4ZCRA 3ND7A 2C5HA 1FLVA 3W06A 2LM4A 4UJ3A 2HA7A 3L6OO 1LA2A 2VXOA 2D5BA 1SXJA 1WUIS 4OYRA 3T4XA 1RLTA 3B9PA 5KQPA 2PRSA 1X80A 5GTHU 5LQJA 1JJBA 5K3EA 2BZSA 2YY7A 1CJCA 1G16A 4N5LA 1CUAA 1TLTA 4L5YA 5J5CA 1JYSA 4U3JB 3HNRA 2HA5A 1XROA 3DVSX 2ZIUA 5IASA 2KHVA 2QAJA 5KL8B 3BL6A 4ZAWA 5AXCA 7MDHA 3PHGA 3X1DA 1JN3A 2WC1A 3U9TA 3Q72A 4E14A 2DX7A 2WKQA 3ESXA 1JEAA 2ZSHA 4DDTA 1EMDA 3ERCA 2QN3A 1Y1PA 4NJ8A 3PSAA 3RODA 1G8MA 4IUYA 3A9SA 2X4DA 4KYTA 2ZZMA 5T64A 3PLRA 3QE3A 4MR7A 2NNWB 3D2QA 1XRPA 3H0KA 4JP8A 4M1EA 1ZQKA 2Q0SA 2IHKA 5T14A 3DGFC 2GO1A 3TZ6A 3WXBA 4DIKA 3SMQA 4A03A 3K9HA 4YJFB 4WGFA 3DZKA 3S5JA 2VA8A 4ECXA 3BILA 3GLUA 3S8YA 4CNQA 1HT3A 1DPFA 4K86A 4UUPA 2ZYAA 1NBMD 1MJGM 5EIOA 3PPYA 3U37A 2PRYA 3L0YA 3WLOA 3VV3A 3ESRA 4A0QA 5CFLA 1KGSA 4BXOA 4FCCA 3AM9A 4RQMA 1GL7A 4LTMA 2XB9A 2ET6A 3C48A 7ADHA 2HOQA 4E2XA 2HIHA 1ZESA 4PZNA 4QPCA 1Q0SA 3TSCA 5CH8A 3C1UA 2F8TA 4HWPA 4K46A 4IZ6A 4K2AA 1ZA2A 3LY7A 4KYIB 5HJ5A 1PBTA 1K5PA 5KQLA 3O4JA 2YDXA 3D8SA 4MUKA 3SK0A 4X24A 4P2BA 5B3KA 3K96A 3KXDA 4FYIA 2NUPA 1OY1A 4HFNA 4A91A 3NPAA 2VK8A 1F60A 3NV9A 2H1LA 2R18A 3IVRA 1IG0A 4Z51A 2F1IA 3EZ7A 4AMUA 2L69A 4LK2A 5E7IA 3MWEB 5JH7B 3AU6A 2FEAA 1WZIA 4ED0A 4H7FA 2P40A 2RH9B 3NWEA 4QGBA 9ICHA 1MRSA 1I6MA 4YGYA 1JVSA 4EGAA 4RQ7A 3B9JA 1AA6A 4CI9A 3ESZA 2NQ8A 3MCVA 4WBNA 4M8LA 3DPSA 2DE0X 2Y1JA 2I78A 1GPBA 4MVWA 4B3BA 4BLUA 1K98A 5DM60 1NZDA 1X15A 5KFBA 4ZYZA 2AR7A 3G7UA 1U1FA 1JDPA 3WC4A 1PJBA 5FWYA 2GXUA 2REXB 2PXXA 4EHIA 3BTSA 4COKA 5B57C 4RCYA 1KP3A 2O2EA 5TPZA 2Q7DA 1Z4LA 4YK7A 3LDGA 2ZYGA 2A0FA 1HZZC 4C6HA 1U3TA 2D3TA 8ICEA 3ML1A 5E6RA 1S01A 2XF8A 4P4SA 5C81A 1RYBA 1RWMA 4TXMA 4RPZA 3DTTA 3EPKA 4R9RA 3ZZUA 3A27A 2YQEA 1PF7E 3T7AA 2JGKA 3PHLA 5CFQA 2H2HA 5DCLA 2AFVA 3I30X 3ZZNA 1KDVA 4MP8A 2ICAA 4JYPA 4MQ6A 1ZGBA 1MGPA 1PV4A 4I2VA 4MRPA 5JAOA 4MZXA 2HRRA 1M34A 4Q7MB 1GCOA 2I2AA 1T9DA 4B17A 3HKDA 1MJFA 2G4CA 4R84A 1FS5A 4KIFA 4XB6B 3WMGA 4URFA 5IDVA 1JIXA 3MLAA 2IHBA 1WABA 4QZ9A 3KZKA 4IHQA 2FU5C 4EH1A 1H94A 2DUJA 3EPLA 4M83A 3WKEA 1J2MA 3L0DA 4X1YB 4GQAA 3W78A 5DH9A 3S7TA 4CCYA 3RC1A 1JIQA 1W36C 3HA7A 4F4XA 4OA8A 1X0VA 3UJBA 1SKWA 4LPSA 4Q4LA 1C9YA 1HG1A 5G3ZA 1UC4B 3AX6A 3EGXB 5TT0A 1SCUA 3C70A 4BFLA 2OK8A 1L8QA 4JWNA 3PB3A 3PL1A 3W9YA 2H6EA 2CCKA 3EIOA 3GV8B 1HNNA 3FJOA 3K0AA 3W2EA 1QGYA 1U48A 1BS9A 2CD9A 3OF2A 2X6RA 5LUAA 1ZK2A 5JJKA 2C8VA 1Y33E 3DFUA 2Y1EA 3JATB 3HVKA 3RJJA 5TZVA 1UOEA 1SKBA 5A0VA 1U2SA 5I7UA 3USES 4KIJA 3Q3IA 2Z9DA 4IMRA 1CBUA 2PSDA 3N2YA 3FYUB 2YWRA 4CV3A 4D4HA 4ESVA 5FWNA 2A0KA 4LZOA 1RRPA 2MCFA 3DF9A 4R2HA 4B3RB 2GJSA 1ESEA 4J2TA 4KE6A 1VYVA 1T2UA 3C28A 4LUCA 2C82A 3SIXA 4HRVA 4RQ8A 3DV9A 2VO1A 1TF5A 2IX3A 1V16B 4JB2A 1N1GA 4BKPA 1MORA 2ZROA 1KFSA 2ENUA 5HW0A 2EGGA 1IMJA 3RF9A 5FBRB 2QTHA 4E0DA 3C8MA 2DC1A 2QYSA 2MRLA 1OXTA 1ZXLA 4L50A 5TLSA 5DKFA 1UBMS 1V26A 2IXTA 4MSUA 1QP7A 3BXEA 1JBKA 1JHXA 2HU7A 1UH5A 4MV0A 5KKAA 2PGDA 3FCAA 4DYVA 1O94D 4OLFA 1PQPA 4NBSA 4BZQA 5IFLA 4E31A 2JEIA 2V4MA 4MV1A 4BP8A 3QIAA 1EVIA 3VO9A 4L4ZA 4OXRA 1VRCA 3QFSA 4ER3A 3TE7A 5LQDA 4QXRA 4HSGA 2EZZA 4JBHA 4LE1A 1JTVA 3KWMA 5JWOA 4WE3A 4HH3C 5SYNA 3VU1A 2PMFA 4P4GA 4NYIQ 1GZUA 4BB0A 2O3QA 4FO6A 4UFNA 2AXPA 2QX7A 5LOVA 2K6GA 2YWHA 1TFUA 1E3DA 4WRRA 5HGXA 1L4UA 2QARB 4RKQA 1R7RA 4I6JA 4X1IB 4LQ4A 5CTJA 2W9AA 4XFKA 1RJFA 2X4LA 4BQNA 4MQEB 3QTLA 4F96A 4HQKA 5J0SA 2GBGA 3EVAA 1TYBE 2OCKA 2FQYA 1CZLA 4DMKA 3V8PA 5KFUA 3SYNA 1DBSA 3L1KA 1ZG3A 2QB1A 2KX7A 1LVHA 2QRNA 1OX5A 1OI2A 1OI4A 1QCKA 3JQCA 1YZ6A 1W35A 2JD2A 2V4QA 4V39A 4DCVA 5EIBC 3AEQA 4I4CA 2NXCA 3UW3A 1A72A 4C03A 2R6HA 1EQUA 3QW4B 3Q0EA 3R3WA 5KNDD 3D0QA 1T5IA 3JQAB 6CHYA 2DAPA 2QVYX 4LZDA 2QNIA 4ZGGA 1UBCA 1UR5A 4URHA 3PKJA 1AQUA 1TZMA 4MUJA 5IVKA 5TGTA 3GF4A 3EPHA 1NJ6A 3IUBA 4YH1A 2C54A 4XZ3A 3P5SA 3ZE1B 1YQQA 4UNSA 5AI6A 2BE7A 3TM5A 3N7AA 3TUJC 1JFVA 2NT3A 2WBLC 3FWNA 1JQJC 5KBYA 3KJIA 4PTZA 1P6UA 2GN8A 1Z5UA 4WOPA 2R97A 5CPBA 2VT2A 4ALIA 5KG3A 3PX3A 2IS6A 1EFLA 4LKOA 1EIWA 1X7WA 3TAUA 2WJYA 3UYLA 3KU4A 1WUDA 1KSJA 2EBUA 1MA0A 1JIUA 4WJZA 1V5GA 1L6NA 1YXMA 3V2UA 2JK0A 3ZQJA 4AULA 4BNTA 1QRRA 2BBOA 1YBHA 3LI2A 1R64A 4PN3A 2ORIA 3RIMA 5K6AC 1XKTA 4EHHA 4JBXA 4L2IA 2FKAA 1LCIA 4DANA 4MFAA 5E6SA 2I5PO 3THSA 4OIMA 4OSOA 4KI0A 2AZXA 2APJA 1WMFA 3IDAA 4TKMA 4OK3A 2YV1A 3LNCA 4V38A 2ZYVX 1U0TA 2JL1A 4RCZA 3FX2A 4MFFA 1SC6A 1NL3A 2QX9A 1QVVA 3F5DA 3OKFA 2QYOA 1EINA 1UADA 5TGDA 4NECA 4O4LA 3V4PB 3GJ6A 4RHTA 1M67A 4Q4AB 1KU6A 2Q6IA 2QJTA 5BY2A 2EQAA 4B7ZA 4W9NC 3THVA 1LWNA 2ID4A 5A6SB 4UBCA 3IUEA 2C8KA 2XIDA 1DB3A 2FN7A 1MW8X 2BGJA 1RKXA 4X45A 3BIFA 2ISQA 3KJFA 3JD3A 1ZVQA 4OHZA 1TU4A 4JB8A 4CTMA 2J31A 3EEIA 4R40A 1AHPA 2ZXUA 1SZDA 1PWHA 4OQXA 1CD5A 2Q2WA 5JH7F 4NBNA 5CCEA 2P6PA 3TLEA 5ALMA 1NLUA 3KBOA 1YVDA 3PIIA 4KUEA 2WD7A 4F4IA 1PNRA 5AVYA 1O6BA 2PWAA 3OKCA 3RS3A 5HUQA 1S2IA 5KU7A 4X65B 3IMFA 1IQ0A 2GNOA 4UAJA 1UJBA 4TUYF 3G7SA 1TK3A 2VUUA 2C4HA 2YWGA 2JAHA 1DIOB 4AX4A 4FS2A 4KQEA 3IULA 2FJ6A 4NCXA 4L15A 4F2RA 3HGTA 1N5DA 4J0GA 2IEAA 1EXDA 4YR3A 2LNDA 4MFCA 2ASEA 1P74A 1LRJA 4HAXA 2L5YA 5J4HA 4O6VA 2OFXA 3MN1A 2CXOA 4ECUA 1DC4A 2VF5X 2GB4A 3R4VA 4R2WA 3DMGA 1I7PA 4HFMA 1RWPA 5D01A 2YL2A 3ND5A 4DPLA 1E63A 5KAFU 1VLLA 4JJZA 2WM8A 5DK6A 3BHJA 3LBAA 2H11A 4ZV4A 1NI4A 4NBRA 5B3AA 3I8SA 1KI1A 4K05A 3VV2A 3JALB 1N7IA 4CLEA 1XMIA 5ECDA 2OC4A 4FKMA 4MB6A 3IG5A 1G8KA 4C05A 4BP3A 4I1UA 1NXSA 4HN2A 1VMDA 4I29A 3RI3A 2L18A 5K0GA 4G36A 1ZQTA 3ETCA 5TQVA 3AF1A 2O2YA 4YMOA 3DT8A 1MHPA 3MCWA 4IGIA 1Y6ZA 3TFQA 5DIZA 2HZ7A 4QDJA 4I28A 3DZ8A 3EFOA 3DKKA 3DF7A 1LDYA 1RACA 2YZNA 4YCSA 2EF1A 3OE7A 2BI8A 5F2NA 4LPKA 1W87A 3C97A 1W5BA 3DDSA 1DLJA 1U4OA 4B46A 1JI7A 1KC3A 2QMEA 2Q5IA 3HVRA 2JFVA 3NVWA 2DWQA 5IPFA 4RFSB 2AN5A 3DAHA 4MIKA 2Q1UA 2ZSUA 3WGUA 2UXBB 4IO0A 5I7WA 4CKXA 1UXIA 3WZ2A 1PD0A 3T1QA 2NO6A 2HPHA 3EH1A 4MWOA 1ZZEA 3ONWA 2NU7A 1CEXA 1WXQA 2EX1A 4EM6A 3IHTA 2R5NA 3KJXA 3TB6A 4TTPA 2X0DA 2HCJB 2CWDA 5HK8A 1ARZA 4RHCA 1ZJWA 2QRLA 1SHJA 1KN5A 4HYTA 2BP7A 2DWUA 3TFWA 1ULZA 2ZWVA 2XCPA 4ZKDA 2QLMA 3FCSB 4JJ8A 2EFHB 1P39A 3BHIA 4GRAA 2RDIA 1RFLA 2GA8A 1DK2A 1M2OA 2AF3C 4G24A 4AY4A 3MMXA 1ZNZA 1I7NA 1GQSA 3CWZA 2PYZA 1T9AA 1SXJD 1JR4A 5FADA 1HYQA 1QIMA 1V8OA 1MA7A 2G17A 4L4SA 4EK9A 1OYVA 3PS9A 3KTFA 3RHZA 4KCGA 3U19A 3TOCA 1K4YA 1JQDA 1FE8A 2IHTA 4L72A 3QVUA 1Q74A 1HOXA 1KEEB 4HB3A 4OP3A 4JI7B 5E1OA 3VHXA 3AR7A 2FR8C 7ICVA 3VTAA 3A2LA 1HWYA 1OCEA 4WSOA 1Y42X 5AW9A 3AY3A 5DYIA 2YIDA 4J0KA 3PSHA 1YOVB 3VO2A 2EQYA 1FBNA 4CF6A 2JLBA 1GSOA 2D2EA 1M0EA 1O89A 4NU0A 5KFVA 4RO0A 4PZUA 2A78A 2FN9A 4IIBA 3AL0C 4O3SA 3OX1A 3QEBZ 4QUDA 4BO4A 3DAYA 4LI3X 2FX2A 1RWBA 3EYWA 3HR7A 4U2DA 4FXOA 2PKCA 3AI7A 2YBEA 2V59A 2A0WA 3HCPA 4H3VA 2NV0A 3LCUA 3NWBA 4PZDA 3WQHA 3VNUA 5DV9A 5B4VA 2GK3A 1HE2A 1U04A 2BEKA 3IP1A 3B7GA 1EKXA 4JB3A 1MX1A 1LSUA 1HFEL 2FLLA 5MHTA 1YVPA 5G4KB 4QDUA 4R3UC 3S8EA 5TGZA 2H2FA 2EG5A 2XIQA 3OJUA 1Y80A 4ENPA 1E6LA 4RIHA 3OE1A 2RAFA 4ALKA 3LWNA 1YACA 4LYDA 2LWIA 1Z6GA 3DH0A 1O6ZA 2GA9A 3FSGA 2WUDA 3VOAA 3CV3A 2J3KA 3QUBA 1DAKA 1T4BA 1ZSYA 2LIPA 3LC7O 2MMCA 3L7YA 1R6DA 4KPGA 2PRKA 5JZSA 4I2BA 5DNYB 2V7QA 4E6PA 2WTAA 3F5QA 1R8XA 4JLVA 1M1YA 1PVRA 1I5OA 2QTVB 3G1TA 4IKEA 3UW1A 3FNBA 1G5PA 2B7LA 4TLAA 1K7YA 1OX4B 3OCZA 2O8CA 3IA2A 1RI2A 2WVHA 3BN3A 3VPSA 5EHXA 5EKUA 5CVEA 5U1PA 2QB5A 4R2IA 1HSZA 3K75D 1GM5A 1PNTA 1R0KA 4DNFA 3AOEC 4GC5A 2O1SA 4K3VA 2W4QA 1DT3A 4ZAVA 3PA6A 2EX4A 1RT9A 5H16A 5BMVF 2OEPA 4HLUA 5G5HA 4J9OA 5IZCA 1Q44A 4QHTA 1TO2E 3QOFA 2KHQA 3BWEA 3TLYA 3MGHA 1TUEA 2KM1A 7ICPA 4MQ5A 4EYKA 3R5JA 1VL8A 1BMFD 3M0EA 3JASB 3CHYA 2C88A 2WZCA 3VPDA 4DNOA 4B3JA 1QS0B 2OB2A 1LTQA 1AXGA 1XRQA 1XEWX 1K6EA 4J2OA 9MHTA 2F90A 2P69A 2CSXA 3FAZA 3N2GB 2MINA 3KPWA 4JBNA 1JAHA 2Q46A 1P7WA 4DUPA 2VT3A 2YQ4A 4GVLA 3CF4A 4OP1A 2H1VA 3UUFA 2G1UA 1PLLA 1Z56C 1HM5A 4C76A 5CXXA 4DMRA 4OMUA 2RRDA 1IWOA 3MT8A 1W46A 2EGUA 5DNEA 2C7RA 1M72A 5BRJA 1BRTA 4LDZA 3S40A 3ZKAA 1BCSA 3HXQA 6LDHA 3PQCA 1PFYA 4K6KA 4G0UA 1ST3A 4OI4A 1JQKA 1KMHB 1O8CA 5KFWA 1LBTA 3PUZA 2PMEA 5EFOA 4RAOA 4C01A 1J2TA 2B2CA 2O50A 1NW3A 4GXRA 2O05A 3UT5A 4DE5A 3C1TA 5J4LA 4B3HA 2V0GA 4CWAA 3E15A 5IH7A 1AC5A 1Y3BE 3WNZA 4Y6PA 2H5JA 1NVMB 4EX7A 1J9GA 1QDUA 3EGDB 1XXHB 2HW3A 1KK0A 3G88A 1E3JA 1TIPA 2QMUA 4AP5A 3EXFA 1VYUA 2VTDA 4LEIA 1QDLB 4UPEA 4Q3DA 3HDYA 1L4EA 4HQRA 4KLAA 4JL5A 3IQWA 4DA9A 1OFGA 1Z39A 4M1TA 3HYTA 1N8KA 3WSWA 1FO4A 2I7TA 3BPSA 5DT9A 1H4TA 1SJ9A 4Z1OA 2BFBA 3L0IB 1OLUB 1XRRA 5EINA 1MB4A 1Y3HA 2Q3CA 2JEJA 5IG2A 3DYBA 4YXWA 3P27A 3DFFA 4HN4B 3FGOA 1UA1A 1P7YA 4MROA 1P4SA 5GZ3A 4K9RA 1IB0A 2BKUA 3OLWA 4ARSA 3P4UA 4D99A 2V96A 1DQNA 4QUIA 2CEAA 4MV5A 4WH0A 3UKOA 3P0EA 4RS4A 1JSLA 1C3VA 2HBYA 1WXXA 3A1NA 3KE9A 1CXZA 2OWDA 1YO6A 4CG3A 4CM9A 3SS8A 4FYWA 3V8RA 5CEFA 2Z9CA 3PWKA 2R6ZA 3OFVA 1JWLA 1YF3A 3ZGYA 1NVEA 1QSYA 3H5VA 4GI7A 2VZLA 5A3QA 1C2YA 5CFOA 4IIUA 4LISA 4ECAA 1XRJA 2I65A 4WBXC 2J0EA 4UE6A 4XIJA 4C5AA 3EZ9A 2JHCA 2FF5A 5KEIA 4BJ3A 4CQMB 3TIIA 3IV9A 2R68A 3QELA 3DEEA 1ZQSA 5A3RA 4LRUA 1K08A 1OYOA 5TY0A 1MT3A 1ULBA 3OM0A 3CR3C 1LPOA 3RB4A 1MJ5A 3S29A 3ISVA 5CNKA 3QUTA 3FW1A 1IAVA 3AI3A 2AIRA 1CUXA 3EVGA 2DGZA 4I2CA 3AHCA 2AT1A 4BV9A 1F0PA 4F45A 4BVFA 1COWA 4YRPA 1Q0ZA 5EWJB 2E4ZA 2FX3A 2QZZA 1T2CA 1Z37A 3G6WA 3CLRC 3MQ4A 4WCFA 5ECYA 3IIEA 2I2WA 3ANYB 1IN8A 1JU9A 4BNUA 3R9IA 2GDZA 2Z5LA 4K4HA 1Y3DE 3TNJA 2OZLA 3FA2A 2MAXA 1JWBB 2O2DA 3KQUA 3ZD6A 5B6PA 2O2ZA 5JYDA 3RLFA 1QLJA 2PKEA 3I8OA 3H84A 4C2AA 4UBMA 3B0YA 3UANA 3WGNA 3BRQA 4IV8A 4Q12A 3OEYA 1RWKA 8ICVA 4PYOA 2FEPA 3V6JA 3OCYA 4KX5A 1ICIA 4R7GA 3ALRA 1SIOA 2EYUA 1Z2DA 3OP4A 2I66A 1O4WA 5B1EA 3P0HA 3RABA 2FPKA 2D1RA 2VJMB 4LZWA 4OCZA 1Y1KE 3ZCQA 1KYQA 2W6IA 4Q9HA 4IEEA 1LFDB 1G21E 3ZVNA 2XZDA 1MB9A 3Q12A 1V95A 3Q6IA 5SYAA 2GN0A 4JA2A 1D8AA 2LMRA 3AONB 3QF4A 3H4VA 2QS9A 2N1BA 1NU8A 2YJNA 5H4GA 1Y6GA 2JR5A 4Q4JB 1N8SA 3WDMA 3R7DA 1C9DB 1H4SA 1EFTA 2D1YA 3H8JA 1IATA 2OD9A 2F8LA 1Z38A 3DOEA 1O5TA 3JWJA 4G0WA 5CX4A 3HUFA 3D5QA 5D5PA 4E3ZA 4G25A 3W3AH 1JMSA 3EQ7A 5KTTA 1OZHA 1DCFA 1YZ3A 3GIMA 3N3BC 4B74A 4MR8A 4Y3UA 2VF4X 4KV9A 1KS2A 4NL4H 2VF8A 1LUAA 2HQ1A 3L1UA 1E6CA 3E70C 5EKDA 2F1KA 2OZKA 5AD1A 3C14C 1FTQA 4US0R 1BJTA 1ZY2A 2VYNA 3PGVA 1WE2A 3HUDA 1WKBA 1E64A 1NZFA 3GCGA 3M9WA 4QEKA 3VU8A 1I14A 4B43A 2Y8EA 1SCBA 4ROTA 1ZCBA 1EVKA 3D64A 3T3FA 2FEXA 3L05A 4IQ0A 2ZS8A 5L6MB 3F4BA 3OQVA 2P4EA 3AQFA 3MSXA 4BDPA 2Q5OA 5ES4B 5F21A 2QNRA 1CZKA 5J0TA 5DNWA 4YAIA 3B6ZA 4H7DA 3MC1A 2AN9A 3VDXA 1KRPA 1GTL1 2ONYA 3ZU2A 2PXHA 1BXGB 1P3JA 1LI5A 3PW0A 3H2ZA 1LSOA 1RI5A 1IEXA 3HCEA 2AD1A 1N5RA 3K1AB 5CEJA 3TW8B 4KO1S 4YRCA 4M1SA 1Y6QA 1TVCA 3P9PA 4IRDA 2XAAA 3FNQA 1CUJA 2WZQA 2Q99A 1YUMA 5AM3A 2IYVA 4HC4A 1GNVA 1L7QA 3JR7A 3PXDA 2G1JA 3KQHA 1F0MA 3VHLB 2JJ1A 2Y0PA 3D6AA 5EP4A 3W8NA 2OO3A 4DSOA 4TL6A 4PQFA 1CCWA 3HJEA 3OTOB 4KNVA 4NIMA 2QLLA 4CXMA 4EZ6A 3DDUA 2C00A 4NM2A 3FHCB 3U3ZA 2OFPA 1GFZA 1F3LA 3LZDA 2I5HA 1T2NA 2FG6C 3MXTA 1BIFA 1Z2CA 4ZOLF 1YDGA 3V1UA 5DHTA 3GFVA 3HN2A 4XB2A 1SXHA 2M6LA 4GVPA 2YWXA 4AJIA 3MJSA 3FNIA 1YQUA 4M9XA 5IC5A 3QX7A 1NDUA 4G0YA 2HTFA 1SH7A 4A6EA 1MBZA 5EJ7A 2NQTA 4ZQHA 1LSSA 2OA0A 5HIJA 1Z13A 5DULA 3PUXA 3ND9A 2PO5A 4FYYA 4HRYA 1UL1X 4WKCA 2PGLA 3IVMA 1PYDA 3K30A 2Z1DA 1YH3A 3WV4A 3CW8X 2DKFA 5EJ2A 3LBIA 3DA8A 4RPHA 5IYZA 3MTQA 5HR5A 2MYUA 2ZE7A 1H6CA 1EB8A 1Z36A 3RK4A 1REQB 4V3BA 2GEUA 1ECCA 5LU9A 1ZLYA 1KVRA 1W88B 4DUGA 4TTJA 4KRGA 1TKDA 1VC2A 4X60A 2VLBA 4S2EA 3MJDA 3VDNB 1A3CA 4TXJA 1EA5A 1N8TA 2BBSA 3SFTA 3BA1A 2EG9A 1W5EA 3O3NB 1YNOA 1F48A 4GLBA 2BR0A 2IYTA 4UU0A 4Y9UA 4KLFA 3HCWA 1U0FA 1CDZA 2JVIA 1DRKA 3SDBA 4CEIA 3RVLA 3CLSD 3T5MA 5FD8A 3GEIA 1YS4A 5LMCA 4BE7B 4F4ZA 4KPUB 5T6MA 4ZAGA 3RVJA 3KE8A 3VJKA 1C8BA 4Y2GA 3THYA 2XB6A 4RL4A 2ES4A 1W36B 4UUBA 1LDBA 4M88A 2W2LA 2OBFA 1TIKA 1QU3A 2Q1XA 9ICTA 4LXUA 2H3HA 2MSCB 4MS3B 3X1KA 2P4HX 2R66A 3OHPA 2JBHA 5L4NA 5D3MB 1E79D 3A9RA 3IAM6 4R8UB 2CZGA 5DKWA 3ND8A 3CZPA 3L04A 2NU6B 3TQHA 5H81A 1NW8A 3VC8A 1W9MA 4IG9A 4PAMA 2A9VA 3CTMA 3SY8A 2RIRA 1QUEA 3ZY5A 3ONVA 4MDYA 1PVOA 3IALA 3P2EA 2QKYA 4GKBA 4NPHA 2Y99A 4MEYA 5KZMB 5GJVC 2HSDA 5G0TA 2UZ0A 2WU1A 3OZUA 3UAWA 1ZQMA 2IHUA 1YRAA 5L1MA 1BH2A 4NICA 3DZGA 2EFYA 5KYGA 4TUSA 821PA 4GYKA 4YCNA 1ZQDA 1KH2A 2ZTSA 4F4YA 3OE7D 2NZXA 5ENZA 3F67A 2BT4A 1U4BA 4XDZA 3BB1A 2QTTA 3A2NA 2H9IA 2VPQA 2EKBA 3V97A 1OZGA 5ELLA 4LVNA 1XMSA 2Q6TA 2QDXA 2PU5A 3QXGA 4O3RA 4WERA 3U4DA 3LGSA 4AUMA 4DSNA 3QU2A 3DEJA 3KEQA 4I9FA 2GESA 3F4LA 3TYXA 1T9GR 4KFUA 2A9PA 4YV7A 1T3TA 4LRWA 1TJ3A 5CFPA 2J9ZB 3C3YA 4TSKA 2CXHA 4EUEA 2Y77A 1LNQA 4WJKB 3S6JA 2VZEA 1QTRA 4TYPA 1B8UA 3I01A 4V0NA 4B2PA 5G3YA 3O8RA 3PE6A 3K9QO 1G0OA 4YRFA 2J6TA 1HDZA 3G2QA 5CVUA 5F3WB 1GPWB 1FUKA 1ECGA 3GIWA 1NIJA 2AN1A 2P7IA 4FT4A 3TACB 3U13A 5EHZA 2V7TA 1JH8A 2WE8A 2QN8A 4RL6A 4KMRA 2C9OA 1UF9A 1YR6A 3PR5B 2EKZA 5MN6A 3B60A 3INGA 5LQNA 4IIJB 3NXSA 1RXEA 2GF0A 2JFQA 1CYDA 5DYTA 5BRAA 3X43A 3N28A 4CF7A 4QRDA 4FE7A 4ICIA 4KACA 3QKIA 3LP6A 3BGDA 4QVIA 3D8NA 1FRVA 1FXSA 2P65A 1IZ7A 1CIVA 4XTCS 3QI7A 5DBEX 4OFWA 1FQKA 4U0KA 3AILA 1BVSA 1N0VC 2GKGA 1KJ9A 4UBJA 5BN5B 4S0ZA 3WFIA 5DJ5A 2DY0A 2PNFA 3N70A 4QAQA 4KKVA 1BWQA 4Q37A 2XVZA 4WY5A 2H2GA 3SR3A 3E4CA 2FXIA 1CULC 1C1DB 4HGPA 4OP2A 3FPAA 1IQUA 1Y4SA 3QXJA 1O95C 1T8WA 1OPRA 3GQBB 5LL6P 3KHSA 2DKOA 1OIVA 5CITA 4L27A 2CLSA 4RCVA 2EERA 4Y6SA 3SAGA 5AOAA 3DUWA 4G0VA 3EPIA 1VCOA 2JNWA 3PEEA 3W6NA 1X9XA 2HDHA 2REBA 3PEWA 4YDQA 2WD8A 4L0MA 2WJIA 4OJPA 1P0CA 2OHOA 3PCRB 3WXMA 2JIZD 4NCJA 4BNIA 4ALJA 5G5GA 3URMA 3G9UA 4J4TA 2JIDA 1OXKB 4Q47A 3Q1KA 4KLIA 5FUWA 1N6KA 4Q1CA 3MMNA 4ZT5A 3L8HA 4JNKA 1ZC4A 4XQGA 3GC6A 3W8FA 1ZQYA 3CZQA 5A7HA 4HNUA 3KYCA 1H3EA 2PEYA 2XB8A 2IPOA 4Q39A 3KOWA 4DEZA 3VTFA 4LECA 2WSYB 1NY6A 1S0NA 3HMQA 3FSGD 5L3RA 2YVQA 1SV0A 4PFQA 3NQ41 3IJPA 1MKYA 4OUKX 3E9NA 2WJVA 3I4LA 2CUKA 1M6HA 2JH1A 5KT3A 2A86A 5KFPA 5B1DA 1EB9A 1QIIA 1Y81A 1E5TA 3H0MB 2IBSA 4KLZA 1SBYA 3PL5A 1NMXA 4I8DA 3C29A 2Y9UA 2CXUA 3OKAA 2GJKA 3WQBA 2AW3A 1QWOA 1SCAA 4H6XA 4R1SA 4WKOA 1XQ9A 3IIMA 2HMUA 4XIFA 1Y4ZA 3JARB 2QPAA 4JKOA 3T3GA 3QE2A 2IS1A 3WMRA 2EAMA 3H9CA 1ZUIA 1DV2A 3R6WA 1F06A 2B94A 5LKAA 2AMLA 3UB4A 3H1PA 4TQGA 4JQYA 4AKGA 5I9LA 3SJBA 1GRRA 1HFWA 4DLPA 2OXRA 1AKYA 3OZDA 1JB1A 2O5VA 2FMTA 1HTWA 5E8RA 4G3IA 4C5BA 2H7VA 3O73A 2AVNA 1XK6A 1V5EA 4MQLA 4WJLA 1PJ4A 3GLHE 1EFPA 2AMJA 3OBIA 1ZM2A 3ZLBA 4PXAA 1NI3A 1N60A 5DRYA 4AYWA 2HHHB 2BN4A 2EYQA 1QU2A 2ZDGA 2WAYA 1N36B 3HVHA 1XMVA 1SN7A 3T15A 2IKSA 3RVOA 3IEIA 1YULA 3DW1X 2XNCA 4D3YA 1SXDA 3R0QA 1G55A 5KWIA 1ESDA 4AY5A 3HP4A 4ZANA 4CODB 4ER7A 3B89A 3RV4A 4OIFA 2G67A 2NW6A 4BEBA 1VDMA 4D25A 1BDJA 4OI2A 2NX2A 1CEZA 2YWCA 1DE0A 2QRHA 1X7GA 4OPMA 4TS9A 4CV0A 3NFRA 2Z08A 1JJIA 3QFRA 2W54A 4XWTA 1UC8A 3ZZ1A 5DXAA 3TEMA 1U1IA 3ICPA 1YRHA 2QRJA 2C58A 2QVZX 1Q0PA 3WYDA 1UOQA 1VPWA 3SCZA 2IZ6A 3FMVA 1R4MB 1SR8A 1EH5A 1NJ2A 3G5LA 2P6MA 1LRKA 1BDIA 3ACCA 1J2UA 2HQRA 3BKWA 5CR0A 5FFMA 4TQAA 2HVHA 1VPEA 3JD0A 2IBTA 1A04A 2QA5A 4L4YA 5K51A 3M9XA 2GFHA 1VL1A 4MWCA 3ZDCA 4YXWD 1FP2A 5JY1A 2K7FA 2CY0A 3MDCA 4WKPA 4KEAA 4YJ2B 3HXKA 3NC0C 2O3RA 4D0GA 4IH4A 2WT9A 2CD7A 2WT8A 1DADA 1T0PA 5BRNA 2PS9A 3NOXA 5HRUA 3FUTA 3HKEB 3NALA 3AO0B 3REQB 5E9JA 4BNDB 1OWPA 2A1UA 4PQGA 3RT7A 5LC1A 4E30A 4R1LA 4JP1A 3FPFA 5IKMA 1X7DA 2XY7A 1E20A 4LE2A 5LWHA 4KN6A 3RH5A 4CM9D 2PH5A 1PR5A 1FOEB 3LLVA 2RB5A 4B82A 1YBVA 4YAEA 1Y9EA 5TT1A 1UBNA 1G20A 3GO4A 4YJGB 1AGXA 3C7TA 5CG2A 1RWVA 4CHGA 5KG5A 1BZYA 4BAUA 2IOYA 5DNCA 5CCXA 5BYJA 3UXOA 1ZHFA 3L3FX 3MINA 2CXNA 5HOEA 1LEHA 3F6EX 2DPLA 4TLLB 4WFIA 4YJ3F 3E9MA 2GEKA 2XW6A 2ADMA 2YYSA 2V5AA 4PXYA 1I80A 1L7VC 3PC8C 2IWRA 1N3LA 3GVPA 1DC8A 2ANBA 1Y3CE 4QO8A 1OFUX 1A0PA 5UKDA 3U44A 3WNVA 2O7NA 4KK4A 1JDNA 3GJ7A 4EYQA 1ZZGA 4IX9A 1AKVA 4ZEWA 4MWGA 4ON9A 5F2EA 5LZ8A 2LYHA 5IUJC 1XYYA 3DMYA 4NQRA 4Z7JA 3L8CA 4UNIA 2QVCA 2SCUB 2ZTCA 1W0JA 3MJCA 2R79A 2GCEA 3DCIA 1GNSA 3IRVA 4PHAA 5EJMA 2AL7A 3EA5A 2J41A 5D1NA 4XVCA 1Y6FA 1DMSA 1FNMA 4ZGBA 3KLMX 2PE5A 1ENOA 5AK6A 3GP3A 1I4OA 1G4HA 4LSMA 1CUFA 2DF8A 1YHYA 2IXFA 3PFIA 2PLRA 2HT1A 2PL9A 2B4RO 2YC2C 4YALA 3E8XA 1DIAA 1E3WA 1ORWA 2GT1A 1W8DA 5AW8A 1H2FA 3J80A 4DQRA 4H4EA 1I13A 1DO8A 3N05A 4JENA 5AUOB 1IBKB 3V6MA 5EC8A 1DZIA 4RKEA 1ZGJA 3CP8A 4RD1A 2QXTA 1XTKA 3NORA 4ZRMA 9ICJA 1XEFA 2W6ID 3HK2A 3GPBA 1CDDA 1ZJZA 4P1ZA 4H7EA 1MC1A 2V58A 2KE5A 3OD1A 3ZBPA 2C7OA 5K3CA 2OHVA 4I5GA 4LGYA 1Q0QA 3PD0A 2GRJA 2LV8A 3AHJA 1TCUA 3AR9A 4ZGWA 4NMMA 3BK7A 3AL0B 4JUDX 4KPYA 3VSAA 4JJIA 5ALJA 3KKKA 2KVSA 3RYIB 3WLSA 4TM8A 4PG8A 4LDAA 4F5WA 3JAKA 4Q7QA 4J43A 1ONOA 3HKZC 2F3UA 3HBAA 3PHIA 2RK4A 3LV8A 1TEZA 4RDXA 4H7HA 3E2PA 4DLWA 1WMAA 2DGDA 1BVYF 2EWMA 3GA7A 1G8AA 4KN4A 4YUVA 4GLLA 1K7SN 1HE5A 2IL1A 4D45A 4R0MA 2A2ZA 1IUOA 4D9IA 1RQNA 5HFAA 2VYND 4HDRA 1WHTB 1TW3A 2FZ4A 3MAJA 3S27A 3EIQA 3SZ3A 4KE7A 2ZRJA 3AUFA 3VR4A 4XSHA 5FPKA 1ZM9A 4CR8A 4JOCA 4KWIA 3BCSA 1TK2A 2D7DA 1P81A 1XKLA 3CCBA 3AHGA 3FYHA 4HF7A 4LA4A 4C4PA 3C7DB 4FS1A 5C1BA 3L9XA 1JDBB 4G5FA 5J9FA 4JV2A 1P2FA 1U2DC 4R1MA 3GMIA 3OOHA 1QH8A 2W8BA 2A1JB 5AHXA 2IPAB 2CLLB 4P53A 3K1ZA 3AVXA 4Z7OB 4WN9B 3VQTA 2HPZA 2HNAA 4R31A 2BFEB 2FWAA 4DCTA 3RTCA 2G09A 1SVMA 3OECA 3SF8B 2X9NA 3CLUD 3CM0A 1GTMA 4FMBB 1S02A 1GKIA 2HHXA 5ITWA 3RV3A 4NXMB 3EARA 4XPZA 3WBJA 10MHA 2R4UA 1U7XA 2WPDA 3RK0A 4TTIA 1QVZA 2UZAA 2O2XA 2C5FA 3GJ8A 4YN4A 4DCJA 3ILXA 4Q1FA 5D46A 3WFJA 4OJMX 5FLEX 1KZHA 1QAMA 5ENDA 5BNZA 2NU8A 1FF9A 2DLCX 1Q2UA 1Z73A 4OB6A 4DR4B 1XALA 4B45A 4OI1A 4JK1A 3PUKA 5IUNC 1G1AA 2YNMD 4UEQA 4CT4B 2V6IA 4DIEA 1ZQQA 3WTCA 2O0HA 4F3KA 4PCUA 5ALOA 4B6QA 1JROA 3KB8A 4CQLB 4RK4A 3MELA 5E2AA 1UXKA 2QE7A 1NF8A 3GBVA 2BC9A 1KAGA 3OICA 1L4KA 1DTEA 1PT5A 4EAQA 1XAHA 1TGVA 3OO0A 5FI1B 2VDNB 1IG6A 4N01A 2CJYA 1XP8A 3D4PA 1I7SB 3SYKA 5C8XA 4Z5XA 3RRXA 3ZY4A 2AHOB 1JX4A 5JAPA 3FKSA 1R50A 4UTRA 4Q4DA 3LCJA 1IRXA 1IEVA 1SCQA 2WJ3A 5AQEA 1PFQA 4IUCS 4Q4HB 1DGJA 1FFEA 3DOCA 4D9CA 4DLUA 2MYNA 2CJFA 4G37A 3AUJB 3FLBA 1H0SA 3MYYA 2V9PA 2P8JA 1NRJB 5JZVA 1QG6A 2F17A 1DO0A 3BJEA 4ESEA 4MV6A 2P41A 4NNJA 4QUAA 5L7WA 2FGJA 4RD4A 4JLMA 4N0QA 4M2YA 1QFZA 2VDUE 1KZGB 1SD1A 2PCJA 2VTBB 3JPRA 5KCMA 1KEUA 3GN2A 2AW5A 2J3QA 3U61B 3AR6A 4ZO9A 4FZ5A 4EKYA 4CM6A 1J7KA 3KS9A 2DBQA 1J0EA 4M7RA 1Q7GA 3P2MA 4W1QA 4DLTA 2JBAB 3F6CA 5AI0A 1ZJMA 4L07A 3VU0A 3EA4A 3GUCA 1D9ZA 1BEZA 3TZHA 3M9NB 4GPAA 5EIAA 2HF8A 2BZGA 2GPAA 2Q1YA 1XC7A 1UJ2A 4JI3B 1UK8A 4DXAA 1WUYA 2OGTA 1G8PA 1LZKA 1ZQWA 4JSTA 1CUBA 4RANA 4BN0A 4DXDA 3D43A 1ENPA 2O1EA 2XJ4A 5K3BA 4ENWA 1XCJA 2PQ2A 1USKA 3AQ4A 2V74B 5ALPA 3UTDA 1FNCA 1HF3A 2DFDA 2FMQA 1VM6A 5I7HA 1XD2B 3ESBA 4Y8VA 4QDZA 3ZY6A 4R2KA 4EHLA 4P9NA 1PU2A 3VR3D 2VSXA 1WU8A 1YU6A 2IIBA 1RWWA 3IAFA 3C7CB 3OQMA 1JE1A 1BE6A 4D4IA 2W00A 5GVSA 3V1NA 5BR7A 1LDMA 2XCLA 5TR9A 5A9TA 5JAZA 3MHPA 1OXBB 1IVSA 1BXZA 2H65A 3EF3A 4B2LA 4PNHA 2DHDA 2IYXA 3NEPX 3T7DA 1QYDA 1PGQA 2FPIB 4GQIA 3C4JA 1OW5A 1J23A 1OBOA 4XDYA 2P2YA 3RRNA 1A7UA 4A8HA 3FFBA 1DC6A 3VA7A 1XR3A 4PONA 3C1YA 3NNDA 1UEXC 4C0HA 4KR7A 3M3DA 4C0XA 4F4UA 4LG1A 5L9AA 3PXBA 3REFA 2E82A 2OVFA 1MRNA 3U1VA 2E18A 4BTLA 3GJ0A 1DFIA 3MWGA 1SPXA 3F2IA 4RLSA 4DA6A 1IK4A 5CD9A 2HFKA 1SXEA 2QR5A 3H2JA 2JZBB 1RHUA 2F1RA 2ZJ6A 2FW6A 3TLAA 4KTTE 4MVCA 3T5JA 1D09A 2G7ZA 1PFWA 3M6MD 1V7CA 4H35A 1F20A 4Z6FA 1VL2A 5F1PA 2OBNA 2PGOA 5JRDS 3L6EA 3COVA 1M75A 3KJNA 1B8PA 3PQ7A 2RARA 3A11A 2XUJA 3BE8A 8ICWA 2XR1A 1L3CA 1SKUA 4K6HA 4QVKA 5A3SA 1KFJB 4YA6A 1UP7A 2B7CA 1CY7A 1RNLA 3NH9A 2IMWP 3L6DA 3QYAA 3VI3B 1YC5A 1TTPB 3A6DA 1XTUA 1D9DA 2QOEA 4O2BB 4IIGA 1HG0A 2HK8A 2I1LA 2EZUA 3H6HA 3AMZA 3NV7A 3GA0A 3JYOA 2HEIA 3KSUA 1MPXA 1QE5A 1YU9A 2CL5A 2WV7A 4HTAA 1ORIA 2RHMA 3GARA 2XWPA 1DJMA 4HYQA 4O2RA 4YAJA 4RA9A 1L3VA 3WJ2A 4UAZA 3W7BA 2BFPA 1KOFA 4MA0A 1FQOA 3PUJA 1N6RA 1IL0A 3GAAA 1BDMA 4J0QA 1E2BA 2CDCA 5H1YA 4QQNA 1K5GA 4TLDA 1YBFA 2GRAA 1X70A 5FBVB 2C59A 1D0VA 3OUZA 4LMAA 5DM2A 4EYOA 3U4QB 3PNYA 1DIRA 2VP0A 3HEAA 2ZJ0A 4TTAA 4REQA 3ZLUA 5CCBA 4ELTA 3N9IA 5EYPB 1YUBA 3UMSA 1OUQA 2XMRA 4O25A 1X3SA 4TTRA 3NBMA 3TQIA 5G40A 4GOXA 4RV9A 1DOAA 3JQDA 2NRVA 4XWOA 3TOSA 4QGHA 5GOTA 3ADKA 3ZCVA 3MBIA 4KNYA 1FUYB 3PFCA 2J07A 3F97A 4BGVA 2O8BA 2VDWB 2VAMA 3HA5A 4EPVA 2VPIA 3JPOA 3PDJA 1SO8A 1VJGA 4BO8A 2EZTA 1DBIA 2FPXA 1N92A 2FUG1 3NNNA 4OJYA 2BUAA 1PJRA 1MX9A 1EHYA 2K8AA 1GNTA 3REOA 2XUIA 2A1IA 4BJHB 1Y7IA 1KI4A 4J1QA 4X8MA 3BSSA 1QC5A 3E3OA 4EJSA 4F60A 4IHJB 4Z7QB 1T13A 2YN0A 3ZHTA 4JJ4A 4QSHA 1J97A 4DV4B 1TUIA 1NP6A 4AZSA 1AMOA 4LWQA 3AEUB 3EOZA 3ULKA 1V11A 4GZMA 4O08A 2YB4A 1Z6QA 1L6IA 4UHEA 9ICRA 3LRXA 4BDSA 1T5TA 3L82B 3ONEA 2IP4A 4E6EA 4MHTA 1E96A 2BW0A 3GV0A 3U60B 4G5OA 4GC6A 2Q3EA 3H16A 1NULA 2P1DA 3BMQB 3MVEA 3GHHA 1DHRA 2PX8A 4RF4A 4PANA 3B1KA 4BB5A 1UQRA 1XMQB 3T5HA 1ISHA 3DBLA 3DOHA 3T3DA 4TMYA 4U7CA 4YI5A 1TD9A 5FB3A 1BSVA 2JRLA 1T3QA 3L7NA 2ZYTX 3PKIA 1OC4A 1JR3A 4QZVA 1OAOC 2V3CC 3UPTA 3TLJA 4YO8A 5DP2A 3G9TA 3TRFA 4R81A 1OT3A 2D1SA 3FOAA 4QX6A 4DIFA 4DZZA 3L0CA 3R40A 4EGCB 1GILA 3DD1A 4XUEA 3OC0A 3VOBA 2PS1A 4WVLA 3K20A 1Z00B 4M9HA 4JVOA 2QXUA 2VFAA 2OZEA 3ZCUA 4BQOA 2GYWA 3FGPA 1WTAA 2QM3A 1E2KA 3CR8A 1JHAA 3VR2A 3GX1A 2Y05A 4EYHB 3PG5A 2P9YA 4QQKA 4COOA 1NW9B 1YS7A 2XQFA 3VMFA 2ST1A 4HXYA 1T3HA 1EXMA 2F7SA 2OCLA 3FNGA 1YRLA 2JI9A 3NH6A 1PK8A 2B37A 4QGSA 1N5WA 5ABPA 2BMJA 4EPRA 4C9BA 1E9EA 4Y6RA 1BE1A 1JDBC 2CVFA 1H9AA 3HGMA 3DG9A 3GPIA 4RACA 3ADBA 1PCXA 1VJ1A 3EZ2A 4L5AA 2X9GA 1R6XA 3STYA 1U5BA 1P91A 3TX2A 2AQIA 1DK3A 1NPDA 4XUDA 2WIJA 3VNSA 1K3UB 4DL6A 4Y7CA 1SB8A 1AK1A 4M0KA 5CU7A 5E6UB 1S0VA 5G0SA 1QSGA 3GLIA 3DWEX 1NI5A 4MZDA 4URWR 3ZJ4A 3FKQA 3B8HA 3HCAA 5F5NA 3DV2A 1B0XA 5E7MA 1KPHA 4H15A 3OQIA 3SLGA 2VJNA 1DWQA 3LYAA 4B3IA 4J6EA 5H5JA 4E21A 2JFBA 1U45A 3GFKB 4KQ9A 1B00A 2EBHX 4TWJA 2HF9A 5C1DA 3O9ZA 1W93A 3WAGA 1WXHA 5H9VA 4Y67A 1NE7A 3S2EA 2W5UA 3ZDXB 4CW7A 1FS4A 1R9NA 3L7OA 5L3SB 2JCSA 2BKXA 4LYGA 4NG5A 4PTLA 3B7PA 2R96A 2JLAA 4PVCA 4S12A 4RTKA 4XEUA 4PX9A 5J29A 3WL8A 4IOKA 4BKMA 2G72A 2QY6A 2Y9PB 5J2BA 2I87A 3RF7A 1ZIDA 1NQTA 4I50A 5TPZD 4UHJA 2X2PA 4IJ5A 1RQXA 2FPWA 1N4DA 3VPHA 4OYHA 5KOJA 4PS0A 3IX7A 2PGJA 3BAFA 4MUAA 4AF6A 1UT5A 3G23A 4X3PA 5AXDA 4OB7A 5AI9A 3NXKA 3E48A 2J3EA 2Z6VA 3K5WA 4WXHA 4EENA 1M2VA 4NF2A 3GJRA 4F7DA 1SPBS 4J0CA 2HTEA 2DPMA 3U40A 3PNOA 3MUOA 4B3CA 4U7HA 4ER5A 1UJMA 5DM70 1NBAA 3VYRB 5GIOE 4AJNA 1XKQA 3WLNA 2AOTA 3UEOA 1DJQA 1HEUA 3ESYA 1TAUA 1CIJA 3TM4A 2Q5QA 1T2DA 3TSOA 1LS1A 5ES3A 2O8EB 4RTOA 1GTJ1 4HNQA 2AD5A 1J9ZA 3O8QA 3BJIC 3RVRA 3CRQA 5F4BA 4QQ8A 3UHJA 1ZCAA 3L1VA 2GPSA 3A7EA 2F3TA 1EWQA 1DTWA 6ADHA 5KIAA 2RJ3A 3LWZA 1GL3A 1JXEA 2YWBA 1AHHA 2JW5A 2XYVA 3TQQA 1DDOA 4DSUA 4LV8B 2XYHA 5TEWA 2X13A 3AJ9A 4KXVA 4Q24A 2XT6A 1QYRA 5TVGA 4MP3A 3CEJA 3CJRA 3Q5DA 3K94A 5J5AA 2LIVA 4NABA 3P19A 2FA9A 4GAEA 2Y1KA 1N2JA 4BKUA 2H08A 1YV9A 2GCPA 1E3TA 4V1CA 3CT6A 3QNUA 1EUCA 5LMUB 2AN4A 4KXQA 3EWIA 1SUDA 2KKPA 1AMNA 5AR1A 4BVJA 4J3FA 3OX3A 2MU1A 2R47A 3MR2A 4YRAA 1F2TA 1NQXA 4BPBA 3WO0A 1ZMXA 2VP2A 1N0HA 4P5PA 3B20A 5CVTA 3G68A 4UOQA 3FOEC 5CNMA 3L8MA 1XXHE 1FFSA 5AJUA 1PTKA 4PAQA 2HPVA 4BMXA 3SEZA 2UAGA 1H66A 1M2KA 1MEJA 5BYKA 4OJNA 2RGDA 3QVGB 2NZ8A 2DPIA 5KPJA 1SXQA 1M1XB 3JQGB 3AM5A 1YMVA 1C0LA 3FJYA 1LV5A 3AP1A 3OPMA 2KK0A 1IVYA 2C97A 3IE2A 1DZ3A 4U5XA 1CHNA 5HJ7A 3NUZA 3NUGA 4IXTA 4NMLA 1KIMA 4M0UA 2ZJ5A 1BPXA 2WW8A 2Y9MB 4O2BF 5KYUB 4YQEA 2H4YA 1E5XA 3MGVA 4HYEA 2VJCA 5TEVA 3ABSB 4BLOA 2C8LA 1ISSA 3MIZA 4OJLA 4S0XA 3D59A 1L0BA 4EHDA 4NLCA 3AYZB 1SIUA 1QF9A 2GNPA 2UZ3A 2UZ1B 2XEXA 5EUBA 2H5LA 4QYIB 1G291 5IKXA 2QRQA 5LXTB 3QBEA 3TNDA 1X8XA 3R9XA 2XX3A 3CRRA 1JXOA 4LQDA 1P8AA 2XECA 1KQNA 4XWGA 3T7KA 1XZNA 2OECA 1MO3A 4DRYA 4ZTUB 5DQGA 4FD3A 3QNMA 1X7ZB 2C0PA 2WPDD 1JQAA 1GFSA 5P21A 5B6JA 4QJ5A 4MVJA 1BYUA 2XOXA 1F8XA 4EW6A 4C6TA 3RB0A 3GV5B 2WF9A 4MV4A 1AKUA 4O0IA 1TECE 1ZM3A 3TK1A 2OGZA 4D6XA 4LTDA 2YC4C 3OJLA 4E5SA 2AZMA 5KFMA 5K4AA 1QH1B 1DC5A 3ETJA 5BN3A 4DM3A 3FNHA 1Z4OA 2RG7A 1TVKA 4ACAA 3MEQA 4YCJA 4EQ6A 3CNHA 1LH0A 1JKFA 1DS6A 2QE7D 5T4BA 1MF7A 1ZAKA 2ZYIA 3EXAA 1JAYA 3RC2A 5DRTA 4N0MA 3RG8A 1YMUA 3IBSA 2P3SA 4AVYA 4RVUA 3NT4A 4V24A 5T41A 2JK1A 3GCZA 4WI1A 3TEFA 2QB0B 4U7JA 3OJFA 4D6PA 4NNOA 1IZ0A 4Y98A 3O9MA 1Z7YA 3SV4A 2HSEA 3AB3A 1G5HA 3OU7A 3KPVA 4MDFA 2BPFA 4DEVA 4IBOA 2YN2A 2YUTA 3CSDA 5JSZB 5BOSB 3V2HA 3ZHBA 1UHUA 5KSPA 2RC5A 3IPLA 4XYEA 1Q15A 4B4WA 5CHYA 4AURA 1T0HB 2X76A 2VA2A 2BCSA 3RSGA 1L7NA 1JECA 2OMKA 4PCVA 3FCCA 1JLRA 3JQRA 2W2KA 2Q4EA 4EF5A 4BVEA 1U9CA 3QHPA 3SNHA 1SC9A 1QANA 1U8XX 3QTBA 4MGHA 1N1MA 4MJXA 3KTAA 1TA9A 3P4XA 5LZ2A 1XPOA 2PRZA 3HLKA 1N6LA 1EFVB 4XFJA 4AZ0A 1NOIA 1NXOA 3SBOA 3VPFA 2ATVA 1EXVA 3EJWA 3HJRA 5AKEA 1T7PA 2HHVA 4HS9A 4GLJA 4DGQA 2QX4A 1T5BA 5CDYA 4QWBA 3GRAA 2BRUC 4S24A 1N9GA 4HV4A 3JQBC 1LLQA 2CCGA 2O8FA 4L22A 5G0WA 5K0NA 1U4SA 1HUZA 3O6VA 1GTRA 1K6JA 3ROZA 4ER0A 5AKXA 1A9TA 3M6VA 3EFHA 2GM4A 4TKUB 3OUTA 2FMPA 5A03A 1J33A 2UDPA 1JW9B 2O7SA 5ARBA 3WX0A 1PV1A 1RC8A 3DT6A 2PUEA 2J3JA 2GZ3A 3IBGA 4MQUA 1JMVA 2NRTA 2D3DA 5A9RA 2GN1A 3E3AA 1VXOA 2FPPB 3AWIA 3N86A 5ICFA 2O6KA 4OLAA 2KJ9A 1DRGA 1X7YB 2CXXA 1ZH6A 1XJWA 4QBIA 4FDAA 1QO7A 1F0YA 2DHCA 1TEHA 1KL9A 4WFQA 1Z6XA 2YYAA 3U09A 4ZAZA 5EA2A 2H5EA 4U7TB 5AKLA 5GJBA 5KYKA 5LMNB 1KW4A 1JFSA 2WMNB 2RONA 5EMLA 1VCMA 3GH1A 4CG1A 5CFNA 3IFSA 3MWFA 5HQ3B 5CA0A 1E4EA 4P4PA 3FIJA 2X8LA 3OD5A 5AVQA 1T8TA 2W6QA 1O03A 1MZVA 3BEDA 3WGJA 4RS3A 3IQXA 3AVYA 3CEHA 4CKEA 3O75A 4EZBA 4YCMA 3AKDA 4QNNA 4KPEC 3WU2U 3IYLW 3RVQA 5ED0A 3D3EA 5DE3A 2QUKA 4DC0A 3L02A 1ZM7A 3LBYA 4J16A 1ADCA 2R2GA 2FDCA 4A3SA 3OSPA 1A5TA 4EYIB 2CJPA 3G8AA 5L1JA 3MERA 4HRXA 1L3TA 4XRRA 4KHPB 5CB1A 2ZW9A 1E3SA 4AT1A 3Q8QB 1GDDA 8OHMA 3R8FA 3A6PC 1GFIA 2NXNA 4JMLA 1TFRA 3F8WA 1YOBA 4FE3A 5MN5A 2LP4Y 4Q19A 1WVMA 4RMJA 1MG0A 1NYRA 2JFFA 3W8EA 3EPJA 2Q07A 4MITA 4BMVA 3PQ3A 4ITVA 9ICQA 3K0EA 4QC2A 1IHPA 2FY8A 4ZVUA 3JWPA 4KOEC 4DMHA 1UDAA 2YMPA 2DCMA 1L4MA 4AS3A 4CG0A 5HTOA 3BQNB 4EI8A 4X9XA 5AM1A 3RU2A 5AK3A 3HACA 4TMXA 2VT6A 4X91A 3U7HB 2ZR9A 4ZQGA 5C5EA 1Y8ZA 4EZEA 1A7AA 5MGNA 2VZ9A 1NPYA 5HM8A 1Z8NA 1L1FA 1TKRA 4PX3A 2VCYA 4WFJA 4DEYA 4EKIA 1A27A 4D97A 4UM7A 2FPGA 1AHIA 4K9KA 4R41A 3AF6A 5DGBA 2G0AA 5CR9A 5HF6A 2O5CA 1Q11A 4N7MA 1E1NA 3ZU6A 1V8PA 1T4DA 3SFZA 5LP6A 3Q9SA 4AIRA 2M2IA 3N2KB 4FYHA 3EBLA 5DVZA 1RYRA 2C2WA 5AICA 4GGOA 3ADCA 1IJBA 1O54A 1T5SA 1HE4A 1CV2A 1YAJA 3VNQA 5FULA 3WQSB 4GGPA 3CH7A 3NIBA 3Q88A 5JS7A 1NN0A 3NYRA 3TFSA 5KNBH 1DWOA 5CHEA 4JN6B 4PGMA 4ZYUA 5KFRA 3PQ4A 2FKNA 1KFKB 5ALKA 4JOSA 5DNDA 5ALUA 3W90A 4J9LA 4Q16A 5EXSA