3QUCA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with sulfate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHNGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 78
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qucA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qucA01
2HI0A 2FPRA 3SF0A 3ZTYA 1K1EA 4HGRA 4EZEA 3U7HB 1IWOA 3IJ5A 3P96A 3W5BA 4FYPA 3ZVNA 5AI0A 5ALIA 4BX2A 2C8LA 3U7FB 1EK2A 2HO4A 2MSNA 3SHQA 4EX6A 1WR8A 3N8GA 5AI6A 2AH5A 4Y2QA 2ZBDA 4C4RA 3A1DA 4I9GA 1Z5GA 3MC1A 4J03A 2FPWA 2FUCA 5AVTA 1Z4LA 2EARA 1RC8A 5ALWA 3WKDA 3RF6A 4C4SA 4KX5A 4XOUA 3B8EA 5AW5A 4JB3A 4Y3UA 4UASA 3L8GA 1RLMA 1Y8AA 3N1UA 2Q4TA 4HGOA 3WK5A 2RBKA 4AS3A 3J7TA 2WFAA 4YH1A 3M9LA 2YJ4A 1SWVA 1J97A 3BA6A 5AK3A 1L8LA 4Y2YA 1F5SA 2HSZA 1AQ6A 2GFHA 2YMQA 3ZX5A 1RQLA 3W5DA 3KD3A 3NIWA 3MN1A 5AI9A 4DW8A 3FM9A 4HGQA 2P11A 4UW9A 4QJBA 4HGNA 3ET5A 4UMDA 3QLEA 4JDPA 2ZBEA 5E0OA 4IFTA 3RFUA 3ZX4A 3QU5A 3VAYA 3QU9A 2MU1A 5IT0A 1O08A 4Y2TA 5AVWA 1QQ6A 2WF7A 4L6CA 2P69A 4RETA 5AW8A 2HCFA 2R8YA 3EWIA 4EELA 3UMBA 3OCYA 3WKAA 1JUDA 2I6XA 4UAVA 4YCNA 5AI4A 4CF5A 3DV9A 2CFRA 3ZI4A 5A3RA 1YNSA 3R9KA 5AK4A 2BY4A 4BYGA 3SD7A 3DNPA 3R09A 1Z4IA 3WK4A 3OTQA 1U2SA 3KZXA 2C8KA 4Y2XA 3ZTWA 2YMLA 3K1ZA 5ALDA 4DFDA 4C4TA 5AVUA 2C88A 2IOFA 3U26A 5AW9A 5AI8A 3QUTA 3L7YA 3QU4A 5AKYA 1KYTA 2GHQA 4HGPA 1RDFA 4KX3A 4NFLA 3DDHA 5ALQA 1RLTA 4NWIA 5AVRA 3ZUPA 2PQ0A 1QQ7A 1ZD2P 3EF1A 4KN8A 3AR5A 3AR6A 3QNMA 4Y2JA 3L0CA 3KC2A 4OD0A 3M1YA 2DQSA 1LTQA 5IT4A 3B9RA 3FVVA 2GMWA 5AI5A 2BDEA 2G06A 2Q5EA 1N8NA 4BNDA 1NNLA 1RKVA 5ALNA 3L1UA 4G9BA 4B6JA 1RLOA 4O8CA 1RQNA 2ODAA 4AP9A 2W11A 1U7OA 3I6BA 5A3SA 3QX7A 1Z4KA 1U7PA 2FPUA 1Z4PX 4QQFA 1Z4QA 5ALZA 2HEGA 4HYTA 2AMYA 2QYHA 3PGVA 5AVYA 1YS9A 3WK6A 3WKBA 5ALSA 1WVIA 2I33A 1J8DA 3GYGA 2B8JA 4L57A 3QUBA 2B30A 2FI1A 3OCVA 4NABA 1L8OA 4UARA 5AVSA 3AR7A 3ZWDA 3KDPA 3U7GA 2JGAA 4GIBA 1U02A 5ALKA 3AR9A 3U13A 5ALJA 5ALLA 4CE6A 3W5CA 4MUMA 3OCXA 1N9KA 2AGVA 2YJ3A 2ZBFA 5AVQA 4UMFA 5AK5A 4UM5A 3FZQA 1X42A 2CN1A 2FPSA 1T5TA 2IA5A 1RMYA 4G63A 3FGOA 1ZD5A 2YJ6A 2JAOA 4Y2SA 2WF6A 4J2TA 2NO4A 1Z4JA 2R8EA 5ALOA 1TJ5A 3IB6A 2YBDA 3L8HA 1YV9A 2WF8A 3E81A 5AK6A 4HAIA 1ZS9A 3ET4A 4MWOA 4AS2A 2X4DA 4NAVA 1Z4MA 2HF7A 2P9JA 3UMGA 2R8XA 4CNQA 2C4NA 3OCUA 3UM9A 3SLRA 2Q4RA 1YDFA 1QYIA 4UMEA 4EENA 2FEAA 2I7DA 4CF4A 1EK1A 5AW0A 1Q91A 2B0CA 3WK7A 1Z88A 1XPJA 2HOQA 2JARA 2CFTA 3BWVA 4YCLA 4BNDB 4YCMA 4UU0A 3PDWA 5AM2A 2B1RA 2G09A 3OCWA 3I1YA 3WGVA 5AM3A 5AKEA 5AM5A 4FFDA 1CQZA 2IOFK 5IS2A 2RB5A 1ZJJA 3QGMA 3N28A 3DAOA 3KOOA 2HX1A 3EF0A 4XE5A 4BEWA 2I54A 1ZD3A 5AW7A 5T41A 2OBBA 3SKYA 3TLMA 5ALMA 1T5SA 1L7MA 2R8ZA 1FEZA 2P27A 5AHXA 3CNHA 2WF9A 2O9JA 3KBBA 1O03A 4UMVA 1ZRNA 1YMQA 4BBJA 3L1VA 1RRCA 1VJ5A 1WPGA 3FPBA 3AR4A 5A3QA 2RAVA 1L7NA 1L7PA 3E84A 3NALA 2WF5A 1RKQA 4E88A 5AW4A 1YJ5A 3W5AA 1XP5A 2AUTA 4L6AA 1RMQA 3CZ4A 2IOHA 5ALGA 2G08A 3WGUA 1QQ5A 3AR8A 2JAWA 3WKEA 3FPSA 3L8EA 4DWOA 2YMMA 3OPXA 3B9BA 2OA0A 3A1EA 4Y2VA 2JAUA 3N5KA 1TE2A 1SWWA 3I28A 3F9RA 3D6JA 4Y2PA 4DCCA 3ZU6A 2B82A 4F72A 1Z4OA 2O2XA 5AW6A 2GHTA 3A3YA 5AKKA 2EATA 4YIKA 2GO7A 2IYEA 3PGLA 3S6JA 1ZRMA 4H1WA 1S8OA 2I34A 3ZWKA 2HDOA 1MH9A 3E58A 4UU1A 5AKJA 1Z5UA 5ALRA 2G1AA 2YMPA 2ZG6A 4XQ0A 2NO5A 4NV0A 4YIHA 2FDRA 2W4MA 4XPZA 1LVHA 1ZOLA 2NYVA 1NRWA 1TA0A 5AIAA 5ALUA 3L8FA 5AM1A 2CFSA 5AW1A 3U7EB 4ZEXA 2I55A 1Z4NA 3WK8A 4GXTA 2VKQA 3E8MA 4FE3A 5ALHA 5ALYA 2G07A 4OHFA 4EEKA 5AKZA 2FPXA 3ED5A 3ONNA 5ALFA 5AESA 3I76A 1XVIA 2ZOSA 4YGYA 2HF2A 2PR7A 3ZVLA 3NANA 1QH9A 3QU2A 2YJ5A 4KNWA 3QXGA 4BKMA 5ALTA 2QLTA 4BX0A 4BX3A 5ALXA 3HLTA 3NUQA 5AVXA 3OCZA 2YN4A 2B1QA 4KNVA 4EX7A 5JJBA 3ZW7A 1TJ3A 1ZD4A 2BDUA 2YY6A 5AVZA 4ZEWA 3L5KA 3ZVMA 5ALVA 5AIBA 3IRUA 3SKXA 1L7OA 5AKIA 1RMTA 3HYCA 4ZEVA 4UATA 1PW5A 5AM0A 5AKLA 3R4CA 2W43A 2MU2A 2WM8A 3N07A 4RESA 4Y2UA 3UMCA 3NASA 3NAMA 4PNHA 2OYCA 2D2VA 5AICA 4OFZA 2RARA 3QU7A 1T9ZA 5AW3A 1TJ4A 4Y2RA 2C9MA 3WK9A 5ALPA 1VJRA 1S2OA 2PKEA 3AR2A 4IG4A 4BEVA 1VFPA 4OCZA 4CF3A 5ALEA 2FUEA 2ZBGA 3U19A 2OM6A 5AM4A 5AKGA 4UM7A 2G80A 1SU4A 3QUQA 4F71A 1Q92A 1WZCA 2HHLA 3AR3A 1CR6A 3A1CA 4UAUA 2EAUA 3MMZA 3MPOA 4I9FA 3PCTA 5AW2A 5FP0A 2ZXEA 3ESRA 3EPRA 3QUCA 3L0YA 2B8EA 3WKCA 5AKXA 2WHEA 1RKUA 3NRJA 1RPZA 3L0BA 3QYPA 5AVVA 1NF2A 2YFYA 2G0AA 3SMVA 1L6RA 4KYTA 3ESQA 5AKHA 1U2TA
chains in the Genus database with same CATH superfamily
1C30B 3V7YA 2AHRA 1T9DA 5E7JA 3C28A 5A4KA 4Z9BA 3TLAA 3H2HA 4XYBA 4D3FA 1XCMA 1U1EA 2DCMA 4C8MA 1X92A 1RQXA 2FUCA 4K5QA 4DR3B 5LD2B 4ZT6A 1WB4A 3SDBA 1XSPA 5DISB 3IPRA 7ICPA 2QI9C 3QVUA 3SF8A 4YMIA 4RUAA 1L8AA 5TPZA 2MSDB 2O2EA 2I6UA 1S0MA 2ZB8A 1VJDA 2K6GA 4ML3A 3IEPA 1Q57A 3K6SA 2VNSA 2VOJA 4ZICA 4M3NA 4I2CA 3WYGA 3CHYA 4YEDA 1R6DA 1YZ7A 4C9BA 5CVCA 4PHHA 4HQ6A 3MGGA 3JAWB 1GKYA 1SD5A 3I9OA 1GITA 5HCNA 3BF8A 1GSHA 2IEZA 5K2OA 2WAOA 2NG1A 3RYTC 4UBJA 4DUYB 5A3RA 2PZ8A 4TVSA 3QU4A 4DRZA 5KWJA 4UUNA 3I6QA 3TWOA 5BRNA 4UHFA 4ZH4A 4KKVA 3OURA 2WSSA 5D2CA 1BE6A 3R6TA 1CEQA 3PDCA 4E4YA 1FK8A 2DTEA 2C7QA 1SCNE 5FI1B 1LZLA 4TKUA 4HYTA 1ZCZA 3UJCA 1UBJS 3OFSA 2ECOA 1KSJA 3O03A 3E3AA 1ZONA 2INGX 3KTFA 2WABA 3B9PA 4DA4A 1DNPA 3R0QA 3NNSA 3NHMA 1T43A 5EP1A 3WG9A 4QTXA 5CAEB 3QEMA 3PA8A 3EXAA 5F9FA 2R8EA 2EBFX 3WDMA 3CVVA 3IUNA 3W5VA 3ZQJA 4B3XA 4LF9B 4OPMA 3QOYA 4NBTA 1FFUA 3M9XA 2JFZA 1Y1TA 1QOZA 2PUEA 3W34A 2P2SA 1SUCA 4UFPA 2NAFA 2RHRA 4N5IX 4NCNA 5AM2A 1R2QA 4Z54A 2EKZA 4XIIA 4BE9A 3UHOA 3TTYA 3KR9A 3QPCA 3KSAC 1RBYA 5CFPA 3O3OB 2UYCA 4HCJA 4DCVA 4K0RA 2P2NA 1CUBA 1AVTA 1XTBA 1ZJ4A 3RCBA 4ZO7A 2WB2A 5FTWA 4LOHA 1G8SA 3QVGB 1QTRA 3MOGA 1PT5A 5HKOA 4DT1A 2CLMB 2YZ2A 1YBHA 4LQCA 4CKWB 2B82A 2JAQA 3L3FX 5AW6A 4P0PA 3WOHA 1L5GB 1ZC4A 3CA8A 2HDOA 2ZAGA 4YB8A 4S1WA 3B9QA 2NV0A 2WD8A 3ZEAA 3UJDA 1TQDA 5L45A 2H1FA 5CVEA 7ABPA 4MRPA 3L8FA 1O94C 2JHFA 4D92A 2A9PA 2I71A 4TYPA 4EKEA 4CMEA 2GH1A 4QOEA 1MGOA 1E2QA 2GN1A 4P0QA 5T14A 1KRPA 1LVUA 4YRLA 1XZLA 3OEEA 2QLTA 1LTHR 3T3MB 5MFZA 4BNMA 3MCAA 3NBZC 4I1IA 4MDFA 4TKLA 2O1XA 1SXGA 3OIVA 1G7RA 3UV7A 4TRRA 3KFVA 4X1OA 5TZVA 3N07A 2IP2A 3I9JA 2GGSA 1ZH4A 1R8XA 1NQ5A 4TVOA 1AKNA 2QUZA 1C4OA 4ROSA 5C18A 5LOVA 4FINA 2P4SA 2PFPA 2VYVD 2WR8A 4R84A 1GGJA 1N5JA 3QWFA 2B8EA 4YK7A 5FOWA 4PGMA 4CIXA 2FG6C 1HLFA 4OSOA 4KN5A 3ZCPA 5B7GA 5E6SB 3ZVRA 3ESXA 1X7HA 3Q8XB 4CU2A 3KKOA 3QPVA 2DLNA 4YAGA 4IZOA 4F45A 2DYKA 2PKYX 3AFGA 3DPSA 1YONA 1RLMA 3I6MA 2BW0A 2VP3A 1XJWA 3BD9A 3Q2IA 3R9XB 5L9XA 2C2KA 1SCIA 5KNLA 1W1UA 4M55A 2XX3A 1HY3A 1YUBA 3C29A 1TV9A 3LUBA 3KHKA 2E4AA 5TPWB 3UXNA 1OWMA 1IUOA 4BUCA 3RDPA 3LCRA 4HDOB 3R77A 4XVCA 4MGYR 4IRMA 2PO7A 2NU7A 5TRTA 2X0KA 2R6DA 1HE3A 3EIHA 3AI3A 3B6JA 5PNTA 3FHTA 3FDZA 1Z0IA 4I6GA 1N78A 1T1GA 5DJ5A 4FB5A 2RHHA 5E8RA 4DFDA 4F6RA 1LJLA 3PV0A 3G9TA 2ZYHA 3WYCA 1DXSA 2WP8J 1Y7IA 3OF3A 3B7GA 1CFZA 1JZTA 1AQUA 1NW6A 2I5PO 1XEFA 5IDQA 1A9PA 1ID1A 4F91B 4MWZA 3ROEA 9ICKA 2G40A 3HWSA 3GQVA 2ZUEA 3HB5X 4IHJF 1DCTA 2VDQB 3DEKA 4EG3A 1M5RA 3TAUA 5IINA 9ICIA 4NBVA 3MTQA 4BV8A 3SIPA 3EMBA 3VBCA 2E37A 4YDSA 3LKZA 3GWZA 5C8YF 2EX4A 3E1KA 4FZRA 4MKRA 4DFKA 4FHFA 3QMMA 2VP6A 4DIUA 2EF1A 1XK6A 3Q8WA 2IHBA 2BF7A 2XQFA 3ZK7A 1A0OA 2JZCA 2V7VA 1P61B 4UXHA 1LC0A 4YBRA 2B6NA 3SLRA 4OGKA 1AA9A 1YMVA 4N3AA 2I7DA 3DWEX 4K05A 4B4DA 1TC2A 5FI0B 1JYEA 2PUTA 4YCMA 3AB8A 1JI3A 4D9BA 3USCS 4NXNB 4MQBA 3TOVA 2ZW9A 2O8DB 1WHSA 2QN2A 4W7SA 5B6JA 2ZBPA 3AEKB 4RHEA 4G1BA 5L9AA 3LLVA 1GRCA 1QHFA 4BO4A 1M34E 3G0HA 2K89A 2HC9A 3R7NA 3U3MA 1T6XA 4LRWA 1KTVA 1LK7A 1GARA 1U2ZA 2IEAA 5IAOA 2G1KA 3V1LA 1QIDA 1TEZA 4AWAA 2YQZA 4PLYA 3PVSA 5CW2A 2H2DA 4E2XA 5AW4A 2M0NA 1JROA 1NYLA 2PY6A 5CT8A 1XLVA 3GJTA 2YH2A 5E6UA 1A96A 2HWYA 4IHAA 4FFBB 16PKA 1TCUA 4Y2PA 3DBLA 3I42A 4C4AA 3EYWA 5KFLA 2BUCA 2OXEA 3OZFA 4TTPA 1SU6A 2EXXA 3LW7A 2QRLA 2XXAA 3VR3A 1TGYA 2NW6A 2VAPA 3QKSB 4RA6A 5KYWB 3LY8A 1Q84A 4AJ1A 3AG6A 3NT2A 1PFVA 2JHPA 3M8RA 1CY6A 4IQWA 1JR3E 3DTVB 5HQ3B 5C8ZA 1IJFA 2X14A 3GZNA 2AXPA 3U3KA 3E1SA 1W52X 4JP5A 3FAHA 4EABA 1UBNA 4PSAA 2ZSFA 3C5HA 3X43A 1K7YA 5AIBA 1ZOSA 2WMOB 1NOIA 4Q3EA 1Z26A 3LHSA 2HU5A 4ZQIA 4CKZA 4S04A 2VAWA 4GR9A 3N75A 5AICA 2FFRA 4NENB 4P35A 5JI2E 1JE0A 4O4JB 3T9AA 1Q1EA 4R4JA 1PP4A 3TADC 4LZWA 3TVTA 3U19A 4D0NA 4ARVA 5AJUA 5JE8A 4INZA 1AE1A 3WLTA 2QUKA 3QZUA 3KETA 4TTVA 4TXHA 2WMDA 1G63A 1FW8A 1Q3VA 3H6KA 2HIHA 2FQWA 3TJMA 1QF6A 4RTOA 5BUSA 3EASA 1F38A 1L7BA 5KNBD 3JASA 1DDGA 2NPOA 3X1KA 3N2GB 3UTCA 4WRRA 4B9MA 2EGUA 4BN0A 4TLDA 4Q03A 1XEAA 3SR0A 1PR6A 4EB3A 1ZU4A 1MAVA 3HDVA 3LDAA 4TVBA 1C9NA 4Q93A 1N5MA 1J9ZA 3RRJA 3THXB 1ODLA 2Q5JA 2BHNA 2MAXA 2CF5A 2HSZA 3H9CA 3OJWA 4TROA 1CWUA 4RNCA 1YI8A 1Z73A 2DY1A 3R7WA 4HNGA 2H08A 4PPFA 2VNAA 4BEBA 1EFVB 1Z0KA 4RULA 4FPXA 4QDTA 1EA7A 1MTOA 1X1QA 3GAAA 4PLPA 1Y4DE 4YT5A 3U3XA 2I9KA 1HT0A 4IMRA 2H92A 4RGBA 4BJHB 1SUBA 5EMLA 1WEHA 5FUYA 1P5FA 2GTPA 4JP3A 4R5MA 2I2FA 4H4DA 3DM5A 5I4IA 3RJZA 521PA 4EKNB 4XIYA 4C4TA 3U26A 3BQ2A 2H1RA 3RTGA 2QNBA 2YFHA 2CGEA 1VIDA 4ECEA 2ZJ1A 2FWMX 1T2DA 4N7RA 5IMSA 2PUAA 3ZCVA 5HBGA 4KE8A 4G0MA 1NHWA 4AKEA 3L92A 4PNEA 4WJ3B 4FZ3A 4NV3A 3G2KA 3M4JA 3ONWA 5B5SA 5LLDA 4B76A 5KVVA 1GZDA 1V8DA 3GFBA 5JEDA 3REQA 1Q14A 4XARA 5JVDB 1UBKS 3JAKA 4OB6A 1MJ5A 1ZQIA 1ZGBA 4EJ2A 4XW2A 4FQ5A 3CVOA 5KPDA 1Q6YA 3OZDA 1KKLA 3VH1A 5HM6A 3K30A 1G6KA 4QBHA 4MK4A 1R5NA 4FZJA 2JBWA 3QLVC 2JAOA 1V3UA 2QRMA 4PTYA 3FR7A 1X74A 3FYUC 1P2BA 1N2OA 1O9HA 3K9QO 1E7WA 4M0EA 2C2EA 3ZZMA 1GTG1 1QMGA 2E9SA 4YRTA 1U7TA 3PWTA 1JQDA 2X13A 1O4VA 3Q8QB 1M6YA 4Y6GB 4MVJG 1EHYA 1LLQA 2AOVA 2WPNA 3FZYA 1XVAA 1DTWA 2I91A 4PIVA 1XXLA 2TS1A 4W7IA 4Q66C 3C14C 5KTSA 3AVUA 2I4TA 4B9SA 5IF3A 3L8MA 3BRSA 4ZCTA 4GP7A 1BFUA 1KVQA 4E5SA 3PC6A 4ZI5A 2PIDA 2K4EA 3M33A 5EI5A 5JAOA 5F3XB 4M0UA 1YJCA 1GVHA 1WD7A 1QCCA 1KEZA 1UBHS 1GU0A 3L6EA 5JROA 2HHVA 1DCMA 3V8BA 2XRYA 1L5HA 1FL9A 1JHAA 4EW6A 3DR3A 4U7JA 9ICNA 5EKUA 4R40A 1JAYA 1AZLA 4J4TA 5DLYA 4LIPD 3C1OA 3BE8A 1XTQA 2B8NA 1PZMA 2MDTA 4MWBA 5LZ4A 4E4TA 1WXEA 1Z6GA 3QNUA 2VJPA 4O2BB 3GLHB 2FEWB 4DFJA 1NKSA 1DV2A 1H2FA 2OP1A 2ZSHA 5JFOA 1AF7A 3SE7A 4TUPA 5HHIA 3LLCA 3F7MA 5DXAA 1K97A 3KLPX 4S2EA 5TISU 1VLLA 2RFLA 1FZQA 2NTYC 3TVDA 3SPXA 3QEJA 1U7ZA 2QF7A 5LNK6 5A2QA 4QXMA 3V8EA 1FTQA 3WMGA 2CVPA 2WM8A 2Z2IA 3FC4A 3ZWPA 3EPJA 3PNYA 3FPCA 1KC1A 3BHNA 5AW3A 3RUEA 4BLQA 4X3PA 1LBIA 2P67A 3DE3X 4GOJA 2KK0A 4R9SA 4QEDA 1ELOA 4Z9XA 4DV7B 1ZITA 4RQMA 2PMKA 1BS9A 3B7PA 5IBRA 4ZXFA 5CB4B 3I9NA 4ED3A 1SZCA 5KFUA 1T9HA 2JGJA 2ZXEA 2R5FA 1LW7A 1KJ9A 5CU7A 4MEXA 1P60A 5LA6F 4ONEA 2RCYA 4MVJD 3G13A 1IQUA 4YONB 1SKYE 3DQPA 3BORA 4FCWA 2POCA 3FJYA 4BFSA 4RT2A 1V1MB 2C1ZA 4MO2A 1YULA 1UL1X 1F3LA 4BNXA 2UZ1A 4R1OA 5KFTA 1M34A 1KK1A 4GDMA 1BG6A 4DKXA 3PUWA 4R16A 1YVPA 3K8OE 2UVDA 2R6AA 3ADKA 2VQDA 2J0VA 1K8YB 1YI0A 3Q1KA 2H3QA 3AF0A 1URPA 1JAXA 1ZJYA 3SXPA 1KA9H 3AY7A 1WP4A 3SYTA 4DLBA 4XJSA 3UG6A 2A5LA 3AV0B 1BWPA 3E0XA 1PT6A 2FX5A 4E0BA 4E1VA 3UB3A 3F2CA 4KSCA 1KKMA 3FPHA 3RB6A 1JJAA 2Q3BA 3UAYA 5P21A 3TJZA 1SKRA 3TBKA 4ELVA 1JQBA 3QPAA 3E7FA 3DULA 3M8SA 3J7AC 1ODSA 3EIWA 2HMAA 4DGSA 1JJ7A 3WJ2A 2BC9A 3MUOA 4JCCA 2ECKA 4BE4A 3R7LA 3G0IA 4DCJA 1JR3A 2AR7A 2RH9B 3RUIA 4FGJA 4R3NA 3BMCB 3L04A 4HGPA 2JCVA 4OXIA 2IIQA 2O8NA 3DVRX 4RFLA 1Z28A 3TADA 3VYTB 4CHTA 3AF6A 3A37A 1TTHA 4IRXA 4ECXA 3DQZA 1PS8A 2G6BA 3BRQA 1R8YA 2VP2A 1T1EA 3ZDQA 2F9MA 3O91A 2XB6A 5FL7D 4F50A 4D41A 1U7OA 2PX0A 1Z4PX 4KL8S 5DWDA 2GA9A 3WGZA 1EEHA 3ZBQA 3GYGA 4O9MA 1RI3A 4NABA 1D2EA 4UARA 2PGDA 4MJLA 4AL4A 1HMPA 2HA0A 1HYQA 1P2SA 3LTNC 1K5OA 2W6ID 3SE0A 1MB3A 3U37A 1DOQA 4J4HA 2ONKA 2EJWA 3VO2A 1GTZA 4HJRA 2HJGA 3ROTA 3DUFB 1J0BA 3KZ1E 1TPYA 3N6VA 2G88A 3HRHA 1SRRA 4FOTA 2V55B 4LK2A 1V43A 3I9MA 4AS2A 4PC7A 1TFUA 1E4OA 3TS1A 4M38A 4Y2GA 1UP4A 3BGSA 3HP6A 1O4WA 2YNMD 1CF4A 2JLQA 1JPUA 3WK7A 1VKJA 3VNSA 1U0GA 4CMHA 2Q2VA 2XCLA 5AKEA 4MP8A 4NBKA 2I8CA 4ID3A 4RHCA 4KXXA 5CM9C 1JFTA 1UAAA 3WYEA 2J48A 2WYIA 2P27A 3ILSA 4QASA 4RVHA 4C6RA 2Y0SC 1UWLA 2ZYIA 4ER7A 1K3UB 4QBTA 1Z08A 1F17A 3HNRA 3WDSA 2ZTSA 1WMAA 7ICIA 3ZS9A 2QTVA 3QEAZ 1EFDN 5JYEA 1EZ4A 3KAKA 4IV0A 3B3JA 4ARIA 2QMQA 1XP5A 3TUIC 3G5MA 4EPVA 3V2HA 1L7EA 5K8VA 5I7HA 1MRZA 2I29A 3PNBA 2A1UB 2FQYA 3RU9A 4BLOA 2AOTB 3A6HA 1C3JA 3OE4A 2D62A 1YRWA 5TQ0A 3BJMA 2PV0A 1PHRA 3R6GA 2YVAA 1YZUA 1RXSA 1SBNE 1USUA 3GQCA 3PDJA 1BVRA 4LZZA 4KPGA 4KIWA 3RRZA 4IILA 3SENA 3NBMA 1L2TA 1ZL0A 3DDOA 3IP8A 3UKJA 3KL4A 3S55A 2YL2A 4OHFA 3THRA 3ED5A 4WKNA 1Y3IA 4ZREA 4RYLA 4YUZA 2GZ2A 5GVRA 4RFSA 2ODWA 2PIAA 3JZMA 3MQFA 4ER3A 5DF1A 1QWOA 4UHBA 5SZKB 2VHYA 3R6LA 2FMSA 3RRHA 3WHLA 1E0JA 1PL7A 2GOLA 1Q8KA 1JS1X 2YWGA 2G9RA 1DVRA 4CM4B 1JIUA 3KRTA 1XEXB 1IXSB 3BGVA 4BO3A 1K7CA 4YR3A 4J1NA 5KT2A 1E5XA 2DULA 3KO8A 3IVMA 3I5AA 4QQ8A 3E27A 4TS3A 3QV2A 5F5LA 3MT9A 2W5UA 4BO5A 5IJZA 1MNAA 3MXTA 4CKCB 4AN0A 4H0NA 2DMRA 2GASA 3ONFA 5C5DA 2H5LA 1B1CA 4LV6A 1KZ4A 3CF4G 1DHTA 2M2IA 3K72B 4BNJA 1GU1A 4LX0A 4LUCA 5EHIA 2V3CC 3A0HU 3CX8A 1LUAA 1TVEA 4EWLA 1T1SA 5JYDA 3LJKA 1RADA 3I58A 3G6YA 2ZUWA 1EQ2A 5B3LA 2YXNA 3TR5A 3EVFA 3DMFA 4RU9A 2H16A 3JPNA 2YXDA 1XBTA 4X1KB 4FGWA 3C8UA 3RT1A 4MA4A 4D6YA 5IWAB 2ZXFA 5CK5A 4JDPA 4C6SA 5F1YA 1WMEA 2Q1TA 3D2QA 1IY8A 1X6IA 2PQ2A 1GXSB 4OQYA 3WKAA 4JVSB 4N5MA 2P5UA 1Z07A 1E63A 2CXRA 3TOCA 2KW5A 4PYLA 3U4QB 2HHHB 3T3OA 5ALDA 2FXVA 1NV9A 3IUYA 4OXXA 4LOKA 4KMUA 4EH1A 1OXXK 4F2HA 1APBA 1JA1A 5B30A 3QVMA 3IXLA 1I6MA 3VZQA 1XA0A 3DXZA 1QSYA 1RLIA 2QWXA 4HLQB 3ZWCA 3SOZA 1Z7WA 5BWCA 2AFIE 2R87A 3VZRA 4AQ7A 1U7PA 1N6PA 1SNYA 4CM3A 4YT4A 1L4KA 3OE7D 2ZB4A 2WTAA 3F98A 3SGLA 2XUPA 5DDMA 2V7UA 1EWQA 3BZWA 3V1MA 1CRQA 1CJMA 4AJOA 4ZZ1A 4URFA 4HI0E 2VWGA 1ILEA 3P97A 1DC4A 3DTVD 3OEHD 5KSPA 5JG7A 4K9MA 4RD3A 2GCOA 1OH7A 1HUOA 1YTUA 4PRLA 2BCJQ 1BHO1 2YTUA 3ZUGA 3RBVA 3SZLA 5DB9A 3GRCA 2D3WA 2X4IA 1XZHA 1KFJB 4AY2A 2YQ4A 3T3IA 2KKVA 4PVDA 1G20E 3PT9A 4A7PA 3CN9A 2JLRA 4LV5B 3GJ8A 1PVPA 4GQBA 1JEAA 2JJ2D 4MV0A 4K7JA 1TQHA 5DG7A 1SXPA 3PR2B 2KX7A 2I62A 2WZCA 3RC9A 2IXFA 1XO1A 1P2TA 2MUTA 4PYIA 1ND6A 2QK4A 2IIVA 3W79A 1Z1VA 2QZSA 4P33A 3LXUX 3G0GA 5AJYA 4F1KA 3SC3A 1WMSA 4E5KA 3M1AA 1IZ8A 1NATA 2J9FA 2QRQA 3K94A 4WA7A 1IC6A 4ZVLA 4Q48A 1EK6A 1ZMXA 1MQSA 4ENQA 1AQJA 4AG5A 2VSQA 2HGZA 1TYAE 3PDIA 2OZLA 4FS8A 3L7AA 1YZTA 4PBRA 4YIKA 5C46F 4RQUA 3S6JA 1ZRMA 5HF9A 1TRHA 4QXQA 1R9GA 1RIIA 2YC4C 1YVEI 2IXBA 2PGLA 3H5NA 3JVVA 4F2RA 5KINB 2BPOA 2Y4OA 2WTUA 3H97A 4I8XA 4TL9A 3JARA 3RH0A 5KC9A 4ES6A 1F44A 1R3DA 1CZHA 4O33A 4BFXA 5HP4A 4BFWA 1QVWA 2EDAA 4HDNB 1MC8A 2VJKA 1P73A 3ETCA 2BTQA 4P6VF 1ILWA 3JZIA 1G3IA 1X7WB 3C3BA 1H38A 4Y2UA 1NZFA 2FWRA 3KYDA 1NURA 4MV6A 3TR0A 1RI1A 5BSMA 5SZHB 4HBZA 4K3UA 4PPYA 3HWX1 3WLFA 1C20A 2P0YA 1MOZA 3VPBA 4DNFA 4OJ5A 4CMBA 1IYZA 4KO4S 3KJXA 4GPZA 3MMZA 3I5XA 4FR5A 5EZSA 4EI2A 4D9MA 2XHZA 2AIRA 5GWXA 2ZB7A 1GNSA 3UO8B 1IUPA 4C0KA 4WXMA 4DQRA 4X44A 1G2QA 3ER8A 2D0IA 4YG2A 4OQFA 1WR8A 5H2FU 3UAWA 3G82C 2YWFA 1E3SA 4DLYA 1J1UA 4KWIA 2I7CA 5E1OA 4HH1A 1S9HA 3OP1A 3UH1A 3NCTA 1FOEB 2XBLA 3DDUA 1ODIA 3LPLA 2DFKB 2R97A 3TVYA 4C5BA 5DHSA 1Q0PA 3ZU3A 1N5LA 4JSTA 1QPZA 1K0FA 3OM8A 1XWWA 3TX2A 1RWVA 4QW9A 4F8RA 3EA4A 3I09A 1C3EA 5A62A 5E6RA 2JRZA 5EJ5A 4I2FA 4NY8A 3N53A 5IAAA 4FGSA 4RPYA 3KEOA 1EB9A 1X9WA 3W6PA 5P8WA 4PFQA 1I3NA 1VG1A 2QTAA 3OUUA 4BP3A 2Z9BA 3Q7TA 1GPUA 3DNPA 1X2IA 3DKRA 1OROA 1QYVA 4UB6U 4WNIA 3VNQA 1MENA 3PX3A 3MGVA 2FP4A 5JCPA 1AF4A 3KVRA 4FD3A 1RLTA 1DRKA 1RPTA 3H8WA 2R00C 4YUYA 1SIWA 1KHHA 3U7QB 3U61B 1DHRA 2GM4A 4GZLA 3GAZA 2QN1A 1HYBA 4N7MA 4ZALA 3IO3A 4B6JA 1NF9A 4FYIA 3EGIA 2A0FA 5KFZA 2I33A 1FRZA 5IVDA 2B36A 5DHFA 3RROA 4XEHA 4Q02A 3L06A 1J49A 1C1DA 2QQ5A 4B7ZA 2CMDA 5BN5A 2B20A 3QRWA 3GT0A 2XNDA 1Z3EB 1U04A 2J59A 1FRFS 4MPRA 2FW9A 2XQVA 4NECA 3RH4A 3BCHA 3QHPA 1VE3A 4DANA 3HDGA 3OQJA 2OD7A 1LNQA 2AFHB 2OILA 1K27A 1GCOA 3U40A 1FNNA 2QLMA 1ULTA 4LXHA 1N5WA 5FBHA 3ANXA 4IEEA 1ODTC 4XIGS 4OOEA 1A9SA 1V1RA 3ZD6A 3T34A 4FS3A 2WF9A 4NLGA 2PU5A 3B6ZA 2JASA 4MA5A 4HD8A 1NG9A 2C5AA 3G9XA 4LRXA 4PSCA 4BL5A 2FLLA 4NU6A 4EO4A 2G76A 5CIWA 3ANYB 5JASA 3H11A 4F4CA 2KG5A 3CTMA 4PZNA 4PLVA 4WN3A 1GAQA 1DWOA 3VYRB 3CLUD 4WBSA 2AB0A 5E1MA 1QQBA 1HX7A 4ND8B 3AU6A 3MFIA 4B6QA 1R64A 1QE5A 3Q6NA 1ADFA 4PZOA 2DHEA 1Q77A 2CLDX 4GUAA 4QJ3A 3KHSA 1WDLA 2AFIA 1RKXA 4EFLA 4BNYA 1SUAA 1PT7A 2ATXA 4ITUA 1UDAA 5BV2P 1OZGA 3R7DA 1SBHA 3ZWQA 5L7YA 5J4KA 2X1HA 2WWYA 2WPDD 2BGJA 1ISPA 1A5AB 3GF4A 3CEPB 4C3ZA 2IMWP 2ZUFA 3H1TA 3I6IA 4G3IA 1TJ3A 4QUIA 1FFHA 3IVCA 2ZYRA 3FCEA 1DQNA 3F8SA 2OGTA 2V4MA 1S4QA 4L5BA 3C98A 2ANCA 4MUNA 4G5XA 3S8EA 1X1BA 5J3JA 2VDMB 3O7MA 4WH0A 4EAAA 3SVZA 1CXZA 1WUDA 2CLLB 5ARDA 3IVAA 5DLEA 2F00A 2HWWA 4H4CA 3N0VA 1TYZA 1G20A 3HFSA 1P7YA 2ZPTX 3OPYA 4X7BA 1PWXA 2HWKA 3VR6A 4TT3D 4C0WA 3LX5A 1BDHA 5IVHA 3BZBA 1C0EA 4ZOAA 4IUBS 1SN7A 1DIBA 2EZXA 1E0SA 1UC9A 5H7XA 5C8DA 3HB7A 1XRQA 2GM9A 1EK0A 1OLSA 2OHJA 1K5DA 1WXHA 3PTZA 4C2AA 5IJAA 4G8BA 5KTMA 7REQA 4CIBA 4CMEC 4M9GA 4DEXA 2Q4TA 4YPFA 1KQGA 4R3UC 3AHIA 3WL5A 3BL6A 5CLQA 1Q20A 1MQ8B 1DQSA 5CW1A 3A6DA 1NSYA 2Q4OA 4E7OA 3F9IA 4R0MA 2WK1A 4YHBA 3HJRA 3NYRA 3ISVA 4MR7B 4W9NC 4XUEA 5JSFA 4XWKA 4RS3A 4HZGA 2J7PD 2JZNA 5K01A 4IJWA 3QX9A 3NKLA 4FX2A 1V48A 2D2FA 3OJSA 2JHGA 2XOEA 5HRUA 1NXPA 1TDJA 4EB6B 2IUUA 1SJ9A 1VYUA 5KYKA 3M49A 1SKSA 3ZV7A 4M8SA 4R05A 5FPQA 1Y3AA 4TMZA 4KX3A 2XUIA 2CHGA 5DKWA 4Z4QA 1CR1A 5KFRA 3TTVA 2GZ1A 3VPHA 1CNMA 5AI5A 3RV3A 2KN7A 4HEJA 2PBZA 4OHVA 3MGKA 3F1KA 4AJKA 2E4XA 5CA7A 3MWYW 1OKKD 2A19A 1T9GS 2VWHA 1MRNA 3T4EA 4PG8A 3U3JA 3WLAA 2NUTA 4DL3A 4JJ8A 2FFBA 4E3ZA 5IABA 4AWBA 4J76A 3WNDA 3ZWDA 4I2VA 1XEWY 3HJFA 1QSSA 2O0HA 1U8TA 2QVXX 4WKOA 3SSOA 3DC2A 1BPYA 4BMZA 4C7BA 1KAHA 4G0WA 1ADGA 1E9SA 4D7AA 3C3PA 4DQVA 2Q0SA 5CR9A 4V0KA 4CYMA 1AIPA 2X40A 3ZXXA 4YT8A 4WOKA 4D2IA 1KDHA 1RZVA 3NRCA 3PICA 3TOZA 4LSWA 3BS4A 3RFTA 3Q7EA 1G5TA 2AEEA 1EG2A 2IITA 3CJQA 4HEQA 5A9SB 4II3A 4G1UC 4BWYA 4ELTA 2WKPA 1K3TA 4DL9A 2XGPA 3EXEA 4QUBA 1WNTA 2W2TA 4D8WA 3KB1A 3LQ4A 3QVJA 3B1ZA 1YT5A 4KMSA 3GROA 1YDEA 3NM5A 4Z9YA 3MAJA 2YB1A 2V6MA 5DOZA 1RHMA 2AHOB 4JLMA 3IV7A 4RNDB 1J42A 3PC7A 4WLNA 3VPGA 8ICTA 2PX2A 3EIFA 1AN0A 3WL8A 1R4ZA 1YHYA 5GQSA 1QVVA 2R00A 3PR3A 5TB5A 3IHKA 1YDGA 4Q3DA 2BTOA 3D6JA 4PLFA 3A14A 3FLEA 4Z8XA 3NRBA 1UT6A 2CLFB 2G5IB 3GPDG 3JAMA 1SXIA 5EJEA 1KXZA 3PR5B 4JODA 1NF8A 1B4DA 3ZYZA 4FWIB 2MWMA 4IMJB 4ZKEA 4D9IA 4N54A 4EEKA 5AKZA 3NHZA 1VJCA 2IBKA 4JGGA 3O0TA 4I08A 4AKHA 3EGDB 3NUQA 4MZXA 1S8AA 1TIBA 4GGOA 4I9UA 3LIPA 3OFKA 1GZ7A 2I1VB 2Q5OA 3AP3A 1WY7A 5AKIA 5REQA 1YRAA 5AXBA 3SXJA 3BQ0A 2ALZA 6CHYA 1DX4A 2X77A 2UVWA 1NDHA 1EHCA 2X3YA 3A4YA 4D8YA 2H5IA 4GC5A 5FH9A 2G80A 1Y9JA 5DIFA 1WSAA 3QVKA 4EQ6A 2EZ4A 1UIMA 5BMVB 2R44A 5K0JA 2YN0A 1U65A 2XO7A 2X8JB 1FJHA 3D4OA 2BKLA 1BMFD 4MI1A 4ELUA 2J0EA 4MPJA 2FPRA 3LW8A 1UOQA 2DWOA 1V9SA 4GQIA 3U7FB 3ETDA 5JO0A 2L5YA 4I14A 3O9MA 5H59A 4MTCA 1QH8A 4ARBA 3SV3A 2V58A 1YAHA 3NWEA 2XPCA 2OCYC 4EDFA 1UAGA 1SUSA 1U94A 2YHBA 3VPSA 3AUOA 1J2YA 1K8XB 1CNFA 1T0HB 2W8BA 1DC3A 3HJNA 4NCIA 3KQSA 1O97C 1E3LA 5G4KA 1H2AS 4YRFA 5LZ2A 1QK3A 3NMUF 2QRUA 2XUJA 3EN0A 1DOAA 4TZ6A 3VAYA 2EKPA 1Z33A 1V4NA 4HDMB 1NQWA 3KKEA 3V5NA 3NH9A 4RL4A 2BH2A 2KP7A 2Q5LA 4BU1A 3O1JC 1Z2EA 1W5AA 1QHHB 4G5HA 1KBQA 3G6WA 3JPSA 4UNIA 4Q3NA 4OGLA 1DKNA 1PWHA 2ZJ4A 4V0QA 5KFAA 3L7YA 3UUWA 5EC8A 4ZYLA 5EFOA 221PA 1SEPA 1UCFA 3DVSX 4JBGA 5DE3A 4OV6B 1WXQA 3OMWA 3EDYA 2Q8PA 2V3VA 4WCFA 4QPZA 3OSPA 1IXKA 3C6QA 2PNFA 1VHDA 1T2AA 3THWB 1ULAA 2G5GX 2OECA 4ZIRB 2HSJA 3PQ2A 4JL5A 5L4LA 4KK4A 3BGOS 5BV1A 3I61A 2JS7A 1XZKA 2DJ5A 1ZPDA 1Z25A 2IS1A 3VAAA 4DQLA 3AOEA 2WT9A 2COUA 4BHTA 7GPBA 1IATA 2HPVA 4UUOA 2ORYA 3KHLA 3N8IA 2WIGA 1UFOA 3LGSA 3RGGA 7ICGA 1A8HA 3NATA 4KXUA 1HURA 2DWQA 2DFVA 5GJVC 2JFBA 1M8GA 3MHPA 5KYXA 4E07A 5J43A 5LJIA 2O3JA 5ECDA 5ALOA 4EW1A 1V9CA 1DBQA 3AQEA 3FD8A 3QFRA 3LVBA 2XLCA 1GFIA 4R6XA 3RB0A 2O50A 2CNWD 1E6EA 4DLXA 4WIAA 1PJCA 5ITZB 4JSRA 4FS1A 4CQLB 2Y0SF 4W9NA 2COEA 1W1WA 5DRYA 3S7TA 3B3GA 4XWGA 3N2KB 1C7RA 4CCYA 3B51X 2UVPB 3D7KA 1NIJA 3GNSA 5J8YC 1EAYA 1JXMA 1HA3A 1FSPA 2WDPA 4KLMA 3C6XA 4OF4A 2ZE5A 1E4EA 3OFJA 5HKLA 1VP3A 2NQ2C 2FFAA 1U1IA 4AICA 1BRMA 4LBYA 3UTDA 1C29B 1UKVY 5HX7A 2TRSB 5A0LA 2XMGA 1ZQRA 4EYQA 2HFKA 5CDHA 1GZSA 3IPXA 2V45A 4KQIA 3SR6A 3KVYA 5ICFA 2A5YB 2HJ9A 2M6KA 3EFBA 3U80A 2QB0A 1M7HA 3VYWA 1LS1A 4C7OA 3WGGA 4WUTA 2XCQA 4UHDA 1VXOA 2EDUA 4D57A 4QU0A 1HE5A 3AUFA 4DV6B 2O2HA 3OZUA 4GX1A 2CXYA 3PHCA 3ESCA 1ZBDA 1OREA 4B87A 2IYNA 4TV9B 1V97A 5KQLA 2CXOA 3W0LB 1J33A 4PN7A 4JSYA 2O6KA 5KNBH 4AFNA 5K03A 3CBGA 3DZFA 5F1OA 2DPJA 1PR2A 4NAUA 4JU9A 4OCZA 2JGKA 5AKGA 4G9EA 2PS0A 4RGYA 2W2LA 4DIDA 1SU4A 2GZSA 2JW5A 3DT9A 3ZDYB 4TUYB 5CX4A 5KG0A 3CUVA 4I2GA 3DFFA 2CK3D 3SLKA 1E6KA 2YZ7A 2JZBA 4P2GA 4ZI7B 2AD1A 3WAJA 1TLTA 3BKXA 5PGMA 1I1QB 1F9EA 4EZEA 3RC2A 3W5BA 1N9GB 1VPDA 5FEUA 3WY9A 4MS1B 5T4HA 1LWOA 4COOA 1BEUB 4RLSA 2GRAA 5B12A 1R6VA 1RAEA 4PQRA 4O4LB 2RBKA 1LBSA 3J7TA 3UVEA 2BEUA 2FP3A 4G1FA 5DSTA 2WHPB 2HN9A 2BJVA 4LGCA 2FPPB 5LB2A 2GUWA 1GG2A 3ZD7A 4X93A 4FJ0A 4PM4A 2E8PA 4IXWA 1RM0A 4FD2A 1JMSA 5DDIP 4GOKA 4FHCA 4NCKA 4KYVA 5AVWA 3A6KA 5D51S 1F9AA 1JT2A 2OE2A 2C9YA 4YJGA 3OOYA 2QP4A 3E8XA 1YNSA 2X1MA 1BPBA 3RLIA 4IDGA 4MAFA 1A88A 1ESNA 3N7AA 1W2GA 2TMDA 2OGZA 5KOJA 2ODNA 4CKBA 2BQRA 1XUOA 3I9V6 4N3BA 2XC9A 4EJSB 3JALA 1LNSA 4KLTA 3QF4B 4CMJA 1GL7A 2V74B 2RI1A 3T0FA 3ON5A 2Q41A 4W5QA 2BMEA 4ILKA 8ICAA 3LA6A 1FPMA 2J46A 3IAM6 2CW5A 1J8DA 4JXKA 3E3NA 4WD3A 4RTMA 2P6MA 1S3GA 4ABYA 4LHZA 5CTJA 2X58A 4DXAA 3JPTA 1P1IA 3GJ0A 4CE6A 2ZSUA 3Q0EA 5L6LB 1QIMA 4Q9AA 2NLOA 1XC9A 4DN6A 5IC4A 2N1MA 1Z13A 3B7WA 5KAMA 1R0KA 3T7RA 3LOUA 1CJCA 4X20B 3DAYA 4O3FA 4X62B 3EVBA 3EXHC 1UFRA 1OF1A 4F4IA 2DSTA 4BNKA 2VLIA 1F6DA 1MP0A 1T2EA 1CZOA 3SAGA 3FG9A 2PUCA 1H5QA 4ZU1X 1MO4A 3CRRA 4KLFA 2EGGA 3KKZA 5H68A 3ZWNA 4G85A 4WEQA 4V0OA 3W77A 2IQIA 1A4XA 4PZDA 2RI6A 3QA3E 1A8QA 4YRMA 1P9NA 1VE6A 3ORYA 1L7PA 2JH7A 2UVVA 1T8YA 1E89A 3C87A 4CG3A 3RUFA 3DL2A 3ZZNA 1NZDA 3AVXA 3VU9A 2A84A 4N49A 4PRYA 5MF6A 2ZIZA 3IBGA 4KRGA 4FZ5A 1KU0A 4LXTA 2J31A 1XTUA 2C8VA 2GOYA 4P5EA 1PK7A 2O3RA 1RYNA 1Z8DA 3OGUA 1GNRA 2QVYX 5I48A 2JFFA 3AUUA 1QCKA 1QR6A 2AC2A 5LZ9A 3I92A 3FSGD 1MIOA 3U4GA 4OH7A 4XUSA 1XTKA 2BE9A 5TXGA 1N36B 1SKQA 2C94A 4DWIA 3ZW8A 4MV3A 1D04A 5L3ZA 4FW9A 1ZCFA 2BHSA 3QQPA 4AF7A 2VT6A 4GX0A 2QUIA 4MVJH 5DNUA 2V4UA 1I8TA 2IYAA 1DJMA 3LWBA 1WCIA 3EPLA 4X95A 2UV8A 4BVEA 3O8QA 3BVPA 3PQ4A 4MKIA 4XIFA 1ZEJA 3DL7A 5DBAA 3S5JA 1OYWA 3IO5A 2NUPA 4LYGA 1NASA 1ESCA 2TMYA 4ZGBA 1ZNQO 3GMIA 2PUVA 2C7VA 3RFFA 1L5UA 3DLHA 5DNWA 1GPYA 2IUFA 3F67A 3HJAA 4L73A 2J5QA 5DG9A 3S2YA 5A7GA 4OQ4A 5J8YA 5C5EA 3U6BA 2R66A 2XYPA 3DB1A 5D86A 3KYBA 1TNDA 2HAEA 5JCOC 3IDWA 2ZGVA 3RYHB 4PHGA 5B1SA 1E9RA 2JGIA 3VKVA 4AG6A 3FUVA 4J03A 2P7HA 1E3QA 1JH9A 1FS5A 1VG0B 3GFPA 4QM7A 3E23A 1RHQA 1R4MA 3PRHA 1QRTA 1T4DA 2XB9A 2R8IA 4G0NA 4WAUA 1NAIA 2ZBVA 4O5OA 3UAVA 4YRZA 4Q34A 2GCGA 2NOAA 2VJCA 5CT9A 3FOCA 1P1KA 5M29A 2NU9B 1GGFA 3CNNA 1QBKC 2OEHA 2B4RO 1C8BA 1JT9A 1I0ZA 3RVSA 3HO1A 2MU1A 2P2LA 1KN5A 3BZCA 5TMPA 1ULSA 3DFUA 1PGNA 1AKVA 4X54A 3WLRA 3I53A 2ZIEA 5DM60 3K6KA 4KTVE 3JQ7A 5AR1A 1CRPA 3MDAA 5J23A 4HRAA 5K3FA 3JS5A 5FUQA 4FYKA 1T9KA 2G25A 4MF2A 4UB2A 2I1QA 3NI2A 4GM0A 4HDRA 1X13A 3TRHA 3PQ7A 3EF1A 3REOA 4Y2JA 4IW3B 4PZPA 1UDBA 1WB5A 3V72A 5JH7B 1MD9A 4PHFA 4I66A 4R2HA 3AKZA 3NHAA 1VI6A 3C1YA 5ALZA 1YCHA 2DXIA 1YS9A 4QYTA 4EF6A 1HXHA 4G2TA 3NUGA 4O4IA 4QPJC 5BSUA 3MWFA 3EQ6A 3W5CA 3IAAA 3A31A 4JQZA 2D13A 1CVRA 4Y2SA 1XLUA 1IZYA 3Q7QA 4OHCA 2Y4NA 4Z4FA 4KBGA 1DLIA 2W3RA 3NETA 2C2ZA 2OYYA 2HM7A 4BAUA 2C4NA 7ICFA 2O2YA 4WLOA 1WUJS 4YRJA 3N70A 1QAOA 5H3HA 3S1AA 4W5HA 2IU6A 1J9EA 4BNDB 1W6UA 5JC8A 4W6ZA 4U7CA 3AUYA 4UBLA 4US1R 4RUKA 1KEVA 3GY0A 2XUOA 4B8WA 2QXYA 1I2MA 5KG7A 4QFCA 4BTLA 1OWPA 4XRHA 3WQQA 2PUWA 2BFFB 3Q0TA 5HF8A 1ESZA 3X2SA 5A3QA 2RAVA 5FTKA 5EIHA 2ZT5A 4AQYB 1QK5A 2ORED 1U0HC 2CCJA 1EXVA 4ON9A 2VSFA 1TAGA 4WESA 4ALJA 2ZJAA 3AP1A 4CUZA 4BKPA 2GJKA 4NG5A 3CJRA 1XNJA 2C54A 1PYOA 3LI2A 4R41A 1V38A 1TUGA 1S8OA 4HDKA 1HDRA 2QU7A 2IYYA 4MF8A 4E2ZA 5IBQA 1P1HA 3AUKA 1EGQA 1B0PA 3SYRA 1NDQA 1LKYA 3RS3A 1CNEA 2FWIA 1KDTA 2X6QA 4YP0A 1NPTO 3JPPA 1NSFA 2QM7A 1GG5A 2V5VA 2FPXA 1LBEA 1KGSA 2VPYA 5DNYB 2BT4A 1REQB 4JIMA 3ID6C 1QC5B 2HRBA 2J5XA 2XNJA 4J0IA 1SPXA 2QTMA 3DE5X 1R5BA 1B7GO 3RFVA 1DRVA 4OY3A 4XJVA 4N65A 1EFPB 1UKBA 1X19A 2FYTA 4QWMA 3BWBA 4P7BA 2BFCA 5CYGA 1NL3A 2XCUA 3VISA 4J07A 2VTKA 3LHIA 3N2NA 1Z83A 3EXHA 4P84A 1MABB 3GG2A 1H05A 2YHUA 4PS1A 1CUVA 2GILA 2DWCA 3NVWA 3D9QX 1SU8A 3EXIB 1PZXA 4TQGA 1XD2B 1Y9AA 4EY5A 3BE6A 1QGYA 3HM9A 4YJ2A 3LYLA 3OVMA 1KI6B 5AXCA 5KYYB 4ZAFA 3UY4A 1M6WA 1G2PA 2Z5VA 1OXBB 4IGKA 2ACKA 2VNIA 3L8CA 1Y4SA 4Z3OA 1LI5A 1ZJ6A 4C4RA 4E21A 4HX2A 5C7LO 4TTRA 3OIGA 2P91A 4LMPA 4JBLA 4JB3A 1JPNA 1I2CA 5L4NA 3RBXA 2A5FA 5KFDA 2XKAA 4R8KA 4PC2A 3VSBA 5EIFA 3FSJX 5AWFC 5KFJA 1A4UA 1Z9BA 1SIJA 4ESEA 1T5IA 2F59A 1V6AA 3A6PC 2GJ9A 4M4SA 5LOVF 1OFUX 2VHTA 2XVTA 1H0KA 1NXSA 4JWMA 1K08A 5LSAA 1XTRA 1K9SA 2QPAA 1V5FA 3JQBC 1X6JA 1Z16A 4DMRA 1JKJA 1VHLA 3TM4A 4H3KB 4YCNA 2GD1O 3OZCA 2ONZA 2I4RA 3SD7A 5DI9A 1U3TA 4C21A 3G0OA 1NUSA 2CD7A 1CLEA 4WOCA 4EA6A 3QKTA 5EG5A 3H1AA 4O5AA 5D6NA 4BMYA 1OFUA 4IG9A 4NFHA 2J0UB 1UM9B 3RHFA 4CU5A 1NDUA 1KNXA 3CZPA 5EE3A 5SY4A 1E7YA 2KHZA 2PNJA 4MFAA 2XMQA 3T1VA 4ETWA 1E8NA 2ZWIA 4Y9SA 3ZXIA 3IQWA 1BNPA 1MQAA 3LM8A 2XDQB 3VKHA 4JBIA 3DW1X 5JCOA 2P0EA 1BVYF 3CC8A 4QBIA 4P4MA 1T1RA 3MJ4A 4O5KA 1F2VA 1G66A 3R8FA 3U17A 4ND3A 2OHFA 2Q0ZX 1QS0A 3SFTA 5LLTA 2CMFA 1U9CA 3G0BA 2FWBA 4RZSA 2J6IA 5AOCA 2FVXA 3QJGA 2PCLA 2QP3A 4DC0A 4ALLA 4AG3A 3IP5A 3PSIA 4Q15A 3PUXA 2CZGA 2Z5LA 3G6KA 2OXIA 4WXPA 4F06A 4KR7A 3BFJA 4ER5A 2R751 5IKXA 1J70A 1TF5A 1QSLA 2BGKA 1ZVMA 3HC7A 3G5TA 4S05A 1RZRD 2D7DA 3ZY4A 2LI6A 3UWPA 1YHNA 2O9JA 1XEWX 3JVEA 4UOZA 2N0SA 5DU2A 1KO8A 1H6BA 3EZFA 4NBRA 1KI8A 5LWHA 3OOJA 2QL5A 3E3LA 4NH4A 4REQB 3RVJA 4B83A 5TS3A 4PC6A 1KDOA 4J0CA 4QZHA 4PAMA 3RHZA 2GD2A 2GT1A 1FTGA 1EINA 3ULKA 2LRHA 1FFAA 5B64A 1P7DA 3HVUA 4JI1B 1T8RA 1JECA 1Z18A 2KWIA 1KQ3A 4C89A 2ECFA 2QYOA 3RU3A 1HLPA 4Z51A 3GV5B 2IPLA 4HLDA 4B0PA 2W2QA 3D3WA 2QLLA 3EIOA 5DW3A 3F73A 3ZZ0A 2BH9A 4TSRA 3QMWA 1VQ1A 2HPHA 1D4AA 4H16A 1GZ5A 3KJGA 3MQ2A 5L6MB 4KIGA 3HKDA 4ZOEA 4MYCA 1B6RA 4DCSA 1C41A 1SY7A 1TYBE 2IYVA 3C23A 4HDSB 2AZXA 5FPPA 5KNIA 2EW2A 2QMYA 5FBKA 4CDNA 2KBFA 4R0VA 1OA1A 1YZYA 4DA0A 2FUG6 3Q4GA 5CIQA 1RMTA 5EPEA 1W5SA 5HIKA 2NU8B 3ZHSA 3UMCA 3KQYA 3TQOA 1N92A 4YPVA 1N8KA 1L1RA 4R8MA 4DILA 5FPYA 5EKXA 4FKMA 1II0A 3J80A 4CG2A 1Z5PA 5GZ3A 1W581 2WE7A 3R3ZA 5TMEA 3VI3B 1E8DA 3A0UA 2C04A 1G16A 3EOBI 4PYRA 1BKDR 4O3RA 4QU5A 5IT5A 5FDFA 1TEXA 4M2LA 3WL7A 1G9SA 3WLNA 3PFKA 2B99A 1ZQKA 4I2AA 1RI4A 1US8B 3A1FA 1L4FA 2R1TA 5J2UB 4OB8A 2X15A 1MGPA 4UASA 2UYOA 4ER6A 4TWJA 5T6MA 4GC6A 2V6IA 1VL6A 4QGAA 2CXSA 1T13A 3CT4A 2VWQA 1OW3B 3L8YA 1IBMB 3D4IA 3TK1A 5E1DA 1YE5A 2VPTA 2RDJA 3AL2A 4HR7A 4YO8A 1R10A 1E9VA 1U0EA 4LBZA 1XNGA 1JBQA 3N74A 4OJOA 5TY0A 1R0YA 2DPYA 3QBJA 3OIDA 3OCYA 3PX7A 4CM6A 5CFLA 4CKEB 4GVPA 3AEVA 5K8CA 2PRJA 5TX7A 2B1JA 2ZXUA 2XQIA 4ZFNA 1SC3A 4MYTA 1GCGA 4RANA 5HPYB 3KLMX 2JFUA 1RRMA 2QTCA 1AZWA 2OO5A 2H52A 2P75A 5IJ9B 2I4IA 2HBYA 1MAUA 4RNOA 1NVUQ 3V80A 3PX0A 3EUFA 2V59A 4RZQA 2PKCA 1VLHA 4U2KA 4NSNA 4IJVA 2VWPA 4JVNA 1QGZA 3C6MA 1PJAA 1PE0A 3KYCA 1VPTA 3ISTA 1LQTA 4QZ8A 1GKUB 5KYUB 3TQTA 3STVA 5K4AA 1UZMA 2HHCA 1EUQA 2BJHA 2MIIA 2IXAA 3GBPA 3ACCA 3ZWVA 421PA 5K05A 1YR8A 3MR5A 2QTTA 5DLGA 2FQQA 1YASA 5EIAA 1GLGA 3CW9A 2JIZA 3O1LA 4G0QA 2XYQA 2XI4A 2OP0A 3CBQA 4UHEA 1W34A 3K0AB 1E8MA 2NYAA 4G5QA 3KZCA 4YTEA 3IPCA 3N2ZB 4G4SP 5KCZA 1QYIA 1Q91A 2CUZA 5KMGB 1FFSA 4GP9A 4KDCA 3UPQA 1Z63A 2C7OA 3GRYA 3KQVA 4C0SA 1VLBA 1M75A 5E0KB 1I9GA 3KSBC 2FR8A 3RBZA 1VSQA 3MSXA 3JQBA 1BKYA 3B20A 1JEOA 6REQB 2GFIA 3IQIX 4EO9A 3FRIA 1H85A 1FIQA 1JI7A 4JJAA 1WPGA 3VBEA 2OFFA 4D0RA 3A26A 7ICRA 5JQGB 1UMCB 4G4JA 5HIAA 3QPDA 3W90A 2QRGA 2XUGA 2QMEA 1RJ9A 2C3MA 3K70C 3COSA 2Z6QA 1VIAA 1W85A 1PJQA 4I9NA 3A1EA 1CY2A 2Q3FA 5G0VA 2OCAA 4Y8VA 1LEHA 5IX8A 1JQLB 5LQAA 1I3KA 4KACA 3OSUA 1Z5UA 3V4SA 2MJLA 3IJPA 4B7CA 2ZQ5A 1EUCA 1OTHA 5G2OA 3EIEA 1FDVA 3B6KA 5TV2A 3CRQA 4O3PA 2CXXA 1PG0A 4WFQA 3O8DA 5LUAA 5FA8A 3ONNA 3I76A 3B2QA 1JJIA 2C5SA 3C5FA 1QIGA 3LC7O 1LPNA 4KPEC 1S0OA 4B2IA 5FFFA 3ASZA 1DRWA 5AVXA 2E5SA 2XLBA 3ICQB 4BMVA 1CYDA 2C0PA 4B44A 1RWMA 5H1YA 4CG0A 3UICA 2J07A 1Z56C 1W4ZA 3TGPA 3T5HA 1FRVA 4BNIA 1KEEB 3OT5A 4UNPA 4L4YA 4HLNA 1T6NA 4IX9A 4HDAA 3K8QA 3H2BA 1EGVB 4PGQA 3NYQA 3ICWA 3LUFA 1UFVA 9ICJA 4O4IF 1SXJD 5KFVA 1IQ0A 4A26A 3JAWA 4E11A 3CUTA 5KUTA 3H3JA 3AZPA 5LVAA 5ARBA 2Q5IA 3EDMA 4IXMA 1RW4A 3F3KA 1U1DA 4X94A 3EGXB 5J4VA 3RKSA 4DL2A 4RKQA 5HVNA 3SR4A 1JHYA 3E2PA 1IN7A 2CUTA 3B78A 2G0TA 4AJPA 2G72A 3GUYA 5H83A 3ROKA 3DCYA 2AU0A 2EARA 2Y99A 4GWKA 3R0IA 4QDJA 1MX5A 5LP6B 3PHBE 3FDSA 4WI1A 3WYDA 2D1FA 1ORVA 3AFMA 1V4VA 4OP3A 2O7SA 3B1VA 3BL8A 4XUCA 1RXCA 3RAPR 5EKDA 1FTWA 4CKYA 1U31A 4Y2YA 1Y3FE 2JFNA 2AQ8A 2GEFA 5CEJA 3T9FA 5SICE 4F2SA 1RAGA 4NH0A 3MGCA 1WDWB 3GD5A 1KKUA 1L5ZA 4POAA 4EGQA 4IFTA 1OR8A 1G8JA 3F7NA 3ETJA 4R2JA 3EWIA 2IYLD 4EELA 2CFRA 2BFMA 2Y77A 4X65B 4DCMA 4EFNA 5CAEA 5SYNA 3K96A 5KOIA 4H7JA 3VKGA 2KZ3A 1ECGA 1GQQA 4P7KA 1DINA 4HS4A 2VBIA 2YOGA 3FUTA 5BSGA 1Q0LA 1DBWA 4KFSA 3HNOA 4KLLA 3Q9LA 2R2AA 1RDFA 4DS4A 3KTOA 4EMBA 3E7WA 3K05A 3NVZA 4NYMQ 2PRIA 5DLQC 2FAXA 4RZRA 1M67A 3TAQA 3B9RA 3IELA 1E2EA 2GSWA 5CGZA 5HW0A 3EUB2 3W2GA 1TAMA 4C03A 4ABTA 4JENA 3UHPA 5EXDA 1WVIA 1E59A 4U6SA 1DQYA 5EZYA 2VQEB 1PNOA 1PJ4A 1CC1S 5FHQA 2P0AA 5K3DA 4Z4HA 4UBOA 2ZBFA 3QVGA 5LQNA 3CZMA 1S89A 1N4DA 5A1JA 3VV3A 3EQ7A 4DDVA 1D0IA 2QIPA 2GXSA 4KXVA 4HAIA 3ET4A 4QGHA 3B89A 3EVNA 4RTPA 3GZTB 3QXSA 4NZZA 1M74A 5FL7A 2XY7A 1QAMA 3L7BA 3DZGA 3T7SA 4PYOA 4L76A 4X1YB 4PG5A 2HYDA 3UV3A 5ISMA 3T79A 1PBNA 1GUZA 2SNIE 1T10A 2OCLA 3PHIA 1E4VA 5L3SB 4QAQA 4G0OA 3EH1A 5HJ7A 3SKYA 3H1EA 3GGSA 4MUYA 5JWHA 2W6IA 2GDZA 4WCFC 3GBVA 4JP8A 3ALRA 3F5AA 2ERYA 1UHUA 3NM4A 3PA6A 4X60A 2XITA 1KAOA 5L1MA 1IPEA 2AJQA 3IHQB 4JEUA 1WULS 3AOEC 5B1EA 2YRFA 3I1IA 2G08A 3T8YA 1SQSA 3DMHA 1OE0A 3SNKA 4DWOA 2FGKA 3UOWA 3OEWA 5KWIA 5TGTA 5F2NA 1S6YA 4DDWA 4E2YA 4QYSA 1BDBA 3FPEA 2AEMA 2VDJA 3ZHBA 5ER9A 3VC3A 1AUXA 3N7RC 3ORFA 1ZOLA 4PPXA 3D0KA 2E85A 3ZZ1A 1COWD 4BFTA 2OB2A 4OLFA 4QLAA 2AJ8A 1BX3A 3WTCA 5E6SA 3EZGA 4FQ7A 4NCBA 1XCBA 5LBUA 4TS9A 1MN8A 4KMMA 2WBLC 4A03A 4D3XA 1RWKA 1R8QA 2GESA 4IH4A 1JXQA 5L3VA 3EMVA 4RU1A 4C3UA 4LMBA 1AU9A 3DLIA 4HAVA 1VE9A 3HCRA 4Q37A 2VUIB 3LGAA 3GD7A 1U0JA 3R9XA 4X63A 2Q0HA 5H3CA 4J94A 5KC8A 3WL4A 1GRRA 4UM7A 1Q46A 3HO8A 3UANA 4F71A 3WGMA 4U6NA 5TPWA 5HK9A 3UPUA 3OHMA 3EPGA 2FF5A 2O7NA 1WA5A 3D7NA 4GU5A 3D5EA 3ANTA 4G8DA 1AKUA 1ZN9A 3CO0S 2YFYA 1YJBA 1LFAA 2ATIA 5ENDA 4L74A 4JYBA 3F90A 5DSXA 3Q1LA 3MZ0A 3AQIA 3UFBA 1KYXA 1XAHA 2FMQA 3SU8A 2VYCA 1JYSA 4KX5A 2OV3A 1I4OA 2CV1A 3GLHE 1F51E 1ZCBA 2RGGA 5ED4A 1RFGE 2WUDA 4Q3BA 2IS4A 3AHCA 4AO6A 5CEHA 1E9BA 5A5VA 2G5CA 1YXMA 1VYHA 2ROQA 3KD3A 4IICA 1XZJA 1Y5MA 3IEKA 1NP3A 3TPFA 2PS9A 4H7KA 3CVXA 2AJLI 4AB1A 3CB4A 1ES9A 1S4MA 1NXTA 2ZRCA 1U7XA 3GV0A 2GPYA 1QH1B 1CUEA 2H3HA 4M0CA 1ETUA 4ETIA 1S2LA 1P80A 2DPXA 2APJA 4DSNA 3CKMA 4PQGA 2FR0A 3AMZA 5E38A 4JYZA 1OXMA 1W36C 4EHBA 1P5JA 1WBBA 4KXYA 3JQQA 2D2IA 2YOFA 3D3JA 3I05A 1DIAA 1VDVA 4JJ4A 4ZMSA 2EANA 4KN8A 2H29A 3OE5A 3OC0A 3VSCA 1YGYA 2CJPA 4EP1A 2F8TA 5EWJB 2QKQA 4JJKA 4XD7A 2KYRA 4AXBA 1KIMA 3ROFA 3VU0A 3Q8SB 1KE2A 3PCXA 1I24A 2O8DA 3FAZA 3OWXA 2FWPA 8ICMA 2IZ1A 3AEKA 1ODKA 2J0SA 4XKJA 1JFFB 4YAWA 4L8FA 3MS7A 3WMEA 2MR5A 3KQKA 3ESZA 4L5CA 2W2KB 5ALLA 1OU0A 3WWCA 3M89A 4D4MA 3C3DA 3ZDBA 5IC5A 1I7LA 4RQ8A 1I13A 3O6VA 1A27A 5D3MA 4YHHB 2NO4A 1E3EA 2H85A 2MYPA 2GN0A 4LYHA 1CKEA 1XZQA 1S2IA 4C4XA 2QMUA 1QFJA 4Q9HA 4Y7CA 3BDIA 3F46A 5HFAA 3W9UA 3TXAA 1T8WA 1ZWLA 1WEKA 4FFBA 4HWGA 3LG2A 2BBSA 2Y1CA 3C7KA 4TTTS 4PQYA 4BUZA 4GOOD 3M6KA 4LSGA 3IR7A 1SD2A 1MW8X 2VXCA 2E5FA 1L1FA 4A2WA 2WV9A 3IUJA 2IEGA 3QKSA 5KYWA 1E2BA 4JELA 4HMOA 4KP7A 3ZWMA 4Z7JA 1RCTE 3A6EA 3QGMA 1SVSA 3IMFA 1ZQFA 4KZKA 4MRRA 4QRDA 4LSMA 4LISA 1SUPA 3DTVA 3OEHA 1UJ2A 1VHTA 3W5SA 5IEBA 2E8OA 1PR3A 4CQMD 3W1VA 5HF5A 3UJHA 1ESDA 3OFVA 3OJUA 2O8FB 4M04A 4TTQA 4ZEOA 3TCKA 2RBEA 5MN6A 5EJ7A 5JCZA 4NENA 8ICWA 1I2ZA 4LRQA 4O4JA 1P44A 5CB6A 1X87A 4QWEA 1ZQ1A 2P40A 4AO7A 1K7FB 1IQPA 2GO7A 3OH8A 4WZZA 1MH9A 5AKJA 2VBFA 2PTHA 4JK3A 3ZGNA 5HZMA 3G8CA 4N5NA 5HQJA 3O9ZA 3KCNA 3TL2A 5DXFA 3CEMA 4MPTA 3V97A 3ITKA 4DEVA 5CHGA 3H84A 1OAAA 1M76A 3PEYA 5CA1B 1DX6A 3N2GA 1ZJ5A 4Y6QA 5K2MA 1NNUA 1GU7A 4RACA 5B6IA 2FPKA 2QG6A 4DUGD 3BL5A 2I6TA 1PJ2A 2ZJYA 2J67A 1O89A 2OH2A 4CL2A 3JPRA 1OB2A 4TWIA 3THXA 1I2BA 3OZIA 4IZIA 4KXFB 3DW3X 4IV8A 4S24A 2R5WA 2BSXA 4ODIA 3A6LA 1M1UA 3GZ4A 4P8RA 3BWEA 2AOXA 5JU6A 2RHFA 3NW9A 5DTRA 4OTZA 2A5JA 3HXOA 1EFVA 2GHIA 1AC5A 5JMTA 4IHQA 2HCJB 3GLGB 2C9CA 2EP5A 2P5TB 2CE7A 4YJ3B 4FLFA 1ZR4A 1T4CB 4EBDA 2RC5A 3T6KA 1SXQA 2OAQ1 4UMFA 1XMVA 4MP6A 2WU3A 2FZKA 4U0KA 4KRYA 1S02A 4FYPA 3DVAA 4ZPXA 2OWDA 4ZCLA 2PLRA 4XPIB 3UNXA 5DWVA 3IILA 3ZWOA 1DGQA 2R48A 4Q43A 1Z00B 4EG6A 1ZLXA 1GHTA 4HQFA 4IQ4A 1P0PA 2CMHA 4KN4A 2Q3LA 1FVHA 1JLSA 1T9AA 1MEJA 4KRXA 2IF0A 4P3YA 3FCUB 2SECE 4PLWA 4DLGA 2YBEA 1SKBA 3TINA 2ZTDA 3LDHA 5JVDA 1WXXA 2DF8A 4A5SA 1UQRA 3CONA 1WU8A 4TXLA 2DWUA 4ARSA 4BS9A 3S1SA 1ZU5A 1Y9EA 1E2FA 3OQ6A 1XNHA 4XQCA 8ICBA 3WHIA 3FIJA 1ISMA 1U8ZA 2KZMA 1Z39A 2H4HA 2HQBA 3STYA 1KFEB 3WWOA 1TEVA 2NNLD 3ZS8A 1Y6FA 1X3LA 3JD1A 2GBIA 2Y1WA 3UFXB 2G9NA 4GL2A 4J8PA 3JQGB 1ZD2P 2DR2A 2XTJA 3DBRB 2NTJA 4LJLA 3C1UA 1BH6A 4BMCA 1Y1SA 1LBQA 3N39C 2IEIA 1OT3A 3GEDA 5LBIA 3OT1B 5HDBB 4CMCA 3GJ6A 3PGVA 2VJAA 1AHNA 2ZWAA 4K6HA 4TOIA 2CJXA 4OXNA 2ATCA 1TAHA 4F9FA 3A1WA 5JSYA 3KR2A 3ELUA 4X66B 4C0HA 1O6CA 2OBMA 2XQJA 5DNEA 4UD6A 2R7LA 2E89A 2O06A 2CFCA 2FPSA 4K40A 5JYCA 3CVWA 3RARA 1BFDA 3Q88A 2VHCA 3D81A 1KPGA 1TB4A 1XQ6A 3C5CA 5K6TA 2IYTA 1F0KA 1NVTA 3B2EA 4I4IA 3UM9A 7ICQA 2GBGA 2W2VA 3PSAA 4O2BA 3GLHA 5KU1A 3D3QA 1I3MA 5HS4A 1N3YA 2JZOA 3ACBA 1PKXA 3CTPA 4TL6A 1MU0A 1ZM3A 1SA0B 3VDRA 1IHYA 3SC2B 1V5IA 3LC0A 4Z2YA 5LU9A 2IEDA 1VIYA 4P82A 4C7MA 4RTRA 5LQDA 4A6EA 2YYSA 2I6QA 3EGVA 3HN7A 3L8ZA 2IIBA 5IDVA 1VJ5A 3IEMA 5DGDA 1A76A 2G4LA 2W6NA 2N1BA 2WJ6A 4GG1A 2ZIUA 3RVDA 4RK1A 4U7WA 1RWWA 1CE8A 3PGA1 1ZVVA 3A9CA 1WG8A 1N56A 4OL0A 5HTKA 5H81A 4ID9A 4F72A 2YV3A 4AMZA 2W00A 2VQ6A 2CLEB 3C48A 2MTBA 2OTCA 4HZUA 5NLLA 5CB4A 1EFTA 4HQRA 4ZVRA 3SK0A 1ZN8A 2XVAA 3CMMA 4ESOA 4JYMA 2PUJA 2BR3A 1S0UA 3RM3A 3C3WA 4RZ3A 4EL0A 2O0MA 2KSOB 1F7VA 2VUUA 3L6BA 3OX4A 3GFQA 3HBAA 5BWMA 1GQRA 3FFAA 3ZY5A 3RD5A 1V1MA 4DQSA 4LZPA 3K6JA 4DCNA 3IIIA 2YJ5A 4JJZA 4S3MA 1XU4A 1P91A 4DPLA 3VUEA 3HXQA 5JJBA 4C5AA 1PL8A 4QG7A 2AOWA 4M2YA 2AGPA 4E94A 3HQ4O 2WU4A 3ZIAA 3AFHA 4HXEB 2XZPA 1FC0A 4JN6B 3RV4A 3T3GA 3PRJA 1W96A 3U49A 3RKRA 2OM6A 5EZYF 1I3OA 3TQFA 2ZTMA 5B7PA 2Z9CA 1WSDA 5DLDA 3WMRA 3GHYA 1GL6A 2H1WA 4FDAA 3Q5EA 4DIEA 1OD6A 1RPZA 1L5MA 3JWIA 1YKGA 1SQ0A 4G8CA 2QY9A 4W5WA 4M60A 4WTOA 3IVGA 4JVMA 2AH5A 1TD9A 2PBRA 1GOTA 3CXUA 1KETA 3EIXA 3JYPA 5EUBA 3BMCA 1RQPA 4GHWA 1P0CA 4XZ3A 3F6EX 2GK4A 4NYJR 3D4PA 3IA2A 4RZIA 3FOAA 4GFJA 3PI7A 4GWGA 4IH1A 3PT5A 1KZHA 1UA1A 3T7JA 2PBFA 2RHTA 4TT3A 4DW8A 1TXGA 5EJMA 1NNEA 4ZWNA 4BJ5A 1E5DA 3RVBA 1NUUA 3I04M 7ICLA 3Q7IA 4RJKA 1F7UA 1UKYA 5JEEA 4CM7A 4DDKA 4PZ0A 1ORWA 9ATCA 2RIPA 4H6PA 3U4DA 4I4NA 5TT1A 2CB9A 2LE0A 2J30A 3DUFA 4ND5A 4OKSA 1D6JA 2F43B 1T6YA 3QK7A 1ECFA 2A2ZA 3LPNA 2ZWMA 4IIDA 2Z30A 4ZO4A 3GG9A 4MR8B 2ZI5A 4I4TB 2E87A 5J4HA 1X8KA 1L3BA 1BGVA 1ABFA 2FN7A 3NAQA 1F0NA 2MCFA 1TA4A 3LS2A 4Q18A 2VT7A 3BQMB 1SQ6A 4OLBA 4KAXA 2J7PA 2AMYA 4MYSA 4D4IA 2H63A 3KT6A 3ZKWB 4F0JA 1PVRA 1CRZA 3S8YA 4P4TA 5EE9A 3OCXA 2VHZA 5KYTA 2I3BA 4TKMA 4M9RA 1VPWA 5CDTA 3IUSA 4GP6A 4AMVA 4TL8A 1P77A 2PYDA 5C7YA 1H8HD 3IXMA 2A1UA 3RUPA 1V41E 3FFBA 3SYZA 2AOTA 3H4TA 4R1SA 4C7JA 2IU4A 2JI7A 3TDKA 3UIEA 1VI2A 2YUIA 3LFHA 3QY0A 4IP0A 1YZVA 3GX1A 1GKLA 5IFLA 1Z88A 1OKKA 2WICA 1NVMB 2QN6A 2VOEA 4ERXA 3OLXA 3AESB 4Z1OA 3L6RA 4RH3A 3B60A 4NYJQ 1P7PA 4GFDA 5IKMA 4C20A 1J5PA 2VANA 3FUUA 5ILQA 4DSUA 4CQJA 5DBEX 5EQJB 3HP4A 2XKKA 2GZMA 3AO0B 3PEUA 1HQYE 1I33A 4RIIA 1UC8A 8ICQA 4G0YA 2HLPA 3COPA 1DV1A 1UBSB 4WDRA 3AFOA 3MERA 3SJBA 4CM4A 4DIKA 1XEXA 2QTRA 4QWDA 3CLHA 1ZK0A 4YCBA 4DQ0A 4ZMBA 2JA1A 2QYTA 1STOA 1D5CA 1L5KA 1LA2A 1PK1B 2ZP1A 4LY6A 5IAKA 4AYTA 3QPUA 5JT1A 5F7OA 3KQTA 5G3YA 2BEJA 3J81j 4CKCA 2UVUA 5I7UA 1BWSA 1EJ2A 1UXOA 1NJ5A 1LI4A 1Y1PA 3KHHA 4OU4A 1JIXA 4TRNA 4ZQEA 4KNWA 3DOCA 3RVMA 2HYIC 2YV1A 4F3OA 1C4XA 4DA7A 1NJYA 4GXKA 1O58A 5B36A 2AFHE 1ECBA 4JXXA 3STUA 3A6GA 2A58A 2QX9A 3DP9A 5JAPA 1K1SA 4GF5A 1P29A 3D6UA 4XFJA 4TS4A 4MICA 2FV8A 3MRVA 1PF7E 1A5ZA 4X1KA 4RWZA 4MRVA 2F3UA 3QH4A 4M1YA 2J3JA 3JPWA 3MTIA 3A1SA 4QIWC 1DAHA 3VOBA 2YFKA 4WA8A 3MB5A 4EUHA 1GXSA 2ZRMA 3GVHA 3B6EA 4R9RA 4F8YA 1SXJB 3MJRA 1DXHA 4YV0A 2LYHA 3U4QA 3IN5A 2LV8A 1XD9A 4OJPA 2SKCA 1EGMB 3S0JA 4EYOA 2OKGA 1CJKC 1YKSA 3P2OA 3WBBA 3GDXA 4Y3UA 4IF4A 4GI7A 2P9YA 3VPXA 2C57A 4MWCA 2ZJFA 2V6FA 4Z9FA 2JIMA 1NBHA 1XHEA 2JAPA 3RYCB 4TQAA 3JQRA 4G01B 4CLXA 1HNZB 3V2GA 2PUGA 1GPNA 4JV1A 3H65A 3R0ZA 4EUEA 5GGXA 2JH1A 3GRPA 1DPFA 5AJHA 1N2JA 4HP8A 5HUJA 1JU9A 1L5VA 3N0XA 1QQ6A 2BFDB 3GIMA 2HA7A 4YAEA 4O4HB 1VCMA 3CSUA 4U3JA 4C7VA 4EHNA 3DXXA 2VJMB 4O4JF 4J6EA 2VH5R 1YQEA 1M5TA 3HJUA 1AS0A 5J2HA 3KYIB 1JIIA 1U9YA 1QRUA 1I30A 3AR6A 3ESBA 4M0PA 4WBXC 1N1MA 4LDZA 2GYUA 3FCSB 3HHEA 2JFHA 2RHCA 4WADA 1N8SA 2PS1A 3HUUA 4LFBB 3I6BA 2IHZA 2QLBA 1RPNA 3FPAA 5J0RA 1IN8A 4IJKA 1SURA 5CNJA 3A05A 4JQSA 3X1JA 4B9UA 3QHQA 3N4MB 1KWGA 3M6UA 2XVXA 3ZJUA 5BVHB 2FW7A 1D7AA 1QVRA 2E4UA 3ZU2A 1WTCA 4QPPA 2YJ3A 3LRTA 1GZUA 1T1JA 4P7GA 1FCJA 3W8RA 3FOWA 2IZ0A 3QV1A 4HZIA 4IAOA 4HJXA 2UUBB 5KQPA 3TZKA 3AN1A 2XMBA 3IL2A 2JFQA 3L02A 1F2UB 3EJ6A 4IDNA 4J75A 3ENZA 3C3CA 4BB0A 5I51A 4A0SA 2BMDA 3MILA 1CFJA 3IBTA 4Q1FA 4HVTA 3WFZA 3SQNA 3S2ZA 4M6WB 3E22B 3M2PA 1TAUA 5C7OO 5ITSA 3BWVA 3EHEA 2C61A 4QIHA 1U5AA 3A11A 1RRGA 3V9AA 2PSSA 2OO5C 2ZJ7A 5AM5A 1CJVC 4PPQA 3VR5H 4DQDA 2WG2A 3SXUB 3QYFA 2P6NA 3DMRA 4LVSA 2WC1A 1VMAA 1HSOA 5K51A 3THVA 1NR5A 4PHPA 4HDNA 2F77X 3GLSA 1E94E 2VJBA 4CEIB 1Z0UA 5ABPA 1RAFA 2DERA 4GW3A 3GNQA 1VG9B 3F7TA 2BBTA 3ELDA 3SP1A 5A4DA 3OHBA 4C0AC 6AT1A 4HWPA 3SZ3A 4KVFA 2CKMA 3AXSA 2YYZA 1UJ4A 2X0JA 2CNWA 1PN3A 3QVWA 5AQEA 4TSFD 4GOLD 5BY2A 2QPLA 3A58B 3GILA 5FF9A 1IVSA 1JVBA 4B17A 2ZE8A 4EG0A 3OFND 3JPQA 2WOJA 1U3WA 3LRXA 1XCOA 3PGLA 1GFZA 3HKEB 3ZE9A 2CNLA 2PE5A 2RE8A 2LR0A 4AM8A 2C8JA 1SHKA 4EQZA 1FIUA 1TJPB 2X2PA 4F96A 3B5JA 2Q2NA 1E9DA 1K8QA 4IYRA 5DX8A 4AUNA 2YYYA 3NPMA 1Q1NA 3DL0A 1GZHB 2VYVA 1PLLA 3WFJA 2O0KA 5AESA 4JXZA 2VC2B 4I46A 4Z8YA 3R9IA 1HQKA 1ORIA 1D0VA 4P3PA 4WNAB 5KFMA 1K88A 2PT5A 3HLTA 4ISBA 1G1MA 2C4HA 2PUDA 1P7WA 1CZRA 4NOKA 2HLNA 2C2BA 2AJTA 2UUPA 4KGDA 3HV0A 2MU2A 3BSFA 4TM7A 2FR8C 3GUUA 1Y4UA 3CRZA 5FOXA 3KDSE 3LZ6A 3H18A 3R3VA 3WI7A 4Y2RA 4IFBA 1O6GA 2A9JA 3P4UA 2J4CA 1WZCA 1N7HA 3SYMA 1OQAA 1LSJA 1XTVA 3BBPA 1DADA 3G59A 4B48A 4P4OA 5FCDA 5G0SA 4HNTA 3AVTA 2CLCX 3VPAA 4IS2A 3PIDA 3PSFA 2IYWA 1O7JA 1E1MA 4J6FA 1VB5A 4D4HA 4LWQA 3N05A 3E03A 3HA5A 4UVHA 3T5MA 4PX5A 1SB3C 1YA4A 1JFSA 4GPEA 4OB7A 1KSPA 4C0JA 3LK7A 1FDWA 2Z8YM 1RBMA 1V45E 5FUVA 2P9EA 4O2BF 4OHXA 3L1HA 3JYQA 4F46A 2A1IA 2VJQA 1NP7A 1TT5B 2WFAA 1QLHA 1GPDG 2FUNB 1X14A 2XXJA 3HDHA 5LD2C 4KN6A 5THXA 4JQYA 3K2BA 4R2IA 1DAGA 1QFYA 1T5HX 2VDKB 4HXFB 1WDMA 3ZD9A 2HJWA 3K53A 4X8OA 2B34A 1K98A 5IH7A 5D1HA 3ISCA 2DZDA 2JKZA 4WXYB 4E15A 2ASVA 2N9UA 2ASDA 2H1VA 3UJBA 3LF1A 4G9GA 2WZBA 5FAKA 3ETLA 1MHPA 4QGFA 2JEZA 5E9AA 5FNZA 2G9ZA 5G0TA 2XTAA 2BY4A 1M2OB 1C8KA 2WAQC 3KZXA 3GFGA 1IY0A 4BNWA 4GXJA 1Z6ZA 4DAOA 4FC6A 5LJLA 2IY8A 3I0ZA 4F97A 5CB4F 1KAMA 4R8UB 1AKYA 3KNZA 4DV0B 5KFGA 2EKLA 5D5QA 4KLJA 3TPZA 2AFHA 4B4WA 4NCJA 5JIBA 2VS1A 3SOPA 3ABQB 2PSHA 3RREA 2QAJA 4CM8B 3ZXYA 5BW4A 1Z37A 3OJXA 1BTOA 1Q3KA 3VR5D 3HTXA 3AP2A 1W4RA 3TACB 1M2JA 3ZZTA 4MVJE 2P3QA 3I4LA 2AZTA 4MZDA 4D6XA 1EDZA 5CLLA 4KJXA 4JJ6A 1L7VC 3D1VA 1EVLA 2LYBA 3HFJA 1DAIA 2AQ0A 3IG5A 1RHRA 1JLRA 2X4DA 3RIGA 1Z4MA 1FSFA 3CH7A 5C34B 4XWTA 1GN9A 1E1DA 4JUAA 4HWOA 5NULA 1YD7A 4ND8A 1TF7A 3Q12A 1T15A 2ZDQA 1QG2A 2NRXA 4K8RB 3N9IA 4EGSA 3E9EA 4NE9A 3GOHA 1QP7A 5J5CA 3VNAA 1CZLA 3KOOA 2Y67A 4BEWA 4DMKA 1T26A 1Y80A 3DDWA 1WYGA 3TX6A 2QZJA 1GM5A 3R74A 1WJGA 3PQFA 2R1VB 2REQB 1B0XA 1M8PA 2MSEB 1YR9A 5JXWA 3IOCA 3UK6A 4RY2A 5EN4A 1LRJA 1ZQNA 4GI2A 5JARA 2HIMA 4RE6A 4MS4B 3CWZA 2IOHA 4MQEB 5B58C 4QJ5A 2JJ8A