3QUCA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with sulfate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHNGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 78
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qucA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qucA01
1Z4OA 2B30A 1ZD5A 5AVXA 3WK6A 2FEAA 5IT4A 4Y2PA 3BWVA 2NO5A 4EZEA 4HGOA 1VJ5A 3AR8A 3ZU6A 2IOFK 2YJ5A 2FPSA 4KYTA 1YV9A 2YMQA 5AVVA 4HGNA 2HF7A 3L0YA 4OFZA 2YBDA 3DV9A 3AR5A 1VJRA 2ZBFA 3P96A 5ALGA 2GMWA 3OCZA 1RKQA 3N1UA 3QX7A 1Z5GA 2HHLA 3WK5A 1VFPA 2ZBEA 3OCVA 3OCXA 5ALQA 1PW5A 2JARA 1ZRMA 3PGLA 1KYTA 3E8MA 3ZWDA 5AESA 3L0BA 2WF9A 4EEKA 3WKDA 4QQFA 2FPWA 4EELA 2PR7A 1O08A 1RMTA 3FVVA 1K1EA 2OA0A 4UATA 4Y2XA 2D2VA 2G0AA 3B9BA 1ZJJA 4F72A 5AI6A 4HGPA 3WGUA 1YDFA 1ZOLA 5AKXA 5JJBA 5ALFA 3ET4A 3HYCA 5ALIA 5AVTA 3ZWKA 3NRJA 3PDWA 2Q5EA 2EATA 5ALRA 4HYTA 1T5TA 5AHXA 2AGVA 5ALTA 2Q4RA 4Y2YA 3ZTYA 2C8LA 3UMBA 2CFRA 5AI4A 3QU9A 1RMYA 3A1DA 4G63A 3QNMA 3IRUA 3IB6A 2OBBA 4KX3A 2I7DA 1TJ3A 2FUEA 3W5BA 1JUDA 1NNLA 4YGYA 4L57A 3U26A 2OM6A 4DCCA 2FUCA 1TA0A 1Q92A 3E84A 4YIHA 4EX6A 2WM8A 4UM5A 4UM7A 3U7HB 3ZX4A 4Y2QA 1IWOA 4DW8A 3ED5A 5ALKA 5ALDA 3E81A 5AK6A 3KOOA 5ALPA 4YCNA 3A1CA 1YMQA 1WPGA 1Z4PX 1L6RA 1Y8AA 1U2SA 2HCFA 2MSNA 5AKKA 3ET5A 3OCWA 4MWOA 2FPXA 1Q91A 2I34A 3R4CA 3IJ5A 5AW4A 5A3RA 5AKJA 3WKAA 5AKHA 4CE6A 5AM1A 1XVIA 4I9FA 2FDRA 3WKCA 4Y2JA 1RMQA 1XP5A 3U7EB 4YCLA 5AVQA 2CN1A 1L8OA 2WF8A 3WGVA 3SF0A 4XOUA 2I55A 3U7GA 3I28A 3AR6A 2W11A 3OCYA 2HO4A 4C4TA 2FPRA 2X4DA 3KC2A 3QU5A 3QUTA 4UAVA 3W5CA 2CFSA 5AKIA 1RLMA 1RQLA 5AW7A 5AM4A 3QXGA 5AI5A 1QH9A 1U2TA 1ZD3A 2RBKA 4Y2TA 4XE5A 2Q4TA 5ALSA 3DAOA 3UMCA 2G80A 4Y2UA 2W4MA 3EF0A 4KX5A 2RB5A 3L1UA 2C88A 5AVZA 4FE3A 4EENA 2YMMA 2JAUA 2JAOA 5AI0A 2B8EA 4ZEXA 3MC1A 2HF2A 3AR4A 4C4RA 2BDUA 1CR6A 3N07A 4UU1A 2AUTA 5AK3A 4YH1A 5AW9A 3U19A 4BEWA 3B9RA 4HAIA 3GYGA 4BX3A 5ALEA 5AM5A 3WK4A 2HEGA 5AW5A 1RQNA 2CFTA 3NIWA 3FPBA 4AP9A 2NO4A 1J97A 1Z4NA 3QUCA 2JAWA 3OPXA 2G1AA 4DWOA 5AM0A 1Z88A 3L8HA 2G08A 4CF5A 2HDOA 4NV0A 2G07A 4H1WA 4RETA 1U7PA 5IS2A 5AKZA 1L7MA 4UMDA 4PNHA 4JB3A 1NF2A 2P9JA 3R09A 4J03A 5ALLA 3I1YA 5ALXA 2ZG6A 1ZD2P 3UM9A 5AW3A 3SMVA 5AIAA 2R8ZA 3W5DA 3FGOA 2GFHA 3QYPA 2IYEA 2FI1A 2C4NA 3NASA 2B8JA 4BKMA 1QQ7A 4IG4A 3ZI4A 5AKGA 4ZEVA 3KD3A 2PKEA 3MPOA 4KNVA 3J7TA 2C8KA 3DDHA 3MN1A 1WR8A 5AKLA 3FM9A 5E0OA 3HLTA 3WKBA 5AM3A 2C9MA 3L7YA 2YJ4A 3L0CA 2RAVA 2R8EA 3SKYA 1X42A 3WK7A 4ZEWA 5AICA 1Z4IA 3TLMA 2BDEA 4UASA 3W5AA 5AK5A 3QU4A 2QYHA 1TJ4A 4BNDB 1RLOA 3SLRA 2AH5A 4RESA 2YY6A 4YIKA 2B0CA 1RRCA 3MMZA 2BY4A 2QLTA 3L8EA 5AVUA 1FEZA 3ZTWA 4AS2A 5AM2A 3PGVA 5ALHA 4B6JA 1RC8A 5AW0A 1J8DA 5ALWA 4KN8A 2IOHA 1YS9A 4L6AA 1AQ6A 2YMLA 4CF3A 4O8CA 5AKEA 4J2TA 1QQ5A 1RDFA 1S8OA 2IA5A 3SD7A 3CNHA 5ALOA 2ZOSA 1WZCA 3QLEA 4BBJA 4F71A 2I54A 1TJ5A 3N28A 2I33A 1YJ5A 1Z4MA 2WFAA 5AVWA 2OYCA 5AW1A 1ZS9A 2YFYA 3SKXA 4IFTA 1RLTA 5AVSA 1Z4LA 4HGRA 5FP0A 2EARA 2G09A 3VAYA 3ZUPA 2WF5A 2WF7A 5AKYA 3FZQA 1T9ZA 4MUMA 2HSZA 4UMVA 3R9KA 3L5KA 3WKEA 1NRWA 1WVIA 3KDPA 4JDPA 3F9RA 4AS3A 1F5SA 2B1QA 2O2XA 4GIBA 3EF1A 4KNWA 3L1VA 3ZW7A 3QU7A 2ZXEA 4I9GA 2I6XA 4UMFA 3FPSA 1QQ6A 1YNSA 4Y2RA 5ALMA 5AW2A 3NALA 1L8LA 3M1YA 2MU1A 2GHQA 2WF6A 1L7OA 2R8XA 1O03A 2DQSA 5AVYA 4UU0A 5A3QA 3AR7A 4Y3UA 3BA6A 3NANA 3ZVMA 1LTQA 2G06A 2YMPA 1SWWA 3WK8A 1U7OA 2B1RA 4BEVA 3AR2A 5AK4A 3ESQA 3M9LA 4OD0A 2MU2A 3L8GA 4Y2SA 4CNQA 1RKVA 4NFLA 3QUBA 3PCTA 3RFUA 5ALYA 2P27A 4BNDA 5ALZA 3A3YA 4UMEA 2YN4A 2AMYA 3QU2A 3KZXA 3NAMA 1SWVA 1EK1A 3K1ZA 2HX1A 3RF6A 1SU4A 1Z4KA 2VKQA 3N5KA 1T5SA 3OCUA 4NWIA 4G9BA 5ALJA 5ALUA 4QJBA 1TE2A 1Z4JA 1EK2A 2R8YA 1QYIA 5AVRA 1ZRNA 2HI0A 4FYPA 4HGQA 4UAUA 3ZVLA 4EX7A 4BYGA 4GXTA 4C4SA 3EWIA 4NAVA 3CZ4A 2ZBDA 3QUQA 1RPZA 3QGMA 1Z5UA 3AR3A 2HOQA 4YCMA 4BX2A 4Y2VA 2ZBGA 3I6BA 2EAUA 5A3SA 5AI9A 4OHFA 3U7FB 3AR9A 2WHEA 2O9JA 3NUQA 4BX0A 4XQ0A 3E58A 3SHQA 3N8GA 4FFDA 3EPRA 5AI8A 3L8FA 2NYVA 2P11A 2GHTA 3A1EA 5AW8A 3WK9A 3OTQA 2P69A 2FPUA 4NABA 1ZD4A 4OCZA 2ODAA 4UARA 2YJ3A 2RARA 1Z4QA 3ZVNA 3KBBA 3U13A 4UW9A 1CQZA 1N9KA 5AW6A 5T41A 5IT0A 1S2OA 5ALVA 3DNPA 3B8EA 4E88A 2W43A 1U02A 2PQ0A 1XPJA 1N8NA 5ALNA 4CF4A 5AIBA 4L6CA 2GO7A 3UMGA 3ONNA 4XPZA 1L7PA 3ZX5A 2B82A 1LVHA 1RKUA 3S6JA 3ESRA 1L7NA 2IOFA 2YJ6A 2JGAA 3D6JA 4DFDA 3I76A 1MH9A
chains in the Genus database with same CATH superfamily
3P5SA 1T9KA 1K75A 1NMEA 2I4TA 2DUYA 4RT3A 4RPJA 1C7EA 4C5BA 1K7XB 2HIGA 1H8HA 1XDBA 4HDOB 2R6JA 3TI9A 2WILA 1RCTE 3KR1A 3CFYA 1VJ5A 4QQKA 4AG6A 2XDYA 2AA3A 5JFTA 2GAFA 1OKKD 4WY2A 3IE1A 1XMOB 4C0HA 4E2FA 1CY1A 3AVWA 4H18A 1U5AA 1FC0A 3QZUA 1PJRA 1HM5A 4NLCA 3INYA 3WMRA 5CCXA 1E2FA 4I55A 1DC8A 3CBGA 3L0YA 4R1PA 3O8QA 2IUFA 3AVTA 1SVKA 3SHOA 5TQJA 1MU0A 2GTHA 4WN9B 2DOKA 2XUGA 4PN3A 2IYFA 4MVJH 2FX5A 2IOQA 5AJHA 2PA0A 2Q0XA 3UHAA 1CQJB 3DVLA 3K9BA 2W9CA 3IDAA 4MW4A 1NDHA 5CK4A 5HBGA 2RK6A 1ZG3A 2K7FA 3L6EA 4J4HA 1DB3A 4FZRA 4Q4CA 1U0HC 1EUCA 3HL4A 3QPCA 2MR6A 4MVWA 2I7TA 1IK6A 2Z2KA 4O3SA 3BAFA 3DOFA 4NCNA 1H0RA 3JAKA 3LBAA 4GP6A 2BH2A 3A2KA 3ICVA 4GR9A 4A16A 4YRKA 1Y7IA 4AMYA 4B2YA 3NHFA 2HBLA 4XUDA 2LDBA 5ELLA 3RF7A 2DXIA 4I2FA 3LZ6A 2GB4A 4I1RA 3TR6A 1X77A 1MQAA 2J5RA 1EVKA 1FSSA 3ITDA 3H2ZA 4EMUA 3WGUA 2MUTB 1ZMTA 3FB4A 2O5RA 3OZTA 4HXFB 3T61A 5C4GB 3V1TC 5BRJA 2PDAA 3GV7B 3JPRA 1CDOA 2X7HA 3HO6A 1DTWA 1Z2AA 3K9CA 4K2HA 3G7SA 4KFRA 3UMSA 4C2AA 4EUEA 4MI6A 5KSWB 3X1JA 3QX8A 4ZCPA 2BTQB 5KFCA 3CV3A 5K0FA 1MFZA 4WNAB 2JGIA 1TA4A 1THGA 1XEXB 1SUBA 3NHYA 3O92A 3OU6A 3PDWA 3Q6NA 4C5AA 4DUGA 4GSLA 1TQ6A 5IJAA 2EATA 2D1TA 3MBIA 1PVDA 2I80A 1I1QB 1JDPA 4MS3B 4V0ME 1S0OA 3PXAA 3ZZ1A 4YXJA 3BOSA 2WSSA 4DJDC 4FMCF 5HR5A 1KMHA 5JPIA 3K72B 5HK9A 2WG1A 2HYDA 1PFKA 1S9FA 3HHEA 4DBLE 5DQHA 4EBEA 5KG7A 3HT3A 1E98A 2QUIA 3RT1A 1B7GO 4XCXA 4S0ZA 3UAOA 3IRUA 4AZTA 4BFWA 5J58A 1JFFA 1YB7A 5EZ6B 3RBEA 2E4UA 4MVCA 5EIHA 1X80A 1V11B 3SC6A 1U9LA 4LC1A 4B6QA 2BJWA 4QUAA 1NK7A 2HMVA 5J0XA 1G3RA 2EJUA 2EP7A 1RWBA 5CIWA 5FWDA 2QHXA 3TQHA 4AWBA 1G19A 3K0AA 4ZAGA 3ZU3A 3CN9A 1E96A 3IUBA 5BW8A 3OTWA 3G5LA 4X71A 3GD5A 4GX1A 4OGLA 5KFHA 2VWQA 3PDCA 2EANA 1C1DB 1UBMS 4WXPA 1WL8A 2WWRA 3WWDA 5I3CA 1ZUNA 2A9PA 2ZKIA 5FUXA 2WKQA 3SHVA 1M0EA 3KKAA 1W4RA 2VZ8A 3NTVA 5ABPA 2DBQA 4BB0A 2QXUA 1Z3CA 3ZX4A 1V0JA 1A5ZA 4RF4A 1FYWA 5EXPA 2F3QA 4JBHA 3V1LA 2P4HX 1I2CA 4LOLA 1JALA 1SPBS 2HV9A 4IDHA 2QMHA 2A2ZA 3JQPA 2V97A 1GZ7A 2R2AA 3AL2A 3EZ5A 1ZI6A 3CT6A 4L95C 4UHFA 1N36B 2YJZA 1EVLA 1K8ZB 2HBZA 1DRGA 4X7MA 5TT0A 1XCBA 3MB8A 3TAUA 4H7FA 1J56A 3OCWA 4KKVA 2ILTA 2FX3A 3IBYA 1OCEA 2FPXA 1XTUA 1Q91A 4AAYA 5F9MA 2Q46A 5B12A 2PT9A 4IQ8A 4Q02A 3C1YA 1L4BA 1G8HA 2YOGA 3NTLA 1T36B 1GN9A 1TU0A 1XVIA 4QJ4A 1UEJA 4CG2A 1P9WA 3JPSA 2NUPA 4GMGA 1Z5VA 4PZAA 1W36D 5AVQA 1N61A 4GLFA 5G2OA 4FHCA 2ZIWA 5P8WA 2YHAA 3RH6A 4QVGA 3KQWA 3IL2A 4P2HA 3QE0A 4M9HA 1Y63A 4MAMA 1U0BB 1QZXA 1BFDA 5EJ9A 3NZEA 3DTVB 4OMDA 4U7PB 2HIMA 3HCPA 3BQ2A 2TMGA 3NTUA 2W6ZA 4MWDA 4LGYA 1AKNA 2XECA 5FJIA 2Q6IA 3U3RA 3UFXA 1GPNA 2CWWA 1G4HA 2O14A 7ICHA 2X3FA 1Z16A 4R2IA 3RVDA 1FW6A 2AUMA 3PNVA 4UAVA 1MGOA 3QEJA 2XO7A 2PJDA 5DGCA 3RNLA 5COBA 4EB8A 1N77A 2C4UA 1YJBA 3LGSA 3JASB 3JVEA 5J2IA 1MABA 2AJQA 1NF3A 3ETRA 3H5IA 4F8JA 1YA6A 3CCFA 4KNYA 1BHQ1 1K6IA 1Y3HA 4Y2TA 2ZJ4A 4G8CA 1ECCA 5EL0A 3SZGA 4DSFA 4FJ1A 3TLGB 1SJ9A 4RQ1A 1XC9A 1JYFA 1M7GA 2HV8A 1SC1A 2FW1A 1NYLA 3MNFA 2JDID 4N8DA 5A7GA 3CLRD 3V6LA 1ORHA 2FXIA 4U2CA 1EB9A 2R4TA 3C4JA 5A9SA 1YOVB 2RB5A 1G38A 4XEHA 7ICSA 4W5NA 2ZAOA 1A4RA 5EKTA 5K3FB 4RHTA 2JFWA 1EU1A 1A04A 1MORA 4PSCA 3AUUA 2GLXA 2A30A 3GAMA 4YJFA 4B3JA 4WUVA 3VO2A 3ZHZA 1NX6A 4UHCA 5E6SB 3FOWA 1D2CA 1QIEA 1PTKA 2CMDA 4IIBA 2AUTA 4M9ZA 4OHCA 4AJNA 2UVWA 4ZCRA 2LVBA 5J1SB 4NF2A 1OXSC 5CB4A 3R3WA 4NBVA 1U0GA 4C8OA 4F4IA 3GYGA 2YNMD 2GF9A 2ZXFA 2QDXA 3DAPA 2UYOA 2FN3A 4M60A 2YVKA 4PC7A 4PZCA 1RI4A 4IXTA 1XEWX 4RMIA 1AQLA 5BSFA 1J4AA 3H5VA 5FR2A 3KPJA 3KP1A 4HEA1 5IULC 1OIWA 3VR4A 3S1SA 4TKVA 4MGZR 4ZZIA 5JTTA 1SB8A 4HNHA 3ANMA 1V35A 5SICE 4S05A 1DNPA 2FW6A 2O3QA 4MI1A 4FB5A 2ZTEA 4DREA 1W88A 3TTYA 4ZC1A 2I2BA 2QB0A 3T5CA 1YBVA 1ZIPA 3L92A 4B17A 1M6NA 3AVPA 3MINA 4R8UB 1MVLA 3M1IA 1WPRA 3FNIA 5AO9A 5DU2A 1VJTA 4BUCA 3EQ2A 1X7XA 3TFWA 4ASUA 3OEWA 1Z19A 4YRTA 4H77A 2BR3A 4UUMA 4UHHA 3VPSA 1T6BY 1T9GR 3S29A 4WX2B 1C14A 1IZYA 4JB3A 1ITZA 1BE1A 4URVR 3EVNA 1JSZA 3QE3A 3NYWA 2CXHA 3OX2A 4MZDA 4B6FA 2D6FA 5DRTA 2HSGA 4EFNA 2D13A 2R8HA 3QF7A 1I5EA 4NLBA 2BPFA 1J0EA 2AG6A 2EERA 2W98A 1OI4A 1O6CA 3BQ9A 3JQGA 3C8MA 5LA6F 1CXZA 1K8YB 3PF9A 4N5NA 4DLLA 2ZGVA 4URFA 1KEKA 5IP5A 3QPUA 1UZMA 3P9IA 3TB6A 3PXDA 6ABPA 1CP2A 1KYYA 2IHTA 3O2SB 5JJKA 4D0NA 1FYXA 2PZEA 5GY7A 1Z0KA 3V7LA 2QR2A 5LZ9A 3D2QA 1GYQA 1PJCA 3DAYA 1E3DA 1GSAA 5I3ZA 3VZQA 5TS3A 3KD3A 2PI5A 1VMEA 3BWBA 3GLHE 4BV9A 1E6MA 5BWMA 2WUDA 1VYUA 1WR8A 1GGEA 1DAFA 2K5UA 4B45A 3D43A 1XU7A 4KLOA 4RLFA 3K1AB 3AEZA 3PFWO 3J81A 5EJIA 3I6YA 1UP7A 1AN0A 1RXEA 1XNHA 1KC1A 2C7GA 1M6WA 4RHXA 3RBZA 3ADOA 1EX7A 2WYIA 3HU3A 2R00C 2FJUA 3I0MA 3I9V1 3LLMA 2YXLA 4POAA 4TWBA 3ZTTA 1BROA 2P91A 3A4IA 4OQLA 3G8AA 3WV4A 4A1OA 2BDEA 4XYLA 1GRNA 1YRWA 4PTZA 2OYRA 3LIIA 2UU9B 2XCIA 1ZW6A 2RAUA 4QYMA 3TECE 4BZPA 3HCCA 4OYYA 2IU3A 4Q1FA 1GNRA 3TIIA 3LOQA 3M2TA 4C14A 1L5YA 5DB8A 2ZETA 2RDMA 3SBOA 3KOYA 4AULA 1MN8A 2VCHA 4D9IA 1DXYA 2QRKA 2EWVA 1R27A 3OETA 4FUQA 3KYJB 1THMA 4A36A 1R6TA 3EDYA 3F78A 5ENDA 1OX5A 3ZTWA 2JKVA 1GO2A 3L1JA 4TUQA 4B6JA 2PTHA 1VPLA 4LOIA 4I50B 1NXQA 3HEBA 1R5OA 3W8FA 3JAMA 2OHOA 1CY6A 4JJIA 2HADA 1DOAA 2I2FA 3FZGA 5IANA 4NLZA 3DE6X 1ZVJA 3HXKA 4LVUA 2B9EA 4CM8B 4HLDA 4DBZA 5C8YB 3VPBA 4DNFA 2VJ5A 2J48A 3F8TA 7ICRA 3HCAA 4OQDA 4TYMA 2OFPA 4PICA 4PYMA 5K3AA 2J8ZA 4YMGA 4F5PA 1WZCA 2EL7A 2NV0A 2QLJA 2COEA 3AOEC 2DT8A 4X94A 4HMPA 3RU9A 1NDUA 4AO6A 4EHBA 4C7OA 3G0IA 3GIMA 1ZQKA 3KQHA 3B7WA 3SIXA 4JT2A 1YVEI 1DC5A 4FCTA 2QOEA 2R8OA 4R6WA 4IIVA 2WFAA 2VJAA 2E4XA 4N3NA 3FPGA 5AOCA 1CR0A 4BAZA 3H75A 3ROTA 1DADA 4QRHA 5BNWA 1KFDA 1FP7A 5BYKA 4DCUA 2VBGA 4CLRA 5DNYB 3R9XA 4QZ8A 3I34X 2AJCA 4F9FA 2EWWA 1NW9B 4RZHA 3DVQX 4HWRA 4I5IA 1F3LA 5KG6A 3X1XA 1WVMA 2JGJA 4HJRA 2QZ4A 4G0ZA 3TXAA 4DQKA 2KTQA 1ZQMA 3L6OO 4P35A 4RENA 4U0KA 4UB4A 4LN1A 4FW9A 8ICHA 2GPJA 2XB4A 4LY3A 1H6AA 1PP4A 1P9OA 1KIFA 2WDZA 1AQNA 3ZW7A 2CHEA 3AINA 3KKMA 3LUCA 2QTHA 3UHJA 4Z4EA 1H9AA 4M1KA 1KF0A 1C3VA 2AT1A 2ORYA 4D7AA 1SQ6A 4ECTA 3OJLA 2RHDA 3OIDA 3WG9A 2E4AA 3U31A 1ADGA 1M6VB 3CIFA 1TAQA 3TI0A 1RI5A 3TUJC 1HYQA 2V03A 3DL0A 4PTYA 5EVCA 4C0KA 2GF2A 5E4YA 3QBVA 1JP7A 2I67A 1DKRA 1VSUA 1P7YA 1M9NA 3PR3A 1TQHA 4EF5A 3M4NA 2FLLA 4OK6A 3N2GA 1I51A 1S8AA 1CF2O 3NIGB 3OP1A 2GM4A 1B8NA 4R1UA 1B26A 1EM6A 1XZ8A 1T6ZA 5F1YA 3QA3E 3MWGA 4Y3UA 5E6RB 1LSUA 1XMSA 4FJ2A 3ZVMA 1IONA 4FT2A 4I9UA 4QDXA 1P91A 3UANA 5BMOA 1MT3A 2CNLA 4JX9A 2Q99A 2ZP1A 1CZUA 3Q98A 5CA7A 2PX2A 4G8BA 3WRXA 1ECWA 2HW8A 3FF1A 2H0QA 2PAAA 2A4MA 5DBIA 3U5TA 5EFZA 1LDYA 1ARZA 4V1CA 1E2UA 4JYBA 3V3TA 2XNDD 5EE1A 4DKXA 1XEWY 4CCSA 1IZ0A 4HB4A 3GLFE 3TQQA 4XCVA 5BOLA 3PCTA 3RFVA 4D4GA 2HH9A 1RYMA 4ND8B 4PG4A 3GFTA 3A3YA 4IIGA 4Y2GA 2O6HA 4UEQA 3UATA 5B6JA 2AFHB 4UBBA 3PV8A 3UFXB 2AU0A 1PWXA 4OHUA 5BN3A 3QU2A 4XQ9A 3RKUA 4MR8B 2GDJA 3WBFA 4MRPA 8MHTA 2IHMA 4N7MA 3NM6B 4MRRA 3L3FX 2IY7A 1IUKA 1E1MA 2EX0A 2ZTCA 1R12A 1P2UA 4M1EA 4BBAA 3BGWA 2ZIWB 5FUBA 2H4ZA 1P45A 3OCUA 4DUZB 2VZLA 3K6RA 3PW0A 3QVVA 4G9BA 3CIOA 5AUPB 1PJZA 1A95A 1JDUA 1M2WA 1Y1RA 2AMLA 5FEMA 1SCBA 1BFKA 3QLTA 4KRGA 5JV5A 3C28A 2J9YB 1ZP6A 3B9QA 3B36A 1LI4A 4EX7A 3NT5A 4XTRA 5GAJA 3EG9B 4F9TA 3TUZC 1SCUA 1MHPA 2VXCA 3L7LA 4KR7A 3CISA 4B9LA 1GTL1 1CQXA 1Q2XA 2JLBA 1LSOA 2I87A 1WXEA 3MRSA 4PQEA 1G4UR 5HVNA 2C4VA 2H7VA 4KQEA 1TW2A 4OKIA 1E6UA 4P7FA 1QH8B 5F21A 3NXSA 1Z36A 2QD3A 3MTBA 3QVLA 3L77A 4KVFA 4M6WB 4KU4A 1WVGA 1XHFA 5TPWA 4NR0A 4CG0A 1WW8A 5A3SA 4OHFA 3I5AA 2MSWA 2VCEA 2DRIA 3DMTC 5DEIA 3TJRA 3W5VA 1EDDA 2GCIA 2BVNA 5L4LA 2LDXA 5ESXA 5KFIA 1JQDA 4KRYA 3MWLA 4G0XA 1CUBA 2YV1A 4WKPA 4YECA 5KYUA 3BZKA 1LUAA 1OXKB 1RYEA 3D8UA 3UH1A 5J43A 5KWEA 4D79A 1EGQA 1NZJA 4RJ2A 2F8MA 3X1MA 2UYGA 1S9DA 3PUZA 1X9IA 3PEFA 2NYVA 4Q3AA 5HE8A 3A2LA 1JAZA 3K0AB 4X66B 1PFQA 3BAZA 2FNAA 4PPNA 1E3WB 1HSOA 1XLTA 4MXDA 1ZLYA 5KQGA 1NXTA 2C2WA 4BQIA 1HL3A 1Q7CA 2QTZA 3SSOA 4CM4A 4JV1A 3IP8A 4RXUA 3GF4A 4E1AA 5ITZB 3F5AA 1N60A 3ESXA 3OUUA 3ECCA 4IZOA 2ZIUB 4ZCQA 3T3GA 5KNCA 3KJIA 4KDFA 2R3SA 2ZATA 1NHGA 1JDZA 1P1RA 1SU8A 2B6HA 1R18A 3DE1X 3RUDA 1N9GB 3E2EA 3PR4A 1UANA 2HSWA 2ZSHA 5J2GA 3GRPA 4KGZA 4ZT5A 3S81A 4ZGWA 4AY5A 4J16C 4JASB 1BEEA 3TNFA 1IBKB 3FPFA 1ST2A 3DW3X 4II3A 3H1AA 1RZRD 1DMSA 1KDRA 2X0RA 3G9ZA 1WE2A 5BV2P 1TKRA 3KZ1E 3COSA 3DE0X 4D98A 1KSHA 4F7DA 3P1JA 5GWXA 1M74A 4EHKA 4RZUA 1F14A 1J20A 3DF9A 4N65A 2GLUA 1N0WA 9ICRA 2B82A 4KQGA 5IUJC 5J47A 1QDLB 2PV0A 4JKIA 5BRNA 1FJGB 2E18A 2VP2A 3D59A 4DUPA 2JF0A 4F5YA 3MT0A 5JQWA 2D3WA 3OO1A 1DIHA 1F4PA 4FGUA 1WBBA 1GTRA 4BMYA 5LXTA 3F0TA 3TQ1A 5K45A 2F44A 1U6IA 4JVMA 5B7NA 3T9DA 1KI7A 5B55A 4OBBA 1ID1A 1X7WA 4IXDA 5ICMA 4KBYA 2R96A 2P66A 4NDZA 1N56A 3JYQA 1Z6AA 1TEVA 2BCJQ 2IZ6A 1FQWA 1E1QD 1TVKA 1L5LA 3A27A 5A04A 5JZOA 1ZZGA 1UA0A 2ZBFA 1I10A 3IA2A 4XR9A 1UDAA 1NK5A 1EK5A 5J2HA 3EIWA 1SURA 1M5TA 4KPUA 4ZYYA 5L8VA 1G5IA 4IF4A 4M0FA 4QGFA 4DGSA 2D1YA 4C7XA 5IBCA 3MJ4A 1OH6A 2QRGA 3DR3A 3NHKA 1QIIA 1TJPB 1ZQ1C 2VI5A 2ZTSA 3EXEA 2Z2ZA 4P4MA 1YQGA 2AZXA 3UN1A 2EZ8A 3MSXA 1EZ4A 4ONEA 2F76X 3TQOA 3OTHA 4BKUA 1GEEA 3HQ4O 4O5CA 4AG5A 1UBKS 5KJEA 3OGUA 4U39A 2PS9A 3DD1A 4M9CA 4YFYA 4EEKA 5DB7A 4C05A 5GZ3A 1UBHS 3P2KA 2PR7A 4RELA 4DQVA 4NNPA 1SHZA 1A77A 4DOCA 2GOYA 3WQHA 4AYBC 3FVVA 1IM4A 4N3BA 3L9XA 1ZFNA 1RFGE 2D2VA 3THWA 2CCKA 1TM5E 5JO9A 4Q9HA 1ZQEA 1G8JA 1TD1A 2NUAB 4HGPA 3EZFA 4RQBA 5DLPA 1AQJA 8ICNA 1NBME 3G5MA 4FFBA 4QU0A 5B3AA 1BDIA 5AKXA 3E61A 1XAIA 5J0SA 4FNMA 5JG7A 2NVUB 4BP8A 1HRDA 3GEGA 4QG3A 3VZSA 3DEJA 3GMDA 4L9RA 2Z9BA 4LRWA 4CZ2A 2PS0A 5EIBD 2J0SA 4YRNA 4MW6A 2QRHA 2EIHA 2RFLA 4UU8A 1NFFA 2OD9A 3AYZB 4MIYA 3KZKA 4K8RB 2V7QD 4BN4A 3PGA1 3Q11A 5F35A 5FYQA 5DLEA 4CIVA 2REQB 2LPEA 3IC5A 4DQIA 2GPNA 1ZQDA 4NZZA 5AI4A 1V8FA 4QELA 1P44A 4LHSA 2BFBB 3IAUA 1AKTA 1M8PA 4XAQA 1OLSA 4CG3A 4E1VA 1P5HA 5JCOA 3G49A 1SXGA 3GA7A 1U2QA 3BK1A 1BEUB 3T54A 3E1KA 3UQZA 2VDVE 3V9AA 4TQ9A 4J9RA 4KLTA 4K2AA 3RRFA 3ZGLA 2I5PO 2F3RA 3HEAA 5HA5A 3PL5A 5C3MA 1JQKA 3R74A 2CDCA 1VL0A 4DHWA 2FMKA 1KZ6A 4G1EB 2NVWA 5FL7A 3H42B 3LT5A 3GDHA 4BMOB 1E63A 2Y99A 5EJ4A 3ZHSA 1P7WA 3I37X 1ZKDA 5DHPA 1SXPA 3OZ7A 4JLDA 2FUCA 2Y1FA 5D2CA 4ZVPA 2HSEA 2IZZA 1C7IA 1TA0A 1XD8A 3NC0C 1DT3A 3OQHA 4QOIA 1W36B 4CV3A 4B9VA 1XZBA 1JW9B 4O4HA 1E1CB 4OX9B 2P90A 1PJ3A 5CYFA 3HFSA 2PGJA 2ZVQX 4UM7A 5AR1A 3G0DA 4YJ2A 1X7ZB 2JFGA 4ZO4A 3A25A 4WK6A 4US1R 1PD1A 3FHOA 3ZPXA 2F17A 1GZ5A 5EP3A 2XC9A 4HLUC 3RUPA 3VYRB 3CUTA 1ZN8A 4EKDA 1RHRA 4F93B 1CUKA 2AG1A 1W2GA 1Y4DE 1L6RA 3JPYA 2N9UA 1MVNA 2HCFA 2W58A 2MSNA 5AKKA 1PR6A 1Y1KE 2VDRB 1MO3A 2AV6A 3FSJX 3FYSA 3CLUC 3DWIA 2E5SA 3C85A 2PYZA 1A98A 3O74A 2F9MA 4L3VA 3WO0A 4E08A 4EPVA 1KRWA 1OFIA 9MHTA 3KJGA 3QFSA 1KQQA 2OD2A 1TAMA 4MYCA 3ZCPA 4YCCA 1KA9H 4QZGA 2OG1A 5CDFE 1ZHOA 1UOEA 2OAQ1 3MRVA 1Y4AE 4LKOA 1XP5A 1B8VA 3LDFA 1E2NA 2JJYA 1TUIA 2HRBA 2P2NA 2WF8A 1QB8A 3DAHA 4OO3A 2HQOA 3W9YA 4ER7A 4EBCA 3P9QA 3IT1A 4XOUA 1IBRA 3QVWA 4RL4A 4LDZA 4KXQA 1JXMA 4MS4B 4BJQA 5BN4B 1OIXA 1J09A 3FTNA 4FUTA 4L5IA 3L0DA 3ZHQA 2YOFA 4EJ0A 4CEIB 4P4TA 1S01A 1DEHA 3DBIA 3E7XA 3PI7A 3WGOA 3DEAA 2UZAA 3U3OA 4MF8A 2FPRA 2QF7A 1Q84A 1XZMA 2X4LA 4L0QA 4LMBA 3D3KA 3VNAA 1SR8A 1C3XA 1B0AA 3DEYX 3R3VA 4MR7A 3MMXA 4MGHA 2B37A 1FDTA 3ISCA 1RLMA 2ODGA 1YK1A 1EP1B 1I6LA 2GBCA 2IF2A 3D3NA 2G70A 4GPBA 1RC0A 1ZICA 1VLBA 1U1DA 4WDRA 5BOVA 1SUFA 3RRJA 4CIXA 1U2TA 1TFRA 3T3EA 3W8NA 2J3QA 3N8HA 1RYRA 3QKSA 4UULA 4Z2AA 1SUPA 2Q4TA 3AUJB 2PGXA 2XVZA 3O3CA 4ICAA 5BPCA 3QWAA 3IXMA 3LTNC 3EMKA 4ERNA 4M2LA 1P3DA 4QYIA 3TLJA 4W7IA 1L4KA 3B51X 4PC1A 1Q15A 4F9EA 1D6MA 3OLVA 1Q0LA 2V7QA 2ZT5A 2ZJ5A 5AI0A 2CJFA 3B5JA 1MPXA 3L7OA 1TMYA 4ZVOA 1SKRA 2QT9A 3H1BA 4GF5A 4M7PA 3TJMA 1R8JA 3SAFA 3AIOA 3VX3A 1SBZA 3UV3A 1I01A 3KEQA 1TYBE 3ETEA 4MIEA 1V38A 3LHIA 4D2IA 3EUEA 3IAM1 4HAIA 4O4HB 1MJ5A 4M3NA 1C0EA 3LJKA 1FTNA 4MVJI 1U28C 2HEGA 4H6XA 4QPPA 1N3LA 3ESBA 3EY9A 3I05A 4NESA 3TKLA 5HJ2A 1N3YA 3TYXA 2BISA 3A3PA 1HTBA 3A1WA 2EQBA 1IM8A 5CR0A 1J21A 4RKWA 5HKKA 3QPDA 3UB2A 2GKGA 1TK8A 3DOEA 2C5LA 5HJEA 3FHCB 4PS1A 4DMGA 4DFMA 1JNXX 1F44A 1ODIA 2PEZA 1NW3A 2D0IA 4AICA 4PQRA 4MDYA 1A69A 2A5DA 4U00A 5E1DA 3LVBA 2XYVA 4GFDA 1R6AA 3UBTA 2N1BA 5DW3A 3H9CA 2XGMA 4BRSA 2AS0A 3QUAA 3RDPA 5I7RA 2ODEA 3EN0A 3FSEA 1Q0UA 2FP4A 2ILVA 2WV9A 3U0BA 3IOBA 5M34A 3U3XA 3UHPA 4EYQA 1BHSA 1FRZA 2REQA 1DRJA 2VSXA 2FB9A 3IIKA 1JIHA 1GG2A 1QR6A 1YJAA 3OX3A 1L5OA 3DP9A 3MK31 4PNHA 1TZKA 4EG4A 3P0FA 1FQJA 4BMVA 2C98A 4ZOAA 4GX2A 2O8BA 3RLFA 1PTJC 3E5RA 3E7FA 2P9GA 3H84A 2QTVB 4OMFG 2FPMA 4L5JA 2DGDA 3CF0A 1QKIA 3OPYA 3R09A 2QPTA 4TMTA 2MA1A 2PSJA 3HLKA 2IYPA 4RSGA 1ES9A 3MGVA 1KYZA 1W5TA 4JYPA 1Z83A 2I3ZA 2HNKA 3A6KA 2OCDA 4N6GA 4FBUA 1GQOA 4IV0A 4R1MA 2O8CB 3D3WA 2WEKA 2I91A 1YUBA 5HUQA 5KFGA 2GESA 2H52A 1FU8A 5CM2Z 5DM4A 3QG5A 1JPVA 3BM5A 3I1IA 4J1TA 4BFYA 4BNZA 1KEEA 4Q7JB 3U3MA 4GH5A 4PLYA 1SQSA 4RIEA 2XKKA 1JS1X 3JU3A 4OA8A 1CEYA 1A97A 1VL2A 1XSLA 3R9IA 1C3JA 5KS2A 1U47A 5HP4A 1NVXQ 1OFVA 3ZVRA 2WMOB 4CV0A 5EE5B 2DPGA 4BQSA 4DJEC 4DUGD 4FYXA 1WSBA 1QVRA 2WE7A 4N76A 3ABSB 4I9NA 3M5PA 1PJSA 1U4OA 2AVDA 2ZR8A 3UVEA 4MQFB 1NIJA 3ZEIA 2MSCB 4PYKA 3C3KA 2GJSA 3TGWA 1QF9A 2C1ZA 2REXB 3GJ5A 2ZE8A 4DCGA 2C28A 1FFBA 3FLAA 3RRNA 3IPLA 4ZYZA 3QJ5A 1D2EA 1TT5A 2B4TO 5FDFA 2NXCA 4JCCA 3SEIA 3VNVA 2PT5A 2V9ZA 4EVRA 4JKYA 1YQUA 1UQVA 2XMQA 1JKXA 1KDHA 4JLNA 2PRZA 1P6QA 5E3JA 1LXCA 1VL5A 2MOKA 4GRAA 1ZNXA 4HDAA 1OU4A 3IPXA 2JGKA 4AS2A 2O3RA 2OZKA 2NWQA 3KEGA 5FFMA 1N5MA 2XDWA 1UL1X 1Z37A 2BCGY 2V7WA 1CK4A 3G1TA 3JRNA 5C7LO 4WHMA 1RC8A 1QO0D 2OSBA 1QHEA 2F2TA 4IWXA 2VA8A 3RFTA 2V5UA 1C41A 4G9GA 1KQNA 1GARA 3N39C 4MDEA 1NVWQ 5AUNB 3I9LA 4PCVA 2PTGA 3TF5A 4O8CA 1BU8A 1C7JA 1S2NA 2PGIA 3D3JA 1VRVA 3I2GA 4WBSA 3GJ4A 5D5QA 3THVA 1H38A 4KQFA 4V1CB 3LX8A 4CM6A 3I1JA 2HIHA 2JA2A 3IPCA 4PGMA 4WSOA 1HG1A 3EYZA 3E05A 4GLLA 4KMOA 2Z8YM 1BWRA 3V8MA 1PGJA 4DWJA 3DOCA 1A7AA 3G02A 1AE1A 3MUNA 1ORRA 4H59A 4I5EA 5AW1A 1DAKA 3SV4A 1NHWA 1RS0A 2RKOA 1JQAA 4JP2A 2GT1A 4KK4A 4OB6A 1N9GA 3I39X 4DNOA 3JVDA 4WESB 2FG7C 2C5GA 3KQVA 3MWKA 1T3SA 1IVSA 5PNTA 4BPRA 1MT0A 2V59A 4QLBA 2KE7A 2H3EA 4LPKA 1LRLA 2QX6A 2WICA 2ZANA 4LZZA 5KG5A 5HF5A 4YMUA 5IWCA 1T0JB 2BFEB 3EEOA 3EVAA 1EFTA 3RJMA 3YASA 2B1QA 3T6KA 1GDTA 3MGBA 4WEQA 1IXRA 2HBJA 1DZ3A 1IE3A 4FZ5A 4I9GA 1T24A 2ZXEA 3K73O 4P4SA 4N47A 2C0QA 3OESA 2F90A 2XUIA 1Q50A 2VQ6A 2JJ8A 3QLVA 2ZT7A 1HY3A 1C4XA 1JIJA 3F6SA 3IJEB 4IHKA 1BYUA 1QC5B 2IF0A 5FQNA 1Z5NA 5K3CA 2HT1A 4XUEA 1KS2A 2WM2A 2P2CA 4TURA 3CTMA 4LIPD 3RIEA 2X8BA 4GOLD 1XCOA 4QW8A 4C0XA 1IPHA 4PZUA 4PLGA 3ZBTA 1YVRA 3ZLUA 3KT3A 4QEKA 3HKEA 1XHEA 4M6WA 2R8XA 4YQEA 5TPWB 2FEMA 4IZHA 4R0VA 3ZDRA 1G66A 4QAJA 1XMVA 1KETA 5E9JA 5J3JA 3G9UA 1QP7A 1MJGM 2A3VA 4PPFA 2P2LA 3I09A 3AY6A 1E9SA 4E07A 4Z6FA 2YMPA 5TB5A 3WBKA 3VC8A 2PGLA 4R2WA 1RM5A 1SA0B 4ZVLA 4F6RB 1XTSA 4PTLA 4ZYTA 5JISA 1QP0A 3OD5A 2J0UA 3FLEA 4XPIB 1Y3BE 3AI3A 2D4HA 1V96A 1I3OA 1MCZA 2QGZA 2WTBA 3MXOA 1CR2A 1DEXA 2PA3A 1S2LA 1CDDA 1J90A 4H7JA 4QXRA 3E2IA 3KQMA 2MU2A 1SIOA 3L8GA 2NXWA 2NTNA 3GGSA 4GC5A 4GGMX 3WVNA 4AVYA 4D3YA 2E48A 4A4DA 2P6NA 1NNSA 1MG0A 4IOKA 3KTAA 4JSRA 4LWQA 2Q27A 2EW1A 2V3CC 4R1SA 3AZOA 3FDSA 5KG2A 4W1RA 1YE5A 3CRW1 1ZITA 3NAMA 5KYWB 4DCSA 2C3MA 1GGNA 5LQDA 3OE1A 4UEWA 3OAAD 2IUUA 4ZDJA 5L95A 3MDCA 2CEKA 2YC2C 1NTOA 5JDIA 3TRJA 1I8TA 3DQPA 2W2NA 1DUIA 2ODPA 3OM1A 3BRQA 4Y0AA 2AF3C 1PQPA 4UBKA 5CNIA 3V1KA 4JVSB 1ZXXA 3JYPA 1ZUWA 3QLUA 3TH5A 2H51A 2XAUA 4WZBB 4E94A 3G3EA 2QX8A 3PQ5A 1QV9A 4X1YA 3FBTA 1EJ0A 1X7DA 4MGKR 2QM7A 3LY8A 1T4BA 2AF4C 4BJ3A 1G21A 4R68A 3JQAA 3ND8A 2Z2YA 4BWYA 5TNXA 3V7WA 2I9PA 3TTVA 1K1SA 2P9EA 3DZDA 7MHTA 5HMLA 3SNKA 2RG1A 4FC6A 3ZXSA 2OGWA 2FPPA 1XQXA 4WKCA 1KJ9A 4HB0A 1TF5A 4RQ2A 3M6AA 4GYYA 4TVSA 3UJ8A 4FE7A 2A3NA 5KFLA 2WD7A 1X66A 3FXAA 4HGZA 2LR0A 4ND3A 2VAMA 2ZJ3A 3KUKA 4BWGA 3K09C 1U3TA 1V4BA 1RQ2A 5EZYF 3GRUA 3PHIA 3T5KA 4X6YA 4B09A 4BOYA 1A9QA 1GAWA 1XRSB 4IKPA 8ICBA 2RH5A 4OLBA 4ZRNA 4QU5A 3ZNPA 1OPRA 3PYXA 1Z8HA 1QANA 4FFPA 5A5DA 5LZ5A 4GEGA 1GSOA 3K4PA 1WHTB 2KK0A 1XYGA 2JEJA 3IQHX 3MTGA 1N5DA 1NP3A 4BGVA 4OQYA 3TL2A 3RC3A 3DH0A 3HDQA 4L85A 4K03A 1YKFA 5GADl 1U28A 2FPIB 4O2AB 4XUCA 2RARA 4BB6A 2Y1XA 4UNPA 4CJXA 2BMAA 3E82A 1LTHR 3E9CA 1GL6A 3II6X 1NSFA 3AEQB 3KBBA 4RU9A 4IC9A 1P1JA 2D2EA 1N6NA 2LYHA 2GILA 2QRUA 3B5IA 3BUSA 3C4VA 3IDQA 3R44A 2YVLA 3JTMA 3NM4A 3TBKA 3WAKA 1N9KA 2A88A 2W6CX 3LO8A 5ER6A 3ZXUB 4KR0A 5B66U 2H63A 2CKMA 4M49A 1GGFA 5DO9A 3TFQA 1OWLA 5DHUA 3B5EA 2HL6A 4X7RA 4EY5A 1MO4A 1KK3A 3BWCA 4U2EA 4RVUA 4C2TA 1DRVA 4TUYB 1JKIA 3H4MA 4O2LA 5KFOA 3NKLA 3GPDG 3WLRA 1X8JA 3ES9A 4AF8A 5L4NA 1UAAA 1CRPA 3V6KA 4JA0A 2HK6A 1JQJC 4DA9A 5LDHA 5K6TA 4X6XA 1L7NA 3E7DA 3LYSA 3EXIA 5C8YA 2WNSA 3W2GA 1NXOA 1X1DA 1ZK0A 4PC2A 5JQGA 2RKWA 1VKOA 2QD1A 3O1IC 5HUJA 3DUFB 4WJKB 5HDQA 1PNVA 1UM9B 5K4LA 1UKAA 2FZKA 2RGXA 3EQ7A 2J3HA 4BVJA 5LA6A 1DI0A 2WUFA 2EX1A 1M6HA 1IAVA 1T1EA 2M9NA 1R4NA 1E3EA 4PC6A 1G2IA 2YJ5A 3B48A 1T3NA 4HRYA 1C9JA 5LB2A 2B8TA 4OJKA 1V7CA 5CLQA 5AVVA 1UZLA 3JQFC 2YBDA 2JIZD 3WLHA 4ANFA 4CMHA 4YMVA 2Q7XA 4G97A 1V6CA 3TFOA 2FW9A 1MB4A 3ILHA 1S8NA 4N5IX 1NUHA 3WHKA 3TX6A 1DSSG 1I2AA 4X8MA 2JH9A 5JUMA 2IEAA 2NQTA 3N1UA 4JJ7A 4PG7A 3MWEB 3HJNA 2E4ZA 3MELA 4R9VA 1C3EA 5JARA 4V03A 2IH4A 1ZGAA 2QLFA 1IQRA 2QPLA 4G5SA 1OFTA 4Q4JB 1SXJD 2ZU6A 8ICLA 5BWCA 5ALQA 2GEFA 2EEPA 2R87A 3ND6A 1Z7EA 5DGAA 2C9BA 2VLIA 4N5DA 4Q9IA 5EKXA 5KPJA 3K1AA 3PUKA 5BVGB 3D2CA 3DKRA 4JI6B 1RABA 3W34A 5AESA 1JR2A 3I61A 9ICCA 4DV0B 2DTXA 2HUNA 2ZR9A 1C20A 3GJXC 5TT1A 1IEXA 4PYNA 4B73A 3FOCA 1A2OA 1SRQA 4ZPXA 1RMTA 1E6KA 3DE2X 1Z6PA 4TSFD 3Q3IA 2X8JA 2G5PA 2OCEA 3OJXA 3I4CA 1NTRA 4R51A 1EHIA 2BF7A 1A3CA 2NACA 1DFHA 4RA9A 2ZI9A 2HUPA 5CJ2A 1QE0A 4FWIB 3H1EA 1W44A 4MHOA 1PUIA 2CF5A 1EZZA 5C46F 1BJRE 1DXHA 2ZUBA 3WQSB 3WSTA 1J6UA 3SQIA 1GY8A 3P2OA 4YRMA 4LRSB 4S2EA 1NQAO 2X0KA 2B92A 4B4OA 2VS1A 3KPVA 1G6Q1 2GJ9A 3LQ1A 3PRJA 5LPNA 4INJA 3R5FA 4D8XA 2QJFA 1FFGA 4QZAA 1S4QA 4NX2A 5IC5A 4DR6B 1PJ8A 4M1WA 4CKXA 4HEJA 2Q5OA 1QVZA 1S7CA 2JJMA 1I7SB 2FQ1A 1CHDA 4BNHA 1D03A 4IVRA 1UPFA 3AZPA 1F5NA 2OZLB 1OXJA 4DA0A 3N0WA 1F48A 1UMDB 1W85A 2VG8A 1QU2A 2NXJA 3MINB 3TDKA 1EYZA 4B3FX 4G63A 4LZPA 2QB0B 4JBWA 4C76A 3EBLA 4TWZA 2P9CA 3E1SA 4DLBA 3KOZA 4CU5A 2PWPA 4FS3A 2GHRA 5K0BA 5J2TA 2GASA 2FUNB 3TZEA 1BJTA 1U8ZA 1X86B 1PR5A 2KN7A 1N4DA 4Z86A 5IJ0A 4QM7A 4CFZA 3G6YA 3E9ZA 2AXEA 4TLAA 1VCHA 2FDXA 4MKHA 2KNJA 1CNFA 3PICA 5K8IA 2D3DA 3KBOA 4DR7B 1JQ3A 3HJTA 3I9V6 3L3BA 1I0ZA 4RGVA 5C4IA 3G5AA 2C5AA 1NK0A 1QAQA 3P2MA 1ODSA 1IBMB 3TK1A 4Y0NA 4C0ZA 5HOQA 5DH9A 3IELA 1Z0SA 5CWRA 1TO2E 2BSAA 2W5UA 3IUPA 5ALDA 1BG6A 1GRRA 4H3HB 1JLLA 2CZQA 4RQTA 4B7AA 4N5HX 4MW9A 1L3IA 1PVPA 2GEUA 3C21A 2RK3A 3QOFA 4ELTA 4MIKA 1V5GA 1YI0A 3C3EA 5H80A 1E61A 1MBZA 4YJ2B 4BS9A 5IUKC 2O05A 3OZVA 4PHAA 3F4BA 4CEJA 1FL9A 1US8A 2XCAA 4NZOA 2VRNA 3OQIA 3CPEA 4LJ6A 3WKAA 2JZNA 3KZNA 1Q5PA 4U2KA 3VJRA 1ACJA 1MKYA 2O6KA 1ISPA 3VOSA 3N2LA 3M82A 1I7QB 1D8YA 2ZM5A 1MW8X 2FLKA 1HUQA 1IUOA 5K05A 5J2AA 2QVXX 3AR6A 1JLSA 4H7KA 3RYFB 4L2IA 4FYVA 3DTVA 3ICCA 4QTXA 3ZCVA 3VKUA 4CPDA 5DM70 1VI6A 3OWHA 2O5VA 4WBNB 4TTTS 3ZD7A 1AZLA 4KOEC 4MV9A 1CQIB 3QXGA 2X3UA 5JS6A 4RTSA 3HPOA 2NUPB 1B15A 2JV3A 1G6OA 1GUBA 2CHFA 5ENVA 3PP8A 1W9HA 4AZSA 3D2LA 1YXMA 4EBFA 2JVKA 1JPUA 3I2KA 4H15A 1QXSA 5JY6A 3PUIA 2DQ4A 3BXOA 4UFPA 4V2IA 4BFZA 4HQFA 4ED0A 1G8SA 4G56A 1A4IA 2DH6A 2JLQA 2R84A 2BGNA 2D8CA 1KJIA 2JD0A 1JILA 3BH6A 1TKDA 4JD5A 4KAXA 2GUWA 3VO9A 2XUJA 4ARZA 4EUFA 3OT1B 1M0WA 2H0AA 3OT1A 5FL3A 1R5BA 1DQRA 1KGDA 1L5SA 1V1JA 4BDPA 2HF2A 4CMJA 1QO7A 4HNAA 2BDUA 3IPAA 4BNYA 3ACCA 3FDZA 3N07A 4M9SA 1X3SA 3TSZA 4DCMA 4TXJA 3O75A 3U4CA 1Z26A 3WLLA 3PX7A 2IKQA 4P8RA 2WJPA 1UT8A 4OSEA 5C80A 2W8BA 4P84A 4DE5A 5C37A 1AGYA 1YZHA 3GA0A 1EWYA 4P0PB 1Z34A 2ZRCA 3H0CA 2Z4RA 2WV7A 4O1IA 3AW9A 4X1OA 3RWBA 1CNMA 3NIWA 2JEFA 2HPHA 2O2GA 4JQZA 2LPMA 4Q45A 1E3JA 1U9JA 2FSSA 4OQPA 2ZS8A 3KKZA 2HPZA 2AEMA 2BFMA 2WT8A 3IUSA 4TKUB 5F4ZA 3G2OA 3QBDA 2G08A 1ZOSA 3LCMA 4ZREA 2GPBA 2V74B 2RHRA 1RRPA 2I6GA 1U63A 3LBIA 1FYFA 1JKJA 4HTAA 4F9GA 3T7JA 1G8PA 4L9SA 4MUGA 4ZXFA 1E66A 4JJ4A 1Z6ZA 4RVFA 4Q3KA 4RPCA 4AKEA 1RIFA 5KWIA 1YONA 2AJTA 1RYSA 3AP3A 3DEFA 3EDQA 4REQA 4B2LA 2FE9A 2GAAA 1VMDA 2QRNA 3T94A 1XQ6A 5I5EA 1YWGO 3HZOA 4YD1A 2HHAA 3J80A 3CVYA 1NSTA 4RXMA 5ITVA 4XJSA 1YQDA 2AEJA 2QAIA 3CLUD 4J9OA 3OIWA 1ZGZA 3HVKA 4H31A 4IIDA 3EJ6A 4BB5A 5DHFA 5ALLA 2VOEA 3GLQA 2ZIVA 1E8NA 5DN6A 3OJOA 5AIAA 1WP9A 3SEZA 1EFAA 5LYJB 2E1RA 1GAQA 4KW7A 4NH4A 4QEZA 3UWPA 1R8QA 2EGUA 1A8HA 2J9FA 4G07A 4URWR 4UZSA 2PT6A 3SDSA 3GJRA 1J2EA 3WYAA 5H9VA 4CV2A 4BKMA 8ADHA 1GU1A 1XOIA 5LZ2A 5GIPE 2YWEA 4IG4A 3NKVA 3FI9A 4JGBA 4OP3A 5EKDA 4C30A 3SDZA 2PKEA 1ENYA 1XVVA 3ADKA 4KNVA 1GPYA 3BSYA 1F7VA 2PKQO 1L4YA 1N2XA 1XO0A 1A76A 5CBKA 3PRYA 3F53A 2YJ4A 4CCWA 1NLYA 5FI1B 1DHTA 3ECAA 5JCJA 4JP1A 1AN9A 4BXOA 3HFRA 1LDEA 4M2YA 2DWOA 2QM3A 2RAVA 2XTJA 2WFLA 1PJQA 3WZ2A 3ZY4A 1LB1B 4G24A 1DWQA 1GWNA 3ODGA 4U7HA 4BAUA 3RK4A 5JSKA 3QX9A 3R7WB 1ACMA 5KWSA 3BKWA 2XE6A 4QXQA 2Q62A 3W5SA 4US2R 4M38A 4YUXA 3RRGA 1E7WA 1LLCA 4FP9A 5EC8A 2XNJA 3ORRA 1VJ0A 2ATEA 2GS9A 2LWIA 2DR3A 3AEYA 3ESZA 5A02A 2XW6A 3LRXA 3O94A 4KG7A 4CIYA 4KIWA 4MITA 5FBVB 2J6BA 4BDTA 5CXQA 3PZPA 4RDXA 1JQLB 2EBHX 1NKEA 1U0FA 3A9RA 5EIOA 4DDKA 4F3TA 3LZCA 1T5OA 3BS4A 4DLYA 4BO7A 2HBKA 2WAYA 3A0RB 3C74A 3OSUA 2C9OA 3L8EA 2BC9A 4JNCA 1N7JA 1Y9JA 5EJ5A 4NXMB 3TW6A 5LQNA 1HQDA 1VBFA 4RZSA 2I2XB 1VSQA 2GK7A 4RZ2A 9ICMA 4RCYA 4LE2A 1RXUA 3TD6A 5JJIA 1DE0A 1GYRA 2QW0X 2UUOA 2HDHA 4GYKA 4RWEA 4WE3A 1CEXA 2YMLA 3C5CA 1NDQA 3N86A 5B1DA 4AJLA 3R3JA 3L6DA 1OA0A 4FGZA 4BNWA 1KTIA 5J0QA 1JVNA 2WLSA 2NP6A 2FF7A 1BDHA 4GECA 3EEYA 5EP2A 2Y8EA 1C8LA 3OHMA 4CR7A 1RDFA 2R11A 5L53A 1BMQA 2IA5A 4LJSA 4G4IA 1TI7A 5B58C 2H2IA 3FPAA 2NTVA 4JR2A 3DOJA 4PHTA 4QUEA 5KFPA 3IMKA 3UJHA 1E4VA 2ZAGA 3KIPA 4BMXA 3NHJA 5IM4A 4KIUA 2V98A 2BHLA 1L5VA 3IVXA 4US0R 2ZRHA 3OZGA 5FTMA 3ILXA 3DMFA 2QTFA 4BNLA 2V6GA 3PO4A 4LYDA 4FPXA 3WIOA 3T1TA 1JN0A 4JZKA 5CHGA 1A5BB 1N2HA 3H2KA 2ISPA 1TB4A 1PO7A 4F5RA 2XADA 3CRMA 3KM0A 1YZNA 1Z4LA 3NTRA 5HJ5A 5IN4A 1B23P 3VU3A 5GJBA 1Q2UA 1VRCA 1P7PA 2VH2A 4H1HA 4LTMA 4MUMA 1PYDA 4G1BA 4I99A 1VHJA 2Q3MA 5JATA 3C6QA 1F5SA 3CRVA 2O2XA 2PU7A 4ENUA 5JEEA 1LK0A 1ZO8A 2VYFA 4Q1EA 5JWRA 2X40A 1E3MA 3HR7A 3GFGA 3U17A 4BO1A 4C6SA 4XVCA 5KYKA 1A1VA 4UMFA 2TMYA 1KZ4A 2AJ8A 3LQKA 2HRDA 3WGQA 2YXPX 4FFNA 1VI5A 5AT1A 1DCKA 1OAOC 3EFEA 4JHLA 2KJQA 4TL8A 4ZT4A 2YHUA 1L8LA 1QSYA 1BW9A 3TIVA 3A9SA 4PO8A 3THXA 2YZNA 2BMJA 2RJNA 2GHQA 2V3WA 3EOAI 4RHEA 2FWMX 5D86A 5FHRA 5J9FA 3V72A 2J87A 1C4OA 2Q3BA 3K6KA 1KH1A 4B40A 2A8YA 1T0IA 2DQSA 1PLJA 2MJLA 3PZRA 1OF1A 2QW1A 4D41A 9ICPA 1YBFA 4KLQA 1A72A 1WM1A 3IESA 4PO3X 3ISVA 4R16A 5DIZA 3WRYA 1GZ3A 1FE8A 2DU8A 2HSJA 3A9TA 4R1QA 2WAQC 3HKZF 1YCFA 1XKLA 3HGMA 2G06A 3TIXB 4KLDA 4NICA 4X7BA 1F2UA 2BP7A 3IG8A 5H4HA 2I29A 2YNMC 1EDZA 1UZNA 2C2EA 4HUJA 1E2HA 4O59O 3RCBA 3LGXA 3ZQUA 1Y4ZA 2NUTB 4XWYA 2CUNA 3ESQA 4BEVA 3K8YA 2ZJBA 2JHPA 4TV8A 2FEWB 4FGSA 3KYIB 2G17A 2VTEA 4O4HF 5B4UA 2O3UA 1HG0A 4I2AA 2HIAA 4HH4A 1KGSA 4MVJM 2ZXHA 4ESHA 4BDSA 1WDWB 3I9JA 4KQWA 2WI8A 2JGFA 4ZVUA 1A8IA 5DKWA 1FP1D 3BL5A 3L79A 3TM5A 2AMYA 4TLBA 4DJJA 4FOPA 3TM4A 1Z38A 4HR7A 4UM8B 4XX0A 2HA5A 3M3HA 4G0OA 2B36A 4XUSA 4NMMA 4Q9DA 3ILSA 4HEQA 3C6BA 1DKNA 3AJRA 3T4PA 3WJAA 3RF6A 3PX2A 4CDMA 2FY8A 3K9NA 3R5TA 5DYGA 4I1VA 3DPUA 6REQA 1XKTA 4TTVA 5IVPA 3GYBA 5IT5A 4RFSB 4U7TB 1JXOA 1Q0ZA 3KWJA 1D8TA 3S7TA 5BR7A 3H9BA 4L7VA 2XB6A 1DAGA 1MIOA 1YT5A 1SHUX 3WMWA 3V48A 3EW9A 3F3MA 2XZPA 3ZVLA 2EP5A 4TS9A 4E5KA 1BXGB 1IIPA 5LR6A 2G0TA 2C2ZA 2O7RA 4IYRA 3T5DA 2C3YA 1C50A 5JANA 3E53A 4K46A 3SJCA 5G4LA 1EVQA 1KNQA 1BA3A 4U4AA 4EG0A 1O7JA 2IXDA 2YW2A 3AIIA 4IM7A 5T57A 1PK9A 4RVDA 4LMPA 3T7CA 1KOGA 2ECQA 4GT1A 3HW8A 2YDXA 5B53A 1L7XA 2BKLA 2DCMA 3RE1A 4BO3A 1CRLA 1AKUA 2ADOA 3SE7A 2EBFX 4DMCA 3U2QA 4CLXA 5C1DA 5DV9A 1J2TA 3RAXA 3AZQA 3E5NA 2OFOA 4MPRA 4CM5A 3N0XA 3F5DA 3LXUX 2ZWAA 1M2EA 3A4YA 3WBJA 5B2EA 3QBEA 4UC0A 3HFGA 3MCAA 3ML1A 3VV2A 2QARB 3WIDA 4HWTA 1LSJA 2F3TA 2J45A 2OC4A 2ID9A 3OHBA 2GBIA 4YCSA 1M5RA 4O33A 4R71A 2DFDA 1N5XA 1LDGA 2GHTA 3A26A 3K0CA 2X14A 5BVHA 4LQCA 3W2FA 1W94A 3PC7A 4KFCA 3M9MB 1M72A 3TD2A 2FPUA 3MWEA 2XSZD 3KX2A 2ZRGA 5K2MA 1I6MA 2ZJ2A 4IL5A 3C7KA 4HVTA 4D9KA 3NNDA 3MOGA 1K98A 3AEUA 2X3YA 4TTAA 4FYKA 3N53A 1S97A 4GOXA 5DW0A 2VUHB 3DD5A 1INLA 1FYEA 3ZCXA 1YASA 2E21A 2BFAA 2Z1DA 3R5XA 5AW6A 1S2OA 3NYQA 4LCJA 1O0SA 3O95A 5E9QA 4DJFC 1STOA 1Q1AA 1EJBA 2XQFA 3ABQB 1JG3A 4ZIRB 2GZRA 5EKUA 3CX3A 1U80A 3FYTA 4OI1A 4MRMB 3G5UA 2GO7A 5EHZA 2EJVA 1R10A 4YDQA 1E1RD 3T35A 4YRCA 2O8EA 2ZRKA 3G82C 4HAUA 4QDZA 4CL0A 4DLAA 4ZK2A 5AK0A 1Y98A 1APBA 3PMLA 2LKDA 4YAIA 3P26A 2XVTA 2VK1A 5A5FA 1H2FA 2ISCA 2A1JA 4TN1A 4WA8A 2QK4A 5THKA 1KLNA 5JLAA 3W6NA 1CD5A 5EPUA 4CVNA 3L4EA 4CF7A 1NBIA 4REMA 4G89A 2Q7OE 1IB0A 2FEAA 2BEKA 1WZNA 3KYCB 4BLRA 4HNSA 3L7NA 1IIRA 3DOUA 2C57A 4IOJA 3ZU6A 1RBZA 2DYKA 4MV6A 4RNDB 4YYEA 2BGJA 3ODPA 1LJLA 3FMOB 1OJ7A 4LC0A 3V4FA 2ADMA 2GN6A 3LDGA 3LUAA 3K9LA 5U1PA 4P0QA 3GD7A 4GMFA 3W78A 3NRZA 1ZWKA 1NXSA 1RSZA 3AEQA 1UXOA 2RH8A 4ZOLB 4CKZA 4RUAA 4V3BA 1KK1A 1GPKA 2WT9A 1XLUA 2AG0A 4ON9A 2R6GA 1PR2A 3HZZA 3HY3A 3ORHA 1EI9A 1SU6A 3RJKA 1NBMA 3GN1A 4N3GA 5SV2A 1F9EA 4QOJA 2VKTA 3QPVA 3PRHA 1VFPA 4Q12A 7REQA 3GFVA 4R5HA 3MGCA 2FDCA 8ICOA 4OU5A 2FF5A 3C0KA 3GLSA 4CQJA 2FSPA 1Q6ZA 4WK4B 1MAHA 4Z5XA 3KR9A 3ZZNA 2QG4A 4W8OA 2HU2A 4Z0PA 1YQ9A 2XUAA 4EB6A 4V0SA 2GWRA 1WXXA 1RRMA 3NXKA 4YJHA 4TLLB 3PQ2A 1V5WA 2BLNA 2R1UA 2ISSD 4OXRA 5FCDA 5JDCA 4FBMA 2R4UA 4EEXA 5MHTA 4DB2A 3EGOA 4Z8XA 3DVAA 5B1EA 1CFJA 1XD9A 3PW5A 4ZVSA 4D3XA 1UOOA 1A9YA 3HNRA 4B71A 3KU4A 1N5JA 3MWFA 1JTEA 4QD3A 1X2IA 5JJBA 1DAPA 5J0UA 1UBNA 1PEAA 3JQAB 1ZIDA 4MS1B 5CEEA 4I50F 3SX0A 5JOQA 3HA3A 2XYGA 4KQIA 1F17A 2QJTA 2HA7A 3SI8A 5HFNA 3BK2A 3TLGA 4B4KA 5DQGA 1Z73A 2BEUB 2K8AA 4IO1A 4P08A 5KJCA 2Q5EA 1NVGA 1EGHA 3S8EA 3TI7A 3EWSA 3LLUA 2X5JO 3C6ZA 2Q4RA 2HSDA 4Y6SA 3FVTA 4IDPA 2PH5A 4OPMA 3UMBA 4RK0A 4F2HA 4LJ5A 2NU8A 4EGAA 1U2ZA 3O7MA 5KTQA 3DWEX 2V1UA 4DTCA 1Z15A 3OCJA 4FDAA 5M29A 2BCQA 5CFLA 3CZMA 2JFOA 1NJZA 2ZRQA 5FA6A 4KX3A 1R74A 3GJTA 3DBOB 2I7DA 1KN5A 2YQEA 4JMUA 1E8MA 1N1EA 2KS6A 5KYWA 5JS7A 3SE0A 2J59A 4MFFA 3I45A 1ZMRA 4WGGA 1JMYA 2MSEB 1BAPA 3LT0A 3I5UA 3NW9A 1OI7A 5FWXA 3A31A 2ECKA 1ZBDA 2OT3B 2X42A 5GGXA 4IAOA 4G81A 3BJZA 3FPLA 3S2ZA 1MGPA 2C0CA 1FXWA 2R1VB 1FFWA 2M6KA 3ASZA 3IDWA 1L3CA 4X60A 4HDCA 1RAEA 2NU9A 1B0XA 3BGVA 3RANA 2H2GA 1U3DA 2J0UB 4J8PA 5KFBA 1HWYA 3CLTC 2RSLA 5DGBA 1Z0JA 3IKJA 3EC2A 4R8RA 1T35A 4YAKA 4NXZA 1NVDA 2O23A 5CEHA 3RRHA 1DP4A 4FX5A 4LTNA 4QBIA 4QWWA 4UBOA 4HT3B 4IRCA 1JN3A 4EY4A 1E7YA 5A4JA 5HPYB 5ICSA 2B98A 4C87A 1LQUA 1ISGA 1Y4UA 1YDHA 2VJBA 4QLAA 1P4SA 5CLFA 3AKZA 3ET5A 4IQWA 1CZRA 1U8UA 3PFIA 1YDWA 2ZM6B 1XL1A 1CQWA 1YC5A 3AERB 3KQNA 3HI6A 3EGXA 1L6IA 3RWOA 1V5FA 3T38A 3CTPA 5EZYB 3JD4A 3T95A 3C43A 3Q3VA 2ZBPA 3NGMA 3IG5A 4NG4A 1IXYA 4D9FA 5EJ8A 1MXHA 1M5UA 3QEAZ 1XV5A 4QYXA 3TDMA 3WGYA 4OJTA 1DVRA 1RFLA 1UQUA 1VGVA 2HBRA 2HD4A 3O0DA 4EF6A 1KOLA 2OECA 1YR6A 3I4LA 1HE4A 2I55A 3ZZMA 1VECA 3KNZA 2WYOA 2UZ4A 1T4DA 4QL3A 2BKAA 2L5YA 2VPQA 5H1YA 5J2UB 1CSEE 1KBUA 2JCGA 3TANA 2L42A 2TECE 3AF3A 5AJUA 5BR8B 1XQWA 4C3ZA 1WDLA 2Y1WA 3TACB 1XTQA 4DSAA 3DF7A 1Q1BA 2A5FA 3VPDA 3FAHA 1FDUA 1T2CA 2PPLA 2UZIR 4RJLA 3G7NA 2F9LA 3U39A 3BVPA 3CY6A 3ON5A 4DC0A 1MB0A 3LRTA 1ZD3A 1J5XA 3IVGA 3V2HA 3NBYC 2YZKA 4RPGA 5C1BA 2VPYA 2R44A 4JT4A 1S0VA 2Y1JA 3NLLA 5D51S 3UMCA 3G2MA 4HPXB 3KDAA 2ZU0C 1I7PA 3GLTA 1UBOS 2Z2JA 2P68A 3V4PB 1SKMA 4PPXA 1VJ1A 1H2HA 1J2MA 3HX0A 2VDWB 5HJ7A 3JW8A 1BRMA 4JS0A 2VHEA 4D45A 4QYIB 1QFJA 3RBDA 2AD5A 2GZDA 2LNDA 2FZGA 1IATA 2P3SA 4GMHA 2ECPA 3TQIA 1OBHA 4GGPA 4PGAA 4EOGA 5BN5A 1V7PC 1X94A 1NQ5A 5HM6A 4OHMA 1IXZA 2NO6A 3U1TA 1VL8A 4R8MA 4CODB 2W83A 2BDPA 2KIWA 3OO0A 3QKSB 3EXFA 4PZDA 2DHQA 3J81j 3ZHXA 1U3GA 3I2IA 1WMEA 1Q0PA 3O0TA 5HILA 1PWHA 2RGGA 2VSNA 5AW5A 1E5DA 3FA2A 7ICOA 2NO4A 2J3LA 5IDYA 4M9GA 2JGNA 1ZQ1A 4C2BA 2JBWA 3V80A 1IZZA 3GEEA 3RG8A 1RRKA 3ZE1B 3AFHA 3UPQA 1A96A 1IOVA 5FBLB 3QE4A 2GXSA 2VJMB 2GTPA 3L8HA 3VPAA 3ZWQA 3HTXA 4KL8S 3DB1A 2AHOA 2OBYA 4RX1A 1QBKC 4ZO6A 5E0KB 4IXMA 4EFLA 3O3NB 3I01M 3FYHA 1P19A 2GCGA 4YHHB 3RYHB 2YB4A 2HK7A 1DJNA 3ETJA 4GUAA 5AQ1A 3W2TA 4CQMA 1UMCB 2F8TA 1CY8A 4UHBA 5CRIA 3EK2A 1U7PA 5LP6F 3D5EA 4XDYA 5L3SB 1K0FA 5JXHA 4TKZA 5B36A 5AKZA 2H1HA 1NASA 3DT9A 3RLIA 4BO6A 4HDQB 2JD1A 4F12A 1B3RA 4I7EA 1RJ9B 4GYWA 4TV8B 5CLIA 1GZSA 4DMRA 1FP4A 1H5NA 1PJBA 2FFAA 4WTOA 3NDRA 2V55B 3QJGA 1XVLA 2EZZA 2GUGA 4H1VA 3HKBB 2AI3A 4YPOA 2YBEA 2DE0X 3MLBA 1JH9A 1ZCZA 3FOBA 1YQXA 4BRUA 1N62A 1WCV1 5FBKA 1LLQA 5K4HA 1OU0A 1EA7A 4ECEA 5JEDA 4NP6A 4YMTA 1GAJA 5KNCH 1KRPA 3UJBA 1KP9A 2EZYA 1SXJC 3SLGA 2O50A 1QQ7A 1W4ZA 1B41A 2M9MA 4HBGA 3THXB 1FSGA 4KTQA 2WAXA 5DIFA 3RJTA 4NI5A 5ESWA 5HHTA 2ZUTA 3K30A 1LV8A 5LOVF 4EGQA 1R9NA 4ECVA 1MRZA 2TMKA 2EEZA 5KL8B 2F1RA 2IZ0A 4M9UA 5JXJA 3TOCA 1YCDA 4D9JA 1ORVA 1SOMA 4C22A 2R8EA 4N3AA 4YP9A 3AUFA 2SCUB 1X42A 3K15A 1O2DA 3LVFO 4OLFA 4S3MA 2BELA 3R8CA 1LPOA 1M66A 2FHSA 1U4NA 4P4NA 5F5NA 1IMOA 4J6FA 3TQCA 2VEDA 4LDJA 5HW0A 2QUJA 3EXG1 1CZNA 1DFIA 3FHJA 3W5AA 1WJGA 1VZ3A 4R83A 3HACA 2COKA 2BQ3A 2DQKA 3OKPA 4YP5A 3LY9A 1XQ9A 4O4IA 4RDHA 2HN9A 4L5YA 4JJAA 4CMBA 4RTNA 2ZVJA 2H5EA 1W0JD 2RGBA 3ZKAA 4R9NA 3EUWA 2WWHA 2I1VB 3BB4A 4BQNA 4JIMA 3PSPA 4QRIA 3O4IA 3PGKA 2F55A 1E99A 5LQSA 3QM1A 1M2FA 5DLYA 5CDGA 3GNQA 1J8DA 3P94A 4HQ6A 4XRRA 3C45A 2NVUA 3PC4A 4KN8A 1XWLA 1UF9A 5DEOA 1YS9A 1NR1A 1Z33A 3AUAA 3P2IA 2PUCA 2X86A 3FFTA 1R0BA 1ZHFA 2AN3A 3HUTA 4WXHA 3BSSA 2Z3ZA 5L1IA 4OAQA 3SC3A 3R8XA 4MEAA 1KO8A 4PHHA 4IDCA 2Z57A 1MDFA 3Q87B 3DM9B 3KKPA 3VZPA 1UJ4A 1MV5A 4KLNA 1LF5A 1MB3A 3VCBA 4W5QA 4CTJA 3DV0B 2ODTX 5IKXA 3RYTC 3X1DA 1WU7A 3G68A 4PHFA 1COZA 3F9CA 1OXXK 4EAQA 4ED9A 2SNIE 1MH1A 3FWNA 4NZPA 4ZU6X 4EG7A 2X19A 4UTVA 4R7ZA 2OYCA 2RRDA 4PLPA 4O3QA 1ZS9A 2GYVA 3GC6A 1G1MA 4IFTA 2BE7A 2JGDA 1OZHA 2PLNA 2PZLA 2IYZA 3I9KA 4QXMA 2HWWA 5FP0A 4LHXA 3RUFA 3RVSA 1VPVA 2G5HB 4DZZA 4IINA 4AD8A 5IYZF 4CCYA 3CRXA 1YIOA 2XWQA 4J9MA 1E3LA 1H93A 3H05A 3L8MA 4PAWA 5F4BA 4LNHA 1FLVA 4ZVVA 1JA9A 1IAQA 3FSGD 3HL0A 1B16A 5JAOA 2A0XA 3WKEA 2VYVD 4ARSA 2VK4A 5KNDA 1FMJA 1QCZA 1JIIA 3F9RA 4IGFA 3OZIA 4BLUA 2I3AA 2BQRA 3COYA 1KZHA 4DCJA 2XKAA 2O4UX 2I6XA 1A8UA 1F0KA 4NOMA 4F3OA 4DS5A 1M2JA 1E9FA 4XWWA 3BF7A 2RGDA 3EXFB 3RGGA 1SV0A 4AKHA 1DJOA 1MO6A 2IS4A 7ICIA 3MTQA 1DAHA 4W5HA 3LLVA 1XMXA 4Q9AA 3ROGA 3C3XA 4RK5A 3CZPA 3VSCA 5LQJA 3GJZA 3NNNA 2YRFA 1K3TA 1UK8A 4D8TA 5ADVA 1ESNA 3UY4A 1X9MA 1FDWA 1N7HA 4LMAA 4L3OA 4PQFA 2ZIVB 1DU4A 2UVUA 5A3QA 5BYAA 3UPTA 1QPZA 3IKLA 1I2BA 2R6HA 1KKLA 3QFHA 2AL7A 1XTKA 5JROA 2IELA 3ZIDA 2OFFA 4AMZA 3AHEA 1GGJA 1FU4A 1KAMA 2JKYA 5HOEA 3EFOB 3D1JA 1R3DA 1UP6A 4X20B 3M6LA 3UIEA 3LL7A 3OE7D 3A1FA 5JT1A 4OD0A 2JEZA 5B6IA 1AB6A 4MICA 1CUSA 2G77B 3BZCA 2RI1A 5TJHA 4A8PA 3D3QA 1NVFA 3WNZA 4RD4A 4OJNA 1E6EA 5KNBD 1D5CA 1EXDA 1HUOA 1G0NA 1RZVA 4YWHA 4CLOB 3GN2A 3LLCA 3AHGA 4DIMA 4UZEA 4P22A 1Q95A 4MMZB 4RSRA 2VK8A 3RRYA 2PRKA 4A0HA 1TPYA 4JEHA 3D0OA 2GNAA 4K5QA 5C8DA 1NMSA 2Z3VA 5CFRA 1JR4A 5CDHA 5KVSA 3PVCA 5EHGA 5J2UA 1O8CA 2CWDA 3NAGA 1QQTA 5CGZA 1GKKA 3PS9A 2NN3C 3AI2A 5E4FA 2IPXA 1XD2B 3BRCA 1WUHS 2NX2A 3AY0A 1DXSA 4L8FA 3CWQA 1QOQB 4V0KA 4YQYA 2KE5A 3H5OA 3KTOA 3O21A 4GDMA 3SQDA 4MR9B 1CY7A 2QUHA 4TMZA 1IHYA 4FMBB 1NVTA 3W04A 5KC8A 1GKUB 2DWCA 3KT0A 1EX9A 1RXSA 2XUQA 3E9NA 3B1XA 4NOLA 4PO9A 4M1OA 2VWPA 4PYRA 1FS6A 2AMFA 4NULA 4P82A 2XTAA 3N6VA 2ZBDA 3RK1A 3QEMB 2Q1TA 4MLCA 3BK7A 5G4KA 1JWBB 2BZ0A 2IHNA 2WVGA 4BX2A 2OL4A 3MUOA 1XN1A 4QOHA 4Z9AA 4ARZB 1BVSA 4IQVA 3N76A 4ZI2A 1MIHA 3LTEA 5E7MA 3FE2A 5F64A 3ZIAA 5CBPA 2P6UA 1FO4A 1R0LA 5KNBA 3DE3X 4C0AC 4EJ6A 5FTJA 3TMYA 1SKQA 1T2NA 1YNOA 3P4YA 1DRWA 5D3MB 3N8GA 2H1WA 2GGSA 2VA9A 3INGA 5AI8A 3CO0S 2XQVA 4GAEA 1ZETA 5HF8A 1E1LA 4EUSA 1YK0A 2H85A 5KX5F 3FYUC 2HHXA 1TC2A 2VJNA 3NOXA 5IBPA 3RRMA 4TMWA 4FO6A 1CTQA 4HAWA 5A5GA 4KMUA 3VZCA 2WYWA 2PYIA 3MT9A 1EPUA 1SBYA 1AHNA 1D8LA 3K1JA 3AJ8A 4HQ0A 2Y0PA 2MMCA 4Z9YA 4P4PA 3VPCA 5C7YA 1Y48E 1Z7WA 2QP9X 3FVWA 2IVFA 4R41A 5L3QA 2UVRA 1JLHA 3BT7A 1JEYA 1TCVA 4PHCA 2EF1A 2HKIA 9ATCA 3S0JA 9ICVA 3G2KA 2A57A 3KXDA 3LRPA 5C5CA 3CPJB 4OOEA 4DXDA 1TW3A 4OREX 2W6QA 3HP1A 3B8EA 1OBVA 2I9GA 2SECE 2XUZA 4RMHA 3SU8A 2NZXA 3E22B 4Y9UA 3GCZA 4HQKA 4AKSA 2HGZA 1U99A 2VXOA 1XF1A 2W04A 4I2DA 2VIIA 4L6CA 4PM4A 2EX4A 4UTZA 5AVKA 2KQUA 4FB4A 4XPZA 4DQQA 4LRUA 4RDCA 3LHKA 3ZX5A 4DIFA 4LJAA 5F78A 3CB4A 2KB0A 9ICLA 1QTNA 2VBIA 4PG5A 4JEUA 1SD5A 1U0LA 2VL7A 3N2KB 4YALA 1TMGE 3NETA 1GZ4A 3SYLA 4GLOA 4NE7A 2C8VA 1P0MA 1ULZA 3KKNA 1NPYA 3F6CA 4R65A 1RYHA 3BC1A 3PITA 4LDNA 4ITRC 1U7DA 2NIPA 4DJ5X 1D3AA 5AVXA 1EZ1A 2GTIA 4EW3A 2BD0A 1Z6QA 2WB1F 2ERCA 1NZBA 1C0PA 2ZUUA 4LJ9A 5JI2E 3MQFA 5DGXA 3SFTA 4V0MA 4IIYA 4MW2A 4EMTA 4NM2A 5KMGA 1S0MA 1J00A 1UDWA 1YD7A 3UO8B 4ZARA 5D7BA 2IZ7A 2B4AA 1K3FA 2Q4EA 2I1WA 3GVIA 2CXPA 4LMRA 3ULKA 1DBSA 1PDOA 4F4FA 1T9HA 2BM9A 2AN9A 3RIYA 3V8NA 3VU9B 4NMLA 2VP9A 4F2GA 3MCUA 4PY2A 3QX7A 4ED6A 1LBIA 3AJDA 3QVSA 4Q9LA 3JQAD 1LFDB 1GTVA 3QWHA 2E5WA 4D57A 1ZQHA 1WNTA 3WK5A 4H4EA 4JITA 5JBIA 1GZDA 1RP1A 1R88A 2APJA 1WD5A 2I7XA 3JZIA 3KLOA 4J9VA 4PYQA 3DYBA 3W6PA 3IXLA 4KVGA 4B75A 4MKRA 4QA9A 4Y8VA 3NQ41 1VB3A 1FQKA 1MN6A 1D7OA 4N9WA 3V8PA 2X1MA 4QIHA 4EELA 4QT4A 1QQAA 5DK6A 3QBTA 4ECYA 2H6EA 2N47A 3O83A 4DSEA 3QF4B 4IDQA 5DYNA 5DTIA 1F60A 5FWYB 2CBZA 1QWOA 1ZUHA 2FEPA 2E4YA 4DWIA 1BIFA 3PVXA 5AI6A 1C30A 1UPBA 1N78A 5T14A 4KRXA 1Z28A 1PFWA 4B79A 4EB0A 1WSDA 2Q0SA 4RA9B 4RNCA 5U4QA 2VPXA 3CU5A 2ZJAA 2NZUG 4CM8A 3CVWA 4F5DA 1KR2A 2XEDA 1TFUA 3UA3A 2I5HA 3IBSA 5CAEB 1CUXA 1HT3A 1W73A 3F74A 4LYHA 5ALIA 3IAS1 4CEHA 3AKCA 5K5EA 1Y4SA 4AJKA 4UB1A 4N0DA 2FZWA 2PWYA 1VL1A 3RBVA 1DJMA 2PFNA 1K5GA 3GG2A 5JSYA 3WADA 4C04A 1WETA 3HVIA 3PXEA 2QRPA 2GJAA 3QIAA 1GZVA 3LP5A 2V45A 9ICBA 2KKPA 2A4KA 1KOJA 2C94A 2MR5A 3A1DA 4D81A 4CT4B 5EXEA 3E0FA 3PQ7A 1E0AA 1IBSA 2OBBA 3RU2A 2FLPA 4OF4A 5LUAA 4PR3A 3QTTA 4E12A 2AR7A 3M6MD 2IYRA 2Z7JA 2BONA 2RJ3A 4Y6LA 5DHQA 2FLWA 3H19A 4NJMB 2HPAA 4ZD6A 5M2QA 1KTVA 1W4BA 2CXRA 5GOTA 1LI5A 4L57A 2H92A 3QMPA 1CG6A 3BHNA 1IV8A 1P3Y1 3C1OA 3DWGA 3I9FA 3LVRE 2CLDX 1CIVA 5E8JA 4ZU3A 5T64A 3KVNA 3VYUB 1OVGA 2ZWOA 4WOCA 1EEXB 4WY5A 1L5UA 1OYYA 1W9MA 1DC6A 1K2WA 3UGJA 1AGRA 2YUIA 3DKVA 3QQPA 3AQFA 3QZ8A 4UM5A 2IPOA 3K0KA 4JBYA 5CAEA 3IDFA 3T7DA 1OJLA 4AJHA 2GJKA 3ED5A 1G55A 2P7IA 2VT6A 3LVQE 5ALKA 3KYDA 4E5YA 3OD1A 4FEGA 4B3BA 2K8CB 1X1AA 2NU6B 4J0QA 1YMQA 3HZRA 3N2GB 1WPGA 1Z4PX 3OUTA 4AWAA 3U16A 3R40A 3HMQA 4NU6A 3CE6A 1VKZA 2PXHA 1NY6A 3E9YA 2NSHA 3WLOA 2ZRAA 3U3KA 5KVAA 1Y7TA 3CLRC 2WSBA 3KR2A 3CSSA 1LBTA 2IXBA 3KZCA 5E1MA 5E9AA 5B4TA 2HOFA 3R4CA 3VPGA 4XGKA 4B87A 3WSWA 5A3RA 3G6KA 4OJPA 4F4XA 3FLBA 2NZ8A 2WABA 5AM1A 3GXOA 3P0EA 1WXQA 4FE4A 4ZC8A 3TW8B 5JYDA 1QTRA 4AX8A 1D5WA 5EHIA 1RQPA 2DB3A 2DPMA 1WDTA 3BCRA 5ECWA 5EG5A 4AYBF 3AHIA 2DWPA 1VC2A 1V37A 2P41A 1FSFA 1OHHA 2AZ4A 2IYLD 2R2GA 2V65A 2XRFA 3T1QA 1BYIA 4MVJG 3A4TA 4E7OA 3U7GA 1VOTA 2G1PA 2WZCA 1B6SA 2CNKA 2GZHA 1UDBA 2I6QA 1C7QA 2YWFA 4YDRA 1WF3A 2GBGA 3VU9A 2ORWA 1CVLA 4Z2YA 5CR9A 5GZ1A 2IYQA 3QEKA 4BO4A 4KAJA 4DLRA 5IDQA 3QI7A 2QBYA 3U1BA 1P62B 1K6EA 3NPMA 3QU5A 1ECFA 1SQ0A 2B2XA 5DLQC 4FMDF 4HUQB 3CW2A 5KMGB 3M0EA 2Y93A 4Z4GA 4LECA 4V24A 3KHGA 4ILEA 4F86A 2HMWA 4BP3A 4TMKA 4TLCA 1WCNA 1TM1E 2EHDA 1OWOA 2Y67A 2ODQA 2Z4TA 5EXDA 4JI5B 2NUTA 3AVVA 3BXEA 3HB4X 1QVWA 3HP7A 3I6MA 4NVRA 4PYLA 3SZ3A 4EWLA 5DMXA 9LDBA 2P79A 1Z06A 1Z0DA 121PA 1F2UB 1VTKA 2G80A 4NBNA 4D02A 3HGTA 5L45A 2PEYA 4KQJA 4KX5A 1NMZA 1TVCA 3COJA 4INOA 3EODA 4AQDA 1Y33E 3U3ZA 3TTXA 4OI0A 2G9QA 2KFNA 4ECZA 2JAUA 2V0GA 3VR5A 1PIWA 3MC1A 4MWBA 4LY9A 3DHEA 4Q6BA 4OJ5A 2P5YA 1V7ZA 4YH1A 1ESEA 4BVLA 1QIHA 4A6EA 1GCUA 3TRDA 1BW9B 1VLVA 2R6CA 2LE0A 4ZAFA 4K9QA 4BEWA 2ZI3A 2E4WA 3DKKA 5DBFA 1H3EA 5AM5A 4MJ3A 1RZUA 1AX9A 1B8UA 2E8PA 1PNOA 2J6IA 3BH0A 4HK4A 1ZQFA 4M46A 5JCPA 4Q44A 2BZ1A 3DBRB 1PUJA 4C8NA 1E2QA 1JQ5A 2QV7A 2QDKA 2ZJ7A 3Q40A