2HHSA

O6-methyl:c pair in the polymerase-10 basepair position
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhsA01
4OKJA 4F4XA 3PR5B 1KVBA 4CJEA 4PWDA 9ICUA 8ICJA 3HPOA 2YKMA 3MEGA 5J2GA 4CEAA 3OS1A 2G8WA 8ICEA 3NH2A 4E7HA 4K8XA 3NAEA 1CXQA 4MF2A 2BANA 4KLGA 5CB1A 3V6KA 4PGQA 1ZQZA 3VQDA 4QWCA 1BI4A 1WCNA 4DFMA 8ICUA 4I27A 3H08A 4DEZA 2ALZA 2DFFA 4IG3A 3NGZA 3TFSA 3ZT4A 4CF1A 3K4GA 4M9LA 1Q8IA 3NF7A 2ASJA 1DGSA 1D8LA 5KGWA 4FS2A 1DTTA 2FLNA 1UT5A 2PXIA 3DM2A 3PW5A 4QZFA 1EX4A 2A1RA 1S9GA 2BQUA 4O55A 3JYTA 4DFKA 4YFKA 2YV0X 9ICPA 1ZQKA 4R66A 4MFFA 4IG0A 9ICMA 3V81A 3NH1A 4M3YA 4B8AB 2F8SA 3ZT3A 1S0VA 1HUZA 5SZTA 3GDXA 1UA1A 4RNNA 1JIHA 3BQTA 4FJGA 3ZSOA 3WNEA 2IA6A 4N76A 5IIIA 3VA0A 2Z1GA 3PX0A 4CK3A 1ZQBA 3I0SA 1ASUA 4F3OA 3K57A 7ICTA 4DS5A 5IINA 2IGIA 4JUZA 5KG5A 3OS2A 3SJJA 3PVXA 4LY7A 4E7JA 2XY6A 4Q44A 3TFRA 1RNHA 4M9JA 3ISDA 3M8SA 1RT1A 4AHCA 2G8UA 2BHNA 1BPYA 2AGQA 3RH4A 4DQSA 4DTSA 3IHQB 3TAFA 4H8KA 3Q8RB 2JEFA 4KLHA 3L2WA 3SNNA 4FJJA 4AHTA 2PFOA 5J0XA 3DI6A 2ZUDA 3DMJA 4FM2A 4I9LA 4IKFA 5SWMA 8ICMA 3AVLA 3K5LA 3ZT2A 3S3NA 3LDAA 1S10A 2YNIA 4MEXA 4FBUA 4DQRA 1HRHA 4TUSA 5KI6A 1S6QA 3QZ8A 4EBDA 4EBEA 2FBVA 2IDOA 3G6XA 4ED6A 1YVUA 2J6SA 4KLOA 1IKYA 4KHSA 5DLFA 1Z00A 5DG7A 8ICVA 3PMLA 1JLGA 3LALA 1VSKA 5DBCA 3ISNC 3OYCA 1WSJA 3RJJA 1TL1A 2YHBA 3ZDEA 3KLFA 1FXXA 4RW9A 3RB0A 3RH5A 1REVA 4RQ6A 3RR7A 3SUOA 2HHUA 3EW9A 1QLNA 2IBKA 8ICPA 5DBAA 5FRMA 2JZBB 3CFRA 4CK1A 1L3UA 3JPNA 3V72A 1XWLA 4Y1CA 3NBPA 4O3NA 5D49A 1B43A 2BQ3A 4BDZA 2J6UA 3UXOA 2LSNA 4E0DA 4YNQA 2A1JB 4RQ0A 3VQ5A 4IR1A 3AVKA 5KFRA 5KFYA 3KK1A 5KFVA 3NGDA 4KLQA 1VSIA 5J2EA 2YNFA 4M9GA 4ECZA 1ZQTA 4CGFA 1RBRA 1NK9A 3NGIA 2BKEA 1C6VA 3QIOA 4KLTA 4O44A 3TABA 3OYIA 2ASDA 3M8RA 4GMJB 4CGIA 1ZQOA 3CM6A 4K4IA 3M8PA 3KK2A 4DU3A 3LDSA 3AUOA 4CJTA 4IFVA 3C2KA 4RPXA 3QLHA 5CP2A 3RJHA 1ASVA 3B0YA 5CJ7A 2AGOA 1U04A 2PFQA 1Y97A 3ZD9A 4UBCA 2AQ4A 3B6OA 4RW4A 4Q8EA 2C2RA 1S1UA 2JEGA 3RJGA 1CXUA 1SL1A 1MQ2A 5J2HA 3ISCA 4O3RA 1K1QA 1NOYA 4OJRA 3VQCA 4OLAA 1WCLA 3GV7B 4QAGA 3AO5A 2I9GA 4FJKA 2DTUA 3L2VA 3CG7A 4CGGA 4KLSA 2Y1IA 3JPSA 1IG9A 2O4GA 2VANA 2FPLA 5BOLA 1UA0A 3KIOA 3JPRA 1ZQAA 2RKIA 4DF8A 3ZDAA 9ICBA 3MR5A 3BGRA 1U48A 2MUTB 4DU1A 4RNOA 4HCBA 4DSFA 1NKEA 1ZBUA 1J54A 4FJXA 5IILA 1RTDA 4CEFA 4I2GA 1KLNA 2KTQA 4O5EA 4W5QA 4LZGA 4J9KA 4CF9A 3V4IA 4YD1A 4NLKA 2FMPA 8ICXA 4PHPA 5DLGA 1SKWA 1BL3A 3K5NA 1A5VA 3PMNA 3V7KA 4W5OA 2HHXA 4N41A 2ATQA 3RMCA 1ITGA 2VG5A 3Q8SB 5K14A 4TQRA 4YCXA 5CWRA 3K5MA 3RB6A 4O9MA 4KLMA 3SUNA 1ZBIA 3M9MB 3B6PA 2C22A 4CEZA 5HMLA 2C2EA 4FJLA 2P66A 4OKEA 5CZ1A 3WNFA 2IOCA 1ZBFA 4FO6A 1C0UA 3ZSWA 4DMNA 1IXRA 3T5KA 5I3UA 4GW6A 3UQ2A 4C8OA 9ICHA 3T5HA 4CJ5A 1X1PA 4QZAA 4F5RA 1ZQNA 7ICKA 4KI4A 3AA5X 4PGYA 2BE2A 5CYQA 1GOCA 3AV9A 9ICGA 3ZDBA 1L3SA 4CGDA 1B9FA 2EHGA 4HYKA 3KLGA 2QKKA 5KFMA 3VQ4A 2GWSA 4ED1A 5KFFA 5KGXA 1RXWA 3ZT0A 3LZJA 1L5UA 9ICVA 2Q0ZX 5DGAA 3RTVA 4UAWA 2P6RA 9ICXA 1NJYA 4UB3A 1C1CA 4C8KA 4JWNA 3ZDDA 2FBYA 3DRPA 2FPMA 4M3UA 1TL3A 5KG6A 4MFAA 4LSLA 4CIFA 4DTRA 4Z4FA 4R8UA 4DTMA 1PZNA 4ECQA 2NRVA 1Z26A 3QIPA 2BCVA 2Q3SA 2XY7A 5IIJA 3QNOA 1NJZA 4RQ5A 2XO7A 1NOZA 4QZ9A 4FZZA 3GIKA 4J9NA 1JX4A 4JS5A 4RG8A 4F93B 1Q9XA 4FLVA 2W9CB 4YMOA 5HMMA 1S9FA 1QE1A 4CHNA 4DTUA 2ZE2A 4F4KA 3VQ6A 2HHWA 3C1YA 3ULDA 7ICPA 4KV8A 2BGWA 4ECWA 8ICIA 5DQHA 4UB4A 2R8IA 3JPPA 3LAMA 3L2UA 1NJXA 4W5RA 4F50A 3SPZA 2B4JA 1RYSA 2KFZA 4YR2A 1U4BA 9ICIA 5HHHA 4KLDA 3OYAA 3TQ1A 2FLPA 5KFTA 3KK3A 1B22A 4YMMA 3RJKA 3H40A 3RAQA 3L8BA 1F21A 3NCIA 4E7KA 9ICRA 3AO1A 1JLBA 1O1WA 3CM5A 5DB7A 4Q45A 2HB5A 5HRPA 1N56A 3AVAA 4KI6A 5KT3A 2HVIA 4ECTA 3NF9A 5L9XA 4YR0A 1QTMA 3F73A 5CYMA 4IDKA 3E2EA 3C6UA 1K1SA 2HHQA 4CJVA 1HQUA 5DG9A 1ZQHA 5KT7A 4ID5A 3SPYA 4AHUA 3O3HA 3C95A 3I0RA 2OA8A 2QKBA 4I2FA 2NRWA 2W42A 1S97A 1EXNA 2YNHA 4B9VA 3HW8A 4N56A 4KLUA 5JS1A 4B9NA 1HNVA 3GIMA 1X9MA 3PW2A 4IQWA 3MFIA 4CFBA 4I2QA 4C8LA 1WNSA 5F9NA 5IIKA 2E6MA 2E6LA 1TAUA 2BCSA 1R0AA 4ED3A 4DU4A 1NK6A 1SUQA 3H4DA 5CZ2A 2MAXA 3G6VA 4M6WB 1JXEA 1MU2A 3K75D 4NYNA 3OJUA 1RXVA 4BWJA 4B9UA 3EPGA 5HRSA 3HPHA 4R5PA 2GUIA 4KREA 3QINA 3ORYA 3Q8PB 1JKHA 2GBZA 4MF8A 3SI8A 4RT3A 5KT5A 4F5NA 5J0SA 2KFNA 4YVZA 1VK0A 4HVJA 5HRNA 4YR3A 1S1VA 4RQ1A 1NJWA 4XUSA 3PW4A 9ICAA 3HVTA 4Q5VA 5KFCA 3G0ZA 4WE1A 4AHRA 9ICEA 1BGXT 3B0XA 3QERA 3AVBA 5HP1A 1KFTA 2ISPA 2NUBA 5C42A 3H4BA 1J9AA 1H38A 1A5XA 3GV8B 3D0PA 2KZZA 3NF6A 3V6DA 3V6HA 4MEYA 2IMWP 7ICMA 3G6YA 4KLIA 3TARA 4RZRA 3KLEA 4BE2A 3ZSQA 3KLHA 2VA3A 2F96A 5DMRA 8ICOA 3C5GA 3HPGA 2DY4A 4RT2A 1BIUA 3VQ9A 3MDCA 3DRRA 2G8IA 7ICRA 4DOAA 5KG4A 1ASWA 4ICLA 4JV2A 3OVNA 4UAYA 1DTQA 2XY5A 4PHAA 3SV3A 3LANA 1CEZA 4KMUA 4FJ8A 1RDAA 4FLZA 9ICTA 4DLEA 4KITB 4EP4A 4I2BA 3PY8A 4DTJA 3SI6A 1ZQEA 4QZ8A 4O3OA 3LPTA 3LK9A 2G8HA 4KTZA 3DLHA 5HROA 3KTQA 3TR8A 1WAJA 4OPKA 3OYLA 4QOZB 4O5KA 3ETLA 2C2DA 3HWTA 1BIZA 4ED8A 4XQ8A 2ZD1A 3WNGA 4R63A 4KKOA 1IO2A 2ZQBA 3RB3A 2HMIA 1TKDA 4ED0A 3K2PA 1LWFA 4BGDA 3ZSYA 4Q0BA 1IM4A 5FRNA 4O3SA 4Z0UA 1HUOA 1ZQYA 4DSKA 1RT3A 4E7IA 4C8MA 4BACA 3HVRA 2ITGA 2BDPA 4DL2A 1WAFA 3O3FA 5D3GA 5CA7A 4NM2A 5KFGA 3RRHA 4DFJA 3IRXA 3T19A 3L2RA 3HK2A 1NK0A 3ZDCA 2D0CA 3AU6A 3M8QA 4J9PA 2DPIA 8ICHA 1RDBA 1ZQSA 2HNYA 4JWMA 2KQ2A 4FLWA 1RT7A 3C5FA 1HJRA 3GILA 4O0IA 4CJLA 9ICKA 1VSDA 4DL6A 5J0OA 5TZVA 4M9NA 2JZBA 2AQ0A 3L3VA 4FM0A 3JPOA 3GIIA 1XI1A 2IAJA 1ZQCA 3SYZA 4Z4GA 4J9LA 3ISBA 5EWGA 2HHSA 4IQTA 5IIMA 3AA4A 1VSJA 1WLJA 2Y1JA 4JRQA 2BQRA 2JLEA 3OYGA 3NHGA 4PHEA 7ICQA 1S6PA 1VSEA 4OGCA 4KLJA 4L8RB 2PFPA 1I39A 4KTQA 1XU4A 1RYRA 2ZUCA 4KHNA 5E41A 5J0RA 3OYBA 1TK5A 2YKNA 2B5JA 8ICTA 4OPJA 3V9WA 4Q43A 4IQUA 3V9ZA 3TANA 4RQ7A 4CHZA 4QW9A 5I42A 3S3MA 4F5OA 3OYJA 3PO4A 2KW4A 3UIQA 4YXJA 2BPCA 4ECXA 4LZDA 3P1GA 4QZHA 1NKCA 4BE0A 1AROP 1RTHA 5F9LA 3U3GA 2ZTCA 4JRPA 5C24A 4ED2A 4DOBA 3OGUA 3KKRA 3UPQA 5J2MA 3PO5A 4QZGA 5HP4A 4HUFA 1WSHA 4DO9A 2YNGA 4DTOA 7ICSA 3VQQA 4J9MA 4UB2A 5J2QA 4CEQA 3O3GA 3C1ZA 1LV5A 3RH6A 5L1IA 4EBCA 1S0MA 3K58A 1FKOA 3OHBA 4ED7A 4EZ9A 4BWMA 2RDIA 4J2AA 2D0BA 3RJIA 4CJ3A 4J9QA 3N97B 3AO4A 4X5VA 3LZIA 3MABA 4FVMA 4TQSA 4CEOA 4ID1A 4B9MA 2KZMA 3LP0A 2IC3A 3GIJA 1WSEA 4J2DA 5J2NA 3MXIA 1KFSA 5KG7A 7ICLA 1TV9A 1RILA 1N6QA 5DK5A 4NLGA 5KFEA 5J2AA 4I2PA 3NDKA 4YQWA 1ZQGA 3VQPA 2F1HA 5KFDA 4F2RA 4E19A 3HM9A 4J9RA 4CFDA 2P5OA 4RU9A 8ICSA 5KRSA 3OYHA 1JXBA 1HQEA 2Z1HA 4B3OA 4I2EA 4FM1A 4KLFA 4FLTA 3H7IA 1ZJNA 2DFLA 1FK9A 2VWKA 1VSHA 4FYDA 1QSYA 5KT6A 2ZTEA 1C0TA 1UAXA 4QCLA 3HX0A 4J2EA 1S1TA 4M42A 4KLLA 4NLZA 1RT5A 4CE9A 1RPLA 2BCRA 1XSNA 2ZUBA 2OPSA 5DGBA 3Q8MA 2ETJA 4EP5A 1J53A 2JEJA 2AJQA 3QEWA 4YP3A 2OWOA 4NM1A 5DBBA 3RB4A 4KHWA 3DLGA 4CFCA 2R7YA 5L1JA 3AO2A 4I2HA 3KHHA 5KFOA 4Z4HA 5KFIA 4OVLA 3V9XA 1UOCA 3VQ7A 3SUQA 1W9HA 3EZ5A 3NGYA 4E1MA 4M3WA 2LYHA 1S76D 5CHGA 2DFHA 3RMBA 2KN7A 4IQVA 4YD2A 8ICGA 4IFYA 1C7YA 3BJYA 4KHYA 5J2DA 1LW0A 3PUFA 1ZETA 2EX3A 1IKXA 3MR6A 3U3YA 1KRPA 5T7BA 3IS9A 3KJVA 2XHBA 3GQCA 1D8YA 1VSFA 5J0PA 4PA1A 1COOA 3KHLA 3ZSRA 4I2DA 1T8EA 4CF0A 3VQEA 1S0NA 3ZSZA 3TI0A 4P4PA 4LVSA 4I2IA 1ZQIA 4HUEA 2HNDA 2XCAA 2F1IA 3AVJA 3PX4A 4C8NA 5KFSA 1RT4A 3OYEA 1G15A 3TAGA 1TVRA 2W9CA 2UVRA 3RR8A 4IRKA 1WSIA 2QXFA 1Z3EB 8ICAA 1YT3A 1TVAA 4I2CA 3AA2A 4Z4IA 4B08A 7ICGA 2JGUA 3OYKA 4B9LA 1JLCA 4Z4CA 2D5RA 4JK1A 3V7JA 4BXOA 1T05A 4FK4A 3FYHA 2J6TA 3IM1A 3CQ8A 4FCYA 2PYJA 4GXKA 3UQ0A 1CUKA 5J2JA 3T3FA 1QQCA 1W0HA 9ICCA 2A1SA 3PV8A 4LH4A 1BISA 2ZJ5A 3GFKB 4CHYA 1UWBA 1RBSA 1SV5A 4HHTA 1KTQA 1N5YA 4HUGA 3T5LA 3OYDA 8ICRA 3MEEA 4CGHA 4IRDA 4CEBA 4CGJA 2PYLA 4NLNA 3RWUA 2P1JA 4MQ3A 5IIOA 4GLXA 4W5NA 4CECA 9ICQA 3V6JA 3NTUA 3HO1A 4M3TA 5J0WA 5J29A 1TKZA 2XC9A 5KFZA 5KFNA 3KHRA 1A76A 5KG0A 4QZBA 1T3NA 5J0QA 2AGPA 3RBEA 3K5OA 1XHZA 1JL1A 4QWEA 4NY8A 4DSJA 4GXJA 4CJRA 1S1WA 4I7FA 4QZDA 1T7PA 2W9MA 2F1JA 4I2JA 3VN5A 3JSMA 5KFQA 5KG1A 4CIGA 3OHAA 4R8UB 1D5AA 1A77A 3EWAA 5J2FA 8ICZA 3QEVA 2FBTA 4O3PA 3MR2A 3UXPA 3DRSA 1QSLA 4CEDA 1Q9YA 5J2IA 5C5JA 4G3IA 4TUPA 7ICUA 8ICWA 1NK4A 3DLBA 9ICJA 5HHIA 3EY1A 2DPJA 2XCPA 2FBXA 4CJFA 3F9KA 3G10A 4B9SA 2X78A 1S9EA 3A2FA 2BCQA 1C1BA 4M0AA 3HYFA 4DLGA 2OZMA 3OS0A 3H8JA 5J2PA 2M9NA 1RDDA 4CJSA 2PI5A 1HJPA 4F92B 3CFOA 1Y88A 3QEIA 3PW7A 3MGHA 4DSIA 4PY5A 1VRUA 5EOZA 4CESA 3RMDA 2HW3A 4QZIA 1RTJA 2OPRA 4FZYA 3KLIA 4CK2A 3NH0A 4K8ZA 2OPQA 3PR4A 1XHXA 4FJMA 8ICKA 4UAZA 4RNMA 3P5JA 4I28A 4DQQA 2P51A 3AVIA 5KT2A 1LAVA 4NCBA 1RZTA 5HNKA 4PPXA 2W9BB 1RT2A 2YHAA 1RCHA 3Q8QB 3TAQA 3SQ1A 2R8KA 2UVWA 2X6NA 3QO9A 2PZSA 4OKKA 3C2LA 8ICYA 4ELVA 4LH5A 4RW6A 2OPPA 3QEPA 4CCHA 4Z6DA 3DLRA 4HCCA 3ZSXA 3V1OA 1TV6A 3QNNA 2VA2A 4KN7A 2AU0A 5HRRA 3BQ1A 3QEXA 4Z4EA 4IBNA 2P6UA 4YG2A 5KRTA 7ICIA 3ALYA 3PNCA 4JV1A 2UVVA 3D45A 4F4ZA 2FMQA 2HHVA 2IHMA 4MFCA 4N5SA 3SUPA 3OYNA 7ICOA 3AVGA 4EYHB 2BGGA 4DOCA 4ECVA 4DTXA 4TSXA 4B8CA 1DOQA 3HT3A 1JLEA 4M3ZA 1VSMA 1JMSA 5DDMA 2UVUA 4CJ4A 4XA5A 2I1QA 1I3AA 2E4LA 1Z25A 8ICBA 4J9OA 2XY8A 2WONA 3AVHA 4ELUA 4I2AA 1MQ3A 4FXDA 3LP3A 1ZYQA 4DQIA 4KFBA 1BPBA 4AILC 2XGPA 4FS1A 4B9TA 4EZ6A 1B9DA 2VG7A 4ECSA 4FLUA 4RUCA 4QWAA 5J0UA 1BI4B 1TAQA 1NOMA 4TURA 4AH9A 4CJQA 1GOAA 1ZQVA 1U47A 2GV9A 1U49A 7ICVA 3AVNA 3O4QA 1YTUA 3H8SA 1ZQPA 1TKXA 4KRFA 3BDPA 5DB8A 4M3RA 4DQPA 3LPUA 4M45A 4LSNA 1SKRA 1KVCA 1EXQA 3SQ0A 2B6AA 2ZJAA 3S3OA 4ZTFA 4FJ5A 3OSNA 8ICFA 4FK0A 4FJIA 2X6SA 3C23A 3PW0A 1BCOA 4E7LA 5JS2A 5EWFA 2OZSA 4ZH4A 4KN4A 1ZQMA 1JLQA 2W8LA 3N4MB 4DG1A 5DQGA 2VA8A 1YTAA 3AU2A 4RPYA 4XIUA 3MFHA 5KFLA 2XGQA 3DLEA 4FW1A 2NRTA 3M9OB 5KT4A 1NK7A 5J2CA 2W9AA 1ZJMA 4G1QA 7ICHA 3C2MA 4KHQA 2A1JA 1BQNA 4J9SA 5KFPA 1QS4A 1ZQWA 1A5WA 4BDYA 3TAPA 5FROA 3T1AA 1RT6A 2QK9A 3HL8A 4FJ9A 3HP9A 4NCAA 3LP2A 4CF8A 5HLFA 1DLOA 2RF2A 1NK5A 4CHQA 5KFBA 1XO1A 2C28A 1RBUA 4F8RA 4XRHA 3AA3A 1LWEA 2ASLA 4YMNA 2PI4A 1FKPA 2FC0A 3V7LA 4JV0A 5DQIA 4CJKA 1S1XA 3PX6A 3H8WA 1GOBA 1QSSA 4ZTJA 3C6TA 1VSLA 3THVA 1SL0A 4FJ7A 4M47A 4M3XA 2KZ3A 5CY4A 7ICJA 4UBBA 8ICCA 3HJFA 2BCUA 4BE1A 4HTUA 3DOLA 4P4MA 1Z00B 4PGXA 4E1NA 4Q8FA 3EPIA 4F4WA 3MGIA 4KO0A 1ZBLA 1KSPA 1RBTA 4JS4A 2O4IA 3MDAA 4Z6CA 4CJUA 1K6YA 3VQAA 4PHDA 4JLHA 2MUTA 4FK2A 3DYAA 5EWEA 1D9DA 7ICFA 5J0TA 4M04A 4P4OA 3LAKA 2FPKA 3AVFA 4UQGA 1ZQDA 1D9FA 1HYZA 3AVMA 1JN3A 3TAMA 5EU7A 1ZQUA 2ISOA 4H4OA 1T4GA 5KFJA 4DL4A 3TWHA 2JEIA 1TKTA 3V9UA 3OJSA 4E89A 1MC8A 2FMSA 1EP4A 3RMAA 1J5OA 4CERA 1KVAA 4GC7A 3GV5B 4DFPA 4DL5A 3ITHA 4R64A 4IR9A 1NKBA 1WSFA 3S9HA 4RQ3A 3NF8A 2VWJA 1RBVA 3RJEA 5FDLA 1BCMA 2ATLA 3MXJA 2HHTA 4FJNA 4KB1A 2NRZA 3JPTA 4ECUA 4FLXA 1ZQRA 5D46A 1RTIA 5J0YA 5KFKA 3IAYA 4IRCA 1CZ9A 4N47A 4FBTA 4F2SA 2D0AA 1ZQQA 5KTQA 4K4GA 3T5JA 3LP1A 4LD0A 4ELTA 4RW7A 4CJWA 3AO3A 9ICFA 5HBMA 1V9PA 4EYIB 4CHOA 5KG2A 2G8KA 3ZCMA 4TUQA 3UXNA 3BQ0A 1BQMA 2NRXA 4CEEA 4FJHA 3SZ2A 5J1EA 4CF2A 3CFPA 2H5XA 2R8HA 4CHPA 3ZSVA 2P5GA 2BPFA 4NXZA 1BPXA 4UB5A 2IS3A 3FFIA 3HXMA 4BDPA 4PQUA 2ZJ8A 1BHLA 2PY5A 1S5JA 8ICQA 4F5QA 1HMVA 1HPZA 8ICLA 1JL2A 4DTPA 1X2IA 1L3TA 4DWIA 3AVCA 4AHVA 3VQ8A 4ECRA 2G8FA 3ASMA 3SV4A 4M41A 3HP6A 2Z1IA 2HVHA 3NFAA 1HNIA 3RJFA 1KDHA 4RQ8A 3V1RA 4NYFA 4DL3A 5KG3A 3WNHA 1X9SA 1HYVA 4KHUA 3RAXA 3O4NA 3MXMA 2XRIA 4F3TA 1ZQLA 2X74A 4K4HA 2RPIA 4YXMA 1JXLA 3ZD8A 1SZPA 1IH7A 3OYMA 5BOMA 3KD5E 5KFUA 2PFNA 1EKEA 3BQ2A 4ECYA 4O4GA 2WTFA 1S0OA 1B92A 4H4MA 3P83D 4DTNA 1CLQA 1T03A 5DB9A 4FW2A 1TFRA 3QEAZ 1N48A 5J2KA 5DG8A 1BPZA 3VA3A 5KFHA 3LWMA 4KLEA 5D4BA 1JLAA 4P2HA 1CZBA 4DS4A 4DF4A 1JLFA 4AHSA 1XC9A 1NK8A 3I8DA 1MSWD 1X9WA 4QWDA 2Z1JA 4PUOA 3QETA 1HYSA 3IG1A 4MFBA 1BPDA 2B21A 2R8GA 4QZCA 2IHNA 3QESA 4CJPA 2ZTDA 2WOMA 3RRGA 4I9QA 1IKWA 3OSPA 4FZXC 4DL7A 4NCGA 3ZT1A 3NE6A 4YFUA 1TK0A 1ZQFA 3SQ2A 1LAWA 9ICOA 4E3SA 1XS9D 4QW8A 1WN7A 3DLKA 4FLYA 4F5PA 4BXOB 3KHGA 9ICLA 1WSGA 3EYZA 5KFAA 4O5CA 1KLMA 4GXIA 1LB2B 4RQ4A 4RQ2A 1ZBHA 4W5TA 3TAEA 4M6WA 5KFXA 3M9NB 3MBYA 2I5JA 4QZEA 3Q8LA 4Z6EA 4KAZA 3DOKA 3HSTB 4J2BA 5DKWA 1TGOA 4F91B 1TK8A 1BVSA 1ZQXA 3FDSA 1ZQJA 4RPZA 9ICSA 4UB1A 1SL2A 3V1QA 2V4QA 3QE9Y 3CYMA 4O0JA 9ICWA 4CIEA 5J2BA 4GC6A 2OYQA 4KPYA 4R65A 2V9WA 3L3UA 1QHTA 4KTWA 4Z6FA 2W9BA 1VRTA 7ICEA 2RN2A 2G8VA 1LWCA 3Q8KA 4EEYA 4GVMA 4DSEA 3OY9A 4OGEA 2BR0A 5CR0A 4CFAA 3K59A 1U45A 2V4RA 2FLLA 4I29A 1RDCA 5L1KA 2F8TA 3LWLA 7ICNA 4OLBA 3KD1E 3SCXA 1SKSA 1UT8A 5KFWA 3L2QA 4Y1DA 9ICNA 4ZHRA 4O3QA 1BPEA 2HNZA 3SQ4A 1EETA 5DDYA 3V9SA 2BPGA 1C0MA 4RW8A 1L3VA 2W8KA 4M9HA 1KCFA 2VG6A 1XSLA 4M2YA 3RBDA 1IKVA 4F4YA 5C25A 3E01A 3U6FA 4PH5A 5DB6A 2DFEA 4QWBA 1C1AA 5JUMA 1S77D 3C21A 3JPQA 2R8JA 3MR3A 3MECA 4YN4A 5L1LA 1XSPA 4O5BA 4KB0A 4RUAA 3QZ7A 1KFDA 4DSLA 1KEJA 3KKSA 3VQBA 1U9LA 2RDJA 3OYFA 3QEBZ 3C94A 3MAQA 5BPCA 3MEDA 8ICNA 1LW2A
chains in the Genus database with same CATH superfamily
1MN8A 5ALIA 4C80A 3Q2TC 4CJEA 2CADA 4XO0A 2AJ1A 5CD4H 5HQ8A 9ICUA 2DH9A 3HPOA 2YKMA 5J2GA 3OS1A 1Z2LA 2L5YA 4I1TA 2LDYA 3TA1A 3NH2A 1IUJA 2XYGB 1WACA 5L46A 2KVCA 3FBCA 4KLGA 2ZIWB 4R5PB 4FWRA 4EHUA 1AUSL 4NXMF 1WCNA 3QGIA 4DFMA 4UY8O 2E44A 2BXJA 2ROPA 4X65K 1KBUA 3SJHA 3NGZA 4QIFA 4DR2J 1MWZA 1UPPA 4M9LA 4C0OC 1A6SA 3WHIA 4JHDB 1DK2A 2CJBA 1DTTA 2ZC4A 1UT5A 1ZPVA 1F44A 4H4KA 1VQ9S 5JVHL 4NASA 1VDHA 2LFVA 2RUSA 2IA0A 1FXDA 3B4MA 2BYCA 4LFCJ 3QUBA 5AQRA 3KVGA 2XMVA 1RWVB 1H7XA 3CC4S 1T44A 1RWNB 1S0VA 1HUZA 3GDXA 5CD4A 1E6YA 2VODA 4RNNA 2JWKA 2ASMA 4FJGA 2M0NA 3WNEA 4N76A 5IIIA 3FCWA 5HJXA 3GG4A 4JUZA 5G4DA 4YHHK 3OPXA 3PVXA 1F2GA 3SMSA 3WZ0A 3PTWA 4M9JA 1PCAA 2VBWA 2QL7B 1KWMA 3LYSA 2BHNA 2MKJA 4CM2A 4NMLA 1W25A 1CJVA 3RH4A 4DQSA 4GRSA 1KKHA 4OHXA 2KKPA 2JEFA 2FHMA 4KLHA 1VK8A 4YDUC 2LEAA 5LMUJ 2HMIB 2BZFA 2I1RA 4KPCA 2E1AA 3G71N 3CEDA 1XJWB 1EWRA 1XNRJ 2RLTA 4ZP9A 3JTNA 1RT3B 3NVMA 2LEPA 4JI3F 4ED6A 1YVUA 5AFUH 4CD1A 3BKTA 4KHSA 5DG7A 5A0YB 3RW6A 3AGRA 1VSKA 2JVRA 4J8FA 5ETNA 1H98A 3RBZA 3QGPA 3RJJA 2B6AB 3GR1A 1T6DA 3TPQA 2HNYB 2KJWA 1RT7B 1H74A 1BWVA 4BR7A 2IBKA 1JLQB 8ICPA 1OJ4A 5FRMA 2JZBB 1Q18A 4CK1A 3CFRA 1YJRA 5DDPC 1DAXA 1XWLA 1BE4A 2IAJB 4Y1CA 2W2NP 2ROGA 1YJNN 4O3NA 1DGJA 3DXMA 4ZVTB 2QC3A 3PRVA 1B43A 3IG5A 1FO4A 4AFFA 3FEZA 4YNQA 4UY85 2MDAA 1BQNB 3VQ5A 4DR6K 5KFRA 2HVEA 2ZNYA 4F04B 5JXSA 3BV8A 1VRQC 5ALMA 4X4VA 3RJMB 5J2EA 2B3TB 4UT4A 4ZVFA 3GSIA 3KG4A 4ECZA 1LQ9A 4NLSA 3H5YA 3NGIA 1WG1A 1C6VA 4JKCA 3TABA 1WBBA 3M8RA 4CGIA 2RVJA 1SCJB 4K4YA 5E3QA 3MAAB 2KU7A 3M8PA 3D0IE 3LDSA 4CJTA 4IFVA 2XZWA 4C8YA 4RPXA 3R27A 3LDNA 3RJHA 3N6LA 2MRLA 5CJ7A 1U25A 2UUBJ 1SQKA 4EIAA 2I6WA 4RW4A 4AQYK 5BPLA 4H0VB 1RTHB 5BRFA 4Q8EA 2AYMA 5CABA 2DPNA 3RJGA 4LF4K 2ZBCA 3QYYA 5CHCB 3GCWP 2W41A 3ISCA 3T6JA 1K1QA 2UV8A 3VQCA 5K8OA 4CH7A 3GV7B 1RKIA 3AO5A 2I9GA 4FJKA 1FJ7A 2BRLA 3CG7A 3JPSA 5J2QB 4TY9A 2O4GA 1Q81T 4CZLA 3KIOA 5ALOA 4PWWA 2HOQA 2FVQA 9ICBA 3MR5A 2VQEJ 3EDRB 5E33A 2XG8A 2MUTB 1OMSA 4FYXB 2V2KA 1ZBUA 1XO0A 4RO0A 4HACA 5IILA 1N34J 2NS1B 4I2GA 1WEYA 2DNNA 3BSAA 5HK4A 3LP0B 2NSBA 4X4TA 4M5GA 5GIOA 3HMJG 5ETTA 2WW4A 2FMPA 2UXCJ 3K5NA 1A5VA 4CO2A 1OPZA 5ETKA 3V7KA 4X66F 3J80Y 5DM7Q 5LL6d 1HQEB 5F0XA 1TU0B 2ATQA 3HZEA 4NEZA 4AD6A 1J5OB 2O8FA 3Q8SB 5EE1A 4YCXA 1LWXA 3K5MA 4O9MA 1VQKN 2YKQA 2UZAA 2Q1NA 1ZBIA 4URSA 1ZS6A 3MPWA 4KIAA 2WHOA 4ZK7M 1R6YA 3D3CJ 2UU9F 4FO6A 4DMNA 4RUBA 2GHPA 5AE1A 1R31A 3T5HA 1O08A 4QJFB 3O8MA 1X1PA 1YTYA 4O23A 5CYJA 2E3TA 4DR4F 1R8PA 4PGYA 2BE2A 3CGIA 3VGLA 3O44A 1GOCA 3QXGA 5F8IA 4P0PA 5D4PA 3VEWA 3MTKA 3OL6A 1V5IB 1UTAA 1B9FA 3J7Z5 1S79A 2MLYA 3OLBA 3MCSA 1Q81O 1ZQ1C 4ED1A 3JQKA 1NO8A 4RBVA 2RQKA 3O6QA 3LZJA 2F5GA 2Q0ZX 4BREA 5DGAA 2BABA 4UAWA 2DEJA 5J1EB 3R1HA 1NJYA 4UB3A 1Q78A 3WXMB 1C0FA 1IKXB 2FBYA 4BVPA 2GC8A 3DRPA 3MMAA 3O9UA 4LSLA 3UI3A 2IDLA 4CIFA 4DTRA 4DTMA 3CB4A 2VQFF 1HMVB 2C3OA 3CD6S 4CLUA 1Z26A 4K0KK 5ADXH 2BCVA 3HVWA 2M52A 1NOZA 3C16A 4FZZA 3GIKA 4IQMA 2ERRA 3G71S 3PRDA 1VQNN 4F93B 4UARA 1PBAA 3TP2A 3EE3A 4F0KA 4FLVA 3WQUA 1LXNA 2H3QA 3J7AN 1NH7A 1S9FA 3I1YA 4FF2A 4CHNA 3D28A 3A5NC 2ZE2A 3C1YA 3PIPL 3MCOA 5DQHA 2R8IA 4B02A 4OX9F 3JPPA 3LAMA 2DIUA 4F50A 5LMNF 1RYSA 5D4LA 2FC9A 1KKXA 2HMPA 1UCVA 3TQ1A 4YOXA 5KFTA 4WQ4C 1Q3UA 4G1PA 4E7KA 9ICRA 1PJ7A 2FHKA 4YY3F 1IR1A 3W5ZA 2KL8A 1BMQB 1N56A 4L6V3 4CH0S 3MEEB 1ITPA 3WK5A 3A0HU 2HK2A 4BR9A 4IDKA 2LXIA 3C6UA 1CBKA 1K1SA 2HHQA 1S5ZA 3L7UA 3ZTOA 4P52A 3UCGA 3SPYA 1IVZA 4CZGA 4I2FA 4PXCA 2J7WA 2A6MA 4LF5K 3QGGA 2Y9TA 3R7BB 1HKBA 3PIOQ 5A0LA 2DXFA 3FMWA 1HNVA 1V97A 3GIMA 4CYUB 3GJRB 1HBNA 4RWXA 2VCPA 4OZ2A 4IQWA 4CFBA 1H2UX 4NWBA 3QRRA 5F9NA 4OZLA 2E6LA 2BCSA 2DY9A 3BH6B 3ENWA 3H4DA 4GKKJ 3NEKA 4A61A 1MU2A 4UOHA 2QJ3A 3ZXWA 2DCUB 4NYNA 2CQ1A 4L76A 3HPHA 1X6IA 2HS3A 2ZIWA 4R5PA 1XMQF 3QINA 2DCLA 3ORYA 3Q8PB 2Y0SF 2GBZA 4MF8A 5ETMA 2EKYA 2W54A 3TEGA 4RT3A 5KT5A 5J0SA 4BQLA 3L4IA 2QV6A 1NJWA 9ICAA 1RLDA 1ZD5A 3G0ZA 3T1HF 4CBUA 5M1FA 4JHDA 1IJEB 4QIGA 1FFWB 1HI1A 2ZJQL 3GV8B 5J2PB 3D0PA 3LGHA 3V6HA 1P1TA 4LRBA 4BGBA 2CQ0A 4PYDA 3UN5A 4OLPA 3M6KA 3D6MB 3W64A 1RTJB 2OPRB 4BE2A 3ZSQA 5H9FK 2KVQE 2VA3A 2OPQB 2KHOA 3I56N 1XNQJ 5DMRA 4USAA 1BIUA 3VQ9A 4DOAA 4JV2A 3OVNA 2Q0UA 3E9OA 2ZEJA 4ZPTR 4PHAA 2LVWA 4NYOA 1Q1KA 4KMUA 4S0MA 2EEYA 4FLZA 2KSOB 3SENA 4KITB 4EP4A 2JJ4D 4I2BA 3VV2B 3PY8A 3MGVA 1FIQA 5AM4A 3NWRA 3SI6A 4FWMA 1YRUA 3WC0A 1X4FA 9RUBA 1XMOF 5IC4B 1VQKS 3LPTA 1OSDA 3UB5A 1N36K 2DNRA 3OYLA 1TV6B 5AKHA 1RWUA 1T9UA 4HVZA 3GU3A 1BIZA 4W90B 1IO2A 5A8KB 2HMIA 3TYTA 4ED0A 2HRTA 3NGSA 3WKAA 2BANB 3VALA 2L9WA 1I3OB 4R25A 2RU3A 3O9RA 3A5MC 1RT3A 1RP5A 4E7IA 5LL6Z 4BACA 3HVRA 2E29A 2ITGA 2BDPA 1WAFA 3A0IX 1N5XA 3SR6A 2R7OA 5A0YA 5BN8A 5KFGA 4C8ZA 3N4QA 2AZ3A 2GTDA 3L2RA 3H98A 2MQ8A 1NEEA 1NK0A 1NGGA 2O1PA 4LF1A 2WONB 2HNYA 1HFEL 1RT7A 2NO5A 3WK6A 1RHKB 3PNIA 3SCJE 2DGSA 5M2RA 4EFHA 4C7YA 4M9NA 4LF8J 2JZBA 2DNQA 2GIFA 4BLGA 5HR6A 5ALRA 3O9SA 4NLCA 2IAJA 1DXSA 1Q7LB 2MQOA 4Z4GA 2L48A 3V81B 3ATUA 5HMYA 3GFXA 2B9XA 2Y1JA 1S59A 3L5KA 1VQNS 5FD1A 2N7YA 2ITMA 1FA0A 5HOOA 1IBMK 4PHEA 2G2ZA 4BG9A 4F02A 5E3PA 3R7NB 4HL9A 1N5VA 3I0SB 2L08A 4KTQA 1RYRA 4RPFA 3FEYB 2E5SA 5E41A 4B3RK 5DJBA 2MSNA 3PLAA 2JR5A 4CHZA 4QW9A 4F5OA 5AZIB 2YH0A 3IC1A 3NG8A 3GCXP 4BGAA 1RAHB 3NAIA 4DPYA 3UIQA 4G1QB 4X65J 1B4SA 5AKGA 1AROP 1RTHA 1DRZA 1O51A 2AA4A 5IM0B 4FN5A 3CJ3A 3J80O 5HR7A 1DQAA 4OHYA 1APSA 4QZGA 2KH9A 5IT9U 4KH5A 3THWA 3W1YC 5M1KA 1TFWA 4DO9A 3TA0A 1COKA 1RAFB 2CVEA 1UEVA 4J9MA 4KHPK 3GDQA 1KNZA 4I6MB 5C10A 2K06A 5J2QA 1LV5A 2O8CB 2P9KA 3RH6A 1VQLS 2NRHA 3W3SA 2QG9B 4MT1A 3K58A 2XVTA 4EZ9A 4BWMA 2ZH4A 1REVB 1S1XB 2UXBF 5H1SQ 3LZIA 2AEFA 4MDBA 3HCXA 4FOIA 4FVMA 2YMLA 4CEOA 2A1BA 2XLJA 2HOEA 4CZMA 3LP0A 3C6TB 3D1HA 2GVZB 1AFJA 4J2DA 3BY5A 5I4MA 4JD2B 4TLRA 4NXMK 3PYDA 4WJBA 1NLVA 3VQPA 5KFDA 4DV3J 2A3JA 2HQCA 4UATA 4E19A 4DOZA 3AJ1A 4LRAA 2ZOFA 3CP8A 1JXBA 3W0LA 1HQEA 1PKUA 4RNHA 4LC9B 4KLFA 4FLTA 1ZJNA 1U0SA 4M63A 2R7RA 3R2DJ 4UAUA 2ES6A 1CPZA 2GIRA 5E3CA 2VJ5A 4FVCA 5AQZA 4PKDB 4C3KA 3Q0AA 4BR0A 1ZAVA 4HKQA 1NDPA 2ZUAA 2JRSA 3F5AA 2BCRA 3ZZZA 3EKUA 3T1YK 2OPSA 3JAMY 4NA1A 1FRXA 2K8BB 3I56S 4GIBA 2ETJA 4JKHA 1UJ6A 3A0BU 4X4OA 4YB1P 1ATSA 4GKJK 4GVEA 2OWOA 4JI5F 1C4AA 1EP4B 5C2DA 3HRDD 2GQ2A 1S6UA 4USJC 1FJGF 3RSEA 5F8NA 4OYWA 2B9WA 4M3WA 2KN7A 2HLUA 1FFUA 1UCNA 2F2AB 2RKIB 4CRXA 2OAUA 3HFKA 1IKXA 3MR6A 1U1PA 1KRPA 1HBMB 4ZPWR 1D8YA 4LFAK 4CRJA 3WXJA 3KHLA 3MDQA 1VAZA 4I2DA 1RTDB 1K47A 4CF0A 4OYAA 1GTEA 2FZGB 3VQEA 1HNZF 4KH1B 1T3OA 4LVSA 2CDQA 3A8EA 2NUHA 2XLKA 5AK6A 2F1IA 1GFWB 1MWKA 3NL0A 1S7IA 5HJYA 1DY3A 3TAGA 5EGYA 3N4WA 2QXFA 5LM7E 2M70A 4GMKA 2AH5A 4M8LA 1ZTWA 1OXJA 4Z4IA 7ICGA 1B70B 2JGUA 2ATCB 3QRPA 4JK1A 4UB6U 3V7JA 3FYHA 2CG8A 2MLXA 3H5SA 4AQYJ 1FESA 3D66A 2VJUA 1Q82T 1RDRA 5B7WA 2C2KB 4FCYA 3CQYA 3T3FA 1W0HA 9ICCA 2I7PA 4RQNA 2ZBPA 4ZVSB 3UCZP 4CHYA 1RBSA 4HHTA 4FPIA 2KXFA 1NGBA 4QS7A 3O9TA 4KC5A 3MEEA 3D2EB 2EFPA 3BGFA 1NZBA 4NLNA 3RWUA 4WXWA 2P1JA 3PEHA 4MQ3A 2BA9A 3THPA 4CLKA 4GLXA 3VGMA 4TLQA 2WSEC 9ICQA 3NTUA 4CECA 3KLGB 3Q86A 1TKZA 3KDNA 1CJKB 4QZBA 6AT1B 3FQLA 5J0QA 3K5OA 1XHZA 4DUZK 2F9DA 4QWEA 4LF7K 3DDNA 3M6UA 1GLFO 4CYUA 4CJRA 2R7XA 4KH4A 1T7PA 1S57A 4KYZA 4C97A 4Y34A 2F1JA 2ZKTA 4PG6A 3VN5A 3CJKB 3H0LB 3O5BA 3VGUA 5KFQA 4CIGA 3OHAA 1K9MT 3BF1A 5A2QU 4N77A 3AA9A 2KG0A 4R8UB 2F4VF 2E20A 5J2FA 8ICZA 4CO0A 2FBTA 3NVKA 1X5PA 3MR2A 5KQ8A 3IG1B 5K9FA 4G3IA 4TUPA 4DUYK 1HBUB 3VTIA 4NA3A 1YVNA 4Y2RA 3BO2A 4P2XA 2RE2A 2DPJA 2XCPA 1QE1B 2MKKA 1Q16B 3G10A 2DNGA 1CC7A 5F3TA 3WC2A 5AI6A 1C1BA 1KQSM 1J5EF 3HYFA 3VEOA 2OYYA 1V6HA 1YI2N 2F4FA 5BREA 3H8JA 5J2PA 2KKZA 1HKGA 2PI5A 3NS7B 4LR8A 3PW7A 4PY5A 4AM7A 1KXPA 4JK7A 2CQ2A 4QZIA 5B0EA 1RTJA 2OPRA 2W55A 3G25A 2M0GB 4MN4C 2P9SB 4CK2A 3NLCA 2OPQA 1XHXA 2FGCA 3CDUA 4EU0A 1ATNA 1T9XA 1U1QA 3OTOF 4I28A 1YKWA 1SV0C 4DR1F 5KT2A 2QYCA 2WF5A 3DOMB 4PPXA 4G1IA 2V2ZA 2OSQA 3Q8QB 4CT9A 4K4VA 1RBLA 4ZJQA 2KSOA 5D78A 5G5GA 2KE7A 2B4VA 5AQTA 5JJBA 2NYHA 3BN4A 4K0KJ 1K9MO 4XEIA 2JC0A 4OYMA 4HCCA 5TKWA 3ICXA 1TV6A 3QNNA 1RHQB 4KN7A 1UEKA 2UU9K 3AY9A 2QLJB 4U9RA 3ONNA 4L3QA 2H54B 7ICIA 2H1YA 1IV0A 1PSDA 2IYIA 1X5TA 4DR4K 5IQ6A 3D45A 4F4ZA 4N5SA 3SUPA 2DHAA 7ICOA 2DGZA 1S22A 3AVGA 4ECVA 3H5XA 1BUPA 3VAKA 2XTJP 4NL9C 3SDEB 4UB8U 4ZITA 3ZETA 1VSMA 2WFAA 2RMLA 4NLYA 1LW2B 2VGMA 1Z25A 4JK9A 3MM6B 4A57A 3DDKA 4JI8J 2WONA 4PABA 1XMBA 4ELUA 3MEGB 4OV6A 3KG1A 2E5GA 1BPBA 4H03B 2XGPA 5M2UA 2HOIA 1G7CB 4QWAA 2AMCB 1BI4B 3UD4P 4LF5J 5HMXA 1UZHA 2P6TA 4A2BA 4Q2LA 2MQMA 4AH9A 4ZLJA 1U49A 1ZQPA 1H72C 2NSCA 1N32F 3BDPA 5DB8A 4M3RA 3ZZYA 1FVQA 5E5NA 3OXGA 2QI2A 1M5PC 3CJCA 2V7YA 4JKGB 4QPTA 3JSRA 2JRZA 3QX7A 4OZ5A 4U8YA 2MMYA 1S9GB 1HD1A 4OX9K 4FJIA 4KAIA 1BCOA 5GADU 4NLUA 5JS2A 5LMNK 4PZNA 1XIQA 2RS8A 1ZQMA 1VLBA 2C2MB 4XIUA 2ZGYA 4Y2VA 4OJ6A 4MKBA 4FW1A 2ZIVB 2NRTA 3M9OB 4YY3K 1SWVA 1RUSA 5J2CA 2C1EB 2ZD1B 1R89A 1N60A 4G1QA 5D4NA 7ICHA 2VASA 4KHQA 2DO4A 2A1JA 1FRJA 3DGPB 2BACA 2CNNB 2CPHA 1QS4A 3KMSA 3GYXB 4UOFA 5IM0A 3TAPA 1UAWA 3K7RA 1U1MA 2L9NA 3HJEA 3GJQB 2HFOA 3BP8A 2QK9A 1E4FT 4USWA 3HP9A 2YKOA 4Y2KA 3I6PA 4CHQA 4I6MA 4UASA 1RBUA 2CDRB 1F9FA 3ETRA 2V0NA 3MXHP 5H9FJ 2BJEA 2ASLA 2R42A 4IJNA 2FC0A 3PHEA 3FRZA 3QT8A 5L9NA 4JV0A 1SQFA 1YWXA 3TVZA 4CJKA 3MCNA 1VQ5N 1A7GE 1S1XA 3DI6B 3AAQA 4U8VA 1GOBA 1QSSA 3QSIA 5ALEA 2YNIB 4A2AA 1XR5A 1QAIA 3C6TA 2AP1A 4EENA 3MWPA 1SL0A 3CCWA 4FJ7A 1S6QB 4JD2A 4M47A 1XMQK 2ZJPL 1V5VA 3P38A 1HA1A 1PJ5A 4BE1A 1RAEB 2W43A 1V9OA 2ABYA 3KNGA 1RE1B 4Q8FA 1JLGB 3EPIA 4F4WA 1Z6RA 1ZBLA 1N36J 1KSPA 4JS4A 3BBFA 2MQNA 4QIWD 2ZZNA 1TL1B 2A40A 3T1HK 3IMXA 4Z6CA 4CJUA 3KLFB 1K6YA 1QJHA 4RW9B 4PHDA 4BR5A 1ZM4A 2YKNB 2E1FA 5DM6Q 1NRKA 2RE1A 1OH6A 2OHFA 4P4OA 4CNZA 3N5BA 4OI0A 4UQGA 3LOUA 1RB0A 2CPDA 3CQXA 1D9FA 3ENBA 1HYZA 4FF1A 3NBPB 5A8RB 1RKJA 2Q4TA 3VGVA 3H3NO 4Z2XA 2W4CA 3KOOA 3FNNA 4DN9A 5C24B 4HI2A 3ZZRA 2JEIA 5ADZA 2BEFA 1WOQA 3HKWA 1MC8A 5J2MB 1EP4A 1YSJA 2E1ZA 1KQKA 4CERA 4O44B 4GC7A 3GV5B 2JGAA 3E9PA 3W60A 5AHXA 2E9ZA 3NUQA 4RQ3A 2MJUA 1M90T 1M5KC 3AD9C 4R0EA 2XMUA 1WC0A 1OQ3A 1XMOK 3IGNA 3POTA 3VOVA 2HHTA 4P75A 5DRKA 5KFKA 3IAYA 3LPEA 1IBMJ 3BBCA 1B0PA 4FBTA 1S1UB 5KTQA 4LD0A 4ELTA 2G13A 4X62J 4I0WA 1N6QB 2WVEA 3I9ZA 3SFUA 4B3RJ 2FVRA 4DV7F 3NS6A 2LQBA 3UXNA 3VF2A 4V19S 1OW5A 4OZJA 2NRXA 2K4EA 5AK4A 2KXNB 1W26A 2XO6A 2P9UB 4FJHA 3CFPA 2H5XA 3ZSVA 2C3YA 2BJ9A 3CCSS 2P5GA 4DR5F 5EX5A 1VISA 4M5MA 3FFIA 5CZVA 1FFSB 4TU7A 1U6FA 4NO7A 2ZJ8A 1OY6A 2QL9B 2BX6A 2FVSA 1S5JA 2LBOA 8ICLA 1X2IA 3IP4B 5JU5A 3J81Y 4B17A 4AHVA 3VQ8A 2G8FA 3N9UC 3D6TB 3CC7N 2PKEA 5F8MA 3HP6A 2YBVA 1NHKL 1HNIA 2PEHA 1Z19A 2F8MA 3OA9A 2ZWPA 2IVPA 3D2EA 3M32B 3TZZA 4KHPJ 3WNHA 1K44A 3BO3A 4A59A 3VGTA 3KHYA 1F5SA 2DBYA 3O2IA 1SXEA 2XB2D 1HYVA 3D2FB 1KAXA 4D3HA 2XRIA 3DLGB 4F3TA 1ZQLA 1SJ4P 3ZZ0A 1M90O 1MMLA 1JXLA 1T9TA 1U09A 1SZPA 5BOMA 4RKUC 1CJKA 2P9IA 3L3FX 4LIWA 3UQSA 2WB4A 4ECYA 5CRXA 1R27B 2Q2RA 5E2QA 2FDRA 4K2XA 2R2SA 5DB9A 4W4MA 4FW2A 4IFYB 1SJQA 1GMVA 3W61A 5AXNA 5J2KA 5DG8A 2E7XA 1LW0B 4FKXA 2EBEA 4NXMJ 2KI2A 4P2HA 1CZBA 4J9UE 4IDHA 3Q24A 4WJ3B 3HJVA 4BRHA 1Y0HA 4ERDA 1TYQB 2D0PA 4AP9A 1HYSA 3IG1A 1A0PA 1BPDA 4Z7YA 1ZZNA 4BRKA 1KQSR 2IOFK 2M4MA 4QZCA 3UMBA 2GW8A 2IHNA 3G6ES 3FFKB 1RT4B 3ET6B 1SJFA 2ZTDA 2WOMA 3OL8A 2FPHX 3CF5L 3ZT1A 3CCQS 1HKAA 5JRTA 4YFUA 1TK0A 3TTFA 2BOPA 3I33A 4PL7A 1WN7A 2IFXA 5GAHI 3KHGA 9ICLA 2O3DA 2VFVA 1WSGA 2IVYA 3EYZA 1HD0A 3X3UA 4RQ4A 1FHTA 3J8AA 3GFHA 5F1XA 3TAEA 2IJFA 2UXBK 5KFXA 1VQ5S 4WFAQ 4IS7A 4Z6EA 2CAJA 1CULB 4U7CA 2V94A 4EMDA 1FCAA 1WJ9A 2DJWA 1TK8A 1BVSA 1ZQXA 2VFTA 4OX7A 2P9SA 1ZQJA 4UB1A 1X3MA 1S5LU 2MQQA 3O1BA 3NMAA 4KR0B 2UUAF 1F3VA 3G8QA 1RTZA 5E79U 4BR2A 1KD1T 2V9WA 3KK7A 3L3UA 1TMMA 1VRTA 5EVZA 4GVMA 4ZVOB 1EIYB 4F36A 1VQMN 1X4BA 1QVGM 4OGEA 3K59A 2Z2MA 1U45A 3BM7A 1X66A 7ICNA 4OLBA 2NCKL 3SCXA 1MROB 2D0OA 3W65A 4A5AA 1BXNA 5MLCQ 1GLEG 2HQFA 5JMNA 3W3DA 1LK5A 5FPMA 1BDGA 5AR0A 2A2DA 3DHXA 1YDLA 1L7NA 3HTVA 5DDYA 3BPDA 2IIRA 3QICA 2ZKUA 4JI3J 1XSLA 2H9ZA 3NOCA 2ZWHA 2DQNB 4BCAA 4F4YA 1X5OA 3B54A 3M4XA 5KPRA 3I0RB 2R8JA 4JI5K 2K1RB 4YN4A 1XSPA 1AZSB 5GIPA 1M1KT 4RTFD 2HS0A 1FJGK 4I6WA 1BU6O 5RUBA 2CGKA 2RDJA 2CA9A 1KVIA 5BPCA 4WFNL 4KQZA 1LW2A 4ILHA 4A8XA 4WP9A 3MM6A 1KVBA 3PR5B 2AIRB 2VPZB 2OCEA 4NZ7A 3AJDA 1R0AB 1VR6A 3AQOA 3I76A 1SUQB 3MEGA 4MO4A 1X4DA 2QFJA 2XHCA 4CZKA 3K9KA 4E7HA 2DR9A 2R7UA 3NAEA 1ZM2A 3BEGB 1D1UA 3LGNA 5CB1A 3V6KA 4PGQA 3VQDA 3J7YI 4QWCA 1YRTA 3WIUA 2NREA 3K89A 3QJJA 1KD1O 1BI4A 5ALGA 4DPOA 8ICUA 4CF3A 3H08A 2ALZA 4HT7A 1N33K 1W2BR 4LF6F 1H3DA 2O01C 3D6JA 3OR2B 3S01A 3QFPA 3QJLA 3WQPA 2ASJA 1DGSA 1UVJA 3TUJC 3KKAA 4JKGA 2YY3A 2FLNA 2RQ5A 5C42B 3I9V9 4C0HA 2DITA 3DWLA 5ALSA 2A1RA 1S9GA 1W7WA 2XMAA 2ZH7A 1FD8A 4IH7A 3CPWM 3OLAA 4R66A 3CIPA 4MFFA 2ZIVA 1MW7A 4M3YA 4B8AB 1URJA 3QT6A 3SAHA 1UL3A 5M1QA 2CPXA 5SZTA 4QU7A 3CC7S 3G2XA 1H1VA 1U02A 2MHEA 5T41A 2CQCA 3ZSOA 3M8WA 2EFQA 1IG6A 2CKWA 3VA0A 2CG4A 4K25A 3TW0A 2KO1A 3MGJA 4IWVA 2FJ6A 4N7TA 2AX1A 4CK3A 2OD6A 3KFUF 4H5RA 2XI9A 3GJTB 3RBXA 4F3OA 4WZMA 2I7NA 2IGIA 4KE5A 1ZRMA 3OS2A 3UNGC 2XY6A 3EVWA 4AUKA 1RNHA 3O5TB 1O0PA 4AHCA 2RHQB 2ZH1A 3CCLN 1BPYA 2Q31A 3TAFA 4H8KA 2BJ3A 2VGNA 4FJJA 2PFOA 3DI6A 1EARA 2HDOA 4WQ5A 4KKOB 3E0FA 3I4PA 4I9LA 4IKFA 4UW9A 1QAJA 4KFBB 2JHDA 3S3NA 3LDAA 2F4VK 4GV6A 1S10A 2YNIA 4P2MA 1KOHA 1UFLA 5B0AA 5IT0A 1HRHA 4DQRA 4X66J 2CUYA 5F3XB 1E6VB 5JVGL 5KI6A 1S6QA 3QZ8A 1RCXB 2KM8B 3C15B 4F9OA 2FBVA 4IUFA 2IDOA 3G6XA 4ETXA 2FE9A 1URRA 2GJFA 2V8HA 5D3GB 1RJJA 2W7AA 3ILOA 1JLGA 3LALA 1PILA 2EWHA 3ISNC 3OYCA 1TL1A 3KZIU 2YHBA 2PD1A 2QSFA 2QWPA 3KLFA 1FXXA 1O6XA 1F60B 4RW9A 3F2BA 1J5EK 4A46A 4RQ6A 2HHUA 3GG0A 1QLNA 1SXDA 5DBAA 3HSGA 4Z94A 1DJ0A 3NCPA 1L3UA 4B1XB 4DR4J 3WKDA 4Y2CA 1I6JA 3DLEB 4US8A 2OKQA 4M1KA 3CCJN 3NBPA 5D49A 5A8RA 5AM1A 2BQ3A 2KJ8A 3UCUP 4FWPA 5LJWA 2DTJA 3TSQA 4E0DA 4RQ0A 3NP5A 4IR1A 5LY3A 1WTBA 2MYFA 1SS6A 3F2KA 3OTOK 3LH2S 4KLQA 4DR1K 2WK4A 1ZQTA 1PAUB 2BKEA 4O44A 3QIOA 4YOTA 1D3WA 4GMJB 2MY7A 1ZQOA 2B5JB 1VQMS 5HLFB 1DLOB 3KK2A 2XICA 2Z2ZA 3RFAA 1M5SA 2DR5A 2VQFJ 2NXUA 1Y7PA 3CMAN 2JFDA 2V63A 2DL0A 4CBWA 4HLBA 4WTOB 3TU5A 4J90A 3ZD9A 4UBCA 5EUHA 1XK8A 2OTLN 2C2RA 1S1UA 3I82A 3HHLD 3CC2N 2JEGA 4P9SA 1SL1A 3O80A 5HMWA 2IVNA 2QW9A 4O3RA 2JV3A 2XS2A 1NOYA 3UDCA 4OJRA 4WFBQ 4QAGA 5LMNJ 4DR7K 2JMGA 3THYB 5ALWA 3FQKA 1VQOS 3S1TA 4DKWA 3PYGA 4CGGA 4KLSA 1WC1A 3THXB 3W66A 1IG9A 4JI1F 3ZZUA 4B3MF 5FLXU 5BOLA 1O8BA 3L4PA 3DLLL 3JPRA 4PYAA 3GOIA 1ZQAA 4YY3J 3QU9A 5TISU 4RNOA 3DYAB 2E9RX 4C0ZA 1NKEA 1ZPWX 2MQLA 5K20B 1J54A 2RD5C 1PGZA 5IZHA 2DR7A 4CEFA 2E1EA 4PL2A 1MWMA 4W5QA 3OTQA 1NGAA 3C29A 1RGVA 4EI2A 2E9TA 4CF9A 4YD1A 1WUDA 2EK1A 2CQHA 4ZA1A 4H4OB 1SKWA 2NZTA 3M32A 1BL3A 2QFIA 2LDIA 3CCEN 2O8BB 2CGLA 3OL7A 2UUCF 2CJXB 4C11B 1N32K 2HHXA 1IM6A 1KN6A 1L3KA 1IXKA 3KXDA 3FGVA 2QSWA 1FK9B 2GNKA 3ZC4A 1RWWB 3RB6A 4KLMA 4JYAF 2WSCC 2C22A 3P96A 3HHLA 5TKYA 2JXJA 1OSCA 1ZOLA 5HMLA 2VBYA 3R5AA 3EE8A 4HHJA 3ZSWA 1XMQJ 4X64F 2OTJN 4CT8A 4QZAA 4F5RA 2VD3A 4ANCA 3SSSA 4OYXA 4QR2A 9ICGA 4NE9C 3T1HJ 4HYKA 4WU2A 2KKVA 2QKKA 5KFMA 3VQ4A 5KQDA 2CFXA 1YIJN 1X3NA 1RXWA 1CRXA 9ICVA 1NNLA 1ESVA 3CCRN 1AB8A 1BQMB 5HSPA 1JJ4A 1FXLA 4C9DA 4WYLA 3CCLS 1RWXB 3CJ0A 1QVFM 5AQFA 2FPMA 4M3UA 4MFAA 2FZCB 4X4RA 2VJ4A 1ZTTA 4YB7A 2UYTA 3MM5B 1NJZA 1CULA 3SMZA 2XO7A 2MQPA 3CW2C 1IIPA 1R8CA 1QVGR 4M7XA 1TVRB 4FNHA 4IKAA 3IGVA 5HMMA 3GE1A 2J0SD 1NDKA 5LSOA 1Q95G 3VAFA 1GTHA 1CC8A 4DTUA 4U6PA 4YB6A 2BGWA 1JLCB 4YHHF 3Q22A 2WF6A 5EY4A 3JQMA 2B4JA 2KFZA 4QYRA 3FBFA 1HEKA 1GMWD 5IT9Y 2Z57B 1U2VB 2AJ4A 3K17A 3RJKA 3CD0A 1FTRA 3NVVA 3RAQA 1MROA 4UZCA 2CH6A 1AUDA 1CG2A 5HRPA 4KI6A 1TR0A 5KT3A 1UETA 2DGQA 2Z0GA 3OFHA 4ITSA 3CCJS 3P49B 4AL6A 3E2EA 2F9TA 1RBOB 5IV4A 1E3MA 6FD1A 1ZQHA 3O3HA 3C95A 3I0RA 2OA8A 2O5DA 2QKBA 1KHWA 2NRWA 2K1RA 5G0RB 2M3DA 4Y2XA 1AZSA 2YNHA 3HW8A 1IKWB 4HEA9 4ETZA 4N56A 4KLUA 5JS1A 4ZVEA 4NZ6A 2A5XA 4I7FB 3IBPA 3FMBA 4I2QA 3HX9A 1KP6A 1FNOA 2W04A 1WNSA 4OYPA 3CMAS 1L7OA 1TUWA 1R0AA 2KRBA 3VENA 4DU4A 1SUQA 2A6OA 3K8VA 3B4DA 3MX2A 3G6VA 2K4PA 4M6WB 3QBCA 4BWJA 4JK8A 1U1KA 3EPGA 5HRSA 2Z2LA 1N88A 1SQEA 2Y8WA 2CGJA 2VFRA 5GMKa 3CC2S 4Y3CA 5HAOA 1ZC6A 1NM1A 2VKQA 3NXZA 2YN4A 4B1WB 2NPIA 2KFNA 4DR6F 4YVZA 4NA2A 2HBKA 4RQ1A 3CO0P 3IBFB 2ZIXA 3SK3A 3OR2A 3LGMA 3PW4A 4Q5VA 2HIYA 5KFCA 4MHVA 3IR7B 4AHRA 2AZ1A 3B0XA 3NMUA 1LWCB 4RLEA 5HP1A 4HDHA 2NUBA 5C42A 4FVUA 1Q86T 2I9SA 1GXUA 4MMOA 4DR5K 1NNDA 2QYGA 3CJTA 1J9AA 5FP0A 4BRFA 2KZZA 3IBWA 2HHHF 2OMOA 7ICMA 2FD2A 4OX6A 3US5A 4CLFA 4RZRA 4ED5A 2ODGA 3R3LA 2ZH8A 2DY4A 4LBHA 4RW8B 3DRRA 2LQ5A 2OM6A 5F8JA 2G8IA 7ICRA 2DRAA 3HHNB 5KG4A 4IOCQ 4ICLA 4LF4F 4C98A 4UAYA 3J7YP 1F0XA 1HKCA 3OFGA 2W2OP 1CEZA 4MKAA 4KGZB 2OEMA 1YJ9S 9ICTA 4CNYA 3A5OC 4DLEA 1SVDA 5KNIA 3BF4A 2MXYA 1NB2A 1XN9A 2NXCA 4OIXA 4QR0A 4DTJA 3QO9B 2UXBJ 3TNVA 4ZN1A 2G2YA 4QZ8A 2W4DA 4O3OA 3MOZA 3ED5A 4MIBA 4RW6B 4ZPAA 4CIOA 2G8HA 2CZ4A 1WAJA 4BC7A 2PDAA 3ETLA 4MH8A 3HWTA 4MO5A 2B43A 1RHUB 2YKMB 3FR0A 3WNGA 1ZAXA 4KGXB 4CZJA 4KKOA 5FPDA 2BJ1A 3U1LA 3H0RB 1HW9A 3F2CA 2PFFB 3ZSYA 1E6VA 4NYZA 1IM4A 2E7VA 4Z0UA 3LM9A 3EGZA 3C15A 1ZQYA 2HFZA 3UKUA 4OLOA 1L6NA 2VIHA 3ULEB 3W8PA 2K3KA 5D3GA 3O3FA 5CA7A 1JLEB 1O5JA 1Q86O 2FZKB 4M5JA 1NZAA 3G86A 3RRHA 3IRXA 3HK2A 5AQIA 4KSEB 3CCRS 3P6YC 4BROA 1NGIA 1LFWA 3AU6A 2O67A 4J9PA 2DPIA 4DPWA 8ICHA 2D3DA 5A6WA 1RDBA 1ZQSA 1SXLA 3GILA 4Y65A 4YN3B 4O0IA 1P7DA 4DL6A 1VSDA 2VDHA 4PXDA 2VG7B 1XI1A 5F0WA 1N8RT 2L3MA 4JI5J 2C3PA 5EWGA 2A19A 4GV3A 2GA7A 1TL4A 5IIMA 5DZ7A 1YHQN 3AQFA 4JRQA 1FJGJ 4HHHA 3FE1A 4A8EA 3KJNB 3M8YA 4E98A 1UFKA 3NHGA 7ICQA 5A2QY 2UUAK 4OGCA 4L8RB 4LSNB 1Z1BA 3MPVA 1Q7YT 1SH0A 3GWCA 4K43A 4JBCA 4UQTA 3GSDA 1TK5A 4HTJA 4IEIA 2B5JA 8ICTA 4KHMA 4OPJA 4B3TF 5ETRA 3QUQA 4USVA 2DIVA 2IJNA 5GAEU 1HNZJ 3D6RA 8ATCB 2KIWA 3HVAA 5DM7L 1RHRB 4X4PA 1G1XA 2WF8A 2YX1A 3U3GA 5CA5A 3CIZA 3CCUN 4DV2F 4KMOB 4ED2A 4DOBA 3OGUA 4B3SK 1QDUB 1HLUA 1K73T 3PO5A 1WSHA 3QU5A 1FKAF 5AQXA 2YNGA 1RGIA 3G4SN 3PSIA 3CCVS 4KJIA 3NASA 3MC1A 2CJYB 2ZGZA 2YWKA 3THYA 1LXJA 4PL8A 2RF2B 4M7YA 3JQJA 1D9AA 2WSFC 3C1ZA 3CD5A 4EBCA 2V8DA 5GVQA 1S0MA 3OV7A 2L9DA 2F76X 3ELHA 3D1OA 1VCTA 2OUGA 4J2AA 2D0BA 4DU7A 2G0AA 1WC6A 1N8RO 3SBTA 1J97A 1SBRA 5LOQA 3AO4A 5BRDA 2QT7A 3AOBA 2ZXHA 3IWLA 4OHZA 1JRPA 4DB3A 1WSEA 3J7AP 5J2NA 1KFSA 1TV9A 4MAKA 2LQJA 3UDEA 4V19X 3Q83A 1VBYA 5DK5A 2Q6BA 4I2PA 3NDKA 3SFGA 1DEJA 2F1HA 3I5CA 1Q7YO 3TX8A 3HM9A 3HSCA 4Y2MA 4C11A 4LF6K 4KO0B 4FSVA 3S6EA 3LQVA 1QHAA 2Z1HA 2Q1LA 4M94A 3H20A 1RWKB 4FM1A 3U4LA 3B82A 1FK9A 5F41A 2XM3A 2VWKA 1VSHA 5KT6A 2W6KA 3TADA 2ZTEA 1FEZA 4DUTA 4QCLA 4QBUA 1UAXA 1WI8A 4ES2A 2F4VJ 4IFVB 3G9CA 1S99A 3J7YU 3AHPA 4KLLA 4DR3K 4NLZA 1N5WA 4CE9A 3ISND 4MLEA 1HI8A 4PG8A 1R0CB 4HTIA 3RUBL 2ZUBA 2VPWB 3AB4B 3SLCA 5L38A 1K73O 3KG0A 2ZWOA 5DGBA 3AQPA 2AEJA 3QEWA 3VZIA 1UJ5A 4A8FA 4NM1A 3U9DA 2R7YA 5L1JA 4I2HA 2WBMA 2J5AA 4J5OA 3ITHB 1J5EJ 1TL7B 1HARA 1BC6A 1ECWA 2V51B 3VPZA 5IT9O 3OTCA 1W9HA 2OXOA 1S76D 4WYBA 1VDVA 4IQVA 2X1FA 4DV4K 3BJYA 4MYTA 4KHYA 2CWKA 2IM1A 1EQYA 3PUFA 2EX3A 4LFBK 2VH7A 4TNOA 1I1GA 3KJVA 2OIHA 2Z58B 4DPUA 1JCGA 5BJRA 4HACB 3G96A 1T8EA 3PIOL 3NVWA 3OTOJ 5IC6B 4K41A 2PMZD 2DRBA 3MM5A 4DR1J 4ZKAA 3LP1B 3CC4N 3LPYA 4P4PA 4I2IA 4HUEA 4CO4A 4OI1A 3R9PA 1Q5VA 4J91A 2QGFB 2D74B 2AEMA 1G15A 1TVRA 4M5LA 1EHWA 8ICAA 1TVAA 1VQ6N 2PIIA 4B08A 3OHRA 2WZ1A 3CO9A 3CJ5A 1VQ8S 1JLCA 3CVKA 2W3SA 4FK4A 2O8FB 2J6TA 2RHSB 4WFYA 2HBLA 3ENQA 3L9ZA 4NLTA 1U2VA 5AICA 2IM3A 1SZHA 3EZOA 5T14A 1X9JA 3B8HA 2ZJ5A 3GFKB 3KYLA 1SV5A 5LT5A 5KOXA 2FY8A 1NB7A 2ILYA 3ZX2A 3RZAA 3T5LA 2IY5B 4RX6A 3GIRA 4IRDA 3HI9A 5C2CA 4CDIA 1ZXOA 3VF4A 4B1UB 4W5NA 3H6EA 2VYPA 2GQCA 2M5YA 5J0WA 3W63A 2LYVA 2NYIA 1PK3A 2QMUB 5G0RA 5SUHA 2KHVA 5KG0A 2DGVA 2CXEA 1GXTA 1NH8A 1SH2A 4A8YA 1YXQA 1JL1A 1J27A 2GMJA 4H4MB 4DSJA 4GXJA 1T03B 4WTYA 1N62A 3HKZC 3PDNA 4I7FA 2F3NA 2JSXA 4GNIA 2EVZA 2YX6A 4J9VA 3VCBA 3DRPB 3NVYA 4ICAA 5K8MA 3TA2A 5F2RA 1NDCA 1N32J 4O3PA 4AYBC 4EEKA 3C16B 1BQXA 5KPZA 3SQGB 1Y5LB 3WX8A 1UP1A 1QSLA 5IWAK 4CEDA 5J2IA 1DKGD 2KHQA 1IQTA 5C5JA 2C2OB 2QLBB 2WBNA 7ICUA 1BA0A 5C0YA 3MM7B 4U7UK 3VEZA 3R5GA 2IRYA 4K4ZA 3EY1A 2FBXA 3G4SS 2ILZA 3F9KA 4BRGA 5BPMA 1CSJA 1S9EA 4UOCA 2BCQA 3NWGA 4FOEA 4B3MK 4M0AA 2HZCA 3DXSX 4DLGA 1PVRA 4NLBA 1KLMB 3UD3P 1CZAN 3A3NB 2D1KA 4YUDA 4CJSA 4HAIA 3N5FA 2VOPA 1HJPA 3CFOA 2XSJB 4ZN3A 5EOZA 3DOKB 2HW3A 1WC5A 5AQYA 2KHDA 2KRRA 4F3QA 3VAMA 5AIAA 4B9QA 3NH0A 4K8ZA 3OBIA 3H8MA 4MLHA 3KJQB 2HSEB 2PN6A 1ZAWA 3P31A 4IDKB 3C6UB 2P51A 2G1DA 2DKXA 2Y9UA 3AVIA 4WYWA 4NCBA 2UUCK 1K0VA 3C6HA 3M2VB 2W2PP 2W6LA 3HOTA 5J8YA 3SQ1A 1FF2A 3LO3A 4OPAA 3QO9A 3DAWA 2PSZA 1K8AO 1HIYA 3BR9A 1BY9A 1WUUA 4JYAK 4RW6A 2WAQC 1VHXA 3IDWA 4Z6DA 2M9KA 3V1OA 2ZM6K 3M6VA 3TUZC 1JJ2M 2HNZB 5HRRA 1T0TV 4Z4EA 4X64K 4CLPA 4C48A 3LDPA 1MU2B 5J1PA 2ZH3A 4Y2UA 1FNXH 4KX5A 3ZEUB 5A2QO 2VPYB 3PNCA 2V8GA 3EM1A 3I5BA 2Q43A 2IHMA 4MFCA 1OPIA 3N4PA 2AYEA 3TADC 3OTDA 2HBQB 3ULEA 2NPFA 2P9EA 4TSXA 5GTIU 1JLEA 3CNHA 1NU0A 1JMSA 2ASYA 4CJ4A 3WQTA 4E2FB 1I3AA 1ATRA 4MTPA 1VYAA 2G5HB 4J9OA 4WK1A 2KJ5A 2WVDA 4B6JA 3DFEA 4I68A 3BKFA 4DDFA 4I2AA 1MQ3A 3SCKE 3ZZOA 1Z4NA 3U02A 3PEJA 1ZYQA 3JTPA 3SCLE 1L7PA 4LF9F 5GAGU 2VG7A 3ZTQA 2IVFB 5HMZA 5CHIA 4FLUA 2VB6A 4UZBA 5K4LA 3T1YF 1NG9A 4BQZA 4KH6A 1WWHA 2E5LF 4Y2YA 1GOAA 1U47A 2GLEA 4O3MA 2KJVA 4GKJF 2GV9A 3H8SA 1ACMB 1TKXA 4KRFA 4DQPA 4M45A 4LSNA 2RS2A 1SKRA 1U24A 1KVCA 3SQ0A 4OYZA 4JI6K 3MR7A 1VQ6S 2KG5A 3DJCA 3CDWA 2YPZA 2ZJAA 3DM2B 4ZTFA 3J7ZT 3IG8A 2HOFA 3OSNA 8ICFA 2LYAA 4FK0A 4E7LA 3PW0A 3JYTB 3HD2A 1QQOA 4C1NK 2FSJA 5EWFA 3IUCA 1YTAA 3MFHA 2EFOA 2ZG6A 2VF3A 3EJMA 2EI5A 2MZJA 2RDDA 4LFAF 2XULA 3QUCA 2EH9A 3Q2SC 3CD6N 4NI2B 4ER8A 4H5NA 3K8WA 1LNQA 3C2MA 2W2QP 2KG1A 4DV7J 4N8OA 4NEYA 9ATCB 2MSTA 2BBEA 4LBIA 1FO1A 4DV6F 1NGFA 5BPNA 4BDYA 3R5DA 4U67Q 5FROA 3C7NA 1RQLA 2BE7D 3T1AA 4OQJA 1S3XA 1KONA 2HCFA 4DR5J 3UKRA 5AKJA 3HL8A 3R1LA 3FCHA 1JROA 3LP2A 4BRCA 2PE8A 4GFJA 2FJDB 2RF2A 1RT1B 5KFBA 2GIQA 2B8PA 1MN7A 5AK5A 2V5HG 1UJ4A 4YEAA 2WW8A 1OH5A 1Z2ZA 4XRHA 3AA3A 5BRHA 3V7LA 2RSQA 5DQIA 3DV9A 2W25A 4DHVA 4BHQA 4I56A 3GTYX 2DNOA 2A10A 4JMUA 2RQMA 4KBIA 1Y3KA 4NRUA 5AQHA 2KZ3A 4RCHA 4AL7A 3HJFA 3DLJA 2DF4B 2K8CB 1IKYB 4HTUA 3R6MA 3DOLA 5ALVA 4E1NA 3IA0A 3J7ZO 5AK3A 3MGIA 1PIEA 3NOGA 1P27B 4KO0A 2OEHA 4WKYA 3H2LA 2ZXIA 2HQ3A 2RQCA 4DUZF 5E84A 2LA6A 4LF7F 2QWOA 4FKYA 3TVKA 2DGWA 4FK2A 3M5RA 2B7BB 1D9DA 2MHNA 2LPEA 3AB2B 2GHWA 4BRMA 3HSDA 4M04A 5AI4A 4CDGA 3AL0B 3LAKA 2HHHK 1ZQDA 1GO3F 1X40A 2BTFA 4FWQA 3W9JA 3AVMA 2GMHA 3IP0A 3MI7X 4FZMA 3A8KA 5KFJA 3L95X 2U1AA 1G99A 5AQGA 5I3QA 3GBTA 4K4UA 3EXYA 3OJSA 2YNFB 2A3ZA 4K4SA 2HKEA 4DUYF 3THWB 3RMAA 5JICA 2B4UA 3ITHA 3MM8B 1TL7A 4R64A 4JV5F 4QNLA 4IR9A 3GLJA 3IO1A 3NF8A 1GQEA 5AT1B 2VWJA 2P9KB 3QLHB 3MN7A 3MXJA 1WSRA 4KB1A 3JPTA 2IM2A 4CZCA 3BR8A 1RTIA 3PFOA 5J0YA 4CWBA 1JCEA 1AQ6A 1H6KX 2UUAJ 3TSUA 3A3OB 4ILLA 4UAVA 6FDRA 1GLCG 4O8UA 3SAGA 3MF5A 4IOXA 1FFGB 3LP1A 3UE2A 3CULA 5JLHA 2NR0A 2QE5A 4CJWA 5I9EB 2JL9A 4USUA 5F0UA 3HOSA 4EYIB 1MDUB 4CHOA 5KG2A 1F5CA 3ZCMA 4TUQA 4PG7A 3P8BB 4DPXA 4CEEA 2WTUA 3D68A 4LRDA 2C2ZB 4CF2A 4K5SA 5AQUA 2ZJPQ 1P6TA 5BR8F 2IS3A 2RILA 3HXMA 3CXCM 3MURP 1BHLA 2PY5A 4ZVRB 4NL5A 4OJGA 5B0FA 4F5QA 2YMMA 1KQQA 3TOQA 2AHOB 4K59A 3WBZA 5IFMA 4DTPA 3GONA 4EHTA 2QA4G 1CJTB 4EUVA 4WF9Q 3SV4A 3QT7A 2YCHA 2C3UA 3BB5A 2HVHA 3NFAA 1IBLF 2KYXA 4DV1F 2OPSB 4NYFA 4DL3A 1BO5O 4K8RA 1VJQA 4KHUA 5C2FA 2YKPA 5DDQC 2CJQA 4A8MP 4K4HA 4IOAQ 2FI1A 1J2MA 4NZ0A 2RPIA 4H4KC 2VG5B 3NS5A 3OYMA 5KFUA 5K14B 3RSEB 1EKEA 2FLOA 3FJ2A 4H4MA 4MKYA 1VC6A 4DTNA 1T03A 2F8HA 4B3TK 3QEAZ 2NZ4A 3CHWA 1N48A 3C2PA 3MN5A 2P9LA 4CLSA 4CP5A 5KFHA 3HD1A 3H0PA 5L1MA 4ZPCA 3KMQA 1JLAA 4UTGA 4NLVA 1RLCL 4DF4A 4EGLA 4AHSA 1YK9A 5H9EK 5GADI 5CYQB 1Q79A 4JAXA 1EJ7L 2W4PA 2WVBA 3QETA 2XS5A 3GL1A 4ZPDA 4DV2K 3SQGA 2NUUG 2YB4A 2Q36A 1H2VZ 3KUGA 4ZPVR 2H3EB 3VMFB 2K2PA 1YJTA 2CZ9A 3MM7A 4FNIA 2QMXA 4DL7A 4NCGA 3NE6A 3D7SB 4PKHA 4DR2K 4LJXA 4BRQA 4WP3A 1C1CB 9ICOA 3HULA 3OT9A 1XS9D 4QW8A 3KUEA 4Y2IA 4F5PA 2X3DA 4FLYA 3CDEA 2BKOA 4C23A 4AXJA 1MG7A 3P4UB 4O5CA 1KLMA 3I55S 4RQ2A 3ISZA 1ZBHA 4PZVA 2CPIA 2XSJA 4LFCK 2I5JA 4QZEA 4KB7A 3Q8LA 4KAZA 3DOKA 4J2BA 3KZXA 2XZTB 2P5VA 1NBEB 2GUPA 3VF0B 1FJEB 3IM9A 9ICSA 1JJHA 1TL5A 2CRLA 4O0JA 1V3ZA 9ICWA 3QFUA 3U7JA 3EGNA 1J6ZA 4GC6A 2JWLA 4CBXA 1JUDA 1U6BA 1LVHA 2ZF5O 1N5SA 3SEOA 4I6AA 3T79A 5DDRC 3Q89A 2E2QA 4KV8B 4EWTA 2RN2A 3M2VA 1TKZB 5GMDA 3TR5A 3CMES 2C2NA 3WIVA 1JJ2R 3VAIA 2OFHX 4RWTA 2FLLA 2QMWA 1VQ7S 1VQLN 1N4LA 4DMZA 4K7QA 3LWLA 4ILGB 2QL5B 1UT8A 5KFWA 3L2QA 5IV3A 4ENOA 3M6GA 3BO4A 4P2FA 2CPEA 1NWKA 5M2PA 1BPEA 2BJ8A 2HNZA 3FUYA 4NRTA 1L3VA 2VJVA 2GEMA 1U8WA 1KCFA 5B08A 4OJ1A 1VGYA 3HKZF 3ZEUA 1RABB 1YJVA 5DB6A 2DFEA 4QWBA 4ID5B 2YMPA 3C21A 3MECA 5L1LA 4DSLA 2OHDA 4DL0C 4ZCLA 3OYFA 4FPAA 4AYBF 3C94A 3NCRA 3MEDA 1C1BB 4QS8A 4F4XA 1BWFO 2LHTA 1JCFA 2W2MP 4U95A 4OJOA 2E8AA 8ICJA 3FSXA 8ICEA 3UN2A 4JI0F 3ZO7A 5D0RA 4K8XA 1U26A 4MF2A 2H3ZA 1X4GA 2D7SA 2VKZG 1ZQZA 3H8YA 1C2PA 3CJSA 4OI3A 3R6LB 2FSNA 4DEZA 2DFFA 2Y0SD 3IBCB 1D8BA 4CF1A 4WE1B 2YJEA 2CQGA 1D8LA 1W2IA 5KGWA 1BD6A 5KAKA 4AYBD 3JAMU 3QMLA 1ILYA 3DM2A 2ROEA 2BQUA 2PGCA 2P9CA 4O55A 3JYTA 4YFKA 2PA3A 4EX7A 1QCKA 3V6DB 1GLDG 9ICPA 2YV0X 2HHPA 5D6GA 1A6LA 4IG0A 2B0GA 3KLEB 9ICMA 3EGVA 3KLHB 2F8SA 2UUBK 2KJ9A 4NI2A 3MCPA 1UA1A 1JIHA 2E2PA 2IA6A 1PVQA 2HS4A 3IFEA 2WAQF 3N01A 2Z4PA 1Z05A 2Z1GA 4JI1J 1ZQBA 2IYGA 2PO4A 3MMCB 3K57A 1ASUA 3MTJA 7ICTA 2HAIA 1KW4A 4ZS6A 3OPKA 3B6BA 5KG5A 2YX4A 3CWJA 1V4TA 1UVKA 4LY7A 4E7JA 5ETOA 4ISFA 3QBWA 3I96A 1RDWX 1NBWA 3ISDA 1RT1A 2YHWA 3ZETB 2WF7A 1VQYA 2AGQA 4GO5X 5HROB 4DTSA 3IHQB 2K4HA 1T9YA 3Q8RB 2LMIA 4X4SA 3D2WA 3A1YG 4IOBA 3L09A 3SNNA 4C0BA 4X4UA 2O8EB 4AHTA 2W1BA 3BKUA 5HANA 2ZUDA 4FM2A 4EFAC 5SWMA 4BR4A 3AVLA 2G5IB 1K8KB 3ZT2A 4WFNQ 2DRDA 1FT8A 1N34K 1TAMA 1YGYA 2WCXA 3H2VE 4FBUA 2DBBA 4TUSA 4EBDA 5M1PA 4ES1A 2ZIUA 4KLOA 1IKYA 5AZJB 5HL7L 5DLFA 1U2CA 3BS9A 4HH0A 1LEOA 1UW9A 1S4FA 1REGX 4JYAJ 5ALTA 2Y1LB 5DBCA 5AQMA 3AARA 4NMXA 3UR0A 2N3OA 1RQNA 4FE3A 3M8QB 3HBTA 3ZDEA 3T69A 2V4JA 2WFBA 2XI2A 2Z2YB 3RB0A 3RH5A 4KRWA 4X64J 1Y3JA 3RR7A 2Y9HA 3SUOA 3ATVA 2GMLA 3F5TA 3VF6A 3V72A 1X5SA 2E1MC 2DH8A 2E1PA 3RAMA 2CXYA 3BS5A 5B8HA 2VV5A 1FXRA 4BDZA 3UXOA 2LSNA 1EO1A 1V3SA 2RQ4A 1WC4A 2A1JB 3QU4A 1QH9A 2B51A 3AVKA 1S6PB 2KK0A 4NWIA 5KFVA 1IBCB 3EVMA 2ACMA 3PJ9A 2YNFA 3HSJA 4F72A 5D77A 4CGFA 1RBRA 4ISGA 4ZVPB 3N79A 3OYIA 2ASDA 3MM8A 4K4IA 1UPHA 3I31A 3UNYA 1KDNA 2FB0A 3QLHA 3VGSA 5C2GA 3CCMN 3KNAA 3B0YA 1SAZA 2AGOA 1U04A 2PFQA 2CPZA 1Y97A 2BZ2A 3B6OA 3BZQA 3NY0A 2QM1A 3PM9A 4X4QA 2GS8A 5D0HA 4AXIA 5AKIA 4US9A 3CJQA 4YOVA 1CLFA 3J81j 2WHEA 1E4GT 1ZA2B 5J2HA 2FSKA 2YI1A 4YHHJ 5AI5A 4OLAA 4HWIA 1WCLA 4CO3A 1WEXA 4WCEQ 1BNOA 3CXCR 2APOA 2DTUA 2HPUA 2FVPA 3L2VA 1X0PA 2HSTA 1HWKA 5AIBA 2FPLA 1RCOB 4OJHA 1M6YA 4JI4F 3C8YA 2BRKA 4PEOA 1FKOB 4OZ3A 4BRNA 3ZDAA 1PO6A 2R9LA 1U48A 1RWPB 1QAYA 4F26A 4HCBA 1R59O 3DNCA 4DSFA 2FJBB 3NS1A 4G9ZA 4IEEA 4FJXA 5KOWA 3WKBA 2KTQA 4O5EA 4NV0A 3M1YA 1CJTA 2QIFA 4ED4A 4LF9K 3V4IA 1GX5A 4K4TA 4NLKA 2AP6A 3M2RA 2HK3A 5DLGA 4A8KA 2IHR1 5IT4A 1L8LA 2E5LK 3NKYA 3SAFA 3PMNA 4DQ8A 3BUZB 4RUHA 1PAEX 3MMBB 3DEEA 1OVQA 2IVMA 4WFAL 4N41A 4O5FA 5HQLA 4B3OB 3RMCA 1FWKA 4W98A 2D8CA 2PT0A 1ITGA 4DXLA 2VG5A 2MA1A 5K14A 4TQRA 5CWRA 3JXUA 5AQVA 3QB0A 4XH5A 1S12A 3M9MB 3RF9A 2R7VA 2V9KA 1RISA 3PCOB 2C2EA 4GVLA 2P66A 4FJLA 4OKEA 3WNFA 4YOWA 1HIWA 2VC0A 2IOCA 3POTB 3E51A