2HHSA

O6-methyl:c pair in the polymerase-10 basepair position
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhsA01
9ICXA 1U45A 2R8KA 1HQUA 4IQUA 4KMUA 4Z6CA 4F5PA 3V6HA 1T4GA 1Z00B 4G1QA 2Z1GA 4N76A 9ICQA 4DFMA 2EHGA 4XA5A 8ICCA 2IMWP 5CZ1A 5EWFA 2KZ3A 2QXFA 9ICGA 2FMPA 9ICPA 4FM1A 1JLEA 1S1XA 2BQ3A 3NFAA 2ZJ8A 1T8EA 3HPHA 4ED7A 3SUNA 4ED0A 5HNKA 5KFYA 3RJHA 1LB2B 2KFZA 3M8RA 3VN5A 2G8VA 1BQMA 4Q0BA 3RB0A 4RQ0A 4RNNA 1ZQHA 2PXIA 4FJKA 1GOCA 2BANA 1RTJA 1XU4A 5KFAA 1C0TA 1VRTA 3KHGA 2BCUA 4W5NA 1D8LA 1TFRA 3MEEA 2OZSA 3H7IA 1KFSA 1IG9A 4J9MA 4FJ7A 4HUFA 3QERA 1C0MA 3NBPA 4E1NA 4BE0A 4O5CA 4IG0A 3EPGA 3MGHA 2HVHA 2VG6A 4ZTJA 4I9QA 4KLGA 1RDAA 8ICBA 2KQ2A 1ZQIA 4B9UA 4Q43A 2MAXA 4ELVA 4O3SA 4BDYA 4KHYA 3LWLA 4B3OA 2KFNA 3CM5A 1NOZA 3SUPA 1TK8A 3JPPA 3VQDA 4I2BA 4Z6EA 3PO4A 4AILC 1JKHA 1RT3A 4Z6DA 3T5JA 3M8SA 1NKBA 1L3SA 2BCSA 5KFGA 4O4GA 4Y1DA 2I5JA 3LDSA 3L8BA 3OYLA 2HNYA 4RQ8A 1S6QA 3TAMA 3QEIA 1TL3A 2D0CA 1F21A 3IHQB 4LVSA 3ZDCA 4NYNA 3OJSA 1PZNA 3B0XA 3AVFA 5CP2A 3PX4A 3ZSWA 4W5RA 1WSEA 2FBYA 4BACA 1XSNA 3PVXA 4H8KA 2VWJA 4RPZA 1WSHA 5CZ2A 3UIQA 3AV9A 3LPUA 5HRRA 1ZQKA 4PQUA 3C95A 4RQ2A 3N97B 2P1JA 4DU4A 4RQ5A 4NM1A 4CF1A 3QZ7A 4DTOA 1CZ9A 3ZT3A 3OGUA 4YMNA 3TANA 3KLEA 3HM9A 4E89A 9ICVA 1TKXA 4TQSA 3OYMA 4DQRA 5KG6A 5KFNA 2AQ0A 4J2EA 4NLZA 5DKWA 3SQ2A 4DMNA 4KO0A 2C2EA 2BPGA 4O3PA 2XHBA 4RPYA 5L1JA 4J9LA 4I29A 4M3XA 4M3WA 3CM6A 3LPTA 1JXEA 4F2RA 2W9BB 1I39A 1VSIA 4M0AA 1ZBLA 4G3IA 5C42A 3DM2A 4Z4FA 4PGYA 8ICMA 2KW4A 1S76D 3DLBA 2RKIA 1W0HA 2F96A 1ZQQA 3QZ8A 4QZ9A 3TAFA 5KFDA 4DU1A 2G8UA 1C7YA 4CJKA 5HP1A 4DTJA 3SCXA 4FK2A 4CJWA 3THVA 3ZT4A 3K4GA 3I8DA 3PNCA 1HJRA 4F4XA 2Y1IA 3ZSXA 1JN3A 3QNOA 2KTQA 3ISNC 4M3RA 1A76A 1VSJA 3EZ5A 4YMOA 4QZGA 4BWMA 4K8XA 1RTIA 1KVAA 5J2GA 4CJ5A 1RPLA 3PMNA 9ICWA 3AVKA 2YKNA 5KFXA 3QEWA 1WCNA 4ELUA 1VSDA 4MF8A 4CFBA 2AGQA 3QEPA 1ZQUA 1DGSA 3S3MA 3TAQA 4DOBA 4RQ6A 2Y1JA 4DL3A 3HXMA 2PY5A 2ETJA 4EZ9A 4J9QA 3AVCA 1KVBA 5J2BA 5IIMA 3VA0A 3KJVA 1HUOA 5IILA 1ITGA 4I2AA 3BDPA 2XY8A 3RR8A 3ZDDA 4DOCA 3MEGA 3QINA 3ZT2A 1U4BA 1D9DA 1ZYQA 1Y88A 1RT4A 2V4RA 2FC0A 2B21A 3E01A 2VG5A 1KDHA 1LAVA 4M9HA 2MUTB 1EX4A 1JMSA 3SZ2A 2BE2A 8ICKA 1TVAA 3ASMA 3HP6A 2Z1HA 3NGIA 3GIKA 3OHAA 1A5XA 1Z00A 5HMMA 1LWEA 3OJUA 4FM0A 4Q44A 4KV8A 1A77A 7ICSA 4M42A 5KI6A 5IIJA 1VSEA 2ZJ5A 3ISBA 4CJSA 4IDKA 4MEXA 2FPLA 2BR0A 3UPQA 3QLHA 4JRPA 5D4BA 4IRCA 4ID5A 7ICKA 3RBDA 2XCAA 2QKKA 4DS5A 2J6SA 2HHVA 4OGCA 1VSMA 1TKDA 4UB4A 2YHBA 3P1GA 5CY4A 4NCGA 3Q8SB 3UXPA 4QW9A 3KHRA 4QWAA 5HBMA 4CE9A 4CEDA 4B9TA 4M9LA 1RT2A 2RF2A 4EBEA 8ICIA 2XGPA 1S0VA 3KKRA 3JPSA 4F8RA 1CEZA 3KHHA 3FYHA 4YG2A 4B8AB 4CJ3A 7ICMA 3ZSZA 3S9HA 1I3AA 2R8JA 4LSLA 9ICFA 2OWOA 4M6WB 4B9LA 1ZBUA 3IRXA 4PY5A 5KFHA 3RAXA 5KFZA 3SQ1A 8ICTA 4DQIA 2PI4A 5J0SA 3SQ4A 4F92B 3MXMA 3IG1A 3MEDA 4PGQA 2A1JB 2W8LA 3PR5B 5EWGA 3SI8A 2JLEA 4KI6A 2HNZA 2V9WA 4P2HA 1GOBA 4FK4A 3O4QA 1U47A 4OKJA 1BIUA 4M9GA 3P83D 4GMJB 3HK2A 1IKYA 1MQ2A 4QZCA 1ZQWA 4DEZA 3UXOA 4NCAA 2ATLA 4E1MA 3AVMA 4QZFA 4JWMA 2JEJA 3DLEA 3L2VA 4CHNA 3OYKA 4QZIA 4FBTA 2BDPA 1BPDA 4PHPA 3RBEA 4CEAA 4YN4A 4FJHA 5DB7A 4RQ3A 4ECYA 3O4NA 2Z1IA 3I0SA 5DB6A 1S0OA 2QKBA 1NK4A 4M3UA 3C23A 2DFHA 1RBVA 4FLZA 1X9MA 4UBBA 3RRGA 4FM2A 1UOCA 5KG0A 3KD5E 2BGGA 4Z6FA 1L3UA 1ZBHA 1S5JA 3EW9A 2WONA 9ICRA 4FVMA 4DU3A 3SUOA 5FRMA 3LAMA 3I0RA 5J2EA 3F9KA 4FLTA 1RCHA 1ZQXA 2YKMA 4UB2A 4CJVA 3LP3A 2P66A 5HRPA 4N5SA 4W5QA 3MABA 4CGJA 2HNDA 3KLIA 4RUCA 4BE1A 4K4IA 4NCBA 2UVVA 4ECUA 3LAKA 3T5KA 1Q9XA 3GV8B 5J2AA 5D46A 2ASLA 2H5XA 5DQGA 3RH5A 4Z0UA 5KFSA 1D5AA 4QWCA 2E6LA 1ZQZA 3DMJA 4FZZA 4RT2A 4W5OA 1S0NA 1J53A 4M41A 3HSTB 3AO1A 1JLGA 3OYGA 2JZBB 4QZBA 2W9BA 3GDXA 3D0PA 1RXWA 4ECSA 5K14A 3O3GA 1KEJA 2F1HA 3OS1A 3AA4A 4GLXA 5KT2A 1RDBA 7ICNA 1ZBIA 5J0QA 2AGPA 4J2BA 3CYMA 4QZAA 4CGDA 3PW2A 3GIIA 3RR7A 4CCHA 4RU9A 4EP5A 3MFIA 2O4GA 4KLIA 5DDMA 3Q8MA 1UT5A 1KLNA 4QZ8A 2HVIA 3ISCA 5DLGA 5DQHA 1HRHA 8ICGA 9ICBA 5J2KA 1DTTA 3RMAA 5KFKA 3G10A 4ED2A 4J9SA 4N41A 4OGEA 4M3ZA 1CZBA 1CLQA 4PHDA 1R0AA 1SL2A 1ZQRA 1TAQA 3L3VA 3HW8A 5KFMA 5KT4A 2D5RA 3H40A 7ICGA 5J0OA 4FZYA 9ICJA 3Q8KA 1S1VA 4JUZA 1X9SA 3MFHA 1NK8A 4O55A 4CJTA 3UQ2A 4I2EA 3LDAA 5DB9A 3AO5A 3NE6A 4DSLA 1SV5A 2F8TA 5KT3A 3OSPA 2BCRA 3ZD8A 1JLCA 4DFKA 1ZQBA 4CHOA 3ORYA 8ICNA 4CK2A 3K2PA 4RG8A 8ICQA 3V81A 4HUGA 5KRSA 4GXJA 1QTMA 4CFCA 2D0AA 2ZQBA 1ASUA 8ICEA 5BOMA 4CIEA 3TARA 3AO3A 3PW4A 3AVAA 3K5MA 2O4IA 1TKZA 3TWHA 2IAJA 3WNGA 1TKTA 1WSGA 2M9NA 2UVRA 3GV7B 3RJGA 4YQWA 1XWLA 2FBXA 1SZPA 2MUTA 1HJPA 4M3YA 2WOMA 4DTRA 2HW3A 4N47A 3SV4A 3MGIA 5J0XA 3S3NA 4DTUA 5KT7A 1C6VA 4NLKA 3MAQA 2NRXA 1ZJNA 4ECTA 7ICHA 3RB4A 4IFYA 2C2RA 4KLFA 3DLKA 2F1IA 5HHHA 4CEOA 4FZXC 4DFPA 2ISOA 4I2GA 3OS2A 4OJRA 1BPBA 4KI4A 4MFBA 4AHSA 5L9XA 4R5PA 5CHGA 2AJQA 2ISPA 2OPPA 5HLFA 4NLGA 2G8FA 3GFKB 5KFPA 9ICUA 4K8ZA 2X6SA 3VQ8A 4UAZA 2P6RA 1ZQVA 4I2CA 4YNQA 3E2EA 4QWBA 3L2WA 4LH4A 5KFUA 2GWSA 1T3NA 2PFNA 8ICFA 3NF7A 2IGIA 1XSLA 9ICSA 2AQ4A 1BI4B 4IR1A 3DYAA 3G6YA 3RB3A 4KHUA 3M9OB 1NOYA 1ZQPA 4KRFA 3Q8RB 4CJLA 1LW0A 4F3OA 3AA5X 4Z4CA 3RJIA 5J0WA 3FDSA 4KHWA 8ICPA 4M6WA 3LP0A 4IRKA 1RNHA 3VQCA 1JL2A 4I2IA 5HHIA 2F1JA 3V4IA 4ED1A 2PFPA 3OYBA 1TL1A 3RJFA 4FJGA 3EWAA 1C1BA 3KLFA 3MXJA 4FJLA 3JPQA 2A1JA 4ECWA 4DFJA 3PUFA 4KLDA 1KTQA 4CK1A 1ZQOA 3OYIA 1KRPA 4C8NA 1T03A 5C24A 3B0YA 4C8MA 3M9NB 1S9FA 2LSNA 1B43A 4O0IA 4F5RA 1BCMA 4F4ZA 3VQPA 3QO9A 1ZQDA 5J2HA 1JLFA 4PWDA 1UA0A 3JSMA 3C2LA 2HHUA 4J9OA 5KT5A 2R8IA 5D3GA 5KFEA 5BPCA 4RQ7A 5KG5A 4DL4A 2VA3A 3V9SA 4YMMA 9ICNA 9ICLA 4HUEA 4H4OA 2OPQA 8ICYA 1BISA 2I9GA 4FXDA 4CGFA 3VQ6A 4I2JA 4CGHA 2G8WA 5J0UA 1EP4A 3OSNA 2G8IA 1UA1A 5KTQA 3B6OA 2DFLA 4HCBA 4DQQA 1RBUA 5KT6A 5CYQA 1X1PA 1QSLA 9ICIA 5I3UA 8ICWA 3OYFA 3SI6A 5DG9A 3V72A 4CJRA 3IM1A 3AVIA 4M2YA 3JPOA 1CUKA 3VQEA 3DI6A 5KG1A 1XHZA 3SV3A 1EXQA 1YT3A 4RW8A 3MDCA 4PPXA 3DRRA 1ZETA 1RYRA 4YXJA 1BPXA 4BGDA 3GV5B 4F5QA 4J2AA 4RNMA 3OYCA 2XCPA 3LZIA 2BCQA 3DLGA 3ETLA 7ICVA 1HYSA 1X2IA 4R63A 3V6JA 1JLQA 3EYZA 3SQ0A 4GC7A 3ALYA 2DFFA 4R64A 1TK0A 4DSJA 2ZTEA 1RXVA 3QEAZ 3K5OA 3NH2A 4KLQA 3ZT1A 1JXBA 1T7PA 2JZBA 1WCLA 1IKWA 4KLUA 2FLLA 3T5HA 4JS4A 4RQ4A 4JV2A 5KG2A 3AO4A 1VSFA 3BQTA 1WLJA 4MFAA 1COOA 4XRHA 4FLVA 3NHGA 3GIMA 4F5NA 1GOAA 3NDKA 4RW6A 1S97A 8ICVA 3SYZA 1QSYA 3OYHA 8ICHA 4FJ5A 2HMIA 1S9GA 4C8LA 3G0ZA 5KFOA 2GV9A 4AHTA 2P6UA 1KFDA 4UAWA 5C25A 2B4JA 3K5NA 3NF6A 4R66A 3TAGA 2W42A 3BQ0A 9ICKA 4CJ4A 2NRWA 8ICSA 1UT8A 1L3VA 4UB1A 3WNEA 4RQ1A 1L5UA 5L1IA 4KLTA 2B6AA 2YNGA 3OYAA 5KFJA 4F5OA 4TUQA 1ZQCA 3MR3A 3PR4A 3SUQA 1NK9A 1RZTA 4EYHB 1S1UA 2HHTA 1REVA 1T05A 3DRPA 4IFVA 1XSPA 1TV9A 4E7KA 4AHVA 4UQGA 4YFUA 5L1LA 4FS2A 5CYMA 2BGWA 3BQ1A 3MXIA 4NLNA 5IIKA 9ICHA 1QHTA 3H8SA 3QE9Y 4J9RA 5I42A 3O3FA 2P5GA 4JRQA 4R8UB 3RJKA 8ICUA 4DTMA 3ULDA 3JPTA 3MBYA 3V7LA 5KG3A 2BPCA 2YNFA 4CEZA 5EWEA 4KLLA 9ICCA 1HNVA 3SPZA 3ZDEA 1VK0A 2DPIA 4AHUA 1G15A 3RTVA 1L3TA 4CJEA 4JV0A 4OLBA 4ECZA 7ICIA 3RJEA 4NY8A 3AA2A 4KB1A 2BPFA 4FJXA 3RRHA 1B22A 4ICLA 1O1WA 1FKPA 3RH4A 4I2DA 1HNIA 3OY9A 1RYSA 4DF8A 3AVNA 1BGXT 3L2QA 1KCFA 4EBCA 3AVHA 5HRNA 2PYLA 3CFPA 1IKVA 1RT5A 1RTDA 7ICLA 4AH9A 1NJWA 4E0DA 1Z3EB 2JEFA 5DGAA 3VQ5A 4DSEA 3C21A 4KTWA 7ICEA 4DTPA 2R7YA 4F91B 1YTAA 4CIGA 1RTHA 2DY4A 3GILA 4BDZA 4LZGA 4B08A 1NKEA 8ICJA 3HL8A 3ZSYA 5HMLA 2GUIA 4M9NA 1XO1A 5CB1A 5L1KA 2IDOA 4ZHRA 1B9DA 3ZSRA 5KRTA 4Q8EA 4PH5A 1ZQLA 8ICOA 1S10A 2XO7A 1BI4A 2A1SA 2R8HA 4CF0A 4DL7A 2BHNA 1XI1A 4DS4A 4I2HA 4CGGA 4QWDA 3OVNA 4Y1CA 4K4HA 3FFIA 3CFRA 3CQ8A 2YHAA 3V6KA 4EEYA 4WE1A 1BL3A 3T19A 4FJIA 1D9FA 4O9MA 2VA2A 4RNOA 4NXZA 3DLRA 2Q3SA 1RBTA 1SUQA 5SWMA 2XY5A 3OHBA 1ZQFA 4YR2A 4F4YA 4TURA 4QOZB 4QW8A 3TQ1A 3H4BA 4DTXA 1BQNA 4FCYA 4I7FA 5J2PA 3Q8PB 2C22A 1SL1A 3V1RA 1N6QA 3VQ7A 2Q0ZX 3S3OA 2PFQA 5J0RA 1XS9D 1KVCA 2X6NA 2HHQA 2PI5A 4IRDA 4IBNA 4Q45A 3HPGA 1NK0A 1BCOA 4ED6A 4JLHA 3KLHA 1IKXA 5IIOA 1ZQTA 5KGWA 3M8PA 2XY7A 4I2PA 4N56A 2ZTCA 4YR0A 1AROP 2XC9A 3WNFA 4Z4IA 4DO9A 2OPSA 4QZHA 3LANA 4KHNA 1NKCA 3OS0A 1S0MA 4ECXA 2ZUBA 3DOKA 3U3GA 4P4OA 1RT6A 4CEFA 1ASVA 1QQCA 1K1SA 2KZMA 4O5BA 1RT1A 4YCXA 1TVRA 4DL2A 4GVMA 3NCIA 4O5EA 1TK5A 1VSKA 4B8CA 4YXMA 3TAPA 1RDDA 4BE2A 1C1AA 1A5WA 7ICRA 2AGOA 3C2KA 5J2MA 1J54A 4FJ8A 5CR0A 1H38A 4OKKA 1KFTA 1JL1A 2EX3A 3ZSQA 3NH1A 1XHXA 1K6YA 4FW1A 4Z4EA 2IS3A 4DLEA 1EETA 2OYQA 3JPRA 1DTQA 3C6UA 1ZQJA 4CJUA 3RH6A 4IR9A 3NF9A 4DQPA 4KKOA 4TSXA 3DRSA 4DG1A 4DWIA 7ICFA 8ICXA 4KLEA 9ICTA 3H08A 1EXNA 3ZDAA 1WAFA 3U3YA 3NGZA 8ICAA 2OZMA 2ASDA 1HYZA 3Q8LA 3AUOA 4ELTA 4IQWA 4RUAA 4ECVA 2FBTA 2ZUCA 5DBCA 2X78A 3B6PA 1N5YA 4EYIB 4X5VA 2HHSA 3AU2A 2UVUA 4DLGA 3V1QA 4FLUA 3VQBA 3VQQA 5IINA 2E6MA 3RB6A 4GXIA 3UQ0A 4YD2A 2W8KA 5J1EA 4FJJA 2JEGA 3PO5A 3L2RA 3A2FA 1TAUA 4J9NA 3SPYA 2AU0A 4KAZA 3PW7A 4OVLA 4E19A 7ICTA 2ITGA 4CFDA 1CXQA 2ZJAA 4Q5VA 1FK9A 4YFKA 1UAXA 5J2NA 4DL5A 4FJ9A 1J9AA 4YVZA 2YNHA 3M8QA 1HPZA 3T1AA 1RBRA 4PGXA 1YVUA 3SJJA 1TV6A 2ASJA 4RW4A 3MECA 5J2JA 1VSHA 4ED3A 1NJYA 3RWUA 5KFQA 4J2DA 2G8HA 1ZQSA 3C1ZA 4MEYA 1IH7A 5J29A 4M45A 3VQAA 4YR3A 5F9NA 5KG7A 3KK2A 3QEVA 2B5JA 1BPYA 3OYDA 4RW9A 2RDJA 4C8OA 4KB0A 1BVSA 4PHAA 4MQ3A 4R8UA 4F4KA 5J2FA 2IOCA 4AHRA 1HYVA 3KIOA 1FKOA 4F50A 4CEQA 5IIIA 3H8WA 2GBZA 3G6VA 1VRUA 1BPEA 1Z25A 3AVLA 1MU2A 4KLOA 1SKSA 4W5TA 1U49A 3C2MA 4IQTA 4ECQA 5DK5A 2ATQA 2E4LA 4KTQA 4CJFA 4XIUA 5J0PA 4CEEA 3HPOA 5EU7A 1KLMA 4LY7A 5KFWA 5HRSA 4BWJA 3RMDA 3AVJA 3AA3A 3BQ2A 4I2FA 1Q9YA 1RT7A 4CJPA 4O3OA 3TI0A 4KHSA 3KKSA 1LW2A 3V9ZA 4HCCA 1LAWA 3LP2A 4UAYA 4H4MA 4OPJA 2UVWA 4NYFA 5KG4A 1ZQAA 4M47A 3HWTA 4CHZA 4KREA 5C5JA 4MFFA 4CF9A 1QS4A 2JGUA 1UWBA 2IBKA 5J2IA 2OA8A 3KHLA 4LH5A 5EOZA 2HHWA 3TFRA 3NF8A 3HVRA 4UBCA 3ZDBA 4BXOB 5DMRA 4KHQA 4O0JA 1ZQNA 4GXKA 4O44A 4E7LA 1HUZA 3WNHA 4JWNA 4E3SA 4DQSA 4JS5A 5KGXA 1YTUA 3VQ9A 2W9CB 1NJXA 1JX4A 5DLFA 5CA7A 4FW2A 5KFLA 3C5GA 1IO2A 3IS9A 1QE1A 1S6PA 2IA6A 4FS1A 2C2DA 4DSIA 2DTUA 3O3HA 1ZQYA 5TZVA 2VANA 3QESA 4CK3A 2A1RA 4QAGA 3QETA 5DBBA 4XQ8A 4I2QA 2YNIA 4MFCA 1ZBFA 3LP1A 4PUOA 3OYNA 1DOQA 5FDLA 3K75D 2WTFA 2IC3A 4FJNA 2P51A 4ZTFA 2Z1JA 1S77D 1MQ3A 7ICQA 1LV5A 4CHYA 2NRTA 2JEIA 3TR8A 7ICOA 1LWCA 3EY1A 2VWKA 4KN4A 4EZ6A 4EP4A 3HVTA 3HO1A 4CGIA 4CEBA 1S9EA 1DLOA 4B9NA 3T3FA 5JS2A 3DOLA 1Q8IA 4TQRA 4UB5A 2ZD1A 5FRNA 2OPRA 1NK5A 3ITHA 4KFBA 4O3QA 4M9JA 1IM4A 3UXNA 1NJZA 1LWFA 3PY8A 3AU6A 4NM2A 1ZQEA 4B9MA 4CHQA 2DFEA 4HYKA 2NUBA 4CJQA 4M3TA 4QWEA 4KLMA 3C94A 4DOAA 3GIJA 1S1WA 1JLBA 4GW6A 4CFAA 4E7HA 1C0UA 4P4MA 3RMCA 5J0TA 4CF2A 1XC9A 4J9KA 3ZSVA 4HHTA 4HTUA 4LZDA 4TUSA 3PW5A 5DB8A 4PA1A 4OPKA 1WAJA 1FXXA 4IQVA 2FMQA 5KFRA 2NRZA 4O5KA 2BCVA 1JIHA 2J6TA 4RW7A 4FO6A 2VG7A 4KTZA 1QSSA 2G8KA 1CXUA 1N48A 4I9LA 4DL6A 4M04A 4JV1A 1WSFA 4OKEA 5HP4A 3NH0A 4DTSA 4I28A 2PYJA 1RBSA 5J2QA 5FROA 4IG3A 3HJFA 3RAQA 8ICLA 1BHLA 3CG7A 2IHMA 4UB3A 1NK6A 4CIFA 2DPJA 4FJMA 4DF4A 1BPZA 1J5OA 2P5OA 3PW0A 1EKEA 3JPNA 3BJYA 2RDIA 2J6UA 4Q8FA 1Y97A 1IXRA 4F2SA 4B9SA 4Z4HA 2ZTDA 1ZQGA 4AHCA 5DG8A 3H8JA 2XRIA 1BIZA 2FBVA 3TAEA 3C5FA 3PX6A 4F93B 3MDAA 5JUMA 4DSKA 3CFOA 5J0YA 3Q8QB 5DBAA 3QNNA 4HVJA 4DSFA 3NAEA 3QIOA 3V9WA 1VSLA 3GQCA 4LD0A 2C28A 7ICPA 3PX0A 3V7KA 9ICEA 3TABA 3KK3A 2X74A 5D49A 4CECA 1TGOA 1D8YA 1NOMA 2IHNA 5KFBA 2ALZA 3P5JA 5KFVA 1S1TA 4JK1A 3LZJA 9ICOA 3ZD9A 3KD1E 7ICJA 4QCLA 2XGQA 5SZTA 1ZJMA 2LYHA 3ZSOA 1C1CA 1RILA 4O3NA 5T7BA 3V9UA 4KPYA 3T5LA 9ICMA 1RDCA 4ID1A 3JYTA 4ZH4A 4KLSA 1U04A 1B92A 1WSJA 4P4PA 4Z4GA 5KFIA 4ED8A 4F3TA 4RZRA 5JS1A 3V7JA 1Z26A 3L2UA 3K59A 1N56A 3QEXA 3LK9A 1U48A 4FYDA 3D45A 1QLNA 2FMSA 1U9LA 3RMBA 1ZQMA 5HROA 5KFTA 1WSIA 2FPKA 4CESA 1SKWA 4BDPA 1KSPA 1MSWD 4RT3A 3M9MB 5CWRA 4KLJA 3AVBA 4ECRA 5DGBA 4IKFA 7ICUA 5KFCA 4KN7A 2R8GA 3TFSA 3N4MB 4TUPA 4FLYA 3RJJA 1HMVA 1SKRA 3C6TA 3V9XA 3MR5A 2HHXA 8ICRA 4BXOA 1A5VA 5DDYA 4FBUA 4OLAA 3NTUA 2RN2A 2XY6A 4PHEA 2D0BA 2RPIA 2NRVA 4B9VA 2BQUA 2VA8A 3ISDA 2W9AA 1B9FA 4L8RB 2W9MA 2F8SA 2W9CA 3LWMA 4XUSA 3HT3A 2ZUDA 3OYEA 1MC8A 3PMLA 4GC6A 2FLNA 1JLAA 3K57A 1HQEA 4K4GA 4I27A 3VQ4A 3MR2A 1WN7A 2FPMA 4EBDA 3IAYA 4CERA 3U6FA 5CJ7A 3HYFA 4CF8A 3L3UA 3HP9A 3KTQA 3BGRA 2YV0X 2KZZA 2HB5A 3H4DA 1V9PA 3F73A 1X9WA 1W9HA 8ICZA 3QEBZ 3V1OA 4J9PA 3PV8A 4DTNA 1K1QA 3SNNA 4C8KA 4KITB 3G6XA 3ZCMA 4E7JA 5J2CA 2QK9A 2I1QA 4YP3A 5J2DA 3NGYA 3K58A 5E41A 2V4QA 2ZE2A 1WNSA 3KK1A 5BOLA 4E7IA 4QZEA 4QZDA 3V6DA 9ICAA 2FLPA 5F9LA 3EPIA 3LALA 4CHPA 3AVGA 4RPXA 2PFOA 5KFFA 5DQIA 2BQRA 3MR6A 4FK0A 2PZSA 3C1YA 3NGDA 4YD1A 3DLHA 3HX0A 1ASWA 4R65A 4LSNA 3AO2A 4O3RA 3K5LA 4FLWA 1SL0A 4F4WA 2BKEA 3KLGA 2KN7A 4KLHA 4MF2A 3OYJA 1NK7A 4FLXA 1JXLA 3ZT0A 3VA3A 5DG7A 3QIPA
chains in the Genus database with same CATH superfamily
4JI2J 1KN6A 2XICA 4LF2A 3SMZA 3VGVA 3V6HA 4YHHK 1REGX 1LWEB 4K4YA 9ICQA 1OJ4A 2EHGA 2IMWP 1ZRMA 3BZQA 4IDKB 9ICPA 1RTZA 4O23A 4BRCA 4FM1A 1JLEA 4IXCA 2FB0A 5H9EJ 3VMFB 5KFYA 3RJHA 2KFZA 1N62A 5ALOA 3L0QA 4ZVUB 2CPDA 2AEJA 2JRSA 3ZZPA 4Q0BA 3HKZF 2FE9A 4RNNA 2PXIA 3LGMA 1X6JA 2LYVA 2R7TA 1C0TA 4DR5F 3NRWA 1CBKA 1VRTA 3KHGA 2BCUA 4RBUA 4NZ7A 4G1IA 3G71N 2FJDB 2J8AA 1TFRA 2V68A 4LVNP 2OZSA 1I94J 5DM7Q 2RRBA 3M8WA 1WDDA 1C0MA 3NBPA 4E1NA 4O5CA 3EPGA 2DYAA 2VG6A 4ZTJA 5AQTA 1GAOA 2VFVA 3MEDB 3I9ZA 1UEVA 5D77A 3WIUA 3L3FX 3MX5A 1T02A 3GWCA 3C16A 1ZQIA 4B9UA 4Q43A 2MAXA 4NLOA 3CJ9A 4IDHA 1RAOA 3RUBL 2DD8S 4NLYA 5F3TA 3T1HF 5JJBA 3ED5A 1IKYB 3SUPA 3AFGA 2G0CA 2YHWA 3JPPA 2DIUA 2MU2A 4AILC 2V63A 1RAGB 2J7UA 5E3PA 3DLEB 2FY8A 3T5JA 1Z4NA 5KPTA 3M32B 4NXMK 2DF4B 4PG5A 4JKBA 1U26A 2BCSA 1SIWB 3RBZA 2MMYA 4BBYA 4O4GA 3VC8A 3D2EA 3LDSA 1SS6A 4WP9A 3OYLA 1NMNA 1SUQB 4JKCA 1BA0A 2WVBA 4PG7A 3J7Z5 2EG1A 1R8HA 4YB5A 3A3OB 1WD6A 3IHQB 3BYPA 1NGBA 3ILOA 3ZDCA 4NYNA 2WONB 4R79A 4N8OA 3AVFA 4DPUA 4FXWA 1SJRA 4BRLA 2ZOMA 3J80U 3QYPA 3A5MC 2OTJN 3UIQA 1J5EF 3AV9A 3LPUA 1ZQKA 1F3FA 1A7GE 4RQ2A 3GONA 5EUHA 4CF1A 3K89A 4I64A 4P75A 3G71S 1BE4A 2L5YA 3TJ8A 3KLIB 5HVGA 1CZ9A 4UT4A 3CMQA 4YMNA 2YB4A 1RCOB 1TKXA 1RWXB 4GRSA 4DQRA 2EZXA 2O8DB 4BJQA 1BQXA 2GMJA 2KO1A 3N79A 4I6AA 1CS4A 3SQ2A 1SIJA 4KO0A 3DMJB 3EGWB 2C2EA 4J91A 1Y3KA 5L1JA 4J9LA 3CM6A 3KUHA 3JAMO 2KH9A 3N01A 1RHKB 2MZ1A 5DDPC 5K14B 1ZBLA 3OTDA 1QDUB 3I8BA 8ICMA 1S76D 1DY3A 1GTEA 4OYMA 2WZ1A 3CDBA 3L95X 4CLWA 3TAFA 4A8XA 2EXUA 1LOTB 2CXYA 3BF1A 2O3DA 4YY3K 7FDRA 4FK2A 3CDWA 4U7CA 1VHIA 5CR4A 3SD7A 2MJNA 4E98A 2OI2A 3BPDA 2NV3A 2V4JA 1ZZNA 2LKZA 3I8DA 1YBUA 4F4XA 4B3SJ 3SEIA 3MMBA 3WHIA 2XWXA 1SH3A 2KT2A 1JK9B 4HR2A 2OTJS 1VSJA 4UOCA 4JD2B 3IAM9 3WKEA 2CH5A 4IEEA 4K8XA 1WKKA 2GO9A 3MN6A 1O5JA 4L73A 2OHFA 1GK8A 2O8BA 2RH3A 3PMNA 2ROGA 4DB3A 2B0GA 3HZGA 5LJWA 1VSDA 3GMGA 3QEPA 1JLCB 1ZQUA 3TAQA 2CGLA 1FEEA 4WF9L 3HXMA 1NZAA 1SQGA 1ECWA 1JJCB 2ETJA 4M1KA 4EZ9A 5B0AA 4J9QA 1RADB 4Y34A 4C3MA 3V81B 1KVBA 3D0GE 5AKLA 3SLCA 2LEPA 4I2AA 4Y2SA 3ZDDA 1XMQF 4DOCA 3ZT2A 3OL6A 2HWIA 2CPIA 4JI8J 4CDIA 1RT4A 5D6GA 4M63A 1LAVA 2W1BA 1JMSA 5KQDA 3SZ2A 2HBLA 8ICKA 2QB1A 1L3KA 1EX8A 3TZYA 3MAAA 4HHHA 1B64A 2ZBIA 1Z00A 1E4FT 3V4MA 1VQNN 3W2VB 1SC4B 4KV8A 2YWKA 7ICSA 4M42A 5KI6A 4B1ZA 2MXYA 2ZJ5A 4CJSA 2H3IA 1MA9B 3DGVA 2BR0A 3QLHA 2AYGA 4F72A 5D4BA 2ACYA 1SV0A 3FLCO 1IV8A 4R5PB 2QKKA 4DS5A 2J6SA 2HHVA 1RUSA 4OGCA 1VSMA 1TKDA 1N32F 4GVEA 4NCGA 2JWKA 3Q8SB 5BPNA 1V97A 4NLRA 3IGVA 4WFAL 4WXOA 5B8HA 4LF7K 2F9WA 4B9TA 3Q22A 5EE0A 3KKRA 4F8RA 4CNZA 3KHHA 4B8AB 3S9HA 1GLLO 1I3AA 4ID8A 2AJ1A 4LSLA 4U7UK 9ICFA 3UB5A 4M6WB 3LP0B 2QA4G 2O8EB 2ODGA 5KFHA 2XLJA 1JXVA 2YKAA 3V4IB 1S57A 1VQ7N 2DHXA 2K8GA 2AXTU 3IG1A 4BGAA 3PR5B 1ZTTA 1WG1A 3GFZA 2HNZA 4DUYK 4OZLA 3O4QA 4OKJA 1VQNS 2V2KA 1RFQA 1FDBA 3FMBA 4CQ1A 4GMJB 1TQLA 1MQ2A 5E5NA 1ZQWA 4DEZA 3ICXA 1U6BA 3HVWA 4NCAA 3L2VA 3KG4A 4CH1A 3OYKA 4KGVB 3RFAA 1KOHA 1U09A 1X31C 3EZOA 4ZLNA 4RQ3A 1V5IB 2Z1IA 5AICA 5DB6A 2QKBA 3ZZZA 3N28A 3GSIA 4NLDA 4UBBA 3Q8YA 2V5HG 1Q5YA 2OP5A 1ZBHA 1S5JA 3EW9A 4F4AA 4DU3A 5FRMA 5I3UB 4YS2A 4HT5A 5D0GA 3N5FA 2HGNA 2A2DA 2F7TA 4PKGA 1RCHA 1DK2A 1P9QC 3ISZA 4CJVA 1NGAA 2VOPA 3P4UB 3C14A 3DRRB 1X0FA 2DNZA 1RLDA 2HNDA 4K4IA 4KE5A 4NCBA 1B4FA 2ZHBA 1KEKA 1IR1A 4CLSA 1TFYA 5J2AA 2H48B 4GV6A 3DLGB 3GE9A 1VQ7S 3PIOL 3CD7A 5DQGA 4ERDA 5JRTA 4ZJOA 1ZQZA 2ZJRQ 4Z7YA 2XSJB 3HSTB 2DHGA 1PC4A 3OVAA 3AO1A 2MB0B 2F4VJ 3UCZP 2BE7D 2VFUA 3D6MB 1HI8A 2EWHA 1K5OA 4ECSA 3DLLL 2DO0A 1IJEB 3OS1A 2NSCA 2CPYA 2JGAA 3AA4A 4GLXA 4ZPAA 1RDBA 2MGZB 3OL8A 3O80A 5J0QA 2LCWA 3CYMA 3DJCA 2Y3YA 2LMRA 3GIIA 2LP4A 4CF5A 4CCHA 3OXGA 4OI2A 4P6QA 1IBKJ 3RG6A 3Q8MA 1UT5A 1KLNA 3E66A 1EKSA 2HVIA 5M1PA 4CO0A 1AW0A 1DTTA 3G10A 1F3VA 1NM2A 4N41A 4OGEA 2OFGX 2MKIA 1Z05A 2DRBA 1SL2A 1TAQA 4N8NA 3GTYX 3QPIA 4J9UE 4CZIA 3U7JA 2K7KA 4IH5A 2VJUA 4WQ4A 3HKZC 1S1UB 2Q66A 1X9SA 2ZH2A 1ZOLA 1OWXA 2DH9A 4WQ4C 3UQ2A 1WC0A 3DAWA 5EN1A 2WVFA 3AO5A 2QT7A 4DV5F 3SR6A 5AKHA 4DSLA 1SV5A 1VQ4S 4YY3F 5KT3A 2BCRA 4LF5F 1RWKB 5FPEA 4TYBA 3LF0A 3EGNA 4PJ0U 2CDRB 4WKRA 3QJPA 1C4CA 5ALYA 2SXLA 3VENA 4IL6U 5TKWA 4CFCA 2ZQBA 5LXYA 3EE8A 3BYRA 1MMDA 1QH9A 3FR0A 2GVDA 4ZLLA 3KG0A 2IAJA 1TKTA 3CB4A 3O6WA 3HFZB 4DV5J 3RJGA 4ZCIA 3T41A 3G8SA 4LF5J 2WOMA 4ICLB 1HX1A 2PMWA 2CZ9A 4N47A 3SV4A 3NY0A 5J0XA 4DR2J 2A6AA 1C6VA 1R8CA 4NLKA 3KMSA 3MAQA 4P71A 4PWUA 1IKVB 4IFYA 2C2RA 1VLOA 3T69A 4MK9A 3P96A 3BY5A 1X4EA 4DCPB 1RTDB 2LU1A 3DLKA 1T95A 3O6QA 5C2FA 1F5CA 4DFPA 2DPNA 3KVGA 1ZM3A 1RAEB 3OS2A 2CQ1A 3QB0A 4OJRA 2YN4A 5L9XA 3IBCB 1VK8A 4WZQA 4JB8B 3QGGA 2AJQA 5HLFA 3GFKB 4HH1A 2OJ3A 3VQ8A 4UAZA 1A0OB 1RTHB 2P6RA 4YNQA 4NASA 3E2EA 1QUVA 4LH4A 3CCLS 2PFNA 3F9MA 3VR1A 1ATSA 2AQ4A 3MTKA 2RE2A 1RWUA 4KHUA 1NOYA 1ZQPA 2ABYA 3QT7A 1SI9A 3NGUA 3Q8RB 4LF9K 4BR5A 4KHWA 1S12A 2MY8A 2W4PA 1JB0C 3EUB2 5AIBA 2F1JA 4ED1A 2DHAA 1N0VC 2VC1A 3U8XA 3TTCA 5JVHL 1RAHB 3H0LB 4I7FB 4FJLA 1AT1B 2W7OA 4WJ3B 4LIRA 4LF7F 2HHHK 1KTQA 4OYIA 1NCLA 1O51A 2NSBA 1VLYA 3M6ZA 1T03A 2QX0A 5C24A 2PKEA 1TL4A 1BCMA 3KLHB 4F4ZA 2HFUA 3M8PB 4NEYA 1VC6A 3HHLA 1FDDA 3PYFA 3QBXA 4PR6A 1NO8A 3JSMA 3IAS9 3C2LA 2HHUA 5KT5A 2R8IA 4RR5A 3POTA 5BPCA 5KG5A 1OYDA 2YQ0A 1F9EB 2HBQB 4H4OA 1SWWA 2OPQA 1HNWF 4FXDA 2AIRB 4IKAA 5ETLA 3THXB 3VQ6A 4I2JA 2EK1A 2YWEA 1WWHA 2IOFK 3OSNA 4CBXA 2QEXN 4DUYF 3DWLA 2E9TA 4NJ8A 4W4MA 1X1PA 3V2UC 3TUPA 9ICIA 8ICWA 3SI6A 3AAQA 2E5SA 2LQ9A 2VPYB 2R2TA 2GELA 3JPOA 2V0NA 3QRRA 1OY9A 3D28A 1XHZA 1LXJA 1NJIT 3SV3A 3EMTA 4KH4A 3N7RC 4YXJA 4F5QA 3DCAA 3M1FA 4J2AA 3WQTA 1JI7A 4DV0J 3EYZA 3OFHA 1NDLA 5AQVA 2DFFA 4R64A 4DSJA 2AJ4A 4HL9A 2PE8A 1SJ4P 1L6NA 4KLQA 2H1YA 3CIPA 4X4RA 3JSRA 1T7PA 2UUCF 4K4UA 4H0OA 1IKWA 2ZWOA 4KLUA 3SDEA 3ZC4A 5H2FU 3A5LC 3T5HA 2AJ0A 4JS4A 4JV2A 5KG2A 4CNYA 1D8ZA 1S72S 2LI6A 4WXWA 3NHGA 1KQFB 2E44A 3GIMA 4F5NA 1S97A 2AH5A 1RBAA 5D0HA 3SIPB 2HMIA 1SZHA 1N8RO 5AE3A 1S4FA 2GV9A 2CPFA 3FC4A 1KAXA 2GAGC 2AW0A 2QEXS 4JKEA 1S5ZA 3L7PA 3NF6A 1U6ZA 2KKHA 1V3RA 1UT8A 5IM0B 3SAGA 5CA5A 5GAEU 1L5UA 1HARA 2D0PA 2B51A 2UUCJ 3Q89A 2MRLA 3PR4A 3MK6A 5AHXA 4EYHB 1RZTA 3PSIA 5AKIA 2HHTA 1HPZB 3DRPA 3MCAB 4IFVA 1NHKL 1XSPA 4UZCA 2V7YA 3CJKB 4YDUA 4I6WA 3MECB 3SCKE 1V4SA 4E7KA 3THYB 5JXSA 4F71A 1DAXA 4YDUC 4C0OC 1U8SA 2IYIA 4FS2A 4C8ZA 3R1LA 4NRTA 3A1YG 2C2MB 3CQYA 3H8SA 1U1NA 1LXNA 2B5JB 3FGVA 5H9FJ 2P5GA 5A0YA 4R8UB 8ICUA 3C66A 4DTMA 2AHOB 3VESA 3W2WA 2UU9K 4USTA 2YNFA 1FKOB 1ESVA 5AQRA 4KLLA 1FRHA 4K7QA 2QMUB 3ENOA 4K42A 4CJEA 5AQHA 4JV0A 7ICIA 1S6OA 1ZA2B 2W25A 4M7YA 4N77A 4LFBJ 5G5GA 3EICA 4ZITA 2FGOA 2WAQD 1FKPA 4ZMMA 4EGLA 1O03A 3OY9A 2YXLA 3HSGA 2CWXA 4NRUA 3L2QA 3AVHA 2PYLA 1H72C 1T44A 1FD2A 3HTVA 2MPUA 2ZIXA 1YF5L 3ENQA 4ANEA 1GO3F 2CNOB 3NG8A 1HBOA 2P9UA 1Z3EB 1LW2B 2JEFA 5BRFA 3C21A 4WFBQ 4KTWA 7ICEA 3CCVN 4F91B 3FEYB 4BDZA 4LZGA 1K0TA 1UWBB 5CZVA 4M9NA 5BJRA 1NRKA 1VC0A 3W9HA 4X4VA 4K25A 4PH5A 4OI0A 8ICOA 2ZIWB 1FWPA 2XO7A 4CF3A 5CD4H 4WFAQ 4I2HA 4CGGA 4NLBA 4RBTA 4A2BA 2CRXA 4Y1CA 3WEEB 3FFIA 2K4EA 2E8NA 3S7RA 4RNOA 2W2NP 2E5IA 4NXZA 5EVZA 1ULRA 3K9JA 2UXCF 3D6HB 2Q3SA 1RBTA 1SUQA 3CD0A 1VCTA 4QIWF 3F56A 3VVUA 4QOZB 1TUYA 1BQNA 3Q8PB 3DGPA 3VQ7A 4C97A 2PFQA 2KU7A 1E3MA 5FDLB 2JC0A 1Y5IB 1G1XA 2CQBA 5ALUA 3BBBA 3J81j 2IC3B 3GCWP 3QNWB 2PI5A 4IBNA 4LF9F 1BCOA 3M2VB 5IIOA 1ZQTA 4FO0A 5FD1A 1KW4A 4I2PA 1XERA 3RSEA 2KP7A 2C2NA 2BDUA 1LWCB 3K9KA 4JI8K 3G4SN 3OR2B 1KQQA 2QWNA 3LANA 3UO0A 1S9EB 5B0DA 2UXCJ 4F3MA 5L39A 3D6JA 2JVOA 1ASVA 3EGZA 2A41A 2ZJQQ 2QB0B 3CCVS 4WCEL 1U1MA 3HF5A 3CDEA 3ITHB 1TVRA 4DL2A 4GKKK 2DNGA 1N5XA 2CQ2A 5KL1B 4O5EA 4BR0A 1LK5A 1P8GA 3M1VA 3LPYA 3MPDA 4K4VA 4KJIA 4YXMA 3R1XA 2Q43A 2Z7JA 4ZJLA 3TAPA 4CD1A 3A0HU 1RDDA 4H0YB 2Y9UA 1A5WA 1S1WB 2E8OA 2MKHA 1QAIA 3DRYA 1J54A 5F8NA 2RE1A 4GY2B 4OKKA 3QDKA 3DDIA 1F9HA 3FKBA 3NH1A 1K6YA 4Z4EA 3M2RB 2IS3A 4V1Ak 2FVPA 2NXNA 3D2NA 3NVZA 2DHSA 2OEJA 1WWUA 2OTLS 3CC7N 3LDLA 3PIPL 3WXLA 2JDJA 4KY3A 4JP8A 4AT1B 3EVMA 1E4GT 1NSQA 8ICXA 4RW7B 9ICTA 2VG7B 1QVGM 2ZBRA 4JD2A 4NLVA 2NXEA 4OI6A 4EUVA 5A76A 2JNJA 5KOXA 1VQ5N 1YJUA 3S6JA 3AUOA 1B4SA 4OHVA 5M1KA 3FBCA 3CF5Q 1WEXA 4FWRA 4R25A 2W54A 2ZUCA 5DBCA 1K44A 2HHSA 2JLGA 3HRGA 4FOIA 1X5PA 2UVUA 2ATCB 1IBMF 4GXIA 4BRPA 3UQ0A 4YD2A 2W8KA 1D0EA 3L2RA 4ZVGA 3A2FA 1TAUA 3NP5A 3BP8A 3CCSN 3ETRA 4OYWA 2L9NA 1RWOB 4CFDA 3CXCR 4AYBF 3A12A 2DKOB 1HIWA 4P7TA 1VQ8N 4DL5A 4LRBA 5AQPA 2OD6A 3SXLA 4A59A 4S0MA 4EFAC 1T3OA 4I4BA 2QA4S 4PGXA 1RHUB 3JS6A 4ZIVA 1TV6A 1IUJA 7FD1A 5J2JA 1VSHA 4ED3A 3RWUA 2WBRA 1PSDA 4J2DA 1LEOA 2GQ2A 2ZKTA 5AK5A 2XYGB 3CWJA 1QQ5A 2AMCB 4MEYA 5ALWA 2E5HA 3UD4P 3B8HA 3CC7S 5A8RA 3BEXA 5AXLA 5EE1A 1BPYA 3OYDA 3CJ3A 1X8DA 2QLFB 5E3CA 4PHAA 4QJFB 4F4KA 2JFDA 3MAHA 4Y2JA 1HYVA 3KIOA 3WK9A 1L8LA 1VQ5S 1IBLJ 2WF9A 3G6VA 1VRUA 3MM8B 3H3OB 4F36A 2GGPA 4GKJK 1KDNA 2QFJA 3BZKA 1U49A 4A5BA 2HOFA 3GDQA 4IQTA 2CAJA 4MYUA 2Y8WA 2ATQA 4KTQA 3L6QA 1U8WA 5J0PA 3IBWA 4CEEA 4TU7A 2ZC3A 3TEGA 3UMBA 3RMDA 3AVJA 1TUVA 2OAUA 2D3O1 1RACB 3TI0A 1YG0A 4KHSA 3KKSA 2CQDA 5FPMA 1XJWB 3NGRA 4UAYA 5RUBA 4H4MA 5KG4A 1IBKK 4KC5A 4DX5A 1HNZJ 3AARA 4CF9A 5AM0A 1IG6A 5L8RC 3C6TB 4LQ3A 3NF8A 3KJQB 4MYTA 4BRHA 3ZDBA 3G6EN 3ZX0A 2KVCA 5DMRA 2HIYA 1PVPA 1ZQNA 2FSJA 2CWKA 1O08A 2EZYA 3AN1A 1ZH5A 4DQSA 4JS5A 4JKGB 2DNLA 3W61A 3C5GA 3IS9A 1QE1A 2D4WA 4FS1A 1JLAB 1HBNA 4UUXA 2W41A 1HQEB 4FYWB 5BPMA 3QQCD 2DBYA 3FBFA 4CK3A 5A8KB 3NMRA 3QETA 3FEZA 2HSZA 3LVVA 2YNIA 4MFCA 3MM9B 1LFPA 2JL9A 2QGFB 3BGRB 3OR1B 3VCDA 3N5BA 1WTBA 3GU3A 4ZTFA 4JB3A 1W7WA 1S77D 7ICQA 1S99A 2QC3A 4AE5A 4K5SA 4NZ6A 3TR8A 2K89A 2G2OA 4EZ6A 4ZK7M 3HVTA 3HO1A 5DETA 4TXSA 4CEBA 1DLOA 3PCOB 4OX9F 4DV4K 3W63A 2KHVA 3N0VA 1XR7A 3QGIA 2HAIA 3TOQA 2QWOA 2WMMA 2QL9B 3V6DB 4JN4A 4DR2K 2V8DA 5FRNA 2W6LA 2CG8A 3BO3A 1QQ7A 4KFBA 1KQKA 3KDOA 4GVLA 1F1BB 1W97L 3J7YI 4B3RJ 3UXNA 3G6ES 3O8MA 4DR4J 5AQOA 4CHQA 1S7IA 2CPXA 1S7HA 3GU0A 1N0UA 4CJQA 1M1GA 3ADAC 4DOAA 2BOPA 3AAWB 1C0UA 2E5LK 2MSNA 2N7YA 4CF2A 3HT0A 4OX9J 1XC9A 3KLGB 2RSQA 4HTUA 3OPKA 3X1LB 4ZVFA 4CM0A 2OO4A 3PW5A 1Z6RA 3CC4N 5DB8A 2IHR1 3M6WA 4GKKF 1FJGK 4QZVB 3GYNA 1NNDA 5AZJB 5AQXA 1HQUB 1N36K 4ZIWA 4O5KA 2W43A 1NGJA 3TJ9A 2CQPA 4USMA 4DL6A 4JV1A 2Y1LB 4C7QA 4OKEA 5AQSA 2HLTA 4DV2F 3A4TA 3SBGA 1S1XB 1YRXA 2PYJA 1U02A 1VBZA 5J2QA 3RAQA 2NYHA 2HVEA 4UB3A 4F0HA 3L4IA 4A61A 4FJMA 3QNMA 1J5OA 3SK3A 1FDNA 5LMUF 3OTBA 3M4XA 3NWRA 2J6UA 4Q8FA 2NYVA 4OHYA 2DB1A 5HMXA 1GLEG 4Q2LA 2FJXA 3NVVA 4CH0S 1ED1A 2RU3A 2DNPA 5DG8A 2BANB 1RQNA 1HUXA 4KR0B 3QWPA 3C5FA 3MDAA 5JUMA 4DSKA 1PJ6A 4DV2J 3E9LA 1KP6A 4YDXA 4HVJA 3NAEA 3MEEB 3HHLD 3QBCA 2WSCC 3BR8A 2C3PA 3EZUA 3O9UA 3V7KA 1CQMA 3G2XA 4IG0B 2J0QD 3N4PA 3TABA 5LMUJ 3IG8A 1WBDA 4CECA 4M5DA 4K0KF 3C0BA 3H0PA 3M2UB 4JI3J 4DPYA 2A6MA 2XWYA 1SJFA 3ZNUA 4EELA 2P6SA 3NS5A 3ZD9A 1NPRA 2HMPA 4Y2RA 7ICJA 2XGQA 3K1ZA 4HHUA 1ZJMA 1D1UA 2P9PA 1RILA 5LL6Z 3V9UA 3GJQB 9ICMA 1RDCA 3IRWP 1RT3B 2RQ5A 3PRBA 1XEZA 2FQQB 1KWMA 3BBCA 1A6LA 4DV0K 3MCNA 4F3TA 2WSEC 3CHWA 4B9QA 3L2UA 1LQ9A 2DKXA 4MO5A 5AK6A 3PSTA 1N56A 3U02A 4Q2MA 1RWWB 2VB6A 5ADXH 2VPXB 3RMBA 1T3QA 1CJVA 4ISEA 5HROA 5KFTA 2J8SA 4OYOA 2NZ4A 2FPKA 4MK8A 2KYXA 2FSNA 3MMAB 3AJDA 2C42A 3J81Y 2KXFA 3WXJA 3CUNA 3IWNC 4PQUB 2ZIVA 1CPZA 3VTIA 1VQ6N 3DDHA 1FF2A 3AVBA 4GKJF 5AI0A 1N34F 3CJ5A 2Y0SF 5BXIA 3KLEB 3CGIA 2ZM6J 4PL7A 1QUPA 2HYIB 3IWLA 3TFSA 3CMAN 1WEYA 2KIVA 4FLYA 4B1XB 2AF6A 4DQ8A 2H54B 3RJJA 1W2BM 2IOFA 2XI2A 4BXOA 1VIXA 1ZOTA 4FBUA 4OLAA 4PHEA 2D0BA 1EZZB 1OYEA 4BRIA 1XO0A 5K8MA 3ISDA 3UWTA 3CJ4A 4A8KA 2F8SA 3LWMA 5C42B 2MLZA 4DN9A 2K1RA 4JI7F 1GEHA 1N34J 4C0ZA 2O01C 1WF2A 5A2QU 2HRTA 2IY5B 2XMTA 1MWQA 3HI9A 1WN7A 2N1RA 1P7DA 2DRAA 1VQPN 3IAYA 4Y2CA 4CERA 4CF8A 1LOUA 4USVA 2HB5A 1V9PA 3H5XA 2ZF5O 3F73A 1X9WA 1WUDA 3JQKA 1YSJA 1W9HA 4QYRA 8ICZA 3US5A 4BRMA 2F3NA 2DNKA 4BRQA 4UF4A 3C28A 2KXNB 3D2FB 4JI7J 3ZCMA 4HTLA 4E7JA 3ZEUA 1FTCA 1VQ6S 1GH8A 2MSTA 1GXTA 1WSRA 4W92B 4DR7K 5E41A 4AYBC 1WNSA 2W03A 2YKNB 1SXLA 1DJ0A 1Y4ZB 4B1VA 5F9LA 2JFKA 3CMAS 3G82B 2NO4A 2PFOA 2HQGA 1HPMA 5C12A 1RWVB 1ZBTA 2V69A 3HILA 1ROFA 3WUHA 4B6JA 1N52B 4DCHA 5A8WB 4RJVA 4LSNA 5HOOA 4X66K 1QVFR 4DJBA 4OV6A 3GJSB 4F4WA 3PACA 2XI9A 1X60A 4H03B 4MKVA 1FW6A 4MF2A 1DGJA 3E01B 2VG5B 3KFUF 5HO4A 5IXUA 4FLXA 1XIQA 1DHMA 3FSIA 2R8KA 3IR5B 5E0OA 4UAUA 2B0CA 4DOZA 2F8KA 2M8DB 5HL7L 3C8YA 3PIPQ 4N76A 3DXMA 4XA5A 4OYZA 4TN2A 3FFKB 1CULB 2QW9A 1Y7PA 2QMXA 5CZ1A 3C15A 5EWFA 2Q0RA 4C0HA 2P6TA 2P9CA 2FMPA 4OJ6A 4I6YA 3EKSA 4CF4A 3M7DA 4QS7A 3AHPA 4I56A 2OANA 2M0GB 1U25A 2ZJ8A 4C8YA 4C2MA 5AE2A 4ED7A 2GOLA 1YDLA 2UUTA 1FJGF 2R18A 3A0BU 1LB2B 4YOWA 4PCQA 1N36F 3M8RA 2MQPA 3R5GA 2KKZA 5ALTA 2G5HB 1UW9A 2YTCA 4A8MP 3W5XA 3RB0A 1YBTA 1SJQA 5HBMB 1GOCA 2RF2B 4LF4F 1YJWS 1RTJA 3CNHA 4QS8A 4L72B 1KKXA 2RUSA 2VKZG 1KOOA 4W5NA 3HRDD 2UV8A 2DGQA 3H7IA 2DISA 3IRXB 4EMDA 5F0UA 4FJ7A 2A18A 4RBVA 3PDNA 5AKJA 4JAXA 5GAHP 3WKDA 1RDAA 4CVNE 4FE3A 3P8BB 3TSUA 1VJWA 1WB9A 1C2PA 2Z2ZA 3QU4A 2L3MA 2YX4A 1JNZB 1WHVA 2LVWA 2LMIA 3VQSA 3PO4A 3OVSA 4HT7A 3RW7A 2VJVA 3THWB 2O66A 3HZEA 3IA0A 3M8SA 5G0RB 2NZCA 4JI1K 1NKBA 2CA9A 3UM9A 2ROEA 2BH1A 1CJUA 5KFGA 2DXEA 2I5JA 4BVOA 4JV5K 1VJ5A 1VIOA 2VV5A 1BOTO 3A8IA 3SQOP 1Q3VA 2O1PA 3TAMA 3MM5B 3QEIA 3H0MB 5AQKA 3J81O 1F5SA 1HQ2A 3ZSWA 4W5RA 1WSEA 2M5YA 3PVXA 4H8KA 3T7ZA 1YJNN 1WSHA 1W25A 2AKWB 3H1VX 4K50A 5HRRA 3IP4B 2MKKA 3C95A 4RUHA 3NCRA 4C4TA 3AODA 2F63A 4NM1A 1FI4A 2GJIA 4LRFA 4DTOA 3CCMN 5ETRA 2UYTA 2FC9A 2YKQA 1SAZA 4H0XB 3I5BA 2KIWA 1WC4A 5FPDA 4TQSA 5KG6A 3KKFA 2EZZA 2Q2RA 5KFNA 2BTFA 2AQ0A 1T3VA 4O5FA 4DL0C 5DKWA 5H1SQ 4XEIA 4DR1J 3GBTA 2RHFA 4UOHA 2BRKA 1DEJA 4RPYA 4I29A 4M3XA 1MN9A 4M3WA 3IWXA 2P9SA 3LPTA 2W9BB 3ENHA 1R7IA 4C1NK 1VSIA 1N60A 4M0AA 3EDRB 1SCJB 4Z4FA 4PGYA 4PL8A 2ZZNA 4NYZA 2RKIA 2I38A 1ZQQA 5FLXU 3ENWA 2RS8A 5E84A 1MWMA 3UD3P 3UKUA 3E1YA 4OO1J 2X3DA 2EI5A 4DU1A 3ONNA 4CJKA 5B09A 4LREA 4CJWA 4NA3A 1HBUB 1NU4A 3PNCA 1R0AB 3ATUA 4Y2QA 3R5JB 5LL6d 2CNLB 1IBLK 1BXNA 2B4VA 4P0PB 2CQCA 1M5VC 2K3IA 1T9YA 3S41A 1AUDA 4AQYJ 3CCMS 1DRZA 4LF8K 2XG8A 1K8KB 2H51B 2W7PA 5AQLA 3BS7A 5KFXA 1WCNA 4ELUA 2B3TB 4MF8A 4U7UD 2CADA 2AGQA 3B4DA 5AQMA 5DS7A 3MX2A 3VTHA 2RQCA 1UQVA 3D2SA 2VBYA 3VAFA 1BWEA 3VGUA 1LK7A 5AQIA 1RU1A 1CVJA 3AVCA 5J2BA 3QIDA 3G25A 2X51A 4CDGA 1HUOA 5IILA 4CTAA 3VF0B 1N63A 2XY8A 2UZAA 2ZH9A 4DR7F 3QINA 2W2QP 1D9DA 1U1QA 4M5LA 2V4RA 3W8PA 1KQSM 1HWIA 1HR0K 1Z1ZA 2MUTB 1NMDA 2QRRA 3TW0A 3G96A 3MMCB 1TVAA 3AM9A 2ZXHA 1MA7A 4BRFA 3HP6A 3NGIA 2A1BA 3QT5A 3P39A 4C3LA 3MZIA 1A5XA 1QAYA 4E1JA 3SMVA 3FQLA 1U0HB 5IWAK 4ZPDA 4LF6K 1Q1KA 4NEZA 3TZXA 4X66F 4Q44A 2D69A 2GMLA 2KG5A 2LYAA 1BWVA 4JRPA 2ZNYA 4ID5A 1YBAA 7ICKA 3RBDA 1CJTB 1NDPA 2EFNA 2V2QA 3RBXA 3UQSA 5BYRA 4UB4A 2YHBA 4NLWA 1H73A 3GR1A 1PBUA 2Y0SC 4PRFA 2QI2A 2W3RA 2G07A 3AMZA 1RT2A 3HM8A 8ICIA 3DYAB 1CEZA 4OZ3A 5EOYA 1ILYA 3FYHA 7ICMA 1Q78A 1URRA 1LW0B 4LRDA 2OWOA 1NEEA 4B9LA 1ZBUA 3DN9A 4IEIA 3C7NA 3G86A 5KFZA 4MKAA 4I6MA 4DQIA 3NAIA 3PJ9A 4JI6K 4ILHA 3HHNB 5J0SA 3MXMA 2A1JB 1AZSA 4MIWA 5T7LB 3VALA 4F02A 8AT1B 2W8LA 5AJ3J 4BY9C 2DR8A 3C6HA 4KI6A 3CCJN 2V9WA 2IPOB 1LNQA 4P2HA 3R8YA 4C3KA 3F2KA 4FK4A 1U47A 2DNNA 1BIUA 4LFCJ 1YUWA 4M9GA 3JTOA 4DV6J 2KEYA 4X4QA 5B0CA 5GAGP 3OV7A 3QO9B 3CO9A 5DO2A 3UXOA 3DNCA 1YXQA 2ATLA 3AVMA 4QZFA 4JWMA 2JEJA 4TU8A 5KOWA 2H3GX 4FPAA 2DGVA 4M95A 4JBCA 1OVQA 3FZFA 1WKLA 5J8YC 2VKQA 4CO5A 1SJ3P 4FWOA 3R7BB 4FJHA 5DB7A 3O1BA 3I0SA 2KHQA 4M3UA 2DFHA 4FLZA 2BJ7A 5M1QA 3KD5E 2BGGA 5CYQB 2A19A 3TACB 3QMLA 3WC0A 3I0RA 5ALPA 2FVSA 3F9KA 3MPWA 4FLTA 2MZRA 4OFZA 2FHOB 2YKMA 1ZTWA 3MPVA 5GAHU 4WU3A 3BBFA 1VHXA 2HQIA 4JI1F 2IMOA 5HRPA 4RW8B 1Y9OA 4N5SA 3MABA 4CGJA 5A8KA 1VHFA 2DO4A 4JYAJ 4BE1A 3VGLA 2UVVA 2LQJA 4ECUA 1N8RT 2B8PA 1ZM9A 2R3VA 4WFNL 2BKPA 3DXSX 1JLQB 5KFSA 3MM7A 2XS2A 4FZZA 3D54A 3UKRA 1O8BA 4RT2A 2NUUG 4W5OA 4P2SA 1J53A 3VEWA 2HQ3A 3D3BJ 4RNHA 4KB7A 1JLGA 1R59O 2MHNA 2JZBB 4PG4A 1AQ6A 2BXJA 3D0PA 3FZHA 3TP2A 3O3GA 3BN7A 5GVQA 2NQPA 2JVRA 2CKWA 1NZBA 3QJJA 1XNSA 2KV2A 4RW6B 4HKQA 1ZBIA 2AGPA 4CGDA 4URQU 1RGVA 5GTIU 1S79A 1L7MA 2O4GA 2EEYA 2N82B 2J9EA 4WQ5C 2GAHC 5DLGA 5DQHA 1HRHA 8ICGA 5CD4A 9ICBA 5J2KA 4WFZA 3RMAA 4ED2A 3VAGA 1D8BA 3SQGA 2B6AB 3HW8A 2D5RA 2P9LA 3TA2A 2OYYA 1TL7A 4FL9A 2F9DA 1S1VA 2C1EB 3ULHA 4JUZA 1REVB 3QU2A 4URSA 1NK8A 1T05B 4O55A 4FYVB 4I2EA 5IT9Y 5DB9A 3TYTA 4X65F 2VQFF 4OX8A 5C7PA 2J5AA 4C4SA 2F8TA 2CYYA 1N88A 1UJ4A 1TUGB 3X3UA 5CYMB 4DFKA 2WBNA 1HWUA 3PM9A 4CHOA 4UZBA 5GADI 3ORYA 1PYTA 2MZSA 1WDTA 1R8BA 4FPIA 5KRSA 4GXJA 3SSSA 2CPJA 3R7SB 5BOMA 3TARA 1YAGA 2CPZA 3AVAA 1WJ9A 1TKZA 1SC1B 2OXOA 1FWKA 3UR0A 4UUWA 3WNGA 3TWHA 2RUGA 3AD9C 1IIPA 2VQFJ 2OKQA 3B6BA 1TELA 1UVIA 2IRYA 2ZZMA 2M9NA 3GV7B 4YQWA 1XWLA 1SZPA 2HMXA 5AIAA 3CP8A 1NGIA 9ATCB 4L76A 1QHAA 3BS5B 1M5SA 3H90A 4G65A 4X4NA 2DGZA 5HMYA 3M30B 3EL2A 2Q31A 1HNXK 1QY7A 3P4IA 2RAQA 4M8LA 1DRGA 2YX8A 1PGZA 1IR0A 1R31A 1RT5B 5HL7Q 5E3RA 4CEOA 3T1YK 4OJOA 5K9FA 4MFBA 4AHSA 4EIAA 1HR0F 2OPPA 3TO8A 2O8CA 1N33K 5HQMA 2G8FA 5KFPA 2R7QA 4ISFA 3BGLA 1ZQVA 2XS7A 2Q6BA 4I2CA 1QVGR 4QWBA 2OGUA 3L2WA 4P2MA 5KFUA 1UVMA 5AKYA 2LKYA 4LF6F 1T3NA 8ICFA 4LBPA 1IVZA 1G3OA 3NF7A 1XSLA 2ZDOA 4X4SA 3KHYA 4DXLA 3DXKA 1BI4B 4IR1A 2XTJP 2DH7A 2FZCB 1DARA 2CQHA 2QARB 2XIDA 3DDKA 1V6HA 4CJLA 3PSPA 1I5OB 3RJIA 3R97A 2XHCA 5BR9A 2LEBA 4WE1B 1LVHA 1SQKA 4IRKA 3VQCA 3B8AX 2N4DA 4EO8A 3I31A 1JL2A 3FC9A 4I2IA 1Q7YO 2F7VA 3EGVA 1YKWA 1TL1A 3RJFA 2HKEA 2CJBA 3MN9A 4FJGA 2M70A 1C1BA 3KLFA 4Y2IA 3MN7A 3ID6A 3AA8A 3JPQA 3CCWA 3MCPA 4ZLJA 2G0AA 2QKQA 1BLUA 1ZQOA 1SKUB 2ACMA 3OTOK 3W3DA 4C8MA 3M9NB 2XMJA 4KH6A 3JQJA 4O0IA 2A3JA 3D4JA 2M9KA 1KS2A 2VBZA 1NZ8A 1JLFA 1O0PA 2B4OA 4OJ3A 4PWDA 5FIIA 2FDRA 2DT9A 4J9OA 5D3GA 3AJ1A 2OPSB 4M7XA 4YMMA 9ICNA 4H5TA 4JI6F 1RT6B 2G06A 8ICYA 3IKMA 1BISA 4BC2A 4B1UB 4HHJA 3I5AA 4UY85 1S59A 3VZHA 3MD3A 4L6V3 1WBBA 2G8WA 5J0UA 1EP4A 4YMEA 2EDUA 2BZ2A 1RT1B 3RGIA 1O6XA 4Y6IA 4JI0F 4XH5A 4HCBA 4KHPJ 4DQQA 4X64K 3O0FA 5KT6A 2HG4A 4BG8A 4IOAL 4CJRA 3UE2A 4C0BA 3VQEA 3DI6A 3TNVA 2ZWPA 5J2MB 2EAOA 4PPXA 1RYRA 1BPXA 3CJSA 2QXLA 4RNMA 3TEHB 4AM7A 4DR3F 2B4PA 3OYCA 4IH6A 2XCPA 2LLZA 3LZIA 1EETB 2EFQA 2BCQA 1JWWA 1DTQB 1HYSA 2J0XA 3C6UB 3V6JA 4HACB 2VDHA 1TK0A 4JI0J 1HBMB 2ZTEA 1RXVA 2YQEA 2D1KA 4KKOB 5GTHU 3DRSB 4DG1B 3I55N 4MLEA 3ZT1A 5GIPA 4DZ6A 1JXBA 3SFUA 3FRZA 2FLLA 2DTJA 4A8YA 4RQ4A 2U1AA 5L38A 3AO4A 4NX9A 4XRHA 2WAQF 3NDKA 8ICVA 3BH7B 4DUZF 1QSYA 1N5YB 2UXDF 1S9GA 2Z4PA 4AM6A 1SPBP 3ZZ0A 2E9RX 3CJAA 4MDAA 2DKZA 1FFUA 1B7FA 1KFDA 5C25A 2B4JA 4R66A 3GJTB 2ADBA 1U2CA 5K20B 5IFMA 4CJ4A 1L3VA 1T9TA 3QBWA 4RQ1A 4BQZA 3O9QA 2G0IA 2YNGA 3MOZA 4ES1A 3W0LA 3MR3A 3SUQA 1FK9B 5J1NA 2QL7B 5J2NB 2OM6A 5IT9O 2VQEK 2YNHB 5B08A 4U9RA 5IC6B 4LR9A 4DUZJ 2F8MA 2UXDJ 2JH7A 3QT6A 2UUAK 4UQGA 2POKA 4U7BA 4O3MA 2E7XA 3KBBA 3OUYA 2QYGA 3UVJA 4LFAK 4USIA 3NNCA 5JVGL 3N6LA 3KG1A 1UAWA 4NLNA 3R6MA 1M5PC 3QE9Y 1RG6A 2CQ3A 3AEVA 3D3CJ 5I42A 3I55S 3O3FA 1UVLA 3JPTA 2R7VA 1EKRA 1T11A 3MBYA 1M90O 2B9XA 5KG3A 3SMSA 4H0VB 5AK4A 3M1YA 1HNVA 3ZDEA 1VK0A 2DPIA 4AHUA 1K8AO 3RTVA 2IFXA 3QMQA 1QZ5A 3C2PA 3VHQA 3L4QA 2H65B 3W60A 4FJXA 3RRHA 1FWLA 5K4LA 1FTRA 4ZPVR 4I2DA 1HNIA 2L48A 4DF8A 3ID8A 4HDGA 1BGXT 1S48A 1KCFA 1KLMB 3W1YC 5HATA 1NGDA 4JI4J 2OMOA 3BGUA 3OHRA 4O0NA 1RT7B 2ASPA 1RWNB 7ICLA 4AH9A 1U1KA 2BBEA 2QO3A 5F41A 3BH6B 1RWPB 1NGCA 3LTOA 4CIGA 2DY4A 3U26A 8ICJA 3HL8A 3D68A 1X42A 2PMHA 1HNXF 1HWJA 3U9ZA 5DJBA 2IDOA 1TYQB 5B7WA 4ZHRA 2AT1B 2FF3B 2YWFA 3NNHA 2FI1A 2OIHA 4O44B 1NU0A 3T1YF 4CF0A 4YOVA 2H3QA 1FDAA 4LVOP 5EDWA 5B0FA 2UUBF 1VBXA 4AQYK 4K4HA 4BHQA 3CFRA 4GVBB 1N33F 2EKNA 2DCLA 2VONA 4FWQA 4NI2B 4O9MA 2QG9B 2FSKA 3E9PA 2KN4A 1XMOF 1ZQFA 5A6WA 2ITMA 4QW8A 1RHJB 4I2QB 5J2PA 1N6QA 1SL1A 3OW2R 2BW7A 2E8MA 2Q0ZX 1N5QA 3I9V9 1MWYA 1R6YA 3DV9A 1KVCA 4B02A 2BRLA 2V6AA 2HHQA 1UMJA 3AL0B 4Q45A 3HPGA 4ED6A 2IVMA 3UDVA 1IKXA 1R3NA 1HA1A 2ZXIA 3FCWA 2UUBJ 2RRDA 1GFWB 2HZVA 4X4OA 2HS3A 2X1AA 2ZTCA 4YR0A 1AROP 2XC9A 3WNFA 2XMMA 1BHNA 4BC5A 3OS0A 1S0MA 4BRDA 5DM6L 4DPXA 3DOKA 3CNQP 4X62F 2IVFB 1CJKB 4CEFA 2J4RA 1XMOJ 2GIRA 1Z1VA 2HSEB 2JLFA 2CZVC 4TLRA 1KN5A 3KOOA 2UV8G 4O5BA 3R2CJ 2MLXA 3OTOF 3DXBA 3WT0A 2QLWA 1TK5A 1H98A 3D9BA 4U67Q 3WQPA 1LWFB 2F77X 3HX9A 5AZIB 3HHDA 5I3QA 2K8AA 4AUKA 2FVRA 3FJ2A 1C1AA 2IM0A 2AGOA 1GLFO 2W55A 3D6FB 1VQOS 2E5JA 1KFTA 1JL1A 1B0PA 4J5OA 2D8CA 4X62J 2ZH8A 2FVCA 2EX3A 4MLHA 3ZSQA 1XHXA 3DOMA 1C20A 5ADXA 3BF3A 2J7WA 2YH1A 1H6KX 3SBMA 1COKA 4JK8A 1FNXH 5JTIA 4CJUA 3G8QA 4X64F 2P9EA 4IR9A 4ILGB 4H0TB 1SB6A 5AXNA 4DQPA 3AD7C 4P52A 4P2FA 7ICFA 3JXOA 3ZDAA 4NXNJ 2ZGZA 2Q1NA 3NGZA 2GWKA 5D78A 1NPPA 2F5GA 1HYZA 2RHKA 4DV3F 4IQWA 2M8HA 1FO4A 1FE4A 4PXCA 4QQBA 4ECVA 2FF6A 1OKJA 1W2BR 4NMXA 3B6PA 3ET6B 4EYIB 6FD1A 3RYLA 3VQBA 3VQQA 3CC2N 5D0RA 5IINA 2YMQA 5AJ3K 3GPAA 5J1EA 2XEXA 1WSVA 4CZEA 3PO5A 3VAIA 2OEHA 2PEHA 4PZOA 4PHTX 2AU0A 2VBWA 3JSYA 4OJ1A 3MWTA 4E19A 4NA2A 1KC8O 2MHEA 2MQNA 4Q5VA 2YHYA 4TNOA 4BG9A 3NAHA 3AB4B 2MKSA 3O1WA 2C3OA 5AI4A 1F44A 3O3LA 2F9TA 5LSOA 3MM6B 3LQVA 3M8QA 2NPFA 4CBUA 2OSQA 1YVUA 3SJJA 5AM4A 3MR7A 2ASJA 4RW4A 5F0WA 2VC0A 3IV6A 3ZETA 2V8GA 3VOVA 3QUTA 1NDKA 5LMNJ 1YJ7A 3EEQA 3C1ZA 2G9OA 3VQAA 5F9NA 1U0HA 5KG7A 5LJ5Y 3KK2A 3I5CA 3PYDA 3MC1A 1YRUA 1S1TB 3OLAA 1X9XA 4RW9A 2RDJA 1LKYB 1YIJS 4DV1F 2YJFA 4KB0A 4EI2A 4MQ3A 1Z19A 4E2FB 4AHRA 1VI7A 1JCFA 2CZ4A 2BE9B 4QU7A 2KJ9A 2MQQA 4F50A 3JYTB 3H8WA 2UUAF 1UJ5A 2GBZA 2K60A 4LFAF 5MLCQ 1MU2A 2GFFA 4JHDB 3W66A 4A2AA 1SKSA 4W5TA 1XNQK 4QIVA 3CT9A 3BB5A 1EWRA 4CJFA 2HBKA 4RWTA 3LPEA 2LYBA 3HPOA 4DV1J 5EU7A 1T6DA 4LY7A 1YZ6A 3OXFA 5HRSA 3RVCA 2WRMA 4BWJA 1X4FA 3QGPA 2E1ZA 4EAHD 2DQNB 4NB4A 2LEAA 4PPZA 4V19J 3AA3A 4I2FA 1Q8KA 4Z2XA 4CJPA 4O3OA 4DR5J 2HZCA 2XB2D 2P9IA 3GFXA 2ZBCA 3V9ZA 4HCCA 3LP2A 2EAMA 2UVWA 2IIHA 1ZQAA 4M47A 2KVQE 4NLPA 2E1YA 5C5JA 4DV7F 4OL8A 1YGYA 4UARA 2JGUA 2IBKA 5J2IA 2OA8A 3VAMA 3KHLA 2NR0A 1ZXOA 5EOZA 2KT3A 4OZJA 3HVRA 1NPKA 1Z4UA 1TTHB 3TTDA 3W3SA 4JWNA 4E3SA 5G4DA 3RU0A 1WC3A 5KGXA 2PA3A 2LXIA 4WIQA 3F5EA 3EM1A 3T1HJ 5CA7A 4IOCL 3R1HA 3ENBA 2A5XA 1S6PA 3K17A 2C2DA 4DSIA 2ASYA 1ZQYA 3CCUN 1NGHA 5JU5A 1NGFA 2A1RA 4A57A 1TAMA 3HOSA 3LP1A 2HVDA 3CCEN 2WAQC 3D0IE 4PUOA 2UXBK 3OYNA 2FVQA 2VU5A 3K75D 1T6CA 2XZDB 3ZTQA 1XNRK 4FJNA 3H8MA 4A48A 2P9NA 2Z1JA 2RB7A 1MQ3A 4UQTA 5HI7A 2DL0A 4CW7B 3PXGa 3FCVA 4WYWA 1J5EJ 4CZMA 3GP9A 2KVSA 1FXRA 1RYUA 5GIOA 3T3FA 1A6SA 5HSPA 2XZTB 3R6GB 3DOLA 1R6VA 3KK1B 1EWQA 2LQ8A 1U6FA 2R2UA 2ZD1A 1E6VA 3C65A 1PILA 5ADZA 2OPRA 1NK5A 2AYEA 4M9JA 4C7YA 3HD2A 4M5IA 3NASA 3BEGB 2ZH4A 2LA4A 3AU6A 1ZQEA 3FEXB 4B9MA 2DFEA 2NUBA 1V5VA 3OLBA 4KLMA 2GMHA 3C94A 1JLBA 4GW6A 2Y8YA 4CFAA 4NYPA 3V5RA 4PABA 4P4MA 4KBIA 2Y9TA 1CG2A 5BN9A 4CZJA 4IO9L 3O08A 4HHTA 2YMLA 4FDFA 3L09A 4LZDA 3ULEB 1L8OA 4TUSA 2ZH5A 2CPHA 2VFRA 2ZG6A 3KUGA 3M8ZA 4OZ2A 2ZH1A 2OHDA 3WKAA 2VGNA 4ZVOB 3CCES 4IOBA 1X4BA 3GG0A 3KLVA 1JIHA 3UMGA 2J6TA 4KTZA 5C0YA 4WP8A 2CXEA 3CJ8A 5E3AA 3NUQA 5HP4A 1XQIA 4B3TK 1FT8A 1KVJA 3NGKA 1JLEB 1YHQN 4TU9A 3CCQN 1VYAA 1DBDA 4IG3A 8ICLA 2JWNA 3NNAA 3CG7A 1NK6A 4CIFA 4OYPA 4DF4A 2BUPA 2LDIA 3UFCX 1ZS6A 4USKA 4BCAA 3BDEA 3BJYA 2RDIA 5T41A 4JI5K 2G4BA 4Y3CA 4M63C 4Q0BB 4FYYB 1SC6A 4IO8A 4BC3A 3CCTA 2XRIA 1C0GA 2DNQA 1C0TB 4MT1A 4ED5A 1XUPO 3CFOA 1VRTB 3Q8QB 3I4PA 5DBAA 1FRJA 2BVZA 3VF4A 3E9OA 4BC4A 3QIOA 4OJ5A 3TVZA 1XMQJ 4CZHA 1PG5B 1PYOB 4HTIA 3PX0A 3DDNA 3ENVA 2WFBA 3NBPB 4I68A 9ICEA 3Q7CA 5AR0A 1SV0C 2VG6B 3KK3A 3PRDA 1NSPA 3BR9A 1JJ4A 5C2CA 4ZCMA 3K5PA 1D8YA 2IHNA 2G2YA 1KBRA 2MQLA 1WC1A 3C16B 2BA9A 2KICA 4ANCA 2IJFA 4YHHF 2B7BB 3IBFB 3W8GA 1ZD2P 4USAA 4K4SA 1XQSC 4CYUA 3QYYA 4ED4A 2XMWA 1ATRA 4QCLA 5SZTA 2LYHA 1TUWA 2R2RA 1C1CA 3SEOA 4DCJB 1Y0HA 2CQ0A 1L7PA 1U04A 1YHQS 4IH7A 3SSRA 1X5TA 4B1YB 5KFIA 1JCGA 5JS1A 4O4GB 3D2EB 2HEKA 1Z26A 3TA1A 2BJEA 4ES3A 4ACOA 4FYDA 3D45A 5BN8A 2Q0UA 1U9LA 3FUYA 1N32J 3F2BA 3A13A 2F44A 5M2UA 3S6EA 1SKWA 1KQSR 3SAHA 1KSPA 1DQAA 4RT3A 3AQFA 2QZ8A 3FK4A 1FFSB 4RKUC 4H5RA 5DGBA 1I3OB 1WG5A 4IKFA 7ICUA 4TY8A 4KN7A 4ES2A 4OI1A 3O4WA 1NGGA 3HFKA 1FRXA 1TKXB 3OTQA 2R8GA 2F65A 3TADA 4RX6A 2G2ZA 4AXIA 1HMVA 3F44A 2C3MA 1CS4B 2VYPA 3V9XA 4KO0B 1V85A 4OJHA 3QSIA 1J2MA 4DR6K 3TWZA 2VGMA 3I1YA 2B6GA 1OY6A 4B1WB 2W9AA 2W9MA 2W9CA 4C11A 4UW9A 1S49A 5BYQA 2ZUDA 1M1KO 5ALLA 2BACA 3PMLA 4ZPTR 4CO1A 1RB0A 2HFSA 3K57A 4NXMF 4K4GA 4I27A 1RLCL 1UVNA 3FZLA 3ZZUA 1F5BA 2CQGA 2KYZA 1M5KC 2DNYA 4NLXA 4RWXA 4C4WA 2FPMA 2VUGA 4EBDA 3U6FA 5GAEP 2XBPA 4YOTA 4OMFG 1DKGD 2YV0X 1WTFA 2PC6A 1UVJA 1QQNA 5KQ8A 3HHKA 2ZITA 2V4JB 3QEBZ 4C8KA 3MMBB 3KDNA 3P5BP 3M3ZA 3G6XA 4NLTA 4FZNA 2E20A 3BSOA 5J2CA 5D15A 4NXMJ 5DZ7A 4YP3A 2IA0A 1ZA1B 4NLQA 3K58A 2ZE2A 3SCLE 2O8BB 2YQ1A 2ASOA 5AI9A 4QZEA 3Q86A 3KD3A 3LALA 3WK7A 2QWMA 4HAIA 2ZGYA 1XNRF 1ZM2A 1GT8A 4ZVRB 4ZCLA 4FZLA 2VFSA 2PZSA 3NGDA 4YD1A 3EUNA 1FFWB 1ZZFA 3HX0A 1KXPA 1ASWA 2O8FA 1NJIO 2H3VA 4USHA 2QA1A 1OS5A 3A5OC 1SL0A 4KLHA 1RT4B 3T6JA 1U2VA 1VJQA 3MCSA 3ALRA 3TVYA 1R43A 1JXLA 3QIPA 1U45A 3MAAB 2PIIA 1EO1A 1FO1A 1Z00B 3NS1A 4Y2MA 4G1QA 3LL3A 5DM7L 2Q79A 4DFMA 5U47A 1MN8A 4KV8B 5ALEA 3CERA 2QXFA 3QLHB 3KOAA 2BQ3A 3VAKA 1T8EA 3HPHA 4WWSA 4BROA 3SUNA 2XQCA 5HNKA 1E6YA 1Q8LA 1RM6C 2KM8C 2PFUA 3M7VA 1NGEA 4AL6A 3K8VA 2MZQA 3WK6A 4FWLA 3VN5A 2G8VA 4YY3J 1OUQA 4NCGB 1RCXB 2HRYA 1BQMA 5HK4A 4I0WA 5I3PA 4JOUA 1MW7A 4UAVA 1XU4A 5KFAA 5F8JA 4B3TF 3PFEA 3TVKA 2YTUA 1D8LA 1PKUA 4LSLB 1G99A 1K0VA 3EVOA 2E1AA 1T9XA 2HSTA 1IG9A 2HOQA 4HUFA 3QERA 2MY7A 4X4TA 4JI5F 2FJAB 3ZO7A 1KVIA 2FHKA 4KPCA 4IC9A 3IG1B 4UOFA 2LXUA 4P0QA 2YJEA 2KQ2A 4ELVA 2HNZB 3UI3A 4B3MK 2IJNA 2BJDA 4KHYA 5KL8B 3LWLA 4B3OA 3NLCA 4A8OA 1T94A 2KFNA 3CM5A 5AI5A 4K4XA 2E29A 3UPFA 3VQDA 3KKAA 5AKKA 4Z6EA 2K06A 1JKHA 3MUMP 3KKAC 1Z2ZA 3QT8A 2F9JA 1H7WA 4FWPA 3AQEA 1L3SA 1HI1A 1Z4OA 2YKPA 3OVBA 2DR7A 5BR8K 2FLOA 1R8AA 2HNYA 2PMZF 1D3WA 1FVQA 2GVZA 4RQ8A 3VPZA 1S6QA 3NL0A 1TL3A 2AEFA 2D0CA 1F21A 4LVSA 1XK8A 3B0XA 5CP2A 3PX4A 4HH0A 4BACA 1YZ7A 2F76X 1XSNA 2GH1A 4RPZA 4GMKA 4IQMA 4GVBA 3N97B 1VK3A 3BZCA 4RQ5A 3G8TA 3QZ7A 3C14B 4M5GA 3H3NO 2HNDB 3FAHA 5ALVA 3HHLC 2CH6A 3ZT3A 3TANA 1DT9A 4WFXA 3OYMA 4KIAA 4GIBA 2W24A 3TJAA 1MROA 2RT3A 4NLZA 2R7WA 4JI2K 3IXQA 4CH7A 4DMNA 1VQYA 1HW9A 2BPGA 4LF7J 4O3PA 2GHPA 2XHBA 4UATA 2WCXA 2AP1A 3O8WA 1RABB 1JXEA 5CCMA 1OW5A 2PN6A 3F5TA 4G3IA 2XYPB 3DM2A 4AFFA 4QPXA 1D9AA 2KW4A 2QM1A 1FE0A 1W0HA 2F96A 4LR7A 5H9EK 3QZ8A 4IOCQ 3ZXWA 1KNZA 4QZ9A 1HNWJ 3DU5A 2KXHA 5KFDA 4OYAA 4CI0B 4DR6F 2G8UA 1C7YA 5HP1A 2JZ5A 2CJXB 4DTJA 2D3OR 2P9KA 1EARA 4DUYJ 1DTTB 2DITA 4FNIA 3CQXA 3VF6A 2GV1A 3ZT4A 1R89A 2L9DA 4ZPBA 1FD8A 2H9ZA 3LO3A 1HJRA 4CLPA 2Y1IA 3U1MA 3ZSXA 4BUGA 1JN3A 3QNOA 2H3FA 4M3RA 1CQNA 1A76A 3EZ5A 4JKAA 4LBIA 4QZGA 2V2VA 2B9YA 4FNHA 1I94K 1F2GA 4Z37A 1WOOA 1RTIA 5J2GA 2F3JA 4CJ5A 2YMPA 2LXFA 1V3ZA 1ITPA 1VQMN 1SV5B 4FKYA 3QEWA 3O5TB 2OMLA 1IJJA 4CFBA 2NRRA 4RQ6A 4DL3A 3MMJA 4V19X 4YEAA 2R4FA 2HPUA 3WQUA 5LY3A 3CO0P 1O13A 5IIMA 1UCVA 1K9MO 4FVUA 1MMLA 4IO1A 4WU2A 3MURP 3KJVA 2QTDA 1FNOA 5K8NA 3AY9A 1ITGA 1PK1A 2QFIA 4A5AA 2FHJA 2GVDB 3IFRA 2KM8B 3MEGA 1AYEA 2CRLA 1SWVA 2IAJB 1T9VA 1Y88A 3BKFA 2E2QA 5AQJA 2FC0A 3PTWA 1TKTB 2B21A 4F0KA 1FRKA 1FRIA 4CLTA 1KDHA 4HI2A 4IO9Q 1EX4A 5LSRA 1DZ5A 2BE2A 2WOMB 1BU6O 3ASMA 2B56A 3IMXA 2Z1HA 4CI6A 4ZP9A 1JJ2M 2ZJPL 2J7KA 1Q81O 3W65A 1LWEA 2JJ4D 3PLAA 2BKOA 4PKHA 2RILA 2K2PA 4IFYB 5EX5A 5IIJA 1HHTP 5ELZA 3I28A 3ISBA 2IOHA 4CE6A 3AXKA 4IDKA 3DLKB 2K4IA 5HJYA 1RP5A 2FPLA 4WF9Q 2OEKA 4XPCA 3PYGA 2WB4A 2DCUB 1Q7YT 2MA1A 3BPSP