2HHSA

O6-methyl:c pair in the polymerase-10 basepair position
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhsA01
1BIUA 1NOMA 3ZSQA 2FBVA 1ZQPA 5FDLA 1B22A 2BCQA 1KEJA 9ICGA 4FM0A 3T1AA 1HQEA 1WSIA 1ZQGA 2FLLA 4EZ6A 4QZEA 1VSFA 4LSNA 1NK0A 1XO1A 1XU4A 4QCLA 4CHQA 4DEZA 9ICIA 4CJPA 3ISBA 4OKKA 1JLCA 3ITHA 1W9HA 3V6HA 1ZQLA 1BI4B 8ICTA 3ZT1A 3P83D 3SI6A 4E1MA 3MDCA 3GV5B 3MXJA 3IHQB 5HRPA 7ICTA 2Q0ZX 5J2JA 5L1LA 2G8KA 5KT2A 1DTQA 4O44A 3BQ2A 4YN4A 8ICZA 4J9KA 4CJRA 3ZSZA 4AH9A 3NH2A 3K4GA 1B92A 3PR5B 3QNNA 4FLWA 4RW6A 3OHAA 5IILA 4I28A 4CFDA 5CP2A 5J2GA 1TK8A 4KREA 4MF2A 1ZQZA 2OPQA 3SUNA 4PWDA 2KTQA 1RBTA 1CZBA 1A5VA 1WSFA 2XY8A 1BIZA 2A1JA 4GW6A 3O3FA 2ASDA 1JX4A 1RT5A 4HCCA 7ICMA 2FPMA 1CEZA 3VQQA 5J2PA 4DTSA 3SPYA 4GXIA 2KZZA 7ICHA 1KVCA 2ETJA 1G15A 1A77A 4F4ZA 3V6DA 5L9XA 3QZ8A 3SV3A 4CEDA 4ED7A 3I0SA 9ICEA 3QIPA 2JZBA 4GVMA 4CJKA 4I2QA 4CECA 4Q45A 2A1JB 4M9HA 3PNCA 4DS4A 4DFMA 5J2MA 4W5OA 3RRGA 3QETA 5KFPA 5BPCA 5J0TA 2AGOA 2ISOA 2RDIA 4F5NA 5D49A 3Q8KA 3QO9A 4FLYA 1BISA 3RBEA 2UVVA 2R8HA 1Z25A 1EETA 5KT6A 4JWNA 9ICJA 4BE1A 4GXJA 4F4YA 4I7FA 4FJXA 4FLVA 2FLNA 4O5EA 2KZMA 4RQ2A 3SV4A 4O5CA 2YHBA 3B0YA 2VANA 4DSIA 2JZBB 4DTMA 3BJYA 4DWIA 4DTOA 3BQ0A 3CFOA 1RBVA 3OYFA 4MFAA 1JKHA 1SV5A 4Z6EA 3WNFA 2V4QA 2V9WA 5CYMA 3VQ9A 4CF8A 1A76A 1WSEA 1S6PA 1NJYA 3AA5X 3HWTA 3O3GA 4O3NA 4EYHB 4JUZA 2P6UA 3RJKA 1S9FA 1BHLA 4RUAA 5DLFA 4PPXA 1KTQA 7ICFA 1QQCA 5C5JA 1ZQQA 2O4GA 4OLBA 1RTIA 1RDDA 4ED2A 3T5HA 3NGIA 1NK5A 4O4GA 3V9SA 4HYKA 1B9FA 3TANA 4XIUA 3AVFA 3FFIA 4DFKA 5J0WA 3DRSA 4O3OA 1N56A 3L8BA 2ZUBA 3QEBZ 4HCBA 3PW7A 1CXUA 4FVMA 3C2LA 4B9NA 4I2AA 2DPJA 3TFRA 9ICLA 4KI4A 4IRKA 2P5GA 4P4MA 4MFFA 1UA1A 3H7IA 4F93B 5CR0A 1VSJA 3PW5A 2HNZA 3LP1A 3MABA 1JLBA 2X78A 2OZSA 4YR0A 3SJJA 3QE9Y 4M9GA 2DPIA 2Z1JA 5KFCA 4M3ZA 4ED0A 3M8RA 3SPZA 3P5JA 2GWSA 5JS2A 2G8IA 3LK9A 4CHYA 1LB2B 5KRSA 4CJQA 4L8RB 4Q43A 7ICGA 2G8HA 1RTDA 4C8OA 4F5OA 3RMDA 1X1PA 4I2HA 4KTQA 3PX6A 1Z26A 1ZQOA 3BDPA 1GOBA 1RZTA 3OSNA 4CGJA 4JV1A 3H4DA 4YD2A 4KLIA 3QERA 4FJ9A 4ECVA 3OYCA 7ICKA 3BQTA 4BWMA 5FRNA 2OZMA 7ICPA 4Z6DA 4DL5A 8ICIA 3G10A 2F8SA 8ICEA 4M6WA 2Y1IA 1IKYA 2BDPA 2ATLA 8ICGA 3FDSA 2C2RA 5SWMA 3HW8A 4I2IA 8ICJA 4Z0UA 4AHVA 4J2BA 4ECZA 4YXJA 1I3AA 4YMMA 3ZDCA 3AVBA 4E19A 1TL1A 2YHAA 2BQRA 3SUPA 3RMAA 1YT3A 4CIFA 4QWEA 2HB5A 4CJLA 4PH5A 4FJJA 2I5JA 1EKEA 2FPKA 2W8KA 4F2SA 4DOAA 4F3TA 4CJTA 9ICMA 3OYJA 1KFDA 1RYRA 4M6WB 3OGUA 2BCVA 4N47A 3RB4A 4YMNA 3HL8A 4JWMA 1KLNA 3NGYA 1Q9XA 4QWCA 3DOKA 4FK0A 4ECQA 2IA6A 4F2RA 3OYLA 1RPLA 1U49A 3F9KA 2KFZA 2R8GA 2YNIA 4XA5A 4RQ5A 4CK2A 7ICUA 1U45A 1TKTA 3TAQA 5KG6A 3LZIA 1WCLA 3N4MB 3CFRA 5EWEA 4DTJA 5SZTA 3OJUA 4KLOA 4FJIA 5J0XA 3RJIA 5DG7A 4IKFA 2PZSA 2PYLA 4CF1A 4C8LA 2J6UA 3MEEA 5HMMA 4DFJA 1TVRA 3PO4A 2HHUA 3GFKB 4FJ7A 2O4IA 1W0HA 4B9LA 4KLHA 7ICEA 4DTXA 2MAXA 1HQUA 1ZQVA 1A5XA 4PHAA 2P6RA 1NK8A 7ICNA 5J2QA 1UA0A 4NLKA 4QZ9A 2BCUA 1HUZA 3C2KA 5CA7A 3RJGA 1JLFA 3PMLA 5D4BA 2Q3SA 4QZFA 2JEJA 9ICUA 1KDHA 4GLXA 1L3UA 2BANA 1LV5A 9ICWA 4BDZA 1ZJMA 3DLGA 8ICPA 3LP2A 2YKNA 4B3OA 3QEIA 3HP9A 3RAQA 1S9EA 4R8UA 1QS4A 4CEAA 4DSEA 4F50A 1NK6A 3QIOA 4DL3A 4KI6A 3DLBA 4KLUA 1UT8A 4KLQA 4J9SA 4NM2A 4I2JA 4UB4A 9ICBA 5KFNA 4FLXA 4ZH4A 1ZJNA 1SZPA 5DG9A 8ICUA 4NCAA 2FBXA 4KITB 2ATQA 5KFQA 3T5KA 1HYZA 4FYDA 3OYBA 1LAVA 4CGDA 2H5XA 1L5UA 4JRPA 2ZUCA 3OJSA 3D0PA 3JPQA 4DU4A 1UOCA 4M3WA 4R8UB 4F8RA 3ZD8A 4RZRA 4B9SA 4J9LA 8ICFA 2ASJA 1HJRA 3KHHA 1MSWD 3O4QA 4QZDA 4O3QA 4FBTA 4O3SA 3OSPA 3MR5A 3HVTA 3L2RA 4IR9A 3ZCMA 5DB7A 4M3TA 1D9DA 4RPYA 3QEAZ 4KLLA 4M45A 4BDPA 5CZ2A 4OKEA 5KFHA 4F92B 1ZQWA 3L3VA 5BOLA 3MR2A 5L1IA 9ICAA 1KCFA 2FBTA 8ICLA 2HMIA 1JN3A 3LPTA 3K5OA 4KHUA 1RCHA 2IGIA 4DFPA 3VA0A 4QW9A 1S1UA 1Q9YA 5DG8A 1ZQDA 9ICSA 3JPNA 2PI5A 4B9UA 1ZQCA 4K4HA 8ICHA 4DLEA 4X5VA 3AVMA 5T7BA 2HHVA 3C1YA 3GV8B 1ZYQA 7ICQA 4DQQA 4NM1A 2XGPA 2JGUA 1S5JA 4MFCA 3QEPA 1XWLA 4GMJB 3HM9A 3EW9A 2HVHA 2D5RA 4IQUA 3SQ0A 3ZSVA 4F5PA 2DFEA 2V4RA 2AU0A 4ZTFA 2PFQA 5J2DA 1LAWA 5CB1A 2ZQBA 2UVRA 9ICNA 3KD1E 5DBCA 2YNHA 1T03A 2W42A 5J0UA 3KLEA 3KK1A 3H08A 4RPZA 4Y1CA 4QWDA 4AHRA 4Z4EA 5KFKA 4HUGA 3V6KA 4KHNA 1Z00A 1C7YA 4LH5A 5DB8A 4E7IA 3LAKA 4TSXA 2B5JA 1BQNA 5CZ1A 4YMOA 3PX4A 4PA1A 1KFTA 3V9UA 1IXRA 3FYHA 2VG6A 2ZJ5A 3NHGA 3SYZA 2J6TA 2KFNA 4HTUA 4DL7A 5KFZA 3C5GA 4M9LA 1S1WA 2LSNA 3AVIA 4DO9A 3TQ1A 3LP0A 3M9OB 4Z4IA 2VA8A 3LZJA 3C2MA 4CGGA 3AO3A 1BPBA 2JLEA 2XGQA 2QKKA 1NJWA 1Z00B 1BPEA 4FS2A 1BPZA 4HUEA 1ZQTA 4RQ4A 5I3UA 1LWFA 2VA3A 3CM5A 3RB0A 4KLTA 4JRQA 1ZETA 4RW8A 3MBYA 1Z3EB 2F1IA 4NCBA 2Z1IA 3AA4A 2E6LA 3KKSA 4CJEA 4E7HA 4KLGA 3IG1A 2AGPA 2HNYA 2ZE2A 5C24A 2C22A 5KG1A 8ICWA 4FJKA 3RJJA 1FK9A 4DSKA 4OPKA 4ICLA 4GXKA 5KFJA 4JLHA 3MECA 1NOZA 1IKVA 4KPYA 3HJFA 3V1OA 4HUFA 5KG7A 3SUOA 4O5BA 4O55A 1JMSA 2BKEA 1DGSA 4ECTA 3N97B 3SZ2A 3CFPA 9ICCA 5JS1A 5KRTA 4ECWA 4RT2A 3DM2A 4Y1DA 2VG5A 4NY8A 4BWJA 3Q8QB 7ICRA 3UXOA 2RN2A 3V7KA 1C1BA 2HHXA 3GQCA 4UAZA 3V72A 3V4IA 4TQSA 3GILA 1XS9D 1KFSA 2PFPA 3V9ZA 3C1ZA 2FMPA 3ASMA 3OYGA 3DRRA 1SL1A 1IH7A 1HRHA 1XC9A 1TV9A 3TAGA 1CUKA 3SQ1A 4KLFA 4EZ9A 3PY8A 1N6QA 3E01A 2IHMA 4AHSA 4MQ3A 1TK5A 4MF8A 1TAUA 4G3IA 2PYJA 4Q8EA 5J2NA 5DKWA 4IR1A 3MGHA 1JXBA 5DQGA 1FKPA 4YNQA 2KN7A 1KRPA 3V9XA 5KG2A 3ZT0A 1ZQAA 2Z1HA 4E1NA 2F96A 3U3YA 4ECYA 4TUSA 3VQEA 4RG8A 2HHQA 3RRHA 3ZSYA 3K59A 3SNNA 4F4KA 1F21A 1ZQMA 1WAFA 1JLAA 3DOLA 4E89A 2AJQA 3EWAA 5KGXA 4NYNA 4KRFA 2G8WA 9ICFA 2XY6A 1O1WA 4M9NA 3KD5E 3RJEA 4FK4A 2RDJA 1BPDA 3AVLA 3L2UA 3ZT2A 4ZTJA 4M3RA 3T5LA 4TUQA 3LPUA 3TAEA 4P4PA 4KLJA 2OWOA 4DU1A 1D5AA 2G8FA 1NJZA 3DYAA 2P1JA 2JEIA 3CQ8A 4I2GA 4CJVA 5J0SA 3WNHA 3QEVA 4YD1A 3BGRA 4FZZA 4KKOA 5IIMA 2PI4A 5DB6A 1U47A 5CWRA 3V81A 5FRMA 1U9LA 4CEBA 3QEWA 3K2PA 4ID1A 2RKIA 7ICSA 1VRTA 8ICRA 1RYSA 4DTPA 3T19A 3OVNA 5J2IA 5DGAA 2B6AA 2YKMA 2M9NA 4TQRA 2Z1GA 3HX0A 3NDKA 1ZBHA 3NGZA 3TFSA 3C94A 4AHTA 3H8WA 1U04A 4FJ5A 3LDAA 1ZQNA 4M41A 2YNFA 4RQ7A 3JPSA 3MAQA 3V6JA 3AVGA 1DLOA 3K5MA 4CE9A 2JEFA 3B6OA 4DOBA 3QZ7A 3VA3A 4I2BA 4KLMA 5HNKA 1S1TA 4CJ5A 5J2HA 4FZXC 1KLMA 5KFDA 1T05A 3RMBA 1REVA 2DY4A 3KLIA 1A5WA 3KLGA 3UIQA 2C28A 1ZQXA 1LW0A 9ICRA 3B6PA 4M47A 3C21A 2VG7A 3V7LA 3PW0A 4W5RA 4F4XA 4FJNA 4KN4A 2RF2A 3KTQA 1VSLA 4PHDA 4IG3A 2ASLA 2XY5A 4M2YA 3F73A 3RJHA 2DTUA 1J53A 2QXFA 5J2AA 1ZBFA 1XSPA 4CEQA 1X9WA 3TAPA 2C2DA 1KVBA 3QNOA 4YVZA 3KHLA 5DGBA 3UQ0A 2FBYA 2A1SA 2KZ3A 3OS2A 2OPRA 3MR6A 2UVWA 4PGXA 4B9VA 5D46A 4F3OA 4KB1A 4B8CA 1RT3A 2F1JA 3WNEA 4LSLA 2AGQA 4QOZB 4P4OA 1QSLA 2QK9A 3ZSWA 4RW9A 4CK1A 3RB6A 1C1AA 1NK4A 2G8VA 4JV0A 4CHPA 2ZTDA 4FLUA 1ZQKA 4DU3A 4CJWA 4KN7A 8ICNA 3RR7A 4EYIB 3AV9A 1S0VA 9ICXA 5HRNA 1RXVA 5HROA 4IG0A 3NF7A 4I2PA 3HPHA 3KK3A 3DLHA 4I27A 1JXLA 1IKXA 1SL2A 1XI1A 3ZSXA 3ETLA 5J0QA 3AA3A 3SQ4A 3AO5A 4R5PA 1WSGA 3L2VA 2BR0A 1NJXA 1QTMA 4DSJA 5KFVA 4YP3A 1IM4A 2GUIA 4FLTA 1LWEA 3C23A 1TFRA 3ALYA 1U48A 4ECUA 2NUBA 1LWCA 1SUQA 1UT5A 4C8KA 2FPLA 3UPQA 1VRUA 9ICTA 3KHGA 2Y1JA 1S10A 4RNMA 1D8LA 5C42A 3JPPA 8ICOA 3H8SA 4I2EA 4HVJA 4J2EA 1TL3A 5I42A 1RT6A 4PGQA 4EBCA 1J9AA 2AQ4A 1MU2A 3EZ5A 1X2IA 1RDBA 4IFVA 5KG3A 3K5NA 4CJ3A 3M8QA 1TK0A 9ICQA 4DL6A 1ZBIA 3C5FA 1BCMA 3NCIA 1L3VA 3EPGA 5IIIA 2FC0A 4B9TA 2OA8A 3VQ5A 1ZQIA 5KFIA 1TKDA 1VSMA 9ICOA 5HMLA 5JUMA 4E7LA 4FJMA 1VSDA 4J9QA 2HVIA 2HNDA 4RU9A 4CGIA 1NKCA 1J54A 1TKZA 5KFBA 4O3PA 1XSLA 5FROA 4HHTA 4FZYA 4NLGA 4O0IA 4J2AA 5TZVA 4DQPA 5F9LA 2RPIA 3I0RA 3RH5A 4B9MA 4DG1A 4K4IA 2IC3A 2BCSA 4FK2A 3NFAA 4F4WA 5C25A 1IG9A 4RNOA 3NH0A 4LZDA 2VA2A 4Z4GA 3MR3A 3TARA 1WN7A 2WTFA 3DLRA 4QZAA 1X9MA 1S76D 5HBMA 4YCXA 1EP4A 5KG4A 4R64A 4F5QA 3VQ4A 4DL2A 4O0JA 2E6MA 4FBUA 2A1RA 4FCYA 4FJLA 3LWMA 1XSNA 3AVCA 2B4JA 3M8SA 5DB9A 7ICLA 3GV7B 4CHNA 4R65A 4CGFA 3S9HA 2EX3A 4W5QA 3UQ2A 4H4MA 1ZQRA 4M3UA 3CM6A 5KFEA 1JLEA 2NRZA 3ZT3A 4QZGA 2NRXA 1NKBA 1C0TA 4Z4CA 4YQWA 5DK5A 2IAJA 1RDAA 4KMUA 2BPGA 4QWAA 5KT4A 3ULDA 1ZQFA 2BPCA 4K8XA 2OPPA 3AUOA 2ZUDA 5HP4A 4E3SA 4C8NA 4ED3A 2ALZA 4CF9A 3B0XA 3Q8PB 1N48A 1WCNA 4FLZA 1HYSA 3NF8A 3KKRA 2BPFA 1YVUA 4FM1A 3LDSA 4GC7A 4UB5A 5KT7A 1HUOA 3RR8A 3P1GA 1QSSA 4RW4A 1TGOA 4AHUA 4CJSA 4M3XA 3OYNA 4OGCA 4DTRA 4Q8FA 4Q44A 3DRPA 4F91B 4AHCA 5CY4A 3VQ6A 1K1SA 1B9DA 1XHXA 4JS5A 3G0ZA 5L1JA 2E4LA 3PW2A 1RBRA 4Q0BA 3Q8RB 3IRXA 1WSJA 1S6QA 3ISCA 4DOCA 4KO0A 4CERA 4FJ8A 1PZNA 1RT7A 2JEGA 1RXWA 3RMCA 2WONA 3GIIA 2FMQA 4ECSA 3GIMA 5IIJA 3LAMA 5BOMA 2PXIA 1JL2A 1HNVA 2NRTA 8ICYA 4Z4FA 4H4OA 3WNGA 5DQHA 3IM1A 3SCXA 1R0AA 4RT3A 5KFWA 4QWBA 2F8TA 2P51A 4Z4HA 5KFOA 4DSFA 1ASUA 4B08A 3S3OA 3JSMA 8ICSA 1DOQA 4NLZA 1Y97A 3H4BA 3H40A 2X6NA 3RH4A 1BI4A 4KHYA 4CFBA 4IFYA 4NYFA 4CEOA 5J2BA 5KFRA 5KFYA 1RILA 4TURA 4IBNA 3I8DA 3NAEA 3ZSRA 1ZQSA 1RDCA 4IDKA 3PW4A 4N5SA 3ORYA 3AA2A 4E0DA 2ZTEA 1TV6A 2DFLA 2ZD1A 3DMJA 4ED8A 2W8LA 3MEDA 2DFFA 5DBAA 4I2DA 4OLAA 3HPOA 1SKRA 3SQ2A 2W9AA 1JL1A 4CFAA 4RQ1A 5J0YA 1ZQHA 3HP6A 2ZJAA 3RWUA 2YNGA 3GIJA 1IKWA 5K14A 5CHGA 1FKOA 3PUFA 2I9GA 4M04A 3QINA 2GV9A 4EEYA 5DLGA 3JPOA 4ELUA 3QLHA 4OVLA 1AROP 3AVHA 3TAFA 3C95A 3ZDEA 4ECXA 2VWKA 3VQAA 4QZ8A 7ICJA 5J2FA 4CJUA 3KJVA 1WNSA 4MEXA 5HLFA 3AVNA 3PR4A 2FMSA 4K4GA 4XQ8A 2P5OA 2J6SA 3KLFA 1YTAA 1C1CA 3THVA 2KQ2A 3HSTB 1TAQA 4F5RA 4EBEA 7ICIA 8ICVA 2XCAA 5J0OA 4DS5A 3MFIA 1S1VA 3V1QA 4BDYA 4I2FA 4P2HA 9ICKA 3IS9A 2DFHA 3TWHA 3OYEA 1H38A 1COOA 4TUPA 1N5YA 2NRVA 2PFNA 4LD0A 3RH6A 4BE2A 3OHBA 4PQUA 4FXDA 2W9CA 1RTJA 4PGYA 4LVSA 4DL4A 1HJPA 1S97A 3RTVA 1ZQJA 1ITGA 3E2EA 1CZ9A 3MGIA 1BL3A 3OYIA 2F1HA 4R66A 1QLNA 1HNIA 3NTUA 4OKJA 5KT3A 5IINA 5IIKA 3LWLA 4GC6A 4NXZA 2KW4A 3LALA 5J1EA 1NK7A 2R8JA 5HHHA 3KIOA 3V1RA 4JK1A 2VWJA 2W9CB 1BGXT 5EWGA 3NGDA 3AO4A 3PMNA 4Q5VA 4QZHA 3TABA 4UBCA 4LZGA 1C0MA 5EWFA 3H8JA 2D0BA 3ZDBA 3ZSOA 1NKEA 1RT4A 3PVXA 1HYVA 4UBBA 2MUTA 5D3GA 4QW8A 4ELTA 4M9JA 5DMRA 4CESA 4DF8A 3Q8LA 5DDMA 1GOAA 4CF2A 3DLKA 3HK2A 3L2WA 1EXQA 4Z6FA 2BE2A 2HHWA 4KTWA 1IO2A 4CEFA 3O4NA 1XHZA 3HYFA 4FJGA 3NF9A 4J9PA 3RAXA 4KHWA 3K57A 4FO6A 4ECRA 1MQ2A 5KGWA 1SKSA 2I1QA 1S0OA 3K5LA 1JIHA 4EP4A 2MUTB 1S77D 1L3SA 4O9MA 4KAZA 2PY5A 3QEXA 7ICOA 3IAYA 3ZD9A 4ID5A 2D0CA 4UAYA 3LANA 2HW3A 8ICKA 5CYQA 4CJ4A 3HPGA 1U4BA 8ICXA 5E41A 4E7JA 3RB3A 3QESA 2ITGA 3U6FA 4J9OA 3UXPA 3HT3A 1VSEA 1HMVA 3UXNA 1L3TA 2R8IA 5IIOA 5J2KA 1RNHA 2NRWA 2ISPA 3TR8A 1WLJA 4EP5A 4KLEA 4ELVA 4CFCA 2IOCA 3Q8SB 1RT2A 4RNNA 4KLDA 2X6SA 4DMNA 4CEEA 3G6YA 3VN5A 3NH1A 4I29A 4N41A 4J9RA 2IHNA 1ZQYA 5HRSA 1ZBLA 5KFFA 1JLQA 1EX4A 1HPZA 1S0NA 1T4GA 4UB1A 4DQSA 1T8EA 4PY5A 4RUCA 1DTTA 2G8UA 4R63A 4QZIA 4YR3A 1T3NA 4CJFA 8ICBA 1S0MA 4I9QA 1MQ3A 3GIKA 1LW2A 4DQIA 3BQ1A 1JXEA 1V9PA 4ED1A 2XO7A 4M3YA 1GOCA 2IMWP 4YXMA 4LY7A 4QZCA 3O3HA 5J29A 2XRIA 4KV8A 4OGEA 4B8AB 4N76A 4XRHA 4KLSA 4UB3A 3AO2A 1B43A 1ASVA 5HHIA 1RBSA 1WAJA 3TAMA 5KFUA 1X9SA 5KTQA 9ICHA 4ED6A 4I2CA 2QKBA 3OYHA 5KT5A 1Q8IA 4DTUA 4DSLA 1YTUA 8ICMA 4ZHRA 2W9BA 3M9MB 3DI6A 1NK9A 4BGDA 4IRCA 9ICPA 4CEZA 1NOYA 1QSYA 2HHSA 3MDAA 2EHGA 1ZQBA 3D45A 3TI0A 1SKWA 8ICCA 5J2EA 5KFMA 3SI8A 1UWBA 2X74A 3VQBA 3T3FA 3T5JA 3L2QA 4IQVA 4J9NA 1VSIA 4J9MA 2R7YA 1K6YA 2BQ3A 3EPIA 5EU7A 3NF6A 3NBPA 4YFUA 1BPXA 2BCRA 2FLPA 4CCHA 4DTNA 4MEYA 2IBKA 2UVUA 3AU2A 4IQTA 4LH4A 2W9BB 4KFBA 4KHQA 3Q8MA 3OS0A 3S3NA 4BE0A 1VSHA 1KSPA 2AQ0A 4EBDA 3U3GA 4H8KA 3JYTA 2BGWA 5J2CA 3V9WA 1S1XA 3ZDDA 3CYMA 3S3MA 1SL0A 5F9NA 4M0AA 3KK2A 3AVAA 3K58A 2XY7A 4CHOA 1C6VA 3G6XA 4QZBA 3MEGA 4CHZA 1RT1A 4UB2A 1RTHA 2WOMA 4M42A 4NLNA 4IRDA 1QHTA 4CK3A 5KG5A 3OYDA 5HP1A 4AILC 3MFHA 2IS3A 5KFGA 3OYMA 1WSHA 4FW2A 3M8PA 4N56A 9ICVA 4KB0A 5KFLA 4JV2A 1BQMA 2LYHA 1FXXA 2W9MA 1ZQEA 4J2DA 3AU6A 4DQRA 3JPRA 3VQPA 8ICQA 1TKXA 4G1QA 1ZBUA 3GDXA 5KFXA 2YV0X 2OPSA 4E7KA 1ZQUA 5KFSA 3ISNC 4UQGA 2C2EA 4K8ZA 4QAGA 4WE1A 4W5TA 1QE1A 3C6TA 2B21A 5KFTA 4RPXA 4BXOA 4CIGA 2P66A 3MXMA 4BACA 1C0UA 1K1QA 1Y88A 3K75D 5DQIA 3G6VA 2IDOA 5EOZA 1VK0A 3VQCA 5KFAA 4YR2A 2BHNA 4NCGA 4CGHA 4CF0A 4XUSA 3JPTA 4RW7A 1ASWA 3CG7A 1MC8A 4CIEA 2GBZA 2PFOA 3HVRA 4OPJA 3AVKA 2D0AA 4PHEA 2BGGA 3PV8A 3OYKA 3PX0A 4BXOB 2ZJ8A 2XCPA 3LP3A 3V7JA 3AO1A 4W5NA 1BPYA 3VQ7A 2R8KA 4JS4A 2XHBA 1UAXA 1CXQA 3OS1A 4RQ0A 5KG0A 2XC9A 2ZTCA 3EYZA 1BVSA 1JLGA 4O5KA 3HO1A 3PO5A 2HHTA 1RBUA 4O3RA 3C6UA 4DLGA 3M9NB 1J5OA 5J0RA 1EXNA 4FJHA 8ICAA 5DBBA 4OJRA 3OYAA 4MFBA 3KLHA 4RQ8A 3RBDA 4FM2A 2OYQA 4C8MA 3RJFA 4DF4A 4YFKA 1D8YA 1BCOA 3OY9A 3ZT4A 3ZDAA 1VSKA 4PHPA 3DLEA 3VQDA 4PUOA 3L3UA 1S9GA 3ISDA 1I39A 4Z6CA 4RQ3A 5CJ7A 3NE6A 2BQUA 3SUQA 4YG2A 1KVAA 4KHSA 4KTZA 7ICVA 5KI6A 5J0PA 5DDYA 1CLQA 5HRRA 5L1KA 1D9FA 3EY1A 4UAWA 4FS1A 4FW1A 4I9LA 3HXMA 3A2FA 3KHRA 3VQ8A 1TVAA 4RQ6A 1T7PA 3AVJA 3MXIA 4IQWA
chains in the Genus database with same CATH superfamily
2FBVA 5FDLA 3GZFA 1B22A 3GE1A 3UQSA 2W7AA 3H5SA 3UFCX 4QCLA 1VSFA 1XO1A 4ANCA 3D2WA 4DEZA 1R8AA 4NLOA 4OKKA 2CYYA 3D3BJ 2WHEA 3V6HA 5M1NA 5J1PA 5DM6L 3KD3A 4PKIA 3A3PB 3MDCA 2ZJPQ 1RFQA 1WKLA 4ZCKA 2G4BA 3IHQB 7ICTA 1DTQA 4O44A 5CABA 3DXMA 1YAGA 3WKAA 2J8SA 1HQEB 4DV6J 2PEHA 4CJRA 1CS4B 2WCXA 2W40A 3K4GA 3DAWA 4OMFG 3QB0A 2AJ1A 3PR5B 2ZD1B 3JTNA 5IILA 2C2KB 3EL2A 1SH3A 5J2GA 4AM7A 3ALRA 2KXHA 2OPQA 2HF4A 4PWDA 4NLVA 1A5VA 1T44A 3N4PA 4F3MA 4GW6A 3NKYA 2KSOB 4H03B 3PCOB 5K14B 4X4NA 1QDUB 1G6BA 4HCCA 5E79U 1FVQA 1WHVA 3MTJA 2WVFA 3VQQA 4C1NK 5K4LA 1SXDA 2CQ4A 7ICHA 3IFEA 4U95A 3LDPA 4RW6B 2W41A 2B9YA 1A77A 2KOBA 4F4ZA 3GU0A 3MUVP 5GVQA 5L9XA 2NO5A 1KAXA 4FWQA 4PRFA 3I0SA 3WKDA 3VMFB 1OY9A 3EGWB 4JK9A 3C19A 2UXBJ 2A1JB 4A47A 3CJ0A 2FB0A 1KN5A 5BPLA 1RT5B 3GL1A 2BKNA 4DFMA 3SAFA 2AXTU 2MLZA 3EDQB 3RFAA 5J0TA 2AGOA 2ISOA 2JV3A 3RG6A 2OH2A 4IQXA 1IJEB 3KFWX 3Q8KA 2WHOA 3QT5A 3FSIA 4FLYA 1BISA 2UVVA 3BZCA 2XEXA 4GXJA 3V6DB 4AL7A 2M8DB 2MHEA 2WBMA 3N7SC 1BMQB 3SV4A 3PXGa 1F5CA 4L6V3 1CRXA 4YUDA 3B0YA 3QIPB 3WXIA 2JZBB 2MA1A 1Z2ZA 3WIVA 3KYLA 2GLEA 4PYDA 3CNQP 3CCUS 4Z6EA 3WNFA 2V9WA 5CYMA 5J2MB 2LQBA 4CP5A 4GKKJ 3AA5X 4O3NA 1TYQA 2XMUA 3RJKA 3NMAA 1T0TV 2CG4A 3AGKA 3FGVA 4PPXA 3A5OC 1KTQA 4JNEA 2E8AA 4FNHA 2O4GA 3I31A 1SQEA 1RDDA 1HBUA 2I7PA 4QIWF 4O4GA 1B9FA 3Q8VA 4XIUA 4CYUA 3CI5A 3AVFA 4DFKA 5J0WA 1MROA 2KFYA 3SDEA 1CXUA 1Q7LB 2N82B 2M7SA 3C2LA 2P35A 3TFRA 4NL9C 2WVCA 3C6AA 1FJEB 4IRKA 2QWQA 4OO1J 3SMSA 4EGLA 1JLBA 1PK1B 4K5SA 3BV8A 4USHA 2GX9A 1ZM3A 3CCMN 2AJ2A 4DQ8A 4H0VB 3GG0A 1CJVA 5HMZA 4M9GA 4DR4F 2YI1A 4I4BA 5KFCA 1HD0A 3R5JB 2G8IA 3D3CJ 4XH1A 4WKYA 2LU2A 4CHYA 3FCWA 2P6SA 1NHVA 4ZKAA 3NVMA 5HL7Q 3RMDA 1Q95G 5KL8B 3PX6A 1J27A 3ET6A 3FE1A 1RZTA 3OSNA 1HNZF 4JV1A 5HO4A 2MLYA 4KLIA 4LF6K 1M5VC 2YHWA 3OL6A 4K59A 2BDUA 5FRNA 3VEZA 2DB1A 3DC2A 4KHPJ 4DL5A 8ICIA 1EZZB 2W4DA 5LL6d 4BGBA 2WAQF 8ICEA 3FBCA 2Y1IA 4JI6F 1RTDB 3CDUA 5SWMA 3HW8A 1N32F 4EEKA 4P7TA 4PQAA 3ZDCA 3K5PA 1RT2B 2W2MP 3BEGB 1TL1A 4CIFA 4QWEA 3VGSA 3A8YA 3ZLJA 2YWKA 2ZJQQ 2I5JA 3D6FB 2Q4TA 2PN6A 2W8KA 4CRJA 2UXDK 3CPWM 4C23A 4F3TA 4CJTA 3OYJA 1KFDA 1W7WA 4M6WB 3OGUA 3AODA 1IKYB 2E44A 4I6MA 4YMNA 3NGYA 4YDUA 2FYXA 3DOKA 3NRWA 4PZNA 5AQZA 3HDSA 4ZVUB 5GADP 2MKJA 1RPLA 2KFZA 2R8GA 3MCAB 4HL9A 3D1HA 1X5SA 2M9KA 1UVJA 1TKTA 4W90B 3H6EA 1EKRA 1AB8A 1WCLA 2CXEA 4DTJA 4KLOA 5J0XA 3I4PA 2VD3A 3RJIA 2EPIA 3IGVA 3ULEA 4CF1A 2V8GA 3MWTA 1M1GA 2K7KA 1TVRA 4OX9F 3WHIA 4C80A 4DR2K 2OANA 4PWUA 1ZQVA 1HQUA 1VGYA 2IM2A 4PHAA 3BZQA 5JMNA 4UZBA 4NLKA 1X5PA 4EENA 2BCUA 1HUZA 4FKYA 3CE8A 3SD7A 3I56N 2Q3SA 4QZFA 2JEJA 5KPZA 4BRAA 4GLXA 3JTPA 1XMOK 4X4RA 4BDZA 4F3QA 3AQPA 2B8QA 2DUYA 2GWKA 1OMSA 3HP9A 2VQEF 2HBLA 4CNQA 4FZMA 4CEAA 2DPNA 4DSEA 4F50A 4QIVA 4DUZJ 3JAMU 3QIOA 2V51B 1K8KB 3KFUF 4MHVA 2KHCA 4KLUA 1WSRA 4KLQA 3F9MA 1Q8KA 4DJBA 2IM0A 4UB4A 9ICBA 4ZH4A 5DG9A 1FO1A 1SZHA 3D6HB 2FBXA 4KITB 3BB5A 3SMVA 3MX5A 3H1VX 1Q86O 1LFWA 3THTA 2KHDA 1N5TA 2DJWA 2OEJA 2ZXIA 1CJUB 3VAJA 4B3OB 2VOPA 2V6AA 4R8UB 3CF5L 4WWSA 3J80Y 1DT9A 1FI4A 3O4QA 1MSWD 1JMTA 1YJUA 2NPFA 4QZDA 2YMLA 3C66A 4DN9A 4O3SA 1T02A 3HVTA 3L2RA 3GFYA 5DB7A 4C0OC 2MZSA 5HP1B 2DXDA 4BDPA 3O3LA 3R1HA 1VK3A 3CVKA 1I5OB 3L3VA 2XLIA 3IG5A 3IM8A 2QWMA 5L1IA 2FBTA 5AK4A 4XDCA 4DV2J 4F71A 4IUFA 1R59O 3VA0A 2XTJP 1RDRA 1RE1B 3BKFA 1MN8A 1RAFB 3VEOA 5DG8A 1ZQDA 9ICSA 3JPNA 4DLEA 3N79A 3TA0A 4X5VA 5IT9Y 3PACA 1NJIO 3K2YA 1GLAG 3D2EA 4DV1J 4K42A 4NM1A 2VPYB 5ALTA 1WC6A 1XWLA 2OAUA 4DV5K 2HVHA 4DUZF 2RHQB 3TUPA 5C15A 3D2NA 1WHXA 1BY9A 3US5A 4GKJJ 1S1UB 1LK5A 1LAWA 9ICNA 1RK8A 3G8TA 2W2NP 2HQCA 3TVKA 3W3DA 3H08A 4AHRA 3VZHA 1KONA 4NV0A 1YJRA 3PYEA 4E7IA 3BS5B 2FZKB 4TSXA 5AKYA 3PKYA 1KFTA 1IXRA 2VG6A 1N36K 3PNIA 2RS2A 2ZJ5A 1VQ4S 2MSSA 4FWLA 2RB7A 1Q18A 2XG8A 3BKTA 4JI3F 4B1UB 4RUHA 5BN9A 2EC0A 3CMAS 1J5OB 2LSNA 5M1PA 2IRYA 1UCVA 3T9ZA 5AQXA 3PFOA 3GWCA 1NXIA 3KLHB 1G1XA 4WIQA 2NCKL 3G96A 2QLFB 2LP4A 4DV7K 4Z4IA 1BPBA 1GMUA 4P0QB 1UW4A 2H3IA 2MPUA 1NJWA 1NWKA 1FEZA 3N28A 1K8AT 1N60A 5B0GA 3LO3A 4FZNA 3I4HX 1RG6A 3LA0A 1ZETA 3M6ZA 2FHJA 4JRQA 4Y00A 1PUZA 3PIOQ 1YJTA 4URQU 1QQ7A 3MBYA 3ENAA 1Z3EB 1ECWA 2APOA 2DIVA 4CJEA 4E7HA 3IG1A 3FC9A 3LP0B 3GIRA 1RABB 2ZE2A 4JKGA 1U8SA 4NMXA 3TOQA 2CPJA 4Y2KA 3PDNA 5BYRA 4DSKA 3TUIC 1N34J 2CPEA 1F9HA 3G87A 1RAAB 4UW2A 5IT0A 2ROEA 4WFZA 3O5BA 2E2NA 4KPYA 4CO3A 1T3OA 4HUFA 4CBXA 1N63A 3SUOA 2BTFA 5AI8A 2HNYB 1JMSA 3WK4A 5C24B 2DHSA 3Q8YA 1DGSA 1O03A 3N97B 2DISA 4BC5A 3NG8A 2CADA 3FEXB 1WBDA 2D8CA 2BH1A 2VG5A 1FK9B 4LRCA 4L3QA 1H7WA 2RN2A 1IWGA 2BRLA 3NS5A 2HHXA 3BO2A 2PFPA 3V9ZA 1IH7A 1VRQC 1XC9A 1HRHA 3CHWA 3HOSA 1XNQJ 3TAGA 4KLFA 2YWGA 5AM3A 3S1TA 4ANDA 1YRXA 5IV4A 4MQ3A 4ZCMA 3L5KA 1QQNA 5J2NA 3FRZA 1AQ6A 2X7IA 2Q6BA 3ZT0A 3RAMA 1JNRB 4FL9A 3G8QA 4TUSA 3D0GE 3CEDA 5ETQA 1WG5A 4F4KA 2WSCC 4E98A 3DOLA 4RCHA 4E89A 4NYPA 1IN0A 2G8WA 4AE5A 1ZOTA 3M2UA 1X9XA 4QYRA 3KD5E 3VAKA 4ITSA 4FK4A 2RDJA 2HAIA 4ZJQA 1OQ6A 3ZT2A 4ZTJA 1U1QA 2YH1A 2HVDA 2X51A 1DGJA 2KYZA 2W6KA 3TAEA 1VQ6N 2BJ3A 2OWOA 3ID6A 1SV0A 1W7AA 3T1HK 4GV9A 2QA1A 3HKZC 1Q53A 1VQPN 4IKAA 2ACYA 5J0SA 1EARA 3CD7A 2J7WA 4KKOA 1VQKS 3WK6A 2PI4A 1NCLA 5FRMA 1U9LA 4NASA 3A4TA 4OZNA 1EQYA 2DK2A 4DUYK 3AT1B 1VRTA 8ICRA 1RYSA 2OMLA 3A1YG 5KQDA 3T19A 4DTPA 5H1SQ 4LF9F 4TQRA 1RA7A 4DPUA 1Y10A 2P9UB 3NDKA 5ALQA 3NGZA 4K0KK 3C94A 3H2LA 3DYAB 5BN8A 4RQ7A 2D1KA 1XNQF 3V6JA 3AVGA 2ZHOA 2JEFA 1AT1B 3V81B 3VA3A 4P73A 4CJ5A 1NU4A 2Y8YA 2RKIB 4DV4F 1T05A 4C7QA 1REVA 2GHVC 2YTCA 4FPBA 4OX8A 2DY4A 5JVGL 3PYDA 3MAHA 3KLIA 3SDEB 3KLGA 3IR5B 1A5WA 1ZQXA 4NXMF 2QL5B 3B6PA 4LRDA 5ADZA 3WX4A 3V7LA 3PW0A 1VHFA 4FJNA 1W2BR 3FBBA 4MT1A 3MPYA 4FSVA 5AICA 4C3KA 1ZS6A 5IM0B 3WXMB 2BE9B 1N4LA 5EX3A 1WOPA 2XY5A 3F73A 2QXFA 3MMCA 2A41A 3OL9A 1S1TB 1XSPA 3M3ZA 3HJEA 3VEXA 1KLMB 1NGDA 1HBOA 1Y3KA 3QNOA 5DGBA 5D4NA 1PIEA 2H3EB 2A19A 2CQDA 2A1SA 2OPRA 4PGXA 2FVRA 2DNGA 4B9VA 5DO2A 2VG7B 4ZITA 1RT3A 2AGQA 3R1XA 4ID8A 4QS8A 4RW9A 2RF2B 4OJHA 4CK1A 1FDNA 1O13A 2KKZA 4IG3B 4OJ6A 1DRZA 3VESA 4YOTA 4OI3A 4U67L 1ZRMA 4O23A 3GJTB 3C15A 1JCEA 1RA6A 1NDLA 2VQFF 1S0VA 1C0FA 4EFAC 1VQ8S 1P8ZA 3AB2B 3KK3A 3DLHA 2HRYA 3GB0A 1XI1A 4LFBK 3E8OA 3ZX0A 4TNOA 5F8IA 1WSGA 2VU5A 2LVWA 3VPZA 3HZ6A 4WQ4C 2LYAA 2OELA 4FYXB 2HWIA 2GO8A 5AQTA 3GG1A 3B9JA 1IM4A 2I5JB 2MHNA 3UI3A 1TFRA 4ECUA 5AJ3J 2NRHA 5BRDA 4V1Ak 1J5EK 1HHQA 5ALMA 5M1QA 9ICTA 3KHGA 2E1MC 2G1DA 3CJQA 5JU5A 2DY1A 5C42A 1QVGM 5L9NA 3JPPA 5H9FJ 5KNIA 1XQIA 4HVJA 4LIRA 2CJAA 4ZLLA 3THXA 3BSNA 2Q0UA 5EOYA 2AQ4A 1UETA 1BG3A 1CULA 4A61A 4IFVA 4DU8A 5KG3A 1LWEB 4CJ3A 1ZBIA 1HIYA 1Z1VA 1R8HA 1WORA 3C5FA 3EPGA 1LWCB 2OA8A 3ULEB 4BUGA 2K1RB 5IS2A 3VALA 5KFIA 1SUQB 4CM0A 4HH0A 4C6AA 1VSMA 2ROPA 3G4SS 5HMLA 5JUMA 4PYAA 1TVRB 4YDDB 1TUVA 3VEWA 4PG7A 1WDDA 5EDWA 1QZ6A 3M8WA 1XSLA 5AKIA 3AY9A 1I3OB 3CT9A 1XO0A 4HHTA 1RAGB 4IL6U 1FFWB 1MU2B 3U1MA 1CC8A 4DQPA 1YBTA 3RH5A 4RTFD 3M8QB 2IVYA 4OI4A 5IC6B 2DH9A 2MRLA 4RNOA 4OFZA 3DN9A 5CH7B 3OLBA 1YJ9S 1I6JA 2BABA 2HSZA 3DLRA 1VBZA 4WCEQ 1UJ5A 1OO0B 1S76D 2OFGX 4YCXA 4AT1B 1EP4A 1S48A 1Z6RA 4IEIA 2N4DA 4GFJA 3M6WA 2CQ0A 3BY5A 1YBUA 2W3RA 4O0JA 2CNLB 2E6MA 3IP4B 1OH5A 4FCYA 4FJLA 1XSNA 3I0RB 4CHNA 3WQTA 4DG1B 4MO4A 2EX3A 1S22A 3BPDA 3GBTA 4W5QA 3KMSA 2Q97A 4DR7K 2PMZC 2GQCA 3CDBA 4LIWA 4QZGA 1FA0A 2MKYA 1VQNS 1NKBA 3WK5A 2KT3A 4C0HA 3NCPA 4ZK7M 3CCQN 4YQWA 1N33J 1F2GA 4W92B 2IAJA 4C48A 1FRKA 2IY5B 2BPGA 4QWAA 3R9PA 5KT4A 3ULDA 1ZQFA 2ZH1A 5AM4A 4H0TB 4K8XA 5ALIA 1HR0K 1QD1A 2K3IA 3HHLC 4E3SA 4C8NA 3HVTB 1N5QA 2M5YA 4LQ3A 4K8RA 3CO0P 1YVUA 4DX8H 3TO8A 4H4MB 1IBKF 1ZAWA 4NLCA 4B1XB 1VC6A 4ZP7A 2YX1A 1JLEB 4RW4A 1TGOA 4BG8A 2LXFA 3I76A 5LJWA 1C0TB 3Q0AA 3NGRA 4Q8FA 3D2SA 4F91B 2L3MA 3EXYA 5CY4A 4FN5A 3M6GA 1K1SA 2G1HA 2OPPB 3KNGA 2O8DB 2HGMA 1OIAA 3QJLA 3IRXA 2EFGA 3DXSX 3W64A 3ILLA 1S6QA 3T6JA 1GX6A 4FPRA 4CE6A 1PKUA 2JEGA 4MIBA 3QIDA 4JI5K 2K4PA 1RXWA 3V4MA 4PEOA 3C14A 3JAMO 3CJTA 2QN6B 4LFCF 1GLJO 3MGVA 3GIIA 2JOQA 1HBMA 5BOMA 1JL2A 3J7A1 3GLJA 4H4OA 3WNGA 3IM1A 1U24A 3DGPA 2P51A 4D3HA 1ASUA 4Q0BB 1B4FA 4B08A 2DCLA 5I4MA 5GTHU 1QM9A 4DR1F 1DOQA 1RT7B 3H4BA 3H40A 3UNGC 1FNXH 1BI4A 4KHYA 4DHYA 1B0PA 1N33F 4Q2MA 4WJBA 5EE3A 4IFYA 5AZJB 2Q31A 1YJWS 4CEOA 5T41A 5AM2A 3AA8A 2GIRA 4H0YB 5KFYA 2Y9UA 3HSGA 1TUUA 3ZSRA 5HANA 3MPWA 1RDCA 2RAQA 5EX5A 2DRDA 2HFOA 3ORYA 5HVGA 1OQ3A 2B0GA 3U27A 4X84A 2P9SB 4ED8A 4OZ2A 2ZM6J 1Z4OA 4QIGA 2FJBB 2LM1A 1KWMA 3C16B 4WF9Q 3MURP 1NI3A 1X6JA 4DV3J 1ZQHA 2ITMA 2O66A 2LPEA 2ZJAA 1B64A 3GIJA 3FLCO 4L3NA 5LOQA 2J9DA 4BRQA 2I9GA 1VI7A 3GFZA 3D67A 4AF1A 5EGYA 2ZBIA 3JPOA 4FO0A 1VISA 1AROP 4PZOA 1TV6B 2OTLS 3EUB2 3AVHA 1APSA 1FO4A 3UKUA 2FZCB 3AA9A 3TZYA 3IC1A 4WFAQ 2GGPB 4QZ8A 4CJUA 2J0XA 4TLQA 4CO1A 1QZ5A 1CJKB 2DNNA 1UPMB 2VBWA 4DV0K 4M63C 2EH9A 3IBPA 2CZVC 3OUYB 4ZN1A 4NE9C 5F8JA 4EO6A 3HKWA 4ZLNA 5F1XA 2FC9A 7ICIA 5AI5A 2W3SA 2BXJA 1W25A 4W4MA 4U7UD 5BPMA 5C10A 2HK3A 4C3MA 1X4CA 1COOA 2J4RA 2E9RX 3R9KA 4LD0A 5HLFB 4BLGA 4IEEA 2W9CA 2ASYA 2N3OA 4LVSA 2BUNA 4DL4A 1HJPA 3IAM9 4ZVFA 2LQ5A 1ZQJA 2QL7B 4QR1A 3E2EA 1CZ9A 2DVIA 3AD7C 3THWA 1BL3A 2RVJA 2F1HA 1QLNA 4RPFA 3O4WA 2KK0A 3NTUA 2OP5A 2ZM6F 2G0CA 1FIQA 3WK8A 3OXGA 3ZTRA 3IS9B 5IIKA 4GC6A 3EKSA 4NXZA 2G09A 2C3UA 2KW4A 1QUVA 1FESA 2H4WB 5AQPA 3FC4A 2R8JA 3LGNA 4DV3F 3KIOA 3V1RA 3WKEA 3SCIE 1HNXK 4PQUB 2J8AA 1NDPA 2VONA 2DWQA 1BGXT 3PFEA 2IIHA 3NGDA 2KRRA 2V8DA 3G82B 1BNPA 1URNA 5AKLA 4I6YA 4LZGA 2A1BA 3MD3A 1C0MA 4KJIA 2VPXB 5CE3A 3LH2S 4QOTA 3WBZA 3ZSOA 4MKVA 1RT4A 3PVXA 1HYVA 1C20A 3FZLA 4TY8B 4QU6A 5DMRA 4NRTA 5B0CA 2ZH2A 1GOAA 3CJ1A 3ILOA 4ZP8A 3L2WA 2H5EA 2H51B 3VAGA 2V63A 4CEFA 2A10A 2I1RA 3POTA 2ZIVB 1JJHA 2CGKA 4KQZA 4C4WA 3K57A 3CC7N 3AL0B 2JZ5A 4ECRA 5F0UA 1Q7YO 4QBUA 1MQ2A 3AGRA 3K5LA 4USKA 2VYPA 5AIAA 3EVOA 3I32A 5GMDA 2PSZA 2ZUAA 2YBVA 2K2PA 4MN4C 2C2OB 3FUYA 4KAZA 1U0HA 3IAYA 4R25A 3UKRB 2GZOA 1SQKA 3SMPA 4NXNK 3MK6A 2CVEA 2MTLA 4UAYA 2A6MA 4ILMA 2K60A 2HBKA 4YY3K 1GXTA 1E3MA 2ZJRL 1KXPA 3F5AA 8RUCA 1R27B 4A59A 1XNRK 1NNEA 3QESA 2ITGA 4DKWA 2KHQA 3TWZA 1I94J 1SIJA 1HMVA 1RBLA 3CGIA 1H2VZ 4DZ6A 5J2KA 1E6VA 3O44A 4B1ZA 4OI6A 1RKJA 3TTCA 2HOEA 4E2FB 3KLGB 2QA4G 1SC6A 3EE8A 4Q2LA 4ID5B 1KHWA 2NO4A 2E5LK 2CRLA 2G08A 2YMMA 2IHNA 1Y9OA 2A3ZA 2CH6A 5JJBA 1MA9B 2AD9A 2DNYA 4F04B 2O8BB 1HPZA 1PC5A 3HBTA 4FWSA 4R63A 4BC7A 4KT0C 4OJPA 4QU7A 5ALFA 2XYPB 4CZLA 4I9QA 3SR6A 5BJRA 4C0ZA 4ILHA 4CH7A 1LW2A 4M5GA 4I67A 3BQ1A 3TTFA 1X9JA 2HYIB 1V9PA 2XO7A 1PO6A 4M3YA 1YBAA 4X65J 1RT3B 3NCRA 3F2BA 4LY7A 4B3TK 1FFVA 5J29A 1JLQB 1A7GE 3F53A 5GAEP 4KV8A 4FYVB 2VODA 4KLSA 5GINA 3HZEA 1B43A 1JI7A 1M90T 3DLLL 3I28A 3ETMA 1IQTA 3MCNA 1NH7A 5FP0A 9ICHA 1PJ5A 2HFUA 3ZEUA 5HR7A 2V50A 3HM8A 4I2CA 2RMLA 4NLXA 2RUSA 1XBWA 3KK3B 1Q8IA 2I2YA 4ERDA 4X4VA 3TRGA 2EVZA 4JKFA 4B3RK 4DSLA 2UUAF 2KJVA 1KD1T 2W9BA 2EQYA 4CZMA 4IRCA 9ICPA 1NOYA 3CCZA 1ZD5A 3HHKA 4LF8K 1ZQBA 3D5MA 4OJ5A 4JI8J 2D3ZA 3W0LA 8AT1B 4IQVA 1VSIA 4IH5A 1WC5A 4LRFA 1NGFA 3I6PA 1K6YA 5IWAJ 3KHYA 1BPXA 3M30A 4ZHRB 5C42B 3NVVA 3DLJA 4B1VA 4JD2B 2IJNA 3DI6B 3TTDA 2CVIA 4LBPA 4EBDA 1Z1ZA 4A62A 5KAFU 1CULB 4IFVB 1S1XA 3P4UB 1PCAA 5L8RC 4DPYA 1NMEB 3OR1A 5DRKA 5F8NA 3KK2A 4TXSA 3AVAA 3K58A 3RYLA 3H5XA 2XY7A 2R2TA 2MB0B 2WF7A 1V3SA 2GA7A 4JI2J 1WBBA 4QZBA 3MEGA 1YWXA 4CHZA 3PLAA 1RT1A 3TPQA 2YPZA 1JWWA 2WOMA 4XK8C 2CGLA 4NLNA 4DXLA 4P52A 5KG5A 3MFHA 1IBMJ 1BWVA 4FW2A 4EO8A 4N56A 9ICVA 2E8NA 4KB0A 3ZTPA 4A46A 2LYHA 1HL6A 3K89A 4LUBA 4IS7A 4J2DA 1Q82T 1TKXA 2OPSA 1U8WA 3KG0A 4CM2A 2PT0A 2MJUA 4KIAA 3ISNC 2YCHA 4UQGA 2WVDA 3J7Z5 3B8AX 4K8ZA 2HAFA 1YJNN 1RTHB 1WSVA 4QR0A 2B21A 5KFTA 1VQ9N 3KG1A 3G8SA 1DHMA 4CIGA 2ZVSA 3ZNUA 3AN1A 1C0UA 2L9DA 1K1QA 1GEHA 4OYOA 3D28A 3G6VA 2DKXA 4JI8F 3NNCA 3HHLB 2P9KB 1VBXA 1ZQ1C 5JVHQ 1LVHA 3CNHA 2B9XA 4CF0A 4XUSA 4OQJA 2MGZB 1UVMA 2IRUA 2JGAA 1MC8A 4CIEA 5IWAF 2PFOA 1Y7PA 4P6QA 3UN5A 2ZH4A 3MMJA 4MO5A 4DR5K 1N88A 2D0AA 3PSPA 4J9UE 4EK2A 4PHEA 4WE1B 2YMQA 2BGGA 1QE1B 2W24A 1LKYA 1TFWA 3OYKA 1SWWA 3CC2N 3M1YA 2J9DE 3LP3A 2RQ5A 4W5NA 3VQ7A 2R8KA 1QVFR 1V5VA 5KG0A 2ZTCA 3HKZF 4O5KA 3HO1A 3PO5A 1UQVA 2HHTA 2BJDA 5CRXA 1S12A 2L5YA 1RBUA 3UO0A 4O3RA 2DCUB 1UJ6A 4DLGA 2PE8A 3IFRA 1AZSA 1YHQN 4RUBA 4K43A 1SGGA 2UUBJ 4MDBA 3ADAC 3VR1A 4YOYA 3BBFA 1K44A 3BBBA 4FM2A 4DF4A 4KBOA 2VH7A 4JHDB 3BO3A 4PHPA 3KVGA 3VQDA 1EB0A 3UMGA 2RQMA 1S9GA 3ISDA 4NO7A 4WFBL 5AE1A 4CO5A 4P0PA 4YG2A 3EX7B 3NGTA 4QR2A 2XMWA 5KI6A 5J0PA 2X1BA 5L1KA 4LR9A 1T9YA 3J7YP 4FS1A 4YHHF 3HXMA 4A48A 4FW1A 4DV6K 3KHRA 1BC6A 4RQ6A 2ZH3A 3ZX2A 3MXIA 3C14B 4IQWA 2IOHA 1OH8A 7FD1A 3ZSQA 1HBMB 5CZXA 5L39A 2PMWA 2VOOA 2K06A 3FGUA 2BCQA 3QXGA 5C12A 4A8QA 1WSIA 4PUOB 2N7YA 1WD6A 4G6VB 4M7XA 2SXLA 1SC1B 1NK0A 4M95A 4OI2A 1KNZA 9ICIA 3DGPB 1KQFB 2E8MA 4MKYA 3U4LA 3FCVA 1JLCA 3ITHA 3MEKA 5GMEA 1T9WA 1BI4B 4WPAA 3ZT1A 3AAWB 4IFYB 3GV5B 4KHMA 2DHHA 1BDGA 2AEMA 3EXCX 3BQ2A 4YN4A 8ICZA 4Y6IA 2Q1NA 2FZGB 4FWNA 1RWMB 4AH9A 3DNCA 2UXBK 1B92A 4GV6A 4Z7YA 1SIZA 1YKWA 1ATSA 2ZXHA 4CFDA 3VAFA 2HIYA 4KREA 4H0OA 1ZQZA 1U09A 2HQGA 1RHJB 4JKBA 3SUNA 1VQ7S 2OEHA 1RBTA 1Q8BA 1EWQA 2DH8A 1BIZA 1XC3A 3ID8A 2DR8A 3KWGA 2DXFA 5F8MA 4JN4A 1BLUA 2ASDA 4BC9A 2RS8A 2HPUA 2FPMA 3UNYA 5M2PA 3SPYA 5DS7A 5AI9A 1M1KO 3RBXA 1MMDA 4NYOA 3OW2M 1JRPA 1YJVA 3UKUB 3ICXA 5CD4H 1G15A 4IH6A 3WU2U 1UFLA 1HD1A 4CD3A 4GKKK 9ICEA 5GIPA 4GVMA 4RJVA 1DXSA 4ES1A 4CJKA 4I2QA 2JHDA 3CUNA 4M9HA 3EKUA 1NDKA 1TL7A 3P39A 3DFEA 1WELA 4W5OA 1P1TA 2MQ8A 2K4EA 4K4VA 5KFPA 5BPCA 4F5NA 5D49A 3WK7A 4CLPA 3RBEA 1G99A 5BR9A 3PIPQ 4ED5A 5KT6A 4XH4A 4BE1A 1NM2A 4FJXA 2HOFA 5D8HB 2FLNA 4O5EA 4NA1A 3HZGA 3GFXA 3BJYA 3KG4A 2G06A 3J8AA 4OZ3A 1SV5A 2V4QA 3VQ9A 1S6PA 1UEUA 2KU7A 2EK1A 2F7TA 3ETOA 3HWTA 5K8MA 2KM8B 5B7WA 2P6UA 3QO9B 3J7AN 2CQGA 3NRZA 1EETB 4RUAA 3CJBA 4I7FB 1TP7A 1QQCA 1RAIB 1ZQQA 1IM6A 3BR9A 5FPEA 2I6XA 2RRNA 1DQAA 2JFKA 2GMHA 2NQPA 3TANA 3PTWA 5DDRC 2ZIUB 3DRSA 5AM5A 1N56A 3QUQA 4K41A 3K7RA 3A12A 1VJ5A 3MUTP 1GLEG 2EG1A 1UJ4A 3WC2A 4L75A 4KI4A 3RSEB 2ZHBA 5EE9A 5A8WA 2P5GA 4P4MA 4QIWD 3H7IA 1QQ5A 4F93B 1VSJA 2HNZA 4KHPK 3LP1A 2FVPA 2QEXS 1RTIB 1WTFA 3FQKA 1RGIA 4JI1J 3H8MA 2MQQA 2GH1A 2PC6A 4B3SF 4DR6J 1WEYA 1U25A 2R42A 3FFIB 1YTYA 4M3ZA 4OIXA 3G6ES 3UDEA 3NXZA 4ED0A 4CLWA 1M5OC 4CZIA 5A8KA 4X4PA 3SPZA 4LRBA 4JK7A 2PMZF 4L8RB 4Q43A 2E1RA 1WNEA 3VGLA 5ALNA 4BVOA 3D0IE 1KL9A 4KTQA 1VQPS 3DDIA 3M8YA 1Z26A 4NPOA 1ZQOA 3BDPA 1DY3A 1GOBA 5ALGA 1L7MA 2JLGA 4CGJA 1W2BM 3H4DA 4YD2A 4C1NI 1SWVA 1HI8A 3NLCA 4ECVA 1D8BA 3SEOA 3OYCA 7ICKA 4X4QA 3TVYA 2V2ZA 3BQTA 1TAMA 1ZPWX 2OZMA 3FJ2A 4F4AA 2KLAA 3G10A 5M1KA 2F8SA 3EGNA 4OJLA 3CCSN 2B4VA 2HGLA 3O9QA 2BDPA 1XR6A 3CW2C 2R7TA 1FEEA 2MDAA 4I2IA 4AXJA 4AHVA 1HKGA 4GVBB 4PXBA 2YHAA 2BQRA 1AW0A 3K9KA 3HSZA 2D9PA 5TKYA 1HWUA 4CJLA 5HMYA 2K8BB 2WAQD 5CA5A 1DEJA 2FPKA 4FF2A 4F2SA 4Y2SA 4H5NA 2BCVA 4BR9A 3M2VB 1WG4A 3RB4A 3H42A 2YHXA 3HL8A 4JWMA 1Q9XA 4M5MA 2MQOA 4URGA 2WBNA 1LEOA 1NGIA 5CAAA 2QWNA 4FWMA 1NRKA 1BE4A 3MMAA 2IA6A 2W03A 4BG9A 3OYLA 3QBXA 2UV8A 2LEPA 2YNIA 4IXCA 4QJVA 3R97A 5T7LA 4CK2A 1U45A 1UHUA 3N4MB 2V8PA 2ZBRA 4DUZK 4B1WB 3AOCA 1S7IA 5DG7A 2PYLA 3FQLA 1JROA 1F2HA 3NUQA 4X4OA 2V8VA 3V5RA 2OSQA 2LXIA 2HHUA 3GFKB 2CNNB 1GNKA 1FXDA 2O4IA 4KLHA 7ICEA 2MAXA 1WC4A 5ADXH 3EE3A 1XMQJ 2P6RA 1KQSR 2F44A 1NGHA 3CCLN 7ICNA 5J2QA 2ZH5A 2E7VA 3THYB 3C2KA 5CA7A 4HTJA 4BR7A 3RJGA 1JLFA 3VF4A 1D8ZA 4TU9A 1JB0C 9ICUA 3K1RB 2G2OA 3VCBA 1RYUA 3NWRA 1ZJMA 2HOIA 1RU1A 3DLGA 3N7RC 1FE0A 3IG8A 3LP2A 1ZA2B 5AQLA 3TJ9A 2KVQE 2CQBA 3MM8B 2MZ1A 4PKDB 1OYEA 3UCGA 3DLBA 3RW6A 4P2FA 3W8PA 2FVSA 1FTRA 1Y5IB 4DV2K 4FLXA 2CA9A 4ZPTR 3BZKA 8ICUA 2AYGA 3EICA 2ATQA 2P9LA 5A2QU 3CJ2A 3BKUA 5AI6A 2BANB 2NLWA 1MN9A 4JRPA 3S8SA 1IVZA 2ZUCA 2DRAA 2QWPA 4BQLA 2M0GB 2C3MA 2O8FB 2KI2A 3CDEA 3ATVA 1S9EB 2ZUGA 4DV1K 2FHJD 4J9LA 3U8XA 4K50A 1RT1B 2KYXA 1X4HA 2AJ4A 4KH0B 3PJXA 4RPYA 2V5HG 3QEAZ 5LMNJ 4GKJK 2W6LA 1GTHA 3SIPB 1ZQWA 2QWLA 5BOLA 5A8RA 1Q81T 9ICAA 1KCFA 2HMIA 4WJ3B 3LPTA 3FAHA 1RCHA 2H5JB 5D4PA 1LOTB 1Q9YA 3D2QA 4ZA1A 2PI5A 3HFZB 1VAZA 4K4HA 1HARA 3OA9A 3AVMA 2BJ7A 5T7BA 1RWPB 1ZYQA 1Y11A 2Z58B 3O0FA 2UU9J 1NGJA 2JGUA 4ETZA 4JI4J 1XTZA 2K8AA 3LW5C 2OYYA 3D6RA 1U6BA 4IQUA 3SQ0A 3ZSVA 4F5PA 4PCQA 1J2VA 2XYHB 2ZOMA 1U1OA 1Q3UA 5CB1A 5KPRA 5DBCA 2YNHA 2W42A 2B9WA 2N4CA 3KK1A 4RPZA 4Y1CA 1LKYB 4Z4EA 3MWBA 3D2FB 4AFFA 5DZ7A 5KFKA 2D0OA 3O1WA 2BX6A 4CTAA 4XDDA 1RAOA 5CZ1A 1WYGA 3PX4A 4PA1A 1PYTA 4OLPA 2W4CA 2XIDA 1Y4ZB 5A0YB 5IV3A 3KBBA 5FLXU 4KGZB 1ATNA 4FVCA 4DL7A 3MTKA 1AZSB 2AJ0A 3C5GA 4M9LA 3AD9C 1RWVB 3SXLA 3AVIA 2BJ1A 1T03B 1RDWX 3KLEB 1N34K 5I3PA 4ZOSA 2VA8A 3O8MA 4CGGA 3AO3A 2BE7D 3OR2A 2XGQA 4FXWA 1Z00B 4FS2A 4HUEA 3DGVA 2B5JB 3QWPA 3TX0A 3NMRA 3BN4A 5I3UA 3DXBA 2PAVA 1TQLA 1CG2A 2MY7A 3L0QA 3I9V9 3QT6A 1F3VA 2Z1IA 4M5HA 3HHEA 1M5KC 2HKEA 3AA4A 1S1WB 2OHDA 4ZCLA 2E3TA 1Q86T 3KKSA 4E8UA 3MM5A 5F3TA 3LM9A 4KLGA 3J81U 2AGPA 2J0WA 3DHXA 2XZWA 3IUCA 5LJ5Y 8ICWA 3W65A 5ALEA 2ZEJA 3RJJA 2GVDB 1HBNA 1XNQK 1LWFB 1FTCA 4OPKA 5EN1A 4ICLA 2JC1A 2R7QA 5KFJA 2IHR1 4OHYA 5HSPA 4BRDA 4M5DA 3TEGA 5B0EA 1OH7A 2GC8A 3ZETB 2XWYA 5A76A 3OBWA 3U1LA 4CF5A 4O3MA 4O5BA 4GO7X 1NLKL 1WG1A 1CVJA 2BKPA 5KRTA 3MM9B 4RT2A 3A5LC 4UATA 4QPTA 2Q6CA 4TYAA 3DXKA 1B7FA 3Q8QB 4OX7A 4OYWA 7ICRA 2ZIXA 1C1BA 2O8EB 1RZMA 1B0XA 4BRPA 1PBAA 3W5ZA 2YKOA 3V4IA 1IQZA 1NJIT 5AK5A 1KFSA 3C1ZA 3IM9A 4XO0A 2GMJA 1CUKA 3PRBA 3OV7A 1Y5NB 2VBXA 1N6QA 2E7WA 4OV6A 1TK5A 2O3DA 4WFNL 1TAUA 1X0PA 3VGUA 5DKWA 2VL1A 1JXBA 4YNQA 1FKPA 3V9XA 2KN7A 1KRPA 3DM2B 2Z1HA 2OTJS 4FXVA 5IFMA 4HI2A 3U3YA 4ECYA 1ZRNA 3N5BA 2DNMA 3VQEA 4DCPB 2X1AA 3K59A 3H8YA 1WAFA 3QUCA 1JLAA 2AJQA 2WF6A 2B4PA 5KGXA 3DRRB 4X66J 4I2QB 1R8BA 4IOAL 2ZZTA 3A0HU 1FRJA 3L2UA 4IQMA 4NLYA 5A2QY 3T5LA 3IR6B 3H25A 4B17A 4MKBA 3E58A 4X2BA 2HWTA 4KLJA 2FSKA 2ILYA 1X5TA 2QA4N 2GTDA 1YGYA 2JEIA 2DNQA 4I2GA 2B7BB 2F9TA 4MAKA 1NHUA 3L3FX 3M6UA 3P8BB 1FDAA 3BGRA 2HHHJ 3MM6B 3DDNA 4K4WA 3BP8A 3W9HA 1M1HA 5DB6A 1U47A 4XAKA 3O08A 5CWRA 2V52B 1FXRA 3K2PA 3CCRN 2KJ9A 3M6VA 4ID1A 7ICSA 4A8FA 4LRAA 4UB8U 2Z56B 3PEJA 5DGAA 3C29A 2DNHA 2B6AA 1UFWA 2DGQA 2YKMA 5F2RA 3HX0A 1YITN 1J2NA 3LDAA 2L9WA 2YNFA 4FNIA 4HDGA 1D4XA 3MAQA 5KOWA 1PVPA 3K5MA 1QHAA 1T11A 4KLMA 3O6QA 5HNKA 2YKAA 2R7SA 2VPWB 2ZWOA 3VENA 4FZXC 5E3AA 1JJ4A 3OTOJ 2C28A 4YN3B 3QGGA 2EFQA 3GE9A 5EY4A 5AQMA 1S72N 4KAIA 2V2VA 2HLUA 2IFXA 4KN4A 5D4LA 5A8WB 4UB6U 3ED5A 1U2CA 3EN9A 3LPYA 1UVNA 1L6NA 1V5IB 3LP1B 4PHDA 3WUHA 1DLOB 4KGMA 3CQXA 3VQSA 1ZBFA 2E1FA 2V2QA 1KVBA 3UQ0A 3ILIA 2FBYA 3U26A 4YS2A 2KZ3A 4LC9B 4WZMA 5ALHA 3MR6A 2UVWA 3MAAB 1LW0B 3JSRA 4B8CA 2RQCA 4P4OA 2QK9A 3S6EA 5AJ3K 1VQON 4KH1B 2CIMA 5K20B 2R18A 3K1ZA 2IVFB 1NK4A 3CC7S 3V2UC 4X62J 2ZTDA 3IV6A 3TACB 5AZIA 4NZ6A 1GLDG 1MN7A 4CJWA 3GJRB 3KDNA 3W60A 2NUHA 5H9FK 3AV9A 1KVKA 4LFAJ 1NGBA 5HRNA 2XNQA 1U2VA 5AKJA 2Z7JA 4LSLB 3S41A 1SL2A 1DFDA 3ZSXA 3HCXA 5LT5A 2V2KA 4DHVA 3AA3A 3SQ4A 1XERA 3D6JA 4R5PA 1ZZNA 4AQYJ 4HLBA 2BZ2A 3L2VA 2BR0A 3F41A 2C3OA 2FJXA 3OTOF 3AQEA 3ALYA 1T9UA 4ZVHA 3SQGA 3BUZB 3WXLA 2NUBA 5HROB 4IG0B 4CDGA 4I2PB 4JI0J 1GAOA 1IR0A 1VQ5N 1UT5A 3A8IA 5AHXA 1IKXB 3DU5A 3CMES 2G0AA 4RNMA 3MMAB 1HWLA 2VBYA 2KVSA 4USJC 1RACB 1TL3A 3X1LB 1FF2A 5F3XB 5I42A 5DM7L 1RT6A 4IO1A 2YNIB 5BREA 4OI0A 4BRKA 3ZTOA 3K5NA 4ETXA 4K2XA 3OTDA 4DL6A 4BRMA 1U1RA 3QU4A 3ZO7A 1L3VA 3L95X 2DBYA 4CRXA 2FSNA 5IIIA 2C2NA 3CJCA 3CJ8A 4C8ZA 1IJJA 1VRUB 4E7LA 2DY9A 1VSDA 4P2MA 2HVIA 2HNDA 2K8CB 2MQLA 4OYIA 4X62F 1C0GA 4CF4A 4EUVA 1TKZA 1K8AO 5HOOA 2HG4A 2VWBA 4O3PA 1YZ6A 3OL8A 5AQOA 1FXLA 1ZH5A 3D7EO 5HJYA 1OW5A 1QAIA 4O0IA 4FWRA 1Q0NA 3MN9A 1N33K 2ROGA 4B9MA 4K4IA 4BC2A 3Q83A 1P6TA 4I68A 4Y2YA 4FK2A 2VFSA 3NFAA 3UVJB 4LF6F 2JRSA 1KQGB 3ELHA 4LZDA 2VA2A 4Z4GA 5AKXA 3G71S 3TARA 1FJGJ 2WTFA 3DLGB 4QZAA 3Q89A 2XZDB 2FF3B 4R64A 4ZIVA 2PA8D 1GH8A 1NMNA 4KR0B 2RIJA 1PGZA 1BO5O 2WMMA 3A0IX 3E66A 5DB9A 1L7OA 3SCKE 2EK6A 2P9LB 1K47A 3PYFA 3S9HA 3EGZA 3OVSA 3LDNA 4WFXA 4OJOA 3UQ2A 1ZQRA 1NGAA 1YK9A 2F3NA 2GFFA 3IWLA 3ZT3A 3MCOA 4ZPAA 2QLBB 2NS1B 2A1AA 3M2RB 2HBYB 2UXDF 2RJZA 2FJ6A 3O80A 4J03A 1FWPA 5DK5A 1UZHA 2NYIA 1RDAA 2PD1A 4KMUA 4JK8A 1D1UA 2DO0A 2R4FA 5MAOA 3AUOA 1E6YA 3P6YC 4CF9A 3CQYA 1WWUA 3QGHA 1RISA 3Q8PB 1N48A 3R5GA 2YX8A 4FLZA 1HYSA 4FM1A 3LDSA 4UB5A 4H4KC 1HUOA 4AHUA 2P9PA 4M3XA 2QARA 3PKMA 3E0FA 4DX5A 4AHCA 2HS4A 2ZGZA 4QYZJ 3CMQA 4A4JA 3QFHA 3NGSA 5GADU 5CXTA 2MKKA 1RBRA 3D9BA 1V4SA 1DGKN 2YKQA 1WSJA 3JQMA 1FJGF 2MSTA 1SB6A 2C3YA 2D4WA 2RHFA 2OCEA 1WI6A 2W4PA 1Y5LB 4PG8A 2ZM6K 3Q22A 3GIMA 5IIJA 1XMOF 1HNVA 4J8FA 5ADXA 3UMCA 4Z4FA 2B4OA 3CULA 2CPHA 1R0AA 4LBIA 2F76X 3DU6A 4DV3K 1NAQA 2GVZB 2EC2A 4QWBA 1H0HB 2F8TA 3UN2A 3TUJC 4DSFA 1FE4A 2JMGA 1KBUA 3SFUA 2QWRA 1EWRA 2CNKB 4UAUA 4NLZA 4KO0B 3KMQA 1Y97A 2HZAA 2UUTA 2DGUA 2B7CB 4A8MP 4CFBA 2BVZA 3H5UA 1WOQA 2WONB 3I55S 2OI2A 3P31A 5KFRA 2FDRA 1BA0A 4IOAQ 4EU0A 4IBNA 5B0BA 2G9OA 3RU0A 2CRXA 1H98A 2F40A 3PW4A 4N5SA 4E0DA 4BRGA 4ZP9A 2FHKA 2AHOB 1BA1A 1W2IA 4BRIA 3MEDA 4FE3A 2XNRA 4I2DA 3JSMB 4ENOA 4OLAA 2QL9B 2HF3A 2W2PP 4GY2B 2ZG6A 3J7ZO 3O9TA 3RWUA 1X66A 1ZM4A 1FKOA 2A2CA 3QINA 4M1KA 4IDKB 5DLGA 2W54A 3TAFA 4UW9A 3CCUN 1NLVA 3DMJB 2DL0A 2DNLA 2QWOA 2GWJA 2NPIA 3KJVA 3JXOA 5HATA 2ZHAA 2P9IA 2AH5A 4FWPA 3PR4A 3HFKA 2FMSA 3AQFA 2ZKUA 4IO8A 4K4GA 1YRTA 5EHHA 2YNGB 3KLFA 1IKWB 4USUA 1YTAA 1C1CA 4DOZA 2KDOA 1TAQA 4DV5F 8ICVA 5J0OA 6AT1B 1ZM2A 5AXKA 3LUYA 3QLHB 2CAJA 3OVAA 1M5HA 1T9VA 3TU5A 4N77A 4BDYA 3PHTA 2VKQA 5LMUJ 3TWHA 2KMDA 3OYEA 4TUPA 2KT5A 4RWWA 2F4VJ 1AFJA 4HACA 4WFYA 4BE2A 3OHBA 4LR7A 5FLXO 4FXDA 1RQ0A 4PGYA 3CB4A 1RB0A 3DV9A 5J8YC 3CCEN 2JC0A 2EFVA 2VJ5A 3GFHA 3RTVA 4K2JA 1X31C 4DR4J 4R66A 4YB1P 1HNIA 5E2QA 3WEEA 3FNNA 4OJGA 1N6QB 1A9NB 1S1VB 5KT3A 3VERA 5FPNA 3MDFA 3EGVA 2DKZA 1ZD4A 1NPPA 1N5YB 1FKPB 1Z4UA 3J80U 2QW9A 3HLUA 3TZZA 1YLXA 4AP9A 3CCVN 1RTJB 1HNZJ 2H3VA 3H7HB 2QMUB 2FHMA 2GX8A 2RRDA 4Q5VA 2ZC4A 2W25A 3TZXA 3J81O 5LSRA 3ZDBA 2RRAA 4WQ5C 2CJBA 1V4TA 4QW8A 4CESA 3W3SA 3HSJA 4NMLA 4JI6J 2P9NA 4EIAA 3C2PA 5J1EB 3DLKA 1N32J 2POKA 1YRUA 3A0BU 2BE2A 4C11B 1I94K 3GMGA 4IOXA 2VFTA 3JS6A 3O4NA 1XHZA 2XI3A 1RDUA 2Y0BB 5JTIA 3MHYA 4HI1A 3DOMA 5B0FA 4FO6A 5IT9U 2XMJA 2RQ4A 2OXOA 2JVOA 3QBWA 1RBOB 2YWWA 2I1QA 1Q3VA 5LMUF 1JIHA 4EP4A 2MUTB 5D3GB 2DGTA 2R7OA 3D1OA 1S77D 2F4VF 4Q7AA 3MD1A 3T6BA 5ALWA 1RWOB 3ZD9A 5EX0A 2D0CA 2CXYA 1YQHA 1JALA 3L9ZA 3BSOA 3Q7BA 8ICKA 2VPZB 1E4GT 4CQ1A 2F8HA 2JFDA 3ETRA 2P9EA 5CYQA 4USVA 5E5NA 4UY85 3ZFVA 1BHNA 1SI9A 2YWFA 2MQPA 4E7JA 3DKDA 2QLTA 4X65K 3HT3A 4IOCQ 2R8IA 4QNLA 4CI6A 2R2SA 2NRWA 3TR8A 1Q78A 3PRDA 3W2VA 3Q8SB 4RNNA 4KLDA 4F25A 4OX9J 3G6YA 3VN5A 4DL0C 3DDHA 1U1PA 3NH1A 4I29A 4MLHA 1K0TA 2H3FA 1YDLA 2CJYB 3UB5A 4UB1A 1WC3A 1RSCA 1DTTA 5G0RB 2G8UA 1T3NA 2CQHA 5ETVA 3BYRA 1GQEA 2O8CB 3GIKA 3ENWA 4DQIA 2XSJA 3W66A 4HT5A 2VQEJ 2ZFHA 3QPIA 3VGMA 2B9EA 4JI8K 2V69A 3C7NA 2DGSA 2J5AA 1T6DA 2PBDA 3KK7A 2Z2MA 3T1HF 4UB3A 1PG5B 1CJTA 3EVMA 1WOSA 5IWAK 2K8GA 1QY7A 4R0JA 4CT9A 1VQLN 5HHIA 1KC8T 1CZAN 3TAMA 1X9SA 2DH7A 4CLLA 3KUEA 4JKEA 5D0HA 2DNOA 1NSQA 2QKBA 3WZ0A 4J5OA 4HDHA 4DTUA 1U26A 4G9ZA 8ICMA 4Y2PA 4KH6A 3CXCR 2EWHA 3M9MB 3CDAA 2KKPA 4JI2K 3AAPA 4ES2A 3CCSS 1KQQA 4Y2XA 2HHSA 5E3QA 4JV5J 2EHGA 3D45A 3TI0A 1FW6A 1SKWA 8ICCA 5J2EA 5FJ4A 1UWBA 2RH3A 2X74A 1V38A 4MYTA 3T5JA 1R0CB 3OT9A 1IBMK 4J9NA 2WK4A 1Q7YT 1SXEA 2XULA 2R7YA 4F7VA 2IJFA 3NBPA 4BC4A 4YFUA 5CEHA 2FLPA 3QRPA 1RXOB 2F8MA 3QMQA 4LH4A 1KQSM 4IQTA 3W9IA 4KFBA 1R8CA 3Q8MA 2IOFA 3R5BA 2AQ0A 3FZ2A 3IN5A 3U3GA 4H8KA 2ADCA 4WYBA 2IVPA 2XBPA 2KVCA 4CZKA 3S3MA 4M0AA 1S4FA 4ICAA 4BR5A 4CHOA 4RQNA 4PXCA 4MIAA 3G6XA 4P7VA 1K73O 4A8OA 4J37A 3SLCA 2AP1A 4UB2A 3AQOA 2MJNA 3NGUA 2UXCJ 3OYDA 2ZKTA 3N6MA 4BREA 3JYTB 5F8GA 3UE2A 4J90A 3VCDA 4NEYA 4JV2A 3VWSA 2W9MA 2GIQA 4EI2A 1ZD2P 5E84A 4G1QA 5KFXA 4FDFA 4E7KA 1ZQUA 3CCTA 2X1FA 1NNLA 5KL1B 3IR7B 4JI3J 1FDBA 1KKHA 1NSPA 4DCJB 1VQ4N 1UVIA 3A5MC 2M70A 4RPXA 2W2QP 3N0VA 4FF1A 4NI2A 4BACA 4I64A 2NXUA 2UUBK 1Y88A 4Z2XA 3BO4A 3K75D 4JV5F 1X6IA 1EO1A 2IDOA 4LFBF 5EOZA 3CIMA 2WRMA 3M8PB 2UUCJ 1N5XA 3B78A 3ZZRA 4YR2A 1BQMB 5DM6Q 4NCGA 3M5RA 2WW4A 4CGHA 1T3VA 4X4UA 4RW7A 1EJ7L 3CG7A 2ESEA 2GBZA 3HVRA 2JWKA 3FCHA 3I87A 2OUGA 4WP9A 1Q1KA 1E4FT 3PV8A 3C6TB 2A42A 2XI2A 3SSQA 1J5EF 2XB2D 3PX0A 4BXOB 1YVFA 2ZJ8A 3ZTSA 4C0BA 3AO1A 3S6JA 2QB0A 2H5IB 3FVYA 4OV1A 2DR5A 1E6YB 1CXQA 2CPFA 1MG7A 3UCZP 1JLGA 2COLA 3QQCD 3W5YA 2ASOA 4FZLA 2HQ3A 4C4RA 4NLTA 1TL5A 5CQGA 2OHFA 2YJFA 2A18A 2QARB 5DBBA 8ICAA 4OJRA 1HKCA 3OYAA 4MFBA 3LPEA 4RQ8A 2OYQA 2UXCF 4YFKA 3OY9A 3ZT4A 1KN6A 3ZDAA 3HKZD 2FVCA 4DU7A 4H0XB 5CHIA 3HOTA 1XR7A 2ZZNA 3L3UA 3FZBA 3O9UA 4Z6CA 1C2PA 5CJ7A 4OPHA 1X42A 2OM6A 1Q46A 4PL8A 1VMBA 4KHSA 1D3WA 4KTZA 7ICVA 1K9MO 2E1YA 1RP5A 2WFBA 2GJIA 3ZZOA 4UAWA 2XSFA 3A2FA 3CCWA 2LQ8A 1UEVA 1UFKA 1KVJA 1YI2N 3K8WA 1T7PA 2QSFA 4P9SA 2LECA 1WEZA 3JXUA 1ZQPA 4DDFA 2YVSA 1HNVB 1LNQA 2V34A 5GAGU 4F0MA 3HFVA 1KEJA 9ICGA 2UUCF 3DLEB 2NYVA 3T1AA 1HQEA 1ZQGA 1CS4A 1FWKA 2Y1LB 4EZ6A 1FRIA 4OZ1A 4LSNA 2U1AA 1XU4A 1OPIA 4CHQA 2J9EA 3W1YC 4CJPA 3ISBA 1KKXA 2MXYA 2WB1D 2C2MB 4BJQA 1KAYA 3M1VB 3MN7A 3LQVA 8ICTA 1H2UX 3SI6A 4DCCA 1R89A 2NZTA 5HRPA 5J2JA 2KSOA 1P1LA 2G8KA 5KT2A 1KEKA 4DR7F 5FDLB 3M1FA 3TX8A 5H1SV 4BR4A 2QG9B 4LF7J 2RILA 4I1TA 2JX2A 4JP8A 3CJ7A 3QU9A 2BUPA 5A0LA 4FLWA 4RW6A 3OHAA 4I28A 5U47A 2KG5A 1TK8A 1HR0F 1QUPA 4MF2A 5AFUH 1AFIA 3A8JA 3MXHP 2KTQA 3RJMB 1WSFA 2XY8A 3AJDA 3IDWA 2A1JA 4JB3A 2ASMA 1DTQB 4O44B 1RT5A 3DXMB 4G65A 1VQKN 3OW2R 4O4RA 4DTSA 2IDEA 1ZA1B 4LF9J 3ZZUA 4RKUC 2OD4A 2EBGA 1KVCA 1ZAVA 2LA6A 3KJVB 3V6DA 2LA4A 2RUGA 2CN1A 3SV3A 4CEDA 4ED7A 2OPQB 3JSYA 3QIPA 2JZBA 2RU9A 4PWDB 1WUDA 1KP6A 2NR0A 2LEBA 3PNCA 3KLFB 1DRGA 1R7IA 1RQNA 4DS4A 3HD1A 4JI5F 5J2MA 5GAHU 4JKDA 4DV4J 2DTJA 2MYFA 3QETA 2HI0A 2HIQA 5KOXA 4NXMJ 1P27B 3ZZ0A 1FRLA 4OZ0A 1Z25A 4JWNA 9ICJA 5B09A 3L7UA 2N7CA 4IJAA 3BGLA 4FLVA 2KZMA 2D0PA 4RQ2A 3BREA 5EUHA 5AQNA 2IIRA 2YHBA 3GR1A 3I0SB 2K4HA 2VANA 4DSIA 4DTMA 5THWA 4DWIA 2ALYB 3F56A 3CFOA 4Y2QA 2D9OA 5K8NA 1RBVA 3OYFA 4LF7F 4MFAA 5IOLA 2QRRA 3OXFA 1UW9A 1SZ2A 2ZJPL 3FMWA 4CF8A 3BH6B 1VLBA 2A6AA 2ADBA 4JI1K 4EYHB 4MH8A 3VV2B 2DEIA 4DR6K 4IYQA 5LJ3Y 2WTUA 2IYIA 1BHLA 5DLFA 2ZOGA 1PK3A 2RT3A 5C5JA 2ZBCA 4UOFA 4OLBA 4NL5A 4ED2A 3T5HA 2K89A 2CPXA 3NGIA 1ELOA 3FM9A 2OKQA 3SQIA 2F4FA 1GO3F 4MDAA 4JEPA 4HHUA 2P9CA 3EZOA 2KXFA 4K4UA 3L8BA 5CYMB 2ZUBA 5ITHA 3HI9A 4HCBA 5BRHA 4I2AA 1SV0C 1TYQB 3C46A 2VQFJ 1IJFB 3KOOA 4OPAA 4Y2RA 1MMNA 4R79A 3QRQA 1UA1A 2P9NB 5CR0A 3PW5A 3U1NA 3IBCB 4JKAA 1H72C 4YOEA 1HBUB 2KB2A 2X78A 1IV0A 3UM9A 5ALRA 3WXJA 4O4GB 4YR0A 1PYOB 2H65B 3I5BA 4CYUB 2DPIA 2Z1JA 3A8KA 3PSIA 1MROB 4JYAJ 4DV0F 3M8RA 4RLEA 2QYCA 1RM6C 2GWSA 1MWZA 5JS2A 3LK9A 4F26A 1WC0A 3CJ3A 2G8HA 4O8UA 1RTDA 3CIPA 4UASA 1X1PA 4I2HA 3HHNB 3HD2A 4D3GA 4G9BA 2ZH8A 1JLBB 4H5RA 3ATUA 3CRXA 3N01A 1IXKA 2EDUA 1M1KT 1SJQA 5M2UA 1CLFA 1CJVB 2PMZD 1EHWA 3DDKA 2D6FC 2CPYA 4BWMA 2L48A 4RBVA 7ICPA 1ZAXA 1IBCB 4Z6DA 2XMAA 3NVYA 4M6WA 1RAEB 1IKYA 4ZP6A 1YITS 3H0RB 8ICGA 1A6SA 3S01A 3HHLD 2LLZA 3ENVA 4CZHA 4J2BA 1WF2A 2D3OR 3ET6B 3AVBA 5GADI 3W2VB 3VVUA 4ZLPA 1YT3A 4H5WA 2R7XA 2HB5A 3BN7A 2CJKA 1FRXA 1WKJA 2CPZA 3C28A 1U1LA 1HNXF 3C6HA 4DOAA 9ICMA 3TP2A 1XMQK 3IP0A 5F0XA 4DFDA 4O8KA 3KJFB 3CF5Q 3LYSA 3ZTQA 2BOPA 2QLXA 4ZVQB 2KVIA 1P7DA 1WWVA 5J1NA 1KLNA 1FWLA 2QMWA 4QWCA 2XMKA 5K5MA 3LDQA 4FK0A 2XMVA 1TL1B 2QE5A 1SVDA 1VQYA 3NAHA 1JJ2R 1YJ9N 4F2RA 1TUGB 5IT9O 1U49A 5M1FA 4JYAF 4XA5A 4RQ5A 1NZPA 3MI7X 5CR4A 3TAQA 5KG6A 3LZIA 2RHKA 5EWEA 1A0PA 1HKBA 5L38A 3QGIA 1UKUA 5SZTA