2HHSA

O6-methyl:c pair in the polymerase-10 basepair position
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*CP*AP*TP*(6OG)P*CP*GP*AP*GP*TP*CP*AP*GP*G)-3'
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhsA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhsA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhsA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhsA01
4M9JA 9ICXA 4HUFA 4DTOA 4KV8A 3ZSZA 3AUOA 1NJYA 2IGIA 1JL2A 3AA4A 3ZSQA 4CF0A 4DQIA 5KFPA 4CEOA 1CXQA 4IG3A 2BCSA 3P83D 5J29A 1RILA 4YNQA 1ZQVA 1S76D 4CK3A 3JPSA 1RNHA 5KFNA 9ICOA 3WNEA 5KT7A 2W9AA 4ED7A 1KLNA 3SI6A 2VWJA 3QEBZ 5L1LA 1HNIA 3D45A 2HVIA 4NLGA 3M9NB 4I28A 4F4YA 4CJ4A 4KTQA 4GW6A 2HNDA 4DTRA 3ALYA 3T19A 1PZNA 4CFCA 4YMNA 2PXIA 4M9GA 3OY9A 3K5NA 4DFMA 5CP2A 5HMLA 1SKWA 1HQUA 4I29A 3RBEA 4O3PA 4JK1A 1CLQA 1RTJA 5SWMA 4KITB 3AVJA 5HLFA 1MQ3A 4LH5A 3CFPA 4M04A 5KFHA 3LP0A 1HQEA 4E7IA 5KT6A 1Z26A 1B43A 5SZTA 1JXLA 1KTQA 3ISCA 4FJHA 2F96A 4FK0A 1TV9A 2NRTA 1G15A 3OYCA 2BQUA 4CE9A 2I1QA 4ELVA 3TQ1A 3P1GA 3RBDA 3K5MA 4GMJB 4NXZA 3UIQA 1S6PA 3AA2A 8ICAA 4PGYA 4CEEA 4RG8A 1L3VA 4I2PA 5KFUA 1X9WA 5J0RA 3GV5B 3VQ6A 5KFSA 3NGYA 3ISDA 3DLKA 1U47A 4BE1A 2ITGA 4FW1A 5C24A 4AHVA 2F1JA 4OKEA 1COOA 2HHSA 1W9HA 2P5OA 3M8SA 1RXVA 4DU3A 4QW9A 4Z6EA 2V9WA 1EXNA 2NRXA 2BANA 4DTMA 2EHGA 1J5OA 1XU4A 1S6QA 9ICPA 3C5FA 2RKIA 4ECYA 5KT5A 4FJIA 4QZAA 2IS3A 5KFVA 4W5NA 4PHPA 9ICCA 4AILC 4KI6A 2AGPA 4I2AA 2X6NA 3IG1A 3QE9Y 7ICVA 2JZBB 3MR5A 4DQSA 1S1XA 4YD2A 4BWJA 3TR8A 3TAGA 3ETLA 4CFDA 1KDHA 5FRMA 1MU2A 3H8JA 2HW3A 4DS4A 2Y1JA 4Q0BA 4HVJA 1NK6A 9ICBA 1ZQOA 5E41A 4KO0A 1HUOA 2F8SA 4B9NA 1JX4A 2BCQA 3RH6A 3V81A 1AROP 5KFCA 3OHAA 2YKNA 1IG9A 1D9FA 4RQ6A 2OZMA 4FJXA 4C8LA 3FDSA 2ZUBA 1IKWA 3OYBA 4FLWA 1TL1A 3Q8SB 1QLNA 5HP4A 3ISBA 3C1YA 4YG2A 1BI4B 4CFAA 1HUZA 4J9NA 4PWDA 3Q8MA 1A76A 3QETA 2XRIA 3QZ8A 3IM1A 9ICHA 1ZQHA 5KRTA 4Z6CA 4J9KA 2ATLA 3V72A 3AO3A 5L1IA 1ZJNA 1WAJA 2FPLA 3H8SA 3I0SA 8ICPA 1Z00B 3MABA 4ZTJA 1EX4A 4EZ6A 2XGQA 1MSWD 1S97A 2BKEA 3VQ9A 4CEDA 4KLFA 3HM9A 2FLPA 4RT3A 3TARA 2XCPA 4I2IA 5J2MA 3IS9A 1FK9A 7ICPA 3QZ7A 4DQQA 2IMWP 4FCYA 1HMVA 2DTUA 1DTQA 4RQ8A 1ZETA 4OPKA 5KG6A 4TQRA 1VSIA 2D0CA 3UXPA 1RCHA 2HHTA 4UAZA 8ICMA 5HRRA 1ZBUA 1JLGA 4ED1A 3E2EA 2HNZA 7ICKA 3DYAA 5J2FA 4KKOA 4KLDA 4IDKA 4M9NA 4NYFA 2YNGA 3ZDAA 4B9TA 2AGQA 3Q8RB 3PX0A 1QHTA 2IOCA 1U9LA 4RQ7A 4FXDA 9ICUA 4DU1A 2ZTDA 1SKRA 4UB4A 1NKCA 2WONA 4LD0A 2R8HA 4JV0A 1J53A 3JPOA 3C95A 3ZT2A 5L1KA 5DB8A 4GXIA 1BQNA 1DTTA 1JLFA 3GIIA 4J2BA 1X1PA 3AA3A 3AO4A 1VSLA 3NF7A 4E89A 1LB2B 4X5VA 3MXIA 1U4BA 2VG6A 1S9EA 3NGZA 3JPPA 4JRQA 4O3NA 5JUMA 1S0VA 4CJTA 3HWTA 3ZSRA 1NKBA 2W9BA 2ZJ5A 3GIJA 3B6PA 4RW8A 3IAYA 2A1JA 4QZGA 2E4LA 4M6WB 3CM6A 3TANA 4PGQA 3RAQA 4Q8FA 1C1CA 4CHZA 4ED8A 1R0AA 1HYSA 4DL4A 3PR4A 1ZQJA 4YMMA 3LALA 2BQRA 2VG5A 4CJKA 3ZT4A 5J2PA 4KPYA 3LAKA 4KLUA 5IIJA 3Q8LA 5DGBA 3KIOA 5DQHA 2C2RA 3S9HA 3QNOA 2W42A 3ZDCA 3SQ1A 2FMQA 5KG7A 3VQPA 1T05A 3OJSA 4I7FA 1B9DA 1RBVA 3L8BA 1S1WA 4DOBA 5J2JA 4DWIA 2I9GA 4PPXA 4K8ZA 3OJUA 5BPCA 2C22A 3SJJA 2HMIA 4HYKA 4ID5A 2R8KA 8ICGA 4CF1A 1S9FA 4YR3A 2LSNA 4Z4HA 1X9MA 5J2GA 4KB1A 2E6MA 1HYZA 4UB1A 3QIOA 4J2DA 5D3GA 4MFFA 4EP4A 4J9RA 3PW4A 3GFKB 3Q8QB 5DQIA 4JS4A 2LYHA 1REVA 1JIHA 1VSEA 1ZQDA 2W8LA 1LAWA 3ZSXA 5J0PA 4I2DA 5DB9A 8ICOA 4KMUA 1CZBA 4Z4IA 2PI4A 7ICJA 5J0XA 4B8AB 4E7JA 2G8WA 1ZBLA 2NRVA 4F5QA 3LPTA 3HVRA 7ICNA 3T5JA 4CHOA 3VA3A 3RMDA 4DTUA 4I2JA 2X78A 3PW2A 3L3VA 2WOMA 5F9LA 3MECA 4CEAA 3HK2A 4I2HA 4M3TA 2DFEA 1HJPA 3K58A 2BHNA 4ECXA 3KKSA 1HYVA 4E7LA 2F8TA 2M9NA 4F2SA 2XHBA 2P5GA 2ZJ8A 4O3QA 4F3TA 3AVIA 2Y1IA 5HRPA 1ZBFA 4CGIA 3EPIA 5DKWA 3QEXA 1NJWA 1RBTA 2PFQA 3ZSYA 4KN7A 3ITHA 1IXRA 2HB5A 4G1QA 3LPUA 2GBZA 2RN2A 4RNMA 3MEGA 4OPJA 4H4OA 1K1QA 3NBPA 1IM4A 3F73A 1FKPA 4KLGA 2RF2A 3CFOA 4DSIA 2MUTB 5HBMA 7ICUA 3HT3A 3AO5A 2XC9A 3EWAA 2BPGA 1JLQA 2JGUA 5KFFA 3M8QA 4O5BA 4IQVA 2KTQA 3V7JA 3NF6A 4AHSA 3JPQA 4FM2A 4KLMA 2W9MA 3C6TA 4PHAA 2XY6A 1Q9XA 4FZZA 1T7PA 4BE2A 2I5JA 4DSEA 3PY8A 3MFIA 4CGGA 1BL3A 4CERA 1F21A 4DSLA 3PMLA 2OWOA 5K14A 2KFZA 5J2IA 4W5RA 4B9UA 2JEIA 5KTQA 1HNVA 4RNOA 4CIGA 4KRFA 5FROA 2Z1JA 1S1UA 4EZ9A 4OKKA 3NDKA 4M0AA 1CUKA 3M8PA 4NLKA 2JZBA 1NK4A 4YP3A 4KTZA 4DMNA 3MBYA 3M8RA 1TKZA 3S3NA 3V6JA 2JEGA 8ICEA 1L3SA 3ZDDA 3LDAA 1U04A 4NY8A 4E3SA 4I2FA 3MFHA 4CIEA 4DO9A 9ICQA 3KHGA 1HPZA 4BWMA 1RYRA 5D49A 4PY5A 3OVNA 3L2VA 8ICJA 2YHBA 3SUOA 4ZH4A 4YMOA 1RYSA 4M3YA 1TVAA 3RB6A 2J6UA 3KD1E 2HHQA 4DL7A 5HHIA 3GQCA 3T5LA 3V1RA 3H4DA 1C1AA 1VRTA 1ASVA 1EKEA 5DQGA 1KVCA 4XQ8A 4RU9A 2BCVA 2ISPA 1A5VA 2HHXA 3EW9A 5KFJA 3M9OB 3QEPA 4QCLA 3V1QA 4FZYA 2IA6A 4KHWA 5J2DA 3H4BA 4MEYA 3AVHA 3DLEA 1BVSA 1RDDA 4Z6FA 3VQQA 1TK5A 4XUSA 2BR0A 4DFJA 4J9QA 5KFIA 1ITGA 4KHUA 1B92A 1WSGA 1XO1A 4DSJA 3K59A 3MXJA 4P4MA 1XSNA 4I9LA 3MR3A 4OGCA 2PYJA 3AO1A 1QQCA 4FZXC 4DSKA 2P51A 2VA3A 4YQWA 3PVXA 1H38A 4J9SA 4N47A 4IBNA 1NKEA 3AO2A 3V6DA 2B5JA 5J2CA 3NCIA 5FDLA 1S1VA 4FJKA 1RT5A 2YHAA 4EBCA 1QE1A 1UT8A 2OA8A 3C6UA 4DL3A 3CG7A 2IC3A 3K4GA 5DBBA 3V7KA 3EZ5A 8ICSA 2D5RA 4N76A 4KREA 5DLGA 3KHRA 4YFKA 1IO2A 4MFBA 9ICEA 1N48A 3DLHA 2DFLA 4ECTA 3KK3A 4R64A 2D0AA 4B9SA 4CF8A 3TAFA 3LP3A 1ZQWA 5KFTA 1JLEA 1ZBIA 3OYAA 4ZHRA 3O3GA 4CJLA 4FJ8A 4W5OA 4LH4A 4CF9A 2F1IA 4F4ZA 5DG8A 2KFNA 2FBXA 1S1TA 4FJGA 4GVMA 2DPJA 3C21A 2C2DA 8ICTA 4FJ9A 1T4GA 3WNFA 5J0WA 7ICEA 3LZIA 3VQBA 4R5PA 2W8KA 8ICBA 3K57A 3BQ0A 1RPLA 5KG0A 8ICVA 4AH9A 4IRDA 4YXMA 1X2IA 4NM2A 1VSHA 3K75D 4FJ5A 1D8LA 3I0RA 1RTHA 4CEFA 2PFOA 8ICKA 3DMJA 2KZMA 4CF2A 5DGAA 2VANA 3RRHA 1LWFA 4BDYA 1BPEA 4O9MA 5IILA 4ECSA 3ZT0A 5DDMA 3GIMA 3JYTA 4IKFA 4M3ZA 3C2MA 4GLXA 1LAVA 4Y1DA 1ZQLA 3SQ4A 3OYLA 2Q0ZX 2J6TA 4KAZA 9ICIA 2JLEA 2XY8A 2AQ0A 4TQSA 3HW8A 2KZ3A 4JWNA 1TKTA 2OPQA 2KQ2A 3JSMA 1XC9A 1KVAA 4F4KA 4LSLA 5DMRA 3RMAA 3C5GA 4KLTA 3AVAA 4DU4A 1RTIA 2Q3SA 1B9FA 4IR1A 2FBVA 4YR0A 4HHTA 4NYNA 1JXBA 1ZQEA 5CZ1A 4BXOB 3ZDEA 2J6SA 4ED2A 4CJWA 4KB0A 3B6OA 4Q8EA 1NJXA 2RDJA 1RZTA 3G6XA 5CR0A 3V7LA 4Z6DA 4Q43A 1S10A 5J1EA 1NOZA 9ICNA 2PFNA 2FC0A 3UQ0A 2IBKA 1YTUA 2B6AA 1YVUA 4LVSA 3OYMA 4R8UB 1KCFA 4ELUA 4QWEA 3VQEA 3VQ7A 2RDIA 4M9HA 1Q9YA 3DOLA 5KFBA 3PX4A 1IKXA 4FM0A 4KLQA 4FJJA 7ICIA 1I3AA 5EOZA 1WSIA 5KFKA 1N56A 3VA0A 4B8CA 2ETJA 1KRPA 3O4QA 5KGXA 3DLGA 3RWUA 4DG1A 1JXEA 4RPXA 4PUOA 2DY4A 1BHLA 5HRSA 2XO7A 4TURA 4QAGA 4DLGA 4BXOA 8ICWA 4J2EA 2XCAA 3TAQA 1VSDA 2PI5A 4DTXA 4DQRA 3QEVA 3GV8B 1C0UA 9ICRA 1DLOA 1NK9A 3NHGA 3KHHA 4O3OA 8ICZA 9ICVA 2BPFA 5KFEA 4Z4CA 4RUCA 2IHNA 1ZQGA 1SL0A 4ED6A 2MUTA 1TK0A 4BDPA 1IKYA 5EU7A 4P4OA 3V9UA 3PO4A 2R8GA 4ECWA 1BPXA 4I2BA 1KVBA 1WSFA 5CY4A 3BQ1A 4CJEA 1BPYA 2FMSA 3OYNA 5CA7A 4RQ2A 4DTNA 5EWGA 1XS9D 4UB2A 5DDYA 3TAEA 3L2RA 4BGDA 4DF4A 3PUFA 3P5JA 3ORYA 1U49A 2BGWA 1K1SA 4PHDA 4KHSA 3QIPA 4DEZA 4N5SA 4FLVA 4F91B 4ED0A 3PW7A 4KLEA 1S9GA 9ICJA 5L9XA 3RB4A 4CGHA 4E19A 3AU2A 3L3UA 4FLTA 2KN7A 7ICOA 2HHUA 4MF8A 3LP2A 3L2WA 5IINA 2Z1IA 3MEDA 4YFUA 1N6QA 1KEJA 3OYEA 2ZE2A 9ICAA 1QS4A 2VG7A 2OZSA 4DTJA 3NH2A 4DFKA 9ICFA 1VSMA 2O4GA 2BCRA 3PV8A 4DOCA 3KLEA 1Q8IA 3TAMA 4OGEA 2OPSA 2ASJA 3DLRA 5DLFA 4KLJA 3K5LA 3D0PA 4E7KA 4KFBA 5J0OA 1TV6A 4QZ9A 5KT3A 4PQUA 5CB1A 3SYZA 4ECZA 1ZQPA 3VN5A 2G8FA 1BCOA 3NE6A 4OLBA 1KLMA 4KHNA 3OYHA 3T1AA 4QZBA 3JPNA 1ZYQA 5DG9A 4AHCA 4KLOA 4GC6A 2NRWA 3MDAA 1KFTA 1RT3A 5KFWA 5KFGA 3ZD9A 4XA5A 1ZQTA 1WLJA 2G8IA 3VQ8A 1Y88A 1ZBHA 1L3UA 2NRZA 5J2AA 3ZT3A 3LAMA 1TFRA 1NK8A 2R7YA 3NTUA 9ICLA 1TKDA 3WNGA 2W9CB 3RMBA 4NLZA 3CFRA 4TUQA 4HUEA 1VSKA 4CJRA 3DLBA 3NGIA 4AHUA 4FYDA 1NK7A 1O1WA 3OSPA 4Q5VA 3SPZA 1WSJA 4ECRA 3L2UA 1IKVA 1QTMA 4E7HA 1L3TA 1ZQMA 5HP1A 2IHMA 3AVLA 1ZQRA 4YN4A 1BPZA 4I27A 1RBUA 3V9XA 4LSNA 4PA1A 4QZDA 4TUPA 5J0YA 2A1SA 2O4IA 1LW0A 2KZZA 4WE1A 5TZVA 1CEZA 1U48A 4RW7A 3T3FA 3TWHA 3VQ4A 2GUIA 4FJLA 1UAXA 1I39A 2W9CA 5KFRA 2R8IA 3NF8A 4YR2A 3DI6A 4NCAA 5KT2A 1T3NA 2UVVA 4EP5A 1TL3A 4CHQA 4W5TA 2PZSA 2VA8A 5KG3A 3MEEA 1BGXT 3GDXA 4O55A 4YVZA 4CJ3A 8ICIA 2ATQA 1SL2A 2H5XA 3AVKA 4RT2A 4FBUA 4FLUA 3Q8KA 4F8RA 4GXJA 1C0MA 1NK5A 4CCHA 5KFYA 4KTWA 3UXOA 4J2AA 1ZQYA 2HVHA 3OS2A 3M9MB 5EWEA 4J9MA 4K4IA 3OYIA 5IIIA 1WCLA 4FK4A 4QZHA 4RNNA 7ICGA 1NK0A 1K6YA 4DL5A 1L5UA 4KLIA 3G10A 2QKKA 4RPZA 2PFPA 2YNIA 3BQ2A 1BISA 4O5KA 4UAYA 4IG0A 1YTAA 3ISNC 3MR2A 3ZCMA 3AU6A 4ECUA 1ZQKA 1EXQA 1A5XA 4FJNA 1KFDA 3PX6A 4CIFA 3SNNA 2PY5A 3DOKA 1D5AA 2RPIA 2FMPA 4DTSA 4CHYA 4JV1A 2OPRA 2JEFA 2P66A 4DSFA 4O5EA 4F4XA 4P2HA 4TSXA 4QWBA 3BGRA 5DBAA 3RJEA 2YNHA 3V6KA 1ZQCA 3SZ2A 1JLCA 3O3FA 4CJFA 1RT7A 3RMCA 1RT1A 5JS1A 4MQ3A 4MFAA 4MFCA 3EYZA 3N4MB 3QEIA 1SZPA 3E01A 3ZDBA 2P6RA 1N5YA 2ZUCA 3TAPA 4F2RA 3OYJA 5KFQA 4K8XA 1D9DA 5EWFA 4UB5A 2C28A 1U45A 3UPQA 1ZQIA 1QSSA 4RUAA 3CQ8A 5J0TA 3KK2A 3VQCA 5KFXA 3HO1A 5BOMA 1ZQXA 4ICLA 3VQDA 4CESA 2DFHA 3QNNA 3OYFA 7ICTA 4RQ3A 1UT5A 2G8KA 4FM1A 3DM2A 3NH1A 4E1NA 2QXFA 4QZ8A 4R66A 1JLAA 3RJKA 1RT2A 5KG1A 3DRSA 3VQAA 1ZQAA 1WSEA 1GOBA 3NFAA 4HCBA 2IDOA 5KFOA 1CZ9A 3ULDA 3RB0A 2HHWA 1ASWA 5KG2A 3ZSOA 4XIUA 4R8UA 2IAJA 3UXNA 4KLLA 4P4PA 4GC7A 4G3IA 1ZQSA 3PO5A 4DTPA 4Z4FA 3HPOA 4XRHA 4CHPA 2BQ3A 4DL2A 3HPGA 5BOLA 3V6HA 3KTQA 3L2QA 4F50A 4FVMA 4LZGA 3QERA 2XGPA 3SUNA 5J2NA 2ZJAA 4DLEA 3S3MA 5J0QA 2B4JA 3AVFA 4HUGA 3RJJA 2ASDA 4B9LA 7ICFA 4H8KA 5F9NA 4QOZB 5L1JA 5CWRA 1LW2A 5C25A 3H7IA 1RDBA 1TGOA 4CK1A 4M42A 1RDCA 2VA2A 4I2GA 1MQ2A 4CJSA 1S0NA 3KLGA 1BPBA 2XY7A 3TI0A 1W0HA 2V4RA 4H4MA 3HSTB 4CHNA 2YV0X 2UVUA 4JUZA 4I9QA 2YKMA 4EBDA 5KT4A 3ZSVA 3G0ZA 1RDAA 2X74A 2ZTEA 4IRKA 4O4GA 4R65A 3SV4A 4ECQA 3SUPA 1LWCA 3RR7A 4NLNA 4EYIB 1JN3A 1J54A 2XY5A 4CJQA 4C8OA 1C0TA 3ZSWA 2FPKA 4CJPA 1BPDA 2UVRA 5I42A 5CYQA 3QEWA 3KJVA 3AVCA 4KHQA 2EX3A 4QW8A 4KLHA 3OS1A 5J2EA 4F5NA 2YNFA 4DL6A 2BE2A 1DOQA 4IR9A 2BGGA 4W5QA 1XHXA 4OKJA 4PH5A 1SUQA 3LK9A 4M2YA 8ICQA 3RH5A 1TVRA 4CEZA 1NJZA 3QESA 3C23A 3U6FA 4I2EA 3T5KA 3F9KA 3RH4A 2NUBA 3FFIA 4F93B 5HHHA 8ICLA 3V4IA 4NCBA 3H40A 4OLAA 4TUSA 3B0XA 3RTVA 9ICKA 3AVGA 3SCXA 3RAXA 3LDSA 2X6SA 3PNCA 7ICMA 3NAEA 2BCUA 4RQ5A 3G6VA 1WN7A 1T03A 3SV3A 2B21A 2ASLA 7ICQA 3DRRA 5KFLA 1HJRA 1BI4A 4QZEA 4FW2A 1VSJA 4J9OA 1VK0A 4F4WA 4JRPA 1XHZA 3OGUA 1SV5A 5DB7A 8ICRA 3SQ2A 1KFSA 1RTDA 3JPTA 3V1OA 4N41A 4HCCA 4AHRA 4Z0UA 3HP6A 4PHEA 4QWDA 3C2KA 4O0JA 3OS0A 3RJGA 4E0DA 4RPYA 4UBCA 5HROA 4FLYA 3KLFA 3OYGA 5J0SA 2DPIA 1C6VA 4B3OA 2PYLA 1BIUA 3AVMA 3C94A 4FS2A 4ELTA 2BDPA 4ED3A 1RT6A 4Z4EA 4LZDA 3H8WA 4O44A 4UB3A 2AQ4A 3KLHA 4Q45A 3MGHA 3PW0A 1JLBA 3OYKA 1NOMA 4CECA 2E6LA 3LP1A 2R8JA 3KK1A 3TABA 1RT4A 3LZJA 3KHLA 4IRCA 3S3OA 4M3XA 1DGSA 3ASMA 3QLHA 1ZQFA 5KFAA 1V9PA 3BJYA 4OVLA 1TK8A 4M41A 5KI6A 5DB6A 3NH0A 3OSNA 5D4BA 5KGWA 1HRHA 3AA5X 4UAWA 4JS5A 3V9SA 1JKHA 1LWEA 4KHYA 4M3RA 9ICSA 2HNYA 3MGIA 2ZTCA 3PMNA 1ZQUA 4E1MA 2OPPA 4DFPA 4NM1A 1SKSA 4M6WA 3U3YA 4L8RB 4OJRA 3CYMA 1MC8A 3OHBA 1TKXA 3C1ZA 1WNSA 4FS1A 7ICRA 4KI4A 3T5HA 3V9ZA 1S0MA 4B9MA 1UA0A 4M45A 3LWLA 8ICUA 4CEQA 2AU0A 8ICNA 1CXUA 5CJ7A 1JL1A 3O4NA 3SQ0A 4CJVA 5I3UA 3O3HA 4CJ5A 4CFBA 4FLXA 2MAXA 1ZQNA 3UQ2A 4ECVA 3GV7B 4JV2A 3SUQA 2V4QA 4RQ1A 4CK2A 2GWSA 3ZD8A 5J2QA 3B0YA 3H08A 3EY1A 4O3SA 4M9LA 3BDPA 2ZQBA 5KRSA 1TAUA 3ZT1A 3U3GA 2ZD1A 1B22A 4QWAA 1BIZA 3RRGA 2FLNA 3GIKA 2ALZA 4RW6A 4YCXA 4Q44A 3Q8PB 1X9SA 3A2FA 3MXMA 3HL8A 2OYQA 4EYHB 1FKOA 3DRPA 5KFZA 1VRUA 3QEAZ 3RB3A 1QSYA 4EEYA 8ICYA 5IIOA 3IRXA 3NF9A 3HVTA 2G8HA 2P6UA 1S0OA 2UVWA 1XWLA 3MDCA 4F5RA 3HJFA 8ICCA 1JMSA 4J9PA 3HX0A 3HYFA 7ICHA 1SL1A 1EETA 2P1JA 1Y97A 3RR8A 1YT3A 4O3RA 3TFRA 3AVNA 4F5PA 3RJHA 9ICTA 2Z1GA 1ZQBA 5J2BA 2FLLA 1UWBA 3FYHA 3WNHA 4YXJA 3THVA 1VSFA 5IIKA 1XSPA 4EBEA 1FXXA 1EP4A 4KN4A 1RBSA 4CGDA 2FBTA 4C8MA 4J9LA 4RQ0A 4IFYA 3VQ5A 5KFMA 3I8DA 4O5CA 2DFFA 4I2QA 3RJFA 3K2PA 2QK9A 4R63A 4CGJA 4FLZA 4BE0A 8ICFA 1GOCA 3HP9A 4UQGA 4LY7A 1Z00A 3RJIA 9ICWA 4MEXA 4K4GA 1GOAA 4YD1A 4RZRA 2BPCA 5HMMA 1BQMA 2Z1HA 1ZJMA 5KG5A 2FBYA 2WTFA 5CYMA 9ICGA 3V9WA 2ZUDA 4IQTA 1J9AA 4QZCA 3KKRA 4B9VA 3EPGA 1Z3EB 1RBRA 4KLSA 3MR6A 1UA1A 2C2EA 1LV5A 3LANA 4QZFA 1QSLA 8ICHA 1RXWA 4GXKA 4QWCA 4ZTFA 4FO6A 5HNKA 3NGDA 2F1HA 5CHGA 1A5WA 4IQWA 4C8KA 1XSLA 4JWMA 9ICMA 4FJ7A 4M3WA 2HHVA 3K5OA 4HTUA 4M47A 8ICXA 1A77A 4FBTA 4QZIA 3QO9A 1BCMA 3C2LA 5J0UA 1C7YA 4CJUA 2AJQA 1NOYA 3AV9A 4F5OA 3KD5E 4F92B 4BDZA 2D0BA 1T8EA 3PR5B 4PGXA 4DQPA 4MF2A 4B08A 3SI8A 1UOCA 2W9BB 2A1RA 1XI1A 4C8NA 3PW5A 4DF8A 4Y1CA 2G8VA 2A1JB 2JEJA 1WCNA 4FJMA 2KW4A 3G6YA 2FPMA 1IH7A 1WAFA 4ID1A 2GV9A 3KLIA 3LWMA 5DBCA 5FRNA 3CM5A 7ICSA 5DK5A 1ZQQA 7ICLA 4CEBA 5D46A 1ZQZA 5J2KA 5C42A 3GILA 4K4HA 1TAQA 5KFDA 1S5JA 5CZ2A 1S77D 3QINA 5JS2A 5J2HA 3MAQA 2G8UA 1D8YA 1KSPA 2VWKA 3IHQB 5C5JA 4IQUA 5T7BA 3SPYA 4DS5A 4CGFA 5IIMA 5HRNA 3JPRA 1C1BA 4RQ4A 3N97B 1WSHA 2ISOA 4Z4GA 4RW9A 1ASUA 4FK2A 5KG4A 3HXMA 4N56A 4DOAA 4NCGA 4BACA 4JLHA 4M3UA 4AHTA 5DG7A 2QKBA 4O0IA 3AVBA 2AGOA 3TFSA 3OYDA 4RW4A 1Z25A 4UBBA 4F3OA 4I2CA 4IFVA 3HPHA 3BQTA
chains in the Genus database with same CATH superfamily
2QWOA 9ICXA 1OSCA 2KXHA 5BRDA 2HI0A 4HUFA 4DTOA 3AUOA 1NJYA 3BS9A 2NRHA 4DQIA 1VQSA 4X62K 1UHUA 5BR9A 2VFTA 3P83D 1RILA 4YNQA 1X4HA 4CLPA 4CK3A 4RU2A 1TFWA 3LGMA 5KFNA 3WNEA 3U9DA 2VWJA 1WG5A 2B4UA 3QSYB 2B43A 3OXFA 1SJQA 2RT3A 5A8KB 3FRZA 2E9TA 1UVNA 2QWMA 3T19A 3ALYA 2ABYA 2X7IA 3TQEA 1SKWA 4YOTA 3WT0A 2JLGA 2J0SD 4C8YA 4I29A 1U0HB 4O3PA 1UVKA 4OX7A 2LQBA 2WSCC 1CS4A 3AVJA 4B3TK 2AHOB 3JAMU 3BF3A 4LH5A 1KVJA 2CZVC 3GIRA 3WKDA 3VGUA 5AE3A 2MQNA 3OFEA 2WB1F 1UW9A 5CQGA 5K8MA 1J5OB 1Z26A 4A62A 4DR1F 1Z1VA 1F9FA 2B6AB 3D28A 2F96A 2RRDA 2CQIA 2NRTA 1FWPA 3FMWA 3TEHB 4WJ3B 3D6JA 3RBDA 1RQLA 3UR3C 2Z57B 5EN1A 1I3OB 2QA4N 5GAGP 4KQZA 2G1HA 4NXZA 3TZZA 4XPEA 1WC4A 1L3VA 4GIBA 3PXGa 2VBYA 2I5JB 4J5OA 1FO1A 4KHRA 3S1TA 1XNRJ 1X9WA 3GV5B 3WZ0A 1NZPA 5ITHA 1DJ0A 4FW1A 2R7UA 3BGLA 2F1JA 4H5WA 4HTLA 1N2XA 4ZDNA 2F2AB 1YZ7A 3IWLA 1W9HA 3W3DA 2P5OA 4UQTA 5HMWA 1R27B 3TJ8A 4Z6EA 2V9WA 1F2GA 3LP0B 2AYEA 1XU4A 2K8CB 1S6QA 2P9UB 4JI7F 3NS6A 2NRRA 3C5FA 4X64F 2VB6A 3WU2U 4W5NA 4PHPA 1VHIA 2LEAA 3CCQS 1IM6A 3TA2A 4AILC 5HMYA 4GKKJ 4I2AA 2X6NA 5BREA 3AQFA 4RW6B 4H0PA 3MR5A 4ZVEA 1QHAA 4B3SK 1LK5A 5ALEA 3TR8A 3D2WA 1OJ4A 3LUYA 3TAGA 2BJ9A 4CFDA 4DUZJ 2DCUB 1KQGB 1FXDA 5D4NA 3W2WB 2JR5A 3KXDA 2Q66A 1NJIO 4HVJA 4ZVHA 4GV3A 1DKGD 4KO0A 3QBWA 1MN8A 1JX4A 2BCQA 3RH6A 3PFEA 4DBQA 2QJ3A 2ZH7A 1SH3A 3MCSA 5EX3A 4PZVA 1B4FA 2RHFA 4CE6A 2ZUBA 1IKWA 4DB3A 3R5CA 2VKZG 1J2MA 4DR6F 1QLNA 1L8LA 5HP4A 3CJTA 2NZTA 4C48A 1X4AA 1YQHA 3LGNA 3A12A 3R3LA 4A8YA 4PWDA 3B54A 2Y0SF 3QETA 2KD1A 2DH9A 4L74A 1YHQS 3IM1A 9ICHA 4CDIA 1ZQHA 3K0JA 4Z6CA 5GTIU 2BM0A 1B0PA 4R0EA 1P8ZA 3JTPA 2ATLA 3AO3A 3I0SA 8ICPA 1Z00B 3MABA 2MKCA 4QYRA 4ZTJA 3POTB 5A8WA 2X1BA 4Y2RA 3TU5A 1MSWD 1ZM9A 1IBLJ 4MDAA 1NLVA 5AKEA 1MMLA 3VQ9A 2G5HB 2WONB 4UZBA 3A0BU 4IH5A 4M5GA 2ZJPL 3FSYA 4FCYA 1HMVA 3H8MA 5C0YA 1Q78A 5IFMA 2QSWA 2DIUA 4A48A 2QGFB 2YX6A 4KKOA 1JLGA 4ED1A 3DYAA 1KKHA 2ALYB 1GQEA 3DOMA 4M9NA 4AUKA 2AGQA 1NGAA 4A8QA 3D2EA 3NCQA 4DN0A 2A0FB 2NLWA 2EK1A 2XWYA 2WONA 4PG8A 2N7YA 4OLPA 3JPOA 5L1KA 3WKBA 4GXIA 3CCTA 2YX8A 3CEDA 4E89A 3NF7A 2W7AA 1OY8A 2JWNA 3THWB 4OCZA 2QV6A 2VG6A 4MYTA 3U7JA 4DMZA 4JRQA 5JUMA 2J9DE 1NKBA 4RW8A 1FRMA 3DOMB 5AZJA 2A1JA 1ILYA 1Y4ZB 2P8IA 3CM6A 3TANA 5GAGU 1TUVA 5E2QA 2VF3A 1PC5A 2VODA 2LBOA 4ED8A 4DR4F 4ILMA 4PL8A 1JJ2R 3EE9A 2R7OA 5AK3A 5B66U 3HSJA 5GAHU 5ALJA 5HI7A 1ZQJA 4YMMA 4LF6F 3LALA 2BQRA 5AQQA 4CJKA 4B6JA 1KAYA 3LAKA 2NZCA 5IIJA 2F77X 5AM0A 3QGPA 3W0LA 5D6GA 2O6KA 2J7KA 4F0MA 3C14A 2BJ7A 1AZSA 1IBLK 2PT0A 3OJSA 3OQ2A 5LOQA 4I7FA 3AD7C 3L8BA 3B6BA 1S1WA 1KVIA 1RT5B 4PZNA 1NEEA 4DOBA 2ZC4A 2A5XA 3O1LA 4TLRA 1XC3A 4EO8A 3OJUA 4GKKF 4CZIA 1AB8A 1X4DA 2C22A 4LSLB 4IFVB 1WC3A 4IG0B 2EAMA 2R8KA 2KHDA 4O23A 4CF1A 3N0VA 3L7UA 3L3FX 2LP4A 2ZKUA 4BCAA 2XS7A 1X9MA 4Z4HA 5J2GA 2UUBJ 3C0BA 1HYZA 4UB1A 3QIOA 4J2DA 5D3GA 4WWSA 2OANA 2BABA 4J9RA 3JQJA 4OHZA 2FC9A 2GVZB 3MWBA 2LXIA 2LYHA 1REVA 3RBZA 1VSEA 3CCRN 1ZC6A 3ZSXA 1LAWA 2H5JB 2XTJP 4ZPWR 1N0UA 1ZAWA 4H5VA 4KMUA 1CZBA 5AK6A 4WYBA 2PI4A 4C7QA 2WCXA 1FE4A 3OTOF 2HMIB 4PAAA 4F5QA 3HVRA 7ICNA 4FWQA 4RUBA 3GDQA 1HLWA 3L3VA 2ZBCA 1NHKL 4PL7A 1FKPB 2RF2B 2ZWOA 3G82B 4NZ0A 4Y6IA 4CF4A 2DGUA 3K58A 4ECXA 3HSGA 2F8TA 2M9NA 4ILHA 4WFXA 3WQTA 4A8KA 4USVA 2ZJ8A 1REVB 2YB4A 1WWUA 4DXLA 4QIWF 5HRPA 4CGIA 1GXTA 3EPIA 4DV2J 1LWFB 2CPRA 2E8MA 4CNYA 4B3RK 2DNLA 3CCJS 2ROEA 2HB5A 5LL6Z 3O9UA 3UR0A 2DNPA 2GBZA 1GX6A 3MEGA 1ICEB 4RQNA 4FN5A 1K1QA 2KO1A 1AFIA 3F73A 1FKPA 2RF2A 1PYSB 3CFOA 3MMCB 4NYZA 2QTDA 2MUTB 1D1UA 5IT4A 3EWAA 5KFFA 4NWBA 4TU8A 3BO3A 3EZUA 3ZX3A 2GCFA 3J81j 2E2OA 2W9MA 1N33F 3TTCA 3HI9A 2ZUGA 2VU5A 3EEQA 4FZZA 3EZOA 1T7PA 4BE2A 3UMCA 1N34F 3PY8A 4BC5A 1HBOB 2QZ8A 5GAEI 3MFIA 4CJ7A 1OPZA 3CMES 4CW7B 5K14A 2KFZA 2V8VA 1GLFO 1TMJA 5J2IA 3CDAA 4W5RA 1N36F 2FGOA 3TACB 1F6TA 1K0VA 2MB0B 2YWWA 3TSUA 2CPXA 4M0AA 3CC4S 3M8PA 2BJ3A 2MTLA 1NK4A 3VAKA 1I94K 3K89A 1YF5L 1YITS 2BOPA 4KTZA 4DMNA 4OZLA 2QLFB 3NL0A 4UB6U 4OMFG 3S3NA 2LYVA 5AJ3J 8ICEA 5DM6Q 1JJ2M 2VC1A 4NY8A 2Z0GA 4XAKA 4E3SA 5F0XA 4DO9A 4OJ5A 3PYGA 2KKPA 3R8EA 2HQDA 4F71A 1MWYA 4DU7A 1V4TA 1ROFA 8ICJA 2YHBA 2ZH8A 4YMOA 3EMTA 2D6FC 2E5LJ 4DCJB 3J7AN 3T5LA 5E84A 1NAQA 3H4DA 3QRPA 1DURA 3HFKA 2V7YA 2AYMA 4YB5A 3QPIA 5DQGA 1EKEA 2O8CB 3A0IX 2GJ2A 2XI3A 5GMKa 3SDEB 2KKHA 5AQWA 3QEPA 3AM9A 1IV8A 1UEVA 3AB2B 4FZYA 4LSZB 2XIDA 1HKAA 4PWUA 5J2DA 4MEYA 4M63C 3DLEA 2J9DA 3U1NA 4PG6A 4O0NA 2CRLA 1TK5A 2WW4A 2Z2MA 2ES6A 3OTOJ 4DFJA 4J9QA 2DGVA 4MJKA 3Q22A 3AA9A 1WDTA 1WSGA 2Q97A 4DSJA 3MXJA 4I9LA 5LSLA 1KAXA 4JD2B 4OGCA 3PHTA 3AO1A 4DSKA 2MSSA 1DGKN 5AT1B 4IBNA 5FLXU 3JXOA 5K9FA 3T9NA 3V6DA 1U2CA 3DNCA 2IPOB 3HVWA 1I94J 1T9XA 4URSA 1RT5A 3K9KA 1QE1A 4X64J 2ESEA 3IP0A 2PMHA 1HNZK 2CQ1A 3MPUB 2IC3A 4JI1J 5DM6L 3BM7A 1AXQA 2D69A 3VCBA 2CXYA 1NPPA 3EZ5A 4ZVUB 4N76A 5ALOA 2WSEC 3KHRA 4YFKA 2LA4A 1QTNB 3GP9A 3OTCA 4GV6A 1N48A 3KK3A 4KH4A 4ZPVR 4IO9L 1PSDA 1NGCA 3LH2S 3LP3A 1O0PA 3ATUA 1YBTA 3ZEUA 1ZQWA 6FD1A 1ZBIA 2H4YB 4KC5A 1FDBA 3FLCO 4GY2B 1J27A 2I6XA 1C1BB 4FJ8A 4W5OA 4LH4A 3GSDA 3TA0A 3U9ZA 4JP8A 4ZP9A 2FBXA 2MGZB 4LFCF 4FJGA 2OP5A 1L7OA 3UN3A 4FJ9A 5J0WA 3HRGA 3EVWA 4IOAL 1C4CA 2Y3YA 4DR7K 1JNRB 3BQ0A 1HBNB 5ETNA 4DR1J 3FJ2A 3BUZB 5KG0A 4XH5A 3GPAA 3TTFA 1B0XA 4FJ5A 1RTHA 1YJ7A 3A3PB 2HQ3A 3MN6A 2HKEA 4DV4K 3R9PA 2GVDA 2GO9A 4ECSA 3ZT0A 1WKLA 1KQSM 3GIMA 4IKFA 2ZIUA 5B5EU 1LAVA 4Y1DA 2WVBA 5MLCV 2F4VF 3SQ4A 1U1OA 2MJUA 4WFBQ 2Q0ZX 3MZIA 3RYLA 2AQ0A 1QY7A 2FHMA 4MKBA 4LF4J 3HW8A 2KZ3A 1TKTA 1RTJB 2OPQA 2Z58B 1FDDA 2JHEA 5IC6B 1HLUA 4F4KA 1OQ6A 3CMQA 3H5YA 1ELOA 3CERA 3MM8B 2ZIWA 2HFNA 1VQNN 4IR1A 4NL9A 3SBGA 4R5PB 1X5SA 2H1YA 1SXDA 1ZQEA 3IR7B 2ZNZA 3R5JB 1F9EB 3B6OA 3OBWA 1YI2N 1NJXA 1YHQN 2QTWA 1HKGA 3I0RB 4Z6DA 1K8KB 3EWGA 3BZKA 1RHQB 2YH1A 2VCPA 5J1EA 3TADA 2NSCA 2NYIA 1NOZA 1OQ3A 2FC0A 4A8MP 2B9YA 5SUHA 3OYMA 4KYZA 2AT1B 1KCFA 1WOSA 2IYGA 3VQEA 4OZJA 2RDIA 4M9HA 5IXUA 2DITA 3DOLA 3M1VA 2O1PA 2CA9A 3PX4A 1VC5A 3GU3A 2KDOA 1VHXA 1S49A 4A8SA 1WSIA 4DR2K 3TADC 1KTVA 3MGJA 5AXLA 2UP1A 4LF9F 2E8PA 5M1OA 3OR2A 3KHYA 2ETJA 5JLFA 1KRPA 3O4QA 4C7YA 5KGXA 2VZ9A 3DLGA 2E9ZA 1Z4NA 2JRSA 1ZXIA 2DY4A 5HRSA 2XO7A 4TURA 1WHVA 1F5CA 1JRPA 4J9UE 4MK8A 2Q2RA 2Z2LA 2VQEJ 3EDRB 2KN4A 2XCAA 5ALHA 2O5DA 3OL7A 4JI3F 4DTXA 4DQRA 3GYNA 3QEVA 2W24A 1C0UA 9ICRA 3AFGA 4UB8U 3SENA 2J4RA 4ZOHC 3CJ8A 3FZKA 4NLPA 4J03A 2P9SA 2BBEA 2IRUA 5KL8B 2BM1A 9ICVA 4C4SA 5HANA 1NSPA 2OTJS 5BPLA 4QJFB 1VDVA 4OJHA 4X2BA 3ET6B 1Q3UA 1CJTA 2BACA 1BY9A 1IV0A 3HKZD 2KB2A 3W61A 1IR2A 3OYNA 1CRXA 2V2QA 3VPZA 3E66A 1K5OA 4M94A 1A6SA 1G6BA 2ZJPQ 5D8HB 2DGXA 1IBKK 3C6TB 4K4TA 5DDYA 2XBPA 1WYGA 2QRRA 1B3TA 3QX7A 5E3RA 3LPEA 4BRFA 3ORYA 2CPDA 2F76X 4N5SA 4F91B 4DV3J 2GMLA 4B1WB 4BGBA 5DJBA 5L9XA 4E19A 5B0FA 3RW7A 3CCMN 3LP2A 3L2WA 5IINA 2IVFB 2XM3A 5FIIA 3MMVA 2KNJA 3MWTA 3THWA 2VPWB 1Y10A 4DTJA 1S72N 2KEYA 3L3CA 2Y8WA 3TAMA 3G8QA 2ZITA 4K4VA 5AM4A 4C2MA 3BZQA 3IR5B 5AZJB 1SJ1A 2ZXHA 4DL0C 5TISU 5KT3A 1O03A 2QWRA 1BXNA 4P73A 4ECZA 2AF6A 2F9WA 4LF2A 1KHVA 2UUCF 3IRWP 3OYHA 7AT1B 3CXCR 1LKZA 4QZBA 2ASOA 1GTEA 4YB7A 5T14A 5AQFA 3MDAA 1RT3A 3D0IE 3M6WA 4ACOA 2YWGA 3ZD9A 3GL1A 4L3KA 1ZQTA 2G8IA 2CPIA 3FR0A 2DEJA 1L3UA 5C2FA 2A1AA 2NRZA 4Y2IA 3FVYA 1TFRA 3NASA 1S72S 1RABB 1F3VA 2HFVA 5HQ8A 2MZSA 2BZFA 3CFRA 3HZ6A 1VSKA 1NH7A 4Y0FA 3DLBA 5ALPA 1EHWA 4AHUA 3I8BA 3G25A 1KXPA 4JYAF 3KDNA 4ECRA 1XJWB 1QTMA 1TV6B 4E7HA 1IQTA 3WC0A 5HP1A 3ICLA 3BO2A 4ZS6A 2FYXA 2IOFA 1T9YA 1MWQA 2PMZD 4Y2KA 4O44B 4QZDA 2CQGA 4A8XA 1BUXA 4NO7A 2C3PA 4RW7A 4HDHA 3T3FA 4D3GA 3BSCA 4NLSA 3VGSA 3VQ4A 5CE3A 4P9SA 1SJ3P 1RT6B 3AAQA 4YR2A 3FRYA 3NF8A 5AI5A 4FZNA 1RWPB 5KT2A 2WMMA 1VS3A 4EP5A 1NZ8A 5KG3A 1BGXT 4YEAA 2YWHA 2DNGA 3GWCA 3TJ9A 4DPWA 1X9XA 3LP1B 3E9OA 5JJBA 4RQMA 3DLLL 3LL3A 1TKTB 1VHFA 1UVIA 1X9JA 4EFHA 1QAYA 1LWEB 3WIVA 4Y2JA 4CJ3A 8ICIA 1NPKA 2GWKA 3PIPL 5A8KA 3FCVA 1N33K 1WSVA 1YDLA 1CBKA 2A6MA 1S79A 2CNNB 1HD0A 5ETVA 1WG1A 4J2AA 4UT4A 2PMWA 2XI2A 2HVHA 2DGQA 3OS2A 4GVBA 2IIHA 1T6CA 1LWXA 3ZZ0A 1RG6A 1TL7B 2ZIVA 4C0OC 3E01B 7ICGA 4H4OB 3GLJA 4ZITA 1K6YA 1L5UA 4KLIA 1UPPA 5L8RC 3G10A 1V85A 2PFPA 3ETOA 3QWUA 3BQ2A 1NHUA 1BISA 4OD0A 3ULHA 1OSDA 4LQ9A 1ULRA 4ECUA 1ZQKA 3BH7B 7FDRA 2KHQA 4YOEA 1EXQA 5AQNA 2WW8A 4A5AA 4FJNA 4CIFA 2OTLN 2FVRA 2V9KA 2RPIA 2L9WA 2FMPA 4CHYA 5DETA 1K9MT 4CI0B 2OPRA 1Q86T 1HNVB 3A8EA 1HI8A 3BGRA 1CLFA 1P8GA 5DBAA 2OLWA 2YNHA 1LKYB 5ETKA 4AM7A 6FDRA 1BA0A 1VQ4N 3FZHA 3DLKB 5JS1A 1M1HA 3QWPA 3QEIA 1SZPA 4ZJOA 1UP1A 3Q2TC 5DM7Q 3R2DJ 2YCHA 3AOBA 3TAPA 4K0KK 3KD3A 1EARA 3D4JA 5C25B 5EWFA 2BDUA 4UB5A 2A1BA 3TX0A 4ZJLA 4RUAA 3FZ2A 3CB4A 3CQ8A 4CZEA 1UQVA 2X1GA 3HO1A 2HBJA 3ISND 2PBDA 2DFHA 3D0GE 4NXNF 3TOQA 4FM1A 3Q7BA 4R66A 1RB0A 1HNWF 1JLAA 1YVFA 1PILA 3QU2A 5KG1A 1Y5IB 1WSEA 2F9DA 1OMSA 3RB0A 4K8RA 1ASWA 5AE1A 2ZH4A 2WAQF 4R8UA 4XIUA 4DPXA 4P4PA 4GC7A 4KH5A 3HPOA 4DV7J 1WOPA 1JCEA 2BXJA 3NY0A 4CHPA 4OPAA 4KHPJ 1IKXB 3HPGA 4UAUA 5AIBA 2CJ9A 2Q3PA 5DDOC 3V6HA 3S3MA 2ZJAA 5B0AA 3TVKA 1U2VA 1YJ9N 2E1RA 5F8JA 5B09A 5GAEP 4WFZA 4M42A 5FPNA 3HMJG 1TL1B 1PK3A 4CF3A 3M2RA 2RUGA 4WQ5C 1W97L 2G06A 1MQ2A 3FEZA 4CJSA 3AD8C 3HZGA 1NWKA 1BPBA 2FSKA 5EE3A 1W0HA 1RBLA 1OW5A 4H4MA 1WBBA 3HSTB 3ET6A 4A46A 2EFGA 1SQKA 2YV0X 4JUZA 1EX8A 1GXUA 1WTFA 2UYTA 4LVOP 3N5BA 4PABA 1FJGF 4BREA 3HT0A 2VYPA 1RDAA 1NGHA 4USJC 4R65A 4ECQA 1WHXA 1VK3A 2HQCA 1SUQB 2QWNA 5M2PA 2HZVA 3CP8A 3DXBA 1JN3A 4CJQA 4A2AA 4Y2AA 3UKUA 1BPDA 3W8GA 2ZH5A 2HPUA 2ASMA 3AH6A 3LO3A 2ZHOA 1Y0HA 2DNYA 3UM9A 3HSCA 3QUBA 1W7WA 1F5AA 4BS2A 1B0VA 4F5NA 3CHWA 4DL6A 5AQHA 4LMZA 2BE2A 4IDKB 3P5BP 5DS7A 4NLTA 2E88A 1T6DA 1HHTP 2D74B 1F2HA 3KOAA 1SUQA 4DKWA 2AKWB 5ADZA 8ICQA 3RH5A 3ENVA 4C1NI 3WEEB 2L5YA 1W7AA 2K89A 3C23A 4I2EA 4KHMA 1UTAA 3F9KA 2NUBA 2B9EA 3FFIA 3UWTA 4F93B 4DPOA 3R5DA 1Q82O 3G8SA 3TZYA 4OLAA 3TUPA 1YJUA 2QIFA 1HBNA 2UU9F 3NAIA 1VBZA 1JNZB 3ZZOA 3PNCA 7ICMA 4RQ5A 4CLKA 3MURP 1WN7A 3N7RC 3NNCA 4UOGA 1RTHB 1IBMK 2IM3A 2B21A 3D2NA 4P7TA 4DR3J 4PWWA 2ROPA 4MN4C 5GINA 5KFLA 4CTAB 1HJRA 1JLFB 1HQ2A 4OYBA 4IYQA 1XHZA 3RU0A 1WACA 3AJ2A 3VENA 2XMWA 2IC3B 4TY9A 1R59O 3PJWA 2BRKA 3CC4N 3SQ2A 3I4HX 1RTDA 2IFXA 2F9TA 4C11B 3ENAA 3DU5A 4X4TA 4L3QA 2FJAB 1C1CB 1S5ZA 4HVZA 3SAHA 4QWDA 4X4VA 1QUPA 3P45B 1ZBTA 4WZMA 3OS0A 4DR5F 1SQFA 2W2PP 3SXLA 2GX9A 2GIFA 1YRXA 5HROA 4FLYA 2DPIA 1C6VA 2QLJB 1NGBA 4B3OA 1KDNA 5MAOA 1D4XA 1VIXA 4FS2A 2V2ZA 4ELTA 3M4XA 1RT6A 3FQKA 3H8WA 3KOOA 1RBAA 2R18A 5AKIA 4FYXB 4CECA 4DCHA 3LP1A 3VGTA 2OPPB 2WF5A 4TYAA 1R6VA 4TXSA 1LKYA 2FIUA 3LZJA 4BC9A 1MA7A 2EC2A 2A3VA 1S7IA 1Q82T 1FVSA 3BJYA 5M1FA 4OX8A 4IOAQ 3CJQA 4OJ1A 4QIWD 1BNOA 1NNEA 4OVLA 1TK8A 4C0ZA 2M9KA 5KI6A 5DB6A 3TW0A 3NH0A 1WHWA 2I0XA 1HRHA 4AD6A 1SQEA 3V5RA 4M3RA 2HNYA 3MGIA 1RWWB 2ZTCA 3PMNA 3I33A 1JJHA 1ZQUA 2RHSB 3H0PA 2VKQA 2AP6A 5EE1A 2OPPA 3U3YA 1U0SA 1J2NA 1RT4B 3F5EA 2VQFJ 3OHBA 1B64A 3G6ES 3WIUA 3WDOA 1Y7PA 2PKEA 3QICA 4EELA 2W7PA 1YJRA 2AP1A 3G96A 1WOQA 3LWLA 4QR1A 4H03B 2B4VA 8ICUA 5E3AA 2AU0A 8ICNA 1JL1A 3O4NA 1UZHA 2D3UA 2BW7A 4NLQA 2YMPA 3QMLA 2LQ5A 1BQXA 1TR0A 1Q5YA 4CFBA 1ZQNA 1FE0A 2ZJRL 4LUBA 3UQ2A 3FSXA 1RAGB 5EUHA 4KH0B 2FHKA 2OPRB 5C10A 3GE9A 3J81U 2W7OA 3OVBA 2E5JA 3EY1A 3O1BA 1SIZA 1Q81O 2FJBB 1MNEA 1SVDA 3ZT1A 4JI8K 4PRFA 4H5NA 3EKSA 4RW6A 2ALZA 3H2LA 4E2FB 2V68A 3W5YA 4YCXA 4Q44A 3RRKA 3Q8PB 3MXMA 2Q4TA 2OI2A 2YJEA 2VQEK 1HW8A 3IFRA 4DV0F 1VRUA 5DZ6A 3OW2M 4JI8F 3RB3A 4EEYA 1IJEB 3IRXA 3NF9A 3HVTA 3BYRA 4C23A 4WYLA 2UVWA 1DHMA 1H1VA 1NGJA 3HX0A 7ICHA 2P1JA 1Y97A 4JAXA 1DLOB 3HFVA 3UQSA 2F4FA 1PYOB 3PRDA 3O1WA 1UWBA 1RT3B 1NDPA 4M8LA 2C2NA 5IIKA 1EP4A 4KN4A 3WXLA 1UFWA 4FZLA 3CF5Q 4CGDA 4LVNP 2FBTA 2E5HA 1RE1B 3DRSB 2P35A 2LEPA 2XQCA 4IZ9A 3VQ5A 2CPZA 3I8DA 4I2QA 3H5SA 1F1BB 1QZ5A 4WTOB 1XUPO 2IAJB 4MIAA 5ETRA 2ZM6K 3HP9A 2VKRA 1VQ8N 3MAAA 2BPCA 2WC9A 2DKOB 1BQMA 2FBYA 3MM5B 1S99A 4RWXA 5TKYA 4A57A 3T6JA 3LDLA 2ZUDA 2ZOFA 1FT8A 1N6QB 4EI2A 3J81Y 2WVCA 3MR6A 1EJ7L 1RXWA 1ZM2A 4GXKA 4HR2A 3P96A 3HHKA 1SH2A 2AEMA 2V5HG 3PM9A 5HNKA 3NNAA 3NGDA 2RMLA 5AICA 4LBIA 3UDVA 3CE8A 5ETQA 2E8AA 1XSLA 4JWMA 4MDBA 4HTUA 4NLWA 1TQLA 4H4KC 4J8FA 3MGVA 1BCMA 2DGOA 5M1QA 3I82A 2AJQA 3GYGA 1NOYA 3CJRA 4I6WA 4CLWA 3ZETA 4F5OA 1GLEG 3LW5C 4ZVSB 4CF5A 4DX6A 3THXB 4PGXA 2CG4A 3DHWC 2FDRA 1VQYA 2N7CA 2A1RA 2DWQA 2YB1A 3M2VA 4USUA 1XI1A 2C2ZB 3HSDA 1NHVA 4LBHA 3D54A 2KW4A 3G6YA 2FPMA 5HATA 2GUPA 3ZTPA 1IH7A 1XNQK 2V8HA 2GV9A 3QU7A 4LF8J 5DBCA 5FRNA 3O0FA 2W54A 2LXUA 3O9TA 1K8AT 5DK5A 1KQQA 1ZQQA 7ICLA 2Y9HA 5J2KA 3H25A 3NVVA 1TAQA 1D09B 1YGYA 5GTHU 5A2QU 3QINA 5JS2A 2W04A 2G8UA 1KC8T 3THXA 3W60A 5AZIB 3SMSA 3D2FA 2FF3B 1QQNA 2H9ZA 3C3LA 1N32J 1T94A 3DDNA 2I7PA 2FY1A 1QVGM 5C2CA 4USKA 2YKAA 3PZPA 5T7BA 3SPYA 5IIMA 2LU1A 1C1BA 1L8OA 4RQ4A 1LOTB 2KKZA 3N97B 4U9RA 2CYYA 3N4WA 1VOMA 4FK2A 1X60A 3H46O 4N56A 4BACA 4JLHA 4M3UA 2R42A 3BGRB 2KJ8A 3M6ZA 1ZA2B 3QB0A 3MN5A 5LSRA 4UW9A 4LFBF 1XMOJ 4RBVA 2AGOA 2F44A 3S41A 4UBBA 4F3OA 3HPHA 5EX5A 5FD1A 4M9JA 3D6RA 4ILJA 3CC7S 1SIWB 1JL2A 2KJ5A 1UL3A 4CF0A 5LSOA 4J7CA 2H4WB 5KFPA 5KAKA 4CEOA 3W64A 2LI6A 2VL1A 2BCSA 5J29A 1S76D 4N7TA 5D4PA 1B7FA 5IC4B 1S9EB 2JFDA 2R7XA 9ICOA 4EHTA 5KT7A 2O8EA 1KLNA 1QVGR 3QEBZ 1HNIA 3D45A 2HVIA 2W11A 3AEVA 4OYAA 3R7NB 4NLGA 5A8RB 3QU9A 3M9NB 3UDLA 2OD6A 3H7HB 2ZIVB 1B70B 4L3NA 5M1KA 1HHQA 4HTJA 2MEWA 3K5NA 5HMZA 3W62A 2HOIA 3UCGA 5AIAA 1HQUA 3K8WA 4Z7CA 1WWHA 4NXMJ 4QBUA 1VQPN 1CLQA 3KFWX 1N54B 5JU5A 1Y11A 3Q2SC 1CULB 2IBOA 4MMOA 5CHIA 5GVQA 2FGCA 1HARA 4OZ2A 4CBWA 4RO0A 3M1FA 5KFHA 1HQEA 4E7IA 4G1PA 1GEHA 5J1EB 1N88A 2G2YA 1JXLA 2DH7A 4FK0A 4QIEA 3OYCA 4CE9A 4ELVA 2LDIA 4LT6A 4DHVA 4DV5K 4F0HA 3CJ3A 2CPHA 4GMJB 4OJOA 2DYAA 1S6PA 3ILOA 3UFCX 2KJWA 4CEEA 4I2PA 2KVIA 2F5GA 3CC2S 3CQXA 3TEGA 7FD1A 1FFVA 4LFAJ 2AZ3A 5KFSA 2WF8A 4M5IA 2VDIA 1FTCA 4BE1A 4FDFA 2WFAA 1NSQA 5E7OB 3UB5A 3CCVN 2W3SA 2VJVA 4OKEA 4BRPA 1COOA 3A1YG 3HULA 2DGTA 1HWKA 1ZD4A 4DV7K 4BRQA 3PLAA 1DFDA 5ALIA 2BANA 1A9NB 2KG1A 3J7YP 3CJ1A 1S6PB 9ICPA 4P10A 5J1NA 1VQMN 4FJIA 5KT5A 2ZNYA 3HDSA 2MA1A 2PMZC 3BV8A 2YKPA 3IG1A 1SS6A 3MAHA 2EZZA 3DDHA 1S1XA 2ZVSA 3UNYA 4LF1A 3D1OA 5ETLA 4O5FA 4ZLPA 2HHHK 1KBUA 1JB0C 2G13A 2R7WA 3IUCA 3AA8A 5B08A 1TVRB 4WYWA 3P8BB 2FSNA 1ZQOA 5E41A 3IKMA 2MQMA 1HUOA 4B9NA 1JCFA 2IM1A 2OUGA 1AROP 4PYDA 2HHHF 1KVKA 1AUDA 1ZS6A 1PAEX 4ZVQB 1ZXOA 2OZMA 4C8LA 1UFKA 2FPHX 4WQ5A 2DD8S 1M6YA 2DVIA 4CT9A 4LF7K 4DR1K 2G4BA 2B9WA 3LDOA 4KFBB 4CFAA 4X4NA 2XSJA 1LWCB 4BR4A 3Q8MA 4K25A 4AYBF 3CJ0A 3PYEA 4LFAK 2MZRA 2XHCA 3SQGA 3UNGC 2C2OB 2CQHA 3PIPQ 4J9KA 2WBNA 3B78A 1TTHB 3ETRA 2FPLA 2FJEB 3J80U 3KVGA 4N8NA 4EZ6A 4PCQA 2XGQA 8ATCB 1S97A 4JNEA 1U24A 2BKEA 4LF4K 4KLFA 2FLPA 1UVMA 1BLUA 3TARA 1FNXH 4I2IA 4YDUA 3O4WA 3IS9A 1KN5A 2ADCA 7ICPA 4DZDA 3QZ7A 4DQQA 3BF1A 1PJ7A 5I42B 1DTQA 4OPKA 5KG6A 5AI4A 2J9EA 1VSIA 1QD1A 5LM7E 4P0QA 2M8HA 3QU4A 3QO9B 4KLDA 2VPZB 4CBXA 4PG4A 1D3WA 2CJYB 2YNGA 1IKVB 4ZA1A 1Z05A 4UY8T 3J7YU 3Q8RB 1SZ2A 5K4LA 1QAJA 1GLAG 3VVTA 4FXDA 1UPHA 3ETMA 4CO0A 2ZUAA 1ZZFA 2MY8A 4JI6F 4UB4A 1K0TA 4JV0A 3ZEUB 1J53A 1W26A 1YK9A 3C95A 5DB8A 1DTTA 3NGKA 4J2BA 1WTBA 1X1PA 3AA3A 4GKJF 1RLDA 4X5VA 2W25A 2CPFA 1VQ6N 1S0VA 4NL9C 1S1TB 4ZMMA 3QRQA 3TX8A 2N3OA 2MPUA 3AN1A 2MKJA 1DGJA 2E4LA 4M6WB 3TO8A 2IMOA 3C29A 3RAQA 2Q6CA 1C1CA 2IHR1 4ZCIA 3A8IA 4GO7X 3DI6B 3CCQN 1SJ4P 2AH5A 3HILA 3H0RB 2G09A 4X62F 2CQCA 3MMBB 3VF0B 3NWRA 1PVPA 2POKA 2LM1A 5DGBA 3VAIA 3P31A 3KIOA 2C2RA 4B1XB 2W42A 2EFVA 2UUCJ 3FZMA 1R0BG 2VH7A 1CJVA 1ATNA 3FGVA 2GAHC 5J2JA 1D8ZA 1Y3KA 4PPXA 2HURA 5BPCA 4WF9Q 4ES2A 4ID5A 1JCGA 1M90T 8ICGA 2QB0B 5LL6d 1S9FA 4PG7A 4DV3K 3ED5A 2IVNA 5CCMA 2KM8B 3UMGA 4KB1A 2E6MA 4IG3B 2E9RX 4K0KF 4MFFA 4EP4A 2CDRB 3NMAA 3C28A 4FWOA 5JVHQ 3GFKB 2XNRA 3CCZA 2QSFA 3HLUA 3Q24A 2A6OA 2D7SA 2W8LA 3TUIC 5J0PA 4KH6A 4BR5A 5ALDA 1QUVA 8ICOA 3VMFB 2RHQB 1Y64A 5U47A 7ICJA 5J0XA 4P0PB 2GJIA 1N0VC 3QJPA 4LRFA 3LPTA 4CRXA 4CHOA 2DH8A 4FWRA 1UWBB 1R31A 1H98A 4MIBA 2JHDA 4BRIA 3MECA 5BJRA 3L6QA 3O5BA 3MPDA 3CT9A 4E7LA 3KKSA 1HYVA 4LIWA 4YMEA 3ADAC 3JSRA 5GADI 2MXYA 2GLEA 5A0YA 1OH6A 4LRAA 3UO0A 1VQOS 3QT6A 1N5VA 2VQEF 2V8DA 2CQBA 4TVAB 2FJ6A 2AYGA 3VVUA 4OX9F 3QEXA 3CNQP 1RBTA 3ZSYA 2W2QP 3ONNA 4KN7A 1HBMB 5AQGA 2RN2A 4RNMA 1ZAXA 2HIQA 4JI2K 2DY1A 2Q1NA 7ICUA 4LFCK 4DV6K 2XC9A 1JLQA 5BRHA 2PEBA 4B3SF 3JS9A 3M8QA 5C24B 4O5BA 1MN9A 2COLA 3I32A 1FRKA 3K2YA 2JDJA 4PXCA 2X1FA 3N28A 2XY6A 1H7WA 2E5LF 2I5JA 1QCKA 3CDUA 4DSEA 4C8ZA 5JMNA 2DUYA 3DU6A 4CDGA 2P9GA 2GOLA 4F25A 3SSRA 1FFSB 3IGNA 2UXBF 2GHVC 2MKHA 3WHIA 3PRVA 1JJ4A 3IGVA 2YHXA 3R5GA 1CUKA 2SXLA 1HNWK 3TR5A 1R43A 4CLYA 4Y3CA 3M8RA 1TKZA 2MLYA 1L3SA 3ZDDA 3LDAA 5IWAJ 1DTQB 4PQUB 3L7OA 9ICQA 4K7QA 5K8OA 1S3XA 5DRKA 2GO8A 4BWMA 1U1QA 2GGPB 2H48B 2E1ZA 2BE7D 1IBLF 4ENOA 4JB8B 2R9LA 3J7ZT 4LR7A 2F8LA 3LVWA 3SUOA 1RYSA 1AT1B 5CH7B 3RB6A 4W92B 2HHQA 4DL7A 2MMYA 4FYYB 4OQJA 2XMKA 1J6ZA 1ASVA 2M8DB 4H0YB 1KVCA 1TL5A 4X4OA 4OPHA 4V1Ak 4RU9A 2P2CB 2ZH3A 3QIDA 2L08A 1JUDA 2AJ1A 2E1EA 1R8CA 2QYCA 3V1QA 2IA6A 4JI2J 4B3RF 4JB3A 4KX5A 4LFCJ 3L5KA 3CNHA 1BVSA 1RDDA 4Z6FA 2A2CA 1VBYA 4XUSA 1NGGA 1GLLO 4IO8A 4MFBB 3AQEA 3W3SA 3CIMA 5GAEU 1GLJO 1KQFB 3PSFA 4FFDA 5AKGA 1XNRK 1H7XA 4AQYJ 1XNSA 1L6NA 3K59A 4ED5A 2P9IA 4P4MA 1XSNA 3CRXA 3R1HA 3FC4A 2PYJA 3UMBA 3WKAA 4IWVA 1YSJA 4H5RA 2CVEA 4TY8B 4I56A 4J9SA 1NKEA 5G0RB 4NLUA 4HT7A 3R1XA 1M5SA 3KUEA 2YY3A 4PL2A 2RU9A 5FDLA 2VIHA 3WC2A 4FJKA 2RAQA 5ALQA 1UT8A 3C6UA 1HWUA 3M5RA 3CG7A 3DXKA 3K4GA 3F5AA 1FRXA 4NLDA 4IUFA 3TTDA 3J7ZO 3M7VA 3V7KA 4OLOA 3OUYB 8ICSA 2CWXA 1FWLA 2HBYB 3DJCA 1K8AO 1IO2A 2D3ZA 2HF3A 9ICEA 3DLHA 1HUXA 4R64A 4CF8A 2XLKA 3TAFA 1VQ7N 3D2SA 2JFKA 2V0NA 3H5XA 5KFTA 1JLEA 3M8YA 3FMBA 3OYAA 5FPDA 5M2RA 3TYTA 1XERA 5LMUF 5AKYA 4P0PA 2KFNA 2PEHA 5HR6A 3C21A 2C2DA 1GX5A 1FD8A 7ICEA 4EX6A 2WOMB 3MMBA 3JSMB 4JI3J 1RPLA 3HVAA 2XMJA 1YRUA 4AH9A 1HWJA 4YXMA 1X2IA 1VSHA 1M5HA 1D8LA 3QATA 3HF5A 3IM8A 2VONA 3R6LB 2K7KA 1DEJA 4X4QA 8ICKA 2KZMA 1W2IA 4US8A 3HM8A 4EGLA 3ZZPA 1BPEA 4O9MA 2WSFC 1U1LA 2YPYA 4JI5J 5M2UA 5DDMA 2IJFA 3C2MA 4GLXA 4KGXB 2K2PA 2HIYA 3OYLA 4N8OA 2J6TA 1REGX 9ICIA 2JLEA 3HRDD 3PSIA 2QB0A 3SEOA 4TQSA 4US9A 2C3MA 2E2PA 3OL9A 3JSMA 1CVJA 1LFWA 2YHWA 4FVUA 1Q1KA 1JLQB 4LSLA 2EFPA 5KAIU 3RMAA 1U1MA 1C0FA 4IOBA 3AVAA 1RTIA 1IG6A 1B9FA 1VQNS 2A6AA 2HSZA 1N5YB 3OR1B 3HCXA 4BXOB 4ED2A 4CJWA 5ALTA 4KB0A 4A8FA 4Q8EA 3SCIE 3TPQA 2ZH2A 1RZTA 3I87A 5IWAF 2B0GA 4Q43A 1S10A 3SBTA 3KNGA 5AR0A 1YTUA 2B6AA 1YVUA 4LVSA 4R8UB 3WK7A 2EVZA 2BX6A 4QWEA 3AQPA 3VQ7A 2OXOA 2W40A 2LECA 2JNJA 2XZWA 4LF4F 1GK8A 1IR0A 2MQQA 3E3XA 1MWKA 7ICIA 4BC4A 5AQOA 5EOZA 2VOOA 1X3MA 2XSFA 3A13A 4OZ1A 1YTYA 1NDKA 2EWSA 4QU7A 2ZF5O 3MD1A 4P2SA 4A47A 2ZIWB 4PUOA 1WEXA 4PEOA 3MM6B 3LP2B 4QAGA 2KT5A 5BPNA 4JV5F 3LM9A 8ICWA 3N6MA 4QR2A 3THYA 1F44A 5AKJA 1NLKL 5ALGA 2DNQA 4U7BA 3EUNA 3BZCA 1NK9A 3NHGA 3QBCA 4DR6J 2YXLA 4QIVA 1FK9B 4O3OA 4IOCQ 2J76E 8ICZA 2FVQA 3R9KA 4Z4CA 1T9UA 3PG9A 2FQQB 3BR9A 2ZBQA 1ZQGA 4HDGA 4ED6A 1IKYA 5A2QY 4JKEA 5EU7A 4RWTA 1BNPA 3V9UA 4P0QB 3AXKA 3PYFA 2H5IB 1BPXA 1KS2A 4I2BA 1WHYA 1WSFA 3BQ1A 4CJEA 2FMSA 2IVMA 1ZTWA 1B99A 2GS8A 1WD6A 3N6NA 2OEHA 4F02A 2DK2A 2CQPA 1JMTA 3PNIA 1CQMA 3H1VX 4DF4A 3PUFA 2CZ4A 4KHSA 1U49A 2ZXIA 2LQJA 4PHDA 4JK9A 1HR0K 3P49B 5ELZA 4BRNA 1PKUA 4KO0B 5K14B 3RB4A 2BVZA 7ICOA 2IOHA 4YOYA 3QJJA 3MEDA 3VTIA 1YVNA 1QQ6A 4YFUA 4XDCA 1KEJA 3OYEA 1QS4A 3NH2A 2EAOA 1VSMA 2BCRA 2MRLA 4DOCA 1Q8IA 2G9OA 3HSZA 2ASJA 3DLRA 3N7PD 5DLFA 4KAIA 1U09A 2JH3A 4KLJA 1V97A 3D0PA 5J0OA 2QARB 4QZ9A 3NS7B 2W03A 5CB1A 4PQAA 1ZQPA 4JI1K 1LCUA 1EETB 3M8ZA 3DXKB 2B8PA 1HPZB 3ID6A 1KLMA 2DRDA 3CCUN 1LW0B 3JPNA 4RW7B 2W3RA 3M2VB 3IS9B 5EDWA 4AHCA 1KFTA 5KFWA 1TZ0A 4XA5A 3R2CJ 1WLJA 1Y5LB 3QIPB 1QDUB 3SSQA 3VQ8A 3G6EN 1JQGA 1CJUB 5J2AA 2RRNA 2DR8A 3RZAA 4DV2K 3ULEA 1VJWA 5AI8A 2YI1A 1FRLA 4C11A 2XYHB 4B3RJ 1TKDA 3FZBA 2QARA 3RMBA 2MJNA 2V52B 1ZH5A 4HUEA 4OI6A 2BJDA 2BMBA 2O8DA 2XVTA 4CJRA 4K59A 1SH0A 1JLGB 4FYDA 2I6WA 1RACB 1O1WA 4Q5VA 3SPZA 5A0LA 3I55S 3O5TB 1GMWD 1S22A 3BF4A 2IHMA 3FNNA 3IFEA 4I27A 1SBRA 4LSNA 5J0YA 2AEJA 2A1SA 2O4IA 5TZVA 5J8YA 4B1YB 2N4DA 1XEZA 2M88A 2MZ1A 3TWHA 4D3HA 1C20A 2WF6A 4FJLA 4F04B 5AQUA 2MQPA 3MMJA 3CULA 3DI6A 4X65K 2PFDA 4XPCA 5AQYA 2O66A 2YNIB 1TL3A 2DF4B 4RW9B 4W5TA 1YIJN 3GDXA 3WX8A 3OUYA 3J80O 2EXUA 3AHPA 3R6MA 4O55A 4JI6J 1QE1B 5K8NA 3F0NA 3UW1A 3GG0A 2UXBJ 2ATQA 5H9EJ 2ZZTA 4FBUA 1N36K 5J2PB 1KKXA 3Q8KA 2H3GX 2P6SA 2M2BA 3E58A 4EU0A 3AD9C 1Q86O 1TL3B 5IT9U 4JKCA 4Y2SA 4L73A 4K4IA 5IIIA 2HCFA 2W6LA 1WCLA 3CCES 3TSPA 3CCJN 2JC0A 4RNNA 1FTRA 1FX4A 1NK0A 4DL5A 4LRCA 5GAGI 1HNXF 1DQAA 4RPZA 4NE9C 1X4GA 1M5OC 1I5OB 1EAYC 2GMJA 4B3MK 1D0EA 3LGHA 4Q2LA 5FJ4A 2KV2A 2WK4A 3ISNC 1VQ9N 1M90O 3BSAA 2FI1A 1N52B 4X65F 5GIOA 4R79A 2YWEA 1LFPA 2FUG9 2PY5A 1QQOA 5BR8K 3FK4A 2APOA 3P5TL 4DSFA 1KEKA 2VJUA 4TSXA 5AI6A 5J2QB 3KK1B 3V6KA 3THYB 4A4JA 3SZ2A 4CLSA 3O3FA 1K44A 1OVYA 3MECB 1PO6A 2XZTB 3NVWA 4MFAA 3HVTB 5A76A 2DPNA 3PKYA 1FA0A 4NLCA 2ZUCA 3MCPA 5KFQA 1FW6A 4OJ3A 1TELA 4JI6K 4J90A 2JLFA 2G1DA 1HBMA 1WC6A 2RILA 3AODA 3OD2A 4I69A 3BSNA 5D4LA 5HK4A 1ZQXA 2PA3A 4CESA 2FC8A 3OYFA 4RQ3A 1UT5A 4NMLA 3NH1A 4E1NA 1E6YB 3R8YA 2A10A 3GZFA 4M5MA 1WB9A 3H3NO 4FWPA 2VASA 3CMEN 3ZTRA 1ZQAA 1S6QB 2IDOA 1CZ9A 1KQSR 4NMXA 2F7VA 5KG2A 3MEDB 2E1CA 4M5KA 3ZSOA 3L4IA 4IO9Q 3UXNA 2FZKB 3DKDA 5LY3A 1X4BA 1EIYB 4F72A 5THWA 2F8HA 4F67A 4OL8A 1LXNA 2DEIA 1RQNA 2LVWA 3KTQA 2CN1A 3L2QA 4LZGA 2E44A 5J2NA 4ZCLA 4HUGA 3PSTA 3FEYB 1CJKA 5C25A 2A3ZA 4GKKK 3H7IA 5B0EA 4OJ6A 2DJWA 1RAIB 2CQ0A 1RDCA 2QB1A 5KPZA 2RH3A 1A0OB 2FE9A 1UVLA 3F53A 3KLGA 1NJIT 3JSYA 2VPYB 1ZM3A 3W9IA 4AP9A 2DHSA 4C9DA 2M70A 1JXVA 1S12A 1RT2B 2YKMA 3U1LA 2I7NA 5KT4A 2LQ9A 5EVZA 1SJRA 1J5EF 3G0ZA 1VJ5A 3QGHA 2X74A 2FVPA 4IRKA 2JWKA 3SV4A 2RHKA 3SUPA 3D6FB 3LA0A 5AFUA 4WK1A 2H3IA 3C8YA 3AOCA 1NH8A 2XY5A 4MAKA 4X66K 3ZSWA 1U1RA 1SC6A 3DLLQ 4CTAA 4ETXA 2UVRA 3ENQA 5I42A 5C7PA 4ES1A 4NXMK 1M1GA 2EEYA 2OGUA 2YVSA 5D4OA 3J7Z5 2X51A 3Q83A 3D7SB 4WF9L 1X66A 1DOQA 5A2QO 1Z1BA 4IR9A 3MN9A 4W5QA 1P6TA 1H2UX 1XHXA 4OKJA 4PH5A 2QLBB 3B8AX 3IG5A 3QUQA 1GXLA 2IOFK 4Y2XA 4ZP6A 4K4ZA 3CDEA 4M2YA 4NASA 4LRDA 3DYAB 4O3MA 1FDAA 3FCHA 4KB7A 4ANCA 3A8KA 3G71N 1NNDA 2EFOA 3SMVA 9ICKA 5LMUK 1WOOA 2RQCA 2X6SA 5L38A 2IDLA 4DR2J 5BPMA 2I38A 3QRRA 2JWLA 2L3MA 1WWVA 3E0FA 2ASLA 3ISZA 4QZEA 1WKKA 4FW2A 4DDFA 1VSJA 1VK0A 4F4WA 3NEKA 3OGUA 3MD3A 3B4DA 2ASPA 3US5A 2KRBA 3ZZZA 4WZQA 1JLBB 3T1YK 4RW8B 1QM9A 4N41A 4AHRA 1XBWA 1X42A 4U95A 4RL1A 3HP6A 4PHEA 3KJFB 3CQYA 4E0DA 2O8EB 4RPYA 2V2KA 4OX6A 4UBCA 1HWLA 4F9OA 5J0SA 2P9PB 1T05B 1IJJA 4QYZK 1BIUA 3C94A 2BDPA 1XQIA 2L48A 2HNDB 4HT5A 1IBKJ 4LZDA 3X3UA 4Z4EA 1RFQA 4CM0A 4DUZF 3KLHA 3MGHA 4BRLA 3GOIA 1HQUB 3PW0A 1JLBA 4WE1B 3OYKA 1VQMS 1NOMA 4YHHJ 1HIYA 1UWAA 2B7CB 2LMRA 2M0GB 1NGDA 2VJ4A 2OCEA 2RSQA 3KK1A 4P7VA 1QQMA 3OW2R 1HA1A 2JX2A 2B3TB 4G9ZA 4HI1A 4IRCA 1FEHA 1OUQA 4A8WA 1PBUA 3QLHA 3AT1B 4JHDA 4C3LA 1RAOA 5D0RA 1V9PA 3GU0A 1RDWX 1R6YA 2WBRA 2P9PA 2B56A 2HAFA 4M41A 5AI0A 5ALVA 3HI0A 1IR1A 1VJQA 4UASA 3OSNA 3BR8A 4NI2B 5D4BA 1SXLA 2VC0A 4PG5A 3JAMY 2YQEA 1L3KA 5D3GB 3AA5X 2HF4A 4M7YA 2LDYA 4LF7J 1LWEA 4KHYA 2CQ3A 2OTLS 9ICSA 4LF5K 4PR6A 4DUYK 2IA0A 3VGKA 1RGVA 4DFPA 2PDAA 3G87A 1MC8A 2H51B 1NI3A 2JMGA 1TKXA 2GVDB 1J97A 1KN6A 1K9MO 4CO2A 2ZD1B 2LMIA 3IRXB 3K1ZA 4KT0C 4B9MA 3A3OB 1VCTA 4DR3F 1HL6A 1URNA 3NLCA 1V3RA 3EUB2 1NSAA 2DNOA 2DIVA 4OJGA 4RLEA 2GH1A 3SQ0A 3CCSS 2QEXS 1N8RO 4QIWC 4OZNA 3TVYA 4KHPK 4FLXA 3QYPA 1RBOB 2ZZNA 1DAXA 4JV2A 4GVLA 4CK2A 3TUJC 2GWSA 3VHQA 3MC1A 3ZD8A 3UE5A 4FPRA 2EAPA 3ICXA 4EX7A 1TAUA 2D8CA 1HNZF 4CZLA 3RSEA 4YN3B 3U3GA 2ZD1A 1JI7A 3GIKA 4C98A 1YXQA 4LR9A 4BY9C 2Y9TA 3SQOP 1F3FA 1JWWA 3A2FA 3QUTA 1FRIA 1GLDG 3HL8A 3MEGB 3CUNA 1TYQA 1P9QC 3FGUA 5KFZA 1MU2B 1J5EJ 1IQZA 4DV4F 1RT7B 3QEAZ 4MKYA 3SD7A 3UI3A 1N4LA 3CO0P 4KMOB 3Q8VA 2H3VA 2IRYA 5IIOA 5AE2A 2YKMB 2N3LA 4DR6K 2LHTA 2P6UA 1NZBA 1UEUA 3OBIA 3MM6A 1R8AA 2CKWA 2VBWA 1GAOA 1S1UB 3R7SB 3GJSB 3T1HJ 3U8XA 1KLMB 4KR0B 3M2UA 3VAMA 2DQNB 5AQLA 3DLGB 5CCLA 4F5PA 4DV5J 2FF6A 3RJHA 2NZ4A 9ICTA 2Z1GA 3FBEA 1XMQJ 5AQMA 4JOUA 4AXIA 4BG8A 1PUZA 1XSPA 4OI1A 1HR0J 1FXXA 1VSFA 4KPCA 5HVFA 3J81O 3S7RA 1EQYA 1BUPA 1WUUA 4M63A 4O5CA 2DFFA 3U27A 2HOEA 3K2PA 1DRGA 4UOHA 4NYPA 4I67A 2KJ9A 2QC3A 1N8RT 4R63A 2FB0A 4CGJA 2O8FA 4ISFA 2QA4G 4OIXA 4JK8A 4K4GA 2AA4A 1KHWA 3M2UB 4OJPA 1S9GB 5CYMA 5JRTA 2V51B 3NKYA 4PXDA 1NSKL 1W2BR 4M5HA 4UATA 1NU4A 3CWJA 4K2JA 3D7EO 4IQTA 5AJ3K 2RKIB 4QZCA 3CCLN 2EK6A 4KGKA 3UD3P 1S6UA 1Z3EB 1RBRA 5EY4A 4KLSA 1UA1A 1LV5A 3LANA 2BUNA 3MM9B 2WHEA 1U8SA 2MY7A 3C15A 4ZTFA 1HW9A 4CBUA 3T69A 5CHGA 4IQWA 3QAEA 3VERA 9ICMA 1XIQA 4Y2QA 4FWMA 1HD1A 3NAHA 3CI5A 4FZMA 2I9SA 3H2VE 5L39A 1T11A 3FCWA 2FJVA 1AYEA 4CIOA 3CJ5A 3AV9A 2MQLA 5TKWA 1QQ7A 2DO4A 2Y0SC 4F92B 4IH6A 3K1RB 1WG8A 3R9LA 3KFUF 3EGNA 3KJVB 3C2PA 4WKRA 4DQ8A 1RAHB 3TRGA 3VESA 4RNHA 3L09A 4MF2A 4B08A 3SI8A 3ULEB 4B3MF 2YNFB 3PW5A 2R7RA 3K0SA 3VEOA 4Y1CA 3GR1A 2XLIA 3FSIA 1WCNA 4FJMA 1SIJA 3CCEN 2HRTA 3IP4B 4ID1A 5HOOA 3KLIA 3TJAA 3CM5A 7ICSA 4Y2VA 2ZDPA 4WFAL 2E66A 1HNXJ 5D46A 3R27A 5ALKA 1BMQB 4F0KA 1FI4A 4ZK7M 5KFDA 3EVOA 3I0SB 1Q0NA 3MMAA 4URGA 2KYXA 3M6KA 3IM9A 2HRYA 1WI6A 2VWKA 4JBCA 1WJ9A 4PKDB 4ZHRB 2VDHA 3NNHA 4CGFA 3NCPA 1MDUB 4I0WA 2ISOA 3BS5B 3SMZA 1ASUA 3F41A 1RI7A 2D3OR 1SC1B 3LPYA 4NCGA 2QWPA 3SR6A 5DG7A 3AVBA 3OYDA 1SV5B 3MTJA 5ALRA 4RNFA 3BQTA 1RWNB 3RF9A 2QWQA 4FF1A 5AQSA 1F5BA 1LK7A 2WFBA 3J8AA 3AA4A 2NV3A 4ANDA 1CXQA 2BKNA 3W2VA 4IJAA 2VFUA 3JPSA 4QIGA 3FUYA 1X7VA 5L1LA 1D8BA 2Z2YB 3UD5A 3M32B 5IWAK 4ZPCA 3BQ7A 3PEJA 4I28A 3BPSP 4F4YA 2FHJA 1EQMA 6AT1B 4JI8J 4GW6A 4DR7J 3BBCA 1PZNA 4AYBC 4YMNA 3H42A 1P1TA 4B3SJ 4DFMA 1Q4RA 5HMLA 9ATCB 1HYSB 1F0MA 1P90A 1T44A 1RWKB 2Q0RA 1QJHA 3RBEA 4JK1A 1TL7A 2ZEJA 3L4PA 1PGZA 1RTJA 2OPQB 3QSIA 4KITB 1HI0P 3C46A 3QT8A 5HLFA 2W4CA 3W2VB 1MQ3A 4M04A 4CI6A 1NBEB 2ZBRA 4K4XA 3CCUS 2BANB 2GMHA 2P9NB 3O2IA 1B43A 3NG8A 3D0HE 4DPUA 5SZTA 4HHHA 2BA9A 3SFGA 1TV9A 1TKXB 2BQUA 1JLCB 3TQ1A 4C80A 3IG1B 3P1GA 1OYEA 1UETA 4X84A 4LFBJ 1VQ8S 3CIPA 4DX5A 3AA2A 4UY85 8ICAA 1H2VZ 4PGYA 2QMUB 2D41A 3KWMA 1VBXA 4RG8A 2FTRA 4Y2PA 1Q5VA 5KFUA 2ERRA 3VQ6A 4USIA 3DLKA 1KP6A 1S59A 2ITGA 2KXFA 2QE5A 4Q2MA 2F8KA 2HBKA 4PUOB 4E1JA 5BXIA 3LDNA 4I4BA 3E1YA 4P2XA 1RUSA 2HHSA 1LQ9A 1RXVA 2O8FB 4CYUB 1DARA 4DV7F 1F9HA 2M4MA 4CRJA 4K4UA 4WXOA 1S8OA 3V81B 2HRUA 2RKIA 4CP5A 2IS3A 2WAQD 9ICCA 3DM2B 4P75A 1F60B 2YKNB 5CYQB 2I2YA 3K5PA 3EL2A 4KI6A 4H54A 1V38A 1N5QA 4GVEA 7ICVA 3KWIA 2JZBB 2VD3A 2DO0A 4DQSA 1VIOA 4YD2A 1X4CA 2B4OA 3I28A 4DV3F 2KP7A 2QFIA 3NRZA 3A4TA 2HW3A 1VRUB 4BR9A 3SBMA 4DS4A 4YDXA 2KXNB 3JTNA 1NK6A 4NB4A 2GW8A 5J8YC 1WEZA 3K7RA 3V81A 5KAFU 3ATVA 2KT3A 4DHYA 2KM8C 4U8VA 2YKNA 2Z2ZA 2QG9B 1D9FA 2ILZA 1IG9A 1Q95G 3DOLB 3M1VB 2R7TA 3OYBA 4FLWA 1TL1A 4DUTA 3Q8SB 2VPXB 2RB7A 4AE5A 4DV6J 2HQIA 4PXBA 2CADA 2J0WA 4YG2A 2CWKA 3SEIA 1CC7A 1HUZA 2VV5A 4A8OA 3SDEA 1VQ4S 4J9NA 3MPVA 5LXYA 1O51A 2YQ0A 3T9ZA 1M5VC 4KIAA 3TA1A 3KLEB 3TAMB 1IIPA 2NLXA 3QZ8A 3HX9A 3DLEB 3W9HA 4F4AA 3ENHA 4RBTA 3BREA 3MR7A 2C3OA 1IUJA 3MCOA 2KMDA 3V72A 5L1IA 1DTTB 4RCHA 3H8SA 2NYHA 1S57A 3AOAA 2MZJA 3H98A 1VC6A 1YJNN 3IC1A 4L76A 4I6YA 1JALA 3M8PB 3HM9A 1B7YB 4RT3A 2OIHA 5AKLA 4NYOA 4JI0K 5FDLB 2V69A 2IMWP 4ZP7A 1RWUA 4RQ8A 1ZETA 1H2TZ 4TQRA 4IC9A 2D0CA 3UXPA 1RCHA 4UAZA 8ICMA 1SC3B 4FWKA 5HRRA 2HNZA 3E2EA 2DRAA 7ICKA 4X66F 5KOWA 4IDKA 4AF1A 3ZDAA 4B9TA 4W98A 2AIRB 4NXNK 1Z4UA 1MWMA 1QHTA 1U9LA 2YN4A 4RQ7A 1PVRA 3ALRA 9ICUA 1HBUA