3QU5A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp11asn mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
221
structure length
221
Chain Sequence
KLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 82
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu5A01
3WKBA 2P9JA 3WK9A 4IFTA 5AM5A 2WF5A 1T5TA 2G80A 3FZQA 3UMGA 2IYEA 4YCMA 5AKGA 1Z4IA 5AW5A 3IRUA 3U7FB 4YIHA 1J8DA 1T5SA 3WK4A 2QYHA 1U02A 4CNQA 5ALIA 3QU2A 2HI0A 1YV9A 2FUCA 2ZBDA 4IG4A 5A3RA 4QJBA 3QU9A 5AICA 1YDFA 2CFTA 1TJ5A 3I1YA 1WZCA 4ZEXA 5AIAA 5ALYA 3NIWA 3SHQA 1EK1A 2WHEA 2FPSA 4EX7A 5ALJA 2G06A 3P96A 4CF3A 2FEAA 2IOFA 1N9KA 2OM6A 3AR2A 4G9BA 2YJ3A 5ALRA 3B9RA 5IT4A 2ZXEA 3QXGA 3QU7A 5AVYA 3EF1A 4YCLA 4EENA 2ZBEA 4YGYA 2OA0A 3OCVA 2IA5A 4GXTA 2R8ZA 2G0AA 4EEKA 4JB3A 3ZW7A 5AI4A 5AM0A 2WF8A 4AS2A 2RARA 2WM8A 3ZX5A 4BNDB 3L8EA 1MH9A 1Z4JA 4BX0A 3W5AA 3AR8A 5ALNA 1PW5A 3QGMA 1RKUA 3MN1A 5ALSA 1NNLA 5IS2A 4XPZA 1RQLA 5AI0A 3DAOA 3QUBA 3UMCA 2YY6A 1ZJJA 3U7EB 1X42A 3ED5A 3KBBA 1Z5GA 3OCUA 3ZVMA 1N8NA 3L1UA 4G63A 3OTQA 3VAYA 3QUCA 1RLMA 2I54A 2C4NA 2HO4A 3WGVA 4UARA 3HLTA 2ZG6A 1L7NA 1Z88A 4OD0A 5AM4A 2B0CA 2HSZA 3N07A 2R8XA 3E8MA 5FP0A 4UM5A 1TE2A 2YJ6A 3D6JA 2YJ5A 1ZD5A 2MSNA 5AHXA 1LTQA 3NALA 3PGLA 5AVSA 4MUMA 3B8EA 3W5DA 5AVUA 1RKVA 2CFRA 3QYPA 2AH5A 3MMZA 4EZEA 1EK2A 3QU4A 1Z4OA 1RLTA 1L6RA 3W5BA 3EWIA 4XE5A 4OCZA 3AR6A 3OCYA 1U7OA 4Y2SA 3B9BA 5ALKA 2W43A 3J7TA 5AVWA 2C9MA 1QQ7A 4UU1A 2MU2A 3I28A 3AR9A 3N5KA 1O08A 3E58A 3RF6A 4B6JA 2HDOA 2B8JA 5ALVA 4Y3UA 4KYTA 5AW1A 2HEGA 3I6BA 1FEZA 3ONNA 5E0OA 2B1QA 5AI5A 2I34A 4NFLA 3A1EA 1YJ5A 3NANA 4YCNA 2YMQA 3WKEA 2HX1A 2R8EA 4KNWA 3WKDA 3IJ5A 2W11A 2HF2A 3U26A 2I7DA 2I6XA 3AR4A 3SLRA 2GFHA 1QYIA 5AVZA 4KN8A 3L0YA 3L8FA 4HGRA 4EELA 4UW9A 2FPUA 5AW8A 4ZEVA 5AKEA 1WVIA 3ZTYA 3E84A 3FM9A 1U2TA 4CF4A 3NAMA 2HOQA 5AI8A 4CF5A 1WPGA 4F71A 4FFDA 4BNDA 3N28A 4UMFA 3U13A 4UMVA 1F5SA 4I9FA 5AM1A 1L8OA 2FPRA 4QQFA 4BYGA 4DFDA 2O9JA 2GMWA 2P69A 5AKKA 3SF0A 3W5CA 3HYCA 3L7YA 5ALHA 2EARA 1RRCA 5AKJA 1NRWA 5AKHA 4Y2VA 1K1EA 3BWVA 5AK5A 5ALDA 5ALMA 5AKLA 3PCTA 2NO5A 3L0BA 4UU0A 1O03A 3KD3A 3KDPA 5ALZA 4L6AA 3M1YA 3QLEA 1J97A 1L8LA 4H1WA 4PNHA 5ALQA 2P11A 2Q4TA 2GO7A 5ALOA 4UMDA 1S8OA 1QQ6A 2RBKA 1YNSA 2QLTA 3QU5A 3R9KA 1RPZA 3BA6A 4DW8A 2YFYA 4BX3A 1ZRMA 2IOHA 5A3QA 2RAVA 2CFSA 1Q92A 3IB6A 1Y8AA 3SKYA 2C88A 1TJ4A 2FUEA 1TA0A 2R8YA 3QUQA 1Z4LA 2IOFK 5AVXA 3QX7A 1QH9A 2MU1A 3ZX4A 5AIBA 3AR7A 2BDUA 1RMYA 4L57A 2C8LA 2AMYA 4BEVA 3ZVNA 2FPWA 4UASA 3ET5A 1Z5UA 4OHFA 1JUDA 2BDEA 2JAOA 5AW3A 4E88A 3RFUA 1VJRA 2FDRA 5AKYA 2D2VA 4UAUA 3MPOA 2B8EA 4Y2RA 2ODAA 5ALEA 2CN1A 3L0CA 1LVHA 5AKXA 2YBDA 5A3SA 3AR3A 5AI9A 3S6JA 1RDFA 5AVTA 4BEWA 4XOUA 2NYVA 5AVVA 3L8HA 2YN4A 2W4MA 5AW7A 3ESRA 1Z4MA 4BX2A 1U2SA 4KX3A 5AKZA 4FE3A 2Q4RA 5AW6A 3AR5A 2YMPA 2ZBFA 3F9RA 2YMMA 1RMQA 1SWVA 5AW9A 5AK3A 2C8KA 3K1ZA 4Y2YA 2ZOSA 3A3YA 3R4CA 2EAUA 2DQSA 5JJBA 2PKEA 5AKIA 4DCCA 4Y2JA 5AVQA 3L1VA 2AGVA 2FI1A 3FGOA 3NUQA 4RESA 4NAVA 2BY4A 5ALWA 1Z4KA 1ZD4A 3QUTA 1CQZA 2OBBA 2JAWA 3WKCA 4HGPA 3KC2A 2NO4A 5ALUA 3N8GA 3ZUPA 5AM2A 1WR8A 2WF9A 3DV9A 4J03A 3FPSA 5AW2A 1T9ZA 4ZEWA 3SKXA 3NRJA 3A1DA 1VFPA 1XP5A 1Q91A 1KYTA 1L7OA 1U7PA 3KZXA 3EF0A 3OPXA 3WK7A 2G1AA 2JGAA 3ZWKA 4FYPA 4NABA 5T41A 2YJ4A 4Y2QA 2HHLA 1RKQA 1ZRNA 3E81A 4OFZA 1ZD3A 2I33A 5AI6A 4HGNA 3M9LA 4Y2PA 3ZTWA 3WK6A 2WFAA 5AESA 1SU4A 1QQ5A 3SMVA 5AK6A 5AVRA 4BBJA 5IT0A 2FPXA 1YMQA 4KX5A 3L5KA 4HAIA 3TLMA 4DWOA 2HCFA 3ZVLA 3U7GA 2ZBGA 2B82A 2WF7A 3L8GA 4AP9A 2GHQA 1YS9A 3OCZA 4NV0A 4Y2UA 1VJ5A 4Y2XA 4L6CA 3FVVA 4YIKA 1SWWA 3DDHA 5ALPA 4UM7A 1S2OA 3WKAA 1RMTA 2JAUA 2OYCA 4I9GA 4BKMA 2HF7A 3MC1A 2GHTA 5ALXA 4HGQA 4C4RA 3KOOA 4UAVA 4XQ0A 1RC8A 4KNVA 1ZS9A 2B30A 2G07A 1RQNA 1L7MA 4C4SA 5ALLA 4AS3A 5AW0A 5AM3A 3R09A 3WGUA 1AQ6A 3ET4A 3GYGA 2O2XA 5AK4A 5ALFA 4C4TA 2B1RA 1Z4PX 1IWOA 3ESQA 2VKQA 4RETA 4YH1A 1XPJA 1ZOLA 2P27A 2RB5A 3CNHA 2G08A 2Q5EA 3U19A 4F72A 3CZ4A 4EX6A 3OCXA 4HGOA 1CR6A 3A1CA 3U7HB 3DNPA 4MWOA 3NASA 3WK8A 4HYTA 1Z4NA 2I55A 3ZI4A 3FPBA 3I76A 5ALTA 3PGVA 3WK5A 3OCWA 4J2TA 3PDWA 4NWIA 3ZWDA 3QNMA 2EATA 1XVIA 2AUTA 4O8CA 1ZD2P 3UMBA 2G09A 2YMLA 1Z4QA 5ALGA 4JDPA 4UMEA 3N1UA 2JARA 1L7PA 2PQ0A 3EPRA 2PR7A 4Y2TA 1NF2A 3ZU6A 1RLOA 4CE6A 2X4DA 3SD7A 2WF6A 5AW4A 4GIBA 4UATA 3UM9A 1TJ3A
chains in the Genus database with same CATH superfamily
1LXCA 2ZU6A 2XRZA 3F2VA 3I9KA 3QFSA 2G80A 4JFAA 2WNSA 3INNA 3QVOA 1M1YA 3LCRA 1M6VB 3L9WA 1WCV1 2O3UA 1CDOA 2VTVA 1HDYA 5D3ZA 4DUYB 4TTQA 4HDCA 2PXIA 2G25A 2ODQA 2VJKA 2QJRA 1M0WA 4ZI7A 4AJHA 2O0LA 4II2A 2IBTA 4EEYA 4HDNB 3O4RA 2Y1JA 1DFIA 4PLGA 3H0KA 4F21A 3FUUA 4PGHA 2ZTEA 4YRSA 1EXVA 4P4MA 4CMKA 1N8NA 3ND8A 2ZKLA 4JLVA 2D5AA 3W5JA 5FP0A 1TO1E 3G6XA 3WGKA 3KEFA 1EG7A 2PFSA 1PV1A 3FN4A 3ZH2A 4UUAA 3JYQA 3EIHA 4TURA 2YIDA 1RWWA 5K3AA 3V2GA 4M86A 1LW6E 2PAFA 1TAMA 1I7NA 3TQIA 1EE9A 4I4TA 4LOJA 3SEIA 2HV9A 1E3LA 3E22A 2YB4A 3N0WA 2AUMA 3NBUA 1DDIA 1AIPA 3IUPA 3OO0A 1FUIA 3CLTD 4TSKA 4ACAA 1IL0A 3WP0A 5JYEA 4NJ8A 3W6PA 3U37A 1YDGA 3D7SA 2XB6A 3BRQA 1M2FA 1TGVA 5FI5A 4OVKA 1N2ZA 3VHRA 4EUSA 1ESZA 4B48A 3RUDA 1F0KA 1K27A 2PSSA 4FCVA 2IDJA 3KYIB 4C6TA 4D4IA 2VYCA 2GMWA 4BB0A 4E5DA 3BQ9A 1R3DA 1T0IA 2FP4B 9ICVA 1ZM7A 1F7VA 3EF3A 2ETXA 3L4BA 2JFOA 2JAPA 2F00A 5AOAA 2QUHA 6PFKA 4R05A 1WQ4A 1UMDA 2I71A 1Y88A 4D9CA 3CPJB 2IH4A 1MENA 2RC5A 1OILA 4YPVA 2KP7A 4KN5A 4AP6A 3M4XA 2VNIA 1NUAA 1U90A 4V3CA 3QUQA 3ORRA 3MSCA 3DD1A 3H1EA 2YNMD 4MVJA 1G6KA 3SDSA 3IKMB 5JU6A 4QOJA 1AKRA 1KO8A 4TUSA 3BWBA 2BN4A 3LT2A 2ZXFA 2Z9DA 4FEAA 4M9GA 3DAYA 3NBKA 1Z45A 3P97A 2EJWA 4PSDA 3RC9A 3QI2A 2BHSA 1Q3UA 3AF2A 4LXYA 4FW8A 5DTMA 4QUEA 1MIOA 1MZVA 4YRDA 5FEUA 3LUAA 1BX1A 2L2QA 4CDGA 4LHWA 1L1QA 5JSHA 5C8YA 1WXQA 2GJAA 3Q7RA 4DC9A 3T5HA 4NAVA 2GFIA 5KAFU 4XDGA 3RVJA 4N6OA 1IBMB 4N3AA 4IJKA 2QGZA 4U1RA 3R7AA 2EFYA 2IITA 1P77A 4KN4A 1QZTA 3HU2A 2E8OA 1UF9A 1TUBB 5HKOA 2IEAA 1J0AA 4CMJA 1NJWA 1VLBA 4G8DA 3ETLA 2GD2A 1C9NA 2KG5A 4GI7A 3U0BA 2UZ4A 2GUWA 2WLTA 3DJYA 3TL6A 3IAM6 4W7SA 2C58A 1HL7A 1OWNA 1LLDA 5E79U 2DYKA 3RH4A 1GCGA 4R3NA 4LE2A 1Y82A 2QTCA 3N6VA 4QBKA 3GDOA 3OE1A 3U60B 2R5NA 3K53A 1UBCA 4CMCA 2V03A 4C78A 4BRUA 2PJZA 1W73A 4RD3A 4F56A 4B6GA 1XA0A 5GADl 1ZYQA 4D3ZA 3CNHA 2Q5EA 1KDYA 2PFGA 3CZ4A 4LHXA 3NDRA 4BGEA 4JV5B 2OXCA 1SV0A 4RTNA 1E7RA 2RAUA 1WD7A 2RH5A 1JJIA 1ID8A 4NWIA 1SXHA 4H3KB 1JPUA 2HM7A 2GRUA 3LW8A 2UZ3A 3G3EA 3WGYA 4MWCA 3PR5B 3M6MD 2VQ3A 4O2AB 4EG1A 1YR9A 5HCNA 4KE6A 1LUAA 2AEEA 4JP2A 1B16A 2OO5A 4ZV4A 4IKPA 4FYYA 1EZZA 3ZHYA 3NB0A 4DA8A 1Y4UA 3CNLA 5I7AA 2GN0A 1YMVA 3BSYA 2HGSA 1XL0A 1U63A 4US8A 3V9PA 1DIAA 3D3WB 2V7EA 2I1LA 4QXQA 2Y0CA 4OXNA 4B3XA 4GWKA 4E22A 3CZ5A 4YO8A 4B0PA 4F3KA 1AQUA 2X5OA 1J0CA 1DSSG 1O95A 5H2FU 4B84A 3G7SA 4WESA 3D4PA 2ZI9A 5BVGB 4XSGA 5EZYB 3FAHA 4MF2A 3FETA 2N1MA 2EKZA 1YBHA 3KXLA 1KL9A 1UDWA 4DIDA 4CKEB 2I6GA 2BKXA 1K6JA 3KUUA 1AZSC 4FFVA 4EZEA 1G8FA 1H0KA 4E70A 3A25A 1RC0A 1Q0HA 4B3FX 5K6TA 2Z58A 5A7FA 1X66A 1CC1S 2XJ4A 2GCOB 4CUKA 1QQ7A 4DLXA 3RSZA 1Q95A 3EEBA 1W96A 1Y8QA 4NFLA 2H2HA 2YYSA 4BO0A 1TGYA 5A0TA 1USWA 1ZVQA 2BFCB 4BFZA 5TT1A 2Y2UA 3HBAA 5HZMA 4NBVA 2XV1A 4FZJA 1ORWA 2FPUA 4XOIA 3OUZA 3TANA 5KG3A 3G2HA 2PZ8A 3R7FA 3WIOA 1MPTA 2MUTB 3IHQB 4OHXA 2JI4A 1OGIA 3BGOS 4F5ZA 4K8RB 5ALHA 2P67A 1FS5A 2LYAA 3BWYA 4KDEA 3RLIA 2OG2A 5BNZA 1GQQA 4RYLA 1TKRA 4G5FA 2MINB 3OC6A 1N2CE 4JB0A 3JYOA 1Q6ZA 2AVDA 4LTMA 4D74A 4ZC1A 4RPKA 5H83A 4OJ6A 2BI4A 4D9BA 2IXAA 1BOOA 4BTLA 4F12A 3TUJC 1ODFA 1Q17A 5LQCA 1B0XA 5AXBA 2P9FA 1E5LA 4RDHA 5TF0A 4YLEA 3GLIA 2E6UX 4WJKB 2KOBA 3U7QB 2NU7B 1E3DA 4DIEA 2O07A 2QM7A 5JBQA 1DMRA 1RJ9A 3D7MA 2AL7A 3W2TA 2EHDA 3NUQA 1G5HA 4DLSA 1NFRA 4HY3A 1R00A 5KT5A 3V8PA 1PI3A 3CUSA 1OLXB 4CIVA 3L93A 1DFGA 4NDAA 2OBYA 4DQSA 4F8EA 3L7LA 3QLJA 1ONBA 3IP3A 1KQGA 4KFCA 4OPMA 1XYYA 5E7JA 1F2UB 4ZJZA 1U8UA 1OTYA 3CO5A 3LPDA 4M9RA 4Q3OA 2PLAA 3KALA 5AK6A 1ZQCA 1MX1A 4XUGB 4PG4A 4Q15A 4EIWA 5BSUA 2ZTHA 4NBWA 2UAGA 4JXXA 1ZXXA 2HMSA 4X3PA 5H0IA 3CY6A 3W8FA 4Q47A 2M98A 5IK2A 4C07A 4NBLA 3KU1A 2UZ1B 3N05A 4FXOA 3GZNA 4LF4B 3ZS8A 2GK6A 1FSFA 5EXSA 1W0JA 1G2PA 2M6SA 1JV2B 2EJBA 2ZJ6A 2W71A 1FMTA 1TTTA 1LDNA 3S2ZA 2KZMA 2HHCA 3EVGA 4FS2A 1SBQA 5HCUA 2RD2A 4R9SA 3EDYA 5JR3A 4DADA 4RDXA 2PQ2A 4C7OA 2OO3A 3WNVA 3THRA 3PFWO 1U02A 1GO2A 4YONB 3NRZA 5EZ6B 2CB0A 1X2EA 3H6GA 1U94A 5LOVA 4Q6BA 3MGVA 1C7ZA 2ODTX 3D1VA 2R65A 4JOSA 5DHUA 4UBCA 4PGMA 3C5FA 3E70C 5KNCA 2IV7A 2VS1A 3V6JA 2GPYA 5EEGA 4KLQA 2VWQA 4MYSA 5GTHU 5HFJA 4PW0A 3FTFA 5TRTA 4OYHA 1SD1A 3H5OA 1E9EA 2YKGA 4BNWA 2C4NA 2XDQB 1X7WA 4HRXA 2J3EA 4PHGA 4C1NA 3HUDA 1JZQA 2QN3A 2NAFA 4G4IA 5B66U 3PGLA 1E1KA 1NPDA 3SBOA 3CCBA 4PR3A 4K46A 1SA0B 2CUTA 2VSFA 2FFHA 1X6VA 4R69A 1QM5A 1OC2A 2EKLA 4DEXA 2CMGA 1KI6A 2BCGY 5CB1A 2FEXA 3ESBA 4K81B 4HB0A 3HABA 4R7ZA 4QATA 4I50A 4BO8A 5CDYA 2CKDA 2X8LA 5GM1A 1BXGA 4LQ4A 4DSTA 5KU7A 4QU5A 4PXYA 1NPYA 1UK7A 5A7HA 3BCHA 2CYCA 4EPTA 4P31A 5JMTA 3QOWA 5FTMA 3KKNA 3QKUA 4ZANA 3FAZA 3OFNA 3GD5A 2A9PA 1R0YA 1E7YA 3NVWA 5EPUA 4RWZA 3QEKA 1IZYA 4I3GA 1VKOA 5LP6F 5AK5A 3DEHA 5FLYA 3FUXA 2P4SA 2C7VA 2X0IA 1ZFNA 1W2WB 4M8KA 2BISA 4IQTA 4GMFA 3K0BA 3P52A 3RTCA 4N8DA 5EHNA 1QQ6A 2YINC 2YFHA 3PPIA 3RSLA 1VMDA 4X8HA 2ZREA 4JP8A 3AHJA 3LX4A 4FWBA 4HLUA 1QH9A 2JF0A 1D6NA 4NMWA 2QDXA 8ICIA 5I01A 3I23A 3VNSA 2RI1A 3V6MA 4KLRA 5A4DA 1S96A 4HPWA 1G8MA 3RK4A 3DR3A 1XP8A 3IMKA 5JE8A 2IIBA 4J7UA 2LPEA 5FUBA 1WSDA 3OM1A 5KQPA 1RMQA 1KEEA 3S81A 1KYWA 1BGVA 3KHGA 2D1FA 5KTKA 4RXMA 1AGPA 2IMWP 4A15A 4I1SA 2HWXA 1OV4A 2QSJA 2C9BA 3FPJA 5ABPA 2OGUA 5ADVA 2ZRPA 3E7XA 2EG5A 1QWSA 2JJYA 4RHYA 3CZAA 4CIWA 4U2BA 3OT1A 1GXSA 4ZTBA 1OJ7A 3A9SA 2YJ4A 3NJRA 3AUAA 1SY7A 3QIVA 5JCOC 3HA2A 2RFLA 1UCVA 5IT0A 4EHLA 2AEMA 4V1CA 5B3JC 3QMVA 1CWUA 3WQQA 3U7GA 5M04A 4OLAA 4BB5A 2WHXA 1OZFA 1G8KA 2H0QA 2J4FA 3N2GA 4N54A 2AF4C 1DAFA 3TTSA 3OU2A 2AYXA 2GK7A 4KFSA 4TKZA 2DKNA 1FU7A 1BPZA 3NC1C 1W4CA 4NOMA 1JBEA 3R9WA 3NASA 9ICAA 1CERA 4HQ6A 4C0HA 3E23A 1H2BA 3HB1A 4MEJA 1AKMA 3F90A 1BPXA 2F17A 2JGJA 1IMOA 5ALGA 2JIZD 2O1WA 4LRWA 1N0VC 2AF3C 3DYBA 1SVUA 1ISSA 2WIDA 2HL6A 5IABA 3KSRA 4ESVA 3SAGA 1CDDA 4Q9KA 3GRPA 3WZ2A 4DO9A 4NFSA 5J8YC 1FVOA 4CLRB 4MS3A 3RANA 3BYZA 3L6DA 3RVBA 3HCWA 3LOQA 1OH7A 4MRSA 4PX3A 3TMKA 5ALRA 5IT4A 4DA6A 2XECA 1VA4A 4I8IA 1C7JA 1JE1A 4PG6A 2H3HA 4ZCSA 1AVTA 2YWGA 3ABRB 3W5AA 5CHGA 4EF4A 1FZQA 9ICEA 3W2EA 1L8XA 3SHTA 1KK0A 4WE3A 5IKEA 3H86A 3QOXA 4RFLA 3RS0A 1DU4A 4EQZA 1UC8A 3OE7A 2CB9A 1X7ZA 4DNFA 3BFVA 2JXJA 1A97A 5C8ZA 5EERA 4B3CA 1J2JA 3ELBA 2I87A 1Y1LA 1KEKA 1XMPA 5TC4A 1V1RB 3VU9B 4KN6A 4R83A 5F23A 1LV8A 2Y4OA 1OAAA 1COWA 2XMRA 4EF5A 4V0ME 3A2MA 4O5EA 3VVCA 2OG1A 3C3XA 4LMBA 1QVRA 3O92A 1DBVO 1YRLA 3H5NA 3PNVA 1ISFA 2W11A 1U7XA 5HBGA 3JPPA 1ZIPA 3FOAA 3OAAA 1T3QA 5FPKA 1S4MA 1IHPA 3PUXA 4YALA 3WL8A 5FIUA 4KLAA 3C41J 3HI4A 3ITNA 5EHIA 3NAMA 3VSCA 4WRRA 2ZIGA 4QHSA 4K88A 1M7GA 2DUMA 1GN9A 3KKEA 4GKKB 1UADA 1IH8A 1NOJA 3L0BA 2CVQA 1N8KA 2TMGA 3B36A 2Y1CA 1YXMA 3LYSA 5CLQA 2QBYA 5K2MA 3EWNA 2XUFA 5F12A 3Q0TA 4GAEA 4Z2YA 4BX3A 3D5TA 4XFDA 4QZCA 4GEGA 4C05A 4L15A 3K1YA 1BDJA 2YY7A 1ZCFA 3MDCA 3CF0A 4GICA 2DHCA 2R7KA 1H85A 2XZTA 1ZLYA 3ISCA 1I24A 3AUOA 3WR5A 2XT6A 5CYGA 1T3LA 3PQFA 4RDIA 4MGHA 3DE3X 4C30A 2IYSA 2X76A 5KFKA 5EE0A 1UINA 5A6VA 1LY1A 2ZOSA 1XWWA 3IHLA 5D87A 3Q8SB 4P0PB 3WIUA 5J0PA 4U0JA 2XICA 4AFNA 5KFQA 3UTDA 4DPLA 5IMSA 3DPUA 1O2DA 4IL5A 1X86B 4M54A 4C7VA 5CLHA 3B6ZA 1M5RA 1I32A 4NYJR 5JCZA 3C48A 3PUWA 1RZRA 1ZRNA 3LFTA 1DBQA 4NJEB 1WDLA 4E2YA 3C23A 2WJGA 2OENG 3PY8A 2AZ4A 1RQPA 2CSXA 1SZHA 3K09A 5EJFA 3EPPA 3TGPA 5FJIA 3ZJ4A 3TOVA 3OLQA 1K4MA 2WY2D 1QSYA 1I80A 4WK0B 4Y2XA 2CT8A 4KRFA 3IUQA 2R1VA 2H3VA 2BFFA 4CV3A 1ZUIA 1J33A 4JGIA 3QKWA 1PDOA 2Z57A 4NRDA 9ICKA 1KI3A 2YW2A 3L4PA 2P30A 2O2XA 4UFPA 2QV7A 4ZAGA 1ZOLA 5BSWA 4LOKA 5FUVA 3CKMA 4BMVA 1NTRA 1EM8A 3JQ7A 1DJNA 3IE2A 5IAJA 3GARA 3Q7PA 1RG6A 3LY8A 2C94A 2IHNA 4EITA 4ZVMA 4XVHA 4C8LA 1EX7A 4E5PA 3D5QA 5E8RA 4ZQIA 4Q05A 2OCAA 5CXSA 5FPQA 3J81k 2CMKA 1UOQA 2ZTSA 4L5CA 5TEVA 2OM2A 5K8IA 1P75A 2FUCA 4A03A 2K4EA 1WZCA 9ICMA 3ZR4B 1FX1A 1JWBB 3GRKA 1AXRA 4F4ZA 4MIEA 3TG2A 2HJRA 3DOHA 1I4WA 3K73O 3P2IA 1WULS 5H7XA 4QEDA 2QU7A 1RADA 3B9RA 4GDFA 5F9FA 3ROXA 1F2DA 1AUOA 4CUZA 3VAAA 4I14A 1ZLXA 3JD3A 4ED0A 2G9QA 4U6SA 4RQTA 5IDQA 1J09A 1ZVMA 4NK4A 2E8MA 4EI9A 5JXGA 2IOYA 5G5GA 4YHHB 3W6ZA 2A5DA 3TECE 1W2GA 4TUQA 3AJAA 1TMOA 5SZIA 2ZG6A 4FYJA 5KG7A 1JHAA 3T52A 1M1XB 3OJXA 1GEEA 3ACCA 3PICA 1KFBB 4QWDA 1ZQ9A 1CUBA 1P0MA 2QTFA 4RK7A 1BW9B 3SU8A 4M9QA 2ZKIA 3M8KA 1L4EA 3EVEA 4HAVA 4YAEA 4RV4A 2G5IB 1QHSA 1IZ7A 5ICEA 3M4ZA 1VKJA 5IKPA 2I34A 2AK3A 4TQSA 2V7PA 2FQQA 2UYHA 5IH7A 1EGMB 2KJ9A 3R8CA 2ZBPA 4C2TA 3T5KA 4QA9A 4DBVO 2EW1A 1TVEA 1NLMA 3ROGA 2YN2A 4TT3A 1ZZEA 4CF4A 1OW5A 3T1YB 2KZ3A 3HVKA 1N5LA 1JSXA 2XGPA 5A2QA 5CFMA 3EA4A 1NBEA 2WU4A 3IILA 4H6PA 4QU0A 3EEOA 4HUJA 3ZWAA 4I5IA 4BCDA 1FFDA 4QDXA 3VOSA 2RBEA 2BBWA 2UYYA 1SOWA 5DYWA 4ZI3A 3E4DA 5IXJA 2M32A 3VOBA 3TPCA 2FMQA 2E3TA 1Y8AA 3ZHCA 1XJWA 5F7OA 5AUPB 1VPWA 3V42A 3M82A 4E03A 5EIXA 3SE7A 5CEEA 3C3AA 1N33B 3RBZA 4ID9A 1IG0A 4R0MA 4IRDA 3MPOA 1VP9A 4Y2RA 2OFOA 5A3SA 1WVMA 2MCFA 1HY3A 1Q1QA 3UXOA 4KVZA 4XOUA 4RQ0A 3QPBA 2D7DA 3HNOA 1P3DA 3KQUA 2DH6A 5JD4A 4LRXA 3NVYA 1UH5A 4RPJA 2CNWA 4C0ZA 3H16A 3NOOA 1E2FA 1RWQA 4DCCA 5FOUA 2X8BA 4M99A 3WQBA 3CLHA 1F8FA 2AX3A 2A9FA 1OXUA 4OHPA 2HQ1A 3H8VA 2NVBA 1I9CA 1NQTA 2BZSA 4ALLA 3Q8RB 4K9DA 1WMSA 1PJTA 1N6RA 3LTNC 3KR1A 3ZOZA 2C77A 1U1CA 4CTOA 4ND6A 2BFDA 1JQAA 3OP1A 1Z63A 4U7WA 2HWWA 2GARA 4JV2A 2C7RA 2JFBA 5TVGA 5T5QA 2W2QA 3LVVA 3LLCA 2UXCB 2UZAA 3U4QA 2OV3A 3H11A 2D6FC 1JQBA 2X4LA 3ZE9A 2XNKA 1VJ0A 2XDAA 4INJA 4BGVA 2DPLA 2GZDA 4HYEA 1RQXA 4WACA 4EA7A 1YR2A 2PUVA 2M2IA 1VSUA 3JWHA 4JX9A 5EKXA 2OHFA 1ZQGA 1U7DA 4I5DA 2JDIA 4EB6A 1W85B 3RTAA 4W5QA 1EFUA 2UYOA 3MELA 3V4ZA 4QU8A 3TLGB 5AQEA 3IQIX 4J9RA 1NKTA 4A0SA 5TDHA 1V9SA 4IDFA 1IPHA 1SZPA 2ARKA 1TKDA 3VZRA 3SYRA 3VR4A 2NRWA 4P7FA 3NKLA 3OPYI 4NQZA 1U28C 1IY9A 4KQHA 1N6PA 4IJ5A 4MVWA 3C6MA 1W36B 1BYUA 4KR7A 4YDRA 4QLOA 2SNIE 2HC9A 1C7EA 2R8JA 3F47A 2LM4A 2ZT7A 1XEXA 2EFCB 3OH8A 4EYHB 3IALA 3N8IA 3HDVA 4GT1A 2V7QA 2VATA 3G6WA 4FCTA 4U00A 2XNDA 1NBOA 2ZR8A 1Y63A 2JJ2D 4F9TA 5JAHA 1JHDA 1DWUA 3V6HA 4RE6A 4IIUA 3EUAA 5IFLA 2JI8A 2JAXA 4QLAA 2ECKA 1YL7A 3TEMA 2VHCA 4OHRA 1MDBA 1RAAA 2ILTA 1MH9A 4F2PA 3PDIA 5JYCA 2ICAA 4OQNA 5ALNA 2HA6A 4MS1A 1MAWA 3IMFA 4MR8B 2BMAA 3QUBA 1DT3A 4DCUA 3WI7A 4JLAA 4P08A 1PFWA 1ZQAA 1TAUA 3PSHA 1COKA 2I3BA 4RNMA 3C3PA 2DLCX 4GVLA 2NIPA 2V5AA 5JEEA 2HBMA 2CLFB 5KTNA 1NN5A 3COJA 1D6JA 1P5RA 3BXEA 1RWPA 1J70A 4MUHA 4Y6GB 3MLBA 3HP6A 1M1NB 1D7AA 3W5BA 3NRWA 5UKDA 1K2VN 3LVQE 2QM3A 4CKZA 4GSYA 2VPXA 3JD4A 5GTIU 4R9VA 3CG0A 2ZJ3A 1ADBA 3AESB 4IH1A 1KRPA 1XKQA 3WLAA 3LO8A 2BMVA 4JLBA 2EBWA 1X80B 1NW9B 2IDMA 221PA 3NTLA 1GLVA 1K3TA 5DN6A 1EQAA 1U7ZA 1Y6FA 2ROQA 1CJMA 1E1CA 1H2ZA 3MRXA 4L4ZA 1M8GA 1XYGA 3DUFA 4KJXA 3M6FA 4NULA 4GBGA 3RB3A 3IP6A 4WOBA 2D0DA 3DXYA 3BJZA 1J6UA 2G6BA 1DARA 1OXSC 4OSEA 4UNRA 1HR0B 1M33A 3C5CA 5G0SA 2HOFA 5KFSA 3O3NB 1G2IA 4RF5A 3ALRA 3PQ8A 2QJOA 1W4LA 4IOLA 3HCDA 5KX5A 4Z4CA 2OQVA 2PRSA 2Z1DA 3G9XA 3QXSA 2GZHA 1BJTA 1SHZA 2AIRA 2CHEA 5T3UA 2W3RA 1RZ3A 5IKXA 2WAYA 3GXBA 5T64A 1ZW6A 3I32A 3OZXA 5JAQA 1DO8A 4DR2B 4QYXA 1KO1A 4KNYA 1FFHA 2OK7A 2ZULA 5AW3A 3UGKA 1KH2A 3UMSA 4QJFB 2C2YA 2JHCA 5G3ZA 5KHLB 2VP3A 3Q40A 3GJ3A 5AI9A 3WGIA 3ZEAA 2VJYA 3WLFA 4PC1A 2ZCJA 1FW8A 2O0HA 2VRCD 2D13A 2WP0A 1ODTC 1BD4A 3N0VA 1LLCA 3JQRA 4TV9F 1WCIA 4NEGA 4BNYA 4LZPA 3MAJA 4CKCB 3D8RA 3PZPA 2JLWA 2JPDA 3UZUA 1NSYA 1Z4KA 2JAWA 1MAUA 3REGA 1SCIA 5JNLA 4POOA 4LIPD 4XFKA 2Q2WA 3T1QA 3BDVA 4NNOA 3BGDA 2DJIA 4UB2A 5HZKA 2I9KA 4DVGA 3X1JA 2G72A 4B6EA 1R4AA 4X7MA 4R31A 5TLSA 1PVOA 4N0QA 4DDKA 3ZY2A 4B7AA 1HFKA 3AM3A 1AKWA 3QITA 4IQFA 3ZDEA 1CUIA 1NV9A 1QOPB 4JA2A 2NP7A 1RQNA 4KWHA 2V58A 4Y1FA 4RNCA 3TMYA 1T8PA 4ZGWA 1QG0A 1X7DA 3I34X 4DOMA 1SZCA 3H5WA 4WECA 1Q3HA 5JY6A 4BRSA 4XR4A 3G2NA 2VTEA 3QVUA 4O4LB 3MTEA 1W36D 2F9LA 1EK6A 3IQDB 4UTRA 2Q3CA 3MTJA 3CWZA 3RRZA 4ODIA 3B6JA 1Z13A 5F2OA 3OA2A 2R7AA 1F4PA 1U9LA 2AKYA 4EABA 2GPNA 2NVOA 4PLPA 1DQYA 3PFNA 2WAOA 4JI0B 1U2GA 1IYZA 1V8BA 1N9GB 2XCRB 2H2GA 2HYDA 5FBVB 3KR2A 1Z73A 1WPXA 2PT6A 3A8TA 4ZEXA 2EZ9A 4DR7B 1SUBA 1OZGA 3P0EA 3LPCA 5EJ5A 4HDKA 3AR2A 3NGDA 8ICXA 2CMHA 3BORA 3AXTA 2QVCA 1P2SA 1A9SA 1A5SB 2B8WA 1QOZA 1TMKA 2XXBA 1X3SA 5G1OA 2PX2A 5J0RA 4MIKA 2GT1A 3KE8A 4R1LA 5JDCC 1RQLA 3FX2A 3W0LB 5KUTA 1FFSA 1EPUA 3WLQA 1JDTA 1ZSYA 2W6ID 4BY9E 4G37A 5CEJA 4HQOA 2CLMB 3F1LA 1MABB 3PRYA 4V0OA 1CR2A 3V6KA 4HATA 1F6DA 3LC0A 2ZQYA 3EY4A 2H7VA 4AYTA 3H13A 3MTGA 3PRKE 3M5CA 2OLEA 2NXEA 1FDRA 2A58A 4WFQA 4TL9A 1LD3A 4Y2SA 5ALKA 1Q0UA 2RGWA 5TJ9A 1FTSA 2CDNA 5FOTA 1TPZA 4AURA 3B7GA 3R5XA 3RF6A 2IEIA 3GEPA 3L7JA 3EZXA 3R77A 4EHIA 2B1QA 4OP2A 1N3LA 1QGAA 1U47A 4HDQB 1XX6A 2CXPA 4MRRA 4ZMBA 4M8IA 2HK8A 4RZXA 3S8EA 1R6AA 2VUUA 3DMNA 1NG9A 5DTJA 2PSFA 3I9V6 3F4LA 3QVVA 3ZWYA 1WVIA 2PD6A 4V0RA 5FPSA 5CITA 1CUGA 2P1RA 3RU2A 2VPQA 3WYCA 4OHZA 4XW2A 4M36A 5AHRA 2GZMA 1WOYA 1K75A 2OH2A 1PZXA 2OV1A 1AQIA 3FMPB 3KE9A 5KC9A 2GJSA 1ATIA 2GD0A 4G1EB 1SK9A 2X9GA 4EYKA 1S2IA 1YE5A 5ALQA 3WDMA 3HCPA 4D44A 1TMYA 3TOSA 5EJAA 2FRDA 1HUOA 3PUHA 3JAKA 3WLKX 5K4AA 1RRPA 1NXTA 4F4HA 1CS4C 1I2AA 2FPWA 5BR1A 5ECYA 1W48A 5H3HA 4FFLA 4OA8A 4MJLA 5J2GA 4JMUA 5IZ4A 2O5EA 1VIAA 5AVTA 3X2EA 1UBTS 1F8XA 3R24A 2XCUA 1N5DA 3HBMA 5E6SB 2KBEA 3KJNA 4GE0A 1JIXA 1F6WA 2FDXA 5JMPA 4H6WA 5B1DA 3WRYC 3UJ3X 5AW9A 4GL4A 5CB4B 3CUTA 1XTQA 3VI4B 1CP2A 4LRSB 3EPLA 2OV8A 4WLUA 4UXIA 3GDWA 4ZPJA 1F8GA 2BQRA 3EPJA 3A6GA 1UFVA 1E58A 3D4LA 3M81A 4FONA 4G65A 1IZ8A 3HSSA 4E5SA 3E81A 3EW7A 3GFVA 3CIOA 2ZB3A 3G1UA 1GM5A 5BVHA 3CIFA 1H3NA 1XZEA 2GF2A 4JJ7A 1NK4A 1QJ4A 1P7VA 4OXIA 2V8OA 3OPMA 1OBCA 4E7PA 5CBPA 4OI0A 2QQEA 2R1TA 2QNRA 1JAYA 4E31A 1DEAA 3MA0A 3DB2A 4IGEA 3JD2A 4Q66C 2CGEA 4F1WA 1BQ4A 3ZWXA 1JN0A 1C0EA 3CF4G 3MINA 3UXYA 3GP8A 2R1ZA 1ZINA 2ECOA 3G88A 2A1TR 5KKCA 1CZLA 2FJPA 4OI4A 5DX0A 1FVFA 2RB5A 4U6NA 1LPMA 4DCPA 3VC1A 2AZMA 2QYOA 2QUZA 2AHRA 4QBGB 1U3TA 5GOZA 4CEHB 2FSHA 3BS4A 4AD8A 1JZTA 2V55B 3TXAA 4GIBA 2QP4A 2P9JA 2XVTA 3K5WA 4YYEA 3ER9A 4OJKA 1XSPA 4ON9A 1V26A 3BJYA 2DWOA 4EB3A 3FA2A 3H1FA 4QUIA 4LDAA 1YQUA 4DRXB 1VRVA 5AIAA 2ERCA 3D43A 2O0KA 5KFCA 1HC7A 2QB1A 3P96A 1PLJA 3ZTTA 3N75A 3CCCA 2WYIA 1ACMA 3KU4A 1EWKA 4YC7A 2BGGA 4QT0A 2N42A 1PW5A 2WK1A 1U0BB 4EUEA 3VMFA 4ZU6X 1LK0A 4M47A 2XIQA 3N39C 4EYEA 1JSRA 1JKFA 5DM60 4NCBA 2WMDA 2IYAA 5JSKA 1PD1A 3DOUA 5JRDS 2F1KA 3I01A 3DWIA 4ENWA 3TLAA 1MVOA 2AG6A 5AOCA 3WL5A 3KYCA 4D9GA 1L6RA 1KOJA 2BZFA 2AVNA 2DETA 3HR4A 4CCYB 5CJPA 3AHCA 5D3KA 4M9ZA 4KBFA 3HFRA 3WHIA 2BGMA 4NM1A 5D5PA 3IVAA 3HCNA 3SHVA 2VDPB 2D4HA 3K3PA 1C4OA 4CKBB 1NK0A 3BGSA 4NARA 3L41A 4C5AA 3B6MA 3GC6A 4FOPA 3SXPA 3HKZC 3AGPA 3GLGA 4Y9TA 2P35A 4EFKA 1Z0UA 3RRJA 1ZI9A 3GRVA 4H3HB 4I9HA 1U80A 4ZYUA 4HDSA 4DSJA 4B3JA 2QW0X 4IMJB 4AUNA 4BX9A 4U2FA 4KIWA 1H1LB 1R6VA 4DKXA 4RQNA 4M1EA 3ANLA 2DWCA 4G36A 2QHXA 4BWMA 2WKQA 4EW6A 2W8BA 5CCXA 3DLTA 1PK1A 2VNKA 1BFKA 3X2SA 4O59O 3NWPA 1WHTA 4DAOA 2BGRA 2X3FA 1G63A 4QDTA 2IY8A 3BRSA 2IS2A 1BGXT 4DL4A 3CISA 4WOPA 2XRYA 4S1OA 2GPWA 2CXSA 4CLDA 4JEHA 4YR2A 1A8SA 4LGVA 5AVXA 1LDEA 9ICUA 3EDMA 2QTWB 3HG7A 2JI6A 1SIOA 4PC2A 5J2FA 3GV7B 4QC2A 3K0CC 4TTSA 4TOIA 4B81A 2PGDA 4Y0VA 5EI5A 2H4ZA 4XJTA 4J0CA 4RBNA 3RVLA 4B8ZA 3KPVA 1SC6A 4Z4GA 1DMSA 1NJYA 3IQFA 1Z4MA 2YHAA 3I83A 1SM4A 1JHPA 5JZSA 1TTHA 3ZUGA 2RHJA 3ZBPA 4A82A 4AICA 3TCKA 5BN4A 1VZ3A 3RJMA 2JK0A 1MO6A 1RQRA 4OQXA 4U4AA 1FO4A 1CS0B 1PSZA 3KJIA 4I3HA 1KSPA 4YQWA 3UG7A 1CRZA 1T0HB 1L7DA 3H8SA 2BPOA 5H3LA 4ZC8A 4MDFA 2O6LA 1Z36A 3ITKA 1L5KA 2AC2A 3H8JA 5HGJA 2WWYA 1PUIA 1YASA 1N0IA 4Q19A 3FKSD 4RKWA 2PVSA 3OLXA 3UHOA 2JJ1A 3CZRA 1TPYA 4GZ5A 4Z9FA 1UMCA 4F5RA 1SBTA 1SBNE 2QG9A 5DDYA 3EHDA 1V71A 2GNAA 2P9GA 2RK4A 3RIEA 3FWYA 3PKJA 1BCRA 4FHZA 3C1UA 3VSAA 4C04A 3DEYX 1MF7A 3IOEA 3RTEA 3FVVA 1C1DA 1X9WA 3DAGA 1IVSA 3PQ2A 3FXAA 3V4PB 4H6VA 4O29A 4ALIA 4XQ0A 1QHXA 1UJCA 3K94A 3PSFA 2RQ5A 4AUEA 3ZE2B 1NZBA 1EWVA 2ESEA 4OJMX 4GKVA 2IYQA 5KVAA 3MJTA 2CHFA 3MUNA 2C5FA 5CG2A 1HX7A 4ZFNA 1H6CA 3NS1A 3IEMA 3CLSC 5IIIA 3MHTA 2W6ZA 2EW8A 3RKUA 3V7JA 4ZCIA 4XX0A 1FFYA 4AN1A 2W22A 1KI9A 4IUCS 4NENA 1J8VA 4E1VA 1GTRA 2VF4X 1B8OA 1NJ2A 2APJA 2HBZA 3N2IA 1SD5A 4RVHA 2JLZA 5KDLA 4QU9A 1NVDA 5FBLB 4ELUA 4R8MA 5A04A 3HUFA 2QZSA 1AROP 3Q8QB 4YDHB 1TYDE 1E5VA 2WU3A 4G9BA 2YJ3A 1NK6A 2HJVA 4KXVA 2BP7A 2WIJA 4AKSA 1SKQA 1GGFA 2V0CA 4CUJA 4PAQA 1CJCA 5TARA 3E1SA 3V1UA 4MIYA 3N8HA 3QGMA 3W04A 2EJCA 1YZ7A 3LT5A 3KBBA 4G2TA 3WNQA 1F12A 1D07A 3GAZA 1NJ5A 2MSKA 4K4GA 3V2HA 3OA0A 1YI8A 2XKKA 1BVYF 1GDHA 5SV2A 4W99A 5ITZA 3PPYA 2ID8A 3OJFA 2ALJA 4ALNA 3PD1A 1G3QA 2YV3A 4I28A 1LZLA 7ICTA 4KN9S 3WJAA 1SXDA 3T94A 1WBDA 5KB3A 4Q4HA 3OTGA 5K8CA 2TMDA 3I8XA 2ISSD 3D7RA 3PE4A 1GTSA 1JX6A 3WMEA 4RW0A 4MQFB 3R20A 4Z4HA 2DHRA 1V3TA 4C0XA 1NNSA 1XQVA 4HN9A 4KMMA 3DOCA 3V7UA 1CE8B 1S6YA 4YCBA 2DLDA 2NTJA 3X2FA 1KK3A 2MT9A 3N70A 1YONA 4DFPA 4HX2A 4NCAA 4UD6A 2IYWA 4GM1A 1YR7A 4KMUA 4X1YA 4TL7A 3OM9A 3WSTA 10MHA 4RD4A 4TLDA 1XLTC 2Q49A 3OZRA 1T91A 4LSGA 2AZTA 3FOZA 4EPVA 3UJBA 5DCYA 1U3UA 3GJ8A 4RZUA 2EBUA 4W5OA 1U3GA 3W3AH 1XZBA 2QVBA 2NQTA 1OA0A 4E5VA 1YZFA 5FA6A 3IQHX 2BEWA 4YCCA 5F2NA 5E4FA 2JFQA 1NDHA 3OY7A 4EGJA 4KMOA 1TM7E 1E1QA 1UXOA 5TQ0A 2P3OA 5J2TB 1PJ3A 1E63A 1OAOC 4FM9A 1HWYA 3LHSA 1T1JA 3OJUA 5K0TA 3PIDA 1IOVA 1D3AA 2A1JB 2C5EA 3Q7EA 2ZS7A 1W0CA 3BL8A 1F1BA 4N3CA 2X6QA 3KQPA 3TWOA 4O33A 5LNK1 7ABPA 3UJ7A 1NNEA 2CXRA 5ENDA 5G40A 1IULA 2ZJ4A 5K3BA 5CFLA 3MGCA 3BM5A 5KJ1A 2B2NA 5DLQC 1R6DA 4OQDA 4YJ3A 4FE3A 4QBTA 4PG8A 4MYCA 3THXB 1MO2A 3FNRA 3ZXSA 5KT3A 4DDHA 4OBXA 3IBYA 2BCUA 1CI4A 3UYKA 3K0AB 1EWRA 2AMJA 2N75A 4UB4A 3TZKA 1RLUA 1H2RS 5FOXA 5IHXA 3E7PA 1JPNA 2QD3A 1DDOA 1NE2A 1Z75A 4IQUA 5DXAA 1VHTA 4C5CA 3DCIA 4AX8A 4OUDA 4EO9A 2HZ7A 1MA3A 1R1DA 1U11A 4PPYA 4LSWA 3OOWA 3QELB 3BXHA 4CM9A 3OT4A 1ECBA 1MAAA 4QJ5A 3EMKA 2O3JA 1YQQA 1PQ4A 2F59A 1KVUA 3KJGA 1VZ2A 1EAMA 4WN3A 2FRXA 4DLUA 3K0EA 3GF4A 1I3MA 1TXGA 4O0LA 3PQ6A 4HAUA 1HSOA 3GDFA 2AOUB 1RWVA 3RB0A 5EIBD 4UHDA 1X2IA 4YT5A 3GJ4A 2PPVA 2FE4A 5IYZA 4YJGB 1R6TA 3FW1A 2O3RA 1QNFA 4RVNA 2JEIA 4IIYA 3KAPA 1AQ6A 3BF8A 3E1GA 4LBVA 3P8ZA 4QNNA 3KQOA 2QLLA 2ZE7A 2HGZA 1WYGA 4NL4H 1WNFA 2DECA 4R2WA 2GRJA 1E4EB 1BRTA 4J2TA 4BQNA 2Z8YM 3Q4GA 4FBGA 1F5NA 3E4CA 1Z0JA 2WLSA 1BVRA 5DP2A 4KH1A 1QGED 4DAEA 2X1MA 2K8BB 2ZRCA 1P4AA 2X6TA 3IT0A 5AM5A 1I3KA 3SPXA 4HWKA 3UMGA 2PEYA 4H2DA 2OOKA 3ENQA 3U3OA 2WJVA 4QXAA 3FSGD 3A0BU 1EM6A 2B5WA 2CJPA 1EXMA 4AG3A 1U0FA 3BHIA 1JHYA 2OZLB 3TZQA 2NNLD 4QXPA 1SQ0A 1RNLA 3PLRA 2DPMA 2PBZA 4RTPA 2WJWA 5FL3A 2NSJA 3D2NA 2XADA 2AT1A 4AS2A 3U4DA 2FLKA 1J7JA 2OTCA 4LDPA 1KN5A 5IS2A 1NW4A 4MCAA 5JH7B 1RAIA 4AJJA 3JQ6A 3IUEA 1LPAB 4CM6A 1XQWA 2VA8A 5FAXA 4DMMA 2OAGA 5EKUA 1TVAA 3KEQA 4O4HF 5KHOC 1IN8A 3OJCA 1EX1A 3ROQA 1EDZA 2CXXA 3ZKWB 4PYOA 1SEPA 2F3UA 1K5PA 1P0IA 2DR3A 1WCWA 2PT5A 3SJBA 3B9BA 3YASA 1J56A 3ZYZA 3BB1A 1IEWA 2WZQA 4N3GA 2EX4A 5M29A 3N2KB 2C4UA 3I6BA 3MJRA 5BPCA 3PV0A 2QW1A 2XD9A 4LZOA 3MWDA 2NU6A 2W83A 1E3QA 4F86A 1FFBA 2JBWA 4KE7A 2TECE 3AO0B 1EFCA 3ELDA 5AKEA 5LXTF 1NZDA 4ECZA 1MA7A 4ARAA 5SY9A 2J32A 3H4IA 2DR0A 3KJFA 2KKPA 2V97A 1XXHB 2CVOA 3BWVA 4OI2A 1S7GA 4YP6A 5F1KA 3C7DB 3HGMA 1YT5A 2V1XA 1Y37A 4LUCA 2JGNA 4D56A 3GGOA 2WQZA 2ZRMA 4EWLA 2FMFA 3Q11A 5AK0A 1KOLA 2QQGA 2RRDA 4YFYA 4DCVA 4KQCA 1L3BA 5J0QA 1PX0A 3K8QA 3ABIA 4KLGA 4RE5A 5K05A 4JUBA 1TQ8A 4L5JA 5DGXA 5M34A 1COZA 4R68A 4MUAA 3H05A 1Q7CA 3FFXA 3LQ2A 2QZJA 4MS4A 4BNFA 4FN5A 2FSVC 4ARVA 3D3KA 1U3DA 1F0NA 1SXJA 5DDIP 2YN4A 4PGYA 1I4LD 1U49A 2ORYA 2P75A 3ZCVA 4GXNA 3LO5A 2BMJA 3OHSX 4IP0A 2ONKA 1IATA 3F74A 1N3YA 2VP5A 2AZDA 1DJQA 3VVLA 1Q16A 1H6BA 4FE7A 3G89A 5ITSA 1L4UA 1KY2A 4ZVPA 3OEEA 4U5QA 3DZGA 3SZMA 2HF9A 3W77A 1NTOA 4AF7A 5JT1A 3ICVA 5T41A 3Q2OA 1XF1A 5KFOA 421PA 4IPTA 3KV1A 3H8MA 4ZOBA 2LBOA 1PFQA 2XNSA 3WYBA 3AQFA 4KQ2A 4MHSA 3GFSA 4J29A 3BD8A 3L5OA 2XODA 2R7MA 4WBNF 4UVGA 3FKJA 2JLXA 1ATZA 1KP3A 5JOQA 2F3TA 4TN5A 3FR8A 3ZGOA 2BPGA 1WLYA 1OXTA 1U8TA 3M9NB 4BNXA 3P2YA 1Z3CA 3OTIA 3O82A 5C7OO 2O6HA 1CY7A 4LECA 4FGLA 3EVBA 4JOQA 1HE1C 1Y4SA 4WNCA 3AY0A 2NTYC 3PA8A 2VKQA 1VC2A 4G0WA 1NBWB 2YWEA 4URWR 1PNOA 3THSA 3MABA 1EZ4A 4OHOA 3Q9NA 2X42A 1QHEA 4BTEA 5FORA 4DCNA 1DKNA 4EFMA 3IVRA 3BA1A 1DDGA 1DC7A 1P4JA 2XQIA 2GOLA 1T9KA 2VAPA 4MW9A 5TPZA 3B12A 2SICE 2JEZA 1KDOA 4I9NA 4OKNA 4U2KA 2O2HA 2BFEB 1H9CA 4DL9A 3KTFA 5KSYA 1PR4A 1JHZA 4UE6A 3CRW1 2ATXA 4X45A 3ZCRA 4IRCA 4RORA 3ZD6A 2IOQA 4XD7D 3GCGA 3TAXA 1X8JA 3KKAA 4HCJA 3CH6A 4QDJA 4ZAXA 4Y2HA 4G97A 1X1SA 1U3CA 1V2HE 1MQ9A 1JHRA 2H1WA 4YJFA 4TSFA 2V9ZA 4Y9DA 4MLZA 4F2DA 3HKDB 4C8NA 1I14A 4M1KA 3QW4B 1I3NA 5ARBA 4AC9A 2WV7A 4M2LA 2RHTA 1T3NA 2RH9B 3IV6A 1HNZB 4ZYXA 2J6CA 3W2HA 3U1VA 1DXOA 3EAGA 3MTAA 1IONA 4U9IS 5LU8A 2H2DA 3OO1A 1NVTA 3ZW9A 1OJLA 1JG2A 2SCUB 4PSAA 1VCHA 2O8DB 4MF8A 4UM9B 3EWIA 4ZIRA 4HHEA 4C7MA 5KVQA 2I2CA 4B74A 4O5KA 1XJ0A 5IJWA 1BN6A 3N5KA 1T34A 2FOLA 2XXAB 1UEIA 1A7KA 4Y6SA 1F0YA 2YMQA 1DOHA 2QTTA 1QTRA 1K63A 4X97A 3PVSA 5LL6P 2XUAA 1G2QA 3A4IA 1FP7A 2ZW9A 3HY6A 4OSPA 1PYDA 1VRCA 4E6EA 3GA0A 3MLEA 2QRVA 4BDSA 3FE2A 1RXSA 2LKCA 1P6UA 5J63A 1RQ2A 3AUFA 3DGFC 4RA9B 1E96A 9ATCA 3KRTA 1PQWA 4W8GA 3R5JA 2X0RA 4ZOEA 2PZMA 3TB4A 2FMUA 4J0GA 1ORIA 5LQJA 2YWDA 2BGIA 1SZDA 1NZJA 5I51A 1OFHA 2GWSA 1Y5IA 1JIJA 3COZA 4MWGA 3FNGA 1THZA 2KJQA 5BYAA 3EQ7A 2Q4TA 3E8SA 2OZPA 4C14A 1TQDA 1DBIA 2MSDB 2IYFA 1NQWA 1J1IA 1DEKA 4DNOA 4BE7B 3V80A 4WZBE 4YRMA 1WV1A 5SYNA 3QFTA 4F45A 2JIRA 5COAA 4AS1A 5FPYA 1E4YA 1R0BA 4L22A 1LJUA 3FYHA 2K4IA 2YDXA 1KLNA 1RYNA 4IIGA 2XCSB 9LDTA 4KUHA 2IU4A 3MAGA 1IV8A 1I7SB 5JWOA 4JI4B 5F4BA 1NM5C 1L4MA 1FPMA 5AJWA 2ZAGA 3RRYA 2ZBFA 3MB8A 1OBOA 1A8QA 1WS6A 4W6ZA 1OH5A 4EPXA 2CXOA 4BS9A 5BWLA 4B2PA 1M3SA 2W2KB 4QLBA 2BH9A 3KZOA 3SVLA 3O1IC 3B2EA 1YU9A 4DCGA 1CUZA 1UDCA 1VFPA 1JAZA 3LXUX 1Z12A 3VJRA 1J2UA 2Z4SA 2AJQA 3LECA 1VXOA 3RD5A 3JATB 2YVLA 4YV1A 5CX1A 3B60A 1P1KA 2K4PA 4RTQA 3ZIAD 2OOSA 2WPDA 1WU8A 5CCDA 2IH5A 5EE1A 5KFPA 4INZA 4KPYA 3NNDA 4IIEA 1FU8A 3WSVA 4WZAA 5FWXB 2QMYA 2NV0A 1XTIA 5KSZA 1BXRA 2BGNA 4ZAZA 3TAUA 3KR0A 4PU0A 3KLNA 5HTKA 2Q9AA 1X38A 3OKPA 2QTHA 4U7HA 5AW0A 2P0EA 3NQ41 3HZRA 1Z3IX 1TIBA 4OIMA 4OHMA 4FOSA 4B9MA 4RETA 2X9VA 4JQZA 3PC6A 3F6SA 3R7LA 1XNQB 3G0HA 3VO9A 4PPGA 3EA5A 3VVMA 4AMUA 2HQRA 1KQOA 1Z0SA 4QOSA 2IHKA 2C0CA 4N01A 4BVEA 7ICGA 2IPLA 5FA5A 1M72A 1Y3DE 4DV6B 3V46A 4M0UA 1MRSA 4MQ4A 4OHUA 2CJFA 2QVZX 2OFPA 4RXUA 2ZI7A 1P6XA 3A37A 2F8MA 3LZ6A 1TM2A 1K8QA 1MD9A 3ABQB 2H5LA 1X39A 3OOHA 3LGXA 3T54A 5D46A 4Q6WA 1G8JA 4P7JA 4BIMA 1W8IA 3R3HA 3RSHA 2Y92A 5DHAA 1AD2A 2H16A 4CQMB 4A5SA 3MWEA 4BDTA 3GPBA 4RTRA 3CLKA 4RPLA 3AH8A 4YLGA 1E94E 4NZZA 1ZK1A 3DBRB 1SUCA 5L1IA 2HFKA 3E35A 1X19A 1X13A 1HETA 1D2EA 1L3SA 2NP6A 2QENA 3OTQA 3OOSA 5B1SA 1MA0A 2OBXA 1USIA 4IEEA 3CUUA 1NW5A 2ZXIA 5A5VA 1WBBA 5JUMA 2LIVA 2IPMA 1CUDA 3V4OA 4S2UA 2GN2A 4ED1A 3PE6A 3ZV7A 1FSSA 3V7NA 3LFUA 4IOMA 4LXTA 3D3QA 4UM9D 3MD9A 4YP0A 3PW7A 2DKOA 2ZS8A 1R10A 1UK6A 5EHZA 3GZTB 2HCJB 1EDEA 3JASA 2WUVA 1H0RA 5T6BA 3VM6A 1VE5A 1YZ6A 1AN9A 2PWBA 4PZOA 5FBWB 1EJ6A 1BDMA 3GRFA 3EQZA 2XY7A 2DERA 1JRLA 3WMGA 1YDWA 5BYJA 4YAWA 3BZWA 4DL5A 5DT2A 1AC5A 2GGSA 3VI3B 5FWAA 4N48A 3HU3A 5AKHA 3H65A 2VDJA 2WSYB 3IXLA 4J6EA 3A1SA 1GHTA 1J8QA 3SKVA 3VRHA 3AF5A 4R8KA 2Y71A 5D49A 4TKMA 4G5RA 4RSHA 3IUBA 5BMOA 2ZUVA 5KKNB 1DX6A 3H6KA 4JP5A 1C8KA 1ZC4A 1T8SA 2W2LD 1M5UA 4V02A 2OXIA 5LA6A 1AXGA 5K0EA 3D0KA 2RHOA 1JR3D 4C80A 1K0FA 4DT1B 2I7TA 4OHFA 4ED9A 1J23A 4KOEC 3WGLA 1SOVA 1MP0A 2IY9A 1RYSA 3OFJA 4X44A 5KTYA 2XUPA 3T3HA 2O8VA 4NNPA 1RI2A 3N7TA 3IKVA 1VKRA 4RPHA 3AEKB 1ZK4A 4L1KA 3ZDRA 4AWBA 4QE3A 2IS1A 4QZFA 5KTSA 1MJGM 2HIAA 4L5AA 3TARA 3VNVA 1X7XB 5LMZA 2JD1A 1P2FA 4RULA 2QM0A 2XDWA 2ASJA 4B9SA 4HLNA 1PJRA 4UCWA 3PX0A 1WR8A 1QSGA 4GPD1 1EHCA 4XUDA 2Z30A 2Y1WA 5HHIA 4C0SA 4EH1A 1NJSA 1UMBB 2KV2A 3LC1O 1FSZA 3H2IA 4JKOA 1P9WA 4G0UA 5L3ZA 5I9MA 3MLAA 4OFZA 2D3TA 3JQEA 3KB1A 3T9DA 1XKTA 4Y2PA 5GVRA 4PAMA 1L7VC 2R48A 1U0RA 3DMRA 1V1MA 1I5OA 1VL8A 1K7YA 4IQ4A 1PFUA 2HCFA 3SOZA 5C9ZA 3AHFA 5H4GA 2MIIA 1M2OB 1I7LA 2I1WA 3C16C 2ZRJA 2AE1A 3IKJA 4WDQA 3BFJA 1IHDA 2RIPA 2ZDHA 2HQSA 3RLFA 2W04A 3BTVA 3NM4A 3GAAA 3DKVA 3ET4A 1ZY2A 2FR8C 2PJDA 5G5HA 4J4HA 1NVBA 5BOSA 4OI1A 4B4DA 3UF0A 2R5WA 4DG8A 2YB1A 4ID3A 4M0EA 3S1AA 3VZSA 3ICEA 4Z4QA 1XZGA 1ZJNA 2BHLA 4X71A 4QECA 3DC7A 3VPHA 3WV4A 3FBGA 3CX7A 5IDWA 4Y67A 3VC7A 1A96A 1OASA 3SD7A 2VF7A 5CT5A 2D74A 3KLMX 3DPSA 4M8LA 4IZIA 3AU6A 2DAPA 5F9NA 1RPAA 3WWDA 3JD1A 1DINA 5KOYA 2ZT8A 4AG6A 3IRUA 4WXHA 3EMVA 4IDAA 5HHTA 4EG5A 1EFHA 3NEJA 4B6OA 3R5FA 1YRAA 3HXPA 3NIWA 3IDSA 2VTBB 4IRKA 1FUEA 4V24A 2DU8A 1LX6A 3LV8A 3QXGA 3F49S 4HAWA 1YIOA 1KFSA 3K15A 2PQMA 4CQMD 3BE8A 1Z4JA 3Q5EA 3A9RA 1AUXA 1P61B 1VPEA 4V2IA 1CEZA 3VAYA 2I54A 3FNBA 1M2WA 2IKQA 5JIBA 2ZRHA 1WABA 2RK6A 1GUZA 2R87A 1E7MA 4TYWA 1KO5A 4X60A 2CEKA 2CXNA 4W7HA 5DTEA 2WD8A 2CFRA 4W8HA 3QU4A 5JROA 4MLDA 4QX6A 4B6QA 3VX3A 4YR9A 4BVJA 5FUWA 1QFXA 1IRIA 5KYYB 4IHJA 2W2PA 3FB4A 3QF4A 1XD8A 1MT3A 5LQKA 1Y6RA 3QE0A 4DSEA 1PKXA 1Q0PA 3FRIA 4XRGA 3GH3A 2EFJA 1JQDA 4YAUA 1X9SA 4ES6A 4GRIA 3OZ7A 5HIAA 1Z7YA 1JBQA 3L0YA 1ODLA 4MGKR 2HLNA 4CHTA 2YJGA 2JKVA 4K2HA 3FRJA 2ID9A 2V7UA 4OOFA 1V43A 5BV0A 2QLMA 4A8JA 1FE8A 1X7YB 4Y18A 1GU7A 1D4ZA 4TTIA 4DY4A 5JD5A 1EUZA 5D1HA 3U48A 3BWMA 3C3YA 2DT8A 7ICUA 2QD4A 1NBMD 1X0VA 1O03A 2F64A 2FCRA 3PFBA 1T8EA 3CGWA 3JVEA 3QEMB 4LJRA 2R2AA 3THWB 4F8RA 1ZU4A 1H42A 4HQ0A 3JAMA 3DQPA 3LBAA 4PY2A 3LUJA 2X8AA 4OQMA 4YQFA 2C7BA 5FUXA 2ACKA 2GNOA 4NPHA 3ZGXA 3MGHA 1V7PC 2LCIA 1E9RA 1II9A 2XWBF 3PXDA 2ZJBA 3HP7A 1M7BA 2B7BA 1RQGA 4RQ4A 3OF5A 1DQPA 3QQPA 2WNIA 2O2CA 5GONA 2JIQA 3SZ3A 2G5TA 2E85A 4XFJA 1E2PA 4DFJA 2VSQA 2AMVA 1GZHB 4MPTA 4PIPA 2O2GA 2WVJA 4I9UA 3UBTA 1P1RA 1LJ8A 4M8NE 2BMFA 4V3BA 4M9XA 3RRFA 1C3EA 4P22A 2CFIA 5HE9A 3ABSB 4M7RA 1NRJB 3P9NA 2DP4E 2G77B 3SVZA 4EHAA 3AERB 1WUYA 4PZAA 2ZP1A 5K0LA 2OWDA 1MOPA 5F7XA 3NYWA 3FPCA 2GESA 4P54A 4MPDA 2HKIA 1SKWA 2WMNB 2XNCA 1I01A 2FXIA 3G17A 1NWHA 3M6IA 1WW8A 3GJYA 1U5BA 3F6YA 4NOJA 2W5UA 1HQYE 4E07A 2NWQA 3HX0A 5K3CA 5DX8A 2PK3A 3AETB 1QGYA 4TKVA 2QR2A 2FX3A 5REQA 3HN6A 2Z1MA 1AN0A 1FFXA 2P9HA 1DWOA 1KMQA 2QG4A 2IHBA 3WGUA 2O19A 5C46F 2IZ0A 3PGJA 4GXQA 1MOQA 4XZ3A 2EWVA 3RWOA 5EWLA 2BF7A 4R5MA 4KLDA 2VO1A 4JBYA 1W4AA 3F5SA 3L1HA 3M4NA 4A91A 2GM4A 3UMBA 5CX4A 2J4CA 2WSSA 3WLOA 4F2HA 3WMRA 1NVGA 2BE7A 5C37A 3RHFA 1D4AA 3IP5A 2J5QA 2RGDA 3Q8PB 3RSOA 1EBUA 3L7NA 1Z8HA 2CVHA 1AA9A 1D0IA 5E2AA 4REMA 2HIGA 4NF2A 1M0TA 5EQJB 3RS8A 4FIZA 1ORDA 1RHQA 5TGDA 2J9YB 5JQWA 1AF7A 1SKAA 3NP9A 1PNQA 1XTRA 7ICLA 1UPTA 1MRZA 4CKXA 4Z2AA 2VTDA 2G6TA 4WCFA 4IUBS 3LWLA 3SEZA 3ZPXA 1M1YB 2QAJA 4XGKA 2XIDA 4PPFA 4EEKA 3QWFA 2R6GA 1MC5A 4G5OA 3RB4A 1YFZA 5A02A 1JJVA 3MAAC 4J0IA 2NV3A 2P7IA 2YZGA 4BFYA 3DZIA 7MHTA 2HY7A 4XLZA 4ISBA 5JVDA 3BMQA 1DEXA 3DKRA 2Z2XA 1D6SA 1TTPB 2GPAA 3ZZMA 3KK0A 2WB1C 8ICJA 3E03A 4YRRA 3W5DA 4BV3A 5AVSA 1D2MA 2O3QA 4HJRA 1Y1RA 1EK2A 3BVPA 2CF6A 2FG7C 2DQKA 1YRYE 3OJWA 2I29A 1EGHA 1O54A 2HA5A 3PUJA 4CI0B 4OM7A 4CNBA 1N5MA 1WZIA 3U4AA 4B3DA 1PQYA 2RAPA 7REQA 1GILA 1US8A 2BMDA 4I4TB 3IT1A 4KPGA 2GZ1A 2XH8A 5EPEA 3PEVA 1K7XB 3HA3A 3NYRA 4F84A 3F8TA 1E20A 3QVKA 4M89A 2P69A 4F4IA 4FWTA 4HEA6 4AB1A 3JWIA 5A5FA 4QZIA 4HGZA 8ICPA 2W9MA 1NX9A 2OPHA 3A6LA 5CEHA 3ITEA 3EZ6A 3CEMA 3U3MA 4G84A 5CA1A 2AEJA 3TOZA 3A70A 4HVCA 4IEIA 2AC7A 2QTGA 2CYBA 3N7UA 1XDGA 1V8PA 3K9HA 1NMSA 1L8AA 3H2HA 2WWFA 4BJ6A 4I4LA 3DZBA 3RTGA 4O3PA 3U7JA 2IVFA 2VIIA 4JSTA 2PV7A 1B0ZA 1U65A 3O7MA 5IC5A 3TQ1A 3JR3A 3U31A 2BDEA 3GOHA 1OB2A 4IIFA 2B8EA 3GLRA 2XITA 1D8BA 1TYCA 4KE9A 4A7PA 3DF9A 1N7IA 4ZOLF 2ZVPX 1BVUA 1KOGA 2IIVA 2KHZA 1A27A 1FRFS 3GFPA 4JK3A 5FUQA 3EWSA 2Q7OE 5FH9A 3M49A 3C5VA 2IWHA 4YJHA 3T61A 5ALUA 1XMJA 2V9WA 4QZBA 2BELA 3SKXA 4TMVA 3K92A 4Q9IA 3GRZA 4F2WA 1I51A 2H7CA 3K5IA 2EL9A 3I6IA 2DQYA 3ZWOA 2EAPA 4UNIA 1U6IA 5J2UB 1JZSA 5DHRA 2P4UA 1NA5A 3L6UA 4RQAA 3TTYA 3VYTB 4JI7B 3Q3VA 1J06A 3MOGA 3DW1X 1CEEA 3TH5A 1NKVA 1I30A 3CXRA 4A73A 3W1EA 2I91A 4OQYA 4QAQA 2QB0A 2WJIA 1HLPA 1B3RA 4D6YA 5A3VA 2PSJA 4ARCA 4UCFA 5B6PA 1YS6A 4NLLA 3VR6H 1OH6A 1SU7A 2TMKA 3SOPA 3PNKA 1M5TA 4FBUA 1EQ2A 3A28A 3ZLTA 4C4SA 1YRWA 1JXAA 3A4TA 3C1ZA 4ONEA 1WW2A 5DULA 4LX0A 4HNHA 1H66A 2AV6A 2NZJA 3MWFA 1IEXA 4KIFA 3IBFA 3U7HB 1XNGA 2OORA 4ROSA 1EBBA 3NDIA 1CYEA 1Z4NA 1TF2A 3WK5A 1YGYA 4HSEA 5IUKC 1CU1A 5K03A 3N1UA 5U1PA 5BMVB 2HSDA 2W98A 1OOEA 1UBRS 5DEOA 2R4UA 2HMAA 5H59A 1ZGJA 3NBAA 3OPVA 5KYUB 3HUTA 4JUFA 1D0SA 2WTXA 2P1ZA 3DZJA 4KE8A 2BR5A 2ODBA 2B5VA 4YROA 3GUCA 4JKIA 3PF8A 3ORSA 4EBBA 3OCVA 2PO7A 2R8ZA 4B3GA 4XRHA 2NLOA 1PK3A 3WIBA 5TQ2B 4RF3A 2C99A 4TRRA 1NFFA 1NOMA 1GKYA 1HEKA 1QO9A 5B5EU 1II0A 2JBHA 4YVZA 2PE5A 2PZJA 2HUPA 4DDVA 1Q7GA 2J0QA 1WIWA 4Z9BA 4FS1A 1Q7TA 1J90A 5FULA 4YQYA 3JSAA 4WHMA 2JFXA 2E5WA 4MW7A 4IF6A 4QTXA 5D7BA 4EDFA 1W49A 2GBLC 4PYQA 4GKAA 1BXZA 3RYTC 1XMOB 5KYNA 1L4HA 5E9WA 3UJAA 1XS9D 5K3DA 4PRLA 2QX6A 5K4GA 1Y3AA 2HX1A 1DTSA 3RNLA 3TQQA 1Z0FA 1NWCA 5JCXA 4YP1A 1KZGB 2GFHA 3HGQA 3OZFA 2ZTVA 5EJ7A 2GYVA 4P34A 2XWSA 3MF4A 2AN4A 3BTUA 4C0AC 1Y1PA 4K87A 5CM2Z 1BHSA 3N28A 1YQEA 2FPRA 3HZZA 1K3FA 5H9WA 1GGHA 3V7WA 3MILA 3ZHUA 4P5PA 5J4HA 2ZJAA 3OTOB 2PNFA 1GADO 1QXSA 5I7WA 3EGXA 3L7MA 3N0RA 4K26A 1XHLA 3D4BA 4YASA 2C83A 9ICQA 4KQ1A 4ICIA 4TQRA 4J0QA 4JUDX 1PZFA 4J9VA 2YFYA 4QJIA 1RE0A 2E7ZA 4EY8A 3MPUA 4QUJA 4WUVA 3JYPA 1TX4B 1R3UA 3UTCA 3DAHA 3SBDA 1UKVY 5IILA 2W6OA 1HORA 2C98A 2GA8A 1XF9A 4Q1FA 4F85A 2K5UA 5DHQA 4R2IA 4DQRA 1E9FA 3JQCA 4NJMA 1S3IA 5J1TB 4U5XA 2YWRA 4MRMA 3RE1A 3E9MA 2HMXA 4DARA 1Q57A 5I8WA 3D0OA 3RREA 2H18A 1BNOA 1QF6A 2A6PA 3SYZA 1XEWY 3K1ZA 4ESOA 1UXKA 5C1DA 5CURA 4AZWA 2FI1A 3CNQS 3QUTA 5DXFA 2WKRA 1KA9H 3N8GA 5EKDA 3HKZF 2F62A 3OUUA 4CVNA 2ORED 4RVUA 3UWDA 4G07A 4RK1A 5KPDA 2PS9A 3MCTA 3R3XA 4QPJC 1JG6A 2WT9A 5CT8A 1FFGA 1QQBA 1QB8A 2YV4A 5LSAA 1N36B 5ECWA 1PS9A 3HJGA 3R6WA 1Z08A 2P5YA 4L7QA 2IQ5A 1AK2A 3ZDCA 1MO5A 1YUNA 2ZYHA 3ZLBA 1I1OA 4R2HA 1Q0ZA 3H97A 5AP9A 5LQMA 3EXG2 3V1NA 2VBIA 3PNBA 3VR3D 3UK2A 3WZLA 3VR2A 1TKBA 1ITZA 5JAIA 2UVPB 4IGIA 2JHPA 3PZRA 3G2KA 2D0IA 4OJOA 3GJ6A 1ZS9A 4Q9NA 3OQ1A 5AQ1A 1FPQA 1VFNA 1DKMA 3A1VA 1INLA 1SBHA 2AQ0A 4ZDWA 1W35A 1C7FA 4LEIA 2CVPA 1I7PA 1V4BA 3FRHA 5A0FA 1CV2A 2Q29A 2RGNC 4BU0A 4PZ9A 2WJYA 2WOOA 4RJTA 2AUTA 1Q22A 4GNRA 1YZGA 4Z1OA 4PFQA 4CV1A 4ND1A 4WN9A 1DK3A 2PUDA 2X9NA 4D92A 2UVUA 2KVCA 4OFWA 1IMJA 3G82C 4Q00A 3TJZA 1AHIA 3BS5B 4BMOB 4G1CA 2CK3D 2UUBB 3PVZA 4LOIA 3B8HA 3HZOA 5DNWA 3H40A 3BJIC 5KQSA 1Z8NA 4CV2A 1U7UA 2A9QA 2JBAA 3F6BX 4PHAA 3OJSA 1FBTA 2YQEA 1KKMA 1LBSA 1QKIA 5CIYA 1ZQQA 4OHCA 2HBYA 5ERYA 4B79A 3HP1A 1VL2A 3ZQKA 3R9XA 5CUQA 4XCVA 3LFHA 3KPUA 3TLKA 2G9ZA 1IOWA 1DHRA 1XDBA 1XRRA 4UD2A 2R00A 3JZMA 1KR5A 3MYYA 3I3OA 5DGHA 1A7UA 1QCKA 3EZ7A 1O5OA 4OLBA 5M2QA 1P4RA 4CODB 1ND6A 4R84A 3AL0C 1JKJA 2BGUA 3HEMA 2AFHE 1ABEA 2AMLA 2ASVA 2P2YA 3T38A 1NVUQ 4ROTA 2X1LA 1CSEE 1RPLA 1Y5MA 2YWBA 3OD5A 5LZ9A 4DV7B 1QHIA 4QWBA 2O1EA 2J6HA 1E66A 4JEUA 4ZD6A 3WNBA 2KW5A 3FVTA 2VOEA 5TB5A 2IYRA 1WY7A 2HA0A 1ZAYA 2H17A 2O9JA 2WD7A 1SZJG 3ETRA 4ZV9A 1JQEA 4YP5A 1X1BA 1KORA 3NBMA 2UDPA 2HUNA 3U39A 4LOAA 3TINA 6NULA 1O94D 2DFNA 4K6OA 1IZ9A 3FCXA 3WDSA 2FOXA 3DE0X 1RJWA 1PHRA 4R65A 1PYOA 1LVUA 4QG3A 2YOGA 3GW8A 4YY3B 4DJDC 1S8OA 1QZ3A 5E8JA 5I9SA 2XTJA 4JJ8A 1IG6A 3D54D 3KFLA 4LZNA 4D9IA 4D2IA 3JCZA 5CCBA 4MUNA 3DE2X 3AUKA 4MUGA 3M7DA 2XKAA 5IG2A 1YR1A 4H0FA 3I4FA 2DVMA 4TS1A 3NVDA 3BZUA 3C3JA 2OP0A 2P9YA 3K32A 2C07A 5IXSA 2C84A 1G5QA 1OR8A 3WNCA 2HH9A 1CZNA 3J81j 4H7HA 4PFJA 2QTMA 1TZ2A 4N0PA 4M0FA 5DWDA 1BMFA 1Y5RA 3VNBA 4C4PA 2FN3A 3BQ1A 3T1VA 2PH3A 1VPDA 2PKEA 4UPDA 5ITWA 3UJHA 2BY4A 2J3IA 3GFRA 4FSHA 5ELLA 3FPSA 1NK5A 1DKLA 1RLJA 2XB8A 5A05A 1AZWA 4Y98A 1NLUA 3LP8A 5EAIA 3GCDA 1RJEA 3VPDA 7ICNA 4JC8A 2HHLA 3WRVA 1TZCA 4RF2A 2QRMA 4XJVA 3AB8A 1MZPA 5BQPA 4QQKA 4QXRA 2VA2A 3AOEC 4R54A 1U5CA 5CJ7A 3WVNA 4O4JF 4WLFA 3B3JA 4D8UA 2AKEA 2FH5B 3L01A 1B1CA 4EBCA 2BZGA 5KYGA 3EXHB 3WKAA 1RMTA 2YXLA 2OYCA 1W88A 3DFIA 3JQGB 2Q99A 1E3MA 1W4BA 1HOTA 4DEYA 3PX2A 3LXRA 2FMIA 1HMPA 4YCAA 4RIEA 4FTWA 2NPOA 2J3KA 3QUSA 4JASB 3Q2IA 4ND7A 2W7TA 2H1HA 5IK2D 5FKJA 2AW5A 2FETA 4KWIA 3JQ8A 5CD9A 1L8QA 2HHJA 4QYIA 3B0XA 2WILA 3IIIA 4S1NA 3AFNA 4O8CA 8ICRA 2FLWA 5DF1A 4FSDA 1FP1D 2AQHA 4QVGA 1XU7A 1STOA 3T0IA 4G0YA 2HLHA 2CL6X 1MGOA 3MNFA 5JTUA 4YP7A 3A6HA 4GMHA 3KT0A 4B09A 2O2YA 4OU4A 3GFGA 4F4KA 1RXYA 2E21A 1KYVA 1SIWA 2UYCA 3NG1A 5C1OA 3BMNA 3VC2A 3O31A 3GELA 2HDHA 1VLMA 3O8DA 3MTIA 4LY0A 5BN3A 3NHPA 1LEHA 2CE7A 3FPFA 1Q12A 2FPPA 1RP7A 4JJZA 1I6MA 2KJ8A 4F96A 4YCLA 1FRZA 1K4YA 4YMTA 2MMCA 1CJSA 4BVAA 3MG9A 3W8RA 2FPIB 3RC2A 3UB4A 2K8CB 5I7FA 4EY5A 1U9YA 1E4OA 1GZ5A 4DQ0A 2VTKA 2WTUA 2QS9A 1L7XA 3OZVA 1LB1B 2Q6VA 5JXHA 3RASA 1CF4A 1MQ2A 4O2RA 3FGPA 3LCCA 4K28A 2PMEA 4QYSA 4L3OA 3FYDA 1RLTA 1ZIXA 1AU9A 4QYWA 3GPCA 3W8EA 3T3OA 3D3EA 4GPAA 5I7VA 4BOYA 1TUIA 2EU8A 4YMOA 5C7LO 2B34A 1DRUA 3R3WA 5CP8A 4CCSA 3PHLA 4QO7A 4Q34A 1CB0A 3Q8XB 1E9BA 4NQRA 1FJGB 4WLNA 3TUIC 1VOTA 4N40A 5JJLA 4M04A 5JSQA 1U1DA 5ENVA 3G0GA 3D2CA 3PJFA 2RH8A 1WSWA 3AHHA 5M7EA 3VQTA 5LCXA 3W4KA 3D2SA 1S97A 2PKRA 3H5IA 4IOJA 5LLSA 3F9CA 1T3SA 4FFBB 2V0NA 2EANA 3ISJA 3M83A 3I09A 2YN0A 4DR3B 1LDGA 3IBTA 2RGYA 3SYMA 2QGNA 4XYLA 1S2DA 4DNQA 4EJMA 3V1YA 2E1FA 2J0UB 4D8VA 1DFHA 3WYNA 1SVSA 2OY0A 3DMTC 1L5MA 2QN7A 5KQLA 4LC9A 4C21A 3IEUA 2OFFA 5TZVA 3L92A 4DGSA 1R0ZA 5KAMA 2XBLA 1ZJMA 1BNCA 3WJ7A 1TB4A 1SJ9A 3NBZC 1L4NA 1E98A 3EFBA 2UUCB 3ET5A 2XTZA 4D1YA 4D43A 2ZVDA 3BF7A 1X1TA 3GLHE 2RHGB 3CGGA 4JYPA 3HJFA 2WTEA 3BH0A 2ZR0A 4A2WA 1P1JA 2X0FA 1GWNA 3JZDA 2ZUSA 3QKSA 1T26A 2PPLA 2LI6A 4D3YA 3ENNA 1U8EA 4L08A 2HCBA 3IJEB 1E2EA 3DBHB 4WZZA 2QZ4A 2ZJ7A 3JAWB 5CA0B 1ZOOA 1K97A 1W34A 4J3NA 1V41E 4R71A 5FBKA 4DVJA 3N87A 2HHQA 3MFIA 2YJZA 3SQLA 3HKBA 4ZQFA 1FJXA 4E32A 1QE5A 1C2TA 3B89A 5J2HA 3FYCA 4DRYA 1XP5A 3M4JA 4D97A 4YUZA 1I5RA 1OMOA 2FZ5A 4U39A 1G20B 3RFCA 4JVSB 5FAKA 5DHFA 2REQB 4KV7A 4DMFA 4RQ6A 4MW0A 3LKDA 3ZC3A 3ILHA 3NGXA 3UMVA 3WK6A 1B2RA 2OZEA 1CBUA 1U1IA 5ICMA 2FSIA 1GFWA 4HDMA 4DG9A 1HDGO 1KFKB 4YV0A 4I1PA 3IHKA 2I4NA 1KZHA 2XGMA 4CTNA 3EGCA 1JVBA 1ZM3A 5ALPA 1IY2A 3UPUA 2RB4A 1UFKA 3F96A 4I9GA 1A5BB 4BAGA 1E1RD 1W6UA 5L9AA 3LBHA 4KKVA 4UAVA 2JC3A 3GEBA 4IHKA 2BFNA 5TPWA 3LLUA 4KRYA 3VO1A 4LHZA 3SEAA 2X2FA 3DLPX 2HJHA 1CIJA 1YZTA 2WSBA 3DLCA 3ZQ6A 1FU4A 1Z6XA 3O4GA 3Q7QA 3IVCA 1E6KA 1M66A 3G0DA 4PSCA 3PD0A 1DHTA 4IQ8A 3PGVA 5CYPA 2JMGA 1GG5A 1U4SA 4ZWNA 4LF9B 2R8PA 2JARA 2E4XA 3N7SC 1OUQA 3AZQA 2GEKA 3F2CA 4CIYA 4CQLA 2V4UA 2FMXA 4YCDA 5DU2A 5T4BA 3DTTA 4TQUS 2OKCA 3PSTA 1ZESA 3U7FB 4NK5A 1QX3A 2OXFA 5IEBA 1N4DA 4OAQA 3SYLA 1E9VA 4E0BA 4O4IF 2J9RA 3LDHA 3N3BC 1A8UA 2P41A 5ICSA 1GRNA 2PZFA 3IO3A 2OM6A 4JR2A 5FO1A 3NHUA 4KU4A 3OY2A 8ICAA 2HVIA 1U8YA 1UZMA 2ZBEA 2C8VA 2QRJA 4FR2A 3V32A 2GYYA 5CP2A 1HBJA 1J39A 1IXRA 5J2KA 4JLKA 2BTEA 3S4YA 1FYXA 4DA0A 1KTIA 1IN6A 2ZYUX 3AQIA 4D99A 3GLFE 5FXMA 4UHEA 2VSNA 1Z47A 4U7GA 5BQOA 4ZDJA 2YYAA 1F38A 4BLSA 5JYBA 3OQHA 2OXOA 4P9NA 3TRDA 2UYQA 5G02A 3DOOA 4OU5A 4CM1A 4ZT5A 4WH0A 1FUUA 4F7WA 2VIXA 1T4CB 3GBVA 4LVOA 2QIPA 4IILA 2WDPA 2A1TS 2OECA 4FN4A 1EFRA 1NVFA 2IL1A 2YVKA 5JNUA 1KRWA 1WRBA 1QFJA 3T3DA 3G13A 3T5DA 3D8HA 2X23A 2FWMX 3FLBA 3ETDA 4BQOA 4DCTA 4LGYA 4CCHA 4M4SA 3RHTA 2NRXA 3A7DA 4Q1AA 1TA4A 4NX2A 2F1JA 3A0RB 1L4BA 1JXQA 3P4YA 3N7PD 1DGQA 4REOA 3RT7A 5C35A 4CM8B 1DKUA 1T2NA 2VCYA 4W9RA 1FLAA 3U6BA 1CY2A 2NUPA 1R64A 2VYQA 1TRKA 3DHNA 4J4TA 3Q9SA 5ILGA 2WQ6A 2J9XB 5KREA 1WZEA 4V0NA 1YNSA 3W3AA 1XTJA 2P9CA 4G1VA 2AG0A 3GFBA 3L0PA 1MFZA 4NBKA 3ZVNA 1YJ8A 3ZCTA 1PT9A 2C9YA 3TF5A 1FMLA 3F71A 4GEKA 4RK6A 3EULA 1YVDA 5F76A 1QIGA 4LJ6A 5K99A 4GOKA 1R5JA 1RDFA 5CDUA 2JEOA 2D1TA 3DH0A 4F9GA 3OJEA 3B7WA 1SNYA 1HT3A 1KJJA 4BAUA 4QDUA 3GEDA 4RZHA 3V00A 2VDLB 1G38A 3B1VA 3WLJA 4D0SA 1TC2A 5BWNA 4ENPA 1P7DA 5DX1A 3H4BA 4I4CA 2VP2A 2VPPA 1ZNQO 4QARA 3G8YA 3OF3A 3N7AA 3RVSA 1MUUA 3V4LA 5HS4A 1HH4A 3JALA 2AN9A 3O4HA 3TQFA 5IJAA 2C9OA 1LKZA 2C1EA 5EKTA 1QOQB 4KPFC 5EJ9A 1E5XA 5BY2A 3O8QA 2QX4A 3QM1A 1W5BA 5LQRA 4JQOA 4JELA 3PQ4A 1FJHA 1F3LA 1UL1X 3I9LA 3PPWA 2HDNB 5IIKA 2ONYA 4NECA 3C1OA 4UFOA 2FR0A 2JLBA 4D9JA 4IICA 1B15A 3IDQA <