3QU5A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp11asn mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
221
structure length
221
Chain Sequence
KLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 82
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu5A01
3U7HB 1YV9A 4FFDA 4UASA 2FPWA 4F71A 2ZBDA 5ALSA 4QJBA 1Z5GA 2ZBFA 2WF7A 1T5SA 5AW3A 4C4TA 2OM6A 2O2XA 3QU4A 2B8EA 3UMCA 3ESRA 3ET5A 1QYIA 4EX6A 2ODAA 4OHFA 1U02A 3QUQA 2G0AA 4KYTA 3WKCA 4UM5A 1T9ZA 5AICA 5AK4A 5AM1A 2X4DA 1X42A 2OA0A 3ZX4A 1QH9A 3QXGA 2HOQA 3HYCA 4DWOA 2I33A 2B82A 1RKQA 3E84A 5AK6A 2G06A 3ONNA 4XPZA 2I34A 2C8KA 3QU7A 4Y2TA 1WR8A 4QQFA 3OCXA 5ALIA 2O9JA 2JGAA 2WF8A 2HF2A 1K1EA 2R8EA 2FPUA 3MPOA 3I76A 2W4MA 3N07A 4MWOA 4J03A 1CR6A 4XQ0A 1SWVA 4BKMA 3AR9A 2I54A 4KNVA 4RESA 2YFYA 1VFPA 3EF0A 3L8HA 3W5BA 4OD0A 4EENA 3HLTA 2ZG6A 1ZRMA 4NWIA 5AW7A 2WF5A 3ZVNA 1O03A 2HCFA 3WKAA 5ALVA 1TJ4A 2HX1A 3L1VA 2CFSA 4ZEXA 1L7NA 2C88A 3ZTWA 4UATA 2WFAA 3BWVA 1N9KA 4BX3A 2YJ4A 5ALRA 4H1WA 4AP9A 4YGYA 1RLMA 1VJ5A 3M1YA 5AKGA 2BY4A 3OPXA 5AW2A 1RLTA 4PNHA 1Z4KA 2R8ZA 5AM0A 3R9KA 4FYPA 2IA5A 2PQ0A 4AS2A 5T41A 4CNQA 4DFDA 3TLMA 1MH9A 3DNPA 2PKEA 5AW4A 4NAVA 2QYHA 4JB3A 1TE2A 1WZCA 4I9FA 2HSZA 3WKDA 1Z88A 3FM9A 4YCMA 1WVIA 2G09A 4HGPA 2YMQA 5AHXA 1RQNA 4UM7A 5ALLA 4C4SA 4UMDA 5AKZA 4C4RA 3L0CA 3GYGA 4HGQA 3D6JA 3B9RA 3I1YA 3U7EB 1CQZA 2FEAA 1ZOLA 1RMQA 1U2SA 4EZEA 4GXTA 4YCLA 2MU2A 1PW5A 3DAOA 3KOOA 1YDFA 3AR8A 3NALA 4FE3A 2D2VA 4UW9A 1Q91A 1YNSA 2YJ6A 2W11A 1Z5UA 3QU9A 5AKEA 4J2TA 3ZVLA 3AR5A 1RC8A 2HEGA 1RLOA 5AKKA 3N1UA 3NIWA 2HI0A 1Z4OA 2HDOA 2IOHA 1N8NA 2WM8A 3P96A 1EK1A 2VKQA 5AKXA 4RETA 4XE5A 4G9BA 2I7DA 4BX2A 2IYEA 4BX0A 2JAWA 3ZWKA 5AIBA 2B30A 3EF1A 4NABA 5AVTA 2GFHA 5ALWA 2HHLA 4CE6A 3QX7A 5AKYA 3ET4A 4JDPA 5ALNA 3QLEA 3B8EA 5E0OA 2FI1A 3MMZA 1AQ6A 3IB6A 2YMPA 1YJ5A 2PR7A 1EK2A 1Z4JA 1TJ3A 3OCUA 2NYVA 3WK7A 4HYTA 3FPBA 5ALTA 3A1CA 5AVWA 3U19A 2Q4TA 4BNDA 3UMGA 3U7GA 1J8DA 1XP5A 3B9BA 3AR3A 1XPJA 3N5KA 4KX5A 2YJ3A 2AH5A 1FEZA 2C9MA 4OFZA 2IOFK 1LTQA 1LVHA 4MUMA 3SD7A 4O8CA 5AI6A 2FDRA 3AR4A 3E8MA 2RARA 2P11A 3L8FA 2JAOA 1U7OA 1U2TA 3K1ZA 3A1EA 3MN1A 1SU4A 5ALZA 2P27A 3ZUPA 1L6RA 5AW6A 5AM2A 2DQSA 1S2OA 2ZBGA 3L7YA 5AVZA 1T5TA 1Z4NA 4Y2RA 5AVQA 3OCYA 4BBJA 5AM4A 2WHEA 3F9RA 3AR7A 2CFRA 3J7TA 5AI0A 4UU0A 3WK8A 3ED5A 4NFLA 3OTQA 4BNDB 4KNWA 4L6CA 2GHQA 1ZRNA 3QUTA 3ZU6A 5ALYA 4KX3A 3WK4A 2BDUA 1TA0A 3UMBA 2QLTA 5ALOA 2NO4A 3SHQA 1Z4LA 3RF6A 1QQ7A 5AVSA 2BDEA 3KBBA 3UM9A 1Y8AA 3L1UA 3AR2A 4EX7A 3WK6A 4IG4A 2WF9A 1Z4IA 1RRCA 3NRJA 3R09A 1RMTA 1TJ5A 3WKEA 2Q4RA 3L0YA 4CF4A 2EAUA 1J97A 4L57A 4UARA 2FPRA 3FGOA 5ALGA 2RAVA 5AM5A 3S6JA 5A3RA 2G1AA 1S8OA 5AW8A 1U7PA 1L7OA 3KZXA 5AKLA 3IJ5A 1XVIA 2B8JA 4Y2JA 3DDHA 1L7MA 1L7PA 3KDPA 5ALUA 3L5KA 2HF7A 3QU5A 5AIAA 3FZQA 4I9GA 2YMMA 3QNMA 4DCCA 4YH1A 1VJRA 2GO7A 2YN4A 2MSNA 1WPGA 1QQ6A 3DV9A 1SWWA 5AVUA 1QQ5A 4ZEVA 1YMQA 4UMEA 5IT4A 3ZI4A 4Y2VA 4YCNA 5AESA 3U26A 2YBDA 2I55A 3EPRA 3WGUA 2ZBEA 4Y2YA 1Z4PX 1RDFA 4HGOA 3RFUA 4UU1A 3OCZA 1YS9A 2OYCA 4Y3UA 3SKYA 3L8GA 3QYPA 5AVYA 2CN1A 3SMVA 2FUEA 5AVXA 5AKJA 1RMYA 3PCTA 2AGVA 3KC2A 1ZD2P 1ZD3A 2AMYA 4UMVA 5ALDA 1NRWA 2FPXA 3OCWA 4B6JA 3M9LA 2W43A 1RKUA 5AW0A 2EATA 3WGVA 2ZXEA 2Q5EA 3WK9A 5AKHA 5AI9A 4BYGA 5ALKA 2YJ5A 3ZX5A 3WK5A 4IFTA 3ESQA 5ALJA 3WKBA 2AUTA 1ZD4A 4BEVA 5ALFA 1L8LA 1RKVA 3QUCA 4L6AA 4OCZA 2RBKA 5AI4A 4G63A 3ZVMA 2C4NA 3U7FB 3VAYA 3ZWDA 3OCVA 1Z4MA 5AW5A 3QGMA 5AKIA 3PDWA 3SF0A 4Y2UA 2CFTA 2FPSA 1F5SA 4Y2QA 3N8GA 5AM3A 5JJBA 3FVVA 4UMFA 3KD3A 5AVVA 5ALHA 2G80A 4CF5A 3AR6A 4UAVA 2WF6A 5IT0A 1IWOA 1ZD5A 5A3SA 3SLRA 2YMLA 2RB5A 2GMWA 4AS3A 2MU1A 1RQLA 2YY6A 3L0BA 1JUDA 1NNLA 4GIBA 5A3QA 3W5CA 1ZJJA 3I28A 3QUBA 5AI8A 1Q92A 2IOFA 1KYTA 4YIHA 5AK5A 2R8XA 3I6BA 1ZS9A 2HO4A 3ZTYA 3L8EA 2I6XA 3EWIA 5ALQA 4KN8A 2JAUA 2JARA 3A3YA 2NO5A 3CNHA 3CZ4A 1NF2A 2FUCA 5FP0A 3IRUA 4XOUA 3E81A 5AK3A 3SKXA 3R4CA 4CF3A 3ZW7A 2B1RA 3NASA 2B0CA 2P69A 4YIKA 5ALMA 2ZOSA 4Y2PA 4DW8A 4HAIA 3NANA 3U13A 2G08A 5AI5A 3PGLA 4ZEWA 4EEKA 3QU2A 4Y2SA 4EELA 1Z4QA 3N28A 3NUQA 4F72A 2R8YA 4HGRA 4E88A 2OBBA 2GHTA 1RPZA 4UAUA 2EARA 2G07A 3BA6A 3W5AA 3NAMA 4BEWA 5AW9A 5ALEA 5ALPA 3E58A 3MC1A 3A1DA 2P9JA 3FPSA 2B1QA 5AVRA 4Y2XA 1L8OA 5ALXA 2C8LA 5AW1A 1O08A 4HGNA 5IS2A 3PGVA 4NV0A 3W5DA
chains in the Genus database with same CATH superfamily
1U4NA 4J29A 3BQ2A 4XYMA 4WFIA 3JYQA 1X8JA 2B5WA 3UWSA 4IDFA 1HTBA 1XTSA 1W25A 2R48A 1SO8A 4DS3A 4F3YA 2ECPA 2ZRJA 5JNRA 3U1BA 2DPLA 4UHHA 2BBSA 1A7AA 1Y1QA 2XIJA 1KR5A 1EQAA 4AC9A 4YR7A 1JKJA 1UBCA 3F1KA 4J7UA 1A5TA 1D03A 4BBAA 3SS8A 2JBWA 1H85A 2ZTLA 3H6KA 5D3MB 2O2YA 5C8YF 4OIMA 3NDRA 4OXKA 2P6RA 1JHPA 5EIEA 4LF5B 3GN1A 3CW2A 5JMWA 4RTLA 3AEZA 3UHJA 3TQSA 2NRVA 3RRGA 1S9DA 2ASEA 3EHEA 3T5HA 5FPSA 5DLFA 1PUIA 4EZ6A 3GXOA 1NYLA 3QWBA 1H9BA 1YHYA 1X2IA 3EVGA 3FVRA 2AT1A 1BA2A 1VPLA 4NBWA 1DX4A 5A02A 1X70A 4DDUA 1EB8A 1F38A 1NOIA 3I32A 2O7QA 3CINA 3PYXA 2QP9X 3STWA 3PRYA 2ZBQA 4N0DA 2BEJA 4RMHA 1W73A 4BMZA 1F4VA 1JBKA 1E3EA 4FZLA 2O3JA 4HB4A 2VA3A 2QRZA 4MOWA 1UBLS 1YT5A 4XFJA 1P8AA 3F6RA 3WA6A 2RHBA 4FCTA 3VO8A 2EG5A 3K4QA 2GFHA 1PJ2A 4V1CB 2VDWA 4D9IA 3DJFA 3MWGA 3N2GB 2WWYA 2NZUG 5DBOA 2RBEA 3EXIA 2C0QA 1XP5A 3EW9A 4GI7A 4NPAA 3VHQA 4MRAA 4A6DA 3WLNA 3ESZA 2BP7B 2H2AA 1T9AA 3DZKA 1M5TA 3LLCA 5BT9A 2Y2UA 1DAOA 4OXIA 2IXGA 1JXMA 4HNUA 3ROPA 1IXSB 3AR7A 4YJGA 2ZVJA 3BJMA 3CB4A 3MNFA 1OWLA 1NBOA 5EYPB 2QLTA 1JFVA 3AVQA 1XCJA 1L5RA 1K08A 4GM0A 1TUEA 3E2MA 2J9YB 3A05A 3TLZA 4MI9A 4OHWA 1UC8A 2XB6A 1BYUA 1MX1A 2JD0A 1JEDA 1UDBA 5LOVB 1RJWA 2DOKA 3DWIA 4MQ5A 4MQEA 1Y3CE 2X2PA 1YI0A 1IXKA 4ZPXA 4UHBA 3N7UA 3GA7A 1TI7A 2DG2A 4RZSA 2YIMA 4JB0A 1JV2B 3O9ZA 3KJQA 1E60A 1HDYA 4Y6RA 4C8NA 3W9YA 3QZ8A 1YK0A 4JJKA 1SG9A 2JW5A 3PQEA 4PHAA 1OXUA 3UW3A 4CLEA 3U6KA 3G2HA 4ENTA 3SMVA 1RBYA 1PBNA 5K0EA 5EPUA 3F71A 5A0VA 5CYOA 1IJBA 1YRWA 1RSZA 3BSFA 1EJ6A 3DDSA 5CHGA 1KY4A 1D2EA 3ONWA 4MKGA 1W5EA 4R81A 3OPYI 3LGSA 4EA7A 1KOLA 2M6SA 5E1BA 2F9MA 1L4UA 1MAVA 1CVIA 2ZJ4A 5HE8A 4N9WA 2XD9A 4HADA 3IGFA 2VYQA 5J0XA 1PJ4A 3GT4A 5K0GA 5CFMA 2ZUWA 1NXTA 4DL6A 5KBYA 4HOYA 5JAUA 5HQ3B 3G8BA 3CW8X 3DEEA 4E4TA 2OHHA 1J9GA 2XKJE 2I91A 2HB6A 1BKDR 5DTEA 3BL6A 2MMCA 4ECTA 1DOZA 1R4MA 3ZOZA 1J00A 1SEVA 3HCWA 5ALMA 5SYAA 4EW3A 3P0RA 1PJLA 3MK31 4KXQA 4B2PA 1Q6ZA 1US8B 4RFVA 3K4HA 4BLPA 1NQTA 5A06A 4YMOA 1YB2A 2J5KA 3FHLA 1WQ3A 3Q7SA 2C5FA 3RRBA 3KJXA 4RIIA 2W7OA 2Z9BA 4QNMA 2XWJI 4ZV9A 3IC5A 3BGWA 3FIJA 3I0NA 5AW3A 2OM6A 1KH2A 1LPSA 4LDZA 1C3XA 1E79A 2X40A 3WIBA 3OUTA 4PONA 4ALIA 1Z2EA 1EFRA 1O96A 3I2KA 1XCPA 3BB1A 3TL3A 1PD1A 2EDUA 1R00A 1F0YA 1CIJA 2RDJA 2JGAA 3ZLUA 3JQDA 4L07A 5KFDA 4DCJA 1SZJG 3WKAA 2P2YA 2H08A 3LOPA 1N5JA 4U9HS 3OCCA 3NDBB 4Q7QA 3SWWA 4TKVA 2NSYA 2QXTA 2FMFA 3RJEA 4MJLA 3AZQA 1K9VF 2FZEA 3DZDA 5TQ0B 4KDFA 7ICPA 4PQFA 1P7PA 1U8TA 2E89A 4D0SA 3H5WA 3D1JA 1LTHR 4OU4A 4UM7A 4D0LB 4WN9B 4KLUA 3I1YA 3ZHOA 1RXSA 2PZFA 1TRKA 3DO8A 4TN5A 4RFSA 4C1BA 1IWPB 3T7DA 3D7KA 1RYSA 1JDBC 4GXKA 3MTAA 1T4DA 5FOWA 1BPEA 2AFHE 4I6GA 2X7HA 3Q3GE 4XCQA 3V7KA 3GEPA 1MT3A 4NABA 5D3QA 3FB4A 3ET4A 2IDMA 3I6ZA 3SOPA 1YZQA 4K9KA 1AQ6A 2G5GX 3HLKA 2ISCA 4ECYA 3B85A 3ZWMA 4M2LA 4Y6GB 4BFUA 2ACKA 2IF0A 4C0KA 2QZSA 2JLBA 3EVCA 1FYEA 3Q9NA 1NV8A 4R2KA 1YBHA 4PZ0A 3DE5X 1Y63A 1E5XA 2C7PA 1SAYA 1NKEA 4OYRA 1FFUA 4P0PB 2ZBPA 1NYQA 5JCOC 2B69A 3OOEA 2KM1A 5EWLB 3UT5B 3R40A 4RQ3A 1UA0A 2I62A 4UU0A 1HUZA 9ICUA 4JR1A 3B2QA 2RK3A 1WBJB 1IMJA 3UFBA 1CHNA 2H1HA 1PGPA 2X4LA 1XRRA 3PQ7A 4W9NC 1JU3A 3ZK8A 3VNVA 3WK6A 4KQEA 5K3FA 4TYYA 5L7YA 3PEWA 4XW2A 4O63O 4DIMA 1WKCA 4H7EA 3LFUA 5EHNA 2PD4A 3K9WA 1UMBB 3NB0A 3P2YA 3LFHA 2GEVA 3A58B 4ZXFA 2PLFA 2PGXA 4RTOA 1DJPA 1Z1BA 4GNKA 1ZIOA 2XIDA 2V6MA 3W6OA 3WGUA 3N4MB 1YA8A 2FVXA 1YS9A 5FOSA 3ZQKA 2CMHA 2JH9A 1UL1X 3RYTC 3GDGA 4HWTA 2XMBA 3OT1A 3OVMA 2BGTA 4EYKA 4ECQA 2N47A 4PZPA 2A78A 2XB8A 4GMGA 4PO9A 1WZNA 2FMTA 2KPOA 1K8QA 3K9CA 4RSMA 4QGSA 1UXKA 3T1TA 5H80A 5EZYB 1E1DA 4BZZA 3V72A 1J8FA 1V4VA 3OJLA 2CKMA 2CFTA 1QJCA 4LTNA 5JRZA 3KD3A 4AI6A 2CLDX 2O23A 5JT1A 3QWIA 4E5SA 1DGSA 2FN9A 1SL1A 2D1RA 3R3SA 5A04A 1DOAA 2YINC 2IOFA 4DIUA 1J20A 3QRWA 1K7YA 1P61B 3UH1A 2OORC 2FLWA 1MEJA 4KIJA 3GH3A 5K9ZA 1BQ4A 2J31A 1PR9A 4F4JA 3N05A 5HVNA 2VFAA 1ZCFA 1ITZA 3TQIA 2Z9DA 3DC2A 2XC9A 3R5HA 5DCYA 3DTVD 1U48A 3BCUA 2L0XA 3G6VA 1ORDA 3SSOA 1M2NA 1KI6B 1W85A 3VISA 4MWGA 2CF6A 1K6JA 3NHPA 1SHJA 1R4NA 5THXA 3ENWA 1K1SA 3B0XA 5AYVA 1FFGA 2BGKA 4QDUA 3TM5A 5G40A 2UZ1B 3RK1A 5EZ5A 2C2OA 3H2KA 1GGVA 1H4SA 2WZDA 5IJXA 4ED2A 2PV0A 2KZZA 4YI5A 2VOJA 4DQUA 4WY2A 3E7XA 1K5GA 4Q4HA 1P5RA 3MQFA 4LX0A 4DCOA 5F2NA 3L18A 5KU1A 4M22A 3OOHA 3ZCQA 4UULA 6ADHA 3M89A 4IZOA 2WWGA 4GSKA 4MQLA 5B53A 1ENYA 2ZT8A 5DIFA 4KITB 5I3CA 1BXZA 5E3HA 3BMXA 4CG0A 5AR1A 1VJ5A 2R87A 1T2NA 2KYRA 4WCFB 1AQUA 4GGMX 2A86A 2PNJA 3PFGA 2G8NA 4AN4A 2JK0A 4ZI5A 3CVWA 1NJWA 2E3TA 4AG6A 3V5NA 1WVIA 4LGCA 3GDOA 3WDSA 2EH9A 2UVWA 1T0BA 1PZGA 4IHKA 2OO5C 1WB9A 3TADC 2VHWA 1UFRA 3D8BA 4EW2A 1ISJA 1WUIS 1LRKA 3R6DA 3NXKA 2JPDA 5KFBA 1AV7A 2QE7A 3F3SA 2OGUA 4DPKA 1RYDA 3VDMA 4G9BA 1XTZA 2AW5A 3UICA 1KK1A 3PCXA 3BWXA 3L8YA 2HJHA 3GLSA 1Q0RA 3QVSA 4MVJA 5G3YA 3FYUC 3H87A 3UZUA 5I7RA 2IL1A 3BIOA 2PR7A 2VRNA 4JI3B 3AETB 3UMJA 2QRHA 1Z0IA 3AYZB 3N8DA 1S5PA 3Q4GA 3OF2A 4P4SA 1KJIA 4MRRA 1KH1A 4DF8A 4FYIA 3EMBA 2YVAA 3HH8A 4MUXA 4MARA 1SBIA 5BOSB 1E96A 1BMQA 1ECBA 1NX6A 1QLNA 1J7JA 4QL3A 4Z4CA 4KIWA 2KKVA 5F2OA 1NR1A 2ZRFA 5FHQA 3SYLA 3RRFA 1E2KA 3KSDO 4DLRA 4WLEA 1D0VA 3W4JA 1VYUA 1ADFA 2I5HA 4CRWB 5IYZB 1COOA 1I0ZA 2HNBA 3AUSA 3H0RB 1EXDA 4YBZA 4LVCA 4CR6A 4Z9YA 2J59A 4XVQA 3VR3A 2ACVA 3U48A 2IE0A 1R6VA 2J6IA 3ROTA 4R98A 1W87A 5JSZA 1MEOA 1V3UA 1UBTS 4NM1A 4JKIA 2IPAB 4XIJA 2E85A 2VJLA 3I39X 4ZEVA 3AI7A 2Q6LA 3ZI4A 4LISA 4MICA 3BJEA 5L8VA 1TQ2A 2YWRA 5HHTA 4GYYA 4QT4A 3B2NA 3RSOA 3IOMA 4J0QA 1WQ1R 4P1ZA 1MT0A 3JPTA 2XEXA 3CTMA 4U1RA 4BQIA 1C3OB 1WY7A 4PXAA 3AEQA 3WGJA 1D6JA 5C8XA 3GA0A 1FFCA 5IDVA 5ARDA 5JCOA 3BGIA 1J0AA 4OG2A 4EHNA 3RF7A 3DDOA 1WOMA 1RADA 3ZW8A 5DWVA 4TLLB 3UT0A 3GRPA 1EGHA 1B0ZA 2RI0A 4ISBA 4W9NA 4QLBA 1AUPA 2YMLA 5TGDA 4NFYA 4TMFA 2G72A 3WFJA 4JSRA 4UFNA 3LCUA 4PX9A 9ICVA 3OE4A 3KQQA 1XZFA 4NTZA 5JO0A 5H9VA 4Q3AA 2ZP1A 1G8PA 4UTVA 4I50B 5C1BA 3BE8A 2IBSA 3OFSA 3BHJA 4Q9IA 3GLHB 2OYRA 3ZHYA 4QJ3A 5DHRA 1Z6AA 1M76A 2BFFA 1G8SA 3TI9A 2C2KA 2B1GA 2WAXA 4HWKA 3NHYA 4HDKB 3E9YA 3AUFA 2QG9A 3M49A 4WEQA 1IPHA 1J2UA 4QLOA 3H8JA 1O08A 4UAYA 3E1SA 4LFCB 3TZLA 2HRDA 3WTCA 2E1RA 3A6KA 3CO5A 1LUAA 3VBCA 4IF4A 2GEJA 4HF7A 3GRFA 1E9CA 3LQYA 5JD5A 2FRXA 3MA0A 2JDID 3WB9A 2TSYB 1Z63A 4ETMA 1QDLB 1PNQA 4FINA 4NOKA 4PM4A 2I34A 3HM2A 3HVJA 1NMYA 2HBQA 3I04M 1TYDE 3GJ7A 3GPIA 5FUBA 5ITZB 1RHRA 3DSRA 1W1UA 1TW3A 4HV4A 3KV3O 1ODSA 3H4VA 3EFBA 4PCLA 3MQ4A 1Y0BA 1XG5A 1GO2A 2D1SA 4BLRA 5CFZA 1N77A 1PJQA 4F5NA 3GFFA 2FETA 1W5SA 3BK1A 3LYUA 5KDLA 3EIOA 1VCOA 2Z4RA 2CZCA 2Q4EA 1I51A 5FJIA 3BZUA 3MLEA 2ZI7A 2FMIA 3UA4A 1T8WA 2HMYB 4AZWA 2QD5A 4CU2A 1U8ZA 1JMKC 3B38A 4XXHA 2QD1A 1ZQNA 5A3VA 2E48A 2FMKA 3UMVA 1S6YA 1N5XA 2R7LA 5EN4A 2B1JA 3GLKA 3JSXA 1Y4AE 2XCTB 4XX1A 2IZZA 3U9TA 2J45A 2OH2A 2XUJA 1MB2A 3F5MA 4R7TA 3IP8A 1UWLA 5C80A 2P4QA 3DUFA 4M46A 5KHLB 3GBSA 2JZCA 1YU9A 2FMPA 1H0KA 2ATIA 4IWXA 1TUGA 5C0OE 1YZUA 4BZXA 1YIDA 4QVGA 1NUPA 4UHEA 4BX2A 1D9DA 3Q8WA 5NLLA 2JBAB 3B1KA 1X8LA 5GZ3A 2F3NA 3ACCA 2X9VA 4CQMD 1PK8A 5GONB 1F5NA 4ZCMA 2EKQA 3CZRA 4N12A 2FR8C 3MJ4A 3PVZA 1DQZA 1FSSA 3SEFA 3E3LA 2Q1XA 4DMCA 3WFIA 4GFJA 4Z6EA 1EA5A 1K4YA 3PSHA 2FW6A 5LQKA 3RC1A 4J0HA 3IOCA 5DEOA 3WJ1A 3F7MA 1QVZA 3OD5A 2ZAYA 1INLA 3RYHB 2WU8A 2E6KA 2UVRA 1OFHA 2WWVD 1AHNA 3QTLA 1D2MA 1AU9A 2QN9A 4JVMA 1A3CA 3BEDA 2ZR8A 1Z2PX 3OE1A 1X1QA 2I2WA 1HDXA 1OW5A 4NEGA 1PR6A 4MEBA 2D3DA 3SSAA 4QKQA 1SXQA 2R1VA 3IALA 2A5YB 4O2AB 4C06A 4Q9KA 2AMFA 1GTVA 3Q8PB 4R9RA 3RBEA 5I48A 2W98A 1J56A 4WLFA 5C5EA 3OTIA 1SKSA 1KY5A 4TMZA 5KNBA 4D8WA 4B9LA 1JFSA 4RTSA 1CDZA 2J07A 4MS1A 3UMYA 5LYJF 1LNQA 4ZYZA 5K0SA 1OH8A 1G3QA 1SBNE 3LUCA 1BMFD 2ISOA 2JV3A 3SC6A 1JQAA 3WL5A 2P66A 4S1PA 3MGGA 3ESDA 5DHFA 1B3BA 3DFMA 3BS7A 1U0BB 3TNJA 3H2SA 1RRGA 2QUIA 3QEMA 3BMQA 1J1UA 5JJBA 3OJWA 2CF5A 4DSAA 3FSEA 4GVXA 4L5JA 4Y9DA 2BFMA 1DX9A 2E5LB 1UM9A 2QV0A 4CMCA 2RMKA 4E30A 3CGWA 5KFTA 1G21E 2QPAA 4H6VA 4G5FA 3W34A 5DIZA 4Z99A 5JHGB 4P4MA 1QVWA 3L7LA 1ZGZA 3HE3A 3CNHA 2VJYA 1YTLA 3HJBA 4NG5A 1O6GA 3LW8A 4DA8A 2JEJA 4R5HA 2P69A 4O4LB 1ZQKA 4Y2PA 1DXYA 4LSWA 2AF4C 3PNYA 4ECUA 3KUUA 2GI4A 4G3XA 3RFXA 4U6QA 2P6UA 4OLHA 1G5FA 2Q8PA 2EJWA 5DPMA 1NYTA 3NOVA 4KQMA 4X6LA 2HDWA 2DECA 4UB8U 1Z17A 1H4QA 3KTOA 4BY9E 1JXAA 2QDKA 1QFJA 1E9BA 3KXLA 1R18A 1KJNA 1U8UA 1ZMTA 5AVKA 4OJTA 3BRWA 1M6WA 1X42A 1L7VC 3QV1A 1FFEA 1I7QB 5DGCA 5EC8A 5KFMA 5CHYA 1V43A 2GERA 1NJFA 1JVBA 1RT9A 4GLJA 2DRIA 1MZPA 4K9RA 1KVQA 2OXIA 3LDFA 4CLOB 1X7YB 2EJBA 5EJAA 1JMVA 1AURA 5KFCA 3QNUA 2QKYA 5KYYA 3ZY6A 3OX2A 5CIQA 4JLPA 1C7QA 1XXHB 4TMWA 3GJ3A 2SKDA 2HBYA 4YV1A 1G2OA 1Y33E 5J0YA 4DAEA 2WTBA 4KBFA 4LCBA 4QYXA 5AHWA 4XM0A 4EECA 3O92A 3VDNB 4NY1A 3K0AB 3MTBA 1VCNA 5DW3A 1RI1A 4B87A 1RQ2A 1YQWA 4I5DA 5LA6B 1TT7A 5KAFU 4YJ2F 4Q02A 4XUGB 3QJGA 1V5IA 3DEJA 3K16A 3KFVA 3AR8A 3TL2A 4UW9A 1N2GA 1EJ0A 4QXMA 2ODGA 1QGUB 5MDHA 4C7OB 3GMTA 1EFDN 3B89A 4MYDA 5CFRA 3NGXA 1N3BA 3O91A 1F14A 2W2NA 4YRZA 1GUFA 3HWTA 1RYRA 4FOOA 4IDEA 2HN9A 1RNLA 2WOOA 1JXEA 4ADSG 3LUHA 2OCDA 1YR2A 4ZAFA 3LXMA 3RKSA 1AKWA 2FW0A 1FZQA 3DDCA 1EKXA 1LBEA 1FEZA 4MAMA 2AXNA 3NBZC 5JYEA 2C3PA 4DTCA 1NLZA 5DK6A 1OJLA 3KB2A 1XPRA 1DWPA 1WD7A 2ZIXB 1IH8A 2DQYA 3OHAA 2QTGA 4ZV4A 1HURA 1Z4NA 1L5NA 1YE8A 1MB3A 4LZDA 2O07A 3DV2A 2O2EA 3M6MD 3ITNA 5FI3A 3U09A 3PVCA 1P17A 2OCXA 4A3SA 4O25A 2KMLA 3I6YA 2JZBA 1DTSA 4JIGA 3HNRA 1FSGA 4LYGA 5CJ2A 1KDZA 4N5LA 2ONJA 5K0TA 3PHGA 5J4VA 2MJLA 2FJ6A 4Q47A 2JFPA 5F1OA 1YR6A 1TIBA 1Z28A 2CD7A 2G8LA 5BWNA 1DPGA 1CY1A 1MKYA 2A84A 3D0OA 3LQFA 1RI2A 5I9BA 1B6RA 2XMZA 3F6BX 2AZMA 5FEMA 3SLKA 3DTVA 1DKUA 3HU5A 1RHKA 1KEVA 5J2TA 2QTVA 4INAA 3ZU3A 2FR8A 4BQQA 4XVRA 1RKUA 4KR3A 4RPIA 4NBNA 8ICEA 1DE0A 2UVDA 2XUIA 4OJYA 1JILA 3L40A 3CLHA 4MUIA 1MTZA 4KXFB 5DM1A 2H59A 3QKUA 4MS3B 4UTOA 2WW8A 1P9NA 5TT0A 1TIKA 5CBPB 3RASA 3K70B 3JRWA 4HFRA 3RS2A 5HS4A 1BEZA 1PDVA 3LY5A 4PZZA 2E1PA 4O5EA 3IPLA 2TMDA 4ERXA 3IP6A 1FUUA 1WMBA 3FTEA 2RJ3A 5DX0A 5I7WA 4HEQA 3W2GA 5CPFA 3NTLA 1HDIA 1LJ8A 2RB4A 3U9LA 3VR5D 2BEUB 5JJ5A 4C5AA 2HQOA 2O3UA 4U6NA 1GCGA 4LJ4A 3KB6A 4YPFA 4IGFA 3EOBI 1ZY2A 1FNCA 2B1QA 5AVRA 3KEMA 1AQLA 5AW1A 3GZNA 4ICAA 4N8SA 1VHTA 1YAHA 1F2UB 3MINB 3K9FC 1NVGA 1X8XA 1BS1A 1PL8A 2H48A 1SK8A 4C7BA 4CTJA 3IBGA 2F7SA 2PFGA 4P4PA 3TFOA 1G64A 1EWVA 3DKPA 5KNDD 2C4HA 3HKCA 4FYHA 4Z5XA 4B8ZA 4L4ZA 2K8CB 1VP3A 2FUKA 3DLCA 1TD1A 4Y67A 5B3LA 3HBLA 1MO4A 1TYBE 1O03A 4R8SA 5DX8A 1CETA 1CS0B 1LLFA 1P2FA 1PNVA 1T3NA 5EXSA 1Z37A 4FN5A 4JWNA 2ZSBA 2WUFA 4X20B 2A8YA 2RK4A 2VUIB 4W5NA 2I76A 3DGEC 2JLVA 1UQUA 1TMKA 1XJWA 2OOSA 3ONDA 4GSYA 4HJRA 2EP8A 2YICA 4D79A 2OCKA 3GOHA 4HWRA 4MF2A 4Z53A 4DS4A 5F7OA 1PN3A 2PIDA 2UYQA 4AX4A 3UXNA 3NAQA 1R0ZA 1JQEA 2XAAA 4OFBA 1FNNA 4C04A 5H70A 3PI7A 1II0A 1N56A 2HHWA 1JSZA 3JQQA 3IJEB 4BFYA 3D7MA 2HDOA 4OQMA 4B32A 3EGIA 1NF8A 4GL4A 2PRYA 3PDJA 2ZSFA 1ULUA 4DQXA 4UPVA 5ADUS 4ECXA 3EEFA 5HR7A 3D7SA 5ECYA 3RUAA 3D0RA 3W8NA 3VNSA 4IIBA 2Z08A 1C0EA 2WWXA 3JASB 3GIWA 5J2CA 2GWSA 3C7AA 3PNVA 1OREA 1V71A 3C21A 4N39A 3X1XA 1UKBA 5BMOA 1A4XA 4UJ3A 4YMLA 1RHQA 4GKAA 2G0NA 1U7OA 3EOAI 1LK0A 3NQ41 1PT9A 3DMDA 3BRQA 1DAPA 5FRDA 4YJHB 2IYFA 3ZQUA 4U5QA 2YNMA 2HR1A 1JECA 4UQPA 3OO0A 1GTMA 4QPJC 5JUWA 1I1HA 3HXKA 4HWPA 2PS3A 3VI4B 4M54A 4IS7A 2HK6A 3UM9A 1Z7GA 1KYQA 4W1SA 2PH5A 1WCLA 1GU0A 5KYWA 3C39A 2VTEA 4YT2A 3CW2C 4TURA 4E6PA 4DR6B 5EJMA 5FWYA 2VZ9A 2FG7C 3SJ7A 3WIVA 4B8YA 4Q4CA 3S8MA 3IELA 4EAQA 3H8VA 1F8FA 3ZDYB 2WABA 1F6DA 1J99A 2EEZA 5DNEA 2B20A 2F77X 4I9GA 3MJFA 1WPGA 3DV9A 5AVUA 4QWBA 1GTSA 1XVAA 1Z6YA 2JEIA 5DSTA 4Y2VA 3DFKA 2Q5HA 3ZGXA 1JHQA 1M1YB 3ZV5A 1Z4PX 1GZ3A 3W77A 4NCNA 5ELXA 2ZREA 2WJJA 2D8AA 5I7FA 1X2EA 1BWSA 1EXVA 3W2HA 5I7EA 3T5AA 2BFAA 3LM8A 3K9QO 4F2SA 3ABQB 2V8OA 1PR2A 1QR6A 1ONOA 2MUTA 5HRAA 2CXHA 2XGSA 4YCCA 2F8MA 4YRPA 4IIFA 5CEEA 2FEPA 4QYIA 3AW9A 2V5VA 3FY4A 4XIYA 2G17A 3R7WA 3HVIA 1JG7A 5F3XB 5IMBA 1Z5WA 3SZUA 2X13A 4JT8A 1BYIA 1DFIA 3HSYA 2OHFA 5L4NA 1V5FA 3HWSA 121PA 1SXPA 3QIAA 1NDQA 1W5FA 1YRLA 4BNNA 2C7QA 3L7NA 3GV0A 3G9UA 1N5WA 1RXIA 3NRZA 1SXJB 3SKXA 2I4LA 2BGMA 3CE6A 2WJHA 2Z5LA 1T5LA 4JOCA 2HLHA 1OV4A 1Z33A 3F6EX 2WFLA 4FX2A 4UAUA 1DIOB 1HY3A 1AVTA 3QSYA 2AX3A 4EA8A 2YZ7A 3KZOA 4GLFA 4L16A 2MDTA 4U7CA 1W8IA 2JLXA 3QXCA 4F11A 1QYXA 1W4RA 4MYSA 1G0OA 4YXWD 3LYLA 2VI5A 2EZXA 4ZH4A 3OQJA 2FPPB 5I4BA 4MMZB 2O2SA 2AJCA 4HTFA 5CJPA 4CCYB 1EIWA 3C2MA 3PNCA 4QUIA 5BNZA 2YWXA 4XEUA 1Z62A 4HRVA 4PBTA 3SQLA 3AEXA 2JHGA 2G9NA 3LCJA 3WXMA 5J58A 2C4KA 2QL9A 1KVTA 5LQUA 2G1UA 3KU1A 2XNHA 2GN0A 3WV5A 1NZDA 3JTEA 1T26A 1S0MA 2W5UA 3Q3VA 4I2BA 2V4QA 4UTNA 1NVMB 4BO5A 3CYFA 4H6PA 5EERA 1KKMA 4FYPA 3GLIA 1MH9A 1M2WA 1A5BB 1WZCA 3N3AC 2LRHA 2H4JA 2CE7A 3AHFA 4MZXA 4MRSA 4F5PA 4JXZA 1JDJA 3VX3A 2FLLA 3P4YA 1P0FA 1EU1A 4ZD6A 3D2CA 1U63A 3TZEA 3FTNA 2BSQA 1ZQZA 2WM8A 2SCUB 2XUFA 3VVLA 1MO2A 2A3VA 1BNPA 1QBGA 5B6IA 1XZJA 4RYDA 2XVTA 4TSFD 4XUDA 1YRYE 3DYVA 2WVJA 4LE2A 3NNDA 4MO9A 4J43A 1FP4B 4MHVA 4GHWA 3FRHA 2IJGX 4ZAGA 1LFAA 3W90A 3UG6A 2GAFA 1KMMA 3FPBA 2FU5C 5TJ9A 2W9BB 2WLSA 3EIQA 4TXLA 3RC7A 2BHTA 3N0WA 2G70A 2C9YA 2AKYA 1F7VA 3P52A 2JA1A 4UEJA 4EUSA 2O3QA 4X5OA 5CD1A 3RIYA 1BG6A 1BPZA 4KO3S 1I7LA 3D5QA 2BZ0A 4Y2RA 5JLJA 2MYPA 3GZTB 4ZREA 2XITA 3WI7A 4YJ3F 1OHHA 3SI7A 3EYWA 2BDEA 5FUVA 4LGMA 1Z47A 2AEMA 4Q9JA 1R0CA 4PGYA 1YFKA 2H9YA 4QIHA 5JI2E 1SU7A 2KP7A 3ZD9A 2B4KA 4GOMD 1SZPA 4GMHA 1QX4A 2G5PA 2FE4A 4PH5A 1HJPA 5HIKA 2H5EA 2B78A 2JAHA 5ILGA 5H2FU 2AIRA 1ZEJA 2OFFA 1RJDA 5J9FA 3TR6A 3KZNA 4F4FA 2FFHA 4O6VA 2GF2A 4L2IB 1A8IA 1KMHB 3EVTA 1E8DA 1NY5A 4UU1A 1SBTA 3C4VA 3R9WA 4YP6A 4RGYA 5BWBA 2FUEA 4IJ6A 1XCLA 3MT8A 1JLMA 3FPCA 1LDGA 2IYWA 2Q5EA 5U4XA 2B0JA 2FH5B 2C5AA 1C2YA 4AS1A 2C2BA 1PHPA 1ZK1A 1ZD4A 3BQMB 1Q1BA 3PA6A 3ZZMA 4HB2A 5F64A 2PXHA 3JVIA 1VG8A 4PR0A 2JK1A 2E3JA 4ZPJA 4V2IA 3FNGA 4EEXA 4H27A 3IDQA 2AUMA 1NBMA 7AT1A 4O4HA 3TAXA 2GDJA 4NRDA 2Q6TA 4DZTA 3JQ7A 4GAEA 2FSVC 1IE3A 3PGKA 3O26A 4XOUA 2F1HA 1FLAA 5DNYB 3C3PA 4UBLA 5DDMA 2WHRA 5KJEA 3OHSX 4MEJA 2UYHA 4X3OA 3T6KA 1GWNA 3NBQA 4QRHA 2CCGA 1X7XB 1KF0A 2XI4A 3A1DA 3PQ6A 1YZ7A 2RJNA 1T9CA 2JA2A 3L4EA 2YJGA 2GBGA 2G0TA 2HT1A 1U99A 3CUYA 4P2HA 3LLSA 2G67A 4RENA 3DD5A 3WKCA 3KKEA 1FP6A 2B7CA 3S8YA 5AXDA 2H17A 2AJ8A 1MIOA 3QVLA 1WDTA 4YRCA 2GEBA 1ND6A 1CRZA 3KEGA 4BVLA 4I66A 1TEHA 2X9LA 3U5ZB 1NE7A 3CKMA 2HCFA 3PUIA 1P7DA 2BTQA 3HKZF 3I9NA 5EP3A 3BMNA 1NW4A 4KXXA 1AQJA 3NAZA 5EWMB 3AQIA 2DFKB 4FBGA 4EPXA 4DHWA 5AM0A 5LOVF 2BUAA 3ENVA 1L3VA 3BJIC 1KP2A 5A0TA 4JOQA 3TLMA 4M7OA 4JP8A 1Q22A 2WD7B 4XWWA 4MW1A 3GOQA 4LF4B 4G5SA 4F2WA 1VE5A 6CHYA 2PGOA 1TTQB 1DDGA 1H8ED 2QV7A 1U2SA 1CUZA 4K6GA 3QKIA 4ES6A 4MLCA 2YJ6A 1NC3A 1D0IA 4TTRA 2B4YA 1ISIA 2HEGA 4J49A 4C0LA 3BS5A 2AXQA 5DW0A 2YHUA 4ND5A 2QYTA 4EHJA 3D02A 5CVUA 5EXTA 2XTZA 3ND5A 2Z1DA 3EA5A 5DE3A 4W5JA 1P7CA 5KSWB 1TYCA 1ZM7A 3HPQA 3OQMA 4UHCA 1IOLA 1V6CA 5AOVA 1T0JB 3BN3A 3I83A 5DB9A 3DONA 4Z0PA 4I5IA 1XJQA 2IYLD 3EXEA 4XJTA 1X13A 4CKWB 1JIIA 1M3SA 3ND9A 3RFTA 5DU2A 3OQBA 3AVXA 4E2XA 1RXUA 2R8RA 3CF0A 2R65A 3IXQA 3MGKA 1CEEA 5IINA 3VM6A 2C9CA 5IKOA 3OE7D 4GC9A 4GBED 3EEBA 2RC6A 3U3KA 4UE2A 1EFVB 4TUYA 3OQNA 3TL6A 3EPIA 5KNCA 3Q8KA 2XDQA 1KEKA 4FVTA 1E9FA 4LRWA 4PPYA 3K71B 1GCOA 3I45A 5AM5A 4I99A 3HDVA 3ZWWA 5K4HA 4JEIA 3HHPA 1FW8A 2R8OA 2YQ4A 3FOCA 3NONA 4C20A 4OBXA 3RABA 2P2NA 1ICIA 2ORYA 1JHRA 1COWA 3M6IA 5KCMA 5JASA 2V7BA 3X3HA 3VYWA 1U8CB 1QCKA 2REOA 1IHUA 3FD8A 2I8CA 2WPDD 3DE2X 3WU2U 4F1JA 2FJPA 1ZIPA 1NBAA 1IB6A 3BQ1A 1TIPA 4C0WA 1F20A 5IH3A 1YZVA 2ZLBA 4G67A 3EBLA 3ZHZA 4W5OA 4QHYA 2OE2A 1XQ6A 1V9LA 2YOFA 1SPBS 1JA9A 2PU7A 3L46A 2C0PA 1JTVA 2WIKA 5DB4A 1P1CA 1THZA 1DLIA 1I2BA 2PXCA 3JWHA 2PZBA 2JVKA 3KXPA 2ZYUX 3RW9A 3N6RA 1QGZA 5DULA 3QW2A 1GCUA 1X1TA 3URKA 3FGZA 5T67A 1AO3A 2Z2KA 3SVTA 2GEUA 1OXSC 3L4JA 3R9XA 1QLHA 2J6HA 1XZMA 2X6TA 3E4CA 5I8ZA 4LYHA 4UTZA 1VPTA 4FC6A 1QCCA 1V11A 1PX0A 2LIPA 4ZQEA 3BA6A 1LCIA 5IUKC 5KSZA 3RSCA 4QW8A 1HDOA 3SR3A 1ADYA 4RZRA 3GIIA 1PL6A 5M2QA 4RUCA 2GPAA 3F78A 1Y1LA 2QJOA 3WL8A 1XQ9A 4G3IA 3ONEA 9MHTA 1C9JA 2YASA 4RCZA 2UDPA 2COEA 3H11A 1L5HA 4NI5A 4D44A 1SCBA 1BA3A 4FXOA 3NDPA 4X7BA 3GO4A 4YEDA 4RZHA 4IJVA 1AO0A 4EGQA 2EC5A 1R3UA 1YQXA 5MFPA 2XBUA 4NQRA 2Y1LA 5L1LA 2GN1A 2PSDA 1CE8A 4G4GA 3I8SA 2ONCA 5THKA 1ID8A 5TIIA 1E9SA 3HZHA 1CT9A 2JB9A 1YMUA 3PKIA 1SXGA 2FSVA 1XJCA 2JHFA 3C2LA 2WG2A 4R51A 2K87A 2OLEA 4QOGA 5EKSA 5ED0A 2WAOA 1ZOPA 1FJXA 4CNQA 3HVHA 4YQFA 1A77A 3UGQA 1PTJC 1O95D 2BZFA 3C7KA 1EQ2A 5HGJA 3W6PA 2MYUA 4AJLA 2H3QA 4RQ1A 4IPTA 3DE4X 1BN7A 3HJTA 3EW7A 2WIGA 1YNOA 5J59A 1FXUA 2HQRA 3LTEA 1VMKA 4U0JA 3T3MB 4EPRA 4H1HA 3UAGA 2NV6A 2G63A 3M9MB 2BM9A 2CXUA 2UZ3A 4PZ9A 3TIXB 2IIPA 3OIWA 4YXFA 3BH7A 1YU6A 1E58A 2LYBA 4BX0A 3WGQA 5H8WA 2CCKA 3ZDQA 2ZYHA 4H1TA 3AM4A 2VHYA 3OJEA 3V4LA 5EZYF 3UFXA 5A5GA 3MERA 4KH1A 3RVDA 1H2HA 3L1KA 3R3YA 4HUQA 3QI2A 2Y76A 2OENG 1AQNA 5FPQA 3AY6A 4QHTA 3CSDA 2W9CB 4R8RA 3GELA 4XVHA 2YJTD 3B1XA 3M4YA 1T4CA 2OK7A 4L22A 4G07A 1USVA 1UPBA 1XLUA 4Q8FA 3MMXA 2ZUDA 5A7HA 3VR2A 4B9AA 2XUHA 5JWRA 3PR5B 1DBVO 4AO6A 1VGVA 4E1BA 2WYUA 3D6HA 2D74A 2JH1A 4UUAA 3HEAA 3BBLA 3T12A 2V6JA 3OTHA 1E32A 3EH1A 2O14A 5D51S 1SXDA 4N0QA 1YZTA 2PXAA 4MYCA 5DMXA 2HT6A 4BO0A 3LQRA 1H2BA 2IU6A 1EVZA 4Q48A 3PITA 3DHVA 3RIXA 1SA0A 1IBKB 5CRIA 1O89A 4CZ2A 1RWXA 5KOHA 4IQ8A 2GLEA 1QNFA 5IJ9A 3SU8A 1GYRA 4OVKA 1EVYA 3KRTA 2FEOA 5FV7A 2VSXA 2JFFA 2C92A 4ENWA 1WUDA 1V1JA 3RU9A 4D4GA 5J2FA 4UB3A 4TV8A 1VIYA 4J9QA 5ER9A 3LK9A 4TN1A 4A15A 2FWRA 2C58A 3WIEA 2O8FB 3NHKA 2C4NA 3E7WA 3EBOA 4ZCQA 4NZPA 4ZN6A 2EBHX 4I3FA 1TU4A 4B3JA 5JY1A 1KP3A 1X7GA 4OX9Y 4RADA 1RQLA 3N2IA 5ESWA 2FB9A 4MR9B 4IKPA 4TSKA 4AZ0A 1PJZA 1GG9A 2Q3DA 3D3NA 1KTIA 4W9RA 5CLIA 4B3XA 1QHIA 4DZZA 1JE0A 4CF3A 3NEPX 1GEGA 3BF7A 8ICMA 3OBBA 4PLFA 5BW6B 1XEWY 1JF8A 1G1AA 2A1TR 2BKXA 3CNNA 2QLMA 3ZHBA 3I42A 4DY4A 5K09A 3BK2A 2F4VB 1O1YA 4NV3A 4Y1EA 2M98A 5ADWA 1PTKA 5JHHB 1PS0A 5IEBA 1LQUA 2XOXA 3W5DA 4JLMA 1UMDB 2NP7A 3GQCA 3L7MA 2G5TA 1RYMA 3C29A 4RWZA 3KYCB 3UNXA 4KUEA 2GO1A 3OU2A 1Y8RB 2JLAA 1JI3A 4HEHA 3NOOA 4GH5A 4AD8A 3I2YX 2LM4A 4EP1A 2QOEA 5ENDA 1XC9A 4CM6A 5IUNC 1JYEA 1DTWA 1Y34E 4AF8A 2YVLA 2DERA 3HU1A 1A97A 3N2EA 2VH2A 1TKRA 3HXLA 1S0NA 3S81A 3E0FA 1AGNA 1IM4A 1ZH2A 4J6EA 4NP6A 3TWOA 5IYZF 5C5DA 1O94A 2HK9A 3K0FB 2M0NA 2D2EA 1OIWA 2YX1A 4MAFA 1VE1A 1RM5A 5CA0B 1YL6A 1K68A 4G09A 4N47A 3TK1A 4Y1GA 2P30A 1ODCA 1D2RA 4CDMA 1PR5A 1UXGA 4MMXB 1REQB 3DOUA 2HSZA 1NK7A 4JSTA 2AOWA 3HCCA 1IN5A 1LPPA 3FWYA 2FQ1A 4YRSA 2AFHA 3DQQA 4CV2A 3QPDA 3IH5A 3A1UA 2IMWP 4A36A 1RACA 1E0DA 2HMUA 5LR6A 1DIGA 4ZQBA 3NIFB 3HBFA 3QE9Y 9ICKA 2QUBA 4CTMA 3X2SA 4Z9FA 4IS3A 3N87A 1N2CE 2ISPA 1VMDA 3K0HA 4QU8A 1TM2A 3IDWA 3ZKAA 5J43A 3OFKA 3PLRA 4KPUA 1NOMA 4YLEA 1UQVA 3P2JA 1BWPA 3M6FA 1HE3A 1I3CA 3P9XA 4M60A 3TRIA 2GARA 3EGDA 4YP0A 4D5GA 4CQLB 5EL0A 4KWCA 2J1LA 5GMOA 1TC2A 5KVQA 1LTKA 2GJSA 5BN5B 4I50F 5EXEA 3EEYA 1L5ZA 5JATA 3BIJA 4LBZA 1T24A 1C14A 3TUIC 3P1JA 1PTJA 4FR2A 2HY7A 1SVSA 3TEFA 3E7DA 1E63A 1GPH1 5C32A 3MRXA 2HZBA 1C29B 1TUIA 2O8BA 1FTWA 3VPBA 4TQGA 3GHYA 4IRCA 4QPZA 3V2GA 3IVRA 2Z9CA 5JAQA 1QS0B 1V47A 4IH9A 2P9TA 2WMDA 3GLQA 1W93A 3MRTA 2X8AA 3EZFA 3PV0A 2O2CA 3FLAA 4D9BA 3WLEA 3DLHA 3WQHA 4EATA 3P19A 2WQ6A 5EOVA 5HS6A 4I27A 1FFXA 3DEKA 1Z2NX 2FQXA 5K6AA 1CUKA 3EUAA 3H9UA 2UZAA 1GTL1 4B4DA 1QFYA 4M83A 1JHVA 1ND5A 5WRFA 2VZLA 4XKJA 3SYNA 2N0SA 1XQXA 3ADBA 4GLLA 4KLGA 4RH1A 4EA9A 2NP6A 4ARIA 2IPOA 3T5JA 3STUA 2BQRA 3TOCA 1T36A 1YCGA 3AW8A 1XDBA 3QYJA 4XIFA 2V3VA 3CW9A 4Q4JA 2EATA 4QZEA 4HNSA 4G0NA 3I9FA 1F3OA 4E70A 2QK4A 9ICFA 4EBDA 3G89A 3GJXC 1IRIA 4L72A 4M38A 3QE4A 1KZ9A 5KG1A 2HLDD 2MINB 3KLNA 1QLWA 2O6KA 3IEXA 2J0VA 2XJ4A 4FHGA 1UCVA 3DHYA 3F7OA 3WWZA 1G18A 3KJFA 4UZSA 2EJTA 4LDAA 3NM5A 5JFTA 4KWHA 2NUPB 5TGTA 2VXOA 3OF3A 1O9BA 5KFFA 3WWDA 4DQKA 3D6VA 1TF5A 1PD0A 2NN3C 4Z49A 1MJHA 2ZWAA 3QY0A 4GR5A 3F3KA 5TMEA 1NQVA 1S8FA 4G5GA 4RX1A 1XGKA 4RKEA 1X3LA 4QSHA 1IAQA 3DTTA 1N0VC 1U3TA 2PVSA 1IEXA 3IHKA 4X7PA 3NAMA 4FFLA 4QU5A 3SX2A 3MC1A 2RH4A 3IV7A 1J8QA 1J2YA 2FGJA 3CQ9A 1YL5A 5GONF 2VIXA 1UDRA 2HTFA 3R6LA 4H59A 2EZTA 2QX9A 1QFXA 3C1YA 4FCCA 1JHAA 1ZITA 3EMKA 3GWGA 3WDKA 4RD1A 4BUGA 1BGXT 5FTMA 1F0NA 3O8QA 4CXMA 1KDVA 1T9ZA 3LVVA 1JG3A 3BGDA 3QXGA 4XTCS 2MOKA 1IZZA 4ZOHC 1JX6A 1SKWA 2O2JA 2M6RA 2X0DA 1H4TA 1P1HA 3K1TA 5BR1A 2CRXA 4LC1A 2A9FA 5EIXA 2DTXA 4R68A 5AW7A 3ZVNA 5FTLA 3G5AA 5EIBC 5CB4A 1Z5OA 2ZT7A 4HPWA 5KL8B 2RGEA 4HQOA 4JK3A 3TZKA 4F4DA 2I9KA 1KEUA 1BCSA 4KXYA 4QECA 3CIOA 4IJMA 1OLSA 4FONA 4ZVSA 2P9EA 3HP7A 1B14A 5F76A 3CWCA 3GAZA 4O2AF 1D4AA 4WESA 3G6YA 1P2TA 3CF4A 2V1XA 3R0IA 4HS9A 4AY4A 2Z4TA 2KIVA 3IB3A 2Q1WA 1PGOA 1V8BA 1HFKA 4XQCA 5A4JA 3FHCB 4D9FA 2WIFA 2Q4OA 4YV7A 1Z75A 3JYHA 2BFDB 4Q01A 1AKMA 4NZYA 2DWPA 9ICTA 3IPXA 3QH4A 1J25A 1XQ1A 2HI0A 2YOGA 1Q0SA 2W2XA 1IK6A 5JJIA 3ZWKA 4B8WA 1XHFA 4MKHA 1GM5A 3ZE7A 5T57A 3V97A 1QRTA 2IVFA 3HNOA 3O93A 7ICGA 1FDRA 4F3KA 1NW9B 4AURA 3DEHA 3COYA 3HKBA 2VJPA 3QUAA 5JNLA 4AKHA 1O54A 4DR3B 2JIDA 2WPDA 1KOGA 2BKUA 1OYWA 1FDWA 4JT2A 1Z5PA 3DO6A 2C8JA 4E51A 1E5VA 3VI3B 3H5NA 2JAQA 2V9ZA 1PR4A 5HILA 16PKA 4KJZA 3K1ZA 3DP9A 4LPSA 1J2EA 3PR2B 2QU8A 3BKXA 2IWHA 1NQAO 3BFXA 4WNAA 5L1IA 1S3IA 5BSEA 4IZHA 3KNZA 1KFKB 4O4LF 1U6JA 4WXYB 4KFTA 2O8CB 1E3SA 2WTNA 4YRAA 4AP5A 1G9XA 1C20A 4IZ6A 2BCUA 4PYNA 3L0YA 1WSBA 5KTKA 2MSCB 3FCSB 3G68A 2FJ0A 1M9NA 3ON5A 1AA9A 1VXRA 1VGQA 1P8JA 2KFNA 1E20A 2IY9A 3G9ZA 5KWVA 2Q6OA 1G8YA 1E1KA 1KSFX 3ABZA 3FCUB 3CNLA 1FJGB 4K6FA 3R5KA 2WU0A 2XMQA 4UMEA 4DDTA 1QTIA 5AESA 2H3IA 4PYMA 1HH4A 3RWBA 1WPQA 1MJGM 2LP4Y 2O1SA 1H42A 1E6EA 3V4OA 3ZKWB 4HDSB 4ZXPA 3CC8A 3EJWA 4YJFB 1H6AA 4INPA 1P1IA 1SIOA 2ATXA 4YCAA 1JQ3A 1VIMA 1KL9A 1J90A 5LB4A 1YSCA 1GSAA 2W6NA 2ZI9A 9ICWA 4L6AA 3WQSB 2DT8A 5LPNA 5AH0A 1KP9A 4M0LA 4PO8A 3T3DA 4YUWA 1V3QE 2HWUA 3B3FA 4S2UA 2VDJA 4Q19A 4FM9A 5H59A 3Q7IA 1E0JA 3U4DA 4AJNA 1RC0A 3PJRA 3EN0A 3GG2A 5LA6F 2ZQ5A 4YMVA 3RYCB 5DRTA 1FLVA 4YO8A 3L4SO 2G1PA 1S8AA 4EVRA 4J75A 4KN8A 4UVEA 3PNBA 3IMEA 1LPOA 1ZR2A 2PUWA 2YNMC 1XZQA 3AVUA 2E18A 2J3DA 3GZFA 1VI5A 1XTIA 4FEAA 3ZXXA 1PVOA 1E2GA 3ZVKA 5M29A 3EUFA 4JUBA 4MFCA 2J7PD 2QRQA 3AMVA 1UEXC 4K5QA 1GG2A 3DWFA 2R8YA 5HFNA 2F76X 1YB1A 4H17A 1USWA 2ZJ0A 2PNFA 4ELVA 2VJ5A 4F3OA 5KYGA 4U00A 1N8KA 2HF8A 3B9JA 3DH0A 4PBRA 2JIBA 4KV9A 3WLSA 1CSEE 4NHEA 4DA7A 1Z5GA 1XAJA 3JZMA 1T29A 2FZGA 4CKYA 3RSFA 1GVNB 2W48A 5LQDA 3Q0IA 1VKHA 3D4IA 2VC2B 3WTBA 4MVJG 3PRKE 3E84A 1TVKA 4EO4A 1GNQA 3NP7A 5J29A 4ZVNA 3PDUA 4QUJA 2WF8A 3MPOA 1A8QA 1S2IA 2J9GA 3MPUA 3RM3A 2IY7A 4GQAA 2QNBA 1CRQA 4YMTA 4RPLA 2N75A 5F9FA 4O3SA 2IHMA 1PJTA 4BMDA 5CVEA 4P2GA 3EZ6A 2Z2YA 2ZRPA 1G0NA 1RLTA 4BYMA 2O1XA 3HO8A 1OWNA 5AW4A 4FQ8A 7ICHA 3QOFA 2PGLA 3GROA 2QG6A 3RSQA 2XQIA 4ER7A 3NRBA 5KEIA 4DDKA 1QX3A 5AHXA 5FPKA 4P98A 4QXOA 2W6OA 3GYGA 5CA1B 2Q0ZX 1S89A 5F35A 3VKUA 3C8MA 2HA2A 2FSIA 4ZI7A 2VDKB 3G5LA 4JI4B 3D8HA 2VKTA 3ESCA 5C8ZA 1LJUA 2HK8A 1H2ZA 2JGIA 4B4VA 2G1JA 4X44A 2BI7A 1KGDA 2RCYA 2B7LA 2C99A 3ZZUA 2C42A 2CVQA 1FYDA 2J09A 2QD3A 3GIDA 3PI6A 1V1MA 2ZDQA 4YFYA 5CLLA 3R0XA 4BU0A 4XM1A 1T8PA 5G5GA 5G0UA 3ITEA 3H0MB 2KE5A 3R20A 3RC2A 2FSPA 3S29A 5J2UB 1X9HA 3H75A 3H84A 3IP4B 1LEHA 3AR3A 1U98A 5AP9A 3MBKA 4CKCA 1NK5A 4O2BA 3HCPA 4DJJA 4ZVVA 3TTSA 4D9MA 5AM2A 1AKQA 3PFFA 5FO0A 3AQ4A 3X1YA 4C3OB 2CFRA 2X23A 3F5SA 5DK4A 1DHTA 1ZCAA 5CB6A 3U4HA 2YFHA 2R6GA 3VPGA 4KIGA 1TYAE 2QUKA 3TQCA 1YZYA 1JFLA 1JHYA 4GWKA 3FAKA 4JVSB 2CXTA 2GWRA 2QRGA 4XWKA 2XYHA 1XN4A 3LRPA 2V59A 4UUBA 1ZXXA 1S8OA 1QQTA 2IZ0A 2KS6A 4M3NA 1E9AA 3ZPXA 4PV7A 4JJZA 3OX3A 1W48A 2MSEB 5T4EA 5FF9A 2ZYVX 2C9DA 3GJ5A 2Y0SF 1XO0A 1GPUA 4C0JA 1HT3A 3C1TA 1LX6A 2QQGA 1CY0A 1VIDA 3GP3A 2GEKA 1T5DX 2FUG6 1U1DA 1ACLA 5D6NA 2AWNA 1CRXA 4KN4A 2JLUA 4JI5B 5HQJA 1LC0A 3EIWA 3IEIA 4B9NA 1U0SY 2AUTA 1G21A 4DA9A 1PS8A 2FWJA 1I0IA 2Q5CA 3IQGX 4QGAA 1HQKA 5B58T 1USUA 1GPKA 1BCRB 1FRQA 3VR4D 2X7XA 2BFPA 1OFTA 1N1GA 3ZDDA 2NUAA 4JI0B 1IQ0A 1KFCB 4AY2A 3U3MA 5C7LO 2BGRA 3HRDD 2H3EA 4BVJA 2CMKA 1GN8A 2J48A 1P4SA 5FP0A 3N70A 4CKBB 1A6SA 1MVLA 4F7DA 3SHWA 4WBSA 3CFYA 3TOXA 4ZEWA 3FPAA 3ZN2A 1Z4QA 2ID4A 3A4MA 4TZTA 4KRYA 1NUSA 1ONNA 4S3MA 2WTUA 4RE6A 4BKRA 4DQVA 3LX5A 3AEKB 2BGNA 4OPMA 1G2IA 3JQPA 2Y9MB 2F44A 5CJJA 2ODQA 1AD2A 4G26A 2J30A 3G9TA 5B66U 1O5OA 2FW7A 2X58A 2VJCA 3TPFA 1I0LA 2O2XA 4F4CA 4NMXB 1W88A 5CK5A 5F51A 4R01A 4ER5A 4OHFA 1VC2A 2IXDA 4DNXA 1H2AS 1Z7EA 2C54A 5DDIP 4LV8B 4DWOA 4IYJA 3QELB 1OXJA 1FYWA 2P9QA 2BTEA 2AC2A 1WXWA 3TBFA 1EFLA 4DUYB 4BE7B 5L1KA 4TMVA 4AP6A 3LS2A 2HVHA 4ZC1A 2IH2A 2YXLA 4UJ5A 1GL3A 3CRW1 1ZN9A 2H85A 2ZSIA 4GOND 2UVPB 4XX0A 3A9RA 4AP9A 1LQTA 2BY4A 4EI8A 1N2BA 3OI7A 1S9FA 4XWAA 4JC4A 1D6MA 4D42A 3OLVA 4AS2A 3EQ7A 4UVGA 4KVZA 1SCKA 2OHVA 2EEPA 3EXHB 5JS1A 1HE8B 2GKSA 3VH3A 5B3JC 5TQ2A 5JU5A 3SDBA 1Y8ZA 3H5LA 1U8YA 3L8DA 1ZQEA 2GYYA 4ZGWA 1MDFA 3CF4G 2I4NA 2V1UA 2Q3EA 3DAOA 4G0PA 5LSAA 4YUVA 3UYKA 2NV2B 1Z5UA 4W8GA 5CNIA 5KDOA 4F5DA 3HXTA 4JJ8A 1VIAA 1KS2A 1V8FA 1UKEA 4YAIA 1W49A 3ALRA 4RVNA 1QQBA 4TQRA 5CITA 1D5CA 3G0IA 3AF6A 1JKIA 3RRNA 2DKNA 3LUGA 5KWSA 3RTCA 1TZCA 3HYNA 4KL8S 2H51A 3PLAE 3LUBA 3OZWA 1EFPB 5CYFA 1DI0A 3T0IA 2QZJA 4BLQA 1BWQA 4X6UA 4HT3B 3AF1A 4L8GA 1BQ3A 1V9SA 4Q1DA 2HA4A 1RZTA 1ZSVA 3MIZA 4XTRA 3DUWA 1WNTA 1CNEA 1UOQA 3AOEA 3DS8A 2A0FA 2JDIA 2QVGA 4UNPA 1J5XA 4Q12A 3H9QA 3ETJA 5AW6A 4XYBA 2HBMA 1O5TA 1YJQA 1GKYA 5J2EA 3INYA 1F0MA 4ZGBA 2QAGA 5GADl 4JP1A 1F1JA 2WKPA 1H2EA 1UBGA 2ACEA 3CLSD 5C4GB 1LZLA 2C4UA 2WP0A 2OFWA 2R8KA 1UP6A 2XF8A 1M66A 4B6EA 1U1FA 2WHXA 3V4ZA 4L57A 3OJCA 4NJOA 1U5BA 4GF5A 1EFCA 5JFGA 1ZOIA 4YPVA 5AW8A 5KFVA 4FGLA 2B8JA 4JUAA 3GLUA 5E7JA 1M1UA 2FF7A 2CJWA 1OIXA 3EIFA 2V6GA 3K20A 3PIIA 3ITKA 4J3NA 4C7JA 5AUOB 2WYHA 3OM0A 3PFHA 2BD0A 1M72A 2PX8A 3N59A 2WUWE 2J5XA 4B7ZA 4IMPA 1I3NA 3E3AA 3KEQA 1MW9X 3PK0A 5EE0A 2DBYA 2AI3A 3LIPA 4N76A 1D2HA 4MINA 2C2YA 3BVPA 2P5YA 3IUYA 1EP2B 1UZLA 1HYEA 2GR9A 3CVYA 4RY0A 4LHSA 4CQMA 2X4IA 3NPAA 1E59A 4M8LA 4X8MA 4XCXA 1C41A 5K8TA 4DOCA 5J0SA 3WBFA 4RA9A 3CRVA 4L74A 4YYEA 1HMYA 2AMLA 5JJLA 3ZGZA 2ZTEA 1QIHA 2H7VA 3GXBA 3DHNA 3TLBA 2WSYB 1Q2UA 5AK3A 2Q9AA 4BNHA 1VBMA 1SQGA 4R0MA 1FRNA 3UJDA 3ORFA 2XMPA 1AN0A 1N8TA 5E0KB 3U3RA 1XD9A 2EQAA 3UK0A 4H7JA 1RP7A 3FB1A 2FXIA 1VPEA 2PLNA 4XAQA 4YUXA 1UODA 4MYUA 1U9IC 2KB0A 1N7HA 4LXTA 2EBUA 1BRTA 1EX9A 3N8IA 2VHTA 3GNQA 4I5GA 2CJXA 2HHSA 1IM5A 2IYUA 3E1KA 3O84A 2AZ4A 2Z1MA 2SHKA 1CIPA 1HA3A 1JLLB 4IZIA 3BXXA 4MV3A 3ER9A 1B2LA 1BAPA 4QHSA 2GTHA 2ZYSA 5ARCA 5A4MS 4H6XA 1SQ5A 3W5BA 5SZKB 4I7EA 4R8UB 4DWVA 3DBVO 4E5PA 4OAPA 1VLJA 2BLLA 1XPUA 3JD1A 1X1BA 2XF2A 4UATA 5HZKA 4BHTA 1BMFA 4BFWA 2EU8A 3BBPA 5AW2A 3H04A 1U3DA 3RIGA 3B6KA 2C7VA 5CM9C 3GLHE 2RAFA 1E9DA 1Z07A 1Z73A 4TUPA 3D7RA 3TKLA 3AVPA 1DAGA 1H6BA 2P0AA 1XSEA 2Q9BA 1E3JA 2Z98A 1KZ6A 1VLHA 4JBLA 3TRHA 3QHQA 1IY8A 2NOAA 2PUBA 3DPSA 2W11A 3ZIUA 1DB3A 4OQYA 4RUAA 1E3MA 1I80A 5FI1B 1I1OA 2P7IA 3RIEA 1JLHA 2OG1A 5H02A 4DIOA 1JN3A 4YLGA 2JJYA 3T7KA 1NBHA 3F8TA 3IG8A 4FNGA 1R16A 3ZZ1A 5DT2A 5KOYA 2Z2JA 3DLIA 2WIDA 2IDJA 5FNVB 2ZZMA 1BXGA 6LDHA 1Y1TA 1CEYA 2PMEA 1KIFA 4RK0A 4X90A 2FUG1 4KMSA 3WNDA 3IHQB 1LBTA 5K8JB 4MRMB 3Q6NA 1BU8A 1IOZA 3QWHA 3UMFA 4EB6A 3AERA 4MWBA 1BN6A 3IBCA 3WICA 3QFRA 4V03A 4D92A 4FN4A 5EUCA 2W8ZA 4NAUA 2IS4A 1C81A 3G82C 1IN7A 2Q7XA 4M0UA 4BVGA 1HK7A 3L4KA 4NYJQ 5E2BA 3SIXA 2XQGA 5B3JA 1G63A 2AN9A 4LJ7A 1CZLA 3GY0A 1K5OA 3PMLA 4J9MA 2IUFA 1TLTA 4ACBA 1R5NA 4FNMA 2CFIA 3Q3IA 4ABYA 1BJKA 2R7MA 3E7FA 3D4LA 1QHFA 2NW6A 3NU1A 4PC3A 2FPIB 1C3EA 3IE0A 1RWKA 2Q4RA 1Q12A 2EGGA 2OZVA 3K70D 1F0KA 1GKLA 3PMNA 3LUFA 5J0QA 1UFOA 2C57A 1QVVA 4MUAA 5C9ZA 2DM6A 4CLRA 1POWA 3WWEA 1QQ6A 2UUPA 1L5KA 3WQBA 4TYPA 4HXYA 2J7PA 1ZIYA 5BSHA 2C2HA 2PKQO 4R40A 2Q6VA 2AX4A 3O90A 3ZE1B 5AKJA 1UJBA 3NFRA 1V45E 2GK7A 3I58A 2DHCA 4WZAA 4TKLA 5FWNA 4RTMA 4UQGA 2Q0XA 4A2CA 3U4CA 3DBOB 3ND6A 1X2BA 3LYHA 4R9NA 4JQYA 5BPHA 2DQZA 3QFTA 3T7RA 4BEVA 2W37A 1FO4A 3LRXA 3PGXA 2YZMA 4Y2QA 5IBCA 2AUNA 1FPMA 3CUWA 5GPBA 1UR5A 4C2AA 3ISJA 3HY3A 2NZVG 3DBLA 1KMNA 2Y4NA 2PBLA 4UAZA 2JCGA 3TACB 3OZFA 3IURA 1NNLA 4PY2A 5A7GA 2GPTA 3FLEA 3E22A 3J81A 2B99A 1MC8A 4EY6A 1YZGA 3ICVA 3SEQA 1BXRB 1P7VA 3EOZA 1ZUNA 3ZW7A 1TK0A 3ZE9A 4CCHA 1E3DA 5G1PA 3NGDA 3MCAA 3LVWA 3TLGB 4DOMA 1A4IA 4GI1A 4P8RA 2I6QA 4ZVKA 2LCIA 4RKRA 1PWZA 4W82A 8ICYA 4K8OA 2BR3A 1QTQA 4RELA 5SYNA 3WMRA 4YYZA 1Q3UA 1BD4A 4F6CA 3G2LA 4PAQA 2PSFA 3QVGA 3WDMA 1JDZA 1NMQA 1FTYA 1NZPA 2WJZB 1KMIY 1SC4A 5AK4A 3CXRA 3CLKA 3A6PC 3G2MA 2CV2A 4BDSA 3HJHA 1RKQA 5AK6A 5F3DA 3TO5A 2YB4A 4QQFA 4HEA6 1CVRA 3ZJYA 7ICLA 1M8FA 2NXEA 4LWZA 3ASYA 8ICNA 1ZN2A 4KNVA 4RVHA 4XJVA 1J8MF 3OZAA 1UJ2A 3MDCA 4UUMA 1J2MA 4RS3A 5DLYA 2ZBUA 2CFSA 4HQRA 2K4PA 3HBJA 1U1EA 1KQGA 4L8FA 3BTUA 3B48A 2JI4A 3Q6MA 3EK2A 4R8LA 5DTJA 1PGNA 5D3KA 1HETA 4X61A 1Q5PA 5K5EA 4N0MA 1GFZA 2X1MA 2D5IA 3WKDA 4G8JA 4UXHA 4GZ5A 1AV6A 4HDMB 1E61A 4LCEA 1CNFA 1Y6ZA 1ULAA 2D1FA 1U9IA 2QZ4A 3DVAA 1XLTA 4A23A 1E6KA 3RRYA 4PLYA 4RTRA 3D2QA 2HCBA 2A92A 4RPYA 3K5HA 1ZZGA 2BW0A 3MVEA 3VR5A 3QVVA 1UBEA 1Y3HA 3L02A 3UPDA 5CLHA 3MT7A 2V97A 1P74A 3UJ7A 5KFOA 3I62A 1DAKA 4GMKA 4HSGA 4NC9A 4REQB 7ICIA 3VAZA 3S40A 1TM1E 1WLYA 2Y0PA 3IR7A 2DUWA 5IUJC 2VTKA 3G2JA 3N2KB 4HLQB 1TZ2A 5JCXA 4RSRA 8ADHA 1XXHE 3QVXA 4CODB 1NYRA 3ETDA 5ITWA 2C4TA 1U2PA 1XP8A 2G9UA 4YP1A 1ZQYA 4MTCA 5KNDA 3KOXA 1BSVA 8AT1A 4HH4A 1V8ZA 5KC9A 1IUKA 4H0CA 4J7CA 4MV1A 1FB5A 2VSQA 4JBYA 3L1UA 2J5RA 1O94C 4KMRA 5FD8A 4D96A 2B6NA 4J1QA 4JL6A 6Q21A 1TW2A 2O7VA 3U3XA 1U7HA 2QVLA 1EA7A 4FDLA 4DLYA 5DLEA 5B12A 2PRZA 3HSSA 1F4LA 1YE3A 4JJFA 5EHZA 1G8JA 1SWWA 4MYRA 4TWJA 3V4VB 3T3OA 1TEXA 4MUKA 5KMGA 3OMWA 1V26A 4FEYA 4UKDA 3MGHA 4EGFA 2D2IA 1RMYA 4R2JA 4YRRA 1QHEA 4YDHB 3M9LA 2H7XA 4M0MA 1JIUA 1FMCA 4NBKA 4JYBA 1U7UA 3QEAZ 1VM6A 1N5IA 4UPDA 1I8TA 3QG5A 4EG3A 3DE0X 1SBYA 3NGMA 5KZMB 4N7JA 2QMHA 4DQ0A 2QBYB 1XZBA 1CUDA 1DC3A 5HBGA 4KPGA 4I1RA 5H82A 5C53B 3I01A 3RI3A 3GUHA 2NTEA 1KFJB 1RWBA 1GO3F 3PPWA 5KTYA 3DDNA 1QPGA 3PT5A 3QBEA 1FIQA 1A1VA 5L4SA 5B7PA 4KDEA 4S2EA 1NXXA 4M6WA 2W2VA 1QCDA 4IFEA 3AF2A 3KHTA 4P2BA 2Q62A 3BE6A 4OLAA 4L50A 1E7WA 5LQAA 2C5EA 2VQ3A 2HU7A 1T1IA 1NJ5A 2BCEA 3EGEA 4J0JA 2VUUA 1VDZA 1KU6A 2FZVA 3NT5A 4S35A 4CJXA 5FTNA 2O4UX 1CK4A 3OETA 5CDGA 4K28A 3F4LA 5F1YA 5GZ6A 1YB5A 4EZ9A 5T3YA 2LZ0A 3LKZA 1MIHA 4KYTA 4MPTA 1SUWA 2GRJA 3THYA 5K6AC 2LBPA 3CX8A 3ZJVA 2G1KA 1UJ4A 3W9SA 1PDWA 2X4GA 4ALJA 2FWMX 1MABB 2GPNA 3PPXA 5HKBA 4OAQA 2YFYA 1JJFA 4LQLA 3VGJA 3H18A 3GJTA 3L1VA 2UV8A 2GF9A 1ECFA 4GP7A 3IP3A 1CF2O 1JFFA 3Q3CA 5DRYA 1XL0A 4PX2A 4WI1A 2V9CA 5TEVA 1WD5A 4P7KA 5AQ1A 3NEJA 1MQ2A 1KVRA 5M04A 1XA0A 3NC4A 5GJVC 3TM4A 4XLZA 2FNAA 3MWDB 3LRTA 2C3OA 4LXXA 4Q66C 4ZT3A 5IABA 4NCKA 4YREA 4K9NA 4CIWA 3RV4A 3L93A 4G4IA 1BXKA 4OTZA 2Q0QA 1M7GA 3I5AA 4PLGA 3PT9A 3LHDA 4G84A 5A5DA 3V6MA 2UU9B 1XHEA 3CR3C 2QTLA 1XMQB 1KZYC 1WTCA 5I9MA 4M1YA 4I3GA 5FUWA 1U6IA 1RPAA 4S1TA 2WUDA 4GXQA 5C51B 2OZPA 3JAKA 4TUSA 3GRZA 4M1WA 1PLKA 3COPA 1CUIA 3SFTA 3IUNA 4YAWA 5F7JA 1Y7HA 1XZLA 1T2VA 4MWTA 4DG9A 4LG1A 4MFAA 3E9RA 4D26A 2C2RA 5DHQA 3CBQA 4EUHA 1JL3A 1F9AA 2ZIWA 1LY1A 5FUQA 1EESA 2OAP1 2LYHA 3TLXA 4YXWA 3ADDA 1O77A 5DHTA 4H3KB 3DFIA 3VR6D 3VKGA 4RT3A 2H92A 1L6RA 2DEUA 8ICPA 4F1WA 1XO1A 2BI4A 3ER6A 3VMMA 2GN9A 2XMDA 1KLNA 2D54A 2YVQA 2IWRA 5CMLA 2PUGA 2JIQA 3B60A 2H07A 1VSBA 1T8RA 4AF6A 3RVMA 4R2XA 3RAEC 5FFFA 3GRUA 5YASA 2X76A 2R8BA 4PSKA 3BRCA 1FVXA 3PTAA 1G4UR 4B6QA 4G5RA 2DHQA 4ER6A 1FS5A 3PW5A 5IVDA 5AJWA 2YHAA 4Z6CA 1U7PA 5KG5A 4UTXA 3U3OA 3EVFA 2JCYA 3MZ0A 1DCMA 3EUEA 4GS5A 3R5TA 3JSAA 1QQ5A 4TTIA 4URUR 5IPFA 1ZLXA 1NXOA 1XFDA 4R2MA 2XCRB 3SX0A 5JSYA 4Z6FA 3D6NB 3ZWOA 1I2DA 1VSQA 1XXLA 3OCWA 5EJGA 3MT0A 2C7OA 5SV2A 1FX0A 2BEKA 2PFKA 4OYYA 4GSLA 2AJQA 3R7AA 2HDHA 3ABSB 5CA0F 4ZOBA 4TSFA 3SN6A 4A26A 1NKCA 3RJKA 4UOEA 1YBFA 4OCZA 5AI4A 4HEA1 1XMIA 2DBQA 3RK4A 3FMOB 5TY0A 4AG5A 4KXVA 1ZQOA 3BWDD 2FLKA 3I72A 1C2TA 2O54A 3OQPA 4JVNA 2W2KB 2HH9A 4YIHA 1NLFA 2QB5A 5EZ6B 4HAYA 2ZQZA 4FZ5A 5JZSA 1NXPA 1ZQ9A 1FFSA 2IHNA 1AY0A 4QUDA 5DISB 3TZQA 1TQ6A 2V0GA 2CVFA 1NF2A 3LYSA 1U2DA 3DXYA 4CLXA 3N6XA 4MP6A 4RD6A 4PTLA 1Z2CA 3KVYA 3RUDA 2OZLB 3BMCA 3TRKA 1B7GO 1ZHFA 3FFWA 3AJ8A 2EANA 4X97A 1ISMA 1UDWA 4RAQA 2PK3A 4H4CA 2ONKA 2C97A 2KOBA 1AM4D 4TWRA 1HXHA 1V48A 2HBKA 1RI4A 5B7NA 4LXUA 1P33A 3A1NA 3QF4B 4JGBA 2G0AA 4E0DA 1W59A 4LZOA 3KETA 4E14A 1C1XB 4R05A 3LSTA 2EQ5A 4C6TA 3RKUA 2QA5A 1FMLA 3HDTA 2H4FA 1HGXA 3SAGA 2W2MA 4YR9A 1APBA 3UUEA 2PGJA 4LMPA 4YQZA 3IHWA 4S0XA 1EWKA 1Y4SA 3BDVA 3EZYA 2VAXA 4IVNA 3KWFA 4KQ1A 4RXUA 2WV7A 2ZWPA 3CX3A 4CI0B 1WMAA 4ZVUA 3THXA 1RAHA 2ZYDA 5J2HA 1SXJE 1X7WB 4HVLA 4OJMX 4FNOA 1CYEA 2VYVD 2SKCA 5C31A 2ZAMA 1OLOA 4WA8A 2EX4A 2A1UA 3AI2A 4DY6A 5FOQA 1BOOA 1JJIA 4FLEA 3VDQA 3OZVA 1EEHA 4A1OA 4RJTA 3C16C 1FYFA 4JOSA 2QTMA 3GEDA 1QUFA 4C4PA 1AGYA 4D0NA 4LHVA 1SVNA 3OZSA 1A9OA 1QKIA 1NPTO 4OATA 4PANA 2CLLB 3GJZA 1T10A 1M8JA 3PPYA 1RJEA 1IJFA 2V9PA 1QMGA 1SBHA 5JMTA 1P73A 5EE3A 5F5XA 1O95C 2OD7A 4HUTA 3W1WA 2O8EA 4MUBA 1BVUA 2GN2A 4Y0AA 1ZGAA 5GM1A 1YULA 4LOLA 3H5IA 1JAYA 4FWIB 2GT1A 3PC3A 5G4LA 2ID7A 3PW7A 5D7BA 1Y7IA 2J67A 4EHKA 3H4TA 1GRNA 1LX7A 3WY9A 2EBFX 2GXUA 1E5TA 1GQQA 3G49A 3P71T 4ZODA 3GJSA 2C22A 1XN1A 3WP0A 2BFBA 4XRRA 4MVWA 1IN8A 1ZYUA 3G1UA 3JPPA 1RIFA 1G5HA 2RGNC 5EJIA 2W7PA 2WWTA 4FC7A 4EABA 4YPOA 4MI6A 5KFEA 3I5XA 4KHZA 4NJEB 4EI9A 2EAUA 1OPRA 1EUCB 4YQEA 5E9AA 1ZFNA 1NJSA 3G7UA 4UVHA 1G20B 4EGAA 4D57A 1U7WA 2J3HA 2HD4A 2HUPA 2YW9A 1RZRD 1MHTA 1JEYB 3DD1A 3QLTA 1B93A 1ORTA 1AZWA 1R0YA 4PSCA 2GO7A 3W7VA 2QARB 1YRQA 4CDRA 3ZLJA 3BMOA 3BDPA 4WOBA 4Z9BA 2JGRA 2Y0EA 1PGJA 1SUBA 1H8EA 3PUZA 1QHNA 1EUDA 1CX9B 3I1FA 5IC4A 5JNVA 1VB3A 3UUWA 2QRVA 2FPXA 2QRKA 1FBTA 3FYHA 1C7JA 2UUCB 4S1NA 3UPTA 1SHZA 3DEFA 4MVJI 5DBCA 2BGGA 2RBKA 5EP4A 3TW8B 1JJVA 1LRLA 1ZM2A 4WZBB 5I7OA 1PF7E 4RTJA 3GLGB 3DZFA 2YWJA 3L79A 1YIOA 1NT2A 4Q82A 3O3CA 2DKXA 1UBRS 1NBWB 4WXRA 5J0UA 1ZGBA 3WNBA 2CUNA 3HJRA 2YY6A 5DB7A 4GLBA 3RC8A 2VQSA 4BQSA 4F85A 4B71A 1G8HA 3FETA 3SQIA 1P45A 5CTJA 3I9V6 1I6WA 1P4HA 3NYIA 2NYUA 2JJ2D 2WTAA 3HS3A 4C9BA 2R8PA 4CTOA 1H05A 3SENA 4XGKA 3WBJA 1UFVA 3JU3A 1XMXA 3TQQA 1NUQA 4M8NE 3WOHA 3FCYA 1MF7A 3E48A 3OE7A 3W5AA 4LVOA 5AW9A 2XCIA 3KHHA 3AEUA 4Y2XA 4HVCA 4XQGA 1Z00A 2X3YA 2A35A 4PYOA 5LDDC 2YS7A 4JITA 3ZCVA 5DV9A 5B7GA 2VHQA 2XXAB 1RYBA 4I2DA 1GTG1 4R1OA 5ICCA 2XY6A 1MU0A 3MR3A 3OWHA 4ZOEA 2FFQA 4M9UA 3ZX4A 2D1TA 4NU5A 3V46A 3O38A 4F4UA 1IJKA 1N6HA 4TYQA 3RQSA 2QUZA 2JLZA 2AFRA 4B76A 5KT7A 1CZOA 3NHBA 1SGWA 2FXVA 3QPCA 2CL7X 2ZBRA 3AR9A 2O1EA 4P7FA 1DZ3A 1OLUB 1U2QA 3TTVA 1VKOA 1Q3KA 4PTZA 4QGGA 1BW9A 3NTVA 4YRBA 2GEFA 4M9JA 1KK0A 1PSDA 2GZRA 3LY7A 2BEVB 2QI9F 2W83A 1R4AA 3FWZA 3U44A 1JFRA 2OQ2A 2YS6A 3PX7A 2I3BA 4O02B 3KS9A 4FW9A 3BFVA 2D2XA 1L7XA 3CIFA 2P6OA 1NI4A 4RHFA 4R41A 1O9HA 3WLQA 1L7AA 3TFWA 1H66A 1N2CA 1NZJA 3IQIX 4J0EA 4H7PA 1PVVA 3PC8C 2H5LA 4HDNB 4OXNA 1SUSA 4NY8A 3BJYA 1IC6A 1PFQA 1ZMOA 3KTAA 4FXPA 1OTHA 2DBRA 3L1HA 5JV5A 3O9VA 2AZXA 5D1HA 5HZHA 4EA6A 3GUCA 2UZIR 2G5CA 2WU1A 4M53A 4W6ZA 1DJQA 4FUQA 4WBNB 3TOVA 4J16A 4E32A 3OIYA 2DHRA 2ZSKA 3ENKA 3KD2A 4NAHA 3W7BA 1ZONA 2CLHB 2QRPA 3S2UA 1VLQA 3L8FA 2ARKA 3K0SA 4EQ6B 3LA8A 1SU4A 4PW0A 4B31A 4D99A 2GZ3A 4Z3DA 1THTA 3LKDA 3SK0A 3G02A 4RMIA 3LI2A 4EH1A 4JI2B 2HDNB 2Z5VA 5CUQA 4B79A 5A6SA 2R1TB 3VHXA 3GQBA 3C2KA 2J46A 1SRQA 1U3CA 1Q21A 3NTUA 2IDZA 2A7XA 2HYIC 2AFVA 4NR0A 3L41A 4FZ3A 3WRXA 1XD2A 3WYBA 1WBDA 2WB2A 4FB4A 5CLJA 4KKXB 3B6IA 1ECPA 3UT6A 3IJ5A 2IVZA 1NIJA 1IMOA 4WLOA 2ZUTA 4HYQA 4IEEA 4QFCA 3E2IA 1DO0A 1O95A 3KKAC 1QU3A 1M8PA 1OXTA 5TE9A 2P9BA 4I9NA 3BC1A 1RYHA 3FZEA 3R74A 2NVOA 3PX0A 3ICQB 3KALA 2VN8A 3KKNA 3GEHA 3I4FA 3WWOA 1PE0A 1TQHA 4HYEA 2QMUA 4KWTA 1JH9A 4RF4A 3WK9A 3G5TA 5B30A 2JEGA 2JGMA 2G9QA 4BO3A 4U8GA 2W9AA 4RZQA 1MHPA 4RQ7A 2QW0X 1PK1B 3OPVA 5E6SA 2KSOB 4NECA 2RGNA 3HHEA 3AR6A 4Z8YA 1NK0A 4CM9D 1QPBA 3W2FA 2XUGA 2ZWOA 3HU3A 1XOIA 3BDAA 4XCVA 3O1LA 2P1RA 4OREX 3GRVA 2AYYA 5CA1F 4RMJA 3SI8A 2VJKA 5T6MA 2BZGA 3AOEC 2ZIGA 4KTVE 3NMUF 1JA0A 1BVSA 4RZIA 1DJNA 2X2FA 4ZDJA