3QU5A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp11asn mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
221
structure length
221
Chain Sequence
b'KLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 82
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu5A01
2YMMA 1L7PA 3F9RA 5AI0A 1RQLA 3L8FA 1RMTA 1ZJJA 2EARA 1CQZA 1N9KA 5AKJA 5AM2A 2FPUA 2DQSA 4HGNA 1F5SA 5AM3A 5A3RA 4NWIA 4Y2RA 3I6BA 3L0YA 5AW6A 5AVUA 4B6JA 4UMEA 1RKUA 3BWVA 2G06A 1RMQA 2CFRA 4YGYA 4UARA 3QNMA 1CR6A 3E81A 5AI6A 5ALIA 3KBBA 3VAYA 3ESRA 1Z4PX 3NRJA 3E8MA 2EAUA 1EK1A 1JUDA 2BDEA 5FP0A 3QGMA 4EX7A 4NAVA 4KX5A 3K1ZA 3RF6A 4YIHA 4Y2TA 3AR4A 2P11A 4OD0A 2ZG6A 2G07A 3WKEA 4DW8A 1RPZA 5ALDA 4ZEXA 3QX7A 3AR3A 4I9FA 3ZVMA 5ALJA 5ALPA 5ALOA 2I55A 3B9RA 2IA5A 3UM9A 4NABA 2AMYA 3M9LA 3WKCA 5AVXA 4UMDA 2R8EA 2NO4A 4BYGA 3R09A 4QJBA 5ALUA 2GFHA 3FPBA 2HSZA 3A1CA 4KNWA 1Z4LA 3AR7A 5AKXA 5ALLA 1Z88A 4MWOA 1TE2A 3WK6A 2YY6A 4YIKA 5AM4A 2ZOSA 4ZEVA 2G0AA 1ZRMA 2QLTA 1Q92A 4UU1A 4PNHA 3N5KA 3ESQA 5AI4A 4C4RA 2FI1A 1XVIA 3EPRA 2RBKA 5AKEA 1IWOA 3N1UA 3ZX4A 1Z4QA 2HI0A 2Q4RA 1RDFA 1NRWA 5ALRA 3A1DA 4HGQA 5ALFA 2YMLA 4QQFA 2B0CA 3I28A 4C4TA 1K1EA 3IJ5A 4Y2PA 4KX3A 2FUEA 1L7MA 4Y2JA 3OCZA 5AW3A 3L1UA 3ZU6A 1YMQA 1ZD2P 3QXGA 2ZXEA 3W5DA 1VJ5A 3DNPA 3NALA 3PDWA 3U7GA 2IOFA 1U02A 3ZX5A 1Z4NA 5AW1A 4OCZA 1VFPA 5AIBA 1QQ5A 2OA0A 5ALHA 2R8YA 4CE6A 2GO7A 3FZQA 3GYGA 5AM1A 1U2TA 3NUQA 2YN4A 5AKHA 5AK3A 1NNLA 1L7NA 2HEGA 5AW9A 3HLTA 3ONNA 3WGUA 3QUBA 4FYPA 3L1VA 3OTQA 5AKYA 3W5AA 2NO5A 1ZD5A 4UASA 3KD3A 5ALMA 5AK5A 1Z4OA 4L6AA 3ED5A 3OPXA 3EF1A 2I33A 2YMQA 3KC2A 2JGAA 4HYTA 3WGVA 5AK6A 4DFDA 1RKQA 3L8EA 3QUCA 4IG4A 4JDPA 4KN8A 1ZRNA 4DWOA 4UM5A 4J2TA 2OYCA 1RLOA 3MC1A 4Y3UA 3EF0A 2B8EA 3ZW7A 4J03A 2HF7A 1QQ7A 4XPZA 5ALZA 4XE5A 2I7DA 5AICA 3ZWKA 2WF8A 4UMVA 3MPOA 4NV0A 1Z5UA 3WK7A 2PR7A 5AESA 1FEZA 1YDFA 1Q91A 4XOUA 3U7HB 5IT4A 1RKVA 3A1EA 2AH5A 3SHQA 4I9GA 4CNQA 2W43A 3QYPA 5AVQA 4KYTA 2EATA 3BA6A 2W4MA 3DDHA 4Y2UA 4MUMA 2RARA 5ALYA 4F71A 1L6RA 2JAWA 5IS2A 2WFAA 3L8HA 3N8GA 2ZBEA 2HF2A 2P69A 3DAOA 3QU7A 4UU0A 4FFDA 3ZVLA 5AW8A 4Y2XA 2YJ3A 1KYTA 1TJ3A 3WK4A 2ODAA 5AI8A 3U19A 3NANA 1X42A 2C8KA 5AW5A 2IOHA 3ET4A 3W5BA 1T5TA 5AK4A 3FVVA 2AGVA 3KOOA 3ZI4A 1MH9A 3SLRA 1LVHA 3FM9A 5AVTA 2MU2A 4RESA 5AKIA 4RETA 4YCMA 1Z4KA 1U2SA 5AM5A 4Y2YA 5AW0A 4HGOA 4Y2QA 3R9KA 3WKDA 4AS3A 1AQ6A 4BBJA 3ET5A 2R8ZA 2WM8A 3AR5A 2FUCA 1L8LA 4L57A 2NYVA 3W5CA 1RRCA 5AI5A 2WF7A 5AKLA 4BX2A 3U7EB 2IOFK 1QH9A 5ALNA 5ALWA 1Z4JA 2B8JA 3QU5A 4EZEA 2P27A 2YBDA 1WPGA 3PGVA 1QQ6A 2R8XA 2BY4A 4BNDA 1YS9A 1TJ4A 1RMYA 3OCWA 4G9BA 3OCUA 2O2XA 5AIAA 1XP5A 2RB5A 3UMGA 1T5SA 2OBBA 2ZBFA 4UAUA 3WK5A 3QU4A 1VJRA 1Z4IA 3L0BA 3AR2A 2GMWA 4G63A 2WF5A 4BEVA 3FPSA 1WVIA 1RQNA 4BX0A 5AW2A 3L8GA 3SF0A 3N07A 3L0CA 3I76A 5AVSA 2HO4A 1ZOLA 2HX1A 3U26A 2ZBGA 1QYIA 3B9BA 2MSNA 2B1RA 2BDUA 1YNSA 3IRUA 4UM7A 3WK8A 3NIWA 5AVWA 1RC8A 2PQ0A 4HAIA 2YMPA 4FE3A 1S8OA 3QUTA 2O9JA 5AI9A 3J7TA 1SWWA 4KNVA 1ZS9A 5AW4A 1Y8AA 4Y2SA 3SKYA 4HGPA 4AS2A 4EX6A 1Z4MA 5AVYA 2FDRA 3AR9A 2FPWA 5AVZA 2WHEA 1PW5A 3N28A 5AKKA 4EEKA 5ALVA 2CFTA 1ZD4A 4YCLA 4XQ0A 2ZBDA 2JAOA 3UMCA 3OCXA 4GXTA 2B82A 2HCFA 2FEAA 3A3YA 3TLMA 2FPRA 1TJ5A 2JARA 2PKEA 4YCNA 5AM0A 1U7PA 2QYHA 2RAVA 2YJ4A 3M1YA 3UMBA 2FPSA 5AVRA 2CN1A 5ALGA 3PCTA 2JAUA 3R4CA 4UATA 4C4SA 3QUQA 4ZEWA 1L7OA 3MN1A 2CFSA 3SKXA 3MMZA 2X4DA 5ALEA 3WKBA 3L5KA 2W11A 1N8NA 1T9ZA 1Z5GA 2Q5EA 3U7FB 3EWIA 3I1YA 2I34A 2HDOA 3AR8A 5E0OA 1S2OA 5AW7A 4OHFA 4YH1A 4BNDB 1O08A 3QU9A 3ZVNA 2YFYA 3AR6A 3NASA 2C9MA 3IB6A 4JB3A 4CF5A 2GHTA 4AP9A 1SU4A 4BKMA 2B30A 2IYEA 3CNHA 4CF4A 1EK2A 3S6JA 3L7YA 3E58A 3WK9A 1U7OA 5AHXA 5ALKA 3B8EA 5AKGA 4UAVA 1ZD3A 2GHQA 3ZWDA 5JJBA 4HGRA 4O8CA 3KZXA 5ALQA 3WKAA 3RFUA 4OFZA 1RLMA 2WF9A 1LTQA 3P96A 1YV9A 5ALXA 5AKZA 1O03A 1J97A 2D2VA 4Y2VA 1L8OA 2YJ6A 2G08A 1XPJA 2C4NA 3HYCA 4UMFA 4L6CA 1TA0A 2FPXA 2Q4TA 3OCVA 4DCCA 4F72A 3QLEA 4BEWA 3SMVA 1RLTA 3NAMA 2I54A 5ALSA 5A3QA 3QU2A 3ZUPA 1J8DA 2VKQA 1SWVA 2G1AA 3DV9A 2C88A 4GIBA 3ZTYA 3FGOA 5A3SA 1WR8A 1WZCA 4EENA 5ALTA 4H1WA 2C8LA 4E88A 4NFLA 3CZ4A 4BX3A 4IFTA 3E84A 2HOQA 2YJ5A 2OM6A 3KDPA 3PGLA 2G80A 5T41A 2HHLA 3SD7A 2AUTA 3D6JA 3OCYA 4CF3A 2WF6A 4UW9A 1YJ5A 2MU1A 3U13A 2B1QA 4EELA 2I6XA 1NF2A 2G09A 5AVVA 3ZTWA 5IT0A 2P9JA
chains in the Genus database with same CATH superfamily
4AYXA 4J91A 4E2ZA 3IXMA 1BPEA 1XKQA 2QRGA 1PEKE 2EARA 2W8BA 3Q0IA 2EKZA 5JSUA 1TCAA 4O3OA 2CFRA 3OJXA 4HOYA 4R1OA 4K03A 1ML4A 1JSLA 3OQPA 4CG2A 1FTQA 3K0HA 1IAQA 2X5XA 4UUMA 1TGYA 5HKLA 2FCRA 1EJ2A 1UHUA 5ALOA 1ZQWA 2IA5A 4BZQA 1NOMA 3Q1KA 1MJ5A 3SXPA 2HRQA 4CEHA 3HB1A 4XLTA 4KQHA 2G88A 3DUFB 1KU0A 2FDXA 1VBKA 1E5TA 5F2EA 2P9TA 3PDHA 1YFKA 2HU5A 1PK1A 1QNLA 2RBKA 3ZJYA 1G42A 1RRVA 2XYVA 5AUNB 1A77A 3QOWA 1QIKA 3SZGA 4EIWA 3K53A 1SEVA 1EK5A 1JEAA 1IEXA 2P67A 4MKXA 2XCPA 2FVXA 1L7MA 4UU8A 5KJCA 4IAOA 2GUGA 4DO9A 5COQA 2OXCA 3HADA 3PC3A 2CZCA 2OFWA 5DTJA 5K1ZA 3VZCA 3UC5A 5AK3A 2GZMA 4YXWA 1ZQEA 1JQ3A 3HI6A 4N0PA 1FMJA 4EJSB 3F90A 4JEHA 4G36A 3V2GA 3ED5A 3OFND 3BTVA 2QTVA 5JAIA 4PHGA 1ZN8A 2QROA 4GMDA 4J0DA 2H4FA 4WKOA 3UJDA 2JFBA 1GPKA 3MJ4A 5F4ZA 1SRRA 1M2KA 3JASA 1D8TA 3ZQ4A 1BS9A 2HIMA 3HU2A 1VCMA 2JI8A 4I2DA 4IIGA 1UJ5A 1MBZA 2WHYA 5F35A 3QYPA 1CVLA 4NEQA 1QRSA 2W54A 5EXXA 3MBKA 1KY3A 1XSLA 3JS5A 1KMNA 2ZYGA 5JUMA 1DBIA 4Q19A 3M83A 4PM4A 2X8JA 1QGOA 3A9VA 2GEBA 5L3VA 2IOHA 3PUKA 4J0KA 4TL6A 4X95A 5ADHA 5JVDB 2A0YA 1D03A 1VE5A 4NMHA 1ZWKA 4P80A 1QRDA 1YFZA 1RI2A 1NQOA 3F4KA 1NJZA 1M7BA 3SEAA 4W5QA 1ZQVA 2QMYA 4L5BA 3QEAZ 3OICA 1SKUA 4CCWA 2OBLA 1XU4A 3MF4A 4P08A 4GP9A 1L5QA 2W2LA 4MKIA 1YS9A 2X0EA 3QKSA 3MBYA 1O9HA 1ZGJA 4G63A 3IH5A 3DD1A 3EZ6A 1ECCA 3CUVA 2FMHA 1C0IA 9ABPA 3FIJA 5TLSA 5CB6A 2HAEA 3I4CA 1KL9A 4B7XA 4GG1A 4DMMA 1JHMA 4PC7A 1BX1A 1R6UA 4AP5A 4IXDA 5EHIA 2W8ZA 3FCOA 3BDVA 3R0IA 1X80B 5IC4A 1GYRA 1ZK0A 2J7PD 4OBXA 1NOJA 3GFFA 2H85A 4RD3A 2QA5A 1KKXA 1CI4A 3ENWA 1FXSA 2B3DA 5CLJA 3CZRA 2QM0A 1K8XB 1KZ1A 4OQFA 3DEYX 4CEIA 4OYHA 9MHTA 1NKBA 2O3JA 4IV0A 4GRIA 1I5OA 1ODJA 1C8BA 5K7SA 1WHTB 1BXKA 5JC1A 1U48A 2WIJA 3LPAA 4YD2A 2WU8A 4KAJA 4ECTA 4PQGA 1JE1A 3KUCA 3NP9A 4JV5B 3DO6A 2RJOA 1UQVA 4HBZA 4YMOA 2REBA 3ZBQA 3WBKA 3MS2A 2ZB8A 1JX4A 5KSZA 2KLHA 2PO5A 3E84A 2NO7A 5KG0A 1EWRA 4AF6A 1JAZA 4FW8A 1F0MA 1JVNA 1MXHA 2BHLA 4HAUA 4QFMA 1AXRA 1YZ7A 3CY6A 4G8DA 4R9UC 4Y9RA 5K4GA 1ZC4A 3HVHA 4XYBA 4L76A 4JR1A 1NVUQ 1Z37A 1FSSA 1CEEA 3BXPA 1ZX1A 2G25A 1Y1QA 2C9BA 5YASA 2FW0A 3PHBE 2FOLA 1Z7WA 4NAVA 3UXNA 2IP2A 1X7XB 3VR3A 4RAOA 4N7RA 2IH5A 1I1OA 1KOJA 1NVMB 1ORRA 3IELA 4L7QA 2C2YA 3JARA 4P4TA 1BJRE 1FFHA 2AQHA 1SZDA 2V9WA 4DLUA 3C3CA 4BB6A 4LYDA 5B7NA 4CKEB 3H4MA 3F97A 4G1FA 4ZZIA 2H17A 5J8YC 3OQIA 3OLVA 2KNJA 1O5IA 3D1JA 3CE9A 5IJ9B 1W52X 1H9BA 1NUQA 1QAOA 4HN4B 4QO8A 1VJ1A 3HHEA 1H1LB 1CQPA 4I28A 3A70A 3ZDRA 2O57A 1RYSA 1VE3A 4S1PA 4X9XA 1L7NA 3EIFA 3E18A 4Y0VA 3KRTA 3B8HA 4YRFA 2FY8A 1XRRA 3UA4A 3UAYA 4MUEA 1RI4A 2O0JA 5MN4A 4MGKR 4RZIA 4FHEA 2WE8A 2KIWA 3KIPA 4WZBE 3DM9B 4FOOA 2PFKA 3FR7A 2MUTA 4H4CA 4CDGA 2WJHA 3EWNA 4YCDA 5E6RA 5JH7A 3OJFA 4H77A 4ENSA 1TYEB 2NSHA 4JNCA 4GAEA 2GGSA 1U8YA 3KOYA 1TYCA 3ER6A 1J21A 1TM7E 2ECQA 2IVZA 5DTEA 1U98A 3M3HA 4KE6A 4OJNA 5IYZB 4AZ3A 2VJQA 1U1CA 4ZN6A 3SQNA 4C7KA 2JJYA 2WINI 1ZVQA 2NUBA 3G5TA 4AMBA 4M1EA 2YXPX 3SX4A 2OCLA 5CBPA 2W6PA 2AGVA 2AFHA 2ST1A 2YS6A 3NTLA 4BEJA 3K75D 4U2DA 1U2SA 1SBNE 3I3OA 4DQIA 3K1RB 4G37A 4D5EA 3RV4A 3HXLA 1QIIA 2C57A 1X3LA 1SCBA 4WJKB 1EU1A 3P9RA 4CN9A 4BB0A 4RK5A 4Y7CA 3L05A 4A2QA 1EAMA 3WNZA 4DRYA 2YVLA 2NZ2A 2OO5C 3ZKWA 1IPFA 1WUTA 3WYCA 4K6GA 3BCHA 1AF4A 3C45A 1NUAA 5JT1A 3DBVO 2HPAA 2TECE 3ELWA 1QHSA 4A0QA 4K40A 5KVVA 1KDVA 3GGGA 3O2JA 2Y66A 4QOGA 2GWSA 3LV8A 2IEBA 5AKKA 5A03A 2ZBDA 4IY1A 1GZVA 2C1ZA 4C0JA 2Q3LA 3HKZF 2HADA 4YJFB 3KK0A 2VJCA 3ZN2A 3QUQA 1DWUA 4ITRC 3NV9A 4X24A 2Y8EA 3RH5A 1PQWA 3W6ZA 3BC1A 2Y2VA 1O6ZA 2I9PA 1XVTA 5IC6A 3L6RA 3M6VA 3ZVNA 2WI8A 3V42A 1XD8A 4NPAA 5T67A 1EFPA 1M72A 1IHUA 2NADA 3ZWCA 3NKVA 2BIFA 1P74A 3DVAB 3C7CB 2VSNA 1X39A 2VH5R 3ZWDA 4Z9XA 2KW5A 4QVIA 3D6AA 3JQFC 4AG6A 4ENWA 3AM3A 5HR5A 2ESEA 4X6XA 1Q12A 5DQIA 2QT0A 5LP6C 3H1GA 4MV7A 1QB7A 4PG6A 1L3TA 2FUNB 3DV9A 3W9BA 4DMFA 1PG2A 2ZXUA 3TLBA 4C1BA 3T5PA 2EZZA 1JEYB 1KO1A 4C0AC 4TSFD 2WQ6A 3K0CA 3KTOA 2XO7A 3K7EA 3FNGA 3FNHA 2AUTA 3CE6A 3KR0A 1IN8A 2FZEA 3VSDA 2R8HA 4UFNA 5CT6A 5L3QA 3ABOB 2HJ9A 3LPLA 2G36A 2DQSA 1RS0A 4NWIA 3P26A 4P84A 5JWHA 4DDKA 2WYHA 4OFWA 2JATA 3H11B 3NRJA 1ZD9A 2FJPA 2Y2UA 5IKMA 1I3KA 1XAJA 3HU3A 4QLAA 2J3JA 1KI7A 3JATA 3IDOA 4OU4A 5IXSA 5JG7A 3C16C 2V7WA 4R7GA 5H02A 5TT0A 2IV2X 9ICEA 4PZLA 4CTKA 4RF5A 4D9HA 1PWZA 1EQUA 4FMCF 4F8YA 2ZDGA 1OXMA 3GH3A 3TW8B 4LJ5A 3HO1A 4EW6A 1CIJA 3KEFA 3H4TA 5DISB 1A27A 1MSWD 1FJ2A 3DHYA 3NXKA 1ZK3A 2JI9A 4WAUA 2GYWA 3WISA 1QS0B 4BGEA 4TVOA 1Z83A 3W3ZB 1AOXA 2XVAA 5HHHA 4A1FA 3H83A 3PB3A 2JEOA 1W94A 3ZWQA 1I1NA 2H2HA 3IXQA 4DBVO 4BLUA 3A1SA 4H3VA 3RREA 1BGXT 3NQ41 2VEDA 5CFNA 1DJLA 5F23A 3V9PA 2BHSA 4PHCA 2PD6A 4GI1A 4PSVA 4Q1DA 1L5MA 3IAAA 2H51A 2C77A 3BD6A 1R8JA 2RDMA 4Q7MB 4A23A 4WJZA 3OEEA 1D1PA 3EVCA 1AV6A 3CWQA 2AHRA 4O4HF 5EHZA 3LNCA 1XHEA 1L5LA 3OZFA 5KQRA 4ALNA 2IXDA 4EL0A 2NVUA 1ZJNA 5K0BA 1UK9A 5A9RA 3GIKA 1P7DA 1V16B 4IWYA 2V74B 3C3JA 1GARA 5P21A 4JBLA 3HBMA 3IBSA 4AIRA 3RVLA 5DT9A 1I36A 5JDCA 2G63A 3NP7A 4ARBA 4JFRA 3R6LA 4RMGA 4OJOA 4ZI7F 4S1NA 2X8LA 4R9NA 2NN3C 4HFJA 3QPUA 9ICGA 2E5SA 1O96A 3C21A 1MVLA 1IHPA 2XDQA 3LOUA 2FG7C 2O2GA 4HLDA 4NLLA 2W6JA 1BXZA 3WMRA 5JNWA 2QR3A 4WGGA 3GJYA 3OUUA 2N9UA 3GEBA 3WP0A 2GMWA 3K70B 2RHGB 4CM8A 2LHTA 3MR2A 1ZXLA 2D0OB 3O8NA 3RFTA 5ESDA 1HKHA 2RMKA 1W4CA 4TUYF 3GT0A 4MR9A 3BMOA 5FPYA 2NW6A 1ECFA 3GL9A 3ND9A 3SYNA 1ISMA 4F4CA 3PD0A 2C8JA 3EA4A 3R0ZA 4GOJA 4BQEA 4ESHA 4HDCA 2AKYA 3ASUA 1IYZA 1B42A 1FP6A 5J2TA 1U1EA 4GMHA 1SK8A 1G3IA 3P4UA 4G01B 3T34A 2PMDA 5KT5A 2IBKA 2I4RA 3OJEA 4KXYA 4EYKA 2HCTA 2Q3HA 4EB6A 3DMTC 4RNCA 5CDFA 3X2EA 3GCXA 3ETJA 3KZIU 3H9GA 4CV2A 2ZW9A 5CAEA 1YZQA 3TVYA 1CJUC 1J2YA 2AG6A 4TKVB 4LCJA 2J7PA 4F9EA 1SBCA 2OHIA 3EVFA 1VB5A 2TMKA 1FDSA 4K9DA 4P5PA 3T3PB 1LW7A 3LOQA 1XD9A 6REQB 4DSTA 1M1ZA 3IILA 2VDWB 2ACWA 4IQ4A 4Z0NA 1KMCA 2ES6A 4NFLA 4H6XA 3SF8A 1RWNA 4FFNA 2JJ2D 3I6MA 3SHTA 1Y1KE 2C7OA 5J2DA 2OV2A 3QLJA 3UFXA 3KHKA 4KDEA 1N2BA 4DZZA 1L7VC 4H0FA 2F1KA 3H1PA 2CLHB 3IP8A 2X0NA 1KZHA 1TKDA 4JUFA 3PNMA 1U7TA 2Y1FA 2ZJOA 2BFBA 4G6ZA 1RAIA 2HBMA 1LJLA 5JZSA 1Z4PX 2XB4A 4K86A 4CKCA 1PFKA 3K8ZA 4YREA 4G0NA 2P62A 1Z2AA 4L02A 5SZIA 4F9FA 3OM8A 4FOSA 1YQWA 2OHJA 4W5WA 3U1BA 4PYNA 1XDGA 2DUWA 4KFCA 1N6RA 1QHFA 3AKEA 3OZGA 1UA0A 1TOAA 3DV0B 1BPBA 2JGDA 3I0NA 1IXRA 5LCXA 4RPKA 2VSFA 2PYDA 4OB7A 5TS2A 1WXDA 1VKNA 4UUOA 1W5SA 1TKBA 3WQHA 4B40A 2VQ6A 5E1OA 1WYGA 3T99A 4YALA 1KWGA 4U2CA 4Z3KA 3HZZA 3AMVA 1P7WA 2B5OA 4BQOA 3N8IA 4DV6B 2NO6A 4LHZA 3JQEA 3BEOA 2GBLC 3IKMB 2HQ1A 3MOSA 4IIEA 3O2QB 1RBQA 1ISIA 5TEWA 4LOKA 5B37A 1JLMA 2KJ9A 1H9AA 2WJPA 1V5IA 3HWX1 1UPFA 3ROXA 4D9BA 1PZMA 1QAQA 5JSZA 4KLTA 5EJ2A 2JIZA 1EG7A 2VP5A 5I7SA 2D2XA 2JXJA 4RLQA 2AFHE 2HHXA 1TCVA 3QE0A 4HYTA 1WB4A 1PJ8A 2GLTA 3T7RA 3V7WA 2KWIA 2XVMA 4CBVA 2O5CA 2J5RA 1X1BA 2IEAA 2WE7A 1S10A 3MYYA 5DCLA 3AKCA 1JXOA 3W8FA 2G4CA 2PZEA 4QUDA 5CJ2A 2QK4A 4BUCA 4RTLA 1SG9A 4Z4QA 1VBFA 3VBEA 1KTVA 2Z04A 3OE7D 4HXGA 3ACCA 3GLGB 3FX2A 2KEYA 4M38A 3LUKA 3QNUA 3E7DA 2A4KA 5DXAA 1D0SA 2J45A 3AR5A 3X2SA 4GHWA 3FWKA 4BQFA 1QTMA 2NU6B 3OZIA 1RT9A 4RL6A 4F86A 1FYDA 5C5EA 3LF1A 4MIKA 2M6SA 1BA2A 3LUCA 1K7EB 2WKPA 2NU9B 2FNAA 1JPVA 5HRAA 1P5FA 1NK8A 5HRUA 3UANA 2NVWA 1T3NA 3I42A 2WAYA 4JU8A 3WK8A 2HZBA 5IZCA 2OMEA 3I39X 3SEZA 2Q3JA 3PNQA 5LN1A 3T3HA 4C5AA 4EX6A 1VMIA 5J2AA 4RENA 4YN4A 2EX4A 1NXWA 3CCCA 1TJ5A 3Q12A 1MA0A 4PGXA 2E55A 1G1MA 2GM4A 3RJGA 3FY4A 3ZQ6A 3ENQA 3FYTA 1IJEA 4V03A 4O3MA 2GOLA 1DFHA 4O5EA 5EYPA 3TAQA 2OHHA 4FIDA 3T94A 4KOEC 3FAZA 1MQ8B 1C4OA 3PNCA 2R84A 2VNJA 3WWEA 4JIMA 2XOKD 3NUZA 1E1CB 3B2QA 4UJ5A 4WOBA 4KKXB 3IAFA 4J7UA 1E1MA 4QU0A 2AQKA 1JIJA 1KKUA 2LBOA 3O8QB 4PLPA 1XDSA 4IG9A 1AS2A 1XK7A 4L6CA 2RK4A 3DGEC 1K6IA 2PZJA 1I3OA 1VCIA 1QP0A 1JIQA 3IQWA 2Q5IA 3S5JA 3O8LA 4IS2A 1B4FA 3AQIA 2QRHA 2YDYA 3NJ4A 4F5YA 1P39A 1OFUX 2UUAB 3O8OB 3RYIB 1SURA 4EWLA 2FEXA 1G98A 3O82A 4I2FA 4F45A 2HV9A 1HE5A 3WOVA 2HUPA 3C8ZA 3L92A 5BWNA 1IHOA 1PCXA 1VIVA 5KTKA 2PBFA 3OQ6A 1VE1A 4UMEA 1Z0DA 2D00A 2VPTA 4DIFA 1IH8A 5GGYA 4Y2TA 2HBQA 3NTQA 3Q3EA 3OD1A 2N1MA 1MT0A 4NCHA 3BQTA 2Q5FA 5B1HA 1Y9ZA 1M1NA 4NBRA 1Z5OA 1SCDA 1K1QA 2VSQA 1JLLB 5EWLB 4E5NA 2FSIA 4MSUA 1N4DA 4DCTA 1S96A 4TZKA 1QWOA 5EVJA 2F44A 4HWTA 1C81A 2C96A 3T52A 2UXCB 1OTXA 7ICHA 1NJ6A 4JUDX 4CV0A 5COBA 1GKIA 1VSVA 3TZCA 3G2NA 2O6HA 2QNIA 3SC6A 4Q34A 3E15A 1AGXA 4I6GA 1Z73A 4NBLA 1WRBA 3T3DA 1CULC 2X7XA 2G3YA 1AQNA 3QFFA 3RG2A 3CLRD 3HRIA 5LQCA 2FRDC 2E6UX 1UKZA 4W9NA 1JBQA 5KYXB 5A71A 3BCUA 4FYIA 3A4TA 1S1MA 4KLMA 4GICA 4I5FA 121PA 1P4GA 3D7MA 4QNLA 2IKSA 4IIJA 3BQ0A 2QP3A 3IT2A 1OI4A 4XD2A 2AFRA 4LI0A 4DF8A 4L5JA 3RFFA 5IDXA 4YGXB 4N9WA 1QKKA 4KYTA 5FYQA 3BA6A 4MUMA 1E7RA 2F48A 4N0DA 1UXKA 5FAKA 4LFCB 3THSA 1S3SA 4I2HA 1X42A 1JJAA 1E2PA 3CRRA 4KH1A 3ROPA 5EC8A 4AF8A 2Q8NA 3GJRA 4ZQGA 4PQFA 4UU7A 4C22A 3RASA 2E1FA 4RQ3A 5BOSB 4PYOA 1UP6A 5KINB 3GUUA 2IOFK 1CQJB 4FKMA 4UCXA 3N8DA 2YBDA 5IVPA 4A6PA 4KMUA 4P22A 4Y9DA 1LX6A 5EUCA 1ZOIA 1Y9JA 4WA8A 3V7UA 3EC7A 2PBZA 4D42A 2ZJ8A 1AKQA 1Y98A 5DXFA 1BO6A 1TDJA 3AILA 3M6MD 4EA6A 3GRAA 1WUIS 1CDZA 5C0YA 4GRDA 5EPUA 4X1YB 2QBYA 3B85A 2VH2A 5KVAA 1A5SB 5CDFE 2ERCA 1R64A 1SCKA 1SHKA 1X7ZB 4XUEA 4LJ9A 3LBNA 3PXGA 4IHJF 1GGJA 5G53C 2V6FA 1E2IA 4JXKA 3R3YA 3BFJA 1PP4A 1N2HA 4K05A 4RQTA 1QFSA 3W78A 2A9PA 4BMSA 2FP4A 4MULA 1MPTA 3VOBA 5CDUA 2CUTA 4IIFA 3IKJA 3ZNPA 2HU7A 4O2AA 2ECFA 4CQLB 2ZBPA 5T4BA 2I34A 4Z6DA 3K20A 1SKRA 2DHEA 3HDJA 3TLKA 1JIIA 3ISVA 1X1RA 1PFUA 2ZCUA 4J3JA 2ZYSA 1QHXA 5E9WA 4QNNA 1U8AA 2IYYA 3GLUA 4EHNA 3A9UA 4DMUB 2BGGA 4ZYUA 1GRNA 4N8EA 2CF5A 3V7KA 3TBFA 2G08A 3PW2A 2Q3CA 4QPDA 2C4NA 1T0BA 5KSWB 4ZRDA 1DRKA 5G0SA 3CR8A 1CE8B 4B4UA 4I6JA 2I4TA 4HB2A 1ATZA 4RTSA 3C2QA 2R7MA 2DLCX 4DFPA 3J7AC 1T5HX 3QQPA 1XZCA 3E3LA 4UM9D 4BZPA 4TQAA 5DBOA 4ECXA 1IHXA 4A82A 5FL7D 4KSYA 4IYRA 3PX6A 4UHEA 4QGGA 5HBGA 5KU7A 2D6FA 3BGVA 5CVVA 2LYBA 3KKNA 4EPVA 3AN1A 4ROTA 1QGZA 2Z1MA 4QQ8A 2SKEA 3GRRA 1SUFA 5E2BA 1VLBA 4HO1X 3P1JA 2H1WA 1M2HA 4YMMA 3EGOA 4PAMA 3EY9A 1GFSA 4E5YA 3ZV3A 1AKNA 3JAMA 2FE4A 2D8MA 2PRIA 4MJXA 3GRKA 4H4EA 2CXUA 4TKUB 2JANA 1FLAA 3LGSA 1AD2A 4S0XA 1UJ6A 3QEBZ 4B2LA 2A5DA 2CLMB 1N6PA 3KPUA 1JXEA 3O6VA 4B4DA 3VJLA 4UOZA 3PQEA 4ZRNA 1XVIA 1KMMA 4JS0A 4GT1A 1XJWA 4NBNA 4MWEA 2YVAA 2UVUA 4Q4JB 5B53A 5FH9A 3A7DA 3NHUA 2O0HA 3O4FA 2QN7A 1N1EA 5AOBA 4ILEA 1ZA1A 1VJDA 2H0QA 4ZGBA 5BSKA 3U7GA 3TW6A 4DWWA 2XVXA 3M5WA 3JYLA 3SICE 3WGUA 3G0OA 2WA1A 3HJTA 4TMFA 4JJ4A 4LMRA 3BWYA 5FFNA 4BNXA 1HQYE 3L6UA 2IYVA 2NM0A 1G20A 2YFKA 1RQPA 5CFPA 1A9TA 3WAJA 3PRJA 3CRXA 4YRJA 3NT5A 4ZXFA 3ZHSA 4R05A 2BM0A 2XRMA 4NZPA 3UAZA 4WGFA 5IC5A 4AAYA 1AHIA 1WCIA 3CX4A 5F3RA 3U80A 1U5BA 1MJGA 4HQFA 3SY8A 2QGZA 4XEUA 3LYHA 4NPCA 5JNUA 1E6EA 5D00A 3CLTD 3V3KA 3RJFA 4HMPA 5F2KA 5H3CA 1VHJA 1JDJA 5EHXA 4Z3OA 4JYAB 4XUGB 3W06A 2PJZA 5KFQA 4F12A 2JI6A 1DEAA 2FMKA 3W5CA 1AZSC 5H2FU 2WSIA 2OQIA 1Q7RA 1ODIA 4V0NA 3F2IA 4XIJA 1VPWA 3CLSC 2VZ8A 3JZIA 1PUJA 2OYYA 4JH0A 5CT9A 5FPQA 3QNWA 2DVMA 3E9RA 1T13A 3NO4A 1J42A 2LV8A 4C8OA 4D4HA 5KFRA 4BX0A 3OE7A 3GAFA 2JVKA 3ZZNA 1UXHA 1GCIA 3AG5A 2Q2VA 3CT6A 4CVNA 1XRNA 4KHPB 2WYIA 4K9PA 3QLVC 3CR7A 3O1HB 1S0NA 3IPCA 2O5EA 4UFPA 1KJJA 3HA2A 1WPRA 3W5IA 4YT2A 3TADC 5KYVA 1CB0A 1EK6A 1XMIA 1QFJA 1Q7BA 1FNBA 4JQZA 4US9A 2H92A 3PCTA 3SOZA 5FWAA 4HNVA 4HAVA 4HMOA 2JFGA 3FSJX 8ICFA 2ZLBA 1EUYA 2H1SA 4TYWA 1ENOA 4LWZA 5DB6A 2Z3ZA 5IUKC 4BNDB 3EARA 1L5RA 3N87A 2C4UA 3PYMA 4QYXA 1QQAA 4K6MA 8MHTA 2H5IA 1C2TA 4UNPA 1C30B 2PL9A 2YZMA 2BT4A 3GVHA 4IMIB 2IXTA 1USVA 3IM1A 2F7SA 3B8EA 5KDLA 1ZQRA 2FYTA 3VMMA 3R3UA 5EP4A 5KQGA 4CLDA 4DR2B 1O03A 5LU9A 4XD7A 3WZ2A 1W5TA 4GWKA 2Q9AA 1B76A 4GYYA 2OAQ1 3L4SO 4EF4A 4R64A 2XAAA 4ZU3A 5JECA 4RQNA 1H2YA 5C46F 2BISA 3P0EA 1V85A 2R8BA 1CDOA 4GD3Q 1J56A 2XOKA 2ANCA 2CBXA 2HLDD 3WB9A 4JVLA 3WA7A 3GDWA 1BGWA 2ZRHA 1P2SA 2WUWE 3R7NA 4Q21A 2B69A 4MDEA 3NTOA 3Q5DA 3JALB 2ORED 4MA5A 4AMVA 1I94B 2C2WA 1LU9A 1P0CA 3S4YA 4BMXA 3G79A 4F6LA 3L0YA 1X2BA 3PF8A 4KWHA 5AFSA 2XYPA 3GHHA 2CHEA 3ITKA 4PZAA 3KBBA 1L6IA 1COKA 1JDBC 2IHJA 1C1XB 2KZZA 4Q03A 2JPDA 3DNFA 3AG6A 3BDIA 2RJNA 2W9XA 4TLEA 1OH6A 3LI2A 1T4GA 2Q1WA 1RPNA 3F3MA 3JD3A 5JNTA 2O3SA 2GAJA 1YJBA 4Q4DA 3DAFA 1Q1BA 1SL0A 2O8NA 1IK4A 1Y5MA 3DPIA 4WZBA 4AJEA 1SULA 4KBYA 3AL0B 1QGDA 3B7WA 2QI9C 1CR2A 3U6BA 5HMLA 2B21A 2Z7JA 3N2EA 5F76A 2AUMA 4EUNA 1QYDA 4X1OA 5ENVA 4YR2A 4QX6A 1VDMA 4ZO7A 4EFNA 4E94A 2PKCA 2ZP1A 2Q7DA 3IBCA 1RRPA 3MWYW 2XGOA 5A5DA 2ZB3A 3V8VA 1R3UA 3EH1A 1TMOA 5HKKD 4TUPA 2FX2A 4P81A 3A10A 2BFNA 2Q28A 3LMKA 4CI9A 4C0XA 3B1XA 3C24A 2GASA 2HF7A 3LX8A 1IZYA 4BKRA 1TAMA 4TVKA 3GFSA 4YFKA 3WHLA 1N3YA 4FN4A 4O4JF 2QM8A 2D3DA 4U4AA 3FOBA 3ASZA 1A5ZA 1M8JA 1R9MA 1X0VA 1DXYA 3M9XA 4MA0A 4PPYA 2ODBA 4LZAA 3PSIA 1BYUA 3VZSA 4CCSA 1U80A 3USCS 3KYJB 4Y1RB 2K4EA 1FQWA 4FZMA 3ROMA 1KMHA 5C4GB 1M75A 2PY6A 4MP8A 1F6DA 2OO7A 2O8EA 1U0NA 3DQPA 4AJ1A 5AI5A 2EFHB 1QR2A 2VPPA 2N75A 4LVNA 4G8JA 1QU3A 3GAZA 1LPPA 4QHYA 4KU4A 1XXLA 2WSBA 1QYRA 5FPSA 3QM1A 4MVJF 2KVCA 1BX0A 1HT2E 3IDAA 2ORIA 4PW0A 4NDZA 3EWAA 3U26A 4JBHA 3NLLA 2YRXA 3NIWA 4MUHA 2YMPA 4BRWA 3DZ8A 2D7JA 4NP6A 5ADWA 4NJMB 1LLQA 4KQ6A 4HZUB 5A4AA 4DLAA 2GTPA 4BV2A 5K6TA 2WYVA 1NY5A 1T2DA 4TS1A 1D0VA 1XYVA 4KQEA 1J09A 3GX1A 2R65A 5FWNA 4LDAA 1DINA 3EPKA 4R81A 1W88B 3Q4GA 3U62A 2O4CA 3AHHA 2BW0A 1YRWA 1L8QA 5AKGA 4E13A 3Q10A 1Y4UA 1RCFA 2AV6A 2CW5A 3VPSA 1H8ED 4ENUA 2ZI4A 2VP3A 1J1ZA 3CBQA 3KLOA 5I45A 2DBRA 3SSMA 4DCCA 1NE2A 2GK7A 4F3YA 1S0MA 3LXUX 3ORYA 3HMKA 3DP7A 4P33A 1L5FA 1E9DA 4V0LA 2JEZA 3JQGB 4WCVA 3GFPA 4TYYA 4FW9A 2E4AA 3PR4A 1CQWA 4GKBA 1RBZA 4DT1B 5HVNA 3JXEA 4JCCA 4FDAA 1G21A 2HDWA 3KDPA 1AKTA 4HG2A 4PU0A 4KACA 1PQ4A 3JTMA 2GAIA 3OOWA 1DC8A 4MV5A 2XF8A 3AKYA 3LYAA 4X7MA 4GXIA 3VOTA 3VFDA 2XF2A 4QW9A 3V9AA 3VPHA 3ASVA 4Q9NA 2BCEA 4LJYA 3OKPA 5DE3A 5IZ4A 4I99A 1EJBA 4DSUA 1USIA 4B48A 3QNMA 1J99A 4BKOA 2PQ2A 1EK1A 1ZQFA 2ATCA 2LZ0A 4NNJA 3Q41A 9ICXA 4DHEA 4LMBA 4F3OA 1GXSB 5A4FS 1GV0A 1SV0C 5D01A 3FDSA 5F9LA 1I8TA 3BM5A 1SV4A 4HWOA 3K2IA 1Z8DA 2QTTA 1XFAA 3GCZA 3O03A 4ZVUA 4OIMA 2IL1A 2A9JA 1IDOA 4OI0A 4UU1A 2CFCA 4I3HA 1EB9A 1G20E 3WTBA 4OM7A 5E6SB 1OH7A 4FBMA 4EI2A 4DIUA 3KEQA 3A0RB 5D5PA 1FCJA 1F1BA 3QV1A 3RCBA 1WV0A 4CRXA 4JK1A 3FCSB 2FG6C 5HGXA 3N7UA 4J8PA 1ZMBA 3WLAA 1QZZA 4CE6A 3S8YA 3FPHA 4Z9BA 4B3DA 4Q15A 2RHJA 2ZK7A 3BFVA 4M99A 5A0VA 2VP4A 1A3CA 2IYZA 4XQCA 4PSAA 2JGAA 3DE0X 4RTOA 5B1SA 1RHKA 3SM9A 4L8YA 4DFDA 1ECPA 1T6BY 4NK4A 2W22A 2Q5CA 4FKZA 2P6NA 4L5CA 1FFVA 3PEYA 4PGQA 1U28C 1Y48E 4BNIA 2AH5A 3ESCA 1ADCA 1UBEA 4NCBA 1EDDA 1LPMA 2A5GA 4G4SO 2HF2A 3GP8A 5KU1A 3NANA 5FUXA 3GDXA 3UQZA 4UDXX 5AK4A 3KHLA 1JHXA 2IWRA 2LWIA 4UBLA 5AM5A 3J81k 3HUEA 1DIOB 4YQZA 1QV6A 4WNAB 3JWEA 2A5YB 5ALNA 2B8JA 4PFSA 2WIKA 1P45A 4BLOA 4IF6A 2C5AA 2G72A 4HNQA 5LZ7A 1CDEA 1VJ0A 2AG1A 4QO7A 4I5DA 4MPJA 3AL2A 4FMBB 3A06A 4R41A 3B2NA 4ZQCB 1QG2A 2GN6A 3CA8A 3DT6A 3FUVA 1KRWA 1PWHA 1Q21A 4UTRA 2W5UA 5AVYA 1AO0A 2LKCA 4TN5A 4OLJA 3PD1A 3EAGA 3D3WA 4LC0A 3RR2A 4LTNA 1DG3A 4FNMA 5BSHA 3EVNA 2VZ0A 4UBMA 1EPUA 1WDLA 2VT6A 2JAUA 1M66A 1YZGA 4ZOQI 4LNHA 1XJQA 5F98A 3HN2A 5HTKA 4BXOA 4KP7A 1S9DA 2ZZKA 5K4AA 4DFJA 2A3VA 3WYBA 3OD5A 2VN8A 3L1KA 3WIDA 1V96A 2OSBA 3TE7A 3KOUA 4YP3A 3ZDDA 2CGEA 1YMUA 3AUAA 1G66A 3PEEA 4BFCA 4Y9TA 3LP6A 3G88A 4H7JA 1CUDA 1PEAA 4HGRA 2ATXA 3H4IA 1CZKA 4UUQA 5A06A 2HJRA 4N54A 3IVMA 2FMSA 4MROA 1RJGA 4ESOA 3ZH9B 4EFMA 2VDVE 3N2YA 3LPNA 3ZLJA 1ELOA 5LDDC 4YRMA 2JAHA 4I0WB 3GLTA 3EIXA 4Y6GB 5J43A 3KXIA 1VZ3A 3M4NA 1WZCA 1RCTE 3LC7O 3H9JA 4USAA 2RC5A 4TRRA 5J0WA 2Q1SA 3DOUA 4QOHA 5LJLA 4ARSA 3P9YA 3OA0A 1T9GS 3AESB 1NMSA 4CM6A 3ISCA 1NVAA 4EKDA 1N2CB 1Q84A 3IGFA 4V3CA 3U4IA 1ZQGA 3LY8A 3LZCA 3C3XA 9ICVA 2HW3A 3ZWWA 5GJVC 4OF4A 1FOEB 5AW6A 1VJTA 2DF8A 1G59A 1TX4B 4IGIA 1T8WA 2ZTDA 1R4NA 2QUIA 3ZWYA 2B7LA 2I8AA 2P3LA 2P7IA 4F7DA 4YRZA 3KR9A 1LBQA 2Q1XA 3BRWD 3UWOA 2HLDA 2F43A 4NCIA 1KKMA 1XQWA 4BO7A 3CLUD 3LE8A 2BMDA 1Y4SA 1V11A 3DAPA 1CUSA 2EFEB 3QJ5A 4GL4A 1BYIA 3IIEA 2HSZA 4EHBA 4AC9A 1AG9A 1VA5A 2AJCA 3NG1A 2XB8A 3U61B 5IX8A 3EDOA 2YWJA 3OU7A 2PYIA 5B66U 2OEPA 2XT6A 5FTWA 3C6KA 4JC4A 4HS4A 3MT0A 1RHRA 1HYHA 5CDTA 2EKDA 3GPBA 1T4DA 4EG3A 1WDTA 3BD7A 2KJ5A 2XLBA 1Y37A 1YQEA 1NUTA 2EFDB 1NM5C 4QGHA 1X66A 4U0KA 1LFAA 4R1MA 1ND5A 1X8JA 3MCZA 5MN5A 1QH8A 3PC8C 4RM3A 2NPFA 3ZCUA 3O4HA 1OVMA 2GFQA 2WYWA 3RNOA 4TQ9A 3DA8A 5L9AA 3ONFA 4YCSA 2VPXA 4BV9A 2QD1A 3ZK9A 1MB2A 4P35A 2J8ZA 1KI1A 2JFYA 2EBHX 1PD1A 3BERA 2BUCA 3TZKA 5JYCA 2D62A 1W5BA 1WAMA 1COOA 3U3JA 4M1YA 3EX7C 3FSRA 2ZIVA 2D13A 3ID6C 4RANA 2ODAA 1AM4D 5LB2A 2P8SA 2J33A 1T5TA 2R18A 4DGQA 1II0A 2HKIA 2HT1A 2HLNA 4PPFA 1PFGA 1V4VA 4FMCB 4K0KB 2KICA 4RY0A 4L4XA 2W2MA 4HEHA 4QZHA 2XI4A 2PGLA 5TX7A 1ZSNA 4PY2A 4JBYA 3WHIA 1EX9A 4LZNA 3AKZA 1CYDA 4C3ZA 4QXOA 4PZOA 4KO8A 5BYBA 5MFZA 2JGEA 5HYVA 2WIAA 4EJ0A 1IZ9A 5E4YA 2JHCA 4PX2A 1Q7CA 1RXVA 1G8MA 2IXGA 4XAQA 1TUIA 4QZDA 5AUPB 4PCLA 1R0RE 3GWZA 4NV1A 4MUYA 2ZUFA 3ESXA 3QVVA 5IM5A 3BFXA 2KOBA 5JAQA 3G17A 2YQ5A 2V55B 1P1HA 4XVRA 1FVHA 3JPYA 4X3CA 4YCNA 4D3DA 3EMKA 1CS0B 2R8RA 2QB5A 1JG1A 3TLAA 2JZNA 1Q3VA 4O4HB 3ZWPA 2Q5LA 2HC9A 4A6EA 4C4SA 4C6HA 3EFOA 8ICJA 2F3PA 2IYUA 4JXXA 4G0ZA 4DJ5X 3QZ8A 4EOGA 5H4GA 9ICMA 1ZW1A 4LDZA 5K9ZA 1M5TA 3K9HA 5JAOA 1G21E 1LDNA 1FMCA 3EBLA 3LX4A 3FPCA 3QPAA 2CB0A 2P3SA 3D4PA 4TOIA 2AQ0A 2HK6A 1LWOA 4JP2A 8ICKA 4EF5A 1PVQA 4QZ8A 4FQ8A 4ZI7B 3NCTA 4YP1A 2ZRDA 1OTHA 4UXJA 3U37A 2K4IA 1FK8A 1PDWA 3RS3A 2AK2A 5LQKA 4UPEA 3V4VB 1LKYA 5A3QA 1MB0A 1KEPA 1W0CA 1CPYA 4LKRA 1E5DA 2GEVA 5B7PA 4W5HA 1ZUWA 3C70A 3L46A 3UB3A 4HFRA 3F4BA 2UXBB 4AZ0B 3JQAD 4DY6A 5TDHA 4MYUA 1HOXA 2YYYA 4FEEA 4JYMA 4P53A 4EVRA 4TUYB 3RK4A 2W9BA 2WF6A 5HZGA 3IA7A 9ICUA 3LBHA 3H97A 2R3SA 2Z43A 3H84A 3L8FA 2YOGA 2VQDA 3ZLTA 3L3BA 1WM1A 5T8KC 1GGFA 5IKOA 3PUYA 2OXRA 1J1IA 3I23A 3BXOA 2X40A 4FILA 1CJKC 5AI6A 3ADPA 5IDWA 2QMQA 5HKBA 3WJ7A 2DC1A 5L7YA 4DCMA 1J24A 2IBMA 5KFWA 1PJCA 4WN9A 4EHHA 4XCVA 3NHZA 3S7ZA 4RL4A 5EHNA 5KS2A 3H1TA 3OFNA 3T7DA 2W03A 2IV3A 5FI1B 3MD0A 4BPRA 3QOYA 1A8QA 5TSDA 2NU7B 2WSMA 1CJMA 1JT2A 5AI4A 2R6DA 1JJVA 4D4GA 1GPAA 4RD1A 2IE0A 5D3MB 4Z4HA 1Z82A 3AERB 1L4KA 3KPWA 2QGNA 4BZWA 4UC0A 1JU4A 1KY5A 1ORHA 4P4UA 4QDTA 4KFSA 3RWMB 4DANA 1AS0A 2XVYA 4D6PA 4HAXA 2B3TA 3I8XA 2YJGA 2ENWA 1N1GA 1TK2A 3DXZA 3NVMB 2DX7A 1EFVB 2KM1A 3OURA 2P1RA 4AY4A 4OL9A 2PXCA 3HYTA 1I51A 2PT7A 3E9YA 3AUSA 3CEHA 4J1TC 3T5KA 1VKOA 2D5AA 1BROA 4QUHA 3EVZA 5ULLA 1L7EA 1T26A 4EP1A 3I09A 1GVHA 3D3KA 3JD0A 3WHKA 2Y05A 3WZMA 3MR6A 1NOIA 4OXNA 1UMCA 3LBAA 2QQEA 1ZUNA 2VQ3A 1RJ9B 3SOPA 3VBCA 2ODQA 4PLZA 1T35A 3RJMA 3TD9A 1J20A 1V39A 4CKWA 2WFAA 1PYOA 5CXUA 4BMNA 2MHCA 1C20A 5L1MA 5FOQA 2WSSD 4BZZA 2I62A 2W6MA 1MFZA 4IRDA 3G3EA 3VZBA 2AD5A 4GI5A 1JNYA 1HG0A 1SUEA 1NV8A 1JXLA 2EHDA 4D5GA 2FSUA 2PUTA 2ZUBA 3QBTA 3PU6A 1ULUA 1A9PA 3X2FA 2UDPA 1Z39A 2QRUA 2FN8A 3G0GA 1ZP6A 1H8HD 1W19A 1R8QA 1AS3A 9ICIA 3CNBA 2IDZA 3NTXA 4KMSA 3N07A 3L0CA 4URFA 4K9MA 5DKFA 4J9SA 1JR4A 3LHFA 4D1YA 3S2IA 1NVWQ 4RJIA 4R40A 1OAAA 1XQ6A 3UPDA 5H1YA 3T9DA 1FF9A 3L4BA 4G3XA 4FD2A 1S77D 5KOHB 4MLCA 3ABIA 2OAEA 3K4PA 3TG2A 4MOWA 1YS4A 3OPNA 4TWRA 1OY1A 1L9XA 4UOQA 4NBKA 1WB5A 3HI4A 3QXJA 2IFTA 4P3NA 2GAOA 4ZV4A 4HXFB 3ZCQA 2EX1A 1V5EA 3FW1A 2FWMX 1Z5GA 5IP5A 2CYCA 4QTTB 2BTEA 4DV2B 5AQEA 3WBFA 3TAXA 2BGWA 2VHTA 2EZXA 3U09A 3IB6A 1PT9A 5JY1A 1O9BA 3O0FA 1M2VA 2J07A 4E11A 3O5AA 4D97A 4RHXA 4WECA 5BVGA 4II3A 2FH5B 1XFDA 2PA3A 2KZMA 5DNWA 2E89A 2W93A 1NIPA 4BC0A 3CM0A 1M2WA 3CUEF 1TW3A 2BELA 1GPLA 4I8XA 4OA8A 3ZDEA 4QZIA 3HN7A 4P9NA 2D74A 2ORYA 5KFZA 3BXEA 2QG6A 4QBIA 4MPPA 2JGMA 4HSGA 2ISOA 2JH7A 1N5WA 2JAXA 1E3LA 3F74A 3GZTB 3D4BA 4ZOLF 3OCYA 1D09A 4WLUA 1EFTA 1PKXA 1XQYA 1GGKA 2ZPTX 2BCQA 1GLNA 4CFYA 5FPTA 1L3VA 1TO2E 2Y0EA 1X8KA 2DR0A 4GLBA 2QN3A 1NZBA 3GFRA 1V8OA 5FLKA 5IANA 4MHOA 1D4AA 3R3XA 3PGJA 4ZAYA 4QYSA 4BFUA 2VJMB 4I3FA 1QQTA 1E20A 4YR7A 3RTAA 2PXHA 2RGCA 1QH1A 2ZBUA 1PZNA 2YUTA 2NRXA 3DTVD 1LBEA 5L9XA 4EAQA 2DOKA 4ZQFA 1LDEA 3UO8B 1RNLA 3LO8A 4FYMA 3BJRA 3FGPA 1LSJA 4MI1A 3A0HU 4PX3A 4TS4A 2HIGA 2CV0A 1SG0A 2LPEA 4C4RA 1D4FA 4QG3A 4ZYXA 2FRVA 5T3YA 2AZ4A 1CUXA 3V8RA 5J4YA 1FYFA 3TJZA 3ZD8A 2OAGA 2VHVA 4L2IB 3CC8A 1U8TA 3L40A 2A8YA 2H48A 4P4LA 1PTJC 2CLEB 1ANKA 3PR1A 4O2BF 1E2KA 4JI6B 1U02A 1MQ2A 3KQSA 3AI3A 3DBRA 3R41A 5E7JA 3AZQA 4JKYA 2H3EA 3N7RC 2VZLA 2W2NA 4W63A 2ZR8A 1UEIA 1ZGZA 4RQUA 3QE3A 1MENA 3OAAD 5FWYB 5BNFA 3GN2A 2X6RA 4AG5A 2O8FB 4YAUA 3ANTA 2RK6A 5DWQA 4BX9A 1XIVA 3CU5A 4D43A 3ZXSA 3EGWA 3S2FA 1ZQPA 4DLTA 3A6JA 1ESMA 1MIOB 1VG9B 1JQKA 3PZRA 4JXZA 3A1EA 4EPXA 1MC1A 4J0HA 3RBDA 5FORA 1KFKB 2MIIA 1JU3A 3WYAA 1P18A 2DULA 5IF3A 1NSYA 4DWVA 2XZTA 4MEAA 3LQ4A 4C8MA 3IUMA 3EHDA 1MDFA 3HWRA 2FPPB 3SLRA 4JLVA 2X9NA 2J85A 4DLKA 4I9NA 1SQ5A 1DIBA 2GVNA 3DLCA 1PGQA 3KVRA 1SUWA 1DP4A 1VIMA 2QSUA 4RQBA 3Q6MA 1KR2A 2PQ6A 4EAAA 1H4TA 1NPYA 1P0MA 2Z0MA 1RWQA 1WXGA 2ZCJA 3V3TA 2WTMA 2QQ0A 4YQFA 4M9RA 5JY6A 2W0MA 3AYXB 1AN0A 3UN1A 5DCUA 1IULA 2Q7XA 2LYAA 1N5XA 4DM4A 3QZ7A 3QKTA 2X0FA 3PFIA 2AX4A 3I6IA 4LHEA 1MVNA 3MUFA 1Z00B 3A04A 3IUQA 3R40A 4OUDB 4RHYA 4I55A 5TZVA 1ZEJA 3EUB2 4TMWA 2FDRA 2YNMD 3Q7QA 3RWBA 4XGQA 3X44A 3ETLA 3HWWA 1L4NA 3Q98A 3OTOB 5ARBA 1ICEA 5D85A 4ZWNA 4BMCA 1N6IA 3S2EA 4I1OA 5JCOA 3TNJA 3MWDA 4TSFA 2OZVA 1R5JA 1YJQA 5HUHA 2B0JA 1U0GA 4UEJA 4KR0A 1AV7A 4YH1A 1MG5A 2BOVA 3UENA 4FC6A 2C9MA 2FW8A 1OBVA 3CW9A 5CA1A 2H11A 2G8NA 2NO9A 2F77X 1IONA 2V9CA 4FI3F 2FZGA 1YF3A 2J6TA 1DMSA 4O4IA 2ZJFA 5LP1A 1NW3A 1QSSA 4MR8B 3PDJA 4BGUA 1UKAA 5BVHB 1T0JB 1NA5A 4KJZA 1YKGA 4P0QA 5J0UA 2VRWA 1YV9A 2H1HA 3LD9A 4B17A 3QI7A 5IT5A 3FB1A 1XPJA 4I1SA 5CFMA 4G1BA 1P81A 1CLEA 2FPMA 5DM4A 1E3JA 1AX9A 1FTWA 1YVPA 4OP3A 1V7CA 4X92A 2P5YA 4GZMA 1GA6A 2PH3A 1JRPA 2RE8A 1XWWA 4J9UE 3B38A 3U1VA 1CETA 1GNPA 3K0FB 5F52A 5IDVA 2DFDA 4PYIA 5C8XA 5AVVA 2I5PO 3WWCA 3P9QA 4CN8A 1L3SA 4HDMB 5KIAA 1BQ4A 5CX1A 3Q15C 1L5YA 1OUQA 4OHMA 4NY8A 2C61A 1A6SA 3IO5A 3SSAA 2FPUA 4IHJB 4X00A 1K8YB 5AUQA 1BG6A 1V3VA 1V3TA 2IYTA 3DBHA 2HCRA 3JQAA 1VYHA 3WWDA 4NOLA 2IYPA 3H8WA 5I8WA 1U81A 3KYDB 4RF2A 2IGBA 4NCNA 1IM8A 2OHXA 1GYQA 4BGVA 1HEKA 4WY8A 4EPYA 3LCVB 5ICFA 2XYGA 1FFCA 2R1ZA 3ROZA 3LAWA 3PWTA 1R16A 5IJ0A 1Q1NA 5BNTA 3GOHA 2A3NA 4MW1A 2A0WA 1C1YA 5CLFA 3UBTA 4ZAWA 2CXYA 4MI3A 3TXYA 1ZC3A 4MARA 2JIPA 3GRVA 4REMA 1A7KA 4C4TA 3SYMA 1GZ4A 5FAXA 3EG9B 4ENPA 3UGKA 3KS9A 1L1EA 3QXGA 1ZCAA 4LMAA 3ILSA 3NRWA 3KYCA 4IILA 2V7PA 3Q5EA 4YNBA 4GGPA 1Y4DE 1SOVA 1AK9A 3BE6A 4HS9A 3ZIAD 3FLEA 1A2OA 1XRSB 5KTRA 8GPBA 3KE8A 2Z56A 5BO5A 4RVFA 4FYYA 3AL3A 3IHKA 1NPTO 4ZV7A 1KJWA 2X4GA 5CITA 4IV8A 5KYNA 3OPYA 3TX2A 3K73O 2BFOA 1ZCFA 5HJ5A 4S1VA 1UBNA 2WUDA 2G1KA 2WW8A 1N8TA 1NVGA 1SC3A 2HU2A 8ICCA 3O0TA 3JQ9A 1NLYA 1O97C 3ZVLA 4HT3B 1H2FA 2YJ3A 1YUBA 2X7JA 3ZNOA 3EZNA 4MLDA 2PHZA 1M34B 4URXR 1F4VA 4PFJA 5JC8A 3U0VA 1UPCA 1SC1A 1EBFA 4IYJA 4M4SA 1H4SA 3HYNA 5DBFA 2H4JA 1LEHA 2AJBA 3W2HA 2DL0A 2OBXA 1UDRA 2BFFB 3ORHA 3PW7A 2BR5A 3A2KA 5ECDA 4MPTA 3OOEA 4EUFA 4YRAA 4WOCA 5ERGB 2R1TB 5A05A 3SCZA 3ZW8A 3AR2A 5JBIA 2CEAA 1Z56C 2EG5A 2CJXA 5KTNA 3F8WA 5HCUA 3GLHB 1WP9A 2UZ4A 3HG7A 3I01A 2KZ3A 2ZJ6A 5AOAA 4Q6WA 1EX1A 3GR6A 1REQB 3BHIA 1NW9B 2O1WA 2GKGA 1GO2A 2HCFA 1H8HA 1ZCZA 2YZNA 3RVQA 1CP2A 2WJZB 2BFWA 3PKIA 5FFFA 3EBOA 5BN4B 1KF0A 4DV4B 1LC0A 2C03A 3ERCA 5ECWA 2QDKA 3W6OA 2JJ2A 2X1VA 4LC1A 4R8MA 5K0SA 1YONA 1E8NA 1XZMA 3G5MA 2V0GA 3ICXA 1EVEA 1B7GO 5JPCA 3K6RA 2UVRA 2VUUA 3TUJC 5TEVA 4RABA 4XA5A 3TD6A 4IIYA 2XVZA 3R77A 1FUIA 1YR2A 4JOBA 4FLEA 4LOHA 1WKBA 4S3MA 1N1MA 1J33A 2NNWB 4RD4A 4TMYA 2I54A 1Q7EA 4ZICA 3PF9A 4Q1FA 3ZTYA 5AOVA 3U1TA 1K0FA 3LX5A 3KR2A 3NYRA 1VL5A 3L8DA 2ZYIA 1MC4A 1NJ5A 3GW8A 3C6ZA 4EG4A 4B83A 2W2OA 3ZCXA 2A86A 3FCEA 1EDZA 1SKWA 2Q9UA 1SQ0A 1CUEA 3SLKA 1KVTA 3RD5A 2OG1A 1SBTA 2JK0A 5AJYA 5TR9A 4RXTA 3NGXA 1OTYA 2PS1A 2Z1DA 1OR8A 3F6SA 3FZNA 4YGYA 3ZDZB 2JKVA 3E8MA 4IQGA 3GNSA 1Y88A 1K97A 1YL6A 3STXA 3EDMA 4L4YA 3T1OA 1MZPA 5E2IA 4JY7A 3N3AC 2XC9A 1Z08A 5DLYA 5ALUA 4BO2A 2X9VA 2EBUA 2ID8A 3C85A 4CIXA 2EG9A 3ZDQA 1MJNA 4MQ5A 4DMCA 3CNLA 2LNDA 5BWCA 4QXPA 4C4OA 1IN1A 1XQVA 5CA7A 1E2EA 1XQXA 5HG0A 4NEHB 4KLRA 3HSKA 4RQ7A 1ISPA 3DTVA 2B5WA 1GCGA 3TO5A 4B0PA 5KT6A 1M1YA 4FGKA 4D96A 5CR9A 3E1KA 1EWQA 4GX0A 4NM1A 4LUCA 1T4BA 5DNCA 3ZW9A 4AKHA 5C32A 5HF8A 3KWLA 3LGAA 2YW2A 5LBUA 1QRRA 3A4LA 3AF4A 2PVSA 3NHBA 5CXSA 1QIEA 4E32A 4HDSB 2ZJ5A 5DRYA 4DIEA 2OWEA 4NX2A 1T1SA 4MS4B 5D5HA 1WZUA 3SKVA 3WMFA 1T9KA 1Q1ZA 4E12A 2F55A 4PIPA 1GUBA 1TU0A 3EZ5A 3QUCA 3HN6A 4M1WA 4DWOA 1EWTA 3OIYA 4Z5XA 3FFWA 4RS4A 1QMGA 4LFBB 5L4SA 2BEUB 1UBRS 3CRVA 2V03A 1ABBA 3HYLA 3R9IA 2HA5A 4JITA 2GJKA 1OOEA 2H9YA 3MT9A 2GXAA 1V45E 2W43A 1P2TA 1NI5A 3TIVA 1JHPA 3K4GA 3HSYA 3PGXA 1BHSA 4DDWA 2WWGA 2EQAA 4JB2A 2HHVA 3WJ2A 4WINA 1VECA 1N9GA 2I6GA 2IEGA 4DF4A 4J4TA 4M1QA 1E3TA 2VT2A 2NWQA 3H0MB 2YWGA 1G17A 2W70A 3HWSA 1LBIA 3TARA 4OVKA 4FQ5A 3FF1A 4M0CA 2LPMA 2LCFA 3HCAA 5KWIA 5F1OA 2YRWA 4JP5A 4WCFC 2PU5A 3COPA 4MEBA 1NW4A 2ZSJA 2X9QA 3KQVA 4MQLA 1Z2OX 1WNTA 5J4HA 3OMWA 5AVWA 4OI2A 1JQLB 1BMQA 1R37A 3NVAA 2OV3A 1MF7A 2PN1A 5EIOA 4CQMB 2GEUA 1H6BA 5B7GA 3F3YA 2CKDA 5KFAA 3ANNA 3EVTA 4CT0A 1DT5A 3GJTA 3SBEA 3CQ9A 4M9UA 3VXKA 2B92A 2CN1A 1WUHS 3EPHA 2NRTA 2CFSA 3I58A 2UAGA 1EHCA 3F5QA 3RRXA 4O4JB 4QYTA 1QAMA 4DEYA 1E92A 3X1WA 3UAOA 2I0FA 1UAAA 1JA9A 2ZIGA 3G2HA 1NF9A 4MQFB 5ANRB 3ZJ4A 1VSTA 5CDGA 4RJJA 3ZWMA 5KTTA 1JFFA 3KZXA 4ZKDA 1Z15A 3EGDA 4HNAB 1GGMA 4Z7JA 1SU8A 1TK0A 3RGWS 1OXJA 3TDNA 2BEVA 3NBKA 3VYRB 1PT8A 4DNXA 1TIBA 3CINA 1N78A 3M1AA 3GG9A 3G82C 4MNTA 3BB3A 2FN3A 1Y1TA 1KK2A 4B9NA 1LPOA 3UJHA 3NR2A 4RYDA 3LTNC 2SCUA 3O91A 3O83A 3GUCA 5GPBA 4B9UA 4A36A 4YPVA 1M83A 3VYTB 2ZIWA 3NEPX 2Q41A 4JB0A 1JXAA 4FFLA 2PSFA 3F6BX 2H6EA 2QXTA 3DW1X 3D8HA 1E59A 4OJQA 5CA0A 5I9MA 2CLLB 2GNAA 2AJDA 2G77B 4KO4S 7REQA 2BDEA 1E9RA 4P6VF 3AMZA 1MX1A 1PRYA 4PO8A 2NUPA 3HBFA 3SVLA 1MRZA 1F44A 1A5AB 4WN3A 5DLQC 5ALPA 4OXYA 4ZMSA 4O2RA 3FDZA 4PF1A 3MUNA 3VHXB 2GFHA 2XUGA 5K4HA 1VMKA 4I2VA 1ZH6A 7ABPA 2LP4Y 4BVHA 1MAAA 3JYNA 4LXQA 2ZIUA 2ZAOA 2JCBA 3HYRA 4M0FA 4YRLA 1JKFA 3M6FA 3Q1LA 4YMUA 3JPNA 4M22A 2A58A 1MP0A 1Y5NA 1I2AA 2QUKA 4GX1A 1FFAA 2IC5A 2QD3A 3P52A 3RFCA 4NZOA 2H7YA 3LQQA 3HCBA 1WW8A 3D3JA 3BJEA 2ZWMA 5CM9C 5J2IA 2OBMA 1OFGA 3CVUA 2WWVD 5BPCA 3CRW1 1K8RA 5KT3A 1YOVB 3DMGA 1ZGHA 2CE2X 3W79A 3JSAA 1NTRA 3NS1A 1YDWA 3F6RA 3GEIA 2V6MA 4BNFA 4RGYA 2YWRA 2AEFA 2JBWA 4HUQB 4U6SA 1BXRA 4A8JA 1ESEA 1DTSA 3NX4A 3HKBB 4O5AA 4Y3UA 5ALZA 4OLBA 3ZHQA 1GN9A 2H4ZA 4QUKA 1WZ2A 4K9KA 2R85A 4F4UA 3GRPA 3HABA 5IT4A 1YNOA 4HQNA 10MHA 2RGEA 4X65B 3O7MA 2AEEA 3JD1A 4P2GA 5KFUA 2YV4A 2W2VA 3T1NA 3ZIAA 2BLNA 2CE7A 2M9NA 3F6YA 3WGOA 1ZHHA 2C8KA 4X6UA 4R65A 2GRUA 4Q37A 4O4LF 1ZRSA 4GH5A 4LBWA 1KO8A 3NB0A 1VXRA 1NNEA 4Z4IA 4PLHA 2ZJYA 3M6AA 3WYGA 3IODA 3M1IA 4PNPA 3UGJA 3TKAA 3SJZA 2WIGA 2BQUA 4G9BA 2MYNA 2EWWA 5KB3A 6NULA 1CBUA 5JQGB 4B87A 2L18A 3SI8A 3JCZA 3C7DB 2GK4A 2OZLA 3CW2C 3RRBA 4KK4A 2J59A 4RT2A 1C3JA 4Z8YA 2P4EA 1YZNA 2E5FA 1IJFA 1ISRA 3AEUA 3KT0A 1L4BA 1KSGA 3L01A 4EUSA 2PG3A 4Y2SA 3IEUA 1R50A 5CLGA 4QYIB 3DMFA 2GKSA 2OTCA 5I7EA 3IDQA 4AN0A 4C76A 2HJSA 4DR4B 2FUG6 3MGBA 3AJ9A 2GWHA 3T9CA 2J5XA 2GBCA 4K3UA 3V4RA 4FSXA 4OLAA 5ALEA 2VNHA 2ZIZA 4MMYB 1B6GA 5JAHA 5EZ6B 2QL6A 2A1JA 5FNVA 4A3SA 4FEYA 2YV3A 5FL7A 4JB8A 3L4EA 1T10A 2GN0A 4ECUA 3D1LA 2LTAA 4L7VA 2OUKA 5FA6A 4LDRA 2PR2A 5ILQA 2JCSA 2GJ8A 1L3BA 1YBFA 4JI7B 3HYCA 4CLRB 3OTWA 2JZBB 3W5JA 1GKLA 4B47A 5ELMA 4BTEA 2OESA 3MLEA 1RLUA 3A05A 2JD0A 2PJDA 1Y80A 5JQGF 4NQRA 3UPUA 3SP1A 4R2HA 3BMQB 4IBOA 1U4OA 3CVOA 4QWAA 5MDHA 2XWPA 3LDHA 2QLBA 1W93A 4IWXA 4F3NA 4DS3A 4E08A 2AMVA 3KB6A 3SS7X 2E7ZA 4R8RA 1ZVJA 4XB1A 5TMBA 5JADA 4PRZA 5F5NA 2I2DA 4I29A 2OAP1 4PGYA 4C2TA 2BDTA 2JMGA 5AM2A 2QL9A 3VC2A 5AM3A 4BNJA 1KDRA 2HF8A 4HAOA 3PDIB 2PZAA 4HWSA 3KSZO 4FJ1A 4QTUB 2XBUA 1ZH2A 1G4AE 2PBLA 5ABPA 3OZTA 1M1YE 4DLZA 1VPVA 5C80A 2V5AA 4IR1A 4F6RA 1BDHA 1X9WA 1LLFA 3WLMA 1FX0A 1XT6A 3JV7A 5DX8A 2C0QA 5LD2C 1CQIB 4XVCA 3P4XA 2HPHA 1DAMA 3OSUA 1EUCB 3IX7A 5DIZA 2AU0A 4G4GA 5I7OA 5E1MA 2VRNA 2GCOB 4OFXA 3QLUC 4Z53A 3ANXA 3AP1A 4FDVA 5JO9A 2D59A 1ICIA 3SSNA 3BBLA 3NCHA 5EKUA 4RORA 3JR7A 3IR7A 2GCPA 2XDAA 1KU6A 1CUFA 4OCZA 1JG3A 4W5RA 4KQIA 5L1IA 3BWXA 2E48A 3WMEA 3KYIB 4N12A 2MCFA 2IHKA 2QTGA 4MK4A 2NT4A 3GBPA 3OFSA 4F2PA 2ZB2A 7ICSA 1ISFA 1EP1B 2MSEB 4R8VA 3Q7PA 3OVMA 4D8VA 3ASYA 2AFVA 1XDBA 4GLLA 1JPNA 2B8EA 3JQ8B 1XXHB 4QQNA 2FFRA 2FN7A 1H0RA 4UB1A 4NMLA 4KRFA 4FYWA 4IW3B 3GV0A 4JI2B 3NGMA 3AM4A 1DQSA 3O75A 1P1KA 1PGPA 2V7EA 5BV2P 3M3DA 4ARUA 1E8DA 4ICAA 3MBIA 2H16A 4L28A 1ULAA 1HR0B 4KR7A 3W4JA 3BXXA 3QU7A 3GCDA 2LIVA 4D79A 1OLSB 2EAMA 3HGMA 4NG5A 2V9PA 3KZCA 3SC2B 2MU2A 3FTNA 4ZT3A 4C87A 3LDAA 2PGIA 5LDGA 3T5HA 4PGHA 4C0ZA 1CY7A 3AVTA 3PYLA 4RELA 4LYHA 4U7TB 4J76A 4Z1MD 2P2CA 4F11A 3DOJA 5T4EA 1OW3B 4H0NA 1X9XA 1Z5PA 2HRBA 2FX3A 4KLDA 3MJHA 4KK3A 4HH0A 3DV2A 1DO8A 4JYCA 4NFHA 2RP5A 4V2UA 4C7OA 5CR0A 3DTYA 4X90A 4WFIA 2AWNA 3FFBA 3CJRA 1R6AA 3BIOA 3DWFA 1XK6A 2RAPA 5BNIA 1C7RA 1CZLA 4P4PA 3U3RA 4K3VA 3KPVA 2WHEA 1ZISA 4M1KA 1FFXA 3HCWA 3TLMA 1WX1A 1DBPA 3O3MB 3DSRA 2UVPA 3OJLA 3KSRA 2A4MA 4AQYB 4O2LA 1AO3A 1V47A 2B4YA 4DLRA 1RYYA 5CFZA 2FFBA 1NKEA 5JTIA 8ICOA 2N42A 2K5UA 2ZRGA 2GUWA 2FB9A 4Z51A 4C7MA 4OHOA 3JQCA 3IBGA 3THWB 1ZM4A 4U9IS 5BP7A 4TWBA 4LHXA 1ETUA 3KSUA 2I4NA 4F85A 1TKAA 1QZUA 1HO3A 5B2ZA 2O2YA 3ZKAA 1P1CA 2FPXA 3RBXA 2WABA 5IH7A 1RLTA 5ICGA 1IATA 1U99A 1JEQB 5D7BA 1DZIA 2SKCA 1A4IA 1E96A 4WCDA 2FHPA 1UM9A 4ACAA 1E2BA 4GC7A 1VZ2A 1A9OA 5A3SA 2I1QA 1GU0A 5IVHA 2GERA 3UJPA 1GG5A 1JAXA 3NXSA 2GB4A 3WZLA 1P77A 5A6SA 4FFMA 1QC5B 2HMTA 2EHJA 1D6JA 2I2CA 3C2LA 1SXJB 1GOTA 5CG2A 1IL0A 1WP4A 4R6XA 4KDRA 2ZJ7A 3VH3A 5KG4A 1PZXA 1GSIA 4BVAA 4QVKA 2XUKA 3FCAA 4TM8A 4EEYA 4RH3A 2A9FA 1ZBDA 4YCBA 4J16C 1HDOA 1X1DA 3P2MA 5HKKA 3C1ZA 4J9PA 4A10A 4XJSA 5DK6A 2I2XB 4L72A 1VPTA 3TFOA 5TF4A 1N5JA 3IPRA 3OT4A 1IWOA 2OCAA 1XU9A 3EWSA 3LC0A 2OGWA 2PZGA 5EJ7A 3HACA 2PZ8A 2LD4A 2E85A 1R4MA 5C7YA 5F7OA 1LY1A 3L8ZA 2AOVA 3M8RA 2P68A 4PL1A 5EP3A 4RBNA 2JLWA 5LA6F 4L3WA 2IDMA 1N77A 1W36C 3EQ9A 1KHHA 3WRYC 5GWXA 5IWAB 5A1TA 3CKKA 1HL3A 2AOTB 3I4FA 7ICOA 4H7KA 4LHYA 2BHRA 1MO3A 2QAJA 3SENA 2DQZA 4XJXA 5KTMA 3L82B 4WNCA 2PX4A 2IZZA 2Y0BA 4DYHA 1V7PC 3RAXA 2F8MA 3TD2A 3S28A 5ARDA 4KIFA 2QRMA 3O4JA 3S44A 1CY4A 5KFXA 3CLHA 5KNDD 4WFKA 1TXGA 4EYGA 4MGYR 7ICPA 3PEWA 1MD9A 1O6GA 1AVTA 3CN7A 3RFXA 4B7UA 5KQSA 4ED6A 4FFDA 2ATIA 1FU4A 5I5GA 2P35A 2QMOA 2B6HA 3KSDO 4D56A 2Q4DA 4WLOA 3FVVA 3ONVA 1MT3A 4IR9A 1QGUA 5DV9A 4BCDA 3BCRA 4FWIB 5IVDA 3LWLA 3F8TA 4PZPA 1CNEA 3TK1A 3LVFO 3E05A 4BNTA 2JJMA 4CM1A 1JF8A 5C4MA 5TMEA 3EPIA 3A1TA 5EE3A 1KJYA 1NI4A 3EZ9A 1CUUA 3P9IA 1V8ZA 1EJ6A 4S1WA 1G16A 2P1ZA 1OC4A 1LI7A 5ITWA 1SOMA 1U1DA 1FZTA 5F9HA 1IXKA 3C3MA 4JL5A 4H18A 4PRLA 2IS4A 3I1FA 3GXOA 2FV8A 1H8EA 4ZQHA 2XV1A 1IWBB 4RWEA 1OB5A 2REXB 5IEBA 2DWPA 4XSHA 4CQJA 1XKLA 4JI3B 4D0NA 1V41E 4GXTA 1RWPA 4NJEB 3DVLA 5C8VA 1UBKS 4I2GA 3PX4A 1CYEA 3SZ2A 2XBLA 1DL5A 3BWDD 3PCRB 2QTLA 1LK5A 1ZKDA 1HDXA 3SR6A 4UE3S 1UBMS 3D4IA 5AOCA 221PA 4LZJA 1GDTA 4R63A 4M9LA 1I6MA 3N8NA 1QZ3A 5LP6A 3U4MA 1IG0A 5L6LB 4NM2A 1GPDG 3UUWA 2NSDA 1H5NA 4NG4A 5C35A 2CMDA 4QEZA 2VO1A 4NL9C 1K2VN 2BR0A 3DLHA 3ZXUB 3GHYA 3BA1A 4C43A 1L2TA 4Y2VA 4WY2A 1TRKA 3VTAA 2YWXA 1EFRD 2FG5A 2YN0A 1WMBA 3TVDA 3H04A 4EJ2A 2RDJA 5F9MA 3F5MA 4NCJA 1BU8A 5FT9A 4LRWA 1ZBQA 1MEJA 2HRRA 3QU2A 4ETMA 2WP8J 2ICAA 1WOYA 5JI2E 5DYIA 3EC2A 4EW3A 3KUXA 3FI0A 3UEOA 3WP1B 1SZCA 4LY9A 5FO0A 3R20A 2EH9A 2QX6A 1OXTA 1WTAA 3FYSA 4WEOA 5LMCA 2DSTA 2HOQA 2P2LA 1EUDA 4H4DA 3U9LA 3S5UA 4RY8A 1F3OA 1Y8RA 1OXUA 2VYCA 3GGCA 2QJRA 3R8FA 2FZKA 2GSWA 3PUIA 4DMKA 2W7TA 3LY5A 3G2LA 1KXZA 3C4JA 1PFWA 4QELA 3RR8A 3KZ1E 2P7HA 3OZAA 3K0EA 4YJHA 4UARA 1QVZA 2PMZC 3K1ZA 2F3SA 2JEJA 2FPGB 3URMA 2E8OA 2XWBF 3Q8MA 3HCCA 5CXXA 1ID1A 4Y6PA 3D6UA 1T94A 5EI5A 2CLSA 4GP7A 2R8EA 3EGVA 4LOLA 4YP5A 2G9NA 5BMVA 1BHO1 3A4MA 2FX5A 4FT2A 1UQRA 4D41A 3O4RA 3OLQA 4ZEVA 2BFDA 4X44A 1Z8NA 1GITA 1P91A 1KWKA 1P31A 2ZBVA 5KCMA 3RSSA 3RSOA 2JZOA 3IAS6 3G0HA 2EZTA 4RZ2A 3SPXA 3HJEA 3CH4B 3P0RA 2ZIAA 2QU7A 3BKXA 5LYJA 4ND5A 2NNLD 2QR2A 1LNQA 3MINB 4J9OA 2GZRA 1CUZA 2E4ZA 1FTYA 5JJ5A 2A5JA 2XKAA 4U8GA 1N25A 4Q4AB 3T7CA 2DHCA 1CRXA 5JRJA 3TINA 2TMGA 5HIMA 3BG5A 4CF7A 1Z4OA 4OQMA 4ZOLB 2Z5FA 1CIPA 1P19A 3MOGA 2WKQA 2K89A 2IHBA 3QPWA 2D5CA 3FHJA 1N6KA 3PGKA 4HDRB 1E79D 3R24A 3MM4A 4YV2A 5IIIA 2VJKA 3HB4X 4O5OA 4F46A 3RIXA 2OP1A 2BEJA 2IYLD 2IIQA 2X0IA 3WVNA 4J0JA 4WBNF 5J2JA 5L3SB 1W46A 5BSTA 3ZE8A 3NKLA 3U4AA 2J30A 2P4QA 4FP9A 2JCXA 2YWCA 1FJHA 2P1DA 3RM3A 3ET4A 5KOJA 4L8GA 4PFQA 2I2FA 4K6KA 3L0ZA 3COJA 3EGEA 4HXYA 4DLVA 4E6PA 3FDJA 1UJNA 3MQ2A 1KS9A 1RPJA 3HXPA 3ZZMA 2FW9A 5I4BA 1PKEA 3QFCA 3HBLA 3T06B 2ZUWA 4O2BB 3WC4A 4KPYA 2DBQA 5KNCH 3B9JA 1UODA 1IHDA 3RTDA 1B6SA 1MH1A 621PA 3UUEA 3DZHA 3FKSD 1NXQA 1HLPA 2BLLA 3JWHA 1SBQA 4ELUA 3W9UA 4PINA 2XZLA 4RHTA 3KQOA 5EA2A 2W9CB 1F48A 3LXRA 4OBWA 4DYDA 4TRJA 2FGJA 3FUTA 4TQRA 1MQSA 2H3QA 5CCEA 1YBVA 1GA1A 1DQZA 5KTYA 3SEIA 1SUPA 1UK8A 3WMGA 3DMTA 5IG2A 1XVUA 1D5WA 1KEEB 1WW3A 2BJVA 3ZD9A 1T4CA 3HP1A 4P3PA 2BEKA 3LWMA 5IBRA 3HJBA 3HC7A 1L8XA 5HW0A 1KSJA 5FPPA 1U4BA 4G9EA 3GIIA 1B26A 4L22A 4XUCA 1X77A 5TGTA 2X1MA 3I8SA 2NRZA 3NWPA 2VSYA 1Z38A 3PJFA 3AEYA 2AVDA 4MIYA 4QODA 4FGSA 4HTFB 2PLAA 1Z8HA 1FS5A 4LPKA 5JSKA 4UFOA 4H9GA 1M5UA 4PBSA 2WUVA 1IUKA 3RSZA 2Y1XA 1J2EA 1GP2A 4Q66C 1ZICA 4QZCA 2FE1A 3FKJA 5EJ6A 1T6YA 3AHJA 3L7AA 3ZQKA 1YJ8A 1U7ZA 3BRWA 3H4BA 3G0BA 3LQ2A 4EG1A 4MI6A 4FDTA 4LHVA 3IAXA 1CY1A 1YB2A 1RW4A 3NH9A 3ZD7A 4M9HA 3ND5A 1U3TA 2IPLA 2H4HA 2JFFA 3PGMA 2PSJA 4DOMA 4G5FA 1E9BA 1HQDA 1X7GA 4DUPA 4U02A 2H5JA 1QOQB 3WYDA 1WY7A 3C6BA 4MINA 4JV0A 3T35A 1ULBA 4DILA 2SHKA 1ENZA 2WFLA 2FSSA 2AQ8A 3DL2A 4KLQA 1E5XA 1Q3UA 3MHTA 2GHIA 3EVEA 4FJ0A 1E58A 3ILYA 3EUFA 2QP4A 3C6MA 4MS3A 3K35A 3CX7A 3P0JA 4MHSA 3EXHC 2QSJA 1IWPB 2CD9A 4UMDA 3RTBA 4ENRA 1KR5A 4BYGA 1MX9A 1KI3A 4K1XA 1R0CA 4IDQA 3E7PA 3OZ7A 4G5OA 4EK9A 2FU5C 1IZ8A 2VHWA 5A4JA 1OIXA 2KSOB 1SHZA 3KVOA 1BEZA 5MFPA 1R3DA 3WL7A 4LDNA 4GMGA 4ZCLA 4R69A 5LOVB 2HWYA 1K68A 3FWYA 3Q6NA 1TNDA 5I7VA 4BNVA 4YXFA 1QF9A 4DMRA 4RFSA 1A9XA 4NNPA 1B00A 4U63A 3GEPA 2PX0A 3OIFA 2JH1A 1C1DA 2HEGA 3DUWA 4BYMA 1ZL2A 1L9KA 4HUJA 3KQWA 1FB5A 4OI4A 3FLAA 5A3JA 1P0QA 4MIOA 1GA4A 2ADFA 4MRVA 3TZHA 1NC1A 3GT7A 3CLSD 4RLSA 5G5HA 1ZOOA 2AYZA 1OA0A 1NYTA 1T4MA 3ULKA 4ZRMA 1XWIA 3ZDBA 1KAQA 1RZUA 3HDTA 2OB1A 3P9SA 4UNIA 5C34B 2HWWA 4M86A 2I22A 1XALA 3AF6A 1K3FA 6LDHA 4RGQA 4TTRA 2WG2A 2QXYA 1NW5A 1C7EA 3SBDA 3CX6A 2NXJA 4UVIA 4O0MA 3KLPX 1H05A 5AJWA 3JYPA 4FR0A 5HIAA 1A4XA 1W8IA 2NTNA 4MV0A 1NZJA 2Z2JA 1N4AA 1CUWA 1UMDB 4WKGA 3BX1A 2H7XA 1IBCA 3KHGA 1NDHA 1KPGA 4Y2YA 2ZRPA 2WWRA 4BFVA 4GOXA 2IHVA 4YJGA 3PLRA 3G2OA 3LUBA 1D6MA 3ZS8A 5FOWA 1A72A 2G9RA 5LOVF 2BE7A 4GXQA 1X9GA 4HLUA 1IN6A 2DE0X 5LZ5A 3AUTA 1SL1A 1JHYA 3VH2A 1J23A 5DYWA 3Q11A 2A1TR 5CB1A 4WKPA 3DC2A 5EE1A 4Z7OB 4KQ1A 3CUKA 3GJ3A 5A4MS 4GMXA 1HNNA 2VP0A 5DHAA 4ZJYA 2X42A 1UK7A 4RIGA 5LIRA 2QQ5A 1F2TB 1LDYA 4KN6A 2EW8A 3H87A 3CLKA 1VHTA 2BFEA 3WLIA 1X3SA 5AYVA 1SKQA 3G85A 4N5MA 5E95A 2IEZA 4DLXA 5TS3A 2ON6A 1BSVA 2JEIA 2UYOA 1NSTA 1J8QA 2IEYA 1EVKA 1EIWA 3NV7A 3IP7A 4KXQA 1KARA 4EYOA 4YT8A 4KLOA 2YHBA 4QBTA 4F5ZA 1EVZA 1EP3B 4DA4A 3MUOA 2I29A 4HXEB 1Z33A 2N3ZA 5A7HA 1H2ZA 5ITZB 1WPXA 4B80A 2LUOA 5A2GA 1Z5WA 4TPKA 2O3TA 1GQQA 3T9AA 2FTKE 1BDIA 4AWBA 2Q4TA 4W82A 4MQEA 4EBDA 1LDBA 3SC4A 3KAKA 3TLCA 4IRCA 1GQRA 3KLBA 1YI8A 5AXDA 5HTOA 2WKSA 4N65A 2Q21A 3BJZA 4WLEA 1O87A 3PHLA 2PXAA 1G18A 4L74A 1FS6A 2RH8A 5BPFA 1HE4A 1FFEA 4B73A 1NXPA 2AGPA 3CF2A 3IEXA 4XTRA 3OHSX 4HGZA 3LG2A 4KMOA 1T8EA 2XUAA 5K0NA 4G9GA 1M8GA 1SIBE 2VDQB 3QW4B 3F9RA 4F2DA 1KYVA 1EFRA 1PZGA 3LQ1A 2F62A 3H6GA 2B37A 5FHRA 1F5SA 2ZRFA 3FMVA 2D5IA 1I7NA 2Q0XA 2ZYHA 2EFGA 2DXIA 4QJIA 1DOAA 4AZWA 2HMWA 4LX8A 3OESA 1R0XA 2IRWA 5BV8A 1CR0A 3RUPA 2X76A 5SY4A 2CLOB 4QIHA 3C5WP 1I2BA 3RYCA 3U56A 1RM5A 3DCNA 3WLQA 4GC6A 1BWQA 1GU1A 4L85A 3C8DA 3A1UA 3V8MA 4JN6B