3QU5A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp11asn mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
221
structure length
221
Chain Sequence
KLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 82
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu5A01
5ALVA 4UM7A 4JB3A 5AW2A 1RC8A 2IYEA 3D6JA 5AIAA 3L8FA 3MMZA 2B1QA 5ALRA 2G08A 2CN1A 5ALYA 3DV9A 3QU9A 4UMDA 3AR3A 4HGQA 4BX2A 2DQSA 5ALUA 5AVZA 5ALJA 1S8OA 1XVIA 4KNVA 5AW5A 1VJRA 2YJ3A 1WPGA 4Y2JA 1WZCA 1JUDA 4HYTA 4UATA 3WKCA 5A3RA 5ALGA 4Y2VA 4UARA 2W11A 4BKMA 4Y2YA 1Z4PX 3U19A 3NALA 4IFTA 2FPSA 3KOOA 4OHFA 4CF5A 1NRWA 2WM8A 4DW8A 3L8EA 2ODAA 4AS3A 4EX7A 3QU5A 3QUQA 2YN4A 2YJ4A 4HGOA 3P96A 5AI0A 3EF0A 3OTQA 4Y2XA 1RKVA 1NF2A 2GO7A 4OFZA 3FM9A 4O8CA 1IWOA 4NWIA 2O2XA 3E8MA 3WGVA 2G07A 3KDPA 4BNDA 3OPXA 1TA0A 4ZEVA 2P27A 3L1UA 4HGNA 2MSNA 3QUBA 5AI4A 2G06A 3W5BA 3NASA 2WF9A 2G0AA 2FPUA 2HF2A 1LTQA 3FGOA 3QGMA 4J03A 4J2TA 1ZRMA 2HOQA 1RMQA 5AVRA 2CFRA 2FUCA 2P9JA 2IOFK 2NO4A 4BYGA 2R8EA 5FP0A 1Z4KA 1TE2A 3QXGA 2I33A 1U7OA 4UU1A 1J97A 3I6BA 1ZD5A 4DFDA 1YS9A 3ZU6A 2AMYA 4XOUA 2B0CA 2MU1A 3EPRA 3MN1A 3RFUA 4I9FA 2G1AA 2WHEA 3WKEA 2PQ0A 2QYHA 1ZD2P 3B8EA 3HYCA 5IT4A 1CQZA 1L7MA 1Y8AA 5ALXA 3PGVA 4FE3A 3AR4A 4ZEWA 4NFLA 3UM9A 5IS2A 5AM4A 1Z4LA 3SD7A 2JARA 3ZWDA 2HHLA 3WK8A 3N1UA 4QJBA 2OA0A 3QYPA 5AM3A 5ALWA 3BWVA 4OCZA 5AHXA 2FUEA 4YGYA 3KD3A 3KZXA 5ALHA 3CZ4A 2HEGA 2ZBGA 4YCLA 2VKQA 3UMBA 4FFDA 3M9LA 3ONNA 4NAVA 1KYTA 4XE5A 2FPXA 4BX3A 1ZD3A 2P11A 2W43A 2G80A 3E81A 5AVTA 3PGLA 3AR8A 3L8GA 3N07A 1LVHA 1QQ7A 5AVXA 2R8XA 3ZVNA 2FEAA 3A1CA 3U7FB 3WKAA 1U7PA 3NANA 3U26A 2C88A 2AH5A 4KNWA 2YFYA 3A1EA 1L7NA 1Q92A 4Y2UA 2ZXEA 2YBDA 4FYPA 3DDHA 1L8LA 2RB5A 4XQ0A 1L7PA 1YNSA 5ALPA 1ZJJA 3TLMA 2B82A 3CNHA 2ZBDA 4G9BA 2B1RA 3A1DA 4BX0A 5ALZA 5ALSA 4UAUA 2RAVA 4DWOA 5AKZA 4UU0A 3FPBA 5ALFA 3J7TA 1N8NA 1O03A 5AW4A 1ZS9A 3EWIA 3AR7A 2CFSA 3QNMA 5AKIA 1RMTA 2RARA 1T9ZA 5ALMA 1L8OA 4YIHA 4Y2PA 3K1ZA 5IT0A 4EX6A 5ALLA 3QX7A 5JJBA 1N9KA 3ESQA 4L57A 3SKXA 2D2VA 2FPWA 1RLMA 3WK4A 5AIBA 1Q91A 5AI5A 2AUTA 4RETA 2ZG6A 2YMPA 4MWOA 4KYTA 3UMGA 2Q4TA 3I76A 2AGVA 2Q4RA 3IJ5A 4EEKA 3U7EB 1WVIA 1U2TA 1MH9A 4Y2RA 5ALEA 5AM1A 5AI6A 3AR6A 3OCXA 3QUTA 4NV0A 3UMCA 5ALNA 1ZRNA 3SF0A 2BDUA 2HDOA 1TJ4A 1Z88A 1K1EA 3ET4A 1YDFA 2JAWA 3U7HB 2BY4A 2I34A 2OYCA 1X42A 3ZX4A 1YJ5A 2IA5A 3L1VA 3N5KA 5AKXA 2YY6A 2B8JA 1RLTA 1F5SA 3QLEA 1T5TA 3U7GA 2JGAA 3ZTYA 2YMQA 2CFTA 5AK6A 3MPOA 1Z5UA 2WFAA 5AI8A 4YIKA 3MC1A 2ZBEA 3ZI4A 2B30A 3NAMA 4C4TA 1FEZA 3U13A 5AM2A 1XP5A 4PNHA 3I28A 3W5CA 2YJ6A 4EELA 1TJ5A 1RRCA 4UMEA 3L5KA 3GYGA 3ZX5A 3PDWA 4BBJA 3WGUA 3ZUPA 2Q5EA 4GXTA 3ED5A 5AVWA 3QU7A 2C8KA 3R9KA 4ZEXA 4QQFA 1EK1A 3SHQA 2YMMA 2GHTA 3SKYA 5AKEA 4F72A 4G63A 1RKQA 1RQLA 4UW9A 3I1YA 3F9RA 1SWVA 4HGRA 1YV9A 5AVQA 2HX1A 3RF6A 1S2OA 3NIWA 1L7OA 1Z4QA 3DNPA 2ZOSA 4XPZA 2EAUA 5AESA 3ZWKA 5AM0A 1Z4NA 2HSZA 2NO5A 2C8LA 3FZQA 5A3QA 4KN8A 3M1YA 2HF7A 4DCCA 3NUQA 1ZOLA 3FVVA 1PW5A 2JAOA 4UASA 1YMQA 3L8HA 5AICA 2GMWA 3SLRA 2YMLA 2MU2A 4NABA 2ZBFA 3ESRA 3QU2A 5AKKA 3WK9A 3N28A 2R8YA 2I55A 3WK5A 3AR2A 3WK7A 5ALDA 4BEWA 5AVVA 4F71A 2WF7A 3FPSA 2PKEA 2FDRA 3WKDA 5T41A 2HI0A 1J8DA 4CF4A 3KBBA 1CR6A 4Y2QA 4I9GA 2HO4A 4CF3A 3L0CA 1WR8A 5AW0A 4CNQA 1Z5GA 1RPZA 3E58A 3S6JA 2NYVA 2C9MA 1QQ6A 3OCVA 1SWWA 3E84A 1NNLA 1EK2A 4Y2SA 4E88A 3WKBA 3QU4A 4C4RA 4BNDB 5E0OA 4KX5A 4HGPA 3AR5A 4B6JA 1QH9A 2B8EA 4EENA 1U2SA 3ZW7A 1O08A 1RMYA 1XPJA 2IOHA 5AI9A 3IRUA 5AVYA 4GIBA 4RESA 2WF8A 5ALKA 3EF1A 3A3YA 3ET5A 3ZTWA 4AS2A 1Z4JA 5AW7A 4H1WA 2OM6A 2FI1A 5A3SA 5ALIA 2G09A 3ZVLA 5AK3A 1Z4OA 5AK5A 3VAYA 2HCFA 3B9RA 1Z4MA 5AKHA 2WF5A 2JAUA 5AM5A 3AR9A 4EZEA 1U02A 2QLTA 1AQ6A 3L0BA 4L6AA 1T5SA 3OCWA 2FPRA 4MUMA 3OCZA 4KX3A 3WK6A 2X4DA 1Z4IA 5AW3A 4YCMA 2GHQA 5AK4A 5AKYA 1ZD4A 3BA6A 3QUCA 5AKLA 2OBBA 3R4CA 1RDFA 2IOFA 2O9JA 3OCYA 2W4MA 5AVSA 3PCTA 3B9BA 4UM5A 4Y2TA 3ZVMA 2WF6A 4UAVA 1SU4A 3KC2A 2C4NA 2RBKA 4YCNA 1RQNA 4AP9A 5AW1A 2GFHA 5AKGA 1TJ3A 1RKUA 2BDEA 4HAIA 3HLTA 3IB6A 3R09A 1VFPA 4C4SA 3W5AA 2EATA 5ALQA 3SMVA 2P69A 4BEVA 3OCUA 2PR7A 5AW8A 3W5DA 5ALOA 3NRJA 5AW6A 4OD0A 4UMVA 1QYIA 3L0YA 5AKJA 5AW9A 5ALTA 2YJ5A 1L6RA 2EARA 4UMFA 4YH1A 3DAOA 2I6XA 5AVUA 2I7DA 4CE6A 3N8GA 4L6CA 2I54A 3L7YA 2R8ZA 4Y3UA 1VJ5A 4IG4A 4JDPA 1QQ5A 1RLOA
chains in the Genus database with same CATH superfamily
3AL0B 2HLDA 1ISSA 1Q14A 1HKUA 3PQEA 4IXNA 1RAIA 2AG0A 4EEZA 1NF3A 4CKZA 1FTNA 5KG6A 2W6NA 2O52A 3Q2KA 4B3BA 3IQZA 2DLDA 3MBYA 3L6CA 3DAFA 4UATA 1S0VA 1CB0A 4DF4A 3I34X 3U19A 2OZVA 4HNUA 1RI5A 1KFKB 4JV2A 2H92A 3QUSA 4KDFA 1ZK4A 4KFTA 1TD9A 3UAWA 1G6HA 1VG0B 5LA6B 4NAHA 4IOLA 5HRUA 4ZVPA 4EYEA 3R20A 1ND6A 4QEZA 2FZLA 3WIUA 3ADPA 1EX7A 2PWPA 3TI9A 3R3WA 1G8JA 3G2JA 1KK0A 3PITA 3RLFA 4C07A 1IL0A 3FETA 2R6FA 3RH5A 3OSPA 4ROTA 5JFOA 4KH1A 5ELLA 4GI7A 1VG9B 3BS4A 4C2TA 4LHWA 1JAZA 1LNSA 3IHWA 2QGZA 2W2NA 3AINA 3ILHA 4G9EA 4FOSA 4BFSA 4LXXA 1E1YA 1FX0A 1I33A 2PAFA 1T8PA 3TCNA 1K3TA 3HCCA 1L7EA 5EUBA 4ENRA 4XQ9A 3KR2A 5IMBA 2I7CA 5LOVA 4B4WA 3DDNA 3NVKI 5K0ZA 5AVKA 1Z5NA 4F45A 4FBUA 2XWPA 1FA9A 1ZOOA 1NDQA 3U7FB 4BJHB 4LWZA 4AYTA 1U8XX 1YZHA 2IXEA 3K32A 2LCIA 2AC4A 1F0YA 2KMLA 4TM7A 3ORRA 4LI0A 3IAS6 4ATNA 2P68A 4G1CA 4Q7MB 5IKMA 1R00A 1RS0A 1T8SA 1EJ6A 4G5OA 4MUXA 4F5RA 4FOPA 2H7YA 1KDHA 1CUCA 4ZN6A 4ER5A 1BWPA 3GJSA 3I76A 1H94A 3SMQA 1NU8A 4P5DA 2IY9A 2P6OA 1U49A 3OG9A 5KREA 3RUEA 2DVMA 3VBEA 2QVYX 1SCNE 1YJ5A 2W9CA 3CF4A 1FFVA 1JPUA 1JF8A 3PC3A 4FJ0A 5EL0A 2IXAA 4B3RB 1KDYA 3DZBA 1ZIPA 2C03A 2OOSA 1YB5A 3CLVA 2C2EA 4LDAA 1KVSA 4UNSA 1CY2A 3VR4A 1PCXA 3R0QA 4EVRA 4YRQA 4E08A 5M7EA 1MHTA 4NJEB 3RU2A 4ITVA 5PNTA 1ZQMA 3CF4G 1HKHA 1Z39A 4ZTBA 1U0SY 3N2GA 1JZTA 5K0LA 4YY3B 2JVIA 1XC9A 4F4JA 3WC4A 3H8JA 2K4EA 2NRZA 3DE1X 3DW3X 4EO4A 1WVGA 2Q1TA 3OE4A 3GCDA 3IG5A 1QLNA 1VMIA 2IU6A 4H4EA 1HE8B 2G0TA 1R4MB 5H7XA 4UB8U 2DAPA 2HU2A 5E6UB 1TAGA 2INGX 1L3IA 3E2EA 3MR5A 2BIFA 5I7HA 1G64A 5EIBD 1B76A 3AI2A 3H8WA 3C3JA 3ILXA 1W8DA 2B1GA 5KQPA 4LRWA 5TNXA 1KDZA 2H63A 1B3RA 3W3AD 3HK2A 3U7IA 4BJQA 4HQ6A 1WDMA 3EXFA 4Q47A 4EK9A 4DMLA 1GXSB 1ZGCA 2PMZC 4QBKA 3JALA 8ICIA 4G4GA 4RKYA 4PBTA 3CXUA 3LYUA 4XTRA 2VA2A 4K2HA 1XVTA 4HAVA 4WZBA 2NTVA 1V2HE 4N48A 2R8OA 3W2HA 2X15A 4HB3A 5DHTA 4RXTA 2X77A 1SQ0A 4YK7A 3C23A 3OICA 4I1OA 5KFJA 3EYWA 1AKMA 3L0YA 4OA5A 1F0NA 4M9XA 5AXAA 4LBWA 3I2KA 5EEGA 1PS9A 5LZ5A 1D6NA 4F4IA 3H0EA 2YW2A 3G0DA 2C2WA 4D9NA 3LECA 5BSEA 1XHEA 2BZ0A 1E7MA 5DFAA 2AOWA 2GS9A 3ZJ4A 1IM4A 3FTFA 1BX1A 2FW0A 4OF4A 1DADA 1EG7A 2CNBA 2ZT6A 2HFJA 1WW3A 1PJTA 2FX2A 2HZBA 2BEWA 2B9EA 4JWTA 5CWRA 1MT0A 1U65A 5CH8A 1EFPB 3NHMA 1ICEA 4ZU6X 3TD9A 2I3DA 2GX6A 4QYIB 1M2HA 4MB0A 2NVBA 2ZWVA 4YJ2A 1F6BA 3E8MA 1QQAA 3KDPA 8ICFA 4BWYA 3RVOA 1KWKA 1V3TA 2F48A 4CKBB 5L1KA 2NTYC 2PS3A 1UC5B 4WKBA 1PTJC 2P9HA 3DZIA 1YB7A 2P2LA 4E5UA 3CH5A 2FPPB 4HWOA 1Z0AA 3WTCA 4QARA 2VOJA 3H13A 3PHJA 2QYOA 3LPLA 1G60A 2AMYA 2WP0A 1CEXA 5DJ5A 1ZD2P 5AJUA 3IAM6 2Y0EA 4HAZA 4D7AA 3AY0A 5F73A 3HJNA 1V39A 1V7ZA 2DR3A 2BEUB 1Q0RA 5IVIA 3PDIB 4GYJA 2YZNA 5FUBA 1WB9A 3TQCA 2XYHA 4BWGA 4LZJA 3V1YA 1FOEB 5TX7A 4ZI5A 2EAMA 4D0NA 3IMCA 2FZCA 3D2BA 4N0MA 4XUGB 2GDJA 4H77A 1K88A 2NW6A 1XF1A 3VZQA 2PI4A 2G76A 4KI0A 2RAVA 5EVJA 3DZFA 4UU0A 2NRWA 5B2EA 5AOCA 1PR6A 3ITEA 4OQLA 1LJUA 2RKWA 3DR5A 3E48A 3GEMA 5I3CA 3BCSA 4QG3A 3T7EA 3QPUA 4B3TB 5E2IA 1T3SA 1SZCA 1GAQA 4H1VA 4ICIA 1R0XA 4R81A 3AQ4A 2WVJA 4JFRA 9ATCA 3GBPA 4R7GA 3EVAA 3D3QA 1SH7A 1EK6A 2V55B 3LQ1A 4YP9A 3WLIA 1M2OA 2FEXA 3OLZA 3N39C 1PGNA 4YRZA 2P1ZA 1SC9A 4NMWA 5AHKA 1NXPA 5B5EU 4U7HA 3S3TA 2JCXA 1EDZA 1T15A 1Q3TA 4O8ZA 2EDAA 3X2FA 4UDXX 2YHIB 4NZOA 2FFJA 3GIKA 3AUYA 5LP6A 1H4TA 2YZGA 1M2VA 1TW3A 4UBOA 2VJ5A 1NVFA 3D8SA 4II3A 1LVGA 4E13A 1IK4A 9ICUA 3QWBA 1W4LA 1YUNA 5KFSA 3DFIA 4OQPA 1E2EA 4ZI3A 1WXIA 5SY9A 1XK7A 2QJOA 1N5KA 3RIMA 1SVKA 1WR8A 1E32A 4L7QA 3KFXA 1C0EA 4LF5B 1ZQZA 3IXMA 4KCGA 3DL2A 3ZHCA 3W7AA 5L1IA 1ZU4A 1PNTA 1I0ZA 3MSCA 4MQLA 4G1VA 2PD3A 4ISBA 2GNOA 1Z2EA 4RLHA 4DZZA 2PUGA 3B9QA 3OF5A 1Z0KA 1FP6A 4HUTA 1M8JA 3PNMA 4ZYVA 4ZDIA 4X8OA 2K2QB 2MHCA 2AN4A 3TGWA 2VT7A 2FSIA 3WK6A 2Y0PA 4YWJA 3UBTA 1IE3A 4ZJPA 4DQQA 2BPCA 2MA1A 2E4XA 2AZ4A 2ADFA 3RYCA 1OKKD 4B35A 4N7BA 1U7DA 3L5OA 3KQUA 1DAMA 4RPJA 2JS7A 1D2HA 4BMDA 1VCOA 2NU8A 1I7PA 2J45A 4JI8B 4B87A 4XWAA 3NRJA 5B6IA 2L19A 4RA9B 1HORA 2EFDB 2PSDA 4UMFA 1GP2A 2RHGB 3Q6IA 3CN9A 1SVNA 2LE0A 4LC1A 1LW6E 4F4FA 1L3VA 4FZRA 4YJ3A 2Z2IA 5JCOA 3D3WA 3CRZA 4A91A 5J2GA 4P0QB 4CEHA 4XUDA 4PLHA 5H4HA 1YFLA 3JSAA 1CZRA 3TIVA 5KG3A 3GLVA 1NULA 1RIIA 4WK2B 1QBKC 2JEIA 5IHPA 2RDJA 2AHOA 4D9EA 3DB1A 1TMYA 5CAEB 5AFSA 1FVOA 1PR3A 1KE2A 3TCXB 3WLKX 1BX0A 1PJ2A 4HGOA 1AGNA 2GO7A 2Z2XA 2IZ1A 3E3AA 4OK6A 5LZ4A 4J4HA 5FV4A 1PYDA 4K2AA 3RVPA 2RHTA 3MGIA 2BSXA 3NDBB 3EPPA 3QGMA 4HDMB 1W0CA 1T4BA 1F0PA 3MFHA 4B6GA 1I0IA 2WU3A 4IEFB 4JOCA 3K2IA 2QTCA 2N1BA 2KVSA 2A88A 3IILA 4EG8A 1N61A 2MUTA 4LNUB 2XR1A 3RTCA 3LFTA 1YZQA 1YACA 2GKSA 4N3AA 2BFWA 4MP6A 3FPJA 5KFYA 5CHEA 3DWFA 3ELWA 1UT6A 4TXLA 4U2EA 5CB0A 5MN5A 1ZMXA 2A9VA 4QGFA 4IAOA 2H7CA 4RQ5A 5A62A 1JLKA 2KD1A 1JU9A 1L7NA 5IIOA 2QTRA 3E70C 1V11A 3NEPX 3PEVA 3HB5X 3LAWA 4NSNA 4DS5A 3QF4B 3RVLA 3JQ7B 1JHRA 1RXCA 3REQA 1ILWA 2JGDB 4CIDA 5FXMA 4Y2PA 5SZHB 2I8AA 3ESQA 3DEZA 4EY6A 1YVDA 1FX1A 4X60A 1OGJA 2DF4B 1IUKA 3LQFA 2D5BA 4P84A 3C5EA 1BDHA 2IPAB 2GTHA 2EHDA 5E2BA 4Z6KA 1X42A 7ICLA 4G0UA 4RUAA 4F0JA 3KQQA 2Y67A 1MC8A 5TIIA 5ADUS 1O89A 3ZJVA 4Q18A 4GMHA 3RS7A 1GG8A 1AUPA 2PUBA 3AI1A 1PDVA 1RJFA 3SKYA 1IJFA 2C2HA 3LZDA 3BL5A 1PVOA 3CT4A 4UBIA 2POQX 3NEYA 1IN6A 3WZ2A 2ZJ3A 1L5MA 3U7JA 2KM1A 1R4NB 3ZBPA 3KEQA 3O4HA 4IR7A 3ZN2A 4KLDA 5GQSA 1QFJA 4AJLA 1A5BB 5F1OA 1I80A 2I3BA 3ESRA 4EG4A 5CA0F 3KQOA 3MMXA 5IHXA 5CDHA 3O5AA 1DG9A 2QN7A 4NMXB 4LOHA 1O5OA 2QGNA 5DBFA 1MH1A 3PD1A 4UBBA 1L6IA 3PMNA 1SWWA 4HYYA 3ZNOA 1QAOA 1G5FA 3TAQA 1KMMA 2R8JA 1E79D 4UFNA 4P32A 3TSAA 5F35A 1HNNA 4HI0E 1PU2A 3NW9A 1WQ1R 2Y93A 4B6SA 4PSCA 2P4UA 1W25A 1T26A 2DPMA 1BZYA 2NXCA 2PX3A 5I9MA 1RRVA 2I1WA 2WPDD 3DJFA 1CUHA 4JENA 1GR1A 4C5BA 3I73A 1L7BA 1KJNA 3QE9Y 2FPRA 1JFRA 3THXB 4DV5B 2JEZA 1AGRA 5AP9A 3BHMA 4AZTA 3NTVA 4AZ0B 2ABWA 3CTMA 3TFRA 1K89A 1VE3A 3TSOA 1NZPA 1SQ6A 1BXKA 3GZNB 4WOJA 2H5EA 4MYSA 1CR1A 1ZD8A 5KHOC 5E4JA 3W5AA 1EVLA 2WUGA 3T3OA 2G4VA 2IBMA 2Y9PB 5HMMA 2VPIA 2YWEA 1MRNA 2WMNB 2X0DA 3RRGA 5JY6A 1PJCA 3F5FA 3HCRA 3BXZA 4DUGD 3HSYA 3KOUA 3JQPA 1Z5OA 4TMXA 4JLKA 2XGPA 2FVXA 1OKKA 1LB2B 3HKCA 5HOQA 5B1DA 4LBVA 4UNIA 3SDBA 2C59A 2ZWMA 3SLKA 5CVTA 5MGBA 1J0AA 5KYUA 3EQ7A 4O08A 4ZV9A 3UB2A 1TYEB 4PJ0U 4W5HA 1O97C 4IG9A 3Q3IA 1DV2A 2QRQA 4ZD6A 1TM2A 5C8ZA 1OILA 7ICSA 2JIOA 3VPHA 1FFGA 2ZJ7A 1M1YE 1E5QA 4BCBA 1G55A 2AFRA 3TBKA 1P7VA 3CNOA 2NU7A 4Y2XA 4HFMA 1RKVA 2P40A 4NDNE 1ZW6A 2XQGA 4RMIA 3DZCA 9MHTA 1V16B 4TYYA 1TW2A 5GONA 3SCZA 1K3UB 3P20A 3CUSA 3ZK7A 4TSFA 5A71A 1RM3A 4E07A 4L78A 2CNWA 3EGEA 4MINA 2YICA 4IXMA 3W6OA 4B5KA 1S4QA 4RE6A 3D43A 4R41A 4UQOA 4I9UA 1CLEA 2OC9A 3CEJA 4YHHB 1J00A 1N2HA 2DULA 1VJGA 2ZYIA 2LBPA 2B7BA 1UXGA 1Z6PA 4YGYA 4AO8A 3LGAA 5DK4A 4AP5A 5CDSA 5J0XA 2H65A 3ZJTA 5DWDA 1U7PA 4YAWA 4DRXA 2WAOA 5CXQA 1XTQA 1UM9B 4YJFA 2Q45A 3RFVA 4OU5A 4B9UA 2WFLA 2ZI6A 4PH5A 5DI9A 4IRUB 1P39A 4UZSA 4UAUA 3VNUA 5JVDB 4B4DA 1VKOA 1ZN8A 4DN6A 3NNDA 1J24A 2LD4A 3QNMA 3K94A 1FS6A 1K3FA 3BRSA 2HV8A 4X94A 4TXMA 5KPJA 2BFEB 4J9NA 4CRXA 5AI5A 2HOFA 4MWOA 3QW2A 4RY2A 1MZPA 1E1RA 3O4JA 1O94D 3DLPX 5AI6A 1KAQA 3M33A 4PSDA 4LC0A 4BO6A 2XCAA 1XQWA 2HCTA 3DLBA 4IH4A 1A8SA 1E2JA 4NP6A 4C4ZA 5BWLA 3ZXXA 3ELDA 1LQUA 3PQ3A 4RV5A 1OLSB 5IULC 4F5YA 4AI6A 4R8UB 2REOA 5G2OA 4GZ5A 3ZX5A 1KH1A 1YCGA 4G0NA 1WMFA 4B8ZA 1E0AA 4KMSA 2JEGA 1HYGA 2A58A 5KFCA 1IY1A 4Q05A 2AKEA 2B0JA 3R6WA 2WIKA 4DLWA 4L0CA 2OVFA 1GSOA 3K2BA 3TQOA 2JIPA 4Z9AA 4IHJB 5FYDA 5J2UB 1NN3A 4YNBA 4B7ZA 4ALKA 2QEQA 3WK9A 1IFXA 4FILA 1R9NA 2RH4A 2Y1GA 5JS8A 5EKSA 1X8KA 3NWOA 5LMCA 4JBGA 1K8YB 1JDSA 2QN1A 5JQGF 4V2IA 1X94A 1Y88A 1T9HA 1EFHA 1DIGA 3TADC 2FWJA 5SZJA 1KI4A 1U8CB 3MLAA 5JZMA 3BQMB 4H7EA 3DPUA 4DCJA 2XMGA 1TPZA 2R751 3CKMA 3C6XA 4E21A 3PSIA 4M6WB 3W8FA 4FYMA 4KWTA 1P7PA 1Y3DE 2NVOA 1MTOA 4PCAA 4DHEA 1MV5A 2WI8A 3RS8A 3CX6A 1Y8QB 3SZGA 1GVHA 3MBKA 1AQ6A 3PSFA 1E3WA 2OG1A 1J9EA 1Z0FA 3OCWA 1M10A 3L04A 3L49A 2VHJA 1Z4IA 5A5EA 1B3BA 1RE1A 1ZJ6A 4TS3A 2O54A 3OZWA 5KOHB 3RJMA 2IOFA 1CVIA 3A32A 1G8FA 1W4RA 3DPSA 2X41A 4LY0A 2VZ8A 1G41A 4L75A 1NBIA 2WHPA 3EIXA 1QDUA 3C3MA 4LPSA 4X90A 1Q7CA 1D8TA 1VFPA 2ODNA 4RKEA 2HK6A 3PKIA 5I48A 4HDCA 2JFQA 3VH3A 4LX0A 1YMUA 1TEVA 1NLMA 3JPRA 3FSGD 2H00A 3B0YA 3CR8A 3E03A 9ICOA 1WSAA 3R6DA 5ENZA 3OHPA 3IG8A 1AQYA 4KN5A 2JLBA 4ER0A 3Q0TA 2NTJA 5GIOE 5EEHA 2BELA 3P19A 3VNAA 1C9DB 1FYXA 4G0PA 4GW3A 4DA4A 4OU4A 2PGOA 3UXNA 4CWAA 3JARA 2BTQB 1DKPA 3K75D 2WM8A 3Q8SB 3BHJA 4IGFA 3B9JA 4GLBA 1CP3A 5DX0A 2CHFA 4BTEA 4QT4A 4G01B 4XWTA 3E8XA 3A9VA 2Q9UA 3HBNA 3OUZA 3C8MA 4M0UA 4KLAA 1V25A 1E61A 1Z68A 2HF2A 4YAFA 4JT4A 1SVSA 1RMQA 1W75A 1ZQEA 2REXB 2EOAA 3B2NA 1U2RA 4UU1A 4HXYA 3IQGX 1Y3FE 4RQBA 1UF9A 3NI2A 1OBOA 1YE5A 4U7JA 4DGQA 2H06A 4R2XA 4EHHA 2Y9TA 1TK9A 4CLOA 3U4CA 2G1AA 4MKZA 2WD7B 2AFHB 5JZOA 3J81k 3ILVA 4PYLA 4TTRA 4E94A 3SV4A 2BOVA 2FN4A 4Q9HA 4ARBA 3HDGA 2ZBGA 1TPYA 3L9WA 2WM2A 1Q2XA 5I8ZA 4BEJA 4FEEA 3E81A 3GJZA 3DMNA 3H84A 2BGIA 1LVHA 5TQ2A 3MF4A 1GGFA 4XUSA 4YRLA 4FQ8A 1PEDA 5K3AA 3KXPA 2HSGA 1MVLA 4KR9A 4XQ0A 1YC5A 4NYIR 4P4TA 1UBHS 3RCBA 1T91A 3HMQA 1FXSA 4PQGA 3IS3A 3USCS 2GK7A 3EC1A 1ZQNA 4CKEB 1Q3KA 2Y4OA 3KBOA 2CDCA 1PFYA 5DT9A 4QEKA 2HBLA 1Z1VA 3RU7A 1C1YA 1XLTC 8ICQA 3INTA 4RJIA 5K4AA 1XEXB 4DC1A 1TC2A 4I55A 5DI3B 2X5KO 3FFTA 4B7CA 2BFCB 5HG0A 5LJLA 4HFRA 3TJZA 5KOYA 1JFLA 2IT1A 2G17A 1ZQSA 5JZSA 1RLTA 2YNMD 3QPAA 2C94A 2IXTA 1QIJA 2A2ZA 3SYZA 2XQIA 1NR5A 4PXSA 3CSUA 4R9UC 1KY3A 3N5CA 3BILA 3QXCA 4F6CA 4YMOA 1ZMRA 5DOVA 1H85A 2DFNA 3LVWA 2QU7A 4LWQA 5EJ8A 1XYVA 2FPMA 4H9GA 5EWFA 1RQLA 5JJLA 1DRVA 3ETEA 1P1IA 5GIPE 1O54A 3K9BA 5ED0A 2ZJ5A 5NULA 3TEMA 6NULA 3EDQA 1EQAA 4QWDA 3FZQA 3HNPA 5MN6A 5BT9A 1XD9A 4RELA 4X92A 2XUOA 4GOKA 3WISA 4HK4A 5KFGA 2CD7A 2J0EA 3ACDA 2JBHA 4Z1MD 3RSGA 2HO4A 3LRXA 2RB4A 3FDFA 4NCIA 1X0XA 2NYVA 2C9MA 2XZPA 1L5YA 3FMVA 1V5IA 3G6KA 3LPNA 3BXHA 1RBQA 5DBIA 3ETDA 1KN5A 3SC3A 3EIEA 3W9SA 2Q62A 2Q5JA 3KZCA 4UPEA 3FH0A 4R9RA 4KWHA 3KRTA 2ZRKA 2IMWP 3K8OE 1GL9B 2WWFA 4J6EA 5J2TA 3UTDA 3CP8A 5JRDS 3IT3A 5CLGA 3WIEA 3KB8A 3G9XA 1GA1A 1U02A 1VKJA 5G4LA 3A4NA 1HT1E 1J1UA 1SHZA 4YJHA 4YMNA 2HTEA 3HXTA 1I4OA 1M2EA 3VHRA 2ODQA 2NACA 4RTQA 4KXNA 4YLGA 1ENYA 3QELA 4Y6PA 1NP6A 3MINB 2FR8C 2WDZA 3EVNA 5F23A 2QYSA 4I5IA 5K8JB 5C80A 3KQHA 1K08A 1H2AS 3U4QA 1DQRA 3UT5B 4F97A 3QVJA 3QBTA 5JU5A 2EL9A 2PLAA 4A8JA 5JTIA 2V1XA 4EDFA 3AETB 2AFVA 4GRAA 3DHNA 5BW6B 1X0VA 5BR7A 4HDQB 2Z58A 3ISDA 2X7JA 4BQSA 2JGNA 2HIMA 2FZ5A 3N74A 1ULHA 3GUUA 4KDCA 4YAIA 2NLOA 2PK3A 2FK7A 4MX8A 3X1YA 4Q9KA 4GPTA 4KODA 2Y1KA 4YUXA 3KHHA 4FCTA 2JF0A 2V45A 2WSMA 1QKIA 5CGZA 2VRBA 1XKQA 5C34B 4I4TF 1ETUA 2MMCA 3VR5D 5IC5A 5K01A 4OFZA 4O3RA 2OEPA 5JRTA 4HB2A 3SYNA 1AQJA 1Z6YA 3B3AA 1E3EA 4MDYA 1NVDA 1I3CA 4RH0A 3QUBA 4EBCA 1YOVB 2G67A 2HUNA 1J56A 1YK0A 2FPUA 2O2EA 3LFHA 4WKNA 1XSLA 4M89A 2QXYA 4ZDJA 5FP0A 4FC7A 3LC2O 4NG4A 3R7SA 1XMJA 3DXFA 3KXLA 4RDIA 3VC8A 4GBMA 1GCGA 3M83A 4DMMA 5IH7A 2FUG6 2BZFA 1JG2A 4DQVA 3JWPA 1ZOPA 3BIFA 2V58A 3YASA 3FCXA 2JIZA 5CG1A 3ZV5A 1AZTA 1W47A 3U9SA 3CPSA 4PX5A 8MHTA 4HX5A 2YFYA 4FYYA 4UNNA 5TMDA 4KGXA 4BV8A 4W9MC 4WEOA 1IU9A 4LAFA 1D2AA 4N0EA 4WY5A 2OCDA 2JFZA 2YZMA 1O03A 2QW1A 1ZA1A 1PUZA 1X7ZB 4DL5A 4MDHA 4D43A 4HXFB 1UA0A 5H3HA 3PGKA 4PSAA 1OUMA 4M7WA 2GI4A 4HDOB 3KUXA 2XT6A 1ZGGA 3AVYA 2WD8A 1U2EA 4YMUA 1MA7A 3WLPA 5IDQA 1VP3A 2HV9A 2L42A 3GF4A 1Z35A 4IDGA 1O95A 1TLFA 5M2QA 1BEEA 4C0XA 2UYOA 4PZEA 1RQPA 5KL1B 3AYZB 2VUSA 5CIWA 2ZUVA 2CGEA 2QVGA 2VK8A 4BXOB 5C8DA 2VWGA 1K68A 2NV3A 3AUTA 2HLDD 3MXOA 1U0NA 2QDKA 1A9ZA 1K5DA 3F9RA 3KOYA 4HWTA 2OFPA 1S2OA 1M0TA 1XSNA 4QATA 2FB9A 4E30A 1G5QA 1MF7A 1OVMA 2K89A 3A3NA 1T2VA 3GEGA 2W9AA 1RT9A 1AXEA 3DLTA 3G8BA 1Q1EA 4UU8A 3U7QB 5DU2A 3CW9A 4N49A 2AI1A 5CXSA 4JB8A 4XR9A 2AOTA 4D3ZA 1C3XA 1ZESA 1OCEA 1KZYC 1GHTA 1QHIA 1KE1A 1QF6A 1X9IA 2EX0A 1YQTA 3CH7A 3RYTC 2QS9A 1QQ6A 3OX1A 3P7MA 4V0LA 1SBQA 2WU1A 2HJRA 3DFMA 3PJEA 3B6ZA 2RGCA 5K8TA 2FPGB 2CFCA 4G4JA 3KPUA 1JT2A 5AVYA 4RESA 2XUIA 4E5MA 2WF8A 4PLYA 2A3NA 1QG2A 1ONOA 4ZTUB 1FU8A 2MR5A 4I1SA 1U47A 4P7JA 3RYIA 4FZLA 4PWZA 5TPWB 5REQB 1DT5A 2YHAA 3U5ZB 1Q12A 4JLSA 4RE5A 3MOIA 4P3XA 2FWBA 4BMYA 3K31A 3K73O 2QE7A 4PPFA 5CEEA 3G2NA 3MFQA 3AM4A 3CG4A 3MMPA 2XMDA 3OLXA 3PCTA 3FGPA 3CRXA 5BYBA 2RBKA 1XTTA 1OZFA 3AF0A 1E3QA 1N56A 2H54A 1I2MA 3U16A 3GUZA 5LNK1 3HUDA 3L7NA 1A8HA 4FZVA 4NZMA 3HCOA 4FWBA 4BMXA 4NHOA 3V4VB 3BPSA 5FBWB 1UBNA 2BW0A 3QWIA 4R2KA 5I6DA 1T2CA 5J2IA 1H9BA 2HA4A 5TS2A 2OESA 3ISJA 1EVEA 3MCAA 1S10A 4O3PA 4ND5A 4OP1A 1JSZA 4LZGA 3EPGA 2IHTA 2GEDA 4L4RA 4FBTA 4CR7A 4AP6A 2EJTA 3I3SR 5AUPB 1K5PA 4IO1A 3ZWAA 2X40A 4HG2A 4HNGA 5CH3A 2ZRDA 2R84A 3ESCA 2IRWA 4R84A 2P79A 1NIJA 4AQ7A 2OSVA 2OCPA 4W6ZA 1BU8A 3D7SA 3QENA 3D0QA 2VJLA 4BQQA 1ZJNA 5A0FA 1ACLA 5JC8A 4K9KA 2PUVA 2Y1WA 4ID9A 1XTPA 5FADA 1HEUA 1X1CA 3VR4D 4E6EA 4MUGA 1SUSA 5FHRA 1WSBA 5EG5A 4G81A 3ESDA 9ICQA 4TN5A 3W3ZB 3OLYA 4GRDA 1FUYB 1BC5A 4R71A 5JI3E 5ICMA 2W6ZA 3TO5A 3VR5A 4ZEWA 4E51A 5AM4A 2C4HA 4LSWA 4KQ1A 3IPCA 5H2FU 3KD3A 5BUQA 1B6SA 1W4AA 4QBGB 3MIZA 4LISA 1SAYA 2FFRA 3THWA 4U0JA 3D0KA 2V65A 3NB0A 5SZIA 2UVRA 1HZZC 3O90A 1J09A 4LMBA 1DO2A 4OEHA 1Z63A 3A6PC 5IASA 2DM6A 3OJLA 3DOHA 2WWTA 1X80B 2UVVA 4QVIA 5EMLA 4UTOA 1NJYA 3R5SA 4JKOA 3DEJA 2CL7X 2V03A 1QVVA 3GLGB 4HDRA 4FMCB 4U7WA 1C9YA 1PLLA 4BWMA 1X7WB 1UPXA 2JHDA 3WWZA 4D4HA 4NH0A 3R7BA 1RZUA 2F3QA 5A9SA 3RSZA 3VKGA 3IE0A 5A5DA 1K1EA 5KMGA 1Y1TA 1T36B 2ONYA 3IUJA 1M5UA 4DAEA 5K03A 5HF6A 2FG5A 4ALJA 1EIZA 2NQTA 4XSHA 2ROQA 4YIKA 1GQ2A 4KLEA 3VVLA 2X6TA 1IDOA 1WUDA 3QVGA 4M1EA 2HPZA 5FAKA 4X63A 2PFKA 2XA9A 4MWDA 3RJZA 5I7WA 1NJFA 3ROGA 2DH6A 5AVQA 1EFCA 2O5CA 2ZWAA 2F2AB 2ZOSA 3O3NB 3A9SA 4RDHA 3FJYA 1QRDA 2RK6A 2BPGA 4AECA 3KKLA 1GZ7A 1JAHA 2OT3B 5FBHA 2PV0A 4QZCA 4M22A 4GZ3A 3DTTA 1TO6A 2YIVX 4HR7A 3UJAA 4BEWA 1FF9A 5HCUA 4MVJE 1WXHA 4X65B 3AHJA 3A70A 4MW4A 1WETA 2AOUA 3C39A 3IBTA 2D6FA 1C3OA 1USKA 2C42A 5T4BA 2IU4A 3GJ5A 2Z5VA 3C1OA 3TSYA 3ZU4A 4G4SO 5A9RA 3WBFA 4UAYA 1I6MA 1BMFA 5K8VA 3OF3A 5EXXA 4A2QA 3DMTC 3KR0A 1O4VA 1XJQA 1YS2X 5EWEA 5HIMA 3JQ9A 1LPPA 5AK5A 4OI4A 2G1JA 2ZATA 1E4EA 2ZVDA 4EZEA 4ZREA 2WKRA 4J9VA 2RLTA 3HBLA 4J9SA 2OV4A 2XMBA 3UAGA 3FAHA 2A5YB 3D7MA 2Y1IA 4TKMA 5T67A 1F51E 3I1JA 2J3EA 3KJFA 2P6PA 3T7JA 2AD1A 2HT6A 3MEQA 3DP7A 3QKIA 1RWVA 3LDGA 1L7RA 1G21E 2E49A 2IYFA 2V5AA 4JJ6A 2R8PA 3DL4A 4PG4A 1PK3A 4X41A 4KJZA 1TB4A 1QH8A 3WP1B 5HK8A 1EAMA 4LF4B 1KYWA 1V4NA 3DMHA 3PLRA 2QAGB 3CEMA 2ZULA 4LE0A 2IYEA 4KPGA 1NR1A 4QQKA 4TMWA 5ULLA 1S3SA 4ZQBA 1USVA 3M49A 4KGZA 2ZSJA 1ZK0A 4RY8A 3BEOA 3S2FA 4E15A 1LD3A 3NV7A 2WTFA 1T1JA 1JDUA 4ZVMA 2OO7A 2P67A 4N3NA 4Q02A 1Z9BA 1FRNA 2C61A 3EF0A 3Q10A 1AKYA 4H1UA 4JJFA 5ECDA 1H5UA 3VJRA 1L3CA 4DL6A 3B20A 5K45A 1CUFA 3B70A 2ZRMA 1D9DA 3CW2A 1UKEA 2VTDA 2DPJA 3O1LA 3QITA 2C7GA 5IYZA 2WABA 4F2GA 3D4BA 5D6OA 2I4OA 4WN9A 4KE7A 3NS1A 2FUNB 3VPCA 1RYYA 3DF7A 2UZ0A 4E2YA 2WA1A 3ZV6A 4S2EA 3LHDA 4PIMA 4W5QA 2HMVA 3KQSA 1NI5A 4IUYA 3Q5DA 4MVXA 1LJLA 4C6RA 4KPYA 1TQHA 3D7LA 2R6HA 1C81A 3RREA 3ROQA 1ONPA 3J81A 1JNYA 4INAA 1QGUA 3M6AA 2G9QA 2YBDA 5DBAA 2J9FA 4PFQA 4ZV7A 2GZSA 4KSBA 3RKRA 3NEAA 3H9EO 1Z2DA 5DISB 2PGJA 2QIPA 4QREA 4YCDA 2H9AA 3DGEC 3A7EA 4AIIA 1ZCJA 2GERA 4LJ9A 4KO8A 5K5EA 2R0QC 3BWCA 4QRDA 1LJ8A 3AUXA 4B79A 2ZJBA 3M9MB 4D97A 2WJYA 2LKCA 1V7PC 1AMNA 4IXDA 3PK0A 1FRVA 3F3YA 4NENA 2BY4A 1JN0A 4L15A 2QTWB 2B8JA 3QLEA 5LQCA 1DEAA 1DOQA 3VR1A 2R1ZA 3UGJA 2WPNA 2W2VA 1LBTA 5GVRA 4Q24A 3A4MA 3IQEA 3TZEA 2Y4NA 1DT3A 5IXSA 1JSRA 1X9WA 5GOTA 4X45A 5CEJA 1PGJA 1JKIA 2XY4A 4P36A 5TEVA 1LKZA 2GF9A 1OWPA 3L4SO 1RIFA 5HVNA 2V7VA 1N62A 1BQ3A 4ZYLA 3N8NA 2ZM5A 3IEUA 1RHKA 2Q6OA 3F2IA 1G8AA 2FWPA 5BYAA 1I5EA 4TKZA 4L74A 3RAEC 2D00A 2ZTVA 1IEQA 3RTBA 4F9EA 4US8A 2DPYA 3VCBA 4TWJA 3LE8A 4YYZA 1UJBA 4OQZA 2PZAA 2VJMB 3QKUA 1O2DA 1DRJA 3WGGA 1FMLA 1VSBA 5KFIA 5KKAA 4N5DA 3FZYA 3OCVA 4PZNA 2VDMB 4M04A 4LEIA 4R1UA 3V48A 1UAGA 1XCMA 1I51A 2O4CA 4US9A 4OJKA 1VE1A 1W19A 3VC3A 3H4TA 2PGLA 3UCEA 5BNWA 3BTUA 4IRKA 4Y9TA 1AUXA 2NO9A 4D0RA 1L2TA 3JQBA 3D4NA 2VP0A 1XRQA 3AU9A 1GR0A 4BZQA 1XWFA 3AFOA 4C78A 2B2CA 3STVA 1G42A 1K7YA 4K9RA 3CF2A 3GUHA 3WGZA 4LFAB 1KEEA 4GPIB 1ZQYA 2YJNA 3NRBA 3Q15C 4HQFA 4BTVA 4G1UC 5F9FA 4RJTA 3WLJA 5JXGA 3E7DA 2Y6VA 2ZETA 3V1MA 2DY0A 4BYMA 3DHEA 3H6KA 4CCYA 3CRRA 3OI7A 1PT6A 1FJGB 1R0SA 2VP6A 2YWXA 3BWXA 5BUSA 4BEVA 4YV1A 2GEKA 2AQHA 4FVTA 2YIJA 3GBVA 3U60B 2X1LA 3WAGA 4EPXA 4AF7A 1UKBA 2YJ5A 3LSYA 5BP7A 2C4MA 2V59A 1N5MA 3OGUA 3UHJA 4MWGA 5FNVA 8OHMA 1NUSA 5H0IA 2HMUA 1KI2A 2WUDA 3D6NB 3IB3A 4N3GA 2Q1YA 1CULC 4MV4A 3LO8A 1CRXA 1WZCA 4OX9B 3UA4A 2H2AA 3LG2A 1W48A 2W11A 4NLCA 5FIUA 4RF2A 2ZEJA 3Q8PB 1M2NA 1HTTA 1RJ9A 3AG5A 3QU5A 3PNLA 4QM6A 1CFJA 5KQGA 4S1VA 4AURA 3DBVO 4P3OA 4DIMA 2O7NA 1ZD9A 2A1TS 4YAGA 5KVVA 1ISFA 3WLLA 4DLXA 4NK4A 3HXMA 3GROA 1T6XA 2PWYA 2HOQA 4AC9A 1BXZA 5E6SB 5CJ2A 1ZITA 1A6SA 5E9AA 2ZB7A 5LQRA 1Y8RB 5EI5A 4UTZA 1WY5A 2XGQA 4GH5A 2BCJQ 4Z7QB 2X42A 2F8SA 1X1RA 4FS8A 4O3NA 3BDAA 1LPOA 3NPMA 3IDFA 4QIWF 1IXRA 2Z08A 1JHZA 4WKCA 4ZKDA 4DLKA 2MYPA 4S3MA 4DV0B 3P94A 2MR6A 1G2IA 3NHKA 4QGBA 5H16A 3GVCA 1P4SA 3EBOA 3C6YA 3WVNA 4DHWA 1Z7WA 3VZBA 2QRVB 3AB7A 1WWKA 3V7KA 3GZTB 2YB4A 2X19A 1IQPA 3NANA 4H17A 4BOYA 1NSTA 4ZIRA 2PCJA 4AWBA 4ZK2A 3PJGA 2CHUA 2WIJA 4UREA 3L7IA 1TC1A 3IKTA 3BZUA 5ALZA 2J85A 1BEZA 1MEEA 2J4CA 4NOKA 3THRA 5CNJA 2W9BB 3VOTA 3LLVA 1FDSA 3Q7SA 1TJYA 1ZQVA 2OYSA 2XE8A 5KZMB 3GT0A 1RCTE 4U7FA 4AKHA 1EDBA 2CCGA 3RHFA 1A4XA 5ITZA 2ZTMA 4M54A 3HWWA 1BYIA 3JAMA 1N2CE 3IV7A 5FOSA 3SIPA 4EJFA 3GZ4A 2RHOA 4CUKA 2N1MA 4GP6A 2RGAA 1EX6A 3OJXA 1D6MA 3ONEA 4C43A 5TE9A 3NAMA 5JAPA 3BJRA 3N7PD 4MQBA 5FKJA 2VHYA 4XX1A 3G8YA 3JPWA 4FOLA 4W8OA 1VPEA 4NEHB 3TUJC 5DB8A 2ATLA 2QMEA 5FDFA 3NS7A 4LRQA 1T2UA 5HDQA 2DQ4A 4DLYA 1MJGM 7ICRA 1VCHA 2E9SA 2O3SA 4DSEA 2C7VA 2P5SA 1N9GA 2CRXA 2H59A 3NUQA 3ZW8A 1M0SA 1VGRA 1NP7A 5B5SA 5C5CA 4BZPA 1ESCA 5KWVA 2D2IA 4MEBA 1Y3HA 2NADA 4OGLA 1RJEA 1JHVA 5EGNA 3TLXA 1PFKA 4O3MA 2PWBA 3QVSA 1SHLA 2PXIA 3HKBB 1DGSA 3CVJA 4R1QA 4O3OA 4ZOLA 1SIUA 1FTYA 1PJ8A 5LKRA 1RRGA 4DVJA 4TSFD 4LJ5A 1ZN9A 3GGSA 3VJMA 2CNWD 3ZKWA 2YN0A 3H5LA 3E15A 3LUBA 2AQ0A 1ZQ1A 4WIAA 5EP1A 3CVVA 4IWNA 4QTUB 2RHMA 5FPKA 1S89A 3E35A 3OAAA 4J29A 5E3JA 2BMFA 4UEJA 4TKVB 2VPXA 3A9CA 5B58T 3RGWS 3LIPA 4DANA 3BJEA 5A3JA 5BMVF 4CQLA 4JODA 4RENA 4EFKA 4Y2TA 1MOQA 1B23P 1UJNA 4L5YA 3IP1A 2MSWA 5A5FA 1WOYA 1YJCA 4OPMA 2YV5A 1LEHA 1I3KA 5DGCA 2VRCA 3DQZA 3DOOA 4MRPA 2OFXA 3N76A 3WQRA 1YL5A 2A9QA 4B85A 3ILSA 2WYHA 1DOHA 3EC2A 1P4AA 3H5IA 3ILYA 4U9UA 1MEJA 4XLZA 4M9HA 1L4HA 4R3WA 5GZ3A 2AG5A 3RYFA 3V6MA 1KYIA 1W4CA 4H35A 1E1RD 5JXHA 4DR6B 2OB1A 2QJRA 4TUQA 3A26A 3O6VA 4A27A 4BX2A 1GZVA 4B73A 5FWYA 1SELA 1DIRA 4URYR 2RAPA 4JI7B 2VXCA 1U4SA 2O59A 1STOA 2FPSA 3T5AA 3EXHB 4MUEA 1RBYA 3AYXB 2F1HA 5EQTA 4EB8A 4QAJA 3QJGA 5HQ3A 1RPTA 4I4IA 1L7VC 1NRIA 1WBBA 1DKUA 1PJBA 5HKKA 3LOQA 3KTDA 3C41J 3W2EA 4KUGA 5M04A 2Y1DA 2PQ6A 3DZDA 1VIMA 2HL6A 1QG0A 4RANA 3NASA 4ZRDA 4QULA 1GQSA 4NMMA 3RAFC 4KLFA 3LKBA 1JXLA 2K8AA 4WH0A 3K70B 4YMTA 1DIAA 3Q3JB 5KG7A 3A9TA 4ZO4A 4EKDA 4DFMA 3RSOA 2JW5A 4FE3A 5EJ9A 3EMKA 4Q7LA 2DEUA 1Y7IA 4P2HA 2YDYA 1JEQB 1ZBDA 4TYNA 5HE8A 5FI5A 3R9WA 1WNFA 4M1SA 3FVQA 1EJBA 4P4PA 4UFPA 3BXXA 1KP9A 4BE9A 3DBHA 3R7LA 3A28A 1KYXA 4QL3A 1KPHA 1AV7A 4ZO8A 4UBCA 4Q4AB 1Z5WA 4E1BA 2WQ7A 3A1EA 5HEKA 3UEOA 5K0TA 1OH6A 2C92A 1G3MA 2A0KA 3P2MA 3ECSA 3FWPA 1ODTC 2FN8A 4C2UA 2FLWA 3SZUA 1PDOA 2CFSA 2I7TA 3LX5A 3U6BA 1P18A 2QM8A 4H4CA 1B8NA 2H3IA 2YX8A 3E7PA 2HU5A 4LVSA 4KQIA 3K9QO 4H7FA 2V9ZA 1WUJS 3M82A 1RZRD 1CEYA 4I2HA 2XQJA 4DUZB 2X2EA 2GEFA 2VK4A 4W99A 4IGKA 2CXSA 4GXKA 4AWXA 4RH1A 4P2GA 3BMOA 1IWBB 5KJFA 1QTRA 2ISCA 1GDHA 4B4KA 2A67A 4Y1RB 3UUFA 5J0OA 5AM2A 3NQ41 4MA0A 3U44B 8ICPA 4C3VA 1QR6A 1I7SB 4W9NC 2CLLB 3KHTA 3F6SA 3OC0A 2GHTA 1AA6A 1Z2PX 4RAOA 1KBZA 5E4FA 1IZ8A 3RTVA 2WKWA 1AOXA 3TBFA 4HBZA 1FLDA 3IQFA 3M9WA 3H97A 4H3SA 1LTKA 4CW7A 4TTQA 1P7WA 3K9LA 2IXBA 3A9WA 4KFSA 4Q66C 3R24A 3ABRB 1Y89A 1WXQA 1KRXA 5CHGA 2J6HA 4DG5A 3U39A 5K8CA 1LRKA 3DO6A 2JJ1A 4MKIA 3KTAB 2HI0A 1J7KA 3O8LA 4QUJA 2J09A 4OHUA 1U48A 5I7VA 2YBEA 2X1HA 3O75A 4IIJB 5DYGA 1DK3A 3INYA 1QKKA 3P5SA 5H9WA 2FN7A 1SUDA 2FF7A 1GT91 1WCLA 3EZFA 5D00A 3EUB2 1CZUA 4DJTA 2BKAA 3ICEA 3KLOA 1MB3A 2W7OA 1MJFA 4LE1A 5D51S 4KR3A 4OFBA 4L08A 3GVPA 5C35A 4F21A 4PZCA 4BNVA 2WTXA 3KPJA 1U90A 3MQFA 3B1YA 1LLUA 3T3DA 3DHWC 8ICVA 5AM5A 3S0JA 1O6GA 2PSFA 1KY4A 1KY2A 3I9LA 1E3IA 1XN1A 5EZYB 4G8DA 4QZVA 3CNBA 3ONFA 1IAVA 1NY6A 1HEKA 2DHDA 3OT1B 5F2EA 3W5VA 4TUYB 3N2KB 2AQ8A 1P0FA 2A6PA 3B1FA 2IGTA 1F5NA 4REQB 1VL5A 2GYYA 3GT7A 5M29A 2X2FA 3HVIA 2M98A 3MZ0A 3D6JA 5DX8A 5KNDA 3NTRA 4OLFA 4FFSA 5DWVA 2YRXA 5ESRA 3FOBA 4G6ZA 1N0HA 1DJQA 2VYCA 5I51A 1PK7A 3DC2A 3RT9A 4BQOA 4Y2JA 3H18A 3OZXA 4RIEA 4QGHA 4UARA 3L9XA 1SXJB 2XITA 3CEPB 4PY2A 4IFTA 5HCNA 1A8IA 4RGQA 2I87A 2PFSA 2NUAB 3QWHA 1M1YB 2D1RA 4Y6OA 3EPLA 2IYOA 1T2FA 1VP9A 1W44A 1DC4A 4RNOA 3IKMB 1JB9A 1ZQDA 2DPLA 3WGVA 3AHFA 2MDTA 4KYUA 1US8B 4WECA 4UUAA 3DE7X 2QY6A 4BMSA 1QFYA 1HJPA 3EVGA 3OTIA 2EF1A 2QD2A 3COVA 4US0R 1YUMA 1EB9A 3PUVA 3QXGA 1I2CA 4B6RA 1LDNA 3C7KA 1KBQA 4FD2A 1HG1A 1RJDA 1VE6A 1SC4A 4OHBA 4WGFA 4ENTA 1XNQB 1PLKA 3JVVA 2KNJA 3PC4A 5ALWA 1TKDA 5JMOA 1NXOA 3PDHA 5AO9A 5EINA 3TB6A 4YXWA 3HBFA 2AZTA 1N5OX 5LPNA 4ED6A 4LMRA 3FWKA 1Z2NX 4J2OA 1SV4A 5ILGA 3VHQA 1Z0DA 3CSDA 1C1XA 2FMIA 4KU4A 4ALLA 3U0VA 4UTPA 2ES4A 4R2JA 2JH1A 4L0QA 3PWSA 4ZAZA 2VYFA 3H1EA 4HATA 4DNXA 3VR6H 3VDXA 1ACJA 3GLFE 3UAZA 3IQHX 3FHCB 4EX6A 2WVAA 4L57A 2YCBA 3DG9A 4QDOA 4BNIA 1W581 5DM0A 3GFOA 4C21A 1GPJA 4D4LA 2PQ2A 1E1KA 1NK5A 3W8DA 2A1TR 2DFVA 5LB2A 4L07A 1JE0A 2Y0SC 4F85A 1JQKA 2WILA 5HZHA 5J8YC 2CVFA 3Q7TA 3U6KA 4E5VA 3HA2A 3INRA 5HILA 4DMRA 5HTKA 2C7QA 3G9QA 5GPBA 3F5EA 2Y8EA 4F72A 1RZRA 1II9A 4ARAA 3K5PA 1QRRA 2XCSB 1PYOA 2WWWA 2I6FA 1P0MA 4AKIA 4P93A 3E82A 1L4MA 5AMXA 5IKEA 4WZZA 2CFIA 3VZRA 4R1TA 4OJ5A 3IPYA 3UO8B 1BCRA 5L40A 3O9ZA 4ITRC 1GAXA 2EW1A 2J6IA 3QPCA 5KTQA 3E58A 1RWKA 3PXUA 4GWKA 2W8BB 1WMEA 4BAUA 5BR8B 1L9KA 3VYRB 4DB4A 5TVKA 4PAGA 3ZWMA 1D1SA 1TK5A 4HP8A 2FMXA 5DNCA 4FR2A 2NOAA 5ALKA 2A1UB 3CPJB 1GGJA 3ONWA 5C53B 5L4SA 4CM5A 2I2CA 1WOMA 5JJ5A 3DBRA 4NHEA 4HADA 4IUBS 2I99A 3EZ9A 8ABPA 3QVWA 3MFIA 2ZE5A 3C14C 3NDPA 4CIWA 4I50B 2JIZD 1P7YA 2GHQA 1YQXA 5K3FB 8ICRA 3LXXA 3L05A 3ZYCA 4ECVA 1W5AA 3SIXA 2C4NA 1R15A 3NIFB 1G16A 4GL2A 3FNBA 3RBDA 2I6UA 4PC2A 3NXSA 4EI2A 1GY8A 1Q84A 2HK7A 2D7CA 2C3MA 3M4NA 2PL1A 1HDYA 1NX6A 1ZONA 3TNDA 3REOA 3EARA 3NBQA 1XZIA 2G28A 2Q2WA 4WPGA 1ZR4A 4FMBB 5TARA 4OG2A 1GZUA 1Z56C 3EXG2 3UUEA 2A0YA 2VG8A 4PVCA 1AIPA 2VFAA 3JV7A 1EDDA 5CDYA 1O95D 3RC9A 2YRFA 3K0HA 3ZV4A 3N58A 3BMXA 1CF9A 3BQ7A 2PUAA 3KZIU 1T1IA 1IDN1 4O25A 1OW3B 3VPAA 4FBLA 1Z3CA 3KWLA 4OUKX 2E85A 3H1FA 1DAOA 3SQXA 1KS2A 1OW5A 1OPRA 3DT9A 3ZU5A 3IM1A 3KKNA 2WJWA 3UWOA 3JQGA 3ISCA 2JGLA 5A3VA 2XTMA 5L51A 4I4LA 2PLNA 2EXXA 1V3VA 4ZQHA 2WNIA 3H5RA 2OUIA 5AXDA 5AM3A 1ODKA 3REGA 4UAZA 2HNAA 4AYXA 1X74A 2HEGA 1D0SA 2R4UA 1QZ3A 3PF8A 2QQGA 2PIDA 4KMOA 1PFWA 2CUTA 3B3FA 4XCQA 4EYGA 2KP7A 3TZLA 2JJ2D 3E61A 2LPMA 3OP4A 4UDOA 3RFCA 1U9JA 2YWRA 1A7JA 5DSZA 2GAFA 1ZJJA 2ZE7A 3IUBA 5CRXA 4JI2B 1G20B 2R85A 2UZ1B 1RWQA 4E5YA 2SKDA 1T9ZA 5DCWA 3JPSA 1CRLA 2QE7D 2YYZA 4OQYA 1WP9A 1ZK1A 1YIOA 2MINA 3H05A 2J30A 4UE6A 4EEKA 2Z3ZA 4MW2A 1SXQA 2NAPA 5BN3A 4FPXA 1Q7RA 1NVWQ 4AJ4A 2ZSFA 4LJXA 1VKRA 5AWFC 1KMHB 1YQQA 3IVXA 1UANA 3L82B 1O6ZA 3U7GA 3ZTYA 3SC2A 1R8QA 1XDUA 4TSRA 4P7FA 4IJMA 3NBFA 3G3EA 2DH5A 5IXYA 2LXNA 4USAA 3N6RA 2J3QA 5KTOA 3PHIA 4A15A 1E92A 2R8GA 1EA5A 4ZHQF 4FFBA 4N41A 1KEVA 1SD2A 1MT3A 1HQKA 1U9YA 4KQWA 3HP4A 2AFIB 1DV1A 1C7JA 4MRVA 2DRIA 1W6RA 3IEIA 2I9GA 1UEJA 4KG7A 4EA8A 4E2WA 5MFZA 1H2FA 1PTJA 3LYAA 3GV7B 3O2QB 3GXOA 1Z6ZA 3OX4A 4M4SA 3U3MA 1A9RA 5ALDA 2NXEA 3B0XA 3WMFA 2ZI7A 3IMFA 2CXXA 4L5IA 1EINA 1NVUQ 4K9MA 1DMSA 3A9RA 4M7OA 4BNTA 1OV4A 4Q4LA 2UYQA 5MHTA 1YU6A 5JSZB 1FU4A 3QEMB 4ZA2A 4C1NA 1HLPA 2EBFX 2EKLA 2NZ2A 5IXJA 2QQ5A 1W93A 1F44A 4D74A 1VE7A 3O4GA 1ADGA 1II8B 3BMCB 4BCCA 7ICHA 2QPTA 4CEJA 4AK9A 1B26A 1WW2A 3ZDYB 4OJOA 2P0AA 2P6NA 4HDAA 3W5HA 2C4WA 3GJ0A 1K6EA 4F91B 2Q4EA 5KAMA 1TCAA 4Y9UA 1HE4A 4WLUA 3P2OA 1ACMA 4DT1A 3ICOA 2GPTA 1G5PA 3OCYA 3C0KA 5JZBA 4JSTA 2Z1NA 1FBNA 5I9IA 2H2GA 2Q6IA 3H2IA 1BRTA 4C8OA 2WTAA 2IUUA 1CJSA 1PZGA 3K0AA 1E62A 4ECWA 3G89A 4B3FX 5JHHB 1PNRA 4J6FA 1AGPA 4RK7A 4NOMA 1QYIA 2X0KA 1IEWA 2J67A 4PHEA 3W6UA 4ZJYA 1J23A 1I94B 3HKDA 1NMQA 2XMSA 4Y3UA 3ZZNA 2YL2A 2EDCA 3MMZA 3RRFA 3R0JA 2Z5GA 2F3UA 1SGGA 2LVBA 4XEUA 2BD0A 2DPXA 2ZRGA 4LRYA 1CJCA 2X58A 2OVBA 2ZTCA 1ZQUA 3H99A 3RS4A 2I78A 3GRAA 5LYJB 1MG5A 4FP9A 1BDIA 2CXUA 4JB0A 4Q3AA 2H2HA 4X7BA 1MVNA 3HCFA 1M5RA 5CXUA 3GWZA 2A9PA 1QS0B 2QPOA 5MF6A 2BGTA 8ICOA 1FXWF 3EJWA 5AVRA 1V7CA 1FFWA 1ZQRA 3P27A 4YD1A 4FCVA 2IKSA 3CB4A 4NLBA 1UBRS 1HPLA 3C5WP 4RD4A 2YJTD 1JYEA 3C29A 4F4KA 4IDQA 2PLRA 3UM9A 3A6DA 2H5IA 3CSSA 3GN1A 4DZTA 5HOEA 1NJ5A 3HYNA 2P9CA 4O9MA 1II0A 4YYEA 1VL8A 3IUQA 2AS0A 3FMGA 4JVNA 1IZ9A 4FB4A 1N6OA 2J9YB 1BMFD 5BR4A 4M46A 3PC7A 1Y1KE 1VJ1A 1GYPA 1F7VA 4QHYA 2BF7A 4GT1A 4TUPA 5FCDA 4MGHA 4KPUA 1R4ZA 3ONVA 2K60A 2IEYA 4E5PA 2H5LA 4CG1A 3AR7A 4N03A 2FE4A 2ZXHA 2KTQA 3D7NA 2YH2A 1M2KA 3HWRA 4JGGA 4RHTA 2VEDA 2JJ2A 5HBGA 4V0NA 2Q6TA 1G5HA 4EBEA 2O8FB 1OI3A 4KQ9A 2YZ2A 2OAGA 4G07A 3HZZA 3CUEF 1FNBA 2GGSA 3I37X 3NAQA 5E4TA 3EVTA 1M6VA 3PUXA 4DCGA 4LHVA 1ONNA 4MEYA 3P2JA 3L4PA 4EGAA 5KU1A 2Y1CA 3OLCX 1KMNA 1NVTA 3EN0A 3LRPA 3PDWA 3N75A 4QYWA 4TL9A 4L8LA 5LFAA 1CLUA 4AZVA 4N12A 2E2WA 2BKUA 3EFBA 3EIUA 1E20A 2PT6A 5C0YA 1PGQA 1K7XB 3IL2A 1QSLA 5EZ6B 1ULAA 3KPWA 3BD7A 1VBFA 4GC6A 3OCCA 3ZWKA 4V0RA 4E46A 3F78A 1SVWA 4LCEA 4JLWA 1OIVA 3BJMA 1MLDA 1IG3A 4GOOD 3LI2A 2V6IA 1D2RA 4RK6A 5LDDC 5LXTF 4DBLE 3HN2A 3BSFA 2FG7C 3PE3A 1OLUA 2ZIWB 4MUIA 3U17A 1MQAA 4K7JA 4GLFA 4DJEC 3GCGA 2LV8A 3C2LA 1G5TA 1NNI1 3HJCA 1DIOB 3CO5A 4YRPA 1FP1D 2CLDX 4O2AA 1KYQA 5J0SA 2QPLA 3QLUC 1LFAA 1BVSA 3NIBA 4C76A 3NKLA 2O23A 3EF1A 2OFFA 1PJAA 3H2HA 4UHFA 3NHUA 3AG6A 1P73A 4FUTA 1NVGA 4FHFA 5DLPA 1U7HA 4YT4A 1I13A 2C5EA 4DMKA 3OY2A 1J2EA 5KFBA 5LYYA 1FUEA 2FCRA 2RSLA 2RD2A 4OUDB 1TAMA 4FDTA 3ZYZA 1R12A 4EHDA 2H3VA 1YT3A 3TB4A 1SXDA 1DU4A 4YQYA 3JRXA 3BIOA 3EGWA 4GBGA 4EBDA 2EZXA 2DGZA 2ZWOA 8ICJA 3DYBA 1AD2A 4H31A 4IF4A 4J9RA 2BFBA 4C30A 5DM2A 4DQSA 1C14A 3C3XA 5DMXA 1GKUB 2OECA 1OB5A 3GP5A 4C03A 3RFXA 3EQ6A 2WTMA 2Q6KA 4DQPA 3OZEA 1I0LA 4YRJA 3L7JA 3IAS1 1U3CA 1N6IA 4IEIA 1HY3A 2BZSA 3T5LA 1XDGA 2QRLA 4QDJA 5F7ZA 2AJCA 2GEVA 1YNOA 3V4LA 4BGVA 5CT9A 2Q3MA 3QIVA 1VSUA 4PO3X 4BB9A 4YRAA 2GKOA 1N5XA 2ZBQA 1X7YB 2XWQA 2F8KA 1I2BA 1IB0A 5IT5A 3PEFA 2FWAA 1OX4A 1JG7A 4BFUA 4DARA 1Y6JA 2VHVA 4C3ZA 3IVRA 1JIHA 5CBPA 4DEXA 1FYEA 2IEZA 3ZQJA 2EEPA 4M9JA 1KPIA 4JT8A 4UHDA 2JL1A 5E1OA 4U5QA 4LF8B 5JAOA 2FDXA 3ZZ0A 3G9UA 3FGOA 3IVGA 3SBXA 3W2FA 1P5FA 3WGJA 1KTQA 3LVFO 5JMPA 3RADC 5FOWA 2AGQA 2PT9A 4N7RA 4WEQA 2ZVQX 1FYDA 1KH2A 3ADCA 4EG5A 1JFFA 2A0UA 2CXYA 3B8EA 4JU9A 2DSTA 2EFYA 3ZVKA 1XCPA 1JDZA 2BAGA 1C7ZA 5FLXA 4I0WB 2CDBA 3UQZA 3FJ1A 1HMYA 1GTRA 1SCBA 1DC5A 4BVJA 1Y4SA 2FPXA 4ARUA 2AYYA 4E1AA 2Q0HA 4CT4B 2D4HA 2R2GA 4KWIA 2QYTA 4EZ9A 1S8AA 4IIXA 4MGIR 2L82A 2R9VA 4FYPA 4FK8A 3KKOA 1SXEA 2VAWA 1T1EA 4C7BA 1RPNA 5EJEA 2DGDA 4GKAA 1N2JA 3GWGA 4TL6A 4GSKA 1J2MA 1E1QD 2W2MA 2CV2A 1ZMBA 1NA5A 2IS4A 5JISA 2MIIA 2O2HA 4KI7A 3GEBA 5HS4A 4PTYA 4BLSA 3ANTA 3KYDA 1YU9A 4FS3A 1UWLA 5BOSA 1UPBA 3ELBA 1RQ7A 5SY6A 4D9BA 5J23A 3I62A 2JLCA 5LQMA 2BGNA 1XKXA 3MIIA 2PVSA 1L8XA 1ICIA 1W0JA 1CQIB 2VUUA 1F4PA 4OHCA 5DQIA 1W73A 1AZSC 3NDJA 1GA4A 3G0BA 1XQYA 1Z6TA 2ZS7A 1CIJA 1Y8CA 3RB4A 2XLBA 4CU5A 4MI9A 1EK0A 5MFPA 2YHUA 5KNLA 3E9QA 4WCDA 3QBEA 3BG5A 1FYVA 4JNCA 4EW3A 4L9AA 1V9SA 7GPBA 3LP8A 1JQEA 1P62B 4DEZA 5L7WA 3HR7A 3BTOA 3S1AB 1N8SA 4I2CA 3ZGXA 3LBAA 3TM4A 2OWEA 4NPHA 1YDMA 3HB1A 2CSXA 3SBOA 2C9BA 3CZCA 3ITNA 2OORC 3T5TA 2X22A 2IZ0A 1KFSA 3SSNA 3B3QA 3A6HA 2EZTA 3UK0A 3WGNA 1HDXA 1XKTA 3QU4A 1E8NA 3HKZC 1U2ZA 3PT9A 4IZ6A 4MJ3A 5HK9A 4P3NA 5KJ1A 1FVHA 2WTEA 1C4OA 1MRZA 5HJ2A 3CUKA 1QGDA 4AY6A 1NUUA 2C0CA 3P0HA 3VNVA 2G09A 2PBLA 1KZ9A 3KZOA 4IQUA 3H1GA 2ZIXB 4X5OA 1QBGA 4LGMA 5CG2A 3CVYA 5LOVF 4V3BA 3OM0A 5HQTA 3IAM1 4TZ6A 1C7RA 5C5EA 4F46A 1TUIA 4RPZA 4DM7A 1OJLA 4X6LA 4ZAYA 4GKVA 1JR3E 3HVJA 3FUTA 4YMHA 1QC5A 5U1PA 5A4MS 3RK4A 1UJ2A 1Y6ZA 1JA1A 1GZ6A 3U3XA 1G21B 3W8NA 2CVOA 1E9VA 4N6NA 2BFDB 4Y7CA 4FMPA 1T13A 3EVEA 3W5DA 5B4TA 5UKDA 4MK4A 3HVRA 1A76A 3ZY5A 3QF7A 1DL5A 1S2NA 3PR2B 5AVUA 1VRVA 2QT0A 1THMA 3EA5A 1FIUA 3NKFA 5EA2A 1U5BA 1M8FA 2D1TA 3RR2A 1T0JB 4UM9B 3GLIE 3I9V6 2MTBA 1IBCA 3LV8A 5CIQA 1NUPA 3G88A 3TSZA 1LBQA 3DTVA 5LQAA 4HNAB 2ZCJA 4JV1A 2HLHA 3C43A 1QIMA 3I30X 4GVXA 1D2MA 1P2BA 4H3VA 2D8AA 2BQRA 2FW1A 3CF0A 1P44A 3EY9A 4ESOA 5BV7A 3TBHA 2H6EA 4NQZA 2WDPA 1WXFA 4CL3A 5M5BA 1IWOA 4NWIA 4GNKA 2JFYA 3ZHQA 4D9IA 4ZEVA 3O26A 3ZHBA 4JP2A 2FSFA 1ADJA 2Z7JA 2WF9A 2F7SA 4FDLA 2QUZA 5EWMA 1Y3CE 1Z5ZA 1RWWA 4W82A 1VCIA 3TADA 5FOTA 4F84A 4B9NA 4DG9A 4UB4A 2FP4A 2LCFA 4A0QA 2JC3A 4HN2A 2ONZA 1W35A 1KEJA 3ECCA 2XMZA 4GO1A 3RAQA 3BBLA 1SD5A 2BCSA 2P5TB 4TV8A 2GPBA 3AP3A 3EXAA 1RACA 4EPYA 3S2IA 1FY2A 1WKCA 3T0GA 4ODIA 1OYYA 3RPEA 1U0FA 3CR3C 5BSKA 2CB9A 3N2IA 3RD5A 2X0JA 4AMUA 1KZ4A 1Z6GA 1MHPA 3D2AA 4HV4A 4KO3S 1QP4A 5L6LB 3S99A 2Y6UA 5J4YA 3CNHA 1XYGA 1WB5A 3BZCA 2F43B 2WV7A 3OAAD 4Y67A 2B4YA 1KF0A 2I5HA 1B0XA 5JBQA 1ZS9A 1ECCA 3CUVA 3ZXYA 3KQVA 3R7NA 4AJKA 1VDZA 3MAGA 3A1UA 2ZBUA 4L8VA 2JASA 1L1QA 3OOWA 3BK2A 3GP3A 5AHRA 4O0MA 3MTJA 4UKDA 3IUNA 2YFHA 1ECBA 1FC0A 4FT2A 2IA5A 1ZQKA 3KQKA 2VRCD 3HDJA 5LU9A 4I1YA 3GUYA 2CFTA 4F56A 4F4CA 3AB3A 5CLQA 1E1QA 5E7QA 1R6VA 2YVLA 4JLDA 2OOKA 3B3GA 3LVQE 1S8FA 3ZCUA 3SHVA 1NRJB 3LBFA 5KFWA 1KR5A 5JSKA 4O1MA 2UUAB 4ECEA 4C4YA 1Z0JA 4F5ZA 3GFFA 1K0FA 2VQFB 1PR2A 3JD3A 2ZUBA 2HSZA 1UZUA 3PFGA 5DGBA 5L45A 1YFKA 4R64A 5HUHA 1OWMA 4EFDA 1U8ZA 4NYJR 3SLRA 4MS3A 1J2JA 3LWDA 2CJPA 1UDWA 2XE4A 4D41A 3KTFA 3WKDA 2YVKA 1XT6A 5HKKD 5F1YA 3Q9SA 1ZUNA 5JAQA 4YJ2F 3UJHA 3K0SA 2K5UA 3LC7O 2HGZA 4KKXB 1ED1A 1AS2A 4E09A 4BRSA 4UVGA 4BP3A 3CX4A 1NZJA 1PS8A 1WZEA 2B92A 4O4HB 3UXOA 5H8WA 2QVXX 4JBIA 4GI2A 1J2UA 3G5MA 2BSAA 1MQ2A 1Y6QA 1PV2A 2HQRA 1MQ9A 4H1WA 4BVBA 2E48A 5C1PA 3EISA 2HCFA 5D5HA 1BFUA 1NYTA 3TZ6A 1I3LA 4NLZA 2GASA 7ICMA 1ZCFA 3DZKA 2B4RO 5B36A 1E7QA 3GH1A 4MGZR 2A9FA 3P9XA 3QXXA 4H7JA 3QUCA 1SRQA 2PZJA 1YA6A 2YOFA 3MR3A 3UB3A 3I1FA 3R9IA 1XLTA 2VIIA 2Q3LA 2EKQA 2XRZA 3ANYB 2DT5A 4TKUB 1NL3A 4GWLA 2EF0A 3MWYW 3JCZA 3T3HA 4XVQA 4LVUA 3PX7A 2AKYA 4CCAA 4LQ4A 1Y7TA 1ZQHA 1N2IA 2BP7B 3RRXA 5AW2A 1Z06A 1LLQA 1RYBA 3R3SA 4ZZ2A 5COBA 2WMYA 2KHVA 1N5RA 4BWVA 4RNCA 1XCBA 3BREA 4TYMA 4NL9C 4M9QA 4KNVA 4Y0VA 2QW0X 1H3FA 4PYKA 3ABZA 4LCBA 3UYLA 1ZAKA 3WHPA 2JRZA 5CW2A 1Q3HA 4Z0HO 5G5HA 2GWRA 1EM6A 2PBRA 5JJCA 3P96A 3HUTA 3P1JA 4WASA 3LVVA 3T5DA 4JLPA 4Q16A 4BFLA 3OU2A 2E8MA 3NWEA 4M86A 3KUDA 1RKXA 5LLDA 3OURA 1OXBB 5A4JA 4ZMBA 2DBRA 4MQEB 4HMPA 1ZH6A 4LJRA 4DOBA 2G1PA 4QIHA 1A8PA 4PLGA 4CLXA 5L3QA 4XEHA 2Z83A 2CYBA 2X0RA 2NPIA 2ZJ4A 3IOMA 3C4JA 2QD4A 3AY7A 1R6BX 2PQ0A 3CKKA 2JJ1D 2NVWA 4KV9A 1TM3E 2ZYRA 4KXUA 1HI9A 2K4HA 2VP3A 4CKCA 5LMNB 2BF4A 4UCWA 1T2DA 3QPWA 4G4IA 2ZT7A 3H2BA 1MO5A 1U3WA 4IJVA 5LP1A 1ND5A 4J9QA 1MB9A 4OH7A 4DCVA 5KKNB 4Z3DA 4B3GA 3OPMA 4CTOA 4J0EA 2B34A 3I0MA 1SMKA 1IYZA 1P9OA 1WUKS 3VVCA 2QI9C 2JI6A 2ZIEA 5DNAA 1XXLA 2JK1A 1CB7A 2FR8A 4J7CA 2D7DA 3IQXA 4KFRA 1DTWA 2C54A 4YJGB 1AUVA 5D87A 2CL5A 4B9VA 3TLJA 1T0IA 4B75A 3OMWA 2GZMA 4DIDA 1SN7A 3SSMA 3CJQA 3SDZA 5HKAA 4FR0A 4YR2A 3V7YA 4DSUA 3ZCVA 5A4AA 4BBPA 4K4HA 4BU0A 2OHHA 3AOGA 3ET4A 4DDHA 1DRWA 1YDGA 4LHSA 1UEXC 1DPGA 3MXTA 5H5JA 3ZLVA 1J0XO 3RODA 3MPOA 1Z5UA 4HRVA 3QFHA 4ZJUA 4FJ1A 4KIJA 4GECA 2QTVA 4B40A 3BRWD 4ML3A 3JRWA 1CQPA 1RYZA 1KU6A 3EW7A 4M0DA 2XKBA 1Z6XA 3MGVA 2YMMA 2R8HA 5KNDD 1QE5A 1R1DA 4YJ3F 1PGOA 2TMDA 4JL5A 1OA0A 5HHIA 1XOIA 3KSUA 5L3SA 4BCDA 3CJTA 4JP8A 3GQCA 3DLCA 3OPYI 3LZCA 3E0QA 3SSOA 3HUFA 2XQFA 1YBAA 3P9IA 2QRNA 2NU9A 5D8DA 3ZCXA 3B2QA 1SG0A 2FZKA 4MS4A 5KHAA 4ZO9A 2GEUA 5J43A 1WZNA 2GOYA 3QBJA 2JGIA 5I8PA 4HQ0A 4RNNA 4C7MA 4S04A 5EWLA 4DVGA 3GNLA 1VKZA 4ECYA 1UBUS 4TTVA 1P9WA 1NVEA 4LIPD 4BN4A 5KG2A 1KVQA 5KSOA 1W36C 2BR3A 4JI6B 3FFXA 5IP5A 3Q6MA 5A3SA 1V5WA 4M9RA 5IM4A 2WUVA 4RD0A 1T94A 2IZ7A 1RAFA 2K4PA 5FV7A 5EPUA 5FBRB 1FNNA 5HRAA 4IZIA 1GEGA 1O8CA 2ZB2A 2Q1UA 1R8XA 2Y99A 4YXWD 3TFSA 3ROEA 1DAIA 3KSBC 4GI1A 5JV5A 1B1CA 1UODA 1H66A 1XALA 1WL8A 1GTSA 2RIPA 4NBRA 5F3XB 3NVMB 4EUNA 4ZODA 1TO1E 3O03A 1CZNA 2P66A 1IBMB 2VWPA 4CDGA 3WB9A 3LKVA 4LGCA 3OWOA 1I3MA 1XTJA 2PR7A 1VHQA 3RSHA 2C5AA 2PYDA 4DLAA 1Z8HA 1SOAA 4HQOA 3WLRA 1O77A 4N76A 2P0EA 3L7YA 1XZGA 2O3QA 2E82A 1WDKA 4YGXB 1G1MA 5GWXA 5H83A 5FH9A 2MJLA 2QV7A 2J6CA 3IUEA 4OJLA 3VO8A 2C04A 4N65A 1OGIA 8LDHA 4IRCA 2V7UA 3DP9A 4BVHA 4NBKA 3HHPA 1T2AA 3B89A 4CN9A 3CH6A 3EB9A 4QTXA 4RH3A 3MUNA 1EEXB 2B2NA 2G63A 4TQGA 4UBMA 3GT4A 1JRLA 3A2MA 3VISA 1CPYA 3MTDA 4RZQA 3ESYA 2VNSA 5EESA 4UJ3A 5LDGA 2YIDA 5DWQA 2ZR0A 4M1YA 3EPKA 1SUIA 3PO4A 1VGVA 2GN1A 1AK2A 2CL0X 1JHPA 4CJXA 1Q0SA 1BPDA 1BG6A 1SD1A 1ZDMA 3W7VA 3G2KA 2QL7A 1UP7A 4M55A 1L5HA 2H1RA 3CINA 1JJFA 1EXMA 1EUCA 1FQJA 1CY8A 4WBNB 2AKAB 1B1AA 3VNBA 3RUFA 1ZQLA 3CZ4A 2JAQA 4GYYA 2HHQA 2ZRAA 4TRNA 1XK6A 3EDYA 9GPBA 5KAPA 2JLXA 5GJWC 5DYYA 3CBQA 4ARVA 1Z82A 3ZD6A 4F38A 1BNPA 4MAMA 4HKTA 3O21A 3WL7A 1L3TA 2FKAA 1RG6A 3EQ9A 4D45A 4AY5A 1ZH8A 4OOEA 4ED7A 4TQUS 4YRBA 1T10A 4JH0A 3DT8A 4PIPA 2FJUA 2X5XA 2GAOA 2XCQA 3ZH9B 4PZZA 4RD1A 3VVMA 5ALFA 2NO7A 1KI1A 5A1JA 4IXTA 5AKIA 3FCAA 3EXIA 3EVBA 1GYQA 4NJMA 4R1OA 3Q40A 3GLHA 4PZLA 5KFAA 1U3FA 2OBXA 5K05A 2HXGA 4GXIA 4ETNA 3UW3A 3ADKA 1E1NA 1AKVA 2LNDA 4CCWA 2IDKA 2F67A 1EXDA 4QDTA 3GJ3A 4B4OA 4TRMA 3B60A 2BFAA 1MW8X 4EGJA 4RVDA 3VYUB 1O4WA 1EWKA 1LS6A 3A4IA 1CUEA 2JJMA 3PO5A 4OI0A 2G9NA 1CRWG 2PQMA 2J31A 3EY4A 3GQVA 2GN2A 2PL5A 3BTVA 1HEYA 4MQUA 2BTOA 2IXGA 2YTZA 1I7LA 2VJPA 3NHBA 4F4XA 4ND3A 3EEBA 2HD4A 5BORA 3H4IA 1C0IA 3FYUC 3EFHA 4ELTA 1QZTA 2IHJA 1SCAA 2KSQA 4XASA 5GZ6A 1ZVMA 2FFHA 2CSUA 1A5AB 5K6TA 1KHTA 3GFKB 2MU2A 1N3BA 3IIEA 1V6CA 4XM0A 3BRWA 1GV0A 4OSOA 2AJTA 1Q0HA 2DB3A 1G0OA 4CF4A 2BGJA 2E7ZA 2BHRA 3PLAE 1D03A 1SEVA 5BW4A 1E60A 4BO1A 3G2IA 2PKQO 3CEAA 4ZJZA 3EZNA 1AVTA 4EQ6A 1SOUA 1OF1A 1XZCA 5GONF 5IKOA 1KI6A 3AR5A 2X0NA 5F1KA 5DQHA 2E1FA 5EE0A 3OF2A 3KZNA 2B4AA 2JEOA 2JEFA 1V9LA 1Z33A 3OQHA 1WZ2A 3KK0A 4N18A 2XOEA 1YDWA 1OAOC 1P72A 1HZZA 4YCAA 4OJPA 2AK2A 5CM2Z 4UAJA 3UQ2A 1P9RA 4J3NA 3JWIA 1TECE 3AERA 1HIWA 4GGMX 621PA 2ZR8A 3T12A 1GM5A 5DLEA 2W2KB 2JNWA 4DYHA 3CKLA 2JAPA 4YS6A 1LPAB 2O3UA 5BYKA 2PKYX 1PVPA 3K09C 3PQDA 4BASA 3I4FA 1JWBB 4YAUA 3EXEB 3EZLA 2FSUA 3W1WA 4G67A 4RTNA 2YZKA 3QKSA 3EIQA 2O0HA 4YI5A 2W2PA 2ZCUA 1UDRA 2I3ZA 4O59O 4LZZA 1J5EB 2JBAB 4RJKA 4PYQA 2WM9B 3VJLA 1HNWB 4YP0A 1QNFA 2BCGY 3T0IA 3PIIA 4W7SA 5AOBA 1FTWA 1KO8A 1Z0SA 2J08A 1MB2A 4DQIA 3EMDA 2A35A 1EXVA 4J0DA 4KREA 4BFVA 4EH1A 1LK0A 1TUBA 4LXUA 5JJIA 4EA9A 1L1EA 2LTAA 1NVMB 3I2GA 2YWGA 4EB6B 3TTSA 1DS6A 3CLRC 3UCXA 3UWDA 3WOVA 3VGPA 4C4OA 4ZVRA 4O3FA 4BATA 1WHTA 2XWSA 4RCVA 4LMPA 2ZWIA 3KUKA 5G1NA 3O74A 1REQB 2AF4C 3ZR4B 1LWNA 3W5BA 4MFCA 1G9XA 4BKQA 2W8ZA 4FW9A 1QO9A 3QFFA 2O3TA 4EGQA 4HBGA 1TE2A 4GUAA 3SICE 3JWGA 4C14A 5GGXA 3HV2A 4C08A 1OOEA 5JSFA 4ZYUA 2IJGX 1K5HA 2C2KA 4I9FA 4XDHA 1G3RA 1E1MA 3DA8A 4FHEA 2JFFA 3HJHA 2PS0A 4E2FA 3DMTA 2Z4SA 4YPOA 3SX2A 3EVFA 3V8EA 3KVRA 1GGVA 4TLEA 2J8ZA 1DAEA 1ZNWA 1X19A 2IGBA 3KVNA 3T5HA 2DJIA 1KJ9A 3RVQA 3RIEA 3CVOA 5EMHA 4FFLA 2OGSA 5F52A 4ESVA 4BNUA 3BICA 1GFZA 3UF0A 3L8GA 1QYRA 1CXZA 4PZUA 4IQVA 2ZPAA 3TLZA 1PEKE 2FW9A 4XWGA 3HXOA 1EBFA 3WTBA 3U4DA 2WYOA 1L3SA 5I5GA 3ETGA 2GZ3A 1EX9A 4FFWA 5ALSA 1T9GS 2G5IB 9ICNA 2XB2A 3WDLA 4WXRA 2V9WA 5C4IA 1M83A 4Z6EA 5CB6A 4TYWA 3D3KA 1MKYA 1QP8A 5EJAA 1OUQA 1CUYA 4MYUA 3IYLW 1ZUD1 2BEVA 4OOFA 3B6IA 3TPZA 2A5GA 2C7PA 2C1XA 1FSSA 3M1AA 5JS2A 1CS0A 1QFZA 1P1FA 2CCJA 1CY1A 4KHPB 4PN7A 3O93A 4PO9A 1DTEA 4DDMA 5BN5A 5CFQA 3WYBA 1MABB 1N5WA 3OJOA 3OKPA 4JD5A 2R8KA