3QU5A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp11asn mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
221
structure length
221
Chain Sequence
KLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 82
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu5A01
4KYTA 3PGLA 3MN1A 2B30A 3A1CA 2C8LA 5ALMA 2P9JA 1KYTA 3QU5A 2WM8A 3WK8A 5ALDA 3ESRA 3ZUPA 2AH5A 3NIWA 3E84A 2ZBFA 2WF7A 2JGAA 3ZVMA 3UMBA 3MC1A 3AR5A 3U7EB 3AR7A 3QU2A 5ALSA 3HLTA 1Z4MA 3DV9A 3F9RA 3OCUA 3NALA 1Z5UA 2FPXA 2HCFA 3FVVA 4HYTA 2HSZA 2HF2A 1TJ3A 2EARA 3L0BA 1O08A 4UW9A 2WF5A 2Q4RA 5T41A 1S8OA 1WPGA 1RPZA 3QX7A 3QUBA 3U7HB 1RLOA 4MUMA 1O03A 2HF7A 1T5TA 3RF6A 3ZVLA 2R8XA 2B8EA 3DNPA 4F71A 1Z4IA 3GYGA 1TA0A 2FUCA 1ZRNA 5AICA 2D2VA 2JARA 4F72A 3L8EA 2FPUA 3D6JA 5AKLA 4BX0A 4YIKA 4O8CA 5IS2A 4BNDA 1RLMA 2W4MA 4GXTA 2BDEA 3WKCA 5JJBA 4HAIA 3B9BA 2MSNA 1X42A 4OCZA 3L7YA 5ALYA 3AR6A 3QU9A 4Y2UA 3ZTYA 3A1EA 1K1EA 5AKYA 4BX3A 2BDUA 2HHLA 4Y2RA 1RKQA 2ZBEA 2NO4A 4KNWA 4UM7A 4UATA 2I54A 3I6BA 2JAWA 1U7OA 1FEZA 1Q91A 3AR2A 3UM9A 3SD7A 4UMDA 4BNDB 3NRJA 4YCLA 2X4DA 2FPSA 2HX1A 2C88A 4G63A 1RLTA 3ZX4A 4PNHA 1RC8A 2EAUA 5ALVA 2G09A 2GMWA 2W11A 1U2TA 1ZD2P 1QQ5A 2RB5A 5AW1A 4Y2SA 1RDFA 1U2SA 5ALOA 4XE5A 2B1QA 5ALLA 2HEGA 3W5BA 1T5SA 1T9ZA 1J8DA 1SWWA 2I34A 3R09A 3L8FA 4OD0A 3ZVNA 5AVWA 3EF1A 3ET5A 4G9BA 1TJ5A 4NWIA 3FM9A 3W5CA 2ZBGA 2I7DA 3E58A 4AS2A 3NASA 1VJ5A 3OCWA 5AVZA 3SMVA 4EENA 5AVVA 3CNHA 3ESQA 3PDWA 1S2OA 1U7PA 3OCZA 1AQ6A 4DFDA 3U13A 1YV9A 2WF9A 3WKDA 3QXGA 1RRCA 3EF0A 3WKBA 4HGQA 2R8YA 1EK2A 4RETA 4CF3A 4FYPA 1J97A 5AI6A 5AVRA 1VJRA 3WK6A 2C8KA 3SLRA 4ZEXA 1NNLA 1LTQA 2Q4TA 2FPRA 3SKXA 5AESA 3NAMA 2YBDA 2C4NA 1Z4PX 3N8GA 3OTQA 2B0CA 2IOFA 1L8LA 3AR9A 5ALXA 4YH1A 1Z4OA 1L7MA 5AVYA 2FPWA 3QUQA 4DCCA 3BA6A 2YFYA 3OCYA 3WK7A 5ALJA 4EX6A 3BWVA 4Y2TA 3OCXA 1YNSA 3L1VA 3I28A 4UU1A 3FGOA 3WKAA 4EEKA 1L8OA 4B6JA 3NUQA 4RESA 5AI9A 2P11A 2IOFK 4BX2A 2CFSA 4QJBA 3IJ5A 5AVQA 2CN1A 4QQFA 5ALHA 5AHXA 3WK5A 5AKZA 3PGVA 2YMPA 4CE6A 4IG4A 2I33A 5AM2A 4BKMA 3WK4A 2G1AA 2YMLA 3WGUA 3QU7A 1WVIA 1TE2A 5AIAA 5ALRA 3KZXA 2B82A 2FDRA 2OA0A 3AR4A 5AW2A 2ZBDA 2DQSA 1RMYA 3ZI4A 5IT0A 1N8NA 2MU2A 5AI5A 4UU0A 4L57A 2HI0A 3KDPA 4AS3A 2RBKA 2RAVA 4NABA 2WF6A 1PW5A 4NAVA 4JDPA 5ALNA 2YJ6A 5A3RA 2YY6A 3PCTA 1CQZA 4XQ0A 4Y2JA 4CF4A 2OM6A 5ALFA 3KBBA 3ZX5A 3QUCA 3QU4A 2ZG6A 3ZWDA 3B8EA 2YN4A 1RKVA 4EZEA 1SU4A 2YMQA 1ZD5A 4KN8A 3L0YA 2YMMA 4E88A 3U26A 2R8ZA 5AK5A 2Q5EA 1Z88A 3DDHA 1YJ5A 3L5KA 5AVSA 5ALQA 2W43A 5AM0A 2O2XA 2ODAA 5ALGA 3N1UA 3OPXA 4KX5A 4YCNA 3N07A 1NF2A 3WK9A 5ALKA 4UM5A 5AK3A 4KX3A 2WFAA 3NANA 4YIHA 1ZJJA 3VAYA 5AM4A 5A3QA 4ZEWA 2YJ3A 3L0CA 1LVHA 3FZQA 4IFTA 3QLEA 1Z4KA 5IT4A 2OBBA 3TLMA 1YMQA 5AI4A 1Z5GA 2AGVA 2I6XA 2HOQA 3W5DA 1YS9A 2FEAA 2B8JA 1L7OA 1XPJA 2PR7A 3WKEA 4C4SA 3FPSA 1QQ7A 2CFRA 2VKQA 5AW6A 1NRWA 4MWOA 1Z4LA 1IWOA 2NYVA 4UARA 4UASA 3CZ4A 4UMFA 4YGYA 4FE3A 1RMQA 3QNMA 4XPZA 5AK6A 4KNVA 5AKEA 4NFLA 3KC2A 4UMEA 2BY4A 1SWVA 2FUEA 3R9KA 1L7PA 5ALZA 1WZCA 3FPBA 5AW0A 2G08A 5AIBA 2WF8A 4H1WA 1RKUA 2RARA 1MH9A 5AW9A 3ZU6A 4AP9A 3IB6A 3ONNA 1WR8A 5AW8A 4CNQA 4NV0A 2YJ5A 4C4TA 1ZD4A 3UMCA 4GIBA 2HO4A 5ALEA 2G06A 2ZOSA 4BYGA 1ZS9A 4I9GA 4C4RA 5ALUA 2O9JA 2GHTA 3ET4A 5ALIA 3K1ZA 4ZEVA 4BBJA 3MPOA 3ED5A 3AR3A 5AM1A 3A3YA 4BEWA 3N28A 4HGPA 5AKJA 3E8MA 3SKYA 3AR8A 4JB3A 5AW3A 4Y3UA 1L6RA 1RMTA 4FFDA 2CFTA 1Z4QA 4XOUA 5A3SA 2C9MA 4L6AA 2ZXEA 3DAOA 3OCVA 3SF0A 2HDOA 1RQLA 5FP0A 4YCMA 2WHEA 5AM5A 3RFUA 4HGNA 2OYCA 4OHFA 5AM3A 5AI0A 1F5SA 4DW8A 2IYEA 5AVTA 2R8EA 1QQ6A 2MU1A 3U19A 3I76A 2PQ0A 5AW5A 2GHQA 3W5AA 3QYPA 2NO5A 5AKGA 2G0AA 3KD3A 4CF5A 4UMVA 4Y2VA 3U7FB 4UAVA 4BEVA 1TJ4A 4J2TA 3U7GA 1U02A 1L7NA 4Y2PA 2QYHA 3J7TA 3P96A 3UMGA 5AW7A 1Y8AA 1VFPA 2IOHA 5AVXA 1Z4NA 3N5KA 5AI8A 3QUTA 5AKIA 5AVUA 2JAOA 3KOOA 1QH9A 1YDFA 5AK4A 2QLTA 4UAUA 1CR6A 2GO7A 2AMYA 3M1YA 5AKXA 4L6CA 1RQNA 3L8HA 1Z4JA 4I9FA 4DWOA 2IA5A 4Y2QA 1XP5A 5ALWA 2AUTA 3ZWKA 3EPRA 1ZOLA 5AKHA 5ALPA 3I1YA 3MMZA 1ZRMA 4Y2XA 3L1UA 3ZTWA 4J03A 3R4CA 2G80A 3L8GA 4HGOA 2P27A 3E81A 2JAUA 3SHQA 1N9KA 5E0OA 2YJ4A 2PKEA 3IRUA 3QGMA 4EX7A 2G07A 4OFZA 1EK1A 3B9RA 1ZD3A 2P69A 3WGVA 3HYCA 3M9LA 3ZW7A 3A1DA 2GFHA 2I55A 4EELA 1Q92A 2EATA 2B1RA 2FI1A 3EWIA 1QYIA 5AW4A 5ALTA 1JUDA 3S6JA 4HGRA 5AKKA 4Y2YA 1XVIA
chains in the Genus database with same CATH superfamily
2JAXA 5LYJF 3VPCA 1PQWA 3PGLA 3ROMA 5KG5A 2GM9A 1L4EA 4HADA 2AHOA 1T2EA 4IHJA 3LVRE 4ZYZA 2G6TA 3PR4A 1VPDA 2FSPA 2Q1XA 4IH1A 3V9AA 1YZVA 2EZ8A 4RDIA 2W6CX 1UKBA 3ZUPA 3X43A 4RNMA 2IUTA 1YMVA 1YQQA 2EL7A 2YJTD 3ABSB 2AK2A 3O1LA 5FCDA 4KO1S 2C03A 4FNOA 1XNJA 3HB7A 5C0OE 3AINA 1T0IA 4F4HA 4WGFA 2AN1A 1NBIA 2OEPA 3JYPA 1O0BA 3RRZA 1RG6A 1EIWA 4FDAA 3WB1A 2E18A 4JC4A 1L3UA 1OFIA 1OAOA 1QH8B 2IKSA 3DHEA 3OQIB 4N0PA 4YS6A 5TS3A 1K1QA 1TUGA 4HHEA 2AR9A 4RUAA 1YHNA 2Q0SA 2DG2A 2WU1A 4UXIA 1RWVA 3K1JA 1JEQB 1UODA 3WMFA 2XGJA 2HW3A 1N6RA 4MR8A 2ZSIA 4MW9A 5KNDA 3TG8A 2D8AA 3LF1A 1ONSA 2FWIA 3QLVA 1VCOA 3OPYB 4AMBA 4G23A 4GI1A 3VPAA 5KL8B 3NJ8A 3CT4A 4PC2A 3D5EA 3PUJA 2VHTA 4M7OA 5KNDH 3JD4A 1BG6A 3BSSA 3OEEA 1M0WA 1Q3VA 4P4UA 1IXKA 1LA2A 3K0EA 4WESA 4U6SA 3CIFA 4OGWA 4TKVB 4UHBA 2VSNA 4JJKA 1EX7A 2D2VA 2JNWA 3H7IA 4P4MA 3Q3EA 4HSEA 4KV9A 4FZRA 4TV9B 3DA8A 4NBUA 5HYVA 2JFYA 2EU8A 5DYWA 5E38A 3KOXA 1PQYA 4TLAA 1XAGA 4EHLA 1CULC 3C5GA 1TVCA 2A30A 4DOBA 2J3EA 2Y6VA 3DV0A 1MJHA 3EXIA 3MERA 4J9PA 1OUQA 5G0SA 2HRCA 9MHTA 3HEMA 4NLCA 1DAGA 4U9HS 1Z26A 5DVZA 1D8LA 4BWJA 3R74A 2AMFA 2QZJA 4H16A 2PMEA 2A1UB 3RBAA 3HRDD 1LPSA 3AU9A 3RC9A 5BSGA 4NBTA 4BLTA 4CL2A 4PSUA 1U9LA 2DFDA 4PIPA 5CLIA 1U7OA 5A2GA 4D9NA 3IBSA 5A5FA 1RXCA 4OXXA 3NHAA 3UM9A 4JJFA 4B45A 4NCJA 1C3EA 2QENA 3OTIA 4KQHA 4GX2A 5K8VA 4PFJA 1E9RA 1MW9X 1P5RA 2B35A 1FTGA 2BWJA 3PFBA 4MJXA 5TVKA 4R40A 2HX1A 3GB9A 4BB9A 5CBPA 4MVJF 2XMCA 3LX8A 2EC5A 4D45A 1GU7A 1Z2CA 2WSLA 3JQBC 4X9XA 4HQOA 4GYYA 3SV3A 1JU9A 5BN3B 4IX1A 1N5RA 2ATVA 3U6KA 4PFKA 2VF5X 4J9SA 2VNKA 3NCHA 3T3HA 2R00A 3JQEA 2AG5A 2JFWA 4V1CI 5C51B 2EFDB 1M6YA 1Q57A 1RWOA 2GMWA 1I33A 3H5NA 5KT2A 3KL4A 4ID9A 3F53A 4OK5A 3VHQA 3A6GA 1ISPA 3I52A 4OQLA 1FS5A 1QCCA 5J0QA 5JNTA 3KPJA 5FUWA 2IDJA 1CHDA 1PWEA 4HX5A 5DB6A 3GP3A 4INAA 4MIEA 3K8OE 5IEJA 2H1SA 1KQGA 3RS8A 4ZAXA 5BW6B 3PQ6A 2DFTA 1Q7CA 2ZRCA 3DP7A 3T5LA 3PTLA 1GNLA 3AU8A 1LX6A 1E4EA 4H08A 3TZBA 3BRQA 3ORHA 4DEYA 4EOGA 5I9IA 3FYUC 3SVLA 1EFRA 3C5HA 3EK2A 4LBWA 2BKLA 1U3GA 2B4AA 3U2QA 5K6TA 2PMBA 3OFSA 1E64A 2R8BA 1TW3A 5EJ9A 3K9WA 4U02A 3ZDQA 3PHHA 3Q9UA 2FH5B 2FJPA 2FRXA 2VDWB 4ATNA 3H9QA 1ZLYA 4MW4A 4I2JA 3JPOA 2IXTA 1Y6RA 2HMUA 2WVAA 2X2OA 3OCWA 4YV2A 4TROA 3SMVA 3I01M 1TYEB 2R1VA 2HRBA 3D02A 3OPYI 3O4GA 4WN9A 2FWAA 1I4DD 4ZAVA 4XASA 4D8XA 1Q0QA 1KSJA 1TQ6A 4B32A 4Q44A 1KHTA 1ZM4A 3KFVA 4X90A 1RIIA 5E8RA 2B99A 1PGOA 3L4EA 3QE4A 3U13A 3KALA 4E1VA 5JCOC 3BD9A 2ZTVA 5TPZD 1W46A 1Y8RB 3LDAA 1SVWA 3BL5A 4QDXA 1NV8A 3UV6A 4DRXA 2FHPA 3OICA 5JMPA 4B0OA 2W98A 4BU1A 5G3ZA 3R0ZA 3QZUA 4ND7A 4RPGA 1U0NA 4UNRA 1YRQA 3LCCA 1HLGA 1BVSA 2PTGA 4OL0A 4AZVA 2PPLA 1Z5ZA 5DW3A 1KYWA 1VDZA 4RF4A 5EQJB 3HRHA 3RU2A 9ICEA 4V0SA 5KVSA 2IEAA 4WN3A 5DCLA 4WXYB 2O7NA 4TMFA 1OFTA 4HLDA 1CEXA 3RYHA 3SKXA 2ZJ8A 3KLBA 3RAEC 4TGLA 5J59A 5JSFA 5CPBA 3CRQA 1UBLS 4KR2A 1QSLA 2WAXA 2E8OA 1DBIA 2BF7A 2GNPA 4M1KA 1G60A 1KOJA 1O94A 1VBMA 2B4RO 4F5OA 2GYWA 2RH9B 2W6NA 2PRKA 3HJNA 4KFRA 2FPIA 4S2EA 4WZAE 4PANA 1CZNA 4DM7A 1M66A 4JIGA 3PFCA 2IY8A 1LJLA 3N74A 1C9JA 2X9GA 2CLKB 3I2JA 3LVFO 4D57A 3N7SC 3QG5A 5T8KA 3UV3A 4H3SA 4C29A 4TZ0A 1E4EB 1PQPA 2R62A 3E4DA 4G65A 5LQDA 2H2IA 1WW3A 2PGOA 2DRIA 4JIMA 3G0BA 3OE5A 1PL8A 2ZSHA 1XTVA 4XSVA 2JBWA 5TDHA 3ULKA 1OWPA 4ZVLA 2A4MA 1WW2A 3GJ6A 2PUAA 3T9AA 2RP5A 2VSOA 2HYDA 2D0OB 3LLVA 4U6QA 4HAXA 4JI8B 1AX9A 3O8BA 1JDBB 2HMSA 3OJWA 4GX0A 5ESDA 3OM8A 4LXIA 3IEPA 2HRZA 3PGVA 4Q3CA 1N2JA 1DE0A 3O31A 5AJWA 2ZSAA 4TLMB 4KWEA 4F50A 2XUAA 3F71A 5ILOA 1ULBA 3ISJA 5CHEA 3GCZA 1NVEA 3QJGA 5ICEA 4I28A 3B51X 2EDCA 3ZY5A 2B94A 3AFIA 2ZTLA 3CLTD 7ICTA 2IYFA 1GRCA 2DPLA 2O7VA 2XT6A 1OWLA 2H31A 4BMXA 2O8VA 1E6CA 4WXPA 4RCZA 2OA0A 3DZKA 4EJSC 4BV3A 4IV8A 1IQ0A 1K97A 5GINE 4ZJPA 1KKLA 2O2IA 2X3UA 4DVGA 2KVCA 2H2AA 4CW7A 2Q0QA 3IE0A 4LEIA 4UBMA 1KS2A 4CM4B 5FOTA 5KAPA 1E2EA 2VK1A 4POOA 1MTZA 4GFDA 5DMXA 1KSHA 1PR0A 3QOWA 4JLAA 4OB8A 2C2BA 2ORVA 1GXSA 1TAQA 3FZYA 3G0GA 4FHEA 1OLXA 3TX6A 4D26A 5F3XB 1QGOA 3U4MA 3T5MA 2BL4A 5BNZA 1S0UA 1AGPA 3U4DA 3IR6A 3DFUA 4WK4B 3FOZA 4AZ3B 2D1QA 4ADSG 2ZSBA 5IM4F 4NXZA 4ENWA 3H1AA 4CHGA 3WYFA 1UC4B 2VAPA 3YASA 2DWCA 3ZX5A 2YXPX 1MB4A 2QXYA 1Q3HA 2HBJA 2ZG6A 4FONA 3W7BA 4ETMA 4MV6A 3ZWDA 2WAOA 2IHNA 1JEQA 3PD7A 4A4DA 1XPRA 1IG3A 1ZQHA 4MHOA 1E9AA 1R8JA 4J0KA 2HSWA 3ZCUA 4DQRA 2BCUA 1YQEA 3G7NA 3L0YA 2FPPA 3ZS8A 3LBIA 3CRXA 3E61A 3KV1A 3KV3O 4M9GA 2D5IA 2VJKA 5GJWC 1ECLA 4WKCA 1ZQAA 1WUKS 1ISJA 4KXNA 5AVSA 4QZ8A 2WJ3A 4M46A 4EGCB 3QRWA 4JBYA 4JC0A 2F64A 4B31A 2DSTA 2HNKA 1BFDA 4P08A 2J7PA 3TXAA 2KX7A 4JJ4A 3CUVA 5C3MA 2JIZD 2JJ2A 2WFAA 4KO2S 4YIHA 3A06A 5CU7A 1OAOC 1B3RA 2HCBA 3VZCA 4KQWA 1W581 1KAQA 3ML1A 4MB0A 4OFBA 4MGHA 3V55A 4C2AA 4GVXA 5SYNA 4C3OB 1HT1E 2D8CA 5FWDA 4ED7A 1DK2A 4WA7A 5A2QA 4PYOA 3QXHA 5KNIA 5CB4F 1FDIA 1U9JA 2NLOA 4WBNB 4JL5A 4Q9JA 1GAQA 3D6HA 2IYZA 1C7JA 5EMMA 4P4OA 3N8KA 4LIPD 3GJ5A 3LGXA 2CMFA 821PA 5JFGA 2BGGA 2OBBA 1GUYA 2PSDA 1NOJA 4B9UA 4DWWA 2C1XA 3HCNA 3P27A 2I6SA 1Q83A 2CJPA 1CDOA 2RAFA 4L7VA 3Q8XB 1KORA 2RIPA 3DE5X 4ZI2A 1TTQB 4WKNA 5KDDA 4IRDA 1T25A 3H0MB 2A0KA 3FPSA 4ZC8A 4DNXA 1UOOA 1J8MF 1U3FA 5KNLA 4CLEA 1W47A 2RI6A 1P75A 1NUAA 4ECXA 4BXOB 5E4JA 3SF8A 2GJ4A 4XPIA 4WESB 4R9NA 1T10A 3EXG2 2BI8A 2ZSJA 1G16A 1T8YA 1SHJA 4E6EA 5BV7A 4JQCA 4X8LA 4YGYA 4B7UA 2RGEA 1MW8X 3LP5A 1A5TA 4J1QA 1NNEA 2HVHA 1XLUA 4UHFA 2OG2A 3DAYA 3G5UA 5JO9A 4PZUA 1B0XA 4KDCA 4JWKA 4ED6A 3T7JA 1M2VB 1YL6A 1ULHA 2Y68A 3C7KA 3KFXA 3AJAA 1YZYA 2OBXA 1MT0A 2OD7A 1DEOA 3OE4A 1AROP 1YRBA 4R3NA 1GSOA 1E5LA 2EOAA 2FUEA 4A82A 1VMDA 4B9EA 4EA8A 5ALZA 3AVWA 2EZYA 1N1DA 1XSPA 9ABPA 4BO1A 4N0MA 2PZFA 4LVSA 3EXFA 3GFTA 2HMAA 3NRCA 4FTWA 5TVGA 1E3LA 4AP9A 3PNCA 2F48A 2ZS8A 1CPYA 3MB8A 4YJ3B 4HAVA 1GNRA 1PJ8A 2ZITA 2XGPA 2AQHA 4P81A 3HYLA 4PHAA 5AW8A 1BCSA 5LP1A 2YL2A 2C5AA 3VPFA 1N0HA 3JVDA 2DKFA 4Q3AA 1DAFA 2PH1A 5KT6A 3CW2A 4JUAA 1TK3A 1U3DA 3LDUA 2ST1A 3F2IA 5IASA 1B22A 5CWRA 4MK4A 1G18A 4G5QA 1WUHS 4UHHA 2X22A 4JR2A 5JVDF 3GLFA 4BAZA 1WDLA 2IEDA 4OHWA 3BSFA 2GHTA 3FOCA 5JAZA 4LPSA 3ZQJA 1Y88A 3WC4A 1XZMA 1U48A 1R16A 1F06A 3ED5A 1L1FA 4PHDA 5MDHA 3AR3A 1LSOA 2HWKA 5HPYB 1FP4A 1VHTA 1H85A 3C5EA 2YVUA 1A7KA 2QUZA 3W7VA 1PUIA 4FMDF 3ORRA 5EKSA 1VMKA 4ZA2A 2Q9CA 2OHFA 4ZIRA 1T6YA 1Z15A 2KZZA 1MOPA 3BQ0A 2RGYA 6ABPA 3OWHA 5G4LA 1AKNA 4DLZA 3T7EA 3PWTA 3D3WB 4QFCA 2V7VA 2ZRGA 2PMZC 3RFTA 1C7RA 4A03A 4EHAA 5BNWA 3THXA 1T8EA 3TRJA 2C3MA 1IIBA 4MV0A 5GONF 3USZA 1Z25A 2VWQA 3VU9B 3Q3VA 3Q3IA 1C1XA 3KWFA 3N0TA 4QPPA 5HQJA 3NHYA 4EZ6A 1A4UA 1PWZA 4H0FA 4I19A 4M7PA 3EEYA 3B0XA 2Z09A 4RV4A 2CD7A 2LXNA 1QQ6A 2P0YA 4FDTA 5KFUA 4R81A 5EJFA 2CFOA 4YT5A 1QG6A 1WX1A 2Q5LA 3LYLA 1EQAA 4QUKA 4M88A 3HJEA 2QVGA 2WB1C 1NF9A 2B0JA 1F4VA 1WM1A 2C0CA 2VUHB 4OEHA 1T3LA 1Y6JA 5EZYA 3FETA 2O8BB 3RQSA 4E2ZA 2NXCA 3CLSC 3HB1A 4RK6A 4IX9A 2O8CB 1SBIA 3I01A 4XW2A 5J0WA 2FYTA 2Z3VA 1Y8CA 1IBKB 2A7QA 3RLFA 5CA0F 2F1JA 4KQKA 5FULA 2RGRA 5KTNA 1QLHA 4AC9A 3AIMA 1BWPA 4U7TB 3BFVA 5GJVC 4IUCS 1M67A 3B5IA 3EFOA 3Q6NA 4HJRA 1DJQA 1GV0A 1P2FA 4XWWA 1EP9A 1TMKA 4MUIA 3D4PA 3P2EA 3TIXB 4F45A 3ZHSA 3N2IA 1W93A 1RI1A 3LPMA 1MQ9A 1FLAA 3OMXA 4F0JA 1MA7A 3V4RA 1NZFA 1SQ6A 1K63A 2ZS9A 4KLQA 1M72A 1G8SA 2QLTA 5KFXA 4JQYA 5GWXA 4QLBA 1FSPA 3M1YA 2O5VA 2E2WA 1DBSA 3KS9A 2DEUA 5LIPA 3R0VA 4BAGA 4TTAA 4E2WA 4CIYA 1X77A 4DB2A 2AMVA 4FWTA 2C7BA 2RHDA 4PGXA 4N8DA 2BGTA 1LQ2A 1NWHA 2BUCA 1QOZA 2O4CA 1BHQ1 2H1CA 3CX6A 1K5HA 4Z6DA 3BL8A 3GLQA 2VJDA 2F3TA 3KYCA 4GUAA 8ICRA 1SKYE 1NYQA 1P2BA 1WCWA 1YTLA 1GQRA 3Q88A 4KC0A 4L4UA 4Q66C 1C3VA 5TSDA 1ZQSA 4KAXA 4X3PA 3RC7A 4H1UA 4TMVA 3WWYA 2JEGA 4NL9C 3VR5D 1QVRA 2G80A 3LBYA 2B4TO 3L8GA 2UYHA 3V6LA 1D2HA 4GRDA 5JXWA 2JJ2D 4RM3A 3HBNA 3I8OA 4TMTA 4PCAA 5A9RA 4PPQA 4AQDA 3VJMA 4WXHA 1MN8A 2ENUA 3PGXA 2FJ0A 3IR5A 4M4SA 3CZPA 5FEUA 1SKAA 1U4NA 1XCBA 3HZZA 5DNUA 1DAMA 1U65A 5BSEA 2H2FA 1A8HA 1XNGA 1Z33A 3GOQA 4I9UA 1U3WA 4HYKA 5KAMA 1MJFA 1NVFA 1EVJA 1KJNA 3FYSA 3BHJA 2JZNA 5DRYA 2GQ0A 3IKVA 3CN7A 3VR5H 4JP1A 4PYJA 2FLVA 2NTNA 2ODBA 2A6PA 5JCJA 4ZEOA 1JF8A 1P7CA 4WI1A 4AFNA 3ZKAA 3S6JA 3AI7A 2VWGA 4HGRA 3RTAA 1ZJWA 1N2CE 2FF5A 1KRXA 3ZHVA 4UM8B 5DBCA 8ICUA 5A0FA 2Q5HA 3WYCA 1PG0A 4ERXA 4UUNA 5HZGA 2UV8A 1MR3F 2FR0A 2HXYA 4JLVA 4MLDA 4S1TA 5D51S 1SELA 1GKYA 3VCBA 5D84A 1XAJA 4EG5A 5F9MA 5BSMA 2DPGA 1DKPA 4D81A 1EE1A 3BFKA 3VYUB 3TFOA 3RAFC 3A10A 1FTNA 2NU8B 3L9XA 4GLBA 3B3GA 1P9RA 4EF6A 1OYOA 5G0WA 4DIEA 3PJFA 3OCCA 3AR5A 2CWWA 1VBNA 3FPAA 2UDPA 2ZR0A 3W2GA 1FDOA 4AF7A 1D4ZA 1FNBA 3OCUA 2BEUA 1Z5UA 2GXUA 4BLPA 1JNXX 3WTBA 1PDWA 1YMUA 3UMSA 1FP6A 5BN1A 2XOEA 5EHZA 4EI2A 3ZGZA 3RJKA 1B8OA 4RD4A 3SYTA 4MAFA 1WQ1R 3V72A 3LCUA 1G38A 3X1MA 4OP2A 3JZFA 3R5KA 1V96A 1YZFA 4RMHA 3VDXA 9ICQA 1ODLA 1N0IA 4CLDA 3TCKA 1UBHS 4UAWA 4ECUA 3HCOA 5LKRA 3EIHA 1IZYA 2X4LA 3NRZA 4TUPA 3VU1A 3CNQS 5JI3E 2B4YA 4YV1A 1QC5A 1FDRA 2PXCA 3KJIA 4YRTA 3IUBA 3UEOA 5DASA 5GM2A 1U28A 3KE8A 3CG4A 4E5MA 2Q3EA 1K8RA 1O7JA 2H92A 3AF3A 2Z8YA 4B74A 4WA8A 3UHFA 4CMAA 5IH3A 2UZIR 1AMOA 1ZU4A 1JH9A 3FLBA 3N58A 4DSKA 3M6FA 2JGMA 2VHVA 3B9BA 3I9FA 4OHKA 4X1IB 4JGIA 3PKIA 3UMVA 4AUMA 3HX0A 1JIXA 4PBRA 5CVVA 3TRKA 4Q4CA 4HG2A 2FZVA 3G9UA 2MUTA 1ORDA 3L7NA 1CG6A 3E22A 1SL0A 4BX3A 3OESA 4EZ9A 1UDXA 2Y0PA 4MVCA 5DHAA 4W1QA 6ADHA 4JX8A 4MWZA 4UM7A 1E2LA 1KA9H 2IQIA 1K4MA 1DK3A 2QNRA 2QQEA 3WIDA 3QX9A 2J6SA 3IP8A 5IJWA 2OXOA 1S0MA 1N5DA 2V4ZA 4OFWA 1XJ0A 3DKIA 1T5IA 3H4IA 4F2SA 4GS5A 3PVXA 2CXHA 4J9NA 1EA7A 1UDAA 4ARIA 1IBRA 2X4DA 3AJDA 4GX1A 5EIHA 4D5EA 5LDDC 1SOVA 1F1BA 3LL7A 1T5DX 2C88A 2GO1A 1NE7A 3GIKA 4EEYA 1A97A 1NLFA 3B3QA 4RHEA 4ZREA 1MC1A 2LMRA 1XUOA 5EIFA 3QWFA 2ADOA 4Q4HA 5EI5A 2BBTA 3TM5A 3BUSA 3GGJA 2HU7A 2OQVA 2AQ8A 3USES 4CIXA 2CF5A 3MWJA 4NMLA 1DTWA 3FMFA 3NHPA 5EN4A 4IHJB 3JPTA 1LKYB 1F14A 1MC5A 1YBFA 1FRZA 2VT2A 3FWHA 1DARA 1GAWA 1GGVA 2R65A 2VP2A 3OA0A 5ER6A 2RGNA 3BF8A 3V7JA 4AKHA 2VJAA 4XE5A 2A9RA 2WE8A 2Q5FA 3D3NA 4P3KA 4Z9XA 3RBZA 2Q1UA 3RJMA 2VP3A 3ZWWA 1TAUA 1PT6A 1T1EA 1LPPA 1KVSA 1SWWA 1ZJYA 1JIIA 3MSCA 3UJ3X 1ZJ5A 4CKBB 1E5XA 2C84A 4MHSA 4YP1A 2E4ZA 3K8ZA 4AY4A 1GPAA 2X4GA 4EZBA 1WWUA 3NH6A 1VPTA 4P5EA 2J6HA 4ZU3A 4COOA 3UBTA 3H9BA 4RHUA 4WNAB 3CMCO 2BM0A 3PXXA 4FX2A 4PGFA 5HR6A 4TSFA 1KSFX 5FL7A 3ESBA 3SS8A 5COQA 3EFEA 3QE9Y 4QARA 1B6TA 2YR0A 1AGNA 3GLUA 3GFPA 5J29A 1SY7A 1PEKE 5DM4A 5FKJA 3S44A 5SICE 1GPBA 5C2JB 5KWSA 1P7DA 5YASA 4M3NA 5EOZA 1ZVKA 1UBEA 1YI8A 2GUWA 2W9CB 5L1JA 1OHHA 2Q0HA 2ZRDA 1NASA 1BSVA 2Z6VA 3IEIA 2N3ZA 4JJ6A 4CMEC 2ECFA 3PV8A 4ES6A 2WD7B 4JDUA 3MWDA 2D2XA 1CIJA 2GOYA 4XTCS 3GJ0A 1JSCA 3ZWCA 3I6ZA 3OF2A 1DWUA 1T5BA 2LDBA 2OV8A 3KLOA 4UUPA 3QPCA 2W9MA 1PYOA 3O74A 2VPPA 4D8VA 4AICA 5KFDA 3OLXA 5IJZA 5BSUA 1HL3A 5KTQA 3GRPA 3JSXA 4FUQA 3TMYA 4D3YA 4QOHA 1F0NA 5AI6A 5E6SB 3KUCA 3N76A 2X5OA 2H08A 4AG3A 4INJA 3RVBA 4E4YA 3MFHA 2B25A 2GXSA 3KTQA 1NHGA 4KUEA 4XKJA 3ZCTA 3R8FA 1EX6A 2IX9A 4RPZA 4NBWA 5HKKD 2OKGA 1YR1A 1M2JA 2UVPB 3G82C 2WHXA 1EB8A 2XZTA 3PVCA 2TYSB 4PHHA 2XCTB 3HSKA 4AECA 1JFLA 2GKGA 4KXFB 4TL6A 1XZQA 3OUZA 1DC8A 3OPVA 3HN7A 4LZLA 3WMEA 3KQPA 2IS6A 1CI4A 4EO4A 1M5TA 1PJLA 1IUNA 4N8SA 5CA0A 2JIPA 4LHSA 4KFTA 4RLFA 4EX6A 3K1TA 4Q3OA 2WTNA 3DBVO 3T1QA 2A3RA 2HLDA 1TFRA 4Q4AB 4XXHA 3L18A 3S1SA 3DW3X 3FGOA 4TYYA 4QFBA 2OY0A 4BGUA 5A7FA 1L5MA 2W8LA 1KMHA 1A98A 4WXEA 1BMFD 1OX6A 1GGKA 2NXEA 1R5JA 2PANA 2P9FA 3RSHA 4HZUB 3D2BA 5F3WB 3H9JA 1MAVA 4CTMA 2BKVA 2CDAA 3B38A 1G1MA 1YZUA 2J5QA 2CBZA 3HV2A 1L9KA 2YOHA 3DBRA 3QF4A 4RUCA 4IG4A 1V8BA 2WUVA 4TWRA 2XEXA 4Q9IA 4O4IB 1ZYQA 1W5EA 4H60A 4LY9A 1BHO1 2Q28A 4FBMA 1DTSA 4DJ5X 3CQ9A 3OT5A 4J43A 5T4EA 3TLCA 2NTVA 1B42A 4DJJA 1L5LA 2NRZA 1I9GA 1MDFA 1V16A 2I7VA 4XJTA 3KK0A 4RFVA 3WOVA 1NMXA 1TE2A 2P9EA 2PS3A 2R6FA 3MYYA 4EUSA 3GNLA 2VT3A 2ZDHA 1PTJA 3B6MA 1L2TA 3OLQA 2JZBA 1KZYC 2JHDA 1T6BY 2JANA 1GG9A 2O0HA 4FZ5A 4PGYA 4TLEA 5L3ZA 1XA4A 3LXMA 3QG1A 2CHQA 2VZLA 4C5BA 5C34B 1EJ0A 1Z8FA 2PRYA 1OZFA 1I4OA 5E2AA 2DZDA 1QDUA 4ARZB 3E9NA 2OGUA 2JFXA 1AK2A 3DZDA 3NHLA 5GPBA 3ZWYA 2DF8A 4OYLA 2RBKA 4R8KA 4DBLC 2YN2A 5EVJA 3ZEIA 2Q3CA 5F23A 2C57A 2P4HX 4LC1A 5KVAA 1CYEA 2ZRAA 4LISA 1HFKA 1HT2E 1XZKA 2Q5IA 3CH5A 3CNNA 3IQFA 3NHUA 3WNDA 4D44A 1EESA 3LC2O 2I6GA 1DJOA 2ETVA 4YNBA 2QI9F 3WLRA 4MEAA 2OR3A 1BGXT 4ED3A 2ZAOA 4OI2A 4NOKA 4FMDB 4LNUB 4P82A 4PHFA 1ESNA 1SRQA 2FB9A 4LVNA 1FDVA 3UKJA 2BGUA 2BPFA 5D7NA 4AZ0A 4TZ6A 1GZUA 1D09A 1SEVA 4EHKA 5KQRA 3BTSA 5TEWA 1E0KA 3BHIA 3NTXA 4ZVOA 5JFOA 4JC8A 3KNZA 4H6VA 1NM5A 5HX7A 1X0VA 1HE8B 2KK0A 4ZTBA 3HKCB 4ZV7A 4KLGA 1EVLA 3C3BA 5MN4A 1NA5A 4O29A 5HFNA 3LUFA 3EUAA 3QBEA 5HOEA 1GTL1 1YI0A 3OHPA 1M3SA 2XTMA 4PBSA 2DHEA 2H4XA 4GR9A 4B40A 3REQB 4KMOA 4KSYA 3A6KA 5IEBA 3UN1A 4RIEA 5CD1A 1VLJA 4I1IA 1BJRE 4MARA 4BNKA 3IMEA 2WSSA 4CDRA 3VUFA 4CKCB 1KAEA 2BPOA 1CR4A 5ALGA 4KX5A 1LH0A 1OTYA 1R3UA 4MEJA 3AM3A 3L7BA 4NPCA 1FP1D 4RVNA 2Q4EA 4F4IA 4N3BA 1ABBA 1TTTA 1V7PC 1XDUA 2WT9A 1GQ2A 1G21A 1E63A 1OWNA 3LRPA 3BS5B 4JXJA 3C4QA 3IIMA 3QI2A 4JQOA 3ZE6A 5BMOA 1XCGB 5LD2B 3STVA 1KJQA 3TW8B 1CY8A 3A1VA 5EHGA 1T2UA 3HS3A 3VR2A 3L0CA 1LVHA 2DFVA 3P2IA 3F96A 3NT2A 3PITA 4LI3X 2LWIA 4QASA 3BBPA 2DGZA 4U5XA 4D9HA 5LU8A 3COZA 4WOKA 1G55A 4IQTA 5IT4A 4YR7A 2CY0A 2PRIA 1G9SA 2WIBA 2PVCA 4D74A 4E21A 5E3JA 5KSOA 1KC1A 3K73O 2GF9A 2P77A 4NDAA 2POCA 4GSYA 1UPAA 5DGIA 3WLLA 3LT2A 4X8HA 4CMIB 5ILGA 4GE0A 3RYFA 5JDIC 5LNK1 2WQ7A 2Q0ZX 1LV8A 2BW0A 1XPJA 1ZOOA 4GP6A 4L73A 3IKTA 3RK1A 1PIWA 2E6KA 2BRUC 2WWWA 3IP9A 1ZSYA 4FD2A 4LE2A 5IF3A 2HUPA 2PPVA 5TT1A 4BMVA 3IEXA 5KOYA 1U9CA 2EP8A 1K2VN 4QREA 2B92A 3UCEA 3LYAA 2CUNA 4HXYA 1CCWA 3DH0A 5BVHB 1SVLA 3GFGA 2XUDA 3SIXA 4N3NA 5CM2Z 3AHEA 3G8BA 5FD8A 5BURA 5MN6A 2KFZA 1QHYA 3HJGA 3DOIA 4KNVA 3TTXA 2RDIA 3FWNA 3TAPA 3DYIA 4IDOA 3RNLA 4U0KA 1MV5A 4ALJA 3A27A 1TO1E 2H5EA 1C3LA 3CBGA 4IG9A 3I5YA 2BQRA 3R9KA 3ZVRA 3L82B 1HXHA 1KO7A 3DOOA 2M1XA 2ORYA 1A2QA 4HAZA 3QBDA 3ZXUB 2HV9A 3IQZA 3PI6A 3DOHA 4YT4A 1P61B 2F9FA 8ABPA 4QHSA 4W82A 4EI8A 1F7VA 4IKEA 2ZR7A 5ER9A 3SQIA 2BQ3A 2V6MA 3WLJA 3ZNQA 1S3SA 4PPYA 5IILA 1Q95A 4G3XA 4KBGA 5BQ5A 3RBVA 3CVWA 1DKLA 1PUJA 1SXJB 3EMVA 5J2EA 4HFRA 3SZUA 4G01B 2HT1A 1A2OA 5GM1A 3WRXA 4UE3S 1J21A 2CVHA 2X15A 4B6GA 3V80A 2IHTA 2OMKA 3EUB2 4YV7A 2AX4A 4MQ6A 2XCUA 4NP6A 1A9RA 4KQ6A 4EBCA 4F9TA 5TMEA 2KI5A 4QKQA 1HDOA 2RHFA 4E3WA 2M6SA 5BV8A 5JNLA 2JLXA 1OZHA 2AFIB 1F0PA 1X2BA 3KQTA 3L8YA 3O26A 1SURA 2ZR9A 2V7UA 4JUCA 4KEAA 4GC9A 4OY3A 3SQOA 4BCDA 3R77A 1CVIA 4ZT7A 2PFSA 3CP8A 5BNIA 3MJFA 3KQOA 4GPZA 2H8KA 2C4TA 1GN8A 2JH1A 1T1GA 4XD2A 4RNOA 4D46A 4XEHA 3E8MA 3SKYA 1REQA 4C0QC 1L4HA 1M2WA 2AS0A 4FYJA 1RAHA 1P7WA 5AOVA 4J3FA 3T7IA 1RMTA 1IOZA 1Y4SA 1YCGA 5AHKA 4MWSA 4OJTA 5CCBA 3IUJA 1HQYE 3P8ZA 4HMOA 4L6AA 1CK4A 2ZXEA 4I66A 3T4XA 6AT1A 3RVRA 3LUPA 2AXEA 3OCVA 1N6NA 4Q01A 3WFIA 4ESOA 4R0MA 2DLNA 4ZZ2A 4KR0A 4AD8A 2ZBVA 1THMA 1X7XB 1Z6XA 1NX6A 2QL5A 2WUDA 4NH0A 5DMHA 4Z9AA 1GZ3A 1PJTA 3B2QA 4I3FA 3HM9A 2XNCA 5LBTA 4DW8A 4ENTA 1X1QA 4P32A 2QN7A 4C2TA 2NRWA 2BHRA 5CYFA 3REFA 3ROQA 3SNKA 2R8EA 4DA0A 4EJ6A 4AX8A 4TKVA 3OZAA 1QFJA 5IH7A 3PW7A 2ZSUA 1OTHA 4OMFG 1B1CA 3QNUA 3H4TA 5FOXA 1ZUHA 2YW2A 2NO5A 1Z74A 1HKUA 1U9ZA 3IDSA 3K94A 2JCBA 1XYYA 4TZKA 2ZT8A 3HRIA 3IJEB 1ODSA 2NWQA 4ZOEA 3KLPX 2XV1A 1DCTA 1W88A 3UJCA 3U5TA 3NS7A 4Y2GA 4QXPA 1FFUA 3O75A 1L5GB 1OXTA 1KVQA 5CFNA 3ST7A 2VT7A 3WNBA 4PSVA 2WG2A 4ACAA 2G7MC 5AW7A 5B5SA 4QHYA 5HE9A 3PMLA 4LZOA 2NSYA 5J2TB 1QZZA 1CUXA 4ZVUA 5K3BA 5CB6A 4PZYA 1XTQA 3CINA 4O4HA 4PZNA 1KQ3A 1X7ZB 2BFFA 2VPQA 4PXAA 4PZZA 4YHBA 3T79A 5JNWA 2D3TA 1A7AA 3BXXA 4HPXB 1UFKA 4NMHA 4E03A 4YQFA 3JAKA 1M76A 3VTKA 3CURA 1II8A 1GZ4A 3EBOA 2BFEB 5IAJA 3DAFA 3D4IA 4AMVA 2P79A 4FJ0A 4KMUA 2JH3A 3LTEA 1KYYA 3NDJA 2H9AA 4GWGA 1J0EA 1UKYA 2E1FA 1AVTA 4JUFA 1M6HA 4RZHA 3RHFA 5B1EA 3HB0A 3LOQA 1HLDA 4G4SO 3ZR4B 2Z08A 3MUNA 1V5FA 5TPWA 1ZVMA 3DHVA 2Z57A 2F1RA 2AN3A 1ST3A 5REQA 3DLHA 1CWUA 2V5VA 5D1NA 4LZWA 1E0AA 2DGDA 2NUTA 4BATA 4GAEA 4EO7A 2Z5GA 5JXJA 4YROA 4UHEA 4CN8A 4DQLA 4P35A 1AQLA 4YMMA 5C4MA 1GADO 3D7LA 3MOGA 3RK4A 2PBZA 2PL5A 4HKTA 4O0MA 1IEQA 1H0HA 5FQOA 1R9JA 1ZH2A 3DHNA 4D96A 3ZDBA 2Y99A 3LCMA 4UZSA 1WCIB 3SC4A 1SZJG 1ID8A 2OCPA 3QGMA 3ENZA 1GU1A 1UKEA 3BJRA 3EZ2A 4LYAA 4XWTA 2W2LA 5ARDA 1RBZA 2B4QA 5HQTA 2JRLA 2R1UA 1TB4A 1T3GA 1C50A 3JU3A 3MCAA 1V4VA 2GLUA 2X6RA 2ONKA 3GLVA 4GOOD 4UEOA 4G0XA 4UDOA 4RDXA 4IP0A 3F5EA 1N8TA 1QGAA 1V5IA 2BD0A 2I1WA 4DG9A 1OZGA 1QWSA 5EIBD 3GT0A 3JCZA 5JCXA 5G1PA 3UH1A 1UBSB 2J9FB 3WJ2A 2VQ3A 3KZCA 2RHRA 4L8YA 1C5KA 1JBQA 2B30A 1RKXA 3OIDA 4BJHB 2C8LA 3KCNA 2BN4A 3SEQA 1CEZA 1QYWA 2IYQA 3F2DA 2ZCVA 1TI7A 2ZAIA 2ZU0C 1UA1A 2ASEA 3E2MA 1XP8A 2I9PA 3I6YA 3W2IA 1VKNA 1BKYA 3ANSA 2FLPA 4U7CA 8ICAA 2O0LA 3EAFA 3M4JA 4JU8A 1RC0A 5LA6F 3U3JA 1GVNB 1NONA 1VTKA 2HU5A 2GCEA 4JSYA 2Z5FA 3QU2A 1A9OA 3HLTA 1Y1TA 1Z4MA 3N39C 3TLKA 5IF9A 2B9VA 1D3AA 2AMJA 1RI3A 2YFQA 1TUIA 5TQ2B 3L7AA 3I6MA 5F1OA 1NOIA 2FP3A 2FPXA 3DM5A 4M0KA 3UHAA 5IJ0A 2GASA 2NADA 1DIAA 3JQCA 1FMFA 2YHUA 4YVFA 2HF2A 1TK8A 3B6KA 4F7DA 1MKYA 2A94A 2ZULA 4F8EA 3P2KA 4EBFA 2JL1A 4PXYA 1USWA 5ECYA 1D8TA 3O83A 4AJIA 3PS9A 5LA6B 1IHYA 1NUHA 3KR2A 4CMEA 1I3LA 1U0BB 1G3MA 5DYNA 5EWJA 4Z6CA 4G25A 4ARAA 3ZCRA 5JCZA 2ACWA 4JLBA 4NIMA 2QGZA 4DV3B 3GZTB 5B1HA 1YE8A 3E5HA 3PUIA 1GOTA 3WRYA 3S2SA 2C98A 3EVAA 1Z4IA 4CQMD 1A96A 4Q1AA 1RZ3A 4ITVA 4EITA 2PKQP 1QHHA 2BMJA 2Q6LA 5DWVA 3PW0A 1ZGJA 1I0ZA 1MAUA 4K3UA 4AO7A 4C0BA 3WO0A 1NK0A 2FWJA 4O8CA 4RL6A 2XVTA 4O9MA 2OOKA 1V47A 2OZLA 3PQ5A 4GBJA 1DWOA 1JYFA 4K88A 4PN7A 5L1KA 5IYZA 1XDDA 3DOJA 5DULA 3QWHA 4R9UC 3FHOA 1OB2A 3QE3A 4DSZA 1ODKA 3OKFA 1CUYA 1L1QA 3ITDA 3WLOA 2FN9A 5ALYA 5KWJA 2MSEB 3LXXA 4AJ2A 3A1EA 1JJ7A 2YYZA 3NWPA 3MAJA 4Y2RA 2LBOA 1J2RA 3WHLA 1ZNXA 1JFRA 1DG3A 1QF7A 1L5RA 2PFQA 1IK4A 1E79A 4ZXPA 1ES9A 3VHXA 3AM5A 5FA6A 3U31A 1Y0BA 4C6TB 3U9TA 1V48A 4PM4A 4PZDA 5IJ0B 2JFQA 3MABA 1V6SA 5EIOA 2D62A 4YJGB 1K7FB 4KE8A 2RHBA 2WE7A 4LJKA 1D1SA 4QTYA 1FSFA 5JBIA 2HZ7A 1VLVA 5M29A 1NQTA 1B93A 1LRLA 1XVUA 3G23A 3W5SA 5FO0A 1KP2A 2OG1A 4RY8A 4U2CA 3EXHB 1WXXA 3PXCX 4QGAA 3O0TA 3COJA 4JBLA 2KNJA 2HBRA 2ZQYA 5AP9A 5TC4A 3DVLA 1ZWLA 1ZQNA 1R66A 2YZKA 2ZPUA 3I1FA 4IFEA 1X8KA 4GMHA 2G5PA 2J0EA 3G8AA 5AJYA 4BBZA 3IKLA 4MUHA 2O8BA 2W42A 1X9XA 4Y2SA 4L0CA 1KPGA 1QLWA 4IQUA 1KVRA 4MVJE 1OYWA 4E2YA 9ICXA 5F7XA 1MZPA 3G0DA 4ZRMA 5CLFA 2W5UA 4KN5A 2XDAA 3O8RA 1W48A 2Q6IA 3ZGLA 2WQ6A 4U6PA 1U7DA 2R8GA 2A9FA 2C2HA 3UWKA 2QVBA 3QEMA 4KDFA 3NPMA 4HX9A 1R8SA 4JZYA 1XTKA 3DMNA 1HDZA 2P4EA 1C1XB 4MKFA 3HVKA 4JJ7A 4PLYA 1C7EA 3O3CA 3DTVB 3UK2A 4D9EA 2ZB8A 4DYDA 1XNQB 3ZHRA 4DV2B 4BUJA 1AHNA 2X9VA 1SBYA 1BGVA 3GVIA 4LZDA 1BS9A 3EVZA 4OP1A 5EXSA 1KH1A 4ZOHC 2VCYA 5AVZA 4OGFA 1EWQA 4CT4B 1CUJA 3NKFA 4GMDA 3PUXA 3AUOA 4NLNA 2BBSA 2R1TA 1DCKA 1SL2A 4TQUS 5L40A 4DQXA 1NW3A 5I7AA 5TF0A 4YDHB 3MD9A 1T13A 1X7YB 3VR4H 5HUHA 3ZCPA 5TLSA 4B3TB 3T3NA 4EPVA 4KO8A 3K4QA 4M8SA 4P0PB 4HGQA 3EGOA 1SUFA 1EBUA 1T9BA 2NXNA 2FWNA 5CR0A 3RARA 5C8VA 4Z6KA 5FADA 1IIPA 1TCVA 2RHWA 4IF6A 4LGYA 3ENQA 5C5EA 4YXWD 3JVEA 1BD3A 2G0NA 2ERYA 2NO9A 5KL1B 3FTNA 3GUUA 3AQ4A 5FYQA 5TQ2A 1ZFNA 3W5HA 4F2DA 4D7AA 1NNLA 3A1UA 5L4SA 2G5HB 4B5KA 1D6SA 2G63A 4NZOA 2QP9X 1HL7A 4L16A 4A1FA 4CCWA 1UDWA 2G9VA 3PQCA 4A92A 3OTQA 4NC9A 3P0HA 4CGYA 3QSYA 2HHUA 4DXHA 1CQIB 2XVAA 2OCKA 1C0LA 1CZRA 4PN3A 4OXQA 4IUYA 3IILA 4QE3A 4R3UC 1DXHA 2QMHA 4IMIB 4IJQA 4JP8A 2LTAA 2Y9UA 1TRKA 7ICRA 5AHRA 4E5VA 3CCFA 3BWYA 4OHMA 3DEJA 4KQ2A 1V11A 4J0EA 4J9QA 1XU4A 3OG9A 3PHJA 1HDIA 1OXKB 1EFKA 3A2MA 3TJRA 1JSRA 4B9MA 2BIFA 2P11A 2DT5A 2YYYA 3N0VA 4HDRA 1IVSA 2QRGA 3IJ5A 3VPSA 3OQNA 5EQTA 3EZNA 3SQDA 4TRMA 1ECJA 2C92A 3RK0A 5T8KC 4K5QA 2YMPA 1E92A 3I58A 2HOFA 3CWZA 3IBGA 1CY2A 3LKVA 1G9XA 1G20A 1RZUA 1L1EA 1IN8A 1W8IA 3Q15C 4H7KA 4Z5XA 5JC8A 1GTRA 2DERA 4TTSA 2O2GA 1ZN7A 1Q16A 1EUDB 2XA2A 3FXAA 3PRJA 1N5WA 4Q3NA 1X3LA 2R4UA 4CODB 4DIFA 1NJ1A 2XAAA 5TQJA 1NFFA 1SG6A 4BU0A 1CJTC 4DOAA 3UWMA 3TCNA 4D4LA 4CKWB 1R7RA 2YWXA 1BPXA 3LFTA 1RXEA 2Z4TA 2D2FA 2C8VA 4LZPA 1JEEA 3QIAA 3STHA 3U4QB 1KDZA 3AY6A 2HM7A 4UB5A 2C97A 2J59A 3DPSA 5AW2A 4H31A 3TMKA 4C7ZA 2NV6A 4XB6B 3PEEA 2ZR8A 4BJQA 4OQXA 3MLBA 3KB8A 5B58C 5CHYA 4JQSA 1MD9A 5KFQA 3D6VA 4M1MA 2Y1FA 4J29A 4WOJA 4FNGA 3SR4A 3UK0A 3WHKA 3ZY4A 5FORA 3IL2A 3GLFE 1HH4A 2AN4A 3EH2A 1IB6A 1VIVA 1R6VA 2C7PA 1VCMA 3BX1A 1LDMA 1US8A 2MWMA 3X1KA 2YY7A 2Q1TA 3DQZA 1MPXA 1C1HA 3TZQA 3C3YA 2QPAA 5A6VA 3VKGA 3DL4A 4Q3EA 4U7HA 3LOPA 5K3CA 3NJ4A 3KZIU 2DLDA 4KVZA 4LBVA 5SY9A 5KOHB 1AUPA 2MMGA 2OM6A 2X2PA 1G8HA 3A31A 4P4NA 4CL3A 2DKNA 3CR8A 2HMVA 2W90A 2OK8A 4ZYUA 3VMMA 1UM9A 3U7QA 1X66A 1UK6A 5BWCA 1N8SA 1MJ5A 3A8TA 3E22B 2JI4A 4LE1A 2YWFA 4L76A 1ZD5A 1K66A 2A0WA 4BB6A 3DDWA 1NL3A 3I04A 2I4OA 2NVOA 4K9QA 3H8WA 1KXJA 1OJLA 2ZIZA 3IGFA 5CLQA 3HWX1 4WGGA 4QXAA 1Z88A 2W2LD 4QGGA 4EYKA 3QF7A 3UPUA 1KY4A 1QU3A 4F5RA 1RBQA 5ALQA 3VKWA 1BTOA 4UB8U 4AJEA 1DLJA 1G5IA 4Q82A 4YCNA 1V8DA 2NM0A 3FNGA 3N07A 4BWGA 1HOTA 4JWMA 2JXJA 4GI3A 4GMFA 4J1TC 4QIHA 5CG2A 4A91A 2JAQA 4UM5A 5IDXA 1GRRA 3FNIA 3KCQA 4JWNA 4OKIA 4A5OA 3AQFA 4YRPA 1MCZA 1E60A 1HTBA 1VM6A 4P34A 2P3LA 1DXYA 1QH1B 3OF3A 2HIMA 4NESA 1HJPA 2PWPA 5EP2A 4ER5A 3TVTA 1JB9A 3LDHA 5CUQA 2Z6UA 3T5HA 1NV9A 1WXWA 1V39A 1XQWA 1ZQQA 2EW8A 2XJ4A 3INTA 4FFRA 5E4TA 4F1KA 3PENA 3BYZA 3C5FA 5KFYA 3C29A 1DIRA 1N4DA 4J9KA 1RVDA 2HPAA 2IZ7A 3ACBA 3F9IA 2OV1A 3K16A 1Q12A 4Y1RA 5H70A 1LV7A 2JFZA 3ZH9B 3ZW8A 3ICEA 3K32A 3DMTA 5C3UA 3IP7A 3CUKA 1ACLA 2RB4A 4GPAA 3UB4A 3GRCA 1FQOA 2VP6A 1LY1A 2Z2ZA 4WH0A 4BFTA 3FTEA 4OQQA 3B36A 2PUHA 3KEGA 3C3PA 1CUWA 1L3BA 3GA7A 4TLBA 3RKUA 4ETIA 3OTOB 2FDXA 4DB4A 2F76X 1P19A 1DEXA 4EA9A 2CXRA 4PCUA 4UB6U 5MGNA 1XDSA 3C3KA 2JEOA 4RIHA 1N78A 1KSGA 4BBPA 3GD7A 3VOTA 5BUSA 3RB3A 1NPYA 1NR5A 3KPVA 4B09A 4EH1A 4FE3A 1CW2B 4XPZA 5EIEA 1FRFS 1N6OA 3HKZC 3OSUA 2ID4A 5GONA 4OJ6A 3VISA 3ZKWA 3K0CA 3W77A 3FAKA 4E1AA 1XHFA 3A36A 1VP3A 4BCCA 4FLFA 3HJCA 1RT9A 2XNSA 4O2AF 1KMNA 4I1SA 4ZO9A 2OAGA 2DBQA 2CHGA 3K7EA 2PBFA 4TS9A 3EVEA 5KFNA 5LWQA 4G5OA 3X1WA 4GGPA 3CNLA 4XIIA 5SZJA 3X1XA 5BPHA 1ILEA 3ZD8A 3WRVA 2GKOA 2PUVA 2ZI3A 3EUEA 4MW7A 1SHUX 5HIIA 3JASB 4FEYA 2ZYAA 3E9YA 2I78A 1RFLA 5JS2A 3K15A 5HMMA 1NTRA 1C29B 2BR5A 1RWQA 3C3DA 1VJGA 4FHCA 1BN6A 2VPWA 4S0XA 1EXDA 2JGIA 5F1KA 4BX9A 1T1JA 5HSGA 1GDHA 3CVJA 2WFZA 1E7WA 3CX4A 4NFHA 4IDQA 3DM9B 4RTRA 2JGFA 3EGXA 4KFCA 2DPJA 1DKNA 5GV8A 3ME5A 1LEHA 1K92A 2VYQA 4CM5A 4LQ4A 2X0NA 5U9CA 5F9HA 2HCJB 4BBJA 3KJGA 4NK5A 1I2ZA 5IIKA 3PQ2A 1ENOA 4EQZA 3DDZX 1YR2A 4JLKA 5JFTA 4BMPB 2HA5A 4CI9A 2GZMA 1SPBS 3TADC 1D7AA 2W4IA 4A0RA 1A2BA 4UB2A 4QFMA 3HNRA 1L6RA 1EAYA 3NIDB 5JS7A 4DM3A 2XXAB 3BFXA 3HO8A 1P7ZA 3EGDA 5CT9A 1K27A 2WAYA 5ISMA 2GSDA 2KFNA 1QSYA 1TM2A 1NP7A 1Z45A 1KQNA 3E8SA 4RTNA 1HNXB 1GTJ1 4QDOA 3HUEA 1TCAA 3DS8A 4XX0A 4BPRA 1R0XA 4MEYA 3LUKA 4B47A 1UT6A 3D0OA 3CR3C 5ANRB 4GHWA 3X2EA 5KNDD 3ESCA 2OCXA 5TJ9A 2VWHA 4ZV9A 4V0QA 4OA8A 5H4GA 1XMPA 1AS0A 2VYNA 4WSOA 4WFJA 4A15A 1A0PA 3D8TA 3FR7A 3ZHYA 2C2XA 2WVGA 4Q7MB 4RFLA 1D4FA 3IP3A 3KSAC 2CB0A 3TF5A 1V6AA 2GAIA 1HE4A 2Q6VA 1M2KA 2OQRA 3C85A 2R25B 1RQ2A 1J6UA 2B37A 1GA4A 2WIFA 1JBKA 3UT6A 1VJ1A 2AX3A 4YD2A 2EG5A 3Q2IA 3ETRA 1NVVR 2CYAA 4WOPA 1SCKA 1PF7E 1SUCA 5G53C 1JHXA 3WLFA 4PRKA 3A26A 3AIKA 2PT5A 5EP4A 3KYDB 4B0PA 3OVMA 2PKYX 2ILVA 1OH7A 4ZKEA 4B3GA 5AI8A 3E9EA 3BEOA 2A78A 1XZAA 2GPAA 2FRVA 4WFIA 1XD8A 3IBFA 4N9WA 3HCFA 5A4DA 3VU9A 3BMNB 3W79A 2OFFA 2BTOA 2XRFA 4MRRA 1XTZA 3WZ2A 4BO9A 4E1BA 3OPMA 3SQXA 4MWTA 2PV7A 1WO8A 2OHXA 2VHCA 3P7MA 4U3JB 1A9QA 1J49A 2D0PB 2R7KA 1QWOA 5J2CA 3L8HA 1K8XB 4ED9A 2AJLI 1TF2A 4PCLA 3QTBA 3BORA 1XP5A 1SIWA 1OX4B 2Q5JA 1RRFA 2NU7A 3D2AA 3D2LA 4J9VA 4X6UA 5KB3A 4LXXA 1EDZA 1P2VA 1IG0A 5KAIU 1GNVA 1IJFA 4IIBA 4CG2A 4G26A 3H40A 4UAJA 1XO0A 4KDRA 1N1MA 3H2IA 4KLNA 4DTIA 3RBDA 1IEXA 4JT4A 2YXEA 4BGDA 2FX2A 3GEBA 3WGOA 5IUNC 1ODCA 3E81A 3EZGA 3R3JA 4MB2A 2FMPA 5E95A 4D4HA 4B4UA 3PDIB 1R8YA 1XDBA 3F1LA 4ZYWA 1BPBA 3BHNA 3IRUA 5KFMA 1CUZA 5IWAB 3H7AA 1QG4A 2RK6A 1YC2A 2PZAA 4IDHA 1H6BA 1G20E 3M6UA 4I4TA 1BWSA 2PD3A 3E4CA 4MOWA 1VRVA 2ZIWA 1BVYF 1DBPA 1PSZA 2EBUA 4DNFA 4PO8A 1N7HA 3HU5A 1ESDA 4MVJI 3ZG6A 5IANA 4Y30A 2XE8A 2W71A 2Y76A 3BXEA 3IS3A 3LA6A 5JD3A 1YQ9A 2I2XB 2QAJA 4BFLA 3M1IA 3V6KA 1NRXA 2ZATA 1CNMA 3SN6A 1SKQA 1NG9A 2FEPA 1G6KA 1K3TA 4DGSA 3SZLA 1YR8A 4IVRA 4O3QA 4OOFA 5J5AA 2FI1A 2E87A 3KU4A 1IXSB 1OW5A 1U11A 1YCHA 2V5AA 3BTVA 1GSHA 3NDIA 1YO6A 1RPZA 1FW6A 2LCIA 3DJYA 4X8OA 1RAAA 4DV1B 1YL5A 2HA3A 3O8OB 1PL7A 5J0OA 3AZPA 4UXJA 4BRUA 4WJ3B 1L9XA 3NKLA 4G0VA 5MN5A 3W9UA 4DSFA 3H17A 2J9GA 3NU1A 2VC2B 2GTHA 4C89A 2GHIA 4GOXA 5LBIA 4EA7A 3A6ZA 1IAVA 3MXTA 2FP4A 3U4GA 6LDHA 1GRQA 4DV0B 4X1KB 4FN4A 3N5CA 3HE3A 3D5QA 5LOVB 1IQRA 3H5LA 3VAZA 1AKTA 1A9TA 1R0ZA 3FCSB 4Q03A 4B6EA 3DV9A 2DY1A 2IIBA 2WABA 3LKDA 3V7YA 1PNTA 4CN9A 3DDSA 5E6SA 3GP5A 4D3SA 3HLKA 4NU6A 2FZ5A 3T3PB 3N6XA 4HNAB 4G2TA 1XPOA 5E9JA 3FLAA 4Z3DA 2A14A 4XI9A 4JYAB 3FPHA 2DXIA 4XRHA 3E8XA 1EU1A 2HHAA 5ES4B 5FO1A 2WTEA 4H1HA 1RLIA 3FHTA 3VYSB 3C48A 4B9VA 4UTPA 5I7UA 3FPCA 1PS8A 2JHPA 2Q4RA 1S8OA 4WBNA 1TOAA 5JSQA 1CRXA 4R7GA 2OL4A 3WIUA 2QI9C 3O4IA 5G2OA 2DWPA 4Q05A 1CX9B 4MV7A 4TL9A 3I39X 4YMIA 3D59A 1XWIA 3LDGA 5H83A 5HBRA 2PN1A 3LPAA 5C5CA 3AXTA 2QL6A 5EZQA 1SB3C 1XVTA 2J9RA 3ZDFA 5EGSA 4IIJB 2IBSA 1GO2A 1XRRA 5NULA 4RT3A 1ZRNA 2IIVA 4CQMB 2GPJA 3CF4A 4GQIA 2GBFA 5ERGB 3O9MA 2H1OA 3STUA 2F8KA 4M55A 1IWPB 2PQ2A 2UVQA 4BO8A 4BRWA 4OGGA 4KLMA 3O95A 5K7SA 1RYHA 3OQVA 2G4VA 4EYHB 3H87A 5LDHA 4YLYA 4F93B 1ZITA 3HMQA 2G28A 1X42A 3PHBE 1FX0A 1OI4A 3TYXA 2IHJA 1NW5A 1TECE 1B2RA 4ZICA 1DJPA 5L9XA 2H57A 4Q16A 1T34A 5AKYA 3O4RA 1A8UA 4KLEA 4PNPA 1E59A 1V4BA 1QFSA 2W2KA 1JNYA 3DPUA 4JB8A 5CLHA 1HYGA 2JD2A 3CF0A 3S55A 5CB8A 1F4LA 4O25A 4ENRA 2PZEA 3CZAA 3LT1A 1JLLB 4MUFA 2JJYA 4YMHA 4YP0A 4AULA 2OUKA 1MABA 3ODGA 3OEHD 1DTWB 3LY9A 5E3HA 1QYXA 1YQGA 1CY6A 4O0IA 1WP9A 2QMZA 3ZXSA 1Q1GA 3O82A 1U8EA 4O1MA 4A23A 1F8FA 1M8FA 3V33A 2KICA 1FZQA 1EGVB 5ICMA 1RLTA 4QUBA 4RTKA 4NS1A 2ZUDA 1ZIXA 2BFDA 4M49A 2ZTEA 3ONVA 3H5VA 4F1WA 3T1HB 4PQFA 1RVV1 3AOEC 3OUUA 4HNGA 2DM6A 3R3ZA 4IWYA 1BE0A 1PLKA 2A4KA 2JRZA 5JMWA 1AZTA 1SQ5A 5HZKA 1JR6A 2ERCA 2B2CA 4LBYA 3GA5A 3QQ5A 1QQ5A 1JPJA 1Z73A 3PXUA 2HY7A 1PDVA 2IY9A 2C7OA 3HPQA 2BCEA 1RXVA 1D07A 2JW5A 2J46A 1X3SA 1FDSA 2BFAA 2HSJA 2Q8NA 4RIIA 1BOOA 4QG3A 5EJ8A 4I6JA 1DIOB 3I92A 3BZWA 5FBQB 4AO6A 2BEVB 1O97D 1EHIA 1WXEA 3BXPA 3ZEAA 1KNXA 4PLGA 3C1UA 1H3NA 4ZOLA 3SS9X 1LUAA 1T24A 4PVCA 3OUTA 1TJ5A 1CT9A 4FEGA 2H5XA 1WSBA 3V1NA 4EKGA 5BWBA 3RTCA 3ELBA 4K86A 3TW6A 1DX4A 3S70A 1GR1A 3OA2A 4G0YA 3ONDA 4UEWA 1UM8A 4L15A 4J0IA 3DW1X 5G02A 4BIMA 3PLNA 3AT1A 3DCIA 4Q4JB 3KFUF 1K7EB 4BNFA 1RYBA 3G6KA 4R2JA 3DEIA 3H5OA 1A5SB 2O3RA 3C5CA 3PDWA 1DNPA 2PGDA 4HN9A 1WMDA 5ERYA 2CSXA 1PW7A 1QG0A 5HVNA 4DSEA 1ZH6A 2A0XA 1L3IA 3BD6A 3HC7A 3L4BC 3WU2U 1P1FA 2VZ9A 4WY2A 1NJWA 1ACJA 2E6UX 3AM9A 1SXHA 2I3BA 3PFFA 4RFSB 3T5TA 1FFCA 3EMKA 2FG5A 3OI7A 3ZDXB 2D1SA 4XD7A 4CHTA 721PA 3A2NA 1J8YF 2CMKA 3O4JA 4RTPA 1USIA 1N8KA 3AJ8A 4CXMA 3NCTA 4M9HA 2YWEA 1Z2DA 4ZDJA 9ICRA 5ADWA 1A9YA 1KR5A 3QA3E 4B2YA 3IJRA 5K09A 2AFVA 3Q9LA 3QXCA 4F3TA 3BWBA 5A04A 1FXWF 2QVXX 6NULA 4KPEC 1S9DA 5GOZA 2CFIA 3QYJA 4XVRA 1Z4PX 4ZC1A 3VTAA 3AR9A 4L5JA 3UXNA 2P4QA 4IGAA 4AG6A 1UAAA 3ETLA 1JLSA 3OAAA 3MXOA 5CT6A 3RYHB 1W44A 4YYZA 3GI1A 1XRSB 2NQ8A 2RMKA 1XG5A 3G5LA 1RHRA 4YLGA 4L0MA 5F5NA 5GGXA 2V5UA 1EEXB 2DBVO 3BJEA 1C8KA 5IFLA 5JJ5A 4YP6A 1EM8A 1A9XB 2V7QD 2W7PA 1BXKA 2X5KO 3D8NA 1OI3A 3QMWA 3I28A 5DWQA 2GLTA 5IVKA 4HOYA 3BD7A 1UBRS 2GBGA 2JRCA 1ZC4A 5IC6A 1JN3A 3RVLA 4AF8A 1BNPA 3UENA 4JS0A 3RADC 3INGA 4ZOAA 1NFRA 2AKYA 2FZ4A 3KPWA 3HYNA 1YC5A 3PE4A 4W9MC 1TZ2A 1A76A 5IM4A 3VC8A 3KSMA 2AE1A 3IAEA 1G8YA 4PPNA 3IDQA 3FSGA 4M0DA 4O4LA 5AHOA 2JHGA 3E1KA 4UTVA 1A1SA 1JA1A 4MIYA 3FD8A 2DH6A 2LD4A 1VIYA 3A70A 1TK0A 4JMPA 4F7WA 3RYIB 1GAEO 2JVIA 5IHPA 3HPOA 4KVFA 1SGWA 2E3JA 1JW9B 2DQKA 2V8OA 5P8WA 3U1BA 2IZ0A 1PV1A 3FUTA 5AVJA 3BQMB 4W5JA 1FYVA 1J2YA 1AGXA 1JA9A 3IHLA 5AHWA 1JQ3A 4GEKA 4IHKA 5EP1A 2BEVA 1ZLXA 2GESA 3PX4A 2OCBA 4IVPA 1QE0A 1RS0A 3ZYZA 4E4TA 5AOAA 1MQ3A 2O4UX 1MNQA 1FQKA 2ACVA 3ZQUA 5DFAA 1G98A 3BIOA 1N0WA 5DXAA 5BR8B 2A92A 2KBEA 3C8ZA 1KERA 1MB0A 2X19A 3HDGA 4QYWA 2ACKA 5I4CA 2HN9A 1ZHOA 5F9FA 4LYFA 3O1HB 9ICBA 3ZV3A 1S8FA 4MWEA 2PUWA 5C37A 2PKCA 1NC3A 5IJ9B 4HEA1 3OF5A 1B6SA 3OD1A 1LTKA 1V5EA 3IAHA 4XDGA 3RSFA 1U28C 4W63A 1FFBA 3LYUA 3TDNA 2CJWA 1L5WA 1THZA 3QPWA 5LZ2A 4XUSA 1EFVA 1Q15A 5K05A 4H17A 2HB6A 2J48A 5K4AA 8ICEA 1L4NA 3B7PA 2Y4NA 3BMCA 2ZJ0A 1JU4A 9ICFA 4REMA 2FR1A 3HVRA 2NZVG 2XE7A 4OSPA 3DBOB 3E1SA 2I6FA 1TZJA 1AMUA 3WADA 4Y2JA 3C1ZA 2DE0X 1XT6A 2KLBA 2PD6A 1GPNA 4ICAA 5J0XA 2QPTA 1KEPA 2GEKA 4QWWA 3RUAA 4LRWA 1E9FA 1KOFA 4O8ZA 3UPTA 2A5YB 4AN4A 4J76A 4FW8A 1TJPB 1I1HA 2R2AA 3TFWA 1NXSA 5KNBH 2GJ8A 2HA2A 4ZVQA 3UGTA 5EAIA 4M83A 4NBNA 2GILA 5IJXA 5DGHA 5EJ2A 5IBCA 2RGBA 1N2CA 1WB6A 3WV4A 4ALMA 2FQQA 1X9WA 1JZQA 3CW2C 1YBVA 2YY5A 4ZMSA 3L5KA 1FIUA 3UQ0A 3KP1A 1N7JA 2LM1A 3S2YA 3T0FA 3VXKA 4ECVA 2HHTA 3U0BA 3V4FA 2CMDA 3N2KB 3K0SA 3F5MA 3FPKA 4MRSA 5JPDA 2C2WA 4AJ1A 2K8BB 2Q2NA 2QP4A 1MG5A 4QZVA 4GMGA 3I61A 1O2DA 1RHUA 2FF7A 1BROA 1MENA 1J07A 1OVGA 2AR0A 3KEQA 2H4ZA 4ZEWA 3IEVA 4YMWA 2FCRA 4AQ7A 3FZQA 1FP7A 2HDHA 1OXVA 3HXKA 1EUZA 5HOQA 4ZPXA 4A8PA 3AQIA 1A72A 1IZ0A 1Z2AA 3CTMA 4P4PA 3FDSA 1QZXA 3QOYA 4G1BA 4L07A 3NGDA 4Q02A 4GZMA 5KFZA 1W5SA 2ZJOA 2HLDD 4S1OA 3ZZ1A 4WKPA 4B8YA 1NPTO 1KI6A 1I1QB 1E9CA 1Y9AA 1RPJA 9ICCA 3EMDA 6REQA 4QUEA 3GIMA 7ICKA 1PJSA 2FSVA 2HRRA 4WLFA 5CT8A 2K87A 2VQSA 2Y77A 3UPQA 1ORWA 2Q07A 1TQ4A 1ZWKA 1YB7A 2JLAA 2R5NA 3AEKB 3L77A 1XI2A 1J00A 3CKLA 3IHTA 4QYXA 1V3VA 2LV8A 1SM4A 1CKEA 3GT7A 4L4YA 1UMCA 3L2OB 1E96A 1H2YA 3TKYA 4X7BA 3A9WA 1E69A 3Q8WA 1IL0A 4XZ3A 2XRZA 3NR2A 1RMQA 4CMKA 1WMFA 3FGZA 4WAUA 3GCWA 1X80B 3MQ4A 3ROEA 1ZA2A 2H3HA 1EYZA 1UP7A 3D6FA 5L95A 4BX8A 1N56A 4F8RA 3UC5A 4XRGA 2KPOA 4HL6A 1T2AA 1V6CA 4NNOA 2WT8A 3DEZA 4I29A 1NI3A 3E3MA 3FWKA 4RK4A 4EFMA 2WJAA 4KSCA 1MVNA 1PWXA 3EPHA 1WHTA 4UJ3A 2IEBA 1UFVA 2Q9UA 3OP1A 5DQGA 1MIHA 1RKUA 4YRLA 4O3SA 4MJ7A 2Q46A 5KTMA 3IB6A 5CIYA 2G1JA 5FT9A 1KMIY 3HP7A 1YGPA 3L6OO 2ZAYA 1H9AA 3TTVA 5BVGA 3QELA 4FGWA 2NZ8A 3LNTA 4NYMR 4R64A 3C4JA 2WHPA 4GPEA 3KQYA 4GIBA 3L6CA 3G2JA 4OFXA 2GBPA 3CLKA 3ZQ4A 2QTRA 1V7ZA 2P35A 2ZFUA 3OEED 5KG4A 1JEOA 1J2TA 1N6PA 2FSVC 2O2EA 4UE6A 4YX9A 2O8FA 3J81k 3SLGA 1E2HA 2FSGA 1VG1A 4EW1A 2ZU6A 4IRMA 3I4LA 3SXUA 3T38A 4LDZA 1COWD 2IC5A 5SZHB 4HS4A 1P0QA 3N86A 3OJFA 3RUHA 1FPMA 2XVYA 2YTUA 2WKSA 1D5CA 3G1UA 2YUTA 3OJ0A 1ZETA 2VUIB 1SC1A 3HCEA 3KYBA 4JEMA 4M8LA 3JYOA 3FYUA 3FPGA 3K9QO 5LNK6 4Z99A 4J6FA 3QHAA 1JROA 3DVAB 4JSTA 5AW3A 4K6OA 5JUMA 4DQIA 1OX4A 4P4LA 2ZSKA 1RHMA 2ZWOA 4XOUA 4DXAA 2WHRA 4EMTA 3E7DA 2C9MA 4WT7A 4PAMA 1VL0A 1MO6A 1P31A 2B5VA 2P9GA 2GWSA 3PA6A 1G2OA 4G1MB 1TJNA 1QV9A 4QOSA 1PKXA 1QX3A 1FFHA 3AEZA 3VNQA 1SULA 4E32A 1TO6A 3C74A 1OKKA 3DDUA 4HDNA 3H84A 1Y1RA 1X7HA 3EOBI 4WVFA 1S77D 3C45A 4YCBA 3GVCA 4LHZA 4ZYYA 4R01A 5J8YA 1NJ2A 1V37A 3KYDA 1U04A 3M6ZA 3BCUA 4RABA 2VQ6A 2IP1A 1F6DA 1KNQA 3AP2A 4WDRA 1YONA 3PQ7A 1RACA 1SAYA 3BAFA 4AP5A 4CG0A 4DCJA 2PUGA 1IQPA 4FXPA 2IH5A 3S5JA 5PGMA 3EA0A 4EG0A 3RTDA 5HHIA 5AYVA 1I1OA 1I9CA 4IEEA 1FMTA 1SUIA 2FLWA 3HDVA 3DE3X 4GI7A 5AUQA 1JPVA 2BGJA 4YAOA 4OK3A 4QZHA 3NEPX 1JS1X 1YK0A 5AMXA 1ITZA 3C14C 3ONEA 5EUMA 1PCXA 2KQUA 2NXWA 5LQMA 3JQFC 2VHEA 4KLRA 1TMOA 1DT5A 1C7YA 1IJKA 2HHWA 3DUFA 4FC7A 4ZI7F 3HKDA 2OFXA 3QVGB 1L3CA 5I9NA 1NW6A 5HS4A 3QKSB 1EXVA 3OJUA 3R3YA 3RVOA 1VYHA 5LQKA 3VJRA 5LYJA 1P80A 2C2ZA 1DC6A 1FXUA 3TSWA 4X5OA 4JJGA 3U4AA 3ILHA 1VSTA 3QKUA 1HLFA 3DEAA 3FOAA 4I1YA 5B66U 3MQ2A 3NM4A 2LDXA 3WL4A 4BQIA 6CHYA 2DCMA 3CT6A 4LQLA 2Q2VA 1H8EA 1GR0A 4HZGA 2WFLA 5KT5A 3QVVA 1AXRA 2P2SA 4UVIA 4HNHA 4UBLA 2HDWA 1QLNA 1OXMA 1HSZA 1EQUA 1Q1AA 5BN5B 2XUHA 1W2GA 5FF9A 4BWMA 1YE5A 3ROPA 1FVHA 5JQGB 3ICPA 4K6CA 2YASA 3SHVA 3WJAA 4LMPA 3GVXA 3HJBA 1JQEA 3H75A 4MTLA 1LLQA 3BAZA 3HFJA 4JAVC 4GMKA 1MPTA 4LOHA 5CX1B 2LE0A 2QSZA 3E9DA 1C7FA 2O07A 5D6OA 3GX1A 5LJIA 2JLSA 2CL7X 2P30A 3GGSA 3O1IC 2CXSA 4HAUA 1V43A 4Y67A 2XYQA 4XQ9A 3IPRA 1EDEA 1KE2A 3IDOA 221PA 1KZGB 5I9LA 3AF0A 4RQ4A 3H5RA 4MKIA 3D6TB 4RJJA 5FPPA 2IYWA 1JRPA 4CTNA 3HBFA 1XRLA 4J9OA 3KHSA 5FUVA 4C43A 3PT9A 3FKQA 2IFTA 2IIQA 2PZKA 3EWIA 1QYIA 4BRZA 4BNZA 1DELA 1ZGHA 2EQBA 4CU5A 4L72A 4E15A 4ZMRA 2XWQA 5TF4A 3JVUA 3UAZA 5ITVA 3RHSA 1PK1A 3LECA 2ZRMA 5DLFA 1M8GA 2Y1OA 1JL3A 1U2PA 3I1JA 3P9PA 4K1LA 4V0OA 4AJHA 3PC7A 5SY6A 4GP7A 4N7RA 2Y05A 2QQFA 2PT7A 4HYQA 3RFCA 4BGVA 4QBIA 3WK8A 3THYB 1ABFA 3DONA 2N46A 4M2LA 2AH5A 4QEZA 1QYVA 1RKBA 4F91B 2OZKA 5IVPA 1VXRA 3WQQA 4A2PA 1CY4A 1UJBA 4BJ5A 2JGAA 1NQOA 1PK7A 3MC1A 1JLKA 4AY6A 3FRJA 3AR7A 4LA4A 3PFIA 1FFVA 2J0UA 1NKSA 3K9BA 2FFQA 2BBWA 3WX0A 4YMGA 4LF4B 3NALA 1ODFA 1JPNA 1BVUA 3SYNA 3EC1A 5KKAA 3ZWQA 4DCTA 4EF4A 5FH9A 2G83A 3U4CA 5HK9A 1C2YA 2FPMA 3BE8A 2HSZA 4QQKA 2XWJI 2NYRA 3R0QA 2GEUA 2IV7A 2QOEA 3RB4A 2B5OA 2GLEA 1IOLA 1OLOA 3KM0A 3JPPA 4G0ZA 1P9OA 4PGAA 3O8CA 1QCYA 4YXMA 1C1DA 4K9DA 5HR5A 1JR3D 3A04A 5KFSA 4D3ZA 4DREA 16PKA 1V45E 2HF7A 4R1SA 1EJ2A 1RYMA 5IINA 1T5TA 2GA9A 4M8KA 4I2DA 4C0AC 1UKCA 2VA2A 4JITA 1K0UA 4QYTA 3CC8A 3M3DA 5LMZA 2FUCA 4NX2A 2A8YA 2F2TA 4MR7B 3OIYA 8LDHA 5K5EA 3ADBA 4CCSA 8ICVA 5AKLA 2ECQA 3QYFA 2X0JA 1H3FA 1HI9A 3LY5A 3OT4A 5EKTA 5LXTA 4FYHA 2VRBA 3KSRA 1PJBA 2J1LA 1C1YA 1EP2B 2AZMA 2GN9A 2QX8A 3MBYA 2X3FA 4WZBA 1R4MA 1PZGA 4O4JA 1NJ5A 1MC4A 2QZPA 1OI7A 4YASA 3GQCA 3R7WB 2RE8A 1EXNA 2O2ZA 3JWEA 4MQEA 1UADA 3DT6A 2ZYDA 3QWAA 3IHQB 3UY4A 2C00A 3T3IA 3IVMA 3L6RA 1XZDA 3RYCA 3FNEA 2R48A 1DQNA 2YVLA 2I8AA 1ISMA 1O87A 2FE9A 4MUAA 5D01A 4FS3A 1Q44A 5GTHU 3SENA 2H16A 4QIWC 1KMQA 4MAAA 5BQPA 2E4UA 3ZH2A 3AR2A 5J2UA 3FDZA 2VATA 2BP7B 4QBHA 4F4KA 2OWEA 5KO2A 4YCLA 4QYIA 5DIFA 1FFXA 2PSJA 2A5GA 3S1LA 5EIAA 4TWZA 3VAAA 1V25A 3Q8PB 1FDUA 3AGPA 3NHBA 3PPIA 3AMVA 4X84A 5FNVB 4ZN6A 5HJ7A 5KFHA 3SC2B 4WV3A 5IFKA 1YK1A 2O8NA 4DSIA 3ZUGA 2RAPA 3GJ7A 4OHOA 2RJNA 4LAFA 2JIRA 3H8VA 3SHOA 1W9MA 2H11A 1ZJ6A 3V97A 4DNOA 1TU0A 3KUKA 1Y48E 4PTLA 1BMTA 4J90A 4KO4S 3GJZA 1LB2B 1SD2A 4M1ZA 3EXEA 4QU5A 4WX2B 3CX3A 5D3MA 4CRWB 3FPEA 3ONFA 5FLYA 5IXYA 1WE2A 3WLPA 1DQPA 3A0UA 4MEBA 1IM5A 3EIEA 3I12A 4P36A 1D4AA 5TARA 2BFBB 1P1JA 2CV0A 4G56A 1FDWA 4I5DA 3R9XA 3GBVA 2I34A 3E05A 2PI5A 1NUPA 1RJ9A 1LDYA 5J2HA 3QHPA 1AC5A 1QOPB 2PRZA 2H1VA 4YAFA 1JT9A 4LC9A 4RVHA 1PZHA 2C9YA 1K6XA 3T3EA 2BEWB 1I3NA 4LJLA 1P2TA 5CA1A 1JHDA 2YV3A 1SVNA 2V7PA 4B76A 5HJ2A 1KH2A 5HDBB 4P2HA 1I4EB 2KTQA 2UZ0A 3EIUA 1C4WA 3JRNA 3RE1A 3K4HA 3EDMA 2VQDA 1NIJA 3L4JA 4AO8A 1JSXA 1IOWA 1EJ6A 1H3EA 5HJEA 2UUAB 5HIKA 4ZP1A 4MB6A 2GNOA 2KKVA 3AKCA 8ICMA 3ZDDA 2ABWA 1E2KA 3PP8A 3QOFA 1Y1QA 3HUDA 1EIZA 2PDAA 3NTLA 3QKIA 4HEHA 4EKEA 4OHBA 2D5LA 5KTYA 4P7FA 1CR0A 3QBJA 4P3PA 4BVLA 3HABA 2VZ0A 1KEVA 1J99A 1K75A 2QRLA 3RIMA 2O0JA 4B3JA 3K6KA 4L78A 3WP1B 4P54A 4JP3A 2GK3A 1T0JB 3WK6A 3NM6B 1LS6A 3K09C 1MTOA 1FU4A 3O21A 5CDUA 1VZ3A 5JH7F 1SIUA 3PZBA 4WY5A 4ZYLA 2FPRA 3ZY2A 4MXDA 3ETNA 1T9GS 1FMJA 3NAMA 4H4EA 4MS4A 4E09A 1NJ8A 1JHVA 1GL7A 2IOFA 2ZP1A 4OB7A 4G37A 1NM5C 3GAAA 3B5EA 5IN5A 4PHTA 3QLJA 1JR3A 3STYA 4ZCTA 5HRCA 2H63A 4MO9A 3QUQA 1R0LA 2IW1A 2H59A 2EGGA 8ICOA 1GQFA 5U4XA 1HBJA 1BMDA 4GL4A 4TWJA 4Y6QA 4ZZ3A 1WTCA 3FROA 1HIWA 3Q8RB 3HB5X 3MFIA 8ICCA 3IG5A 4OU5A 4CLRA 3JQRA 3TI0A 4L02A 3U09A 3RDPA 4XGNA 3SAJA 4B4DA 3HXQA 2H1HA 5IUJC 4GL2A 2DR0A 4MMYB 1HNNA 1CEQA 4KJZA 1QZTA 4EPXA 4AZSA 3B1ZA 3N2EA 4PAOA 3LUGA 5JS8A 3B2NA 1UEXC 7ICIA 2XDQB 5L4NA 4R31A 2VJ5A 1G5TA 3B7GA 3IUQA 5KSYA 3L8ZA 3QVOA 2QKYA 3AHDA 3FDIA 1ZXXA 4GU5A 3V2IA 2VJ4A 4B44A 4BASA 4ARVA 3HA7A 3IAS6 4JKYA 3KKLA 3KWLA 3N2GA 4FLMA 4EAAA 1R9GA 1UQVA 1X2IA 1E1MA 1FYWA 2FGKA 3KAQA 4C0KA 5I7RA 4EG8A 2P68A 4OHYA 4B7AA 3KXKA 4CT0A 1MOSA 1SV4A 1G7CA 3FZNA 4MPJA 4DV7B 4R68A 5AIAA 4I7EA 1JHPA 3L7DA 4L8FA 2GI4A 5BMVA 1LK7A 1MEEA 2WINI 2FE1A 3CLHA 3TQIA 2ZBDA 2Y0EA 1P4HA 4URZR 2WYUA 5K4LA 1WSDA 1KN5A 2P6OA 4KZPA 3AP3A 3DXXA 1P8JA 4O2BF