3QU5A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp11asn mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
221
structure length
221
Chain Sequence
KLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 82
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu5A01
2O9JA 5AI6A 4CF5A 4AS2A 1RLOA 2FPSA 1YV9A 4L6CA 2W4MA 4YH1A 3QLEA 4YGYA 4YCMA 3DAOA 2I54A 4YIHA 1NF2A 2AH5A 1L6RA 5JJBA 4EELA 3ZX5A 5ALEA 4UW9A 5AVZA 2Q4RA 2YBDA 3KDPA 5ALPA 2GHTA 3L1VA 2RAVA 2HDOA 1VFPA 1RKUA 1ZOLA 5ALFA 3ZWKA 5AESA 2IOHA 1MH9A 3R09A 1WVIA 5AW7A 4ZEXA 2GMWA 2WF9A 1T5SA 3QNMA 4C4RA 1X42A 3L1UA 5IT4A 3QU7A 3DNPA 2FUCA 3N28A 2RARA 4XPZA 2HEGA 3EF1A 1J97A 1RKVA 1XVIA 1ZS9A 4MWOA 2PKEA 1EK1A 3S6JA 2G1AA 1Z4MA 3PCTA 1RKQA 3WKAA 2JGAA 3EPRA 3OPXA 2YMMA 3WK6A 2HSZA 1AQ6A 3FM9A 2HX1A 3J7TA 4ZEVA 3R4CA 4HGNA 1VJ5A 2MSNA 5AI0A 3WK8A 3FPBA 3L8EA 4GIBA 3UMGA 4QQFA 3HLTA 4QJBA 1RLTA 4CE6A 4AP9A 4KNVA 2HF2A 2ODAA 5AIAA 2B1QA 3VAYA 4Y2JA 2PQ0A 4BNDA 3W5CA 2JARA 3NANA 3ZW7A 3N5KA 2HI0A 1YS9A 3W5DA 2WF7A 3WK4A 1K1EA 2CN1A 4KX5A 1L7OA 1O08A 2G80A 5AVQA 3MMZA 2JAWA 3IB6A 3WKEA 4H1WA 3QU9A 4NV0A 3W5BA 2YMQA 2BDEA 3SLRA 4CNQA 1XP5A 5AW5A 2G0AA 2G09A 2FEAA 5AKXA 3ZTYA 2I34A 3GYGA 1ZD4A 5A3RA 1YNSA 5AM1A 2IOFA 4UMDA 4KNWA 2NYVA 3N07A 2FPXA 4UM5A 1EK2A 1ZD5A 3B9BA 1QYIA 3QYPA 1RLMA 3BA6A 3QUCA 3MC1A 3ZX4A 2I6XA 5AW1A 3TLMA 4J2TA 4FE3A 3ZVLA 1Z4LA 3IRUA 4BX3A 2YJ4A 3QU2A 4B6JA 3AR4A 4YCLA 2B8EA 2ZBFA 2O2XA 2B1RA 2Q4TA 1RC8A 5ALLA 4UM7A 2P11A 1ZRMA 1Q92A 2HF7A 2WHEA 3ZVMA 3A1CA 1O03A 2IOFK 2DQSA 2OM6A 2PR7A 5AKGA 1Z5UA 2B0CA 4KN8A 3DDHA 3ZWDA 2CFRA 3ET5A 5IS2A 5AK3A 5AW9A 2C9MA 1VJRA 5AW0A 4IG4A 2P27A 2AGVA 3L0CA 3QUTA 1XPJA 3QUQA 3M9LA 5AKJA 3WKCA 4EEKA 4BEWA 1RQNA 1IWOA 1T5TA 3NASA 2CFTA 3UMBA 3IJ5A 2AUTA 1U7OA 3NIWA 5AVYA 3L0BA 2FPWA 2W43A 4UATA 1PW5A 1Z4PX 1CR6A 3PDWA 4HGOA 4F72A 1F5SA 5AK6A 4L57A 2EARA 4OHFA 4NFLA 2ZBDA 3OCUA 5AI8A 5AKLA 1Z4KA 4XOUA 4ZEWA 1CQZA 2WF8A 3NRJA 3PGVA 2GFHA 4PNHA 5E0OA 1FEZA 5ALTA 2C88A 2NO4A 1ZRNA 5ALYA 3FPSA 4UMVA 4UU0A 3RF6A 1J8DA 2G08A 3HYCA 4XQ0A 3OCZA 3L0YA 3ED5A 1TE2A 3KOOA 2MU1A 4Y2QA 3QUBA 3P96A 3SKXA 2BY4A 4EZEA 5AW2A 4JB3A 2YMLA 4DCCA 3R9KA 2FUEA 3E58A 5AW8A 4G9BA 2D2VA 4KYTA 4NABA 3UM9A 3OCYA 5AVXA 2EAUA 4HYTA 3EWIA 1Z4JA 2C8KA 3AR7A 4UMEA 5AKIA 3ET4A 2I55A 3AR9A 3U13A 5AIBA 1RMYA 1SWWA 4FFDA 3E8MA 2B30A 5AVVA 1LTQA 5ALSA 1QQ7A 5AW3A 3I1YA 2HHLA 2X4DA 4EX6A 2G07A 4JDPA 2FI1A 4EX7A 2JAUA 3KBBA 1U02A 4BEVA 5AK5A 1L8OA 1RMQA 3OCVA 3D6JA 2P9JA 1KYTA 4BYGA 1QQ6A 4BX0A 4AS3A 4DW8A 4DWOA 5AVTA 2OYCA 3KC2A 3A1DA 5ALJA 2WF5A 2YFYA 5AKEA 2I33A 4E88A 3NAMA 5ALZA 1QQ5A 1RQLA 3ZTWA 4XE5A 4OD0A 1Z88A 2BDUA 4HGRA 5AVSA 2MU2A 3A1EA 3DV9A 3OCXA 3WK5A 3N8GA 5T41A 3QXGA 5AKYA 2QYHA 1ZJJA 3L8GA 5A3QA 3BWVA 4KX3A 3ZU6A 3N1UA 4EENA 1ZD2P 1L7NA 2FPRA 3ZVNA 5ALDA 1L7PA 4BKMA 4Y2PA 4HAIA 2YJ3A 5AVUA 3U7EB 3M1YA 3B9RA 3U7FB 4UAVA 5ALOA 4UMFA 2YJ6A 2FDRA 5AKKA 1U7PA 1L8LA 4HGPA 1Y8AA 1TJ4A 4L6AA 4Y2SA 4G63A 5A3SA 1U2TA 2R8XA 4Y2UA 2HO4A 3W5AA 3SKYA 4NAVA 2I7DA 3OTQA 3AR5A 2JAOA 4Y3UA 5ALGA 3L8FA 2HCFA 5AVRA 4UASA 5ALRA 4CF4A 3QU4A 5AI4A 2WF6A 2AMYA 4UAUA 2WFAA 1YJ5A 2RB5A 2RBKA 3QX7A 2B8JA 2C4NA 1Z5GA 3ESRA 1TJ3A 1SU4A 1Q91A 2Q5EA 5ALUA 3E81A 4UARA 2ZBEA 3QU5A 3FZQA 3L7YA 2NO5A 3U7HB 2P69A 2EATA 2ZG6A 4O8CA 2IYEA 2IA5A 1WPGA 5AI5A 3U19A 1RPZA 2GHQA 2YJ5A 3WK9A 5ALVA 3WGUA 3NALA 4YIKA 5AK4A 3NUQA 4I9GA 4RESA 5ALXA 3I28A 2GO7A 3SD7A 4FYPA 4RETA 5AW6A 5ALNA 5AKZA 3EF0A 2G06A 4DFDA 5AM2A 2YN4A 5ALQA 3CZ4A 3ONNA 1YDFA 2YY6A 4CF3A 4NWIA 4BNDB 4IFTA 2ZXEA 2WM8A 5AI9A 2CFSA 3L5KA 3WK7A 5ALHA 1RRCA 1NNLA 1NRWA 5FP0A 2HOQA 4BX2A 3CNHA 3MPOA 5ALKA 3FVVA 5AM3A 3FGOA 5ALIA 1RDFA 3OCWA 1N8NA 2OA0A 5AM4A 1WZCA 3PGLA 3WGVA 5AICA 3L8HA 3UMCA 1Z4NA 5AM0A 1ZD3A 1S2OA 1TJ5A 4MUMA 2B82A 4C4SA 3SF0A 4OCZA 4BBJA 4UU1A 3ZUPA 3WKBA 5ALWA 3MN1A 2QLTA 4Y2VA 1RMTA 1WR8A 2YMPA 3B8EA 3F9RA 3RFUA 3WKDA 1Z4QA 3K1ZA 3ZI4A 3KD3A 4I9FA 1SWVA 2VKQA 1QH9A 4YCNA 3AR3A 3KZXA 4OFZA 3SMVA 1TA0A 3E84A 4Y2YA 2ZOSA 2R8YA 1YMQA 1LVHA 1T9ZA 2C8LA 5AVWA 3I6BA 3AR2A 5IT0A 5AW4A 3A3YA 3SHQA 2R8EA 4J03A 3I76A 5AKHA 4Y2RA 5ALMA 1N9KA 2FPUA 4F71A 2OBBA 5AHXA 4GXTA 1S8OA 3QGMA 4Y2XA 4C4TA 4HGQA 3U7GA 2R8ZA 1L7MA 2ZBGA 1U2SA 1JUDA 5AM5A 4Y2TA 2W11A 1Z4OA 3U26A 3AR8A 3AR6A 1Z4IA 3ESQA
chains in the Genus database with same CATH superfamily
3B60A 4BEBA 4ZKDA 1G3MA 1I3LA 4PPGA 2P2YA 4CPDA 3ODPA 3QIAA 2BGNA 2RAFA 3IVRA 4M0LA 3FSGD 4G4SO 5DQHA 3QUSA 4Q6BA 2IYOA 1MHTA 4D9CA 3Q8XB 4Z7QB 4C6HA 3V72A 2Z95A 3LWZA 3OTGA 121PA 1AMOA 3CJTA 1NI4A 2RFLA 3EMKA 1FOEB 3BEDA 5CNMA 2VF5X 1ADYA 2OCIA 3UJ6A 3KJQA 4JCCA 5I3CA 3ZCUA 4ZJPA 4ZGWA 4ZKEA 3NRZA 4PLHA 4WPGA 2QTNA 3LTEA 4WLUA 1M72A 2IZ0A 5EJGA 4E12A 1MB9A 3ADKA 3FUUA 2QU8A 1E6CA 2R6AA 3IR5A 1PVPA 1HEKA 4WCFA 1ZETA 5EWLA 4EI9A 1BVYF 2XMQA 4R5HA 4EABA 5LVAA 3G0GA 2QTRA 2ZLBA 1KS9A 1MIOA 8ICFA 2YTUA 1R8YA 3AQ4A 5JI3E 4MV5A 2FDCA 1JHAA 3ETJA 4IRCA 1UWKA 3Q6IA 4NZNA 3VGJA 1TO6A 1UWVA 3BMNB 1A04A 2KB0A 3U2QA 2FUCA 3N28A 1VYVA 5M7EA 1MIHA 2OFOA 2CUZA 1S0UA 1YB1A 3GPCA 3HBLA 1YE8A 3UVEA 3WY9A 4C7KA 1G9TA 3TKLA 8MHTA 2XVYA 3IPAA 4C4AA 4CETA 1E6LA 2B6NA 2FGKA 1DV2A 3UA3A 5FR1A 2E37A 3PNVA 2YB4A 1JQBA 2B6GA 1L1RA 1H0HA 1N5OX 2CF5A 2XHZA 4OI4A 1X1BA 1Z4MA 2VYVA 1LF5A 3AL3A 3KUUA 3M6LA 4OJNA 1HDEA 3U3XA 5I8WA 5JBIA 1Y98A 4DLRA 3T38A 3TB4A 3NWEA 2AXEA 1XA3A 4A8EA 4EZ9A 1SKYE 1R16A 2MIIA 3JQ7B 5E7JA 2RHMA 1CY1A 2A3VA 5F9HA 5KFAA 1DJMA 1E2HA 3KZNA 4ETNA 2VUSA 3JAKA 2IIVA 4I55B 2JB9A 3SZMA 4RACA 2K2QB 4D25A 4IMIB 4QZDA 3WYCA 4RTNA 4WNIA 1NUPA 1DSSG 4W5QA 1P1JA 1VYUA 2ZDHA 2H5IA 1ZL0A 3DF7A 5DWQA 5AJWA 4ZXFA 3UMFA 1FDUA 3F0TA 5DI3B 4GBED 5KFIA 1KKXA 9ICCA 3BWCA 4J76A 2O5EA 3E35A 5ESDA 2IWHA 1Y7HA 4AUKA 4C8OA 3IX7A 1NK4A 4OJOA 3ZE7A 4YRIA 2PS3A 4JXKA 4H2DA 4YUWA 2I2CA 3WKEA 3PC3A 3S3TA 4H1WA 1EFAA 2BM0A 1JSRA 3W5BA 2BDEA 1ZXXA 1F51E 1ZQQA 3PLAE 3D8SA 2QRPA 4QRHA 5I3ZA 5JWOA 1KQ3A 1QM5A 5DQGA 1Y7LA 2PHZA 2C2DA 1VA4A 2R00A 2EBUA 4X63A 1AQJA 1D0SA 3NTOA 3VKFA 3EIOA 2G09A 1S2NA 2QN3A 5AKXA 3OE4A 2BQUA 3GLFB 4Y2GA 4ARBA 4URYR 2PUFA 1YNSA 1BKSB 1NE2A 1QDUA 2YCBA 3L7MA 3O73A 4FZJA 1K8ZB 4IINA 4UNNA 4Z0PA 5J9FA 3RQIA 4HLDA 1CETA 1CDZA 2G6BA 5EJ4A 1IB0A 1U2ZA 2WFZA 4BO3A 1PJAA 3BH7A 2I5HA 2VDKB 3ZVRA 5HF9A 2G83A 4K6MA 1VRVA 3T5GA 5B3JC 1ATIA 3MB5A 3Q8KA 1L2TA 3ZX4A 3PUYA 1FUYB 4ZT5A 2QEQA 4MP3A 5LZ4A 1RIFA 3K20A 2XCSB 1NXVA 3EC2A 4FE3A 2RKBA 4HAXA 4LVNA 2Y2UA 2AK2A 2CE7A 3F3MA 4BYMA 3BS4A 4MVJF 3OZRA 1F17A 4MLDA 3MINB 4TGLA 5K0TA 1GQ2A 5BNTA 1KYVA 3F98A 5FOTA 2JLBA 2XRMA 4LHYA 2LKCA 1YFLA 1RLJA 4DV0B 1P2UA 1XP8A 2QF7A 5IBCA 1TU3A 2BF4A 2H59A 2WWGA 2AL7A 2CFIA 1H8ED 1TIPA 1PZFA 3L0SA 4JQSA 4FHDA 4QXRA 3TR6A 3AJ9A 3QE4A 4Y6RA 1ZH0A 3AERB 3OA0A 4TUYB 4RZRA 1RNLA 4DXDA 1H0KA 1XOIA 1HRKA 1E20A 1NRXA 3EY4A 1H1LB 2QARB 2WWHA 3GRKA 5HQTA 2ET6A 2BTOA 1ZI6A 3LQKA 5JNTA 2FTKE 3FCEA 5KQGA 4ZVQA 1CNMA 4KIFA 3QNUA 1B1AA 4I5EA 3DBHA 2PFKA 2O1WA 1P0QA 3CRRA 2CEKA 3QXJA 1USUA 3R5TA 4XIGS 4Y6QA 1O9GA 3ZXIA 3IJEB 1VPWA 3O7WA 2AGVA 3M6VA 1MSWD 4XFDA 2XXBA 3KPJA 4L2IB 1MH1A 2AMVA 3M8KA 1KN5A 2C58A 3JRXA 3UG6A 1XPJA 5IH7A 2JLXA 2CL6X 2WIDA 1S8NA 3BS5A 2V74B 2D5LA 2VA2A 3UMBA 2AUTA 3C3MA 3NIWA 1XEWY 1E7MA 2Z98A 2ZR0A 3VGPA 2IU6A 4EF5A 2XUPA 3KPUA 2QAIA 1UXGA 2XT9A 3WFJA 3WOHA 2KPOA 1B73A 1C4WA 1EJBA 1FLNA 1UMCB 2VNKA 3BTVA 3MAGA 1ZP6A 1GXSB 1P7CA 3EW7A 1X6JA 4IDHA 3R77A 4X1YB 3V3TA 5IJ0B 2IEDA 1XNSA 1MC5A 5G2OA 3NP7A 1L4YA 2J6HA 4D8UA 4BPBA 1P2SA 3BGDA 5E4TA 1H2EA 1DAEA 4BWJA 4W5TA 4TQAA 1Y1LA 2C2EA 4GI2A 5LBTA 2R18A 3ZGVA 3C4QA 2PFGA 4BHTA 1W1UA 1H23A 1BN7A 1KHHA 1KKLA 1U1EA 2HY7A 3HN7A 1T36B 4PZCA 3TUIC 4QGSA 5IDYA 4F9TA 1VBFA 3B3AA 3FW1A 1J00A 1E3IA 2QG9A 2RKWA 3PRJA 4I50B 4MQ5A 3BL6A 4NS4A 4QC2A 4CM3A 3H0KA 4R1MA 2AQ0A 5P8WA 2JKVA 2ZTVA 1WB6A 3UWOA 1VKHA 5E4YA 3SQXA 2ZI5A 1S5LU 3GIJA 3R5HA 1P5RA 2HA7A 4CCSA 4G9BA 5JISA 1WYGA 1PBNA 2CVFA 3W05A 1LPMA 1XS9D 3EISA 1Z08A 4NMMA 4QXQA 4BFXA 1U7ZA 3LHKA 3LX8A 2IYZA 4BC1A 2DR2A 2FSVA 2W6JD 3JVEA 3T3IA 4CN8A 2I55A 5J0SA 3AR9A 3GW8A 1C9MA 5AXBA 3U13A 4XVCA 4AO6A 1XYGA 1M33A 5AIBA 1N9GB 1WHTB 1YQXA 3RHZA 3PDCA 3ZWVA 3F90A 3PPYA 1JX4A 1WCXA 1I1HA 1ZFNA 2EJVA 1Z74A 2XTAA 3AL2A 4P80A 4MQ4A 5FNVB 3SZUA 4RKWA 4E33A 1KK2A 1QUEA 2G1KA 1FFWA 3CUEF 2V7GA 1YL6A 1ZNWA 3QPBA 3A3OA 3P5SA 1TAQA 1UDXA 1XN4A 3IV7A 5JMOA 3BE4A 1ODFA 1BHSA 1TU0A 3IVAA 2OOKA 4R8SA 2OPBA 4R98A 1NNI1 1ABFA 1U9JA 1TQHA 4NHOA 4IP0A 2Q0HA 1U02A 2BCEA 3I9NA 2QUZA 1B6GA 3WLEA 3WWYA 4FC6A 1LXCA 4C6RA 4X1IA 1PVOA 3MFYA 1M7HA 5K01A 4DPMA 4A0QA 3B0YA 3OQMA 4DW8A 5EQDA 4LMRA 2C22A 4XQCA 3NEJA 3J7AC 4QW8A 4DSOA 4OHZA 2W03A 2D7CA 2VPYA 4F1KA 1Q15A 1CVRA 1ODSA 2HJVA 1Y4SA 2Q5OA 3EUFA 2WF5A 4HDAA 1MG0A 1G8GA 1I2AA 2IHKA 4RF2A 2CNBA 2Z9BA 4FQ5A 1L6NA 2Z1MA 2QZZA 4KLCA 4RJKA 3X1DA 3SIPA 5BN3A 1EWQA 1OFVA 4WN9A 1GKYA 1DKOA 3G0OA 3LOUA 4IMPA 1LQ2A 1PJ3A 2QROA 3A0UA 4BNGA 4DLLA 5KKNB 1G5PA 2V3CC 4IVPA 2BW0A 2KHZA 1DCKA 3ETCA 3GUVA 4DQLA 3DV9A 2VQEB 3R40A 1J25A 2QL7A 3H9JA 2ENWA 4EFLA 1XEWX 3QWHA 4F6RB 3C7TA 3RJ5A 1JYFA 1S4QA 1XX6A 1XO0A 2BV3A 1QF6A 4FD2A 2JEIA 3B6ZA 4K9SA 4BU0A 1Q0HA 2BJVA 4C5BA 2N1RA 2WT8A 3JD0A 3JS5A 1ZM4A 4AY4A 4DS5A 3QFSA 1PKEA 1Y9JA 1S3SA 1G2QA 2FPRA 4X6YA 3SJBA 1FDIA 3M5CA 4PZDA 1Y9ZA 3LX4A 2ZIUB 2Q21A 3BJMA 5BQFA 2ZB7A 3H5VA 2P75A 1JLKA 2EQ5A 2PGAA 4Y2PA 2PWZA 2XB9A 2ZI9A 3FHLA 4TYWA 1FDTA 4GZ3A 1X6IA 4XCVA 4FFBB 3KK0A 3RF7A 2VAPA 1JHQA 4LJ9A 2FPGA 5EJMA 5IC6A 3K0HA 1SBCA 2VJOA 2H48A 3RSGA 2GAJA 4KRFA 1P17A 1OI3A 1TJ4A 3GLRA 3K1RB 3P0FA 3OZFA 4KWEA 5ETJA 5EWJA 4U2EA 1Q0QA 3HM2A 4J0EA 4G63A 2DWQA 3GT0A 3G13A 3EVCA 5EQFA 4XYMA 1BFDA 5AH0A 4JLUA 1WKVA 2BI4A 3UUWA 1PGOA 3DBVO 3ZEIA 1E8NA 1EQAA 4Y2HA 3WYFA 4B9LA 1XHFA 1Z0IA 1A9SA 4MV6A 4TROA 1IOWA 2Y9MB 1IJBA 5EZYA 2AT1A 4DUZB 4IOJA 4NJMB 5AVRA 2HK8A 2J85A 2O3JA 8ICLA 1BPYA 3QU4A 2HRZA 1U6KA 2YS6A 7ICTA 2ZSJA 4AO7A 1ABBA 3ACDA 4RMJA 5HFAA 1DBPA 4UZEA 4G5RA 2MUTB 2UVWA 2VP6A 3WWOA 5CU7A 3H97A 1LJLA 3GDHA 3F2IA 4ZMSA 1NW8A 4I2EA 3GCZA 4BNUA 1J5XA 2Y1OA 1JKMA 5HVNA 3B1WA 4RMGA 1Q91A 3NHBA 1NI4B 3GPIA 2GFIA 1P44A 5ALUA 4QG7A 4I1VA 3QG5A 3W5IA 1VL2A 3K0AA 1PF7E 1K7EB 2ADMA 2VQ3A 4I4TA 3GV7B 4R7ZA 3T3PB 2ZJ5A 1BD4A 1RSZA 1EVKA 2HQRA 3CRW1 4HDOB 3T3EA 4L3VA 2GD0A 3TM5A 3DWEX 5C8DA 3K0KA 2JC3A 2PKXA 1T1SA 4BTVA 4DYVA 3FI9A 4E21A 4HC4A 4CDNA 4OXXA 1A3CA 1YKGA 3RKUA 3U31A 3UC5A 4EPRA 5K6AA 1ZWLA 1YB6A 4RESA 3G6VA 2PJZA 4ES6A 5CB4F 4G1MB 1JN0A 5LZ8A 2RGNC 5A3VA 1T2EA 2A1AA 2OHVA 1MIOB 2WZQA 1H4VB 4DIMA 1Q3UA 2WSSD 1B8NA 1EZ4A 2W9XA 3F3SA 3VH1A 4JLJA 3K0CC 4UBNA 3SBXA 2YN4A 2ZRFA 2WMYA 2DFTA 5FTMA 2OGUA 5AUQA 1QH1A 4CF3A 3BJEA 4LMAA 3T4PA 4BNDB 4EDHA 3HU2A 3DKVA 1CUEA 4PGAA 4FOLA 3L40A 4YMNA 4DIEA 5EHIA 1FFEA 5TB5A 3K4GA 4QWAA 3DOEA 3C3BA 4K8RB 5ALHA 5TX7A 3V6LA 1BH6A 1RRCA 1SGGA 1KZ4A 1MAWA 2EX4A 1L1EA 4FIDA 5DN6D 5B1DA 3RYFA 3B2NA 1V48A 4FT4A 4MA0A 2WYHA 1X80A 4RADA 4F3RA 1BXGB 1ZNXA 1QVAA 4U2KA 4RW0A 3JQQA 2AXPA 4X20B 1T4BA 2OV8A 4FUQA 2C98A 4RORA 4WOBA 4AYTA 3AY0A 1KQFA 5ILOA 1J22A 2PUDA 2D7JA 3G2QA 4HCJA 1RKBA 4H17A 5I8PA 4Z3OA 3H6KA 1L7EA 4IYRA 3RUAA 3TSWA 4E3WA 2GM4A 1QH0A 4ED8A 5EXSA 1ZBDA 1VTKA 4HPXB 3RG2A 4R9VA 3I5MA 2D3WA 4UU7A 4F96A 9ICTA 2GPYA 3C3DA 5TPWB 3NVMB 2FUKA 4S12A 1JX6A 5L1LA 5AICA 1VGRA 3MTEA 4WZAE 2VP3A 3GMTA 2G5TA 2WU4A 3FJ1A 1WV0A 2VJPA 3AFMA 1MAAA 1VZ2A 1SQ5A 1UQRA 3T3GA 3MILA 1QCYA 2AOTB 2I7XA 2JKYA 3KT3A 5EUCA 3M5WA 3SR6A 2PJDA 3IQEA 1MZPA 1Y4ZA 2AV6A 3JW8A 1TAUA 2IBMA 2QVXX 3B12A 3B6EA 5GJWC 4BC0A 4JI4B 5KFOA 4XRHA 3MCUA 5IU6A 4LGMA 3UHOA 5JZ9A 5K0SA 2ZEJA 4BV3A 4ZH4A 3D2AA 1KP3A 4Z2AA 1D8LA 5LWHA 2EQYA 2R4UA 3C97A 1N6LA 3T79A 1MA0A 1NZDA 1OX6A 2G9VA 4G8BA 5FPHA 4KN4A 2J4FA 1TQ8A 5TJHA 1IVYA 4N5NA 4QECA 3KFXA 3AR3A 4OHKA 2C1EA 1WAMA 4NF2A 3VRHA 4H6PA 4ER0A 2EP8A 2Y67A 3GD5A 4Q4JA 3RFTA 4HMPA 4KLLA 1J2RA 1LPAB 4PS0A 3UJ8A 2XE7A 4KG7A 2GEFA 1C4KA 1MX3A 1XVTA 4YJHA 4QRIA 1KAEA 1VG9B 4IHJB 2JZBA 4Q93A 2PUAA 3QFTA 4HNAA 4KFRA 2HK6A 3E4DA 5DNDA 3RU7A 5JECA 2R9VA 2D1QA 2LD4A 2XECA 4B6QA 1H22A 5J2GA 1C5KA 2MCFA 5GVSA 3OO1A 2WIKA 1I33A 3LBHA 4ND5A 1UP4A 3JASB 3KJIA 1ZQEA 1HLFA 1GLGA 4C4TA 3N6VA 4RJ2A 4LFAB 1MQ2A 1A50B 4JL8A 2O3SA 1ZRSA 3H04A 9ICPA 3TAUA 1RS0A 1JVBA 3HNPA 4ER5A 1JBQA 4CM8A 2H1LA 4EUHA 4CGZA 4FLEA 1NVWQ 3HP4A 3FKQA 3I0MA 2IKSA 4L27A 1HK7A 1DAGA 5C5JA 1M8GA 3VR4A 5SY4A 4JUZA 1C14A 1OASA 1MGPA 4RKEA 2P0EA 3D7KA 5JXHA 3Q8MA 2ATIA 3IFSA 3Q40A 4Z9BA 2AOVA 4YS6A 2W4MA 1PG5A 4YXMA 4A91A 2FSFA 1EWTA 1QZUA 1T1JA 2JLWA 4ZN6A 4MGYR 3LFTA 1GQFA 4J0DA 4KDRA 4CQJA 3U6BA 2UVPB 1JR6A 2P4QA 1YNOA 5BRNA 3URKA 5KQLA 3BF7A 3V1UA 3AC0A 3ZWMA 2YINC 5EXXA 2D1FA 4EEYA 2M98A 1DBVO 1EJ0A 1OBCA 2H3VA 5JNUA 4LSZA 4TZ0A 4QZGA 1MQAA 3W5SA 4HOYA 4H1VA 5K8UA 4KK3A 2OWOA 3LQYA 4ND8A 2G0NA 4PVCA 4MKFA 3ZWKA 1HDOA 3V1YA 4CKWA 4GSLA 3EIUA 1YZNA 3IT1A 3DMNA 5EWGA 1B15A 1JMSA 1MDFA 1OPXA 4WESB 3RBVA 4EITA 1DKMA 1E59A 4L28A 1B0XA 4WXEA 2J08A 3KDAA 5F1YA 4YJFA 2W0MA 1XMXA 4K46A 2R1TA 2QQGA 5FOUA 4IR9A 4ZFNA 5FL7A 4YGXB 3F4KA 3TIFA 4P3XA 3TR5A 4PPQA 3SXUA 2XSZD 4GC9A 1YD7A 2N9UA 4BIIA 2ZT5A 1VCMA 2BR4A 2OSBA 5CT5A 1WP9A 3EVAA 3DOHA 4P5EA 4Q37A 4H4DA 2B98A 1G8SA 4CYMA 4JKOA 3V9AA 1JPUA 2JGDA 1P18A 7ADHA 4YAJA 5HRAA 4HLQB 3V7UA 1XNJA 3DXFA 3BJYA 1WUHS 3FTPA 4S2UA 1PNRA 1AQ6A 4R83A 1TGYA 1W85B 2AG0A 3T15A 2QP4A 1UBLS 1ADFA 2ILTA 3K15A 3OQ6A 3AHFA 2JI4A 3U39A 1KI1A 2DQNB 2FMIA 2GN9A 3MLAA 2RB4A 1OX4B 1FC0A 1BC5A 1XZGA 2G17A 2JFWA 3O3NB 4D9GA 2FVXA 1W2HA 1KTVA 4KCGA 5GMOA 4CQLB 1BQ4A 3BB4A 3T7CA 1CULC 3HS3A 3NHFA 3VC7A 1AKNA 1LLFA 3PC2A 4LVUA 1MN8A 4KSYA 4M0AA 4JB8A 1DTSA 2YJZA 3O3CA 3JWGA 4EHHA 5IIMA 3IVMA 5MGBA 3CH4B 1RHRA 1G4UR 1PCXA 1X77A 1GSAA 1XLTA 3LK6A 1LB2B 3VDXA 4DNFA 4XDYA 4PSKA 3VO8A 1JW9B 1ULUA 5GZ6A 3ZJVA 2EAMA 1GPNA 4LZPA 4TWRA 2XUZA 3QEBZ 2BGUA 2JPDA 4ZVUA 1E0SA 3T1VA 1TQ2A 2OAP1 2EJCA 4JENA 1FJ2A 3MB8A 2A5GA 4IDCA 1B8UA 2EGHA 4BLRA 2A14A 3VR4D 2YIJA 3KCQA 2YMQA 1GNSA 1IHUA 2YZGA 3EAFA 4LKOA 4NMHA 1E2PA 5EIHA 3K1YA 2W90A 2P9TA 5JO0A 3U9TA 4MJ7A 3EGDB 4ZVRA 1DUIA 1MP0A 2QN9A 2DGDA 3RYTC 1QG4A 3SXPA 5L3SB 4Q1BA 3LT4A 1BO6A 1UKEA 3LIPA 4QQRA 4EHJA 1M6VB 2H2DA 2B9VA 5KREA 2V7UA 1CZRA 9ICQA 4V38A 5T5QA 3TOVA 2W2VA 4QHSA 3WHKA 2XVTA 4PANA 3K4HA 1XYYA 7GPBA 1JN3A 4CMKA 1N8TA 1Z0ZA 2YASA 1F6DA 2YV5A 3LWNA 4TTQA 2G6TA 3BXPA 4H6VA 3ELBA 3I30X 3FPHA 3FVQA 4V0MA 5KYXB 2JVKA 1TM4E 2X1VA 3DKIA 1EK2A 2Q5FA 3QF4B 2VK4A 2F9MA 1UINA 3AZQA 4EJ2A 4E5PA 8ICZA 4ECUA 1CJTC 4LYHA 3PNPA 4XVHA 1XK6A 3FHOA 2BMFA 2SCUB 1M1NA 2D4AA 2DHQA 3TRJA 5ISMA 2AOTA 3RWOA 3SYKA 4AYBC 4W6QA 3WV5A 2J31A 1V9SA 2F3NA 1VG8A 1Z6YA 1TZJA 2QW0X 3DOIA 4OHBA 3ZVKA 1M2JA 5DHRA 1NG1A 2P1DA 3KT0A 3FNEA 2OC9A 5KMGB 1EESA 3I3OA 3GH1A 1BKYA 4HWRA 2VDWB 5H5JA 1F8FA 3L46A 3B5JA 1UPXA 4FFSA 4G1VA 1I7PA 4HX2A 2HCRA 4X5OA 2WUVA 5TF0A 4MQFA 5JDCC 1A2BA 4C1NA 5KUTA 2BSXA 2O2XA 2GX6A 4MYTA 4R8RA 3ZU5A 1R10A 1M9NA 1ZICA 2HD4A 4G1CA 5EJAA 1Q3VA 1CDDA 1PDWA 2OHHA 2ZU6A 3FOAA 2HMYB 3K30A 3LBFA 4L0MA 3MR2A 4OMCA 1W59A 1WZUA 3CXRA 4M0KA 2FR8A 1ED1A 1C1XA 3BD9A 3EVGA 3OF2A 2ESRA 2X0EA 5JI2E 4QYIB 4I5GA 1GZ3A 2AZTA 2BN4A 1AXRA 4IIEA 2BKVA 3QKUA 2I2DA 4L2IA 3VX3A 4B3FX 1B7GO 1YTUA 3EARA 4C7XA 4QA9A 4PZAA 3GJ8A 2Z5LA 3CNQS 4NE7A 4OGFA 2VUUA 4PRZA 2B4KA 5I47A 5HM6A 2ZIWA 2YRFA 1IWPB 4B47A 1B6TA 2HLPA 5BMOA 4KE6A 5D2CA 1YTLA 3DXXA 3L4SO 4J0CA 3MRXA 3VPFA 3ZHCA 1QDLB 4GWGA 4LXHA 1EEHA 5JSKA 1V5WA 4NR0A 16PKA 4X54A 2IW3A 3RYHA 3HC7A 2FRXA 2OO5A 2KQUA 5H9VA 3NKVA 3ANTA 2XMZA 2ZCUA 3GQCA 1W0KA 3D6FA 1ZZEA 3K9CA 5KINB 5DNAA 1PT6A 1JTEA 3KB1A 3Q7QA 4BO7A 3KNZA 4G1FA 2NQTA 1DX4A 3ORYA 3SENA 4Y1FA 4Y6SA 5CPFA 2IXDA 4AN0A 2Q28A 1T3ZA 1CQZA 5AUOB 1UFOA 9ICVA 3CVOA 4HVAA 1W85A 3BD6A 7ICNA 2JBAB 3Q1LA 4GHWA 4HNSA 3RSLA 1ENZA 3U44B 4W5HA 5BSGA 2WG2A 2XZLA 5IT9A 1GKUB 3UOWA 5ALYA 1V39A 3PXEA 4V0NA 4C4ZA 4DABA 2OD2A 3PQ7A 4EO4A 3HVHA 5CGQB 3PGMA 4ZO8A 1S3FA 3ZKWB 1FSFA 4CQLA 4DBVO 3RVRA 2Y77A 2J09A 4LXUA 4BBPA 2PR2A 3GIWA 4IIJA 4QBKA 2IP2A 3UANA 4DQVA 3I83A 5I7VA 5KPJA 4REQA 1Q50A 2ALZA 4GPTA 5EHGA 4EPTA 1XJCA 1FU7A 5I7FA 3S1AA 3LDUA 1KJ8A 1SU6A 4GRDA 2J0QA 3E8XA 2QIOA 3VSBA 1AXGA 5HR6A 2EH9A 1RPLA 1H2AS 4Y6LA 1WVGA 2J3HA 4HEJA 1QC5B 1MX9A 3M6AA 4X6UA 1T8TA 2C4KA 5DJ5A 4X93A 2EJTA 1NZBA 2B1GA 2DY0A 3NAGA 1PFQA 5JAOA 3EXEB 1RCFA 5H2FU 1EGMB 2G5HB 1YQDA 2D62A 3C39A 1RJ9A 3LXRA 2EIXA 5F23A 1Z56C 5H68A 4DMLA 5EESA 5ALSA 3R6GA 3CLKA 3FHJA 4PZ0A 3EAQA 5TMDA 5EMMA 2KFNA 1CUGA 4GT1A 4MPJA 4N5LA 5G4KB 3EZGA 4JV2A 3LVVA 1WXGA 3AQIA 2QUBA 3FUVA 5HS4A 2F2AB 1Z75A 1VE6A 4QL3A 3MR5A 3NEPX 2ZSBA 4J1TC 3NYRA 2OB1A 3GVXA 4HAOA 1OWNA 3AEUB 3PHJA 4OXKA 4UVEA 5CWRA 1N56A 1X0VA 3V4OA 3Q7TA 3W5JA 4YFVA 1SCNE 3OJ0A 1KTQA 5ER6A 2AZMA 4AF7A 2QI9F 4KXUA 1XLVA 2BJHA 5JZVA 1E2JA 3PUXA 4U3JB 2OGTA 3ZHTA 4LDNA 2B4YA 3WRXA 2AMJA 2RC6A 3CLRC 1VL1A 4I81A 1YR8A 2H7XA 3K9NA 4R2MA 1HUZA 1T5IA 5CB4B 5FTWA 4YRZA 2H1CA 4Y67A 2HHVA 1XQ9A 3PR2B 3AM4A 2A9RA 3IUQA 3I9OA 2QX7A 3JD4A 3QFCA 4E11A 3IMCA 2Z5FA 4ID3A 4HGRA 4JEIA 3KVYA 3PHLA 1I6MA 1E1QD 1D5CA 4FDMA 5A4MS 1TCBA 2XXAB 3N8GA 1VLQA 1KI6A 3A28A 2ZWIA 3CLTD 3LPDA 3REQB 4YDQA 3OFVA 4K9MA 4EG0A 1IXYA 3K4QA 2Y8EA 3LPCA 4PX5A 4RUAA 2GRJA 3TWOA 2DPGA 1E3WB 4QELA 3PNBA 4TZ6A 1SKBA 4IMJB 1SB8A 2EQAA 2OM2A 2GZ2A 2Q6IA 3A2NA 4LQCA 1NI3A 4LMPA 3CF4A 2PRZA 3C41J 3M5DA 1Y8QA 3QQPA 3WB0A 1KYQA 4WKPA 1EFKA 2ZETA 5CT4A 4YQEA 1JJAA 3UV6A 1YK0A 2XUOA 4MDFA 1UA0A 2FZLA 2UZ1B 2ZKIA 3B9RA 4TSFD 1PZMA 2XY4A 3D81A 1FYWA 5CA1A 5JVDF 3AF0A 4NICA 1TIKA 2QT0A 7MHTA 5IN5A 2IUEA 4QOFA 1G9SA 1CYDA 2FJPA 4C30A 5GONB 1GVNB 4CLRA 3W8RA 2IZZA 2R8XA 3C4JA 5JXGA 2K8BB 3A1SA 4PTZA 4MRMA 4G9EA 4N8SA 2IBTA 2I7DA 4ND7A 3R6LA 3AR5A 2XUHA 3VOAA 3HDQA 3ULKA 4DDMA 5A4FS 2NZVG 1OZGA 3I92A 4LOIA 2LI6A 1IOZA 1UR5A 3A05A 4ILEA 3I42A 1ZDMA 2KHVA 4HXFB 1ODKA 2NV6A 4LRXA 1YBAA 5ALRA 3FYTA 3I9KA 4OXQA 4B7ZA 5F1OA 4OHXA 2JCGA 4MUYA 1FQKA 5GM1A 2XQGA 5F3WB 3EODA 3BS5B 1PVQA 4NNOA 4YUVA 4DDKA 2V54A 4NLZA 2ORVA 4ZT4A 4J0IA 1YJ5A 3HH8A 2QUHA 2RB5A 5EWFA 1W7AA 4BJ1A 5B2FA 5DGAA 1PT8A 1GDDA 4WJ3B 3ESRA 5A4IS 4DEZA 1SU4A 4ZVVA 3MVEA 1H0SA 3KOYA 5IMBA 2AFIE 2HBYA 2ZZMA 2YZMA 2XXJA 5BOSA 3L7YA 1OUMA 2ZUEA 3ZJ5A 3I5XA 3G1TA 2PO7A 5E3JA 5JH7B 1ZVQA 3A7DA 1YVUA 1ZIOA 3DGFC 1WUDA 1EFVA 2B0JA 1O8CA 3MK31 1GDHA 3QEMA 1P8JA 4HBZA 4K0RA 4LDJA 2HIAA 1L0BA 4REQB 4TMKA 4TMXA 5IFLA 2OGZA 1GAWA 1K0FA 5FORA 5CUQA 3P26A 1R5NA 4MUFA 1ECLA 4ZZ1A 5DYWA 1HT1E 4ZHQF 2XKKA 2PTGA 3E03A 3IAS1 1NI5A 3HU1A 3LH5A 1KEUA 2FMKA 2ID9A 1P3JA 4REOA 5FO0A 3RC7A 10MHA 4D9NA 5KNCA 5LXTB 1XQWA 3ILHA 5EYPA 2AEFA 3SZOA 6REQA 1H3EA 1BS9A 2HBZA 2CUTA 1NURA 1GR0A 4GC6A 1QYWA 2IZ5A 2VZ0A 3I8XA 3N2GB 3OZVA 5CVEA 3OZWA 3GJYA 1H69A 3H4MA 4UB4A 3SC2A 721PA 1OBOA 3F5EA 1YQWA 5K0FA 4R84A 3BCSA 1MX5A 4NLCA 2QY6A 3QOYA 5IDQA 1G21E 5H80A 1LX7A 3FPAA 3VISA 3SBEA 1GV0A 3E05A 4KWIA 5KT6A 3GB9A 4J9MA 1THMA 1Q7BA 3E9QA 4O4LB 4GX2A 2HNAA 3FGOA 2V0GA 5IWCA 2JLVA 2OMKA 2XUIA 1YDHA 2NTYC 4QICA 3ITDA 4I55A 1FVXA 5LYYA 2REOA 2WTUA 1FQJA 1RYHA 4JI0B 4Q03A 1TCVA 1C7ZA 3OCWA 1V6AA 3HP6A 5JNVA 2WE8A 4ZEMA 4YJHB 1VG0B 5YASA 1UXIA 5HRCA 4DWWA 4JOSA 1QHHB 3WGVA 3AYZB 1A8IA 3HRKA 3BGSA 4DY6A 3UMCA 3FR7A 2FG5A 3SDSA 2H3ZA 1BMFD 2WUGA 3Q9UA 4OM7A 4PGFA 1Z2EA 3HTXA 4QUKA 3DTYA 3P9CA 4OPMA 1CUSA 1NONA 1XTZA 3WJ7A 3IXMA 2Q8NA 2H2IA 1HOXA 4BNWA 4CM7A 2YWFA 2QE6A 3CX4A 4A8JB 2HWXA 1BQEA 1O5TA 3K6SB 3D31A 4LY0A 5KG1A 3EFEA 4KQFA 2BFCB 1T94A 3RTCA 5J2UF 4M1WA 1K5PA 4NPHA 2Y0SC 2DOKA 4WN9B 3FR8A 2E8MA 3OHBA 1F20A 1WO8A 3B70A 3I2GA 1JDBB 3MWKA 5FEMA 3KKEA 3AM5A 4EG8A 3BFKA 1SWVA 2W2LA 5LD2C 4B3TB 1A8HA 1NM5C 1NVAA 3BT7A 4BRWA 1DU4A 3MXOA 4DL2A 4YRNA 1U0JA 4M0MA 3ZJUA 3DM9B 2LBOA 1LI4A 1WETA 5AVKA 1YBVA 1M1UA 4NZ9A 5T7BA 1ZAKA 2D2XA 2R8YA 2ZOSA 1A4UA 5LQMA 1OY1A 1ZOPA 2HDNB 3W1WA 4JJAA 1IULA 3LYUA 2ZUUA 4O4LF 2HJ9A 4D6YA 4AMBA 1EX1A 2J0EA 5L53A 4RPYA 2EP7A 2NZ8A 4OH1A 1N60A 1TO2E 1HQKA 2FDXA 4LHSA 1NAIA 1WEKA 3FX2A 5HJ2A 4S1NA 5DOZA 3BH0A 3NBXX 5GONA 4CLRB 3WAJA 5KFWA 4KRXA 4FFBA 2IZ1A 4E30A 5BNFA 5EA2A 2H52A 1V11A 3W3AH 4AKTA 4ITVA 3O4GA 2ZBGA 2EBWA 3ETNA 3PI7A 2JFYA 4KQCA 3NBAA 4MHOA 1EX7A 3R9WA 4NAUA 3LXXA 4S1VA 2F8TA 4D9HA 3L77A 4FNGA 1DDOA 3A6LA 1G7TA 2ZJ8A 4XDZA 3W2TA 1ZBQA 3AR8A 5TT1A 3TOZA 1P0IA 3E3NA 5SYNA 2P5YA 4YVZA 4G9GA 6LDHA 2PXHA 5KG6A 2GEDA 1ZQRA 1UPBA 1I8TA 1LKZA 1U3CA 2TECE 1NK5A 2C83A 2IK8A 4MR8B 3THXB 1USWA 1XSEA 2D1YA 1K5OA 1BA2A 1I3MA 1KXZA 4U6NA 3CP8A 3V4PB 1BTOA 4J3FA 2QS9A 4TKUB 4XLLA 8ICTA 3D4IA 1Q11A 3JYHA 4NBRA 3SS9X 5AWFC 2I54A 1E2UA 4WL0A 4ZCSA 5JJBA 5HR7A 3L9WA 1Y1SA 3C8UA 3CUKA 3QUAA 4LECA 4YRMA 4CIYA 4AKHA 1J33A 2QD2A 3G8AA 5GM2A 1DC3A 4MQ6A 2C61A 1LWNA 3TNFA 4D4LA 1JIXA 3RCBA 1LD3A 4OHWA 3UK1A 3OLVA 4PR3A 2CFCA 2PT9A 1EM6A 4JLVA 4AZTA 2XY6A 4ASUD 3J81k 1JTVA 1NF9A 5JYEA 1ZOLA 1OAOC 7ICGA 2G5PA 4WCDA 3S2EA 4IV5A 1XG5A 3Q88A 4A6EA 1ML3A 1LLDA 4JP8A 4NDNE 4AWAA 5GAJA 5K3EA 2MSEB 4X64B 2V03A 3LOQA 4Z4HA 2F3TA 2FFBA 2E1PA 2PCLA 3L01A 3OQJA 4Y1RB 3A9SA 3U17A 2XTZA 1P4RA 4ACBA 4D3XA 4EYOA 2JJ1D 3RUFA 2FAXA 4DRYA 5INTA 3STHA 1J5PA 1FYFA 5JCOA 1QZXA 2KVCA 4MW2A 4DUPA 3BC1A 2WU3A 4HLCA 1M2NA 2IYWA 2AQHA 3IAM1 1KEKA 5T4HA 1J97A 2JGJA 4D02A 1U0EA 5HEKA 1R66A 3W5UA 2ACVA 4NNJA 1NYLA 3ICOA 4R1SA 1P1IA 1GWNA 3R0QA 4GI3A 4GQIA 4LJXA 2QRLA 3PHBE 4LMBA 5JRTA 3EB9A 3RJMA 2A19A 1MFZA 2EW1A 2KIWA 1BXRA 1HEIA 2HMUA 2YC4C 4RPLA 2F8KA 3TS1A 2GZAA 3WK6A 3UY4A 3WYDA 3E7PA 2ZYWX 4XXHA 8ICCA 2Q62A 4DDVA 1UMDA 2W71A 1NVVQ 3B7WA 2J6UA 1F4VA 4BE9A 1O57A 1TM2A 7AT1A 1J2TA 1AUOA 1CWUA 1XZDA 5AHOA 2Q0XA 3PYLA 5EFOA 3TR0A 2A5LA 2RH9B 1GKLA 4HNQA 1WUKS 2UVDA 2P65A 1GRVA 4IQVA 4JMLA 4LI0A 3S1AB 3GJTA 1N2ZA 2DT8A 3IUNA 4CE6A 3Q8SB 1UPCA 4JBXA 3KQPA 5HE8A 4YRPA 4BFYA 3ESYA 1DTWB 3Q3CA 4KQHA 3OJEA 4Y2JA 4DN6A 1NPTO 4Y0AA 4Z49A 5CDSA 2VF7A 5KHOC 4B80A 4CFZA 5LXTA 4YRLA 1FP2A 1TUBA 3CUVA 3GJRA 4JLOA 2Q3EA 1YONA 1N9ZA 3ZWCA 1LPNA 3NMUF 3JQEA 4A2WA 4U7FA 2CXRA 4V0SA 3H9GA 4GPD1 3F7MA 3UQZA 3E82A 5D7NA 2PXIA 1RD4A 2CC2A 2IXTA 5J0TA 1HDXA 2JAWA 4A26A 1JFRA 2NRXA 1NUQA 1O9HA 1JRPA 4K1XA 4FS1A 1C41A 3E7DA 2I4TA 4UNPA 1GZ6A 4KXWA 2XHEA 1AB5A 4ZMRA 2VSYA 4OJKA 5JQGB 4O59O 3V55A 5DSXA 4LHXA 3RBZA 4KXMA 3K2EA 3GILA 2G9QA 3ZHRA 4US0R 2AZDA 1BVUA 1PGQA 1JA1A 2GN6A 4M87A 4N3NA 3BGIA 1L1FA 1GLNA 1Q3KA 2EYUA 3TX2A 5IG2A 3PXCX 1P62B 2ZIUA 1AG9A 2QXTA 4IJKA 1IAVA 3ANYB 2XKAA 2IOFA 3A04A 2NSHA 2QL6A 1IUOA 4JFAA 4ZCMA 3G85A 3V6MA 5BVGA 1SN7A 3OZ7A 1PYDA 1FTYA 2XF2A 3WJ1A 4XCXA 3GJZA 3H2GA 3K73O 4XFJA 5BPCA 1SBIA 3K32A 4Z6CA 4DM7A 2RCNA 3AEVA 3EQ2A 2YYZA 3TH5A 2P90A 4DHEA 1EUCA 3IHQB 2UXBB 2DC1A 4HRAA 4UEJA 2BI7A 3CX8A 1DRJA 4H3HB 2IITA 1X9GA 3BFPA 2P4HX 4JH0A 4IQTA 3WL6A 4DOAA 4C0AC 4CCAA 1XT6A 1I4EB 1GNTA 1M5UA 4XRRA 1MDBA 2QRVA 4JR1A 3Q5DA 3L43A 3MERA 5F4ZA 5D5PA 4W5OA 2MAXA 2JZCA 3AR4A 3HR7A 4G0VA 1PKXA 4J6EA 3H65A 2ID8A 1XWIA 2A9JA 3QOXA 5CNJA 2VP4A 2PGOA 5E2IA 3WLSA 2H06A 3ROZA 4YRSA 4IXMA 5KFVA 4F3YA 1RXYA 2X76A 4U6SA 2JV3A 4WJKB 1AV6A 2OLEA 3RLIA 1DRWA 1KKMA 5CJPA 1RYBA 2P11A 2COKA 3WR5A 5JDCA 3AJDA 1II9A 3LO5A 3PNQA 5GQSA 1Y7IA 1NYTA 2QTVA 4TTPA 2DETA 4E13A 3GC6A 5TQ2B 1E3EA 4BB0A 4EY7A 1B6SA 1HDGO 2ZT6A 3QE0A 3JASA 4KN8A 5KTQA 1NSYA 3GEBA 3ET5A 4F5EA 1N6KA 4E1VA 4TLMB 1IPEA 2DWOA 4IG4A 4RTPA 1BCRA 2PWPA 2EAPA 4LZJA 1NC3A 4H35A 5CHYA 5K3OA 4W7IA 3VAAA 2A0XA 2OOSA 1RYUA 4EI7A 1BAPA 5AKJA 1PQPA 1SU7A 1E0KA 1IWOA 2VCHA 5J0UA 2C29D 1T6BY 1SIWA 1I1QB 1DO0A 3LT1A 3CSSA 4M2LA 4WK0B 4HP8A 4R1UA 2QVGA 4JU9A 4UATA 1DHTA 3PHHA 4HDNB 2B7BA 2XQKA 2XWBF 4E14A 1RJFA 4YWHA 1KL9A 1QH1B 4N5IX 5DGXA 3LS2A 1KMMA 2P1ZA 2AFHA 4V0RA 1MW9X 1NK0A 5FI5A 1EK5A 3P5BA 5AK6A 4LQLA 1Y1RA 5JZBA 4OHFA 4PRKA 3HXMA 5IBPA 3ZH2A 4BKOA 1UCVA 3FVTA 1II0A 2W3SA 1JWAB 1NYRA 1PHRA 1I4LD 3FLMA 4XOUA 3UAVA 4DXAA 4YYZA 1WWKA 2IEZA 2VDRB 4ECZA 2GNOA 1NLYA 1SUSA 2V6JA 4JCOA 2GEJA 3HBAA 2MSLA 4ESHA 1BXGA 3NUGA 4I14A 3NS1A 2JFGA 4PPYA 2CLCX 4U2CA 3RF6A 1BXZA 4MCHA 3GLIE 1M8PA 4FX2A 1Y3HA 1SKQA 2VJNA 3I37X 4UTRA 3VV3A 2XCAA 1HFJA 5MFZA 3UV3A 3KHGA 5DBHX 1TTPB 2W8BA 3ZE8A 1RPJA 4TVKA 2R1UA 3UGJA 1NA5A 2G1PA 4TXNA 3R9KA 4LG1A 3LF2A 4AZ3B 4CQNA 2UVQA 2OV2A 2ZJ4A 5DHUA 3W2FA 2NU7A 1L7AA 2QK4A 2CLKB 5P21A 4C3OB 2UUAB 1W75A 3Q7PA 4JSTA 3S44A 5DI3A 4PO8A 2AX4A 3N0VA 1KP9A 3E9YA 4GE0A 2H1IA 5KYWB 4X9XA 1EK0A 2WQ6A 1T8UA 2LRHA 2WUEA 4II3A 4UXHA 4HNUA 1TCAA 1XEAA 1SXJA 4TPKA 2C5FA 4N9WA 3STWA 4C4YA 4YT4A 5IYZF 1QIMA 4B3XA 1SFRA 3IUSA 1O6CA 1W19A 2OZVA 1TZMA 4DL6A 1C3OB 3HUFA 1G3UA 1F12A 1LTKA 4B75A 4PN7A 1YE3A 3QMWA 4H1UA 1QVVA 4M1YA 5IZCA 1S89A 2W8ZA 4KE7A 2Y0EA 2RGWA 1Z2OX 4J90A 2CYAA 3PFKA 4JDPA 5LMNB 5U4XA 1FFUA 5HHIA 3AU2A 2UVRA 1D4ZA 3JZDA 4GPEA 2ZJ1A 3M70A 1TOAA 5DLFA 4PCVA 4BYGA 2HMWA 3M9OB 4RTQA 7ICVA 5JNSA 1HWYA 4C9BA 1G7RA 2DFKB 2PKWA 2QW1A 1Z5NA 4YLGA 5TNXA 4M37A 5IKXA 3MWDB 1AB6A 5IJZA 3AG5A 3IP3A 4Q7QA 2FYTA 3D2QA 3T0FA 4DSFA 1L3BA 2YWEA 3EUWA 3D7MA 1G66A 1Q1EA 2JFBA 3ZTWA 4QPJC 1EAYA 2EZ4A 3JPRA 3JYLA 3V4SA 4EUEA 1I2MA 2FZEA 2M6RA 3DYIA 1FTQA 3A1EA 3EPPA 5K6RA 5J4YA 1QAQA 4BATA 1C81A 5CBPB 2QGNA 3RO7A 4RNMA 4L5CA 1A8PA 1OROA 2WP8J 1EWVA 5DGIA 5T41A 3TEJA 3LAWA 3PFCA 3RRHA 4CR8A 4RLFA 4TT3A 3JVIA 3UYLA 3GLHA 4GM0A 3BWVA 4D99A 4MLPA 4PL2A 2H7CA 5L3SA 4QZIA 1ZIYA 4DLBA 1DAOA 1JU9A 2WQ7A 4DO9A 3R0VA 2BR3A 5EOVA 2CLDX 2ATXA 2V6FA 4GOOD 2J9GA 1EDEA 4GZLA 4I9NA 1KP2A 3AKEA 2HQOA 3CO5A 1L5GB 1NVXQ 3ELWA 3KTDA 4OMFG 3GRAA 4CR6A 4Z7NB 5MFPA 1V7QA 2X13A 3F6RA 1N5DA 1K08A 3IJPA 2YN0A 4MKIA 3S68A 3V8VA 3LSTA 5HCNA 3VM6A 4YT2A 3ITKA 2GASA 3A0BU 5E4JA 2X9GA 1N3BA 2D0DA 5WRFA 5LQDA 2PX6A 4M8LA 1Z0UA 3FDXA 1L3SA 4RK0A 2FPGB 1BE8A 2RJOA 4HTFA 4DMUB 3IBTA 3E1KA 4HJRA 3BB1A 2HO4A 3EF3A 2HYIC 1KQPA 4RC9A 4RQ2A 1WPXA 3ER8A 4V1CB 3O1JC 4N1AA 4L75A 3VXKA 1SBTA 2WTEA 1A1SA 4LJAA 1W2WB 3GUZA 5KWJA 3TVYA 3UPUA 4MWGA 3HZOA 3QKSB 3JAMA 4ENPA 2A78A 4P4GA 3H7AA 1JA9A 2Y1IA 2A1JA 3SX4A 5CT6A 2OXOA 1I5OA 2J6TA 2UYQA 3AEQA 4LZLA 1NW3A 1FVOA 3C8DA 2CK3A 4JJFA 4MAFA 4DVGA 1AC5A 3RVLA 1NJWA 3M5PA 4IRXA 3C85A 4ZVPA 1YH3A 1YJ8A 2RIPA 2C96A 4JI5B 3SJ7A 5B12A 4B44A 4RA6B 3P2KA 2O48X 2VDNB 2BP7A 1AMNA 3FDZA 2EX1A 4QFDA 3SEQA 5IKOA 2DWCA 1Y80A 3LTNC 4QTZA 5SYMA 3HA5A 3JQAB 4CJXA 3JQ7A 2YHBA 3FHTA 3L1KA 2XWJI 3KFVA 5JQWA 3T7DA 3ON5A 1J7JA 3OTWA 4O4JA 4NQZA 5B6PA 3CU5A 2Z1NA 5ITZB 2YJ5A 4ERXA 1KI2A 4B3MB 1D8AA 4B43A 4YRBA 2WHPB 4YT8A 1Z1BA 1XJ0A 2FW7A 3SDZA 1X9HA 1IXZA 3CBQA 4L50A 4QPPA 3QPCA 1JG1A 3TSOA 1MABA 4YAWA 4ELVA 1GGFA 1QLJA 3LP5A 3ZWPA 5AVJA 3VC8A 4RETA 1FZTA 2E5LB 1EVQA 1ZQ9A 3JD3A 4OL9A 3UBTA 1IG3A 1L9KA 3WLOA 1YZ3A 1ES9A 3QM1A 4UBBA 5FLEX 4QUGA 2F4VB 1MORA 3MGKA 4DCTA 1GTJ1 2JVIA 4AIRA 2GETA 8LDHA 4Q7EA 2ZXEA 1RYRA 3ND9A 4RHEA 1ZM9A 4AKGA 4A8JA 1FMTA 3SJAA 1LLCA 1N9GA 1WHTA 2DM6A 2WWXA 3LVQE 4HLUC 2NO9A 4KXNA 8ICBA 4PGGA 2WWTA 2IV2X 4DSZA 3K70D 1H38A 3JALB 4YCAA 4LGVA 3QPAA 3KEGA 4M0FA 4BX2A 1TCUA 2BRUC 2O4CA 4PHAA 1U3VA 1B93A 1YT3A 3D3WA 2AVNA 3AILA 3IP9A 3R20A 1JDTA 1RHJA 3N76A 4GMFA 5KNDD 4AKIA 1U3DA 1T8RA 4JBNA 2QB0A 4ARUA 3ESCA 4AXBA 4HV4A 1XTRA 5HJEA 1NT2A 5FWNA 5BN4B 2PFPA 1UJMA 1N8NA 4RH3A 2OA0A 1V5IA 2AVDA 3ABRB 3TYXA 2GAOA 2FSVC 1X2IA 2NRWA 3LHFA 2VDMB 3L8HA 2X3FA 3E3OA 2HA0A 5CK4A 2KLBA 4UEWA 4CBVA 3R6TA 2BSAA 1OXBB 4C4SA 5F52A 2OHFA 1KEVA 2VLBA 3A06A 5I4KA 1TEXA 1HNWB 1J2YA 1R88A 2WLSA 1WV1A 3WKBA 3LY7A 3R9XA 4IGFA 4URZR 5HQJA 3MN1A 4B3DA 1SUWA 1MNAA 4X71A 4HL6A 4RSGA 3A25A 4Y30A 4BE4A 3GBVA 1VE9A 3WSWA 5KYWA 1OH5A 3ND7A 4L16A 3WKDA 1QVWA 3ENWA 4R69A 3LP8A 2W4QA 2FCRA 3G2LA 4HUQB 3ZZ0A 3T5AA 4O1HA 3SHWA 5GV8A 5BSUA 3H87A 1BA3A 3O83A 3GX1A 4LNUA 5B30A 2NZUG 5CB0A 3PHGA 1QQBA 1DAMA 2V6BA 1YS2X 2YQ5A 3K4PA 4Z8YA 3RIEA 1E2IA 2RGUA 2O8EB 2Q6TA 4BAUA 1TA0A 5HBGA 3Q2IA 2UUCB 3I2KA 2D0IA 4FBMA 1MAHA 1SZDA 3FNHA 4MAMA 3THXA 2O1XA 3T3DA 3LCRA 1E2LA 1H65A 1X1TA 3QLUA 2CXXA 4LRUA 2KFZA 1W1IA 3A3YA 4GVXA 2GGSA 4CI9A 3KJFA 4XJVA 4IJMA 3V7LA 2KZZA 1OVMA 5ALMA 2MR6A 3BOSA 3G1UA 4UCWA 4A6XA 3TLGA 1KU6A 2RHLA 1SO8A 4JJIA 4WA8A 3V7JA 1CJUC 4GPZA 1Y6RA 1NU6A 5BXQC 2H9AA 4RIIA 2W00A 1T5DX 4MJXA 2I4LA 3QGMA 4D3DA 3EZYA 3QWFA 1KIMA 1OC4A 2AN5A 3GL9A 3QLVC 4OU4A 3CPHA 2C84A 4HGQA 3CUTA 1F8UA 3PDJA 2ZUTA 2EFGA 4CMEA 2GLXA 4I2HA 1XDUA 2AMFA 4KGVA 1RZVA 4EAQA 3SSOA 4HT3B 4HO1X 4Z0NA 3LUAA 3SSMA 2J5RA 2O2HA 1KAOA 3PUVA 1ZQZA 1C1DB 1KDTA 1N3YA 2GO1A 3R7SA 4C22A 4CM6A 3EPLA 3KZCA 1HYQA 1D0VA 2Q7DA 1NQTA 2XE6A 4OAPA 3L8ZA 2FMXA 4FJ1A 1H5UA 4Z54A 9ICMA 1E7SA 1N75A 2BSQA 2WP0A 3KHUA 4YAOA 3AJ8A 1WCIA 2ZRNA 3ECCA 1ISSA 1TXGA 1E7RA 1D7OA 1R0CA 5KG2A 1CZKA 4NARA 3L7DA 5CNIA 5B58T 4P2HA 1JJFA 4QYIA 3ROTA 3SEFA 4B3IA 621PA 1N77A 1E61A 5D4BA 2YR0A 2BHNA 1Y48E 2LGJA 3BDIA 3MD9A 1NXTA 4P31A 5G41A 2WK1A 4A23A 3IOMA 2XYRA 1X7WA 5UKDA 2QLFA 2Y6UA 4BNYA 3Q2KA 1S3GA 1SZHA 1DBRA 5M04A 1K7CA 1E6EA 1DKLA 1YXMA 2PLAA 1X7ZB 2WHPA 2AWOA 1CP2A 1EPUA 2NTJA 2PXAA 3BTUA 2ZRHA 4MKGA 4Q82A 4BASA 3HILA 1EIZA 1KDPA 2QRMA 5DF1A 5IXYA 3K8YA 4RULA 1TA4A 1T9AA 3D4BA 5TPZA 2R96A 3H2JA 1FIUA 4EBCA 3VVLA 1KFSA 3QVWA 3AUOA 4M3NA 2YQZA 5JH7F 1YJAA 4QVKA 5GV7A 5I7OA 5KKCA 4I7EA 2C92A 3FKJA 5ERYA 2PANA 4INAA 3QU7A 1XMSA 3IS3A 3LQ2A 4H31A 4V3BA 1JHZA 2X1HA 2Y0PA 1LSSA 3KPVA 2A0YA 4RH1A 3TLZA 3BSFA 4HPWA 3U3JA 4DSTA 1WMAA 1KAMA 3SF8A 3MRSA 4OBWA 1EIWA 4JI6B 1CQXA 3VDNB 1NWHA 4KR0A 5FNVA 5A5DA 5CD9A 2GA9A 2LM1A 4EA7A 1NQVA 1NZJA 2JAHA 5A9SA 5CRIA 2W2QA 3CF0A 4J1SA 4GZ6A 3NETA 3CRVA 4FQ7A 1A7JA 3UAXA 1UPUA 2O06A 4KXVA 4XTCS 3VMMA 4KSCA 4AMVA 4JKIA 1AHPA 1ND5A 2YWRA 4O5AA 5KNBD 1GGMA 1ND6A 1U9ZA 3F6BX 4IVNA 4E94A 3R4CA 2WIBA 2WWRA 3QYFA 4MVCA 1DLIA 4WASA 3VYRB 5CA1F 2MSNA 2QRKA 4DOBA 2OVBA 2DKZA 1KI4A 1XWLA 1HG1A 3TSZA 1GFZA 2A1UB 4WGGA 2K7FA 4RVUA 4EG7A 2ZI7A 5B53A 1IQRA 1W5SA 2KW5A 2QVBA 2HCTA 4E46A 1X1RA 3E0QA 2EEZA 4OJPA 1FRVA 1M0WA 1QC5A 2C97A 2YFHA 2YZ7A 3DO8A 2OCBA 4XI9A 1KZHA 3IG8A 4BO9A 2ZIXA 2Q9AA 5H4HA 1AD2A 3CQ9A 3MTDA 4ADSG 4EKYA 2Q1SA 2PMFA 5BW4A 1XZBA 1SD5A 2YX1A 3A3KA 2GZ3A 5KNBH 5U9CA 4QZ8A 3LO8A 3N5KA 2ES4A 2OL4A 4ZQCB 4NV1A 4RPKA 5ED4A 3GEMA 4C29A 4OLBA 2IS6A 4CL8A 5J5CA 4RQ3A 3QKWA 2AJQA 1NSFA 4WBXC 5JAQA 3UBMA 3SXJA 2A6PA 4FHEA 3DUWA 1GN8A 3F71A 2BKXA 3NTVA 4E08A 3EXG1 1KZGB 2IL1A 1OGYA 5FYQA 2FRDC 2WQZA 3LP6A 2YZ2A 4DQKA 2HO5A 4P22A 1S9FA 1V3QE 2ZS7A 4I46A 1XZKA 3GH3A 5E1OA 1UWLA 1XD8A 1CF9A 2VYNA 3TADC 3EGXB 3EVBA 5AW5A 4BDTA 2P77A 4X65B 1LUAA 5BW6B 1M34E 1T9CA 3D5TA 3UFXA 9ICJA 3DONA 1AURA 4Z4GA 3JD2A 4I6GA 3RAJA 4LFBB 3RUIA 1X2BA 4LHEA 1G5RA 1A77A 3HCRA 4ONEA 1PJ8A 1AGXA 1U0FA 1QB7A 3KT8A 5FPSA 3M3HA 5DVZA 5EZYF 3AWDA 4B73A 4N0PA 1ZM3A 4GLOA 2XY5A 4B2PA 5CCEA 4NVRA 4RFVA 1QYIA 4ZHQA 4G1EB 4PV7A 1AOXA 1RLMA 2C1ZA 3QUCA 2FWMX 4KLOA 1EINA 1PWZA 5F2OA 1DCTA 5DDIP 2R2AA 3B3QA 4JOCA 2PKYX 2I6XA 3MNFA 3KAPA 3MWGA 4LYFA 1IMJA 3EZNA 4LZDA 3KL4A 4RAOA 3T9BA 4F4CA 4KREA 1ZQJA 2ZUBA 1Z35A 2HQ1A 2HQSA 3RJ9A 4A4DA 1I0ZA 3PKIA 1V2GA 1DJOA 1UCFA 3TL3A 2DLNA 2I9GA 1AK2A 4L3OA 5CRXA 3DT6A 2BAGA 4D8WA 3HCNA 1TM3E 2XMRA 2GZMA 3K6JA 3KKQA 4I4TF 2VDJA 2X14A 2F1JA 1PI3A 1JWLA 1U63A 5KFEA 2Y1KA 2UZ4A 2GCEA 1EFRD 2DPIA 2IYPA 4OHYA 2QPAA 2ZSKA 4IILA 1PE0A 4MPTA 1GUZA 2ZRIA 5KL1B 1NK8A 1D1TA 4K6KA 4MUKA 2I4RA 2GD2A 5LQNA 3AONB 1E9VA 3SPXA 1CB7A 4F9GA 4WBNB 4RKQA 3OHSX 4RFSA 4JUIA 4OQYA 4CGYA 5E1MA 2R4TA 1ISGA 1K5DA 3LKZA 4FSHA 3HLKA 3RR8A 4FCVA 4OI0A 2L19A 1ULHA 2G9UA 4PX2A 4WCFB 4KAJA 2V7XA 5J2IA 1A9YA 4ZQGA 4BNKA 1JZTA 3DZ8A 2V7BA 3B5EA 3DFIA 3HKEA 4ENWA 3JARA 1Z39A 2VQ6A 4H6XA 4TTIA 3OPYA 4EPXA 1EDZA 5JMWA 4JJ7A 1PIWA 3RKSA 1XO1A 1ORRA 4S04A 1MAUA 1WUYA 2H2HA 3TAHA 3TOCA 2R8OA 4EB3A 4DJEC 4MW5A 3NAQA 1NJ2A 8ICOA 3RRYA 5HOEA 1GIAA 1J09A 4WKCA 3AEXA 5DBFA 1BEEA 2LDBA 2KG5A 3R0ZA 3A6DA 3A6FA 2BFBB 4ZV7A 1XNRB 1KOGA 4DILA 3QPDA 5GJVC 5JRZA 1N5KA 4EB8A 1Z9BA 4FDVA 3FYHA 1F8XA 1YQGA 1A9TA 4TUSA 4JWKA 4K9QA 5G53C 2C4HA 2AI1A 3HY4A 5MDHA 1U8XX 2BP7B 2XCOA 5CA0F 4JHXA 4CEIA 1JU4A 1EEXB 1DXSA 5DLDA 1I4OA 3CN7A 4TZKA 3W8EA 1KORA 3CPJB 1DG1G 3T7JA 1E64A 2C88A 1PL6A 1SQGA 1K63A 1LK0A 2HLHA 3C43A 3O38A 3FD8A 3Q10A 1XA0A 5FOSA 5AVZA 3UOGA 4DR5B 2GUWA 4FOPA 4EUKA 3HPOA 3UK0A 2VTVA 1PL0A 4IYJA 3WNCA 4RWEA 1WWUA 1DJLA 2Q1UA 4MQEB 4PG6A 5J2BA 5EXTA 5IVDA 4YALA 5C5DA 2Q4BA 1C9EA 5DCWA 4EI2A 2BGKA 1X9MA 4TSKA 3TOSA 5JATA 4D7AA 4DCJA 1RKXA 4UE3S 3QFHA 1RTKA 2H4YA 4HEQA 4YJ3B 3FNGA 1GAQA 1TKRA 2V65A 4MPRA 1QHGA 1BPBA 3NOVA 4RO0A 4B4DA 1Y5NA 2UYCA 4I5IA 2XDWA 3UC9A 1JQ3A 3AF5A 2WWYA 4URVR 1IXKA 3D2SA 2RDJA 1V3TA 2C2HA 3DEFA 3ZLBA 4BXOA 1KAGA 3QPWA 2JEGA 4PGYA 2XA2A 4HLNA 4Z7JA 3EA4A 1XZFA 5IW8A 2G28A 4C88A 5F7XA 3N9IA 2H11A 1RMYA 1T5LA 2H1SA 2IKQA 3H5WA 3GGPA 5FBRB 2JLUA 3NOXA 1F0PA 4QUIA 2GUGA 1UT8A 1DADA 1W0KD 3RYIB 1FDWA 3V8PA 1KO7A 4K40A 2FFRA 4Q4AA 1OXVA 2XT0A 4R40A 4CF7A 3FPFA 1U4BA 1AY0A 3NHKA 4F4UA 1A8UA 2X4DA 5IRCD 1G3QA 3NTXA 4KLQA 4XEUA 3ZU4A 4DLPA 4PYJA 2NZWA 2JZNA 5G4KA 4DLVA 4M54A 1L8OA 2QUKA 3CX7A 1VKRA 5A9TA 2R4QA 3PRYA 2QRHA 2RRDA 1QWOA 2KJ8A 1WZ2A 4BVKA 1QTNA 4TS3A 1DOHA 4UBLA 2NU8B 3FGZA 2JFPA 3KCNA 3T94A 1ID8A 3F5QA 2OYCA 1E3TA 1GILA 1HNNA 1TZKA 1O77A 2XCQA 2QARA 3GJ4A 4EHKA 5TPWA 1YDMA 3BJIC 4UPEA 1RXSA 3S5JA 3P9XA 1NYQA 4WDRA 4EW1A 2OMEA 5HW0A 4DVJA 5KDOA 2FPOA 1P3DA 1L7DA 1WRBA 1CDOA 4BFUA 2MR5A 1VBMA 2OECA 1OW3B 1NT4A 4XE5A 4NBNA 3RWMB 2DLCX 3HZZA 1RYYA 5TSDA 2CKDA 1UK8A 4ZO7A 2QV0A 4L1KA 1OLOA 3HCWA 3E9CA 5KSYA 3QXGA 4F4FA 1Z8DA 4EJSB 5FADA 5A3QA 2DT5A 1CV2A 4KI7A 1E98A 1AA9A 3GYBA 4R2LA 4JITA 3UJ7A 3H8WA 1HGXA 3PIDA 3VTZA 5BR7A 3MM4A 3AERA 2O8DB 2AKAB 1NQXA 3TQHA 5K8IA 3G0IA 3L06A 3PJRA 3DMDA 2CW5A 5EMJA 3ZY4A 2YV2A 4YAKA 1ZA1A 3IOEA 2PGJA 1QGUA 1SH7A 2UZ0A 3A7EA 4TKUA 4KZKA 3TSAA 4EL0A 1E3MA 1M66A 2JAPA 2Z3VA 5IX8A 4G25A 1VL0A 5FJJA 1UZLA 1KY4A 3FZNA 4IHJA 4B2IA 1PX0A 3FSRA 1Z3IX 1Y34E 1YR3A 3T5CA 1T3QA 4BV2A 2QW8A 3CVJA 5LB2A 2EG5A 3I04M 3N53A 5IVKA 2PZMA 4LX0A 5DZSA 2PWAA 2QJTA 4PHFA 4PNPA 5TRTA 4HDSA 2MINB 3DZFA 5LMZA 1NR7A 3W6PA 2A5DA 2C7QA 3WNVA 1KR5A 5HYVA 4P3NA 2NPIA 4ZHSA 1OUQA 2BFPA 4V02A 3G2KA 3FTFA 1NQOA 1Y1QA 3R3JA 2ID4A 5IF3A 1AQYA 2C4TA 3OEEA 4WW0A 2BBOA 3STXA 4ZV9A 3T5BA 4KLNA 1L3TA 5FQNA 3PEEA 4YR7A 1JHYA 2K4PA 1FSGA 1XCPA 4ZT6A 2JLZA 5FQOA 3VHXA 3VJRA 3QX7A 4N5DA 5IN4A 1XMOB 2X5NA 2JH3A 1TVCA 4IQUA 4QUDA 1A8SA 1KO5A 3I4FA 4YTEA 3OPYI 5E8RA 2Q5EA 3KHHA 2DECA 3W4KA 4DIFA 1HEUA 1H8HA 3RI3A 1R9JA 2Y1XA 1C20A 5CVUA 3UAZA 4B2LA 3SY8A 1KVUA 2HHCA 3D8RA 2EATA 4DZTA 2RK4A 3QXSA 5DXAA 3TF5A 1PT9A 2ASDA 2C20A 2Z9CA 3LY8A 4JIMA 4BBZA 3L6BA 5DGTA 3RASA 5KO2A 2W6IA 1T9BA 2AJCA 3RU3A 4DSNA 2C57A 4AUEA 3P71T 3DR3A 1LKYB 3RB6A 1ODIA 3GNTA 2I22A 3FA2A 3HVUA 4MIEA 4E6PA 1Q0LA 1OR8A 2GPSA 3IHLA 1NQWA 1W2GA 4G09A 1AQNA 2R60A 1G20E 4Q4CA 2B8TA 2GCGA 3KQOA 4QDXA 4RK4A 1T6XA 4MIKA 3VUFA 2YOGA 5D7BA 3GLSA 4DSJA 3O8NA 2JEFA 2IT1A 5LA6F 3WLTA 4CEHB 1JQEA 2ARKA 3GQBB 5DU2A 4C21A 1XQVA 4OJQA 2EWWA 4P0QA 3G88A 5DXJA 3ZZ1A 1N2SA 3NAZA 3HKBA 3K35A 3IVXA 3PL5A 4L6IA 3UEOA 4BFWA 2X8JB 3A6EA 2EEPA 5AK0A 2WWVD 2GBFA 3UN1A 5J43A 3U5ZB 2GAIA 5FPKA 1CQPA 2IQIA 5LKAA 4C2TA 2I8LA 1QTQA 3PICA 4RIHA 3MWEA 4G07A 3K6KA 4AY5A 4EPVA 4I8XA 1EUQA 2IHNA 1BWRA 4RHFA 2ZYVX 4HVCA 5IFKA 5THKA 3ESBA 2CHUA 3L0OA 4AMZA 2UVUA 4TOIA 2KVSA 4O3NA 1AGYA 2BEWB 2PX2A 1Z4NA 3DEKA 3NW9A 2LIPA 1U4NA 4P7BA 5EXEA 3HGMA 5BVGB 2Z58A 2A35A 4FDLA 4RLHA 5CEHA 5L3ZA 4DCNA 5BN1A 1R4MB 2OBLA 3JV7A 3WIOA 5CDGA 5KQRA 1J2UA 1Y37A 1IN8A 2HBLA 1TW3A 2I76A 3KR2A 2PN1A 1QGZA 4PAOA 1YUBA 2ODPA 3QVVA 2CNDA 3UO8B 3RIGA 4EK9A 3CNOA 1F3LA 3F9RA 2H1OA 3JQBA 3D6HA 2XCPA 3D3NA 4NATA 2JI9A 5D00A 4F86A 4F6RA 821PA 2R6FA 2ORWA 3OJWA 4KLAA 1Z4QA 4ZP1A 4KQEA 4UAZA 3IN5A 5H3HA 4HXYA 4HH3C 1YZ7A 2CDAA 4I2AA 4BV9A 2J7KA 2V6IA 3R2JA 1WVMA 1NJYA 5JYBA 1J8FA 2AKYA 4MI3A 4CMGA 4QIWF 5IASA 3RUEA 5JJIA 5FDFA 3HCOA 1GGEA 2BZGA 5FV7A 1GU0A 1YQTA 1TK9A 2VBIA 3E84A 4FW8A 4GVPA 3GEHA 4JVOA 2FK7A 4OKNA 4WFJA 2YZKA 1EE9A 4UHCA 2O8NA 2ATCA 4Q9HA 2X1MA 4MVJE 5FBKA 2NUTB 3F7TA 5CDUA 1I1OA 5AVWA 1POXA 5BOMA 1KK0A 2R8EA 1UEJA 1H2ZA 2ZSUA 1IZ9A 2MOKA 4Y1GA 1ACJA 1B3RA 2VBFA 1X74A 5J0XA 1ODLA 4EATA 2HWWA 3U4IA 2NXJA 1Y5LA 3VTFA 3BXHA 1JLMA 1KEZA 3AF3A 5KFRA 4LXYA 4FYVA 4BZZA 4J29A 4EHBA 4Y2XA 2MINA 2X8BA 1BPZA 3OM1A 4NYJR 5K2MA 3SYMA 4DCOA 4GG1A 5CPBA 1JFSA 2W93A 3GN1A 4QWDA 1ATZA 2FWBA 4Z6DA 1TI7A 2X5OA 1Q57A 1UJCA 2ZJBA 4FFPA 1W36B 3HL0A 3C3CA 2QPOA 3EPHA 2BQ3A 3X1ZA 4B5LA 3CCBA 4RXTA 1PT5A 2XYGA 3AR6A 3FNRA 2Y05A 4G5GA 1ISHA 3ZXXA 2H16A 1RC0A 4NLLA 2PTHA 3GLHB 5KYVA 4ZGBA 3ZE6A 3ESQA 2PX3A 3KX2A 1KI9A 1XVLA 3KYBA 3T9CA 5KNBA 3UATA 5BWOA 4GXNA 3C8ZA 1OX5A 3C0KA 1R6VA 3FMOB 4AJLA 4BUZA 2VJQA 3N2NA 3ZDXB 1W34A 1LBIA 2DUUA 2VH2A 2IHYA 3MTJA 1T6ZA 4MQFB 2XZPA 3CF4G 4X61A 4EIWA 2DPXA 4DCPA 1CR0A 2RGXA 3EIHA 3MRVA 4DRXA 4Z0TA 1ZX1A 2FEOA 4OBEA 4DREA 3GPLA 1ZQXA 3P20A 1YI1A 3H17A 2H1HA 3HU3A 4QQ8A 4NL4H 4PLYA 4FOTA 5ECGC 2N47A 2FW0A 2WB2A 3I05A 2AKEA 1Y88A 4KUHA 2RAVA 3T5HA 4HDCA 1JG6A 3I64A 3TZHA 4RTOA 5FUBA 3E18A 4EQZA 1ST2A 3DW1X 2HU8A 5AJHA 4ESVA 1RWWA 2H0QA 1UWCA 5JSZA 3PSAA 1YFKA 3GELA 3QW2A 4LZWA 1VHTA 2VLIA 1MV5A 3AO0B 1MB3A 5JWHA 4KXQA 1GG5A 2IUFA 2ZJ3A 5JROA 1I6KA 1EFTA 5LYJF 1Q12A 1PJ4A 3PWSA 4P4UA 4Y9TA 2I2XB 4YRJA 5DHAA 2ZXUA 3EBPA 4MW9A 4IS2A 1OIVA 2A57A 2AXNA 4C0BA 5T67A 2E9SA 2GTIA 3SQOA 5LJLA 2RARA 4LJLA 2NZXA 2VZLA 4O4HA 2AXTU 1SVSA 3GFKB 1WDTA 1U28A 3MYRA 3H5TA 5K9ZA 1KDZA 1ZEMA 2P68A 1ACLA 2ZUDA 4KAAA 3EZLA 4ZALA 1TZBA 1VECA 3ML1A 5FPPA 2JK1A 1AUPA 1YJBA 1ZW6A 3T99A 2CMHA 2JGAA 1JEEA 1ECJA 2ZTSA 3FM9A 1N5LA 2YWDA 4OGGA 4S1TA 2YVLA 1SAYA 1ZLXA 2YWGA 5BMVF 4W9MC 4RPZA 3EZ5A 1YE5A 4KV7A 2NVUB 3TRDA 1JT2A 1N5IA 3N2YA 1C7FA 4XVUA 4Y6PA 4Y7DA 3VNRA 3RK4A 3OMLA 4FQ8A 4KOAA 4FDAA 4OF4A 1ZUNA 3MFQA 4F5NA 4ACOA 4PIPA 4PZPA 5JU6A 4OX9B 2BKEA 5DDMA 4WVFA 1H9BA 3OICA 1LDMA 2QNIA 1H3NA 2IZ7A 3DPSA 1DO2A 4YJ3A 3RD5A 1QNFA 4AP9A 5EUMA 4A6PA 3EA5A 5ENDA 3ROMA 4GKBA 1S01A 3V5NA 1KPIA 3VAYA 2CXOA 1FFXA 2E8NA 1D2RA 1WA5A 1G5FA 1SBNE 3GAZA 4G36A 2ZK7A 2Q5LA 3W5DA 3JVDA 4DQSA 3QPVA 3RSSA 5EJ5A 4X1KA 4MVJD 3H05A 5C3MA 1U0TA 1XSNA 3DLPX 3H1FA 2CN1A 3GCWA 5BSMA 4BFLA 4D98A 3VUEA 1T4GA 1XI2A 1QFJA 1KA9H 2G40A 3IAUA 3WIVA 3PX2A 3ZH9B 4CLDA 3PEVA 4KSBA 3VTAA 1Z6XA 4QDJA 3U7QB 4XGNA 2ZPUA 3Q8LA 2M1XA 5CVVA 5CM2Z 2ERCA 2ZE8A 1O95D 2TMGA 4RJIA 2LE0A 1QSYA 1XV5A 4GOKA 4CNQA 5HF8A 5DTQA 3VPCA 3AFOA 4N0QA 1THZA 4EBFA 4G0YA 1T8EA 1K66A 3D8UA 2V5VA 1HZJA 1GP2A 1BDJA 4OHRA 2BFDB 1PS0A 3B82A 1QLNA 1TMYA 4EW6A 5BMVB 5K0EA 2CWWA 1ULZA 4I5FA 1C8VB 1T4CB 2DQZA 3ZDQA 3OJOA 3CRZA 1U5AA 4X91A 2OFWA 3AHEA 2GZ1A 2RGDA 1U6JA 8OHMA 4MI1A 5KNDH 3HJFA 4TYPA 4YAUA 5BRAA 1IB6A 1PX2A 4UUQA 1L4EA 2DTDA 4D4IA 1ZN2A 4JLWA 5BYKA 1H9CA 3QVLA 5AQ1A 4IKEA 2K4HA 2GZSA 3N2EA 2DL0A 3I39X 2W6CX 4ZTBA 2CHEA 1RM0A 5KFHA 5ILGA 1SCDA 2H1VA 2CCGA 3G3EA 5K0NA 1XWWA 2C3PA 3EGWA 4DLUA 4Q3DA 4ZEOA 3WIDA 2WWFA 1P9NA 5HUHA 1EG7A 4G5SA 5C37A 4B45A 3JATB 2G25A 5KTKA 4TLDA 3KYDA 2ZFUA 1E5XA 4P7JA 1GYQA 2NT3A 3KTAA 4UJ5A 1VC2A 1RRFA 4GYWA 5ED0A 1WL8A 2FPLA 1M2OA 1L5RA 5TPZD 4EJSA 1CRXA 2CJXA 5EE9A 2XYHA 4MA4A 2QUJA 4M4SA 4ALMA 3SYRA 3HCAA 1KFBB 1XMVA 2HMSA 3S2IA 4DA4A 3REQA 4NXMB 1JRLA 1C9NA 1UMBB 4U63A 7ICEA 1CW2B 4X1IB 4JL5A 2Q4TA 1JFVA 3IBYA 1H1LA 3OFND 3G5AA 3OT1A 4L85A 3TN7A 4ECXA 3NPAA 4NG4A 4AS1A 1ZMBA 3CF2A 4AG3A 4OL0A 1L4MA 3VCBA 2OC4A 1IXSB 1ZRMA 1WDWB 2H8KA 3FLEA 4MVWA 4Q3LA 3KZOA 1RWVA 1SBHA 3TVDA 2XRZA 3LHDA 5DW3A 5JUMA 1FNDA 3SAFA 3ROQA 3Q0IA 1UP7A 4LRYA 4HNRA 4AG5A 1IHXA 1YQUA 3C16C 5AKGA 3MGHA 3EBOA 2WLTA 2G9RA 1W5EA 2CE2X 3D7RA 4K9PA 3T1OA 5JRDS 2VJMB 5FBZA 2GLTA 5H82A 2C4VA 1QF9A 2GT1A 3VU8A 2APJA 2G77B 4XX0B 4N76A 1LDNA 3E9NA 3SZ2A 3HFGA 4YRRA 1MX1A 4U7TB 5DM0A 1M6YA 2A5YB 1ESMA 2JJQA 2QYOA 2KV2A 3EMDA 3KKOA 2Q7OE 4BZPA 3AETA 2C77A 1SXDA 1U0LA 3H1TA 4YPFA 2WYVA 3V7NA 1HRDA 3EUEA 3FOBA 4F8EA 1DPGA 1RAIA 1HO3A 1DTEA 1MABB 2XOKA 3R44A 3C5GA 1JU3A 1AQLA 2AEEA 1QX3A 1TKBA 3OBBA 3L4JA 3HX0A 2FSHA 1T5TA 4FE7A 4EYHB 3EASA 4OQPA 2A7QA 2GNAA 4Q19A 5E1DA 3VKUA 4DPLA 1F9EA 1MN6A 2WICA 3UAGA 3HI6A 5AVYA 1HR0B 1E58A 4ALNA 3MOSA 2Q1XA 3FN4A 4Y98A 5EC8A 1EA5A 4FZ3A 5DULA 5H70A 1S5PA 4DOMA 1I7NA 1WX1A 2PX4A 5CBKA 5DCYA 3ZZNA 1E5QA 2A58A 5DISB 4HEA1 1F5SA 2Z7JA 1Y8RA 1KETA 1QIFA 1YCFA 4NL9A 4B35A 2H51A 4DDTA 3O8RA 5HE9A 4A36A 3TPZA 4C2BA 4MS3B 1YT5A 3ZPXA 2EZ9A 3PQ4A 2BTEA 2DKXA 5KT5A 5KNCD 2HXGA 2C2ZA 4F2PA 3K0AB 5KSZA 1RPTA 2BHRA 1L7QA 2JGLA 4RELA 3VR5H 4NYMR 4FJ0A 2EFHB 2NT4A 1IATA 3ZG6A 4YLYA 5BR8B 3F4BA 2CLLB 1SVUA 3E7WA 3CZ9A 2GXAA 1KMIY 3B1FA 3NWOA 5CB1A 3QA3E 4P35A 3O91A 3WLMA 2B21A 2QGZA 3T52A 4EZIA 4GDFA 3AXSA 3P96A 3SNHA 4QPNA 3WICA 1BSVA 4XPIB 2B4AA 2FNAA