3QU5A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp11asn mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
221
structure length
221
Chain Sequence
KLKAVLFNMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 82
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu5A01
3R09A 1QQ6A 1RKQA 3NALA 4ZEWA 2W11A 4OHFA 3U26A 3R4CA 5IT0A 2Q4TA 5AICA 1YS9A 3QX7A 1TJ3A 1RLTA 4XOUA 2B82A 2IOFK 1YV9A 2ODAA 4BEVA 2WF8A 4OFZA 1Z4OA 1LVHA 4GXTA 5A3QA 2YMPA 3QUBA 5T41A 3U7HB 1O08A 5AW6A 4Y2VA 3N07A 4C4RA 3L8FA 4GIBA 1EK2A 2FDRA 5FP0A 3KD3A 3ZX5A 1WZCA 3ZW7A 2B1RA 3DNPA 4EZEA 4Y2RA 3QUQA 3KC2A 3L1VA 3CNHA 2YJ4A 5ALHA 2AUTA 3L8HA 4KNWA 5AK3A 3U7FB 2R8YA 4QQFA 5ALKA 3K1ZA 3WK8A 5AK4A 2YY6A 1TJ4A 4BX2A 3EPRA 1XP5A 2D2VA 3E8MA 4AS3A 5AVXA 1YJ5A 3PCTA 1TJ5A 3PGLA 5AM1A 5AKXA 3IJ5A 1Q92A 3QU9A 3NIWA 2PQ0A 3AR2A 3HYCA 4EENA 1VJRA 3MN1A 1Z4NA 1AQ6A 2WF6A 2ZBEA 1LTQA 2OA0A 3W5AA 1Z4MA 5AESA 2O2XA 3L0CA 3NAMA 3UMGA 2Q4RA 5AK6A 4NAVA 3EF1A 2GHQA 1U2TA 2YJ3A 2HDOA 1Z5UA 5AI9A 2HF7A 2G80A 1N9KA 1Z4JA 2R8XA 3SHQA 2WF9A 4OCZA 3WKCA 4EX7A 2MU1A 5ALNA 2I54A 3QU7A 3WK6A 4B6JA 3DDHA 5ALIA 5AW0A 2I7DA 4HAIA 2C9MA 3SMVA 2JAUA 1RQLA 3SD7A 4YCNA 3NANA 1VFPA 3MPOA 5AHXA 4UAVA 3ZVNA 5ALXA 5AKGA 4BNDB 5A3SA 3A1CA 1L7PA 2YMMA 1J8DA 4NV0A 2OYCA 3SF0A 3WK9A 3NRJA 4L6CA 3IRUA 1KYTA 2WF7A 5ALMA 1ZD5A 4L6AA 3U19A 2MU2A 5AVRA 5AIAA 1ZD4A 3WKDA 2I33A 3IB6A 3M1YA 1MH9A 4J2TA 4YIKA 1CQZA 3I1YA 2EARA 2HI0A 5ALYA 2DQSA 2IA5A 5AW5A 4QJBA 3L1UA 4DFDA 4E88A 4XPZA 2FUCA 4BX3A 3UMBA 3AR9A 3B9RA 1PW5A 1RMTA 1QH9A 4EELA 2QYHA 3PGVA 1J97A 3ED5A 4Y2JA 4YH1A 3L5KA 2CN1A 3L0BA 2HX1A 4FYPA 5A3RA 3N1UA 5AVTA 2B8EA 2I6XA 3AR5A 4UMFA 2HEGA 5ALUA 3WKEA 2RAVA 2B30A 2FEAA 1WVIA 3OTQA 1TE2A 2G06A 3W5DA 5AI8A 1RQNA 1Z4KA 5AVZA 1Z4QA 1S2OA 2C88A 3E81A 3ESRA 4L57A 4I9FA 1QQ5A 4MWOA 3W5BA 2CFRA 5AW9A 4UMDA 1S8OA 4BX0A 5AVQA 5AVYA 3DV9A 3M9LA 3OCWA 3BWVA 4BYGA 1XVIA 2YJ5A 4UM5A 5AKIA 2YJ6A 3FPBA 5AKJA 3AR4A 4BNDA 3CZ4A 3QXGA 4Y2XA 3UM9A 5AM3A 3SKYA 4Y2SA 5AW1A 1FEZA 3A1DA 1EK1A 4IFTA 2WHEA 2G1AA 4MUMA 4UW9A 2ZOSA 5AM5A 2WM8A 1WPGA 2MSNA 4BBJA 2NO5A 2EATA 1T5SA 4Y2PA 2EAUA 2IOFA 4KX3A 3WKBA 5ALSA 3QUCA 3S6JA 1RKVA 4YGYA 2G09A 4KNVA 4CF3A 2QLTA 4Y2UA 4UMEA 5AVWA 3BA6A 2FPXA 1YNSA 4UARA 4CE6A 4F72A 3ONNA 1JUDA 3QNMA 4CF4A 2JAOA 5AKHA 3GYGA 3QGMA 2P11A 4YCMA 1RC8A 3ZTYA 3WGUA 3SKXA 1Z4LA 3DAOA 2P69A 4G63A 4HGOA 2IYEA 1Z5GA 5AKZA 5IS2A 3ZUPA 3W5CA 4Y2TA 4DCCA 1Z4IA 3L8GA 4G9BA 1RMQA 3NASA 5AVVA 2OBBA 1RLMA 5ALWA 1L7NA 4UAUA 4HGRA 4NABA 4KYTA 4OD0A 1N8NA 3U7EB 2HOQA 5ALEA 1Q91A 3P96A 4DW8A 4Y2YA 4UU0A 3ZVMA 3F9RA 3PDWA 3ZX4A 3B8EA 5ALRA 5AKLA 3QYPA 4PNHA 3KBBA 3FPSA 5AM2A 3R9KA 2FPWA 1U2SA 3HLTA 2X4DA 1RMYA 3EWIA 2AH5A 2NYVA 4EX6A 3ZU6A 1QYIA 5ALZA 2B8JA 3MMZA 4C4TA 4Y2QA 1ZD2P 2I34A 3OCXA 4C4SA 2AMYA 3EF0A 5ALPA 2W4MA 2W43A 1T9ZA 3ET4A 3WKAA 1ZOLA 4RETA 2G0AA 5AW2A 2RB5A 2ZBFA 3OCVA 1F5SA 3FM9A 5AI5A 5ALTA 5AVSA 2JGAA 1SU4A 3ESQA 2ZXEA 2G08A 3ZWDA 2YN4A 2HO4A 1Z4PX 3A3YA 5ALLA 2FI1A 3I76A 3QU2A 2NO4A 1L8LA 5AK5A 2YBDA 4UASA 2HHLA 2PR7A 3VAYA 5AW7A 2IOHA 4F71A 1QQ7A 2R8EA 1NF2A 4Y3UA 1ZS9A 3RF6A 2P27A 1Z88A 2GHTA 3TLMA 1TA0A 5AVUA 4ZEVA 3KDPA 4KN8A 5JJBA 4J03A 5AIBA 1NNLA 5AI0A 2FPRA 2BY4A 2HCFA 3N28A 5ALJA 3B9BA 4NWIA 2GO7A 3OCYA 3KOOA 1O03A 3AR7A 2OM6A 4XQ0A 1K1EA 3I6BA 4AS2A 1IWOA 2HF2A 1YMQA 3N8GA 1WR8A 1L8OA 4BKMA 3J7TA 1U7PA 3SLRA 4HGPA 1L7MA 1U7OA 5AKYA 3ET5A 4JB3A 5ALOA 3WGVA 4AP9A 5AI6A 4NFLA 2B1QA 2ZG6A 1X42A 4JDPA 4O8CA 5ALVA 3FZQA 3QU5A 4UU1A 4UMVA 2C4NA 5AW4A 1VJ5A 3E58A 4ZEXA 1L6RA 2FUEA 2C8LA 3U13A 5IT4A 1SWWA 4UM7A 3N5KA 3RFUA 1RDFA 4BEWA 3ZWKA 2YMQA 3MC1A 1RLOA 2RARA 3KZXA 3A1EA 2PKEA 4HGNA 4HYTA 5ALQA 4CNQA 1RRCA 2BDEA 1Y8AA 2I55A 2JAWA 2JARA 2Q5EA 4XE5A 2VKQA 2HSZA 4HGQA 4FE3A 1ZRNA 3UMCA 3D6JA 4YCLA 2G07A 5AI4A 3ZVLA 3AR3A 4IG4A 2C8KA 5ALFA 3WK5A 3I28A 4FFDA 3U7GA 4KX5A 2R8ZA 2FPUA 2GMWA 3FVVA 1RKUA 3AR8A 1RPZA 3L0YA 2BDUA 3WK4A 5AW8A 5AM4A 5AKKA 1YDFA 3QUTA 1ZD3A 1ZRMA 1L7OA 3E84A 4I9GA 2ZBGA 3NUQA 5AW3A 3L8EA 1T5TA 1XPJA 2FPSA 5ALGA 4UATA 4CF5A 1NRWA 2CFTA 2ZBDA 4DWOA 1ZJJA 2CFSA 3WK7A 3OCZA 2AGVA 4H1WA 3OCUA 2GFHA 1U02A 3QLEA 5AKEA 4YIHA 1SWVA 2YMLA 1CR6A 2YFYA 3ZI4A 4EEKA 2B0CA 3FGOA 2O9JA 4RESA 3ZTWA 2WFAA 5ALDA 5AM0A 3OPXA 2WF5A 2P9JA 5E0OA 3QU4A 2RBKA 3L7YA 3AR6A
chains in the Genus database with same CATH superfamily
3CLUC 4Y6GB 2NOAA 4TV8F 4UQGA 4OQNA 3CEJA 1MQAA 1TZMA 3R20A 4ABYA 5IM4A 2EIXA 1Z5PA 2BFEB 2Q1TA 3U26A 4Y0VA 4B17A 4D41A 4E3ZA 5BQFA 5F3XB 3TDKA 4XI9A 2XGMA 1L4GA 3FOWA 5JY6A 5F4BA 2IW3A 3E2MA 4RHEA 4MDFA 4C0AC 3B1ZA 3Q3IA 4OHVA 5CRIA 1GLNA 5T4HA 4EB6A 3EC2A 1RLTA 3O93A 4G5XA 3KSDO 2PANA 2Z1MA 1V43A 3UPDA 1ZUIA 1D9XA 3RCBA 4HBZA 1OJLA 1ZRHA 3DF9A 3VRHA 4JC4A 3CCBA 3VYVA 3WISA 2Q6OA 4EBBA 5A3QA 4HZUA 3H65A 1SU8A 3SFTA 1KQOA 1SUSA 2M1ZA 3AF5A 3E5RA 3RR8A 3MCTA 2NO9A 1ZL2A 4US9A 4C4RA 5DYNA 3U2QA 3QX9A 4MYRA 1USWA 3QF4A 1E3EA 4XQEA 1SEVA 4EG6A 3IDAA 5KAPA 1DGQA 2YWRA 1QCZA 2X5OA 3KQOA 3X1WA 2PD4A 2VC2B 1OXUA 4TRRA 3T95A 3TJMA 4RCVA 3K0CA 4ER0A 4Q7KA 1Q0ZA 3TW8A 1RHKA 1RHUA 3UTDA 2IGBA 3QXHA 2FNAA 5KUTA 4A3SA 5JYCA 1TIBA 4EECA 3JQ6A 1I0LA 3ELDA 4S0XA 4AXXA 5ECDA 3MJEA 1EJBA 2ZRHA 3TEMA 1QX3A 5KWEA 3ZVKA 3ZQ6A 1DIOB 3TIVA 4HZIA 5HPYB 4AY6A 2ORIA 4J9RA 5BW6B 2VPXA 4LZGA 1JLHA 1NJFA 2E5SA 1JFSA 1QVVA 1ZGBA 3CPEA 3B7GA 2A7XA 1XDZA 5CFOA 5D46A 3EUAA 2O57A 3GDFA 1G21B 4MLCA 3KL2A 3QLTA 3W7BA 4S1TA 4BFWA 1B6SA 4KQ9A 4G0NA 1GN8A 2Q0ZX 4WXRA 3AW8A 1QFJA 1AX9A 1GNQA 1VHTA 1XVLA 3CURA 1LA2A 7ICUA 2NTVA 3AL2A 3C6QA 4OGKA 4M0MA 4PC2A 4PRKA 1OLSB 4UXJA 4Q66C 1QM5A 2A0UA 5EJ8A 3F6RA 3H2BA 3I2JA 5LWQA 4MMYB 4TX1A 3RS9A 2I3ZA 1VXOA 3K6JA 4JWTA 3V42A 1Z4NA 1FYDA 1AQ6A 1OYVA 1WRBA 2ADMA 2OA0A 5IBRA 1L1FA 4GWGA 2C3MA 2KLBA 4PU0A 2ZIXB 3KUCA 3LHFA 2ZJFA 3UW1A 1V48A 2QMQA 4IWYA 5AK6A 3CF6R 8OHMA 3B2EA 4RU9A 1A71A 4C7KA 3ZQUA 1FFDA 1DC4A 2QAGB 2K5UA 4CLOB 1L1EA 2IPMA 1QMPA 3JD3A 2B25A 2G80A 5IXYA 3Q7SA 2OZEA 2ZRPA 3NC1C 4HWSA 5AOAA 2QS9A 4LY3A 5DG9A 4KOEC 3TI7A 3L4JA 3WKCA 4FYMA 2R7NA 5LKRA 1R3UA 5ALNA 1R0CA 2M1XA 1K06A 3IGFA 2QL6A 4NECA 3MWFA 1PKEA 4B80A 1ORVA 2WSSA 3WK6A 3P0IA 3QXSA 3RTDA 4AUNA 4DSZA 3TUZC 1RM6C 2AOVA 3C8MA 3LF2A 4KE8A 4O4LA 4AJLA 2IU6A 4ED3A 2H5JA 2R00C 1RQLA 3NHLA 4YCNA 1T3ZA 1Z3IX 1SCNE 4D0RA 1CQJA 1L5VA 1O97D 2CXTA 5KCZA 1G17A 2IDZA 4M9HA 3H6GA 5AHXA 3QVSA 3HDVA 3UK6A 4AKEA 3TARA 2H7YA 5IN4A 3ZVNA 1WCNA 4AJ1A 1ZY2A 3I34X 1T29A 2QT0A 1ZN2A 5CNIA 2WB2A 3R24A 3A1CA 3IOMA 1EBUA 1L7PA 1OGIA 2CFIA 1M34B 4TYNA 2DUNA 4F9TA 3DGEC 3N2IA 1BAPA 1IBKB 3T5JA 2VDWA 2KVCA 3IOYA 3QG5A 1DNPA 1HDIA 4FDUA 5IN5A 1ZQQA 1AQLA 4RNNA 2AU0A 5I7EA 3MR3A 3FFBA 4FFBB 3RBAA 2IU0A 4YCSA 4BO0A 2W2OA 3HP7A 3VSBA 3CSSA 5CD1A 4H16A 4DT1A 1XMJA 2XUGA 3N0WA 4A2CA 1RJEA 3A05A 5ALYA 3DZJA 4K3UA 1EFPA 4DM3A 3G7UA 4EK9A 3FWYA 3ZGXA 4ATNA 4NL9C 3OTIA 2WB1C 1JHPA 2TMDA 3TLJA 3S4YA 5KJFA 4KPEC 3WDSA 2QN9A 4O4HF 1N5IA 1NJ6A 3D8BA 4AJ2A 1TAUA 2QG4A 1MB0A 1VHLA 1Q11A 3TW6A 1RPLA 4BL5A 4E1AA 4MV5A 3MGCA 2ZWMA 4GUDA 5D3MB 1EA7A 3PGVA 4TOIA 3R7BA 3P8ZA 5TGTA 1CJUC 3EJWA 3PQ5A 1B26A 2GYUA 4FFBA 2KK0A 4NK4A 2WW8A 2FMKA 3LQFA 4G2TA 4PX9A 5EA2A 3A9CA 3TSYA 2FZGA 3U4MA 5C1PA 2JI9A 1V16A 2P5YA 2FSGA 3L9WA 3LF1A 2CNKA 3L02A 2YW9A 4H35A 4V0ME 5DBGA 4YROA 2CHEA 2VBIA 2WUVA 4I9NA 2FUG1 4Z54A 1M6NA 4ICIA 2XTJA 1H6CA 1RCTE 3ITNA 3UENA 1Z6XA 4K4IA 3CIFA 2AFIE 1AS0A 1RYZA 1KNXA 4KAXA 3RFFA 1ORDA 1J1ZA 4RX1A 3HX0A 3EMBA 3ACCA 2RSLA 1UWLA 2X8AA 5EYPB 5KMGB 4FBGA 1YFLA 3H8MA 2FSVA 3I37X 2WT8A 1UBCA 4CV2A 2RBEA 2CHQA 4OL0A 2GH1A 3W5BA 3OZCA 1U9JA 2RIPA 4BMYA 1PTJA 3H5IA 3TZQA 3RWMB 1IN4A 3FMGA 4GXNA 1C4OA 4YVFA 1GUYA 3OLZA 3RUPA 3U1TA 4BEJA 2BSQA 1RNLA 3ICQB 1L6IA 1DUIA 1FNNA 2Y68A 4HUQA 4RPIA 4BYGA 4CUKA 3R3XA 2BEKA 1OWMA 3BXXA 3K0CC 4KQFA 3RUEA 1COZA 5DN9A 4KLQA 4NFSA 3JPRA 1DAMA 3GFPA 3E0XA 4HL6A 1PW7A 7ICTA 4WDRA 1J2JA 1LJLA 5G0SA 3RR2A 1S2DA 5IK2D 4DQSA 5J2GA 4OMCA 5K2OA 1XZAA 1GQ2A 5KFHA 4P7FA 1X7XA 3EPPA 3SNHA 4G26A 2X1LA 1YT5A 1OH8A 1JFVA 1QMGA 1YVRA 3C70A 3H99A 3UM9A 3LHIA 3NAGA 4I14A 4DLYA 2RGWA 1E3DA 4ZYVA 4XUEA 4XYEA 2CMFA 3TIGA 4FE4A 1C0EA 1EXDA 4C78A 5KSOA 2JZBB 4N0QA 2Q5LA 3LBNA 2VYNA 4MYUA 5CVVA 3C3AA 2CJWA 1U2PA 3LXXA 3NFYA 4QW9A 5KOHA 4M36A 5ICEA 2PFOA 1HFWA 1VBMA 1B73A 1RAFA 1FL9A 2PK3A 3I0MA 1N5MA 1M34E 3G0CA 1IBMB 1P4GA 2J7PD 3FF1A 3ROTA 4LZNA 3WB0A 5I7FA 5K6TA 1KA9H 1KPHA 4TTJA 3M5DA 5DW3A 4QPJC 4KX3A 4LN1A 4WK2B 1IIPA 1F2VA 1RACA 4CL2A 2D1TA 3SXPA 2C92A 2P2CA 3IJEB 4UEKA 5THQA 4LNHA 1TUBA 3T0IA 5CLJA 4EKGA 1G9SA 2XDWA 3I9V6 1JDVA 8ICCA 1QV7A 2E6KA 4JROA 3SC3A 2YWGA 3T7IA 1H93A 3B9QA 4M99A 3UCXA 1NXPA 3KKOA 1BX3A 2WSLA 2AN5A 4IWNA 5ARDA 3ZI0A 4ZI7F 5LIRA 1YNSA 2DKXA 1ZW6A 2LP4Y 3C29A 2WFZA 4R41A 4DREA 4TUYF 4DSNA 4JB2A 5EXPA 4NCBA 1X87A 3QNMA 2GPNA 3OE1A 1Z83A 4YCMA 4ZKDA 4C0XA 5BN3B 1RC8A 1MJ5A 4DAEA 2YJZA 4BOYA 4O2BF 5LPNA 3H05A 3O74A 3NJRA 1XZEA 2AFHE 2C2BA 2QU8A 5IC5A 5ENDA 5A4AA 1P7PA 3F2DA 3LDHA 5C9ZA 3OEYA 4BE9A 1VLHA 3EW7A 2EP7A 4BV3A 1WY5A 2MSKA 3TM5A 3PFCA 3EIEA 1M1YB 1RCUA 1Z4IA 4MJLA 3B5JA 1GG2A 5CNJA 3IRVA 1XSNA 1E1KA 1V8FA 4LCBA 2JL1A 2QSJA 4J0FA 5J5VA 5IKPA 5JSQA 2JAQA 3VH1A 4OD0A 3MWDA 4ECEA 1FDIA 2XNDA 1UBSB 4OF4A 2FMFA 2EDAA 4DW8A 3ZWQA 5JSUA 3V55A 4B3BA 2AGOA 2H2FA 1PJSA 1SUPA 1U0NA 1KEUA 3ZX4A 5A5DA 2AYYA 3SZUA 5AFSA 3UBTA 1N57A 4LXGA 5FPTA 1L5OA 3P4XA 2JFUA 3A3NA 3NDRA 3OOEA 1R66A 1PFKA 2K4IA 4I2GA 3WIOA 1DX6A 1PS9A 4YUZA 2JCXA 4MZDA 4WNYA 2G72A 2B92A 4WJZA 2QUBA 4HAOA 3THSA 1COOA 3ZXXA 4LS3A 2CWWA 3OLXA 5H70A 1TO1E 4H7JA 1GZ5A 3HP4A 1ZNQO 1HQCA 4JBNA 1NAIA 2R6DA 3DNMA 4TWRA 5FWDA 4H27A 1F0MA 3F7TA 2AH5A 3O92A 4JCOA 2PGOA 1LDYA 1RYEA 3V00A 2D2EA 3OIYA 4WZBB 2GRUA 3ZDXB 4D79A 3RIHA 4WOJA 3OQ1A 1CNMA 3AT1A 3BMCB 3R41A 9ICKA 2BMAA 5E3IA 4C4TA 2IZZA 5K3FA 3QFFA 2I34A 3SX4A 1KF0A 1OI3A 2I6FA 2VJPA 3HMKA 4GF5A 4J4BA 4NJOA 4NNPA 3FG9A 3NIDB 4P36A 2IL1A 2PSHA 1OXXK 4IV5A 1VJ1A 3ET4A 5EOVA 2O20A 3JYLA 2DQNB 2M0NA 3BGVA 1TEZA 4GC6A 3CLKA 4ERXA 4IHQA 3AYXB 3OZUA 1J1IA 4DCMA 2UU9B 1SZJG 4AG6A 2RB5A 3QX3A 3D3QA 3T1HB 1FYVA 2GESA 2G28A 4AZ0A 4UFPA 1UEJA 1W5BA 5AI5A 2Z7JA 4DS5A 1JKXA 3OPVA 4N03A 1E5XA 5CB1A 1FA9A 3EC1A 4JBIA 3JARA 2GWSA 3LWDA 2BPCA 1M2VB 4C0BA 4MVJM 1YS2X 2ZIZA 1EI9A 5KC8A 1NNI1 2ZTHA 2FF7A 3JPYA 4MR8A 3BDPA 1K89A 4I3GA 3ZHQA 5C5EA 4IOKA 3BULA 4LE0A 5DSTA 1S2IA 3SVTA 2H31A 5IVHA 4IRCA 1SXJB 3Q8SB 1W85A 2VFAA 1L8LA 2ZZNA 3WRWA 3QJ5A 1BN6A 1VCMA 2J85A 3HEAA 3QPCA 4LY0A 2CHVA 2HHLA 5BRNA 4MK4A 3IA7A 4I4IA 4HGZA 4PAOA 1YJQA 5IIJA 2D5CA 4PLYA 5EEGA 1WQ3A 3IIIA 1SZPA 3CINA 3FFXA 4LG1A 5EKTA 3TW4A 4D1YA 1YONA 5B36A 1QQ7A 1SB3C 1G6Q1 2NXJA 3D6AA 3CLTD 3IV7A 4PZ9A 3T52A 1SC4A 1ZS9A 4U0JA 1T8EA 1N8TA 3G0GA 5EKSA 5IKOA 2XX3A 1BFKA 1R0SA 4NCHA 1TA0A 3HDJA 2W2KB 3CXUA 5CW1A 2OGWA 3EG9B 4BUZA 2ZRMA 4R8SA 1L7BA 4P32A 4MS3B 4OI2A 4ZDWA 5HX7A 1H22A 2KBFA 1CR1A 5GJVC 1BMFA 3MGKA 1DV1A 1GZ4A 3GHYA 3P9IA 4D81A 3DEEA 1N7HA 2WJZB 3H0RB 3HRDD 3ANSA 1Y8ZA 2K4HA 6LDHA 1I1QB 2P75A 2Q3BA 3AR7A 1NPYA 1PX0A 4LSMA 4R0VA 1IWOA 4FYHA 4RPGA 2O8DB 2IQIA 1WDTA 2XRFA 1SZCA 4GP7A 2MDTA 4B3GA 4JYMA 3V7KA 1B1CA 1AHHA 3JQGB 4KYUA 3U4AA 1V45E 4OLJA 4LOLA 1PX2A 1R15A 3H1BA 5AJXA 3HW8A 4UUQA 3LPDA 4AP9A 1QONA 2Y1IA 1U3VA 4YAWA 5IP5A 1BHQ1 1U49A 2QUZA 1T8PA 1YA4A 1X42A 3GGCA 1G2QA 3PHBE 4R83A 1QFZA 3QU5A 4H1UA 1HE2A 1F1JA 1KI4A 1AD2A 1VGVA 3C1UA 3Q7EA 1X39A 2JGJA 2JLVA 3WYCA 2Q7XA 3E8XA 3DBLB 3QQ5A 1FS4A 5KWVA 2FEPA 1NONA 2JCGA 2WJAA 3QIAA 1F2TA 2JIPA 1HNNA 1SCUB 3A8TA 7ICHA 2FZWA 3DMFA 1W35A 3DKRA 3IVCA 1C7QA 5EXTA 2G5TA 2H00A 3P27A 3UUFA 2CVOA 5J2TA 3KV1A 4R1PA 4N41A 3EOAI 2KSQA 5KG5A 4WZBE 4B3HA 3MVEA 1QIGA 3RTVA 3HH8A 4RAQA 4CUZA 1UT8A 4I8IA 3RRXA 3EZLA 5TJHA 2HJ9A 4GKVA 1F0YA 4IXNA 4J4TA 5FBHA 3CIOA 2AOTA 5L3QA 1JKJB 2XH8A 1ND5A 4KGXA 4WIAA 3Q2OA 4YP9A 1HFKA 4PIVA 2EKBA 2R11A 3VR1A 4ZJZA 5DHUA 3EC7A 9ICAA 3KQWA 1VYTA 3H3XA 4YMSA 1PLKA 1NJ1A 3RVMA 3EPHA 2WJYA 5HBGA 3ZXUB 3MINA 4DV3B 5IM4F 2ZVPX 3T12A 3WA7A 4JNCA 3K6SB 3E22B 3CG4A 4O4LB 3W2FA 4A0QA 4YCLA 1OZHA 3H1TA 4L4UA 1EUQA 2XCLA 3UKJA 1ZVJA 1OPRA 2EWVA 2A9VA 1SL0A 1A3CA 3HWTA 1GTZA 2C8KA 3S55A 1XQYA 5BORA 4MW1A 3I0ZA 1TIKA 5A04A 3CWQA 3BQTA 1GGHA 1FXWA 1NZFA 2D0PB 3FWKA 2FQXA 1OAOA 1XZJA 3DOOA 3L4EA 3NRBA 3PRHA 4HR7A 4RF4A 3BTVA 4YA6A 5LZ7A 2ZITA 2BDUA 1PJRA 3PR4A 1WDWB 1G7SA 2Z2XA 3GUCA 2GT1A 3HXPA 4LRSB 1GNSA 2RB4A 4LXIA 1YJAA 4UEOA 3TBKA 3IUBA 4JVOA 5CGZA 4MIYA 2X42A 4JR2A 3BH7A 3ZWVA 1Z2PX 5CB0A 2NP6A 3P45A 4TRNA 5DP2A 1XCPA 1I7DA 5DDMA 1XO1A 2ZJ3A 4JYPA 2BISA 3MWGA 2FWAA 1YS6A 2PN1A 1HSOA 2CXQA 3U3OA 3D64A 4U7JA 1AZTA 3DBHA 3UB4A 3KKAC 4BV2A 1HG1A 4R6WA 4YNBA 3ZZMA 1RZRD 3V2IA 3W9SA 4QXMA 1UPBA 3HBFA 3PX4A 5CT6A 4B1FA 2AJ8A 2PR2A 2ZYTX 1PGNA 1O7JA 4BDPA 1JPNA 3IBYA 5FXMA 5K4AA 4CMEA 2QK4A 4HDNA 1XZNA 2QVYX 2KVSA 3AESB 4K6MA 5FOVA 4DUGD 1OGJA 2VAWA 5A4MS 3N7PD 2C7GA 2QP9X 2I4MA 4OEHA 5I7RA 4JVNA 3WICA 4CMBA 4AY4A 2C97A 3G8CA 4S1PA 3M5PA 2V4UA 1C30A 2CNOA 4H7EA 2VJ4A 4A16A 5L45A 4G0XA 2OGZA 4PNEA 1FQKA 1EMDA 3BSWA 5CRXA 3QU4A 1W2WB 4P6VF 2ZYUX 3G79A 2BELA 1XRJA 1WHSA 1IHXA 1KZ6A 3ODPA 1K5HA 3ZE1B 4CNBA 5IT0A 2Q4TA 1Y48E 5AICA 1JZSA 2PG3A 4AY2A 4ZI5A 2EGGA 1XVAA 1I30A 1W1UA 4RL6A 4J2OA 1HTTA 5L4LA 3OUUA 1XEFA 1VBFA 4H3HB 4RHUA 5C8YB 1E79A 3F1KA 5KFJA 1UFQA 4UPDA 1KDYA 4BCBA 3WNBA 1TJPB 4OFZA 3F5AA 2W9BB 4GXTA 2VPYA 5KVAA 3QUBA 1BQ4A 2XYRA 3AZQA 3WL5A 3J81k 3NV9A 4EBDA 3K53A 3UWSA 1MKYA 2AOUA 3WA6A 3L8FA 4B2IA 4DQRA 4ZOEA 4Y1FA 4GIBA 1ICEA 2ZJBA 1FFUA 1E7MA 1EK2A 2QLJA 2RK4A 4DY4A 3N0TA 4MVJH 1Z9BA 2JJ1D 4MWBA 1CWUA 1A8QA 5JO9A 4R98A 1JLLB 1G0NA 4JFAA 3UWOA 4Z4IA 3S8EA 2J9RA 4IKOA 1SV4A 4QOEA 2M6RA 4EHLA 4ZVUA 2RHGB 5DX1A 4YYEA 1ADJA 1KVTA 1QHHA 4XRGA 2ATXA 3R3JA 4W5TA 3FCCA 3JWGA 2VQDA 1OFIA 4JLSA 4G5HA 1KFJB 5AK3A 1N6HA 2ZRIA 2PRIA 2HFKA 2O1XA 2HIMA 4XVUA 2J8ZA 3H86A 1X2IA 1ZINA 5AK4A 2JD0A 2VXCA 1PBTA 4BC1A 1XO0A 1WEKA 2YHUA 4KIUA 4PGGA 4J9KA 4WOCA 4EDHA 4YV7A 1ECBA 1ENPA 1NPDA 3ORQA 2ZBQA 4DABA 2NUAA 1JROA 4DQLA 1LRJA 4H7IA 3GX1A 4DJJA 1VOTA 1U3GA 1IFXA 1NUSA 2B5WA 2EHJA 1LS6A 2ORED 3BXFA 3M1AA 4G86A 4HLQB 4PG6A 1SU6A 2E4YA 1SXJD 3CUTA 1V3VA 1QORA 3QU9A 1U9YA 5F7XA 5I47A 5JC8A 4GMXA 1MOQA 2PQ2A 4MRPA 1XTIA 2O8NA 3HYCA 4LDRA 3WRXC 1E2QA 3S1AA 3U7JA 2QLBA 3DVLA 5M34A 4UDNA 4QOHA 1H05A 4XUGB 4Y67A 1TU0A 4R65A 1FTQA 2QXTA 2YHAA 4NX2A 1VXRA 5DM1A 3I2FA 4PCVA 1CYEA 2X15A 3OEWA 1NJ2A 1SBIA 4RLSA 4QBHA 3T1YB 3T5DA 1IZYA 2BCJQ 1ULSA 2QTCA 1LSJA 3HCOA 3KSZO 3HI4A 4JGGA 2DOKA 2PMCA 3RIYA 4DV6B 1N2OA 1XD2B 5HQJA 5KAMA 2HBLA 1VRCA 3L0OA 3R0JA 1ULTA 2FEKA 4JT8A 4CM4B 4CEHB 1LPSA 3MELA 1W0KD 1G5QA 1N6LA 3UGTA 3FPEA 5HKAA 2CJFA 3MRTA 3WRYC 4D9IA 4AKHA 5DBBA 4YRQA 4E70A 3FLBA 1XXLA 1Y3DE 1FFYA 2QPLA 2VR1A 3BM5A 4EPWA 3VZQA 2REBA 1IG3A 2Y2VA 1WKCA 2PBLA 4KVAA 4EF6A 1ZW1A 3QP9A 5DLPA 3T3DA 5AW0A 4ED0A 1HKHA 2YV4A 1N77A 2XAUA 5EAIA 4DQQA 2RHBA 4M86A 1IHOA 2IELA 1ECFA 3HUEA 3MWDB 3G5UA 2EFYA 4RACA 2XJ9A 2P9GA 4KK4A 4O4IF 4Q7EA 1MOPA 4H3SA 2FXIA 2GD6A 2GS9A 4OOEA 4IR7A 1RYDA 3CH4B 3C1AA 4BY9E 2QMHA 3JQ9C 2WK1A 3A1FA 2YMMA 1HDOA 3K0HA 2NZYA 1WNTA 2ATCA 5B4VA 2AQKA 8MHTA 2DUMA 2RJNA 1QUEA 2PQMA 3LNCA 3OJLA 4NEHB 3ZDRA 4R1NA 4I50B 4EI7A 2GDZA 3CUYA 2PMKA 2YY5A 4ZXPA 1QIIA 3IOCA 4X64B 2BCUA 1J8QA 3EVBA 4HCJA 4Q15A 4XX0A 3M1YA 1CF2O 2HXGA 3OPYI 4Q4HA 4KXQA 3JYNA 3PNLA 4TMYA 3AILA 3BIXA 1H4SA 4FXPA 1UMCA 1IH8A 2EFGA 1LU9A 2H5LA 2CW5A 4GBED 2PTGA 3HVKA 3UMVA 2NSHA 1MXHA 4BX3A 3KSAC 1E2PA 1PGPA 1UQRA 4V2UA 3RE1A 4KACA 4A8JC 3G13A 1CW2B 3MM4A 3UJDA 4EPTA 1MFZA 4J6FA 3A1SA 2OH2A 2OP0A 1O0BA 4IMJB 3P9QA 4W1QA 4Q21A 1G8YA 1RWNA 1YR3A 5JAUA 4ELVA 2JLUA 4HEQA 1C8LA 3H5LA 4UDXX 4AJHA 4YRPA 2O2IA 5MHTA 1KIFA 1JQBA 4QVKA 1G9XA 1M2EA 4KN6A 3LX4A 1K75A 2XZLA 3LK9A 3GDHA 5ECWA 4Z4GA 2W8BB 2B30A 2BMJA 1NOKA 5D1HA 3LRXA 2G06A 3BCRA 3K1TA 4FGJA 4FM9A 4UC0A 1Y5MA 1TNDA 1XAJA 5AVZA 1JBQA 1TFUA 1JTFA 1TQHA 1KOGA 1S9FA 1QZZA 2ZIVA 2IHMA 4MWOA 3Q8LA 1RVDA 2A4MA 4GLXA 2J7PA 4BLRA 4CTMA 2CLIB 1LBQA 4PRLA 3MFIA 1C0PA 2PO5A 2WG1A 2ZT5A 3INRA 2JVKA 4J94A 2OD2A 4K6FA 2Q50A 2ZS9A 2ANBA 2B98A 3KZCA 4V0NA 4AG3A 2BFPA 2C8VA 3K9CA 4HQKA 1HLPA 4QL3A 4G89A 4UM5A 5EHQA 5TMEA 1HQKA 3GAFA 3T5BA 5B7GA 2UVPA 1H2WA 3TAHA 5LP6F 2A57A 3NWOA 3UXMA 2RGEA 2C0PA 3PXCX 5KZMB 3EZ7A 5HBRA 1NLMA 5AKJA 1CKEA 2ZATA 4F9EA 3AR4A 2W70A 3NVVA 4L78A 2AW5A 4UPVA 1RPAA 4WK0B 1ZMTA 2CVHA 5DWQA 3PX6A 4PLCA 3B3QA 3LXMA 4G5RA 3KHKA 1ZQWA 4J90A 4MB2A 5DXJA 2JHAA 3H11A 2OCGA 1V6AA 2IA6A 3AZOA 3BWCA 2BZFA 1LBTA 2CY0A 2G1AA 2G1KA 3BIFA 1A4XA 3E23A 3LCVB 5FTMA 1YA8A 3TVDA 2IZOA 3BJMA 1JAIA 4IGAA 2M6KA 4N8DA 5EWEA 4MEBA 4D56A 7ICVA 1QO0A 1PT8A 2B34A 2WM8A 4ZT6A 5TMDA 3DBRA 4AI6A 2RKBA 2W7OA 1JBEA 1GCIA 2VIIA 3LWNA 3Q72A 3W3AH 3JRNA 2VJDA 1MN8A 4A5OA 4N3AA 1UBTS 1F0PA 3AV0B 3WKBA 5TEWA 3BD7A 5F9FA 2GYYA 5A3JA 2X13A 3HXTA 3BS5B 1L4KA 4QWDA 2ZXFA 2DKZA 5CT4A 4YGXB 5TS3A 3TFWA 4KR2A 3T5KA 3T9BA 1Z38A 3QYJA 1M34A 1X1CA 4B9SA 3CRMA 5LDGA 4G1FA 5BNFA 1SK9A 5IIMA 4WZAE 2XTNA 3ZHYA 2IYQA 5JS1A 2HOFA 3HR8A 4G5OA 2P8SA 3MWEB 4B34A 5KNIA 2P2DA 1FZTA 1JI7A 2XDAA 2OKGA 3ONNA 1DE0A 2OORC 4W8OA 3VC7A 1R2QA 2XY7A 1M74A 2IYOA 1DB3A 1KGDA 1O89A 4CQJA 4G5YA 4UE2A 4OOFA 3SKXA 3ETDA 4OYYA 2Y8EA 2VUUA 1E8DA 3DAOA 1U9LA 2H1FA 5SYAA 1JH8A 4WBNB 2FOLA 3AVPA 4H7PA 1L5MA 2P6UA 2BGWA 1CRWG 2XQFA 5AKZA 1RM4A 2ZB8A 7ICIA 1PNOA 2QA5A 4IINA 4ZK2A 4CQMB 4L8GA 2H48A 1RMQA 4F4DA 4EL0A 3WLKX 3EPLA 4QZAA 1V85A 1KORA 1Z36A 4DN6A 1J22A 5L3SA 3M1LA 1PZFA 3O4GA 1BIFA 4F12A 1F6DA 1U4OA 1QAOA 2OFWA 3PRJA 2CHUA 5F9NA 1KAMA 1U3FA 2CC2A 2DFTA 1C3OA 1P9WA 2OPBA 3H87A 1CIPA 1E5TA 2IP1A 4FEGA 1W96A 1TM5E 3JSXA 4QODA 4W5QA 1GU0A 1XTJA 2UYOA 3CLRC 1M2FA 1C30B 4NBSA 4RIFA 4I2FA 2O6HA 4HO1X 3SHOA 4BN5A 1PT6A 4FFLA 4RS4A 1UZAA 3ZIDA 3VSCA 4CBVA 1XRRA 3NBMA 4R9RA 1PUXA 5IMBA 1E7WA 3K73O 3R7WA 5EE5B 4HNQA 4JKYA 1EP1B 4TZ6A 1CQXA 4NENB 2FLNA 1XL1A 2ZU0C 3GLKA 5BXQC 2Q4EA 3WGTA 1OASA 3QVJA 4RANA 1KIAA 2CV1A 1OBCA 2R7LA 1Q19A 4JEUA 4I1YA 1GU7A 1O6FA 1JECA 2FPWA 1U1CA 4JV2A 3AQIA 4C04A 5A4JA 1N2CA 2Q41A 5HQ3B 3ZLJA 3PHLA 3LL4A 1ZSNA 1I7NA 4MUIA 1V3QE 2BQUA 4U2BA 1OZFA 4FYVA 3NOQA 2ZIXA 1LB2B 1VB5A 2EQAA 1V7CA 1PR6A 3ILSA 4LSWA 2WB4A 2BTQB 4KFRA 4OAOA 5DSZA 5ADWA 1XNSA 3B1WA 5L3VA 2IH2A 2H08A 5TPZA 4BVBA 3AU8A 3HBNA 4UM8B 4BO5A 3E82A 2R3SA 4M0KA 4TT3D 2ZYSA 4OHYA 3EGCA 1NMXA 4AROA 5KOIA 3V8PA 4U2KA 4EF4A 2Q3CA 3DKPA 1UXIA 4MLDA 1IXKA 3B89A 4MUXA 3TSWA 4X1IB 4LF6B 2D1YA 1B15A 5BN3A 2Q7DA 3JQAD 3R8XA 2EIHA 4L0DA 2W9AA 1M7BA 1XP8A 4WESA 1L3VA 4EY7A 4H59A 4DSEA 1JZQA 1RAEA 3ORSA 3OCVA 4IO1A 5HIIA 1EUCA 4AZWA 5HF9A 5DISB 3A26A 3K0EA 1Z68A 1WG8A 2EFCB 2O8VA 3CX7A 2JGAA 2MR5A 1FDRA 3AH8A 4FCTA 4HFMA 4BMPB 4E0BA 1BPBA 4UHCA 3RHZA 3HRKA 4FDVA 2IY7A 4WFIA 3IYLW 3QV1A 1P6QA 1X80A 3F46A 3ORHA 2GPWA 4ZJYA 3KEOA 1DT5A 2I2AA 1ZQXA 4I19A 5I8WA 2AXNA 4JT9A 4ZOLB 1XDBA 2XGSA 4PZAA 2BTEA 3ND5A 1KDVA 1BGVA 1CVLA 3H2IA 1KFCB 5A4IS 2VTDA 1UODA 3GILA 2E3JA 4JR1A 4PLTA 3WGNA 4F71A 3OWOA 5DYIA 4DUZB 2V7TA 2C57A 3MBIA 3PI6A 1Z6TA 1NF2A 3KXLA 2P67A 3MBKA 4X6LA 3ZZ1A 2GHTA 2QVGA 1UJ4A 3VKGA 2WDZA 3ME5A 4I1RA 4KAFA 1S2LA 2PWAA 4MQ6A 4XQGA 5AR1A 3SBOA 2E85A 2R00A 2VQ3A 4UCQA 4ZV4A 1I24A 3PSPA 1DELA 4K1LA 2FPRA 4HDRB 4KIFA 1ZA1A 1UP6A 1D0IA 2GKOA 3B9BA 4HNAA 4Q7JB 2A5DA 1KIMA 1ZI9A 3KKZA 1JIUA 1K92A 1U65A 1XL0A 4AS2A 1PJAA 4N5IX 4LZZA 1VE5A 3P9ZA 1GCAA 4GXIA 3KV3O 2OCBA 1M6WA 1YB6A 4M9QA 3LHKA 4MP8A 3DA8A 5HIMA 3A6JA 4N47A 1NYTA 3ACDA 2IXFA 3JWPA 4FP9A 2B1QA 2OESA 2F44A 2ZWIA 4AKTA 1QZXA 4QYMA 5DHPA 4A0SA 4DMUB 2F4NA 3F96A 3RVSA 1VRWA 2GXUA 3PZBA 1JTVA 3DW1X 1VSUA 5AW4A 1IUKA 4F5DA 1U28A 2VANA 3U0VA 1N5WA 4ANFA 1W94A 2XOKD 4ZOHC 2J33A 2R1VA 3QLJA 4HJXA 2G1JA 4ZVVA 3WLPA 2G9ZA 1S01A 3CNOA 1RI2A 4CF7A 1E9VA 2J9FB 2WHYA 4RT2A 2WIDA 2ONKA 1B3BA 1OAAA 2PMBA 4MPJA 3URMA 1QH8B 1SVIA 1QIMA 1HM5A 1T35A 1Z16A 2HK8A 3B6EA 4I2NA 4KDRA 3RB0A 2ON6A 5HDBB 3QBDA 3P0JA 1G291 1H1DA 1TU4A 4QJ4A 1YZNA 3QVMA 2Y9UA 3PSFA 2HK7A 1OF1A 2P2GA 4HGNA 4P4UA 4HN4B 5C4IA 5LMZA 1CPYA 2LWIA 3DHVA 1Y8AA 4CWAA 4CFYA 1RLJA 4PZZA 2OV6A 2VKQA 4N1AA 4PLHA 2L82A 3PJEA 4AJ9A 1WDLA 3HWRA 1ZXLA 3GW8A 4QDOA 2MINB 3LKBA 4P81A 1ZN7A 1FDOA 2CLFB 2AX3A 1DK3A 4K7JA 1E58A 4RVNA 5B30A 3GR6A 1Q3UA 4S05A 5ALFA 3AESA 1WUKS 3LQ1A 1IJEA 1LFAA 3DLCA 2I9PA 1QG4A 5EERA 4BQRA 1HIWA 3FNFA 5FORA 4XA8A 1ADCA 1WABA 1AE1A 2BLNA 3UF0A 5KX5B 3BQ0A 3KU4A 3LY7A 2ZE7A 3P9RA 4MCIA 2Q7OE 4RGBA 2XC9A 5I7VA 2PD3A 2AKYA 4IVRA 4JN6B 4W5WA 1I7LA 3I2KA 4CRWB 5AKKA 3BFPA 3WG9A 2JCBA 2R96A 1UMDB 1UFVA 3A3PA 3GVPA 4M4SA 4N0EA 4XPIB 1BWPA 2L17A 3SBXA 4JLBA 4YJ2A 1KZGB 1N34B 4DV0B 1IK6A 5KVVA 4DQKA 2FG6C 2KX7A 3IMGA 4ND5A 4P2HA 4BNHA 2RH9B 3FRIA 1NTRA 3ZLVA 5K8LA 1AZLA 2D4AA 3BB3A 4RPXA 1WXEA 4AJKA 1GPKA 1NXSA 1XWWA 1JQ3A 1UBKS 4Q4AB 1RRPA 4US2R 3CVXA 1U02A 1UWKA 1L5GB 2UYHA 4M1MA 2BFMA 2IIBA 4MB6A 5KTTA 1CI4A 3TZEA 1K5DA 4CQLB 3NMUF 3IALA 2O3SA 3Q9NA 4TTAA 3SF8B 3CRNA 4MW4A 3HBJA 1X13A 2NXCA 4N5HX 1BGXT 1H2ZA 1NVMB 3KNZA 1ISFA 4R2KA 1E2FA 3U40A 2KN7A 3R3WA 4G85A 1TXGA 3ZY3A 4EJ6A 3V32A 4OM7A 3N2EA 5FB3A 4RD2A 4C2UA 1RIFA 1YKSA 3TOXA 2V45A 3GEGA 1TI7A 1PSDA 1RKQA 2O1SA 4IIYA 4CKXA 1JH9A 5F3WB 3BL6A 4PX2A 2EZ9A 1TKCA 2F3SA 3PY8A 2A9OA 2XE4A 1SAYA 3I6YA 4EKNB 1DGJA 1A82A 1RSZA 1SELA 3ICCA 5CUQA 3QX7A 2DPLA 4NNOA 3VVMA 4CKBB 2FFHA 4EY3A 3HUDA 4HYQA 5T4BA 1SV0C 4N8SA 4P80A 8ICJA 3RSSA 4RD1A 621PA 4U4AA 5HFNA 4PHFA 1Z4OA 2IEAA 4W9NC 3WYBA 4AYXA 1BH6A 1EAMA 2EBUA 4UBIA 2RDIA 4QWEA 1BZYA 5TQ2A 1ECGA 4RK7A 1L1RA 1RG6A 2C2DA 3OP1A 3PVSA 2OSVA 4OJKA 3GIIA 1N7JA 1RAIA 1JNYA 1B8NA 2VNSA 4CEIA 3ZX5A 1T9DA 4MRSA 4YJFB 4W8GA 5GOTA 2FPIA 3C3BA 4OYLA 4Y1RB 4F8EA 2I6SA 2NXNA 4YMNA 3SAGA 2DFKB 2O48X 4MUFA 2JCYA 4PRZA 1EVJA 1T3TA 4WRRA 3GPLA 1NLUA 1ZRSA 3COSA 5I5EA 1W6UA 3GRAA 2CLKB 2HPHA 3K2BA 3EGIA 4WGGA 5CCDA 5J59A 4ID3A 4KNWA 2WJVA 1NN5A 3UV6A 5JO0A 1MMFB 4I8XA 3FTNA 4H4EA 4TKUB 4F4UA 1KC3A 1L3SA 1JDNA 3G9TA 3UUWA 1UXJA 3KQTA 3OTOB 2HMAA 2WKSA 3FHOA 3N2GA 3O8BA 1O3YA 3PD0A 1Y1TA 5KREA 4JP3A 2JFYA 3B1FA 1XF9A 5E6UB 1LK5A 3FTQA 4CQMA 2KLHA 2MSDB 2PY6A 3O8NA 1KXJA 1Y3FE 3DMTA 3IIMA 3Q0TA 1SZHA 1KY3A 1N92A 4ILKA 4X54A 4D9BA 4EYKA 3I5MA 1GRNA 2COEA 2I22A 1HK7A 2O0LA 4F5RA 2A1TS 3O0FA 2XO7A 3L07A 2MJLA 3RSGA 3OWXA 2ZXIA 4XGKA 3VR3D 3GROA 4I4TF 3UIEA 3VHXB 3FFWA 2Y1WA 1OXSC 2VF8A 4RT3A 4N3CA 4NLZA 1N0HA 3NIWA 2D1SA 3U9SA 1X7XB 4DQUA 2BKXA 4ZEMA 3RO7A 1YZTA 3GH3A 3GN2A 2IYYA 2WHXA 3VI3B 3R7WB 4D80A 2HHCA 3WL6A 2OBXA 2QL9A 5GPBA 5DMXA 1KERA 3NW9A 1R6VA 3T7DA 4BBPA 2FMUA 1DGSA 4JX8A 2GVNA 4OU5A 5JIBA 3UMYA 3RU3A 3EMKA 4IW3B 1UZUA 2A0FA 1FUKA 3FUVA 3QK7A 2WVGA 3PW4A 4TL6A 3RVDA 2H54A 3DHNA 5AJHA 1SQFA 4QQNA 1N0VC 2BM1A 2VDKB 3WWEA 4ZI2A 4CR6A 4F7WA 1HRKA 4ZCTA 1W87A 1Q0RA 4DF8A 3JRXA 5G1OA 1QH8A 2Y99A 1B0ZA 2AG1A 4DIKA 2LKDA 1A69A 1EEHA 1B16A 4OB8A 5EQFA 2I9KA 1NW4A 1TZJA 2QE7A 3ITEA 3LVRE 3KJHA 3UHPA 3I01M 4NZNA 1IMJA 1ZM7A 1BYUA 1A8HA 3EEIA 3U37A 2B6HA 1OC4A 4MARA 3JVDA 2C9MA 1SGWA 4H7HA 1FVOA 1THGA 1X77A 4DIEA 221PA 2RRDA 5H80A 5BMVA 3NV7A 4QXAA 1IEQA 1UQVA 2NV2B 4TN5A 2H3FA 5AYVA 2DCUA 3V97A 4CMHA 1IEWA 1LQTA 1B00A 4RQ1A 1YJ8A 5CLGA 5E7QA 3UKDA 4CL3A 5CHYA 2FJ6A 2EEPA 2YIVX 5FBRB 3D6TB 1XKLA 3IIEA 4IH1A 3TMYA 2QR2A 4M46A 1A9XA 3D6MA 4TQUS 1ILEA 2A0XA 2PO7A 2Q5QA 3HJAA 5I9BA 4V0MA 3HYLA 4Z9AA 5EJ4A 2JS7A 2SKCA 1JRLA 1Q3TA 2J3LA 3OFNA 5DBIA 4KDFA 5DOVA 1M6VB 3VNUA 1A1SA 4S0ZA 1ZICA 4UAWA 1PUJA 5HK9A 3RH4A 2HBRA 4J2TA 1GZUA 1QWSA 3QVTA 1OIWA 3BEOA 4XUDA 4F2DA 2W9CA 4ZAXA 2XEXA 1UOPA 1SC1A 3UXHA 3B3GA 3AR9A 3C2MA 2OB2A 4M9GA 1PW5A 4M1YA 1QSLA 2QYHA 4FB5A 3R3YA 3C3XA 3LL7A 3BFKA 1EBFA 2E8OA 3PKJA 2P9CA 2Y92A 4X71A 3I6IA 9ICMA 1D6JA 1C5KA 1GQFA 1GAQA 2CXNA 3LSTA 4BRWA 5BWOA 5JJLA 4PG4A 1K9SA 2ID4A 2QJRA 1FFCA 1CZHA 2VYVA 4C7BA 1F4PA 2K2QB 2YRWA 3FFTA 4NLGA 1W52X 5DKWA 4GE0A 4MGEA 4XFKA 3JAMA 4F4JA 3RIMA 2PSSA 4Z3KA 2I6XA 4H6PA 2J5KA 2QN8A 2MR6A 3RRJA 1RWMA 1ZN9A 1XEXB 1IPHA 2KSOB 2HAEA 2W2LD 2YWXA 4MTLA 1RFLA 3W4JA 2PLNA 3PFWO 2E6UX 3ZIAA 2NU8B 1RQNA 4A4DA 1SL2A 1EJ2A 1W47A 2A33A 2UUAB 1KFSA 2BH2A 1TZKA 5CFMA 4L57A 2ZBUA 1N2BA 4ND2A 4LF7B 1F51E 3AVXA 4RLFA 2Q3MA 2IUEA 1WUYA 4CHGA 8ICVA 1ZDMA 3ZHOA 4IEEA 5AMXA 3TBFA 2FRVA 4ZOQI 3KZ1E 3BWVA 1UM9A 4NQRA 1HG0A 4LWQA 4ZAGA 1PK3A 2WAQF 2CB9A 3Q15C 1L1QA 1OFUA 4FWBA 4Q9JA 3A58B 4JJ6A 5DNWA 3R7AA 3RJGA 1G19A 4ER7A 2ESEA 3NKFA 2PSFA 2Q5JA 4LC9A 2MRLA 1JKIA 1EX7A 3ICPA 4LHZA 3F0TA 2HU5A 1W1WA 3GFVA 4LVSA 4C0HA 5AK0A 1U1GA 2B6GA 1UDAA 4Q4JB 1T3QA 2DHEA 4N18A 2QY6A 2QV0A 4NDNE 1DRKA 4EJMA 1V1MA 2BN4A 3A4TA 2NRTA 1BXRA 2O2EA 1EB8A 3UJPA 3K8QA 2MSEB 4NJ8A 1CNFA 4ER6A 4D0SA 3OZDA 4N82A 5J2CA 2OV2A 1DI0A 2JKVA 4HH4A 3I58A 2V97A 4H60A 2GARA 1NUPA 1XR3A 2HLHA 3BN3A 3I64A 2JKYA 5EZQA 1GNPA 2KHZA 2PUJA 2H8KA 4TTVA 1GTVA 3KZNA 1EZ4A 1O94D 4HWKA 4GNKA 3DAFA 1HT2E 3EOZA 1XQ1A 3IHTA 1YQXA 3PPYA 3RQIA 4E1BA 2CXRA 4KVZA 3HUFA 2WWIA 3UJHA 3ZD9A 1E4EA 4IGKA 5EMLA 5KYVA 1AGXA 1OVMA 2EATA 1T5SA 3GRYA 3QEJA 4D8VA 4ZI3A 5FWNA 2O8FB 2IOFA 4KMRA 1ID8A 3ZDEA 3RRMA 3HZHA 3WSVA 1KRWA 3GQBB 1O6ZA 3O94A 1IEXA 4QDKA 1UAAA 5EE1A 2EV9A 3RR7A 2N42A 2O23A 3K0BA 4RJ2A 2VT6A 1K88A 3IT0A 4CKZA 5JECA 1IUPA 2YVAA 2PMWB 4O3OA 2V0NA 3C48A 1AROP 1PJ2A 4RVHA 5JVDB 2HQBA 2QHXA 2E7ZA 1Y9DA 4CIYA 1U4BA 1TM4E 3D7NA 3Q5EA 2QF7A 5IAKA 1AG9A 3KSRA 1XRSB 2DSNA 2VF5X 4GGPA 4H0NA 5IANA 4IOJA 2NM0A 3PPWA 1QH1B 4DADA 1SXPA 5CM2Z 1UBHS 4M0DA 8ICIA 2IVZA 4H2DA 4K28A 2QX8A 4RMJA 2FRXA 4MQEA 3UJ7A 4URHA 1A9PA 1FP2A 1WX1A 3R5SA 3QH4A 4DE5A 4F21A 4CFZA 3DOUA 3KQLA 2HY7A 4OMFG 2FMSA 1SOVA 5H3CA 4G56A 3WGQA 3NASA 4K0RA 1LTKA 4CIDA 4DL2A 3PDUA 1L7NA 1CDOA 1SUBA 1TJNA 2W93A 2AQ0A 3MPUA 3PPVA 3DEYX 4G0MA 2X5XA 4YT8A 3N97B 1QTRA 4CLDA 1JG1A 4AL4A 3HTXA 4WKNA 5SYNA 3RFXA 2W3RA 1K86A 1WDMA 3MFHA 4REMA 3H7AA 4HF7A 5E9JA 3PDWA 2VNJA 3OE7A 3HDTA 4ASUA 4OP3A 2ERYA 2OD9A 3B8EA 4W4TA 3BGDA 4WTOA 5DASA 5HS6A 3ZY4A 1L4UA 4KGVA 4J0GA 3OECA 3ZNQA 4D5GA 1QCDA 3PJDA 3ZW9A 3LX8A 2KTQA 3FYUB 3CW2C 3LV8A 4PXSA 3FF4A 2FKNA 2GPSA 2HMXA 1Z8FA 3CKKA 2M6LA 5IXJA 1S3GA 5ADVA 2X4DA 4OBEA 4EOGA 4PZCA 2HBMA 3TKAA 3COYA 4Y9UA 5A3RA 4J1SA 4RMNA 1ZK3A 1Y5LA 5M2QA 1QV9A 1V7PC 4YMMA 5FBLB 5SYMA 4CUJA 1H2XA 4WCFC 3TD6A 5DDYA 1V5FA 4I5DA 2F3NA 3UXEA 1QYIA 4OGLA 2PL5A 3F5FA 3OBBA 1J21A 4RQ8A 2GD1O 3FWNA 3CXRA 4MV0A 3WNVA 5CFRA 1RAAA 1XQWA 1LH0A 2QI9F 3BXGA 1BJKA 1UC8A 3IQHX 5J40A 2HR1A 2CCKA 2H3IA 1Q7EA 1WZEA 2E18A 4QOIA 4R1TA 3JQBA 3ZH9B 2I4RA 1MB9A 2ONCA 4UEQA 1CQJB 5F77A 3SFVA 2FXVA 4RK1A 4X1YA 2KIWA 4JLWA 5F12A 3ONVA 2G0AA 4I46A 4QFMA 3QA9A 5I9LA 3HY4A 4O4HA 3I53A 4EUHA 1XZQA 3V9PA 4AJIA 2PZKA 4MJXA 4PONA 2ZSAA 2JGKA 1WD5A 1PGQA 2CL0X 5BSRA 5FTLA 1AXGA 1DQZA 1F12A 3IE2A 4YDQA 1J49A 4FI3F 2WD7B 3SHFA 4OKNA 1LUAA 1R4ZA 4PHEA 1T5HX 2R8IA 4P92A 4GD3Q 4BFSA 3GLGE 4QLOA 3E1SA 3KQHA 3Q1LA 1KZ9A 2V8OA 3A4IA 2FLKA 3DFKA 1Z0AA 2AOTB 1GXSB 3PSAA 5ANRB 3LBFA 1JHUA 5IILA 4EJ2A 3EY4A 5LQRA 4D57A 1HOXA 2PGIA 3F6CA 2HPVA 3MJVA 5HJ2A 2GEUA 2C5LA 2FMIA 4Z4FA 4NAUA 5DYGA 1LEHA 4F8RA 5TGDA 4D3XA 4EUNA 3BQNB 2VP0A 1KSFX 1X9SA 4NPCA 1NJZA 4BS9A 2QJTA 1Z8NA 4KOAA 5GONF 1ONSA 1J0DA 3HJFA 1UMCB 2BCQA 2C5GA 3LVVA 1BGWA 1XEWY 3T5LA 1Z0ZA 3R9XB 1RWBA 1O6BA 3LPMA 3RUIA 2PH1A 3D7RA 5LYJF 3N28A 2B61A 4E2YA 2INGX 3P0RA 3ZDQA 2WE7A 1ZNZA 1QHNA 3CZPA 5IZCA 1IXRA 2HF2A 3FCUB 4J0EA 4S1NA 1CDZA 4WKPA 1SBQA 3LYAA 4IJ6A 1DWUA 3IKLA 3PJGA 1ZQCA 1DC5A 4N3GA 4U02A 3HWX1 4KTTE 2XUJA 7ICGA 1JHAA 4QYSA 5BP7A 3KKQA 2B1IA 4REQA 4N7MA 2FZKA 1T2NA 4KRXA 5DIZA 2GJ8A 4YQZA 3IUEA 1LNQA 3V7WA 4DA4A 1SCQA 3AJ8A 5J2DA 3FZQA 4EP1A 1ZOOA 1F60A 1ZXIA 4MRMB 4BO2A 5L3QB 4KR6A 1NLZA 2IXTA 3A11A 4DUPA 3ZPXA 4DTIA 1BD3A 4ED1A 1RAHA 1ZO8A 1Q12A 4RDIA 5JS8A 1IQ0A 4RDCA 3EBOA 4IH9A 4D82A 5F2KA 3OTHA 1IY8A 2XWSA 3FTCA 5JD3A 3GEDA 2ZRGA 4I2JA 1AXRA 2DGZA 3A1WA 1DUVG 1Z13A 4GP6A 2QUJA 3TTTA 3DMHA 2VKTA 4YP5A 5IEBA 4EYSA 3LW8A 1YR9A 3A04A 4L4SA 4DNQA 3PQDA 3MD0A 2Z3VA 4CFSA 2WZDA 3CB2A 3KLOA 2P79A 1H2BA 5JSYA 3H9QA 2YMQA 3T41A 1N1DA 1TMOA 5CLHA 4LJYA 4CLRA 2SKDA 3HCNA 4ZAFA 3L84A 3GRCA 1VCOA 2QGFA 4CDGA 2C04A 2Q5CA 4PG5A 1X9HA 4DQXA 3A4VA 5K99A 3GLGB 2UZ4A 1UEIA 3ER9A 4Z4EA 1GWNA 5H59A 1TC2A 3W8FA 2D8MA 3LCRA 2A88A 3DHWC 5LBIA 3T38A 4P35A 2BDEA 1DADA 1B22A 2BHNA 1WTCA 4TSFA 5JSFA 1R0RE 1QTQA 3SYZA 3MXOA 2C3OA 3NATA 3TAUA 3ILHA 4EW2A 5BUQA 2FFQA 1UPAA 3VBCA 1KKLA 1OIVA 3RVJA 2NVOA 1SXIA 2WDPA 2AE1A 1Z45A 2ZWPA 3ISTA 4QYXA 4DLRA 2WLTA 3DXYA 3L04A 4NPAA 1OFHA 2FU5C 2GF2A 3OSZA 2UVQA 1WBBA 4QOJA 1FZQA 1XXHE 3INGA 6PFKA 3BMQB 1NBME 3T9EA 3UC5A 2KPOA 1E2IA 1H6AA 3UOGA 3ADBA 4AMGA 7AT1A 3TTYA 3PFIA 2Q4BA 1JG3A 5IKXA 1N32B 2UZ1B 1YDWA 2A19A 3K8ZA 1B6GA 4F4CA 3EMVA 2Q2NA 3K94A 3UHAA 1DRJA 1S6YA 3GNSA 2VHJA 1RXCA 2M6SA 4Q1VA 5INTA 1TADA 4NYJQ 3T35A 4A6PA 1DSSG 3HNRA 2ZIWA 4QWCA 2O05A 3GYBA 4LX0A 4E5UA 1NPTO 3MCZA 2B21A 1BE0A 3TQFA 1GVHA 2Y3IA 3DXXA 4PC3A 2OAGA 4A9AA 4JZKA 3MUFA 1X1DA 4O3RA 1WXDA 2QDKA 2JHGA 3JV7A 4IILA 4KDCA 4TTIA 5U4QA 1NRWA 4L8FA 1CP3A 8ICUA 1FYXA 3A0HU 4PS1A 3CFYA 5KKAA 2VCYA 3THRA 5J4YA 4G25A 1UQTA 1L5FA 1KAHA 3R0IA 4M9LA 1UDBA 2WJJA 4HWTA 4F6CA 4HUJA 1U0LA 2G77B 3KLMX 2B94A 3GNQA 2AEEA 1RM3A 4PGAA 5FTKA 3H4IA 1EFUA 2FPOA 2V74B 2YMLA 1KY4A 3SQOA 4IL5A 4BVAA 5LMCA 3T7SA 2XNCA 4P3PA 5GZ6A 2XVTA 4KL8S 2OL4A 2B0CA 3FGOA 4US1R 1I36A 3SJBA 1FFEA 2XCSB 4D25A 1LF0A 3E2IA 3KPUA 1YA6A 1YDEA 4EM6A 1H38A 2E48A 4PYQA 1M0SA 2QE6A 3LLVA 4WERA 4F6RB 3THWA 3IVGA 4WXPA 1KR5A 4ALKA 4CT0A 2CDBA 2QNRA 1AKQA 3EXFA 2WWTA 3OX2A 1DOAA 3N7AA 3O4FA 3IAS6 3JR3A 1RWQA 5DGTA 4HEA1 1RD4A 2HDNB 1K63A 3FTPA 3LUHA 3PR3A 4LSGA 3LWMA 1LSOA 5I01A 3P26A 4I4TB 5LQCA 3RLFA 4NCXA 1TTQB 4GMKA 4OA8A 5I3CA 1XTTA 2C22A 5ENZA 2QTVB 2VXOA 3CC8A 3UY4A 5DB8A 1L5ZA 3ZDYB 4XQ9A 2JCSA 1ENZA 1J8VA 2CE7A 2ZRLA 3HJCA 2GCOB 2G5IB 4Y2VA 1V6SA 1XDDA 3WMGA 4E07A 3BWEA 4EGFA 2OSBA 1OW3B 2XLBA 3ZGOA 2JAXA 5H4HA 2WNSA 3ZH2A 3LHDA 4LMRA 2B3DA 1YCDA 2IZ1A 2LBPA 4KDEA 3LTEA 4O3FA 1N7GA 4PHHA 2DYKA 5KU1A 1UBRS 1AQUA 4B83A 1JWAB 3WRYA 5HKBA 3D2QA 3T3MB 2W6PA 3TVYA 2D5AA 4FBTA 2FQ1A 4EW6A 2VSXA 1IUOA 1M8PA 2PH7A 3JYHA 4RKQA 1R5NA 5NULA 5KFRA 3D54D 3H5RA 4J0KA 4FJ1A 1Y6JA 1Z37A 2JBWA 4HG2A 5JQWA 3C97A 5BMVF 2EZYA 2R8YA 3E9ZA 4CODB 5BOSA 3K1ZA 3TTVA 3AUFA 3I5YA 1RS0A 2JFOA 2OBFA 3IA2A 4RIGA 4BE7B 1E8MA 1Q44A 4RHXA 3EMDA 1XZBA 3KTAA 4PZYA 1RI3A 4WNIA 4V1CI 5J1SB 1SKRA 1ACJA 1P2VA 2NMVA 4ED8A 3HCDA 3QVVA 4O8ZA 3F6PA 2G5PA 4NU0A 3IPCA 1Z0UA 1E3WA 2NGRA 1UBLS 2XB2A 4C43A 2O59A 2O50A 2WD7A 1GPMA 1TF5A 4I2IA 1CB0A 3Q8RB 4GFJA 3H17A 3LPLA 4NYMR 2HBYA 1XELA 1Z0SA 3E22A 4RKYA 1VJRA 1GYRA 1NP6A 2BFDA 5JQGB 2ALJA 4IZOA 1Y7IA 2DHDA 1HEIA 5L9AA 2PKYX 4JQZA 4BJ3A 2TECE 4E14A 2AMVA 3LT2A 4ECZA 1YZFA 2ZR9A 1SKAA 4KR0A 2CCJA 3OQJA 4PGMA 4RQBA 2ZCVA 1GSIA 2XSZD 2O1EA 1YZHA 1P1FA 1T0UA 4D4KA 1E69A 2YX1A 3MNFA 4H0CA 1N5KA 3VMMA 1E2LA 1MPXA 2YJ3A 2HDOA 4PWYA 2HA2A 3EFOA 3E03A 4O4JB 3V8VA 2B4YA 1YQQA 1ZQMA 3VPDA 3SQIA 5BSEA 3S0JA 3WMWA 3U1BA 4F2SA 1DC8A 1KHTA 3E53A 5H02A 4DILA 2L42A 4Z7NB 2UZ3A 4H17A 4BDSA 2IEDA 1BXZA 1EGVB 4UNRA 4U3JB 2FMPA 4G0UA 3BEDA 3DDHA 1HRDA 1XCGB 3IS3A 1OI7A 2D13A 3ROGA 1G8SA 1OYYA 3QEBZ 2Q8NA 3BK1A 3O90A 1NI4B 4FFMA 1VL2A 1OC2A 4IQTA 2PWPA 4ECTA 3C87A 5K3AA 1WV0A 1S8AA 2X8BA 1U1IA 2GTIA 1VIDA 2ACVA 4ILEA 5ALXA 4EW1A 2RC6A 2J3QA 5JWRA 3RODA 4RKFA 4GE3A 2A78A 5J8YC 4QTUB 3T1QA 4OJ6A 1ULHA 4KE6A 3AL0C 3R9WA 7ICEA 2QNIA 3MLEA 2NU7B 3HR7A 3PC6A 4AZ3B 4D8XA 5KTPA 2AD5A 3W79A 3NRJA 4XGRA 3REQA 1LBEA 2AUMA 8LDHA 5EJ6A 3BAFA 4IRKA 3J81j 2WR8A 5ALMA 3A6GA 1YHZA 3G9UA 1JRPA 3L0DA 3X1YA 4BZQA 2WU0A 2GERA 3ORFA 1T5BA 5KAFU 2QGZA 1GGEA 2GYVA 4C2AA 1QIDA 1VHJA 1NK4A 2B3TA 3NWPA 1OLSA 5HNKA 4P83A 1R4MB 3DOFA 2EDUA 1JHYA 4NZPA 1Q46A 2O5RA 2KFZA 3VTZA 5IJ0A 4W6ZA 2IEGA 2ZE8A 3INYA 2H52A 5LP6A 2XVZA 1QJCA 2ZSHA 5BV7A 1J2RA 4K9DA 1SXEA 1R0BA 5IFKA 1LNZA 2FZLA 3GIKA 2R2AA 3QMMA 1I6MA 1DHRA 4IDGA 4RA9A 4B44A 1HZZA 3K6SA 3NGDA 2JJYA 3PQ2A 4EGJA 3SHVA 2OQVA 5GP1A 2IKQA 1BRMA 4QUAA 3BCHA 2OG2A 4AFNA 5GTIU 1SKYE 2VJBA 5B3JC 1DQPA 4YR0A 4EBEA 3TAQA 4RHTA 3GHHA 2YB4A 4KR7A 4MV1A 1YCHA 3TMAA 4W8HA 3F90A 4KPYA 2O19A 1C14A 1BJTA 2MSCB 2HCTA 4ZCLA 3O1HB 2F8MA 3PFBA 4JT4A 5EP3A 3HU3A 4CM8B 1ZP6A 3CUUA 3FXAA 3VU0A 3ZKAA 2AD1A 3NDPA 1KJQA 4RE5A 1OYWA 1DRWA 2FE1A 3LUFA 3MTEA 1JMKC 3FPLA 3QFTA 4I9FA 2ZSDA 4X84A 4XCVA 1NW9B 2J1LA 3R3UA 3N8NA 1FU4A 1WZIA 6AT1A 5JW6A 1BMDA 2QL7A 3NEPX 2VDOB 1R5BA 4MIOA 3DV9A 1BEEA 3LP5A 5FQNA 4DLXA 2D0DA 3JASB 2COKA 5CIYA 2OWDA 3GLIA 1CUKA 2A6PA 3ALRA 4JLNA 3QOFA 2PU7A 3L7BA 4PN3A 1UMDA 3FB4A 1BC5A 4AYBC 2YVUA 3BZBA 3FOBA 3T1NA 1ZQBA 2HBZA 1JEQA 2DX7A 4NU8X 1JU4A 1P3JA 1FIUA 3RF9A 4FHZA 5C35A 3T3OA 3LKZA 2BQRA 1QVAA 1OB2A 3FTDA 1WCWA 3IUQA 1V9PA 1UXHA 1L3TA 3WDMA 4O25A 2QR3A 4OAPA 5KFAA 5IJWA 1BJRE 2R2GA 3O2SB 3DQQA 1SBTA 4G4SO 4RV4A 2AJBA 2HRBA 2QRVA 4Y2SA 2PUWA 2Y9TA 4Q39A 4RBNA 2DR0A 2HF8A 5BW8A 3N8KA 3TFSA 2A1UB 3DDZX 1PWHA 1V37A 4R2LA 3UQYS 1VE9A 3FN4A 4RWZA 2X41A 2VPWA 1YQEA 3MTIA 4KXXA 4LJAA 3FMOB 3KVRA 1B14A 2QTNA 4KODA 3NR2A 5D2CA 3EXG2 3W78A 2HYDA 3NBFA 1IIRA 2E5LB 5LLTA 1FTGA 3K8OE 4MWEA 4F7DA 1KZ7B 3S29A 3I04A 4PWZA 1DIRA 1IY1A 4NS1A 4KO3S 4HFNA 1QPBA 4TV8B 5FPQA 3E3MA 5ALSA 1L9KA 1TCVA 4LC1A 1SCIA 2B5VA 4YUYA 3AHHA 1JALA 3PUWA 2VP6A 2WU8A 4DLNA 1RQ2A 1OY1A 1RADA 3PC3A 2B0JA 2VLIA 3UJ9A 3WZ2A 1Q0PA 3NBXX 3N6RA 3QVUA 5FX2A 3VR6H 2EHDA 1EDZA 1HLGA 4F4WA 3BA6A 5THKA 1S77D 3CP8A 3W7AA 4BQEA 5KOHB 4IVQA 4JLUA 3W9YA 4FS3A 1UT6A 1KK2A 4KN4A 4CCSA 3AB8A 2K4EA 1Z5WA 2QNBA 4ZPJA 5LQKA 1YL6A 2X4GA 3VZCA 1H5NA 3FROA 1JPJA 2A9JA 5DV9A 4RU1A 4ZZ1A 1I7SB 3Q9UA 1K4YA 4COOA 3T79A 2IYRA 2P91A 3WDKA 1O9BA 1ZC3A 1XCLA 1TMYA 4OQYA 4ABTA 1BPXA 1UBGA 2I67A 4TMVA 2H4HA 2ZSJA 1KEEB 4OQEA 4G0WA 8GPBA 4BATA 2OBBA 4E15A 2LUOA 4MUBA 5LC1A 2LCFA 2HSGA 4NABA 2PPVA 2QUHA 4Q1AA 1F8XA 2QQ5A 3CJRA 4G0VA 1KI8A 2W58A 1BN7A 2D1QA 1MIOA 3MB8A 4QOSA 1CX9B 4BRZA 2GBLC 3JY6A 1K9VF 3COWA 4N6GA 4NMXB 4YO7A 4B3DA 1JHRA 5DN6A 3KWFA 3CRZA 3GEPA 4Z0NA 2QPOA 3ZLUA 3UMJA 2AMJA 4EY4A 2QX4A 4N6OA 3THOA 2ZJ6A 2HSEA 4GQBA 4LNAA 2H3HA 1J9EA 3PNQA 4XGIA 4A1FA 2FW0A 3Q8PB 2Q62A 3QKTA 5KNDD 3BPSA 1RRFA 4LJ4A 4C7VA 5JAIA 4N0PA 3RB6A 5K8TA 1BDBA 2JXJA 2CYBA 1O95C 3N4MB 1HV8A 1SUDA 2FWNA 1MABA 2QD2A 2ZLBA 4Q3NA 5K9ZA 1A97A 3UJNA 5JU5A 2HW3A 4K05A 3F2IA 2XMZA 1PRYA 4KNYA 3ZCRA 2MCFA 5EXSA 2OD7A 5CA1A 1NG9A 3YASA 4EFKA 3W4IA 1X7YB 3PCXA 1DWPA 4G4GA 2CZCA 2RAPA 2EW1A 3D59A 4U7TB 1PZMA 3GZTB 2PL1A 2ZRKA 4Q47A 3TUJC 1I51A 5JTUA 3CLVA 4TYQA 5EMNA 2PUAA 5L9XA 2X9VA 4R9SA 2YHSA 1OMOA 4NESA 1DTWA 3QVWA 4TLDA 2B9VA 2IU3A 3CA8A 3SSNA 5IXSA 3HZZA 5K6AC 2C4VA 2H3EA 2R6ZA 2OV3A 2BKUA 4C4AA 5JNVA 4PGYA 4TQSA 1YGYA 5DHRA 4XWAA 3FNHA 3V1NA 3WLEA 1JDUA 4RFVA 2PGAA 3KO8A 4YXFA 2PBRA 4ECVA 4B7ZA 4D74A 3OQHA 3LO8A 4FNAA 2C2HA 1GA4A 1G41A 2E4ZA 2WB1F 2HXSA 4FJ0A 1AMUA 1P4HA 5DQGA 1M8KA 3FVTA 1MG0A 1OX6A 3M4JA 2OBMA 4Q3LA 4D6PA 1A95A 3PLNA 4IHJF 3UH0A 1JVBA 3ZV6A 3D0RA 2VZ8A 3ZJ5A 3BMOB 3DDUA 2OXIA 3W5UA 5AK5A 5JZVA 1QDUA 1JX6A 3K6KA 4KCGA 1EP3B 3ONEA 3P9PA 821PA 1SBYA 1PVRA 1FX0A 2EKLA 3VC2A 3OY7A 2AR9A 4UNIA 4R71A 1WQ1R 4Z5XA 1J23A 1KMNA 3RJ5A 2OCIA 1G42A 2GCOA 1X3SA 2VSFA 5JQGA 3I6MA 4BMZA 4YP3A 2CDCA 1Q7TA 3SIWA 5BW5A 2X0EA 4DLWA 1IB6A 2I3DA 4A8EA 3KDPA 4PO1A 2Y0SF 3AI1A 4UVGA 1FTNA 1OWLA 1Y9EA 2CXSA 4N8EA 3HC7A 3TQHA 2ZJ8A 5HR7A 5KTRA 5LLDA 1OH6A 2BPOA 2XQVA 4C3ZA 1XCMA 3X1XA 4PW0A 3M6UA 3LTNC 3BILA 4M6WA 1JPVA 2WYWA 3RJKA 4KIGA 2FQYA 3HZOA 1MJGM 3S2EA 3SIRA 5BR8B 3MCWA 4ZFNA 3RBVA 4LTNA 2RHDA 2QVZX 3KWLA 3GP5A 2HHAA 1L7AA 1DCMA 2GPTA 3AIKA 2AFIA 5GINE 5TMPA 3EE6A 2IYSA 1G63A 3JWIA 4DLLA 3INNA 4OU4A 5LD2C 2VH2A 4BO4A 5F9HA 1A7AA 4C7YA 2GN2A 3NWEA 1Z2CA 1G5HA 1YJCA 2RHWA 4MRVA 3RYHA 3R4VA 1EXVA 4KRGA 2YV1A 3RJJA 5ES3A 5B1IA 2YV2A 3D7SA 4KKXB 2XXAB 1PI3A 3CM0A 3WYGA 2HHWA 3BYZA 3AEUA 3GLHA 2RHLA 3NU1A 4OXYA 4TXNA 3HJTA 2BM8A 3PUVA 5T64A 3KG2A 3PXEA 4YPVA 5FPHA 2XF2A 1HFJA 3EXEA 2BKVA 3ES9A 4TWJA 3V8EA 2OG1A 2GB4A 4DL3A 5DB7A 1I3MA 2BGMA 3GFRA 1CRXA 1ZQGA 5C1BA 1IN1A 3FW1A 1EWVA 2YDXA 1GG5A 2G9VA 3G23A 2GR9A 2WI8A 3AKDA 3QBJA 1CEZA 1GRRA 4GI7A 5KYUA 4EBFA 1GFWA 5BNTA 4GZ3A 5CM9C 3RK4A 1R0XA 4MV8A 4ODIA 1UDCA 1UQUA 4NFHA 5J47A 1BMFD 4BU0A 3OJSA 5TGZA 3N0VA 5KFVA 3O1IC 2YDYA 2FV8A 2KZZA 1QRAA 2EXXA 3A1EA 4PL1A 3ZDCA 1KY5A 3LVBA 4HYTA 5FL7D 4BO6A 1XZMA 1CV2A 2BUBA 3OE4A 3UK2A 1NBHA 4KXNA 2FYTA 3V2HA 3NUZA 3BVPA 1U0TA 5IHXA 3TOVA 2IPAB 4M9ZA 7ADHA 3RKSA 5JU6A 1Z15A 2VYVD 3F74A 1CUIA 2RHOA 5KYWB 1HE5A 2IS4A 3HKZC 1KZ1A 1NWCA 1U81A 3VSAA 2IS1A 5DXFA 1QH1A 4FLFA 1P74A 4IIJA 1QP4A 3S1AB 1D2EA 2G07A 1JYFA 3S27A 3WWCA 3AWIA 4POOA 2RCNA 4LJRA 4FC7A 2V3WA 5AJTA 3QOYA 1RR6A 1IM4A 1KRHA 2HA4A 1XU7A 3OIWA 1MFPA 4IYRA 2XRYA 4GX0A 5DK6A 4FFDA 121PA 1UKZA 1JB1A 2HSJA 2ZFUA 4OFBA 1PUIA 1Z2NX 3RAGA 4EG8A 5HWSA 1SRRA 2XOKA 4DC9A 5KFYA 1RKUA 4XGQA 1Y8QB 1QB7A 1VKRA 3JD0A 3RS4A 1XD2A 4HEA6 5IVDA 1PFYA 1YFKA 3VHLB 3A6DA 3IVRA 4D9EA 3PX7A 5M5BA 1KZHA 4PYMA 1PZXA 3EZGA 5AW8A 5AM4A 3U49A 3A6KA 4MVJG 4HTAA 4M0UA 4C2TA 1S3FA 3DC2A 3WAJA 3QI7A 1CIVA 3QPUA 3GIJA 2HLNA 1F4VA 5ELMA 3QXXA 1W30A 3KR1A 1Y7TA 2CKMA 3SYLA 4NK5A 4WFJA 1FRVA 3GN1A 3PUJA 4UVIA 4NU6A 4JBHA 2O8BB 3A1NA 1H2YA 4RQ7A 2HJSA 1ZQDA 2CFSA 1EG7A 2Y1GA 1UMBB 3KWMA 2XCIA 4II3A 2JRZA 2C94A 2WZQA 2ATEA 4KLEA 2ODPA 2FLPA 1LDNA 1X2EA 4O2RA 1EE9A 3VSDA 3AO0B 1D2RA 4G4SP 4XD7A 3BCUA 1XQ9A 4GYWA 3AM3A 1EFCA 2XQIA 1CJSA 3BK7A 3D3KA 3SR6A 4KQEA 4RY8A 3VUFA 2O9JA 3I0NA 4GMDA 5JBQA 3K2QA 1ZGAA 5LL6P 1SU7A 2AXEA 2YHBA 1IE3A 4F3YA 3VYUB 3DD5A 2V7UA 3OT5A 3F98A 2O7VA 2P30A 3NALA 4MKRA 4XCQA 4ZEWA 3STWA 1S4QA 5WRFA 2NUPB 3QQPA 1YZLA 3R4CA 4D8WA 2ZJ0A 2QUIA 5KTNA 2EP5A 2I5PO 2GNOA 4U9IS 3RHTA 1V2HE 2WILA 3HYNA 3B51X 2WM9B 4WNCA 5PNTA 1WB9A 4JGIA 2C2WA 2H6EA 2EANA 3DAGA 1OFGA 2PZGA 3L6RA 3QTLA 4M0EA 2ODAA 3GDXA 3MQFA 1T36B 1X9GA 5E6RA 5T6MA 4PFKA 1D03A 3KE9A 4FHGA 4BX8A 4BVLA 2X4LA 2QTBA 1QQBA 2VAMA 3DMYA 1AV6A 3O8DA 1UT5A 3M6AA 2FN7A 5D4BA 2O0HA 1DCFA 2FDRA 2Y1DA 1QE0A 3QSGA 5F3DA 4IKEA 3PD7A 1D2GA 1E2KA 3FUCA 3DBOB 3WYEA 5H82A 3N8IA 3Q8QB 3HNOA 3QELA 4I3HA 1ZJNA 2H4YA 4O3NA 3PIRA 5FI3A 2FSUA 1A4UA 5J2UB 4XA5A 3E9CA 4U7PB 2EW8A 3ZBQA 5I45A 2WQ6A 4RA6A 3QKWA 3C8HA 4M37A 1E20A 2HJHA 1U7UA 3V1KA 5C37A 1AHNA 1DO8A 1J33A 2A1TR 3CZCA 4EHAA 4YRBA 1MV5A 3T5HA 3FYUC 4QBKA 2VA3A 3LLSA 2YZMA 5D3ZA 1PNQA 3CLTC 1HQYE 3DVAA 1P2UA 2FHPA 4PTLA 2JASA 2SNIE 4K9NA 2JGDB 1G7TA 4ZGGA 2IF2A 2DERA 1UK8A 4A8JA 5JHHB 1YFJA 1NFQA 3CBQA 1GCUA 2CWDA 1T9AA 3AY3A 4BDTA 1QOQB 1PT7A 1YJ5A 3NO4A 2RI1A 3PCTA 4RLQA 2II6A 3IEXA 4D44A 2H7VA 2DJ5A 5CA0A 1N2CE 1FXSA 5JT1A 1AKWA 2YXPX 3RSZA 3IDWA 4AMUA 5BSMA 4GOOD 4KYIB 4D5EA 3PVCA 4D2IA 2IYNA 1JBKA 1C9MA 4NE9A 1EFVB 2B7CA 4ETMA 8ADHA 4GR4A 4UFNA 5AOBA 1KMQA 5TSDA 3RSQA 1W49A 4JJGA 1Z29A 3U16A 4HAZA 4UAJA 3W5AA 2O2XA 3NAMA 1ONOA 2NVBA 1NXQA 3NH6A 3RSOA 1Z0IA 3LH5A 5ARCA 4EHKA 3G6YA 1L6NA 3BMCA 1E98A 1RHQA 5IIKA 2XDQB 1IOLA 4PZEA 1U3DA 2VWQA 2X0JA 4XYLA 3ND6A 3GMDA 4HGYA 1G3UA 2XXJA 4B09A 3EVGA 5C7IO 2A3VA 4C0ZA 2F2TA 2IYXA 4HZGA 1DOQA 4LI0A 3SN6A 1CT9A 4G5QA 4NYIR 2XZOA 3V4RA 4C0KA 5J58A 2I76A 2X5JO 3KTOA 1NX6A 5CB6A 4DGSA 2DBZA 1Q0HA 1WBDA 2J7KA 4PCUA 1KNQA 4DRXA 3U44A 2OFFA 2FR8C 3MYRA 4TM8A 3P2KA 5CP2A 1X0XA 1LQUA 3H2KA 4B9AA 3QX8A 1VZ2A 3CZRA 4LRXA 4Y1EA 2XIDA 1L8AA 2GAJA 3SD7A 1L5RA 3RVNA 1EIZA 3I9KA 4P7GA 2XNSA 3C41J 2OHHA 3HSKA 4JSYA 1FXWF 1EM6A 1HSZA 2C4WA 2FW8A 1ZVMA 4IMIB 1KWKA 2YWEA 2PGJA 4MVCA 3X44A 4EBCA 4OSEA 1K7SN 3WHKA 3WNZA 4V0RA 4BWFB 3AFMA 1XZ8A 1QG0A 2ZAGA 4B6QA 3UAYA 1DC3A 4C07A 2X40A 2VOEA 3JQ7B 1JSZA 2O2YA 2HC9A 2OXFA 4GMGA 3UXYA 1R4NA 4JI7B 4IRDA 1PFQA 3NOXA 3PR5B 2QAJA 3BIWA 4GBGA 1DAEA 4MUYA 5LOVA 1YT3A 1XRPA 1B7GO 3U61B 1JN0A 2Q9BA 4KLRA 1GPWB 2W2KA 5AW5A 2NSYA 3HILA 3O9VA 1CUBA 4PYNA 1Q6ZA 4B4DA 5E2IA 3JAKA 3V3KA 4MR9B 3GCWA 1M2KA 2VL7A 3UQ2A 1Q74A 3A1VA 4EVQA 5JARA 1G2PA 3AHFA 4O4HB 3IILA 3EZ2A 4WPGA 2D54A 1RMTA 5BVGA 1B0UA 1C4KA 4UU8A 3ED5A 3GT7A 3OZIA 5EP1A 3U6BA 4JOBA 1AKRA 4KHZA 1WWUA 3H8JA 2Q5OA 2PUTA 3FYCA 2CKDA 1UKCA 4ZO8A 5HRCA 1GNRA 2JFGA 4P7BA 4JV5B 2FPKA 1DEHA 3WS7A 3DKIA 1Q1GA 2Q3DA 3A6EA 4X1KA 5BYBA 4EHIA 4AJOA 4C88A 2JDIA 1DRVA 3OHMA 5FYQA 1E18A 2FMHA 1CU1A 4KC0A 1MEJA 3T1TA 7ICLA 4L0CA 3K1JA 4TTRA 4Q5IA 2B6NA 4H4DA 5K8UA 1L5LA 4JQCA 4GVXA 1S2OA 3RBXA 4UB5A 2OHIA 3EQ2A 4FKZA 4HB4A 4NOLA 3NC4A 3GL9A 1L5NA 2HWKA 3KJXA 3MJFA 5IJXA 2QRPA 2K4PA 3H40A 4LHXA 3N74A 1HO3A 1HGXA 1Q0UA 3BE4A 5E6UA 1M2WA 3OE7D 4IIEA 1VJTA 2EAOA 1I5OA 2O8CA 3GRVA 5FWXB 5SZKB 1OBOA 1S02A 3ZY2A 2OO5C 1TK9A 2YJ5A 1FRQA 1GL7A 1PFGA 2W7TA 3BQ9A 4XYMA 5BO5A