2LPEA

Solution nmr structure of the ksr1 ca1-ca1a domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
GHMDGGAGAAVSRALQQCGQLQKLIDISIGSLRGLRTKCSVSNDLTQQEIRTLEAKLVKYICKQQQSKLSVTPSDRTAELNSYPRFSDWLYIFNVRPEVVQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLRKVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A CC-SAM, for Coiled Coil Sterile a Motif, Domain Targets the Scaffold KSR-1 to Specific Sites in the Plasma Membrane
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Kinase suppressor of Ras 1
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13543 SAM_KSR1 SAM like domain present in kinase suppressor RAS 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lpeA02
2LMRA 1WWUA 3SENA 4NJ8A 1OXJA 2KIVA 1UQVA 2ESEA 2QARB 4NL9A 2F8KA 2E8MA 3IDWA 2L5YA 4NL9C 1SV4A 4PZNA 1B0XA 2JV3A 3BS7A 2KE7A 2QB1A 1PK1A 2D3DA 2DKXA 1LKYB 3H8MA 5F3XB 1OW5A 2E8NA 2DL0A 2Y9UA 3BS5A 1COKA 5JRTA 2QARA 4IS7A 2FE9A 3KKAA 5L1MA 1SXDA 2QKQA 2LPEA 1PK1B 3KKAC 4RQMA 1LKYA 1PK3A 2E8PA 5J8YA 1Z1VA 2KSOB 1V38A 3BS5B 2EAMA 1B4FA 1SV0C 3K1RB 2Y9TA 2D8CA 3HILA 1V85A 2KMDA 2QB0A 1X9XA 4PZOA 2GLEA 1SGGA 2KSOA 1SV0A 2YTUA 1RG6A 2B6GA 1DXSA 2DKZA 4RQNA 2ES6A 3BQ7A 1F0MA 1KW4A 5JTIA 2QB0B 3TACB 5JU5A 3TADC 3SEIA 5J8YC 1X66A 2EAPA 2K60A 2F3NA 4MHVA 1JI7A 2K4PA 5KNIA 1X40A 3TADA 2KG5A 1WWVA 1UCVA 2E8OA 1SXEA 2EAOA 2F44A 2EANA
chains in the Genus database with same CATH superfamily
3SAHA 1SKWA 4ED0A 2LYAA 2NYVA 1ZQHA 4Z6FA 1SKSA 5EWFA 3QE9Y 1ZQXA 8ICWA 2M0NA 5D46A 2L5YA 4O5CA 1X6IA 2EDUA 2P6UA 4UARA 1T3QA 3C28A 4Y2VA 2HHXA 1KFDA 5DB8A 2OEHA 3I1YA 3Q8RB 2XGPA 2K4IA 2VA8A 4DLGA 4Y2YA 2HOFA 1RQNA 2YN4A 3M9OB 2VIXA 3WU2U 2P6RA 2E8PA 3TKAA 4FS2A 1XO0A 1S77D 4TQSA 2OH2A 2MUTA 2VKQA 2WB1C 4CNQA 2BPFA 3PW5A 5CWRA 5ALWA 4RZRA 5J2AA 3HT3A 5DGAA 4UB6U 2MAXA 1MC8A 2W9MA 5KFFA 2KKPA 8ICIA 3GDXA 5KFWA 3BDPA 1ZQQA 5ALKA 3Q8QB 1ZD2P 4OO1J 4KX5A 1ZQPA 4Q8EA 1JXEA 4FE3A 3RR7A 4EZ9A 3GIJA 4B9TA 3PX0A 2BPGA 5KNIA 1ZXIA 3ICXA 5KAFU 3HKZC 1ZJNA 1ZQTA 2JEGA 4R65A 1N62A 2H3QA 5HHIA 4BX9C 4ECVA 2H3VA 5KFSA 1ZQCA 3KTQA 2LBOA 3C2LA 2BCQA 9ICAA 5KFNA 2Q4TA 4JV1A 1RDFA 1XSNA 1J2MA 2DFLA 3OTQA 5E79U 2E8MA 2OWOA 1B0XA 4BWMA 4JWMA 3DV9A 2D3DA 1Z4NA 3HW8A 1NJYA 1OW5A 5B5EU 3UXPA 5JRTA 1XO1A 4IS7A 3QUQA 3PR5B 4J9NA 3KKAA 2IBKA 3RH5A 4Z6EA 1PK1B 4NM1A 5J0SA 3UQ2A 5DGBA 5AK6A 4KLDA 1M6YA 4MFAA 1TVAA 3BJYA 4US9A 1U48A 2W7PA 2R8JA 3EWAA 1SV0C 4ELVA 2ASJA 4J9RA 5HR7A 9ICEA 3I76A 5BPCA 1IV8A 5KFLA 4F93B 5KFVA 2P66A 2KSOA 5GTHU 1KEJA 4M0AA 5AIAA 3RF9A 5CA7A 1RZTA 4MFFA 4B6JA 4C0ZA 3PX6A 4YP3A 3THVA 4P0PB 4TUQA 8ICEA 1S5LU 2ALZA 4F3OA 1C20A 5KFOA 4YXMA 1BPZA 3KZIU 2PMZF 1FO4A 3GV5B 3PY8A 3HJEA 3B0YA 5ALQA 3CNHA 4KLOA 5J0WA 3RB4A 5D4BA 1BNPA 5J2JA 2C2DA 2W03A 5AKYA 2EANA 1L5UA 4MFCA 4B9VA 3ETLA 1OXJA 2KIVA 3O0FA 5J29A 5DBCA 5KL1B 4XUSA 5AM4A 4DL7A 3OGUA 4M2YA 2PI5A 2QB1A 1U9LA 5KG4A 3M8RA 1LKYB 3D2NA 4KN7A 3H0LB 4QWDA 7ICQA 2G0AA 3KHHA 4QWAA 2C2EA 4BDPA 2RLTA 5BOLA 9ICPA 9ICBA 1URJA 4PHAA 3RJFA 2JEJA 5KG3A 4IQTA 3RBDA 3ZDCA 2W8LA 3GIIA 2KTQA 4AYBC 1PVPA 2K8CB 4QZHA 4RNMA 2GO7A 3NS1A 1PVQA 2G06A 8ICUA 2ZTCA 4IR1A 2XIDA 2YQEA 1L3VA 4GLXA 7ICMA 5HR6A 1T4GA 2ZIWA 3SD7A 5KFBA 2F1IA 3PZPA 2Y1JA 2I1QA 1S76D 3M9NB 1WYGA 1ZD3A 1SL2A 2AQ0A 2HCFA 5AM0A 4YD1A 4TQRA 1S0VA 7ICVA 1KQQA 3NRZA 1S9FA 1DXSA 7ICKA 3JPRA 2DKZA 4ECSA 4F4ZA 4OJLA 5AI8A 4YMNA 1S97A 4FZMA 4O3PA 3RR8A 1DOQA 4R8UB 2K60A 5ALEA 4Q43A 1LVHA 4DLEA 3QUBA 4I2DA 4RUCA 4BWJA 4YR2A 4DSLA 3C2KA 4OCZA 4QZIA 3ZDDA 4ED7A 5DLFA 1X2IA 5ALPA 1J2NA 1ZJMA 3EUB2 4M9HA 1DK3A 3ISDA 1N2XA 2RQ5A 1S10A 4JV2A 3WK7A 3M9MB 4J9KA 5KFIA 3KHLA 1XNSA 2EH9A 2K4HA 4RPXA 4DSEA 2ZIVB 1WWUA 3SENA 1NJWA 3RRGA 2XCAA 2HBKA 3KOOA 3QU4A 1N5XA 4NL9A 2F8KA 4KN4A 1BPYA 7ICLA 4JWNA 2DGZA 4NL9C 3ZD9A 2JV3A 2XC9A 4RQ2A 5D49A 3H8SA 4DOCA 2BCUA 3RJIA 8ICXA 4ECQA 2HVHA 2W9CA 3TAQA 2H5XA 4CF4A 4YG2A 1XSPA 9ICRA 3PW0A 5AKHA 5L1MA 5F9NA 1YZ6A 1L7OA 3GU3A 3KKAC 4ECWA 4C7ZA 3GV8B 4J03A 4X5VA 1F44A 1KRPA 3OHBA 1T8EA 2ISPA 4RQ0A 4Y2JA 5ALYA 1Q8KA 2EZYA 1UHUA 5KT2A 4IRCA 5KG5A 1IM4A 1ZD4A 1WUDA 3H0MB 1O03A 3IP4B 4TUPA 1X9MA 2BCSA 5CJ7A 3TQ1A 4K4IA 4LZDA 5A0LA 4AP9A 3ETRA 2JRZA 1JXLA 3D2QA 4ZOHC 3F5EA 5AM2A 4ED2A 4WJ3B 4FFDA 4YFKA 4F5QA 3LK9A 3CP8A 3MBYA 1BPXA 5AK3A 2YY6A 2PXIA 3TADC 1SWWA 2JHDA 1DGJA 5FP0A 5H2FU 4I2JA 4DSKA 1ED1A 3MGIA 2AGOA 4YCXA 4QZ8A 4ELTA 5ALTA 5L1IA 4BGDA 5GTIU 2DWQA 5KFCA 3HPOA 4UAVA 5DKWA 2WB1F 5EE9A 1AQ6A 2AJQA 2KEYA 4DL6A 1ZQGA 4F4WA 3LVWA 2MA1A 5KFXA 1RPLA 4C4RA 2A1JA 2QARB 3KFUF 5EE0A 5KT6A 1HUZA 5J0RA 3CW2C 4M47A 4PGYA 3PX4A 2LM4A 3TFSA 2BDUA 4O5KA 4Y2PA 9ICMA 3V7JA 3CRXA 4I27A 1ZQBA 2KFNA 3C5GA 2ATLA 4BXOB 1GO3F 4NLBA 1TAUA 5KFPA 3Q8MA 2KHVA 1RYSA 1WCLA 5KG2A 2VA3A 8ICFA 1Z4OA 2E3TA 1QTMA 3AU2A 4EEKA 1ZQJA 4O3MA 4FS1A 4QIWC 2XO7A 4DFKA 2JH1A 2WF8A 1V9PA 3CYMA 9ICVA 4J9OA 9ICKA 2H3ZA 3RH4A 2UVVA 5AICA 3IN5A 4LZGA 5EOZA 4PZOA 2DPIA 4NLZA 3QEBZ 3C21A 9ICCA 2YTUA 1NK6A 5KL8B 5KFRA 4O3QA 3EZ5A 5DDMA 1JUDA 2E1FA 4Y2UA 3RJJA 4KLHA 3M7DA 5TISU 1RYUA 5KAIU 5J2GA 7ICIA 4C4TA 3F2CA 1QSLA 7ICSA 1X66A 4CE6A 5KTQA 3C5FA 3TADA 4F2RA 1IG6A 4DQQA 1Z3EB 3S6JA 1L7PA 5DBAA 1U47A 1TK0A 5J2BA 1Q46A 2YB1A 2FPKA 5J2FA 5KFGA 4NY8A 4I2FA 4KLJA 4IRDA 1D9FA 3H8WA 1UA1A 3DDHA 2KFZA 2FMQA 2HBMA 3GZFA 1TE2A 5ALIA 4IQVA 2ASLA 4Y2TA 1N63A 4RT3A 9ICIA 4MF8A 2C22A 5F3XB 1SB3C 4OD0A 3FC4A 4G9BA 5DB6A 2JMGA 4B9MA 4PJ0U 2Z7JA 4KLFA 4I2GA 4IQUA 2W9AA 2R18A 4M9NA 5IINA 3N7PD 2MSNA 1NOMA 4O3OA 1DGSA 1BNOA 5CEHA 4PL2A 1ZQYA 4YQWA 4DS5A 4DQIA 3OHAA 2G5HB 4EBCA 2D6FC 2QB0A 8ICLA 5F9LA 2K89A 1L3UA 3TAPA 3ZDBA 4UQGA 4LJXA 2ZIXB 4XQ8A 2WAQC 5AKEA 1NK4A 3LDAA 3E58A 3EYZA 4FZLA 1ZD5A 5DQGA 4U6PA 5CP2A 3V7LA 2BZFA 3G6XA 4F5PA 1KKXA 3PO5A 2EAPA 1UT8A 4DQRA 2F77X 5DB7A 5KG1A 1NZPA 2K4PA 2KOBA 4DL2A 2Q0ZX 1BPDA 2RRDA 2KICA 5L1LA 2HHTA 4DSIA 3TANA 9ICOA 3KBBA 1EXNA 4YR0A 4F4KA 5AK4A 2KJ9A 1Z00B 4DQSA 1S0NA 1ZQKA 1TAMA 4I28A 5DDYA 3WK4A 4UB3A 3AQEA 3IM1A 3QU2A 2MU2A 5EWEA 4DS4A 1KFSA 5KG6A 2HHVA 2XGQA 2PI4A 3WKEA 2NRTA 4QWCA 3QNMA 8ICHA 1JRPA 4TURA 3H4BA 1LB2B 2K4EA 1K1SA 4F71A 4QWBA 4ED8A 4O9MA 1L6NA 4EENA 9ICJA 3IHQB 1F5SA 1B22A 2J6UA 2D8CA 2V4QA 1IIPA 1SKRA 1QSYA 2A3VA 5J2CA 2FJ6A 4UBBA 8ICKA 4JK1A 1HEKA 2EZXA 3QZ8A 7ICUA 4F2SA 2I5HA 4F4YA 1HIWA 1X42A 5AI5A 1ZOLA 1NJZA 3RAQA 1ZQZA 3J81j 3Q8KA 1XWLA 5KT3A 2JEIA 5CHGA 5J0TA 4P0QA 5JTIA 3D2SA 2HVIA 2ZXHA 2QLTA 4ECZA 5ALRA 3NVWA 4MHVA 4C8LA 1JI7A 2BCRA 7ICGA 1L7MA 4RPZA 2J6SA 4FO6A 1JMSA 3RBEA 3I28A 4ECUA 3FAHA 3NUQA 1ZQDA 4I2BA 4ECXA 3V6JA 5KFDA 1HJPA 4J9QA 2UVWA 4J9LA 2F76X 3RTVA 1KBUA 2A19A 2OCEA 3RJHA 1L8OA 4UAYA 2W54A 4DOAA 1MSWD 3T5HA 2YB4A 3L5KA 4Y2RA 2JEFA 4DOBA 2ZIVA 2W8KA 2E8NA 5ALHA 3VC8A 4C8MA 4YVZA 4ED6A 3BQTA 1PUZA 4QZEA 2W9BA 3RRHA 3EPIA 5AM1A 1D8LA 1KN5A 2XY6A 1SZHA 2B21A 4O5EA 2AH5A 2XVTA 1NKBA 1Z1VA 4YMOA 2W9CB 3PMLA 4Z6DA 1JROA 5AKGA 3RH6A 4UB5A 3D6JA 2G09A 3K1RB 4UATA 3NASA 2ZJAA 3EW9A 5IIOA 4KX3A 3H7IA 1T3NA 2GLEA 5J0OA 5AKIA 4M9GA 1SGGA 2HHQA 2IOHA 2E1EA 3MGVA 4ED3A 1O08A 3M1YA 5HHHA 5J0PA 5IIIA 4KLSA 3SYZA 4CF5A 2AGPA 3UMGA 2Y0SC 2F1JA 1NK8A 4DFDA 4A8EA 3MABA 2BPCA 3RJGA 4M6WB 1VLBA 3SR6A 3AEVA 4F72A 1ZQNA 2FPMA 5HMMA 3OJUA 3ONNA 1IXRA 2HHWA 4QIWF 2KG5A 2JZBA 1WWVA 1ECWA 1L8LA 3JPQA 2E8OA 2HHSA 4PHEA 3A0BU 3PW4A 1U45A 1LV5A 8ICPA 2F44A 1FFUA 3PW7A 4NLGA 7ICFA 2PFNA 5AIBA 2C28A 3ED5A 5J2IA 2R8KA 1Q3VA 2BR0A 2EZZA 5KG0A 4B9LA 2DKXA 4QZCA 1PZNA 4I2EA 2BQ3A 2CRXA 3QX7A 2OM6A 4KMOB 3V7KA 3BS5A 2GH1A 4EYIB 1RQLA 2ODGA 5CB1A 5KFJA 4CCHA 5BOMA 5L1KA 1SXDA 4RNNA 2LPEA 3LVVA 3H40A 3ZDAA 2KVCA 1ZQOA 4RQ1A 2FLNA 1CUKA 2NRXA 2WF5A 5J0XA 4BXOA 4QZDA 2YMPA 1TK5A 1BGXT 4UB4A 3F2BA 2RDIA 1FIQA 1ZQLA 3H4DA 4EEYA 5AI9A 1X9XA 5L1JA 3FM9A 3QUTA 3Q8PB 3QEAZ 4OJPA 3GV7B 4E0DA 1OUQA 2R8GA 4TUSA 5G5HA 8ICSA 3SMVA 5ALDA 3ZI4A 2ZIUA 5EWGA 4R64A 3MR2A 5ALVA 5DG7A 2IA6A 3QYPA 2VANA 2KVSA 1ZQIA 1AROP 3WKAA 4KITB 1QSSA 4UAUA 5L9XA 4P0PA 3SZ2A 5AM5A 7ICRA 1TKDA 3T79A 1L3SA 5DLGA 1BPEA 1NI3A 1Q3UA 4IQWA 1UT5A 4QZGA 3B0XA 2EQYA 3IDWA 2KJ5A 5J0QA 1DRGA 2YMMA 1ZYQA 1ZQ1C 5ALLA 2HOIA 1A77A 1X9SA 3BQ1A 3PW2A 2FLLA 2B0CA 3K4GA 5AI6A 2PFOA 2IMWP 2NV3A 1ZQVA 4DSFA 1ZQWA 4JUZA 2MUTB 2F8LA 4U7CA 2FE9A 2XY7A 3PVXA 1XSLA 3RB0A 5ALJA 1CEZA 3F5AA 3MC1A 2H3FA 1KFTA 4EBEA 1LKYA 4LVSA 4EBDA 4P2HA 1NNLA 2R8HA 2BDPA 3WK6A 4F5RA 2PFPA 4Q8FA 2OHFA 3GILA 1TV9A 2BCVA 2R8IA 4QW8A 3E2EA 3C1YA 4P4MA 2IOFA 3MFHA 4ACOA 3HRDD 2HDOA 1N48A 3AN1A 4YN4A 2DQNB 3RAXA 5KFMA 3AMZA 2BQRA 2FDRA 5J2HA 4Q45A 2KK0A 2B6GA 2VJ5A 4G3IA 4EZ6A 1KLNA 4DL3A 3NVYA 3NVVA 5J8YC 7ICPA 2AXTU 4PL1A 3SAFA 4QWEA 2F3NA 2YX8A 3L4PA 4O0IA 1RM6C 4BJQA 2KNJA 3UXNA 3N28A 3IRUA 5KFUA 3WKDA 2KP7A 1FFVA 3PMNA 4M9LA 4US8A 4XRHA 3T5KA 3UQ0A 2CN1A 1ZQSA 4GXKA 2ZG6A 2W3RA 4EELA 3K1ZA 3AU6A 4EX6A 2HI0A 2WFAA 9ICQA 4C7YA 2BHNA 3QZ7A 9ICHA 3ORYA 2GWSA 1HUOA 3FDSA 3NGDA 3UXOA 4UW9A 2HMXA 5ALZA 3JPOA 3B9JA 1NJXA 5KFYA 4IRKA 4AYBF 4B9NA 5ALUA 5KFAA 3L3FX 2W3SA 1Z00A 4FBUA 4YMMA 2LI6A 1JIHA 5KFHA 1KDHA 9ICGA 2ZXIA 7ICNA 4ED1A 1KSPA 3C1ZA 5KFTA 1QQ5A 2KSOB 4DL5A 4UAWA 3QXGA 3GFKB 5G5GA 4NXZA 3MR3A 2KMDA 1S0OA 2KIWA 3SV3A 1QQ6A 5ALGA 1TK8A 5C5JA 5EE1A 1WCNA 3IG5A 1H38A 2G08A 2HOQA 3UPQA 1KW4A 5ALNA 3LWMA 4NLNA 4UB2A 1D8YA 5HP4A 3RB3A 3V6HA 3MR6A 3QU9A 4GC6A 2PFQA 3SEIA 4GXJA 4ELUA 3JPSA 2HBLA 2YMLA 4YR3A 2HBJA 2KD1A 3Q8LA 1NK5A 4P4PA 2G07A 1UCVA 5B66U 4P0QB 3NVZA 2DBYA 2XICA 8ICGA 4QZ9A 4KLQA 2NRWA 8ICCA 3M8SA 2A1AA 4C8KA 3FYHA 4NLKA 3OSPA 4USAA 3IV6A 5IIJA 1UQVA 4ICAA 4KLEA 4M9JA 4IR9A 5KT7A 2KN7A 4CF3A 2LYHA 5AKKA 5KT5A 1ZRMA 1CRXA 5J0UA 2ZTDA 3AUOA 2DL0A 3NTUA 4NM2A 2A1JB 2QARA 3T5LA 8ICAA 1KTQA 4C8NA 2QKQA 5AHXA 1KL9A 5DG9A 3C29A 2I9GA 7ICJA 9ICSA 4IL6U 1MN8A 2W04A 2RDJA 1BPBA 4RQ8A 4PHDA 2RP5A 7ICOA 1JALA 3G6YA 4KLTA 3HP6A 2IHMA 1CI4A 1TAQA 4DFPA 2CXYA 2Y9TA 4K4GA 2W9BB 1K5OA 5J2KA 3KD3A 3PV8A 1SL0A 4B9SA 4ECRA 3GIMA 2WF6A 3PNCA 3T5JA 3UMCA 3SQIA 2NRZA 1ZQRA 4QJFB 1L7NA 2P35A 1U4BA 3N97B 3AL0B 2WF7A 2O6KA 4Y2XA 2HHUA 3AQFA 2ASDA 4UB1A 9ICXA 4P4OA 4DQPA 1XS9D 4CGZA 4Y2SA 4MEYA 4J9PA 8ICMA 3RJEA 3RB6A 9ICLA 9ICUA 4CRXA 5J2EA 4BUGA 4JB3A 5CR0A 7ICTA 1C7YA 1B43A 2AQ4A 4UASA 5AKXA 1YZ7A 4NJ8A 3EPGA 1RXVA 8ICQA 1NKCA 2HSZA 4F5OA 4R63A 1JX4A 8ICBA 5ALMA 4NV0A 1SV4A 4PZNA 2KE7A 5KT4A 3G6VA 2FLPA 3WK5A 3H8JA 2G5IB 4QZFA 3T3FA 1A6SA 4J9SA 4Y2QA 1NK9A 2WTFA 1COKA 3QUCA 4OJ5A 3WKCA 2VA2A 2V4RA 3DEEA 2KZZA 1BVSA 5AI0A 1VJ5A 4HAIA 3Q8SB 3HKZF 1L3TA 5J8YA 2WF9A 3SV4A 3UMBA 5AI4A 2C2RA 2DF4B 8ICVA 4ZH4A 7ICHA 4F8RA 4QZBA 3BQ2A 1X9WA 3GQCA 1Z19A 1NK0A 9ICWA 5HMLA 4GIBA 4KTQA 4O3NA 2ZJ8A 2H3IA 1Z1BA 2GOLA 5AK5A 1ZQFA 1SIJA 3JPNA 2QB0B 1XU4A 5JU5A 2HW3A 5T14A 5J2DA 2K8BB 5TZVA 2LM1A 2KJ8A 5AKJA 2W55A 4ECTA 3MR5A 3KZXA 3OPXA 1SXEA 3F2DA 4RNOA 3PSTA 2W11A 2IHNA 1MQ3A 4YXJA 3BQ0A 4PGXA 4NWIA 2LMRA 8ICJA 1VDVA 2F1HA 1SL1A 4QNLA 2KZ3A 2ESEA 4UAZA 5DB9A 2BKEA 3WK9A 4MF2A 1DK2A 5ALOA 2JH7A 1PK1A 4GC7A 3H0RB 3A0HU 2VJ4A 5KG7A 4PHPA 2UVUA 2FMSA 4I2CA 3H8MA 3M6KA 3AM9A 2FI1A 1ZQUA 2J6TA 1QQ7A 3SAGA 1T94A 1N61A 4DO9A 4PGQA 3U26A 1JN3A 3WK8A 1YT3A 2Y0SF 3ZD8A 2AHOB 4M04A 1RYRA 4RQMA 3K75D 3M6ZA 2KZMA 2BQUA 4KLLA 3GIKA 5ALXA 4PPXA 7ICEA 4RQ4A 2YMQA 4OJ6A 2W43A 2AGQA 5C0YA 1V38A 2PMZC 1SWVA 2EAMA 1QLNA 8ICTA 2CPRA 4JV0A 3LYSA 3N7RC 1SV0A 3HX0A 4DL4A 3C2MA 8ICNA 4FBTA 2NRVA 5KFEA 4F92B 4I2IA 4B9UA 4Z6CA 3BQ7A 1S0MA 4GFJA 5DQHA 5AKZA 4F91B 1N5WA 4FZNA 4QW9A 4UBCA 2BGWA 1NKEA 4Q44A 2KKVA 3JPPA 2LYBA 2WHEA 4RQ7A 5DG8A 2JR5A 4DCCA 5IIKA 5KFKA 5J0YA 2AU0A 1UA0A 2JGAA 5IILA 5DBBA 1UPHA 3HWTA 1U49A 2DPJA 4O3RA 4DFJA 2IOFK 4GXIA 4OJOA 1QH9A 3VCBA 4PH5A 3TI0A 5JUMA 5HNKA 4CDGA 9ICNA 5ALSA 4RQ6A 4I29A 3C23A 2Y9UA 2XY5A 2FPLA 3KHRA 1SZPA 5AM3A 3QU7A 2LHTA 4ECYA 3WKBA 8ICRA 1WG8A 1X6JA 3PSPA 4C80A 3MDAA 2ZIWB 1FEZA 5CRXA 3UM9A 2ISOA 4KLMA 3R9KA 2ZIXA 3V72A 4HYKA 8ICOA 3BZCA 4XA5A 1B4FA 2K8AA 3N4MB 4MEXA 5EE3A 1N56A 3HILA 3MDCA 1V85A 2XCPA 3ZDEA 2LKYA 4KLIA 4JMUA 2M9NA 4C4SA 3E0FA 4RQ5A 4R8UA 4DEZA 1RG6A 1N60A 5ALFA 4UB8U 1ZRNA 2RHFA 3PSFA 4RQNA 2Y1IA 2W7OA 3QU5A 3TACB 3ALRA 3PSIA 1PVRA 2WAQF 5IIMA 5K4LA 3PO4A 3RFAA 1P7DA 4K4HA 2F2AB 4NLCA 4DSJA 3SI8A 1D9DA 4KLUA 3ISCA 1TFRA 2UVRA 4F50A 1D8BA 3F53A 2EAOA 4J9MA 3JPTA 1MA7A 1ZETA 3NRWA 4M6WA 2JZBB 4KLGA 2I6XA 9ICTA 1ZQEA 3BS7A 2ZUBA 2KHQA 5KFZA 3MFIA 2NO4A 2DUYA 8ICYA 3RJKA 3TFRA 4RUAA 1K1QA 2KV2A 8ICZA 4EYHB 1NZBA 4F5NA 3ISBA 2OYYA 2OXOA 4QZAA 1Y88A 1T7PA 4R66A 1PK3A 3BZKA 1V97A 1A0PA 3OSNA 1RXWA 4RU9A 3KHGA 1COOA 4EX7A 3TARA 1ZQAA 2ZJ5A 3BS5B 4IC9A 3OJSA 1A76A 4I2AA 4O3SA 4RPYA 2XI9A 4DF8A 2JXJA 2PKEA 4RQ3A 3PR4A 2ZTEA 2ZUDA 3N7SC 2N1RA 4I2HA 2ES6A 1F0MA 4DF4A 1ZQMA 1QCKA 1NK7A 4C8OA 5DQIA 1MQ2A 4RT2A 4DFMA 2E5SA 1XC9A 1X40A 5AKLA 4F4XA 4KMUA 2MRLA 2V9WA 1S8OA 3MGHA 2FMPA 2ZIUB 2NO5A 5KFQA 2ZUCA 4YD2A 3LWLA 9ICFA 1J97A 4DWIA 3IG8A 3V6KA
chains in the Genus database with same CATH topology
2LMRA 1WWUA 3SENA 4NJ8A 1OXJA 2KIVA 1UQVA 2ESEA 2QARB 4NL9A 2F8KA 2E8MA 3IDWA 2L5YA 4NL9C 1SV4A 4PZNA 1B0XA 2JV3A 3BS7A 2KE7A 2QB1A 1PK1A 2D3DA 2DKXA 1LKYB 3H8MA 5F3XB 1OW5A 2E8NA 2DL0A 2Y9UA 3BS5A 1COKA 5JRTA 2QARA 4IS7A 2FE9A 3KKAA 5L1MA 1SXDA 2QKQA 2LPEA 1PK1B 3KKAC 4RQMA 1LKYA 1PK3A 2E8PA 5J8YA 1Z1VA 2KSOB 1V38A 3BS5B 2EAMA 1B4FA 1SV0C 3K1RB 2Y9TA 2D8CA 3HILA 1V85A 2KMDA 2QB0A 1X9XA 4PZOA 2GLEA 1SGGA 2KSOA 1SV0A 2YTUA 1RG6A 2B6GA 1DXSA 2DKZA 4RQNA 2ES6A 3BQ7A 1F0MA 1KW4A 5JTIA 2QB0B 3TACB 5JU5A 3TADC 3SEIA 5J8YC 1X66A 2EAPA 2K60A 2F3NA 4MHVA 1JI7A 2K4PA 5KNIA 1X40A 3TADA 2KG5A 1WWVA 1UCVA 2E8OA 1SXEA 2EAOA 2F44A 2EANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMR A;  1WWU A;  3SEN A;  4NJ8 A;  1OXJ A;  2KIV A;  1UQV A;  2ESE A;  2QAR B;  4NL9 A;  2F8K A;  2E8M A;  3IDW A;  2L5Y A;  4NL9 C;  1SV4 A;  4PZN A;  1B0X A;  2JV3 A;  3BS7 A;  2KE7 A;  2QB1 A;  1PK1 A;  2D3D A;  2DKX A;  1LKY B;  3H8M A;  5F3X B;  1OW5 A;  2E8N A;  2DL0 A;  2Y9U A;  3BS5 A;  1COK A;  5JRT A;  2QAR A;  4IS7 A;  2FE9 A;  3KKA A;  5L1M A;  1SXD A;  2QKQ A;  2LPE A;  1PK1 B;  3KKA C;  4RQM A;  1LKY A;  1PK3 A;  2E8P A;  5J8Y A;  1Z1V A;  2KSO B;  1V38 A;  3BS5 B;  2EAM A;  1B4F A;  1SV0 C;  3K1R B;  2Y9T A;  2D8C A;  3HIL A;  1V85 A;  2KMD A;  2QB0 A;  1X9X A;  4PZO A;  2GLE A;  1SGG A;  2KSO A;  1SV0 A;  2YTU A;  1RG6 A;  2B6G A;  1DXS A;  2DKZ A;  4RQN A;  2ES6 A;  3BQ7 A;  1F0M A;  1KW4 A;  5JTI A;  2QB0 B;  3TAC B;  5JU5 A;  3TAD C;  3SEI A;  5J8Y C;  1X66 A;  2EAP A;  2K60 A;  2F3N A;  4MHV A;  1JI7 A;  2K4P A;  5KNI A;  1X40 A;  3TAD A;  2KG5 A;  1WWV A;  1UCV A;  2E8O A;  1SXE A;  2EAO A;  2F44 A;  2EAN A; 
#chains in the Genus database with same CATH topology
 3SAH A;  1SKW A;  4ED0 A;  2LYA A;  2NYV A;  1ZQH A;  4Z6F A;  1SKS A;  5EWF A;  3QE9 Y;  1ZQX A;  8ICW A;  2M0N A;  5D46 A;  2L5Y A;  4O5C A;  1X6I A;  2EDU A;  2P6U A;  4UAR A;  1T3Q A;  3C28 A;  4Y2V A;  2HHX A;  1KFD A;  5DB8 A;  2OEH A;  3I1Y A;  3Q8R B;  2XGP A;  2K4I A;  2VA8 A;  4DLG A;  4Y2Y A;  2HOF A;  1RQN A;  2YN4 A;  3M9O B;  2VIX A;  3WU2 U;  2P6R A;  2E8P A;  3TKA A;  4FS2 A;  1XO0 A;  1S77 D;  4TQS A;  2OH2 A;  2MUT A;  2VKQ A;  2WB1 C;  4CNQ A;  2BPF A;  3PW5 A;  5CWR A;  5ALW A;  4RZR A;  5J2A A;  3HT3 A;  5DGA A;  4UB6 U;  2MAX A;  1MC8 A;  2W9M A;  5KFF A;  2KKP A;  8ICI A;  3GDX A;  5KFW A;  3BDP A;  1ZQQ A;  5ALK A;  3Q8Q B;  1ZD2 P;  4OO1 J;  4KX5 A;  1ZQP A;  4Q8E A;  1JXE A;  4FE3 A;  3RR7 A;  4EZ9 A;  3GIJ A;  4B9T A;  3PX0 A;  2BPG A;  5KNI A;  1ZXI A;  3ICX A;  5KAF U;  3HKZ C;  1ZJN A;  1ZQT A;  2JEG A;  4R65 A;  1N62 A;  2H3Q A;  5HHI A;  4BX9 C;  4ECV A;  2H3V A;  5KFS A;  1ZQC A;  3KTQ A;  2LBO A;  3C2L A;  2BCQ A;  9ICA A;  5KFN A;  2Q4T A;  4JV1 A;  1RDF A;  1XSN A;  1J2M A;  2DFL A;  3OTQ A;  5E79 U;  2E8M A;  2OWO A;  1B0X A;  4BWM A;  4JWM A;  3DV9 A;  2D3D A;  1Z4N A;  3HW8 A;  1NJY A;  1OW5 A;  5B5E U;  3UXP A;  5JRT A;  1XO1 A;  4IS7 A;  3QUQ A;  3PR5 B;  4J9N A;  3KKA A;  2IBK A;  3RH5 A;  4Z6E A;  1PK1 B;  4NM1 A;  5J0S A;  3UQ2 A;  5DGB A;  5AK6 A;  4KLD A;  1M6Y A;  4MFA A;  1TVA A;  3BJY A;  4US9 A;  1U48 A;  2W7P A;  2R8J A;  3EWA A;  1SV0 C;  4ELV A;  2ASJ A;  4J9R A;  5HR7 A;  9ICE A;  3I76 A;  5BPC A;  1IV8 A;  5KFL A;  4F93 B;  5KFV A;  2P66 A;  2KSO A;  5GTH U;  1KEJ A;  4M0A A;  5AIA A;  3RF9 A;  5CA7 A;  1RZT A;  4MFF A;  4B6J A;  4C0Z A;  3PX6 A;  4YP3 A;  3THV A;  4P0P B;  4TUQ A;  8ICE A;  1S5L U;  2ALZ A;  4F3O A;  1C20 A;  5KFO A;  4YXM A;  1BPZ A;  3KZI U;  2PMZ F;  1FO4 A;  3GV5 B;  3PY8 A;  3HJE A;  3B0Y A;  5ALQ A;  3CNH A;  4KLO A;  5J0W A;  3RB4 A;  5D4B A;  1BNP A;  5J2J A;  2C2D A;  2W03 A;  5AKY A;  2EAN A;  1L5U A;  4MFC A;  4B9V A;  3ETL A;  1OXJ A;  2KIV A;  3O0F A;  5J29 A;  5DBC A;  5KL1 B;  4XUS A;  5AM4 A;  4DL7 A;  3OGU A;  4M2Y A;  2PI5 A;  2QB1 A;  1U9L A;  5KG4 A;  3M8R A;  1LKY B;  3D2N A;  4KN7 A;  3H0L B;  4QWD A;  7ICQ A;  2G0A A;  3KHH A;  4QWA A;  2C2E A;  4BDP A;  2RLT A;  5BOL A;  9ICP A;  9ICB A;  1URJ A;  4PHA A;  3RJF A;  2JEJ A;  5KG3 A;  4IQT A;  3RBD A;  3ZDC A;  2W8L A;  3GII A;  2KTQ A;  4AYB C;  1PVP A;  2K8C B;  4QZH A;  4RNM A;  2GO7 A;  3NS1 A;  1PVQ A;  2G06 A;  8ICU A;  2ZTC A;  4IR1 A;  2XID A;  2YQE A;  1L3V A;  4GLX A;  7ICM A;  5HR6 A;  1T4G A;  2ZIW A;  3SD7 A;  5KFB A;  2F1I A;  3PZP A;  2Y1J A;  2I1Q A;  1S76 D;  3M9N B;  1WYG A;  1ZD3 A;  1SL2 A;  2AQ0 A;  2HCF A;  5AM0 A;  4YD1 A;  4TQR A;  1S0V A;  7ICV A;  1KQQ A;  3NRZ A;  1S9F A;  1DXS A;  7ICK A;  3JPR A;  2DKZ A;  4ECS A;  4F4Z A;  4OJL A;  5AI8 A;  4YMN A;  1S97 A;  4FZM A;  4O3P A;  3RR8 A;  1DOQ A;  4R8U B;  2K60 A;  5ALE A;  4Q43 A;  1LVH A;  4DLE A;  3QUB A;  4I2D A;  4RUC A;  4BWJ A;  4YR2 A;  4DSL A;  3C2K A;  4OCZ A;  4QZI A;  3ZDD A;  4ED7 A;  5DLF A;  1X2I A;  5ALP A;  1J2N A;  1ZJM A;  3EUB 2;  4M9H A;  1DK3 A;  3ISD A;  1N2X A;  2RQ5 A;  1S10 A;  4JV2 A;  3WK7 A;  3M9M B;  4J9K A;  5KFI A;  3KHL A;  1XNS A;  2EH9 A;  2K4H A;  4RPX A;  4DSE A;  2ZIV B;  1WWU A;  3SEN A;  1NJW A;  3RRG A;  2XCA A;  2HBK A;  3KOO A;  3QU4 A;  1N5X A;  4NL9 A;  2F8K A;  4KN4 A;  1BPY A;  7ICL A;  4JWN A;  2DGZ A;  4NL9 C;  3ZD9 A;  2JV3 A;  2XC9 A;  4RQ2 A;  5D49 A;  3H8S A;  4DOC A;  2BCU A;  3RJI A;  8ICX A;  4ECQ A;  2HVH A;  2W9C A;  3TAQ A;  2H5X A;  4CF4 A;  4YG2 A;  1XSP A;  9ICR A;  3PW0 A;  5AKH A;  5L1M A;  5F9N A;  1YZ6 A;  1L7O A;  3GU3 A;  3KKA C;  4ECW A;  4C7Z A;  3GV8 B;  4J03 A;  4X5V A;  1F44 A;  1KRP A;  3OHB A;  1T8E A;  2ISP A;  4RQ0 A;  4Y2J A;  5ALY A;  1Q8K A;  2EZY A;  1UHU A;  5KT2 A;  4IRC A;  5KG5 A;  1IM4 A;  1ZD4 A;  1WUD A;  3H0M B;  1O03 A;  3IP4 B;  4TUP A;  1X9M A;  2BCS A;  5CJ7 A;  3TQ1 A;  4K4I A;  4LZD A;  5A0L A;  4AP9 A;  3ETR A;  2JRZ A;  1JXL A;  3D2Q A;  4ZOH C;  3F5E A;  5AM2 A;  4ED2 A;  4WJ3 B;  4FFD A;  4YFK A;  4F5Q A;  3LK9 A;  3CP8 A;  3MBY A;  1BPX A;  5AK3 A;  2YY6 A;  2PXI A;  3TAD C;  1SWW A;  2JHD A;  1DGJ A;  5FP0 A;  5H2F U;  4I2J A;  4DSK A;  1ED1 A;  3MGI A;  2AGO A;  4YCX A;  4QZ8 A;  4ELT A;  5ALT A;  5L1I A;  4BGD A;  5GTI U;  2DWQ A;  5KFC A;  3HPO A;  4UAV A;  5DKW A;  2WB1 F;  5EE9 A;  1AQ6 A;  2AJQ A;  2KEY A;  4DL6 A;  1ZQG A;  4F4W A;  3LVW A;  2MA1 A;  5KFX A;  1RPL A;  4C4R A;  2A1J A;  2QAR B;  3KFU F;  5EE0 A;  5KT6 A;  1HUZ A;  5J0R A;  3CW2 C;  4M47 A;  4PGY A;  3PX4 A;  2LM4 A;  3TFS A;  2BDU A;  4O5K A;  4Y2P A;  9ICM A;  3V7J A;  3CRX A;  4I27 A;  1ZQB A;  2KFN A;  3C5G A;  2ATL A;  4BXO B;  1GO3 F;  4NLB A;  1TAU A;  5KFP A;  3Q8M A;  2KHV A;  1RYS A;  1WCL A;  5KG2 A;  2VA3 A;  8ICF A;  1Z4O A;  2E3T A;  1QTM A;  3AU2 A;  4EEK A;  1ZQJ A;  4O3M A;  4FS1 A;  4QIW C;  2XO7 A;  4DFK A;  2JH1 A;  2WF8 A;  1V9P A;  3CYM A;  9ICV A;  4J9O A;  9ICK A;  2H3Z A;  3RH4 A;  2UVV A;  5AIC A;  3IN5 A;  4LZG A;  5EOZ A;  4PZO A;  2DPI A;  4NLZ A;  3QEB Z;  3C21 A;  9ICC A;  2YTU A;  1NK6 A;  5KL8 B;  5KFR A;  4O3Q A;  3EZ5 A;  5DDM A;  1JUD A;  2E1F A;  4Y2U A;  3RJJ A;  4KLH A;  3M7D A;  5TIS U;  1RYU A;  5KAI U;  5J2G A;  7ICI A;  4C4T A;  3F2C A;  1QSL A;  7ICS A;  1X66 A;  4CE6 A;  5KTQ A;  3C5F A;  3TAD A;  4F2R A;  1IG6 A;  4DQQ A;  1Z3E B;  3S6J A;  1L7P A;  5DBA A;  1U47 A;  1TK0 A;  5J2B A;  1Q46 A;  2YB1 A;  2FPK A;  5J2F A;  5KFG A;  4NY8 A;  4I2F A;  4KLJ A;  4IRD A;  1D9F A;  3H8W A;  1UA1 A;  3DDH A;  2KFZ A;  2FMQ A;  2HBM A;  3GZF A;  1TE2 A;  5ALI A;  4IQV A;  2ASL A;  4Y2T A;  1N63 A;  4RT3 A;  9ICI A;  4MF8 A;  2C22 A;  5F3X B;  1SB3 C;  4OD0 A;  3FC4 A;  4G9B A;  5DB6 A;  2JMG A;  4B9M A;  4PJ0 U;  2Z7J A;  4KLF A;  4I2G A;  4IQU A;  2W9A A;  2R18 A;  4M9N A;  5IIN A;  3N7P D;  2MSN A;  1NOM A;  4O3O A;  1DGS A;  1BNO A;  5CEH A;  4PL2 A;  1ZQY A;  4YQW A;  4DS5 A;  4DQI A;  3OHA A;  2G5H B;  4EBC A;  2D6F C;  2QB0 A;  8ICL A;  5F9L A;  2K89 A;  1L3U A;  3TAP A;  3ZDB A;  4UQG A;  4LJX A;  2ZIX B;  4XQ8 A;  2WAQ C;  5AKE A;  1NK4 A;  3LDA A;  3E58 A;  3EYZ A;  4FZL A;  1ZD5 A;  5DQG A;  4U6P A;  5CP2 A;  3V7L A;  2BZF A;  3G6X A;  4F5P A;  1KKX A;  3PO5 A;  2EAP A;  1UT8 A;  4DQR A;  2F77 X;  5DB7 A;  5KG1 A;  1NZP A;  2K4P A;  2KOB A;  4DL2 A;  2Q0Z X;  1BPD A;  2RRD A;  2KIC A;  5L1L A;  2HHT A;  4DSI A;  3TAN A;  9ICO A;  3KBB A;  1EXN A;  4YR0 A;  4F4K A;  5AK4 A;  2KJ9 A;  1Z00 B;  4DQS A;  1S0N A;  1ZQK A;  1TAM A;  4I28 A;  5DDY A;  3WK4 A;  4UB3 A;  3AQE A;  3IM1 A;  3QU2 A;  2MU2 A;  5EWE A;  4DS4 A;  1KFS A;  5KG6 A;  2HHV A;  2XGQ A;  2PI4 A;  3WKE A;  2NRT A;  4QWC A;  3QNM A;  8ICH A;  1JRP A;  4TUR A;  3H4B A;  1LB2 B;  2K4E A;  1K1S A;  4F71 A;  4QWB A;  4ED8 A;  4O9M A;  1L6N A;  4EEN A;  9ICJ A;  3IHQ B;  1F5S A;  1B22 A;  2J6U A;  2D8C A;  2V4Q A;  1IIP A;  1SKR A;  1QSY A;  2A3V A;  5J2C A;  2FJ6 A;  4UBB A;  8ICK A;  4JK1 A;  1HEK A;  2EZX A;  3QZ8 A;  7ICU A;  4F2S A;  2I5H A;  4F4Y A;  1HIW A;  1X42 A;  5AI5 A;  1ZOL A;  1NJZ A;  3RAQ A;  1ZQZ A;  3J81 j;  3Q8K A;  1XWL A;  5KT3 A;  2JEI A;  5CHG A;  5J0T A;  4P0Q A;  5JTI A;  3D2S A;  2HVI A;  2ZXH A;  2QLT A;  4ECZ A;  5ALR A;  3NVW A;  4MHV A;  4C8L A;  1JI7 A;  2BCR A;  7ICG A;  1L7M A;  4RPZ A;  2J6S A;  4FO6 A;  1JMS A;  3RBE A;  3I28 A;  4ECU A;  3FAH A;  3NUQ A;  1ZQD A;  4I2B A;  4ECX A;  3V6J A;  5KFD A;  1HJP A;  4J9Q A;  2UVW A;  4J9L A;  2F76 X;  3RTV A;  1KBU A;  2A19 A;  2OCE A;  3RJH A;  1L8O A;  4UAY A;  2W54 A;  4DOA A;  1MSW D;  3T5H A;  2YB4 A;  3L5K A;  4Y2R A;  2JEF A;  4DOB A;  2ZIV A;  2W8K A;  2E8N A;  5ALH A;  3VC8 A;  4C8M A;  4YVZ A;  4ED6 A;  3BQT A;  1PUZ A;  4QZE A;  2W9B A;  3RRH A;  3EPI A;  5AM1 A;  1D8L A;  1KN5 A;  2XY6 A;  1SZH A;  2B21 A;  4O5E A;  2AH5 A;  2XVT A;  1NKB A;  1Z1V A;  4YMO A;  2W9C B;  3PML A;  4Z6D A;  1JRO A;  5AKG A;  3RH6 A;  4UB5 A;  3D6J A;  2G09 A;  3K1R B;  4UAT A;  3NAS A;  2ZJA A;  3EW9 A;  5IIO A;  4KX3 A;  3H7I A;  1T3N A;  2GLE A;  5J0O A;  5AKI A;  4M9G A;  1SGG A;  2HHQ A;  2IOH A;  2E1E A;  3MGV A;  4ED3 A;  1O08 A;  3M1Y A;  5HHH A;  5J0P A;  5III A;  4KLS A;  3SYZ A;  4CF5 A;  2AGP A;  3UMG A;  2Y0S C;  2F1J A;  1NK8 A;  4DFD A;  4A8E A;  3MAB A;  2BPC A;  3RJG A;  4M6W B;  1VLB A;  3SR6 A;  3AEV A;  4F72 A;  1ZQN A;  2FPM A;  5HMM A;  3OJU A;  3ONN A;  1IXR A;  2HHW A;  4QIW F;  2KG5 A;  2JZB A;  1WWV A;  1ECW A;  1L8L A;  3JPQ A;  2E8O A;  2HHS A;  4PHE A;  3A0B U;  3PW4 A;  1U45 A;  1LV5 A;  8ICP A;  2F44 A;  1FFU A;  3PW7 A;  4NLG A;  7ICF A;  2PFN A;  5AIB A;  2C28 A;  3ED5 A;  5J2I A;  2R8K A;  1Q3V A;  2BR0 A;  2EZZ A;  5KG0 A;  4B9L A;  2DKX A;  4QZC A;  1PZN A;  4I2E A;  2BQ3 A;  2CRX A;  3QX7 A;  2OM6 A;  4KMO B;  3V7K A;  3BS5 A;  2GH1 A;  4EYI B;  1RQL A;  2ODG A;  5CB1 A;  5KFJ A;  4CCH A;  5BOM A;  5L1K A;  1SXD A;  4RNN A;  2LPE A;  3LVV A;  3H40 A;  3ZDA A;  2KVC A;  1ZQO A;  4RQ1 A;  2FLN A;  1CUK A;  2NRX A;  2WF5 A;  5J0X A;  4BXO A;  4QZD A;  2YMP A;  1TK5 A;  1BGX T;  4UB4 A;  3F2B A;  2RDI A;  1FIQ A;  1ZQL A;  3H4D A;  4EEY A;  5AI9 A;  1X9X A;  5L1J A;  3FM9 A;  3QUT A;  3Q8P B;  3QEA Z;  4OJP A;  3GV7 B;  4E0D A;  1OUQ A;  2R8G A;  4TUS A;  5G5H A;  8ICS A;  3SMV A;  5ALD A;  3ZI4 A;  2ZIU A;  5EWG A;  4R64 A;  3MR2 A;  5ALV A;  5DG7 A;  2IA6 A;  3QYP A;  2VAN A;  2KVS A;  1ZQI A;  1ARO P;  3WKA A;  4KIT B;  1QSS A;  4UAU A;  5L9X A;  4P0P A;  3SZ2 A;  5AM5 A;  7ICR A;  1TKD A;  3T79 A;  1L3S A;  5DLG A;  1BPE A;  1NI3 A;  1Q3U A;  4IQW A;  1UT5 A;  4QZG A;  3B0X A;  2EQY A;  3IDW A;  2KJ5 A;  5J0Q A;  1DRG A;  2YMM A;  1ZYQ A;  1ZQ1 C;  5ALL A;  2HOI A;  1A77 A;  1X9S A;  3BQ1 A;  3PW2 A;  2FLL A;  2B0C A;  3K4G A;  5AI6 A;  2PFO A;  2IMW P;  2NV3 A;  1ZQV A;  4DSF A;  1ZQW A;  4JUZ A;  2MUT B;  2F8L A;  4U7C A;  2FE9 A;  2XY7 A;  3PVX A;  1XSL A;  3RB0 A;  5ALJ A;  1CEZ A;  3F5A A;  3MC1 A;  2H3F A;  1KFT A;  4EBE A;  1LKY A;  4LVS A;  4EBD A;  4P2H A;  1NNL A;  2R8H A;  2BDP A;  3WK6 A;  4F5R A;  2PFP A;  4Q8F A;  2OHF A;  3GIL A;  1TV9 A;  2BCV A;  2R8I A;  4QW8 A;  3E2E A;  3C1Y A;  4P4M A;  2IOF A;  3MFH A;  4ACO A;  3HRD D;  2HDO A;  1N48 A;  3AN1 A;  4YN4 A;  2DQN B;  3RAX A;  5KFM A;  3AMZ A;  2BQR A;  2FDR A;  5J2H A;  4Q45 A;  2KK0 A;  2B6G A;  2VJ5 A;  4G3I A;  4EZ6 A;  1KLN A;  4DL3 A;  3NVY A;  3NVV A;  5J8Y C;  7ICP A;  2AXT U;  4PL1 A;  3SAF A;  4QWE A;  2F3N A;  2YX8 A;  3L4P A;  4O0I A;  1RM6 C;  4BJQ A;  2KNJ A;  3UXN A;  3N28 A;  3IRU A;  5KFU A;  3WKD A;  2KP7 A;  1FFV A;  3PMN A;  4M9L A;  4US8 A;  4XRH A;  3T5K A;  3UQ0 A;  2CN1 A;  1ZQS A;  4GXK A;  2ZG6 A;  2W3R A;  4EEL A;  3K1Z A;  3AU6 A;  4EX6 A;  2HI0 A;  2WFA A;  9ICQ A;  4C7Y A;  2BHN A;  3QZ7 A;  9ICH A;  3ORY A;  2GWS A;  1HUO A;  3FDS A;  3NGD A;  3UXO A;  4UW9 A;  2HMX A;  5ALZ A;  3JPO A;  3B9J A;  1NJX A;  5KFY A;  4IRK A;  4AYB F;  4B9N A;  5ALU A;  5KFA A;  3L3F X;  2W3S A;  1Z00 A;  4FBU A;  4YMM A;  2LI6 A;  1JIH A;  5KFH A;  1KDH A;  9ICG A;  2ZXI A;  7ICN A;  4ED1 A;  1KSP A;  3C1Z A;  5KFT A;  1QQ5 A;  2KSO B;  4DL5 A;  4UAW A;  3QXG A;  3GFK B;  5G5G A;  4NXZ A;  3MR3 A;  2KMD A;  1S0O A;  2KIW A;  3SV3 A;  1QQ6 A;  5ALG A;  1TK8 A;  5C5J A;  5EE1 A;  1WCN A;  3IG5 A;  1H38 A;  2G08 A;  2HOQ A;  3UPQ A;  1KW4 A;  5ALN A;  3LWM A;  4NLN A;  4UB2 A;  1D8Y A;  5HP4 A;  3RB3 A;  3V6H A;  3MR6 A;  3QU9 A;  4GC6 A;  2PFQ A;  3SEI A;  4GXJ A;  4ELU A;  3JPS A;  2HBL A;  2YML A;  4YR3 A;  2HBJ A;  2KD1 A;  3Q8L A;  1NK5 A;  4P4P A;  2G07 A;  1UCV A;  5B66 U;  4P0Q B;  3NVZ A;  2DBY A;  2XIC A;  8ICG A;  4QZ9 A;  4KLQ A;  2NRW A;  8ICC A;  3M8S A;  2A1A A;  4C8K A;  3FYH A;  4NLK A;  3OSP A;  4USA A;  3IV6 A;  5IIJ A;  1UQV A;  4ICA A;  4KLE A;  4M9J A;  4IR9 A;  5KT7 A;  2KN7 A;  4CF3 A;  2LYH A;  5AKK A;  5KT5 A;  1ZRM A;  1CRX A;  5J0U A;  2ZTD A;  3AUO A;  2DL0 A;  3NTU A;  4NM2 A;  2A1J B;  2QAR A;  3T5L A;  8ICA A;  1KTQ A;  4C8N A;  2QKQ A;  5AHX A;  1KL9 A;  5DG9 A;  3C29 A;  2I9G A;  7ICJ A;  9ICS A;  4IL6 U;  1MN8 A;  2W04 A;  2RDJ A;  1BPB A;  4RQ8 A;  4PHD A;  2RP5 A;  7ICO A;  1JAL A;  3G6Y A;  4KLT A;  3HP6 A;  2IHM A;  1CI4 A;  1TAQ A;  4DFP A;  2CXY A;  2Y9T A;  4K4G A;  2W9B B;  1K5O A;  5J2K A;  3KD3 A;  3PV8 A;  1SL0 A;  4B9S A;  4ECR A;  3GIM A;  2WF6 A;  3PNC A;  3T5J A;  3UMC A;  3SQI A;  2NRZ A;  1ZQR A;  4QJF B;  1L7N A;  2P35 A;  1U4B A;  3N97 B;  3AL0 B;  2WF7 A;  2O6K A;  4Y2X A;  2HHU A;  3AQF A;  2ASD A;  4UB1 A;  9ICX A;  4P4O A;  4DQP A;  1XS9 D;  4CGZ A;  4Y2S A;  4MEY A;  4J9P A;  8ICM A;  3RJE A;  3RB6 A;  9ICL A;  9ICU A;  4CRX A;  5J2E A;  4BUG A;  4JB3 A;  5CR0 A;  7ICT A;  1C7Y A;  1B43 A;  2AQ4 A;  4UAS A;  5AKX A;  1YZ7 A;  4NJ8 A;  3EPG A;  1RXV A;  8ICQ A;  1NKC A;  2HSZ A;  4F5O A;  4R63 A;  1JX4 A;  8ICB A;  5ALM A;  4NV0 A;  1SV4 A;  4PZN A;  2KE7 A;  5KT4 A;  3G6V A;  2FLP A;  3WK5 A;  3H8J A;  2G5I B;  4QZF A;  3T3F A;  1A6S A;  4J9S A;  4Y2Q A;  1NK9 A;  2WTF A;  1COK A;  3QUC A;  4OJ5 A;  3WKC A;  2VA2 A;  2V4R A;  3DEE A;  2KZZ A;  1BVS A;  5AI0 A;  1VJ5 A;  4HAI A;  3Q8S B;  3HKZ F;  1L3T A;  5J8Y A;  2WF9 A;  3SV4 A;  3UMB A;  5AI4 A;  2C2R A;  2DF4 B;  8ICV A;  4ZH4 A;  7ICH A;  4F8R A;  4QZB A;  3BQ2 A;  1X9W A;  3GQC A;  1Z19 A;  1NK0 A;  9ICW A;  5HML A;  4GIB A;  4KTQ A;  4O3N A;  2ZJ8 A;  2H3I A;  1Z1B A;  2GOL A;  5AK5 A;  1ZQF A;  1SIJ A;  3JPN A;  2QB0 B;  1XU4 A;  5JU5 A;  2HW3 A;  5T14 A;  5J2D A;  2K8B B;  5TZV A;  2LM1 A;  2KJ8 A;  5AKJ A;  2W55 A;  4ECT A;  3MR5 A;  3KZX A;  3OPX A;  1SXE A;  3F2D A;  4RNO A;  3PST A;  2W11 A;  2IHN A;  1MQ3 A;  4YXJ A;  3BQ0 A;  4PGX A;  4NWI A;  2LMR A;  8ICJ A;  1VDV A;  2F1H A;  1SL1 A;  4QNL A;  2KZ3 A;  2ESE A;  4UAZ A;  5DB9 A;  2BKE A;  3WK9 A;  4MF2 A;  1DK2 A;  5ALO A;  2JH7 A;  1PK1 A;  4GC7 A;  3H0R B;  3A0H U;  2VJ4 A;  5KG7 A;  4PHP A;  2UVU A;  2FMS A;  4I2C A;  3H8M A;  3M6K A;  3AM9 A;  2FI1 A;  1ZQU A;  2J6T A;  1QQ7 A;  3SAG A;  1T94 A;  1N61 A;  4DO9 A;  4PGQ A;  3U26 A;  1JN3 A;  3WK8 A;  1YT3 A;  2Y0S F;  3ZD8 A;  2AHO B;  4M04 A;  1RYR A;  4RQM A;  3K75 D;  3M6Z A;  2KZM A;  2BQU A;  4KLL A;  3GIK A;  5ALX A;  4PPX A;  7ICE A;  4RQ4 A;  2YMQ A;  4OJ6 A;  2W43 A;  2AGQ A;  5C0Y A;  1V38 A;  2PMZ C;  1SWV A;  2EAM A;  1QLN A;  8ICT A;  2CPR A;  4JV0 A;  3LYS A;  3N7R C;  1SV0 A;  3HX0 A;  4DL4 A;  3C2M A;  8ICN A;  4FBT A;  2NRV A;  5KFE A;  4F92 B;  4I2I A;  4B9U A;  4Z6C A;  3BQ7 A;  1S0M A;  4GFJ A;  5DQH A;  5AKZ A;  4F91 B;  1N5W A;  4FZN A;  4QW9 A;  4UBC A;  2BGW A;  1NKE A;  4Q44 A;  2KKV A;  3JPP A;  2LYB A;  2WHE A;  4RQ7 A;  5DG8 A;  2JR5 A;  4DCC A;  5IIK A;  5KFK A;  5J0Y A;  2AU0 A;  1UA0 A;  2JGA A;  5IIL A;  5DBB A;  1UPH A;  3HWT A;  1U49 A;  2DPJ A;  4O3R A;  4DFJ A;  2IOF K;  4GXI A;  4OJO A;  1QH9 A;  3VCB A;  4PH5 A;  3TI0 A;  5JUM A;  5HNK A;  4CDG A;  9ICN A;  5ALS A;  4RQ6 A;  4I29 A;  3C23 A;  2Y9U A;  2XY5 A;  2FPL A;  3KHR A;  1SZP A;  5AM3 A;  3QU7 A;  2LHT A;  4ECY A;  3WKB A;  8ICR A;  1WG8 A;  1X6J A;  3PSP A;  4C80 A;  3MDA A;  2ZIW B;  1FEZ A;  5CRX A;  3UM9 A;  2ISO A;  4KLM A;  3R9K A;  2ZIX A;  3V72 A;  4HYK A;  8ICO A;  3BZC A;  4XA5 A;  1B4F A;  2K8A A;  3N4M B;  4MEX A;  5EE3 A;  1N56 A;  3HIL A;  3MDC A;  1V85 A;  2XCP A;  3ZDE A;  2LKY A;  4KLI A;  4JMU A;  2M9N A;  4C4S A;  3E0F A;  4RQ5 A;  4R8U A;  4DEZ A;  1RG6 A;  1N60 A;  5ALF A;  4UB8 U;  1ZRN A;  2RHF A;  3PSF A;  4RQN A;  2Y1I A;  2W7O A;  3QU5 A;  3TAC B;  3ALR A;  3PSI A;  1PVR A;  2WAQ F;  5IIM A;  5K4L A;  3PO4 A;  3RFA A;  1P7D A;  4K4H A;  2F2A B;  4NLC A;  4DSJ A;  3SI8 A;  1D9D A;  4KLU A;  3ISC A;  1TFR A;  2UVR A;  4F50 A;  1D8B A;  3F53 A;  2EAO A;  4J9M A;  3JPT A;  1MA7 A;  1ZET A;  3NRW A;  4M6W A;  2JZB B;  4KLG A;  2I6X A;  9ICT A;  1ZQE A;  3BS7 A;  2ZUB A;  2KHQ A;  5KFZ A;  3MFI A;  2NO4 A;  2DUY A;  8ICY A;  3RJK A;  3TFR A;  4RUA A;  1K1Q A;  2KV2 A;  8ICZ A;  4EYH B;  1NZB A;  4F5N A;  3ISB A;  2OYY A;  2OXO A;  4QZA A;  1Y88 A;  1T7P A;  4R66 A;  1PK3 A;  3BZK A;  1V97 A;  1A0P A;  3OSN A;  1RXW A;  4RU9 A;  3KHG A;  1COO A;  4EX7 A;  3TAR A;  1ZQA A;  2ZJ5 A;  3BS5 B;  4IC9 A;  3OJS A;  1A76 A;  4I2A A;  4O3S A;  4RPY A;  2XI9 A;  4DF8 A;  2JXJ A;  2PKE A;  4RQ3 A;  3PR4 A;  2ZTE A;  2ZUD A;  3N7S C;  2N1R A;  4I2H A;  2ES6 A;  1F0M A;  4DF4 A;  1ZQM A;  1QCK A;  1NK7 A;  4C8O A;  5DQI A;  1MQ2 A;  4RT2 A;  4DFM A;  2E5S A;  1XC9 A;  1X40 A;  5AKL A;  4F4X A;  4KMU A;  2MRL A;  2V9W A;  1S8O A;  3MGH A;  2FMP A;  2ZIU B;  2NO5 A;  5KFQ A;  2ZUC A;  4YD2 A;  3LWL A;  9ICF A;  1J97 A;  4DWI A;  3IG8 A;  3V6K A; 
#chains in the Genus database with same CATH homology
 2LMR A;  1WWU A;  3SEN A;  4NJ8 A;  1OXJ A;  2KIV A;  1UQV A;  2ESE A;  2QAR B;  4NL9 A;  2F8K A;  2E8M A;  3IDW A;  2L5Y A;  4NL9 C;  1SV4 A;  4PZN A;  1B0X A;  2JV3 A;  3BS7 A;  2KE7 A;  2QB1 A;  1PK1 A;  2D3D A;  2DKX A;  1LKY B;  3H8M A;  5F3X B;  1OW5 A;  2E8N A;  2DL0 A;  2Y9U A;  3BS5 A;  1COK A;  5JRT A;  2QAR A;  4IS7 A;  2FE9 A;  3KKA A;  5L1M A;  1SXD A;  2QKQ A;  2LPE A;  1PK1 B;  3KKA C;  4RQM A;  1LKY A;  1PK3 A;  2E8P A;  5J8Y A;  1Z1V A;  2KSO B;  1V38 A;  3BS5 B;  2EAM A;  1B4F A;  1SV0 C;  3K1R B;  2Y9T A;  2D8C A;  3HIL A;  1V85 A;  2KMD A;  2QB0 A;  1X9X A;  4PZO A;  2GLE A;  1SGG A;  2KSO A;  1SV0 A;  2YTU A;  1RG6 A;  2B6G A;  1DXS A;  2DKZ A;  4RQN A;  2ES6 A;  3BQ7 A;  1F0M A;  1KW4 A;  5JTI A;  2QB0 B;  3TAC B;  5JU5 A;  3TAD C;  3SEI A;  5J8Y C;  1X66 A;  2EAP A;  2K60 A;  2F3N A;  4MHV A;  1JI7 A;  2K4P A;  5KNI A;  1X40 A;  3TAD A;  2KG5 A;  1WWV A;  1UCV A;  2E8O A;  1SXE A;  2EAO A;  2F44 A;  2EAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...