2LPEA

Solution nmr structure of the ksr1 ca1-ca1a domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
b'GHMDGGAGAAVSRALQQCGQLQKLIDISIGSLRGLRTKCSVSNDLTQQEIRTLEAKLVKYICKQQQSKLSVTPSDRTAELNSYPRFSDWLYIFNVRPEVVQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLRKVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinase suppressor of Ras 1
molecule tags Signaling protein
source organism Mus musculus
publication title A CC-SAM, for Coiled Coil Sterile a Motif, Domain Targets the Scaffold KSR-1 to Specific Sites in the Plasma Membrane
rcsb
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13543 SAM_KSR1 SAM like domain present in kinase suppressor RAS 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lpeA02
1Z1VA 3K1RB 1PK1B 3H8MA 2QB0A 2E8MA 3HILA 1X66A 3BS5B 1SV0C 2B6GA 3TADA 1SXDA 1RG6A 2FE9A 2KSOB 2EAPA 5F3XB 1JI7A 1V85A 1PK1A 2LMRA 2Y9TA 2E8OA 2Y9UA 1SXEA 4RQNA 1F0MA 2QKQA 2KIVA 1LKYA 2D8CA 2ES6A 2K4PA 1X9XA 2QB0B 2QARA 3TACB 2EAMA 2F3NA 2QARB 5KNIA 1SGGA 5L1MA 3SEIA 3IDWA 4NL9A 3BS5A 2DKXA 1X40A 2DL0A 2LPEA 1UCVA 1PK3A 2ESEA 1WWUA 1UQVA 2KG5A 3BQ7A 4RQMA 1COKA 2F44A 2GLEA 4PZOA 5JU5A 2EAOA 5J8YA 1B4FA 1SV4A 2KMDA 1WWVA 2L5YA 4NL9C 1KW4A 3KKAC 2D3DA 3KKAA 1DXSA 4MHVA 2EANA 5JRTA 2DKZA 5JTIA 2KSOA 4NJ8A 1SV0A 1OXJA 1V38A 2KE7A 4IS7A 3SENA 2YTUA 3BS7A 3TADC 2E8PA 2F8KA 2QB1A 2E8NA 5J8YC 1OW5A 1LKYB 1B0XA 2K60A 2JV3A 4PZNA
chains in the Genus database with same CATH superfamily
4KTQA 3AEVA 4ELVA 1L7MA 4PHDA 3H8MA 2NO4A 5AKYA 4RQ4A 5EE0A 4NV0A 3KHRA 5KFJA 4Y2XA 3PO4A 5KAIU 4C8LA 2HDOA 3PW4A 2CXYA 4DCCA 4GLXA 4QIWF 1XSLA 4KLDA 4ZOHC 1NJZA 4XUSA 1S0NA 4B6JA 1A77A 1ZQCA 1O08A 5CEHA 3M6KA 2KTQA 1V85A 4GXIA 4DSKA 7ICKA 4JB3A 1EXNA 1GO3F 1XNSA 4I2JA 3DDHA 4ACOA 4C8OA 9ICSA 1ZOLA 1NKBA 3V6JA 1CUKA 1JUDA 1X9XA 5FP0A 7ICEA 1NK7A 4F91B 2HSZA 2A3VA 5L1MA 3UXNA 4RT2A 9ICMA 2FPKA 1J2MA 1L8LA 2R18A 1ZQOA 2DKXA 5L1KA 5J0QA 7ICUA 1QSLA 4K4HA 1X40A 1ZQTA 2ESEA 1J97A 1UQVA 2W04A 3PMNA 4QZ9A 5EWGA 2KZMA 5J8YA 3IP4B 1HJPA 2CN1A 1HIWA 3SAHA 3EWAA 3KKAA 4YMMA 1UPHA 4ED0A 2NV3A 3QE9Y 7ICRA 2RRDA 1FO4A 3VC8A 2PFOA 3OSNA 3QX7A 1NJXA 3KZIU 3EUB2 3RAQA 3B9JA 4KLLA 2WAQF 2DPJA 5K4LA 3I28A 1VJ5A 4C7YA 1Z1VA 1AROP 2IOFK 4YN4A 4QWDA 4RUAA 1BPXA 3ISBA 2BQ3A 5HHHA 2J6TA 1RDFA 3K4GA 1LVHA 1C20A 2C2RA 1ZJMA 2B0CA 2KSOB 4KITB 4QZFA 2OCEA 5HHIA 4PPXA 5KFCA 8ICSA 1Q8KA 2O6KA 2XICA 1NK8A 5AKGA 1K5OA 2JEJA 7ICGA 4O3OA 4CF3A 2DPIA 2DUYA 3HW8A 2VANA 4JMUA 2E8OA 2QKQA 3T5LA 2LM4A 2QB0B 3OJSA 5AM3A 2W3SA 1ZQQA 1JIHA 1KDHA 2F3NA 1MQ3A 4I2EA 2G0AA 2YB1A 1KEJA 1X6IA 3UMBA 5AKIA 2J6SA 4CF5A 2KG5A 1JROA 4UB5A 4Q45A 2ATLA 5L9XA 1DOQA 1ZQZA 3GV5B 3BZCA 4TUSA 5ALGA 1ZQDA 3TANA 2BCSA 3PX0A 4ECZA 2UVUA 1N62A 3PW5A 4YMOA 5J0UA 5KFEA 1XO1A 1L3UA 5DBAA 3WKAA 9ICBA 5EE1A 5KFWA 1OXJA 4UASA 2JZBA 3QU4A 3OHBA 3N7SC 3M9NB 5AM1A 3G6YA 1F5SA 5DG7A 3RH5A 1KN5A 2MSNA 1OW5A 1N5WA 3AM9A 2R8JA 4RU9A 2RDIA 4C0ZA 2J6UA 4FBTA 4KMUA 2G08A 4MFFA 4Y2QA 2WF5A 1JRPA 1TAQA 5CB1A 3GDXA 3ZDBA 2P35A 4CGZA 9ICEA 4O3SA 3O0FA 3GV7B 5AKLA 1J2NA 2EAPA 4F50A 1S8OA 1N61A 4O3PA 1UHUA 1AQ6A 3I76A 2JEGA 8ICMA 9ICIA 4E0DA 4LVSA 1Z19A 1SZPA 3E0FA 1HUOA 1DK3A 2YMPA 5DGAA 3RR8A 4YVZA 3M7DA 2DQNB 9ICQA 1WYGA 3ICXA 1SKRA 5IIIA 2HBMA 2QARA 4FS1A 3WK5A 3KOOA 9ICKA 1XO0A 4O5KA 4ECSA 2ZXHA 2ZTDA 1ZD4A 2GH1A 4NM1A 9ICLA 2FDRA 3QUBA 4UQGA 4ECYA 1ECWA 2FPMA 3FAHA 1NI3A 3S6JA 2F44A 2KD1A 1DGSA 1X9WA 3E2EA 4KLMA 1TE2A 1TV9A 3AUOA 8ICPA 5AI4A 3H8WA 2ZTCA 4QJFB 3KZXA 4PHAA 8ICJA 1DXSA 5CP2A 3MR5A 2KKVA 2BR0A 3C2MA 3RH4A 2JH1A 5BPCA 5ALSA 3RJGA 3GV8B 4IS7A 4DL3A 1IV8A 2ZIWB 3N28A 3EPIA 9ICRA 2EDUA 1V97A 3WKCA 1ZQMA 3PR5B 1TK8A 2K60A 4RNMA 2EH9A 1BNOA 4C7ZA 2NRTA 3M6ZA 2XC9A 1L7NA 4UB8U 2KZ3A 4DL7A 4KLEA 4YR2A 4GIBA 2ZTEA 1Z3EB 4I2BA 4DQPA 1NKCA 2AGOA 3KTQA 4OO1J 1HEKA 2KJ9A 2ASJA 2HVIA 2ZIVA 7ICQA 4YR0A 5KFHA 4I28A 3N7RC 2LI6A 4RPZA 2FPLA 3JPPA 5DG9A 1NNLA 4KN7A 4TURA 4DSIA 3UXOA 3JPTA 4IC9A 2WF7A 4ED1A 3SAGA 4UAZA 2R8GA 3ZI4A 2W55A 1NK6A 2ZIUB 1U49A 2FLNA 2PI5A 4Q8EA 1L5UA 4UAYA 3GU3A 5TISU 4C4TA 7ICNA 2G5IB 8ICGA 1MA7A 5KFDA 3JPQA 3F2BA 1D9DA 2R8IA 1ZQAA 1ZQ1C 1DGJA 1YT3A 1ZQWA 2DL0A 2ZIVB 3HKZC 5DG8A 4MFCA 5AHXA 3N4MB 2XCAA 8ICTA 4KLUA 5JU5A 2YQEA 3ZDCA 1PVPA 2FMPA 1B4FA 1BNPA 1SV4A 2RP5A 4PH5A 2IBKA 4NL9C 2A19A 4OD0A 3EZ5A 4M9GA 4QZCA 4MHVA 1VDVA 4RUCA 5ALZA 2KN7A 4F3OA 5KFZA 3IG8A 3Q8RB 5AKXA 4DQQA 4JV2A 3IM1A 3QUQA 3U26A 2YTUA 5KFBA 4QWEA 3WKDA 3BS7A 5KFYA 5EOZA 2KHQA 1FEZA 1A6SA 2EZYA 2EQYA 4DS5A 4MEYA 4XQ8A 3NGDA 3KFUF 2H3QA 3C21A 4YXMA 1HUZA 1TFRA 4DFDA 3GIKA 1TAUA 5J2EA 3H7IA 5IILA 2BQUA 2HOIA 4M9LA 1ZD5A 5B66U 2BQRA 3C2LA 7ICIA 4C8MA 4F5QA 1N48A 2KJ8A 5KT4A 2P6UA 2VJ5A 3PSPA 4M6WA 3IV6A 5IIJA 2F1IA 2XVTA 3WK7A 3QU5A 4M04A 3GZFA 2WF6A 1U4BA 5CR0A 4P0QB 1IXRA 1LKYA 3ONNA 3PW0A 7ICSA 4DOBA 2C2EA 2MU2A 4K4GA 4YP3A 4GC7A 5L1LA 2JGAA 3M8RA 4QWCA 3RAXA 2HW3A 1RYUA 4U7CA 3RB0A 8ICIA 2HHVA 4DF4A 4I2GA 4IRDA 2XY6A 1JALA 3RJEA 1UCVA 3BQ7A 3I1YA 8ICZA 2YMMA 5CHGA 3OGUA 5ALQA 2BPCA 4NM2A 4O3MA 3AU2A 4GFJA 2DFLA 2KMDA 2W43A 4OCZA 2LHTA 2D3DA 2JRZA 1Q3VA 1URJA 1SIJA 3NUQA 3M9MB 2DWQA 4X5VA 3LWMA 2R8HA 4BJQA 3OPXA 4FZNA 4OJPA 4UB1A 1ZRMA 4NLKA 3EYZA 3D2QA 3ALRA 2KE7A 2OHFA 3C23A 3UMCA 1D8YA 2HHWA 5IIKA 2E8NA 1B0XA 4ED8A 1LB2B 3ZDEA 3K1RB 1L7OA 4BXOB 4EELA 5AM4A 4CNQA 5J2IA 3L5KA 2QLTA 2KFZA 5J2DA 1KLNA 2BZFA 2LYHA 4KN4A 1SV0C 4ED6A 2UVRA 2AU0A 1S0OA 5J0SA 2P6RA 3IG5A 5CA7A 2NRXA 8ICAA 3WK6A 4RQ5A 3V7LA 2BGWA 4O3QA 5DQGA 2PI4A 2UVWA 5DB7A 4KLQA 4ELUA 4G3IA 4ECVA 3TARA 2Y9UA 2KIVA 1JX4A 2JR5A 2H3VA 4R63A 4JV1A 5J0XA 1KTQA 4EEKA 4M6WB 2ZUBA 4MF8A 3MDCA 2LYBA 2Y1JA 2W9CA 4PGYA 4P0PB 5DDYA 5AM5A 1T7PA 9ICXA 4ELTA 2LKYA 1ZD2P 4DOCA 1T94A 4RQ7A 1S77D 7ICJA 3GFKB 4CF4A 2Q0ZX 3SAFA 2LPEA 1KFSA 2F76X 1ZQNA 2M0NA 4YR3A 4PZOA 4US9A 1BPDA 3Q8SB 5KG5A 1RM6C 4XA5A 1OUQA 3NVWA 3T79A 1RYRA 4PL2A 4DEZA 1TAMA 1L3SA 1WG8A 2F8LA 4Y2RA 2E1EA 5J0WA 5DKWA 2OEHA 3EPGA 2C2DA 3UQ2A 2KSOA 2BKEA 4KX5A 4YCXA 8ICXA 4BUGA 4IR9A 4Z6FA 3TFRA 3DV9A 5KFAA 8ICKA 4LJXA 3PY8A 3H4BA 1VLBA 2H5XA 4TQSA 1NZPA 4DWIA 4I2DA 4RZRA 3F2CA 1KRPA 4DO9A 1XS9D 7ICHA 5AKEA 4C8KA 9ICFA 4KLTA 4IQWA 2W7PA 5HNKA 2V9WA 3OJUA 5KFRA 1SXEA 3FC4A 1X6JA 4R8UB 5KFMA 3BQ2A 2ES6A 5AKKA 4F8RA 4F4WA 3RF9A 4JWMA 2FLLA 3NVVA 5EE9A 2IHNA 5IIOA 1SWVA 4OJ5A 5KT2A 8ICLA 1BPEA 4B9MA 2YY6A 5AI0A 2Y0SC 4AYBF 3PX6A 4QWBA 8ICWA 3SQIA 1ZJNA 4DFPA 2W11A 1NK0A 4BXOA 3ETRA 4KLGA 2G5HB 2LM1A 4Y2VA 3DEEA 1TK5A 4R8UA 4RQ1A 1SL1A 1TKDA 8ICQA 3SMVA 2L5YA 3N97B 1KW4A 2WB1C 2VA3A 4P4OA 8ICNA 5J2JA 2YB4A 1KL9A 2OYYA 2BCQA 1SV0A 1RXWA 3B0XA 1FFVA 8ICVA 3Q8MA 3CNHA 1N60A 2MUTB 3B0YA 4AP9A 1BGXT 1KKXA 1A76A 3OSPA 2W03A 4US8A 3PZPA 2VA8A 2KZZA 5GTHU 3RTVA 1D8BA 2PMZF 4TUQA 5CRXA 3MGHA 5KFUA 5HMMA 4RT3A 4MFAA 1QTMA 3HX0A 4CDGA 3AQEA 3F5EA 4B9LA 2H3FA 4UB6U 2H3ZA 1Z4NA 3LK9A 2R8KA 4Q43A 2ASDA 2FE9A 8ICOA 1NOMA 4J9MA 4EEYA 3UPQA 1BPZA 3MGVA 5KFNA 3HRDD 3SR6A 2XO7A 2PFQA 3J81j 2FMSA 1SZHA 4Y2UA 4F72A 1SKSA 2PFPA 3RBEA 1PZNA 3THVA 1ZQGA 3RB3A 3PV8A 4FS2A 1ZQXA 3C1YA 3V7KA 1RXVA 3BDPA 2KOBA 4WJ3B 2W9AA 2D6FC 3NASA 1S5LU 2K8CB 3UM9A 3PR4A 3QUCA 9ICAA 1Z00A 2XGQA 3C28A 1A0PA 1X9MA 3KHGA 5KFVA 5HP4A 2PFNA 4RPYA 3TKAA 2W9MA 2KP7A 3FM9A 8ICUA 4EBCA 4FZMA 1NKEA 4DSEA 2P66A 4P4MA 2ZXIA 1JXLA 4GC6A 4F71A 2MA1A 1WWVA 5ALFA 5ALYA 3Q8KA 2ZJ8A 5ALKA 5J2CA 7ICLA 2JMGA 2F1JA 1ZQKA 4QNLA 4FFDA 3GIMA 4ICAA 4QZEA 5JTIA 3K75D 1Q46A 2I5HA 5L1IA 7ICFA 2ZIXA 4DL6A 2K4EA 4XRHA 2GWSA 4DLGA 1CRXA 2B21A 8ICBA 3T5KA 4M0AA 3RJFA 2NO5A 5AI5A 4FBUA 5AI6A 4Z6EA 5AIBA 1ZQRA 5J0YA 4NLNA 2F77X 4BX9C 4IR1A 2KKPA 3MR6A 2WHEA 5J2AA 1N2XA 3NRZA 1ZQIA 3JPNA 4NLCA 2JHDA 1RPLA 4UB3A 2ISPA 1XC9A 3TADA 1O03A 2BCUA 3ISDA 1JI7A 4NWIA 1BVSA 5KG1A 2ZG6A 4YXJA 4M9JA 5ALOA 4CRXA 3ZD8A 1QSYA 2ISOA 2Y0SF 4UBCA 4CCHA 5CWRA 2DF4B 3D6JA 2FI1A 5ALXA 3SZ2A 3QYPA 1KFTA 5J2FA 1L3TA 3RBDA 3H40A 3RJJA 2WFAA 3CYMA 5TZVA 3OTQA 2PXIA 2W8KA 3FDSA 1N56A 3C1ZA 2AQ4A 4RQMA 5A0LA 3LVVA 2W9BB 5AI9A 4F4ZA 4ZH4A 5DLFA 1QLNA 5ALNA 5KFSA 4ED2A 5E79U 2Q4TA 3SD7A 2EANA 4RNNA 3MGIA 4UAUA 3H4DA 2PMZC 5J2BA 5EWFA 2E3TA 5BOLA 3ED5A 4LZDA 4OJLA 5AK4A 4PHPA 4KMOB 2IOHA 5DBCA 5KG0A 7ICMA 3NRWA 3AQFA 4M9NA 4YD2A 2BHNA 3PSIA 2PKEA 2ZIUA 3RFAA 2QB0A 1L8OA 9ICCA 2HHUA 2HHTA 1B43A 4O5EA 5CJ7A 1IM4A 2KVSA 4UB4A 1NK9A 3Q8LA 7ICOA 1JXEA 3RJKA 1Y88A 3MABA 2W9BA 3SYZA 5DGBA 4HYKA 4C4SA 1L3VA 5KFTA 3HWTA 4RQNA 9ICGA 1RZTA 2CRXA 1D8LA 3FYHA 3QU2A 2LYAA 1ZQFA 3HJEA 2AQ0A 7ICVA 4QZAA 2CPRA 4DL4A 2I9GA 3SV3A 4USAA 3E58A 3F5AA 4Y2TA 4I2CA 7ICTA 3RR7A 2AGQA 1PK3A 4DL5A 1RYSA 1MQ2A 5F9LA 4QW8A 2ALZA 2HVHA 4QWAA 1NZBA 2JEIA 5ALIA 3CP8A 4J03A 3HKZF 2RLTA 4I2FA 2WF8A 4F92B 2YX8A 4Z6DA 1JN3A 5ALHA 5J2GA 1RQNA 3BQ0A 1S10A 1KFDA 1Z1BA 3IHQB 3TQ1A 5JUMA 4ECTA 2IMWP 4ECXA 4K4IA 3MR3A 5KG6A 3TADC 3QEAZ 3TAQA 1RQLA 5AM2A 4EYHB 2W54A 2V4RA 1LKYB 2C28A 3TFSA 1S76D 3NVYA 3TAPA 1ZQPA 4I2IA 2MUTA 1C7YA 3IN5A 1WCLA 5DBBA 3PW7A 1ZQVA 4QIWC 2FJ6A 1QQ5A 1COOA 5J0RA 3BQ1A 3H0LB 3LWLA 4DQIA 2RDJA 5ALVA 5H2FU 2HBJA 1X66A 2KHVA 5EE3A 8ICFA 5KG3A 2LBOA 4DS4A 1TK0A 2UVVA 1NK5A 2W8LA 4RQ8A 5KT7A 5BOMA 4RPXA 2W3RA 2AH5A 4Q8FA 2A1JA 2ZIWA 4ED7A 2NYVA 2K4PA 4KLHA 2BDUA 5HMLA 5IIMA 4M47A 4OJ6A 5G5GA 4NY8A 2HHSA 9ICNA 3GILA 3MBYA 5J29A 1Z4OA 2RHFA 1IG6A 3BS5A 4P4PA 9ICWA 3PNCA 5C5JA 4UB2A 1ZYQA 3QXGA 5DLGA 2YN4A 4M9HA 4DQSA 4NLGA 2OXOA 1F44A 1T4GA 8ICRA 3HPOA 4AYBC 3PVXA 5GTIU 3ISCA 1NJWA 2JZBB 1ZXIA 4NXZA 1SKWA 2W7OA 2F1HA 2QB1A 5KFFA 5G5HA 2MRLA 3HP6A 5ALMA 5D46A 3PSTA 2KNJA 3JPOA 3Q8PB 2KEYA 4EX7A 2I6XA 2ZJ5A 1L7PA 1L6NA 3RB6A 5ALRA 4F5PA 2NRVA 1QCKA 1UA0A 4B9UA 5DQHA 3MFIA 4Y2JA 3BQTA 1T8EA 1Z00B 4I2AA 5HR7A 2KICA 5F3XB 4IRKA 3RJIA 5AK5A 3L4PA 4C4RA 3AMZA 4I29A 1SL2A 2AXTU 4KLFA 1ZQJA 1QH9A 2Y9TA 9ICVA 2D8CA 4J9OA 1X9SA 4DQRA 5C0YA 1QSSA 1K1SA 4JUZA 2XI9A 5AICA 3GIJA 7ICPA 1UT5A 4UARA 4R64A 3D2NA 3WK9A 4B9SA 3SI8A 4DF8A 4P0PA 1COKA 2GLEA 1U48A 2Y1IA 1MN8A 1SB3C 2YMLA 1BPBA 5KG4A 1S97A 2WB1F 3RH6A 1UT8A 5AKHA 3WKEA 3WU2U 4P0QA 3SV4A 2BCVA 1XSPA 5F9NA 2G07A 1ZRNA 3QEBZ 4RQ0A 3H0MB 9ICHA 4EX6A 4PGQA 3SENA 1YZ6A 2KV2A 3QNMA 3NTUA 4QW9A 4PHEA 4JWNA 3VCBA 5KFIA 3WK8A 4KLSA 2DBYA 1X42A 4F5RA 3M8SA 3NS1A 1PK1B 4Z6CA 3H8JA 3UMGA 2HHQA 2KFNA 4F5OA 2HCFA 1SL0A 4P2HA 3HILA 2KK0A 1U47A 2B6GA 4DSJA 4DSLA 4FZLA 2K89A 5J0OA 3V72A 2HHXA 5DB8A 1RG6A 4J9RA 1ZETA 3MDAA 3IRUA 9ICTA 1SWWA 4IL6U 3KD3A 5KL8B 4R65A 5J0TA 2KVCA 3GIIA 1DRGA 1PK1A 4JV0A 5ALDA 4EENA 5D4BA 4I2HA 3QZ8A 3AU6A 1YZ7A 4B9VA 3ZDAA 4ECRA 1CI4A 2M9NA 3IDWA 3G6XA 4NLBA 4EZ6A 1ZQLA 5B5EU 3V7JA 4GXJA 4YQWA 4JK1A 1WWUA 1P7DA 3V6KA 3WK4A 5DDMA 2WAQC 1T3NA 4Q44A 2EAOA 2GOLA 1QQ6A 2KJ5A 4UW9A 2HOFA 3KKAC 2I1QA 3H0RB 3QU9A 5J2KA 5AM0A 4J9PA 5JRTA 3M1YA 2ZIXB 4PGXA 1XWLA 1IIPA 5AKJA 2ODGA 3BZKA 1D9FA 1UA1A 3A0HU 4QZ8A 1ZQEA 3V6HA 1PVRA 2F8KA 2E5SA 5AI8A 1FIQA 4KLIA 3K1ZA 2VKQA 2JEFA 2H3IA 4DFMA 4UAWA 2XGPA 2EZZA 3CW2C 5KFOA 2K4IA 9ICPA 4BDPA 2ZUDA 4CE6A 2BPFA 2HBLA 3NVZA 5DQIA 2AJQA 3JPSA 3AL0B 4Y2PA 5KFXA 4IRCA 1WCNA 4PJ0U 3A0BU 3LDAA 2BPGA 3ETLA 4MF2A 4QZGA 5AIAA 5KTQA 3C29A 5EWEA 4I27A 3LVWA 8ICEA 3UXPA 8ICYA 8ICHA 3BJYA 3C5FA 2Z7JA 2LMRA 4IQVA 1TVAA 4ECWA 2XIDA 3RRGA 4UBBA 3UQ0A 2OM6A 4F2SA 3M9OB 4RQ3A 9ICJA 3TACB 5KFLA 2QARB 5KNIA 1SGGA 1NK4A 4KLOA 3L3FX 4A8EA 5KFPA 4O9MA 4RNOA 2BDPA 1XSNA 2C22A 4F4YA 2WF9A 1K1QA 3PMLA 4BWJA 5T14A 5L1JA 4TQRA 3GQCA 5ALPA 4UATA 4FO6A 4DL2A 4UAVA 2XY5A 2DGZA 1JMSA 4C80A 1B22A 2IA6A 1N5XA 1V38A 3T3FA 4KX3A 5KG7A 4LZGA 4RQ2A 4O3NA 1S0VA 4DFJA 5ALLA 2E8PA 2G09A 1KQQA 4YG2A 2A1AA 2OWOA 2JV3A 4PZNA 4ECUA 3T5HA 1T3QA 2OH2A 3D2SA 3Q8QB 2MAXA 4NLZA 2E8MA 4GXKA 4Y2SA 5IINA 3H8SA 3T5JA 2YMQA 5DB6A 4O0IA 3QZ7A 3G6VA 4RQ6A 1N63A 4EYIB 4F93B 4F2RA 2XY7A 1ZQHA 2G06A 1XU4A 4QZIA 3PW2A 5KL1B 3RB4A 5KT6A 2V4QA 4J9KA 2K8AA 2ZUCA 4DSFA 1KSPA 2EAMA 2ZJAA 1V9PA 1MSWD 2IOFA 4YMNA 4YD1A 3HT3A 4QZBA 4ED3A 3RJHA 3RRHA 4DLEA 4DFKA 4O3RA 1ZQSA 1ED1A 5KFQA 2HI0A 4QZHA 3F53A 4KLJA 4ECQA 2F2AB 2KIWA 3MFHA 4EBDA 5AK3A 2BCRA 4EBEA 4FE3A 5KT5A 3C5GA 3JPRA 4NJ8A 3MC1A 5ALTA 4U6PA 4F5NA 5ALWA 4J9QA 2FLPA 1M6YA 3TI0A 3PX4A 1ZD3A 4B9NA 2WTFA 4F4XA 3F2DA 2HOQA 2W9CB 3KHHA 2AGPA 2XCPA 4G9BA 5AK6A 1U9LA 2EZXA 1PUZA 2JXJA 3AN1A 1PVQA 3BS5B 9ICOA 1KBUA 3ZD9A 1SXDA 5KFKA 3QUTA 3QU7A 4EZ9A 3N7PD 5KAFU 4B9TA 2K4HA 1DK2A 2VA2A 3PO5A 4Y2YA 2A1JB 5ALJA 3R9KA 3MR2A 2NRWA 1F0MA 3ZDDA 4IQUA 5ALEA 4BWMA 4YFKA 1BPYA 4J9SA 2VIXA 4F4KA 5ALUA 9ICUA 1X2IA 3EW9A 4C8NA 4MEXA 1S0MA 5KG2A 4M2YA 1Q3UA 4J9NA 2K8BB 5DB9A 1ZQYA 2NRZA 3KHLA 2GO7A 3SEIA 1S9FA 3ORYA 1QQ7A 8ICCA 4NL9A 2IHMA 1LV5A 1ZQUA 1CEZA 4DOAA 4J9LA 4TUPA 5HR6A 2N1RA 4OJOA 4QZDA 1NJYA 1MC8A 2FMQA 5KT3A 5J0PA 2HBKA 4O5CA 2E1FA 2HMXA 5AKZA 1FFUA 3KBBA 3WKBA 1WUDA 4HAIA 1U45A 4R66A 2DKZA 4IQTA 4PL1A 3CRXA 2ASLA 2JH7A 3LYSA 2AHOB 3C2KA 2VJ4A 2RQ5A 1H38A 4BGDA 5J8YC 1ZQBA 5KFGA 5D49A 3OHAA 3PSFA 5J2HA
chains in the Genus database with same CATH topology
1Z1VA 3K1RB 1PK1B 3H8MA 2QB0A 2E8MA 3HILA 1X66A 3BS5B 1SV0C 2B6GA 3TADA 1SXDA 1RG6A 2FE9A 2KSOB 2EAPA 5F3XB 1JI7A 1V85A 1PK1A 2LMRA 2Y9TA 2E8OA 2Y9UA 1SXEA 4RQNA 1F0MA 2QKQA 2KIVA 1LKYA 2D8CA 2ES6A 2K4PA 1X9XA 2QB0B 2QARA 3TACB 2EAMA 2F3NA 2QARB 5KNIA 1SGGA 5L1MA 3SEIA 3IDWA 4NL9A 3BS5A 2DKXA 1X40A 2DL0A 2LPEA 1UCVA 1PK3A 2ESEA 1WWUA 1UQVA 2KG5A 3BQ7A 4RQMA 1COKA 2F44A 2GLEA 4PZOA 5JU5A 2EAOA 5J8YA 1B4FA 1SV4A 2KMDA 1WWVA 2L5YA 4NL9C 1KW4A 3KKAC 2D3DA 3KKAA 1DXSA 4MHVA 2EANA 5JRTA 2DKZA 5JTIA 2KSOA 4NJ8A 1SV0A 1OXJA 1V38A 2KE7A 4IS7A 3SENA 2YTUA 3BS7A 3TADC 2E8PA 2F8KA 2QB1A 2E8NA 5J8YC 1OW5A 1LKYB 1B0XA 2K60A 2JV3A 4PZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1V A;  3K1R B;  1PK1 B;  3H8M A;  2QB0 A;  2E8M A;  3HIL A;  1X66 A;  3BS5 B;  1SV0 C;  2B6G A;  3TAD A;  1SXD A;  1RG6 A;  2FE9 A;  2KSO B;  2EAP A;  5F3X B;  1JI7 A;  1V85 A;  1PK1 A;  2LMR A;  2Y9T A;  2E8O A;  2Y9U A;  1SXE A;  4RQN A;  1F0M A;  2QKQ A;  2KIV A;  1LKY A;  2D8C A;  2ES6 A;  2K4P A;  1X9X A;  2QB0 B;  2QAR A;  3TAC B;  2EAM A;  2F3N A;  2QAR B;  5KNI A;  1SGG A;  5L1M A;  3SEI A;  3IDW A;  4NL9 A;  3BS5 A;  2DKX A;  1X40 A;  2DL0 A;  2LPE A;  1UCV A;  1PK3 A;  2ESE A;  1WWU A;  1UQV A;  2KG5 A;  3BQ7 A;  4RQM A;  1COK A;  2F44 A;  2GLE A;  4PZO A;  5JU5 A;  2EAO A;  5J8Y A;  1B4F A;  1SV4 A;  2KMD A;  1WWV A;  2L5Y A;  4NL9 C;  1KW4 A;  3KKA C;  2D3D A;  3KKA A;  1DXS A;  4MHV A;  2EAN A;  5JRT A;  2DKZ A;  5JTI A;  2KSO A;  4NJ8 A;  1SV0 A;  1OXJ A;  1V38 A;  2KE7 A;  4IS7 A;  3SEN A;  2YTU A;  3BS7 A;  3TAD C;  2E8P A;  2F8K A;  2QB1 A;  2E8N A;  5J8Y C;  1OW5 A;  1LKY B;  1B0X A;  2K60 A;  2JV3 A;  4PZN A; 
#chains in the Genus database with same CATH topology
 4KTQ A;  3AEV A;  4ELV A;  1L7M A;  4PHD A;  3H8M A;  2NO4 A;  5AKY A;  4RQ4 A;  5EE0 A;  4NV0 A;  3KHR A;  5KFJ A;  4Y2X A;  3PO4 A;  5KAI U;  4C8L A;  2HDO A;  3PW4 A;  2CXY A;  4DCC A;  4GLX A;  4QIW F;  1XSL A;  4KLD A;  4ZOH C;  1NJZ A;  4XUS A;  1S0N A;  4B6J A;  1A77 A;  1ZQC A;  1O08 A;  5CEH A;  3M6K A;  2KTQ A;  1V85 A;  4GXI A;  4DSK A;  7ICK A;  4JB3 A;  1EXN A;  1GO3 F;  1XNS A;  4I2J A;  3DDH A;  4ACO A;  4C8O A;  9ICS A;  1ZOL A;  1NKB A;  3V6J A;  1CUK A;  1JUD A;  1X9X A;  5FP0 A;  7ICE A;  1NK7 A;  4F91 B;  2HSZ A;  2A3V A;  5L1M A;  3UXN A;  4RT2 A;  9ICM A;  2FPK A;  1J2M A;  1L8L A;  2R18 A;  1ZQO A;  2DKX A;  5L1K A;  5J0Q A;  7ICU A;  1QSL A;  4K4H A;  1X40 A;  1ZQT A;  2ESE A;  1J97 A;  1UQV A;  2W04 A;  3PMN A;  4QZ9 A;  5EWG A;  2KZM A;  5J8Y A;  3IP4 B;  1HJP A;  2CN1 A;  1HIW A;  3SAH A;  3EWA A;  3KKA A;  4YMM A;  1UPH A;  4ED0 A;  2NV3 A;  3QE9 Y;  7ICR A;  2RRD A;  1FO4 A;  3VC8 A;  2PFO A;  3OSN A;  3QX7 A;  1NJX A;  3KZI U;  3EUB 2;  3RAQ A;  3B9J A;  4KLL A;  2WAQ F;  2DPJ A;  5K4L A;  3I28 A;  1VJ5 A;  4C7Y A;  1Z1V A;  1ARO P;  2IOF K;  4YN4 A;  4QWD A;  4RUA A;  1BPX A;  3ISB A;  2BQ3 A;  5HHH A;  2J6T A;  1RDF A;  3K4G A;  1LVH A;  1C20 A;  2C2R A;  1ZJM A;  2B0C A;  2KSO B;  4KIT B;  4QZF A;  2OCE A;  5HHI A;  4PPX A;  5KFC A;  8ICS A;  1Q8K A;  2O6K A;  2XIC A;  1NK8 A;  5AKG A;  1K5O A;  2JEJ A;  7ICG A;  4O3O A;  4CF3 A;  2DPI A;  2DUY A;  3HW8 A;  2VAN A;  4JMU A;  2E8O A;  2QKQ A;  3T5L A;  2LM4 A;  2QB0 B;  3OJS A;  5AM3 A;  2W3S A;  1ZQQ A;  1JIH A;  1KDH A;  2F3N A;  1MQ3 A;  4I2E A;  2G0A A;  2YB1 A;  1KEJ A;  1X6I A;  3UMB A;  5AKI A;  2J6S A;  4CF5 A;  2KG5 A;  1JRO A;  4UB5 A;  4Q45 A;  2ATL A;  5L9X A;  1DOQ A;  1ZQZ A;  3GV5 B;  3BZC A;  4TUS A;  5ALG A;  1ZQD A;  3TAN A;  2BCS A;  3PX0 A;  4ECZ A;  2UVU A;  1N62 A;  3PW5 A;  4YMO A;  5J0U A;  5KFE A;  1XO1 A;  1L3U A;  5DBA A;  3WKA A;  9ICB A;  5EE1 A;  5KFW A;  1OXJ A;  4UAS A;  2JZB A;  3QU4 A;  3OHB A;  3N7S C;  3M9N B;  5AM1 A;  3G6Y A;  1F5S A;  5DG7 A;  3RH5 A;  1KN5 A;  2MSN A;  1OW5 A;  1N5W A;  3AM9 A;  2R8J A;  4RU9 A;  2RDI A;  4C0Z A;  2J6U A;  4FBT A;  4KMU A;  2G08 A;  4MFF A;  4Y2Q A;  2WF5 A;  1JRP A;  1TAQ A;  5CB1 A;  3GDX A;  3ZDB A;  2P35 A;  4CGZ A;  9ICE A;  4O3S A;  3O0F A;  3GV7 B;  5AKL A;  1J2N A;  2EAP A;  4F50 A;  1S8O A;  1N61 A;  4O3P A;  1UHU A;  1AQ6 A;  3I76 A;  2JEG A;  8ICM A;  9ICI A;  4E0D A;  4LVS A;  1Z19 A;  1SZP A;  3E0F A;  1HUO A;  1DK3 A;  2YMP A;  5DGA A;  3RR8 A;  4YVZ A;  3M7D A;  2DQN B;  9ICQ A;  1WYG A;  3ICX A;  1SKR A;  5III A;  2HBM A;  2QAR A;  4FS1 A;  3WK5 A;  3KOO A;  9ICK A;  1XO0 A;  4O5K A;  4ECS A;  2ZXH A;  2ZTD A;  1ZD4 A;  2GH1 A;  4NM1 A;  9ICL A;  2FDR A;  3QUB A;  4UQG A;  4ECY A;  1ECW A;  2FPM A;  3FAH A;  1NI3 A;  3S6J A;  2F44 A;  2KD1 A;  1DGS A;  1X9W A;  3E2E A;  4KLM A;  1TE2 A;  1TV9 A;  3AUO A;  8ICP A;  5AI4 A;  3H8W A;  2ZTC A;  4QJF B;  3KZX A;  4PHA A;  8ICJ A;  1DXS A;  5CP2 A;  3MR5 A;  2KKV A;  2BR0 A;  3C2M A;  3RH4 A;  2JH1 A;  5BPC A;  5ALS A;  3RJG A;  3GV8 B;  4IS7 A;  4DL3 A;  1IV8 A;  2ZIW B;  3N28 A;  3EPI A;  9ICR A;  2EDU A;  1V97 A;  3WKC A;  1ZQM A;  3PR5 B;  1TK8 A;  2K60 A;  4RNM A;  2EH9 A;  1BNO A;  4C7Z A;  2NRT A;  3M6Z A;  2XC9 A;  1L7N A;  4UB8 U;  2KZ3 A;  4DL7 A;  4KLE A;  4YR2 A;  4GIB A;  2ZTE A;  1Z3E B;  4I2B A;  4DQP A;  1NKC A;  2AGO A;  3KTQ A;  4OO1 J;  1HEK A;  2KJ9 A;  2ASJ A;  2HVI A;  2ZIV A;  7ICQ A;  4YR0 A;  5KFH A;  4I28 A;  3N7R C;  2LI6 A;  4RPZ A;  2FPL A;  3JPP A;  5DG9 A;  1NNL A;  4KN7 A;  4TUR A;  4DSI A;  3UXO A;  3JPT A;  4IC9 A;  2WF7 A;  4ED1 A;  3SAG A;  4UAZ A;  2R8G A;  3ZI4 A;  2W55 A;  1NK6 A;  2ZIU B;  1U49 A;  2FLN A;  2PI5 A;  4Q8E A;  1L5U A;  4UAY A;  3GU3 A;  5TIS U;  4C4T A;  7ICN A;  2G5I B;  8ICG A;  1MA7 A;  5KFD A;  3JPQ A;  3F2B A;  1D9D A;  2R8I A;  1ZQA A;  1ZQ1 C;  1DGJ A;  1YT3 A;  1ZQW A;  2DL0 A;  2ZIV B;  3HKZ C;  5DG8 A;  4MFC A;  5AHX A;  3N4M B;  2XCA A;  8ICT A;  4KLU A;  5JU5 A;  2YQE A;  3ZDC A;  1PVP A;  2FMP A;  1B4F A;  1BNP A;  1SV4 A;  2RP5 A;  4PH5 A;  2IBK A;  4NL9 C;  2A19 A;  4OD0 A;  3EZ5 A;  4M9G A;  4QZC A;  4MHV A;  1VDV A;  4RUC A;  5ALZ A;  2KN7 A;  4F3O A;  5KFZ A;  3IG8 A;  3Q8R B;  5AKX A;  4DQQ A;  4JV2 A;  3IM1 A;  3QUQ A;  3U26 A;  2YTU A;  5KFB A;  4QWE A;  3WKD A;  3BS7 A;  5KFY A;  5EOZ A;  2KHQ A;  1FEZ A;  1A6S A;  2EZY A;  2EQY A;  4DS5 A;  4MEY A;  4XQ8 A;  3NGD A;  3KFU F;  2H3Q A;  3C21 A;  4YXM A;  1HUZ A;  1TFR A;  4DFD A;  3GIK A;  1TAU A;  5J2E A;  3H7I A;  5IIL A;  2BQU A;  2HOI A;  4M9L A;  1ZD5 A;  5B66 U;  2BQR A;  3C2L A;  7ICI A;  4C8M A;  4F5Q A;  1N48 A;  2KJ8 A;  5KT4 A;  2P6U A;  2VJ5 A;  3PSP A;  4M6W A;  3IV6 A;  5IIJ A;  2F1I A;  2XVT A;  3WK7 A;  3QU5 A;  4M04 A;  3GZF A;  2WF6 A;  1U4B A;  5CR0 A;  4P0Q B;  1IXR A;  1LKY A;  3ONN A;  3PW0 A;  7ICS A;  4DOB A;  2C2E A;  2MU2 A;  4K4G A;  4YP3 A;  4GC7 A;  5L1L A;  2JGA A;  3M8R A;  4QWC A;  3RAX A;  2HW3 A;  1RYU A;  4U7C A;  3RB0 A;  8ICI A;  2HHV A;  4DF4 A;  4I2G A;  4IRD A;  2XY6 A;  1JAL A;  3RJE A;  1UCV A;  3BQ7 A;  3I1Y A;  8ICZ A;  2YMM A;  5CHG A;  3OGU A;  5ALQ A;  2BPC A;  4NM2 A;  4O3M A;  3AU2 A;  4GFJ A;  2DFL A;  2KMD A;  2W43 A;  4OCZ A;  2LHT A;  2D3D A;  2JRZ A;  1Q3V A;  1URJ A;  1SIJ A;  3NUQ A;  3M9M B;  2DWQ A;  4X5V A;  3LWM A;  2R8H A;  4BJQ A;  3OPX A;  4FZN A;  4OJP A;  4UB1 A;  1ZRM A;  4NLK A;  3EYZ A;  3D2Q A;  3ALR A;  2KE7 A;  2OHF A;  3C23 A;  3UMC A;  1D8Y A;  2HHW A;  5IIK A;  2E8N A;  1B0X A;  4ED8 A;  1LB2 B;  3ZDE A;  3K1R B;  1L7O A;  4BXO B;  4EEL A;  5AM4 A;  4CNQ A;  5J2I A;  3L5K A;  2QLT A;  2KFZ A;  5J2D A;  1KLN A;  2BZF A;  2LYH A;  4KN4 A;  1SV0 C;  4ED6 A;  2UVR A;  2AU0 A;  1S0O A;  5J0S A;  2P6R A;  3IG5 A;  5CA7 A;  2NRX A;  8ICA A;  3WK6 A;  4RQ5 A;  3V7L A;  2BGW A;  4O3Q A;  5DQG A;  2PI4 A;  2UVW A;  5DB7 A;  4KLQ A;  4ELU A;  4G3I A;  4ECV A;  3TAR A;  2Y9U A;  2KIV A;  1JX4 A;  2JR5 A;  2H3V A;  4R63 A;  4JV1 A;  5J0X A;  1KTQ A;  4EEK A;  4M6W B;  2ZUB A;  4MF8 A;  3MDC A;  2LYB A;  2Y1J A;  2W9C A;  4PGY A;  4P0P B;  5DDY A;  5AM5 A;  1T7P A;  9ICX A;  4ELT A;  2LKY A;  1ZD2 P;  4DOC A;  1T94 A;  4RQ7 A;  1S77 D;  7ICJ A;  3GFK B;  4CF4 A;  2Q0Z X;  3SAF A;  2LPE A;  1KFS A;  2F76 X;  1ZQN A;  2M0N A;  4YR3 A;  4PZO A;  4US9 A;  1BPD A;  3Q8S B;  5KG5 A;  1RM6 C;  4XA5 A;  1OUQ A;  3NVW A;  3T79 A;  1RYR A;  4PL2 A;  4DEZ A;  1TAM A;  1L3S A;  1WG8 A;  2F8L A;  4Y2R A;  2E1E A;  5J0W A;  5DKW A;  2OEH A;  3EPG A;  2C2D A;  3UQ2 A;  2KSO A;  2BKE A;  4KX5 A;  4YCX A;  8ICX A;  4BUG A;  4IR9 A;  4Z6F A;  3TFR A;  3DV9 A;  5KFA A;  8ICK A;  4LJX A;  3PY8 A;  3H4B A;  1VLB A;  2H5X A;  4TQS A;  1NZP A;  4DWI A;  4I2D A;  4RZR A;  3F2C A;  1KRP A;  4DO9 A;  1XS9 D;  7ICH A;  5AKE A;  4C8K A;  9ICF A;  4KLT A;  4IQW A;  2W7P A;  5HNK A;  2V9W A;  3OJU A;  5KFR A;  1SXE A;  3FC4 A;  1X6J A;  4R8U B;  5KFM A;  3BQ2 A;  2ES6 A;  5AKK A;  4F8R A;  4F4W A;  3RF9 A;  4JWM A;  2FLL A;  3NVV A;  5EE9 A;  2IHN A;  5IIO A;  1SWV A;  4OJ5 A;  5KT2 A;  8ICL A;  1BPE A;  4B9M A;  2YY6 A;  5AI0 A;  2Y0S C;  4AYB F;  3PX6 A;  4QWB A;  8ICW A;  3SQI A;  1ZJN A;  4DFP A;  2W11 A;  1NK0 A;  4BXO A;  3ETR A;  4KLG A;  2G5H B;  2LM1 A;  4Y2V A;  3DEE A;  1TK5 A;  4R8U A;  4RQ1 A;  1SL1 A;  1TKD A;  8ICQ A;  3SMV A;  2L5Y A;  3N97 B;  1KW4 A;  2WB1 C;  2VA3 A;  4P4O A;  8ICN A;  5J2J A;  2YB4 A;  1KL9 A;  2OYY A;  2BCQ A;  1SV0 A;  1RXW A;  3B0X A;  1FFV A;  8ICV A;  3Q8M A;  3CNH A;  1N60 A;  2MUT B;  3B0Y A;  4AP9 A;  1BGX T;  1KKX A;  1A76 A;  3OSP A;  2W03 A;  4US8 A;  3PZP A;  2VA8 A;  2KZZ A;  5GTH U;  3RTV A;  1D8B A;  2PMZ F;  4TUQ A;  5CRX A;  3MGH A;  5KFU A;  5HMM A;  4RT3 A;  4MFA A;  1QTM A;  3HX0 A;  4CDG A;  3AQE A;  3F5E A;  4B9L A;  2H3F A;  4UB6 U;  2H3Z A;  1Z4N A;  3LK9 A;  2R8K A;  4Q43 A;  2ASD A;  2FE9 A;  8ICO A;  1NOM A;  4J9M A;  4EEY A;  3UPQ A;  1BPZ A;  3MGV A;  5KFN A;  3HRD D;  3SR6 A;  2XO7 A;  2PFQ A;  3J81 j;  2FMS A;  1SZH A;  4Y2U A;  4F72 A;  1SKS A;  2PFP A;  3RBE A;  1PZN A;  3THV A;  1ZQG A;  3RB3 A;  3PV8 A;  4FS2 A;  1ZQX A;  3C1Y A;  3V7K A;  1RXV A;  3BDP A;  2KOB A;  4WJ3 B;  2W9A A;  2D6F C;  3NAS A;  1S5L U;  2K8C B;  3UM9 A;  3PR4 A;  3QUC A;  9ICA A;  1Z00 A;  2XGQ A;  3C28 A;  1A0P A;  1X9M A;  3KHG A;  5KFV A;  5HP4 A;  2PFN A;  4RPY A;  3TKA A;  2W9M A;  2KP7 A;  3FM9 A;  8ICU A;  4EBC A;  4FZM A;  1NKE A;  4DSE A;  2P66 A;  4P4M A;  2ZXI A;  1JXL A;  4GC6 A;  4F71 A;  2MA1 A;  1WWV A;  5ALF A;  5ALY A;  3Q8K A;  2ZJ8 A;  5ALK A;  5J2C A;  7ICL A;  2JMG A;  2F1J A;  1ZQK A;  4QNL A;  4FFD A;  3GIM A;  4ICA A;  4QZE A;  5JTI A;  3K75 D;  1Q46 A;  2I5H A;  5L1I A;  7ICF A;  2ZIX A;  4DL6 A;  2K4E A;  4XRH A;  2GWS A;  4DLG A;  1CRX A;  2B21 A;  8ICB A;  3T5K A;  4M0A A;  3RJF A;  2NO5 A;  5AI5 A;  4FBU A;  5AI6 A;  4Z6E A;  5AIB A;  1ZQR A;  5J0Y A;  4NLN A;  2F77 X;  4BX9 C;  4IR1 A;  2KKP A;  3MR6 A;  2WHE A;  5J2A A;  1N2X A;  3NRZ A;  1ZQI A;  3JPN A;  4NLC A;  2JHD A;  1RPL A;  4UB3 A;  2ISP A;  1XC9 A;  3TAD A;  1O03 A;  2BCU A;  3ISD A;  1JI7 A;  4NWI A;  1BVS A;  5KG1 A;  2ZG6 A;  4YXJ A;  4M9J A;  5ALO A;  4CRX A;  3ZD8 A;  1QSY A;  2ISO A;  2Y0S F;  4UBC A;  4CCH A;  5CWR A;  2DF4 B;  3D6J A;  2FI1 A;  5ALX A;  3SZ2 A;  3QYP A;  1KFT A;  5J2F A;  1L3T A;  3RBD A;  3H40 A;  3RJJ A;  2WFA A;  3CYM A;  5TZV A;  3OTQ A;  2PXI A;  2W8K A;  3FDS A;  1N56 A;  3C1Z A;  2AQ4 A;  4RQM A;  5A0L A;  3LVV A;  2W9B B;  5AI9 A;  4F4Z A;  4ZH4 A;  5DLF A;  1QLN A;  5ALN A;  5KFS A;  4ED2 A;  5E79 U;  2Q4T A;  3SD7 A;  2EAN A;  4RNN A;  3MGI A;  4UAU A;  3H4D A;  2PMZ C;  5J2B A;  5EWF A;  2E3T A;  5BOL A;  3ED5 A;  4LZD A;  4OJL A;  5AK4 A;  4PHP A;  4KMO B;  2IOH A;  5DBC A;  5KG0 A;  7ICM A;  3NRW A;  3AQF A;  4M9N A;  4YD2 A;  2BHN A;  3PSI A;  2PKE A;  2ZIU A;  3RFA A;  2QB0 A;  1L8O A;  9ICC A;  2HHU A;  2HHT A;  1B43 A;  4O5E A;  5CJ7 A;  1IM4 A;  2KVS A;  4UB4 A;  1NK9 A;  3Q8L A;  7ICO A;  1JXE A;  3RJK A;  1Y88 A;  3MAB A;  2W9B A;  3SYZ A;  5DGB A;  4HYK A;  4C4S A;  1L3V A;  5KFT A;  3HWT A;  4RQN A;  9ICG A;  1RZT A;  2CRX A;  1D8L A;  3FYH A;  3QU2 A;  2LYA A;  1ZQF A;  3HJE A;  2AQ0 A;  7ICV A;  4QZA A;  2CPR A;  4DL4 A;  2I9G A;  3SV3 A;  4USA A;  3E58 A;  3F5A A;  4Y2T A;  4I2C A;  7ICT A;  3RR7 A;  2AGQ A;  1PK3 A;  4DL5 A;  1RYS A;  1MQ2 A;  5F9L A;  4QW8 A;  2ALZ A;  2HVH A;  4QWA A;  1NZB A;  2JEI A;  5ALI A;  3CP8 A;  4J03 A;  3HKZ F;  2RLT A;  4I2F A;  2WF8 A;  4F92 B;  2YX8 A;  4Z6D A;  1JN3 A;  5ALH A;  5J2G A;  1RQN A;  3BQ0 A;  1S10 A;  1KFD A;  1Z1B A;  3IHQ B;  3TQ1 A;  5JUM A;  4ECT A;  2IMW P;  4ECX A;  4K4I A;  3MR3 A;  5KG6 A;  3TAD C;  3QEA Z;  3TAQ A;  1RQL A;  5AM2 A;  4EYH B;  2W54 A;  2V4R A;  1LKY B;  2C28 A;  3TFS A;  1S76 D;  3NVY A;  3TAP A;  1ZQP A;  4I2I A;  2MUT A;  1C7Y A;  3IN5 A;  1WCL A;  5DBB A;  3PW7 A;  1ZQV A;  4QIW C;  2FJ6 A;  1QQ5 A;  1COO A;  5J0R A;  3BQ1 A;  3H0L B;  3LWL A;  4DQI A;  2RDJ A;  5ALV A;  5H2F U;  2HBJ A;  1X66 A;  2KHV A;  5EE3 A;  8ICF A;  5KG3 A;  2LBO A;  4DS4 A;  1TK0 A;  2UVV A;  1NK5 A;  2W8L A;  4RQ8 A;  5KT7 A;  5BOM A;  4RPX A;  2W3R A;  2AH5 A;  4Q8F A;  2A1J A;  2ZIW A;  4ED7 A;  2NYV A;  2K4P A;  4KLH A;  2BDU A;  5HML A;  5IIM A;  4M47 A;  4OJ6 A;  5G5G A;  4NY8 A;  2HHS A;  9ICN A;  3GIL A;  3MBY A;  5J29 A;  1Z4O A;  2RHF A;  1IG6 A;  3BS5 A;  4P4P A;  9ICW A;  3PNC A;  5C5J A;  4UB2 A;  1ZYQ A;  3QXG A;  5DLG A;  2YN4 A;  4M9H A;  4DQS A;  4NLG A;  2OXO A;  1F44 A;  1T4G A;  8ICR A;  3HPO A;  4AYB C;  3PVX A;  5GTI U;  3ISC A;  1NJW A;  2JZB B;  1ZXI A;  4NXZ A;  1SKW A;  2W7O A;  2F1H A;  2QB1 A;  5KFF A;  5G5H A;  2MRL A;  3HP6 A;  5ALM A;  5D46 A;  3PST A;  2KNJ A;  3JPO A;  3Q8P B;  2KEY A;  4EX7 A;  2I6X A;  2ZJ5 A;  1L7P A;  1L6N A;  3RB6 A;  5ALR A;  4F5P A;  2NRV A;  1QCK A;  1UA0 A;  4B9U A;  5DQH A;  3MFI A;  4Y2J A;  3BQT A;  1T8E A;  1Z00 B;  4I2A A;  5HR7 A;  2KIC A;  5F3X B;  4IRK A;  3RJI A;  5AK5 A;  3L4P A;  4C4R A;  3AMZ A;  4I29 A;  1SL2 A;  2AXT U;  4KLF A;  1ZQJ A;  1QH9 A;  2Y9T A;  9ICV A;  2D8C A;  4J9O A;  1X9S A;  4DQR A;  5C0Y A;  1QSS A;  1K1S A;  4JUZ A;  2XI9 A;  5AIC A;  3GIJ A;  7ICP A;  1UT5 A;  4UAR A;  4R64 A;  3D2N A;  3WK9 A;  4B9S A;  3SI8 A;  4DF8 A;  4P0P A;  1COK A;  2GLE A;  1U48 A;  2Y1I A;  1MN8 A;  1SB3 C;  2YML A;  1BPB A;  5KG4 A;  1S97 A;  2WB1 F;  3RH6 A;  1UT8 A;  5AKH A;  3WKE A;  3WU2 U;  4P0Q A;  3SV4 A;  2BCV A;  1XSP A;  5F9N A;  2G07 A;  1ZRN A;  3QEB Z;  4RQ0 A;  3H0M B;  9ICH A;  4EX6 A;  4PGQ A;  3SEN A;  1YZ6 A;  2KV2 A;  3QNM A;  3NTU A;  4QW9 A;  4PHE A;  4JWN A;  3VCB A;  5KFI A;  3WK8 A;  4KLS A;  2DBY A;  1X42 A;  4F5R A;  3M8S A;  3NS1 A;  1PK1 B;  4Z6C A;  3H8J A;  3UMG A;  2HHQ A;  2KFN A;  4F5O A;  2HCF A;  1SL0 A;  4P2H A;  3HIL A;  2KK0 A;  1U47 A;  2B6G A;  4DSJ A;  4DSL A;  4FZL A;  2K89 A;  5J0O A;  3V72 A;  2HHX A;  5DB8 A;  1RG6 A;  4J9R A;  1ZET A;  3MDA A;  3IRU A;  9ICT A;  1SWW A;  4IL6 U;  3KD3 A;  5KL8 B;  4R65 A;  5J0T A;  2KVC A;  3GII A;  1DRG A;  1PK1 A;  4JV0 A;  5ALD A;  4EEN A;  5D4B A;  4I2H A;  3QZ8 A;  3AU6 A;  1YZ7 A;  4B9V A;  3ZDA A;  4ECR A;  1CI4 A;  2M9N A;  3IDW A;  3G6X A;  4NLB A;  4EZ6 A;  1ZQL A;  5B5E U;  3V7J A;  4GXJ A;  4YQW A;  4JK1 A;  1WWU A;  1P7D A;  3V6K A;  3WK4 A;  5DDM A;  2WAQ C;  1T3N A;  4Q44 A;  2EAO A;  2GOL A;  1QQ6 A;  2KJ5 A;  4UW9 A;  2HOF A;  3KKA C;  2I1Q A;  3H0R B;  3QU9 A;  5J2K A;  5AM0 A;  4J9P A;  5JRT A;  3M1Y A;  2ZIX B;  4PGX A;  1XWL A;  1IIP A;  5AKJ A;  2ODG A;  3BZK A;  1D9F A;  1UA1 A;  3A0H U;  4QZ8 A;  1ZQE A;  3V6H A;  1PVR A;  2F8K A;  2E5S A;  5AI8 A;  1FIQ A;  4KLI A;  3K1Z A;  2VKQ A;  2JEF A;  2H3I A;  4DFM A;  4UAW A;  2XGP A;  2EZZ A;  3CW2 C;  5KFO A;  2K4I A;  9ICP A;  4BDP A;  2ZUD A;  4CE6 A;  2BPF A;  2HBL A;  3NVZ A;  5DQI A;  2AJQ A;  3JPS A;  3AL0 B;  4Y2P A;  5KFX A;  4IRC A;  1WCN A;  4PJ0 U;  3A0B U;  3LDA A;  2BPG A;  3ETL A;  4MF2 A;  4QZG A;  5AIA A;  5KTQ A;  3C29 A;  5EWE A;  4I27 A;  3LVW A;  8ICE A;  3UXP A;  8ICY A;  8ICH A;  3BJY A;  3C5F A;  2Z7J A;  2LMR A;  4IQV A;  1TVA A;  4ECW A;  2XID A;  3RRG A;  4UBB A;  3UQ0 A;  2OM6 A;  4F2S A;  3M9O B;  4RQ3 A;  9ICJ A;  3TAC B;  5KFL A;  2QAR B;  5KNI A;  1SGG A;  1NK4 A;  4KLO A;  3L3F X;  4A8E A;  5KFP A;  4O9M A;  4RNO A;  2BDP A;  1XSN A;  2C22 A;  4F4Y A;  2WF9 A;  1K1Q A;  3PML A;  4BWJ A;  5T14 A;  5L1J A;  4TQR A;  3GQC A;  5ALP A;  4UAT A;  4FO6 A;  4DL2 A;  4UAV A;  2XY5 A;  2DGZ A;  1JMS A;  4C80 A;  1B22 A;  2IA6 A;  1N5X A;  1V38 A;  3T3F A;  4KX3 A;  5KG7 A;  4LZG A;  4RQ2 A;  4O3N A;  1S0V A;  4DFJ A;  5ALL A;  2E8P A;  2G09 A;  1KQQ A;  4YG2 A;  2A1A A;  2OWO A;  2JV3 A;  4PZN A;  4ECU A;  3T5H A;  1T3Q A;  2OH2 A;  3D2S A;  3Q8Q B;  2MAX A;  4NLZ A;  2E8M A;  4GXK A;  4Y2S A;  5IIN A;  3H8S A;  3T5J A;  2YMQ A;  5DB6 A;  4O0I A;  3QZ7 A;  3G6V A;  4RQ6 A;  1N63 A;  4EYI B;  4F93 B;  4F2R A;  2XY7 A;  1ZQH A;  2G06 A;  1XU4 A;  4QZI A;  3PW2 A;  5KL1 B;  3RB4 A;  5KT6 A;  2V4Q A;  4J9K A;  2K8A A;  2ZUC A;  4DSF A;  1KSP A;  2EAM A;  2ZJA A;  1V9P A;  1MSW D;  2IOF A;  4YMN A;  4YD1 A;  3HT3 A;  4QZB A;  4ED3 A;  3RJH A;  3RRH A;  4DLE A;  4DFK A;  4O3R A;  1ZQS A;  1ED1 A;  5KFQ A;  2HI0 A;  4QZH A;  3F53 A;  4KLJ A;  4ECQ A;  2F2A B;  2KIW A;  3MFH A;  4EBD A;  5AK3 A;  2BCR A;  4EBE A;  4FE3 A;  5KT5 A;  3C5G A;  3JPR A;  4NJ8 A;  3MC1 A;  5ALT A;  4U6P A;  4F5N A;  5ALW A;  4J9Q A;  2FLP A;  1M6Y A;  3TI0 A;  3PX4 A;  1ZD3 A;  4B9N A;  2WTF A;  4F4X A;  3F2D A;  2HOQ A;  2W9C B;  3KHH A;  2AGP A;  2XCP A;  4G9B A;  5AK6 A;  1U9L A;  2EZX A;  1PUZ A;  2JXJ A;  3AN1 A;  1PVQ A;  3BS5 B;  9ICO A;  1KBU A;  3ZD9 A;  1SXD A;  5KFK A;  3QUT A;  3QU7 A;  4EZ9 A;  3N7P D;  5KAF U;  4B9T A;  2K4H A;  1DK2 A;  2VA2 A;  3PO5 A;  4Y2Y A;  2A1J B;  5ALJ A;  3R9K A;  3MR2 A;  2NRW A;  1F0M A;  3ZDD A;  4IQU A;  5ALE A;  4BWM A;  4YFK A;  1BPY A;  4J9S A;  2VIX A;  4F4K A;  5ALU A;  9ICU A;  1X2I A;  3EW9 A;  4C8N A;  4MEX A;  1S0M A;  5KG2 A;  4M2Y A;  1Q3U A;  4J9N A;  2K8B B;  5DB9 A;  1ZQY A;  2NRZ A;  3KHL A;  2GO7 A;  3SEI A;  1S9F A;  3ORY A;  1QQ7 A;  8ICC A;  4NL9 A;  2IHM A;  1LV5 A;  1ZQU A;  1CEZ A;  4DOA A;  4J9L A;  4TUP A;  5HR6 A;  2N1R A;  4OJO A;  4QZD A;  1NJY A;  1MC8 A;  2FMQ A;  5KT3 A;  5J0P A;  2HBK A;  4O5C A;  2E1F A;  2HMX A;  5AKZ A;  1FFU A;  3KBB A;  3WKB A;  1WUD A;  4HAI A;  1U45 A;  4R66 A;  2DKZ A;  4IQT A;  4PL1 A;  3CRX A;  2ASL A;  2JH7 A;  3LYS A;  2AHO B;  3C2K A;  2VJ4 A;  2RQ5 A;  1H38 A;  4BGD A;  5J8Y C;  1ZQB A;  5KFG A;  5D49 A;  3OHA A;  3PSF A;  5J2H A; 
#chains in the Genus database with same CATH homology
 1Z1V A;  3K1R B;  1PK1 B;  3H8M A;  2QB0 A;  2E8M A;  3HIL A;  1X66 A;  3BS5 B;  1SV0 C;  2B6G A;  3TAD A;  1SXD A;  1RG6 A;  2FE9 A;  2KSO B;  2EAP A;  5F3X B;  1JI7 A;  1V85 A;  1PK1 A;  2LMR A;  2Y9T A;  2E8O A;  2Y9U A;  1SXE A;  4RQN A;  1F0M A;  2QKQ A;  2KIV A;  1LKY A;  2D8C A;  2ES6 A;  2K4P A;  1X9X A;  2QB0 B;  2QAR A;  3TAC B;  2EAM A;  2F3N A;  2QAR B;  5KNI A;  1SGG A;  5L1M A;  3SEI A;  3IDW A;  4NL9 A;  3BS5 A;  2DKX A;  1X40 A;  2DL0 A;  2LPE A;  1UCV A;  1PK3 A;  2ESE A;  1WWU A;  1UQV A;  2KG5 A;  3BQ7 A;  4RQM A;  1COK A;  2F44 A;  2GLE A;  4PZO A;  5JU5 A;  2EAO A;  5J8Y A;  1B4F A;  1SV4 A;  2KMD A;  1WWV A;  2L5Y A;  4NL9 C;  1KW4 A;  3KKA C;  2D3D A;  3KKA A;  1DXS A;  4MHV A;  2EAN A;  5JRT A;  2DKZ A;  5JTI A;  2KSO A;  4NJ8 A;  1SV0 A;  1OXJ A;  1V38 A;  2KE7 A;  4IS7 A;  3SEN A;  2YTU A;  3BS7 A;  3TAD C;  2E8P A;  2F8K A;  2QB1 A;  2E8N A;  5J8Y C;  1OW5 A;  1LKY B;  1B0X A;  2K60 A;  2JV3 A;  4PZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...