2LPEA

Solution nmr structure of the ksr1 ca1-ca1a domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
GHMDGGAGAAVSRALQQCGQLQKLIDISIGSLRGLRTKCSVSNDLTQQEIRTLEAKLVKYICKQQQSKLSVTPSDRTAELNSYPRFSDWLYIFNVRPEVVQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLRKVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Kinase suppressor of Ras 1
publication title A CC-SAM, for Coiled Coil Sterile a Motif, Domain Targets the Scaffold KSR-1 to Specific Sites in the Plasma Membrane
rcsb
source organism Mus musculus
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13543 SAM_KSR1 SAM like domain present in kinase suppressor RAS 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lpeA02
2ES6A 3TADC 2E8NA 1X9XA 2KE7A 2KSOB 2KMDA 4MHVA 5JU5A 1UQVA 4NL9C 4PZOA 1SV4A 2D3DA 1UCVA 1X66A 2QARB 2Y9TA 2KG5A 2GLEA 2E8PA 1X40A 1V85A 3SENA 3H8MA 2KSOA 4IS7A 5KNIA 2DKZA 2QB0B 4PZNA 3HILA 5J8YA 4RQNA 1B4FA 1LKYB 2EAOA 5L1MA 1DXSA 5JRTA 3IDWA 2LPEA 1KW4A 2DKXA 2QARA 5F3XB 1SGGA 2K60A 1B0XA 1Z1VA 2F44A 3KKAA 2EAMA 1SXEA 1PK3A 2QB0A 3K1RB 1WWVA 1PK1B 2E8MA 2F3NA 5J8YC 2L5YA 1SXDA 2FE9A 2Y9UA 1SV0A 2QB1A 2B6GA 3BQ7A 3SEIA 5JTIA 1WWUA 1COKA 3BS7A 3TACB 4RQMA 4NJ8A 2LMRA 1F0MA 3BS5B 2EANA 3KKAC 2QKQA 3TADA 2YTUA 1OXJA 2DL0A 2KIVA 1PK1A 2F8KA 2D8CA 1RG6A 2K4PA 2EAPA 4NL9A 1SV0C 1LKYA 1V38A 2E8OA 1JI7A 2JV3A 2ESEA 1OW5A 3BS5A
chains in the Genus database with same CATH superfamily
2AHOB 1L3VA 2BQUA 3AEVA 2UVVA 4GLXA 2MA1A 1X9XA 1ZJNA 5KFGA 1HUOA 1NK6A 3RR8A 2RP5A 1NZBA 4KLEA 3SR6A 2DPJA 2WF6A 5ALWA 2OCEA 4DL2A 3MBYA 5J0XA 1S0MA 3PSPA 4KX3A 4F93B 2RDJA 1EXNA 5HNKA 2M0NA 4RT3A 4RQ4A 1N48A 2HBJA 2R8HA 4I2HA 1B4FA 3GV7B 4ECYA 2KKVA 4RQ6A 3MR2A 4K4IA 1B0XA 5CP2A 9ICLA 2PI4A 1S10A 3IV6A 5DG9A 1ZQGA 4AYBF 3GILA 2DWQA 4DOCA 3SAGA 3QX7A 3SAHA 4TQSA 2WHEA 3QZ8A 3SZ2A 3M8SA 5FP0A 3PV8A 2PI5A 3UM9A 5J2KA 2LHTA 4B9UA 5ALKA 5ALPA 4F2SA 8ICFA 1C20A 1WWUA 5KFTA 4QW9A 2YB1A 1SB3C 2Q0ZX 1O08A 2HI0A 2UVRA 5ALQA 1RYUA 4UAYA 1DOQA 2QKQA 3PX4A 4F4ZA 4EX6A 3IM1A 2DL0A 1S0OA 1SIJA 2H3IA 1PZNA 3CRXA 1NI3A 2J6TA 4ED8A 1DGSA 1HIWA 7ICUA 3FAHA 3I76A 1SKWA 4KLOA 3MR5A 2PMZC 3C21A 2ZUBA 2KZ3A 3TADC 2YMPA 2IBKA 4DOAA 5EWFA 2VANA 1ZQVA 1IIPA 4I2EA 4KLQA 5AK4A 3UMBA 4UBCA 4DQSA 4GC7A 1N5WA 9ICGA 1JX4A 5KG5A 9ICNA 3SV3A 4CCHA 2P6RA 2VJ4A 2GLEA 2NRXA 5J0SA 1KSPA 3AU6A 1X40A 3H0MB 2LKYA 4P0PB 1S5LU 3EPGA 1HEKA 4Z6FA 4J9QA 2JHDA 4EELA 1L7OA 4QWAA 4RPZA 5F3XB 5AHXA 1DK2A 2MUTA 3V6JA 1ZQDA 1WG8A 4CNQA 4E0DA 2KV2A 4QZEA 5J2AA 2HOFA 1Z1VA 2W54A 5AKJA 2HMXA 2BCSA 2K8CB 1KTQA 3UXPA 2QB0A 4PGXA 1IM4A 1ZQYA 2HHVA 5J8YC 3AU2A 1Z4OA 3PMNA 2PXIA 4Y2XA 3QUQA 2WF8A 4WJ3B 4EZ9A 3SEIA 2YX8A 5D46A 2F2AB 5KFEA 2CPRA 3GIIA 2AGQA 4Q8EA 3IP4B 3QE9Y 3JPOA 1PK1A 4XRHA 1XC9A 4QNLA 4LZDA 5AKYA 1LKYA 4I2JA 1V38A 2KJ9A 5EE1A 1JI7A 4BJQA 3U26A 3UPQA 3ONNA 1BNOA 2W9MA 4C4TA 5KFCA 3S6JA 1V97A 4YR3A 4O3RA 1ZQOA 4MFFA 4Q8FA 2I6XA 1CUKA 3FYHA 2I1QA 3RRHA 1BPYA 3Q8LA 1ZRNA 2RDIA 1L7PA 3RF9A 1ZQIA 5KTQA 1SL0A 4F5RA 4NM1A 4NLNA 2CRXA 5KFMA 2K4IA 4DF4A 4DQPA 1X42A 3DDHA 5KFNA 3C1ZA 2KJ8A 3KZIU 4EBCA 2LPEA 3AM9A 2QARA 4OJLA 5DQHA 3MGHA 2JH1A 2W3RA 4KTQA 2ZXHA 3PO4A 3KKAA 4PL1A 3BQ1A 9ICKA 3NVZA 9ICSA 2EAMA 3AUOA 4GXJA 4GXKA 1NK8A 4C8MA 4K4GA 2BQRA 8ICOA 5J0OA 4F8RA 4DL7A 1MA7A 1SV0A 3Q8PB 2ASJA 3F2CA 4JWMA 1KFSA 2NRVA 1COKA 2JEFA 5DLGA 5AI6A 2W11A 4BXOA 5ALYA 2JEJA 1ZQTA 4BUGA 2K8BB 1OXJA 4PPXA 4QWEA 2VKQA 2JZBB 2HOIA 5J2HA 4OJ6A 2KIVA 4OJPA 2KFNA 2RQ5A 3QYPA 2D8CA 3PMLA 4ELTA 1SL1A 9ICWA 3F5EA 4NLCA 4O3SA 4IQTA 1N56A 1B43A 3T5JA 4DQQA 9ICJA 2KN7A 1SZHA 2XO7A 5AM3A 1MQ3A 1TFRA 3KD3A 5KG1A 3WKAA 2W8KA 3HW8A 5J0QA 2ES6A 4KLJA 5G5GA 4PHEA 2KE7A 1PVQA 1XU4A 4EYHB 2ZIWB 1JROA 3TQ1A 2F1HA 4B9VA 4CE6A 5J0WA 4DEZA 8ICLA 2MUTB 5KFPA 2XCPA 4IQUA 1TK5A 1MC8A 4BWJA 1N5XA 1V85A 2A1JA 3RJJA 4I27A 2LM4A 1WUDA 2QB0B 3F5AA 5AIBA 2FPMA 5J0YA 3HILA 1H38A 1ZQKA 3PNCA 1XWLA 4UATA 3JPSA 5DBBA 2BQ3A 8ICPA 1NK4A 4DFDA 2MSNA 4I2IA 1ZQWA 1XO1A 5BOLA 4NLGA 3PO5A 3V6HA 3PSFA 4CRXA 1KBUA 1PVRA 2K8AA 4DSJA 3Q8MA 5F9NA 1PK1B 4QZ9A 4NLKA 4NWIA 2JGAA 3RBEA 3HT3A 3PW7A 5G5HA 5GTHU 5ALLA 4RZRA 2KVSA 5KFQA 2LM1A 4C4RA 4YXMA 5AM1A 3PX6A 2WB1C 2XVTA 4Z6EA 5ALOA 9ICTA 2V4RA 1ZQNA 4F2RA 3BQ0A 2OXOA 2ZTCA 4US9A 4C8NA 3BDPA 4DSKA 4C0ZA 3RBDA 5DB8A 1UPHA 3IHQB 4YD1A 3N28A 3VC8A 1Z19A 8ICHA 4IQVA 4EBDA 3HKZF 2KNJA 2OHFA 2Y0SC 1ECWA 2KIWA 4NM2A 1X66A 2KZZA 2QARB 4Y2QA 2G5HB 2KG5A 3D2SA 5KT2A 5HHHA 2E8PA 1LVHA 1TV9A 1K1SA 4IS7A 3LWLA 4JK1A 4KLUA 3TAPA 2ZJ8A 2R8GA 2VIXA 3M8RA 1A0PA 3HX0A 3V7KA 5KFOA 3WKCA 4QIWF 2ZIUA 4Y2VA 2AGOA 1ZD4A 1Z4NA 4CF4A 5AKKA 4BXOB 1QQ7A 4FO6A 4RQ0A 4PHDA 2EZYA 9ICRA 3N7RC 2VJ5A 5IIKA 2VA8A 4F4YA 5DGAA 2L5YA 2K89A 4FS1A 3PX0A 1FFUA 1ZJMA 1S97A 4RNOA 3PVXA 2BHNA 2W55A 2OYYA 2E1EA 3KKAC 3MDAA 1U48A 4YVZA 4P0PA 3KHHA 2FLPA 1JXLA 4GXIA 3H4BA 2K4PA 2JXJA 4NL9A 1SV0C 1ZOLA 2ZTDA 4B9TA 4ECQA 4JV0A 4LJXA 4UARA 5KFUA 4J9PA 3M9OB 7ICEA 4J9OA 5F9LA 3CYMA 3PW4A 4RQ8A 1UA0A 3EW9A 1ZQ1C 4J9MA 5J2JA 1NK9A 1V9PA 4ED2A 4FZNA 2FPLA 4Y2JA 3ZDAA 1KDHA 2ASLA 3GIKA 2D3DA 2MRLA 4F50A 4KN7A 2DBYA 4QZ8A 1ZQHA 3ETRA 1L3SA 1ZQEA 2XICA 3H7IA 1BPZA 2GWSA 1AQ6A 3ORYA 4ECUA 5AI5A 3ETLA 4OCZA 1JN3A 2FLLA 5L1MA 2B0CA 2F77X 2JMGA 2H3FA 3OGUA 2K60A 2KHQA 5ALTA 3NASA 3B9JA 1FEZA 1KKXA 2Y1IA 4US8A 1ZD5A 5AKGA 4YXJA 7ICNA 2EZXA 4I2AA 4BX9C 4IRCA 5ALEA 3RJGA 1XSNA 2Y9UA 1COOA 2W9BB 4GIBA 2KEYA 1D8BA 5KT7A 4RQMA 3A0HU 1S9FA 5IINA 4O5CA 4TUQA 3WK5A 1KQQA 3K75D 9ICOA 2OEHA 1CRXA 4QWBA 1P7DA 4F72A 1JALA 3ZDCA 1L3TA 1A6SA 5DB6A 3SQIA 2KJ5A 1UT8A 8ICIA 3A0BU 5ALMA 3C5GA 3QU5A 4ELUA 3D6JA 2ATLA 4UAUA 3C5FA 4FS2A 3ISCA 3H0LB 3RB0A 1VDVA 2ZIUB 5EE3A 4KLTA 2HSZA 1D8YA 3SD7A 4HYKA 4R8UA 4JMUA 1NKCA 3G6YA 2AU0A 2JZBA 1T7PA 4RQ5A 4MFCA 4NLBA 4O3OA 3QXGA 4RNMA 4QZHA 2EAOA 4RQ7A 1KW4A 1J97A 4IL6U 3L4PA 1NJWA 1NZPA 3OPXA 3GU3A 3RR7A 2BCRA 4Y2SA 3MR6A 2PFQA 3GIJA 2UVWA 2ZIWA 1RDFA 3RAQA 5BPCA 7ICPA 5AK6A 3F2DA 2HVIA 4B6JA 4F5OA 4TUSA 4I28A 1T94A 4YMOA 2AQ0A 1KFTA 7ICFA 4C7YA 5AKXA 1BPXA 2FMPA 5KFXA 4J9LA 3AQFA 2FLNA 4EBEA 2AH5A 5CEHA 5AK3A 2F8KA 2D6FC 5GTIU 2NRTA 2EAPA 1L6NA 3H8JA 3O0FA 1ZQQA 4ELVA 4M9JA 3GV8B 5AICA 5AKHA 1BVSA 4IQWA 1KRPA 4I2GA 1NKBA 3PSTA 2AXTU 2YY6A 3NVWA 4BDPA 1LB2B 3B0XA 2ZIVB 3Q8SB 1BPEA 1NK5A 4B9LA 1SL2A 5KAFU 3SMVA 4NL9C 3AMZA 2ZUCA 1O03A 2NRZA 2DUYA 4DO9A 5J0RA 4QZFA 3BQ2A 5H2FU 5KG0A 4YR2A 4P0QB 4F71A 1ZD3A 1AROP 2ISOA 2HDOA 1SWVA 4DLEA 3ISDA 2P35A 2JR5A 2F1IA 5HMMA 4DSLA 2VA2A 1S0NA 3F53A 1RZTA 1WCLA 4XQ8A 2AQ4A 2A19A 4O9MA 1L8OA 2F44A 4YN4A 4PHAA 4Z6DA 8ICMA 5KT4A 1ED1A 5L1LA 1PK3A 4Y2PA 2J6UA 2W3SA 1K1QA 2H5XA 2BPCA 4MF8A 5JTIA 4EYIB 4UB6U 4QZDA 5ALGA 3OJSA 3ALRA 2P66A 4IC9A 3RTVA 1SKSA 1FO4A 3WU2U 2XC9A 3H8WA 3OTQA 2XI9A 5AM4A 2F8LA 4OO1J 2XCAA 1RG6A 8ICVA 5KFYA 3WKDA 5AI8A 8ICYA 4J03A 4RPYA 4UBBA 3TI0A 1JMSA 5ALRA 3NGDA 3HP6A 4CF3A 4K4HA 1Q3UA 3QUCA 4PH5A 3N7SC 5ALSA 3BS5A 1K5OA 4F5PA 2V9WA 5KG6A 4M9GA 4R8UB 4Q43A 2DF4B 4ECRA 5ALZA 5J2DA 2YN4A 3NUQA 4F5NA 4ACOA 3T5LA 1UQVA 4M47A 4FE3A 4YR0A 2WTFA 3GV5B 4YP3A 3RH5A 1XS9D 4I2BA 1VLBA 1UCVA 9ICQA 2XGPA 3SI8A 3V72A 5KFRA 4O5KA 1YZ6A 2W9CB 5J0PA 1ZQAA 4DFMA 3SENA 4KITB 5L1KA 2KSOA 2ZTEA 5KAIU 2NO4A 3RAXA 2IOFK 1PVPA 2MAXA 4DSEA 1TVAA 4USAA 4EEYA 4OJ5A 5CR0A 3JPRA 5KT3A 2Z7JA 4I29A 2DKXA 2W7PA 4JV1A 1SGGA 4KN4A 4J9SA 2RHFA 8ICSA 1MQ2A 3PW0A 3RRGA 5C5JA 5DDYA 2F76X 3RJIA 4PGQA 1ZQFA 2E8MA 3LWMA 3D2NA 4JV2A 1SXDA 2ALZA 3OSPA 1ZQLA 3BS7A 3MFHA 7ICTA 4F4XA 1BPBA 4Y2RA 2JEIA 1TK8A 1ZXIA 4Y2UA 2I9GA 1IV8A 3T5HA 4I2CA 1Q3VA 3ZDDA 4I2FA 1N61A 4F4WA 3TFRA 1D8LA 4R65A 3JPNA 4M04A 1YT3A 5KT5A 5HHIA 2C22A 4RQ3A 1RPLA 3V6KA 1M6YA 3QU2A 2ZXIA 1Y88A 2OM6A 5AKEA 3R9KA 3M1YA 2HBMA 2HBLA 1ZQXA 2Y0SF 1ZYQA 5KFBA 4NLZA 2HOQA 3AQEA 4P4MA 4M0AA 5AI0A 5AKZA 3TFSA 4IR1A 2E8NA 4C8LA 5ALXA 3KBBA 5KFJA 4PL2A 3H0RB 3WKBA 4M9NA 1X6JA 2W9BA 3RJKA 3OSNA 2Y9TA 4DCCA 9ICAA 1ZETA 2BR0A 7ICOA 3NRWA 4RNNA 4IRDA 3BQTA 5J2EA 3QEBZ 3PZPA 7ICRA 4PZNA 4C8OA 1T3QA 2RRDA 4CF5A 4DL4A 4KLMA 2KHVA 1XSLA 4KX5A 4ED7A 4F3OA 9ICUA 4RPXA 4PJ0U 2WAQF 2FJ6A 3I28A 1UHUA 5ALUA 4DS4A 1F44A 5CB1A 4KLFA 4QWCA 3H8SA 4JB3A 2BCQA 4UB1A 2F3NA 4KLGA 5CHGA 3RJHA 1QQ5A 3M7DA 3EYZA 1F5SA 2K4EA 5KFVA 2KOBA 2B21A 8ICWA 2IMWP 4OJOA 3TACB 5EWGA 2BKEA 1WCNA 3BZKA 9ICHA 4Z6CA 4PHPA 1U47A 2WF9A 4EEKA 4RUAA 3BS5B 2BCVA 3N4MB 3LDAA 2LI6A 4UB4A 3QEAZ 2ZJAA 2C28A 2HBKA 4QJFB 1NJYA 3KHRA 1J2NA 2FDRA 4U6PA 1Z00A 4LZGA 2BGWA 2XY7A 5ALIA 2RLTA 9ICCA 3HKZC 8ICKA 2G07A 5KFAA 2KSOB 2KMDA 2C2RA 1LV5A 4ZH4A 2FMQA 2IHNA 3SAFA 2W03A 4BWMA 3AN1A 1SV4A 4O3QA 4YMMA 2NRWA 3RB3A 4Y2YA 2P6UA 4RQ1A 5AM2A 4R63A 4QIWC 3K1ZA 2DKZA 2WFAA 2EH9A 3WK4A 2GH1A 3GDXA 4YQWA 4F5QA 1U9LA 3UMCA 3VCBA 4RU9A 5KG2A 4DL5A 5KL8B 3E0FA 3MDCA 5J2IA 5AI4A 2DQNB 1NOMA 4DL6A 2IHMA 2ZG6A 5HMLA 4O0IA 1X9WA 3WK8A 2CN1A 5DKWA 5ALFA 3IG8A 2ZIVA 2G0AA 2V4QA 5KFIA 1QTMA 4AP9A 2AGPA 5J2BA 4UB5A 4J9RA 3LVWA 4DFPA 1KFDA 3C23A 3LYSA 2DFLA 3M6ZA 2XGQA 3RB4A 1U49A 5EWEA 1UT5A 4P0QA 5KFFA 3M9NB 9ICBA 1BGXT 5D49A 5ALDA 8ICCA 5ALVA 3C29A 2HHXA 3HRDD 5JUMA 1QCKA 2YQEA 1ZQBA 2A3VA 1TAUA 2J6SA 3BZCA 3SV4A 4M6WA 1MSWD 1QQ6A 4UAVA 4RQ2A 1J2MA 3E2EA 3J81j 3MABA 3DV9A 3SYZA 2PMZF 4B9MA 3JPPA 2HHTA 2ODGA 3UMGA 5J0TA 1N2XA 3CNHA 4KMOB 8ICAA 3I1YA 4KLIA 2EZZA 4YD2A 3EPIA 3QUTA 2FPKA 3G6XA 1RXVA 1L7NA 4R64A 1X2IA 1C7YA 2OH2A 4BGDA 4KLLA 3GIMA 4O3PA 3C2KA 5KT6A 3WK6A 4IR9A 3PR4A 3V7JA 3N7PD 3L5KA 2W9AA 3B0YA 3OHAA 2ZJ5A 4IRKA 1JUDA 3KHLA 3NVYA 3V7LA 2HHWA 5T14A 1KL9A 4ZOHC 2KKPA 2Q4TA 4UAWA 1JRPA 4U7CA 1DGJA 1S77D 1QH9A 4YCXA 1SZPA 4AYBC 2DPIA 1Z00B 3BQ7A 4J9NA 3UQ2A 8ICBA 5DQGA 2LMRA 1ZQJA 2F1JA 5DDMA 2W9CA 2BPGA 1RYRA 8ICTA 1L7MA 8ICNA 4UW9A 2VA3A 4UB2A 4M9HA 4M9LA 3MGIA 5B66U 3PW5A 2JRZA 3RB6A 8ICRA 5J29A 3TKAA 4DFKA 1SKRA 3M6KA 5DG8A 5ALNA 1MN8A 1N63A 2BZFA 5KG4A 2QLTA 4ECTA 2MU2A 1U45A 4C7ZA 1T3NA 4JUZA 4QZAA 4B9SA 4ECSA 5DB9A 3ISBA 4C4SA 5A0LA 3T5KA 5BOMA 4FBUA 2KD1A 4O3MA 4UASA 5KG3A 4ECWA 2KFZA 3THVA 3OHBA 2NYVA 2NO5A 5AKLA 5IIJA 3IDWA 4DS5A 3C28A 1S0VA 1T8EA 3K4GA 4CDGA 7ICHA 1WYGA 3HWTA 3NTUA 3QU9A 3QU7A 5IIOA 9ICFA 3WK9A 3QU4A 4QWDA 4B9NA 9ICIA 4MEXA 2ASDA 3PW2A 8ICJA 4EENA 1XNSA 2G06A 3OJUA 2KICA 4ECZA 4M6WB 4ECXA 3KHGA 4NY8A 3ZDBA 1S76D 1NNLA 2YMMA 5AIAA 5KFWA 3WKEA 2WF5A 5IIIA 2KP7A 2N1RA 4HAIA 4YMNA 2GO7A 4X5VA 2BPFA 4DL3A 2LBOA 1S8OA 4KLDA 4TURA 1JIHA 5J2CA 4YFKA 4DWIA 4Q45A 3T79A 5TZVA 4QZIA 2XIDA 1ZQUA 4R66A 3JPQA 4MF2A 2ZUDA 1ZQRA 4G3IA 1ZD2P 4DSFA 1X9SA 5KFDA 2IA6A 4CGZA 2E1FA 3G6VA 2R8KA 3CP8A 1TAMA 1CEZA 4FZMA 5DLFA 4NV0A 4GC6A 3FM9A 1N62A 3FC4A 1CI4A 2G08A 4TQRA 4UAZA 5KFLA 7ICQA 2PFNA 3RFAA 7ICJA 1D9FA 2H3QA 3UQ0A 4DLGA 2EDUA 1NKEA 4F91B 2AJQA 3H8MA 4F92B 3WK7A 9ICMA 2W04A 5KNIA 2GOLA 5DGBA 1TKDA 4RUCA 3DEEA 1RXWA 1FIQA 5AK5A 2UVUA 4DSIA 7ICGA 9ICPA 5JRTA 3T3FA 1YZ7A 1L3UA 2FMSA 4XUSA 5KFKA 5DG7A 4QZGA 8ICZA 3IG5A 4FFDA 5KFHA 5CWRA 2FI1A 1ZQMA 1NJXA 3JPTA 2WF7A 2NV3A 2O6KA 4UB8U 5IIMA 3KTQA 4DQIA 2PFPA 3UXNA 3C1YA 2KVCA 2FE9A 1X9MA 5D4BA 3ZD9A 2R18A 1ZRMA 3RJEA 9ICXA 4A8EA 3QUBA 1KLNA 3TAQA 2PFOA 5B5EU 3F2BA 4ED0A 5L1IA 1RQNA 2BDPA 2W43A 4UQGA 1TK0A 2I5HA 4P4PA 1B22A 1L8LA 5K4LA 2YMLA 4OD0A 1URJA 1Q8KA 8ICQA 2WB1F 3RJFA 2W7OA 8ICGA 5C0YA 4P4OA 2JV3A 2G09A 1BNPA 2ESEA 1OW5A 2EQYA 3PSIA 5KG7A 3EZ5A 4DFJA 2ISPA 4O5EA 1TE2A 5DB7A 2KZMA 2ZIXA 5HR6A 3RH6A 1A77A 1BPDA 5JU5A 3HPOA 4EZ6A 3MR3A 5J0UA 2A1AA 4PZOA 3GZFA 4YG2A 3M9MB 3C2LA 5ALJA 5EE9A 1A76A 1FFVA 3NS1A 4ED1A 3TANA 2KTQA 1RYSA 5HR7A 3RH4A 1ZQCA 1JXEA 2DGZA 1NK0A 1VJ5A 2HCFA 5CJ7A 1HJPA 3LVVA 2JH7A 5L9XA 3E58A 4NXZA 4RQNA 4TUPA 1LKYB 2R8JA 2JEGA 1OUQA 1DXSA 4QZBA 2XY6A 3ZDEA 3QNMA 2BDUA 4FZLA 1NK7A 1Q46A 3NRZA 5DBCA 3GQCA 3BJYA 2CXYA 1QSYA 1SXEA 1ZQPA 1X6IA 3IRUA 1N60A 4F4KA 3HJEA 1WWVA 4MEYA 1QSSA 3QZ7A 1KEJA 3C2MA 4DQRA 4G9BA 7ICKA 4LVSA 5AM0A 4ED6A 2QB1A 3L3FX 2B6GA 2BCUA 4ICAA 2H3ZA 5TISU 2K4HA 3UXOA 1T4GA 3MC1A 1F0MA 2EANA 3IN5A 3KOOA 1QLNA 3TADA 2YTUA 5KL1B 2YB4A 1IXRA 2C2DA 3AL0B 1TAQA 3MFIA 1XO0A 3Q8RB 2E8OA 3ICXA 5KFZA 1XSPA 1UA1A 5DQIA 1D9DA 4C8KA 4DF8A 1L5UA 2H3VA 3ZI4A 7ICLA 7ICSA 1HUZA 2LYHA 4J9KA 3NVVA 4MHVA 1PUZA 3EUB2 4QZCA 3CW2C 2R8IA 5CRXA 3KZXA 4C80A 4ECVA 1IG6A 2KK0A 4JWNA 2PKEA 5HP4A 2G5IB 3MGVA 2E5SA 1RQLA 4KLHA 1KN5A 5CA7A 5EOZA 5EE0A 2HHUA 5KFSA 9ICVA 5J2FA 2M9NA 4Q44A 4KMUA 1Z1BA 4FBTA 5J8YA 2WAQC 5AI9A 3Q8QB 1QSLA 2LYBA 2W8LA 7ICIA 4KLSA 3H4DA 2HVHA 2XY5A 1DK3A 1SWWA 9ICEA 4I2DA 7ICMA 5ALHA 7ICVA 5IILA 3ED5A 1ZQSA 4GFJA 4O3NA 2HW3A 5DBAA 3FDSA 3K1RB 4Y2TA 5L1JA 2Y1JA 1DRGA 4MFAA 8ICEA 4RT2A 2IOHA 2E3TA 3KFUF 3ZD8A 2C2EA 3N97B 4UB3A 3LK9A 4XA5A 5J2GA 2HHQA 2OWOA 3D2QA 5AM5A 1Z3EB 4NJ8A 3H40A 4ED3A 8ICUA 3TARA 1ZQZA 2A1JB 4P2HA 2YMQA 5E79U 2ZIXB 8ICXA 3PY8A 4DOBA 4PGYA 3Q8KA 1RM6C 4EX7A 1NJZA 3EWAA 3PR5B 1U4BA 3GFKB 1GO3F 2LYAA 4M2YA 2IOFA 2HHSA 4QW8A 5AKIA
chains in the Genus database with same CATH topology
2ES6A 3TADC 2E8NA 1X9XA 2KE7A 2KSOB 2KMDA 4MHVA 5JU5A 1UQVA 4NL9C 4PZOA 1SV4A 2D3DA 1UCVA 1X66A 2QARB 2Y9TA 2KG5A 2GLEA 2E8PA 1X40A 1V85A 3SENA 3H8MA 2KSOA 4IS7A 5KNIA 2DKZA 2QB0B 4PZNA 3HILA 5J8YA 4RQNA 1B4FA 1LKYB 2EAOA 5L1MA 1DXSA 5JRTA 3IDWA 2LPEA 1KW4A 2DKXA 2QARA 5F3XB 1SGGA 2K60A 1B0XA 1Z1VA 2F44A 3KKAA 2EAMA 1SXEA 1PK3A 2QB0A 3K1RB 1WWVA 1PK1B 2E8MA 2F3NA 5J8YC 2L5YA 1SXDA 2FE9A 2Y9UA 1SV0A 2QB1A 2B6GA 3BQ7A 3SEIA 5JTIA 1WWUA 1COKA 3BS7A 3TACB 4RQMA 4NJ8A 2LMRA 1F0MA 3BS5B 2EANA 3KKAC 2QKQA 3TADA 2YTUA 1OXJA 2DL0A 2KIVA 1PK1A 2F8KA 2D8CA 1RG6A 2K4PA 2EAPA 4NL9A 1SV0C 1LKYA 1V38A 2E8OA 1JI7A 2JV3A 2ESEA 1OW5A 3BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ES6 A;  3TAD C;  2E8N A;  1X9X A;  2KE7 A;  2KSO B;  2KMD A;  4MHV A;  5JU5 A;  1UQV A;  4NL9 C;  4PZO A;  1SV4 A;  2D3D A;  1UCV A;  1X66 A;  2QAR B;  2Y9T A;  2KG5 A;  2GLE A;  2E8P A;  1X40 A;  1V85 A;  3SEN A;  3H8M A;  2KSO A;  4IS7 A;  5KNI A;  2DKZ A;  2QB0 B;  4PZN A;  3HIL A;  5J8Y A;  4RQN A;  1B4F A;  1LKY B;  2EAO A;  5L1M A;  1DXS A;  5JRT A;  3IDW A;  2LPE A;  1KW4 A;  2DKX A;  2QAR A;  5F3X B;  1SGG A;  2K60 A;  1B0X A;  1Z1V A;  2F44 A;  3KKA A;  2EAM A;  1SXE A;  1PK3 A;  2QB0 A;  3K1R B;  1WWV A;  1PK1 B;  2E8M A;  2F3N A;  5J8Y C;  2L5Y A;  1SXD A;  2FE9 A;  2Y9U A;  1SV0 A;  2QB1 A;  2B6G A;  3BQ7 A;  3SEI A;  5JTI A;  1WWU A;  1COK A;  3BS7 A;  3TAC B;  4RQM A;  4NJ8 A;  2LMR A;  1F0M A;  3BS5 B;  2EAN A;  3KKA C;  2QKQ A;  3TAD A;  2YTU A;  1OXJ A;  2DL0 A;  2KIV A;  1PK1 A;  2F8K A;  2D8C A;  1RG6 A;  2K4P A;  2EAP A;  4NL9 A;  1SV0 C;  1LKY A;  1V38 A;  2E8O A;  1JI7 A;  2JV3 A;  2ESE A;  1OW5 A;  3BS5 A; 
#chains in the Genus database with same CATH topology
 2AHO B;  1L3V A;  2BQU A;  3AEV A;  2UVV A;  4GLX A;  2MA1 A;  1X9X A;  1ZJN A;  5KFG A;  1HUO A;  1NK6 A;  3RR8 A;  2RP5 A;  1NZB A;  4KLE A;  3SR6 A;  2DPJ A;  2WF6 A;  5ALW A;  2OCE A;  4DL2 A;  3MBY A;  5J0X A;  1S0M A;  3PSP A;  4KX3 A;  4F93 B;  2RDJ A;  1EXN A;  5HNK A;  2M0N A;  4RT3 A;  4RQ4 A;  1N48 A;  2HBJ A;  2R8H A;  4I2H A;  1B4F A;  3GV7 B;  4ECY A;  2KKV A;  4RQ6 A;  3MR2 A;  4K4I A;  1B0X A;  5CP2 A;  9ICL A;  2PI4 A;  1S10 A;  3IV6 A;  5DG9 A;  1ZQG A;  4AYB F;  3GIL A;  2DWQ A;  4DOC A;  3SAG A;  3QX7 A;  3SAH A;  4TQS A;  2WHE A;  3QZ8 A;  3SZ2 A;  3M8S A;  5FP0 A;  3PV8 A;  2PI5 A;  3UM9 A;  5J2K A;  2LHT A;  4B9U A;  5ALK A;  5ALP A;  4F2S A;  8ICF A;  1C20 A;  1WWU A;  5KFT A;  4QW9 A;  2YB1 A;  1SB3 C;  2Q0Z X;  1O08 A;  2HI0 A;  2UVR A;  5ALQ A;  1RYU A;  4UAY A;  1DOQ A;  2QKQ A;  3PX4 A;  4F4Z A;  4EX6 A;  3IM1 A;  2DL0 A;  1S0O A;  1SIJ A;  2H3I A;  1PZN A;  3CRX A;  1NI3 A;  2J6T A;  4ED8 A;  1DGS A;  1HIW A;  7ICU A;  3FAH A;  3I76 A;  1SKW A;  4KLO A;  3MR5 A;  2PMZ C;  3C21 A;  2ZUB A;  2KZ3 A;  3TAD C;  2YMP A;  2IBK A;  4DOA A;  5EWF A;  2VAN A;  1ZQV A;  1IIP A;  4I2E A;  4KLQ A;  5AK4 A;  3UMB A;  4UBC A;  4DQS A;  4GC7 A;  1N5W A;  9ICG A;  1JX4 A;  5KG5 A;  9ICN A;  3SV3 A;  4CCH A;  2P6R A;  2VJ4 A;  2GLE A;  2NRX A;  5J0S A;  1KSP A;  3AU6 A;  1X40 A;  3H0M B;  2LKY A;  4P0P B;  1S5L U;  3EPG A;  1HEK A;  4Z6F A;  4J9Q A;  2JHD A;  4EEL A;  1L7O A;  4QWA A;  4RPZ A;  5F3X B;  5AHX A;  1DK2 A;  2MUT A;  3V6J A;  1ZQD A;  1WG8 A;  4CNQ A;  4E0D A;  2KV2 A;  4QZE A;  5J2A A;  2HOF A;  1Z1V A;  2W54 A;  5AKJ A;  2HMX A;  2BCS A;  2K8C B;  1KTQ A;  3UXP A;  2QB0 A;  4PGX A;  1IM4 A;  1ZQY A;  2HHV A;  5J8Y C;  3AU2 A;  1Z4O A;  3PMN A;  2PXI A;  4Y2X A;  3QUQ A;  2WF8 A;  4WJ3 B;  4EZ9 A;  3SEI A;  2YX8 A;  5D46 A;  2F2A B;  5KFE A;  2CPR A;  3GII A;  2AGQ A;  4Q8E A;  3IP4 B;  3QE9 Y;  3JPO A;  1PK1 A;  4XRH A;  1XC9 A;  4QNL A;  4LZD A;  5AKY A;  1LKY A;  4I2J A;  1V38 A;  2KJ9 A;  5EE1 A;  1JI7 A;  4BJQ A;  3U26 A;  3UPQ A;  3ONN A;  1BNO A;  2W9M A;  4C4T A;  5KFC A;  3S6J A;  1V97 A;  4YR3 A;  4O3R A;  1ZQO A;  4MFF A;  4Q8F A;  2I6X A;  1CUK A;  3FYH A;  2I1Q A;  3RRH A;  1BPY A;  3Q8L A;  1ZRN A;  2RDI A;  1L7P A;  3RF9 A;  1ZQI A;  5KTQ A;  1SL0 A;  4F5R A;  4NM1 A;  4NLN A;  2CRX A;  5KFM A;  2K4I A;  4DF4 A;  4DQP A;  1X42 A;  3DDH A;  5KFN A;  3C1Z A;  2KJ8 A;  3KZI U;  4EBC A;  2LPE A;  3AM9 A;  2QAR A;  4OJL A;  5DQH A;  3MGH A;  2JH1 A;  2W3R A;  4KTQ A;  2ZXH A;  3PO4 A;  3KKA A;  4PL1 A;  3BQ1 A;  9ICK A;  3NVZ A;  9ICS A;  2EAM A;  3AUO A;  4GXJ A;  4GXK A;  1NK8 A;  4C8M A;  4K4G A;  2BQR A;  8ICO A;  5J0O A;  4F8R A;  4DL7 A;  1MA7 A;  1SV0 A;  3Q8P B;  2ASJ A;  3F2C A;  4JWM A;  1KFS A;  2NRV A;  1COK A;  2JEF A;  5DLG A;  5AI6 A;  2W11 A;  4BXO A;  5ALY A;  2JEJ A;  1ZQT A;  4BUG A;  2K8B B;  1OXJ A;  4PPX A;  4QWE A;  2VKQ A;  2JZB B;  2HOI A;  5J2H A;  4OJ6 A;  2KIV A;  4OJP A;  2KFN A;  2RQ5 A;  3QYP A;  2D8C A;  3PML A;  4ELT A;  1SL1 A;  9ICW A;  3F5E A;  4NLC A;  4O3S A;  4IQT A;  1N56 A;  1B43 A;  3T5J A;  4DQQ A;  9ICJ A;  2KN7 A;  1SZH A;  2XO7 A;  5AM3 A;  1MQ3 A;  1TFR A;  3KD3 A;  5KG1 A;  3WKA A;  2W8K A;  3HW8 A;  5J0Q A;  2ES6 A;  4KLJ A;  5G5G A;  4PHE A;  2KE7 A;  1PVQ A;  1XU4 A;  4EYH B;  2ZIW B;  1JRO A;  3TQ1 A;  2F1H A;  4B9V A;  4CE6 A;  5J0W A;  4DEZ A;  8ICL A;  2MUT B;  5KFP A;  2XCP A;  4IQU A;  1TK5 A;  1MC8 A;  4BWJ A;  1N5X A;  1V85 A;  2A1J A;  3RJJ A;  4I27 A;  2LM4 A;  1WUD A;  2QB0 B;  3F5A A;  5AIB A;  2FPM A;  5J0Y A;  3HIL A;  1H38 A;  1ZQK A;  3PNC A;  1XWL A;  4UAT A;  3JPS A;  5DBB A;  2BQ3 A;  8ICP A;  1NK4 A;  4DFD A;  2MSN A;  4I2I A;  1ZQW A;  1XO1 A;  5BOL A;  4NLG A;  3PO5 A;  3V6H A;  3PSF A;  4CRX A;  1KBU A;  1PVR A;  2K8A A;  4DSJ A;  3Q8M A;  5F9N A;  1PK1 B;  4QZ9 A;  4NLK A;  4NWI A;  2JGA A;  3RBE A;  3HT3 A;  3PW7 A;  5G5H A;  5GTH U;  5ALL A;  4RZR A;  2KVS A;  5KFQ A;  2LM1 A;  4C4R A;  4YXM A;  5AM1 A;  3PX6 A;  2WB1 C;  2XVT A;  4Z6E A;  5ALO A;  9ICT A;  2V4R A;  1ZQN A;  4F2R A;  3BQ0 A;  2OXO A;  2ZTC A;  4US9 A;  4C8N A;  3BDP A;  4DSK A;  4C0Z A;  3RBD A;  5DB8 A;  1UPH A;  3IHQ B;  4YD1 A;  3N28 A;  3VC8 A;  1Z19 A;  8ICH A;  4IQV A;  4EBD A;  3HKZ F;  2KNJ A;  2OHF A;  2Y0S C;  1ECW A;  2KIW A;  4NM2 A;  1X66 A;  2KZZ A;  2QAR B;  4Y2Q A;  2G5H B;  2KG5 A;  3D2S A;  5KT2 A;  5HHH A;  2E8P A;  1LVH A;  1TV9 A;  1K1S A;  4IS7 A;  3LWL A;  4JK1 A;  4KLU A;  3TAP A;  2ZJ8 A;  2R8G A;  2VIX A;  3M8R A;  1A0P A;  3HX0 A;  3V7K A;  5KFO A;  3WKC A;  4QIW F;  2ZIU A;  4Y2V A;  2AGO A;  1ZD4 A;  1Z4N A;  4CF4 A;  5AKK A;  4BXO B;  1QQ7 A;  4FO6 A;  4RQ0 A;  4PHD A;  2EZY A;  9ICR A;  3N7R C;  2VJ5 A;  5IIK A;  2VA8 A;  4F4Y A;  5DGA A;  2L5Y A;  2K89 A;  4FS1 A;  3PX0 A;  1FFU A;  1ZJM A;  1S97 A;  4RNO A;  3PVX A;  2BHN A;  2W55 A;  2OYY A;  2E1E A;  3KKA C;  3MDA A;  1U48 A;  4YVZ A;  4P0P A;  3KHH A;  2FLP A;  1JXL A;  4GXI A;  3H4B A;  2K4P A;  2JXJ A;  4NL9 A;  1SV0 C;  1ZOL A;  2ZTD A;  4B9T A;  4ECQ A;  4JV0 A;  4LJX A;  4UAR A;  5KFU A;  4J9P A;  3M9O B;  7ICE A;  4J9O A;  5F9L A;  3CYM A;  3PW4 A;  4RQ8 A;  1UA0 A;  3EW9 A;  1ZQ1 C;  4J9M A;  5J2J A;  1NK9 A;  1V9P A;  4ED2 A;  4FZN A;  2FPL A;  4Y2J A;  3ZDA A;  1KDH A;  2ASL A;  3GIK A;  2D3D A;  2MRL A;  4F50 A;  4KN7 A;  2DBY A;  4QZ8 A;  1ZQH A;  3ETR A;  1L3S A;  1ZQE A;  2XIC A;  3H7I A;  1BPZ A;  2GWS A;  1AQ6 A;  3ORY A;  4ECU A;  5AI5 A;  3ETL A;  4OCZ A;  1JN3 A;  2FLL A;  5L1M A;  2B0C A;  2F77 X;  2JMG A;  2H3F A;  3OGU A;  2K60 A;  2KHQ A;  5ALT A;  3NAS A;  3B9J A;  1FEZ A;  1KKX A;  2Y1I A;  4US8 A;  1ZD5 A;  5AKG A;  4YXJ A;  7ICN A;  2EZX A;  4I2A A;  4BX9 C;  4IRC A;  5ALE A;  3RJG A;  1XSN A;  2Y9U A;  1COO A;  2W9B B;  4GIB A;  2KEY A;  1D8B A;  5KT7 A;  4RQM A;  3A0H U;  1S9F A;  5IIN A;  4O5C A;  4TUQ A;  3WK5 A;  1KQQ A;  3K75 D;  9ICO A;  2OEH A;  1CRX A;  4QWB A;  1P7D A;  4F72 A;  1JAL A;  3ZDC A;  1L3T A;  1A6S A;  5DB6 A;  3SQI A;  2KJ5 A;  1UT8 A;  8ICI A;  3A0B U;  5ALM A;  3C5G A;  3QU5 A;  4ELU A;  3D6J A;  2ATL A;  4UAU A;  3C5F A;  4FS2 A;  3ISC A;  3H0L B;  3RB0 A;  1VDV A;  2ZIU B;  5EE3 A;  4KLT A;  2HSZ A;  1D8Y A;  3SD7 A;  4HYK A;  4R8U A;  4JMU A;  1NKC A;  3G6Y A;  2AU0 A;  2JZB A;  1T7P A;  4RQ5 A;  4MFC A;  4NLB A;  4O3O A;  3QXG A;  4RNM A;  4QZH A;  2EAO A;  4RQ7 A;  1KW4 A;  1J97 A;  4IL6 U;  3L4P A;  1NJW A;  1NZP A;  3OPX A;  3GU3 A;  3RR7 A;  2BCR A;  4Y2S A;  3MR6 A;  2PFQ A;  3GIJ A;  2UVW A;  2ZIW A;  1RDF A;  3RAQ A;  5BPC A;  7ICP A;  5AK6 A;  3F2D A;  2HVI A;  4B6J A;  4F5O A;  4TUS A;  4I28 A;  1T94 A;  4YMO A;  2AQ0 A;  1KFT A;  7ICF A;  4C7Y A;  5AKX A;  1BPX A;  2FMP A;  5KFX A;  4J9L A;  3AQF A;  2FLN A;  4EBE A;  2AH5 A;  5CEH A;  5AK3 A;  2F8K A;  2D6F C;  5GTI U;  2NRT A;  2EAP A;  1L6N A;  3H8J A;  3O0F A;  1ZQQ A;  4ELV A;  4M9J A;  3GV8 B;  5AIC A;  5AKH A;  1BVS A;  4IQW A;  1KRP A;  4I2G A;  1NKB A;  3PST A;  2AXT U;  2YY6 A;  3NVW A;  4BDP A;  1LB2 B;  3B0X A;  2ZIV B;  3Q8S B;  1BPE A;  1NK5 A;  4B9L A;  1SL2 A;  5KAF U;  3SMV A;  4NL9 C;  3AMZ A;  2ZUC A;  1O03 A;  2NRZ A;  2DUY A;  4DO9 A;  5J0R A;  4QZF A;  3BQ2 A;  5H2F U;  5KG0 A;  4YR2 A;  4P0Q B;  4F71 A;  1ZD3 A;  1ARO P;  2ISO A;  2HDO A;  1SWV A;  4DLE A;  3ISD A;  2P35 A;  2JR5 A;  2F1I A;  5HMM A;  4DSL A;  2VA2 A;  1S0N A;  3F53 A;  1RZT A;  1WCL A;  4XQ8 A;  2AQ4 A;  2A19 A;  4O9M A;  1L8O A;  2F44 A;  4YN4 A;  4PHA A;  4Z6D A;  8ICM A;  5KT4 A;  1ED1 A;  5L1L A;  1PK3 A;  4Y2P A;  2J6U A;  2W3S A;  1K1Q A;  2H5X A;  2BPC A;  4MF8 A;  5JTI A;  4EYI B;  4UB6 U;  4QZD A;  5ALG A;  3OJS A;  3ALR A;  2P66 A;  4IC9 A;  3RTV A;  1SKS A;  1FO4 A;  3WU2 U;  2XC9 A;  3H8W A;  3OTQ A;  2XI9 A;  5AM4 A;  2F8L A;  4OO1 J;  2XCA A;  1RG6 A;  8ICV A;  5KFY A;  3WKD A;  5AI8 A;  8ICY A;  4J03 A;  4RPY A;  4UBB A;  3TI0 A;  1JMS A;  5ALR A;  3NGD A;  3HP6 A;  4CF3 A;  4K4H A;  1Q3U A;  3QUC A;  4PH5 A;  3N7S C;  5ALS A;  3BS5 A;  1K5O A;  4F5P A;  2V9W A;  5KG6 A;  4M9G A;  4R8U B;  4Q43 A;  2DF4 B;  4ECR A;  5ALZ A;  5J2D A;  2YN4 A;  3NUQ A;  4F5N A;  4ACO A;  3T5L A;  1UQV A;  4M47 A;  4FE3 A;  4YR0 A;  2WTF A;  3GV5 B;  4YP3 A;  3RH5 A;  1XS9 D;  4I2B A;  1VLB A;  1UCV A;  9ICQ A;  2XGP A;  3SI8 A;  3V72 A;  5KFR A;  4O5K A;  1YZ6 A;  2W9C B;  5J0P A;  1ZQA A;  4DFM A;  3SEN A;  4KIT B;  5L1K A;  2KSO A;  2ZTE A;  5KAI U;  2NO4 A;  3RAX A;  2IOF K;  1PVP A;  2MAX A;  4DSE A;  1TVA A;  4USA A;  4EEY A;  4OJ5 A;  5CR0 A;  3JPR A;  5KT3 A;  2Z7J A;  4I29 A;  2DKX A;  2W7P A;  4JV1 A;  1SGG A;  4KN4 A;  4J9S A;  2RHF A;  8ICS A;  1MQ2 A;  3PW0 A;  3RRG A;  5C5J A;  5DDY A;  2F76 X;  3RJI A;  4PGQ A;  1ZQF A;  2E8M A;  3LWM A;  3D2N A;  4JV2 A;  1SXD A;  2ALZ A;  3OSP A;  1ZQL A;  3BS7 A;  3MFH A;  7ICT A;  4F4X A;  1BPB A;  4Y2R A;  2JEI A;  1TK8 A;  1ZXI A;  4Y2U A;  2I9G A;  1IV8 A;  3T5H A;  4I2C A;  1Q3V A;  3ZDD A;  4I2F A;  1N61 A;  4F4W A;  3TFR A;  1D8L A;  4R65 A;  3JPN A;  4M04 A;  1YT3 A;  5KT5 A;  5HHI A;  2C22 A;  4RQ3 A;  1RPL A;  3V6K A;  1M6Y A;  3QU2 A;  2ZXI A;  1Y88 A;  2OM6 A;  5AKE A;  3R9K A;  3M1Y A;  2HBM A;  2HBL A;  1ZQX A;  2Y0S F;  1ZYQ A;  5KFB A;  4NLZ A;  2HOQ A;  3AQE A;  4P4M A;  4M0A A;  5AI0 A;  5AKZ A;  3TFS A;  4IR1 A;  2E8N A;  4C8L A;  5ALX A;  3KBB A;  5KFJ A;  4PL2 A;  3H0R B;  3WKB A;  4M9N A;  1X6J A;  2W9B A;  3RJK A;  3OSN A;  2Y9T A;  4DCC A;  9ICA A;  1ZET A;  2BR0 A;  7ICO A;  3NRW A;  4RNN A;  4IRD A;  3BQT A;  5J2E A;  3QEB Z;  3PZP A;  7ICR A;  4PZN A;  4C8O A;  1T3Q A;  2RRD A;  4CF5 A;  4DL4 A;  4KLM A;  2KHV A;  1XSL A;  4KX5 A;  4ED7 A;  4F3O A;  9ICU A;  4RPX A;  4PJ0 U;  2WAQ F;  2FJ6 A;  3I28 A;  1UHU A;  5ALU A;  4DS4 A;  1F44 A;  5CB1 A;  4KLF A;  4QWC A;  3H8S A;  4JB3 A;  2BCQ A;  4UB1 A;  2F3N A;  4KLG A;  5CHG A;  3RJH A;  1QQ5 A;  3M7D A;  3EYZ A;  1F5S A;  2K4E A;  5KFV A;  2KOB A;  2B21 A;  8ICW A;  2IMW P;  4OJO A;  3TAC B;  5EWG A;  2BKE A;  1WCN A;  3BZK A;  9ICH A;  4Z6C A;  4PHP A;  1U47 A;  2WF9 A;  4EEK A;  4RUA A;  3BS5 B;  2BCV A;  3N4M B;  3LDA A;  2LI6 A;  4UB4 A;  3QEA Z;  2ZJA A;  2C28 A;  2HBK A;  4QJF B;  1NJY A;  3KHR A;  1J2N A;  2FDR A;  4U6P A;  1Z00 A;  4LZG A;  2BGW A;  2XY7 A;  5ALI A;  2RLT A;  9ICC A;  3HKZ C;  8ICK A;  2G07 A;  5KFA A;  2KSO B;  2KMD A;  2C2R A;  1LV5 A;  4ZH4 A;  2FMQ A;  2IHN A;  3SAF A;  2W03 A;  4BWM A;  3AN1 A;  1SV4 A;  4O3Q A;  4YMM A;  2NRW A;  3RB3 A;  4Y2Y A;  2P6U A;  4RQ1 A;  5AM2 A;  4R63 A;  4QIW C;  3K1Z A;  2DKZ A;  2WFA A;  2EH9 A;  3WK4 A;  2GH1 A;  3GDX A;  4YQW A;  4F5Q A;  1U9L A;  3UMC A;  3VCB A;  4RU9 A;  5KG2 A;  4DL5 A;  5KL8 B;  3E0F A;  3MDC A;  5J2I A;  5AI4 A;  2DQN B;  1NOM A;  4DL6 A;  2IHM A;  2ZG6 A;  5HML A;  4O0I A;  1X9W A;  3WK8 A;  2CN1 A;  5DKW A;  5ALF A;  3IG8 A;  2ZIV A;  2G0A A;  2V4Q A;  5KFI A;  1QTM A;  4AP9 A;  2AGP A;  5J2B A;  4UB5 A;  4J9R A;  3LVW A;  4DFP A;  1KFD A;  3C23 A;  3LYS A;  2DFL A;  3M6Z A;  2XGQ A;  3RB4 A;  1U49 A;  5EWE A;  1UT5 A;  4P0Q A;  5KFF A;  3M9N B;  9ICB A;  1BGX T;  5D49 A;  5ALD A;  8ICC A;  5ALV A;  3C29 A;  2HHX A;  3HRD D;  5JUM A;  1QCK A;  2YQE A;  1ZQB A;  2A3V A;  1TAU A;  2J6S A;  3BZC A;  3SV4 A;  4M6W A;  1MSW D;  1QQ6 A;  4UAV A;  4RQ2 A;  1J2M A;  3E2E A;  3J81 j;  3MAB A;  3DV9 A;  3SYZ A;  2PMZ F;  4B9M A;  3JPP A;  2HHT A;  2ODG A;  3UMG A;  5J0T A;  1N2X A;  3CNH A;  4KMO B;  8ICA A;  3I1Y A;  4KLI A;  2EZZ A;  4YD2 A;  3EPI A;  3QUT A;  2FPK A;  3G6X A;  1RXV A;  1L7N A;  4R64 A;  1X2I A;  1C7Y A;  2OH2 A;  4BGD A;  4KLL A;  3GIM A;  4O3P A;  3C2K A;  5KT6 A;  3WK6 A;  4IR9 A;  3PR4 A;  3V7J A;  3N7P D;  3L5K A;  2W9A A;  3B0Y A;  3OHA A;  2ZJ5 A;  4IRK A;  1JUD A;  3KHL A;  3NVY A;  3V7L A;  2HHW A;  5T14 A;  1KL9 A;  4ZOH C;  2KKP A;  2Q4T A;  4UAW A;  1JRP A;  4U7C A;  1DGJ A;  1S77 D;  1QH9 A;  4YCX A;  1SZP A;  4AYB C;  2DPI A;  1Z00 B;  3BQ7 A;  4J9N A;  3UQ2 A;  8ICB A;  5DQG A;  2LMR A;  1ZQJ A;  2F1J A;  5DDM A;  2W9C A;  2BPG A;  1RYR A;  8ICT A;  1L7M A;  8ICN A;  4UW9 A;  2VA3 A;  4UB2 A;  4M9H A;  4M9L A;  3MGI A;  5B66 U;  3PW5 A;  2JRZ A;  3RB6 A;  8ICR A;  5J29 A;  3TKA A;  4DFK A;  1SKR A;  3M6K A;  5DG8 A;  5ALN A;  1MN8 A;  1N63 A;  2BZF A;  5KG4 A;  2QLT A;  4ECT A;  2MU2 A;  1U45 A;  4C7Z A;  1T3N A;  4JUZ A;  4QZA A;  4B9S A;  4ECS A;  5DB9 A;  3ISB A;  4C4S A;  5A0L A;  3T5K A;  5BOM A;  4FBU A;  2KD1 A;  4O3M A;  4UAS A;  5KG3 A;  4ECW A;  2KFZ A;  3THV A;  3OHB A;  2NYV A;  2NO5 A;  5AKL A;  5IIJ A;  3IDW A;  4DS5 A;  3C28 A;  1S0V A;  1T8E A;  3K4G A;  4CDG A;  7ICH A;  1WYG A;  3HWT A;  3NTU A;  3QU9 A;  3QU7 A;  5IIO A;  9ICF A;  3WK9 A;  3QU4 A;  4QWD A;  4B9N A;  9ICI A;  4MEX A;  2ASD A;  3PW2 A;  8ICJ A;  4EEN A;  1XNS A;  2G06 A;  3OJU A;  2KIC A;  4ECZ A;  4M6W B;  4ECX A;  3KHG A;  4NY8 A;  3ZDB A;  1S76 D;  1NNL A;  2YMM A;  5AIA A;  5KFW A;  3WKE A;  2WF5 A;  5III A;  2KP7 A;  2N1R A;  4HAI A;  4YMN A;  2GO7 A;  4X5V A;  2BPF A;  4DL3 A;  2LBO A;  1S8O A;  4KLD A;  4TUR A;  1JIH A;  5J2C A;  4YFK A;  4DWI A;  4Q45 A;  3T79 A;  5TZV A;  4QZI A;  2XID A;  1ZQU A;  4R66 A;  3JPQ A;  4MF2 A;  2ZUD A;  1ZQR A;  4G3I A;  1ZD2 P;  4DSF A;  1X9S A;  5KFD A;  2IA6 A;  4CGZ A;  2E1F A;  3G6V A;  2R8K A;  3CP8 A;  1TAM A;  1CEZ A;  4FZM A;  5DLF A;  4NV0 A;  4GC6 A;  3FM9 A;  1N62 A;  3FC4 A;  1CI4 A;  2G08 A;  4TQR A;  4UAZ A;  5KFL A;  7ICQ A;  2PFN A;  3RFA A;  7ICJ A;  1D9F A;  2H3Q A;  3UQ0 A;  4DLG A;  2EDU A;  1NKE A;  4F91 B;  2AJQ A;  3H8M A;  4F92 B;  3WK7 A;  9ICM A;  2W04 A;  5KNI A;  2GOL A;  5DGB A;  1TKD A;  4RUC A;  3DEE A;  1RXW A;  1FIQ A;  5AK5 A;  2UVU A;  4DSI A;  7ICG A;  9ICP A;  5JRT A;  3T3F A;  1YZ7 A;  1L3U A;  2FMS A;  4XUS A;  5KFK A;  5DG7 A;  4QZG A;  8ICZ A;  3IG5 A;  4FFD A;  5KFH A;  5CWR A;  2FI1 A;  1ZQM A;  1NJX A;  3JPT A;  2WF7 A;  2NV3 A;  2O6K A;  4UB8 U;  5IIM A;  3KTQ A;  4DQI A;  2PFP A;  3UXN A;  3C1Y A;  2KVC A;  2FE9 A;  1X9M A;  5D4B A;  3ZD9 A;  2R18 A;  1ZRM A;  3RJE A;  9ICX A;  4A8E A;  3QUB A;  1KLN A;  3TAQ A;  2PFO A;  5B5E U;  3F2B A;  4ED0 A;  5L1I A;  1RQN A;  2BDP A;  2W43 A;  4UQG A;  1TK0 A;  2I5H A;  4P4P A;  1B22 A;  1L8L A;  5K4L A;  2YML A;  4OD0 A;  1URJ A;  1Q8K A;  8ICQ A;  2WB1 F;  3RJF A;  2W7O A;  8ICG A;  5C0Y A;  4P4O A;  2JV3 A;  2G09 A;  1BNP A;  2ESE A;  1OW5 A;  2EQY A;  3PSI A;  5KG7 A;  3EZ5 A;  4DFJ A;  2ISP A;  4O5E A;  1TE2 A;  5DB7 A;  2KZM A;  2ZIX A;  5HR6 A;  3RH6 A;  1A77 A;  1BPD A;  5JU5 A;  3HPO A;  4EZ6 A;  3MR3 A;  5J0U A;  2A1A A;  4PZO A;  3GZF A;  4YG2 A;  3M9M B;  3C2L A;  5ALJ A;  5EE9 A;  1A76 A;  1FFV A;  3NS1 A;  4ED1 A;  3TAN A;  2KTQ A;  1RYS A;  5HR7 A;  3RH4 A;  1ZQC A;  1JXE A;  2DGZ A;  1NK0 A;  1VJ5 A;  2HCF A;  5CJ7 A;  1HJP A;  3LVV A;  2JH7 A;  5L9X A;  3E58 A;  4NXZ A;  4RQN A;  4TUP A;  1LKY B;  2R8J A;  2JEG A;  1OUQ A;  1DXS A;  4QZB A;  2XY6 A;  3ZDE A;  3QNM A;  2BDU A;  4FZL A;  1NK7 A;  1Q46 A;  3NRZ A;  5DBC A;  3GQC A;  3BJY A;  2CXY A;  1QSY A;  1SXE A;  1ZQP A;  1X6I A;  3IRU A;  1N60 A;  4F4K A;  3HJE A;  1WWV A;  4MEY A;  1QSS A;  3QZ7 A;  1KEJ A;  3C2M A;  4DQR A;  4G9B A;  7ICK A;  4LVS A;  5AM0 A;  4ED6 A;  2QB1 A;  3L3F X;  2B6G A;  2BCU A;  4ICA A;  2H3Z A;  5TIS U;  2K4H A;  3UXO A;  1T4G A;  3MC1 A;  1F0M A;  2EAN A;  3IN5 A;  3KOO A;  1QLN A;  3TAD A;  2YTU A;  5KL1 B;  2YB4 A;  1IXR A;  2C2D A;  3AL0 B;  1TAQ A;  3MFI A;  1XO0 A;  3Q8R B;  2E8O A;  3ICX A;  5KFZ A;  1XSP A;  1UA1 A;  5DQI A;  1D9D A;  4C8K A;  4DF8 A;  1L5U A;  2H3V A;  3ZI4 A;  7ICL A;  7ICS A;  1HUZ A;  2LYH A;  4J9K A;  3NVV A;  4MHV A;  1PUZ A;  3EUB 2;  4QZC A;  3CW2 C;  2R8I A;  5CRX A;  3KZX A;  4C80 A;  4ECV A;  1IG6 A;  2KK0 A;  4JWN A;  2PKE A;  5HP4 A;  2G5I B;  3MGV A;  2E5S A;  1RQL A;  4KLH A;  1KN5 A;  5CA7 A;  5EOZ A;  5EE0 A;  2HHU A;  5KFS A;  9ICV A;  5J2F A;  2M9N A;  4Q44 A;  4KMU A;  1Z1B A;  4FBT A;  5J8Y A;  2WAQ C;  5AI9 A;  3Q8Q B;  1QSL A;  2LYB A;  2W8L A;  7ICI A;  4KLS A;  3H4D A;  2HVH A;  2XY5 A;  1DK3 A;  1SWW A;  9ICE A;  4I2D A;  7ICM A;  5ALH A;  7ICV A;  5IIL A;  3ED5 A;  1ZQS A;  4GFJ A;  4O3N A;  2HW3 A;  5DBA A;  3FDS A;  3K1R B;  4Y2T A;  5L1J A;  2Y1J A;  1DRG A;  4MFA A;  8ICE A;  4RT2 A;  2IOH A;  2E3T A;  3KFU F;  3ZD8 A;  2C2E A;  3N97 B;  4UB3 A;  3LK9 A;  4XA5 A;  5J2G A;  2HHQ A;  2OWO A;  3D2Q A;  5AM5 A;  1Z3E B;  4NJ8 A;  3H40 A;  4ED3 A;  8ICU A;  3TAR A;  1ZQZ A;  2A1J B;  4P2H A;  2YMQ A;  5E79 U;  2ZIX B;  8ICX A;  3PY8 A;  4DOB A;  4PGY A;  3Q8K A;  1RM6 C;  4EX7 A;  1NJZ A;  3EWA A;  3PR5 B;  1U4B A;  3GFK B;  1GO3 F;  2LYA A;  4M2Y A;  2IOF A;  2HHS A;  4QW8 A;  5AKI A; 
#chains in the Genus database with same CATH homology
 2ES6 A;  3TAD C;  2E8N A;  1X9X A;  2KE7 A;  2KSO B;  2KMD A;  4MHV A;  5JU5 A;  1UQV A;  4NL9 C;  4PZO A;  1SV4 A;  2D3D A;  1UCV A;  1X66 A;  2QAR B;  2Y9T A;  2KG5 A;  2GLE A;  2E8P A;  1X40 A;  1V85 A;  3SEN A;  3H8M A;  2KSO A;  4IS7 A;  5KNI A;  2DKZ A;  2QB0 B;  4PZN A;  3HIL A;  5J8Y A;  4RQN A;  1B4F A;  1LKY B;  2EAO A;  5L1M A;  1DXS A;  5JRT A;  3IDW A;  2LPE A;  1KW4 A;  2DKX A;  2QAR A;  5F3X B;  1SGG A;  2K60 A;  1B0X A;  1Z1V A;  2F44 A;  3KKA A;  2EAM A;  1SXE A;  1PK3 A;  2QB0 A;  3K1R B;  1WWV A;  1PK1 B;  2E8M A;  2F3N A;  5J8Y C;  2L5Y A;  1SXD A;  2FE9 A;  2Y9U A;  1SV0 A;  2QB1 A;  2B6G A;  3BQ7 A;  3SEI A;  5JTI A;  1WWU A;  1COK A;  3BS7 A;  3TAC B;  4RQM A;  4NJ8 A;  2LMR A;  1F0M A;  3BS5 B;  2EAN A;  3KKA C;  2QKQ A;  3TAD A;  2YTU A;  1OXJ A;  2DL0 A;  2KIV A;  1PK1 A;  2F8K A;  2D8C A;  1RG6 A;  2K4P A;  2EAP A;  4NL9 A;  1SV0 C;  1LKY A;  1V38 A;  2E8O A;  1JI7 A;  2JV3 A;  2ESE A;  1OW5 A;  3BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...