2LPEA

Solution nmr structure of the ksr1 ca1-ca1a domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
GHMDGGAGAAVSRALQQCGQLQKLIDISIGSLRGLRTKCSVSNDLTQQEIRTLEAKLVKYICKQQQSKLSVTPSDRTAELNSYPRFSDWLYIFNVRPEVVQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLRKVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinase suppressor of Ras 1
publication title A CC-SAM, for Coiled Coil Sterile a Motif, Domain Targets the Scaffold KSR-1 to Specific Sites in the Plasma Membrane
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13543 SAM_KSR1 SAM like domain present in kinase suppressor RAS 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lpeA02
5L1MA 2KSOB 1PK1A 1V38A 1OW5A 2Y9UA 5J8YA 1UCVA 2KSOA 3TADC 3K1RB 4IS7A 1PK3A 2F44A 5KNIA 2QKQA 2EAMA 3BS5B 2D3DA 2QB0B 1JI7A 1KW4A 2LMRA 3HILA 1V85A 1B0XA 4RQMA 3TACB 1RG6A 4NL9C 3SEIA 2DL0A 2L5YA 2K4PA 1UQVA 1SV0C 3KKAA 1SGGA 2K60A 2LPEA 4MHVA 3IDWA 2B6GA 5JU5A 1LKYB 2KE7A 2QARB 1SXDA 2EAPA 2F8KA 1SXEA 2E8MA 2F3NA 2Y9TA 1LKYA 3BS5A 2GLEA 2QARA 2EAOA 2QB0A 2JV3A 3BS7A 1SV4A 1X66A 2ES6A 2QB1A 3BQ7A 4NJ8A 3TADA 2DKZA 2DKXA 2E8PA 4PZNA 1COKA 5JTIA 1F0MA 1WWUA 2E8OA 2E8NA 1OXJA 2KIVA 1DXSA 2D8CA 1X40A 1WWVA 4RQNA 5J8YC 2ESEA 4NL9A 2YTUA 3KKAC 5F3XB 2KMDA 1SV0A 1Z1VA 1B4FA 1X9XA 2FE9A 3H8MA 2EANA 5JRTA 1PK1B 4PZOA 2KG5A 3SENA
chains in the Genus database with same CATH superfamily
3QE9Y 4O3NA 4NLNA 2IHNA 4OJ6A 3TAQA 3RB6A 2R8GA 2HW3A 3RB3A 3T5HA 1PZNA 2J6TA 5ALNA 4KLUA 3M9NB 1ZQKA 3BJYA 2DUYA 1SWVA 2YMMA 2K4HA 2C2EA 3AU2A 3IM1A 3QZ7A 5J0XA 4MF2A 1UPHA 1ZQRA 4UAYA 2JXJA 1NJXA 5L1IA 3A0HU 4FFDA 2R8HA 4JMUA 5J0SA 3K1ZA 2V4QA 1SV0C 4G3IA 3SD7A 3TKAA 4PJ0U 4ELTA 4ECWA 2C2DA 3M9OB 2XGPA 2ODGA 4IR1A 2HHWA 9ICJA 4FS1A 1F44A 3K4GA 3C2MA 2AHOB 3CNHA 4EX6A 4ECRA 3B9JA 5AI8A 1ZQPA 4MFFA 2J6UA 2F2AB 1TAQA 3AQFA 2UVUA 7ICKA 3J81j 4ECZA 5ALMA 5E79U 3AUOA 4GC6A 5ALXA 2BCRA 3ISDA 9ICFA 4PPXA 1WYGA 2XICA 1CUKA 4ED1A 4IR9A 4J9KA 2R8JA 1UHUA 1S0MA 5EE1A 7ICRA 3B0YA 3AU6A 3H0RB 2A3VA 4EEYA 1ZQXA 2WAQF 2MU2A 1FEZA 2BQ3A 2ASJA 2ZUBA 2EANA 4BXOA 2G07A 4RQ2A 3C21A 4RQ1A 3EW9A 3SENA 4LVSA 8ICWA 2E5SA 2HHUA 1XO0A 3RJIA 1ZD5A 1KFSA 1HUOA 2FPKA 2WF8A 3FM9A 3NGDA 5DG8A 5CWRA 3ZDCA 1QQ6A 2G5HB 3PR4A 2NRXA 8ICVA 8ICCA 3QU2A 4IQTA 2ZXIA 3CP8A 4QZ9A 3CW2C 2W9AA 3BZKA 2GO7A 4UB1A 3GIJA 5EE3A 4DL2A 3RRHA 2V4RA 1U47A 3GV8B 8ICEA 2IOHA 2I1QA 1ZQOA 5KFOA 5B66U 3SYZA 2F3NA 2K4EA 4C4RA 1ZQBA 3N7SC 2WTFA 5ALPA 4PHPA 3EZ5A 2YB4A 4F2RA 3DV9A 5AI5A 1S10A 1VLBA 3MR3A 2FJ6A 4NJ8A 3WK9A 3T5KA 2FMSA 3HPOA 4EENA 1YT3A 4ED0A 1C20A 3JPSA 1TAUA 3N28A 4LZGA 1HJPA 1K5OA 5KG7A 2PMZC 1M6YA 3SAFA 1T7PA 4F8RA 2EH9A 2K8AA 5J0OA 2Q4TA 3BZCA 1ZQDA 4FZLA 2OWOA 2W9CB 2PKEA 4Y2TA 4FBUA 2H3VA 4R8UA 1ZETA 2FLNA 1N62A 5L1MA 3AEVA 2NRTA 5AI9A 1LV5A 1V38A 5HR7A 1NNLA 1SZHA 2KD1A 1ZQCA 2G09A 5DBCA 2FLPA 5KFKA 8ICPA 2RLTA 3M8RA 4M9JA 2VA8A 4J9SA 1PVRA 4IQUA 4O3MA 2EAMA 5C5JA 4KX5A 9ICWA 3F53A 4UB5A 4DOAA 4TQSA 2ATLA 1A0PA 4OJOA 4RQMA 4B9SA 3C2LA 3PMLA 2NO5A 1MA7A 3PX6A 1L7NA 3AQEA 2KKPA 2JR5A 4ECTA 8ICOA 3H40A 3MR5A 2KFZA 3MR6A 5J2GA 5JU5A 3RBDA 1LKYB 5EWFA 5AKGA 1RYSA 1SXDA 2VA3A 2EAPA 2IOFK 8ICSA 2F8KA 4EEKA 2Y9TA 4KLEA 1QSYA 1LKYA 2KOBA 4YP3A 2BR0A 5ALTA 5KFBA 2FDRA 2BDUA 7ICVA 2KN7A 2BQRA 4I28A 4F5PA 4I2HA 3QX7A 1ZXIA 2W11A 2KIWA 3IG8A 5ALKA 4CGZA 1N60A 5A0LA 4C8KA 5D4BA 4F4KA 1KL9A 1ZQJA 7ICFA 4QZIA 5KG4A 5J2KA 1DXSA 3G6YA 7ICUA 3ETRA 1BPDA 2O6KA 5J2FA 2CN1A 2YTUA 2UVVA 2VKQA 1XS9D 3JPQA 3H0LB 2JEGA 4ECUA 1T3QA 1DK2A 1N56A 3EUB2 2CXYA 1BNPA 1DK3A 4Y2VA 8ICYA 2ZIVB 2ZG6A 5KFIA 1S97A 2XY7A 4DQRA 1KQQA 3MGVA 8ICUA 2ZIVA 3RAXA 4XQ8A 5AKKA 4U6PA 2R8IA 3F5EA 5KNIA 3EWAA 3UXOA 5C0YA 5F9NA 4O9MA 3RJEA 5AI6A 1VJ5A 1S9FA 4RQ6A 2BCUA 1ZOLA 4CRXA 3FC4A 3GFKB 4QNLA 2HMXA 4R63A 1D8BA 5H2FU 4F5RA 1UQVA 8ICBA 5ALLA 2LPEA 1U4BA 3KOOA 4DL5A 4YQWA 4YD2A 5T14A 2QARB 4KLTA 2JEJA 1H38A 3BS5A 2QARA 3RB4A 5TZVA 4CF5A 2WHEA 4PZNA 2E1FA 4UB3A 5KFZA 2F1IA 4I2FA 2HHXA 3IV6A 4OJPA 4ED8A 2KZMA 2PXIA 5AIBA 1ZQWA 9ICKA 3OGUA 2H3QA 2NO4A 1SB3C 2XIDA 5ALZA 4EELA 4NL9A 9ICBA 4EYIB 5KFYA 4DO9A 3JPOA 3D2SA 2EDUA 2ZTDA 4AP9A 5ALFA 4DOCA 1QCKA 3LVWA 5IILA 1NJWA 5L1LA 4QIWF 3ED5A 9ICMA 3MABA 3OHBA 2AQ4A 1DGSA 9ICTA 4ACOA 1L6NA 1KLNA 1KTQA 2W7PA 1URJA 2HSZA 3GILA 3SAGA 3T79A 2Y9UA 3C2KA 1D9DA 4M9LA 1X6IA 2Y1IA 1S0NA 1A77A 5D49A 2ZTCA 2QB0B 4BDPA 2WFAA 4EX7A 3WKBA 3UMGA 3NTUA 5EE0A 4QZDA 2DPIA 1Y88A 5DLFA 1ZD3A 4B9NA 3OHAA 1L3VA 8ICLA 3B0XA 5J0RA 4RQ3A 3RJJA 5KFEA 3H4BA 4M9GA 1GO3F 4FE3A 1RPLA 3IDWA 1IIPA 2KV2A 2BCSA 2PI5A 4YXJA 4C8OA 2OCEA 1ZQHA 2XY6A 1PVQA 3UMCA 4B9UA 5L1KA 3QUBA 3RJFA 4YMOA 1QQ7A 4NLCA 1S77D 2KFNA 1ED1A 1ZJNA 4PH5A 1RZTA 9ICNA 5GTHU 5EOZA 9ICHA 8ICTA 1Q3UA 2QLTA 2YMLA 2EZYA 2D8CA 3UQ2A 4BGDA 4RQ7A 3Q8PB 2OH2A 1L8LA 4MFCA 1L7OA 4M04A 2ZIWA 4DSIA 9ICLA 3I28A 2MUTA 2ZJ5A 7ICQA 1IG6A 2LI6A 2H3FA 2W55A 3AM9A 5DQGA 4GFJA 4I29A 4KMOB 3M1YA 2KSOB 3DEEA 5IIIA 5KFNA 2N1RA 1WG8A 5ALWA 3N97B 2KSOA 2VA2A 2BQUA 5KT6A 1ZQZA 4PGYA 3JPNA 8ICAA 4C80A 2AH5A 1ZQMA 4Z6EA 1UT5A 4CE6A 4RT3A 2I6XA 4RUAA 4IC9A 3PY8A 2D3DA 4M0AA 2Y0SF 3QUQA 2OM6A 4NLBA 5AM2A 5AKLA 1V85A 1ZQQA 1NK8A 2UVWA 4YR2A 5DB9A 3TQ1A 4QW8A 4Q8FA 2ZJ8A 5CRXA 5L1JA 2RHFA 4R64A 4KLOA 1XSPA 2JHDA 4P4MA 1YZ6A 3NUQA 2YN4A 1SL0A 1TV9A 2WB1C 2E8MA 3FYHA 3H8WA 1ZRNA 2AXTU 2LM4A 2P6UA 1C7YA 3QU4A 5BPCA 3HX0A 1KSPA 3SAHA 4GXIA 1Z4NA 5TISU 5KFJA 3F5AA 3ETLA 5DB7A 1RQLA 1TKDA 4Y2UA 3ZD9A 3PW0A 2NV3A 1L3SA 3I76A 3HWTA 4P2HA 2PFQA 4HYKA 4Y2JA 5KFTA 4AYBC 1MN8A 2RRDA 2KIVA 1MC8A 1X40A 4RQNA 3V7LA 2XGQA 3ZDEA 1UA0A 5ALJA 3MFHA 1X9XA 1FO4A 1Z19A 1ZYQA 2OEHA 5KG6A 5JRTA 4ECVA 2VJ4A 5HHHA 2HHQA 2KG5A 3PZPA 5AKIA 1LVHA 5AM4A 5AM3A 1JMSA 1QTMA 7ICNA 4BUGA 2BGWA 4J03A 5KFQA 5ALRA 4DSLA 3RR8A 2A1JB 2JH7A 2GWSA 2J6SA 3H7IA 3MBYA 2MRLA 2IA6A 3MDAA 3BQ2A 5CB1A 2Q0ZX 5G5HA 3RR7A 3BQTA 5AI0A 2HOIA 2LBOA 1NK9A 4P4PA 4J9RA 2KJ8A 1RXVA 1BVSA 3F2BA 4FZMA 4YXMA 5AKXA 2ISOA 2PMZF 3WK7A 1RDFA 1JIHA 2I5HA 4CF3A 4YD1A 9ICOA 4I27A 3GU3A 3H8SA 2HVHA 3RJKA 3PX4A 2QB1A 3ISBA 4B9TA 5DB6A 5JTIA 3V7KA 3KHHA 1WWUA 2FMQA 1QLNA 3IHQB 4P4OA 2RDJA 4YCXA 1ZQNA 5JUMA 4KN4A 1QQ5A 4RUCA 1VDVA 3QU5A 4HAIA 2F1JA 4P0PB 9ICVA 5J8YC 1BPZA 3AMZA 3V6HA 4ECXA 5F3XB 4YMMA 3QZ8A 2KMDA 3R9KA 5D46A 1U49A 4C4SA 4UB6U 4O3RA 8ICZA 4KLSA 4RNNA 2WAQC 1F5SA 4DEZA 2VJ5A 4LJXA 7ICOA 5IINA 2FPMA 4MF8A 5ALHA 1NKEA 3M7DA 1AQ6A 3FAHA 3KHGA 4F4ZA 4UW9A 5J0TA 2DQNB 3MGHA 4Y2RA 1YZ7A 1ZQYA 1SWWA 2KNJA 3QUCA 5KFUA 2KZ3A 3H4DA 2NYVA 5ALGA 2P35A 2W9CA 1HUZA 4Z6FA 5CP2A 4US8A 1T94A 3LDAA 1RXWA 4PHAA 5AKYA 4NL9C 3Q8LA 1DGJA 2W8KA 2BCQA 4QZ8A 5AKZA 1KBUA 5J0PA 4DFPA 4TUSA 4ZOHC 1CEZA 2C28A 1NKBA 3EPGA 3QYPA 5J29A 4B9LA 1X9WA 1ZQGA 2CRXA 5AKEA 2EZXA 4EZ9A 1NKCA 2JV3A 1SL2A 3ONNA 2XCPA 8ICXA 3RTVA 3PX0A 1Z00B 1TE2A 4KLJA 3LYSA 9ICIA 1ECWA 2XY5A 2B0CA 5AHXA 2BKEA 1Z00A 5DGBA 9ICAA 4UQGA 3PMNA 2EZZA 4IRCA 4RZRA 4UB2A 4RPZA 1MSWD 1K1SA 4UATA 1FFUA 4JV2A 1N5WA 4B9MA 2ZTEA 3LK9A 4ECYA 4YN4A 1U45A 3TAPA 3N4MB 2BPGA 1KEJA 2FE9A 2HI0A 2MA1A 2KVSA 4UARA 8ICQA 1TAMA 4PZOA 4UASA 4QZGA 4I2BA 4DFKA 1D9FA 1NK4A 4QZCA 4J9QA 2G08A 3VC8A 4JV1A 5J0YA 3HRDD 2XC9A 3ORYA 1EXNA 5DB8A 3RH4A 2W7OA 1MQ3A 2M0NA 4OO1J 4RNMA 3E2EA 1UT8A 2F44A 4XUSA 2QKQA 5CJ7A 4QZHA 2BHNA 3TFSA 9ICSA 3UXNA 1JROA 1Q3VA 4DSFA 3GZFA 2LMRA 2K8BB 1MQ2A 1RG6A 2ZJAA 3SEIA 4C8LA 4NLGA 2XI9A 4MFAA 4K4IA 4NWIA 2KTQA 4NXZA 3NRZA 4Q44A 5DGAA 4O5EA 5ALIA 3Q8MA 4DWIA 1S5LU 3LVVA 4PL1A 3KHRA 4NLKA 4KLFA 1SXEA 3C1YA 5J2DA 4P0QB 4JV0A 1FIQA 1LB2B 1X6JA 4GXKA 1X66A 5KG0A 4O3SA 1XWLA 2ES6A 3TADA 2AGQA 1NK0A 1SIJA 1D8YA 8ICGA 2BPCA 4EBDA 3HKZC 2W43A 2DWQA 3C1ZA 5KFVA 1NZBA 4DCCA 1ZQIA 4KN7A 4NLZA 4EBCA 3JPPA 8ICIA 2PFNA 3M8SA 1S0OA 1ZQLA 3NVZA 5J2AA 2JZBB 5GTIU 5J2JA 3OTQA 4DOBA 1P7DA 2KICA 5HMLA 4Q43A 2ASLA 4YR0A 3UQ0A 1JXLA 5KAIU 2KJ5A 2XO7A 2K89A 4PGXA 3E58A 1ZD4A 4ED2A 3WK5A 5EE9A 3Q8QB 2DF4B 3ZDBA 2BCVA 3VCBA 3JPRA 1RQNA 4BWJA 4B6JA 4ZH4A 9ICXA 2HHTA 4YFKA 2KJ9A 4J9PA 1S0VA 3QEBZ 2L5YA 4DSKA 3GIMA 4X5VA 5AKHA 2IMWP 4MEXA 1SGGA 5HR6A 3OJUA 2Z7JA 1JALA 3O0FA 5DDMA 3N7RC 3GV7B 4QWBA 3ZD8A 4O3OA 2JEFA 3V72A 4QW9A 2W54A 4JK1A 2ALZA 2QB0A 2W03A 3C5FA 3RH5A 2YX8A 3THVA 2DKZA 2W9BB 3FDSA 3PVXA 4JWNA 4KTQA 1O03A 3MGIA 3KZIU 2ZIUB 1NK7A 5AICA 2W9BA 3SV4A 4DFDA 4ECSA 1JUDA 1IXRA 4DLEA 1Q46A 1ZQ1C 5CHGA 2ZIUA 1OUQA 4C8NA 5IIJA 2FPLA 2RQ5A 1J2MA 4JB3A 1X42A 1HIWA 2A1AA 1RYRA 4KLDA 4OD0A 3C28A 1BPYA 4UAVA 4DQPA 4RQ8A 1A6SA 1Z3EB 1U9LA 2DFLA 4TQRA 4G9BA 3H8MA 4J9OA 1X9MA 1D8LA 5KFAA 1V9PA 3LWLA 1CI4A 1PK1B 5FP0A 3E0FA 2XVTA 4Y2QA 3PSFA 4O3QA 1PK1A 2ISPA 5AK6A 4IRDA 4M9NA 4PL2A 4R65A 4BJQA 5KT3A 1UCVA 3SMVA 2RP5A 3Q8KA 2WF7A 2KHQA 1CRXA 1PK3A 3WKAA 1N5XA 5KTQA 1U48A 5KFCA 1XC9A 1L3TA 4F92B 5KT4A 3QU9A 4JWMA 2HOQA 3SZ2A 5ALEA 3IG5A 5J0QA 2YMQA 5EWEA 1ZJMA 1WUDA 2YY6A 2DGZA 4AYBF 3GQCA 4M6WB 4B9VA 4DFMA 4NY8A 4GC7A 5G5GA 5KFFA 2NRWA 3NVVA 3TANA 2KE7A 4M6WA 4C7YA 1TK5A 9ICEA 5HMMA 3D2NA 2LHTA 1NZPA 2LYAA 5DBBA 4F5OA 4RPYA 1T3NA 3PW4A 5KFRA 1SV4A 1S76D 4BX9C 2DKXA 1COKA 3PW7A 4MEYA 4QZBA 1F0MA 1SZPA 5KT5A 3PW5A 1X2IA 3PSIA 2H3IA 4ELVA 1KRPA 3UM9A 2ZXHA 2VANA 1N48A 1KDHA 4DL7A 7ICPA 2UVRA 4QWAA 4O5CA 1WWVA 3MFIA 2G06A 4RU9A 1ZQSA 1PVPA 3WU2U 4J9NA 1QSLA 2W3RA 4OCZA 2H5XA 3OSPA 1Z1VA 3H8JA 5IIOA 1NJZA 4Z6DA 4DL4A 2ZIXB 4C8MA 4DL6A 1TFRA 3PSTA 2HBKA 3ALRA 4ICAA 3EYZA 2ASDA 3S6JA 3A0BU 1ZQFA 2ZIXA 2K4IA 5HP4A 4RPXA 1KFTA 5DBAA 2HBLA 4Y2SA 2PFPA 3SR6A 8ICRA 1XNSA 2ZUCA 3G6XA 2DBYA 3WKCA 4I2DA 3C23A 9ICRA 3V7JA 4R66A 2JH1A 2JRZA 2MSNA 4KLMA 2B21A 1KW4A 4DSJA 1B0XA 2IOFA 2Y0SC 2W04A 3GIIA 5K4LA 1FFVA 2LKYA 1NJYA 2IHMA 4C4TA 3PO4A 2A1JA 1ZRMA 4Y2PA 3AN1A 7ICHA 2W3SA 3C29A 1IV8A 5F9LA 4QWDA 4Z6CA 3AL0B 4BXOB 3PNCA 3BQ7A 3L5KA 4F91B 5KFSA 1J97A 5J0WA 4OJLA 4PHEA 3TI0A 4DSEA 4KLQA 5KT2A 2P6RA 3ZDDA 1PUZA 4FS2A 4XA5A 3HT3A 5CA7A 7ICLA 3T3FA 2ESEA 1L8OA 2KHVA 1KN5A 5CR0A 3ZDAA 4KITB 3T5JA 3SQIA 5J2IA 1QSSA 1NK5A 7ICEA 2M9NA 5EWGA 3PV8A 1UA1A 4ED7A 5DQHA 2YB1A 3IP4B 1OW5A 7ICSA 3RJHA 1N2XA 3TADC 3SI8A 1BPXA 5AK3A 5ALDA 2E1EA 3ICXA 4IS7A 1BNOA 4UBCA 4P0PA 4TUPA 3UPQA 4UAZA 4F71A 3KTQA 4K4GA 5KAFU 5DLGA 3HW8A 4U7CA 2V9WA 3WK4A 4RQ5A 1TK8A 3G6VA 4EBEA 3KKAA 3M6ZA 1COOA 4F50A 2B6GA 5ALOA 3BQ1A 1N61A 2MAXA 4Y2XA 5DDYA 5BOLA 1AROP 3RJGA 4KMUA 1JXEA 5AIAA 5J2EA 1ZQUA 5J0UA 4YR3A 1IM4A 4DF8A 5ALVA 5HNKA 4R8UB 2D6FC 2AGOA 4O0IA 5ALSA 3UXPA 2E8OA 1RYUA 4QJFB 5BOMA 2LYHA 5DG9A 1XU4A 1J2NA 2PFOA 3KBBA 4GXJA 4F4WA 5AM0A 4F3OA 1BPEA 1SKWA 3PR5B 1WCNA 1SV0A 1B4FA 4I2EA 5KFLA 3GV5B 4TUQA 4DL3A 4QWCA 3BQ0A 4FBTA 8ICNA 1XSNA 3ZI4A 3H0MB 2YMPA 2GH1A 2E3TA 2I9GA 1T4GA 5KFGA 2OYYA 4QZEA 2K8CB 2A19A 1QH9A 3GIKA 1HEKA 4IL6U 3I1YA 3KFUF 4XRHA 3PW2A 2G5IB 4F93B 5KL1B 4A8EA 2P66A 4Q45A 3QUTA 8ICHA 1L3UA 8ICFA 3NRWA 3L3FX 4I2IA 4BWMA 5CEHA 1KKXA 1O08A 1K1QA 3HP6A 1JI7A 3U26A 1S8OA 3V6JA 1BPBA 3OSNA 4Y2YA 3TACB 3RFAA 1KFDA 4F4XA 3M9MB 4F4YA 3HJEA 4J9MA 5KFPA 2KZZA 3HKZF 2WF9A 2EQYA 2AQ0A 2VIXA 2K60A 3WK8A 4F5NA 4MHVA 1X9SA 9ICQA 8ICJA 2WF6A 3OJSA 4DFJA 4RQ0A 4M9HA 3GDXA 4M2YA 3NS1A 4F72A 2EAOA 3T5LA 9ICCA 2OXOA 3KD3A 2KP7A 4I2JA 2KKVA 5AM1A 4DQIA 9ICUA 5AM5A 2KVCA 5AKJA 1RM6C 4JUZA 4IQWA 4ED3A 5KG5A 4NV0A 1OXJA 5KG1A 5IIKA 4C7ZA 1L7PA 4DQSA 1SKSA 2LYBA 2BZFA 3JPTA 4KLGA 4RQ4A 3NVWA 1N63A 1DRGA 2LM1A 1ZQTA 4RT2A 4P0QA 2KEYA 1L7MA 3IN5A 3K75D 3C5GA 7ICJA 2BPFA 4GIBA 4M47A 2HBMA 5AI4A 2WF5A 4RNOA 2F77X 2C2RA 5IIMA 5J8YA 2XCAA 1ZQAA 4UB8U 3RRGA 2CPRA 3K1RB 2R18A 3MC1A 4IQVA 3TARA 1XO1A 2DPJA 3UMBA 5KFDA 4UBBA 7ICIA 2HCFA 3BS5B 5B5EU 3ISCA 1A76A 5KFMA 1TVAA 3QXGA 4O5KA 4CNQA 3HILA 1Q8KA 4CF4A 2JZBA 5KFHA 1BGXT 4IRKA 2HBJA 2RDIA 5KG3A 4UB4A 4EZ6A 2DL0A 3QEAZ 2JMGA 3D2QA 4I2AA 2AGPA 4KLHA 4DQQA 3V6KA 2HHVA 2KK0A 2AJQA 2F8LA 7ICMA 9ICPA 4KX3A 3BDPA 5ALUA 4UAWA 3WKDA 2GOLA 5AK4A 4C0ZA 1Z4OA 2NRVA 8ICMA 3PSPA 4DS5A 2HDOA 5HHIA 3CYMA 5J2BA 8ICKA 1ZQVA 1JRPA 1TK0A 2E8NA 1NOMA 4US9A 3PO5A 4ED6A 2OHFA 3D6JA 2HOFA 7ICGA 3L4PA 4YMNA 2ZUDA 4OJ5A 5KG2A 4EYHB 1SKRA 2C22A 2AU0A 1ZD2P 3CRXA 2W9MA 4USAA 3EPIA 1WCLA 5DQIA 3RAQA 3WKEA 3NVYA 3IRUA 4YG2A 3MDCA 4Q8EA 4PHDA 3RBEA 9ICGA 1T8EA 4QWEA 4CCHA 4FZNA 4FO6A 1DOQA 5J2CA 4GLXA 7ICTA 2Y1JA 4PGQA 5AK5A 4UAUA 4I2GA 5KFXA 3DDHA 5L9XA 3F2CA 4NM2A 4WJ3B 2HVIA 2H3ZA 3RB0A 4QZFA 4KLLA 1NI3A 5KL8B 2K4PA 4QIWC 1L5UA 1B22A 3QNMA 5KT7A 2WB1F 4J9LA 2R8KA 3KHLA 3M6KA 2W8LA 4O3PA 1JN3A 3Q8RB 5DG7A 3N7PD 3RF9A 3RH6A 4NM1A 4F2SA 2FLLA 4ECQA 4I2CA 2ZIWB 4E0DA 2IBKA 2JGAA 3F2DA 2GLEA 2MUTB 1V97A 3BS7A 4TURA 4DS4A 4ELUA 1ZQEA 3OPXA 5KFWA 2E8PA 2HHSA 1NK6A 1JX4A 2G0AA 3LWMA 2PI4A 5ALYA 1SL1A 4LZDA 5ALQA 5DKWA 2F1HA 3SV3A 4DF4A 3QU7A 3KZXA 2FMPA 4QZAA 1B43A 4F5QA 2NRZA 2BDPA 3MR2A 3WK6A 3Q8SB 5J2HA 4K4HA 3KKAC 4DLGA 3TFRA 1XSLA 4CDGA 2F76X 1Z1BA 2JEIA 2FI1A 3NASA 2YQEA 4YVZA 4KLIA
chains in the Genus database with same CATH topology
5L1MA 2KSOB 1PK1A 1V38A 1OW5A 2Y9UA 5J8YA 1UCVA 2KSOA 3TADC 3K1RB 4IS7A 1PK3A 2F44A 5KNIA 2QKQA 2EAMA 3BS5B 2D3DA 2QB0B 1JI7A 1KW4A 2LMRA 3HILA 1V85A 1B0XA 4RQMA 3TACB 1RG6A 4NL9C 3SEIA 2DL0A 2L5YA 2K4PA 1UQVA 1SV0C 3KKAA 1SGGA 2K60A 2LPEA 4MHVA 3IDWA 2B6GA 5JU5A 1LKYB 2KE7A 2QARB 1SXDA 2EAPA 2F8KA 1SXEA 2E8MA 2F3NA 2Y9TA 1LKYA 3BS5A 2GLEA 2QARA 2EAOA 2QB0A 2JV3A 3BS7A 1SV4A 1X66A 2ES6A 2QB1A 3BQ7A 4NJ8A 3TADA 2DKZA 2DKXA 2E8PA 4PZNA 1COKA 5JTIA 1F0MA 1WWUA 2E8OA 2E8NA 1OXJA 2KIVA 1DXSA 2D8CA 1X40A 1WWVA 4RQNA 5J8YC 2ESEA 4NL9A 2YTUA 3KKAC 5F3XB 2KMDA 1SV0A 1Z1VA 1B4FA 1X9XA 2FE9A 3H8MA 2EANA 5JRTA 1PK1B 4PZOA 2KG5A 3SENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L1M A;  2KSO B;  1PK1 A;  1V38 A;  1OW5 A;  2Y9U A;  5J8Y A;  1UCV A;  2KSO A;  3TAD C;  3K1R B;  4IS7 A;  1PK3 A;  2F44 A;  5KNI A;  2QKQ A;  2EAM A;  3BS5 B;  2D3D A;  2QB0 B;  1JI7 A;  1KW4 A;  2LMR A;  3HIL A;  1V85 A;  1B0X A;  4RQM A;  3TAC B;  1RG6 A;  4NL9 C;  3SEI A;  2DL0 A;  2L5Y A;  2K4P A;  1UQV A;  1SV0 C;  3KKA A;  1SGG A;  2K60 A;  2LPE A;  4MHV A;  3IDW A;  2B6G A;  5JU5 A;  1LKY B;  2KE7 A;  2QAR B;  1SXD A;  2EAP A;  2F8K A;  1SXE A;  2E8M A;  2F3N A;  2Y9T A;  1LKY A;  3BS5 A;  2GLE A;  2QAR A;  2EAO A;  2QB0 A;  2JV3 A;  3BS7 A;  1SV4 A;  1X66 A;  2ES6 A;  2QB1 A;  3BQ7 A;  4NJ8 A;  3TAD A;  2DKZ A;  2DKX A;  2E8P A;  4PZN A;  1COK A;  5JTI A;  1F0M A;  1WWU A;  2E8O A;  2E8N A;  1OXJ A;  2KIV A;  1DXS A;  2D8C A;  1X40 A;  1WWV A;  4RQN A;  5J8Y C;  2ESE A;  4NL9 A;  2YTU A;  3KKA C;  5F3X B;  2KMD A;  1SV0 A;  1Z1V A;  1B4F A;  1X9X A;  2FE9 A;  3H8M A;  2EAN A;  5JRT A;  1PK1 B;  4PZO A;  2KG5 A;  3SEN A; 
#chains in the Genus database with same CATH topology
 3QE9 Y;  4O3N A;  4NLN A;  2IHN A;  4OJ6 A;  3TAQ A;  3RB6 A;  2R8G A;  2HW3 A;  3RB3 A;  3T5H A;  1PZN A;  2J6T A;  5ALN A;  4KLU A;  3M9N B;  1ZQK A;  3BJY A;  2DUY A;  1SWV A;  2YMM A;  2K4H A;  2C2E A;  3AU2 A;  3IM1 A;  3QZ7 A;  5J0X A;  4MF2 A;  1UPH A;  1ZQR A;  4UAY A;  2JXJ A;  1NJX A;  5L1I A;  3A0H U;  4FFD A;  2R8H A;  4JMU A;  5J0S A;  3K1Z A;  2V4Q A;  1SV0 C;  4G3I A;  3SD7 A;  3TKA A;  4PJ0 U;  4ELT A;  4ECW A;  2C2D A;  3M9O B;  2XGP A;  2ODG A;  4IR1 A;  2HHW A;  9ICJ A;  4FS1 A;  1F44 A;  3K4G A;  3C2M A;  2AHO B;  3CNH A;  4EX6 A;  4ECR A;  3B9J A;  5AI8 A;  1ZQP A;  4MFF A;  2J6U A;  2F2A B;  1TAQ A;  3AQF A;  2UVU A;  7ICK A;  3J81 j;  4ECZ A;  5ALM A;  5E79 U;  3AUO A;  4GC6 A;  5ALX A;  2BCR A;  3ISD A;  9ICF A;  4PPX A;  1WYG A;  2XIC A;  1CUK A;  4ED1 A;  4IR9 A;  4J9K A;  2R8J A;  1UHU A;  1S0M A;  5EE1 A;  7ICR A;  3B0Y A;  3AU6 A;  3H0R B;  2A3V A;  4EEY A;  1ZQX A;  2WAQ F;  2MU2 A;  1FEZ A;  2BQ3 A;  2ASJ A;  2ZUB A;  2EAN A;  4BXO A;  2G07 A;  4RQ2 A;  3C21 A;  4RQ1 A;  3EW9 A;  3SEN A;  4LVS A;  8ICW A;  2E5S A;  2HHU A;  1XO0 A;  3RJI A;  1ZD5 A;  1KFS A;  1HUO A;  2FPK A;  2WF8 A;  3FM9 A;  3NGD A;  5DG8 A;  5CWR A;  3ZDC A;  1QQ6 A;  2G5H B;  3PR4 A;  2NRX A;  8ICV A;  8ICC A;  3QU2 A;  4IQT A;  2ZXI A;  3CP8 A;  4QZ9 A;  3CW2 C;  2W9A A;  3BZK A;  2GO7 A;  4UB1 A;  3GIJ A;  5EE3 A;  4DL2 A;  3RRH A;  2V4R A;  1U47 A;  3GV8 B;  8ICE A;  2IOH A;  2I1Q A;  1ZQO A;  5KFO A;  5B66 U;  3SYZ A;  2F3N A;  2K4E A;  4C4R A;  1ZQB A;  3N7S C;  2WTF A;  5ALP A;  4PHP A;  3EZ5 A;  2YB4 A;  4F2R A;  3DV9 A;  5AI5 A;  1S10 A;  1VLB A;  3MR3 A;  2FJ6 A;  4NJ8 A;  3WK9 A;  3T5K A;  2FMS A;  3HPO A;  4EEN A;  1YT3 A;  4ED0 A;  1C20 A;  3JPS A;  1TAU A;  3N28 A;  4LZG A;  1HJP A;  1K5O A;  5KG7 A;  2PMZ C;  1M6Y A;  3SAF A;  1T7P A;  4F8R A;  2EH9 A;  2K8A A;  5J0O A;  2Q4T A;  3BZC A;  1ZQD A;  4FZL A;  2OWO A;  2W9C B;  2PKE A;  4Y2T A;  4FBU A;  2H3V A;  4R8U A;  1ZET A;  2FLN A;  1N62 A;  5L1M A;  3AEV A;  2NRT A;  5AI9 A;  1LV5 A;  1V38 A;  5HR7 A;  1NNL A;  1SZH A;  2KD1 A;  1ZQC A;  2G09 A;  5DBC A;  2FLP A;  5KFK A;  8ICP A;  2RLT A;  3M8R A;  4M9J A;  2VA8 A;  4J9S A;  1PVR A;  4IQU A;  4O3M A;  2EAM A;  5C5J A;  4KX5 A;  9ICW A;  3F53 A;  4UB5 A;  4DOA A;  4TQS A;  2ATL A;  1A0P A;  4OJO A;  4RQM A;  4B9S A;  3C2L A;  3PML A;  2NO5 A;  1MA7 A;  3PX6 A;  1L7N A;  3AQE A;  2KKP A;  2JR5 A;  4ECT A;  8ICO A;  3H40 A;  3MR5 A;  2KFZ A;  3MR6 A;  5J2G A;  5JU5 A;  3RBD A;  1LKY B;  5EWF A;  5AKG A;  1RYS A;  1SXD A;  2VA3 A;  2EAP A;  2IOF K;  8ICS A;  2F8K A;  4EEK A;  2Y9T A;  4KLE A;  1QSY A;  1LKY A;  2KOB A;  4YP3 A;  2BR0 A;  5ALT A;  5KFB A;  2FDR A;  2BDU A;  7ICV A;  2KN7 A;  2BQR A;  4I28 A;  4F5P A;  4I2H A;  3QX7 A;  1ZXI A;  2W11 A;  2KIW A;  3IG8 A;  5ALK A;  4CGZ A;  1N60 A;  5A0L A;  4C8K A;  5D4B A;  4F4K A;  1KL9 A;  1ZQJ A;  7ICF A;  4QZI A;  5KG4 A;  5J2K A;  1DXS A;  3G6Y A;  7ICU A;  3ETR A;  1BPD A;  2O6K A;  5J2F A;  2CN1 A;  2YTU A;  2UVV A;  2VKQ A;  1XS9 D;  3JPQ A;  3H0L B;  2JEG A;  4ECU A;  1T3Q A;  1DK2 A;  1N56 A;  3EUB 2;  2CXY A;  1BNP A;  1DK3 A;  4Y2V A;  8ICY A;  2ZIV B;  2ZG6 A;  5KFI A;  1S97 A;  2XY7 A;  4DQR A;  1KQQ A;  3MGV A;  8ICU A;  2ZIV A;  3RAX A;  4XQ8 A;  5AKK A;  4U6P A;  2R8I A;  3F5E A;  5KNI A;  3EWA A;  3UXO A;  5C0Y A;  5F9N A;  4O9M A;  3RJE A;  5AI6 A;  1VJ5 A;  1S9F A;  4RQ6 A;  2BCU A;  1ZOL A;  4CRX A;  3FC4 A;  3GFK B;  4QNL A;  2HMX A;  4R63 A;  1D8B A;  5H2F U;  4F5R A;  1UQV A;  8ICB A;  5ALL A;  2LPE A;  1U4B A;  3KOO A;  4DL5 A;  4YQW A;  4YD2 A;  5T14 A;  2QAR B;  4KLT A;  2JEJ A;  1H38 A;  3BS5 A;  2QAR A;  3RB4 A;  5TZV A;  4CF5 A;  2WHE A;  4PZN A;  2E1F A;  4UB3 A;  5KFZ A;  2F1I A;  4I2F A;  2HHX A;  3IV6 A;  4OJP A;  4ED8 A;  2KZM A;  2PXI A;  5AIB A;  1ZQW A;  9ICK A;  3OGU A;  2H3Q A;  2NO4 A;  1SB3 C;  2XID A;  5ALZ A;  4EEL A;  4NL9 A;  9ICB A;  4EYI B;  5KFY A;  4DO9 A;  3JPO A;  3D2S A;  2EDU A;  2ZTD A;  4AP9 A;  5ALF A;  4DOC A;  1QCK A;  3LVW A;  5IIL A;  1NJW A;  5L1L A;  4QIW F;  3ED5 A;  9ICM A;  3MAB A;  3OHB A;  2AQ4 A;  1DGS A;  9ICT A;  4ACO A;  1L6N A;  1KLN A;  1KTQ A;  2W7P A;  1URJ A;  2HSZ A;  3GIL A;  3SAG A;  3T79 A;  2Y9U A;  3C2K A;  1D9D A;  4M9L A;  1X6I A;  2Y1I A;  1S0N A;  1A77 A;  5D49 A;  2ZTC A;  2QB0 B;  4BDP A;  2WFA A;  4EX7 A;  3WKB A;  3UMG A;  3NTU A;  5EE0 A;  4QZD A;  2DPI A;  1Y88 A;  5DLF A;  1ZD3 A;  4B9N A;  3OHA A;  1L3V A;  8ICL A;  3B0X A;  5J0R A;  4RQ3 A;  3RJJ A;  5KFE A;  3H4B A;  4M9G A;  1GO3 F;  4FE3 A;  1RPL A;  3IDW A;  1IIP A;  2KV2 A;  2BCS A;  2PI5 A;  4YXJ A;  4C8O A;  2OCE A;  1ZQH A;  2XY6 A;  1PVQ A;  3UMC A;  4B9U A;  5L1K A;  3QUB A;  3RJF A;  4YMO A;  1QQ7 A;  4NLC A;  1S77 D;  2KFN A;  1ED1 A;  1ZJN A;  4PH5 A;  1RZT A;  9ICN A;  5GTH U;  5EOZ A;  9ICH A;  8ICT A;  1Q3U A;  2QLT A;  2YML A;  2EZY A;  2D8C A;  3UQ2 A;  4BGD A;  4RQ7 A;  3Q8P B;  2OH2 A;  1L8L A;  4MFC A;  1L7O A;  4M04 A;  2ZIW A;  4DSI A;  9ICL A;  3I28 A;  2MUT A;  2ZJ5 A;  7ICQ A;  1IG6 A;  2LI6 A;  2H3F A;  2W55 A;  3AM9 A;  5DQG A;  4GFJ A;  4I29 A;  4KMO B;  3M1Y A;  2KSO B;  3DEE A;  5III A;  5KFN A;  2N1R A;  1WG8 A;  5ALW A;  3N97 B;  2KSO A;  2VA2 A;  2BQU A;  5KT6 A;  1ZQZ A;  4PGY A;  3JPN A;  8ICA A;  4C80 A;  2AH5 A;  1ZQM A;  4Z6E A;  1UT5 A;  4CE6 A;  4RT3 A;  2I6X A;  4RUA A;  4IC9 A;  3PY8 A;  2D3D A;  4M0A A;  2Y0S F;  3QUQ A;  2OM6 A;  4NLB A;  5AM2 A;  5AKL A;  1V85 A;  1ZQQ A;  1NK8 A;  2UVW A;  4YR2 A;  5DB9 A;  3TQ1 A;  4QW8 A;  4Q8F A;  2ZJ8 A;  5CRX A;  5L1J A;  2RHF A;  4R64 A;  4KLO A;  1XSP A;  2JHD A;  4P4M A;  1YZ6 A;  3NUQ A;  2YN4 A;  1SL0 A;  1TV9 A;  2WB1 C;  2E8M A;  3FYH A;  3H8W A;  1ZRN A;  2AXT U;  2LM4 A;  2P6U A;  1C7Y A;  3QU4 A;  5BPC A;  3HX0 A;  1KSP A;  3SAH A;  4GXI A;  1Z4N A;  5TIS U;  5KFJ A;  3F5A A;  3ETL A;  5DB7 A;  1RQL A;  1TKD A;  4Y2U A;  3ZD9 A;  3PW0 A;  2NV3 A;  1L3S A;  3I76 A;  3HWT A;  4P2H A;  2PFQ A;  4HYK A;  4Y2J A;  5KFT A;  4AYB C;  1MN8 A;  2RRD A;  2KIV A;  1MC8 A;  1X40 A;  4RQN A;  3V7L A;  2XGQ A;  3ZDE A;  1UA0 A;  5ALJ A;  3MFH A;  1X9X A;  1FO4 A;  1Z19 A;  1ZYQ A;  2OEH A;  5KG6 A;  5JRT A;  4ECV A;  2VJ4 A;  5HHH A;  2HHQ A;  2KG5 A;  3PZP A;  5AKI A;  1LVH A;  5AM4 A;  5AM3 A;  1JMS A;  1QTM A;  7ICN A;  4BUG A;  2BGW A;  4J03 A;  5KFQ A;  5ALR A;  4DSL A;  3RR8 A;  2A1J B;  2JH7 A;  2GWS A;  2J6S A;  3H7I A;  3MBY A;  2MRL A;  2IA6 A;  3MDA A;  3BQ2 A;  5CB1 A;  2Q0Z X;  5G5H A;  3RR7 A;  3BQT A;  5AI0 A;  2HOI A;  2LBO A;  1NK9 A;  4P4P A;  4J9R A;  2KJ8 A;  1RXV A;  1BVS A;  3F2B A;  4FZM A;  4YXM A;  5AKX A;  2ISO A;  2PMZ F;  3WK7 A;  1RDF A;  1JIH A;  2I5H A;  4CF3 A;  4YD1 A;  9ICO A;  4I27 A;  3GU3 A;  3H8S A;  2HVH A;  3RJK A;  3PX4 A;  2QB1 A;  3ISB A;  4B9T A;  5DB6 A;  5JTI A;  3V7K A;  3KHH A;  1WWU A;  2FMQ A;  1QLN A;  3IHQ B;  4P4O A;  2RDJ A;  4YCX A;  1ZQN A;  5JUM A;  4KN4 A;  1QQ5 A;  4RUC A;  1VDV A;  3QU5 A;  4HAI A;  2F1J A;  4P0P B;  9ICV A;  5J8Y C;  1BPZ A;  3AMZ A;  3V6H A;  4ECX A;  5F3X B;  4YMM A;  3QZ8 A;  2KMD A;  3R9K A;  5D46 A;  1U49 A;  4C4S A;  4UB6 U;  4O3R A;  8ICZ A;  4KLS A;  4RNN A;  2WAQ C;  1F5S A;  4DEZ A;  2VJ5 A;  4LJX A;  7ICO A;  5IIN A;  2FPM A;  4MF8 A;  5ALH A;  1NKE A;  3M7D A;  1AQ6 A;  3FAH A;  3KHG A;  4F4Z A;  4UW9 A;  5J0T A;  2DQN B;  3MGH A;  4Y2R A;  1YZ7 A;  1ZQY A;  1SWW A;  2KNJ A;  3QUC A;  5KFU A;  2KZ3 A;  3H4D A;  2NYV A;  5ALG A;  2P35 A;  2W9C A;  1HUZ A;  4Z6F A;  5CP2 A;  4US8 A;  1T94 A;  3LDA A;  1RXW A;  4PHA A;  5AKY A;  4NL9 C;  3Q8L A;  1DGJ A;  2W8K A;  2BCQ A;  4QZ8 A;  5AKZ A;  1KBU A;  5J0P A;  4DFP A;  4TUS A;  4ZOH C;  1CEZ A;  2C28 A;  1NKB A;  3EPG A;  3QYP A;  5J29 A;  4B9L A;  1X9W A;  1ZQG A;  2CRX A;  5AKE A;  2EZX A;  4EZ9 A;  1NKC A;  2JV3 A;  1SL2 A;  3ONN A;  2XCP A;  8ICX A;  3RTV A;  3PX0 A;  1Z00 B;  1TE2 A;  4KLJ A;  3LYS A;  9ICI A;  1ECW A;  2XY5 A;  2B0C A;  5AHX A;  2BKE A;  1Z00 A;  5DGB A;  9ICA A;  4UQG A;  3PMN A;  2EZZ A;  4IRC A;  4RZR A;  4UB2 A;  4RPZ A;  1MSW D;  1K1S A;  4UAT A;  1FFU A;  4JV2 A;  1N5W A;  4B9M A;  2ZTE A;  3LK9 A;  4ECY A;  4YN4 A;  1U45 A;  3TAP A;  3N4M B;  2BPG A;  1KEJ A;  2FE9 A;  2HI0 A;  2MA1 A;  2KVS A;  4UAR A;  8ICQ A;  1TAM A;  4PZO A;  4UAS A;  4QZG A;  4I2B A;  4DFK A;  1D9F A;  1NK4 A;  4QZC A;  4J9Q A;  2G08 A;  3VC8 A;  4JV1 A;  5J0Y A;  3HRD D;  2XC9 A;  3ORY A;  1EXN A;  5DB8 A;  3RH4 A;  2W7O A;  1MQ3 A;  2M0N A;  4OO1 J;  4RNM A;  3E2E A;  1UT8 A;  2F44 A;  4XUS A;  2QKQ A;  5CJ7 A;  4QZH A;  2BHN A;  3TFS A;  9ICS A;  3UXN A;  1JRO A;  1Q3V A;  4DSF A;  3GZF A;  2LMR A;  2K8B B;  1MQ2 A;  1RG6 A;  2ZJA A;  3SEI A;  4C8L A;  4NLG A;  2XI9 A;  4MFA A;  4K4I A;  4NWI A;  2KTQ A;  4NXZ A;  3NRZ A;  4Q44 A;  5DGA A;  4O5E A;  5ALI A;  3Q8M A;  4DWI A;  1S5L U;  3LVV A;  4PL1 A;  3KHR A;  4NLK A;  4KLF A;  1SXE A;  3C1Y A;  5J2D A;  4P0Q B;  4JV0 A;  1FIQ A;  1LB2 B;  1X6J A;  4GXK A;  1X66 A;  5KG0 A;  4O3S A;  1XWL A;  2ES6 A;  3TAD A;  2AGQ A;  1NK0 A;  1SIJ A;  1D8Y A;  8ICG A;  2BPC A;  4EBD A;  3HKZ C;  2W43 A;  2DWQ A;  3C1Z A;  5KFV A;  1NZB A;  4DCC A;  1ZQI A;  4KN7 A;  4NLZ A;  4EBC A;  3JPP A;  8ICI A;  2PFN A;  3M8S A;  1S0O A;  1ZQL A;  3NVZ A;  5J2A A;  2JZB B;  5GTI U;  5J2J A;  3OTQ A;  4DOB A;  1P7D A;  2KIC A;  5HML A;  4Q43 A;  2ASL A;  4YR0 A;  3UQ0 A;  1JXL A;  5KAI U;  2KJ5 A;  2XO7 A;  2K89 A;  4PGX A;  3E58 A;  1ZD4 A;  4ED2 A;  3WK5 A;  5EE9 A;  3Q8Q B;  2DF4 B;  3ZDB A;  2BCV A;  3VCB A;  3JPR A;  1RQN A;  4BWJ A;  4B6J A;  4ZH4 A;  9ICX A;  2HHT A;  4YFK A;  2KJ9 A;  4J9P A;  1S0V A;  3QEB Z;  2L5Y A;  4DSK A;  3GIM A;  4X5V A;  5AKH A;  2IMW P;  4MEX A;  1SGG A;  5HR6 A;  3OJU A;  2Z7J A;  1JAL A;  3O0F A;  5DDM A;  3N7R C;  3GV7 B;  4QWB A;  3ZD8 A;  4O3O A;  2JEF A;  3V72 A;  4QW9 A;  2W54 A;  4JK1 A;  2ALZ A;  2QB0 A;  2W03 A;  3C5F A;  3RH5 A;  2YX8 A;  3THV A;  2DKZ A;  2W9B B;  3FDS A;  3PVX A;  4JWN A;  4KTQ A;  1O03 A;  3MGI A;  3KZI U;  2ZIU B;  1NK7 A;  5AIC A;  2W9B A;  3SV4 A;  4DFD A;  4ECS A;  1JUD A;  1IXR A;  4DLE A;  1Q46 A;  1ZQ1 C;  5CHG A;  2ZIU A;  1OUQ A;  4C8N A;  5IIJ A;  2FPL A;  2RQ5 A;  1J2M A;  4JB3 A;  1X42 A;  1HIW A;  2A1A A;  1RYR A;  4KLD A;  4OD0 A;  3C28 A;  1BPY A;  4UAV A;  4DQP A;  4RQ8 A;  1A6S A;  1Z3E B;  1U9L A;  2DFL A;  4TQR A;  4G9B A;  3H8M A;  4J9O A;  1X9M A;  1D8L A;  5KFA A;  1V9P A;  3LWL A;  1CI4 A;  1PK1 B;  5FP0 A;  3E0F A;  2XVT A;  4Y2Q A;  3PSF A;  4O3Q A;  1PK1 A;  2ISP A;  5AK6 A;  4IRD A;  4M9N A;  4PL2 A;  4R65 A;  4BJQ A;  5KT3 A;  1UCV A;  3SMV A;  2RP5 A;  3Q8K A;  2WF7 A;  2KHQ A;  1CRX A;  1PK3 A;  3WKA A;  1N5X A;  5KTQ A;  1U48 A;  5KFC A;  1XC9 A;  1L3T A;  4F92 B;  5KT4 A;  3QU9 A;  4JWM A;  2HOQ A;  3SZ2 A;  5ALE A;  3IG5 A;  5J0Q A;  2YMQ A;  5EWE A;  1ZJM A;  1WUD A;  2YY6 A;  2DGZ A;  4AYB F;  3GQC A;  4M6W B;  4B9V A;  4DFM A;  4NY8 A;  4GC7 A;  5G5G A;  5KFF A;  2NRW A;  3NVV A;  3TAN A;  2KE7 A;  4M6W A;  4C7Y A;  1TK5 A;  9ICE A;  5HMM A;  3D2N A;  2LHT A;  1NZP A;  2LYA A;  5DBB A;  4F5O A;  4RPY A;  1T3N A;  3PW4 A;  5KFR A;  1SV4 A;  1S76 D;  4BX9 C;  2DKX A;  1COK A;  3PW7 A;  4MEY A;  4QZB A;  1F0M A;  1SZP A;  5KT5 A;  3PW5 A;  1X2I A;  3PSI A;  2H3I A;  4ELV A;  1KRP A;  3UM9 A;  2ZXH A;  2VAN A;  1N48 A;  1KDH A;  4DL7 A;  7ICP A;  2UVR A;  4QWA A;  4O5C A;  1WWV A;  3MFI A;  2G06 A;  4RU9 A;  1ZQS A;  1PVP A;  3WU2 U;  4J9N A;  1QSL A;  2W3R A;  4OCZ A;  2H5X A;  3OSP A;  1Z1V A;  3H8J A;  5IIO A;  1NJZ A;  4Z6D A;  4DL4 A;  2ZIX B;  4C8M A;  4DL6 A;  1TFR A;  3PST A;  2HBK A;  3ALR A;  4ICA A;  3EYZ A;  2ASD A;  3S6J A;  3A0B U;  1ZQF A;  2ZIX A;  2K4I A;  5HP4 A;  4RPX A;  1KFT A;  5DBA A;  2HBL A;  4Y2S A;  2PFP A;  3SR6 A;  8ICR A;  1XNS A;  2ZUC A;  3G6X A;  2DBY A;  3WKC A;  4I2D A;  3C23 A;  9ICR A;  3V7J A;  4R66 A;  2JH1 A;  2JRZ A;  2MSN A;  4KLM A;  2B21 A;  1KW4 A;  4DSJ A;  1B0X A;  2IOF A;  2Y0S C;  2W04 A;  3GII A;  5K4L A;  1FFV A;  2LKY A;  1NJY A;  2IHM A;  4C4T A;  3PO4 A;  2A1J A;  1ZRM A;  4Y2P A;  3AN1 A;  7ICH A;  2W3S A;  3C29 A;  1IV8 A;  5F9L A;  4QWD A;  4Z6C A;  3AL0 B;  4BXO B;  3PNC A;  3BQ7 A;  3L5K A;  4F91 B;  5KFS A;  1J97 A;  5J0W A;  4OJL A;  4PHE A;  3TI0 A;  4DSE A;  4KLQ A;  5KT2 A;  2P6R A;  3ZDD A;  1PUZ A;  4FS2 A;  4XA5 A;  3HT3 A;  5CA7 A;  7ICL A;  3T3F A;  2ESE A;  1L8O A;  2KHV A;  1KN5 A;  5CR0 A;  3ZDA A;  4KIT B;  3T5J A;  3SQI A;  5J2I A;  1QSS A;  1NK5 A;  7ICE A;  2M9N A;  5EWG A;  3PV8 A;  1UA1 A;  4ED7 A;  5DQH A;  2YB1 A;  3IP4 B;  1OW5 A;  7ICS A;  3RJH A;  1N2X A;  3TAD C;  3SI8 A;  1BPX A;  5AK3 A;  5ALD A;  2E1E A;  3ICX A;  4IS7 A;  1BNO A;  4UBC A;  4P0P A;  4TUP A;  3UPQ A;  4UAZ A;  4F71 A;  3KTQ A;  4K4G A;  5KAF U;  5DLG A;  3HW8 A;  4U7C A;  2V9W A;  3WK4 A;  4RQ5 A;  1TK8 A;  3G6V A;  4EBE A;  3KKA A;  3M6Z A;  1COO A;  4F50 A;  2B6G A;  5ALO A;  3BQ1 A;  1N61 A;  2MAX A;  4Y2X A;  5DDY A;  5BOL A;  1ARO P;  3RJG A;  4KMU A;  1JXE A;  5AIA A;  5J2E A;  1ZQU A;  5J0U A;  4YR3 A;  1IM4 A;  4DF8 A;  5ALV A;  5HNK A;  4R8U B;  2D6F C;  2AGO A;  4O0I A;  5ALS A;  3UXP A;  2E8O A;  1RYU A;  4QJF B;  5BOM A;  2LYH A;  5DG9 A;  1XU4 A;  1J2N A;  2PFO A;  3KBB A;  4GXJ A;  4F4W A;  5AM0 A;  4F3O A;  1BPE A;  1SKW A;  3PR5 B;  1WCN A;  1SV0 A;  1B4F A;  4I2E A;  5KFL A;  3GV5 B;  4TUQ A;  4DL3 A;  4QWC A;  3BQ0 A;  4FBT A;  8ICN A;  1XSN A;  3ZI4 A;  3H0M B;  2YMP A;  2GH1 A;  2E3T A;  2I9G A;  1T4G A;  5KFG A;  2OYY A;  4QZE A;  2K8C B;  2A19 A;  1QH9 A;  3GIK A;  1HEK A;  4IL6 U;  3I1Y A;  3KFU F;  4XRH A;  3PW2 A;  2G5I B;  4F93 B;  5KL1 B;  4A8E A;  2P66 A;  4Q45 A;  3QUT A;  8ICH A;  1L3U A;  8ICF A;  3NRW A;  3L3F X;  4I2I A;  4BWM A;  5CEH A;  1KKX A;  1O08 A;  1K1Q A;  3HP6 A;  1JI7 A;  3U26 A;  1S8O A;  3V6J A;  1BPB A;  3OSN A;  4Y2Y A;  3TAC B;  3RFA A;  1KFD A;  4F4X A;  3M9M B;  4F4Y A;  3HJE A;  4J9M A;  5KFP A;  2KZZ A;  3HKZ F;  2WF9 A;  2EQY A;  2AQ0 A;  2VIX A;  2K60 A;  3WK8 A;  4F5N A;  4MHV A;  1X9S A;  9ICQ A;  8ICJ A;  2WF6 A;  3OJS A;  4DFJ A;  4RQ0 A;  4M9H A;  3GDX A;  4M2Y A;  3NS1 A;  4F72 A;  2EAO A;  3T5L A;  9ICC A;  2OXO A;  3KD3 A;  2KP7 A;  4I2J A;  2KKV A;  5AM1 A;  4DQI A;  9ICU A;  5AM5 A;  2KVC A;  5AKJ A;  1RM6 C;  4JUZ A;  4IQW A;  4ED3 A;  5KG5 A;  4NV0 A;  1OXJ A;  5KG1 A;  5IIK A;  4C7Z A;  1L7P A;  4DQS A;  1SKS A;  2LYB A;  2BZF A;  3JPT A;  4KLG A;  4RQ4 A;  3NVW A;  1N63 A;  1DRG A;  2LM1 A;  1ZQT A;  4RT2 A;  4P0Q A;  2KEY A;  1L7M A;  3IN5 A;  3K75 D;  3C5G A;  7ICJ A;  2BPF A;  4GIB A;  4M47 A;  2HBM A;  5AI4 A;  2WF5 A;  4RNO A;  2F77 X;  2C2R A;  5IIM A;  5J8Y A;  2XCA A;  1ZQA A;  4UB8 U;  3RRG A;  2CPR A;  3K1R B;  2R18 A;  3MC1 A;  4IQV A;  3TAR A;  1XO1 A;  2DPJ A;  3UMB A;  5KFD A;  4UBB A;  7ICI A;  2HCF A;  3BS5 B;  5B5E U;  3ISC A;  1A76 A;  5KFM A;  1TVA A;  3QXG A;  4O5K A;  4CNQ A;  3HIL A;  1Q8K A;  4CF4 A;  2JZB A;  5KFH A;  1BGX T;  4IRK A;  2HBJ A;  2RDI A;  5KG3 A;  4UB4 A;  4EZ6 A;  2DL0 A;  3QEA Z;  2JMG A;  3D2Q A;  4I2A A;  2AGP A;  4KLH A;  4DQQ A;  3V6K A;  2HHV A;  2KK0 A;  2AJQ A;  2F8L A;  7ICM A;  9ICP A;  4KX3 A;  3BDP A;  5ALU A;  4UAW A;  3WKD A;  2GOL A;  5AK4 A;  4C0Z A;  1Z4O A;  2NRV A;  8ICM A;  3PSP A;  4DS5 A;  2HDO A;  5HHI A;  3CYM A;  5J2B A;  8ICK A;  1ZQV A;  1JRP A;  1TK0 A;  2E8N A;  1NOM A;  4US9 A;  3PO5 A;  4ED6 A;  2OHF A;  3D6J A;  2HOF A;  7ICG A;  3L4P A;  4YMN A;  2ZUD A;  4OJ5 A;  5KG2 A;  4EYH B;  1SKR A;  2C22 A;  2AU0 A;  1ZD2 P;  3CRX A;  2W9M A;  4USA A;  3EPI A;  1WCL A;  5DQI A;  3RAQ A;  3WKE A;  3NVY A;  3IRU A;  4YG2 A;  3MDC A;  4Q8E A;  4PHD A;  3RBE A;  9ICG A;  1T8E A;  4QWE A;  4CCH A;  4FZN A;  4FO6 A;  1DOQ A;  5J2C A;  4GLX A;  7ICT A;  2Y1J A;  4PGQ A;  5AK5 A;  4UAU A;  4I2G A;  5KFX A;  3DDH A;  5L9X A;  3F2C A;  4NM2 A;  4WJ3 B;  2HVI A;  2H3Z A;  3RB0 A;  4QZF A;  4KLL A;  1NI3 A;  5KL8 B;  2K4P A;  4QIW C;  1L5U A;  1B22 A;  3QNM A;  5KT7 A;  2WB1 F;  4J9L A;  2R8K A;  3KHL A;  3M6K A;  2W8L A;  4O3P A;  1JN3 A;  3Q8R B;  5DG7 A;  3N7P D;  3RF9 A;  3RH6 A;  4NM1 A;  4F2S A;  2FLL A;  4ECQ A;  4I2C A;  2ZIW B;  4E0D A;  2IBK A;  2JGA A;  3F2D A;  2GLE A;  2MUT B;  1V97 A;  3BS7 A;  4TUR A;  4DS4 A;  4ELU A;  1ZQE A;  3OPX A;  5KFW A;  2E8P A;  2HHS A;  1NK6 A;  1JX4 A;  2G0A A;  3LWM A;  2PI4 A;  5ALY A;  1SL1 A;  4LZD A;  5ALQ A;  5DKW A;  2F1H A;  3SV3 A;  4DF4 A;  3QU7 A;  3KZX A;  2FMP A;  4QZA A;  1B43 A;  4F5Q A;  2NRZ A;  2BDP A;  3MR2 A;  3WK6 A;  3Q8S B;  5J2H A;  4K4H A;  3KKA C;  4DLG A;  3TFR A;  1XSL A;  4CDG A;  2F76 X;  1Z1B A;  2JEI A;  2FI1 A;  3NAS A;  2YQE A;  4YVZ A;  4KLI A; 
#chains in the Genus database with same CATH homology
 5L1M A;  2KSO B;  1PK1 A;  1V38 A;  1OW5 A;  2Y9U A;  5J8Y A;  1UCV A;  2KSO A;  3TAD C;  3K1R B;  4IS7 A;  1PK3 A;  2F44 A;  5KNI A;  2QKQ A;  2EAM A;  3BS5 B;  2D3D A;  2QB0 B;  1JI7 A;  1KW4 A;  2LMR A;  3HIL A;  1V85 A;  1B0X A;  4RQM A;  3TAC B;  1RG6 A;  4NL9 C;  3SEI A;  2DL0 A;  2L5Y A;  2K4P A;  1UQV A;  1SV0 C;  3KKA A;  1SGG A;  2K60 A;  2LPE A;  4MHV A;  3IDW A;  2B6G A;  5JU5 A;  1LKY B;  2KE7 A;  2QAR B;  1SXD A;  2EAP A;  2F8K A;  1SXE A;  2E8M A;  2F3N A;  2Y9T A;  1LKY A;  3BS5 A;  2GLE A;  2QAR A;  2EAO A;  2QB0 A;  2JV3 A;  3BS7 A;  1SV4 A;  1X66 A;  2ES6 A;  2QB1 A;  3BQ7 A;  4NJ8 A;  3TAD A;  2DKZ A;  2DKX A;  2E8P A;  4PZN A;  1COK A;  5JTI A;  1F0M A;  1WWU A;  2E8O A;  2E8N A;  1OXJ A;  2KIV A;  1DXS A;  2D8C A;  1X40 A;  1WWV A;  4RQN A;  5J8Y C;  2ESE A;  4NL9 A;  2YTU A;  3KKA C;  5F3X B;  2KMD A;  1SV0 A;  1Z1V A;  1B4F A;  1X9X A;  2FE9 A;  3H8M A;  2EAN A;  5JRT A;  1PK1 B;  4PZO A;  2KG5 A;  3SEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...