2LPEA

Solution nmr structure of the ksr1 ca1-ca1a domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
GHMDGGAGAAVSRALQQCGQLQKLIDISIGSLRGLRTKCSVSNDLTQQEIRTLEAKLVKYICKQQQSKLSVTPSDRTAELNSYPRFSDWLYIFNVRPEVVQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLRKVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A CC-SAM, for Coiled Coil Sterile a Motif, Domain Targets the Scaffold KSR-1 to Specific Sites in the Plasma Membrane
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Kinase suppressor of Ras 1
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13543 SAM_KSR1 SAM like domain present in kinase suppressor RAS 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lpeA02
5JU5A 2LMRA 4NL9C 2KSOA 2EAOA 1SV4A 3SENA 4RQMA 2K4PA 1WWVA 4IS7A 1X9XA 1X66A 3BS7A 3BS5A 5JTIA 4MHVA 3TADA 1SV0A 2FE9A 2F8KA 5L1MA 1SGGA 3BS5B 1COKA 2GLEA 2QARA 1LKYB 5JRTA 1WWUA 5J8YA 4RQNA 2F44A 3K1RB 2KIVA 2D3DA 5KNIA 2K60A 4NL9A 2DL0A 1F0MA 2Y9UA 3KKAA 2QB0B 2QKQA 2QARB 2L5YA 4NJ8A 2EAMA 1SXDA 2ESEA 1PK1B 1KW4A 2JV3A 1UQVA 1DXSA 2EANA 2D8CA 2B6GA 1LKYA 1X40A 3HILA 3TACB 2KMDA 2E8MA 3KKAC 2E8OA 3SEIA 3TADC 3IDWA 3BQ7A 2KE7A 2KG5A 3H8MA 1OW5A 1RG6A 1PK3A 2LPEA 4PZOA 1V85A 2ES6A 2QB1A 1OXJA 2DKXA 2F3NA 1V38A 2YTUA 1B4FA 2E8NA 1PK1A 2Y9TA 2QB0A 1UCVA 1Z1VA 5F3XB 5J8YC 1SXEA 1SV0C 2KSOB 1JI7A 2EAPA 2E8PA 2DKZA 4PZNA 1B0XA
chains in the Genus database with same CATH superfamily
3F2BA 3AL0B 5KFFA 4DSKA 4UB3A 3QXGA 5J0YA 2NRVA 2GH1A 4UB2A 1X6JA 1N5XA 7ICPA 2BPFA 1DGSA 3H8JA 2BDPA 3V7KA 4Z6FA 4DFMA 3DV9A 4YCXA 5KFEA 4QW8A 2Y1IA 3E0FA 2F1JA 4BUGA 1LKYB 3MR6A 3C29A 2VANA 3THVA 4ECVA 1WWUA 2PFNA 5J8YA 4Q8FA 3CNHA 4C8OA 2KIVA 3MDCA 2G07A 2DL0A 2V4QA 3PVXA 4WJ3B 4LZDA 4TUSA 4J9QA 2MUTB 2E1FA 3N7RC 3QU2A 7ICHA 4FFDA 4YD2A 3F2DA 5CWRA 5DDMA 4NLGA 5ALRA 4M04A 2D8CA 4KLTA 1PUZA 2RHFA 4AYBF 4YQWA 4EYHB 2E8OA 3K1ZA 2EZZA 5ALIA 2H3FA 5KFTA 3H8MA 4YMNA 4IC9A 1SWWA 2KD1A 4F72A 1ZQTA 3OSNA 4DSFA 2E5SA 1RZTA 5DLGA 2R8KA 1XO1A 2W7PA 3MR2A 4O3PA 4Q8EA 3RJIA 5J0OA 5KT2A 1JI7A 5J0PA 5IIKA 5AK5A 2XICA 1ZQIA 4ECQA 4F50A 5G5GA 3C1ZA 3H4DA 1SL2A 4DEZA 3AQFA 2FLLA 9ICBA 2WB1F 3OTQA 1MN8A 3QU5A 9ICHA 2W9MA 1K1SA 4BXOA 4QZHA 2E1EA 5B5EU 2ASLA 1SB3C 4NLKA 3BS7A 3BS5A 1S76D 3MGVA 3PY8A 1S0NA 4NLBA 5J2FA 2UVRA 2H5XA 1KRPA 4M2YA 2KICA 7ICRA 4QWCA 2AQ4A 1Z19A 2WAQF 4I2FA 4F93B 3BQ0A 9ICJA 2LYBA 4KLSA 2A1AA 1IIPA 5EE9A 3UXPA 2KVSA 2C2EA 4PPXA 4I2JA 2IMWP 4NJ8A 4P4PA 3RB3A 1PK1B 4RNMA 4Y2XA 2EDUA 5HR6A 4KN4A 5AI8A 2IA6A 5DKWA 2OCEA 2FPLA 1BPEA 1NNLA 1Q3VA 1PVRA 3KKAC 4F5PA 5ALTA 2A1JA 1ZD3A 2W11A 1RG6A 1A6SA 1AROP 9ICPA 2XC9A 4OJ6A 5AIBA 2J6SA 4DLEA 1F5SA 4HAIA 1XSNA 2DKXA 1NKBA 2D6FC 9ICMA 1ED1A 1ZQWA 3M6KA 3MABA 8ICSA 3KOOA 2WHEA 5HNKA 1NK0A 3H7IA 5KFRA 3K75D 5KFSA 5D4BA 1SV4A 1QQ7A 4UAUA 1S9FA 1WWVA 4UB6U 4DFPA 3PR4A 4UBCA 2YY6A 4JMUA 5DQGA 4F4ZA 4PHDA 4DQSA 5ALDA 1ZQMA 3WKDA 2BCSA 1WCNA 2G06A 5DB9A 4GC7A 4UAWA 2YQEA 2N1RA 3ETLA 5EWFA 1ZQBA 1HJPA 3UXNA 1MA7A 2F76X 3FDSA 1U9LA 8ICYA 7ICQA 4RT2A 3QU9A 1T4GA 3SAHA 4F5OA 2E3TA 5BOMA 3PNCA 4JK1A 5J2EA 3TQ1A 1VJ5A 5DB8A 5KFXA 5L1KA 4QIWC 2ZTCA 1QQ5A 4ED7A 1T8EA 3EYZA 5IIOA 2W9BA 1RQLA 3RR8A 3AU6A 4B9TA 1KKXA 4O3MA 1V85A 4YN4A 2QB1A 1OXJA 2QB0A 4I2GA 2JEFA 1RYSA 2W9CB 5D49A 2EAPA 1FFVA 4PHPA 2ASJA 1K1QA 4IRDA 3C5FA 4DQPA 4O5CA 1X9SA 3H0RB 3EUB2 3KZXA 2VA3A 1SKSA 2Y0SF 4NLNA 3GIKA 3GV8B 8ICJA 3NVZA 4Q45A 5JTIA 7ICMA 2HHVA 3RJGA 3T5LA 5DQIA 2DPJA 4F4KA 7ICEA 3RJEA 2JMGA 4UASA 1ZJNA 2WFAA 5KFIA 3PO5A 1PZNA 3SAGA 4EBDA 4XRHA 1NKCA 9ICQA 1D8YA 9ICIA 3RJFA 8ICGA 1F0MA 1NK7A 1BNPA 5KFYA 4ECXA 4KLUA 4QZFA 1SKWA 5ALJA 5C5JA 2PKEA 3M8RA 5EOZA 3ALRA 2NRWA 3PX0A 3HKZC 2FI1A 5AICA 3PR5B 4GXJA 5HMMA 4UAZA 1U48A 1JXEA 2KZ3A 2KEYA 3UXOA 1TAMA 2KG5A 3BQ7A 4J03A 7ICTA 4F2RA 1OW5A 1RYRA 4ACOA 4ED3A 2M9NA 2W8KA 5KFZA 2OHFA 4HYKA 1DRGA 4M9HA 2PXIA 5J2CA 2F1HA 5J2GA 4JWNA 2KNJA 8ICXA 1SL1A 3QU7A 4JWMA 2ZIXB 4DS5A 5HMLA 1J2NA 2W43A 3V7LA 4QZGA 3C28A 3Q8MA 2JZBB 5AKEA 2ZJAA 3BQTA 5KTQA 9ICTA 4NL9C 5IIJA 4IQUA 2KSOA 2BGWA 4ECRA 3QYPA 2WF5A 1MC8A 2PI5A 5C0YA 9ICVA 4QIWF 4K4IA 2ZUDA 1ZD4A 3EZ5A 2C28A 1QSLA 3RH5A 5J2JA 2P66A 4ECUA 1ZQAA 2ODGA 1CUKA 2HCFA 3QUCA 4ECZA 3D2SA 2HHTA 3GFKB 3BJYA 1TK5A 3Q8KA 3UQ0A 1JUDA 5KFUA 4TQRA 4PHAA 2PFPA 2AJQA 2D3DA 1ZJMA 5T14A 4C80A 5KL8B 1UPHA 4RPZA 3CRXA 2ZIWA 1JXLA 4LVSA 3KHHA 4EBEA 2OWOA 2NO4A 1SIJA 4AP9A 3I76A 4I2CA 3V6KA 1JN3A 5KG0A 4ED6A 4DFKA 4MF2A 2FPMA 4OD0A 5TZVA 3GIJA 1DK2A 8ICBA 1LKYA 2Y1JA 4YR2A 1ZQFA 4EBCA 3H8SA 1QSYA 2XO7A 2XI9A 3TAQA 4YXJA 4DF8A 4UQGA 4TQSA 1JX4A 4FBUA 5ALFA 1WYGA 3FAHA 1QSSA 1S77D 3UM9A 2ZIUA 4FS2A 2K8BB 3PO4A 1ZQLA 4RPXA 3IG5A 3B9JA 4NY8A 5ALVA 3WK9A 4RPYA 5KG6A 5AKKA 5AI5A 1ZQKA 2BCRA 3SYZA 2CXYA 2BPGA 4RQ4A 1QQ6A 2YN4A 4M9GA 1BVSA 3G6YA 3TFRA 5AKZA 2W9AA 3KD3A 3ORYA 9ICUA 5KFDA 3RAXA 3ZD9A 4DO9A 2KJ9A 4PJ0U 3L4PA 5FP0A 3KBBA 8ICVA 2OM6A 1NK4A 1XC9A 1SGGA 4EELA 1LB2B 5KFQA 5AI4A 4XA5A 2BZFA 4F92B 2Q4TA 1IM4A 3RBEA 4RNNA 3EWAA 1N56A 1MQ2A 4UB5A 4ECWA 3B0YA 8ICWA 3BQ2A 3SZ2A 4K4HA 3KZIU 4EYIB 3H0MB 1TK0A 3WK6A 1VLBA 3M6ZA 3JPNA 2MSNA 4MF8A 4JV0A 4DFDA 4IRCA 4CF5A 2Q0ZX 3BZCA 1NI3A 4CRXA 4O3RA 2B6GA 4I2DA 3B0XA 3D6JA 3HILA 1NOMA 5J0TA 2G0AA 1DK3A 3D2NA 5ALOA 5L1IA 3SEIA 2JRZA 4OJPA 4B9VA 1FO4A 4UARA 2JEJA 8ICEA 3TAPA 2FMQA 2GO7A 3QEBZ 3ZDBA 4F5NA 2E8NA 3CW2C 3PW4A 3OHAA 3RRGA 1Z1VA 5KFWA 2K8CB 1KSPA 3EPGA 1JRPA 2JH7A 1XWLA 3F2CA 2P35A 3MFHA 3N97B 4M47A 4O0IA 3KHRA 8ICFA 2WF7A 3RRHA 2H3IA 2HHUA 2EAOA 2HOQA 4ICAA 1ZQRA 4C7YA 4MFAA 1Z3EB 1X66A 4IQVA 2KZMA 5AM1A 5IILA 4P0PB 3TADA 3WU2U 2HDOA 3WKCA 4RQ5A 3HKZF 5KFHA 4BJQA 3LVWA 1L3UA 1O03A 2GLEA 3NVYA 3SQIA 4X5VA 1BPZA 4IQWA 2GOLA 5KFCA 2F44A 3VCBA 4I28A 2F8LA 1D9DA 4FZMA 3JPTA 4O3SA 3N7SC 2LKYA 5B66U 8ICMA 1RXVA 5AKXA 2ZIUB 2BR0A 3OGUA 1JALA 4BX9C 4QW9A 3AN1A 4UAVA 5DBCA 1PVPA 4KITB 2MUTA 1NK6A 2R8HA 3SAFA 2ZIVB 4KTQA 4KLEA 9ICKA 4ECYA 2HBLA 2ISOA 3LVVA 4U6PA 1ZQPA 5J0SA 4MEXA 2LM4A 3K4GA 4RQ0A 5KFOA 7ICKA 1UT5A 2W54A 5DB7A 1L3SA 4DWIA 2XIDA 1CRXA 3SMVA 4YD1A 3ONNA 4LZGA 1TAUA 2DPIA 2LM1A 5CA7A 8ICUA 3GV7B 4DQIA 5TISU 2BPCA 2BHNA 3CYMA 4J9KA 3T5HA 1UCVA 3QZ7A 5J8YC 4F4WA 4ED8A 4F4YA 2E8PA 2XGPA 5J0RA 3AM9A 1J2MA 2ZIWB 3JPQA 2KV2A 3LWLA 4DCCA 4QWEA 4QZDA 2KN7A 3HX0A 2W03A 2WAQC 5KT6A 1BGXT 4Y2PA 3C2LA 4YG2A 3PX6A 1RQNA 3SENA 5AKJA 5J2IA 9ICOA 4DOBA 4YR3A 4J9NA 1RPLA 7ICIA 2F8KA 4FZNA 4Y2RA 1N60A 1J97A 2ZJ5A 1XSPA 1T7PA 1ZQXA 1U47A 5HHIA 1Z00B 4RQNA 4YFKA 2NV3A 4DSEA 4B9NA 4B9MA 3KKAA 4PGQA 4E0DA 2ZG6A 1ZQHA 1ZQSA 1IXRA 2XY5A 2MA1A 3H40A 4RQ6A 9ICFA 2FDRA 4F91B 3UMGA 9ICCA 4UB1A 3IM1A 4P4OA 5AK4A 5J2BA 2IBKA 2UVVA 1FFUA 3N7PD 3QE9Y 3C1YA 2RP5A 4C8NA 4FO6A 1K5OA 1ZQUA 5ALZA 5AM5A 2FLPA 5HR7A 2JXJA 3IDWA 3MBYA 2HMXA 5F9LA 4IRKA 4IL6U 4M6WA 2AGOA 2ZTDA 5H2FU 2ES6A 3CP8A 3M1YA 1PK1A 3VC8A 3ISDA 4UATA 1L7PA 4P0PA 1YT3A 2H3VA 2DUYA 2BQ3A 3DDHA 3NVWA 2YMLA 4O3OA 3WK4A 2DKZA 2W55A 1N48A 3O0FA 2LBOA 2HVIA 1B0XA 5AM0A 1N5WA 4KLHA 3MDAA 2I1QA 5CJ7A 2YMMA 1BPYA 1KTQA 1TV9A 3WK7A 1QH9A 4B6JA 1WUDA 4M9JA 2J6UA 3GQCA 2IOFK 4EEKA 3MC1A 2DFLA 3MFIA 3ISBA 4KLGA 3PSIA 4KX5A 4F3OA 3F53A 1XU4A 2FE9A 4J9SA 2YX8A 5D46A 1COOA 8ICPA 1COKA 1QCKA 2JHDA 1VDVA 4DQQA 2F1IA 3K1RB 2Y0SC 3TFSA 4QZAA 3BDPA 4ZOHC 4PGXA 1NKEA 2ATLA 3SV3A 2JZBA 4DF4A 1FIQA 2XY6A 2HSZA 4YMOA 4BWMA 2QKQA 2L5YA 3UMCA 4BWJA 5CEHA 4DFJA 1UQVA 1WCLA 5ALUA 4XQ8A 5EWEA 2WF9A 4JV2A 1XS9D 1ZQGA 3HRDD 3HPOA 1KEJA 3NS1A 4OO1J 2BQRA 4RZRA 3FM9A 2KE7A 4OCZA 1BPDA 1KFSA 1NJYA 5J2DA 3ZDCA 2W9BB 2I5HA 3M9OB 2ZIVA 3QUBA 2VJ5A 2Y9TA 1LV5A 2KJ5A 2YB1A 5F3XB 4OJOA 1SXEA 3AEVA 2RQ5A 4BDPA 3ETRA 2HHWA 3E58A 3N28A 2LYAA 2CPRA 4J9RA 1L5UA 4MEYA 2KKVA 2DWQA 2DQNB 1T94A 3RBDA 3Q8LA 1URJA 1NZPA 3LYSA 1C7YA 1BPXA 3NASA 2HW3A 1TK8A 3C21A 1U49A 3GILA 4UBBA 2NRXA 3L3FX 1D8BA 5DBAA 2HBJA 4J9PA 1X9WA 3A0HU 4TUPA 4DOCA 1Z4OA 5JRTA 3AQEA 4UB8U 1S10A 3GZFA 3IHQB 3IRUA 3PW2A 1S97A 4QZ8A 5GTIU 5KT7A 2HVHA 2CRXA 1B43A 5DDYA 4TUQA 4U7CA 4EZ9A 2K8AA 1D8LA 2AGQA 1YZ7A 1ZD5A 5J2KA 4RQ3A 5KG2A 4B9UA 4YVZA 3LWMA 2QARB 8ICCA 1S8OA 5KAFU 4I2EA 4DL2A 3AMZA 1P7DA 5ALKA 1ZQVA 2ISPA 2DGZA 4TURA 4I2BA 5AKLA 4PL1A 1Q3UA 5KT3A 1U4BA 2ZUCA 4RT3A 4BGDA 1KN5A 1JIHA 4ECSA 1XSLA 3NRWA 3Q8SB 1ZQNA 5ALPA 1IG6A 1TAQA 3V6HA 3MR3A 9ICEA 1SZHA 4GIBA 5DGAA 2YTUA 3RF9A 2XGQA 1B4FA 5F9NA 4O5EA 5J2AA 3GDXA 4KLJA 4RQ8A 2C22A 7ICUA 4O5KA 3A0BU 1L7MA 3TKAA 2WTFA 2KFZA 1NK9A 3UPQA 2V4RA 2ZUBA 2AXTU 2F2AB 2W3RA 1HIWA 3HP6A 2ZIXA 1X42A 3G6XA 5KT5A 1H38A 4IS7A 2EH9A 5BPCA 2ASDA 1QLNA 3JPPA 5EE0A 3MR5A 1L8OA 3OSPA 4C4TA 1WG8A 4GXKA 2IHMA 4R8UA 4QZ9A 8ICAA 4NLZA 4I2IA 3PW0A 1NJXA 1L3TA 4C8LA 2Y9UA 1RXWA 3KTQA 3LDAA 4US9A 1NK8A 5DB6A 3EW9A 1X2IA 3T3FA 4R66A 4O3QA 1ZQJA 1TFRA 1A77A 3D2QA 4RQ1A 1U45A 3RR7A 4RQ2A 1S5LU 4YR0A 5ALLA 1RYUA 2B0CA 5A0LA 2JEIA 1HEKA 3FYHA 3GIIA 2HI0A 3RB4A 4CF3A 1SKRA 5JUMA 3PW5A 4EX6A 3H4BA 1T3NA 9ICWA 2H3QA 2R8JA 1ZYQA 4BXOB 1BPBA 2ZXIA 1V38A 3SD7A 4P4MA 2HHQA 4R63A 3H0LB 2G08A 4ED2A 5DG8A 2K4IA 5EWGA 4EEYA 1ZQYA 5KT4A 3T5JA 9ICNA 4M9LA 8ICIA 3PSTA 4G9BA 3QUTA 2KHVA 4FE3A 4DQRA 2LMRA 4Z6EA 1N2XA 2EQYA 1Z00A 5AKIA 2BCUA 3N4MB 2PFOA 3PV8A 4RQMA 3OPXA 3NGDA 2PFQA 3HJEA 4CGZA 2ALZA 1MQ3A 1NJZA 5L1MA 2DBYA 1C20A 3QZ8A 2AH5A 1Q46A 8ICHA 1ZQZA 4FS1A 4EX7A 5AHXA 5J0UA 1S0MA 4Y2JA 2OYYA 2ZXHA 5KFLA 3RAQA 5AM3A 4M6WB 1UA1A 4KLOA 1BNOA 5KFKA 4P0QB 8ICOA 2BCQA 4I29A 3C2KA 2K4HA 5AI0A 2RDJA 2YB4A 2MRLA 3WKEA 1TE2A 5KFAA 8ICZA 3UMBA 2RLTA 3V72A 2BQUA 1SXDA 2JV3A 3KHGA 4F5QA 9ICSA 4J9OA 1TVAA 7ICSA 3QU4A 2YMQA 4DL7A 4C8KA 5ALMA 1AQ6A 4KX3A 2G5HB 4I27A 2KMDA 4UAYA 4R64A 4RU9A 2FLNA 3RH4A 4JV1A 4KMOB 5IIIA 5J0WA 1PK3A 2HOFA 5HHHA 2AGPA 5AK3A 2KOBA 3U26A 2HOIA 4NV0A 1ZETA 5L1JA 4QWAA 1L7NA 4KN7A 2KSOB 2FJ6A 3JPOA 4PZNA 2VKQA 2W8LA 2P6RA 3QEAZ 5CR0A 2VIXA 4YP3A 4ED1A 3GU3A 1X9MA 1JROA 2EZXA 1Q8KA 3HT3A 5KFBA 5J0QA 1NJWA 3EPIA 2AU0A 1XNSA 2UVWA 4IQTA 1IV8A 4NXZA 4USAA 5AKHA 1SV0A 3MGIA 2WB1C 2V9WA 2HBMA 5AI9A 2GWSA 2MU2A 4F8RA 4JUZA 7ICLA 2Z7JA 1F44A 5DQHA 5DLFA 1NZBA 5DG9A 1V9PA 2KP7A 2WF8A 2NRTA 3RH6A 3RJHA 2QLTA 3NVVA 1S0VA 5KG5A 3GV5B 5KFPA 4QZCA 4ECTA 4M9NA 5ALXA 1OUQA 2QB0B 3NUQA 4DL4A 2VJ4A 4O3NA 4Z6CA 4Q44A 4CCHA 7ICNA 3ZD8A 5KFNA 4EZ6A 3KHLA 3WK8A 3E2EA 4R8UB 1HUZA 4IR9A 3KFUF 4KLIA 2G09A 7ICGA 5EE3A 2RDIA 5IINA 3QUQA 2WF6A 4DL5A 4C4RA 2IOHA 5ALWA 4DOAA 3Q8RB 3TADC 4FZLA 4F5RA 4Y2TA 2LI6A 2OEHA 1A0PA 4CNQA 4Q43A 9ICRA 4XUSA 4KLLA 2DF4B 3IG8A 3RB6A 2F3NA 2KKPA 7ICVA 4JB3A 8ICRA 2KFNA 3PW7A 3I1YA 5AI6A 1QTMA 3TI0A 5L9XA 2KHQA 2XCAA 7ICJA 4C7ZA 3T79A 4GLXA 1KFDA 1SV0C 3QNMA 4F2SA 2IHNA 1KBUA 3TARA 2NO5A 3UQ2A 2C2RA 2K89A 5AM4A 3IV6A 3S6JA 3WK5A 2I9GA 5JU5A 3PSPA 5ALHA 2LYHA 4PGYA 4OJLA 4KLQA 1V97A 2KJ8A 1YZ6A 2LHTA 2O6KA 3JPSA 1S0OA 1X9XA 1T3QA 5AKYA 2MAXA 4MHVA 1DOQA 2A3VA 1D9FA 4Y2SA 2KIWA 2QARA 5AKGA 1B22A 2EZYA 4ELUA 2RRDA 1Z4NA 5KFGA 4PHEA 5CB1A 5KNIA 1ZQQA 2K60A 4ELVA 3R9KA 2R8GA 3OHBA 3ZI4A 5AIAA 2C2DA 4NWIA 3RJKA 5GTHU 2NRZA 1EXNA 2HHXA 3Q8PB 4QJFB 2BCVA 5J2HA 2EAMA 2F77X 4MFFA 1DXSA 8ICNA 4B9SA 1UHUA 3L5KA 5K4LA 1KDHA 3C2MA 8ICLA 3C23A 2A1JB 4F71A 3M9MB 4MFCA 4Y2UA 3WKBA 2W3SA 1ZQ1C 4DL3A 5DG7A 9ICGA 2BDUA 3RB0A 5AK6A 4I2AA 9ICAA 3F5AA 1ZQDA 4KLFA 1XO0A 3T5KA 4NM2A 3PX4A 2FMSA 4RNOA 2K4EA 3HWTA 3TANA 4LJXA 5ALYA 1UT8A 2FPKA 5L1LA 2CN1A 2A19A 3NRZA 1NK5A 1HUOA 5ALNA 4PH5A 3WKAA 5HP4A 1Y88A 1PVQA 4G3IA 3RFAA 1JMSA 3ZDEA 2AQ0A 1N61A 8ICTA 1LVHA 2JR5A 2G5IB 3ZDAA 1KFTA 2XY7A 4DSIA 2H3ZA 4AYBC 5DBBA 4M0AA 2K4PA 2OH2A 3SR6A 2FMPA 4RUCA 5ALQA 4Y2YA 1N62A 1Z1BA 2I6XA 4UW9A 5E79U 8ICKA 4CF4A 4R65A 3BQ1A 3C5GA 2PMZC 3PMLA 1ZRNA 5CP2A 3OJSA 5KG1A 5KG4A 4UB4A 4NL9A 3PMNA 1ZQCA 5ALEA 3ISCA 4I2HA 1FEZA 1ZD2P 4O9MA 5KL1B 3IP4B 4NM1A 2ZJ8A 4FBTA 3HW8A 5J29A 4Y2QA 3H8WA 1M6YA 7ICFA 5BOLA 1ZOLA 4A8EA 2R18A 1KW4A 2HHSA 2R8IA 1RDFA 3AU2A 3I28A 4ELTA 4IR1A 2ZTEA 3J81j 2PMZF 4K4GA 2NYVA 1KQQA 1SL0A 4KMUA 1X40A 3RJJA 4QZEA 2E8MA 4B9LA 2AHOB 4DS4A 2BKEA 1CEZA 3F5EA 1RM6C 1SWVA 4QNLA 4YXMA 2LPEA 4C8MA 4EENA 5J0XA 2IOFA 4Y2VA 5CRXA 5KFVA 4GC6A 4KLDA 4ZH4A 3ZDDA 5KG3A 2B21A 2KK0A 3V6JA 4KLMA 4C0ZA 1GO3F 1CI4A 5KFMA 5EE1A 4US8A 4QZIA 1KL9A 4QWBA 2XVTA 1O08A 2PI4A 1A76A 3PSFA 1ZQOA 4F4XA 1X6IA 5KFJA 2J6TA 9ICXA 3DEEA 2VA8A 1L3VA 3Q8QB 3M7DA 4P2HA 5G5HA 3V7JA 5AM2A 1L7OA 3BS5B 4DLGA 2XCPA 4DL6A 3NTUA 1N63A 5IIMA 2HBKA 3QX7A 3AUOA 3ICXA 4P0QA 1L8LA 2JGAA 1ECWA 3M9NB 3SV4A 1ZRMA 4OJ5A 4CE6A 2JH1A 1L6NA 4GFJA 4NLCA 4J9MA 3PZPA 2W9CA 9ICLA 4DSJA 5ALSA 2W7OA 2ESEA 4C4SA 3M8SA 1ZXIA 4DSLA 2VA2A 4GXIA 3GIMA 4YMMA 2EANA 5KAIU 1UA0A 3FC4A 4CDGA 2KZZA 3IN5A 5KG7A 4RQ7A 2KVCA 2OXOA 3TACB 5CHGA 5ALGA 1ZQEA 4RUAA 3MGHA 3SI8A 4J9LA 1DGJA 5DGBA 4QZBA 3LK9A 4PZOA 3ED5A 1TKDA 3RTVA 2JEGA 3BZKA 4Z6DA 3OJUA 1SZPA 7ICOA 1KLNA 2UVUA 2P6UA 4ED0A 4QWDA 1MSWD 2KTQA 2M0NA 2W04A 8ICQA 2YMPA 4PL2A 3G6VA 3JPRA
chains in the Genus database with same CATH topology
5JU5A 2LMRA 4NL9C 2KSOA 2EAOA 1SV4A 3SENA 4RQMA 2K4PA 1WWVA 4IS7A 1X9XA 1X66A 3BS7A 3BS5A 5JTIA 4MHVA 3TADA 1SV0A 2FE9A 2F8KA 5L1MA 1SGGA 3BS5B 1COKA 2GLEA 2QARA 1LKYB 5JRTA 1WWUA 5J8YA 4RQNA 2F44A 3K1RB 2KIVA 2D3DA 5KNIA 2K60A 4NL9A 2DL0A 1F0MA 2Y9UA 3KKAA 2QB0B 2QKQA 2QARB 2L5YA 4NJ8A 2EAMA 1SXDA 2ESEA 1PK1B 1KW4A 2JV3A 1UQVA 1DXSA 2EANA 2D8CA 2B6GA 1LKYA 1X40A 3HILA 3TACB 2KMDA 2E8MA 3KKAC 2E8OA 3SEIA 3TADC 3IDWA 3BQ7A 2KE7A 2KG5A 3H8MA 1OW5A 1RG6A 1PK3A 2LPEA 4PZOA 1V85A 2ES6A 2QB1A 1OXJA 2DKXA 2F3NA 1V38A 2YTUA 1B4FA 2E8NA 1PK1A 2Y9TA 2QB0A 1UCVA 1Z1VA 5F3XB 5J8YC 1SXEA 1SV0C 2KSOB 1JI7A 2EAPA 2E8PA 2DKZA 4PZNA 1B0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JU5 A;  2LMR A;  4NL9 C;  2KSO A;  2EAO A;  1SV4 A;  3SEN A;  4RQM A;  2K4P A;  1WWV A;  4IS7 A;  1X9X A;  1X66 A;  3BS7 A;  3BS5 A;  5JTI A;  4MHV A;  3TAD A;  1SV0 A;  2FE9 A;  2F8K A;  5L1M A;  1SGG A;  3BS5 B;  1COK A;  2GLE A;  2QAR A;  1LKY B;  5JRT A;  1WWU A;  5J8Y A;  4RQN A;  2F44 A;  3K1R B;  2KIV A;  2D3D A;  5KNI A;  2K60 A;  4NL9 A;  2DL0 A;  1F0M A;  2Y9U A;  3KKA A;  2QB0 B;  2QKQ A;  2QAR B;  2L5Y A;  4NJ8 A;  2EAM A;  1SXD A;  2ESE A;  1PK1 B;  1KW4 A;  2JV3 A;  1UQV A;  1DXS A;  2EAN A;  2D8C A;  2B6G A;  1LKY A;  1X40 A;  3HIL A;  3TAC B;  2KMD A;  2E8M A;  3KKA C;  2E8O A;  3SEI A;  3TAD C;  3IDW A;  3BQ7 A;  2KE7 A;  2KG5 A;  3H8M A;  1OW5 A;  1RG6 A;  1PK3 A;  2LPE A;  4PZO A;  1V85 A;  2ES6 A;  2QB1 A;  1OXJ A;  2DKX A;  2F3N A;  1V38 A;  2YTU A;  1B4F A;  2E8N A;  1PK1 A;  2Y9T A;  2QB0 A;  1UCV A;  1Z1V A;  5F3X B;  5J8Y C;  1SXE A;  1SV0 C;  2KSO B;  1JI7 A;  2EAP A;  2E8P A;  2DKZ A;  4PZN A;  1B0X A; 
#chains in the Genus database with same CATH topology
 3F2B A;  3AL0 B;  5KFF A;  4DSK A;  4UB3 A;  3QXG A;  5J0Y A;  2NRV A;  2GH1 A;  4UB2 A;  1X6J A;  1N5X A;  7ICP A;  2BPF A;  1DGS A;  3H8J A;  2BDP A;  3V7K A;  4Z6F A;  4DFM A;  3DV9 A;  4YCX A;  5KFE A;  4QW8 A;  2Y1I A;  3E0F A;  2F1J A;  4BUG A;  1LKY B;  3MR6 A;  3C29 A;  2VAN A;  3THV A;  4ECV A;  1WWU A;  2PFN A;  5J8Y A;  4Q8F A;  3CNH A;  4C8O A;  2KIV A;  3MDC A;  2G07 A;  2DL0 A;  2V4Q A;  3PVX A;  4WJ3 B;  4LZD A;  4TUS A;  4J9Q A;  2MUT B;  2E1F A;  3N7R C;  3QU2 A;  7ICH A;  4FFD A;  4YD2 A;  3F2D A;  5CWR A;  5DDM A;  4NLG A;  5ALR A;  4M04 A;  2D8C A;  4KLT A;  1PUZ A;  2RHF A;  4AYB F;  4YQW A;  4EYH B;  2E8O A;  3K1Z A;  2EZZ A;  5ALI A;  2H3F A;  5KFT A;  3H8M A;  4YMN A;  4IC9 A;  1SWW A;  2KD1 A;  4F72 A;  1ZQT A;  3OSN A;  4DSF A;  2E5S A;  1RZT A;  5DLG A;  2R8K A;  1XO1 A;  2W7P A;  3MR2 A;  4O3P A;  4Q8E A;  3RJI A;  5J0O A;  5KT2 A;  1JI7 A;  5J0P A;  5IIK A;  5AK5 A;  2XIC A;  1ZQI A;  4ECQ A;  4F50 A;  5G5G A;  3C1Z A;  3H4D A;  1SL2 A;  4DEZ A;  3AQF A;  2FLL A;  9ICB A;  2WB1 F;  3OTQ A;  1MN8 A;  3QU5 A;  9ICH A;  2W9M A;  1K1S A;  4BXO A;  4QZH A;  2E1E A;  5B5E U;  2ASL A;  1SB3 C;  4NLK A;  3BS7 A;  3BS5 A;  1S76 D;  3MGV A;  3PY8 A;  1S0N A;  4NLB A;  5J2F A;  2UVR A;  2H5X A;  1KRP A;  4M2Y A;  2KIC A;  7ICR A;  4QWC A;  2AQ4 A;  1Z19 A;  2WAQ F;  4I2F A;  4F93 B;  3BQ0 A;  9ICJ A;  2LYB A;  4KLS A;  2A1A A;  1IIP A;  5EE9 A;  3UXP A;  2KVS A;  2C2E A;  4PPX A;  4I2J A;  2IMW P;  4NJ8 A;  4P4P A;  3RB3 A;  1PK1 B;  4RNM A;  4Y2X A;  2EDU A;  5HR6 A;  4KN4 A;  5AI8 A;  2IA6 A;  5DKW A;  2OCE A;  2FPL A;  1BPE A;  1NNL A;  1Q3V A;  1PVR A;  3KKA C;  4F5P A;  5ALT A;  2A1J A;  1ZD3 A;  2W11 A;  1RG6 A;  1A6S A;  1ARO P;  9ICP A;  2XC9 A;  4OJ6 A;  5AIB A;  2J6S A;  4DLE A;  1F5S A;  4HAI A;  1XSN A;  2DKX A;  1NKB A;  2D6F C;  9ICM A;  1ED1 A;  1ZQW A;  3M6K A;  3MAB A;  8ICS A;  3KOO A;  2WHE A;  5HNK A;  1NK0 A;  3H7I A;  5KFR A;  3K75 D;  5KFS A;  5D4B A;  1SV4 A;  1QQ7 A;  4UAU A;  1S9F A;  1WWV A;  4UB6 U;  4DFP A;  3PR4 A;  4UBC A;  2YY6 A;  4JMU A;  5DQG A;  4F4Z A;  4PHD A;  4DQS A;  5ALD A;  1ZQM A;  3WKD A;  2BCS A;  1WCN A;  2G06 A;  5DB9 A;  4GC7 A;  4UAW A;  2YQE A;  2N1R A;  3ETL A;  5EWF A;  1ZQB A;  1HJP A;  3UXN A;  1MA7 A;  2F76 X;  3FDS A;  1U9L A;  8ICY A;  7ICQ A;  4RT2 A;  3QU9 A;  1T4G A;  3SAH A;  4F5O A;  2E3T A;  5BOM A;  3PNC A;  4JK1 A;  5J2E A;  3TQ1 A;  1VJ5 A;  5DB8 A;  5KFX A;  5L1K A;  4QIW C;  2ZTC A;  1QQ5 A;  4ED7 A;  1T8E A;  3EYZ A;  5IIO A;  2W9B A;  1RQL A;  3RR8 A;  3AU6 A;  4B9T A;  1KKX A;  4O3M A;  1V85 A;  4YN4 A;  2QB1 A;  1OXJ A;  2QB0 A;  4I2G A;  2JEF A;  1RYS A;  2W9C B;  5D49 A;  2EAP A;  1FFV A;  4PHP A;  2ASJ A;  1K1Q A;  4IRD A;  3C5F A;  4DQP A;  4O5C A;  1X9S A;  3H0R B;  3EUB 2;  3KZX A;  2VA3 A;  1SKS A;  2Y0S F;  4NLN A;  3GIK A;  3GV8 B;  8ICJ A;  3NVZ A;  4Q45 A;  5JTI A;  7ICM A;  2HHV A;  3RJG A;  3T5L A;  5DQI A;  2DPJ A;  4F4K A;  7ICE A;  3RJE A;  2JMG A;  4UAS A;  1ZJN A;  2WFA A;  5KFI A;  3PO5 A;  1PZN A;  3SAG A;  4EBD A;  4XRH A;  1NKC A;  9ICQ A;  1D8Y A;  9ICI A;  3RJF A;  8ICG A;  1F0M A;  1NK7 A;  1BNP A;  5KFY A;  4ECX A;  4KLU A;  4QZF A;  1SKW A;  5ALJ A;  5C5J A;  2PKE A;  3M8R A;  5EOZ A;  3ALR A;  2NRW A;  3PX0 A;  3HKZ C;  2FI1 A;  5AIC A;  3PR5 B;  4GXJ A;  5HMM A;  4UAZ A;  1U48 A;  1JXE A;  2KZ3 A;  2KEY A;  3UXO A;  1TAM A;  2KG5 A;  3BQ7 A;  4J03 A;  7ICT A;  4F2R A;  1OW5 A;  1RYR A;  4ACO A;  4ED3 A;  2M9N A;  2W8K A;  5KFZ A;  2OHF A;  4HYK A;  1DRG A;  4M9H A;  2PXI A;  5J2C A;  2F1H A;  5J2G A;  4JWN A;  2KNJ A;  8ICX A;  1SL1 A;  3QU7 A;  4JWM A;  2ZIX B;  4DS5 A;  5HML A;  1J2N A;  2W43 A;  3V7L A;  4QZG A;  3C28 A;  3Q8M A;  2JZB B;  5AKE A;  2ZJA A;  3BQT A;  5KTQ A;  9ICT A;  4NL9 C;  5IIJ A;  4IQU A;  2KSO A;  2BGW A;  4ECR A;  3QYP A;  2WF5 A;  1MC8 A;  2PI5 A;  5C0Y A;  9ICV A;  4QIW F;  4K4I A;  2ZUD A;  1ZD4 A;  3EZ5 A;  2C28 A;  1QSL A;  3RH5 A;  5J2J A;  2P66 A;  4ECU A;  1ZQA A;  2ODG A;  1CUK A;  2HCF A;  3QUC A;  4ECZ A;  3D2S A;  2HHT A;  3GFK B;  3BJY A;  1TK5 A;  3Q8K A;  3UQ0 A;  1JUD A;  5KFU A;  4TQR A;  4PHA A;  2PFP A;  2AJQ A;  2D3D A;  1ZJM A;  5T14 A;  4C80 A;  5KL8 B;  1UPH A;  4RPZ A;  3CRX A;  2ZIW A;  1JXL A;  4LVS A;  3KHH A;  4EBE A;  2OWO A;  2NO4 A;  1SIJ A;  4AP9 A;  3I76 A;  4I2C A;  3V6K A;  1JN3 A;  5KG0 A;  4ED6 A;  4DFK A;  4MF2 A;  2FPM A;  4OD0 A;  5TZV A;  3GIJ A;  1DK2 A;  8ICB A;  1LKY A;  2Y1J A;  4YR2 A;  1ZQF A;  4EBC A;  3H8S A;  1QSY A;  2XO7 A;  2XI9 A;  3TAQ A;  4YXJ A;  4DF8 A;  4UQG A;  4TQS A;  1JX4 A;  4FBU A;  5ALF A;  1WYG A;  3FAH A;  1QSS A;  1S77 D;  3UM9 A;  2ZIU A;  4FS2 A;  2K8B B;  3PO4 A;  1ZQL A;  4RPX A;  3IG5 A;  3B9J A;  4NY8 A;  5ALV A;  3WK9 A;  4RPY A;  5KG6 A;  5AKK A;  5AI5 A;  1ZQK A;  2BCR A;  3SYZ A;  2CXY A;  2BPG A;  4RQ4 A;  1QQ6 A;  2YN4 A;  4M9G A;  1BVS A;  3G6Y A;  3TFR A;  5AKZ A;  2W9A A;  3KD3 A;  3ORY A;  9ICU A;  5KFD A;  3RAX A;  3ZD9 A;  4DO9 A;  2KJ9 A;  4PJ0 U;  3L4P A;  5FP0 A;  3KBB A;  8ICV A;  2OM6 A;  1NK4 A;  1XC9 A;  1SGG A;  4EEL A;  1LB2 B;  5KFQ A;  5AI4 A;  4XA5 A;  2BZF A;  4F92 B;  2Q4T A;  1IM4 A;  3RBE A;  4RNN A;  3EWA A;  1N56 A;  1MQ2 A;  4UB5 A;  4ECW A;  3B0Y A;  8ICW A;  3BQ2 A;  3SZ2 A;  4K4H A;  3KZI U;  4EYI B;  3H0M B;  1TK0 A;  3WK6 A;  1VLB A;  3M6Z A;  3JPN A;  2MSN A;  4MF8 A;  4JV0 A;  4DFD A;  4IRC A;  4CF5 A;  2Q0Z X;  3BZC A;  1NI3 A;  4CRX A;  4O3R A;  2B6G A;  4I2D A;  3B0X A;  3D6J A;  3HIL A;  1NOM A;  5J0T A;  2G0A A;  1DK3 A;  3D2N A;  5ALO A;  5L1I A;  3SEI A;  2JRZ A;  4OJP A;  4B9V A;  1FO4 A;  4UAR A;  2JEJ A;  8ICE A;  3TAP A;  2FMQ A;  2GO7 A;  3QEB Z;  3ZDB A;  4F5N A;  2E8N A;  3CW2 C;  3PW4 A;  3OHA A;  3RRG A;  1Z1V A;  5KFW A;  2K8C B;  1KSP A;  3EPG A;  1JRP A;  2JH7 A;  1XWL A;  3F2C A;  2P35 A;  3MFH A;  3N97 B;  4M47 A;  4O0I A;  3KHR A;  8ICF A;  2WF7 A;  3RRH A;  2H3I A;  2HHU A;  2EAO A;  2HOQ A;  4ICA A;  1ZQR A;  4C7Y A;  4MFA A;  1Z3E B;  1X66 A;  4IQV A;  2KZM A;  5AM1 A;  5IIL A;  4P0P B;  3TAD A;  3WU2 U;  2HDO A;  3WKC A;  4RQ5 A;  3HKZ F;  5KFH A;  4BJQ A;  3LVW A;  1L3U A;  1O03 A;  2GLE A;  3NVY A;  3SQI A;  4X5V A;  1BPZ A;  4IQW A;  2GOL A;  5KFC A;  2F44 A;  3VCB A;  4I28 A;  2F8L A;  1D9D A;  4FZM A;  3JPT A;  4O3S A;  3N7S C;  2LKY A;  5B66 U;  8ICM A;  1RXV A;  5AKX A;  2ZIU B;  2BR0 A;  3OGU A;  1JAL A;  4BX9 C;  4QW9 A;  3AN1 A;  4UAV A;  5DBC A;  1PVP A;  4KIT B;  2MUT A;  1NK6 A;  2R8H A;  3SAF A;  2ZIV B;  4KTQ A;  4KLE A;  9ICK A;  4ECY A;  2HBL A;  2ISO A;  3LVV A;  4U6P A;  1ZQP A;  5J0S A;  4MEX A;  2LM4 A;  3K4G A;  4RQ0 A;  5KFO A;  7ICK A;  1UT5 A;  2W54 A;  5DB7 A;  1L3S A;  4DWI A;  2XID A;  1CRX A;  3SMV A;  4YD1 A;  3ONN A;  4LZG A;  1TAU A;  2DPI A;  2LM1 A;  5CA7 A;  8ICU A;  3GV7 B;  4DQI A;  5TIS U;  2BPC A;  2BHN A;  3CYM A;  4J9K A;  3T5H A;  1UCV A;  3QZ7 A;  5J8Y C;  4F4W A;  4ED8 A;  4F4Y A;  2E8P A;  2XGP A;  5J0R A;  3AM9 A;  1J2M A;  2ZIW B;  3JPQ A;  2KV2 A;  3LWL A;  4DCC A;  4QWE A;  4QZD A;  2KN7 A;  3HX0 A;  2W03 A;  2WAQ C;  5KT6 A;  1BGX T;  4Y2P A;  3C2L A;  4YG2 A;  3PX6 A;  1RQN A;  3SEN A;  5AKJ A;  5J2I A;  9ICO A;  4DOB A;  4YR3 A;  4J9N A;  1RPL A;  7ICI A;  2F8K A;  4FZN A;  4Y2R A;  1N60 A;  1J97 A;  2ZJ5 A;  1XSP A;  1T7P A;  1ZQX A;  1U47 A;  5HHI A;  1Z00 B;  4RQN A;  4YFK A;  2NV3 A;  4DSE A;  4B9N A;  4B9M A;  3KKA A;  4PGQ A;  4E0D A;  2ZG6 A;  1ZQH A;  1ZQS A;  1IXR A;  2XY5 A;  2MA1 A;  3H40 A;  4RQ6 A;  9ICF A;  2FDR A;  4F91 B;  3UMG A;  9ICC A;  4UB1 A;  3IM1 A;  4P4O A;  5AK4 A;  5J2B A;  2IBK A;  2UVV A;  1FFU A;  3N7P D;  3QE9 Y;  3C1Y A;  2RP5 A;  4C8N A;  4FO6 A;  1K5O A;  1ZQU A;  5ALZ A;  5AM5 A;  2FLP A;  5HR7 A;  2JXJ A;  3IDW A;  3MBY A;  2HMX A;  5F9L A;  4IRK A;  4IL6 U;  4M6W A;  2AGO A;  2ZTD A;  5H2F U;  2ES6 A;  3CP8 A;  3M1Y A;  1PK1 A;  3VC8 A;  3ISD A;  4UAT A;  1L7P A;  4P0P A;  1YT3 A;  2H3V A;  2DUY A;  2BQ3 A;  3DDH A;  3NVW A;  2YML A;  4O3O A;  3WK4 A;  2DKZ A;  2W55 A;  1N48 A;  3O0F A;  2LBO A;  2HVI A;  1B0X A;  5AM0 A;  1N5W A;  4KLH A;  3MDA A;  2I1Q A;  5CJ7 A;  2YMM A;  1BPY A;  1KTQ A;  1TV9 A;  3WK7 A;  1QH9 A;  4B6J A;  1WUD A;  4M9J A;  2J6U A;  3GQC A;  2IOF K;  4EEK A;  3MC1 A;  2DFL A;  3MFI A;  3ISB A;  4KLG A;  3PSI A;  4KX5 A;  4F3O A;  3F53 A;  1XU4 A;  2FE9 A;  4J9S A;  2YX8 A;  5D46 A;  1COO A;  8ICP A;  1COK A;  1QCK A;  2JHD A;  1VDV A;  4DQQ A;  2F1I A;  3K1R B;  2Y0S C;  3TFS A;  4QZA A;  3BDP A;  4ZOH C;  4PGX A;  1NKE A;  2ATL A;  3SV3 A;  2JZB A;  4DF4 A;  1FIQ A;  2XY6 A;  2HSZ A;  4YMO A;  4BWM A;  2QKQ A;  2L5Y A;  3UMC A;  4BWJ A;  5CEH A;  4DFJ A;  1UQV A;  1WCL A;  5ALU A;  4XQ8 A;  5EWE A;  2WF9 A;  4JV2 A;  1XS9 D;  1ZQG A;  3HRD D;  3HPO A;  1KEJ A;  3NS1 A;  4OO1 J;  2BQR A;  4RZR A;  3FM9 A;  2KE7 A;  4OCZ A;  1BPD A;  1KFS A;  1NJY A;  5J2D A;  3ZDC A;  2W9B B;  2I5H A;  3M9O B;  2ZIV A;  3QUB A;  2VJ5 A;  2Y9T A;  1LV5 A;  2KJ5 A;  2YB1 A;  5F3X B;  4OJO A;  1SXE A;  3AEV A;  2RQ5 A;  4BDP A;  3ETR A;  2HHW A;  3E58 A;  3N28 A;  2LYA A;  2CPR A;  4J9R A;  1L5U A;  4MEY A;  2KKV A;  2DWQ A;  2DQN B;  1T94 A;  3RBD A;  3Q8L A;  1URJ A;  1NZP A;  3LYS A;  1C7Y A;  1BPX A;  3NAS A;  2HW3 A;  1TK8 A;  3C21 A;  1U49 A;  3GIL A;  4UBB A;  2NRX A;  3L3F X;  1D8B A;  5DBA A;  2HBJ A;  4J9P A;  1X9W A;  3A0H U;  4TUP A;  4DOC A;  1Z4O A;  5JRT A;  3AQE A;  4UB8 U;  1S10 A;  3GZF A;  3IHQ B;  3IRU A;  3PW2 A;  1S97 A;  4QZ8 A;  5GTI U;  5KT7 A;  2HVH A;  2CRX A;  1B43 A;  5DDY A;  4TUQ A;  4U7C A;  4EZ9 A;  2K8A A;  1D8L A;  2AGQ A;  1YZ7 A;  1ZD5 A;  5J2K A;  4RQ3 A;  5KG2 A;  4B9U A;  4YVZ A;  3LWM A;  2QAR B;  8ICC A;  1S8O A;  5KAF U;  4I2E A;  4DL2 A;  3AMZ A;  1P7D A;  5ALK A;  1ZQV A;  2ISP A;  2DGZ A;  4TUR A;  4I2B A;  5AKL A;  4PL1 A;  1Q3U A;  5KT3 A;  1U4B A;  2ZUC A;  4RT3 A;  4BGD A;  1KN5 A;  1JIH A;  4ECS A;  1XSL A;  3NRW A;  3Q8S B;  1ZQN A;  5ALP A;  1IG6 A;  1TAQ A;  3V6H A;  3MR3 A;  9ICE A;  1SZH A;  4GIB A;  5DGA A;  2YTU A;  3RF9 A;  2XGQ A;  1B4F A;  5F9N A;  4O5E A;  5J2A A;  3GDX A;  4KLJ A;  4RQ8 A;  2C22 A;  7ICU A;  4O5K A;  3A0B U;  1L7M A;  3TKA A;  2WTF A;  2KFZ A;  1NK9 A;  3UPQ A;  2V4R A;  2ZUB A;  2AXT U;  2F2A B;  2W3R A;  1HIW A;  3HP6 A;  2ZIX A;  1X42 A;  3G6X A;  5KT5 A;  1H38 A;  4IS7 A;  2EH9 A;  5BPC A;  2ASD A;  1QLN A;  3JPP A;  5EE0 A;  3MR5 A;  1L8O A;  3OSP A;  4C4T A;  1WG8 A;  4GXK A;  2IHM A;  4R8U A;  4QZ9 A;  8ICA A;  4NLZ A;  4I2I A;  3PW0 A;  1NJX A;  1L3T A;  4C8L A;  2Y9U A;  1RXW A;  3KTQ A;  3LDA A;  4US9 A;  1NK8 A;  5DB6 A;  3EW9 A;  1X2I A;  3T3F A;  4R66 A;  4O3Q A;  1ZQJ A;  1TFR A;  1A77 A;  3D2Q A;  4RQ1 A;  1U45 A;  3RR7 A;  4RQ2 A;  1S5L U;  4YR0 A;  5ALL A;  1RYU A;  2B0C A;  5A0L A;  2JEI A;  1HEK A;  3FYH A;  3GII A;  2HI0 A;  3RB4 A;  4CF3 A;  1SKR A;  5JUM A;  3PW5 A;  4EX6 A;  3H4B A;  1T3N A;  9ICW A;  2H3Q A;  2R8J A;  1ZYQ A;  4BXO B;  1BPB A;  2ZXI A;  1V38 A;  3SD7 A;  4P4M A;  2HHQ A;  4R63 A;  3H0L B;  2G08 A;  4ED2 A;  5DG8 A;  2K4I A;  5EWG A;  4EEY A;  1ZQY A;  5KT4 A;  3T5J A;  9ICN A;  4M9L A;  8ICI A;  3PST A;  4G9B A;  3QUT A;  2KHV A;  4FE3 A;  4DQR A;  2LMR A;  4Z6E A;  1N2X A;  2EQY A;  1Z00 A;  5AKI A;  2BCU A;  3N4M B;  2PFO A;  3PV8 A;  4RQM A;  3OPX A;  3NGD A;  2PFQ A;  3HJE A;  4CGZ A;  2ALZ A;  1MQ3 A;  1NJZ A;  5L1M A;  2DBY A;  1C20 A;  3QZ8 A;  2AH5 A;  1Q46 A;  8ICH A;  1ZQZ A;  4FS1 A;  4EX7 A;  5AHX A;  5J0U A;  1S0M A;  4Y2J A;  2OYY A;  2ZXH A;  5KFL A;  3RAQ A;  5AM3 A;  4M6W B;  1UA1 A;  4KLO A;  1BNO A;  5KFK A;  4P0Q B;  8ICO A;  2BCQ A;  4I29 A;  3C2K A;  2K4H A;  5AI0 A;  2RDJ A;  2YB4 A;  2MRL A;  3WKE A;  1TE2 A;  5KFA A;  8ICZ A;  3UMB A;  2RLT A;  3V72 A;  2BQU A;  1SXD A;  2JV3 A;  3KHG A;  4F5Q A;  9ICS A;  4J9O A;  1TVA A;  7ICS A;  3QU4 A;  2YMQ A;  4DL7 A;  4C8K A;  5ALM A;  1AQ6 A;  4KX3 A;  2G5H B;  4I27 A;  2KMD A;  4UAY A;  4R64 A;  4RU9 A;  2FLN A;  3RH4 A;  4JV1 A;  4KMO B;  5III A;  5J0W A;  1PK3 A;  2HOF A;  5HHH A;  2AGP A;  5AK3 A;  2KOB A;  3U26 A;  2HOI A;  4NV0 A;  1ZET A;  5L1J A;  4QWA A;  1L7N A;  4KN7 A;  2KSO B;  2FJ6 A;  3JPO A;  4PZN A;  2VKQ A;  2W8L A;  2P6R A;  3QEA Z;  5CR0 A;  2VIX A;  4YP3 A;  4ED1 A;  3GU3 A;  1X9M A;  1JRO A;  2EZX A;  1Q8K A;  3HT3 A;  5KFB A;  5J0Q A;  1NJW A;  3EPI A;  2AU0 A;  1XNS A;  2UVW A;  4IQT A;  1IV8 A;  4NXZ A;  4USA A;  5AKH A;  1SV0 A;  3MGI A;  2WB1 C;  2V9W A;  2HBM A;  5AI9 A;  2GWS A;  2MU2 A;  4F8R A;  4JUZ A;  7ICL A;  2Z7J A;  1F44 A;  5DQH A;  5DLF A;  1NZB A;  5DG9 A;  1V9P A;  2KP7 A;  2WF8 A;  2NRT A;  3RH6 A;  3RJH A;  2QLT A;  3NVV A;  1S0V A;  5KG5 A;  3GV5 B;  5KFP A;  4QZC A;  4ECT A;  4M9N A;  5ALX A;  1OUQ A;  2QB0 B;  3NUQ A;  4DL4 A;  2VJ4 A;  4O3N A;  4Z6C A;  4Q44 A;  4CCH A;  7ICN A;  3ZD8 A;  5KFN A;  4EZ6 A;  3KHL A;  3WK8 A;  3E2E A;  4R8U B;  1HUZ A;  4IR9 A;  3KFU F;  4KLI A;  2G09 A;  7ICG A;  5EE3 A;  2RDI A;  5IIN A;  3QUQ A;  2WF6 A;  4DL5 A;  4C4R A;  2IOH A;  5ALW A;  4DOA A;  3Q8R B;  3TAD C;  4FZL A;  4F5R A;  4Y2T A;  2LI6 A;  2OEH A;  1A0P A;  4CNQ A;  4Q43 A;  9ICR A;  4XUS A;  4KLL A;  2DF4 B;  3IG8 A;  3RB6 A;  2F3N A;  2KKP A;  7ICV A;  4JB3 A;  8ICR A;  2KFN A;  3PW7 A;  3I1Y A;  5AI6 A;  1QTM A;  3TI0 A;  5L9X A;  2KHQ A;  2XCA A;  7ICJ A;  4C7Z A;  3T79 A;  4GLX A;  1KFD A;  1SV0 C;  3QNM A;  4F2S A;  2IHN A;  1KBU A;  3TAR A;  2NO5 A;  3UQ2 A;  2C2R A;  2K89 A;  5AM4 A;  3IV6 A;  3S6J A;  3WK5 A;  2I9G A;  5JU5 A;  3PSP A;  5ALH A;  2LYH A;  4PGY A;  4OJL A;  4KLQ A;  1V97 A;  2KJ8 A;  1YZ6 A;  2LHT A;  2O6K A;  3JPS A;  1S0O A;  1X9X A;  1T3Q A;  5AKY A;  2MAX A;  4MHV A;  1DOQ A;  2A3V A;  1D9F A;  4Y2S A;  2KIW A;  2QAR A;  5AKG A;  1B22 A;  2EZY A;  4ELU A;  2RRD A;  1Z4N A;  5KFG A;  4PHE A;  5CB1 A;  5KNI A;  1ZQQ A;  2K60 A;  4ELV A;  3R9K A;  2R8G A;  3OHB A;  3ZI4 A;  5AIA A;  2C2D A;  4NWI A;  3RJK A;  5GTH U;  2NRZ A;  1EXN A;  2HHX A;  3Q8P B;  4QJF B;  2BCV A;  5J2H A;  2EAM A;  2F77 X;  4MFF A;  1DXS A;  8ICN A;  4B9S A;  1UHU A;  3L5K A;  5K4L A;  1KDH A;  3C2M A;  8ICL A;  3C23 A;  2A1J B;  4F71 A;  3M9M B;  4MFC A;  4Y2U A;  3WKB A;  2W3S A;  1ZQ1 C;  4DL3 A;  5DG7 A;  9ICG A;  2BDU A;  3RB0 A;  5AK6 A;  4I2A A;  9ICA A;  3F5A A;  1ZQD A;  4KLF A;  1XO0 A;  3T5K A;  4NM2 A;  3PX4 A;  2FMS A;  4RNO A;  2K4E A;  3HWT A;  3TAN A;  4LJX A;  5ALY A;  1UT8 A;  2FPK A;  5L1L A;  2CN1 A;  2A19 A;  3NRZ A;  1NK5 A;  1HUO A;  5ALN A;  4PH5 A;  3WKA A;  5HP4 A;  1Y88 A;  1PVQ A;  4G3I A;  3RFA A;  1JMS A;  3ZDE A;  2AQ0 A;  1N61 A;  8ICT A;  1LVH A;  2JR5 A;  2G5I B;  3ZDA A;  1KFT A;  2XY7 A;  4DSI A;  2H3Z A;  4AYB C;  5DBB A;  4M0A A;  2K4P A;  2OH2 A;  3SR6 A;  2FMP A;  4RUC A;  5ALQ A;  4Y2Y A;  1N62 A;  1Z1B A;  2I6X A;  4UW9 A;  5E79 U;  8ICK A;  4CF4 A;  4R65 A;  3BQ1 A;  3C5G A;  2PMZ C;  3PML A;  1ZRN A;  5CP2 A;  3OJS A;  5KG1 A;  5KG4 A;  4UB4 A;  4NL9 A;  3PMN A;  1ZQC A;  5ALE A;  3ISC A;  4I2H A;  1FEZ A;  1ZD2 P;  4O9M A;  5KL1 B;  3IP4 B;  4NM1 A;  2ZJ8 A;  4FBT A;  3HW8 A;  5J29 A;  4Y2Q A;  3H8W A;  1M6Y A;  7ICF A;  5BOL A;  1ZOL A;  4A8E A;  2R18 A;  1KW4 A;  2HHS A;  2R8I A;  1RDF A;  3AU2 A;  3I28 A;  4ELT A;  4IR1 A;  2ZTE A;  3J81 j;  2PMZ F;  4K4G A;  2NYV A;  1KQQ A;  1SL0 A;  4KMU A;  1X40 A;  3RJJ A;  4QZE A;  2E8M A;  4B9L A;  2AHO B;  4DS4 A;  2BKE A;  1CEZ A;  3F5E A;  1RM6 C;  1SWV A;  4QNL A;  4YXM A;  2LPE A;  4C8M A;  4EEN A;  5J0X A;  2IOF A;  4Y2V A;  5CRX A;  5KFV A;  4GC6 A;  4KLD A;  4ZH4 A;  3ZDD A;  5KG3 A;  2B21 A;  2KK0 A;  3V6J A;  4KLM A;  4C0Z A;  1GO3 F;  1CI4 A;  5KFM A;  5EE1 A;  4US8 A;  4QZI A;  1KL9 A;  4QWB A;  2XVT A;  1O08 A;  2PI4 A;  1A76 A;  3PSF A;  1ZQO A;  4F4X A;  1X6I A;  5KFJ A;  2J6T A;  9ICX A;  3DEE A;  2VA8 A;  1L3V A;  3Q8Q B;  3M7D A;  4P2H A;  5G5H A;  3V7J A;  5AM2 A;  1L7O A;  3BS5 B;  4DLG A;  2XCP A;  4DL6 A;  3NTU A;  1N63 A;  5IIM A;  2HBK A;  3QX7 A;  3AUO A;  3ICX A;  4P0Q A;  1L8L A;  2JGA A;  1ECW A;  3M9N B;  3SV4 A;  1ZRM A;  4OJ5 A;  4CE6 A;  2JH1 A;  1L6N A;  4GFJ A;  4NLC A;  4J9M A;  3PZP A;  2W9C A;  9ICL A;  4DSJ A;  5ALS A;  2W7O A;  2ESE A;  4C4S A;  3M8S A;  1ZXI A;  4DSL A;  2VA2 A;  4GXI A;  3GIM A;  4YMM A;  2EAN A;  5KAI U;  1UA0 A;  3FC4 A;  4CDG A;  2KZZ A;  3IN5 A;  5KG7 A;  4RQ7 A;  2KVC A;  2OXO A;  3TAC B;  5CHG A;  5ALG A;  1ZQE A;  4RUA A;  3MGH A;  3SI8 A;  4J9L A;  1DGJ A;  5DGB A;  4QZB A;  3LK9 A;  4PZO A;  3ED5 A;  1TKD A;  3RTV A;  2JEG A;  3BZK A;  4Z6D A;  3OJU A;  1SZP A;  7ICO A;  1KLN A;  2UVU A;  2P6U A;  4ED0 A;  4QWD A;  1MSW D;  2KTQ A;  2M0N A;  2W04 A;  8ICQ A;  2YMP A;  4PL2 A;  3G6V A;  3JPR A; 
#chains in the Genus database with same CATH homology
 5JU5 A;  2LMR A;  4NL9 C;  2KSO A;  2EAO A;  1SV4 A;  3SEN A;  4RQM A;  2K4P A;  1WWV A;  4IS7 A;  1X9X A;  1X66 A;  3BS7 A;  3BS5 A;  5JTI A;  4MHV A;  3TAD A;  1SV0 A;  2FE9 A;  2F8K A;  5L1M A;  1SGG A;  3BS5 B;  1COK A;  2GLE A;  2QAR A;  1LKY B;  5JRT A;  1WWU A;  5J8Y A;  4RQN A;  2F44 A;  3K1R B;  2KIV A;  2D3D A;  5KNI A;  2K60 A;  4NL9 A;  2DL0 A;  1F0M A;  2Y9U A;  3KKA A;  2QB0 B;  2QKQ A;  2QAR B;  2L5Y A;  4NJ8 A;  2EAM A;  1SXD A;  2ESE A;  1PK1 B;  1KW4 A;  2JV3 A;  1UQV A;  1DXS A;  2EAN A;  2D8C A;  2B6G A;  1LKY A;  1X40 A;  3HIL A;  3TAC B;  2KMD A;  2E8M A;  3KKA C;  2E8O A;  3SEI A;  3TAD C;  3IDW A;  3BQ7 A;  2KE7 A;  2KG5 A;  3H8M A;  1OW5 A;  1RG6 A;  1PK3 A;  2LPE A;  4PZO A;  1V85 A;  2ES6 A;  2QB1 A;  1OXJ A;  2DKX A;  2F3N A;  1V38 A;  2YTU A;  1B4F A;  2E8N A;  1PK1 A;  2Y9T A;  2QB0 A;  1UCV A;  1Z1V A;  5F3X B;  5J8Y C;  1SXE A;  1SV0 C;  2KSO B;  1JI7 A;  2EAP A;  2E8P A;  2DKZ A;  4PZN A;  1B0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...