2LPEA

Solution nmr structure of the ksr1 ca1-ca1a domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
b'GHMDGGAGAAVSRALQQCGQLQKLIDISIGSLRGLRTKCSVSNDLTQQEIRTLEAKLVKYICKQQQSKLSVTPSDRTAELNSYPRFSDWLYIFNVRPEVVQEIPQELTLDALLEMDEAKAKEMLRRWGASTEECSRLQQALTCLRKVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinase suppressor of Ras 1
publication title A CC-SAM, for Coiled Coil Sterile a Motif, Domain Targets the Scaffold KSR-1 to Specific Sites in the Plasma Membrane
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2012-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13543 SAM_KSR1 SAM like domain present in kinase suppressor RAS 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2lpeA02
3SENA 2QARA 2LMRA 3HILA 2KE7A 2Y9TA 1PK1B 2L5YA 2EAPA 3BQ7A 2ES6A 1SV4A 1X40A 2F3NA 2QARB 4PZOA 1OW5A 1F0MA 5L1MA 1B0XA 1SV0C 2KG5A 4IS7A 4PZNA 2KSOA 5KNIA 1KW4A 1DXSA 1COKA 1PK3A 2D3DA 3IDWA 1LKYA 2EANA 3BS7A 5J8YA 4MHVA 5JTIA 1WWVA 1Z1VA 2K60A 1JI7A 1LKYB 5JRTA 4NL9C 2EAOA 2F8KA 1UCVA 2Y9UA 5JU5A 2E8NA 1SV0A 3SEIA 2KSOB 2QB0A 2DL0A 1B4FA 3H8MA 2QKQA 2JV3A 2LPEA 3K1RB 1X9XA 2QB0B 2D8CA 2EAMA 4NL9A 2B6GA 2FE9A 2YTUA 1SXDA 1V38A 1RG6A 3KKAC 2E8MA 1PK1A 2E8PA 2KMDA 3TACB 3KKAA 4NJ8A 2GLEA 1X66A 2DKXA 1UQVA 2KIVA 1V85A 1OXJA 5F3XB 4RQNA 3BS5A 2K4PA 3TADC 1SXEA 5J8YC 1WWUA 2DKZA 2QB1A 3BS5B 3TADA 2ESEA 2E8OA 1SGGA 2F44A 4RQMA
chains in the Genus database with same CATH superfamily
4F5RA 5ALFA 5CP2A 4J03A 3AQFA 1NK0A 3I1YA 2HDOA 2W9CA 2ES6A 4QWDA 4MF2A 1X40A 5B66U 1WG8A 2O6KA 2KNJA 2IOFK 2BDPA 2KTQA 1ED1A 4ELTA 1F5SA 1ZOLA 1PZNA 2OH2A 5J0WA 3N7RC 2D3DA 3IDWA 9ICLA 3WK5A 3PNCA 3F2CA 5J0QA 1JIHA 1WWVA 3MABA 3RJKA 5D49A 4FBTA 5J2CA 1ZQPA 2YB1A 2EAOA 7ICIA 4IR1A 2EZZA 3SAFA 4R65A 1HIWA 4B9TA 2Y9UA 1KTQA 2CXYA 2WF9A 2ZIVA 5AKXA 5KAIU 2AJQA 2E8NA 5IILA 5AM2A 8ICZA 3C2MA 2KSOB 5DB7A 4HYKA 1MA7A 3T5LA 3C21A 4Y2RA 5GTIU 2JV3A 4OJLA 2Z7JA 2ZXHA 2KP7A 1U4BA 3ZD9A 3QUTA 2YMQA 3CRXA 3UM9A 4GXKA 4I2BA 1PK1A 4EZ9A 2ZJAA 4ELUA 2YMMA 3KKAA 4GIBA 4QIWC 4FO6A 1IIPA 3DEEA 1X66A 5J0RA 1KDHA 4TQSA 4UB4A 2KZZA 2ODGA 3WKCA 3LK9A 2G09A 4QWBA 9ICAA 4M6WA 7ICKA 4C7YA 4B9UA 4AP9A 5KG4A 2PKEA 4FE3A 5HP4A 3RF9A 5J2AA 3QZ7A 1VJ5A 4DF8A 3PO5A 2RDIA 1JROA 5KFJA 3HP6A 2FLNA 5KFIA 4P4MA 2MSNA 4MFFA 2RP5A 3GU3A 2ZIWB 3AN1A 2JH1A 2Y0SF 1ZQNA 5CRXA 3J81j 2W9CB 5AK4A 3T79A 5AICA 3EUB2 2EANA 4C8KA 3RTVA 5KG3A 3V7KA 1TK8A 1JI7A 2EZXA 3JPSA 2JZBA 4ED1A 4WJ3B 5AI5A 2WTFA 3SYZA 1SIJA 4B9SA 3Q8KA 4FS1A 4DF4A 4UARA 1QQ6A 3QX7A 2GOLA 2KEYA 1RQLA 4KLSA 4C7ZA 3BQ0A 4DFMA 9ICJA 4PL2A 1YT3A 1KL9A 4DFDA 2NYVA 4F2RA 2BPGA 5KFNA 4ED8A 2KVSA 2N1RA 3M9NB 1ZQTA 5D4BA 4RQ5A 4BUGA 3SD7A 4QZAA 3G6VA 2LI6A 3EW9A 4YD1A 3TFSA 2VJ4A 2EQYA 3TACB 2A1JA 2RQ5A 5AIAA 4RNNA 8ICKA 2KZ3A 2XI9A 4FBUA 1ZQQA 4MF8A 5KFGA 5EWGA 1V85A 3OGUA 4J9RA 5EWFA 1CI4A 5AI6A 4KLJA 5AK5A 4XUSA 4KLHA 2R8IA 3M9OB 9ICQA 2RHFA 5E79U 4QNLA 5JUMA 2R8GA 4EYHB 1NKBA 4OCZA 2DKZA 3PX0A 4RPZA 4IQWA 2F44A 4M0AA 4TUSA 3Q8RB 2RRDA 4NV0A 3N7SC 5DQHA 1LB2B 2W54A 2G06A 2BPFA 4PZOA 1BVSA 4M9GA 3AU2A 1NK5A 1KLNA 1K1SA 2XY5A 4TURA 1FIQA 4RPYA 4P2HA 2FPLA 4OJ5A 5EWEA 3RH5A 1JALA 3MDAA 5J8YA 3NVZA 4GXJA 3U26A 5EE1A 5DGBA 2GH1A 1ZETA 3F2BA 1HJPA 4CF3A 2MRLA 4NY8A 3MDCA 4RQ6A 1L3UA 5AKYA 1SKRA 2F77X 3KHHA 9ICCA 2JZBB 3RFAA 3OJUA 2JEGA 4BWMA 1UA1A 2C2DA 1QH9A 2QLTA 1NJZA 3IV6A 2W43A 8ICSA 2YY6A 4J9PA 3ZDDA 3RJEA 5EE3A 4QW8A 3K1RB 1NKEA 5J0XA 4EX6A 4DL4A 4F3OA 3EPIA 2PI5A 1RG6A 4HAIA 5J2BA 5AIBA 4NLZA 2YB4A 3GV8B 3RB3A 2BQUA 2HW3A 1Q8KA 1X6JA 4PH5A 4B9NA 1RYSA 3T5KA 1JXEA 2FMQA 2FPMA 5AKGA 2HI0A 4YN4A 2BCUA 5J0PA 3I76A 3ALRA 3H4BA 3ETRA 2FMSA 2HOIA 4QZFA 1XO1A 2LM1A 4U6PA 2QB1A 3WKAA 2XC9A 2E8OA 2A19A 4NLBA 3QU5A 5BOLA 4JV1A 4A8EA 4MEXA 3S6JA 5ALSA 1NOMA 1WYGA 4KLIA 5AKHA 4F5PA 2K4HA 4JV2A 2F1JA 4F8RA 5DLFA 3F5EA 1BPDA 8ICMA 3AMZA 4UB6U 4LJXA 2NV3A 1RPLA 2WF5A 1IV8A 1J2MA 2CN1A 2WAQC 4DS5A 2AHOB 3PSPA 1XSPA 4C8LA 3M7DA 4Y2XA 5L9XA 1JX4A 1KBUA 5ALYA 2K8BB 4UB1A 3F5AA 2BQRA 3NVYA 3RB0A 4C8OA 3QEBZ 2XICA 2NRXA 2GO7A 5KFPA 4QZBA 2W7PA 2ZUCA 5KFOA 3NGDA 4PHEA 1Z4OA 2LYAA 3MBYA 3V7JA 5KTQA 1S9FA 4UQGA 3MR3A 4UW9A 4PL1A 2BPCA 4I2GA 1UQVA 1ZQZA 3JPQA 2XGQA 3TAPA 2JR5A 5AM4A 3RH4A 9ICRA 3ZD8A 2I9GA 4KLDA 1F44A 5KFCA 2HHWA 5AKJA 3OHBA 1KEJA 1Q3UA 1J2NA 3N97B 5EE9A 1SGGA 2JXJA 3IG5A 4ECTA 3CNHA 1N5XA 2DUYA 2E1EA 2KD1A 4DS4A 3V7LA 1T94A 2RLTA 1SV4A 3F2DA 2B21A 2OCEA 4KX3A 4FZNA 3WKEA 1F0MA 1S76D 1X9SA 4ECRA 2GWSA 3MC1A 3GIIA 4IRDA 1PK3A 5J2KA 3AEVA 4UAUA 7ICTA 4USAA 4RZRA 7ICOA 3KBBA 9ICVA 1ZQHA 2WB1F 1UT8A 3V6HA 4KMUA 3PSIA 4NLNA 5AKIA 5TZVA 1ZQRA 1PUZA 2W9MA 1S0MA 4PGYA 1MQ3A 3T5HA 2MUTA 3C23A 4EX7A 1NNLA 3OJSA 3KHGA 3HX0A 3JPNA 4OO1J 4KMOB 2DQNB 4I28A 4I2IA 4ICAA 4CCHA 2PI4A 4PGQA 1ZQYA 1QSYA 4Q8EA 1JRPA 1ZQVA 3THVA 3EPGA 2OXOA 3DDHA 4TUQA 5IIOA 3UXNA 8ICYA 1ZQOA 4QWAA 1ZRMA 2KVCA 2I5HA 3BS5A 1RYUA 4O9MA 5CB1A 4RNMA 5DBBA 4Q8FA 8ICBA 5ALDA 4DL7A 4QZDA 2BCQA 2P66A 1B22A 4F4YA 3Q8LA 1X6IA 5AK3A 2HBKA 4UATA 4P4PA 8ICEA 1L3TA 4O3OA 4CRXA 3D2NA 2EAPA 3R9KA 2R18A 3LVWA 9ICIA 3VC8A 2H5XA 4PZNA 1KW4A 5ALVA 4ELVA 1TK5A 1N63A 1LKYA 1KFTA 2J6UA 4I2FA 3TFRA 1S97A 1BPZA 5J0OA 5ALRA 4ECVA 1BGXT 3PV8A 3JPRA 5KFZA 3FYHA 2C28A 1CUKA 5C5JA 9ICEA 3E2EA 4XQ8A 2Y0SC 3CW2C 2ASDA 1QSSA 4KLQA 2W9AA 3MGHA 3D2SA 1SB3C 3RJJA 1SV0A 5DQIA 2W9BB 3SEIA 3UMBA 4RQ4A 3BZKA 2QKQA 1ZD4A 2MUTB 5CR0A 5DBCA 4CNQA 3RB6A 4TQRA 4QW9A 4YMMA 2W11A 4K4GA 8ICCA 2K4EA 5ALQA 5KFFA 3M1YA 4UB5A 5HMMA 2H3VA 1L7NA 4R64A 5D46A 2GLEA 1GO3F 4PGXA 3ICXA 2IOFA 4UBBA 1KKXA 4J9QA 2H3IA 4KLUA 4P0QA 4FZLA 5IIJA 3V6KA 4DL6A 2JRZA 5ALLA 5ALNA 2ZJ8A 2HHVA 5DG7A 3I28A 3C1ZA 3PO4A 3BS5B 4JK1A 3M6KA 3WU2U 1QSLA 2A3VA 2LMRA 4J9MA 5J2GA 4DOCA 1L7MA 5ALOA 5KG0A 4CDGA 4ED3A 7ICSA 1HUZA 4F4KA 2D6FC 5ALGA 4UAZA 5G5HA 4DCCA 4OD0A 1B0XA 1ZRNA 4C4TA 3N4MB 1X9MA 3ONNA 3M6ZA 4K4IA 1YZ6A 4Q43A 1IM4A 3FC4A 3NRWA 4RQ1A 5KFYA 1Z1VA 9ICSA 1LKYB 5CA7A 2F8KA 1C7YA 3GIMA 4QZ9A 9ICGA 3PW7A 7ICQA 4JWNA 2WHEA 1UHUA 5J2HA 1CEZA 2VJ5A 4YR0A 3FAHA 2AQ4A 1UT5A 4O3PA 2ZG6A 1Z1BA 1MQ2A 1VDVA 2NRTA 3A0BU 4UAWA 3PVXA 1ZQMA 2WF6A 4Q45A 3GV5B 1PVRA 4JUZA 1X9XA 3RR8A 2IA6A 7ICNA 4KLEA 1ZQXA 2W03A 1KFSA 2JMGA 4IQUA 2HOFA 3HKZF 2KHQA 1FEZA 2JH7A 1RM6C 4J9SA 3H8SA 1URJA 2Q4TA 3ISBA 2HHUA 2ZIVB 4NWIA 4O5EA 2HCFA 4Y2UA 3KHRA 4P0PA 4GLXA 4ECYA 4PHPA 1L8LA 5KG7A 2W8KA 4P0QB 3PX4A 3MFIA 4NLKA 4QWCA 5KFUA 1KQQA 4UBCA 2ISPA 3E58A 3JPPA 4JB3A 1ZQWA 4C4RA 3M8RA 1TV9A 8ICHA 3OTQA 3C5GA 4I2EA 2QARA 4IQVA 8ICLA 1PK1B 1XS9D 1KRPA 2L5YA 4B9VA 4Y2YA 2F1HA 4U7CA 4US8A 4XRHA 5J2IA 1EXNA 2G07A 9ICHA 2KOBA 4DSKA 1SL1A 1COKA 3KZXA 1T7PA 4RU9A 4M6WB 3HT3A 1N48A 4BGDA 2K4IA 2W3RA 5DG9A 1U45A 2ASLA 3UPQA 1JN3A 1ZQJA 4DL5A 2K89A 3H7IA 1BPEA 3EWAA 4C4SA 1TKDA 1Y88A 4DSIA 2E1FA 5AK6A 4F5QA 7ICUA 5AI9A 4CF4A 4DOAA 5J2JA 5L1IA 8ICPA 4PHAA 3BDPA 1ZQEA 1HUOA 3MR2A 1OUQA 4KN4A 1AQ6A 1S10A 1QQ7A 2LKYA 3MFHA 3MR5A 3L4PA 4BWJA 4FZMA 5DGAA 2P6UA 2EAMA 3CYMA 2EZYA 1KSPA 3G6YA 1L3SA 2KN7A 4RQ7A 1JUDA 3MR6A 3BQ1A 1RDFA 4G9BA 2G0AA 1L7PA 1FFUA 1DGSA 3Q8MA 1OXJA 1CRXA 2NRZA 3AM9A 4R63A 4B9LA 1TAQA 1ECWA 7ICPA 1L8OA 5IIMA 5AKZA 4P0PB 4AYBC 5J8YC 1RYRA 3KOOA 4DEZA 4M9NA 4IR9A 4ED0A 1A76A 2ESEA 5K4LA 5CEHA 1FO4A 4OJPA 4O0IA 1S8OA 3PX6A 4YQWA 5TISU 5DKWA 4GC6A 5ALTA 4ECQA 2A1JB 1O08A 2F3NA 4KLLA 8ICQA 2QARB 1ZQ1C 1A77A 1U49A 1WCNA 2KG5A 4RQ2A 4DL2A 3A0HU 4LZDA 1UA0A 3RH6A 4J9LA 2ZTDA 5KFEA 2XCAA 4JWMA 4KITB 3D6JA 3KHLA 3QXGA 3Q8SB 1FFVA 4MHVA 3T3FA 5JTIA 5KT3A 5KFXA 2MU2A 3B0YA 2NO5A 4YR2A 3OSPA 5L1LA 1ZQLA 1ZQBA 1Z19A 3C28A 5IINA 7ICEA 4ZOHC 4KTQA 4F5NA 5KFSA 4QZGA 3QUBA 3JPOA 5KT2A 2ALZA 3KFUF 2DWQA 5HNKA 1ZJNA 4QWEA 5ALPA 4Y2VA 5CHGA 2EH9A 2HHSA 3PZPA 3LYSA 1BNOA 1NK4A 3FDSA 3WKBA 1B4FA 5DDYA 7ICHA 3C29A 4NM2A 1SWWA 3ISDA 4NL9A 2WB1C 5J0TA 3RJHA 4KLFA 1SXDA 2VANA 4O3RA 4GFJA 3N7PD 3UXPA 1H38A 2PFNA 5ALIA 1RXVA 1NK9A 3V6JA 2KIVA 4DSFA 3UQ0A 5ALKA 3RBEA 1DK3A 4KLMA 1KN5A 3ED5A 4AYBF 2K4PA 3GIJA 1L6NA 2PMZF 4O5CA 4YR3A 1XSNA 4DQQA 5IIKA 3PW5A 3H0RB 3L3FX 4BJQA 4TUPA 3PR5B 4DO9A 1NJWA 4LVSA 4NLCA 1OW5A 2NO4A 2XO7A 2VKQA 4Z6EA 1TVAA 3ORYA 5KT4A 4C8NA 5EOZA 3QNMA 3BS7A 2G5HB 4P4OA 2K60A 3PY8A 3QU4A 3L5KA 1LVHA 2H3ZA 5DLGA 5J0UA 4DQRA 2BR0A 3RJGA 7ICJA 2BCSA 3QU9A 3H4DA 4KN7A 4YG2A 2MAXA 3BQTA 1AROP 1D8LA 3C2KA 2W55A 1BPYA 1SKSA 1SZPA 1RZTA 4FS2A 3TANA 5J2DA 9ICPA 3EYZA 2D8CA 4M47A 1ZQAA 2HHQA 2PFOA 4F5OA 2BDUA 2BZFA 3BJYA 4DFPA 2LHTA 5BPCA 4O3MA 2IHNA 1XSLA 3ZI4A 1NK7A 4IL6U 1ZQGA 4O5KA 2BHNA 3H8WA 4F50A 5EE0A 2HHXA 2WF8A 4OJ6A 5DDMA 4UB3A 1NJXA 5G5GA 2B0CA 2NRVA 4JV0A 4IRCA 4F71A 4J9NA 1ZQIA 3QU2A 1NKCA 4Q44A 1S5LU 4DLGA 1X9WA 4PHDA 3SI8A 2G08A 4DL3A 4Z6DA 1X2IA 3WKDA 1T3QA 4F72A 1KFDA 3AL0B 3HWTA 3C5FA 2KK0A 2R8HA 2JEIA 2AGQA 1MC8A 2W7OA 1SL0A 1TFRA 2KSOA 4X5VA 4C8MA 3GIKA 2FLLA 5AI8A 2FPKA 4BX9C 4QZCA 7ICMA 4UAYA 4EEKA 4MFCA 5KFAA 4Z6CA 4FFDA 5DB8A 4C0ZA 4DQIA 1J97A 1T8EA 2PFQA 2J6SA 4BXOA 4DFKA 2CRXA 3SV4A 2IHMA 3IN5A 4JMUA 5AI0A 3Q8PB 4I2HA 2XGPA 7ICVA 5KT7A 5KFLA 4GC7A 1S0NA 3KTQA 5C0YA 2KZMA 2BGWA 4M2YA 3RR7A 2KKVA 4YXJA 1NJYA 5KAFU 4QZIA 2FE9A 3E0FA 3QZ8A 1UPHA 9ICFA 1SZHA 2XY6A 3HJEA 2UVVA 2IMWP 2E8PA 5HHIA 3H8JA 1D9DA 3PW0A 3UMCA 4ECXA 1NK6A 2XY7A 3SZ2A 2DKXA 2ZIXA 2XVTA 2Y1IA 1D9FA 5KG2A 3GFKB 3TADC 1ZYQA 4RNOA 1WUDA 5T14A 9ICNA 1ZQCA 1RQNA 4EENA 1DGJA 3NRZA 3HKZC 2WF7A 1ZQUA 2AXTU 3GQCA 2M0NA 2ZUBA 4ED7A 4LZGA 3Q8QB 2HMXA 4MEYA 2VA8A 4F2SA 2HVHA 3RAQA 1SV0C 1N60A 4EZ6A 3H0MB 2M9NA 1Z00A 2LM4A 9ICUA 8ICIA 4DSEA 2VA2A 4EELA 3OHAA 3RAXA 4K4HA 3KD3A 5ALUA 1U48A 3QUQA 3SAGA 4NLGA 2KJ5A 4I2AA 2ZTCA 1V97A 1P7DA 1UCVA 3FM9A 3RBDA 4PPXA 4B6JA 3MGVA 1VLBA 5CJ7A 4BXOB 3ZDCA 1ZQDA 3M9MB 5J2EA 2P35A 5AKLA 2KFZA 4DOBA 3LDAA 8ICJA 4UAVA 2KFNA 3T5JA 3TARA 4F4ZA 2DFLA 2B6GA 2C22A 2UVRA 1S0OA 2H3FA 3KKAC 4KX5A 4QZHA 3TKAA 5FP0A 2KJ9A 2FJ6A 4F4WA 4Y2JA 4E0DA 1XWLA 3RJFA 3ZDBA 5F9LA 4ZH4A 1ZXIA 5ALMA 2HVIA 4DFJA 3LVVA 3MGIA 1Z3EB 3K1ZA 5KFKA 1TAMA 4IQTA 2ZIXB 5AI4A 3C1YA 4NM1A 5KG5A 1WWUA 3NUQA 4ECZA 4YMNA 4UB8U 5J0SA 3LWLA 4PJ0U 1Z4NA 1A6SA 3B9JA 5KT6A 1Q46A 3HILA 1XO0A 2EDUA 3PSFA 4M04A 3WK9A 5DB9A 2XCPA 2OHFA 3BQ7A 2UVUA 3M8SA 8ICXA 5AM0A 1N62A 5L1MA 4Y2PA 5KFQA 1DXSA 3NVVA 4Y2TA 2WFAA 4Y2SA 1LV5A 3SV3A 2BCVA 2K8AA 2ZIUA 3WK8A 1Z00B 3PW2A 3LWMA 3SR6A 5KFMA 1T4GA 3QE9Y 5KFDA 5AHXA 2KIWA 9ICXA 1M6YA 2PFPA 2I1QA 4BDPA 4IRKA 1YZ7A 4QIWF 1ZD2P 5KL8B 4UASA 2V4QA 2KICA 1D8YA 4DQSA 3RB4A 4R8UA 3UXOA 2ZXIA 1ZQSA 2Y1JA 4YVZA 4O3QA 5AM5A 2YMPA 4YFKA 1XU4A 5KFBA 4R66A 2G5IB 1ZD3A 8ICAA 2LPEA 2I6XA 3VCBA 5BOMA 4O3NA 3KZIU 4ACOA 3D2QA 3QEAZ 2YTUA 1DK2A 4YMOA 1N61A 4ECUA 2E8MA 1D8BA 3CP8A 5KT5A 1Q3VA 2DPJA 4I29A 5KFVA 1ZJMA 2HBLA 4RQ8A 3UQ2A 4RQ3A 1ZQFA 3NASA 5AM3A 5F3XB 3NTUA 8ICNA 2HBJA 4RQNA 2KKPA 3TAQA 3EZ5A 4RT2A 1QTMA 5GTHU 4I2JA 2YQEA 2YX8A 4I2DA 2OYYA 2ASJA 2E5SA 5AKKA 5J29A 2IBKA 4XA5A 1BNPA 3RRGA 3GILA 1TK0A 2LYBA 4M9JA 3WK4A 2KHVA 1XNSA 2DPIA 4F93B 4MFAA 4EBEA 2HOQA 2OWOA 4IS7A 5KNIA 2P6RA 1JXLA 1MSWD 1K1QA 2PMZC 3OSNA 4B9MA 3B0XA 5CWRA 4RPXA 5KFWA 2AQ0A 5KFHA 3C2LA 3F53A 2ZIUB 3ETLA 4QZ8A 3G6XA 4GXIA 2W3SA 1ZQKA 3N28A 4RT3A 1COOA 5DQGA 2DGZA 5JU5A 3OPXA 5J2FA 8ICTA 1S77D 5IIIA 3WK7A 1C20A 3ZDAA 2A1AA 2H3QA 3BZCA 3AUOA 2CPRA 4ECSA 9ICKA 5HR7A 3H8MA 1WCLA 3GV7B 3TI0A 2VIXA 7ICRA 4R8UB 2BQ3A 1K5OA 4QZEA 2YN4A 4M9LA 8ICVA 4DLEA 1PVQA 4EBDA 1N5WA 2ZUDA 3AQEA 3TQ1A 2DF4B 2KMDA 1HEKA 1T3NA 4IC9A 3K4GA 1N2XA 2KV2A 4QJFB 2E3TA 2LYHA 3O0FA 8ICWA 2LBOA 2R8KA 2ZJ5A 1SWVA 3IRUA 5A0LA 2MA1A 5HR6A 8ICGA 8ICRA 3HRDD 2JHDA 2F76X 3SQIA 2BCRA 4I27A 2JEJA 9ICWA 5HHHA 4M9HA 9ICBA 2NRWA 4J9KA 1NI3A 1MN8A 2AGPA 2F8LA 3JPTA 2FDRA 2V9WA 5KFRA 3V72A 1NZBA 2C2EA 3H40A 1SKWA 2UVWA 3HW8A 9ICTA 2HBMA 1DOQA 5H2FU 3UMGA 4NL9C 4CE6A 4ED2A 2ATLA 4I2CA 5AKEA 1BPXA 3RJIA 4CF5A 4YCXA 4DSJA 5ALWA 3IP4B 1PVPA 2F1IA 4EYIB 2DBYA 3HPOA 1B43A 1L7OA 5KG1A 1TE2A 2JGAA 2QB0A 1IXRA 2R8JA 5KL1B 4F91B 4CGZA 8ICFA 4ECWA 1QQ5A 2J6TA 4Z6FA 2FI1A 3GDXA 5ALJA 4NXZA 3NS1A 1JMSA 9ICOA 5J0YA 2HHTA 4NJ8A 1L5UA 5HMLA 2F2AB 3PMLA 3PSTA 4KLOA 1V9PA 7ICGA 4RQ0A 3BQ2A 1SL2A 3PMNA 3RRHA 3SMVA 5L1KA 1U9LA 4YP3A 2Q0ZX 1SXEA 5ALXA 1DRGA 2FMPA 2WAQF 4RQMA 3SENA 1N56A 2KE7A 2Y9TA 3H0LB 2BKEA 7ICFA 3NVWA 4ED6A 1X42A 4C80A 1QCKA 1S0VA 8ICOA 4OJOA 5AM1A 2K8CB 4RUCA 2OM6A 3K75D 4G3IA 3GZFA 2IOHA 2W9BA 4US9A 1ZD5A 1IG6A 2V4RA 3QYPA 5ALHA 3ISCA 5ALEA 2OEHA 1XC9A 2HSZA 5JRTA 2AH5A 1NZPA 3DV9A 4KLTA 2W04A 2KJ8A 2YMLA 4DQPA 3PR4A 3IM1A 8ICUA 4YXMA 4DSLA 2AU0A 7ICLA 2C2RA 5DG8A 2ISOA 2ZTEA 2DL0A 5DB6A 4DWIA 2RDJA 2JEFA 3ZDEA 3QUCA 4F92B 1U47A 3IG8A 3QU7A 4J9OA 3PW4A 5F9NA 2QB0B 1BPBA 2W8LA 2VA3A 1V38A 5L1JA 1RXWA 4Y2QA 5KG6A 4O3SA 3SAHA 9ICMA 4KLGA 4RUAA 2XIDA 3IHQB 1L3VA 1QLNA 5ALZA 3WK6A 2FLPA 4UB2A 1NK8A 5B5EU 1TAUA 5DBAA 1A0PA 1O03A 4YD2A 4F4XA 2PXIA 2AGOA 4EBCA 3TADA 4EEYA 3AU6A 2ZIWA 5KFTA
chains in the Genus database with same CATH topology
3SENA 2QARA 2LMRA 3HILA 2KE7A 2Y9TA 1PK1B 2L5YA 2EAPA 3BQ7A 2ES6A 1SV4A 1X40A 2F3NA 2QARB 4PZOA 1OW5A 1F0MA 5L1MA 1B0XA 1SV0C 2KG5A 4IS7A 4PZNA 2KSOA 5KNIA 1KW4A 1DXSA 1COKA 1PK3A 2D3DA 3IDWA 1LKYA 2EANA 3BS7A 5J8YA 4MHVA 5JTIA 1WWVA 1Z1VA 2K60A 1JI7A 1LKYB 5JRTA 4NL9C 2EAOA 2F8KA 1UCVA 2Y9UA 5JU5A 2E8NA 1SV0A 3SEIA 2KSOB 2QB0A 2DL0A 1B4FA 3H8MA 2QKQA 2JV3A 2LPEA 3K1RB 1X9XA 2QB0B 2D8CA 2EAMA 4NL9A 2B6GA 2FE9A 2YTUA 1SXDA 1V38A 1RG6A 3KKAC 2E8MA 1PK1A 2E8PA 2KMDA 3TACB 3KKAA 4NJ8A 2GLEA 1X66A 2DKXA 1UQVA 2KIVA 1V85A 1OXJA 5F3XB 4RQNA 3BS5A 2K4PA 3TADC 1SXEA 5J8YC 1WWUA 2DKZA 2QB1A 3BS5B 3TADA 2ESEA 2E8OA 1SGGA 2F44A 4RQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEN A;  2QAR A;  2LMR A;  3HIL A;  2KE7 A;  2Y9T A;  1PK1 B;  2L5Y A;  2EAP A;  3BQ7 A;  2ES6 A;  1SV4 A;  1X40 A;  2F3N A;  2QAR B;  4PZO A;  1OW5 A;  1F0M A;  5L1M A;  1B0X A;  1SV0 C;  2KG5 A;  4IS7 A;  4PZN A;  2KSO A;  5KNI A;  1KW4 A;  1DXS A;  1COK A;  1PK3 A;  2D3D A;  3IDW A;  1LKY A;  2EAN A;  3BS7 A;  5J8Y A;  4MHV A;  5JTI A;  1WWV A;  1Z1V A;  2K60 A;  1JI7 A;  1LKY B;  5JRT A;  4NL9 C;  2EAO A;  2F8K A;  1UCV A;  2Y9U A;  5JU5 A;  2E8N A;  1SV0 A;  3SEI A;  2KSO B;  2QB0 A;  2DL0 A;  1B4F A;  3H8M A;  2QKQ A;  2JV3 A;  2LPE A;  3K1R B;  1X9X A;  2QB0 B;  2D8C A;  2EAM A;  4NL9 A;  2B6G A;  2FE9 A;  2YTU A;  1SXD A;  1V38 A;  1RG6 A;  3KKA C;  2E8M A;  1PK1 A;  2E8P A;  2KMD A;  3TAC B;  3KKA A;  4NJ8 A;  2GLE A;  1X66 A;  2DKX A;  1UQV A;  2KIV A;  1V85 A;  1OXJ A;  5F3X B;  4RQN A;  3BS5 A;  2K4P A;  3TAD C;  1SXE A;  5J8Y C;  1WWU A;  2DKZ A;  2QB1 A;  3BS5 B;  3TAD A;  2ESE A;  2E8O A;  1SGG A;  2F44 A;  4RQM A; 
#chains in the Genus database with same CATH topology
 4F5R A;  5ALF A;  5CP2 A;  4J03 A;  3AQF A;  1NK0 A;  3I1Y A;  2HDO A;  2W9C A;  2ES6 A;  4QWD A;  4MF2 A;  1X40 A;  5B66 U;  1WG8 A;  2O6K A;  2KNJ A;  2IOF K;  2BDP A;  2KTQ A;  1ED1 A;  4ELT A;  1F5S A;  1ZOL A;  1PZN A;  2OH2 A;  5J0W A;  3N7R C;  2D3D A;  3IDW A;  9ICL A;  3WK5 A;  3PNC A;  3F2C A;  5J0Q A;  1JIH A;  1WWV A;  3MAB A;  3RJK A;  5D49 A;  4FBT A;  5J2C A;  1ZQP A;  2YB1 A;  2EAO A;  7ICI A;  4IR1 A;  2EZZ A;  3SAF A;  4R65 A;  1HIW A;  4B9T A;  2Y9U A;  1KTQ A;  2CXY A;  2WF9 A;  2ZIV A;  5AKX A;  5KAI U;  2AJQ A;  2E8N A;  5IIL A;  5AM2 A;  8ICZ A;  3C2M A;  2KSO B;  5DB7 A;  4HYK A;  1MA7 A;  3T5L A;  3C21 A;  4Y2R A;  5GTI U;  2JV3 A;  4OJL A;  2Z7J A;  2ZXH A;  2KP7 A;  1U4B A;  3ZD9 A;  3QUT A;  2YMQ A;  3CRX A;  3UM9 A;  4GXK A;  4I2B A;  1PK1 A;  4EZ9 A;  2ZJA A;  4ELU A;  2YMM A;  3KKA A;  4GIB A;  4QIW C;  4FO6 A;  1IIP A;  3DEE A;  1X66 A;  5J0R A;  1KDH A;  4TQS A;  4UB4 A;  2KZZ A;  2ODG A;  3WKC A;  3LK9 A;  2G09 A;  4QWB A;  9ICA A;  4M6W A;  7ICK A;  4C7Y A;  4B9U A;  4AP9 A;  5KG4 A;  2PKE A;  4FE3 A;  5HP4 A;  3RF9 A;  5J2A A;  3QZ7 A;  1VJ5 A;  4DF8 A;  3PO5 A;  2RDI A;  1JRO A;  5KFJ A;  3HP6 A;  2FLN A;  5KFI A;  4P4M A;  2MSN A;  4MFF A;  2RP5 A;  3GU3 A;  2ZIW B;  3AN1 A;  2JH1 A;  2Y0S F;  1ZQN A;  5CRX A;  3J81 j;  2W9C B;  5AK4 A;  3T79 A;  5AIC A;  3EUB 2;  2EAN A;  4C8K A;  3RTV A;  5KG3 A;  3V7K A;  1TK8 A;  1JI7 A;  2EZX A;  3JPS A;  2JZB A;  4ED1 A;  4WJ3 B;  5AI5 A;  2WTF A;  3SYZ A;  1SIJ A;  4B9S A;  3Q8K A;  4FS1 A;  4DF4 A;  4UAR A;  1QQ6 A;  3QX7 A;  2GOL A;  2KEY A;  1RQL A;  4KLS A;  4C7Z A;  3BQ0 A;  4DFM A;  9ICJ A;  4PL2 A;  1YT3 A;  1KL9 A;  4DFD A;  2NYV A;  4F2R A;  2BPG A;  5KFN A;  4ED8 A;  2KVS A;  2N1R A;  3M9N B;  1ZQT A;  5D4B A;  4RQ5 A;  4BUG A;  3SD7 A;  4QZA A;  3G6V A;  2LI6 A;  3EW9 A;  4YD1 A;  3TFS A;  2VJ4 A;  2EQY A;  3TAC B;  2A1J A;  2RQ5 A;  5AIA A;  4RNN A;  8ICK A;  2KZ3 A;  2XI9 A;  4FBU A;  1ZQQ A;  4MF8 A;  5KFG A;  5EWG A;  1V85 A;  3OGU A;  4J9R A;  5EWF A;  1CI4 A;  5AI6 A;  4KLJ A;  5AK5 A;  4XUS A;  4KLH A;  2R8I A;  3M9O B;  9ICQ A;  2RHF A;  5E79 U;  4QNL A;  5JUM A;  2R8G A;  4EYH B;  1NKB A;  4OCZ A;  2DKZ A;  3PX0 A;  4RPZ A;  4IQW A;  2F44 A;  4M0A A;  4TUS A;  3Q8R B;  2RRD A;  4NV0 A;  3N7S C;  5DQH A;  1LB2 B;  2W54 A;  2G06 A;  2BPF A;  4PZO A;  1BVS A;  4M9G A;  3AU2 A;  1NK5 A;  1KLN A;  1K1S A;  2XY5 A;  4TUR A;  1FIQ A;  4RPY A;  4P2H A;  2FPL A;  4OJ5 A;  5EWE A;  3RH5 A;  1JAL A;  3MDA A;  5J8Y A;  3NVZ A;  4GXJ A;  3U26 A;  5EE1 A;  5DGB A;  2GH1 A;  1ZET A;  3F2B A;  1HJP A;  4CF3 A;  2MRL A;  4NY8 A;  3MDC A;  4RQ6 A;  1L3U A;  5AKY A;  1SKR A;  2F77 X;  3KHH A;  9ICC A;  2JZB B;  3RFA A;  3OJU A;  2JEG A;  4BWM A;  1UA1 A;  2C2D A;  1QH9 A;  2QLT A;  1NJZ A;  3IV6 A;  2W43 A;  8ICS A;  2YY6 A;  4J9P A;  3ZDD A;  3RJE A;  5EE3 A;  4QW8 A;  3K1R B;  1NKE A;  5J0X A;  4EX6 A;  4DL4 A;  4F3O A;  3EPI A;  2PI5 A;  1RG6 A;  4HAI A;  5J2B A;  5AIB A;  4NLZ A;  2YB4 A;  3GV8 B;  3RB3 A;  2BQU A;  2HW3 A;  1Q8K A;  1X6J A;  4PH5 A;  4B9N A;  1RYS A;  3T5K A;  1JXE A;  2FMQ A;  2FPM A;  5AKG A;  2HI0 A;  4YN4 A;  2BCU A;  5J0P A;  3I76 A;  3ALR A;  3H4B A;  3ETR A;  2FMS A;  2HOI A;  4QZF A;  1XO1 A;  2LM1 A;  4U6P A;  2QB1 A;  3WKA A;  2XC9 A;  2E8O A;  2A19 A;  4NLB A;  3QU5 A;  5BOL A;  4JV1 A;  4A8E A;  4MEX A;  3S6J A;  5ALS A;  1NOM A;  1WYG A;  4KLI A;  5AKH A;  4F5P A;  2K4H A;  4JV2 A;  2F1J A;  4F8R A;  5DLF A;  3F5E A;  1BPD A;  8ICM A;  3AMZ A;  4UB6 U;  4LJX A;  2NV3 A;  1RPL A;  2WF5 A;  1IV8 A;  1J2M A;  2CN1 A;  2WAQ C;  4DS5 A;  2AHO B;  3PSP A;  1XSP A;  4C8L A;  3M7D A;  4Y2X A;  5L9X A;  1JX4 A;  1KBU A;  5ALY A;  2K8B B;  4UB1 A;  3F5A A;  2BQR A;  3NVY A;  3RB0 A;  4C8O A;  3QEB Z;  2XIC A;  2NRX A;  2GO7 A;  5KFP A;  4QZB A;  2W7P A;  2ZUC A;  5KFO A;  3NGD A;  4PHE A;  1Z4O A;  2LYA A;  3MBY A;  3V7J A;  5KTQ A;  1S9F A;  4UQG A;  3MR3 A;  4UW9 A;  4PL1 A;  2BPC A;  4I2G A;  1UQV A;  1ZQZ A;  3JPQ A;  2XGQ A;  3TAP A;  2JR5 A;  5AM4 A;  3RH4 A;  9ICR A;  3ZD8 A;  2I9G A;  4KLD A;  1F44 A;  5KFC A;  2HHW A;  5AKJ A;  3OHB A;  1KEJ A;  1Q3U A;  1J2N A;  3N97 B;  5EE9 A;  1SGG A;  2JXJ A;  3IG5 A;  4ECT A;  3CNH A;  1N5X A;  2DUY A;  2E1E A;  2KD1 A;  4DS4 A;  3V7L A;  1T94 A;  2RLT A;  1SV4 A;  3F2D A;  2B21 A;  2OCE A;  4KX3 A;  4FZN A;  3WKE A;  1F0M A;  1S76 D;  1X9S A;  4ECR A;  2GWS A;  3MC1 A;  3GII A;  4IRD A;  1PK3 A;  5J2K A;  3AEV A;  4UAU A;  7ICT A;  4USA A;  4RZR A;  7ICO A;  3KBB A;  9ICV A;  1ZQH A;  2WB1 F;  1UT8 A;  3V6H A;  4KMU A;  3PSI A;  4NLN A;  5AKI A;  5TZV A;  1ZQR A;  1PUZ A;  2W9M A;  1S0M A;  4PGY A;  1MQ3 A;  3T5H A;  2MUT A;  3C23 A;  4EX7 A;  1NNL A;  3OJS A;  3KHG A;  3HX0 A;  3JPN A;  4OO1 J;  4KMO B;  2DQN B;  4I28 A;  4I2I A;  4ICA A;  4CCH A;  2PI4 A;  4PGQ A;  1ZQY A;  1QSY A;  4Q8E A;  1JRP A;  1ZQV A;  3THV A;  3EPG A;  2OXO A;  3DDH A;  4TUQ A;  5IIO A;  3UXN A;  8ICY A;  1ZQO A;  4QWA A;  1ZRM A;  2KVC A;  2I5H A;  3BS5 A;  1RYU A;  4O9M A;  5CB1 A;  4RNM A;  5DBB A;  4Q8F A;  8ICB A;  5ALD A;  4DL7 A;  4QZD A;  2BCQ A;  2P66 A;  1B22 A;  4F4Y A;  3Q8L A;  1X6I A;  5AK3 A;  2HBK A;  4UAT A;  4P4P A;  8ICE A;  1L3T A;  4O3O A;  4CRX A;  3D2N A;  2EAP A;  3R9K A;  2R18 A;  3LVW A;  9ICI A;  3VC8 A;  2H5X A;  4PZN A;  1KW4 A;  5ALV A;  4ELV A;  1TK5 A;  1N63 A;  1LKY A;  1KFT A;  2J6U A;  4I2F A;  3TFR A;  1S97 A;  1BPZ A;  5J0O A;  5ALR A;  4ECV A;  1BGX T;  3PV8 A;  3JPR A;  5KFZ A;  3FYH A;  2C28 A;  1CUK A;  5C5J A;  9ICE A;  3E2E A;  4XQ8 A;  2Y0S C;  3CW2 C;  2ASD A;  1QSS A;  4KLQ A;  2W9A A;  3MGH A;  3D2S A;  1SB3 C;  3RJJ A;  1SV0 A;  5DQI A;  2W9B B;  3SEI A;  3UMB A;  4RQ4 A;  3BZK A;  2QKQ A;  1ZD4 A;  2MUT B;  5CR0 A;  5DBC A;  4CNQ A;  3RB6 A;  4TQR A;  4QW9 A;  4YMM A;  2W11 A;  4K4G A;  8ICC A;  2K4E A;  5ALQ A;  5KFF A;  3M1Y A;  4UB5 A;  5HMM A;  2H3V A;  1L7N A;  4R64 A;  5D46 A;  2GLE A;  1GO3 F;  4PGX A;  3ICX A;  2IOF A;  4UBB A;  1KKX A;  4J9Q A;  2H3I A;  4KLU A;  4P0Q A;  4FZL A;  5IIJ A;  3V6K A;  4DL6 A;  2JRZ A;  5ALL A;  5ALN A;  2ZJ8 A;  2HHV A;  5DG7 A;  3I28 A;  3C1Z A;  3PO4 A;  3BS5 B;  4JK1 A;  3M6K A;  3WU2 U;  1QSL A;  2A3V A;  2LMR A;  4J9M A;  5J2G A;  4DOC A;  1L7M A;  5ALO A;  5KG0 A;  4CDG A;  4ED3 A;  7ICS A;  1HUZ A;  4F4K A;  2D6F C;  5ALG A;  4UAZ A;  5G5H A;  4DCC A;  4OD0 A;  1B0X A;  1ZRN A;  4C4T A;  3N4M B;  1X9M A;  3ONN A;  3M6Z A;  4K4I A;  1YZ6 A;  4Q43 A;  1IM4 A;  3FC4 A;  3NRW A;  4RQ1 A;  5KFY A;  1Z1V A;  9ICS A;  1LKY B;  5CA7 A;  2F8K A;  1C7Y A;  3GIM A;  4QZ9 A;  9ICG A;  3PW7 A;  7ICQ A;  4JWN A;  2WHE A;  1UHU A;  5J2H A;  1CEZ A;  2VJ5 A;  4YR0 A;  3FAH A;  2AQ4 A;  1UT5 A;  4O3P A;  2ZG6 A;  1Z1B A;  1MQ2 A;  1VDV A;  2NRT A;  3A0B U;  4UAW A;  3PVX A;  1ZQM A;  2WF6 A;  4Q45 A;  3GV5 B;  1PVR A;  4JUZ A;  1X9X A;  3RR8 A;  2IA6 A;  7ICN A;  4KLE A;  1ZQX A;  2W03 A;  1KFS A;  2JMG A;  4IQU A;  2HOF A;  3HKZ F;  2KHQ A;  1FEZ A;  2JH7 A;  1RM6 C;  4J9S A;  3H8S A;  1URJ A;  2Q4T A;  3ISB A;  2HHU A;  2ZIV B;  4NWI A;  4O5E A;  2HCF A;  4Y2U A;  3KHR A;  4P0P A;  4GLX A;  4ECY A;  4PHP A;  1L8L A;  5KG7 A;  2W8K A;  4P0Q B;  3PX4 A;  3MFI A;  4NLK A;  4QWC A;  5KFU A;  1KQQ A;  4UBC A;  2ISP A;  3E58 A;  3JPP A;  4JB3 A;  1ZQW A;  4C4R A;  3M8R A;  1TV9 A;  8ICH A;  3OTQ A;  3C5G A;  4I2E A;  2QAR A;  4IQV A;  8ICL A;  1PK1 B;  1XS9 D;  1KRP A;  2L5Y A;  4B9V A;  4Y2Y A;  2F1H A;  4U7C A;  4US8 A;  4XRH A;  5J2I A;  1EXN A;  2G07 A;  9ICH A;  2KOB A;  4DSK A;  1SL1 A;  1COK A;  3KZX A;  1T7P A;  4RU9 A;  4M6W B;  3HT3 A;  1N48 A;  4BGD A;  2K4I A;  2W3R A;  5DG9 A;  1U45 A;  2ASL A;  3UPQ A;  1JN3 A;  1ZQJ A;  4DL5 A;  2K89 A;  3H7I A;  1BPE A;  3EWA A;  4C4S A;  1TKD A;  1Y88 A;  4DSI A;  2E1F A;  5AK6 A;  4F5Q A;  7ICU A;  5AI9 A;  4CF4 A;  4DOA A;  5J2J A;  5L1I A;  8ICP A;  4PHA A;  3BDP A;  1ZQE A;  1HUO A;  3MR2 A;  1OUQ A;  4KN4 A;  1AQ6 A;  1S10 A;  1QQ7 A;  2LKY A;  3MFH A;  3MR5 A;  3L4P A;  4BWJ A;  4FZM A;  5DGA A;  2P6U A;  2EAM A;  3CYM A;  2EZY A;  1KSP A;  3G6Y A;  1L3S A;  2KN7 A;  4RQ7 A;  1JUD A;  3MR6 A;  3BQ1 A;  1RDF A;  4G9B A;  2G0A A;  1L7P A;  1FFU A;  1DGS A;  3Q8M A;  1OXJ A;  1CRX A;  2NRZ A;  3AM9 A;  4R63 A;  4B9L A;  1TAQ A;  1ECW A;  7ICP A;  1L8O A;  5IIM A;  5AKZ A;  4P0P B;  4AYB C;  5J8Y C;  1RYR A;  3KOO A;  4DEZ A;  4M9N A;  4IR9 A;  4ED0 A;  1A76 A;  2ESE A;  5K4L A;  5CEH A;  1FO4 A;  4OJP A;  4O0I A;  1S8O A;  3PX6 A;  4YQW A;  5TIS U;  5DKW A;  4GC6 A;  5ALT A;  4ECQ A;  2A1J B;  1O08 A;  2F3N A;  4KLL A;  8ICQ A;  2QAR B;  1ZQ1 C;  1A77 A;  1U49 A;  1WCN A;  2KG5 A;  4RQ2 A;  4DL2 A;  3A0H U;  4LZD A;  1UA0 A;  3RH6 A;  4J9L A;  2ZTD A;  5KFE A;  2XCA A;  4JWM A;  4KIT B;  3D6J A;  3KHL A;  3QXG A;  3Q8S B;  1FFV A;  4MHV A;  3T3F A;  5JTI A;  5KT3 A;  5KFX A;  2MU2 A;  3B0Y A;  2NO5 A;  4YR2 A;  3OSP A;  5L1L A;  1ZQL A;  1ZQB A;  1Z19 A;  3C28 A;  5IIN A;  7ICE A;  4ZOH C;  4KTQ A;  4F5N A;  5KFS A;  4QZG A;  3QUB A;  3JPO A;  5KT2 A;  2ALZ A;  3KFU F;  2DWQ A;  5HNK A;  1ZJN A;  4QWE A;  5ALP A;  4Y2V A;  5CHG A;  2EH9 A;  2HHS A;  3PZP A;  3LYS A;  1BNO A;  1NK4 A;  3FDS A;  3WKB A;  1B4F A;  5DDY A;  7ICH A;  3C29 A;  4NM2 A;  1SWW A;  3ISD A;  4NL9 A;  2WB1 C;  5J0T A;  3RJH A;  4KLF A;  1SXD A;  2VAN A;  4O3R A;  4GFJ A;  3N7P D;  3UXP A;  1H38 A;  2PFN A;  5ALI A;  1RXV A;  1NK9 A;  3V6J A;  2KIV A;  4DSF A;  3UQ0 A;  5ALK A;  3RBE A;  1DK3 A;  4KLM A;  1KN5 A;  3ED5 A;  4AYB F;  2K4P A;  3GIJ A;  1L6N A;  2PMZ F;  4O5C A;  4YR3 A;  1XSN A;  4DQQ A;  5IIK A;  3PW5 A;  3H0R B;  3L3F X;  4BJQ A;  4TUP A;  3PR5 B;  4DO9 A;  1NJW A;  4LVS A;  4NLC A;  1OW5 A;  2NO4 A;  2XO7 A;  2VKQ A;  4Z6E A;  1TVA A;  3ORY A;  5KT4 A;  4C8N A;  5EOZ A;  3QNM A;  3BS7 A;  2G5H B;  4P4O A;  2K60 A;  3PY8 A;  3QU4 A;  3L5K A;  1LVH A;  2H3Z A;  5DLG A;  5J0U A;  4DQR A;  2BR0 A;  3RJG A;  7ICJ A;  2BCS A;  3QU9 A;  3H4D A;  4KN7 A;  4YG2 A;  2MAX A;  3BQT A;  1ARO P;  1D8L A;  3C2K A;  2W55 A;  1BPY A;  1SKS A;  1SZP A;  1RZT A;  4FS2 A;  3TAN A;  5J2D A;  9ICP A;  3EYZ A;  2D8C A;  4M47 A;  1ZQA A;  2HHQ A;  2PFO A;  4F5O A;  2BDU A;  2BZF A;  3BJY A;  4DFP A;  2LHT A;  5BPC A;  4O3M A;  2IHN A;  1XSL A;  3ZI4 A;  1NK7 A;  4IL6 U;  1ZQG A;  4O5K A;  2BHN A;  3H8W A;  4F50 A;  5EE0 A;  2HHX A;  2WF8 A;  4OJ6 A;  5DDM A;  4UB3 A;  1NJX A;  5G5G A;  2B0C A;  2NRV A;  4JV0 A;  4IRC A;  4F71 A;  4J9N A;  1ZQI A;  3QU2 A;  1NKC A;  4Q44 A;  1S5L U;  4DLG A;  1X9W A;  4PHD A;  3SI8 A;  2G08 A;  4DL3 A;  4Z6D A;  1X2I A;  3WKD A;  1T3Q A;  4F72 A;  1KFD A;  3AL0 B;  3HWT A;  3C5F A;  2KK0 A;  2R8H A;  2JEI A;  2AGQ A;  1MC8 A;  2W7O A;  1SL0 A;  1TFR A;  2KSO A;  4X5V A;  4C8M A;  3GIK A;  2FLL A;  5AI8 A;  2FPK A;  4BX9 C;  4QZC A;  7ICM A;  4UAY A;  4EEK A;  4MFC A;  5KFA A;  4Z6C A;  4FFD A;  5DB8 A;  4C0Z A;  4DQI A;  1J97 A;  1T8E A;  2PFQ A;  2J6S A;  4BXO A;  4DFK A;  2CRX A;  3SV4 A;  2IHM A;  3IN5 A;  4JMU A;  5AI0 A;  3Q8P B;  4I2H A;  2XGP A;  7ICV A;  5KT7 A;  5KFL A;  4GC7 A;  1S0N A;  3KTQ A;  5C0Y A;  2KZM A;  2BGW A;  4M2Y A;  3RR7 A;  2KKV A;  4YXJ A;  1NJY A;  5KAF U;  4QZI A;  2FE9 A;  3E0F A;  3QZ8 A;  1UPH A;  9ICF A;  1SZH A;  2XY6 A;  3HJE A;  2UVV A;  2IMW P;  2E8P A;  5HHI A;  3H8J A;  1D9D A;  3PW0 A;  3UMC A;  4ECX A;  1NK6 A;  2XY7 A;  3SZ2 A;  2DKX A;  2ZIX A;  2XVT A;  2Y1I A;  1D9F A;  5KG2 A;  3GFK B;  3TAD C;  1ZYQ A;  4RNO A;  1WUD A;  5T14 A;  9ICN A;  1ZQC A;  1RQN A;  4EEN A;  1DGJ A;  3NRZ A;  3HKZ C;  2WF7 A;  1ZQU A;  2AXT U;  3GQC A;  2M0N A;  2ZUB A;  4ED7 A;  4LZG A;  3Q8Q B;  2HMX A;  4MEY A;  2VA8 A;  4F2S A;  2HVH A;  3RAQ A;  1SV0 C;  1N60 A;  4EZ6 A;  3H0M B;  2M9N A;  1Z00 A;  2LM4 A;  9ICU A;  8ICI A;  4DSE A;  2VA2 A;  4EEL A;  3OHA A;  3RAX A;  4K4H A;  3KD3 A;  5ALU A;  1U48 A;  3QUQ A;  3SAG A;  4NLG A;  2KJ5 A;  4I2A A;  2ZTC A;  1V97 A;  1P7D A;  1UCV A;  3FM9 A;  3RBD A;  4PPX A;  4B6J A;  3MGV A;  1VLB A;  5CJ7 A;  4BXO B;  3ZDC A;  1ZQD A;  3M9M B;  5J2E A;  2P35 A;  5AKL A;  2KFZ A;  4DOB A;  3LDA A;  8ICJ A;  4UAV A;  2KFN A;  3T5J A;  3TAR A;  4F4Z A;  2DFL A;  2B6G A;  2C22 A;  2UVR A;  1S0O A;  2H3F A;  3KKA C;  4KX5 A;  4QZH A;  3TKA A;  5FP0 A;  2KJ9 A;  2FJ6 A;  4F4W A;  4Y2J A;  4E0D A;  1XWL A;  3RJF A;  3ZDB A;  5F9L A;  4ZH4 A;  1ZXI A;  5ALM A;  2HVI A;  4DFJ A;  3LVV A;  3MGI A;  1Z3E B;  3K1Z A;  5KFK A;  1TAM A;  4IQT A;  2ZIX B;  5AI4 A;  3C1Y A;  4NM1 A;  5KG5 A;  1WWU A;  3NUQ A;  4ECZ A;  4YMN A;  4UB8 U;  5J0S A;  3LWL A;  4PJ0 U;  1Z4N A;  1A6S A;  3B9J A;  5KT6 A;  1Q46 A;  3HIL A;  1XO0 A;  2EDU A;  3PSF A;  4M04 A;  3WK9 A;  5DB9 A;  2XCP A;  2OHF A;  3BQ7 A;  2UVU A;  3M8S A;  8ICX A;  5AM0 A;  1N62 A;  5L1M A;  4Y2P A;  5KFQ A;  1DXS A;  3NVV A;  4Y2T A;  2WFA A;  4Y2S A;  1LV5 A;  3SV3 A;  2BCV A;  2K8A A;  2ZIU A;  3WK8 A;  1Z00 B;  3PW2 A;  3LWM A;  3SR6 A;  5KFM A;  1T4G A;  3QE9 Y;  5KFD A;  5AHX A;  2KIW A;  9ICX A;  1M6Y A;  2PFP A;  2I1Q A;  4BDP A;  4IRK A;  1YZ7 A;  4QIW F;  1ZD2 P;  5KL8 B;  4UAS A;  2V4Q A;  2KIC A;  1D8Y A;  4DQS A;  3RB4 A;  4R8U A;  3UXO A;  2ZXI A;  1ZQS A;  2Y1J A;  4YVZ A;  4O3Q A;  5AM5 A;  2YMP A;  4YFK A;  1XU4 A;  5KFB A;  4R66 A;  2G5I B;  1ZD3 A;  8ICA A;  2LPE A;  2I6X A;  3VCB A;  5BOM A;  4O3N A;  3KZI U;  4ACO A;  3D2Q A;  3QEA Z;  2YTU A;  1DK2 A;  4YMO A;  1N61 A;  4ECU A;  2E8M A;  1D8B A;  3CP8 A;  5KT5 A;  1Q3V A;  2DPJ A;  4I29 A;  5KFV A;  1ZJM A;  2HBL A;  4RQ8 A;  3UQ2 A;  4RQ3 A;  1ZQF A;  3NAS A;  5AM3 A;  5F3X B;  3NTU A;  8ICN A;  2HBJ A;  4RQN A;  2KKP A;  3TAQ A;  3EZ5 A;  4RT2 A;  1QTM A;  5GTH U;  4I2J A;  2YQE A;  2YX8 A;  4I2D A;  2OYY A;  2ASJ A;  2E5S A;  5AKK A;  5J29 A;  2IBK A;  4XA5 A;  1BNP A;  3RRG A;  3GIL A;  1TK0 A;  2LYB A;  4M9J A;  3WK4 A;  2KHV A;  1XNS A;  2DPI A;  4F93 B;  4MFA A;  4EBE A;  2HOQ A;  2OWO A;  4IS7 A;  5KNI A;  2P6R A;  1JXL A;  1MSW D;  1K1Q A;  2PMZ C;  3OSN A;  4B9M A;  3B0X A;  5CWR A;  4RPX A;  5KFW A;  2AQ0 A;  5KFH A;  3C2L A;  3F53 A;  2ZIU B;  3ETL A;  4QZ8 A;  3G6X A;  4GXI A;  2W3S A;  1ZQK A;  3N28 A;  4RT3 A;  1COO A;  5DQG A;  2DGZ A;  5JU5 A;  3OPX A;  5J2F A;  8ICT A;  1S77 D;  5III A;  3WK7 A;  1C20 A;  3ZDA A;  2A1A A;  2H3Q A;  3BZC A;  3AUO A;  2CPR A;  4ECS A;  9ICK A;  5HR7 A;  3H8M A;  1WCL A;  3GV7 B;  3TI0 A;  2VIX A;  7ICR A;  4R8U B;  2BQ3 A;  1K5O A;  4QZE A;  2YN4 A;  4M9L A;  8ICV A;  4DLE A;  1PVQ A;  4EBD A;  1N5W A;  2ZUD A;  3AQE A;  3TQ1 A;  2DF4 B;  2KMD A;  1HEK A;  1T3N A;  4IC9 A;  3K4G A;  1N2X A;  2KV2 A;  4QJF B;  2E3T A;  2LYH A;  3O0F A;  8ICW A;  2LBO A;  2R8K A;  2ZJ5 A;  1SWV A;  3IRU A;  5A0L A;  2MA1 A;  5HR6 A;  8ICG A;  8ICR A;  3HRD D;  2JHD A;  2F76 X;  3SQI A;  2BCR A;  4I27 A;  2JEJ A;  9ICW A;  5HHH A;  4M9H A;  9ICB A;  2NRW A;  4J9K A;  1NI3 A;  1MN8 A;  2AGP A;  2F8L A;  3JPT A;  2FDR A;  2V9W A;  5KFR A;  3V72 A;  1NZB A;  2C2E A;  3H40 A;  1SKW A;  2UVW A;  3HW8 A;  9ICT A;  2HBM A;  1DOQ A;  5H2F U;  3UMG A;  4NL9 C;  4CE6 A;  4ED2 A;  2ATL A;  4I2C A;  5AKE A;  1BPX A;  3RJI A;  4CF5 A;  4YCX A;  4DSJ A;  5ALW A;  3IP4 B;  1PVP A;  2F1I A;  4EYI B;  2DBY A;  3HPO A;  1B43 A;  1L7O A;  5KG1 A;  1TE2 A;  2JGA A;  2QB0 A;  1IXR A;  2R8J A;  5KL1 B;  4F91 B;  4CGZ A;  8ICF A;  4ECW A;  1QQ5 A;  2J6T A;  4Z6F A;  2FI1 A;  3GDX A;  5ALJ A;  4NXZ A;  3NS1 A;  1JMS A;  9ICO A;  5J0Y A;  2HHT A;  4NJ8 A;  1L5U A;  5HML A;  2F2A B;  3PML A;  3PST A;  4KLO A;  1V9P A;  7ICG A;  4RQ0 A;  3BQ2 A;  1SL2 A;  3PMN A;  3RRH A;  3SMV A;  5L1K A;  1U9L A;  4YP3 A;  2Q0Z X;  1SXE A;  5ALX A;  1DRG A;  2FMP A;  2WAQ F;  4RQM A;  3SEN A;  1N56 A;  2KE7 A;  2Y9T A;  3H0L B;  2BKE A;  7ICF A;  3NVW A;  4ED6 A;  1X42 A;  4C80 A;  1QCK A;  1S0V A;  8ICO A;  4OJO A;  5AM1 A;  2K8C B;  4RUC A;  2OM6 A;  3K75 D;  4G3I A;  3GZF A;  2IOH A;  2W9B A;  4US9 A;  1ZD5 A;  1IG6 A;  2V4R A;  3QYP A;  5ALH A;  3ISC A;  5ALE A;  2OEH A;  1XC9 A;  2HSZ A;  5JRT A;  2AH5 A;  1NZP A;  3DV9 A;  4KLT A;  2W04 A;  2KJ8 A;  2YML A;  4DQP A;  3PR4 A;  3IM1 A;  8ICU A;  4YXM A;  4DSL A;  2AU0 A;  7ICL A;  2C2R A;  5DG8 A;  2ISO A;  2ZTE A;  2DL0 A;  5DB6 A;  4DWI A;  2RDJ A;  2JEF A;  3ZDE A;  3QUC A;  4F92 B;  1U47 A;  3IG8 A;  3QU7 A;  4J9O A;  3PW4 A;  5F9N A;  2QB0 B;  1BPB A;  2W8L A;  2VA3 A;  1V38 A;  5L1J A;  1RXW A;  4Y2Q A;  5KG6 A;  4O3S A;  3SAH A;  9ICM A;  4KLG A;  4RUA A;  2XID A;  3IHQ B;  1L3V A;  1QLN A;  5ALZ A;  3WK6 A;  2FLP A;  4UB2 A;  1NK8 A;  5B5E U;  1TAU A;  5DBA A;  1A0P A;  1O03 A;  4YD2 A;  4F4X A;  2PXI A;  2AGO A;  4EBC A;  3TAD A;  4EEY A;  3AU6 A;  2ZIW A;  5KFT A; 
#chains in the Genus database with same CATH homology
 3SEN A;  2QAR A;  2LMR A;  3HIL A;  2KE7 A;  2Y9T A;  1PK1 B;  2L5Y A;  2EAP A;  3BQ7 A;  2ES6 A;  1SV4 A;  1X40 A;  2F3N A;  2QAR B;  4PZO A;  1OW5 A;  1F0M A;  5L1M A;  1B0X A;  1SV0 C;  2KG5 A;  4IS7 A;  4PZN A;  2KSO A;  5KNI A;  1KW4 A;  1DXS A;  1COK A;  1PK3 A;  2D3D A;  3IDW A;  1LKY A;  2EAN A;  3BS7 A;  5J8Y A;  4MHV A;  5JTI A;  1WWV A;  1Z1V A;  2K60 A;  1JI7 A;  1LKY B;  5JRT A;  4NL9 C;  2EAO A;  2F8K A;  1UCV A;  2Y9U A;  5JU5 A;  2E8N A;  1SV0 A;  3SEI A;  2KSO B;  2QB0 A;  2DL0 A;  1B4F A;  3H8M A;  2QKQ A;  2JV3 A;  2LPE A;  3K1R B;  1X9X A;  2QB0 B;  2D8C A;  2EAM A;  4NL9 A;  2B6G A;  2FE9 A;  2YTU A;  1SXD A;  1V38 A;  1RG6 A;  3KKA C;  2E8M A;  1PK1 A;  2E8P A;  2KMD A;  3TAC B;  3KKA A;  4NJ8 A;  2GLE A;  1X66 A;  2DKX A;  1UQV A;  2KIV A;  1V85 A;  1OXJ A;  5F3X B;  4RQN A;  3BS5 A;  2K4P A;  3TAD C;  1SXE A;  5J8Y C;  1WWU A;  2DKZ A;  2QB1 A;  3BS5 B;  3TAD A;  2ESE A;  2E8O A;  1SGG A;  2F44 A;  4RQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...