2VKQA

Crystal structure of human cytosolic 5'-nucleotidase iii (cn-iii, nt5c3) in complex with beryllium trifluoride
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cytosolic 5'- Nucleotidase III
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2vkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2vkqA01
2FUCA 3IJ5A 4KNWA 2FPXA 3DV9A 4BNDB 4BX3A 3B8EA 1K1EA 3U13A 3L7YA 5JJBA 2BDEA 5AW5A 1NRWA 4NFLA 4Y2JA 3OPXA 3AR9A 5ALEA 2GHTA 1U7OA 5AIBA 1JUDA 2JAWA 4AP9A 4HGNA 4J2TA 5AM1A 3P96A 5ALKA 5ALJA 4ZEVA 4BEWA 1CR6A 1KYTA 4EX7A 5AVVA 2IOFA 1RLTA 2G09A 4YIHA 3N5KA 2HOQA 1RQLA 1YS9A 1Z88A 3L8EA 4PNHA 3U7GA 2X4DA 4Y3UA 2FPWA 1WZCA 1Z4QA 3L8HA 4XPZA 2C8KA 3QU5A 1L7OA 2ZBEA 3ZTWA 5AVWA 3W5DA 3I1YA 4AS3A 2EATA 3WK6A 1EK2A 5ALXA 4O8CA 5ALGA 4CF3A 5ALDA 2BDUA 3FM9A 4YCNA 4YCLA 4YGYA 5ALIA 2JARA 5AVTA 4NWIA 3A1EA 2B30A 5AKJA 1WPGA 2G80A 1Z4JA 3SLRA 3OCUA 3L0CA 3S6JA 3N1UA 2ZBDA 3D6JA 4XOUA 4KN8A 1QQ7A 3ED5A 2FUEA 1VFPA 1L7NA 1RC8A 2PQ0A 5ALNA 2PKEA 3E81A 5ALVA 3TLMA 3QLEA 4HAIA 4UM5A 4F72A 3U26A 4HGOA 3WK8A 5AW9A 1S8OA 2NO5A 3QUBA 1Z4PX 5ALUA 1SWWA 3ZU6A 4MWOA 2ZBGA 2ZG6A 2W43A 3W5CA 2G08A 3IB6A 4OHFA 3W5AA 2C88A 2HHLA 2IOHA 3RFUA 3ZX4A 3I6BA 4XE5A 3GYGA 3B9RA 1T9ZA 4DFDA 4L6AA 3W5BA 3A1CA 3QUCA 5ALSA 3ZW7A 2AH5A 5ALOA 3SD7A 1L7PA 4Y2UA 1X42A 2G1AA 1QH9A 3AR4A 1ZD5A 2CFTA 2OM6A 4UU0A 4DCCA 5ALHA 1VJRA 2EARA 5AIAA 3ZVMA 2YJ6A 1XVIA 2Q4TA 5IS2A 4EELA 3L1UA 3QXGA 3A1DA 2O9JA 5AW6A 2B82A 5AVYA 3WKBA 1NNLA 1J8DA 2YN4A 4NAVA 5ALYA 3EF0A 5AKXA 1U02A 1TJ4A 2HCFA 1S2OA 1ZD2P 3KZXA 5AM5A 5AI5A 3VAYA 2HX1A 3ZX5A 4E88A 2RARA 1WR8A 3NALA 4FFDA 4RETA 3DNPA 3ZI4A 2WF8A 4HGPA 5A3SA 2HEGA 3MN1A 4BX0A 3OCVA 2Q5EA 3AR8A 4Y2RA 1RQNA 1PW5A 1LTQA 5AKKA 2YFYA 3MMZA 2HI0A 2B1RA 3A3YA 5AICA 4Y2VA 1T5TA 4I9FA 2OBBA 2ZBFA 3EF1A 4IFTA 3ZTYA 1RKQA 4UATA 2R8XA 3FPSA 2FPSA 3HLTA 3WKDA 1U2SA 3QU7A 1ZS9A 3QYPA 4HGRA 2OA0A 3R9KA 5AVSA 4DW8A 2YJ5A 4UARA 2JAUA 3NUQA 4CF4A 1RMQA 2PR7A 5AK5A 2CFRA 4BX2A 5AW1A 2DQSA 5E0OA 5AI8A 1WVIA 3L1VA 3SMVA 4AS2A 1YMQA 5AKIA 3L8FA 3E84A 1T5SA 4UAVA 4QQFA 2CFSA 2P69A 3OCYA 4Y2SA 3QUTA 2RAVA 4UASA 2B0CA 4IG4A 4Y2TA 3M1YA 4KNVA 2ZXEA 5AVXA 3BWVA 1AQ6A 5AI0A 5AKGA 2YBDA 2I54A 3ZWKA 5AVZA 3ZVNA 2MU1A 3QU2A 3AR6A 1YDFA 4H1WA 4CE6A 5AVUA 2I33A 5AHXA 3KOOA 2C4NA 3DDHA 4FE3A 5AW3A 1LVHA 5AK6A 2HO4A 2I34A 4F71A 1YJ5A 4BYGA 5AM2A 3SKYA 5AKYA 5ALWA 5AI6A 3R09A 4YH1A 3ESRA 2YMLA 3KD3A 2JGAA 2WF7A 1RKVA 2YY6A 1NF2A 5AKLA 5AKZA 4MUMA 5AM0A 3MC1A 2GHQA 3QU4A 3QX7A 4C4SA 5A3QA 4KYTA 3ZUPA 4UMDA 5AI9A 3E58A 3OCZA 3J7TA 1SU4A 1YV9A 1RPZA 2YMPA 2P9JA 4L57A 3PGLA 5IT0A 3WGUA 2RB5A 4BEVA 2G06A 2WM8A 1SWVA 3U7EB 3B9BA 2HF2A 3NASA 5AKEA 3QNMA 5AK4A 2BY4A 2QLTA 4UMFA 3SF0A 1RMTA 2JAOA 2R8ZA 4EEKA 1N9KA 4YCMA 3QU9A 1TA0A 5AW7A 1Z4IA 3ONNA 2VKQA 2R8EA 2C9MA 4ZEWA 2EAUA 3E8MA 3FPBA 3HYCA 1Z4NA 3FVVA 1O03A 3UMGA 3EPRA 5ALLA 2FPUA 3WK7A 1CQZA 3DAOA 3L5KA 4I9GA 5AK3A 1Q91A 5ALQA 3ZWDA 2YMMA 3L0BA 3K1ZA 4OCZA 3MPOA 1Z5UA 4NV0A 4B6JA 1L6RA 3N8GA 5ALMA 5T41A 1ZJJA 3FGOA 3RF6A 5AW8A 4BNDA 2G07A 2Q4RA 2AUTA 2FI1A 2IOFK 5ALTA 2AGVA 4ZEXA 1ZRMA 3NIWA 4UMVA 1RLMA 4KX3A 2WF6A 3WGVA 5AVRA 2YMQA 2CN1A 2AMYA 4UW9A 2FEAA 5AVQA 1XP5A 3AR2A 4EENA 1U7PA 3OTQA 5AW0A 1QYIA 3CZ4A 2W4MA 1U2TA 2HDOA 4Y2YA 1YNSA 2QYHA 1F5SA 2ODAA 5ALPA 1QQ6A 1O08A 3AR3A 1Z4KA 2G0AA 2NO4A 2MSNA 3AR7A 3L0YA 5AM3A 2P27A 1ZD4A 4NABA 1EK1A 4HYTA 4C4RA 4EX6A 4GIBA 3ZVLA 3KC2A 4UM7A 5A3RA 5AKHA 1Z4MA 4Y2QA 5ALFA 1XPJA 4CNQA 2WHEA 3UMBA 1ZRNA 2I6XA 5AM4A 3WK4A 3KDPA 3OCXA 1RRCA 2IA5A 1L7MA 3U7FB 5ALZA 3UM9A 2B1QA 4JB3A 2OYCA 3NAMA 3PCTA 3PDWA 3UMCA 3I28A 4QJBA 4J03A 4YIKA 2B8EA 3R4CA 3N07A 5IT4A 4Y2XA 4Y2PA 3NRJA 1Z5GA 2ZOSA 3I76A 2O2XA 3SHQA 3WKCA 4OD0A 1IWOA 3AR5A 4G63A 2GFHA 3ET5A 1ZOLA 4BKMA 1FEZA 3WK9A 2NYVA 4BBJA 3M9LA 4JDPA 3QUQA 2HSZA 5AI4A 3KBBA 1J97A 1Z4OA 2WFAA 3WKEA 4UU1A 1RDFA 5AW2A 1RMYA 1ZD3A 4UMEA 4DWOA 3OCWA 4UAUA 2R8YA 3QGMA 3BA6A 3ESQA 3WK5A 4CF5A 5ALRA 1TE2A 4G9BA 3U19A 1N8NA 3N28A 2FPRA 1RLOA 3IRUA 3SKXA 1MH9A 3NANA 4XQ0A 4KX5A 1RKUA 2IYEA 5FP0A 4EZEA 2I55A 4HGQA 2W11A 3CNHA 3EWIA 1L8OA 3U7HB 4FYPA 1Q92A 5AW4A 1VJ5A 2RBKA 2YJ4A 2GO7A 1Z4LA 4OFZA 1TJ5A 2B8JA 1QQ5A 2D2VA 4RESA 1L8LA 4L6CA 1Y8AA 3WKAA 1TJ3A 2GMWA 3ET4A 2HF7A 2FDRA 2WF5A 4C4TA 2WF9A 2I7DA 3L8GA 4GXTA 5AESA 2C8LA 2P11A 3PGVA 2YJ3A 3F9RA 3FZQA
chains in the Genus database with same CATH superfamily
1UC8A 2XVZA 2HPAA 2JH1A 1OJLA 1YZGA 2HCBA 3CEJA 3GVIA 3K6RA 3N2IA 4GSKA 4MVWA 4X6UA 3SX0A 3U7QB 3UJBA 4KFCA 1IWBB 1P5ZB 1WBBA 3RVQA 1N33B 3C3XA 4QUGA 3OQNA 5FUVA 1ECFA 1OW5A 4NXMB 1PJTA 5KFKA 2NXEA 4OGKA 1RG6A 2JFFA 3K9LA 4LJ9A 1E9EA 1TADA 4WVFA 5K4AA 3G89A 1D3AA 2Y1XA 4ZHQA 3K09C 1KI4A 1MABA 2FPMA 1TX4B 1M2OB 2NO1A 2OXRA 3EVZA 4JUAA 4C6SA 2QY6A 2HHUA 4IFIA 4EUEA 3V3TA 1KSFX 3CKMA 3WOVA 4MTLA 2IYFA 2PD3A 3QKRB 1E9SA 3V1YA 4ECQA 3AY0A 3ELWA 4K86A 3IE2A 3WJ1A 1ZZEA 2O2EA 1MB0A 4C7JA 3LUPA 2BIFA 5FWXA 1KYTA 2IYVA 4YAUA 4QASA 4KO1S 4CKZA 5AVVA 4ZI7F 2M1XA 1RLTA 4KLUA 2QJWA 1NOIA 3RG2A 4BMDA 2JZOA 1GUDA 3G9UA 1GTRA 3W6ZA 3WIVA 4S2UA 2L0XA 3V4OA 1E32A 2PKQP 2VJQA 4HK4A 4S3MA 2UZ1A 4K03A 4BVHA 4F9GA 3D1VA 1EDEA 5A5GA 2KEYA 3S5JA 4OJ6A 1DIBA 1G20E 1LS1A 1PTJC 2PZLA 3D5EA 3D4LA 4RFSB 3PX4A 2CRXA 1G6HA 2ZW9A 1RM6C 3EZ6A 1NVWQ 4IDFA 4B4DA 3QWBA 4P3OA 4WLFA 4BATA 4OJKA 4ZV7A 1V1JA 2EL9A 4A6PA 1D7AA 5AOBA 1UKZA 4GX0A 5HBRA 3X44A 5C34B 5ALIA 3LOUA 2WB1F 4F4YA 3KLMX 1Y4UA 2WPDD 3W34A 3VC7A 1JQDA 2AQIA 1AT1A 2DULA 4WOJA 3T7IA 1JIJA 4IYRA 5I8ZA 1SXJA 2QAGC 4LJRA 3MRTA 4J9UE 1U9LA 1NBMD 1WPGA 4LZWA 3W9UA 1XRJA 1Y3AA 2DFKB 2LKCA 4RTPA 3SLRA 2P3SA 1PHPA 4NCBA 3BS4A 3CF6R 1OFUA 4USAA 2V4QA 1X9GA 1W29A 3AY6A 3NBXX 4P7JA 3IUPA 2W6OA 2EDUA 1G21E 3M9NB 2Q1XA 4QOJA 4QGSA 3B8HA 3I2IA 3B82A 3VH3A 4XWWA 4RV5A 3DBIA 3RT7A 1TD1A 2DOKA 1CPYA 2ZSBA 5HUHA 4Q9DA 3MGAA 2NOAA 3U39A 1G7RA 1JYSA 2AQKA 3A14A 2QBYA 2FR0A 2CCJA 4DUZB 2OYSA 4F38A 4D3XA 5JYEA 3QUBA 2B92A 4HLQB 4O02B 5CDGA 4GBJA 3D3QA 4R9RA 1QX4A 3I8SA 3EPLA 2D1QA 2L69A 3QY0A 2W54A 3UNXA 4F46A 1T2AA 4FUTA 3N6VA 4LOJA 4AZTA 4V3CA 3TECE 3H9CA 1L3SA 1U8FO 1N5KA 2X8AA 3NHBA 5TMPA 2GM5A 2ZM5A 2IHKA 4IWXA 3V1LA 2JEIA 1D1TA 3EUAA 4IW3B 4EW6A 2JAQA 1KVSA 2OXIA 1ADYA 2EOAA 4PJ0U 1O95A 5KX5F 2AYZA 1L8XA 3GJ6A 1WQ1R 2KQUA 4XA5A 4HNAA 3CBQA 5TPZD 3MWEB 1PGQA 3ZW7A 5AD1A 1XTTA 5J8YA 4UHDA 2ID9A 3EZGA 4QDUA 4V0KA 3EA5A 4X45A 4ZVOA 4CIVA 2CVPA 4M87A 5K3FA 2BFAA 2BFEB 2YV1A 5B5EU 2D54A 3G7UA 3MQ2A 4UU0A 4ENQA 2HHTA 1NYQA 2BCJQ 1NKVA 3TNLA 2BUAA 3UJ9A 3U61B 3RK0A 2ID4A 5TGDA 4J0KA 1JHYA 4ZYLA 1NV8A 2C77A 1S3IA 1PLLA 4Q66C 2XOEA 1GQRA 1V4BA 4HXYA 1QE3A 2O9JA 4QNRA 3TZHA 2B82A 1P3JA 2BZ0A 4HAUA 1PT5A 2RAFA 1NZJA 2RK3A 4LDJA 1PK1B 4MZXA 2HEIA 4KXMA 4F06A 2YN4A 2CNLA 5EXPA 4X6LA 3THWB 4NMHA 3BJIC 3CGGA 3PK0A 4BQOA 3L7MA 1RXWA 4HFJA 3P26A 3G6WA 2XZLA 3I6ZA 3MJVA 1A72A 1B00A 1KYQA 1ODLA 4UB6U 4AG5A 2HX1A 1U4BA 2XQFA 1ZH6A 2RARA 5HK8A 4AZ3B 2DUJA 4I14A 2VYVD 4DMUB 4TMYA 2UUAB 2FZKA 3B48A 5DLGA 4RO0A 5TE9A 4RTOA 1HY3A 3E23A 2YICA 2GCOA 2QLFA 4BUGA 2JCXA 4PHFA 3VGPA 2LM1A 2LBPA 2TYSB 3A1WA 4WFIA 5T4FA 3JPPA 3BHMA 4AZSA 4UHKA 5DTEA 3G0IA 3B1VA 4JV1A 1I4OA 3MJ4A 1UIRA 3R74A 5KAPA 3UIEA 4C7XA 4P84A 3ZC3A 1KXZA 2GCOB 5DDYA 2VJMA 1V48A 2X4LA 4NV3A 4D9CA 3TOVA 3EVGA 4LC9A 2CHEA 5DGXA 2J87A 1SV4A 5FQOA 1AOXA 1MDFA 3DKIA 3P4YA 2HLPA 3EMVA 5JS1A 2Q0XA 3H1EA 4XDHA 3SS7X 4NDZA 2XUGA 2R1VA 3QHQA 3RVMA 1VB3A 2P91A 3O1JC 2ZSIA 4HZUA 1E96A 9ICSA 1RQPA 1ZJYA 1PK1A 5M5BA 2D5CA 1E6LA 1XTKA 1M7HA 4JV5B 2F77X 1HZZA 4MLZA 4EJ2A 1WV0A 2FWPA 3GH3A 5T3YA 7ICPA 5JCJA 1ZQEA 2AE1A 3HBLA 3UXMA 3NMUF 2QUZA 5AI8A 3KVRA 3Q6IA 3SMVA 1VCHA 4DQRA 1W35A 1IK6A 2I91A 5K1ZA 2BFEA 4FDUA 4M2YA 3D0OA 4L8YA 1MOQA 3T6KA 4WCFB 1B0AA 4CT0A 4OLAA 2ZS7A 4FYVA 3TNFA 1UKAA 3DT9A 1CKEA 3UPUA 4DLGA 1CY6A 1U2GA 4PPNA 4D8TA 1G3UA 1SBIA 1IJFA 3KPVA 4HNAB 3CNQS 3PR1A 4OP3A 4J4HA 3UAXA 4MPTA 1DP4A 1LV8A 1O57A 2Y4OA 2ZDGA 3TO5A 5JYBA 4RD0A 3WRYC 1FXWF 3G0CA 1MAAA 4P0PA 1B22A 6CHYA 3VKWA 3O9VA 3OT5A 3INYA 2FKAA 4DBLE 3FYSA 1Q19A 1N2CE 4F50A 1LFDB 4IRUB 4ECXA 4EI7A 2XYVA 3A0UA 2H5JA 4YT4A 5CFOA 1F3OA 2VATA 1YZUA 3H3JA 3K05A 4N7MA 4R6WA 3FNIA 1TQ4A 4OUKX 5DX8A 3TDKA 1D6JA 4CM3A 5K01A 2XKKA 2IU3A 2ORED 4JQZA 4KO3S 4ND7A 1MA3A 3IHTA 5IXYA 3L7IA 1C41A 4C7YA 4BV2A 4O0MA 2DPYA 3L93A 3DLPX 3W2EA 5EIXA 1RHKA 2E4XA 1OYVA 3UOGA 2R2AA 4I1UA 2H18A 4HHEA 3MYYA 2ZJZA 4KLRA 3AKYA 1ZQWA 2PWBA 3AK4A 3WLAA 4RQTA 2PQ2A 2JLCA 1CR2A 4IIJF 3M6LA 3O7MA 1UT8A 1M2JA 1GRRA 4DLBA 3LC1O 2DFDA 5CM8B 1KI7A 1J49A 1OD6A 1BRMA 3PUHA 4JKIA 4F8RA 2JHCA 4E5DA 3ZJ5A 2H2GA 1L6NA 1GQOA 4K4HA 2GEFA 1RM5A 2OUKA 1FMCA 1FTNA 2WF7A 1R8JA 4JJAA 4BUCA 4DSTA 1LB1B 2H7YA 1YWGO 1TK3A 1S2GA 3W5IA 3P0EA 1ZISA 1F1BA 3ICWA 2HMUA 1IEVA 1LRKA 3DVSX 3O0TA 2FMXA 3O4VA 4GMDA 4JZKA 4K9LA 4BMYA 1DBSA 2OO5C 1VI6A 2ZSEA 4B3SB 1XNJA 4BQRA 5BSKA 1NZDA 4YR2A 1YV9A 4NEQA 4MW6A 1Z1BA 5KQGA 3FAZA 3IKJA 4JLWA 1P1IA 5FOXA 5JCOA 3WB2A 5D3ZA 2CYAA 5ITSA 2ZBVA 2G06A 3SYZA 3T4PA 1CY8A 4L0QA 1GITA 4Q3KA 4Q3OA 1XL0A 5AKEA 2YXBA 4EAQA 2UZ1B 4BJ6A 1F2TA 3VNQA 2DFTA 1MJGA 1CUCA 2JAOA 4EBEA 4QFDA 4YWHA 2B78A 3SF0A 4YAIA 2IPLA 1J7KA 2JGEA 4FS1A 3HV0A 4LJXA 3E9EA 5DHRA 4PPYA 5F2KA 1JJIA 5I7SA 3F5FA 2YWXA 2VJ4A 1NVKA 3V48A 5LNK1 2FUG1 1DQYA 2XQJA 4HX9A 3FFWA 3W8DA 5JD6A 2C42A 3CWQA 2IPNA 2FPLA 1J70A 2R8EA 1SVMA 3QKRA 2NRZA 1VCOA 3FI0A 2W8BB 3OIFA 1TI7A 1YR6A 2QN7A 3KV3O 1Z0SA 3BWCA 4L5CA 3KPUA 1Z4NA 4IDGA 3C6YA 1JT9A 4QVIA 4KRXA 1SHJA 1VJGA 1K86A 1E8MA 1MABB 1PZHA 4Q37A 2R6R1 4YP1A 3ZHUA 2GA8A 3ZLUA 2XB6A 2Z83A 5LYYA 3ZY2A 1HNNA 3ASUA 4TSKA 5AT1A 5ALQA 1E2EA 4BWFB 5AVOA 2QU7A 4C4YA 5JTTA 4IDPA 2XOXA 5IJAA 2H3VA 3QVLA 1GTZA 4F7WA 3H9JA 1XN4A 2XMSA 4FDLA 1FRFS 3EGWA 1UJ6A 4YT8A 4LJAA 3M6XA 2R6HA 3GFVA 4R64A 5EINA 1ZQBA 1A50B 4JB0A 1W9HA 4F1WA 1IM5A 3G9ZA 1K7XB 3KOWA 3MDAA 5ITZB 2CV1A 4F4DA 5EEHA 3Q3HA 2CV2A 3EPHA 4GKJB 1AQLA 3LYUA 1C3LA 4RGVA 1NMXA 4D82A 1Y5IA 3MLBA 2BC9A 4FE4A 4IJQA 3VH4A 3IQIX 3GJ0A 2G71A 4UUNA 4TKZA 4CDNA 1PBTA 5L1MA 4XASA 3MVEA 1JX6A 1FTGA 3FWHA 3LO8A 3JWGA 4WBNA 2VHXA 3TQHA 2I99A 1LPOA 3CT6A 2JH8A 2HTFA 1K89A 3GIMA 3IXQA 4XUGB 1E9RA 3ERCA 2W4MA 1IVSA 2FP4B 2HDOA 4Y2YA 3BSWA 3QLVC 1CT9A 3MTAA 1CY7A 3KELA 5EUMA 3QE4A 4U2FA 3U4GA 3BS5B 5FL3A 4D79A 5AUPB 2OZLB 3FTFA 1O08A 1D2CA 3OSZA 2R0QC 1NJ2A 3GVCA 3NOOA 2VRCA 3UWOA 2XZOA 2CXNA 2VN8A 1C9EA 4RAOA 1VG1A 2G0AA 1I2BA 3KJZA 3LLSA 4RXUA 3VISA 1PGOA 1RYRA 3LOQA 1N78A 1NMEA 3C2MA 5K0NA 5B2EA 1NKEA 4CN9A 1ZH8A 1XF1A 4NABA 5CGZA 4MQEA 421PA 4TROA 2JLAA 3HVIA 2J6TA 1K75A 3CRZA 4X1OA 5IK2A 4X1YA 1R6XA 4O1MA 4MUFA 2N1MA 2YWDA 4QDXA 4ETNA 5HDBB 2WDPA 4N5DA 1Z5ZA 2RGNC 3V4RA 1RI1A 1Y5NA 3E5RA 3IC5A 1DAOA 1ZK4A 4FMCF 1L4GA 1SHLA 3H8JA 5E95A 4CQLA 3CF2A 3Q3GE 1GEGA 1ZJZA 4NBLA 5J2TF 4DQKA 3X2EA 1UZLA 4I5EA 4O5CA 2PS9A 4GQAA 5DM60 5EJ4A 2DE0X 3HKZC 2O5RA 1JEAA 3OCXA 4C1BA 1W19A 3O38A 4JC8A 4MCJA 4WECA 5C8VA 5KFUA 1ZQ9A 2OSBA 3H5IA 5M3BA 3FIUA 2XCUA 2IXGA 2CT8A 1HEIA 4JLAA 3BMCA 2ZRMA 4KAXA 1Y9DA 1FX1A 4JQSA 4QKQA 3W4KA 5DN6A 4AIIA 1SBYA 4A6EA 2G8NA 3HU2A 1ZD9A 2HHQA 2D6FA 1KEKA 3JQ9A 1TYCA 4OXRA 1MJ5A 4ZWNA 2EKZA 4JA2A 2AKEA 1BE8A 1NXQA 1JB1A 2ISOA 1NL3A 4KEAA 4BWGA 1XCOA 2C4VA 5DSXA 2X2OA 3AR5A 3K75D 3AM3A 5ILGA 4YRMA 1VTKA 1W96A 1Y82A 3DEHA 3UAVA 3UFBA 1XNRB 3JD2A 1AB5A 3D8BA 5DOVA 5AI4A 1X87A 2VSXA 4YO8A 3DWEX 1N60A 4DRXB 2H3QA 5K3EA 3WKEA 1Q74A 3JWIA 2MINA 4IEIA 3B7GA 2C92A 3LFHA 2XRMA 1Y7PA 4L76A 5KTMA 3OZVA 3ZE2B 3H0LB 2GCIA 5FAKA 3PYLA 1W6UA 3EDMA 4OO3A 4MWDA 2PSHA 3GPCA 4A8JA 2I4LA 3V7YA 2FETA 4M37A 4XWTA 1US8A 1U5CA 2YJTD 1XNGA 2C83A 1TW3A 3FCUB 1I4TD 3MJDA 3Q8SB 4GWKA 4J9KA 3DZKA 3PUXA 4HLDA 4LJ8A 4PR3A 4R1UA 4U7FA 5BRAA 3HWTA 2ANBA 3H5NA 4I6EA 4PXYA 3ZLJA 2PTHA 4ZK6A 5DYNA 2JLYA 4G8CA 1DWUA 4FB4A 1KO5A 4QZGA 2Y6VA 3ND8A 2ZR9A 5BWCA 3GFFA 5D00A 3K6KA 2G4CA 4LSGA 2DB3A 2QD1A 4P3PA 3E7PA 5BNTA 4ODIA 2ID8A 1L1QA 4GGMX 3L0PA 1CUHA 1KDZA 2R6ZA 3SV4A 1NPTO 3FUVA 3TE7A 1YDMA 3UPDA 4NDAA 4X1IA 4O63O 1VBKA 1O4VA 3WFZA 4DN6A 1F4LA 3EXFA 3G5TA 3GU3A 1KOFA 4I1YA 4O4JB 3I72A 2UVRA 2HV8A 3EMDA 3TI7A 1NRXA 3FOBA 4ZPJA 3DD1A 2WA2A 2C4KA 1JJVA 1T5IA 1TQ6A 3DYVA 1JHDA 5KYKA 1FFGA 3Q9LA 1KMCA 2D7JA 4KGVA 2FMSA 1SUIA 2FSUA 2D0IA 4QYIA 1BN6A 3OZUA 3UA4A 4WJZA 4G56A 4KFSA 2DMRA 3VHQA 2KSQA 4DEYA 4GLJA 5L6LB 2QTGA 3MFQA 1J8MF 3R9IA 2C2OA 2I4RA 5EL0A 4FDTA 4Z49A 1K2WA 2Z0MA 3F9RA 4QBGB 3NHSA 3A1FA 2VJKA 3C7CB 4K9OA 1TFUA 4P58A 4M9LA 1Y5MA 2YNMC 4JJEA 1A0OA 4TLAA 1I3LA 1MC5A 1YC2A 4K6OA 4DMGA 4EHKA 4WBNF 3KOUA 4IHJA 2FVXA 2PX8A 1MJNA 1P2SA 2BDEA 4LDPA 3TRDA 3WDKA 2NP7A 3KTAA 3H1BA 3NHWA 3ONDA 1TAQA 1UC5B 3GEMA 4Q34A 8ICUA 2C94A 4K5QA 3GDFA 3LVFO 2QUAA 4BHTA 1PL6A 1XZNA 1W0JA 3GXBA 4MQ5A 4ZRDA 5JLAA 1DEAA 4B9MA 1VL0A 3SSNA 1Z19A 5EZSA 3KEGA 1A5BB 3AHCA 3HVHA 3N7TA 4KE9A 3RU9A 1E7RA 2C5SA 4QODA 4NE7A 4YRLA 3ISCA 2W6JD 4ZARA 4B87A 1FVOA 4JEUA 4X7MA 5KT2A 2Q3HA 4YBZA 4FCVA 2X0FA 4NFHA 4EK9A 4GDFA 5F51A 4ZQEA 1MN6A 1X7XB 4QW9A 3STXA 3QFTA 1QB8A 4MMZB 1N2SA 1CRWG 2GZRA 3OQHA 2ZR7A 3SC4A 4D3YA 4DQDA 5B36A 1EFAA 1Z22A 1BXRB 3DFMA 1IXRA 2XZTA 4DS5A 5EE9A 1Z47A 3KYCA 4CWAA 5I4BA 5JR3A 1JEQB 1KQOA 2A67A 3U5ZB 3LQRA 2BTQB 1V5EA 2AR9A 3E9NA 1UMDB 4FBUA 2PCJA 1PR6A 1WU8A 1ZA1A 5ICCA 3HE3A 1ULSA 4A8HA 3LXMA 2G70A 3EXIA 3FPEA 1G5HA 1OX6A 3OZXA 3OM0A 4OQZA 3JYPA 3IQFA 4N3CA 2R8OA 3JYHA 3CGWA 3IMCA 4CHTA 3OQOA 5HJ7A 4EPTA 2ZRHA 3FM9A 3MM4A 4BQSA 2QVZX 4PW0A 2FW6A 4AY5A 3DMTC 1ADJA 3FLMA 3KPJA 4XVQA 2Z2XA 3OJXA 4LHWA 3RVOA 5JEEA 2AWOA 1NP3A 4J8PA 1E1YA 2ZJ7A 3U4HA 2RJ3A 3O8RA 3UXPA 2VDLB 3UJCA 3A2LA 4LMPA 1FSFA 4IO0A 4OG2A 1OYOA 5L1IA 5FBZA 4PSCA 3U1VA 4N0DA 2WT8A 3PC6A 3WWPA 4EPYA 3ISBA 3PRKE 1GRNA 3UGJA 1SC3A 2G25A 2O07A 1QORA 4RK1A 5H8WA 3RS8A 2BZSA 1Z7GA 3BA1A 2V54A 1UXHA 1XKTA 4DYDA 5ALNA 3HZOA 3F6SA 2XQIA 3ROFA 3BF7A 1B8UA 4YRJA 3ILSA 4R81A 2D8CA 5FHRA 4ESVA 3JQRA 4V0NA 3D6NB 5BWLA 3HCBA 1OASA 1QIMA 2JHAA 4MCHA 1ZQKA 1IHPA 5KNBH 1L1RA 3KSMA 5KAMA 4LJKA 4PO1A 1TKAA 3KXIA 1OIXA 3K9QO 3LVQE 4Z86A 3AEUB 1ATZA 4IDOA 1INLA 4PCLA 4DBZA 1POXA 4MWOA 3F2CA 1QIDA 1QZUA 5IH3A 5IHXA 2CLFB 2FLKA 3MB5A 3V4LA 4FCWA 3W5CA 3UVEA 3NBKA 2EH9A 1KHTA 1M0TA 3A37A 3N74A 4MA5A 4YMTA 3IAS6 3D4OA 1ABFA 3OOSA 1ZGCA 4LHZA 3J81A 1T6ZA 1P6UA 2A0XA 4BP8A 4DFDA 3C3BA 1FTWA 1KS2A 3I9V1 4IFEA 4RADA 3S5UA 1U0GA 2UZIR 4CQNA 4KVFA 1SKYE 3AVXA 3WL7A 2VAMA 3AR4A 4U39A 1R10A 2NVBA 1ZD8A 1IAQA 3DFZA 4HXGA 3K8YA 4MUJA 4UE3S 4HB2A 1ZSYA 2EARA 1X0XA 3ADDA 5DLFA 1BMQA 1AZTA 4AWBA 2BGKA 5JS8A 3A0HU 3DZHA 3WC4A 2D62A 2NLOA 3T52A 4E70A 2BQ3A 1HYEA 1LI5A 2VQDA 2RKBA 2IXAA 1U2DC 2WWXA 3E3MA 4P34A 3G8CA 1WE2A 2GEUA 3ETLA 3T41A 4OAOA 1Z9BA 4L0MA 3EF0A 3IT0A 4PZ0A 1XCLA 1DXQA 3OE4A 4BO3A 1GSOA 3R6WA 2HCFA 1GT91 2FFBA 4OOFA 5IKPA 2KD1A 1G16A 3KV1A 1OLXB 3DVLA 1XCJA 3IHKA 1ITZA 4R9VA 3N8DA 5DZSA 1BWPA 8ICMA 5JSZA 3WWCA 4Z7OB 4QIWF 1T0HB 4MIEA 4PC1A 3FSJX 1FUKA 2JEYA 2PL5A 4HAOA 1JF8A 3ZDEA 1QHYA 1ZM9A 3DXYA 4ICIA 4GVLA 1PFWA 4WVLA 4YR9A 6ABPA 5BMVA 3VR3D 1U0TA 1ZUD1 3OCVA 4ZT4A 3VSAA 4D56A 3ZLTA 2R66A 3U3JA 2PBFA 1YBMA 1XRMA 5JSHA 5HHIA 5B6JA 4EMTA 1Z0AA 4WD3A 4UHBA 2C58A 1DPFA 1Y3IA 4MLCA 3DHNA 4K46A 2DBRA 1A9SA 2JLQA 1WTAA 2IZ7A 2VFAA 3H2HA 3OFND 4I99A 1W36C 1P8JA 1PFVA 3L82B 1ZBDA 1ZHHA 3C6ZA 1YE5A 3BWBA 3GEIA 4XLZA 5BMVF 3RV4A 3FUXA 4JT2A 4OGWA 1BRTA 1DEHA 4UATA 5DHFA 4CL0A 2LBOA 1H1DA 1K7CA 3T38A 3V80A 4KN7A 1KORA 1EM8B 4R2IA 2ZUWA 1SVNA 2VDJA 5DHQA 4BZPA 1IUNA 3TKLA 5K8LA 2OV1A 5A9TA 2KVCA 1HDZA 3HV2A 1E9AA 1TMYA 5BSFA 1GNLA 1UXIA 4DNPA 4PG7A 3BJMA 5DQHA 3REFA 4K88A 4BRUA 3K73O 1T0JB 1RU3A 4GEKA 4K9SA 2BCVA 3CYMA 2X3YA 4MTCA 1M0WA 1WZUA 5AW1A 1O9GA 1NM5C 1NJZA 2R96A 3EVDA 4PLPA 3VDRA 3T8YA 1L3IA 4UUMA 4AWXA 1U0HC 3AYZB 5REQB 5LOVF 2OBFA 3O82A 4BNGA 4DCVA 4YR7A 2RAUA 5KL1B 1EJ2A 2DWUA 2WNSA 3ZHYA 5KMGA 1GA4A 1CUUA 3GZFA 3H8MA 1JAZA 3A06A 4LYEA 3RTEA 3WISA 4QT4A 2HT1A 4OEHA 4GR9A 3CQ9A 1O6CA 1U3GA 4CFYA 4JU9A 2Q3LA 3D3JA 3C1AA 5IT5A 1EP3B 3C97A 1MO2A 5KHOC 4U7CA 1NNI1 2C2EA 4R2MA 5HIIA 1RLJA 2QAJA 2QP3A 2UYOA 2H3FA 2Q3EA 3WGTA 2VA2A 8OHMA 4G9GA 4BQNA 2A92A 3BWVA 2OZEA 3PBKA 4QOEA 3ZZNA 1XHEA 3FUTA 1E0AA 3KHTA 4N12A 3FW1A 4LVUA 2I54A 1NYLA 5KJ1A 4NM2A 2F9FA 4HDSB 5BSMA 4E5SA 1M10A 3WRXC 3UQYS 2OH2A 1VECA 3RAGA 1DIHA 3UB2A 3K9HA 3BQNB 1W581 5AHXA 4TX1A 3KOOA 2GKOA 5JXHA 1JXQA 5LP6A 1APBA 1J8YF 4YPVA 4MYUA 3MT9A 5IF9A 4B9UA 3L0ZA 3QM1A 4HRYA 5AW3A 4U0KA 5JPCA 3ZTTA 4QUEA 1TU4A 4ZZ1A 1CERA 3W1VA 1UEXC 2HO4A 1ZQVA 3TACB 3REQB 1J99A 1HDOA 4B80A 5CBPB 2OCPA 1D03A 2OQ2A 2XNDD 3M7IA 4A7PA 1BMFA 2YW2A 4MAMA 2ILVA 1V5GA 5FUQA 4XD7D 4FFNA 3EGCA 4IDBA 4OHXA 1JEDA 5FULA 3KE9A 5KFSA 4Q3DA 5IAJA 4J9NA 1OWMA 5D01A 3T9AA 1KTIA 2VSQA 1IPEA 1RAFA 2SHKA 5B12A 2ZJ2A 4QYXA 1P17A 1AUXA 2OCAA 2WJJA 1Z6YA 5AKLA 3BJZA 3DA8A 4ARVA 3FLAA 2TECE 3C5HA 1BX1A 2WDZA 1CRXA 5FR1A 4FW8A 1QVWA 3SI8A 1Y80A 3GA7A 2GWHA 2YHSA 2ATIA 3KLNA 5DWDA 5LBUA 4UMDA 1JXOA 5AI9A 2IYPA 2HCTA 5KNCH 3E58A 4RHCA 2AXTU 3TANA 1SU4A 4D9HA 1CZHA 2FSHA 1CVLA 4MFFA 2YHAA 3OEHA 4IJ5A 3VOAA 3RKSA 3E5HA 1TC2A 5LP1A 1G6KA 1U99A 4YD1A 4G67A 3LPMA 5K0SA 2JJQA 5KYYA 3DDZX 3CUKA 3QTBA 1KR2A 1VA4A 3CUTA 1A8UA 1UFQA 3DO8A 1GFZA 4ER5A 4JBLA 4WJKB 5FLKA 5H68A 3DV0A 2V5AA 3AIMA 3OT1B 4CVNA 3W2IA 4F1KA 3MTEA 4RQ6A 4B76A 1U8AA 4JB8A 1PQWA 1ZNZA 1ZOOA 3EFOB 4MR7A 2Q9UA 3FMFA 1USUA 3VI4B 4O0IA 1Y3HA 3AWDA 1OFTA 4U63A 1SCNE 1YBFA 4B82A 1HZJA 3CF4A 5CDTA 2O52A 2QJRA 3LHKA 2K4PA 1Y8QA 1OI3A 1OV4A 2KE5A 3RB8A 5C7YA 4AKGA 3FPLA 2O2YA 3G2JA 1YT3A 1VP9A 3BIJA 1ESNA 2OILA 3GDHA 3NV9A 3QSYA 4UB3A 7ICVA 1BDBA 1MAWA 2FB9A 3LQ1A 4PSKA 5L4NA 3K6SA 3THXB 1BJTA 1SVSA 1PNOA 4O9MA 4O3RA 1ZU4A 2DAPA 4WNYA 5FTJA 1G5FA 5K2MA 4P2BA 2GKGA 3QBEA 3UWPA 1SXQA 5NLLA 1SQSA 2RFLA 2I9GA 4KIFA 3NHKA 2GTHA 3SBEA 8ICYA 4ZEXA 4RHEA 2ZUCA 2AG6A 4H3HB 1ZRMA 4OF4A 3R7LA 4US9A 2Q0QA 3C3WA 5L1JA 4MB0A 1C4OA 4ZTBA 1WXEA 3RWOA 1OZAA 4FYXA 1D6NA 3KT0A 4X20B 2NT3A 2WTXA 4KYIB 3GA0A 1E3WA 3MWKA 3V8VA 3Q0IA 2DKFA 8ICQA 4Q6WA 4M98A 3UHFA 1W0KD 3AR2A 3LHSA 5IDWA 2IZ0A 5HR6A 2Q5IA 1HK7A 2QTHA 3HABA 3WLFA 1COOA 1N5DA 1WKBA 2AN5A 1KSJA 4N6OA 3W77A 1R18A 2YL2A 3I9OA 5B3AA 3FSEA 3TUZC 5B53A 3CW2A 8ICIA 1XCBA 2CJWB 4Z4GA 4PLZA 3TMKA 3VR0A 3FMIA 1VE6A 1U2TA 1YQEA 3EDRA 2O5VA 3PJFA 2EF1A 2L5YA 5HBGA 1M5UA 1P5JA 2AV6A 1QQ6A 5KFZA 4EG1A 3TLZA 4DBLC 3CE9A 2RI6A 3L6RA 5EIHA 4J9SA 2BFBA 5CBPA 2KHVA 2A3NA 1TECE 2REXB 2WMOB 5DW3A 5A4JA 5HTKA 3PENA 2PE5A 3L6EA 1P7WA 1T13A 2IZ6A 2IU0A 1MW8X 3PUJA 4M6WA 4LRXA 3HFJA 4ZALA 3UMJA 4HLUA 4A2QA 5A5DA 4AFNA 1XELA 2EQAA 3GGOA 4Y9TA 4MVJH 2O3TA 4MHSA 3SQWA 1ESCA 5BN5A 2JRLA 2GCEA 4J0FA 2C2ZA 2PRJA 2VF7A 4QBIA 1NZFA 4YJFA 3VR5H 5G0UA 2Y77A 1N75A 2XGPA 2WOOA 4EB0A 4ZU1X 4ZO7A 3ST7A 2BMWA 1WBDA 3OFKA 3HX0A 4PZDA 2QYOA 4CIAA 3J80A 3HWX1 3LNTA 4YASA 3UBMA 4IRMA 3RR2A 5J2JA 2E6UX 5AK0A 4PLGA 5SZIA 3CCFA 2I6XA 2EQ5A 1K4KA 4HC4A 1EUQA 2RGRA 1K0UA 3WIOA 3P94A 3FNEA 2B1QA 5HKAA 2V96A 3VSBA 5IFKA 4F92B 1S1MA 4HLNA 3RBDA 3C3MA 2WR8A 1QFJA 4BJ5A 3RAQA 2AMVA 2OYCA 4K9NA 13PKA 5B5SA 3UMCA 3M6VA 4ELVA 1U28C 2PFKA 4HFRA 1RE1A 5B3JA 2C2MA 4HRVA 9ICJA 3C24A 5F5NA 5TIIA 3NRJA 3IBCA 2NT4A 4Z0PA 3EVBA 3DOOA 4UPVA 2AZXA 1G66A 1TMKA 3KZKA 5LZ2A 5TX7A 3VC1A 3V7JA 4K6HA 4IIYA 4YAFA 5KYVA 3A2NA 2H4ZA 4PGGA 2JI9A 2P9TA 1JIXA 1XSNA 1SK8A 2V8BA 3TG8A 4RPHA 1ZOLA 4BZZA 2FJ0A 1ICEA 4BNMA 3RI3A 2X0KA 3CUEF 5EKTA 2AFVA 2BM8A 4KLZA 8ICNA 5BYAA 2PUWA 2V9PA 3K9NA 3LF2A 2II6A 5CW1A 5B64A 3MRXA 4MRRA 1YS7A 4FEYA 3C3CA 3P97A 2MTBA 2VAWA 3LIIA 3LOPA 4NDNE 3EG5A 2PY6A 2HADA 4RUAA 1W5SA 2O3RA 2BMJA 2R8YA 1A6SA 5EQTA 1YGPA 4NLLA 4KXXA 4CV1A 1NVVR 2C5AA 4XUCA 1YOBA 5L8VA 2XPCA 4DL7A 4AURA 4DJDC 1DQNA 1CJUC 2FR8A 4UREA 3U3MA 4MWEA 5KB3A 3ICVA 3G13A 3Q3EA 3VH1A 5U4QA 3NBZC 4IR9A 3A4IA 1MNQA 3ENZA 5JUWA 5J2IA 2NSDA 2F67A 2NO6A 4D9FA 1NI5A 2XUAA 1UZMA 3AJDA 4PG4A 4WK4B 1H2BA 4JL6A 3MFYA 4RE6A 3H9UA 3F8SA 1IQPA 4D3ZA 1M72A 3HEBA 4M7PA 5J2TB 3Q12A 5KTQA 4IRXA 5C5EA 5AHOA 4DWJA 3FPCA 2PGJA 3LC7O 5L3VA 5M29A 5BORA 3T7DA 4B3DA 2VTBA 4F4IA 4RORA 1X8KA 1S10A 2I1WA 3PF8A 4WOCA 4E5KA 1L7QA 1P1BA 1IY8A 2V7UA 3R40A 4M54A 4YJGA 3QVSA 2QT1A 4FEAA 3NBUA 3SLGA 4L50A 3KQOA 3JQ9C 4TKUB 1WW3A 3RYCA 1A4UA 3QPAA 5AHRA 1B73A 2HQSA 4DSUA 5DTJA 1SZJG 3KHLA 3DM9B 3SVZA 2H31A 3RREA 2VCHA 2WJ6A 2W9CB 4B83A 1P39A 3H9EO 5CDSA 1AMNA 2VJLA 3STWA 2JZNA 5E2BA 5FV7A 4YFKA 2V45A 2FWBA 4KXNA 1K68A 3RC7A 4GXTA 4LE1A 1U31A 2MRLA 1T9GR 1OLSA 2ECKA 4RDHA 4N5LA 4I4TA 3AXSA 2DH5A 1Z36A 4YO7A 4QZBA 2PFGA 5LU8A 1S01A 1L5WA 4YLEA 5F9NA 1A8QA 3PSIA 1C20A 4Q19A 5CFNA 4YD2A 1FU8A 5G4KA 4EQ6B 3IEIA 5I7WA 2Q9AA 4M9HA 3PQ4A 3HJTA 3WQBA 5EN4A 3I1JA 5F7XA 4Y2JA 4IV8A 3T3FA 2B34A 3DLIA 1BGWA 4I55F 4P33A 3PZBA 3AH8A 3H6KA 2ETVA 3KKEA 3PPWA 4EF4A 2C7VA 2P2GA 1ZG3A 2VP6A 3OBIA 4YPOA 2QTNA 3KQKA 2ZTSA 4TYMA 1CUGA 4M1MA 3OWXA 3SKVA 3DZJA 1V95A 1R8QA 3H6GA 1FSSA 3QQ5A 4TTPA 2ZREA 4TTQA 4C0WA 2J6BA 4NCKA 2WE7A 4WESB 1HE1C 5DB7A 2HSDA 2P3OA 2PRKA 2BLNA 2FSIA 2PX0A 2R60A 1DEXA 1RIIA 4MKFA 1RIFA 3SQXA 1ZN2A 5LUBA 2QG6A 5EWEA 2PZJA 1CCWA 3ESDA 1YRQA 3RJ9A 4UHCA 5A9SA 1U1DA 2XJ4A 4U7JA 4QW8A 2GZ3A 1ZI8A 2ZRPA 3OHPA 2G09A 4PYIA 1WYGA 4I3FA 4N9WA 4WA8A 4JQCA 3U44B 1VLBA 1GPLA 1RQLA 1CQIA 1X3LA 1Z88A 3A4NA 2FEPA 2OCYC 3OM1A 4RSGA 2B99A 4YA6A 3PVSA 4OHCA 3VJMA 3DDWA 2W6MA 1AK2A 3OIUA 4QYWA 3ZGOA 1Z4QA 4NYIQ 2BPFA 1IUOA 1I2AA 1JQJC 4I9HA 2X9NA 4K9DA 2YZ7A 3ETCA 1YONA 1NBAA 2E8OA 4TV8B 3TLKA 1W4RA 1E6EA 5AVWA 3W5DA 3HJGA 3CNNA 3NTVA 2DKZA 1FJ2A 3WMWA 5KYUA 4JLSA 1CZUA 2ZJ0A 4JT8A 1F20A 1KL7A 1KK0A 1M2FA 2JDIA 2ZIUA 2RGWA 4R5HA 4C4ZA 5JI2E 3ICQB 1PFYA 4LYHA 2JA2A 4YCNA 2WLTA 3LCCA 2XKJE 4I2HA 3ETGA 1KJYA 2J4CA 3HO8A 2IODA 4JK1A 3PE6A 4KQEA 1QOQB 2M32A 3LLCA 2XSZD 4M1WA 3L8ZA 4WN9B 1BVRA 1M8GA 1V2HE 2XB8A 3EHEA 2O2JA 4PFSA 4WZZA 3S4YA 4BUJA 4FZ3A 3MOGA 1TA4A 4K28A 1YE8A 1T2NA 1O6BA 4XCQA 1I3KA 4GXNA 2P68A 3KQUA 4MQ4A 3UAYA 1GNSA 3RJHA 1IG3A 1P4AA 1P4JA 4TYYA 1D2NA 2ZBDA 4AP5A 4HQRA 4OFXA 4MS1B 2JBAB 3B1XA 4YAEA 2QSZA 4O3PA 4QD3A 5FO0A 4FZLA 1TPYA 4HCJA 4MI3A 4D8XA 4FINA 4ISBA 1XWWA 3FCXA 2JLRA 3QF4A 4LYJA 1EMDA 3MZ0A 4QZDA 4GRAA 1XT6A 4BDTA 4IWNA 4GL2A 2D5AA 3O94A 4S0XA 5HYVA 3IAM6 3ZIAA 5JASA 3IQGX 4MARA 3LE8A 2G67A 2OM2A 3R5XA 3MXTA 8AT1A 1S7CA 3WU2U 3G3EA 3QJ5A 3H04A 4ITRC 3AKDA 1VHLA 5EMLA 1GL6A 4EI8A 4NSNA 2F3QA 4I1PA 1HEUA 3ZU6A 1QF6A 3GCXA 4L6IA 1TYAE 5E6SA 3JQBC 2PQ6A 2DKNA 1W94A 5KFVA 4IMIB 4BKOA 2ZVQX 4B3GA 4YHBA 4AJIA 1AHPA 1USWA 1KS9A 2A9FA 4CCAA 3RT1A 1R3UA 4DV3B 3W5SA 4WXPA 3UQ0A 2WB2A 2H7XA 2C29D 1GPH1 2WD8A 4X8LA 3E8SA 3TW8B 2C8JA 1OH7A 2BJWA 4L4RA 5DEOA 3WLKX 3KJEA 5KOJA 4J0GA 4A0QA 3NI2A 3NOXA 2WMNB 3T7RA 1XKXA 3SD7A 1ODCA 2IDJA 3DXZA 3IIMA 4S1VA 5ELXA 3SHFA 5KKNB 2OM6A 3MUNA 5CB0A 5HDQA 4B7ZA 4A8JC 4OVKA 5IBQA 3LBFA 2QX4A 2VK1A 3EXG2 3SXJA 3TR0A 4BCDA 3LMKA 2A9OA 3PITA 2WY2D 2HRRA 2PT7A 1PTKA 1JDSA 1S0UA 1E79A 2HQ1A 3MXOA 3RVLA 3QXGA 5IG2A 3L3FX 2XVTA 3N4MB 5BYBA 1AKMA 1JLHA 3TRJA 1SA0B 1B4DA 2ZYRA 4IV0A 2OQRA 2VLBA 1L5VA 4K0RA 1CNFA 2HHAA 3T95A 4DREA 4DLNA 2YV5A 1XEWY 3OPYA 2XUJA 1QHFA 2VL7A 4I0WB 1U5AA 4UXIA 2FZWA 4YJ2B 5UKDA 3UJ8A 3ZW8A 5LZ8A 5C46F 1WETA 5LXTA 1ZD2P 1CUSA 2XT0A 1IONA 1D0VA 4U3JA 3THYB 2XYGA 5JXWA 3LCJA 3UN1A 1KR5A 3MILA 3PC8C 1XSEA 3SNKA 4B74A 3BWDD 3GRRA 4F8JA 4ENPA 3OI7A 2QGZA 2CWWA 4PBSA 2E5FA 4Y0VA 4IZ6A 3WLOA 5HZMA 5F3WB 5JY6A 4XLTA 5KYXA 4XTRA 5GWXA 4LYYA 2K6GA 3K0CC 2EGHA 2HEGA 2IF0A 2DWOA 2EF0A 1GSIA 1XMVA 3MN1A 3WGJA 4F56A 3GG9A 1B15A 5TPZA 3T0GA 1ISJA 4JC5A 3VOTA 4DG9A 5I9MA 4E03A 1XTPA 4D2IA 1IAVA 3JARA 2VSYA 3M2TA 2H3IA 2PN1A 3LI2A 1TZCA 4HUJA 5FBRB 2ZIEA 3C6QA 2CLKB 1N5OX 3HA3A 1QGDA 2AC7A 1EG2A 5E8JA 2IRWA 1W8IA 4D57A 1NUUA 3PW4A 1DGJA 2ENWA 1OHHA 2PZGA 2R8GA 1BHSA 1DMRA 1WDLA 2FZEA 1IPHA 2H5IA 3VU0A 3ZH9B 2JATA 2W2XA 4ZDIA 1HLGA 2PSJA 4M88A 1WG8A 1T9AA 2B8NA 3NDPA 4J1NA 3T9EA 3TH5A 2GDZA 1YB7A 5EKXA 1RYZA 4AN4A 3ASYA 2LI6A 1C5KA 1SO8A 3MHPA 2X1MA 5FF9A 2PSFA 2HRZA 3RHTA 1N8KA 3TCXB 3WFIA 4BMZA 2YUTA 3QYPA 2EFDB 3OETA 4EYQA 5HZHA 1O6GA 3HWRA 3KQQA 3TBHA 2PPVA 2CZGA 1R0SA 1UZAA 2AIRA 2BFMA 1RRPA 2NADA 3BCRA 4MUXA 1MAVA 2LR0A 3ETNA 2Q41A 3OC6A 4DW8A 2IGBA 3FGZA 2WWIA 1UFKA 1KMIY 5HMLA 2QVLA 2QLMA 1D0IA 1ORIA 2Q3MA 3NG1A 4P32A 3O0FA 4NU8X 1DX6A 1Q15A 4G85A 2WP0A 3PRJA 3TI0A 1E4EB 2B4YA 2BFFB 2VDKB 3MCAA 4MJ3A 3L1VA 4E07A 2JCYA 4RDXA 4DS3A 1T8UA 3BHJA 1Z00A 1A2QA 1X2EA 3HY6A 2EYQA 3T3PB 5CH8A 2CFCA 2K89A 1G8MA 4JGBA 3JALB 2H1OA 2EQBA 3JQ8A 2GR9A 3CHYA 4QQFA 4R83A 3ZDQA 1MQAA 1K3FA 4E1AA 1B26A 4QECA 4BO6A 4QRIA 4MKIA 4CKWA 1GN8A 1LI7A 4IRKA 2XCOA 4Y2TA 1YKGA 3IDZA 1OUMA 4M1QA 4BVAA 4XWOA 3ETJA 1XR3A 3PL5A 3K4HA 4ER3A 5HCIA 1MTOA 3VTZA 4O2AA 4DIFA 3TLYA 2ZI7A 5LQJA 2P2DA 3OUTA 1VLQA 1XU4A 3BSFA 2CBZA 1XDWA 4L5AA 2AR0A 5LOVB 1H6BA 5BOMA 2A1UA 3CX6A 4E3WA 2V0GA 3V32A 3UPQA 3H4DA 3JD1A 3A9RA 4MPPA 2D5LA 4OK3A 1X9SA 8LDHA 2C4NA 4NBKA 4X24A 4HNTA 2R8RA 3CNEA 3PLAE 1XQVA 1Q11A 3ON5A 4REOA 3L4EA 4RV9A 5HGXA 3GPDG 3HDGA 3MT0A 3EEYA 5CLIA 4C5BA 4ZI7B 3PV8A 2XGJA 4JCCA 3U56A 1NR5A 2CUKA 4R05A 4F60A 4AZ0A 4O3QA 1CYEA 1XU9A 1AU9A 1C1DA 1YR8A 3DC2A 3KM0A 4KOAA 4ZJUA 5BNZA 4IZOA 1SUWA 1S1CA 3PXEA 1QTIA 3CINA 4G41A 4RZXA 3BZKA 1SC9A 3R20A 2YY6A 3AUUA 2AZDA 3O8QB 8ICXA 4AJOA 1SH7A 1K6EA 4PONA 1GTJ1 1OXSC 5EC8A 5ITWA 1Y7LA 1I1NA 4CW7A 5EUBA 1XD9A 4MV0A 3ME5A 3FRJA 5DIFA 2ST1A 1C8KA 1FDRA 1V7PC 2V6MA 5CP2A 3L9WA 4AICA 1P2UA 3UB3A 4PTLA 821PA 3OQIA 3QZUA 4JI1B 4Y9UA 2O7QA 5JO9A 3OEWA 5HF5A 3GRFA 4Q12A 2BW0A 2EERA 1KI6A 5AK4A 1SELA 2QLTA 3OAAA 3OY7A 1Y98A 1JROA 2W0SA 2QM8A 3HZZA 1SL0A 3JZMA 5FPSA 4ZYUA 3G6VA 4RU9A 3P9IA 1EFCA 3DMDA 3H3XA 4WCDA 3KSBC 5SICE 4C87A 1KEUA 1FFHA 3QXHA 1QYCA 1LW6E 2XLCA 1IOZA 2DSTA 2RDJA 4I2BA 9ICBA 1NN0A 2W98A 2ASVA 3SEQA 2UUCB 2CXYA 3OKCA 3Q10A 3V6KA 1G5QA 4LZJA 2MCFA 1X2IA 3RNOA 3GQBB 3FPBA 4CG0A 4DKXA 5PNTA 2IEZA 1KRWA 4UB2A 3W78A 1I0LA 1SJ9A 4XD2A 1QG4A 4ZVPA 4WERA 5J0QA 1FFBA 1WVGA 1X0VA 3OJCA 3OEED 4O1HA 2VWHA 4OM8A 5HR7A 2B1IA 2B7LA 2XHEA 3FH0A 1PT6A 3G8AA 3K6JA 5CHYA 5DGCA 1Q91A 2Q7OE 3T3IA 2EFEB 3LT5A 2PKCA 3HI4A 4LX0A 4O08A 4KTVE 5JBIA 1C8VB 3M6WA 3R0JA 5D86A 5IC6A 2W2KB 3FGOA 5KVCA 5EPEA 3LK6A 4PFJA 2AQ4A 4UVDA 1FUYB 5BOVA 4OJOA 4NL9C 4G4SP 3ZD6A 3OIYA 3E61A 1IEXA 3Q15C 4HQFA 4IR1A 5B1HA 3A3OA 1A9RA 3DB2A 4B3CA 1M1UA 2Z5GA 5TPWB 1BOFA 5TQ2B 3A3PA 3SVTA 1RHMA 5FPKA 5J2UA 5F9LA 4D3FA 4NBVA 4XYMA 4D96A 2W9MA 5AVQA 4B3FX 3QEOA 4M9ZA 4URFA 3U3OA 4FLEA 1C2YA 1NQ5A 2J5KA 3HSSA 4RPLA 2LCIA 1WP4A 3TOXA 1Q3KA 2BEUA 3STHA 2KLBA 3KVVA 4I2FA 3WIEA 2J67A 4PL2A 1W4CA 3U0VA 4Q9JA 3SAHA 4YAWA 3BMQB 4RVCA 5IKMA 1E9VA 4LY3A 3V2HA 3A0BU 1VRWA 2B4RO 2EDAA 1IIRA 1ZQAA 1T3HA 1LCIA 5DDIP 4TLEA 4N47A 1KRPA 4J3NA 3RYIA 4DSOA 1SVKA 2PMBA 3DL2A 4EL5A 2W2VA 1X7WB 3PLRA 2H1RA 1Q5PA 3JQQA 3R23A 5EESA 4J4TA 3OE1A 1UODA 3BQMB 3N86A 1OX5A 2C0QA 4P54A 3HPRA 3B52X 2HSJA 1QO9A 4D8YA 5K6AC 5LD2C 5EKDA 5CEHA 4AO8A 3W5JA 2ODBA 2MT9A 2FMHA 2VWPA 3ZDYB 4HEJA 4ZHSA 1EK1A 3S3TA 1E2QA 1XMSA 3CRQA 3RTVA 1ZCFA 2ILTA 3D9QX 4UDYX 5DOZA 2FZLA 3V7WA 5CFRA 5F9HA 3UK6A 2OHVA 1QK5A 3SDZA 3CKLA 2A1AA 3VHLB 4XFKA 4U7PB 4BQPA 4B9AA 1Q0ZA 1Y9AA 1Z4MA 2H2WA 3MF4A 4REQB 5FRDA 3TWOA 4BNFA 3RSGA 2MIIA 9ICNA 1IB6A 2XTJA 4K1LA 4H6XA 3CN7A 4L8WB 5KVSA 4RX1A 3L01A 3L79A 1VJTA 4MKXA 5AM4A 2WHRA 4LVCA 1KH2A 4E4RA 3TMAA 4EF6A 1FW6A 4MDFA 5SZKB 4I66A 1UOQA 4OHOA 4R2LA 4ZRMA 5TMEA 2NU8B 3H2SA 4J76A 1RWXA 1P45A 3H0CA 1YQ9A 3PEWA 4MICA 4HN4B 3PFCA 1IL0A 3PNPA 3PRYA 1QGAA 4ZQHA 4Q3NA 3SF8A 1ZOPA 5LWQA 1XE3A 3N07A 1A8IA 1DO0A 2ZE8A 3ADOA 1DTWB 3G2PA 4H1HA 4X3PA 1PR9A 1IZ0A 2R84A 3A9SA 3OJWA 4GI5A 1GSAA 2X6RA 1GL9B 1XJCA 2A30A 2V1UA 4JLBA 4LMAA 5CLGA 4LVNA 3WKCA 1OXMA 1UKVY 3KD2A 4ZRNA 2BR0A 1ZW6A 3WL4A 1FNCA 1BW9A 1L7VC 1AUOA 3SC2A 2A9JA 1NXVA 4YR3A 5I51A 5ECGC 4ECTA 1T4GA 3M9LA 3OX1A 2F3SA 2EJCA 2H4WA 4KE7A 2NPOA 2VNHA 2CNBA 2AMFA 2VHWA 3P52A 3TINA 2AG8A 4JY7A 3IDWA 4CODB 2ORWA 3ADPA 5DWVA 1CUIA 5B58T 2D1SA 3SP1A 1EEXB 5IM4F 3MR6A 2BEVB 3NBQA 4QLBA 1OGIA 1UMKA 1V8PA 2OBXA 1IQ0A 4P4OA 2NYAA 1X6IA 1SCDA 3FROA 3RJ5A 1LVUA 2H7CA 5J43A 3JPQA 1E0KA 1H6DA 2XMBA 2Z3ZA 5JALA 5L6MB 4PLVA 3KS9A 4BIIA 2JD2A 3H86A 3GLFE 1DOHA 1UM9B 4LZOA 4ZXFA 5CFPA 1QLWA 4OL9A 4PNZA 4KX5A 3ZE0B 4EZEA 4JQYA 2YYZA 1SB8A 3EWNA 1U8CB 3UG6A 3KSZO 1H8ED 1Z0UA 2DQKA 2GPYA 3PQ8A 5J2UF 1M2GA 3DW3X 3ENWA 5B2ZA 2H3HA 4JVNA 3AUOA 2P90A 1P4HA 1SXHA 2CCGA 3D43A 2PZMA 2IHUA 1FRZA 2R7LA 4IFBA 3MDCA 2JCBA 1CE8B 2E85A 2OWEA 4XX0B 5ERXA 2C8VA 2QMYA 1LQTA 4LZGA 4OQMA 3I73A 4UB1A 2R6AA 2HA7A 4FBLA 2D06A 5I9SA 1QUFA 1C3OB 2BRUA 2OYRA 5KQLA 4D46A 5TT1A 3NWJA 4QUBA 2ZDQA 1N8SA 1WWUA 1NXOA 2RAPA 1E6UA 3OCJA 4JS0A 5FTWA 2Q5CA 4ACBA 4WFJA 5C3MA 2QL9A 3JASB 1YQXA 3DCJA 1PEKE 1KQNA 1CBUA 4G0VA 2QMZA 1XEAA 2XNCA 1NXXA 2X5NA 1JSXA 4R7TA 1V9LA 1EEHA 5FWNA 3QBVA 5DASA 4TYPA 5CJ2A 3PNCA 3JQGB 5J4VA 3F5MA 1R4ZA 3IEPA 5K0JA 4BVGA 3FVQA 1F2UA 4Y0NA 4RKWA 4CZ2A 3QXXA 4QDKA 4AU1A 3ND7A 2QK4A 2O8CA 4GC6A 2E0IA 4IOMA 4EW2A 1RWPA 3OQ6A 2XA9A 4IZHA 1X9HA 3NVDA 3MNFA 3R3YA 4KUEA 4YLGA 2JEZA 3PUIA 3H2BA 1N5WA 1JBKA 3L8DA 1SCJA 2CHFA 5DJ5A 1YJCA 4EDHA 1J6UA 4Q9KA 4DYHA 1KJQA 4PYMA 1DAHA 5BVGA 1JH9A 2EKLA 1T3SA 3AETA 5JC1A 2DZDA 3Q7PA 2RKWA 1LPAB 3SGLA 4OJMX 1G8SA 3A05A 4ND8B 3S55A 3W6NA 1WX1A 2V6IA 4PGXA 2ZI6A 5JO0A 4TT8A 4MWGA 3LYSA 4MDYA 1EE9A 4GPIB 1T3NA 1QM5A 3DMHA 1OU0A 2PRSA 3M81A 4ZOLB 2NZVG 3TZCA 4E33A 9ICLA 1G20B 2QM0A 3W7AA 3FKQA 3OLZA 3M9WA 4DMMA 3KUDA 5DYWA 1ZXBA 2IXFA 3TSAA 4ZCQA 4Y1GA 4H7JA 4HTFA 1KEWA 4KR9A 2YWFA 2KMDA 2WV9A 2YXLA 2QN8A 3FB4A 2JIZD 3JQ6A 3K0FB 1WNTA 3RK1A 3VU3A 4EJSA 5CA1F 1L5UA 3TE6A 2Q2NA 2D3DA 1D7OA 5KFWA 1OIVA 1VBMA 2YX1A 3T5PA 4GP6A 4XPZA 5CEFA 1L7OA 2Z57A 1JN0A 3D2LA 2YINC 4HDRB 3TI9A 3KT3A 1HETA 1MU0A 2AW3A 1WCNA 3C3JA 1QG2A 4R2KA 4O8CA 5ALDA 4TMFA 1E0DA 3I6QA 1QGYA 4ZI3A 3CRXA 2BGUA 2Z7JA 2AK2A 3L02A 2JARA 4PLTA 4HZIA 1JE1A 5LQDA 3WRWA 2BZGA 2FN3A 1DCMA 1NXTA 1RYDA 1HT0A 4NH0A 4CM4A 5IULC 5ECYA 5BT8A 3UBTA 1K4YA 1T0IA 2FFAA 2M1ZA 2QJOA 3N2KB 5F1YA 1VA5A 4B7CA 2G80A 2RCYA 1XZCA 2DPLA 2WPNA 1PVVA 3QMMA 5EZYB 3C6XA 3CO0S 3OPMA 4LC1A 3PXCX 4HG2A 4D6YA 3ZIAD 1EINA 4N1AA 3T3MB 4FHCA 1XDZA 1PVQA 4MS4A 1K5PA 1IG6A 3B38A 4WI1A 4FIDA 3MSXA 4XOUA 1NK9A 4FFVA 5EZYF 2R6CA 2JZBA 1Q7CA 5KL8B 2IHBA 1GZ7A 2L42A 1P2VA 1XQWA 3IP8A 3LGAA 2HBJA 2JVIA 3IESA 2NXNA 1CB7A 2PQ0A 2H2AA 3JZAA 3KLPX 5FHQA 3GUVA 5AVJA 5G3ZA 1HJPA 1I7LA 3D2BA 1P9LA 3FPHA 1UDAA 2P75A 3UK1A 1N2CA 5ELMA 4AY3A 1OFUX 3IUEA 5CR0A 1NKSA 5KFCA 4C89A 4DV6B 4R2HA 4YRBA 1G8KA 4QDJA 1TOAA 4KLQA 1V5IA 3BXFA 1Q7EA 4N39A 2OE2A 4V24A 3FOZA 3FG9A 1LXCA 2IHMA 3MCZA 1XXHE 2AOUB 3DTVB 4IIUA 2B5WA 1YVPA 1LSUA 1JJFA 1NDQA 4I5DA 4TT3D 1J7JA 1FXSA 4Z99A 2AGQA 4B3JA 4DLWA 1DJMA 2WJ3A 8ICLA 1DAEA 2WWWA 1QDLB 3DEJA 2G04A 4O4IA 2PUFA 3QI2A 4EBCA 3IB6A 1QF9A 1I2DA 2GRUA 4NV1A 1LSOA 5D4BA 1BA3A 1X14A 2D0PB 3W5AA 1MO5A 3B1KA 4QOIA 2P65A 2Y1GA 4TQAA 3WTBA 1N8TA 5HJ5A 4JJFA 4LVSA 2M98A 4AQ7A 1C7FA 4FT4A 5J5VA 3RRMA 1GY8A 1M2VA 2D1YA 2GFIA 4EGFA 3BK7A 4FOOA 2AH5A 4DOBA 3DULA 4TS3A 2B4TO 4Y2UA 3OF3A 5BW5A 4ZKDA 1IMJA 1XZKA 2RHDA 1Z28A 1P62B 1AO3A 2VDUE 1AXGA 2WK1A 3BGOS 3IA7A 3ZCVA 3HKBB 4KPUB 3O1LA 5KT7A 4DLKA 1VG9B 4ME6A 3K8ZA 2K8CB 5F3DA 4V1CA 2YJ6A 4QYSA 4RK7A 4CTKA 2ZE7A 4INZA 1GLNA 3TIGA 1VBNA 2VDRB 4NS4A 2OBLA 3N39C 3O4JA 4YUAA 1K27A 1L4EA 1SG0A 2GEJA 4P3NA 2XH8A 3GELA 4GAEA 1QCKA 3UJPA 1Z3CA 4F3CA 5K4GA 4UPEA 2QUBA 3FIJA 5CXUA 1BPEA 3KHHA 3PNYA 1SBZA 4LFCB 4C6HA 4CLRA 2OD2A 4CG2A 2XD4A 3KJGA 4DV7B 4IXNA 3OZBA 3ZV5A 1EFPB 3I8XA 1RQXA 2JFBA 5CDFE 1B4FA 4MQBA 2OO3A 2BBWA 3BFKA 5HOQA 4QNMA 3RS9A 2WHQA 2VXBA 3H2ZA 4INJA 1C81A 3VAZA 1Z33A 3FMOB 2B3DA 4Z1OA 4O3MA 4G26A 4WX2B 5KFMA 2JPDA 4C3OB 2NSYA 4GYKA 1W73A 1F12A 1SZPA 3FMPB 1ZM3A 2ZCVA 2YV4A 3LBYA 3QZ7A 3A4VA 4MUHA 4UOZA 2HXSA 2AI3A 1KFBB 3EE6A 7ICTA 1D8AA 3SHVA 4A8TA 5L3QB 3B3GA 3SPXA 1NBME 4BGIA 2KZZA 4EO9A 3JY6A 4YJ2F 4JNCA 2Z1MA 2YFYA 1EG7A 1ZINA 2RH5A 3U9LA 4TYQA 1Q14A 2ROQA 3H4MA 1QRTA 4YDQA 5JXIA 3SXUA 4G5OA 4I9FA 4CM9A 3R5SA 1AKTA 1D2HA 4DS4A 3EZ2A 1E58A 4WZBB 2VF2A 4JI6B 1F38A 3V34A 5T6BA 1O0SA 2BSXA 3JQAA 1CZKA 3AX6A 3LUGA 2K2WA 4TKLA 2IUUA 1F6BA 1XQ9A 1ONPA 4BC0A 2C7BA 4C7BA 2WZCA 3EN0A 1K66A 3WKDA 2XGQA 1U2SA 1MPTA 2Q6VA 1XWIA 3QVGA 4I1VA 4RJTA 1KHHA 2A7XA 5D8DA 3BMOB 4JV2A 5CXXA 3U7IA 5DRTA 4ZVNA 1F8GA 3A6KA 5LLTA 4TQSA 1LS6A 5HKBA 4EO7A 4QRHA 4YN4A 1USIA 3K9GA 1JQKA 2QRJA 1K4MA 1QJ4A 4WZBE 1KIAA 1ST3A 5IIIA 1DL5A 4JUFA 2IVZA 1XTRA 2J6SA 4M8LA 3T9DA 2UVVA 1T0BA 3CRVA 3AVYA 1T1GA 3CPHA 3O84A 1JHAA 4F45A 2C31A 2EANA 2J09A 5FBKA 3FFAA 4FS3A 1UQTA 1Y63A 1WW2A 2E4AA 3X1YA 1Z45A 3PV0A 3NBFA 4XOIA 5F3XB 3KAQA 4UAVA 3DL0A 1BVHA 5L3SA 2WSYB 1V4VA 3DR3A 4MRSA 2DY1A 5AQ1A 4GVPA 4DC9A 4WHMA 5CVVA 3KKOA 1R0CA 5GONA 2BLLA 2B0CA 4F86A 3A31A 2EKDA 1MP0A 4RIGA 1N3YA 2OD7A 2G9ZA 3AI3A 1DADA 4K8OA 2GJ9A 3EGOA 3S99A 4NPAA 4B4VA 4B17A 1DC7A 3ETHA 1UPBA 3GAZA 1K63A 5EJ6A 5KJ6A 3GCDA 1HLDA 1AE1A 2B6HA 4J75A 4EA7A 4EHIA 5KYWB 4GKAA 2C61A 5FFMA 3H4BA 1TW2A 5FLYA 4EKGA 2MU1A 1T15A 4JOCA 1UQVA 3LP6A 4LOIA 3K92A 2PT9A 4PSVA 1VP3A 4H1WA 5HNKA 4JUIA 3JPNA 1CDZA 2WYOA 1J0EA 2N9UA 3AT1A 4B3BA 4R1QA 1QPBA 4RDCA 3RTDA 2FWMX 3T3GA 4RXMA 1TJYA 3MOSA 2P40A 3EDYA 4HWPA 4FZ5A 2H1CA 2HNBA 1KDTA 1S0NA 3HKCB 4GF5A 4JSYA 5FA6A 3INGA 1X7YB 3C1ZA 1QHXA 4LI0A 4Q3EA 1QVZA 2R87A 2X8JB 5A1JA 4IXTA 3N7UA 2O2DA 2SKEA 4QBHA 2OHOA 5JISA 3IAFA 3CEPB 2GBGA 2XA2A 1JB9A 1TQHA 1CV2A 1NI4B 2JGIA 2O0KA 3T9FA 3V9AA 1C1XB 1N9GA 1Y6RA 4UEWA 4DDKA 2V7EA 5LKRA 2DFVA 1RKVA 3NTQA 4PBTA 4D4IA 3RYHA 3L0DA 2YZMA 2B8TA 5IAAA 1WDTA 1P3Y1 2DUYA 2LE0A 3QYAA 4NTZA 1NC3A 2A0YA 2W4QA 3H4IA 4XQ9A 2PXCA 1J2TA 4DEZA 1X39A 1E60A 2VRBA 3PEFA 4O4HA 4RY9A 3RHFA 4Z54A 1N2EA 2H07A 3LPNA 3TSWA 2HGZA 2FX2A 5CH3A 4DJ5X 1R12A 2P1RA 4X84A 3VR5D 4R1PA 5I7FA 3HHEA 3RRBA 5J59A 4PHCA 4PGHA 3QPBA 1KVQA 3B6KA 2YFHA 2EDCA 3N7SC 3VO8A 2QSJA 2YDXA 4BEVA 1PJBA 2KIVA 2ZXIA 5BOLA 1CUZA 1YZLA 5FPTA 5TJHA 3U62A 3BB3A 4PLYA 4EEYA 4W63A 3X1JA 1DFHA 2F00A 2NYUA 1COZA 1II0A 4LWZA 3VXKA 5JH7F 4QAQA 5ESWA 3UMMA 1XALA 2Q2WA 4Z51A 2RHFA 2PD6A 4C4OA 4DNOA 4EZ9A 3ONFA 1YR1A 1G3IA 1I4DD 3CLUC 3NVMB 1M1YA 1XDGA 4ZZ3A 4CRXA 2BM9A 5T67A 2CKMA 1NN1A 4DLRA 3Q2KA 1O97C 4IVPA 5D5HA 2WTFA 3UJ6A 1P6QA 2HWKA 4L2IA 5KG0A 2ZTHA 3KQTA 3FNFA 3CZRA 3MMPA 4HNVA 4CL3A 4MQLA 1X9WA 4ZCSA 3F2BA 1ESMA 4CDRA 1MENA 2DLDA 1NOJA 4LIPD 3S2EA 4EBFA 4XYEA 4GNRA 3RH6A 2PYDA 1PJSA 4GKKB 2AC4A 5DQGA 4R01A 4YRZA 4DLUA 4IH4A 2WZQA 1XEWX 4ENSA 4CUJA 3JVVA 1WUKS 3EVNA 3FTNA 2AUTA 2FSFA 5C0OE 4CR8A 4OB7A 4EY8A 4DXHA 3GDXA 2VDWB 3UK0A 1XRPA 5JAIA 5JD3A 4FHZA 2UZ4A 4GOJA 2AX3A 4RC9A 2ZS8A 3PI7A 1YJ8A 3DE0X 5CK5A 3WBJA 4YDRA 2GXQA 3UGTA 4F4UA 4IOKA 1Z5WA 2AMYA 3HEMA 2X4IA 2FZVA 3EARA 5I9LA 4MROA 1WF3A 3L8MA 1BXZA 3LC0A 2C28A 1UBOS 2VPWA 5JTUA 2C1XA 3KL4A 3TVDA 4IIXA 2QLJA 3CU5A 4GPBA 1U04A 4JI2B 4PZZA 3CSSA 4R3UC 1X7GA 2PYIA 1W5AA 2I80A 5HCNA 5DBHX 1DDIA 1VJDA 1TQDA 1IXYA 3CZ4A 1FFUA 3EW9A 4OUDA 3LBAA 2QGNA 3CLTD 1BXGB 4TS9A 5K0BA 2AG0A 1CDDA 4C1NA 3IBYA 1Q6ZA 1UA1A 5EKUA 2JC3A 5LD2B 4P7KA 5I4CA 2V9CA 2POQX 1EKXA 3HKDB 3HR8A 1MZVA 4JFAA 4FMPA 5GV7A 3K16A 5JNUA 3B1YA 3SHTA 1Z4KA 2J0UA 1XJ0A 1Y81A 4KWEA 1VPWA 1LSJA 1SZDA 1SKWA 3KR0A 4RTSA 5EXXA 5HG0A 3EZ5A 4LXQA 1VIVA 1XB2A 1K9VF 2IOYA 2X42A 3B5EA 3TPFA 2AOVA 3QUSA 4DQXA 2VYQA 4ZZ0A 1N32B 1G64A 3TGLA 3PFBA 4TWIA 3FOEC 2VPIA 1Y8RB 3G17A 5FBVB 2UXBB 1SIBE 3CX3A 4L16A 1V4NA 3I12A 1VYHA 1L0BA 3KC2A 4CKCA 3F4LA 5TVGA 1EGMB 1R6DA 3B1WA 5AKHA 4Y67A 1FFAA 3K1YA 2I7TA 3KFLA 1S76D 5B7PA 4HQ0A 1E6WA 1I36A 3LX6A 4P31A 1OE0A 2EBFX 4FFRA 3I23A 4N8DA 4NL4H 4D6XA 2W9XA 1YQWA 3V1MA 3VR2D 3AB8A 3HP4A 1RRCA 1L7MA 1A8SA 5A4MS 1BOOA 4GGOA 4C0KA 4EHHA 1T2UA 4JMUA 1BH2A 3P9YA 2XBMA 2HBZA 5C1BA 2WV7A 4MHTA 4JHXA 3PXDA 1UBTS 2YWRA 1ZKDA 1ZN9A 2HA2A 4D0LB 2X0NA 2C3MA 3IB3A 1ZVQA 3NRZA 3PDIA 1PEYA 1P61B 4XGQA 4WOBA 5HJEA 3I76A 1XQXA 3AHIA 3NVVA 5FEMA 4B09A 4MGKR 4D0NA 2I87A 5HPYB 2R47A 2H1FA 4DCSA 3HY3A 4I7EA 2DYKA 1NIPA 3P19A 1SBQA 3KHUA 2EIXA 1DKLA 1TYEB 1M75A 5C81A 5CA0F 3OIGA 3F3YA 4K3VA 4UZFA 4C0HA 4L3VA 4OXXA 5FQNA 1RBQA 4Y6OA 4DQLA 1J97A 5A7FA 1Z4OA 5DG9A 4HSGA 3WI7A 3HCPA 1U0SY 3LF1A 1R4AA 3Q3VA 1YH3A 2QMQA 1JQEA 2OB2A 2REQA 1JPJA 3G1TA 1HSOA 3FAKA 1Z7BA 1ILEA 4PSUA 2P9HA 3DO5A 1DQSA 3Q5GA 2C96A 1SU8A 1AV6A 1SKAA 2MU2A 3ZV6A 5AJWA 3U7RA 2ATEA 3P7MA 4DCJA 5J2HA 2OORC 3QF7A 1PT7A 3UKJA 3NYWA 1TE2A 1RQ2A 5G40A 2HGSA 1BDMA 2FN4A 4W5JA 4CQMA 4NMXB 2FF7A 5JBQA 3R9XB 1E0SA 1MSWD 1X80B 1D5WA 1QNLA 2BGNA 3OJLA 3Q4GA 3ZI7A 5FOQA 2FV8A 4KBYA 1TF7A 1D1QA 3Q8PB 2KMLA 2PMKA 2QRVA 4CV3A 4EZIA 3QE0A 3AQEA 1W4BA 2QRMA 3DFUA 2JBHA 1YOVA 1ZQRA 2QY9A 3RCBA 2GN6A 2XYPA 4Z9FA 3F4BA 1Y89A 3H5LA 2J3MA 1RM3A 3CZQA 1O0CA 3LL4A 3HW8A 1Y7IA 4XCVA 2FK7A 2AOTA 1D5CA 3DLCA 4ZVKA 1PYDA 4CL8A 4PCUA 4OJQA 3O4GA 4IIJA 1T4BA 3UMRA 2DUUA 1RYUA 3URMA 4Q8FA 4N9QA 1Z38A 1XMJA 4B45A 1ZGHA 4TTRA 3DZFA 4GOND 2O57A 2XNKA 4GSLA 5HQ3B 2GA9A 2KYRA 1WUDA 4WE3A 5FUBA 5IF3A 1X74A 1J4AA 4U1RA 2M0NA 1WTCA 4QWBA 4L8VA 4BV8A 2PFQA 3JZDA 3KQVA 2CF5A 1Z7WA 1AY0A 4JJZA 2ATLA 1YGYA 5L9XA 1JTVA 2CLLB 2PLRA 2SCUB 4JWNA 1A04A 4KN9S 4L4YA 5E1MA 3U3XA 4E30A 5A4AA 3UUFA 1MRZA 5TC4A 3IBGA 2W2NA 3ELBA 2ZIWB 3S1AA 3VO1A 2OCIA 3TLGA 3V42A 4D42A 1CIJA 2DC1A 4BRWA 4UTRA 1G5TA 3FNGA 4BNDB 1ORWA 1N3LA 1P2GA 1Y3FE 1Z2AA 2WYHA 1J0AA 1K1EA 3NYIA 3UUEA 2YQ5A 3ZGXA 4DL9A 2PHZA 2VEOA 4D25A 1F51E 2OOKA 1DJQA 4MYHA 1DC4A 5B1EA 1V9CA 4NFLA 4EATA 2XEDA 1T36B 4KLNA 3T3HA 4MMXB 3PJRA 3H2YA 1LV5A 4JI5B 1HMPA 2E9SA 2IYAA 3CLRD 4FQ8A 2PA0A 4MEXA 4YN3A 5E7MA 4YMSA 3EOAI 5ABPA 1F17A 1UBCA 3K9FC 1ISGA 5J0XA 2COUA 2J3KA 4QTXA 4WADA 5FFNA 3EBLA 3H0KA 3I5MA 3IP3A 3Q7EA 4GHWA 4B44A 1CUXA 5J8YC 2PSEA 4EHLA 3OJSA 3HO1A 1CR6A 1KP3A 2R8HA 1ZI6A 3JYQA 5H4HA 3DSRA 5AJZA 4DJAA 2XGOA 4J6FA 2P67A 3EEQA 1NXPA 3OZIA 4LXIA 1ZUNB 1CY1A 3TADA 3KFUF 2JFVA 5LA6B 4LHSA 2CJXA 3Q11A 3F53A 1ISHA 4M9SA 2VA8A 3NEPX 3GP8A 1H9AA 5DSZA 3SR3A 4ERNA 2X4DA 4Y3UA 3F6RA 1MA0A 2GOYA 4GWLA 2A78A 9ICMA 1N2OA 2FWAA 2IOQA 1EE2A 2YRWA 2HOIA 2Q9BA 5KFXA 3AJRA 3HXLA 3DQPA 3IHWA 5K3FB 4OX9Y 2EFHB 4FGLA 3VNSA 4YMOA 4GZ3A 4DG5A 2B8WA 1BEZA 1UXGA 3ILVA 3MBKA 4IUDS 1VYTA 3B9JA 1Q0PA 5E3JA 5BW8A 3NVAA 4GC5A 4UXJA 1CWUA 1J9GA 3LK9A 4D0SA 4KMOB 4JUCA 4KODA 3OPVA 1H6CA 5EVJA 3B7PA 1ODKA 4HVLA 4MOWA 3ITDA 1PJ8A 4B81A 2IY8A 3GV7B 2QRKA 4R51A 4A0RA 1GRVA 4BC1A 1TO6A 1E3JA 1WD7A 1OBOA 5KFIA 2XD9A 3C2QA 4PYOA 3GPLA 2ZRIA 4LXTA 3C43A 4YUYA 4WK6A 4W7SA 4QM7A 4PX9A 1JG1A 2IMWP 3E3NA 3LV8A 2QT0A 4P35A 1RAAA 3UEOA 2HU7A 4FNAA 2LDBA 1QMGA 4QGAA 5ALVA 3F6PA 4ML3A 2GT1A 4LG1A 4OQDA 5DX0A 3KDAA 1UINA 3OEYA 3AM1A 4B6QA 1L4MA 4JLJA 1RFGE 4RJLA 1I7SB 1TTQB 4AMGA 3HH8A 2NO5A 4H77A 3FGNA 5AHWA 1B0UA 3HFRA 3RJIA 4WASA 2R1UA 5CHEA 1IBKB 5ALUA 1KNQA 4K6MA 4A8PA 3EW7A 3EDCA 1NR7A 5AVKA 3RAJA 1KQPA 3S29A 3LFUA 4X3CA 1IZ7A 4ISCA 3RVPA 3ANMA 5C1IA 3LH5A 4ZVMA 3VVCA 2ZRQA 1I7QB 2GZMA 2QI9F 4V1CI 3MAGA 3WLIA 1BKYA 1U80A 1C3EA 5JLJA 2HA4A 1GWNA 5JQWA 2J0QA 1BDHA 4FSHA 3EZXA 3I6BA 1ZQDA 1Q0HA 4NNJA 5A4IS 4CEHA 2JJ1A 4L6AA 3EC7A 5T3UA 4GXIA 3DAPA 4QL3A 5KTKA 2IGTA 1TJPB 1N5LA 5ALOA 4HAVA 4EUSA 4XQEA 3MELA 2RHTA 1CQJA 1S4QA 3RH0A 3UAOA 3E15A 3JCZA 3I2KA 3PO5A 4ZAGA 1ZQPA 3RUFA 2I6SA 3JYNA 4AG6A 4I2IA 3AONB 5E79U 5LBTA 3FHLA 4ZOBA 4QZHA 1BX3A 2UVPB 1VIYA 2PI5A 4KQCA 2XWBF 4JCOA 3I09A 4Q3LA 4TSRA 2ZRLA 3TG2A 1EFDN 2R44A 4L4UA 2FJPA 4JMPA 1C7ZA 3GHHA 1QQBA 1M6VA 2CDCA 3F71A 4OSPA 2BCUA 4M1KA 5AP9A 2F1KA 3D3WA 1K3UB 5YASA 4KMUA 3BKWA 1ZNWA 2PUDA 2HFJA 1P80A 3LPLA 3AKEA 1LNZA 3PX2A 2BPCA 2PMDA 1FRVA 1ZOIA 4DR7B 3FDIA 2N1BA 4AJ2A 3VPFA 3PUZA 3NRBA 1P1CA 2Q5LA 2WIDA 3AESB 4LV6A 4E51A 2C99A 3UT6A 4W5OA 1E92A 3C48A 3O6VA 5JSKA 1ZESA 1L9KA 1QNFA 2AEEA 2EYUA 3ND6A 2OVBA 4CEIA 1MB4A 2FPOA 3DYIA 2B3TA 3WWYA 1AZWA 3VJLA 1QANA 4I1SA 3U9SA 5KSYA 1IRXA 2Q3DA 3H75A 5ERGB 5BN3B 2LMRA 1MO6A 1T4CB 3T7SA 2I5PO 1ZBQA 4J90A 3TQ1A 2PX6A 2OAQ1 1EFRD 2CUZA 4UUQA 2L18A 5FPQA 3TSYA 1BX0A 3HJNA 3UWDA 3DMPA 1NBEA 4MQ6A 1NVGA 2WAOA 3T1YB 2EKBA 2QQGA 1EHCA 3VU9B 1QF7A 3F1LA 2WIKA 3U40A 2A9PA 2XCRB 1JP7A 4IDQA 1ZAYA 2CXSA 3K1RB 4UNSA 3GD7A 5CG1A 4ED1A 1GZVA 3LWNA 3PEUA 4H7PA 3S8MA 3V00A 1WCIB 4KLHA 1KN5A 3OECA 4ZDJA 2FW1A 4AMUA 2XA1A 1KI2A 4BP3A 4DPLA 1Z2EA 2F17A 2ONZA 3HGQA 4ZV9A 3TTYA 2X1LA 3OZTA 3T0IA 4CF4A 3C7KA 3PWTA 5KTRA 4HYQA 1GNPA 1S9DA 4LMRA 5IABA 2CXQA 3FCAA 1VG0B 3RH4A 4AF6A 5AJVB 4ZVUA 2PGDA 5E0OA 5GJVC 5KNIA 3EGIA 2E1PA 2GARA 3KWLA 3D59A 1TYDE 3FWYA 5EFOA 1NJGA 2XGSA 4Q0MA 3WDSA 1PDOA 4OL0A 3HU3A 2FOIA 1HDIA 1NQOA 3S40A 4KXQA 1DZ3A 1L5KA 2VBIA 3CUVA 1Z34A 2RIPA 1M34B 3GL9A 3ICPA 1OAKA 4MKRA 4TLLB 3ZE7A 3BGSA 1A3CA 1KYWA 1VL8A 3A0RB