2VKQA

Crystal structure of human cytosolic 5'-nucleotidase iii (cn-iii, nt5c3) in complex with beryllium trifluoride
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
b'NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'- Nucleotidase III
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2vkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2vkqA01
5ALYA 3NUQA 3KC2A 3EWIA 1NF2A 3WKDA 2BDUA 2HHLA 2I54A 5AM2A 3N07A 3OTQA 2B8EA 4Y2TA 3IB6A 5T41A 3QYPA 4UAUA 2YJ4A 4CF4A 5AW6A 2GO7A 2R8YA 2W4MA 5IS2A 3ZWDA 1RKVA 1LVHA 2IOFK 3M9LA 3D6JA 5IT4A 5AM0A 2YJ5A 3SKXA 2I6XA 2YJ6A 5FP0A 2OA0A 5AI9A 3ZVNA 3PGVA 4XPZA 2RARA 2YMPA 2R8EA 3NAMA 3E81A 2G08A 3QU9A 3I28A 3L1VA 3AR2A 1TE2A 1RQLA 2ODAA 4YCLA 4ZEXA 3QUCA 4Y2JA 2B30A 5AVQA 3WK7A 4CF5A 3IRUA 4Y2XA 3WK8A 3UMGA 3NASA 3U7EB 3L7YA 3N8GA 3UMCA 4Y3UA 3HYCA 5AKYA 2WF7A 2ZBFA 4PNHA 1Z4KA 3CZ4A 3ZW7A 3W5AA 2PR7A 3IJ5A 5ALHA 2AH5A 3MPOA 3QU2A 2NYVA 2QLTA 5AKXA 2WF6A 1Z4LA 3L8HA 4KNWA 2CN1A 1ZRMA 4HGOA 3AR8A 2JARA 5AKIA 2OBBA 5ALWA 3L0CA 3QU7A 2RB5A 5AVUA 1RMTA 4NFLA 4BEVA 3KD3A 3KDPA 1L7MA 1RDFA 4XOUA 3ZX5A 2FUEA 1O03A 2G1AA 2G0AA 1L6RA 3I1YA 4F71A 1N9KA 3FM9A 1S8OA 2HDOA 3B9BA 3M1YA 2ZXEA 2WHEA 3ZTWA 4UMFA 2YFYA 1ZRNA 3I76A 3KBBA 3L1UA 1VJRA 4YCMA 4O8CA 5AVXA 4OD0A 1TJ5A 2WM8A 1T5SA 1Q92A 2B0CA 3ED5A 3QLEA 1MH9A 3ZWKA 3QUQA 2I34A 5AI6A 2I7DA 1Y8AA 4GIBA 2EAUA 4FYPA 1Z4PX 1NRWA 3SLRA 4E88A 1X42A 2B8JA 2IYEA 4L6AA 5AI8A 2IA5A 3OCYA 1RLMA 2NO4A 3NANA 5ALKA 2FUCA 2G80A 1RKUA 1J8DA 1XPJA 1RPZA 4I9GA 1YMQA 3N5KA 2AGVA 4H1WA 3AR4A 5AI5A 4C4TA 3FGOA 4IFTA 3AR6A 2FI1A 4L6CA 3A1EA 2HSZA 4DCCA 4CE6A 1Z4MA 4EX6A 4BX3A 5ALPA 1ZS9A 3N1UA 5ALVA 2P69A 2WF9A 4JDPA 3WK5A 5AW4A 3VAYA 4J03A 2OYCA 1U7PA 2P11A 2PQ0A 2VKQA 5AM3A 1RC8A 1RQNA 3EF1A 2IOFA 2C9MA 4MWOA 1WPGA 2Q4RA 3MN1A 1U2TA 2QYHA 3WK9A 2EATA 3EF0A 3FVVA 3UM9A 5AK4A 1SWWA 3A1DA 3W5BA 2JAUA 1RMQA 1AQ6A 4MUMA 5AKLA 5ALTA 5AVYA 5AI4A 5AK3A 2HI0A 3L8EA 3SD7A 4C4RA 4HGNA 4OFZA 5ALMA 1QH9A 2X4DA 3ESQA 3MMZA 3QGMA 1Z4QA 3QU4A 1Z4NA 3J7TA 4EEKA 2O9JA 1T5TA 2YY6A 4AS3A 2OM6A 2DQSA 3WK4A 1CR6A 2Q4TA 1L7NA 3E58A 1KYTA 1SU4A 1L7OA 4RESA 4Y2PA 3WKBA 2W11A 3L0YA 5ALUA 5AKKA 4KX5A 2HO4A 5AM1A 4KYTA 2P9JA 4Y2SA 4EENA 5AW3A 4DWOA 2MSNA 5AESA 4DFDA 4Y2RA 1RMYA 3U26A 4OCZA 5AW0A 3FPBA 4HGPA 1EK1A 1TJ3A 3QUBA 4NAVA 5AW2A 3QU5A 4GXTA 3BA6A 4OHFA 4Y2YA 1WZCA 3NRJA 4IG4A 3ONNA 2G09A 5ALNA 1K1EA 5AVSA 1YS9A 3MC1A 2ZG6A 4UASA 2W43A 4DW8A 5AW8A 5ALIA 4B6JA 1L8LA 3NALA 1FEZA 3NIWA 5AK5A 2YMMA 4QJBA 5AVRA 3ZUPA 2NO5A 3BWVA 4KNVA 4YIHA 2C8KA 4BX0A 1Z4OA 3PGLA 3AR7A 2FPUA 2AMYA 2CFRA 4YIKA 4YGYA 2G07A 2GFHA 2BY4A 3PDWA 1QQ6A 4HAIA 1O08A 2JAOA 3U7HB 2JAWA 4FFDA 1Z5UA 3U7GA 4Y2QA 4CF3A 2FPWA 2ZBDA 3S6JA 1Z4JA 3HLTA 2AUTA 3KOOA 4NABA 5AVWA 2B1QA 5AW1A 3UMBA 1Q91A 1JUDA 3FZQA 2C88A 4RETA 2HF2A 4UATA 1QQ7A 3DNPA 5ALXA 3TLMA 3ZX4A 1PW5A 3U19A 2ZBEA 4ZEVA 2P27A 2YN4A 3AR9A 4YCNA 2GMWA 4HGQA 4NV0A 3L0BA 2R8XA 1SWVA 1CQZA 4UMDA 4XQ0A 3W5DA 4HYTA 2FPRA 5ALZA 5AM4A 4BNDB 3QX7A 5AW7A 2C4NA 1Z88A 1LTQA 3SF0A 4BEWA 5JJBA 1VFPA 3DV9A 2I55A 5ALGA 1L8OA 2Q5EA 4BNDA 3K1ZA 5ALEA 5AICA 5AKHA 5A3SA 3CNHA 1F5SA 1YV9A 2FEAA 1YJ5A 4F72A 2FPSA 5ALRA 5A3RA 5AI0A 1YDFA 2IOHA 1RLOA 1S2OA 1QYIA 1U2SA 4HGRA 4EX7A 4FE3A 3WKCA 4YH1A 3F9RA 4BKMA 2YMQA 4ZEWA 4EELA 3W5CA 1T9ZA 1YNSA 3R4CA 5AK6A 5AVZA 5ALJA 2B1RA 4BBJA 3AR3A 3OCXA 4QQFA 3ESRA 1WR8A 5AVTA 4AP9A 3SHQA 2MU1A 1U7OA 1QQ5A 4I9FA 4UMEA 2YJ3A 1IWOA 5ALDA 4G9BA 1Z4IA 1ZD3A 1Z5GA 3P96A 4C4SA 1ZD4A 3I6BA 2R8ZA 2WFAA 5AHXA 4Y2UA 2CFSA 5ALFA 3RF6A 4UMVA 4BX2A 1ZD5A 4G63A 5AKJA 3QNMA 3OCUA 5E0OA 3U13A 3GYGA 2JGAA 3DAOA 1WVIA 3EPRA 1L7PA 3R09A 3KZXA 3RFUA 4CNQA 2PKEA 5AVVA 3ET4A 2FDRA 2HOQA 4XE5A 4Y2VA 3SKYA 2FPXA 3L8GA 3OPXA 4KX3A 2GHTA 1RRCA 4KN8A 1TA0A 4UU1A 5ALLA 2O2XA 1VJ5A 2HX1A 4AS2A 2RBKA 3OCZA 1U02A 2HCFA 5AKEA 3ZTYA 3SMVA 2RAVA 4UM5A 3ZVLA 5IT0A 5ALSA 2ZBGA 3QUTA 1XP5A 2BDEA 3DDHA 3B9RA 2D2VA 2EARA 2YMLA 3QXGA 1XVIA 2I33A 2WF5A 2CFTA 5AKZA 5AIBA 2GHQA 2YBDA 3WKAA 4NWIA 4J2TA 3A3YA 2HF7A 5A3QA 4UARA 3L8FA 3WGVA 3N28A 5ALOA 1RKQA 3WK6A 3U7FB 3PCTA 3E8MA 3AR5A 2G06A 3ZI4A 4BYGA 2WF8A 1N8NA 3L5KA 3B8EA 5ALQA 5AKGA 5AIAA 4UAVA 4UW9A 4EZEA 4JB3A 1NNLA 3ZVMA 1ZOLA 3WKEA 1RLTA 3OCVA 1TJ4A 3ZU6A 4UM7A 3OCWA 4UU0A 1EK2A 2B82A 3FPSA 4L57A 1ZJJA 3A1CA 1ZD2P 2ZOSA 3R9KA 3E84A 2HEGA 5AW9A 2C8LA 5AM5A 5AW5A 3WGUA 1J97A 3ET5A
chains in the Genus database with same CATH superfamily
1DT5A 3UJAA 3GD5A 1V2HE 2Q29A 5LMZA 5M34A 3E2EA 2B8EA 4Y2TA 4YX9A 3TPCA 4UPVA 4RJ2A 2RHGB 4YMSA 3QI2A 5DN9A 1Z2AA 1M6HA 3UGJA 2XECA 1FFXA 2BONA 3I28A 2GNAA 1UXJA 1DBSA 2OAEA 1FJXA 5IANA 3LUAA 5K6AA 3LW7A 4L9WA 3QEJA 1DNPA 1XAHA 4JUFA 1ZQVA 1SEVA 2IKSA 2ZIXB 1PV4A 4LEIA 3EULA 2IODA 1SKAA 4CCYA 1NZBA 4DMMA 2XLCA 4GMXA 3L0ZA 4E03A 1T1GA 3EOZA 2PFNA 2E5LB 4Z4IA 1EPUA 5J23A 3PUXA 4ZCSA 1ILWA 2BWJA 4GZ3A 1CEEA 4IM7A 4PSKA 5CYPA 2B5WA 3CG0A 2RK6A 4ER3A 3EVCA 3ZWKA 2XBUA 2SKCA 3UHOA 3JQ7B 1ZMRA 2HL6A 4NARA 4PFSA 1WEHA 5B1SA 1CUAA 3WV5A 2XCPA 1ZZGA 3GCXA 5BP7A 4DLRA 1HYHA 1H5UA 2JFGA 3N5KA 3H5WA 3M9MB 3N97B 2VJLA 1ZK2A 4QECA 5FKJA 4IEIA 1C1DA 4CE6A 3SJZA 3ZJ5A 5LQCA 3QM1A 1KY5A 5J63A 1T91A 1RC8A 4LZNA 3E7FA 2IOFA 1MQAA 2C4WA 4DVJA 1DGJA 4MGKR 4TN5A 2CCGA 3LM8A 1TAMA 4Q1FA 4N48A 2XUHA 1H6AA 1QGYA 1COWD 2RCNA 1QH9A 1J06A 4PH5A 2I4MA 4RZQA 4NLZA 2ZI3A 4B7XA 4FE4A 3I5AA 3P0EA 2FLKA 1ZQSA 4WH0A 4WPGA 3KLOA 4PIPA 3GFSA 1E2GA 3PTAA 4BE4A 4GPAA 4X3CA 1Q0ZA 1WIWA 4R9UC 5C8ZA 3NZEA 4K81B 4PYRA 3G88A 4UBLA 4FLMA 4R05A 4GPZA 2AE1A 4OAPA 2EFCB 4M9HA 2V0NA 2NQ2C 1FRNA 3T38A 2ZG6A 3B53X 5G1OA 2BGNA 4EUSA 1E6WA 3QFRA 5SICE 1RBQA 5JJ5A 3A28A 1DEXA 4YJGB 2FPMA 3C3EA 3LP6A 3QMWA 1FDWA 1ADJA 2PZKA 1R8XA 4OHYA 4BTVA 1BOFA 4RQ4A 1DXHA 5HGJA 2NZVG 2M6RA 1Q8KA 3HUDA 4F5WA 4WE3A 4NFSA 5DGAA 3F7OA 5IJ9A 3DEFA 4DQSA 3B6MA 4L5BA 1RWKA 3C3DA 2YFHA 3BZBA 1KRPA 2GMWA 1KEKA 2NQTA 5K0TA 5AM4A 4U3JB 3TADA 1J7JA 5KFEA 4F21A 1S2MA 1DWPA 3PFIA 1YV9A 4NU6A 2D3TA 3HMKA 1B42A 4WJ3B 4AP6A 1D0IA 1IXRA 3U7QA 3JQEA 1X13A 3PSIA 3UK1A 1XOIA 4K9QA 4EELA 3W5CA 1RRVA 3VR1A 2QAGA 5GONA 1N8TA 1DXQA 4D8VA 5DHPA 3DDNA 5DJ5A 1BCRA 4IUBS 4J3JA 1IZ8A 4CRXA 4X63A 4F93B 5TXGA 3U13A 1QM5A 3F73A 2OD2A 4E70A 3ET4A 5LQNA 1LV7A 3E9YA 4IRXA 2VIXA 1M9NA 4X6LA 4FHZA 3D4OA 2V9PA 1CS0B 2H1FA 5LZ9A 2DFVA 5EHNA 3VYVA 1EX1A 3LUDA 4DLZA 2GEDA 3FOBA 2AMJA 3HLYA 5AO9A 5F1OA 2ZYHA 4FYYA 3ICCA 4XQCA 2P8JA 1YR8A 4LHZA 4MR8A 2VANA 3QTLA 3FNIA 5HMMA 5A4FS 4YV1A 3EEQA 4BYMA 4LZZA 3FMFA 2B82A 1V3TA 3CGGA 5K0GA 4QBKA 3MTGA 4II2A 4E5PA 2QT9A 2W6OA 1KERA 1KDZA 1EAMA 2W4MA 1RBZA 3EXFB 2NACA 2WQ6A 3KZVA 2R8BA 2QX4A 1R7RA 4CYMA 2BHTA 1G3UA 2RHJA 4ER7A 4ZAWA 3DR5A 3I2HA 2XUAA 4M9QA 2IDKA 3JPOA 1VJTA 5IM4F 4L8WB 3JYQA 4G56A 2XY4A 4C4XA 2Q2OA 2J31A 4XWKA 3VZPA 3U31A 5MFZA 1Y6ZA 2C3MA 3FWHA 5AR1A 1HMYA 3LWNA 1GZ4A 1ZRMA 2OCYC 3IVXA 1Z2DA 2A1UA 1GZ3A 3NT4A 2JLCA 2MUTB 5BSEA 4QWBA 3TQTA 1CUYA 3I6IA 2X1VA 3S27A 3D6HA 4ONEA 3B1FA 3OICA 1KYQA 1OXSC 2ZYVX 3FYTA 2JA2A 1L5OA 3D4LA 4TXHA 4LI0A 5HQ3B 1M2VB 4WACA 1L1FA 1H1LA 4F8EA 1P4JA 4F4ZA 2VWGA 5J1TB 2KD1A 1I3MA 4NSNA 3BT7A 2KM1A 1KMNA 1YU9A 4Q3CA 1U2PA 1EZ4A 3QLVC 4ZV7A 3QYAA 3O8BA 4XR4A 2AN5A 2QUKA 2Y2UA 4IZIA 4RJJA 3K8YA 2GXSA 4EB0A 4RFSB 3WICA 1ISFA 4U5QA 4UOEA 2YHAA 4N7RA 4HX9A 2HXGA 1EXMA 1DUSA 4PFKA 3MGGA 1TZBA 2GOLA 4YT4A 2D00A 1KJNA 1J99A 1E0KA 4EZBA 1XBTA 3IB3A 4JI2B 3KFUF 2Z7JA 2GR9A 4BFUA 2ZITA 3C5HA 5HA5A 5AW3A 4P4GA 3ZWOA 1JQDA 2OGZA 4FDUA 2HSGA 1PG2A 3OZIA 5EMLA 3A1WA 3G9ZA 1I6WA 2H9AA 3T7AA 4F92B 1ZD9A 3TLCA 1L4BA 3V00A 4OHOA 4QJBA 4M8IA 1GZHB 1BROA 9MHTA 2GWRA 2WQ7A 5DX0A 4B4KA 4F9EA 5HHHA 1EVLA 2I1QA 3OAAD 4BNTA 1NFQA 3KZMA 4RDXA 3ZUGA 4HQOA 2OFOA 3EGOA 5BWLA 3HVIA 1P18A 3D6MA 3ZZUA 1UM9A 2Y2VA 2X0FA 2CMKA 1EFPA 4HVLA 2BFBA 4EUNA 1R00A 1Y80A 2ZTSA 2D0PB 4HG2A 2FPRA 4B9AA 4IW3B 3D4IA 3H04A 4L76A 2K7ZA 2BQUA 4QEKA 5CVJA 3EBPA 3LPCA 3JQRA 4WOKA 3JS5A 2ZIEA 5EQFA 1NVAA 5I5EA 5B53A 2BIFA 2EFHB 2BL4A 1ODJA 4DLNA 2FEKA 4BQRA 3TYXA 4UXIA 3SC3A 1U0RA 3CZ5A 4NMMA 4F85A 1T24A 1U7OA 3W5VA 3MMPA 3I5YA 4JLOA 1NOIA 1M66A 3A10A 3CF2A 1FBTA 5C7OO 4P9NA 2XMCA 3EPRA 1JQ3A 1RCTE 2JHGA 2HOQA 2QQ0A 4GL4A 1JEYB 4PQEA 1FU4A 3L43A 4ND2A 4FHGA 4R2XA 4AECA 4AKIA 3JWJA 3VH4A 5EY5B 4FIDA 4JXZA 3L8FA 4J0EA 4QUIA 4DSUA 4Q0MA 1CNFA 4HEA6 2DY1A 1IAVA 1GNRA 4Y0AA 1JVSA 1IE3A 2CK3D 1OH7A 1AMUA 5BNFA 1XNGA 2CWWA 3M6UA 5KYUB 4OU5A 4JVNA 4B4OA 2IP1A 1F60A 3V2HA 4HWPA 5L45A 4JI4B 4IIHA 4I4IA 3AHFA 2NU9B 3O47A 2Q4EA 5H0IA 1SZPA 3TJZA 3W4IA 4KNYA 5JQWA 1I30A 4DLLA 3HCEA 3B6IA 2ZRMA 2CL6X 3RRHA 5CVDA 5I4KA 3LC1O 3TNJA 2PZAA 5CK5A 4LS3A 2P68A 3FGNA 1ETUA 3WZ2A 1J0DA 4WK2B 4LCBA 4C89A 3WB2A 1AK1A 5ADUS 3IM1A 4MUGA 4BTEA 3QTBA 2DBQA 4H08A 2ES4A 1IZZA 2A9PA 3TAXA 4UQLA 2V7EA 4OA5A 3BN3A 3DO5A 3PC8C 3EC2A 1GM5A 5CURA 4CTJA 2YCBA 3UGKA 3NHUA 1Q57A 2WWIA 1O5TA 4EBCA 3E70C 4G0VA 1Y5NA 3BKXA 4CN8A 5HZMA 1Q92A 1UMCB 3BJMA 4P7FA 1M2KA 3VDQA 3JPSA 4W5QA 2YZMA 3HSYA 1IYZA 4KFCA 1L1QA 3SLRA 3A31A 1GPBA 2ID7A 4L6AA 5EKXA 3KVNA 4V0MA 4MA4A 3BS7A 1GSIA 4N8DA 1JG1A 4YCXA 4HQ6A 2IS6A 1MAWA 1FU7A 4ZODA 2IX3A 2QY9A 2W42A 2WDZA 1EGHA 1BVHA 4O9MA 4J8PA 4KO2S 2JFQA 5JATA 2GKGA 1GXSB 2VDWA 5LYJA 2DCMA 2VPWA 2AE2A 2BHLA 1Y0BA 2Z5GA 4QPDA 3SMQA 3FY4A 2JCXA 5J59A 2ZRFA 1TJNA 1DMRA 4FCCA 1S1MA 5KMGA 2ZAIA 3MGCA 1QQAA 4AN4A 1H2XA 4R71A 4UNNA 1L7OA 3K73O 2VUHB 2A9OA 3HWRA 2GBIA 1G19A 4BKUA 1CD5A 3L7DA 3I9FA 4KYTA 4R1UA 4F38A 4FB4A 1B8OA 4ZTBA 1YHZA 5TIIA 4F3NA 1XU4A 1W36D 5K4HA 3RUCA 4MLPA 4EI8A 3ZVRA 1MORA 3IAS1 1X40A 1M2OA 4XI9A 3W3AD 2EKQA 4MV3A 4Q6BA 3NNNA 3BQMB 3QXXA 2ZS9A 4YXJA 2CYAA 2WG1A 2BR5A 4EPXA 5K1ZA 4ELTA 3LBFA 2GQ0A 5HRUA 1VG1A 2GSDA 1WRBA 2BP7B 3DGEC 1L2TA 1YKFA 1CZKA 2VTBA 2HWWA 3OKFA 2VHQA 3B13B 2RGDA 2W2VA 3N2IA 2ZW9A 1XMIA 2D8MA 4UBIA 1CUGA 1N0UA 3CF6R 1TEVA 1ZJNA 5J8YA 2PKQP 3LVBA 3FLBA 4UNRA 1B43A 4GC9A 5KZMB 4KFTA 2YB4A 3HBNA 3W9UA 3EGXB 3LWZA 4U7FA 1SHTX 4DHEA 3LWBA 2BM1A 4Z1MD 4S12A 1VTKA 1DRJA 3DMRA 5FPTA 3OVMA 1X9XA 3SYLA 4EQ6A 3F9RA 5CBPB 4A0FA 4HDQB 1PR1A 5ENVA 1PR5A 2IELA 4W9MC 4ER6A 2QQFA 4CCHA 1V38A 3AOEA 5HBRA 3H2KA 1IQ0A 1JR4A 4JBIA 3ONEA 2CFSA 2IH2A 4TLLB 3ZH2A 3EFOA 3WA6A 1V85A 4OJLA 5K0LA 3BD6A 3ITKA 3WWOA 3KKEA 4XE5A 3GT0A 5K45A 1RPNA 4M8SA 2FSPA 3NV7A 2Q9CA 2IOQA 3ZVLA 5I4CA 1X9SA 1TX4B 1NR7A 4G37A 1Z0ZA 1JILA 1CLUA 1R4MB 3PGJA 5EUBA 1LPBB 1N5JA 2AHOB 5KQMA 4OPMA 4EWLA 2YZ7A 3C70A 5DWDA 2D2XA 4W9NC 3B6EA 1W44A 1UPHA 4ECQA 2NV0A 1T36B 2BR3A 3W8RA 2OKGA 2UYOA 4DLXA 2JFVA 1TPYA 3EMDA 3GG9A 3UMMA 5DOZA 1CZRA 3IQZA 1YB4A 3CUSA 1GYQA 5EC8A 4YMHA 1D2CA 2O7SA 3BXFA 1HNNA 3FB4A 2EH9A 1J6UA 3U4HA 4IIJB 1D7OA 3V3TA 3PWTA 3AYZB 7ICVA 1SBCA 1N9ZA 2IZ0A 2W6CX 1WXDA 3ZDFA 1NR5A 5GZ6A 1H4SA 1GPDG 3IRUA 4GT1A 4PC7A 5IN5A 3IAM1 5FTLA 1YR9A 1ZVQA 5JCOC 4DMKA 2XA2A 4LOAA 3VR5H 7ICTA 1QANA 2QAIA 3GR6A 5K4AA 4NY8A 1G5HA 2JRCA 1P1KA 3HJAA 1SD1A 3ICQB 3I2GA 3SZ3A 1XU7A 4FGJA 3BXHA 3KBBA 4ARSA 1QE0A 1E2DA 2KTQA 4N3CA 4MI3A 2FLVA 4NLGA 1A9XA 5G1NA 1G7SA 1SOAA 3NWBA 3PRHA 4C14A 4ZA2A 3T5HA 1YL6A 1MOPA 1P44A 4F4HA 2ZJ0A 4BPRA 1BDHA 4OGKA 4IXWA 2CBZA 2C5BA 4HUTA 3JQBA 4U7JA 2OHIA 4J1TC 5ULLA 4JQCA 4O3OA 1KMHB 2B0JA 3NYIA 1ID8A 1ZS9A 4LGYA 2VA8A 2PNJA 1V43A 3R1IA 2RH4A 4I29A 1YFKA 1VHTA 4G1MB 3T8YA 3AGQA 5HX7A 1AXGA 3VC2A 2KJ9A 3EA0A 9ICOA 3GLIB 3WGIA 1MH1A 1AX9A 1EXVA 3TDKA 4BC0A 1SVSA 4BUGA 1S10A 3EPGA 4R16A 2NXJA 5AK0A 4E12A 2VRCA 3TGWA 4DQRA 1DJOA 3LYUA 4NYMQ 3GJXC 1VZ3A 3AY7A 3LHFA 2IHZA 5KFAA 3IN5A 4HUQB 5JWHA 2I6UA 4R68A 3N8NA 1JQJC 1ORTA 1UDXA 2HLDD 2C98A 3COZA 4HSEA 1W19A 3X0DA 1JDJA 3P2EA 3RC7A 3LI2A 1E1CB 1HGXA 1YB6A 4DLVA 4C8LA 4UM9B 3D31A 1TYZA 3JPYA 2R65A 2B36A 1J07A 1LV5A 3BFPA 4ND4A 2C8KA 5I7FA 1VPTA 4MGEA 4YGYA 2G07A 2BY4A 2PSFA 4M0EA 4OP1A 4ENVA 3ZWWA 5DCUA 4HPJB 1V8ZA 1K5PA 5DDIP 3E9RA 3VU1A 1RJEA 5HUHA 4N12A 2RGXA 4RGBA 1OB5A 2AFHA 4LVUA 2QMZA 2YV1A 4LYAA 1WCXA 3WB9A 3TI7A 5KSOA 1H94A 2A3RA 3CZAA 1SUIA 3ID6C 3NGDA 1LF0A 1ECLA 4M83A 1U4SA 1EDDA 3LIIA 3LGSA 5KVAA 4ND8B 5K2MA 4Y6QA 3K0EA 3MXOA 1GNQA 2H3IA 3JZMA 2VO1A 4FGKA 5C81A 3AV0B 4M88A 2NZUG 4O2BF 2XCRB 2XCUA 3D1VA 4PLCA 5CM2Z 4EKIA 1XNJA 2V98A 2HYDA 1YUMA 4OXNA 3OA2A 5JXHA 1E2BA 3GLHB 5EMKA 1HG0A 1CVLA 1NATA 4BNXA 4LOLA 3T34A 4K8OA 3QBJA 4UM5A 4O4IB 1SEPA 4TTJA 4L3VA 3PR5B 1RW4A 4R2KA 5JDIA 5A3QA 2RI1A 1X2BA 1CF4A 4B32A 4ZIRB 2W2MA 2HYIC 1QX3A 4C2AA 1XLTC 2VQ3A 4NX2A 3K15A 4DGSA 4ZZ1A 1ZWKA 4K9KA 2CCJA 5BRNA 2YJZA 5JNTA 1LK0A 3PF8A 1EVJA 4F4XA 1B00A 1F0MA 5AW5A 1LW6E 3ZV4A 2QIPA 5KAPA 1H2AS 2SICE 3VR4A 1EMDA 3I2KA 3NHFA 2GZ2A 2J8ZA 1B3BA 5KNIA 1E89A 2J6HA 2ZJOA 1JXEA 4OUDA 3WGMA 3FJOA 2VUUA 5FUQA 1SL2A 3AF3A 5U1PA 1Z75A 1YVUA 3CLSD 1UDWA 5GZ1A 3TZBA 1D0VA 1TAQA 1HKHA 3KLMX 1E7WA 1G8KA 4YPVA 1WS6A 5A4JA 2Q1UA 3D8BA 2JAPA 2H06A 1Y1LA 4G4JA 4HDMA 3I9JA 4UEWA 1P5ZB 3RUEA 1GA1A 1MTZA 2BHRA 3ND6A 1XZHA 3W5UA 1PWYE 4EO7A 2C0QA 2ECPA 4BIIA 4K46A 2BEUB 2H7CA 3FOZA 3PC7A 3QQPA 5C1OA 4KE9A 2P9YA 1FS5A 3H83A 4DUGD 2QGFA 4I2NA 4RDHA 1WCWA 2G9VA 1NFRA 2YUIA 4E5KA 1WY7A 1XHFA 2AEEA 2P4SA 2AN9A 3IOCA 4YP3A 1ZVKA 4N3GA 4IDGA 5JS1A 4UVDA 2W90A 2VHZA 3QG5A 3UXEA 2GPTA 1MRSA 1WKCA 4IFTA 4K28A 3MNFA 4EY4A 4PBTA 3V1TC 1EX9A 3DYIA 1YBFA 5BSHA 1U1CA 2VNJA 4ZJPA 1U3DA 4HDCA 1F12A 1NJ2A 2GRUA 2NVWA 5EE1A 4UNIA 3T7IA 1XZJA 4CDGA 3SZRA 4O4JB 2OD9A 3H0LB 3RIYA 1L7NA 2WUFA 5J0PA 1NLFA 1ZD8A 1GY8A 4RGVA 1Q50A 5EIBC 1SIJA 2R6FA 2PKRA 3DDOA 4JJKA 4OFWA 2C42A 2XHEA 2VJ5A 4PGMA 2W8LA 1BMQA 3LD9A 5M3BA 4JUCA 3Q7SA 4FWBA 3NVWA 4EMUA 4RKEA 1N5WA 3ECSA 1KJYA 3N8KA 4N6OA 4BX0A 3OJCA 4GKAA 1MP0A 4RKYA 2NP7A 1EEXB 4MUYA 5FBKA 1T9HA 1BEUB 2PMWB 4B73A 2KI5A 5HDBB 4JT8A 4MUJA 5JTTA 9ICJA 3N05A 8ICFA 3PSPA 4YYEA 5DNWA 2AOTB 3FOWA 4PS1A 3KHKA 2R6GA 5TVKA 1VPVA 2ONJA 4UZSA 1O5OA 4URWR 3P2KA 1AK9A 3QX7A 5U9CA 4UUMA 3F78A 4R2LA 3WRVA 4NBNA 5EIWA 2NU8A 1AQNA 4G25A 4BMYA 3ESAA 3I05A 2UKDA 1U8EA 1E8DA 3B60A 3N0TA 2WU8A 5FPQA 5IJ0A 4OIMA 3R7FA 2GZAA 3HSSA 3BREA 5KOYA 3PDCA 3BF7A 3U3KA 4G0NA 4OX9B 1VYUA 3V7LA 3EHEA 4D9IA 3OZEA 3QNWA 1CUFA 5IIOA 4AJIA 4Y2UA 4B3HA 1JNYA 1R4AA 2WAAA 1MB3A 1A71A 1USVA 3DAOA 4GPD1 4M0UA 3N6RA 4NE2A 3SKYA 4GVPA 4JV2A 1XYYA 2ORVA 4ZFNA 5KT6A 2I6FA 1B0UA 2QD2A 4J4BA 4PGQA 3ER9A 4PXYA 3UMVA 4EW6A 3HKCB 1C80A 3KELA 1RAAA 2R6CA 2A0UA 4KBFA 1D0SA 4GLLA 1GCAA 4ITUA 1R3UA 3L77A 3GFFA 3FMVA 2ADMA 4XIIA 4A0QA 1PEDA 1JEAA 4CMGA 1JE0A 2L5YA 1GQ2A 2WKQA 3PC4A 4QYSA 2XIDA 1HDYA 1X1SA 1HE8B 1J97A 3P2MA 1RYYA 2GXQA 3V6HA 2CXOA 1UBKS 4D82A 2OO5C 3E15A 3L01A 2LGJA 3HV0A 4QSHA 5J4YA 3CX6A 3E27A 1P1JA 3ZWDA 4I46A 1TGVA 4K9SA 1TK5A 3P20A 2YJ6A 4EY8A 7ICQA 2FGJA 2OA0A 3RYIB 4MKFA 1W4LA 3U44B 3R3JA 3A1TA 2WKRA 2ACWA 3C87A 1IHDA 2CLSA 3K5PA 2HXYA 4I55A 3LCUA 3IC5A 3JQ9C 3FCAA 2WF7A 3IR5A 1SVUA 1HYQA 3THWA 4Y1EA 4JP5A 2BV3A 3LC0A 1DOZA 4KDEA 4BX9C 1JFRA 2E5SA 3KD3A 3VKUA 4QZFA 2JW5A 2NRTA 1S3SA 3Q8WA 1A2OA 2DBRA 1Q0QA 3GYBA 3QI7A 1UPAA 4EJSC 3RF9A 1YDEA 3GA7A 3ZI0A 3EUB2 3IIEA 1JDBB 1NKCA 5KDDA 1T9KA 3RCBA 2P91A 4KDRA 1KU0A 3KYJB 2H2FA 1XF1A 4RA9B 2C1ZA 4C7OA 3E2MA 1DP4A 4TX1A 3ROTA 1CQWA 3BIXA 3Q3JB 4WEOA 2H1RA 2UVDA 1FO4A 3C3YA 2E5WA 4TPKA 5TF0A 3ZWPA 1OE0A 4B6RA 1JTVA 4DM4A 1CE8A 2HSZA 1Z4MA 4BX3A 2QB0B 4CV0A 1D09A 3B2EA 4DNQA 2H2AA 1K0UA 5CA7A 1KAOA 2CLLB 3UM9A 1R4NB 1LNZA 3JZAA 3UNXA 5L1IA 2MWMA 1SKUA 1DAHA 5AVYA 3TCNA 3WBBA 3E2PA 3IP1A 1GZSA 4PVDA 4EEKA 1YVPA 4JBYA 5K6AC 3Q3HA 1BFKA 3LTNC 4MB0A 2NGRA 4P36A 1KJ9A 3HCRA 3AFOA 4YQYA 2EAMA 2XUFA 4C0LA 4C3VA 3WNDA 1E6UA 4WBNA 4G0WA 3FTPA 4I36A 4KLLA 4IG4A 4MVCA 3QKTA 5MFPA 3PCRB 1E2JA 4IDPA 2WWXA 1PR0A 1Z8DA 4MAMA 2O0JA 2VPPA 4PLZA 1SKBA 3A0UA 2KJ8A 2OG2A 4LKOA 5M2QA 1KPGA 1QCDA 5LDDC 3HR7A 3TPFA 5K9ZA 1EP3B 2AQKA 4BV2A 4BNIA 5D1NA 1PK9A 5ANRB 5D01A 1KZHA 3VH3A 1QV6A 1S0OA 5A9SB 3JPTA 2HOIA 5JJCA 3COSA 3N39C 2VHYA 4ZVNA 4Q01A 5AOVA 1ZSYA 1WBDA 3LA6A 3KNZA 1NIPA 3U3RA 2NRVA 3K1ZA 2F3SA 3NBXX 1T3QA 3M2PA 2CXXA 3P0IA 1CR2A 4XCQA 1XSNA 1LDEA 1NLMA 3AHCA 3HEAA 5KFQA 4IHJB 1QGZA 1BOOA 5D7NA 3U4QA 1CUIA 4X1KA 4QZ8A 3I8SA 1Z18A 1AQLA 3D1JA 1AKVA 2VJOA 4MDYA 5JU5A 3OY2A 2Z0MA 2ZBRA 4ZPXA 1J00A 3AJRA 4O29A 2BYTA 5LXTB 1ZCAA 2XZOA 5DM4A 1LTKA 3N2KB 5DMHA 4H6WA 4REQB 4MUHA 3QYFA 2YNMA 1TF5A 4QSMA 4RPHA 4HTAA 1XMSA 7GPBA 3HB0A 4BO7A 2P0AA 1VJ5A 1PK7A 2ZWIA 2XE6A 4BP9A 4H35A 3ENNA 3NRZA 3OSNA 3MTDA 5LP6F 3GIWA 1QTMA 3NTVA 4FKBA 3JALA 2DM6A 2VF4X 1VC2A 3K30A 3R8CA 4AY3A 1Y3AA 1NXQA 1XJWA 3ASUA 4AF8A 5F9NA 4P35A 4KLTA 4JKYA 4H3SA 3AR5A 5HK8A 4OHZA 5ALQA 2MSKA 1VJDA 4YUVA 4WVFA 5JRJA 5JARA 2Y4OA 3LUCA 3PZBA 1ZUD1 3U3OA 4DAEA 1JQBA 1MAUA 3UPTA 1WB6A 3PDIB 2CCKA 3M5CA 2O7RA 3TADC 2QN2A 2I54A 4TTAA 4UAGA 4UAUA 1YKSA 3P97A 4E08A 4KN7A 2C5FA 3R76A 3J80A 5IKXA 1IXRC 4X91A 4Q7MB 1YZUA 3SV4A 1UCFA 4DA7A 2UXCB 3NOXA 1RABA 4QBHA 4IGFA 1DIGA 1GQQA 3GPBA 4F9GA 2QAGC 3AZPA 3I23A 1P6XA 3QKSA 1AUQA 2YC4C 5EE9A 4K6KA 1G5QA 5HQJA 3SXJA 4QQ8A 3O0FA 1A8PA 4YK7A 1FB5A 2RB5A 2ZSJA 2ZREA 3TH5A 3OU7A 4LMRA 1NTOA 3U1VA 2FUEA 5I01A 3FNBA 2QTVB 5LZ2A 4AJJA 1K5HA 3PUIA 3RJZA 4PC3A 4JHXA 3LQ1A 3VH2A 1QO0A 3EUEA 4XYLA 4BNHA 2HPVA 2WMYA 4YDHB 1XQWA 5KL1B 4OSOA 1IQRA 2PMCA 2L42A 1DOHA 1LBHA 1XEXA 3N4MB 1J4AA 2EANA 1JFFB 1EHIA 4YCCA 1GJRA 4HRYA 2YHIB 4DCSA 1U3CA 2CJPA 3RF7A 1VI2A 1W2WB 1DRKA 2HK9A 2DCUA 5ED4A 5C32A 3J81A 2NV3A 3DEKA 5BN3A 3DGFC 4BQNA 1IQPA 2FSHA 5ERXA 2QXTA 1GG8A 2JGDA 3OMLA 2IFTA 1GU1A 5JJKA 3PI6A 3K8OE 1V48A 3ESDA 1OXTA 4MVJA 3VYUB 3CBQA 2O9JA 4D9KA 5FOVA 1RI4A 1WXWA 2ZJ6A 1G21E 2HA0A 1ZH0A 1XAGA 1XRSB 2X0DA 5EKTA 1PYOA 5EE5B 1IMOA 2QPLA 2DSNA 3PGXA 4KR6A 4RZUA 6YASA 1YHNA 4KYVA 4P0QA 5KTMA 4A8JA 1K1EA 3CQ9A 4ZOLB 4ABYA 3IDFA 2M6SA 1WL8A 4AJ2A 2Y76A 1SUAA 2BFOA 8ICGA 2HB6A 1H9CA 3AR7A 5HE8A 1OBOA 4YRBA 3QJYA 2O7QA 1VBNA 4KQEA 2JAOA 2CMFA 4PO9A 3UAVA 1XA4A 1XKXA 1E3EA 3BWMA 4YMNA 3UT5B 1QYDA 2EKPA 5E4YA 3II6X 3HKEB 4IR9A 5CPBA 4G5SA 4MF2A 3ESCA 3LP5A 2HF2A 1E1QD 3RFCA 4XQ9A 1P6UA 4DV1B 1MXFA 3C7CB 2F55A 1JHPA 1JEOA 4YCNA 2CNNA 1QCYA 1WMEA 2HA5A 2OLEA 3QLUA 2QTWB 4V39A 5BV0A 4ZHSA 2DPJA 3PNMA 3CSSA 1DRGA 3TIVA 4JLJA 4AJEA 2YS6A 4OG2A 1XTQA 3DAFA 4DLSA 2D1RA 4EBDA 2HLPA 2VRWA 2XGMA 4JVLA 4RJTA 1WBBA 1TM3E 2WBLC 2X5NA 4QZCA 2O8EB 2EKDA 1PJQA 4B0PA 2IQ5A 1T4MA 4ZTUB 2BCQA 3AY6A 4AMBA 1HT2E 3I6BA 1BQEA 1KMMA 2A9FA 1JI7A 1SA0B 5FTKA 2H4WA 2WU1A 2HHQA 1NF3A 3B8HA 4PHHA 3R09A 4RQBA 3WU2U 3W05A 2IS2A 3NBUA 2KFZA 1GUDA 4EK9A 3CW2A 2ZE6A 4LVCA 3KJEA 2O3TA 1C7EA 4WK6A 1HC7A 3JAKA 3H8WA 3PW2A 3R7DA 3HXQA 1EK5A 3IKMB 4INAA 3GDGA 2BELA 2ZJ8A 1KNXA 2R6DA 3OURA 1NPYA 4QFCA 1QO7A 2C2BA 1YAJA 2BKVA 1XRRA 1J2JA 3P0FA 5CEJA 3GROA 2ASJA 1QP7A 2EIXA 3K0FB 1OLUB 5IDWA 4GKKB 4MWEA 1V9LA 1T8EA 1Q14A 4HZGA 4OATA 3HX0A 5AXAA 4H17A 4HNGA 1E2KA 5C8YA 4TYNA 5DIFA 5J4HA 3AUKA 1J2UA 5DM1A 3U3JA 4YR0A 4RPCA 3T7CA 2H3ZA 2R8YA 2FGKA 4PEVA 3C4VA 3EFBA 3LO5A 2I1VB 3IXQA 5TQ0A 4FS2A 3VMMA 4ZT7A 5BPCA 3LLSA 1YIAA 3IPAA 5THKA 5KSYA 5KWSA 3DWEX 1QV7A 3H2SA 4YV2A 2Z5VA 4IIVA 4Y3UA 2W6ID 4M60A 1OUMA 1Q19A 3GELA 4N0QA 3QA3E 1GILA 2CT8A 1I2BA 3AHGA 2D1FA 1O54A 3AKCA 4DLPA 2HV8A 1J1UA 2MHCA 2EZ4A 3IDAA 4U2GA 3WA7A 2NZJA 5LQUA 2FDCA 3GV7B 3T9EA 1KGDA 2YN2A 2MR5A 5F52A 1G8GA 3KOUA 4JSRA 1TC1A 4V3BA 3AF0A 1FLDA 3H5AA 3H9UA 3I53A 1II8A 1Y1SA 1BPZA 2I2AA 2UUCB 3U81A 5JY1A 5D3MB 2IA5A 4DT1B 3M6IA 2A1JB 3KQYA 2KQUA 4QOEA 1KAEA 5J0QA 3KOZA 4DCCA 3MZ0A 2Z1MA 2VK4A 4KLZA 4KPGA 1MW9X 4PAGA 2A5YB 4KCGA 1BKYA 3AU8A 3HYRA 5K05A 2P5UA 1E2QA 1TUGA 3PWZA 1HDGO 3IMFA 2FE1A 3KLNA 4MFAA 2EKZA 2FRXA 1DEKA 3TLAA 4J07A 3O8OB 3IS3A 4PE5B 1BXGA 1E3TA 4BVGA 2JVIA 1Y5LA 4KQ2A 3NIGB 1L3SA 3MIZA 4NJEB 3MQ2A 1W4BA 1VHJA 1RIFA 3UJNA 3FD8A 1SCUA 2PSHA 1B76A 3LSYA 3SBEA 4DM7A 4J0HA 2JLRA 1FSGA 1QZXA 2VI5A 5K3FA 4XB2A 2COUA 2WJGA 3PFCA 3ZW9A 4XPIB 4CM6A 3SI7A 3BHIA 4LRXA 2OHJA 2ZZMA 2PHZA 4WA7A 4BCDA 1I3NA 1E9VA 1O6FA 3AKZA 3RKUA 1V35A 4YBZA 3ROFA 3SQOA 4EGFA 1Q84A 3G2QA 3T52A 5MN5A 4R3NA 4E5MA 1N36B 5TGZA 3ZHCA 5DISB 1K7CA 4IWYA 3DNPA 4I50A 2KWIA 3NS7A 3C3BA 1JDNA 2P2YA 1DG3A 2NNWB 5D4BA 3OOWA 3GZFA 4BNDB 1WUHS 2AOUB 1RI5A 4W7SA 4G5OA 2O5CA 3RKRA 3QWAA 1SOMA 2EFEB 1KP2A 3N70A 4PANA 1UBFA 4U6SA 5K0JA 3CZPA 1NSTA 4BBPA 3ACCA 3Q5GA 2VDNB 5J2UB 1YDFA 3E5MA 1Q3HA 2JVJA 1SXPA 4QLAA 3K16A 2EG5A 4YH1A 2BE7A 2ISCA 5CA0B 4KO8A 4C8MA 1K98A 4KWCA 5BWOA 1PV1A 5F21A 2ZVDA 3RV3A 1WUYA 3O2QB 3H8VA 4ZJZA 2JEZA 3RRJA 3WWEA 1RAEA 4PR3A 4DZTA 1DOAA 3ZCUA 5HSGA 1ENOA 1OASA 1W0KA 1LNQA 4YLEA 5L8VA 1R8YA 4Q4HA 4UCWA 3RK0A 5KYXA 2B25A 1XP5A 3PTLA 5DV9A 3GZTB 3VUEA 1K4MA 4UOZA 3ZIUA 1PJBA 4BMSA 1Y9EA 3FGZA 4WCFA 1SXJA 4CIBA 4TL9A 1VIVA 4BFYA 4CCAA 2JI8A 4NRDA 2QTZA 5HPYB 5J8YC 2BFPA 2JDID 2NXNA 2GYWA 3DKKA 2Q4OA 3OOSA 1OX4B 1PJTA 4UD6A 4PPYA 4MI9A 3AFNA 1KPHA 2DUUA 5AYVA 2G72A 4F8JA 1S0VA 4PO1A 5JI2E 5KG7A 4QTXA 2J3JA 5F7XA 2X0JA 2I3AA 4LJKA 5KVCA 1KFEB 3AOEC 3KRTA 2BFCB 2C97A 4K6FA 4B3XA 4J0KA 3RI3A 3RIMA 5BOSA 4MQUA 4EA8A 2H54A 4DO9A 4JMUA 5ALHA 2ZIAA 4MNTA 4PQRA 3RSSA 8ICOA 2Q28A 4BLQA 3HJGA 1SC9A 4NFLA 2E8PA 3U1TA 1LPAB 5I3ZA 3FAKA 1ST2A 3JYOA 5BVHA 1OLXA 1L4MA 2Q6IA 1UWLA 3WHPA 3W1EA 2IOYA 3QXSA 3SAJA 2EGGA 1LDBA 4MFCA 2FOIA 4OLHA 4K0KB 2F1HA 5D6OA 3Q8PB 1PFQA 1NJWA 1ZNYA 2WLTA 1LI5A 3DNMA 2ID8A 1MC8A 3NOVA 2CB9A 3GN2A 5JAOA 4ZH4A 3B3FA 3RRNA 1FNSA 3TZ6A 4XW2A 1U2TA 3EVNA 5HW0A 1FX0A 2DH5A 1R0CA 4L4ZA 1FF9A 1ZM2A 4O6VA 4YPFA 3A3OA 1E1YA 3SR3A 4W1PA 4LRWA 3DEZA 4PSDA 2TMYA 4YXFA 4P80A 3SNHA 4AJ9A 5B5SA 1NP3A 4YAFA 3W90A 3HBFA 1Z3EB 4Y0VA 2LZ0A 4ZGBA 3NC0C 4RIFA 3AJAA 4DEYA 5IBCA 1T26A 5AESA 1R15A 3KXKA 2RHLA 3H17A 4HWKA 2VF2A 3CONA 1UMBA 4TXMA 4EG7A 5IX8A 5EJGA 3PPWA 1JJIA 4JB0A 4OHKA 1Y5RA 1L3CA 1U49A 3PIIA 1NMEA 5BV7A 2WJZB 3EY9A 4JI8B 1ZVJA 1URJA 4YIHA 3Q5DA 3VNQA 3T5DA 2E1RA 4UB1A 4IINA 1FCJA 1K97A 1NUTA 2IV3A 1CERA 1UK8A 5AVWA 3Q9LA 4DSAA 3JQBC 1N9GA 2EJBA 5G5GA 1NUUA 4ECEA 5L3QA 1D2NA 4RF5A 2I22A 1R0ZA 1YB7A 3BE5A 2PFSA 3V55A 3QOYA 4I1PA 4ED3A 2JK0A 4ZRDA 4K1LA 4IV5A 2FSFA 1RPJA 1VG0B 4JJ6A 1TFUA 4DG9A 2QMEA 2AOXA 5DQIA 4B7ZA 4M1OA 3KR9A 3QYJA 3RU3A 2KICA 4QARA 1U0EA 5EGSA 2VYNA 1YA4A 1Z07A 1G60A 4RY9A 1L4YA 1KHHA 1CZNA 3K0CA 2ADFA 2G8NA 2XB9A 1SZCA 5CT5A 3PDHA 3RR8A 2JLVA 1FLAA 4JJGA 4ZO7A 3FI0A 2IW1A 2DY0A 2R7NA 2F43A 3OBIA 3ZGVA 5CR9A 1I1NA 2XQKA 2Z2IA 4I2IA 1EGMB 1Y5MA 4L15A 3SMVA 1N5KA 2FW6A 4F86A 2O0MA 4E6PA 1DJNA 2A0WA 1YCFA 1H93A 7ICPA 3R2JA 1F6WA 3R5JA 4KAFA 1NI4B 2OK7A 3BRWD 3JWPA 5KNDD 1JDPA 4XRRA 3ZYCA 4WZBA 4YJDA 5I4BA 4E30A 3WV4A 4AF6A 3KQLA 4MGIR 5KFJA 1UXGA 4CM3A 1QHIA 4QASA 5FL3A 4BATA 5D1HA 3ZHTA 4DC0A 4XYMA 1CUBA 1TEXA 3PX0A 3J81j 2C8LA 8ICUA 4AO6A 3ET5A 4KXQA 5JDCA 5LZ4A 3EIHA 2C03A 4AUKA 3OTGA 1YOVB 2WB1F 3VO9A 1EUDA 5CB8A 4G8JA 3K8ZA 5K09A 2C7OA 4KDCA 1B8PA 2F59A 3U4DA 1E0AA 2O1SA 3R40A 3MT8A 4B85A 4M7RA 3VR4H 1CJSA 1T0HB 2PS3A 1JBEA 2H85A 3QF4B 5IARA 4XWOA 1K7FB 5DG8A 5DX8A 1BA3A 2H2DA 4FN5A 1R9GA 4IMRA 1VHQA 3PUJA 4U0JA 5HCIA 5ALWA 4B2LA 2QLFA 5AXDA 4BGVA 4TT3D 4KIFA 5KNCD 8ICAA 4L4SA 3KT6A 3DDZX 5FBVB 2OV2A 2QRJA 1VCOA 1JI0A 2GZ3A 1QNLA 1GUBA 2OZEA 1O57A 4JLSA 1CRPA 5JDIC 1L7RA 4TTPA 4UAWA 2PJZA 3FFXA 1P9NA 5BO5A 5G4KA 1QYVA 1LDYA 4H7KA 4HKTA 4PHFA 1NRWA 1N6IA 1MQ2A 3HXTA 4XYBA 1D2AA 2CXQA 1R4ZA 4HQNA 3IHTA 2YINC 5J2TA 2VJCA 4NLBA 1C3LA 4ENWA 4K6MA 2EZTA 4AXXA 4JH0A 4WJZA 2DLCX 1QORA 1OMOA 3A3KA 4J1SA 3OQMA 4YHHB 4JYZA 4Z6KA 1NYRA 1AH2A 1OROA 3QV2A 2XGJA 4E0BA 4OTZA 2W8BA 3WK9A 4JLVA 3TRJA 4TUSA 4HI0E 4B3CA 3P9RA 3USZA 4BQFA 3GJQA 1R0RE 4BO1A 1BU5A 3I2IA 3QVTA 5IABA 1UJCA 4LMAA 2VJBA 1FYXA 4JNCA 3GZNB 4S1TA 1HV8A 3ZWBA 4IIUA 2R1VB 1XZIA 2R7MA 5IW8A 1D4FA 3JQDA 4M1YA 3JQFA 1A96A 4U7GA 3LC2O 1BE6A 3ZH9B 3G6YA 2J3QA 5CLHA 1G2QA 2B2XA 4QXMA 1JEQB 1T4GA 4UB2A 3KWFA 4LNUB 3OU6A 2QZZA 4PNPA 3MC1A 5KX5A 1WO8A 1O9GA 4KN4A 3D4NA 1TZ2A 2YW9A 1P4RA 3RNOA 4JLWA 3KPYA 2DHEA 4NHEA 4ENQA 1ZZEA 1C3JA 4ED0A 3WL4A 2KNJA 2VNSA 3ZY3A 3DZJA 3AB3A 1GSOA 2V3WA 3I2JA 3FPAA 1CUWA 2B2NA 4DMHA 4MPPA 1CB7A 3TLMA 3D64A 3IAS6 1WUTA 1F1BA 2H3FA 2H2HA 2G9ZA 4AQ7A 3QVJA 5KG5A 1U0HC 2IXDA 1LKYB 5CITA 1GRCA 2F8LA 1VKHA 1TYCA 4NCIA 1X1TA 4Y6GB 2PXIA 3LX6A 4LHEA 4LE2A 1ZXIA 5F33A 3ZS9A 2W6QA 4BXOA 2H0AA 3BUSA 4LYDA 5KWIA 5KFIA 3HUFA 4ECYA 3MERA 3FOEC 2JGJA 1JI3A 2QXYA 3AKDA 3A70A 5KTTA 3LSTA 1Y81A 2ZCUA 2Q2NA 3OZUA 1XYGA 5BXYA 4COKA 3HYTA 8ICYA 2ZJAA 1ZSNA 2Q1SA 1DX9A 3KZXA 3B9PA 1NC3A 2A5GA 4MEAA 1MA0A 5JD4A 3IEVA 1JZTA 1ZMXA 4O3PA 1FBNA 4INZA 4MA0A 10MHA 4H15A 4WNAA 3LC7O 1IHPA 8ICLA 4AX8A 3QITA 4OB8A 3DWIA 5DGTA 1EFRD 4P4MA 4EFKA 5JH7A 3FDIA 2UAGA 2FF7A 2CXYA 1F48A 3VPFA 1KO8A 2QTGA 1E92A 3ZOZA 1AG9A 2ISPA 1KSHA 4FNAA 1YASA 4QICA 4UVHA 4TRNA 1WLYA 2RHOA 1JALA 5EG5A 4CV1A 4S3MA 3NNSA 4OIFA 1QBGA 2JIQA 4TTTS 4BGDA 4H2DA 4KN6A 5IM5A 5JSYA 4JV1A 1SZJG 1SBYA 4NV1A 1CEYA 3AW8A 3GVPA 3GBVA 3G85A 2L2QA 4DDHA 1MJNA 4FJ0A 5C1IA 1ZH2A 5A6VA 2NRXA 4ZK2A 2NP6A 4B9EA 2BKLA 2XQGA 2HBKA 3JASB 3M4XA 3FMIA 3PX6A 5LYYA 1GCIA 4K5QA 3M6XA 4O3FA 1SHJA 2Y8EA 1GZ6A 4H4DA 3C3PA 1EE9A 2NU6A 8ICTA 2CBXA 1T6ZA 3NKVA 1ZQGA 4DC1A 3ZE7A 4OQMA 4KW7A 1T2NA 2RBGA 2G0NA 2RGAA 4NS1A 1Z3CA 1P9OA 1E9EA 3D5TA 1SV4A 4OF4A 3ZX5A 5CUQA 4Y9DA 2K4IA 6AT1A 2M6LA 2R6R1 3FWYA 3RTCA 2UUAB 4LN1A 4MDEA 2QTAA 5F1PA 1H85A 1IEVA 3DL7A 3IAM6 1M34B 1N2SA 2XVMA 4AJ1A 1AV6A 2DR3A 4CEJB 5C4GB 2E85A 5CX4A 4C01A 2IYEA 4MLCA 2NO4A 1UJMA 4MOWA 2XMPA 1SKSA 4KTVE 3O4IA 4XVHA 4IGIA 3KLPX 1T8RA 3E9QA 3D59A 1DKOA 821PA 3PJEA 3REOA 3DE7X 5AW4A 2XGPA 2X2PA 2WJJA 1ZINA 3CR8A 2X13A 2J9FA 4C0ZA 2I9PA 2KSOB 1OZGA 5HMLA 1QBKC 2NT3A 2R85A 5EJ9A 1ZQEA 1XUOA 2AZTA 5IVHA 2K60A 2GN2A 2K2WA 2VF7A 4J9OA 1ULTA 2QDXA 4B2IA 4YECA 1U5BA 4Z4HA 3E7PA 4Z2YA 4HGYA 4Y2PA 4KLFA 3DONA 4F5ZA 3E4DA 2IPMA 2JJMA 4J7UA 4C6TB 4KQXA 1RZRA 1VYTA 3IDSA 2EQ5A 3QPWA 2FZGA 2I8AA 3QVMA 2GRAA 4W63A 1XWLA 4UASA 3CEHA 3IQWA 2CJWA 1HQKA 4BEJA 1UWVA 2C3PA 1TPZA 4CMCA 4BQSA 2EW2A 1JECA 4TYMA 2X40A 1PQPA 1ZOOA 4BRUA 5G2OA 3M9OB 4KVZA 2KJQA 1P0PA 1IB6A 4UPEA 3IILA 5SZIA 4KTQA 3PV8A 3KPUA 4JUAA 4E2WA 1V8PA 2H9YA 2ZRQA 2ZBPA 5E7IA 2HW8A 4ZV4A 5L3SB 3WLTA 2E4YA 5FWXB 1GGEA 2LBPA 1CQPA 1TU4A 2BFFA 5B4TA 3IMEA 1THMA 3DQQA 2QVGA 3O74A 1PWXA 3B7GA 4PNZA 3AP2A 3ZHVA 4CUKA 1SIBE 2G7MC 5JUMA 1WQ3A 1SRRA 4IUCS 1Z00B 1KK2A 1EJ2A 5BYAA 2I4IA 2IIBA 3ZK7A 5AI0A 3IG8A 1QZZA 1RLOA 3MR5A 3CLTC 3BFXA 3NGLA 4HB3A 4JN6B 3B1KA 3TD2A 5L6LB 2HUPA 2VDJA 5DNCA 3H13A 3LXRA 2I80A 5LSAA 3KETA 3L7LA 2YJ3A 1T0BA 1ZD3A 4IOLA 1WSAA 4IJWA 2VCYA 1P2GA 3Q2OA 2EIHA 5EYPA 5J4VA 1ECGA 3MLAA 1D1TA 4CN9A 3BHNA 2CHUA 3MWEB 2O23A 1YE5A 2YX8A 3QHQA 2UZ1A 2O5RA 1QK5A 2AF4C 4KN8A 4S35A 3EC7A 2X41A 5B3JA 4U5XA 4Q3OA 2IE8A 4EG8A 2PY6A 4OHXA 1WUJS 3HP7A 4GECA 2Z43A 3LFUA 4YRMA 4BUZA 4MS3A 3QVLA 3WGVA 3K9CA 3WK6A 1DC4A 1M6VA 4R4JA 1DVRA 2LPEA 2WSLA 4TLBA 2G5TA 4QA9A 3BJYA 3MFHA 4H18A 3DKIA 4EZEA 2A59A 5JAUA 2A88A 3PEEA 4P0PB 4LVOA 4Z0HO 4Y30A 2G1JA 1RQGA 3DC2A 4I5FA 5A3VA 5EHXA 1W85A 2ZTHA 3GRAA 1ICEA 4CF4A 3FWZA 1UWKA 2ZBQA 1GDHA 1HZZA 1AHIA 3OQ1A 2DYKA 5B7NA 2WUGA 5KTPA 1QRRA 3KQVA 1TDJA 4OJKA 5JD6A 3GC6A 1C14A 3GQCA 4ZEMA 1W93A 2E18A 4RNMA 4IH9A 5DYIA 4TKUA 2VPIA 4JJ7A 4WAUA 1ZM4A 9ICTA 2BSXA 1OJLA 4IXDA 2VYQA 2YNMC 1GN9A 5CLFA 2FUG1 1C3OB 4EW2A 4FZ5A 3O2SB 1VMDA 4EJSB 3TPZA 3TRDA 2WHXA 3EFEA 4JK1A 4CTNA 3OQIA 4ENRA 3CVXA 3BCHA 1MJGA 3LUJA 4HFNA 3UUFA 1TV9A 3KQSA 5AJXA 2V58A 1XTVA 1KRWA 4XIJA 2CUNA 4BRSA 1KYZA 3NBMA 3TAUA 2V7VA 4JOQA 2FUCA 4MS4A 4JSTA 4MHSA 3W4JA 2LDBA 2FWIA 4YRRA 2WTXA 3TNDA 2BBSA 3BIJA 4URUR 1FFXB 2PRZA 3NHPA 1P7CA 4F2WA 3EAGA 4Z0NA 1V26A 4REMA 4YP1A 3PEYA 4DCNA 4HJXA 4B7AA 4DL3A 4HADA 3I04A 3JCZA 5B1YA 4HXYA 3MMZA 1LDMA 3JD3A 4Z0PA 4X62B 4RQTA 3L4SO 4CCYB 1ZQFA 4B3TB 5I7OA 4I2EA 1FFBA 3PSTA 1S9DA 1Z9BA 1IMJA 1OFUX 5CDFE 4IHKA 3H65A 3E3OA 5AW2A 3AONB 1KL7A 4BV9A 2OT3B 2DAPA 4MVJH 1QGUA 2GAOA 4NONA 4KAXA 3FBGA 4LF6B 5CFMA 1UOPA 3WIOA 4FYKA 2OGSA 5L9AA 3CSDA 1POWA 1X74A 1JV2B 5KYVA 3BWVA 4R0VA 1LLCA 3RWMB 1S96A 5ITZA 1AKNA 3K94A 2BFNA 5LIRA 1NG1A 2IYSA 4KLCA 3HFJA 3G8CA 4WKOA 2J87A 3Q6IA 1OYYA 2X8JA 2OVFA 2XX3A 1JJFA 2FUG6 1C1DB 4I9UA 2BE9A 1XCLA 4GRIA 2OAGA 2XMDA 2HNBA 2RJNA 2V03A 4JGGA 5IT9A 2QLBA 3CNQS 3T7SA 1SU6A 3DMTA 5JPCA 4IDFA 3WBFA 3KPWA 4ZMRA 3TAHA 1KSGA 4ZT6A 1CHNA 4LZAA 2K8CB 1G6KA 4DJJA 5LA6F 3MTJA 3F98A 4FE7A 2O8DA 1DC3A 4V0KA 1QYIA 2W0MA 4FE3A 4MUIA 3RYHB 1CZHA 2OQRA 2R25B 1ZQIA 4QPNA 4TV8A 3KFXA 1SRQA 1M0EA 1E6MA 1RJWA 1R2QA 1Z83A 1AMNA 1O6ZA 2HHUA 5KKNB 1JEEA 1WVMA 1UXIA 5C34B 2YYZA 4Z0TA 1J25A 3V6JA 2WTAA 4A9AA 4D9FA 4R2IA 2KHVA 3HP1A 4A8JC 4QPZA 2W6JA 2CV0A 3URKA 4NZNA 3ZTYA 3UHJA 5ITWA 2ZWAA 4EHKA 3PHHA 3HEMA 2WHRA 5SZKB 4FGUA 4ECXA 5DLGA 1V5IA 4W1QA 2OO7A 2R7KA 5IJ9B 2V6MA 4MV9A 2YCLA 1KLNA 3P32A 2HR1A 5CCDA 3WL5A 4UZEA 2I2CA 2R84A 1NBME 3K05A 2J30A 3OZCA 4V0QA 3M70A 3H1EA 4MFFA 3BS4A 2ZYGA 4V0SA 1A2KC 3SBDA 1ACLA 3QLUC 5AW9A 3RAJA 2R00A 4M0CA 5A06A 4CL8A 4NICA 3JPPA 1CUZA 4C4PA 2FQ1A 1CUVA 2CLOB 3U7QB 1E1MA 1X86B 2GM4A 1I32A 1NQ5A 1PZMA 2QAGB 5GONB 4U9IS 2ZPAA 3T5GA 2FN8A 4F5PA 1VDVA 4URYR 1GO2A 1DGSA 1G8PA 3ZW7A 3IKLA 4DQVA 3HN7A 2YTZA 4BAGA 4GPTA 1RRPA 2YVAA 2HHAA 4XIYA 3ITNA 4GPEA 4YMVA 3HCDA 4EHDA 3CW2C 1P77A 1V9SA 4AN0A 1WXXA 2V6JA 2H9IA 3VNSA 3HZRA 3ED5A 2Q9AA 4XSVA 5BURA 2N46A 4MR8B 1LWNA 5IEJA 7ICOA 4KFSA 3R9XA 3NTOA 1F7UA 1QC5A 2PSJA 2XZDA 3MBIA 2Y77A 2RG1A 1RLUA 3NDIA 4JASB 2G6TA 4OSPA 2P4UA 1UPXA 4LZLA 3EZ6A 3REQA 1UA1A 4CKXA 3U61B 2KS6A 1G59A 1VI6A 1KE2A 1M1XB 2C9MA 4PICA 1W52X 1FFAA 3AVYA 2CJYA 1HOTA 2O0HA 4QLOA 4C3UA 3MJRA 1TIBA 4WZAA 3H3JA 4R0MA 3N8HA 3R3HA 4B6SA 4RYLA 5G0TA 2B20A 3I4FA 4V1CI 4P84A 9ICVA 4KMMA 3D8UA 1T5TA 3P0HA 4E11A 2VCHA 2VDLB 1ZN9A 4OY3A 2GASA 1E69A 1Z62A 2PU7A 4BAZA 2AR9A 3GP5A 3ROPA 3HWTA 1OGJA 2HQSA 2O2HA 4YQFA 1GPAA 3HT3A 4YMUA 2PE5A 2QL5A 2ZIZA 3AL2A 3DE2X 1CV2A 3ND7A 3JPNA 1JKJB 4FYIA 5J2FA 3GFQA 4Y9RA 3BERA 3DBHA 4M6WB 2I7VA 3VVCA 5LLTA 1RRFA 3HCOA 1N2IA 4FFDA 5J47A 2GCIA 2G4VA 3RW9A 2AU0A 1B3RA 1K7SN 3RYTC 4KGDA 4KLQA 2RCYA 3HHEA 4HS9A 1YZ7A 5AD1A 2ZETA 1MIOA 3MJSA 2EX4A 3C28A 1NMSA 5H9WA 4W5JA 1MEOA 1T5LA 4PZPA 4HNAA 4E1AA 2GAIA 4BWJA 1R88A 4J3NA 3R7SA 1YHYA 4DY4A 5JJBA 1XKQA 2QE6A 5EEGA 4B3GA 3PXXA 1PK1B 1JDSA 1C0KA 2PX2A 3FYHA 4BLSA 1ZU4A 2L17A 3DNFA 4LSZA 4TT8A 4Y6PA 2A2ZA 4F4JA 4DLYA 3B36A 5YASA 1YI1A 3AI2A 1Z5NA 1ZGCA 2JXJA 4YT5A 1JIQA 1W87A 1NBAA 2CFOA 1N2CE 4MV7A 2EKBA 3WMRA 1CUEA 5T3YA 1G20A 3C8UA 4DJ5X 4PCAA 5ALFA 2Y0EA 3S44A 1W75A 1CUKA 5DN6D 1ST3A 3F3SA 2R97A 2WAQF 3Q87B 3AQFA 3WRYA 2BSAA 4X6YA 3PHBE 4EGCB 3OPVA 1GL6A 2VP6A 5L1KA 5CYFA 1JLHA 2QX8A 1E1RA 2ADOA 2YIJA 2PZMA 4BTLA 3GOHA 2Q45A 1S2GA 5FPPA 1PYDA 4XWTA 4Q43A 2ACVA 2PUDA 1UOOA 2GHQA 1SD5A 3DKRA 1AKMA 1UM9B 3LOPA 1EFPB 3CLKA 1JIIA 4HAZA 5CIWA 2BFBB 2PMBA 3TNLA 3H7IA 3WGLA 3GB9A 3I6MA 1P5HA 4EEZA 1YIDA 3RJHA 4O4LF 4Z9BA 4E5DA 4L16A 3IODA 3CYMA 2XI4A 4RXUA 1CUCA 2WUWE 4C76A 1M8KA 1Z68A 5U4XA 3PXCX 4JYAB 5K4LA 2ZEJA 3L41A 2AFIA 2OHGA 4AZSA 4F3CA 4Z5XA 5DXFA 4RAOA 4XPZA 3AX6A 4G4SO 3QU9A 4W9RA 3DOIA 2IZOA 2AQ4A 1NBEA 1Q0SA 2AVDA 3GUCA 4LHSA 2FETA 3HVRA 1F8YA 3UMCA 2EZ8A 5K8IA 3HCWA 5DB4A 1W1UA 1I01A 3M6KA 1N6PA 4H0NA 1MW8X 2Q5HA 4B5KA 2OGTA 2ZTEA 4BNZA 4KNWA 5KU7A 3KKOA 2O8BA 1SGGA 1Q77A 3L82B 1VA4A 4ZYYA 1RHQA 3HJBA 4M86A 4YJ3F 5LDHA 3ROKA 3VPBA 1E94E 1Y8RA 2VJYA 1DBIA 2ZWOA 1SUSA 2EFGA 3LDGA 3RB0A 2PH7A 4WCFC 1SXJC 2J4FA 3BSYA 1KI6A 3KAPA 1X42A 2QN9A 1BMFD 2KBEA 3I37X 3WLPA 1WP4A 3QJ5A 1SK9A 2QSUA 1U1IA 1XTIA 2GCOA 3JAWB 2OECA 4WOPA 3G89A 1AM4D 1TZKA 3EXEA 5KCZA 2DC1A 3BIWA 4LZJA 4XD7A 3LOQA 3UOGA 4QWCA 4DTCA 2W7TA 4E5NA 4MUFA 3RD5A 4OM8A 1Y1QA 4R5MA 2Z3VA 4B75A 1QXSA 3P7MA 4EPWA 3N2YA 5F4ZA 5J2IA 4EYHB 3G8AA 3HJFA 3K1TA 2OUKA 1G9XA 3QW4B 3USCS 4KR9A 1AQUA 4GW3A 5AJUA 4MAFA 3AJDA 1J09A 3BMQA 3BGWA 4B47A 3A32A 3CVUA 3BIFA 4FZRA 5FFMA 1SG6A 3HA7A 2XCTB 5KHOC 3TQCA 3O82A 4DLGA 2QYSA 1QSYA 4C3OB 4NV3A 2YUTA 4PPNA 3ILXA 5FA8A 1OFIA 1XF9A 3LX8A 5HFJA 3AVQA 1ESEA 2NUBA 2FX2A 1DKMA 2XRYA 1NQUA 3DJYA 2ZT5A 2P6RA 1YOBA 3DZHA 1JLRA 3HXMA 3QOFA 4JL6A 1D9FA 3ZZTA 2W43A 4C7KA 1TQHA 4B6JA 4ZVUA 3KJQA 5EWFA 2AD5A 2RGCA 5C5JA 1W46A 5TS3A 5I51A 4KNVA 3QVGB 1UANA 3X44A 4J0QA 3K9WA 2DKOA 3U9LA 1PP4A 1DIHA 4ZT2A 4D4GA 3IUPA 1BO6A 1ZQUA 1ENPA 3O5AA 4HDNA 3SEQA 4ZKEA 3N2ZB 2ONYA 5IC5A 1Z4JA 5ITSA 4RF4A 5FPSA 4PSAA 1MJHA 3G9QA 4DZRA 4IZ6A 4DDMA 1O9HA 4X97A 2OG1A 3D5EA 1JHVA 2MA1A 1M10A 1GD1O 5L53A 1B6SA 1H2EA 3A14A 2AR0A 4LCJA 2XT9A 2VDWB 1KFTA 2A3NA 5LYJB 5ICGA 3V6MA 2P6UA 3KHUA 2R3SA 4Y0NA 3GWGA 1L8OA 1XE3A 1FVHA 3CYFA 4MB2A 1GTRA 1DIOB 1NMQA 4EHAA 5KMGB 1BA2A 3ZNQA 1ENZA 3DFKA 3PMLA 1U1DA 3KKPA 4XUCA 1RD4A 2B1RA 1YR3A 3DM9B 3V4VB 1ZVMA 4Q39A 4L3OA 3CKMA 4DQDA 1ZJYA 4G8DA 3L7KA 1M2OB 2CEAA 1WP9A 1KQQA 4PAOA 4PPQA 1OILA 3FWPA 2NTEA 3PNSA 3NEYA 1E3DA 3MB5A 2IXAA 4ZKDA 3KHRA 2VTBB 3OMXA 1Q16A 3RODA 4TWZA 3CKYA 5EHZA 3HO8A 1M74A 2YZ2A 1WMDA 1YZGA 1MO5A 4QBTA 3EGCA 5AKZA 1HE2A 2XDWA 3RT7A 4DQLA 4IDQA 4B34A 2B1IA 2ZJ5A 4YRTA 4PYNA 1KAMA 2PVCA 3L5KA 2JNWA 1UODA 1GOTA 2VL7A 2JAQA 4UAVA 2NADA 2ZRBA 4LYEA 3OCWA 3IBCA 3LXXA 2KFNA 4J94A 5E4JA 3R20A 4PLGA 3E84A 1UBJS 4ZHQF 4GOMD 2JHPA 2KX7A 4DJAA 1JAHA 1EFLA 3AF6A 3LQYA 3SWWA 4EQ6B 3Q8MA 2EP7A 5B1DA 5EQDA 2Y99A 4P58A 1A9OA 2E4AA 1KDTA 3NWJA 2C20A 3U39A 1KJJA 1LF5A 1P33A 3M6VA 1NP6A 1TKBA 1GTMA 3KO8A 2KVSA 1VB3A 3K0CC 5AVQA 3EFOB 3ZJ4A 2OEPA 1SY7A 1AOXA 1QB7A 2QJRA 2HDWA 2ECKA 4FS8A 2PA0A 1Z34A 3OPYI 2R6ZA 1H4QA 3KQTA 5AT1A 4R41A 4LZOA 3W5AA 3ELDA 1ZH8A 3ABRB 2Y93A 1HT1E 5T5QA 2OCPA 3FSGA 3EPJA 4DJEC 3P2JA 3C29A 1XJCA 3BWDD 4BVKA 3LF2A 1T0UA 2F64A 1D6SA 3RUHA 4E6EA 1K3UB 2VP4A 3VH1A 3ZXUB 4UMFA 2JL1A 2XDAA 2MYTA 4P53A 4YI5A 4K0RA 1ZNXA 2JMGA 4OBWA 4WGGA 1H8EA 3JW8A 3AB7A 2Q6TA 2GYVA 3SQXA 2XBLA 4Q9NA 1R0KA 2LM1A 3NV9A 3G0IA 1E3WB 2VJMA 2XMRA 5SV2A 2P9BA 4QIWC 4FILA 3O3OB 3V6KA 4IGKA 1BH2A 2R4UA 4J2HA 1N0IA 1Z74A 4B5LA 1X39A 2FUKA 4F84A 4MXDA 1XELA 5JDCC 2BFAA 5CB0A 621PA 4RMIA 4YN4A 4QC2A 1SG9A 3NG1A 2R2AA 3QNUA 2C5LA 1DBQA 2BKEA 3A0RB 1E98A 1D8BA 4YRDA 5FX2A 2FN9A 4GO1A 1GUAA 2B34A 3RRYA 3IGFA 2NTVA 2R18A 1XD9A 1E4VA 4R54A 5KFSA 1QP0A 4DV4B 4GVXA 3WQHA 3AVOA 4I4TA 3GA0A 2IY8A 5FUBA 1H3EA 2HBMA 3HDGA 5IM4A 4Y2SA 3DPIA 3NJ8A 2MSNA 1QIEA 1DPFA 4Z1OA 2BUCA 3QPVA 3L7MA 3MGBA 1TTHA 5K99A 3RJTA 2X0KA 1ULUA 3Q0IA 2ZYIA 4AMZA 1TRKA 4NBRA 1W88A 3PGMA 4F12A 3GW8A 5K01A 1YQUA 4KQGA 3M4ZA 4DOBA 1ZM3A 4X3PA 4IX1A 3C5FA 1S8FA 4TZ6A 1Z0JA 4BVHA 3LLUA 1A9SA 1KFSA 1PKXA 1N6RA 5HF8A 4DA8A 1MHTA 3K1RB 2WP8J 3IBSA 2DFNA 4L4YA 3V32A 4C2BA 3RTDA 2V54A 4R2WA 1KTVA 3MWDA 3S2ZA 1P5RA 3ESBA 3ZNNA 1AIPA 5JE8A 4QM6A 2BM0A 1U48A 1JFTA 1M5UA 2BKXA 1FJGB 8ICCA 4RFLA 3B48A 2ATIA 5ALEA 4PG7A 2FEAA 1M0SA 1YDGA 3AFGA 3ZC3A 4P1ZA 3DT9A 2PWYA 3GGPA 1LEHA 1JDVA 2XKJE 2BDTA 3ZQJA 4DGQA 3IA7A 4DB2A 3KEMA 1E63A 1HLGA 3W34A 4LXTA 5TS2A 2P3QA 3FG9A 1QQ5A 1WMSA 1PEAA 5J0TA 4K6CA 4GDMA 2PBLA 1RAHA 2WRZA 2B3TA 2HA7A 3PKIA 3RFUA 1MOZA 1R9MA 2RI0A 1ZW6A 3FHJA 1ZQJA 1ZHOA 2H31A 2IUSA 1EP1B 5L7YA 2C2EA 4Z9AA 1OTHA 4NM2A 1LSSA 1TK9A 4OGWA 3WKAA 3AF1A 4UUNA 3T06B 2ZDQA 9ABPA 2XBMA 4NBVA 2AFHB 4EYQA 2F90A 2G82A 5TEVA 2XW6A 4PIMA 3KT8A 1LBIA 4I5EA 4IAOA 3KX2A 2JAXA 3QKRA 2N1RA 3VNRA 3TTTA 3PZPA 3KCQA 5ERYA 2ZJFA 1CU1A 3K8QA 4MGZR 4Q45A 2NO6A 3HK2A 3AETA 1DCMA 1JYFA 3DLTA 4RT3A 6CHYA 1ISJA 4Z7QB 2AL7A 4IYRA 2EBWA 3WDSA 3NP9A 1B2LA 2R8EA 2EP5A 4R1LA 4IHQA 1C50A 2WIKA 1CLEA 1H2BA 4CIVA 4HBGA 2E6KA 2CVPA 1DIBA 5ED0A 3UMGA 3U7EB 2UYHA 3K5HA 2XE8A 3IUNA 1YK1A 2IZ5A 2XI9A 3QHAA 2Z58A 1IDN1 3FKSA 2IYOA 4TMZA 1E2PA 2WA1A 3TSYA 1XJQA 5HBGA 5K3OA 2ZJZA 4WDQA 4RY2A 3OJWA 3OESA 4FBMA 2IEAA 3TW4A 2P2ZA 5ILOA 4BB5A 4V0NA 2VYVA 1SELA 5LB2A 1H6BA 1MGPA 3IEIA 2C59A 3H5OA 2I0FA 1YRQA 1K89A 1VI5A 3I01A 3SV3A 2JHDA 3HQ4O 3NRCA 3NT5A 4RV9A 4L0QA 3KHTA 4HWGA 5HS6A 3H75A 9ICUA 2G36A 3T3MB 3GJ8A 1XPJA 5HM8A 3FLMA 2AWOA 3PNPA 4R6WA 5CLLA 1J0AA 3HDQA 3C5WP 4M8KA 3MOGA 4RHFA 4N8SA 4KGXA 4OUDB 1IU9A 4BP3A 1TMOA 4A23A 2I67A 4M7PA 3WXMA 4OKNA 3ZQ4A 1AUVA 2QYHA 1WLSA 2XDQA 2ZYSA 3FHOA 1V37A 1BEEA 3W5SA 4ARUA 3JR7A 1HYEA 1Z4NA 4E3WA 1SKYE 5KFKA 4HDMB 3BTUA 4L75A 5AMXA 5KVSA 4BNWA 1C9EA 5F2OA 5DBCA 5H02A 2A6PA 5LQRA 2I5PO 4OJTA 3CE6A 1USWA 3LHKA 3TK1A 4M9SA 2O5EA 1O97C 1VHLA 2X15A 5FEMA 4EY3A 4ZYLA 1L0BA 2RBEA 1GGHA 3HKZC 4GBJA 4D9EA 4RQMA 3PSFA 4GS5A 4OU4A 2JJ1D 3WLMA 3NQ41 1MPXA 1V1JA 1Z4OA 3ZBPA 1R16A 9ICXA 5REQA 3PNCA 1TNDA 2YTUA 2JBHA 3MFIA 2GEFA 1BD3A 5CRIA 4A6EA 3WIVA 1ORIA 3TB4A 3DZBA 3I0NA 3M4NA 5CFRA 3LLCA 4RIIA 2QRHA 3ZX4A 2XIJA 5CD9A 4FOLA 1TLFA 2IP2A 1YMVA 3HEBA 4KI7A 1OWPA 2ZRIA 3ITEA 3L92A 3K0AA 3TN7A 1Q7BA 4IQ8A 2KHQA 1LK5A 3PCXA 3VPDA 4XIGS 1FRQA 1XLVA 3RVRA 1QG0A 3F47A 3TOSA 4I9NA 4X54A 1P5JA 1KVQA 3N58A 3GQVA 4JITA 2FK7A 4HDRA 4BMDA 3OF3A 3M34A 5J2JA 2P3LA 3HABA 1CFJA 2WFAA 2FLPA 3FVQA 4D9NA 3PFNA 4ISCA 1ZK3A 3RANA 4J2OA 2SCUA 5HKOA 5BW6B 7REQA 3K9BA 5EZYF 3OZVA 3ZE6A 1UFKA 3A9TA 4I28A 3QBEA 9LDTA 2H3EA 3R77A 4I1VA 4R64A 2J7PA 4PIVA 1E1LA 5BUQA 4J2TA 3M83A 4EI7A 2XGQA 1TM2A 1ZC3A 2EBUA 3QMMA 3HCAA 4CT5A 5LQMA 1JA9A 4H6XA 9ICSA 2X86A 4D44A 4ARCA 4UW9A 5FNVB 4NAUA 2V9WA 1MV5A 2DUJA 2PWPA 1JLLA 4DB4A 5JANA 1U0TA 4PO8A 2FEXA 2NU8B 2VBIA 3JVEA 4GLFA 4N5DA 5BNTA 2ORYA 3I9V1 4GSLA 4P4SA 5LN1A 5IJ0B 4LDQA 2AX3A 1B8NA 1LVHA 4YQEA 4J43A 3RE1A 1HE4A 2JFOA 4ZCTA 4IWXA 1NVDA 4IQUA 3BXGA 5KYYA 2Q4DA 1ULHA 3AINA 2IITA 3M82A 4CF5A 2LCQA 1TU3A 6ABPA 4TSKA 1NAHA 4NY1A 2C95A 4YRAA 1GQFA 3CPSA 1VMAA 3EDQA 2BPGA 1KR5A 1XSEA 3L6BA 5B3JC 1RFGE 4BQOA 2F67A 2P9ZA 2DR2A 4KJXA 2GEJA 3DVQX 5JJLA 2WJAA 1SVIA 4MW6A 5JAZA 4A2WA 3W8FA 5HR6A 1RI3A 2P5YA 1G5RA 4WT7A 1J39A 4UCXA 3UMSA 1NN0A 8GPBA 2C9OA 4U8GA 2HIAA 1XXHB 1C20A 1RHJA 4DEXA 1FDVA 2Q5OA 1XROA 1QGED 2BCJQ 2J5RA 5TT1A 2AGVA 4AKHA 4JROA 4N03A 1HL7A 3IEUA 2D2IA 2CNWA 1W9MA 2EX0A 2FWJA 4M0AA 1FPMA 2XXAA 3BVPA 1HZZC 3ZHQA 4CKBA 2AXTU 3MTQA 4MMXB 1KO7A 4I55B 2GM5A 1M73E 1IH8A 1WXIA 2XNJA 3NRWA 2HCRA 3O84A 1TIKA 2W22A 2C8VA 3THWB 2CHVA 1FS6A 1B74A 5F51A 1WA5A 1U0LA 2YOFA 4G26A 2QZJA 3I9V6 1CHDA 2JD2A 4DHWA 3NB0A 3F5FA 2A19A 4MEBA 4DBLE 4TTIA 5H2FU 1TJ3A 4MVYA 3V3KA 5FXMA 1XZBA 4MRSA 3NRJA 4JVMA 4NDZA 2O2JA 4Q00A 4OJPA 4PN3A 1KA9H 2VUIB 5KFUA 2P1DA 2HDNB 3UKJA 3NHAA 1ZY2A 2BN4A 4DQKA 3PHJA 3ZE1B 1CY2A 1XB2A 3ZGYA 1QG2A 5JAHA 2AYZA 3ZKWB 4C7OB 2XNHA 3G5MA 5KI6A 2PXXA 3HVUA 4IOKA 4X45A 4D9BA 2YXNA 5A0VA 1DC6A 1HNZB 4IS7A 1CE8B 4GZ5A 5DBGA 4L78A 2DX7A 3KZNA 3PVSA 4D2IA 3ANLA 4BNKA 5DLDA 1CPYA 4XQ0A 4QODA 4AY5A 3PS9A 3K9FC 3S2YA 1KKLA 3PR4A 1Z7GA 3DDCA 1W2GA 2FKNA 3U3MA 4F3OA 1M5TA 4RIGA 3M5WA 3AERA 3ER8A 1D8LA 3GEIA 2X77A 4F72A 2FX3A 1PVPA 4B3SB 4LKRA 3EZNA 2MSEB 4X85A 3DVRX 4EHHA 5AOBA 5DM70 4MW4A 2CZCA 5F2KA 3ESRA 4DUZB 3WHLA 2KBFA 5JXWA 3ZWAA 1FJHA 1FVXA 3L6OO 4WBNB 1UCVA 5K7SA 4X00A 1Z0SA 1PSZA 2ODQA 1FFHA 4QJ5A 3PF9A 4C7BA 4DV3B 1PJLA 2AYXA 4IPTA 3QTTA 4UFNA 1OIXA 3RVDA 4ENUA 5CFPA 8ICQA 1E5VA 2UYQA 2ATLA 2J3KA 2J7KA 4XUEA 2QROA 3OJSA 3SF8B 4YP0A 4NG4A 4WFKA 1YK0A 5JNLA 1H0KA 4I8XA 4KXWA 4JUDX 5MN6A 1OXVA 2FQWA 2JCGA 1H5QA 1UUFA 4N5MA 3KYDB 3PPXA 4I0WB 3E8XA 1X1AA 4G84A 2Z95A 4F2DA 5KAMA 4CMIB 1XCJA 3KV3O 1TJ4A 1V16A 4X8LA 5JCJA 3DMTC 3ORQA 2OKCA 1N2EA 3VJKA 3H6GA 1PT5A 2XNCA 1VLHA 2RKWA 4S1WA 5FL7A 5DGBA 3U4QB 4X1OA 4X1KB 4X90A 4JLKA 3JWHA 2IHUA 1ZNWA 1JZQA 3LW8A 2G4CA 3DYBA 3QE3A 3HWSA 3NS1A 3AVWA 4CLOA 4AKGA 1Z5OA 4JELA 2ON6A 1UKEA 4AJOA 1LK7A 4UEJA 2O4CA 3RR2A 2QT0A 3DZKA 3OHPA 4P83A 2P7HA 4YRZA 2NV2B 4XLZA 4AIIA 1V6AA 2G5GX 2WQZA 3EISA 2BZGA 3JALB 3RS2A 1FP4A 4D6XA 1DJMA 4IRMA 3F0TA 4OD0A 5FBQB 3T54A 2J59A 5HNKA 3OZRA 4K9MA 3RS0A 2OP0A 4CQMB 1ES9A 4MIEA 5HRAA 4CMHA 1XIVA 4F5NA 1H65A 5ARBA 4C2UA 4BJ1A 2PUVA 2XCQA 2H8GA 3QLJA 3DTVD 2HRQA 4GLXA 4IC9A 3NIBA 3WLSA 2C2GA 4W5HA 5BR1A 2VA2A 5BOVA 4I1UA 5L1JA 2CJXA 2R00C 4IJ5A 3LOUA 4OQPA 4KLDA 3F3MA 3UV7A 3G8YA 3A6ZA 3CUKA 2JH3A 2VSXA 3EQ6A 2O3JA 1MTOA 3FNFA 3VSAA 5AUOB 1DJLA 4BFLA 3EWAA 1YI0A 1JF8A 2HI0A 2GJSA 1Y1PA 1AN9A 1ZNZA 2QVCA 1LJ8A 2EJWA 4GI7A 2B37A 2Q0HA 1SV0A 1TUIA 5H5JA 5KFDA 2GYUA 1JHXA 2WWRA 2YWEA 2ASLA 4RESA 2W11A 4O2RA 2ZI9A 2X7XA 1JKIA 2QDKA 1CDOA 4P2GA 1TMYA 4M22A 3DB1A 3WYNA 4TQ9A 5JQGF 3DAPA 3DEHA 1X8JA 1EUCB 4QL3A 2I9KA 2UYCA 5KYKA 1ITZA 3RS3A 4NIMA 4UNPA 4ASUD 2VZEA 4DADA 4J9NA 3STTA 1SAYA 3L7BA 5CG1A 3QOXA 1UT5A 1XEXB 3KE8A 1E20A 1K08A 3B78A 1T8TA 1TGYA 2HH9A 3WP0A 3T1NA 3CLUC 1YKGA 4QZEA 3QP9A 1PI3A 3P26A 4KE6A 3W2GA 3AESA 1QK3A 2HMWA 5DM60 3NAZA 4RETA 4KSYA 3D3WA 1GITA 1DAMA 2C5AA 4GP9A 3CJQA 5GADl 1E3IA 3TBFA 3C2LA 2DKNA 4WASA 1VSBA 1IWPB 3GUZA 5BN3B 1K6EA 5HDQA 4OJQA 1QAOA 1PW7A 1KVSA 4UFPA 3GVHA 2JGDB 1LTQA 5F9HA 4HK4A 5CFLA 3MCTA 1TB4A 4XXHA 1CS4C 1I14A 1MB9A 3V6LA 2VCEA 4ELVA 4NBTA 4N01A 4G1UC 3EIWA 2PFGA 1UL1X 1CJKC 1KTQA 1KAQA 1X6IA 2JFYA 4PV7A 4OH1A 2XTMA 1XEFA 3NWPA 4A92A 3O4RA 4ZICA 3OHAA 2QB1A<