2VKQA

Crystal structure of human cytosolic 5'-nucleotidase iii (cn-iii, nt5c3) in complex with beryllium trifluoride
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'- Nucleotidase III
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2vkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2vkqA01
2FPXA 2O9JA 3QU2A 4ZEXA 3ZX4A 5ALFA 4UM5A 1TE2A 3E84A 3ET5A 4L6AA 2G06A 3L8HA 4KX5A 5ALLA 3WKEA 3M9LA 1QQ7A 4Y2RA 2QLTA 2ZOSA 4YH1A 4BNDA 5AVVA 3S6JA 3RF6A 2B30A 3ET4A 4KX3A 2HOQA 1L8OA 1Z4NA 3U7FB 1L7MA 1LVHA 2PQ0A 1VJ5A 3WK6A 3I28A 1U2TA 5AVRA 2FUCA 3FZQA 5AKZA 1LTQA 2I7DA 4Y2VA 3FGOA 4G9BA 5AVZA 3W5CA 3MMZA 4Y2XA 4C4SA 4BEWA 2YFYA 2I34A 5AK5A 1WVIA 4EX7A 2B1QA 5AKJA 1WZCA 4UU0A 1XVIA 3OCWA 3EWIA 1QH9A 3DDHA 3P96A 5ALDA 5AM3A 1L6RA 1Y8AA 3WK5A 2RB5A 2I54A 5A3QA 2I55A 3QGMA 4CF3A 2HDOA 3ZI4A 3WK4A 3F9RA 1RQNA 3WKBA 3WGUA 2EATA 4HGNA 3SMVA 4EX6A 2WF8A 5AVQA 5AM5A 5ALWA 2P9JA 3QX7A 3AR4A 4KN8A 4Y2QA 1RRCA 1F5SA 4XPZA 5AW2A 3AR8A 5ALIA 2FDRA 3ESQA 3B9BA 4UMEA 2FPUA 4RESA 4BNDB 1ZD2P 4YGYA 1VFPA 4UATA 1RMYA 3A1CA 2JAOA 1AQ6A 1FEZA 5ALOA 4AP9A 5AKLA 3WGVA 2VKQA 3BA6A 2GHQA 4E88A 4IFTA 3I76A 4BEVA 1SWWA 2G0AA 3N5KA 4G63A 1RMTA 5AW4A 5ALYA 3W5DA 4I9GA 4HGQA 4EZEA 1RLTA 2QYHA 1YV9A 2AGVA 4OCZA 2C8LA 3IRUA 3AR9A 1Z4LA 5AVXA 3WK8A 2WM8A 1J97A 2R8YA 1WPGA 2IOFA 3AR6A 4JB3A 3SD7A 5AW3A 1NNLA 2YMLA 5AKIA 4L57A 3ONNA 3L8FA 4CF4A 4NWIA 1RPZA 2ZBFA 2OA0A 1T5SA 2HI0A 1RDFA 3QU5A 4OHFA 3UMCA 4H1WA 5ALVA 4J2TA 2W43A 3NUQA 4BX2A 3SF0A 3KBBA 4F71A 2HF7A 1WR8A 5AVUA 1ZOLA 3N07A 4NAVA 3FPBA 5AW5A 1O03A 3FM9A 2FUEA 1L7PA 3WK9A 4I9FA 5AI8A 1Z4OA 2CN1A 2ZBEA 4UASA 4UMVA 3L8GA 5AM0A 3WKCA 2O2XA 4Y2JA 4UARA 1YJ5A 3L5KA 2EARA 3PCTA 2P11A 3QYPA 5ALTA 3SLRA 5ALUA 3QNMA 5ALNA 2PR7A 4HGOA 3EPRA 3QUBA 4PNHA 2BDEA 4HGPA 5ALPA 2ZBDA 1YMQA 4BX3A 1J8DA 3N1UA 2MU1A 2YY6A 2WHEA 5AIAA 5AKHA 3VAYA 3PGVA 3ZUPA 1N8NA 3PGLA 2HF2A 3KZXA 3EF0A 2BDUA 2X4DA 3OCZA 5AM2A 1RMQA 2D2VA 1ZD3A 5AI6A 5AI4A 3OTQA 3L8EA 1Z5UA 2OM6A 2AH5A 1VJRA 2YJ4A 1Z5GA 1RLOA 3HLTA 2CFTA 4OFZA 4DW8A 3QUCA 4HYTA 3QXGA 3B9RA 2RARA 4Y2TA 3ZVMA 2G07A 5IT0A 3QLEA 2I33A 5AW9A 2HCFA 3W5BA 4FYPA 4OD0A 3EF1A 3E81A 2FPWA 1RLMA 2P69A 1QQ5A 1ZD5A 3BWVA 3PDWA 1N9KA 4Y2UA 3DV9A 4ZEWA 4GIBA 3SKYA 2PKEA 1RKUA 2Q4RA 3L1VA 4DWOA 1TJ5A 4UMFA 3SHQA 5ALKA 5AW8A 4FE3A 4XE5A 5AIBA 3L1UA 4BBJA 5JJBA 4L6CA 3QU9A 2RBKA 3IJ5A 5AVWA 2HSZA 3DNPA 1L7OA 4MUMA 3CNHA 5AW6A 1ZJJA 2B1RA 3ESRA 1T5TA 4C4TA 3ZVNA 3U7HB 3NALA 1SU4A 5AKGA 1Z4PX 3U26A 1QYIA 4J03A 1ZRNA 2EAUA 5ALEA 4F72A 4AS3A 4IG4A 4B6JA 2YMQA 3OCUA 2B0CA 1TJ3A 1L7NA 3R09A 4O8CA 5AM1A 1TJ4A 2NYVA 4AS2A 4EEKA 1Z4MA 5AW7A 2NO4A 3R9KA 4KNWA 2NO5A 3QUTA 4GXTA 3ED5A 4HGRA 4JDPA 3ZX5A 3OCXA 2HX1A 5IT4A 4RETA 3A3YA 1L8LA 1MH9A 2GHTA 5AK6A 4QJBA 3L7YA 4KNVA 3KD3A 3ZWDA 4Y3UA 1YS9A 1NRWA 1PW5A 4C4RA 3OPXA 3A1EA 4UAUA 5AKKA 5ALXA 3ZU6A 2WF7A 2YBDA 3N28A 2YJ5A 3E8MA 2YMPA 1U2SA 5ALZA 2WF6A 3NRJA 1EK1A 2B8EA 4UAVA 4EELA 2CFSA 3AR7A 3U13A 2FI1A 2JAUA 2JARA 1IWOA 2G1AA 2AMYA 1ZD4A 3RFUA 2WFAA 1RKQA 2BY4A 2G08A 5AK3A 4DCCA 3U7EB 3NASA 2CFRA 4NFLA 5AI5A 5AHXA 4NV0A 1T9ZA 2IOFK 2GMWA 1Z88A 3L0CA 4UM7A 3WKDA 3SKXA 1Z4QA 3W5AA 3TLMA 2HO4A 4CE6A 1NF2A 3I1YA 1XPJA 4XOUA 3U7GA 4YCLA 2C88A 4Y2SA 4BYGA 3CZ4A 4UU1A 2IA5A 4YIKA 5AVSA 2R8XA 4BX0A 2WF9A 2HEGA 5IS2A 5AVYA 1RQLA 3DAOA 1O08A 3KOOA 4ZEVA 5AKXA 5AK4A 2WF5A 4CNQA 2FPSA 2G09A 3AR5A 4YIHA 4Y2PA 1S2OA 3UM9A 2DQSA 3MN1A 3ZTWA 3J7TA 2FEAA 5A3SA 3KC2A 3WKAA 3WK7A 2JAWA 3ZVLA 1Q91A 1ZRMA 2FPRA 1K1EA 1ZS9A 1SWVA 3QU7A 1CQZA 4MWOA 4KYTA 3IB6A 3I6BA 4DFDA 3UMBA 1RKVA 1U7PA 3ZWKA 3A1DA 4FFDA 4XQ0A 4Y2YA 5AKEA 3KDPA 2YJ3A 2AUTA 5ALSA 3AR3A 1JUDA 1YDFA 3MPOA 3MC1A 5ALGA 2Q5EA 5AI0A 2GFHA 3OCVA 4EENA 5ALQA 5ALRA 4BKMA 1Z4KA 3ZW7A 3AR2A 3L0YA 1Z4IA 4QQFA 2GO7A 2B82A 3NIWA 5AM4A 3QUQA 5ALJA 1X42A 1CR6A 1U7OA 1XP5A 4YCNA 1EK2A 4CF5A 2I6XA 2R8ZA 3M1YA 2ZG6A 5T41A 3D6JA 1RC8A 2R8EA 2RAVA 5ALHA 2OYCA 1TA0A 4HAIA 3HYCA 1KYTA 3R4CA 1Z4JA 2P27A 2YN4A 2ZBGA 1QQ6A 5AESA 3ZTYA 1YNSA 3FVVA 2YJ6A 4UW9A 5AICA 5A3RA 5AVTA 2W11A 2ZXEA 3U19A 2Q4TA 2ODAA 2G80A 5AKYA 2YMMA 4YCMA 5ALMA 3E58A 1U02A 2OBBA 3L0BA 2C9MA 3K1ZA 2C4NA 2MSNA 3N8GA 3FPSA 1Q92A 2JGAA 5AW0A 2IYEA 5AW1A 3NAMA 2HHLA 3GYGA 1S8OA 3UMGA 3OCYA 4UMDA 5E0OA 2B8JA 5AI9A 5FP0A 3NANA 2IOHA 2W4MA 4NABA 2C8KA 3QU4A 3B8EA
chains in the Genus database with same CATH superfamily
3MJHA 5LB2A 5A04A 1AS2A 3M1IA 2P1ZA 1P7PA 1T9CA 2B7CA 1VRVA 4EDHA 3SFZA 4OQ4A 1K86A 1PJSA 1Q20A 2RI1A 4F8RA 5JH7F 1S10A 3HYLA 4NDAA 3ZDQA 1JJFA 1V8DA 3IN5A 4LFBB 1NVTA 5L3QA 3FC4A 1M2VA 4MWEA 2VHVA 4M86A 4MH0R 3H8MA 4PXYA 4X9XA 1RQPA 4TUQA 4OEHA 4IJMA 3HV0A 3BRWA 2PL5A 3ASUA 1LEHA 3CN7A 4W8HA 2PKQP 2ZCUA 1PQYA 1QIIA 4MEJA 3MA0A 3KRTA 5FPPA 2CWDA 1T2AA 5LLDA 4PBSA 4AC9A 1ZSVA 1EK6A 1NKCA 1L8XA 3AOEA 1KOLA 1VSBA 5EKUA 1ZMXA 3C16C 4B3IA 3I04M 5DBFA 1Y88A 4BMVA 2H65A 4C4XA 4S3MA 3WWYA 1HTWA 3IA2A 2DB3A 4QFDA 3BXFA 1CR2A 3NDRA 5B6PA 3K09C 5DFAA 5TR9A 4XUEA 1XDWA 2ZJBA 1W49A 4M76B 2HPHA 2QEQA 3GUVA 1G64A 1EP2B 1EK5A 3HABA 1EA7A 3L6OO 3D8BA 3P4XA 3TIVA 3E61A 3L41A 3EAQA 2PG3A 1LZLA 2ARKA 2GR9A 3KCQA 2HMYB 4C7XA 3HVJA 4Y9SA 1UL1X 3I6QA 2B94A 5EE9A 2XE8A 3E15A 3FOWA 2ZK7A 4DUZB 4FYPA 1YHZA 4NCKA 1IG3A 4G09A 3FKSA 4BFUA 4KLJA 3NATA 3DCIA 4RY9A 2D1FA 4PSCA 2CDBA 4WAUA 2ES4A 3VR4A 2W4IA 2EKLA 2JB9A 1P3JA 1Z17A 3FOBA 3JQGB 5T3UA 3EC1A 4YRLA 3U4QB 3FD8A 2BHNA 2D13A 1W5SA 2Q5FA 1OLUB 4Q3NA 3CXRA 2AG8A 2GILA 3NIFB 2E8NA 3HVUA 3B20A 1T94A 5J2CA 4JDPA 1BDIA 1Z13A 3FX2A 2E3JA 1C9JA 1Z6XA 1W7AA 2X8WA 1YIDA 2JCYA 2V7VA 2NO9A 1AS3A 3HCBA 3EPKA 1YB4A 3RSOA 3ETNA 5J2FA 3QPBA 3U2QA 4RPZA 1E66A 1G5PA 1TT5A 3RO7A 2X0NA 3LT4A 4GKBA 1L4LA 1XZNA 3CNNA 1M6WA 4A03A 1QORA 1XTJA 1SKMA 2AEEA 1KBUA 4K9KA 3MR6A 3RFTA 2OZLB 2HBMA 3CZ4A 4MVWA 3I30X 3M6LA 4MAFA 5CMLA 5L7YA 2X5KO 3JQCA 2VDOB 4DRXA 3D2SA 4DLPA 2FPSA 3ESAA 1VL2A 3HJAA 1MRZA 4ESVA 4OX9Y 2PMWB 2QTFA 5EQDA 2O5EA 3VC8A 1QF9A 2XMCA 1CDOA 1SZPA 3SQIA 1UFKA 5CNMA 1IN8A 2WD9A 5HK9A 1GDDA 1GGFA 4G24A 4TUYB 1FO4A 3LBIA 4GRDA 2X9GA 4HH1A 3UJCA 1PEKE 3NX4A 1JKXA 4F5YA 2IH4A 1HT0A 1XVVA 3VBCA 2GCOA 4NDZA 2XECA 3HBNA 1K68A 3X2EA 1VCMA 2JFOA 1TVCA 3BD7A 1CU1A 4ND8A 4UC0A 1VI6A 5AESA 3DW3X 1E1QD 3OX3A 1ECJA 2H0AA 3KJFA 2VDWB 3C3AA 1VHWA 5J2UA 3ZWOA 3CYFA 5E6SB 4P32A 4UUNA 3D8NA 4QKQA 3M2TA 4U7HA 4HGZA 3WQSB 3ZBQA 4QZ8A 4ZCRA 1I1HA 1PS9A 2ZUCA 5AFSA 4YT5A 4Y2RA 1BGVA 5DYIA 1HMPA 2OAGA 1PFKA 3T1VA 4A0QA 3HXMA 1KU6A 4FZVA 2XCPA 1LWOA 3ENZA 3M6ZA 4R4JA 1NVFA 2GO1A 1NXVA 3SX4A 2L5YA 4WFKA 1P8AA 4JBLA 1K4MA 4QPCA 2XXAA 1Z2DA 2BR3A 2Z6UA 3HKCA 4G1MB 4CMIB 3WIBA 2DLCX 5TEVA 3P8ZA 4MUBA 1RRCA 2F2AB 1TW2A 3ISJA 4DEVA 3PX7A 3RUAA 1WEKA 1XN1A 3PUXA 3V2IA 2FFAA 5A06A 5FWAA 4RQ5A 1RZTA 4BQEA 3B48A 2Z5FA 3GZTB 4ETIA 1RAAA 4RY2A 3IAM1 4M0MA 4C08A 3K6SB 2GLTA 3QKTA 4M1KA 4DUGA 1CDZA 1SCAA 3NIGB 1NBMD 4F5DA 2Q2NA 3NHKA 3H6HA 1FLVA 4RA9A 4C9BA 1GCGA 5L1KA 1WKCA 3FHJA 2REQA 2BYTA 2IXTA 2W98A 3BXPA 3QUBA 2VT7A 5TPWA 2C7OA 4BO5A 3WYCA 4TL9A 3TPCA 1FP1D 3NTOA 2PCJA 4TMZA 4UQOA 2POCA 2ID4A 4DB4A 4DLLA 1ZQ9A 2A84A 3UKOA 4J43A 3ML1A 4QEKA 1ZNYA 4UBLA 1X9WA 1E3WA 4B79A 4AZTA 4IWNA 1GNPA 2MYNA 3TRFA 4ISCA 3A6GA 9ICNA 1EU1A 4HO1X 3H5NA 3G5TA 3JATA 5J2JA 3CIOA 1ZEMA 1SU7A 2O50A 1GSOA 3T5PA 5A5DA 4R71A 2HN9A 7ICOA 3IALA 2G9QA 4LE0A 3QFTA 2BHLA 3SIWA 4C5BA 2X1VA 3PE6A 1EFRA 4DLUA 1L7OA 1P2FA 4DYVA 1S0OA 2YZMA 2GF0A 5HPYB 3DO8A 2Y1OA 5DNCA 3STXA 2UUOA 2XITA 4NZZA 2FLNA 5CT6A 2VWHA 1VMIA 5BUZA 1SQGA 2V5UA 1J0CA 2O4CA 4I2VA 3BCSA 3D43A 1BJRE 3W34A 1EZZA 4GLOA 3E22B 2X23A 4TV8A 2PCLA 2F59A 1AA9A 5ENDA 3PTLA 4I55F 4X93A 4U6SA 1I2BA 4PIPA 8ICXA 3DMYA 2F3NA 2R7NA 2IW1A 2E4UA 3GGCA 2MSDB 2ZJ4A 4G37A 4LKRA 3BAFA 3QF4B 1NFRA 3JSAA 2C5BA 4NAHA 1XN4A 1MAVA 4J6EA 4LV5B 4QD3A 3ZHYA 5FUMA 4EOGA 3MGGA 1IVSA 3PCRB 2OO5C 3GIWA 4Z7OB 1ZM3A 4RUAA 3A9WA 4H1UA 4IFIA 3WOVA 3ASVA 1XFAA 1R1DA 2J85A 1P4JA 2QAGB 2G88A 5EJ9A 3DT8A 2IBMA 2QY6A 4YQYA 1PGOA 2CL7X 2K87A 1AC5A 2P5YA 3GLHB 3MWJA 3C48A 4RTSA 1DTSA 5CEEA 5TF4A 3IR5A 4XSVA 2ILTA 2XX3A 3KAPA 4F0JA 3FSRA 2VJBA 4F4JA 8ICCA 1CR4A 3A14A 5KL1B 3GXBA 4MPRA 5JCPA 4NEQA 1DEAA 3B6MA 1RRKA 3K2BA 4EZ9A 3RSQA 1JJAA 2ANBA 5KT6A 2C2GA 3QBJA 3SP1A 4IXNA 1M1YA 1RE0A 4BLPA 4PLTA 1R37A 2H17A 4UOQA 1PT6A 1XQVA 5BOSA 4B4UA 3F4BA 5K51A 3PNBA 3CURA 3KL4A 1S96A 1Y37A 3WLOA 2Q49A 3ET5A 1YONA 3OF2A 4JN6B 2B30A 4IZ6A 2F7SA 1N7HA 4W82A 1KIFA 5CGQB 1S76D 5DULA 2ZRKA 4YI5A 3A1WA 3TR6A 5E9JA 4M0LA 5T67A 1OZ0A 3LY9A 1WZCA 5AHOA 4H2DA 3BYZA 4FS1A 1Y0BA 3CM0A 1M3SA 2VBCA 2DY1A 3B60A 4GZMA 1V3TA 3LQQA 3WQRA 3PQ3A 4MIOA 2CNLA 1C1YA 3M6KA 4KREA 1XXHA 5GV7A 2FDXA 4PSVA 2C5GA 1NC3A 4FFMA 3ZWMA 5K2OA 2RHBA 5EP3A 3EPPA 4XGNA 1T6XA 2JIRA 4TYQA 2P78A 3A9RA 1FSSA 1RJWA 2BFPA 4LKOA 3VU3A 5LSAA 3UMVA 1PU2A 5LL6P 1MA7A 4OLJA 2ATLA 2H7CA 2WUWE 4KWCA 2ZWAA 3FOAA 3H40A 1Z0AA 3RJGA 3ZJTA 4R84A 3AX6A 2PXCA 1UBRS 3QWBA 2V0CA 1ID8A 4BX2A 3HP1A 3BRCA 3JD3A 2QPAA 4IS3A 5EWLA 2XYGA 4HZGA 2VCHA 1I4WA 3UAOA 1N8KA 1HPLA 3EY9A 1Y81A 2J5KA 1E2MA 4XW2A 3FNQA 2V4QA 4TN5A 5L40A 1GLVA 3COSA 3FDSA 1HKUA 2MU1A 1X86B 1QIEA 2PD6A 1G21B 4YJKA 2D1SA 4K7JA 3CO0S 3VZBA 4DZRA 1E1RD 1X38A 3PSAA 2IZ0A 1CVIA 3BQTA 3ZY2A 3TGLA 3JALB 3RROA 1HFKA 2NSJA 4NBWA 3FUVA 3Q10A 1CULC 1DX9A 4JUAA 1XX6A 1T4CA 4RFSA 2ADOA 2VF7A 3JR7A 3HA5A 2YC2C 1KWGA 5HCIA 3FOCA 3PVCA 2NQ2C 1P9NA 1QFXA 2W7OA 4UMFA 2YKGA 4DR6B 1N3YA 1XRQA 4A8TA 3BS7A 5JYCA 5D3MB 5F3WB 1OB2A 2KK0A 4M0AA 1YR6A 3WV4A 4DIBA 4G4JA 5KNDH 4RNDB 1YF3A 1OE0A 4PFQA 3UCFA 1T4GA 1A9ZA 2RGCA 1RD4A 1WDMA 3UMMA 4QO8A 3WLIA 2Y68A 1G8JA 4Q45A 3QIVA 3O8RA 1ID1A 1GZDA 4RABA 3THXB 3IODA 3AOEC 3H99A 3MERA 1QFSA 4F6RB 3N28A 1WUHS 4MR8A 3FYUA 2B98A 5KT7A 1J7KA 2HWXA 1QF6A 5H3LA 4M9SA 2ZE6A 2FI1A 1V5IA 3ZCSA 5H82A 2BGRA 5EG5A 1UP6A 3VM6A 4IPTA 3CLUD 3H1AA 3TUJC 4ZHSA 1CVLA 3UH1A 4OXIA 4UM9D 1OH7A 1VRWA 3W5AA 1R6AA 1TRKA 1TCAA 3EK2A 1C30B 5I7AA 3O8NA 1HE3A 3LCMA 3DAOA 4DA9A 2EJTA 2ZQYA 5JYDA 3LQ4A 4ZC1A 1R3DA 4OAOA 4JP5A 4ZCSA 1O4VA 3GDWA 1ZQ1A 4GR9A 5JPDA 3ISCA 1JEAA 4QJIA 4OM7A 1NUUA 3S81A 1ONPA 3T5BA 1DHRA 1M2GA 3KHHA 1WY5A 2QJOA 3W04A 2G1PA 3L0DA 3UYLA 5CBKA 4C14A 1UC8A 4X6XA 2IYPA 2JDIA 3FPGA 4CEJB 4EYQA 2VYND 2P27A 3KQLA 1S3FA 3LH5A 4WOCA 3HJHA 4RHTA 2YJ6A 1DKMA 2CDNA 4N40A 4FFVA 3ILSA 3DKVA 3H9JA 5ALMA 1NI4A 1MD9A 5G40A 5A5EA 2CXNA 4U63A 1RZVA 1K2WA 2M98A 4CF6A 1LV7A 2F1JA 2B8JA 3N2GA 2A9OA 1URJA 1EHYA 2E1FA 3UY4A 3ZHTA 1Y8ZA 3WMEA 1UDXA 4DLSA 3E84A 4DT1B 5B53A 3WKEA 3UOAB 4EJ2A 3WBKA 1ZEJA 5K8LA 1IY8A 2FUCA 3SCZA 3LX8A 1ORVA 2YX1A 5J5VA 2BJVA 3I6MA 2YYAA 4KAAA 2IL1A 1F8YA 5CYOA 4KPYA 2IYLD 2DKOA 5KYYA 3DOFA 2VDPB 1T3NA 2QSZA 3W2TA 2DF4B 2J3JA 3COJA 2PBLA 3M4YA 3TPZA 5K09A 5EJEA 3M4NA 1ZIYA 4LYDA 5F76A 1JHQA 5KTTA 4JDUA 2P2CA 3PKJA 4WKCA 2P5TB 3M70A 3ZK8A 1W73A 1Z4LA 4XUCA 3L8YA 3C29A 2A1JA 4RPIA 2C3PA 4XQGA 4NWIA 1T9HA 1XRNA 5M34A 4B80A 1PCXA 2QUHA 6ABPA 2FKNA 1YQTA 2XOKD 1SA0A 4O2BF 1RXSA 2F00A 2QD3A 3ROXA 3MWYW 1J06A 5LDDC 4MLPA 2FE9A 3C3YA 1W59A 1IVYA 1DEHA 4BDTA 3PI7A 1H3NA 3RJFA 1F0KA 2DVMA 1VECA 5DHAA 3O26A 4YDQA 1ZVVA 3P20A 4EG0A 1SUBA 3UHOA 3CVVA 3KS9A 1BHO1 2QYOA 2WVJA 2XPCA 1N0HA 2FNAA 3W2EA 1TAGA 2PX5A 3GA0A 3DDCA 1SQ0A 2FX5A 2PLRA 2MIIA 5JJIA 3F67A 4D9HA 4EPVA 5IUJC 4I4CA 3INGA 2HMWA 1HDXA 4TS9A 3ZQ6A 5J0WA 3P19A 4JU8A 1RPJA 5JMOA 2VWQA 2XAAA 4D4JA 3H5WA 4XE5A 3PWZA 2NVBA 2LDXA 3UWMA 3PE4A 4QZIA 2AB0A 3WLEA 5FNZA 3H8JA 4XJTA 3EBLA 4F4FA 2CGEA 3GILA 3AF1A 3LPCA 1L5HA 1JEQB 1DIGA 5A4MS 3DZJA 2NO1A 3UWOA 3MS4A 1MAAA 3LV8A 1P4SA 3EGVA 4LDJA 1QGDA 3QPWA 1GD1O 4Y7CA 1C0PA 2IHKA 1FPMA 1A9XB 2W9BA 1U7ZA 5BQOA 3GLGE 121PA 3I4CA 4HXYA 1RRPA 2NUPA 4AJ4A 5KFNA 3RVBA 3FPKA 4KQ2A 1I6WA 3DFMA 4ZQHA 4YRIA 1L4EA 5CEFA 1E5VA 2NOAA 3RYHB 2WHPA 4M54A 4HP8A 2Z2JA 4JT9A 2NU6A 2X2EA 3W5VA 5U4QA 4MR7A 1JN0A 1N77A 3RLFA 4TTJA 1D9DA 5DBBA 3JD1A 3MCTA 4IZHA 1SC1A 1Q2XA 1U1FA 2R6DA 4BVHA 1IOWA 2I71A 1ZR4A 2YVUA 2JZBA 1FFGA 3TXXA 5BSVA 3UUFA 2ZT8A 4HEHA 1ZX1A 3UXOA 2OCIA 3VV2A 5FBLB 2CJWA 5C7YA 4UZSA 2W2OA 4Y9UA 3F49S 5IDVA 1SL1A 3D6MA 4Q39A 4GM1A 3GPLA 4A2QA 1IIRA 1GR1A 3DPSA 2GPSA 3LVVA 2JHPA 4QBTA 1KR2A 3D0OA 1BFDA 2C07A 3NONA 2HBKA 4KAXA 3ZGYA 1BS2A 4BWGA 4FZJA 1JL3A 4WASA 1X2EA 1U04A 2OSBA 2Q6TA 1VL8A 4U7TB 3WDKA 4TWJA 1LDEA 3JD4A 1G42A 1GG2A 3DE4X 3FYDA 3ZS9A 4HH3C 4MWZA 3NM4A 5GTDA 3T7EA 2PAAA 3WMRA 2C4NA 2EJCA 4P54A 2Z2KA 4FCVA 5NULA 2Z8ZA 3P9KA 2QDXA 3I73A 1CQJB 4M1OA 2FG7C 5FI0B 3VSCA 3LGAA 2XLCA 3A1SA 1VLZA 3D54D 2Q2WA 2X9LA 5IAEA 1I0LA 1S4QA 4A5OA 3DJYA 2DXIA 1L8OA 4DWVA 3DVAB 5HJEA 5EJGA 4QYTA 2GA9A 1YZGA 4QOJA 3WE7A 4RYDA 2YVQA 1W29A 3VNUA 4OY3A 1R4NB 1RYBA 3F9RA 2SICE 4NYIQ 2IOQA 2F4VB 3F5EA 5LB4A 2VPTA 3JYHA 2CD9A 3OMXA 1CS0A 1H2EA 1RMYA 4Q1FA 2FN8A 3NM5A 2PI4A 1G9XA 3GOHA 2X14A 2SKEA 1EXVA 4MWGA 1DJOA 2AGVA 3TQQA 4OHXA 3GRFA 1U90A 7ICNA 1YDGA 4B4OA 2BBWA 5JBNA 2AOVA 2TMKA 3EISA 5IT9A 1W36C 3DVLA 4FEEA 3AESA 5DNEA 2Q6KA 2V6GA 1PJQA 3PHGA 4X95A 2AF4C 2BCQA 3WRWA 4N3BA 1KEWA 5KFQA 1WW2A 2DFVA 9ICTA 4E31A 1PUIA 5EP1A 3IP6A 1GUBA 1JIHA 1DV1A 4I55A 4JP2A 3OFJA 3VYUB 1XK6A 3SXUB 2A5GA 5FPHA 2O20A 3TGWA 1HNWB 3ISTA 4PG8A 4DR4B 2IELA 1KFDA 3NYIA 4YV0A 5IHPA 4E5SA 3V3KA 3LLSA 3TEJA 5K2MA 5E4YA 3GFSA 4XTCS 5LQSA 1Z6YA 5JNTA 1DAIA 2B6NA 4HX5A 4R8UB 2C20A 4HNSA 1J70A 2BKXA 1AHNA 1AGNA 1UQTA 1B8UA 1XVUA 4MUMA 3I01M 1V0JA 4DM3A 3A3PA 5J8YA 2W6QA 1K0UA 4NZOA 2ZRBA 5DTEA 1W25A 3LCVB 2XVTA 4F46A 2EP5A 4RXTA 1LSUA 3UQ2A 1L8LA 3GFRA 4M7RA 3KYJB 1SIOA 1ZN2A 3RVRA 1GFZA 3HVKA 3AIMA 3OEWA 4REQB 3E8MA 1O94D 3GFFA 3U6BA 3PDIB 2PT6A 4WZBA 9ICVA 3TDKA 5JSZA 4C43A 1Z3CA 3HA7A 3NJ4A 1NV8A 2B5VA 2QW0X 1IM4A 3SLGA 1IHOA 2R62A 1GVNB 1RYZA 5TEWA 1IB0A 5MGNA 4FBMA 4KDFA 2E87A 2WR8A 3IDOA 3QZUA 1GXSB 3IEVA 5IPFA 1XPJA 4NF2A 4MS3B 3PC4A 2V54A 4I50B 1AKUA 3EMKA 5I8ZA 3F71A 4A82A 2Y1FA 4A16A 4QFCA 1GPBA 2DQSA 1BG6A 1JXOA 4GMKA 2J6BA 4TTPA 2A9VA 3COZA 3DZKA 1PZMA 2W8LA 1KY4A 2Y1DA 5IVHA 2CF6A 2QW1A 3EGEA 1VQ1A 5BYKA 4LHVA 1Q44A 5KYWA 4YMTA 1PQUA 2Q6LA 1VHDA 3F2BA 3ZK7A 1X80B 2VTBB 2X13A 1T9DA 4OXNA 3S1LA 4Z51A 1JMYA 3A4VA 1HDCA 3TQIA 3UAGA 1WUDA 3ZTYA 2M6RA 3A32A 5DQHA 2YWDA 4PPNA 1ZXBA 2YS7A 2AJCA 4WFJA 4AO7A 8ICFA 2XR1A 4WKGA 3MJDA 5C0OE 4ZV9A 1ZQOA 3C5CA 3O2NA 5LKRA 2HY7A 3VFDA 5K4HA 3AUOA 4PZZA 1SHZA 4Q8FA 3ZWNA 5E2AA 2EX1A 4N48A 2WIJA 1HA3A 4E1VA 3MAGA 3DKRA 3FYUC 7ICUA 3EGWA 3PUIA 5B4VA 4NE7A 3U7FB 3T7AA 5A7HA 2JC3A 5FPYA 4LZWA 4TTTS 2VC2B 4DCNA 5T3YA 3DOIA 4FXOA 4IRKA 1WVIA 4WTOA 3A1UA 3HCFA 3OCWA 4DIUA 3LYSA 1G8FA 3UG6A 4FE7A 1ZUHA 1GTJ1 4AMVA 2I0FA 1LVUA 2OB1A 4JLWA 4F8JA 4P4SB 1DCFA 4DMUB 2KLHA 5IG2A 2ERXA 1R9MA 5ULLA 1XQ9A 3PFBA 3JAKB 2JRZA 3HKDB 1CE8B 1H1LA 3SBXA 1I3KA 2O2GA 4WK4B 3ZDYB 4Q6WA 2VAVA 1UP4A 3ZHXA 5EZYB 1N60A 2G0AA 2QLLA 4AL4A 5EMHA 3H3XA 3IEKA 4ON9A 3U56A 1OGIA 3CSDA 1VA5A 4J9RA 5GONB 3Q9SA 1SG6A 2R8YA 1UPAA 1EX6A 3GV7B 4YDRA 3HVHA 1UF9A 3UMCA 2WU1A 1E60A 4ZTZB 1RVV1 5DNAA 1BCRB 5CXSA 4Z54A 5DDIP 1B23P 3JASA 4UTVA 1KA9H 2I03A 4RY0A 1A9PA 2W8ZA 1E89A 1NUTA 2ZAOA 4Z0NA 2QMZA 4PFSA 2P2GA 3EZLA 3A1FA 1HT3A 3R8FA 1TQ4A 4UTRA 4JC8A 1MIOB 2PS0A 1DIRA 3FGZA 2VOJA 3W1VA 1ONOA 4X84A 2AJ8A 4L4ZA 1PJ2A 1KZ1A 1A7JA 3PGLA 3PHLA 4PYRA 3KOXA 4RAQA 3OTOB 2RGXA 5H68A 3RANA 4QWCA 5JFGA 3FUCA 3P2IA 3QXGA 3RFAA 5I9BA 5C4GB 1QZZA 2NSYA 1ZNXA 2JLWA 4JR2A 1JIXA 1PQWA 3VH4A 1X7YA 1QQ5A 2AXTU 2GGSA 1WB4A 4MUIA 1KLNA 1JSXA 1H2YA 1U6JA 3HPRA 3P9QA 4GWGA 4EAAA 5FTNA 4RTLA 5L1IA 1V45E 3IJPA 5I45A 1C41A 1YVRA 4GE0A 3IP8A 2B4RO 4MV4A 1C4OA 1ZOSA 1NW6A 3ZXYA 4WGFA 1EE1A 4X8HA 2YW2A 4OHZA 4JNKA 1YQ9A 4IQWA 5JMPA 1PR1A 1RKXA 1STOA 3PFHA 2I2BA 1SVOA 1KI2A 2QN3A 1H23A 2WI8A 2VYCA 5TGZA 4AAYA 1VA4A 2JFYA 1M33A 4DJFC 4IHKA 2HF9A 3P0JA 1NFQA 2ESRA 2IH2A 1FDIA 3KCNA 4FW8A 1N57A 3HSKA 1CZHA 4I4TB 2G40A 1AQNA 2QLBA 1W4LA 3HYTA 4QYWA 1QAMA 1F20A 3B0XA 2YQEA 1AT1A 3EMBA 3CUTA 4U8HA 1PHPA 3EIFA 1VG9B 5F7ZA 2G1AA 2X8BA 1ST3A 1BAPA 4C01A 4K3VA 2FK8A 1V6SA 2HZBA 1X94A 3MWLA 2UZ3A 2YL2A 2CE7A 3I37X 3TLAA 3C5GA 1JMVA 1NJ6A 1EE2A 1I8TA 2ZSEA 2HA4A 1GNLA 4P38A 1BWQA 3LF1A 5IS2A 5HKLA 5BNTA 2PH5A 4W5QA 4HFRA 2WNSA 3NB0A 3ZVLA 2W8BA 3QW2A 1QIMA 4EHIA 4KYTA 1JJVA 1Z15A 4J9LA 4DCPA 1W30A 3TSZA 4BVAA 1LA2A 1NNEA 1ZONA 3H2BA 3NHRA 3DTVA 5JDCA 5ALJA 2OY0A 3DXYA 3MGCA 4H16A 1YZ6A 1D9XA 3DH0A 4D3SA 1PT5A 2XE6A 3OQ6A 3M4XA 1QX4A 5JAZA 1JIQA 4ZT2A 1WB6A 1PO7A 2BFEB 4GXKA 3H4VA 5FORA 4UE3S 4DSUA 2O6KA 4O2BA 4N8SA 2FW6A 1KTQA 4LYAA 5D3KA 1RXWA 4D46A 3ELDA 2F1IA 3HLYA 1DOQA 3B8EA 1IOLA 3OETA 4JV0A 3AJAA 1MGOA 1JYEA 5EKXA 3WAGA 1WOYA 2J5QA 4QIWC 1ZJYA 3EA4A 3NYQA 3SXJA 2K60A 4BRWA 2D5BA 2OO5A 3OH8A 3OZRA 2H1WA 4MUGA 2YRFA 3LVRE 4QJ3A 5SV2A 3VAZA 1TB4A 2HZ7A 1IRIA 4BE9A 5BSKA 4Z8XA 3FLBA 6ADHA 1V8ZA 1DC6A 4CF3A 4AF6A 4NULA 1QNLA 4LN1A 3IIEA 1F1JA 5HF9A 1L7QA 2IXEA 4PYMA 2REBA 1D4ZA 3NCHA 1Z28A 2VPYA 3VKGA 2AFIE 4BX9A 3BF7A 4YGYA 1SCKA 1YS4A 2OKGA 1GVHA 4OHPA 2RKWA 4MCHA 2ZQ5A 3ZVRA 4ZVLA 3NXSA 1K3TA 1U0OC 3DHWC 4L22A 5JHGB 4PZPA 5C5DA 5EUBA 1J56A 2XH8A 5AVXA 1UZNA 4URXR 1A8IA 3T4EA 4EK9A 2HLHA 1RDFA 5J2GA 5EN4A 2WWWA 2DE0X 3PLNA 4IMJB 3FPBA 4Z4FA 1NW3A 5EY5B 3TX6A 3WL7A 1Z5NA 3VOAA 3KSBC 1AKRA 3VDMA 2PR7A 1SCUA 3MJ4A 5IVPA 4YD2A 3TRDA 4L9AA 1KSPA 4R7GA 5F1YA 1VMKA 4V02A 1XGKA 3F46A 4OFZA 2WTBA 3R41A 4FYXA 4DUPA 3JYNA 1I4EB 3AGQA 3T3GA 2J9FA 4NI5A 3ZBTA 1AKYA 1L8QA 4LI3X 3AT1A 5FTKA 1ITZA 1T0JB 5F9HA 1XJQA 1EM8A 1C0EA 2NQ8A 4U7GA 2K5UA 1U8CB 1PTJC 4RMHA 1LRLA 1WCWA 1I30A 2CK3D 4L4XA 1JXQA 3H19A 3ZIAA 1USVA 3C85A 1PJ3A 3MBKA 1K2VN 2NVWA 1H5UA 4U9IS 3Q3IA 5DN9A 2VAWA 1G5HA 4ZO6A 1Y1SA 2FZ4A 5ITZA 4QT0A 3EXG1 3IUMA 3LCRA 3OPXA 4UAUA 2WPDA 2YCBA 2M6KA 5REQA 1P0QA 3I6ZA 4QQRA 3GQCA 4FVTA 3OLQA 1RAGA 2GF2A 1JTEA 4RDCA 2MR5A 2IP1A 4X20A 1NJZA 4OXYA 3WLLA 1JT2A 4E4TA 2HQOA 5F33A 5JT1A 4JQZA 4OL0A 4YB8A 4EG6A 3ABZA 4KMSA 1EVJA 2I7VA 2HFKA 1J0BA 4UU1A 2GWSA 5TE9A 4XA5A 1YJBA 2COKA 3R9IA 2ZU0C 1DKLA 5AK4A 4QAJA 3GFGA 4KW7A 8MHTA 2ZW9A 1BN6A 4DL3A 1L3CA 5BSEA 3OOJA 4ECVA 5D8DA 4CVNA 2P9YA 1GZUA 1AN9A 5A4FS 5T8KC 1U7PA 1NLZA 2BQRA 3DF7A 1GY8A 1OXTA 2JEIA 2ATVA 2W6ID 4EENA 2I9PA 3WTBA 4YXWA 3CEAA 4UHCA 2VP3A 2VYVA 4KPUB 3RSCA 4R1MA 1VPDA 3KDSE 1DVRA 3RC7A 1DKNA 1OI7A 1CUSA 4DRXB 4R9SA 4F93B 3GWZA 3ZE2B 2G28A 4G84A 4BP3A 3DE3X 1LX6A 5J8YC 4Y2GA 1M0EA 5K0ZA 1UBUS 3R0VA 3VTFA 2GH1A 1PL8A 3E1KA 4F3RA 4B44A 5FEMA 5DHPA 4LV6A 1Z8FA 2PS9A 1FCJA 2O59A 4UTPA 4HBZA 2IHMA 2GCOB 4D0NA 2WNIA 3RNOA 4CV2A 2Z7JA 1UR5A 2R6GA 5KFXA 2QJWA 3RJMA 1TOAA 8GPBA 3O93A 3L2OB 3D4NA 3IDAA 5DGTA 4S24A 4EVRA 5D7BA 1XZGA 1YUBA 2HWWA 4Q4JA 4X94A 4X00A 1VG8A 3A70A 3PFGA 1S01A 3CVOA 4TXLA 2DWUA 3ES9A 4WLNA 3N6RA 2VNIA 3W2IA 4LXYA 4DLTA 2FU5C 2INGX 1R8JA 4IHJF 4E51A 1R7RA 3OSZA 3FPLA 2J32A 3OE1A 2M1XA 3PX2A 2PZJA 1MX5A 1WG8A 3L6CA 3MR5A 3N9IA 4BNZA 1OI4A 1DIAA 3AVTA 3ODPA 3A1CA 3NV9A 3FXAA 1YE3A 3V7NA 1EEXB 2BEJA 5C8ZA 1EGMB 2C9YA 3V34A 2O3JA 3WP1B 2QD1A 1WHTB 2JLAA 5LKAA 2QG4A 4CL0A 1RM0A 4HAXA 2BPGA 5IF3A 3QPUA 3ALRA 4FFBA 4IOLA 3GEHA 1SQ6A 2HF7A 3T3NA 1WR8A 3RFVA 5DDYA 1PEYA 2R8PA 3WKCA 5EYPA 4NYMQ 3BMCB 2QSJA 3P0RA 3PXDA 4XYMA 1SBTA 2P90A 4DQXA 5AIAA 1DG3A 5FF9A 5BQFA 3B1YA 3O8BA 1H1DA 1ULSA 1ZL2A 3OUZA 4FXPA 2OM6A 4YCXA 1E3QA 2FYTA 3OE4A 3OFVA 4EYKA 3AIKA 2Q5IA 1SZCA 4E12A 3BFPA 4RA9B 4OHVA 2HMXA 4MPJA 2REQB 4JJIA 4IIYA 1EUYA 2QP3A 4BO0A 3F3YA 2ON6A 3DV9A 1YASA 4LE1A 5C5IA 2RHCA 3LLMA 3SG0A 4PO3X 5TPWB 1HQDA 4KH1A 1SKSA 4BKQA 5C34B 1MOSA 3S55A 4B34A 1KSFX 3SJCA 1A82A 2LYAA 4ZA2A 3KSRA 4MPTA 1MT0A 5HVNA 1OY1A 3OEHD 4BJ3A 2YMQA 4PVCA 4U7DA 3UJDA 4IR7A 3IB3A 3FOZA 2RKOA 3AC0A 4U6NA 2I1QA 2FSVC 4PYNA 3WFZA 5LWHA 5D85A 2JEZA 4R7TA 2HX1A 2OCXA 2PBFA 1AF4A 1EJ0A 1QP8A 4MYDA 2RHTA 3NS7A 4FYKA 4KTQA 3SQWA 1Y3AA 4EY6A 3G2OA 1YULA 2QVLA 3OSNA 4EHHA 1F4LA 4OUKX 5LZ8A 4C1NA 1SFRA 4IIGA 4BJHB 3V5NA 2Q1XA 1YXMA 1IXRC 4QIWF 3G9ZA 2FK7A 2ZE5A 1TAMA 1XHEA 2CFRA 2OHFA 5IN4A 1KZ7B 3LYUA 1V8PA 5J4VA 2Y9TA 3RS9A 4RHFA 4HTAA 1WZNA 3KLBA 1X0XA 4GBGA 3FUWA 4NIMA 1NA5A 1LDNA 2H1CA 2ZJYA 3NHZA 4LYEA 4ECAA 4EO9A 1RFLA 3I64A 3G8DA 1LTKA 5K1ZA 2E5SA 2WJWA 3MCAA 4EKDA 1XZ8A 2PNFA 2FCAA 1OQAA 1TCBA 3KB2A 3BK1A 4NL9C 2PSJA 2ZB2A 3I1IA 3I12A 3SJ7A 1XZFA 4M22A 2C2BA 5HCUA 1XTVA 1EUCA 1CUIA 2AL7A 5I7SA 1Y82A 4JVNA 3AWDA 3KNZA 1Z6TA 3E4CA 1PR3A 3BDAA 4Q6BA 4WECA 3DOOA 5B5EU 3IEPA 3WZLA 3V8PA 4AWXA 1UJ4A 1OUMA 2GAJA 3LK9A 4BL5A 2Q8PA 2QY9A 5K0LA 2PZKA 5HYVA 4EGFA 4EEXA 4FZ3A 3IUNA 5BWNA 1GILA 3NAMA 1CRWG 1ZSYA 5E0OA 1LS6A 1YOVA 1SHKA 1CUWA 1NK4A 1PYDA 3U7RA 3PY8A 4UBCA 1SXEA 3R0XA 3RFCA 5IBQA 4QC2A 4O25A 4L85A 4KH0A 2QTMA 3WL3A 4GVXA 4KLDA 1M1YB 4W63A 1UQVA 3PXXA 1SUSA 4HDMA 3PFNA 1Q3KA 1DG1G 4RTJA 4D9KA 1PUZA 3QMMA 1FVXA 4EBFA 2AR7A 4QWMA 1WXIA 2Q27A 4CM9A 5I3CA 1G4HA 3WWDA 3O1JC 1OLOA 4D9NA 1Q0HA 1SPBS 5A1TA 3SVZA 3GPDG 2G9RA 3I62A 4XEHA 2VQDA 3F7OA 2LCQA 4RY8A 2J0EA 3SQDA 1TMKA 4Y0NA 4DIMA 1LPPA 3FB4A 3M6IA 4AYXA 1UPUA 4GLBA 1Y1QA 2GBGA 5JDCC 3SYKA 3G1WA 4CIVA 5I7EA 4HDQB 1XXHB 2WIKA 3EYAA 5B58C 3RBDA 4QECA 1Z63A 1JG6A 3QMWA 1BWPA 4MAAA 3AN1A 1YJ5A 5JRDS 2A58A 3R7WA 3EYWA 2CHVA 5DU2A 2PPVA 2GAAA 3TFSA 3ZCUA 3EDRA 4PGAA 1US8B 5F12A 1HDEA 3AL2A 4PWYA 4OTZA 5AI6A 5LUAA 2YJ4A 2HHVA 4BLTA 1YDWA 4YPFA 4B6GA 1KFCB 4D8VA 3VC2A 2CXHA 3JRWA 2QHXA 3TF5A 1MEJA 1CB7A 1VPTA 3O74A 1ZGAA 2D1RA 2JHFA 1BU5A 4UNPA 1CERA 1QANA 2FMFA 3ZH2A 3ZQ4A 2YHBA 3IXMA 3NAZA 1BS9A 5KDOA 3S8MA 3FTPA 3T06B 2I22A 5AW6A 3TYXA 1K7XB 3GL9A 2AJBA 2CMHA 2F67A 3QFRA 3N70A 4BX9C 4KO8A 5TRTA 4B8YA 1TW3A 4AJLA 1PQPA 4RFSB 2Q2QA 4HQOA 3N53A 4QZCA 2IQ5A 3JQFC 2M0NA 1ZUD1 3R5XA 3O9VA 4AF8A 4FGJA 4FHZA 1KF0A 1R88A 1R4AA 2FHPA 4BU0A 1J9GA 1DRVA 1YZVA 2Z3VA 4LRYA 3WGMA 4AJJA 3ZV5A 3B1JA 4DZTA 1EBUA 5IWAB 1NSTA 3TE7A 3WIDA 4RU9A 3EXFA 3C24A 2V9PA 1RWMA 1R4ZA 2P4QA 3HYRA 4BGVA 4DM7A 3LS2A 3L4PA 2FH5B 4G5SA 1Y1RA 4MV7A 4FDUA 1SG9A 3IP7A 3U7GA 5I5EA 4AZ3B 3WLMA 4BFCA 1SCJA 3KOOA 2I7XA 3Q6IA 5HQ3A 3HXLA 4CV0A 5A71A 2XY6A 4EI7A 2GPBA 3VC7A 2I67A 1WHSB 3KC2A 4IIHA 3VJMA 3OX1A 1JDSA 2LP4Y 5KBYA 1F17A 1W2GA 2ADFA 1V7QA 5HW0A 3OQMA 1S0VA 2V7XA 3EUAA 3KM0A 1G6HA 1NXPA 3OIGA 4CKEB 5CP8A 1WMSA 3H7AA 3HL0A 3JWPA 3OOYA 1TYBE 1XBTA 4DXDA 5TV2A 2F1RA 1GQRA 4D9FA 1Y6ZA 5JH7B 1P1IA 2BJWA 1YB7A 2O3SA 4TWIA 4HWGA 3W5UA 4B4KA 3WGQA 4V0OA 1Z82A 1Z0UA 2H2GA 4X45A 4H7HA 4BB5A 5FT9A 4EY3A 1H65A 4LZJA 3R6LA 5J2AA 4KN9S 1M6NA 5F51A 3W8RA 1FRZA 5KNBA 2OV1A 1NQWA 2HDHA 2XY7A 5IKPA 521PA 4G0OA 1YD7A 3P0HA 7REQA 3P5BA 1K3UB 2QT0A 1DC3A 2D0IA 2CE2X 4NU6A 1X1SA 2JVKA 1EP3B 1K06A 3EEYA 3AY7A 4RPYA 5KG6A 1C3XA 1TA4A 4BNDA 5BV1A 1CHDA 1H66A 1GAEO 5JO0A 5D1NA 3N7PD 1H3EA 5U1PA 4KV7A 4HWRA 3VR1A 5C3MA 2GSDA 2X40A 4TKVA 5DG9A 5HUQA 2QG6A 2QR2A 2JAXA 5AKJA 5IC4A 1A88A 3N2GB 1QYVA 2BVNA 5BSGA 3T1TA 2JXJA 4G4SP 5G0VA 7ICVA 5J59A 1ZO8A 4NENA 3OOSA 1DEXA 2ONCA 1LWNA 1AQ6A 3UOGA 4UTZA 2FPPB 2EC5A 4Y6PA 1HR0B 1UOEA 3UG7A 4DSOA 4I2CA 1TRHA 3QKUA 1A5AB 5BOLA 2DRIA 4NLCA 4ARUA 3JQ7A 4H0CA 3AKCA 3MXTA 3DBHB 4XAQA 5ESDA 3OWHA 2W6JA 1N5WA 5CG1A 5KYYB 4KIGA 4ZO7A 1J39A 5FBRB 5EZQA 1ICEA 4DR3B 5TDHA 3O8DA 3UN1A 4OOFA 2EQAA 1RPTA 1ZN9A 1XLTC 1V39A 3PQ5A 4ABTA 3S2FA 3U4CA 4IDBA 5TC4A 3DW1X 1T5DX 1O58A 1B74A 1GTG1 3ZUPA 1V47A 2Z1MA 5CB0A 4LY0A 4O3SA 1QLHA 4C2UA 3K15A 4OOEA 5E4TA 4JJ4A 3NRWA 3C45A 4IQ0A 1KORA 4X6LA 2QLMA 3HHEA 1NXSA 3KX2A 1G20B 3AKYA 1NW4A 4GL4A 4EFNA 2ODEA 5JJLA 1RBMA 5IKMA 3E9RA 4Z9FA 4DCTA 3I23A 2ZS9A 5FOVA 2FZGA 1TZJA 1NVAA 2CNWA 5SICE 3PSTA 2QL6A 3GVHA 4O3MA 3W9YA 1CXZA 4DWOA 3DULA 1JB1A 2PWAA 3I2KA 3D7RA 4WJ3B 3DL2A 2NZYA 3F6PA 3G1TA 3GCXA 3T5HA 4F2SA 1XPRA 2K4EA 1CZUA 1RAIA 2W22A 1YHNA 2IVZA 3KSUA 5GOTA 4E5YA 3QVJA 3R44A 1ULHA 4PPGA 4DMCA 1YJXA 1TTQB 5EJ8A 4A8JA 1G3IA 4PSAA 1DO0A 2XB2A 3RIXA 5FI1B 4XVQA 4PZOA 3ZWQA 2GZRA 4IH4A 4J9QA 4Y9RA 1KKLA 1Z9BA 2MWMA 2XYPA 4OQDA 1HYQA 1LFDB 1EE9A 2ORIA 3UXPA 4YRGA 1P1RA 1ISGA 5EMKA 3H11A 1N9GB 2O57A 3QTBA 1PNRA 4AW9A 3CONA 2E4WA 3OEED 4X1KB 4N3GA 1WD7A 3H4IA 3PNCA 1JN3A 4CLOA 3GLSA 3OPQA 4MKIA 1DFGA 4I1OA 3BZCA 1A1SA 3N2ZB 4N6GA 2NUPB 3DHEA 1W5BA 4RA6B 4YUAA 4FI3C 4OH7A 2JAWA 4IHJA 3T5AA 3LLCA 1HLPA 4JLDA 1ZXIA 1JHVA 4EY4A 3NGLA 2HEIA 4R1NA 2NU6B 5L3SA 4JSTA 4YFVA 4MR7B 4K9DA 3ZKWA 3S2ZA 2P8JA 1JUDA 3O0DA 5DLPA 4KXXA 3HCPA 1Y3IA 5LYJB 3T3MB 4QFMA 3F9CA 4J1SA 4G5YA 4D74A 2JZBB 2XNKA 2DY0A 1E98A 4PC7A 3TRHA 1YCFA 4MV9A 4Z53A 4DSFA 1CUVA 2CJWB 3AM9A 1HFEL 3FVVA 1A1VA 2QX4A 4PQYA 5F9LA 2W11A 1X1BA 1P5HA 4DLGA 5DGCA 2H4HA 2EHDA 3KTAA 3PKIA 4HYYA 3Q9LA 3EVFA 3H0LB 1GPKA 4Q1DA 1Q84A 3O1HB 3AMZA 5EFZA 4ZGBA 1ZICA 1JPNA 4RKYA 5TQ2A 1HT2E 3VNRA 2O54A 4JWNA 3AI1A 2C8KA 4MYTA 5JD6A 4ZYVA 1T36A 5EIBC 4LTNA 5AD1A 2H3IA 3ASZA 4OB8A 4L2IA 1U8ZA 3AEKA 1UZUA 5BVHB 4H6XA 4IGEA 4C7KA 2D7CA 1QRTA 4XM2A 4LGCA 3PX6A 9GPBA 5HE9A 3AQIA 1KYVA 2ZS7A 4KUEA 5C52B 1BE6A 2QW8A 4HX9A 1ZOOA 1P6XA 5ALDA 4HMQA 3OFSA 3PLAE 1P0PA 4P0QA 4DAOA 1L0BA 1VI2A 3CQ9A 1A6SA 2VT3A 4QASA 5I7HA 3QX7A 1UBCA 3U3OA 2Q2VA 5HIJA 2BCJQ 2FPUA 1QHHA 2O1SA 4LTDA 4ZJPA 3O73A 1RYNA 2BFFA 4PLYA 1J21A 2MRLA 1E1CB 2JVJA 1JKJB 4JJ8A 3HACA 2GEDA 2WKQA 3H9EO 3D3JA 4B0OA 4QQNA 2Y9PB 3H1PA 1WXDA 1VYVA 2CUZA 4RC9A 4WXPA 4CEHA 4ZYLA 4NU8X 3M81A 1MW9X 5E95A 2TRSB 3FHLA 5EGNA 4YGXB 5AVKA 3KJIA 4YUYA 5KTRA 3LOPA 5FPTA 4EHLA 4YRKA 1YBMA 1Y9JA 1VTKA 2ZBEA 2DCMA 3RC2A 4C22A 1L5WA 1R3UA 4TLAA 2JHDA 2OWOA 2GZSA 4PIVA 3UANA 2OVFA 3BIFA 3LKDA 3BCUA 3HCNA 1WKVA 3PGVA 1UJ6A 1XJ5A 2XMRA 3BZKA 4O02B 3SX0A 3ADKA 5DB7A 4YMOA 1EFTA 4TSFD 2QA5A 3O1LA 5T4EA 2AOUA 4E32A 3TZHA 2C22A 2R44A 5CH8A 1L5QA 1ML4A 4MOWA 3FE2A 1A7KA 4BWJA 3DDUA 4TLDA 1CK4A 3O4RA 4FTWA 3JV7A 3QVVA 4I55B 4C7MA 1VLVA 2BKAA 3W5HA 1OGJA 4PCAA 2CLIB 4RGBA 3EGOA 1M76A 8ICSA 4KPFC 1BFKA 5FCDA 1T3QA 1NVVQ 5H02A 4CU2A 4ND3A 3QHPA 1FUYB 1ESEA 1Q0TA 1SBCA 2G6BA 4EA7A 1B6GA 2B0CA 1I0IA 1KYYA 4O8CA 4Q43A 1X1TA 3H9GA 3VYVA 2O6HA 4BGDA 1UAAA 5AJUA 4RQ8A 5ENZA 1I6MA 2QNRA 4ICAA 3OLCX 4QPJC 4AP5A 2NWQA 2ALZA 2LHTA 4C80A 2A33A 4U02A 3KQSA 2CHFA 1N5MA 3UHPA 3UAWA 2WIGA 4PZUA 1HSOA 1TFUA 5KWIA 3JVIA 4CM4B 2PTGA 5ECWA 1KQQA 3BSFA 5C8XA 1U5CA 5GADl 3ROTA 1ZCBA 4GO1A 3MCUA 5B7NA 4CU5A 4ICIA 1CJUC 4KBYA 4J4BA 4HAWA 2B3TA 2KE5A 4UM8B 3IT3A 5U9CA 1G1AA 1TT7A 4ALMA 2PN1A 3RV4A 5JSZB 4FK8A 5EMNA 3QU7A 1J2UA 3GU3A 1PTJA 1DWUA 4ALNA 1NP7A 1XJCA 1L5YA 2BKEA 1TKDA 1O9HA 3Q85A 1HTTA 2GLXA 1UT8A 3SC3A 2WWFA 4YRQA 2B9VA 2CLMB 2XMSA 2BFNA 1NJYA 1N1DA 1COKA 4MVJE 1VG0B 1Z3EB 1TFRA 1FTNA 3E53A 3VKWA 3A4MA 3TINA 2C5HA 2J67A 5H8WA 4DQLA 2JFBA 5A0TA 1Q21A 4P3PA 4BRZA 3P2JA 3NWEA 1P9WA 3LDGA 5FJIA 3ECSA 3I9V1 1FW8A 3ASYA 4F4UA 1YZQA 4NS4A 5CG2A 3PIIA 5IEJA 2JLVA 1N8TA 4MYCA 4RIGA 4IRUB 1G8SA 3OJUA 2JI6A 3SZOA 5JAIA 1GPYA 4RF2A 5KFAA 3D3KA 2QM8A 3UWDA 4FIZA 1SCQA 4QHSA 5L95A 5DNVA 4FFOA 3GR6A 3R40A 1LTQA 2QZZA 3ITEA 3DOJA 1RW4A 3TMKA 2I78A 2TECE 4EZ6A 4BB6A 1GU1A 1H2WA 1FOEB 1S2NA 5KQGA 2I54A 5HFAA 2R5FA 1C3VA 5T8KA 4E33A 3HL4A 1EDEA 5AVQA 4MQBA 2UZ0A 3RVDA 4B9LA 3RTVA 3FWZA 4UATA 2JAOA 3LC1O 2CUKA 2H1LA 1EWQA 1KYQA 2FHSA 3P9NA 4GDFA 1ZQKA 2BLLA 1J9EA 4MP8A 3KQTA 1M0WA 1W88B 1I4LD 1Q14A 1JTVA 4NBSA 3DHYA 4UNQA 2EJVA 3SNKA 1UBHS 1XEWX 3SYTA 2ZRFA 2B7BA 2GEVA 5DQIA 4LS3A 3SR6A 4DYHA 5M2QA 4LJRA 5DN6D 3D1JA 2NZWA 4ROSA 5AUNB 4OM8A 1KO1A 3BQ1A 2QLNA 1E0DA 3GUHA 1H1LB 3C6YA 2C5LA 3V4PB 3HSYA 1Z62A 3PJDA 1CRZA 3GELA 4ZCPA 5HUHA 5HIKA 3A6FA 4BNYA 2GXSA 4MQUA 1B1AA 3RTAA 2QTAA 1IC6A 1WLYA 4M6WA 2GBLA 2N9UA 4FI3F 1YTLA 1W34A 3NJ8A 2HHAA 3SZUA 5K20A 4Z1OA 2DQNB 4DQUA 1IJFA 1K97A 3P71T 3F0TA 3C70A 4YAGA 3B1WA 1SO8A 4B7AA 3EFOA 2BQUA 4ELVA 2H18A 4DNQA 4WY5A 4JHXA 2IQIA 5B12A 4YXMA 4EIWA 1OXVA 2A3RA 2JIZD 1SKWA 2O8EB 5F35A 5FLEX 1GAXA 5JU6A 3M83A 5L3RA 2EGUA 3HEAA 5JAQA 2CUNA 1M83A 1X7YB 4D5EA 2X77A 1BWSA 2R84A 3DEKA 4C4OA 4BNLA 1QKIA 3ABIA 3RJZA 1BXGA 3TDMA 2A19A 3I39X 4Y2HA 4L0DA 2CYAA 3K4HA 3A1EA 3DUFA 2P40A 4L75A 3DMTC 5ALZA 1N3BA 2WWYA 4AY6A 4HBGA 3QOYA 1WWKA 3PT9A 4LISA 1JH9A 4CR8A 1RIIA 3LIIA 1OI3A 1ZG3A 4KJXA 3W4JA 2NYAA 3GLRA 1K88A 1U80A 1RP1A 2BEWB 3BG5A 2QK4A 4HSEA 1QS0A 3CRRA 1YZHA 4XCQA 1TO2E 1VB3A 3AEUB 1QSLA 3SPXA 4JLOA 4M4SA 4ND5A 4WCVA 5IJ9A 2GNAA 4PX2A 1MNAA 1SL0A 2H5XA 2DUUA 4MF2A 1M10A 4KKVA 1ISHA 1XALA 1YH3A 1D8AA 4OUDA 3V8BA 4BDSA 1UBKS 2CFIA 1ADFA 2JGRA 4DA4A 1NUPA 5ALSA 2K8BB 4AG6A 8ICTA 3IKLA 1S9FA 4TMFA 3G9UA 3FMPB 5KINB 3HFRA 5MDHA 5JAHA 3ZW7A 4RQNA 2FSVA 1LW6E 1ESCA 3R1IA 4Z4HA 4OP2A 1TK8A 5LQJA 3R4CA 2WD7B 4EPYA 5FBVB 1DHTA 3DEZA 4YT8A 5BNZA 5LU9A 3QBDA 3GQBA 4ZAGA 3PTZA 1H4VB 3BXZA 2FJ0A 2QX9A 3AV3A 1E3DA 4A8JC 4CDMA 5AW0A 1IXRA 1S8OA 3OCYA 3EA5A 4O5OA 4JFAA 1R9JA 3MD9A 5E3HA 5FP0A 1W76A 2QUZA 1ZH6A 2CY0A 2H16A 2XE7A 4YR3A 2VDQB 4JWTA 2I7CA 4N39A 4TUSA 4XUSA 4UM5A 4UCXA 2R68A 1O94C 2Q21A 1DIOB 3NTLA 1OHHA 5JPCA 1K8ZB 4RSGA 3H6KA 4K9NA 1HEYA 4F85A 1H69A 4EFMA 3GJ0A 4W5RA 1CX9B 3NV7A 4NL9A 4K2AA 4O2BB 2C1ZA 1C7FA 1Y8AA 3IUQA 4DBLC 3DKPA 1GZVA 3L4KA 4BE4A 3N7RC 3I0MA 3DONA 5FJJA 3Q87B 3TR5A 5HA5A 4RDXA 3MS2A 1DMRA 1T13A 2QE7D 3CLSC 4LDNA 4D44A 5KFRA 2NTVA 2FLVA 4LZOA 4X90A 3OZVA 2IBTA 4NJ8A 4BEVA 1Q0RA 4HXGA 5KSZA 1T3TA 5C8YF 3R6DA 2JLXA 4KIJA 5ER9A 2C2KA 4GI3A 1I4DD 3BTVA 1RTKA 2V03A 2P6NA 1K9VF 2BWJA 3LXRA 3KV1A 3PC2A 3ZU5A 4ZCQA 2XSZD 1QZUA 3RJ5A 2VNJA 4RM2A 3PQFA 5AJVB 2WFZA 3BH7A 2K4IA 3Q2IA 3UMJA 2C2DA 4JP3A 4YX9A 1XSEA 2Z5LA 1U4NA 4MS1A 1VJGA 1RACA 2ZYRA 3N2IA 1NAIA 1M2KA 1K5PA 4DCUA 3IUEA 3UK1A 4J1QA 3FHTA 4LVOA 3ZDEA 4RHYA 3VSEA 2BDUA 1DG9A 3E3NA 1DZ3A 2D2VA 2IUEA 5AI4A 821PA 4KLGA 2WWTA 5FBHA 2E5WA 3MWKA 3PL1A 4IC9A 3GT3A 2WSMA 5IT0A 1IONA 1XRLA 3PR5B 1E6MA 5L4NA 2FPWA 4Y0AA 2B2CA 2QL9A 4U39A 4OMCA 3WHLA 1XA3A 1B0UA 2IKSA 3EGXA 3U0VA 1I2ZA 5BORA 1XYVA 1Z16A 4PGHA 5BN1A 3N7UA 4F9GA 2LKDA 2C98A 4OBXA 5KFSA 4MFAA 4DF4A 4NOLA 1QPGA 3GGGA 5AQEA 1ZIOA 1B2RA 1JT9A 4RJIA 1VYTA 4DLEA 4HGRA 2GBCA 2JEFA 3IESA 1U8TA 5JJCA 3UQ0A 5B7QA 2PFKA 1WW8A 3NIDB 1E1QA 2HPVA 4MVYA 1E3LA 5M29A 3B6IA 1QG2A 1EM8B 2H0RA 1AHPA 2OWEA 8LDHA 5K3EA 2PRKA 3R0IA 1MCZA 1SVNA 4DQQA 1NY5A 2I4NA 4KLHA 4Z6CA 4H7DA 4HT3B 4GVPA 4CQLB 1LD3A 2KV2A 5HKKD 1MUUA 3IBFA 4GWKA 3VPCA 4GXRA 9ICBA 4GYYA 3CNQS 3PV0A 5IAAA 3BFKA 1WX1A 5L1MA 4I9NA 2EZ4A 1AZSC 4RE5A 3A3KA 2IPLA 1X66A 2NZJA 2IA5A 3LGSA 4Q1CA 3CNBA 4RZXA 2HAEA 1QIKA 3ROMA 4M0EA 2D5AA 4Y2PA 1LBHA 4G3IA 3MGIA 3FTFA 2A6PA 4A91A 1UC4B 2VJDA 3HPOA 2K89A 4RZRA 4HDNA 4NECA 4OHCA 1QK3A 1V1JA 1SXDA 3EIHA 4CODB 2G4VA 3TMAA 5ALGA 4BNWA 4PFJA 5CVCA 1FTQA 3BORA 3K9BA 4YVZA 4NMLA 2H2DA 1NXOA 4FMPA 5J1SB 2BF7A 1EK2A 4YRTA 1DAPA 3ADDA 1WF3A 3IPYA 3USZA 5L3QB 3JQFA 1M2VB 2FW9A 2DJ5A 1SZHA 2RBEA 4UHJA 3OE7D 1D7OA 1T6BY 2ISCA 2NXEA 3G59A 3LM8A 5AVTA 5IN5A 2Z2XA 2RLTA 2LNDA 4YQZA 3PMNA 3QYFA 3N8HA 3EHDA 5G3YA 5IRCD 2UXBB 3D6VA 4ND4A 3BB4A 1NBMA 3NTVA 2ECKA 1QVAA 5LBIA 2QB1A 4ARVA 1HXHA 2I4IA 2JANA 4I36A 3EWNA 4IH1A 1RWQA 3AI2A 2QJTA 4O4JF 4K6KA 1VLJA 3ONWA 1E7YA 3OJSA 4KSCA 2QLFA 3L46A 4EBEA 1JECA 1KEZA 4LXIA 5E0KB 2V7QD 1IMJA 2MU2A 2ZVJA 1YZTA 1K27A 1Y1KE 1K7FB 4IDHA 3PWKA 2CRXA 4A0HA 1O8CA 5C18A 3Q8QB 4F12A 1CZNA 1GN9A 1OTXA 1ZSNA 1HV8A 1SKUA 5EQFA 1JX4A 2BE7A 3M33A 4Y0VA 1VE5A 5IM5A 1R64A 4Y2QA 1EVKA 5CEHA 3VO2A 5CA7A 2AQ0A 3T79A 2R7MA 2X0FA 3ZE6A 1OZFA 3VO9A 5C51B 2WZDA 5TX7A 1WDLA 2FPLA 2KJ9A 3CU5A 3CFYA 1ODIA 2PGNA 4CLHA 1TPZA 4XLLA 1WXFA 3CVXA 4DKXA 3SAFA 3IYLW 4EZEA 4K05A 3JAMA 3TRJA 1F3LA 1WMBA 2NO0A 2DPIA 3CGWA 2JCBA 2XVZA 2NLOA 2AZXA 4C76A 3U16A 3HP7A 2C4VA 4L57A 3A4YA 4RH0A 4E3ZA 4ZI5A 4DMMA 4U00A 2FPIA 3KBBA 1FXWF 1YL5A 3A3NA 4YJFA 1ZM7A 3N07A 4BTLA 3WJ1A 4EHAA 3NTXA 1XNSA 3MYRA 5JAUA 1RFGE 1E3IA 1NE7A 2PT5A 2WWXA 3AI3A 3IOMA 2FETA 3TTVA 4L9SA 1SB9A 4HGPA 4BEBA 2WHEA 1TJPB 1E2LA 4K4HA 3WFJA 3HCEA 2IUYA 2D8AA 3VPFA 2FGJA 3FHOA 2XEXA 4E46A 2FEOA 1MO3A 1R0WA 4I27A 4CTJA 4FFBB 2IZOA 3QOXA 4KTVE 3DZ8A 4BC0A 4WXYB 4FKBA 3KKMA 4GQBA 3RBVA 3NNDA 3HXTA 5K05A 1C1XA 4XCXA 4G0QA 1TT5B 1RKUA 1PI3A 3B9QA 3TSCA 1X87A 1TZKA 2ZPAA 2PY6A 3LUHA 4QZVA 3ND7A 4L5IA 3EQ7A 3E1GA 1NJGA 2AFHA 2GJAA 4CDGA 3BXHA 9ATCA 1YAHA 1ULZA 1EB8A 1SXHA 4JQOA 3D5TA 1Y9EA 2H29A 2CEAA 1J4AA 1WB9A 4BNHA 4H6WA 2RH4A 3O2SB 1TK3A 4W1QA 1XPUA 1T2NA 5JRTA 4M21A 5IYZA 1XLTA 3QVTA 2RAUA 1Q5PA 3RIGA 1W0JD 2C7BA 1PR4A 5AKKA 3QEJA 3DOEA 4P9NA 1IZZA 3G2PA 4YRAA 2FW0A 3TH5A 4OKSA 2BW0A 1RCTE 2HBYA 2P9GA 1UXGA 2E4VA 2I87A 2QZSA 4URZR 2VSOA 1WS6A 3G2LA 5EESA 1HC7A 1TLFA 3RADC 3V7WA 1H6BA 4ND8B 3F9IA 3VHRA 3OJLA 3W79A 2P67A 2AZ4A 4ZVSA 4I8XA 2PU7A 1QYDA 2HEGA 5J2UB 2WC1A 4CBVA 4QFBA 2GBLC 1FFAA 4C1BA 1NQOA 3HSSA 3AFGA 4FR0A 2FUKA 1KZHA 1YQEA 1Y8RA 3KWLA 5D86A 2LCFA 3ADOA 2BM0A 3P2MA 5F9FA 5LP6A 3TW6A 2FOIA 1M0TA 3A9VA 5SZJA 3GVPA 1UA1A 1Y4SA 4GG1A 2CFCA 4EL5A 5KL8B 3OCVA 5ALQA 3V1KA 3IOBA 4G01B 4CG1A 3VQTA 4LVCA 2P6PA 3AR2A 4QQFA 5A5FA 1WMEA 2VJYA 3N2EA 3R9XA 2J6IA 4LDRA 3F5AA 2IBSA 5TMBA 5IIMA 1W96A 3VKVA 4LJLA 5FL3A 2XMDA 2PRZA 3OTHA 3TZBA 2HCRA 5FI3A 2JH1A 3IMCA 2XXAB 3PHJA 2ASLA 2PRIA 1E2UA 4R8SA 3HKCB 3CT6A 1L5LA 1AH2A 5DLEA 1EUCB 5BSRA 5EOVA 4BZQA 2WG2A 1E0AA 4EY5A 4F5PA 2YIMA 3H0KA 4YG2A 5J47A 5UKDA 1TE2A 4IDOA 3EHEA 4GOND 2O2SA 4HX2A 3I9MA 3EXHC 3BWCA 1OXSC 2VJPA 3L92A 3MIZA 1XO1A 2OV3A 3QEMA 3NR2A 2FR1A 3EWSA 3L7BA 4MV1A 1JQAA 2EP7A 2WVHA 5D5QA 4HN9A 1KY2A 1WPXA 4IX9A 1YOVB 4OX9B 2WYWA 4L1KA 3A58B 4I2DA 3IIIA 5EE1A 1GAWA 2BHTA 5CNJA 3PIDA 4TWZA 1CRXA 3V8NA 3K0AA 3GRUA 2Z4SA 4FQ8A 3GLIE 4F2GA 1C7ZA 1AZLA 1EZ1A 4TTAA 3JTMA 4M88A 4YS6A 4OKNA 3REQA 1TNDA 4FBGA 1YV9A 4MLDA 3H1FA 8ATCA 1E3WB 3DMNA 3FZGA 5HKBA 4CT5A 1GTL1 4JC4A 4G0NA 3X0DA 2H4JA 4C0AC 4DQPA 3JATB 1AZWA 4LMBA 1QE0A 2W43A 4JK1A 1J25A 2EDAA 4GC6A 4IOKA 2F1KA 5LIRA 1TVKA 4PG6A 2J3DA 2HSWA 2WJ6A 4NHOA 4RPCA 1A96A 1DQNA 4Y2JA 1BD4A 2X7HA 3D8SA 2FW1A 1QK4A 3ZD6A 3DZDA 1Q50A 2H07A 1ZCZA 3C0KA 3Q1KA 5IBCA 1FU4A 1JSZA 2ZI3A 2RG7A 2YWXA 1N32B 2D2XA 3K4PA 3LCUA 1PKXA 3HEBA 5I9SA 4MQMA 4FR5A 2ID7A 3BIJA 4EYIB 4KLNA 3F2CA 2R1UA 5IASA 2D7DA 3ADPA 3U1BA 4QDKA 2NX2A 5DWDA 1MC1A 4C29A 2CFOA 4C8OA 3H0EA 2XDAA 1JDJA 4HAOA 4TV8B 4ZCIA 4YRCA 4ESEA 3LJKA 3VDQA 1CY4A 4RENA 4PRLA 4EHKA 3LGXA 4O08A 4DNOA 5BWMA 1RZ3A 3QU9A 3QPAA 4HLDA 1IU9A 5F2NA 1W48A 1J2MA 2PIAA 1QGYA 4Z5XA 3OESA 1N5IA 2QTRA 5BUCA 1QYWA 2VJOA 4Q3BA 1DXYA 2ZYHA 4CM6A 1N5LA 4FHDA 4RK1A 3U40A 3GK3A 4ESOA 5B2ZA 3UAVA 2ASJA 5JZBA 4R2KA 1L5SA 4UHHA 3E3LA 2C61A 5LBTA 1UIRA 4R2WA 3RAPR 4CI9A 3ABQB 1RWNA 1NZFA 4OQXA 5CDFE 5CVVA 4QXAA 4EELA 3ZDDA 3I58A 1BA3A 4DFKA 4FGKA 2IRWA 2QNIA 3A6HA 1SU8A 3AMVA 4X5VA 4OQQA 1RT9A 5EOZA 1GA1A 3GUCA 1LY1A 4UUAA 3L06A 1W36B 2KICA 4W7HA 3AUXA 5JXGA 5E8RA 3CO5A 2OCYC 1T5HX 9LDBA 2C88A 2JGIA 3RJHA 3VU0A 4FHEA 3LL4A 4Z99A 1DQRA 3BHNA 5G5HA 3X1KA 1VYUA 4EG1A 2WF5A 5CVTA 5HF6A 3UM9A 4YJDA 3U60B 2W90A 4J1TC 3ROFA 3KKNA 5JQWA 1YHYA 3L84A 4K28A 4CGZA 2IDMA 2YBEA 5BOSB 5DSZA 1AUQA 2BELA 1PNTA 4UNNA 1KK2A 2W5UA 4PSDA 4RL6A 4X41A 1NK7A 2CVHA 3H42B 3P9CA 4YP5A 1J22A 3F8SA 2H1SA 3PXEA 1NK5A 2OESA 4CHGA 4HEA1 2HB6A 3KFXA 5C8YA 5IC5A 5D87A 3TNFA 1EUQA 6LDHA 4IQVA 4IG9A 2YN4A 3F5SA 4BC1A 1YNSA 1BKYA 3IHWA 4E94A 1KVSA 2AXPA 2D54A 2WTFA 4ZZ0A 3FWKA 4PZEA 1XZMA 4JUCA 3VCBA 3T0GA 3FAHA 2X1HA 2OBBA 2UYQA 5FOSA 2WJ3A 4GEKA 2XCQA 3PJGA 1D8YA 2G72A 2ZXIA 1BVUA 1P31A 4W6QA 2JIMA 3TRKA 1T35A 4WK6A 2N47A 3W6ZA 1BDJA 1VKJA 3UPTA 4F3YA 3KVRA 2I91A 4MEBA 3GJSA 4PPFA 3HVRA 4Z86A 1IRXA 2OV2A 5TY0A 2P4SA 2Y76A 3P2EA 1CHNA 3GLKA 1BXRA 4P5DA 4MHVA 5EWLB 3A26A 1HE4A 5GM2A 4AY4A 2ZKLA 4FZLA 2IYUA 4HGNA 1LPSA 1CRQA 1XNHA 3H2YA 2AT1A 4QU5A 5JTIA 1WF6A 3M2PA 3R5FA 5CM2Z 4BNDB 3AOGA 5KJ1A 2EJWA 1GL7A 3L8MA 1YS7A 2Z1NA 3IAS1 2ZIVA 2VKQA 3AF5A 1MFZA 2V7BA 4HJRA 3VGJA 1LDBA 2Q41A 4E5MA 1N62A 3D6TB 3IOYA 4C87A 1BPDA 4KQHA 3GNLA 4KRGA 3WFIA 3AJ8A 4R69A 4NMXB 1T4CB 3E23A 4QNLA 5KFBA 3TPFA 1OBVA 1ZH8A 1L7RA 4F9TA 2IXBA 2JLQA 3DHVA 3MTGA 2QRHA 1TM5E 3AF4A 1NW8A 1DS6A 4WINA 3L0IB 4IQGA 1N6KA 1ZM9A 1WYGA 4Q9LA 4RULA 1T0PA 2RP5A 3ISDA 4NY8A 3GN1A 1P44A 1IZ9A 5ALNA 1PWEA 1YJ8A 2VXBA 2QUJA 5CHGA 3EOBI 3FAZA 5JTTA 2W03A 4TTQA 3OTQA 5CFMA 1TJYA 1WSAA 2X41A 3IVRA 5F7JA 3KZOA 5JCJA 4FBUA 1CD5A 1J1IA 2GXUA 4UOEA 4EITA 3PC7A 3BTOA 4QGSA 3WIEA 3IEMA 3NKLA 4MR8B 3TARA 4G1VA 3FYUB 4F50A 4I5IA 3PHBE 3PDHA 2QVZX 2M9NA 1JLSA 2IIPA 1NBHA 4R63A 1MVNA 5T57A 4BBJA 1ZQTA 2KE7A 1M2OA 4L6CA 4U3JA 3B6KA 4CRXA 2WNHA 3AERA 1KYWA 2YJTD 4IHAA 2HV9A 4YVFA 1A69A 2B34A 5DTMA 4DR1B 3BA1A 3O2QB 2W6ZA 3OBBA 1MN6A 3DDZX 5I7VA 2I62A 1Z25A 2F1OA 2BTEA 3BN3A 4F2DA 4W1PA 3HN2A 4JIGA 2VH1A 5IU6A 3T5JA 1I01A 1QRSA 2ZS8A 2VDJA 1M34A 3W0LB 4EB3A 4NDNE 1I33A 1C9MA 4MW2A 1RWBA 2HLDD 4JVMA 1UM8A 4O4JA 4KFCA 5KT2A 5ESXA 5K3FA 4AVYA 3C7CB 2IYQA 3E0XA 1OIVA 1YR2A 4IIFA 1UC5B 2QVXX 3OLWA 1I7SB 4RVHA 3WGTA 1YFJA 2HYDA 1R5OA 4H7KA 1QAQA 5WRFA 4Q1VA 2B8TA 3RUFA 3L8ZA 5AXAA 3WNVA 4B3BA 1P2BA 3AM1A 1NI4B 4R1TA 2J3MA 4QZHA 1LH0A 3MN1A 4PLZA 3RASA 1LDYA 2C4MA 1GT6A 3ICPA 4R9VA 3F4KA 5B55A 3ICQB 1I80A 4TS1A 3N7AA 1K1QA 3GAMA 4P80A 4K9SA 1LQTA 1B15A 4M0DA 4ECEA 1XIVA 2YJ3A 2HA5A 4IV8A 5DW0A 1KXZA 2CHEA 2Q5EA 2YWRA 1VE3A 4BJ6A 4MCJA 3L0YA 1T5OA 5AM4A 2YV2A 1VXRA 1WCIA 4DQDA 5CWRA 4YMSA 1X6JA 2QD2A 1BXZA 2OXIA 3B5JA 4WESA 2V7WA 1L3TA 3F6SA 3HYCA 4XYBA 2R1ZA 4IHJB 3A25A 1HL7A 1YSCA 4XR4A 2ZZMA 5HBRA 1NHWA 4O33A 3DMTA 1BN7A 2BKUA 1FXWA 1MNQA 3ZKWB 3PW7A 3RU9A 4FYYA 4EARA 1ZXXA 4J4TA 1J2RA 1GGJA 5G4LA 5KSPA 3G8YA 1JPJA 4ZEXA 3BD9A 5KNDA 1ZU4A 1Z73A 3S7ZA 3FLMA 3RYTC 1T3HA 2AGPA 5IJXA 4M1SA 3U44A 5EIHA 3WK6A 1Z1VA 5K0SA 2A1JB 4NCJA 4Z3KA 3G23A 4Q9JA 3WICA 1PBTA 5CDHA 3RARA 5CYGA 2KFNA 3D59A 1X9XA 3I6IA 3I42A 4PLCA 2EYUA 3ER9A 1YCDA 3RS3A 2NSDA 3R8CA 1SA0B 1B76A 1U3CA 1RZRD 4DHWA 1YGYA 3C3CA 1Z7BA 1DBWA 2Q3EA 1ZD2P 2RGWA 1BOOA 2YWEA 5K8VA 1DIBA 5CDUA 2JD0A 1W8IA 3OTWA 4COKA 3N8KA 5LP6C 1GG9A 2ZJ1A 1BQEA 1K7SN 1MQAA 5CB6A 4HGQA 2PH3A 1I51A 2YHIA 2QYHA 5JARA 2R87A 3K7EA 1P2DA 2BIFA 2F6RA 1L5KA 3SC4A 4P0QB 1SUAA 2ZXHA 2HVHA 2GKSA 3Q8KA 4ZRDA 2Y67A 1T29A 3LQ1A 2BDPA 4D0RA 2KSOA 4TT3D 1GR0A 1F60A 1SHJA 5EKDA 4F96A 3GEBA 1O94A 3S2GA 2W0SA 3EVCA 4LX0A 1Q22A 2BDEA 4YWJA 1L5HB 4GOLD 5FPQA 2QTLA 4S1NA 4NP6A 4CEHB 1XT6A 4C05A 2ES6A 1BW9A 2F3TA 4HATA 2EAOA 3B36A 4CGYA 4MRRA 2GERA 1LI7A 3CZPA 3KWJA 4BBPA 2O8FA 2R2GA 4DV2B 3R75A 1YB5A 1XWFA 2HCFA 4PG7A 2W9BB 1GZ7A 3DZHA 1SU6A 2IE0A 1T4BA 3CISA 4A6EA 3KBOA 4LXTA 4DR5B 1JLRA 2JKZA 3HCDA 1NX9A 2WHPB 4E30A 1QVWA 3AF0A 1FJGB 2RBKA 3TVDA 3KKAA 1V8FA 1G16A 2D5LA 3AZQA 4R3NA 4GHWA 4PHDA 2GSWA 2PKYX 2FV8A 4BNUA 2DL0A 4HRXA 2IHNA 3VDXA 2JA1A 3VJKA 1V71A 1TK5A 3LFTA 1HE8B 2Z3WA 3N8NA 3K53A 3GLQA 1P77A 3FBGA 2WUGA 3KAQA 5CVJA 5DF1A 5ICSA 1G38A 2OBLA 1XQ6A 1KVTA 3ETJA 1LBEA 1OXMA 1ZM2A 3JPNA 4HRVA 4TVSA 3NORA 3RDPA 1FA9A 4UAVA 4CQJA 4Z4EA 1MX1A 3MRSA 4MB6A 2A9KA 2W3RA 4V3BA 3MIIA 2R8OA 3OMLA 4IJKA 3FNGA 1XRSB 3W06A 4RZSA 1X14A 3A1VA 5CIWA 2DP4E 2EKBA 4URVR 1KKUA 2WMOB 1HDZA 4D9IA 2HR1A 3CLUC 5LBUA 4M37A 1EFLA 7MHTA 4UBMA 5KTSA 3N59A 2DERA 1ISRA 2FPGA 3ZE0B 4MWOA 4OMDA 2ZIUA 2Q5OA 4G0UA 1LJ8A 3W9BA 5MFPA 5AOCA 4MROA 3T5MA 3P2OA 3MUEA 1M2WA 4Y1GA 1H8ED 3WNCA 1RJGA 4NNPA 3HKEA 4J7AA 4L9RA 1PLJA 4LJ7A 3IV6A 3ZZMA 5ALHA 1BQ4A 3FWNA 3UJ7A 1QZXA 1J23A 4J0DA 4CT4B 4KACA 1LV8A 4XFJA 2P65A 5EWJA 2BPOA 5J0PA 3T3IA 1CS0B 5JMTA 3T35A 3DE6X 1T5BA 4ED7A 2AVDA 4YO7A 2IJGX 2B36A 3EYZA 2JLZA 2ILVA 3TZCA 4DJEC 2I66A 1DWQA 2B8WA 5A3JA 1Q16A 1WUYA 3ND6A 3QBEA 3QF7A 5FNVA 4URYR 3UT0A 1DFHA 4FN5A 4Y2VA 1PR0A 4CUKA 3FROA 2ZKIA 4Q93A 2GRJA 2G5PA 5DGXA 3DVSX 1TQ6A 3ZXXA 4C5AA 2I55A 3L0ZA 1EX7A 3AESB 2UVDA 4C6SA 1HYGA 4BLQA 3GGSA 4NE2A 3C7AA 4F2WA 1KVRA 2D1YA 3BBLA 5TXGA 3PPYA 2PFNA 8AT1A 2IXDA 3H5LA 2ZSKA 1P91A 3RJJA 2V8BA 5IH7A 2D2EA 4IFTA 3FTQA 5JANA 3KXPA 3Q5EA 1PT8A 1LZKA 4J29A 1Y7HA 2XQFA 4GUAA 3AVWA 4YAJA 1MQ2A 4U8GA 2AEJA 5EXEA 3SDSA 4AWBA 4WSOA 1CLUA 3GLFE 2I1LA 4Q21A 4GLXA 3SF0A 4GF5A 2P79A 1CNFA 2UU9B 1FY2A 1SB3C 3BQ9A 4FD2A 1JR4A 3RKRA 4ZJYA 1MB9A 5HHIA 5ALTA 5C1BA 3TAPA 1CUJA 1N2CE 2IUFA 2QMUA 1XYYA 5J0UA 4WKNA 2GNPA 2B2NA 3KQHA 1VLHA 2KG5A 3DTTA 4C4YA 3K31A 1AV7A 4LC1A 1YRLA 1X39A 2HNKA 1ZISA 1TUEA 1UBSB 3DXFA 2WSIA 4KYIB 5D00A 4OP1A 1KU0A 4KEAA 3D7MA 2DX7A 4EJMA 3RRJA 5HBGA 4IDFA 1CBUA 4EKIA 3UTCA 4ZCTA 4FDMA 5DB9A 4J16A 4TROA 4WZBB 4MVJD 4F5OA 4RQAA 5G02A 1ULBA 4CT0A 4YRRA 2OXRA 1DUIA 3M5CA 3RKUA 2WDZA 2GARA 1QU2A 2JLBA 1OH8A 5ARBA 1OX6A 2Z8YA 3A36A 3MJSA 1N92A 3M6MD 1O5TA 4EJ6A 1DQZA 1G8KA 2VJCA 4XH9B 5F23A 2YXBA 3OTGA 3OCUA 3LFUA 3LDUA 1B0PA 4U2KA 1JI0A 3ZZUA 5ES4B 3WB9A 4H7EA 1Z4MA 2EU8A 3D81A 1O89A 4GXTA 4JZKA 3MCVA 1I13A 1R0LA 1MGPA 4IICA 1UDAA 5IYZF 1KPHA 3EB9A 3DXZA 4LOJA 3F73A 1OXUA 2MYPA 2X2FA 4G5OA 4AJEA 4RK0A 5IC6A 4OHRA 5KYWB 4KR2A 4ED3A 1FTSA 4MDFA 2I3ZA 1MKYA 2XTMA 4N3NA 4UE2A 1OAOA 2HRDA 1WCNA 3RS7A 3I6YA 3ZBPA 4FIDA 4DDWA 2FUG1 2WDPA 2HO5A 4MKFA 1TTTA