2VKQA

Crystal structure of human cytosolic 5'-nucleotidase iii (cn-iii, nt5c3) in complex with beryllium trifluoride
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'- Nucleotidase III
rcsb
source organism Homo sapiens
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2vkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2vkqA01
5AVQA 1RKVA 4MWOA 5ALRA 4F71A 5AW0A 4YCLA 1RPZA 5ALVA 2NYVA 2GHTA 3W5DA 1Q92A 1ZD2P 3QYPA 3RF6A 1PW5A 1QQ7A 2I6XA 5AKLA 4BX2A 1CQZA 2WF6A 3BWVA 1FEZA 1J8DA 2G09A 3FVVA 4Y2TA 3UMCA 3WK8A 4RETA 4KYTA 3ZTWA 2ZOSA 1WVIA 3NANA 1Z4IA 4UAVA 2ZXEA 4AP9A 3E84A 1RDFA 2I33A 2HDOA 4UARA 5AW1A 4UMVA 4EX6A 1Y8AA 4HGNA 4Y2UA 1ZD5A 4H1WA 3E8MA 3EPRA 3TLMA 2BDUA 2R8ZA 3ZI4A 1QQ5A 1ZD3A 3OTQA 3QUCA 4Y2QA 3N28A 3VAYA 2G0AA 2IOFA 1Z4PX 4KNVA 5ALTA 4C4TA 2Q4RA 4HGPA 2WF5A 4DWOA 5AM4A 4BX0A 4MUMA 5ALMA 2OA0A 3AR6A 3QU5A 2WF8A 3WK5A 4BKMA 5ALJA 2FDRA 2GHQA 2JARA 5ALDA 5E0OA 4NFLA 1QYIA 2IYEA 5AW6A 4I9GA 1O03A 2EAUA 5AW5A 4NWIA 4CE6A 2OBBA 4HGOA 3IRUA 4QJBA 2YN4A 5ALKA 3BA6A 5ALUA 4BBJA 1YMQA 4DCCA 2CFTA 4UU1A 4Y3UA 5AKJA 1Z88A 5IT4A 3PDWA 3WKCA 5AW4A 3IJ5A 2B1RA 3MMZA 3WK4A 3NUQA 1EK1A 5AW7A 4C4SA 1L8OA 3ZX5A 4HYTA 3W5CA 2FEAA 4C4RA 2VKQA 2AMYA 4CF3A 3GYGA 2EARA 1YNSA 3F9RA 1AQ6A 3RFUA 2JAOA 1ZRNA 1VJ5A 2HF2A 3DNPA 1S8OA 3I76A 5ALSA 3I1YA 3NAMA 2G07A 2WF7A 3PGVA 5AK4A 5AI4A 3ZX4A 4FYPA 3NASA 2B8JA 4F72A 4BX3A 2O2XA 2FUCA 3A3YA 4PNHA 4HGQA 3QGMA 1F5SA 2W11A 5AIAA 3OCZA 4Y2YA 1QH9A 1T5SA 2PR7A 4YH1A 4AS2A 5AW2A 1EK2A 4Y2SA 4ZEVA 3QU2A 3OCXA 5ALFA 5AW3A 1O08A 4OD0A 3UM9A 3AR9A 1Z4KA 3ZTYA 5AVTA 1L7NA 1Z4MA 3KDPA 3ESQA 5AKYA 4YIHA 2GO7A 5IS2A 1XP5A 3CNHA 2C9MA 2OM6A 3FGOA 3K1ZA 3P96A 1RQLA 2AH5A 3QX7A 5AESA 1U7PA 5FP0A 2G1AA 5AKGA 5AKIA 1RMYA 2YJ6A 5IT0A 4J03A 4B6JA 3ZUPA 5AI0A 4ZEWA 2FPRA 4I9FA 3L0YA 2BY4A 1NF2A 1MH9A 4HAIA 3AR4A 3M9LA 4NAVA 2YFYA 3WK6A 5AM1A 1VFPA 4EX7A 4G63A 1XVIA 2HI0A 1ZOLA 3L8HA 5AKZA 5AK5A 5ALYA 1TJ5A 3SLRA 2AGVA 4AS3A 2C88A 5AVYA 1U2SA 3L5KA 2Q5EA 4KX5A 1U02A 3AR2A 5AI8A 2JGAA 3ZWDA 2ZBDA 2I7DA 2ZBGA 2C8KA 5ALGA 3B8EA 3AR5A 3W5BA 2FPSA 3QU4A 4IG4A 4HGRA 3IB6A 4Y2JA 1J97A 4YCMA 3SKYA 3AR7A 2CN1A 3WKBA 4DW8A 3KC2A 3ZVNA 4UMEA 2WHEA 5A3QA 4G9BA 4J2TA 5AKXA 3QUBA 2IOFK 3CZ4A 5AVUA 3SMVA 4L6CA 2OYCA 2B8EA 1NRWA 2YJ3A 2DQSA 2FPUA 2YMLA 5AM5A 3R9KA 1RLTA 3UMBA 2C4NA 1ZRMA 3J7TA 1K1EA 1L7OA 3B9RA 3QUTA 1X42A 4UM5A 1TE2A 2RB5A 3ZW7A 2G06A 3ESRA 2P27A 4UMDA 2JAUA 1Z4LA 2YMQA 2ZBEA 1YDFA 3AR3A 1YS9A 5ALXA 2WM8A 3FPBA 1JUDA 2IOHA 4L57A 4YCNA 5AK6A 3W5AA 2HEGA 1QQ6A 1LTQA 2MSNA 3L8EA 5AKHA 5ALQA 5AW9A 2ZBFA 3L1UA 3PGLA 1U7OA 5AI6A 2HCFA 2HOQA 1ZD4A 2RARA 3E81A 4XE5A 1SWVA 2P69A 5AIBA 4OCZA 4Y2VA 5AKKA 2FPXA 3U7GA 2QLTA 3B9BA 2G08A 3DV9A 3ET4A 3HLTA 4QQFA 1XPJA 3ZWKA 1WR8A 5AM0A 2WFAA 2EATA 2NO4A 2RAVA 4RESA 2P9JA 5JJBA 2HHLA 4GIBA 4YIKA 2FPWA 4BEVA 1RKUA 4EEKA 1T5TA 2HSZA 3QNMA 3M1YA 5A3SA 3N1UA 1L7PA 3PCTA 3MPOA 3S6JA 3AR8A 1RKQA 3NIWA 3OCUA 2ZG6A 1RMQA 3L0CA 5ALOA 3WGVA 3KD3A 1N8NA 4EENA 3WKDA 5ALHA 2QYHA 4Y2RA 2CFSA 2WF9A 1Z5GA 5AK3A 3N5KA 2B0CA 4XOUA 4Y2XA 3QUQA 4EZEA 1TA0A 4KN8A 4NABA 4NV0A 2NO5A 1ZJJA 2PQ0A 3FPSA 2YJ4A 1LVHA 2C8LA 3OCWA 3SD7A 1KYTA 5ALZA 3WKEA 2W4MA 3QU7A 1ZS9A 3HYCA 5AVRA 2P11A 5AM2A 4UW9A 4UM7A 3EF0A 4UMFA 2R8YA 4CNQA 4KNWA 3ZU6A 3E58A 1RLMA 5AVWA 2JAWA 5ALIA 4CF5A 3ET5A 5AVVA 5AI5A 5AVXA 3KBBA 2GMWA 3OPXA 5ALEA 2YMPA 1L7MA 4KX3A 1SWWA 4GXTA 4OFZA 1Z4JA 2GFHA 4FFDA 3QU9A 2R8XA 5AHXA 3ZVLA 2AUTA 1WZCA 2B30A 2B1QA 4XPZA 1NNLA 4E88A 1Z4OA 4UASA 3U7FB 3QLEA 3L0BA 1RC8A 2HO4A 2I54A 1RLOA 3L7YA 5ALLA 1Z4NA 4Y2PA 3I28A 1T9ZA 4DFDA 2O9JA 2IA5A 3MN1A 4CF4A 1IWOA 3U7HB 2YMMA 1RQNA 4EELA 4XQ0A 4BNDA 3ONNA 2YY6A 1U2TA 1RMTA 2CFRA 4O8CA 3N07A 2BDEA 1CR6A 3SKXA 3DDHA 3SHQA 3R4CA 2X4DA 4OHFA 4JB3A 3WK9A 4FE3A 1TJ3A 5AW8A 3WKAA 3EWIA 5AI9A 2ODAA 4UATA 3U13A 2I34A 1RRCA 5AM3A 3WK7A 5AVZA 2HF7A 3SF0A 1WPGA 2R8EA 5AKEA 2G80A 3A1CA 3L8GA 2I55A 3D6JA 4IFTA 4UAUA 3FZQA 5AICA 2Q4TA 4YGYA 3UMGA 2FI1A 3L8FA 4BEWA 3OCYA 5ALPA 1L6RA 3A1DA 5ALNA 2D2VA 2PKEA 3N8GA 3KZXA 4L6AA 1Z4QA 1Z5UA 2B82A 1Q91A 2MU1A 2HX1A 3KOOA 3WGUA 3U7EB 3I6BA 1VJRA 5ALWA 3R09A 1L8LA 5T41A 3EF1A 3ZVMA 1S2OA 2FUEA 1N9KA 3MC1A 4BNDB 2RBKA 3NALA 3A1EA 5A3RA 2W43A 3DAOA 2YBDA 5AVSA 4JDPA 4UU0A 4BYGA 1YV9A 3NRJA 1SU4A 3OCVA 3U19A 3QXGA 3FM9A 1TJ4A 3ED5A 2YJ5A 1YJ5A 4ZEXA 3U26A 3L1VA
chains in the Genus database with same CATH superfamily
1C1DA 1AJEA 2OHFA 1TYAE 1B6TA 4RMIA 4GXRA 2OGTA 1XX6A 2VPIA 4PQYA 1WDLA 1F2TB 5KDOA 4AK9A 2G6BA 3OEED 4TZKA 2KJ9A 3KSBC 3HW8A 5FTKA 4XOIA 3UXEA 3RBEA 1VXOA 2QSZA 4BLOA 3CISA 5JXWA 3HY3A 2PUCA 4NMMA 1RZTA 4E5VA 3H87A 3DDCA 2RHWA 4YONB 3I34X 4XB6B 4BX0A 4AZ0B 2PAFA 2O8EA 1WCWA 2PT7A 1PJBA 4NMHA 1Z0SA 2FW1A 4M0LA 4R66A 1P7CA 5JO0A 3A28A 2NV0A 3EEIA 3F9RA 1MABB 3W3ZB 4AYBC 1WXWA 3LV8A 3AVUA 3A6JA 4CHTA 1FE8A 3RTDA 1GIAA 3UMMA 1C1XB 4GD3Q 2J0UA 2XADA 4XD2A 1QQAA 4CEHA 3DHNA 2ODWA 4RVHA 1ZMBA 2V3CC 3LQ2A 3H5OA 3WMWA 3DOIA 4Y6RA 4UREA 4IBOA 1F0PA 1JHOA 1SBHA 1R0KA 1OBHA 3I8SA 1Z3CA 2C2MA 4YRAA 4XFJA 4ZCLA 1KJIA 1DO0A 2XIDA 4OI1A 3RS3A 1SUIA 2QQ0A 1QH0A 5KTSA 2X8WA 2FH5B 1TUBA 1DO8A 3UHAA 3IFSA 8ICTA 1ESNA 1IH8A 4XB1A 4PPXA 2C95A 3UNXA 3ZNOA 2YJ3A 1YZLA 2Q3CA 4EL5A 1UFVA 3DGEC 1SCDA 4IGIA 2HK7A 3KXKA 5FAXA 3X1DA 3CPHA 3HS3A 1XAHA 4PLWA 4NZ9A 3LXXA 1I9CA 2V58A 4N5IX 4P31A 3GCGA 2VDQB 4LE2A 1X7XB 3N0WA 2WUDA 3UUGA 4M9GA 3DD1A 3OIYA 1E63A 1TAMA 5DHUA 3PCTA 2GNAA 4IKEA 3IIEA 4QZGA 5IJAA 2D6FC 4LQCA 4JBHA 3MOSA 1GY8A 1R8JA 2E4XA 1TV9A 1S2LA 1CUWA 1G7SA 4LRXA 1P5FA 4ZYXA 1YOVB 2JLXA 1SIBE 2GLUA 1QE0A 1DX9A 2AUMA 3DAPA 2WAAA 4EHDA 4BBZA 3IOBA 3PO4A 1E3QA 4KFRA 2QPOA 2G71A 5FUYA 4UB1A 3QLUC 4P84A 3DP7A 2WYUA 1F1BA 4CNQA 3ZHUA 3K94A 1TU0A 1YR8A 3W6ZA 3ZIDA 1BNPA 3RUAA 2K4IA 4S2UA 3JATA 4Y6SA 4ZT6A 4CN8A 2HJ9A 1OYWA 1ADBA 4QQKA 5IBCA 2HW8A 5JEDA 2A1TR 4KMOA 3ZCSA 3IKMB 3R24A 5JZ9A 1DOQA 3T8YA 1YBAA 4EY5A 3DKKA 3ICOA 1TMOA 1NK6A 2VJMA 1J0DA 2KE5A 4LN1A 2HF7A 1WPGA 1N2XA 4ED3A 1C7JA 2AQ8A 4NE9A 4QTUB 5E4YA 3DE3X 4MS4A 2Q6LA 1P6QA 1Z2AA 3W3AA 4PYLA 4DA4A 3UWDA 4RK4A 1YMVA 3ZQ6A 5E1OA 3GR6A 5E0KB 3IQDB 3TK1A 5LXTB 2KKPA 2VAVA 3VDMA 2R4UA 5EJAA 4NG4A 4BNWA 2YUIA 4NMXB 4II3A 3HZZA 1CWUA 4HWSA 2RHMA 2CVZA 1UIMA 4MWOA 3BQTA 5J8YA 1OXKB 4ZH4A 3AVVA 1K8XB 2PGAA 2WJWA 4W5NA 1SL1A 3FDSA 2JK1A 9ICBA 2NU7A 1XQYA 4JXXA 4O3QA 3U56A 3RWBA 4PE5B 2K2QB 5KNBD 3PVSA 5D7NA 5KTYA 3U3MA 5CX1B 3BL6A 3T3IA 1KKLA 1U1GA 4Q21A 3TZQA 2LWIA 2I87A 7ICMA 5K4HA 1BYIA 1T4MA 4LMPA 2FAXA 4D0LB 5ALUA 2X2FA 1XLVA 3E1SA 1YMQA 3RRXA 3D3KA 4F4YA 3SIRA 1P4SA 3SQDA 1OXMA 4QATA 4EHBA 1C9KA 3KPYA 3WK4A 4HI0E 4MKFA 4PRZA 2ZTVA 1SCQA 4JS0A 1B4FA 5B6IA 4EHKA 4PG7A 2H7XA 1XO0A 3IDSA 1GG2A 4O3PA 4K88A 1A82A 2PT9A 4M8KA 2ZCUA 3EASA 3DH0A 4IHQA 3QKUA 3HJAA 2Q2VA 2GSDA 1DBSA 2IUSA 2AMLA 3KAQA 3LLSA 1Z39A 1TUGA 4JLAA 4RD1A 3EIUA 4KO2S 4V0KA 4HDAA 5J2EA 1KMIY 5K4AA 4EKDA 2ARKA 5LM3A 3D6NB 2M32A 4C4ZA 1F48A 3SHFA 3PUWA 4RH0A 3C3EA 4D26A 5DN9A 3KZ1E 1VMIA 1HL7A 4C8KA 3SEFA 2WJPA 2TMYA 2VP6A 2C8KA 4LXTA 2IKSA 3I1FA 3UWPA 2WTNA 3IXQA 3H2KA 5CDGA 1NNUA 1ZI9A 1M1YB 3IESA 4BAZA 3D4IA 1Q14A 4RANA 5JTUA 1DBRA 4YP1A 1IBCA 5HF6A 2WHEA 4C88A 2FW6A 4L8FA 1RJGA 3K4HA 1W30A 1QCCA 3REQB 3LUPA 5HK8A 1YAJA 3V3TA 5LIPA 3B9RA 2Z5LA 3HSKA 2YWCA 1JUDA 4PSKA 4EG8A 7ICNA 3TLEA 2QRKA 3MB5A 3QX3A 1VJTA 1TCBA 1MO2A 4O2LA 4IINA 3B70A 4RK1A 3NW9A 2PSHA 2H4WA 1BG6A 5I3ZA 5C4IA 4XUEA 3OZWA 2FW9A 3S6JA 3CMCO 1UDAA 3A37A 5C81A 5C7OO 2ZDHA 4F46A 3NHAA 2CKMA 1O6ZA 4Q7MB 2VJBA 1TA0A 2P4QA 3MUEA 4QU5A 3OFVA 3EXHA 2NW6A 3FYUA 4HVTA 1JEYA 4QZVA 1QYVA 1ZGAA 2ZE7A 4R2KA 3CF6R 3RTCA 4KXYA 3WLMA 3FYTA 3IP4B 3TKLA 3W8NA 5HRUA 3ZVLA 4UJ5A 5H16A 1A4XA 3FCAA 3CNOA 3PXDA 5JARA 2WZDA 1ZNXA 2I54A 1SBCA 2J8ZA 4CM6A 5JD6A 3JPOA 4B48A 2AJTA 3UJ3X 8ICSA 5KTNA 3LFTA 1T3NA 1XYVA 3EFHA 3R5SA 3I09A 4KTVE 5L4LA 4TN5A 3NWOA 3HXLA 1XT6A 2Y1LA 2Q27A 4M0UA 4TZTA 3D8SA 2M9NA 4J07A 1W47A 3H3JA 4RFSB 2BCRA 3WL5A 1IB0A 3VDXA 4TVOA 3CPJB 3ISJA 3IKVA 2W6MA 1E2GA 4C7KA 4KSCA 2BHSA 4JVMA 4BWFB 5TMEA 3EVNA 4RKFA 3DFMA 1CETA 4JUAA 4PCAA 5CYFA 1FC0A 4FEEA 2VF7A 1IDOA 1P0PA 1Q84A 5JMTA 4O3SA 3IODA 4O3OA 3ISBA 1ONNA 5EZYA 3M7DA 3L7KA 2ZRNA 4BMCA 4AICA 3OZCA 1D2AA 1PK1B 3L46A 1KEKA 3BEDA 1WW3A 3NLLA 4GOMD 4CV3A 2NYVA 3H1BA 1UADA 2IH2A 2WTUA 3JQ8B 2XY4A 2I6XA 2I3ZA 2RGCA 1BRTA 1JJFA 2ZP1A 1IG3A 4EB0A 2YH2A 3HYRA 3JQCA 4RQ6A 4G23A 2YNMA 2IEAA 1KY4A 2PNJA 4UPVA 3GEGA 1I14A 3H18A 4WCFC 5IINA 5L4NA 3AINA 1IWBB 3LDGA 3IMEA 4M38A 1EHCA 9ICQA 1A1VA 1BH6A 3CKLA 3DZFA 3GLVA 2BN4A 1QQTA 3I05A 4B4OA 4IQ4A 4PGQA 2JARA 2VPXA 3O8NA 2BGUA 1KW4A 1IXRA 4B43A 1QHGA 4CE6A 3K9QO 4C7OB 3NGLA 5G2OA 4B46A 2XZOA 4BFCA 1E5XA 3GJ8A 1F5NA 5FTMA 3ZU2A 1PJ3A 4OJLA 5AW7A 1PYGA 3MBIA 4EG7A 1OJLA 2RHOA 4N0PA 4JBLA 3OETA 1G6HA 1OGYA 1VJGA 5ICGA 5LR6A 2ID7A 4AJLA 1K7EB 3TLKA 4DO9A 1CF9A 5DHPA 3GA7A 5EWEA 4F2SA 4IIDA 4CCAA 1HETA 3OZUA 5JS8A 4JYPA 3AKDA 5J0QA 1A98A 1Y9EA 4J0DA 2ILTA 3LLVA 4M1TA 2QTFA 2IHUA 1KEJA 5ECGC 1AHPA 4RIIA 4JLVA 3GFGA 4RPXA 1ENYA 3U9TA 3EEOA 2AQHA 4BJQA 1V5EA 1DOAA 3JPNA 4P54A 4F4XA 1Z5WA 5IXSA 3A3KA 3VR3A 3KOWA 3WNCA 2W2KA 3H9BA 4D98A 2Q5FA 2ZREA 4RQ1A 4TLAA 4FTWA 3B52X 3VC2A 3DYBA 3V46A 2OZLB 3OLQA 5KHAA 2C03A 3AU2A 3CF2A 2OC4A 1P9OA 4EYIB 4TLBA 1K5PA 3S8EA 3COPA 2FE1A 5E1MA 4NU5A 2YFKA 4LV8B 3ZWBA 4XJXA 3UB4A 4DV7B 4QZFA 2D3WA 4D4KA 3VGJA 3C45A 3PNVA 4I5GA 1Z5OA 4RM3A 1E2LA 2CB9A 3UY4A 2AEMA 2BUAA 3BC1A 3QVJA 2YMQA 3DT8A 1WW8A 1Z82A 3CNLA 1Z17A 1U3VA 3CG0A 4Q3DA 1DBQA 4AJNA 4MUGA 1VB5A 2I2XB 3C0KA 4WXRA 1E8DA 3PX4A 4ENQA 3GPLA 2JLSA 1QIGA 1NN3A 3ES9A 4H6WA 3LE8A 2FSSA 2BJHA 3TAXA 4AZ3A 3FGPA 2VIIA 4XGQA 5D3KA 1E1LA 1O95A 4ZI7B 2ORYA 1U4OA 3KLPX 5KKCA 2JI7A 5FPSA 4K1XA 2NPFA 4C8OA 2RIRA 4X60A 1P31A 3IAFA 1A9RA 1WRBA 3CW2C 2R1TB 1UOOA 1MO6A 3OIGA 2V7VA 4JLDA 1R00A 1JXMA 3GFVA 3RJ5A 3VYRB 1P17A 1NC1A 3G0BA 4L9RA 1BTOA 5TF4A 3QPDA 3RC8A 2AC4A 2OAP1 5E3IA 4NKRA 4PBRA 2XDWA 1KDPA 1W36D 3PXEA 4IRUB 4K03A 5DV9A 1NBMA 3ZD6A 3MUNA 3UYLA 1TA4A 1Q0UA 3U4QA 1FP1D 3QP9A 4ACAA 4FZJA 4BRSA 1EK6A 5KJEA 2IA5A 2FRXA 3PV0A 2WA2A 2HSWA 2RGXA 5K0LA 5ITZA 1R4ZA 2PD6A 3I2IA 4Q6WA 2OECA 4H3HB 1LRJA 5IUNC 3WKAA 1D5WA 5C5JA 3H99A 3OAAD 1GAXA 1Y5NA 1XC9A 2NTVA 3BSFA 1YI1A 5G4KB 3Q3CA 4L51A 4W5OA 4F50A 5F12A 4Z9YA 3ULKA 4OHWA 8ICLA 3BAZA 1NKBA 3CRW1 1R8QA 2I4LA 4E33A 3K92A 1X1CA 4YRCA 4I27A 1J7KA 1GL9B 2B5WA 1ZM3A 3OZEA 3L4SO 2DU8A 2GPJA 1FX0A 5H9VA 4QQ8A 2Q2OA 1CS0B 4QZCA 2J33A 5K0CA 4O9MA 4KB5A 3PEEA 2YYZA 3ZXUB 3UMCA 2FN7A 4PRLA 3CE9A 4TWZA 4V3CA 1V2GA 1J9EA 3QIAA 1B74A 4RHXA 3MILA 2QVBA 4F97A 1U5CA 4MB0A 1VJDA 3AVQA 2X86A 3AF4A 4KCGA 5DCLA 4ZYUA 2GS9A 3RABA 1TW3A 4RYLA 4C7JA 5KI6A 1N9GB 3QTBA 2JCVA 5D86A 3EGVA 3R7WB 3IE0A 2BGJA 2JD2A 1PWXA 1AVTA 2HUNA 2GM3A 3BCUA 4BFVA 4Z3DA 1XLTA 2BI8A 3BFVA 3OM1A 5IH7A 3DYIA 2KV2A 2H8GA 4UZSA 1L7AA 4J4TA 4P7KA 5KC9A 3TRKA 1VBFA 1SXQA 3JQGB 2JAOA 4ARIA 2Q28A 3VTKA 3DBHA 3TUJC 1RLJA 2QEQA 5KL8B 2IU0A 2QB0A 3K6RA 1SU6A 2IC5A 3CR7A 5AW2A 3U3DA 3TOXA 3A2KA 4LXGA 1XVUA 1MTOA 1PP4A 2RI0A 2NZXA 2QM0A 3EEYA 5CAEB 1I30A 1Y6ZA 1ST3A 1IVYA 2BR3A 2HMTA 1ECFA 3WBBA 5FLKA 1C8LA 4BCDA 2OORA 1RXVA 2A1UB 2PT6A 3OTWA 3WBKA 4O63O 1NF2A 4O4HF 1GGFA 2BC9A 3B36A 3HCFA 1R18A 1N5IA 1R16A 1OLUA 4R3NA 2W54A 4PS1A 3ZDQA 1NZPA 1FJHA 1STOA 1J42A 4NJ8A 2WIJA 4IY1A 5H80A 5A2GA 2DC1A 5FT9A 2QR2A 4U6NA 1GXSA 4F5ZA 1GAEO 3ZVNA 1QSLA 5AKXA 4JA2A 4CT5A 3QOYA 2ADMA 3OHMA 4OH7A 4PBTA 4PZPA 5GAJA 1F7VA 1WBJB 3V8QA 2X0RA 2IITA 4MW2A 1PAUA 1YZTA 4PLZA 4URZR 5HUQA 2XQVA 5AUOB 3RWOA 2IDJA 4BLRA 1X9XA 4GM1A 3SI7A 4XUGB 1QRUA 1S89A 1NVWQ 1FFHA 3PWTA 3WLEA 2WFAA 5LC1A 5JI2E 4MR7A 3A7DA 1HZZA 4DR2B 2E8OA 4FNAA 4C14A 2Q8NA 3ZE1B 3PO5A 3KQKA 4N5DA 1DC3A 2ZCVA 5EJEA 1O87A 3QEBZ 2X0KA 3BSSA 4DOCA 4DOBA 4WACA 3B9JA 1DEOA 1G64A 3AF1A 4NABA 3G0IA 4DEVA 4BTLA 1NMSA 1LVHA 1M34E 4IZHA 1XCGB 1OV4A 3ZJUA 1JG7A 1DKUA 4KR9A 3AI1A 1JR3D 2FA9A 3C3AA 1YWGO 1NMZA 1W29A 4MPJA 2QP9X 2HLDA 4HNAA 1D6JA 2FWMX 2GEBA 4FMCB 2KZZA 1JDJA 3T7AA 1T1SA 2BT4A 3TNJA 2P9EA 1K5OA 2NTJA 4KMRA 5EZQA 1A97A 2IPOA 4R3UC 1TUEA 2RDMA 2G67A 2ZUSA 2CFRA 4FILA 2O3TA 2BCVA 4F1WA 4NZOA 4XKJA 2PI4A 4YPVA 2DETA 3EWIA 5AI9A 1PVRA 4MA0A 4L4XA 1E4EB 5JS7A 2KBFA 4WKBA 2OXFA 3SX2A 5FX2A 1SM4A 2BIFA 2DAPA 1WXQA 5E3HA 3BBPA 1Y5LA 4H4CA 4W9NA 4F4KA 1OXJA 4HDSB 1UQRA 2Y1OA 3R7NA 4EMBA 1TCVA 2I6QA 5K01A 4TN1A 3GMIA 3N2ZB 4DG5A 2F1JA 3TG2A 3EAFA 3OD1A 3GLHB 4H7EA 1TCUA 3IMFA 1W1IA 4R8SA 1W0CA 1SKUA 2HXYA 1DELA 5T5QA 3M6XA 8ICIA 2AZDA 4B9LA 3NNNA 2ODNA 2P1ZA 3R74A 4BPBA 4WKGA 2CMHA 4E4RA 4D02A 2G82A 4RAQA 2IHTA 4ONEA 1NASA 3UJBA 2IYLD 1XF1A 1UJBA 4EZ6A 1HOTA 1Z6TA 2FZVA 3IMKA 1WCNA 4EBDA 4U1RA 4MQUA 1DJMA 4KLIA 2UZ1A 2Q2WA 4AYBF 1SQ5A 4PHCA 4JI1B 1N0HA 5LB2A 2Q29A 4GBMA 2PX8A 1HEKA 3FUUA 5HR7A 3IEXA 2B5VA 1LBQA 1RZRA 4F4JA 1JE1A 4W8GA 2G0NA 5DJ5A 3A70A 4HNTA 3M82A 4GL2A 1JAYA 2C4TA 2YZNA 4QGHA 1KKUA 2B8JA 4RQ4A 3F2IA 5KTMA 1DINA 2B69A 2ZJ5A 2B94A 4DRZA 1IJEA 4S0ZA 3MB8A 4JI5B 1OVMA 3UXPA 1KS9A 2ZXFA 4X6UA 1Y42X 2LP4Y 3FFXA 5FL7A 3R20A 5TARA 5LQSA 1T6BY 2XWPA 2CVFA 2V03A 4C0HA 2OCKA 5KG1A 3AV0B 1E3IA 3JALA 2EZ4A 3PNPA 1CJVC 4N9QA 4LI3X 4CLEA 3EARA 1RI3A 5JXIA 6REQB 1USVA 5HJ5A 4OBXA 2RHTA 3TFQA 2EHDA 2JGFA 4J0CA 3LC1O 1H9CA 1EG7A 4DQ0A 2HF8A 1U9YA 2Q07A 1NR7A 2ZAYA 3PF8A 4MS3B 3X1YA 3MW8A 1C1DB 1FUYB 4YCMA 1SGWA 2BGIA 2FLVA 1DEKA 4Z1OA 1EWQA 3I6MA 1YFJA 3KYDB 1GYPA 4JI6B 2VO1A 1E2PA 1VIVA 4MVJE 1FL9A 3ONDA 1GNVA 9ICSA 4ZC1A 4BLUA 5FBVB 1IZ7A 1IM5A 2HA3A 2DUYA 1EJ0A 3B2EA 3GCDA 3FX2A 4ZV4A 3D7SA 3IUBA 1XL0A 4BJ6A 4OPMA 4WMLA 1PZXA 5KFBA 3DZCA 3ESZA 4NP6A 1X7WA 3NJ8A 3JASA 3ODPA 2E1EA 1BU5A 5KNDH 4ML3A 4OQFA 2DUUA 1PK7A 1QKJA 1H3NA 3CEMA 1Y1KE 4WSOA 1M2GA 2O8EB 1C30A 4YAOA 4NNJA 4G8JA 4POAA 3IQGX 3B3JA 2R5NA 3O4FA 4G37A 4X8MA 1I36A 2UZ3A 1FYWA 2QP3A 4INPA 1HOXA 3PTZA 3RUPA 3LZ6A 4S1PA 2F44A 3A4VA 1PLJA 4J43A 1XZEA 3WKDA 1E2JA 5BV1A 2GK7A 1KAQA 3V8EA 5HM8A 1KAOA 2PBFA 2DCMA 4BFSA 5DXFA 3V32A 1CU1A 3R7DA 4NV0A 2WMYA 2C7RA 3IPAA 2HBYA 2KX7A 5DX8A 2A9VA 5LN1A 4L4UA 4D45A 1SCAA 2V3WA 4GZ6A 1E3WA 2VYND 2J0UB 5CT6A 3F6YA 1I7NA 3QPAA 4CIWA 4DGSA 4AKGA 4JJ8A 4JVOA 3K8QA 1U1DA 5U9CA 4CEHB 3RRMA 2F43A 3H84A 1J0BA 2BUBA 1WZCA 2HRQA 3TDNA 5DT9A 2WK1A 3RHFA 1MEJA 1D6NA 3D7LA 1TF5A 3TAHA 5DLGA 4FQ7A 4TPKA 2Q1YA 1E69A 4UHFA 3TBHA 3OZIA 3ORRA 3SHQA 1G5TA 3ZNNA 4MUIA 5JSFA 4XDYA 2WI8A 1MRNA 4IR9A 4PYIA 1TUBB 2Y9TA 1YGYA 2XYQA 3RYIA 2K7FA 3FRJA 4KN5A 4ZHQB 5K6TA 1Z8NA 3EUFA 2VTEA 4RQ3A 3FJYA 5KJ1A 3OMLA 4HR7A 3CVOA 3WNDA 3M34A 5EP2A 4YTEA 2OL4A 1AQLA 3NEPX 5D01A 4HRXA 3A8TA 3SF8A 3IVAA 1TCAA 2AC2A 5HR5A 3PXUA 2QXUA 3ECSA 2PSSA 1KI8A 3JYNA 3NHBA 4MWSA 1UIRA 1FSZA 5DW3A 3CZCA 2VDJA 1PJ2A 4KQ2A 1G0OA 4Q3BA 4O1MA 3NDRA 1BIFA 4EYSA 1DEAA 5TGTA 2MSWA 4HQNA 4DQVA 1CUFA 1Z4PX 3R4VA 2Q1TA 3TD2A 1NJYA 3KKPA 4ZU6X 1K08A 3HDHA 1E1QD 2I99A 4LKOA 3N8DA 1NFRA 3H4TA 2GEDA 4WNAA 1IOWA 5KFNA 2FWRA 3EBOA 2Q0XA 3JATB 1BHO1 4WNCA 3H9EO 4M21A 3BRWD 4DMUB 3TW6A 4KMOB 1U7TA 3KZCA 4IUDS 3FNGA 1GKLA 1EE1A 2SHKA 4GPEA 2G04A 3A3YA 1N6PA 3NWPA 5L1JA 4XLTA 4OIMA 3GRFA 2PR7A 4D57A 2COKA 1RE0A 4MYSA 4PLCA 5ICEA 3N5CA 5B6JA 3WLPA 1S9HA 2R97A 4ZREA 2ECQA 4IFIA 1RQPA 4RTJA 1PEDA 4MS4B 1XRNA 1UF9A 4XUSA 3TBKA 3W90A 1M8PA 4RJKA 3K70D 1KTVA 1GZHB 5T67A 2FPRA 1N7HA 1DRUA 1ETHA 2KIWA 5ES4B 4JROA 4KLUA 1EYZA 5ED0A 3O75A 3UHFA 2IZZA 5FLEX 4UHJA 4MV3A 2BEWA 1E98A 4JJ7A 1V3UA 3UV7A 2XUIA 1FRFS 3Q1KA 5BRJA 4JB8A 4G5QA 5SZHB 5BQ5A 2FX5A 3D31A 4R2LA 2C94A 3A27A 2A5JA 2WWRA 3TFRA 2W6ID 1Z16A 3MMNA 1I2BA 4NNOA 3AOEC 1E2HA 2NU7B 4TLMB 4JC0A 2OH2A 1W8DA 1GU0A 3F73A 2VRNA 4EA6A 2OT3B 1YRLA 1O0SA 1GUFA 2A6PA 4Q7KA 3FPKA 3F5EA 2YTUA 5KNBA 4XPIA 1RLUA 1XTPA 1RYZA 4X62B 1JDVA 5TE9A 2IODA 2VEOA 1YB1A 3QWFA 3FI9A 5FOWA 2VUUA 1L3CA 2R8JA 3ZWKA 5IZCC 1PO7A 4GZ3A 2PZGA 1UOQA 1O5OA 3A9CA 1UJCA 2WJ4A 1ZNYA 2CJWA 3HR4A 3VHRA 1X87A 1UZAA 2GASA 4EHAA 4J9QA 4W9MC 3V1MA 2LKDA 4IH4A 1B42A 4P98A 4EJ0A 4RQ7A 2H1IA 3DF9A 1USWA 3VVLA 1JN3A 3INNA 3LCMA 1RE1A 2VP9A 3AY6A 2CCJA 2EBUA 5KTOA 1KY5A 4TTAA 2MRLA 1ORRA 2W4MA 3SGLA 5AM2A 2QPAA 1FXUA 3HPOA 3GEHA 3ZK9A 1BD3A 4P53A 2ZJZA 1VGVA 3IUSA 1VMEA 1CC1S 3DCYA 1LWNA 6LDHA 4AN4A 1K98A 4UE3S 4E88A 2DP4E 4OAOA 5JYDA 5C7IO 2O2HA 2GTPA 1YC5A 5EG5A 3F8WA 5HZKA 7ICFA 4RM2A 2EG9A 4GMGA 5HEKA 1W96A 1IUOA 3PXCX 2IYUA 4RENA 1BA2A 4GBJA 3F90A 1W48A 2XLBA 3I37X 4OXNA 5BWNA 4BLQA 3CUTA 1DCTA 4X3CA 1L3BA 1Z45A 2H2HA 5EN4A 2YQEA 1JDZA 1KY2A 2FMHA 4IUBS 2ZT8A 4N9WA 2Q5QA 4RHUA 3JPPA 5KNCD 3ZPXA 1E6CA 5F4ZA 1P0IA 4L78A 3G6YA 3L6EA 4XI9A 2QZSA 4IGEA 1JRLA 3VKUA 1FX1A 2XCUA 2JLBA 3VO1A 5C8YF 1I4EB 1XAGA 3FCXA 1RI5A 2JW5A 1IHUA 3R5HA 3B1YA 4LJLA 4ZQFA 1CUHA 4ZWNA 5EMLA 1Z0FA 5FR1A 4ALMA 4CIDA 2FY8A 1W49A 5TPWA 3RYFA 3BB3A 3P2YA 2Q3BA 3QVUA 3L7DA 5GTHU 2H5IA 2JL1A 1PQPA 4P80A 5TXGA 5ESRA 1M6VA 3DHWC 1QV6A 3OZ7A 3QZ8A 1ZQKA 1U47A 4CG1A 2ZB2A 5C1IA 3EXHB 2O8NA 3IB3A 1JEYB 2WOOA 3L7LA 4YXFA 1PLLA 4MR8A 1E2IA 2PV0A 1WM1A 2N9UA 2VYQA 1DQNA 4WA7A 1Y6RA 3WB0A 2P5UA 2IYQA 4P4SA 3TSWA 1TT5A 1D0VA 4MJ7A 1U3CA 2ZE8A 3WL7A 4TTSA 5CEEA 3HJCA 4FI3C 3BJEA 4DCNA 3EBPA 1ZQTA 4YECA 2M6SA 3UMJA 3IELA 1PTKA 3WRVA 4JQZA 1P73A 4S35A 4JXKA 3KQHA 1OSNA 3MGHA 3SIXA 5JY6A 4MQMA 3QIVA 1HIWA 4KMMA 2RE8A 4FHCA 3KEOA 1JGTA 4PQRA 2JDID 3CNHA 1JLMA 2P1RA 4FSXA 4D46A 5D1NA 1GZVA 4HYYA 3S1AA 4IV0A 4YHBA 1K9VF 2P8SA 2EGGA 4X84A 3MFQA 1JKMA 2JFQA 1BOFA 3F9CA 1UK6A 3ZJ5A 4PLTA 5AK5A 5EZYB 5KG4A 4OV6B 2DVMA 2G8LA 1G17A 5ILOA 3P4YA 4P7BA 2ZYDA 2ZBQA 1V1RA 3EGDA 4AJHA 4IWYA 1I6MA 5KQLA 4RJTA 4KXWA 2WT9A 4AX4A 2YWGA 4PONA 2PLNA 2R7KA 3GY0A 3FKQA 2IHYA 1S3IA 4L6CA 4CM1A 5KYKA 3MRXA 5CA0A 2X0JA 1OA0A 3IOYA 1K06A 4C4OA 5TQVA 3LCJA 1ATIA 4TGLA 3W5SA 1TC2A 1UZLA 1IZ8A 2YVLA 4IIHA 2M0NA 3GD5A 4BLPA 4MQ5A 4ZT4A 4ZT2A 1MXHA 1ZNWA 2XECA 2HBQA 3D54D 3WBFA 4DIBA 2IV7A 1KZGB 4AKHA 3LA8A 3CLKA 4ON9A 4EYGA 2C83A 4YCBA 4GWKA 4N0MA 2WHXA 3K96A 3OKPA 5DTIA 4DE5A 5KT7A 5M3BA 3W4JA 3CY6A 3MAJA 4ZAVA 1VKJA 1AXEA 2I2BA 1NAHA 4BX8A 3V6JA 2FMPA 4DLAA 3F7MA 3FCUB 4GU5A 3QFHA 4KZPA 3B7GA 3WQBA 2ZTHA 3CVVA 4XSGA 5CYGA 3QE0A 1P5ZB 2ONCA 1T3HA 4RKWA 1VE9A 5AI5A 4UTPA 5HDQA 1JZTA 3MWKA 2CLKB 2XY7A 4F21A 1XCMA 2B78A 2EAMA 1AQIA 1YQDA 4ED7A 4EELA 1PGNA 3HUFA 2W2KB 1TU4A 2GERA 1NJ5A 4IIUA 3OLWA 3TLXA 5AVZA 1VLJA 4ZT7A 1W35A 3UJDA 2YYYA 3SSOA 2NXNA 4K9DA 5KHLB 4HUJA 5G41A 4URWR 2ZSFA 1DXSA 5ABPA 1L7RA 4ATNA 4OKNA 2C5GA 2O7QA 1Y5MA 2JBHA 2WZCA 7ICTA 1L8QA 3GT3A 1YD7A 3V4VB 2HJHA 1KMHA 3U19A 1J6UA 5E7IA 4M22A 3SVZA 2FZ4A 1P7WA 4BRZA 1BC5A 1DI0A 2L2QA 4ISCA 4KRYA 2GZMA 1VCMA 4U3JA 2X2EA 5KKNB 3FUTA 4ZQIA 1MN8A 1ZQ1A 4Y2TA 5MN4A 2PGXA 1UC8A 3HA2A 4AZ3B 3PGXA 4I9UA 5BUSA 4MK4A 2ZYGA 2RQ5A 1E7RA 4EPYA 3DBOB 2Z5VA 1E3EA 1I1HA 4TUSA 2FOXA 1E2FA 3KJGA 4R9RA 1ZQHA 1ZWKA 1LQUA 1AQJA 1L8XA 4UB4A 1U8TA 1D6SA 1L3SA 5BSKA 4H0CA 1TKBA 3UJ9A 1SK9A 3AI7A 1T15A 2RHJA 5DM70 3H0MB 4DWVA 4FT2A 3M9NB 3PDWA 1JIVA 4LDPA 1ZJWA 3I53A 1KVRA 2X58A 4DBLC 1AKRA 3THWA 4CF3A 3GYGA 3U4QB 3U80A 2BKAA 4MQFA 4EFMA 1HSZA 3L7JA 1WL8A 3G7NA 3PGVA 4FJ1A 4GDMA 5ITZB 2I6FA 5J0YA 1ONSA 2OG1A 2W48A 2ZTUA 3ZZ0A 3AIMA 1L3TA 1PD1A 4P32A 2XY5A 1IQ0A 1W5BA 4IIJA 1KZ9A 2VNHA 4M54A 3OSPA 1EUDA 4C04A 2D7DA 4RIFA 3S2FA 3B13B 4ESEA 4F45A 3C87A 1Z0JA 3OAAA 3IBGA 2ZSUA 1Y5IA 2CXRA 1FU8A 9ICRA 1WMEA 5B6PA 3WZMA 4J49A 2QVXX 2E37A 2AQ4A 1DADA 1SUCA 3MG9A 3AERA 4DNFA 3R75A 3ZGNA 2X5KO 2ZAMA 1K6IA 4NAVA 1TM4E 2XB6A 3C6YA 4QRIA 2W70A 5KT6A 2IYWA 2G5GX 4QT4A 2C00A 2ONZA 4O5CA 3GCZA 4JY7A 2F3NA 1ULSA 3TOZA 4HX9A 3B1VA 5DYWA 3JWHA 3A9VA 3HDGA 3TKYA 2XUKA 3VMFA 4O59O 1FX0B 3B8EA 3JQ9C 3DV2A 2JJYA 2WPNA 2FEXA 3JVVA 3B5EA 4YCAA 2CDCA 2QIOA 3OG9A 4QVKA 5G0UA 4XWGA 1K86A 2PTGA 3G13A 1VG9B 2X7JA 4BTEA 3AL0C 1X80A 2WKSA 2WSSD 4MRPA 1HT3A 3F2VA 9ICIA 1QV9A 1VL5A 1EB9A 2CLSA 1QGED 3GV5B 1ZRSA 1GN9A 3HKCA 4FE4A 4FD3A 1C8KA 3K09C 5ALQA 1Z34A 1KI1A 2PXIA 4RVGA 2RARA 1Y8QA 1XZ8A 4WY5A 4UDNA 4OIFA 3K6KA 3GK3A 1DQYA 5BMVA 2IUUA 2QTCA 1P1IA 4KFSA 2RK4A 3EPJA 1MPXA 3VO9A 3MR5A 2ZZKA 2GCNA 4I99A 3D0OA 3G82C 1N6LA 1H6BA 5CDUA 3SZUA 1KBUA 2FE4A 2AF4C 4H1TA 2E8NA 1J2UA 5J2TF 5I6DA 5FWAA 3PSPA 3PKZA 1Y9ZA 3PKJA 3DBHB 3VJKA 1B8OA 5I8PA 1U6JA 2YY7A 2OP1A 5L1MA 2QB0B 3Q0TA 1PX2A 1H42A 3JWEA 3PW4A 1K4YA 4QXRA 4M9CA 5T8KA 4LJXA 3MGCA 1BYUA 3SCZA 3OPXA 2XQIA 3ADBA 2ZULA 3WC4A 3EMKA 1M6EX 4D4MA 5HCNA 3VPGA 4BP3A 2PBLA 1NIJA 2OCDA 4NJEB 3W5UA 4YUAA 4F4IA 1MC5A 1VE3A 1D2HA 3NJ4A 2XHEA 1RIIA 3GGPA 2OYRA 5DBEX 4BDPA 2AOVA 1ZJ6A 4I14A 4OHFA 1WE2A 4B76A 1OLUB 5TRTA 1CD5A 4PG5A 1EJ2A 1BFDA 2JZCA 3Q4GA 2EJVA 4RU1A 1GXSB 2OHIA 3PI6A 2A9RA 5HOQA 3IE2A 2D2IA 5I4IA 2XVAA 1S3SA 2FWBA 4UBIA 4KPFC 4L5IA 4FBUA 3SX4A 3TJZA 3IQEA 7ICUA 1RRMA 3NH6A 3HJFA 1YO6A 2IZ1A 3AXTA 2A5DA 2WWVD 1II8A 1TKCA 2FMTA 1JROA 4MV8A 2R8KA 1N9ZA 2Z1NA 2IYZA 2ZIFA 3BWDD 4MR7B 1B6GA 2AMFA 3A1VA 3ILVA 4P4PA 4EO4A 3ZHSA 4Y2UA 1CRPA 1N3IA 1BPZA 4QPZA 2C5EA 3U3OA 3KUKA 4KTTE 5DGXA 1WDKA 3CPEA 2VAXA 4QJFB 2J5QA 4BNFA 4GSLA 3G2IA 3KKAA 3NYIA 3X2EA 5LL6P 5KPJA 3P4XA 2IIBA 2ZJ1A 3LQ4A 4FCCA 1DTSA 1H94A 3PTAA 4X91A 4FCTA 1OB2A 3SHOA 1JR3A 4KGVA 4L5JA 3CRRA 4HNAB 3RVRA 4X8OA 3GJ5A 4PRKA 5EP3A 4TXNA 1NW6A 3KYCA 3KJIA 4I4NA 2C3UA 1VCIA 3BD8A 5D8DA 2PMFA 1RABA 2X5JO 4JEHA 4Z0HO 5JNLA 3AYZB 1N75A 4ZI2A 5IDYA 3IUYA 1DUVG 3QKWA 2XGQA 3BZBA 2GEJA 1KFDA 3ZDZB 5HE8A 4XCVA 4ED0A 1JEJA 4XJVA 2QGFA 3PHJA 3HU1A 3V2UA 3PW2A 5B4TA 4F9TA 3QEJA 1ZKDA 3EAQA 3RH6A 1XELA 4MPDA 3GILA 2C97A 1OW5A 2VHJA 1IVSA 4UB3A 2JZBA 4OF4A 3Q8RB 4LJSA 4RY2A 3LSYA 4Z4IA 4KQIA 2HCJB 3HVKA 1XA3A 1P2BA 2JIZD 3CVXA 2R1VA 1RG6A 2VXBA 4LPSA 2DBYA 3QU4A 2Q3LA 2R6R1 2QN8A 2HBLA 1EXWA 2RCNA 5I51A 2ZJAA 4C6HA 3RODA 3JPRA 3M6AA 1UPTA 1UT6A 5CEHA 3M8SA 3WMFA 1EK5A 5HF5A 4GFJA 1JQLB 1PEYA 1ZVKA 1POWA 1RPTA 5FI0B 4MHTA 4G26A 2I4MA 1E61A 3V4OA 3UBTA 4R51A 1KYIA 3JSXA 1P7PA 1RFLA 3ZDXB 3B1JA 3T3DA 1YDFA 2PEZA 1S2DA 1Y37A 2Q4EA 4DEYA 2IPLA 2L5YA 1EBBA 4F92B 2XYRA 4P3NA 3Q98A 2UZ1B 3KHGA 3LF2A 3ITEA 2CK3D 4H7DA 4XD7D 1KDZA 4LGVA 5DGDA 4PFSA 1GUBA 1W9HA 1K5DA 1RW4A 2O3UA 5CM9C 5JJBA 1IN6A 1GAQA 3TQIA 3CWQA 1Y1RA 3T0IA 3AXSA 3RDPA 1C7YA 3Q3IA 3M1YA 4CL0A 1JL3A 5L3QA 2W90A 2E48A 3Q9NA 4P22A 4OYLA 2IEGA 3L05A 3MBYA 1R9JA 3VH3A 3TKAA 4S24A 3QTTA 2BSQA 3ENQA 1QG2A 3U5TA 1XTSA 1MG5A 1UPXA 3BRCA 3KPVA 4TV8F 1PFYA 2VR1A 4V2UA 4WGFA 1FFAA 5KFPA 4Q9DA 4HF7A 5L8VA 2WQ6A 5GONB 2GAOA 2V4UA 3OTIA 5C8VA 3RYTC 1RJDA 1CVLA 5ERYA 4LYAA 4N65A 2IZOA 3D2AA 3WWZA 3WY9A 3JWPA 2YOHA 2CSUA 4XRRA 1A95A 2CHVA 4XGIA 4M7WA 3ZHCA 4IIEA 4ENWA 1Y3HA 2AN9A 3X1KA 4D4LA 2VQFB 4YP9A 3QH4A 5HIKA 5DM2A 2IEDA 3VAAA 1Y82A 3H11A 3ENKA 4H60A 3CURA 3FOCA 2ZYAA 5JEEA 4IL5A 1MW9X 4ZEOA 4AAYA 1RS0A 3EXEA 1HA3A 4CGYA 4HH0A 3CF4G 1SXJE 2IU3A 4YGYA 5KFJA 4IRKA 4DSTA 5AHKA 1OIWA 4XLLA 1NUUA 3LUJA 3MTJA 2CPRA 1E1YA 1KOLA 1DAKA 2ECOA 2W43A 4Q45A 4BUGA 2GBFA 1HE4A 1T3GA 1X7WB 2PL1A 3JASB 3Q88A 4J16A 1O6BA 1FBTA 1L5ZA 3QX8A 2WWFA 4GGMX 4Q1FA 4H18A 4TL7A 2P3SA 5KREA 1YQGA 1JI3A 3QFCA 3RFVA 2DPMA 1C30B 3B8HA 2Y92A 2C4WA 3EOAI 3DT6A 2LMRA 3P8ZA 1IL0A 1RDFA 5CM8B 4J6FA 3DKIA 1ZQWA 3KXLA 2PKQP 3F4BA 5CDSA 2W2MA 4F8RA 1AKEA 1N8KA 1N2EA 3OT4A 5CUQA 2W93A 4H7KA 3DQZA 3IMCA 2O2CA 4UBMA 5CYOA 5IN5A 5ALMA 3N4MB 2JV3A 4MYCA 3K8YA 2L42A 2GCEA 4WQMA 4QEKA 1E3WB 4ZYWA 2NSJA 5B64A 1KRWA 3O03A 4NLGA 3E5NA 2VYNA 3IUPA 3GH1A 3LHSA 2Z6AA 2F43B 1D8AA 4Q47A 5JVDA 4OK3A 1FP4A 1YZGA 5CVCA 4YAWA 3WG9A 4QOJA 4U7WA 3EXAA 4KE9A 4TTJA 3V8VA 2HF2A 1KEEA 4Y6LA 4FR5A 2G07A 1VCNA 5DLQC 2JH7A 3QE9Y 1S10A 4K9RA 1KU0A 2AGOA 1L7EA 3DCNA 3OQNA 1JG4A 2SKDA 4B31A 2ST1A 3DKRA 1RZVA 5KVVA 4TVBA 1H6AA 2Z1MA 4DF4A 3LO5A 1MU0A 4A2CA 3RYIB 2DPGA 4JUFA 3WE7A 1Q11A 4CT0A 2WP8J 4ZEWA 2FLKA 1SBQA 1M6NA 5CPBA 3RT1A 4IYJA 4OQQA 4TSKA 4I1IA 4JOCA 1AF4A 3T06B 3KU4A 1Z6QA 4UCXA 4GC6A 2D7CA 5F77A 1IMOA 5IAEA 4Z6KA 2UVPA 4C87A 2WU4A 3SF8B 1TKRA 3BQMB 1JF8A 1SNYA 5AXCA 4ZTZB 4FX2A 3KOZA 3WKBA 3CUUA 4OK5A 2OOKA 2QUHA 4B5KA 4WCVA 4JKYA 5KFMA 3SMVA 2OYCA 1G18A 5KSOA 3G6VA 4CTOA 2DUWA 1HGXA 5IABA 4TYNA 3DMYA 4GECA 4ER7A 4OYHA 1BRMA 5JY1A 4FDLA 2O2ZA 1H9AA 1Z36A 3L7IA 1MOZA 4D97A 1HL3A 1G5IA 2YS6A 4KR7A 4GHWA 4Q9KA 1QLWA 2WV9A 2GWSA 4PZYA 2EATA 2Y4OA 4EMTA 4RHEA 1CY2A 2ZJ8A 3TL3A 1E1QA 3EH2A 4WNAB 3QNMA 3WGGA 1L7PA 1DJPA 1GGHA 1U98A 1Y1LA 4HEHA 1JJAA 5JBIA 2IX3A 4OBBA 1K3UB 3QKSA 1OFUA 3BRWA 3D4NA 4EZEA 1U0EA 2NPOA 1YNOA 1AGYA 4U2BA 3QU7A 4DS4A 1QZTA 5CHGA 4KR0A 4PR3A 1ZQ9A 4JSRA 3T54A 1NU8A 4AUKA 3SV3A 1JIHA 3MWJA 2PUDA 4US0R 1C80A 4WZBE 1JTFA 4DMHA 4DABA 1FFWA 4YQFA 1Q46A 1MO5A 3E9MA 2KE7A 1QLHA 2KN7A 3PA8A 4L50A 2ZIGA 1KZ6A 3OF5A 2A2ZA 3EZGA 1K7XB 5E7QA 5DRYA 4BO4A 1NVGA 2OHXA 1ZQAA 2DG2A 2XUOA 4KLDA 4I2EA 1JMYA 1KF0A 4GX0A 3JU3A 3F53A 5TMBA 3PXAA 3HM2A 3Q8WA 4D4HA 4JI3B 1JXAA 1F3LA 1XDUA 2DQZA 2W6IA 1M2EA 3N7RC 4KN4A 1NUHA 2PS9A 1FLAA 1P45A 3DVQX 4CKYA 2HSJA 4D9GA 2AWOA 5JMPA 1XZJA 4GO1A 2O7RA 4I9HA 4KPUA 2H9IA 3CE6A 3UWOA 5FPYA 4XPIB 3M4JA 3RROA 1B6RA 2WD7A 4L1KA 3WLOA 3RBZA 3P2JA 2XT6A 4AUNA 2CNBA 5D85A 5F7ZA 3NO4A 4QOHA 2H4ZA 4GSKA 2I3DA 2H48A 2CJWB 3E84A 2IIQA 2O0HA 2DBQA 4QFMA 4CLRA 1C3LA 3OFKA 4F04A 5HKOA 2ZB4A 2P6UA 3LU1A 4QJIA 2WVHA 3PLNA 5LYYA 4AG5A 4Q18A 2EIHA 2YOFA 3OC6A 1SUWA 4FI3F 3EVZA 4Z7OB 5HCUA 5FHQA 3NP9A 1JVNA 4GKAA 2NLOA 1XRLA 1WEKA 1O94C 3ZD7A 4RD2A 9ICMA 4ER3A 1GEEA 4EQZA 4FFWA 4IXWA 5CWRA 1V1MA 2XYPA 4GNKA 3PC4A 3NXSA 3WI7A 1J0AA 4Z5XA 1CZKA 4E5SA 4UOQA 4V38A 4QQNA 5KDLA 2IRWA 4CIYA 4OJ6A 5B3KA 4D8YA 3AFNA 1JKFA 3RIXA 2G9RA 2PL5A 2JH8A 1U45A 1CIPA 1G2IA 4KWIA 5CA7A 4PZZA 1F2UA 4FMDB 4KDFA 3SSNA 3A2MA 2J3KA 4FYHA 4DV3B 4QBGB 4QVGA 2H0QA 4C6SA 5A4AA 2C57A 1Z0IA 1GZSA 4CF7A 4E4TA 1KBQA 1M6YA 1UBFA 1VLQA 4QLBA 1YK1A 4JOBA 5KNCA 2UUBB 4QDOA 3T12A 3OVMA 3AHCA 2PMEA 1IHPA 3FR7A 3T95A 1OH8A 3N8NA 2O19A 3GA5A 1IQUA 1KDTA 4ARUA 3WLIA 3HWWA 5DDYA 3MDAA 3RG8A 2YASA 3IR7A 4DW8A 5TPWB 3RYFB 1HK7A 1UXHA 3AFHA 1CJTC 5CLLA 2OCBA 3UJAA 3ER9A 1BDIA 2Y2VA 5LOVA 3CPSA 4YFVA 5DYGA 4JP1A 2C4NA 4GQIA 1XL1A 4L8GA 3N87A 5IMSA 2ID9A 4BVLA 1T94A 1M6VB 4GRIA 3GZJA 3H0KA 4LHXA 5F73A 2H1OA 4ZPXA 1OX4A 3AF6A 1NHGA 4FWBA 3Q5EA 2C59A 4MR8B 4NE2A 1CR0A 3FJOA 3KOYA 3AVXA 1E92A 4I9NA 2AD1A 4MIOA 2NT3A 5F5NA 3VHLB 2P9GA 4YIKA 3VSCA 1P6XA 2EJTA 1FRZA 1YB6A 1GA1A 3L6CA 1T5TA 1TT5B 3PVZA 2GAFA 3S2UA 3SR6A 3ZQJA 2WB2A 1D9ZA 5T4EA 4R1UA 2HA2A 3AY3A 4YLYA 2P9TA 2CDRA 2YFQA 4WFJA 1T5OA 3LOPA 5GJBA 3TZ6A 1ZBQA 4WKOA 1EWVA 1T4BA 1Y9JA 3FC4A 1AUOA 3C41J 2J0SA 3D59A 4MQLA 1JYEA 4S1TA 1XZKA 1PWEA 2IXDA 5KAFU 2PT5A 3CEAA 1XDGA 2W2PA 4GKVA 4B45A 3LF1A 1OF1A 1I9GA 2A4KA 3QLEA 2JDIA 3PHGA 5AOBA 1WMFA 3HX0A 5EWGA 4FGKA 1BJKA 4KNYA 4REMA 1ZKMA 2RH9B 2FSPA 3MJFA 4I2IA 1G1MA 2NYRA 2C9OA 3HFGA 2ZI7A 4JMPA 1B0ZA 2D59A 2JA1A 1V1RB 3PXXA 5JYCA 4UXJA 3EGDB 5TNXA 4OQMA 5A06A 3AQ4A 1ZM7A 4N0DA 1DSSG 2O20A 2R1UA 3E3AA 4YRBA 3B9PA 1T34A 1F14A 3OU7A 3W9YA 1A3CA 3H5VA 2KI5A 1F0NA 3ZHQA 4OU5A 1QIEA 4I6JA 2B7BA 2Q6VA 4Y8VA 3ZW9A 4A7PA 3NHZA 1C4WA 4HH3C 1GZUA 5TIIA 3VM6A 1Y4UA 2YVUA 1BFKA 5BQPA 3T41A 5KTTA 4YJKA 4UKDA 8ICCA 1KQPA 1S8AA 2A5LA 4RV4A 1JAXA 2Y2UA 2DPYA 1EVLA 5IUKC 3ZQ4A 4QGAA 3GJZA 4PX9A 5BN4A 1AK2A 4Q4DA 1CDDA 4XVQA 3M3DA 1XMPA 4OHUA 4DSLA 5DSXA 4R7GA 2CXOA 3U44A 1KETA 3EPLA 5LQNA 4ZK2A 3L0SA 3LZCA 1TQ8A 1U0OC 3KB1A 4ZVOA 1B93A 2O8FA 2ISQA 4YV0A 3F2BA 1PWHA 4K6OA 2A5GA 1DC7A 2Q7XA 3NAZA 3HCAA 3G8YA 2W42A 2BFDA 2IY9A 3IJRA 1II0A 4UFPA 1R6DA 4A36A 4CCHA 3INTA 4C29A 4JBNA 4EPTA 1GCUA 3HNRA 3LT1A 4AN0A 1DVRA 4E4YA 2AMYA 3P94A 1A7KA 5BO5A 4B3FX 4DRYA 4TMVA 2AQIA 3E3NA 3C3JA 2BELA 3NHUA 4RCVA 4IJMA 2EL7A 3JVUA 3SPXA 4OGWA 3KB6A 1NZDA 2ZYRA 4RQ5A 3R7LA 4Y2SA 4R1NA 1B0AA 4G8DA 2C4KA 3CX8A 2R6ZA 1L2TA 4OM7A 2Z43A 1JNXX 1M83A 5DNVA 1NN5A 3L2OB 4TTRA 3I30X 2P9CA 1HEYA 4WL0A 3EYAA 2MCFA 4BVGA 4PYMA 7ICOA 3I04M 1IIBA 4EVRA 5EMHA 3PZPA 3OQJA 2J6SA 2PRIA 1KMHB 1FRQA 1V9PA 1QORA 2FFAA 3GOQA 1P7YA 1XSPA 3INGA 2ISCA 1X8KA 3ZHVA 3FWKA 2ODTX 3PR5B 4U3JB 3WGZA 5K51A 3O47A 2ZYVX 2IYVA 3G5AA 2Z5GA 3E6AA 3K71B 2W7PA 3BDIA 5JAHA 1VIAA 2VANA 1OA1A 2PE5A 1WQ3A 5H81A 4KXQA 2F8TA 5JUWA 4GT1A 3QXJA 3DG9A 1MQSA 2WINI 4ES6A 1NX6A 4F4UA 1ISSA 2HREA 1M8GA 4M9RA 3OU2A 5BN3A 4MMYB 3SJBA 1SU8A 3HLTA 3INRA 5GMOA 3J7AC 2AN1A 4R9VA 1USUA 4MRNA 1DXOA 2Y27A 4PTZA 5KYTA 2G5CA 3THWB 3C24A 3WYBA 1VJ0A 5LWQA 4MQFB 1ZUIA 3LPDA 4KDCA 1Z75A 4IJVA 5KYXA 1KU6A 4Y98A 1ODLA 1V7CA 7ABPA 1M33A 4J1TA 2XAAA 5A9SA 2JI9A 1KH3A 4E5MA 4HLUC 4MJ3A 4XA5A 4IIJB 4KIUA 1EUDB 1Q1GA 4UNPA 1Z74A 5B36A 4DLYA 3CUWA 1QYDA 5L53A 4GXQA 2NOAA 4L5AA 4MYTA 5HRAA 3WQQA 4CU2A 1ISFA 1CW2B 1MAAA 3TVTA 1DJLA 1T8SA 2HXGA 3AERB 1LKYA 1MFPA 3D3JA 3QFTA 2XNJA 2KLBA 1DTWA 1NPDA 4DSOA 3MYYA 4J2HA 1A2OA 4KHPB 5JAOA 3BDVA 2IBMA 7ADHA 1MA0A 3EFOA 3ZQUA 3L8GA 4IWXA 3FZQA 2W2VA 3OQHA 2VDLB 1W4RA 4FKZA 5B58C 1X80B 4RK0A 1TZBA 5LDDC 2WSSA 3FHLA 1KH1A 4TM7A 4EEZA 3DDUA 2F3TA 2JFFA 2HADA 3L7OA 3DAOA 3THRA 4Z2YA 4U7CA 1M2FA 1LDEA 2JHCA 3HKCB 2FYTA 4RWEA 4K9MA 2VJMB 4ZD6A 3BQ9A 4MFAA 1ZQJA 1U8ZA 3VC3A 3AFGA 2RGUA 1DWQA 4M9HA 1Y8QB 3KWFA 4B4DA 3VHXA 3RR2A 4FGJA 1G6Q1 5BMVB 3UB3A 1A72A 3IX7A 5HKKD 5ESXA 3DWFA 5A5FA 1SN7A 4UAVA 3RCBA 1B3BA 3DLAA 2Y77A 1SY7A 4J3NA 4I1UA 1D2MA 3BL8A 3EUEA 4FU0A 1A69A 3TLMA 3ZBQA 3GLIA 1Z6GA 3HFRA 2XICA 1DWUA 3NOXA 1DAGA 1E4VA 1IG6A 4HATA 2Q4RA 3W9SA 4TUPA 1MG0A 2J5XA 4OHRA 3AB7A 4IG9A 3KZNA 4YWJA 3K9FC 5KFUA 4I5FA 5DOZA 3ZCPA 3TTVA 5JXHA 3IG8A 1ZQYA 4Q3OA 3HCCA 2NV3A 3I9LA 2DWUA 4NCBA 1TQ2A 4U9IS 4I2BA 3LQ1A 4QO7A 3KPWA 4N5HX 1G8HA 4D9FA 3G2HA 5F64A 4ZN6A 2B1IA 1WZIA 3UXMA 4ZOAA 1GZ6A 1ISRA 4DT1A 5A4MS 1E1KA 5EJFA 1KSGA 4UXIA 3S81A 1J70A 1JG2A 2QNIA 4UAGA 4ZV7A 2P4SA 4TYYA 4GRDA 5KFAA 3LXMA 2WC1A 1BA3A 3QRWA 1CHNA 3AEQA 5CNJA 4MCAA 3M89A 4RIHA 1V16A 3JVDA 4HAIA 2PO7A 5C5CA 1OAKA 5JJIA 3NC0C 5K8IA 1E2UA 5ENDA 1JVSA 1P61B 1KMNA 3TFWA 1PU2A 3QA9A 3BFJA 2BCEA 4EK9A 2YYAA 4MFCA 2WKPA 2YJTD 1QTQA 2OHGA 2NZYA 2BR0A 1D4ZA 2VP3A 4OI0A 4D42A 3NBYC 4LHYA 621PA 5EE1A 1P80A 2HZ7A 2CMGA 4MUFA 3WR5A 2E1FA 2KHVA 4DNQA 1YBVA 1Z2PX 1Z18A 2PZEA 4I81A 4XRGA 3CSSA 4K4HA 2HHXA 2D5CA 4LZOA 1O9GA 1GDTA 3RNLA 3ROQA 3MD9A 2Z95A 1LB1B 3OKAA 1G38A 1JNYA 5IKMA 4YD2A 2ZS9A 4B2PA 3BGVA 3EIHA 4J4HA 4PZLA 2H2DA 2A86A 1TVCA 4GVPA 4A82A 4CFYA 1NQWA 3V72A 4LF8B 1QO7A 3A58B 1HT1E 1T24A 4RPCA 4LJ8A 3E5HA 1MOPA 1XO1A 2O7VA 4BQFA 2ZDQA 1IM2A 3TLAA 4QZEA 2IHBA 3OMWA 1QPBA 5CRIA 5ALHA 1NVEA 1JYFA 3KYCB 3AP2A 2D2XA 2BMFA 2HT6A 1WABA 2KP7A 1NVVR 3FDZA 2O0LA 3ZWNA 1V39A 1Q0TA 2AJBA 1E0DA 4EW1A 1RXWA 3FNRA 4R54A 4QU0A 2ZIUA 3A04A 5ER6A 2GWRA 4QREA 4YMHA 2YMPA 2A3RA 4KK4A 1TAHA 1RRFA 2FW8A 1P2TA 4O4IA 3A1FA 2JZOA 2IFTA 2FSVA 1YR7A 5AD1A 5B1SA 1T9HA 3PX3A 3B7WA 3HUEA 1MVNA 1ZPDA 5BV0A 2B36A 2JJ1D 3D2NA 3FYUB 3K0BA 4LOHA 3ZKAA 2JZBB 3KT8A 4RY8A 1JEQA 4IKOA 3GAZA 4K1LA 4MVJM 2R1VB 1EXDA 2OV8A 9LDBA 2HBMA 2QTMA 2JIZA 5LMUB 4YS6A 5BY2A 2RCYA 1J20A 4YX9A 3MR2A 1ZIOA 4K28A 1N5JA 1J2JA 3C3CA 2HA0A 4I19A 2F55A 1ZW1A 3EPKA 1Z5UA 3Q6MA 2PS3A 3MWYW 5D3ZA 2G70A 3WGQA 2D54A 1F9EA 1L8LA 1IZZA 2C29D 4O2AA 4HQLA 2P2ZA 3N7AA 1QCKA 3TIVA 3N7TA 4GBED 3T3NA 1TIKA 3ZU5A 4ZHSA 3TZCA 4OLFA 2B25A 5FNVA 5JROA 1HLPA 4BNVA 1AUQA 3C3XA 3GJ0A 2CK3A 1GUYA 3C1ZA 4XD7A 3DM5A 2PSJA 1QOQB 2XJ4A 3JW8A 3JD2A 1TLLA 5BWBA 4RETA 2KZ3A 3ZGVA 5GM2A 1SL2A 3WIUA 1XMVA 1Z6PA 3FRHA 1T3SA 2Q41A 2CL5A 1FFCA 3R7AA 5L3QB 1RRGA 1R12A 2EW8A 7ICSA 5CLJA 2CUKA 2LVBA 3IDFA 1OXUA 4M8NE 2KM1A 3MEQA 3X44A 3WLAA 1LRKA 1OBOA 3OZXA 1H93A 1ED1A 5DF1A 2FMUA 4MVWA 5A7HA 2GBLA 3ZE9A 2XR1A 3T5JA 3D2BA 3SQOA 1FF9A 1N6OA 3WRXC 3D5QA 2AXNA 4RPZA 3Q6IA 4XWKA 4WI1A 4MO2A 5IC4A 5SZJA 1YCDA 1CUCA 3IPCA 2RP5A 2AFHE 1OJ7A 5LJIA 4PS0A 1RJFA 1L5MA 3QVLA 1D3AA 4NFYA 4OLBA 4J9VA 4YRDA 3H11B 4LQDA 4HQOA 3PIDA 1CBUA 3EXEB 2MU2A 1CCWA 1I1NA 2AH5A 5A0LA 2P75A 1YH3A 1HRDA 3B2QA 3LHIA 1P0FA 1CUUA 5GJVC 1TFUA 1UJNA 5IT0A 3G5UA 1XNGA 2VXCA 2HIHA 3BXPA 4CV1A 2WJ3A 5JNVA 1L4KA 1PHRA 1E9VA 1VHTA 4DQLA 3OZTA 2GCGA 2QENA 4YFYA 1O8CA 2IH5A 3ZE2B 4TL8A 1F12A 3SYTA 3P52A 4G01B 3IB6A 4Y1FA 5E6SA 4ZU1X 5DBFA 2CDAA 1U0RA 3IQHX 2CLMB 3Q7QA 3TSCA 5J59A 4QBFA 3GRZA 4ZV9A 2B8EA 1UWCA 4IZIA 1W7AA 2DR0A 3UMBA 2RGRA 1N5OX 3GLFE 3AUYA 1KJYA 5KNDD 3OM0A 2YX1A 4YRMA 3CGGA 5GM1A 1Z5ZA 1HUOA 4IIYA 3PSTA 4XQEA 5K8TA 4R7TA 4JA0A 2CE7A 1Y9AA 2G7MC 3DDOA 1YIOA 3AB8A 2XE7A 5HPYB 3O8DA 5K5EA 3I39X 4I2GA 2FLWA 4QUJA 3DWGA 3TSZA 1R0XA 3MS7A 3PGJA 4FMBB 1OUMA 2HRDA 1NK9A 2EP8A 5JVDB 1FP4B 2DRIA 2MSLA 2ZUDA 4G36A 4UHBA 3M3PA 2OCYC 1KEEB 4CMHA 5AOCA 1J07A 4TTPA 3CUKA 1PQYA 4MKZA 4B17A 3HU2A 3DLCA 5DULA 3WWCA 1Z1BA 5I9MA 2C3OA 3C3BA 3A31A 4V0LA 1NVKA 3VMMA 3Q6NA 4WESA 3ET5A 1S5PA 2H5JA 2EQYA 3SQNA 4EW6A 1A5ZA 4MEAA 3GPBA 1X2BA 3WFJA 3B2NA 3OHPA 4YCDA 2DXIA 1KI7A 4RQNA 3T3EA 2R8HA 1H8HD 3K8OE 4QOFA 2LD4A 2PQ2A 2ZWVA 3OQ1A 4I29A 3IEVA 3C3DA 1BH2A 2UZAA 1O58A 5JRTA 3R3XA 1G8YA 4DY4A 8AT1A 2UVPB 3W04A 2NO9A 1E5QA 2I55A 5F3RA 1I6WA 2PS0A 5J40A 5K8VA 1POXA 3KT6A 3W4IA 3RVBA 4YMVA 3VDRA 3VC7A 2ZWPA 2QAIA 2V9ZA 4PGFA 2EFEB 2AQ0A 4AWXA 4BYGA 1EA7A 1VKHA 1JSZA 4DJDC 4F2RA 4U8GA 1TJ4A 5IF3A 5DQHA 4XWYA 3TOVA 4MHSA 2A78A 1TYDE 3VAZA 4FJ2A 1XZAA 1F8YA 1WA5A 1FJ2A 1YB4A 4GPZA 1XZLA 3KP1A 1YMUA 1J49A 1IN7A 2KLHA 4KYTA 4KUEA 2CNDA 1MV8A 4GP7A 2VATA 3TJRA 1XHFA 4YRKA 2D00A 5JAMA 1C7EA 2I6TA 2DY0A 3BIWA 1Z33A 3C1OA 4UEWA 5DOVA 5EXTA 3TBFA 1XJCA 1S0NA 2NU8A 2CXSA 3RAXA 5TQ2A 2R8ZA 4UFNA 1CV2A 4BTVA 2B9VA 3QKSB 4CETA 2YXBA 3C1AA 2CL0X 1Q2UA 4NEHB 5FWYA 3W2IA 4EUKA 2D0IA 1YB7A 1NDHA 3KHHA 2AD5A 4ROTA 1GJRA 2E7ZA 5DCWA 1P29A 1DFHA 1OLSA 4AUMA 4CN9A 1ZICA 1IVNA 4UU1A 1F4VA 5KFFA 1K6EA 2JKZA 2Q6KA 3RHZA 2NVBA 3W5CA 4DREA 1C4KA 5LMCA 4M1KA 2XD9A 2Y76A 3IBCA 3K70B 1NC3A 4WVLA 5A1TA 5EKXA 2VDMB 4GYKA 4DA8A 1YT5A 1FFBA 1D8BA 4NQZA 5BRAA 1GZ4A 3RYHA 1GFIA 3HFJA 3NC4A 3AEKA 1XTVA 4ZDWA 4MB6A 1WKCA 4KHZA 2CNKA 3CNQS 4EKNB 3QJGA 4M9NA 4QUIA 3TQQA 3ICQB 4TKZA 4N54A 2QOEA 4EGFA 1PR2A 2Q5EA 4KPUB 5AI8A 4P5DA 1THTA 4KP7A 2HU2A 2AYXA 2WD7B 1A4UA 2HMYB 3G5TA 4BNKA 1Z7EA 1JZQA 3QLJA 3FCSB 1AKTA 1SURA 5EC8A 5FKJA 3ZZNA 1I32A 4BZWA 2VS1A 2VT3A 2OFFA 1BROA 1CZHA 3N0XA 1SMKA 4CLRB 4J9UE 2E8MA 2ASVA 4RELA 4JP2A 4UU8A 1VHLA 2QU7A 3QYFA 4JSYA 4P4TA 1YS9A 2P91A 4N12A 2PRJA 4V0QA 2R7AA 1QM5A 2HO5A 1T25A 3X1WA 2WAXA 4FLFA 4DPKA 3A9WA 5IIKA 3G85A 1OWMA 2HWXA 2PMWB 3K9GA 3LAWA 1VSQA 5KOHA 4MV4A 1IDN1 1NF8A 1GR1A 3LP8A 1TO1E 2ZJ3A 3O4RA 3EZYA 2IMWP 1DCMA 1V1MB 1M2WA 1AXRA 4AMYA 1VRWA 3OPQA 1SOWA 3R9IA 1P4JA 2FSFA 4OQZA 1LBIA 2JHAA 5I01A 3IL2A 4CMEC 1EFLA 1AN0A 4KO1S 4POOA 1JSRA 4WOKA 4U2GA 2EKZA 1F2UB 4HRAA 4RVCA 1F8XA 2DFDA 4KRXA 2RGYA 1HRKA 1KO4A 4B6RA 1GN8A 3LBFA 2WTMA 4AQDA 4U0KA 3AUOA 1CNFA 1QF7A 1PUIA 1U7XA 1K4KA 2QU8A 3MJ4A 1R9MA 5I7FA 3CX6A 3ZV3A 5F3DA 2FPKA 1HF3A 5AXAA 3BDPA 3IPRA 5CT8A 1Q7CA 2AVNA 3PXGA 2V4MA 1KVTA 1HKHA 2ZROA 3RJHA 4QWBA 2HIAA 3M1LA 1R74A 5LZ2A 2ZAOA 4KAXA 4RX1A 3LHKA 4V0MA 5F9MA 3VOAA 4FZVA 2IBSA 5LOVB 1DKOA 3CTMA 4G5FA 4B33A 1R5BA 3U9LA 2C0PA 4BGVA 2R00C 3EQ8A 4B81A 1ML4A 2I2AA 4GC7A 2D13A 4F4FA 4BMYA 2YIDA 1EQAA 1W9MA 4BNJA 5HWSA 2KW5A 4YDQA 1OX4B 2RGNA 1JZSA 3SM9A 2OFPA 4FDMA 1EFVA 1EAMA 5G0WA 3L1HA 3VHQA 2X2PA 1CG6A 2FNAA 4C08A 2NSYA 2RHBA 4C0QC 2XZLA 3ER8A 6GPBA 3S2GA 2AG0A 4HJRA 3SFTA 4YA6A 4H3KB 4HRVA 1LPMA 3L6UA 4Z7JA 2WT4A 3R0IA 2JNWA 4JL6A 2DGZA 2J3IA 4XFDA 1XS9D 4XDHA 3L4BC 2W3SA 3DEFA 4EHNA 3CG4A 2XX3A 2AG8A 3TRFA 1RYSA 4Q4CA 3EG5A 4I2NA 1GTRA 1LC3A 3T1VA 3L7CA 4YLGA 1PKEA 2VK4A 1G8KA 3K3PA 1HDZA 4HOYA 3L0ZA 1JLHA 3BPSA 4JIGA 1PBNA 5KFTA 4IHJA 3WYNA 3NTOA 5HKLA 3BS7A 3ABZA 3DEAA 3P5BA 4DCCA 1ODKA 1Q3HA 1CZNA 5JSUA 2FR8A 2HEIA 2QRNA 1IYZA 1U3DA 4ZT5A 2C77A 3VOTA 2FEAA 2GN1A 2P8JA 3NBAA 4F8EA 1ZK2A 1A76A 1UOPA 3Q3GE 1KOJA 3IP1A 5AK4A 1NIPA 2QJRA 5A4KA 5JDCA 2E4WA 4M9SA 3NASA 1EI9A 1W25A 2FZGA 1NAIA 4QUDA 2ZDGA 3CZ5A 3FVQA 2ZM6B 1G59A 4FN5A 3EXG2 1EVEA 1DC8A 1F7UA 3E7DA 2XGPA 5FFMA 4PGXA 5AVTA 2CD9A 3KJQA 4OFWA 2XVTA 2Q4DA 5CP2A 3L5OA 1K66A 2YN2A 3RFAA 5K7SA 2GXQA 2F4VB 5J0TA 4PVCA 2POCA 3QUAA 1CUZA 4DFJA 3G0GA 1AZWA 2PMKA 2FWAA 2ROQA 1TRKA 2I6GA 4KN9S 2Q8PA 5GV8A 1C50A 3RT9A 3SS7X 4RH3A 5ALYA 4K9LA 3U2QA 3MQFA 1H9BA 2JGLA 4M0PA 3WAJA 4I5IA 4C7YA 1EH5A 1MCZA 4BFUA 2OMKA 2WW8A 1Y88A 1GKKA 2V7UA 7ICKA 5KO2A 1L9XA 3JALB 1JFTA 1CZRA 2WWXA 4F8JA 4KQWA 2YMLA 2FWJA 2W04A 2IYPA 3C5CA 1NV9A 5EIBD 2D0PB 4I4LA 5IAGA 4UNSA 5SYMA 3U44B 1MAUA 3WL3A 2WD9A 3CMMA 4UMDA 1Z29A 2V6MA 4LIPD 4LFCB 3MWGA 3BE5A 5H3LA 2BSXA 4AZTA 4NLKA 1P1JA 4YN4A 4O1IA 4GZMA 4RJJA 1T9GR 2Q5LA 3NVYA 2QTVA 1CEEA 5B7GA 2O8FB 3O0TA 4N82A 2AI2A 1RM4A 3MT9A 1YULA 4NZNA 8ICNA 1F2VA 4QDXA 4FHGA 2BFDB 1AK1A 3H2JA 3DZGA 4A8TA 4H0FA 3AO0B 2IHMA 3ZEIA 4FINA 5DW0A 4LFAB 3M6UA 1GG9A 3AG5A 4F86A 3KD3A 2AG6A 2H2IA 2FFRA 2OTCA 9ICXA 5LD2B 1TIPA 1TOAA 2B0CA 1CQXA 2C5BA 4B71A 1B8PA 4G25A 1OWPA 2OLJA 1WXGA 4JITA 3DC7A 3AHHA 5CTAA 3C7AA 7ICHA 1YJCA 2IHVA 3VKVA 4EP1A 3QPCA 3CWCA 4JT2A 1PX0A 1F0MA 1BJTA 1BDBA 5GIPE 1M66A 3O4GA 3IXLA 1KXJA 1APBA 1J56A 2CXHA 3WLTA 5P21A 1SD2A 3TEJA 4OFZA 3Q9SA 1L4BA 3Q0EA 1RIFA 4EF5A 2DTXA 3ZHBA 1AHHA 3ZDCA 5ECWA 2Q1SA 1FUKA 3FCCA 1U9IC 3FTPA 4CIVA 3IAXA 2D06A 5BV2P 1PJCA 4QWCA 1E2NA 1JTVA 4FEYA 1Z5NA 4ZZ0A 4F5NA 1J06A 1Q7BA 1F60A 3WWDA 3VZPA 1N2OA 4KLCA 3DA8A 4D9EA 3VPCA 4JOQA 1XHEA 4G9GA 4KZKA 2P6PA 1KQ3A 4D9JA 2L69A 4WBNA 3PEVA 3KHTA 1YQEA 3L8FA 2V98A 5IIOA 5KFRA 2AJQA 2FSUA 2ZIAA 1T5BA 4UJ3A 4C7VA 1RYYA 3H2BA 3O31A 1RI2A 2Y8EA 3JQBC 4AYWA 5AVSA 4YV7A 4O5OA 3UANA 3M8RA 4HGZA 1NOKA 3GRYA 1ABEA 4L9SA 1ZN8A 2PX0A 4EO7A 3TLGA 1WUKS 2MHCA 3DMPA 5BN3B 4MDHA 5DO9A 4LQ4A 3EZFA 4NS1A 5CHYA 2I0FA 1EGAA 4V2IA 3O26A 1H85A 3Q7EA 3ROEA 2VP5A 1PN3A 4QYXA 4DIMA 2AGPA 3ZY3A 2J6BA 1VM6A 3VUFA 5AQ1A 3VSEA 5CVVA 4YAJA 2FKAA 5KYXB 2HTEA 4K3UA 3LKZA 5BUQA 2A94A 3E70C 5A9SB 4QECA 4TSRA 4MRAA 3ZZUA 4G8BA 4ZOEA 3CSDA 1Y98A 3B0YA 3H5RA 1IQRA 3TW4A 3R44A 1VSUA 1TJPB 3G68A 2AEFA 4OP3A 4E2YA 3HVJA 2ZTCA 1CJSA 2W37A 1T8TA 2O2JA 4KRFA 1PT5A 1YI0A 3UG6A 1AQ6A 4UDYX 1USIA 2WKRA 3I76A 1LKYB 3V5NA 1SD5A 1DTWB 5J5CA 5LNK1 1ZQLA 3RYCA 5GVRA 4PZAA 2OD2A 4OA5A 3G59A 2XUJA 3WL8A 4QXMA 4MULA 1EK2A 4QXOA 4WASA 3EFOB 2XCIA 2QUIA 4RY9A 1F6DA 1RJ9A 2B0JA 3CH7A 2JFPA 3CBQA 5FBLB 4MUBA 3PC8C 2H65A 4MYRA 1PWYE 3C29A 4J03A 3KS9A 2GVZC 4I08A 3FYSA 4HCJA 3FOEC 1NBWB 2B8TA 5JH7A 4KBYA 4M9XA 4RNOA 1R7RA 5C8ZA 1O7JA 3OX1A 1P72A 1ZG3A 1QZUA 1YDGA 3C85A 3VHXB 4ALJA 1TKDA 4L4YA 3U6KA 2X22A 2PY6A 2HBJA 1KERA 1Q15A 3K1TA 1GGMA 3B89A 5DLEA 4WAUA 3HLKA 4BB5A 1X9SA 4JL8A 5DNYB 2J0QA 4CM7A 4RDCA 5HKKA 3C5WP 3ZTTA 3WLQA 2FEWB 1GQQA 4A8PA 3PK0A 1F4PA 1FFUA 3TACB 4L4RA 2ONYA 3GLIB 4B7UA 5HJ7A 2BEWB 3D8NA 3C3WA 5FCDA 4AZVA 3GQVA 1NLUA 4UNNA 1M1NA 4PM4A 5CFOA 1NI4A 2SCUA 4DILA 1U3GA 4CMIA 4OVKA 4RQBA 4C30A 4EF6A 3K16A 1RKUA 4FP9A 4CL8A 5F2OA 3UQYS 4KO8A 3ASZA 1RZUA 4IZ6A 4PW0A 3WICA 1WXEA 2QLNA 1VCOA 4F5WA 2PKXA 3F78A 4R8KA 1ZH4A 1SAYA 3CUSA 1GPDG 4PZ9A 3N6RA 1VG0B 5FFNA 4AL4A 4FS3A 4FS1A 1VYUA 3HYCA 5EOVA 1OQAA 2JIOA 2ZUBA 3EFBA 1FMFA 3OLZA 3GAAA 4FSHA 1KP3A 5FAKA 4DT1B 3H2IA 1E18A 5AVVA 1Y4DE 3OLCX 1GA4A 1QTRA 3W2EA 5I9LA 1JWBB 4MW6A 5KG7A 3AK4A 3FIJA 5ILQA 3AEQB 3BT7A 1YHZA 5IM4A 2B9EA 2ISOA 4FYIA 1JHDA 5HJ2A 3FMPB 4MCJA 1TXGA 5EUMA 1D1SA 1VKNA 3NFYA 1XALA 4JI2B 1LK0A 2J08A 3FLAA 4QFDA 4ARCA 3ZCRA 1VIYA 4Z7QB 4O2BF 1GG5A 1JXQA 2VF2A 4MUJA 2E0IA 5IDXA 8ICKA 9ICHA 2MU1A 4FK8A 1S2GA 3OZAA 1NW9B 2V54A 3DMTA 1KFBB 2GD6A 3GO4A 1IN8A 1E2EA 1X92A 3NGDA 4Y2HA 2VJAA 3WL6A 5CPFA 3C8DA 3OWHA 3BXHA 2WSLA 4AMBA 5E7MA 1U2DA 4UEOA 2ODGA 2WE8A 4EW2A 2GHTA 4FS2A 1ZMRA 1OU0A 4NDZA 5EUQB 1JKIA 2CYBA 3MLBA 4DJJA 1CX9B 3OA0A 2H00A 4HNGA 4TRMA 4D74A 2CFIA 2HUPA 4JASB 3JZMA 2ZTEA 5J4LA 3PZRA 5BURA 1ZD3A 1G5RA 3LY8A 2JGKA 1R8XA 4PX3A 2PWPA 3FDZB 2YV4A 1GYRA 1U63A 2JLYA 4BIMA 4Z9XA 4C1NA 5DHSA 2I62A 5KSWB 3DFUA 2C0CA 2D3TA 1JSCA 4GL4A 1BMTA 5KFSA 2ZIUB 1G20A 5G40A 2LGJA 3COJA 4U2FA 1NJWA 1K8YB 3OSZA 3A32A 3MLEA 2P6MA 4JV0A 4O4IB 4NFSA 3DL4A 4PGAA 4MAAA 3RNOA 1KGDA 2IKQA 4BC0A 2F90A 3L43A 3CT4A 1AK9A 5BSVA 3K5WA 2RSLA 3I45A 2EQBA 4HLCA 3HXQA 4FKMA 5BMOA 1ZFNA 2JJ1A 2BE9A 1V3TA 5JO9A 2SKEA 1JEQB 1KFSA 3NHWA 4P4SB 3TXAA 3JD0A 4ZOHC 3T7DA 1WXIA 2ODBA 3GWGA 4A2WA 3TJMA 4W9RA 3D4LA 2HCRA 3OX3A 4BWGA 4O5EA 1VQ1A 1SVIA 2V65A 2OGSA 1WV1A 2ZT5A 1DAPA 1R9NA 4O2AB 4BO0A 4YUZA 3V9AA 1WXDA 2IXTA 2AKYA 1YKGA 1BQEA 1PWZA 3IPLA 5K8LA 2WQ7A 3WRYA 4HS9A 2V0NA 5FNVB 1S97A 1OTXA 3INYA 4JBXA 4A8JC 3JZAA 2X19A 4Y2JA 3KKOA 1AH2A 1I4DD 2VA3A 3S1AB 1KZ7B 2R2AA 1BAPA 3CM0A 4O3FA 4E1VA 3ZW7A 5B7NA 4L5BA 2CZGA 3WYGA 1FXSA 3BN3A 3O38A 2JGMA 4FLEA 2ZQ5A 3P19A 1ADCA 9ICFA 1DOZA 3UOWA 3K9CA 1WCIA 1YZFA 1ECWA 3JXEA 4HB0A 2E3JA 5CA0B 3TPZA 1ZVVA 1YQ9A 1KQQA 4GC5A 4MV5A 3D8UA 2ORWA 4R40A 3NBFA 1YQWA 2HN9A 2GEFA 4TXH