2VKQA

Crystal structure of human cytosolic 5'-nucleotidase iii (cn-iii, nt5c3) in complex with beryllium trifluoride
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'- Nucleotidase III
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2vkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2vkqA01
2ZBEA 3VAYA 2C8KA 5AI9A 2W4MA 4IFTA 4BBJA 2OM6A 3WK9A 5ALYA 2FPRA 2ZBDA 4H1WA 1CR6A 3NANA 3PCTA 3QUQA 3RF6A 2HEGA 3HLTA 5ALJA 2CFTA 3DDHA 4GXTA 2IA5A 5ALIA 4J03A 2FUEA 3EF0A 5E0OA 4YIKA 5AKJA 4G9BA 3CZ4A 2BDEA 5AVSA 1Z88A 3QGMA 2G06A 1VJRA 2FPWA 2I6XA 3N1UA 1TE2A 3OCVA 2B8EA 3OCXA 1U7PA 3PGLA 3L7YA 4HGQA 2OYCA 1XP5A 4UAVA 2YJ3A 3A1CA 3QXGA 1XVIA 3FVVA 3ZW7A 3UMGA 2MSNA 3U7GA 4Y2TA 3OTQA 4XE5A 1U2SA 3UMCA 3NIWA 5AK6A 3I28A 1SU4A 5AVUA 2RB5A 5AI8A 5ALWA 3W5CA 1O08A 1RLMA 2JGAA 3E84A 1Q92A 3AR7A 1Y8AA 4NFLA 4EX7A 3KOOA 5AKHA 2G08A 1RQLA 4OHFA 1Z4IA 4RESA 1T9ZA 2FPXA 4XQ0A 3WK5A 4DW8A 1J8DA 4I9GA 3UM9A 1ZD5A 3KC2A 4YCMA 4PNHA 1L7PA 1LTQA 4Y2XA 2HI0A 5AKLA 3UMBA 5AM5A 3W5AA 3MMZA 3MC1A 3DV9A 3FPSA 5AKEA 5ALFA 3FM9A 1Z4JA 3ZX5A 3AR8A 3WKDA 2B30A 2GO7A 2CFRA 2YMQA 3NASA 3K1ZA 4HGNA 5AKGA 1O03A 2B1RA 2W11A 3R9KA 5ALHA 2HCFA 2NYVA 3U19A 3ZWKA 3P96A 1LVHA 2HO4A 2FPUA 4CF4A 3J7TA 2NO5A 4C4TA 3M1YA 2I33A 5ALKA 4UAUA 4KNVA 3ET4A 4CE6A 3IB6A 4BNDA 4DFDA 1U7OA 1Z4NA 4Y2QA 4O8CA 2YJ5A 1NRWA 2YY6A 3ZX4A 2G80A 3OCUA 4L57A 2AMYA 3QUTA 1VJ5A 2R8ZA 4KN8A 4CF5A 2YMLA 3RFUA 3L8FA 2CFSA 3E8MA 3WKCA 3WGUA 2EATA 5AK3A 2PR7A 2EARA 4MWOA 2YMMA 4E88A 1RKUA 5AW8A 2C4NA 5AVTA 4UARA 3QLEA 3WK4A 3L1UA 4ZEWA 1ZOLA 5ALSA 3NALA 3BA6A 3ZWDA 1Z5GA 4BNDB 5AVXA 2WF6A 3N07A 3PGVA 4JDPA 5AVYA 2QYHA 3KD3A 4NV0A 2PQ0A 1RMTA 3ZI4A 2WM8A 5AW6A 5AIBA 1NF2A 2HF2A 5ALTA 3ET5A 2C88A 5ALQA 1S2OA 1QQ7A 3I6BA 4EX6A 1N9KA 2JAWA 1L8LA 1EK1A 1Z4LA 1TA0A 4UMVA 5AI6A 2RARA 4KX5A 5AW2A 5AVWA 5ALOA 4Y2RA 4CNQA 2C8LA 1ZS9A 2Q4RA 5AKYA 1PW5A 1QYIA 4HGRA 4DCCA 5AVZA 5AW5A 4Y2JA 5ALVA 4EENA 4BEVA 3WK8A 4FYPA 5AM3A 3KZXA 1SWVA 4YIHA 3SKXA 1VFPA 1T5TA 4KNWA 3SHQA 3ZVLA 3U26A 1RPZA 2WFAA 3B9RA 3QU5A 2GMWA 2B0CA 1U02A 1YMQA 4FE3A 3BWVA 3L8HA 3ESQA 4DWOA 3R09A 4XOUA 3N28A 4EEKA 3L0BA 3KDPA 4KX3A 3WKBA 2HOQA 3B8EA 1T5SA 2D2VA 1ZD4A 4BKMA 3QNMA 1L7MA 2C9MA 5AKIA 3MPOA 1Z4OA 1RQNA 2HDOA 2WF9A 2I54A 4B6JA 4AP9A 3PDWA 1L6RA 5IS2A 4UATA 3DNPA 4UASA 3DAOA 1QH9A 3SMVA 5IT4A 3ZVNA 1RMQA 4UMEA 1Z4PX 4BX2A 1RLTA 4NABA 3SD7A 2IOFA 4XPZA 2FEAA 5AVVA 2CN1A 5AW7A 1Z4KA 2FI1A 5AVRA 5AVQA 5AW3A 1ZD2P 3S6JA 3M9LA 4L6CA 1YDFA 4BX3A 4BX0A 5JJBA 2ZXEA 2AGVA 2EAUA 2HSZA 3WKEA 5AW9A 5AKZA 1ZRMA 3GYGA 5ALPA 5AI4A 3A1DA 1Z4QA 4KYTA 2YFYA 2DQSA 1CQZA 2Q5EA 3QU7A 5T41A 3SKYA 3ZTWA 1RLOA 5AI0A 2B8JA 3ESRA 5FP0A 1Z4MA 3AR5A 3L5KA 2W43A 5A3SA 1ZD3A 5ALRA 2R8YA 4HYTA 5AM1A 2PKEA 4MUMA 1RKQA 4ZEVA 2BY4A 2I55A 1L7OA 1ZRNA 1MH9A 5AW0A 2BDUA 2Q4TA 5ALZA 3W5DA 5IT0A 4F71A 5AM0A 4YCNA 3NRJA 3OCYA 3IRUA 2I7DA 3AR9A 5AK4A 1WPGA 1FEZA 4HAIA 3L8GA 1IWOA 4Y2VA 2OA0A 2O9JA 4UM5A 1Z5UA 5A3QA 1EK2A 5AKXA 3ZUPA 2YMPA 2G09A 4HGPA 2G0AA 4YCLA 3IJ5A 2JAUA 2QLTA 1X42A 1QQ6A 3N5KA 5AICA 4ZEXA 4QJBA 5ALXA 4UMFA 3D6JA 2AH5A 2JARA 3CNHA 3U7EB 1Q91A 2G1AA 1WZCA 5A3RA 3L0CA 1TJ4A 1WR8A 2FDRA 5AK5A 3E58A 4Y2SA 1S8OA 5ALMA 4NAVA 3ED5A 4I9FA 3QX7A 3L8EA 3W5BA 2O2XA 2B82A 4BEWA 2FUCA 3TLMA 4QQFA 2AUTA 4BYGA 2P9JA 5AW4A 3NAMA 2P11A 4C4RA 2WF5A 3L0YA 3A1EA 3WK7A 3QU2A 4YH1A 1RDFA 2R8XA 3QUCA 4HGOA 3N8GA 3OCWA 2YN4A 3U7HB 4YGYA 4EZEA 1ZJJA 4UMDA 4FFDA 3EPRA 5ALLA 1SWWA 2P69A 3OCZA 2IYEA 2WHEA 4UU0A 3A3YA 4GIBA 2VKQA 2RAVA 3ZVMA 3AR3A 2ZOSA 4UW9A 2ZBGA 2YBDA 3ZTYA 4Y3UA 2IOHA 1JUDA 3F9RA 4AS2A 2RBKA 2MU1A 1TJ3A 3AR2A 1RC8A 5AKKA 4Y2YA 2FPSA 2GHQA 3KBBA 1TJ5A 5AHXA 3SLRA 1XPJA 1RKVA 3MN1A 3QYPA 1AQ6A 1RRCA 2X4DA 1N8NA 3WKAA 5ALEA 3SF0A 3I76A 5AIAA 3NUQA 2R8EA 4IG4A 4CF3A 3FPBA 4AS3A 4F72A 3B9BA 3FGOA 4L6AA 3QUBA 2I34A 2P27A 2NO4A 1RMYA 2HF7A 1QQ5A 3ZU6A 4G63A 4NWIA 2WF7A 3EWIA 3QU9A 3AR6A 2G07A 2GHTA 2JAOA 3WGVA 1WVIA 2B1QA 4EELA 4UU1A 5AM4A 1YJ5A 5ALUA 1NNLA 2HX1A 1L7NA 1K1EA 1L8OA 4OCZA 4RETA 5AM2A 3R4CA 3E81A 1KYTA 2IOFK 1YV9A 5ALGA 3ONNA 1F5SA 2ZG6A 2WF8A 5AI5A 5ALDA 5AW1A 2YJ6A 3FZQA 2YJ4A 3HYCA 1U2TA 4J2TA 5AESA 3OPXA 3WK6A 1YNSA 2ODAA 3I1YA 3QU4A 1J97A 4OD0A 3EF1A 1YS9A 2GFHA 2ZBFA 3AR4A 5ALNA 4C4SA 3L1VA 4UM7A 3U7FB 2OBBA 2HHLA 4Y2UA 3U13A 4OFZA 4JB3A 4Y2PA
chains in the Genus database with same CATH superfamily
1TK0A 1CG6A 3ICVA 2FEXA 4B17A 3A6KA 3H6GA 2X3UA 4AG6A 1EWTA 3A0UA 4KMSA 3HBLA 4F4KA 2DQ4A 3T3MB 3E3MA 1XCBA 1H4SA 2NSJA 2RP5A 3I1JA 4GHWA 5A71A 3PU6A 3CUUA 5KFQA 4KMRA 4KL8S 4MQ6A 3FOBA 3GJSA 1GRNA 4CM5A 3L7YA 2V6MA 1S97A 1MGOA 5F64A 2GARA 3ORFA 2WSSA 2W2OA 4CPDA 1H5NA 1LRJA 5FWDA 1EB8A 3EXEB 1UOOA 5EUBA 1KQ3A 4YBRA 5B58C 2IS1A 3LS2A 1JPVA 2VVTA 4OV6B 1T8UA 4O4LB 4YR7A 4UHBA 1XMSA 2CHVA 5L9AA 1YR9A 1Q0RA 4H3SA 1G6Q1 5ICGA 3ADCA 1FPQA 4UQLA 1OU0A 3UJ6A 1FFGA 3G2NA 5D01A 4Y98A 4M89A 2N9UA 4C14A 5F9HA 2FEMA 1JV2B 3AEQA 5LA6F 5I7SA 5K3EA 2BHSA 1FP2A 2C9BA 4PHAA 1YS7A 2EL9A 2J6CA 1MFPA 1ZK1A 1NQWA 1PJ3A 2QAGC 1TT7A 4M2LA 2GJ9A 5CRIA 1WMDA 2VJOA 1UP7A 3AOGA 2EU8A 2IE8A 3A8TA 1BHJA 2QMQA 4NEQA 5IUJC 1REQA 3QXHA 4QASA 4CNQA 3P2JA 4NBUA 1OTHA 4N01A 4DT1B 4TWAA 4PZCA 3DL0A 3ZD8A 2CUTA 3WK8A 3OX4A 3IR7A 4XGKA 3S2YA 1E5XA 4QNMA 1J7KA 4KNWA 3WLJA 4EFKA 2IXTA 4IGEA 1JZQA 4QJIA 4KO8A 3RUIA 4M1TA 3O0FA 4LCEA 3REOA 10MHA 4RBNA 3DVLA 3MHPA 3CEMA 1Z07A 2ZIGA 3UAZA 4QWCA 5BR4A 4WZZA 1X38A 2C9MA 1U0RA 1R66A 3F6PA 3LBIA 4L3VA 4KMUA 4I50F 4LMPA 2OPHA 1CLEA 1HE8B 1ZVQA 3SQDA 3QLJA 4MEJA 1H9BA 3QF4B 1NBAA 4YNBA 1I13A 4OK6A 3NBXX 1SBTA 1CUCA 1QIGA 3PY8A 3DOJA 5KFPA 1Z4QA 5C32A 1JAHA 4QPDA 1GGEA 1FJ2A 2AKYA 5F35A 3EZXA 2F17A 5A4FS 2X8WA 1IXRC 1H9CA 1WZNA 2VKTA 2ONZA 3ROZA 4PC2A 3ND7A 4DYDA 1HR0B 3WIEA 1WW8A 4NHOA 2CNWD 4J9PA 4PRYA 3R3SA 1KHHA 4LXUA 1KVSA 3THYB 2BJVA 4CU5A 5DH9A 3N2GB 3JQ7A 4EA6A 4D8WA 4ANFA 5HMMA 1L5LA 1SCNE 3BT7A 3OZVA 4RH3A 3PFKA 3GZJA 1S8OA 4M9RA 2ZI7A 3DMTC 3QX8A 3Q9SA 5DBCA 4BE9A 1X94A 5LKAA 2XGMA 3RHZA 1F3OA 4GBMA 2W8BA 3DEEA 4WBNA 1GEGA 1L0BA 3PS9A 2ZAMA 3WWEA 1V85A 1Q11A 2PS3A 4UU0A 1E66A 4E1VA 2BCJQ 5CJ2A 4W99A 4R1OA 3H7AA 4ZMRA 2ZB2A 3AR2A 1TGVA 1NK6A 1M8FA 2DECA 4B2PA 3CIOA 1MB4A 3SLRA 3HCCA 1VPEA 2PMKA 2VAXA 2XCOA 4NCHA 1TKCA 2V97A 2GBPA 4KC0A 4JU9A 3WTBA 2QVGA 2OLJA 4S24A 1J5PA 1RHRA 2ETVA 4LZGA 3V80A 4K81B 4YEDA 1YSCA 5E38A 8ICAA 3P5BA 2F1IA 3AR6A 4D80A 3QPDA 4POAA 4E13A 1NASA 4LPKA 4DXDA 5JV5A 2ZIVA 5THXA 5FLEX 1VB3A 3GLVA 1YV9A 2V7GA 4OH7A 3COVA 3A4TA 4LYEA 5A04A 4QGSA 1JFVA 1B6RA 2OBNA 2H00A 4K3VA 1OLXB 3C3KA 1H05A 4IJ5A 1AHNA 1HSOA 1CY4A 1AZSC 3IQXA 3HU3A 1TCAA 5K6AC 3LLVA 2Q3BA 4JFAA 1JEEA 4E5KA 2EBHX 2FMSA 3I2YX 4W5TA 1P1HA 9ICGA 4CMJA 3CVOA 3UAYA 3SQNA 3TIVA 3U49A 1YB7A 2JC3A 5EL0A 2ES6A 1A9PA 1XLWA 1AIPA 1DEAA 3U39A 1M73E 3VO2A 2NRWA 3JXEA 2QRNA 1W581 2GK3A 1QOPB 3F2IA 3TAXA 3O91A 4LZWA 2HNBA 5PGMA 2VDVE 4M9UA 3Q9NA 4Z9XA 3VHLB 2EANA 1U48A 3LGAA 4QBFA 3HZRA 4O1HA 4RPGA 5LB4A 1Q7TA 3VR2A 3WWOA 1U1DA 4WE3A 3J7TA 2BGWA 2X42A 3OWOA 3LX4A 2DF8A 5EMKA 3G6KA 4MR7B 1P3JA 4TUYB 1CX9B 1I6LA 2C59A 3QTLA 1KEEA 1NBME 1Z2AA 1QHXA 1AKNA 1CJVC 1UAYA 2UXBB 1MX3A 4NJ8A 5CXXA 4CI9A 1QFJA 4KJXA 3IXMA 4AS1A 4EBBA 4MUFA 5B5SA 3WA6A 1PEYA 4W4TA 3L4KA 5LZ4A 5C9ZA 4K40A 3DE7X 2IQ5A 4Q3LA 4PIPA 1NLMA 5A5GA 2CJFA 4UTRA 1T2UA 5LNK1 4QUKA 1T6NA 1UPFA 4MGYR 2OWOA 3OD1A 5CA1B 3NOVA 3ENKA 5JDIC 2QTMA 4EZ9A 3B9RA 1IBMB 3BWVA 4RQAA 1MQ9A 1VJTA 2XUQA 1JJBA 4ID3A 3D8UA 2WHRA 3IAHA 2ZVDA 1ZQWA 3PNYA 1W52X 1EGHA 1K08A 3GBVA 1ZYQA 3TUIC 5EFOA 3SHOA 2P4HX 4AT1A 3EGOA 2DYKA 3SR0A 2GVDC 3STYA 4EY6A 2PZ8A 1P0MA 3UEOA 1DCMA 5C7OO 1YA4A 1NXWA 2HBMA 4RJLA 1FRFS 2Y2VA 2OGSA 2O3JA 2WG2A 3QFHA 2QQEA 2RMKA 5KHOC 5F7XA 1E7QA 1IEXA 4KWEA 3OG9A 1XZQA 1Z2CA 2AVNA 1G7TA 2WZQA 1CETA 4UB3A 5H3CA 3UKJA 4CCHA 2E0IA 3OZWA 2HDWA 1C3OB 1NDUA 5D6NA 4KOAA 2BMVA 2C97A 4N6GA 1P8JA 3TADA 4YD2A 3KSRA 3ZWCA 4YCLA 1NOJA 2P1DA 2O05A 3K94A 4HRAA 4E4RA 3OE1A 1E9VA 4ZYXA 3QX7A 1YBHA 3HDGA 1THTA 4JSYA 1NX9A 2ZE5A 4TV8A 1DQSA 4GPAA 4J2OA 4ZXFA 4C08A 4PYMA 4PZPA 4FYXA 5B66U 2F1RA 3C5CA 2W70A 1W30A 2QR3A 4P3NA 4IXDA 1ZD8A 4R1MA 2PT6A 4HAYA 2XA2A 2OCBA 5F1PA 2WAXA 4N5HX 1H2FA 3K1JA 4I19A 3QNUA 1ID1A 3Q7EA 4GQAA 3S8YA 4Z9YA 3SYTA 2GM5A 1RC8A 2BE7A 3AHGA 1RJGA 3VH2A 4AICA 5I7WA 3QE4A 3AVYA 5T57A 4NXZA 5F52A 2R751 4LHWA 3LUGA 1T3ZA 5KNDA 2VJCA 4MUAA 5JSUA 1DX4A 4XVCA 3FYSA 1JXEA 1TNDA 3A9SA 4AQ7A 5CEEA 4N4AA 4D3ZA 5ELMA 4E03A 3DMRA 4UPVA 2YS7A 3ASVA 3QFFA 5DTJA 2HHQA 2FE4A 4KLRA 3GQBA 3IAAA 3X0DA 2R68A 3Q3VA 1U7TA 2YNMD 1SPXA 3WLTA 1GCGA 4QBKA 1XYYA 4HN9A 4YWHA 2GEVA 4LDJA 5K0JA 1XEXB 1IQPA 4L5IA 4HZUA 3UGTA 1EE9A 3PFIA 4Z49A 4XEHA 1W93A 1ULZA 2W6OA 3A4LA 4BMCA 1WU7A 3TCNA 4IIFA 1OX6A 4KLOA 4ZDIA 1QS0B 2JZOA 4UEWA 3IEMA 3B51X 1T9DA 3TECE 5AVSA 4ZU6X 2B8EA 2XDQA 3WAKA 2BDPA 3M8SA 3EG5A 1UC9A 4NOKA 1FSSA 2HHWA 3I73A 2FPGA 3BS5A 3V8PA 2VDWB 1B6SA 3RS5A 1GPYA 5EINA 1IZYA 2XT6A 3QHPA 3S1AA 2C8JA 1XTUA 4QREA 3DV9A 4G8JA 5K2OA 1VL1A 1W5SA 3NDIA 1NJSA 3IP1A 1X7XA 4C4TA 2J07A 3QKRA 2H3HA 3AJDA 1QZUA 1OZ0A 1V3UA 1VOTA 4AL4A 1XQ1A 4PO9A 5AUQA 2DFNA 4EH1A 2J7KA 1Q17A 3H1TA 3ENWA 2DWUA 3EE6A 3RJGA 5DBBA 3P71T 5TIIA 4GLFA 1OWOA 2GEJA 4P4NA 5HUQA 4QTUB 5JXHA 2APJA 3ZI4A 2XCAA 4ZYYA 1A7KA 4DUGD 3C3CA 2AMFA 5DKFA 3AM1A 3C3EA 3C6MA 3EUAA 3FMFA 2EZTA 4O29A 5H0IA 1ZLYA 2Q28A 4GLLA 2PUFA 3LZ6A 5ADUS 2A3RA 4RHXA 1PYDA 4TL6A 1T1RA 1Y6JA 3CR8A 3WYDA 3HO8A 2QUIA 1Z6QA 2C5LA 3HTXA 1NYQA 2B4KA 2WD9A 2XJ4A 3PLRA 4A2CA 4MUGA 2N46A 4PHGA 4WH0A 4GL4A 1RBYA 3RBVA 3BA1A 4AF8A 3SENA 4LMRA 5LA6B 2XMRA 3FF4A 5LOVB 3G9TA 3EB9A 1V9SA 1EFUA 2Z3WA 1J2JA 1P1IA 3Q7PA 5HQJA 1N34B 1URPA 4IV8A 1W1UA 1XDUA 5DG8A 4MWDA 1UC8A 3RTDA 4LV6A 2B61A 3E2IA 2JGJA 4G5XA 1TZ2A 2A2ZA 5TT0A 3F7MA 3C4VA 4B8YA 1OILA 4B74A 3AY0A 2FV8A 4BZWA 4DOCA 5AP9A 2NG1A 1UA1A 3NBYC 4HXGA 3LCJA 1B93A 4ED0A 3O47A 4YMNA 5AVOA 3VOBA 5AXBA 3CYFA 2QTCA 1Z0UA 2MYPA 1C3VA 1BCSA 4JUBA 2JAPA 3ABZA 1V6CA 3RAQA 4RANA 3SEZA 3JPPA 1KYQA 3ACBA 4AYBF 3ED5A 1E79A 4ELVA 2N42A 1N2JA 7ICMA 1CUAA 4X8HA 1D9ZA 1JYFA 5CM9C 2X0JA 1B7GO 1Y6FA 5KFOA 3HCNA 1AH2A 4G81A 2O52A 4EDHA 3OTWA 4R2MA 4Y1GA 3OJCA 3TLGA 5FHQA 3A2KA 4LG1A 5CXQA 1CQJB 2HVHA 3HN6A 3E2EA 2RBKA 1OTYA 4OMUA 3RUCA 1Z5NA 3IB3A 4D9JA 3GLGB 1XE3A 5LD2C 2HRCA 1SK9A 3W9UA 4IY1A 3KR0A 3IEXA 1TC2A 5D5PA 3MT8A 2NO4A 4I4IA 1M2NA 5TMPA 1G3RA 2AN3A 4F06A 3FI0A 3ZWVA 2E85A 1MB0A 5D3KA 1DRWA 1GZ6A 3NEYA 5J8YC 5FKJA 1YJ5A 4ETMA 3C74A 3QA9A 3CUKA 1HY3A 2BEWB 3K2QA 2XYQA 3SQWA 4C2TA 3JQQA 2ZDHA 4CV1A 1U2TA 3EVNA 3NEAA 4MIEA 4F2HA 3HQ4O 1GLVA 5CEHA 4QUIA 3R0VA 3WHIA 1UAGA 2UZ0A 4JBGA 2C9OA 3JQ8B 3SDZA 4UB8U 5KJCA 2O8EA 2AOWA 1FVOA 4BMXA 4Y1RB 2XHZA 2K4EA 5COAA 4E46A 4YI5A 3OQMA 3RRJA 4WKNA 1NK8A 4IH1A 4HO1X 4QYWA 1M2OB 1Q1AA 2DPYA 1GZ5A 2V7QA 3LSTA 4WJ3B 3GEIA 4M1KA 1PR0A 4MPPA 1EFHA 3WK5A 3WR5A 2K4MA 2VTKA 4JCOA 3CNOA 3CZQA 1RQRA 4ZOBA 3Q2KA 4NS4A 5JQGA 2FFRA 2VT7A 3QJGA 1UQTA 4MKGA 3I2FA 5JPCA 3CKLA 4JODA 3PNCA 1QO7A 1SZHA 4LDZA 1NQXA 2YWBA 1GL3A 3AONB 1VE5A 5FH9A 4LXIA 4RT3A 3WRYA 4FOLA 1Y4ZA 1KQNA 3UXMA 3NOXA 3GR6A 4U6QA 2CB0A 3PFGA 4K7JA 2O0LA 3D81A 2A9KA 5M04A 1JQAA 3VKUA 5AVTA 1IG0A 3GARA 1QB8A 5C7YA 5MN5A 4WXMA 3CKKA 1MXHA 4R8UA 2EZ4A 2B4TO 1KFSA 3EY9A 4JT9A 5L3RA 1DTEA 5ICEA 1BVSA 2RGYA 1Z2EA 5EKUA 4Y2RA 5FNVF 3ANNA 3DWFA 3ESZA 1H3EA 1TQDA 4NFSA 4BNUA 2W6MA 5FPTA 1SWVA 4AP5A 4HL6A 1C0LA 4BLOA 1VPVA 4YWJA 4XI9A 3LLSA 2RI1A 4Q8FA 4XASA 1YQQA 3PFHA 3WIUA 2C22A 3OU7A 3L9XA 4XUGB 1U8CB 2O0KA 5KYGA 2X86A 2F77X 4KQJA 3AY6A 2WMNB 2GN6A 2KFZA 2NRVA 2JFNA 3DOUA 2XIQA 4XPIA 2MMGA 5J3JA 1KTQA 3L40A 3NM4A 2QD4A 3QE0A 3H2GA 4TTPA 3ZVKA 1N33B 2HF8A 1F1JA 3C3AA 3NOQA 2G0TA 3MJHA 5ESWA 1NMSA 2OXIA 2CXXA 3VOTA 1WP4A 1W1WA 4Y8VA 4UQPA 1HBJA 1G7CA 3W3ZB 3SEIA 3FZNA 4COOA 1BE0A 4MUMA 2H85A 3GJ8A 4ARCA 4HDQB 1NPTO 4C7JA 4A2QA 3ZCUA 3QVLA 1ZQGA 4NDZA 1BVRA 3DYIA 1ZJZA 1LBTA 3SX0A 2BBWA 1XMIA 1W59A 4BNZA 1GZ7A 2PMCA 4RIIA 1UOEA 2AI2A 1Z63A 2YHIB 1BFKA 3U7EB 1DRKA 1FVHA 4OGGA 1H42A 4WV3A 4RZUA 1SCKA 1VHTA 1HZZA 5CG2A 3FA2A 4FCVA 5KYYA 1VI5A 2BM8A 3GCWA 3RVMA 9ICHA 4H31A 1EG2A 4OQPA 4C6HA 1W46A 1YHNA 1G60A 3IPCA 3K5HA 5EGSA 1ZQMA 3KIPA 3ZU3A 4DB2A 4BC0A 5CH5A 3CZ5A 1WOYA 2I3AA 1LNZA 4M0MA 2IYYA 4MOWA 4NLNA 2SKCA 1N8NA 2HPHA 4B79A 3PX6A 1Y5IA 4K9DA 2I76A 2R8EA 2ZYAA 1R64A 3GVHA 1JX4A 3NFYA 1DQRA 3OHBA 3LNTA 4WINA 821PA 3Q2IA 2AQHA 1MU0A 1NMEA 3ZDCA 3V6KA 5JNSA 4J0KA 1ISFA 2E8MA 4CV0A 2Y0EA 4RU1A 4GM4A 2Z04A 3M9NB 1TMOA 1XTIA 3T52A 4YRDA 3WWCA 4OYRA 1U0LA 1YNSA 1VYUA 3NJRA 4AYTA 1QR2A 3GRPA 1N7HA 2NU6B 2XW6A 5IULC 2GK4A 4JVNA 1QF6A 3EEYA 3SQLA 4YP3A 1SQ6A 2XMQA 4X1IB 3A9UA 1GNLA 2E5LB 2FR0A 3HI4A 3VYRB 4O3PA 1AE1A 1VDMA 4X93A 5HQTA 2VHCA 1FS6A 3MR6A 2ZAIA 1UDRA 1OZHA 4K9RA 4F5DA 4P08A 1PFQA 5BQXA 3HZHA 2IH5A 2OB2A 1JBKA 1AM4D 1J9GA 3GGPA 4FFPA 4GPZA 3HKDB 1Y8AA 3VU8A 2FJ0A 3LH5A 4IRCA 5KQMA 1NBMA 4DLBA 4JC4A 4W9NC 3UMMA 1ZDMA 3G13A 4TQSA 1CDOA 1ULBA 1QP4A 2J8ZA 5EEHA 4LRQA 4ZO4A 2C9DA 3V00A 5B57C 4GZMA 3PPWA 1C9EA 3KU1A 5ER6A 5HTKA 4YHHB 1LVHA 3Q8LA 4CQMB 1ZJ6A 3GVPA 2OYRA 3KJIA 4DEVA 1I36A 3QXCA 1ECCA 3IKVA 4D8VA 1DJPA 1KMHA 3TSCA 4MYHA 2X41A 3HWX1 3ETJA 4JC5A 2PWZA 3SHWA 2C57A 4GLJA 3GL9A 1RQXA 4LNAA 1L9XA 1U28A 3P7MA 3N2NA 2COUA 5ALSA 1XRPA 2ZXUA 4BLWA 4PONA 4Q44A 4M6WB 1GJRA 1VCOA 5DN6D 4KAXA 4G2TA 3I42A 4LC0A 3VSAA 4F1WA 3H4VA 4A8JA 5I5GA 5A0TA 4LWZA 3WICA 2Z1NA 2MU2A 2WJVA 2YS6A 3ZGVA 2EIHA 3A4NA 4UXHA 4CW7A 1T3NA 1QRTA 2Q49A 4K8OA 1B42A 4I55F 5CFQA 2HH9A 5F1OA 3B7PA 2QN2A 1EXMA 1CEXA 4AMGA 1NR5A 1UDCA 4UE6A 3ZXXA 1GGNA 3ABOB 4PAMA 2YVQA 1L4YA 4WVLA 3SPXA 3OA2A 8ICTA 1UIMA 2BM9A 3S8MA 2FPPB 9ICRA 3BPSA 3LUCA 2W9CA 4PRLA 3FH0A 4EFMA 4MUKA 4BGVA 4NBVA 1U2RA 2ZE8A 4FYHA 4Q3BA 2HHUA 4YDQA 1VG9B 3EAGA 3I9LA 3IQHX 4K87A 2VNSA 2BGMA 3BMCB 3AEUB 2PM8A 3ENNA 1EWVA 5EMLA 4D3XA 4PR3A 1O0SA 4Q19A 2PEYA 1Q16A 1L5NA 2Q9CA 4FFWA 3U9TA 4DCMA 3N3BC 4XRGA 1T2FA 2REBA 4JYCA 3ZUGA 2JHGA 1JAYA 1HIWA 5GZ3A 5JC8A 2VLIA 1WBDA 1HUZA 1P0PA 3NV9A 4AQYB 2A0XA 1KPGA 4BNJA 4OU5A 4RT2A 3IRVA 3HKZC 1ZP6A 4LVNA 2WIDA 2OO5C 3UWOA 3M3PA 4A73A 4B4DA 4Q4AB 3WA7A 1ZO8A 2J3EA 2QZJA 2I1LA 5TT1A 3ELYA 3O92A 3PMLA 3VHXB 5HBGA 1IM5A 5BO5A 2FW8A 1W0KA 1ULHA 4FXOA 1U3VA 4GZ5A 2EFGA 1NAHA 1VSUA 2KP7A 3KX2A 3GW8A 3L0ZA 1EK5A 3DFZA 4EHAA 2ZRFA 3SGLA 3SR4A 1TO2E 5A7GA 2FTKE 1L8OA 7ICFA 3OF3A 5G4KA 8ICZA 1AS2A 5T3UA 2J6UA 4BJ5A 3FZQA 1Z2NX 3OZRA 5BN5A 5AHRA 4MYRA 3UJHA 3LW7A 1BH2A 3WLEA 3ZY3A 2DZDA 2UVUA 4QJFB 2C98A 2UVPB 3RB8A 1DAMA 1OXJA 4ND5A 4AUMA 4AXBA 3ADBA 5PNTA 1EUQA 2ZBDA 4S0XA 3GV5B 1AVTA 1FMCA 4MP8A 2FWBA 5AK0A 1VRWA 2NT3A 5CAEA 3ZXUB 2A88A 5LQCA 1FUUA 2NLOA 2BI7A 2DPXA 3V2GA 3TE6A 1C8VB 3RYCA 2AHOA 5F5NA 3U80A 2LMRA 4MZDA 3QZ8A 4AC9A 4ECYA 1QPGA 1U6JA 3CX6A 1AT1A 2IYPA 5D3MB 4Y0AA 3FW1A 5G0SA 3TMAA 1TAQA 4JJFA 4IM7A 2QG9A 1HDXA 1O6BA 1L7PA 2IRWA 2P6NA 3NCTA 3ZBQA 3AL0C 2GJAA 3L4BA 1S3IA 4NFHA 4GRDA 3AR8A 4Z3OA 3EZGA 3NASA 4O3QA 2C2GA 1RR6A 2NUAA 4JQZA 2MR6A 5E7JA 1C7FA 2XOKD 5GTHU 2QE6A 4QX6A 1OIXA 2A14A 1NVBA 5BT9A 1G19A 3HJCA 1T9AA 1DRGA 1U04A 3WFZA 2JL1A 2ZW9A 2ZUFA 1T2DA 4ZXPA 5DVZA 3P94A 1CY1A 3P4YA 1TMYA 3WZ2A 4HZGA 2AB0A 2MSDB 3KT6A 4BKQA 2YMMA 4L8WB 3GFTA 4ZEWA 2HUPA 2XLCA 1QNFA 1B8NA 2P4UA 4NV0A 3KO8A 1QYXA 1RKXA 4BX8A 1ZIXA 3KOZA 1BWPA 1RRKA 3H4MA 2QI9C 2A1JA 3G9ZA 4YMMA 4KLEA 4JT4A 3LQQA 2FG7C 1Z3EB 1QP0A 4BY9E 1JBEA 5IIOA 1GRRA 1Z7YA 1MQSA 1XCMA 4BV3A 2HSWA 3DDUA 3IAM1 2I91A 3BF7A 3N0TA 1EFLA 5C8XA 3QPVA 4NCBA 1SC6A 1XN4A 2ZT5A 4MR9A 4LTNA 1N0HA 5LP6F 4QLAA 1OAOA 1V11A 4B6GA 2UVWA 3D4LA 4Y6QA 3KJZA 2H4XA 1XO1A 3STWA 1ARZA 2ACVA 3IP3A 3CONA 3PIDA 1VGQA 4TUSA 4RORA 3B89A 1AGPA 3EA4A 1NY6A 3MGHA 3CC8A 4PN7A 5DK4A 2VIXA 1FQOA 1NV9A 1E8MA 4LDPA 1N36B 4Q1BA 2ZXEA 1XMOB 1H2HA 2CL6X 1AKRA 3CGWA 4BLUA 2HM7A 2KSOA 3E35A 1WUIS 1R0SA 1P1RA 4CIAA 1O7JA 3A1SA 2F3QA 1MAAA 2AXPA 3UHJA 4YJ2B 3A25A 4CQJA 2GJ8A 5P8WA 2HOIA 3GAAA 1V26A 4M9SA 8ICWA 4I8XA 1TAUA 2P9ZA 4WN9B 3LQ4A 5GAJA 1G291 1QR6A 1NRJB 4G89A 4UZSA 4ZWNA 4NU0A 4DE5A 3GI1A 4D8TA 3CE9A 1OLOA 2W2QA 3INGA 3FYUB 4CF6A 1WVMA 3EVZA 3IBYA 3K9NA 3D64A 2QP4A 2FP4A 3COYA 2NZ2A 3L0YA 3A31A 4EZEA 3RT1A 2E3JA 1U7ZA 1YNOA 3D7RA 1NLUA 4PGMA 2GEFA 3NWBA 2CVQA 2HCJB 4V1CB 1ZNWA 2IOHA 1T8RA 2ZAYA 3Q2OA 3HKBA 4FGJA 4XSVA 2Z9CA 4EUHA 4PSCA 4Z6DA 2ZJ2A 4CTKA 1MCZA 1AQYA 1NVEA 3PPVA 2QTBA 4FP9A 3FYTA 2P35A 1PT7A 1J33A 1FX1A 2Q5FA 1E0JA 4AZ0B 1DQYA 1RM6C 4NWIA 4CETA 4LISA 2F62A 2W9MA 2QW0X 4P58A 5C7IO 3PR4A 2GOYA 5KG1A 5JR3A 2CVOA 1JMSA 3MFIA 4UAWA 4UM8B 4KYIB 1R6TA 4LHEA 4P8RA 3RAPR 5ALNA 1GPJA 3AP2A 3U62A 3L7JA 2UDPA 4RK5A 5KFYA 1KP2A 1E9SA 4NE9A 1XPRA 1M0TA 5KFTA 3KV1A 2BPGA 2BFCB 3AVQA 1K9VF 2JH8A 1QDLB 1UFQA 1IOVA 4MUBA 1QG4A 4NIMA 4DJDC 3MGVA 4I2JA 2OCGA 3WJ7A 2FUEA 4PF1A 2GXUA 4G9BA 3DC2A 2OFPA 1ITZA 1VECA 1R4NB 4KDCA 1M66A 3TPCA 1GUBA 4J3NA 2LKCA 3MVEA 2P9YA 5ICFA 3W3AH 3WP1B 4LYYA 3LPLA 1L1EA 4ALLA 1VSBA 1GDHA 1YR7A 4FGSA 3T94A 3OEWA 4XM1A 3SZMA 2G76A 4MV1A 4LTMA 4HFRA 4O2AB 1YQTA 3JZDA 1XIVA 1EFPB 4PCLA 3F5MA 5KOHA 5AJVB 3H2JA 2H3IA 3RC8A 3PSHA 3I5XA 2GEBA 8ICKA 5LB2A 2OH2A 3TDKA 4QUJA 1EJ6A 2CMFA 5JRTA 1G20A 3H1GA 3N2YA 4RFVA 4O59O 3F0TA 2G80A 3N5CA 3I4LA 1PFWA 3WGGA 1TRHA 2EFYA 3VSBA 1QDEA 4F92B 2VXYA 3ESDA 4Z6KA 1UBUS 1SULA 2GSDA 3UGJA 3MK31 3L1UA 1XSNA 5BN4A 3WRVA 4DR4B 4HAVA 1V43A 2AEFA 4NP6A 5FWYA 3WQRA 5JD5A 3O6VA 1KF0A 4U6NA 2BRUA 3VU3A 4FVTA 4BQQA 4IQFA 4EG6A 3WVNA 3U61B 1U2EA 2W0SA 5HF9A 4JEUA 3ZCVA 3CWCA 5IJ0A 2VBCA 2E5WA 4HAXA 4QQKA 2V74B 4WMLA 3Q41A 5CTAA 3W6PA 2VHEA 1ZN7A 4AVYA 1AZLA 3KEMA 1KI8A 3ANTA 4I1PA 5BYBA 2I1QA 1ML3A 4P98A 4EPYA 2BFEA 2X4IA 4IHQA 5E7QA 4GWKA 4DWOA 3WL5A 4KPGA 2WZDA 4JFRA 1TIBA 1OZAA 1CERA 4OXRA 3GLIB 3ILHA 1XCPA 1NVTA 4W9MC 4EWLA 4EZ6A 1ZQHA 3HCRA 3EUWA 2Z8YM 4BFCA 3MLAA 2Z9DA 1PVOA 1RRMA 4IL6U 1LGYA 4FCTA 1KKXA 2Q3CA 3S29A 5AHOA 1E2KA 4OHYA 3SC6A 5EKXA 3OFJA 4D0RA 4BMZA 2XQJA 3GGDA 2LNDA 3GHYA 4DSEA 3L5KA 1RT9A 3FNHA 2D7CA 4WERA 3I05A 3GJZA 6Q21A 3C4JA 2VC2B 4OJLA 2IA6A 2DBZA 4ZCRA 5CLIA 4B4UA 3EUB2 3HZZA 3QELA 1G0NA 3L8GA 3MB5A 2I6UA 1VBNA 3D1VA 4YMUA 1W0JA 1R15A 1WAMA 3C5HA 3QJ5A 2VHVA 3QKIA 2X2PA 1IQRA 1KVRA 3P9NA 3M6KA 1D2RA 4FKZA 4RNMA 3ACCA 3E9DA 2FK7A 2PX3A 1BDIA 4II7A 3N58A 4PO8A 2PMFA 1F8XA 2ZANA 4K3UA 5H68A 3CPHA 3IVRA 1RDFA 3C6BA 3KPYA 4I4CA 1L5RA 1GT91 3A4VA 1IC6A 1J2EA 3EJWA 4MQBA 1XUOA 3DKKA 2R8GA 3ONEA 1RJ9A 3N3AC 3GFFA 4J1TA 3DMHA 3FTEA 1RQPA 3HU2A 5LZ5A 3EXIA 1KBZA 2FSHA 1XPJA 4UNPA 4PJ0U 5HF6A 4OA5A 3PPIA 5I7RA 3OD5A 4KE6A 1SKYE 4NMXB 3RW9A 5ENZA 1JPJA 3O7WA 3U3DA 3QU9A 2VWHA 3PEEA 4KN7A 2YWHA 1I2CA 1BVUA 3BXGA 3TD2A 3RTEA 2F6RA 3IUPA 2OLKA 4JUFA 5AM2A 4NCNA 4P84A 5LC1A 2GHRA 3GDFA 3TZCA 3NORA 4EY3A 3KQWA 3AOEC 3H0MB 2QVZX 4NYMQ 1TLLA 1C1HA 4P4UA 2VN8A 3E23A 4B6EA 4V39A 4DWWA 2DLDA 1YZYA 2B4QA 5DEOA 3TVYA 5BSWA 3WSWA 4G67A 4AY4A 4IIXA 3F1KA 4QJ3A 4FMDF 3WK9A 3IAS6 2D74A 2JJYA 3TQIA 4XQ8A 4DLGA 4XR9A 5JVDB 4KWIA 2NU7A 1NJ2A 3ZDRA 4XCQA 4HSEA 4MINA 3ILVA 2C2OA 4LDNA 3FDZA 2L0XA 5IJ9B 3PCXA 4K9LA 4K0KB 1LXCA 1AKMA 1ABFA 4RJJA 4X7MA 4W7HA 1P5ZB 4N6OA 3NNNA 3P9CA 5LIPA 5H83A 4YR3A 4LJYA 1FDUA 1S1CA 4E15A 4U1RA 1IJEA 1BDBA 1Q3KA 4YPOA 2DJ5A 5C8YA 1C14A 5DB8A 3GLFB 2J5QA 3RBAA 1RZ3A 2E4XA 1Q74A 3PQDA 3VBEA 1E2EA 3FIUA 1KEZA 4EDFA 2FMHA 3R9XB 2A7XA 2FVYA 3T4PA 3CVUA 3OIGA 3A32A 1W6RA 1IVSA 1GG2A 4GFJA 4HN4B 2BGTA 3ETHA 3RS3A 3EY4A 2YW9A 2VUTA 1T5IA 3ISJA 2ZYDA 4XTRA 5JSQA 4F5WA 4AJ4A 1ONOA 1AX9A 4FINA 5DT9A 1INLA 2WUFA 2OV1A 3V72A 1EEXB 3GK3A 1AMUA 4FOOA 5DRTA 2UKDA 4CVNA 4D97A 4GXIA 4Z6CA 3E7FA 3T1HB 3KLBA 4KIGA 2OWEA 2XGOA 1MTOA 4EFNA 1S89A 3ETGA 5IBQA 5DIZA 3Q8RB 2DY1A 4YJFB 3T7EA 1E3JA 3DP9A 2ZRAA 5CX1A 4HYQA 1JVSA 1J2RA 2OOSA 4LIPD 5MGNA 3OEHA 4WXPA 1N9GA 4HUQB 4C06A 4PZYA 4TVBA 3G68A 2O5CA 3KPUA 1YXMA 2HGZA 1VE6A 3F3SA 3W2HA 1QIEA 1UDAA 1P2VA 5FOSA 1DBWA 1AZTA 1BOFA 2V6BA 3VHRA 4IOLA 4IDFA 1K6EA 4F2DA 1VE9A 1G21B 3FKSD 1RRGA 1A27A 1E92A 3T5AA 4BX0A 3ENQA 2RAPA 5DNEA 3BQMB 3MZ0A 1A95A 3ZWXA 2CKMA 1IJFA 4M37A 3IG5A 5A3SA 5J4YA 2YXBA 4W8GA 2SCUB 2RHMA 3ZV7A 1NW4A 4UE3S 4ZT5A 1J0EA 2BEUB 3BAFA 3OLVA 5A6VA 2JXJA 3IQIX 4AECA 1OA1A 4MV7A 4IKOA 4DLXA 2PUCA 3P0FA 2CVFA 4YCDA 1AKTA 3M5WA 2FSIA 1K06A 1MJ5A 3SQOA 2CPRA 4QFBA 3BVPA 3UUFA 2D2FA 2NP7A 1ZQ9A 1NI3A 2YY5A 1HOXA 3BD8A 2O2XA 5HX7A 2F9LA 8ICHA 1IN6A 1X8XA 3R74A 3NVWA 5FAXA 4YCBA 2CLCX 2BCRA 3EOBI 1JEAA 3M6LA 2IK8A 2PX6A 2AS0A 1V3VA 2W2PA 1ZCFA 3T5PA 4U5QA 1U0JA 3SM9A 3FDIA 1O9GA 2R00A 3R0IA 3SAGA 2F76X 2VHXA 2Y92A 4BQFA 3KWFA 4R0MA 1N5LA 4WSOA 1D8BA 4NZNA 1LK7A 3PSFA 4DDWA 3U9SA 1CUJA 3DAYA 3L8CA 1MC1A 4UULA 3GJ5A 1LK5A 1O97C 1U49A 3DJYA 5LFAA 3NTUA 4FMBB 4LHXA 3U4AA 1A50B 4CYMA 2P2ZA 4DZRA 1WU8A 4G0PA 2V7TA 4YJGB 2D1QA 3IO5A 1VCIA 1FNSA 1H2YA 2EHJA 4H6PA 4LJSA 5BW6B 4QULA 4ND6A 1H94A 4KQFA 5DTMA 4XDGA 2PRKA 4L6IA 5IVIA 4RZHA 1N5RA 5J2UA 3ZH9B 1E5DA 4PGAA 3VM6A 4GPTA 3T7KA 1KKUA 5KOJA 3ZR4B 3LYLA 3LG2A 3T5BA 4BAUA 1TLTA 2VI5A 4OO1J 1TAGA 3MT9A 3LL7A 2A9QA 1KPHA 4JIGA 3TW8A 3HB5X 5FUYA 1L7BA 5A9SA 1FX0A 3ZBUA 2B4YA 2Q9BA 3RKUA 4C6TB 4BKUA 3DBRB 1DQPA 2TMKA 3COJA 2QR2A 4QWAA 4ZC8A 1K8QA 3TQOA 1BQ3A 1ZGJA 4DPMA 4GMKA 1E64A 5DB6A 1F1BA 4N0DA 2RH8A 3MM4A 4ED3A 3ELBA 1KI7A 4WLOA 3RKSA 4Z7OB 3V7LA 2AWOA 3MJFA 1T9ZA 1I4WA 3GEBA 3FVQA 4IVQA 3ZYCA 3EXHC 2ISOA 1TZMA 5DXFA 1KMQA 1QMPA 1QK5A 2JJQA 2CZGA 3JYNA 1W8IA 2HCFA 2OL4A 4C01A 4F97A 4Z51A 4S04A 3AC0A 1DIAA 5JY6A 1GOTA 2GD2A 1JHYA 1C0IA 5CT5A 4YP7A 3W77A 4I6GA 4JMPA 2B5WA 4CXMA 4D9NA 2FFQA 1R2QA 1R9MA 1USUA 4AF7A 4RPKA 4I3HA 2YXNA 3K4PA 1SVIA 1SZJG 3FPHA 5JXIA 1CEZA 1A9XB 1DRUA 3KHUA 4WEQA 3V1YA 1XHLA 2V98A 3PXCX 2QARA 4P34A 4P7FA 1AUXA 2HPAA 2PMZC 4QT0A 1TA0A 1SXDA 1HEUA 3RIGA 2CFOA 3VC3A 1E4VA 3MFHA 5DSTA 1ECGA 4CEIB 2IFTA 3GLTA 4CCAA 3FUWA 2ZJZA 3MINB 4C88A 1JIUA 3GWGA 1JYEA 1VHLA 5A9TA 5G41A 4NBSA 1YFJA 4M8SA 3C3DA 2ODWA 3SEQA 2OT3B 1O5OA 4GR9A 2F48A 2FF5A 5HIAA 2CXYA 1E6KA 2NUTA 3KHSA 1CFZA 2IXAA 3FUXA 3EEIA 2WWXA 5J59A 3D2QA 1AKQA 4RLQA 3E5RA 3SMVA 3DAPA 2AUMA 2W2TA 3PT5A 3IV6A 5J2JA 3FCEA 1N0IA 3Q3GE 2RC6A 5FUBA 3B6KA 4KOEC 4D42A 3V7NA 1YDFA 2JGKA 1HZJA 2I6TA 1Q7GA 2HA3A 2QPTA 3GNSA 1G9TA 2XXAB 4A0RA 3L41A 3HU5A 2GCOB 4MI9A 3JATA 1CF9A 1TT5B 2PKEA 1DOHA 2OXRA 5J2TA 2XYHA 5CFRA 4LYFA 1FRVA 5JS2A 2CNBA 3RG2A 1PG0A 4HRYA 2NYRA 3TXYA 4ER3A 3N7SC 3W8RA 3JW8A 2QLTA 2GZHA 5AICA 4LJAA 4M1YA 3EA5A 5LLSA 4ABYA 2YOFA 3FFWA 4KLAA 3K6KA 5TPZD 4RM3A 4F3RA 4A16A 4EW3A 1GYQA 1VHQA 3FNEA 1SB8A 4QZBA 3HBJA 4KFRA 5G3ZA 2RCYA 3RSQA 1TK5A 4I9HA 3ZH2A 5IP5A 1CZRA 3E9MA 2WA1A 5DNVA 4REQB 3JAKB 3TG2A 4TV9B 1OZGA 1KVQA 1B1CA 1ZPDA 4QEZA 4WADA 4DM4A 4PS0A 5B1IA 3PYXA 4F3TA 3VR4H 4CF3A 2Z58A 3NHFA 5HGJA 5T8KA 4FDVA 1QHEA 8ICGA 4RIHA 2XODA 1R00A 1T1IA 1KBOA 1KJNA 3DW1X 2DLCX 1KQOA 1ZM7A 4XJSA 3OHSX 2QLFA 4B71A 1YK1A 3JWIA 1ZU4A 5KNCA 1SIJA 4TROA 3L6RA 4OREX 3TZLA 1ATIA 2WJHA 5CA0A 1P6XA 1D1SA 4R6XA 2YJTD 4PFQA 2LI6A 1ZHOA 2SKEA 4OIFA 4OHBA 4IUCS 3X44A 4BPBA 4BQIA 1Y3AA 4ND4A 4TUQA 2PLWA 3QVUA 4DQQA 1FFWA 1XJ0A 3NDRA 3OMLA 5HRUA 3OGUA 3VFDA 3DUFA 4ACOA 5EUCA 1I3NA 5K8TA 4OX9Y 1X7ZA 4BO0A 4TL8A 3E9NA 3U3RA 2TRSB 4KAFA 2E4AA 4Y18A 4RTNA 2AVDA 2H3VA 1ISHA 3O4VA 1ZSNA 3EZNA 5KHLB 5BWOA 2QB5A 3DOCA 2EFCB 2YWXA 4C7MA 3F2DA 2VJAA 2D6FA 5FTLA 3F7NA 3DJFA 3HJFA 4KN6A 2MINA 1OXVA 2W83A 1SZCA 4RQ7A 4JXKA 5AJXA 2QU7A 3TANA 2YMQA 2XVAA 2Y3IA 2HLHA 1CUHA 2Y1EA 1QORA 1QZZA 3U19A 1CSEE 1MAWA 3OUTA 5A5EA 2FQ1A 1GGVA 4AJ9A 4OUKX 5TXGA 1X80A 3FJYA 4YR2A 1XQ9A 3GLRA 5KYUB 4XLTA 1Y6QA 3GUUA 4L57A 3AQIA 5I7HA 3DFFA 1ZXBA 3JPTA 2HVIA 4MYCA 4X20B 3H5NA 1O94D 5HKLA 5IBPA 1N6KA 2C5BA 4MVCA 5B1EA 4ZQEA 2FZCA 3BA6A 4YAGA 2P0AA 3CZ9A 3PO4A 2O5RA 2ECOA 4FZ5A 3FZEA 4JENA 5AJZA 2JD1A 4Q15A 3JSAA 3J81j 5KFLA 2Q27A 2WSMA 3IQEA 3NTXA 2OZVA 4ZYTA 5CYOA 2QBYB 1GN8A 3QVWA 1LBQA 2YN2A 4GR5A 4JUCA 3OURA 2PMEA 3Q9UA 2ODTX 5KFWA 1NUUA 3HR8A 3NM5A 2HCTA 4WJKB 1Y7IA 1NI5A 4I50B 4EJ6A 2GBLA 3BZWA 1IUPA 3I61A 2OHVA 2VDKB 5FUQA 4KQKA 3M5DA 2RHLA 3I2HA 3T9FA 1V9PA 2WW8A 5CB4A 3NTLA 2O7VA 2D2IA 5DQHA 1RHJA 4F04A 2V96A 2A6PA 2IUEA 3TYXA 1W4BA 3DNPA 3CR7A 3EBOA 2ISPA 2BPCA 2PH5A 3HRDD 4DYVA 2GCNA 4BKRA 1I01A 1RPNA 3C8ZA 4EO4A 2C5GA 4AULA 2MUTA 3IOMA 3WDLA 3L02A 1B0ZA 3UG6A 4JUZA 4C3VA 3GDXA 1HL7A 4O3OA 3M83A 1EM8A 4BVAA 1KR5A 1I80A 1PT5A 2RGDA 4HQ0A 1L7OA 3RABA 2Q5IA 4URXR 5CH8A 4Z6EA 2CF5A 3MIIA 5KYNA 4TXHA 1WCYA 4EF5A 5HKKA 3B1JA 3OT5A 2HZ7A 2WSBA 4DRXA 3T38A 1V8PA 4XIGS 4P5EA 4TUPA 5K5EA 1EAYA 1HGXA 1QQ6A 2NADA 2AH5A 3MGBA 5EQJB 5AK5A 3BGDA 5EOVA 2YH2A 2PZAA 4F12A 1BRMA 3IT2A 3REQB 1FP4A 1GCIA 3E7XA 1WDKA 1XI2A 1JXLA 4KXMA 4MGZR 3N8GA 3GF4A 1KI3A 9ICSA 3KYCA 1KVUA 4C4XA 3KL2A 4BKPA 5BMVA 4ZV7A 2PH3A 3FFBA 2DOKA 3QY9A 2FCAA 1PR2A 2LYAA 5KT4A 4ECZA 4F5PA 2ZAOA 2OCIA 2QX8A 3HKCA 3PHJA 4TMVA 1ONSA 3LNCA 1A2KC 2ZYWX 1DDGA 1IK4A 3EN0A 4XEUA 4RPXA 3SLGA 4E5VA 4AS3A 1EXNA 5TLSA 2P27A 4BFSA 1BXZA 1BHQ1 4Q1DA 2XR1A 1OY1A 5KI6A 3VAAA 2JAOA 1S02A 1OGJA 4AJ1A 3DMGA 3FDXA 1T94A 4R81A 5CCBA 2ODGA 3HYSA 3SU8A 1KAGA 1Q2UA 1SFRA 3SK0A 2NTVA 4ZQCB 3E4DA 1T2CA 4MVXA 1BPEA 5ED4A 4L9WA 2D0OB 3FPJA 1LSOA 3A7EA 2J0EA 4B1FA 2J0UA 1KDTA 2BBOA 1UP4A 2AJTA 9ICMA 4YMTA 4GW3A 3IH5A 1SGGA 5HBRA 1CR6A 1T9CA 1VZ2A 2YWCA 1ZH0A 2IODA 2XVZA 2G5PA 1T3LA 1J9ZA 1NE2A 3KTAA 3UXHA 5DBFA 2XVMA 2ICAA 4BEBA 4UAVA 1G59A 5IAOA 3KVNA 3DXXA 3LV8A 4EAQA 1Z74A 1ELOA 2QQ0A 2ZIEA 3U81A 5E6SA 1RLMA 1UKAA 3GCDA 2OHJA 1XMPA 2QRGA 1P4JA 3C7DB 4YCMA 2GEKA 4FC6A 1ZW6A 1B2LA 2B30A 2C3PA 2JJ1D 2MSLA 5LMUB 3IHTA 1YBMA 1N2CE 4IQWA 2NYVA 3F7OA 4CCWA 4DG9A 1RTKA 1SEPA 4IGFA 3M6AA 1SXJC 1YACA 7ABPA 5CVTA 3JQEA 4KBFA 2JBAA 1TQHA 5JZBA 1ULSA 2PGAA 2RSLA 4J7CA 4RV4A 4A91A 3VMFA 4E88A 5KAMA 2FW0A 1ZOLA 1KAEA 1US8A 2DUUA 2EEPA 2CK3A 1MW8X 1NUQA 2WJGA 2DHRA 3HXTA 4Z1MD 1L7EA 1WHTA 4GE0A 4K6HA 1NJ5A 5CA7A 1GIAA 3PKIA 1I6MA 1L4EA 1KH2A 2KE7A 4QEDA 2ZUSA 2WFLA 1NP7A 3ZJVA 3C14C 2ZSDA 3R40A 2VIIA 1Q15A 4RUKA 3JX9A 3EF3A 3V3TA 2Z2IA 3LKDA 1JZSA 1W19A 2D62A 3VOSA 5F9FA 1TYZA 3AU6A 1KDHA 2FEAA 3AWDA 2JB9A 2C5SA 4B3DA 3D4IA 3G8DA 1K63A 2QY9A 1E61A 2Q21A 3HUEA 1BDMA 1T4GA 4ND3A 3LBYA 3H9EO 4ENVA 4ZOCA 2ZJ0A 3OVMA 4MVJI 3IVMA 2HU8A 4RNOA 1MNAA 2ISQA 2JAQA 5AW0A 3TUJC 2CFCA 5GV7A 5LYYA 3DTVD 2I7DA 4C1BA 2HFJA 3TLYA 3DB2A 1T2AA 5DLPA 3U7IA 3AQ4A 1MVNA 5B2ZA 3QIAA 4IMJB 1PWEA 2PKXA 3CNHA 2KIVA 3NS1A 4MARA 8ICQA 5TB5A 2O8DA 1VMEA 1LX7A 3LHDA 1HEYA 4Z2YA 4MPJA 4XUEA 2GS9A 5EJ5A 3OJSA 3CPSA 4TWIA 5EZYA 2J9ZB 1B0PA 1WXIA 3CISA 2JCVA 3LGSA 4R9SA 3LPCA 1HDEA 2WUGA 3F7TA 1N7IA 1I0ZA 2VT6A 4HDKA 1NJZA 4RTSA 2B1GA 1P39A 5CNKA 3WMEA 1S2MA 2HREA 3DDOA 3U5TA 4Q4HB 1CEYA 1C9MA 4MRMA 3K6SA 1WX1A 3RM3A 2ZKIA 1XZFA 4E5DA 3ALRA 2PUGA 1XS9D 3TJRA 1R9NA 3BSWA 4I2HA 2R7LA 3HS3A 3RS9A 1BX0A 2OXTA 3V6HA 4GC7A 4URYR 2I2DA 4KZKA 1SUWA 1BXGA 5KCZA 2CJYA 2P1RA 2VP4A 4B6QA 2FLKA 3K6JA 4MWGA 1LPAB 3K75D 4LRSB 1CHNA 3U1TA 4CKEA 3ZXYA 4D3SA 4MKZA 1H8HD 2BR3A 2G8NA 3AHHA 5C0OE 1NSTA 2Q3FA 2GZ2A 1KMIY 5ECYA 3KP1A 3FTQA 3AUAA 4HGQA 2H16A 3ZE6A 2WJJA 1QLHA 2D3WA 3WGHA 2VUSA 2ZTCA 2JGDA 5GJWC 3ZHYA 1E3MA 4YRGA 1U0SY 1M5TA 5JLAA 3KSDO 5FFNA 4R8MA 5IDVA 3MWYW 1H5QA 4J7XA 4P92A 4XUCA 3OQIB 1TRKA 1U2GC 5KWEA 1PV2A 3RADC 3UWPA 5C3MA 4DIUA 1XQ6A 1H2XA 1FFBA 1F20A 3PGJA 5HGXA 3QZUA 1KI4A 2P3LA 4I28A 3O8QA 4CUJA 2H7XA 1E3EA 4OJKA 2QMEA 2Q2VA 2AQ0A 4RTRA 2W42A 5HK8A 1R0WA 4KQCA 1GU0A 3MUEA 2ALZA 2PL3A 1A76A 4RU9A 1XD2B 3DDZX 5DLQC 1JW9B 2VF2A 2A19A 3H2YA 1UZLA 4BN4A 1RACA 3WBJA 1KK2A 3NKVA 2KICA 3N07A 4F5RA 4MMYB 3V4LA 4HLUA 2FRVA 2ESEA 4IICA 1LLUA 3LBAA 1T15A 1WWUA 3M3DA 5ALOA 4HWGA 3IUYA 1LC0A 1JHXA 1X8KA 1U31A 2F8KA 4CMEC 5ALVA 4MKHA 4P2BA 4NS1A 2HLNA 4EATA 1W5FA 1PUZA 2OM2A 1FU4A 3K30A 3RFTA 2IUSA 2L18A 2ZSHA 4X8OA 5FUXA 3PRKE 3ZV4A 3JARA 2X8JA 5GM1A 1RYRA 2CLHB 3UXPA 3BK7A 4QGFA 4OFWA 1FL9A 3IAFA 1W2WB 1GTVA 1UCVA 2C95A 4KR6A 1RQGA 4RFSB 1P61B 4W5JA 5F78A 1CIJA 3RUEA 2Q9UA 2AOUB 2BGRA 4OUDA 5AMXA 2VOEA 3AVUA 3EXFA 1G3UA 2XV1A 1V5FA 3U3OA 3UBMA 5EE0A 3HFJA 2ECQA 1W36C 4WL0A 3G8YA 9GPBA 1M1XB 1SUPA 4DBLC 4ZDKA 1NNEA 2ET6A 5UKDA 3L79A 3QWBA 5L40A 2QA5A 4IMPA 3FKJA 4QOHA 2XCPA 5DISB 4W1SA 3QEAZ 1O58A 1FXWA 2JK0A 3C16C 3G82C 3TLXA 4JC8A 3TXAA 3VCBA 1M34E 3UWKA 3K05A 1XD8A 4BFXA 1WE2A 3FHLA 2C00A 3A1EA 2I2FA 4D74A 1O95C 3OJLA 1R7RA 2MHCA 2YIVX 4J0CA 3NHLA 4GOND 3A3YA 3BD6A 3ONVA 3ZVMA 4FB5A 4G5HA 4WCFC 1HL3A 1YDEA 3AUYA 1N3BA 5JAPA 3UJ9A 3HKZF 1E5VA 2QZZA 3T61A 2PR2A 4U2FA 1E59A 1I2MA 4YCXA 2HQRA 1CDEA 1IPHA 3DMYA 4QHTA 2W4QA 3C5WP 4WBSA 3BMQA 4JLJA 4C3ZA 4LK2A 5IVKA 3OICA 4P81A 4D45A 1Q6YA 1WP9A 4ZO9A 1LS6A 1L7AA 2QM0A 4XQEA 2GUWA 4H15A 2G04A 1UPTA 4AMUA 1CKEA 3FHOA 3HHEA 3EQ2A 4I8DA 2R8JA 2VOJA 1G2QA 4YY3B 1VGVA 3H0EA 2O2DA 2QVXX 4WA8A 4CMIB 3A14A 2B2XA 1FUKA 5D46A 1CTQA 2P9HA 2EJUA 3KSBC 3BFXA 3RCBA 5KOIA 3NXSA 2R9VA 3FTDA 3MHTA 3LL4A 3CJTA 1EVYA 4H7PA 2V3VA 4H1VA 2VUHB 4EPVA 3P19A 5L1LA 4Z4IA 1WS6A 1XP5A 1RP7A 2JA1A 3R0JA 3EZLA 1W5TA 1KDOA 1PL6A 3HP1A 4P4TA 3TSOA 2F9MA 3OTIA 5LWHA 1AUQA 4LQLA 5L3ZA 2PCJA 3F71A 4E1BA 1KRPA 1FUYB 2J3QA 3N7RC 3KVOA 2PFPA 1SELA 2Z8ZA 3AEKA 1NKCA 2ESRA 3H19A 2FJUA 4WOCA 2BN4A 1JNXX 4QA9A 1HORA 3L0IB 3HXKA 2IKSA 4F50A 5HUJA 3E8SA 4GUDA 1FP7A 1W75A 3TTWA 1UZUA 3FWZA 2B6NA 1XP8A 5JZOA 4N41A 5JJKA 2Q4DA 3G0IA 4TVKA 3GV7B 1Z8FA 1YZNA 3JR7A 1HDYA 1Z36A 3MWLA 1N25A 1RYNA 4D3DA 1WWKA 3L06A 1I4LD 4G2NA 5FNVB 5HVNA 3P2KA 5C4MA 4RQ0A 1J56A 4M1OA 1RPAA 2B78A 4YRRA 1OXSC 5CR9A 1TYCA 3K0AA 1E3WA 2O8BB 3ET5A 5J63A 5EMJA 2BCGY 4ISBA 4M7PA 3EYAA 2RAUA 4A4DA 2QRMA 2G28A 1VE7A 4WJZA 5C80A 2JIDA 3T3IA 2QI9F 4MLDA 1LDMA 3LAWA 4NZMA 1V7QA 3RJHA 2A67A 4MP6A 1X7DA 1RPLA 1WSWA 4MA4A 5J4HA 2PJZA 3CUVA 1XG5A 1ILWA 1SIWA 4OJQA 1J2NA 1C41A 3N2KB 2PZMA 4ZAZA 2IEAA 1XMVA 3HUTA 2PANA 4CRWB 1JVNA 4AYXA 3AHFA 5ILOA 4FHGA 5F5XA 1RMQA 3RK4A 1FTGA 1IUNA 2V59A 5AVVA 3OIDA 2ZUCA 3V2HA 5CGQB 4HZIA 3JQBA 3RH6A 2AGVA 3HV0A 2Q5LA 1N2OA 2YFYA 1UBLS 1U8ZA 4ZT3A 4JLKA 2A57A 3UENA 2H2DA 2HAEA 1ZONA 3UUGA 1CUIA 1EBBA 1Y48E 2IE0A 4L50A 7ICSA 2A59A 1IVYA 4E21A 5EKDA 2HUNA 1SKQA 4JK1A 3H5LA 3SOPA 3SX2A 4B9AA 4LVOA 1KVTA 2LGJA 1V4BA 3WB9A 4YK7A 5M29A 2V3CC 3L7AA 1QP8A 4Z9FA 3M0EA 2DY0A 2XBLA 1FMLA 3G79A 2ZM6B 1NK9A 5HEKA 2VLBA 4UHJA 1W76A 1GTSA 5I48A 4FFDA 1RWPA 1GXSB 4BDTA 2XNDD 5BQPA 4DIEA 3HW8A 2D5IA 4EI2A 4QU8A 4LF5B 4EHJA 1UWVA 3OPNA 3W1VA 4DUPA 2QD3A 3PYLA 2P6MA 1UDXA 2BZ0A 1ZVJA 4IDBA 1IXYA 4O2BA 3W1EA 4FZLA 3H5AA 3DAHA 3BHJA 1P4GA 2H2IA 1G2IA 2FP3A 2NSLA 4HBGA 2FXVA 4Y9UA 1TVEA 2XUAA 3FG9A 5FI5A 3FHJA 4FZMA 3LOQA 1A2OA 4AN1A 1TUBA 3CU5A 2NOAA 2RBGA 2KW5A 5L1IA 3ITKA 4NTZA 2P5UA 5B7NA 2I99A 4X1OA 3ORQA 3KT8A 3EDYA 2RK6A 3SYLA 3U3JA 3PQ2A 1ZQJA 4LZAA 1ZQ1C 1FJXA 2FSVA 1RYDA 1HOTA 2HLPA 2PFGA 2IZ7A 1YUBA 1MV8A 2O8VA 2Q07A 3QTTA 1AUVA 3RYHB 2NSYA 3RR2A 3WQQA 4AJ2A 3EVFA 3R24A 3H4IA 1PWXA 5AJHA 1I94B 1BG6A 5J43A 1ODKA 1Z0AA 3ZWYA 1F8UA 3O2NA 2A94A 3KOOA 2E6KA 5KINB 3FWHA 3WJ1A 4MRSA 2IC5A 4UHHA 3ZW8A 4KPUB 5G1NA 3KLMX 2JRZA 5AKLA 5D7BA 1QSGA 4QOGA 4ECUA 5EPOA 2J5BA 2YWJA 4N54A 3PZBA 3ZY6A 5JZSA 3S4YA 3JQAB 2NNLD 1EESA 4UUMA 4CJXA 3TQRA 5BVGA 1YD7A 3OIYA 2PH7A 4DFDA 2G4LA 4IILA 2BI8A 4BFUA 2YY6A 4B35A 3VUFA 1L4MA 2JRLA 1E5TA 4S2UA 3USCS 1HG0A 1KIAA 3HH8A 1C8BA 2R3SA 5TX7A 3P5SA 3ZWDA 4EB6A 1KI6A 5AVYA 4MGEA 3W8NA 4I55B 1PEAA 1SN7A 5DBOA 2PFSA 3HR7A 4MHTA 3VI4B 3QY0A 5A0LA 1TXGA 2C2XA 1QLWA 2PI4A 4G5OA 4XZ3A 1LKYA 1H6BA 1RLUA 3AYZB 4HXYA 2FRDC 3IESA 3CT6A 5F7OA 4JOCA 3RR8A 4AX4A 1DJOA 5K99A 4IDPA 5C1PA 5JNRA 3CO0S 4O0MA 2GMWA 3RWMB 2EP5A 2C4TA 2WMDA 5KYXB 2YINC 2OXOA 2J46A 4GUAA 4B5LA 3U0VA 4ZODA 2VPQA 1ODLA 4HGZA 3DT8A 2BGUA 1J0XO 1VHDA 1NK4A 5BOMA 2P91A 5DM70 3C85A 5DWDA 2IZZA 2ZTEA 1P5HA 1XAGA 4GZ6A 5E7MA 1U65A 3N86A 2PNFA 2A9JA 1JA1A 2FKNA 4B09A 1LV7A 3DL4A 2WTUA 1YOVB 1ZD3A 2O3RA 2UXCB 4BATA 4KK4A 13PKA 1MVOA 1FFEA 4OHRA 3AG5A 4C4PA 2M9NA 5FOWA 1D4FA 1RYHA 2RHRA 4OSOA 3RB4A 2ATEA 1PUJA 4UM5A 4IIJF 4ZQBA 5DI3A 5EJEA 2NUPA 5E4TA 1P19A 2ANBA 4Q7MB 2AL7A 2YV3A 4P82A 2JCXA 2J3HA 2ZUEA 1E1QA 1H4TA 4IR1A 2WNSA 2XTNA 3C1OA 4CKBA 4PRZA 2QSYA 4LDRA 1RVV1 4NCXA 5F4BA 4FNOA 2DKNA 4NK4A 1CY2A 4JP5A 1GFIA 2ZIWA 3JY6A 3PNQA 2UVDA 2IDKA 1OGYA 4L9SA 4NLGA 2I71A 1VSQA 1FFSA 3T15A 2BFOA 3C24A 2OBFA 1OFTA 3WOVA 4G0WA 2QQ5A 1MHPA 4JJAA 1VKJA 1NWHA 1QC5B 4C5CA 2Y4OA 3QEKA 4I2AA 4OQZA 4CM9D 4LFBB 4PQEA 2DG2A 2F1KA 2BCUA 5FL7A 2C5EA 5JWHA 1F6BA 3FPLA 2P90A 1UPAA 2L17A 4A15A 5D5HA 4E0BA 5L53A 1A6SA 2ORYA 5CLQA 3HCOA 2FPIA 4UBMA 1F2DA 2X0DA 2HNAA 4J76A 4NNJA 3JVUA 1M6NA 4OFBA 4JQOA 4J7AA 4GC5A 1K7CA 4QM7A 3DFKA 3TINA 1O8CA 4EHNA 3NV7A 1I1OA 4M9NA 1J97A 3C5GA 4OD0A 4N3BA 1I7PA 2LDBA 2GA9A 3U09A 4JWNA 1EFDN 5JH7F 1MC8A 2GPTA 4G4SP 1UM9B 3WLFA 3L7DA 2FPRA 3RVJA 1G2PA 4LF8B 1CR2A 1PZEA 3GGJA 3VH4A 2PLAA 1OXBB 1V7ZA 3KKAA 3RSOA 4YIKA 1NM5C 3I5UA 4P2HA 3VR5A 5C5EA 4HB2A 3MD0A 3I23A 2WD8A 1P2SA 3MYRA 1YZGA 1A4RA 3E0XA 4C1NA 4XYLA 2MT9A 5M7EA 3E3LA 4EM6A 2H3QA 3EIEA 3ELDA 2F8TA 5AJYA 3FSRA 4UB6U 4RQ4A 1COZA 5ETJA 4KE7A 2H1CA 4PQGA 2REQB 4JGGA 2CV2A 4WUTA 2H07A 2GOLA 1U8TA 2R2AA 2DX7A 3LC1O 1KR2A 2YHAA 4KDEA 2B2NA 4ZOLF 1CK4A 4FYMA 3DEYX 1ENYA 3KB6A 1ZI8A 3T35A 1C7EA 2Z8XA 2O3SA 2WC1A 3AERB 4TMZA 1JLLB 3D54D 4BBAA 1KSFX 1L5MA 3PB3A 1HDZA 1W6UA 2CMHA 5KNDH 5L4SA 1OLSB 2PKQP 4DKXA 3GIKA 5FEUA 4P0QB 1QM5A 4J4BA 1RMTA 1OKKA 4DMLA 4BZZA 2YC4C 1ETHA 3EVTA 3LW8A 2MRLA 1Z29A 4B47A 3AFHA 5CP8A 5LP6B 1GM5A 2IDMA 2DERA 5T4BA 1P2TA 4A6DA 3ZQ6A 1OXTA 5DMHA 2R1VB 4MVJF 1MQ2A 5DM2A 3WGKA 1WV0A 3TBKA 3VRHA 5LYJF 1ISPA 5L3QB 2B6GA 1SCIA 4JLWA 3L1JA 3QKUA 1SB3C 1U02A 5L8VA 3WHKA 2J9GA 3VPCA 4EEKA 3DHYA 1UAAA 3CG4A 1YB2A 2BEVB 1M76A 2PXCA 2VDOB 3GLHB 2I3ZA 1WXGA 1SCUA 4E51A 3DZIA 1UZMA 1GFSA 3FTFA 1J70A 1P4AA 3OMWA 5DGBA 2ZR9A 2Q5QA 1BGVA 2QTNA 2WINI 2ZYSA 4TXLA 4W82A 1IM8A 3IBCA 5E2IA 2DPMA 3URMA 2QD5A 4M99A 5BRAA 1RI3A 1WETA 3K16A 2D1RA 1P3DA 3CLUC 4X1YB 4NM1A 2JBWA 2JH1A 4RWEA 4LNUA 3EH2A 3OX1A 1RAIA 1JG4A 4O4JA 1Y5MA 4D0GA 1CEEA 1ZRNA 4G8BA 1PLLA 3O90A 2EF0A 3LYUA 1I0IA 4F71A 2BM1A 3PW2A 2Q7XA 3LC7O 1DHTA 2R8RA 1OWMA 4X6YA 5CT9A 4Z4HA 4Z0NA 4DBZA 3PR3A 1HETA 4JA0A 4Q21A 1UFVA 6YASA 5CX4A 4GOMD 4PCUA 3D6JA 1OHHD 3QK7A 3G2HA 3BCSA 3I9NA 2X13A 1NFQA 2Y9MB 2IF2A 1VIAA 4UUPA 1R4MA 1XZEA 1IHOA 1NLYA 1UBFA 4HSGA 3GOHA 5K4LA 2ONJA 1JQJC 1B41A 1UQRA 4JBLA 5ILGA 1YRBA 3QMPA 2N3ZA 4ZCTA 1HM5A 4MRNA 2WIFA 4J6FA 5GGYA 2C0CA 2XTZA 4ND7A 4P3KA 5C18A 4OXYA 1H22A 5FA6A 4N8DA 1K68A 3I6YA 2QRQA 4MB6A 4FD3A 3NLLA 4FS2A 4MQ4A 5IM4F 1UHUA 4KLDA 2CXRA 4DFMA 3GQCA 3HNOA 4AZSA 1XWIA 1M9NA 1I7QB 3PUJA 1IUOA 3LCCA 4UTXA 3DS8A 4K9OA 4J9SA 1GR1A 1GAJA 4DM3A 5J2IA 2AGOA 1WHSA 4I7EA 5AW1A 3KJXA 4C3OB 1ZGHA 2WHXA 4BHTA 1WO8A 1KDYA 2BPOA 5F33A 1IG3A 3OZCA 1JG7A 2PVCA 4HDCA 5KG4A 4NMMA 1JN3A 1MORA 4LZLA 2HJSA 4WNIA 5I8WA 1EHYA 1WMFA 1YMUA 1SV0C 4CKWB 2GETA 2IZ5A 3M6VA 3Q6IA 3CRZA 3WYGA 4YREA 1XXLA 1NJGA 4NOJA 4ZQGA 421PA 3VSCA 4Q4JA 3WGQA 1NZBA 4D9GA 2LXNA 1WZEA 1Q0LA 4US8A 3R7FA 3EPJA 4TX1A 5EXSA 1VLHA 2J33A 3KKQA 1M7GA 4C3UA 4EJSA 2BTQB 5HPYB 2FN7A 3AI7A 1G7SA 2WMYA 4HD8A 2JV3A 2BUAA 3WLLA 4V3BA 3L7KA 1A8UA 1YQUA 2WIGA 2IOQA 1ODTC 2YVLA 3JQ9C 3LXUX 1GKKA 1JT2A 1DG3A 2GAOA 3WGLA 1A9SA 5K0SA 1X1DA 3VVCA 2IV3A 9ICNA 1DELA 4BO8A 3TLKA 9ICQA 4ZT6A 3F49S 3AFIA 1NRWA 2DMRA 2JIOA 3OE7A 4XWTA 5KTKA 3KSAC 5EOZA 1XSLA 1ZNXA 1V7PC 4B84A 3VO9A 5EHXA 4Q05A 3OZXA 2XBUA 5AW8A 2BKEA 1WW3A 4FIDA 2RDJA 2FQQA 4LFCB 4NLCA 4CM8B 4QSMA 4RF3A 4IFBA 1RVDA 4JDPA 5C1OA 4HLCA 3OJOA 3RG8A 5EP3A 1MO5A 1CVIA 4KDFA 4UB2A 5CBPA 4OATA 3ZOZA 5BXYA 1MOZA 1UBOS 1PNVA 1G8MA 4WK6A 4EAAA 3D6TB 4DDUA 4ERXA 4J49A 2AJBA 4DTCA 5AVZA 4Z53A 1WDTA 2W71A 5AM3A 1NC1A 3JPRA 3CRQA 4LRXA 3ZVLA 2PMZF 4J43A 4IR7A 2D3DA 1OT3A 1KZ1A 1N8SA 5I47A 3DBLA 5A1JA 2ZAGA 4M1SA 2D5BA 3A70A 4INPA 1MN6A 4J94A 1BA2A 1P7WA 1OIVA 3UT5B 1ZM4A 4ENQA 1I3LA 1OI4A 5SZKB 1QU3A 5ESDA 3L93A 3PF9A 4PLFA 5BVHA 2YIMA 3IP6A 5DN6A 1DKOA 3VO8A 4ZZ1A 3U4QA 5C2JB 2GSWA 1ZUWA 3WBKA 4YDHB 5M3BA 3R7LA 5TF0A 5IVDA 3UIEA 2GXQA 1SRQA 3VJRA 3FVTA 3AMVA 1MJGM 4LYAA 2DTEA 2FDCA 1XF9A 4EYEA 5IG2A 1II8A 3PQEA 4MV5A 5A3QA 4DFJA 4PBTA 5EIBC 5IJXA 2VTEA 2KS6A 4P2GA 4ODIA 4TXJA 1PQPA 2A5JA 2QM7A 2QMUA 2G40A 4JJEA 4IHJF 2JARA 3TQHA 2X9NA 3QTBA 1RHMA 3E22B 1ENPA 4HFNA 4X00A 3UHAA 2BFFA 3GIDA 1DEKA 3DCNA 4ZAYA 1BNCA 3L05A 1NQ5A 4WY5A 2C42A 3OPYI 3QWAA 2GKSA 4I3GA 4QZEA 3I9FA 4LBZA 2C96A 1KH1A 2DFTA 2OUKA 4IWXA 4GMFA 2QLBA 3ZD9A 4K6FA 1UJ5A 3NRWA 2QEQA 3GD5A 4OYLA 1S76D 4EW1A 1G0OA 5I01A 3O2JA 3QPUA 4YBZA 4MLPA 2AMVA 2HMAA 4YXWD 2A92A 8ICCA 5CD1A 4F72A 5FQOA 4EMUA 4YACA 1WY5A 4IIJB 1SD2A 4HPXB 4TKVB 5JXJA 4MIOA 5TQ2A 2FB9A 1OF1A 3LVFO 3PX0A 4FMDB 3S2FA 3LO5A 1MMFB 2WF8A 4H3HB 5T4HA 3WTCA 3KVVA 2OORA 3RIYA 4LUCA 4AJKA 2FFAA 2HHHB 3SXUA 2I3GA 2JIBA 5CLFA 5J5AA 3HJBA 1QHYA 3PT9A 3F5QA 2XKKA 4JV2A 4I9NA 3C1TA 3MA0A 3IIIA 2HEGA 2OG2A 1GADO 1J20A 3GEDA 4YJ3F 4R8RA 5AKJA 2QD2A 3FSGA 4L15A 3MG9A 4U39A 3TB6A 3G0CA 4GKKB 4L74A 2O8NA 5KYTA 1UMDB 1U0GA 2HA6A 4PH5A 1J39A 3PUYA 4S1NA 4HC4A 4WXYB 4YO8A 3U7GA 1A69A 2QKYA 3FUVA 3M6UA 2Z8YA 2A1AA 1KMCA 3KFXA 1MFZA 4XQ9A 1T0IA 2Z4RA 4UHDA 1H0KA 3KAPA 2VJKA 4OHFA 2I4OA 4G9EA 1W5EA 2H2AA 3CRVA 3U6KA 4GX5A 3ZX5A 3KWJA 1S5PA 1VI6A 4NR0A 2HV8A 1HYBA 1CIVA 4GXJA 5ECGC 3K8QA 2HO4A 3ZLBA 4HQRA 3B82A 4ILKA 1ONBA 1IIBA 5KPDA 1EVLA 2UAGA 1LVUA 3I32A 2QPAA 2VHYA 1ZCJA 2QAGB 3DFIA 3WQHA 4MP3A 5DWVA 2ZJ3A 1LW6E 1EFTA 3G5MA 1RYYA 4ZOQI 2JFQA 3LT2A 5DK6A 2JRCA 3S55A 4I2BA 4UARA 2ODNA 4XARA 5BOSB 2RGNA 3DVSX 4B9VA 1WQ1R 2PQ0A 2IYRA 4KN5A 4HNSA 1BWQA 2XF8A 2DWCA 1WCNA 4BNKA 2C4MA 4JI1B 4Q9LA 4RXUA 1U6IA 1E4EA 2B83A 5AW2A 2ZRLA 4RQ2A 1GITA 3OQ1A 3WNCA 3ECSA 5I7UA 1X92A 3GFRA 1IHPA 5JFTA 3S7ZA 3EG9B 7ICGA 4BCBA 3PFNA 3BDIA 2O5VA 1DEOA 1XA0A 3G0OA 4PSKA 4ZTUB 1PJCA 4LX0A 1KNXA 4I1SA 1ECLA 5LIRA 3NQ41 1GUDA 3KZVA 5FF9A 4HX9A 3IOYA 5H59A 1AK9A 1KK3A 2DH6A 2HDOA 2CZQA 4LPSA 5CB8A 3AL3A 1Y1RA 4L22A 1G3MA 1GUAA 4Z54A 5FTJA 3V5NA 5L6MB 2GN2A 3GZNA 5IK2D 3K8YA 1WTCA 1OA0A 3RHSA 3SSAA 5EWFA 3ES9A 1JHOA 3O3CA 4LZOA 1TPYA 4MQEA 1ZA2A 4KAAA 1JJFA 4RDHA 4ZAGA 3IAS1 1RFLA 1XCOA 1A4XA 2V65A 3GP5A 2OAGA 4Z9AA 3OIVA 4KXVA 3FYCA 3TW4A 2EQAA 3RBXA 4LY6A 4HWSA 2FR8A 1F2VA 4UC0A 2GT1A 1B8UA 1T24A 4P1ZA 5AK4A 2CXSA 4DIKA 4EQ6B 5LYJB 2LW7A 4QXPA 5GY7A 3NPMA 3RD5A 5AKXA 4KFSA 4OI0A 1ZUNA 1XTKA 2QW8A 3EIXA 4QQ8A 3T0GA 2IBSA 1ODSA 1M8JA 3JSXA 2AYYA 4ZANA 4X3CA 3TLMA 1JFFB 2JCGA 3LQ2A 3OAAA 2EW2A 2BP7B 2RGAA 1TGYA 4ZHQF 2XXJA 1BPYA 3H86A 1UMCA 2P69A 3OCZA 4JDUA 3CLRC 1R5JA 2WIAA 2Y1DA 1T5DX 4Q3CA 3LA6A 4MW2A 4LOHA 5CJPA 1M75A 5L3SB 3THOA 2F8MA 3ZDZB 1QHSA 2YWDA 1TVAA 4HFJA 2B8TA 4XIYA 4F93B 1NMYA 3O1LA 1N2BA 3EA0A 4NG5A 5EJ9A 1KEKA 4YAUA 2Y1JA 4M1MA 4BGIA 3YASA 2VHQA 1CLUA 3LOUA 1IV8A 2CXNA 2GBIA 4E12A 4Z4FA 3I39X 1GYRA 4HDRB 5BN3A 3EW9A 3AK4A 4X45A 4EPRA 2JFBA 2M6LA 5JJLA 4CKCB 4HDOB 2GFHA 1Z35A 3KAKA 3DXYA 3U7FB 2EJWA 2XIDA 2GH1A 1M54A 3WB2A 1NVFA 1QGUB 4RGBA 3MLBA 1HE4A 3TZ6A 3M9OB 1KE1A 3GNLA 1PE0A 3RS7A 4TZ0A 4PC1A 4MRPA 5DYTA 3W2TA 4MS4A 1XZLA 4OO3A 1U45A 5DCLA 4IWYA 3TEFA 4NDNE 3SBXA 9ICCA 3FVVA 1B3BA 3ZW7A 3D0QA 1TDJA 4JYAB 5J4LA 3HMQA 4LECA 1V4VA 4RE5A 3UTCA 3I28A 4EI9A 2W2LA 1X0VA 1JU3A 4UDXX 4WAUA 1XYVA 2FPXA 1DC6A 4NY1A 3IILA 5BPFA 1Z56C 1I4EB 1PK8A 1XVTA 4NZYA 4IEEA 4XR4A 3P0RA 3GGGA 2R6JA 4HDAA 3IODA 4RIGA 5E6RB 5K3SA 1DXQA 3T4UA 1ZOSA 1E1MA 3T12A 4JGIA 4WKOA 5HWSA 3E5HA 4CIBA 4GKBA 1K7FB 2AFRA 4Y2QA 3T7TA 3OPQA 2H7YA 3NGXA 5KKNB 2NU8B 3ER8A 1C1XA 1GNSA 2QMHA 2V8BA 4DLUA 4RSMA 5CK5A 3FCOA 4KBYA 5EQFA 3L18A 4HV4A 2IIQA 2LRHA 2JHFA 5FAKA 1YRHA 1AQUA 4U9UA 5AW6A 4HWRA 4IOKA 4NESA 1Z7EA 5AUNB 4DQRA 4I1UA 1DXYA 1CQIA 1Y7LA 4NL9A 4MQFA 1QYIA 1JKIA 4UUNA 1QMGA 1ESEA 2IIVA 4MCIA 4NLLA 3OOYA 1J8MF 3QPBA 1GPNA 2ZRNA 4N6NA 2GXSA 3DEZA 1IXSB 2QX4A 3ODPA 1RI5A 4JEMA 4D6XA 1OV6A 3SX4A 2PLFA 2D2VA 5ADWA 2BJHA 1HKHA 3EXG1 2A1IA 2C4KA 1N61A 1O96B 4KVAA 4LSZA 3HDJA 4JR0A 3QEJA 3DDSA 4V3CA 2ILTA 4FFVA 1ZNZA 3EQ7A 3LPAA 4UBIA 2ZEJA 2HY7A 4HWKA 3EMVA 2W8LA 2O2YA 2DQSA 1M1NA 1VE3A 4C0HA 1VL0A 5CYFA 3R3ZA 5BSMA 4LCBA 1ND6A 2HBJA 5ITVA 2FZKA 2XAAA 5DZSA 4LXTA 4WTOA 2FEOA 1V95A 3ON5A 4ARIA 2AFVA 2XGJA 3LHSA 3WNDA 2CL7X 1EBFA 1AGXA 3FNRA 4C80A 4QAQA 1VJCA 1EM6A 5JXWA 1W1IA 3P0JA 2OHFA 4UM9B 5HSGA 3CT4A 1W88B 4RY2A 2RHCA 3QMWA 1SKUA 3ND8A 5EZ6B 5D51S 1JDPA 2FUNB 1PUIA 3C7AA 1X13A 3AESB 1DQZA 4E07A 2PS0A 1KRHA 1GILA 3AI2A 3I3SR 1NVMB 2PT9A 1XAHA 1T36B 1Z00A 1Y4SA 1V4NA 4UMDA 4J3FA 4YQFA 4DR2B 2GR9A 4INZA 1TAMA 1TO6A 1DBVO 3SS9X 3UAOA 1PFVA 2I7TA 1D2AA 1FYDA 4EJFA 4Q43A 2NXJA 3RU3A 1CUGA 4FZVA 3MAAC 1Z73A 4IP0A 4RUAA 3TG8A 2F3SA 3H99A 1V16B 2I1VB 2QL9A 4YPFA 2ZIUB 2I4RA 1EUCB 3DHEA