2VKQA

Crystal structure of human cytosolic 5'-nucleotidase iii (cn-iii, nt5c3) in complex with beryllium trifluoride
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cytosolic 5'- Nucleotidase III
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2vkqA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2vkqA01
1U7OA 1Z4QA 3L5KA 1L7OA 3U13A 2I55A 5A3SA 2C88A 2ZXEA 2FPXA 3DDHA 3QUTA 2D2VA 3DNPA 3L1UA 1T5SA 5ALLA 2C9MA 5AW3A 3L7YA 4UW9A 1Z4OA 4G9BA 4MUMA 2CFSA 1RLOA 2YJ5A 4EZEA 2YN4A 1L8LA 5AIAA 5ALWA 4C4RA 2OBBA 3OPXA 4AS2A 1S8OA 2ZBEA 1YS9A 2IOFK 1CQZA 4Y2UA 2WF9A 4UMDA 5AK4A 3L0YA 5AVQA 3L8GA 2RB5A 3U7EB 3I28A 2YJ6A 1QQ5A 3MPOA 1TE2A 4EELA 3OCZA 3QXGA 5AK3A 5ALOA 2AMYA 2HX1A 5AW2A 1L7MA 1QYIA 2R8YA 3UMCA 4ZEXA 3QU9A 4UM5A 2EAUA 3W5BA 1VFPA 1T9ZA 2WF8A 1RMTA 1S2OA 4KYTA 3WK9A 1ZOLA 2JAOA 1VJ5A 5AVYA 3FPSA 1QH9A 5AI8A 2NO5A 4BNDB 4CF5A 5AVVA 5AKJA 1YV9A 1LVHA 2B8JA 3SF0A 4KNVA 4YCMA 1RPZA 4BYGA 1Q92A 1WZCA 4UATA 5AW5A 4C4TA 4J2TA 4EENA 2W43A 5ALDA 5ALJA 2G09A 3B9BA 4UMEA 3RF6A 3NAMA 3BA6A 1RMQA 4KNWA 1NNLA 2HCFA 3SD7A 2HOQA 5ALRA 1YDFA 2AGVA 4IFTA 1VJRA 4KN8A 2AUTA 1L7PA 3QUCA 1TA0A 3ZW7A 2YY6A 1AQ6A 5IS2A 5ALEA 3EF0A 5JJBA 1Z5UA 4Y2PA 4AP9A 3ZVNA 3ZVLA 4NWIA 5ALZA 3UMBA 4HAIA 3ZWDA 4DFDA 3WK4A 5AKGA 3W5AA 5AKHA 2P9JA 5ALNA 1U7PA 2IA5A 2WF6A 1QQ7A 1ZRNA 4XOUA 3NALA 2ZOSA 3A3YA 5AM0A 2I34A 5AVXA 2YBDA 4AS3A 4CF4A 1RKQA 3WK7A 3N5KA 2ZG6A 3WK8A 5AI0A 4EX7A 3PGVA 1FEZA 4OCZA 1RMYA 3VAYA 1ZRMA 1ZD4A 3TLMA 5A3RA 3IB6A 5IT0A 2OA0A 2QYHA 2PQ0A 3SKYA 2B8EA 2EATA 2PKEA 2BDUA 2HF7A 2I7DA 1NF2A 5AKIA 4Y2JA 5AI9A 4XE5A 3U7FB 3QU2A 2EARA 5AKXA 3CNHA 2I33A 3MMZA 3N8GA 3RFUA 2FPRA 1RLMA 2FI1A 4ZEVA 1U2SA 1XVIA 2CFRA 3NUQA 2HHLA 1SU4A 1Y8AA 1ZS9A 4YGYA 5ALIA 1XP5A 5AW8A 4Y2TA 1QQ6A 2I6XA 1L6RA 5ALXA 4OFZA 4DWOA 3OCVA 2WHEA 3OCXA 4XQ0A 3E8MA 3W5CA 3E84A 5AW7A 5AW9A 5ALUA 3EWIA 5T41A 2WM8A 4HYTA 5AM4A 4EX6A 5ALKA 2G1AA 3N1UA 2P11A 4UMFA 4DCCA 2ZBGA 4HGNA 3D6JA 5AM5A 4BEVA 5ALVA 3E81A 5AK6A 2X4DA 2WF5A 4L6AA 4YIHA 4FE3A 1L7NA 3WKAA 1EK2A 4FYPA 4BNDA 2G80A 4DW8A 4Y2SA 3L0CA 3ZWKA 4Y2XA 2BY4A 4I9GA 4YIKA 5AW1A 3NIWA 3SHQA 4NABA 4G63A 2B0CA 1Z4KA 3U7GA 4NV0A 3A1CA 3WKEA 4L6CA 4UARA 3I6BA 3ZTYA 4YCLA 3NRJA 4HGQA 5ALHA 5AW6A 2FUCA 5ALTA 3MN1A 5A3QA 2FPWA 3K1ZA 1Z4PX 3AR3A 5ALQA 4YH1A 4IG4A 3QX7A 4UU1A 2G0AA 3AR6A 5ALMA 3AR4A 2Q5EA 3ZI4A 3HYCA 1T5TA 4Y2RA 5AW4A 1ZD5A 5ALGA 3FPBA 2GHQA 3AR5A 3ET5A 2GFHA 2HSZA 3ET4A 2YJ4A 4YCNA 2DQSA 4NAVA 1Z4NA 3P96A 5AKEA 4Y2YA 5AI6A 3NANA 2CFTA 1WPGA 3N07A 4Y2VA 1RDFA 2JAWA 3IRUA 4BBJA 2W4MA 3WKBA 1XPJA 1U2TA 2BDEA 3E58A 3WK6A 3ZU6A 5AM2A 2YJ3A 1YJ5A 3U19A 2WF7A 2MU1A 1MH9A 2P69A 5ALYA 4RESA 5AICA 3KD3A 3W5DA 4MWOA 1RLTA 3KBBA 5AVUA 2B30A 1TJ3A 3QU5A 4NFLA 2HF2A 1RKVA 4BKMA 2C4NA 4PNHA 3L8FA 2AH5A 1WVIA 3M1YA 2R8EA 1RQNA 1WR8A 3MC1A 4JDPA 2FPSA 2JGAA 2Q4TA 1TJ5A 3WK5A 3AR2A 4HGOA 4HGRA 1X42A 4H1WA 3KC2A 3I1YA 1J8DA 2GO7A 3WKDA 4L57A 4B6JA 1F5SA 1O03A 5AVTA 5AVZA 3R4CA 1IWOA 3ZX4A 3QUBA 4OHFA 4I9FA 5AM1A 5AI4A 2P27A 2FEAA 3QLEA 1Z4LA 3WGVA 3UM9A 3QU7A 2JAUA 1NRWA 3QYPA 3ZVMA 3EPRA 3WKCA 5AVSA 1CR6A 4Y2QA 2VKQA 2YMQA 5AK5A 4BX2A 4CNQA 3QNMA 3KOOA 3L0BA 3PDWA 3IJ5A 4UU0A 1ZD2P 1L8OA 1TJ4A 4GIBA 4XPZA 4BEWA 2R8XA 3L1VA 4FFDA 2FDRA 3FVVA 2B1QA 3FGOA 2YMLA 4HGPA 4KX3A 1LTQA 3ZX5A 1JUDA 4QQFA 3SLRA 1Z4JA 3DAOA 4EEKA 2HEGA 2FPUA 2QLTA 2W11A 3QGMA 5ALPA 3ESRA 2ZBFA 3ED5A 5AKKA 4UAVA 2C8KA 2GHTA 3UMGA 4JB3A 5AW0A 5ALSA 3CZ4A 2NYVA 3HLTA 3KZXA 3A1DA 3ZUPA 1KYTA 4CE6A 2WFAA 3M9LA 3OCUA 3SMVA 2IYEA 3OCYA 3AR9A 1N8NA 3U7HB 4OD0A 2HO4A 2B1RA 4BX0A 3GYGA 3AR7A 1ZD3A 2Q4RA 4UMVA 3WGUA 3FM9A 3A1EA 2IOHA 4RETA 3QUQA 2G08A 2YMPA 2OM6A 1Z4MA 2YMMA 3SKXA 2ZBDA 3S6JA 3OTQA 2O9JA 4KX5A 2I54A 2NO4A 1K1EA 3KDPA 2HDOA 1ZJJA 3U26A 2ODAA 2R8ZA 2G07A 4BX3A 5IT4A 3R09A 2JARA 2MSNA 4O8CA 4UAUA 4J03A 1SWVA 3OCWA 3DV9A 3ONNA 2B82A 3N28A 4F72A 4UM7A 1RRCA 3I76A 3B9RA 3NASA 5AHXA 1RKUA 5AM3A 1RQLA 2O2XA 5AESA 2RBKA 1Z88A 2IOFA 3PGLA 5E0OA 3PCTA 3ZTWA 4CF3A 4E88A 3L8EA 3FZQA 1J97A 4UASA 2CN1A 1SWWA 2YFYA 1Z5GA 1N9KA 1EK1A 4C4SA 3L8HA 5AKLA 3BWVA 5AKZA 3R9KA 4GXTA 2C8LA 3ESQA 3B8EA 5AVWA 5FP0A 4Y3UA 1PW5A 4ZEWA 2G06A 1Z4IA 3EF1A 2RAVA 5AI5A 1Q91A 2HI0A 2OYCA 1YMQA 2RARA 5AKYA 1U02A 4QJBA 3J7TA 3QU4A 3AR8A 1YNSA 5AIBA 1RC8A 2PR7A 2GMWA 3F9RA 2FUEA 5AVRA 1O08A 4F71A 5ALFA
chains in the Genus database with same CATH superfamily
4MROA 3LUHA 3JS5A 1L7OA 3P9YA 5KDDA 4QUAA 1BHQ1 1H1TA 3FX2A 3MOSA 1JAXA 3HCCA 4K6MA 2ONZA 1EK6A 1Y5RA 1GAEO 3K8OE 3NHBA 5I48A 2WA2A 1IK4A 8ICBA 2FWJA 3PNOA 1JKMA 2WT9A 3DE7X 4PHHA 1E69A 2WUVA 1Q21A 3BH6A 3OG9A 3WIOA 4DMMA 2VR1A 2XMPA 3ZCSA 3HPQA 2HPHA 4BVHA 4DLYA 3LRXA 5HOEA 2BR3A 5IF3A 1AB6A 4UW9A 3DZKA 4RGYA 3AG6A 4NZOA 4PSDA 3LBIA 5T8KA 2V7VA 4ZKEA 4J6EA 3P0EA 8ICMA 4MKIA 3VAYA 5K0LA 5BXYA 1X2BA 1U2ZA 3ISCA 3PW4A 1AS3A 3NEPX 4ENRA 1AK2A 1S4QA 1SG0A 2BFCA 2OBBA 1V6SA 4NV1A 1VPWA 4MLDA 1JXEA 4NEQA 2IKQA 3FFBA 1EDEA 3IV9A 5JNSA 1K1SA 2XCPA 4TLLB 2XCUA 2XRMA 4NZ9A 1JBEA 1V1MA 3OY2A 4LC1A 1QTIA 3GPCA 1D9ZA 1SCBA 3TBHA 4AJKA 1EZ4A 2NQTA 2PH1A 1G5TA 1VMIA 3RUAA 4TL8A 1WDKA 3H4DA 1JTEA 4DG8A 1T8TA 2ZWOA 2RD2A 3P32A 5U4QA 4J29A 3SIPA 2E4WA 1L5YA 1MN6A 3B60A 3EC2A 3HP1A 3R0JA 4OHOA 3MPOA 5IBRA 3P71T 2JGDA 1D5CA 2AG5A 3GX1A 5JPCA 1KKMA 2H3FA 5EIBC 1ESEA 5B4UA 3PEVA 4GC5A 3Q7QA 2YB4A 4Q4JB 3RFFA 4GKBA 2J45A 3H97A 3QEOA 5A0VA 3AVVA 5JJCA 1DZ3A 1NSYA 3UMCA 2R8YA 2ZTMA 3KV1A 2HWKA 3JYOA 2ZJ8A 2DZDA 3ZKAA 4D0LB 4XGRA 2F7SA 3GLIA 3BWXA 3HKZC 1JFLA 3BGDA 2F77X 3ETNA 4CIYA 5ETJA 4QPJC 4CJXA 3MDAA 1FTWA 1SUFA 4K28A 1YZ3A 5F12A 1KNQA 2PZFA 1L5HA 3RWMB 1UBLS 3HA7A 2A9FA 3I4LA 2F64A 4ZVOA 4BN4A 1NR1A 5PNTA 1OCEA 4CUZA 2YFQA 4R9SA 5HFAA 5JZVA 4MUEA 5DTQA 1RRVA 3EZXA 3M83A 4OV6B 3EODA 4QTZA 1EWYA 4C06A 4CV1A 2XMRA 3QK7A 4GUDA 3BCUA 2F3NA 1F2VA 3PI7A 3GUZA 4J9LA 1YV9A 4Y6OA 3CUEF 1EUDB 3ELUA 2JG3A 1IBSA 1OT3A 1Q1ZA 2AOUA 1FBTA 4I2CA 1XCLA 2Q9UA 5JZSA 4OHYA 2XY5A 3CYMA 1GZSA 1V37A 4F97A 3ZLTA 1VKZA 4ENQA 3H18A 1E6MA 5J59A 3NDRA 4IOLA 2W54A 4J43A 2I2XB 1ZIOA 4MB6A 3I0NA 2Z4TA 1QYCA 2W4QA 1Y4DE 3SN6A 5HRCA 3K73O 4RPJA 2BKUA 2M0NA 1GFIA 3WLTA 2P7HA 1KHHA 2I3DA 3PNQA 5E4TA 4O3FA 5A9TA 3B12A 4PN7A 1QIEA 2GFQA 4HNRA 3SD7A 5ELLA 3U80A 4UPEA 4IFBA 5KQMA 2D7DA 1BYUA 2W58A 1F8FA 2O59A 1DV2A 3DMGA 3U44A 3QUCA 2RGXA 1PKXA 1G5HA 2Q07A 2GPAA 2AZXA 1TPYA 1EE2A 3REGA 4YV0A 4DYVA 2XCIA 1AQ6A 4LZWA 1TEVA 3MRSA 3WDMA 1NSTA 1RXYA 5K20A 5KOHB 4JEMA 3NJRA 4U3JA 3IAUA 5DP1A 4F46A 3FFTA 1RXUA 3H3JA 3OFJA 4RZQA 3PX3A 1W30A 1YIOA 4BOYA 1K4YA 1NK6A 1WAMA 4HPXB 1RXEA 2R65A 1NVTA 1WS6A 4IIBA 4N82A 4JI6B 4ZDKA 1L4GA 5KFYA 2RGCA 1W6RA 3FROA 3K9NA 4L27A 5FQNA 5L3QA 1UT5A 3GH1A 1RXSA 1ZOIA 1JZQA 4BVKA 5BT9A 1L4HA 3NUGA 1WLYA 1KEUA 2FZEA 4A8EA 4B6RA 4ZZ1A 3QZ7A 1CDZA 1XLTA 4XEHA 1JRPA 3CVJA 4DIMA 5JJLA 2Z8ZA 4FLFA 3F9CA 3PIRA 4RS4A 3TCNA 1E9DA 2C54A 3VAZA 4ZGGA 5JT1A 4LE0A 1YZLA 1EE1A 1UPUA 1UZAA 4HFNA 3OSNA 1MFPA 4J4BA 3PQCA 3A3YA 1JKJB 4CLHA 2X8LA 1IM4A 4PX5A 2EP5A 2IYNA 2JIOA 3AOEC 4P5EA 3MAGA 1FYDA 1PL8A 1ZICA 4G5QA 3HMKA 1VBFA 4TMXA 3RADC 1T5BA 2YJNA 3B9JA 2ZPTX 1RMYA 4NLNA 3NB0A 3AP1A 1WHSB 2GBLC 4NU0A 1QE3A 2EBHX 4QE3A 5IT0A 1K8QA 1SPBS 1ZNQO 4YRPA 2HVIA 3BL8A 2A9VA 3Q5GA 5LQMA 2PUCA 4GOJA 3CQ9A 1N5MA 1XV5A 3B13B 4HBZA 4QZBA 4YDQA 2FUG6 1J22A 4EG3A 1L5WA 4L3OA 1KU6A 2IEBA 4PE5B 5JU6A 3AUOA 1G5FA 4OUDA 4ND7A 5TGTA 4B3FX 2FE1A 5LR6A 2JZBA 1B22A 3CO5A 2GCOA 4O1HA 3B1VA 2WZBA 4P3PA 3GLQA 4CMEC 1NW6A 4BUGA 2N75A 4PXYA 4NCHA 1FZQA 1DC4A 1WDLA 3DOIA 3HR4A 1U2SA 4H7EA 5EXSA 3THXA 3FR8A 5JYDA 2HADA 2NP6A 3Q3VA 2FEMA 1W59A 2X4LA 1I5EA 1UC5B 1UBKS 4NZYA 2HFKA 4X63A 4DQQA 3VNRA 5JISA 2PK3A 2REQB 1U9JA 3KHTA 1PG5A 4YRZA 4CIAA 1QZXA 1GKLA 4X00A 2OYYA 3FCCA 2F8LA 4KLFA 1VG9B 2IZ0A 3GRUA 2OBXA 2R4UA 1F0NA 4YMMA 3S7TA 3U7RA 1Z0FA 5HF6A 3KAPA 4ZCMA 2G88A 3K09C 2DFDA 2KKVA 2IV2X 2KZ3A 1H2EA 2ST1A 3DWGA 1BQ4A 2EF0A 1H8ED 3MJHA 2NV3A 4PG7A 1S4MA 4RGBA 3KOZA 4LJ9A 4KFSA 2BBTA 2GD0A 4NBUA 1JS1X 4EX6A 3W04A 2HWWA 1OUQA 3N1UA 1H38A 1KK3A 4FMPA 2HBZA 2BSQA 3JVIA 1QYXA 2XD4A 4HNGA 3EXG1 2Z2YA 4YP7A 3DT6A 3S28A 3AEUA 1KEJA 3UTCA 1RYSA 3E81A 1N2ZA 4YV1A 2C8VA 1EINA 3N2EA 3ZNOA 2D13A 5IHPA 1U4SA 3RJTA 1E60A 3VU9A 1QKJA 1ZOSA 2O0MA 4R7ZA 3O93A 1T3LA 4ZYUA 1NBME 2X9LA 4D57A 4ZAVA 2WUEA 2WHYA 4NBSA 3IS3A 3RRJA 4B4OA 4DMFA 3MWYW 2QS9A 3WLAA 3BD9A 4RC9A 4NK5A 4CL8A 3NM5A 5I7EA 1WNTA 3E2IA 1M7HA 1P3DA 3CRW1 4B45A 4DUPA 1KBOA 3KKLA 1TA9A 1KPGA 1W0KD 3FWNA 3LBFA 3I6QA 5HZMA 3AGQA 4C4XA 5LIPA 5C51B 4QWDA 1JH8A 1LLCA 1I24A 4U7PB 5L3ZA 2XTJA 3A3KA 1NZJA 4ZJYA 3K0FB 4TVKA 3I6BA 3E7XA 1E6EA 5IM4F 3R7FA 4YCLA 1RRGA 1WDTA 3I2GA 1OOEA 2GCOB 1XU4A 2WHQA 5KYVA 1K5DA 1A9SA 1B16A 1TUBA 3ZV5A 5HCIA 2ZYDA 2J6BA 4X1IB 2G0AA 1R4NB 1W19A 1XEWX 2HMAA 3DZHA 3OEHA 5D86A 5DBFA 1KFTA 1SM4A 2WV7A 3SAJA 4EVIA 4DSJA 5TISU 2B92A 3RKUA 4D0NA 4TN1A 2AB0A 4E6PA 1EP2B 5KNDA 1U3DA 4H35A 3VR2A 1WSAA 1H2RS 1N3IA 2R60A 2YNMC 4OTZA 3ET5A 4OKNA 3UH1A 4MYTA 3PEWA 4KRGA 2YOGA 5F9HA 3ANXA 1OBHA 1CY0A 4IIJB 3KDAA 4RD1A 1WSBA 1B6SA 1O94A 3A36A 4ND6A 3HYTA 1QPZA 4L2IB 3S2GA 1NI5A 2R87A 2V3WA 4HMQA 3VYRB 5AKEA 2EKPA 3ZXYA 3A6LA 3EVBA 3HKEA 1FUEA 1SBTA 3BXHA 3WP0A 2CFTA 2QTCA 1F44A 1X6IA 4MUJA 3MRTA 3F2BA 1ZI9A 3CH4B 4HB0A 4KQ2A 4N6OA 5H3CA 3SU8A 2ORWA 1LBTA 2BFOA 4PYLA 1J2RA 4D9NA 5JUWA 4QOFA 5DCYA 2P2DA 4JR2A 1T3SA 4PO3X 3IPAA 2KV2A 1Y4ZA 3PU6A 3DD5A 2QLNA 4J0GA 5G4KA 3RI3A 5A4DA 5BRNA 2D6FC 3GU3A 5IW8A 1FXUA 2MU1A 2YRFA 4K9SA 5A71A 3DLHA 2FFAA 2PUAA 3T35A 3R6TA 1AUOA 4RESA 1J0CA 2DBZA 4JFRA 4R3NA 5A3VA 3FXAA 2QIOA 3VVCA 2W8LA 3IQXA 4AULA 3UFXB 5I7UA 4TUPA 2HF2A 1VBNA 3AERA 2O2YA 1NK4A 2JCVA 4WJKB 3IE2A 4ZGBA 1L3CA 2J5QA 4ATNA 3HILA 4KMUA 4GRAA 3DLTA 4MO2A 3ZY2A 5KFZA 1QAQA 3R0VA 4RBNA 2RGYA 1KRPA 3BFKA 2OUIA 2HZBA 3DP9A 3DMYA 3QPCA 4J9VA 5CM8B 3ROQA 1PJAA 4GC9A 2YBEA 4BN0A 3V42A 221PA 3ZQ6A 4FSXA 2OBYA 3LLSA 2RHJA 4FYHA 2DWQA 5JI2E 3DMPA 1SVMA 5HIAA 1PGJA 1ZUWA 2KSOA 1NWHA 1QIIA 2GBGA 4IAOA 3TSZA 1VXOA 5J2DA 1J9GA 3JQAB 1CP3A 4IGEA 4N7MA 4DQPA 5AMXA 3W90A 3SYRA 1NZPA 1LTKA 2Q0QA 4OG2A 1TL7C 1E1RD 1YVPA 2I6QA 2R85A 5GJVC 1Z15A 3RK4A 4AI6A 2NUTA 4O29A 4I4TA 4F9EA 4QDKA 1LVUA 4MV4A 1Z07A 2YOHA 1OC2A 3E3OA 3MUEA 4CCWA 1G7SA 2QRUA 4GKVA 2AKYA 4Y2GA 3CXUA 4AYBC 3IUBA 3QLEA 2FQWA 1QHYA 3UB3A 2C3UA 4IIJA 5BOLA 1U2EA 2FSFA 3R7DA 2DEUA 3JQPA 2FP4B 2FX2A 1ZMTA 1UPFA 1AV6A 2E48A 1NK0A 4OB7A 2VKQA 2RFLA 5E7IA 4AXXA 1Q95A 1L7QA 2EHDA 4LMAA 4DLLA 3TLEA 4DYDA 5IZCC 1NJYA 1JHVA 5ELMA 3AEKB 4KYUA 4HVLA 1VL5A 3ORYA 4RCYA 2G5IB 4A0GA 1QFJA 1DWOA 2VDLB 5F77A 2C2KA 4XGIA 2PHZA 1UJCA 4LE2A 4EPRA 3SBDA 1EUCB 4DLVA 4AU1A 4EPXA 4DF3A 1BZYA 5T6MA 3QZ8A 4MKGA 5HX7A 4E51A 2GLUA 3IEXA 2ZJ7A 1A0OA 3FY4A 1AQUA 4HAOA 1Z3CA 1K3TA 2XNKA 1ORHA 1W46A 2NXWA 3PXEA 4UBKA 1ZZGA 5E6RA 4M0LA 3UG6A 3ZX5A 4XKJA 1LSOA 4LX8A 1R9MA 3BJZA 2CLIB 4L8YA 4LHXA 4FBLA 3TCKA 3UJ6A 3AFGA 3ANLA 1Q0QA 2E2WA 4IQTA 5ICEA 3NVKI 1LKYA 1RJGA 1SXHA 4A1FA 2H1VA 2BC9A 1RHUA 2R7NA 1P33A 1W2HA 1T5OA 2AFVA 2FSVC 4Q5IA 1DJPA 4BLTA 1OUMA 4G5XA 5B6PA 4M1OA 5FI0B 4N6NA 3R8CA 2BGUA 3HLKA 2VJAA 1VCHA 2DHQA 4UDXX 3A7DA 3A2KA 2CNLA 3OIUA 2F55A 2ZM5A 1KSJA 2Z8YA 4UHJA 5E7JA 1WL8A 4H3HB 4HOYA 1JIJA 4OAOA 2H8KA 1JPVA 3ZDRA 5LWHA 2NYVA 2PS0A 4Z0PA 1DBQA 1PR9A 3H5LA 3ZJVA 3DW1X 1SXIA 3VR2D 3MJVA 1DKRA 2VWQA 1FUIA 5EUCA 2IE8A 3BMNB 4TWBA 3RJFA 3IP9A 4E14A 9GPBA 1WPXA 1LWNA 2FW1A 4HEJA 5CBPB 1PVQA 5TX7A 2ZTVA 4C0HA 2BHNA 4J16A 4GO1A 3HXQA 2VJMB 3IT0A 2AN3A 4IXTA 4WZBE 5EHNA 3FYUC 4BB6A 4RT3A 4ER0A 4LJ7A 4L0QA 4AO8A 2Q4RA 1PK7A 4CKBA 1EDBA 3BQ2A 3LUGA 4B6QA 3SNHA 3TK1A 4J0KA 3UXEA 1P0MA 3CLTC 3ROGA 4ENPA 1A5ZA 2F1JA 5CFZA 2XCLA 3P2MA 5FPPA 1U8AA 3P4UA 2XKJE 3SC3A 2PWBA 3ESCA 4UU8A 1ENYA 3U3ZA 1E9EA 2H3EA 2Q3LA 5H3HA 1FB5A 2G9VA 3QWHA 2G07A 2HRDA 4FT4A 1NP7A 2OILA 3PDCA 2JCGA 4IP0A 1ZXIA 1PJ8A 2OTCA 4O8CA 1NUPA 4F4UA 4QPNA 3OCWA 4IQ0A 4Y8VA 2H5JA 3STHA 2RHFA 4DQVA 3H1EA 5JI3E 2H1RA 1MG5A 4MQ4A 3VDNB 3VYVA 5IKMA 1ITZA 1X7WA 2A30A 5HMMA 1PUIA 2DY1A 2QZSA 3D8NA 5KYUB 3QVUA 1GT91 3T1YB 3JRNA 2WTFA 2FGKA 3IMEA 4RKFA 1W0CA 3EZGA 3MA0A 1W5SA 3JQRA 3BIOA 1WXEA 2OOSA 3C3AA 3FLEA 3O84A 4TMYA 3TQFA 4CEHB 2HCJB 1EWVA 3NH6A 3R5HA 1NKTA 2BM8A 3RS8A 3ADCA 1NXWA 2O20A 4MICA 4DLUA 4BGIA 2WWWA 3UKJA 4EZ6A 4BVBA 4HWSA 2KFZA 2HHWA 3VPXA 2X22A 4MYDA 1PEYA 1OYYA 2O1XA 1YJ8A 2AJLI 3UAZA 3G8AA 3BGVA 3C4QA 2C0QA 4B0OA 3K53A 2Z0MA 4ZAFA 5KT2A 4Q16A 3ROFA 4CTJA 4RTSA 2DFLA 1U9IA 3TACB 5J0SA 4KLLA 1MO3A 1WUJS 1WZUA 3PENA 5ARBA 2F3TA 1DX6A 2YWDA 3HWRA 1CD5A 4JL8A 3SR0A 3UHAA 1ZLXA 2H4HA 3UMFA 1YBMA 3QSYA 3OTWA 1FX0A 1NVFA 1SKMA 2LUOA 4PTYA 2BFDB 4BC0A 3AB8A 3GBPA 1MB3A 2WD7A 3QJYA 1KARA 1YMQA 4GPTA 4C4YA 4QX6A 2F9LA 1T3QA 1UKBA 1DUIA 1JYEA 4KE8A 4H18A 4L8LA 4OL9A 4QJBA 1XD2B 4Y2HA 5CYOA 1NJZA 2VRCA 3ZDCA 2D4HA 2E0IA 3NYIA 2CB0A 4MK4A 4K4HA 3Q3GE 1Q1QA 4X6YA 5F76A 2QQ5A 3EA5A 3W3AH 4KREA 2CNBA 3IP3A 2VHZA 3U13A 3HKCB 1DBPA 3LWZA 4P0TA 4OIFA 3PLNA 5FPTA 4YMLA 1U98A 3IVXA 5IJ9A 1RQGA 3OEED 4K9NA 5ENVA 3NYRA 1DO2A 4NOMA 4TXNA 5FF9A 2ACVA 2VSOA 5J2JA 2PMCA 9ICOA 1UBUS 3SYZA 2IHUA 4C3UA 2GM9A 1I0IA 1JQJC 2XWQA 4WZAB 1Z9BA 3QLUA 4XH9B 3FNFA 4ID3A 2HBRA 2NN3C 2WVAA 3QMVA 1LRLA 2O2EA 4ARIA 4DQLA 4KXWA 4S1PA 1E32A 1U0SY 1WD7A 3BRWA 3NH9A 2OEPA 3RBZA 1FUKA 5CK4A 1EZ1A 4XB6B 3W3AD 1O8CA 1JDVA 3VUEA 3TZ6A 4FLEA 5B5EU 3OKPA 3RTAA 4FFBB 3VMFA 1E4OA 5FAKA 4Q05A 2QPAA 3G17A 2RHGB 2JK1A 4B81A 2PSJA 5D5HA 4EF4A 1ZHOA 3JD1A 4CIVA 2Y27A 3LRTA 3T7DA 1K5GA 1NZBA 1E62A 1D0IA 3K8QA 5TQJA 3IR6A 3ORSA 2C4VA 2W6JD 3OOSA 1RAFA 1NQ5A 4XRGA 1IN4A 4JLJA 3RV3A 4RQNA 4IV0A 3KHSA 3C28A 4L73A 2O3SA 2E21A 3SJAA 5CDYA 3C8MA 2G9UA 3CY6A 3FCSB 3ZHVA 1T24A 3HCOA 2BQUA 2HL6A 4LQLA 2GWSA 5K9ZA 2YINC 1W73A 5B30A 3AKEA 1T7PA 3OC6A 4R40A 4TTQA 3FNBA 2IY8A 4BO3A 4Z53A 4JV5B 1PP4A 3ANYB 3E9QA 3KD2A 1U0JA 4N5NA 1JQLB 5JDIC 1EVEA 2C7VA 4LOHA 1TIBA 4M7PA 1GRRA 2JBAB 3PPYA 1LLDA 2X5JO 4PAOA 2YXDA 5JJKA 1BPYA 1HQDA 5K4AA 1TGYA 4EGQA 1LBIA 3OJ0A 1FE8A 3IMFA 1BJTA 2B6HA 2W6ZA 1MJGA 2VDPB 2WD9A 4IJ6A 1SGGA 3K20A 3LDGA 5K8TA 3AZQA 4PGYA 4RTLA 2V0NA 5L7YA 4ZAWA 2GJ9A 4F2HA 2XE8A 2R1VB 4L15A 5B1EA 2UXBB 3DZGA 1CZOA 1MH1A 5FI3A 5AVVA 3SNKA 1E6LA 4Z4FA 2BZGA 2B8JA 3CUKA 5DTJA 4BIIA 2IZ7A 1J21A 3F6RA 1FQKA 4W8HA 3VJLA 1Z0IA 1ZUNA 2O3UA 3L7AA 3C5FA 5COBA 5BT8A 3ENZA 1XAGA 2ANBA 3OFSA 1DIAA 1DOZA 1QZ3A 1OAOC 1PLKA 4YR3A 2YX8A 2WB4A 3D43A 1EX7A 4J2TA 1NKBA 5TPWB 1AA9A 2XIQA 1R3UA 2L69A 2G3YA 3RF6A 4GKKB 2NRVA 2Z5VA 4AX4A 4HH1A 4GI2A 2Z6QA 2HCFA 1LI5A 1WOMA 3CLHA 4DCSA 4P3KA 3M6ZA 4Q3KA 2Y66A 4KIUA 5FXMA 5ADWA 2QROA 1V47A 2ZI4A 3FPLA 1VJRA 2WUGA 4NPHA 4FILA 4PW0A 5KWSA 1QV9A 2HB6A 3NHLA 4HGYA 2CVHA 3E35A 3J7AC 1N2BA 3KPVA 3OPYA 4KO3S 1S77D 3TBKA 1J2TA 1W52X 5CIQA 3VPDA 4ITUA 4D4IA 4UM9B 2B25A 8ICPA 5JJBA 2QI9C 2I62A 4M9RA 1T94A 2E3TA 1RP1A 3SM9A 3QG1A 3T7JA 2NQ2C 2Y1WA 4XDHA 5LOVA 1KMQA 3GAAA 1ORTA 2I5HA 1ZH6A 2C94A 2QL9A 3AFIA 3IBSA 4KXLA 1N7JA 2C97A 3L1HA 4LAFA 3UBMA 4DARA 5F3WB 3Q72A 4P4SB 4R68A 3UW1A 3A9SA 4DABA 1DSSG 4RXMA 5FTKA 5K0NA 4P5DA 4EF6A 5DNUA 2JJ8A 3E7PA 4HX9A 5IDYA 5TQ2A 4C03A 3C2KA 2IIBA 2X2OA 4V02A 4DFDA 4ZTZB 3WK4A 1R4MA 2H5LA 4W1SA 5HDBB 4ZEOA 1YDHA 3EZNA 3W3AA 2RC5A 4TV9F 5T8KC 4HNVA 5KVCA 1GPNA 2M32A 4YREA 5DB8A 4Q66C 3DQPA 1J90A 3QKSB 2DPIA 5DNAA 5ULLA 1GGHA 3GEIA 3AESB 3UJ9A 4C88A 3KKNA 3N7PD 1NJSA 2JH8A 1QQ7A 4LTMA 4HJRA 5LQCA 3H4IA 2AYYA 4OQ4A 1E0AA 2WDZA 5KFJA 3ZHZA 3NHAA 4IDQA 4JKYA 1NKCA 2JI9A 4KOEC 4ZDJA 1R1DA 2CWWA 1S0NA 1GKKA 3WK7A 1HE5A 2IF2A 2ZCUA 3AOEA 1V3QE 1YDEA 2XVAA 3C8DA 3CTMA 3GIWA 1R64A 1KETA 4L4UA 4LG1A 3REFA 1OILA 3WMEA 5AFSA 4JJZA 3PUJA 3NBAA 2IHJA 2D06A 3TPFA 1MT3A 2ROQA 3C7AA 4TV9A 5BRJA 2ORIA 1GPLA 2AI1A 4QASA 1W9MA 2PQ0A 3OZAA 2JFWA 2AQ0A 4GLXA 5KSZA 4UE3S 1TM7E 4IKPA 3U3DA 3TYXA 2PKEA 4M9LA 1YCFA 3K0HA 3O8NA 3QA9A 4QFBA 1WB4A 2BMDA 4MXDA 3TLGA 1W7AA 5CM2Z 1UR5A 1BFUA 3DW3X 5EWFA 3SZ3A 5LOVF 1XO1A 2V5VA 5TIIA 2WSMA 2EARA 2VDRB 4FYMA 4JLKA 4D9MA 1NATA 1CE8B 1ZK1A 4B17A 5DKFA 1B26A 2VS1A 4D46A 1VLLA 5CA1A 3ITDA 4O3PA 2VA8A 3NDIA 3MUOA 3NUQA 2HHLA 2O7RA 1DWUA 1SU4A 1VPLA 5M3BA 3FGZA 4NTZA 1N92A 2AJQA 3RVKA 3SLGA 1EVKA 1PJTA 1LPOA 1RC0A 3KZKA 5HRAA 2JIZA 3G0BA 5K8LA 4Y2TA 2FPMA 3FUWA 3IVMA 4U2BA 4BMDA 2X2EA 5A05A 3M9OB 1G60A 2AC4A 2NUPB 4OFZA 4WNAB 5E9QA 2B5VA 5HEKA 5CDFE 3WAGA 2VCEA 2QD3A 3FWZA 2KX7A 3R3HA 3CGGA 4XYEA 3U7QB 3N87A 3IE0A 3KP1A 4YJ3F 4E6EA 4Z49A 3S2UA 5CLFA 1IHUA 2PAFA 4KVZA 3U4DA 2HIAA 3N39C 1N8KA 4HZUB 4ZT4A 1PSDA 3TECE 4BIMA 1R16A 3HM2A 1ECCA 1Z8NA 3BRWD 5LD2B 5H8WA 2JLYA 3HYRA 2I5PO 2QZZA 2R6CA 3CN9A 4HNHA 1NRIA 1K08A 3GARA 3GZTB 4KC0A 3ZH9B 6GPBA 4GI7A 1UOPA 4L72A 3QLVA 5LDGA 4YGXB 1JQ5A 4BO2A 5EXTA 4J9QA 2A86A 1T0UA 2HIGA 3DOEA 2Y9TA 3GC6A 2I9GA 1AXGA 1TK3A 5K1ZA 2EFJA 2MDTA 1O57A 3ER6A 1YQGA 3SXUA 1KI6A 4HAVA 3N76A 1AKYA 4MP3A 2PFNA 3DQZA 1I5RA 4FBMA 4OUDB 2ZRNA 4DR3B 2KHQA 5FOWA 1DIOB 4E09A 5ISMA 1U2PA 5FDFA 1H8HA 2D62A 5CVVA 5FI5A 2XD9A 4C0AC 4DW8A 1Q3KA 4ECZA 4Q8EA 3L0CA 3DVLA 4GR5A 1L6NA 1IK6A 1K8XB 3IXQA 3RHZA 3N2ZB 5EHQA 4G0MA 1YJQA 5EWLB 4QJ3A 1I36A 1UMBB 2ZPUA 2ISOA 1KAMA 2XBLA 3S2SA 4KPEC 2PXIA 2V7QD 3NIBA 3P2IA 4RJKA 3TMAA 3PEFA 4LJXA 1Z4KA 3U7GA 3WKEA 2P4SA 4L6CA 3DEEA 3DEYX 4ZJZA 4R05A 3CX4A 4BGEA 2DUNA 1N75A 3OTIA 2R8KA 2D1QA 1HZZA 2BMJA 4KRXA 5CLLA 4YRAA 2XWSA 4NFSA 3UGJA 2GNAA 4URYR 2ATCA 1N6PA 1F3OA 4EYEA 1U0RA 3QQPA 4PZOA 3RIGA 3TSWA 4C7ZA 1QSSA 2Q1WA 3AR6A 5K3SA 3DKRA 1X70A 3BZUA 4OAQA 2JMGA 3Q3EA 3K70D 3ER8A 1UZLA 4KO8A 5J2FA 2N1MA 5IILA 4ZV9A 5KS2A 2IE0A 1JEDA 4KLEA 4MV1A 3WTBA 2B35A 1N7HA 1N6NA 3TOVA 1HY3A 1AQYA 1M76A 2YL2A 4MKHA 1DO0A 2H16A 2XWBF 5ICFA 2IDMA 1YA8A 1CJCA 4LHYA 4QPCA 4C3OB 3CFYA 3I3OA 2H1LA 1YQ9A 2VIIA 1NF9A 3N07A 4GYWA 1HLDA 2IVZA 2P5YA 1HRKA 3DFKA 3LFHA 4J1SA 3AFOA 4PO8A 5E2IA 2MU2A 2R18A 4MGIR 4CTMA 5F33A 4RY8A 3WG9A 1CRLA 4BVLA 3TSAA 1W49A 1SOUA 2O2ZA 4QWEA 1XA0A 3ZWWA 5JWRA 1KJIA 1RI5A 4WMLA 4F96A 1T2NA 3BEOA 2V6GA 4ZYWA 1BPBA 4EMSA 2ZW9A 3CF2A 4TROA 4ZCIA 2MIIA 4YXWD 4CEJA 3D2QA 3C43A 3ODGA 4JLNA 3NT4A 2QSUA 4EKEA 3O7WA 4CV3A 5FUBA 2DC1A 3LFTA 1NUQA 4KEAA 3UXMA 3QEKA 4BNZA 1HDYA 1EAMA 1V11B 3BXPA 4OVKA 4HDAA 1AD2A 3ESXA 2R6JA 1A9OA 1E99A 2CUZA 3BXXA 3IQHX 3T5MA 3TQHA 1M10A 4LXIA 4BJHB 2H9YA 2VOJA 3L8DA 1DLJA 5BUSA 4RZHA 1JFSA 1R37A 2HC9A 2V8BA 1EFPA 3UHFA 3JQ8A 5JD3A 4NX2A 5B55A 4Y1RB 5F7OA 3UCEA 1UAAA 2P0EA 3X1ZA 2RRDA 3ZV3A 5LC1A 4F4CA 1U0GA 1ZM7A 3TSOA 1M1UA 5DH9A 3S2YA 1KBQA 2EC5A 3H5OA 1QK5A 3QW4B 1TMYA 2JIBA 4KMSA 1KYXA 3ZE0B 5E6SB 1Z08A 1K8ZB 3TUJC 3W5JA 2CLLB 4DBZA 1QHNA 2OE2A 3L7DA 2PWYA 1SUWA 4BWGA 5IBPA 3IA7A 4BKRA 1GT6A 8ICOA 2DFNA 4FZRA 2I4LA 4Z3KA 1OH5A 8ICKA 2YB1A 1D2CA 2UUOA 3K0AB 3H2GA 4WJLA 4LCBA 2QMOA 3R4CA 1A88A 2V45A 3LTNC 3CVYA 2ZE8A 1RFLA 4E30A 1MEEA 3FDFA 1KJ9A 1X8LA 2P8SA 2RBEA 5FL3A 5G4KB 1D2EA 1E94E 3BPSA 3OPMA 4LSZA 4RUKA 2MMCA 1GRNA 2AXQA 3VO1A 1H5UA 1B93A 1V1RA 3GIIA 3EH2A 3UFXA 1YCHA 1BDBA 4RU9A 2ZUVA 3IP8A 4BVEA 4WXPA 2J7KA 4ID9A 4EFNA 1PRYA 3AF5A 3OX1A 3R0ZA 4UU0A 3AGPA 3FNGA 1A8PA 1TJ4A 4ZODA 4ZO7A 4CKCA 5JRDS 4AN0A 2KYRA 3M2TA 2GCIA 1PR4A 1L5GB 4C21A 1TM3E 3RV4A 3JZDA 2VYVA 1SCUA 2AYXA 2BGIA 4UUOA 1E7YA 3AFMA 3X1MA 4JBWA 3ESAA 1SXJD 4LRTB 4C5CA 5DN9A 3RG8A 1GCGA 1IY0A 1GSHA 4NL9A 3RR7A 2IODA 4TQ9A 1S2GA 1Z4JA 3V33A 2AU0A 4TL6A 4XA5A 5HG0A 1S2MA 1E9SA 1T1RA 5LXTB 1DQRA 5C4MA 4K9PA 3IJRA 4I4TB 2J07A 3P7MA 4ETWA 5KO2A 1SCAA 1FRZA 1TEHA 1G8JA 3LUFA 3MCAA 2HJGA 4NJEB 3EOBI 2QAIA 2YC2C 2FN7A 4WCDA 3ND5A 9ICXA 1SC3A 2TRSB 2W6ID 3HUUA 1IY8A 3L9WA 3LECA 4Q3BA 3H8VA 4MYCA 4XWAA 3L0PA 5TJHA 2ZB3A 2EBUA 4GX2A 4ZYVA 1E8NA 2ZVJA 3QFFA 4RZ3A 4DS5A 3BFVA 5J0XA 2LWIA 2JD2A 4I8DA 4QO8A 2DU8A 5DE3A 2NUBA 3E61A 3PSIA 4CMCA 2UZAA 3V2IA 2EJWA 4L9RA 4QUJA 1FFDA 3RB0A 1CY6A 1SCQA 4ZVNA 4CE6A 4GMHA 1N33B 5LVAA 1P1CA 4JUFA 4OQFA 3F2CA 1AF7A 2D2FA 4WNYA 1VG0B 4ABTA 5A3JA 3ROMA 3OT5A 4OKSA 1SAYA 2XADA 4NCIA 2NU6B 1EFCA 3FD8A 7ICNA 1G17A 4AMVA 2J5RA 5KTMA 1L5UA 4YMIA 3H86A 2ZUEA 4MQFB 4B33A 1UDAA 3HUEA 5JSFA 2JD1A 4H4DA 1IHYA 3I12A 4H16A 2Q5JA 4K6FA 3ZY3A 5C8ZA 1UXHA 2G08A 3CSUA 1CZUA 2V74B 2FQQA 2EFEB 2ADOA 1IOWA 3I2IA 8ICEA 3QSGA 2H5EA 3KYIB 2GERA 2FZKA 2R1UA 3IAM6 4LYYA 4MTLA 1R0CA 2UZ1B 5AJYA 3HYLA 1DU4A 4MRPA 3BIJA 3KTFA 5LQUA 1YOVA 1OLOA 2NZXA 3EUWA 5TT1A 3THYA 4J9SA 5F5XA 4BX3A 2JFGA 3OQOA 3R09A 2HWYA 3NQ41 5LZ8A 2QAGC 3NTQA 4PR0A 1GR0A 1D09A 3KJFA 3OM9A 1RJ9B 1JL3A 4Y9UA 3PV8A 4N0PA 1P6XA 4Q47A 2KZZA 1O5IA 3TJMA 2AZMA 1VHDA 4MVJP 2QT0A 3AJAA 4MR7B 3Q7SA 5JQWA 2ZIFA 1FP4B 1WKVA 3PPWA 1BN6A 1Y1LA 1IXRA 2Z8YM 3ABRB 4AUKA 3GK3A 1AKNA 4FOPA 1V43A 2IUSA 5KFKA 3ISVA 4AP5A 1C9EA 3GQBB 5HHTA 3GCZA 2RBKA 1DCMA 2QTWB 4YRNA 4PIVA 5JXGA 1O94D 3LDUA 3ZY4A 4EQZA 3VPHA 3IM1A 3F4KA 4FWTA 2ZDHA 1D4FA 1Y89A 2ZIEA 4ZCSA 1JJIA 4NYIR 2DFKB 3L01A 3HN6A 2A5FA 5I7RA 5L8VA 4P4MA 4MR8B 2MA1A 4AVYA 2Y9UA 2A5LA 5J0TA 4FHFA 1JKFA 4LXQA 3KQPA 4L76A 1J8YF 1US8A 1QP8A 2PSHA 3RS3A 2BGGA 1TAMA 2VUTA 3Q10A 3AVUA 4KSBA 3CF0A 5CXSA 3OHBA 5J23A 1QK3A 3EG5A 3KSBC 1ZWLA 4AG3A 3SHOA 2ZJ0A 3JSXA 1NOMA 5HQJA 3DE1X 3UQ0A 4B74A 4WBSA 4DCGA 4CNBA 2I3BA 4QZEA 1URPA 5KEIA 3TW6A 2CXPA 1B0ZA 5BQ5A 1PWHA 1AK9A 2Z3WA 2XXJA 4UEQA 4A3SA 3JQFA 5ITSA 4RTPA 2EZ4A 3ISDA 2J3IA 4JENA 3W7VA 3PQ8A 4HLUC 3LWNA 1PR2A 1ZQ1C 1UXKA 2DRIA 2VJBA 3DHWC 3QIAA 3WMRA 3F9RA 3H4MA 3OO1A 1P2GA 3JQCA 2G1UA 1IRXA 3JD2A 3IVGA 3KHUA 3A4VA 8ICYA 4M54A 4F6RA 2VQFB 1EMDA 3L1KA 3OEWA 3V72A 2RH4A 2ZZMA 1MV8A 3A1VA 4LDRA 5C1IA 3RSHA 4QWMA 4BAZA 3D7KA 3JPTA 4R8UB 1Z1BA 2WJ6A 3MOGA 3NBKA 4IH9A 1KERA 2YWBA 5ALLA 1MTZA 1A3CA 2H6EA 3IP6A 2OQVA 2CVPA 4TLAA 3DVAA 3QV2A 2V54A 5EPUA 5F51A 4RY2A 1QHIA 3N05A 2MSKA 4TRRA 3HJCA 5KTOA 3KUXA 3TLXA 1ZQBA 2ODNA 4LJKA 1RHJA 1DQYA 3ZBUA 5AIAA 2DQZA 1X13A 4MWDA 1X8KA 1DQZA 2BD0A 5I3ZA 5IFLA 4B9MA 2D5IA 5F9NA 1SN7A 1BVRA 1Q7BA 1E79A 2ZAIA 4MAMA 4LDQA 3ZBPA 2EIHA 4OGFA 5HJ5A 3DB2A 3HCAA 3OWXA 2FSHA 1MX5A 3HUFA 3B6IA 1JE1A 3AFNA 3LA8A 5AK4A 4W8GA 1TK2A 4I36A 4KE7A 1ZQAA 1BW9B 1C3VA 1THMA 1YZFA 4PLWA 5HR5A 3FKSD 3N74A 3SM3A 3BB1A 3V1TC 2FQ1A 3WXBA 3RRMA 1WV1A 1QQ5A 1X9WA 1JN3A 1QVWA 2SBTA 1RWKA 3FPAA 1N7GA 4QYSA 1FLNA 1ODSA 4X7MA 4EELA 5JWOA 3U39A 3T5KA 4C8OA 3R3VA 1CDDA 3BAFA 4LV8B 4PC3A 3NEJA 3V8VA 3ZUGA 1QIGA 4RQMA 3R3JA 4DUGD 1J39A 3I8SA 4JJEA 4E5SA 4F8JA 4RDXA 3V2HA 1P7ZA 5CFOA 5DYGA 4ZEXA 4UM5A 3MCZA 4JLPA 3W9SA 2P1RA 4RPZA 1LA2A 2P8JA 2Q1TA 1J2YA 2VP6A 4KYTA 1CF2O 1VA4A 2YXPX 3WYDA 3NOOA 4S1NA 4D98A 1BDIA 1BROA 2OGTA 1OQAA 1N4AA 3GJ0A 5FBKA 3ZNPA 4UZSA 3MJSA 4K46A 3VR5H 3KXLA 5AVYA 1IFXA 4H7DA 1QH9A 3G89A 1QR2A 4BMCA 1T8EA 1D1SA 2PJUA 4PBSA 4J7XA 4Z2YA 3AJEA 3MCVA 4CI9A 4CLXA 3SK0A 1N6OA 3ZJ4A 3CF4G 5F7XA 3SIRA 4A5OA 2A7XA 4Q6BA 3ITEA 4C0QC 3OURA 3QMWA 1DI0A 3CMMA 1L4EA 5T64A 1P7CA 2PKQO 5EKSA 1L7RA 4MCJA 1TAGA 1LPBB 4C07A 3EVAA 2VJMA 3NAGA 4BBZA 4DIKA 2OL4A 5A06A 2IS4A 4O4JA 3E9EA 2C0CA 4I29A 4UVDA 1GTSA 1KMHB 3EMBA 1EBFA 4UHKA 3AUXA 1EBBA 2A1AA 1MORA 4HK4A 2DBYA 3ROXA 3RYHA 1KMCA 3GRKA 4LMPA 3M7IA 5EIOA 2W6QA 2BMAA 4PYMA 4UMEA 5DIZA 1Z33A 4BXOB 4BFCA 5FNZA 1WZ2A 1VJDA 1VSQA 2RGNC 3BSYA 1NVKA 1ZK2A 3UAOA 3ZHBA 5IG2A 2PFSA 1ZPDA 2HOQA 2QL5A 3NBMA 5AXCA 2HBYA 5AXBA 4D44A 2H1HA 1GO3F 4F8RA 2JBAA 1Z6PA 4TS4A 2Z3VA 4ZREA 4QJFB 13PKA 2B4TO 2EYUA 4JVMA 2NSYA 1Q0UA 2FW6A 1UXJA 2XT9A 4MIYA 5KYXA 1EB9A 3AF4A 4W6QA 3RFVA 3D3WA 2JLBA 3STVA 2LI6A 2NXEA 1CS0A 3ZCUA 4NJ8A 1U3UA 4CQMA 1X77A 2IF0A 4FBTA 1P1JA 2Q1SA 3RH4A 2QRKA 4WZBA 4CLDA 1E2HA 4ZT6A 1UJNA 4ZCQA 5J2CA 3GT4A 4D9FA 1K89A 2QRPA 1JEYB 1XAIA 3TEJA 4ECUA 4ED7A 3RC2A 4EOGA 5KYTA 3ABIA 3WRYC 1N5WA 4FDVA 1LK5A 1V1MB 3LQ2A 4Q3DA 5AKHA 2EJBA 3HSYA 4TTPA 4EAQA 2SCUB 4R0VA 1PE0A 2QY6A 3SR4A 1MF7A 1ZK0A 5JZBA 1IG3A 4ISCA 3EZFA 4WPGA 5FEUA 3SJUA 3B38A 3MINB 2N42A 4F5NA 5CR0A 1OY1A 1YBVA 3NV7A 4BNWA 1TF7A 3NALA 4TRMA 5ESDA 1R6TA 2A3VA 3QVMA 2FRVA 4KDFA 4QZHA 1K7XB 4HH0A 4DKJA 3OZIA 1HDRA 1NBOA 2NW6A 2QX9A 4FOOA 1FEZA 1L5LA 4BQRA 4WN3A 4CMJA 3CNOA 4KR3A 1WABA 3PJFA 4G9EA 3MB5A 4GS5A 4NMMA 2OA0A 3S2IA 3KTOA 4BQSA 4CKXA 5B4TA 3RYCA 1NJ5A 3HSKA 5K0JA 1FTSA 1X2IA 1OYVA 3RS4A 5DYYA 3AFHA 3O2JA 1UXIA 1ILWA 4YJHA 3QI7A 4EEXA 3KKMA 2D7CA 4OJ5A 2DHRA 1M8JA 3FGNA 4ZVMA 4FEGA 4CMHA 4FB5A 1WMAA 1WUIS 3II6X 2NUAB 1UBGA 4MVJD 2QRVB 2VEOA 3LQRA 2UV8A 3OF5A 4IICA 4L8VA 4D9CA 4EUSA 2VTBB 2BZSA 2R8PA 3HBFA 3DM5A 5J4LA 1YBFA 2ZYWX 2H5IA 1CJTC 1GG2A 1LFAA 1OGIA 3IOMA 2MYNA 3E6AA 2NWQA 2B4KA 1TK0A 1U28C 2BP7A 4PANA 4QG7A 4UEWA 4HVCA 2AOUB 4YRJA 1RG6A 1GAJA 3KVRA 4H77A 4X84A 3MYRA 2F1HA 2PVSA 2RAFA 2Q41A 1QE5A 2WVGA 2ZSHA 3A58B 3CPJB 4EGJA 1ZC3A 4XCQA 4QWWA 4B5LA 1ZBDA 5ALXA 3ND7A 4TX1A 4BO6A 4NU8X 1BAPA 1BN7A 1C7JA 1H6CA 3PYXA 2WHEA 3AL0C 5BYAA 5G0TA 2Q3CA 1GYPA 3HB7A 1QO0A 4I2GA 5FYQA 2OOKA 5KFVA 1GG5A 2IGTA 2G8LA 2JEFA 1Z06A 4IIDA 4KG7A 4U7GA 3T99A 4DL6A 2O0HA 2ZULA 3NS1A 4F5QA 3PQ2A 4NDNE 4EY7A 2VA9A 5LDDC 5KPDA 5DJ5A 1THTA 1CFJA 3Q3CA 7ICRA 3D2AA 5I51A 2SCUA 4BRWA 3EVCA 1E9VA 1M34E 4MJXA 1ZSVA 4NDAA 1CWUA 3UT6A 1PQPA 2GXSA 1NJ1A 2ATLA 2F90A 3NP9A 1MFZA 1QUFA 1LV5A 4OI4A 4Z0NA 3WL3A 1SG9A 2W2KA 1AU9A 3MGBA 3U60B 1F14A 1XDWA 2P1ZA 3QVGA 4C4AA 5AK6A 1FRNA 3N2NA 5KMGB 1Y9DA 1ATZA 2BMFA 1B23P 1QGUA 5DX0A 4Z4GA 4D3ZA 4BV8A 4RQ2A 4ND2A 3KFXA 2P1DA 1Z19A 1KDOA 2ONCA 4JT8A 1PS8A 3PUWA 1TFRA 3O90A 3QJGA 5K3CA 3RRXA 2VSNA 3OLWA 1XSEA 4CMIA 4D1YA 4U2EA 4B6GA 4BP9A 2C1XA 1HMPA 4YIKA 4K6CA 3VZBA 5FO1A 3SHQA 3A1UA 5B1SA 1E3SA 2X0EA 1L5KA 5KT5A 4ELTA 3WLFA 4U7CA 1KZ4A 3PKIA 1OXJA 1FFAA 5SYMA 3OFVA 4B5KA 3R77A 2ZIXA 4AT1A 3KLPX 5DQIA 2FUCA 2QTRA 3O9VA 4HKTA 4EUEA 2IL1A 1NXQA 3MN1A 4UAGA 4IUCS 3O4IA 2PUWA 5DCLA 4ENVA 3GF4A 3NFYA 4LA4A 4ALMA 4DF4A 1QLNA 1I51A 1IZ9A 3LNTA 3WDLA 5H16A 4DSFA 3R3YA 2XUJA 2OLKA 4ODIA 2HH9A 1O96A 4ZICA 5JC8A 5C80A 2JI4A 2R00C 4FQ7A 5KNCD 1ZD5A 2EANA 1CR0A 1JBKA 4QTUB 1J2MA 2IZ1A 4LNUB 4NAUA 3TFWA 1P4RA 3B1YA 2XWPA 4YCNA 4L5CA 4JYAB 1N2XA 5FO0A 1RYHA 1PR0A 5B1DA 4YV7A 4YUWA 1JJFA 1TMKA 4RHXA 1QIKA 2JLAA 3C70A 3HP4A 4UE6A 3TX2A 2Q45A 3PHGA 1Y98A 2X13A 2XYVA 1E0DA 1JXMA 5EJ6A 2DPYA 2XUHA 3GCGA 1H0KA 4WVFA 2BGTA 2EDAA 3PNLA 4JNCA 2R66A 3C41J 5DG9A 3PQ4A 2DBVO 2XWJI 1KNXA 5DHUA 4BQQA 2VI5A 3AK4A 2FPIA 1KXZA 2A1TS 3NBQA 4KGZA 1K0FA 3ZGNA 1VMEA 1RXIA 5SZKB 1GPDG 1AE1A 2OK7A 3FSRA 4FOTA 1OHHA 4RVSA 5J4KA 3DCYA 2BJVA 1AKMA 5ALYA 2W2VA 3P9IA 4RUCA 2HHUA 2W9CB 4D97A 3BA1A 4YYZA 5KKNB 1ZVQA 5G1PA 1RE0A 3ZHRA 2AF4C 3RVOA 3PI6A 4RSMA 3TZEA 1D04A 4I3GA 1W44A 3PW0A 1CS4C 1U6JA 2DSTA 3WGQA 3ZNQA 1USIA 1XTQA 2V5AA 3WWPA 2WFLA 2VNHA 2OK8A 4XIGS 5CH5A 1N2JA 1HNNA 1ZQOA 3KQLA 4D3DA 2XZPA 3M8KA 5KTTA 2RKWA 3WB1A 2L82A 4BPBA 2GJSA 3LY5A 9ICHA 2VH5R 4H0FA 3VC7A 2RJOA 3QMMA 2DL0A 2Q4TA 1OLUA 1Q0HA 2Q6IA 3IO5A 4WA7A 5DWQA 4ZVLA 5G4LA 1D6JA 4L08A 2G77B 3Q8LA 3JARB 3V55A 5DM70 2HJHA 5HBRA 1II0A 1PG2A 4YDRA 2JZBB 1EFLA 3A37A 4B2YA 4D74A 3EZ6A 2WQZA 3OLVA 3K6RA 3M1LA 3SYLA 3OZRA 1YRYE 1KYQA 1VE6A 5AVZA 4HS4A 5CK5A 2QG9A 3PJDA 3WBKA 1RHMA 4HWTA 1E5LA 1VKJA 4OHFA 5AM1A 1DK3A 4Y1FA 1CJUC 3RJEA 3PKZA 4DREA 4LZDA 1DAFA 1NFFA 1HDGO 1BSVA 4DUYB 4IO0A 2G6TA 4LF9B 3VKWA 3I9OA 4I4NA 4Q37A 1II8A 1UAGA 1NRWA 2O1EA 1E8DA 2RHMA 3SJ7A 3M6XA 5HDQA 3VKUA 1CR6A 5EIEA 3H0MB 1W75A 5CH8A 1BE6A 2XVTA 1X2EA 2EG5A 1NFRA 4FGLA 3NW9A 4C7OB 2GCGA 3QTBA 1FDUA 3SEIA 1V11A 1RZ3A 2Q8QA 1VMKA 1QHGA 4GH5A 2LCFA 1W2WB 7ICSA 5GONA 1UANA 4KN4A 1E2UA 1KZ1A 1SXGA 3IXMA 4NULA 2Z09A 4UE2A 4X7BA 2XJ4A 3G0DA 4ZVRA 5CDFA 3EPGA 3SF8A 4YMTA 3HVRA 1QQAA 3ZVKA 4JQYA 4IVNA 4L07A 3TI9A 4D8WA 5FWXA 4JELA 5H81A 2QUJA 2ZIVA 2FDXA 1WXGA 1LSUA 2CHEA 4KWHA 4IDEA 3I05A 4WADA 1SD5A 1EFHA 3SLRA 1QNLA 5EE0A 3N2GB 3OJCA 4UCQA 4JP1A 2B8NA 2X1MA 3LAWA 2ETVA 3HZZA 3QWBA 3QPWA 4FP9A 4MSUA 4C0SA 1Y3FE 2ZYAA 3FOWA 2QLTA 3R20A 5B1YA 1LKZA 3AVXA 2J5XA 1X66A 1P4AA 4GMDA 5TQ0B 3UN1A 2PCJA 3HDHA 4X64B 1H5QA 2ZBFA 4A0HA 5CEEA 1VKNA 3R3UA 2QE7A 3R7NA 1JTFA 2OT3B 4MF2A 2O6KA 1IAVA 4QHTA 4XUCA 1Q74A 5GAJA 5IAEA 5C5IA 4UAVA 1P2UA 2GHTA 3WL4A 2BZ0A 1BD4A 4L95C 2QD5A 1JDNA 5BSGA 1KOFA 3CVWA 2PI4A 1ZMBA 3SR3A 5H7XA 3EFBA 1N4DA 1ULHA 3NOVA 1ES9A 3V8EA 3AV0B 3GLUA 1XVLA 2NQ8A 4XWYA 1QU2A 2XUQA 2R8BA 1QVAA 2GRAA 2VDKB 2EHJA 3R5JA 5KJCA 4XQGA 3DEZA 3O8DA 3K05A 2J3KA 3ADKA 4YJDA 4RX1A 1U0HC 3WFZA 4F2SA 2P41A 4AMUA 2V59A 1DFGA 5CJPA 4TYYA 1Z3IX 2AC7A 2G9RA 4PLGA 4QGBA 5CA7A 1T2AA 2H1CA 3SXJA 5KAFU 1W36B 4AD8A 2ZIUB 2HPAA 4B9UA 3GDHA 2KN7A 2WYWA 3HBJA 3ISTA 4I8XA 4BWMA 3RIHA 4C2BA 2DKNA 3CCBA 5E4FA 3KHHA 3SKXA 5K05A 2G7MC 5F35A 1GUYA 1T3TA 5KG1A 1USVA 2Y1IA 2DUUA 1YQUA 4URZR 5KFLA 3O95A 4E0BA 1P7PA 1X15A 3AY0A 2CBXA 4PRYA 3H5RA 1CUDA 5EJGA 2YJZA 5DSZA 1ISSA 2GWHA 2W2XA 1ZSYA 2FLNA 3N6VA 1PL0A 3NHYA 1BXGB 1JDZA 5DLQC 4ZJUA 7ICUA 2FP4A 2HA6A 2CW5A 1RKBA 1RWPA 1X3SA 1MIHA 1RYBA 2EGHA 2N9UA 3NV9A 2WW8A 4INAA 3AU8A 3LGSA 3RTCA 3STTA 3DAGA 3O8OB 3WIBA 5LKRA 2QUIA 2FG5A 1IN6A 5D51S 1WNFA 4QECA 5WRFA 5AESA 4U2DA 4ED0A 1W4ZA 3U4IA 3OAAA 4AK9A 1VZ2A 2LW7A 4U8HA 1J97A 1EZZA 4ZPXA 3RRYA 1S3FA 1CR4A 1U8EA 3TFRA 3EA0A 2F9FA 2J9ZB 3EXHA 1Q3UA 5CDHA 2V7WA 2UXDB 3OZEA 4BQEA 1IUOA 3MSCA 3VNSA 3MTBA 4GYYA 2I7TA 5E38A 1QVVA 2PFGA 2QM8A 2XIJA 1S96A 2Y1EA 4UVIA 5DASA 2J6CA 1TVAA 1BXKA 3FAKA 5E4YA 2HBMA 4LWPA 1PGOA 5HM6A 1V9SA 5JH7F 1V3VA 3KR0A 2GJKA 4ZXFA 5BN4A 5CA1F 3FCEA 3CU5A 1OWOA 1M2GA 3C39A 2OYRA 3JR7A 3K0EA 5F1PA 3RAQA 5JO9A 1W36C 1AHHA 3EIFA 3K9BA 1KFJB 4PPXA 3W4IA 5J5AA 4Y6QA 2VYNA 3SJZA 1C8LA 3WADA 3AR8A 3MGIA 5ERXA 4OHWA 3I4CA 1TM1E 4MB2A 1CQIA 7ICMA 1XDGA 4TWZA 4TZTA 3SAHA 3G6YA 5AVRA 2R8GA 4PZEA 3HL4A 4G2NA 4JWTA 3WZ2A 1KSFX 2GZMA 4QZIA 1GQRA 4DMUB 1P8AA 3RAGA 1QGED 3BKXA 4BNTA 3OX4A 4CI0B 1ZITA 2V7TA 4H6WA 5IARA 2ZGVA 3CX3A 5IT9A 5EHGA 3VVBA 2VP5A 1QMPA 2BHSA 3AI7A 1YZGA 1O8BA 3I9FA 4UNQA 2I1WA 5DX8A 2WQ6A 4B80A 1RU3A 4XJXA 1ENOA 2Y0BA 1C1DA 3D2NA 1UBFA 2OCPA 3GBSA 3Q8RB 2WIJA 1VPVA 3QFCA 3JASA 1PCXA 4O5AA 4OOEA 2H3VA 1R0ZA 2PD3A 3OZTA 3K75D 4JLMA 4WXHA 2G8NA 1MC8A 2GN1A 4LY0A 4YASA 1OH7A 1YNOA 3N6XA 1IZ7A 1QSLA 2XEXA 5HJEA 2TYSB 5IFKA 2PUDA 2HSJA 4DXHA 1EGQA 4PRKA 3ZPXA 2DGZA 4C6SA 2MOKA 2W7PA 4EI7A 2D0DA 5CVDA 3GPIA 2RG1A 4YC7A 4Z3OA 2PX8A 5B66U 1C0EA 2FZ5A 1OWMA 3UWKA 1VGVA 5JSZB 4XXHA 4Z4HA 3E82A 1YUNA 4JVLA 3OKAA 5KQPA 3DJFA 2O1SA 2P0AA 5C4GB 2SECE 2X2FA 5FNVF 4DEXA 5KDOA 3BILA 2O54A 2FPLA 2FCAA 5AK3A 1USUA 4XPIA 4R8KA 1R2QA 1KSGA 4ED1A 2IUFA 5LJLA 3FTEA 1HT3A 2X0JA 3U4GA 1MDFA 4EZIA 4DLRA 2PBFA 4U6SA 2C9DA 5HS6A 1FRFS 4O3QA 1NA5A 1GCAA 2PGAA 4KOAA 4QA9A 2F44A 2MCFA 2VRWA 4WGFA 5J8YC 1AKWA 4G8DA 4XB2A 5ESXA 4EYGA 5HXAA 1RQRA 4HDMA 4AAYA 3N7SC 3ICPA 1SV4A 4GOKA 4MV5A 5HJ7A 2WJVA 1SQGA 1OI4A 2A1UA 1PJSA 5J0OA 1UK6A 3HHPA 3D4LA 3WY9A 2Q27A 4B3HA 2NTYC 2PA0A 3TINA 2R68A 1BOOA 5EVCA 4OHBA 2HO5A 1XNHA 2YV5A 4J07A 4Z4CA 2XKAA 1QTQA 1WWVA 2A67A 4EYKA 4DCTA 1E64A 2XGQA 2JRLA 2QN9A 1OFVA 1NLUA 3G0HA 1GZUA 4FGWA 2AEEA 4FR0A 1P60A 1I32A 4TVBA 2GYYA 3IDOA 3NS7A 3T34A 2IC5A 2YZKA 3UJCA 1DCTA 2R47A 1ZNYA 1MN8A 5KX5A 1YUBA 4V0KA 3ZXUB 4CGZA 3GRRA 1JJBA 2LPMA 1O95A 3AU6A 1S0MA 2C5GA 2P2NA 2VJLA 4GX1A 4R6WA 3UH0A 5I4CA 4M9ZA 4EG5A 2BBOA 1QBGA 2V3VA 2ZVDA 3E9ZA 3GGJA 4FI3F 4MS1A 1OBVA 4E31A 5ESRA 4Z51A 2C95A 3L7BA 3GWZA 1M2NA 1V3UA 3HJUA 2QSZA 1A95A 4IJUA 4GKJB 1Y6FA 1GJRA 3ACBA 1KPHA 4HQRA 2QJRA 1FVFA 4K9RA 4M0FA 4P08A 4PLPA 2D8AA 4L28A 1LEHA 4ESEA 1TA0A 3MJRA 3NORA 1W4LA 1PEAA 5D2CA 4KITB 4O33A 3RM3A 4MJ7A 2Q2WA 3NP7A 5EXXA 3WQRA 1KH2A 3QVSA 4OXYA 1FSSA 1R8SA 2XMZA 3KSAC 1JXAA 3R6DA 5DV9A 1TXGA 3HE3A 3TKLA 4R2XA 2QQGA 5DNYB 1T1IA 3GA0A 5THKA 3IEMA 1ODIA 4YD1A 1TK5A 3AW8A 4RKQA 5GOTA 4A0QA 1L4NA 3LT1A 4MQBA 4CKYA 1N9GB 2P7IA 2EX0A 3EAFA 2FWNA 9ICWA 2G71A 2PAAA 2X9GA 4HEA1 3IIJA 3OPVA 1F0MA 3ZWDA 1FIQA 1X1QA 4LQCA 1TKBA 4F50A 1KXJA 1DQSA 1ZM3A 4KMRA 2JH1A 3MQFA 3AX6A 1FX0B 3UA4A 2QVCA 4ZZ2A 4OMFG 1H9BA 2C1ZA 3D2SA 1KTQA 1BH6A 1OSNA 3PCXA 4IIVA 4I9UA 4U1RA 3BDVA 1ZO8A 4A16A 2GZAA 1L8XA 2BFBB 1DVRA 3GLFE 1CBUA 1SPXA 3BJEA 4MVJG 3QVOA 4I1SA 4C6RA 4BU1A 2VQDA 4ER7A 2B34A 3SZLA 3ST7A 3VTAA 3S99A 3O1JC 5GADl 5IK2A 1FLVA 3SQIA 3GNTA 4MUBA 3ZU5A 1MJNA 1EUQA 1KOGA 3D0KA 3CIOA 3B6JA 4JUBA 4P4GA 1XRMA 3WISA 1XPOA 1TEZA 3UC5A 4A8TA 4F5RA 4CCAA 3RIYA 4POOA 2B8EA 3FIJA 4YS6A 5FPHA 3VYSB 3ZWCA 5C1BA 3ZI0A 2I91A 1KO5A 1XK7A 2A78A 3GP5A 4ER3A 2QB0A 4D6YA 5LQAA 4G4IA 3BK1A 5FH9A 1Y88A 1VL2A 2CZGA 4FTWA 3EJ6A 4QGAA 3I58A 2P9CA 1X92A 2FNAA 3TXAA 3EIHA 1LZLA 1VFNA 4JJ6A 5A4FS 4CPDA 1MZPA 4YAJA 4IWXA 2E1FA 4QUBA 3RFUA 4A9AA 4TKUB 4ERXA 2IFTA 5DSXA 2LIVA 4XDYA 3H9GA 1RM0A 3ADBA 3GFKB 5J2GA 2HVHA 1ISFA 3PGA1 2PN1A 4MGKR 4ND8B 2A9QA 5L45A 4RNMA 1WO8A 2O3JA 4GI3A 5J2UF 2C99A 3IULA 2GPBA 5KFFA 1E61A 1G1AA 2J5KA 3PNSA 3T0IA 4M89A 4N5LA 3R5SA 2N47A 3QOWA 4H2DA 2WFMA 4XQ0A 1FSGA 1FXWA 1JTVA 3G1UA 4DDVA 1SD1A 4CT0A 2AD1A 3OECA 4Y7CA 3IT1A 5E9WA 1AMUA 4XRHA 1DDIA 4MARA 3HJEA 1W4CA 4QYIA 2WAMA 4GPZA 2JLRA 5T41A 3E18A 4F56A 1YU9A 8ICUA 4YRSA 1BGWA 1IIRA 1VLZA 1XR3A 2GEJA 3C3PA 2VUHB 3E9YA 1LB2B 1VJCA 2PKCA 2PU5A 2G1AA 3P9SA 4R2IA 4Y9SA 4Q48A 4QEKA 4BLVA 2ZSDA 2ZBGA 1E5DA 9ICIA 5AM5A 8ICLA 2ERXA 4MDEA 1TGVA 1LLQA 4BEVA 4REOA 1Y1QA 1T0HB 2E49A 2VJKA 4C08A 1WXXA 2CXUA 4EJSB 2LRHA 3B36A 3ZW8A 2CLHB 1L7NA 1QPGA 2O7QA 2VT7A 4P4SA 1FFGA 3RVBA 3MIIA 1E66A 4RQ1A 1KC1A 2YTZA 1W25A 5K01A 4OLFA 2ZSBA 1Y0BA 3KQQA 2PUBA 3UHJA 1DKMA 4ED6A 5K09A 5E3HA 1ZYQA 4ZRMA 4OBXA 1A8HA 2BCJQ 2VPXA 3IQDB 2C7RA 2B7LA 2V1XA 3DFFA 3CWCA 3GNSA 2OHIA 4L9SA 5LP1A 3W8NA 3FVRA 3Q6MA 3Q2KA 4LISA 3UJ7A 1R9NA 3DEFA 1SVWA 1VL8A 3T3GA 3QE9Y 1KKUA 1GUDA 2MINA 1KO4A 2P9YA 3A1CA 4UTOA 3O1IC 3T1TA 3VPFA 3AONB 3TLKA 2Q5HA 1R0XA 1UMCB 3GGDA 4DXDA 1VHJA 5JSUA 2C7OA 1SCKA 2XTZA 4LYHA 2G4LA 3E1SA 3WQSB 4CEHA 2LD4A 1LB1B 3ZYZA 4IQFA 4K81B 2AXEA 3QXCA 3RK0A 5LYJB 5EJ2A 5ALMA 1GNRA 5LQSA 3AR4A 5JADA 3PL5A 1T4CA 1T5TA 4M60A 4WN9A 3DMDA 5FWYA 2VTDA 4BASA 3HGTA 3IIMA 2FMKA 5J2TB 5FNVB 2VWHA 3H1FA 4MQ5A 4HNSA 3QVXA 1KZ7B 1WSDA 2OZVA 3BQ1A 4K9KA 1DEKA 2DQSA 3WWEA 2QUKA 4XIFA 3DR3A 4QWCA 2PL3A 2OP0A 2VJQA 5CUQA 4DDTA 3HDJA 3ZOZA 3NNSA 5I45A 4Y2YA 1P31A 1B00A 1WPGA 3ZXSA 1RDFA 3BM5A 3ESZA 3HZHA 1XQ1A 1JT9A 1QGAA 3N0VA 4X1OA 1FXSA 1OH8A 1ODKA 2ZS9A 3UOAB 3GB9A 2QPLA 5TZVA 3WTCA 5IKPA 4FFLA 1IY1A 4MNTA 1PR1A 3WXMA 4NHOA 3GBVA 3I04M 4WWHA 1N3BA 3C3WA 5CRXA 3CINA 3GUYA 4I99A 1G41A 1C7RA 3C1TA 4I50A 1XCJA 3L02A 4JI1B 1IBKB 2PQMA 2O8BB 1VI2A 2B30A 4M1ZA 5JROA 5FORA 3ZWBA 2G5HB 3NBYC 1ACLA 2ODQA 3NXKA 5A5VA 3SBOA 3KYDB 2R1TA 2Z1NA 4CHTA 2IS2A 1ZNZA 2RDMA 4FFMA 3WGLA 2D00A 5C2JB 2WJ4A 4L78A 3WHLA 2ID7A 3MCUA 3F98A 1RRKA 5MDHA 3EZ9A 1A9XB 1Q1GA 5BVGB 2H2AA 1PJBA 2FQYA 3QLJA 1XLUA 3IBGA 5FOUA 2QSYA 4DIOA 4WKCA 4JA0A 2Q3MA 4CIBA 4MHVA 1VQ1A 1EDDA 1W4BA 3BIXA 1OV4A 4Z9YA 5C8YF 3CLUD 2IBTA 2UUBB 2KP7A 1D2HA 4O3SA 3KUUA 2ZRIA 5KI6A 4RENA 1DXSA 2V6IA 3PDIB 3ILSA 3RAXA 4PZAA 3CSSA 5T7BA 2AHOB 4H1WA 1H2HA 3ER9A 3G68A 4AF8A 4PZYA 5JCZA 1K9VF 2A0YA 1ECPA 2GO7A 1GKIA 2I9KA 3IAFA 5ICSA 1ZQTA 1KL7A 1N60A 1Z12A 1VSUA 3HCEA 3OLYA 5CBPA 1YFKA 5KNIA 3KCQA 3Q85A 1GQYA 4HADA 3ETDA 1SUEA 1PFWA 2WWVD 3VU3A 4TL9A 4GM1A 4XWGA 4M6WA 3HDGA 2NUPA 2ORED 2ZWIA 3JQ9C 1QLJA 2OLJA 3JZIA 4GPD1 4PGFA 4A92A 1Y8CA 3HFGA 4ZFNA 5HCUA 5U9CA 3ZV7A 3AVQA 4A2QA 4JU9A 5DSTA 5LWQA 3VI4B 4KFUA 4OYRA 1YZUA 2D54A 1R0SA 2R1ZA 3LDHA 2HYIC 2CHVA 4Y6PA 1K7YA 4XEUA 4G36A 1Q2XA 3RT7A 5HIKA 3RUEA 1B42A 3ANSA 2F2TA 4M9HA 3TSYA 5ELXA 3PBKA 4PX3A 2AD5A 4M9UA 1F5NA 3I1FA 1P1IA 2VP3A 1I6LA 4JI2B 4HP8A 1ISRA 5IMBA 4Q7MB 2DECA 2GAJA 3SI7A 1KI6B 2YQEA 3TOSA 3EYAA 3N4MB 2BPCA 3JARA 1H6AA 1NU6A 4C30A 3GJRA 4OGLA 2VF4X 4UU7A 3KT8A 4YR9A 3QVJA 1RKXA 2GX6A 3OPYI 4BVFA 3WLKX 2IV7A 1RW4A 4UBNA 4RF2A 4L4SA 1DBVO 9ICQA 3X2EA 2CMGA 2P78A 4IHJA 1V4VA 5FBWB 4C0XA 1RXVA 4F11A 4CG0A 3ASZA 1OXKB 4BFZA 4EB6A 1FMTA 1S1MA 2G4VA 2BEJA 4QXOA 2NVWA 3VGPA 4BKOA 4YRMA 1QU3A 4LHEA 4RK5A 2QVLA 1FFHA 4FKMA 3W7AA 2QARA 2VSFA 2PMEA 1DINA 3A9UA 2WJYA 4M0KA 3AF6A 4CV0A 4D8XA 2WTEA 3IGFA 4WASA 2XCRB 4PF1A 4ETIA 5DHTA 3LO8A 3L4PA 1W581 4IY1A 4KLQA 2VYVD 3KT3A 3EQ6A 4PG6A 4QOEA 4RETA 4Q0MA 1M72A 4IDBA 2BFAA 2NPIA 2YJGA 2LVBA 2VDOB 4YJFA 5JMTA 2PRYA 1TF2A 1TW3A 2V7PA 3GRYA 3NRCA 4BLOA 4JUDX 3BXFA 9LDTA 2I54A 2VDWA 2P9HA 3T5LA 5JCOA 1ZJJA 1EUDA 1WWKA 4ZVSA 3R5FA 3HEMA 2WMNB 4E22A 1YK0A 4GEKA 1W93A 3O1HB 4KFRA 1JHPA 2MSNA 3C23A 4UAUA 2XY6A 1A2OA 4P22A 4WKNA 5J3JA 1A9PA 1G7CA 3RU3A 5KFAA 4AKHA 2GPYA 2WD8A 3F71A 4PV7A 5I8PA 4FYYA 1M2JA 2DWUA 3TW8A 4BJ5A 3NASA 5DGHA 4ZC8A 3IPRA 5LUAA 1T36A 4B9LA 3IN5A 1EVJA 1UHUA 3M1IA 3OOEA 4LVUA 5AM3A 3T15A 1MABB 2FW0A 5C8XA 5IULC 1ODLA 1YQTA 1OWPA 3PR1A 5D1HA 3DLPX 3UMSA 1W4AA 3CLSD 3W2FA 3U4MA 4GBGA 3F8SA 3MDCA 3MTAA 4V38A 3UMVA 1GZHB 2C96A 4ZGWA 1U3FA 2HHVA 1Z7YA 4QZDA 1C7FA 2WG2A 2YFYA 1EK1A 1WQ4A 3DB1A 3LUJA 4K2AA 3DCNA 4R1SA 4B83A 5AKZA 5C34B 2J4FA 2XH8A 4CLRB 3AUSA 3OETA 4ISBA 2CHGA 5THQA 1OFTA 3CUTA 5CLJA 4KTQA 4ZHSA 1Y81A 5KQSA 4PNEA 3L49A 4IG9A 5MFZA 3ZE8A 2WTNA 3HS3A 2PFKA 1EWKA 3OZUA 4GX5A 121PA 1J0XO 3C5GA 1B4DA 2IYAA 3G9QA 4XLLA 3SX0A 1CY1A 1DB3A 3WGGA 4BZZA 5BQFA 2JBWA 4BVJA 4BCBA 5BV1A 5KZMB 1RJWA 1WMDA 1I2BA 5IM5A 2WIAA 1I3OA 1EG2A 4C5AA 1L3IA 2LHTA 1H94A 1YI8A 5IINA 1Z3EB 4RQ7A 1P75A 3D0QA 3PK0A 3DCJA 1UPTA 3H84A 5AQ1A 4HCJA 3LBNA 2GAOA 2QGNA 3S2EA 6YASA 5A9SA 5LQNA 1HDXA 4PBRA 3P9PA 4X97A 1TTTA 4LVOA 4IGKA 1UL1X 1CUWA 2X4GA 3NKVA 3TBFA 4X6XA 4I2BA 1RC8A 3GLHE 4G67A 2LPEA 2NACA 4MP8A 3S40A 4FFRA 5JW6A 3QBJA 3HB1A 4K05A 1JWBB 7REQB 3ZBTA 2YQZA 2WTMA 3M9WA 1NOKA 3OZGA 5BQ3A 4I1IA 1DQPA 3CUVA 2HPZA 2X1HA 4ZOLF 3QVTA 1XKLA 1F0KA 3GUVA 5BURA 1UBSB 4FEEA 4RVNA 1MO5A 5J0YA 1JG1A 4CKCB 2G76A 4LRQA 4G86A 4I6JA 1KJJA 1CX9B 4MUNA 1RE1A 3KQSA 2CK3D 2ON6A 4V0LA 1BXRA 4NE7A 1JSZA 1JFTA 1XNRB 1Z2CA 3DBOB 1G9SA 3FW1A 2EFCB 3RS7A 4C2AA 4C7KA 2W2NA 3OT1A 3Q9NA 4RULA 4YRLA 3OGUA 4BNJA 3EUAA 3M0EA 4ZT5A 2A0WA 3M2PA 3EPLA 2O8FB 2VPTA 3DZ8A 4D3SA 4RLFA 4S1OA 1J25A 3U5TA 4GGOA 1P2BA 2QTVA 2QTHA 2AN4A 3PNPA 4GR9A 4X1YA 3L8ZA 2G17A 1O95D 4X1IA 3RF7A 3IOYA 2IHKA 4C29A 4B44A 1QRDA 3KSMA 3L82B 3NNNA 1C4WA 4R9RA 5TF0A 4BNNA 2VDVE 2O7SA 3AL2A 2ZIWB 2IPAB 3HVIA 1RCTE 4OK6A 4E2WA 2KEYA 3PXXA 1UKCA 5DB4A 4CR7A 2Z57A 5EWMA 3ANMA 4MRMA 2BI8A 2PZEA 3IMCA 8ICAA 4J2HA 2BR4A 5L3RA 5TNXA 4RSGA 3GQBA 3KE9A 4X8HA 4BP8A 1CJVC 5CIWA 4WL0A 1OKKD 3QHQA 1OFHA 3MFIA 4S1VA 3OESA 1G7TA 2DH5A 3AUUA 3M6UA 3C98A 3COYA 1U0TA 1FU4A 2XYQA 3QU9A 2AFRA 2ZVQX 3VR6D 3NFRA 2HU2A 2XNJA 5IJ0B 1P0CA 3VR6H 5D84A 3ZLVA 1ZESA 2YQ5A 4L0CA 2DCUA 2JIDA 3ZR4B 5DISB 4YQFA 2BM9A 2QD1A 1U5AA 4ER6A 2ORVA 2DQKA 2X8BA 2NSJA 3KQMA 4C6HA 3TG8A 4YY3B 1NNEA 2V9ZA 1MO4A 3LQKA 2IZZA 5A7FA 1IDN1 1EFRD 3C7DB 3GFFA 3MGGA 4AURA 3PKJA 1G63A 3TI0A 1OZGA 4OY3A 4Q01A 4BVAA 3KFLA 5C5EA 1E2NA 1HSZA 1SL0A 3LO5A 2VYFA 5A9RA 1GRVA 1GVNB 2QVZX 3BXEA 5CMLA 2W4IA 4TGLA 2GASA 4ZIRB 3JWEA 3SF0A 1KFSA 1IY2A 1QHHA 4GSLA 2WTUA 3R7WA 1XTRA 1RYFA 2DTEA 2OFPA 4WGGA 1BKSB 1L4LA 4YALA 1VKRA 3TTSA 3VJKA 2C2YA 2BJWA 4HTAA 4KXYA 2PRSA 4CIWA 1G5PA 1INLA 9ICSA 1IIPA 2PL9A 3OT1B 5FPYA 4N47A 4GZLA 2FMPA 3R40A 4CIDA 2GR9A 4FZLA 3N6RA 1WBJB 5EJEA 3BB3A 1VCNA 3EY9A 1C3OB 4M36A 1NTOA 5IYZF 2XMDA 1TZBA 5F7ZA 2O0JA 5EJAA 4D26A 2GCNA 1EI9A 2E6KA 1NW3A 4PQRA 4NP6A 2NZJA 4HEHA 1EP3B 3OWHA 2FF5A 4I14A 5LMNB 4Y1RA 1K86A 2Y6VA 3H1AA 4YX9A 5IS2A 2XGPA 1FSZA 4WXRA 4EUFA 2CRXA 3ABOB 2HFJA 2QUBA 2A1UB 3V6MA 3ZVNA 1HDEA 5E6SA 3I64A 5KQLA 4TMTA 4G97A 2JCSA 4I66A 4LFCB 3DE0X 5ILGA 2H1IA 3GMSA 4J4HA 3EGCA 3TM5A 1L7BA 3G2JA 2IYWA 1N48A 3SDZA 3VNUA 4C2UA 2AW3A 3SIXA 4B32A 4DJ5X 5C31A 3T7SA 2FMSA 2ODBA 1DC8A 3G1TA 1HTTA 1HL7A 3JTMA 2PVCA 4G25A 4ILEA 1F51E 3GIKA 4DA7A 3FPHA 3G2MA 5DHQA 3OHAA 3OA2A 3OU6A 3G5LA 4G84A 1GSAA 3VU8A 4Z1OA 1V7ZA 2A0XA 1VYHA 1SU8A 4XOUA 3A9TA 5KJ1A 4WECA 4P4TA 2YBDA 3MBYA 4P0QB 2JIRA 2NX2A 2WPDA 5BWOA 3JVEA 1RWXA 1V45E 2JK0A 2XVZA 4HEQA 4Q18A 2JHDA 3W8FA 1A27A 2H0QA 1VIAA 1ABEA 1QTRA 1QVRA 3C3KA 1OROA 4FCCA 2GD1O 3Q7RA 4MA5A 5GONF 1XRJA 5A3RA 1LKYB 2CHQA 1J20A 3MABA 4Q3EA 2G9NA 1EDOA 1OI7A 4QDTA 5CT9A 1TVCA 5D5QA 1ZQVA 4DT1B 3SQXA 2OCYC 1IONA 2AG6A 2BQ3A 3ITKA 4P4OA 1C7ZA 4RQBA 4HAUA 5F2OA 1I10A 3SICE 1M1ZA 3EXEA 4PU0A 3KQKA 2MSCB 1E1QD 1MO6A 1XRRA 3I72A 4GM0A 4F9TA 3PE3A 5AKXA 4NLKA 1G6OA 2R97A 5HK9A 3AKZA 2YXNA 4M83A 2VCHA 2NRZA 4ITRC 4PZCA 4U7TB 1B8PA 1KAQA 5C5CA 621PA 4C6TB 2VJOA 3DTVB 2FI1A 4I19A 1ZJMA 2ZTEA 3GGGA 3S68A 3T5CA 8ICIA 1N9GA 7ABPA 2HWXA 3RFCA 1XN4A 3BTUA 4DQDA 1ZIPA 1SY7A 4DSKA 3S8YA 1DJQA 3D64A 2A5JA 2YV3A 4HXYA 3JQ7A 4P54A 4LOJA 4L3WA 4H1UA 2WU1A 2Q0ZX 4NZMA 3SC2A 2K2QB 2HA0A 1SKWA 3OQIA 4EW3A 5C3UA 4JCOA 1K8RA 4YRIA 2ZYTX 1W47A 1RPNA 3UXNA 3SKVA 1CU1A 5LD2C 2B21A 2PMBA 3FA2A 3OMLA 5A04A 5H59A 1VSTA 1DTWB 1N6IA 4D56A 4LKOA 4DLPA 4DY6A 1GQFA 2WM8A 2Y0SF 3DL0A