2EAOA

Solution structure of the c-terminal sam-domain of mouse ephrin type-b receptor 1 precursor (ec 2.7.1.112)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-B receptor 1
molecule tags Signaling protein, transferase
source organism Homo sapiens
publication title Solution structure of the C-terminal SAM-domain of mouse ephrin type-B receptor 1 precursor (EC 2.7.1.112)
rcsb
total genus 15
structure length 99
sequence length 99
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2eaoA01
5J8YC 1V85A 2KSOA 4MHVA 4NL9A 4PZNA 5JRTA 2GLEA 1PK1B 1LKYB 1SXEA 2DKZA 3SEIA 3HILA 2L5YA 2B6GA 2QB1A 2F3NA 3BS5A 5JU5A 2KSOB 5KNIA 2KE7A 2QKQA 2F8KA 1X40A 3IDWA 2JV3A 4PZOA 4IS7A 3TADC 1UQVA 2KG5A 3H8MA 2QB0B 3BQ7A 1B4FA 2QARB 1SV4A 2Y9UA 2KIVA 5L1MA 1KW4A 3KKAA 1SV0A 2ES6A 2EAOA 3KKAC 2ESEA 5JTIA 1SV0C 3TADA 2D8CA 1B0XA 2K4PA 2F44A 2DL0A 2KMDA 2DKXA 1F0MA 1PK3A 2D3DA 1JI7A 3TACB 5F3XB 2E8NA 1SGGA 1OW5A 3SENA 1RG6A 5J8YA 2K60A 2LMRA 2E8OA 1UCVA 2YTUA 1DXSA 1V38A 4NJ8A 2Y9TA 2FE9A 3BS5B 4RQNA 1OXJA 2EANA 2EAMA 1X9XA 2EAPA 1SXDA 3BS7A 1X66A 4RQMA 1WWVA 1PK1A 2QB0A 2E8PA 1LKYA 2QARA 1WWUA 2LPEA 3K1RB 2E8MA 4NL9C 1Z1VA 1COKA
chains in the Genus database with same CATH superfamily
2JEIA 8ICCA 1NJXA 8ICYA 3PSFA 1C20A 2DKZA 5AKZA 3UM9A 5F9NA 2W55A 5KFRA 4G9BA 4NLGA 1MA7A 5KFAA 2L5YA 2HVHA 4P4MA 3QNMA 5ALEA 4J9QA 2UVRA 5CP2A 5T14A 4I28A 3FAHA 8ICSA 5ALXA 3EZ5A 3V6KA 4UBCA 3QU4A 5AKEA 4JV0A 5ALIA 2EQYA 3PSIA 4YR3A 2XCAA 4NLCA 9ICWA 1J2NA 5AM3A 5CWRA 3RJGA 1KW4A 3QE9Y 5GTHU 2ZXIA 1SWVA 3QZ7A 2ES6A 3I76A 4UQGA 5DG9A 2ZTCA 4ECYA 2DL0A 4GFJA 4CRXA 4RT2A 1BNOA 3V72A 5ALUA 3N97B 4Q8EA 4A8EA 1OW5A 4F2RA 2H3QA 4IRCA 2A1AA 4QZAA 1RYUA 2O6KA 1XO1A 4DSJA 3ZD8A 1L8LA 4YR0A 3TKAA 1V38A 9ICFA 1N61A 4U7CA 4DFDA 1ZETA 2GWSA 1QSLA 4F72A 2MU2A 3C5FA 5ALTA 4KLTA 1PK1A 2QB0A 3H40A 2E8PA 2KN7A 1ZQIA 3JPPA 4FBTA 1UA1A 5KFMA 2YMPA 3HRDD 2FLLA 4OJLA 4QWBA 4QIWC 2K4IA 3IRUA 1LKYB 3T3FA 1SXEA 4PL2A 3HILA 3HJEA 2QB1A 7ICUA 5KT4A 4ED7A 4GC7A 4YN4A 3JPNA 4EYHB 3AL0B 3NASA 3GIIA 1NK8A 1ECWA 7ICPA 3PMNA 3SV3A 3EW9A 1ED1A 4ZH4A 3T5KA 5GTIU 4QZDA 3C23A 4RQ3A 4RUCA 4O3PA 3RAQA 3FC4A 3BQ0A 4DSEA 4NY8A 2G5HB 3D6JA 2YMMA 4ECWA 1KBUA 1ZD4A 1RZTA 2VIXA 1IV8A 2OYYA 5ALYA 2JEJA 2CXYA 3A0HU 2OWOA 3LVWA 5AI6A 5AIAA 1DK3A 5KTQA 1OUQA 1ZQFA 5ALDA 2LYBA 3T5JA 3CYMA 3GIKA 2HBLA 3GILA 4C8KA 3B9JA 2DWQA 2F8LA 2KJ9A 3IP4B 1EXNA 1KFDA 5KG6A 3JPSA 1FO4A 2ATLA 1SWWA 5C0YA 2GO7A 3Q8KA 5EWGA 3TAQA 2R8JA 3ZDDA 3AEVA 3QUTA 3C21A 5L1LA 1IG6A 4RU9A 4DL2A 3DV9A 4BWMA 3QX7A 5KFBA 4YP3A 1ZQHA 2I9GA 2ISOA 1Z00B 3UXNA 3C5GA 1WWUA 5DG7A 3MDCA 3RB3A 3K1RB 1ZYQA 5EE9A 2K4EA 3HWTA 3PZPA 2JH7A 4Z6DA 2IOFA 4J9SA 4JWMA 1Z00A 1N62A 7ICKA 1C7YA 5KG7A 9ICEA 4ZOHC 1SKSA 4Y2XA 4BJQA 3WKBA 4ELVA 2BHNA 4O9MA 2FMQA 3LK9A 3PSPA 4XUSA 3NVZA 4PZOA 4F93B 1L3UA 1UHUA 2KD1A 4F2SA 4M0AA 4B9NA 1X2IA 5D46A 2AGPA 2IHMA 3GV7B 1ZJMA 4F8RA 3M1YA 3KFUF 1QCKA 4OJ6A 3GQCA 4MFCA 5HHHA 4F4ZA 8ICWA 4PHDA 4ED8A 3FM9A 3RR7A 2KJ8A 3H0RB 3SZ2A 5DGBA 4F4XA 4YCXA 3KTQA 2KP7A 1TFRA 1ZQGA 1SGGA 4KITB 4I2CA 5J0PA 3RH6A 2J6TA 1RG6A 4C7ZA 1SKWA 3PR5B 2LMRA 2OM6A 2W9AA 1S0VA 2D6FC 8ICRA 4C4TA 5KFKA 4YQWA 4CF3A 2YN4A 2XY5A 1ZJNA 2FE9A 2NRVA 5KG0A 5AM2A 4I2HA 5KFVA 5KT3A 4F5QA 1S77D 5DLFA 2HHUA 4RQMA 4CF5A 2E5SA 2YMLA 1WWVA 2FPLA 2F76X 2JEGA 1QH9A 5AKHA 4IRKA 3F2BA 2AJQA 2KSOA 1JUDA 2GLEA 5K4LA 5CHGA 5J2IA 1KLNA 4ECXA 2VA8A 5AK5A 5IINA 4KLGA 2AGOA 1KKXA 4IQUA 5G5GA 4UAWA 3KBBA 2F8KA 4K4IA 4DFKA 2BQRA 4O3QA 1LV5A 2W43A 1F44A 1A6SA 5B66U 4ECZA 3UXPA 1N5XA 1A76A 3SR6A 2DFLA 4IC9A 1ZQVA 1Z4NA 4R65A 4UB8U 1BPZA 3OPXA 2Y0SF 3BJYA 4DQQA 3T5HA 2LI6A 3GU3A 5KG1A 1NK0A 4F91B 1NZBA 1ZQBA 1KRPA 4AP9A 2V4QA 2KVCA 3TANA 4I29A 1A77A 4LZGA 8ICMA 3EPGA 1F0MA 4CE6A 8ICXA 5AK4A 4BDPA 2JMGA 4KLMA 4KMOB 4QZ8A 2P6UA 1JXEA 5KFXA 1S8OA 4US8A 2KICA 7ICEA 2K60A 3SQIA 1L6NA 1D9DA 1ZQPA 1T3QA 3IG5A 1DGSA 1V9PA 2R18A 3OSNA 3TARA 5AI4A 2W9BA 4DFMA 4NJ8A 5KG3A 5AK3A 4R8UB 3BS5B 3IHQB 4MFAA 3QZ8A 4E0DA 4Y2TA 1P7DA 8ICAA 4F5RA 1HEKA 4CCHA 8ICKA 1V97A 4KN4A 2PFOA 5J2BA 4RQ6A 2QARA 2P6RA 2PFQA 2NV3A 4UB4A 2PKEA 4B9VA 3MR5A 4XA5A 3SAFA 4QW8A 4I2IA 3J81j 3QU5A 3M7DA 2K8AA 5AKKA 4FZNA 4F4KA 4RZRA 1ZQAA 4YD1A 4K4HA 3MFHA 3IN5A 4UB3A 4DSFA 5KL1B 4DLEA 5J2KA 1SL1A 9ICOA 1KEJA 2FJ6A 3HW8A 1QSSA 4JWNA 4M2YA 4OJ5A 4FE3A 5ALPA 4IR9A 4B9TA 3N7PD 3BQ7A 4TQSA 3D2SA 1NZPA 3A0BU 5AIBA 1T4GA 2Y9UA 4NM1A 4DL7A 4B9MA 4M47A 4XQ8A 4P4PA 4I2EA 2G06A 1X9WA 4PGQA 4TUPA 2XIDA 2XY7A 3C2LA 1X9MA 5BOLA 5HMLA 4C7YA 3PX6A 3ALRA 3PMLA 2WF8A 5AHXA 5J8YA 2P66A 4BUGA 2ZJ8A 3AQEA 1KQQA 2LYAA 1NKBA 2OCEA 4YVZA 5DBAA 3G6YA 1X42A 3FYHA 1ZRNA 1IIPA 5AM1A 3Q8RB 2AU0A 5ALSA 5TZVA 3PW0A 3AU2A 1SIJA 5KT6A 3M6ZA 4EEYA 3BS7A 4YXMA 4FZLA 2LM1A 5CA7A 1COOA 3Q8PB 2C28A 1KSPA 7ICRA 4J9LA 9ICHA 1ZQNA 4RNOA 2W9CB 5KFZA 2HHTA 1TE2A 3N7SC 2LKYA 5KFTA 3U26A 5J2DA 2B6GA 1D8LA 4YD2A 3THVA 3BS5A 4DQRA 4NLZA 5ALOA 1BPBA 3H0LB 2ZXHA 1X40A 4RPXA 2DPIA 3CNHA 5J29A 3Q8QB 2K89A 1N48A 1U4BA 2W3SA 5J0WA 4M9GA 5KFUA 2CN1A 1AQ6A 1Q8KA 2ZIVA 4QZHA 1SZHA 5AI9A 1JXLA 4Y2YA 4UARA 4FFDA 2RQ5A 2KIWA 3ED5A 4IQWA 2H3ZA 1XS9D 5KFNA 4PJ0U 2OEHA 5BOMA 1U47A 4DL3A 3H8WA 3I1YA 4JV1A 2XI9A 5B5EU 4F50A 8ICIA 3TACB 5F3XB 5L1IA 3R9KA 1UT5A 7ICQA 1FFVA 1XU4A 3ETRA 2ASLA 3F53A 1SKRA 3OHAA 2XY6A 9ICQA 5AM4A 2JHDA 5G5HA 4DOBA 9ICJA 2BQUA 3RRGA 4UAZA 3MGVA 3L5KA 3SMVA 4QZBA 4KTQA 4OCZA 5KAIU 1X9XA 2WF9A 5J0SA 3NRWA 2WFAA 3RR8A 2R8KA 1KN5A 1JN3A 1YZ7A 2JH1A 5AKLA 3PW2A 1S97A 3ISDA 4EEKA 3RTVA 7ICFA 4UB1A 5AI8A 7ICIA 1JROA 4KLDA 2KFZA 1ZQWA 1HUOA 4DL6A 4F4WA 2AGQA 2BQ3A 2Y0SC 3BZCA 3BQ1A 5KL8B 3M9NB 2KK0A 2AHOB 3BQTA 3G6VA 8ICFA 4KLQA 1O08A 3AN1A 2YY6A 3UMCA 3HPOA 5J2GA 4CNQA 3WKCA 7ICOA 3LDAA 4C4SA 2JR5A 4R66A 2HHQA 4MFFA 4RQ8A 2ESEA 2MUTA 3JPOA 1B0XA 1T7PA 5IIOA 4LVSA 1GO3F 2LYHA 4Q44A 3OJUA 7ICNA 1L7PA 4G3IA 3B0YA 3ICXA 1XNSA 2CRXA 2AQ0A 2F1JA 4UAYA 1L8OA 2ASJA 1KL9A 1S10A 4C0ZA 3H8JA 3KHHA 2N1RA 2BR0A 3PNCA 4FO6A 2W04A 5KFEA 4NLBA 1KFSA 5KFOA 2LBOA 4J9OA 1X6JA 1L7OA 4DF8A 9ICMA 1SL0A 1Z1BA 2HVIA 5J0UA 4GC6A 3KOOA 9ICCA 4PL1A 3PVXA 3NVWA 3MR2A 2CPRA 1Q46A 4DFJA 5E79U 4C4RA 4DQIA 3T5LA 5KFLA 2NO4A 5IIKA 4LJXA 3RBEA 1Q3UA 2OXOA 2RRDA 2ISPA 4BX9C 2NO5A 3VCBA 3MGHA 2ZIXB 3RB0A 4ED3A 2V9WA 2XGPA 3C2MA 1FIQA 4KLFA 2BDUA 7ICHA 3CP8A 1K5OA 2WB1F 1XSPA 1XWLA 4RNNA 3WK5A 2BCVA 3PX0A 5CR0A 2DF4B 2RLTA 2F44A 4P0PA 2KMDA 3E2EA 1ZQOA 3FDSA 5TISU 5AI5A 2HOIA 5DQGA 1KTQA 2YMQA 3TFSA 5J2FA 3NS1A 4J9NA 3ISBA 3TAPA 4KLIA 2DUYA 4I2BA 2B0CA 2H5XA 4P0PB 1TAQA 4P4OA 3H4DA 2AH5A 2RP5A 4GXJA 3TFRA 1N2XA 2E8OA 3AU6A 3V7KA 4Y2QA 9ICRA 5ALWA 3RJHA 2HHXA 1LVHA 5ALJA 2A3VA 4Q43A 4PGYA 5DG8A 3LVVA 1XO0A 2QLTA 3RB4A 1ZQRA 4QNLA 4KMUA 2H3IA 5BPCA 4QWEA 1L3TA 4EYIB 2KNJA 1MSWD 8ICJA 1DK2A 4TUQA 5L1JA 2IHNA 5F9LA 1COKA 5HMMA 2K8CB 2ODGA 2M0NA 3H4BA 4Y2UA 2HHWA 3T79A 3K1ZA 4R8UA 2DQNB 5JU5A 5KNIA 3EPIA 4JV2A 1ZQ1C 7ICJA 4ECVA 4UBBA 4I27A 4IS7A 3C28A 5ALNA 2KG5A 3H8MA 2F2AB 1N63A 5KFCA 3E0FA 4DLGA 3MR6A 4PH5A 2QARB 3K4GA 1AROP 2KIVA 2HBKA 2MRLA 1MQ2A 1TAUA 4DQSA 4B6JA 4J9KA 1ZQYA 8ICPA 2I1QA 3TQ1A 1SB3C 1Z4OA 5DKWA 4KN7A 2KFNA 7ICMA 2KKVA 5CJ7A 3G6XA 4UB6U 5CEHA 3SENA 4QZFA 3ISCA 1LB2B 3ZD9A 1CEZA 1L5UA 5DDMA 1RQLA 4QIWF 4RQ1A 2LHTA 3EYZA 5ALFA 2KTQA 5EE0A 1VJ5A 1RYRA 1N5WA 4NXZA 2ZIUB 5J2JA 2ZUCA 3WK6A 5H2FU 1TK5A 3L4PA 5AKXA 3CW2C 3ZI4A 4PGXA 1NJZA 5KFQA 3AM9A 2LPEA 3HKZC 3QU9A 4JB3A 4MF2A 3H7IA 5KFIA 2MAXA 9ICPA 3KZIU 9ICIA 4PHAA 4ECRA 2W3RA 7ICGA 9ICBA 4DL4A 2W8KA 3RBDA 5KT5A 1WUDA 1NI3A 2IMWP 1N60A 1ZOLA 1HIWA 3TADC 3RJEA 3V7LA 2BPFA 4EX7A 4M6WA 4CF4A 2Q4TA 3C1YA 4BWJA 3I28A 3ZDEA 4RQ5A 2E3TA 4DEZA 2W54A 2HBMA 2D8CA 8ICZA 1S5LU 4EENA 2K4PA 5HP4A 4B9UA 1Z19A 5J2EA 2FLPA 1RDFA 2VA2A 4EX6A 3NTUA 2JGAA 1JI7A 2I5HA 5DBBA 2XO7A 4CGZA 2WF5A 4I2JA 7ICLA 2BPCA 4BXOA 3NUQA 3IM1A 1QQ7A 4QW9A 4JUZA 2XGQA 5EE3A 4Z6CA 2NRTA 1Y88A 3ZDAA 3TI0A 9ICUA 2ZIWB 1RYSA 2FMSA 9ICGA 2H3VA 1NK6A 4BGDA 3UPQA 3QU2A 5DB6A 4DFPA 4M9NA 4M9LA 3N7RC 2HBJA 3F2CA 2EANA 2EAMA 2A19A 2JEFA 1ZD3A 4F3OA 3PW4A 3DEEA 2PFPA 1JIHA 2WTFA 3QUQA 2MSNA 3F5EA 5KFYA 1H38A 8ICLA 4EELA 1LKYA 3C29A 1KFTA 4DOCA 2J6UA 2W8LA 1X6IA 3KHGA 1B22A 2B21A 2GH1A 4NV0A 4PZNA 3H8SA 2VA3A 8ICOA 5KG4A 3NVYA 4UAVA 5CB1A 5J2HA 3GDXA 2ZIXA 2KSOB 5DBCA 4C8NA 5KFHA 2KE7A 1K1QA 2P35A 1WCNA 2JV3A 2JRZA 1S0NA 1U48A 3NRZA 1UQVA 1RPLA 4IQVA 2AQ4A 2KZZA 1B4FA 4UATA 4HYKA 5DQHA 4IR1A 4KLHA 2EZZA 5AKGA 5AK6A 4F5OA 5DDYA 4M04A 5D49A 1SV0A 3KKAC 3GIMA 4F71A 4OJPA 4DS5A 2K8BB 2W11A 3V6HA 2DKXA 2E1FA 1S0OA 2KKPA 5ALGA 3QUCA 1NK7A 5CRXA 1PK3A 2D3DA 3KZXA 3MC1A 4QZIA 2DPJA 2K4HA 3AUOA 4Z6FA 5JUMA 3D2NA 3PW7A 1ZD2P 2EDUA 3WK8A 4I2GA 4X5VA 1ZXIA 4MEXA 4J9PA 3PY8A 3RAXA 4YMOA 5DQIA 1TV9A 4UB5A 2HDOA 2E1EA 3QUBA 4ECQA 1YZ6A 2EAPA 3H0MB 3HKZF 1ZQMA 2BGWA 4B9SA 3IG8A 2DGZA 4R64A 2C2RA 1XSNA 2YX8A 5ALZA 3V6JA 1SZPA 4GXIA 4ED2A 4C8OA 2E8MA 5D4BA 4NL9C 3GV5B 1L3VA 4Z6EA 1JX4A 2KOBA 2BCSA 1V85A 4NL9A 2G5IB 2PFNA 1NK4A 2KZ3A 8ICGA 8ICNA 1RQNA 3C1ZA 2MA1A 2ZIWA 4IQTA 3SYZA 5ALHA 3BZKA 3UQ0A 3ONNA 5AI0A 5HR7A 4DCCA 3B0XA 4QWCA 2KV2A 2IA6A 4IRDA 8ICTA 3MFIA 1QQ5A 3WKAA 2HHVA 4IL6U 5IIJA 4I2DA 4QZCA 3MDAA 1B43A 3ORYA 5DB8A 3ZDCA 3CRXA 4Y2JA 4GLXA 5ALKA 4PHPA 2M9NA 3KKAA 1QTMA 2EAOA 1BPYA 3PV8A 5JTIA 2FI1A 2NRZA 7ICTA 3OGUA 4NLNA 4KLLA 1VDVA 2C2EA 1NJWA 2R8IA 4GIBA 3S6JA 5KFGA 4FS2A 4RQ4A 4O5EA 1J97A 4DQPA 9ICXA 5ALLA 5L1KA 2Q0ZX 1UA0A 2JZBB 1RXWA 5EWEA 5KG2A 1CUKA 5J0TA 4F5PA 1T8EA 1SL2A 3M9OB 4AYBC 1ZQJA 4OD0A 3JPRA 9ICNA 3LWMA 1BPEA 3F5AA 4KX5A 3JPQA 4ED0A 2JZBA 4Q8FA 5HR6A 4O3OA 1T94A 5ALVA 4Q45A 4RQNA 1ZQKA 2IBKA 3HP6A 4KLSA 7ICSA 3EUB2 2YB1A 3SAGA 4KLOA 2ZUDA 2YQEA 1X66A 4RT3A 2F1HA 1K1SA 4HAIA 4RQ2A 4EBEA 1HUZA 1FFUA 2HI0A 4ELUA 5ALMA 1U45A 1XSLA 4UW9A 3ZDBA 4MHVA 4DWIA 1U9LA 4YMNA 3WK4A 1L7MA 2G09A 1BNPA 1BGXT 5J0YA 3WKEA 3NGDA 4ED6A 4JK1A 1WYGA 4UB2A 2R8HA 2WF6A 2IOFK 2UVUA 4DO9A 1RXVA 2KVSA 8ICHA 2W9MA 2FPKA 2KEYA 4J9MA 2XC9A 3DDHA 5DLGA 3PR4A 2XVTA 2A1JB 4RUAA 2WHEA 1KDHA 4ACOA 5J2AA 2W9CA 2FLNA 3GV8B 8ICQA 2VJ4A 4J9RA 1QLNA 1JRPA 8ICEA 5J0OA 5KG5A 4ICAA 3M8RA 4YXJA 3RFAA 3M6KA 3Q8LA 4Y2VA 5A0LA 1UPHA 5ALQA 2BCUA 5KFFA 3D2QA 2WAQC 5DB9A 3MABA 4O3NA 3M8SA 1D9FA 4USAA 1DXSA 3L3FX 3ETLA 4B9LA 1TAMA 1VLBA 4R63A 3KHRA 1OXJA 4OJOA 4YMMA 2PMZC 2G08A 1TK0A 4QZEA 3K75D 2HSZA 3RF9A 5AKYA 1SXDA 1ZRMA 4J03A 7ICVA 3UMGA 3SV4A 2FPMA 2XICA 1S9FA 2UVVA 2HMXA 3RJKA 3BDPA 4ELTA 2RDIA 1DGJA 2G0AA 4NM2A 5J0XA 3KD3A 4NLKA 3LYSA 1MC8A 3GIJA 3JPTA 3MGIA 5KFDA 3Q8MA 1TKDA 3QU7A 1PZNA 2I6XA 3RJJA 4KX3A 1PUZA 3M9MB 1MN8A 1WG8A 1CRXA 3RJIA 4F5NA 1D8BA 3HX0A 4QJFB 5IIMA 2PI5A 4O5CA 2GOLA 2VANA 1ZQLA 1PVQA 2QKQA 5KFJA 1NK5A 3SAHA 4EZ9A 1ZQSA 2C22A 2G07A 8ICBA 3OJSA 4O3MA 1QSYA 5KFPA 2YB4A 2XCPA 1SV4A 3GZFA 1BPXA 1A0PA 1BPDA 1ZD5A 4WJ3B 4RQ0A 4M9HA 4RPYA 2W03A 4PHEA 2ALZA 3TADA 3WK9A 3WKDA 4KLEA 4DF4A 1XC9A 1UT8A 5DB7A 4UASA 4ECSA 4O3SA 1MQ3A 8ICUA 5HNKA 9ICKA 2R8GA 2VKQA 2EH9A 2VJ5A 2E8NA 2EZYA 5C5JA 4ED1A 3WU2U 5AKJA 2Y1JA 2BCRA 4P0QB 4Y2SA 1DRGA 1JALA 2ZJ5A 4TUSA 2FMPA 2OHFA 5IILA 3NVVA 3SD7A 4Y2PA 3O0FA 2Y9TA 4M6WB 2NYVA 1ZQXA 4MEYA 2HOQA 2A1JA 4P0QA 1NJYA 3EWAA 3HT3A 2MUTB 2ZTDA 1IM4A 2H3FA 2W9BB 4KLJA 3QXGA 4I2AA 3QYPA 2ZUBA 4ECUA 5J2CA 5IIIA 1RM6C 4DOAA 5EOZA 4DSLA 1NNLA 2PXIA 2BDPA 1ZQZA 2AXTU 9ICSA 4XRHA 1U49A 2ZG6A 5AICA 1Z1VA 3RB6A 1Z3EB 3QEBZ 4BXOB 1YT3A 2NRXA 1M6YA 2IOHA 2KZMA 1PK1B 1ZQUA 4DS4A 2Y1IA 3RH5A 5ALRA 3SEIA 9ICVA 1BVSA 4EBDA 1J2MA 2BZFA 1PVPA 1ZQEA 2JXJA 4RPZA 2WB1C 4RQ7A 4I2FA 1NOMA 4F4YA 2ASDA 3IDWA 2Z7JA 1N56A 4F92B 3F2DA 2ZTEA 5L9XA 1HJPA 4EBCA 5KFSA 1X9SA 2J6SA 3IV6A 1TK8A 3VC8A 3RJFA 4DSIA 1NK9A 1ZQDA 5J0QA 4AYBF 5HHIA 2KJ5A 4K4GA 3N28A 4C8MA 4CDGA 1DOQA 4TURA 1IXRA 1NKEA 4QWDA 2HW3A 3V7JA 2W7PA 2EZXA 3OSPA 2NRWA 4Y2RA 1T3NA 4EZ6A 1WCLA 3MBYA 3OTQA 2UVWA 1ZQQA 2ZIUA 1S0MA 9ICLA 4C8LA 2F77X 1URJA 3RH4A 2V4RA 2LM4A 4P2HA 5AM0A 3LWLA 3AMZA 8ICVA 3UXOA 4UAUA 1CI4A 3RRHA 2HOFA 1QQ6A 2PMZF 4RNMA 1D8YA 3AQFA 3OHBA 3WK7A 3SI8A 2DBYA 3PSTA 4TQRA 2PI4A 5J8YC 3BQ2A 5JRTA 2RHFA 4DL5A 1JMSA 2C2DA 3E58A 2F3NA 3GFKB 4ECTA 1S76D 4YFKA 1L3SA 1L7NA 1Q3VA 4O5KA 4MF8A 1O03A 4JMUA 4LZDA 5KT7A 4OO1J 5KAFU 3MR3A 2QB0B 3UMBA 2HHSA 1NKCA 3Q8SB 1FEZA 1TVAA 5L1MA 3N4MB 5KFWA 2OH2A 5KT2A 3QEAZ 2KHVA 4GXKA 3C2KA 4M9JA 2BPGA 1SV0C 4QWAA 4YG2A 2WAQF 9ICTA 4QZGA 1F5SA 2ZIVB 3UQ2A 4C80A 4FBUA 3PX4A 2FDRA 5FP0A 4O3RA 2RDJA 2ZJAA 5J0RA 4O0IA 9ICAA 1ZQTA 4U6PA 4DSKA 3KHLA 2BCQA 4PPXA 1PVRA 3PO5A 4QZ9A 1UCVA 2W7OA 2YTUA 4NWIA 4FS1A 5DGAA 3PW5A 5AM5A 5EE1A 4US9A 4YR2A 1ZQCA 2KHQA 5AKIA 4KLUA 2WF7A 2F1IA 2HCFA 4FZMA 5EWFA 2BKEA 3PO4A
chains in the Genus database with same CATH topology
5J8YC 1V85A 2KSOA 4MHVA 4NL9A 4PZNA 5JRTA 2GLEA 1PK1B 1LKYB 1SXEA 2DKZA 3SEIA 3HILA 2L5YA 2B6GA 2QB1A 2F3NA 3BS5A 5JU5A 2KSOB 5KNIA 2KE7A 2QKQA 2F8KA 1X40A 3IDWA 2JV3A 4PZOA 4IS7A 3TADC 1UQVA 2KG5A 3H8MA 2QB0B 3BQ7A 1B4FA 2QARB 1SV4A 2Y9UA 2KIVA 5L1MA 1KW4A 3KKAA 1SV0A 2ES6A 2EAOA 3KKAC 2ESEA 5JTIA 1SV0C 3TADA 2D8CA 1B0XA 2K4PA 2F44A 2DL0A 2KMDA 2DKXA 1F0MA 1PK3A 2D3DA 1JI7A 3TACB 5F3XB 2E8NA 1SGGA 1OW5A 3SENA 1RG6A 5J8YA 2K60A 2LMRA 2E8OA 1UCVA 2YTUA 1DXSA 1V38A 4NJ8A 2Y9TA 2FE9A 3BS5B 4RQNA 1OXJA 2EANA 2EAMA 1X9XA 2EAPA 1SXDA 3BS7A 1X66A 4RQMA 1WWVA 1PK1A 2QB0A 2E8PA 1LKYA 2QARA 1WWUA 2LPEA 3K1RB 2E8MA 4NL9C 1Z1VA 1COKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8Y C;  1V85 A;  2KSO A;  4MHV A;  4NL9 A;  4PZN A;  5JRT A;  2GLE A;  1PK1 B;  1LKY B;  1SXE A;  2DKZ A;  3SEI A;  3HIL A;  2L5Y A;  2B6G A;  2QB1 A;  2F3N A;  3BS5 A;  5JU5 A;  2KSO B;  5KNI A;  2KE7 A;  2QKQ A;  2F8K A;  1X40 A;  3IDW A;  2JV3 A;  4PZO A;  4IS7 A;  3TAD C;  1UQV A;  2KG5 A;  3H8M A;  2QB0 B;  3BQ7 A;  1B4F A;  2QAR B;  1SV4 A;  2Y9U A;  2KIV A;  5L1M A;  1KW4 A;  3KKA A;  1SV0 A;  2ES6 A;  2EAO A;  3KKA C;  2ESE A;  5JTI A;  1SV0 C;  3TAD A;  2D8C A;  1B0X A;  2K4P A;  2F44 A;  2DL0 A;  2KMD A;  2DKX A;  1F0M A;  1PK3 A;  2D3D A;  1JI7 A;  3TAC B;  5F3X B;  2E8N A;  1SGG A;  1OW5 A;  3SEN A;  1RG6 A;  5J8Y A;  2K60 A;  2LMR A;  2E8O A;  1UCV A;  2YTU A;  1DXS A;  1V38 A;  4NJ8 A;  2Y9T A;  2FE9 A;  3BS5 B;  4RQN A;  1OXJ A;  2EAN A;  2EAM A;  1X9X A;  2EAP A;  1SXD A;  3BS7 A;  1X66 A;  4RQM A;  1WWV A;  1PK1 A;  2QB0 A;  2E8P A;  1LKY A;  2QAR A;  1WWU A;  2LPE A;  3K1R B;  2E8M A;  4NL9 C;  1Z1V A;  1COK A; 
#chains in the Genus database with same CATH topology
 2JEI A;  8ICC A;  1NJX A;  8ICY A;  3PSF A;  1C20 A;  2DKZ A;  5AKZ A;  3UM9 A;  5F9N A;  2W55 A;  5KFR A;  4G9B A;  4NLG A;  1MA7 A;  5KFA A;  2L5Y A;  2HVH A;  4P4M A;  3QNM A;  5ALE A;  4J9Q A;  2UVR A;  5CP2 A;  5T14 A;  4I28 A;  3FAH A;  8ICS A;  5ALX A;  3EZ5 A;  3V6K A;  4UBC A;  3QU4 A;  5AKE A;  4JV0 A;  5ALI A;  2EQY A;  3PSI A;  4YR3 A;  2XCA A;  4NLC A;  9ICW A;  1J2N A;  5AM3 A;  5CWR A;  3RJG A;  1KW4 A;  3QE9 Y;  5GTH U;  2ZXI A;  1SWV A;  3QZ7 A;  2ES6 A;  3I76 A;  4UQG A;  5DG9 A;  2ZTC A;  4ECY A;  2DL0 A;  4GFJ A;  4CRX A;  4RT2 A;  1BNO A;  3V72 A;  5ALU A;  3N97 B;  4Q8E A;  4A8E A;  1OW5 A;  4F2R A;  2H3Q A;  4IRC A;  2A1A A;  4QZA A;  1RYU A;  2O6K A;  1XO1 A;  4DSJ A;  3ZD8 A;  1L8L A;  4YR0 A;  3TKA A;  1V38 A;  9ICF A;  1N61 A;  4U7C A;  4DFD A;  1ZET A;  2GWS A;  1QSL A;  4F72 A;  2MU2 A;  3C5F A;  5ALT A;  4KLT A;  1PK1 A;  2QB0 A;  3H40 A;  2E8P A;  2KN7 A;  1ZQI A;  3JPP A;  4FBT A;  1UA1 A;  5KFM A;  2YMP A;  3HRD D;  2FLL A;  4OJL A;  4QWB A;  4QIW C;  2K4I A;  3IRU A;  1LKY B;  3T3F A;  1SXE A;  4PL2 A;  3HIL A;  3HJE A;  2QB1 A;  7ICU A;  5KT4 A;  4ED7 A;  4GC7 A;  4YN4 A;  3JPN A;  4EYH B;  3AL0 B;  3NAS A;  3GII A;  1NK8 A;  1ECW A;  7ICP A;  3PMN A;  3SV3 A;  3EW9 A;  1ED1 A;  4ZH4 A;  3T5K A;  5GTI U;  4QZD A;  3C23 A;  4RQ3 A;  4RUC A;  4O3P A;  3RAQ A;  3FC4 A;  3BQ0 A;  4DSE A;  4NY8 A;  2G5H B;  3D6J A;  2YMM A;  4ECW A;  1KBU A;  1ZD4 A;  1RZT A;  2VIX A;  1IV8 A;  2OYY A;  5ALY A;  2JEJ A;  2CXY A;  3A0H U;  2OWO A;  3LVW A;  5AI6 A;  5AIA A;  1DK3 A;  5KTQ A;  1OUQ A;  1ZQF A;  5ALD A;  2LYB A;  3T5J A;  3CYM A;  3GIK A;  2HBL A;  3GIL A;  4C8K A;  3B9J A;  2DWQ A;  2F8L A;  2KJ9 A;  3IP4 B;  1EXN A;  1KFD A;  5KG6 A;  3JPS A;  1FO4 A;  2ATL A;  1SWW A;  5C0Y A;  2GO7 A;  3Q8K A;  5EWG A;  3TAQ A;  2R8J A;  3ZDD A;  3AEV A;  3QUT A;  3C21 A;  5L1L A;  1IG6 A;  4RU9 A;  4DL2 A;  3DV9 A;  4BWM A;  3QX7 A;  5KFB A;  4YP3 A;  1ZQH A;  2I9G A;  2ISO A;  1Z00 B;  3UXN A;  3C5G A;  1WWU A;  5DG7 A;  3MDC A;  3RB3 A;  3K1R B;  1ZYQ A;  5EE9 A;  2K4E A;  3HWT A;  3PZP A;  2JH7 A;  4Z6D A;  2IOF A;  4J9S A;  4JWM A;  1Z00 A;  1N62 A;  7ICK A;  1C7Y A;  5KG7 A;  9ICE A;  4ZOH C;  1SKS A;  4Y2X A;  4BJQ A;  3WKB A;  4ELV A;  2BHN A;  4O9M A;  2FMQ A;  3LK9 A;  3PSP A;  4XUS A;  3NVZ A;  4PZO A;  4F93 B;  1L3U A;  1UHU A;  2KD1 A;  4F2S A;  4M0A A;  4B9N A;  1X2I A;  5D46 A;  2AGP A;  2IHM A;  3GV7 B;  1ZJM A;  4F8R A;  3M1Y A;  3KFU F;  1QCK A;  4OJ6 A;  3GQC A;  4MFC A;  5HHH A;  4F4Z A;  8ICW A;  4PHD A;  4ED8 A;  3FM9 A;  3RR7 A;  2KJ8 A;  3H0R B;  3SZ2 A;  5DGB A;  4F4X A;  4YCX A;  3KTQ A;  2KP7 A;  1TFR A;  1ZQG A;  1SGG A;  4KIT B;  4I2C A;  5J0P A;  3RH6 A;  2J6T A;  1RG6 A;  4C7Z A;  1SKW A;  3PR5 B;  2LMR A;  2OM6 A;  2W9A A;  1S0V A;  2D6F C;  8ICR A;  4C4T A;  5KFK A;  4YQW A;  4CF3 A;  2YN4 A;  2XY5 A;  1ZJN A;  2FE9 A;  2NRV A;  5KG0 A;  5AM2 A;  4I2H A;  5KFV A;  5KT3 A;  4F5Q A;  1S77 D;  5DLF A;  2HHU A;  4RQM A;  4CF5 A;  2E5S A;  2YML A;  1WWV A;  2FPL A;  2F76 X;  2JEG A;  1QH9 A;  5AKH A;  4IRK A;  3F2B A;  2AJQ A;  2KSO A;  1JUD A;  2GLE A;  5K4L A;  5CHG A;  5J2I A;  1KLN A;  4ECX A;  2VA8 A;  5AK5 A;  5IIN A;  4KLG A;  2AGO A;  1KKX A;  4IQU A;  5G5G A;  4UAW A;  3KBB A;  2F8K A;  4K4I A;  4DFK A;  2BQR A;  4O3Q A;  1LV5 A;  2W43 A;  1F44 A;  1A6S A;  5B66 U;  4ECZ A;  3UXP A;  1N5X A;  1A76 A;  3SR6 A;  2DFL A;  4IC9 A;  1ZQV A;  1Z4N A;  4R65 A;  4UB8 U;  1BPZ A;  3OPX A;  2Y0S F;  3BJY A;  4DQQ A;  3T5H A;  2LI6 A;  3GU3 A;  5KG1 A;  1NK0 A;  4F91 B;  1NZB A;  1ZQB A;  1KRP A;  4AP9 A;  2V4Q A;  2KVC A;  3TAN A;  4I29 A;  1A77 A;  4LZG A;  8ICM A;  3EPG A;  1F0M A;  4CE6 A;  8ICX A;  5AK4 A;  4BDP A;  2JMG A;  4KLM A;  4KMO B;  4QZ8 A;  2P6U A;  1JXE A;  5KFX A;  1S8O A;  4US8 A;  2KIC A;  7ICE A;  2K60 A;  3SQI A;  1L6N A;  1D9D A;  1ZQP A;  1T3Q A;  3IG5 A;  1DGS A;  1V9P A;  2R18 A;  3OSN A;  3TAR A;  5AI4 A;  2W9B A;  4DFM A;  4NJ8 A;  5KG3 A;  5AK3 A;  4R8U B;  3BS5 B;  3IHQ B;  4MFA A;  3QZ8 A;  4E0D A;  4Y2T A;  1P7D A;  8ICA A;  4F5R A;  1HEK A;  4CCH A;  8ICK A;  1V97 A;  4KN4 A;  2PFO A;  5J2B A;  4RQ6 A;  2QAR A;  2P6R A;  2PFQ A;  2NV3 A;  4UB4 A;  2PKE A;  4B9V A;  3MR5 A;  4XA5 A;  3SAF A;  4QW8 A;  4I2I A;  3J81 j;  3QU5 A;  3M7D A;  2K8A A;  5AKK A;  4FZN A;  4F4K A;  4RZR A;  1ZQA A;  4YD1 A;  4K4H A;  3MFH A;  3IN5 A;  4UB3 A;  4DSF A;  5KL1 B;  4DLE A;  5J2K A;  1SL1 A;  9ICO A;  1KEJ A;  2FJ6 A;  3HW8 A;  1QSS A;  4JWN A;  4M2Y A;  4OJ5 A;  4FE3 A;  5ALP A;  4IR9 A;  4B9T A;  3N7P D;  3BQ7 A;  4TQS A;  3D2S A;  1NZP A;  3A0B U;  5AIB A;  1T4G A;  2Y9U A;  4NM1 A;  4DL7 A;  4B9M A;  4M47 A;  4XQ8 A;  4P4P A;  4I2E A;  2G06 A;  1X9W A;  4PGQ A;  4TUP A;  2XID A;  2XY7 A;  3C2L A;  1X9M A;  5BOL A;  5HML A;  4C7Y A;  3PX6 A;  3ALR A;  3PML A;  2WF8 A;  5AHX A;  5J8Y A;  2P66 A;  4BUG A;  2ZJ8 A;  3AQE A;  1KQQ A;  2LYA A;  1NKB A;  2OCE A;  4YVZ A;  5DBA A;  3G6Y A;  1X42 A;  3FYH A;  1ZRN A;  1IIP A;  5AM1 A;  3Q8R B;  2AU0 A;  5ALS A;  5TZV A;  3PW0 A;  3AU2 A;  1SIJ A;  5KT6 A;  3M6Z A;  4EEY A;  3BS7 A;  4YXM A;  4FZL A;  2LM1 A;  5CA7 A;  1COO A;  3Q8P B;  2C28 A;  1KSP A;  7ICR A;  4J9L A;  9ICH A;  1ZQN A;  4RNO A;  2W9C B;  5KFZ A;  2HHT A;  1TE2 A;  3N7S C;  2LKY A;  5KFT A;  3U26 A;  5J2D A;  2B6G A;  1D8L A;  4YD2 A;  3THV A;  3BS5 A;  4DQR A;  4NLZ A;  5ALO A;  1BPB A;  3H0L B;  2ZXH A;  1X40 A;  4RPX A;  2DPI A;  3CNH A;  5J29 A;  3Q8Q B;  2K89 A;  1N48 A;  1U4B A;  2W3S A;  5J0W A;  4M9G A;  5KFU A;  2CN1 A;  1AQ6 A;  1Q8K A;  2ZIV A;  4QZH A;  1SZH A;  5AI9 A;  1JXL A;  4Y2Y A;  4UAR A;  4FFD A;  2RQ5 A;  2KIW A;  3ED5 A;  4IQW A;  2H3Z A;  1XS9 D;  5KFN A;  4PJ0 U;  2OEH A;  5BOM A;  1U47 A;  4DL3 A;  3H8W A;  3I1Y A;  4JV1 A;  2XI9 A;  5B5E U;  4F50 A;  8ICI A;  3TAC B;  5F3X B;  5L1I A;  3R9K A;  1UT5 A;  7ICQ A;  1FFV A;  1XU4 A;  3ETR A;  2ASL A;  3F53 A;  1SKR A;  3OHA A;  2XY6 A;  9ICQ A;  5AM4 A;  2JHD A;  5G5H A;  4DOB A;  9ICJ A;  2BQU A;  3RRG A;  4UAZ A;  3MGV A;  3L5K A;  3SMV A;  4QZB A;  4KTQ A;  4OCZ A;  5KAI U;  1X9X A;  2WF9 A;  5J0S A;  3NRW A;  2WFA A;  3RR8 A;  2R8K A;  1KN5 A;  1JN3 A;  1YZ7 A;  2JH1 A;  5AKL A;  3PW2 A;  1S97 A;  3ISD A;  4EEK A;  3RTV A;  7ICF A;  4UB1 A;  5AI8 A;  7ICI A;  1JRO A;  4KLD A;  2KFZ A;  1ZQW A;  1HUO A;  4DL6 A;  4F4W A;  2AGQ A;  2BQ3 A;  2Y0S C;  3BZC A;  3BQ1 A;  5KL8 B;  3M9N B;  2KK0 A;  2AHO B;  3BQT A;  3G6V A;  8ICF A;  4KLQ A;  1O08 A;  3AN1 A;  2YY6 A;  3UMC A;  3HPO A;  5J2G A;  4CNQ A;  3WKC A;  7ICO A;  3LDA A;  4C4S A;  2JR5 A;  4R66 A;  2HHQ A;  4MFF A;  4RQ8 A;  2ESE A;  2MUT A;  3JPO A;  1B0X A;  1T7P A;  5IIO A;  4LVS A;  1GO3 F;  2LYH A;  4Q44 A;  3OJU A;  7ICN A;  1L7P A;  4G3I A;  3B0Y A;  3ICX A;  1XNS A;  2CRX A;  2AQ0 A;  2F1J A;  4UAY A;  1L8O A;  2ASJ A;  1KL9 A;  1S10 A;  4C0Z A;  3H8J A;  3KHH A;  2N1R A;  2BR0 A;  3PNC A;  4FO6 A;  2W04 A;  5KFE A;  4NLB A;  1KFS A;  5KFO A;  2LBO A;  4J9O A;  1X6J A;  1L7O A;  4DF8 A;  9ICM A;  1SL0 A;  1Z1B A;  2HVI A;  5J0U A;  4GC6 A;  3KOO A;  9ICC A;  4PL1 A;  3PVX A;  3NVW A;  3MR2 A;  2CPR A;  1Q46 A;  4DFJ A;  5E79 U;  4C4R A;  4DQI A;  3T5L A;  5KFL A;  2NO4 A;  5IIK A;  4LJX A;  3RBE A;  1Q3U A;  2OXO A;  2RRD A;  2ISP A;  4BX9 C;  2NO5 A;  3VCB A;  3MGH A;  2ZIX B;  3RB0 A;  4ED3 A;  2V9W A;  2XGP A;  3C2M A;  1FIQ A;  4KLF A;  2BDU A;  7ICH A;  3CP8 A;  1K5O A;  2WB1 F;  1XSP A;  1XWL A;  4RNN A;  3WK5 A;  2BCV A;  3PX0 A;  5CR0 A;  2DF4 B;  2RLT A;  2F44 A;  4P0P A;  2KMD A;  3E2E A;  1ZQO A;  3FDS A;  5TIS U;  5AI5 A;  2HOI A;  5DQG A;  1KTQ A;  2YMQ A;  3TFS A;  5J2F A;  3NS1 A;  4J9N A;  3ISB A;  3TAP A;  4KLI A;  2DUY A;  4I2B A;  2B0C A;  2H5X A;  4P0P B;  1TAQ A;  4P4O A;  3H4D A;  2AH5 A;  2RP5 A;  4GXJ A;  3TFR A;  1N2X A;  2E8O A;  3AU6 A;  3V7K A;  4Y2Q A;  9ICR A;  5ALW A;  3RJH A;  2HHX A;  1LVH A;  5ALJ A;  2A3V A;  4Q43 A;  4PGY A;  5DG8 A;  3LVV A;  1XO0 A;  2QLT A;  3RB4 A;  1ZQR A;  4QNL A;  4KMU A;  2H3I A;  5BPC A;  4QWE A;  1L3T A;  4EYI B;  2KNJ A;  1MSW D;  8ICJ A;  1DK2 A;  4TUQ A;  5L1J A;  2IHN A;  5F9L A;  1COK A;  5HMM A;  2K8C B;  2ODG A;  2M0N A;  3H4B A;  4Y2U A;  2HHW A;  3T79 A;  3K1Z A;  4R8U A;  2DQN B;  5JU5 A;  5KNI A;  3EPI A;  4JV2 A;  1ZQ1 C;  7ICJ A;  4ECV A;  4UBB A;  4I27 A;  4IS7 A;  3C28 A;  5ALN A;  2KG5 A;  3H8M A;  2F2A B;  1N63 A;  5KFC A;  3E0F A;  4DLG A;  3MR6 A;  4PH5 A;  2QAR B;  3K4G A;  1ARO P;  2KIV A;  2HBK A;  2MRL A;  1MQ2 A;  1TAU A;  4DQS A;  4B6J A;  4J9K A;  1ZQY A;  8ICP A;  2I1Q A;  3TQ1 A;  1SB3 C;  1Z4O A;  5DKW A;  4KN7 A;  2KFN A;  7ICM A;  2KKV A;  5CJ7 A;  3G6X A;  4UB6 U;  5CEH A;  3SEN A;  4QZF A;  3ISC A;  1LB2 B;  3ZD9 A;  1CEZ A;  1L5U A;  5DDM A;  1RQL A;  4QIW F;  4RQ1 A;  2LHT A;  3EYZ A;  5ALF A;  2KTQ A;  5EE0 A;  1VJ5 A;  1RYR A;  1N5W A;  4NXZ A;  2ZIU B;  5J2J A;  2ZUC A;  3WK6 A;  5H2F U;  1TK5 A;  3L4P A;  5AKX A;  3CW2 C;  3ZI4 A;  4PGX A;  1NJZ A;  5KFQ A;  3AM9 A;  2LPE A;  3HKZ C;  3QU9 A;  4JB3 A;  4MF2 A;  3H7I A;  5KFI A;  2MAX A;  9ICP A;  3KZI U;  9ICI A;  4PHA A;  4ECR A;  2W3R A;  7ICG A;  9ICB A;  4DL4 A;  2W8K A;  3RBD A;  5KT5 A;  1WUD A;  1NI3 A;  2IMW P;  1N60 A;  1ZOL A;  1HIW A;  3TAD C;  3RJE A;  3V7L A;  2BPF A;  4EX7 A;  4M6W A;  4CF4 A;  2Q4T A;  3C1Y A;  4BWJ A;  3I28 A;  3ZDE A;  4RQ5 A;  2E3T A;  4DEZ A;  2W54 A;  2HBM A;  2D8C A;  8ICZ A;  1S5L U;  4EEN A;  2K4P A;  5HP4 A;  4B9U A;  1Z19 A;  5J2E A;  2FLP A;  1RDF A;  2VA2 A;  4EX6 A;  3NTU A;  2JGA A;  1JI7 A;  2I5H A;  5DBB A;  2XO7 A;  4CGZ A;  2WF5 A;  4I2J A;  7ICL A;  2BPC A;  4BXO A;  3NUQ A;  3IM1 A;  1QQ7 A;  4QW9 A;  4JUZ A;  2XGQ A;  5EE3 A;  4Z6C A;  2NRT A;  1Y88 A;  3ZDA A;  3TI0 A;  9ICU A;  2ZIW B;  1RYS A;  2FMS A;  9ICG A;  2H3V A;  1NK6 A;  4BGD A;  3UPQ A;  3QU2 A;  5DB6 A;  4DFP A;  4M9N A;  4M9L A;  3N7R C;  2HBJ A;  3F2C A;  2EAN A;  2EAM A;  2A19 A;  2JEF A;  1ZD3 A;  4F3O A;  3PW4 A;  3DEE A;  2PFP A;  1JIH A;  2WTF A;  3QUQ A;  2MSN A;  3F5E A;  5KFY A;  1H38 A;  8ICL A;  4EEL A;  1LKY A;  3C29 A;  1KFT A;  4DOC A;  2J6U A;  2W8L A;  1X6I A;  3KHG A;  1B22 A;  2B21 A;  2GH1 A;  4NV0 A;  4PZN A;  3H8S A;  2VA3 A;  8ICO A;  5KG4 A;  3NVY A;  4UAV A;  5CB1 A;  5J2H A;  3GDX A;  2ZIX A;  2KSO B;  5DBC A;  4C8N A;  5KFH A;  2KE7 A;  1K1Q A;  2P35 A;  1WCN A;  2JV3 A;  2JRZ A;  1S0N A;  1U48 A;  3NRZ A;  1UQV A;  1RPL A;  4IQV A;  2AQ4 A;  2KZZ A;  1B4F A;  4UAT A;  4HYK A;  5DQH A;  4IR1 A;  4KLH A;  2EZZ A;  5AKG A;  5AK6 A;  4F5O A;  5DDY A;  4M04 A;  5D49 A;  1SV0 A;  3KKA C;  3GIM A;  4F71 A;  4OJP A;  4DS5 A;  2K8B B;  2W11 A;  3V6H A;  2DKX A;  2E1F A;  1S0O A;  2KKP A;  5ALG A;  3QUC A;  1NK7 A;  5CRX A;  1PK3 A;  2D3D A;  3KZX A;  3MC1 A;  4QZI A;  2DPJ A;  2K4H A;  3AUO A;  4Z6F A;  5JUM A;  3D2N A;  3PW7 A;  1ZD2 P;  2EDU A;  3WK8 A;  4I2G A;  4X5V A;  1ZXI A;  4MEX A;  4J9P A;  3PY8 A;  3RAX A;  4YMO A;  5DQI A;  1TV9 A;  4UB5 A;  2HDO A;  2E1E A;  3QUB A;  4ECQ A;  1YZ6 A;  2EAP A;  3H0M B;  3HKZ F;  1ZQM A;  2BGW A;  4B9S A;  3IG8 A;  2DGZ A;  4R64 A;  2C2R A;  1XSN A;  2YX8 A;  5ALZ A;  3V6J A;  1SZP A;  4GXI A;  4ED2 A;  4C8O A;  2E8M A;  5D4B A;  4NL9 C;  3GV5 B;  1L3V A;  4Z6E A;  1JX4 A;  2KOB A;  2BCS A;  1V85 A;  4NL9 A;  2G5I B;  2PFN A;  1NK4 A;  2KZ3 A;  8ICG A;  8ICN A;  1RQN A;  3C1Z A;  2MA1 A;  2ZIW A;  4IQT A;  3SYZ A;  5ALH A;  3BZK A;  3UQ0 A;  3ONN A;  5AI0 A;  5HR7 A;  4DCC A;  3B0X A;  4QWC A;  2KV2 A;  2IA6 A;  4IRD A;  8ICT A;  3MFI A;  1QQ5 A;  3WKA A;  2HHV A;  4IL6 U;  5IIJ A;  4I2D A;  4QZC A;  3MDA A;  1B43 A;  3ORY A;  5DB8 A;  3ZDC A;  3CRX A;  4Y2J A;  4GLX A;  5ALK A;  4PHP A;  2M9N A;  3KKA A;  1QTM A;  2EAO A;  1BPY A;  3PV8 A;  5JTI A;  2FI1 A;  2NRZ A;  7ICT A;  3OGU A;  4NLN A;  4KLL A;  1VDV A;  2C2E A;  1NJW A;  2R8I A;  4GIB A;  3S6J A;  5KFG A;  4FS2 A;  4RQ4 A;  4O5E A;  1J97 A;  4DQP A;  9ICX A;  5ALL A;  5L1K A;  2Q0Z X;  1UA0 A;  2JZB B;  1RXW A;  5EWE A;  5KG2 A;  1CUK A;  5J0T A;  4F5P A;  1T8E A;  1SL2 A;  3M9O B;  4AYB C;  1ZQJ A;  4OD0 A;  3JPR A;  9ICN A;  3LWM A;  1BPE A;  3F5A A;  4KX5 A;  3JPQ A;  4ED0 A;  2JZB A;  4Q8F A;  5HR6 A;  4O3O A;  1T94 A;  5ALV A;  4Q45 A;  4RQN A;  1ZQK A;  2IBK A;  3HP6 A;  4KLS A;  7ICS A;  3EUB 2;  2YB1 A;  3SAG A;  4KLO A;  2ZUD A;  2YQE A;  1X66 A;  4RT3 A;  2F1H A;  1K1S A;  4HAI A;  4RQ2 A;  4EBE A;  1HUZ A;  1FFU A;  2HI0 A;  4ELU A;  5ALM A;  1U45 A;  1XSL A;  4UW9 A;  3ZDB A;  4MHV A;  4DWI A;  1U9L A;  4YMN A;  3WK4 A;  1L7M A;  2G09 A;  1BNP A;  1BGX T;  5J0Y A;  3WKE A;  3NGD A;  4ED6 A;  4JK1 A;  1WYG A;  4UB2 A;  2R8H A;  2WF6 A;  2IOF K;  2UVU A;  4DO9 A;  1RXV A;  2KVS A;  8ICH A;  2W9M A;  2FPK A;  2KEY A;  4J9M A;  2XC9 A;  3DDH A;  5DLG A;  3PR4 A;  2XVT A;  2A1J B;  4RUA A;  2WHE A;  1KDH A;  4ACO A;  5J2A A;  2W9C A;  2FLN A;  3GV8 B;  8ICQ A;  2VJ4 A;  4J9R A;  1QLN A;  1JRP A;  8ICE A;  5J0O A;  5KG5 A;  4ICA A;  3M8R A;  4YXJ A;  3RFA A;  3M6K A;  3Q8L A;  4Y2V A;  5A0L A;  1UPH A;  5ALQ A;  2BCU A;  5KFF A;  3D2Q A;  2WAQ C;  5DB9 A;  3MAB A;  4O3N A;  3M8S A;  1D9F A;  4USA A;  1DXS A;  3L3F X;  3ETL A;  4B9L A;  1TAM A;  1VLB A;  4R63 A;  3KHR A;  1OXJ A;  4OJO A;  4YMM A;  2PMZ C;  2G08 A;  1TK0 A;  4QZE A;  3K75 D;  2HSZ A;  3RF9 A;  5AKY A;  1SXD A;  1ZRM A;  4J03 A;  7ICV A;  3UMG A;  3SV4 A;  2FPM A;  2XIC A;  1S9F A;  2UVV A;  2HMX A;  3RJK A;  3BDP A;  4ELT A;  2RDI A;  1DGJ A;  2G0A A;  4NM2 A;  5J0X A;  3KD3 A;  4NLK A;  3LYS A;  1MC8 A;  3GIJ A;  3JPT A;  3MGI A;  5KFD A;  3Q8M A;  1TKD A;  3QU7 A;  1PZN A;  2I6X A;  3RJJ A;  4KX3 A;  1PUZ A;  3M9M B;  1MN8 A;  1WG8 A;  1CRX A;  3RJI A;  4F5N A;  1D8B A;  3HX0 A;  4QJF B;  5IIM A;  2PI5 A;  4O5C A;  2GOL A;  2VAN A;  1ZQL A;  1PVQ A;  2QKQ A;  5KFJ A;  1NK5 A;  3SAH A;  4EZ9 A;  1ZQS A;  2C22 A;  2G07 A;  8ICB A;  3OJS A;  4O3M A;  1QSY A;  5KFP A;  2YB4 A;  2XCP A;  1SV4 A;  3GZF A;  1BPX A;  1A0P A;  1BPD A;  1ZD5 A;  4WJ3 B;  4RQ0 A;  4M9H A;  4RPY A;  2W03 A;  4PHE A;  2ALZ A;  3TAD A;  3WK9 A;  3WKD A;  4KLE A;  4DF4 A;  1XC9 A;  1UT8 A;  5DB7 A;  4UAS A;  4ECS A;  4O3S A;  1MQ3 A;  8ICU A;  5HNK A;  9ICK A;  2R8G A;  2VKQ A;  2EH9 A;  2VJ5 A;  2E8N A;  2EZY A;  5C5J A;  4ED1 A;  3WU2 U;  5AKJ A;  2Y1J A;  2BCR A;  4P0Q B;  4Y2S A;  1DRG A;  1JAL A;  2ZJ5 A;  4TUS A;  2FMP A;  2OHF A;  5IIL A;  3NVV A;  3SD7 A;  4Y2P A;  3O0F A;  2Y9T A;  4M6W B;  2NYV A;  1ZQX A;  4MEY A;  2HOQ A;  2A1J A;  4P0Q A;  1NJY A;  3EWA A;  3HT3 A;  2MUT B;  2ZTD A;  1IM4 A;  2H3F A;  2W9B B;  4KLJ A;  3QXG A;  4I2A A;  3QYP A;  2ZUB A;  4ECU A;  5J2C A;  5III A;  1RM6 C;  4DOA A;  5EOZ A;  4DSL A;  1NNL A;  2PXI A;  2BDP A;  1ZQZ A;  2AXT U;  9ICS A;  4XRH A;  1U49 A;  2ZG6 A;  5AIC A;  1Z1V A;  3RB6 A;  1Z3E B;  3QEB Z;  4BXO B;  1YT3 A;  2NRX A;  1M6Y A;  2IOH A;  2KZM A;  1PK1 B;  1ZQU A;  4DS4 A;  2Y1I A;  3RH5 A;  5ALR A;  3SEI A;  9ICV A;  1BVS A;  4EBD A;  1J2M A;  2BZF A;  1PVP A;  1ZQE A;  2JXJ A;  4RPZ A;  2WB1 C;  4RQ7 A;  4I2F A;  1NOM A;  4F4Y A;  2ASD A;  3IDW A;  2Z7J A;  1N56 A;  4F92 B;  3F2D A;  2ZTE A;  5L9X A;  1HJP A;  4EBC A;  5KFS A;  1X9S A;  2J6S A;  3IV6 A;  1TK8 A;  3VC8 A;  3RJF A;  4DSI A;  1NK9 A;  1ZQD A;  5J0Q A;  4AYB F;  5HHI A;  2KJ5 A;  4K4G A;  3N28 A;  4C8M A;  4CDG A;  1DOQ A;  4TUR A;  1IXR A;  1NKE A;  4QWD A;  2HW3 A;  3V7J A;  2W7P A;  2EZX A;  3OSP A;  2NRW A;  4Y2R A;  1T3N A;  4EZ6 A;  1WCL A;  3MBY A;  3OTQ A;  2UVW A;  1ZQQ A;  2ZIU A;  1S0M A;  9ICL A;  4C8L A;  2F77 X;  1URJ A;  3RH4 A;  2V4R A;  2LM4 A;  4P2H A;  5AM0 A;  3LWL A;  3AMZ A;  8ICV A;  3UXO A;  4UAU A;  1CI4 A;  3RRH A;  2HOF A;  1QQ6 A;  2PMZ F;  4RNM A;  1D8Y A;  3AQF A;  3OHB A;  3WK7 A;  3SI8 A;  2DBY A;  3PST A;  4TQR A;  2PI4 A;  5J8Y C;  3BQ2 A;  5JRT A;  2RHF A;  4DL5 A;  1JMS A;  2C2D A;  3E58 A;  2F3N A;  3GFK B;  4ECT A;  1S76 D;  4YFK A;  1L3S A;  1L7N A;  1Q3V A;  4O5K A;  4MF8 A;  1O03 A;  4JMU A;  4LZD A;  5KT7 A;  4OO1 J;  5KAF U;  3MR3 A;  2QB0 B;  3UMB A;  2HHS A;  1NKC A;  3Q8S B;  1FEZ A;  1TVA A;  5L1M A;  3N4M B;  5KFW A;  2OH2 A;  5KT2 A;  3QEA Z;  2KHV A;  4GXK A;  3C2K A;  4M9J A;  2BPG A;  1SV0 C;  4QWA A;  4YG2 A;  2WAQ F;  9ICT A;  4QZG A;  1F5S A;  2ZIV B;  3UQ2 A;  4C80 A;  4FBU A;  3PX4 A;  2FDR A;  5FP0 A;  4O3R A;  2RDJ A;  2ZJA A;  5J0R A;  4O0I A;  9ICA A;  1ZQT A;  4U6P A;  4DSK A;  3KHL A;  2BCQ A;  4PPX A;  1PVR A;  3PO5 A;  4QZ9 A;  1UCV A;  2W7O A;  2YTU A;  4NWI A;  4FS1 A;  5DGA A;  3PW5 A;  5AM5 A;  5EE1 A;  4US9 A;  4YR2 A;  1ZQC A;  2KHQ A;  5AKI A;  4KLU A;  2WF7 A;  2F1I A;  2HCF A;  4FZM A;  5EWF A;  2BKE A;  3PO4 A; 
#chains in the Genus database with same CATH homology
 5J8Y C;  1V85 A;  2KSO A;  4MHV A;  4NL9 A;  4PZN A;  5JRT A;  2GLE A;  1PK1 B;  1LKY B;  1SXE A;  2DKZ A;  3SEI A;  3HIL A;  2L5Y A;  2B6G A;  2QB1 A;  2F3N A;  3BS5 A;  5JU5 A;  2KSO B;  5KNI A;  2KE7 A;  2QKQ A;  2F8K A;  1X40 A;  3IDW A;  2JV3 A;  4PZO A;  4IS7 A;  3TAD C;  1UQV A;  2KG5 A;  3H8M A;  2QB0 B;  3BQ7 A;  1B4F A;  2QAR B;  1SV4 A;  2Y9U A;  2KIV A;  5L1M A;  1KW4 A;  3KKA A;  1SV0 A;  2ES6 A;  2EAO A;  3KKA C;  2ESE A;  5JTI A;  1SV0 C;  3TAD A;  2D8C A;  1B0X A;  2K4P A;  2F44 A;  2DL0 A;  2KMD A;  2DKX A;  1F0M A;  1PK3 A;  2D3D A;  1JI7 A;  3TAC B;  5F3X B;  2E8N A;  1SGG A;  1OW5 A;  3SEN A;  1RG6 A;  5J8Y A;  2K60 A;  2LMR A;  2E8O A;  1UCV A;  2YTU A;  1DXS A;  1V38 A;  4NJ8 A;  2Y9T A;  2FE9 A;  3BS5 B;  4RQN A;  1OXJ A;  2EAN A;  2EAM A;  1X9X A;  2EAP A;  1SXD A;  3BS7 A;  1X66 A;  4RQM A;  1WWV A;  1PK1 A;  2QB0 A;  2E8P A;  1LKY A;  2QAR A;  1WWU A;  2LPE A;  3K1R B;  2E8M A;  4NL9 C;  1Z1V A;  1COK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...