2EAOA

Solution structure of the c-terminal sam-domain of mouse ephrin type-b receptor 1 precursor (ec 2.7.1.112)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
GSSGSSGSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-B receptor 1
publication title Solution structure of the C-terminal SAM-domain of mouse ephrin type-B receptor 1 precursor (EC 2.7.1.112)
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 15
structure length 99
sequence length 99
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2eaoA01
1X9XA 3H8MA 2D3DA 1KW4A 1SV4A 2DKXA 2EANA 1V85A 2K4PA 2KE7A 1JI7A 2E8MA 1LKYA 2E8PA 2F3NA 2DKZA 2QARB 4IS7A 2JV3A 3TACB 2ES6A 1X40A 5J8YC 1DXSA 1PK3A 3SEIA 2K60A 1WWVA 5JTIA 1LKYB 1WWUA 1COKA 2E8NA 2QB1A 2Y9UA 3TADA 1F0MA 2KMDA 2YTUA 4NJ8A 5KNIA 2D8CA 3HILA 3SENA 1B4FA 2L5YA 5JRTA 1SGGA 2GLEA 1OXJA 1Z1VA 3K1RB 1PK1A 1RG6A 3BS7A 2KIVA 1SXDA 2ESEA 1X66A 4PZNA 1SV0A 5L1MA 2FE9A 2F8KA 1SXEA 5F3XB 2KSOA 2KG5A 4PZOA 2EAPA 3BS5A 2DL0A 3TADC 1UQVA 3IDWA 4MHVA 2LPEA 1PK1B 4RQNA 2QB0A 2QKQA 2EAMA 4NL9A 3BQ7A 1V38A 2EAOA 2LMRA 2B6GA 5J8YA 3KKAA 2KSOB 4NL9C 1UCVA 4RQMA 3BS5B 1OW5A 5JU5A 1SV0C 2E8OA 2F44A 2QARA 3KKAC 1B0XA 2QB0B 2Y9TA
chains in the Genus database with same CATH superfamily
5DGBA 4FZLA 1KLNA 4MF8A 5HHHA 2E5SA 2KHVA 3B0YA 1L3VA 1QSYA 4DOAA 3RH6A 2E8PA 4DCCA 3UM9A 1SL0A 4PH5A 4F5QA 2KJ9A 2P35A 2LHTA 2LYAA 4PJ0U 4C80A 2XIDA 4DLGA 5J0QA 9ICQA 4BJQA 2W8KA 3PZPA 4B6JA 7ICHA 4IL6U 2KZMA 4F91B 2IA6A 1X42A 3PMNA 4ECQA 2ASJA 1F0MA 4UAZA 1L7MA 3TAQA 3GV7B 9ICNA 1TAMA 1SGGA 4ECUA 5GTIU 4FO6A 2G09A 5L1IA 4RQ4A 4P0PB 4C8MA 5AM3A 3HKZC 7ICJA 2RQ5A 1PK1A 3QXGA 8ICLA 2VJ4A 3NS1A 4YD2A 4ECXA 4BXOB 2AH5A 5KFAA 1JMSA 3E0FA 2RDIA 3Q8QB 2LBOA 2LYBA 3AU2A 5DDYA 4OO1J 1NOMA 3UMBA 1XO0A 5TISU 4F93B 4Q45A 2JZBA 3PSTA 1BGXT 4F4YA 4DL5A 4O3RA 1L8OA 4NM2A 3RB3A 4KLQA 4PHEA 2K89A 2ZIXB 3WK4A 1OW5A 4Y2QA 1TVAA 4UAWA 5KFXA 3SV3A 1B0XA 2K8BB 1KFDA 3QX7A 5AM1A 4J9OA 4I2HA 8ICGA 2GO7A 4Y2XA 2BDUA 2V4RA 3TQ1A 3RH5A 3N28A 8ICBA 3V7LA 2F1HA 4F5NA 1ZQGA 4LVSA 5AK6A 5CA7A 3H0LB 1NK0A 4J9SA 2W7PA 1SL2A 5ALNA 4ED3A 3WK8A 3MDAA 5EE1A 1S0NA 3NTUA 4JMUA 2HHUA 1ZQTA 3LK9A 4PHPA 3FAHA 5DB8A 4YQWA 2PI5A 2BGWA 1ZQKA 1RXWA 4DQSA 4DO9A 8ICYA 3M6KA 4ELTA 1S0MA 1HUOA 1YT3A 2KZ3A 1XC9A 5KG4A 4DQIA 2W9AA 1K5OA 1B4FA 1ZETA 5KFHA 1N56A 1Z1VA 4ELUA 4UAUA 5J29A 2W3SA 1RG6A 5IIMA 2H3QA 5J2IA 2W3RA 1EXNA 4Q8FA 2C2EA 4J9MA 2OEHA 2WHEA 2ALZA 3SZ2A 3RF9A 3TADC 4KLJA 3IP4B 2FMSA 2XI9A 3OPXA 2ISPA 4BX9C 4RQNA 1M6YA 3LDAA 2VA3A 5DLGA 3KHGA 2CXYA 1KTQA 3QYPA 5ALPA 3SAGA 2JGAA 5J0TA 1BPXA 5ALIA 3GIKA 2K8CB 1Q3UA 3WK7A 4I2JA 1NKCA 4AYBC 9ICHA 3PX4A 5KT4A 1N60A 2ZJ5A 2WB1F 2PFQA 3PMLA 4F72A 2MUTA 2WAQF 4TUSA 3KFUF 4BGDA 3UQ0A 1U48A 9ICGA 3WK9A 7ICEA 2MA1A 5AKEA 4O3OA 3PVXA 2ZTEA 2AU0A 1MN8A 3F2BA 4NLGA 2GOLA 3N7SC 3T5JA 1Q46A 5AI4A 4B9LA 4YD1A 5AKJA 1KKXA 2V4QA 5AHXA 3QZ7A 1DXSA 4GIBA 4KLGA 4KX5A 3RH4A 4FZNA 2K60A 2QLTA 3PR5B 1HUZA 2HHTA 3DDHA 3PW7A 1ZYQA 9ICSA 2EZYA 1COKA 5IIOA 2XY6A 8ICKA 2YMPA 2UVVA 2KMDA 2UVUA 2YTUA 5KT2A 3RBDA 3AQEA 2M0NA 1MC8A 1S9FA 1Z19A 1BPBA 3RR8A 5KFPA 2NRXA 1L6NA 2AQ4A 2ODGA 4QNLA 3F2CA 4Q43A 1D8LA 2ZUBA 4RPXA 1X9SA 4F2SA 1XSNA 2JHDA 4ZH4A 4DFJA 1ZQIA 3ZDBA 4XRHA 4LZDA 5DKWA 1BPDA 1Z1BA 9ICRA 3HT3A 1B22A 1VDVA 4C8KA 1RQLA 1S0OA 3RJEA 4KLOA 3MC1A 3LYSA 4YG2A 5J2CA 3PW4A 3FDSA 3UXNA 4HYKA 2R8GA 4DFPA 2NO4A 1S76D 1TV9A 4OJ6A 2W43A 1YZ7A 2G5IB 2KN7A 3BS5B 2VKQA 4DL3A 5L1KA 2ZTCA 1KQQA 1L3UA 3MR5A 3IG8A 1L5UA 3IRUA 9ICPA 2HBLA 1FFVA 5C5JA 2KICA 4OJPA 1LKYA 2YB1A 1JXLA 9ICTA 4YN4A 4MFAA 4PGXA 2G08A 2CPRA 5J0SA 4MEXA 2RRDA 5J8YC 1ZRNA 1ZQYA 4UBBA 1TK5A 4IR9A 4RZRA 4C8LA 2PFPA 4KLMA 3SEIA 4GXKA 1NJYA 3H8JA 2JEIA 4E0DA 4QJFB 3BZKA 4WJ3B 2NRTA 2NRVA 3RBEA 3ZDDA 1F44A 5HMMA 1N63A 2JH1A 5KG3A 2HVIA 2D8CA 2BQ3A 5G5GA 1KL9A 2W55A 3T5LA 5KT5A 1ZQDA 5HNKA 4P2HA 4MF2A 3EPGA 5IILA 2ZJ8A 3RFAA 2Q0ZX 5L1MA 3GDXA 3CP8A 1CI4A 1X6IA 1RPLA 4Y2YA 2HHWA 4QZ9A 2J6UA 3HPOA 3ONNA 5GTHU 2XO7A 2ZUCA 5J2FA 3IV6A 3BQ7A 2G07A 5KAFU 1BPZA 4O3SA 3F53A 4ECVA 3C1ZA 8ICEA 3KKAA 3PW0A 4PGYA 4ED6A 5KG0A 2H3FA 1KBUA 5KFCA 3QUBA 5JU5A 1ZQUA 3V6HA 5L9XA 4EBDA 1SWVA 3ZDAA 4US9A 4RU9A 5KFGA 4M9LA 3OTQA 5AKLA 1ZQPA 1CUKA 5T14A 2YMQA 4EELA 4DFMA 2BCSA 9ICEA 2OCEA 4UB4A 4F4WA 7ICVA 4UASA 4QZDA 2A19A 2G5HB 4EEKA 3PW2A 4IRCA 9ICIA 1F5SA 2FMPA 1VLBA 2LM1A 2DQNB 2VANA 2WFAA 5KFNA 4GLXA 2DUYA 3UXPA 8ICJA 1WWUA 2RHFA 2J6SA 4P0PA 3MFHA 2F1IA 5DDMA 4YP3A 2JR5A 4ECTA 4PHDA 3MR2A 3JPQA 1XSPA 1N5XA 8ICIA 2KNJA 5L1LA 2R8IA 5KT3A 3C5GA 3GIJA 1C20A 7ICRA 3M1YA 1N62A 3SI8A 4QIWF 5D4BA 1ZQJA 3L5KA 4PZNA 3MDCA 4M9NA 3UMGA 4RUCA 1PZNA 3GFKB 1JUDA 3PO4A 8ICPA 2ZIXA 4TQRA 3RR7A 3HRDD 3M9OB 2YY6A 5ALWA 2R8HA 4C4RA 5F9LA 5KFVA 3M7DA 5AKGA 2AXTU 4GXJA 1XNSA 4NV0A 1YZ6A 2HOIA 5KFRA 2DGZA 2BCUA 3SR6A 1S97A 8ICXA 2PMZC 2VIXA 2DPIA 5ALLA 4J9KA 3AQFA 3WKEA 9ICOA 5AIBA 1ZQQA 3H7IA 1WYGA 3GILA 2XCAA 2QB0B 3WK6A 4R63A 3ISDA 2ASLA 2AGOA 4KITB 2YN4A 1Z00B 1V85A 5KFJA 4CDGA 3J81j 1UT8A 5HR7A 9ICCA 2F3NA 2VJ5A 2JH7A 4IQVA 4EENA 4DOBA 1ZD2P 4I2CA 4QZCA 4EEYA 4DFDA 3QU2A 2WF7A 1IIPA 1X40A 3C21A 1PK3A 5ALYA 4ACOA 4DF8A 3ETRA 3NASA 2PI4A 5D46A 5K4LA 4IQWA 4UARA 2IOFA 2G06A 5CP2A 2HOQA 4CRXA 2P6RA 1KN5A 1AROP 5KNIA 2BPGA 3S6JA 1NK6A 7ICLA 2JRZA 4M9HA 4Y2JA 2UVWA 5J0PA 7ICPA 2HMXA 2KIVA 4YMMA 3RB4A 1SXDA 5DG9A 4USAA 4F4ZA 1J2NA 2AJQA 1T8EA 3RRHA 2Q4TA 4DQRA 4CCHA 4F92B 2K4EA 5ALMA 2EAPA 3G6VA 1UHUA 5KTQA 3PSIA 5J0XA 5J0OA 2W8LA 2HBKA 5ALSA 5ALUA 4C4TA 5KT6A 5IIJA 1J2MA 1HEKA 3C23A 2PFOA 5J2AA 2W9CB 1KEJA 2LKYA 4FBUA 3KKAC 2CN1A 3PSFA 3C2LA 3PW5A 4EYHB 2KVSA 3BQ2A 1X9MA 2YMLA 4JUZA 3NRZA 3PR4A 2BQRA 1ZQLA 1QQ6A 4GFJA 5KFIA 1NI3A 2OXOA 5J0YA 1SIJA 3RJKA 4J9NA 5J2KA 1NKBA 9ICBA 4FFDA 4KLSA 4P4MA 4IS7A 9ICUA 4F3OA 4M04A 3QEAZ 5D49A 2I5HA 2D6FC 4EX6A 3L4PA 1ZQVA 1HJPA 4LJXA 2H3IA 4G9BA 2FLLA 3PY8A 4DL6A 2XY7A 4Z6FA 5KL8B 5EE9A 1L8LA 4C4SA 2L5YA 8ICHA 1NK9A 2HBMA 3ZDEA 2G0AA 3RAXA 3QU4A 5KG2A 2YMMA 4ED1A 1J97A 2R18A 1A76A 4FBTA 3I28A 2ZIVB 3HW8A 4KLDA 5F3XB 5BPCA 3T79A 4DSFA 1BPEA 5KFBA 5KFUA 2A1JB 3BS5A 4I2FA 1ZQCA 1V9PA 2KJ8A 1MA7A 3KD3A 1COOA 2V9WA 3PX0A 4PPXA 1ZJNA 5B66U 3RB6A 3KHRA 2OM6A 1UCVA 4I29A 3N97B 3NVYA 4O5EA 2WB1C 2WAQC 5ALXA 2KOBA 3WKDA 4O3MA 4EYIB 1JX4A 4G3IA 4EZ6A 2MU2A 3VC8A 3HP6A 2Y0SF 3D2QA 3V72A 7ICQA 3ED5A 1S5LU 1DGSA 3GIMA 1QLNA 2HHSA 3GV8B 2KTQA 1ZQZA 4B9SA 2DKZA 2FPKA 5AK3A 1RDFA 2LYHA 2HCFA 1T3NA 2YB4A 3QEBZ 4JWMA 2BCRA 1DK3A 3PX6A 2R8KA 9ICFA 4KX3A 4M2YA 1X9WA 1QTMA 2GWSA 2JEJA 3LVWA 3H0RB 4OCZA 4U7CA 4ED0A 3KHLA 3OSNA 4HAIA 4DSIA 2BPFA 4Y2RA 5A0LA 3EPIA 4KLFA 1BNPA 3AN1A 3WKCA 2YX8A 3OJUA 5CJ7A 1X66A 1IXRA 4DF4A 2B0CA 1SV0A 3BQTA 3CRXA 1D8YA 4RQ8A 4BDPA 4AYBF 4B9VA 1SXEA 1ED1A 1NJXA 5KAIU 2PKEA 2KJ5A 5KT7A 1D9FA 4O9MA 3JPPA 4QW9A 5KFSA 2H3ZA 1JRPA 2FDRA 2WF8A 2DFLA 4RUAA 3RJFA 5DQGA 5JUMA 1JALA 4RQ7A 5AI0A 5AKYA 1ZQRA 4ED8A 3C29A 1A0PA 5IINA 1KFSA 3SYZA 7ICFA 1Q3VA 2Y9TA 2EQYA 1ZQHA 2KP7A 4C7ZA 8ICOA 5AM0A 4K4GA 2DF4B 8ICCA 3NGDA 5B5EU 2I6XA 1NZBA 4F5RA 7ICGA 2KZZA 2ATLA 4YMNA 2NO5A 3UXOA 4YXJA 4QWAA 1Z3EB 2KV2A 3F2DA 3JPNA 4CF3A 1HIWA 4RNOA 8ICMA 4QZIA 3F5AA 4I2DA 5EWEA 4TURA 4XUSA 5J2DA 3RTVA 5KFEA 3JPTA 2XGPA 2E1FA 4DL2A 2XCPA 3CYMA 4NLBA 1L3SA 5JRTA 2HOFA 8ICQA 2Y1JA 3K1RB 5KG1A 3ZD8A 1TFRA 2FE9A 1QQ5A 1N2XA 1C7YA 2HI0A 3L3FX 8ICNA 4KLHA 3M9NB 4RNMA 4Y2UA 3NVZA 1H38A 4DEZA 4RT2A 3IDWA 2FPMA 5J2JA 4PHAA 4P4PA 2N1RA 4ICAA 5KG5A 4EZ9A 2QB0A 4RT3A 3D2SA 3V7KA 3FYHA 1KSPA 4O3QA 1Z00A 5ALFA 3K75D 5DBAA 2K4IA 4DSLA 2PXIA 4U6PA 5AK5A 4KLUA 4CF4A 4J9LA 3A0BU 5AM2A 3LVVA 2KKPA 2C22A 1RQNA 2AHOB 1VJ5A 5AI6A 1ZRMA 4UB3A 5BOLA 3NVVA 5HMLA 3UQ2A 2DKXA 4RQ1A 1JN3A 1XO1A 8ICFA 1JI7A 1QCKA 5ALEA 4KLTA 2JEGA 2EDUA 3ZD9A 3THVA 1N61A 3C2MA 1SKRA 2RDJA 9ICLA 2WF5A 2BQUA 1IG6A 5AKKA 3KTQA 4QWBA 2FLNA 2LM4A 2JMGA 4MFCA 4RQ2A 2A1AA 3A0HU 3F5EA 2JXJA 4KLEA 3K1ZA 4QW8A 3Q8MA 1L3TA 2HVHA 3MFIA 5KFKA 3RJGA 2MRLA 1B43A 4ECWA 3Q8KA 4DQPA 3CNHA 4QWEA 3GU3A 2I9GA 1KRPA 2GLEA 2OYYA 5ALOA 2WF9A 4KMUA 2ZG6A 5J2BA 2B21A 5DG7A 8ICWA 3QZ8A 5KFQA 3BQ1A 1U47A 3QU5A 4GC7A 2KG5A 3C2KA 4ED2A 2W9CA 1DK2A 1LB2B 3RB0A 4KLIA 1JXEA 4M47A 3JPOA 4RQ3A 1L7OA 4JV0A 4QZEA 1JIHA 1SZHA 2NV3A 5KFYA 3M8RA 2NRZA 5KG6A 2HHQA 1X6JA 2O6KA 5EE3A 5AI5A 4NWIA 4DLEA 2Z7JA 1T3QA 5DQIA 2IBKA 1X9XA 2IMWP 5J0RA 1QSSA 1WG8A 3EW9A 2K4PA 4DQQA 2DPJA 4CGZA 2P66A 2HHVA 4QZBA 3ISCA 3TFRA 4P0QB 4C8OA 9ICWA 2QARB 3ZDCA 5FP0A 2JV3A 1SZPA 3NUQA 2ZIWB 4ECZA 1BVSA 5AM5A 3KZXA 2I1QA 3N7PD 5J2HA 5G5HA 5C0YA 4QZHA 1SB3C 1WWVA 4OD0A 2F1JA 5HP4A 5ALQA 5DGAA 5CEHA 5L1JA 3VCBA 3GZFA 2BZFA 4Z6DA 2HW3A 3TADA 1ZQNA 3HWTA 4DL7A 3NVWA 1DGJA 5KFFA 9ICKA 2F76X 3IN5A 2ZIVA 5DB7A 3GQCA 3TANA 2A1JA 1ZJMA 2HSZA 2KK0A 4QZ8A 3JPRA 4Y2PA 4KTQA 4A8EA 5CHGA 3BS7A 3BJYA 3AU6A 2IOFK 4JK1A 2FMQA 5KFWA 2K4HA 3FC4A 1ZQFA 4R66A 2MSNA 4JWNA 2E1EA 5J0WA 4F2RA 5IIKA 1D9DA 3QU7A 4B9UA 1Y88A 2XICA 2CRXA 1O03A 2RP5A 4DS5A 1XSLA 3WK5A 1L7NA 4NL9A 5KFLA 3H4DA 3KZIU 2AGQA 4Q8EA 3E2EA 8ICTA 5DBBA 2BCVA 2OH2A 3H8SA 2B6GA 1ZOLA 5AI9A 1U45A 1U4BA 4YR3A 2F8LA 3UPQA 4MEYA 4ECRA 1OUQA 5DB6A 5CB1A 3SQIA 2WF6A 1TAQA 5AKZA 4ECSA 3M6ZA 3B9JA 2EANA 8ICZA 1K1QA 3SMVA 8ICSA 5CR0A 2WTFA 4M6WB 3EUB2 3R9KA 1NK7A 3RJHA 3G6YA 4C7YA 4ED7A 5KFDA 1GO3F 3TI0A 5EWFA 4CE6A 1TAUA 4M0AA 1U9LA 5ALJA 5KFTA 3V6JA 3QU9A 4OJ5A 4I2IA 1NK5A 2A3VA 1ECWA 1P7DA 2E8NA 3MGHA 4F71A 7ICSA 3CW2C 3H40A 2BPCA 4R8UA 2KD1A 4NJ8A 1FEZA 1AQ6A 7ICIA 4YXMA 4F4KA 5AK4A 4NXZA 1N5WA 4XQ8A 1ZQAA 3HKZF 2RLTA 3TARA 2ZTDA 1CEZA 1UT5A 7ICOA 2ZXHA 2F77X 1RYSA 4X5VA 4I2EA 5HHIA 5ALDA 2R8JA 4O3NA 3AEVA 1S77D 5DLFA 3HX0A 3T5KA 2KFNA 3SD7A 2Y1IA 4RQ5A 5ALZA 5CRXA 7ICKA 2W03A 5J0UA 2BDPA 2FI1A 1SL1A 1N48A 2W9BB 5DBCA 4KN7A 4R65A 2UVRA 3E58A 1D8BA 4CF5A 2QKQA 2EZZA 4QWDA 2P6UA 5ALRA 5AIAA 4TUPA 2W11A 4F5PA 1Z4OA 4DL4A 5J8YA 4IQUA 2KHQA 2KSOB 3DEEA 4FZMA 2ZIUB 4XA5A 2F2AB 2C28A 3MABA 5IIIA 5EOZA 1SKSA 4QZFA 3SAHA 4KMOB 4RQ6A 2VA2A 1S10A 2Y0SC 8ICRA 4DSJA 3H8WA 4OJLA 4JV2A 9ICAA 4B9MA 1SV4A 2KFZA 8ICUA 2E8MA 3WKAA 3UMCA 3T3FA 3LWMA 1T94A 4O5CA 2VA8A 4DS4A 2W9MA 1TKDA 7ICNA 1TE2A 5KFMA 3T5HA 4YCXA 1NJWA 3O0FA 3SV4A 1PVPA 4GC6A 2M9NA 3N4MB 1S0VA 5AICA 3TKAA 1ZQ1C 5JTIA 4J9RA 4DSKA 5EE0A 4US8A 3D6JA 1WCNA 2Y9UA 4P4OA 2ISOA 4NLZA 3IG5A 4I28A 4I2BA 3SAFA 3IHQB 2HBJA 4R64A 4MFFA 4BUGA 3OGUA 1MSWD 3JPSA 3HILA 4M9GA 1NNLA 1BPYA 4O5KA 4I27A 1FO4A 2ESEA 2J6TA 1T4GA 5H2FU 1A6SA 1X2IA 2BCQA 4RPZA 4IR1A 1MQ2A 9ICMA 5F9NA 4PL1A 2DL0A 1Q8KA 1PUZA 1UQVA 3KBBA 4MHVA 8ICVA 4DFKA 5DB9A 1PK1B 1K1SA 2NYVA 3V7JA 2BR0A 2KIWA 4UAVA 1V38A 3C5FA 1NK8A 1MQ3A 4UATA 4R8UB 4J9PA 4NL9C 4O0IA 4RQMA 5AKHA 9ICVA 4BWMA 4NLKA 9ICJA 3TAPA 5ALGA 3MBYA 2XVTA 2JZBB 3TFSA 3K4GA 1WUDA 4BWJA 1ZQSA 3KHHA 3IM1A 3QUQA 4DOCA 5AM4A 3PV8A 4FE3A 4OJOA 5DG8A 4YFKA 2W54A 4YR2A 3OJSA 4EBCA 4JB3A 4IQTA 3TACB 2ES6A 5KL1B 4K4IA 3H0MB 5J2GA 3QUTA 4FS2A 2H3VA 4C8NA 2C2DA 1FFUA 4IC9A 7ICUA 1QH9A 1S8OA 1WCLA 4KLLA 2BKEA 3ALRA 4B9TA 4UB8U 4Y2TA 4NLNA 5HR6A 4YVZA 4I2AA 2IHNA 3ZI4A 4DSEA 1RZTA 5AKXA 3MR3A 4PGQA 1IV8A 3AL0B 2H5XA 3GV5B 4CNQA 1BNOA 2ZJAA 5ALVA 1PVRA 3EZ5A 1NZPA 3ICXA 4PZOA 3MGIA 3C1YA 4UQGA 4ELVA 4UW9A 4UB1A 2LPEA 1DRGA 1ZQEA 4PL2A 2OWOA 3C28A 3QUCA 4FS1A 2FJ6A 3U26A 2FLPA 1NKEA 1UA1A 4ECYA 5AI8A 1QSLA 7ICMA 1NK4A 4ZOHC 3AM9A 1NJZA 1QQ7A 1ZQWA 1T7PA 3D2NA 3BDPA 1LV5A 4P0QA 1RXVA 2PFNA 2E8OA 2F44A 2QARA 4IRKA 4I2GA 2AGPA 1A77A 4UB5A 2ZIWA 4GXIA 4B9NA 3PSPA 4RPYA 5KFZA 1KDHA 3Q8RB 2NRWA 5E79U 2D3DA 1KW4A 1DOQA 2KVCA 1ZD3A 5TZVA 2KE7A 3OHAA 4F8RA 4KN4A 1RYRA 4EBEA 2XY5A 2MUTB 3H4BA 2E3TA 2EZXA 3DV9A 4Y2SA 3QE9Y 1PVQA 1U49A 2KEYA 2EH9A 1ZD5A 2FPLA 4UB6U 2QB1A 3Q8PB 1ZXIA 2C2RA 3ORYA 5J2EA 3G6XA 2AQ0A 5CWRA 1UA0A 1RYUA 2ZUDA 4RQ0A 4AP9A 1ZQXA 4EX7A 5AKIA 3SENA 1TK8A 2HDOA 5EWGA 1CRXA 3PNCA 5ALTA 3ISBA 3HJEA 4NY8A 4J9QA 3AUOA 5KFOA 4QZGA 4NLCA 2JEFA 4LZGA 2ZXIA 3RJIA 3LWLA 3PO5A 1URJA 4YR0A 3EWAA 1V97A 3OSPA 4QZAA 5DQHA 3EYZA 3I1YA 1UPHA 3WU2U 1SWWA 4RNNA 1XWLA 2HHXA 3ETLA 1TK0A 4QIWC 4IRDA 2EAOA 2LMRA 4YMOA 1SKWA 3M9MB 4M9JA 3AMZA 3Q8SB 4UBCA 1SV0C 4M6WA 2BHNA 4K4HA 1XU4A 1XS9D 3H8MA 2ASDA 4C0ZA 3Q8LA 1FIQA 3OHBA 1IM4A 4F4XA 3MGVA 4JV1A 2DWQA 2LI6A 3BQ0A 4BXOA 3QNMA 4TQSA 4NM1A 2XC9A 2GH1A 3M8SA 3N7RC 2W7OA 5BOMA 1ZQMA 4Z6EA 4UAYA 2XGQA 1LKYB 1KFTA 1ZQOA 5ALHA 4DWIA 3NRWA 1L7PA 4UB2A 2IHMA 1RM6C 3RJJA 2YQEA 4F5OA 3WKBA 8ICAA 4Z6CA 3MR6A 1OXJA 5ALKA 7ICTA 1ZD4A 3FM9A 4Q44A 3BZCA 1Z4NA 2W9BA 1JROA 3RAQA 2F8KA 2KSOA 9ICXA 2OHFA 4TUQA 3V6KA 4F50A 1O08A 2ZIUA 1LVHA 3B0XA 3I76A 4O3PA 4J03A 2IOHA 2EAMA 3KOOA 2W04A 2MAXA 4QWCA 2DBYA 2KKVA 4Y2VA 2PMZF 3RRGA 5KG7A 1ZQBA 2K8AA 3GIIA
chains in the Genus database with same CATH topology
1X9XA 3H8MA 2D3DA 1KW4A 1SV4A 2DKXA 2EANA 1V85A 2K4PA 2KE7A 1JI7A 2E8MA 1LKYA 2E8PA 2F3NA 2DKZA 2QARB 4IS7A 2JV3A 3TACB 2ES6A 1X40A 5J8YC 1DXSA 1PK3A 3SEIA 2K60A 1WWVA 5JTIA 1LKYB 1WWUA 1COKA 2E8NA 2QB1A 2Y9UA 3TADA 1F0MA 2KMDA 2YTUA 4NJ8A 5KNIA 2D8CA 3HILA 3SENA 1B4FA 2L5YA 5JRTA 1SGGA 2GLEA 1OXJA 1Z1VA 3K1RB 1PK1A 1RG6A 3BS7A 2KIVA 1SXDA 2ESEA 1X66A 4PZNA 1SV0A 5L1MA 2FE9A 2F8KA 1SXEA 5F3XB 2KSOA 2KG5A 4PZOA 2EAPA 3BS5A 2DL0A 3TADC 1UQVA 3IDWA 4MHVA 2LPEA 1PK1B 4RQNA 2QB0A 2QKQA 2EAMA 4NL9A 3BQ7A 1V38A 2EAOA 2LMRA 2B6GA 5J8YA 3KKAA 2KSOB 4NL9C 1UCVA 4RQMA 3BS5B 1OW5A 5JU5A 1SV0C 2E8OA 2F44A 2QARA 3KKAC 1B0XA 2QB0B 2Y9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9X A;  3H8M A;  2D3D A;  1KW4 A;  1SV4 A;  2DKX A;  2EAN A;  1V85 A;  2K4P A;  2KE7 A;  1JI7 A;  2E8M A;  1LKY A;  2E8P A;  2F3N A;  2DKZ A;  2QAR B;  4IS7 A;  2JV3 A;  3TAC B;  2ES6 A;  1X40 A;  5J8Y C;  1DXS A;  1PK3 A;  3SEI A;  2K60 A;  1WWV A;  5JTI A;  1LKY B;  1WWU A;  1COK A;  2E8N A;  2QB1 A;  2Y9U A;  3TAD A;  1F0M A;  2KMD A;  2YTU A;  4NJ8 A;  5KNI A;  2D8C A;  3HIL A;  3SEN A;  1B4F A;  2L5Y A;  5JRT A;  1SGG A;  2GLE A;  1OXJ A;  1Z1V A;  3K1R B;  1PK1 A;  1RG6 A;  3BS7 A;  2KIV A;  1SXD A;  2ESE A;  1X66 A;  4PZN A;  1SV0 A;  5L1M A;  2FE9 A;  2F8K A;  1SXE A;  5F3X B;  2KSO A;  2KG5 A;  4PZO A;  2EAP A;  3BS5 A;  2DL0 A;  3TAD C;  1UQV A;  3IDW A;  4MHV A;  2LPE A;  1PK1 B;  4RQN A;  2QB0 A;  2QKQ A;  2EAM A;  4NL9 A;  3BQ7 A;  1V38 A;  2EAO A;  2LMR A;  2B6G A;  5J8Y A;  3KKA A;  2KSO B;  4NL9 C;  1UCV A;  4RQM A;  3BS5 B;  1OW5 A;  5JU5 A;  1SV0 C;  2E8O A;  2F44 A;  2QAR A;  3KKA C;  1B0X A;  2QB0 B;  2Y9T A; 
#chains in the Genus database with same CATH topology
 5DGB A;  4FZL A;  1KLN A;  4MF8 A;  5HHH A;  2E5S A;  2KHV A;  3B0Y A;  1L3V A;  1QSY A;  4DOA A;  3RH6 A;  2E8P A;  4DCC A;  3UM9 A;  1SL0 A;  4PH5 A;  4F5Q A;  2KJ9 A;  2P35 A;  2LHT A;  2LYA A;  4PJ0 U;  4C80 A;  2XID A;  4DLG A;  5J0Q A;  9ICQ A;  4BJQ A;  2W8K A;  3PZP A;  4B6J A;  7ICH A;  4IL6 U;  2KZM A;  4F91 B;  2IA6 A;  1X42 A;  3PMN A;  4ECQ A;  2ASJ A;  1F0M A;  4UAZ A;  1L7M A;  3TAQ A;  3GV7 B;  9ICN A;  1TAM A;  1SGG A;  4ECU A;  5GTI U;  4FO6 A;  2G09 A;  5L1I A;  4RQ4 A;  4P0P B;  4C8M A;  5AM3 A;  3HKZ C;  7ICJ A;  2RQ5 A;  1PK1 A;  3QXG A;  8ICL A;  2VJ4 A;  3NS1 A;  4YD2 A;  4ECX A;  4BXO B;  2AH5 A;  5KFA A;  1JMS A;  3E0F A;  2RDI A;  3Q8Q B;  2LBO A;  2LYB A;  3AU2 A;  5DDY A;  4OO1 J;  1NOM A;  3UMB A;  1XO0 A;  5TIS U;  4F93 B;  4Q45 A;  2JZB A;  3PST A;  1BGX T;  4F4Y A;  4DL5 A;  4O3R A;  1L8O A;  4NM2 A;  3RB3 A;  4KLQ A;  4PHE A;  2K89 A;  2ZIX B;  3WK4 A;  1OW5 A;  4Y2Q A;  1TVA A;  4UAW A;  5KFX A;  3SV3 A;  1B0X A;  2K8B B;  1KFD A;  3QX7 A;  5AM1 A;  4J9O A;  4I2H A;  8ICG A;  2GO7 A;  4Y2X A;  2BDU A;  2V4R A;  3TQ1 A;  3RH5 A;  3N28 A;  8ICB A;  3V7L A;  2F1H A;  4F5N A;  1ZQG A;  4LVS A;  5AK6 A;  5CA7 A;  3H0L B;  1NK0 A;  4J9S A;  2W7P A;  1SL2 A;  5ALN A;  4ED3 A;  3WK8 A;  3MDA A;  5EE1 A;  1S0N A;  3NTU A;  4JMU A;  2HHU A;  1ZQT A;  3LK9 A;  4PHP A;  3FAH A;  5DB8 A;  4YQW A;  2PI5 A;  2BGW A;  1ZQK A;  1RXW A;  4DQS A;  4DO9 A;  8ICY A;  3M6K A;  4ELT A;  1S0M A;  1HUO A;  1YT3 A;  2KZ3 A;  1XC9 A;  5KG4 A;  4DQI A;  2W9A A;  1K5O A;  1B4F A;  1ZET A;  5KFH A;  1N56 A;  1Z1V A;  4ELU A;  4UAU A;  5J29 A;  2W3S A;  1RG6 A;  5IIM A;  2H3Q A;  5J2I A;  2W3R A;  1EXN A;  4Q8F A;  2C2E A;  4J9M A;  2OEH A;  2WHE A;  2ALZ A;  3SZ2 A;  3RF9 A;  3TAD C;  4KLJ A;  3IP4 B;  2FMS A;  2XI9 A;  3OPX A;  2ISP A;  4BX9 C;  4RQN A;  1M6Y A;  3LDA A;  2VA3 A;  5DLG A;  3KHG A;  2CXY A;  1KTQ A;  3QYP A;  5ALP A;  3SAG A;  2JGA A;  5J0T A;  1BPX A;  5ALI A;  3GIK A;  2K8C B;  1Q3U A;  3WK7 A;  4I2J A;  1NKC A;  4AYB C;  9ICH A;  3PX4 A;  5KT4 A;  1N60 A;  2ZJ5 A;  2WB1 F;  2PFQ A;  3PML A;  4F72 A;  2MUT A;  2WAQ F;  4TUS A;  3KFU F;  4BGD A;  3UQ0 A;  1U48 A;  9ICG A;  3WK9 A;  7ICE A;  2MA1 A;  5AKE A;  4O3O A;  3PVX A;  2ZTE A;  2AU0 A;  1MN8 A;  3F2B A;  4NLG A;  2GOL A;  3N7S C;  3T5J A;  1Q46 A;  5AI4 A;  4B9L A;  4YD1 A;  5AKJ A;  1KKX A;  2V4Q A;  5AHX A;  3QZ7 A;  1DXS A;  4GIB A;  4KLG A;  4KX5 A;  3RH4 A;  4FZN A;  2K60 A;  2QLT A;  3PR5 B;  1HUZ A;  2HHT A;  3DDH A;  3PW7 A;  1ZYQ A;  9ICS A;  2EZY A;  1COK A;  5IIO A;  2XY6 A;  8ICK A;  2YMP A;  2UVV A;  2KMD A;  2UVU A;  2YTU A;  5KT2 A;  3RBD A;  3AQE A;  2M0N A;  1MC8 A;  1S9F A;  1Z19 A;  1BPB A;  3RR8 A;  5KFP A;  2NRX A;  1L6N A;  2AQ4 A;  2ODG A;  4QNL A;  3F2C A;  4Q43 A;  1D8L A;  2ZUB A;  4RPX A;  1X9S A;  4F2S A;  1XSN A;  2JHD A;  4ZH4 A;  4DFJ A;  1ZQI A;  3ZDB A;  4XRH A;  4LZD A;  5DKW A;  1BPD A;  1Z1B A;  9ICR A;  3HT3 A;  1B22 A;  1VDV A;  4C8K A;  1RQL A;  1S0O A;  3RJE A;  4KLO A;  3MC1 A;  3LYS A;  4YG2 A;  5J2C A;  3PW4 A;  3FDS A;  3UXN A;  4HYK A;  2R8G A;  4DFP A;  2NO4 A;  1S76 D;  1TV9 A;  4OJ6 A;  2W43 A;  1YZ7 A;  2G5I B;  2KN7 A;  3BS5 B;  2VKQ A;  4DL3 A;  5L1K A;  2ZTC A;  1KQQ A;  1L3U A;  3MR5 A;  3IG8 A;  1L5U A;  3IRU A;  9ICP A;  2HBL A;  1FFV A;  5C5J A;  2KIC A;  4OJP A;  1LKY A;  2YB1 A;  1JXL A;  9ICT A;  4YN4 A;  4MFA A;  4PGX A;  2G08 A;  2CPR A;  5J0S A;  4MEX A;  2RRD A;  5J8Y C;  1ZRN A;  1ZQY A;  4UBB A;  1TK5 A;  4IR9 A;  4RZR A;  4C8L A;  2PFP A;  4KLM A;  3SEI A;  4GXK A;  1NJY A;  3H8J A;  2JEI A;  4E0D A;  4QJF B;  3BZK A;  4WJ3 B;  2NRT A;  2NRV A;  3RBE A;  3ZDD A;  1F44 A;  5HMM A;  1N63 A;  2JH1 A;  5KG3 A;  2HVI A;  2D8C A;  2BQ3 A;  5G5G A;  1KL9 A;  2W55 A;  3T5L A;  5KT5 A;  1ZQD A;  5HNK A;  4P2H A;  4MF2 A;  3EPG A;  5IIL A;  2ZJ8 A;  3RFA A;  2Q0Z X;  5L1M A;  3GDX A;  3CP8 A;  1CI4 A;  1X6I A;  1RPL A;  4Y2Y A;  2HHW A;  4QZ9 A;  2J6U A;  3HPO A;  3ONN A;  5GTH U;  2XO7 A;  2ZUC A;  5J2F A;  3IV6 A;  3BQ7 A;  2G07 A;  5KAF U;  1BPZ A;  4O3S A;  3F53 A;  4ECV A;  3C1Z A;  8ICE A;  3KKA A;  3PW0 A;  4PGY A;  4ED6 A;  5KG0 A;  2H3F A;  1KBU A;  5KFC A;  3QUB A;  5JU5 A;  1ZQU A;  3V6H A;  5L9X A;  4EBD A;  1SWV A;  3ZDA A;  4US9 A;  4RU9 A;  5KFG A;  4M9L A;  3OTQ A;  5AKL A;  1ZQP A;  1CUK A;  5T14 A;  2YMQ A;  4EEL A;  4DFM A;  2BCS A;  9ICE A;  2OCE A;  4UB4 A;  4F4W A;  7ICV A;  4UAS A;  4QZD A;  2A19 A;  2G5H B;  4EEK A;  3PW2 A;  4IRC A;  9ICI A;  1F5S A;  2FMP A;  1VLB A;  2LM1 A;  2DQN B;  2VAN A;  2WFA A;  5KFN A;  4GLX A;  2DUY A;  3UXP A;  8ICJ A;  1WWU A;  2RHF A;  2J6S A;  4P0P A;  3MFH A;  2F1I A;  5DDM A;  4YP3 A;  2JR5 A;  4ECT A;  4PHD A;  3MR2 A;  3JPQ A;  1XSP A;  1N5X A;  8ICI A;  2KNJ A;  5L1L A;  2R8I A;  5KT3 A;  3C5G A;  3GIJ A;  1C20 A;  7ICR A;  3M1Y A;  1N62 A;  3SI8 A;  4QIW F;  5D4B A;  1ZQJ A;  3L5K A;  4PZN A;  3MDC A;  4M9N A;  3UMG A;  4RUC A;  1PZN A;  3GFK B;  1JUD A;  3PO4 A;  8ICP A;  2ZIX A;  4TQR A;  3RR7 A;  3HRD D;  3M9O B;  2YY6 A;  5ALW A;  2R8H A;  4C4R A;  5F9L A;  5KFV A;  3M7D A;  5AKG A;  2AXT U;  4GXJ A;  1XNS A;  4NV0 A;  1YZ6 A;  2HOI A;  5KFR A;  2DGZ A;  2BCU A;  3SR6 A;  1S97 A;  8ICX A;  2PMZ C;  2VIX A;  2DPI A;  5ALL A;  4J9K A;  3AQF A;  3WKE A;  9ICO A;  5AIB A;  1ZQQ A;  3H7I A;  1WYG A;  3GIL A;  2XCA A;  2QB0 B;  3WK6 A;  4R63 A;  3ISD A;  2ASL A;  2AGO A;  4KIT B;  2YN4 A;  1Z00 B;  1V85 A;  5KFJ A;  4CDG A;  3J81 j;  1UT8 A;  5HR7 A;  9ICC A;  2F3N A;  2VJ5 A;  2JH7 A;  4IQV A;  4EEN A;  4DOB A;  1ZD2 P;  4I2C A;  4QZC A;  4EEY A;  4DFD A;  3QU2 A;  2WF7 A;  1IIP A;  1X40 A;  3C21 A;  1PK3 A;  5ALY A;  4ACO A;  4DF8 A;  3ETR A;  3NAS A;  2PI4 A;  5D46 A;  5K4L A;  4IQW A;  4UAR A;  2IOF A;  2G06 A;  5CP2 A;  2HOQ A;  4CRX A;  2P6R A;  1KN5 A;  1ARO P;  5KNI A;  2BPG A;  3S6J A;  1NK6 A;  7ICL A;  2JRZ A;  4M9H A;  4Y2J A;  2UVW A;  5J0P A;  7ICP A;  2HMX A;  2KIV A;  4YMM A;  3RB4 A;  1SXD A;  5DG9 A;  4USA A;  4F4Z A;  1J2N A;  2AJQ A;  1T8E A;  3RRH A;  2Q4T A;  4DQR A;  4CCH A;  4F92 B;  2K4E A;  5ALM A;  2EAP A;  3G6V A;  1UHU A;  5KTQ A;  3PSI A;  5J0X A;  5J0O A;  2W8L A;  2HBK A;  5ALS A;  5ALU A;  4C4T A;  5KT6 A;  5IIJ A;  1J2M A;  1HEK A;  3C23 A;  2PFO A;  5J2A A;  2W9C B;  1KEJ A;  2LKY A;  4FBU A;  3KKA C;  2CN1 A;  3PSF A;  3C2L A;  3PW5 A;  4EYH B;  2KVS A;  3BQ2 A;  1X9M A;  2YML A;  4JUZ A;  3NRZ A;  3PR4 A;  2BQR A;  1ZQL A;  1QQ6 A;  4GFJ A;  5KFI A;  1NI3 A;  2OXO A;  5J0Y A;  1SIJ A;  3RJK A;  4J9N A;  5J2K A;  1NKB A;  9ICB A;  4FFD A;  4KLS A;  4P4M A;  4IS7 A;  9ICU A;  4F3O A;  4M04 A;  3QEA Z;  5D49 A;  2I5H A;  2D6F C;  4EX6 A;  3L4P A;  1ZQV A;  1HJP A;  4LJX A;  2H3I A;  4G9B A;  2FLL A;  3PY8 A;  4DL6 A;  2XY7 A;  4Z6F A;  5KL8 B;  5EE9 A;  1L8L A;  4C4S A;  2L5Y A;  8ICH A;  1NK9 A;  2HBM A;  3ZDE A;  2G0A A;  3RAX A;  3QU4 A;  5KG2 A;  2YMM A;  4ED1 A;  1J97 A;  2R18 A;  1A76 A;  4FBT A;  3I28 A;  2ZIV B;  3HW8 A;  4KLD A;  5F3X B;  5BPC A;  3T79 A;  4DSF A;  1BPE A;  5KFB A;  5KFU A;  2A1J B;  3BS5 A;  4I2F A;  1ZQC A;  1V9P A;  2KJ8 A;  1MA7 A;  3KD3 A;  1COO A;  2V9W A;  3PX0 A;  4PPX A;  1ZJN A;  5B66 U;  3RB6 A;  3KHR A;  2OM6 A;  1UCV A;  4I29 A;  3N97 B;  3NVY A;  4O5E A;  2WB1 C;  2WAQ C;  5ALX A;  2KOB A;  3WKD A;  4O3M A;  4EYI B;  1JX4 A;  4G3I A;  4EZ6 A;  2MU2 A;  3VC8 A;  3HP6 A;  2Y0S F;  3D2Q A;  3V72 A;  7ICQ A;  3ED5 A;  1S5L U;  1DGS A;  3GIM A;  1QLN A;  2HHS A;  3GV8 B;  2KTQ A;  1ZQZ A;  4B9S A;  2DKZ A;  2FPK A;  5AK3 A;  1RDF A;  2LYH A;  2HCF A;  1T3N A;  2YB4 A;  3QEB Z;  4JWM A;  2BCR A;  1DK3 A;  3PX6 A;  2R8K A;  9ICF A;  4KX3 A;  4M2Y A;  1X9W A;  1QTM A;  2GWS A;  2JEJ A;  3LVW A;  3H0R B;  4OCZ A;  4U7C A;  4ED0 A;  3KHL A;  3OSN A;  4HAI A;  4DSI A;  2BPF A;  4Y2R A;  5A0L A;  3EPI A;  4KLF A;  1BNP A;  3AN1 A;  3WKC A;  2YX8 A;  3OJU A;  5CJ7 A;  1X66 A;  1IXR A;  4DF4 A;  2B0C A;  1SV0 A;  3BQT A;  3CRX A;  1D8Y A;  4RQ8 A;  4BDP A;  4AYB F;  4B9V A;  1SXE A;  1ED1 A;  1NJX A;  5KAI U;  2PKE A;  2KJ5 A;  5KT7 A;  1D9F A;  4O9M A;  3JPP A;  4QW9 A;  5KFS A;  2H3Z A;  1JRP A;  2FDR A;  2WF8 A;  2DFL A;  4RUA A;  3RJF A;  5DQG A;  5JUM A;  1JAL A;  4RQ7 A;  5AI0 A;  5AKY A;  1ZQR A;  4ED8 A;  3C29 A;  1A0P A;  5IIN A;  1KFS A;  3SYZ A;  7ICF A;  1Q3V A;  2Y9T A;  2EQY A;  1ZQH A;  2KP7 A;  4C7Z A;  8ICO A;  5AM0 A;  4K4G A;  2DF4 B;  8ICC A;  3NGD A;  5B5E U;  2I6X A;  1NZB A;  4F5R A;  7ICG A;  2KZZ A;  2ATL A;  4YMN A;  2NO5 A;  3UXO A;  4YXJ A;  4QWA A;  1Z3E B;  2KV2 A;  3F2D A;  3JPN A;  4CF3 A;  1HIW A;  4RNO A;  8ICM A;  4QZI A;  3F5A A;  4I2D A;  5EWE A;  4TUR A;  4XUS A;  5J2D A;  3RTV A;  5KFE A;  3JPT A;  2XGP A;  2E1F A;  4DL2 A;  2XCP A;  3CYM A;  4NLB A;  1L3S A;  5JRT A;  2HOF A;  8ICQ A;  2Y1J A;  3K1R B;  5KG1 A;  3ZD8 A;  1TFR A;  2FE9 A;  1QQ5 A;  1N2X A;  1C7Y A;  2HI0 A;  3L3F X;  8ICN A;  4KLH A;  3M9N B;  4RNM A;  4Y2U A;  3NVZ A;  1H38 A;  4DEZ A;  4RT2 A;  3IDW A;  2FPM A;  5J2J A;  4PHA A;  4P4P A;  2N1R A;  4ICA A;  5KG5 A;  4EZ9 A;  2QB0 A;  4RT3 A;  3D2S A;  3V7K A;  3FYH A;  1KSP A;  4O3Q A;  1Z00 A;  5ALF A;  3K75 D;  5DBA A;  2K4I A;  4DSL A;  2PXI A;  4U6P A;  5AK5 A;  4KLU A;  4CF4 A;  4J9L A;  3A0B U;  5AM2 A;  3LVV A;  2KKP A;  2C22 A;  1RQN A;  2AHO B;  1VJ5 A;  5AI6 A;  1ZRM A;  4UB3 A;  5BOL A;  3NVV A;  5HML A;  3UQ2 A;  2DKX A;  4RQ1 A;  1JN3 A;  1XO1 A;  8ICF A;  1JI7 A;  1QCK A;  5ALE A;  4KLT A;  2JEG A;  2EDU A;  3ZD9 A;  3THV A;  1N61 A;  3C2M A;  1SKR A;  2RDJ A;  9ICL A;  2WF5 A;  2BQU A;  1IG6 A;  5AKK A;  3KTQ A;  4QWB A;  2FLN A;  2LM4 A;  2JMG A;  4MFC A;  4RQ2 A;  2A1A A;  3A0H U;  3F5E A;  2JXJ A;  4KLE A;  3K1Z A;  4QW8 A;  3Q8M A;  1L3T A;  2HVH A;  3MFI A;  5KFK A;  3RJG A;  2MRL A;  1B43 A;  4ECW A;  3Q8K A;  4DQP A;  3CNH A;  4QWE A;  3GU3 A;  2I9G A;  1KRP A;  2GLE A;  2OYY A;  5ALO A;  2WF9 A;  4KMU A;  2ZG6 A;  5J2B A;  2B21 A;  5DG7 A;  8ICW A;  3QZ8 A;  5KFQ A;  3BQ1 A;  1U47 A;  3QU5 A;  4GC7 A;  2KG5 A;  3C2K A;  4ED2 A;  2W9C A;  1DK2 A;  1LB2 B;  3RB0 A;  4KLI A;  1JXE A;  4M47 A;  3JPO A;  4RQ3 A;  1L7O A;  4JV0 A;  4QZE A;  1JIH A;  1SZH A;  2NV3 A;  5KFY A;  3M8R A;  2NRZ A;  5KG6 A;  2HHQ A;  1X6J A;  2O6K A;  5EE3 A;  5AI5 A;  4NWI A;  4DLE A;  2Z7J A;  1T3Q A;  5DQI A;  2IBK A;  1X9X A;  2IMW P;  5J0R A;  1QSS A;  1WG8 A;  3EW9 A;  2K4P A;  4DQQ A;  2DPJ A;  4CGZ A;  2P66 A;  2HHV A;  4QZB A;  3ISC A;  3TFR A;  4P0Q B;  4C8O A;  9ICW A;  2QAR B;  3ZDC A;  5FP0 A;  2JV3 A;  1SZP A;  3NUQ A;  2ZIW B;  4ECZ A;  1BVS A;  5AM5 A;  3KZX A;  2I1Q A;  3N7P D;  5J2H A;  5G5H A;  5C0Y A;  4QZH A;  1SB3 C;  1WWV A;  4OD0 A;  2F1J A;  5HP4 A;  5ALQ A;  5DGA A;  5CEH A;  5L1J A;  3VCB A;  3GZF A;  2BZF A;  4Z6D A;  2HW3 A;  3TAD A;  1ZQN A;  3HWT A;  4DL7 A;  3NVW A;  1DGJ A;  5KFF A;  9ICK A;  2F76 X;  3IN5 A;  2ZIV A;  5DB7 A;  3GQC A;  3TAN A;  2A1J A;  1ZJM A;  2HSZ A;  2KK0 A;  4QZ8 A;  3JPR A;  4Y2P A;  4KTQ A;  4A8E A;  5CHG A;  3BS7 A;  3BJY A;  3AU6 A;  2IOF K;  4JK1 A;  2FMQ A;  5KFW A;  2K4H A;  3FC4 A;  1ZQF A;  4R66 A;  2MSN A;  4JWN A;  2E1E A;  5J0W A;  4F2R A;  5IIK A;  1D9D A;  3QU7 A;  4B9U A;  1Y88 A;  2XIC A;  2CRX A;  1O03 A;  2RP5 A;  4DS5 A;  1XSL A;  3WK5 A;  1L7N A;  4NL9 A;  5KFL A;  3H4D A;  3KZI U;  2AGQ A;  4Q8E A;  3E2E A;  8ICT A;  5DBB A;  2BCV A;  2OH2 A;  3H8S A;  2B6G A;  1ZOL A;  5AI9 A;  1U45 A;  1U4B A;  4YR3 A;  2F8L A;  3UPQ A;  4MEY A;  4ECR A;  1OUQ A;  5DB6 A;  5CB1 A;  3SQI A;  2WF6 A;  1TAQ A;  5AKZ A;  4ECS A;  3M6Z A;  3B9J A;  2EAN A;  8ICZ A;  1K1Q A;  3SMV A;  8ICS A;  5CR0 A;  2WTF A;  4M6W B;  3EUB 2;  3R9K A;  1NK7 A;  3RJH A;  3G6Y A;  4C7Y A;  4ED7 A;  5KFD A;  1GO3 F;  3TI0 A;  5EWF A;  4CE6 A;  1TAU A;  4M0A A;  1U9L A;  5ALJ A;  5KFT A;  3V6J A;  3QU9 A;  4OJ5 A;  4I2I A;  1NK5 A;  2A3V A;  1ECW A;  1P7D A;  2E8N A;  3MGH A;  4F71 A;  7ICS A;  3CW2 C;  3H40 A;  2BPC A;  4R8U A;  2KD1 A;  4NJ8 A;  1FEZ A;  1AQ6 A;  7ICI A;  4YXM A;  4F4K A;  5AK4 A;  4NXZ A;  1N5W A;  4XQ8 A;  1ZQA A;  3HKZ F;  2RLT A;  3TAR A;  2ZTD A;  1CEZ A;  1UT5 A;  7ICO A;  2ZXH A;  2F77 X;  1RYS A;  4X5V A;  4I2E A;  5HHI A;  5ALD A;  2R8J A;  4O3N A;  3AEV A;  1S77 D;  5DLF A;  3HX0 A;  3T5K A;  2KFN A;  3SD7 A;  2Y1I A;  4RQ5 A;  5ALZ A;  5CRX A;  7ICK A;  2W03 A;  5J0U A;  2BDP A;  2FI1 A;  1SL1 A;  1N48 A;  2W9B B;  5DBC A;  4KN7 A;  4R65 A;  2UVR A;  3E58 A;  1D8B A;  4CF5 A;  2QKQ A;  2EZZ A;  4QWD A;  2P6U A;  5ALR A;  5AIA A;  4TUP A;  2W11 A;  4F5P A;  1Z4O A;  4DL4 A;  5J8Y A;  4IQU A;  2KHQ A;  2KSO B;  3DEE A;  4FZM A;  2ZIU B;  4XA5 A;  2F2A B;  2C28 A;  3MAB A;  5III A;  5EOZ A;  1SKS A;  4QZF A;  3SAH A;  4KMO B;  4RQ6 A;  2VA2 A;  1S10 A;  2Y0S C;  8ICR A;  4DSJ A;  3H8W A;  4OJL A;  4JV2 A;  9ICA A;  4B9M A;  1SV4 A;  2KFZ A;  8ICU A;  2E8M A;  3WKA A;  3UMC A;  3T3F A;  3LWM A;  1T94 A;  4O5C A;  2VA8 A;  4DS4 A;  2W9M A;  1TKD A;  7ICN A;  1TE2 A;  5KFM A;  3T5H A;  4YCX A;  1NJW A;  3O0F A;  3SV4 A;  1PVP A;  4GC6 A;  2M9N A;  3N4M B;  1S0V A;  5AIC A;  3TKA A;  1ZQ1 C;  5JTI A;  4J9R A;  4DSK A;  5EE0 A;  4US8 A;  3D6J A;  1WCN A;  2Y9U A;  4P4O A;  2ISO A;  4NLZ A;  3IG5 A;  4I28 A;  4I2B A;  3SAF A;  3IHQ B;  2HBJ A;  4R64 A;  4MFF A;  4BUG A;  3OGU A;  1MSW D;  3JPS A;  3HIL A;  4M9G A;  1NNL A;  1BPY A;  4O5K A;  4I27 A;  1FO4 A;  2ESE A;  2J6T A;  1T4G A;  5H2F U;  1A6S A;  1X2I A;  2BCQ A;  4RPZ A;  4IR1 A;  1MQ2 A;  9ICM A;  5F9N A;  4PL1 A;  2DL0 A;  1Q8K A;  1PUZ A;  1UQV A;  3KBB A;  4MHV A;  8ICV A;  4DFK A;  5DB9 A;  1PK1 B;  1K1S A;  2NYV A;  3V7J A;  2BR0 A;  2KIW A;  4UAV A;  1V38 A;  3C5F A;  1NK8 A;  1MQ3 A;  4UAT A;  4R8U B;  4J9P A;  4NL9 C;  4O0I A;  4RQM A;  5AKH A;  9ICV A;  4BWM A;  4NLK A;  9ICJ A;  3TAP A;  5ALG A;  3MBY A;  2XVT A;  2JZB B;  3TFS A;  3K4G A;  1WUD A;  4BWJ A;  1ZQS A;  3KHH A;  3IM1 A;  3QUQ A;  4DOC A;  5AM4 A;  3PV8 A;  4FE3 A;  4OJO A;  5DG8 A;  4YFK A;  2W54 A;  4YR2 A;  3OJS A;  4EBC A;  4JB3 A;  4IQT A;  3TAC B;  2ES6 A;  5KL1 B;  4K4I A;  3H0M B;  5J2G A;  3QUT A;  4FS2 A;  2H3V A;  4C8N A;  2C2D A;  1FFU A;  4IC9 A;  7ICU A;  1QH9 A;  1S8O A;  1WCL A;  4KLL A;  2BKE A;  3ALR A;  4B9T A;  4UB8 U;  4Y2T A;  4NLN A;  5HR6 A;  4YVZ A;  4I2A A;  2IHN A;  3ZI4 A;  4DSE A;  1RZT A;  5AKX A;  3MR3 A;  4PGQ A;  1IV8 A;  3AL0 B;  2H5X A;  3GV5 B;  4CNQ A;  1BNO A;  2ZJA A;  5ALV A;  1PVR A;  3EZ5 A;  1NZP A;  3ICX A;  4PZO A;  3MGI A;  3C1Y A;  4UQG A;  4ELV A;  4UW9 A;  4UB1 A;  2LPE A;  1DRG A;  1ZQE A;  4PL2 A;  2OWO A;  3C28 A;  3QUC A;  4FS1 A;  2FJ6 A;  3U26 A;  2FLP A;  1NKE A;  1UA1 A;  4ECY A;  5AI8 A;  1QSL A;  7ICM A;  1NK4 A;  4ZOH C;  3AM9 A;  1NJZ A;  1QQ7 A;  1ZQW A;  1T7P A;  3D2N A;  3BDP A;  1LV5 A;  4P0Q A;  1RXV A;  2PFN A;  2E8O A;  2F44 A;  2QAR A;  4IRK A;  4I2G A;  2AGP A;  1A77 A;  4UB5 A;  2ZIW A;  4GXI A;  4B9N A;  3PSP A;  4RPY A;  5KFZ A;  1KDH A;  3Q8R B;  2NRW A;  5E79 U;  2D3D A;  1KW4 A;  1DOQ A;  2KVC A;  1ZD3 A;  5TZV A;  2KE7 A;  3OHA A;  4F8R A;  4KN4 A;  1RYR A;  4EBE A;  2XY5 A;  2MUT B;  3H4B A;  2E3T A;  2EZX A;  3DV9 A;  4Y2S A;  3QE9 Y;  1PVQ A;  1U49 A;  2KEY A;  2EH9 A;  1ZD5 A;  2FPL A;  4UB6 U;  2QB1 A;  3Q8P B;  1ZXI A;  2C2R A;  3ORY A;  5J2E A;  3G6X A;  2AQ0 A;  5CWR A;  1UA0 A;  1RYU A;  2ZUD A;  4RQ0 A;  4AP9 A;  1ZQX A;  4EX7 A;  5AKI A;  3SEN A;  1TK8 A;  2HDO A;  5EWG A;  1CRX A;  3PNC A;  5ALT A;  3ISB A;  3HJE A;  4NY8 A;  4J9Q A;  3AUO A;  5KFO A;  4QZG A;  4NLC A;  2JEF A;  4LZG A;  2ZXI A;  3RJI A;  3LWL A;  3PO5 A;  1URJ A;  4YR0 A;  3EWA A;  1V97 A;  3OSP A;  4QZA A;  5DQH A;  3EYZ A;  3I1Y A;  1UPH A;  3WU2 U;  1SWW A;  4RNN A;  1XWL A;  2HHX A;  3ETL A;  1TK0 A;  4QIW C;  4IRD A;  2EAO A;  2LMR A;  4YMO A;  1SKW A;  3M9M B;  4M9J A;  3AMZ A;  3Q8S B;  4UBC A;  1SV0 C;  4M6W A;  2BHN A;  4K4H A;  1XU4 A;  1XS9 D;  3H8M A;  2ASD A;  4C0Z A;  3Q8L A;  1FIQ A;  3OHB A;  1IM4 A;  4F4X A;  3MGV A;  4JV1 A;  2DWQ A;  2LI6 A;  3BQ0 A;  4BXO A;  3QNM A;  4TQS A;  4NM1 A;  2XC9 A;  2GH1 A;  3M8S A;  3N7R C;  2W7O A;  5BOM A;  1ZQM A;  4Z6E A;  4UAY A;  2XGQ A;  1LKY B;  1KFT A;  1ZQO A;  5ALH A;  4DWI A;  3NRW A;  1L7P A;  4UB2 A;  2IHM A;  1RM6 C;  3RJJ A;  2YQE A;  4F5O A;  3WKB A;  8ICA A;  4Z6C A;  3MR6 A;  1OXJ A;  5ALK A;  7ICT A;  1ZD4 A;  3FM9 A;  4Q44 A;  3BZC A;  1Z4N A;  2W9B A;  1JRO A;  3RAQ A;  2F8K A;  2KSO A;  9ICX A;  2OHF A;  4TUQ A;  3V6K A;  4F50 A;  1O08 A;  2ZIU A;  1LVH A;  3B0X A;  3I76 A;  4O3P A;  4J03 A;  2IOH A;  2EAM A;  3KOO A;  2W04 A;  2MAX A;  4QWC A;  2DBY A;  2KKV A;  4Y2V A;  2PMZ F;  3RRG A;  5KG7 A;  1ZQB A;  2K8A A;  3GII A; 
#chains in the Genus database with same CATH homology
 1X9X A;  3H8M A;  2D3D A;  1KW4 A;  1SV4 A;  2DKX A;  2EAN A;  1V85 A;  2K4P A;  2KE7 A;  1JI7 A;  2E8M A;  1LKY A;  2E8P A;  2F3N A;  2DKZ A;  2QAR B;  4IS7 A;  2JV3 A;  3TAC B;  2ES6 A;  1X40 A;  5J8Y C;  1DXS A;  1PK3 A;  3SEI A;  2K60 A;  1WWV A;  5JTI A;  1LKY B;  1WWU A;  1COK A;  2E8N A;  2QB1 A;  2Y9U A;  3TAD A;  1F0M A;  2KMD A;  2YTU A;  4NJ8 A;  5KNI A;  2D8C A;  3HIL A;  3SEN A;  1B4F A;  2L5Y A;  5JRT A;  1SGG A;  2GLE A;  1OXJ A;  1Z1V A;  3K1R B;  1PK1 A;  1RG6 A;  3BS7 A;  2KIV A;  1SXD A;  2ESE A;  1X66 A;  4PZN A;  1SV0 A;  5L1M A;  2FE9 A;  2F8K A;  1SXE A;  5F3X B;  2KSO A;  2KG5 A;  4PZO A;  2EAP A;  3BS5 A;  2DL0 A;  3TAD C;  1UQV A;  3IDW A;  4MHV A;  2LPE A;  1PK1 B;  4RQN A;  2QB0 A;  2QKQ A;  2EAM A;  4NL9 A;  3BQ7 A;  1V38 A;  2EAO A;  2LMR A;  2B6G A;  5J8Y A;  3KKA A;  2KSO B;  4NL9 C;  1UCV A;  4RQM A;  3BS5 B;  1OW5 A;  5JU5 A;  1SV0 C;  2E8O A;  2F44 A;  2QAR A;  3KKA C;  1B0X A;  2QB0 B;  2Y9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...