1COOA

The cooh-terminal domain of rna polymerase alpha subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the activator contact domain of the RNA polymerase alpha subunit.
pubmed rcsb
source organism Escherichia coli
molecule tags Nucleotidyl transferase
molecule keywords RNA POLYMERASE ALPHA SUBUNIT
total genus 10
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 1995-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1cooA00
1RZTA 2F1IA 4RQ0A 3E2EA 5KG6A 4GLXA 3PW4A 3TANA 4E0DA 3V72A 1QSLA 4RQ7A 3PW7A 4C8MA 2C2DA 1WCLA 1QSSA 4ECYA 5DBAA 1ZQUA 4KLDA 4RQ8A 1MQ3A 4QZDA 4M0AA 3M9OB 3PO4A 5KG7A 1S97A 4FS1A 4QZHA 3V7JA 5DLFA 2W9BB 3ISDA 2AGQA 5J0SA 4QWAA 9ICLA 5CA7A 2HW3A 3KHHA 5DGBA 3EYZA 1TAQA 1KDHA 4RQ2A 3LDAA 1BGXT 5D4BA 3RH5A 1U45A 1RXVA 9ICGA 2AQ4A 4DSIA 4PPXA 5J0XA 4O5CA 4RUAA 5J0RA 7ICQA 5KFFA 1ZQIA 2P6RA 1UA0A 5DQHA 5HMMA 4XQ8A 4PHDA 4ECUA 4ECXA 5IILA 4M04A 4DL2A 1EXNA 3GQCA 1C7YA 1Z3EB 4DL7A 4IR1A 5DDMA 5KFOA 4B9VA 1RPLA 1DGSA 7ICKA 5DQGA 4M47A 4O9MA 4ECWA 4O3NA 1MQ2A 4UB1A 4RT2A 4YQWA 3QZ8A 4DOBA 1DOQA 4RQ3A 1S0OA 2PI5A 7ICIA 4UAYA 4I2AA 3QEBZ 4C8LA 4J9PA 2C22A 2JEGA 4TURA 3LWLA 1TVAA 4Q44A 5J0QA 3C1ZA 4F3OA 7ICRA 1T4GA 4I2EA 4HYKA 4TUSA 5IIJA 1XSLA 4F91B 4FBUA 2JEJA 3MDCA 2Y1IA 2MAXA 5L1KA 4ED0A 1NKCA 1SL2A 1ZQJA 4KTQA 2A1JA 4KLHA 4DFJA 5HHIA 2KTQA 2HHWA 5J2FA 1XS9D 4DLGA 4QZ8A 1BPYA 1ZQFA 5J2GA 3Q8PB 1Y88A 4Z6CA 1BPEA 4R65A 4I2IA 5KT3A 3TARA 5DLGA 5J2JA 4TUPA 3Q8KA 2FMQA 3ZDCA 4QZCA 4GXIA 4DQRA 1NK4A 1JXEA 3OSNA 5KFLA 3RJJA 4PHAA 2XGQA 4PHPA 1XSPA 4QW9A 3H8WA 2Q0ZX 3Q8QB 2B21A 3KHRA 5IINA 1L3UA 3HP6A 5D49A 1D9DA 2ISOA 1TAUA 5HMLA 2BQRA 2KFNA 4R8UB 3PV8A 7ICFA 1XWLA 5DG9A 1KRPA 3V6JA 2VA8A 3M8RA 3SZ2A 1ZQQA 3EZ5A 2HHQA 4RZRA 9ICFA 1H38A 3UXPA 2PFOA 4I2HA 4YXMA 3AU2A 2P66A 2FLPA 4UAZA 1TV9A 4YVZA 5DDYA 5J0OA 1NK9A 1HUZA 2J6UA 2PFPA 2HVIA 5KFTA 4LVSA 4RQ4A 4TQRA 5KG3A 4O0IA 4EYHB 4F8RA 1X9SA 4RQ6A 3C2LA 8ICMA 1MC8A 3MABA 1NJYA 1ZQTA 2BCSA 4ECQA 4F5PA 8ICRA 2ASDA 1X2IA 8ICUA 5KFBA 4O3OA 4R64A 5DB7A 1QSYA 7ICNA 1ZQSA 4DSFA 1CEZA 4NLNA 1Z00A 1TK8A 3RAXA 5KG5A 3PX0A 2J6SA 4J9OA 1S9FA 5KFRA 4BGDA 3PO5A 7ICOA 7ICSA 3N97B 5EWFA 3RB6A 8ICPA 4O5KA 8ICGA 2KN7A 2DPJA 4TUQA 1TK5A 1ZQGA 4TQSA 2J6TA 2ZUDA 3C1YA 4KMUA 2R8IA 4X5VA 5JUMA 5DB6A 7ICUA 9ICHA 2I9GA 1A77A 4NY8A 4DFMA 4YCXA 4F4XA 4JUZA 4F5NA 2DPIA 3K4GA 5KFEA 4Q8FA 2XCPA 4QZEA 3SV3A 1T7PA 5TZVA 4F4KA 9ICUA 4KN4A 3RH4A 4EYIB 4JK1A 4DQPA 2XCAA 2HHUA 5J2BA 3GV7B 4MFFA 2AJQA 4DFPA 4K4GA 3RB3A 2W8LA 5L1JA 1UT5A 1QTMA 3SYZA 1SKSA 1TK0A 1KTQA 3H7IA 3G6XA 3TAQA 1AROP 8ICJA 5DG8A 3H8JA 1S0VA 2UVUA 4RU9A 4BWMA 4YMOA 3C2MA 1ZQXA 4DSJA 4ECSA 9ICEA 4NLKA 7ICLA 3RBDA 1NK7A 1RXWA 2JZBA 1BVSA 3Q8SB 3H40A 4ECRA 3IHQB 1ZQBA 2I1QA 2M9NA 2LYHA 4RNMA 4UQGA 4BWJA 1KSPA 3OJUA 3BJYA 4PHEA 5KT6A 5BOMA 3JPRA 3HWTA 2BPCA 4UBBA 4QZGA 3GDXA 4M9GA 2H5XA 5KT5A 1NKBA 4LZGA 8ICXA 3B0YA 3T3FA 4YXJA 4KLIA 2XY6A 5J2CA 3GIKA 2JZBB 5DG7A 5J0YA 1NJXA 4J9MA 8ICFA 3ISBA 4MFCA 4F2RA 4I29A 3MFHA 3SV4A 4UB4A 5KFYA 4MF8A 3QE9Y 4RUCA 4YR2A 1SKWA 3RR8A 1NK5A 3HT3A 3Q8RB 4P4MA 9ICQA 8ICSA 1U49A 1RYSA 3RB4A 4QZFA 9ICKA 2IHNA 2R8KA 4ELTA 4PGQA 3PR5B 1JN3A 3AUOA 3RJIA 4UB2A 1XU4A 4KLMA 3PY8A 5KFVA 5HNKA 1L3TA 2MUTB 1S77D 5J2AA 2KZMA 4J9SA 4C8NA 3H8SA 3GV8B 3PMNA 4B9LA 3FDSA 3ZDBA 3FYHA 2V4RA 2AGPA 5DB9A 2C2EA 1K1SA 1UT8A 4DSEA 4RNNA 2RDJA 4J9RA 2C28A 3Q8LA 1L3VA 4K4HA 4Q45A 4R8UA 4JV1A 1IXRA 3H4BA 1NKEA 3TFRA 4F2SA 9ICVA 5HHHA 2BR0A 5KT7A 2OWOA 3MR2A 5CJ7A 8ICZA 9ICWA 1JMSA 4EBEA 8ICBA 8ICHA 3PW2A 4B9NA 5KT2A 4P4PA 4F93B 4DL6A 4EZ6A 1PZNA 5KFIA 1ZQRA 1KFSA 5KG0A 4YP3A 1KFDA 3NTUA 5J2KA 9ICJA 4RPYA 4O3SA 3H4DA 2BQ3A 4ED8A 3RJFA 1ZQZA 2IBKA 3B0XA 4DQIA 4IR9A 1KEJA 4IQVA 1CUKA 8ICVA 3OHAA 3PVXA 5KG2A 2FPMA 3ETLA 4XUSA 5J2DA 3OSPA 2BDPA 5IIMA 2ZUBA 3HW8A 3AU6A 1ZQOA 3BDPA 4XA5A 3EW9A 3JPNA 4I2FA 4MEYA 7ICVA 2W9CA 3RBEA 1TKDA 5J0PA 4FS2A 3M9NB 2BGWA 1SL1A 4DF8A 1N56A 1XO1A 4DSKA 9ICNA 7ICPA 2PFNA 4DL3A 2KZ3A 4J9NA 3TI0A 1NK8A 4IQWA 4O5EA 7ICJA 5KFMA 4RNOA 1SZPA 4DOAA 3KHLA 4JV2A 4XRHA 4I2JA 1L3SA 5J2IA 1ZJMA 9ICXA 1TFRA 2HHXA 2W9CB 8ICCA 4B9SA 3UXNA 2Y1JA 3MBYA 4CCHA 4GXJA 3QEAZ 3RJKA 3GIJA 4DS5A 1COOA 1UA1A 5DQIA 3RR7A 3MR5A 4KLTA 4C8OA 8ICWA 3OHBA 5CB1A 3UQ0A 4J9LA 2XC9A 2ALZA 1ZETA 4ECVA 1T3NA 1NJWA 1BPZA 2UVVA 4B9MA 3RJGA 2FPKA 5KFAA 2KZZA 3PR4A 4MF2A 1U48A 3RRHA 1SL0A 4ECTA 4GC6A 4NLGA 2ASJA 4QZBA 2ZUCA 4DQQA 3GV5B 4F4WA 4F4ZA 4DFKA 9ICSA 1XSNA 3BQTA 4KLFA 2UVRA 5F9LA 7ICEA 4PGYA 4YFKA 8ICEA 4M9NA 5J2HA 4NLZA 3HPOA 3C5GA 1NK6A 4EBDA 9ICPA 4KLSA 3ORYA 4ELVA 2XY7A 1RYRA 4QWBA 4KN7A 1D9FA 4I2CA 1BPXA 4KLUA 4M2YA 4ED3A 2NRWA 3ZDEA 1S0MA 8ICKA 5F9NA 8ICAA 1S10A 5KFSA 1ZQCA 5J2EA 3MFIA 4YD2A 4I2DA 1BPDA 4R66A 2IHMA 3RAQA 4JV0A 1B22A 2F1HA 4I2BA 4QWEA 3BQ1A 4DF4A 5KT4A 3TAPA 4G3IA 4Z6FA 4NM2A 2ZTDA 3JPTA 2A1JB 2MUTA 4YMNA 2FMPA 1B43A 4MFAA 4B9TA 8ICOA 3V6HA 1BPBA 2R8JA 4KLEA 3KHGA 3MGHA 2WTFA 3GIMA 5DKWA 4J9KA 2BKEA 5J29A 5CP2A 5EOZA 3M8SA 2NRXA 1WCNA 2ZJ8A 3V7LA 2AQ0A 3RH6A 1JIHA 4JWMA 2UVWA 4IRDA 2VA3A 1JX4A 7ICHA 2W9MA 4ECZA 4GXKA 3BQ0A 4BDPA 5KG1A 1K1QA 3RJEA 1ZQMA 2VANA 4QWCA 3RRGA 4KLOA 2PXIA 1V9PA 9ICBA 2ISPA 1ZQVA 4O3RA 2W9BA 4ED1A 4Q43A 3JPSA 4DSLA 1D8YA 2FLNA 4K4IA 2KFZA 4UB3A 3LK9A 4IRKA 2HHVA 2BHNA 5KFZA 3T5HA 2V9WA 3HX0A 2XY5A 3NGDA 5KFWA 4NM1A 5BPCA 4EZ9A 2ZJ5A 4FO6A 2XGPA 3RJHA 1A76A 5L1LA 1X9WA 5KFNA 4JWNA 5IIIA 5KFJA 2PFQA 8ICNA 4UAWA 1ZQDA 4PH5A 2F1JA 4UB5A 4B9UA 4QZAA 3PW0A 4P2HA 2BQUA 3EPIA 1T8EA 8ICLA 3C2KA 8ICYA 3BQ2A 4KITB 1ZQEA 8ICIA 4O3PA 3MR3A 5J0UA 4ELUA 3N4MB 1Z00B 3RTVA 2IA6A 5KFCA 4LZDA 7ICTA 3MGIA 3T5KA 2BCQA 4IQTA 5EWEA 1S0NA 4O3QA 2ZTCA 4YMMA 2JEIA 3PNCA 4RT3A 2AU0A 5J0TA 4RPZA 4MEXA 5J0WA 4EEYA 1SKRA 4DOCA 1S76D 1ZQKA 2BPGA 3LWMA 5KFDA 3MDAA 4ED7A 1U47A 3PX4A 5KFPA 2XO7A 5L9XA 3JPQA 4M9HA 4DO9A 9ICMA 9ICTA 4RQ5A 4C8KA 4I27A 2FLLA 2HVHA 5KFHA 1U9LA 4M6WB 3PMLA 1N48A 2NRVA 2BCRA 8ICTA 7ICGA 3C5FA 4P4OA 2V4QA 9ICAA 1ZQWA 3OJSA 4M9JA 2C2RA 1NK0A 2BPFA 3M9MB 3UXOA 3EPGA 3UPQA 3THVA 1ZQPA 1ZYQA 3MR6A 4RPXA 5CR0A 5KG4A 2P6UA 2FPLA 1ZJNA 2HHTA 1ZQAA 3SI8A 2PI4A 1HJPA 3V7KA 4M6WA 2GWSA 9ICRA 4F50A 3C23A 4IQUA 4IRCA 3KTQA 4F5RA 3IM1A 4KLQA 4NXZA 1QLNA 4YR0A 2ASLA 4DL4A 4M9LA 4GC7A 2IMWP 5L1IA 4Z6EA 4F4YA 3Q8MA 4YN4A 1D8LA 3T5LA 4I2GA 4KLJA 5IIKA 5D46A 5DBCA 3K75D 3GIIA 3RB0A 5C5JA 3PX6A 3V6KA 2RDIA 2BCUA 4RQ1A 5CHGA 1U4BA 1ZQHA 2DFLA 1X9MA 2JEFA 4DQSA 3G6VA 2NRZA 5KFGA 4YD1A 1NJZA 4QWDA 2ZJAA 3ZDDA 3GFKB 3PW5A 4I28A 3JPPA 1XC9A 4ED2A 3T5JA 5IIOA 4ZH4A 4Z6DA 3G6YA 4KLGA 4Q8EA 3JPOA 3ZD9A 4F5OA 1IM4A 4QW8A 5DBBA 4QZ9A 4QZIA 3QZ7A 4DL5A 1HUOA 3GILA 1ZQLA 1KLNA 2R8GA 1KFTA 9ICIA 5CWRA 2BCVA 4DEZA 4YR3A 8ICQA 3ZDAA 1JXLA 5KFQA 5EWGA 2VA2A 9ICCA 4BXOB 1NOMA 1ZQYA 4J9QA 5KFXA 7ICMA 3UQ2A 5KFKA 4PGXA 3TQ1A 4KLLA 3TFSA 2W8KA 4EBCA 4DS4A 4R63A 5BOLA 1LV5A 1ZQNA 2FMSA 1LB2B 4FBTA 4F92B 5HP4A 3C21A 2HHSA 2NRTA 5KTQA 5DB8A 4BXOA 4UBCA 4YG2A 1MSWD 5DGAA 3ZD8A 3OGUA 2AGOA 2ZTEA 5KFUA 4DWIA 2W9AA 4ED6A 3EWAA 2ATLA 9ICOA 1L5UA 4F5QA 3ISCA 4DLEA 2R8HA
chains in the Genus database with same CATH superfamily
2VJ4A 3D2QA 1WWVA 5KG6A 2CRXA 1QSLA 4OJ6A 1WCLA 5DBAA 2WAQF 3UMCA 4FS1A 5DLFA 1PVQA 4P0QB 5CA7A 2HW3A 3KHHA 1J2NA 3CYMA 4Y2YA 2YMMA 2QLTA 1KDHA 1BGXT 2DBYA 9ICGA 4NJ8A 1T3QA 5IILA 1EXNA 1C7YA 1Z3EB 4DL7A 5DQGA 3WKBA 4RQ3A 7ICIA 4I2AA 3BS5B 1TVAA 2HBKA 5J0QA 4I2EA 2D3DA 2YMQA 3MDCA 1ZQJA 1NKCA 2HHWA 5J2FA 1FEZA 1COKA 3TARA 3Q8KA 2FMQA 1LKYA 2FE9A 4IS7A 3LYSA 4DQRA 4U6PA 2W3SA 1XSPA 5IINA 4QW9A 3H8WA 1OUQA 3KHRA 5HMLA 2BQRA 2KFNA 2RQ5A 1KRPA 3EZ5A 2HHQA 4MHVA 4FFDA 2FLPA 4UAZA 1TV9A 5J0OA 2J6UA 2PFPA 3MABA 4ECQA 4F5PA 2ASDA 1X2IA 3NUQA 5DB7A 7ICNA 1ZQSA 4US9A 1Z00A 3RAXA 2J6SA 5ALTA 3PO5A 4BGDA 7ICSA 2QB1A 2YQEA 4O5KA 8ICGA 3HILA 4IL6U 2J6TA 3C1YA 5DB6A 1SGGA 4JUZA 2XCPA 5TZVA 2DWQA 2AJQA 3RB3A 2ZG6A 5L1JA 1KTQA 2EANA 1S0VA 4YMOA 1ZQXA 4DSJA 1N2XA 2NO5A 4AYBF 2Y0SF 1RYUA 5AICA 3QU2A 2F3NA 4BWJA 1J2MA 3JPRA 5BOMA 1ZD2P 1DK3A 4UBBA 4M9GA 2H5XA 5KT5A 1NKBA 4LZGA 8ICXA 2DL0A 5ALEA 3OPXA 5J2CA 3AQEA 3AM9A 2KKVA 4I29A 5AKEA 1QQ5A 5KFYA 1SKWA 3KKAC 3WK6A 2VKQA 2YX8A 8ICSA 1X6JA 3ALRA 4ELTA 2R8KA 4PGQA 2WB1C 3AUOA 2EAMA 2NYVA 4UB2A 1XU4A 4KLMA 2KHQA 2FJ6A 5KFVA 5HNKA 4J9SA 3H8SA 4B9LA 3ZDBA 4PZOA 1K1SA 2WFAA 2RDJA 2C28A 2G07A 3H4BA 1CI4A 1NKEA 1P7DA 2KEYA 5AKHA 2BR0A 5KT7A 3MR2A 8ICBA 4B9NA 3M7DA 4EZ6A 4F93B 4PJ0U 2KOBA 4USAA 5G5GA 4RPYA 2BQ3A 2ODGA 4IQVA 2ZIXA 2FPMA 2JMGA 3HW8A 2A19A 3RBEA 4FS2A 1SL1A 2QKQA 1N61A 2YY6A 4DF8A 4J9NA 4O5EA 4DOAA 1L7MA 3KHLA 2K4IA 1FIQA 4XRHA 2GO7A 1L7PA 5J2IA 1L3SA 3U26A 8ICCA 4B9SA 3MBYA 3QEAZ 2ZIWB 1ZOLA 4DS5A 3GIJA 5DQIA 1ZRMA 1DK2A 3OHBA 5CB1A 2XC9A 1ZETA 1BPZA 2FPKA 2CXYA 4ECTA 4GC6A 2ASJA 4QZBA 4DQQA 3GV5B 4DFKA 3BQTA 2EZXA 2H3IA 4YFKA 4M9NA 5AI9A 5AKGA 4ELVA 3ZDEA 3CRXA 3PSPA 4UAUA 3DEEA 2I6XA 1IV8A 4YD2A 3RAQA 2WAQC 2F1HA 2GH1A 2KVSA 4I2BA 4QWEA 3L5KA 4NM2A 4B9TA 3KFUF 2KKPA 3D2NA 2R8JA 3MGHA 2YB4A 1VJ5A 3HJEA 2BKEA 5EOZA 5J29A 3RH6A 4JWMA 4IRDA 2W9MA 4ECZA 4GXKA 3BQ0A 4OCZA 1K1QA 2Y9UA 1ZQMA 3RJEA 4DSLA 4ACOA 1JUDA 2KFZA 2HHVA 4IRKA 2V9WA 4NM1A 2D6FC 5L1LA 4JWNA 5KFJA 8ICNA 1BNOA 1QCKA 4B9UA 4QZAA 2H3ZA 2YTUA 2N1RA 3QUQA 8ICYA 4O3PA 3N4MB 1Z00B 3RTVA 1NZPA 2IA6A 5K4LA 1FFVA 3N7RC 4YMMA 3PNCA 3IV6A 2LYAA 5J0TA 1PVRA 2W04A 1N62A 1SKRA 2H3QA 2KE7A 1KKXA 5KFPA 3QUCA 1S5LU 2HOFA 2HVHA 1O08A 2NRVA 5EE0A 8ICTA 1V85A 3VCBA 1ZQWA 2C2RA 3M9MB 3UXOA 3EPGA 1ZQPA 1WUDA 3SAGA 2W11A 3MR6A 4RPXA 1KBUA 1Z1BA 5ALFA 5JTIA 1HJPA 2IOHA 4IRCA 1L7OA 4YR0A 1VLBA 2YMLA 2YN4A 4I2GA 4KLJA 2KV2A 5AKJA 3SQIA 5C5JA 3V6KA 2KHVA 5CHGA 4DQSA 2ZJAA 2GOLA 3JPPA 4ZH4A 4KLGA 3G6YA 4F5OA 1L7NA 5DBBA 1KLNA 3WK8A 4DEZA 3ZDAA 3GU3A 5KFQA 4J9QA 5KFKA 4PGXA 4EENA 4Y2XA 1ZQNA 2FMSA 5E79U 3WKAA 2MRLA 2NRTA 5DB8A 3HRDD 3ETRA 3TACB 3N7PD 5DGAA 2ATLA 2HBJA 4F5QA 3I1YA 3ISCA 4DLEA 3E2EA 4B6JA 4GLXA 4E0DA 2GLEA 3WK5A 4C8MA 2C2DA 1ZQUA 3J81j 2VIXA 3M9OB 3PO4A 1S97A 5AI4A 2EZZA 4QZHA 3V7JA 2W9BB 2AGQA 2K8AA 5J0SA 4QWAA 5AM0A 3EYZA 3RFAA 2B6GA 2G5HB 1RXVA 4FZMA 4RUAA 5KFFA 5DQHA 4ECXA 4PHDA 4M04A 2JH7A 2AH5A 4IR1A 1TAMA 2F44A 1DGSA 4M47A 2QB0A 5ALMA 4ECWA 2R18A 1MQ2A 1PK1A 3K1ZA 3QZ8A 4DOBA 2KNJA 3TADC 2LYBA 1S0OA 2PI5A 2G08A 1L8LA 4CF4A 3LWLA 7ICRA 1RQNA 2HBLA 3S6JA 2OCEA 4HYKA 4HAIA 2Y1IA 2MAXA 1SL2A 4CRXA 4DFJA 2A1AA 2JR5A 1XS9D 4DLGA 3Q8PB 2H3VA 4Z6CA 1BPEA 1CRXA 5AI8A 4GXIA 1XNSA 2LHTA 1JXEA 5KFLA 3RJJA 2G0AA 1L3UA 2B21A 5AKKA 5DG9A 2W7OA 3F2BA 3V6JA 5HR7A 4A8EA 2PFOA 5DDYA 9ICSA 1HUZA 3CW2C 3KBBA 2HVIA 4RQ4A 4EYHB 3HKZF 4F8RA 1X9SA 5AKXA 1ZQTA 1RG6A 2BCSA 8ICRA 5KFBA 4O3OA 3I76A 1RDFA 2F76X 4DSFA 4NLNA 1JALA 5ALNA 5KFRA 7ICOA 3N97B 1RM6C 5L1MA 2ZUDA 5AK5A 5AKLA 1A77A 4YCXA 4F4XA 4F5NA 2DPIA 5KFEA 2PMZC 9ICUA 3F2DA 4EYIB 4DQPA 1Q46A 1PK1B 4DFPA 4K4GA 1UT5A 3G6XA 3TAQA 2LM4A 1AROP 5DG8A 1WWUA 3H8JA 4UATA 3C2MA 9ICEA 4NLKA 1NK7A 2F77X 5ALOA 4BX9C 2M9NA 2O6KA 1F0MA 1UPHA 3OJUA 5KT6A 3BS7A 2BPCA 2WF8A 2JZBB 1NJXA 3ISBA 5FP0A 4MFCA 4F2RA 3BS5A 4UB4A 4UAVA 4MF8A 2KJ9A 3M1YA 3Q8RB 3KKAA 3IDWA 2RP5A 4OD0A 4P4MA 9ICQA 5AIAA 3RB4A 9ICKA 2IHNA 3PR5B 1M6YA 2QARB 1LKYB 4BUGA 3RJIA 1L3TA 2MUTB 2OEHA 4C8NA 3GV8B 3MGVA 2AGPA 5DB9A 2C2EA 4RNNA 4J9RA 2AHOB 9ICVA 4F2SA 5HHHA 3PW2A 2DF4B 4P4PA 4DL6A 5KFIA 3WK4A 4NL9C 2HDOA 1ZQRA 4FZLA 1KFDA 9ICJA 4ED8A 2IBKA 4IR9A 4Y2JA 2HMXA 1O03A 3OHAA 5KG2A 2BDPA 2EAOA 1YZ6A 3BDPA 3AU6A 4MEYA 2W9CA 1TKDA 5J0PA 2BGWA 5ALKA 1XO1A 9ICNA 3TI0A 2KZ3A 1NK8A 3D2SA 1LVHA 2ZIUB 1ZJMA 1TFRA 5EE9A 3QU9A 4GXJA 1SXEA 1S8OA 1COOA 4OJ5A 1UA1A 3NVWA 4C8OA 8ICWA 2VJ5A 4J9LA 2HHXA 1ZD4A 4ECVA 1URJA 3PR4A 3RRHA 3UMGA 2DGZA 2E3TA 4NLGA 2ZUCA 4F4ZA 4KLFA 2PKEA 5B5EU 2K4EA 2QB0B 5G5HA 2XY7A 1NZBA 4KLUA 4M2YA 2NRWA 3C28A 8ICAA 2KVCA 1ZQCA 3QUBA 5J2EA 3DV9A 2XVTA 5KT4A 3TAPA 4G3IA 4Z6FA 5B66U 8ICOA 2MUTA 1B43A 4MFAA 4KLEA 3GIMA 4J9KA 5DKWA 4EELA 1JIHA 1TE2A 2DKXA 4US8A 2OM6A 3QU5A 4BDPA 2VANA 4QWCA 4C4SA 2PXIA 1V9PA 2W43A 4C7ZA 2ISPA 2P35A 4Q43A 2KIWA 1D8YA 3ED5A 3LK9A 2KK0A 2BDUA 2JV3A 5ALIA 3T5HA 5KFWA 3PSFA 1DXSA 3RJHA 3ICXA 3F5AA 5KFNA 2PFQA 3A0HU 2EQYA 1ZQDA 4PH5A 4RQMA 1KQQA 3H8MA 2KICA 4KITB 3AMZA 5CRXA 4ELUA 5KFCA 7ICTA 3AL0B 2LBOA 2BCQA 4O3QA 2AU0A 3CNHA 5ALUA 5H2FU 4RPZA 3L3FX 2Z7JA 5KFDA 3NVVA 2XO7A 3JPQA 2E8NA 2FI1A 4PL2A 2KD1A 4M9HA 2YB1A 4RQ5A 5JRTA 4C8KA 4M6WB 1N48A 5EE3A 3L4PA 4Y2QA 3H0LB 4M9JA 2L5YA 1NK0A 1AQ6A 3UPQA 5KL8B 5CR0A 5KG4A 2HHTA 1ZQAA 3SI8A 5ALPA 4KLQA 1QLNA 4AP9A 4M9LA 2IMWP 3Q8MA 3T5LA 5D46A 4KMOB 1JROA 4UB8U 3QNMA 5ALVA 4RQ1A 1U4BA 1ZQHA 2DFLA 5AM5A 2DKZA 3C29A 3PW5A 3QYPA 1XC9A 3SR6A 2WF7A 4Z6DA 1KL9A 5T14A 4QZIA 1KFTA 9ICIA 1JXLA 5EWGA 2VA2A 4BXOB 1Q8KA 1OW5A 7ICMA 3TQ1A 2LKYA 1N60A 5C0YA 2KIVA 4UBCA 1ZRNA 5GTHU 3ZD8A 2AGOA 5KFUA 4DWIA 4ED6A 9ICOA 3GZFA 3UM9A 2E1FA 2R8HA 2F1IA 4RQ0A 3TANA 2HBMA 3V72A 2OXOA 4ECYA 4KLDA 1PVPA 1MQ3A 2MA1A 5KG7A 5AM2A 1UHUA 3ISDA 1MN8A 2XIDA 5DGBA 1NNLA 1TAQA 5D4BA 3LDAA 4RQ2A 1SWWA 4GIBA 3RH5A 1U45A 2AQ4A 4DSIA 4PPXA 4O5CA 4P0PA 7ICQA 2P6RA 1UA0A 1FFUA 3N28A 4XQ8A 1J97A 4P0QA 4DL2A 4G9BA 4Y2UA 1GO3F 4NLBA 4O9MA 3PSTA 2ZIUA 3FM9A 4UB1A 4RT2A 4YQWA 5AM3A 1BNPA 1DOQA 4UAYA 2JEGA 4Q44A 4F3OA 1T4GA 1XSLA 5IIJA 1WG8A 2JEJA 5L1KA 4ED0A 1ZXIA 2A1JA 4QZ8A 5KT3A 3EUB2 5DLGA 5J2JA 4TUPA 3ZDCA 2E8OA 1NK4A 1UCVA 2JXJA 2ZIVA 4PHAA 2KJ5A 2Q0ZX 5D49A 2ISOA 1C20A 5ALJA 4R8UB 7ICFA 3BZCA 1XWLA 3M6KA 1DRGA 2VA8A 2NV3A 4OJOA 1ZQQA 2H3FA 4RZRA 1H38A 3UXPA 4I2HA 1QQ7A 4NLCA 2KG5A 4OJLA 1NK9A 3SAHA 5KFTA 4TQRA 1MC8A 2G5IB 1VDVA 3AEVA 1T94A 8ICUA 2XI9A 4CE6A 5KG5A 4J9OA 1S9FA 4OO1J 4JMUA 5EWFA 3RB6A 8ICPA 2KN7A 4TUQA 2HOIA 3E0FA 2E1EA 4KMUA 2R8IA 5JUMA 1SIJA 7ICUA 4DFMA 1XO0A 2E8PA 3SV3A 1T7PA 4F4KA 4KN4A 3RH4A 4JK1A 2XCAA 5J2BA 5GTIU 3GV7B 5AKYA 4MFFA 1QTMA 3SYZA 1SKSA 1TK0A 8ICJA 3MC1A 2UVUA 4BWMA 4ECSA 7ICLA 3RBDA 5AM4A 1RXWA 3Q8SB 3H40A 4ECRA 1ZQBA 2I1QA 2LYHA 1KSPA 3F53A 4PHEA 1DGJA 3HWTA 4UASA 3GDXA 3NVYA 2CN1A 4YXJA 3GIKA 5J0YA 8ICFA 2ZIVB 3SV4A 4RUCA 3RR8A 1NK5A 5AI6A 2K8CB 1JI7A 2F8KA 1RYSA 3F5EA 4QZFA 1JN3A 1A6SA 1ZQ1C 5ALYA 1SV0A 5KL1B 1S77D 3FDSA 1ZD5A 1SZHA 1UT8A 4EX7A 3HKZC 3Q8LA 1L3VA 4K4HA 4JV1A 1Q3VA 3RF9A 2OWOA 8ICZA 4EX6A 1JMSA 4EBEA 2MU2A 1V97A 5KT2A 2Y0SC 3WU2U 5J2KA 1F44A 4O3SA 5ALHA 3RJFA 1ZQZA 3B0XA 2ES6A 2M0NA 1CUKA 3ETLA 4DFDA 4ZOHC 4XUSA 5IIMA 1ZQOA 3JPNA 1WYGA 3B9JA 5AKIA 3UMBA 3M9NB 2ZIWA 4DSKA 2PFNA 4KX5A 7ICJA 3KOOA 5KFMA 1SZPA 3DDHA 5AIBA 2FDRA 1L8OA 3WK7A 5ALDA 3UXNA 2Y1JA 3RJKA 3QU4A 3MR5A 4KLTA 1UQVA 2ALZA 4B9MA 3RJGA 5AK6A 5KFAA 4MF2A 1U48A 2EZYA 1SL0A 2RLTA 4F4WA 2IOFA 1XSNA 2UVRA 7ICEA 4NLZA 3HPOA 1NK6A 3FAHA 4EBDA 4KLSA 1RYRA 4KN7A 2LPEA 1S0MA 3QUTA 2WHEA 5KFSA 4RQNA 3MFIA 4I2DA 2IOFK 3BQ1A 4DF4A 2ZTDA 4KX3A 2A1JB 1K5OA 4YMNA 1BPBA 3KHGA 3NS1A 2WTFA 1D9DA 5CP2A 2Y9TA 4Y2VA 1WCNA 3IG8A 2UVWA 7ICHA 2RHFA 2W7PA 1N63A 4NV0A 1SWVA 9ICBA 4O3RA 3H0RB 2K60A 2EAPA 3JPSA 2FLNA 5JU5A 2CPRA 4UB3A 2BHNA 3HX0A 3A0BU 1Z19A 2JRZA 4FO6A 1YZ7A 1X9WA 1SV4A 5IIIA 4C7YA 2KSOB 3D6JA 2F1JA 3BQ7A 3PW0A 3N7SC 4UARA 1ZQEA 2K4PA 3LVVA 3MR3A 5J0UA 3SMVA 5AK3A 3T5KA 4Y2RA 5EWEA 1S0NA 2ZTCA 3SEIA 2JEIA 1MA7A 4RT3A 5ALSA 4EEYA 4AYBC 1S76D 3MDAA 4ED7A 4CDGA 2DQNB 3OTQA 2WF6A 2I5HA 4I27A 5KFHA 1U9LA 2V4QA 9ICAA 4OJPA 3THVA 1ZYQA 1ZJNA 2P6UA 3V7KA 2GWSA 3C23A 4IQUA 4F5RA 3IM1A 4NXZA 5ALGA 1F5SA 1HIWA 3NASA 4F4YA 4YN4A 1D8LA 1Q3UA 1RQLA 5IIKA 5DBCA 1IG6A 4QJFB 2WB1F 3RB0A 5KFGA 1NJZA 3GFKB 4I28A 1ZD3A 4C80A 4ED2A 3T5JA 1N5WA 4Q8EA 3JPOA 1IM4A 4QW8A 4QZ9A 3IP4B 1HUOA 3GILA 2R8GA 2KJ8A 2BCVA 8ICQA 4BJQA 1NOMA 1ZQYA 3UQ2A 2ESEA 3TFSA 2W8KA 2KSOA 4EBCA 4DS4A 4R63A 5BOLA 4FBTA 5HP4A 2HHSA 5KTQA 2OH2A 4YG2A 3AQFA 4QNLA 1Z4OA 3OGUA 2W9AA 3EWAA 1NI3A 1L5UA 2W9BA 1RZTA 3PW4A 4RQ7A 3PW7A 1QSSA 4RQ8A 4CNQA 4QZDA 4M0AA 4NL9A 9ICLA 4EEKA 1Z1VA 4QIWC 4Y2PA 4CGZA 3AN1A 5J0XA 5J0RA 1ZQIA 5HMMA 4ECUA 5J8YC 3GQCA 2KMDA 2ZXHA 5DDMA 5KFOA 4B9VA 1RPLA 7ICKA 5KNIA 4O3NA 1QQ6A 2LI6A 3QEBZ 4C8LA 4J9PA 2C22A 4TURA 5KAIU 2E8MA 3C1ZA 4TUSA 4FE3A 4F91B 4FBUA 4KLHA 4KTQA 2KTQA 5HHIA 3VC8A 1BPYA 1ZQFA 5J2GA 1Y88A 3O0FA 4R65A 4I2IA 4QZCA 3SAFA 2W3RA 2PMZF 4CF3A 5AHXA 3OSNA 2XGQA 4PHPA 3Q8QB 1PUZA 5AI0A 3HP6A 1TAUA 4C4TA 3IN5A 5TISU 2AXTU 3QU7A 3PV8A 5ALZA 2ZXIA 2B0CA 3M8RA 1X6IA 3SZ2A 3T79A 2A3VA 9ICFA 4YXMA 3AU2A 2P66A 5ALQA 4YVZA 4LVSA 5AK4A 5KG3A 4O0IA 1X9XA 4RQ6A 3C2LA 8ICMA 3K1RB 1NJYA 4IC9A 1PK3A 4R64A 1QSYA 2HCFA 2WF9A 2YMPA 1CEZA 1TK8A 3H0MB 3PX0A 1X66A 2EH9A 3I28A 2DPJA 1TK5A 1ZQGA 4TQSA 2OYYA 4X5VA 3NVZA 9ICHA 2I9GA 4NY8A 3M6ZA 3K4GA 4Q8FA 4QZEA 5HR6A 2HHUA 2W8LA 1QH9A 3H7IA 3LVWA 4DCCA 3FC4A 3TADA 4RU9A 2HI0A 4FZNA 1B4FA 2F2AB 4P0PB 2K4HA 2JH1A 2JZBA 1BVSA 3IHQB 4RNMA 4UQGA 1X42A 3BJYA 3SD7A 4PZNA 4QZGA 3B0YA 3T3FA 3QXGA 4KLIA 2XY6A 2JGAA 4GFJA 5DG7A 4J9MA 2BZFA 4UW9A 3MFHA 3F2CA 2W03A 3QE9Y 4YR2A 3HT3A 3CP8A 2E5SA 2HSZA 1U49A 2G09A 3ONNA 2D8CA 1N5XA 3PY8A 4C0ZA 5J2AA 2KZMA 3PMNA 2K8BB 3FYHA 2V4RA 4DSEA 2QARA 1Z4NA 1OXJA 1FO4A 1SXDA 4Q45A 4R8UA 1IXRA 2F8LA 3WK9A 3TFRA 2G06A 3WKCA 3SENA 5CJ7A 9ICWA 8ICHA 1PZNA 5ALXA 1KFSA 5KG0A 2WF5A 4YP3A 3NTUA 2Q4TA 3H4DA 4DQIA 3PSIA 1KEJA 8ICVA 3PVXA 3NRWA 4F71A 3OSPA 3WKEA 5J2DA 2ZUBA 4I2FA 4Y2TA 4J03A 1B0XA 3EW9A 4NWIA 4XA5A 7ICVA 1N56A 7ICPA 4DL3A 4IQWA 4RNOA 4JV2A 4I2JA 4C4RA 9ICXA 2W9CB 4CCHA 2OHFA 3RR7A 3UQ0A 3WKDA 1T3NA 1SB3C 1NJWA 2UVVA 5ALWA 2KZZA 1YT3A 5F9LA 4PGYA 3KD3A 8ICEA 3E58A 4PL1A 5J2HA 3C5GA 9ICPA 5J8YA 1KW4A 3ORYA 2KP7A 4QWBA 1D9FA 4I2CA 1BPXA 4ED3A 8ICKA 5F9NA 2MSNA 1S10A 1IIPA 2IHMA 1BPDA 4R66A 4JV0A 1B22A 3TKAA 3JPTA 2FMPA 4U7CA 5EE1A 3V6HA 5ALLA 3QX7A 2XICA 4QIWF 3M8SA 2NRXA 2ZJ8A 3V7LA 2AQ0A 2VA3A 1JX4A 4UB6U 5KG1A 1D8BA 3RRGA 4KLOA 4LJXA 4ICAA 1SV0C 1ZQVA 4ED1A 4F72A 4K4IA 5KFZA 2HOQA 3NGDA 2XY5A 5BPCA 4JB3A 4EZ9A 2ZJ5A 2XGPA 1A76A 3R9KA 4UAWA 4UB5A 4P2HA 2K89A 1A0PA 2BQUA 4Y2SA 3EPIA 1T8EA 8ICLA 3C2KA 3BQ2A 8ICIA 1KN5A 4O3MA 4LZDA 3MGIA 4IQTA 1X40A 5F3XB 4MEXA 2W54A 5J0WA 4DOCA 1ZQKA 1JRPA 3LWMA 2BPGA 3KZIU 1U47A 3PX4A 5L9XA 4DO9A 9ICMA 9ICTA 2NO4A 2LMRA 2FLLA 3PMLA 3NRZA 3PZPA 2BCRA 7ICGA 3C5FA 4P4OA 3OJSA 2BPFA 3IRUA 2FPLA 5A0LA 2PI4A 4WJ3B 4M6WA 9ICRA 4F50A 1ED1A 3KTQA 5KAFU 4CF5A 2ASLA 4DL4A 3BZKA 3KZXA 4GC7A 5L1IA 4Z6EA 1ECWA 1V38A 2JHDA 3K75D 2RRDA 5AKZA 3GIIA 3PX6A 2RDIA 2BCUA 2JEFA 1X9MA 3G6VA 2W55A 2NRZA 5AI5A 4YD1A 4QWDA 3ZDDA 5AM1A 5IIOA 5ALRA 3ZD9A 3ZI4A 4DL5A 1ZQLA 3QZ7A 2DUYA 1HEKA 5CWRA 4YR3A 9ICCA 2EDUA 5KFXA 4KLLA 1LV5A 2LM1A 1LB2B 4F92B 3C21A 2ZIXB 4BXOA 1MSWD 2ZTEA 3IG5A 1L6NA 5CEHA
chains in the Genus database with same CATH topology
1RZTA 2F1IA 4RQ0A 3E2EA 5KG6A 4GLXA 3PW4A 3TANA 4E0DA 3V72A 1QSLA 4RQ7A 3PW7A 4C8MA 2C2DA 1WCLA 1QSSA 4ECYA 5DBAA 1ZQUA 4KLDA 4RQ8A 1MQ3A 4QZDA 4M0AA 3M9OB 3PO4A 5KG7A 1S97A 4FS1A 4QZHA 3V7JA 5DLFA 2W9BB 3ISDA 2AGQA 5J0SA 4QWAA 9ICLA 5CA7A 2HW3A 3KHHA 5DGBA 3EYZA 1TAQA 1KDHA 4RQ2A 3LDAA 1BGXT 5D4BA 3RH5A 1U45A 1RXVA 9ICGA 2AQ4A 4DSIA 4PPXA 5J0XA 4O5CA 4RUAA 5J0RA 7ICQA 5KFFA 1ZQIA 2P6RA 1UA0A 5DQHA 5HMMA 4XQ8A 4PHDA 4ECUA 4ECXA 5IILA 4M04A 4DL2A 1EXNA 3GQCA 1C7YA 1Z3EB 4DL7A 4IR1A 5DDMA 5KFOA 4B9VA 1RPLA 1DGSA 7ICKA 5DQGA 4M47A 4O9MA 4ECWA 4O3NA 1MQ2A 4UB1A 4RT2A 4YQWA 3QZ8A 4DOBA 1DOQA 4RQ3A 1S0OA 2PI5A 7ICIA 4UAYA 4I2AA 3QEBZ 4C8LA 4J9PA 2C22A 2JEGA 4TURA 3LWLA 1TVAA 4Q44A 5J0QA 3C1ZA 4F3OA 7ICRA 1T4GA 4I2EA 4HYKA 4TUSA 5IIJA 1XSLA 4F91B 4FBUA 2JEJA 3MDCA 2Y1IA 2MAXA 5L1KA 4ED0A 1NKCA 1SL2A 1ZQJA 4KTQA 2A1JA 4KLHA 4DFJA 5HHIA 2KTQA 2HHWA 5J2FA 1XS9D 4DLGA 4QZ8A 1BPYA 1ZQFA 5J2GA 3Q8PB 1Y88A 4Z6CA 1BPEA 4R65A 4I2IA 5KT3A 3TARA 5DLGA 5J2JA 4TUPA 3Q8KA 2FMQA 3ZDCA 4QZCA 4GXIA 4DQRA 1NK4A 1JXEA 3OSNA 5KFLA 3RJJA 4PHAA 2XGQA 4PHPA 1XSPA 4QW9A 3H8WA 2Q0ZX 3Q8QB 2B21A 3KHRA 5IINA 1L3UA 3HP6A 5D49A 1D9DA 2ISOA 1TAUA 5HMLA 2BQRA 2KFNA 4R8UB 3PV8A 7ICFA 1XWLA 5DG9A 1KRPA 3V6JA 2VA8A 3M8RA 3SZ2A 1ZQQA 3EZ5A 2HHQA 4RZRA 9ICFA 1H38A 3UXPA 2PFOA 4I2HA 4YXMA 3AU2A 2P66A 2FLPA 4UAZA 1TV9A 4YVZA 5DDYA 5J0OA 1NK9A 1HUZA 2J6UA 2PFPA 2HVIA 5KFTA 4LVSA 4RQ4A 4TQRA 5KG3A 4O0IA 4EYHB 4F8RA 1X9SA 4RQ6A 3C2LA 8ICMA 1MC8A 3MABA 1NJYA 1ZQTA 2BCSA 4ECQA 4F5PA 8ICRA 2ASDA 1X2IA 8ICUA 5KFBA 4O3OA 4R64A 5DB7A 1QSYA 7ICNA 1ZQSA 4DSFA 1CEZA 4NLNA 1Z00A 1TK8A 3RAXA 5KG5A 3PX0A 2J6SA 4J9OA 1S9FA 5KFRA 4BGDA 3PO5A 7ICOA 7ICSA 3N97B 5EWFA 3RB6A 8ICPA 4O5KA 8ICGA 2KN7A 2DPJA 4TUQA 1TK5A 1ZQGA 4TQSA 2J6TA 2ZUDA 3C1YA 4KMUA 2R8IA 4X5VA 5JUMA 5DB6A 7ICUA 9ICHA 2I9GA 1A77A 4NY8A 4DFMA 4YCXA 4F4XA 4JUZA 4F5NA 2DPIA 3K4GA 5KFEA 4Q8FA 2XCPA 4QZEA 3SV3A 1T7PA 5TZVA 4F4KA 9ICUA 4KN4A 3RH4A 4EYIB 4JK1A 4DQPA 2XCAA 2HHUA 5J2BA 3GV7B 4MFFA 2AJQA 4DFPA 4K4GA 3RB3A 2W8LA 5L1JA 1UT5A 1QTMA 3SYZA 1SKSA 1TK0A 1KTQA 3H7IA 3G6XA 3TAQA 1AROP 8ICJA 5DG8A 3H8JA 1S0VA 2UVUA 4RU9A 4BWMA 4YMOA 3C2MA 1ZQXA 4DSJA 4ECSA 9ICEA 4NLKA 7ICLA 3RBDA 1NK7A 1RXWA 2JZBA 1BVSA 3Q8SB 3H40A 4ECRA 3IHQB 1ZQBA 2I1QA 2M9NA 2LYHA 4RNMA 4UQGA 4BWJA 1KSPA 3OJUA 3BJYA 4PHEA 5KT6A 5BOMA 3JPRA 3HWTA 2BPCA 4UBBA 4QZGA 3GDXA 4M9GA 2H5XA 5KT5A 1NKBA 4LZGA 8ICXA 3B0YA 3T3FA 4YXJA 4KLIA 2XY6A 5J2CA 3GIKA 2JZBB 5DG7A 5J0YA 1NJXA 4J9MA 8ICFA 3ISBA 4MFCA 4F2RA 4I29A 3MFHA 3SV4A 4UB4A 5KFYA 4MF8A 3QE9Y 4RUCA 4YR2A 1SKWA 3RR8A 1NK5A 3HT3A 3Q8RB 4P4MA 9ICQA 8ICSA 1U49A 1RYSA 3RB4A 4QZFA 9ICKA 2IHNA 2R8KA 4ELTA 4PGQA 3PR5B 1JN3A 3AUOA 3RJIA 4UB2A 1XU4A 4KLMA 3PY8A 5KFVA 5HNKA 1L3TA 2MUTB 1S77D 5J2AA 2KZMA 4J9SA 4C8NA 3H8SA 3GV8B 3PMNA 4B9LA 3FDSA 3ZDBA 3FYHA 2V4RA 2AGPA 5DB9A 2C2EA 1K1SA 1UT8A 4DSEA 4RNNA 2RDJA 4J9RA 2C28A 3Q8LA 1L3VA 4K4HA 4Q45A 4R8UA 4JV1A 1IXRA 3H4BA 1NKEA 3TFRA 4F2SA 9ICVA 5HHHA 2BR0A 5KT7A 2OWOA 3MR2A 5CJ7A 8ICZA 9ICWA 1JMSA 4EBEA 8ICBA 8ICHA 3PW2A 4B9NA 5KT2A 4P4PA 4F93B 4DL6A 4EZ6A 1PZNA 5KFIA 1ZQRA 1KFSA 5KG0A 4YP3A 1KFDA 3NTUA 5J2KA 9ICJA 4RPYA 4O3SA 3H4DA 2BQ3A 4ED8A 3RJFA 1ZQZA 2IBKA 3B0XA 4DQIA 4IR9A 1KEJA 4IQVA 1CUKA 8ICVA 3OHAA 3PVXA 5KG2A 2FPMA 3ETLA 4XUSA 5J2DA 3OSPA 2BDPA 5IIMA 2ZUBA 3HW8A 3AU6A 1ZQOA 3BDPA 4XA5A 3EW9A 3JPNA 4I2FA 4MEYA 7ICVA 2W9CA 3RBEA 1TKDA 5J0PA 4FS2A 3M9NB 2BGWA 1SL1A 4DF8A 1N56A 1XO1A 4DSKA 9ICNA 7ICPA 2PFNA 4DL3A 2KZ3A 4J9NA 3TI0A 1NK8A 4IQWA 4O5EA 7ICJA 5KFMA 4RNOA 1SZPA 4DOAA 3KHLA 4JV2A 4XRHA 4I2JA 1L3SA 5J2IA 1ZJMA 9ICXA 1TFRA 2HHXA 2W9CB 8ICCA 4B9SA 3UXNA 2Y1JA 3MBYA 4CCHA 4GXJA 3QEAZ 3RJKA 3GIJA 4DS5A 1COOA 1UA1A 5DQIA 3RR7A 3MR5A 4KLTA 4C8OA 8ICWA 3OHBA 5CB1A 3UQ0A 4J9LA 2XC9A 2ALZA 1ZETA 4ECVA 1T3NA 1NJWA 1BPZA 2UVVA 4B9MA 3RJGA 2FPKA 5KFAA 2KZZA 3PR4A 4MF2A 1U48A 3RRHA 1SL0A 4ECTA 4GC6A 4NLGA 2ASJA 4QZBA 2ZUCA 4DQQA 3GV5B 4F4WA 4F4ZA 4DFKA 9ICSA 1XSNA 3BQTA 4KLFA 2UVRA 5F9LA 7ICEA 4PGYA 4YFKA 8ICEA 4M9NA 5J2HA 4NLZA 3HPOA 3C5GA 1NK6A 4EBDA 9ICPA 4KLSA 3ORYA 4ELVA 2XY7A 1RYRA 4QWBA 4KN7A 1D9FA 4I2CA 1BPXA 4KLUA 4M2YA 4ED3A 2NRWA 3ZDEA 1S0MA 8ICKA 5F9NA 8ICAA 1S10A 5KFSA 1ZQCA 5J2EA 3MFIA 4YD2A 4I2DA 1BPDA 4R66A 2IHMA 3RAQA 4JV0A 1B22A 2F1HA 4I2BA 4QWEA 3BQ1A 4DF4A 5KT4A 3TAPA 4G3IA 4Z6FA 4NM2A 2ZTDA 3JPTA 2A1JB 2MUTA 4YMNA 2FMPA 1B43A 4MFAA 4B9TA 8ICOA 3V6HA 1BPBA 2R8JA 4KLEA 3KHGA 3MGHA 2WTFA 3GIMA 5DKWA 4J9KA 2BKEA 5J29A 5CP2A 5EOZA 3M8SA 2NRXA 1WCNA 2ZJ8A 3V7LA 2AQ0A 3RH6A 1JIHA 4JWMA 2UVWA 4IRDA 2VA3A 1JX4A 7ICHA 2W9MA 4ECZA 4GXKA 3BQ0A 4BDPA 5KG1A 1K1QA 3RJEA 1ZQMA 2VANA 4QWCA 3RRGA 4KLOA 2PXIA 1V9PA 9ICBA 2ISPA 1ZQVA 4O3RA 2W9BA 4ED1A 4Q43A 3JPSA 4DSLA 1D8YA 2FLNA 4K4IA 2KFZA 4UB3A 3LK9A 4IRKA 2HHVA 2BHNA 5KFZA 3T5HA 2V9WA 3HX0A 2XY5A 3NGDA 5KFWA 4NM1A 5BPCA 4EZ9A 2ZJ5A 4FO6A 2XGPA 3RJHA 1A76A 5L1LA 1X9WA 5KFNA 4JWNA 5IIIA 5KFJA 2PFQA 8ICNA 4UAWA 1ZQDA 4PH5A 2F1JA 4UB5A 4B9UA 4QZAA 3PW0A 4P2HA 2BQUA 3EPIA 1T8EA 8ICLA 3C2KA 8ICYA 3BQ2A 4KITB 1ZQEA 8ICIA 4O3PA 3MR3A 5J0UA 4ELUA 3N4MB 1Z00B 3RTVA 2IA6A 5KFCA 4LZDA 7ICTA 3MGIA 3T5KA 2BCQA 4IQTA 5EWEA 1S0NA 4O3QA 2ZTCA 4YMMA 2JEIA 3PNCA 4RT3A 2AU0A 5J0TA 4RPZA 4MEXA 5J0WA 4EEYA 1SKRA 4DOCA 1S76D 1ZQKA 2BPGA 3LWMA 5KFDA 3MDAA 4ED7A 1U47A 3PX4A 5KFPA 2XO7A 5L9XA 3JPQA 4M9HA 4DO9A 9ICMA 9ICTA 4RQ5A 4C8KA 4I27A 2FLLA 2HVHA 5KFHA 1U9LA 4M6WB 3PMLA 1N48A 2NRVA 2BCRA 8ICTA 7ICGA 3C5FA 4P4OA 2V4QA 9ICAA 1ZQWA 3OJSA 4M9JA 2C2RA 1NK0A 2BPFA 3M9MB 3UXOA 3EPGA 3UPQA 3THVA 1ZQPA 1ZYQA 3MR6A 4RPXA 5CR0A 5KG4A 2P6UA 2FPLA 1ZJNA 2HHTA 1ZQAA 3SI8A 2PI4A 1HJPA 3V7KA 4M6WA 2GWSA 9ICRA 4F50A 3C23A 4IQUA 4IRCA 3KTQA 4F5RA 3IM1A 4KLQA 4NXZA 1QLNA 4YR0A 2ASLA 4DL4A 4M9LA 4GC7A 2IMWP 5L1IA 4Z6EA 4F4YA 3Q8MA 4YN4A 1D8LA 3T5LA 4I2GA 4KLJA 5IIKA 5D46A 5DBCA 3K75D 3GIIA 3RB0A 5C5JA 3PX6A 3V6KA 2RDIA 2BCUA 4RQ1A 5CHGA 1U4BA 1ZQHA 2DFLA 1X9MA 2JEFA 4DQSA 3G6VA 2NRZA 5KFGA 4YD1A 1NJZA 4QWDA 2ZJAA 3ZDDA 3GFKB 3PW5A 4I28A 3JPPA 1XC9A 4ED2A 3T5JA 5IIOA 4ZH4A 4Z6DA 3G6YA 4KLGA 4Q8EA 3JPOA 3ZD9A 4F5OA 1IM4A 4QW8A 5DBBA 4QZ9A 4QZIA 3QZ7A 4DL5A 1HUOA 3GILA 1ZQLA 1KLNA 2R8GA 1KFTA 9ICIA 5CWRA 2BCVA 4DEZA 4YR3A 8ICQA 3ZDAA 1JXLA 5KFQA 5EWGA 2VA2A 9ICCA 4BXOB 1NOMA 1ZQYA 4J9QA 5KFXA 7ICMA 3UQ2A 5KFKA 4PGXA 3TQ1A 4KLLA 3TFSA 2W8KA 4EBCA 4DS4A 4R63A 5BOLA 1LV5A 1ZQNA 2FMSA 1LB2B 4FBTA 4F92B 5HP4A 3C21A 2HHSA 2NRTA 5KTQA 5DB8A 4BXOA 4UBCA 4YG2A 1MSWD 5DGAA 3ZD8A 3OGUA 2AGOA 2ZTEA 5KFUA 4DWIA 2W9AA 4ED6A 3EWAA 2ATLA 9ICOA 1L5UA 4F5QA 3ISCA 4DLEA 2R8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RZT A;  2F1I A;  4RQ0 A;  3E2E A;  5KG6 A;  4GLX A;  3PW4 A;  3TAN A;  4E0D A;  3V72 A;  1QSL A;  4RQ7 A;  3PW7 A;  4C8M A;  2C2D A;  1WCL A;  1QSS A;  4ECY A;  5DBA A;  1ZQU A;  4KLD A;  4RQ8 A;  1MQ3 A;  4QZD A;  4M0A A;  3M9O B;  3PO4 A;  5KG7 A;  1S97 A;  4FS1 A;  4QZH A;  3V7J A;  5DLF A;  2W9B B;  3ISD A;  2AGQ A;  5J0S A;  4QWA A;  9ICL A;  5CA7 A;  2HW3 A;  3KHH A;  5DGB A;  3EYZ A;  1TAQ A;  1KDH A;  4RQ2 A;  3LDA A;  1BGX T;  5D4B A;  3RH5 A;  1U45 A;  1RXV A;  9ICG A;  2AQ4 A;  4DSI A;  4PPX A;  5J0X A;  4O5C A;  4RUA A;  5J0R A;  7ICQ A;  5KFF A;  1ZQI A;  2P6R A;  1UA0 A;  5DQH A;  5HMM A;  4XQ8 A;  4PHD A;  4ECU A;  4ECX A;  5IIL A;  4M04 A;  4DL2 A;  1EXN A;  3GQC A;  1C7Y A;  1Z3E B;  4DL7 A;  4IR1 A;  5DDM A;  5KFO A;  4B9V A;  1RPL A;  1DGS A;  7ICK A;  5DQG A;  4M47 A;  4O9M A;  4ECW A;  4O3N A;  1MQ2 A;  4UB1 A;  4RT2 A;  4YQW A;  3QZ8 A;  4DOB A;  1DOQ A;  4RQ3 A;  1S0O A;  2PI5 A;  7ICI A;  4UAY A;  4I2A A;  3QEB Z;  4C8L A;  4J9P A;  2C22 A;  2JEG A;  4TUR A;  3LWL A;  1TVA A;  4Q44 A;  5J0Q A;  3C1Z A;  4F3O A;  7ICR A;  1T4G A;  4I2E A;  4HYK A;  4TUS A;  5IIJ A;  1XSL A;  4F91 B;  4FBU A;  2JEJ A;  3MDC A;  2Y1I A;  2MAX A;  5L1K A;  4ED0 A;  1NKC A;  1SL2 A;  1ZQJ A;  4KTQ A;  2A1J A;  4KLH A;  4DFJ A;  5HHI A;  2KTQ A;  2HHW A;  5J2F A;  1XS9 D;  4DLG A;  4QZ8 A;  1BPY A;  1ZQF A;  5J2G A;  3Q8P B;  1Y88 A;  4Z6C A;  1BPE A;  4R65 A;  4I2I A;  5KT3 A;  3TAR A;  5DLG A;  5J2J A;  4TUP A;  3Q8K A;  2FMQ A;  3ZDC A;  4QZC A;  4GXI A;  4DQR A;  1NK4 A;  1JXE A;  3OSN A;  5KFL A;  3RJJ A;  4PHA A;  2XGQ A;  4PHP A;  1XSP A;  4QW9 A;  3H8W A;  2Q0Z X;  3Q8Q B;  2B21 A;  3KHR A;  5IIN A;  1L3U A;  3HP6 A;  5D49 A;  1D9D A;  2ISO A;  1TAU A;  5HML A;  2BQR A;  2KFN A;  4R8U B;  3PV8 A;  7ICF A;  1XWL A;  5DG9 A;  1KRP A;  3V6J A;  2VA8 A;  3M8R A;  3SZ2 A;  1ZQQ A;  3EZ5 A;  2HHQ A;  4RZR A;  9ICF A;  1H38 A;  3UXP A;  2PFO A;  4I2H A;  4YXM A;  3AU2 A;  2P66 A;  2FLP A;  4UAZ A;  1TV9 A;  4YVZ A;  5DDY A;  5J0O A;  1NK9 A;  1HUZ A;  2J6U A;  2PFP A;  2HVI A;  5KFT A;  4LVS A;  4RQ4 A;  4TQR A;  5KG3 A;  4O0I A;  4EYH B;  4F8R A;  1X9S A;  4RQ6 A;  3C2L A;  8ICM A;  1MC8 A;  3MAB A;  1NJY A;  1ZQT A;  2BCS A;  4ECQ A;  4F5P A;  8ICR A;  2ASD A;  1X2I A;  8ICU A;  5KFB A;  4O3O A;  4R64 A;  5DB7 A;  1QSY A;  7ICN A;  1ZQS A;  4DSF A;  1CEZ A;  4NLN A;  1Z00 A;  1TK8 A;  3RAX A;  5KG5 A;  3PX0 A;  2J6S A;  4J9O A;  1S9F A;  5KFR A;  4BGD A;  3PO5 A;  7ICO A;  7ICS A;  3N97 B;  5EWF A;  3RB6 A;  8ICP A;  4O5K A;  8ICG A;  2KN7 A;  2DPJ A;  4TUQ A;  1TK5 A;  1ZQG A;  4TQS A;  2J6T A;  2ZUD A;  3C1Y A;  4KMU A;  2R8I A;  4X5V A;  5JUM A;  5DB6 A;  7ICU A;  9ICH A;  2I9G A;  1A77 A;  4NY8 A;  4DFM A;  4YCX A;  4F4X A;  4JUZ A;  4F5N A;  2DPI A;  3K4G A;  5KFE A;  4Q8F A;  2XCP A;  4QZE A;  3SV3 A;  1T7P A;  5TZV A;  4F4K A;  9ICU A;  4KN4 A;  3RH4 A;  4EYI B;  4JK1 A;  4DQP A;  2XCA A;  2HHU A;  5J2B A;  3GV7 B;  4MFF A;  2AJQ A;  4DFP A;  4K4G A;  3RB3 A;  2W8L A;  5L1J A;  1UT5 A;  1QTM A;  3SYZ A;  1SKS A;  1TK0 A;  1KTQ A;  3H7I A;  3G6X A;  3TAQ A;  1ARO P;  8ICJ A;  5DG8 A;  3H8J A;  1S0V A;  2UVU A;  4RU9 A;  4BWM A;  4YMO A;  3C2M A;  1ZQX A;  4DSJ A;  4ECS A;  9ICE A;  4NLK A;  7ICL A;  3RBD A;  1NK7 A;  1RXW A;  2JZB A;  1BVS A;  3Q8S B;  3H40 A;  4ECR A;  3IHQ B;  1ZQB A;  2I1Q A;  2M9N A;  2LYH A;  4RNM A;  4UQG A;  4BWJ A;  1KSP A;  3OJU A;  3BJY A;  4PHE A;  5KT6 A;  5BOM A;  3JPR A;  3HWT A;  2BPC A;  4UBB A;  4QZG A;  3GDX A;  4M9G A;  2H5X A;  5KT5 A;  1NKB A;  4LZG A;  8ICX A;  3B0Y A;  3T3F A;  4YXJ A;  4KLI A;  2XY6 A;  5J2C A;  3GIK A;  2JZB B;  5DG7 A;  5J0Y A;  1NJX A;  4J9M A;  8ICF A;  3ISB A;  4MFC A;  4F2R A;  4I29 A;  3MFH A;  3SV4 A;  4UB4 A;  5KFY A;  4MF8 A;  3QE9 Y;  4RUC A;  4YR2 A;  1SKW A;  3RR8 A;  1NK5 A;  3HT3 A;  3Q8R B;  4P4M A;  9ICQ A;  8ICS A;  1U49 A;  1RYS A;  3RB4 A;  4QZF A;  9ICK A;  2IHN A;  2R8K A;  4ELT A;  4PGQ A;  3PR5 B;  1JN3 A;  3AUO A;  3RJI A;  4UB2 A;  1XU4 A;  4KLM A;  3PY8 A;  5KFV A;  5HNK A;  1L3T A;  2MUT B;  1S77 D;  5J2A A;  2KZM A;  4J9S A;  4C8N A;  3H8S A;  3GV8 B;  3PMN A;  4B9L A;  3FDS A;  3ZDB A;  3FYH A;  2V4R A;  2AGP A;  5DB9 A;  2C2E A;  1K1S A;  1UT8 A;  4DSE A;  4RNN A;  2RDJ A;  4J9R A;  2C28 A;  3Q8L A;  1L3V A;  4K4H A;  4Q45 A;  4R8U A;  4JV1 A;  1IXR A;  3H4B A;  1NKE A;  3TFR A;  4F2S A;  9ICV A;  5HHH A;  2BR0 A;  5KT7 A;  2OWO A;  3MR2 A;  5CJ7 A;  8ICZ A;  9ICW A;  1JMS A;  4EBE A;  8ICB A;  8ICH A;  3PW2 A;  4B9N A;  5KT2 A;  4P4P A;  4F93 B;  4DL6 A;  4EZ6 A;  1PZN A;  5KFI A;  1ZQR A;  1KFS A;  5KG0 A;  4YP3 A;  1KFD A;  3NTU A;  5J2K A;  9ICJ A;  4RPY A;  4O3S A;  3H4D A;  2BQ3 A;  4ED8 A;  3RJF A;  1ZQZ A;  2IBK A;  3B0X A;  4DQI A;  4IR9 A;  1KEJ A;  4IQV A;  1CUK A;  8ICV A;  3OHA A;  3PVX A;  5KG2 A;  2FPM A;  3ETL A;  4XUS A;  5J2D A;  3OSP A;  2BDP A;  5IIM A;  2ZUB A;  3HW8 A;  3AU6 A;  1ZQO A;  3BDP A;  4XA5 A;  3EW9 A;  3JPN A;  4I2F A;  4MEY A;  7ICV A;  2W9C A;  3RBE A;  1TKD A;  5J0P A;  4FS2 A;  3M9N B;  2BGW A;  1SL1 A;  4DF8 A;  1N56 A;  1XO1 A;  4DSK A;  9ICN A;  7ICP A;  2PFN A;  4DL3 A;  2KZ3 A;  4J9N A;  3TI0 A;  1NK8 A;  4IQW A;  4O5E A;  7ICJ A;  5KFM A;  4RNO A;  1SZP A;  4DOA A;  3KHL A;  4JV2 A;  4XRH A;  4I2J A;  1L3S A;  5J2I A;  1ZJM A;  9ICX A;  1TFR A;  2HHX A;  2W9C B;  8ICC A;  4B9S A;  3UXN A;  2Y1J A;  3MBY A;  4CCH A;  4GXJ A;  3QEA Z;  3RJK A;  3GIJ A;  4DS5 A;  1COO A;  1UA1 A;  5DQI A;  3RR7 A;  3MR5 A;  4KLT A;  4C8O A;  8ICW A;  3OHB A;  5CB1 A;  3UQ0 A;  4J9L A;  2XC9 A;  2ALZ A;  1ZET A;  4ECV A;  1T3N A;  1NJW A;  1BPZ A;  2UVV A;  4B9M A;  3RJG A;  2FPK A;  5KFA A;  2KZZ A;  3PR4 A;  4MF2 A;  1U48 A;  3RRH A;  1SL0 A;  4ECT A;  4GC6 A;  4NLG A;  2ASJ A;  4QZB A;  2ZUC A;  4DQQ A;  3GV5 B;  4F4W A;  4F4Z A;  4DFK A;  9ICS A;  1XSN A;  3BQT A;  4KLF A;  2UVR A;  5F9L A;  7ICE A;  4PGY A;  4YFK A;  8ICE A;  4M9N A;  5J2H A;  4NLZ A;  3HPO A;  3C5G A;  1NK6 A;  4EBD A;  9ICP A;  4KLS A;  3ORY A;  4ELV A;  2XY7 A;  1RYR A;  4QWB A;  4KN7 A;  1D9F A;  4I2C A;  1BPX A;  4KLU A;  4M2Y A;  4ED3 A;  2NRW A;  3ZDE A;  1S0M A;  8ICK A;  5F9N A;  8ICA A;  1S10 A;  5KFS A;  1ZQC A;  5J2E A;  3MFI A;  4YD2 A;  4I2D A;  1BPD A;  4R66 A;  2IHM A;  3RAQ A;  4JV0 A;  1B22 A;  2F1H A;  4I2B A;  4QWE A;  3BQ1 A;  4DF4 A;  5KT4 A;  3TAP A;  4G3I A;  4Z6F A;  4NM2 A;  2ZTD A;  3JPT A;  2A1J B;  2MUT A;  4YMN A;  2FMP A;  1B43 A;  4MFA A;  4B9T A;  8ICO A;  3V6H A;  1BPB A;  2R8J A;  4KLE A;  3KHG A;  3MGH A;  2WTF A;  3GIM A;  5DKW A;  4J9K A;  2BKE A;  5J29 A;  5CP2 A;  5EOZ A;  3M8S A;  2NRX A;  1WCN A;  2ZJ8 A;  3V7L A;  2AQ0 A;  3RH6 A;  1JIH A;  4JWM A;  2UVW A;  4IRD A;  2VA3 A;  1JX4 A;  7ICH A;  2W9M A;  4ECZ A;  4GXK A;  3BQ0 A;  4BDP A;  5KG1 A;  1K1Q A;  3RJE A;  1ZQM A;  2VAN A;  4QWC A;  3RRG A;  4KLO A;  2PXI A;  1V9P A;  9ICB A;  2ISP A;  1ZQV A;  4O3R A;  2W9B A;  4ED1 A;  4Q43 A;  3JPS A;  4DSL A;  1D8Y A;  2FLN A;  4K4I A;  2KFZ A;  4UB3 A;  3LK9 A;  4IRK A;  2HHV A;  2BHN A;  5KFZ A;  3T5H A;  2V9W A;  3HX0 A;  2XY5 A;  3NGD A;  5KFW A;  4NM1 A;  5BPC A;  4EZ9 A;  2ZJ5 A;  4FO6 A;  2XGP A;  3RJH A;  1A76 A;  5L1L A;  1X9W A;  5KFN A;  4JWN A;  5III A;  5KFJ A;  2PFQ A;  8ICN A;  4UAW A;  1ZQD A;  4PH5 A;  2F1J A;  4UB5 A;  4B9U A;  4QZA A;  3PW0 A;  4P2H A;  2BQU A;  3EPI A;  1T8E A;  8ICL A;  3C2K A;  8ICY A;  3BQ2 A;  4KIT B;  1ZQE A;  8ICI A;  4O3P A;  3MR3 A;  5J0U A;  4ELU A;  3N4M B;  1Z00 B;  3RTV A;  2IA6 A;  5KFC A;  4LZD A;  7ICT A;  3MGI A;  3T5K A;  2BCQ A;  4IQT A;  5EWE A;  1S0N A;  4O3Q A;  2ZTC A;  4YMM A;  2JEI A;  3PNC A;  4RT3 A;  2AU0 A;  5J0T A;  4RPZ A;  4MEX A;  5J0W A;  4EEY A;  1SKR A;  4DOC A;  1S76 D;  1ZQK A;  2BPG A;  3LWM A;  5KFD A;  3MDA A;  4ED7 A;  1U47 A;  3PX4 A;  5KFP A;  2XO7 A;  5L9X A;  3JPQ A;  4M9H A;  4DO9 A;  9ICM A;  9ICT A;  4RQ5 A;  4C8K A;  4I27 A;  2FLL A;  2HVH A;  5KFH A;  1U9L A;  4M6W B;  3PML A;  1N48 A;  2NRV A;  2BCR A;  8ICT A;  7ICG A;  3C5F A;  4P4O A;  2V4Q A;  9ICA A;  1ZQW A;  3OJS A;  4M9J A;  2C2R A;  1NK0 A;  2BPF A;  3M9M B;  3UXO A;  3EPG A;  3UPQ A;  3THV A;  1ZQP A;  1ZYQ A;  3MR6 A;  4RPX A;  5CR0 A;  5KG4 A;  2P6U A;  2FPL A;  1ZJN A;  2HHT A;  1ZQA A;  3SI8 A;  2PI4 A;  1HJP A;  3V7K A;  4M6W A;  2GWS A;  9ICR A;  4F50 A;  3C23 A;  4IQU A;  4IRC A;  3KTQ A;  4F5R A;  3IM1 A;  4KLQ A;  4NXZ A;  1QLN A;  4YR0 A;  2ASL A;  4DL4 A;  4M9L A;  4GC7 A;  2IMW P;  5L1I A;  4Z6E A;  4F4Y A;  3Q8M A;  4YN4 A;  1D8L A;  3T5L A;  4I2G A;  4KLJ A;  5IIK A;  5D46 A;  5DBC A;  3K75 D;  3GII A;  3RB0 A;  5C5J A;  3PX6 A;  3V6K A;  2RDI A;  2BCU A;  4RQ1 A;  5CHG A;  1U4B A;  1ZQH A;  2DFL A;  1X9M A;  2JEF A;  4DQS A;  3G6V A;  2NRZ A;  5KFG A;  4YD1 A;  1NJZ A;  4QWD A;  2ZJA A;  3ZDD A;  3GFK B;  3PW5 A;  4I28 A;  3JPP A;  1XC9 A;  4ED2 A;  3T5J A;  5IIO A;  4ZH4 A;  4Z6D A;  3G6Y A;  4KLG A;  4Q8E A;  3JPO A;  3ZD9 A;  4F5O A;  1IM4 A;  4QW8 A;  5DBB A;  4QZ9 A;  4QZI A;  3QZ7 A;  4DL5 A;  1HUO A;  3GIL A;  1ZQL A;  1KLN A;  2R8G A;  1KFT A;  9ICI A;  5CWR A;  2BCV A;  4DEZ A;  4YR3 A;  8ICQ A;  3ZDA A;  1JXL A;  5KFQ A;  5EWG A;  2VA2 A;  9ICC A;  4BXO B;  1NOM A;  1ZQY A;  4J9Q A;  5KFX A;  7ICM A;  3UQ2 A;  5KFK A;  4PGX A;  3TQ1 A;  4KLL A;  3TFS A;  2W8K A;  4EBC A;  4DS4 A;  4R63 A;  5BOL A;  1LV5 A;  1ZQN A;  2FMS A;  1LB2 B;  4FBT A;  4F92 B;  5HP4 A;  3C21 A;  2HHS A;  2NRT A;  5KTQ A;  5DB8 A;  4BXO A;  4UBC A;  4YG2 A;  1MSW D;  5DGA A;  3ZD8 A;  3OGU A;  2AGO A;  2ZTE A;  5KFU A;  4DWI A;  2W9A A;  4ED6 A;  3EWA A;  2ATL A;  9ICO A;  1L5U A;  4F5Q A;  3ISC A;  4DLE A;  2R8H A; 
#chains in the Genus database with same CATH topology
 2VJ4 A;  3D2Q A;  1WWV A;  5KG6 A;  2CRX A;  1QSL A;  4OJ6 A;  1WCL A;  5DBA A;  2WAQ F;  3UMC A;  4FS1 A;  5DLF A;  1PVQ A;  4P0Q B;  5CA7 A;  2HW3 A;  3KHH A;  1J2N A;  3CYM A;  4Y2Y A;  2YMM A;  2QLT A;  1KDH A;  1BGX T;  2DBY A;  9ICG A;  4NJ8 A;  1T3Q A;  5IIL A;  1EXN A;  1C7Y A;  1Z3E B;  4DL7 A;  5DQG A;  3WKB A;  4RQ3 A;  7ICI A;  4I2A A;  3BS5 B;  1TVA A;  2HBK A;  5J0Q A;  4I2E A;  2D3D A;  2YMQ A;  3MDC A;  1ZQJ A;  1NKC A;  2HHW A;  5J2F A;  1FEZ A;  1COK A;  3TAR A;  3Q8K A;  2FMQ A;  1LKY A;  2FE9 A;  4IS7 A;  3LYS A;  4DQR A;  4U6P A;  2W3S A;  1XSP A;  5IIN A;  4QW9 A;  3H8W A;  1OUQ A;  3KHR A;  5HML A;  2BQR A;  2KFN A;  2RQ5 A;  1KRP A;  3EZ5 A;  2HHQ A;  4MHV A;  4FFD A;  2FLP A;  4UAZ A;  1TV9 A;  5J0O A;  2J6U A;  2PFP A;  3MAB A;  4ECQ A;  4F5P A;  2ASD A;  1X2I A;  3NUQ A;  5DB7 A;  7ICN A;  1ZQS A;  4US9 A;  1Z00 A;  3RAX A;  2J6S A;  5ALT A;  3PO5 A;  4BGD A;  7ICS A;  2QB1 A;  2YQE A;  4O5K A;  8ICG A;  3HIL A;  4IL6 U;  2J6T A;  3C1Y A;  5DB6 A;  1SGG A;  4JUZ A;  2XCP A;  5TZV A;  2DWQ A;  2AJQ A;  3RB3 A;  2ZG6 A;  5L1J A;  1KTQ A;  2EAN A;  1S0V A;  4YMO A;  1ZQX A;  4DSJ A;  1N2X A;  2NO5 A;  4AYB F;  2Y0S F;  1RYU A;  5AIC A;  3QU2 A;  2F3N A;  4BWJ A;  1J2M A;  3JPR A;  5BOM A;  1ZD2 P;  1DK3 A;  4UBB A;  4M9G A;  2H5X A;  5KT5 A;  1NKB A;  4LZG A;  8ICX A;  2DL0 A;  5ALE A;  3OPX A;  5J2C A;  3AQE A;  3AM9 A;  2KKV A;  4I29 A;  5AKE A;  1QQ5 A;  5KFY A;  1SKW A;  3KKA C;  3WK6 A;  2VKQ A;  2YX8 A;  8ICS A;  1X6J A;  3ALR A;  4ELT A;  2R8K A;  4PGQ A;  2WB1 C;  3AUO A;  2EAM A;  2NYV A;  4UB2 A;  1XU4 A;  4KLM A;  2KHQ A;  2FJ6 A;  5KFV A;  5HNK A;  4J9S A;  3H8S A;  4B9L A;  3ZDB A;  4PZO A;  1K1S A;  2WFA A;  2RDJ A;  2C28 A;  2G07 A;  3H4B A;  1CI4 A;  1NKE A;  1P7D A;  2KEY A;  5AKH A;  2BR0 A;  5KT7 A;  3MR2 A;  8ICB A;  4B9N A;  3M7D A;  4EZ6 A;  4F93 B;  4PJ0 U;  2KOB A;  4USA A;  5G5G A;  4RPY A;  2BQ3 A;  2ODG A;  4IQV A;  2ZIX A;  2FPM A;  2JMG A;  3HW8 A;  2A19 A;  3RBE A;  4FS2 A;  1SL1 A;  2QKQ A;  1N61 A;  2YY6 A;  4DF8 A;  4J9N A;  4O5E A;  4DOA A;  1L7M A;  3KHL A;  2K4I A;  1FIQ A;  4XRH A;  2GO7 A;  1L7P A;  5J2I A;  1L3S A;  3U26 A;  8ICC A;  4B9S A;  3MBY A;  3QEA Z;  2ZIW B;  1ZOL A;  4DS5 A;  3GIJ A;  5DQI A;  1ZRM A;  1DK2 A;  3OHB A;  5CB1 A;  2XC9 A;  1ZET A;  1BPZ A;  2FPK A;  2CXY A;  4ECT A;  4GC6 A;  2ASJ A;  4QZB A;  4DQQ A;  3GV5 B;  4DFK A;  3BQT A;  2EZX A;  2H3I A;  4YFK A;  4M9N A;  5AI9 A;  5AKG A;  4ELV A;  3ZDE A;  3CRX A;  3PSP A;  4UAU A;  3DEE A;  2I6X A;  1IV8 A;  4YD2 A;  3RAQ A;  2WAQ C;  2F1H A;  2GH1 A;  2KVS A;  4I2B A;  4QWE A;  3L5K A;  4NM2 A;  4B9T A;  3KFU F;  2KKP A;  3D2N A;  2R8J A;  3MGH A;  2YB4 A;  1VJ5 A;  3HJE A;  2BKE A;  5EOZ A;  5J29 A;  3RH6 A;  4JWM A;  4IRD A;  2W9M A;  4ECZ A;  4GXK A;  3BQ0 A;  4OCZ A;  1K1Q A;  2Y9U A;  1ZQM A;  3RJE A;  4DSL A;  4ACO A;  1JUD A;  2KFZ A;  2HHV A;  4IRK A;  2V9W A;  4NM1 A;  2D6F C;  5L1L A;  4JWN A;  5KFJ A;  8ICN A;  1BNO A;  1QCK A;  4B9U A;  4QZA A;  2H3Z A;  2YTU A;  2N1R A;  3QUQ A;  8ICY A;  4O3P A;  3N4M B;  1Z00 B;  3RTV A;  1NZP A;  2IA6 A;  5K4L A;  1FFV A;  3N7R C;  4YMM A;  3PNC A;  3IV6 A;  2LYA A;  5J0T A;  1PVR A;  2W04 A;  1N62 A;  1SKR A;  2H3Q A;  2KE7 A;  1KKX A;  5KFP A;  3QUC A;  1S5L U;  2HOF A;  2HVH A;  1O08 A;  2NRV A;  5EE0 A;  8ICT A;  1V85 A;  3VCB A;  1ZQW A;  2C2R A;  3M9M B;  3UXO A;  3EPG A;  1ZQP A;  1WUD A;  3SAG A;  2W11 A;  3MR6 A;  4RPX A;  1KBU A;  1Z1B A;  5ALF A;  5JTI A;  1HJP A;  2IOH A;  4IRC A;  1L7O A;  4YR0 A;  1VLB A;  2YML A;  2YN4 A;  4I2G A;  4KLJ A;  2KV2 A;  5AKJ A;  3SQI A;  5C5J A;  3V6K A;  2KHV A;  5CHG A;  4DQS A;  2ZJA A;  2GOL A;  3JPP A;  4ZH4 A;  4KLG A;  3G6Y A;  4F5O A;  1L7N A;  5DBB A;  1KLN A;  3WK8 A;  4DEZ A;  3ZDA A;  3GU3 A;  5KFQ A;  4J9Q A;  5KFK A;  4PGX A;  4EEN A;  4Y2X A;  1ZQN A;  2FMS A;  5E79 U;  3WKA A;  2MRL A;  2NRT A;  5DB8 A;  3HRD D;  3ETR A;  3TAC B;  3N7P D;  5DGA A;  2ATL A;  2HBJ A;  4F5Q A;  3I1Y A;  3ISC A;  4DLE A;  3E2E A;  4B6J A;  4GLX A;  4E0D A;  2GLE A;  3WK5 A;  4C8M A;  2C2D A;  1ZQU A;  3J81 j;  2VIX A;  3M9O B;  3PO4 A;  1S97 A;  5AI4 A;  2EZZ A;  4QZH A;  3V7J A;  2W9B B;  2AGQ A;  2K8A A;  5J0S A;  4QWA A;  5AM0 A;  3EYZ A;  3RFA A;  2B6G A;  2G5H B;  1RXV A;  4FZM A;  4RUA A;  5KFF A;  5DQH A;  4ECX A;  4PHD A;  4M04 A;  2JH7 A;  2AH5 A;  4IR1 A;  1TAM A;  2F44 A;  1DGS A;  4M47 A;  2QB0 A;  5ALM A;  4ECW A;  2R18 A;  1MQ2 A;  1PK1 A;  3K1Z A;  3QZ8 A;  4DOB A;  2KNJ A;  3TAD C;  2LYB A;  1S0O A;  2PI5 A;  2G08 A;  1L8L A;  4CF4 A;  3LWL A;  7ICR A;  1RQN A;  2HBL A;  3S6J A;  2OCE A;  4HYK A;  4HAI A;  2Y1I A;  2MAX A;  1SL2 A;  4CRX A;  4DFJ A;  2A1A A;  2JR5 A;  1XS9 D;  4DLG A;  3Q8P B;  2H3V A;  4Z6C A;  1BPE A;  1CRX A;  5AI8 A;  4GXI A;  1XNS A;  2LHT A;  1JXE A;  5KFL A;  3RJJ A;  2G0A A;  1L3U A;  2B21 A;  5AKK A;  5DG9 A;  2W7O A;  3F2B A;  3V6J A;  5HR7 A;  4A8E A;  2PFO A;  5DDY A;  9ICS A;  1HUZ A;  3CW2 C;  3KBB A;  2HVI A;  4RQ4 A;  4EYH B;  3HKZ F;  4F8R A;  1X9S A;  5AKX A;  1ZQT A;  1RG6 A;  2BCS A;  8ICR A;  5KFB A;  4O3O A;  3I76 A;  1RDF A;  2F76 X;  4DSF A;  4NLN A;  1JAL A;  5ALN A;  5KFR A;  7ICO A;  3N97 B;  1RM6 C;  5L1M A;  2ZUD A;  5AK5 A;  5AKL A;  1A77 A;  4YCX A;  4F4X A;  4F5N A;  2DPI A;  5KFE A;  2PMZ C;  9ICU A;  3F2D A;  4EYI B;  4DQP A;  1Q46 A;  1PK1 B;  4DFP A;  4K4G A;  1UT5 A;  3G6X A;  3TAQ A;  2LM4 A;  1ARO P;  5DG8 A;  1WWU A;  3H8J A;  4UAT A;  3C2M A;  9ICE A;  4NLK A;  1NK7 A;  2F77 X;  5ALO A;  4BX9 C;  2M9N A;  2O6K A;  1F0M A;  1UPH A;  3OJU A;  5KT6 A;  3BS7 A;  2BPC A;  2WF8 A;  2JZB B;  1NJX A;  3ISB A;  5FP0 A;  4MFC A;  4F2R A;  3BS5 A;  4UB4 A;  4UAV A;  4MF8 A;  2KJ9 A;  3M1Y A;  3Q8R B;  3KKA A;  3IDW A;  2RP5 A;  4OD0 A;  4P4M A;  9ICQ A;  5AIA A;  3RB4 A;  9ICK A;  2IHN A;  3PR5 B;  1M6Y A;  2QAR B;  1LKY B;  4BUG A;  3RJI A;  1L3T A;  2MUT B;  2OEH A;  4C8N A;  3GV8 B;  3MGV A;  2AGP A;  5DB9 A;  2C2E A;  4RNN A;  4J9R A;  2AHO B;  9ICV A;  4F2S A;  5HHH A;  3PW2 A;  2DF4 B;  4P4P A;  4DL6 A;  5KFI A;  3WK4 A;  4NL9 C;  2HDO A;  1ZQR A;  4FZL A;  1KFD A;  9ICJ A;  4ED8 A;  2IBK A;  4IR9 A;  4Y2J A;  2HMX A;  1O03 A;  3OHA A;  5KG2 A;  2BDP A;  2EAO A;  1YZ6 A;  3BDP A;  3AU6 A;  4MEY A;  2W9C A;  1TKD A;  5J0P A;  2BGW A;  5ALK A;  1XO1 A;  9ICN A;  3TI0 A;  2KZ3 A;  1NK8 A;  3D2S A;  1LVH A;  2ZIU B;  1ZJM A;  1TFR A;  5EE9 A;  3QU9 A;  4GXJ A;  1SXE A;  1S8O A;  1COO A;  4OJ5 A;  1UA1 A;  3NVW A;  4C8O A;  8ICW A;  2VJ5 A;  4J9L A;  2HHX A;  1ZD4 A;  4ECV A;  1URJ A;  3PR4 A;  3RRH A;  3UMG A;  2DGZ A;  2E3T A;  4NLG A;  2ZUC A;  4F4Z A;  4KLF A;  2PKE A;  5B5E U;  2K4E A;  2QB0 B;  5G5H A;  2XY7 A;  1NZB A;  4KLU A;  4M2Y A;  2NRW A;  3C28 A;  8ICA A;  2KVC A;  1ZQC A;  3QUB A;  5J2E A;  3DV9 A;  2XVT A;  5KT4 A;  3TAP A;  4G3I A;  4Z6F A;  5B66 U;  8ICO A;  2MUT A;  1B43 A;  4MFA A;  4KLE A;  3GIM A;  4J9K A;  5DKW A;  4EEL A;  1JIH A;  1TE2 A;  2DKX A;  4US8 A;  2OM6 A;  3QU5 A;  4BDP A;  2VAN A;  4QWC A;  4C4S A;  2PXI A;  1V9P A;  2W43 A;  4C7Z A;  2ISP A;  2P35 A;  4Q43 A;  2KIW A;  1D8Y A;  3ED5 A;  3LK9 A;  2KK0 A;  2BDU A;  2JV3 A;  5ALI A;  3T5H A;  5KFW A;  3PSF A;  1DXS A;  3RJH A;  3ICX A;  3F5A A;  5KFN A;  2PFQ A;  3A0H U;  2EQY A;  1ZQD A;  4PH5 A;  4RQM A;  1KQQ A;  3H8M A;  2KIC A;  4KIT B;  3AMZ A;  5CRX A;  4ELU A;  5KFC A;  7ICT A;  3AL0 B;  2LBO A;  2BCQ A;  4O3Q A;  2AU0 A;  3CNH A;  5ALU A;  5H2F U;  4RPZ A;  3L3F X;  2Z7J A;  5KFD A;  3NVV A;  2XO7 A;  3JPQ A;  2E8N A;  2FI1 A;  4PL2 A;  2KD1 A;  4M9H A;  2YB1 A;  4RQ5 A;  5JRT A;  4C8K A;  4M6W B;  1N48 A;  5EE3 A;  3L4P A;  4Y2Q A;  3H0L B;  4M9J A;  2L5Y A;  1NK0 A;  1AQ6 A;  3UPQ A;  5KL8 B;  5CR0 A;  5KG4 A;  2HHT A;  1ZQA A;  3SI8 A;  5ALP A;  4KLQ A;  1QLN A;  4AP9 A;  4M9L A;  2IMW P;  3Q8M A;  3T5L A;  5D46 A;  4KMO B;  1JRO A;  4UB8 U;  3QNM A;  5ALV A;  4RQ1 A;  1U4B A;  1ZQH A;  2DFL A;  5AM5 A;  2DKZ A;  3C29 A;  3PW5 A;  3QYP A;  1XC9 A;  3SR6 A;  2WF7 A;  4Z6D A;  1KL9 A;  5T14 A;  4QZI A;  1KFT A;  9ICI A;  1JXL A;  5EWG A;  2VA2 A;  4BXO B;  1Q8K A;  1OW5 A;  7ICM A;  3TQ1 A;  2LKY A;  1N60 A;  5C0Y A;  2KIV A;  4UBC A;  1ZRN A;  5GTH U;  3ZD8 A;  2AGO A;  5KFU A;  4DWI A;  4ED6 A;  9ICO A;  3GZF A;  3UM9 A;  2E1F A;  2R8H A;  2F1I A;  4RQ0 A;  3TAN A;  2HBM A;  3V72 A;  2OXO A;  4ECY A;  4KLD A;  1PVP A;  1MQ3 A;  2MA1 A;  5KG7 A;  5AM2 A;  1UHU A;  3ISD A;  1MN8 A;  2XID A;  5DGB A;  1NNL A;  1TAQ A;  5D4B A;  3LDA A;  4RQ2 A;  1SWW A;  4GIB A;  3RH5 A;  1U45 A;  2AQ4 A;  4DSI A;  4PPX A;  4O5C A;  4P0P A;  7ICQ A;  2P6R A;  1UA0 A;  1FFU A;  3N28 A;  4XQ8 A;  1J97 A;  4P0Q A;  4DL2 A;  4G9B A;  4Y2U A;  1GO3 F;  4NLB A;  4O9M A;  3PST A;  2ZIU A;  3FM9 A;  4UB1 A;  4RT2 A;  4YQW A;  5AM3 A;  1BNP A;  1DOQ A;  4UAY A;  2JEG A;  4Q44 A;  4F3O A;  1T4G A;  1XSL A;  5IIJ A;  1WG8 A;  2JEJ A;  5L1K A;  4ED0 A;  1ZXI A;  2A1J A;  4QZ8 A;  5KT3 A;  3EUB 2;  5DLG A;  5J2J A;  4TUP A;  3ZDC A;  2E8O A;  1NK4 A;  1UCV A;  2JXJ A;  2ZIV A;  4PHA A;  2KJ5 A;  2Q0Z X;  5D49 A;  2ISO A;  1C20 A;  5ALJ A;  4R8U B;  7ICF A;  3BZC A;  1XWL A;  3M6K A;  1DRG A;  2VA8 A;  2NV3 A;  4OJO A;  1ZQQ A;  2H3F A;  4RZR A;  1H38 A;  3UXP A;  4I2H A;  1QQ7 A;  4NLC A;  2KG5 A;  4OJL A;  1NK9 A;  3SAH A;  5KFT A;  4TQR A;  1MC8 A;  2G5I B;  1VDV A;  3AEV A;  1T94 A;  8ICU A;  2XI9 A;  4CE6 A;  5KG5 A;  4J9O A;  1S9F A;  4OO1 J;  4JMU A;  5EWF A;  3RB6 A;  8ICP A;  2KN7 A;  4TUQ A;  2HOI A;  3E0F A;  2E1E A;  4KMU A;  2R8I A;  5JUM A;  1SIJ A;  7ICU A;  4DFM A;  1XO0 A;  2E8P A;  3SV3 A;  1T7P A;  4F4K A;  4KN4 A;  3RH4 A;  4JK1 A;  2XCA A;  5J2B A;  5GTI U;  3GV7 B;  5AKY A;  4MFF A;  1QTM A;  3SYZ A;  1SKS A;  1TK0 A;  8ICJ A;  3MC1 A;  2UVU A;  4BWM A;  4ECS A;  7ICL A;  3RBD A;  5AM4 A;  1RXW A;  3Q8S B;  3H40 A;  4ECR A;  1ZQB A;  2I1Q A;  2LYH A;  1KSP A;  3F53 A;  4PHE A;  1DGJ A;  3HWT A;  4UAS A;  3GDX A;  3NVY A;  2CN1 A;  4YXJ A;  3GIK A;  5J0Y A;  8ICF A;  2ZIV B;  3SV4 A;  4RUC A;  3RR8 A;  1NK5 A;  5AI6 A;  2K8C B;  1JI7 A;  2F8K A;  1RYS A;  3F5E A;  4QZF A;  1JN3 A;  1A6S A;  1ZQ1 C;  5ALY A;  1SV0 A;  5KL1 B;  1S77 D;  3FDS A;  1ZD5 A;  1SZH A;  1UT8 A;  4EX7 A;  3HKZ C;  3Q8L A;  1L3V A;  4K4H A;  4JV1 A;  1Q3V A;  3RF9 A;  2OWO A;  8ICZ A;  4EX6 A;  1JMS A;  4EBE A;  2MU2 A;  1V97 A;  5KT2 A;  2Y0S C;  3WU2 U;  5J2K A;  1F44 A;  4O3S A;  5ALH A;  3RJF A;  1ZQZ A;  3B0X A;  2ES6 A;  2M0N A;  1CUK A;  3ETL A;  4DFD A;  4ZOH C;  4XUS A;  5IIM A;  1ZQO A;  3JPN A;  1WYG A;  3B9J A;  5AKI A;  3UMB A;  3M9N B;  2ZIW A;  4DSK A;  2PFN A;  4KX5 A;  7ICJ A;  3KOO A;  5KFM A;  1SZP A;  3DDH A;  5AIB A;  2FDR A;  1L8O A;  3WK7 A;  5ALD A;  3UXN A;  2Y1J A;  3RJK A;  3QU4 A;  3MR5 A;  4KLT A;  1UQV A;  2ALZ A;  4B9M A;  3RJG A;  5AK6 A;  5KFA A;  4MF2 A;  1U48 A;  2EZY A;  1SL0 A;  2RLT A;  4F4W A;  2IOF A;  1XSN A;  2UVR A;  7ICE A;  4NLZ A;  3HPO A;  1NK6 A;  3FAH A;  4EBD A;  4KLS A;  1RYR A;  4KN7 A;  2LPE A;  1S0M A;  3QUT A;  2WHE A;  5KFS A;  4RQN A;  3MFI A;  4I2D A;  2IOF K;  3BQ1 A;  4DF4 A;  2ZTD A;  4KX3 A;  2A1J B;  1K5O A;  4YMN A;  1BPB A;  3KHG A;  3NS1 A;  2WTF A;  1D9D A;  5CP2 A;  2Y9T A;  4Y2V A;  1WCN A;  3IG8 A;  2UVW A;  7ICH A;  2RHF A;  2W7P A;  1N63 A;  4NV0 A;  1SWV A;  9ICB A;  4O3R A;  3H0R B;  2K60 A;  2EAP A;  3JPS A;  2FLN A;  5JU5 A;  2CPR A;  4UB3 A;  2BHN A;  3HX0 A;  3A0B U;  1Z19 A;  2JRZ A;  4FO6 A;  1YZ7 A;  1X9W A;  1SV4 A;  5III A;  4C7Y A;  2KSO B;  3D6J A;  2F1J A;  3BQ7 A;  3PW0 A;  3N7S C;  4UAR A;  1ZQE A;  2K4P A;  3LVV A;  3MR3 A;  5J0U A;  3SMV A;  5AK3 A;  3T5K A;  4Y2R A;  5EWE A;  1S0N A;  2ZTC A;  3SEI A;  2JEI A;  1MA7 A;  4RT3 A;  5ALS A;  4EEY A;  4AYB C;  1S76 D;  3MDA A;  4ED7 A;  4CDG A;  2DQN B;  3OTQ A;  2WF6 A;  2I5H A;  4I27 A;  5KFH A;  1U9L A;  2V4Q A;  9ICA A;  4OJP A;  3THV A;  1ZYQ A;  1ZJN A;  2P6U A;  3V7K A;  2GWS A;  3C23 A;  4IQU A;  4F5R A;  3IM1 A;  4NXZ A;  5ALG A;  1F5S A;  1HIW A;  3NAS A;  4F4Y A;  4YN4 A;  1D8L A;  1Q3U A;  1RQL A;  5IIK A;  5DBC A;  1IG6 A;  4QJF B;  2WB1 F;  3RB0 A;  5KFG A;  1NJZ A;  3GFK B;  4I28 A;  1ZD3 A;  4C80 A;  4ED2 A;  3T5J A;  1N5W A;  4Q8E A;  3JPO A;  1IM4 A;  4QW8 A;  4QZ9 A;  3IP4 B;  1HUO A;  3GIL A;  2R8G A;  2KJ8 A;  2BCV A;  8ICQ A;  4BJQ A;  1NOM A;  1ZQY A;  3UQ2 A;  2ESE A;  3TFS A;  2W8K A;  2KSO A;  4EBC A;  4DS4 A;  4R63 A;  5BOL A;  4FBT A;  5HP4 A;  2HHS A;  5KTQ A;  2OH2 A;  4YG2 A;  3AQF A;  4QNL A;  1Z4O A;  3OGU A;  2W9A A;  3EWA A;  1NI3 A;  1L5U A;  2W9B A;  1RZT A;  3PW4 A;  4RQ7 A;  3PW7 A;  1QSS A;  4RQ8 A;  4CNQ A;  4QZD A;  4M0A A;  4NL9 A;  9ICL A;  4EEK A;  1Z1V A;  4QIW C;  4Y2P A;  4CGZ A;  3AN1 A;  5J0X A;  5J0R A;  1ZQI A;  5HMM A;  4ECU A;  5J8Y C;  3GQC A;  2KMD A;  2ZXH A;  5DDM A;  5KFO A;  4B9V A;  1RPL A;  7ICK A;  5KNI A;  4O3N A;  1QQ6 A;  2LI6 A;  3QEB Z;  4C8L A;  4J9P A;  2C22 A;  4TUR A;  5KAI U;  2E8M A;  3C1Z A;  4TUS A;  4FE3 A;  4F91 B;  4FBU A;  4KLH A;  4KTQ A;  2KTQ A;  5HHI A;  3VC8 A;  1BPY A;  1ZQF A;  5J2G A;  1Y88 A;  3O0F A;  4R65 A;  4I2I A;  4QZC A;  3SAF A;  2W3R A;  2PMZ F;  4CF3 A;  5AHX A;  3OSN A;  2XGQ A;  4PHP A;  3Q8Q B;  1PUZ A;  5AI0 A;  3HP6 A;  1TAU A;  4C4T A;  3IN5 A;  5TIS U;  2AXT U;  3QU7 A;  3PV8 A;  5ALZ A;  2ZXI A;  2B0C A;  3M8R A;  1X6I A;  3SZ2 A;  3T79 A;  2A3V A;  9ICF A;  4YXM A;  3AU2 A;  2P66 A;  5ALQ A;  4YVZ A;  4LVS A;  5AK4 A;  5KG3 A;  4O0I A;  1X9X A;  4RQ6 A;  3C2L A;  8ICM A;  3K1R B;  1NJY A;  4IC9 A;  1PK3 A;  4R64 A;  1QSY A;  2HCF A;  2WF9 A;  2YMP A;  1CEZ A;  1TK8 A;  3H0M B;  3PX0 A;  1X66 A;  2EH9 A;  3I28 A;  2DPJ A;  1TK5 A;  1ZQG A;  4TQS A;  2OYY A;  4X5V A;  3NVZ A;  9ICH A;  2I9G A;  4NY8 A;  3M6Z A;  3K4G A;  4Q8F A;  4QZE A;  5HR6 A;  2HHU A;  2W8L A;  1QH9 A;  3H7I A;  3LVW A;  4DCC A;  3FC4 A;  3TAD A;  4RU9 A;  2HI0 A;  4FZN A;  1B4F A;  2F2A B;  4P0P B;  2K4H A;  2JH1 A;  2JZB A;  1BVS A;  3IHQ B;  4RNM A;  4UQG A;  1X42 A;  3BJY A;  3SD7 A;  4PZN A;  4QZG A;  3B0Y A;  3T3F A;  3QXG A;  4KLI A;  2XY6 A;  2JGA A;  4GFJ A;  5DG7 A;  4J9M A;  2BZF A;  4UW9 A;  3MFH A;  3F2C A;  2W03 A;  3QE9 Y;  4YR2 A;  3HT3 A;  3CP8 A;  2E5S A;  2HSZ A;  1U49 A;  2G09 A;  3ONN A;  2D8C A;  1N5X A;  3PY8 A;  4C0Z A;  5J2A A;  2KZM A;  3PMN A;  2K8B B;  3FYH A;  2V4R A;  4DSE A;  2QAR A;  1Z4N A;  1OXJ A;  1FO4 A;  1SXD A;  4Q45 A;  4R8U A;  1IXR A;  2F8L A;  3WK9 A;  3TFR A;  2G06 A;  3WKC A;  3SEN A;  5CJ7 A;  9ICW A;  8ICH A;  1PZN A;  5ALX A;  1KFS A;  5KG0 A;  2WF5 A;  4YP3 A;  3NTU A;  2Q4T A;  3H4D A;  4DQI A;  3PSI A;  1KEJ A;  8ICV A;  3PVX A;  3NRW A;  4F71 A;  3OSP A;  3WKE A;  5J2D A;  2ZUB A;  4I2F A;  4Y2T A;  4J03 A;  1B0X A;  3EW9 A;  4NWI A;  4XA5 A;  7ICV A;  1N56 A;  7ICP A;  4DL3 A;  4IQW A;  4RNO A;  4JV2 A;  4I2J A;  4C4R A;  9ICX A;  2W9C B;  4CCH A;  2OHF A;  3RR7 A;  3UQ0 A;  3WKD A;  1T3N A;  1SB3 C;  1NJW A;  2UVV A;  5ALW A;  2KZZ A;  1YT3 A;  5F9L A;  4PGY A;  3KD3 A;  8ICE A;  3E58 A;  4PL1 A;  5J2H A;  3C5G A;  9ICP A;  5J8Y A;  1KW4 A;  3ORY A;  2KP7 A;  4QWB A;  1D9F A;  4I2C A;  1BPX A;  4ED3 A;  8ICK A;  5F9N A;  2MSN A;  1S10 A;  1IIP A;  2IHM A;  1BPD A;  4R66 A;  4JV0 A;  1B22 A;  3TKA A;  3JPT A;  2FMP A;  4U7C A;  5EE1 A;  3V6H A;  5ALL A;  3QX7 A;  2XIC A;  4QIW F;  3M8S A;  2NRX A;  2ZJ8 A;  3V7L A;  2AQ0 A;  2VA3 A;  1JX4 A;  4UB6 U;  5KG1 A;  1D8B A;  3RRG A;  4KLO A;  4LJX A;  4ICA A;  1SV0 C;  1ZQV A;  4ED1 A;  4F72 A;  4K4I A;  5KFZ A;  2HOQ A;  3NGD A;  2XY5 A;  5BPC A;  4JB3 A;  4EZ9 A;  2ZJ5 A;  2XGP A;  1A76 A;  3R9K A;  4UAW A;  4UB5 A;  4P2H A;  2K89 A;  1A0P A;  2BQU A;  4Y2S A;  3EPI A;  1T8E A;  8ICL A;  3C2K A;  3BQ2 A;  8ICI A;  1KN5 A;  4O3M A;  4LZD A;  3MGI A;  4IQT A;  1X40 A;  5F3X B;  4MEX A;  2W54 A;  5J0W A;  4DOC A;  1ZQK A;  1JRP A;  3LWM A;  2BPG A;  3KZI U;  1U47 A;  3PX4 A;  5L9X A;  4DO9 A;  9ICM A;  9ICT A;  2NO4 A;  2LMR A;  2FLL A;  3PML A;  3NRZ A;  3PZP A;  2BCR A;  7ICG A;  3C5F A;  4P4O A;  3OJS A;  2BPF A;  3IRU A;  2FPL A;  5A0L A;  2PI4 A;  4WJ3 B;  4M6W A;  9ICR A;  4F50 A;  1ED1 A;  3KTQ A;  5KAF U;  4CF5 A;  2ASL A;  4DL4 A;  3BZK A;  3KZX A;  4GC7 A;  5L1I A;  4Z6E A;  1ECW A;  1V38 A;  2JHD A;  3K75 D;  2RRD A;  5AKZ A;  3GII A;  3PX6 A;  2RDI A;  2BCU A;  2JEF A;  1X9M A;  3G6V A;  2W55 A;  2NRZ A;  5AI5 A;  4YD1 A;  4QWD A;  3ZDD A;  5AM1 A;  5IIO A;  5ALR A;  3ZD9 A;  3ZI4 A;  4DL5 A;  1ZQL A;  3QZ7 A;  2DUY A;  1HEK A;  5CWR A;  4YR3 A;  9ICC A;  2EDU A;  5KFX A;  4KLL A;  1LV5 A;  2LM1 A;  1LB2 B;  4F92 B;  3C21 A;  2ZIX B;  4BXO A;  1MSW D;  2ZTE A;  3IG5 A;  1L6N A;  5CEH A; 
#chains in the Genus database with same CATH homology
 1RZT A;  2F1I A;  4RQ0 A;  3E2E A;  5KG6 A;  4GLX A;  3PW4 A;  3TAN A;  4E0D A;  3V72 A;  1QSL A;  4RQ7 A;  3PW7 A;  4C8M A;  2C2D A;  1WCL A;  1QSS A;  4ECY A;  5DBA A;  1ZQU A;  4KLD A;  4RQ8 A;  1MQ3 A;  4QZD A;  4M0A A;  3M9O B;  3PO4 A;  5KG7 A;  1S97 A;  4FS1 A;  4QZH A;  3V7J A;  5DLF A;  2W9B B;  3ISD A;  2AGQ A;  5J0S A;  4QWA A;  9ICL A;  5CA7 A;  2HW3 A;  3KHH A;  5DGB A;  3EYZ A;  1TAQ A;  1KDH A;  4RQ2 A;  3LDA A;  1BGX T;  5D4B A;  3RH5 A;  1U45 A;  1RXV A;  9ICG A;  2AQ4 A;  4DSI A;  4PPX A;  5J0X A;  4O5C A;  4RUA A;  5J0R A;  7ICQ A;  5KFF A;  1ZQI A;  2P6R A;  1UA0 A;  5DQH A;  5HMM A;  4XQ8 A;  4PHD A;  4ECU A;  4ECX A;  5IIL A;  4M04 A;  4DL2 A;  1EXN A;  3GQC A;  1C7Y A;  1Z3E B;  4DL7 A;  4IR1 A;  5DDM A;  5KFO A;  4B9V A;  1RPL A;  1DGS A;  7ICK A;  5DQG A;  4M47 A;  4O9M A;  4ECW A;  4O3N A;  1MQ2 A;  4UB1 A;  4RT2 A;  4YQW A;  3QZ8 A;  4DOB A;  1DOQ A;  4RQ3 A;  1S0O A;  2PI5 A;  7ICI A;  4UAY A;  4I2A A;  3QEB Z;  4C8L A;  4J9P A;  2C22 A;  2JEG A;  4TUR A;  3LWL A;  1TVA A;  4Q44 A;  5J0Q A;  3C1Z A;  4F3O A;  7ICR A;  1T4G A;  4I2E A;  4HYK A;  4TUS A;  5IIJ A;  1XSL A;  4F91 B;  4FBU A;  2JEJ A;  3MDC A;  2Y1I A;  2MAX A;  5L1K A;  4ED0 A;  1NKC A;  1SL2 A;  1ZQJ A;  4KTQ A;  2A1J A;  4KLH A;  4DFJ A;  5HHI A;  2KTQ A;  2HHW A;  5J2F A;  1XS9 D;  4DLG A;  4QZ8 A;  1BPY A;  1ZQF A;  5J2G A;  3Q8P B;  1Y88 A;  4Z6C A;  1BPE A;  4R65 A;  4I2I A;  5KT3 A;  3TAR A;  5DLG A;  5J2J A;  4TUP A;  3Q8K A;  2FMQ A;  3ZDC A;  4QZC A;  4GXI A;  4DQR A;  1NK4 A;  1JXE A;  3OSN A;  5KFL A;  3RJJ A;  4PHA A;  2XGQ A;  4PHP A;  1XSP A;  4QW9 A;  3H8W A;  2Q0Z X;  3Q8Q B;  2B21 A;  3KHR A;  5IIN A;  1L3U A;  3HP6 A;  5D49 A;  1D9D A;  2ISO A;  1TAU A;  5HML A;  2BQR A;  2KFN A;  4R8U B;  3PV8 A;  7ICF A;  1XWL A;  5DG9 A;  1KRP A;  3V6J A;  2VA8 A;  3M8R A;  3SZ2 A;  1ZQQ A;  3EZ5 A;  2HHQ A;  4RZR A;  9ICF A;  1H38 A;  3UXP A;  2PFO A;  4I2H A;  4YXM A;  3AU2 A;  2P66 A;  2FLP A;  4UAZ A;  1TV9 A;  4YVZ A;  5DDY A;  5J0O A;  1NK9 A;  1HUZ A;  2J6U A;  2PFP A;  2HVI A;  5KFT A;  4LVS A;  4RQ4 A;  4TQR A;  5KG3 A;  4O0I A;  4EYH B;  4F8R A;  1X9S A;  4RQ6 A;  3C2L A;  8ICM A;  1MC8 A;  3MAB A;  1NJY A;  1ZQT A;  2BCS A;  4ECQ A;  4F5P A;  8ICR A;  2ASD A;  1X2I A;  8ICU A;  5KFB A;  4O3O A;  4R64 A;  5DB7 A;  1QSY A;  7ICN A;  1ZQS A;  4DSF A;  1CEZ A;  4NLN A;  1Z00 A;  1TK8 A;  3RAX A;  5KG5 A;  3PX0 A;  2J6S A;  4J9O A;  1S9F A;  5KFR A;  4BGD A;  3PO5 A;  7ICO A;  7ICS A;  3N97 B;  5EWF A;  3RB6 A;  8ICP A;  4O5K A;  8ICG A;  2KN7 A;  2DPJ A;  4TUQ A;  1TK5 A;  1ZQG A;  4TQS A;  2J6T A;  2ZUD A;  3C1Y A;  4KMU A;  2R8I A;  4X5V A;  5JUM A;  5DB6 A;  7ICU A;  9ICH A;  2I9G A;  1A77 A;  4NY8 A;  4DFM A;  4YCX A;  4F4X A;  4JUZ A;  4F5N A;  2DPI A;  3K4G A;  5KFE A;  4Q8F A;  2XCP A;  4QZE A;  3SV3 A;  1T7P A;  5TZV A;  4F4K A;  9ICU A;  4KN4 A;  3RH4 A;  4EYI B;  4JK1 A;  4DQP A;  2XCA A;  2HHU A;  5J2B A;  3GV7 B;  4MFF A;  2AJQ A;  4DFP A;  4K4G A;  3RB3 A;  2W8L A;  5L1J A;  1UT5 A;  1QTM A;  3SYZ A;  1SKS A;  1TK0 A;  1KTQ A;  3H7I A;  3G6X A;  3TAQ A;  1ARO P;  8ICJ A;  5DG8 A;  3H8J A;  1S0V A;  2UVU A;  4RU9 A;  4BWM A;  4YMO A;  3C2M A;  1ZQX A;  4DSJ A;  4ECS A;  9ICE A;  4NLK A;  7ICL A;  3RBD A;  1NK7 A;  1RXW A;  2JZB A;  1BVS A;  3Q8S B;  3H40 A;  4ECR A;  3IHQ B;  1ZQB A;  2I1Q A;  2M9N A;  2LYH A;  4RNM A;  4UQG A;  4BWJ A;  1KSP A;  3OJU A;  3BJY A;  4PHE A;  5KT6 A;  5BOM A;  3JPR A;  3HWT A;  2BPC A;  4UBB A;  4QZG A;  3GDX A;  4M9G A;  2H5X A;  5KT5 A;  1NKB A;  4LZG A;  8ICX A;  3B0Y A;  3T3F A;  4YXJ A;  4KLI A;  2XY6 A;  5J2C A;  3GIK A;  2JZB B;  5DG7 A;  5J0Y A;  1NJX A;  4J9M A;  8ICF A;  3ISB A;  4MFC A;  4F2R A;  4I29 A;  3MFH A;  3SV4 A;  4UB4 A;  5KFY A;  4MF8 A;  3QE9 Y;  4RUC A;  4YR2 A;  1SKW A;  3RR8 A;  1NK5 A;  3HT3 A;  3Q8R B;  4P4M A;  9ICQ A;  8ICS A;  1U49 A;  1RYS A;  3RB4 A;  4QZF A;  9ICK A;  2IHN A;  2R8K A;  4ELT A;  4PGQ A;  3PR5 B;  1JN3 A;  3AUO A;  3RJI A;  4UB2 A;  1XU4 A;  4KLM A;  3PY8 A;  5KFV A;  5HNK A;  1L3T A;  2MUT B;  1S77 D;  5J2A A;  2KZM A;  4J9S A;  4C8N A;  3H8S A;  3GV8 B;  3PMN A;  4B9L A;  3FDS A;  3ZDB A;  3FYH A;  2V4R A;  2AGP A;  5DB9 A;  2C2E A;  1K1S A;  1UT8 A;  4DSE A;  4RNN A;  2RDJ A;  4J9R A;  2C28 A;  3Q8L A;  1L3V A;  4K4H A;  4Q45 A;  4R8U A;  4JV1 A;  1IXR A;  3H4B A;  1NKE A;  3TFR A;  4F2S A;  9ICV A;  5HHH A;  2BR0 A;  5KT7 A;  2OWO A;  3MR2 A;  5CJ7 A;  8ICZ A;  9ICW A;  1JMS A;  4EBE A;  8ICB A;  8ICH A;  3PW2 A;  4B9N A;  5KT2 A;  4P4P A;  4F93 B;  4DL6 A;  4EZ6 A;  1PZN A;  5KFI A;  1ZQR A;  1KFS A;  5KG0 A;  4YP3 A;  1KFD A;  3NTU A;  5J2K A;  9ICJ A;  4RPY A;  4O3S A;  3H4D A;  2BQ3 A;  4ED8 A;  3RJF A;  1ZQZ A;  2IBK A;  3B0X A;  4DQI A;  4IR9 A;  1KEJ A;  4IQV A;  1CUK A;  8ICV A;  3OHA A;  3PVX A;  5KG2 A;  2FPM A;  3ETL A;  4XUS A;  5J2D A;  3OSP A;  2BDP A;  5IIM A;  2ZUB A;  3HW8 A;  3AU6 A;  1ZQO A;  3BDP A;  4XA5 A;  3EW9 A;  3JPN A;  4I2F A;  4MEY A;  7ICV A;  2W9C A;  3RBE A;  1TKD A;  5J0P A;  4FS2 A;  3M9N B;  2BGW A;  1SL1 A;  4DF8 A;  1N56 A;  1XO1 A;  4DSK A;  9ICN A;  7ICP A;  2PFN A;  4DL3 A;  2KZ3 A;  4J9N A;  3TI0 A;  1NK8 A;  4IQW A;  4O5E A;  7ICJ A;  5KFM A;  4RNO A;  1SZP A;  4DOA A;  3KHL A;  4JV2 A;  4XRH A;  4I2J A;  1L3S A;  5J2I A;  1ZJM A;  9ICX A;  1TFR A;  2HHX A;  2W9C B;  8ICC A;  4B9S A;  3UXN A;  2Y1J A;  3MBY A;  4CCH A;  4GXJ A;  3QEA Z;  3RJK A;  3GIJ A;  4DS5 A;  1COO A;  1UA1 A;  5DQI A;  3RR7 A;  3MR5 A;  4KLT A;  4C8O A;  8ICW A;  3OHB A;  5CB1 A;  3UQ0 A;  4J9L A;  2XC9 A;  2ALZ A;  1ZET A;  4ECV A;  1T3N A;  1NJW A;  1BPZ A;  2UVV A;  4B9M A;  3RJG A;  2FPK A;  5KFA A;  2KZZ A;  3PR4 A;  4MF2 A;  1U48 A;  3RRH A;  1SL0 A;  4ECT A;  4GC6 A;  4NLG A;  2ASJ A;  4QZB A;  2ZUC A;  4DQQ A;  3GV5 B;  4F4W A;  4F4Z A;  4DFK A;  9ICS A;  1XSN A;  3BQT A;  4KLF A;  2UVR A;  5F9L A;  7ICE A;  4PGY A;  4YFK A;  8ICE A;  4M9N A;  5J2H A;  4NLZ A;  3HPO A;  3C5G A;  1NK6 A;  4EBD A;  9ICP A;  4KLS A;  3ORY A;  4ELV A;  2XY7 A;  1RYR A;  4QWB A;  4KN7 A;  1D9F A;  4I2C A;  1BPX A;  4KLU A;  4M2Y A;  4ED3 A;  2NRW A;  3ZDE A;  1S0M A;  8ICK A;  5F9N A;  8ICA A;  1S10 A;  5KFS A;  1ZQC A;  5J2E A;  3MFI A;  4YD2 A;  4I2D A;  1BPD A;  4R66 A;  2IHM A;  3RAQ A;  4JV0 A;  1B22 A;  2F1H A;  4I2B A;  4QWE A;  3BQ1 A;  4DF4 A;  5KT4 A;  3TAP A;  4G3I A;  4Z6F A;  4NM2 A;  2ZTD A;  3JPT A;  2A1J B;  2MUT A;  4YMN A;  2FMP A;  1B43 A;  4MFA A;  4B9T A;  8ICO A;  3V6H A;  1BPB A;  2R8J A;  4KLE A;  3KHG A;  3MGH A;  2WTF A;  3GIM A;  5DKW A;  4J9K A;  2BKE A;  5J29 A;  5CP2 A;  5EOZ A;  3M8S A;  2NRX A;  1WCN A;  2ZJ8 A;  3V7L A;  2AQ0 A;  3RH6 A;  1JIH A;  4JWM A;  2UVW A;  4IRD A;  2VA3 A;  1JX4 A;  7ICH A;  2W9M A;  4ECZ A;  4GXK A;  3BQ0 A;  4BDP A;  5KG1 A;  1K1Q A;  3RJE A;  1ZQM A;  2VAN A;  4QWC A;  3RRG A;  4KLO A;  2PXI A;  1V9P A;  9ICB A;  2ISP A;  1ZQV A;  4O3R A;  2W9B A;  4ED1 A;  4Q43 A;  3JPS A;  4DSL A;  1D8Y A;  2FLN A;  4K4I A;  2KFZ A;  4UB3 A;  3LK9 A;  4IRK A;  2HHV A;  2BHN A;  5KFZ A;  3T5H A;  2V9W A;  3HX0 A;  2XY5 A;  3NGD A;  5KFW A;  4NM1 A;  5BPC A;  4EZ9 A;  2ZJ5 A;  4FO6 A;  2XGP A;  3RJH A;  1A76 A;  5L1L A;  1X9W A;  5KFN A;  4JWN A;  5III A;  5KFJ A;  2PFQ A;  8ICN A;  4UAW A;  1ZQD A;  4PH5 A;  2F1J A;  4UB5 A;  4B9U A;  4QZA A;  3PW0 A;  4P2H A;  2BQU A;  3EPI A;  1T8E A;  8ICL A;  3C2K A;  8ICY A;  3BQ2 A;  4KIT B;  1ZQE A;  8ICI A;  4O3P A;  3MR3 A;  5J0U A;  4ELU A;  3N4M B;  1Z00 B;  3RTV A;  2IA6 A;  5KFC A;  4LZD A;  7ICT A;  3MGI A;  3T5K A;  2BCQ A;  4IQT A;  5EWE A;  1S0N A;  4O3Q A;  2ZTC A;  4YMM A;  2JEI A;  3PNC A;  4RT3 A;  2AU0 A;  5J0T A;  4RPZ A;  4MEX A;  5J0W A;  4EEY A;  1SKR A;  4DOC A;  1S76 D;  1ZQK A;  2BPG A;  3LWM A;  5KFD A;  3MDA A;  4ED7 A;  1U47 A;  3PX4 A;  5KFP A;  2XO7 A;  5L9X A;  3JPQ A;  4M9H A;  4DO9 A;  9ICM A;  9ICT A;  4RQ5 A;  4C8K A;  4I27 A;  2FLL A;  2HVH A;  5KFH A;  1U9L A;  4M6W B;  3PML A;  1N48 A;  2NRV A;  2BCR A;  8ICT A;  7ICG A;  3C5F A;  4P4O A;  2V4Q A;  9ICA A;  1ZQW A;  3OJS A;  4M9J A;  2C2R A;  1NK0 A;  2BPF A;  3M9M B;  3UXO A;  3EPG A;  3UPQ A;  3THV A;  1ZQP A;  1ZYQ A;  3MR6 A;  4RPX A;  5CR0 A;  5KG4 A;  2P6U A;  2FPL A;  1ZJN A;  2HHT A;  1ZQA A;  3SI8 A;  2PI4 A;  1HJP A;  3V7K A;  4M6W A;  2GWS A;  9ICR A;  4F50 A;  3C23 A;  4IQU A;  4IRC A;  3KTQ A;  4F5R A;  3IM1 A;  4KLQ A;  4NXZ A;  1QLN A;  4YR0 A;  2ASL A;  4DL4 A;  4M9L A;  4GC7 A;  2IMW P;  5L1I A;  4Z6E A;  4F4Y A;  3Q8M A;  4YN4 A;  1D8L A;  3T5L A;  4I2G A;  4KLJ A;  5IIK A;  5D46 A;  5DBC A;  3K75 D;  3GII A;  3RB0 A;  5C5J A;  3PX6 A;  3V6K A;  2RDI A;  2BCU A;  4RQ1 A;  5CHG A;  1U4B A;  1ZQH A;  2DFL A;  1X9M A;  2JEF A;  4DQS A;  3G6V A;  2NRZ A;  5KFG A;  4YD1 A;  1NJZ A;  4QWD A;  2ZJA A;  3ZDD A;  3GFK B;  3PW5 A;  4I28 A;  3JPP A;  1XC9 A;  4ED2 A;  3T5J A;  5IIO A;  4ZH4 A;  4Z6D A;  3G6Y A;  4KLG A;  4Q8E A;  3JPO A;  3ZD9 A;  4F5O A;  1IM4 A;  4QW8 A;  5DBB A;  4QZ9 A;  4QZI A;  3QZ7 A;  4DL5 A;  1HUO A;  3GIL A;  1ZQL A;  1KLN A;  2R8G A;  1KFT A;  9ICI A;  5CWR A;  2BCV A;  4DEZ A;  4YR3 A;  8ICQ A;  3ZDA A;  1JXL A;  5KFQ A;  5EWG A;  2VA2 A;  9ICC A;  4BXO B;  1NOM A;  1ZQY A;  4J9Q A;  5KFX A;  7ICM A;  3UQ2 A;  5KFK A;  4PGX A;  3TQ1 A;  4KLL A;  3TFS A;  2W8K A;  4EBC A;  4DS4 A;  4R63 A;  5BOL A;  1LV5 A;  1ZQN A;  2FMS A;  1LB2 B;  4FBT A;  4F92 B;  5HP4 A;  3C21 A;  2HHS A;  2NRT A;  5KTQ A;  5DB8 A;  4BXO A;  4UBC A;  4YG2 A;  1MSW D;  5DGA A;  3ZD8 A;  3OGU A;  2AGO A;  2ZTE A;  5KFU A;  4DWI A;  2W9A A;  4ED6 A;  3EWA A;  2ATL A;  9ICO A;  1L5U A;  4F5Q A;  3ISC A;  4DLE A;  2R8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...