1COOA

The cooh-terminal domain of rna polymerase alpha subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the activator contact domain of the RNA polymerase alpha subunit.
pubmed rcsb
source organism Escherichia coli
molecule tags Nucleotidyl transferase
molecule keywords RNA POLYMERASE ALPHA SUBUNIT
total genus 10
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 1995-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1cooA00
5KFXA 2ZJ5A 5DG9A 3OSPA 5KG6A 2XY5A 2BGWA 3JPRA 1NKCA 4IQUA 3MGHA 1V9PA 4GXJA 8ICCA 3V6HA 5DQGA 3C1YA 7ICOA 4FS2A 4J9LA 2R8KA 4CCHA 1K1SA 5J0PA 3C2KA 3V72A 3M8RA 5J2FA 4MF8A 2KN7A 2ZUDA 2ISOA 1C7YA 3JPPA 2R8JA 4RUCA 4M04A 1ZQGA 4EYIB 4QW9A 1RYRA 4Q8FA 4J9NA 3TANA 3Q8RB 1BVSA 2W9BB 4I2AA 7ICUA 3GIIA 5KFZA 3LWMA 4F5OA 4I2HA 3PW7A 8ICTA 1XWLA 1UA0A 1U48A 3B0XA 4IQVA 1CUKA 4QZDA 5CR0A 1ZQTA 3MFIA 2KZMA 4IRDA 4DQSA 2A1JB 2UVVA 1NK8A 7ICJA 4ED7A 3PMLA 1MQ2A 4O9MA 4UAYA 3GV8B 3IM1A 1NOMA 3PW2A 2BPFA 3OSNA 4QZ8A 3RB0A 4ED6A 2BCUA 3MDCA 2IBKA 3V7JA 1L3UA 5KT6A 4GXKA 4GLXA 3PO4A 2H5XA 5KFHA 1DGSA 5F9LA 4YXMA 4UBBA 4R8UB 3V6KA 4F50A 2PI4A 1HJPA 1UA1A 5J0YA 3ZD9A 4KN4A 1KTQA 5KG5A 2IMWP 2B21A 3RJFA 1BPDA 2JZBB 1S77D 1ZQEA 2HW3A 4UB2A 4O5EA 5KFOA 4NLNA 2XCPA 3RJJA 5IIJA 2J6UA 3RJHA 4M6WA 1BPZA 4B9VA 4ECYA 3BQ2A 3PX6A 4IQTA 4P4MA 1N48A 2C28A 4KLIA 3BJYA 3RB6A 3JPOA 1S0NA 9ICJA 3RJIA 3GIKA 4M9GA 9ICFA 3IHQB 2NRTA 5KFMA 2UVRA 4KLOA 3PX4A 3PR4A 8ICLA 4RT2A 5KFFA 4DS5A 8ICBA 1S97A 5KG4A 4RNNA 4GC6A 2UVUA 2HHTA 3EYZA 4TUQA 4I2GA 3UQ2A 2BDPA 4B9TA 2DPJA 3OHBA 2V9WA 2IA6A 3GFKB 1Z3EB 5DBAA 2BCQA 4RQ3A 4Q44A 4O3PA 4RUAA 4QW8A 4C8LA 3JPTA 4DQIA 1NKBA 4KN7A 1ZQQA 3AUOA 2KFNA 2WTFA 1SKRA 1ZQRA 5CHGA 8ICSA 3HW8A 3SV4A 4YCXA 5KFIA 1WCLA 4TQSA 4MEXA 1QLNA 2FPMA 3LK9A 3KHLA 5J0RA 2NRVA 2F1IA 4ZH4A 3JPQA 3V7LA 4RQ4A 4R8UA 4PHDA 4ED1A 1S0OA 2P66A 2XC9A 2HVIA 2VA8A 3GDXA 4DFMA 2HHUA 9ICQA 3AU2A 3NTUA 3PW5A 3PO5A 3M9NB 3G6VA 2PXIA 4YMMA 5J2KA 9ICPA 4RNOA 5KG7A 2LYHA 1Z00B 2ALZA 2F1HA 2NRWA 2W9CA 1BPBA 3ZDBA 4DWIA 5J29A 4P4OA 3H4DA 4DEZA 1KFTA 4RQ7A 4BGDA 2NRXA 4F5QA 2VANA 3BDPA 2C2RA 5KG3A 3T3FA 4ELTA 8ICFA 4YXJA 7ICEA 9ICOA 4BWMA 1ZQBA 4PGYA 1IXRA 5KFWA 4I2BA 4ECTA 3MR2A 2GWSA 4KMUA 3GIMA 4QWBA 8ICHA 4RQ8A 1NKEA 2DFLA 3ISBA 3RH4A 3RJGA 2HHVA 4ELUA 2ZJAA 1DOQA 3ISCA 1ZQSA 2HHXA 4KLJA 5TZVA 3BQTA 1BGXT 1KDHA 4C8NA 2JEIA 4KLEA 4EZ6A 2IHNA 4EZ9A 4ECWA 5J2GA 1QSSA 3SZ2A 4DS4A 5DLGA 4RT3A 2V4RA 4M2YA 4KLHA 9ICGA 1NJWA 4NXZA 1JXEA 9ICXA 1NJXA 4FBUA 3ISDA 2PFOA 1ZQWA 5DGBA 5KFJA 4FO6A 7ICMA 3C21A 3MBYA 4B9MA 4I2EA 4UB1A 3GV5B 4RQ5A 2BQUA 4O5CA 4DLEA 2DPIA 4F5RA 4QZBA 4C8OA 3RH6A 3M9MB 5J0OA 1ZYQA 4M0AA 8ICXA 3Q8SB 4P4PA 1KLNA 4DSKA 4O5KA 3T5HA 4LZGA 1ZJNA 4YR3A 1LV5A 2MUTB 7ICPA 3GILA 4EBEA 1MC8A 5DB7A 2BHNA 5IIIA 2AGOA 3UQ0A 1QSYA 1BPXA 4ECUA 9ICEA 2AQ0A 5D4BA 4JUZA 1ZQFA 8ICUA 5J2DA 3EPIA 4KLMA 5C5JA 5J0UA 4LVSA 3G6YA 4ECXA 3HPOA 3MR3A 8ICEA 4DFKA 2XY7A 4O3QA 3EW9A 4F4WA 4NM1A 4RPZA 1ZQVA 4DQRA 1KRPA 1KEJA 3HT3A 5DGAA 3BQ0A 3Q8LA 2FLPA 4FBTA 4Z6DA 2NRZA 2ATLA 2AGPA 4YP3A 8ICAA 4R66A 9ICAA 4DSJA 1U4BA 4UB5A 2KZZA 1ZQUA 4YQWA 5L9XA 2XO7A 3QE9Y 5EWGA 2ASJA 2HVHA 9ICSA 9ICHA 1UT5A 1D8YA 4IR1A 9ICTA 3EWAA 1NK4A 5KT4A 5J2HA 1XC9A 3RRHA 4DL2A 8ICKA 4F4XA 1JN3A 5J0TA 4UBCA 4R63A 3SYZA 1UT8A 5KT7A 3QZ7A 2XGQA 4YN4A 1SL0A 4G3IA 2PFPA 4RQ2A 1SL1A 9ICVA 4J9SA 1U47A 2R8GA 4BXOB 4DO9A 5KFPA 4UQGA 3TAPA 2BPCA 5KFAA 5CP2A 4KLSA 9ICCA 4P2HA 4K4GA 5KFNA 2JEJA 2ASLA 4DL7A 4O3NA 7ICQA 4PH5A 5KFKA 1BPYA 3H8WA 1TVAA 3MFHA 1Y88A 1SKSA 4I28A 3SV3A 5KFTA 2M9NA 1WCNA 5DDYA 4KLFA 1X2IA 2BQ3A 4XQ8A 1L5UA 5EWFA 4QZGA 3RB3A 5IINA 8ICWA 2PFQA 3M9OB 3OGUA 1K1QA 5BOLA 1D8LA 5KFRA 2RDJA 4ECZA 4DSLA 7ICVA 1S0MA 7ICLA 1SL2A 1ZQAA 4MEYA 3RBDA 2BQRA 5J2IA 4TQRA 4DL6A 4F8RA 3TI0A 4DQPA 3MDAA 4ELVA 5J2CA 3RB4A 3QZ8A 3BQ1A 4EBDA 3C2LA 4DF8A 2W8KA 5CA7A 1TK0A 4I2IA 5D46A 5CJ7A 4PGXA 1JX4A 2W8LA 4F5NA 4DOCA 2JEGA 5HHHA 5DQIA 2Q0ZX 1T7PA 4MFCA 1XU4A 7ICIA 1U9LA 1NK7A 4YR0A 2KTQA 1X9MA 1NJZA 4R64A 4I27A 1U45A 5KT5A 4YFKA 1RXVA 4QZ9A 4PHPA 3MABA 4IR9A 4QZIA 2W9MA 5KFVA 5DBBA 4DF4A 9ICMA 4DQQA 3HWTA 3RH5A 1XO1A 1NJYA 9ICRA 1NK5A 2FMQA 4IRCA 2A1JA 1ZQNA 1ZQCA 5KFGA 3FYHA 3SI8A 2I1QA 4F2RA 5KFDA 5DB9A 4J9MA 1A77A 4QWDA 4RPXA 1Z00A 5KT2A 3H7IA 1IM4A 4LZDA 3C5FA 4J9OA 1T3NA 4JWMA 2ZUBA 3JPSA 5DQHA 4J9RA 1HUZA 4M9LA 2UVWA 8ICNA 5HNKA 3UXOA 1KFDA 1MQ3A 4J9QA 4NY8A 2Y1JA 3T5LA 1JIHA 4RNMA 3C5GA 2AGQA 5KFCA 5KFYA 5CWRA 3K4GA 1JXLA 4DOAA 2HHQA 4KLUA 7ICNA 2P6UA 3GV7B 2FMSA 4Q45A 4YD2A 2F1JA 3ZDCA 3JPNA 3PW0A 1ZQYA 3RJKA 5DKWA 5IIMA 5KG2A 3KHHA 2I9GA 2J6SA 4Q8EA 1ZETA 5HMMA 3AU6A 1AROP 5J2AA 1ZQXA 4RQ1A 2BR0A 1ZQDA 2VA3A 3RJEA 3V7KA 1TK8A 4DL4A 4KLDA 2BPGA 3OJUA 5J0XA 1JMSA 3RTVA 4JWNA 4I2JA 5D49A 5J0WA 4O3RA 5F9NA 2W9CB 4ECRA 4DFPA 3NGDA 4DSEA 4F3OA 4XA5A 5J0SA 4RPYA 2MAXA 7ICGA 5KG1A 4M9NA 3TQ1A 8ICVA 1L3VA 4HYKA 4JV0A 3ZD8A 5KTQA 9ICUA 2AJQA 1BPEA 3GQCA 2OWOA 4NLGA 1TAUA 4ED2A 3LWLA 3RRGA 3FDSA 5IIOA 5KFBA 1EXNA 4BWJA 2V4QA 3TAQA 1NK9A 1ZQHA 2FPKA 5L1IA 5IILA 4JV1A 4EEYA 4O3SA 4QZEA 7ICFA 4EYHB 4E0DA 4KLTA 1ZQIA 1B43A 4F4ZA 4K4HA 3T5KA 7ICRA 1S10A 3HX0A 1A76A 4UAWA 1U49A 4F93B 5J2BA 5J2JA 4I29A 9ICIA 3N97B 2PFNA 5HP4A 1NK0A 2Y1IA 4KITB 3H8SA 4PGQA 8ICZA 4B9NA 5DG8A 5BPCA 1XSNA 1NK6A 5KG0A 4F5PA 3EZ5A 4YVZA 4J9PA 2FMPA 1S0VA 4R65A 4XUSA 4B9SA 4K4IA 2JEFA 1XSLA 8ICMA 8ICIA 4YMOA 1N56A 4QZCA 4F4YA 2XCAA 3THVA 3PVXA 4KTQA 3RBEA 4ED8A 4I2DA 1PZNA 3UXNA 3ZDDA 5DDMA 4I2CA 4RZRA 2JZBA 4I2FA 1KFSA 2C2DA 3PW4A 2W9AA 1ZQOA 4IRKA 2W9BA 3G6XA 4O3OA 4F4KA 3PX0A 3ETLA 3OHAA 2FLLA 4BXOA 3KTQA 3PR5B 1LB2B 4GXIA 4DOBA 1RXWA 2P6RA 3LDAA 8ICYA 3RR8A 4UAZA 4TURA 4J9KA 2VA2A 1XS9D 5DLFA 3MR5A 4RQ6A 3EPGA 3ORYA 4YD1A 3UXPA 5J0QA 2KZ3A 4B9UA 4NM2A 3N4MB 4FS1A 2FLNA 1COOA 3M8SA 4Z6FA 4PHEA 4QWEA 3MGIA 4EBCA 1ZQMA 1QSLA 5KT3A 4DL5A 1B22A 5KFQA 7ICKA 7ICTA 2ZUCA 5HMLA 5KFUA 9ICNA 2XGPA 5IIKA 1QTMA 4Q43A 5DB8A 3PY8A 3GIJA 1HUOA 4QZHA 4QWAA 3H4BA 2BCSA 4C8MA 4YG2A 4ECVA 1TV9A 4JV2A 8ICGA 2ZTCA 5EWEA 2XY6A 9ICBA 2ISPA 5CB1A 1H38A 1RZTA 1CEZA 8ICOA 4ED3A 7ICHA 8ICPA 1D9DA 4B9LA 3ZDEA 3RR7A 3PV8A 3Q8MA 4X5VA 5KFLA 2HHWA 4XRHA 5DB6A 3OJSA 2ZJ8A 2C2EA 3T5JA 3QEAZ 4BDPA 4KLLA 4M6WB 4JK1A 2BCVA 1ZQZA 2HHSA 1SKWA 4UB3A 1SZPA 4O0IA 2RDIA 4DL3A 5BOMA 3TFRA 4DFJA 2AU0A 1X9WA 1KSPA 9ICWA 2BKEA 5L1JA 1RPLA 4M9JA 4PHAA 1S76D 4Z6EA 5J2EA 3RAQA 5KFSA 3KHRA 7ICSA 1ZQJA 3QEBZ 2ASDA 3Q8QB 5EOZA 2BCRA 1ZJMA 3K75D 1T4GA 2ZTEA 5L1KA 1ZQPA 4KLGA 3Q8PB 4NLKA 2PI5A 1TK5A 5JUMA 5HHIA 3H40A 3UPQA 1L3TA 4TUPA 3TARA 3ZDAA 4F92B 1TAQA 4KLQA 1TKDA 4QWCA 2J6TA 1MSWD 3HP6A 5L1LA 4ECSA 1X9SA 1L3SA 8ICQA 3H8JA 4UB4A 3MR6A 3KHGA 3PNCA 4MFAA 3B0YA 3C23A 4Z6CA 3Q8KA 9ICKA 3PMNA 5KFEA 2AQ4A 4MFFA 1D9FA 4M47A 1ZQKA 2R8IA 4TUSA 8ICJA 4QZFA 4YMNA 4DSIA 1T8EA 3V6JA 4DSFA 1RYSA 4RQ0A 4NLZA 4M9HA 4RU9A 9ICLA 2R8HA 5DBCA 1ZQLA 3TFSA 4IQWA 3E2EA 2IHMA 4QZAA 1XSPA 4F2SA 4PPXA 4ED0A 4ECQA 2C22A 4YR2A 3C1ZA 1TFRA 8ICRA 1S9FA 4C8KA 4DLGA 3C2MA 2KFZA 2MUTA 4GC7A 4MF2A 2FPLA 5DG7A 2ZTDA 3RAXA 4F91B
chains in the Genus database with same CATH superfamily
2ZJ5A 2XY5A 2BGWA 3C1YA 5ALSA 4FS2A 4CCHA 1K1SA 3C2KA 1N63A 4G9BA 1ZQGA 4QW9A 5T14A 1X42A 7ICUA 3ED5A 5CEHA 4I2HA 3PW7A 1U48A 3B0XA 1CUKA 1ZQTA 3SR6A 4DQSA 3PMLA 1MQ2A 1NOMA 3PW2A 4PZNA 2BPFA 4QZ8A 2MSNA 4J03A 2IBKA 1GO3F 5KT6A 3PO4A 5KFHA 4MHVA 1HJPA 3HKZC 2ZXIA 5KFOA 2XCPA 2MU2A 5IIJA 3RJHA 4M6WA 4ECYA 4P4MA 2C28A 4KLIA 1S0NA 3RJIA 9ICFA 8ICLA 2A19A 5AI8A 8ICBA 5KG4A 4I2GA 4TUQA 3UQ2A 1KBUA 3WKEA 3QYPA 3GFKB 5ALMA 5AKKA 4Q44A 4QW8A 5ALDA 2K4HA 4OCZA 1RM6C 2KICA 3AUOA 1ZQQA 4Y2SA 3SV4A 3D2NA 4YCXA 2WHEA 5J0RA 2F1IA 4LJXA 3V7LA 1UQVA 5AKXA 4NLBA 2Y9TA 3NTUA 3PO5A 2K8BB 3M9NB 4YMMA 9ICPA 3K1RB 2F1HA 4P0PB 3H4DA 4IS7A 4BGDA 2NRXA 4F5QA 1PVQA 2A1AA 4JB3A 5KG3A 3QUTA 4ELTA 5ALFA 4PZOA 4BWMA 2H3FA 1IXRA 4EELA 4KMUA 5JTIA 2DFLA 2WFAA 3RH4A 4ELUA 5A0LA 1BGXT 4C8NA 2IHNA 4UW9A 4EZ9A 1FIQA 4KLHA 4C80A 1K5OA 4USAA 4EEKA 3NVYA 3MBYA 3GV5B 5JU5A 5J0OA 1IIPA 1YZ7A 2KHVA 1LV5A 2LHTA 1WWVA 4EBEA 5DB7A 5IIIA 3AN1A 9ICEA 5J2DA 4LVSA 2AHOB 4O3QA 3D2SA 3KZXA 3Q8LA 4FBTA 4Z6DA 8ICAA 4YP3A 2W43A 9ICAA 2JH7A 1U4BA 3QE9Y 9ICSA 4C4SA 1D8YA 1NK4A 2WF7A 4R63A 1UT8A 5KT7A 4G3IA 1LKYB 1S5LU 1SL1A 9ICVA 4J9SA 1U47A 1HEKA 1VLBA 4BXOB 3TAPA 2BPCA 5KFAA 2HSZA 1CRXA 4DL7A 1N5WA 4O3NA 3H8WA 3DEEA 3NRZA 3SAHA 2KIVA 4I28A 5KFTA 1WCNA 3NVZA 5ALGA 1X2IA 5AM4A 2BQ3A 5EWFA 3RB3A 5AKYA 8ICWA 2PFQA 3KZIU 1K1QA 2RDJA 4DSLA 2KNJA 1URJA 2LPEA 4FE3A 2BQRA 4DL6A 3TI0A 3BS7A 5CA7A 4PGXA 1M6YA 1QQ7A 5DQIA 1SZHA 2ODGA 1T7PA 7ICIA 1U9LA 2K60A 4QZ9A 4IR9A 1NK5A 2G5HB 2FMQA 1ZQNA 1ZQCA 5KFGA 5KFDA 1JROA 4RPXA 3H7IA 5AK4A 2ZUBA 2F76X 5KL1B 4NY8A 4J9QA 2Y1JA 1ECWA 5AKIA 3M6KA 2HHQA 3KKAA 4KLUA 1X6IA 2FMSA 3JPNA 5KG2A 1OW5A 2YB1A 3KHHA 1ZETA 2RRDA 1PUZA 5HMMA 2BR0A 1ZQXA 1O03A 1ZQDA 2G0AA 2FI1A 3RTVA 4I2JA 5J0WA 4ECRA 4DSEA 4XA5A 3AM9A 5KG1A 4M9NA 8ICVA 3I1YA 3ZD8A 4OO1J 3SENA 1BNOA 3WK4A 2AJQA 1BPEA 1JRPA 1KQQA 3RRGA 1ZQHA 5IILA 5L1IA 4O3SA 4KLTA 3ONNA 2JV3A 1TE2A 5AM5A 3HX0A 4UAWA 1A76A 4F93B 2JGAA 2Y1IA 3H8SA 2F2AB 5DG8A 5BPCA 4QJFB 4F5PA 4J9PA 2HI0A 1L8OA 4R65A 2JMGA 2F8LA 1XSLA 2O6KA 4IL6U 4KTQA 3UXNA 1PZNA 3ZDDA 4I2FA 1KFSA 4Y2PA 1PK3A 2ZIXA 3TADA 3PW4A 3ETLA 3OHAA 4CNQA 3PR5B 4GXIA 1L7MA 4UAZA 2VA2A 3L4PA 5ALIA 4Y2XA 2KZ3A 5ALYA 4QWEA 4PHEA 2GH1A 1T94A 1RDFA 5HMLA 4Q43A 5DB8A 4QZHA 3IV6A 2BCSA 3PSFA 1TV9A 2EANA 4JV2A 1SXDA 3AQEA 3RF9A 1RZTA 1J97A 4ED3A 3DDHA 2ZJ8A 2C2EA 4BDPA 2JRZA 4FFDA 1ZQZA 1SZPA 3TFRA 4NV0A 2WF8A 3RAQA 4EX6A 5KFSA 2EZXA 1ZQJA 1RYUA 3CW2C 3Q8QB 2H3ZA 5L1KA 5E79U 5G5GA 2HOQA 1IG6A 1X40A 3ZDAA 4KLQA 8ICKA 1TKDA 2J6TA 1MSWD 1X9SA 3WKDA 3PNCA 3C23A 3Q8KA 4MFFA 5GTHU 2R8IA 8ICJA 2HBLA 5ALXA 4UAVA 1SXEA 1ZRNA 4NLZA 3FM9A 2OHFA 2NO5A 4PL2A 3TFSA 2MA1A 1XSPA 4PPXA 2C22A 2RHFA 3F2BA 3NASA 2LMRA 2ASJA 4EZ6A 1RQLA 5DG9A 2LYBA 1NKCA 1V9PA 2QKQA 3V6HA 5DQGA 7ICOA 3V72A 4MF8A 2ZUDA 1C7YA 4EYIB 5B5EU 3L5KA 4I2AA 3GIIA 3E0FA 8ICTA 1JALA 2DWQA 2PMZC 4IRDA 2A1JB 1NK8A 4ED7A 1QCKA 4UAYA 3GV8B 3IM1A 1O08A 3OSNA 5ALTA 2BCUA 3UMGA 4PJ0U 3V7JA 1DGSA 4YXMA 4R8UB 4CE6A 5J0YA 4KN4A 2K4IA 2IMWP 1S77D 4UASA 3A0HU 3WK8A 2QB0B 3N7PD 4UB2A 1F5SA 4NLNA 2F3NA 2J6UA 3IRUA 1BPZA 2ZG6A 3RB6A 1WUDA 3JPOA 9ICJA 3GIKA 4M9GA 3IHQB 2NRTA 2ZIWB 3PR4A 3PX4A 4DS5A 4Y2JA 1RQNA 4GC6A 2W54A 1A0PA 2DPJA 3QUBA 3QNMA 4RUAA 1NKBA 2KFNA 2JR5A 8ICSA 5KFIA 4TQSA 2FPMA 1COKA 3JPQA 5H2FU 4R8UA 4PHDA 1S0OA 2P66A 9ICQA 3GDXA 3IDWA 2QARB 3GZFA 4P4OA 5AK5A 1KFTA 4RQ7A 3BDPA 2C2RA 4Y2QA 3T3FA 2QLTA 3QX7A 3AQFA 2GWSA 3QU9A 4QWBA 5AIAA 2HHXA 4KLJA 3BQTA 1KDHA 2JEIA 4KLEA 1V85A 3SZ2A 4JMUA 5ALLA 1N2XA 4M2YA 4NXZA 9ICXA 3F2CA 1ED1A 4B9MA 1SWWA 4UB1A 2KD1A 4RQ5A 4DLEA 4QZBA 1KLNA 4P4PA 3NRWA 5B66U 3PSIA 1ZJNA 1ZD3A 1WWUA 1KL9A 2AQ0A 8ICUA 3EPIA 4KX3A 2HBMA 2VJ5A 3HPOA 8ICEA 1ZQVA 4DQRA 2JHDA 1KRPA 3HT3A 3K1ZA 3BS5A 5DGAA 4FZLA 2NRZA 2YMQA 3WK7A 4R66A 2CPRA 4DSJA 2G06A 2KZZA 2OCEA 9ICHA 2XO7A 5L9XA 5EWGA 1UT5A 3EWAA 5KT4A 5J2HA 3RRHA 5ALRA 5J0TA 4UBCA 4YN4A 2LBOA 4RQ2A 2R8GA 3CRXA 3UM9A 5KFPA 4UQGA 5CP2A 4PH5A 5KFKA 1BPYA 2YQEA 1SKSA 3SV3A 2M9NA 4C4RA 4C0ZA 3M9OB 3OGUA 7ICLA 1SL2A 5AK6A 1ZQAA 3QU2A 4MEYA 4UARA 2KJ9A 2HBKA 5J2IA 5AI4A 4TQRA 4NJ8A 3MDAA 3RB4A 4EBDA 3BS5B 3C2LA 1CI4A 2KKPA 4I2IA 5D46A 5CJ7A 1DXSA 1JX4A 2W8LA 4Y2RA 4F5NA 4DOCA 2JEGA 5HHHA 2Q0ZX 2KTQA 1X9MA 4R64A 4I27A 1U45A 2DKXA 1RXVA 2RQ5A 4PHPA 4C7ZA 5DBBA 1VDVA 2IOHA 4IRCA 1UHUA 2VKQA 2B6GA 2WAQC 3BZKA 4F2RA 5DB9A 1Z00A 3C5FA 2ZIWA 1IM4A 4LZDA 4NLCA 1T3NA 4JWMA 2Z7JA 4J9RA 8ICNA 1NZPA 3WU2U 3T5LA 3SAFA 1F44A 2GO7A 4QIWC 2YMLA 5KFYA 3T79A 4DOAA 2KSOA 7ICNA 3IN5A 1SGGA 2P6UA 2FE9A 3ZDCA 3PW0A 1ZQYA 3RJKA 2G08A 4CRXA 2K4PA 3AU6A 4CF4A 1JUDA 5AK3A 3OJUA 4DFPA 4O3MA 4F3OA 1UCVA 3TQ1A 1L3VA 2H3VA 4JV0A 1PVPA 5KTQA 9ICUA 3GQCA 1TAUA 4KMOB 3FDSA 5KFBA 1EXNA 2V4QA 1FO4A 3N28A 4QIWF 3AL0B 4F4ZA 4K4HA 7ICRA 3E58A 5AKLA 5K4LA 2KSOB 2Y0SC 4I29A 5J2JA 1X6JA 2PFNA 5HP4A 2NO4A 2QARA 4B9NA 1PK1A 5KG0A 3EZ5A 1S0VA 1XNSA 2I5HA 4B9SA 4K4IA 8ICMA 4CDGA 8ICIA 4YMOA 2ZXHA 4I2DA 5DDMA 4I2CA 4RZRA 2JZBA 3QU4A 2W9AA 1ZQOA 4IRKA 2B0CA 2E3TA 3PX0A 4F4KA 2BDUA 2YB4A 2CXYA 1RXWA 4ACOA 4TURA 4J9KA 5DLFA 3ORYA 3UXPA 5J0QA 4FS1A 4US8A 1B22A 3TKAA 4CGZA 7ICKA 9ICNA 2QB1A 3PY8A 3GIJA 3C28A 1HUOA 4C8MA 4ECVA 2ISPA 5CB1A 8ICOA 7ICHA 1D9DA 3ZDEA 3RR7A 2HHWA 3Q8MA 5KFLA 4XRHA 3T5JA 2R18A 3PSPA 2G5IB 4DFJA 2AU0A 1A6SA 1X9WA 2ESEA 1KSPA 2BKEA 4U6PA 2RP5A 5L1JA 3I76A 4Z6EA 1SIJA 1PVRA 3KHRA 4US9A 1ZQ1C 1QH9A 4ICAA 5EOZA 5KAFU 2CRXA 3H0LB 3H0MB 3Q8PB 1TK5A 5JUMA 5F3XB 3UPQA 3TARA 3S6JA 1DK2A 4F92B 4ECSA 1L3SA 5EE3A 3H8JA 3KHGA 4P0QA 3MR6A 4MFAA 1NZBA 3PMNA 2AQ4A 2AH5A 4QZFA 3SD7A 4YMNA 1MA7A 2W04A 2XIDA 4WJ3B 5ALPA 1V38A 4ECQA 8ICRA 4C8KA 4DLGA 4DFDA 2KFZA 1VJ5A 4MF2A 5KFXA 3OSPA 5KG6A 1MN8A 3JPRA 8ICCA 3MGHA 4J9LA 2R8KA 5J0PA 3M8RA 2KN7A 2R8JA 3JPPA 4M04A 4RUCA 3A0BU 1RYRA 4Q8FA 4J9NA 1L7PA 3TANA 3Q8RB 2K4EA 1XWLA 2DUYA 4IQVA 4OJPA 4QZDA 2KZMA 3M1YA 5AI6A 2DQNB 2UVVA 1BNPA 4O9MA 1N60A 3D2QA 3RB0A 4GXKA 4GLXA 3WK9A 2OYYA 2H3QA 4F50A 1ZD4A 2B21A 3RJFA 5AHXA 1BPDA 5EE0A 3KOOA 3BQ2A 3PX6A 4IQTA 2KKVA 3BJYA 5KFMA 4KLOA 1Q46A 4C4TA 1HIWA 1L7NA 5JRTA 2HHTA 1S97A 3OHBA 2V9WA 1Z3EB 3LVVA 3WKAA 5DBAA 4RQ3A 2BCQA 4O3PA 5ALVA 4C8LA 3JPTA 4DQIA 4KN7A 1WCLA 2LKYA 3CYMA 3KHLA 2NRVA 5ALOA 2HHUA 2XC9A 2HVIA 2VA8A 4DFMA 3AEVA 3AU2A 3PW5A 3G6VA 2PXIA 5J2KA 2PKEA 1X9XA 1Z1VA 1OXJA 4RNOA 5J8YC 2W9CA 1PK1B 3ZDBA 4DWIA 5AICA 4DEZA 1L8LA 3R9KA 4FZNA 9ICOA 8ICFA 4YXJA 2XI9A 4PGYA 1ZQBA 3GIMA 1P7DA 2NV3A 5AI9A 3ISBA 1UPHA 2HHVA 2ZJAA 3ISCA 1ZQSA 3SQIA 3IP4B 5J2GA 4RT3A 2V4RA 2KE7A 2YX8A 9ICGA 1JXEA 2A3VA 3ISDA 2W3SA 1ZQWA 5KFJA 4FO6A 7ICMA 2BQUA 2KHQA 4F5RA 4C8OA 3RH6A 3M9MB 8ICXA 1ZYQA 3EUB2 3ETRA 4DSKA 2KMDA 3T5HA 4YR3A 2MUTB 7ICPA 3GILA 2XVTA 2BHNA 2AXTU 4ECUA 4GIBA 5D4BA 5AM3A 3NVVA 3KKAC 4ECXA 2P35A 3MR3A 4AYBF 4NM1A 4RPZA 1KEJA 3U26A 3MC1A 3BQ0A 4NL9C 2FLPA 2AGPA 4A8EA 1D8BA 4QNLA 4YQWA 5ALNA 2K89A 4BX9C 4F4XA 1JN3A 5G5HA 3QZ7A 1SL0A 3ICXA 2PFPA 2JXJA 9ICCA 4K4GA 5KFNA 4U7CA 2KJ5A 3QXGA 2LYAA 2I6XA 4KLFA 4XQ8A 1L5UA 2DBYA 3WK6A 4QZGA 5IINA 5BOLA 1S0MA 1DK3A 3L3FX 1WG8A 4UB6U 3RBDA 5ALHA 4F8RA 4ELVA 5J2CA 4DF8A 5EE1A 1TK0A 1FFUA 1N62A 2WB1C 5AI5A 4CF5A 1KN5A 2KV2A 1LVHA 4MFCA 1XU4A 1NK7A 2W3RA 1L7OA 5KT5A 2VJ4A 2EDUA 2YMMA 5KFVA 9ICMA 5HR7A 3HWTA 3RH5A 9ICRA 1Q8KA 2A1JA 4B6JA 3SI8A 4J9MA 4J9OA 2UVWA 3UXOA 1KFDA 1JIHA 4RNMA 3C5GA 2HOIA 2EQYA 3QUQA 3GV7B 4BUGA 2N1RA 2QB0A 5DKWA 5IIMA 4Q8EA 2OM6A 5CRXA 1X66A 1AROP 4RQ1A 2G07A 3RJEA 4CF3A 3V7KA 4DL4A 4KLDA 2BPGA 5J0XA 1JMSA 2ZIVB 1J2NA 5D49A 2KK0A 3D6JA 5F9NA 2W03A 2W9CB 2ZIUA 2MAXA 2IOFK 2HCFA 4P0QB 1Z4OA 3HRDD 4ED2A 3LWLA 4GFJA 1SB3C 3IG5A 3F5EA 3TAQA 7ICFA 1DGJA 3OPXA 4EEYA 2HMXA 1ZQIA 2ZIUB 1U49A 9ICIA 1NK0A 3CP8A 4PGQA 8ICZA 2FDRA 3NUQA 4RQMA 2JH1A 2HBJA 4XUSA 4QZCA 1SV4A 3KD3A 3PVXA 3RBEA 2W9BA 3G6XA 2DL0A 4BXOA 3KTQA 2P6RA 2E1EA 3RR8A 3MR5A 2W7PA 4YD1A 4B9UA 4NM2A 3N4MB 1COOA 4F71A 3M8SA 5KT3A 5KFQA 3UMCA 7ICTA 5KFUA 2XGPA 5IIKA 1QTMA 1Z1BA 3ALRA 4QWAA 8ICGA 2ZTCA 2XY6A 2WAQF 1H38A 3PV8A 4X5VA 3QEAZ 1SKWA 4O0IA 5BOMA 9ICWA 2KVCA 4M9JA 1N5XA 5J2EA 1Z19A 2EAMA 3QEBZ 2ASDA 2BCRA 3SEIA 4KLGA 4NLKA 2PI5A 1SWVA 3QU5A 2KP7A 1TAQA 1ZXIA 4QWCA 4UB4A 1T3QA 3CNHA 2D6FC 3N7RC 4Z6CA 5KFEA 4PL1A 1D9FA 1ZQKA 4DSIA 4DSFA 2G09A 2DF4B 4RU9A 2R8HA 5DBCA 2EZZA 4IQWA 1B4FA 4QZAA 4YR2A 3C1ZA 1TFRA 2Y0SF 3MGVA 1S9FA 3C2MA 5AKEA 2FPLA 5DG7A 3RAXA 4F91B 2IOFA 4IQUA 4GXJA 1NNLA 2E5SA 1F0MA 5J2FA 2F8KA 2ISOA 1Q3UA 4Y2UA 1XO0A 1NI3A 4Y2TA 1BVSA 2ZIXB 2NYVA 2W9BB 3FC4A 5KFZA 4UAUA 3LWMA 3N7SC 4F5OA 1UA0A 5CR0A 2D3DA 3MFIA 5KL8B 7ICJA 2EAPA 2KG5A 1LKYA 2OXOA 4ED6A 3MDCA 1L3UA 2H5XA 5F9LA 4UBBA 3V6KA 2PI4A 1UA1A 3ZD9A 3RFAA 1KTQA 5KG5A 1IV8A 2JZBB 2LM4A 4DCCA 1ZQEA 2HW3A 4O5EA 2DKZA 3WKCA 3RJJA 4B9VA 1KW4A 4EENA 1N48A 2UVRA 2F44A 4UATA 4RT2A 5FP0A 5KFFA 4RNNA 2UVUA 3EYZA 2BDPA 4B9TA 2IA6A 5HR6A 3SAGA 3M7DA 2WTFA 1SKRA 1ZQRA 5CHGA 4RQNA 3HW8A 4MEXA 1QLNA 3O0FA 3LK9A 4ZH4A 5C0YA 4RQ4A 4ED1A 5ALKA 2K8AA 5KG7A 2LYHA 1Z00B 5L1MA 2ALZA 2NRWA 2RLTA 1BPBA 5J29A 4ZOHC 2VANA 7ICEA 1KKXA 5KFWA 4I2BA 5J8YA 4ECTA 3MR2A 8ICHA 3HILA 4RQ8A 1NKEA 3RJGA 1JI7A 1DOQA 3B9JA 2KOBA 2WB1F 5TZVA 2E8PA 3DV9A 3LVWA 3WKBA 3OTQA 3SMVA 4ECWA 1QSSA 4DS4A 5DLGA 2KIWA 1NJWA 3NS1A 1OUQA 1FFVA 3BZCA 1NJXA 4FBUA 3C29A 2PFOA 3KBBA 3HKZF 5DGBA 2W7OA 3C21A 2WF5A 4I2EA 4O5CA 2DPIA 2GOLA 4M0AA 3Q8SB 4O5KA 1TAMA 4LZGA 1SV0A 5AM2A 3M6ZA 4OJLA 5AKZA 2L5YA 1MC8A 2AGOA 3UQ0A 1QSYA 1BPXA 1C20A 4JUZA 1ZQFA 4KLMA 2WF6A 5C5JA 5J0UA 3G6YA 4Y2VA 4DFKA 3PSTA 2XY7A 4F4WA 3EW9A 4Y2YA 2ATLA 2HDOA 4OJOA 5TISU 4AYBC 4UB5A 1ZQUA 2HVHA 3WK5A 4IR1A 9ICTA 1XC9A 2VIXA 4DL2A 1Q3VA 3SYZA 2XGQA 4DO9A 2OH2A 3F2DA 4KLSA 4P2HA 3FAHA 2JEJA 2ASLA 1J2MA 3H8MA 7ICQA 5AI0A 1TVAA 3MFHA 1Y88A 3NVWA 5DDYA 3PZPA 1QQ6A 1D8LA 3F53A 5KFRA 4ECZA 7ICVA 3VCBA 1N61A 5ALJA 2KJ8A 5AIBA 4DQPA 3QZ8A 5AM0A 3BQ1A 2W55A 2W8KA 3TACB 4FZMA 2E8NA 3GU3A 4YR0A 1NJZA 1AQ6A 1SV0C 5KNIA 4YFKA 2EZYA 2KVSA 3MABA 4QZIA 3KFUF 2W9MA 4DF4A 4C7YA 4DQQA 2MRLA 1XO1A 1NJYA 3FYHA 1V97A 2I1QA 1A77A 4QWDA 5KT2A 1YT3A 2KEYA 4M9LA 3JPSA 1HUZA 5DQHA 2XICA 2YMPA 1DRGA 5HNKA 1RG6A 1MQ3A 4NL9A 1L6NA 2DGZA 4HAIA 2AGQA 5KFCA 5CWRA 3K4GA 5AKHA 1JXLA 4Q45A 4YD2A 2F1JA 2YY6A 5GTIU 2I9GA 2J6SA 5ALZA 5J2AA 2VA3A 2CN1A 1TK8A 3VC8A 2PMZF 4JWNA 4O3RA 2GLEA 3F5AA 3NGDA 5J0SA 4RPYA 7ICGA 5ALQA 4HYKA 4NWIA 3I28A 2Y9UA 2OWOA 4NLGA 1ZD2P 3LYSA 5IIOA 3QU7A 4BWJA 4IC9A 1ZOLA 1NK9A 5ALEA 2FPKA 4JV1A 4QZEA 4OD0A 4EYHB 4E0DA 1B43A 1FEZA 3T5KA 2FJ6A 1S10A 2HOFA 3TADC 2E8MA 2EH9A 5J2BA 3N97B 5KAIU 2K8CB 4KITB 2M0NA 1XSNA 1NK6A 4P0PA 2W11A 4YVZA 2FMPA 4OJ6A 1B0XA 2LM1A 5ALUA 2JEFA 2YN4A 1N56A 3ZI4A 4F4YA 2XCAA 3THVA 4ED8A 2ZIVA 2C2DA 4O3OA 3HJEA 1Z4NA 2FLLA 4EX7A 1LB2B 4DOBA 3LDAA 8ICYA 2EAOA 1YZ6A 1XS9D 4RQ6A 3EPGA 1QQ5A 2E8OA 1ZD5A 2FLNA 1ZQMA 4Z6FA 3MGIA 4EBCA 1QSLA 4DL5A 2ZUCA 2WF9A 3AMZA 3H4BA 4YG2A 2OEHA 5EWEA 9ICBA 1CEZA 8ICPA 1WYGA 4B9LA 5DB6A 3OJSA 4KLLA 4M6WB 4JK1A 4OJ5A 2BCVA 2HHSA 3BQ7A 4UB3A 4DL3A 2RDIA 5EE9A 3QUCA 5ALWA 1RPLA 4PHAA 2F77X 5AM1A 2Q4TA 1S76D 7ICSA 3J81j 2D8CA 1ZJMA 3K75D 1T4GA 2ZTEA 1ZQPA 5HHIA 3H40A 2YTUA 3IG8A 1L3TA 4TUPA 4UB8U 3HP6A 5L1LA 8ICQA 1S8OA 4AP9A 3B0YA 2E1FA 9ICKA 3H0RB 4M47A 4KX5A 4F72A 4TUSA 1T8EA 2BZFA 5AKGA 3V6JA 1RYSA 2H3IA 4RQ0A 4M9HA 5AKJA 9ICLA 4BJQA 1ZRMA 1ZQLA 2ES6A 3E2EA 2IHMA 3UMBA 4F2SA 4ED0A 2MUTA 4GC7A 2ZTDA 2LI6A
chains in the Genus database with same CATH topology
5KFXA 2ZJ5A 5DG9A 3OSPA 5KG6A 2XY5A 2BGWA 3JPRA 1NKCA 4IQUA 3MGHA 1V9PA 4GXJA 8ICCA 3V6HA 5DQGA 3C1YA 7ICOA 4FS2A 4J9LA 2R8KA 4CCHA 1K1SA 5J0PA 3C2KA 3V72A 3M8RA 5J2FA 4MF8A 2KN7A 2ZUDA 2ISOA 1C7YA 3JPPA 2R8JA 4RUCA 4M04A 1ZQGA 4EYIB 4QW9A 1RYRA 4Q8FA 4J9NA 3TANA 3Q8RB 1BVSA 2W9BB 4I2AA 7ICUA 3GIIA 5KFZA 3LWMA 4F5OA 4I2HA 3PW7A 8ICTA 1XWLA 1UA0A 1U48A 3B0XA 4IQVA 1CUKA 4QZDA 5CR0A 1ZQTA 3MFIA 2KZMA 4IRDA 4DQSA 2A1JB 2UVVA 1NK8A 7ICJA 4ED7A 3PMLA 1MQ2A 4O9MA 4UAYA 3GV8B 3IM1A 1NOMA 3PW2A 2BPFA 3OSNA 4QZ8A 3RB0A 4ED6A 2BCUA 3MDCA 2IBKA 3V7JA 1L3UA 5KT6A 4GXKA 4GLXA 3PO4A 2H5XA 5KFHA 1DGSA 5F9LA 4YXMA 4UBBA 4R8UB 3V6KA 4F50A 2PI4A 1HJPA 1UA1A 5J0YA 3ZD9A 4KN4A 1KTQA 5KG5A 2IMWP 2B21A 3RJFA 1BPDA 2JZBB 1S77D 1ZQEA 2HW3A 4UB2A 4O5EA 5KFOA 4NLNA 2XCPA 3RJJA 5IIJA 2J6UA 3RJHA 4M6WA 1BPZA 4B9VA 4ECYA 3BQ2A 3PX6A 4IQTA 4P4MA 1N48A 2C28A 4KLIA 3BJYA 3RB6A 3JPOA 1S0NA 9ICJA 3RJIA 3GIKA 4M9GA 9ICFA 3IHQB 2NRTA 5KFMA 2UVRA 4KLOA 3PX4A 3PR4A 8ICLA 4RT2A 5KFFA 4DS5A 8ICBA 1S97A 5KG4A 4RNNA 4GC6A 2UVUA 2HHTA 3EYZA 4TUQA 4I2GA 3UQ2A 2BDPA 4B9TA 2DPJA 3OHBA 2V9WA 2IA6A 3GFKB 1Z3EB 5DBAA 2BCQA 4RQ3A 4Q44A 4O3PA 4RUAA 4QW8A 4C8LA 3JPTA 4DQIA 1NKBA 4KN7A 1ZQQA 3AUOA 2KFNA 2WTFA 1SKRA 1ZQRA 5CHGA 8ICSA 3HW8A 3SV4A 4YCXA 5KFIA 1WCLA 4TQSA 4MEXA 1QLNA 2FPMA 3LK9A 3KHLA 5J0RA 2NRVA 2F1IA 4ZH4A 3JPQA 3V7LA 4RQ4A 4R8UA 4PHDA 4ED1A 1S0OA 2P66A 2XC9A 2HVIA 2VA8A 3GDXA 4DFMA 2HHUA 9ICQA 3AU2A 3NTUA 3PW5A 3PO5A 3M9NB 3G6VA 2PXIA 4YMMA 5J2KA 9ICPA 4RNOA 5KG7A 2LYHA 1Z00B 2ALZA 2F1HA 2NRWA 2W9CA 1BPBA 3ZDBA 4DWIA 5J29A 4P4OA 3H4DA 4DEZA 1KFTA 4RQ7A 4BGDA 2NRXA 4F5QA 2VANA 3BDPA 2C2RA 5KG3A 3T3FA 4ELTA 8ICFA 4YXJA 7ICEA 9ICOA 4BWMA 1ZQBA 4PGYA 1IXRA 5KFWA 4I2BA 4ECTA 3MR2A 2GWSA 4KMUA 3GIMA 4QWBA 8ICHA 4RQ8A 1NKEA 2DFLA 3ISBA 3RH4A 3RJGA 2HHVA 4ELUA 2ZJAA 1DOQA 3ISCA 1ZQSA 2HHXA 4KLJA 5TZVA 3BQTA 1BGXT 1KDHA 4C8NA 2JEIA 4KLEA 4EZ6A 2IHNA 4EZ9A 4ECWA 5J2GA 1QSSA 3SZ2A 4DS4A 5DLGA 4RT3A 2V4RA 4M2YA 4KLHA 9ICGA 1NJWA 4NXZA 1JXEA 9ICXA 1NJXA 4FBUA 3ISDA 2PFOA 1ZQWA 5DGBA 5KFJA 4FO6A 7ICMA 3C21A 3MBYA 4B9MA 4I2EA 4UB1A 3GV5B 4RQ5A 2BQUA 4O5CA 4DLEA 2DPIA 4F5RA 4QZBA 4C8OA 3RH6A 3M9MB 5J0OA 1ZYQA 4M0AA 8ICXA 3Q8SB 4P4PA 1KLNA 4DSKA 4O5KA 3T5HA 4LZGA 1ZJNA 4YR3A 1LV5A 2MUTB 7ICPA 3GILA 4EBEA 1MC8A 5DB7A 2BHNA 5IIIA 2AGOA 3UQ0A 1QSYA 1BPXA 4ECUA 9ICEA 2AQ0A 5D4BA 4JUZA 1ZQFA 8ICUA 5J2DA 3EPIA 4KLMA 5C5JA 5J0UA 4LVSA 3G6YA 4ECXA 3HPOA 3MR3A 8ICEA 4DFKA 2XY7A 4O3QA 3EW9A 4F4WA 4NM1A 4RPZA 1ZQVA 4DQRA 1KRPA 1KEJA 3HT3A 5DGAA 3BQ0A 3Q8LA 2FLPA 4FBTA 4Z6DA 2NRZA 2ATLA 2AGPA 4YP3A 8ICAA 4R66A 9ICAA 4DSJA 1U4BA 4UB5A 2KZZA 1ZQUA 4YQWA 5L9XA 2XO7A 3QE9Y 5EWGA 2ASJA 2HVHA 9ICSA 9ICHA 1UT5A 1D8YA 4IR1A 9ICTA 3EWAA 1NK4A 5KT4A 5J2HA 1XC9A 3RRHA 4DL2A 8ICKA 4F4XA 1JN3A 5J0TA 4UBCA 4R63A 3SYZA 1UT8A 5KT7A 3QZ7A 2XGQA 4YN4A 1SL0A 4G3IA 2PFPA 4RQ2A 1SL1A 9ICVA 4J9SA 1U47A 2R8GA 4BXOB 4DO9A 5KFPA 4UQGA 3TAPA 2BPCA 5KFAA 5CP2A 4KLSA 9ICCA 4P2HA 4K4GA 5KFNA 2JEJA 2ASLA 4DL7A 4O3NA 7ICQA 4PH5A 5KFKA 1BPYA 3H8WA 1TVAA 3MFHA 1Y88A 1SKSA 4I28A 3SV3A 5KFTA 2M9NA 1WCNA 5DDYA 4KLFA 1X2IA 2BQ3A 4XQ8A 1L5UA 5EWFA 4QZGA 3RB3A 5IINA 8ICWA 2PFQA 3M9OB 3OGUA 1K1QA 5BOLA 1D8LA 5KFRA 2RDJA 4ECZA 4DSLA 7ICVA 1S0MA 7ICLA 1SL2A 1ZQAA 4MEYA 3RBDA 2BQRA 5J2IA 4TQRA 4DL6A 4F8RA 3TI0A 4DQPA 3MDAA 4ELVA 5J2CA 3RB4A 3QZ8A 3BQ1A 4EBDA 3C2LA 4DF8A 2W8KA 5CA7A 1TK0A 4I2IA 5D46A 5CJ7A 4PGXA 1JX4A 2W8LA 4F5NA 4DOCA 2JEGA 5HHHA 5DQIA 2Q0ZX 1T7PA 4MFCA 1XU4A 7ICIA 1U9LA 1NK7A 4YR0A 2KTQA 1X9MA 1NJZA 4R64A 4I27A 1U45A 5KT5A 4YFKA 1RXVA 4QZ9A 4PHPA 3MABA 4IR9A 4QZIA 2W9MA 5KFVA 5DBBA 4DF4A 9ICMA 4DQQA 3HWTA 3RH5A 1XO1A 1NJYA 9ICRA 1NK5A 2FMQA 4IRCA 2A1JA 1ZQNA 1ZQCA 5KFGA 3FYHA 3SI8A 2I1QA 4F2RA 5KFDA 5DB9A 4J9MA 1A77A 4QWDA 4RPXA 1Z00A 5KT2A 3H7IA 1IM4A 4LZDA 3C5FA 4J9OA 1T3NA 4JWMA 2ZUBA 3JPSA 5DQHA 4J9RA 1HUZA 4M9LA 2UVWA 8ICNA 5HNKA 3UXOA 1KFDA 1MQ3A 4J9QA 4NY8A 2Y1JA 3T5LA 1JIHA 4RNMA 3C5GA 2AGQA 5KFCA 5KFYA 5CWRA 3K4GA 1JXLA 4DOAA 2HHQA 4KLUA 7ICNA 2P6UA 3GV7B 2FMSA 4Q45A 4YD2A 2F1JA 3ZDCA 3JPNA 3PW0A 1ZQYA 3RJKA 5DKWA 5IIMA 5KG2A 3KHHA 2I9GA 2J6SA 4Q8EA 1ZETA 5HMMA 3AU6A 1AROP 5J2AA 1ZQXA 4RQ1A 2BR0A 1ZQDA 2VA3A 3RJEA 3V7KA 1TK8A 4DL4A 4KLDA 2BPGA 3OJUA 5J0XA 1JMSA 3RTVA 4JWNA 4I2JA 5D49A 5J0WA 4O3RA 5F9NA 2W9CB 4ECRA 4DFPA 3NGDA 4DSEA 4F3OA 4XA5A 5J0SA 4RPYA 2MAXA 7ICGA 5KG1A 4M9NA 3TQ1A 8ICVA 1L3VA 4HYKA 4JV0A 3ZD8A 5KTQA 9ICUA 2AJQA 1BPEA 3GQCA 2OWOA 4NLGA 1TAUA 4ED2A 3LWLA 3RRGA 3FDSA 5IIOA 5KFBA 1EXNA 4BWJA 2V4QA 3TAQA 1NK9A 1ZQHA 2FPKA 5L1IA 5IILA 4JV1A 4EEYA 4O3SA 4QZEA 7ICFA 4EYHB 4E0DA 4KLTA 1ZQIA 1B43A 4F4ZA 4K4HA 3T5KA 7ICRA 1S10A 3HX0A 1A76A 4UAWA 1U49A 4F93B 5J2BA 5J2JA 4I29A 9ICIA 3N97B 2PFNA 5HP4A 1NK0A 2Y1IA 4KITB 3H8SA 4PGQA 8ICZA 4B9NA 5DG8A 5BPCA 1XSNA 1NK6A 5KG0A 4F5PA 3EZ5A 4YVZA 4J9PA 2FMPA 1S0VA 4R65A 4XUSA 4B9SA 4K4IA 2JEFA 1XSLA 8ICMA 8ICIA 4YMOA 1N56A 4QZCA 4F4YA 2XCAA 3THVA 3PVXA 4KTQA 3RBEA 4ED8A 4I2DA 1PZNA 3UXNA 3ZDDA 5DDMA 4I2CA 4RZRA 2JZBA 4I2FA 1KFSA 2C2DA 3PW4A 2W9AA 1ZQOA 4IRKA 2W9BA 3G6XA 4O3OA 4F4KA 3PX0A 3ETLA 3OHAA 2FLLA 4BXOA 3KTQA 3PR5B 1LB2B 4GXIA 4DOBA 1RXWA 2P6RA 3LDAA 8ICYA 3RR8A 4UAZA 4TURA 4J9KA 2VA2A 1XS9D 5DLFA 3MR5A 4RQ6A 3EPGA 3ORYA 4YD1A 3UXPA 5J0QA 2KZ3A 4B9UA 4NM2A 3N4MB 4FS1A 2FLNA 1COOA 3M8SA 4Z6FA 4PHEA 4QWEA 3MGIA 4EBCA 1ZQMA 1QSLA 5KT3A 4DL5A 1B22A 5KFQA 7ICKA 7ICTA 2ZUCA 5HMLA 5KFUA 9ICNA 2XGPA 5IIKA 1QTMA 4Q43A 5DB8A 3PY8A 3GIJA 1HUOA 4QZHA 4QWAA 3H4BA 2BCSA 4C8MA 4YG2A 4ECVA 1TV9A 4JV2A 8ICGA 2ZTCA 5EWEA 2XY6A 9ICBA 2ISPA 5CB1A 1H38A 1RZTA 1CEZA 8ICOA 4ED3A 7ICHA 8ICPA 1D9DA 4B9LA 3ZDEA 3RR7A 3PV8A 3Q8MA 4X5VA 5KFLA 2HHWA 4XRHA 5DB6A 3OJSA 2ZJ8A 2C2EA 3T5JA 3QEAZ 4BDPA 4KLLA 4M6WB 4JK1A 2BCVA 1ZQZA 2HHSA 1SKWA 4UB3A 1SZPA 4O0IA 2RDIA 4DL3A 5BOMA 3TFRA 4DFJA 2AU0A 1X9WA 1KSPA 9ICWA 2BKEA 5L1JA 1RPLA 4M9JA 4PHAA 1S76D 4Z6EA 5J2EA 3RAQA 5KFSA 3KHRA 7ICSA 1ZQJA 3QEBZ 2ASDA 3Q8QB 5EOZA 2BCRA 1ZJMA 3K75D 1T4GA 2ZTEA 5L1KA 1ZQPA 4KLGA 3Q8PB 4NLKA 2PI5A 1TK5A 5JUMA 5HHIA 3H40A 3UPQA 1L3TA 4TUPA 3TARA 3ZDAA 4F92B 1TAQA 4KLQA 1TKDA 4QWCA 2J6TA 1MSWD 3HP6A 5L1LA 4ECSA 1X9SA 1L3SA 8ICQA 3H8JA 4UB4A 3MR6A 3KHGA 3PNCA 4MFAA 3B0YA 3C23A 4Z6CA 3Q8KA 9ICKA 3PMNA 5KFEA 2AQ4A 4MFFA 1D9FA 4M47A 1ZQKA 2R8IA 4TUSA 8ICJA 4QZFA 4YMNA 4DSIA 1T8EA 3V6JA 4DSFA 1RYSA 4RQ0A 4NLZA 4M9HA 4RU9A 9ICLA 2R8HA 5DBCA 1ZQLA 3TFSA 4IQWA 3E2EA 2IHMA 4QZAA 1XSPA 4F2SA 4PPXA 4ED0A 4ECQA 2C22A 4YR2A 3C1ZA 1TFRA 8ICRA 1S9FA 4C8KA 4DLGA 3C2MA 2KFZA 2MUTA 4GC7A 4MF2A 2FPLA 5DG7A 2ZTDA 3RAXA 4F91B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KFX A;  2ZJ5 A;  5DG9 A;  3OSP A;  5KG6 A;  2XY5 A;  2BGW A;  3JPR A;  1NKC A;  4IQU A;  3MGH A;  1V9P A;  4GXJ A;  8ICC A;  3V6H A;  5DQG A;  3C1Y A;  7ICO A;  4FS2 A;  4J9L A;  2R8K A;  4CCH A;  1K1S A;  5J0P A;  3C2K A;  3V72 A;  3M8R A;  5J2F A;  4MF8 A;  2KN7 A;  2ZUD A;  2ISO A;  1C7Y A;  3JPP A;  2R8J A;  4RUC A;  4M04 A;  1ZQG A;  4EYI B;  4QW9 A;  1RYR A;  4Q8F A;  4J9N A;  3TAN A;  3Q8R B;  1BVS A;  2W9B B;  4I2A A;  7ICU A;  3GII A;  5KFZ A;  3LWM A;  4F5O A;  4I2H A;  3PW7 A;  8ICT A;  1XWL A;  1UA0 A;  1U48 A;  3B0X A;  4IQV A;  1CUK A;  4QZD A;  5CR0 A;  1ZQT A;  3MFI A;  2KZM A;  4IRD A;  4DQS A;  2A1J B;  2UVV A;  1NK8 A;  7ICJ A;  4ED7 A;  3PML A;  1MQ2 A;  4O9M A;  4UAY A;  3GV8 B;  3IM1 A;  1NOM A;  3PW2 A;  2BPF A;  3OSN A;  4QZ8 A;  3RB0 A;  4ED6 A;  2BCU A;  3MDC A;  2IBK A;  3V7J A;  1L3U A;  5KT6 A;  4GXK A;  4GLX A;  3PO4 A;  2H5X A;  5KFH A;  1DGS A;  5F9L A;  4YXM A;  4UBB A;  4R8U B;  3V6K A;  4F50 A;  2PI4 A;  1HJP A;  1UA1 A;  5J0Y A;  3ZD9 A;  4KN4 A;  1KTQ A;  5KG5 A;  2IMW P;  2B21 A;  3RJF A;  1BPD A;  2JZB B;  1S77 D;  1ZQE A;  2HW3 A;  4UB2 A;  4O5E A;  5KFO A;  4NLN A;  2XCP A;  3RJJ A;  5IIJ A;  2J6U A;  3RJH A;  4M6W A;  1BPZ A;  4B9V A;  4ECY A;  3BQ2 A;  3PX6 A;  4IQT A;  4P4M A;  1N48 A;  2C28 A;  4KLI A;  3BJY A;  3RB6 A;  3JPO A;  1S0N A;  9ICJ A;  3RJI A;  3GIK A;  4M9G A;  9ICF A;  3IHQ B;  2NRT A;  5KFM A;  2UVR A;  4KLO A;  3PX4 A;  3PR4 A;  8ICL A;  4RT2 A;  5KFF A;  4DS5 A;  8ICB A;  1S97 A;  5KG4 A;  4RNN A;  4GC6 A;  2UVU A;  2HHT A;  3EYZ A;  4TUQ A;  4I2G A;  3UQ2 A;  2BDP A;  4B9T A;  2DPJ A;  3OHB A;  2V9W A;  2IA6 A;  3GFK B;  1Z3E B;  5DBA A;  2BCQ A;  4RQ3 A;  4Q44 A;  4O3P A;  4RUA A;  4QW8 A;  4C8L A;  3JPT A;  4DQI A;  1NKB A;  4KN7 A;  1ZQQ A;  3AUO A;  2KFN A;  2WTF A;  1SKR A;  1ZQR A;  5CHG A;  8ICS A;  3HW8 A;  3SV4 A;  4YCX A;  5KFI A;  1WCL A;  4TQS A;  4MEX A;  1QLN A;  2FPM A;  3LK9 A;  3KHL A;  5J0R A;  2NRV A;  2F1I A;  4ZH4 A;  3JPQ A;  3V7L A;  4RQ4 A;  4R8U A;  4PHD A;  4ED1 A;  1S0O A;  2P66 A;  2XC9 A;  2HVI A;  2VA8 A;  3GDX A;  4DFM A;  2HHU A;  9ICQ A;  3AU2 A;  3NTU A;  3PW5 A;  3PO5 A;  3M9N B;  3G6V A;  2PXI A;  4YMM A;  5J2K A;  9ICP A;  4RNO A;  5KG7 A;  2LYH A;  1Z00 B;  2ALZ A;  2F1H A;  2NRW A;  2W9C A;  1BPB A;  3ZDB A;  4DWI A;  5J29 A;  4P4O A;  3H4D A;  4DEZ A;  1KFT A;  4RQ7 A;  4BGD A;  2NRX A;  4F5Q A;  2VAN A;  3BDP A;  2C2R A;  5KG3 A;  3T3F A;  4ELT A;  8ICF A;  4YXJ A;  7ICE A;  9ICO A;  4BWM A;  1ZQB A;  4PGY A;  1IXR A;  5KFW A;  4I2B A;  4ECT A;  3MR2 A;  2GWS A;  4KMU A;  3GIM A;  4QWB A;  8ICH A;  4RQ8 A;  1NKE A;  2DFL A;  3ISB A;  3RH4 A;  3RJG A;  2HHV A;  4ELU A;  2ZJA A;  1DOQ A;  3ISC A;  1ZQS A;  2HHX A;  4KLJ A;  5TZV A;  3BQT A;  1BGX T;  1KDH A;  4C8N A;  2JEI A;  4KLE A;  4EZ6 A;  2IHN A;  4EZ9 A;  4ECW A;  5J2G A;  1QSS A;  3SZ2 A;  4DS4 A;  5DLG A;  4RT3 A;  2V4R A;  4M2Y A;  4KLH A;  9ICG A;  1NJW A;  4NXZ A;  1JXE A;  9ICX A;  1NJX A;  4FBU A;  3ISD A;  2PFO A;  1ZQW A;  5DGB A;  5KFJ A;  4FO6 A;  7ICM A;  3C21 A;  3MBY A;  4B9M A;  4I2E A;  4UB1 A;  3GV5 B;  4RQ5 A;  2BQU A;  4O5C A;  4DLE A;  2DPI A;  4F5R A;  4QZB A;  4C8O A;  3RH6 A;  3M9M B;  5J0O A;  1ZYQ A;  4M0A A;  8ICX A;  3Q8S B;  4P4P A;  1KLN A;  4DSK A;  4O5K A;  3T5H A;  4LZG A;  1ZJN A;  4YR3 A;  1LV5 A;  2MUT B;  7ICP A;  3GIL A;  4EBE A;  1MC8 A;  5DB7 A;  2BHN A;  5III A;  2AGO A;  3UQ0 A;  1QSY A;  1BPX A;  4ECU A;  9ICE A;  2AQ0 A;  5D4B A;  4JUZ A;  1ZQF A;  8ICU A;  5J2D A;  3EPI A;  4KLM A;  5C5J A;  5J0U A;  4LVS A;  3G6Y A;  4ECX A;  3HPO A;  3MR3 A;  8ICE A;  4DFK A;  2XY7 A;  4O3Q A;  3EW9 A;  4F4W A;  4NM1 A;  4RPZ A;  1ZQV A;  4DQR A;  1KRP A;  1KEJ A;  3HT3 A;  5DGA A;  3BQ0 A;  3Q8L A;  2FLP A;  4FBT A;  4Z6D A;  2NRZ A;  2ATL A;  2AGP A;  4YP3 A;  8ICA A;  4R66 A;  9ICA A;  4DSJ A;  1U4B A;  4UB5 A;  2KZZ A;  1ZQU A;  4YQW A;  5L9X A;  2XO7 A;  3QE9 Y;  5EWG A;  2ASJ A;  2HVH A;  9ICS A;  9ICH A;  1UT5 A;  1D8Y A;  4IR1 A;  9ICT A;  3EWA A;  1NK4 A;  5KT4 A;  5J2H A;  1XC9 A;  3RRH A;  4DL2 A;  8ICK A;  4F4X A;  1JN3 A;  5J0T A;  4UBC A;  4R63 A;  3SYZ A;  1UT8 A;  5KT7 A;  3QZ7 A;  2XGQ A;  4YN4 A;  1SL0 A;  4G3I A;  2PFP A;  4RQ2 A;  1SL1 A;  9ICV A;  4J9S A;  1U47 A;  2R8G A;  4BXO B;  4DO9 A;  5KFP A;  4UQG A;  3TAP A;  2BPC A;  5KFA A;  5CP2 A;  4KLS A;  9ICC A;  4P2H A;  4K4G A;  5KFN A;  2JEJ A;  2ASL A;  4DL7 A;  4O3N A;  7ICQ A;  4PH5 A;  5KFK A;  1BPY A;  3H8W A;  1TVA A;  3MFH A;  1Y88 A;  1SKS A;  4I28 A;  3SV3 A;  5KFT A;  2M9N A;  1WCN A;  5DDY A;  4KLF A;  1X2I A;  2BQ3 A;  4XQ8 A;  1L5U A;  5EWF A;  4QZG A;  3RB3 A;  5IIN A;  8ICW A;  2PFQ A;  3M9O B;  3OGU A;  1K1Q A;  5BOL A;  1D8L A;  5KFR A;  2RDJ A;  4ECZ A;  4DSL A;  7ICV A;  1S0M A;  7ICL A;  1SL2 A;  1ZQA A;  4MEY A;  3RBD A;  2BQR A;  5J2I A;  4TQR A;  4DL6 A;  4F8R A;  3TI0 A;  4DQP A;  3MDA A;  4ELV A;  5J2C A;  3RB4 A;  3QZ8 A;  3BQ1 A;  4EBD A;  3C2L A;  4DF8 A;  2W8K A;  5CA7 A;  1TK0 A;  4I2I A;  5D46 A;  5CJ7 A;  4PGX A;  1JX4 A;  2W8L A;  4F5N A;  4DOC A;  2JEG A;  5HHH A;  5DQI A;  2Q0Z X;  1T7P A;  4MFC A;  1XU4 A;  7ICI A;  1U9L A;  1NK7 A;  4YR0 A;  2KTQ A;  1X9M A;  1NJZ A;  4R64 A;  4I27 A;  1U45 A;  5KT5 A;  4YFK A;  1RXV A;  4QZ9 A;  4PHP A;  3MAB A;  4IR9 A;  4QZI A;  2W9M A;  5KFV A;  5DBB A;  4DF4 A;  9ICM A;  4DQQ A;  3HWT A;  3RH5 A;  1XO1 A;  1NJY A;  9ICR A;  1NK5 A;  2FMQ A;  4IRC A;  2A1J A;  1ZQN A;  1ZQC A;  5KFG A;  3FYH A;  3SI8 A;  2I1Q A;  4F2R A;  5KFD A;  5DB9 A;  4J9M A;  1A77 A;  4QWD A;  4RPX A;  1Z00 A;  5KT2 A;  3H7I A;  1IM4 A;  4LZD A;  3C5F A;  4J9O A;  1T3N A;  4JWM A;  2ZUB A;  3JPS A;  5DQH A;  4J9R A;  1HUZ A;  4M9L A;  2UVW A;  8ICN A;  5HNK A;  3UXO A;  1KFD A;  1MQ3 A;  4J9Q A;  4NY8 A;  2Y1J A;  3T5L A;  1JIH A;  4RNM A;  3C5G A;  2AGQ A;  5KFC A;  5KFY A;  5CWR A;  3K4G A;  1JXL A;  4DOA A;  2HHQ A;  4KLU A;  7ICN A;  2P6U A;  3GV7 B;  2FMS A;  4Q45 A;  4YD2 A;  2F1J A;  3ZDC A;  3JPN A;  3PW0 A;  1ZQY A;  3RJK A;  5DKW A;  5IIM A;  5KG2 A;  3KHH A;  2I9G A;  2J6S A;  4Q8E A;  1ZET A;  5HMM A;  3AU6 A;  1ARO P;  5J2A A;  1ZQX A;  4RQ1 A;  2BR0 A;  1ZQD A;  2VA3 A;  3RJE A;  3V7K A;  1TK8 A;  4DL4 A;  4KLD A;  2BPG A;  3OJU A;  5J0X A;  1JMS A;  3RTV A;  4JWN A;  4I2J A;  5D49 A;  5J0W A;  4O3R A;  5F9N A;  2W9C B;  4ECR A;  4DFP A;  3NGD A;  4DSE A;  4F3O A;  4XA5 A;  5J0S A;  4RPY A;  2MAX A;  7ICG A;  5KG1 A;  4M9N A;  3TQ1 A;  8ICV A;  1L3V A;  4HYK A;  4JV0 A;  3ZD8 A;  5KTQ A;  9ICU A;  2AJQ A;  1BPE A;  3GQC A;  2OWO A;  4NLG A;  1TAU A;  4ED2 A;  3LWL A;  3RRG A;  3FDS A;  5IIO A;  5KFB A;  1EXN A;  4BWJ A;  2V4Q A;  3TAQ A;  1NK9 A;  1ZQH A;  2FPK A;  5L1I A;  5IIL A;  4JV1 A;  4EEY A;  4O3S A;  4QZE A;  7ICF A;  4EYH B;  4E0D A;  4KLT A;  1ZQI A;  1B43 A;  4F4Z A;  4K4H A;  3T5K A;  7ICR A;  1S10 A;  3HX0 A;  1A76 A;  4UAW A;  1U49 A;  4F93 B;  5J2B A;  5J2J A;  4I29 A;  9ICI A;  3N97 B;  2PFN A;  5HP4 A;  1NK0 A;  2Y1I A;  4KIT B;  3H8S A;  4PGQ A;  8ICZ A;  4B9N A;  5DG8 A;  5BPC A;  1XSN A;  1NK6 A;  5KG0 A;  4F5P A;  3EZ5 A;  4YVZ A;  4J9P A;  2FMP A;  1S0V A;  4R65 A;  4XUS A;  4B9S A;  4K4I A;  2JEF A;  1XSL A;  8ICM A;  8ICI A;  4YMO A;  1N56 A;  4QZC A;  4F4Y A;  2XCA A;  3THV A;  3PVX A;  4KTQ A;  3RBE A;  4ED8 A;  4I2D A;  1PZN A;  3UXN A;  3ZDD A;  5DDM A;  4I2C A;  4RZR A;  2JZB A;  4I2F A;  1KFS A;  2C2D A;  3PW4 A;  2W9A A;  1ZQO A;  4IRK A;  2W9B A;  3G6X A;  4O3O A;  4F4K A;  3PX0 A;  3ETL A;  3OHA A;  2FLL A;  4BXO A;  3KTQ A;  3PR5 B;  1LB2 B;  4GXI A;  4DOB A;  1RXW A;  2P6R A;  3LDA A;  8ICY A;  3RR8 A;  4UAZ A;  4TUR A;  4J9K A;  2VA2 A;  1XS9 D;  5DLF A;  3MR5 A;  4RQ6 A;  3EPG A;  3ORY A;  4YD1 A;  3UXP A;  5J0Q A;  2KZ3 A;  4B9U A;  4NM2 A;  3N4M B;  4FS1 A;  2FLN A;  1COO A;  3M8S A;  4Z6F A;  4PHE A;  4QWE A;  3MGI A;  4EBC A;  1ZQM A;  1QSL A;  5KT3 A;  4DL5 A;  1B22 A;  5KFQ A;  7ICK A;  7ICT A;  2ZUC A;  5HML A;  5KFU A;  9ICN A;  2XGP A;  5IIK A;  1QTM A;  4Q43 A;  5DB8 A;  3PY8 A;  3GIJ A;  1HUO A;  4QZH A;  4QWA A;  3H4B A;  2BCS A;  4C8M A;  4YG2 A;  4ECV A;  1TV9 A;  4JV2 A;  8ICG A;  2ZTC A;  5EWE A;  2XY6 A;  9ICB A;  2ISP A;  5CB1 A;  1H38 A;  1RZT A;  1CEZ A;  8ICO A;  4ED3 A;  7ICH A;  8ICP A;  1D9D A;  4B9L A;  3ZDE A;  3RR7 A;  3PV8 A;  3Q8M A;  4X5V A;  5KFL A;  2HHW A;  4XRH A;  5DB6 A;  3OJS A;  2ZJ8 A;  2C2E A;  3T5J A;  3QEA Z;  4BDP A;  4KLL A;  4M6W B;  4JK1 A;  2BCV A;  1ZQZ A;  2HHS A;  1SKW A;  4UB3 A;  1SZP A;  4O0I A;  2RDI A;  4DL3 A;  5BOM A;  3TFR A;  4DFJ A;  2AU0 A;  1X9W A;  1KSP A;  9ICW A;  2BKE A;  5L1J A;  1RPL A;  4M9J A;  4PHA A;  1S76 D;  4Z6E A;  5J2E A;  3RAQ A;  5KFS A;  3KHR A;  7ICS A;  1ZQJ A;  3QEB Z;  2ASD A;  3Q8Q B;  5EOZ A;  2BCR A;  1ZJM A;  3K75 D;  1T4G A;  2ZTE A;  5L1K A;  1ZQP A;  4KLG A;  3Q8P B;  4NLK A;  2PI5 A;  1TK5 A;  5JUM A;  5HHI A;  3H40 A;  3UPQ A;  1L3T A;  4TUP A;  3TAR A;  3ZDA A;  4F92 B;  1TAQ A;  4KLQ A;  1TKD A;  4QWC A;  2J6T A;  1MSW D;  3HP6 A;  5L1L A;  4ECS A;  1X9S A;  1L3S A;  8ICQ A;  3H8J A;  4UB4 A;  3MR6 A;  3KHG A;  3PNC A;  4MFA A;  3B0Y A;  3C23 A;  4Z6C A;  3Q8K A;  9ICK A;  3PMN A;  5KFE A;  2AQ4 A;  4MFF A;  1D9F A;  4M47 A;  1ZQK A;  2R8I A;  4TUS A;  8ICJ A;  4QZF A;  4YMN A;  4DSI A;  1T8E A;  3V6J A;  4DSF A;  1RYS A;  4RQ0 A;  4NLZ A;  4M9H A;  4RU9 A;  9ICL A;  2R8H A;  5DBC A;  1ZQL A;  3TFS A;  4IQW A;  3E2E A;  2IHM A;  4QZA A;  1XSP A;  4F2S A;  4PPX A;  4ED0 A;  4ECQ A;  2C22 A;  4YR2 A;  3C1Z A;  1TFR A;  8ICR A;  1S9F A;  4C8K A;  4DLG A;  3C2M A;  2KFZ A;  2MUT A;  4GC7 A;  4MF2 A;  2FPL A;  5DG7 A;  2ZTD A;  3RAX A;  4F91 B; 
#chains in the Genus database with same CATH topology
 2ZJ5 A;  2XY5 A;  2BGW A;  3C1Y A;  5ALS A;  4FS2 A;  4CCH A;  1K1S A;  3C2K A;  1N63 A;  4G9B A;  1ZQG A;  4QW9 A;  5T14 A;  1X42 A;  7ICU A;  3ED5 A;  5CEH A;  4I2H A;  3PW7 A;  1U48 A;  3B0X A;  1CUK A;  1ZQT A;  3SR6 A;  4DQS A;  3PML A;  1MQ2 A;  1NOM A;  3PW2 A;  4PZN A;  2BPF A;  4QZ8 A;  2MSN A;  4J03 A;  2IBK A;  1GO3 F;  5KT6 A;  3PO4 A;  5KFH A;  4MHV A;  1HJP A;  3HKZ C;  2ZXI A;  5KFO A;  2XCP A;  2MU2 A;  5IIJ A;  3RJH A;  4M6W A;  4ECY A;  4P4M A;  2C28 A;  4KLI A;  1S0N A;  3RJI A;  9ICF A;  8ICL A;  2A19 A;  5AI8 A;  8ICB A;  5KG4 A;  4I2G A;  4TUQ A;  3UQ2 A;  1KBU A;  3WKE A;  3QYP A;  3GFK B;  5ALM A;  5AKK A;  4Q44 A;  4QW8 A;  5ALD A;  2K4H A;  4OCZ A;  1RM6 C;  2KIC A;  3AUO A;  1ZQQ A;  4Y2S A;  3SV4 A;  3D2N A;  4YCX A;  2WHE A;  5J0R A;  2F1I A;  4LJX A;  3V7L A;  1UQV A;  5AKX A;  4NLB A;  2Y9T A;  3NTU A;  3PO5 A;  2K8B B;  3M9N B;  4YMM A;  9ICP A;  3K1R B;  2F1H A;  4P0P B;  3H4D A;  4IS7 A;  4BGD A;  2NRX A;  4F5Q A;  1PVQ A;  2A1A A;  4JB3 A;  5KG3 A;  3QUT A;  4ELT A;  5ALF A;  4PZO A;  4BWM A;  2H3F A;  1IXR A;  4EEL A;  4KMU A;  5JTI A;  2DFL A;  2WFA A;  3RH4 A;  4ELU A;  5A0L A;  1BGX T;  4C8N A;  2IHN A;  4UW9 A;  4EZ9 A;  1FIQ A;  4KLH A;  4C80 A;  1K5O A;  4USA A;  4EEK A;  3NVY A;  3MBY A;  3GV5 B;  5JU5 A;  5J0O A;  1IIP A;  1YZ7 A;  2KHV A;  1LV5 A;  2LHT A;  1WWV A;  4EBE A;  5DB7 A;  5III A;  3AN1 A;  9ICE A;  5J2D A;  4LVS A;  2AHO B;  4O3Q A;  3D2S A;  3KZX A;  3Q8L A;  4FBT A;  4Z6D A;  8ICA A;  4YP3 A;  2W43 A;  9ICA A;  2JH7 A;  1U4B A;  3QE9 Y;  9ICS A;  4C4S A;  1D8Y A;  1NK4 A;  2WF7 A;  4R63 A;  1UT8 A;  5KT7 A;  4G3I A;  1LKY B;  1S5L U;  1SL1 A;  9ICV A;  4J9S A;  1U47 A;  1HEK A;  1VLB A;  4BXO B;  3TAP A;  2BPC A;  5KFA A;  2HSZ A;  1CRX A;  4DL7 A;  1N5W A;  4O3N A;  3H8W A;  3DEE A;  3NRZ A;  3SAH A;  2KIV A;  4I28 A;  5KFT A;  1WCN A;  3NVZ A;  5ALG A;  1X2I A;  5AM4 A;  2BQ3 A;  5EWF A;  3RB3 A;  5AKY A;  8ICW A;  2PFQ A;  3KZI U;  1K1Q A;  2RDJ A;  4DSL A;  2KNJ A;  1URJ A;  2LPE A;  4FE3 A;  2BQR A;  4DL6 A;  3TI0 A;  3BS7 A;  5CA7 A;  4PGX A;  1M6Y A;  1QQ7 A;  5DQI A;  1SZH A;  2ODG A;  1T7P A;  7ICI A;  1U9L A;  2K60 A;  4QZ9 A;  4IR9 A;  1NK5 A;  2G5H B;  2FMQ A;  1ZQN A;  1ZQC A;  5KFG A;  5KFD A;  1JRO A;  4RPX A;  3H7I A;  5AK4 A;  2ZUB A;  2F76 X;  5KL1 B;  4NY8 A;  4J9Q A;  2Y1J A;  1ECW A;  5AKI A;  3M6K A;  2HHQ A;  3KKA A;  4KLU A;  1X6I A;  2FMS A;  3JPN A;  5KG2 A;  1OW5 A;  2YB1 A;  3KHH A;  1ZET A;  2RRD A;  1PUZ A;  5HMM A;  2BR0 A;  1ZQX A;  1O03 A;  1ZQD A;  2G0A A;  2FI1 A;  3RTV A;  4I2J A;  5J0W A;  4ECR A;  4DSE A;  4XA5 A;  3AM9 A;  5KG1 A;  4M9N A;  8ICV A;  3I1Y A;  3ZD8 A;  4OO1 J;  3SEN A;  1BNO A;  3WK4 A;  2AJQ A;  1BPE A;  1JRP A;  1KQQ A;  3RRG A;  1ZQH A;  5IIL A;  5L1I A;  4O3S A;  4KLT A;  3ONN A;  2JV3 A;  1TE2 A;  5AM5 A;  3HX0 A;  4UAW A;  1A76 A;  4F93 B;  2JGA A;  2Y1I A;  3H8S A;  2F2A B;  5DG8 A;  5BPC A;  4QJF B;  4F5P A;  4J9P A;  2HI0 A;  1L8O A;  4R65 A;  2JMG A;  2F8L A;  1XSL A;  2O6K A;  4IL6 U;  4KTQ A;  3UXN A;  1PZN A;  3ZDD A;  4I2F A;  1KFS A;  4Y2P A;  1PK3 A;  2ZIX A;  3TAD A;  3PW4 A;  3ETL A;  3OHA A;  4CNQ A;  3PR5 B;  4GXI A;  1L7M A;  4UAZ A;  2VA2 A;  3L4P A;  5ALI A;  4Y2X A;  2KZ3 A;  5ALY A;  4QWE A;  4PHE A;  2GH1 A;  1T94 A;  1RDF A;  5HML A;  4Q43 A;  5DB8 A;  4QZH A;  3IV6 A;  2BCS A;  3PSF A;  1TV9 A;  2EAN A;  4JV2 A;  1SXD A;  3AQE A;  3RF9 A;  1RZT A;  1J97 A;  4ED3 A;  3DDH A;  2ZJ8 A;  2C2E A;  4BDP A;  2JRZ A;  4FFD A;  1ZQZ A;  1SZP A;  3TFR A;  4NV0 A;  2WF8 A;  3RAQ A;  4EX6 A;  5KFS A;  2EZX A;  1ZQJ A;  1RYU A;  3CW2 C;  3Q8Q B;  2H3Z A;  5L1K A;  5E79 U;  5G5G A;  2HOQ A;  1IG6 A;  1X40 A;  3ZDA A;  4KLQ A;  8ICK A;  1TKD A;  2J6T A;  1MSW D;  1X9S A;  3WKD A;  3PNC A;  3C23 A;  3Q8K A;  4MFF A;  5GTH U;  2R8I A;  8ICJ A;  2HBL A;  5ALX A;  4UAV A;  1SXE A;  1ZRN A;  4NLZ A;  3FM9 A;  2OHF A;  2NO5 A;  4PL2 A;  3TFS A;  2MA1 A;  1XSP A;  4PPX A;  2C22 A;  2RHF A;  3F2B A;  3NAS A;  2LMR A;  2ASJ A;  4EZ6 A;  1RQL A;  5DG9 A;  2LYB A;  1NKC A;  1V9P A;  2QKQ A;  3V6H A;  5DQG A;  7ICO A;  3V72 A;  4MF8 A;  2ZUD A;  1C7Y A;  4EYI B;  5B5E U;  3L5K A;  4I2A A;  3GII A;  3E0F A;  8ICT A;  1JAL A;  2DWQ A;  2PMZ C;  4IRD A;  2A1J B;  1NK8 A;  4ED7 A;  1QCK A;  4UAY A;  3GV8 B;  3IM1 A;  1O08 A;  3OSN A;  5ALT A;  2BCU A;  3UMG A;  4PJ0 U;  3V7J A;  1DGS A;  4YXM A;  4R8U B;  4CE6 A;  5J0Y A;  4KN4 A;  2K4I A;  2IMW P;  1S77 D;  4UAS A;  3A0H U;  3WK8 A;  2QB0 B;  3N7P D;  4UB2 A;  1F5S A;  4NLN A;  2F3N A;  2J6U A;  3IRU A;  1BPZ A;  2ZG6 A;  3RB6 A;  1WUD A;  3JPO A;  9ICJ A;  3GIK A;  4M9G A;  3IHQ B;  2NRT A;  2ZIW B;  3PR4 A;  3PX4 A;  4DS5 A;  4Y2J A;  1RQN A;  4GC6 A;  2W54 A;  1A0P A;  2DPJ A;  3QUB A;  3QNM A;  4RUA A;  1NKB A;  2KFN A;  2JR5 A;  8ICS A;  5KFI A;  4TQS A;  2FPM A;  1COK A;  3JPQ A;  5H2F U;  4R8U A;  4PHD A;  1S0O A;  2P66 A;  9ICQ A;  3GDX A;  3IDW A;  2QAR B;  3GZF A;  4P4O A;  5AK5 A;  1KFT A;  4RQ7 A;  3BDP A;  2C2R A;  4Y2Q A;  3T3F A;  2QLT A;  3QX7 A;  3AQF A;  2GWS A;  3QU9 A;  4QWB A;  5AIA A;  2HHX A;  4KLJ A;  3BQT A;  1KDH A;  2JEI A;  4KLE A;  1V85 A;  3SZ2 A;  4JMU A;  5ALL A;  1N2X A;  4M2Y A;  4NXZ A;  9ICX A;  3F2C A;  1ED1 A;  4B9M A;  1SWW A;  4UB1 A;  2KD1 A;  4RQ5 A;  4DLE A;  4QZB A;  1KLN A;  4P4P A;  3NRW A;  5B66 U;  3PSI A;  1ZJN A;  1ZD3 A;  1WWU A;  1KL9 A;  2AQ0 A;  8ICU A;  3EPI A;  4KX3 A;  2HBM A;  2VJ5 A;  3HPO A;  8ICE A;  1ZQV A;  4DQR A;  2JHD A;  1KRP A;  3HT3 A;  3K1Z A;  3BS5 A;  5DGA A;  4FZL A;  2NRZ A;  2YMQ A;  3WK7 A;  4R66 A;  2CPR A;  4DSJ A;  2G06 A;  2KZZ A;  2OCE A;  9ICH A;  2XO7 A;  5L9X A;  5EWG A;  1UT5 A;  3EWA A;  5KT4 A;  5J2H A;  3RRH A;  5ALR A;  5J0T A;  4UBC A;  4YN4 A;  2LBO A;  4RQ2 A;  2R8G A;  3CRX A;  3UM9 A;  5KFP A;  4UQG A;  5CP2 A;  4PH5 A;  5KFK A;  1BPY A;  2YQE A;  1SKS A;  3SV3 A;  2M9N A;  4C4R A;  4C0Z A;  3M9O B;  3OGU A;  7ICL A;  1SL2 A;  5AK6 A;  1ZQA A;  3QU2 A;  4MEY A;  4UAR A;  2KJ9 A;  2HBK A;  5J2I A;  5AI4 A;  4TQR A;  4NJ8 A;  3MDA A;  3RB4 A;  4EBD A;  3BS5 B;  3C2L A;  1CI4 A;  2KKP A;  4I2I A;  5D46 A;  5CJ7 A;  1DXS A;  1JX4 A;  2W8L A;  4Y2R A;  4F5N A;  4DOC A;  2JEG A;  5HHH A;  2Q0Z X;  2KTQ A;  1X9M A;  4R64 A;  4I27 A;  1U45 A;  2DKX A;  1RXV A;  2RQ5 A;  4PHP A;  4C7Z A;  5DBB A;  1VDV A;  2IOH A;  4IRC A;  1UHU A;  2VKQ A;  2B6G A;  2WAQ C;  3BZK A;  4F2R A;  5DB9 A;  1Z00 A;  3C5F A;  2ZIW A;  1IM4 A;  4LZD A;  4NLC A;  1T3N A;  4JWM A;  2Z7J A;  4J9R A;  8ICN A;  1NZP A;  3WU2 U;  3T5L A;  3SAF A;  1F44 A;  2GO7 A;  4QIW C;  2YML A;  5KFY A;  3T79 A;  4DOA A;  2KSO A;  7ICN A;  3IN5 A;  1SGG A;  2P6U A;  2FE9 A;  3ZDC A;  3PW0 A;  1ZQY A;  3RJK A;  2G08 A;  4CRX A;  2K4P A;  3AU6 A;  4CF4 A;  1JUD A;  5AK3 A;  3OJU A;  4DFP A;  4O3M A;  4F3O A;  1UCV A;  3TQ1 A;  1L3V A;  2H3V A;  4JV0 A;  1PVP A;  5KTQ A;  9ICU A;  3GQC A;  1TAU A;  4KMO B;  3FDS A;  5KFB A;  1EXN A;  2V4Q A;  1FO4 A;  3N28 A;  4QIW F;  3AL0 B;  4F4Z A;  4K4H A;  7ICR A;  3E58 A;  5AKL A;  5K4L A;  2KSO B;  2Y0S C;  4I29 A;  5J2J A;  1X6J A;  2PFN A;  5HP4 A;  2NO4 A;  2QAR A;  4B9N A;  1PK1 A;  5KG0 A;  3EZ5 A;  1S0V A;  1XNS A;  2I5H A;  4B9S A;  4K4I A;  8ICM A;  4CDG A;  8ICI A;  4YMO A;  2ZXH A;  4I2D A;  5DDM A;  4I2C A;  4RZR A;  2JZB A;  3QU4 A;  2W9A A;  1ZQO A;  4IRK A;  2B0C A;  2E3T A;  3PX0 A;  4F4K A;  2BDU A;  2YB4 A;  2CXY A;  1RXW A;  4ACO A;  4TUR A;  4J9K A;  5DLF A;  3ORY A;  3UXP A;  5J0Q A;  4FS1 A;  4US8 A;  1B22 A;  3TKA A;  4CGZ A;  7ICK A;  9ICN A;  2QB1 A;  3PY8 A;  3GIJ A;  3C28 A;  1HUO A;  4C8M A;  4ECV A;  2ISP A;  5CB1 A;  8ICO A;  7ICH A;  1D9D A;  3ZDE A;  3RR7 A;  2HHW A;  3Q8M A;  5KFL A;  4XRH A;  3T5J A;  2R18 A;  3PSP A;  2G5I B;  4DFJ A;  2AU0 A;  1A6S A;  1X9W A;  2ESE A;  1KSP A;  2BKE A;  4U6P A;  2RP5 A;  5L1J A;  3I76 A;  4Z6E A;  1SIJ A;  1PVR A;  3KHR A;  4US9 A;  1ZQ1 C;  1QH9 A;  4ICA A;  5EOZ A;  5KAF U;  2CRX A;  3H0L B;  3H0M B;  3Q8P B;  1TK5 A;  5JUM A;  5F3X B;  3UPQ A;  3TAR A;  3S6J A;  1DK2 A;  4F92 B;  4ECS A;  1L3S A;  5EE3 A;  3H8J A;  3KHG A;  4P0Q A;  3MR6 A;  4MFA A;  1NZB A;  3PMN A;  2AQ4 A;  2AH5 A;  4QZF A;  3SD7 A;  4YMN A;  1MA7 A;  2W04 A;  2XID A;  4WJ3 B;  5ALP A;  1V38 A;  4ECQ A;  8ICR A;  4C8K A;  4DLG A;  4DFD A;  2KFZ A;  1VJ5 A;  4MF2 A;  5KFX A;  3OSP A;  5KG6 A;  1MN8 A;  3JPR A;  8ICC A;  3MGH A;  4J9L A;  2R8K A;  5J0P A;  3M8R A;  2KN7 A;  2R8J A;  3JPP A;  4M04 A;  4RUC A;  3A0B U;  1RYR A;  4Q8F A;  4J9N A;  1L7P A;  3TAN A;  3Q8R B;  2K4E A;  1XWL A;  2DUY A;  4IQV A;  4OJP A;  4QZD A;  2KZM A;  3M1Y A;  5AI6 A;  2DQN B;  2UVV A;  1BNP A;  4O9M A;  1N60 A;  3D2Q A;  3RB0 A;  4GXK A;  4GLX A;  3WK9 A;  2OYY A;  2H3Q A;  4F50 A;  1ZD4 A;  2B21 A;  3RJF A;  5AHX A;  1BPD A;  5EE0 A;  3KOO A;  3BQ2 A;  3PX6 A;  4IQT A;  2KKV A;  3BJY A;  5KFM A;  4KLO A;  1Q46 A;  4C4T A;  1HIW A;  1L7N A;  5JRT A;  2HHT A;  1S97 A;  3OHB A;  2V9W A;  1Z3E B;  3LVV A;  3WKA A;  5DBA A;  4RQ3 A;  2BCQ A;  4O3P A;  5ALV A;  4C8L A;  3JPT A;  4DQI A;  4KN7 A;  1WCL A;  2LKY A;  3CYM A;  3KHL A;  2NRV A;  5ALO A;  2HHU A;  2XC9 A;  2HVI A;  2VA8 A;  4DFM A;  3AEV A;  3AU2 A;  3PW5 A;  3G6V A;  2PXI A;  5J2K A;  2PKE A;  1X9X A;  1Z1V A;  1OXJ A;  4RNO A;  5J8Y C;  2W9C A;  1PK1 B;  3ZDB A;  4DWI A;  5AIC A;  4DEZ A;  1L8L A;  3R9K A;  4FZN A;  9ICO A;  8ICF A;  4YXJ A;  2XI9 A;  4PGY A;  1ZQB A;  3GIM A;  1P7D A;  2NV3 A;  5AI9 A;  3ISB A;  1UPH A;  2HHV A;  2ZJA A;  3ISC A;  1ZQS A;  3SQI A;  3IP4 B;  5J2G A;  4RT3 A;  2V4R A;  2KE7 A;  2YX8 A;  9ICG A;  1JXE A;  2A3V A;  3ISD A;  2W3S A;  1ZQW A;  5KFJ A;  4FO6 A;  7ICM A;  2BQU A;  2KHQ A;  4F5R A;  4C8O A;  3RH6 A;  3M9M B;  8ICX A;  1ZYQ A;  3EUB 2;  3ETR A;  4DSK A;  2KMD A;  3T5H A;  4YR3 A;  2MUT B;  7ICP A;  3GIL A;  2XVT A;  2BHN A;  2AXT U;  4ECU A;  4GIB A;  5D4B A;  5AM3 A;  3NVV A;  3KKA C;  4ECX A;  2P35 A;  3MR3 A;  4AYB F;  4NM1 A;  4RPZ A;  1KEJ A;  3U26 A;  3MC1 A;  3BQ0 A;  4NL9 C;  2FLP A;  2AGP A;  4A8E A;  1D8B A;  4QNL A;  4YQW A;  5ALN A;  2K89 A;  4BX9 C;  4F4X A;  1JN3 A;  5G5H A;  3QZ7 A;  1SL0 A;  3ICX A;  2PFP A;  2JXJ A;  9ICC A;  4K4G A;  5KFN A;  4U7C A;  2KJ5 A;  3QXG A;  2LYA A;  2I6X A;  4KLF A;  4XQ8 A;  1L5U A;  2DBY A;  3WK6 A;  4QZG A;  5IIN A;  5BOL A;  1S0M A;  1DK3 A;  3L3F X;  1WG8 A;  4UB6 U;  3RBD A;  5ALH A;  4F8R A;  4ELV A;  5J2C A;  4DF8 A;  5EE1 A;  1TK0 A;  1FFU A;  1N62 A;  2WB1 C;  5AI5 A;  4CF5 A;  1KN5 A;  2KV2 A;  1LVH A;  4MFC A;  1XU4 A;  1NK7 A;  2W3R A;  1L7O A;  5KT5 A;  2VJ4 A;  2EDU A;  2YMM A;  5KFV A;  9ICM A;  5HR7 A;  3HWT A;  3RH5 A;  9ICR A;  1Q8K A;  2A1J A;  4B6J A;  3SI8 A;  4J9M A;  4J9O A;  2UVW A;  3UXO A;  1KFD A;  1JIH A;  4RNM A;  3C5G A;  2HOI A;  2EQY A;  3QUQ A;  3GV7 B;  4BUG A;  2N1R A;  2QB0 A;  5DKW A;  5IIM A;  4Q8E A;  2OM6 A;  5CRX A;  1X66 A;  1ARO P;  4RQ1 A;  2G07 A;  3RJE A;  4CF3 A;  3V7K A;  4DL4 A;  4KLD A;  2BPG A;  5J0X A;  1JMS A;  2ZIV B;  1J2N A;  5D49 A;  2KK0 A;  3D6J A;  5F9N A;  2W03 A;  2W9C B;  2ZIU A;  2MAX A;  2IOF K;  2HCF A;  4P0Q B;  1Z4O A;  3HRD D;  4ED2 A;  3LWL A;  4GFJ A;  1SB3 C;  3IG5 A;  3F5E A;  3TAQ A;  7ICF A;  1DGJ A;  3OPX A;  4EEY A;  2HMX A;  1ZQI A;  2ZIU B;  1U49 A;  9ICI A;  1NK0 A;  3CP8 A;  4PGQ A;  8ICZ A;  2FDR A;  3NUQ A;  4RQM A;  2JH1 A;  2HBJ A;  4XUS A;  4QZC A;  1SV4 A;  3KD3 A;  3PVX A;  3RBE A;  2W9B A;  3G6X A;  2DL0 A;  4BXO A;  3KTQ A;  2P6R A;  2E1E A;  3RR8 A;  3MR5 A;  2W7P A;  4YD1 A;  4B9U A;  4NM2 A;  3N4M B;  1COO A;  4F71 A;  3M8S A;  5KT3 A;  5KFQ A;  3UMC A;  7ICT A;  5KFU A;  2XGP A;  5IIK A;  1QTM A;  1Z1B A;  3ALR A;  4QWA A;  8ICG A;  2ZTC A;  2XY6 A;  2WAQ F;  1H38 A;  3PV8 A;  4X5V A;  3QEA Z;  1SKW A;  4O0I A;  5BOM A;  9ICW A;  2KVC A;  4M9J A;  1N5X A;  5J2E A;  1Z19 A;  2EAM A;  3QEB Z;  2ASD A;  2BCR A;  3SEI A;  4KLG A;  4NLK A;  2PI5 A;  1SWV A;  3QU5 A;  2KP7 A;  1TAQ A;  1ZXI A;  4QWC A;  4UB4 A;  1T3Q A;  3CNH A;  2D6F C;  3N7R C;  4Z6C A;  5KFE A;  4PL1 A;  1D9F A;  1ZQK A;  4DSI A;  4DSF A;  2G09 A;  2DF4 B;  4RU9 A;  2R8H A;  5DBC A;  2EZZ A;  4IQW A;  1B4F A;  4QZA A;  4YR2 A;  3C1Z A;  1TFR A;  2Y0S F;  3MGV A;  1S9F A;  3C2M A;  5AKE A;  2FPL A;  5DG7 A;  3RAX A;  4F91 B;  2IOF A;  4IQU A;  4GXJ A;  1NNL A;  2E5S A;  1F0M A;  5J2F A;  2F8K A;  2ISO A;  1Q3U A;  4Y2U A;  1XO0 A;  1NI3 A;  4Y2T A;  1BVS A;  2ZIX B;  2NYV A;  2W9B B;  3FC4 A;  5KFZ A;  4UAU A;  3LWM A;  3N7S C;  4F5O A;  1UA0 A;  5CR0 A;  2D3D A;  3MFI A;  5KL8 B;  7ICJ A;  2EAP A;  2KG5 A;  1LKY A;  2OXO A;  4ED6 A;  3MDC A;  1L3U A;  2H5X A;  5F9L A;  4UBB A;  3V6K A;  2PI4 A;  1UA1 A;  3ZD9 A;  3RFA A;  1KTQ A;  5KG5 A;  1IV8 A;  2JZB B;  2LM4 A;  4DCC A;  1ZQE A;  2HW3 A;  4O5E A;  2DKZ A;  3WKC A;  3RJJ A;  4B9V A;  1KW4 A;  4EEN A;  1N48 A;  2UVR A;  2F44 A;  4UAT A;  4RT2 A;  5FP0 A;  5KFF A;  4RNN A;  2UVU A;  3EYZ A;  2BDP A;  4B9T A;  2IA6 A;  5HR6 A;  3SAG A;  3M7D A;  2WTF A;  1SKR A;  1ZQR A;  5CHG A;  4RQN A;  3HW8 A;  4MEX A;  1QLN A;  3O0F A;  3LK9 A;  4ZH4 A;  5C0Y A;  4RQ4 A;  4ED1 A;  5ALK A;  2K8A A;  5KG7 A;  2LYH A;  1Z00 B;  5L1M A;  2ALZ A;  2NRW A;  2RLT A;  1BPB A;  5J29 A;  4ZOH C;  2VAN A;  7ICE A;  1KKX A;  5KFW A;  4I2B A;  5J8Y A;  4ECT A;  3MR2 A;  8ICH A;  3HIL A;  4RQ8 A;  1NKE A;  3RJG A;  1JI7 A;  1DOQ A;  3B9J A;  2KOB A;  2WB1 F;  5TZV A;  2E8P A;  3DV9 A;  3LVW A;  3WKB A;  3OTQ A;  3SMV A;  4ECW A;  1QSS A;  4DS4 A;  5DLG A;  2KIW A;  1NJW A;  3NS1 A;  1OUQ A;  1FFV A;  3BZC A;  1NJX A;  4FBU A;  3C29 A;  2PFO A;  3KBB A;  3HKZ F;  5DGB A;  2W7O A;  3C21 A;  2WF5 A;  4I2E A;  4O5C A;  2DPI A;  2GOL A;  4M0A A;  3Q8S B;  4O5K A;  1TAM A;  4LZG A;  1SV0 A;  5AM2 A;  3M6Z A;  4OJL A;  5AKZ A;  2L5Y A;  1MC8 A;  2AGO A;  3UQ0 A;  1QSY A;  1BPX A;  1C20 A;  4JUZ A;  1ZQF A;  4KLM A;  2WF6 A;  5C5J A;  5J0U A;  3G6Y A;  4Y2V A;  4DFK A;  3PST A;  2XY7 A;  4F4W A;  3EW9 A;  4Y2Y A;  2ATL A;  2HDO A;  4OJO A;  5TIS U;  4AYB C;  4UB5 A;  1ZQU A;  2HVH A;  3WK5 A;  4IR1 A;  9ICT A;  1XC9 A;  2VIX A;  4DL2 A;  1Q3V A;  3SYZ A;  2XGQ A;  4DO9 A;  2OH2 A;  3F2D A;  4KLS A;  4P2H A;  3FAH A;  2JEJ A;  2ASL A;  1J2M A;  3H8M A;  7ICQ A;  5AI0 A;  1TVA A;  3MFH A;  1Y88 A;  3NVW A;  5DDY A;  3PZP A;  1QQ6 A;  1D8L A;  3F53 A;  5KFR A;  4ECZ A;  7ICV A;  3VCB A;  1N61 A;  5ALJ A;  2KJ8 A;  5AIB A;  4DQP A;  3QZ8 A;  5AM0 A;  3BQ1 A;  2W55 A;  2W8K A;  3TAC B;  4FZM A;  2E8N A;  3GU3 A;  4YR0 A;  1NJZ A;  1AQ6 A;  1SV0 C;  5KNI A;  4YFK A;  2EZY A;  2KVS A;  3MAB A;  4QZI A;  3KFU F;  2W9M A;  4DF4 A;  4C7Y A;  4DQQ A;  2MRL A;  1XO1 A;  1NJY A;  3FYH A;  1V97 A;  2I1Q A;  1A77 A;  4QWD A;  5KT2 A;  1YT3 A;  2KEY A;  4M9L A;  3JPS A;  1HUZ A;  5DQH A;  2XIC A;  2YMP A;  1DRG A;  5HNK A;  1RG6 A;  1MQ3 A;  4NL9 A;  1L6N A;  2DGZ A;  4HAI A;  2AGQ A;  5KFC A;  5CWR A;  3K4G A;  5AKH A;  1JXL A;  4Q45 A;  4YD2 A;  2F1J A;  2YY6 A;  5GTI U;  2I9G A;  2J6S A;  5ALZ A;  5J2A A;  2VA3 A;  2CN1 A;  1TK8 A;  3VC8 A;  2PMZ F;  4JWN A;  4O3R A;  2GLE A;  3F5A A;  3NGD A;  5J0S A;  4RPY A;  7ICG A;  5ALQ A;  4HYK A;  4NWI A;  3I28 A;  2Y9U A;  2OWO A;  4NLG A;  1ZD2 P;  3LYS A;  5IIO A;  3QU7 A;  4BWJ A;  4IC9 A;  1ZOL A;  1NK9 A;  5ALE A;  2FPK A;  4JV1 A;  4QZE A;  4OD0 A;  4EYH B;  4E0D A;  1B43 A;  1FEZ A;  3T5K A;  2FJ6 A;  1S10 A;  2HOF A;  3TAD C;  2E8M A;  2EH9 A;  5J2B A;  3N97 B;  5KAI U;  2K8C B;  4KIT B;  2M0N A;  1XSN A;  1NK6 A;  4P0P A;  2W11 A;  4YVZ A;  2FMP A;  4OJ6 A;  1B0X A;  2LM1 A;  5ALU A;  2JEF A;  2YN4 A;  1N56 A;  3ZI4 A;  4F4Y A;  2XCA A;  3THV A;  4ED8 A;  2ZIV A;  2C2D A;  4O3O A;  3HJE A;  1Z4N A;  2FLL A;  4EX7 A;  1LB2 B;  4DOB A;  3LDA A;  8ICY A;  2EAO A;  1YZ6 A;  1XS9 D;  4RQ6 A;  3EPG A;  1QQ5 A;  2E8O A;  1ZD5 A;  2FLN A;  1ZQM A;  4Z6F A;  3MGI A;  4EBC A;  1QSL A;  4DL5 A;  2ZUC A;  2WF9 A;  3AMZ A;  3H4B A;  4YG2 A;  2OEH A;  5EWE A;  9ICB A;  1CEZ A;  8ICP A;  1WYG A;  4B9L A;  5DB6 A;  3OJS A;  4KLL A;  4M6W B;  4JK1 A;  4OJ5 A;  2BCV A;  2HHS A;  3BQ7 A;  4UB3 A;  4DL3 A;  2RDI A;  5EE9 A;  3QUC A;  5ALW A;  1RPL A;  4PHA A;  2F77 X;  5AM1 A;  2Q4T A;  1S76 D;  7ICS A;  3J81 j;  2D8C A;  1ZJM A;  3K75 D;  1T4G A;  2ZTE A;  1ZQP A;  5HHI A;  3H40 A;  2YTU A;  3IG8 A;  1L3T A;  4TUP A;  4UB8 U;  3HP6 A;  5L1L A;  8ICQ A;  1S8O A;  4AP9 A;  3B0Y A;  2E1F A;  9ICK A;  3H0R B;  4M47 A;  4KX5 A;  4F72 A;  4TUS A;  1T8E A;  2BZF A;  5AKG A;  3V6J A;  1RYS A;  2H3I A;  4RQ0 A;  4M9H A;  5AKJ A;  9ICL A;  4BJQ A;  1ZRM A;  1ZQL A;  2ES6 A;  3E2E A;  2IHM A;  3UMB A;  4F2S A;  4ED0 A;  2MUT A;  4GC7 A;  2ZTD A;  2LI6 A; 
#chains in the Genus database with same CATH homology
 5KFX A;  2ZJ5 A;  5DG9 A;  3OSP A;  5KG6 A;  2XY5 A;  2BGW A;  3JPR A;  1NKC A;  4IQU A;  3MGH A;  1V9P A;  4GXJ A;  8ICC A;  3V6H A;  5DQG A;  3C1Y A;  7ICO A;  4FS2 A;  4J9L A;  2R8K A;  4CCH A;  1K1S A;  5J0P A;  3C2K A;  3V72 A;  3M8R A;  5J2F A;  4MF8 A;  2KN7 A;  2ZUD A;  2ISO A;  1C7Y A;  3JPP A;  2R8J A;  4RUC A;  4M04 A;  1ZQG A;  4EYI B;  4QW9 A;  1RYR A;  4Q8F A;  4J9N A;  3TAN A;  3Q8R B;  1BVS A;  2W9B B;  4I2A A;  7ICU A;  3GII A;  5KFZ A;  3LWM A;  4F5O A;  4I2H A;  3PW7 A;  8ICT A;  1XWL A;  1UA0 A;  1U48 A;  3B0X A;  4IQV A;  1CUK A;  4QZD A;  5CR0 A;  1ZQT A;  3MFI A;  2KZM A;  4IRD A;  4DQS A;  2A1J B;  2UVV A;  1NK8 A;  7ICJ A;  4ED7 A;  3PML A;  1MQ2 A;  4O9M A;  4UAY A;  3GV8 B;  3IM1 A;  1NOM A;  3PW2 A;  2BPF A;  3OSN A;  4QZ8 A;  3RB0 A;  4ED6 A;  2BCU A;  3MDC A;  2IBK A;  3V7J A;  1L3U A;  5KT6 A;  4GXK A;  4GLX A;  3PO4 A;  2H5X A;  5KFH A;  1DGS A;  5F9L A;  4YXM A;  4UBB A;  4R8U B;  3V6K A;  4F50 A;  2PI4 A;  1HJP A;  1UA1 A;  5J0Y A;  3ZD9 A;  4KN4 A;  1KTQ A;  5KG5 A;  2IMW P;  2B21 A;  3RJF A;  1BPD A;  2JZB B;  1S77 D;  1ZQE A;  2HW3 A;  4UB2 A;  4O5E A;  5KFO A;  4NLN A;  2XCP A;  3RJJ A;  5IIJ A;  2J6U A;  3RJH A;  4M6W A;  1BPZ A;  4B9V A;  4ECY A;  3BQ2 A;  3PX6 A;  4IQT A;  4P4M A;  1N48 A;  2C28 A;  4KLI A;  3BJY A;  3RB6 A;  3JPO A;  1S0N A;  9ICJ A;  3RJI A;  3GIK A;  4M9G A;  9ICF A;  3IHQ B;  2NRT A;  5KFM A;  2UVR A;  4KLO A;  3PX4 A;  3PR4 A;  8ICL A;  4RT2 A;  5KFF A;  4DS5 A;  8ICB A;  1S97 A;  5KG4 A;  4RNN A;  4GC6 A;  2UVU A;  2HHT A;  3EYZ A;  4TUQ A;  4I2G A;  3UQ2 A;  2BDP A;  4B9T A;  2DPJ A;  3OHB A;  2V9W A;  2IA6 A;  3GFK B;  1Z3E B;  5DBA A;  2BCQ A;  4RQ3 A;  4Q44 A;  4O3P A;  4RUA A;  4QW8 A;  4C8L A;  3JPT A;  4DQI A;  1NKB A;  4KN7 A;  1ZQQ A;  3AUO A;  2KFN A;  2WTF A;  1SKR A;  1ZQR A;  5CHG A;  8ICS A;  3HW8 A;  3SV4 A;  4YCX A;  5KFI A;  1WCL A;  4TQS A;  4MEX A;  1QLN A;  2FPM A;  3LK9 A;  3KHL A;  5J0R A;  2NRV A;  2F1I A;  4ZH4 A;  3JPQ A;  3V7L A;  4RQ4 A;  4R8U A;  4PHD A;  4ED1 A;  1S0O A;  2P66 A;  2XC9 A;  2HVI A;  2VA8 A;  3GDX A;  4DFM A;  2HHU A;  9ICQ A;  3AU2 A;  3NTU A;  3PW5 A;  3PO5 A;  3M9N B;  3G6V A;  2PXI A;  4YMM A;  5J2K A;  9ICP A;  4RNO A;  5KG7 A;  2LYH A;  1Z00 B;  2ALZ A;  2F1H A;  2NRW A;  2W9C A;  1BPB A;  3ZDB A;  4DWI A;  5J29 A;  4P4O A;  3H4D A;  4DEZ A;  1KFT A;  4RQ7 A;  4BGD A;  2NRX A;  4F5Q A;  2VAN A;  3BDP A;  2C2R A;  5KG3 A;  3T3F A;  4ELT A;  8ICF A;  4YXJ A;  7ICE A;  9ICO A;  4BWM A;  1ZQB A;  4PGY A;  1IXR A;  5KFW A;  4I2B A;  4ECT A;  3MR2 A;  2GWS A;  4KMU A;  3GIM A;  4QWB A;  8ICH A;  4RQ8 A;  1NKE A;  2DFL A;  3ISB A;  3RH4 A;  3RJG A;  2HHV A;  4ELU A;  2ZJA A;  1DOQ A;  3ISC A;  1ZQS A;  2HHX A;  4KLJ A;  5TZV A;  3BQT A;  1BGX T;  1KDH A;  4C8N A;  2JEI A;  4KLE A;  4EZ6 A;  2IHN A;  4EZ9 A;  4ECW A;  5J2G A;  1QSS A;  3SZ2 A;  4DS4 A;  5DLG A;  4RT3 A;  2V4R A;  4M2Y A;  4KLH A;  9ICG A;  1NJW A;  4NXZ A;  1JXE A;  9ICX A;  1NJX A;  4FBU A;  3ISD A;  2PFO A;  1ZQW A;  5DGB A;  5KFJ A;  4FO6 A;  7ICM A;  3C21 A;  3MBY A;  4B9M A;  4I2E A;  4UB1 A;  3GV5 B;  4RQ5 A;  2BQU A;  4O5C A;  4DLE A;  2DPI A;  4F5R A;  4QZB A;  4C8O A;  3RH6 A;  3M9M B;  5J0O A;  1ZYQ A;  4M0A A;  8ICX A;  3Q8S B;  4P4P A;  1KLN A;  4DSK A;  4O5K A;  3T5H A;  4LZG A;  1ZJN A;  4YR3 A;  1LV5 A;  2MUT B;  7ICP A;  3GIL A;  4EBE A;  1MC8 A;  5DB7 A;  2BHN A;  5III A;  2AGO A;  3UQ0 A;  1QSY A;  1BPX A;  4ECU A;  9ICE A;  2AQ0 A;  5D4B A;  4JUZ A;  1ZQF A;  8ICU A;  5J2D A;  3EPI A;  4KLM A;  5C5J A;  5J0U A;  4LVS A;  3G6Y A;  4ECX A;  3HPO A;  3MR3 A;  8ICE A;  4DFK A;  2XY7 A;  4O3Q A;  3EW9 A;  4F4W A;  4NM1 A;  4RPZ A;  1ZQV A;  4DQR A;  1KRP A;  1KEJ A;  3HT3 A;  5DGA A;  3BQ0 A;  3Q8L A;  2FLP A;  4FBT A;  4Z6D A;  2NRZ A;  2ATL A;  2AGP A;  4YP3 A;  8ICA A;  4R66 A;  9ICA A;  4DSJ A;  1U4B A;  4UB5 A;  2KZZ A;  1ZQU A;  4YQW A;  5L9X A;  2XO7 A;  3QE9 Y;  5EWG A;  2ASJ A;  2HVH A;  9ICS A;  9ICH A;  1UT5 A;  1D8Y A;  4IR1 A;  9ICT A;  3EWA A;  1NK4 A;  5KT4 A;  5J2H A;  1XC9 A;  3RRH A;  4DL2 A;  8ICK A;  4F4X A;  1JN3 A;  5J0T A;  4UBC A;  4R63 A;  3SYZ A;  1UT8 A;  5KT7 A;  3QZ7 A;  2XGQ A;  4YN4 A;  1SL0 A;  4G3I A;  2PFP A;  4RQ2 A;  1SL1 A;  9ICV A;  4J9S A;  1U47 A;  2R8G A;  4BXO B;  4DO9 A;  5KFP A;  4UQG A;  3TAP A;  2BPC A;  5KFA A;  5CP2 A;  4KLS A;  9ICC A;  4P2H A;  4K4G A;  5KFN A;  2JEJ A;  2ASL A;  4DL7 A;  4O3N A;  7ICQ A;  4PH5 A;  5KFK A;  1BPY A;  3H8W A;  1TVA A;  3MFH A;  1Y88 A;  1SKS A;  4I28 A;  3SV3 A;  5KFT A;  2M9N A;  1WCN A;  5DDY A;  4KLF A;  1X2I A;  2BQ3 A;  4XQ8 A;  1L5U A;  5EWF A;  4QZG A;  3RB3 A;  5IIN A;  8ICW A;  2PFQ A;  3M9O B;  3OGU A;  1K1Q A;  5BOL A;  1D8L A;  5KFR A;  2RDJ A;  4ECZ A;  4DSL A;  7ICV A;  1S0M A;  7ICL A;  1SL2 A;  1ZQA A;  4MEY A;  3RBD A;  2BQR A;  5J2I A;  4TQR A;  4DL6 A;  4F8R A;  3TI0 A;  4DQP A;  3MDA A;  4ELV A;  5J2C A;  3RB4 A;  3QZ8 A;  3BQ1 A;  4EBD A;  3C2L A;  4DF8 A;  2W8K A;  5CA7 A;  1TK0 A;  4I2I A;  5D46 A;  5CJ7 A;  4PGX A;  1JX4 A;  2W8L A;  4F5N A;  4DOC A;  2JEG A;  5HHH A;  5DQI A;  2Q0Z X;  1T7P A;  4MFC A;  1XU4 A;  7ICI A;  1U9L A;  1NK7 A;  4YR0 A;  2KTQ A;  1X9M A;  1NJZ A;  4R64 A;  4I27 A;  1U45 A;  5KT5 A;  4YFK A;  1RXV A;  4QZ9 A;  4PHP A;  3MAB A;  4IR9 A;  4QZI A;  2W9M A;  5KFV A;  5DBB A;  4DF4 A;  9ICM A;  4DQQ A;  3HWT A;  3RH5 A;  1XO1 A;  1NJY A;  9ICR A;  1NK5 A;  2FMQ A;  4IRC A;  2A1J A;  1ZQN A;  1ZQC A;  5KFG A;  3FYH A;  3SI8 A;  2I1Q A;  4F2R A;  5KFD A;  5DB9 A;  4J9M A;  1A77 A;  4QWD A;  4RPX A;  1Z00 A;  5KT2 A;  3H7I A;  1IM4 A;  4LZD A;  3C5F A;  4J9O A;  1T3N A;  4JWM A;  2ZUB A;  3JPS A;  5DQH A;  4J9R A;  1HUZ A;  4M9L A;  2UVW A;  8ICN A;  5HNK A;  3UXO A;  1KFD A;  1MQ3 A;  4J9Q A;  4NY8 A;  2Y1J A;  3T5L A;  1JIH A;  4RNM A;  3C5G A;  2AGQ A;  5KFC A;  5KFY A;  5CWR A;  3K4G A;  1JXL A;  4DOA A;  2HHQ A;  4KLU A;  7ICN A;  2P6U A;  3GV7 B;  2FMS A;  4Q45 A;  4YD2 A;  2F1J A;  3ZDC A;  3JPN A;  3PW0 A;  1ZQY A;  3RJK A;  5DKW A;  5IIM A;  5KG2 A;  3KHH A;  2I9G A;  2J6S A;  4Q8E A;  1ZET A;  5HMM A;  3AU6 A;  1ARO P;  5J2A A;  1ZQX A;  4RQ1 A;  2BR0 A;  1ZQD A;  2VA3 A;  3RJE A;  3V7K A;  1TK8 A;  4DL4 A;  4KLD A;  2BPG A;  3OJU A;  5J0X A;  1JMS A;  3RTV A;  4JWN A;  4I2J A;  5D49 A;  5J0W A;  4O3R A;  5F9N A;  2W9C B;  4ECR A;  4DFP A;  3NGD A;  4DSE A;  4F3O A;  4XA5 A;  5J0S A;  4RPY A;  2MAX A;  7ICG A;  5KG1 A;  4M9N A;  3TQ1 A;  8ICV A;  1L3V A;  4HYK A;  4JV0 A;  3ZD8 A;  5KTQ A;  9ICU A;  2AJQ A;  1BPE A;  3GQC A;  2OWO A;  4NLG A;  1TAU A;  4ED2 A;  3LWL A;  3RRG A;  3FDS A;  5IIO A;  5KFB A;  1EXN A;  4BWJ A;  2V4Q A;  3TAQ A;  1NK9 A;  1ZQH A;  2FPK A;  5L1I A;  5IIL A;  4JV1 A;  4EEY A;  4O3S A;  4QZE A;  7ICF A;  4EYH B;  4E0D A;  4KLT A;  1ZQI A;  1B43 A;  4F4Z A;  4K4H A;  3T5K A;  7ICR A;  1S10 A;  3HX0 A;  1A76 A;  4UAW A;  1U49 A;  4F93 B;  5J2B A;  5J2J A;  4I29 A;  9ICI A;  3N97 B;  2PFN A;  5HP4 A;  1NK0 A;  2Y1I A;  4KIT B;  3H8S A;  4PGQ A;  8ICZ A;  4B9N A;  5DG8 A;  5BPC A;  1XSN A;  1NK6 A;  5KG0 A;  4F5P A;  3EZ5 A;  4YVZ A;  4J9P A;  2FMP A;  1S0V A;  4R65 A;  4XUS A;  4B9S A;  4K4I A;  2JEF A;  1XSL A;  8ICM A;  8ICI A;  4YMO A;  1N56 A;  4QZC A;  4F4Y A;  2XCA A;  3THV A;  3PVX A;  4KTQ A;  3RBE A;  4ED8 A;  4I2D A;  1PZN A;  3UXN A;  3ZDD A;  5DDM A;  4I2C A;  4RZR A;  2JZB A;  4I2F A;  1KFS A;  2C2D A;  3PW4 A;  2W9A A;  1ZQO A;  4IRK A;  2W9B A;  3G6X A;  4O3O A;  4F4K A;  3PX0 A;  3ETL A;  3OHA A;  2FLL A;  4BXO A;  3KTQ A;  3PR5 B;  1LB2 B;  4GXI A;  4DOB A;  1RXW A;  2P6R A;  3LDA A;  8ICY A;  3RR8 A;  4UAZ A;  4TUR A;  4J9K A;  2VA2 A;  1XS9 D;  5DLF A;  3MR5 A;  4RQ6 A;  3EPG A;  3ORY A;  4YD1 A;  3UXP A;  5J0Q A;  2KZ3 A;  4B9U A;  4NM2 A;  3N4M B;  4FS1 A;  2FLN A;  1COO A;  3M8S A;  4Z6F A;  4PHE A;  4QWE A;  3MGI A;  4EBC A;  1ZQM A;  1QSL A;  5KT3 A;  4DL5 A;  1B22 A;  5KFQ A;  7ICK A;  7ICT A;  2ZUC A;  5HML A;  5KFU A;  9ICN A;  2XGP A;  5IIK A;  1QTM A;  4Q43 A;  5DB8 A;  3PY8 A;  3GIJ A;  1HUO A;  4QZH A;  4QWA A;  3H4B A;  2BCS A;  4C8M A;  4YG2 A;  4ECV A;  1TV9 A;  4JV2 A;  8ICG A;  2ZTC A;  5EWE A;  2XY6 A;  9ICB A;  2ISP A;  5CB1 A;  1H38 A;  1RZT A;  1CEZ A;  8ICO A;  4ED3 A;  7ICH A;  8ICP A;  1D9D A;  4B9L A;  3ZDE A;  3RR7 A;  3PV8 A;  3Q8M A;  4X5V A;  5KFL A;  2HHW A;  4XRH A;  5DB6 A;  3OJS A;  2ZJ8 A;  2C2E A;  3T5J A;  3QEA Z;  4BDP A;  4KLL A;  4M6W B;  4JK1 A;  2BCV A;  1ZQZ A;  2HHS A;  1SKW A;  4UB3 A;  1SZP A;  4O0I A;  2RDI A;  4DL3 A;  5BOM A;  3TFR A;  4DFJ A;  2AU0 A;  1X9W A;  1KSP A;  9ICW A;  2BKE A;  5L1J A;  1RPL A;  4M9J A;  4PHA A;  1S76 D;  4Z6E A;  5J2E A;  3RAQ A;  5KFS A;  3KHR A;  7ICS A;  1ZQJ A;  3QEB Z;  2ASD A;  3Q8Q B;  5EOZ A;  2BCR A;  1ZJM A;  3K75 D;  1T4G A;  2ZTE A;  5L1K A;  1ZQP A;  4KLG A;  3Q8P B;  4NLK A;  2PI5 A;  1TK5 A;  5JUM A;  5HHI A;  3H40 A;  3UPQ A;  1L3T A;  4TUP A;  3TAR A;  3ZDA A;  4F92 B;  1TAQ A;  4KLQ A;  1TKD A;  4QWC A;  2J6T A;  1MSW D;  3HP6 A;  5L1L A;  4ECS A;  1X9S A;  1L3S A;  8ICQ A;  3H8J A;  4UB4 A;  3MR6 A;  3KHG A;  3PNC A;  4MFA A;  3B0Y A;  3C23 A;  4Z6C A;  3Q8K A;  9ICK A;  3PMN A;  5KFE A;  2AQ4 A;  4MFF A;  1D9F A;  4M47 A;  1ZQK A;  2R8I A;  4TUS A;  8ICJ A;  4QZF A;  4YMN A;  4DSI A;  1T8E A;  3V6J A;  4DSF A;  1RYS A;  4RQ0 A;  4NLZ A;  4M9H A;  4RU9 A;  9ICL A;  2R8H A;  5DBC A;  1ZQL A;  3TFS A;  4IQW A;  3E2E A;  2IHM A;  4QZA A;  1XSP A;  4F2S A;  4PPX A;  4ED0 A;  4ECQ A;  2C22 A;  4YR2 A;  3C1Z A;  1TFR A;  8ICR A;  1S9F A;  4C8K A;  4DLG A;  3C2M A;  2KFZ A;  2MUT A;  4GC7 A;  4MF2 A;  2FPL A;  5DG7 A;  2ZTD A;  3RAX A;  4F91 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...