1COOA

The cooh-terminal domain of rna polymerase alpha subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Solution structure of the activator contact domain of the RNA polymerase alpha subunit.
pubmed rcsb
source organism Escherichia coli
molecule tags Nucleotidyl transferase
total genus 10
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 1995-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1cooA00
8ICZA 3EPIA 4F92B 2R8KA 5CWRA 5BPCA 5DLFA 3T5JA 4YFKA 3EYZA 3THVA 1ZQVA 1L5UA 4PH5A 3RH5A 1ZQPA 8ICKA 4R66A 3QE9Y 3Q8LA 4ECYA 1RXWA 5IIOA 3PR5B 1SL0A 1K1QA 5EOZA 4YN4A 5DDMA 4GLXA 4R64A 2RDJA 4QZIA 1ZQYA 3C21A 4KMUA 4DQRA 3GFKB 1JIHA 3H4DA 1JXLA 3PO5A 1U45A 4QZBA 4M9LA 4O3OA 1XO1A 1Z3EB 4NM1A 5DB9A 2BQRA 1MC8A 7ICQA 3KTQA 4MFAA 3ZDCA 4J9KA 2JZBA 4DL7A 4C8KA 3SI8A 4RPXA 3B0YA 2BQ3A 1D9FA 5DGBA 2PI5A 4YMNA 2P6RA 3UXOA 3PX6A 2FPMA 5J29A 4DQIA 1S10A 1HUOA 2KN7A 3HX0A 4UB2A 5HMMA 3IHQB 2VA3A 1BPXA 2FPKA 2J6TA 4EYIB 4QW8A 4M47A 3RJGA 5CA7A 1JN3A 4KITB 1NK6A 4GC6A 5DB6A 3PNCA 1Y88A 4P4OA 4I2GA 1D8YA 2PXIA 3OJSA 1TAQA 1QSSA 4Z6DA 1Z00B 2PFQA 4YMOA 2HHVA 9ICMA 4UB1A 4DEZA 5J2KA 1QSYA 1RPLA 1H38A 4O3PA 1WCLA 3BJYA 1TAUA 3EW9A 4YG2A 1ZJMA 4P4PA 1ZQFA 2FLNA 4JV2A 4P4MA 3OHAA 3M8RA 3MABA 3H8JA 4GC7A 1U48A 1TK0A 4DL4A 5KFYA 5JUMA 4IQWA 3MDCA 3NTUA 4YQWA 4R65A 2I9GA 4F5PA 4UBCA 1UT5A 5KFBA 4BGDA 1SZPA 2VA8A 7ICUA 1ZQOA 4JWMA 4XRHA 2ALZA 2AGQA 4MF8A 1KFSA 4J9QA 3ETLA 1U9LA 5KFRA 2UVWA 2W9BB 1T7PA 3RJEA 1BPEA 4RQ1A 3MGIA 3M8SA 2JEFA 4B9MA 4RZRA 3BDPA 2KFZA 3HP6A 3RJIA 3KHRA 4MFFA 2ZTEA 2W9CA 1AROP 1CUKA 7ICEA 4PGYA 3G6YA 3V7JA 3UPQA 4FO6A 3RTVA 3TFRA 2HHSA 3RB4A 7ICOA 2H5XA 3V7LA 2R8IA 4YCXA 1NK5A 1L3SA 3ISDA 2AJQA 4IRDA 3ZDBA 1WCNA 1NOMA 3UXNA 5KT6A 2ASLA 1NJXA 1BGXT 5KFQA 5HNKA 2W9MA 4QZDA 4QWCA 4DOCA 3RH4A 2BQUA 4DFJA 5D4BA 1ZQAA 3NGDA 4YVZA 3EWAA 4BWJA 3M9NB 3M9OB 4DOAA 5DLGA 4ED1A 4YXMA 2XY5A 2C22A 7ICGA 2XO7A 9ICGA 4QZEA 1PZNA 4QZAA 1U49A 4KN4A 2ZUDA 1ZQSA 9ICSA 5J0OA 9ICVA 1ZQWA 3AU2A 1T8EA 3JPQA 2NRXA 2AGPA 2MUTB 4PGQA 8ICEA 4RU9A 5DQIA 1XSPA 4O3QA 9ICJA 3PX4A 4DF4A 2IMWP 4QZGA 2MAXA 4TQRA 2DPIA 5KFJA 2XCPA 4O3NA 4DSFA 4DLEA 2JEGA 3LWLA 3AU6A 1NK7A 4IRKA 3PMLA 8ICQA 2F1HA 4M9NA 4O3SA 5KFOA 8ICGA 4F50A 8ICOA 1KSPA 4DWIA 4F4KA 3C1ZA 4R8UA 5J0WA 5KG1A 2FMPA 3RJJA 4DSLA 2JEIA 4M6WA 5J0RA 2BHNA 4QZCA 2P66A 2W8KA 5CP2A 3N97B 1D9DA 4KLHA 3V6JA 3QEAZ 4KLUA 1RYRA 1S97A 3T5HA 5DQHA 4J9LA 5DBAA 3JPSA 4YP3A 4F5RA 9ICKA 2AQ4A 5KFVA 4UAZA 4DO9A 4ECZA 7ICSA 4KLEA 4I2BA 4O5KA 1XS9D 3RB6A 5L1JA 8ICJA 2RDIA 1D8LA 1SKRA 4Q8FA 8ICMA 7ICTA 9ICPA 5L1KA 1K1SA 4Q8EA 4QZ9A 2BPFA 8ICAA 4NLKA 5KFFA 2C2RA 1TVAA 3K4GA 5CJ7A 2DPJA 4NLZA 5EWGA 4F3OA 4EBDA 3KHHA 4XQ8A 3OGUA 3PW2A 2NRTA 3GV8B 1ZQMA 4F2SA 1HUZA 4E0DA 4JWNA 8ICCA 1NK4A 4YR2A 5KFTA 3OSPA 2HVHA 3BQ2A 4DSJA 3H4BA 4B9NA 1ZQJA 1KRPA 2HHUA 1ZQDA 4K4IA 4UB4A 2KFNA 1ZQHA 4F4YA 3GILA 5KG4A 4EBEA 2I1QA 5D49A 4KLOA 4IQUA 4RPZA 3UQ2A 5KG7A 4ECRA 1NK8A 1SKSA 1NKEA 9ICUA 3MR2A 2ASJA 5L9XA 4Q43A 2AU0A 1ZYQA 4KLMA 1MQ2A 2BCQA 3T5LA 4DSKA 1ZQUA 2V4RA 8ICTA 4KN7A 3UXPA 4QWBA 3M9MB 2PFPA 1KEJA 3ISBA 1KFDA 1S76D 4J9OA 4KLFA 4LZGA 3V72A 1JXEA 5KFAA 5IILA 3C1YA 3FYHA 2F1JA 5CB1A 5KFHA 3SZ2A 2UVVA 4JV1A 4MEYA 4QW9A 1NKCA 4EYHB 1NJZA 1ZQLA 1RZTA 1MSWD 1HJPA 4DFMA 4QWEA 4I29A 5DQGA 2KZ3A 3MDAA 4DFPA 3Q8KA 3V7KA 5J2DA 4HYKA 1KDHA 1ZQIA 2PFOA 4ED3A 3RB0A 2AGOA 2ISPA 2Y1IA 3ZDDA 4B9LA 1L3TA 3JPRA 4ED6A 5J0QA 4YR0A 5DG9A 3OJUA 5J0UA 3ISCA 4ECSA 3RR7A 7ICFA 9ICQA 4ED2A 4DF8A 3HT3A 3RB3A 5HP4A 4JV0A 1Z00A 5J2BA 2HHXA 9ICBA 3H7IA 5CR0A 3C23A 2HW3A 7ICJA 5J0XA 4M9HA 3E2EA 2NRVA 2R8JA 4Z6FA 4RUAA 4DOBA 4RQ7A 4C8LA 3AUOA 4O9MA 8ICBA 8ICUA 4BXOB 1DGSA 3RRHA 2BGWA 5IIMA 1ZQQA 8ICRA 3Q8QB 2ZUBA 3G6VA 2BKEA 4JUZA 4B9VA 4RQ3A 5J2FA 2V9WA 4NLGA 4KLIA 2BCSA 3BQTA 5KG3A 5KT2A 1EXNA 2XCAA 3ORYA 4TUSA 3MR3A 4I2EA 4K4GA 1S77D 9ICRA 3ZD8A 2W9BA 4ECWA 5DG8A 8ICSA 4FS2A 4GXJA 2NRZA 3EPGA 2R8HA 3C2KA 1ZQEA 5DBCA 3H40A 5DG7A 3RRGA 3C5FA 7ICNA 3MGHA 4DS5A 3TQ1A 2ZTCA 2BR0A 4F8RA 3RR8A 1X9WA 5F9NA 5IIIA 5J0YA 4DQQA 4I2CA 5J0TA 3ZDAA 4EZ6A 1BPDA 8ICVA 4MEXA 5KFZA 1NK0A 9ICAA 3MBYA 4PHDA 2B21A 3GIJA 5J2IA 4FBTA 4O5EA 2C28A 4KLQA 3JPOA 7ICMA 9ICCA 4YXJA 3BQ1A 4Q45A 4ECQA 4GXKA 2UVUA 4M04A 5J2CA 9ICOA 4IQVA 2ATLA 3QEBZ 4KLSA 4Z6CA 2ZUCA 1XSNA 2BCRA 2ISOA 3ZD9A 1SL1A 4EEYA 4NLNA 4DQSA 2XY6A 4MFCA 5J2AA 5L1IA 2C2EA 1JMSA 2MUTA 3LK9A 2FMSA 9ICEA 4ECXA 5BOLA 2P6UA 4IR1A 4PPXA 1U47A 4F93B 1IM4A 1ZQXA 3JPTA 2IA6A 5HHIA 1XWLA 8ICYA 5C5JA 2JEJA 4DFKA 4RQ0A 1KFTA 4M9JA 4UAYA 2HVIA 2BPCA 3KHLA 3C5GA 4QWDA 3TARA 1ZQCA 1TK5A 2XGPA 1NKBA 4J9NA 4NXZA 3GIKA 3UQ0A 2LYHA 5BOMA 4PHAA 3MFHA 4YR3A 4FBUA 2KZZA 3RAQA 9ICHA 3ZDEA 4ED0A 5IIJA 7ICKA 4BDPA 2VANA 5D46A 3RBDA 4ECVA 4DSIA 3JPNA 5IINA 3PO4A 2KZMA 3PR4A 3B0XA 4ED8A 2HHQA 1A76A 2ZTDA 3K75D 2W9AA 4EBCA 2FMQA 4J9SA 3QZ8A 4RQ5A 4B9SA 4O0IA 4O3RA 3T5KA 1S9FA 1TK8A 1S0VA 4DQPA 1XSLA 4UQGA 1ZQGA 2PFNA 1XC9A 3RAXA 3PW7A 9ICTA 4UBBA 1UA1A 1BPBA 1TFRA 1LV5A 2BCVA 4QZHA 8ICXA 4F5NA 2XGQA 2V4QA 2ZJ5A 1IXRA 3PMNA 2ZJ8A 4B9UA 5DKWA 5DB8A 2BPGA 1BPZA 4RT3A 5HMLA 2JZBB 4F4ZA 4RQ2A 5EWFA 3V6KA 9ICWA 3TI0A 3TAQA 4I2AA 1TKDA 4M2YA 4X5VA 4DL3A 4CCHA 3QZ7A 3Q8SB 2Y1JA 1NJWA 1CEZA 3GIMA 3PVXA 5KG5A 1ZQKA 3IM1A 4TURA 3KHGA 3SYZA 8ICWA 2HHWA 2F1IA 2XY7A 2OWOA 8ICPA 3T3FA 3MR6A 3RBEA 2FLLA 4G3IA 1B43A 5KFEA 1C7YA 5EWEA 4KLGA 5L1LA 3GV5B 4RQ6A 2VA2A 5DBBA 3RJKA 3GDXA 2WTFA 3MFIA 2IHMA 4LZDA 1T4GA 2C2DA 7ICRA 2M9NA 2KTQA 4RNNA 1JX4A 4F4XA 5KFGA 5KG0A 5KT3A 3SV3A 5KT5A 4DL2A 7ICVA 1S0NA 4IRCA 3PW0A 3MR5A 5KFNA 3H8SA 4J9RA 4JK1A 1X9SA 5KFDA 3V6HA 2R8GA 4ELTA 4M9GA 1N56A 5IIKA 3PY8A 3OSNA 4FS1A 5J0SA 4ELUA 3PX0A 3LWMA 1DOQA 5KFSA 1COOA 4F4WA 4RUCA 4I28A 4NY8A 4PGXA 3BQ0A 4DL6A 1BPYA 5KTQA 4F5OA 1ZJNA 2J6SA 3HW8A 1S0MA 5KFCA 1U4BA 5KG6A 1LB2B 2UVRA 4MF2A 4XA5A 3Q8RB 2W9CB 1KLNA 3FDSA 4Z6EA 1ZQBA 1SKWA 5HHHA 4ED7A 2IBKA 1A77A 5DDYA 4RT2A 1T3NA 4BXOA 7ICLA 4YD1A 5KFXA 3TANA 9ICFA 2BDPA 3HWTA 1UT8A 4GXIA 4K4HA 4F2RA 4ELVA 4LVSA 8ICFA 7ICIA 2Q0ZX 4R63A 1BVSA 2FPLA 5KG2A 4TUPA 4F5QA 1ZETA 1ZQNA 9ICNA 4YD2A 2NRWA 4P2HA 1UA0A 4J9MA 3N4MB 4KLLA 5J2HA 4KLJA 3PV8A 4RQ4A 1NJYA 2AQ0A 2J6UA 3RJHA 3LDAA 4I2IA 3PW4A 5KT4A 4KLDA 1V9PA 5KFMA 4UAWA 1MQ3A 4I27A 1TV9A 2ASDA 2XC9A 4QWAA 2GWSA 3HPOA 5DB7A 5KFLA 9ICXA 5KFUA 4PHEA 4TUQA 3Q8PB 3GIIA 2W8LA 4ECTA 2FLPA 1NK9A 4O5CA 8ICIA 4DS4A 4Q44A 3RH6A 3GV7B 1L3UA 2A1JB 1X2IA 5TZVA 3C2MA 5KFKA 3Q8MA 9ICLA 4R8UB 4PHPA 5F9LA 5DGAA 1KTQA 4M6WB 1QSLA 4DLGA 3JPPA 4B9TA 1XU4A 2BCUA 1ZQZA 2HHTA 1RYSA 5CHGA 4TQSA 1S0OA 1X9MA 4RNOA 7ICHA 2A1JA 4ECUA 1N48A 4BWMA 4RNMA 4RQ8A 4QZ8A 1QLNA 4I2JA 5J2GA 3GQCA 4I2FA 4XUSA 9ICIA 4IR9A 2ZJAA 4UB3A 4C8MA 5J0PA 4DSEA 2IHNA 4ZH4A 3EZ5A 4KTQA 3OHBA 3G6XA 8ICNA 4DL5A 1L3VA 4KLTA 2DFLA 4QZFA 4RPYA 3PW5A 3RJFA 4J9PA 5KT7A 1B22A 1SL2A 4M0AA 3TFSA 1ZQRA 4I2HA 2PI4A 5KFIA 4C8OA 4C8NA 3H8WA 1ZQTA 4F91B 3C2LA 1RXVA 3TAPA 3SV4A 8ICHA 5J2JA 7ICPA 4YMMA 5KFWA 5KFPA 5J2EA 1QTMA 4I2DA 4NM2A 4EZ9A 4UB5A 4IQTA 8ICLA
chains in the Genus database with same CATH superfamily
3RFAA 3EPIA 5CWRA 1F44A 4R66A 1RXWA 3PR5B 1SL0A 5EOZA 3WK9A 4OCZA 2RDJA 3C21A 4KMUA 1XO1A 1Z3EB 5DB9A 1Z4NA 2BQRA 7ICQA 4DL7A 3QU7A 4KX3A 3B0YA 5K4LA 4ACOA 2W3RA 5HMMA 2FPKA 2J6TA 5CA7A 2HMXA 2FDRA 4P4OA 4I2GA 3NRZA 2F44A 4Z6DA 1Z00B 3WK4A 2LYAA 4DEZA 1RPLA 2WAQC 3NVYA 1WCLA 4EX6A 3BJYA 4OJOA 1ZQFA 2LMRA 2ZIWA 3SEIA 3H8JA 2DL0A 3NTUA 4YQWA 2I9GA 3AEVA 4UBCA 2ZIXA 4UB6U 4BGDA 1ZQOA 4JWMA 1ZD4A 4J9QA 1U9LA 1BPEA 4PL2A 1OUQA 2EZXA 4MFFA 2QB1A 5AKJA 3TFRA 3ALRA 3UPQA 3RTVA 3RB4A 2H5XA 2NO4A 1WCNA 1NOMA 1BGXT 4QZDA 5A0LA 4QWCA 4DOCA 2YB4A 1ZQAA 4YVZA 3ETRA 3EWAA 2XY5A 4YXMA 2C22A 2A1AA 4QZEA 2Y0SC 3D6JA 5J0OA 1T8EA 2QARB 3H8MA 4PGQA 1XSPA 4O3QA 5ALVA 4GFJA 4C7YA 2DPIA 4O3NA 3AU6A 4IRKA 4C7ZA 4M9NA 2W7PA 2K8CB 3BZKA 5EE1A 3C1ZA 4R8UA 5KG1A 1M6YA 2JEIA 4QZCA 4KLHA 1N61A 1UPHA 2W55A 2A3VA 4J9LA 5DBAA 4JMUA 4I2BA 4O5KA 1XS9D 5L1JA 8ICJA 4Q8FA 9ICPA 5ALEA 2OYYA 2HSZA 1K1SA 4Q8EA 5ALDA 2WF5A 4NLKA 1TVAA 4B6JA 3K4GA 5AK3A 5J8YC 3CRXA 1ZQMA 8ICCA 2DF4B 1NK4A 4YR2A 5KFTA 3H4BA 5ALXA 2EDUA 1ZQJA 1ZQDA 4F4YA 3GILA 5KG4A 5D49A 3WKCA 4KLOA 1NKEA 5L9XA 1MQ2A 3T5LA 3GZFA 8ICTA 1S76D 1D8BA 2K60A 4LZGA 2OXOA 3FYHA 1NI3A 1NKCA 2IOHA 1KBUA 1ZQLA 1N5WA 1HJPA 3MDAA 1L7MA 4HYKA 4ED3A 3ZDDA 5AM0A 1L3TA 2YQEA 3PSIA 4UAUA 5DG9A 3OJUA 3M1YA 3ISCA 4DF8A 3QUCA 5J2BA 1Z00A 2RRDA 1KN5A 2ZIVB 4RUAA 4DOBA 5ALOA 4C8LA 1JALA 3AUOA 4CNQA 1DGSA 5B5EU 8ICRA 2Y9UA 3KKAA 3G6VA 4JUZA 1T94A 2MRLA 5KT2A 4NJ8A 2XCAA 3MR3A 2EAOA 2IOFK 9ICRA 5DG8A 1KL9A 2R8HA 3EPGA 4KX5A 3C5FA 4CF4A 2BR0A 4F8RA 1V38A 1X9WA 5IIIA 4I2CA 3ZDAA 4MEXA 1IV8A 9ICAA 5KL8B 5ALSA 4ECQA 3IV6A 2UVUA 4M04A 5J2CA 9ICOA 4NLNA 2QARA 4MFCA 5L1IA 2FMSA 4PPXA 4F93B 1IM4A 2IA6A 2JEJA 3CW2C 4GIBA 2BPCA 2G5HB 5EE3A 3C29A 2LM1A 2LYHA 2H3FA 2KZZA 4FBUA 5IIJA 5AM2A 2PMZF 1A0PA 2E1FA 2VANA 5D46A 3RBDA 4BDPA 4DSIA 3PR4A 3QZ8A 1S9FA 2WF7A 1TE2A 1ZQGA 3S6JA 2PFNA 9ICTA 4UARA 5KNIA 1BPBA 1IXRA 5DB8A 2EQYA 4F4ZA 3DV9A 3TI0A 3TAQA 4I2AA 2Y1JA 1NJWA 3GIMA 5AKKA 1ZQKA 3HILA 3IM1A 4TURA 3SYZA 2DQNB 1PVRA 8ICPA 3MR6A 1B43A 1C7YA 2W54A 4DFDA 5DBBA 3RJKA 2KOBA 1WWVA 5C0YA 7ICRA 5G5GA 2KTQA 1JX4A 4F4XA 3WK8A 3PSFA 3SV3A 5KT5A 7ICVA 2KNJA 1RQLA 5KFNA 5KFDA 2K4HA 2R8GA 4ELTA 2JGAA 4ELUA 2XICA 4RUCA 3BQ0A 2CPRA 1DK2A 3QU4A 2WF8A 2WHEA 2UVRA 1KLNA 1ZQBA 5HHHA 3NRWA 4UATA 5DDYA 4Y2QA 3TANA 3A0HU 5KFXA 2HOIA 3HWTA 2KEYA 4IC9A 3QX7A 3ED5A 4R63A 1BVSA 2FPLA 4TUPA 4F5QA 3BS5B 1ZETA 9ICNA 2NRWA 3A0BU 2M0NA 4RQ4A 3RJHA 2J6UA 4I2IA 2KKVA 1JRPA 1MQ3A 1TV9A 5KFLA 5KFUA 4PHEA 3QXGA 3Q8PB 3GIIA 2CN1A 5FP0A 2W8LA 4DS4A 3PSPA 3GV7B 1J2MA 4O3MA 2N1RA 4NWIA 5KFKA 9ICLA 5DGAA 4IS7A 4M6WB 2HHTA 3JPPA 4B9TA 3QU9A 3UM9A 4ECUA 4BWMA 2G06A 4QZ8A 3GQCA 2W11A 4UB3A 2LPEA 4KLTA 4QZFA 4RPYA 5KT7A 1SL2A 3TFSA 4WJ3B 4NV0A 5KFIA 2WF6A 7ICPA 5J2EA 2LM4A 5KFPA 3NVVA 4EZ9A 4UB5A 5AKYA 5BPCA 5DLFA 1L5UA 3EYZA 1L6NA 1ZQVA 1X9XA 4ECYA 2I5HA 4U6PA 5DDMA 4GLXA 3H4DA 4NM1A 3AMZA 1MC8A 3KTQA 2VKQA 1L7PA 4MFAA 4C8KA 3SI8A 1D9FA 1J97A 3QUTA 2PI5A 2P6RA 3PX6A 1OXJA 2Y0SF 5J29A 4DQIA 1HUOA 4UASA 2KN7A 1BPXA 4FZLA 2ZIWB 4KITB 1NK6A 2QKQA 1Y88A 4YMOA 2HHVA 4UB1A 2JH1A 5J2KA 1QSYA 2PMZC 3EW9A 2BZFA 4CRXA 4JV2A 4P4MA 3M8RA 4GC7A 3KOOA 1U48A 2PKEA 4IQWA 3MDCA 1Q3VA 4R65A 1UT5A 5KFBA 7ICUA 4XRHA 4MF8A 1KFSA 3SENA 3ETLA 3M8SA 2JEFA 1IG6A 3WKDA 3BDPA 2KFZA 5ALHA 5AI4A 1AROP 7ICEA 3G6YA 4FO6A 7ICOA 1X66A 3V7LA 2R8IA 1NK5A 2KE7A 2K4IA 5ALNA 2E1EA 3AM9A 2ASLA 5KT6A 1NJXA 5HR7A 2OM6A 3BS5A 3L3FX 4DFJA 3NGDA 2EAPA 4DOAA 3M9OB 5DLGA 7ICGA 2XO7A 1PZNA 1SV0C 9ICSA 3AU2A 3JPQA 2NRXA 2MUTB 4RU9A 3PX4A 4DF4A 4P0QB 5B66U 4QZGA 5KFJA 5ALGA 2XCPA 8ICQA 3PMLA 8ICGA 2E8MA 8ICOA 3FAHA 5J0WA 3RJJA 1SWVA 4M6WA 5J0RA 5AKHA 5CEHA 5CP2A 3V6JA 2EAMA 4KLUA 3T5HA 5DQHA 2O6KA 3WK6A 3D2NA 2KHVA 2YMMA 3RB6A 1D8LA 8ICMA 1WUDA 3PZPA 3SAFA 2L5YA 4QZ9A 2BPFA 8ICAA 3F5AA 3VC8A 5KFFA 3N7PD 1ZD3A 1UHUA 2HVHA 4B9NA 1DGJA 1X6JA 1ZQHA 4EBEA 5ALFA 3SD7A 4IQUA 5KG7A 9ICUA 3SQIA 2F2AB 2AU0A 4KLMA 3QU2A 2AH5A 1ZQUA 2V4RA 4KN7A 3UXPA 1KEJA 5AKZA 3R9KA 4KLFA 3N28A 3PSTA 3F2CA 1JXEA 5KFAA 1KQQA 4JV1A 3FC4A 5AKIA 1ZRNA 4DFMA 3H0MB 5ALMA 5DQGA 4DFPA 3V7KA 3AQFA 2ISPA 1DK3A 2YTUA 2WF9A 2FE9A 2WB1C 1PVQA 7ICFA 2QLTA 3HT3A 3SAGA 3H7IA 5CR0A 2G5IB 1TAMA 5HR6A 4M9HA 1S8OA 3E2EA 4Z6FA 5ALUA 1VLBA 8ICUA 3RRHA 2BGWA 4Y2VA 3Q8QB 2MU2A 2XI9A 3OTQA 2DGZA 4B9VA 2KKPA 4NLGA 2JRZA 1P7DA 4US9A 5KG3A 2HOQA 3ORYA 2HBKA 3IP4B 4K4GA 1S77D 4FS2A 4OJPA 3C2KA 5DBCA 7ICNA 3MGHA 1ECWA 1L8LA 5J0YA 4EZ6A 8ICVA 1RG6A 1NNLA 3MBYA 1JROA 4KLQA 3HKZC 3JPOA 9ICCA 3NVWA 2KIVA 4Q45A 2YX8A 4IQVA 1FO4A 2ATLA 3QEBZ 3OPXA 4UW9A 3ZD9A 4EEYA 4ICAA 3QNMA 5J2AA 2C2EA 1JMSA 2MUTA 3MC1A 2P6UA 4IR1A 2F3NA 1U47A 4P0QA 1HIWA 3WKBA 5KAIU 5C5JA 3AQEA 3BQ7A 1FIQA 4QWDA 2XGPA 4J9NA 3UQ0A 1AQ6A 3MFHA 4YR3A 1ZD2P 3TKAA 4DCCA 1ZQ1C 4Y2XA 3JPNA 3PO4A 3AN1A 3SAHA 3WU2U 2ZTDA 2VJ5A 2FMQA 4B9SA 4RQ5A 1YT3A 4O0IA 3MGVA 1S0VA 4UQGA 1XC9A 3U26A 4UBBA 3KZIU 2LKYA 1XO0A 1LV5A 4QZHA 4PZOA 2XGQA 2V4QA 3F5EA 4UAVA 2LYBA 2VJ4A 1BPZA 2JZBB 4RQ2A 5EWFA 3V6KA 2JR5A 2LI6A 2WFAA 5AKGA 1WG8A 1WYGA 5EE9A 5ALZA 2YMPA 2F1IA 5F3XB 2FLLA 4KLGA 5L1LA 2VA2A 4OJ5A 3MFIA 1T4GA 2C2DA 4AYBF 2NV3A 5KFGA 3J81j 4PJ0U 1JI7A 4DL2A 3PW0A 3MR5A 4RQNA 1X9SA 3V6HA 1N56A 2W7OA 3OSNA 4FS1A 1DOQA 4F4WA 1ZJNA 2J6SA 5JTIA 1VJ5A 4CF5A 3Q8RB 3FDSA 4ED7A 2XVTA 2DUYA 1T3NA 4YD1A 2BDPA 1V85A 3QYPA 1PK1B 2F8KA 4K4HA 7ICIA 1LKYA 2H3VA 4YD2A 3F2DA 4J9MA 3N4MB 4KLLA 4KLJA 2AQ0A 3PW4A 4NL9A 4KLDA 4UAWA 2KIWA 2K4EA 4I27A 1N5XA 5GTHU 2XC9A 4QWAA 2D6FC 4OO1J 3HPOA 5DB7A 4TUQA 1J2NA 1Z19A 4G9BA 1NK9A 4O5CA 8ICIA 4CE6A 3E0FA 4U7CA 4PHPA 1QSLA 4DLGA 2BCUA 1ZQZA 1O08A 1RYSA 2H3QA 4RNOA 1X9MA 7ICHA 2W3SA 1N48A 3AL0B 3DEEA 1BNPA 4RQ8A 1N60A 5J2GA 1O03A 4XUSA 9ICIA 4IR9A 3IN5A 5J0PA 5AICA 1UCVA 4KTQA 5AKEA 1L3VA 2DFLA 3D2QA 2KVCA 1ZQRA 4I2HA 2K89A 5JRTA 2AHOB 3C2LA 3TAPA 8ICHA 4YMMA 5KFWA 1QTMA 4AP9A 1B0XA 4IQTA 1JUDA 8ICZA 4F92B 5AIAA 4YFKA 3THVA 3GU3A 3RH5A 8ICKA 4Y2RA 3Q8LA 1K1QA 4YN4A 4R64A 4QZIA 4DQRA 4PZNA 1JXLA 2NYVA 4O3OA 3ZI4A 1DRGA 3ICXA 4J9KA 2JZBA 2BQ3A 2KMDA 3UMBA 5CRXA 4YMNA 2FPMA 2HBJA 2KVSA 3KD3A 4UB2A 4EYIB 4M47A 3RJGA 4GC6A 5DB6A 1D8YA 3OJSA 1A6SA 1TAQA 4C0ZA 9ICMA 4YG2A 3BS7A 4P4PA 2KV2A 2FLNA 1COKA 3OHAA 3MABA 1TK0A 4DL4A 5KFYA 4CGZA 2FI1A 1N2XA 1K5OA 1Z1VA 2RLTA 2ALZA 1RDFA 4RZRA 4Y2PA 2R18A 8ICNA 4YCXA 4IRDA 1PK1A 3UXNA 2K4PA 5KFQA 5HNKA 2BQUA 3RH4A 5TISU 2HOFA 5D4BA 3M9NB 4ED1A 4QZAA 1U49A 4AYBC 2EZZA 4RQMA 3NS1A 1RM6C 9ICJA 5ALIA 4TQRA 4DLEA 3LWLA 1NK7A 3I76A 3WK5A 2B6GA 4EEKA 1KSPA 3KKAC 2FMPA 4DSLA 2HCFA 3N97B 1QH9A 1RYRA 1Z1BA 2WB1F 1YZ7A 4BJQA 4YP3A 9ICKA 1HEKA 2AQ4A 4QNLA 5KFVA 4UAZA 4ECZA 2KP7A 4QIWC 7ICTA 2ES6A 2EH9A 5L1KA 5ALPA 2F8LA 2DPJA 4NLZA 3OGUA 3PW2A 2NRTA 3GV8B 3QUQA 4DSJA 4PL1A 4C4SA 2ZXIA 4K4IA 1LVHA 4UB4A 2KFNA 2FJ6A 2I1QA 1NK8A 3MR2A 4Q43A 2BCQA 4QWBA 3ISBA 1KFDA 2W43A 3HKZF 3L4PA 2HBMA 5IILA 2F1JA 5AM3A 5CB1A 5KFHA 3SZ2A 2UVVA 4QWEA 4I29A 1ZQIA 2PFOA 2VIXA 2AGOA 3RB0A 4B9LA 2Y1IA 4P0PB 3JPRA 4ED6A 5J0QA 2HI0A 3UMGA 4ECSA 3RR7A 9ICQA 4ED2A 3RB3A 1NZBA 5HP4A 9ICBA 1Q8KA 3C23A 1UQVA 5J0XA 2R8JA 8ICBA 5AI5A 4BXOB 2YB1A 4RQ3A 2V9WA 2D3DA 4KLIA 2BCSA 3B9JA 3BQTA 1EXNA 4TUSA 2OEHA 1ZD5A 4ECWA 4GXJA 2NRZA 1ZQEA 3RRGA 3H40A 4FFDA 2ZTCA 3ONNA 1BPDA 5KFZA 1GO3F 2B21A 2XIDA 5J8YA 4YXJA 3BQ1A 5AK6A 5JU5A 4KLSA 1XSNA 5AM1A 2JV3A 1SL1A 3KBBA 2XY6A 9ICEA 4IL6U 5BOLA 3H0RB 5HHIA 1XWLA 3CNHA 8ICYA 4DFKA 2LBOA 5AKXA 4UAYA 2Q4TA 3KHLA 3TARA 1ZQCA 3M6ZA 1NKBA 4Y2JA 5BOMA 4PHAA 3RAQA 9ICHA 3ZDEA 4ED0A 2E8OA 3NVZA 2KK0A 4ED8A 2GOLA 1A76A 2HHQA 4J9SA 1CRXA 4O3RA 3T5KA 1IIPA 3NUQA 1TK8A 4DQPA 1XSLA 3RAXA 3PW7A 2E3TA 4FZMA 3K1RB 1UA1A 5AK4A 3PMNA 4B9UA 2KSOB 4RT3A 3LVWA 1TKDA 4M2YA 2JH7A 4DL3A 4X5VA 2MSNA 3DDHA 3QZ7A 2D8CA 3Q8SB 1CEZA 1N62A 5KG5A 2YN4A 3KHGA 2ODGA 8ICWA 2HHWA 2BDUA 2ESEA 3T3FA 4RQ6A 2YMLA 2A19A 2H3ZA 2KJ5A 4LZDA 5KG0A 2W04A 5KT3A 1S0NA 2RP5A 4M9GA 3TADA 5IIKA 3HJEA 4P0PA 1COOA 4I28A 4PGXA 4DL6A 1FFVA 1BPYA 1Z4OA 4OD0A 1LKYB 5KG6A 2W9CB 4Z6EA 2CRXA 4RT2A 4BXOA 5G5HA 9ICFA 3M6KA 4GXIA 4FE3A 4F2RA 4LVSA 8ICFA 2DKXA 3SMVA 5KG2A 2E8NA 2RQ5A 4P2HA 5J2HA 3PV8A 2QB0B 1V9PA 2ASDA 2GWSA 2F77X 9ICXA 4ECTA 4NLCA 1L3UA 1SXDA 5TZVA 2KD1A 3EUB2 3Q8MA 2KJ9A 3CYMA 3M7DA 1C20A 1XU4A 5KL1B 2GO7A 2A1JA 1SXEA 4I2JA 4I2FA 1PVPA 4DSEA 3OHBA 4Y2UA 2PI4A 4C8OA 4JB3A 1RXVA 1X6IA 1F0MA 2B0CA 1VDVA 4I2DA 4NM2A 2R8KA 3IDWA 3T5JA 4PH5A 1ZQPA 3QE9Y 5IIOA 2DWQA 1ZQYA 3GFKB 1JIHA 3PO5A 1U45A 4QZBA 4USAA 4M9LA 2KSOA 4EENA 1ZRMA 3ZDCA 4RPXA 3UMCA 5DGBA 1RYUA 3UXOA 1SWWA 1S10A 3HX0A 2VA3A 1BNOA 3IHQB 4QW8A 1JN3A 3PNCA 5ALLA 2PXIA 1QSSA 2PFQA 2OHFA 1H38A 4O3PA 1TAUA 4CF3A 1ZJMA 1URJA 3RF9A 5JUMA 4F5PA 1SZPA 2VA8A 4C4TA 3O0FA 2AGQA 5KFRA 4QIWF 2UVWA 3RJEA 2W9BB 1T7PA 4RQ1A 3MGIA 4B9MA 3HP6A 3RJIA 2KG5A 3KHRA 4OJ6A 2ZTEA 4F72A 2W9CA 1CUKA 2OCEA 4PGYA 3V7JA 2HHSA 1KW4A 1NZPA 1L3SA 3ISDA 2AJQA 3ZDBA 5ALYA 3E58A 4FZNA 2W9MA 1B4FA 1SZHA 4BWJA 9ICGA 5ALQA 5GTIU 4KN4A 2ZUDA 1ZQSA 2QB0A 1SB3C 4BX9C 9ICVA 1ZQWA 2AGPA 8ICEA 1ZXIA 5DQIA 1Q3UA 2ZIUB 2IMWP 2MAXA 3TADC 4DSFA 1WWUA 2JEGA 4BUGA 4US8A 2F1HA 4O3SA 2ZG6A 1X42A 5KFOA 4F50A 4DWIA 4F4KA 2Y9TA 5E79U 2BHNA 2P66A 2W8KA 1D9DA 4KMOB 3QEAZ 1S97A 3H0LB 3JPSA 5EE0A 4F5RA 2Z7JA 3QU5A 4MHVA 4DO9A 2KJ8A 7ICSA 4KLEA 1L8OA 5H2FU 2G09A 2GH1A 5AKLA 2RDIA 2G07A 2G0AA 1QQ7A 3WKEA 1SKRA 1V97A 3NASA 1KKXA 2C2RA 2LHTA 5CJ7A 2E5SA 5EWGA 4F3OA 4EBDA 3KHHA 4XQ8A 4JWNA 4F2SA 1HUZA 4E0DA 2HDOA 3SR6A 3OSPA 3BQ2A 5L1MA 1ED1A 1KRPA 2HHUA 4Y2YA 3I1YA 4RPZA 3UQ2A 1SKSA 4ECRA 2ASJA 1RQNA 1ZYQA 4Y2SA 4DSKA 2IOFA 1QQ6A 2YMQA 3M9MB 2PFPA 4J9OA 4HAIA 3V72A 3C1YA 4MEYA 4QW9A 4EYHB 1NJZA 5AM4A 1RZTA 1MSWD 3QUBA 2KZ3A 1KDHA 3Q8KA 5J2DA 1QQ5A 1S5LU 1SV0A 4YR0A 3T79A 5J0UA 2HHXA 4JV0A 3HRDD 1F5SA 1L7NA 2HW3A 7ICJA 2NRVA 4RQ7A 4O9MA 3WKAA 2HBLA 3IG8A 5IIMA 1ZQQA 5ALWA 2CXYA 2K8AA 2ZUBA 3FM9A 2BKEA 4A8EA 5J2FA 2ZIVA 4I2EA 3ZD8A 2W9BA 8ICSA 5DG7A 5KAFU 2EANA 4DS5A 3TQ1A 1X40A 3RR8A 3TACB 5F9NA 4DQQA 5J0TA 2E8PA 3D2SA 2I6XA 1NK0A 4NLBA 4PHDA 4EX7A 3GIJA 5J2IA 4FBTA 4O5EA 2C28A 1PUZA 7ICMA 5AIBA 4GXKA 4Z6CA 2ZUCA 3I28A 1MA7A 2W03A 2BCRA 2ISOA 2KICA 4DQSA 4Y2TA 5AM5A 3LK9A 1DXSA 4ECXA 3IRUA 3WK7A 2ZIUA 1FEZA 1ZQXA 3JPTA 1KFTA 4RQ0A 2K8BB 4M9JA 2HVIA 5AHXA 2ZXHA 3C5GA 5ALKA 5AI9A 1TK5A 4NXZA 3GIKA 2F76X 5ALJA 7ICKA 5AI8A 2WAQF 4ECVA 3KFUF 5IINA 2KZMA 1L7OA 3B0XA 2W9AA 3K75D 4NL9C 4EBCA 4QJFB 4C4RA 5ALTA 1SV4A 1TFRA 2BCVA 1SIJA 2YY6A 4F5NA 8ICXA 2ZJ5A 1SGGA 1XNSA 4LJXA 2ZJ8A 5DKWA 2BPGA 5HMLA 9ICWA 3CP8A 3KZXA 4CDGA 4CCHA 2EZYA 3PVXA 2RHFA 3F53A 2XY7A 2OWOA 4ZOHC 1Q46A 3RBEA 4G3IA 1ZOLA 5KFEA 5EWEA 3GV5B 2P35A 3N7SC 3GDXA 5ALRA 2WTFA 2IHMA 2JXJA 2M9NA 4RNNA 1QCKA 3BZCA 3F2BA 4IRCA 3H8SA 4J9RA 4JK1A 4C80A 3N7RC 4UB8U 3PY8A 4J03A 3L5KA 2ZIXB 5J0SA 3PX0A 3LWMA 5AI6A 2DKZA 1PK3A 5KFSA 4NY8A 5KTQA 4F5OA 3HW8A 1S0MA 5KFCA 1U4BA 1LB2B 4MF2A 5AI0A 4XA5A 2OH2A 1SKWA 2IBKA 1A77A 4EELA 7ICLA 1UT8A 4ELVA 2Q0ZX 3LYSA 3C28A 1ZQNA 1UA0A 4F71A 1NJYA 3LDAA 5KT4A 5KFMA 2DBYA 1CI4A 5T14A 2FLPA 4Q44A 2GLEA 2JMGA 3RH6A 2A1JB 1X2IA 2JHDA 2MA1A 5AK5A 1FFUA 3C2MA 4R8UB 5F9LA 2H3IA 1KTQA 3LVVA 1N63A 1MN8A 5CHGA 4TQSA 3VCBA 1S0OA 2G08A 4RNMA 4OJLA 1QLNA 2ZJAA 4C8MA 2IHNA 4ZH4A 3EZ5A 3G6XA 1OW5A 4DL5A 1B22A 2NO5A 3PW5A 3RJFA 2AXTU 4J9PA 4M0AA 1T3QA 3IG5A 4C8NA 3H8WA 1ZQTA 4F91B 1YZ6A 3SV4A 5J2JA 3K1ZA 2KHQA 8ICLA
chains in the Genus database with same CATH topology
8ICZA 3EPIA 4F92B 2R8KA 5CWRA 5BPCA 5DLFA 3T5JA 4YFKA 3EYZA 3THVA 1ZQVA 1L5UA 4PH5A 3RH5A 1ZQPA 8ICKA 4R66A 3QE9Y 3Q8LA 4ECYA 1RXWA 5IIOA 3PR5B 1SL0A 1K1QA 5EOZA 4YN4A 5DDMA 4GLXA 4R64A 2RDJA 4QZIA 1ZQYA 3C21A 4KMUA 4DQRA 3GFKB 1JIHA 3H4DA 1JXLA 3PO5A 1U45A 4QZBA 4M9LA 4O3OA 1XO1A 1Z3EB 4NM1A 5DB9A 2BQRA 1MC8A 7ICQA 3KTQA 4MFAA 3ZDCA 4J9KA 2JZBA 4DL7A 4C8KA 3SI8A 4RPXA 3B0YA 2BQ3A 1D9FA 5DGBA 2PI5A 4YMNA 2P6RA 3UXOA 3PX6A 2FPMA 5J29A 4DQIA 1S10A 1HUOA 2KN7A 3HX0A 4UB2A 5HMMA 3IHQB 2VA3A 1BPXA 2FPKA 2J6TA 4EYIB 4QW8A 4M47A 3RJGA 5CA7A 1JN3A 4KITB 1NK6A 4GC6A 5DB6A 3PNCA 1Y88A 4P4OA 4I2GA 1D8YA 2PXIA 3OJSA 1TAQA 1QSSA 4Z6DA 1Z00B 2PFQA 4YMOA 2HHVA 9ICMA 4UB1A 4DEZA 5J2KA 1QSYA 1RPLA 1H38A 4O3PA 1WCLA 3BJYA 1TAUA 3EW9A 4YG2A 1ZJMA 4P4PA 1ZQFA 2FLNA 4JV2A 4P4MA 3OHAA 3M8RA 3MABA 3H8JA 4GC7A 1U48A 1TK0A 4DL4A 5KFYA 5JUMA 4IQWA 3MDCA 3NTUA 4YQWA 4R65A 2I9GA 4F5PA 4UBCA 1UT5A 5KFBA 4BGDA 1SZPA 2VA8A 7ICUA 1ZQOA 4JWMA 4XRHA 2ALZA 2AGQA 4MF8A 1KFSA 4J9QA 3ETLA 1U9LA 5KFRA 2UVWA 2W9BB 1T7PA 3RJEA 1BPEA 4RQ1A 3MGIA 3M8SA 2JEFA 4B9MA 4RZRA 3BDPA 2KFZA 3HP6A 3RJIA 3KHRA 4MFFA 2ZTEA 2W9CA 1AROP 1CUKA 7ICEA 4PGYA 3G6YA 3V7JA 3UPQA 4FO6A 3RTVA 3TFRA 2HHSA 3RB4A 7ICOA 2H5XA 3V7LA 2R8IA 4YCXA 1NK5A 1L3SA 3ISDA 2AJQA 4IRDA 3ZDBA 1WCNA 1NOMA 3UXNA 5KT6A 2ASLA 1NJXA 1BGXT 5KFQA 5HNKA 2W9MA 4QZDA 4QWCA 4DOCA 3RH4A 2BQUA 4DFJA 5D4BA 1ZQAA 3NGDA 4YVZA 3EWAA 4BWJA 3M9NB 3M9OB 4DOAA 5DLGA 4ED1A 4YXMA 2XY5A 2C22A 7ICGA 2XO7A 9ICGA 4QZEA 1PZNA 4QZAA 1U49A 4KN4A 2ZUDA 1ZQSA 9ICSA 5J0OA 9ICVA 1ZQWA 3AU2A 1T8EA 3JPQA 2NRXA 2AGPA 2MUTB 4PGQA 8ICEA 4RU9A 5DQIA 1XSPA 4O3QA 9ICJA 3PX4A 4DF4A 2IMWP 4QZGA 2MAXA 4TQRA 2DPIA 5KFJA 2XCPA 4O3NA 4DSFA 4DLEA 2JEGA 3LWLA 3AU6A 1NK7A 4IRKA 3PMLA 8ICQA 2F1HA 4M9NA 4O3SA 5KFOA 8ICGA 4F50A 8ICOA 1KSPA 4DWIA 4F4KA 3C1ZA 4R8UA 5J0WA 5KG1A 2FMPA 3RJJA 4DSLA 2JEIA 4M6WA 5J0RA 2BHNA 4QZCA 2P66A 2W8KA 5CP2A 3N97B 1D9DA 4KLHA 3V6JA 3QEAZ 4KLUA 1RYRA 1S97A 3T5HA 5DQHA 4J9LA 5DBAA 3JPSA 4YP3A 4F5RA 9ICKA 2AQ4A 5KFVA 4UAZA 4DO9A 4ECZA 7ICSA 4KLEA 4I2BA 4O5KA 1XS9D 3RB6A 5L1JA 8ICJA 2RDIA 1D8LA 1SKRA 4Q8FA 8ICMA 7ICTA 9ICPA 5L1KA 1K1SA 4Q8EA 4QZ9A 2BPFA 8ICAA 4NLKA 5KFFA 2C2RA 1TVAA 3K4GA 5CJ7A 2DPJA 4NLZA 5EWGA 4F3OA 4EBDA 3KHHA 4XQ8A 3OGUA 3PW2A 2NRTA 3GV8B 1ZQMA 4F2SA 1HUZA 4E0DA 4JWNA 8ICCA 1NK4A 4YR2A 5KFTA 3OSPA 2HVHA 3BQ2A 4DSJA 3H4BA 4B9NA 1ZQJA 1KRPA 2HHUA 1ZQDA 4K4IA 4UB4A 2KFNA 1ZQHA 4F4YA 3GILA 5KG4A 4EBEA 2I1QA 5D49A 4KLOA 4IQUA 4RPZA 3UQ2A 5KG7A 4ECRA 1NK8A 1SKSA 1NKEA 9ICUA 3MR2A 2ASJA 5L9XA 4Q43A 2AU0A 1ZYQA 4KLMA 1MQ2A 2BCQA 3T5LA 4DSKA 1ZQUA 2V4RA 8ICTA 4KN7A 3UXPA 4QWBA 3M9MB 2PFPA 1KEJA 3ISBA 1KFDA 1S76D 4J9OA 4KLFA 4LZGA 3V72A 1JXEA 5KFAA 5IILA 3C1YA 3FYHA 2F1JA 5CB1A 5KFHA 3SZ2A 2UVVA 4JV1A 4MEYA 4QW9A 1NKCA 4EYHB 1NJZA 1ZQLA 1RZTA 1MSWD 1HJPA 4DFMA 4QWEA 4I29A 5DQGA 2KZ3A 3MDAA 4DFPA 3Q8KA 3V7KA 5J2DA 4HYKA 1KDHA 1ZQIA 2PFOA 4ED3A 3RB0A 2AGOA 2ISPA 2Y1IA 3ZDDA 4B9LA 1L3TA 3JPRA 4ED6A 5J0QA 4YR0A 5DG9A 3OJUA 5J0UA 3ISCA 4ECSA 3RR7A 7ICFA 9ICQA 4ED2A 4DF8A 3HT3A 3RB3A 5HP4A 4JV0A 1Z00A 5J2BA 2HHXA 9ICBA 3H7IA 5CR0A 3C23A 2HW3A 7ICJA 5J0XA 4M9HA 3E2EA 2NRVA 2R8JA 4Z6FA 4RUAA 4DOBA 4RQ7A 4C8LA 3AUOA 4O9MA 8ICBA 8ICUA 4BXOB 1DGSA 3RRHA 2BGWA 5IIMA 1ZQQA 8ICRA 3Q8QB 2ZUBA 3G6VA 2BKEA 4JUZA 4B9VA 4RQ3A 5J2FA 2V9WA 4NLGA 4KLIA 2BCSA 3BQTA 5KG3A 5KT2A 1EXNA 2XCAA 3ORYA 4TUSA 3MR3A 4I2EA 4K4GA 1S77D 9ICRA 3ZD8A 2W9BA 4ECWA 5DG8A 8ICSA 4FS2A 4GXJA 2NRZA 3EPGA 2R8HA 3C2KA 1ZQEA 5DBCA 3H40A 5DG7A 3RRGA 3C5FA 7ICNA 3MGHA 4DS5A 3TQ1A 2ZTCA 2BR0A 4F8RA 3RR8A 1X9WA 5F9NA 5IIIA 5J0YA 4DQQA 4I2CA 5J0TA 3ZDAA 4EZ6A 1BPDA 8ICVA 4MEXA 5KFZA 1NK0A 9ICAA 3MBYA 4PHDA 2B21A 3GIJA 5J2IA 4FBTA 4O5EA 2C28A 4KLQA 3JPOA 7ICMA 9ICCA 4YXJA 3BQ1A 4Q45A 4ECQA 4GXKA 2UVUA 4M04A 5J2CA 9ICOA 4IQVA 2ATLA 3QEBZ 4KLSA 4Z6CA 2ZUCA 1XSNA 2BCRA 2ISOA 3ZD9A 1SL1A 4EEYA 4NLNA 4DQSA 2XY6A 4MFCA 5J2AA 5L1IA 2C2EA 1JMSA 2MUTA 3LK9A 2FMSA 9ICEA 4ECXA 5BOLA 2P6UA 4IR1A 4PPXA 1U47A 4F93B 1IM4A 1ZQXA 3JPTA 2IA6A 5HHIA 1XWLA 8ICYA 5C5JA 2JEJA 4DFKA 4RQ0A 1KFTA 4M9JA 4UAYA 2HVIA 2BPCA 3KHLA 3C5GA 4QWDA 3TARA 1ZQCA 1TK5A 2XGPA 1NKBA 4J9NA 4NXZA 3GIKA 3UQ0A 2LYHA 5BOMA 4PHAA 3MFHA 4YR3A 4FBUA 2KZZA 3RAQA 9ICHA 3ZDEA 4ED0A 5IIJA 7ICKA 4BDPA 2VANA 5D46A 3RBDA 4ECVA 4DSIA 3JPNA 5IINA 3PO4A 2KZMA 3PR4A 3B0XA 4ED8A 2HHQA 1A76A 2ZTDA 3K75D 2W9AA 4EBCA 2FMQA 4J9SA 3QZ8A 4RQ5A 4B9SA 4O0IA 4O3RA 3T5KA 1S9FA 1TK8A 1S0VA 4DQPA 1XSLA 4UQGA 1ZQGA 2PFNA 1XC9A 3RAXA 3PW7A 9ICTA 4UBBA 1UA1A 1BPBA 1TFRA 1LV5A 2BCVA 4QZHA 8ICXA 4F5NA 2XGQA 2V4QA 2ZJ5A 1IXRA 3PMNA 2ZJ8A 4B9UA 5DKWA 5DB8A 2BPGA 1BPZA 4RT3A 5HMLA 2JZBB 4F4ZA 4RQ2A 5EWFA 3V6KA 9ICWA 3TI0A 3TAQA 4I2AA 1TKDA 4M2YA 4X5VA 4DL3A 4CCHA 3QZ7A 3Q8SB 2Y1JA 1NJWA 1CEZA 3GIMA 3PVXA 5KG5A 1ZQKA 3IM1A 4TURA 3KHGA 3SYZA 8ICWA 2HHWA 2F1IA 2XY7A 2OWOA 8ICPA 3T3FA 3MR6A 3RBEA 2FLLA 4G3IA 1B43A 5KFEA 1C7YA 5EWEA 4KLGA 5L1LA 3GV5B 4RQ6A 2VA2A 5DBBA 3RJKA 3GDXA 2WTFA 3MFIA 2IHMA 4LZDA 1T4GA 2C2DA 7ICRA 2M9NA 2KTQA 4RNNA 1JX4A 4F4XA 5KFGA 5KG0A 5KT3A 3SV3A 5KT5A 4DL2A 7ICVA 1S0NA 4IRCA 3PW0A 3MR5A 5KFNA 3H8SA 4J9RA 4JK1A 1X9SA 5KFDA 3V6HA 2R8GA 4ELTA 4M9GA 1N56A 5IIKA 3PY8A 3OSNA 4FS1A 5J0SA 4ELUA 3PX0A 3LWMA 1DOQA 5KFSA 1COOA 4F4WA 4RUCA 4I28A 4NY8A 4PGXA 3BQ0A 4DL6A 1BPYA 5KTQA 4F5OA 1ZJNA 2J6SA 3HW8A 1S0MA 5KFCA 1U4BA 5KG6A 1LB2B 2UVRA 4MF2A 4XA5A 3Q8RB 2W9CB 1KLNA 3FDSA 4Z6EA 1ZQBA 1SKWA 5HHHA 4ED7A 2IBKA 1A77A 5DDYA 4RT2A 1T3NA 4BXOA 7ICLA 4YD1A 5KFXA 3TANA 9ICFA 2BDPA 3HWTA 1UT8A 4GXIA 4K4HA 4F2RA 4ELVA 4LVSA 8ICFA 7ICIA 2Q0ZX 4R63A 1BVSA 2FPLA 5KG2A 4TUPA 4F5QA 1ZETA 1ZQNA 9ICNA 4YD2A 2NRWA 4P2HA 1UA0A 4J9MA 3N4MB 4KLLA 5J2HA 4KLJA 3PV8A 4RQ4A 1NJYA 2AQ0A 2J6UA 3RJHA 3LDAA 4I2IA 3PW4A 5KT4A 4KLDA 1V9PA 5KFMA 4UAWA 1MQ3A 4I27A 1TV9A 2ASDA 2XC9A 4QWAA 2GWSA 3HPOA 5DB7A 5KFLA 9ICXA 5KFUA 4PHEA 4TUQA 3Q8PB 3GIIA 2W8LA 4ECTA 2FLPA 1NK9A 4O5CA 8ICIA 4DS4A 4Q44A 3RH6A 3GV7B 1L3UA 2A1JB 1X2IA 5TZVA 3C2MA 5KFKA 3Q8MA 9ICLA 4R8UB 4PHPA 5F9LA 5DGAA 1KTQA 4M6WB 1QSLA 4DLGA 3JPPA 4B9TA 1XU4A 2BCUA 1ZQZA 2HHTA 1RYSA 5CHGA 4TQSA 1S0OA 1X9MA 4RNOA 7ICHA 2A1JA 4ECUA 1N48A 4BWMA 4RNMA 4RQ8A 4QZ8A 1QLNA 4I2JA 5J2GA 3GQCA 4I2FA 4XUSA 9ICIA 4IR9A 2ZJAA 4UB3A 4C8MA 5J0PA 4DSEA 2IHNA 4ZH4A 3EZ5A 4KTQA 3OHBA 3G6XA 8ICNA 4DL5A 1L3VA 4KLTA 2DFLA 4QZFA 4RPYA 3PW5A 3RJFA 4J9PA 5KT7A 1B22A 1SL2A 4M0AA 3TFSA 1ZQRA 4I2HA 2PI4A 5KFIA 4C8OA 4C8NA 3H8WA 1ZQTA 4F91B 3C2LA 1RXVA 3TAPA 3SV4A 8ICHA 5J2JA 7ICPA 4YMMA 5KFWA 5KFPA 5J2EA 1QTMA 4I2DA 4NM2A 4EZ9A 4UB5A 4IQTA 8ICLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8ICZ A;  3EPI A;  4F92 B;  2R8K A;  5CWR A;  5BPC A;  5DLF A;  3T5J A;  4YFK A;  3EYZ A;  3THV A;  1ZQV A;  1L5U A;  4PH5 A;  3RH5 A;  1ZQP A;  8ICK A;  4R66 A;  3QE9 Y;  3Q8L A;  4ECY A;  1RXW A;  5IIO A;  3PR5 B;  1SL0 A;  1K1Q A;  5EOZ A;  4YN4 A;  5DDM A;  4GLX A;  4R64 A;  2RDJ A;  4QZI A;  1ZQY A;  3C21 A;  4KMU A;  4DQR A;  3GFK B;  1JIH A;  3H4D A;  1JXL A;  3PO5 A;  1U45 A;  4QZB A;  4M9L A;  4O3O A;  1XO1 A;  1Z3E B;  4NM1 A;  5DB9 A;  2BQR A;  1MC8 A;  7ICQ A;  3KTQ A;  4MFA A;  3ZDC A;  4J9K A;  2JZB A;  4DL7 A;  4C8K A;  3SI8 A;  4RPX A;  3B0Y A;  2BQ3 A;  1D9F A;  5DGB A;  2PI5 A;  4YMN A;  2P6R A;  3UXO A;  3PX6 A;  2FPM A;  5J29 A;  4DQI A;  1S10 A;  1HUO A;  2KN7 A;  3HX0 A;  4UB2 A;  5HMM A;  3IHQ B;  2VA3 A;  1BPX A;  2FPK A;  2J6T A;  4EYI B;  4QW8 A;  4M47 A;  3RJG A;  5CA7 A;  1JN3 A;  4KIT B;  1NK6 A;  4GC6 A;  5DB6 A;  3PNC A;  1Y88 A;  4P4O A;  4I2G A;  1D8Y A;  2PXI A;  3OJS A;  1TAQ A;  1QSS A;  4Z6D A;  1Z00 B;  2PFQ A;  4YMO A;  2HHV A;  9ICM A;  4UB1 A;  4DEZ A;  5J2K A;  1QSY A;  1RPL A;  1H38 A;  4O3P A;  1WCL A;  3BJY A;  1TAU A;  3EW9 A;  4YG2 A;  1ZJM A;  4P4P A;  1ZQF A;  2FLN A;  4JV2 A;  4P4M A;  3OHA A;  3M8R A;  3MAB A;  3H8J A;  4GC7 A;  1U48 A;  1TK0 A;  4DL4 A;  5KFY A;  5JUM A;  4IQW A;  3MDC A;  3NTU A;  4YQW A;  4R65 A;  2I9G A;  4F5P A;  4UBC A;  1UT5 A;  5KFB A;  4BGD A;  1SZP A;  2VA8 A;  7ICU A;  1ZQO A;  4JWM A;  4XRH A;  2ALZ A;  2AGQ A;  4MF8 A;  1KFS A;  4J9Q A;  3ETL A;  1U9L A;  5KFR A;  2UVW A;  2W9B B;  1T7P A;  3RJE A;  1BPE A;  4RQ1 A;  3MGI A;  3M8S A;  2JEF A;  4B9M A;  4RZR A;  3BDP A;  2KFZ A;  3HP6 A;  3RJI A;  3KHR A;  4MFF A;  2ZTE A;  2W9C A;  1ARO P;  1CUK A;  7ICE A;  4PGY A;  3G6Y A;  3V7J A;  3UPQ A;  4FO6 A;  3RTV A;  3TFR A;  2HHS A;  3RB4 A;  7ICO A;  2H5X A;  3V7L A;  2R8I A;  4YCX A;  1NK5 A;  1L3S A;  3ISD A;  2AJQ A;  4IRD A;  3ZDB A;  1WCN A;  1NOM A;  3UXN A;  5KT6 A;  2ASL A;  1NJX A;  1BGX T;  5KFQ A;  5HNK A;  2W9M A;  4QZD A;  4QWC A;  4DOC A;  3RH4 A;  2BQU A;  4DFJ A;  5D4B A;  1ZQA A;  3NGD A;  4YVZ A;  3EWA A;  4BWJ A;  3M9N B;  3M9O B;  4DOA A;  5DLG A;  4ED1 A;  4YXM A;  2XY5 A;  2C22 A;  7ICG A;  2XO7 A;  9ICG A;  4QZE A;  1PZN A;  4QZA A;  1U49 A;  4KN4 A;  2ZUD A;  1ZQS A;  9ICS A;  5J0O A;  9ICV A;  1ZQW A;  3AU2 A;  1T8E A;  3JPQ A;  2NRX A;  2AGP A;  2MUT B;  4PGQ A;  8ICE A;  4RU9 A;  5DQI A;  1XSP A;  4O3Q A;  9ICJ A;  3PX4 A;  4DF4 A;  2IMW P;  4QZG A;  2MAX A;  4TQR A;  2DPI A;  5KFJ A;  2XCP A;  4O3N A;  4DSF A;  4DLE A;  2JEG A;  3LWL A;  3AU6 A;  1NK7 A;  4IRK A;  3PML A;  8ICQ A;  2F1H A;  4M9N A;  4O3S A;  5KFO A;  8ICG A;  4F50 A;  8ICO A;  1KSP A;  4DWI A;  4F4K A;  3C1Z A;  4R8U A;  5J0W A;  5KG1 A;  2FMP A;  3RJJ A;  4DSL A;  2JEI A;  4M6W A;  5J0R A;  2BHN A;  4QZC A;  2P66 A;  2W8K A;  5CP2 A;  3N97 B;  1D9D A;  4KLH A;  3V6J A;  3QEA Z;  4KLU A;  1RYR A;  1S97 A;  3T5H A;  5DQH A;  4J9L A;  5DBA A;  3JPS A;  4YP3 A;  4F5R A;  9ICK A;  2AQ4 A;  5KFV A;  4UAZ A;  4DO9 A;  4ECZ A;  7ICS A;  4KLE A;  4I2B A;  4O5K A;  1XS9 D;  3RB6 A;  5L1J A;  8ICJ A;  2RDI A;  1D8L A;  1SKR A;  4Q8F A;  8ICM A;  7ICT A;  9ICP A;  5L1K A;  1K1S A;  4Q8E A;  4QZ9 A;  2BPF A;  8ICA A;  4NLK A;  5KFF A;  2C2R A;  1TVA A;  3K4G A;  5CJ7 A;  2DPJ A;  4NLZ A;  5EWG A;  4F3O A;  4EBD A;  3KHH A;  4XQ8 A;  3OGU A;  3PW2 A;  2NRT A;  3GV8 B;  1ZQM A;  4F2S A;  1HUZ A;  4E0D A;  4JWN A;  8ICC A;  1NK4 A;  4YR2 A;  5KFT A;  3OSP A;  2HVH A;  3BQ2 A;  4DSJ A;  3H4B A;  4B9N A;  1ZQJ A;  1KRP A;  2HHU A;  1ZQD A;  4K4I A;  4UB4 A;  2KFN A;  1ZQH A;  4F4Y A;  3GIL A;  5KG4 A;  4EBE A;  2I1Q A;  5D49 A;  4KLO A;  4IQU A;  4RPZ A;  3UQ2 A;  5KG7 A;  4ECR A;  1NK8 A;  1SKS A;  1NKE A;  9ICU A;  3MR2 A;  2ASJ A;  5L9X A;  4Q43 A;  2AU0 A;  1ZYQ A;  4KLM A;  1MQ2 A;  2BCQ A;  3T5L A;  4DSK A;  1ZQU A;  2V4R A;  8ICT A;  4KN7 A;  3UXP A;  4QWB A;  3M9M B;  2PFP A;  1KEJ A;  3ISB A;  1KFD A;  1S76 D;  4J9O A;  4KLF A;  4LZG A;  3V72 A;  1JXE A;  5KFA A;  5IIL A;  3C1Y A;  3FYH A;  2F1J A;  5CB1 A;  5KFH A;  3SZ2 A;  2UVV A;  4JV1 A;  4MEY A;  4QW9 A;  1NKC A;  4EYH B;  1NJZ A;  1ZQL A;  1RZT A;  1MSW D;  1HJP A;  4DFM A;  4QWE A;  4I29 A;  5DQG A;  2KZ3 A;  3MDA A;  4DFP A;  3Q8K A;  3V7K A;  5J2D A;  4HYK A;  1KDH A;  1ZQI A;  2PFO A;  4ED3 A;  3RB0 A;  2AGO A;  2ISP A;  2Y1I A;  3ZDD A;  4B9L A;  1L3T A;  3JPR A;  4ED6 A;  5J0Q A;  4YR0 A;  5DG9 A;  3OJU A;  5J0U A;  3ISC A;  4ECS A;  3RR7 A;  7ICF A;  9ICQ A;  4ED2 A;  4DF8 A;  3HT3 A;  3RB3 A;  5HP4 A;  4JV0 A;  1Z00 A;  5J2B A;  2HHX A;  9ICB A;  3H7I A;  5CR0 A;  3C23 A;  2HW3 A;  7ICJ A;  5J0X A;  4M9H A;  3E2E A;  2NRV A;  2R8J A;  4Z6F A;  4RUA A;  4DOB A;  4RQ7 A;  4C8L A;  3AUO A;  4O9M A;  8ICB A;  8ICU A;  4BXO B;  1DGS A;  3RRH A;  2BGW A;  5IIM A;  1ZQQ A;  8ICR A;  3Q8Q B;  2ZUB A;  3G6V A;  2BKE A;  4JUZ A;  4B9V A;  4RQ3 A;  5J2F A;  2V9W A;  4NLG A;  4KLI A;  2BCS A;  3BQT A;  5KG3 A;  5KT2 A;  1EXN A;  2XCA A;  3ORY A;  4TUS A;  3MR3 A;  4I2E A;  4K4G A;  1S77 D;  9ICR A;  3ZD8 A;  2W9B A;  4ECW A;  5DG8 A;  8ICS A;  4FS2 A;  4GXJ A;  2NRZ A;  3EPG A;  2R8H A;  3C2K A;  1ZQE A;  5DBC A;  3H40 A;  5DG7 A;  3RRG A;  3C5F A;  7ICN A;  3MGH A;  4DS5 A;  3TQ1 A;  2ZTC A;  2BR0 A;  4F8R A;  3RR8 A;  1X9W A;  5F9N A;  5III A;  5J0Y A;  4DQQ A;  4I2C A;  5J0T A;  3ZDA A;  4EZ6 A;  1BPD A;  8ICV A;  4MEX A;  5KFZ A;  1NK0 A;  9ICA A;  3MBY A;  4PHD A;  2B21 A;  3GIJ A;  5J2I A;  4FBT A;  4O5E A;  2C28 A;  4KLQ A;  3JPO A;  7ICM A;  9ICC A;  4YXJ A;  3BQ1 A;  4Q45 A;  4ECQ A;  4GXK A;  2UVU A;  4M04 A;  5J2C A;  9ICO A;  4IQV A;  2ATL A;  3QEB Z;  4KLS A;  4Z6C A;  2ZUC A;  1XSN A;  2BCR A;  2ISO A;  3ZD9 A;  1SL1 A;  4EEY A;  4NLN A;  4DQS A;  2XY6 A;  4MFC A;  5J2A A;  5L1I A;  2C2E A;  1JMS A;  2MUT A;  3LK9 A;  2FMS A;  9ICE A;  4ECX A;  5BOL A;  2P6U A;  4IR1 A;  4PPX A;  1U47 A;  4F93 B;  1IM4 A;  1ZQX A;  3JPT A;  2IA6 A;  5HHI A;  1XWL A;  8ICY A;  5C5J A;  2JEJ A;  4DFK A;  4RQ0 A;  1KFT A;  4M9J A;  4UAY A;  2HVI A;  2BPC A;  3KHL A;  3C5G A;  4QWD A;  3TAR A;  1ZQC A;  1TK5 A;  2XGP A;  1NKB A;  4J9N A;  4NXZ A;  3GIK A;  3UQ0 A;  2LYH A;  5BOM A;  4PHA A;  3MFH A;  4YR3 A;  4FBU A;  2KZZ A;  3RAQ A;  9ICH A;  3ZDE A;  4ED0 A;  5IIJ A;  7ICK A;  4BDP A;  2VAN A;  5D46 A;  3RBD A;  4ECV A;  4DSI A;  3JPN A;  5IIN A;  3PO4 A;  2KZM A;  3PR4 A;  3B0X A;  4ED8 A;  2HHQ A;  1A76 A;  2ZTD A;  3K75 D;  2W9A A;  4EBC A;  2FMQ A;  4J9S A;  3QZ8 A;  4RQ5 A;  4B9S A;  4O0I A;  4O3R A;  3T5K A;  1S9F A;  1TK8 A;  1S0V A;  4DQP A;  1XSL A;  4UQG A;  1ZQG A;  2PFN A;  1XC9 A;  3RAX A;  3PW7 A;  9ICT A;  4UBB A;  1UA1 A;  1BPB A;  1TFR A;  1LV5 A;  2BCV A;  4QZH A;  8ICX A;  4F5N A;  2XGQ A;  2V4Q A;  2ZJ5 A;  1IXR A;  3PMN A;  2ZJ8 A;  4B9U A;  5DKW A;  5DB8 A;  2BPG A;  1BPZ A;  4RT3 A;  5HML A;  2JZB B;  4F4Z A;  4RQ2 A;  5EWF A;  3V6K A;  9ICW A;  3TI0 A;  3TAQ A;  4I2A A;  1TKD A;  4M2Y A;  4X5V A;  4DL3 A;  4CCH A;  3QZ7 A;  3Q8S B;  2Y1J A;  1NJW A;  1CEZ A;  3GIM A;  3PVX A;  5KG5 A;  1ZQK A;  3IM1 A;  4TUR A;  3KHG A;  3SYZ A;  8ICW A;  2HHW A;  2F1I A;  2XY7 A;  2OWO A;  8ICP A;  3T3F A;  3MR6 A;  3RBE A;  2FLL A;  4G3I A;  1B43 A;  5KFE A;  1C7Y A;  5EWE A;  4KLG A;  5L1L A;  3GV5 B;  4RQ6 A;  2VA2 A;  5DBB A;  3RJK A;  3GDX A;  2WTF A;  3MFI A;  2IHM A;  4LZD A;  1T4G A;  2C2D A;  7ICR A;  2M9N A;  2KTQ A;  4RNN A;  1JX4 A;  4F4X A;  5KFG A;  5KG0 A;  5KT3 A;  3SV3 A;  5KT5 A;  4DL2 A;  7ICV A;  1S0N A;  4IRC A;  3PW0 A;  3MR5 A;  5KFN A;  3H8S A;  4J9R A;  4JK1 A;  1X9S A;  5KFD A;  3V6H A;  2R8G A;  4ELT A;  4M9G A;  1N56 A;  5IIK A;  3PY8 A;  3OSN A;  4FS1 A;  5J0S A;  4ELU A;  3PX0 A;  3LWM A;  1DOQ A;  5KFS A;  1COO A;  4F4W A;  4RUC A;  4I28 A;  4NY8 A;  4PGX A;  3BQ0 A;  4DL6 A;  1BPY A;  5KTQ A;  4F5O A;  1ZJN A;  2J6S A;  3HW8 A;  1S0M A;  5KFC A;  1U4B A;  5KG6 A;  1LB2 B;  2UVR A;  4MF2 A;  4XA5 A;  3Q8R B;  2W9C B;  1KLN A;  3FDS A;  4Z6E A;  1ZQB A;  1SKW A;  5HHH A;  4ED7 A;  2IBK A;  1A77 A;  5DDY A;  4RT2 A;  1T3N A;  4BXO A;  7ICL A;  4YD1 A;  5KFX A;  3TAN A;  9ICF A;  2BDP A;  3HWT A;  1UT8 A;  4GXI A;  4K4H A;  4F2R A;  4ELV A;  4LVS A;  8ICF A;  7ICI A;  2Q0Z X;  4R63 A;  1BVS A;  2FPL A;  5KG2 A;  4TUP A;  4F5Q A;  1ZET A;  1ZQN A;  9ICN A;  4YD2 A;  2NRW A;  4P2H A;  1UA0 A;  4J9M A;  3N4M B;  4KLL A;  5J2H A;  4KLJ A;  3PV8 A;  4RQ4 A;  1NJY A;  2AQ0 A;  2J6U A;  3RJH A;  3LDA A;  4I2I A;  3PW4 A;  5KT4 A;  4KLD A;  1V9P A;  5KFM A;  4UAW A;  1MQ3 A;  4I27 A;  1TV9 A;  2ASD A;  2XC9 A;  4QWA A;  2GWS A;  3HPO A;  5DB7 A;  5KFL A;  9ICX A;  5KFU A;  4PHE A;  4TUQ A;  3Q8P B;  3GII A;  2W8L A;  4ECT A;  2FLP A;  1NK9 A;  4O5C A;  8ICI A;  4DS4 A;  4Q44 A;  3RH6 A;  3GV7 B;  1L3U A;  2A1J B;  1X2I A;  5TZV A;  3C2M A;  5KFK A;  3Q8M A;  9ICL A;  4R8U B;  4PHP A;  5F9L A;  5DGA A;  1KTQ A;  4M6W B;  1QSL A;  4DLG A;  3JPP A;  4B9T A;  1XU4 A;  2BCU A;  1ZQZ A;  2HHT A;  1RYS A;  5CHG A;  4TQS A;  1S0O A;  1X9M A;  4RNO A;  7ICH A;  2A1J A;  4ECU A;  1N48 A;  4BWM A;  4RNM A;  4RQ8 A;  4QZ8 A;  1QLN A;  4I2J A;  5J2G A;  3GQC A;  4I2F A;  4XUS A;  9ICI A;  4IR9 A;  2ZJA A;  4UB3 A;  4C8M A;  5J0P A;  4DSE A;  2IHN A;  4ZH4 A;  3EZ5 A;  4KTQ A;  3OHB A;  3G6X A;  8ICN A;  4DL5 A;  1L3V A;  4KLT A;  2DFL A;  4QZF A;  4RPY A;  3PW5 A;  3RJF A;  4J9P A;  5KT7 A;  1B22 A;  1SL2 A;  4M0A A;  3TFS A;  1ZQR A;  4I2H A;  2PI4 A;  5KFI A;  4C8O A;  4C8N A;  3H8W A;  1ZQT A;  4F91 B;  3C2L A;  1RXV A;  3TAP A;  3SV4 A;  8ICH A;  5J2J A;  7ICP A;  4YMM A;  5KFW A;  5KFP A;  5J2E A;  1QTM A;  4I2D A;  4NM2 A;  4EZ9 A;  4UB5 A;  4IQT A;  8ICL A; 
#chains in the Genus database with same CATH topology
 3RFA A;  3EPI A;  5CWR A;  1F44 A;  4R66 A;  1RXW A;  3PR5 B;  1SL0 A;  5EOZ A;  3WK9 A;  4OCZ A;  2RDJ A;  3C21 A;  4KMU A;  1XO1 A;  1Z3E B;  5DB9 A;  1Z4N A;  2BQR A;  7ICQ A;  4DL7 A;  3QU7 A;  4KX3 A;  3B0Y A;  5K4L A;  4ACO A;  2W3R A;  5HMM A;  2FPK A;  2J6T A;  5CA7 A;  2HMX A;  2FDR A;  4P4O A;  4I2G A;  3NRZ A;  2F44 A;  4Z6D A;  1Z00 B;  3WK4 A;  2LYA A;  4DEZ A;  1RPL A;  2WAQ C;  3NVY A;  1WCL A;  4EX6 A;  3BJY A;  4OJO A;  1ZQF A;  2LMR A;  2ZIW A;  3SEI A;  3H8J A;  2DL0 A;  3NTU A;  4YQW A;  2I9G A;  3AEV A;  4UBC A;  2ZIX A;  4UB6 U;  4BGD A;  1ZQO A;  4JWM A;  1ZD4 A;  4J9Q A;  1U9L A;  1BPE A;  4PL2 A;  1OUQ A;  2EZX A;  4MFF A;  2QB1 A;  5AKJ A;  3TFR A;  3ALR A;  3UPQ A;  3RTV A;  3RB4 A;  2H5X A;  2NO4 A;  1WCN A;  1NOM A;  1BGX T;  4QZD A;  5A0L A;  4QWC A;  4DOC A;  2YB4 A;  1ZQA A;  4YVZ A;  3ETR A;  3EWA A;  2XY5 A;  4YXM A;  2C22 A;  2A1A A;  4QZE A;  2Y0S C;  3D6J A;  5J0O A;  1T8E A;  2QAR B;  3H8M A;  4PGQ A;  1XSP A;  4O3Q A;  5ALV A;  4GFJ A;  4C7Y A;  2DPI A;  4O3N A;  3AU6 A;  4IRK A;  4C7Z A;  4M9N A;  2W7P A;  2K8C B;  3BZK A;  5EE1 A;  3C1Z A;  4R8U A;  5KG1 A;  1M6Y A;  2JEI A;  4QZC A;  4KLH A;  1N61 A;  1UPH A;  2W55 A;  2A3V A;  4J9L A;  5DBA A;  4JMU A;  4I2B A;  4O5K A;  1XS9 D;  5L1J A;  8ICJ A;  4Q8F A;  9ICP A;  5ALE A;  2OYY A;  2HSZ A;  1K1S A;  4Q8E A;  5ALD A;  2WF5 A;  4NLK A;  1TVA A;  4B6J A;  3K4G A;  5AK3 A;  5J8Y C;  3CRX A;  1ZQM A;  8ICC A;  2DF4 B;  1NK4 A;  4YR2 A;  5KFT A;  3H4B A;  5ALX A;  2EDU A;  1ZQJ A;  1ZQD A;  4F4Y A;  3GIL A;  5KG4 A;  5D49 A;  3WKC A;  4KLO A;  1NKE A;  5L9X A;  1MQ2 A;  3T5L A;  3GZF A;  8ICT A;  1S76 D;  1D8B A;  2K60 A;  4LZG A;  2OXO A;  3FYH A;  1NI3 A;  1NKC A;  2IOH A;  1KBU A;  1ZQL A;  1N5W A;  1HJP A;  3MDA A;  1L7M A;  4HYK A;  4ED3 A;  3ZDD A;  5AM0 A;  1L3T A;  2YQE A;  3PSI A;  4UAU A;  5DG9 A;  3OJU A;  3M1Y A;  3ISC A;  4DF8 A;  3QUC A;  5J2B A;  1Z00 A;  2RRD A;  1KN5 A;  2ZIV B;  4RUA A;  4DOB A;  5ALO A;  4C8L A;  1JAL A;  3AUO A;  4CNQ A;  1DGS A;  5B5E U;  8ICR A;  2Y9U A;  3KKA A;  3G6V A;  4JUZ A;  1T94 A;  2MRL A;  5KT2 A;  4NJ8 A;  2XCA A;  3MR3 A;  2EAO A;  2IOF K;  9ICR A;  5DG8 A;  1KL9 A;  2R8H A;  3EPG A;  4KX5 A;  3C5F A;  4CF4 A;  2BR0 A;  4F8R A;  1V38 A;  1X9W A;  5III A;  4I2C A;  3ZDA A;  4MEX A;  1IV8 A;  9ICA A;  5KL8 B;  5ALS A;  4ECQ A;  3IV6 A;  2UVU A;  4M04 A;  5J2C A;  9ICO A;  4NLN A;  2QAR A;  4MFC A;  5L1I A;  2FMS A;  4PPX A;  4F93 B;  1IM4 A;  2IA6 A;  2JEJ A;  3CW2 C;  4GIB A;  2BPC A;  2G5H B;  5EE3 A;  3C29 A;  2LM1 A;  2LYH A;  2H3F A;  2KZZ A;  4FBU A;  5IIJ A;  5AM2 A;  2PMZ F;  1A0P A;  2E1F A;  2VAN A;  5D46 A;  3RBD A;  4BDP A;  4DSI A;  3PR4 A;  3QZ8 A;  1S9F A;  2WF7 A;  1TE2 A;  1ZQG A;  3S6J A;  2PFN A;  9ICT A;  4UAR A;  5KNI A;  1BPB A;  1IXR A;  5DB8 A;  2EQY A;  4F4Z A;  3DV9 A;  3TI0 A;  3TAQ A;  4I2A A;  2Y1J A;  1NJW A;  3GIM A;  5AKK A;  1ZQK A;  3HIL A;  3IM1 A;  4TUR A;  3SYZ A;  2DQN B;  1PVR A;  8ICP A;  3MR6 A;  1B43 A;  1C7Y A;  2W54 A;  4DFD A;  5DBB A;  3RJK A;  2KOB A;  1WWV A;  5C0Y A;  7ICR A;  5G5G A;  2KTQ A;  1JX4 A;  4F4X A;  3WK8 A;  3PSF A;  3SV3 A;  5KT5 A;  7ICV A;  2KNJ A;  1RQL A;  5KFN A;  5KFD A;  2K4H A;  2R8G A;  4ELT A;  2JGA A;  4ELU A;  2XIC A;  4RUC A;  3BQ0 A;  2CPR A;  1DK2 A;  3QU4 A;  2WF8 A;  2WHE A;  2UVR A;  1KLN A;  1ZQB A;  5HHH A;  3NRW A;  4UAT A;  5DDY A;  4Y2Q A;  3TAN A;  3A0H U;  5KFX A;  2HOI A;  3HWT A;  2KEY A;  4IC9 A;  3QX7 A;  3ED5 A;  4R63 A;  1BVS A;  2FPL A;  4TUP A;  4F5Q A;  3BS5 B;  1ZET A;  9ICN A;  2NRW A;  3A0B U;  2M0N A;  4RQ4 A;  3RJH A;  2J6U A;  4I2I A;  2KKV A;  1JRP A;  1MQ3 A;  1TV9 A;  5KFL A;  5KFU A;  4PHE A;  3QXG A;  3Q8P B;  3GII A;  2CN1 A;  5FP0 A;  2W8L A;  4DS4 A;  3PSP A;  3GV7 B;  1J2M A;  4O3M A;  2N1R A;  4NWI A;  5KFK A;  9ICL A;  5DGA A;  4IS7 A;  4M6W B;  2HHT A;  3JPP A;  4B9T A;  3QU9 A;  3UM9 A;  4ECU A;  4BWM A;  2G06 A;  4QZ8 A;  3GQC A;  2W11 A;  4UB3 A;  2LPE A;  4KLT A;  4QZF A;  4RPY A;  5KT7 A;  1SL2 A;  3TFS A;  4WJ3 B;  4NV0 A;  5KFI A;  2WF6 A;  7ICP A;  5J2E A;  2LM4 A;  5KFP A;  3NVV A;  4EZ9 A;  4UB5 A;  5AKY A;  5BPC A;  5DLF A;  1L5U A;  3EYZ A;  1L6N A;  1ZQV A;  1X9X A;  4ECY A;  2I5H A;  4U6P A;  5DDM A;  4GLX A;  3H4D A;  4NM1 A;  3AMZ A;  1MC8 A;  3KTQ A;  2VKQ A;  1L7P A;  4MFA A;  4C8K A;  3SI8 A;  1D9F A;  1J97 A;  3QUT A;  2PI5 A;  2P6R A;  3PX6 A;  1OXJ A;  2Y0S F;  5J29 A;  4DQI A;  1HUO A;  4UAS A;  2KN7 A;  1BPX A;  4FZL A;  2ZIW B;  4KIT B;  1NK6 A;  2QKQ A;  1Y88 A;  4YMO A;  2HHV A;  4UB1 A;  2JH1 A;  5J2K A;  1QSY A;  2PMZ C;  3EW9 A;  2BZF A;  4CRX A;  4JV2 A;  4P4M A;  3M8R A;  4GC7 A;  3KOO A;  1U48 A;  2PKE A;  4IQW A;  3MDC A;  1Q3V A;  4R65 A;  1UT5 A;  5KFB A;  7ICU A;  4XRH A;  4MF8 A;  1KFS A;  3SEN A;  3ETL A;  3M8S A;  2JEF A;  1IG6 A;  3WKD A;  3BDP A;  2KFZ A;  5ALH A;  5AI4 A;  1ARO P;  7ICE A;  3G6Y A;  4FO6 A;  7ICO A;  1X66 A;  3V7L A;  2R8I A;  1NK5 A;  2KE7 A;  2K4I A;  5ALN A;  2E1E A;  3AM9 A;  2ASL A;  5KT6 A;  1NJX A;  5HR7 A;  2OM6 A;  3BS5 A;  3L3F X;  4DFJ A;  3NGD A;  2EAP A;  4DOA A;  3M9O B;  5DLG A;  7ICG A;  2XO7 A;  1PZN A;  1SV0 C;  9ICS A;  3AU2 A;  3JPQ A;  2NRX A;  2MUT B;  4RU9 A;  3PX4 A;  4DF4 A;  4P0Q B;  5B66 U;  4QZG A;  5KFJ A;  5ALG A;  2XCP A;  8ICQ A;  3PML A;  8ICG A;  2E8M A;  8ICO A;  3FAH A;  5J0W A;  3RJJ A;  1SWV A;  4M6W A;  5J0R A;  5AKH A;  5CEH A;  5CP2 A;  3V6J A;  2EAM A;  4KLU A;  3T5H A;  5DQH A;  2O6K A;  3WK6 A;  3D2N A;  2KHV A;  2YMM A;  3RB6 A;  1D8L A;  8ICM A;  1WUD A;  3PZP A;  3SAF A;  2L5Y A;  4QZ9 A;  2BPF A;  8ICA A;  3F5A A;  3VC8 A;  5KFF A;  3N7P D;  1ZD3 A;  1UHU A;  2HVH A;  4B9N A;  1DGJ A;  1X6J A;  1ZQH A;  4EBE A;  5ALF A;  3SD7 A;  4IQU A;  5KG7 A;  9ICU A;  3SQI A;  2F2A B;  2AU0 A;  4KLM A;  3QU2 A;  2AH5 A;  1ZQU A;  2V4R A;  4KN7 A;  3UXP A;  1KEJ A;  5AKZ A;  3R9K A;  4KLF A;  3N28 A;  3PST A;  3F2C A;  1JXE A;  5KFA A;  1KQQ A;  4JV1 A;  3FC4 A;  5AKI A;  1ZRN A;  4DFM A;  3H0M B;  5ALM A;  5DQG A;  4DFP A;  3V7K A;  3AQF A;  2ISP A;  1DK3 A;  2YTU A;  2WF9 A;  2FE9 A;  2WB1 C;  1PVQ A;  7ICF A;  2QLT A;  3HT3 A;  3SAG A;  3H7I A;  5CR0 A;  2G5I B;  1TAM A;  5HR6 A;  4M9H A;  1S8O A;  3E2E A;  4Z6F A;  5ALU A;  1VLB A;  8ICU A;  3RRH A;  2BGW A;  4Y2V A;  3Q8Q B;  2MU2 A;  2XI9 A;  3OTQ A;  2DGZ A;  4B9V A;  2KKP A;  4NLG A;  2JRZ A;  1P7D A;  4US9 A;  5KG3 A;  2HOQ A;  3ORY A;  2HBK A;  3IP4 B;  4K4G A;  1S77 D;  4FS2 A;  4OJP A;  3C2K A;  5DBC A;  7ICN A;  3MGH A;  1ECW A;  1L8L A;  5J0Y A;  4EZ6 A;  8ICV A;  1RG6 A;  1NNL A;  3MBY A;  1JRO A;  4KLQ A;  3HKZ C;  3JPO A;  9ICC A;  3NVW A;  2KIV A;  4Q45 A;  2YX8 A;  4IQV A;  1FO4 A;  2ATL A;  3QEB Z;  3OPX A;  4UW9 A;  3ZD9 A;  4EEY A;  4ICA A;  3QNM A;  5J2A A;  2C2E A;  1JMS A;  2MUT A;  3MC1 A;  2P6U A;  4IR1 A;  2F3N A;  1U47 A;  4P0Q A;  1HIW A;  3WKB A;  5KAI U;  5C5J A;  3AQE A;  3BQ7 A;  1FIQ A;  4QWD A;  2XGP A;  4J9N A;  3UQ0 A;  1AQ6 A;  3MFH A;  4YR3 A;  1ZD2 P;  3TKA A;  4DCC A;  1ZQ1 C;  4Y2X A;  3JPN A;  3PO4 A;  3AN1 A;  3SAH A;  3WU2 U;  2ZTD A;  2VJ5 A;  2FMQ A;  4B9S A;  4RQ5 A;  1YT3 A;  4O0I A;  3MGV A;  1S0V A;  4UQG A;  1XC9 A;  3U26 A;  4UBB A;  3KZI U;  2LKY A;  1XO0 A;  1LV5 A;  4QZH A;  4PZO A;  2XGQ A;  2V4Q A;  3F5E A;  4UAV A;  2LYB A;  2VJ4 A;  1BPZ A;  2JZB B;  4RQ2 A;  5EWF A;  3V6K A;  2JR5 A;  2LI6 A;  2WFA A;  5AKG A;  1WG8 A;  1WYG A;  5EE9 A;  5ALZ A;  2YMP A;  2F1I A;  5F3X B;  2FLL A;  4KLG A;  5L1L A;  2VA2 A;  4OJ5 A;  3MFI A;  1T4G A;  2C2D A;  4AYB F;  2NV3 A;  5KFG A;  3J81 j;  4PJ0 U;  1JI7 A;  4DL2 A;  3PW0 A;  3MR5 A;  4RQN A;  1X9S A;  3V6H A;  1N56 A;  2W7O A;  3OSN A;  4FS1 A;  1DOQ A;  4F4W A;  1ZJN A;  2J6S A;  5JTI A;  1VJ5 A;  4CF5 A;  3Q8R B;  3FDS A;  4ED7 A;  2XVT A;  2DUY A;  1T3N A;  4YD1 A;  2BDP A;  1V85 A;  3QYP A;  1PK1 B;  2F8K A;  4K4H A;  7ICI A;  1LKY A;  2H3V A;  4YD2 A;  3F2D A;  4J9M A;  3N4M B;  4KLL A;  4KLJ A;  2AQ0 A;  3PW4 A;  4NL9 A;  4KLD A;  4UAW A;  2KIW A;  2K4E A;  4I27 A;  1N5X A;  5GTH U;  2XC9 A;  4QWA A;  2D6F C;  4OO1 J;  3HPO A;  5DB7 A;  4TUQ A;  1J2N A;  1Z19 A;  4G9B A;  1NK9 A;  4O5C A;  8ICI A;  4CE6 A;  3E0F A;  4U7C A;  4PHP A;  1QSL A;  4DLG A;  2BCU A;  1ZQZ A;  1O08 A;  1RYS A;  2H3Q A;  4RNO A;  1X9M A;  7ICH A;  2W3S A;  1N48 A;  3AL0 B;  3DEE A;  1BNP A;  4RQ8 A;  1N60 A;  5J2G A;  1O03 A;  4XUS A;  9ICI A;  4IR9 A;  3IN5 A;  5J0P A;  5AIC A;  1UCV A;  4KTQ A;  5AKE A;  1L3V A;  2DFL A;  3D2Q A;  2KVC A;  1ZQR A;  4I2H A;  2K89 A;  5JRT A;  2AHO B;  3C2L A;  3TAP A;  8ICH A;  4YMM A;  5KFW A;  1QTM A;  4AP9 A;  1B0X A;  4IQT A;  1JUD A;  8ICZ A;  4F92 B;  5AIA A;  4YFK A;  3THV A;  3GU3 A;  3RH5 A;  8ICK A;  4Y2R A;  3Q8L A;  1K1Q A;  4YN4 A;  4R64 A;  4QZI A;  4DQR A;  4PZN A;  1JXL A;  2NYV A;  4O3O A;  3ZI4 A;  1DRG A;  3ICX A;  4J9K A;  2JZB A;  2BQ3 A;  2KMD A;  3UMB A;  5CRX A;  4YMN A;  2FPM A;  2HBJ A;  2KVS A;  3KD3 A;  4UB2 A;  4EYI B;  4M47 A;  3RJG A;  4GC6 A;  5DB6 A;  1D8Y A;  3OJS A;  1A6S A;  1TAQ A;  4C0Z A;  9ICM A;  4YG2 A;  3BS7 A;  4P4P A;  2KV2 A;  2FLN A;  1COK A;  3OHA A;  3MAB A;  1TK0 A;  4DL4 A;  5KFY A;  4CGZ A;  2FI1 A;  1N2X A;  1K5O A;  1Z1V A;  2RLT A;  2ALZ A;  1RDF A;  4RZR A;  4Y2P A;  2R18 A;  8ICN A;  4YCX A;  4IRD A;  1PK1 A;  3UXN A;  2K4P A;  5KFQ A;  5HNK A;  2BQU A;  3RH4 A;  5TIS U;  2HOF A;  5D4B A;  3M9N B;  4ED1 A;  4QZA A;  1U49 A;  4AYB C;  2EZZ A;  4RQM A;  3NS1 A;  1RM6 C;  9ICJ A;  5ALI A;  4TQR A;  4DLE A;  3LWL A;  1NK7 A;  3I76 A;  3WK5 A;  2B6G A;  4EEK A;  1KSP A;  3KKA C;  2FMP A;  4DSL A;  2HCF A;  3N97 B;  1QH9 A;  1RYR A;  1Z1B A;  2WB1 F;  1YZ7 A;  4BJQ A;  4YP3 A;  9ICK A;  1HEK A;  2AQ4 A;  4QNL A;  5KFV A;  4UAZ A;  4ECZ A;  2KP7 A;  4QIW C;  7ICT A;  2ES6 A;  2EH9 A;  5L1K A;  5ALP A;  2F8L A;  2DPJ A;  4NLZ A;  3OGU A;  3PW2 A;  2NRT A;  3GV8 B;  3QUQ A;  4DSJ A;  4PL1 A;  4C4S A;  2ZXI A;  4K4I A;  1LVH A;  4UB4 A;  2KFN A;  2FJ6 A;  2I1Q A;  1NK8 A;  3MR2 A;  4Q43 A;  2BCQ A;  4QWB A;  3ISB A;  1KFD A;  2W43 A;  3HKZ F;  3L4P A;  2HBM A;  5IIL A;  2F1J A;  5AM3 A;  5CB1 A;  5KFH A;  3SZ2 A;  2UVV A;  4QWE A;  4I29 A;  1ZQI A;  2PFO A;  2VIX A;  2AGO A;  3RB0 A;  4B9L A;  2Y1I A;  4P0P B;  3JPR A;  4ED6 A;  5J0Q A;  2HI0 A;  3UMG A;  4ECS A;  3RR7 A;  9ICQ A;  4ED2 A;  3RB3 A;  1NZB A;  5HP4 A;  9ICB A;  1Q8K A;  3C23 A;  1UQV A;  5J0X A;  2R8J A;  8ICB A;  5AI5 A;  4BXO B;  2YB1 A;  4RQ3 A;  2V9W A;  2D3D A;  4KLI A;  2BCS A;  3B9J A;  3BQT A;  1EXN A;  4TUS A;  2OEH A;  1ZD5 A;  4ECW A;  4GXJ A;  2NRZ A;  1ZQE A;  3RRG A;  3H40 A;  4FFD A;  2ZTC A;  3ONN A;  1BPD A;  5KFZ A;  1GO3 F;  2B21 A;  2XID A;  5J8Y A;  4YXJ A;  3BQ1 A;  5AK6 A;  5JU5 A;  4KLS A;  1XSN A;  5AM1 A;  2JV3 A;  1SL1 A;  3KBB A;  2XY6 A;  9ICE A;  4IL6 U;  5BOL A;  3H0R B;  5HHI A;  1XWL A;  3CNH A;  8ICY A;  4DFK A;  2LBO A;  5AKX A;  4UAY A;  2Q4T A;  3KHL A;  3TAR A;  1ZQC A;  3M6Z A;  1NKB A;  4Y2J A;  5BOM A;  4PHA A;  3RAQ A;  9ICH A;  3ZDE A;  4ED0 A;  2E8O A;  3NVZ A;  2KK0 A;  4ED8 A;  2GOL A;  1A76 A;  2HHQ A;  4J9S A;  1CRX A;  4O3R A;  3T5K A;  1IIP A;  3NUQ A;  1TK8 A;  4DQP A;  1XSL A;  3RAX A;  3PW7 A;  2E3T A;  4FZM A;  3K1R B;  1UA1 A;  5AK4 A;  3PMN A;  4B9U A;  2KSO B;  4RT3 A;  3LVW A;  1TKD A;  4M2Y A;  2JH7 A;  4DL3 A;  4X5V A;  2MSN A;  3DDH A;  3QZ7 A;  2D8C A;  3Q8S B;  1CEZ A;  1N62 A;  5KG5 A;  2YN4 A;  3KHG A;  2ODG A;  8ICW A;  2HHW A;  2BDU A;  2ESE A;  3T3F A;  4RQ6 A;  2YML A;  2A19 A;  2H3Z A;  2KJ5 A;  4LZD A;  5KG0 A;  2W04 A;  5KT3 A;  1S0N A;  2RP5 A;  4M9G A;  3TAD A;  5IIK A;  3HJE A;  4P0P A;  1COO A;  4I28 A;  4PGX A;  4DL6 A;  1FFV A;  1BPY A;  1Z4O A;  4OD0 A;  1LKY B;  5KG6 A;  2W9C B;  4Z6E A;  2CRX A;  4RT2 A;  4BXO A;  5G5H A;  9ICF A;  3M6K A;  4GXI A;  4FE3 A;  4F2R A;  4LVS A;  8ICF A;  2DKX A;  3SMV A;  5KG2 A;  2E8N A;  2RQ5 A;  4P2H A;  5J2H A;  3PV8 A;  2QB0 B;  1V9P A;  2ASD A;  2GWS A;  2F77 X;  9ICX A;  4ECT A;  4NLC A;  1L3U A;  1SXD A;  5TZV A;  2KD1 A;  3EUB 2;  3Q8M A;  2KJ9 A;  3CYM A;  3M7D A;  1C20 A;  1XU4 A;  5KL1 B;  2GO7 A;  2A1J A;  1SXE A;  4I2J A;  4I2F A;  1PVP A;  4DSE A;  3OHB A;  4Y2U A;  2PI4 A;  4C8O A;  4JB3 A;  1RXV A;  1X6I A;  1F0M A;  2B0C A;  1VDV A;  4I2D A;  4NM2 A;  2R8K A;  3IDW A;  3T5J A;  4PH5 A;  1ZQP A;  3QE9 Y;  5IIO A;  2DWQ A;  1ZQY A;  3GFK B;  1JIH A;  3PO5 A;  1U45 A;  4QZB A;  4USA A;  4M9L A;  2KSO A;  4EEN A;  1ZRM A;  3ZDC A;  4RPX A;  3UMC A;  5DGB A;  1RYU A;  3UXO A;  1SWW A;  1S10 A;  3HX0 A;  2VA3 A;  1BNO A;  3IHQ B;  4QW8 A;  1JN3 A;  3PNC A;  5ALL A;  2PXI A;  1QSS A;  2PFQ A;  2OHF A;  1H38 A;  4O3P A;  1TAU A;  4CF3 A;  1ZJM A;  1URJ A;  3RF9 A;  5JUM A;  4F5P A;  1SZP A;  2VA8 A;  4C4T A;  3O0F A;  2AGQ A;  5KFR A;  4QIW F;  2UVW A;  3RJE A;  2W9B B;  1T7P A;  4RQ1 A;  3MGI A;  4B9M A;  3HP6 A;  3RJI A;  2KG5 A;  3KHR A;  4OJ6 A;  2ZTE A;  4F72 A;  2W9C A;  1CUK A;  2OCE A;  4PGY A;  3V7J A;  2HHS A;  1KW4 A;  1NZP A;  1L3S A;  3ISD A;  2AJQ A;  3ZDB A;  5ALY A;  3E58 A;  4FZN A;  2W9M A;  1B4F A;  1SZH A;  4BWJ A;  9ICG A;  5ALQ A;  5GTI U;  4KN4 A;  2ZUD A;  1ZQS A;  2QB0 A;  1SB3 C;  4BX9 C;  9ICV A;  1ZQW A;  2AGP A;  8ICE A;  1ZXI A;  5DQI A;  1Q3U A;  2ZIU B;  2IMW P;  2MAX A;  3TAD C;  4DSF A;  1WWU A;  2JEG A;  4BUG A;  4US8 A;  2F1H A;  4O3S A;  2ZG6 A;  1X42 A;  5KFO A;  4F50 A;  4DWI A;  4F4K A;  2Y9T A;  5E79 U;  2BHN A;  2P66 A;  2W8K A;  1D9D A;  4KMO B;  3QEA Z;  1S97 A;  3H0L B;  3JPS A;  5EE0 A;  4F5R A;  2Z7J A;  3QU5 A;  4MHV A;  4DO9 A;  2KJ8 A;  7ICS A;  4KLE A;  1L8O A;  5H2F U;  2G09 A;  2GH1 A;  5AKL A;  2RDI A;  2G07 A;  2G0A A;  1QQ7 A;  3WKE A;  1SKR A;  1V97 A;  3NAS A;  1KKX A;  2C2R A;  2LHT A;  5CJ7 A;  2E5S A;  5EWG A;  4F3O A;  4EBD A;  3KHH A;  4XQ8 A;  4JWN A;  4F2S A;  1HUZ A;  4E0D A;  2HDO A;  3SR6 A;  3OSP A;  3BQ2 A;  5L1M A;  1ED1 A;  1KRP A;  2HHU A;  4Y2Y A;  3I1Y A;  4RPZ A;  3UQ2 A;  1SKS A;  4ECR A;  2ASJ A;  1RQN A;  1ZYQ A;  4Y2S A;  4DSK A;  2IOF A;  1QQ6 A;  2YMQ A;  3M9M B;  2PFP A;  4J9O A;  4HAI A;  3V72 A;  3C1Y A;  4MEY A;  4QW9 A;  4EYH B;  1NJZ A;  5AM4 A;  1RZT A;  1MSW D;  3QUB A;  2KZ3 A;  1KDH A;  3Q8K A;  5J2D A;  1QQ5 A;  1S5L U;  1SV0 A;  4YR0 A;  3T79 A;  5J0U A;  2HHX A;  4JV0 A;  3HRD D;  1F5S A;  1L7N A;  2HW3 A;  7ICJ A;  2NRV A;  4RQ7 A;  4O9M A;  3WKA A;  2HBL A;  3IG8 A;  5IIM A;  1ZQQ A;  5ALW A;  2CXY A;  2K8A A;  2ZUB A;  3FM9 A;  2BKE A;  4A8E A;  5J2F A;  2ZIV A;  4I2E A;  3ZD8 A;  2W9B A;  8ICS A;  5DG7 A;  5KAF U;  2EAN A;  4DS5 A;  3TQ1 A;  1X40 A;  3RR8 A;  3TAC B;  5F9N A;  4DQQ A;  5J0T A;  2E8P A;  3D2S A;  2I6X A;  1NK0 A;  4NLB A;  4PHD A;  4EX7 A;  3GIJ A;  5J2I A;  4FBT A;  4O5E A;  2C28 A;  1PUZ A;  7ICM A;  5AIB A;  4GXK A;  4Z6C A;  2ZUC A;  3I28 A;  1MA7 A;  2W03 A;  2BCR A;  2ISO A;  2KIC A;  4DQS A;  4Y2T A;  5AM5 A;  3LK9 A;  1DXS A;  4ECX A;  3IRU A;  3WK7 A;  2ZIU A;  1FEZ A;  1ZQX A;  3JPT A;  1KFT A;  4RQ0 A;  2K8B B;  4M9J A;  2HVI A;  5AHX A;  2ZXH A;  3C5G A;  5ALK A;  5AI9 A;  1TK5 A;  4NXZ A;  3GIK A;  2F76 X;  5ALJ A;  7ICK A;  5AI8 A;  2WAQ F;  4ECV A;  3KFU F;  5IIN A;  2KZM A;  1L7O A;  3B0X A;  2W9A A;  3K75 D;  4NL9 C;  4EBC A;  4QJF B;  4C4R A;  5ALT A;  1SV4 A;  1TFR A;  2BCV A;  1SIJ A;  2YY6 A;  4F5N A;  8ICX A;  2ZJ5 A;  1SGG A;  1XNS A;  4LJX A;  2ZJ8 A;  5DKW A;  2BPG A;  5HML A;  9ICW A;  3CP8 A;  3KZX A;  4CDG A;  4CCH A;  2EZY A;  3PVX A;  2RHF A;  3F53 A;  2XY7 A;  2OWO A;  4ZOH C;  1Q46 A;  3RBE A;  4G3I A;  1ZOL A;  5KFE A;  5EWE A;  3GV5 B;  2P35 A;  3N7S C;  3GDX A;  5ALR A;  2WTF A;  2IHM A;  2JXJ A;  2M9N A;  4RNN A;  1QCK A;  3BZC A;  3F2B A;  4IRC A;  3H8S A;  4J9R A;  4JK1 A;  4C80 A;  3N7R C;  4UB8 U;  3PY8 A;  4J03 A;  3L5K A;  2ZIX B;  5J0S A;  3PX0 A;  3LWM A;  5AI6 A;  2DKZ A;  1PK3 A;  5KFS A;  4NY8 A;  5KTQ A;  4F5O A;  3HW8 A;  1S0M A;  5KFC A;  1U4B A;  1LB2 B;  4MF2 A;  5AI0 A;  4XA5 A;  2OH2 A;  1SKW A;  2IBK A;  1A77 A;  4EEL A;  7ICL A;  1UT8 A;  4ELV A;  2Q0Z X;  3LYS A;  3C28 A;  1ZQN A;  1UA0 A;  4F71 A;  1NJY A;  3LDA A;  5KT4 A;  5KFM A;  2DBY A;  1CI4 A;  5T14 A;  2FLP A;  4Q44 A;  2GLE A;  2JMG A;  3RH6 A;  2A1J B;  1X2I A;  2JHD A;  2MA1 A;  5AK5 A;  1FFU A;  3C2M A;  4R8U B;  5F9L A;  2H3I A;  1KTQ A;  3LVV A;  1N63 A;  1MN8 A;  5CHG A;  4TQS A;  3VCB A;  1S0O A;  2G08 A;  4RNM A;  4OJL A;  1QLN A;  2ZJA A;  4C8M A;  2IHN A;  4ZH4 A;  3EZ5 A;  3G6X A;  1OW5 A;  4DL5 A;  1B22 A;  2NO5 A;  3PW5 A;  3RJF A;  2AXT U;  4J9P A;  4M0A A;  1T3Q A;  3IG5 A;  4C8N A;  3H8W A;  1ZQT A;  4F91 B;  1YZ6 A;  3SV4 A;  5J2J A;  3K1Z A;  2KHQ A;  8ICL A; 
#chains in the Genus database with same CATH homology
 8ICZ A;  3EPI A;  4F92 B;  2R8K A;  5CWR A;  5BPC A;  5DLF A;  3T5J A;  4YFK A;  3EYZ A;  3THV A;  1ZQV A;  1L5U A;  4PH5 A;  3RH5 A;  1ZQP A;  8ICK A;  4R66 A;  3QE9 Y;  3Q8L A;  4ECY A;  1RXW A;  5IIO A;  3PR5 B;  1SL0 A;  1K1Q A;  5EOZ A;  4YN4 A;  5DDM A;  4GLX A;  4R64 A;  2RDJ A;  4QZI A;  1ZQY A;  3C21 A;  4KMU A;  4DQR A;  3GFK B;  1JIH A;  3H4D A;  1JXL A;  3PO5 A;  1U45 A;  4QZB A;  4M9L A;  4O3O A;  1XO1 A;  1Z3E B;  4NM1 A;  5DB9 A;  2BQR A;  1MC8 A;  7ICQ A;  3KTQ A;  4MFA A;  3ZDC A;  4J9K A;  2JZB A;  4DL7 A;  4C8K A;  3SI8 A;  4RPX A;  3B0Y A;  2BQ3 A;  1D9F A;  5DGB A;  2PI5 A;  4YMN A;  2P6R A;  3UXO A;  3PX6 A;  2FPM A;  5J29 A;  4DQI A;  1S10 A;  1HUO A;  2KN7 A;  3HX0 A;  4UB2 A;  5HMM A;  3IHQ B;  2VA3 A;  1BPX A;  2FPK A;  2J6T A;  4EYI B;  4QW8 A;  4M47 A;  3RJG A;  5CA7 A;  1JN3 A;  4KIT B;  1NK6 A;  4GC6 A;  5DB6 A;  3PNC A;  1Y88 A;  4P4O A;  4I2G A;  1D8Y A;  2PXI A;  3OJS A;  1TAQ A;  1QSS A;  4Z6D A;  1Z00 B;  2PFQ A;  4YMO A;  2HHV A;  9ICM A;  4UB1 A;  4DEZ A;  5J2K A;  1QSY A;  1RPL A;  1H38 A;  4O3P A;  1WCL A;  3BJY A;  1TAU A;  3EW9 A;  4YG2 A;  1ZJM A;  4P4P A;  1ZQF A;  2FLN A;  4JV2 A;  4P4M A;  3OHA A;  3M8R A;  3MAB A;  3H8J A;  4GC7 A;  1U48 A;  1TK0 A;  4DL4 A;  5KFY A;  5JUM A;  4IQW A;  3MDC A;  3NTU A;  4YQW A;  4R65 A;  2I9G A;  4F5P A;  4UBC A;  1UT5 A;  5KFB A;  4BGD A;  1SZP A;  2VA8 A;  7ICU A;  1ZQO A;  4JWM A;  4XRH A;  2ALZ A;  2AGQ A;  4MF8 A;  1KFS A;  4J9Q A;  3ETL A;  1U9L A;  5KFR A;  2UVW A;  2W9B B;  1T7P A;  3RJE A;  1BPE A;  4RQ1 A;  3MGI A;  3M8S A;  2JEF A;  4B9M A;  4RZR A;  3BDP A;  2KFZ A;  3HP6 A;  3RJI A;  3KHR A;  4MFF A;  2ZTE A;  2W9C A;  1ARO P;  1CUK A;  7ICE A;  4PGY A;  3G6Y A;  3V7J A;  3UPQ A;  4FO6 A;  3RTV A;  3TFR A;  2HHS A;  3RB4 A;  7ICO A;  2H5X A;  3V7L A;  2R8I A;  4YCX A;  1NK5 A;  1L3S A;  3ISD A;  2AJQ A;  4IRD A;  3ZDB A;  1WCN A;  1NOM A;  3UXN A;  5KT6 A;  2ASL A;  1NJX A;  1BGX T;  5KFQ A;  5HNK A;  2W9M A;  4QZD A;  4QWC A;  4DOC A;  3RH4 A;  2BQU A;  4DFJ A;  5D4B A;  1ZQA A;  3NGD A;  4YVZ A;  3EWA A;  4BWJ A;  3M9N B;  3M9O B;  4DOA A;  5DLG A;  4ED1 A;  4YXM A;  2XY5 A;  2C22 A;  7ICG A;  2XO7 A;  9ICG A;  4QZE A;  1PZN A;  4QZA A;  1U49 A;  4KN4 A;  2ZUD A;  1ZQS A;  9ICS A;  5J0O A;  9ICV A;  1ZQW A;  3AU2 A;  1T8E A;  3JPQ A;  2NRX A;  2AGP A;  2MUT B;  4PGQ A;  8ICE A;  4RU9 A;  5DQI A;  1XSP A;  4O3Q A;  9ICJ A;  3PX4 A;  4DF4 A;  2IMW P;  4QZG A;  2MAX A;  4TQR A;  2DPI A;  5KFJ A;  2XCP A;  4O3N A;  4DSF A;  4DLE A;  2JEG A;  3LWL A;  3AU6 A;  1NK7 A;  4IRK A;  3PML A;  8ICQ A;  2F1H A;  4M9N A;  4O3S A;  5KFO A;  8ICG A;  4F50 A;  8ICO A;  1KSP A;  4DWI A;  4F4K A;  3C1Z A;  4R8U A;  5J0W A;  5KG1 A;  2FMP A;  3RJJ A;  4DSL A;  2JEI A;  4M6W A;  5J0R A;  2BHN A;  4QZC A;  2P66 A;  2W8K A;  5CP2 A;  3N97 B;  1D9D A;  4KLH A;  3V6J A;  3QEA Z;  4KLU A;  1RYR A;  1S97 A;  3T5H A;  5DQH A;  4J9L A;  5DBA A;  3JPS A;  4YP3 A;  4F5R A;  9ICK A;  2AQ4 A;  5KFV A;  4UAZ A;  4DO9 A;  4ECZ A;  7ICS A;  4KLE A;  4I2B A;  4O5K A;  1XS9 D;  3RB6 A;  5L1J A;  8ICJ A;  2RDI A;  1D8L A;  1SKR A;  4Q8F A;  8ICM A;  7ICT A;  9ICP A;  5L1K A;  1K1S A;  4Q8E A;  4QZ9 A;  2BPF A;  8ICA A;  4NLK A;  5KFF A;  2C2R A;  1TVA A;  3K4G A;  5CJ7 A;  2DPJ A;  4NLZ A;  5EWG A;  4F3O A;  4EBD A;  3KHH A;  4XQ8 A;  3OGU A;  3PW2 A;  2NRT A;  3GV8 B;  1ZQM A;  4F2S A;  1HUZ A;  4E0D A;  4JWN A;  8ICC A;  1NK4 A;  4YR2 A;  5KFT A;  3OSP A;  2HVH A;  3BQ2 A;  4DSJ A;  3H4B A;  4B9N A;  1ZQJ A;  1KRP A;  2HHU A;  1ZQD A;  4K4I A;  4UB4 A;  2KFN A;  1ZQH A;  4F4Y A;  3GIL A;  5KG4 A;  4EBE A;  2I1Q A;  5D49 A;  4KLO A;  4IQU A;  4RPZ A;  3UQ2 A;  5KG7 A;  4ECR A;  1NK8 A;  1SKS A;  1NKE A;  9ICU A;  3MR2 A;  2ASJ A;  5L9X A;  4Q43 A;  2AU0 A;  1ZYQ A;  4KLM A;  1MQ2 A;  2BCQ A;  3T5L A;  4DSK A;  1ZQU A;  2V4R A;  8ICT A;  4KN7 A;  3UXP A;  4QWB A;  3M9M B;  2PFP A;  1KEJ A;  3ISB A;  1KFD A;  1S76 D;  4J9O A;  4KLF A;  4LZG A;  3V72 A;  1JXE A;  5KFA A;  5IIL A;  3C1Y A;  3FYH A;  2F1J A;  5CB1 A;  5KFH A;  3SZ2 A;  2UVV A;  4JV1 A;  4MEY A;  4QW9 A;  1NKC A;  4EYH B;  1NJZ A;  1ZQL A;  1RZT A;  1MSW D;  1HJP A;  4DFM A;  4QWE A;  4I29 A;  5DQG A;  2KZ3 A;  3MDA A;  4DFP A;  3Q8K A;  3V7K A;  5J2D A;  4HYK A;  1KDH A;  1ZQI A;  2PFO A;  4ED3 A;  3RB0 A;  2AGO A;  2ISP A;  2Y1I A;  3ZDD A;  4B9L A;  1L3T A;  3JPR A;  4ED6 A;  5J0Q A;  4YR0 A;  5DG9 A;  3OJU A;  5J0U A;  3ISC A;  4ECS A;  3RR7 A;  7ICF A;  9ICQ A;  4ED2 A;  4DF8 A;  3HT3 A;  3RB3 A;  5HP4 A;  4JV0 A;  1Z00 A;  5J2B A;  2HHX A;  9ICB A;  3H7I A;  5CR0 A;  3C23 A;  2HW3 A;  7ICJ A;  5J0X A;  4M9H A;  3E2E A;  2NRV A;  2R8J A;  4Z6F A;  4RUA A;  4DOB A;  4RQ7 A;  4C8L A;  3AUO A;  4O9M A;  8ICB A;  8ICU A;  4BXO B;  1DGS A;  3RRH A;  2BGW A;  5IIM A;  1ZQQ A;  8ICR A;  3Q8Q B;  2ZUB A;  3G6V A;  2BKE A;  4JUZ A;  4B9V A;  4RQ3 A;  5J2F A;  2V9W A;  4NLG A;  4KLI A;  2BCS A;  3BQT A;  5KG3 A;  5KT2 A;  1EXN A;  2XCA A;  3ORY A;  4TUS A;  3MR3 A;  4I2E A;  4K4G A;  1S77 D;  9ICR A;  3ZD8 A;  2W9B A;  4ECW A;  5DG8 A;  8ICS A;  4FS2 A;  4GXJ A;  2NRZ A;  3EPG A;  2R8H A;  3C2K A;  1ZQE A;  5DBC A;  3H40 A;  5DG7 A;  3RRG A;  3C5F A;  7ICN A;  3MGH A;  4DS5 A;  3TQ1 A;  2ZTC A;  2BR0 A;  4F8R A;  3RR8 A;  1X9W A;  5F9N A;  5III A;  5J0Y A;  4DQQ A;  4I2C A;  5J0T A;  3ZDA A;  4EZ6 A;  1BPD A;  8ICV A;  4MEX A;  5KFZ A;  1NK0 A;  9ICA A;  3MBY A;  4PHD A;  2B21 A;  3GIJ A;  5J2I A;  4FBT A;  4O5E A;  2C28 A;  4KLQ A;  3JPO A;  7ICM A;  9ICC A;  4YXJ A;  3BQ1 A;  4Q45 A;  4ECQ A;  4GXK A;  2UVU A;  4M04 A;  5J2C A;  9ICO A;  4IQV A;  2ATL A;  3QEB Z;  4KLS A;  4Z6C A;  2ZUC A;  1XSN A;  2BCR A;  2ISO A;  3ZD9 A;  1SL1 A;  4EEY A;  4NLN A;  4DQS A;  2XY6 A;  4MFC A;  5J2A A;  5L1I A;  2C2E A;  1JMS A;  2MUT A;  3LK9 A;  2FMS A;  9ICE A;  4ECX A;  5BOL A;  2P6U A;  4IR1 A;  4PPX A;  1U47 A;  4F93 B;  1IM4 A;  1ZQX A;  3JPT A;  2IA6 A;  5HHI A;  1XWL A;  8ICY A;  5C5J A;  2JEJ A;  4DFK A;  4RQ0 A;  1KFT A;  4M9J A;  4UAY A;  2HVI A;  2BPC A;  3KHL A;  3C5G A;  4QWD A;  3TAR A;  1ZQC A;  1TK5 A;  2XGP A;  1NKB A;  4J9N A;  4NXZ A;  3GIK A;  3UQ0 A;  2LYH A;  5BOM A;  4PHA A;  3MFH A;  4YR3 A;  4FBU A;  2KZZ A;  3RAQ A;  9ICH A;  3ZDE A;  4ED0 A;  5IIJ A;  7ICK A;  4BDP A;  2VAN A;  5D46 A;  3RBD A;  4ECV A;  4DSI A;  3JPN A;  5IIN A;  3PO4 A;  2KZM A;  3PR4 A;  3B0X A;  4ED8 A;  2HHQ A;  1A76 A;  2ZTD A;  3K75 D;  2W9A A;  4EBC A;  2FMQ A;  4J9S A;  3QZ8 A;  4RQ5 A;  4B9S A;  4O0I A;  4O3R A;  3T5K A;  1S9F A;  1TK8 A;  1S0V A;  4DQP A;  1XSL A;  4UQG A;  1ZQG A;  2PFN A;  1XC9 A;  3RAX A;  3PW7 A;  9ICT A;  4UBB A;  1UA1 A;  1BPB A;  1TFR A;  1LV5 A;  2BCV A;  4QZH A;  8ICX A;  4F5N A;  2XGQ A;  2V4Q A;  2ZJ5 A;  1IXR A;  3PMN A;  2ZJ8 A;  4B9U A;  5DKW A;  5DB8 A;  2BPG A;  1BPZ A;  4RT3 A;  5HML A;  2JZB B;  4F4Z A;  4RQ2 A;  5EWF A;  3V6K A;  9ICW A;  3TI0 A;  3TAQ A;  4I2A A;  1TKD A;  4M2Y A;  4X5V A;  4DL3 A;  4CCH A;  3QZ7 A;  3Q8S B;  2Y1J A;  1NJW A;  1CEZ A;  3GIM A;  3PVX A;  5KG5 A;  1ZQK A;  3IM1 A;  4TUR A;  3KHG A;  3SYZ A;  8ICW A;  2HHW A;  2F1I A;  2XY7 A;  2OWO A;  8ICP A;  3T3F A;  3MR6 A;  3RBE A;  2FLL A;  4G3I A;  1B43 A;  5KFE A;  1C7Y A;  5EWE A;  4KLG A;  5L1L A;  3GV5 B;  4RQ6 A;  2VA2 A;  5DBB A;  3RJK A;  3GDX A;  2WTF A;  3MFI A;  2IHM A;  4LZD A;  1T4G A;  2C2D A;  7ICR A;  2M9N A;  2KTQ A;  4RNN A;  1JX4 A;  4F4X A;  5KFG A;  5KG0 A;  5KT3 A;  3SV3 A;  5KT5 A;  4DL2 A;  7ICV A;  1S0N A;  4IRC A;  3PW0 A;  3MR5 A;  5KFN A;  3H8S A;  4J9R A;  4JK1 A;  1X9S A;  5KFD A;  3V6H A;  2R8G A;  4ELT A;  4M9G A;  1N56 A;  5IIK A;  3PY8 A;  3OSN A;  4FS1 A;  5J0S A;  4ELU A;  3PX0 A;  3LWM A;  1DOQ A;  5KFS A;  1COO A;  4F4W A;  4RUC A;  4I28 A;  4NY8 A;  4PGX A;  3BQ0 A;  4DL6 A;  1BPY A;  5KTQ A;  4F5O A;  1ZJN A;  2J6S A;  3HW8 A;  1S0M A;  5KFC A;  1U4B A;  5KG6 A;  1LB2 B;  2UVR A;  4MF2 A;  4XA5 A;  3Q8R B;  2W9C B;  1KLN A;  3FDS A;  4Z6E A;  1ZQB A;  1SKW A;  5HHH A;  4ED7 A;  2IBK A;  1A77 A;  5DDY A;  4RT2 A;  1T3N A;  4BXO A;  7ICL A;  4YD1 A;  5KFX A;  3TAN A;  9ICF A;  2BDP A;  3HWT A;  1UT8 A;  4GXI A;  4K4H A;  4F2R A;  4ELV A;  4LVS A;  8ICF A;  7ICI A;  2Q0Z X;  4R63 A;  1BVS A;  2FPL A;  5KG2 A;  4TUP A;  4F5Q A;  1ZET A;  1ZQN A;  9ICN A;  4YD2 A;  2NRW A;  4P2H A;  1UA0 A;  4J9M A;  3N4M B;  4KLL A;  5J2H A;  4KLJ A;  3PV8 A;  4RQ4 A;  1NJY A;  2AQ0 A;  2J6U A;  3RJH A;  3LDA A;  4I2I A;  3PW4 A;  5KT4 A;  4KLD A;  1V9P A;  5KFM A;  4UAW A;  1MQ3 A;  4I27 A;  1TV9 A;  2ASD A;  2XC9 A;  4QWA A;  2GWS A;  3HPO A;  5DB7 A;  5KFL A;  9ICX A;  5KFU A;  4PHE A;  4TUQ A;  3Q8P B;  3GII A;  2W8L A;  4ECT A;  2FLP A;  1NK9 A;  4O5C A;  8ICI A;  4DS4 A;  4Q44 A;  3RH6 A;  3GV7 B;  1L3U A;  2A1J B;  1X2I A;  5TZV A;  3C2M A;  5KFK A;  3Q8M A;  9ICL A;  4R8U B;  4PHP A;  5F9L A;  5DGA A;  1KTQ A;  4M6W B;  1QSL A;  4DLG A;  3JPP A;  4B9T A;  1XU4 A;  2BCU A;  1ZQZ A;  2HHT A;  1RYS A;  5CHG A;  4TQS A;  1S0O A;  1X9M A;  4RNO A;  7ICH A;  2A1J A;  4ECU A;  1N48 A;  4BWM A;  4RNM A;  4RQ8 A;  4QZ8 A;  1QLN A;  4I2J A;  5J2G A;  3GQC A;  4I2F A;  4XUS A;  9ICI A;  4IR9 A;  2ZJA A;  4UB3 A;  4C8M A;  5J0P A;  4DSE A;  2IHN A;  4ZH4 A;  3EZ5 A;  4KTQ A;  3OHB A;  3G6X A;  8ICN A;  4DL5 A;  1L3V A;  4KLT A;  2DFL A;  4QZF A;  4RPY A;  3PW5 A;  3RJF A;  4J9P A;  5KT7 A;  1B22 A;  1SL2 A;  4M0A A;  3TFS A;  1ZQR A;  4I2H A;  2PI4 A;  5KFI A;  4C8O A;  4C8N A;  3H8W A;  1ZQT A;  4F91 B;  3C2L A;  1RXV A;  3TAP A;  3SV4 A;  8ICH A;  5J2J A;  7ICP A;  4YMM A;  5KFW A;  5KFP A;  5J2E A;  1QTM A;  4I2D A;  4NM2 A;  4EZ9 A;  4UB5 A;  4IQT A;  8ICL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...