1COOA

The cooh-terminal domain of rna polymerase alpha subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
b'FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Solution structure of the activator contact domain of the RNA polymerase alpha subunit.
pubmed rcsb
source organism Escherichia coli
molecule tags Nucleotidyl transferase
total genus 10
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 1995-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1cooA00
3RR7A 4YMOA 4KLJA 7ICQA 5J0OA 4P2HA 3H7IA 3AUOA 4FBUA 9ICGA 5KG6A 4O3NA 4ED7A 3SI8A 3RAXA 1RXVA 1QSSA 1Z00B 5HNKA 5KFFA 4J9NA 2V4RA 2GWSA 4Q45A 3PNCA 2A1JB 3OJUA 9ICJA 2ZTCA 4DFPA 5KFBA 2W9BA 3HPOA 2JEIA 4KMUA 8ICSA 5KG5A 4R63A 3V6HA 1S9FA 5J29A 4KLEA 4RPZA 2W8KA 2ZJ5A 1MQ2A 4KLSA 4YD2A 1L3UA 3RJJA 5KFMA 8ICTA 2BDPA 3MFHA 3MGHA 1TAUA 5KFIA 3T5JA 5CJ7A 4ECVA 4QW9A 2UVRA 4F2SA 5D4BA 3T5LA 4NXZA 5J0YA 4KITB 3EYZA 2PI4A 9ICCA 3BQTA 4IQVA 2UVUA 3RR8A 5J0UA 5CR0A 5DQHA 1X9SA 2VANA 3PO5A 5KFPA 1SKRA 1NK9A 5DB9A 4F92B 3H8WA 4I2FA 2RDIA 3MABA 1NK7A 2W9CA 1LV5A 4F5QA 4I2HA 3KHRA 1MSWD 5J2CA 3OGUA 5DQIA 8ICXA 3BQ1A 4K4HA 4B9NA 3Q8PB 4IR9A 4M9HA 2HW3A 3PVXA 1ZQNA 1D9DA 9ICQA 5KFLA 2JZBB 4GC6A 5J0XA 8ICZA 4Z6CA 2ZTEA 1MQ3A 3JPOA 9ICKA 5J0TA 4F4XA 8ICHA 1U49A 3GIIA 1BGXT 3PV8A 3MBYA 2J6UA 9ICWA 4YMMA 3Q8QB 4BXOA 3E2EA 4RQ2A 1HJPA 3JPRA 4RQ8A 4TURA 3MDCA 1TFRA 4RUCA 1C7YA 3V7KA 3LWMA 4JWMA 1S0VA 7ICJA 1U4BA 2XCAA 2FMPA 1U45A 5KFDA 2DPJA 4DOAA 4EEYA 3OSPA 4P4OA 3N4MB 2VA2A 4O5KA 5KG2A 3RJGA 1WCNA 4YR2A 3GV5B 4CCHA 4J9KA 1JMSA 3PR4A 1A77A 3BQ2A 1QLNA 2I9GA 2XO7A 3MR6A 2PFPA 4I2CA 1TVAA 5KFVA 2KZMA 8ICYA 4YD1A 4M0AA 4UAWA 4PHDA 1ZQOA 4Z6DA 5KFQA 1NKCA 2MUTB 4DO9A 1S0NA 4I2GA 4Q43A 3PW7A 4EBCA 9ICXA 1U9LA 2UVVA 5DLFA 2C28A 1KSPA 5DB7A 1BPDA 4KLDA 3LDAA 1ZQRA 4KLFA 4EZ9A 5EOZA 4JV1A 4YMNA 4Z6EA 3LK9A 3PX6A 2NRVA 1S10A 4DLEA 4I2AA 1COOA 3C5FA 2J6SA 3GDXA 3ZDCA 7ICKA 2B21A 1D8LA 3PR5B 4R8UA 3PMLA 5DBCA 4YR0A 2BQUA 3RB4A 2VA3A 3TI0A 8ICCA 3V72A 2AGQA 4C8OA 2IHMA 2ASLA 1EXNA 2ZJ8A 1KFDA 4UB3A 4TUPA 5CB1A 4DQQA 4M2YA 2XGPA 4I2IA 4F5NA 3C21A 7ICOA 4KLOA 4I2JA 1BPZA 4EBEA 3UXPA 4R65A 4DOCA 5DB8A 4JV0A 3B0YA 3NTUA 7ICVA 4NLNA 2BPGA 4M04A 5TZVA 4XQ8A 2BCSA 2Q0ZX 4P4MA 4UB4A 5KFOA 4ECUA 3TFSA 1NJWA 4YN4A 4F4KA 1JIHA 7ICIA 3H8JA 3V6KA 8ICKA 5J2JA 4DSFA 3M9OB 3MFIA 4F4WA 5KFUA 1ZQDA 2BPCA 4B9SA 2Y1IA 3GV7B 2NRWA 2HVHA 3HT3A 3SYZA 4E0DA 3RTVA 4I2BA 2HVIA 1N56A 1JXEA 1SL1A 4QZCA 4KLLA 4PGYA 5DQGA 4I29A 5CP2A 1HUOA 4B9LA 3KHGA 4ECZA 1BPBA 1KEJA 3RH4A 5KFRA 3IM1A 5J2HA 1XSPA 3C2MA 4QZGA 4DS5A 1ZQIA 4QZBA 4MF8A 4ELVA 8ICAA 4ECRA 5J0QA 3JPNA 2C22A 4O0IA 3KTQA 3QZ8A 4JWNA 1SKWA 5CWRA 2F1JA 5DDYA 4LZGA 4IQTA 2OWOA 4DEZA 4QZ9A 3ETLA 3IHQB 4DQPA 4M6WB 4UQGA 4DFKA 3RH5A 1ZQSA 5J2EA 4GC7A 3RJIA 5DG9A 1T8EA 1Z3EB 9ICAA 3H8SA 4KLQA 4J9LA 1ZQFA 1RYRA 2MAXA 3AU6A 2JEFA 3PW5A 2KN7A 5HMMA 3Q8LA 3JPSA 4JK1A 4O3PA 4NY8A 4ECYA 4BWJA 4PH5A 1JX4A 2M9NA 4I27A 3T5KA 1X9MA 1SL2A 2BCRA 4QZ8A 4RPYA 4J9SA 4EYIB 4RU9A 3QZ7A 1LB2B 5IIIA 1JXLA 1K1QA 5IILA 2NRXA 5KTQA 5D49A 2V4QA 2P6RA 3V7JA 2HHSA 4LVSA 1QSYA 1S0MA 5KFTA 2IA6A 5J2DA 4DF8A 4I2EA 4P4PA 2W9MA 5F9NA 1NJYA 4J9OA 2IHNA 2FMSA 4O9MA 3HP6A 3PMNA 1PZNA 2VA8A 4DS4A 1KRPA 4UB5A 4ED3A 2XY6A 5HP4A 8ICGA 5KFNA 3HW8A 2BGWA 2BKEA 2PFNA 4DL3A 3RH6A 4F4YA 1SZPA 3UPQA 1NKEA 1L3SA 8ICUA 5KT7A 1TV9A 1ZQUA 9ICLA 5C5JA 1BPYA 9ICOA 2ZJAA 2XY5A 3UXOA 4RNOA 3C2LA 4FS2A 4XA5A 3M8RA 1DOQA 3MR2A 5L9XA 1ZETA 5JUMA 3JPPA 4YQWA 3EPGA 3OHAA 4FS1A 4YVZA 4ED6A 1NKBA 4MFCA 2KZ3A 9ICRA 4O3OA 3UQ0A 3PX4A 8ICLA 4BDPA 1X9WA 3ISDA 5IIMA 2H5XA 4Z6FA 3RAQA 4DSLA 4F8RA 4IQUA 5KT5A 3V7LA 4KLUA 3RRGA 1ZQPA 3UXNA 4C8KA 5J0RA 2R8GA 3PW4A 3ISCA 3PW2A 4IRDA 1T4GA 3BJYA 3SV3A 1Z00A 2V9WA 4DSEA 1WCLA 1ZJNA 2A1JA 4RPXA 1A76A 3QEAZ 5BOLA 4M9GA 3Q8SB 1L3VA 1IM4A 4GLXA 5KG7A 1NK5A 4DSJA 5KFKA 1UT5A 2PFOA 4NLZA 5IIOA 8ICOA 5L1IA 3MR5A 2BCUA 3ZDBA 4K4GA 4RUAA 3ORYA 2WTFA 3BQ0A 1ZYQA 1NK0A 2BQ3A 1ZQHA 3RJKA 5KG3A 4DFJA 4IR1A 1NK8A 2W9BB 3KHLA 8ICQA 2ATLA 4PGQA 3RJHA 5KFJA 4JV2A 3V6JA 1U47A 2J6TA 1ZQMA 3C5GA 4YG2A 9ICTA 5J0SA 2KZZA 4ELUA 1MC8A 1CEZA 1ZQQA 3ZDAA 4RNMA 4F3OA 4UBBA 1NK6A 1BVSA 4ECWA 4C8MA 2F1IA 3HX0A 4B9UA 7ICMA 4YXMA 4NLGA 1TKDA 1S77D 4I2DA 4FBTA 8ICJA 2HHXA 8ICPA 9ICIA 3M8SA 2IBKA 2R8IA 4J9PA 2JZBA 4XUSA 2BR0A 4K4IA 2W9CB 1H38A 1ZQKA 3AU2A 4ECTA 5KT6A 3GIJA 2XY7A 2P6UA 4IRKA 2JEJA 5HHHA 5DGBA 9ICSA 4DWIA 1ZQAA 4ECSA 4IQWA 4O3RA 4QWCA 4F5PA 4BXOB 1CUKA 1ZQXA 5CA7A 3G6VA 4UBCA 3GIKA 1ZQGA 4I28A 5J2AA 4M47A 3H4BA 3MDAA 4F91B 2ALZA 5KG0A 1V9PA 3EZ5A 5J2BA 4DFMA 2BPFA 5KFZA 4QZIA 1BPXA 4KTQA 1BPEA 1DGSA 2LYHA 4R64A 2W8LA 2P66A 1S97A 2FLPA 5DDMA 2MUTA 4TUSA 5L1JA 1XSLA 2R8KA 4M9NA 4EYHB 5EWEA 2UVWA 4DL7A 5KFYA 5J2KA 4EZ6A 2C2EA 4QZEA 5KT3A 3M9NB 4F50A 1HUZA 4DSKA 4YXJA 3GV8B 9ICNA 8ICNA 8ICIA 4DQSA 1NJZA 1IXRA 4YCXA 1D8YA 2FLLA 2HHTA 4Q44A 2XC9A 2FPMA 3JPTA 8ICMA 5DGAA 4F2RA 3M9MB 4QWBA 3RRHA 4O5CA 2FPKA 7ICTA 4Q8EA 4B9VA 4NM1A 1S76D 4R66A 1NJXA 3GIMA 3RBDA 4PHAA 1U48A 1ZQCA 4TUQA 4IRCA 3EWAA 9ICMA 2R8HA 4RQ1A 4DF4A 7ICLA 4KN4A 4XRHA 3G6XA 3RBEA 2FLNA 9ICFA 3OHBA 4F5RA 3BDPA 7ICEA 4R8UB 2ZTDA 4QWEA 2AQ4A 2RDJA 4Q8FA 1ZQBA 2HHQA 4KLTA 4MEYA 1ZQLA 1XSNA 1ZQVA 9ICEA 9ICUA 1NK4A 3ISBA 4KLIA 1XO1A 3ZDEA 4QW8A 1B22A 5KG4A 3ZDDA 3RB3A 2Y1JA 4UB1A 2ISPA 3TARA 1ZJMA 2ASJA 1RZTA 1KFSA 2ZUCA 4TQSA 7ICUA 4LZDA 3H40A 1L3TA 2XGQA 7ICSA 1Y88A 5IIKA 1T3NA 3JPQA 4KLGA 7ICNA 5HMLA 2XCPA 3Q8KA 3RB0A 1QTMA 5KFCA 4RQ0A 3RB6A 5IIJA 5KFEA 9ICBA 2ISOA 2ZUDA 4FO6A 4JUZA 2C2DA 7ICRA 5KFXA 4EBDA 3PO4A 1KFTA 7ICFA 3T5HA 3SV4A 4O3SA 4YR3A 4GXJA 2AJQA 2F1HA 3HWTA 5KG1A 1NOMA 1XU4A 3T3FA 3Q8RB 1ZQWA 1UA1A 5KFAA 1RYSA 4B9MA 3MR3A 3ZD9A 3QE9Y 4J9QA 4M9JA 3PX0A 3SZ2A 4GXIA 2AGOA 2R8JA 4ECXA 2HHUA 4F5OA 5KFHA 1N48A 3KHHA 4DL5A 1SKSA 4KLMA 2FMQA 2IMWP 1XWLA 1KLNA 7ICHA 2DFLA 3G6YA 3N97B 2JEGA 3MGIA 4O5EA 2ASDA 5L1KA 4M6WA 3C1ZA 5KFWA 4PHEA 1AROP 2NRZA 3LWLA 2W9AA 1B43A 5J2IA 3QEBZ 1RXWA 8ICWA 3B0XA 1ZQZA 3GQCA 1TK5A 5KT4A 4GXKA 1ZQTA 4RQ3A 5CHGA 4UAZA 4ED1A 5J2GA 3TFRA 2C2RA 1X2IA 4QWAA 4QZFA 4DL6A 1TK0A 1SL0A 1RPLA 4MEXA 4G3IA 1KDHA 3RJFA 5KFGA 1D9FA 2AQ0A 1KTQA 3TANA 4M9LA 3OJSA 2BQRA 3UQ2A 4NLKA 3OSNA 1ZQEA 4RT3A 4PPXA 7ICPA 5DB6A 3K75D 3GILA 3PY8A 2PI5A 3C1YA 2PXIA 4UB2A 3PW0A 1T7PA 2FPLA 3NGDA 7ICGA 1TK8A 5BOMA 4PHPA 1JN3A 8ICBA 1XS9D 4ECQA 4DQRA 3FDSA 3TQ1A 3TAPA 4C8LA 4MF2A 4RQ7A 2ZUBA 4DQIA 4BWMA 4ELTA 2I1QA 3TAQA 3ZD8A 5J2FA 2KFNA 5DBBA 4ED0A 4J9RA 1UT8A 3H4DA 8ICVA 3THVA 4F4ZA 5L1LA 9ICPA 5D46A 3C23A 4YP3A 4X5VA 4DSIA 5DBAA 5DG8A 4DOBA 4J9MA 4O3QA 2HHWA 2DPIA 4KN7A 5HHIA 4QZDA 4MFAA 4RZRA 2BCQA 2KTQA 2KFZA 5F9LA 4QWDA 9ICVA 2PFQA 3GFKB 1L5UA 5DKWA 4TQRA 4KLHA 4C8NA 8ICFA 3EPIA 1S0OA 5IINA 4RQ5A 3Q8MA 4YFKA 5J0PA 2AU0A 4DL4A 4B9TA 3C2KA 3EW9A 5BPCA 4NM2A 4UAYA 2AGPA 9ICHA 3FYHA 4BGDA 1TAQA 4F93B 1UA0A 5EWFA 1XC9A 4MFFA 2HHVA 4QZHA 4ZH4A 5EWGA 1QSLA 4RNNA 4RQ4A 4ED8A 1ZQYA 5DLGA 5DG7A 2BCVA 3K4GA 8ICRA 5KFSA 4RT2A 4PGXA 4DL2A 4QZAA 1ZQJA 5J0WA 4HYKA 1K1SA 4RQ6A 4ED2A 5KT2A 4DLGA 3RJEA 8ICEA 2NRTA 2BHNA
chains in the Genus database with same CATH superfamily
3RR7A 4YMOA 7ICQA 4P2HA 2LPEA 4FBUA 9ICGA 3RAXA 3PSPA 3BS5B 5HNKA 4J9NA 3R9KA 3OJUA 3I1YA 2ZTCA 8ICSA 4KLEA 1S9FA 1DK2A 2H3ZA 1SB3C 5ALLA 4KLSA 1L3UA 8ICTA 2YQEA 2BDPA 1PK1B 1TAUA 5KFIA 3SQIA 2UVRA 5D4BA 4JB3A 3BQTA 3NVWA 3GU3A 3PO5A 5DB9A 4I2FA 2RDIA 1NK7A 1LV5A 2CXYA 4I2HA 3KHRA 1MSWD 5J2CA 5DQIA 4C7YA 4K4HA 3PVXA 5GTHU 5KFLA 4Z6CA 2HBLA 4F4XA 3BS7A 4U7CA 3GIIA 1BNPA 4RQ2A 3TADC 2VIXA 1C7YA 1XNSA 7ICJA 1V97A 2FMPA 1U45A 5KFDA 4DOAA 3O0FA 3KKAA 3KZIU 3PR4A 2I9GA 5EE3A 2ES6A 8ICYA 4C4SA 3B9JA 1S0NA 4EBCA 3BQ7A 4CE6A 5AM3A 3QNMA 1KSPA 5DB7A 4KLDA 2JRZA 4UARA 4YMNA 1PVRA 1S10A 4I2AA 3C5FA 3GDXA 3M6ZA 1D8LA 3E0FA 4YR0A 2KVSA 3RB4A 2VA3A 8ICCA 2KJ5A 1EXNA 1KFDA 4M2YA 2D8CA 3C21A 1A6SA 2QB0B 2KJ9A 4I2JA 1BPZA 3K1ZA 4OCZA 4FZLA 4XQ8A 2BCSA 4P4MA 3HKZF 5KFOA 4UB4A 3TFSA 1PK3A 1JIHA 2EANA 1Q3UA 4DSFA 5AICA 4PZNA 5AI9A 5KFUA 3GV7B 3HT3A 2K89A 5AM5A 4I2BA 1N56A 2P35A 4KLLA 1IIPA 2YX8A 1HUOA 3DV9A 4DFDA 3IM1A 3H0LB 2DL0A 1Q46A 8ICAA 5J0QA 2EAMA 3KTQA 5CWRA 2OWOA 3L5KA 4M6WB 4UQGA 5DG9A 1Z3EB 4KLQA 3PW5A 4C4RA 1KN5A 3T5KA 2BCRA 4RU9A 3QZ7A 2HOIA 4USAA 5AKKA 2NRXA 2P6RA 2HHSA 2F8LA 2IA6A 5J2DA 4P4PA 2CPRA 5F9NA 3HP6A 3FM9A 2XY6A 1B0XA 2PFNA 3UPQA 1NKEA 2OM6A 5KT7A 1ZQUA 5C5JA 1BPYA 4FS2A 1DOQA 5AI6A 3DEEA 1ZETA 4FS1A 1IG6A 4YVZA 3UQ0A 2DWQA 1UHUA 3ISDA 4Z6FA 4F8RA 2DKXA 3RRGA 4C8KA 3ISCA 1UQVA 2V9WA 4RPXA 1IM4A 1NZBA 5AI5A 5KG7A 1NK5A 1JI7A 1ZXIA 2KEYA 5IIOA 1ZYQA 3BQ0A 1Z4OA 4IR1A 4G9BA 2W9BB 4PGQA 1SWWA 5ALMA 5AKXA 4PL2A 4YG2A 9ICTA 1CEZA 3H8MA 1NK6A 3FAHA 4ECWA 4C8MA 2QLTA 3HX0A 4B9UA 7ICMA 2F8KA 4NLGA 1TKDA 9ICIA 2Y0SC 5AKYA 2BR0A 4ECTA 2WHEA 3GIJA 4IRKA 2ZIWA 5HHHA 3BZKA 9ICSA 2HBKA 1OW5A 4F5PA 2E3TA 3G6VA 1ZQXA 4I28A 1ZQGA 3GIKA 2G0AA 5KAIU 3EZ5A 2BPFA 2FE9A 2KKVA 5KFZA 1VJ5A 4R64A 2FLPA 4FZNA 5DDMA 2JH7A 3QYPA 9ICNA 4YXJA 1WWUA 2FLLA 2W03A 2HHTA 2YMPA 5FP0A 1ZD2P 1RDFA 5DGAA 3HILA 4O5CA 1S76D 1NJXA 2O6KA 4HAIA 4TUQA 4IRCA 4KN4A 3RBEA 2FLNA 4F5RA 4R8UB 4Q8FA 4KLTA 3ISBA 1B22A 5KG4A 3UM9A 3HRDD 2EQYA 3TARA 3NVYA 1ZJMA 2ZUCA 4LZDA 2XGQA 2ZIXA 2XCPA 2DUYA 5IIJA 5KFEA 4FO6A 4EBDA 3PO4A 3T5HA 3KD3A 4YR3A 3LYSA 2F1HA 1SV0A 1UA1A 4UAVA 3WK5A 2MSNA 2K8AA 2KKPA 3NRWA 4NWIA 4M9JA 4GXIA 2AGOA 2YN4A 1N48A 4KLMA 5HR7A 2DBYA 4PHEA 2NRZA 5J2IA 3LWLA 1B43A 4NL9A 4Y2UA 3ICXA 2C2RA 3OJSA 2PI5A 2PXIA 1XS9D 4ECQA 3TQ1A 3PSFA 4DQIA 2ZUBA 3DDHA 3KOOA 1UT8A 1SWVA 3VCBA 2E8PA 5B5EU 4X5VA 4QZDA 2KTQA 2KFZA 4QWDA 2KJ8A 4RQ5A 2LYAA 2WF7A 3C2KA 3EW9A 4UAYA 2AGPA 5EWFA 4QZHA 4RQ4A 4ED8A 3T79A 3WKBA 1IV8A 4DL2A 4ED2A 4DLGA 2Z7JA 5JTIA 2NRTA 2BHNA 1SGGA 1QQ6A 3H7IA 5KG6A 1Z00B 2KK0A 1J2MA 4CF5A 2GWSA 3GZFA 3N7PD 4R63A 3V6HA 5J29A 3WKEA 4RPZA 1Q3VA 2W8KA 1Z1BA 3U26A 5AIBA 3RJJA 3QU5A 4EENA 4PJ0U 3T5JA 5CJ7A 2KP7A 4QW9A 1S5LU 2RQ5A 5J0YA 4KITB 9ICCA 5AM4A 5T14A 5CR0A 1X9SA 2EAOA 3MABA 4F5QA 1VLBA 2VJ4A 3BQ1A 4B9NA 4M9HA 2H3IA 3SMVA 4IR9A 1ZQNA 1RM6C 2HSZA 2IOHA 5B66U 5J0TA 3ED5A 5KAFU 3MBYA 2KICA 9ICWA 1ED1A 4BXOA 1QQ5A 4TURA 4RUCA 4JWMA 1C20A 5KG2A 1SXDA 4CCHA 4J9KA 2E8MA 4FFDA 5AK5A 2PFPA 4FE3A 5ALOA 4YD1A 1GO3F 4Z6DA 1YZ7A 5ALWA 2UVVA 5DLFA 2WB1C 1ZQRA 3PX6A 1COOA 2KIVA 2K8BB 3D2SA 1FO4A 7ICKA 2B21A 5C0YA 2PMZC 3S6JA 4J03A 2AGQA 2IHMA 2ASLA 2ZJ8A 4QIWF 4DQQA 2XGPA 4I2IA 4F5NA 2MA1A 4R65A 4DOCA 4JV0A 5DB8A 3AEVA 7ICVA 4ECUA 3H8JA 5J2JA 2K4PA 3M9OB 3IG8A 2BPCA 2Q4TA 3TADA 3SYZA 4E0DA 2HVIA 3F53A 2LBOA 4QZCA 4C7ZA 3H0MB 4I29A 5CP2A 2B6GA 3KHGA 4ECZA 1BPBA 1KEJA 3RH4A 1WG8A 2L5YA 5J2HA 3C2MA 4QZGA 3IV6A 4DS5A 1JROA 4O0IA 1KBUA 3QZ8A 3A0HU 5DDYA 4LZGA 4IQTA 2KVCA 2I6XA 3ETLA 3IHQB 1KW4A 3RH5A 2YY6A 9ICAA 4J9LA 2MAXA 3WKAA 3AU6A 3J81j 3JPSA 2RP5A 4O3PA 2K4HA 3TACB 4BWJA 5AM2A 1PVPA 4I27A 1X9MA 4EYIB 4RPYA 4J9SA 1F44A 5IIIA 2OEHA 2V4QA 1QQ7A 4Y2SA 2IHNA 3WK9A 2FMSA 2LM4A 3VC8A 1PZNA 4ED3A 5HP4A 5KFNA 1P7DA 2OXOA 4DL3A 1URJA 8ICUA 3AQFA 2KD1A 3CW2C 9ICOA 4C4TA 1HEKA 2PKEA 3EPGA 4ED6A 3HJEA 4Y2QA 3PX4A 4BDPA 2JR5A 2H5XA 1L7OA 3RAQA 5KT5A 1AQ6A 3SENA 1VDVA 1PUZA 3UXNA 1X6JA 1T4GA 3SV3A 1YT3A 3BS5A 3PSIA 1WCLA 3QEAZ 4UB6U 4DSJA 5KFKA 3WU2U 2WAQC 2KHQA 4NLBA 3ZDBA 4K4GA 2HMXA 2WTFA 3ONNA 3RJKA 5KG3A 1NK8A 2ATLA 3RJHA 5KFJA 1M6YA 3V6JA 1PVQA 2HOFA 1U47A 3C29A 5J0SA 4UBBA 2BZFA 1BVSA 4AYBC 2VJ5A 1XO0A 4YXMA 1S77D 2HHXA 3M8SA 2R8IA 4XUSA 2KV2A 2W9CB 1H38A 1ZQKA 2EH9A 3ZI4A 2G07A 2P6UA 2JEJA 5DGBA 1ZQAA 4O3RA 2LYBA 4QWCA 2YB4A 4UBCA 2GLEA 5J2AA 3H4BA 4F91B 5TISU 5CRXA 1V9PA 2OYYA 5ALGA 4DFMA 5ALFA 1DGSA 2RHFA 1S97A 1XSLA 4WJ3B 4EYHB 5EWEA 2ZG6A 4DL7A 4EZ6A 5KT3A 4F50A 4DSKA 2ZIUA 4DQSA 2GH1A 3QXGA 4YCXA 1D8YA 4Q44A 1Z19A 2FPMA 2WF9A 5G5HA 3JPTA 3D2QA 3M9MB 4Q8EA 4B9VA 4NM1A 4R66A 3RBDA 4PHAA 2D6FC 3EWAA 4RQ1A 4KX3A 4XRHA 3M6KA 7ICEA 4QWEA 2OHFA 2QB0A 2ZIVB 2HHQA 4IS7A 1ZQVA 9ICEA 1NK4A 4KLIA 3ZDEA 4QW8A 3RB3A 2Y1JA 1RZTA 4TQSA 7ICSA 4EEKA 5IIKA 2Y0SF 3HKZC 3JPQA 7ICNA 5KFCA 9ICBA 7ICRA 2C2DA 1KFTA 7ICFA 3SV4A 4O3SA 5L1MA 3HWTA 1HIWA 1XU4A 1RYSA 4B9MA 2G06A 1X40A 2E1EA 2HCFA 5KFHA 2FMQA 1XWLA 1KLNA 7ICHA 2DFLA 2W7OA 3G6YA 3N97B 2XIDA 2ASDA 4M6WA 3AN1A 3AMZA 3MGVA 2LI6A 2W9AA 1RXWA 2R18A 1TK5A 4UAZA 2DGZA 4ED1A 2QARB 1SL0A 1Q8KA 5KFGA 3RJFA 2AQ0A 4Y2RA 2FJ6A 2BQRA 2HOQA 3UQ2A 4NLKA 1ZQEA 4GIBA 7ICPA 2EZZA 3PY8A 3C1YA 3PW0A 1T7PA 1J2NA 2FPLA 3CNHA 4EELA 2W43A 5BOMA 4PHPA 3NASA 3RFAA 8ICBA 3F5EA 3TAPA 1A0PA 2EZXA 4RQ7A 2I1QA 4BX9C 2KFNA 3ZD8A 4ED0A 8ICVA 4NLCA 3D6JA 5L1LA 3THVA 2EDUA 4DOBA 4O3QA 4RZRA 2KE7A 3EPIA 2AU0A 4DL4A 4NM2A 4FZMA 9ICHA 4BGDA 2JHDA 5ALUA 5KL8B 1N63A 1ZQYA 3K4GA 4RT2A 4HYKA 1ZD3A 4RQ6A 5KT2A 1ZRNA 1NNLA 5J0OA 2IOFA 4O3NA 4BUGA 4ED7A 3SI8A 5ALXA 1QSSA 3ETRA 2FDRA 5KFFA 2HBMA 3PNCA 2A1JB 4KX5A 9ICJA 3I28A 1SV4A 5KFBA 2W9BA 3HPOA 2JEIA 4KMUA 2KIWA 2ODGA 2ZJ5A 1MN8A 4NJ8A 1MQ2A 4YD2A 4IC9A 2ESEA 2W04A 4LJXA 1ZOLA 4F2SA 2JGAA 4P0PB 3T5LA 2PI4A 4RQNA 4IQVA 2UVUA 3RR8A 3QUBA 3WKDA 4CRXA 2K4EA 5DQHA 5KFPA 1SKRA 2H3QA 3H8WA 2M0NA 3IN5A 2HW3A 2KHVA 1D9DA 4US8A 1RG6A 2JZBB 2W55A 4GC6A 2K8CB 3JPOA 8ICHA 4OJOA 3PV8A 2J6UA 4YMMA 3E2EA 1HJPA 3JPRA 2JMGA 1TFRA 1N60A 4UAUA 2A1AA 3LWMA 2I5HA 2CRXA 2KG5A 2DPJA 4EEYA 1N62A 3N4MB 5AIAA 3GV5B 2LMRA 1S8OA 3BQ2A 5EE1A 2XO7A 4I2CA 4Y2PA 4M0AA 1ZQOA 2Y9TA 5KFQA 1NKCA 2MUTB 4DO9A 4I2GA 5AKIA 2C28A 5KNIA 2WFAA 2OCEA 1BPDA 4KLFA 4EZ9A 2A19A 4JV1A 5AI8A 4F72A 3LK9A 2J6SA 1RQLA 5AK6A 4R8UA 2YMQA 1N2XA 3TI0A 4C8OA 3L3FX 2W11A 1L6NA 4UB3A 7ICOA 2W3RA 4Y2XA 1COKA 4KLOA 2HDOA 4EBEA 3B0YA 4M04A 3WK6A 1NJWA 4YN4A 3V6KA 8ICKA 1J97A 4O3MA 4JMUA 5ALSA 3F2DA 2Y1IA 4EX6A 3SR6A 3QUCA 2NRWA 1Z1VA 3OPXA 5EE9A 4PGYA 5DQGA 4B9LA 5KFRA 2LHTA 4UASA 3QX7A 1ZQIA 4ECRA 3JPNA 1SIJA 2C22A 1LKYB 1SKWA 2F1JA 5ALJA 5HR6A 4DQPA 4DFKA 1ZQSA 5ALQA 5J2EA 2YB1A 5ALRA 3RJIA 3H8SA 4DCCA 1RYRA 2JEFA 2NO4A 2KN7A 5HMMA 3Q8LA 1CI4A 1F0MA 4JK1A 1X66A 4NY8A 4ECYA 2W3SA 1JX4A 3AL0B 1SL2A 3F5AA 4QZ8A 1BNOA 2F77X 2LM1A 5D49A 4LVSA 1S0MA 1RYUA 4J9OA 3PMNA 2VA8A 4UB5A 3HW8A 4C80A 1JUDA 3K1RB 2BKEA 2WF6A 4F4YA 3CRXA 3NVVA 1TV9A 2F76X 3IRUA 2NO5A 2ZJAA 1SZHA 2XY5A 3UXOA 3C2LA 4XA5A 3MR2A 5JUMA 3OHAA 2KNJA 2KZ3A 2KSOB 2GOLA 1X9WA 1UCVA 3N28A 5IIMA 4IQUA 3V7LA 2FI1A 5J0RA 3PW4A 2DKZA 1K5OA 4P0QB 2AXTU 1Z00A 1A76A 4M9GA 2A3VA 1L3VA 4GLXA 2B0CA 2F44A 2G5HB 1NK0A 5ALYA 3IDWA 4DFJA 5E79U 8ICQA 2MRLA 4JV2A 3LVWA 1O08A 5AM0A 2J6TA 4ELUA 1MC8A 3ZDAA 2NYVA 8ICPA 3OTQA 4I2DA 1L8OA 4Y2YA 2WF8A 4K4IA 5AI4A 3SEIA 1ZD4A 5KT6A 3IG5A 1N5XA 4ECSA 1CUKA 3N7RC 5KG0A 4KMOB 2LKYA 2KMDA 2K4IA 5J8YC 4QZIA 4KTQA 2LYHA 2W8LA 5AM1A 3PZPA 5L1JA 2R8KA 1WWVA 2UVWA 5KFYA 2C2EA 4QZEA 3M9NB 3GV8B 8ICNA 1F5SA 1NJZA 1IXRA 1X9XA 2XC9A 2ZXHA 7ICTA 2WAQF 3GIMA 3ALRA 7ICLA 1OXJA 9ICFA 2XICA 2ZTDA 2JH1A 2AQ4A 1ZQBA 2HI0A 4MEYA 1ZQLA 1XSNA 5G5GA 4QIWC 3WK4A 1XO1A 3A0BU 5ALNA 2H3VA 4B6JA 2ISPA 4AYBF 2ASJA 1QH9A 4CF4A 7ICUA 3Q8KA 1QTMA 3RB0A 2ZXIA 3RB6A 2ZUDA 4JUZA 5KFXA 3UMCA 4GXJA 2AJQA 1T3QA 3T3FA 3Q8RB 1ZQWA 5KFAA 3MR3A 2EAPA 3ZD9A 3QE9Y 4J9QA 3EUB2 3SZ2A 4ECXA 2XI9A 2HHUA 4F5OA 1SKSA 2IMWP 3SAGA 3C1ZA 3B0XA 1ZQZA 3TKAA 1KL9A 3GQCA 5KT4A 4GXKA 3QUQA 1ZQTA 1PK1A 5J2GA 1X2IA 5AKHA 4QWAA 4DL6A 4MEXA 3TANA 1WUDA 4M9LA 4OD0A 2ZIUB 4RT3A 5GTIU 1O03A 5DB6A 4UB2A 3NGDA 3D2NA 1KKXA 1JN3A 4PZOA 4DQRA 3FDSA 3QU2A 4MF2A 2QB1A 2WF5A 5J2FA 5DBBA 4J9RA 4F4ZA 9ICPA 5D46A 5DBAA 5DG8A 4J9MA 2E5SA 2HHWA 2DPIA 4KN7A 5HHIA 2BCQA 5F9LA 5DKWA 4TQRA 4KLHA 3QUTA 4YFKA 5J0PA 5BPCA 3WK7A 3FYHA 3RF9A 4F93B 1UA0A 1XC9A 4MFFA 2HHVA 4ZH4A 5ALDA 4RQMA 3C28A 2BCVA 5AKZA 3KKAC 5KFSA 4PGXA 4QZAA 5AHXA 3QU9A 3WK8A 8ICEA 2G08A 5AKLA 4KLJA 3AUOA 2F2AB 1RXVA 3AM9A 4ACOA 1N5WA 3SD7A 2V4RA 4Q45A 4OJ5A 2G5IB 4DFPA 3LVVA 5KG5A 5KFMA 3UMGA 3MFHA 3MGHA 3NRZA 4ECVA 4NXZA 1OUQA 3EYZA 2E1FA 3F2CA 5J0UA 2VANA 3MC1A 2W54A 1NK9A 1KQQA 4F92B 2W9CA 3OGUA 1N61A 1MA7A 8ICXA 3Q8PB 4BJQA 1FEZA 5J0XA 8ICZA 2ZTEA 1MQ3A 9ICKA 1U49A 2RLTA 1BGXT 3Q8QB 2ZIWB 4RQ8A 3MDCA 4Y2TA 5ALTA 3V7KA 1S0VA 1U4BA 2XCAA 3N7SC 3OSPA 4P4OA 2VA2A 4O5KA 4UW9A 1WCNA 5EE0A 3RJGA 4YR2A 1JMSA 5AI0A 1A77A 1QLNA 2Y9UA 3MR6A 1TVAA 5KFVA 2KZMA 2DF4B 4OJLA 4UAWA 4PHDA 4Q43A 3PW7A 1L7NA 1U9LA 1JRPA 5AKEA 4U6PA 3WKCA 3LDAA 5EOZA 4OO1J 4Z6EA 2NRVA 3I76A 4DLEA 5CEHA 3ZDCA 2JV3A 3PR5B 3PMLA 5DBCA 2BQUA 2ZIVA 3V72A 4C0ZA 1FFVA 4Y2VA 4TUPA 5CB1A 3UXPA 3NTUA 4NLNA 2BPGA 5TZVA 2Q0ZX 4EX7A 1YZ6A 4F4KA 2YMMA 7ICIA 2ZIXB 3MFIA 4F4WA 2QKQA 1ZQDA 4B9SA 2HVHA 3BZCA 3RTVA 2JXJA 1JXEA 1NI3A 1SL1A 5JU5A 4US9A 3M1YA 4ICAA 1L7PA 1XSPA 5ALPA 5AKGA 4QZBA 4MF8A 4ELVA 5ALIA 4OJPA 4JWNA 3F2BA 3NVZA 4UATA 1FIQA 4DEZA 2XVTA 5H2FU 4QJFB 4QZ9A 3CP8A 2QARA 1QCKA 4GC7A 2NV3A 1T8EA 1ZQFA 1X6IA 4PH5A 2M9NA 5ALZA 4OJ6A 1JXLA 1LB2B 1K1QA 1V85A 5IILA 5KTQA 3V7JA 1QSYA 5KFTA 4DF8A 4I2EA 2W9MA 1NJYA 4O9MA 4F71A 4DS4A 1KRPA 4AP9A 8ICGA 2BGWA 4QNLA 3RH6A 2MU2A 1SZPA 1ECWA 1L3SA 3QU7A 9ICLA 2AH5A 2VKQA 4CDGA 4RNOA 3M8RA 5L9XA 4MFCA 3JPPA 4YQWA 1NKBA 9ICXA 1V38A 9ICRA 2AHOB 1LVHA 4O3OA 8ICLA 4DSLA 3L4PA 2RRDA 4KLUA 1ZQPA 2H3FA 2R8GA 3CYMA 5JRTA 3PW2A 4IRDA 2HBJA 3BJYA 4DSEA 1X42A 1ZJNA 2A1JA 5BOLA 3Q8SB 1JALA 2PFOA 1UT5A 4NLZA 8ICOA 5L1IA 3MR5A 2BCUA 4RUAA 3ORYA 1ZQHA 2BQ3A 3KHLA 1L8LA 5AKJA 4P0PA 1ZQMA 3C5GA 2KZZA 1ZQQA 4RNMA 4F3OA 5ALHA 2F1IA 4NV0A 3PSTA 4FBTA 8ICJA 2IBKA 4J9PA 2JZBA 4IL6U 2W7PA 3AU2A 2XY7A 5ALVA 4DWIA 4IQWA 3SAFA 4BXOB 5CA7A 2GO7A 2EZYA 4M47A 1SV0C 5K4LA 3MDAA 2ALZA 1D8BA 5J2BA 1BPXA 1BPEA 2E8NA 3KFUF 2P66A 5F3XB 2MUTA 4TUSA 4M9NA 4GFJA 5J2KA 1HUZA 4CGZA 2D3DA 2BDUA 8ICIA 1Z4NA 2WB1F 3E58A 4NL9C 2OH2A 8ICMA 2G09A 4F2RA 2F3NA 4QWBA 1ZQ1C 3RRHA 2FPKA 2N1RA 1TE2A 2PMZF 1U48A 1ZQCA 9ICMA 2R8HA 4DF4A 3G6XA 9ICQA 2YTUA 3OHBA 3BDPA 2RDJA 1ZRMA 9ICUA 4PL1A 3ZDDA 5ALEA 4UB1A 1KFSA 3H40A 1L3TA 2DQNB 1Y88A 3SAHA 1T3NA 4KLGA 1DGJA 5HMLA 1NZPA 3NUQA 4RQ0A 4CF3A 2ISOA 4UB8U 5KG1A 1NOMA 3QU4A 5A0LA 4MHVA 3H0RB 5J8YA 3PX0A 2R8JA 1TAMA 1ZD5A 3KHHA 4DL5A 1LKYA 2JEGA 3MGIA 4Y2JA 4O5EA 5L1KA 5KFWA 1AROP 1DK3A 3KZXA 3QEBZ 8ICWA 4RQ3A 5CHGA 3TFRA 1CRXA 4CNQA 4QZFA 1TK0A 4G3IA 1RPLA 3NS1A 1KDHA 3FC4A 1D9FA 4A8EA 1KTQA 3IP4B 3OSNA 3KBBA 4ZOHC 4PPXA 1UPHA 3K75D 3GILA 2IOFK 1WYGA 1DXSA 7ICGA 1TK8A 3UMBA 4C8LA 4BWMA 4ELTA 3TAQA 3H4DA 1SXEA 3C23A 4YP3A 4DSIA 2KOBA 4MFAA 9ICVA 3AQEA 2CN1A 2PFQA 3GFKB 5AK3A 1L5UA 4C8NA 8ICFA 2YMLA 1S0OA 5IINA 5ALKA 3Q8MA 4B9TA 1DRGA 2KSOA 1TAQA 2E8OA 5EWGA 1QSLA 1T94A 5KL1B 4RNNA 5DG7A 5DLGA 1L7MA 8ICRA 3M7DA 1ZQJA 4P0QA 5J0WA 1K1SA 1RQNA 1B4FA 2K60A 3RJEA 5AK4A 1FFUA
chains in the Genus database with same CATH topology
3RR7A 4YMOA 4KLJA 7ICQA 5J0OA 4P2HA 3H7IA 3AUOA 4FBUA 9ICGA 5KG6A 4O3NA 4ED7A 3SI8A 3RAXA 1RXVA 1QSSA 1Z00B 5HNKA 5KFFA 4J9NA 2V4RA 2GWSA 4Q45A 3PNCA 2A1JB 3OJUA 9ICJA 2ZTCA 4DFPA 5KFBA 2W9BA 3HPOA 2JEIA 4KMUA 8ICSA 5KG5A 4R63A 3V6HA 1S9FA 5J29A 4KLEA 4RPZA 2W8KA 2ZJ5A 1MQ2A 4KLSA 4YD2A 1L3UA 3RJJA 5KFMA 8ICTA 2BDPA 3MFHA 3MGHA 1TAUA 5KFIA 3T5JA 5CJ7A 4ECVA 4QW9A 2UVRA 4F2SA 5D4BA 3T5LA 4NXZA 5J0YA 4KITB 3EYZA 2PI4A 9ICCA 3BQTA 4IQVA 2UVUA 3RR8A 5J0UA 5CR0A 5DQHA 1X9SA 2VANA 3PO5A 5KFPA 1SKRA 1NK9A 5DB9A 4F92B 3H8WA 4I2FA 2RDIA 3MABA 1NK7A 2W9CA 1LV5A 4F5QA 4I2HA 3KHRA 1MSWD 5J2CA 3OGUA 5DQIA 8ICXA 3BQ1A 4K4HA 4B9NA 3Q8PB 4IR9A 4M9HA 2HW3A 3PVXA 1ZQNA 1D9DA 9ICQA 5KFLA 2JZBB 4GC6A 5J0XA 8ICZA 4Z6CA 2ZTEA 1MQ3A 3JPOA 9ICKA 5J0TA 4F4XA 8ICHA 1U49A 3GIIA 1BGXT 3PV8A 3MBYA 2J6UA 9ICWA 4YMMA 3Q8QB 4BXOA 3E2EA 4RQ2A 1HJPA 3JPRA 4RQ8A 4TURA 3MDCA 1TFRA 4RUCA 1C7YA 3V7KA 3LWMA 4JWMA 1S0VA 7ICJA 1U4BA 2XCAA 2FMPA 1U45A 5KFDA 2DPJA 4DOAA 4EEYA 3OSPA 4P4OA 3N4MB 2VA2A 4O5KA 5KG2A 3RJGA 1WCNA 4YR2A 3GV5B 4CCHA 4J9KA 1JMSA 3PR4A 1A77A 3BQ2A 1QLNA 2I9GA 2XO7A 3MR6A 2PFPA 4I2CA 1TVAA 5KFVA 2KZMA 8ICYA 4YD1A 4M0AA 4UAWA 4PHDA 1ZQOA 4Z6DA 5KFQA 1NKCA 2MUTB 4DO9A 1S0NA 4I2GA 4Q43A 3PW7A 4EBCA 9ICXA 1U9LA 2UVVA 5DLFA 2C28A 1KSPA 5DB7A 1BPDA 4KLDA 3LDAA 1ZQRA 4KLFA 4EZ9A 5EOZA 4JV1A 4YMNA 4Z6EA 3LK9A 3PX6A 2NRVA 1S10A 4DLEA 4I2AA 1COOA 3C5FA 2J6SA 3GDXA 3ZDCA 7ICKA 2B21A 1D8LA 3PR5B 4R8UA 3PMLA 5DBCA 4YR0A 2BQUA 3RB4A 2VA3A 3TI0A 8ICCA 3V72A 2AGQA 4C8OA 2IHMA 2ASLA 1EXNA 2ZJ8A 1KFDA 4UB3A 4TUPA 5CB1A 4DQQA 4M2YA 2XGPA 4I2IA 4F5NA 3C21A 7ICOA 4KLOA 4I2JA 1BPZA 4EBEA 3UXPA 4R65A 4DOCA 5DB8A 4JV0A 3B0YA 3NTUA 7ICVA 4NLNA 2BPGA 4M04A 5TZVA 4XQ8A 2BCSA 2Q0ZX 4P4MA 4UB4A 5KFOA 4ECUA 3TFSA 1NJWA 4YN4A 4F4KA 1JIHA 7ICIA 3H8JA 3V6KA 8ICKA 5J2JA 4DSFA 3M9OB 3MFIA 4F4WA 5KFUA 1ZQDA 2BPCA 4B9SA 2Y1IA 3GV7B 2NRWA 2HVHA 3HT3A 3SYZA 4E0DA 3RTVA 4I2BA 2HVIA 1N56A 1JXEA 1SL1A 4QZCA 4KLLA 4PGYA 5DQGA 4I29A 5CP2A 1HUOA 4B9LA 3KHGA 4ECZA 1BPBA 1KEJA 3RH4A 5KFRA 3IM1A 5J2HA 1XSPA 3C2MA 4QZGA 4DS5A 1ZQIA 4QZBA 4MF8A 4ELVA 8ICAA 4ECRA 5J0QA 3JPNA 2C22A 4O0IA 3KTQA 3QZ8A 4JWNA 1SKWA 5CWRA 2F1JA 5DDYA 4LZGA 4IQTA 2OWOA 4DEZA 4QZ9A 3ETLA 3IHQB 4DQPA 4M6WB 4UQGA 4DFKA 3RH5A 1ZQSA 5J2EA 4GC7A 3RJIA 5DG9A 1T8EA 1Z3EB 9ICAA 3H8SA 4KLQA 4J9LA 1ZQFA 1RYRA 2MAXA 3AU6A 2JEFA 3PW5A 2KN7A 5HMMA 3Q8LA 3JPSA 4JK1A 4O3PA 4NY8A 4ECYA 4BWJA 4PH5A 1JX4A 2M9NA 4I27A 3T5KA 1X9MA 1SL2A 2BCRA 4QZ8A 4RPYA 4J9SA 4EYIB 4RU9A 3QZ7A 1LB2B 5IIIA 1JXLA 1K1QA 5IILA 2NRXA 5KTQA 5D49A 2V4QA 2P6RA 3V7JA 2HHSA 4LVSA 1QSYA 1S0MA 5KFTA 2IA6A 5J2DA 4DF8A 4I2EA 4P4PA 2W9MA 5F9NA 1NJYA 4J9OA 2IHNA 2FMSA 4O9MA 3HP6A 3PMNA 1PZNA 2VA8A 4DS4A 1KRPA 4UB5A 4ED3A 2XY6A 5HP4A 8ICGA 5KFNA 3HW8A 2BGWA 2BKEA 2PFNA 4DL3A 3RH6A 4F4YA 1SZPA 3UPQA 1NKEA 1L3SA 8ICUA 5KT7A 1TV9A 1ZQUA 9ICLA 5C5JA 1BPYA 9ICOA 2ZJAA 2XY5A 3UXOA 4RNOA 3C2LA 4FS2A 4XA5A 3M8RA 1DOQA 3MR2A 5L9XA 1ZETA 5JUMA 3JPPA 4YQWA 3EPGA 3OHAA 4FS1A 4YVZA 4ED6A 1NKBA 4MFCA 2KZ3A 9ICRA 4O3OA 3UQ0A 3PX4A 8ICLA 4BDPA 1X9WA 3ISDA 5IIMA 2H5XA 4Z6FA 3RAQA 4DSLA 4F8RA 4IQUA 5KT5A 3V7LA 4KLUA 3RRGA 1ZQPA 3UXNA 4C8KA 5J0RA 2R8GA 3PW4A 3ISCA 3PW2A 4IRDA 1T4GA 3BJYA 3SV3A 1Z00A 2V9WA 4DSEA 1WCLA 1ZJNA 2A1JA 4RPXA 1A76A 3QEAZ 5BOLA 4M9GA 3Q8SB 1L3VA 1IM4A 4GLXA 5KG7A 1NK5A 4DSJA 5KFKA 1UT5A 2PFOA 4NLZA 5IIOA 8ICOA 5L1IA 3MR5A 2BCUA 3ZDBA 4K4GA 4RUAA 3ORYA 2WTFA 3BQ0A 1ZYQA 1NK0A 2BQ3A 1ZQHA 3RJKA 5KG3A 4DFJA 4IR1A 1NK8A 2W9BB 3KHLA 8ICQA 2ATLA 4PGQA 3RJHA 5KFJA 4JV2A 3V6JA 1U47A 2J6TA 1ZQMA 3C5GA 4YG2A 9ICTA 5J0SA 2KZZA 4ELUA 1MC8A 1CEZA 1ZQQA 3ZDAA 4RNMA 4F3OA 4UBBA 1NK6A 1BVSA 4ECWA 4C8MA 2F1IA 3HX0A 4B9UA 7ICMA 4YXMA 4NLGA 1TKDA 1S77D 4I2DA 4FBTA 8ICJA 2HHXA 8ICPA 9ICIA 3M8SA 2IBKA 2R8IA 4J9PA 2JZBA 4XUSA 2BR0A 4K4IA 2W9CB 1H38A 1ZQKA 3AU2A 4ECTA 5KT6A 3GIJA 2XY7A 2P6UA 4IRKA 2JEJA 5HHHA 5DGBA 9ICSA 4DWIA 1ZQAA 4ECSA 4IQWA 4O3RA 4QWCA 4F5PA 4BXOB 1CUKA 1ZQXA 5CA7A 3G6VA 4UBCA 3GIKA 1ZQGA 4I28A 5J2AA 4M47A 3H4BA 3MDAA 4F91B 2ALZA 5KG0A 1V9PA 3EZ5A 5J2BA 4DFMA 2BPFA 5KFZA 4QZIA 1BPXA 4KTQA 1BPEA 1DGSA 2LYHA 4R64A 2W8LA 2P66A 1S97A 2FLPA 5DDMA 2MUTA 4TUSA 5L1JA 1XSLA 2R8KA 4M9NA 4EYHB 5EWEA 2UVWA 4DL7A 5KFYA 5J2KA 4EZ6A 2C2EA 4QZEA 5KT3A 3M9NB 4F50A 1HUZA 4DSKA 4YXJA 3GV8B 9ICNA 8ICNA 8ICIA 4DQSA 1NJZA 1IXRA 4YCXA 1D8YA 2FLLA 2HHTA 4Q44A 2XC9A 2FPMA 3JPTA 8ICMA 5DGAA 4F2RA 3M9MB 4QWBA 3RRHA 4O5CA 2FPKA 7ICTA 4Q8EA 4B9VA 4NM1A 1S76D 4R66A 1NJXA 3GIMA 3RBDA 4PHAA 1U48A 1ZQCA 4TUQA 4IRCA 3EWAA 9ICMA 2R8HA 4RQ1A 4DF4A 7ICLA 4KN4A 4XRHA 3G6XA 3RBEA 2FLNA 9ICFA 3OHBA 4F5RA 3BDPA 7ICEA 4R8UB 2ZTDA 4QWEA 2AQ4A 2RDJA 4Q8FA 1ZQBA 2HHQA 4KLTA 4MEYA 1ZQLA 1XSNA 1ZQVA 9ICEA 9ICUA 1NK4A 3ISBA 4KLIA 1XO1A 3ZDEA 4QW8A 1B22A 5KG4A 3ZDDA 3RB3A 2Y1JA 4UB1A 2ISPA 3TARA 1ZJMA 2ASJA 1RZTA 1KFSA 2ZUCA 4TQSA 7ICUA 4LZDA 3H40A 1L3TA 2XGQA 7ICSA 1Y88A 5IIKA 1T3NA 3JPQA 4KLGA 7ICNA 5HMLA 2XCPA 3Q8KA 3RB0A 1QTMA 5KFCA 4RQ0A 3RB6A 5IIJA 5KFEA 9ICBA 2ISOA 2ZUDA 4FO6A 4JUZA 2C2DA 7ICRA 5KFXA 4EBDA 3PO4A 1KFTA 7ICFA 3T5HA 3SV4A 4O3SA 4YR3A 4GXJA 2AJQA 2F1HA 3HWTA 5KG1A 1NOMA 1XU4A 3T3FA 3Q8RB 1ZQWA 1UA1A 5KFAA 1RYSA 4B9MA 3MR3A 3ZD9A 3QE9Y 4J9QA 4M9JA 3PX0A 3SZ2A 4GXIA 2AGOA 2R8JA 4ECXA 2HHUA 4F5OA 5KFHA 1N48A 3KHHA 4DL5A 1SKSA 4KLMA 2FMQA 2IMWP 1XWLA 1KLNA 7ICHA 2DFLA 3G6YA 3N97B 2JEGA 3MGIA 4O5EA 2ASDA 5L1KA 4M6WA 3C1ZA 5KFWA 4PHEA 1AROP 2NRZA 3LWLA 2W9AA 1B43A 5J2IA 3QEBZ 1RXWA 8ICWA 3B0XA 1ZQZA 3GQCA 1TK5A 5KT4A 4GXKA 1ZQTA 4RQ3A 5CHGA 4UAZA 4ED1A 5J2GA 3TFRA 2C2RA 1X2IA 4QWAA 4QZFA 4DL6A 1TK0A 1SL0A 1RPLA 4MEXA 4G3IA 1KDHA 3RJFA 5KFGA 1D9FA 2AQ0A 1KTQA 3TANA 4M9LA 3OJSA 2BQRA 3UQ2A 4NLKA 3OSNA 1ZQEA 4RT3A 4PPXA 7ICPA 5DB6A 3K75D 3GILA 3PY8A 2PI5A 3C1YA 2PXIA 4UB2A 3PW0A 1T7PA 2FPLA 3NGDA 7ICGA 1TK8A 5BOMA 4PHPA 1JN3A 8ICBA 1XS9D 4ECQA 4DQRA 3FDSA 3TQ1A 3TAPA 4C8LA 4MF2A 4RQ7A 2ZUBA 4DQIA 4BWMA 4ELTA 2I1QA 3TAQA 3ZD8A 5J2FA 2KFNA 5DBBA 4ED0A 4J9RA 1UT8A 3H4DA 8ICVA 3THVA 4F4ZA 5L1LA 9ICPA 5D46A 3C23A 4YP3A 4X5VA 4DSIA 5DBAA 5DG8A 4DOBA 4J9MA 4O3QA 2HHWA 2DPIA 4KN7A 5HHIA 4QZDA 4MFAA 4RZRA 2BCQA 2KTQA 2KFZA 5F9LA 4QWDA 9ICVA 2PFQA 3GFKB 1L5UA 5DKWA 4TQRA 4KLHA 4C8NA 8ICFA 3EPIA 1S0OA 5IINA 4RQ5A 3Q8MA 4YFKA 5J0PA 2AU0A 4DL4A 4B9TA 3C2KA 3EW9A 5BPCA 4NM2A 4UAYA 2AGPA 9ICHA 3FYHA 4BGDA 1TAQA 4F93B 1UA0A 5EWFA 1XC9A 4MFFA 2HHVA 4QZHA 4ZH4A 5EWGA 1QSLA 4RNNA 4RQ4A 4ED8A 1ZQYA 5DLGA 5DG7A 2BCVA 3K4GA 8ICRA 5KFSA 4RT2A 4PGXA 4DL2A 4QZAA 1ZQJA 5J0WA 4HYKA 1K1SA 4RQ6A 4ED2A 5KT2A 4DLGA 3RJEA 8ICEA 2NRTA 2BHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RR7 A;  4YMO A;  4KLJ A;  7ICQ A;  5J0O A;  4P2H A;  3H7I A;  3AUO A;  4FBU A;  9ICG A;  5KG6 A;  4O3N A;  4ED7 A;  3SI8 A;  3RAX A;  1RXV A;  1QSS A;  1Z00 B;  5HNK A;  5KFF A;  4J9N A;  2V4R A;  2GWS A;  4Q45 A;  3PNC A;  2A1J B;  3OJU A;  9ICJ A;  2ZTC A;  4DFP A;  5KFB A;  2W9B A;  3HPO A;  2JEI A;  4KMU A;  8ICS A;  5KG5 A;  4R63 A;  3V6H A;  1S9F A;  5J29 A;  4KLE A;  4RPZ A;  2W8K A;  2ZJ5 A;  1MQ2 A;  4KLS A;  4YD2 A;  1L3U A;  3RJJ A;  5KFM A;  8ICT A;  2BDP A;  3MFH A;  3MGH A;  1TAU A;  5KFI A;  3T5J A;  5CJ7 A;  4ECV A;  4QW9 A;  2UVR A;  4F2S A;  5D4B A;  3T5L A;  4NXZ A;  5J0Y A;  4KIT B;  3EYZ A;  2PI4 A;  9ICC A;  3BQT A;  4IQV A;  2UVU A;  3RR8 A;  5J0U A;  5CR0 A;  5DQH A;  1X9S A;  2VAN A;  3PO5 A;  5KFP A;  1SKR A;  1NK9 A;  5DB9 A;  4F92 B;  3H8W A;  4I2F A;  2RDI A;  3MAB A;  1NK7 A;  2W9C A;  1LV5 A;  4F5Q A;  4I2H A;  3KHR A;  1MSW D;  5J2C A;  3OGU A;  5DQI A;  8ICX A;  3BQ1 A;  4K4H A;  4B9N A;  3Q8P B;  4IR9 A;  4M9H A;  2HW3 A;  3PVX A;  1ZQN A;  1D9D A;  9ICQ A;  5KFL A;  2JZB B;  4GC6 A;  5J0X A;  8ICZ A;  4Z6C A;  2ZTE A;  1MQ3 A;  3JPO A;  9ICK A;  5J0T A;  4F4X A;  8ICH A;  1U49 A;  3GII A;  1BGX T;  3PV8 A;  3MBY A;  2J6U A;  9ICW A;  4YMM A;  3Q8Q B;  4BXO A;  3E2E A;  4RQ2 A;  1HJP A;  3JPR A;  4RQ8 A;  4TUR A;  3MDC A;  1TFR A;  4RUC A;  1C7Y A;  3V7K A;  3LWM A;  4JWM A;  1S0V A;  7ICJ A;  1U4B A;  2XCA A;  2FMP A;  1U45 A;  5KFD A;  2DPJ A;  4DOA A;  4EEY A;  3OSP A;  4P4O A;  3N4M B;  2VA2 A;  4O5K A;  5KG2 A;  3RJG A;  1WCN A;  4YR2 A;  3GV5 B;  4CCH A;  4J9K A;  1JMS A;  3PR4 A;  1A77 A;  3BQ2 A;  1QLN A;  2I9G A;  2XO7 A;  3MR6 A;  2PFP A;  4I2C A;  1TVA A;  5KFV A;  2KZM A;  8ICY A;  4YD1 A;  4M0A A;  4UAW A;  4PHD A;  1ZQO A;  4Z6D A;  5KFQ A;  1NKC A;  2MUT B;  4DO9 A;  1S0N A;  4I2G A;  4Q43 A;  3PW7 A;  4EBC A;  9ICX A;  1U9L A;  2UVV A;  5DLF A;  2C28 A;  1KSP A;  5DB7 A;  1BPD A;  4KLD A;  3LDA A;  1ZQR A;  4KLF A;  4EZ9 A;  5EOZ A;  4JV1 A;  4YMN A;  4Z6E A;  3LK9 A;  3PX6 A;  2NRV A;  1S10 A;  4DLE A;  4I2A A;  1COO A;  3C5F A;  2J6S A;  3GDX A;  3ZDC A;  7ICK A;  2B21 A;  1D8L A;  3PR5 B;  4R8U A;  3PML A;  5DBC A;  4YR0 A;  2BQU A;  3RB4 A;  2VA3 A;  3TI0 A;  8ICC A;  3V72 A;  2AGQ A;  4C8O A;  2IHM A;  2ASL A;  1EXN A;  2ZJ8 A;  1KFD A;  4UB3 A;  4TUP A;  5CB1 A;  4DQQ A;  4M2Y A;  2XGP A;  4I2I A;  4F5N A;  3C21 A;  7ICO A;  4KLO A;  4I2J A;  1BPZ A;  4EBE A;  3UXP A;  4R65 A;  4DOC A;  5DB8 A;  4JV0 A;  3B0Y A;  3NTU A;  7ICV A;  4NLN A;  2BPG A;  4M04 A;  5TZV A;  4XQ8 A;  2BCS A;  2Q0Z X;  4P4M A;  4UB4 A;  5KFO A;  4ECU A;  3TFS A;  1NJW A;  4YN4 A;  4F4K A;  1JIH A;  7ICI A;  3H8J A;  3V6K A;  8ICK A;  5J2J A;  4DSF A;  3M9O B;  3MFI A;  4F4W A;  5KFU A;  1ZQD A;  2BPC A;  4B9S A;  2Y1I A;  3GV7 B;  2NRW A;  2HVH A;  3HT3 A;  3SYZ A;  4E0D A;  3RTV A;  4I2B A;  2HVI A;  1N56 A;  1JXE A;  1SL1 A;  4QZC A;  4KLL A;  4PGY A;  5DQG A;  4I29 A;  5CP2 A;  1HUO A;  4B9L A;  3KHG A;  4ECZ A;  1BPB A;  1KEJ A;  3RH4 A;  5KFR A;  3IM1 A;  5J2H A;  1XSP A;  3C2M A;  4QZG A;  4DS5 A;  1ZQI A;  4QZB A;  4MF8 A;  4ELV A;  8ICA A;  4ECR A;  5J0Q A;  3JPN A;  2C22 A;  4O0I A;  3KTQ A;  3QZ8 A;  4JWN A;  1SKW A;  5CWR A;  2F1J A;  5DDY A;  4LZG A;  4IQT A;  2OWO A;  4DEZ A;  4QZ9 A;  3ETL A;  3IHQ B;  4DQP A;  4M6W B;  4UQG A;  4DFK A;  3RH5 A;  1ZQS A;  5J2E A;  4GC7 A;  3RJI A;  5DG9 A;  1T8E A;  1Z3E B;  9ICA A;  3H8S A;  4KLQ A;  4J9L A;  1ZQF A;  1RYR A;  2MAX A;  3AU6 A;  2JEF A;  3PW5 A;  2KN7 A;  5HMM A;  3Q8L A;  3JPS A;  4JK1 A;  4O3P A;  4NY8 A;  4ECY A;  4BWJ A;  4PH5 A;  1JX4 A;  2M9N A;  4I27 A;  3T5K A;  1X9M A;  1SL2 A;  2BCR A;  4QZ8 A;  4RPY A;  4J9S A;  4EYI B;  4RU9 A;  3QZ7 A;  1LB2 B;  5III A;  1JXL A;  1K1Q A;  5IIL A;  2NRX A;  5KTQ A;  5D49 A;  2V4Q A;  2P6R A;  3V7J A;  2HHS A;  4LVS A;  1QSY A;  1S0M A;  5KFT A;  2IA6 A;  5J2D A;  4DF8 A;  4I2E A;  4P4P A;  2W9M A;  5F9N A;  1NJY A;  4J9O A;  2IHN A;  2FMS A;  4O9M A;  3HP6 A;  3PMN A;  1PZN A;  2VA8 A;  4DS4 A;  1KRP A;  4UB5 A;  4ED3 A;  2XY6 A;  5HP4 A;  8ICG A;  5KFN A;  3HW8 A;  2BGW A;  2BKE A;  2PFN A;  4DL3 A;  3RH6 A;  4F4Y A;  1SZP A;  3UPQ A;  1NKE A;  1L3S A;  8ICU A;  5KT7 A;  1TV9 A;  1ZQU A;  9ICL A;  5C5J A;  1BPY A;  9ICO A;  2ZJA A;  2XY5 A;  3UXO A;  4RNO A;  3C2L A;  4FS2 A;  4XA5 A;  3M8R A;  1DOQ A;  3MR2 A;  5L9X A;  1ZET A;  5JUM A;  3JPP A;  4YQW A;  3EPG A;  3OHA A;  4FS1 A;  4YVZ A;  4ED6 A;  1NKB A;  4MFC A;  2KZ3 A;  9ICR A;  4O3O A;  3UQ0 A;  3PX4 A;  8ICL A;  4BDP A;  1X9W A;  3ISD A;  5IIM A;  2H5X A;  4Z6F A;  3RAQ A;  4DSL A;  4F8R A;  4IQU A;  5KT5 A;  3V7L A;  4KLU A;  3RRG A;  1ZQP A;  3UXN A;  4C8K A;  5J0R A;  2R8G A;  3PW4 A;  3ISC A;  3PW2 A;  4IRD A;  1T4G A;  3BJY A;  3SV3 A;  1Z00 A;  2V9W A;  4DSE A;  1WCL A;  1ZJN A;  2A1J A;  4RPX A;  1A76 A;  3QEA Z;  5BOL A;  4M9G A;  3Q8S B;  1L3V A;  1IM4 A;  4GLX A;  5KG7 A;  1NK5 A;  4DSJ A;  5KFK A;  1UT5 A;  2PFO A;  4NLZ A;  5IIO A;  8ICO A;  5L1I A;  3MR5 A;  2BCU A;  3ZDB A;  4K4G A;  4RUA A;  3ORY A;  2WTF A;  3BQ0 A;  1ZYQ A;  1NK0 A;  2BQ3 A;  1ZQH A;  3RJK A;  5KG3 A;  4DFJ A;  4IR1 A;  1NK8 A;  2W9B B;  3KHL A;  8ICQ A;  2ATL A;  4PGQ A;  3RJH A;  5KFJ A;  4JV2 A;  3V6J A;  1U47 A;  2J6T A;  1ZQM A;  3C5G A;  4YG2 A;  9ICT A;  5J0S A;  2KZZ A;  4ELU A;  1MC8 A;  1CEZ A;  1ZQQ A;  3ZDA A;  4RNM A;  4F3O A;  4UBB A;  1NK6 A;  1BVS A;  4ECW A;  4C8M A;  2F1I A;  3HX0 A;  4B9U A;  7ICM A;  4YXM A;  4NLG A;  1TKD A;  1S77 D;  4I2D A;  4FBT A;  8ICJ A;  2HHX A;  8ICP A;  9ICI A;  3M8S A;  2IBK A;  2R8I A;  4J9P A;  2JZB A;  4XUS A;  2BR0 A;  4K4I A;  2W9C B;  1H38 A;  1ZQK A;  3AU2 A;  4ECT A;  5KT6 A;  3GIJ A;  2XY7 A;  2P6U A;  4IRK A;  2JEJ A;  5HHH A;  5DGB A;  9ICS A;  4DWI A;  1ZQA A;  4ECS A;  4IQW A;  4O3R A;  4QWC A;  4F5P A;  4BXO B;  1CUK A;  1ZQX A;  5CA7 A;  3G6V A;  4UBC A;  3GIK A;  1ZQG A;  4I28 A;  5J2A A;  4M47 A;  3H4B A;  3MDA A;  4F91 B;  2ALZ A;  5KG0 A;  1V9P A;  3EZ5 A;  5J2B A;  4DFM A;  2BPF A;  5KFZ A;  4QZI A;  1BPX A;  4KTQ A;  1BPE A;  1DGS A;  2LYH A;  4R64 A;  2W8L A;  2P66 A;  1S97 A;  2FLP A;  5DDM A;  2MUT A;  4TUS A;  5L1J A;  1XSL A;  2R8K A;  4M9N A;  4EYH B;  5EWE A;  2UVW A;  4DL7 A;  5KFY A;  5J2K A;  4EZ6 A;  2C2E A;  4QZE A;  5KT3 A;  3M9N B;  4F50 A;  1HUZ A;  4DSK A;  4YXJ A;  3GV8 B;  9ICN A;  8ICN A;  8ICI A;  4DQS A;  1NJZ A;  1IXR A;  4YCX A;  1D8Y A;  2FLL A;  2HHT A;  4Q44 A;  2XC9 A;  2FPM A;  3JPT A;  8ICM A;  5DGA A;  4F2R A;  3M9M B;  4QWB A;  3RRH A;  4O5C A;  2FPK A;  7ICT A;  4Q8E A;  4B9V A;  4NM1 A;  1S76 D;  4R66 A;  1NJX A;  3GIM A;  3RBD A;  4PHA A;  1U48 A;  1ZQC A;  4TUQ A;  4IRC A;  3EWA A;  9ICM A;  2R8H A;  4RQ1 A;  4DF4 A;  7ICL A;  4KN4 A;  4XRH A;  3G6X A;  3RBE A;  2FLN A;  9ICF A;  3OHB A;  4F5R A;  3BDP A;  7ICE A;  4R8U B;  2ZTD A;  4QWE A;  2AQ4 A;  2RDJ A;  4Q8F A;  1ZQB A;  2HHQ A;  4KLT A;  4MEY A;  1ZQL A;  1XSN A;  1ZQV A;  9ICE A;  9ICU A;  1NK4 A;  3ISB A;  4KLI A;  1XO1 A;  3ZDE A;  4QW8 A;  1B22 A;  5KG4 A;  3ZDD A;  3RB3 A;  2Y1J A;  4UB1 A;  2ISP A;  3TAR A;  1ZJM A;  2ASJ A;  1RZT A;  1KFS A;  2ZUC A;  4TQS A;  7ICU A;  4LZD A;  3H40 A;  1L3T A;  2XGQ A;  7ICS A;  1Y88 A;  5IIK A;  1T3N A;  3JPQ A;  4KLG A;  7ICN A;  5HML A;  2XCP A;  3Q8K A;  3RB0 A;  1QTM A;  5KFC A;  4RQ0 A;  3RB6 A;  5IIJ A;  5KFE A;  9ICB A;  2ISO A;  2ZUD A;  4FO6 A;  4JUZ A;  2C2D A;  7ICR A;  5KFX A;  4EBD A;  3PO4 A;  1KFT A;  7ICF A;  3T5H A;  3SV4 A;  4O3S A;  4YR3 A;  4GXJ A;  2AJQ A;  2F1H A;  3HWT A;  5KG1 A;  1NOM A;  1XU4 A;  3T3F A;  3Q8R B;  1ZQW A;  1UA1 A;  5KFA A;  1RYS A;  4B9M A;  3MR3 A;  3ZD9 A;  3QE9 Y;  4J9Q A;  4M9J A;  3PX0 A;  3SZ2 A;  4GXI A;  2AGO A;  2R8J A;  4ECX A;  2HHU A;  4F5O A;  5KFH A;  1N48 A;  3KHH A;  4DL5 A;  1SKS A;  4KLM A;  2FMQ A;  2IMW P;  1XWL A;  1KLN A;  7ICH A;  2DFL A;  3G6Y A;  3N97 B;  2JEG A;  3MGI A;  4O5E A;  2ASD A;  5L1K A;  4M6W A;  3C1Z A;  5KFW A;  4PHE A;  1ARO P;  2NRZ A;  3LWL A;  2W9A A;  1B43 A;  5J2I A;  3QEB Z;  1RXW A;  8ICW A;  3B0X A;  1ZQZ A;  3GQC A;  1TK5 A;  5KT4 A;  4GXK A;  1ZQT A;  4RQ3 A;  5CHG A;  4UAZ A;  4ED1 A;  5J2G A;  3TFR A;  2C2R A;  1X2I A;  4QWA A;  4QZF A;  4DL6 A;  1TK0 A;  1SL0 A;  1RPL A;  4MEX A;  4G3I A;  1KDH A;  3RJF A;  5KFG A;  1D9F A;  2AQ0 A;  1KTQ A;  3TAN A;  4M9L A;  3OJS A;  2BQR A;  3UQ2 A;  4NLK A;  3OSN A;  1ZQE A;  4RT3 A;  4PPX A;  7ICP A;  5DB6 A;  3K75 D;  3GIL A;  3PY8 A;  2PI5 A;  3C1Y A;  2PXI A;  4UB2 A;  3PW0 A;  1T7P A;  2FPL A;  3NGD A;  7ICG A;  1TK8 A;  5BOM A;  4PHP A;  1JN3 A;  8ICB A;  1XS9 D;  4ECQ A;  4DQR A;  3FDS A;  3TQ1 A;  3TAP A;  4C8L A;  4MF2 A;  4RQ7 A;  2ZUB A;  4DQI A;  4BWM A;  4ELT A;  2I1Q A;  3TAQ A;  3ZD8 A;  5J2F A;  2KFN A;  5DBB A;  4ED0 A;  4J9R A;  1UT8 A;  3H4D A;  8ICV A;  3THV A;  4F4Z A;  5L1L A;  9ICP A;  5D46 A;  3C23 A;  4YP3 A;  4X5V A;  4DSI A;  5DBA A;  5DG8 A;  4DOB A;  4J9M A;  4O3Q A;  2HHW A;  2DPI A;  4KN7 A;  5HHI A;  4QZD A;  4MFA A;  4RZR A;  2BCQ A;  2KTQ A;  2KFZ A;  5F9L A;  4QWD A;  9ICV A;  2PFQ A;  3GFK B;  1L5U A;  5DKW A;  4TQR A;  4KLH A;  4C8N A;  8ICF A;  3EPI A;  1S0O A;  5IIN A;  4RQ5 A;  3Q8M A;  4YFK A;  5J0P A;  2AU0 A;  4DL4 A;  4B9T A;  3C2K A;  3EW9 A;  5BPC A;  4NM2 A;  4UAY A;  2AGP A;  9ICH A;  3FYH A;  4BGD A;  1TAQ A;  4F93 B;  1UA0 A;  5EWF A;  1XC9 A;  4MFF A;  2HHV A;  4QZH A;  4ZH4 A;  5EWG A;  1QSL A;  4RNN A;  4RQ4 A;  4ED8 A;  1ZQY A;  5DLG A;  5DG7 A;  2BCV A;  3K4G A;  8ICR A;  5KFS A;  4RT2 A;  4PGX A;  4DL2 A;  4QZA A;  1ZQJ A;  5J0W A;  4HYK A;  1K1S A;  4RQ6 A;  4ED2 A;  5KT2 A;  4DLG A;  3RJE A;  8ICE A;  2NRT A;  2BHN A; 
#chains in the Genus database with same CATH topology
 3RR7 A;  4YMO A;  7ICQ A;  4P2H A;  2LPE A;  4FBU A;  9ICG A;  3RAX A;  3PSP A;  3BS5 B;  5HNK A;  4J9N A;  3R9K A;  3OJU A;  3I1Y A;  2ZTC A;  8ICS A;  4KLE A;  1S9F A;  1DK2 A;  2H3Z A;  1SB3 C;  5ALL A;  4KLS A;  1L3U A;  8ICT A;  2YQE A;  2BDP A;  1PK1 B;  1TAU A;  5KFI A;  3SQI A;  2UVR A;  5D4B A;  4JB3 A;  3BQT A;  3NVW A;  3GU3 A;  3PO5 A;  5DB9 A;  4I2F A;  2RDI A;  1NK7 A;  1LV5 A;  2CXY A;  4I2H A;  3KHR A;  1MSW D;  5J2C A;  5DQI A;  4C7Y A;  4K4H A;  3PVX A;  5GTH U;  5KFL A;  4Z6C A;  2HBL A;  4F4X A;  3BS7 A;  4U7C A;  3GII A;  1BNP A;  4RQ2 A;  3TAD C;  2VIX A;  1C7Y A;  1XNS A;  7ICJ A;  1V97 A;  2FMP A;  1U45 A;  5KFD A;  4DOA A;  3O0F A;  3KKA A;  3KZI U;  3PR4 A;  2I9G A;  5EE3 A;  2ES6 A;  8ICY A;  4C4S A;  3B9J A;  1S0N A;  4EBC A;  3BQ7 A;  4CE6 A;  5AM3 A;  3QNM A;  1KSP A;  5DB7 A;  4KLD A;  2JRZ A;  4UAR A;  4YMN A;  1PVR A;  1S10 A;  4I2A A;  3C5F A;  3GDX A;  3M6Z A;  1D8L A;  3E0F A;  4YR0 A;  2KVS A;  3RB4 A;  2VA3 A;  8ICC A;  2KJ5 A;  1EXN A;  1KFD A;  4M2Y A;  2D8C A;  3C21 A;  1A6S A;  2QB0 B;  2KJ9 A;  4I2J A;  1BPZ A;  3K1Z A;  4OCZ A;  4FZL A;  4XQ8 A;  2BCS A;  4P4M A;  3HKZ F;  5KFO A;  4UB4 A;  3TFS A;  1PK3 A;  1JIH A;  2EAN A;  1Q3U A;  4DSF A;  5AIC A;  4PZN A;  5AI9 A;  5KFU A;  3GV7 B;  3HT3 A;  2K89 A;  5AM5 A;  4I2B A;  1N56 A;  2P35 A;  4KLL A;  1IIP A;  2YX8 A;  1HUO A;  3DV9 A;  4DFD A;  3IM1 A;  3H0L B;  2DL0 A;  1Q46 A;  8ICA A;  5J0Q A;  2EAM A;  3KTQ A;  5CWR A;  2OWO A;  3L5K A;  4M6W B;  4UQG A;  5DG9 A;  1Z3E B;  4KLQ A;  3PW5 A;  4C4R A;  1KN5 A;  3T5K A;  2BCR A;  4RU9 A;  3QZ7 A;  2HOI A;  4USA A;  5AKK A;  2NRX A;  2P6R A;  2HHS A;  2F8L A;  2IA6 A;  5J2D A;  4P4P A;  2CPR A;  5F9N A;  3HP6 A;  3FM9 A;  2XY6 A;  1B0X A;  2PFN A;  3UPQ A;  1NKE A;  2OM6 A;  5KT7 A;  1ZQU A;  5C5J A;  1BPY A;  4FS2 A;  1DOQ A;  5AI6 A;  3DEE A;  1ZET A;  4FS1 A;  1IG6 A;  4YVZ A;  3UQ0 A;  2DWQ A;  1UHU A;  3ISD A;  4Z6F A;  4F8R A;  2DKX A;  3RRG A;  4C8K A;  3ISC A;  1UQV A;  2V9W A;  4RPX A;  1IM4 A;  1NZB A;  5AI5 A;  5KG7 A;  1NK5 A;  1JI7 A;  1ZXI A;  2KEY A;  5IIO A;  1ZYQ A;  3BQ0 A;  1Z4O A;  4IR1 A;  4G9B A;  2W9B B;  4PGQ A;  1SWW A;  5ALM A;  5AKX A;  4PL2 A;  4YG2 A;  9ICT A;  1CEZ A;  3H8M A;  1NK6 A;  3FAH A;  4ECW A;  4C8M A;  2QLT A;  3HX0 A;  4B9U A;  7ICM A;  2F8K A;  4NLG A;  1TKD A;  9ICI A;  2Y0S C;  5AKY A;  2BR0 A;  4ECT A;  2WHE A;  3GIJ A;  4IRK A;  2ZIW A;  5HHH A;  3BZK A;  9ICS A;  2HBK A;  1OW5 A;  4F5P A;  2E3T A;  3G6V A;  1ZQX A;  4I28 A;  1ZQG A;  3GIK A;  2G0A A;  5KAI U;  3EZ5 A;  2BPF A;  2FE9 A;  2KKV A;  5KFZ A;  1VJ5 A;  4R64 A;  2FLP A;  4FZN A;  5DDM A;  2JH7 A;  3QYP A;  9ICN A;  4YXJ A;  1WWU A;  2FLL A;  2W03 A;  2HHT A;  2YMP A;  5FP0 A;  1ZD2 P;  1RDF A;  5DGA A;  3HIL A;  4O5C A;  1S76 D;  1NJX A;  2O6K A;  4HAI A;  4TUQ A;  4IRC A;  4KN4 A;  3RBE A;  2FLN A;  4F5R A;  4R8U B;  4Q8F A;  4KLT A;  3ISB A;  1B22 A;  5KG4 A;  3UM9 A;  3HRD D;  2EQY A;  3TAR A;  3NVY A;  1ZJM A;  2ZUC A;  4LZD A;  2XGQ A;  2ZIX A;  2XCP A;  2DUY A;  5IIJ A;  5KFE A;  4FO6 A;  4EBD A;  3PO4 A;  3T5H A;  3KD3 A;  4YR3 A;  3LYS A;  2F1H A;  1SV0 A;  1UA1 A;  4UAV A;  3WK5 A;  2MSN A;  2K8A A;  2KKP A;  3NRW A;  4NWI A;  4M9J A;  4GXI A;  2AGO A;  2YN4 A;  1N48 A;  4KLM A;  5HR7 A;  2DBY A;  4PHE A;  2NRZ A;  5J2I A;  3LWL A;  1B43 A;  4NL9 A;  4Y2U A;  3ICX A;  2C2R A;  3OJS A;  2PI5 A;  2PXI A;  1XS9 D;  4ECQ A;  3TQ1 A;  3PSF A;  4DQI A;  2ZUB A;  3DDH A;  3KOO A;  1UT8 A;  1SWV A;  3VCB A;  2E8P A;  5B5E U;  4X5V A;  4QZD A;  2KTQ A;  2KFZ A;  4QWD A;  2KJ8 A;  4RQ5 A;  2LYA A;  2WF7 A;  3C2K A;  3EW9 A;  4UAY A;  2AGP A;  5EWF A;  4QZH A;  4RQ4 A;  4ED8 A;  3T79 A;  3WKB A;  1IV8 A;  4DL2 A;  4ED2 A;  4DLG A;  2Z7J A;  5JTI A;  2NRT A;  2BHN A;  1SGG A;  1QQ6 A;  3H7I A;  5KG6 A;  1Z00 B;  2KK0 A;  1J2M A;  4CF5 A;  2GWS A;  3GZF A;  3N7P D;  4R63 A;  3V6H A;  5J29 A;  3WKE A;  4RPZ A;  1Q3V A;  2W8K A;  1Z1B A;  3U26 A;  5AIB A;  3RJJ A;  3QU5 A;  4EEN A;  4PJ0 U;  3T5J A;  5CJ7 A;  2KP7 A;  4QW9 A;  1S5L U;  2RQ5 A;  5J0Y A;  4KIT B;  9ICC A;  5AM4 A;  5T14 A;  5CR0 A;  1X9S A;  2EAO A;  3MAB A;  4F5Q A;  1VLB A;  2VJ4 A;  3BQ1 A;  4B9N A;  4M9H A;  2H3I A;  3SMV A;  4IR9 A;  1ZQN A;  1RM6 C;  2HSZ A;  2IOH A;  5B66 U;  5J0T A;  3ED5 A;  5KAF U;  3MBY A;  2KIC A;  9ICW A;  1ED1 A;  4BXO A;  1QQ5 A;  4TUR A;  4RUC A;  4JWM A;  1C20 A;  5KG2 A;  1SXD A;  4CCH A;  4J9K A;  2E8M A;  4FFD A;  5AK5 A;  2PFP A;  4FE3 A;  5ALO A;  4YD1 A;  1GO3 F;  4Z6D A;  1YZ7 A;  5ALW A;  2UVV A;  5DLF A;  2WB1 C;  1ZQR A;  3PX6 A;  1COO A;  2KIV A;  2K8B B;  3D2S A;  1FO4 A;  7ICK A;  2B21 A;  5C0Y A;  2PMZ C;  3S6J A;  4J03 A;  2AGQ A;  2IHM A;  2ASL A;  2ZJ8 A;  4QIW F;  4DQQ A;  2XGP A;  4I2I A;  4F5N A;  2MA1 A;  4R65 A;  4DOC A;  4JV0 A;  5DB8 A;  3AEV A;  7ICV A;  4ECU A;  3H8J A;  5J2J A;  2K4P A;  3M9O B;  3IG8 A;  2BPC A;  2Q4T A;  3TAD A;  3SYZ A;  4E0D A;  2HVI A;  3F53 A;  2LBO A;  4QZC A;  4C7Z A;  3H0M B;  4I29 A;  5CP2 A;  2B6G A;  3KHG A;  4ECZ A;  1BPB A;  1KEJ A;  3RH4 A;  1WG8 A;  2L5Y A;  5J2H A;  3C2M A;  4QZG A;  3IV6 A;  4DS5 A;  1JRO A;  4O0I A;  1KBU A;  3QZ8 A;  3A0H U;  5DDY A;  4LZG A;  4IQT A;  2KVC A;  2I6X A;  3ETL A;  3IHQ B;  1KW4 A;  3RH5 A;  2YY6 A;  9ICA A;  4J9L A;  2MAX A;  3WKA A;  3AU6 A;  3J81 j;  3JPS A;  2RP5 A;  4O3P A;  2K4H A;  3TAC B;  4BWJ A;  5AM2 A;  1PVP A;  4I27 A;  1X9M A;  4EYI B;  4RPY A;  4J9S A;  1F44 A;  5III A;  2OEH A;  2V4Q A;  1QQ7 A;  4Y2S A;  2IHN A;  3WK9 A;  2FMS A;  2LM4 A;  3VC8 A;  1PZN A;  4ED3 A;  5HP4 A;  5KFN A;  1P7D A;  2OXO A;  4DL3 A;  1URJ A;  8ICU A;  3AQF A;  2KD1 A;  3CW2 C;  9ICO A;  4C4T A;  1HEK A;  2PKE A;  3EPG A;  4ED6 A;  3HJE A;  4Y2Q A;  3PX4 A;  4BDP A;  2JR5 A;  2H5X A;  1L7O A;  3RAQ A;  5KT5 A;  1AQ6 A;  3SEN A;  1VDV A;  1PUZ A;  3UXN A;  1X6J A;  1T4G A;  3SV3 A;  1YT3 A;  3BS5 A;  3PSI A;  1WCL A;  3QEA Z;  4UB6 U;  4DSJ A;  5KFK A;  3WU2 U;  2WAQ C;  2KHQ A;  4NLB A;  3ZDB A;  4K4G A;  2HMX A;  2WTF A;  3ONN A;  3RJK A;  5KG3 A;  1NK8 A;  2ATL A;  3RJH A;  5KFJ A;  1M6Y A;  3V6J A;  1PVQ A;  2HOF A;  1U47 A;  3C29 A;  5J0S A;  4UBB A;  2BZF A;  1BVS A;  4AYB C;  2VJ5 A;  1XO0 A;  4YXM A;  1S77 D;  2HHX A;  3M8S A;  2R8I A;  4XUS A;  2KV2 A;  2W9C B;  1H38 A;  1ZQK A;  2EH9 A;  3ZI4 A;  2G07 A;  2P6U A;  2JEJ A;  5DGB A;  1ZQA A;  4O3R A;  2LYB A;  4QWC A;  2YB4 A;  4UBC A;  2GLE A;  5J2A A;  3H4B A;  4F91 B;  5TIS U;  5CRX A;  1V9P A;  2OYY A;  5ALG A;  4DFM A;  5ALF A;  1DGS A;  2RHF A;  1S97 A;  1XSL A;  4WJ3 B;  4EYH B;  5EWE A;  2ZG6 A;  4DL7 A;  4EZ6 A;  5KT3 A;  4F50 A;  4DSK A;  2ZIU A;  4DQS A;  2GH1 A;  3QXG A;  4YCX A;  1D8Y A;  4Q44 A;  1Z19 A;  2FPM A;  2WF9 A;  5G5H A;  3JPT A;  3D2Q A;  3M9M B;  4Q8E A;  4B9V A;  4NM1 A;  4R66 A;  3RBD A;  4PHA A;  2D6F C;  3EWA A;  4RQ1 A;  4KX3 A;  4XRH A;  3M6K A;  7ICE A;  4QWE A;  2OHF A;  2QB0 A;  2ZIV B;  2HHQ A;  4IS7 A;  1ZQV A;  9ICE A;  1NK4 A;  4KLI A;  3ZDE A;  4QW8 A;  3RB3 A;  2Y1J A;  1RZT A;  4TQS A;  7ICS A;  4EEK A;  5IIK A;  2Y0S F;  3HKZ C;  3JPQ A;  7ICN A;  5KFC A;  9ICB A;  7ICR A;  2C2D A;  1KFT A;  7ICF A;  3SV4 A;  4O3S A;  5L1M A;  3HWT A;  1HIW A;  1XU4 A;  1RYS A;  4B9M A;  2G06 A;  1X40 A;  2E1E A;  2HCF A;  5KFH A;  2FMQ A;  1XWL A;  1KLN A;  7ICH A;  2DFL A;  2W7O A;  3G6Y A;  3N97 B;  2XID A;  2ASD A;  4M6W A;  3AN1 A;  3AMZ A;  3MGV A;  2LI6 A;  2W9A A;  1RXW A;  2R18 A;  1TK5 A;  4UAZ A;  2DGZ A;  4ED1 A;  2QAR B;  1SL0 A;  1Q8K A;  5KFG A;  3RJF A;  2AQ0 A;  4Y2R A;  2FJ6 A;  2BQR A;  2HOQ A;  3UQ2 A;  4NLK A;  1ZQE A;  4GIB A;  7ICP A;  2EZZ A;  3PY8 A;  3C1Y A;  3PW0 A;  1T7P A;  1J2N A;  2FPL A;  3CNH A;  4EEL A;  2W43 A;  5BOM A;  4PHP A;  3NAS A;  3RFA A;  8ICB A;  3F5E A;  3TAP A;  1A0P A;  2EZX A;  4RQ7 A;  2I1Q A;  4BX9 C;  2KFN A;  3ZD8 A;  4ED0 A;  8ICV A;  4NLC A;  3D6J A;  5L1L A;  3THV A;  2EDU A;  4DOB A;  4O3Q A;  4RZR A;  2KE7 A;  3EPI A;  2AU0 A;  4DL4 A;  4NM2 A;  4FZM A;  9ICH A;  4BGD A;  2JHD A;  5ALU A;  5KL8 B;  1N63 A;  1ZQY A;  3K4G A;  4RT2 A;  4HYK A;  1ZD3 A;  4RQ6 A;  5KT2 A;  1ZRN A;  1NNL A;  5J0O A;  2IOF A;  4O3N A;  4BUG A;  4ED7 A;  3SI8 A;  5ALX A;  1QSS A;  3ETR A;  2FDR A;  5KFF A;  2HBM A;  3PNC A;  2A1J B;  4KX5 A;  9ICJ A;  3I28 A;  1SV4 A;  5KFB A;  2W9B A;  3HPO A;  2JEI A;  4KMU A;  2KIW A;  2ODG A;  2ZJ5 A;  1MN8 A;  4NJ8 A;  1MQ2 A;  4YD2 A;  4IC9 A;  2ESE A;  2W04 A;  4LJX A;  1ZOL A;  4F2S A;  2JGA A;  4P0P B;  3T5L A;  2PI4 A;  4RQN A;  4IQV A;  2UVU A;  3RR8 A;  3QUB A;  3WKD A;  4CRX A;  2K4E A;  5DQH A;  5KFP A;  1SKR A;  2H3Q A;  3H8W A;  2M0N A;  3IN5 A;  2HW3 A;  2KHV A;  1D9D A;  4US8 A;  1RG6 A;  2JZB B;  2W55 A;  4GC6 A;  2K8C B;  3JPO A;  8ICH A;  4OJO A;  3PV8 A;  2J6U A;  4YMM A;  3E2E A;  1HJP A;  3JPR A;  2JMG A;  1TFR A;  1N60 A;  4UAU A;  2A1A A;  3LWM A;  2I5H A;  2CRX A;  2KG5 A;  2DPJ A;  4EEY A;  1N62 A;  3N4M B;  5AIA A;  3GV5 B;  2LMR A;  1S8O A;  3BQ2 A;  5EE1 A;  2XO7 A;  4I2C A;  4Y2P A;  4M0A A;  1ZQO A;  2Y9T A;  5KFQ A;  1NKC A;  2MUT B;  4DO9 A;  4I2G A;  5AKI A;  2C28 A;  5KNI A;  2WFA A;  2OCE A;  1BPD A;  4KLF A;  4EZ9 A;  2A19 A;  4JV1 A;  5AI8 A;  4F72 A;  3LK9 A;  2J6S A;  1RQL A;  5AK6 A;  4R8U A;  2YMQ A;  1N2X A;  3TI0 A;  4C8O A;  3L3F X;  2W11 A;  1L6N A;  4UB3 A;  7ICO A;  2W3R A;  4Y2X A;  1COK A;  4KLO A;  2HDO A;  4EBE A;  3B0Y A;  4M04 A;  3WK6 A;  1NJW A;  4YN4 A;  3V6K A;  8ICK A;  1J97 A;  4O3M A;  4JMU A;  5ALS A;  3F2D A;  2Y1I A;  4EX6 A;  3SR6 A;  3QUC A;  2NRW A;  1Z1V A;  3OPX A;  5EE9 A;  4PGY A;  5DQG A;  4B9L A;  5KFR A;  2LHT A;  4UAS A;  3QX7 A;  1ZQI A;  4ECR A;  3JPN A;  1SIJ A;  2C22 A;  1LKY B;  1SKW A;  2F1J A;  5ALJ A;  5HR6 A;  4DQP A;  4DFK A;  1ZQS A;  5ALQ A;  5J2E A;  2YB1 A;  5ALR A;  3RJI A;  3H8S A;  4DCC A;  1RYR A;  2JEF A;  2NO4 A;  2KN7 A;  5HMM A;  3Q8L A;  1CI4 A;  1F0M A;  4JK1 A;  1X66 A;  4NY8 A;  4ECY A;  2W3S A;  1JX4 A;  3AL0 B;  1SL2 A;  3F5A A;  4QZ8 A;  1BNO A;  2F77 X;  2LM1 A;  5D49 A;  4LVS A;  1S0M A;  1RYU A;  4J9O A;  3PMN A;  2VA8 A;  4UB5 A;  3HW8 A;  4C80 A;  1JUD A;  3K1R B;  2BKE A;  2WF6 A;  4F4Y A;  3CRX A;  3NVV A;  1TV9 A;  2F76 X;  3IRU A;  2NO5 A;  2ZJA A;  1SZH A;  2XY5 A;  3UXO A;  3C2L A;  4XA5 A;  3MR2 A;  5JUM A;  3OHA A;  2KNJ A;  2KZ3 A;  2KSO B;  2GOL A;  1X9W A;  1UCV A;  3N28 A;  5IIM A;  4IQU A;  3V7L A;  2FI1 A;  5J0R A;  3PW4 A;  2DKZ A;  1K5O A;  4P0Q B;  2AXT U;  1Z00 A;  1A76 A;  4M9G A;  2A3V A;  1L3V A;  4GLX A;  2B0C A;  2F44 A;  2G5H B;  1NK0 A;  5ALY A;  3IDW A;  4DFJ A;  5E79 U;  8ICQ A;  2MRL A;  4JV2 A;  3LVW A;  1O08 A;  5AM0 A;  2J6T A;  4ELU A;  1MC8 A;  3ZDA A;  2NYV A;  8ICP A;  3OTQ A;  4I2D A;  1L8O A;  4Y2Y A;  2WF8 A;  4K4I A;  5AI4 A;  3SEI A;  1ZD4 A;  5KT6 A;  3IG5 A;  1N5X A;  4ECS A;  1CUK A;  3N7R C;  5KG0 A;  4KMO B;  2LKY A;  2KMD A;  2K4I A;  5J8Y C;  4QZI A;  4KTQ A;  2LYH A;  2W8L A;  5AM1 A;  3PZP A;  5L1J A;  2R8K A;  1WWV A;  2UVW A;  5KFY A;  2C2E A;  4QZE A;  3M9N B;  3GV8 B;  8ICN A;  1F5S A;  1NJZ A;  1IXR A;  1X9X A;  2XC9 A;  2ZXH A;  7ICT A;  2WAQ F;  3GIM A;  3ALR A;  7ICL A;  1OXJ A;  9ICF A;  2XIC A;  2ZTD A;  2JH1 A;  2AQ4 A;  1ZQB A;  2HI0 A;  4MEY A;  1ZQL A;  1XSN A;  5G5G A;  4QIW C;  3WK4 A;  1XO1 A;  3A0B U;  5ALN A;  2H3V A;  4B6J A;  2ISP A;  4AYB F;  2ASJ A;  1QH9 A;  4CF4 A;  7ICU A;  3Q8K A;  1QTM A;  3RB0 A;  2ZXI A;  3RB6 A;  2ZUD A;  4JUZ A;  5KFX A;  3UMC A;  4GXJ A;  2AJQ A;  1T3Q A;  3T3F A;  3Q8R B;  1ZQW A;  5KFA A;  3MR3 A;  2EAP A;  3ZD9 A;  3QE9 Y;  4J9Q A;  3EUB 2;  3SZ2 A;  4ECX A;  2XI9 A;  2HHU A;  4F5O A;  1SKS A;  2IMW P;  3SAG A;  3C1Z A;  3B0X A;  1ZQZ A;  3TKA A;  1KL9 A;  3GQC A;  5KT4 A;  4GXK A;  3QUQ A;  1ZQT A;  1PK1 A;  5J2G A;  1X2I A;  5AKH A;  4QWA A;  4DL6 A;  4MEX A;  3TAN A;  1WUD A;  4M9L A;  4OD0 A;  2ZIU B;  4RT3 A;  5GTI U;  1O03 A;  5DB6 A;  4UB2 A;  3NGD A;  3D2N A;  1KKX A;  1JN3 A;  4PZO A;  4DQR A;  3FDS A;  3QU2 A;  4MF2 A;  2QB1 A;  2WF5 A;  5J2F A;  5DBB A;  4J9R A;  4F4Z A;  9ICP A;  5D46 A;  5DBA A;  5DG8 A;  4J9M A;  2E5S A;  2HHW A;  2DPI A;  4KN7 A;  5HHI A;  2BCQ A;  5F9L A;  5DKW A;  4TQR A;  4KLH A;  3QUT A;  4YFK A;  5J0P A;  5BPC A;  3WK7 A;  3FYH A;  3RF9 A;  4F93 B;  1UA0 A;  1XC9 A;  4MFF A;  2HHV A;  4ZH4 A;  5ALD A;  4RQM A;  3C28 A;  2BCV A;  5AKZ A;  3KKA C;  5KFS A;  4PGX A;  4QZA A;  5AHX A;  3QU9 A;  3WK8 A;  8ICE A;  2G08 A;  5AKL A;  4KLJ A;  3AUO A;  2F2A B;  1RXV A;  3AM9 A;  4ACO A;  1N5W A;  3SD7 A;  2V4R A;  4Q45 A;  4OJ5 A;  2G5I B;  4DFP A;  3LVV A;  5KG5 A;  5KFM A;  3UMG A;  3MFH A;  3MGH A;  3NRZ A;  4ECV A;  4NXZ A;  1OUQ A;  3EYZ A;  2E1F A;  3F2C A;  5J0U A;  2VAN A;  3MC1 A;  2W54 A;  1NK9 A;  1KQQ A;  4F92 B;  2W9C A;  3OGU A;  1N61 A;  1MA7 A;  8ICX A;  3Q8P B;  4BJQ A;  1FEZ A;  5J0X A;  8ICZ A;  2ZTE A;  1MQ3 A;  9ICK A;  1U49 A;  2RLT A;  1BGX T;  3Q8Q B;  2ZIW B;  4RQ8 A;  3MDC A;  4Y2T A;  5ALT A;  3V7K A;  1S0V A;  1U4B A;  2XCA A;  3N7S C;  3OSP A;  4P4O A;  2VA2 A;  4O5K A;  4UW9 A;  1WCN A;  5EE0 A;  3RJG A;  4YR2 A;  1JMS A;  5AI0 A;  1A77 A;  1QLN A;  2Y9U A;  3MR6 A;  1TVA A;  5KFV A;  2KZM A;  2DF4 B;  4OJL A;  4UAW A;  4PHD A;  4Q43 A;  3PW7 A;  1L7N A;  1U9L A;  1JRP A;  5AKE A;  4U6P A;  3WKC A;  3LDA A;  5EOZ A;  4OO1 J;  4Z6E A;  2NRV A;  3I76 A;  4DLE A;  5CEH A;  3ZDC A;  2JV3 A;  3PR5 B;  3PML A;  5DBC A;  2BQU A;  2ZIV A;  3V72 A;  4C0Z A;  1FFV A;  4Y2V A;  4TUP A;  5CB1 A;  3UXP A;  3NTU A;  4NLN A;  2BPG A;  5TZV A;  2Q0Z X;  4EX7 A;  1YZ6 A;  4F4K A;  2YMM A;  7ICI A;  2ZIX B;  3MFI A;  4F4W A;  2QKQ A;  1ZQD A;  4B9S A;  2HVH A;  3BZC A;  3RTV A;  2JXJ A;  1JXE A;  1NI3 A;  1SL1 A;  5JU5 A;  4US9 A;  3M1Y A;  4ICA A;  1L7P A;  1XSP A;  5ALP A;  5AKG A;  4QZB A;  4MF8 A;  4ELV A;  5ALI A;  4OJP A;  4JWN A;  3F2B A;  3NVZ A;  4UAT A;  1FIQ A;  4DEZ A;  2XVT A;  5H2F U;  4QJF B;  4QZ9 A;  3CP8 A;  2QAR A;  1QCK A;  4GC7 A;  2NV3 A;  1T8E A;  1ZQF A;  1X6I A;  4PH5 A;  2M9N A;  5ALZ A;  4OJ6 A;  1JXL A;  1LB2 B;  1K1Q A;  1V85 A;  5IIL A;  5KTQ A;  3V7J A;  1QSY A;  5KFT A;  4DF8 A;  4I2E A;  2W9M A;  1NJY A;  4O9M A;  4F71 A;  4DS4 A;  1KRP A;  4AP9 A;  8ICG A;  2BGW A;  4QNL A;  3RH6 A;  2MU2 A;  1SZP A;  1ECW A;  1L3S A;  3QU7 A;  9ICL A;  2AH5 A;  2VKQ A;  4CDG A;  4RNO A;  3M8R A;  5L9X A;  4MFC A;  3JPP A;  4YQW A;  1NKB A;  9ICX A;  1V38 A;  9ICR A;  2AHO B;  1LVH A;  4O3O A;  8ICL A;  4DSL A;  3L4P A;  2RRD A;  4KLU A;  1ZQP A;  2H3F A;  2R8G A;  3CYM A;  5JRT A;  3PW2 A;  4IRD A;  2HBJ A;  3BJY A;  4DSE A;  1X42 A;  1ZJN A;  2A1J A;  5BOL A;  3Q8S B;  1JAL A;  2PFO A;  1UT5 A;  4NLZ A;  8ICO A;  5L1I A;  3MR5 A;  2BCU A;  4RUA A;  3ORY A;  1ZQH A;  2BQ3 A;  3KHL A;  1L8L A;  5AKJ A;  4P0P A;  1ZQM A;  3C5G A;  2KZZ A;  1ZQQ A;  4RNM A;  4F3O A;  5ALH A;  2F1I A;  4NV0 A;  3PST A;  4FBT A;  8ICJ A;  2IBK A;  4J9P A;  2JZB A;  4IL6 U;  2W7P A;  3AU2 A;  2XY7 A;  5ALV A;  4DWI A;  4IQW A;  3SAF A;  4BXO B;  5CA7 A;  2GO7 A;  2EZY A;  4M47 A;  1SV0 C;  5K4L A;  3MDA A;  2ALZ A;  1D8B A;  5J2B A;  1BPX A;  1BPE A;  2E8N A;  3KFU F;  2P66 A;  5F3X B;  2MUT A;  4TUS A;  4M9N A;  4GFJ A;  5J2K A;  1HUZ A;  4CGZ A;  2D3D A;  2BDU A;  8ICI A;  1Z4N A;  2WB1 F;  3E58 A;  4NL9 C;  2OH2 A;  8ICM A;  2G09 A;  4F2R A;  2F3N A;  4QWB A;  1ZQ1 C;  3RRH A;  2FPK A;  2N1R A;  1TE2 A;  2PMZ F;  1U48 A;  1ZQC A;  9ICM A;  2R8H A;  4DF4 A;  3G6X A;  9ICQ A;  2YTU A;  3OHB A;  3BDP A;  2RDJ A;  1ZRM A;  9ICU A;  4PL1 A;  3ZDD A;  5ALE A;  4UB1 A;  1KFS A;  3H40 A;  1L3T A;  2DQN B;  1Y88 A;  3SAH A;  1T3N A;  4KLG A;  1DGJ A;  5HML A;  1NZP A;  3NUQ A;  4RQ0 A;  4CF3 A;  2ISO A;  4UB8 U;  5KG1 A;  1NOM A;  3QU4 A;  5A0L A;  4MHV A;  3H0R B;  5J8Y A;  3PX0 A;  2R8J A;  1TAM A;  1ZD5 A;  3KHH A;  4DL5 A;  1LKY A;  2JEG A;  3MGI A;  4Y2J A;  4O5E A;  5L1K A;  5KFW A;  1ARO P;  1DK3 A;  3KZX A;  3QEB Z;  8ICW A;  4RQ3 A;  5CHG A;  3TFR A;  1CRX A;  4CNQ A;  4QZF A;  1TK0 A;  4G3I A;  1RPL A;  3NS1 A;  1KDH A;  3FC4 A;  1D9F A;  4A8E A;  1KTQ A;  3IP4 B;  3OSN A;  3KBB A;  4ZOH C;  4PPX A;  1UPH A;  3K75 D;  3GIL A;  2IOF K;  1WYG A;  1DXS A;  7ICG A;  1TK8 A;  3UMB A;  4C8L A;  4BWM A;  4ELT A;  3TAQ A;  3H4D A;  1SXE A;  3C23 A;  4YP3 A;  4DSI A;  2KOB A;  4MFA A;  9ICV A;  3AQE A;  2CN1 A;  2PFQ A;  3GFK B;  5AK3 A;  1L5U A;  4C8N A;  8ICF A;  2YML A;  1S0O A;  5IIN A;  5ALK A;  3Q8M A;  4B9T A;  1DRG A;  2KSO A;  1TAQ A;  2E8O A;  5EWG A;  1QSL A;  1T94 A;  5KL1 B;  4RNN A;  5DG7 A;  5DLG A;  1L7M A;  8ICR A;  3M7D A;  1ZQJ A;  4P0Q A;  5J0W A;  1K1S A;  1RQN A;  1B4F A;  2K60 A;  3RJE A;  5AK4 A;  1FFU A; 
#chains in the Genus database with same CATH homology
 3RR7 A;  4YMO A;  4KLJ A;  7ICQ A;  5J0O A;  4P2H A;  3H7I A;  3AUO A;  4FBU A;  9ICG A;  5KG6 A;  4O3N A;  4ED7 A;  3SI8 A;  3RAX A;  1RXV A;  1QSS A;  1Z00 B;  5HNK A;  5KFF A;  4J9N A;  2V4R A;  2GWS A;  4Q45 A;  3PNC A;  2A1J B;  3OJU A;  9ICJ A;  2ZTC A;  4DFP A;  5KFB A;  2W9B A;  3HPO A;  2JEI A;  4KMU A;  8ICS A;  5KG5 A;  4R63 A;  3V6H A;  1S9F A;  5J29 A;  4KLE A;  4RPZ A;  2W8K A;  2ZJ5 A;  1MQ2 A;  4KLS A;  4YD2 A;  1L3U A;  3RJJ A;  5KFM A;  8ICT A;  2BDP A;  3MFH A;  3MGH A;  1TAU A;  5KFI A;  3T5J A;  5CJ7 A;  4ECV A;  4QW9 A;  2UVR A;  4F2S A;  5D4B A;  3T5L A;  4NXZ A;  5J0Y A;  4KIT B;  3EYZ A;  2PI4 A;  9ICC A;  3BQT A;  4IQV A;  2UVU A;  3RR8 A;  5J0U A;  5CR0 A;  5DQH A;  1X9S A;  2VAN A;  3PO5 A;  5KFP A;  1SKR A;  1NK9 A;  5DB9 A;  4F92 B;  3H8W A;  4I2F A;  2RDI A;  3MAB A;  1NK7 A;  2W9C A;  1LV5 A;  4F5Q A;  4I2H A;  3KHR A;  1MSW D;  5J2C A;  3OGU A;  5DQI A;  8ICX A;  3BQ1 A;  4K4H A;  4B9N A;  3Q8P B;  4IR9 A;  4M9H A;  2HW3 A;  3PVX A;  1ZQN A;  1D9D A;  9ICQ A;  5KFL A;  2JZB B;  4GC6 A;  5J0X A;  8ICZ A;  4Z6C A;  2ZTE A;  1MQ3 A;  3JPO A;  9ICK A;  5J0T A;  4F4X A;  8ICH A;  1U49 A;  3GII A;  1BGX T;  3PV8 A;  3MBY A;  2J6U A;  9ICW A;  4YMM A;  3Q8Q B;  4BXO A;  3E2E A;  4RQ2 A;  1HJP A;  3JPR A;  4RQ8 A;  4TUR A;  3MDC A;  1TFR A;  4RUC A;  1C7Y A;  3V7K A;  3LWM A;  4JWM A;  1S0V A;  7ICJ A;  1U4B A;  2XCA A;  2FMP A;  1U45 A;  5KFD A;  2DPJ A;  4DOA A;  4EEY A;  3OSP A;  4P4O A;  3N4M B;  2VA2 A;  4O5K A;  5KG2 A;  3RJG A;  1WCN A;  4YR2 A;  3GV5 B;  4CCH A;  4J9K A;  1JMS A;  3PR4 A;  1A77 A;  3BQ2 A;  1QLN A;  2I9G A;  2XO7 A;  3MR6 A;  2PFP A;  4I2C A;  1TVA A;  5KFV A;  2KZM A;  8ICY A;  4YD1 A;  4M0A A;  4UAW A;  4PHD A;  1ZQO A;  4Z6D A;  5KFQ A;  1NKC A;  2MUT B;  4DO9 A;  1S0N A;  4I2G A;  4Q43 A;  3PW7 A;  4EBC A;  9ICX A;  1U9L A;  2UVV A;  5DLF A;  2C28 A;  1KSP A;  5DB7 A;  1BPD A;  4KLD A;  3LDA A;  1ZQR A;  4KLF A;  4EZ9 A;  5EOZ A;  4JV1 A;  4YMN A;  4Z6E A;  3LK9 A;  3PX6 A;  2NRV A;  1S10 A;  4DLE A;  4I2A A;  1COO A;  3C5F A;  2J6S A;  3GDX A;  3ZDC A;  7ICK A;  2B21 A;  1D8L A;  3PR5 B;  4R8U A;  3PML A;  5DBC A;  4YR0 A;  2BQU A;  3RB4 A;  2VA3 A;  3TI0 A;  8ICC A;  3V72 A;  2AGQ A;  4C8O A;  2IHM A;  2ASL A;  1EXN A;  2ZJ8 A;  1KFD A;  4UB3 A;  4TUP A;  5CB1 A;  4DQQ A;  4M2Y A;  2XGP A;  4I2I A;  4F5N A;  3C21 A;  7ICO A;  4KLO A;  4I2J A;  1BPZ A;  4EBE A;  3UXP A;  4R65 A;  4DOC A;  5DB8 A;  4JV0 A;  3B0Y A;  3NTU A;  7ICV A;  4NLN A;  2BPG A;  4M04 A;  5TZV A;  4XQ8 A;  2BCS A;  2Q0Z X;  4P4M A;  4UB4 A;  5KFO A;  4ECU A;  3TFS A;  1NJW A;  4YN4 A;  4F4K A;  1JIH A;  7ICI A;  3H8J A;  3V6K A;  8ICK A;  5J2J A;  4DSF A;  3M9O B;  3MFI A;  4F4W A;  5KFU A;  1ZQD A;  2BPC A;  4B9S A;  2Y1I A;  3GV7 B;  2NRW A;  2HVH A;  3HT3 A;  3SYZ A;  4E0D A;  3RTV A;  4I2B A;  2HVI A;  1N56 A;  1JXE A;  1SL1 A;  4QZC A;  4KLL A;  4PGY A;  5DQG A;  4I29 A;  5CP2 A;  1HUO A;  4B9L A;  3KHG A;  4ECZ A;  1BPB A;  1KEJ A;  3RH4 A;  5KFR A;  3IM1 A;  5J2H A;  1XSP A;  3C2M A;  4QZG A;  4DS5 A;  1ZQI A;  4QZB A;  4MF8 A;  4ELV A;  8ICA A;  4ECR A;  5J0Q A;  3JPN A;  2C22 A;  4O0I A;  3KTQ A;  3QZ8 A;  4JWN A;  1SKW A;  5CWR A;  2F1J A;  5DDY A;  4LZG A;  4IQT A;  2OWO A;  4DEZ A;  4QZ9 A;  3ETL A;  3IHQ B;  4DQP A;  4M6W B;  4UQG A;  4DFK A;  3RH5 A;  1ZQS A;  5J2E A;  4GC7 A;  3RJI A;  5DG9 A;  1T8E A;  1Z3E B;  9ICA A;  3H8S A;  4KLQ A;  4J9L A;  1ZQF A;  1RYR A;  2MAX A;  3AU6 A;  2JEF A;  3PW5 A;  2KN7 A;  5HMM A;  3Q8L A;  3JPS A;  4JK1 A;  4O3P A;  4NY8 A;  4ECY A;  4BWJ A;  4PH5 A;  1JX4 A;  2M9N A;  4I27 A;  3T5K A;  1X9M A;  1SL2 A;  2BCR A;  4QZ8 A;  4RPY A;  4J9S A;  4EYI B;  4RU9 A;  3QZ7 A;  1LB2 B;  5III A;  1JXL A;  1K1Q A;  5IIL A;  2NRX A;  5KTQ A;  5D49 A;  2V4Q A;  2P6R A;  3V7J A;  2HHS A;  4LVS A;  1QSY A;  1S0M A;  5KFT A;  2IA6 A;  5J2D A;  4DF8 A;  4I2E A;  4P4P A;  2W9M A;  5F9N A;  1NJY A;  4J9O A;  2IHN A;  2FMS A;  4O9M A;  3HP6 A;  3PMN A;  1PZN A;  2VA8 A;  4DS4 A;  1KRP A;  4UB5 A;  4ED3 A;  2XY6 A;  5HP4 A;  8ICG A;  5KFN A;  3HW8 A;  2BGW A;  2BKE A;  2PFN A;  4DL3 A;  3RH6 A;  4F4Y A;  1SZP A;  3UPQ A;  1NKE A;  1L3S A;  8ICU A;  5KT7 A;  1TV9 A;  1ZQU A;  9ICL A;  5C5J A;  1BPY A;  9ICO A;  2ZJA A;  2XY5 A;  3UXO A;  4RNO A;  3C2L A;  4FS2 A;  4XA5 A;  3M8R A;  1DOQ A;  3MR2 A;  5L9X A;  1ZET A;  5JUM A;  3JPP A;  4YQW A;  3EPG A;  3OHA A;  4FS1 A;  4YVZ A;  4ED6 A;  1NKB A;  4MFC A;  2KZ3 A;  9ICR A;  4O3O A;  3UQ0 A;  3PX4 A;  8ICL A;  4BDP A;  1X9W A;  3ISD A;  5IIM A;  2H5X A;  4Z6F A;  3RAQ A;  4DSL A;  4F8R A;  4IQU A;  5KT5 A;  3V7L A;  4KLU A;  3RRG A;  1ZQP A;  3UXN A;  4C8K A;  5J0R A;  2R8G A;  3PW4 A;  3ISC A;  3PW2 A;  4IRD A;  1T4G A;  3BJY A;  3SV3 A;  1Z00 A;  2V9W A;  4DSE A;  1WCL A;  1ZJN A;  2A1J A;  4RPX A;  1A76 A;  3QEA Z;  5BOL A;  4M9G A;  3Q8S B;  1L3V A;  1IM4 A;  4GLX A;  5KG7 A;  1NK5 A;  4DSJ A;  5KFK A;  1UT5 A;  2PFO A;  4NLZ A;  5IIO A;  8ICO A;  5L1I A;  3MR5 A;  2BCU A;  3ZDB A;  4K4G A;  4RUA A;  3ORY A;  2WTF A;  3BQ0 A;  1ZYQ A;  1NK0 A;  2BQ3 A;  1ZQH A;  3RJK A;  5KG3 A;  4DFJ A;  4IR1 A;  1NK8 A;  2W9B B;  3KHL A;  8ICQ A;  2ATL A;  4PGQ A;  3RJH A;  5KFJ A;  4JV2 A;  3V6J A;  1U47 A;  2J6T A;  1ZQM A;  3C5G A;  4YG2 A;  9ICT A;  5J0S A;  2KZZ A;  4ELU A;  1MC8 A;  1CEZ A;  1ZQQ A;  3ZDA A;  4RNM A;  4F3O A;  4UBB A;  1NK6 A;  1BVS A;  4ECW A;  4C8M A;  2F1I A;  3HX0 A;  4B9U A;  7ICM A;  4YXM A;  4NLG A;  1TKD A;  1S77 D;  4I2D A;  4FBT A;  8ICJ A;  2HHX A;  8ICP A;  9ICI A;  3M8S A;  2IBK A;  2R8I A;  4J9P A;  2JZB A;  4XUS A;  2BR0 A;  4K4I A;  2W9C B;  1H38 A;  1ZQK A;  3AU2 A;  4ECT A;  5KT6 A;  3GIJ A;  2XY7 A;  2P6U A;  4IRK A;  2JEJ A;  5HHH A;  5DGB A;  9ICS A;  4DWI A;  1ZQA A;  4ECS A;  4IQW A;  4O3R A;  4QWC A;  4F5P A;  4BXO B;  1CUK A;  1ZQX A;  5CA7 A;  3G6V A;  4UBC A;  3GIK A;  1ZQG A;  4I28 A;  5J2A A;  4M47 A;  3H4B A;  3MDA A;  4F91 B;  2ALZ A;  5KG0 A;  1V9P A;  3EZ5 A;  5J2B A;  4DFM A;  2BPF A;  5KFZ A;  4QZI A;  1BPX A;  4KTQ A;  1BPE A;  1DGS A;  2LYH A;  4R64 A;  2W8L A;  2P66 A;  1S97 A;  2FLP A;  5DDM A;  2MUT A;  4TUS A;  5L1J A;  1XSL A;  2R8K A;  4M9N A;  4EYH B;  5EWE A;  2UVW A;  4DL7 A;  5KFY A;  5J2K A;  4EZ6 A;  2C2E A;  4QZE A;  5KT3 A;  3M9N B;  4F50 A;  1HUZ A;  4DSK A;  4YXJ A;  3GV8 B;  9ICN A;  8ICN A;  8ICI A;  4DQS A;  1NJZ A;  1IXR A;  4YCX A;  1D8Y A;  2FLL A;  2HHT A;  4Q44 A;  2XC9 A;  2FPM A;  3JPT A;  8ICM A;  5DGA A;  4F2R A;  3M9M B;  4QWB A;  3RRH A;  4O5C A;  2FPK A;  7ICT A;  4Q8E A;  4B9V A;  4NM1 A;  1S76 D;  4R66 A;  1NJX A;  3GIM A;  3RBD A;  4PHA A;  1U48 A;  1ZQC A;  4TUQ A;  4IRC A;  3EWA A;  9ICM A;  2R8H A;  4RQ1 A;  4DF4 A;  7ICL A;  4KN4 A;  4XRH A;  3G6X A;  3RBE A;  2FLN A;  9ICF A;  3OHB A;  4F5R A;  3BDP A;  7ICE A;  4R8U B;  2ZTD A;  4QWE A;  2AQ4 A;  2RDJ A;  4Q8F A;  1ZQB A;  2HHQ A;  4KLT A;  4MEY A;  1ZQL A;  1XSN A;  1ZQV A;  9ICE A;  9ICU A;  1NK4 A;  3ISB A;  4KLI A;  1XO1 A;  3ZDE A;  4QW8 A;  1B22 A;  5KG4 A;  3ZDD A;  3RB3 A;  2Y1J A;  4UB1 A;  2ISP A;  3TAR A;  1ZJM A;  2ASJ A;  1RZT A;  1KFS A;  2ZUC A;  4TQS A;  7ICU A;  4LZD A;  3H40 A;  1L3T A;  2XGQ A;  7ICS A;  1Y88 A;  5IIK A;  1T3N A;  3JPQ A;  4KLG A;  7ICN A;  5HML A;  2XCP A;  3Q8K A;  3RB0 A;  1QTM A;  5KFC A;  4RQ0 A;  3RB6 A;  5IIJ A;  5KFE A;  9ICB A;  2ISO A;  2ZUD A;  4FO6 A;  4JUZ A;  2C2D A;  7ICR A;  5KFX A;  4EBD A;  3PO4 A;  1KFT A;  7ICF A;  3T5H A;  3SV4 A;  4O3S A;  4YR3 A;  4GXJ A;  2AJQ A;  2F1H A;  3HWT A;  5KG1 A;  1NOM A;  1XU4 A;  3T3F A;  3Q8R B;  1ZQW A;  1UA1 A;  5KFA A;  1RYS A;  4B9M A;  3MR3 A;  3ZD9 A;  3QE9 Y;  4J9Q A;  4M9J A;  3PX0 A;  3SZ2 A;  4GXI A;  2AGO A;  2R8J A;  4ECX A;  2HHU A;  4F5O A;  5KFH A;  1N48 A;  3KHH A;  4DL5 A;  1SKS A;  4KLM A;  2FMQ A;  2IMW P;  1XWL A;  1KLN A;  7ICH A;  2DFL A;  3G6Y A;  3N97 B;  2JEG A;  3MGI A;  4O5E A;  2ASD A;  5L1K A;  4M6W A;  3C1Z A;  5KFW A;  4PHE A;  1ARO P;  2NRZ A;  3LWL A;  2W9A A;  1B43 A;  5J2I A;  3QEB Z;  1RXW A;  8ICW A;  3B0X A;  1ZQZ A;  3GQC A;  1TK5 A;  5KT4 A;  4GXK A;  1ZQT A;  4RQ3 A;  5CHG A;  4UAZ A;  4ED1 A;  5J2G A;  3TFR A;  2C2R A;  1X2I A;  4QWA A;  4QZF A;  4DL6 A;  1TK0 A;  1SL0 A;  1RPL A;  4MEX A;  4G3I A;  1KDH A;  3RJF A;  5KFG A;  1D9F A;  2AQ0 A;  1KTQ A;  3TAN A;  4M9L A;  3OJS A;  2BQR A;  3UQ2 A;  4NLK A;  3OSN A;  1ZQE A;  4RT3 A;  4PPX A;  7ICP A;  5DB6 A;  3K75 D;  3GIL A;  3PY8 A;  2PI5 A;  3C1Y A;  2PXI A;  4UB2 A;  3PW0 A;  1T7P A;  2FPL A;  3NGD A;  7ICG A;  1TK8 A;  5BOM A;  4PHP A;  1JN3 A;  8ICB A;  1XS9 D;  4ECQ A;  4DQR A;  3FDS A;  3TQ1 A;  3TAP A;  4C8L A;  4MF2 A;  4RQ7 A;  2ZUB A;  4DQI A;  4BWM A;  4ELT A;  2I1Q A;  3TAQ A;  3ZD8 A;  5J2F A;  2KFN A;  5DBB A;  4ED0 A;  4J9R A;  1UT8 A;  3H4D A;  8ICV A;  3THV A;  4F4Z A;  5L1L A;  9ICP A;  5D46 A;  3C23 A;  4YP3 A;  4X5V A;  4DSI A;  5DBA A;  5DG8 A;  4DOB A;  4J9M A;  4O3Q A;  2HHW A;  2DPI A;  4KN7 A;  5HHI A;  4QZD A;  4MFA A;  4RZR A;  2BCQ A;  2KTQ A;  2KFZ A;  5F9L A;  4QWD A;  9ICV A;  2PFQ A;  3GFK B;  1L5U A;  5DKW A;  4TQR A;  4KLH A;  4C8N A;  8ICF A;  3EPI A;  1S0O A;  5IIN A;  4RQ5 A;  3Q8M A;  4YFK A;  5J0P A;  2AU0 A;  4DL4 A;  4B9T A;  3C2K A;  3EW9 A;  5BPC A;  4NM2 A;  4UAY A;  2AGP A;  9ICH A;  3FYH A;  4BGD A;  1TAQ A;  4F93 B;  1UA0 A;  5EWF A;  1XC9 A;  4MFF A;  2HHV A;  4QZH A;  4ZH4 A;  5EWG A;  1QSL A;  4RNN A;  4RQ4 A;  4ED8 A;  1ZQY A;  5DLG A;  5DG7 A;  2BCV A;  3K4G A;  8ICR A;  5KFS A;  4RT2 A;  4PGX A;  4DL2 A;  4QZA A;  1ZQJ A;  5J0W A;  4HYK A;  1K1S A;  4RQ6 A;  4ED2 A;  5KT2 A;  4DLG A;  3RJE A;  8ICE A;  2NRT A;  2BHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...