1COOA

The cooh-terminal domain of rna polymerase alpha subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nucleotidyl transferase
molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Solution structure of the activator contact domain of the RNA polymerase alpha subunit.
pubmed rcsb
source organism Escherichia coli
total genus 10
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 1995-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1cooA00
3AUOA 3AU2A 1TKDA 3ZDEA 1ZQEA 4DS5A 2UVVA 4IQWA 7ICKA 8ICIA 4YMOA 4FS1A 4RQ5A 1MC8A 7ICHA 3MBYA 1TV9A 4G3IA 4UB2A 4KN4A 5KFBA 1U4BA 3IM1A 2FLLA 4PPXA 4J9RA 4ECXA 4EZ9A 2B21A 3RJHA 4MFFA 1ZQQA 4QW9A 4YP3A 4DOCA 9ICMA 2FPMA 5KFDA 3RJJA 5KFWA 4RQ1A 1S76D 2OWOA 2BCVA 4XRHA 1D8LA 3JPPA 8ICLA 3KHRA 2W9BB 2FMSA 4QWDA 5DGBA 4BWJA 3RAXA 2JEIA 3MDCA 3EPGA 3SV4A 1QSLA 4Q8EA 5HNKA 3RH4A 4DQQA 5IINA 5C5JA 2AQ0A 3T5KA 4PHPA 1X9SA 4LVSA 5DG8A 1K1SA 4Z6FA 2FLPA 1ZQGA 3KHHA 2XO7A 4DSIA 3N4MB 2ZJ5A 4J9QA 3ZDCA 1SZPA 4RNOA 4F2RA 2MUTB 1D9FA 8ICVA 4J9OA 5KFQA 5DB7A 1JN3A 4K4IA 4C8LA 7ICNA 4RNNA 5BOMA 4Q44A 3LK9A 7ICMA 4GXJA 3RBEA 2P6RA 3RRGA 4I27A 2FMPA 3LDAA 4P2HA 3RJFA 4XA5A 8ICGA 4R64A 3RJEA 2JZBB 8ICZA 1T8EA 1NK0A 2XY7A 1U47A 8ICMA 3ZDAA 2Y1IA 4P4MA 4QWCA 3SV3A 1ZQJA 3C1ZA 3PR5B 8ICTA 5DDMA 4KLUA 3GIKA 5CB1A 3OHAA 4PHDA 4Z6CA 2P6UA 4M9NA 2XY6A 4GC6A 3PR4A 3T5HA 5KFXA 4QZAA 2NRTA 5DDYA 4FO6A 2W9BA 3B0XA 4EYHB 8ICEA 4F5NA 1JXEA 1V9PA 5DG9A 1PZNA 3TFSA 2KZMA 2KFZA 7ICIA 4F8RA 4RU9A 4PHAA 4YG2A 1Z00A 5J0UA 2MUTA 2DPIA 3BQ2A 5KFVA 4I2GA 5L1IA 4IQUA 4F5PA 1K1QA 5EOZA 4YQWA 3PX0A 4TUPA 1ZQFA 3LWLA 5KFYA 4KITB 2BQ3A 3RR7A 7ICOA 9ICEA 4FS2A 3NGDA 3KHLA 3TQ1A 2JZBA 5KT3A 5DBAA 1BPYA 2J6UA 3M8SA 4QZEA 4O5KA 2XC9A 4J9SA 5IIJA 2R8KA 1QSSA 2I1QA 3ZD8A 4TQSA 4DL6A 5IIOA 4ECVA 8ICYA 4QZIA 1RZTA 2UVRA 1ZQPA 4B9NA 1ZQSA 5CA7A 3GV7B 3TANA 5J2FA 3RAQA 9ICWA 3PY8A 4MEXA 4DLGA 5KFFA 1ZQDA 4UB1A 1NKCA 5KFCA 8ICNA 4O5CA 1TFRA 3GIJA 1KFDA 4ECRA 4DEZA 3ZDBA 4DQPA 3RJKA 2J6SA 4YR3A 4JV0A 5J2AA 4F2SA 5KG0A 5KFGA 5HP4A 2IA6A 4RNMA 5DBBA 3ZD9A 4QZBA 3THVA 4DLEA 2C2RA 4RT3A 4QZ9A 3QZ7A 4PGYA 1MQ2A 4KLTA 7ICFA 5KT5A 2KN7A 5KFPA 1QSYA 2IBKA 1XWLA 3OGUA 4DSEA 3FDSA 2KZZA 4IRCA 1S77D 3TFRA 2V4RA 2A1JA 1KFSA 1QTMA 3MGIA 3PW2A 4I2BA 1UA0A 1U45A 4KLMA 2ZJ8A 5L1KA 2BDPA 3HW8A 3H4DA 1JMSA 5HHIA 3K4GA 5HHHA 3PX4A 4Q43A 4QWEA 5J0XA 1TK0A 5DB6A 4YR2A 3Q8KA 5DBCA 4PH5A 1ZQLA 1U9LA 4BWMA 4C8OA 9ICNA 9ICPA 3V6HA 1KFTA 3Q8RB 3G6YA 1TK8A 2HVHA 4KLFA 2VANA 1UT8A 3G6XA 2BCQA 4GC7A 4F4YA 3HX0A 4DL7A 4FBUA 1ZQHA 4NM1A 4KLQA 2FMQA 3RH5A 2UVWA 2ASDA 2NRWA 1S10A 4M9JA 4DL5A 2BR0A 4KLJA 1NK6A 1SKWA 4O3QA 3TI0A 4ECSA 5F9LA 1H38A 3Q8LA 2XCPA 1SKRA 2HHSA 3UXNA 3Q8SB 4KN7A 3JPQA 3UXOA 3JPNA 4MEYA 4O3SA 1S0VA 1T4GA 3UQ2A 2HW3A 5KFHA 5KFOA 5KT4A 1Z00B 5DGAA 3C5FA 2ZJAA 4J9NA 5J0WA 4M9GA 1QLNA 1KEJA 3B0YA 1KSPA 4ECQA 4UAZA 2BHNA 3OSNA 5J0YA 1ZQZA 4O3PA 4ED6A 8ICKA 7ICSA 3M9MB 1ZQIA 3H8JA 1IXRA 4JWMA 4GXIA 1TAQA 4DSKA 2F1IA 4ELUA 8ICPA 1B22A 5J2GA 3HWTA 3H7IA 1A77A 4EYIB 4B9UA 4MF8A 5D4BA 4NLGA 4NLZA 8ICAA 4YXMA 4UAWA 3V7KA 2C2EA 5KG6A 3KTQA 1ZQTA 4DF4A 4RQ6A 3RB3A 4IR9A 8ICRA 4K4GA 5DLGA 5KG2A 3K75D 4Z6EA 4XUSA 1S9FA 4B9VA 2AQ4A 2ZUBA 3GIIA 9ICUA 3C23A 4QZHA 5KFRA 4BGDA 4TUQA 3MFHA 2RDJA 4ED1A 3Q8MA 2HHVA 3QEBZ 5JUMA 1NJZA 4RPYA 5IILA 5CWRA 4UBCA 4M47A 3MGHA 5DG7A 2JEFA 4EBDA 4QZCA 4ED8A 4DWIA 3M9OB 3QEAZ 3V7LA 3RB0A 3OJUA 4YN4A 4ELTA 4JWNA 5KFZA 5J2HA 3PW5A 4KLLA 3BJYA 1T7PA 5L1JA 2ISOA 1ZQOA 2ASLA 3TAPA 1ZQKA 9ICIA 8ICXA 5D49A 3PMNA 2HVIA 1BPBA 5CR0A 2JEGA 7ICGA 5J2CA 5KG5A 8ICOA 5BOLA 1BPZA 4I2DA 9ICCA 3LWMA 4ELVA 3T5LA 4YMMA 1XO1A 4R63A 4M2YA 5EWFA 4EEYA 1NK5A 5L9XA 3KHGA 3H40A 4M9HA 5TZVA 4RQ7A 4J9MA 3C1YA 3RB4A 9ICGA 2XCAA 4F4WA 7ICQA 3ISBA 4XQ8A 5J2BA 1S0MA 1Y88A 2A1JB 4IRDA 2H5XA 8ICFA 2ZTCA 5KFTA 5KT6A 4Q45A 4KMUA 4ED3A 3V6KA 4DFMA 4EZ6A 3GQCA 2WTFA 5DLFA 4DL3A 3IHQB 5EWEA 3MR3A 2UVUA 4YVZA 5J0SA 1KDHA 4ECUA 5EWGA 4DQIA 4I2EA 4RT2A 4RQ4A 3BQTA 4YXJA 4E0DA 4LZGA 9ICVA 4ECWA 4F4XA 2BGWA 4NY8A 4KLSA 3C5GA 5DQHA 4GXKA 1NKEA 4TURA 2HHTA 3G6VA 1XSNA 9ICQA 2W9CA 4I2IA 1ZJMA 1L3UA 1DGSA 2XGPA 4IR1A 3GDXA 2AJQA 1BGXT 5J0RA 4DL4A 4DL2A 3RB6A 9ICXA 8ICCA 4MF2A 5KFAA 5DQIA 3RRHA 4RUAA 1S97A 1ZQMA 4M6WA 3V72A 1ZQNA 2ISPA 1CEZA 1IM4A 4ZH4A 3V6JA 4KLEA 2KFNA 3QZ8A 1U48A 9ICFA 1ZYQA 4B9TA 1UT5A 1XSLA 1ZQRA 3ORYA 3FYHA 3ZDDA 4DO9A 8ICQA 3SZ2A 2BPFA 3TARA 3T5JA 1RXWA 1C7YA 3OSPA 1DOQA 2BCSA 5KFNA 4NLKA 4UAYA 3AU6A 2KZ3A 8ICUA 4DSLA 4P4OA 3M9NB 4JV2A 1L5UA 4KLIA 4C8MA 3RBDA 5KFEA 4F92B 2ATLA 4ED2A 2R8HA 3JPSA 4ECZA 1WCNA 1SL1A 4I2JA 4RQ3A 8ICBA 1UA1A 1D8YA 1JIHA 4NXZA 3RJIA 4EBCA 1ZQWA 2BQUA 4KLOA 5KG1A 2F1JA 2HHQA 4UB4A 4CCHA 2IMWP 5KG3A 2FPKA 5KFUA 1L3SA 5KFSA 2W8KA 4IQTA 9ICBA 3BDPA 3PNCA 5KFLA 3E2EA 1S0OA 4BDPA 5DB9A 5J2EA 4DSFA 4RZRA 3PW0A 1NJWA 4PGXA 1ZQAA 4IRKA 4DS4A 1Z3EB 5IIIA 1L3VA 2ALZA 5J29A 5DB8A 4DFPA 4KLHA 1BPXA 1COOA 3HT3A 3H4BA 1NJYA 4EBEA 2W9MA 4J9PA 7ICRA 9ICKA 1XS9D 4J9KA 4NM2A 4O3RA 5KG7A 4RQ8A 3SYZA 4I2HA 2HHWA 1HJPA 2I9GA 5L1LA 1X2IA 2ZTEA 7ICJA 2IHNA 3RH6A 2AGQA 4DQRA 1T3NA 1RYSA 5J2IA 1XSPA 1XC9A 4F91B 4Z6DA 1SL2A 2BCUA 7ICTA 1NJXA 2NRXA 2RDIA 2C28A 4NLNA 5J0PA 3MR5A 4I2CA 2W8LA 5KTQA 4YR0A 7ICUA 5J0TA 1NK8A 1SKSA 4RPZA 3GIMA 4GLXA 5J2KA 4ECYA 2JEJA 1JX4A 4K4HA 3GILA 3BQ1A 3H8SA 2ZTDA 4QW8A 5J2DA 2NRZA 4QWBA 1U49A 4P4PA 4F5OA 1BPEA 4PHEA 2XGQA 3PV8A 4X5VA 1L3TA 1BPDA 3M8RA 2J6TA 4R8UB 4QWAA 4DSJA 1ZQXA 4UBBA 2PI4A 1ZETA 1TAUA 2BPGA 2DFLA 5KFMA 1ZQVA 4DQSA 4DF8A 4QZGA 1NK4A 3JPRA 4JUZA 4DOAA 2R8GA 2W9CB 1TVAA 4RPXA 4IQVA 5J0OA 4B9MA 3ISCA 2PFOA 4FBTA 1EXNA 5J2JA 2PXIA 4R66A 1N48A 2PFNA 1XU4A 4Q8FA 3EWAA 4M6WB 5DQGA 1NOMA 3PO4A 4KLDA 4F93B 3JPTA 1D9DA 3NTUA 1JXLA 4HYKA 4KLGA 2VA8A 2HHXA 4DFKA 2Y1JA 3N97B 5F9NA 5KFJA 3EZ5A 3C2MA 1ZQBA 3EYZA 4C8KA 2ASJA 1A76A 4DFJA 3EPIA 2VA3A 4BXOB 4O5EA 4O3NA 4TQRA 4J9LA 3SI8A 3HPOA 3UPQA 4F5RA 4I28A 4YCXA 3C21A 2NRVA 2BQRA 2BPCA 4F4ZA 4UB3A 5CHGA 8ICJA 8ICWA 2FLNA 4RQ2A 3EW9A 5J0QA 2AGPA 2W9AA 3C2KA 3JPOA 2M9NA 2F1HA 3UQ0A 4LZDA 1NKBA 4QZ8A 5IIKA 4JK1A 4B9SA 2ZUDA 2DPJA 2BKEA 4R8UA 3T3FA 2C2DA 1HUZA 4YMNA 4I2FA 1KLNA 3PW7A 2AU0A 9ICSA 9ICRA 2P66A 3RR8A 5KG4A 1ZQUA 4O0IA 4UQGA 5IIMA 4M9LA 3V7JA 4JV1A 1KTQA 2LYHA 3MDAA 4ED0A 1MSWD 1KRPA 4R65A 4F5QA 1ZQCA 5KFKA 1S0NA 2VA2A 4MFAA 4F3OA 1WCLA 2ZUCA 2FPLA 1BVSA 1ZJNA 1X9WA 1SL0A 4I2AA 2HHUA 3UXPA 1ZQYA 4C8NA 3ETLA 4O3OA 2V9WA 4KTQA 3PMLA 1HUOA 2MAXA 3OHBA 3RTVA 2GWSA 4BXOA 1AROP 2BCRA 1RPLA 2PI5A 4YD1A 5HMLA 3MR2A 8ICHA 2PFQA 1X9MA 9ICAA 2KTQA 1N56A 3PX6A 4M04A 3MABA 3TAQA 3C2LA 1RXVA 4F4KA 9ICHA 5KFIA 7ICVA 1B43A 5DKWA 3QE9Y 3BQ0A 4B9LA 4UB5A 4ECTA 8ICSA 2AGOA 1RYRA 3OJSA 1CUKA 5D46A 3ISDA 9ICJA 4F50A 1NK7A 3PO5A 3Q8PB 9ICTA 5HMMA 2Q0ZX 3GV8B 4QZFA 4O9MA 2C22A 2PFPA 7ICEA 9ICOA 4RQ0A 3HP6A 4PGQA 7ICPA 4RUCA 3H8WA 5KT2A 2V4QA 1MQ3A 4ED7A 2XY5A 3Q8QB 3GV5B 4M0AA 4QZDA 3MR6A 4DOBA 3PVXA 1LB2B 3PW4A 1NK9A 2R8IA 1LV5A 1TK5A 2IHMA 2R8JA 3MFIA 5KT7A 5BPCA 3RJGA 9ICLA 3GFKB 4TUSA 5CP2A 4I29A 4YD2A 4YFKA 4MFCA 5CJ7A 7ICLA
chains in the Genus database with same CATH superfamily
7ICKA 4RQ5A 3HILA 3EUB2 3MBYA 1TV9A 4CE6A 5KFBA 2FLLA 2W54A 4EZ9A 1ZQQA 3ED5A 5AIBA 4QW9A 2A19A 2ZIVA 1D8BA 9ICMA 1S76D 1D8LA 3JPPA 8ICLA 3AM9A 4BWJA 3SV4A 5HNKA 4DQQA 2AQ0A 4PHPA 1K1SA 1RQNA 2ZJ5A 4F2RA 1FEZA 3CRXA 3BS5B 1D9FA 2OYYA 5DB7A 1JN3A 3WKDA 4C8LA 7ICMA 3LDAA 3I1YA 1Z1VA 8ICZA 2K4HA 5ALQA 2PMZF 3WKBA 3SV3A 8ICTA 1RM6C 3PZPA 2KMDA 2YN4A 4QZAA 2D3DA 4F5NA 5DG9A 5ALDA 5ALZA 2WHEA 5J0UA 4AYBC 1URJA 2MUTA 5EOZA 4YQWA 3PX0A 4KITB 1YZ7A 2ESEA 2J6UA 2XC9A 2EANA 4OO1J 2R8KA 1FO4A 4DL6A 2D8CA 5IIOA 3IRUA 1RZTA 2UVRA 5E79U 2HDOA 1L7PA 4MHVA 3RAQA 3NUQA 1NKCA 3GIJA 3ZDBA 2QB1A 2Z7JA 4DQPA 2IA6A 5KFGA 4DLEA 2MRLA 4QZ9A 3SAHA 1MQ2A 2KN7A 1WWUA 1QSYA 1XWLA 2YMQA 2E3TA 2DQNB 2ZJ8A 3IDWA 1FFUA 2W7OA 4Q43A 5KL1B 4YR2A 1ZQLA 3Q8KA 5DBCA 4PH5A 1U9LA 9ICPA 3V6HA 1TK8A 2HVHA 2W03A 4KLFA 3G6XA 1UT8A 4DL7A 4NM1A 2HI0A 2YB1A 2F8LA 4UARA 3RH5A 2ASDA 4O3QA 5F9LA 5AI5A 3Q8LA 3NASA 2B0CA 4KN7A 5G5HA 3JPQA 3KZIU 4MEYA 3E0FA 5KFHA 5DGAA 1Z00B 3C5FA 2ZJAA 5J0WA 1QLNA 3B0YA 4ED6A 1UHUA 3F5AA 4DSKA 2F2AB 1V38A 2JMGA 3H7IA 1A77A 4MF8A 4UAWA 2BDUA 3KTQA 4DF4A 4IR9A 5AM3A 4Z6EA 9ICUA 2ZUBA 4QZHA 2MA1A 3Q8MA 3ALRA 4A8EA 4RPYA 3IG8A 5CWRA 2Y9TA 3MGHA 2K4PA 2OH2A 4ED8A 4DWIA 1LKYA 5J2HA 5AM2A 3BJYA 5L1JA 2NV3A 1ZQOA 2ASLA 1ZQKA 2HVIA 1BPBA 2WFAA 2JEGA 7ICGA 8ICOA 4QIWF 5BOLA 3E58A 4I2DA 3T5LA 4YMMA 1XO1A 4M2YA 2WF7A 1NK5A 5L9XA 4RQ7A 3C1YA 7ICQA 4PJ0U 5EE9A 5J2BA 1Y88A 2HBMA 4IRDA 2ZTCA 5KT6A 1ZRMA 4ED3A 3D6JA 4BX9C 4EZ6A 3BZKA 2WTFA 2JGAA 5DLFA 4DL3A 2E8NA 2YX8A 2W43A 5J0SA 3BQTA 4F4XA 2BGWA 4NY8A 3C5GA 5AI4A 9ICQA 4EX7A 1ZJMA 4DFDA 3GDXA 4IR1A 3UMCA 4DL4A 2OEHA 4M6WA 3V72A 5ALIA 2NO5A 3HJEA 1ZYQA 4B9TA 1X9XA 3T5JA 3OSPA 1DOQA 4OJOA 1DRGA 4J03A 2EAPA 5AKYA 2YMPA 2QARB 3I76A 2ATLA 2R8HA 4ECZA 2A1AA 1WCNA 1SL1A 4RQ3A 1UA1A 3IG5A 1B0XA 2XICA 5KFUA 1L8LA 2FI1A 4B6JA 2KOBA 3ONNA 1ZOLA 5DB9A 4DSFA 2QB0B 4DS4A 1Z3EB 5IIIA 1Z4OA 1KKXA 3CP8A 3BS7A 2DBYA 4KLHA 5KL8B 3HT3A 3H4BA 1X6IA 1XS9D 4J9KA 5ALKA 4RQ8A 2ZIXA 4I2HA 2HHWA 5L1LA 2F76X 2VJ4A 1RYSA 1XSPA 2G09A 4Z6DA 5AKKA 1NJXA 2C28A 3MR5A 2W8LA 1N5XA 3L5KA 2JEJA 1JX4A 3BQ1A 5AM5A 2ZTDA 2NRZA 2K4EA 5AICA 4UBBA 1TAUA 5KFMA 1ZQVA 3JPRA 2W9CB 4B9MA 1PVQA 3ISCA 2PFOA 4R66A 1D9DA 3NTUA 2VA8A 2Y1JA 5F9NA 1ZQBA 3SMVA 3EPIA 4O5EA 3SI8A 3N28A 3TACB 2ZG6A 3C21A 3PSTA 2K4IA 5CHGA 8ICWA 5J0QA 2E1FA 3JPOA 1VJ5A 2F1HA 1NKBA 4JK1A 3T79A 1SGGA 3M7DA 3BS5A 1KLNA 3RR8A 4UQGA 5IIMA 2OXOA 3IP4B 4JV1A 2LYHA 2F77X 5K4LA 5ALOA 1WCLA 2FPLA 1ZJNA 1SB3C 4KTQA 4C8NA 3ETLA 3PMLA 2MAXA 2BCRA 3A0HU 2KTQA 1N56A 4PL2A 3MABA 4F4KA 3QXGA 5KAIU 1MN8A 5DKWA 1V97A 2AGOA 1RYRA 1Z4NA 1CUKA 4F50A 4FZMA 4UAUA 3GV8B 2PFPA 3UMGA 9ICOA 2KNJA 2V4QA 1MQ3A 5J8YC 2IOFA 2K8CB 2XY5A 4QZDA 1LB2B 3PW4A 1LV5A 1RG6A 1VDVA 3RJGA 2I5HA 4UAVA 5AI8A 1ZQEA 3NVVA 2UVVA 2HBKA 2E8PA 1UCVA 4FS1A 3IV6A 7ICHA 2G0AA 2CPRA 5G5GA 1CRXA 4G3IA 2MU2A 4QNLA 4UB2A 1U4BA 3IM1A 1DXSA 2WAQC 4MFFA 5AM0A 4JB3A 3MGVA 2FPMA 5KFWA 4RQ1A 3KBBA 2FMSA 2W9BB 2GO7A 3RH4A 2OCEA 3T5KA 2FLPA 2E8MA 5F3XB 2HCFA 4DSIA 4RNOA 2RP5A 1WUDA 4J9OA 2ES6A 5KFQA 1VLBA 4Q44A 3LK9A 3S6JA 3RBEA 1NZBA 4XA5A 4R64A 3RJEA 2ZXHA 1U47A 1ZQJA 3C1ZA 3PR5B 4KLUA 3GIKA 3OHAA 4Y2YA 4Z6CA 5H2FU 4M9NA 3PR4A 5ALSA 3T5HA 4FO6A 5DDYA 4EYHB 1RYUA 5AI6A 5GTIU 2K8BB 2KZMA 2KK0A 4F8RA 1Z00A 5ALFA 3BQ2A 1NZPA 4PZOA 4IQUA 4F5PA 4TUPA 1ZQFA 3LWLA 3RR7A 1X42A 2JZBA 5KT3A 5DBAA 4O5KA 2JV3A 3WK5A 1QSSA 8ICYA 1PK1B 4QZIA 5T14A 3K1RB 4B9NA 1ZQSA 5J2FA 1K5OA 4DLGA 2JH7A 5KFFA 1ZQDA 3QU4A 3ZI4A 1O08A 1TFRA 4ECRA 1KFDA 4DEZA 4YR3A 4JV0A 5KG0A 5DBBA 3NS1A 3ZD9A 5CRXA 2C2RA 3SEIA 3IN5A 2LI6A 5ALHA 2IBKA 4DSEA 4PZNA 2DF4B 3TFRA 4Y2PA 1KFSA 4CF3A 1X6JA 1U45A 4KLMA 2HOQA 5L1KA 2WB1F 3HW8A 3H8MA 4KX3A 1FFVA 4OD0A 5DB6A 4C8OA 9ICNA 5ALMA 4BWMA 3G6YA 2LPEA 1OW5A 2BCQA 4KLQA 3D2SA 3D2NA 4CF5A 4M9JA 4DL5A 2KEYA 4ECSA 1H38A 1N62A 2HW3A 5KT4A 4ECQA 4UAZA 5J0YA 8ICKA 3H8JA 4GXIA 1B22A 5J2GA 4NLGA 4EYIB 2YMLA 3AEVA 1ZRNA 5KG6A 1ZQTA 3RB3A 4B9VA 1S9FA 3M6KA 5J8YA 4TUQA 4BGDA 1NJZA 4UASA 3KKAC 2HBJA 4M47A 3QEAZ 3RB0A 3CW2C 3OJUA 4ELTA 4JWNA 3PW5A 4KLLA 2LYAA 2ISOA 8ICXA 3PMNA 5CR0A 1DGJA 5AKXA 5A0LA 2KIVA 5KG5A 1BPZA 2HOIA 5HR7A 1XNSA 4ELVA 4R63A 3WKAA 5EWFA 4EEYA 1QQ5A 5TZVA 3C28A 9ICGA 3ICXA 4F4WA 4EEKA 2WF5A 4XQ8A 2CRXA 3QX7A 2A1JB 4DFMA 4BUGA 3GQCA 4C0ZA 3MR3A 4NL9C 4YVZA 1KDHA 4RT2A 4E0DA 2F3NA 4ZOHC 5DQHA 4GXKA 1NKEA 2HHTA 2LYBA 2W9CA 3DEEA 2WB1C 5KFAA 2ISPA 1Z1BA 3V6JA 1KQQA 9ICFA 1XSLA 3ORYA 2HMXA 2BPFA 3TARA 1RXWA 1T94A 2BCSA 2ZXIA 1ED1A 4UAYA 4CDGA 5AK6A 4DSLA 4P4OA 4JV2A 1L5UA 1Q3VA 4F92B 4ED2A 3N7RC 1ECWA 2KVCA 1D8YA 1JIHA 2MSNA 4EBCA 2BQUA 2FPKA 2AHOB 1L3SA 1IG6A 3H0MB 4USAA 3BDPA 1S0OA 5J2EA 1ZQAA 4IRKA 5AKGA 4BJQA 5DB8A 1COOA 3K1ZA 2W9MA 4J9PA 7ICRA 2PMZC 3SYZA 3L3FX 2KKPA 1T3NA 1XC9A 1SL2A 5AI9A 3QUCA 2RDIA 5AK5A 4I2CA 2D6FC 7ICUA 2JR5A 3R9KA 5J0TA 4RPZA 5J2KA 4K4HA 3GILA 2K60A 2NYVA 4OJPA 2M0NA 4X5VA 1SWVA 4PHEA 1L3TA 1BPDA 4DSJA 1UQVA 2HBLA 4IS7A 1TVAA 1OXJA 1EXNA 1N48A 4O3MA 4Q8FA 4KLDA 2HHXA 3M6ZA 3WK4A 4DFKA 4ACOA 3C2MA 2LM4A 3PSFA 1WG8A 4Y2JA 2KICA 2ASJA 4BXOB 3VCBA 1N2XA 4YCXA 2NRVA 1MA7A 4F4ZA 8ICJA 5AKHA 2DKZA 3EW9A 2W9AA 3U26A 3C2KA 2ODGA 2BZFA 4P0PA 4ICAA 3UQ0A 1RQLA 2KHVA 4Y2QA 5IIKA 2YTUA 2DPJA 4R8UA 4YMNA 3H0LB 4I2FA 4C7ZA 2QLTA 2P66A 2OHFA 3AQFA 4ED0A 2W3RA 1MSWD 3HKZF 1ZQCA 2VKQA 4F3OA 2ZIUA 2ZUCA 3KOOA 4AP9A 1SL0A 2IOFK 1ZQYA 2V9WA 3KKAA 1HUOA 4Y2SA 3QUQA 2GWSA 1AROP 1RPLA 2KJ5A 5HMLA 2PFQA 1X9MA 4M04A 1JROA 1QH9A 1B4FA 1N5WA 5EE0A 1SXDA 7ICVA 2ZIVB 3QE9Y 3BQ0A 2KHQA 4UB5A 8ICSA 4CNQA 3OJSA 4Y2UA 9ICJA 1IIPA 1J2NA 1KW4A 4NJ8A 2Q0ZX 1PVPA 5JRTA 1JI7A 3PSIA 3RF9A 2C22A 4O9MA 5ALJA 1X40A 3I28A 3MR6A 2R8IA 2IHMA 2DGZA 5AKIA 5KT7A 5BPCA 5TISU 4I29A 1A0PA 2AH5A 2YQEA 4NL9A 2KV2A 2B6GA 4MFCA 3AU2A 1TKDA 3ZDEA 4DS5A 1PK1A 4YMOA 3SENA 1MC8A 1TE2A 4J9RA 2W7PA 2B21A 3RJHA 2KP7A 2WF6A 4YP3A 3AN1A 5KFDA 3SQIA 2OWOA 2JH1A 4XRHA 2BCVA 4QWDA 5DGBA 2JEIA 3WK9A 3MDCA 1Z19A 4Q8EA 4WJ3B 1X9SA 1ZQGA 4QIWC 3N4MB 4J9QA 2MUTB 4CGZA 5BOMA 4OJLA 4GXJA 4I27A 3RRGA 2FMPA 3QU7A 4P2HA 3RJFA 1AQ6A 2XY7A 8ICMA 3ZDAA 5EE1A 4P4MA 3AMZA 1QCKA 1CI4A 1S5LU 4KX5A 4GC6A 2XY6A 1A6SA 5KFXA 3F2BA 4NWIA 3B0XA 3TFSA 4UB6U 3HKZC 7ICIA 3HRDD 1SV0C 5KFVA 1YZ6A 4FE3A 5L1IA 2BQ3A 9ICEA 4FS2A 4US9A 3NGDA 3KHLA 1PUZA 1BPYA 4J9SA 5IIJA 4CF4A 2I1QA 3ZD8A 4TQSA 2H3FA 4ECVA 5CA7A 3TANA 3PY8A 5AHXA 8ICNA 2OM6A 1DK2A 5J2AA 5HP4A 3AL0B 3KFUF 1Q8KA 4QZBA 4RT3A 4LJXA 3QZ7A 1UPHA 4PGYA 7ICFA 2N1RA 3PSPA 2FDRA 3FDSA 4IRCA 4OJ6A 2A1JA 4C4RA 1BNPA 3MGIA 2KE7A 2BDPA 3H4DA 2Q4TA 4F72A 3K4GA 3PX4A 1TK0A 2Y0SF 4G9BA 3WKCA 2YMMA 3OTQA 3RFAA 3QUBA 3MC1A 2RLTA 1ZQHA 4FBUA 4GFJA 2NRWA 1S10A 2BR0A 1NK6A 1SKWA 1ZD2P 5AKJA 3UXOA 3JPNA 4C80A 4O3SA 2RRDA 1S0VA 1T4GA 4OJ5A 4M9GA 1KEJA 1OUQA 2BHNA 3OSNA 7ICSA 4O3PA 3DV9A 3QNMA 1TAQA 4ELUA 3HWTA 1QQ6A 8ICAA 4NLZA 4YXMA 4K4GA 2PKEA 2W55A 3K75D 1V85A 3GIIA 3C23A 5KFRA 3MFHA 2EDUA 2HHVA 1JALA 5JUMA 2EZXA 5IILA 4UBCA 3SR6A 3M9OB 3V7LA 4U6PA 1ZD4A 9ICIA 3AQEA 2G08A 5J2CA 2LHTA 9ICCA 3LWMA 2VJ5A 3KHGA 4J9MA 5ALXA 2H5XA 4Q45A 2XI9A 2JXJA 3N7PD 5EWEA 2W3SA 3QU2A 4ECUA 5EWGA 4I2EA 9ICVA 4LZGA 5AI0A 4ECWA 3LYSA 4KLSA 3FM9A 2QKQA 4DCCA 4I2IA 5ALGA 2A3VA 2AJQA 1XO0A 3OPXA 1S97A 3RRHA 2I6XA 1KBUA 1ZQNA 1CEZA 4KLEA 1Q3UA 2KFNA 2Y0SC 1C20A 4IC9A 4FZLA 3ZDDA 1C7YA 1SV4A 5AKLA 5KFNA 4NLKA 8ICUA 4KLIA 4C8MA 5KFEA 1L7NA 3RJIA 4KLOA 1ZQWA 1KL9A 2O6KA 1SV0A 3CYMA 4UB4A 3GU3A 5KFSA 2W8KA 4IQTA 1TAMA 3E2EA 4BDPA 2LBOA 1NI3A 4PGXA 5J29A 5C0YA 5JTIA 2DWQA 3H0RB 1M6YA 1NJYA 5KG7A 1HJPA 2YB4A 2ZTEA 7ICJA 3F2CA 5FP0A 2QARA 2AGQA 5ALVA 1P7DA 4Y2TA 7ICTA 5AKEA 4F71A 5J0PA 8ICPA 5KTQA 1SKSA 2JRZA 1ZD5A 3GIMA 4GLXA 4ECYA 3H8SA 5J2DA 1WYGA 4QWBA 1U49A 2ZIWB 2PI4A 2BPGA 2QB0A 4DF8A 5AK4A 2KVSA 2R8GA 4DOAA 2E5SA 3SAGA 4IQVA 4FBTA 2PFNA 3EWAA 5ALRA 5DQGA 4F93B 3N7SC 3JPTA 3SD7A 4CRXA 3TADC 2E8OA 2FJ6A 3FC4A 5KFJA 5EE3A 1F0MA 2G06A 1Q46A 4C8KA 1F5SA 4DFJA 4O3NA 2JHDA 4J9LA 4F5RA 1S8OA 4NLBA 2BQRA 4UB3A 5JU5A 4RQ2A 4FFDA 2AGPA 4LZDA 2ZUDA 3T3FA 2KSOB 2XIDA 1HUZA 1COKA 5CEHA 3PW7A 3WKEA 2EQYA 5KG4A 4O0IA 4M9LA 3MDAA 1HIWA 4F5QA 5KFKA 1S0NA 4MFAA 1BVSA 3FAHA 2HHUA 2K89A 3RTVA 2PI5A 4OCZA 5ALWA 3C2LA 9ICHA 4JMUA 5KFIA 1JUDA 4ECTA 3BQ7A 4C4SA 5D46A 3ISDA 1NK7A 3NVWA 4QZFA 1L6NA 7ICEA 3HP6A 4RUCA 5KT2A 4ED7A 3GV5B 3F5EA 3TKAA 4M0AA 4DOBA 3PVXA 1NK9A 1TK5A 3MFIA 9ICLA 4TUSA 1QQ7A 5CP2A 5B66U 3WK6A 3ETRA 7ICLA 3AUOA 8ICIA 1FIQA 3UMBA 4IQWA 1N63A 4NLCA 4IL6U 2XVTA 2DKXA 4KN4A 2FE9A 4ECXA 4PPXA 2CN1A 2NO4A 4DOCA 2KG5A 3RJJA 3KHRA 3RAXA 3EPGA 1PK3A 1QSLA 5IINA 5C5JA 4LVSA 2Y9UA 5DG8A 4Z6FA 3KHHA 2XO7A 3ZDCA 1SZPA 8ICVA 4K4IA 7ICNA 4RNNA 2P6RA 5KNIA 3D2QA 8ICGA 1WWVA 2JZBB 1T8EA 1NK0A 2Y1IA 2E1EA 2R18A 4QWCA 4P0QB 5DDMA 5CB1A 4PHDA 2P6UA 4FZNA 2H3QA 2NRTA 1KN5A 2W9BA 8ICEA 1JXEA 1V9PA 2KFZA 1PZNA 3VC8A 4RU9A 4PHAA 4YG2A 2W11A 3CNHA 2DPIA 5AM4A 4I2GA 1J97A 5ALLA 1K1QA 4RQNA 5KFYA 7ICOA 1NNLA 5AK3A 3TQ1A 2F44A 5AIAA 3M8SA 4QZEA 2EH9A 3QU5A 1ZQPA 3GV7B 9ICWA 4MEXA 1BNOA 2EAMA 4UB1A 5KFCA 1T3QA 4O5CA 3RJKA 2J6SA 2G5IB 2GOLA 4F2SA 2GH1A 4RNMA 3NRZA 3THVA 4QJFB 3TADA 4KLTA 5KT5A 5KFPA 3OGUA 2KZZA 1S77D 2V4RA 1QTMA 3PW2A 4I2BA 1UA0A 3WU2U 1JMSA 5B5EU 5HHIA 5HHHA 2RQ5A 4QWEA 5J0XA 1N61A 1KFTA 3Q8RB 2VANA 4GC7A 4F4YA 4EX6A 3HX0A 1SZHA 2FMQA 2H3VA 2UVWA 4KLJA 4UATA 3QUTA 3TI0A 5ALUA 2XCPA 1SKRA 2KJ9A 2HHSA 3UXNA 3Q8SB 3O0FA 4Y2VA 3UQ2A 5KFOA 5L1MA 1PVRA 4J9NA 1KSPA 2G07A 1ZQZA 3B9JA 3M9MB 1ZQIA 1IXRA 4JWMA 2F1IA 4B9UA 5D4BA 3V7KA 2C2EA 4RQ6A 8ICRA 5DLGA 4XUSA 2YY6A 5KG2A 2AQ4A 4RQMA 2RDJA 4ED1A 3QEBZ 2WAQF 2AXTU 5DG7A 1GO3F 2JEFA 4EBDA 4QZCA 2G5HB 4PL1A 4YN4A 5KFZA 4EELA 1T7PA 4U7CA 3TAPA 5D49A 5AKZA 1ZXIA 3GZFA 5AM1A 2H3ZA 3NRWA 1L7MA 3H40A 4M9HA 3RB4A 2XCAA 3ISBA 1S0MA 8ICFA 5KFTA 4KMUA 3V6KA 2IOHA 3IHQB 4UW9A 2UVUA 4KMOB 1ZQ1C 4DQIA 2ZIWA 4RQ4A 4YXJA 4NV0A 4TURA 3KZXA 3G6VA 1XSNA 1L3UA 1DGSA 2XGPA 4C4TA 1BGXT 5J0RA 4DL2A 3RB6A 4GIBA 8ICCA 9ICXA 4MF2A 5DQIA 4RUAA 1ZQMA 2EZZA 2EZYA 1IM4A 4ZH4A 3QZ8A 1U48A 4EENA 1UT5A 1ZQRA 3FYHA 4DO9A 2VIXA 8ICQA 3SZ2A 2RHFA 1LVHA 3AU6A 2KZ3A 2EAOA 3M9NB 2KKVA 2HOFA 3SAFA 3RBDA 1J2MA 3JPSA 4I2JA 8ICBA 4NXZA 2KSOA 5ALEA 3A0BU 2F1JA 5KG1A 4C7YA 2HHQA 4CCHA 2IMWP 1N60A 5KG3A 2P35A 9ICBA 3PNCA 5KFLA 1ZD3A 3PW0A 4RZRA 1NJWA 2HSZA 5ALYA 1L3VA 1LKYB 2KJ8A 2ALZA 1RDFA 4DFPA 1BPXA 1JRPA 4EBEA 9ICKA 4O3RA 4NM2A 2W04A 1L8OA 2I9GA 5HR6A 1X2IA 2IHNA 3RH6A 4DQRA 3LVVA 3NVZA 5J2IA 4F91B 2BCUA 1SWWA 2NRXA 4NLNA 1YT3A 3M1YA 4YR0A 1NK8A 4QW8A 4P4PA 4F5OA 1BPEA 3PV8A 2XGQA 4P0PB 2K8AA 3M8RA 2J6TA 4R8UB 4QWAA 1ZQXA 1X66A 3QYPA 1ZETA 2DFLA 4DQSA 4QZGA 5ALNA 1NK4A 4JUZA 3J81j 4RPXA 3DDHA 5J0OA 5J2JA 2PXIA 1XU4A 3NVYA 4US8A 4M6WB 1NOMA 3PO4A 3KD3A 2ZIUB 2KD1A 4KLGA 1JXLA 4HYKA 2LMRA 3N97B 1L7OA 3EZ5A 3EYZA 1A76A 4Y2RA 2F8KA 2VA3A 4TQRA 3UPQA 3HPOA 4I28A 3QU9A 4UB8U 2BPCA 3WK7A 3WK8A 2FLNA 4Y2XA 3BZCA 2WF8A 3LVWA 2M9NA 3F2DA 4QZ8A 4B9SA 2BKEA 2C2DA 2GLEA 2AU0A 1SXEA 9ICSA 9ICRA 1DK3A 1ZQUA 2LM1A 2DL0A 5KAFU 3V7JA 2LKYA 1KTQA 3UM9A 1KRPA 4R65A 2WF9A 5GTHU 4HAIA 2VA2A 1O03A 4P0QA 4AYBF 1X9WA 4I2AA 3UXPA 2CXYA 4O3OA 3OHBA 2L5YA 4BXOA 1HEKA 5ALPA 4YD1A 2ZIXB 3MR2A 8ICHA 2H3IA 9ICAA 2DUYA 3PX6A 1RXVA 3TAQA 1IV8A 1B43A 4B9LA 3PO5A 3Q8PB 9ICTA 5ALTA 5HMMA 1F44A 3F53A 2KIWA 4RQ0A 7ICPA 4PGQA 1SIJA 3H8WA 3Q8QB 2R8JA 3C29A 3GFKB 4YD2A 3L4PA 4YFKA 5CJ7A
chains in the Genus database with same CATH topology
3AUOA 3AU2A 1TKDA 3ZDEA 1ZQEA 4DS5A 2UVVA 4IQWA 7ICKA 8ICIA 4YMOA 4FS1A 4RQ5A 1MC8A 7ICHA 3MBYA 1TV9A 4G3IA 4UB2A 4KN4A 5KFBA 1U4BA 3IM1A 2FLLA 4PPXA 4J9RA 4ECXA 4EZ9A 2B21A 3RJHA 4MFFA 1ZQQA 4QW9A 4YP3A 4DOCA 9ICMA 2FPMA 5KFDA 3RJJA 5KFWA 4RQ1A 1S76D 2OWOA 2BCVA 4XRHA 1D8LA 3JPPA 8ICLA 3KHRA 2W9BB 2FMSA 4QWDA 5DGBA 4BWJA 3RAXA 2JEIA 3MDCA 3EPGA 3SV4A 1QSLA 4Q8EA 5HNKA 3RH4A 4DQQA 5IINA 5C5JA 2AQ0A 3T5KA 4PHPA 1X9SA 4LVSA 5DG8A 1K1SA 4Z6FA 2FLPA 1ZQGA 3KHHA 2XO7A 4DSIA 3N4MB 2ZJ5A 4J9QA 3ZDCA 1SZPA 4RNOA 4F2RA 2MUTB 1D9FA 8ICVA 4J9OA 5KFQA 5DB7A 1JN3A 4K4IA 4C8LA 7ICNA 4RNNA 5BOMA 4Q44A 3LK9A 7ICMA 4GXJA 3RBEA 2P6RA 3RRGA 4I27A 2FMPA 3LDAA 4P2HA 3RJFA 4XA5A 8ICGA 4R64A 3RJEA 2JZBB 8ICZA 1T8EA 1NK0A 2XY7A 1U47A 8ICMA 3ZDAA 2Y1IA 4P4MA 4QWCA 3SV3A 1ZQJA 3C1ZA 3PR5B 8ICTA 5DDMA 4KLUA 3GIKA 5CB1A 3OHAA 4PHDA 4Z6CA 2P6UA 4M9NA 2XY6A 4GC6A 3PR4A 3T5HA 5KFXA 4QZAA 2NRTA 5DDYA 4FO6A 2W9BA 3B0XA 4EYHB 8ICEA 4F5NA 1JXEA 1V9PA 5DG9A 1PZNA 3TFSA 2KZMA 2KFZA 7ICIA 4F8RA 4RU9A 4PHAA 4YG2A 1Z00A 5J0UA 2MUTA 2DPIA 3BQ2A 5KFVA 4I2GA 5L1IA 4IQUA 4F5PA 1K1QA 5EOZA 4YQWA 3PX0A 4TUPA 1ZQFA 3LWLA 5KFYA 4KITB 2BQ3A 3RR7A 7ICOA 9ICEA 4FS2A 3NGDA 3KHLA 3TQ1A 2JZBA 5KT3A 5DBAA 1BPYA 2J6UA 3M8SA 4QZEA 4O5KA 2XC9A 4J9SA 5IIJA 2R8KA 1QSSA 2I1QA 3ZD8A 4TQSA 4DL6A 5IIOA 4ECVA 8ICYA 4QZIA 1RZTA 2UVRA 1ZQPA 4B9NA 1ZQSA 5CA7A 3GV7B 3TANA 5J2FA 3RAQA 9ICWA 3PY8A 4MEXA 4DLGA 5KFFA 1ZQDA 4UB1A 1NKCA 5KFCA 8ICNA 4O5CA 1TFRA 3GIJA 1KFDA 4ECRA 4DEZA 3ZDBA 4DQPA 3RJKA 2J6SA 4YR3A 4JV0A 5J2AA 4F2SA 5KG0A 5KFGA 5HP4A 2IA6A 4RNMA 5DBBA 3ZD9A 4QZBA 3THVA 4DLEA 2C2RA 4RT3A 4QZ9A 3QZ7A 4PGYA 1MQ2A 4KLTA 7ICFA 5KT5A 2KN7A 5KFPA 1QSYA 2IBKA 1XWLA 3OGUA 4DSEA 3FDSA 2KZZA 4IRCA 1S77D 3TFRA 2V4RA 2A1JA 1KFSA 1QTMA 3MGIA 3PW2A 4I2BA 1UA0A 1U45A 4KLMA 2ZJ8A 5L1KA 2BDPA 3HW8A 3H4DA 1JMSA 5HHIA 3K4GA 5HHHA 3PX4A 4Q43A 4QWEA 5J0XA 1TK0A 5DB6A 4YR2A 3Q8KA 5DBCA 4PH5A 1ZQLA 1U9LA 4BWMA 4C8OA 9ICNA 9ICPA 3V6HA 1KFTA 3Q8RB 3G6YA 1TK8A 2HVHA 4KLFA 2VANA 1UT8A 3G6XA 2BCQA 4GC7A 4F4YA 3HX0A 4DL7A 4FBUA 1ZQHA 4NM1A 4KLQA 2FMQA 3RH5A 2UVWA 2ASDA 2NRWA 1S10A 4M9JA 4DL5A 2BR0A 4KLJA 1NK6A 1SKWA 4O3QA 3TI0A 4ECSA 5F9LA 1H38A 3Q8LA 2XCPA 1SKRA 2HHSA 3UXNA 3Q8SB 4KN7A 3JPQA 3UXOA 3JPNA 4MEYA 4O3SA 1S0VA 1T4GA 3UQ2A 2HW3A 5KFHA 5KFOA 5KT4A 1Z00B 5DGAA 3C5FA 2ZJAA 4J9NA 5J0WA 4M9GA 1QLNA 1KEJA 3B0YA 1KSPA 4ECQA 4UAZA 2BHNA 3OSNA 5J0YA 1ZQZA 4O3PA 4ED6A 8ICKA 7ICSA 3M9MB 1ZQIA 3H8JA 1IXRA 4JWMA 4GXIA 1TAQA 4DSKA 2F1IA 4ELUA 8ICPA 1B22A 5J2GA 3HWTA 3H7IA 1A77A 4EYIB 4B9UA 4MF8A 5D4BA 4NLGA 4NLZA 8ICAA 4YXMA 4UAWA 3V7KA 2C2EA 5KG6A 3KTQA 1ZQTA 4DF4A 4RQ6A 3RB3A 4IR9A 8ICRA 4K4GA 5DLGA 5KG2A 3K75D 4Z6EA 4XUSA 1S9FA 4B9VA 2AQ4A 2ZUBA 3GIIA 9ICUA 3C23A 4QZHA 5KFRA 4BGDA 4TUQA 3MFHA 2RDJA 4ED1A 3Q8MA 2HHVA 3QEBZ 5JUMA 1NJZA 4RPYA 5IILA 5CWRA 4UBCA 4M47A 3MGHA 5DG7A 2JEFA 4EBDA 4QZCA 4ED8A 4DWIA 3M9OB 3QEAZ 3V7LA 3RB0A 3OJUA 4YN4A 4ELTA 4JWNA 5KFZA 5J2HA 3PW5A 4KLLA 3BJYA 1T7PA 5L1JA 2ISOA 1ZQOA 2ASLA 3TAPA 1ZQKA 9ICIA 8ICXA 5D49A 3PMNA 2HVIA 1BPBA 5CR0A 2JEGA 7ICGA 5J2CA 5KG5A 8ICOA 5BOLA 1BPZA 4I2DA 9ICCA 3LWMA 4ELVA 3T5LA 4YMMA 1XO1A 4R63A 4M2YA 5EWFA 4EEYA 1NK5A 5L9XA 3KHGA 3H40A 4M9HA 5TZVA 4RQ7A 4J9MA 3C1YA 3RB4A 9ICGA 2XCAA 4F4WA 7ICQA 3ISBA 4XQ8A 5J2BA 1S0MA 1Y88A 2A1JB 4IRDA 2H5XA 8ICFA 2ZTCA 5KFTA 5KT6A 4Q45A 4KMUA 4ED3A 3V6KA 4DFMA 4EZ6A 3GQCA 2WTFA 5DLFA 4DL3A 3IHQB 5EWEA 3MR3A 2UVUA 4YVZA 5J0SA 1KDHA 4ECUA 5EWGA 4DQIA 4I2EA 4RT2A 4RQ4A 3BQTA 4YXJA 4E0DA 4LZGA 9ICVA 4ECWA 4F4XA 2BGWA 4NY8A 4KLSA 3C5GA 5DQHA 4GXKA 1NKEA 4TURA 2HHTA 3G6VA 1XSNA 9ICQA 2W9CA 4I2IA 1ZJMA 1L3UA 1DGSA 2XGPA 4IR1A 3GDXA 2AJQA 1BGXT 5J0RA 4DL4A 4DL2A 3RB6A 9ICXA 8ICCA 4MF2A 5KFAA 5DQIA 3RRHA 4RUAA 1S97A 1ZQMA 4M6WA 3V72A 1ZQNA 2ISPA 1CEZA 1IM4A 4ZH4A 3V6JA 4KLEA 2KFNA 3QZ8A 1U48A 9ICFA 1ZYQA 4B9TA 1UT5A 1XSLA 1ZQRA 3ORYA 3FYHA 3ZDDA 4DO9A 8ICQA 3SZ2A 2BPFA 3TARA 3T5JA 1RXWA 1C7YA 3OSPA 1DOQA 2BCSA 5KFNA 4NLKA 4UAYA 3AU6A 2KZ3A 8ICUA 4DSLA 4P4OA 3M9NB 4JV2A 1L5UA 4KLIA 4C8MA 3RBDA 5KFEA 4F92B 2ATLA 4ED2A 2R8HA 3JPSA 4ECZA 1WCNA 1SL1A 4I2JA 4RQ3A 8ICBA 1UA1A 1D8YA 1JIHA 4NXZA 3RJIA 4EBCA 1ZQWA 2BQUA 4KLOA 5KG1A 2F1JA 2HHQA 4UB4A 4CCHA 2IMWP 5KG3A 2FPKA 5KFUA 1L3SA 5KFSA 2W8KA 4IQTA 9ICBA 3BDPA 3PNCA 5KFLA 3E2EA 1S0OA 4BDPA 5DB9A 5J2EA 4DSFA 4RZRA 3PW0A 1NJWA 4PGXA 1ZQAA 4IRKA 4DS4A 1Z3EB 5IIIA 1L3VA 2ALZA 5J29A 5DB8A 4DFPA 4KLHA 1BPXA 1COOA 3HT3A 3H4BA 1NJYA 4EBEA 2W9MA 4J9PA 7ICRA 9ICKA 1XS9D 4J9KA 4NM2A 4O3RA 5KG7A 4RQ8A 3SYZA 4I2HA 2HHWA 1HJPA 2I9GA 5L1LA 1X2IA 2ZTEA 7ICJA 2IHNA 3RH6A 2AGQA 4DQRA 1T3NA 1RYSA 5J2IA 1XSPA 1XC9A 4F91B 4Z6DA 1SL2A 2BCUA 7ICTA 1NJXA 2NRXA 2RDIA 2C28A 4NLNA 5J0PA 3MR5A 4I2CA 2W8LA 5KTQA 4YR0A 7ICUA 5J0TA 1NK8A 1SKSA 4RPZA 3GIMA 4GLXA 5J2KA 4ECYA 2JEJA 1JX4A 4K4HA 3GILA 3BQ1A 3H8SA 2ZTDA 4QW8A 5J2DA 2NRZA 4QWBA 1U49A 4P4PA 4F5OA 1BPEA 4PHEA 2XGQA 3PV8A 4X5VA 1L3TA 1BPDA 3M8RA 2J6TA 4R8UB 4QWAA 4DSJA 1ZQXA 4UBBA 2PI4A 1ZETA 1TAUA 2BPGA 2DFLA 5KFMA 1ZQVA 4DQSA 4DF8A 4QZGA 1NK4A 3JPRA 4JUZA 4DOAA 2R8GA 2W9CB 1TVAA 4RPXA 4IQVA 5J0OA 4B9MA 3ISCA 2PFOA 4FBTA 1EXNA 5J2JA 2PXIA 4R66A 1N48A 2PFNA 1XU4A 4Q8FA 3EWAA 4M6WB 5DQGA 1NOMA 3PO4A 4KLDA 4F93B 3JPTA 1D9DA 3NTUA 1JXLA 4HYKA 4KLGA 2VA8A 2HHXA 4DFKA 2Y1JA 3N97B 5F9NA 5KFJA 3EZ5A 3C2MA 1ZQBA 3EYZA 4C8KA 2ASJA 1A76A 4DFJA 3EPIA 2VA3A 4BXOB 4O5EA 4O3NA 4TQRA 4J9LA 3SI8A 3HPOA 3UPQA 4F5RA 4I28A 4YCXA 3C21A 2NRVA 2BQRA 2BPCA 4F4ZA 4UB3A 5CHGA 8ICJA 8ICWA 2FLNA 4RQ2A 3EW9A 5J0QA 2AGPA 2W9AA 3C2KA 3JPOA 2M9NA 2F1HA 3UQ0A 4LZDA 1NKBA 4QZ8A 5IIKA 4JK1A 4B9SA 2ZUDA 2DPJA 2BKEA 4R8UA 3T3FA 2C2DA 1HUZA 4YMNA 4I2FA 1KLNA 3PW7A 2AU0A 9ICSA 9ICRA 2P66A 3RR8A 5KG4A 1ZQUA 4O0IA 4UQGA 5IIMA 4M9LA 3V7JA 4JV1A 1KTQA 2LYHA 3MDAA 4ED0A 1MSWD 1KRPA 4R65A 4F5QA 1ZQCA 5KFKA 1S0NA 2VA2A 4MFAA 4F3OA 1WCLA 2ZUCA 2FPLA 1BVSA 1ZJNA 1X9WA 1SL0A 4I2AA 2HHUA 3UXPA 1ZQYA 4C8NA 3ETLA 4O3OA 2V9WA 4KTQA 3PMLA 1HUOA 2MAXA 3OHBA 3RTVA 2GWSA 4BXOA 1AROP 2BCRA 1RPLA 2PI5A 4YD1A 5HMLA 3MR2A 8ICHA 2PFQA 1X9MA 9ICAA 2KTQA 1N56A 3PX6A 4M04A 3MABA 3TAQA 3C2LA 1RXVA 4F4KA 9ICHA 5KFIA 7ICVA 1B43A 5DKWA 3QE9Y 3BQ0A 4B9LA 4UB5A 4ECTA 8ICSA 2AGOA 1RYRA 3OJSA 1CUKA 5D46A 3ISDA 9ICJA 4F50A 1NK7A 3PO5A 3Q8PB 9ICTA 5HMMA 2Q0ZX 3GV8B 4QZFA 4O9MA 2C22A 2PFPA 7ICEA 9ICOA 4RQ0A 3HP6A 4PGQA 7ICPA 4RUCA 3H8WA 5KT2A 2V4QA 1MQ3A 4ED7A 2XY5A 3Q8QB 3GV5B 4M0AA 4QZDA 3MR6A 4DOBA 3PVXA 1LB2B 3PW4A 1NK9A 2R8IA 1LV5A 1TK5A 2IHMA 2R8JA 3MFIA 5KT7A 5BPCA 3RJGA 9ICLA 3GFKB 4TUSA 5CP2A 4I29A 4YD2A 4YFKA 4MFCA 5CJ7A 7ICLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AUO A;  3AU2 A;  1TKD A;  3ZDE A;  1ZQE A;  4DS5 A;  2UVV A;  4IQW A;  7ICK A;  8ICI A;  4YMO A;  4FS1 A;  4RQ5 A;  1MC8 A;  7ICH A;  3MBY A;  1TV9 A;  4G3I A;  4UB2 A;  4KN4 A;  5KFB A;  1U4B A;  3IM1 A;  2FLL A;  4PPX A;  4J9R A;  4ECX A;  4EZ9 A;  2B21 A;  3RJH A;  4MFF A;  1ZQQ A;  4QW9 A;  4YP3 A;  4DOC A;  9ICM A;  2FPM A;  5KFD A;  3RJJ A;  5KFW A;  4RQ1 A;  1S76 D;  2OWO A;  2BCV A;  4XRH A;  1D8L A;  3JPP A;  8ICL A;  3KHR A;  2W9B B;  2FMS A;  4QWD A;  5DGB A;  4BWJ A;  3RAX A;  2JEI A;  3MDC A;  3EPG A;  3SV4 A;  1QSL A;  4Q8E A;  5HNK A;  3RH4 A;  4DQQ A;  5IIN A;  5C5J A;  2AQ0 A;  3T5K A;  4PHP A;  1X9S A;  4LVS A;  5DG8 A;  1K1S A;  4Z6F A;  2FLP A;  1ZQG A;  3KHH A;  2XO7 A;  4DSI A;  3N4M B;  2ZJ5 A;  4J9Q A;  3ZDC A;  1SZP A;  4RNO A;  4F2R A;  2MUT B;  1D9F A;  8ICV A;  4J9O A;  5KFQ A;  5DB7 A;  1JN3 A;  4K4I A;  4C8L A;  7ICN A;  4RNN A;  5BOM A;  4Q44 A;  3LK9 A;  7ICM A;  4GXJ A;  3RBE A;  2P6R A;  3RRG A;  4I27 A;  2FMP A;  3LDA A;  4P2H A;  3RJF A;  4XA5 A;  8ICG A;  4R64 A;  3RJE A;  2JZB B;  8ICZ A;  1T8E A;  1NK0 A;  2XY7 A;  1U47 A;  8ICM A;  3ZDA A;  2Y1I A;  4P4M A;  4QWC A;  3SV3 A;  1ZQJ A;  3C1Z A;  3PR5 B;  8ICT A;  5DDM A;  4KLU A;  3GIK A;  5CB1 A;  3OHA A;  4PHD A;  4Z6C A;  2P6U A;  4M9N A;  2XY6 A;  4GC6 A;  3PR4 A;  3T5H A;  5KFX A;  4QZA A;  2NRT A;  5DDY A;  4FO6 A;  2W9B A;  3B0X A;  4EYH B;  8ICE A;  4F5N A;  1JXE A;  1V9P A;  5DG9 A;  1PZN A;  3TFS A;  2KZM A;  2KFZ A;  7ICI A;  4F8R A;  4RU9 A;  4PHA A;  4YG2 A;  1Z00 A;  5J0U A;  2MUT A;  2DPI A;  3BQ2 A;  5KFV A;  4I2G A;  5L1I A;  4IQU A;  4F5P A;  1K1Q A;  5EOZ A;  4YQW A;  3PX0 A;  4TUP A;  1ZQF A;  3LWL A;  5KFY A;  4KIT B;  2BQ3 A;  3RR7 A;  7ICO A;  9ICE A;  4FS2 A;  3NGD A;  3KHL A;  3TQ1 A;  2JZB A;  5KT3 A;  5DBA A;  1BPY A;  2J6U A;  3M8S A;  4QZE A;  4O5K A;  2XC9 A;  4J9S A;  5IIJ A;  2R8K A;  1QSS A;  2I1Q A;  3ZD8 A;  4TQS A;  4DL6 A;  5IIO A;  4ECV A;  8ICY A;  4QZI A;  1RZT A;  2UVR A;  1ZQP A;  4B9N A;  1ZQS A;  5CA7 A;  3GV7 B;  3TAN A;  5J2F A;  3RAQ A;  9ICW A;  3PY8 A;  4MEX A;  4DLG A;  5KFF A;  1ZQD A;  4UB1 A;  1NKC A;  5KFC A;  8ICN A;  4O5C A;  1TFR A;  3GIJ A;  1KFD A;  4ECR A;  4DEZ A;  3ZDB A;  4DQP A;  3RJK A;  2J6S A;  4YR3 A;  4JV0 A;  5J2A A;  4F2S A;  5KG0 A;  5KFG A;  5HP4 A;  2IA6 A;  4RNM A;  5DBB A;  3ZD9 A;  4QZB A;  3THV A;  4DLE A;  2C2R A;  4RT3 A;  4QZ9 A;  3QZ7 A;  4PGY A;  1MQ2 A;  4KLT A;  7ICF A;  5KT5 A;  2KN7 A;  5KFP A;  1QSY A;  2IBK A;  1XWL A;  3OGU A;  4DSE A;  3FDS A;  2KZZ A;  4IRC A;  1S77 D;  3TFR A;  2V4R A;  2A1J A;  1KFS A;  1QTM A;  3MGI A;  3PW2 A;  4I2B A;  1UA0 A;  1U45 A;  4KLM A;  2ZJ8 A;  5L1K A;  2BDP A;  3HW8 A;  3H4D A;  1JMS A;  5HHI A;  3K4G A;  5HHH A;  3PX4 A;  4Q43 A;  4QWE A;  5J0X A;  1TK0 A;  5DB6 A;  4YR2 A;  3Q8K A;  5DBC A;  4PH5 A;  1ZQL A;  1U9L A;  4BWM A;  4C8O A;  9ICN A;  9ICP A;  3V6H A;  1KFT A;  3Q8R B;  3G6Y A;  1TK8 A;  2HVH A;  4KLF A;  2VAN A;  1UT8 A;  3G6X A;  2BCQ A;  4GC7 A;  4F4Y A;  3HX0 A;  4DL7 A;  4FBU A;  1ZQH A;  4NM1 A;  4KLQ A;  2FMQ A;  3RH5 A;  2UVW A;  2ASD A;  2NRW A;  1S10 A;  4M9J A;  4DL5 A;  2BR0 A;  4KLJ A;  1NK6 A;  1SKW A;  4O3Q A;  3TI0 A;  4ECS A;  5F9L A;  1H38 A;  3Q8L A;  2XCP A;  1SKR A;  2HHS A;  3UXN A;  3Q8S B;  4KN7 A;  3JPQ A;  3UXO A;  3JPN A;  4MEY A;  4O3S A;  1S0V A;  1T4G A;  3UQ2 A;  2HW3 A;  5KFH A;  5KFO A;  5KT4 A;  1Z00 B;  5DGA A;  3C5F A;  2ZJA A;  4J9N A;  5J0W A;  4M9G A;  1QLN A;  1KEJ A;  3B0Y A;  1KSP A;  4ECQ A;  4UAZ A;  2BHN A;  3OSN A;  5J0Y A;  1ZQZ A;  4O3P A;  4ED6 A;  8ICK A;  7ICS A;  3M9M B;  1ZQI A;  3H8J A;  1IXR A;  4JWM A;  4GXI A;  1TAQ A;  4DSK A;  2F1I A;  4ELU A;  8ICP A;  1B22 A;  5J2G A;  3HWT A;  3H7I A;  1A77 A;  4EYI B;  4B9U A;  4MF8 A;  5D4B A;  4NLG A;  4NLZ A;  8ICA A;  4YXM A;  4UAW A;  3V7K A;  2C2E A;  5KG6 A;  3KTQ A;  1ZQT A;  4DF4 A;  4RQ6 A;  3RB3 A;  4IR9 A;  8ICR A;  4K4G A;  5DLG A;  5KG2 A;  3K75 D;  4Z6E A;  4XUS A;  1S9F A;  4B9V A;  2AQ4 A;  2ZUB A;  3GII A;  9ICU A;  3C23 A;  4QZH A;  5KFR A;  4BGD A;  4TUQ A;  3MFH A;  2RDJ A;  4ED1 A;  3Q8M A;  2HHV A;  3QEB Z;  5JUM A;  1NJZ A;  4RPY A;  5IIL A;  5CWR A;  4UBC A;  4M47 A;  3MGH A;  5DG7 A;  2JEF A;  4EBD A;  4QZC A;  4ED8 A;  4DWI A;  3M9O B;  3QEA Z;  3V7L A;  3RB0 A;  3OJU A;  4YN4 A;  4ELT A;  4JWN A;  5KFZ A;  5J2H A;  3PW5 A;  4KLL A;  3BJY A;  1T7P A;  5L1J A;  2ISO A;  1ZQO A;  2ASL A;  3TAP A;  1ZQK A;  9ICI A;  8ICX A;  5D49 A;  3PMN A;  2HVI A;  1BPB A;  5CR0 A;  2JEG A;  7ICG A;  5J2C A;  5KG5 A;  8ICO A;  5BOL A;  1BPZ A;  4I2D A;  9ICC A;  3LWM A;  4ELV A;  3T5L A;  4YMM A;  1XO1 A;  4R63 A;  4M2Y A;  5EWF A;  4EEY A;  1NK5 A;  5L9X A;  3KHG A;  3H40 A;  4M9H A;  5TZV A;  4RQ7 A;  4J9M A;  3C1Y A;  3RB4 A;  9ICG A;  2XCA A;  4F4W A;  7ICQ A;  3ISB A;  4XQ8 A;  5J2B A;  1S0M A;  1Y88 A;  2A1J B;  4IRD A;  2H5X A;  8ICF A;  2ZTC A;  5KFT A;  5KT6 A;  4Q45 A;  4KMU A;  4ED3 A;  3V6K A;  4DFM A;  4EZ6 A;  3GQC A;  2WTF A;  5DLF A;  4DL3 A;  3IHQ B;  5EWE A;  3MR3 A;  2UVU A;  4YVZ A;  5J0S A;  1KDH A;  4ECU A;  5EWG A;  4DQI A;  4I2E A;  4RT2 A;  4RQ4 A;  3BQT A;  4YXJ A;  4E0D A;  4LZG A;  9ICV A;  4ECW A;  4F4X A;  2BGW A;  4NY8 A;  4KLS A;  3C5G A;  5DQH A;  4GXK A;  1NKE A;  4TUR A;  2HHT A;  3G6V A;  1XSN A;  9ICQ A;  2W9C A;  4I2I A;  1ZJM A;  1L3U A;  1DGS A;  2XGP A;  4IR1 A;  3GDX A;  2AJQ A;  1BGX T;  5J0R A;  4DL4 A;  4DL2 A;  3RB6 A;  9ICX A;  8ICC A;  4MF2 A;  5KFA A;  5DQI A;  3RRH A;  4RUA A;  1S97 A;  1ZQM A;  4M6W A;  3V72 A;  1ZQN A;  2ISP A;  1CEZ A;  1IM4 A;  4ZH4 A;  3V6J A;  4KLE A;  2KFN A;  3QZ8 A;  1U48 A;  9ICF A;  1ZYQ A;  4B9T A;  1UT5 A;  1XSL A;  1ZQR A;  3ORY A;  3FYH A;  3ZDD A;  4DO9 A;  8ICQ A;  3SZ2 A;  2BPF A;  3TAR A;  3T5J A;  1RXW A;  1C7Y A;  3OSP A;  1DOQ A;  2BCS A;  5KFN A;  4NLK A;  4UAY A;  3AU6 A;  2KZ3 A;  8ICU A;  4DSL A;  4P4O A;  3M9N B;  4JV2 A;  1L5U A;  4KLI A;  4C8M A;  3RBD A;  5KFE A;  4F92 B;  2ATL A;  4ED2 A;  2R8H A;  3JPS A;  4ECZ A;  1WCN A;  1SL1 A;  4I2J A;  4RQ3 A;  8ICB A;  1UA1 A;  1D8Y A;  1JIH A;  4NXZ A;  3RJI A;  4EBC A;  1ZQW A;  2BQU A;  4KLO A;  5KG1 A;  2F1J A;  2HHQ A;  4UB4 A;  4CCH A;  2IMW P;  5KG3 A;  2FPK A;  5KFU A;  1L3S A;  5KFS A;  2W8K A;  4IQT A;  9ICB A;  3BDP A;  3PNC A;  5KFL A;  3E2E A;  1S0O A;  4BDP A;  5DB9 A;  5J2E A;  4DSF A;  4RZR A;  3PW0 A;  1NJW A;  4PGX A;  1ZQA A;  4IRK A;  4DS4 A;  1Z3E B;  5III A;  1L3V A;  2ALZ A;  5J29 A;  5DB8 A;  4DFP A;  4KLH A;  1BPX A;  1COO A;  3HT3 A;  3H4B A;  1NJY A;  4EBE A;  2W9M A;  4J9P A;  7ICR A;  9ICK A;  1XS9 D;  4J9K A;  4NM2 A;  4O3R A;  5KG7 A;  4RQ8 A;  3SYZ A;  4I2H A;  2HHW A;  1HJP A;  2I9G A;  5L1L A;  1X2I A;  2ZTE A;  7ICJ A;  2IHN A;  3RH6 A;  2AGQ A;  4DQR A;  1T3N A;  1RYS A;  5J2I A;  1XSP A;  1XC9 A;  4F91 B;  4Z6D A;  1SL2 A;  2BCU A;  7ICT A;  1NJX A;  2NRX A;  2RDI A;  2C28 A;  4NLN A;  5J0P A;  3MR5 A;  4I2C A;  2W8L A;  5KTQ A;  4YR0 A;  7ICU A;  5J0T A;  1NK8 A;  1SKS A;  4RPZ A;  3GIM A;  4GLX A;  5J2K A;  4ECY A;  2JEJ A;  1JX4 A;  4K4H A;  3GIL A;  3BQ1 A;  3H8S A;  2ZTD A;  4QW8 A;  5J2D A;  2NRZ A;  4QWB A;  1U49 A;  4P4P A;  4F5O A;  1BPE A;  4PHE A;  2XGQ A;  3PV8 A;  4X5V A;  1L3T A;  1BPD A;  3M8R A;  2J6T A;  4R8U B;  4QWA A;  4DSJ A;  1ZQX A;  4UBB A;  2PI4 A;  1ZET A;  1TAU A;  2BPG A;  2DFL A;  5KFM A;  1ZQV A;  4DQS A;  4DF8 A;  4QZG A;  1NK4 A;  3JPR A;  4JUZ A;  4DOA A;  2R8G A;  2W9C B;  1TVA A;  4RPX A;  4IQV A;  5J0O A;  4B9M A;  3ISC A;  2PFO A;  4FBT A;  1EXN A;  5J2J A;  2PXI A;  4R66 A;  1N48 A;  2PFN A;  1XU4 A;  4Q8F A;  3EWA A;  4M6W B;  5DQG A;  1NOM A;  3PO4 A;  4KLD A;  4F93 B;  3JPT A;  1D9D A;  3NTU A;  1JXL A;  4HYK A;  4KLG A;  2VA8 A;  2HHX A;  4DFK A;  2Y1J A;  3N97 B;  5F9N A;  5KFJ A;  3EZ5 A;  3C2M A;  1ZQB A;  3EYZ A;  4C8K A;  2ASJ A;  1A76 A;  4DFJ A;  3EPI A;  2VA3 A;  4BXO B;  4O5E A;  4O3N A;  4TQR A;  4J9L A;  3SI8 A;  3HPO A;  3UPQ A;  4F5R A;  4I28 A;  4YCX A;  3C21 A;  2NRV A;  2BQR A;  2BPC A;  4F4Z A;  4UB3 A;  5CHG A;  8ICJ A;  8ICW A;  2FLN A;  4RQ2 A;  3EW9 A;  5J0Q A;  2AGP A;  2W9A A;  3C2K A;  3JPO A;  2M9N A;  2F1H A;  3UQ0 A;  4LZD A;  1NKB A;  4QZ8 A;  5IIK A;  4JK1 A;  4B9S A;  2ZUD A;  2DPJ A;  2BKE A;  4R8U A;  3T3F A;  2C2D A;  1HUZ A;  4YMN A;  4I2F A;  1KLN A;  3PW7 A;  2AU0 A;  9ICS A;  9ICR A;  2P66 A;  3RR8 A;  5KG4 A;  1ZQU A;  4O0I A;  4UQG A;  5IIM A;  4M9L A;  3V7J A;  4JV1 A;  1KTQ A;  2LYH A;  3MDA A;  4ED0 A;  1MSW D;  1KRP A;  4R65 A;  4F5Q A;  1ZQC A;  5KFK A;  1S0N A;  2VA2 A;  4MFA A;  4F3O A;  1WCL A;  2ZUC A;  2FPL A;  1BVS A;  1ZJN A;  1X9W A;  1SL0 A;  4I2A A;  2HHU A;  3UXP A;  1ZQY A;  4C8N A;  3ETL A;  4O3O A;  2V9W A;  4KTQ A;  3PML A;  1HUO A;  2MAX A;  3OHB A;  3RTV A;  2GWS A;  4BXO A;  1ARO P;  2BCR A;  1RPL A;  2PI5 A;  4YD1 A;  5HML A;  3MR2 A;  8ICH A;  2PFQ A;  1X9M A;  9ICA A;  2KTQ A;  1N56 A;  3PX6 A;  4M04 A;  3MAB A;  3TAQ A;  3C2L A;  1RXV A;  4F4K A;  9ICH A;  5KFI A;  7ICV A;  1B43 A;  5DKW A;  3QE9 Y;  3BQ0 A;  4B9L A;  4UB5 A;  4ECT A;  8ICS A;  2AGO A;  1RYR A;  3OJS A;  1CUK A;  5D46 A;  3ISD A;  9ICJ A;  4F50 A;  1NK7 A;  3PO5 A;  3Q8P B;  9ICT A;  5HMM A;  2Q0Z X;  3GV8 B;  4QZF A;  4O9M A;  2C22 A;  2PFP A;  7ICE A;  9ICO A;  4RQ0 A;  3HP6 A;  4PGQ A;  7ICP A;  4RUC A;  3H8W A;  5KT2 A;  2V4Q A;  1MQ3 A;  4ED7 A;  2XY5 A;  3Q8Q B;  3GV5 B;  4M0A A;  4QZD A;  3MR6 A;  4DOB A;  3PVX A;  1LB2 B;  3PW4 A;  1NK9 A;  2R8I A;  1LV5 A;  1TK5 A;  2IHM A;  2R8J A;  3MFI A;  5KT7 A;  5BPC A;  3RJG A;  9ICL A;  3GFK B;  4TUS A;  5CP2 A;  4I29 A;  4YD2 A;  4YFK A;  4MFC A;  5CJ7 A;  7ICL A; 
#chains in the Genus database with same CATH topology
 7ICK A;  4RQ5 A;  3HIL A;  3EUB 2;  3MBY A;  1TV9 A;  4CE6 A;  5KFB A;  2FLL A;  2W54 A;  4EZ9 A;  1ZQQ A;  3ED5 A;  5AIB A;  4QW9 A;  2A19 A;  2ZIV A;  1D8B A;  9ICM A;  1S76 D;  1D8L A;  3JPP A;  8ICL A;  3AM9 A;  4BWJ A;  3SV4 A;  5HNK A;  4DQQ A;  2AQ0 A;  4PHP A;  1K1S A;  1RQN A;  2ZJ5 A;  4F2R A;  1FEZ A;  3CRX A;  3BS5 B;  1D9F A;  2OYY A;  5DB7 A;  1JN3 A;  3WKD A;  4C8L A;  7ICM A;  3LDA A;  3I1Y A;  1Z1V A;  8ICZ A;  2K4H A;  5ALQ A;  2PMZ F;  3WKB A;  3SV3 A;  8ICT A;  1RM6 C;  3PZP A;  2KMD A;  2YN4 A;  4QZA A;  2D3D A;  4F5N A;  5DG9 A;  5ALD A;  5ALZ A;  2WHE A;  5J0U A;  4AYB C;  1URJ A;  2MUT A;  5EOZ A;  4YQW A;  3PX0 A;  4KIT B;  1YZ7 A;  2ESE A;  2J6U A;  2XC9 A;  2EAN A;  4OO1 J;  2R8K A;  1FO4 A;  4DL6 A;  2D8C A;  5IIO A;  3IRU A;  1RZT A;  2UVR A;  5E79 U;  2HDO A;  1L7P A;  4MHV A;  3RAQ A;  3NUQ A;  1NKC A;  3GIJ A;  3ZDB A;  2QB1 A;  2Z7J A;  4DQP A;  2IA6 A;  5KFG A;  4DLE A;  2MRL A;  4QZ9 A;  3SAH A;  1MQ2 A;  2KN7 A;  1WWU A;  1QSY A;  1XWL A;  2YMQ A;  2E3T A;  2DQN B;  2ZJ8 A;  3IDW A;  1FFU A;  2W7O A;  4Q43 A;  5KL1 B;  4YR2 A;  1ZQL A;  3Q8K A;  5DBC A;  4PH5 A;  1U9L A;  9ICP A;  3V6H A;  1TK8 A;  2HVH A;  2W03 A;  4KLF A;  3G6X A;  1UT8 A;  4DL7 A;  4NM1 A;  2HI0 A;  2YB1 A;  2F8L A;  4UAR A;  3RH5 A;  2ASD A;  4O3Q A;  5F9L A;  5AI5 A;  3Q8L A;  3NAS A;  2B0C A;  4KN7 A;  5G5H A;  3JPQ A;  3KZI U;  4MEY A;  3E0F A;  5KFH A;  5DGA A;  1Z00 B;  3C5F A;  2ZJA A;  5J0W A;  1QLN A;  3B0Y A;  4ED6 A;  1UHU A;  3F5A A;  4DSK A;  2F2A B;  1V38 A;  2JMG A;  3H7I A;  1A77 A;  4MF8 A;  4UAW A;  2BDU A;  3KTQ A;  4DF4 A;  4IR9 A;  5AM3 A;  4Z6E A;  9ICU A;  2ZUB A;  4QZH A;  2MA1 A;  3Q8M A;  3ALR A;  4A8E A;  4RPY A;  3IG8 A;  5CWR A;  2Y9T A;  3MGH A;  2K4P A;  2OH2 A;  4ED8 A;  4DWI A;  1LKY A;  5J2H A;  5AM2 A;  3BJY A;  5L1J A;  2NV3 A;  1ZQO A;  2ASL A;  1ZQK A;  2HVI A;  1BPB A;  2WFA A;  2JEG A;  7ICG A;  8ICO A;  4QIW F;  5BOL A;  3E58 A;  4I2D A;  3T5L A;  4YMM A;  1XO1 A;  4M2Y A;  2WF7 A;  1NK5 A;  5L9X A;  4RQ7 A;  3C1Y A;  7ICQ A;  4PJ0 U;  5EE9 A;  5J2B A;  1Y88 A;  2HBM A;  4IRD A;  2ZTC A;  5KT6 A;  1ZRM A;  4ED3 A;  3D6J A;  4BX9 C;  4EZ6 A;  3BZK A;  2WTF A;  2JGA A;  5DLF A;  4DL3 A;  2E8N A;  2YX8 A;  2W43 A;  5J0S A;  3BQT A;  4F4X A;  2BGW A;  4NY8 A;  3C5G A;  5AI4 A;  9ICQ A;  4EX7 A;  1ZJM A;  4DFD A;  3GDX A;  4IR1 A;  3UMC A;  4DL4 A;  2OEH A;  4M6W A;  3V72 A;  5ALI A;  2NO5 A;  3HJE A;  1ZYQ A;  4B9T A;  1X9X A;  3T5J A;  3OSP A;  1DOQ A;  4OJO A;  1DRG A;  4J03 A;  2EAP A;  5AKY A;  2YMP A;  2QAR B;  3I76 A;  2ATL A;  2R8H A;  4ECZ A;  2A1A A;  1WCN A;  1SL1 A;  4RQ3 A;  1UA1 A;  3IG5 A;  1B0X A;  2XIC A;  5KFU A;  1L8L A;  2FI1 A;  4B6J A;  2KOB A;  3ONN A;  1ZOL A;  5DB9 A;  4DSF A;  2QB0 B;  4DS4 A;  1Z3E B;  5III A;  1Z4O A;  1KKX A;  3CP8 A;  3BS7 A;  2DBY A;  4KLH A;  5KL8 B;  3HT3 A;  3H4B A;  1X6I A;  1XS9 D;  4J9K A;  5ALK A;  4RQ8 A;  2ZIX A;  4I2H A;  2HHW A;  5L1L A;  2F76 X;  2VJ4 A;  1RYS A;  1XSP A;  2G09 A;  4Z6D A;  5AKK A;  1NJX A;  2C28 A;  3MR5 A;  2W8L A;  1N5X A;  3L5K A;  2JEJ A;  1JX4 A;  3BQ1 A;  5AM5 A;  2ZTD A;  2NRZ A;  2K4E A;  5AIC A;  4UBB A;  1TAU A;  5KFM A;  1ZQV A;  3JPR A;  2W9C B;  4B9M A;  1PVQ A;  3ISC A;  2PFO A;  4R66 A;  1D9D A;  3NTU A;  2VA8 A;  2Y1J A;  5F9N A;  1ZQB A;  3SMV A;  3EPI A;  4O5E A;  3SI8 A;  3N28 A;  3TAC B;  2ZG6 A;  3C21 A;  3PST A;  2K4I A;  5CHG A;  8ICW A;  5J0Q A;  2E1F A;  3JPO A;  1VJ5 A;  2F1H A;  1NKB A;  4JK1 A;  3T79 A;  1SGG A;  3M7D A;  3BS5 A;  1KLN A;  3RR8 A;  4UQG A;  5IIM A;  2OXO A;  3IP4 B;  4JV1 A;  2LYH A;  2F77 X;  5K4L A;  5ALO A;  1WCL A;  2FPL A;  1ZJN A;  1SB3 C;  4KTQ A;  4C8N A;  3ETL A;  3PML A;  2MAX A;  2BCR A;  3A0H U;  2KTQ A;  1N56 A;  4PL2 A;  3MAB A;  4F4K A;  3QXG A;  5KAI U;  1MN8 A;  5DKW A;  1V97 A;  2AGO A;  1RYR A;  1Z4N A;  1CUK A;  4F50 A;  4FZM A;  4UAU A;  3GV8 B;  2PFP A;  3UMG A;  9ICO A;  2KNJ A;  2V4Q A;  1MQ3 A;  5J8Y C;  2IOF A;  2K8C B;  2XY5 A;  4QZD A;  1LB2 B;  3PW4 A;  1LV5 A;  1RG6 A;  1VDV A;  3RJG A;  2I5H A;  4UAV A;  5AI8 A;  1ZQE A;  3NVV A;  2UVV A;  2HBK A;  2E8P A;  1UCV A;  4FS1 A;  3IV6 A;  7ICH A;  2G0A A;  2CPR A;  5G5G A;  1CRX A;  4G3I A;  2MU2 A;  4QNL A;  4UB2 A;  1U4B A;  3IM1 A;  1DXS A;  2WAQ C;  4MFF A;  5AM0 A;  4JB3 A;  3MGV A;  2FPM A;  5KFW A;  4RQ1 A;  3KBB A;  2FMS A;  2W9B B;  2GO7 A;  3RH4 A;  2OCE A;  3T5K A;  2FLP A;  2E8M A;  5F3X B;  2HCF A;  4DSI A;  4RNO A;  2RP5 A;  1WUD A;  4J9O A;  2ES6 A;  5KFQ A;  1VLB A;  4Q44 A;  3LK9 A;  3S6J A;  3RBE A;  1NZB A;  4XA5 A;  4R64 A;  3RJE A;  2ZXH A;  1U47 A;  1ZQJ A;  3C1Z A;  3PR5 B;  4KLU A;  3GIK A;  3OHA A;  4Y2Y A;  4Z6C A;  5H2F U;  4M9N A;  3PR4 A;  5ALS A;  3T5H A;  4FO6 A;  5DDY A;  4EYH B;  1RYU A;  5AI6 A;  5GTI U;  2K8B B;  2KZM A;  2KK0 A;  4F8R A;  1Z00 A;  5ALF A;  3BQ2 A;  1NZP A;  4PZO A;  4IQU A;  4F5P A;  4TUP A;  1ZQF A;  3LWL A;  3RR7 A;  1X42 A;  2JZB A;  5KT3 A;  5DBA A;  4O5K A;  2JV3 A;  3WK5 A;  1QSS A;  8ICY A;  1PK1 B;  4QZI A;  5T14 A;  3K1R B;  4B9N A;  1ZQS A;  5J2F A;  1K5O A;  4DLG A;  2JH7 A;  5KFF A;  1ZQD A;  3QU4 A;  3ZI4 A;  1O08 A;  1TFR A;  4ECR A;  1KFD A;  4DEZ A;  4YR3 A;  4JV0 A;  5KG0 A;  5DBB A;  3NS1 A;  3ZD9 A;  5CRX A;  2C2R A;  3SEI A;  3IN5 A;  2LI6 A;  5ALH A;  2IBK A;  4DSE A;  4PZN A;  2DF4 B;  3TFR A;  4Y2P A;  1KFS A;  4CF3 A;  1X6J A;  1U45 A;  4KLM A;  2HOQ A;  5L1K A;  2WB1 F;  3HW8 A;  3H8M A;  4KX3 A;  1FFV A;  4OD0 A;  5DB6 A;  4C8O A;  9ICN A;  5ALM A;  4BWM A;  3G6Y A;  2LPE A;  1OW5 A;  2BCQ A;  4KLQ A;  3D2S A;  3D2N A;  4CF5 A;  4M9J A;  4DL5 A;  2KEY A;  4ECS A;  1H38 A;  1N62 A;  2HW3 A;  5KT4 A;  4ECQ A;  4UAZ A;  5J0Y A;  8ICK A;  3H8J A;  4GXI A;  1B22 A;  5J2G A;  4NLG A;  4EYI B;  2YML A;  3AEV A;  1ZRN A;  5KG6 A;  1ZQT A;  3RB3 A;  4B9V A;  1S9F A;  3M6K A;  5J8Y A;  4TUQ A;  4BGD A;  1NJZ A;  4UAS A;  3KKA C;  2HBJ A;  4M47 A;  3QEA Z;  3RB0 A;  3CW2 C;  3OJU A;  4ELT A;  4JWN A;  3PW5 A;  4KLL A;  2LYA A;  2ISO A;  8ICX A;  3PMN A;  5CR0 A;  1DGJ A;  5AKX A;  5A0L A;  2KIV A;  5KG5 A;  1BPZ A;  2HOI A;  5HR7 A;  1XNS A;  4ELV A;  4R63 A;  3WKA A;  5EWF A;  4EEY A;  1QQ5 A;  5TZV A;  3C28 A;  9ICG A;  3ICX A;  4F4W A;  4EEK A;  2WF5 A;  4XQ8 A;  2CRX A;  3QX7 A;  2A1J B;  4DFM A;  4BUG A;  3GQC A;  4C0Z A;  3MR3 A;  4NL9 C;  4YVZ A;  1KDH A;  4RT2 A;  4E0D A;  2F3N A;  4ZOH C;  5DQH A;  4GXK A;  1NKE A;  2HHT A;  2LYB A;  2W9C A;  3DEE A;  2WB1 C;  5KFA A;  2ISP A;  1Z1B A;  3V6J A;  1KQQ A;  9ICF A;  1XSL A;  3ORY A;  2HMX A;  2BPF A;  3TAR A;  1RXW A;  1T94 A;  2BCS A;  2ZXI A;  1ED1 A;  4UAY A;  4CDG A;  5AK6 A;  4DSL A;  4P4O A;  4JV2 A;  1L5U A;  1Q3V A;  4F92 B;  4ED2 A;  3N7R C;  1ECW A;  2KVC A;  1D8Y A;  1JIH A;  2MSN A;  4EBC A;  2BQU A;  2FPK A;  2AHO B;  1L3S A;  1IG6 A;  3H0M B;  4USA A;  3BDP A;  1S0O A;  5J2E A;  1ZQA A;  4IRK A;  5AKG A;  4BJQ A;  5DB8 A;  1COO A;  3K1Z A;  2W9M A;  4J9P A;  7ICR A;  2PMZ C;  3SYZ A;  3L3F X;  2KKP A;  1T3N A;  1XC9 A;  1SL2 A;  5AI9 A;  3QUC A;  2RDI A;  5AK5 A;  4I2C A;  2D6F C;  7ICU A;  2JR5 A;  3R9K A;  5J0T A;  4RPZ A;  5J2K A;  4K4H A;  3GIL A;  2K60 A;  2NYV A;  4OJP A;  2M0N A;  4X5V A;  1SWV A;  4PHE A;  1L3T A;  1BPD A;  4DSJ A;  1UQV A;  2HBL A;  4IS7 A;  1TVA A;  1OXJ A;  1EXN A;  1N48 A;  4O3M A;  4Q8F A;  4KLD A;  2HHX A;  3M6Z A;  3WK4 A;  4DFK A;  4ACO A;  3C2M A;  2LM4 A;  3PSF A;  1WG8 A;  4Y2J A;  2KIC A;  2ASJ A;  4BXO B;  3VCB A;  1N2X A;  4YCX A;  2NRV A;  1MA7 A;  4F4Z A;  8ICJ A;  5AKH A;  2DKZ A;  3EW9 A;  2W9A A;  3U26 A;  3C2K A;  2ODG A;  2BZF A;  4P0P A;  4ICA A;  3UQ0 A;  1RQL A;  2KHV A;  4Y2Q A;  5IIK A;  2YTU A;  2DPJ A;  4R8U A;  4YMN A;  3H0L B;  4I2F A;  4C7Z A;  2QLT A;  2P66 A;  2OHF A;  3AQF A;  4ED0 A;  2W3R A;  1MSW D;  3HKZ F;  1ZQC A;  2VKQ A;  4F3O A;  2ZIU A;  2ZUC A;  3KOO A;  4AP9 A;  1SL0 A;  2IOF K;  1ZQY A;  2V9W A;  3KKA A;  1HUO A;  4Y2S A;  3QUQ A;  2GWS A;  1ARO P;  1RPL A;  2KJ5 A;  5HML A;  2PFQ A;  1X9M A;  4M04 A;  1JRO A;  1QH9 A;  1B4F A;  1N5W A;  5EE0 A;  1SXD A;  7ICV A;  2ZIV B;  3QE9 Y;  3BQ0 A;  2KHQ A;  4UB5 A;  8ICS A;  4CNQ A;  3OJS A;  4Y2U A;  9ICJ A;  1IIP A;  1J2N A;  1KW4 A;  4NJ8 A;  2Q0Z X;  1PVP A;  5JRT A;  1JI7 A;  3PSI A;  3RF9 A;  2C22 A;  4O9M A;  5ALJ A;  1X40 A;  3I28 A;  3MR6 A;  2R8I A;  2IHM A;  2DGZ A;  5AKI A;  5KT7 A;  5BPC A;  5TIS U;  4I29 A;  1A0P A;  2AH5 A;  2YQE A;  4NL9 A;  2KV2 A;  2B6G A;  4MFC A;  3AU2 A;  1TKD A;  3ZDE A;  4DS5 A;  1PK1 A;  4YMO A;  3SEN A;  1MC8 A;  1TE2 A;  4J9R A;  2W7P A;  2B21 A;  3RJH A;  2KP7 A;  2WF6 A;  4YP3 A;  3AN1 A;  5KFD A;  3SQI A;  2OWO A;  2JH1 A;  4XRH A;  2BCV A;  4QWD A;  5DGB A;  2JEI A;  3WK9 A;  3MDC A;  1Z19 A;  4Q8E A;  4WJ3 B;  1X9S A;  1ZQG A;  4QIW C;  3N4M B;  4J9Q A;  2MUT B;  4CGZ A;  5BOM A;  4OJL A;  4GXJ A;  4I27 A;  3RRG A;  2FMP A;  3QU7 A;  4P2H A;  3RJF A;  1AQ6 A;  2XY7 A;  8ICM A;  3ZDA A;  5EE1 A;  4P4M A;  3AMZ A;  1QCK A;  1CI4 A;  1S5L U;  4KX5 A;  4GC6 A;  2XY6 A;  1A6S A;  5KFX A;  3F2B A;  4NWI A;  3B0X A;  3TFS A;  4UB6 U;  3HKZ C;  7ICI A;  3HRD D;  1SV0 C;  5KFV A;  1YZ6 A;  4FE3 A;  5L1I A;  2BQ3 A;  9ICE A;  4FS2 A;  4US9 A;  3NGD A;  3KHL A;  1PUZ A;  1BPY A;  4J9S A;  5IIJ A;  4CF4 A;  2I1Q A;  3ZD8 A;  4TQS A;  2H3F A;  4ECV A;  5CA7 A;  3TAN A;  3PY8 A;  5AHX A;  8ICN A;  2OM6 A;  1DK2 A;  5J2A A;  5HP4 A;  3AL0 B;  3KFU F;  1Q8K A;  4QZB A;  4RT3 A;  4LJX A;  3QZ7 A;  1UPH A;  4PGY A;  7ICF A;  2N1R A;  3PSP A;  2FDR A;  3FDS A;  4IRC A;  4OJ6 A;  2A1J A;  4C4R A;  1BNP A;  3MGI A;  2KE7 A;  2BDP A;  3H4D A;  2Q4T A;  4F72 A;  3K4G A;  3PX4 A;  1TK0 A;  2Y0S F;  4G9B A;  3WKC A;  2YMM A;  3OTQ A;  3RFA A;  3QUB A;  3MC1 A;  2RLT A;  1ZQH A;  4FBU A;  4GFJ A;  2NRW A;  1S10 A;  2BR0 A;  1NK6 A;  1SKW A;  1ZD2 P;  5AKJ A;  3UXO A;  3JPN A;  4C80 A;  4O3S A;  2RRD A;  1S0V A;  1T4G A;  4OJ5 A;  4M9G A;  1KEJ A;  1OUQ A;  2BHN A;  3OSN A;  7ICS A;  4O3P A;  3DV9 A;  3QNM A;  1TAQ A;  4ELU A;  3HWT A;  1QQ6 A;  8ICA A;  4NLZ A;  4YXM A;  4K4G A;  2PKE A;  2W55 A;  3K75 D;  1V85 A;  3GII A;  3C23 A;  5KFR A;  3MFH A;  2EDU A;  2HHV A;  1JAL A;  5JUM A;  2EZX A;  5IIL A;  4UBC A;  3SR6 A;  3M9O B;  3V7L A;  4U6P A;  1ZD4 A;  9ICI A;  3AQE A;  2G08 A;  5J2C A;  2LHT A;  9ICC A;  3LWM A;  2VJ5 A;  3KHG A;  4J9M A;  5ALX A;  2H5X A;  4Q45 A;  2XI9 A;  2JXJ A;  3N7P D;  5EWE A;  2W3S A;  3QU2 A;  4ECU A;  5EWG A;  4I2E A;  9ICV A;  4LZG A;  5AI0 A;  4ECW A;  3LYS A;  4KLS A;  3FM9 A;  2QKQ A;  4DCC A;  4I2I A;  5ALG A;  2A3V A;  2AJQ A;  1XO0 A;  3OPX A;  1S97 A;  3RRH A;  2I6X A;  1KBU A;  1ZQN A;  1CEZ A;  4KLE A;  1Q3U A;  2KFN A;  2Y0S C;  1C20 A;  4IC9 A;  4FZL A;  3ZDD A;  1C7Y A;  1SV4 A;  5AKL A;  5KFN A;  4NLK A;  8ICU A;  4KLI A;  4C8M A;  5KFE A;  1L7N A;  3RJI A;  4KLO A;  1ZQW A;  1KL9 A;  2O6K A;  1SV0 A;  3CYM A;  4UB4 A;  3GU3 A;  5KFS A;  2W8K A;  4IQT A;  1TAM A;  3E2E A;  4BDP A;  2LBO A;  1NI3 A;  4PGX A;  5J29 A;  5C0Y A;  5JTI A;  2DWQ A;  3H0R B;  1M6Y A;  1NJY A;  5KG7 A;  1HJP A;  2YB4 A;  2ZTE A;  7ICJ A;  3F2C A;  5FP0 A;  2QAR A;  2AGQ A;  5ALV A;  1P7D A;  4Y2T A;  7ICT A;  5AKE A;  4F71 A;  5J0P A;  8ICP A;  5KTQ A;  1SKS A;  2JRZ A;  1ZD5 A;  3GIM A;  4GLX A;  4ECY A;  3H8S A;  5J2D A;  1WYG A;  4QWB A;  1U49 A;  2ZIW B;  2PI4 A;  2BPG A;  2QB0 A;  4DF8 A;  5AK4 A;  2KVS A;  2R8G A;  4DOA A;  2E5S A;  3SAG A;  4IQV A;  4FBT A;  2PFN A;  3EWA A;  5ALR A;  5DQG A;  4F93 B;  3N7S C;  3JPT A;  3SD7 A;  4CRX A;  3TAD C;  2E8O A;  2FJ6 A;  3FC4 A;  5KFJ A;  5EE3 A;  1F0M A;  2G06 A;  1Q46 A;  4C8K A;  1F5S A;  4DFJ A;  4O3N A;  2JHD A;  4J9L A;  4F5R A;  1S8O A;  4NLB A;  2BQR A;  4UB3 A;  5JU5 A;  4RQ2 A;  4FFD A;  2AGP A;  4LZD A;  2ZUD A;  3T3F A;  2KSO B;  2XID A;  1HUZ A;  1COK A;  5CEH A;  3PW7 A;  3WKE A;  2EQY A;  5KG4 A;  4O0I A;  4M9L A;  3MDA A;  1HIW A;  4F5Q A;  5KFK A;  1S0N A;  4MFA A;  1BVS A;  3FAH A;  2HHU A;  2K89 A;  3RTV A;  2PI5 A;  4OCZ A;  5ALW A;  3C2L A;  9ICH A;  4JMU A;  5KFI A;  1JUD A;  4ECT A;  3BQ7 A;  4C4S A;  5D46 A;  3ISD A;  1NK7 A;  3NVW A;  4QZF A;  1L6N A;  7ICE A;  3HP6 A;  4RUC A;  5KT2 A;  4ED7 A;  3GV5 B;  3F5E A;  3TKA A;  4M0A A;  4DOB A;  3PVX A;  1NK9 A;  1TK5 A;  3MFI A;  9ICL A;  4TUS A;  1QQ7 A;  5CP2 A;  5B66 U;  3WK6 A;  3ETR A;  7ICL A;  3AUO A;  8ICI A;  1FIQ A;  3UMB A;  4IQW A;  1N63 A;  4NLC A;  4IL6 U;  2XVT A;  2DKX A;  4KN4 A;  2FE9 A;  4ECX A;  4PPX A;  2CN1 A;  2NO4 A;  4DOC A;  2KG5 A;  3RJJ A;  3KHR A;  3RAX A;  3EPG A;  1PK3 A;  1QSL A;  5IIN A;  5C5J A;  4LVS A;  2Y9U A;  5DG8 A;  4Z6F A;  3KHH A;  2XO7 A;  3ZDC A;  1SZP A;  8ICV A;  4K4I A;  7ICN A;  4RNN A;  2P6R A;  5KNI A;  3D2Q A;  8ICG A;  1WWV A;  2JZB B;  1T8E A;  1NK0 A;  2Y1I A;  2E1E A;  2R18 A;  4QWC A;  4P0Q B;  5DDM A;  5CB1 A;  4PHD A;  2P6U A;  4FZN A;  2H3Q A;  2NRT A;  1KN5 A;  2W9B A;  8ICE A;  1JXE A;  1V9P A;  2KFZ A;  1PZN A;  3VC8 A;  4RU9 A;  4PHA A;  4YG2 A;  2W11 A;  3CNH A;  2DPI A;  5AM4 A;  4I2G A;  1J97 A;  5ALL A;  1K1Q A;  4RQN A;  5KFY A;  7ICO A;  1NNL A;  5AK3 A;  3TQ1 A;  2F44 A;  5AIA A;  3M8S A;  4QZE A;  2EH9 A;  3QU5 A;  1ZQP A;  3GV7 B;  9ICW A;  4MEX A;  1BNO A;  2EAM A;  4UB1 A;  5KFC A;  1T3Q A;  4O5C A;  3RJK A;  2J6S A;  2G5I B;  2GOL A;  4F2S A;  2GH1 A;  4RNM A;  3NRZ A;  3THV A;  4QJF B;  3TAD A;  4KLT A;  5KT5 A;  5KFP A;  3OGU A;  2KZZ A;  1S77 D;  2V4R A;  1QTM A;  3PW2 A;  4I2B A;  1UA0 A;  3WU2 U;  1JMS A;  5B5E U;  5HHI A;  5HHH A;  2RQ5 A;  4QWE A;  5J0X A;  1N61 A;  1KFT A;  3Q8R B;  2VAN A;  4GC7 A;  4F4Y A;  4EX6 A;  3HX0 A;  1SZH A;  2FMQ A;  2H3V A;  2UVW A;  4KLJ A;  4UAT A;  3QUT A;  3TI0 A;  5ALU A;  2XCP A;  1SKR A;  2KJ9 A;  2HHS A;  3UXN A;  3Q8S B;  3O0F A;  4Y2V A;  3UQ2 A;  5KFO A;  5L1M A;  1PVR A;  4J9N A;  1KSP A;  2G07 A;  1ZQZ A;  3B9J A;  3M9M B;  1ZQI A;  1IXR A;  4JWM A;  2F1I A;  4B9U A;  5D4B A;  3V7K A;  2C2E A;  4RQ6 A;  8ICR A;  5DLG A;  4XUS A;  2YY6 A;  5KG2 A;  2AQ4 A;  4RQM A;  2RDJ A;  4ED1 A;  3QEB Z;  2WAQ F;  2AXT U;  5DG7 A;  1GO3 F;  2JEF A;  4EBD A;  4QZC A;  2G5H B;  4PL1 A;  4YN4 A;  5KFZ A;  4EEL A;  1T7P A;  4U7C A;  3TAP A;  5D49 A;  5AKZ A;  1ZXI A;  3GZF A;  5AM1 A;  2H3Z A;  3NRW A;  1L7M A;  3H40 A;  4M9H A;  3RB4 A;  2XCA A;  3ISB A;  1S0M A;  8ICF A;  5KFT A;  4KMU A;  3V6K A;  2IOH A;  3IHQ B;  4UW9 A;  2UVU A;  4KMO B;  1ZQ1 C;  4DQI A;  2ZIW A;  4RQ4 A;  4YXJ A;  4NV0 A;  4TUR A;  3KZX A;  3G6V A;  1XSN A;  1L3U A;  1DGS A;  2XGP A;  4C4T A;  1BGX T;  5J0R A;  4DL2 A;  3RB6 A;  4GIB A;  8ICC A;  9ICX A;  4MF2 A;  5DQI A;  4RUA A;  1ZQM A;  2EZZ A;  2EZY A;  1IM4 A;  4ZH4 A;  3QZ8 A;  1U48 A;  4EEN A;  1UT5 A;  1ZQR A;  3FYH A;  4DO9 A;  2VIX A;  8ICQ A;  3SZ2 A;  2RHF A;  1LVH A;  3AU6 A;  2KZ3 A;  2EAO A;  3M9N B;  2KKV A;  2HOF A;  3SAF A;  3RBD A;  1J2M A;  3JPS A;  4I2J A;  8ICB A;  4NXZ A;  2KSO A;  5ALE A;  3A0B U;  2F1J A;  5KG1 A;  4C7Y A;  2HHQ A;  4CCH A;  2IMW P;  1N60 A;  5KG3 A;  2P35 A;  9ICB A;  3PNC A;  5KFL A;  1ZD3 A;  3PW0 A;  4RZR A;  1NJW A;  2HSZ A;  5ALY A;  1L3V A;  1LKY B;  2KJ8 A;  2ALZ A;  1RDF A;  4DFP A;  1BPX A;  1JRP A;  4EBE A;  9ICK A;  4O3R A;  4NM2 A;  2W04 A;  1L8O A;  2I9G A;  5HR6 A;  1X2I A;  2IHN A;  3RH6 A;  4DQR A;  3LVV A;  3NVZ A;  5J2I A;  4F91 B;  2BCU A;  1SWW A;  2NRX A;  4NLN A;  1YT3 A;  3M1Y A;  4YR0 A;  1NK8 A;  4QW8 A;  4P4P A;  4F5O A;  1BPE A;  3PV8 A;  2XGQ A;  4P0P B;  2K8A A;  3M8R A;  2J6T A;  4R8U B;  4QWA A;  1ZQX A;  1X66 A;  3QYP A;  1ZET A;  2DFL A;  4DQS A;  4QZG A;  5ALN A;  1NK4 A;  4JUZ A;  3J81 j;  4RPX A;  3DDH A;  5J0O A;  5J2J A;  2PXI A;  1XU4 A;  3NVY A;  4US8 A;  4M6W B;  1NOM A;  3PO4 A;  3KD3 A;  2ZIU B;  2KD1 A;  4KLG A;  1JXL A;  4HYK A;  2LMR A;  3N97 B;  1L7O A;  3EZ5 A;  3EYZ A;  1A76 A;  4Y2R A;  2F8K A;  2VA3 A;  4TQR A;  3UPQ A;  3HPO A;  4I28 A;  3QU9 A;  4UB8 U;  2BPC A;  3WK7 A;  3WK8 A;  2FLN A;  4Y2X A;  3BZC A;  2WF8 A;  3LVW A;  2M9N A;  3F2D A;  4QZ8 A;  4B9S A;  2BKE A;  2C2D A;  2GLE A;  2AU0 A;  1SXE A;  9ICS A;  9ICR A;  1DK3 A;  1ZQU A;  2LM1 A;  2DL0 A;  5KAF U;  3V7J A;  2LKY A;  1KTQ A;  3UM9 A;  1KRP A;  4R65 A;  2WF9 A;  5GTH U;  4HAI A;  2VA2 A;  1O03 A;  4P0Q A;  4AYB F;  1X9W A;  4I2A A;  3UXP A;  2CXY A;  4O3O A;  3OHB A;  2L5Y A;  4BXO A;  1HEK A;  5ALP A;  4YD1 A;  2ZIX B;  3MR2 A;  8ICH A;  2H3I A;  9ICA A;  2DUY A;  3PX6 A;  1RXV A;  3TAQ A;  1IV8 A;  1B43 A;  4B9L A;  3PO5 A;  3Q8P B;  9ICT A;  5ALT A;  5HMM A;  1F44 A;  3F53 A;  2KIW A;  4RQ0 A;  7ICP A;  4PGQ A;  1SIJ A;  3H8W A;  3Q8Q B;  2R8J A;  3C29 A;  3GFK B;  4YD2 A;  3L4P A;  4YFK A;  5CJ7 A; 
#chains in the Genus database with same CATH homology
 3AUO A;  3AU2 A;  1TKD A;  3ZDE A;  1ZQE A;  4DS5 A;  2UVV A;  4IQW A;  7ICK A;  8ICI A;  4YMO A;  4FS1 A;  4RQ5 A;  1MC8 A;  7ICH A;  3MBY A;  1TV9 A;  4G3I A;  4UB2 A;  4KN4 A;  5KFB A;  1U4B A;  3IM1 A;  2FLL A;  4PPX A;  4J9R A;  4ECX A;  4EZ9 A;  2B21 A;  3RJH A;  4MFF A;  1ZQQ A;  4QW9 A;  4YP3 A;  4DOC A;  9ICM A;  2FPM A;  5KFD A;  3RJJ A;  5KFW A;  4RQ1 A;  1S76 D;  2OWO A;  2BCV A;  4XRH A;  1D8L A;  3JPP A;  8ICL A;  3KHR A;  2W9B B;  2FMS A;  4QWD A;  5DGB A;  4BWJ A;  3RAX A;  2JEI A;  3MDC A;  3EPG A;  3SV4 A;  1QSL A;  4Q8E A;  5HNK A;  3RH4 A;  4DQQ A;  5IIN A;  5C5J A;  2AQ0 A;  3T5K A;  4PHP A;  1X9S A;  4LVS A;  5DG8 A;  1K1S A;  4Z6F A;  2FLP A;  1ZQG A;  3KHH A;  2XO7 A;  4DSI A;  3N4M B;  2ZJ5 A;  4J9Q A;  3ZDC A;  1SZP A;  4RNO A;  4F2R A;  2MUT B;  1D9F A;  8ICV A;  4J9O A;  5KFQ A;  5DB7 A;  1JN3 A;  4K4I A;  4C8L A;  7ICN A;  4RNN A;  5BOM A;  4Q44 A;  3LK9 A;  7ICM A;  4GXJ A;  3RBE A;  2P6R A;  3RRG A;  4I27 A;  2FMP A;  3LDA A;  4P2H A;  3RJF A;  4XA5 A;  8ICG A;  4R64 A;  3RJE A;  2JZB B;  8ICZ A;  1T8E A;  1NK0 A;  2XY7 A;  1U47 A;  8ICM A;  3ZDA A;  2Y1I A;  4P4M A;  4QWC A;  3SV3 A;  1ZQJ A;  3C1Z A;  3PR5 B;  8ICT A;  5DDM A;  4KLU A;  3GIK A;  5CB1 A;  3OHA A;  4PHD A;  4Z6C A;  2P6U A;  4M9N A;  2XY6 A;  4GC6 A;  3PR4 A;  3T5H A;  5KFX A;  4QZA A;  2NRT A;  5DDY A;  4FO6 A;  2W9B A;  3B0X A;  4EYH B;  8ICE A;  4F5N A;  1JXE A;  1V9P A;  5DG9 A;  1PZN A;  3TFS A;  2KZM A;  2KFZ A;  7ICI A;  4F8R A;  4RU9 A;  4PHA A;  4YG2 A;  1Z00 A;  5J0U A;  2MUT A;  2DPI A;  3BQ2 A;  5KFV A;  4I2G A;  5L1I A;  4IQU A;  4F5P A;  1K1Q A;  5EOZ A;  4YQW A;  3PX0 A;  4TUP A;  1ZQF A;  3LWL A;  5KFY A;  4KIT B;  2BQ3 A;  3RR7 A;  7ICO A;  9ICE A;  4FS2 A;  3NGD A;  3KHL A;  3TQ1 A;  2JZB A;  5KT3 A;  5DBA A;  1BPY A;  2J6U A;  3M8S A;  4QZE A;  4O5K A;  2XC9 A;  4J9S A;  5IIJ A;  2R8K A;  1QSS A;  2I1Q A;  3ZD8 A;  4TQS A;  4DL6 A;  5IIO A;  4ECV A;  8ICY A;  4QZI A;  1RZT A;  2UVR A;  1ZQP A;  4B9N A;  1ZQS A;  5CA7 A;  3GV7 B;  3TAN A;  5J2F A;  3RAQ A;  9ICW A;  3PY8 A;  4MEX A;  4DLG A;  5KFF A;  1ZQD A;  4UB1 A;  1NKC A;  5KFC A;  8ICN A;  4O5C A;  1TFR A;  3GIJ A;  1KFD A;  4ECR A;  4DEZ A;  3ZDB A;  4DQP A;  3RJK A;  2J6S A;  4YR3 A;  4JV0 A;  5J2A A;  4F2S A;  5KG0 A;  5KFG A;  5HP4 A;  2IA6 A;  4RNM A;  5DBB A;  3ZD9 A;  4QZB A;  3THV A;  4DLE A;  2C2R A;  4RT3 A;  4QZ9 A;  3QZ7 A;  4PGY A;  1MQ2 A;  4KLT A;  7ICF A;  5KT5 A;  2KN7 A;  5KFP A;  1QSY A;  2IBK A;  1XWL A;  3OGU A;  4DSE A;  3FDS A;  2KZZ A;  4IRC A;  1S77 D;  3TFR A;  2V4R A;  2A1J A;  1KFS A;  1QTM A;  3MGI A;  3PW2 A;  4I2B A;  1UA0 A;  1U45 A;  4KLM A;  2ZJ8 A;  5L1K A;  2BDP A;  3HW8 A;  3H4D A;  1JMS A;  5HHI A;  3K4G A;  5HHH A;  3PX4 A;  4Q43 A;  4QWE A;  5J0X A;  1TK0 A;  5DB6 A;  4YR2 A;  3Q8K A;  5DBC A;  4PH5 A;  1ZQL A;  1U9L A;  4BWM A;  4C8O A;  9ICN A;  9ICP A;  3V6H A;  1KFT A;  3Q8R B;  3G6Y A;  1TK8 A;  2HVH A;  4KLF A;  2VAN A;  1UT8 A;  3G6X A;  2BCQ A;  4GC7 A;  4F4Y A;  3HX0 A;  4DL7 A;  4FBU A;  1ZQH A;  4NM1 A;  4KLQ A;  2FMQ A;  3RH5 A;  2UVW A;  2ASD A;  2NRW A;  1S10 A;  4M9J A;  4DL5 A;  2BR0 A;  4KLJ A;  1NK6 A;  1SKW A;  4O3Q A;  3TI0 A;  4ECS A;  5F9L A;  1H38 A;  3Q8L A;  2XCP A;  1SKR A;  2HHS A;  3UXN A;  3Q8S B;  4KN7 A;  3JPQ A;  3UXO A;  3JPN A;  4MEY A;  4O3S A;  1S0V A;  1T4G A;  3UQ2 A;  2HW3 A;  5KFH A;  5KFO A;  5KT4 A;  1Z00 B;  5DGA A;  3C5F A;  2ZJA A;  4J9N A;  5J0W A;  4M9G A;  1QLN A;  1KEJ A;  3B0Y A;  1KSP A;  4ECQ A;  4UAZ A;  2BHN A;  3OSN A;  5J0Y A;  1ZQZ A;  4O3P A;  4ED6 A;  8ICK A;  7ICS A;  3M9M B;  1ZQI A;  3H8J A;  1IXR A;  4JWM A;  4GXI A;  1TAQ A;  4DSK A;  2F1I A;  4ELU A;  8ICP A;  1B22 A;  5J2G A;  3HWT A;  3H7I A;  1A77 A;  4EYI B;  4B9U A;  4MF8 A;  5D4B A;  4NLG A;  4NLZ A;  8ICA A;  4YXM A;  4UAW A;  3V7K A;  2C2E A;  5KG6 A;  3KTQ A;  1ZQT A;  4DF4 A;  4RQ6 A;  3RB3 A;  4IR9 A;  8ICR A;  4K4G A;  5DLG A;  5KG2 A;  3K75 D;  4Z6E A;  4XUS A;  1S9F A;  4B9V A;  2AQ4 A;  2ZUB A;  3GII A;  9ICU A;  3C23 A;  4QZH A;  5KFR A;  4BGD A;  4TUQ A;  3MFH A;  2RDJ A;  4ED1 A;  3Q8M A;  2HHV A;  3QEB Z;  5JUM A;  1NJZ A;  4RPY A;  5IIL A;  5CWR A;  4UBC A;  4M47 A;  3MGH A;  5DG7 A;  2JEF A;  4EBD A;  4QZC A;  4ED8 A;  4DWI A;  3M9O B;  3QEA Z;  3V7L A;  3RB0 A;  3OJU A;  4YN4 A;  4ELT A;  4JWN A;  5KFZ A;  5J2H A;  3PW5 A;  4KLL A;  3BJY A;  1T7P A;  5L1J A;  2ISO A;  1ZQO A;  2ASL A;  3TAP A;  1ZQK A;  9ICI A;  8ICX A;  5D49 A;  3PMN A;  2HVI A;  1BPB A;  5CR0 A;  2JEG A;  7ICG A;  5J2C A;  5KG5 A;  8ICO A;  5BOL A;  1BPZ A;  4I2D A;  9ICC A;  3LWM A;  4ELV A;  3T5L A;  4YMM A;  1XO1 A;  4R63 A;  4M2Y A;  5EWF A;  4EEY A;  1NK5 A;  5L9X A;  3KHG A;  3H40 A;  4M9H A;  5TZV A;  4RQ7 A;  4J9M A;  3C1Y A;  3RB4 A;  9ICG A;  2XCA A;  4F4W A;  7ICQ A;  3ISB A;  4XQ8 A;  5J2B A;  1S0M A;  1Y88 A;  2A1J B;  4IRD A;  2H5X A;  8ICF A;  2ZTC A;  5KFT A;  5KT6 A;  4Q45 A;  4KMU A;  4ED3 A;  3V6K A;  4DFM A;  4EZ6 A;  3GQC A;  2WTF A;  5DLF A;  4DL3 A;  3IHQ B;  5EWE A;  3MR3 A;  2UVU A;  4YVZ A;  5J0S A;  1KDH A;  4ECU A;  5EWG A;  4DQI A;  4I2E A;  4RT2 A;  4RQ4 A;  3BQT A;  4YXJ A;  4E0D A;  4LZG A;  9ICV A;  4ECW A;  4F4X A;  2BGW A;  4NY8 A;  4KLS A;  3C5G A;  5DQH A;  4GXK A;  1NKE A;  4TUR A;  2HHT A;  3G6V A;  1XSN A;  9ICQ A;  2W9C A;  4I2I A;  1ZJM A;  1L3U A;  1DGS A;  2XGP A;  4IR1 A;  3GDX A;  2AJQ A;  1BGX T;  5J0R A;  4DL4 A;  4DL2 A;  3RB6 A;  9ICX A;  8ICC A;  4MF2 A;  5KFA A;  5DQI A;  3RRH A;  4RUA A;  1S97 A;  1ZQM A;  4M6W A;  3V72 A;  1ZQN A;  2ISP A;  1CEZ A;  1IM4 A;  4ZH4 A;  3V6J A;  4KLE A;  2KFN A;  3QZ8 A;  1U48 A;  9ICF A;  1ZYQ A;  4B9T A;  1UT5 A;  1XSL A;  1ZQR A;  3ORY A;  3FYH A;  3ZDD A;  4DO9 A;  8ICQ A;  3SZ2 A;  2BPF A;  3TAR A;  3T5J A;  1RXW A;  1C7Y A;  3OSP A;  1DOQ A;  2BCS A;  5KFN A;  4NLK A;  4UAY A;  3AU6 A;  2KZ3 A;  8ICU A;  4DSL A;  4P4O A;  3M9N B;  4JV2 A;  1L5U A;  4KLI A;  4C8M A;  3RBD A;  5KFE A;  4F92 B;  2ATL A;  4ED2 A;  2R8H A;  3JPS A;  4ECZ A;  1WCN A;  1SL1 A;  4I2J A;  4RQ3 A;  8ICB A;  1UA1 A;  1D8Y A;  1JIH A;  4NXZ A;  3RJI A;  4EBC A;  1ZQW A;  2BQU A;  4KLO A;  5KG1 A;  2F1J A;  2HHQ A;  4UB4 A;  4CCH A;  2IMW P;  5KG3 A;  2FPK A;  5KFU A;  1L3S A;  5KFS A;  2W8K A;  4IQT A;  9ICB A;  3BDP A;  3PNC A;  5KFL A;  3E2E A;  1S0O A;  4BDP A;  5DB9 A;  5J2E A;  4DSF A;  4RZR A;  3PW0 A;  1NJW A;  4PGX A;  1ZQA A;  4IRK A;  4DS4 A;  1Z3E B;  5III A;  1L3V A;  2ALZ A;  5J29 A;  5DB8 A;  4DFP A;  4KLH A;  1BPX A;  1COO A;  3HT3 A;  3H4B A;  1NJY A;  4EBE A;  2W9M A;  4J9P A;  7ICR A;  9ICK A;  1XS9 D;  4J9K A;  4NM2 A;  4O3R A;  5KG7 A;  4RQ8 A;  3SYZ A;  4I2H A;  2HHW A;  1HJP A;  2I9G A;  5L1L A;  1X2I A;  2ZTE A;  7ICJ A;  2IHN A;  3RH6 A;  2AGQ A;  4DQR A;  1T3N A;  1RYS A;  5J2I A;  1XSP A;  1XC9 A;  4F91 B;  4Z6D A;  1SL2 A;  2BCU A;  7ICT A;  1NJX A;  2NRX A;  2RDI A;  2C28 A;  4NLN A;  5J0P A;  3MR5 A;  4I2C A;  2W8L A;  5KTQ A;  4YR0 A;  7ICU A;  5J0T A;  1NK8 A;  1SKS A;  4RPZ A;  3GIM A;  4GLX A;  5J2K A;  4ECY A;  2JEJ A;  1JX4 A;  4K4H A;  3GIL A;  3BQ1 A;  3H8S A;  2ZTD A;  4QW8 A;  5J2D A;  2NRZ A;  4QWB A;  1U49 A;  4P4P A;  4F5O A;  1BPE A;  4PHE A;  2XGQ A;  3PV8 A;  4X5V A;  1L3T A;  1BPD A;  3M8R A;  2J6T A;  4R8U B;  4QWA A;  4DSJ A;  1ZQX A;  4UBB A;  2PI4 A;  1ZET A;  1TAU A;  2BPG A;  2DFL A;  5KFM A;  1ZQV A;  4DQS A;  4DF8 A;  4QZG A;  1NK4 A;  3JPR A;  4JUZ A;  4DOA A;  2R8G A;  2W9C B;  1TVA A;  4RPX A;  4IQV A;  5J0O A;  4B9M A;  3ISC A;  2PFO A;  4FBT A;  1EXN A;  5J2J A;  2PXI A;  4R66 A;  1N48 A;  2PFN A;  1XU4 A;  4Q8F A;  3EWA A;  4M6W B;  5DQG A;  1NOM A;  3PO4 A;  4KLD A;  4F93 B;  3JPT A;  1D9D A;  3NTU A;  1JXL A;  4HYK A;  4KLG A;  2VA8 A;  2HHX A;  4DFK A;  2Y1J A;  3N97 B;  5F9N A;  5KFJ A;  3EZ5 A;  3C2M A;  1ZQB A;  3EYZ A;  4C8K A;  2ASJ A;  1A76 A;  4DFJ A;  3EPI A;  2VA3 A;  4BXO B;  4O5E A;  4O3N A;  4TQR A;  4J9L A;  3SI8 A;  3HPO A;  3UPQ A;  4F5R A;  4I28 A;  4YCX A;  3C21 A;  2NRV A;  2BQR A;  2BPC A;  4F4Z A;  4UB3 A;  5CHG A;  8ICJ A;  8ICW A;  2FLN A;  4RQ2 A;  3EW9 A;  5J0Q A;  2AGP A;  2W9A A;  3C2K A;  3JPO A;  2M9N A;  2F1H A;  3UQ0 A;  4LZD A;  1NKB A;  4QZ8 A;  5IIK A;  4JK1 A;  4B9S A;  2ZUD A;  2DPJ A;  2BKE A;  4R8U A;  3T3F A;  2C2D A;  1HUZ A;  4YMN A;  4I2F A;  1KLN A;  3PW7 A;  2AU0 A;  9ICS A;  9ICR A;  2P66 A;  3RR8 A;  5KG4 A;  1ZQU A;  4O0I A;  4UQG A;  5IIM A;  4M9L A;  3V7J A;  4JV1 A;  1KTQ A;  2LYH A;  3MDA A;  4ED0 A;  1MSW D;  1KRP A;  4R65 A;  4F5Q A;  1ZQC A;  5KFK A;  1S0N A;  2VA2 A;  4MFA A;  4F3O A;  1WCL A;  2ZUC A;  2FPL A;  1BVS A;  1ZJN A;  1X9W A;  1SL0 A;  4I2A A;  2HHU A;  3UXP A;  1ZQY A;  4C8N A;  3ETL A;  4O3O A;  2V9W A;  4KTQ A;  3PML A;  1HUO A;  2MAX A;  3OHB A;  3RTV A;  2GWS A;  4BXO A;  1ARO P;  2BCR A;  1RPL A;  2PI5 A;  4YD1 A;  5HML A;  3MR2 A;  8ICH A;  2PFQ A;  1X9M A;  9ICA A;  2KTQ A;  1N56 A;  3PX6 A;  4M04 A;  3MAB A;  3TAQ A;  3C2L A;  1RXV A;  4F4K A;  9ICH A;  5KFI A;  7ICV A;  1B43 A;  5DKW A;  3QE9 Y;  3BQ0 A;  4B9L A;  4UB5 A;  4ECT A;  8ICS A;  2AGO A;  1RYR A;  3OJS A;  1CUK A;  5D46 A;  3ISD A;  9ICJ A;  4F50 A;  1NK7 A;  3PO5 A;  3Q8P B;  9ICT A;  5HMM A;  2Q0Z X;  3GV8 B;  4QZF A;  4O9M A;  2C22 A;  2PFP A;  7ICE A;  9ICO A;  4RQ0 A;  3HP6 A;  4PGQ A;  7ICP A;  4RUC A;  3H8W A;  5KT2 A;  2V4Q A;  1MQ3 A;  4ED7 A;  2XY5 A;  3Q8Q B;  3GV5 B;  4M0A A;  4QZD A;  3MR6 A;  4DOB A;  3PVX A;  1LB2 B;  3PW4 A;  1NK9 A;  2R8I A;  1LV5 A;  1TK5 A;  2IHM A;  2R8J A;  3MFI A;  5KT7 A;  5BPC A;  3RJG A;  9ICL A;  3GFK B;  4TUS A;  5CP2 A;  4I29 A;  4YD2 A;  4YFK A;  4MFC A;  5CJ7 A;  7ICL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...