3SR6A

Crystal structure of reduced bovine xanthine oxidase in complex with arsenite
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 37
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3sr6A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sr6A01
1KRHA 1RWSA 1L6VA 3SFDB 1E6EB 1EWYC 2FBWB 4ITKA 3W9CB 3AN1A 1FO4A 5H92C 2HTME 1NYRA 1L5PA 1AWDA 1QOAA 3W5UB 2QJLA 1QOBA 1V97A 4JWSC 4WQMA 1FFVA 1NI3A 3AEBB 3NVYA 2L83A 1NEKB 2PKOA 1DOYA 3VR9B 2DWQA 1WYGA 2L52A 3P63A 2K22A 3AH7A 3DWMA 2K5PA 1KF6B 1TJEA 3HVZA 4IDIA 4ZHOA 2BT6A 2MH7A 1L0VB 5EE0A 1NYQA 1OQRA 1VJKA 3PO0A 3NVWA 2MJEA 3EUB2 4C7ZA 2W3SA 3NS1A 4USAA 1N63A 2Y5CA 3ETRA 3BIID 5EE1A 1QOFA 1SF0A 3LXFA 4ZHPA 4N58A 4YXDB 3AB5A 1XLOA 1N60A 1FXIA 2G1EA 4N59A 3VRBB 5MPOA 2WU2B 1E10A 2EKIA 1ZUD2 3FAHA 1JW9D 1UWMA 1NVID 1RYJA 4LTUA 1J7AA 1ROEA 1FRDA 2CJNA 2WDVB 3AE8B 4A9AA 4KX6B 1PDXA 3AE1B 4YT0B 3NVVA 3AE6B 1YQ3B 3AV8A 3HRDD 4HRSA 3AE5B 1CJEA 2H88B 3ABVB 1NENB 1L6UA 2WDRB 1QOGA 3AEDB 2WLBA 1AYFA 2WU5B 1N61A 1YQ4B 2CJOA 1IUEA 5EE3A 4YTNB 4P6VF 5G5GA 1PUTA 1N62A 3CWIA 2LEKA 1VLBA 3AE4B 4YSXB 3P1MA 4YTPB 1N5XA 2W3RA 1XLQA 1JWAD 5AUKA 3P4SB 2CU3A 2WQYB 5C2TB 2K9XA 1XO3A 1T3QA 1YJJA 5AUIA 1WWTA 3AEEB 4HROA 4YSYB 1WXQA 3AEGB 2Q5WD 3ZYYX 2M56B 1DGJA 4C7YA 1ZOYB 1QT9A 3AE9B 1PFDA 4JWUC 3P4PB 2W54A 3AEAB 4YTMB 2N0SB 3W5VB 1E7PB 3AECB 2BS3B 1JRPA 4YSZB 5C3JB 1FRRA 1OFFA 1VDVA 1TYGB 1V8CA 3AE7B 3CIRB 3P4QB 2MJ3A 3AE3B 1DOXA 3WCQA 2WDQB 4US8A 1GAQB 2B76B 2DBYA 5EE9A 5GXGB 1N5WA 4JX1C 1DOIA 3SFEB 3SR6A 1J7CA 1A70A 1OQQA 2QIEB 3AEFB 4WWMA 1RM6C 1KFYB 3B9JA 2KMMA 1QLBB 5H8YE 3RPFC 3HUIA 2PVOD 3VR8B 3NRZA 3AMZA 1JROA 5G5HA 1FM0D 3B2FA 1FIQA 2M19A 1E0ZA 1TKEA 3AM9A 1ZXIA 4C80A 1WRIA 2H89B 2OHFA 3LB8C 3VRAB 3FC4A 3AE2B 2MJDA 4US9A 3L4PA 3DWGC 2W55A 1R7SA 1TKGA 1TKYA 2JX5A 1J7BA 2ACZB 1FMAD 4FXCA 3P4RB 1WGKA 4N6EB 2AX5A 1QF6A 3NVZA 3KWLA 2BS4B 1XLPA 2BS2B 2JQRB 1FXAA 2WS3B 1GPXA 2PVGC 1JWBD 1ZP0B 2KAJA 1SIJA 1B9RA 1FFUA 4ZOHC 1SB3C 1JQ4A 1E9MA 1I7HA 2E3TA 1JALA 2WP9B 2PIAA 1RFKA 1YJIA 3B2GA 1CZPA 1XLNA 1F0ZA
chains in the Genus database with same CATH superfamily
2EZXA 3PW5A 4CGZA 5ALSA 4F4WA 2JEJA 4B9LA 2OYYA 2QLTA 1V80A 4GN1A 1D3ZA 2R8IA 3H8HA 4ITKA 3X0WA 3NHEB 5IN7A 1SV0A 2VANA 5J0SA 2C2RA 4KGTA 4LZDA 5L1KA 4RU9A 3OJSA 5C0YA 1E90A 5J2AA 3ICXA 2JEGA 5AM1A 4P0PB 2L83A 2WF5A 1K5OA 3QUTA 4DSLA 3QWZB 2BYFA 4NM1A 2HJ1A 3WAOA 2P6UA 3IG3A 1F5SA 5DDYA 1NYQA 2KP7A 2HJ8A 1TBEA 5CX3A 2ZTEA 2ATLA 1N63A 4G3XB 3ZNZB 2HHXA 4KLEA 4CCHA 4JWMA 1SF0A 2K6QA 2N9KA 2YMPA 5AI8A 4DLEA 9ICRA 2I1JA 3GIJA 2FUG1 4RM9A 4B6WA 1UNSA 1JW9D 2KMAA 4QZ8A 1P9DU 4IOIE 2KKVA 1D9DA 1CQVA 5J2GA 1ROEA 4E0DA 2WDVB 1IPGA 4KX6B 1LM8B 3QU7A 4BXOB 1ZQKA 2O6VA 4DHJD 1U49A 4DQQA 1E5WA 4YR3A 1XCTL 2ZPNA 4K1RB 1K53A 4C8LA 2WDRB 2OJRA 4QWDA 1PK1B 3H8MA 3ZUNA 1NDDA 1IUEA 1LO5D 4P6VF 2MAXA 3VHTC 1N2XA 1BPBA 3ZGZA 1ZQAA 1QSYA 5FR6A 5CTRC 3A0HU 4EYHB 2UVUA 4FBTA 1MFWA 4IW0A 4AP4C 2OEDA 2PE6B 1TVAA 4UB6U 1OEYJ 2IOFK 4URKA 4J6IA 4HLEA 3M9MB 4YSYB 4MSMB 3MGHA 3V60A 1YOVB 4DS5A 8ICSA 3MGVA 4U6PA 4RPXA 1V5OA 1WMHB 2KXJA 1XC9A 4CF4A 2LD9A 4DSIA 8ICWA 3VUYA 2Y3AA 3BJYA 1LFDA 3M62B 4DOBA 1WGHA 5J0OA 1VDVA 1E7UA 2YN4A 2LMCA 2FDRA 1D8YA 2MQJA 4HXDA 1GO3F 4II3B 2FPMA 3N9YC 3WCQA 4CF5A 8ICXA 5CHGA 2G4DB 2J6UA 3SFEB 2IOFA 1A5RA 1OQQA 3RB0A 1QLBB 4KVGB 5H8YE 3CNHA 2FPKA 2MRLA 1LKYA 4PGXA 2DFLA 3KHHA 3R8BA 1BPXA 3ALBA 3A9KA 1WRIA 3BINA 4PYUA 2XC9A 3K1RB 2DUYA 3DWGC 4O3OA 2RLTA 3BZCA 2FLLA 1E8XA 1A76A 2Y9UA 5AK5A 4FXCA 5HI1A 4ED6A 2ALZA 3WAMA 1WXMA 3QQ8B 2JWZA 3UQBA 4Y2XA 4ZDVA 2ZIUB 1U45A 5HMMA 2DAFA 4RGTA 1FFUA 1ZD4A 2DQNB 4ICUA 4Q43A 3AU2A 3A4RA 4RQMA 2NTSA 5D94A 2QHOA 1N6ZA 1K1QA 2CU1A 2GO7A 1WX8A 2PPHA 4MDKE 3OPXA 3IDWA 3PNCA 3VAWA 5BPCA 2YEPB 3R2TA 1CI4A 5D4BA 1NK7A 8ICZA 5JHBA 4NY8A 4TQSA 2W9CA 1NEKB 4RQ6A 4NL9C 3JPQA 4PJ0U 4CRXA 1X9SA 9ICJA 4KGSA 1TJEA 3DBRI 4RUAA 1QH9A 2JH7A 3BQ1A 1VR9A 2BT6A 2WXRA 4F5RA 2INDC 8ICQA 4ZYSA 3K75D 4MF2A 1E8WA 2LYAA 3ZD9A 3GQCA 4OZBA 3TANA 1X9XA 2OCEA 5AK6A 3HM6X 4ZHPA 4J03A 2IJ0A 3JPTA 3LDAA 3DBHI 3V62A 3DQVA 2EQYA 5ALXA 4IR9A 3RRGA 3DV9A 2EELA 5FP0A 4YL8A 1ZQWA 1VZ6A 2NRVA 3ENEA 1RQLA 2KZMA 3DEEA 3B1LX 5DB9A 1HZ5A 4IKGA 2ZNVC 1KOTA 5J2IA 2B0CA 4GDLA 1NKEA 1ENFA 3BK2A 2HBMA 3KHGA 1V49A 4I2BA 8ICYA 2LGSA 3QE9Y 4YMMA 3ZRCA 1WGYA 5E79U 3TADA 3ZD8A 3P1MA 4EZJA 4PT5A 1I4RA 1PVQA 4TUQA 5J2HA 5IILA 3MC9A 1I4XA 2BKRB 1YD8U 3M6KA 1BNOA 1YJJA 5L1MA 3IP4B 3GZFA 1WWUA 4K7SA 4KX5A 8ICFA 2DYOA 5AKLA 1NKCA 4C7YA 4MF8A 2C60A 4KX3A 3RZFA 5AKJA 3AEAB 5FK9C 4EOYA 7ICVA 3D2SA 1GC7A 1E7PB 1Z19A 2K0PA 3QX7A 2D8CA 2JZPA 4GGQA 2FLPA 4LNOA 4P4PA 2BPGA 5ALFA 5K4LA 3Q8SB 3CIRB 2KACA 2WDQB 4US8A 2EAOA 1BMLC 2DBYA 5TZVA 4EBEA 1KEJA 2KJ6A 2NBWB 4OJLA 1A6SA 3KZIU 1WY8A 4A8XC 1M94A 2V1YA 4P0QB 1TZOA 4H2AA 4B9MA 1D8LA 2MSNA 1TKDA 2JRIB 3JPRA 3M95A 3UIPB 9ICAA 2MU2A 1TE2A 5AI0A 3N7RC 1ZJMA 2GB1A 2WXOA 2LGYA 4M00A 3WKDA 2KWUB 2JZBA 3H8SA 1TS5A 1SBBB 2L7RA 4PHDA 2K39A 4NLNA 2O2VA 2PMZF 2YLMA 1WGKA 2KTRA 5EDSA 4FBJB 3SAFA 2QEJC 1WCLA 4W9HA 1ZQNA 4B9VA 2WAQC 3L10B 4BOSC 2Y0SC 2NRZA 2XY5A 4O5EA 2KFZA 4M0WB 1TY0A 4FZMA 3VUXA 3V7KA 2NMQA 2KK8A 3ZLZA 1M4VA 3B2GA 1RFKA 5GTIU 1CZPA 4YR2A 1SWWA 4W9KA 5JU5A 1WXAA 2M9NA 1T94A 2KOXA 1BPZA 2AQ3B 2HW3A 3LJ3A 5KT5A 2ESEA 2N9LA 3KTQA 1COOA 4UAUA 1FPYA 4F50A 2WXIA 3BZDB 2K25A 3TEWA 5L95C 2KWCA 1OTRB 3AEBB 4IWQA 2IYDB 8ICRA 4GU2A 1JX4A 5J0RA 7ICPA 1D6EC 1WJUA 1T3NA 1KBUA 4P16A 4WJPA 1OQRA 2C2DA 1P3QU 3CMMB 2BGFA 2JHDA 5CR0A 3HJEA 1IBXB 3BY4B 3ETLA 5E6JA 2GWSA 4KLLA 1LVHA 4XRHA 2MBBB 1S0OA 5J2FA 4R3DA 3M1YA 1ZD5A 5CP2A 3UM9A 2LPEA 4GXJA 3RAXA 5MPOA 3ZI4A 2DNFA 5AM5A 9ICPA 1AN8A 3DBLB 4WAFA 3V72A 3VH3B 2V4QA 3PT2B 5KFVA 2KOBA 3OJUA 3IN5A 3OWEB 4HRSA 4GIVA 3PHWB 1ZPSA 2Z7JA 1C76A 4QIWF 1DOQA 1X2IA 4HDOA 4BWMA 4IQWA 2QCZA 4DOCA 4RZRA 3IHPC 5DG8A 4FS2A 1UD7A 4YD2A 2FE9A 2N7JA 3BQ7A 2R8JA 2YVCA 3VDZA 4IQUA 3U52E 1WCNA 3EZ5A 4ED0A 2PFOA 3L54A 2CU3A 3MFGA 5FKAC 2E6XA 5AUIA 4ELUA 1WWTA 2I6XA 4DSEA 1ZQQA 1F44A 2AL3A 4FFDA 5DDMA 5JH5C 1PFDA 1XS9D 3ZDEA 4DL6A 2V4LA 3MJ5A 5G55A 1JRPA 4GXIA 4JMUA 2WXLA 2KYWA 4AOFA 4F72A 1K50A 2KVRA 5KT7A 3TFRA 4G9BA 2INPE 3C2LA 3PS6A 4ECVA 1JXLA 4TQRA 7ICQA 3PGEA 1L3VA 5AM4A 2LUMA 2QIEB 3OSNA 1C3TA 3KKAA 2KC2A 2A3VA 3U30A 2W43A 2KQ7A 3NRZA 2PXIA 1VCBA 3PV8A 3NJTA 2KG5A 4S17A 3HK0A 1E0ZA 2OHFA 2JRZA 3LDZE 4QZFA 2HHSA 2BDPA 1S77D 2FLNA 3C8YA 4C8KA 3EECA 1PUZA 2D07B 2J4XA 4L2YA 1LGRA 2KX0A 4U7CA 2RDBC 5J0YA 2QB0B 2VA3A 9ICNA 3G6XA 1MVKA 4EZLA 5KHQA 5J29A 2G3QB 3W1SC 4QWBA 3H8WA 3AU4A 4C4TA 2PLPA 2KJ8A 4DQRA 2M1MA 2ZUCA 5AKGA 1UH6A 2MUTB 5AM0A 2KLGA 5AIBA 4QZBA 1CUKA 1AWDA 2LHEA 4QZHA 4DL3A 5J2BA 2BQUA 4J9QA 1P1AA 3NVYA 2MHJA 2PE9A 4HCPB 2QARA 4EENA 3KH0A 2WF7A 2XI9A 1EM7A 4M8NA 3GILA 1NZBA 1K51A 2MH7A 4XDDA 3R7RA 4BBNC 3WKCA 2DF4B 2LRUA 2MJEA 4PHEA 1D5ZC 5J0QA 1GJZA 4USAA 3V6HA 7ICSA 1UBIA 2INNE 4F3OA 5KAIU 3LWLA 3MC0B 2ISPA 5AEKB 3BS7A 4DDID 2G1EA 4F71A 1ZDVA 3A9JB 2WU2B 2J42A 3RBEA 3UPQA 2DPJA 7ICTA 1KKXA 1T7PA 2BYEA 2LXAA 4IC7B 2W11A 2CJNA 3DPDA 5DB6A 2Y9TA 1BVSA 3GIKA 1I4PA 5EOZA 9ICLA 2EZZA 3SHQA 4OJ6A 2RDHA 3SENA 3IAS1 2GOLA 4C4SA 4R66A 2BB5A 4K7UA 2MA9B 1VLBA 4DF8A 3AE4B 3PSIA 2HMXA 9ICUA 3APCA 4HVBA 2Z8LA 2K8HA 2EMTA 3SI8A 1WX7A 4CDGA 1F9JA 3R66C 3GIIA 3TAPA 3AEEB 2E8PA 1WJ6A 2WFAA 2FMPA 1P98A 3ZYYX 2WWZA 4YCXA 3H0MB 4MFFA 4DQIA 4OVUA 2BKFA 5DB7A 1Q46A 1UPHA 2PFNA 3RRHA 1V9PA 2L32A 3JSVA 3Q3MC 2GLSA 4KLQA 3VVWB 1J97A 4DL7A 2KNJA 5ALZA 3BS5A 5KFBA 3PHXB 3DDCB 3GP7A 3KHRA 1SE9A 3SR6A 3PX0A 4NAWB 5AKIA 2VA8A 1ECWA 2M19A 1I4QA 1UGJA 3H7PB 3D2NA 1WYWB 1WM2A 3TEXA 2ZIVB 1ZETA 1ZQTA 4WJ3B 1J7BA 2NR2A 3UI3A 2QDFA 3E0FA 3P4RB 3TMPB 4JK1A 2INCC 8ICGA 2BS4B 4PPXA 3Q8RB 2QILA 3AI5A 2YX8A 3PSTA 2KFJA 1IM4A 1QKZA 1IV8A 1ZQ1C 3SV4A 1JQ4A 1X6IA 4IWOA 2WP9B 5KG3A 3ML8A 4I2DA 3HKZF 3PLVA 2JU6X 4Y2QA 2JZZA 4HKZE 2J6TA 2ZZPB 4E71A 4QWCA 1Z5SB 1FO4A 2HHQA 3NZSA 3QU9A 3QARA 2GOWA 4OZCA 4A55A 3QU5A 1T6BX 1QTMA 2WDTB 4KLTA 1GG3A 2L52A 2YTUA 4IDIA 2G45B 2BPFA 2HHVA 4DWFA 2ZW0A 2EMSA 3K9OB 4ZRKA 2LASA 1TAMA 1WGDA 5J2EA 8ICNA 3NS1A 2BVCA 2LXCA 3N1ZC 1IIPA 4ECRA 2AQ0A 4BVUC 3AB5A 2AQ1B 4PZNA 1RDFA 3ISCA 4N59A 3RJKA 1YX6B 4CYEA 3OLMD 4ECWA 3FAHA 2D3BA 3I9V1 3QUQA 2R61A 3ZKJC 4OO1J 4FADA 4K3BA 2C7NB 1JIHA 3A1QB 2KSOB 3AE1B 4ICVA 2N9PC 4KV2A 3MDAA 5ALYA 2X8XX 2JF5A 3N28A 4Y2RA 4KIKB 5IIOA 1N61A 2LBOA 2IO2B 3ZXRA 3I57A 2N7DA 2C7HA 2HHUA 2RGFA 1MQ2A 5AIAA 2IHNA 4YSXB 5DPRA 3RJGA 1JWAD 1B4FA 1FNUA 5HP4A 5DPSA 1ZQMA 4MT5A 1OXJA 1HIWA 4RQ7A 2KZRA 4C8OA 3FYHA 4J9LA 1ZQVA 5DG7A 4KSKC 2XN9C 1WRDB 1X9WA 1NJZA 2JR5A 1KFDA 2FMSA 1XO0A 2BS3B 4Y2SA 4MHVA 2HOIA 4EUTA 3ZDBA 3N1XC 3OJ3A 1BPDA 4ED7A 4CE6A 1DOXA 5ALQA 2KKPA 4MSQB 1DOIA 3ZIMA 3ZTCA 1V1PA 1I42A 2BW2A 2ZJAA 2ZVNA 4JWNA 2YQEA 5D3IB 4DSKA 3WK9A 2PVOD 4KLDA 1JROA 5BOMA 1U4AA 2Z0EB 1ZQXA 3EC8A 7ICGA 2IOHA 5DGBA 3O65B 5KG1A 5EWGA 3FILA 5CWRA 3NVZA 3WALA 1MG4A 3KFUF 2HOQA 2DX5B 4MM3A 2QKQA 8ICTA 1DYQA 5KFXA 3EPGA 1ZQDA 1FEHA 2JH1A 4F8CB 1F1HA 1Y8RC 1CMXB 4IR1A 4C56C 3HIZA 3KHLA 2PIAA 5FR3A 2F3NA 2EH9A 2W03A 4A8EA 5BO4B 3MC1A 1L2NA 2IGHA 2BCUA 1C78A 3QJZA 2I9GA 3M9NB 4G0NB 4KDIC 3URYA 4ED3A 4DEZA 3OSPA 2WHEA 1QOBA 4FJVB 3TI0A 8ICAA 3M8SA 4M9NA 2D5GA 4EX7A 4JWSC 1L7YA 3TFSA 2V0GA 1V2YA 1TK8A 3VR9B 4IG7B 3P63A 3BDPA 1QSSA 3T5HA 3UIOB 2O6KA 3VFKA 5J0PA 3PX4A 1SSNA 2KDFB 1VJKA 2G4SA 2WB1F 3M9OB 1COKA 3N30A 2RRDA 4O3SA 1N48A 1IGCA 3KYDD 1H38A 5ALJA 2ZEQA 3GV7B 1JRUA 5KFMA 1BT0A 2A5UA 1YN3A 1XLOA 2IY1B 3V05A 4I27A 5KFFA 4HCNB 2JV3A 3LK9A 1ZKHA 2FNJB 5DLGA 1YJ1A 4B0EA 1HUZA 3MTNB 4G3IA 5B66U 1BGXT 4HYKA 3QIJA 3PLUA 3NVVA 3AV8A 1YQ3B 4XZ4A 2IA6A 4DXFA 1NNLA 1I4GA 1DK2A 2BWFA 2FI1A 3ZVVA 4Z6EA 4PGYA 2KFNA 3Q8FA 4EBDA 3U8ZA 2WLBA 1ED1A 2WXHA 3K4GA 5DKWA 2MWSB 1DGSA 3I76A 1PZNA 7ICKA 4ICAA 5ALDA 3EPIA 2WXJA 2JXTA 4M02A 4OVVA 1ZQSA 5KFIA 4UBBA 3TACB 4IM0A 1QSLA 2WXKA 2G06A 2PKEA 5KFGA 4R65A 1L3SA 4NLCA 4RMAA 1Z1VA 2P66A 2LI6A 4M6WB 4MGYE 2M56B 3UF8A 4P1CC 3RF9A 4F2SA 1PGBA 3TAQA 3Q8BA 5ALTA 3P4PB 4JWUC 4HPPA 3W5VB 1SL1A 3TCAA 1GNUA 1Z4OA 3AE7B 4RQ1A 4GFJA 1GAQB 2REXA 4PYZA 2UVWA 4ZYNA 2N9EB 1J7CA 1UZXB 2M0AA 1EU4A 1XXGA 2DZJA 4A3PA 4F4ZA 5C1ZA 2A1AA 3F2DA 5B5EU 4JLCA 2KDEB 2XGPA 5KFWA 4B9TA 2G07A 5EWEA 1TV9A 1UUPA 3VRAB 5CRXA 2A1JA 2R2QA 2W55A 5DGAA 1Z00B 3PVXA 1WM3A 3KWVA 1KQQA 4YQWA 3PZ7A 2BPSA 2IPKD 2LGIA 2XY7A 4DFPA 2LVQA 3BK1A 3GOEA 1TT5B 1R4NB 1M6YA 5ALEA 2D3GA 2YMQA 5ALGA 1SB3C 1I7HA 1JALA 3MHSD 1F0ZA 3LVVA 2LHTA 2XCAA 5LLIA 1ZQBA 4UB5A 1XU4A 3AN1A 2WXNA 3OG5A 4ASWC 5IP4D 1PQSA 4WWOA 4YG2A 3W5UB 8ICLA 1F2RC 2XBBC 3H9DA 1B22A 5HMLA 2HE7A 4XDCA 1EXNA 3D2QA 3MR2A 3MC8A 3PX6A 3DWMA 1P7FA 1ZW7A 2XEWA 3SDLC 4P2HA 4Z6CA 3T9LA 2CN1A 1PVPA 2OEHA 5F3XB 1WZ0A 5AI5A 1QILA 3NS8A 5KG4A 3ECIA 5KFZA 1GOZA 3C19A 1KLGD 4QW9A 2W9BB 3ZQ4A 3EA6A 4LDTD 5J8YA 3N7SC 2D3AA 2VKQA 1EF5A 5L83A 5KL8B 3RFAA 1S5LU 2Q4TA 4Y2UA 4LTUA 3P2BA 4C4VA 3QZ7A 4EFOA 1X66A 5KAFU 5HNKA 4Q45A 1CJEA 2DHZA 4OJPA 1Q10A 1ZE3D 2NBUA 2V4IB 4CHKA 1AYFA 2R2OA 3E56A 3OJ4B 4K4HA 4W9DA 1GB4A 4GDKB 4ACOA 2VZKB 2LEKA 2M8SA 2NPTB 2IGGA 2LFIA 4C8NA 3BVZA 3EGRA 2GBNA 5DQHA 4FA6A 1XLQA 2OXOA 1DK3A 4KLUA 4GB9A 3QA8A 4NJ8A 4QW8A 4RNNA 3GFKB 2K9XA 4RFBA 4WJOA 4ECXA 5HHDG 2F77X 3UXPA 1ZQLA 2VH2A 3AEGB 4AJYB 7ICRA 3WANA 4E74A 2MSED 3ZO5B 3FKYA 4MEMA 4LVSA 3NUHB 1ET6A 3NG0A 3ONNA 4ANXA 4NQLB 2ZIXA 3T3OA 3C1YA 4J3OD 4Y2TA 3U7DA 2LI5A 4CQNA 5D2MB 3H7SA 1KSPA 4JX1C 5CA7A 4NAMA 5IAAC 2PMZC 4FBUA 3K1ZA 1JXEA 1KFYB 1HQRD 9ICBA 4ED2A 2OJWA 3X23A 3VC8A 3UMCA 2ASLA 3U4EG 2LVPA 5HG2A 4BWJA 7ICFA 5CB1A 2BCSA 1TKYA 1C1YB 2JX5A 3I5JC 4PS3A 2NRTA 2NVUI 3B0XA 1S3SG 1TTNA 5AI9A 5KFQA 4DBGA 3FDSA 2QMTA 1NJYA 4JV1A 1AROP 2HBJA 5L1IA 1FXAA 3J9CA 3LYSA 3NZUA 2ZCBA 3VTUA 1SE2A 1UBQA 1YNTE 1ZP0B 4ECUA 2BBCA 4RF0A 4I2GA 2E3TA 2LGDA 3DBLI 3TUOA 1S10A 2MP2A 4P1BC 4AYBF 4QWAA 4TUUA 1N56A 1SXDA 4XQ8A 1SKWA 1MSWD 2LGXA 2FCMA 1UQVA 4O3NA 1FNVA 1EWYC 3PZDA 5KG5A 2PFPA 4R8UB 3Q8MA 1L5PA 2GBMA 4PS8A 1J2NA 4DQOC 1ET9A 3L17A 2UU7A 1FFVA 2KDIA 3D6JA 1I4HA 1DOYA 3PSFA 3ZDCA 8ICIA 4R63A 4LLGM 4OD0A 1RQNA 2R18A 1L0VB 3PSPA 2LYHA 4FZNA 4J9MA 4BUGA 4F5OA 1E8YA 4E3CA 3NZ3A 1PGXA 5J2DA 4GSWA 5JHAA 7ICNA 3ED5A 2FPLA 1KRPA 1TFRA 4QIWC 2Y5BB 2I2YA 3UXOA 3WK8A 2LJIA 2C9WB 5KFSA 1NVID 4MELA 2DZKA 1EU3A 2KC1A 1FRDA 2H3QA 1FCLA 3DBHB 1E7VA 4NNJB 2NO4A 2AGQA 2D3CA 4KKJA 4GOCA 4JB3A 4TQ1A 3RFZB 5DBCA 2WU5B 2ZIWA 4FJYA 3UQAA 1X9MA 1YQ4B 2ZJ5A 4ED1A 2KEYA 5KG7A 2Z0DB 3CWIA 4MJSA 4KTQA 2DENB 4FO6A 2KLCA 3WAPA 3EW9A 1IYFA 5KFEA 3PPAA 1TS2A 1F0MA 4C8MA 4M9JA 3NUQA 2ISOA 3OTQA 1L0YB 3KYCD 4JIOU 4HROA 3GDXA 1WXQA 4CF3A 5DPWA 4JV0A 2Q5WD 2XK5A 1ZD3A 2KANA 1ZD2P 2IZVB 1ZOYB 2F8KA 3S2AA 1TAUA 4OZAA 3RNEC 5AI6A 4GXKA 3HX0A 2KK0A 2KV2A 4HEA1 4W9LA 1V1OA 5DQIA 4UATA 5KFCA 1STEA 2J53A 5ALWA 4B9SA 2ASQA 4UW9A 4IM3A 4RGNA 3AULA 5GXGB 4FHKA 3OAWA 1CEZA 3L13A 3MFHA 2KE7A 5CHVC 1NJWA 4NLGA 2O6VB 1V6EA 4ARIA 1FM0D 9ICMA 3T5LA 9ICEA 2MCNB 2ZUBA 1KLNA 4DS4A 3NRWA 2HD5B 3AE2B 4US9A 3I63C 5DQGA 2KD0A 1UF0A 4HKQA 1G6JA 4QZAA 2QB1A 1KN5A 2R8HA 3RI7C 2JUOA 3JPNA 2GMIC 4LCDE 2ZXHA 2JMGA 4AP9A 5J0XA 2JZ3B 4F5PA 5AZGA 1SV0C 2R8KA 2ASJA 3JW0X 1F52A 2HOFA 2J7QB 2LHDA 3APFA 5ALHA 2N7EA 3T8MA 2VZKD 9ICTA 1VZ7A 3L16A 4JV2A 4EZ6A 2FBWB 4TURA 4HDQA 3SAHA 1PGAA 2HTME 3GZNB 3ZDDA 1NYRA 2K6DB 3BQTA 1AARA 4YXJA 2DKXA 3VUWA 2UYZB 4UB8U 5IA7A 2DZIA 3H0RB 2W8LA 2K8BA 1RYUA 2K22A 2KFKA 2L0TA 5KG6A 4EEYA 4C4RA 4O9MA 1AW7A 4TSSA 2M4NA 2AU0A 1LKYB 3ONSA 3RD2A 1TS3A 3V6EB 1ZGUB 3A9KB 1F77A 2D10A 4LK0M 2KT7A 3TJPA 3BQ2A 2CRXA 3O13A 4QJFB 3PRZA 3RMKC 1OQYA 4YD1A 1FXTB 5GMVA 4A20A 3QHTA 4J9RA 2MW5A 3AE8B 1RPLA 2HVIA 2BF8B 9ICIA 3RN9C 1PDXA 4ZRPA 3MP9A 3RNBC 4BGDA 3DVGX 5CHWA 2C7MB 3CSTA 3ABVB 4I2AA 3Q3FA 4KLFA 1S0NA 4DL4A 4PL2A 1QOGA 5J2CA 9ICWA 3PW2A 1J19A 3OGUA 1Y88A 4TV3A 3SZ2A 5IOIA 1ZQZA 5KFNA 2K8CA 2W9CB 5C2TB 2XICA 1ZRMA 4QAYA 1QQ5A 5KL1B 4R64A 1ZQHA 4J9NA 2FAZA 4FS1A 4D2KA 5C23A 3HVDA 2PFQA 2L3ZA 1J8CA 1L8OA 2WF8A 2YMLA 1YZ7A 5ALUA 4YR0A 1QT9A 2WXFA 2NTTA 2C22A 1SXTA 3RB6A 4O3RA 2W8KA 4JGHB 3IFWB 5KHOA 2BTEA 4YSZB 1JCKB 2KHVA 4BKTA 4J9OA 4UQGA 4PH5A 4B9UA 4HK2A 1N5WA 4P0PA 1D4BA 1V38A 2P35A 4F4YA 1RRBA 4OVZA 1SGGA 3RJJA 4ECZA 8ICUA 2RPQA 2Z59B 3RPFC 3VR8B 2AGOA 4UAWA 4GDLB 3KZXA 3N7PD 2UWQA 3A4SC 4BAXA 1B1ZA 2MJDA 1Q3VA 9ICVA 4AUQC 3RB4A 3HKZC 1TS4A 4IL6U 4LJPB 3ZNHB 3F2BA 3QK0A 4IWPA 2JRHA 4XC2A 2IMWP 4LZGA 2N1WA 4DHZE 5GTHU 1KDHA 3K9PB 3E9SA 3AUOA 1ZQUA 3MFIA 5KFRA 4BXOA 4GXBA 3ZJTA 2OM6A 4JE3B 2CS4A 5F9LA 2IO3B 4EEKA 3EFCA 1KRHA 2GRIA 4ACFA 3H4BA 1MPEA 1PK1A 2KDMA 4DXGA 2VRRB 5ALKA 5KFLA 3W9CB 3C2MA 2ON8A 5H92C 3RT3B 4BOZB 3LYYA 1ZQJA 3HW8A 4UAZA 1ZQGA 9ICQA 2KN5A 4RQ5A 2V3NA 5T8IA 2Y1JA 1SGHA 3VXWA 4I2JA 3ZDTA 5BYSA 5AI4A 4ZRIA 2M17A 5CJ7A 2F8LA 4KLIA 2HHWA 2ZW1A 1LQBA 4ZHOA 3Q8LA 1WMHA 5KFHA 1JWSD 3ORYA 2P6RA 4WQOB 1L6NA 3EUB2 2W04A 4C7ZA 1TY2A 4G11A 1R4MB 5ALNA 2RPVA 3QU4A 2JZBB 4QZEA 1XSPA 3UINB 2O2VB 4N58A 2XGQA 1J2MA 1N60A 3TKAA 2KTRB 1L7OA 4RPYA 2O6VD 1ZOLA 4C00A 1X40A 4NL9A 2DAJA 3TADC 4A9AA 3THVA 2X38A 2VJ5A 3UQ0A 1ACCA 3M8RA 2KMCA 2XNAC 2A4ZA 2KIVA 2ZXIA 1H8CA 1I35A 3V6JA 4EZKA 5A0LA 3JPPA 3U26A 1WGGA 5ALRA 4MH8A 1YN5A 4OCZA 1X42A 4O0IA 2K4IA 4ED8A 2KO3A 3BVGA 4WJQA 3U7ZA 3VQIA 1HZ6A 4KITB 4DL5A 5DB8A 3Q8KA 2ZTDA 5G5GA 3RUIB 4BKSA 3KUDB 3ZXVA 2BHNA 5G2NA 3C29A 3MGIA 4LNNA 4RQ3A 3RAQA 2AEHA 4YXMA 1L4ZB 2ZIUA 2K89A 3QX1A 1SEBD 2K4EA 3AL0B 3SV3A 4RQ8A 2W7PA 4ECTA 3B0AA 5KT6A 2PI5A 4ANVA 4K4IA 2VJ4A 1MC8A 5D3DA 4UB2A 1SXEA 5KT4A 4DL2A 3Q14C 4RF1A 1SL2A 1OFFA 1LV5A 2L5YA 3L5KA 1OGWA 4AWJA 4BFRA 4Y2PA 1V81A 4DWIA 2JPHA 4FE3A 4NJCA 3SEIA 5H2FU 3UMBA 1Q3UA 3TBLD 1BPYA 4DXAB 5G5HA 4NV0A 2WX0A 1Q0WB 4GDKA 5AZHA 2VH1A 1TKEA 1ZXIA 4RQ2A 3PMLA 4TKNA 3LB8C 3TEZA 2PTLA 2WXPA 3V6KA 5JUMA 3PY8A 3Q6BA 4DSFA 1V5TA 3DVNV 2ZPYA 3HHMA 1DRGA 5J2KA 3T3FA 1U9LA 1MQ3A 3KWLA 5D6JB 4B95A 3N4MB 3HT3A 1Y56A 3RB3A 3LWMA 3EHVA 5IKCM 3N97B 2E1FA 2PMVA 3APDA 4W9EA 1Q5WB 1OW5A 1S8OA 2EANA 4GIBA 3KUZA 3IM1A 1NKBA 1XEEA 2KHQA 4LDTB 1MJDA 3BZKA 2NRWA 2JSVX 3RCZA 3GV8B 1RLFA 2UVRA 2MA1A 2WB1C 2ZJDA 3S6JA 1RYRA 2HBKA 1NI2A 4O3QA 1CK1A 4UAVA 4TUSA 3EYZA 3I3TB 4WQMA 3SEBA 5C5JA 4XYCA 2PKOA 4W9CA 1WYGA 2XO7A 3U2SC 4KZ0A 4QZIA 2J52A 3V7LA 5KNIA 2KVZA 1KLUD 1UELA 2AWTA 4IQVA 3GE8C 4IUMB 4W9FA 2CHWA 1LXDA 3DHGC 4M9HA 5BOLA 4O3MA 1XF5L 3KOOA 3QC8B 5KFPA 3PO5A 8ICBA 2KNBA 4KLSA 5J0WA 5L9XA 2KQSA 2KWVB 2CKHB 4NZLB 3DCGA 2CPRA 3Q8QB 1PVRA 2EKIA 1WIAA 2ZVOA 1F2RI 3PZPA 1RYSA 4DLGA 2EDUA 5IO9A 1U4BA 4NPNA 4I2EA 8ICEA 4P0QA 4NLKA 5J17A 3QUBA 2SAKA 2KTQA 3Q3NC 1TIFA 4BDPA 1S0VA 2BGWA 4ECYA 1WJNA 2LZ6A 4ANUA 3TL5A 2Y5PA 2K60A 2ZTCA 3A33B 5L1JA 4RGMA 3WIMA 7ICEA 3A0BU 3N32A 3PO4A 3V61A 2KIWA 4F2RA 5AKHA 4P4OA 1HJPA 3R9KA 2QARB 4DO9A 4M0WA 1HTOA 1T0RC 2DZMA 3F53A 8ICKA 1R4NI 2HDEA 3KKAC 2LRWA 3HPOA 5DPTA 2KJ5A 3AECB 4OHJA 3VTVA 1NK8A 3RULA 1L7PA 5CEHA 1EO6A 4KMUA 1KJTA 5J2JA 1RXVA 1ZQPA 3FM9A 2B3AA 5DG9A 1WGRA 5TR5A 2V9WA 2PJHA 3Q2AC 1S97A 3PSEB 5AM2A 2G5IB 4I6NB 1QQRA 1KH0A 4ZRJA 3IG5A 4ARCA 4WWPA 4Z6DA 1ZQYA 1T0SC 3HUIA 2JVCA 3GS2A 3MR5A 2VA2A 5ALLA 1BNPA 2ZUDA 5J0TA 3MR6A 1V9JA 1ZQEA 2H3IA 2AXTU 4LJOB 1MHXA 4QZGA 1MN8A 3FC4A 1IBXA 2BCVA 3H0LB 3SMVA 4RT3A 2Y1IA 2RR9A 2WGSA 4QZ9A 3PV1A 1YQBA 2BCQA 4G50A 1BPEA 2JGAA 2BS2B 3JVZX 3TQ1A 5HHHA 3TEYA 8ICOA 2PW9A 2G09A 4DCCA 4Y2YA 1E9MA 3C1ZA 4KLOA 5JZEB 1YJIA 4YMOA 1RWSA 3NTUA 2ODGA 2WXQA 3I28A 3RH4A 1SE4A 4RH6A 5BYRA 1E6EB 3JSVB 1L8LA 5JTIA 4EEWA 1KL9A 2EZYA 4B0MA 3BS5B 2YB4A 9ICOA 3KBBA 4IC9A 4QNLA 5ALMA 4ECQA 2LWPA 3H6NA 2AQ2B 2I1QA 3ZNID 3W1SA 1NOMA 3L3FX 4AS1A 2F2AB 5KFDA 1S1QB 5KT3A 3AU5A 3HVZA 3QEAZ 8ICVA 5BYQA 4NWIA 4P4MA 1B43A 4XA5A 2RDIA 3E58A 3WA0A 3MDCA 3EWAA 4RQ4A 1KFTA 1QOFA 3OHAA 3LXFA 1QZEA 4IRDA 3PTFC 4P7IA 1K1SA 4B9KA 1FXIA 2JXXA 1NK0A 1FEZA 1ZUD2 3WU2U 1WXVA 4OJ5A 2EAMA 1C79A 1WUDA 3QYPA 3C5FA 5HR6A 3HRDD 4GLSC 1XQQA 3RNGC 3MABA 2ONQA 7ICMA 2FUHB 4FJZA 2JYEA 2V3PA 2CJOA 4L23A 5EE3A 4YTNB 3C23A 4M47A 1ZXHA 3RNFC 3IBEA 4YTPB 3M6ZA 4KDLB 3B0YA 4YVZA 5AUKA 2FCQA 2H3ZA 3AU6A 2I1KA 2QB0A 1WG8A 4DF4A 4NM2A 3NY5A 4CNQA 1MHHE 4HPMB 1FNWA 4WWNA 2MUTA 2D11A 2KTFA 2ZNVB 4HPLB 1VRAB 1ZQOA 2D2QA 2N1VA 4MH0E 3AE3B 2BPCA 3O0FA 5EE9A 2BQ3A 1QQ6A 5D49A 3VH4B 2KZ3A 2XCPA 3M63B 3WK7A 4HAIA 1X6JA 3HWTA 1NBFC 3ZW3A 5CHFA 1OUQA 1XD3B 4DSJA 4F93B 3W1YA 3ZJUA 2BQQA 1YX5B 5D46A 3WK5A 2JEFA 3AM9A 4UB4A 4XE0A 4HJGE 2JYTA 2L00B 4NLBA 1TKGA 2M0XA 2IO1B 3GB1A 1UT8A 4M0AA 2J0KA 1WZ3A 3RTVA 4AYBC 1FMAD 1ZJNA 1RXWA 2AX5A 3A9JA 2HCFA 2JT4B 8ICMA 2CXYA 2WS3B 5EWFA 3MHZA 1D9FA 2KZZA 3F5AA 4Z6FA 1MI0A 5ALVA 1XWLA 1HEKA 1T0YA 4YN4A 2KICA 4X5VA 2J0MA 5DLFA 1RZTA 3GU3A 3SFDB 3H1UA 5J2RA 4I2CA 2MBQA 4RNAA 5BMGA 5KFKA 4GC6A 2ES6A 2AL6A 5LXHA 1EUVB 1WR1A 1Z4NA 2BR0A 2MX2A 4JL9A 4UDUC 1MG8A 1QOAA 4BX9C 3JPSA 3PR5B 4QZDA 1NI3A 4WJNA 1V1PB 2KJ9A 2RDJA 4YWGG 4FN2A 2K5PA 2G0AA 3WK4A 4LNIA 2LJ5A 3PO0A 9ICCA 3G6YA 1HE8A 4O1NA 2Y5CA 3TIXA 1S9FA 1WE7A 4AJWA 1Q1OA 3CW2C 3NOBA 3MJWA 4X57B 3AQEA 2BCRA 2BYTA 3RJIA 1VD2A 3FILB 3VRBB 3MBYA 4MFAA 1U48A 3PRPB 4MM3B 5KFOA 2K4PA 3V3XA 1UWMA 1J0GA 1SJED 1J7AA 4NAWA 7ICJA 2EAPA 2AGPA 2RP5A 4II2B 5J0UA 2ZCCA 1WE6A 2K4HA 2KVSA 4KLHA 3R7QA 4RPZA 1QLNA 4F5NA 1NENB 2B21A 2E8MA 3H7PA 3RYTA 3QEBZ 1XNSA 2NYVA 1S0MA 3C5GA 1WI0A 2ZIVA 5TISU 1V85A 3KLSX 5IIKA 2IHMA 3BYYB 3WKEA 3W2DA 1N5XA 2XVTA 3KQ4A 4M8MA 3R2IA 4XGAB 4A6QA 3DBRB 1VZ8A 2WQYB 4W9IA 3TARA 3RH5A 4EYIB 2NS5A 2PEAA 5AKYA 2RD0A 5TSSA 4DK5A 1RAXA 2J0JA 2GBRA 1DGJA 2E8NA 3DOWA 3AXCA 4KMOB 2OWOA 3AE9B 4NXZA 5D7GA 2W54A 1MA7A 5AICA 2N0SB 4B9NA 4PK1A 4F4XA 1YN4A 1SL0A 2FMQA 4I28A 2YEPF 4CO7A 3IV6A 3P4QB 1TYGB 2W9AA 1LB2B 4WIPA 2V3SA 2B76B 2XY6A 2LYBA 1E8ZA 3GZNI 1L7MA 3CYMA 3LVWA 3T79A 1O03A 3RR7A 2JEIA 1TK0A 3UMGA 4OJOA 4I2IA 1P0RA 4RM8A 5HR7A 1FIQA 3RJFA 4QWEA 1JMSA 3F2CA 4PS7A 2FJ6A 2L1AA 3DVGY 4EE2A 4I2FA 1R7SA 5LXIB 2KWDA 7ICIA 2ZG6A 2NRXA 4IQTA 3QUCA 1C4PA 3QZ8A 2BYVE 4IRKA 1GPXA 4GC7A 3A1QA 2PVGC 2KSOA 2BDUA 2KAJA 1B9RA 2KHWB 1IP9A 5JRTA 3RJHA 1GB1A 5AZFA 3L08A 1SZPA 1FD6A 1IXRA 3C21A 1ZDXA 3T5JA 2EKEC 2MBEA 3DVNU 1C20A 3OHBA 3IXSA 4KIKA 3RZWC 2CHZA 1D5MC 4UB3A 3UQ2A 1D8BA 2WAQF 4PHPA 4A3OA 2Y0SF 2AYOB 2GLEA 1L0XB 1UHUA 3ZDMC 1JMLA 1TZ1A 4F91B 3Q8PB 4DFKA 1GC6A 2HTHA 4MACA 2QJLA 1V97A 4KSLC 4JUZA 4BKSD 4NJ7A 3VCBA 2WXMA 1QCKA 4O3PA 3BYTB 4YMNA 2H3FA 2AH5A 3RNCC 7ICOA 3G6VA 3H7IA 1L3TA 3B08A 4DQSA 4DFMA 5IIMA 3ZDAA 2LM1A 1FCCC 1L7NA 4UB1A 4HWIB 3BIID 2A1JB 3DDHA 2CHXA 2QSDA 2FIFA 3C2KA 3SQIA 9ICFA 2LVOA 5AK4A 1D5XC 1CRXA 2Q0ZX 3SYZA 4WAAA 1WSPA 1C9FA 1WX9A 1SIFA 2PI4A 2CR5A 5KG0A 2E1EA 4TQ0A 3AE6B 2BQRA 4F8RA 4W9JA 4DHZB 1NK5A 3Q8EA 2W82A 3EFUA 4GMVA 1L6UA 4N9F4 3N3KB 2NBVB 3HM3A 3D32A 1SWVA 8ICCA 4WURA 1ZQRA 3DBSA 1ZRNA 1K8RB 4M9GA 4MGIE 2BZFA 3RH6A 2MRPA 3H8JA 2AQ4A 3ZJVA 3C0RB 1KW4A 2GH1A 4F7ZA 5KTQA 4XX5A 2JWUA 4Q8EA 3ZTDA 5BMHA 1XO1A 3Q3OC 1HUOA 3CSFA 4FHJA 3T3NA 4YTMB 3ALRA 3H4DA 1SKSA 1Q8KA 4JQWC 4J9SA 4JPSA 3UGBB 4C0ZA 2W9NA 3P42A 1XT9B 2ASDA 1H4RA 4IRCA 2KD1A 1UT5A 4PZOA 1V8CA 4NY0A 2MJ3A 2GI9A 2BKEA 5AKKA 2KVCA 4ELVA 3Q8AA 2RMMA 2HBLA 3ISDA 3KW5B 3GE3C 2G9HD 2IGDA 3AQFA 2N9XA 4C4VB 5J18A 5ALOA 3NGDA 1HA5A 4EZ9A 2XIDA 1IG6A 1HEZE 4S0RA 1L4DB 3TSSA 3AMZA 4F4KA 3IRUA 3SD5A 4XWTA 3QNMA 2IDYA 3IT4B 5KG2A 4LNKA 2HSZA 2GBJA 1KFSA 9ICHA 5E6NA 1HXYD 3QXGA 2ACZB 4N6EB 1QF6A 1R4MI 2W7OA 4KKIA 4J9KA 1ZQIA 3DHIC 3WKAA 1ISNA 1Z2MA 1XLPA 2RDGA 4UASA 3GV5B 1JWBD 2DYMA 3AEVA 2V4RA 3PMNA 1TGZB 4PL1A 5DCNA 3GIMA 2LM4A 1XLNA 4I2HA 5DBBA 2UVVA 2W9MA 2F1IA 1YZ6A 5KT2A 3QAQA 1S76D 4RGOS 2HHTA 2QC8A 2ZIXB 2KMDA 2FCSA 1ZQCA 2VIXA 4TMAB 4Q2JA 2LMRA 3Q8CA 3VTWA 4ANWA 3NASA 2LUEA 5J8YC 2F76X 3BQ0A 2AHOB 3RJEA 1V86A 2C5LC 3RR8A 3L0WB 1GUAB 4YP3A 1KF6B 1BXTA 4M6WA 1B0XA 2RQ5A 1AQ6A 1NZPA 3NVWA 2FE8A 1UWXA 2W3SA 1U47A 3ETRA 2ICIA 5T14A 5AM3A 3PREA 1NK6A 1WH3A 1BUIC 1P7DA 4IM2A 4DQPA 4O5KA 5KFTA 4EKUA 3E2EA 5AKEA 1RYJA 4BBNF 3HP6A 4YT0B 2BWES 4WH4A 2NCNA 3SU8X 4KLGA 1UGMA 4KLJA 3PW7A 5E6PA 4AQ7A 2MP2B 4UARA 4MEYA 1C4CA 2WXGA 4NLZA 1NK9A 1YIWA 2WF6A 4KLMA 1WXSA 3IAM1 3PZ8A 3PW4A 1PUTA 1N62A 3T5KA 1Z00A 1EF1A 1WJ4A 8ICJA 4I29A 3KVFB 2E8OA 2SEBD 1JI7A 1XO3A 1T3QA 4M01A 2AJQA 5HHIA 2WNMA 1ESFA 4I6LB 2F44A 4RQNA 2I5HA 5AHXA 3UXNA 1OEYA 5AKZA 2WTFA 2KKCA 3CF6E 2MBOA 4FLHA 4M04A 1PK3A 1WWVA 4O5CA 4RT2A 1EWCA 1IGDA 5IINA 4RUCA 2KDBA 1C4AA 4PHAA 2BB6A 2WYQA 2LKYA 3JPOA 1KTQA 2R8GA 3Q3JA 1WFYA 2KJRA 9ICSA 4RNOA 4MEXA 3MR3A 4NJ6A 2C2EA 2G08A 4NQKE 1HTQA 4WWMA 7ICUA 1RM6C 3V6CB 3B9JA 2KMMA 4KZCA 2C28A 3N20C 2FCNA 1KLVA 1JN3A 2H3VA 3SAGA 7ICLA 1K52A 2IY0B 1XSNA 4C80A 2H89B 2DKZA 2ZIWB 1ZYQA 2WX1A 4LNFA 4DHJB 2YMMA 1X1MA 2W9BA 1T4GA 4MJSB 7ICHA 4DFDA 3N1YC 5KFJA 4DFJA 3QU2A 2D3DA 2DPIA 2FIDA 2G5HB 4BJQA 4KN4A 1Z1BA 2NV3A 2V9HA 3M3JA 4F1SA 3DHHC 4BZAA 1SIJA 3PR4A 4I6PA 1KTKA 2XK5B 1SV4A 1L5UA 1KM7A 3H40A 2JXJA 4K7WA 3PVLA 1L6VA 1T8EA 2MBHA 2KJHB 3IVFA 1YT3A 4TUPA 2MEKA 4KGRA 3QCAA 3ZRFA 2KN7A 1SE3A 2WHIA 1A0PA 1SZHA 1JWUD 4RNMA 4KN7A 3V7JA 2IO0B 2L8JA 2NPTA 4J9PA 3SD7A 1XCQL 3IT6B 2YY6A 3C28A 4MGKE 4F92B 1Z3EB 8ICHA 2RHFA 5HKHA 3RNAC 2DWQA 1O08A 2DYBA 3AH7A 4FULA 2WF9A 4LJXA 5EE0A 2K3UA 2N1RA 3I1YA 3CRXA 4L1BA 3WKBA 4ZH4A 4A90A 5EE1A 5BMIA 2L76A 3PW0A 4YXDB 3WK6A 2NO5A 1JWMD 1E10A 5IIIA 9ICKA 4HJKA 4MFCA 4YFKA 2IBIB 4M2YA 5AK3A 4B6JA 4XUSA 5HFYA 4K4GA 2OOBB 4EBCA 4ECSA 5KFUA 3IHQB 1L3UA 3AE5B 1DXSA 5ALPA 1C7YA 2H88B 1WF9A 2L05A 3ISBA 2HVHA 1RG6A 4Y2VA 5JXVA 3AEDB 9ICXA 5E6OA 4FZLA 3M7DA 5DBAA 4K81A 5KFYA 3HILA 3KD3A 2J6SA 1NK4A 2KQ4X 4OW0A 4ELTA 4QZCA 1PYWD 4RCOA 1VJ5A 5LNK1 1TK5A 4Q8FA 1T5XD 3Q69A 4F5QA 2W3RA 4Y2JA 2HDOA 2F1HA 3P4SB 4DDGD 5ALIA 1UCVA 1A77A 2K8BB 4PGQA 9ICGA 2KFKB 2ZJ8A 3IG8A 2IBKA 4K3CA 2I38A 4UBCA 1UA0A 1T0QC 5F9NA 2TSSA 2K1FA 4RQ0A 5IIJA 4DOAA 1C77A 1P7EA 2M0NA 5AKXA 2MLBA 1URJA 2B6GA 3F5EA 1UA1A 3J81j 2HI0A 2F1JA 4EELA 1ZQFA 3R3MA 4R8UA 1FRRA 2KN4A 5C3JB 4UAYA 3RBDA 4IS7A 5I4DA 4MGZE 1QQ7A 5KFAA 3ZNGC 1JUDA 4GLXA 1A70A 4BKGA 3AEFB 2D6FC 2L0FA 2DL0A 1NJXA 3B2FA 3BVMA 2E5SA 1RFAA 4EX6A 4Q44A 4W9GA 1TAQA 1YMHE 2OH2A 3L4PA 4ZRQA 5L1LA 3JYUA 4XWWA 2H5XA 2DGZA 3PRMB 8ICPA 2DLBA 2YB1A 2K8AA 3BWUD 2JY6A 2K8CB 3KUCB 2JQRB 3ML9A 2N4FA 1SJHD 2KX3A 2A19A 4M9LA 4REZA 1WR6E 2RSUA 4ZOHC 1SKRA 3CP8A 2GBKA 1XSLA
chains in the Genus database with same CATH topology
2JU6X 3SFDB 4HKZE 4RNAA 5BMGA 2FBWB 3H8HA 4ITKA 1PGAA 1FO4A 2HTME 4UDUC 1NYRA 4KGTA 1QOAA 4OZCA 4A55A 1NI3A 1T6BX 2L83A 1V1PB 2L52A 2K22A 4YWGG 2K5PA 4TSSA 1AW7A 4IDIA 2ZW0A 1NYQA 3PO0A 1TS3A 4O1NA 1F77A 4LK0M 3NS1A 1N63A 2Y5CA 1SF0A 3O13A 2N9KA 2BYTA 3AB5A 2AQ1B 4N59A 3FILB 2FUG1 3VRBB 1UNSA 3FAHA 1JW9D 4MM3B 3I9V1 2R61A 4IOIE 1UWMA 3V3XA 1CQVA 1J7AA 1ROEA 1SJED 2WDVB 3AE8B 4KX6B 1PDXA 3AE1B 4ZRPA 3MP9A 1XCTL 3ABVB 1K53A 1NENB 2WDRB 1QOGA 1N61A 1IUEA 1LO5D 4P6VF 3I57A 3KLSX 4YSXB 3BYYB 3ZGZA 3W2DA 1N5XA 3KQ4A 1JWAD 1FNUA 3R2IA 4A6QA 2OEDA 1VZ8A 2WQYB 4MT5A 5C2TB 4YSYB 4D2KA 5TSSA 3HVDA 2XN9C 1DGJA 1QT9A 2WXFA 3AE9B 2NTTA 5D7GA 2W54A 2N0SB 1SXTA 2Y3AA 2BS3B 1YN4A 2YEPF 2BTEA 4YSZB 3P4QB 1VDVA 1JCKB 1TYGB 2LMCA 1DOXA 4WIPA 3WCQA 2B76B 3N9YC 1N5WA 1D4BA 1DOIA 3SFEB 1V1PA 1OQQA 2BW2A 4OVZA 5D3IB 1QLBB 5H8YE 3RPFC 2PVOD 3VR8B 1JROA 3R8BA 4GDLB 1FIQA 1WRIA 1B1ZA 4EE2A 2L1AA 2MJDA 3DWGC 1R7SA 1TS4A 2KWDA 5HI1A 4FXCA 3FILA 3NVZA 1C4PA 1GPXA 1DYQA 3E9SA 1FEHA 2PVGC 2KAJA 1B9RA 4RGTA 1FFUA 3ZJTA 4C56C 1GB1A 4JE3B 2PIAA 5FR3A 1FD6A 2NTSA 1KRHA 1ZDXA 2GRIA 3IXSA 1MPEA 2KDMA 4DXGA 2IGHA 1D5MC 3W9CB 2ON8A 5H92C 1C78A 1L0XB 3URYA 3LYYA 1JMLA 2V3NA 2YEPB 4MACA 3R2TA 5T8IA 2QJLA 1QOBA 1V97A 2D5GA 4JWSC 5BYSA 1NEKB 2V0GA 2WXMA 3VR9B 3BYTB 3P63A 2ZW1A 4KGSA 1TJEA 4ZHOA 1VR9A 2BT6A 1SSNA 2WXRA 4ZYSA 1VJKA 1JWSD 1FCCC 3EUB2 4C7ZA 1IGCA 4OZBA 1TY2A 2RPVA 3BIID 4ZHPA 2IJ0A 2QSDA 4N58A 3V05A 1YN3A 1XLOA 1N60A 1D5XC 4B0EA 2EELA 1VZ6A 1WSPA 4A9AA 1C9FA 2X38A 1ACCA 3NVVA 3AE6B 1HZ5A 1YQ3B 2XNAC 3AV8A 4IKGA 4TQ0A 4DXFA 3Q8EA 2W82A 1I4GA 1L6UA 4MH8A 3Q8FA 1YN5A 1ENFA 3BK2A 3VQIA 3U7ZA 2WLBA 3BVGA 2WXHA 1HZ6A 5G5GA 4WURA 2WXJA 3P1MA 2JXTA 4PT5A 1I4RA 2WXKA 1I4XA 1L4ZB 1SEBD 3ZJVA 1YJJA 2JWUA 2DYOA 5BMHA 2M56B 4C7YA 1PGBA 3Q8BA 3P4PB 3AEAB 4JWUC 5FK9C 4YTMB 3T3NA 3W5VB 4JPSA 1E7PB 5D3DA 2K0PA 3P42A 2JZPA 4RF1A 1OFFA 3CIRB 1V8CA 2KACA 3AE7B 2MJ3A 2GI9A 2WDQB 4US8A 1BMLC 1GAQB 2DBYA 3Q8AA 2RMMA 4NJCA 2G9HD 2IGDA 1J7CA 2M0AA 1EU4A 1HA5A 1XXGA 4A8XC 1TZOA 1HEZE 1L4DB 4H2AA 3TSSA 3AMZA 5G5HA 1TKEA 1ZXIA 4XWTA 2GB1A 2WXOA 3LB8C 3TEZA 1UUPA 3VRAB 2PTLA 2WXPA 2IDYA 3IT4B 1TS5A 2W55A 1SBBB 1HXYD 2ACZB 3KWVA 3PZ7A 4N6EB 1WGKA 1QF6A 2QEJC 4KKIA 2IPKD 2LGIA 3KWLA 3BK1A 1XLPA 2RDGA 1Y56A 1JWBD 1TY0A 2PMVA 2DYMA 2NMQA 1SB3C 1I7HA 1M4VA 1JALA 3B2GA 1RFKA 1CZPA 1XLNA 1F0ZA 1XEEA 4RGOS 2JSVX 3AN1A 2AQ3B 2WXNA 4TMAB 3W5UB 1CK1A 2N9LA 3BZDB 4Q2JA 1F2RC 2WXIA 3Q8CA 4WQMA 3SEBA 3TEWA 3AEBB 4XDCA 2PKOA 1WYGA 3U2SC 3DWMA 1P7FA 1KF6B 2J52A 1BXTA 1D6EC 1KLUD 4P16A 1OQRA 1QILA 3NVWA 2FE8A 1UWXA 2W3SA 1IBXB 3ETRA 1XF5L 2ICIA 5E6JA 1GOZA 1KLGD 3ZQ4A 3EA6A 4R3DA 5MPOA 1BUIC 4NZLB 2EKIA 1F2RI 1AN8A 1RYJA 4LTUA 4WAFA 4YT0B 4HRSA 3OWEB 4WH4A 1ZPSA 1CJEA 1C76A 2SAKA 4AQ7A 1Q10A 1ZE3D 2V4IB 1C4CA 2WXGA 1AYFA 3E56A 2Y5PA 3IAM1 3PZ8A 4RGMA 1PUTA 4GDKB 1GB4A 1N62A 2VZKB 2LEKA 2N7JA 2IGGA 2LFIA 3BVZA 3EGRA 3U52E 1XLQA 2CU3A 3MFGA 5FKAC 2E6XA 2K9XA 2SEBD 1XO3A 4RFBA 1T3QA 4M0WA 5AUIA 1WWTA 2WNMA 1ESFA 5HHDG 3AEGB 2HDEA 3NUHB 1ET6A 1PFDA 1EWCA 1IGDA 3AECB 4OHJA 3MJ5A 1C4AA 1JRPA 2BB6A 3T3OA 4J3OD 2WXLA 4CQNA 1K50A 4JX1C 2INPE 1QQRA 1KH0A 4WWMA 2LUMA 2QIEB 4ARCA 1RM6C 1KFYB 1HQRD 3B9JA 2KMMA 3HUIA 3NRZA 3GS2A 3U4EG 1K52A 1E0ZA 2OHFA 4C80A 2H89B 5HG2A 1MHXA 3FC4A 1IBXA 1TKYA 2JX5A 3C8YA 2QMTA 2J4XA 4L2YA 2BS2B 1FXAA 3J9CA 3TEYA 1MVKA 1SE2A 2PW9A 1ZP0B 1YNTE 1SIJA 1KTKA 2BBCA 4RF0A 1E9MA 2E3TA 1YJIA 3TUOA 2PLPA 1RWSA 1L6VA 2WXQA 1SE4A 4KGRA 2MEKA 1FNVA 1E6EB 1EWYC 4RH6A 5BYRA 1SE3A 1JWUD 1L5PA 1AWDA 2LHEA 4B0MA 4DQOC 1ET9A 1XCQL 3IT6B 1FFVA 2AQ2B 3NVYA 1I4HA 3W1SA 1DOYA 4AS1A 2DWQA 3AH7A 3HVZA 4LLGM 1EM7A 5BYQA 1K51A 4XDDA 2MH7A 1L0VB 5EE0A 2K3UA 2MJEA 4L1BA 1D5ZC 4USAA 3NZ3A 1PGXA 4A90A 5EE1A 5BMIA 2INNE 1QOFA 3LXFA 3MC0B 2I2YA 4YXDB 1FXIA 2G1EA 1JWMD 1ZDVA 1E10A 2WU2B 1ZUD2 2J42A 2LJIA 1NVID 1EU3A 5HFYA 1C79A 1FRDA 2CJNA 1FCLA 3HRDD 4GLSC 3AE5B 1I4PA 2ONQA 2H88B 2RDHA 2JYEA 3AEDB 3IAS1 4KKJA 4TQ1A 5JXVA 3RFZB 2V3PA 2WU5B 1YQ4B 2CJOA 2KQ4X 4L23A 5EE3A 4OW0A 4YTNB 1PYWD 2BB5A 4RCOA 1ZXHA 3CWIA 5LNK1 1T5XD 1VLBA 3Q69A 3AE4B 4YTPB 2W3RA 1TS2A 2Z8LA 5AUKA 3P4SB 1L0YB 3AEEB 4HROA 1WXQA 2I38A 1MHHE 2Q5WD 2TSSA 3ZYYX 1FNWA 1C77A 1ZOYB 1P7EA 4OZAA 2L32A 5C3JB 1VRAB 4HEA1 2KN4A 1FRRA 1V1OA 1STEA 2J53A 3AE3B 4RGNA 5I4DA 5EE9A 5GXGB 3GP7A 4NAWB 3SR6A 1A70A 3AEFB 3ZJUA 4ARIA 1FM0D 3B2FA 3BVMA 2M19A 3AM9A 1I4QA 4XE0A 4HJGE 1UGJA 2JYTA 1YMHE 3AE2B 4HKQA 4US9A 3L4PA 4ZRQA 1TKGA 3TEXA 4XWWA 3GB1A 1J7BA 3UI3A 4NAMA 1FMAD 3P4RB 2DLBA 2AX5A 3BWUD 2BS4B 2QILA 2JQRB 2WS3B 3MHZA 1SJHD 2LHDA 4REZA 1QKZA 1MI0A 4ZOHC 1JQ4A 2WP9B 2VZKD 1VZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRH A;  1RWS A;  1L6V A;  3SFD B;  1E6E B;  1EWY C;  2FBW B;  4ITK A;  3W9C B;  3AN1 A;  1FO4 A;  5H92 C;  2HTM E;  1NYR A;  1L5P A;  1AWD A;  1QOA A;  3W5U B;  2QJL A;  1QOB A;  1V97 A;  4JWS C;  4WQM A;  1FFV A;  1NI3 A;  3AEB B;  3NVY A;  2L83 A;  1NEK B;  2PKO A;  1DOY A;  3VR9 B;  2DWQ A;  1WYG A;  2L52 A;  3P63 A;  2K22 A;  3AH7 A;  3DWM A;  2K5P A;  1KF6 B;  1TJE A;  3HVZ A;  4IDI A;  4ZHO A;  2BT6 A;  2MH7 A;  1L0V B;  5EE0 A;  1NYQ A;  1OQR A;  1VJK A;  3PO0 A;  3NVW A;  2MJE A;  3EUB 2;  4C7Z A;  2W3S A;  3NS1 A;  4USA A;  1N63 A;  2Y5C A;  3ETR A;  3BII D;  5EE1 A;  1QOF A;  1SF0 A;  3LXF A;  4ZHP A;  4N58 A;  4YXD B;  3AB5 A;  1XLO A;  1N60 A;  1FXI A;  2G1E A;  4N59 A;  3VRB B;  5MPO A;  2WU2 B;  1E10 A;  2EKI A;  1ZUD 2;  3FAH A;  1JW9 D;  1UWM A;  1NVI D;  1RYJ A;  4LTU A;  1J7A A;  1ROE A;  1FRD A;  2CJN A;  2WDV B;  3AE8 B;  4A9A A;  4KX6 B;  1PDX A;  3AE1 B;  4YT0 B;  3NVV A;  3AE6 B;  1YQ3 B;  3AV8 A;  3HRD D;  4HRS A;  3AE5 B;  1CJE A;  2H88 B;  3ABV B;  1NEN B;  1L6U A;  2WDR B;  1QOG A;  3AED B;  2WLB A;  1AYF A;  2WU5 B;  1N61 A;  1YQ4 B;  2CJO A;  1IUE A;  5EE3 A;  4YTN B;  4P6V F;  5G5G A;  1PUT A;  1N62 A;  3CWI A;  2LEK A;  1VLB A;  3AE4 B;  4YSX B;  3P1M A;  4YTP B;  1N5X A;  2W3R A;  1XLQ A;  1JWA D;  5AUK A;  3P4S B;  2CU3 A;  2WQY B;  5C2T B;  2K9X A;  1XO3 A;  1T3Q A;  1YJJ A;  5AUI A;  1WWT A;  3AEE B;  4HRO A;  4YSY B;  1WXQ A;  3AEG B;  2Q5W D;  3ZYY X;  2M56 B;  1DGJ A;  4C7Y A;  1ZOY B;  1QT9 A;  3AE9 B;  1PFD A;  4JWU C;  3P4P B;  2W54 A;  3AEA B;  4YTM B;  2N0S B;  3W5V B;  1E7P B;  3AEC B;  2BS3 B;  1JRP A;  4YSZ B;  5C3J B;  1FRR A;  1OFF A;  1VDV A;  1TYG B;  1V8C A;  3AE7 B;  3CIR B;  3P4Q B;  2MJ3 A;  3AE3 B;  1DOX A;  3WCQ A;  2WDQ B;  4US8 A;  1GAQ B;  2B76 B;  2DBY A;  5EE9 A;  5GXG B;  1N5W A;  4JX1 C;  1DOI A;  3SFE B;  3SR6 A;  1J7C A;  1A70 A;  1OQQ A;  2QIE B;  3AEF B;  4WWM A;  1RM6 C;  1KFY B;  3B9J A;  2KMM A;  1QLB B;  5H8Y E;  3RPF C;  3HUI A;  2PVO D;  3VR8 B;  3NRZ A;  3AMZ A;  1JRO A;  5G5H A;  1FM0 D;  3B2F A;  1FIQ A;  2M19 A;  1E0Z A;  1TKE A;  3AM9 A;  1ZXI A;  4C80 A;  1WRI A;  2H89 B;  2OHF A;  3LB8 C;  3VRA B;  3FC4 A;  3AE2 B;  2MJD A;  4US9 A;  3L4P A;  3DWG C;  2W55 A;  1R7S A;  1TKG A;  1TKY A;  2JX5 A;  1J7B A;  2ACZ B;  1FMA D;  4FXC A;  3P4R B;  1WGK A;  4N6E B;  2AX5 A;  1QF6 A;  3NVZ A;  3KWL A;  2BS4 B;  1XLP A;  2BS2 B;  2JQR B;  1FXA A;  2WS3 B;  1GPX A;  2PVG C;  1JWB D;  1ZP0 B;  2KAJ A;  1SIJ A;  1B9R A;  1FFU A;  4ZOH C;  1SB3 C;  1JQ4 A;  1E9M A;  1I7H A;  2E3T A;  1JAL A;  2WP9 B;  2PIA A;  1RFK A;  1YJI A;  3B2G A;  1CZP A;  1XLN A;  1F0Z A; 
#chains in the Genus database with same CATH topology
 2EZX A;  3PW5 A;  4CGZ A;  5ALS A;  4F4W A;  2JEJ A;  4B9L A;  2OYY A;  2QLT A;  1V80 A;  4GN1 A;  1D3Z A;  2R8I A;  3H8H A;  4ITK A;  3X0W A;  3NHE B;  5IN7 A;  1SV0 A;  2VAN A;  5J0S A;  2C2R A;  4KGT A;  4LZD A;  5L1K A;  4RU9 A;  3OJS A;  5C0Y A;  1E90 A;  5J2A A;  3ICX A;  2JEG A;  5AM1 A;  4P0P B;  2L83 A;  2WF5 A;  1K5O A;  3QUT A;  4DSL A;  3QWZ B;  2BYF A;  4NM1 A;  2HJ1 A;  3WAO A;  2P6U A;  3IG3 A;  1F5S A;  5DDY A;  1NYQ A;  2KP7 A;  2HJ8 A;  1TBE A;  5CX3 A;  2ZTE A;  2ATL A;  1N63 A;  4G3X B;  3ZNZ B;  2HHX A;  4KLE A;  4CCH A;  4JWM A;  1SF0 A;  2K6Q A;  2N9K A;  2YMP A;  5AI8 A;  4DLE A;  9ICR A;  2I1J A;  3GIJ A;  2FUG 1;  4RM9 A;  4B6W A;  1UNS A;  1JW9 D;  2KMA A;  4QZ8 A;  1P9D U;  4IOI E;  2KKV A;  1D9D A;  1CQV A;  5J2G A;  1ROE A;  4E0D A;  2WDV B;  1IPG A;  4KX6 B;  1LM8 B;  3QU7 A;  4BXO B;  1ZQK A;  2O6V A;  4DHJ D;  1U49 A;  4DQQ A;  1E5W A;  4YR3 A;  1XCT L;  2ZPN A;  4K1R B;  1K53 A;  4C8L A;  2WDR B;  2OJR A;  4QWD A;  1PK1 B;  3H8M A;  3ZUN A;  1NDD A;  1IUE A;  1LO5 D;  4P6V F;  2MAX A;  3VHT C;  1N2X A;  1BPB A;  3ZGZ A;  1ZQA A;  1QSY A;  5FR6 A;  5CTR C;  3A0H U;  4EYH B;  2UVU A;  4FBT A;  1MFW A;  4IW0 A;  4AP4 C;  2OED A;  2PE6 B;  1TVA A;  4UB6 U;  1OEY J;  2IOF K;  4URK A;  4J6I A;  4HLE A;  3M9M B;  4YSY B;  4MSM B;  3MGH A;  3V60 A;  1YOV B;  4DS5 A;  8ICS A;  3MGV A;  4U6P A;  4RPX A;  1V5O A;  1WMH B;  2KXJ A;  1XC9 A;  4CF4 A;  2LD9 A;  4DSI A;  8ICW A;  3VUY A;  2Y3A A;  3BJY A;  1LFD A;  3M62 B;  4DOB A;  1WGH A;  5J0O A;  1VDV A;  1E7U A;  2YN4 A;  2LMC A;  2FDR A;  1D8Y A;  2MQJ A;  4HXD A;  1GO3 F;  4II3 B;  2FPM A;  3N9Y C;  3WCQ A;  4CF5 A;  8ICX A;  5CHG A;  2G4D B;  2J6U A;  3SFE B;  2IOF A;  1A5R A;  1OQQ A;  3RB0 A;  1QLB B;  4KVG B;  5H8Y E;  3CNH A;  2FPK A;  2MRL A;  1LKY A;  4PGX A;  2DFL A;  3KHH A;  3R8B A;  1BPX A;  3ALB A;  3A9K A;  1WRI A;  3BIN A;  4PYU A;  2XC9 A;  3K1R B;  2DUY A;  3DWG C;  4O3O A;  2RLT A;  3BZC A;  2FLL A;  1E8X A;  1A76 A;  2Y9U A;  5AK5 A;  4FXC A;  5HI1 A;  4ED6 A;  2ALZ A;  3WAM A;  1WXM A;  3QQ8 B;  2JWZ A;  3UQB A;  4Y2X A;  4ZDV A;  2ZIU B;  1U45 A;  5HMM A;  2DAF A;  4RGT A;  1FFU A;  1ZD4 A;  2DQN B;  4ICU A;  4Q43 A;  3AU2 A;  3A4R A;  4RQM A;  2NTS A;  5D94 A;  2QHO A;  1N6Z A;  1K1Q A;  2CU1 A;  2GO7 A;  1WX8 A;  2PPH A;  4MDK E;  3OPX A;  3IDW A;  3PNC A;  3VAW A;  5BPC A;  2YEP B;  3R2T A;  1CI4 A;  5D4B A;  1NK7 A;  8ICZ A;  5JHB A;  4NY8 A;  4TQS A;  2W9C A;  1NEK B;  4RQ6 A;  4NL9 C;  3JPQ A;  4PJ0 U;  4CRX A;  1X9S A;  9ICJ A;  4KGS A;  1TJE A;  3DBR I;  4RUA A;  1QH9 A;  2JH7 A;  3BQ1 A;  1VR9 A;  2BT6 A;  2WXR A;  4F5R A;  2IND C;  8ICQ A;  4ZYS A;  3K75 D;  4MF2 A;  1E8W A;  2LYA A;  3ZD9 A;  3GQC A;  4OZB A;  3TAN A;  1X9X A;  2OCE A;  5AK6 A;  3HM6 X;  4ZHP A;  4J03 A;  2IJ0 A;  3JPT A;  3LDA A;  3DBH I;  3V62 A;  3DQV A;  2EQY A;  5ALX A;  4IR9 A;  3RRG A;  3DV9 A;  2EEL A;  5FP0 A;  4YL8 A;  1ZQW A;  1VZ6 A;  2NRV A;  3ENE A;  1RQL A;  2KZM A;  3DEE A;  3B1L X;  5DB9 A;  1HZ5 A;  4IKG A;  2ZNV C;  1KOT A;  5J2I A;  2B0C A;  4GDL A;  1NKE A;  1ENF A;  3BK2 A;  2HBM A;  3KHG A;  1V49 A;  4I2B A;  8ICY A;  2LGS A;  3QE9 Y;  4YMM A;  3ZRC A;  1WGY A;  5E79 U;  3TAD A;  3ZD8 A;  3P1M A;  4EZJ A;  4PT5 A;  1I4R A;  1PVQ A;  4TUQ A;  5J2H A;  5IIL A;  3MC9 A;  1I4X A;  2BKR B;  1YD8 U;  3M6K A;  1BNO A;  1YJJ A;  5L1M A;  3IP4 B;  3GZF A;  1WWU A;  4K7S A;  4KX5 A;  8ICF A;  2DYO A;  5AKL A;  1NKC A;  4C7Y A;  4MF8 A;  2C60 A;  4KX3 A;  3RZF A;  5AKJ A;  3AEA B;  5FK9 C;  4EOY A;  7ICV A;  3D2S A;  1GC7 A;  1E7P B;  1Z19 A;  2K0P A;  3QX7 A;  2D8C A;  2JZP A;  4GGQ A;  2FLP A;  4LNO A;  4P4P A;  2BPG A;  5ALF A;  5K4L A;  3Q8S B;  3CIR B;  2KAC A;  2WDQ B;  4US8 A;  2EAO A;  1BML C;  2DBY A;  5TZV A;  4EBE A;  1KEJ A;  2KJ6 A;  2NBW B;  4OJL A;  1A6S A;  3KZI U;  1WY8 A;  4A8X C;  1M94 A;  2V1Y A;  4P0Q B;  1TZO A;  4H2A A;  4B9M A;  1D8L A;  2MSN A;  1TKD A;  2JRI B;  3JPR A;  3M95 A;  3UIP B;  9ICA A;  2MU2 A;  1TE2 A;  5AI0 A;  3N7R C;  1ZJM A;  2GB1 A;  2WXO A;  2LGY A;  4M00 A;  3WKD A;  2KWU B;  2JZB A;  3H8S A;  1TS5 A;  1SBB B;  2L7R A;  4PHD A;  2K39 A;  4NLN A;  2O2V A;  2PMZ F;  2YLM A;  1WGK A;  2KTR A;  5EDS A;  4FBJ B;  3SAF A;  2QEJ C;  1WCL A;  4W9H A;  1ZQN A;  4B9V A;  2WAQ C;  3L10 B;  4BOS C;  2Y0S C;  2NRZ A;  2XY5 A;  4O5E A;  2KFZ A;  4M0W B;  1TY0 A;  4FZM A;  3VUX A;  3V7K A;  2NMQ A;  2KK8 A;  3ZLZ A;  1M4V A;  3B2G A;  1RFK A;  5GTI U;  1CZP A;  4YR2 A;  1SWW A;  4W9K A;  5JU5 A;  1WXA A;  2M9N A;  1T94 A;  2KOX A;  1BPZ A;  2AQ3 B;  2HW3 A;  3LJ3 A;  5KT5 A;  2ESE A;  2N9L A;  3KTQ A;  1COO A;  4UAU A;  1FPY A;  4F50 A;  2WXI A;  3BZD B;  2K25 A;  3TEW A;  5L95 C;  2KWC A;  1OTR B;  3AEB B;  4IWQ A;  2IYD B;  8ICR A;  4GU2 A;  1JX4 A;  5J0R A;  7ICP A;  1D6E C;  1WJU A;  1T3N A;  1KBU A;  4P16 A;  4WJP A;  1OQR A;  2C2D A;  1P3Q U;  3CMM B;  2BGF A;  2JHD A;  5CR0 A;  3HJE A;  1IBX B;  3BY4 B;  3ETL A;  5E6J A;  2GWS A;  4KLL A;  1LVH A;  4XRH A;  2MBB B;  1S0O A;  5J2F A;  4R3D A;  3M1Y A;  1ZD5 A;  5CP2 A;  3UM9 A;  2LPE A;  4GXJ A;  3RAX A;  5MPO A;  3ZI4 A;  2DNF A;  5AM5 A;  9ICP A;  1AN8 A;  3DBL B;  4WAF A;  3V72 A;  3VH3 B;  2V4Q A;  3PT2 B;  5KFV A;  2KOB A;  3OJU A;  3IN5 A;  3OWE B;  4HRS A;  4GIV A;  3PHW B;  1ZPS A;  2Z7J A;  1C76 A;  4QIW F;  1DOQ A;  1X2I A;  4HDO A;  4BWM A;  4IQW A;  2QCZ A;  4DOC A;  4RZR A;  3IHP C;  5DG8 A;  4FS2 A;  1UD7 A;  4YD2 A;  2FE9 A;  2N7J A;  3BQ7 A;  2R8J A;  2YVC A;  3VDZ A;  4IQU A;  3U52 E;  1WCN A;  3EZ5 A;  4ED0 A;  2PFO A;  3L54 A;  2CU3 A;  3MFG A;  5FKA C;  2E6X A;  5AUI A;  4ELU A;  1WWT A;  2I6X A;  4DSE A;  1ZQQ A;  1F44 A;  2AL3 A;  4FFD A;  5DDM A;  5JH5 C;  1PFD A;  1XS9 D;  3ZDE A;  4DL6 A;  2V4L A;  3MJ5 A;  5G55 A;  1JRP A;  4GXI A;  4JMU A;  2WXL A;  2KYW A;  4AOF A;  4F72 A;  1K50 A;  2KVR A;  5KT7 A;  3TFR A;  4G9B A;  2INP E;  3C2L A;  3PS6 A;  4ECV A;  1JXL A;  4TQR A;  7ICQ A;  3PGE A;  1L3V A;  5AM4 A;  2LUM A;  2QIE B;  3OSN A;  1C3T A;  3KKA A;  2KC2 A;  2A3V A;  3U30 A;  2W43 A;  2KQ7 A;  3NRZ A;  2PXI A;  1VCB A;  3PV8 A;  3NJT A;  2KG5 A;  4S17 A;  3HK0 A;  1E0Z A;  2OHF A;  2JRZ A;  3LDZ E;  4QZF A;  2HHS A;  2BDP A;  1S77 D;  2FLN A;  3C8Y A;  4C8K A;  3EEC A;  1PUZ A;  2D07 B;  2J4X A;  4L2Y A;  1LGR A;  2KX0 A;  4U7C A;  2RDB C;  5J0Y A;  2QB0 B;  2VA3 A;  9ICN A;  3G6X A;  1MVK A;  4EZL A;  5KHQ A;  5J29 A;  2G3Q B;  3W1S C;  4QWB A;  3H8W A;  3AU4 A;  4C4T A;  2PLP A;  2KJ8 A;  4DQR A;  2M1M A;  2ZUC A;  5AKG A;  1UH6 A;  2MUT B;  5AM0 A;  2KLG A;  5AIB A;  4QZB A;  1CUK A;  1AWD A;  2LHE A;  4QZH A;  4DL3 A;  5J2B A;  2BQU A;  4J9Q A;  1P1A A;  3NVY A;  2MHJ A;  2PE9 A;  4HCP B;  2QAR A;  4EEN A;  3KH0 A;  2WF7 A;  2XI9 A;  1EM7 A;  4M8N A;  3GIL A;  1NZB A;  1K51 A;  2MH7 A;  4XDD A;  3R7R A;  4BBN C;  3WKC A;  2DF4 B;  2LRU A;  2MJE A;  4PHE A;  1D5Z C;  5J0Q A;  1GJZ A;  4USA A;  3V6H A;  7ICS A;  1UBI A;  2INN E;  4F3O A;  5KAI U;  3LWL A;  3MC0 B;  2ISP A;  5AEK B;  3BS7 A;  4DDI D;  2G1E A;  4F71 A;  1ZDV A;  3A9J B;  2WU2 B;  2J42 A;  3RBE A;  3UPQ A;  2DPJ A;  7ICT A;  1KKX A;  1T7P A;  2BYE A;  2LXA A;  4IC7 B;  2W11 A;  2CJN A;  3DPD A;  5DB6 A;  2Y9T A;  1BVS A;  3GIK A;  1I4P A;  5EOZ A;  9ICL A;  2EZZ A;  3SHQ A;  4OJ6 A;  2RDH A;  3SEN A;  3IAS 1;  2GOL A;  4C4S A;  4R66 A;  2BB5 A;  4K7U A;  2MA9 B;  1VLB A;  4DF8 A;  3AE4 B;  3PSI A;  2HMX A;  9ICU A;  3APC A;  4HVB A;  2Z8L A;  2K8H A;  2EMT A;  3SI8 A;  1WX7 A;  4CDG A;  1F9J A;  3R66 C;  3GII A;  3TAP A;  3AEE B;  2E8P A;  1WJ6 A;  2WFA A;  2FMP A;  1P98 A;  3ZYY X;  2WWZ A;  4YCX A;  3H0M B;  4MFF A;  4DQI A;  4OVU A;  2BKF A;  5DB7 A;  1Q46 A;  1UPH A;  2PFN A;  3RRH A;  1V9P A;  2L32 A;  3JSV A;  3Q3M C;  2GLS A;  4KLQ A;  3VVW B;  1J97 A;  4DL7 A;  2KNJ A;  5ALZ A;  3BS5 A;  5KFB A;  3PHX B;  3DDC B;  3GP7 A;  3KHR A;  1SE9 A;  3SR6 A;  3PX0 A;  4NAW B;  5AKI A;  2VA8 A;  1ECW A;  2M19 A;  1I4Q A;  1UGJ A;  3H7P B;  3D2N A;  1WYW B;  1WM2 A;  3TEX A;  2ZIV B;  1ZET A;  1ZQT A;  4WJ3 B;  1J7B A;  2NR2 A;  3UI3 A;  2QDF A;  3E0F A;  3P4R B;  3TMP B;  4JK1 A;  2INC C;  8ICG A;  2BS4 B;  4PPX A;  3Q8R B;  2QIL A;  3AI5 A;  2YX8 A;  3PST A;  2KFJ A;  1IM4 A;  1QKZ A;  1IV8 A;  1ZQ1 C;  3SV4 A;  1JQ4 A;  1X6I A;  4IWO A;  2WP9 B;  5KG3 A;  3ML8 A;  4I2D A;  3HKZ F;  3PLV A;  2JU6 X;  4Y2Q A;  2JZZ A;  4HKZ E;  2J6T A;  2ZZP B;  4E71 A;  4QWC A;  1Z5S B;  1FO4 A;  2HHQ A;  3NZS A;  3QU9 A;  3QAR A;  2GOW A;  4OZC A;  4A55 A;  3QU5 A;  1T6B X;  1QTM A;  2WDT B;  4KLT A;  1GG3 A;  2L52 A;  2YTU A;  4IDI A;  2G45 B;  2BPF A;  2HHV A;  4DWF A;  2ZW0 A;  2EMS A;  3K9O B;  4ZRK A;  2LAS A;  1TAM A;  1WGD A;  5J2E A;  8ICN A;  3NS1 A;  2BVC A;  2LXC A;  3N1Z C;  1IIP A;  4ECR A;  2AQ0 A;  4BVU C;  3AB5 A;  2AQ1 B;  4PZN A;  1RDF A;  3ISC A;  4N59 A;  3RJK A;  1YX6 B;  4CYE A;  3OLM D;  4ECW A;  3FAH A;  2D3B A;  3I9V 1;  3QUQ A;  2R61 A;  3ZKJ C;  4OO1 J;  4FAD A;  4K3B A;  2C7N B;  1JIH A;  3A1Q B;  2KSO B;  3AE1 B;  4ICV A;  2N9P C;  4KV2 A;  3MDA A;  5ALY A;  2X8X X;  2JF5 A;  3N28 A;  4Y2R A;  4KIK B;  5IIO A;  1N61 A;  2LBO A;  2IO2 B;  3ZXR A;  3I57 A;  2N7D A;  2C7H A;  2HHU A;  2RGF A;  1MQ2 A;  5AIA A;  2IHN A;  4YSX B;  5DPR A;  3RJG A;  1JWA D;  1B4F A;  1FNU A;  5HP4 A;  5DPS A;  1ZQM A;  4MT5 A;  1OXJ A;  1HIW A;  4RQ7 A;  2KZR A;  4C8O A;  3FYH A;  4J9L A;  1ZQV A;  5DG7 A;  4KSK C;  2XN9 C;  1WRD B;  1X9W A;  1NJZ A;  2JR5 A;  1KFD A;  2FMS A;  1XO0 A;  2BS3 B;  4Y2S A;  4MHV A;  2HOI A;  4EUT A;  3ZDB A;  3N1X C;  3OJ3 A;  1BPD A;  4ED7 A;  4CE6 A;  1DOX A;  5ALQ A;  2KKP A;  4MSQ B;  1DOI A;  3ZIM A;  3ZTC A;  1V1P A;  1I42 A;  2BW2 A;  2ZJA A;  2ZVN A;  4JWN A;  2YQE A;  5D3I B;  4DSK A;  3WK9 A;  2PVO D;  4KLD A;  1JRO A;  5BOM A;  1U4A A;  2Z0E B;  1ZQX A;  3EC8 A;  7ICG A;  2IOH A;  5DGB A;  3O65 B;  5KG1 A;  5EWG A;  3FIL A;  5CWR A;  3NVZ A;  3WAL A;  1MG4 A;  3KFU F;  2HOQ A;  2DX5 B;  4MM3 A;  2QKQ A;  8ICT A;  1DYQ A;  5KFX A;  3EPG A;  1ZQD A;  1FEH A;  2JH1 A;  4F8C B;  1F1H A;  1Y8R C;  1CMX B;  4IR1 A;  4C56 C;  3HIZ A;  3KHL A;  2PIA A;  5FR3 A;  2F3N A;  2EH9 A;  2W03 A;  4A8E A;  5BO4 B;  3MC1 A;  1L2N A;  2IGH A;  2BCU A;  1C78 A;  3QJZ A;  2I9G A;  3M9N B;  4G0N B;  4KDI C;  3URY A;  4ED3 A;  4DEZ A;  3OSP A;  2WHE A;  1QOB A;  4FJV B;  3TI0 A;  8ICA A;  3M8S A;  4M9N A;  2D5G A;  4EX7 A;  4JWS C;  1L7Y A;  3TFS A;  2V0G A;  1V2Y A;  1TK8 A;  3VR9 B;  4IG7 B;  3P63 A;  3BDP A;  1QSS A;  3T5H A;  3UIO B;  2O6K A;  3VFK A;  5J0P A;  3PX4 A;  1SSN A;  2KDF B;  1VJK A;  2G4S A;  2WB1 F;  3M9O B;  1COK A;  3N30 A;  2RRD A;  4O3S A;  1N48 A;  1IGC A;  3KYD D;  1H38 A;  5ALJ A;  2ZEQ A;  3GV7 B;  1JRU A;  5KFM A;  1BT0 A;  2A5U A;  1YN3 A;  1XLO A;  2IY1 B;  3V05 A;  4I27 A;  5KFF A;  4HCN B;  2JV3 A;  3LK9 A;  1ZKH A;  2FNJ B;  5DLG A;  1YJ1 A;  4B0E A;  1HUZ A;  3MTN B;  4G3I A;  5B66 U;  1BGX T;  4HYK A;  3QIJ A;  3PLU A;  3NVV A;  3AV8 A;  1YQ3 B;  4XZ4 A;  2IA6 A;  4DXF A;  1NNL A;  1I4G A;  1DK2 A;  2BWF A;  2FI1 A;  3ZVV A;  4Z6E A;  4PGY A;  2KFN A;  3Q8F A;  4EBD A;  3U8Z A;  2WLB A;  1ED1 A;  2WXH A;  3K4G A;  5DKW A;  2MWS B;  1DGS A;  3I76 A;  1PZN A;  7ICK A;  4ICA A;  5ALD A;  3EPI A;  2WXJ A;  2JXT A;  4M02 A;  4OVV A;  1ZQS A;  5KFI A;  4UBB A;  3TAC B;  4IM0 A;  1QSL A;  2WXK A;  2G06 A;  2PKE A;  5KFG A;  4R65 A;  1L3S A;  4NLC A;  4RMA A;  1Z1V A;  2P66 A;  2LI6 A;  4M6W B;  4MGY E;  2M56 B;  3UF8 A;  4P1C C;  3RF9 A;  4F2S A;  1PGB A;  3TAQ A;  3Q8B A;  5ALT A;  3P4P B;  4JWU C;  4HPP A;  3W5V B;  1SL1 A;  3TCA A;  1GNU A;  1Z4O A;  3AE7 B;  4RQ1 A;  4GFJ A;  1GAQ B;  2REX A;  4PYZ A;  2UVW A;  4ZYN A;  2N9E B;  1J7C A;  1UZX B;  2M0A A;  1EU4 A;  1XXG A;  2DZJ A;  4A3P A;  4F4Z A;  5C1Z A;  2A1A A;  3F2D A;  5B5E U;  4JLC A;  2KDE B;  2XGP A;  5KFW A;  4B9T A;  2G07 A;  5EWE A;  1TV9 A;  1UUP A;  3VRA B;  5CRX A;  2A1J A;  2R2Q A;  2W55 A;  5DGA A;  1Z00 B;  3PVX A;  1WM3 A;  3KWV A;  1KQQ A;  4YQW A;  3PZ7 A;  2BPS A;  2IPK D;  2LGI A;  2XY7 A;  4DFP A;  2LVQ A;  3BK1 A;  3GOE A;  1TT5 B;  1R4N B;  1M6Y A;  5ALE A;  2D3G A;  2YMQ A;  5ALG A;  1SB3 C;  1I7H A;  1JAL A;  3MHS D;  1F0Z A;  3LVV A;  2LHT A;  2XCA A;  5LLI A;  1ZQB A;  4UB5 A;  1XU4 A;  3AN1 A;  2WXN A;  3OG5 A;  4ASW C;  5IP4 D;  1PQS A;  4WWO A;  4YG2 A;  3W5U B;  8ICL A;  1F2R C;  2XBB C;  3H9D A;  1B22 A;  5HML A;  2HE7 A;  4XDC A;  1EXN A;  3D2Q A;  3MR2 A;  3MC8 A;  3PX6 A;  3DWM A;  1P7F A;  1ZW7 A;  2XEW A;  3SDL C;  4P2H A;  4Z6C A;  3T9L A;  2CN1 A;  1PVP A;  2OEH A;  5F3X B;  1WZ0 A;  5AI5 A;  1QIL A;  3NS8 A;  5KG4 A;  3ECI A;  5KFZ A;  1GOZ A;  3C19 A;  1KLG D;  4QW9 A;  2W9B B;  3ZQ4 A;  3EA6 A;  4LDT D;  5J8Y A;  3N7S C;  2D3A A;  2VKQ A;  1EF5 A;  5L83 A;  5KL8 B;  3RFA A;  1S5L U;  2Q4T A;  4Y2U A;  4LTU A;  3P2B A;  4C4V A;  3QZ7 A;  4EFO A;  1X66 A;  5KAF U;  5HNK A;  4Q45 A;  1CJE A;  2DHZ A;  4OJP A;  1Q10 A;  1ZE3 D;  2NBU A;  2V4I B;  4CHK A;  1AYF A;  2R2O A;  3E56 A;  3OJ4 B;  4K4H A;  4W9D A;  1GB4 A;  4GDK B;  4ACO A;  2VZK B;  2LEK A;  2M8S A;  2NPT B;  2IGG A;  2LFI A;  4C8N A;  3BVZ A;  3EGR A;  2GBN A;  5DQH A;  4FA6 A;  1XLQ A;  2OXO A;  1DK3 A;  4KLU A;  4GB9 A;  3QA8 A;  4NJ8 A;  4QW8 A;  4RNN A;  3GFK B;  2K9X A;  4RFB A;  4WJO A;  4ECX A;  5HHD G;  2F77 X;  3UXP A;  1ZQL A;  2VH2 A;  3AEG B;  4AJY B;  7ICR A;  3WAN A;  4E74 A;  2MSE D;  3ZO5 B;  3FKY A;  4MEM A;  4LVS A;  3NUH B;  1ET6 A;  3NG0 A;  3ONN A;  4ANX A;  4NQL B;  2ZIX A;  3T3O A;  3C1Y A;  4J3O D;  4Y2T A;  3U7D A;  2LI5 A;  4CQN A;  5D2M B;  3H7S A;  1KSP A;  4JX1 C;  5CA7 A;  4NAM A;  5IAA C;  2PMZ C;  4FBU A;  3K1Z A;  1JXE A;  1KFY B;  1HQR D;  9ICB A;  4ED2 A;  2OJW A;  3X23 A;  3VC8 A;  3UMC A;  2ASL A;  3U4E G;  2LVP A;  5HG2 A;  4BWJ A;  7ICF A;  5CB1 A;  2BCS A;  1TKY A;  1C1Y B;  2JX5 A;  3I5J C;  4PS3 A;  2NRT A;  2NVU I;  3B0X A;  1S3S G;  1TTN A;  5AI9 A;  5KFQ A;  4DBG A;  3FDS A;  2QMT A;  1NJY A;  4JV1 A;  1ARO P;  2HBJ A;  5L1I A;  1FXA A;  3J9C A;  3LYS A;  3NZU A;  2ZCB A;  3VTU A;  1SE2 A;  1UBQ A;  1YNT E;  1ZP0 B;  4ECU A;  2BBC A;  4RF0 A;  4I2G A;  2E3T A;  2LGD A;  3DBL I;  3TUO A;  1S10 A;  2MP2 A;  4P1B C;  4AYB F;  4QWA A;  4TUU A;  1N56 A;  1SXD A;  4XQ8 A;  1SKW A;  1MSW D;  2LGX A;  2FCM A;  1UQV A;  4O3N A;  1FNV A;  1EWY C;  3PZD A;  5KG5 A;  2PFP A;  4R8U B;  3Q8M A;  1L5P A;  2GBM A;  4PS8 A;  1J2N A;  4DQO C;  1ET9 A;  3L17 A;  2UU7 A;  1FFV A;  2KDI A;  3D6J A;  1I4H A;  1DOY A;  3PSF A;  3ZDC A;  8ICI A;  4R63 A;  4LLG M;  4OD0 A;  1RQN A;  2R18 A;  1L0V B;  3PSP A;  2LYH A;  4FZN A;  4J9M A;  4BUG A;  4F5O A;  1E8Y A;  4E3C A;  3NZ3 A;  1PGX A;  5J2D A;  4GSW A;  5JHA A;  7ICN A;  3ED5 A;  2FPL A;  1KRP A;  1TFR A;  4QIW C;  2Y5B B;  2I2Y A;  3UXO A;  3WK8 A;  2LJI A;  2C9W B;  5KFS A;  1NVI D;  4MEL A;  2DZK A;  1EU3 A;  2KC1 A;  1FRD A;  2H3Q A;  1FCL A;  3DBH B;  1E7V A;  4NNJ B;  2NO4 A;  2AGQ A;  2D3C A;  4KKJ A;  4GOC A;  4JB3 A;  4TQ1 A;  3RFZ B;  5DBC A;  2WU5 B;  2ZIW A;  4FJY A;  3UQA A;  1X9M A;  1YQ4 B;  2ZJ5 A;  4ED1 A;  2KEY A;  5KG7 A;  2Z0D B;  3CWI A;  4MJS A;  4KTQ A;  2DEN B;  4FO6 A;  2KLC A;  3WAP A;  3EW9 A;  1IYF A;  5KFE A;  3PPA A;  1TS2 A;  1F0M A;  4C8M A;  4M9J A;  3NUQ A;  2ISO A;  3OTQ A;  1L0Y B;  3KYC D;  4JIO U;  4HRO A;  3GDX A;  1WXQ A;  4CF3 A;  5DPW A;  4JV0 A;  2Q5W D;  2XK5 A;  1ZD3 A;  2KAN A;  1ZD2 P;  2IZV B;  1ZOY B;  2F8K A;  3S2A A;  1TAU A;  4OZA A;  3RNE C;  5AI6 A;  4GXK A;  3HX0 A;  2KK0 A;  2KV2 A;  4HEA 1;  4W9L A;  1V1O A;  5DQI A;  4UAT A;  5KFC A;  1STE A;  2J53 A;  5ALW A;  4B9S A;  2ASQ A;  4UW9 A;  4IM3 A;  4RGN A;  3AUL A;  5GXG B;  4FHK A;  3OAW A;  1CEZ A;  3L13 A;  3MFH A;  2KE7 A;  5CHV C;  1NJW A;  4NLG A;  2O6V B;  1V6E A;  4ARI A;  1FM0 D;  9ICM A;  3T5L A;  9ICE A;  2MCN B;  2ZUB A;  1KLN A;  4DS4 A;  3NRW A;  2HD5 B;  3AE2 B;  4US9 A;  3I63 C;  5DQG A;  2KD0 A;  1UF0 A;  4HKQ A;  1G6J A;  4QZA A;  2QB1 A;  1KN5 A;  2R8H A;  3RI7 C;  2JUO A;  3JPN A;  2GMI C;  4LCD E;  2ZXH A;  2JMG A;  4AP9 A;  5J0X A;  2JZ3 B;  4F5P A;  5AZG A;  1SV0 C;  2R8K A;  2ASJ A;  3JW0 X;  1F52 A;  2HOF A;  2J7Q B;  2LHD A;  3APF A;  5ALH A;  2N7E A;  3T8M A;  2VZK D;  9ICT A;  1VZ7 A;  3L16 A;  4JV2 A;  4EZ6 A;  2FBW B;  4TUR A;  4HDQ A;  3SAH A;  1PGA A;  2HTM E;  3GZN B;  3ZDD A;  1NYR A;  2K6D B;  3BQT A;  1AAR A;  4YXJ A;  2DKX A;  3VUW A;  2UYZ B;  4UB8 U;  5IA7 A;  2DZI A;  3H0R B;  2W8L A;  2K8B A;  1RYU A;  2K22 A;  2KFK A;  2L0T A;  5KG6 A;  4EEY A;  4C4R A;  4O9M A;  1AW7 A;  4TSS A;  2M4N A;  2AU0 A;  1LKY B;  3ONS A;  3RD2 A;  1TS3 A;  3V6E B;  1ZGU B;  3A9K B;  1F77 A;  2D10 A;  4LK0 M;  2KT7 A;  3TJP A;  3BQ2 A;  2CRX A;  3O13 A;  4QJF B;  3PRZ A;  3RMK C;  1OQY A;  4YD1 A;  1FXT B;  5GMV A;  4A20 A;  3QHT A;  4J9R A;  2MW5 A;  3AE8 B;  1RPL A;  2HVI A;  2BF8 B;  9ICI A;  3RN9 C;  1PDX A;  4ZRP A;  3MP9 A;  3RNB C;  4BGD A;  3DVG X;  5CHW A;  2C7M B;  3CST A;  3ABV B;  4I2A A;  3Q3F A;  4KLF A;  1S0N A;  4DL4 A;  4PL2 A;  1QOG A;  5J2C A;  9ICW A;  3PW2 A;  1J19 A;  3OGU A;  1Y88 A;  4TV3 A;  3SZ2 A;  5IOI A;  1ZQZ A;  5KFN A;  2K8C A;  2W9C B;  5C2T B;  2XIC A;  1ZRM A;  4QAY A;  1QQ5 A;  5KL1 B;  4R64 A;  1ZQH A;  4J9N A;  2FAZ A;  4FS1 A;  4D2K A;  5C23 A;  3HVD A;  2PFQ A;  2L3Z A;  1J8C A;  1L8O A;  2WF8 A;  2YML A;  1YZ7 A;  5ALU A;  4YR0 A;  1QT9 A;  2WXF A;  2NTT A;  2C22 A;  1SXT A;  3RB6 A;  4O3R A;  2W8K A;  4JGH B;  3IFW B;  5KHO A;  2BTE A;  4YSZ B;  1JCK B;  2KHV A;  4BKT A;  4J9O A;  4UQG A;  4PH5 A;  4B9U A;  4HK2 A;  1N5W A;  4P0P A;  1D4B A;  1V38 A;  2P35 A;  4F4Y A;  1RRB A;  4OVZ A;  1SGG A;  3RJJ A;  4ECZ A;  8ICU A;  2RPQ A;  2Z59 B;  3RPF C;  3VR8 B;  2AGO A;  4UAW A;  4GDL B;  3KZX A;  3N7P D;  2UWQ A;  3A4S C;  4BAX A;  1B1Z A;  2MJD A;  1Q3V A;  9ICV A;  4AUQ C;  3RB4 A;  3HKZ C;  1TS4 A;  4IL6 U;  4LJP B;  3ZNH B;  3F2B A;  3QK0 A;  4IWP A;  2JRH A;  4XC2 A;  2IMW P;  4LZG A;  2N1W A;  4DHZ E;  5GTH U;  1KDH A;  3K9P B;  3E9S A;  3AUO A;  1ZQU A;  3MFI A;  5KFR A;  4BXO A;  4GXB A;  3ZJT A;  2OM6 A;  4JE3 B;  2CS4 A;  5F9L A;  2IO3 B;  4EEK A;  3EFC A;  1KRH A;  2GRI A;  4ACF A;  3H4B A;  1MPE A;  1PK1 A;  2KDM A;  4DXG A;  2VRR B;  5ALK A;  5KFL A;  3W9C B;  3C2M A;  2ON8 A;  5H92 C;  3RT3 B;  4BOZ B;  3LYY A;  1ZQJ A;  3HW8 A;  4UAZ A;  1ZQG A;  9ICQ A;  2KN5 A;  4RQ5 A;  2V3N A;  5T8I A;  2Y1J A;  1SGH A;  3VXW A;  4I2J A;  3ZDT A;  5BYS A;  5AI4 A;  4ZRI A;  2M17 A;  5CJ7 A;  2F8L A;  4KLI A;  2HHW A;  2ZW1 A;  1LQB A;  4ZHO A;  3Q8L A;  1WMH A;  5KFH A;  1JWS D;  3ORY A;  2P6R A;  4WQO B;  1L6N A;  3EUB 2;  2W04 A;  4C7Z A;  1TY2 A;  4G11 A;  1R4M B;  5ALN A;  2RPV A;  3QU4 A;  2JZB B;  4QZE A;  1XSP A;  3UIN B;  2O2V B;  4N58 A;  2XGQ A;  1J2M A;  1N60 A;  3TKA A;  2KTR B;  1L7O A;  4RPY A;  2O6V D;  1ZOL A;  4C00 A;  1X40 A;  4NL9 A;  2DAJ A;  3TAD C;  4A9A A;  3THV A;  2X38 A;  2VJ5 A;  3UQ0 A;  1ACC A;  3M8R A;  2KMC A;  2XNA C;  2A4Z A;  2KIV A;  2ZXI A;  1H8C A;  1I35 A;  3V6J A;  4EZK A;  5A0L A;  3JPP A;  3U26 A;  1WGG A;  5ALR A;  4MH8 A;  1YN5 A;  4OCZ A;  1X42 A;  4O0I A;  2K4I A;  4ED8 A;  2KO3 A;  3BVG A;  4WJQ A;  3U7Z A;  3VQI A;  1HZ6 A;  4KIT B;  4DL5 A;  5DB8 A;  3Q8K A;  2ZTD A;  5G5G A;  3RUI B;  4BKS A;  3KUD B;  3ZXV A;  2BHN A;  5G2N A;  3C29 A;  3MGI A;  4LNN A;  4RQ3 A;  3RAQ A;  2AEH A;  4YXM A;  1L4Z B;  2ZIU A;  2K89 A;  3QX1 A;  1SEB D;  2K4E A;  3AL0 B;  3SV3 A;  4RQ8 A;  2W7P A;  4ECT A;  3B0A A;  5KT6 A;  2PI5 A;  4ANV A;  4K4I A;  2VJ4 A;  1MC8 A;  5D3D A;  4UB2 A;  1SXE A;  5KT4 A;  4DL2 A;  3Q14 C;  4RF1 A;  1SL2 A;  1OFF A;  1LV5 A;  2L5Y A;  3L5K A;  1OGW A;  4AWJ A;  4BFR A;  4Y2P A;  1V81 A;  4DWI A;  2JPH A;  4FE3 A;  4NJC A;  3SEI A;  5H2F U;  3UMB A;  1Q3U A;  3TBL D;  1BPY A;  4DXA B;  5G5H A;  4NV0 A;  2WX0 A;  1Q0W B;  4GDK A;  5AZH A;  2VH1 A;  1TKE A;  1ZXI A;  4RQ2 A;  3PML A;  4TKN A;  3LB8 C;  3TEZ A;  2PTL A;  2WXP A;  3V6K A;  5JUM A;  3PY8 A;  3Q6B A;  4DSF A;  1V5T A;  3DVN V;  2ZPY A;  3HHM A;  1DRG A;  5J2K A;  3T3F A;  1U9L A;  1MQ3 A;  3KWL A;  5D6J B;  4B95 A;  3N4M B;  3HT3 A;  1Y56 A;  3RB3 A;  3LWM A;  3EHV A;  5IKC M;  3N97 B;  2E1F A;  2PMV A;  3APD A;  4W9E A;  1Q5W B;  1OW5 A;  1S8O A;  2EAN A;  4GIB A;  3KUZ A;  3IM1 A;  1NKB A;  1XEE A;  2KHQ A;  4LDT B;  1MJD A;  3BZK A;  2NRW A;  2JSV X;  3RCZ A;  3GV8 B;  1RLF A;  2UVR A;  2MA1 A;  2WB1 C;  2ZJD A;  3S6J A;  1RYR A;  2HBK A;  1NI2 A;  4O3Q A;  1CK1 A;  4UAV A;  4TUS A;  3EYZ A;  3I3T B;  4WQM A;  3SEB A;  5C5J A;  4XYC A;  2PKO A;  4W9C A;  1WYG A;  2XO7 A;  3U2S C;  4KZ0 A;  4QZI A;  2J52 A;  3V7L A;  5KNI A;  2KVZ A;  1KLU D;  1UEL A;  2AWT A;  4IQV A;  3GE8 C;  4IUM B;  4W9F A;  2CHW A;  1LXD A;  3DHG C;  4M9H A;  5BOL A;  4O3M A;  1XF5 L;  3KOO A;  3QC8 B;  5KFP A;  3PO5 A;  8ICB A;  2KNB A;  4KLS A;  5J0W A;  5L9X A;  2KQS A;  2KWV B;  2CKH B;  4NZL B;  3DCG A;  2CPR A;  3Q8Q B;  1PVR A;  2EKI A;  1WIA A;  2ZVO A;  1F2R I;  3PZP A;  1RYS A;  4DLG A;  2EDU A;  5IO9 A;  1U4B A;  4NPN A;  4I2E A;  8ICE A;  4P0Q A;  4NLK A;  5J17 A;  3QUB A;  2SAK A;  2KTQ A;  3Q3N C;  1TIF A;  4BDP A;  1S0V A;  2BGW A;  4ECY A;  1WJN A;  2LZ6 A;  4ANU A;  3TL5 A;  2Y5P A;  2K60 A;  2ZTC A;  3A33 B;  5L1J A;  4RGM A;  3WIM A;  7ICE A;  3A0B U;  3N32 A;  3PO4 A;  3V61 A;  2KIW A;  4F2R A;  5AKH A;  4P4O A;  1HJP A;  3R9K A;  2QAR B;  4DO9 A;  4M0W A;  1HTO A;  1T0R C;  2DZM A;  3F53 A;  8ICK A;  1R4N I;  2HDE A;  3KKA C;  2LRW A;  3HPO A;  5DPT A;  2KJ5 A;  3AEC B;  4OHJ A;  3VTV A;  1NK8 A;  3RUL A;  1L7P A;  5CEH A;  1EO6 A;  4KMU A;  1KJT A;  5J2J A;  1RXV A;  1ZQP A;  3FM9 A;  2B3A A;  5DG9 A;  1WGR A;  5TR5 A;  2V9W A;  2PJH A;  3Q2A C;  1S97 A;  3PSE B;  5AM2 A;  2G5I B;  4I6N B;  1QQR A;  1KH0 A;  4ZRJ A;  3IG5 A;  4ARC A;  4WWP A;  4Z6D A;  1ZQY A;  1T0S C;  3HUI A;  2JVC A;  3GS2 A;  3MR5 A;  2VA2 A;  5ALL A;  1BNP A;  2ZUD A;  5J0T A;  3MR6 A;  1V9J A;  1ZQE A;  2H3I A;  2AXT U;  4LJO B;  1MHX A;  4QZG A;  1MN8 A;  3FC4 A;  1IBX A;  2BCV A;  3H0L B;  3SMV A;  4RT3 A;  2Y1I A;  2RR9 A;  2WGS A;  4QZ9 A;  3PV1 A;  1YQB A;  2BCQ A;  4G50 A;  1BPE A;  2JGA A;  2BS2 B;  3JVZ X;  3TQ1 A;  5HHH A;  3TEY A;  8ICO A;  2PW9 A;  2G09 A;  4DCC A;  4Y2Y A;  1E9M A;  3C1Z A;  4KLO A;  5JZE B;  1YJI A;  4YMO A;  1RWS A;  3NTU A;  2ODG A;  2WXQ A;  3I28 A;  3RH4 A;  1SE4 A;  4RH6 A;  5BYR A;  1E6E B;  3JSV B;  1L8L A;  5JTI A;  4EEW A;  1KL9 A;  2EZY A;  4B0M A;  3BS5 B;  2YB4 A;  9ICO A;  3KBB A;  4IC9 A;  4QNL A;  5ALM A;  4ECQ A;  2LWP A;  3H6N A;  2AQ2 B;  2I1Q A;  3ZNI D;  3W1S A;  1NOM A;  3L3F X;  4AS1 A;  2F2A B;  5KFD A;  1S1Q B;  5KT3 A;  3AU5 A;  3HVZ A;  3QEA Z;  8ICV A;  5BYQ A;  4NWI A;  4P4M A;  1B43 A;  4XA5 A;  2RDI A;  3E58 A;  3WA0 A;  3MDC A;  3EWA A;  4RQ4 A;  1KFT A;  1QOF A;  3OHA A;  3LXF A;  1QZE A;  4IRD A;  3PTF C;  4P7I A;  1K1S A;  4B9K A;  1FXI A;  2JXX A;  1NK0 A;  1FEZ A;  1ZUD 2;  3WU2 U;  1WXV A;  4OJ5 A;  2EAM A;  1C79 A;  1WUD A;  3QYP A;  3C5F A;  5HR6 A;  3HRD D;  4GLS C;  1XQQ A;  3RNG C;  3MAB A;  2ONQ A;  7ICM A;  2FUH B;  4FJZ A;  2JYE A;  2V3P A;  2CJO A;  4L23 A;  5EE3 A;  4YTN B;  3C23 A;  4M47 A;  1ZXH A;  3RNF C;  3IBE A;  4YTP B;  3M6Z A;  4KDL B;  3B0Y A;  4YVZ A;  5AUK A;  2FCQ A;  2H3Z A;  3AU6 A;  2I1K A;  2QB0 A;  1WG8 A;  4DF4 A;  4NM2 A;  3NY5 A;  4CNQ A;  1MHH E;  4HPM B;  1FNW A;  4WWN A;  2MUT A;  2D11 A;  2KTF A;  2ZNV B;  4HPL B;  1VRA B;  1ZQO A;  2D2Q A;  2N1V A;  4MH0 E;  3AE3 B;  2BPC A;  3O0F A;  5EE9 A;  2BQ3 A;  1QQ6 A;  5D49 A;  3VH4 B;  2KZ3 A;  2XCP A;  3M63 B;  3WK7 A;  4HAI A;  1X6J A;  3HWT A;  1NBF C;  3ZW3 A;  5CHF A;  1OUQ A;  1XD3 B;  4DSJ A;  4F93 B;  3W1Y A;  3ZJU A;  2BQQ A;  1YX5 B;  5D46 A;  3WK5 A;  2JEF A;  3AM9 A;  4UB4 A;  4XE0 A;  4HJG E;  2JYT A;  2L00 B;  4NLB A;  1TKG A;  2M0X A;  2IO1 B;  3GB1 A;  1UT8 A;  4M0A A;  2J0K A;  1WZ3 A;  3RTV A;  4AYB C;  1FMA D;  1ZJN A;  1RXW A;  2AX5 A;  3A9J A;  2HCF A;  2JT4 B;  8ICM A;  2CXY A;  2WS3 B;  5EWF A;  3MHZ A;  1D9F A;  2KZZ A;  3F5A A;  4Z6F A;  1MI0 A;  5ALV A;  1XWL A;  1HEK A;  1T0Y A;  4YN4 A;  2KIC A;  4X5V A;  2J0M A;  5DLF A;  1RZT A;  3GU3 A;  3SFD B;  3H1U A;  5J2R A;  4I2C A;  2MBQ A;  4RNA A;  5BMG A;  5KFK A;  4GC6 A;  2ES6 A;  2AL6 A;  5LXH A;  1EUV B;  1WR1 A;  1Z4N A;  2BR0 A;  2MX2 A;  4JL9 A;  4UDU C;  1MG8 A;  1QOA A;  4BX9 C;  3JPS A;  3PR5 B;  4QZD A;  1NI3 A;  4WJN A;  1V1P B;  2KJ9 A;  2RDJ A;  4YWG G;  4FN2 A;  2K5P A;  2G0A A;  3WK4 A;  4LNI A;  2LJ5 A;  3PO0 A;  9ICC A;  3G6Y A;  1HE8 A;  4O1N A;  2Y5C A;  3TIX A;  1S9F A;  1WE7 A;  4AJW A;  1Q1O A;  3CW2 C;  3NOB A;  3MJW A;  4X57 B;  3AQE A;  2BCR A;  2BYT A;  3RJI A;  1VD2 A;  3FIL B;  3VRB B;  3MBY A;  4MFA A;  1U48 A;  3PRP B;  4MM3 B;  5KFO A;  2K4P A;  3V3X A;  1UWM A;  1J0G A;  1SJE D;  1J7A A;  4NAW A;  7ICJ A;  2EAP A;  2AGP A;  2RP5 A;  4II2 B;  5J0U A;  2ZCC A;  1WE6 A;  2K4H A;  2KVS A;  4KLH A;  3R7Q A;  4RPZ A;  1QLN A;  4F5N A;  1NEN B;  2B21 A;  2E8M A;  3H7P A;  3RYT A;  3QEB Z;  1XNS A;  2NYV A;  1S0M A;  3C5G A;  1WI0 A;  2ZIV A;  5TIS U;  1V85 A;  3KLS X;  5IIK A;  2IHM A;  3BYY B;  3WKE A;  3W2D A;  1N5X A;  2XVT A;  3KQ4 A;  4M8M A;  3R2I A;  4XGA B;  4A6Q A;  3DBR B;  1VZ8 A;  2WQY B;  4W9I A;  3TAR A;  3RH5 A;  4EYI B;  2NS5 A;  2PEA A;  5AKY A;  2RD0 A;  5TSS A;  4DK5 A;  1RAX A;  2J0J A;  2GBR A;  1DGJ A;  2E8N A;  3DOW A;  3AXC A;  4KMO B;  2OWO A;  3AE9 B;  4NXZ A;  5D7G A;  2W54 A;  1MA7 A;  5AIC A;  2N0S B;  4B9N A;  4PK1 A;  4F4X A;  1YN4 A;  1SL0 A;  2FMQ A;  4I28 A;  2YEP F;  4CO7 A;  3IV6 A;  3P4Q B;  1TYG B;  2W9A A;  1LB2 B;  4WIP A;  2V3S A;  2B76 B;  2XY6 A;  2LYB A;  1E8Z A;  3GZN I;  1L7M A;  3CYM A;  3LVW A;  3T79 A;  1O03 A;  3RR7 A;  2JEI A;  1TK0 A;  3UMG A;  4OJO A;  4I2I A;  1P0R A;  4RM8 A;  5HR7 A;  1FIQ A;  3RJF A;  4QWE A;  1JMS A;  3F2C A;  4PS7 A;  2FJ6 A;  2L1A A;  3DVG Y;  4EE2 A;  4I2F A;  1R7S A;  5LXI B;  2KWD A;  7ICI A;  2ZG6 A;  2NRX A;  4IQT A;  3QUC A;  1C4P A;  3QZ8 A;  2BYV E;  4IRK A;  1GPX A;  4GC7 A;  3A1Q A;  2PVG C;  2KSO A;  2BDU A;  2KAJ A;  1B9R A;  2KHW B;  1IP9 A;  5JRT A;  3RJH A;  1GB1 A;  5AZF A;  3L08 A;  1SZP A;  1FD6 A;  1IXR A;  3C21 A;  1ZDX A;  3T5J A;  2EKE C;  2MBE A;  3DVN U;  1C20 A;  3OHB A;  3IXS A;  4KIK A;  3RZW C;  2CHZ A;  1D5M C;  4UB3 A;  3UQ2 A;  1D8B A;  2WAQ F;  4PHP A;  4A3O A;  2Y0S F;  2AYO B;  2GLE A;  1L0X B;  1UHU A;  3ZDM C;  1JML A;  1TZ1 A;  4F91 B;  3Q8P B;  4DFK A;  1GC6 A;  2HTH A;  4MAC A;  2QJL A;  1V97 A;  4KSL C;  4JUZ A;  4BKS D;  4NJ7 A;  3VCB A;  2WXM A;  1QCK A;  4O3P A;  3BYT B;  4YMN A;  2H3F A;  2AH5 A;  3RNC C;  7ICO A;  3G6V A;  3H7I A;  1L3T A;  3B08 A;  4DQS A;  4DFM A;  5IIM A;  3ZDA A;  2LM1 A;  1FCC C;  1L7N A;  4UB1 A;  4HWI B;  3BII D;  2A1J B;  3DDH A;  2CHX A;  2QSD A;  2FIF A;  3C2K A;  3SQI A;  9ICF A;  2LVO A;  5AK4 A;  1D5X C;  1CRX A;  2Q0Z X;  3SYZ A;  4WAA A;  1WSP A;  1C9F A;  1WX9 A;  1SIF A;  2PI4 A;  2CR5 A;  5KG0 A;  2E1E A;  4TQ0 A;  3AE6 B;  2BQR A;  4F8R A;  4W9J A;  4DHZ B;  1NK5 A;  3Q8E A;  2W82 A;  3EFU A;  4GMV A;  1L6U A;  4N9F 4;  3N3K B;  2NBV B;  3HM3 A;  3D32 A;  1SWV A;  8ICC A;  4WUR A;  1ZQR A;  3DBS A;  1ZRN A;  1K8R B;  4M9G A;  4MGI E;  2BZF A;  3RH6 A;  2MRP A;  3H8J A;  2AQ4 A;  3ZJV A;  3C0R B;  1KW4 A;  2GH1 A;  4F7Z A;  5KTQ A;  4XX5 A;  2JWU A;  4Q8E A;  3ZTD A;  5BMH A;  1XO1 A;  3Q3O C;  1HUO A;  3CSF A;  4FHJ A;  3T3N A;  4YTM B;  3ALR A;  3H4D A;  1SKS A;  1Q8K A;  4JQW C;  4J9S A;  4JPS A;  3UGB B;  4C0Z A;  2W9N A;  3P42 A;  1XT9 B;  2ASD A;  1H4R A;  4IRC A;  2KD1 A;  1UT5 A;  4PZO A;  1V8C A;  4NY0 A;  2MJ3 A;  2GI9 A;  2BKE A;  5AKK A;  2KVC A;  4ELV A;  3Q8A A;  2RMM A;  2HBL A;  3ISD A;  3KW5 B;  3GE3 C;  2G9H D;  2IGD A;  3AQF A;  2N9X A;  4C4V B;  5J18 A;  5ALO A;  3NGD A;  1HA5 A;  4EZ9 A;  2XID A;  1IG6 A;  1HEZ E;  4S0R A;  1L4D B;  3TSS A;  3AMZ A;  4F4K A;  3IRU A;  3SD5 A;  4XWT A;  3QNM A;  2IDY A;  3IT4 B;  5KG2 A;  4LNK A;  2HSZ A;  2GBJ A;  1KFS A;  9ICH A;  5E6N A;  1HXY D;  3QXG A;  2ACZ B;  4N6E B;  1QF6 A;  1R4M I;  2W7O A;  4KKI A;  4J9K A;  1ZQI A;  3DHI C;  3WKA A;  1ISN A;  1Z2M A;  1XLP A;  2RDG A;  4UAS A;  3GV5 B;  1JWB D;  2DYM A;  3AEV A;  2V4R A;  3PMN A;  1TGZ B;  4PL1 A;  5DCN A;  3GIM A;  2LM4 A;  1XLN A;  4I2H A;  5DBB A;  2UVV A;  2W9M A;  2F1I A;  1YZ6 A;  5KT2 A;  3QAQ A;  1S76 D;  4RGO S;  2HHT A;  2QC8 A;  2ZIX B;  2KMD A;  2FCS A;  1ZQC A;  2VIX A;  4TMA B;  4Q2J A;  2LMR A;  3Q8C A;  3VTW A;  4ANW A;  3NAS A;  2LUE A;  5J8Y C;  2F76 X;  3BQ0 A;  2AHO B;  3RJE A;  1V86 A;  2C5L C;  3RR8 A;  3L0W B;  1GUA B;  4YP3 A;  1KF6 B;  1BXT A;  4M6W A;  1B0X A;  2RQ5 A;  1AQ6 A;  1NZP A;  3NVW A;  2FE8 A;  1UWX A;  2W3S A;  1U47 A;  3ETR A;  2ICI A;  5T14 A;  5AM3 A;  3PRE A;  1NK6 A;  1WH3 A;  1BUI C;  1P7D A;  4IM2 A;  4DQP A;  4O5K A;  5KFT A;  4EKU A;  3E2E A;  5AKE A;  1RYJ A;  4BBN F;  3HP6 A;  4YT0 B;  2BWE S;  4WH4 A;  2NCN A;  3SU8 X;  4KLG A;  1UGM A;  4KLJ A;  3PW7 A;  5E6P A;  4AQ7 A;  2MP2 B;  4UAR A;  4MEY A;  1C4C A;  2WXG A;  4NLZ A;  1NK9 A;  1YIW A;  2WF6 A;  4KLM A;  1WXS A;  3IAM 1;  3PZ8 A;  3PW4 A;  1PUT A;  1N62 A;  3T5K A;  1Z00 A;  1EF1 A;  1WJ4 A;  8ICJ A;  4I29 A;  3KVF B;  2E8O A;  2SEB D;  1JI7 A;  1XO3 A;  1T3Q A;  4M01 A;  2AJQ A;  5HHI A;  2WNM A;  1ESF A;  4I6L B;  2F44 A;  4RQN A;  2I5H A;  5AHX A;  3UXN A;  1OEY A;  5AKZ A;  2WTF A;  2KKC A;  3CF6 E;  2MBO A;  4FLH A;  4M04 A;  1PK3 A;  1WWV A;  4O5C A;  4RT2 A;  1EWC A;  1IGD A;  5IIN A;  4RUC A;  2KDB A;  1C4A A;  4PHA A;  2BB6 A;  2WYQ A;  2LKY A;  3JPO A;  1KTQ A;  2R8G A;  3Q3J A;  1WFY A;  2KJR A;  9ICS A;  4RNO A;  4MEX A;  3MR3 A;  4NJ6 A;  2C2E A;  2G08 A;  4NQK E;  1HTQ A;  4WWM A;  7ICU A;  1RM6 C;  3V6C B;  3B9J A;  2KMM A;  4KZC A;  2C28 A;  3N20 C;  2FCN A;  1KLV A;  1JN3 A;  2H3V A;  3SAG A;  7ICL A;  1K52 A;  2IY0 B;  1XSN A;  4C80 A;  2H89 B;  2DKZ A;  2ZIW B;  1ZYQ A;  2WX1 A;  4LNF A;  4DHJ B;  2YMM A;  1X1M A;  2W9B A;  1T4G A;  4MJS B;  7ICH A;  4DFD A;  3N1Y C;  5KFJ A;  4DFJ A;  3QU2 A;  2D3D A;  2DPI A;  2FID A;  2G5H B;  4BJQ A;  4KN4 A;  1Z1B A;  2NV3 A;  2V9H A;  3M3J A;  4F1S A;  3DHH C;  4BZA A;  1SIJ A;  3PR4 A;  4I6P A;  1KTK A;  2XK5 B;  1SV4 A;  1L5U A;  1KM7 A;  3H40 A;  2JXJ A;  4K7W A;  3PVL A;  1L6V A;  1T8E A;  2MBH A;  2KJH B;  3IVF A;  1YT3 A;  4TUP A;  2MEK A;  4KGR A;  3QCA A;  3ZRF A;  2KN7 A;  1SE3 A;  2WHI A;  1A0P A;  1SZH A;  1JWU D;  4RNM A;  4KN7 A;  3V7J A;  2IO0 B;  2L8J A;  2NPT A;  4J9P A;  3SD7 A;  1XCQ L;  3IT6 B;  2YY6 A;  3C28 A;  4MGK E;  4F92 B;  1Z3E B;  8ICH A;  2RHF A;  5HKH A;  3RNA C;  2DWQ A;  1O08 A;  2DYB A;  3AH7 A;  4FUL A;  2WF9 A;  4LJX A;  5EE0 A;  2K3U A;  2N1R A;  3I1Y A;  3CRX A;  4L1B A;  3WKB A;  4ZH4 A;  4A90 A;  5EE1 A;  5BMI A;  2L76 A;  3PW0 A;  4YXD B;  3WK6 A;  2NO5 A;  1JWM D;  1E10 A;  5III A;  9ICK A;  4HJK A;  4MFC A;  4YFK A;  2IBI B;  4M2Y A;  5AK3 A;  4B6J A;  4XUS A;  5HFY A;  4K4G A;  2OOB B;  4EBC A;  4ECS A;  5KFU A;  3IHQ B;  1L3U A;  3AE5 B;  1DXS A;  5ALP A;  1C7Y A;  2H88 B;  1WF9 A;  2L05 A;  3ISB A;  2HVH A;  1RG6 A;  4Y2V A;  5JXV A;  3AED B;  9ICX A;  5E6O A;  4FZL A;  3M7D A;  5DBA A;  4K81 A;  5KFY A;  3HIL A;  3KD3 A;  2J6S A;  1NK4 A;  2KQ4 X;  4OW0 A;  4ELT A;  4QZC A;  1PYW D;  4RCO A;  1VJ5 A;  5LNK 1;  1TK5 A;  4Q8F A;  1T5X D;  3Q69 A;  4F5Q A;  2W3R A;  4Y2J A;  2HDO A;  2F1H A;  3P4S B;  4DDG D;  5ALI A;  1UCV A;  1A77 A;  2K8B B;  4PGQ A;  9ICG A;  2KFK B;  2ZJ8 A;  3IG8 A;  2IBK A;  4K3C A;  2I38 A;  4UBC A;  1UA0 A;  1T0Q C;  5F9N A;  2TSS A;  2K1F A;  4RQ0 A;  5IIJ A;  4DOA A;  1C77 A;  1P7E A;  2M0N A;  5AKX A;  2MLB A;  1URJ A;  2B6G A;  3F5E A;  1UA1 A;  3J81 j;  2HI0 A;  2F1J A;  4EEL A;  1ZQF A;  3R3M A;  4R8U A;  1FRR A;  2KN4 A;  5C3J B;  4UAY A;  3RBD A;  4IS7 A;  5I4D A;  4MGZ E;  1QQ7 A;  5KFA A;  3ZNG C;  1JUD A;  4GLX A;  1A70 A;  4BKG A;  3AEF B;  2D6F C;  2L0F A;  2DL0 A;  1NJX A;  3B2F A;  3BVM A;  2E5S A;  1RFA A;  4EX6 A;  4Q44 A;  4W9G A;  1TAQ A;  1YMH E;  2OH2 A;  3L4P A;  4ZRQ A;  5L1L A;  3JYU A;  4XWW A;  2H5X A;  2DGZ A;  3PRM B;  8ICP A;  2DLB A;  2YB1 A;  2K8A A;  3BWU D;  2JY6 A;  2K8C B;  3KUC B;  2JQR B;  3ML9 A;  2N4F A;  1SJH D;  2KX3 A;  2A19 A;  4M9L A;  4REZ A;  1WR6 E;  2RSU A;  4ZOH C;  1SKR A;  3CP8 A;  2GBK A;  1XSL A; 
#chains in the Genus database with same CATH homology
 2JU6 X;  3SFD B;  4HKZ E;  4RNA A;  5BMG A;  2FBW B;  3H8H A;  4ITK A;  1PGA A;  1FO4 A;  2HTM E;  4UDU C;  1NYR A;  4KGT A;  1QOA A;  4OZC A;  4A55 A;  1NI3 A;  1T6B X;  2L83 A;  1V1P B;  2L52 A;  2K22 A;  4YWG G;  2K5P A;  4TSS A;  1AW7 A;  4IDI A;  2ZW0 A;  1NYQ A;  3PO0 A;  1TS3 A;  4O1N A;  1F77 A;  4LK0 M;  3NS1 A;  1N63 A;  2Y5C A;  1SF0 A;  3O13 A;  2N9K A;  2BYT A;  3AB5 A;  2AQ1 B;  4N59 A;  3FIL B;  2FUG 1;  3VRB B;  1UNS A;  3FAH A;  1JW9 D;  4MM3 B;  3I9V 1;  2R61 A;  4IOI E;  1UWM A;  3V3X A;  1CQV A;  1J7A A;  1ROE A;  1SJE D;  2WDV B;  3AE8 B;  4KX6 B;  1PDX A;  3AE1 B;  4ZRP A;  3MP9 A;  1XCT L;  3ABV B;  1K53 A;  1NEN B;  2WDR B;  1QOG A;  1N61 A;  1IUE A;  1LO5 D;  4P6V F;  3I57 A;  3KLS X;  4YSX B;  3BYY B;  3ZGZ A;  3W2D A;  1N5X A;  3KQ4 A;  1JWA D;  1FNU A;  3R2I A;  4A6Q A;  2OED A;  1VZ8 A;  2WQY B;  4MT5 A;  5C2T B;  4YSY B;  4D2K A;  5TSS A;  3HVD A;  2XN9 C;  1DGJ A;  1QT9 A;  2WXF A;  3AE9 B;  2NTT A;  5D7G A;  2W54 A;  2N0S B;  1SXT A;  2Y3A A;  2BS3 B;  1YN4 A;  2YEP F;  2BTE A;  4YSZ B;  3P4Q B;  1VDV A;  1JCK B;  1TYG B;  2LMC A;  1DOX A;  4WIP A;  3WCQ A;  2B76 B;  3N9Y C;  1N5W A;  1D4B A;  1DOI A;  3SFE B;  1V1P A;  1OQQ A;  2BW2 A;  4OVZ A;  5D3I B;  1QLB B;  5H8Y E;  3RPF C;  2PVO D;  3VR8 B;  1JRO A;  3R8B A;  4GDL B;  1FIQ A;  1WRI A;  1B1Z A;  4EE2 A;  2L1A A;  2MJD A;  3DWG C;  1R7S A;  1TS4 A;  2KWD A;  5HI1 A;  4FXC A;  3FIL A;  3NVZ A;  1C4P A;  1GPX A;  1DYQ A;  3E9S A;  1FEH A;  2PVG C;  2KAJ A;  1B9R A;  4RGT A;  1FFU A;  3ZJT A;  4C56 C;  1GB1 A;  4JE3 B;  2PIA A;  5FR3 A;  1FD6 A;  2NTS A;  1KRH A;  1ZDX A;  2GRI A;  3IXS A;  1MPE A;  2KDM A;  4DXG A;  2IGH A;  1D5M C;  3W9C B;  2ON8 A;  5H92 C;  1C78 A;  1L0X B;  3URY A;  3LYY A;  1JML A;  2V3N A;  2YEP B;  4MAC A;  3R2T A;  5T8I A;  2QJL A;  1QOB A;  1V97 A;  2D5G A;  4JWS C;  5BYS A;  1NEK B;  2V0G A;  2WXM A;  3VR9 B;  3BYT B;  3P63 A;  2ZW1 A;  4KGS A;  1TJE A;  4ZHO A;  1VR9 A;  2BT6 A;  1SSN A;  2WXR A;  4ZYS A;  1VJK A;  1JWS D;  1FCC C;  3EUB 2;  4C7Z A;  1IGC A;  4OZB A;  1TY2 A;  2RPV A;  3BII D;  4ZHP A;  2IJ0 A;  2QSD A;  4N58 A;  3V05 A;  1YN3 A;  1XLO A;  1N60 A;  1D5X C;  4B0E A;  2EEL A;  1VZ6 A;  1WSP A;  4A9A A;  1C9F A;  2X38 A;  1ACC A;  3NVV A;  3AE6 B;  1HZ5 A;  1YQ3 B;  2XNA C;  3AV8 A;  4IKG A;  4TQ0 A;  4DXF A;  3Q8E A;  2W82 A;  1I4G A;  1L6U A;  4MH8 A;  3Q8F A;  1YN5 A;  1ENF A;  3BK2 A;  3VQI A;  3U7Z A;  2WLB A;  3BVG A;  2WXH A;  1HZ6 A;  5G5G A;  4WUR A;  2WXJ A;  3P1M A;  2JXT A;  4PT5 A;  1I4R A;  2WXK A;  1I4X A;  1L4Z B;  1SEB D;  3ZJV A;  1YJJ A;  2JWU A;  2DYO A;  5BMH A;  2M56 B;  4C7Y A;  1PGB A;  3Q8B A;  3P4P B;  3AEA B;  4JWU C;  5FK9 C;  4YTM B;  3T3N A;  3W5V B;  4JPS A;  1E7P B;  5D3D A;  2K0P A;  3P42 A;  2JZP A;  4RF1 A;  1OFF A;  3CIR B;  1V8C A;  2KAC A;  3AE7 B;  2MJ3 A;  2GI9 A;  2WDQ B;  4US8 A;  1BML C;  1GAQ B;  2DBY A;  3Q8A A;  2RMM A;  4NJC A;  2G9H D;  2IGD A;  1J7C A;  2M0A A;  1EU4 A;  1HA5 A;  1XXG A;  4A8X C;  1TZO A;  1HEZ E;  1L4D B;  4H2A A;  3TSS A;  3AMZ A;  5G5H A;  1TKE A;  1ZXI A;  4XWT A;  2GB1 A;  2WXO A;  3LB8 C;  3TEZ A;  1UUP A;  3VRA B;  2PTL A;  2WXP A;  2IDY A;  3IT4 B;  1TS5 A;  2W55 A;  1SBB B;  1HXY D;  2ACZ B;  3KWV A;  3PZ7 A;  4N6E B;  1WGK A;  1QF6 A;  2QEJ C;  4KKI A;  2IPK D;  2LGI A;  3KWL A;  3BK1 A;  1XLP A;  2RDG A;  1Y56 A;  1JWB D;  1TY0 A;  2PMV A;  2DYM A;  2NMQ A;  1SB3 C;  1I7H A;  1M4V A;  1JAL A;  3B2G A;  1RFK A;  1CZP A;  1XLN A;  1F0Z A;  1XEE A;  4RGO S;  2JSV X;  3AN1 A;  2AQ3 B;  2WXN A;  4TMA B;  3W5U B;  1CK1 A;  2N9L A;  3BZD B;  4Q2J A;  1F2R C;  2WXI A;  3Q8C A;  4WQM A;  3SEB A;  3TEW A;  3AEB B;  4XDC A;  2PKO A;  1WYG A;  3U2S C;  3DWM A;  1P7F A;  1KF6 B;  2J52 A;  1BXT A;  1D6E C;  1KLU D;  4P16 A;  1OQR A;  1QIL A;  3NVW A;  2FE8 A;  1UWX A;  2W3S A;  1IBX B;  3ETR A;  1XF5 L;  2ICI A;  5E6J A;  1GOZ A;  1KLG D;  3ZQ4 A;  3EA6 A;  4R3D A;  5MPO A;  1BUI C;  4NZL B;  2EKI A;  1F2R I;  1AN8 A;  1RYJ A;  4LTU A;  4WAF A;  4YT0 B;  4HRS A;  3OWE B;  4WH4 A;  1ZPS A;  1CJE A;  1C76 A;  2SAK A;  4AQ7 A;  1Q10 A;  1ZE3 D;  2V4I B;  1C4C A;  2WXG A;  1AYF A;  3E56 A;  2Y5P A;  3IAM 1;  3PZ8 A;  4RGM A;  1PUT A;  4GDK B;  1GB4 A;  1N62 A;  2VZK B;  2LEK A;  2N7J A;  2IGG A;  2LFI A;  3BVZ A;  3EGR A;  3U52 E;  1XLQ A;  2CU3 A;  3MFG A;  5FKA C;  2E6X A;  2K9X A;  2SEB D;  1XO3 A;  4RFB A;  1T3Q A;  4M0W A;  5AUI A;  1WWT A;  2WNM A;  1ESF A;  5HHD G;  3AEG B;  2HDE A;  3NUH B;  1ET6 A;  1PFD A;  1EWC A;  1IGD A;  3AEC B;  4OHJ A;  3MJ5 A;  1C4A A;  1JRP A;  2BB6 A;  3T3O A;  4J3O D;  2WXL A;  4CQN A;  1K50 A;  4JX1 C;  2INP E;  1QQR A;  1KH0 A;  4WWM A;  2LUM A;  2QIE B;  4ARC A;  1RM6 C;  1KFY B;  1HQR D;  3B9J A;  2KMM A;  3HUI A;  3NRZ A;  3GS2 A;  3U4E G;  1K52 A;  1E0Z A;  2OHF A;  4C80 A;  2H89 B;  5HG2 A;  1MHX A;  3FC4 A;  1IBX A;  1TKY A;  2JX5 A;  3C8Y A;  2QMT A;  2J4X A;  4L2Y A;  2BS2 B;  1FXA A;  3J9C A;  3TEY A;  1MVK A;  1SE2 A;  2PW9 A;  1ZP0 B;  1YNT E;  1SIJ A;  1KTK A;  2BBC A;  4RF0 A;  1E9M A;  2E3T A;  1YJI A;  3TUO A;  2PLP A;  1RWS A;  1L6V A;  2WXQ A;  1SE4 A;  4KGR A;  2MEK A;  1FNV A;  1E6E B;  1EWY C;  4RH6 A;  5BYR A;  1SE3 A;  1JWU D;  1L5P A;  1AWD A;  2LHE A;  4B0M A;  4DQO C;  1ET9 A;  1XCQ L;  3IT6 B;  1FFV A;  2AQ2 B;  3NVY A;  1I4H A;  3W1S A;  1DOY A;  4AS1 A;  2DWQ A;  3AH7 A;  3HVZ A;  4LLG M;  1EM7 A;  5BYQ A;  1K51 A;  4XDD A;  2MH7 A;  1L0V B;  5EE0 A;  2K3U A;  2MJE A;  4L1B A;  1D5Z C;  4USA A;  3NZ3 A;  1PGX A;  4A90 A;  5EE1 A;  5BMI A;  2INN E;  1QOF A;  3LXF A;  3MC0 B;  2I2Y A;  4YXD B;  1FXI A;  2G1E A;  1JWM D;  1ZDV A;  1E10 A;  2WU2 B;  1ZUD 2;  2J42 A;  2LJI A;  1NVI D;  1EU3 A;  5HFY A;  1C79 A;  1FRD A;  2CJN A;  1FCL A;  3HRD D;  4GLS C;  3AE5 B;  1I4P A;  2ONQ A;  2H88 B;  2RDH A;  2JYE A;  3AED B;  3IAS 1;  4KKJ A;  4TQ1 A;  5JXV A;  3RFZ B;  2V3P A;  2WU5 B;  1YQ4 B;  2CJO A;  2KQ4 X;  4L23 A;  5EE3 A;  4OW0 A;  4YTN B;  1PYW D;  2BB5 A;  4RCO A;  1ZXH A;  3CWI A;  5LNK 1;  1T5X D;  1VLB A;  3Q69 A;  3AE4 B;  4YTP B;  2W3R A;  1TS2 A;  2Z8L A;  5AUK A;  3P4S B;  1L0Y B;  3AEE B;  4HRO A;  1WXQ A;  2I38 A;  1MHH E;  2Q5W D;  2TSS A;  3ZYY X;  1FNW A;  1C77 A;  1ZOY B;  1P7E A;  4OZA A;  2L32 A;  5C3J B;  1VRA B;  4HEA 1;  2KN4 A;  1FRR A;  1V1O A;  1STE A;  2J53 A;  3AE3 B;  4RGN A;  5I4D A;  5EE9 A;  5GXG B;  3GP7 A;  4NAW B;  3SR6 A;  1A70 A;  3AEF B;  3ZJU A;  4ARI A;  1FM0 D;  3B2F A;  3BVM A;  2M19 A;  3AM9 A;  1I4Q A;  4XE0 A;  4HJG E;  1UGJ A;  2JYT A;  1YMH E;  3AE2 B;  4HKQ A;  4US9 A;  3L4P A;  4ZRQ A;  1TKG A;  3TEX A;  4XWW A;  3GB1 A;  1J7B A;  3UI3 A;  4NAM A;  1FMA D;  3P4R B;  2DLB A;  2AX5 A;  3BWU D;  2BS4 B;  2QIL A;  2JQR B;  2WS3 B;  3MHZ A;  1SJH D;  2LHD A;  4REZ A;  1QKZ A;  1MI0 A;  4ZOH C;  1JQ4 A;  2WP9 B;  2VZK D;  1VZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...