3SR6A

Crystal structure of reduced bovine xanthine oxidase in complex with arsenite
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 37
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3sr6A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sr6A01
1ZOYB 3AEBB 2WU2B 2K9XA 4YSZB 1XLPA 1QF6A 2JX5A 3BIID 3P1MA 1N63A 5H92C 1QT9A 2M56B 1TKYA 3VRBB 3DWGC 1CJEA 1JQ4A 2MJ3A 3AE9B 5AUIA 4C80A 2WDRB 1E0ZA 1DGJA 2BS3B 2BS2B 1AWDA 3RPFC 4JWSC 3AE3B 3AEEB 2PIAA 1T3QA 3CIRB 1ZP0B 2PKOA 3VR8B 2OHFA 3AN1A 5EE3A 4C7ZA 4YSYB 1ZUD2 5C2TB 3AE1B 2M19A 3LXFA 3W9CB 1NVID 2W55A 3ETRA 1ZXIA 3P4QB 2WS3B 2K22A 2BS4B 2K5PA 2L83A 3NS1A 4KX6B 1SIJA 1JWAD 2DBYA 1RWSA 3AH7A 1NI3A 1N5XA 1NEKB 2WQYB 3HRDD 2CJNA 2QJLA 1FRDA 1DOIA 1FXIA 3DWMA 4ITKA 4WQMA 3P4PB 2JQRB 2KAJA 2W3RA 4ZHOA 1YJIA 5EE0A 1OQQA 5C3JB 1GPXA 1PDXA 1YQ4B 3AEDB 1N5WA 1J7AA 1EWYC 1KFYB 2QIEB 1WYGA 2WLBA 3AECB 1XLNA 3P63A 1RYJA 1WRIA 1XO3A 3AE7B 1A70A 1L6VA 4LTUA 4WWMA 5EE9A 4P6VF 3KWLA 1L6UA 5EE1A 3NRZA 1QOBA 2HTME 1NYQA 1TKEA 1AYFA 2WU5B 5MPOA 2WDQB 1UWMA 1WWTA 3EUB2 4US8A 2BT6A 1ROEA 3AB5A 1KF6B 2H88B 4ZOHC 3SR6A 3AE6B 4IDIA 1V8CA 5AUKA 3SFDB 4YSXB 2PVOD 1FFVA 1SB3C 1IUEA 4US9A 2AX5A 1KRHA 3AMZA 2WP9B 2LEKA 3AE8B 2N0SB 2WDVB 4USAA 3PO0A 4YTPB 4ZHPA 1PFDA 2G1EA 3AE4B 1B9RA 3NVZA 1YJJA 1QLBB 3CWIA 3LB8C 1XLOA 1L0VB 1E7PB 3AV8A 3HVZA 3HUIA 1JALA 2Q5WD 2DWQA 1NYRA 2KMMA 1FXAA 5G5HA 3VR9B 2Y5CA 4JX1C 1PUTA 3B2FA 1JRPA 3AEAB 3B2GA 2CJOA 1TKGA 1DOYA 1VJKA 1CZPA 1XLQA 1QOGA 2FBWB 1FFUA 3P4SB 3W5UB 1F0ZA 1OFFA 3L4PA 1RFKA 2B76B 2L52A 1FM0D 1L5PA 1WGKA 1J7CA 1VLBA 5H8YE 3B9JA 4N59A 1TYGB 1FRRA 2MH7A 3NVYA 1QOAA 2CU3A 3NVWA 3WCQA 4C7YA 3SFEB 3FAHA 4A9AA 3AEFB 1DOXA 2E3TA 1E10A 1N60A 4HROA 1JW9D 1WXQA 1E6EB 2PVGC 1V97A 1GAQB 3AM9A 5G5GA 4N58A 2EKIA 1NENB 1RM6C 3AEGB 3P4RB 1N61A 1JROA 2W3SA 4YT0B 3W5VB 1N62A 3FC4A 1JWBD 3VRAB 1J7BA 3ZYYX 2MJDA 1QOFA 1I7HA 4N6EB 4JWUC 1FMAD 2ACZB 4YTNB 2W54A 2MJEA 5GXGB 4HRSA 4YXDB 3NVVA 1SF0A 1VDVA 1R7SA 1E9MA 1TJEA 1YQ3B 4YTMB 3AE5B 1FO4A 3ABVB 1FIQA 1OQRA 2H89B 4FXCA 3AE2B
chains in the Genus database with same CATH superfamily
2ZJAA 2XC9A 1UWXA 3M3JA 4DF4A 3GZNI 1D6EC 1QF6A 5ALWA 5DG9A 3BIID 4KX5A 1Y56A 4G11A 4QAYA 3CP8A 3PW5A 4FADA 4B9UA 4P1BC 3I57A 2D3AA 2KTFA 2C22A 5I4DA 9ICEA 4PGQA 3BVZA 2G5IB 2RMMA 4AJWA 4ECYA 3CIRB 1IM4A 3VUWA 2Z59B 3H1UA 2HHSA 2JMGA 2XY7A 2LBOA 1UA1A 2O6VA 4HVBA 3LXFA 7ICGA 2KIWA 2DAFA 3ZQ4A 3V61A 2CR5A 1PGAA 9ICKA 1NJWA 1RWSA 2A1AA 4M2YA 8ICVA 8ICGA 1FEHA 3DEEA 2G4SA 2QJLA 3KVFB 3TBLD 2AWTA 3A4SC 5CB1A 3QXGA 2QSDA 2WX0A 1WYWB 4F5RA 4I2GA 2QIEB 3P63A 1WYGA 5ALVA 4K4IA 1WRIA 1JMLA 1Z1VA 1U9LA 5CTRC 4P6VF 3IDWA 5GTIU 2FMPA 4DSJA 2HVIA 1OGWA 2KC2A 3V62A 5MPOA 4TUPA 2KYWA 4AYBC 5AI5A 3BQ2A 2ZIWB 1KF6B 5CX3A 4QZHA 1V8CA 2WDTB 1RDFA 5J0RA 3TKAA 4Y2XA 3M8SA 2AX5A 3ZJTA 2YVCA 4CHKA 3NGDA 8ICUA 3HVDA 3ISCA 4NQLB 4Y2RA 2X38A 4YXMA 4KVGB 5KFFA 1ET9A 1E7PB 2D10A 3HVZA 1COKA 3L54A 4WH4A 1WXMA 1Q3UA 4P4PA 2INCC 2IO2B 4KKIA 2MCNB 3H8SA 2DZIA 2KE7A 9ICRA 3AXCA 2XBBC 1ZQHA 4C56C 4PK1A 3SEIA 1OXJA 1WXAA 1HA5A 2BF8B 3L4PA 4Y2UA 1P7DA 1JX4A 3BWUD 1C3TA 5E79U 4HLEA 1CI4A 5KFKA 3WK7A 4FBTA 4YL8A 1T7PA 3UINB 3LK9A 7ICHA 4BOSC 1I42A 3KKAA 1CMXB 4OJLA 2FNJB 1RQLA 1NZBA 4MGZE 2W9CB 2UVUA 7ICTA 3T5JA 2OJRA 3DHGC 4NLBA 4F50A 2Y1JA 5J0YA 3RJFA 2KMAA 2MBEA 4ECUA 3FM9A 4Y2QA 2BYVE 3VRAB 1HIWA 4C8MA 4EELA 3C2MA 2HW3A 3V3XA 2W9BB 1QKZA 4QZ9A 4N6EB 3M9NB 1U4BA 1GB1A 1SL0A 3HIZA 2MBOA 1C77A 4OZAA 3NVVA 4K3CA 5D6JB 1BT0A 3AE5B 1FO4A 2WB1C 1EUVB 1V5OA 2H89B 2CHWA 4IQUA 3DBHB 1HTQA 4X57B 2LASA 2PPHA 2RDHA 4DOBA 2E1EA 2F1HA 5HHDG 4ANUA 1A5RA 3QU4A 1XEEA 1WE7A 4OJPA 4FJYA 1SE9A 3KHLA 3BK1A 2IHNA 1H4RA 3V6KA 5TZVA 1GJZA 1DGSA 3GE8C 4MHVA 2YY6A 4PH5A 1STEA 3CNHA 1KDHA 1JCKB 1V9JA 2RR9A 3Q3MC 1KW4A 5AM2A 2KMCA 1RAXA 1RXVA 2NRZA 4DSLA 1E7VA 3CYMA 1SV0A 2E8OA 4K7WA 1ZXIA 4TURA 1HE8A 1TBEA 2C7NB 3WKDA 4DOCA 4RQNA 1LM8B 2XN9C 4II2B 4LNKA 1RQNA 2KDFB 9ICTA 1S1QB 2WXLA 2KX0A 1GPXA 5EE0A 3R9KA 3KUZA 4YMMA 4IOIE 2I1JA 1EF5A 2KXJA 3IT6B 3AE7B 2XO7A 3ISDA 3Q6BA 2ZIUB 5EE1A 2WXFA 4UB2A 1WRDB 1ECWA 3V6JA 1ZQLA 2YEPF 3AB5A 1IBXB 5J0SA 4BXOB 4ECSA 4ZOHC 2P35A 4QIWC 2KT7A 1Q5WB 4QJFB 3TUOA 2LRUA 1VZ6A 4O5KA 9ICUA 2NV3A 1UT5A 5L1JA 1TFRA 5HNKA 3THVA 2ZIWA 1PFDA 1QZEA 3A9JB 1B9RA 3MTNB 3LDZE 3MJWA 3QZ7A 4DFPA 4MF8A 1RXWA 4M02A 4IQWA 2Q5WD 3QWZB 2NMQA 3TMPB 5KG1A 5J2JA 2WXRA 3B2FA 1NK6A 4YG2A 5J0WA 2RPQA 1CZPA 3KYCD 4KMUA 1X9MA 1PGBA 2Y1IA 3ZRFA 2K1FA 1MQ2A 2JXXA 4O3PA 5DKWA 2WAQC 2B76B 4M04A 3RFAA 3TEWA 2FUHB 1DRGA 1QLNA 2YMLA 2HDOA 2N7JA 2CXYA 4QZFA 1F2RI 3AU4A 3MC0B 1DOXA 2HE7A 3WANA 2GO7A 7ICQA 2K4IA 2ZPYA 2V9WA 4C8OA 1KEJA 2L0FA 3QX7A 3WKBA 1F77A 2J4XA 3QQ8B 4N58A 4U7CA 2V4RA 3PW2A 1AW7A 1FNUA 1L2NA 2BCVA 1Q8KA 4CO7A 1YIWA 4RGTA 2W9CA 1L7YA 1B0XA 2JZ3B 1JWUD 3I76A 5F3XB 3JPRA 4F7ZA 5EDSA 2BCSA 3ENEA 2N7DA 2W9BA 5FR6A 4O3NA 2K9XA 2BYTA 2LYAA 3ZD8A 3PR5B 1R4NB 2WX1A 2LVQA 3O65B 1N63A 5AM5A 4QZ8A 2JZBB 1Y8RC 3G6YA 5AUIA 4MH8A 4PHDA 3C29A 3Q3OC 3AE3B 3P42A 4L2YA 4P2HA 4O9MA 2K8CB 4TKNA 3RH5A 4KLTA 5LXIB 4C7ZA 2BYEA 1WSPA 1SJED 4G0NB 3WK8A 1F9JA 2KOBA 4RPZA 3BQTA 4BAXA 5DG8A 5JXVA 3WAMA 4ED2A 1SGHA 2K22A 4DLGA 2VKQA 3PMLA 4I29A 3Q8FA 3PO5A 3ZJVA 1NJZA 4ED3A 3KZIU 4I2HA 3BZKA 4ZRPA 3RJIA 3NZUA 1N5WA 3KUCB 2NRXA 2MSNA 4YMNA 1RYJA 1UUPA 3HKZF 1QSLA 4OZCA 2IJ0A 2DENB 3RRGA 3NRZA 4MEYA 1OEYA 3RYTA 1K52A 3PX0A 3QC8B 4DL5A 1EU3A 1WUDA 2VZKB 2Y5PA 2ZIUA 4YSXB 4DQQA 2M4NA 1S76D 3MR2A 1KRHA 3H40A 3RT3B 4F4WA 1VZ7A 4BXOA 2EMTA 3WK5A 2D3GA 3H0RB 4KLGA 4NAMA 5HR6A 5TR5A 2W11A 5AKKA 2D2QA 3LB8C 3VTVA 1KKXA 5AKJA 4A3OA 3M63B 2IBKA 1UBQA 3IFWB 4NJ8A 2MLBA 5D4BA 2N9XA 1XCQL 3A9JA 1KTQA 1ZQQA 2A5UA 2FPKA 1H8CA 2QLTA 2ESEA 4RQMA 3H8JA 1WCNA 4YCXA 4BGDA 1HUZA 2ZXIA 3RBEA 4REZA 3H6NA 2ASJA 3GIKA 1B43A 1TK8A 4EZLA 1NBFC 2KQ4X 2KKVA 5DBBA 2J53A 2K4EA 2EAOA 5ALNA 5EWGA 1SSNA 5KFJA 4LZDA 3SFEB 4KSKC 2KJ9A 4F5PA 1E7UA 8ICXA 1NI2A 3SU8X 3BDPA 4K4HA 4PGYA 2PVGC 3ZW3A 5KFYA 3V72A 3W5VB 4ANVA 1Q10A 2JH7A 4XDDA 3QHTA 2K8AA 3GV5B 2RP5A 3DBRB 2B3AA 4LNFA 4NY0A 5BYRA 4IM2A 4AYBF 2PKEA 4UAWA 2ACZB 2WF7A 3HT3A 1WY8A 1YQ3B 1E9MA 2NTTA 3GFKB 2KNJA 4UBBA 4B9VA 2WU2B 3AE2B 5AKGA 3J81j 2LHDA 5ALEA 3BK2A 5E6JA 1T94A 4CQNA 3PNCA 2EKEC 2F44A 4LJXA 2D6FC 7ICLA 4J9KA 2KQSA 4ICAA 4RQ7A 5AKYA 1RRBA 1ZQTA 2C60A 4JWSC 4RNAA 4EOYA 2DPJA 2QMTA 1ZETA 7ICJA 5IOIA 8ICIA 2FIDA 3ZNHB 1ZP0B 2KD0A 3U7ZA 4IS7A 4I6PA 1KOTA 5EE3A 2JZBA 1GC7A 4YD2A 3DBSA 3BZDB 3RNGC 2IA6A 1S10A 2JEJA 3QUQA 1V5TA 2ZCCA 3QX1A 3L0WB 4WJQA 3BQ7A 1SV4A 2K8CA 4GDKB 1I4QA 3VUYA 2V9HA 4GB9A 2IGGA 3EA6A 4K7SA 7ICOA 4DSKA 2V4QA 2KK0A 2W3RA 4A90A 4HXDA 5DB7A 1SV0C 1D5MC 3VR8B 3DVNV 4EBDA 3H0MB 4HPPA 5DG7A 2ZUBA 3R7RA 4II3B 5AM4A 1L6UA 3RUIB 4S17A 2W7PA 3VUXA 2DFLA 3L16A 5CA7A 1XSNA 2CHXA 5ALIA 4ZRIA 4G3XB 1ET6A 4KIKA 1L7OA 4YMOA 1VJ5A 2BB6A 3N1YC 2NPTB 4NQKE 2ZCBA 2BKFA 2WB1F 1JMSA 2ZZPB 3RB0A 2HJ1A 1E5WA 4NAWB 4XUSA 1C76A 3RBDA 1UF0A 4Z6CA 3OWEB 1KBUA 5GTHU 4Q44A 5KL1B 4KLSA 2RSUA 5IN7A 5BPCA 4DQIA 3PV8A 2YQEA 4ED6A 3B0XA 2QDFA 1WJNA 4MJSA 4S0RA 2FJ6A 5KHQA 3APCA 4JX1C 2J0JA 1SKSA 1QQRA 2O6KA 3LWLA 1UT8A 5J2HA 3Q8AA 4DQSA 2KQ7A 4QZAA 3A0HU 3QK0A 2DZMA 4WURA 3WALA 2KZRA 3HK0A 1C79A 2KDIA 4DFDA 2ZTDA 4QNLA 2F1JA 4F72A 3B1LX 4F4YA 1DOQA 2FMQA 7ICKA 3DVGX 5AZHA 5AHXA 2ZVNA 2MH7A 4IWOA 8ICPA 4OO1J 4W9DA 4LVSA 2CU1A 2VANA 4A3PA 2XGPA 1F0MA 1I4GA 3E9SA 4DF8A 3IM1A 3Q14C 3VTUA 1COOA 4E3CA 1M94A 1I4PA 4IQTA 2IO3B 4DSFA 4I2IA 1J19A 2WXMA 3RNAC 5IA7A 2N1VA 3W1SC 1L3UA 2INPE 1ZQXA 1XSLA 3Q8EA 2RRDA 2E8PA 1C78A 5KFPA 2MJDA 4GDLB 9ICQA 5DB6A 1SZPA 3KLSX 1K53A 2BGWA 3GDXA 1LVHA 4QIWF 1FMAD 2BGFA 2DQNB 3IV6A 4BVUC 4KX3A 1WZ3A 1VDVA 1C1YB 1ZQPA 9ICOA 1FIQA 3ZNID 3N20C 3HHMA 4M9NA 1WG8A 1E90A 3GZFA 1BGXT 4WWPA 5KFLA 1XLPA 2WXOA 2NTSA 3V05A 2KC1A 2LI5A 3OJ4B 5AK4A 2C5LC 3I1YA 1PGXA 2BS2B 1JUDA 3DBLB 2PIAA 1IIPA 4TQ1A 2R8JA 4PYUA 2ZIXB 2PKOA 3ZVVA 1D9FA 4C8NA 2KFKB 3HM6X 2M19A 3RH6A 3DQVA 4ICUA 1GOZA 3DDCB 4RQ2A 3LDAA 1JWAD 3S6JA 4M0WB 5KFWA 5J2AA 2AQ3B 5GMVA 2OWOA 2P6UA 4YR2A 2ZVOA 1DOIA 4JLCA 4DXAB 3PZ7A 4W9FA 1RYUA 4GDKA 4QWCA 4HYKA 1PDXA 1Z5SB 2J6UA 1ZDVA 2KN5A 4F5NA 3E0FA 2WXGA 3APDA 3F2DA 5KFCA 1I4XA 1PVRA 4ANWA 4DDID 3AQFA 4M6WA 1ZQOA 2ZTCA 2ES6A 3EC8A 2NO5A 1ISNA 1J8CA 4MACA 2R61A 2FMSA 2BT6A 4HKZE 4J9OA 1HZ5A 3Q8SB 2IY0B 2FCSA 3PVXA 4I2FA 3UF8A 4I2CA 4RM8A 1L8LA 5KFAA 2WP9B 1FD6A 3QE9Y 8ICYA 1WX8A 4ZRKA 2GLSA 1E8XA 2HDEA 2HTHA 3NZ3A 4DFKA 1LKYB 3AV8A 5F9NA 3EZ5A 2KMMA 2F3NA 1SEBD 1Z4OA 4NAWA 1IP9A 8ICHA 2RPVA 1T3NA 4LNIA 4WAFA 4MELA 3M95A 2DYMA 5J0QA 2JZZA 2JZPA 2Q0ZX 1V49A 1ZE3D 2IYDB 4ANXA 5HKHA 1TS2A 5KFTA 1RFKA 2XICA 3TI0A 4RF1A 3MP9A 4QZEA 1ZXHA 2KJ5A 3NUQA 5KG2A 1VLBA 2BZFA 3BS5B 4N59A 1TYGB 2V1YA 3ZTCA 5D49A 4M9LA 1ESFA 4C7YA 2WXHA 3LVWA 1LV5A 5AIBA 4GC7A 3RJKA 4UAZA 3DPDA 2UVWA 2VJ5A 1SE3A 3UIPB 1MHXA 4ZYNA 2MWSB 2JGAA 3BQ1A 2QILA 5DBAA 3NUHB 3GP7A 1T0YA 3SEBA 3OTQA 3FC4A 4ZH4A 2NRTA 4ECZA 2AJQA 4EZKA 3TFSA 3AU5A 1Z1BA 1L4DB 3VHTC 1K50A 1F5SA 3GQCA 1NK0A 5IIIA 2LXCA 4KLEA 1TZ1A 2L7RA 3O13A 2GOWA 2BWFA 1ZOYB 2I9GA 5ALLA 5JHBA 4M8MA 4DXFA 1ZQZA 4YVZA 4EBEA 2OH2A 2IOFK 2BPCA 3GIIA 3RPFC 3QARA 3T9LA 3N9YC 2RDIA 4O0IA 1T0QC 4B0EA 4B6JA 2JXTA 2XK5A 2LUEA 2RDGA 2MBBB 3ZXVA 2DX5B 1TS5A 4EZ9A 3Q3JA 1RG6A 2B0CA 4DFMA 5ALXA 4MEXA 5G55A 4I2AA 2DF4B 4IUMB 2N7EA 3BYYB 3MABA 8ICZA 3DHHC 4WWNA 4CF4A 5HHIA 5AIAA 4E0DA 1UGMA 4XYCA 2YMQA 4JPSA 3LVVA 2GBJA 4DHJD 4ZHOA 5DB8A 4I27A 2M0XA 4Q43A 1ZQBA 3RNCC 3ZIMA 4M01A 5L95C 1GG3A 2FUG1 4WJOA 4ELUA 1D3ZA 2XY5A 2A19A 4LJOB 1ZD3A 2KVRA 3PLVA 4HCNB 7ICSA 4ZRQA 1QOBA 2HBLA 3PR4A 2GB1A 4JWMA 1YN5A 2MSED 4HJGE 2PEAA 1ZJNA 4B9SA 3PHWB 4H2AA 3D2NA 4RGMA 1RPLA 2NVUI 2NRVA 5AUKA 2LHEA 2JRIB 4US9A 4J03A 3PO0A 4O3RA 4J3OD 4UB8U 4L1BA 3UIOB 1QLBB 1TE2A 2J7QB 2LHTA 2ZW0A 1BUIC 2ZPNA 3TEZA 3FILB 5AKHA 4OJ5A 1L4ZB 1X1MA 3KYDD 5KT3A 3WAOA 2AHOB 4P0PB 4UB4A 4B9NA 1VJKA 2K4PA 5DLGA 1LKYA 1SGGA 3RMKC 1PYWD 2IGHA 3RZFA 1BVSA 4HK2A 4GXJA 4FS1A 1CEZA 4OJOA 4DO9A 2J42A 3CSTA 2WNMA 1JXEA 4F8RA 5HR7A 1TGZB 2GMIC 2NR2A 3X23A 1J7CA 5JU5A 4XDCA 1BNOA 3NVYA 2HBKA 2BHNA 1ZQYA 2HHTA 2GBNA 2LMCA 5AEKB 3QEAZ 4MT5A 1N60A 5AKXA 3BS5A 2SEBD 3UMBA 1V80A 2V4IB 5E6PA 1GAQB 1UNSA 1TS3A 5KFUA 5DBCA 1S9FA 3C1ZA 2PE6B 3ISBA 4C4SA 9ICLA 2HCFA 4DK5A 4F5QA 4ACOA 1T8EA 3A4RA 4EENA 4NLGA 2IMWP 3QZ8A 5JZEB 4ZYSA 4YTMB 1R7SA 5AKLA 1WWUA 3WKEA 1NJXA 3AEVA 2INNE 1WX9A 3P1MA 1FNVA 1YMHE 1ZD5A 1QT9A 4JMUA 2BQRA 2V3NA 3PX4A 2ZEQA 1Q1OA 2BBCA 1AWDA 4UB3A 4FZMA 1ZQFA 3C0RB 2INDC 4CNQA 3ECIA 2NBVB 4ED1A 4MFCA 3PW4A 3U4EG 4FFDA 2QC8A 4Y2TA 2ZUCA 2PFNA 3V60A 2EZZA 1LB2B 3IXSA 2FDRA 1SXEA 4CGZA 9ICWA 1NVID 4HKQA 3WK9A 2BS4B 1J0GA 3ONNA 4DL4A 2LGXA 2PI4A 1K8RB 1NI3A 3AH7A 3MDCA 4KGRA 3Q8CA 4RPXA 3HRDD 5J2DA 1XT9B 2NO4A 1VD2A 2FLLA 1Z2MA 3RTVA 2K89A 2HOIA 1SJHD 3DOWA 3IVFA 4FULA 3QU9A 3MHZA 1RZTA 4LTUA 4C00A 4AUQC 1YN3A 5EE9A 2KKCA 1U4AA 2MA9B 3KWLA 3ZO5B 2PLPA 2QCZA 1JWSD 4EEWA 4QWAA 3TEXA 5DDMA 3UMCA 4U6PA 1UZXB 3DCGA 1WWTA 2HHVA 3V6EB 3EUB2 1TT5B 2AL6A 3GB1A 2KK8A 4LDTB 4B9MA 2W04A 2VRRB 1L7PA 3E2EA 4KLLA 3C28A 4NV0A 4USAA 1S97A 2XNAC 2BKEA 4FHJA 1KLUD 3CSFA 1SL2A 3N7RC 2WXIA 4K4GA 5KFBA 4DQPA 2KIVA 3VDZA 1FXAA 3VR9B 3C2KA 3PSPA 3DBHI 3B2GA 5AKEA 1L3VA 1FCCC 5CHWA 1QQ6A 3TQ1A 3NOBA 4LCDE 2FBWB 2M9NA 4XC2A 1URJA 1X6IA 2G09A 1F0ZA 2J6TA 1OFFA 1BPXA 4IM3A 4MSMB 3JPSA 2L52A 3R2TA 4P0PA 3EECA 4DL2A 3P2BA 3PZDA 5H8YE 1ZD4A 3SV3A 3N4MB 2J0KA 5D3IB 1AQ6A 1XSPA 8ICEA 5DQIA 3HW8A 4PYZA 2ASQA 2N9PC 3T3FA 5ALJA 4FO6A 2R2OA 1ZKHA 3P4RB 1FPYA 4F71A 4KGTA 5J0TA 1L3TA 1SWWA 3GV7B 1ZQMA 2VA8A 1TKDA 1C4PA 5H2FU 2LXAA 1YX5B 1V6EA 4MDKE 4C4RA 1X40A 4XQ8A 4BBNC 3MC9A 3AU2A 5ALHA 4DSIA 2L76A 2OCEA 2ISOA 2ZG6A 1D8YA 1L8OA 1MSWD 3PSTA 4Q2JA 4I6NB 2MRLA 1UD7A 4LNNA 4Y2JA 3W1SA 2D5GA 2P66A 5DGBA 2BDPA 2JX5A 5L1IA 2Q4TA 5TSSA 1JQ4A 2JYEA 3G6VA 3GS2A 3H7PB 5BO4B 2LM1A 2OM6A 3MHSD 2VJ4A 2UWQA 4F1SA 5CP2A 4YSYB 1WXSA 4KMOB 2JT4B 3ETRA 4QZCA 3VFKA 5AK5A 2YN4A 2L83A 2MUTB 3BVMA 1S0VA 1BPYA 1I4HA 2DUYA 5ALQA 4RQ0A 1NEKB 3SQIA 4UASA 2ONQA 1WWVA 5IIKA 5DLFA 1IYFA 4DL6A 3R8BA 3GIJA 2NRWA 4QZGA 1EWYC 2JYTA 8ICCA 4MSQB 1M4VA 4W9LA 1N2XA 2K60A 5KFIA 1VRAB 2NBWB 3VC8A 2O6VD 5HFYA 2YLMA 4Z6DA 3U30A 8ICTA 2W43A 5JHAA 4KLJA 2MEKA 2M0NA 5DQGA 2PVOD 5LNK1 4BFRA 5KHOA 2BVCA 7ICVA 4EEYA 2PI5A 3AMZA 1YX6B 2LEKA 2GI9A 4IRDA 2XGQA 3KH0A 3NVZA 1WGGA 2V0GA 1DK3A 3KQ4A 4Q45A 3B0AA 5DPRA 1KL9A 4WAAA 5J2KA 4OHJA 3M9MB 2LKYA 3EYZA 2BB5A 1J2NA 4F4KA 2KG5A 2FE9A 5J2CA 2D11A 4L23A 2C2DA 1R4NI 3Q8QB 4GXKA 3F2CA 3KUDB 3W5UB 4Y2PA 2HHWA 2K39A 4J9LA 4YXJA 3WU2U 1XS9D 8ICQA 2KMDA 2KDBA 3BVGA 1B1ZA 4F2RA 3Q8MA 1SE4A 2WF5A 1L5PA 5KT6A 5KFVA 1ZRNA 2MBHA 1WH3A 3ETLA 2MU2A 2WXKA 1FRRA 4Z6EA 1IBXA 1SBBB 5T14A 1QTMA 3FAHA 5DQHA 4ED7A 4JV0A 2B6GA 4HROA 5ALUA 1ZQNA 3UMGA 5J29A 2VA2A 1MPEA 5L9XA 3PHXB 4XZ4A 3JW0X 2UVVA 3DVGY 2BTEA 1J7BA 4QW8A 3V7KA 5ALSA 2ZJDA 3H7SA 3TARA 3JSVB 5AZFA 2VH2A 4JWUC 4ECWA 3HILA 2W54A 4BKSD 5CR0A 1SXTA 2KDEB 2I6XA 3N28A 3MFIA 3N30A 3T3OA 2W9MA 2JSVX 4YSZB 5C0YA 1DK2A 1A6SA 2FCQA 3I9V1 3R66C 4JE3B 3OHBA 1HZ6A 1TKYA 1SKRA 3AE9B 4ELVA 2FLNA 1QSSA 3M9OB 1S0OA 1D5XC 1NZPA 2PMZC 2ZXHA 2PXIA 2W8LA 1D9DA 1TIFA 2NBUA 2V4LA 3PT2B 3TADC 7ICUA 1Z3EB 1DYQA 4P0QB 4DEZA 3UQ2A 5T8IA 3KOOA 1ZQVA 2XCPA 4ECRA 3TAQA 2BQUA 5KFXA 4BWMA 2KN7A 2AU0A 1R4MB 3H7PA 4ASWC 2BPFA 2KNBA 2MRPA 1E8ZA 1SIJA 4J9MA 3H9DA 4HDOA 2LVOA 3ZDAA 2LGIA 2EH9A 5ALPA 4F93B 2CJNA 4JL9A 1WE6A 3IBEA 4PS8A 4E74A 4GLXA 1ZQUA 5KG6A 1YJIA 2MUTA 3QYPA 4UB6U 1OQQA 2L00B 5B5EU 4RU9A 3AEDB 3AI5A 4WWMA 2I2YA 1ZQRA 1PUZA 1L6VA 2H5XA 4FJVB 4F4XA 5KFSA 1S8OA 5AI8A 1WZ0A 1WJ6A 1TZOA 4UARA 4AP9A 2F76X 3OSNA 4WJ3B 2HTME 2X8XX 3WA0A 1B4FA 1QQ5A 3T3NA 5CWRA 1ENFA 1B22A 1UELA 2ATLA 2K25A 1HEKA 2K8HA 2Z0DB 4IDIA 4IG7B 5BMIA 3SFDB 4RGOS 4LLGM 3V6HA 3SMVA 4KSLC 4W9CA 2MW5A 1TV9A 2VA3A 4NJ7A 1MFWA 3DBRI 4M00A 2WWZA 3ICXA 5TISU 1I35A 3PW0A 5AK6A 1HEZE 1WM2A 4YD1A 4M9GA 2CKHB 1V38A 2KLCA 4JIOU 4N9F4 9ICBA 1BPDA 3NASA 4QWBA 5KL8B 3UXOA 2WHEA 1TKGA 2FAZA 4E71A 2IO1B 1V1OA 3Q2AC 4UATA 4DCCA 1QOGA 1KN5A 5FR3A 1L7MA 3KD3A 1TY0A 4CRXA 5CJ7A 1SKWA 2A3VA 4KLUA 2G9HD 2LUMA 2IY1B 4DQRA 2MA1A 2Y0SC 4M47A 4DBGA 4NNJB 2P6RA 4FBUA 2F8LA 3NS8A 3GV8B 3NG0A 3A0BU 3VH3B 2XVTA 4FBJB 1X66A 2PE9A 4EX6A 3MC8A 1MN8A 3UGBB 1C20A 5AI6A 4NLZA 4ZRJA 4I2BA 3ZNGC 2G08A 3GE3C 3S2AA 3AL0B 3IP4B 1QILA 5IILA 4EYHB 5KFHA 3BS7A 4A20A 3H4BA 1TTNA 4YT0B 1N62A 1KH0A 3GOEA 1F52A 4EFOA 3GU3A 4UB1A 2HOQA 4RUAA 3JPPA 2ASLA 1JRUA 3ZXRA 3TL5A 4OZBA 1Q3VA 3SI8A 3C8YA 2R2QA 2LMRA 1FCLA 2WF8A 3M62B 2KVCA 3JSVA 2DZJA 4PS3A 5KFRA 2JWZA 3PRPB 2LYBA 3ZRCA 2ZTEA 3D6JA 5HP4A 4FJZA 2HHQA 9ICMA 2Z0EB 2W9NA 1TS4A 5AKZA 2WTFA 1NKBA 1UCVA 2IO0B 2LFIA 2G0AA 1I4RA 2K6QA 2R8KA 2LGDA 3M6KA 4CF5A 4O3OA 1XO0A 1KFSA 1F1HA 3RNEC 4C4VB 5IKCM 4RT3A 4DL3A 1S5LU 4QZBA 5AM0A 1ZQEA 3N3KB 3PS6A 2K8BB 4RQ4A 2LYHA 3QAQA 4ECTA 4DOAA 4ITKA 1EU4A 3H8WA 3QUBA 3EFCA 3ONSA 5CHVC 4DHZE 2OXOA 4BZAA 3H4DA 3Q8KA 3BINA 3C23A 2PFPA 3Q8LA 2NYVA 3H0LB 3ZGZA 4QZIA 2F1IA 4EEKA 5J0XA 4DS4A 1CK1A 2AGPA 4PL1A 4NL9C 4R8UB 2H88B 4BBNF 4UB5A 4MH0E 4PZNA 4RH6A 1P7EA 1WR1A 2WAQF 2HVHA 2N4FA 1GUAB 1V85A 1V1PB 4GXIA 3LYYA 3B08A 3PRMB 2AL3A 2LPEA 4B0MA 2WDVB 4WJNA 4KDIC 3ZLZA 3DHIC 2CN1A 4BOZB 5KG7A 1D5ZC 4XRHA 4RQ1A 3C21A 4ECXA 5ALYA 4C0ZA 1L7NA 3BZCA 2JRZA 1X9XA 5G5HA 3BQ0A 3A9KB 1JRPA 2KX3A 2MBQA 3QCAA 4HWIB 3TCAA 5J18A 2BPGA 2G5HB 4LZGA 1Z00B 1FFUA 3HX0A 3PW7A 3P4SB 1HQRD 5AZGA 5J8YA 3N97B 4X5VA 2BW2A 1UA0A 3DBLI 3C1YA 4UBCA 3PPAA 4P4MA 5L1KA 2RGFA 3WCQA 3PZPA 4RM9A 9ICAA 4AJYB 2NPTA 3EFUA 3V6CB 2FCNA 3RB3A 4KV2A 3NZSA 4B9LA 3UXNA 2Z7JA 4PZOA 2EKIA 3AEGB 1OUQA 4XWTA 1MI0A 5D7GA 5LLIA 3ED5A 3N7PD 4JGHB 5KFNA 3ZDCA 4GN1A 3SZ2A 1N56A 3D2SA 4RNMA 1QOFA 3ZJUA 2KLGA 2E1FA 5BYQA 4IL6U 4RQ6A 4HRSA 3NRWA 1SF0A 1RYRA 2YMMA 2OEHA 2ZNVB 8ICAA 1OQRA 1ZPSA 4IRCA 1JXLA 3HJEA 2YX8A 1X9WA 4EUTA 4UAYA 1ZJMA 3VRBB 1CJEA 2DYOA 1AN8A 3VQIA 1KM7A 3I63C 3IHQB 1K1QA 2YB1A 3EW9A 2HOFA 3PO4A 1F2RC 1JWMD 4W9JA 3KFUF 4YR3A 3SDLC 2BCUA 4K7UA 3OAWA 4PHPA 3RJJA 1ZUD2 1FNWA 1WFYA 5C2TB 2KP7A 3W9CB 3PV1A 4R65A 5KTQA 4UDUC 2GOLA 1XWLA 1L0XB 2J0MA 3P4QB 1S77D 5AM1A 4TUSA 3OJSA 3ZDTA 5J2GA 2DBYA 4GDLA 1EM7A 5IINA 1GC6A 4C4VA 1TAMA 1FXIA 4WQMA 4KLDA 9ICVA 2EELA 1WI0A 3FKYA 1MJDA 5IO9A 5EWFA 1OW5A 3C5GA 5AM3A 2QEJC 2DYBA 1SXDA 3M8RA 5F9LA 1Z19A 2WF6A 4B9KA 2V3SA 3UQBA 1P3QU 2BQ3A 1NYQA 3RNBC 4AQ7A 4WWOA 4NJCA 3GZNB 3EWAA 4O3QA 4WQOB 4YN4A 3SR6A 3ZI4A 3Q3FA 3SD7A 3IHPC 3MJ5A 3C2LA 1SB3C 2ZIXA 4YFKA 4MGYE 2AYOB 2KFKA 2PTLA 2MX2A 4EE2A 3AE4B 2D3BA 1UPHA 1RFAA 3PSEB 2Y5BB 5LXHA 1ACCA 1V1PA 1WGYA 5DPWA 2XCAA 9ICPA 2F8KA 3LYSA 3MC1A 3MFGA 4M0WA 2PMZF 3ZDDA 2B21A 3VH4B 1MVKA 2L5YA 3AEAB 1DOYA 1Q46A 4CF3A 2QB1A 5J0OA 4FS2A 1ZW7A 1SIFA 3Q69A 3RI7C 3CF6E 1BPZA 3ORYA 4HPMB 4P1CC 1UHUA 3QU7A 3A9KA 1TK5A 1YT3A 2PFOA 3MR3A 4RFBA 4ZDVA 4ARCA 5AI9A 1EXNA 5ALTA 7ICFA 4UAUA 1Z00A 4NM1A 4M8NA 3PLUA 4IW0A 4I2DA 4TQSA 3QIJA 3WAPA 4DLEA 2E3TA 3PSIA 3NJTA 2G07A 1WJ4A 3X0WA 4KLQA 2LGYA 5IAAC 2HD5B 2AQ4A 3OLMD 2L1AA 1ZOLA 1L6NA 3PSFA 3KHGA 5ALMA 3MR5A 4JV2A 2IBIB 2ICIA 3ZYYX 2AGOA 1TAUA 7ICPA 8ICLA 4PT5A 2WXJA 5KFEA 3WKCA 1ZDXA 3C5FA 3HWTA 5BOMA 4TSSA 2XI9A 2XEWA 1TJEA 4BKGA 4NWIA 3EGRA 5J0PA 1F44A 1BXTA 4J6IA 4W9HA 2GBKA 4QWEA 2ZIVB 3RN9C 1J97A 3VXWA 4NPNA 1YQBA 5DPTA 3I5JC 3MBYA 3V7LA 1LXDA 5KT4A 1Q0WB 3L5KA 2ODGA 7ICNA 3OGUA 2D8CA 2BPSA 2BWES 2J52A 1FXTB 2EDUA 2MJ3A 5KG5A 3ZDEA 1WM3A 3L17A 9ICHA 4DDGD 1K1SA 4C8KA 1T3QA 2JV3A 3IAS1 1WJUA 2K3UA 3U7DA 4AP4C 5DDYA 2KV2A 4CCHA 3KZXA 2PFQA 2ZJ8A 2KOXA 2LJ5A 4KLMA 1PVQA 2M17A 4BDPA 2Y0SF 2WS3B 3I3TB 2M0AA 2LRWA 3TADA 5HG2A 2WYQA 4NY8A 4O3SA 5L1MA 4UAVA 2KHWB 3C19A 4KKJA 4NLKA 3P4PB 5D94A 4KN7A 2C28A 2KAJA 2NCNA 4HEA1 3PTFC 4R64A 2REXA 3Q8BA 2KZMA 4W9EA 2IGDA 3HPOA 1LQBA 1XO1A 1V86A 3R3MA 1K5OA 3HM3A 4K81A 1M6YA 1X6JA 1E8YA 4KTQA 3QA8A 1TY2A 3UXPA 3JPTA 2G4DB 8ICWA 2Z8LA 1ZQWA 4WJPA 1ROEA 1KFTA 4ACFA 3BJYA 5J17A 1WF9A 1OTRB 3T5LA 1HXYD 2EAPA 1XNSA 1IUEA 4BKSA 1NKCA 2KWVB 3VCBA 3WKAA 3UQ0A 3SENA 5KFDA 5DPSA 3R2IA 4DWFA 3IAM1 2KTQA 3RNFC 3PMNA 1V9PA 3RB4A 1KJTA 1MG8A 4DXGA 4Y2SA 3TANA 1NDDA 4GLSC 4ECQA 1UH6A 4P4OA 4IWQA 3RR8A 4PPXA 3L13A 1K51A 1PK3A 4M9HA 1PUTA 1XCTL 4W9KA 4GGQA 2DNFA 1ZQJA 1BPEA 5KG3A 5J2BA 4IC7B 2DZKA 2AQ1B 1O08A 1CQVA 4RQ3A 2JY6A 3TACB 2KFJA 2FPMA 2KTRB 2YEPB 2L0TA 1U47A 4CDGA 1L3SA 1AROP 3KHRA 5AICA 4B9TA 3O0FA 5C5JA 2N1RA 2RQ5A 1NNLA 2QARB 2CU3A 2HSZA 3NY5A 2IPKD 2QB0B 4MM3B 1XU4A 5J8YC 4ED8A 1XF5L 2E8MA 3ZTDA 3SAGA 1NENB 2ZJ5A 4F3OA 2JH1A 3IRUA 1WIAA 3RD2A 1PZNA 3OJ3A 3URYA 2CS4A 3W1YA 2FIFA 3FILA 4GXBA 2KWCA 3K1RB 1JN3A 2JU6X 4YTNB 5IIMA 5D46A 3K9OB 4MGIE 4TUQA 2IZVB 5D2MB 4BX9C 3FYHA 2M1MA 2EANA 1T6BX 2RLTA 3AEBB 2OJWA 3RFZB 4RZRA 4MF2A 4KITB 1J2MA 4O3MA 3AULA 4I28A 3F5AA 4O5CA 3AQEA 2SAKA 4TQRA 2WDRB 2ZIVA 1E0ZA 2BS3B 3Q8RB 4KZ0A 3QU2A 2LD9A 2MAXA 2GRIA 3AEEB 4YWGG 4A6QA 5KFQA 8ICMA 3MFHA 2JF5A 3W2DA 5JH5C 2W03A 1WGRA 2AH5A 4G9BA 3T79A 3U2SC 2J6SA 2K5PA 4RQ8A 4KX6B 1QH9A 4OJ6A 8ICNA 5B66U 2FPLA 2PW9A 1D8LA 4I2JA 3ZNZB 4KLHA 3D2QA 3DWMA 2KN4A 4XGAB 2PMVA 5FP0A 2KFZA 2LVPA 1V81A 4IR1A 2WLBA 1UQVA 3OG5A 3G6XA 4ED0A 4UQGA 2KJHB 5AKIA 4Y2YA 5BMGA 1U49A 1O03A 3IG8A 1AYFA 4F8CB 1D4BA 2WDQB 2V3PA 2WHIA 4R3DA 2GWSA 5ALZA 3T5HA 2ZUDA 2FCMA 1NKEA 4R63A 2KACA 4EKUA 4J9NA 1WMHB 3AE8B 3L10B 4WIPA 2H3QA 4NM2A 2N0SB 5HMLA 2BDUA 2Y3AA 1VZ8A 4GSWA 1UBIA 3LJ3A 2E8NA 3ZDBA 1LO5D 2DKXA 3KBBA 4F5OA 2G45B 3QJZA 1RYSA 1KLNA 4NL9A 3DVNU 2KKPA 5CHGA 4PGXA 2Y5CA 4PL2A 2KWDA 2LWPA 2CJOA 1S3SG 5KT5A 1ZQIA 4ECVA 2WXNA 4I6LB 4EBCA 2MHJA 4GOCA 2D3CA 4CE6A 3IT4B 1EWCA 2I38A 2WFAA 2R8GA 5KFGA 3GILA 3LWMA 4RF0A 2BCQA 3EHVA 1BNPA 2N9EB 1NK5A 4NXZA 2DLBA 2KTRA 1Y88A 1CRXA 4A9AA 3TAPA 1WXVA 4HJKA 5DB9A 1IG6A 4J9PA 3RJHA 1ZQSA 3T8MA 3K9PB 1E6EB 1XXGA 2WF9A 2MP2B 3E56A 2QARA 3JVZX 2L05A 4LNOA 3SV4A 1JROA 2W3SA 1T0RC 5FKAC 2QB0A 4MM3A 3JPOA 2LI6A 4K3BA 3UQAA 1OEYJ 5C1ZA 2W7OA 1QSYA 2IOFA 4J9SA 4W9IA 2EQYA 4DWIA 1NOMA 1T5XD 1PK1B 2L8JA 4FXCA 3HP6A 1S0MA 2E6XA 4DHJB 3N1XC 3RAQA 8ICOA 2EMSA 2RHFA 4ELTA 5EWEA 2KDMA 4KIKB 2G3QB 2KVSA 3SAFA 1YD8U 4Y2VA 5L83A 4RQ5A 2YMPA 1X42A 3IN5A 1X2IA 3TFRA 1T0SC 4LK0M 4EYIB 1G6JA 3RAXA 2WGSA 5JRTA 2AGQA 2DHZA 4RCOA 3SAHA 3IG5A 5JUMA 2OHFA 2JWUA 2LJIA 4RGNA 4GIBA 4KN4A 3UPQA 2ZNVC 3A33B 1L0YB 3EPIA 1JI7A 2OEDA 4KLOA 5KFZA 2R18A 5KG0A 3NS1A 4KLFA 3KW5B 8ICFA 3NTUA 2LGSA 3U26A 4MJSB 4RNOA 5CHFA 3PX6A 2W9AA 3RJEA 4M0AA 4JQWC 2JQRB 2MQJA 5ALOA 1ZQKA 2UYZB 2BR0A 1XO3A 3K4GA 1A70A 2JR5A 9ICSA 4QZDA 3RZWC 1X9SA 2KZZA 4OW0A 1N48A 1KTKA 4G3IA 4CYEA 4FN2A 3H8MA 3QUCA 4OD0A 1NJYA 3AE6B 5BOLA 3SYZA 1BPBA 1GNUA 2D07B 1ZQDA 1FFVA 2C7HA 4D2KA 4ARIA 1HUOA 5J2IA 4GFJA 4XWWA 2GBMA 3ZKJC 1C9FA 1L0VB 3TSSA 1WMHA 3RB6A 1JALA 4BWJA 2JRHA 1VR9A 3UI3A 1ZQGA 4IQVA 1Z4NA 4IKGA 3M7DA 5FK9C 1TK0A 1KQQA 2HHXA 3KKAC 2DGZA 1ZQAA 1TAQA 5JTIA 2L3ZA 2G06A 3VTWA 2KZ3A 2BQQA 3RRHA 5DGAA 2WXQA 3PREA 5KFMA 3SHQA 3ML8A 4FLHA 3RJGA 5C23A 4DSEA 1V2YA 4F92B 1LGRA 4J9QA 2N9KA 1NK7A 1EO6A 3NVWA 1U45A 1YOVB 1EF1A 4KZCA 2CHZA 1VCBA 2FI1A 3WK4A 4LJPB 1R4MI 4XE0A 4MGKE 2DAJA 3AM9A 5IIJA 3VAWA 1N61A 2DPIA 7ICMA 3N1ZC 2I1KA 1E8WA 4YR0A 2KJ6A 2K0PA 1P1AA 4JUZA 4PHAA 5BMHA 2UVRA 2MP2A 3M6ZA 2BKRB 2KEYA 5ALFA 3ZUNA 3F53A 3EPGA 2WXPA 3M1YA 3GIMA 2W82A 5C3JB 2I5HA 2KHQA 2NS5A 2K4HA 2YTUA 3PY8A 4JWNA 1ZRMA 4A8XC 1CUKA 4M6WB 2XIDA 1MG4A 3RCZA 1IV8A 2HMXA 1PK1A 1L5UA 1P7FA 2IDYA 9ICIA 2RDBC 2GH1A 4EX7A 2E5SA 3DWGC 4C80A 4YQWA 5E6NA 4EZ6A 4A8EA 3KHHA 1WGDA 4HCPB 2GBRA 5KT2A 3Q3NC 2KVZA 3APFA 3AN1A 2OOBB 3AUOA 5E6OA 3K75D 4J9RA 2VIXA 2W55A 2HHUA 2AEHA 3PGEA 2KD1A 5CRXA 5AI4A 4NZLB 4IC9A 4Q8FA 4IM0A 4K1RB 4JK1A 5HMMA 1N5XA 5CEHA 3A1QB 3DV9A 1KSPA 1FRDA 2OYYA 4RPYA 3L08A 3RULA 3B0YA 1YQ4B 3N32A 5D3DA 1KFYB 1H38A 4A55A 1JIHA 1XLNA 5DCNA 4F4ZA 9ICGA 1MHHE 2A4ZA 4C8LA 1NK9A 4MFFA 7ICRA 1XQQA 4NLNA 3OJUA 4M9JA 2GLEA 3ZD9A 5KT7A 1UWMA 5AK3A 4US8A 3Q8PB 3JPQA 2O2VB 3QEBZ 2ISPA 1S0NA 1KLVA 2AQ0A 1A76A 2CPRA 1ZGUB 9ICFA 4OVUA 4TMAB 2HI0A 4GC6A 4P0QA 2QKQA 5EOZA 3N7SC 2L32A 3PZ8A 4YTPB 4FE3A 3TJPA 2A1JB 3SD5A 2BYFA 1ED1A 2G1EA 4BUGA 4GU2A 3KTQA 1YJJA 5K4LA 2UU7A 3BY4B 3ZDMC 4OCZA 3H8HA 5KAFU 3J9CA 4HPLB 3HUIA 2DWQA 3T5KA 8ICRA 1RLFA 3ALRA 5ALDA 4B6WA 4TV3A 1XD3B 5HI1A 3BYTB 4GMVA 1TVAA 1QCKA 4ICVA 4RMAA 1A0PA 1ZQCA 2AQ2B 5HHHA 2KANA 4FZLA 2RD0A 3OSPA 1HJPA 2F77X 2N9LA 1UGJA 3CW2C 4URKA 3CRXA 4RUCA 2H3IA 1IGDA 1GB4A 1WX7A 4LDTD 3B9JA 4BJQA 3FDSA 9ICNA 4IR9A 2KSOB 2LZ6A 3K1ZA 4Z6FA 1YNTE 5J2FA 2XK5B 4FZNA 3U8ZA 5BYSA 2C2EA 2R8IA 4F91B 2FLPA 4RT2A 2JEIA 4P7IA 1OQYA 1WXQA 2R8HA 1A77A 1V97A 5G5GA 1C4AA 2H3ZA 2DL0A 4RNNA 2K6DB 2KJRA 5AI0A 9ICCA 4AS1A 2ALZA 1GO3F 8ICSA 2KJ8A 1I7HA 2W8KA 1SE2A 3MGVA 5GXGB 4QW9A 3KWVA 2QHOA 1P0RA 1WCLA 1SL1A 3MDAA 4UW9A 1ZD2P 1BMLC 2JUOA 4BKTA 2EAMA 1P98A 2F2AB 5IIOA 3MGHA 3JYUA 2PJHA 4AWJA 2HBMA 3DDHA 4HAIA 4QWDA 2TSSA 3ALBA 5H92C 3RR7A 5KAIU 2JEFA 2M56B 2IOHA 3JPNA 4KGSA 4MFAA 1YJ1A 2I1QA 9ICJA 1DGJA 5KG4A 1KLGD 2O6VB 1FEZA 2Y9TA 4DQOC 2KICA 4OVVA 1LFDA 2H3VA 1WR6E 5G2NA 3F5EA 4TQ0A 8ICBA 1C4CA 4MEMA 2AXTU 1C7YA 3V7JA 3MR6A 4PS7A 1ZYQA 1IXRA 4YP3A 3AE1B 3QUTA 1MQ3A 4F2SA 1D8BA 1IGCA 1XC9A 3NHEB 3E58A 3RF9A 2KWUB 3TIXA 1AARA 1ZQ1C 2WQYB 4B95A 2Y9UA 7ICEA 1WGHA 3PVLA 3UM9A 4DS5A 1YZ6A 1J7AA 2C9WB 1KRPA 2VH1A 3AECB 2KO3A 5KNIA 2CRXA 3QNMA 3A1QA 2KHVA 3QU5A 1PVPA 2JEGA 4Q8EA 5L1LA 2JPHA 1QQ7A 4GIVA 1TKEA 1YZ7A 2WU5B 3CMMB 3R7QA 4NJ6A 2D3DA 1HTOA 2HBJA 1YN4A 4PHEA 3VVWB 3F2BA 4JB3A 2JHDA 2O2VA 4PJ0U 4OVZA 3L3FX 2ON8A 4ZHPA 5J0UA 4DHZB 2C2RA 4O5EA 3CWIA 1P9DU 1XLOA 2H3FA 5ALRA 1IPGA 1NK4A 3TEYA 2DKZA 1NYRA 4W9GA 2A1JA 3WIMA 1MA7A 2K8BA 3MGIA 4XA5A 2BCRA 4DFJA 4KLIA 3H7IA 2IHMA 1XLQA 4TUUA 1T4GA 5A0LA 4EZJA 2EZXA 4FA6A 5J2EA 1SZHA 2FE8A 2EZYA 2N1WA 4C4TA 1SWVA 3IG3A 2ZW1A 5J2RA 2C7MB 5KFOA 1FM0D 2HJ8A 3WK6A 1WGKA 3OHAA 1KFDA 4G50A 1PQSA 1U48A 8ICKA 3OPXA 8ICJA 2KFNA 9ICXA 1QOAA 4R8UA 4DL7A 4NLCA 3AEFB 1E10A 5ALGA 2JVCA 3I28A 4AOFA 3AU6A 4FHKA 1N6ZA 4JV1A 3ML9A 2JXJA 1JW9D 3HKZC 4HDQA 2KSOA 4I2EA 4KDLB 1RM6C 4P16A 5ALKA 1MC8A 1JWBD 2RDJA 4XX5A 2ASDA 3RH4A 7ICIA 3D32A 5IP4D 4IWPA 3U52E 2XY6A 1DXSA 2MJEA 2YB4A 4R66A 4IRKA 2M8SA 2LM4A 4YXDB 3PRZA 2VZKD 3ABVB 4O1NA 1NK8A
chains in the Genus database with same CATH topology
1T6BX 1UWXA 3AEBB 2JSVX 4YSZB 3RFZB 1XLPA 1D6EC 3I9V1 2WXOA 2NTSA 1QF6A 3BIID 4JE3B 1Y56A 1HZ6A 3V05A 1TKYA 3I57A 5I4DA 3AE9B 1D5XC 2SAKA 2WDRB 1E0ZA 1PGXA 2BS3B 2BS2B 3BVZA 2RMMA 2GRIA 1DYQA 3AEEB 4YWGG 2PIAA 4A6QA 4TQ1A 3CIRB 2PKOA 5T8IA 3W2DA 2M19A 3LXFA 1GOZA 3U2SC 3ZQ4A 3T3OA 2K5PA 4KX6B 1SIJA 1JWAD 1PGAA 1RWSA 2AQ3B 1FEHA 2PW9A 2LGIA 2CJNA 2QJLA 1DOIA 3DWMA 2KN4A 2PMVA 3PZ7A 1YJIA 1OQQA 2QSDA 1PDXA 3AEDB 2QIEB 3P63A 1WYGA 1ZDVA 2WLBA 1WRIA 2WXGA 4WWMA 2I2YA 1L6VA 1JMLA 4P6VF 1I4XA 5BMGA 1TZOA 2HTME 1AYFA 1D4BA 5MPOA 2WDQB 2V3PA 4MACA 2R61A 4R3DA 2BT6A 4HKZE 3T3NA 1ENFA 1HZ5A 1KF6B 5BMIA 4IDIA 1V8CA 3SFDB 2KACA 4RGOS 4LLGM 2AX5A 3ZJTA 2WP9B 3AE8B 4WIPA 1FD6A 2N0SB 2Y3AA 1VZ8A 3HVDA 1HEZE 1LO5D 2HDEA 2X38A 3NZ3A 1ET9A 1E7PB 3AV8A 3HVZA 2KMMA 1SEBD 4WH4A 4KKIA 2RPVA 2Y5CA 2KWDA 4WAFA 2CJOA 1TKGA 2DYMA 2JZPA 1V1OA 1ZE3D 2WXNA 4C56C 1QOGA 5FR3A 1TS2A 1TY0A 1HA5A 2G9HD 3L4PA 1RFKA 2LUMA 3IT4B 4RF1A 1EWCA 3MP9A 2I38A 1ZXHA 3BWUD 1VLBA 4N59A 1TYGB 4RF0A 1ESFA 4C7YA 2DLBA 2WXHA 4A9AA 1E6EB 1XXGA 1SE3A 3E56A 1MHXA 1QILA 2QILA 1JROA 3NUHB 2W3SA 3GP7A 4YT0B 3SEBA 5FKAC 1N62A 1KH0A 3FC4A 3VRAB 3V3XA 1QKZA 4N6EB 1GB1A 1C77A 1L4DB 1K50A 4OZAA 3NVVA 4OZBA 1T5XD 3AE5B 1FO4A 3C8YA 2H89B 4FXCA 3O13A 2E6XA 1FCLA 1ZOYB 4DXFA 2RDHA 5HHDG 1XEEA 2KDMA 3BK1A 3RPFC 3N9YC 4LK0M 4B0EA 1TS4A 2JXTA 1STEA 1JCKB 4RCOA 2RDGA 2JWUA 2LFIA 2LJIA 2OHFA 4RGNA 1I4RA 1TS5A 1L0YB 2OEDA 1ZXIA 3NS1A 2XN9C 3BYYB 2WXLA 4ITKA 1EU4A 4JPSA 2JQRB 1GPXA 4ZHOA 5EE0A 4IOIE 2FUG1 3IT6B 3AE7B 1XO3A 1A70A 4ZRQA 5EE1A 3ZGZA 1QOBA 2WXFA 1KTKA 4OW0A 1CK1A 2GB1A 1YN5A 4HJGE 2YEPF 1IBXB 3AB5A 4H2AA 4RGMA 2H88B 4ZOHC 3AE6B 5AUKA 4RH6A 1P7EA 1FFVA 2LHEA 4D2KA 4US9A 1V1PB 4ARIA 3LYYA 3TUOA 4B0MA 1VZ6A 3PO0A 2WDVB 4J3OD 1PFDA 4XWWA 1B9RA 4L1BA 1QLBB 1D5ZC 1C9FA 1L0VB 2ZW0A 1BUIC 3TSSA 3TEZA 1JALA 2Q5WD 3FILB 1VR9A 1L4ZB 3UI3A 2NMQA 5G5HA 4IKGA 2WXRA 5FK9C 3B2FA 1JRPA 1VJKA 1CZPA 1PGBA 1PYWD 1FFUA 2IGHA 3P4SB 1HQRD 2WXQA 2B76B 2J42A 2WNMA 2BW2A 3TEWA 1J7CA 2N9KA 4XDCA 2N7JA 3NVYA 3NVWA 1F2RI 3WCQA 2LMCA 3MC0B 1DOXA 4MT5A 1N60A 4XE0A 2SEBD 2V4IB 1GAQB 3AM9A 1F77A 1UNSA 2J4XA 4N58A 2EKIA 3AEGB 1TS3A 1N61A 4XWTA 1AW7A 1FNUA 1MI0A 5D7GA 4RGTA 2K0PA 5BMHA 1QOFA 1JWUD 3ZJUA 5BYQA 4HRSA 4ZYSA 1SF0A 2WXPA 1R7SA 4YTMB 2W82A 5C3JB 1OQRA 1ZPSA 2INNE 2K9XA 2BYTA 4A8XC 3P1MA 1N63A 1FNVA 1YMHE 1QT9A 2V3NA 3IXSA 1P7FA 2IDYA 1CJEA 3DWGC 2DYOA 3VRBB 5AUIA 1AN8A 3VQIA 4C80A 2BBCA 4MH8A 1AWDA 1F2RC 1JWMD 3AE3B 3P42A 4L2YA 3AN1A 4C7ZA 3U4EG 1WSPA 1ZUD2 1FNWA 1SJED 5C2TB 3W9CB 1NVID 2W55A 4UDUC 5JXVA 4HKQA 3P4QB 1L0XB 2K22A 2BS4B 3Q8FA 2DBYA 3AH7A 4KGRA 1NI3A 4NZLB 3ZJVA 3Q8CA 1N5XA 1EM7A 3HRDD 1FRDA 1FXIA 4WQMA 2EELA 4ZRPA 1YQ4B 1N5WA 1SJHD 2QEJC 1KFYB 5D3DA 4A55A 3MHZA 1XLNA 4LTUA 1RYJA 1UUPA 1YN3A 5EE9A 1MHHE 2IJ0A 4OZCA 3KWLA 2PLPA 3NRZA 1JWSD 3TEXA 1NYQA 4AQ7A 1K52A 1UWMA 1WWTA 4NJCA 1EU3A 3EUB2 4US8A 2VZKB 3GB1A 3SR6A 2Y5PA 4TMAB 4YSXB 3MJ5A 1SB3C 1KRHA 2L32A 3PZ8A 4YTPB 4USAA 2PTLA 1VZ7A 4EE2A 2G1EA 2XNAC 3AE4B 4NAMA 1YJJA 1KLUD 3H8HA 3LB8C 1ACCA 1V1PA 2WXIA 3J9CA 3HUIA 3MFGA 2DWQA 4M0WA 1FXAA 1XCQL 3VR9B 1MVKA 5HI1A 3B2GA 3AEAB 3BYTB 1FCCC 1DOYA 2AQ2B 2FBWB 3Q69A 4REZA 1F0ZA 1OFFA 2N9LA 1UGJA 2L52A 3R2TA 4RFBA 4ARCA 2KQ4X 1IGDA 1GB4A 5H8YE 2J53A 3B9JA 1SSNA 3SFEB 1YNTE 5D3IB 5BYSA 2E3TA 1WXQA 2PVGC 1V97A 2L1AA 5G5GA 3P4RB 4KGTA 1C4AA 3W5VB 1Q10A 2ICIA 4XDDA 3ZYYX 1C4PA 5BYRA 4AS1A 4PT5A 1I7HA 2WXJA 1SE2A 1ZDXA 2ACZB 5GXGB 4TSSA 3KWVA 1TJEA 1YQ3B 1E9MA 2NTTA 3EGRA 4Q2JA 1BXTA 2WU2B 3AE2B 1BMLC 2LHDA 3W1SA 2D5GA 3BK2A 5E6JA 4CQNA 2JX5A 2TSSA 5H92C 2M56B 5TSSA 1JQ4A 4KGSA 2MJ3A 2J52A 2JYEA 1DGJA 1KLGD 4JWSC 4DQOC 4RNAA 3GS2A 2QMTA 4TQ0A 1T3QA 3IAS1 1ZP0B 1C4CA 3U7ZA 2K3UA 5EE3A 4YSYB 3BZDB 3AE1B 3ETRA 1IGCA 2WS3B 2L83A 4GDKB 1I4QA 2M0AA 3BVMA 2IGGA 3EA6A 1I4HA 5HG2A 1NEKB 2WQYB 2ONQA 4KKJA 3P4PB 2KAJA 2W3RA 4HEA1 4A90A 3Q8BA 3R8BA 1J7AA 1D5MC 1EWYC 3AECB 3VR8B 2IGDA 2JYTA 1M4VA 1L6UA 1TY2A 1VRAB 1TKEA 2WU5B 5HFYA 2Z8LA 1ET6A 1ROEA 2BB6A 2MEKA 2PVOD 1HXYD 1YN4A 5LNK1 1IUEA 3AMZA 2LEKA 2GI9A 4ZHPA 3R2IA 4NAWB 1C76A 2ON8A 3IAM1 4OVZA 3NVZA 3CWIA 3OWEB 4DXGA 2V0GA 1XLOA 3KQ4A 4GLSC 3TEYA 1NYRA 4OHJA 2BB5A 1K51A 1PUTA 1XCTL 4JX1C 1QQRA 4L23A 3Q8AA 1XLQA 3W5UB 2FE8A 2AQ1B 1CQVA 4WURA 2ZW1A 3BVGA 1B1ZA 2YEPB 1C79A 1FM0D 1SE4A 1L5PA 1WGKA 2WXKA 1FRRA 2MH7A 1IBXA 1QOAA 1SBBB 2CU3A 3FAHA 2IPKD 3AEFB 1E10A 1I4GA 4MM3B 3E9SA 4HROA 1JW9D 1XF5L 1I4PA 1MPEA 2WXMA 1NENB 1RM6C 4P16A 2INPE 1JWBD 3Q8EA 3URYA 2BTEA 1J7BA 1C78A 2MJDA 4GDLB 3FILA 3KLSX 3U52E 1K53A 4JWUC 2JU6X 1FMAD 4YTNB 2W54A 2MJEA 4YXDB 1VDVA 1SXTA 2VZKD 3ABVB 1FIQA 4O1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY B;  3AEB B;  2WU2 B;  2K9X A;  4YSZ B;  1XLP A;  1QF6 A;  2JX5 A;  3BII D;  3P1M A;  1N63 A;  5H92 C;  1QT9 A;  2M56 B;  1TKY A;  3VRB B;  3DWG C;  1CJE A;  1JQ4 A;  2MJ3 A;  3AE9 B;  5AUI A;  4C80 A;  2WDR B;  1E0Z A;  1DGJ A;  2BS3 B;  2BS2 B;  1AWD A;  3RPF C;  4JWS C;  3AE3 B;  3AEE B;  2PIA A;  1T3Q A;  3CIR B;  1ZP0 B;  2PKO A;  3VR8 B;  2OHF A;  3AN1 A;  5EE3 A;  4C7Z A;  4YSY B;  1ZUD 2;  5C2T B;  3AE1 B;  2M19 A;  3LXF A;  3W9C B;  1NVI D;  2W55 A;  3ETR A;  1ZXI A;  3P4Q B;  2WS3 B;  2K22 A;  2BS4 B;  2K5P A;  2L83 A;  3NS1 A;  4KX6 B;  1SIJ A;  1JWA D;  2DBY A;  1RWS A;  3AH7 A;  1NI3 A;  1N5X A;  1NEK B;  2WQY B;  3HRD D;  2CJN A;  2QJL A;  1FRD A;  1DOI A;  1FXI A;  3DWM A;  4ITK A;  4WQM A;  3P4P B;  2JQR B;  2KAJ A;  2W3R A;  4ZHO A;  1YJI A;  5EE0 A;  1OQQ A;  5C3J B;  1GPX A;  1PDX A;  1YQ4 B;  3AED B;  1N5W A;  1J7A A;  1EWY C;  1KFY B;  2QIE B;  1WYG A;  2WLB A;  3AEC B;  1XLN A;  3P63 A;  1RYJ A;  1WRI A;  1XO3 A;  3AE7 B;  1A70 A;  1L6V A;  4LTU A;  4WWM A;  5EE9 A;  4P6V F;  3KWL A;  1L6U A;  5EE1 A;  3NRZ A;  1QOB A;  2HTM E;  1NYQ A;  1TKE A;  1AYF A;  2WU5 B;  5MPO A;  2WDQ B;  1UWM A;  1WWT A;  3EUB 2;  4US8 A;  2BT6 A;  1ROE A;  3AB5 A;  1KF6 B;  2H88 B;  4ZOH C;  3SR6 A;  3AE6 B;  4IDI A;  1V8C A;  5AUK A;  3SFD B;  4YSX B;  2PVO D;  1FFV A;  1SB3 C;  1IUE A;  4US9 A;  2AX5 A;  1KRH A;  3AMZ A;  2WP9 B;  2LEK A;  3AE8 B;  2N0S B;  2WDV B;  4USA A;  3PO0 A;  4YTP B;  4ZHP A;  1PFD A;  2G1E A;  3AE4 B;  1B9R A;  3NVZ A;  1YJJ A;  1QLB B;  3CWI A;  3LB8 C;  1XLO A;  1L0V B;  1E7P B;  3AV8 A;  3HVZ A;  3HUI A;  1JAL A;  2Q5W D;  2DWQ A;  1NYR A;  2KMM A;  1FXA A;  5G5H A;  3VR9 B;  2Y5C A;  4JX1 C;  1PUT A;  3B2F A;  1JRP A;  3AEA B;  3B2G A;  2CJO A;  1TKG A;  1DOY A;  1VJK A;  1CZP A;  1XLQ A;  1QOG A;  2FBW B;  1FFU A;  3P4S B;  3W5U B;  1F0Z A;  1OFF A;  3L4P A;  1RFK A;  2B76 B;  2L52 A;  1FM0 D;  1L5P A;  1WGK A;  1J7C A;  1VLB A;  5H8Y E;  3B9J A;  4N59 A;  1TYG B;  1FRR A;  2MH7 A;  3NVY A;  1QOA A;  2CU3 A;  3NVW A;  3WCQ A;  4C7Y A;  3SFE B;  3FAH A;  4A9A A;  3AEF B;  1DOX A;  2E3T A;  1E10 A;  1N60 A;  4HRO A;  1JW9 D;  1WXQ A;  1E6E B;  2PVG C;  1V97 A;  1GAQ B;  3AM9 A;  5G5G A;  4N58 A;  2EKI A;  1NEN B;  1RM6 C;  3AEG B;  3P4R B;  1N61 A;  1JRO A;  2W3S A;  4YT0 B;  3W5V B;  1N62 A;  3FC4 A;  1JWB D;  3VRA B;  1J7B A;  3ZYY X;  2MJD A;  1QOF A;  1I7H A;  4N6E B;  4JWU C;  1FMA D;  2ACZ B;  4YTN B;  2W54 A;  2MJE A;  5GXG B;  4HRS A;  4YXD B;  3NVV A;  1SF0 A;  1VDV A;  1R7S A;  1E9M A;  1TJE A;  1YQ3 B;  4YTM B;  3AE5 B;  1FO4 A;  3ABV B;  1FIQ A;  1OQR A;  2H89 B;  4FXC A;  3AE2 B; 
#chains in the Genus database with same CATH topology
 2ZJA A;  2XC9 A;  1UWX A;  3M3J A;  4DF4 A;  3GZN I;  1D6E C;  1QF6 A;  5ALW A;  5DG9 A;  3BII D;  4KX5 A;  1Y56 A;  4G11 A;  4QAY A;  3CP8 A;  3PW5 A;  4FAD A;  4B9U A;  4P1B C;  3I57 A;  2D3A A;  2KTF A;  2C22 A;  5I4D A;  9ICE A;  4PGQ A;  3BVZ A;  2G5I B;  2RMM A;  4AJW A;  4ECY A;  3CIR B;  1IM4 A;  3VUW A;  2Z59 B;  3H1U A;  2HHS A;  2JMG A;  2XY7 A;  2LBO A;  1UA1 A;  2O6V A;  4HVB A;  3LXF A;  7ICG A;  2KIW A;  2DAF A;  3ZQ4 A;  3V61 A;  2CR5 A;  1PGA A;  9ICK A;  1NJW A;  1RWS A;  2A1A A;  4M2Y A;  8ICV A;  8ICG A;  1FEH A;  3DEE A;  2G4S A;  2QJL A;  3KVF B;  3TBL D;  2AWT A;  3A4S C;  5CB1 A;  3QXG A;  2QSD A;  2WX0 A;  1WYW B;  4F5R A;  4I2G A;  2QIE B;  3P63 A;  1WYG A;  5ALV A;  4K4I A;  1WRI A;  1JML A;  1Z1V A;  1U9L A;  5CTR C;  4P6V F;  3IDW A;  5GTI U;  2FMP A;  4DSJ A;  2HVI A;  1OGW A;  2KC2 A;  3V62 A;  5MPO A;  4TUP A;  2KYW A;  4AYB C;  5AI5 A;  3BQ2 A;  2ZIW B;  1KF6 B;  5CX3 A;  4QZH A;  1V8C A;  2WDT B;  1RDF A;  5J0R A;  3TKA A;  4Y2X A;  3M8S A;  2AX5 A;  3ZJT A;  2YVC A;  4CHK A;  3NGD A;  8ICU A;  3HVD A;  3ISC A;  4NQL B;  4Y2R A;  2X38 A;  4YXM A;  4KVG B;  5KFF A;  1ET9 A;  1E7P B;  2D10 A;  3HVZ A;  1COK A;  3L54 A;  4WH4 A;  1WXM A;  1Q3U A;  4P4P A;  2INC C;  2IO2 B;  4KKI A;  2MCN B;  3H8S A;  2DZI A;  2KE7 A;  9ICR A;  3AXC A;  2XBB C;  1ZQH A;  4C56 C;  4PK1 A;  3SEI A;  1OXJ A;  1WXA A;  1HA5 A;  2BF8 B;  3L4P A;  4Y2U A;  1P7D A;  1JX4 A;  3BWU D;  1C3T A;  5E79 U;  4HLE A;  1CI4 A;  5KFK A;  3WK7 A;  4FBT A;  4YL8 A;  1T7P A;  3UIN B;  3LK9 A;  7ICH A;  4BOS C;  1I42 A;  3KKA A;  1CMX B;  4OJL A;  2FNJ B;  1RQL A;  1NZB A;  4MGZ E;  2W9C B;  2UVU A;  7ICT A;  3T5J A;  2OJR A;  3DHG C;  4NLB A;  4F50 A;  2Y1J A;  5J0Y A;  3RJF A;  2KMA A;  2MBE A;  4ECU A;  3FM9 A;  4Y2Q A;  2BYV E;  3VRA B;  1HIW A;  4C8M A;  4EEL A;  3C2M A;  2HW3 A;  3V3X A;  2W9B B;  1QKZ A;  4QZ9 A;  4N6E B;  3M9N B;  1U4B A;  1GB1 A;  1SL0 A;  3HIZ A;  2MBO A;  1C77 A;  4OZA A;  3NVV A;  4K3C A;  5D6J B;  1BT0 A;  3AE5 B;  1FO4 A;  2WB1 C;  1EUV B;  1V5O A;  2H89 B;  2CHW A;  4IQU A;  3DBH B;  1HTQ A;  4X57 B;  2LAS A;  2PPH A;  2RDH A;  4DOB A;  2E1E A;  2F1H A;  5HHD G;  4ANU A;  1A5R A;  3QU4 A;  1XEE A;  1WE7 A;  4OJP A;  4FJY A;  1SE9 A;  3KHL A;  3BK1 A;  2IHN A;  1H4R A;  3V6K A;  5TZV A;  1GJZ A;  1DGS A;  3GE8 C;  4MHV A;  2YY6 A;  4PH5 A;  1STE A;  3CNH A;  1KDH A;  1JCK B;  1V9J A;  2RR9 A;  3Q3M C;  1KW4 A;  5AM2 A;  2KMC A;  1RAX A;  1RXV A;  2NRZ A;  4DSL A;  1E7V A;  3CYM A;  1SV0 A;  2E8O A;  4K7W A;  1ZXI A;  4TUR A;  1HE8 A;  1TBE A;  2C7N B;  3WKD A;  4DOC A;  4RQN A;  1LM8 B;  2XN9 C;  4II2 B;  4LNK A;  1RQN A;  2KDF B;  9ICT A;  1S1Q B;  2WXL A;  2KX0 A;  1GPX A;  5EE0 A;  3R9K A;  3KUZ A;  4YMM A;  4IOI E;  2I1J A;  1EF5 A;  2KXJ A;  3IT6 B;  3AE7 B;  2XO7 A;  3ISD A;  3Q6B A;  2ZIU B;  5EE1 A;  2WXF A;  4UB2 A;  1WRD B;  1ECW A;  3V6J A;  1ZQL A;  2YEP F;  3AB5 A;  1IBX B;  5J0S A;  4BXO B;  4ECS A;  4ZOH C;  2P35 A;  4QIW C;  2KT7 A;  1Q5W B;  4QJF B;  3TUO A;  2LRU A;  1VZ6 A;  4O5K A;  9ICU A;  2NV3 A;  1UT5 A;  5L1J A;  1TFR A;  5HNK A;  3THV A;  2ZIW A;  1PFD A;  1QZE A;  3A9J B;  1B9R A;  3MTN B;  3LDZ E;  3MJW A;  3QZ7 A;  4DFP A;  4MF8 A;  1RXW A;  4M02 A;  4IQW A;  2Q5W D;  3QWZ B;  2NMQ A;  3TMP B;  5KG1 A;  5J2J A;  2WXR A;  3B2F A;  1NK6 A;  4YG2 A;  5J0W A;  2RPQ A;  1CZP A;  3KYC D;  4KMU A;  1X9M A;  1PGB A;  2Y1I A;  3ZRF A;  2K1F A;  1MQ2 A;  2JXX A;  4O3P A;  5DKW A;  2WAQ C;  2B76 B;  4M04 A;  3RFA A;  3TEW A;  2FUH B;  1DRG A;  1QLN A;  2YML A;  2HDO A;  2N7J A;  2CXY A;  4QZF A;  1F2R I;  3AU4 A;  3MC0 B;  1DOX A;  2HE7 A;  3WAN A;  2GO7 A;  7ICQ A;  2K4I A;  2ZPY A;  2V9W A;  4C8O A;  1KEJ A;  2L0F A;  3QX7 A;  3WKB A;  1F77 A;  2J4X A;  3QQ8 B;  4N58 A;  4U7C A;  2V4R A;  3PW2 A;  1AW7 A;  1FNU A;  1L2N A;  2BCV A;  1Q8K A;  4CO7 A;  1YIW A;  4RGT A;  2W9C A;  1L7Y A;  1B0X A;  2JZ3 B;  1JWU D;  3I76 A;  5F3X B;  3JPR A;  4F7Z A;  5EDS A;  2BCS A;  3ENE A;  2N7D A;  2W9B A;  5FR6 A;  4O3N A;  2K9X A;  2BYT A;  2LYA A;  3ZD8 A;  3PR5 B;  1R4N B;  2WX1 A;  2LVQ A;  3O65 B;  1N63 A;  5AM5 A;  4QZ8 A;  2JZB B;  1Y8R C;  3G6Y A;  5AUI A;  4MH8 A;  4PHD A;  3C29 A;  3Q3O C;  3AE3 B;  3P42 A;  4L2Y A;  4P2H A;  4O9M A;  2K8C B;  4TKN A;  3RH5 A;  4KLT A;  5LXI B;  4C7Z A;  2BYE A;  1WSP A;  1SJE D;  4G0N B;  3WK8 A;  1F9J A;  2KOB A;  4RPZ A;  3BQT A;  4BAX A;  5DG8 A;  5JXV A;  3WAM A;  4ED2 A;  1SGH A;  2K22 A;  4DLG A;  2VKQ A;  3PML A;  4I29 A;  3Q8F A;  3PO5 A;  3ZJV A;  1NJZ A;  4ED3 A;  3KZI U;  4I2H A;  3BZK A;  4ZRP A;  3RJI A;  3NZU A;  1N5W A;  3KUC B;  2NRX A;  2MSN A;  4YMN A;  1RYJ A;  1UUP A;  3HKZ F;  1QSL A;  4OZC A;  2IJ0 A;  2DEN B;  3RRG A;  3NRZ A;  4MEY A;  1OEY A;  3RYT A;  1K52 A;  3PX0 A;  3QC8 B;  4DL5 A;  1EU3 A;  1WUD A;  2VZK B;  2Y5P A;  2ZIU A;  4YSX B;  4DQQ A;  2M4N A;  1S76 D;  3MR2 A;  1KRH A;  3H40 A;  3RT3 B;  4F4W A;  1VZ7 A;  4BXO A;  2EMT A;  3WK5 A;  2D3G A;  3H0R B;  4KLG A;  4NAM A;  5HR6 A;  5TR5 A;  2W11 A;  5AKK A;  2D2Q A;  3LB8 C;  3VTV A;  1KKX A;  5AKJ A;  4A3O A;  3M63 B;  2IBK A;  1UBQ A;  3IFW B;  4NJ8 A;  2MLB A;  5D4B A;  2N9X A;  1XCQ L;  3A9J A;  1KTQ A;  1ZQQ A;  2A5U A;  2FPK A;  1H8C A;  2QLT A;  2ESE A;  4RQM A;  3H8J A;  1WCN A;  4YCX A;  4BGD A;  1HUZ A;  2ZXI A;  3RBE A;  4REZ A;  3H6N A;  2ASJ A;  3GIK A;  1B43 A;  1TK8 A;  4EZL A;  1NBF C;  2KQ4 X;  2KKV A;  5DBB A;  2J53 A;  2K4E A;  2EAO A;  5ALN A;  5EWG A;  1SSN A;  5KFJ A;  4LZD A;  3SFE B;  4KSK C;  2KJ9 A;  4F5P A;  1E7U A;  8ICX A;  1NI2 A;  3SU8 X;  3BDP A;  4K4H A;  4PGY A;  2PVG C;  3ZW3 A;  5KFY A;  3V72 A;  3W5V B;  4ANV A;  1Q10 A;  2JH7 A;  4XDD A;  3QHT A;  2K8A A;  3GV5 B;  2RP5 A;  3DBR B;  2B3A A;  4LNF A;  4NY0 A;  5BYR A;  4IM2 A;  4AYB F;  2PKE A;  4UAW A;  2ACZ B;  2WF7 A;  3HT3 A;  1WY8 A;  1YQ3 B;  1E9M A;  2NTT A;  3GFK B;  2KNJ A;  4UBB A;  4B9V A;  2WU2 B;  3AE2 B;  5AKG A;  3J81 j;  2LHD A;  5ALE A;  3BK2 A;  5E6J A;  1T94 A;  4CQN A;  3PNC A;  2EKE C;  2F44 A;  4LJX A;  2D6F C;  7ICL A;  4J9K A;  2KQS A;  4ICA A;  4RQ7 A;  5AKY A;  1RRB A;  1ZQT A;  2C60 A;  4JWS C;  4RNA A;  4EOY A;  2DPJ A;  2QMT A;  1ZET A;  7ICJ A;  5IOI A;  8ICI A;  2FID A;  3ZNH B;  1ZP0 B;  2KD0 A;  3U7Z A;  4IS7 A;  4I6P A;  1KOT A;  5EE3 A;  2JZB A;  1GC7 A;  4YD2 A;  3DBS A;  3BZD B;  3RNG C;  2IA6 A;  1S10 A;  2JEJ A;  3QUQ A;  1V5T A;  2ZCC A;  3QX1 A;  3L0W B;  4WJQ A;  3BQ7 A;  1SV4 A;  2K8C A;  4GDK B;  1I4Q A;  3VUY A;  2V9H A;  4GB9 A;  2IGG A;  3EA6 A;  4K7S A;  7ICO A;  4DSK A;  2V4Q A;  2KK0 A;  2W3R A;  4A90 A;  4HXD A;  5DB7 A;  1SV0 C;  1D5M C;  3VR8 B;  3DVN V;  4EBD A;  3H0M B;  4HPP A;  5DG7 A;  2ZUB A;  3R7R A;  4II3 B;  5AM4 A;  1L6U A;  3RUI B;  4S17 A;  2W7P A;  3VUX A;  2DFL A;  3L16 A;  5CA7 A;  1XSN A;  2CHX A;  5ALI A;  4ZRI A;  4G3X B;  1ET6 A;  4KIK A;  1L7O A;  4YMO A;  1VJ5 A;  2BB6 A;  3N1Y C;  2NPT B;  4NQK E;  2ZCB A;  2BKF A;  2WB1 F;  1JMS A;  2ZZP B;  3RB0 A;  2HJ1 A;  1E5W A;  4NAW B;  4XUS A;  1C76 A;  3RBD A;  1UF0 A;  4Z6C A;  3OWE B;  1KBU A;  5GTH U;  4Q44 A;  5KL1 B;  4KLS A;  2RSU A;  5IN7 A;  5BPC A;  4DQI A;  3PV8 A;  2YQE A;  4ED6 A;  3B0X A;  2QDF A;  1WJN A;  4MJS A;  4S0R A;  2FJ6 A;  5KHQ A;  3APC A;  4JX1 C;  2J0J A;  1SKS A;  1QQR A;  2O6K A;  3LWL A;  1UT8 A;  5J2H A;  3Q8A A;  4DQS A;  2KQ7 A;  4QZA A;  3A0H U;  3QK0 A;  2DZM A;  4WUR A;  3WAL A;  2KZR A;  3HK0 A;  1C79 A;  2KDI A;  4DFD A;  2ZTD A;  4QNL A;  2F1J A;  4F72 A;  3B1L X;  4F4Y A;  1DOQ A;  2FMQ A;  7ICK A;  3DVG X;  5AZH A;  5AHX A;  2ZVN A;  2MH7 A;  4IWO A;  8ICP A;  4OO1 J;  4W9D A;  4LVS A;  2CU1 A;  2VAN A;  4A3P A;  2XGP A;  1F0M A;  1I4G A;  3E9S A;  4DF8 A;  3IM1 A;  3Q14 C;  3VTU A;  1COO A;  4E3C A;  1M94 A;  1I4P A;  4IQT A;  2IO3 B;  4DSF A;  4I2I A;  1J19 A;  2WXM A;  3RNA C;  5IA7 A;  2N1V A;  3W1S C;  1L3U A;  2INP E;  1ZQX A;  1XSL A;  3Q8E A;  2RRD A;  2E8P A;  1C78 A;  5KFP A;  2MJD A;  4GDL B;  9ICQ A;  5DB6 A;  1SZP A;  3KLS X;  1K53 A;  2BGW A;  3GDX A;  1LVH A;  4QIW F;  1FMA D;  2BGF A;  2DQN B;  3IV6 A;  4BVU C;  4KX3 A;  1WZ3 A;  1VDV A;  1C1Y B;  1ZQP A;  9ICO A;  1FIQ A;  3ZNI D;  3N20 C;  3HHM A;  4M9N A;  1WG8 A;  1E90 A;  3GZF A;  1BGX T;  4WWP A;  5KFL A;  1XLP A;  2WXO A;  2NTS A;  3V05 A;  2KC1 A;  2LI5 A;  3OJ4 B;  5AK4 A;  2C5L C;  3I1Y A;  1PGX A;  2BS2 B;  1JUD A;  3DBL B;  2PIA A;  1IIP A;  4TQ1 A;  2R8J A;  4PYU A;  2ZIX B;  2PKO A;  3ZVV A;  1D9F A;  4C8N A;  2KFK B;  3HM6 X;  2M19 A;  3RH6 A;  3DQV A;  4ICU A;  1GOZ A;  3DDC B;  4RQ2 A;  3LDA A;  1JWA D;  3S6J A;  4M0W B;  5KFW A;  5J2A A;  2AQ3 B;  5GMV A;  2OWO A;  2P6U A;  4YR2 A;  2ZVO A;  1DOI A;  4JLC A;  4DXA B;  3PZ7 A;  4W9F A;  1RYU A;  4GDK A;  4QWC A;  4HYK A;  1PDX A;  1Z5S B;  2J6U A;  1ZDV A;  2KN5 A;  4F5N A;  3E0F A;  2WXG A;  3APD A;  3F2D A;  5KFC A;  1I4X A;  1PVR A;  4ANW A;  4DDI D;  3AQF A;  4M6W A;  1ZQO A;  2ZTC A;  2ES6 A;  3EC8 A;  2NO5 A;  1ISN A;  1J8C A;  4MAC A;  2R61 A;  2FMS A;  2BT6 A;  4HKZ E;  4J9O A;  1HZ5 A;  3Q8S B;  2IY0 B;  2FCS A;  3PVX A;  4I2F A;  3UF8 A;  4I2C A;  4RM8 A;  1L8L A;  5KFA A;  2WP9 B;  1FD6 A;  3QE9 Y;  8ICY A;  1WX8 A;  4ZRK A;  2GLS A;  1E8X A;  2HDE A;  2HTH A;  3NZ3 A;  4DFK A;  1LKY B;  3AV8 A;  5F9N A;  3EZ5 A;  2KMM A;  2F3N A;  1SEB D;  1Z4O A;  4NAW A;  1IP9 A;  8ICH A;  2RPV A;  1T3N A;  4LNI A;  4WAF A;  4MEL A;  3M95 A;  2DYM A;  5J0Q A;  2JZZ A;  2JZP A;  2Q0Z X;  1V49 A;  1ZE3 D;  2IYD B;  4ANX A;  5HKH A;  1TS2 A;  5KFT A;  1RFK A;  2XIC A;  3TI0 A;  4RF1 A;  3MP9 A;  4QZE A;  1ZXH A;  2KJ5 A;  3NUQ A;  5KG2 A;  1VLB A;  2BZF A;  3BS5 B;  4N59 A;  1TYG B;  2V1Y A;  3ZTC A;  5D49 A;  4M9L A;  1ESF A;  4C7Y A;  2WXH A;  3LVW A;  1LV5 A;  5AIB A;  4GC7 A;  3RJK A;  4UAZ A;  3DPD A;  2UVW A;  2VJ5 A;  1SE3 A;  3UIP B;  1MHX A;  4ZYN A;  2MWS B;  2JGA A;  3BQ1 A;  2QIL A;  5DBA A;  3NUH B;  3GP7 A;  1T0Y A;  3SEB A;  3OTQ A;  3FC4 A;  4ZH4 A;  2NRT A;  4ECZ A;  2AJQ A;  4EZK A;  3TFS A;  3AU5 A;  1Z1B A;  1L4D B;  3VHT C;  1K50 A;  1F5S A;  3GQC A;  1NK0 A;  5III A;  2LXC A;  4KLE A;  1TZ1 A;  2L7R A;  3O13 A;  2GOW A;  2BWF A;  1ZOY B;  2I9G A;  5ALL A;  5JHB A;  4M8M A;  4DXF A;  1ZQZ A;  4YVZ A;  4EBE A;  2OH2 A;  2IOF K;  2BPC A;  3GII A;  3RPF C;  3QAR A;  3T9L A;  3N9Y C;  2RDI A;  4O0I A;  1T0Q C;  4B0E A;  4B6J A;  2JXT A;  2XK5 A;  2LUE A;  2RDG A;  2MBB B;  3ZXV A;  2DX5 B;  1TS5 A;  4EZ9 A;  3Q3J A;  1RG6 A;  2B0C A;  4DFM A;  5ALX A;  4MEX A;  5G55 A;  4I2A A;  2DF4 B;  4IUM B;  2N7E A;  3BYY B;  3MAB A;  8ICZ A;  3DHH C;  4WWN A;  4CF4 A;  5HHI A;  5AIA A;  4E0D A;  1UGM A;  4XYC A;  2YMQ A;  4JPS A;  3LVV A;  2GBJ A;  4DHJ D;  4ZHO A;  5DB8 A;  4I27 A;  2M0X A;  4Q43 A;  1ZQB A;  3RNC C;  3ZIM A;  4M01 A;  5L95 C;  1GG3 A;  2FUG 1;  4WJO A;  4ELU A;  1D3Z A;  2XY5 A;  2A19 A;  4LJO B;  1ZD3 A;  2KVR A;  3PLV A;  4HCN B;  7ICS A;  4ZRQ A;  1QOB A;  2HBL A;  3PR4 A;  2GB1 A;  4JWM A;  1YN5 A;  2MSE D;  4HJG E;  2PEA A;  1ZJN A;  4B9S A;  3PHW B;  4H2A A;  3D2N A;  4RGM A;  1RPL A;  2NVU I;  2NRV A;  5AUK A;  2LHE A;  2JRI B;  4US9 A;  4J03 A;  3PO0 A;  4O3R A;  4J3O D;  4UB8 U;  4L1B A;  3UIO B;  1QLB B;  1TE2 A;  2J7Q B;  2LHT A;  2ZW0 A;  1BUI C;  2ZPN A;  3TEZ A;  3FIL B;  5AKH A;  4OJ5 A;  1L4Z B;  1X1M A;  3KYD D;  5KT3 A;  3WAO A;  2AHO B;  4P0P B;  4UB4 A;  4B9N A;  1VJK A;  2K4P A;  5DLG A;  1LKY A;  1SGG A;  3RMK C;  1PYW D;  2IGH A;  3RZF A;  1BVS A;  4HK2 A;  4GXJ A;  4FS1 A;  1CEZ A;  4OJO A;  4DO9 A;  2J42 A;  3CST A;  2WNM A;  1JXE A;  4F8R A;  5HR7 A;  1TGZ B;  2GMI C;  2NR2 A;  3X23 A;  1J7C A;  5JU5 A;  4XDC A;  1BNO A;  3NVY A;  2HBK A;  2BHN A;  1ZQY A;  2HHT A;  2GBN A;  2LMC A;  5AEK B;  3QEA Z;  4MT5 A;  1N60 A;  5AKX A;  3BS5 A;  2SEB D;  3UMB A;  1V80 A;  2V4I B;  5E6P A;  1GAQ B;  1UNS A;  1TS3 A;  5KFU A;  5DBC A;  1S9F A;  3C1Z A;  2PE6 B;  3ISB A;  4C4S A;  9ICL A;  2HCF A;  4DK5 A;  4F5Q A;  4ACO A;  1T8E A;  3A4R A;  4EEN A;  4NLG A;  2IMW P;  3QZ8 A;  5JZE B;  4ZYS A;  4YTM B;  1R7S A;  5AKL A;  1WWU A;  3WKE A;  1NJX A;  3AEV A;  2INN E;  1WX9 A;  3P1M A;  1FNV A;  1YMH E;  1ZD5 A;  1QT9 A;  4JMU A;  2BQR A;  2V3N A;  3PX4 A;  2ZEQ A;  1Q1O A;  2BBC A;  1AWD A;  4UB3 A;  4FZM A;  1ZQF A;  3C0R B;  2IND C;  4CNQ A;  3ECI A;  2NBV B;  4ED1 A;  4MFC A;  3PW4 A;  3U4E G;  4FFD A;  2QC8 A;  4Y2T A;  2ZUC A;  2PFN A;  3V60 A;  2EZZ A;  1LB2 B;  3IXS A;  2FDR A;  1SXE A;  4CGZ A;  9ICW A;  1NVI D;  4HKQ A;  3WK9 A;  2BS4 B;  1J0G A;  3ONN A;  4DL4 A;  2LGX A;  2PI4 A;  1K8R B;  1NI3 A;  3AH7 A;  3MDC A;  4KGR A;  3Q8C A;  4RPX A;  3HRD D;  5J2D A;  1XT9 B;  2NO4 A;  1VD2 A;  2FLL A;  1Z2M A;  3RTV A;  2K89 A;  2HOI A;  1SJH D;  3DOW A;  3IVF A;  4FUL A;  3QU9 A;  3MHZ A;  1RZT A;  4LTU A;  4C00 A;  4AUQ C;  1YN3 A;  5EE9 A;  2KKC A;  1U4A A;  2MA9 B;  3KWL A;  3ZO5 B;  2PLP A;  2QCZ A;  1JWS D;  4EEW A;  4QWA A;  3TEX A;  5DDM A;  3UMC A;  4U6P A;  1UZX B;  3DCG A;  1WWT A;  2HHV A;  3V6E B;  3EUB 2;  1TT5 B;  2AL6 A;  3GB1 A;  2KK8 A;  4LDT B;  4B9M A;  2W04 A;  2VRR B;  1L7P A;  3E2E A;  4KLL A;  3C28 A;  4NV0 A;  4USA A;  1S97 A;  2XNA C;  2BKE A;  4FHJ A;  1KLU D;  3CSF A;  1SL2 A;  3N7R C;  2WXI A;  4K4G A;  5KFB A;  4DQP A;  2KIV A;  3VDZ A;  1FXA A;  3VR9 B;  3C2K A;  3PSP A;  3DBH I;  3B2G A;  5AKE A;  1L3V A;  1FCC C;  5CHW A;  1QQ6 A;  3TQ1 A;  3NOB A;  4LCD E;  2FBW B;  2M9N A;  4XC2 A;  1URJ A;  1X6I A;  2G09 A;  1F0Z A;  2J6T A;  1OFF A;  1BPX A;  4IM3 A;  4MSM B;  3JPS A;  2L52 A;  3R2T A;  4P0P A;  3EEC A;  4DL2 A;  3P2B A;  3PZD A;  5H8Y E;  1ZD4 A;  3SV3 A;  3N4M B;  2J0K A;  5D3I B;  1AQ6 A;  1XSP A;  8ICE A;  5DQI A;  3HW8 A;  4PYZ A;  2ASQ A;  2N9P C;  3T3F A;  5ALJ A;  4FO6 A;  2R2O A;  1ZKH A;  3P4R B;  1FPY A;  4F71 A;  4KGT A;  5J0T A;  1L3T A;  1SWW A;  3GV7 B;  1ZQM A;  2VA8 A;  1TKD A;  1C4P A;  5H2F U;  2LXA A;  1YX5 B;  1V6E A;  4MDK E;  4C4R A;  1X40 A;  4XQ8 A;  4BBN C;  3MC9 A;  3AU2 A;  5ALH A;  4DSI A;  2L76 A;  2OCE A;  2ISO A;  2ZG6 A;  1D8Y A;  1L8O A;  1MSW D;  3PST A;  4Q2J A;  4I6N B;  2MRL A;  1UD7 A;  4LNN A;  4Y2J A;  3W1S A;  2D5G A;  2P66 A;  5DGB A;  2BDP A;  2JX5 A;  5L1I A;  2Q4T A;  5TSS A;  1JQ4 A;  2JYE A;  3G6V A;  3GS2 A;  3H7P B;  5BO4 B;  2LM1 A;  2OM6 A;  3MHS D;  2VJ4 A;  2UWQ A;  4F1S A;  5CP2 A;  4YSY B;  1WXS A;  4KMO B;  2JT4 B;  3ETR A;  4QZC A;  3VFK A;  5AK5 A;  2YN4 A;  2L83 A;  2MUT B;  3BVM A;  1S0V A;  1BPY A;  1I4H A;  2DUY A;  5ALQ A;  4RQ0 A;  1NEK B;  3SQI A;  4UAS A;  2ONQ A;  1WWV A;  5IIK A;  5DLF A;  1IYF A;  4DL6 A;  3R8B A;  3GIJ A;  2NRW A;  4QZG A;  1EWY C;  2JYT A;  8ICC A;  4MSQ B;  1M4V A;  4W9L A;  1N2X A;  2K60 A;  5KFI A;  1VRA B;  2NBW B;  3VC8 A;  2O6V D;  5HFY A;  2YLM A;  4Z6D A;  3U30 A;  8ICT A;  2W43 A;  5JHA A;  4KLJ A;  2MEK A;  2M0N A;  5DQG A;  2PVO D;  5LNK 1;  4BFR A;  5KHO A;  2BVC A;  7ICV A;  4EEY A;  2PI5 A;  3AMZ A;  1YX6 B;  2LEK A;  2GI9 A;  4IRD A;  2XGQ A;  3KH0 A;  3NVZ A;  1WGG A;  2V0G A;  1DK3 A;  3KQ4 A;  4Q45 A;  3B0A A;  5DPR A;  1KL9 A;  4WAA A;  5J2K A;  4OHJ A;  3M9M B;  2LKY A;  3EYZ A;  2BB5 A;  1J2N A;  4F4K A;  2KG5 A;  2FE9 A;  5J2C A;  2D11 A;  4L23 A;  2C2D A;  1R4N I;  3Q8Q B;  4GXK A;  3F2C A;  3KUD B;  3W5U B;  4Y2P A;  2HHW A;  2K39 A;  4J9L A;  4YXJ A;  3WU2 U;  1XS9 D;  8ICQ A;  2KMD A;  2KDB A;  3BVG A;  1B1Z A;  4F2R A;  3Q8M A;  1SE4 A;  2WF5 A;  1L5P A;  5KT6 A;  5KFV A;  1ZRN A;  2MBH A;  1WH3 A;  3ETL A;  2MU2 A;  2WXK A;  1FRR A;  4Z6E A;  1IBX A;  1SBB B;  5T14 A;  1QTM A;  3FAH A;  5DQH A;  4ED7 A;  4JV0 A;  2B6G A;  4HRO A;  5ALU A;  1ZQN A;  3UMG A;  5J29 A;  2VA2 A;  1MPE A;  5L9X A;  3PHX B;  4XZ4 A;  3JW0 X;  2UVV A;  3DVG Y;  2BTE A;  1J7B A;  4QW8 A;  3V7K A;  5ALS A;  2ZJD A;  3H7S A;  3TAR A;  3JSV B;  5AZF A;  2VH2 A;  4JWU C;  4ECW A;  3HIL A;  2W54 A;  4BKS D;  5CR0 A;  1SXT A;  2KDE B;  2I6X A;  3N28 A;  3MFI A;  3N30 A;  3T3O A;  2W9M A;  2JSV X;  4YSZ B;  5C0Y A;  1DK2 A;  1A6S A;  2FCQ A;  3I9V 1;  3R66 C;  4JE3 B;  3OHB A;  1HZ6 A;  1TKY A;  1SKR A;  3AE9 B;  4ELV A;  2FLN A;  1QSS A;  3M9O B;  1S0O A;  1D5X C;  1NZP A;  2PMZ C;  2ZXH A;  2PXI A;  2W8L A;  1D9D A;  1TIF A;  2NBU A;  2V4L A;  3PT2 B;  3TAD C;  7ICU A;  1Z3E B;  1DYQ A;  4P0Q B;  4DEZ A;  3UQ2 A;  5T8I A;  3KOO A;  1ZQV A;  2XCP A;  4ECR A;  3TAQ A;  2BQU A;  5KFX A;  4BWM A;  2KN7 A;  2AU0 A;  1R4M B;  3H7P A;  4ASW C;  2BPF A;  2KNB A;  2MRP A;  1E8Z A;  1SIJ A;  4J9M A;  3H9D A;  4HDO A;  2LVO A;  3ZDA A;  2LGI A;  2EH9 A;  5ALP A;  4F93 B;  2CJN A;  4JL9 A;  1WE6 A;  3IBE A;  4PS8 A;  4E74 A;  4GLX A;  1ZQU A;  5KG6 A;  1YJI A;  2MUT A;  3QYP A;  4UB6 U;  1OQQ A;  2L00 B;  5B5E U;  4RU9 A;  3AED B;  3AI5 A;  4WWM A;  2I2Y A;  1ZQR A;  1PUZ A;  1L6V A;  2H5X A;  4FJV B;  4F4X A;  5KFS A;  1S8O A;  5AI8 A;  1WZ0 A;  1WJ6 A;  1TZO A;  4UAR A;  4AP9 A;  2F76 X;  3OSN A;  4WJ3 B;  2HTM E;  2X8X X;  3WA0 A;  1B4F A;  1QQ5 A;  3T3N A;  5CWR A;  1ENF A;  1B22 A;  1UEL A;  2ATL A;  2K25 A;  1HEK A;  2K8H A;  2Z0D B;  4IDI A;  4IG7 B;  5BMI A;  3SFD B;  4RGO S;  4LLG M;  3V6H A;  3SMV A;  4KSL C;  4W9C A;  2MW5 A;  1TV9 A;  2VA3 A;  4NJ7 A;  1MFW A;  3DBR I;  4M00 A;  2WWZ A;  3ICX A;  5TIS U;  1I35 A;  3PW0 A;  5AK6 A;  1HEZ E;  1WM2 A;  4YD1 A;  4M9G A;  2CKH B;  1V38 A;  2KLC A;  4JIO U;  4N9F 4;  9ICB A;  1BPD A;  3NAS A;  4QWB A;  5KL8 B;  3UXO A;  2WHE A;  1TKG A;  2FAZ A;  4E71 A;  2IO1 B;  1V1O A;  3Q2A C;  4UAT A;  4DCC A;  1QOG A;  1KN5 A;  5FR3 A;  1L7M A;  3KD3 A;  1TY0 A;  4CRX A;  5CJ7 A;  1SKW A;  2A3V A;  4KLU A;  2G9H D;  2LUM A;  2IY1 B;  4DQR A;  2MA1 A;  2Y0S C;  4M47 A;  4DBG A;  4NNJ B;  2P6R A;  4FBU A;  2F8L A;  3NS8 A;  3GV8 B;  3NG0 A;  3A0B U;  3VH3 B;  2XVT A;  4FBJ B;  1X66 A;  2PE9 A;  4EX6 A;  3MC8 A;  1MN8 A;  3UGB B;  1C20 A;  5AI6 A;  4NLZ A;  4ZRJ A;  4I2B A;  3ZNG C;  2G08 A;  3GE3 C;  3S2A A;  3AL0 B;  3IP4 B;  1QIL A;  5IIL A;  4EYH B;  5KFH A;  3BS7 A;  4A20 A;  3H4B A;  1TTN A;  4YT0 B;  1N62 A;  1KH0 A;  3GOE A;  1F52 A;  4EFO A;  3GU3 A;  4UB1 A;  2HOQ A;  4RUA A;  3JPP A;  2ASL A;  1JRU A;  3ZXR A;  3TL5 A;  4OZB A;  1Q3V A;  3SI8 A;  3C8Y A;  2R2Q A;  2LMR A;  1FCL A;  2WF8 A;  3M62 B;  2KVC A;  3JSV A;  2DZJ A;  4PS3 A;  5KFR A;  2JWZ A;  3PRP B;  2LYB A;  3ZRC A;  2ZTE A;  3D6J A;  5HP4 A;  4FJZ A;  2HHQ A;  9ICM A;  2Z0E B;  2W9N A;  1TS4 A;  5AKZ A;  2WTF A;  1NKB A;  1UCV A;  2IO0 B;  2LFI A;  2G0A A;  1I4R A;  2K6Q A;  2R8K A;  2LGD A;  3M6K A;  4CF5 A;  4O3O A;  1XO0 A;  1KFS A;  1F1H A;  3RNE C;  4C4V B;  5IKC M;  4RT3 A;  4DL3 A;  1S5L U;  4QZB A;  5AM0 A;  1ZQE A;  3N3K B;  3PS6 A;  2K8B B;  4RQ4 A;  2LYH A;  3QAQ A;  4ECT A;  4DOA A;  4ITK A;  1EU4 A;  3H8W A;  3QUB A;  3EFC A;  3ONS A;  5CHV C;  4DHZ E;  2OXO A;  4BZA A;  3H4D A;  3Q8K A;  3BIN A;  3C23 A;  2PFP A;  3Q8L A;  2NYV A;  3H0L B;  3ZGZ A;  4QZI A;  2F1I A;  4EEK A;  5J0X A;  4DS4 A;  1CK1 A;  2AGP A;  4PL1 A;  4NL9 C;  4R8U B;  2H88 B;  4BBN F;  4UB5 A;  4MH0 E;  4PZN A;  4RH6 A;  1P7E A;  1WR1 A;  2WAQ F;  2HVH A;  2N4F A;  1GUA B;  1V85 A;  1V1P B;  4GXI A;  3LYY A;  3B08 A;  3PRM B;  2AL3 A;  2LPE A;  4B0M A;  2WDV B;  4WJN A;  4KDI C;  3ZLZ A;  3DHI C;  2CN1 A;  4BOZ B;  5KG7 A;  1D5Z C;  4XRH A;  4RQ1 A;  3C21 A;  4ECX A;  5ALY A;  4C0Z A;  1L7N A;  3BZC A;  2JRZ A;  1X9X A;  5G5H A;  3BQ0 A;  3A9K B;  1JRP A;  2KX3 A;  2MBQ A;  3QCA A;  4HWI B;  3TCA A;  5J18 A;  2BPG A;  2G5H B;  4LZG A;  1Z00 B;  1FFU A;  3HX0 A;  3PW7 A;  3P4S B;  1HQR D;  5AZG A;  5J8Y A;  3N97 B;  4X5V A;  2BW2 A;  1UA0 A;  3DBL I;  3C1Y A;  4UBC A;  3PPA A;  4P4M A;  5L1K A;  2RGF A;  3WCQ A;  3PZP A;  4RM9 A;  9ICA A;  4AJY B;  2NPT A;  3EFU A;  3V6C B;  2FCN A;  3RB3 A;  4KV2 A;  3NZS A;  4B9L A;  3UXN A;  2Z7J A;  4PZO A;  2EKI A;  3AEG B;  1OUQ A;  4XWT A;  1MI0 A;  5D7G A;  5LLI A;  3ED5 A;  3N7P D;  4JGH B;  5KFN A;  3ZDC A;  4GN1 A;  3SZ2 A;  1N56 A;  3D2S A;  4RNM A;  1QOF A;  3ZJU A;  2KLG A;  2E1F A;  5BYQ A;  4IL6 U;  4RQ6 A;  4HRS A;  3NRW A;  1SF0 A;  1RYR A;  2YMM A;  2OEH A;  2ZNV B;  8ICA A;  1OQR A;  1ZPS A;  4IRC A;  1JXL A;  3HJE A;  2YX8 A;  1X9W A;  4EUT A;  4UAY A;  1ZJM A;  3VRB B;  1CJE A;  2DYO A;  1AN8 A;  3VQI A;  1KM7 A;  3I63 C;  3IHQ B;  1K1Q A;  2YB1 A;  3EW9 A;  2HOF A;  3PO4 A;  1F2R C;  1JWM D;  4W9J A;  3KFU F;  4YR3 A;  3SDL C;  2BCU A;  4K7U A;  3OAW A;  4PHP A;  3RJJ A;  1ZUD 2;  1FNW A;  1WFY A;  5C2T B;  2KP7 A;  3W9C B;  3PV1 A;  4R65 A;  5KTQ A;  4UDU C;  2GOL A;  1XWL A;  1L0X B;  2J0M A;  3P4Q B;  1S77 D;  5AM1 A;  4TUS A;  3OJS A;  3ZDT A;  5J2G A;  2DBY A;  4GDL A;  1EM7 A;  5IIN A;  1GC6 A;  4C4V A;  1TAM A;  1FXI A;  4WQM A;  4KLD A;  9ICV A;  2EEL A;  1WI0 A;  3FKY A;  1MJD A;  5IO9 A;  5EWF A;  1OW5 A;  3C5G A;  5AM3 A;  2QEJ C;  2DYB A;  1SXD A;  3M8R A;  5F9L A;  1Z19 A;  2WF6 A;  4B9K A;  2V3S A;  3UQB A;  1P3Q U;  2BQ3 A;  1NYQ A;  3RNB C;  4AQ7 A;  4WWO A;  4NJC A;  3GZN B;  3EWA A;  4O3Q A;  4WQO B;  4YN4 A;  3SR6 A;  3ZI4 A;  3Q3F A;  3SD7 A;  3IHP C;  3MJ5 A;  3C2L A;  1SB3 C;  2ZIX A;  4YFK A;  4MGY E;  2AYO B;  2KFK A;  2PTL A;  2MX2 A;  4EE2 A;  3AE4 B;  2D3B A;  1UPH A;  1RFA A;  3PSE B;  2Y5B B;  5LXH A;  1ACC A;  1V1P A;  1WGY A;  5DPW A;  2XCA A;  9ICP A;  2F8K A;  3LYS A;  3MC1 A;  3MFG A;  4M0W A;  2PMZ F;  3ZDD A;  2B21 A;  3VH4 B;  1MVK A;  2L5Y A;  3AEA B;  1DOY A;  1Q46 A;  4CF3 A;  2QB1 A;  5J0O A;  4FS2 A;  1ZW7 A;  1SIF A;  3Q69 A;  3RI7 C;  3CF6 E;  1BPZ A;  3ORY A;  4HPM B;  4P1C C;  1UHU A;  3QU7 A;  3A9K A;  1TK5 A;  1YT3 A;  2PFO A;  3MR3 A;  4RFB A;  4ZDV A;  4ARC A;  5AI9 A;  1EXN A;  5ALT A;  7ICF A;  4UAU A;  1Z00 A;  4NM1 A;  4M8N A;  3PLU A;  4IW0 A;  4I2D A;  4TQS A;  3QIJ A;  3WAP A;  4DLE A;  2E3T A;  3PSI A;  3NJT A;  2G07 A;  1WJ4 A;  3X0W A;  4KLQ A;  2LGY A;  5IAA C;  2HD5 B;  2AQ4 A;  3OLM D;  2L1A A;  1ZOL A;  1L6N A;  3PSF A;  3KHG A;  5ALM A;  3MR5 A;  4JV2 A;  2IBI B;  2ICI A;  3ZYY X;  2AGO A;  1TAU A;  7ICP A;  8ICL A;  4PT5 A;  2WXJ A;  5KFE A;  3WKC A;  1ZDX A;  3C5F A;  3HWT A;  5BOM A;  4TSS A;  2XI9 A;  2XEW A;  1TJE A;  4BKG A;  4NWI A;  3EGR A;  5J0P A;  1F44 A;  1BXT A;  4J6I A;  4W9H A;  2GBK A;  4QWE A;  2ZIV B;  3RN9 C;  1J97 A;  3VXW A;  4NPN A;  1YQB A;  5DPT A;  3I5J C;  3MBY A;  3V7L A;  1LXD A;  5KT4 A;  1Q0W B;  3L5K A;  2ODG A;  7ICN A;  3OGU A;  2D8C A;  2BPS A;  2BWE S;  2J52 A;  1FXT B;  2EDU A;  2MJ3 A;  5KG5 A;  3ZDE A;  1WM3 A;  3L17 A;  9ICH A;  4DDG D;  1K1S A;  4C8K A;  1T3Q A;  2JV3 A;  3IAS 1;  1WJU A;  2K3U A;  3U7D A;  4AP4 C;  5DDY A;  2KV2 A;  4CCH A;  3KZX A;  2PFQ A;  2ZJ8 A;  2KOX A;  2LJ5 A;  4KLM A;  1PVQ A;  2M17 A;  4BDP A;  2Y0S F;  2WS3 B;  3I3T B;  2M0A A;  2LRW A;  3TAD A;  5HG2 A;  2WYQ A;  4NY8 A;  4O3S A;  5L1M A;  4UAV A;  2KHW B;  3C19 A;  4KKJ A;  4NLK A;  3P4P B;  5D94 A;  4KN7 A;  2C28 A;  2KAJ A;  2NCN A;  4HEA 1;  3PTF C;  4R64 A;  2REX A;  3Q8B A;  2KZM A;  4W9E A;  2IGD A;  3HPO A;  1LQB A;  1XO1 A;  1V86 A;  3R3M A;  1K5O A;  3HM3 A;  4K81 A;  1M6Y A;  1X6J A;  1E8Y A;  4KTQ A;  3QA8 A;  1TY2 A;  3UXP A;  3JPT A;  2G4D B;  8ICW A;  2Z8L A;  1ZQW A;  4WJP A;  1ROE A;  1KFT A;  4ACF A;  3BJY A;  5J17 A;  1WF9 A;  1OTR B;  3T5L A;  1HXY D;  2EAP A;  1XNS A;  1IUE A;  4BKS A;  1NKC A;  2KWV B;  3VCB A;  3WKA A;  3UQ0 A;  3SEN A;  5KFD A;  5DPS A;  3R2I A;  4DWF A;  3IAM 1;  2KTQ A;  3RNF C;  3PMN A;  1V9P A;  3RB4 A;  1KJT A;  1MG8 A;  4DXG A;  4Y2S A;  3TAN A;  1NDD A;  4GLS C;  4ECQ A;  1UH6 A;  4P4O A;  4IWQ A;  3RR8 A;  4PPX A;  3L13 A;  1K51 A;  1PK3 A;  4M9H A;  1PUT A;  1XCT L;  4W9K A;  4GGQ A;  2DNF A;  1ZQJ A;  1BPE A;  5KG3 A;  5J2B A;  4IC7 B;  2DZK A;  2AQ1 B;  1O08 A;  1CQV A;  4RQ3 A;  2JY6 A;  3TAC B;  2KFJ A;  2FPM A;  2KTR B;  2YEP B;  2L0T A;  1U47 A;  4CDG A;  1L3S A;  1ARO P;  3KHR A;  5AIC A;  4B9T A;  3O0F A;  5C5J A;  2N1R A;  2RQ5 A;  1NNL A;  2QAR B;  2CU3 A;  2HSZ A;  3NY5 A;  2IPK D;  2QB0 B;  4MM3 B;  1XU4 A;  5J8Y C;  4ED8 A;  1XF5 L;  2E8M A;  3ZTD A;  3SAG A;  1NEN B;  2ZJ5 A;  4F3O A;  2JH1 A;  3IRU A;  1WIA A;  3RD2 A;  1PZN A;  3OJ3 A;  3URY A;  2CS4 A;  3W1Y A;  2FIF A;  3FIL A;  4GXB A;  2KWC A;  3K1R B;  1JN3 A;  2JU6 X;  4YTN B;  5IIM A;  5D46 A;  3K9O B;  4MGI E;  4TUQ A;  2IZV B;  5D2M B;  4BX9 C;  3FYH A;  2M1M A;  2EAN A;  1T6B X;  2RLT A;  3AEB B;  2OJW A;  3RFZ B;  4RZR A;  4MF2 A;  4KIT B;  1J2M A;  4O3M A;  3AUL A;  4I28 A;  3F5A A;  4O5C A;  3AQE A;  2SAK A;  4TQR A;  2WDR B;  2ZIV A;  1E0Z A;  2BS3 B;  3Q8R B;  4KZ0 A;  3QU2 A;  2LD9 A;  2MAX A;  2GRI A;  3AEE B;  4YWG G;  4A6Q A;  5KFQ A;  8ICM A;  3MFH A;  2JF5 A;  3W2D A;  5JH5 C;  2W03 A;  1WGR A;  2AH5 A;  4G9B A;  3T79 A;  3U2S C;  2J6S A;  2K5P A;  4RQ8 A;  4KX6 B;  1QH9 A;  4OJ6 A;  8ICN A;  5B66 U;  2FPL A;  2PW9 A;  1D8L A;  4I2J A;  3ZNZ B;  4KLH A;  3D2Q A;  3DWM A;  2KN4 A;  4XGA B;  2PMV A;  5FP0 A;  2KFZ A;  2LVP A;  1V81 A;  4IR1 A;  2WLB A;  1UQV A;  3OG5 A;  3G6X A;  4ED0 A;  4UQG A;  2KJH B;  5AKI A;  4Y2Y A;  5BMG A;  1U49 A;  1O03 A;  3IG8 A;  1AYF A;  4F8C B;  1D4B A;  2WDQ B;  2V3P A;  2WHI A;  4R3D A;  2GWS A;  5ALZ A;  3T5H A;  2ZUD A;  2FCM A;  1NKE A;  4R63 A;  2KAC A;  4EKU A;  4J9N A;  1WMH B;  3AE8 B;  3L10 B;  4WIP A;  2H3Q A;  4NM2 A;  2N0S B;  5HML A;  2BDU A;  2Y3A A;  1VZ8 A;  4GSW A;  1UBI A;  3LJ3 A;  2E8N A;  3ZDB A;  1LO5 D;  2DKX A;  3KBB A;  4F5O A;  2G45 B;  3QJZ A;  1RYS A;  1KLN A;  4NL9 A;  3DVN U;  2KKP A;  5CHG A;  4PGX A;  2Y5C A;  4PL2 A;  2KWD A;  2LWP A;  2CJO A;  1S3S G;  5KT5 A;  1ZQI A;  4ECV A;  2WXN A;  4I6L B;  4EBC A;  2MHJ A;  4GOC A;  2D3C A;  4CE6 A;  3IT4 B;  1EWC A;  2I38 A;  2WFA A;  2R8G A;  5KFG A;  3GIL A;  3LWM A;  4RF0 A;  2BCQ A;  3EHV A;  1BNP A;  2N9E B;  1NK5 A;  4NXZ A;  2DLB A;  2KTR A;  1Y88 A;  1CRX A;  4A9A A;  3TAP A;  1WXV A;  4HJK A;  5DB9 A;  1IG6 A;  4J9P A;  3RJH A;  1ZQS A;  3T8M A;  3K9P B;  1E6E B;  1XXG A;  2WF9 A;  2MP2 B;  3E56 A;  2QAR A;  3JVZ X;  2L05 A;  4LNO A;  3SV4 A;  1JRO A;  2W3S A;  1T0R C;  5FKA C;  2QB0 A;  4MM3 A;  3JPO A;  2LI6 A;  4K3B A;  3UQA A;  1OEY J;  5C1Z A;  2W7O A;  1QSY A;  2IOF A;  4J9S A;  4W9I A;  2EQY A;  4DWI A;  1NOM A;  1T5X D;  1PK1 B;  2L8J A;  4FXC A;  3HP6 A;  1S0M A;  2E6X A;  4DHJ B;  3N1X C;  3RAQ A;  8ICO A;  2EMS A;  2RHF A;  4ELT A;  5EWE A;  2KDM A;  4KIK B;  2G3Q B;  2KVS A;  3SAF A;  1YD8 U;  4Y2V A;  5L83 A;  4RQ5 A;  2YMP A;  1X42 A;  3IN5 A;  1X2I A;  3TFR A;  1T0S C;  4LK0 M;  4EYI B;  1G6J A;  3RAX A;  2WGS A;  5JRT A;  2AGQ A;  2DHZ A;  4RCO A;  3SAH A;  3IG5 A;  5JUM A;  2OHF A;  2JWU A;  2LJI A;  4RGN A;  4GIB A;  4KN4 A;  3UPQ A;  2ZNV C;  3A33 B;  1L0Y B;  3EPI A;  1JI7 A;  2OED A;  4KLO A;  5KFZ A;  2R18 A;  5KG0 A;  3NS1 A;  4KLF A;  3KW5 B;  8ICF A;  3NTU A;  2LGS A;  3U26 A;  4MJS B;  4RNO A;  5CHF A;  3PX6 A;  2W9A A;  3RJE A;  4M0A A;  4JQW C;  2JQR B;  2MQJ A;  5ALO A;  1ZQK A;  2UYZ B;  2BR0 A;  1XO3 A;  3K4G A;  1A70 A;  2JR5 A;  9ICS A;  4QZD A;  3RZW C;  1X9S A;  2KZZ A;  4OW0 A;  1N48 A;  1KTK A;  4G3I A;  4CYE A;  4FN2 A;  3H8M A;  3QUC A;  4OD0 A;  1NJY A;  3AE6 B;  5BOL A;  3SYZ A;  1BPB A;  1GNU A;  2D07 B;  1ZQD A;  1FFV A;  2C7H A;  4D2K A;  4ARI A;  1HUO A;  5J2I A;  4GFJ A;  4XWW A;  2GBM A;  3ZKJ C;  1C9F A;  1L0V B;  3TSS A;  1WMH A;  3RB6 A;  1JAL A;  4BWJ A;  2JRH A;  1VR9 A;  3UI3 A;  1ZQG A;  4IQV A;  1Z4N A;  4IKG A;  3M7D A;  5FK9 C;  1TK0 A;  1KQQ A;  2HHX A;  3KKA C;  2DGZ A;  1ZQA A;  1TAQ A;  5JTI A;  2L3Z A;  2G06 A;  3VTW A;  2KZ3 A;  2BQQ A;  3RRH A;  5DGA A;  2WXQ A;  3PRE A;  5KFM A;  3SHQ A;  3ML8 A;  4FLH A;  3RJG A;  5C23 A;  4DSE A;  1V2Y A;  4F92 B;  1LGR A;  4J9Q A;  2N9K A;  1NK7 A;  1EO6 A;  3NVW A;  1U45 A;  1YOV B;  1EF1 A;  4KZC A;  2CHZ A;  1VCB A;  2FI1 A;  3WK4 A;  4LJP B;  1R4M I;  4XE0 A;  4MGK E;  2DAJ A;  3AM9 A;  5IIJ A;  3VAW A;  1N61 A;  2DPI A;  7ICM A;  3N1Z C;  2I1K A;  1E8W A;  4YR0 A;  2KJ6 A;  2K0P A;  1P1A A;  4JUZ A;  4PHA A;  5BMH A;  2UVR A;  2MP2 A;  3M6Z A;  2BKR B;  2KEY A;  5ALF A;  3ZUN A;  3F53 A;  3EPG A;  2WXP A;  3M1Y A;  3GIM A;  2W82 A;  5C3J B;  2I5H A;  2KHQ A;  2NS5 A;  2K4H A;  2YTU A;  3PY8 A;  4JWN A;  1ZRM A;  4A8X C;  1CUK A;  4M6W B;  2XID A;  1MG4 A;  3RCZ A;  1IV8 A;  2HMX A;  1PK1 A;  1L5U A;  1P7F A;  2IDY A;  9ICI A;  2RDB C;  2GH1 A;  4EX7 A;  2E5S A;  3DWG C;  4C80 A;  4YQW A;  5E6N A;  4EZ6 A;  4A8E A;  3KHH A;  1WGD A;  4HCP B;  2GBR A;  5KT2 A;  3Q3N C;  2KVZ A;  3APF A;  3AN1 A;  2OOB B;  3AUO A;  5E6O A;  3K75 D;  4J9R A;  2VIX A;  2W55 A;  2HHU A;  2AEH A;  3PGE A;  2KD1 A;  5CRX A;  5AI4 A;  4NZL B;  4IC9 A;  4Q8F A;  4IM0 A;  4K1R B;  4JK1 A;  5HMM A;  1N5X A;  5CEH A;  3A1Q B;  3DV9 A;  1KSP A;  1FRD A;  2OYY A;  4RPY A;  3L08 A;  3RUL A;  3B0Y A;  1YQ4 B;  3N32 A;  5D3D A;  1KFY B;  1H38 A;  4A55 A;  1JIH A;  1XLN A;  5DCN A;  4F4Z A;  9ICG A;  1MHH E;  2A4Z A;  4C8L A;  1NK9 A;  4MFF A;  7ICR A;  1XQQ A;  4NLN A;  3OJU A;  4M9J A;  2GLE A;  3ZD9 A;  5KT7 A;  1UWM A;  5AK3 A;  4US8 A;  3Q8P B;  3JPQ A;  2O2V B;  3QEB Z;  2ISP A;  1S0N A;  1KLV A;  2AQ0 A;  1A76 A;  2CPR A;  1ZGU B;  9ICF A;  4OVU A;  4TMA B;  2HI0 A;  4GC6 A;  4P0Q A;  2QKQ A;  5EOZ A;  3N7S C;  2L32 A;  3PZ8 A;  4YTP B;  4FE3 A;  3TJP A;  2A1J B;  3SD5 A;  2BYF A;  1ED1 A;  2G1E A;  4BUG A;  4GU2 A;  3KTQ A;  1YJJ A;  5K4L A;  2UU7 A;  3BY4 B;  3ZDM C;  4OCZ A;  3H8H A;  5KAF U;  3J9C A;  4HPL B;  3HUI A;  2DWQ A;  3T5K A;  8ICR A;  1RLF A;  3ALR A;  5ALD A;  4B6W A;  4TV3 A;  1XD3 B;  5HI1 A;  3BYT B;  4GMV A;  1TVA A;  1QCK A;  4ICV A;  4RMA A;  1A0P A;  1ZQC A;  2AQ2 B;  5HHH A;  2KAN A;  4FZL A;  2RD0 A;  3OSP A;  1HJP A;  2F77 X;  2N9L A;  1UGJ A;  3CW2 C;  4URK A;  3CRX A;  4RUC A;  2H3I A;  1IGD A;  1GB4 A;  1WX7 A;  4LDT D;  3B9J A;  4BJQ A;  3FDS A;  9ICN A;  4IR9 A;  2KSO B;  2LZ6 A;  3K1Z A;  4Z6F A;  1YNT E;  5J2F A;  2XK5 B;  4FZN A;  3U8Z A;  5BYS A;  2C2E A;  2R8I A;  4F91 B;  2FLP A;  4RT2 A;  2JEI A;  4P7I A;  1OQY A;  1WXQ A;  2R8H A;  1A77 A;  1V97 A;  5G5G A;  1C4A A;  2H3Z A;  2DL0 A;  4RNN A;  2K6D B;  2KJR A;  5AI0 A;  9ICC A;  4AS1 A;  2ALZ A;  1GO3 F;  8ICS A;  2KJ8 A;  1I7H A;  2W8K A;  1SE2 A;  3MGV A;  5GXG B;  4QW9 A;  3KWV A;  2QHO A;  1P0R A;  1WCL A;  1SL1 A;  3MDA A;  4UW9 A;  1ZD2 P;  1BML C;  2JUO A;  4BKT A;  2EAM A;  1P98 A;  2F2A B;  5IIO A;  3MGH A;  3JYU A;  2PJH A;  4AWJ A;  2HBM A;  3DDH A;  4HAI A;  4QWD A;  2TSS A;  3ALB A;  5H92 C;  3RR7 A;  5KAI U;  2JEF A;  2M56 B;  2IOH A;  3JPN A;  4KGS A;  4MFA A;  1YJ1 A;  2I1Q A;  9ICJ A;  1DGJ A;  5KG4 A;  1KLG D;  2O6V B;  1FEZ A;  2Y9T A;  4DQO C;  2KIC A;  4OVV A;  1LFD A;  2H3V A;  1WR6 E;  5G2N A;  3F5E A;  4TQ0 A;  8ICB A;  1C4C A;  4MEM A;  2AXT U;  1C7Y A;  3V7J A;  3MR6 A;  4PS7 A;  1ZYQ A;  1IXR A;  4YP3 A;  3AE1 B;  3QUT A;  1MQ3 A;  4F2S A;  1D8B A;  1IGC A;  1XC9 A;  3NHE B;  3E58 A;  3RF9 A;  2KWU B;  3TIX A;  1AAR A;  1ZQ1 C;  2WQY B;  4B95 A;  2Y9U A;  7ICE A;  1WGH A;  3PVL A;  3UM9 A;  4DS5 A;  1YZ6 A;  1J7A A;  2C9W B;  1KRP A;  2VH1 A;  3AEC B;  2KO3 A;  5KNI A;  2CRX A;  3QNM A;  3A1Q A;  2KHV A;  3QU5 A;  1PVP A;  2JEG A;  4Q8E A;  5L1L A;  2JPH A;  1QQ7 A;  4GIV A;  1TKE A;  1YZ7 A;  2WU5 B;  3CMM B;  3R7Q A;  4NJ6 A;  2D3D A;  1HTO A;  2HBJ A;  1YN4 A;  4PHE A;  3VVW B;  3F2B A;  4JB3 A;  2JHD A;  2O2V A;  4PJ0 U;  4OVZ A;  3L3F X;  2ON8 A;  4ZHP A;  5J0U A;  4DHZ B;  2C2R A;  4O5E A;  3CWI A;  1P9D U;  1XLO A;  2H3F A;  5ALR A;  1IPG A;  1NK4 A;  3TEY A;  2DKZ A;  1NYR A;  4W9G A;  2A1J A;  3WIM A;  1MA7 A;  2K8B A;  3MGI A;  4XA5 A;  2BCR A;  4DFJ A;  4KLI A;  3H7I A;  2IHM A;  1XLQ A;  4TUU A;  1T4G A;  5A0L A;  4EZJ A;  2EZX A;  4FA6 A;  5J2E A;  1SZH A;  2FE8 A;  2EZY A;  2N1W A;  4C4T A;  1SWV A;  3IG3 A;  2ZW1 A;  5J2R A;  2C7M B;  5KFO A;  1FM0 D;  2HJ8 A;  3WK6 A;  1WGK A;  3OHA A;  1KFD A;  4G50 A;  1PQS A;  1U48 A;  8ICK A;  3OPX A;  8ICJ A;  2KFN A;  9ICX A;  1QOA A;  4R8U A;  4DL7 A;  4NLC A;  3AEF B;  1E10 A;  5ALG A;  2JVC A;  3I28 A;  4AOF A;  3AU6 A;  4FHK A;  1N6Z A;  4JV1 A;  3ML9 A;  2JXJ A;  1JW9 D;  3HKZ C;  4HDQ A;  2KSO A;  4I2E A;  4KDL B;  1RM6 C;  4P16 A;  5ALK A;  1MC8 A;  1JWB D;  2RDJ A;  4XX5 A;  2ASD A;  3RH4 A;  7ICI A;  3D32 A;  5IP4 D;  4IWP A;  3U52 E;  2XY6 A;  1DXS A;  2MJE A;  2YB4 A;  4R66 A;  4IRK A;  2M8S A;  2LM4 A;  4YXD B;  3PRZ A;  2VZK D;  3ABV B;  4O1N A;  1NK8 A; 
#chains in the Genus database with same CATH homology
 1T6B X;  1UWX A;  3AEB B;  2JSV X;  4YSZ B;  3RFZ B;  1XLP A;  1D6E C;  3I9V 1;  2WXO A;  2NTS A;  1QF6 A;  3BII D;  4JE3 B;  1Y56 A;  1HZ6 A;  3V05 A;  1TKY A;  3I57 A;  5I4D A;  3AE9 B;  1D5X C;  2SAK A;  2WDR B;  1E0Z A;  1PGX A;  2BS3 B;  2BS2 B;  3BVZ A;  2RMM A;  2GRI A;  1DYQ A;  3AEE B;  4YWG G;  2PIA A;  4A6Q A;  4TQ1 A;  3CIR B;  2PKO A;  5T8I A;  3W2D A;  2M19 A;  3LXF A;  1GOZ A;  3U2S C;  3ZQ4 A;  3T3O A;  2K5P A;  4KX6 B;  1SIJ A;  1JWA D;  1PGA A;  1RWS A;  2AQ3 B;  1FEH A;  2PW9 A;  2LGI A;  2CJN A;  2QJL A;  1DOI A;  3DWM A;  2KN4 A;  2PMV A;  3PZ7 A;  1YJI A;  1OQQ A;  2QSD A;  1PDX A;  3AED B;  2QIE B;  3P63 A;  1WYG A;  1ZDV A;  2WLB A;  1WRI A;  2WXG A;  4WWM A;  2I2Y A;  1L6V A;  1JML A;  4P6V F;  1I4X A;  5BMG A;  1TZO A;  2HTM E;  1AYF A;  1D4B A;  5MPO A;  2WDQ B;  2V3P A;  4MAC A;  2R61 A;  4R3D A;  2BT6 A;  4HKZ E;  3T3N A;  1ENF A;  1HZ5 A;  1KF6 B;  5BMI A;  4IDI A;  1V8C A;  3SFD B;  2KAC A;  4RGO S;  4LLG M;  2AX5 A;  3ZJT A;  2WP9 B;  3AE8 B;  4WIP A;  1FD6 A;  2N0S B;  2Y3A A;  1VZ8 A;  3HVD A;  1HEZ E;  1LO5 D;  2HDE A;  2X38 A;  3NZ3 A;  1ET9 A;  1E7P B;  3AV8 A;  3HVZ A;  2KMM A;  1SEB D;  4WH4 A;  4KKI A;  2RPV A;  2Y5C A;  2KWD A;  4WAF A;  2CJO A;  1TKG A;  2DYM A;  2JZP A;  1V1O A;  1ZE3 D;  2WXN A;  4C56 C;  1QOG A;  5FR3 A;  1TS2 A;  1TY0 A;  1HA5 A;  2G9H D;  3L4P A;  1RFK A;  2LUM A;  3IT4 B;  4RF1 A;  1EWC A;  3MP9 A;  2I38 A;  1ZXH A;  3BWU D;  1VLB A;  4N59 A;  1TYG B;  4RF0 A;  1ESF A;  4C7Y A;  2DLB A;  2WXH A;  4A9A A;  1E6E B;  1XXG A;  1SE3 A;  3E56 A;  1MHX A;  1QIL A;  2QIL A;  1JRO A;  3NUH B;  2W3S A;  3GP7 A;  4YT0 B;  3SEB A;  5FKA C;  1N62 A;  1KH0 A;  3FC4 A;  3VRA B;  3V3X A;  1QKZ A;  4N6E B;  1GB1 A;  1C77 A;  1L4D B;  1K50 A;  4OZA A;  3NVV A;  4OZB A;  1T5X D;  3AE5 B;  1FO4 A;  3C8Y A;  2H89 B;  4FXC A;  3O13 A;  2E6X A;  1FCL A;  1ZOY B;  4DXF A;  2RDH A;  5HHD G;  1XEE A;  2KDM A;  3BK1 A;  3RPF C;  3N9Y C;  4LK0 M;  4B0E A;  1TS4 A;  2JXT A;  1STE A;  1JCK B;  4RCO A;  2RDG A;  2JWU A;  2LFI A;  2LJI A;  2OHF A;  4RGN A;  1I4R A;  1TS5 A;  1L0Y B;  2OED A;  1ZXI A;  3NS1 A;  2XN9 C;  3BYY B;  2WXL A;  4ITK A;  1EU4 A;  4JPS A;  2JQR B;  1GPX A;  4ZHO A;  5EE0 A;  4IOI E;  2FUG 1;  3IT6 B;  3AE7 B;  1XO3 A;  1A70 A;  4ZRQ A;  5EE1 A;  3ZGZ A;  1QOB A;  2WXF A;  1KTK A;  4OW0 A;  1CK1 A;  2GB1 A;  1YN5 A;  4HJG E;  2YEP F;  1IBX B;  3AB5 A;  4H2A A;  4RGM A;  2H88 B;  4ZOH C;  3AE6 B;  5AUK A;  4RH6 A;  1P7E A;  1FFV A;  2LHE A;  4D2K A;  4US9 A;  1V1P B;  4ARI A;  3LYY A;  3TUO A;  4B0M A;  1VZ6 A;  3PO0 A;  2WDV B;  4J3O D;  1PFD A;  4XWW A;  1B9R A;  4L1B A;  1QLB B;  1D5Z C;  1C9F A;  1L0V B;  2ZW0 A;  1BUI C;  3TSS A;  3TEZ A;  1JAL A;  2Q5W D;  3FIL B;  1VR9 A;  1L4Z B;  3UI3 A;  2NMQ A;  5G5H A;  4IKG A;  2WXR A;  5FK9 C;  3B2F A;  1JRP A;  1VJK A;  1CZP A;  1PGB A;  1PYW D;  1FFU A;  2IGH A;  3P4S B;  1HQR D;  2WXQ A;  2B76 B;  2J42 A;  2WNM A;  2BW2 A;  3TEW A;  1J7C A;  2N9K A;  4XDC A;  2N7J A;  3NVY A;  3NVW A;  1F2R I;  3WCQ A;  2LMC A;  3MC0 B;  1DOX A;  4MT5 A;  1N60 A;  4XE0 A;  2SEB D;  2V4I B;  1GAQ B;  3AM9 A;  1F77 A;  1UNS A;  2J4X A;  4N58 A;  2EKI A;  3AEG B;  1TS3 A;  1N61 A;  4XWT A;  1AW7 A;  1FNU A;  1MI0 A;  5D7G A;  4RGT A;  2K0P A;  5BMH A;  1QOF A;  1JWU D;  3ZJU A;  5BYQ A;  4HRS A;  4ZYS A;  1SF0 A;  2WXP A;  1R7S A;  4YTM B;  2W82 A;  5C3J B;  1OQR A;  1ZPS A;  2INN E;  2K9X A;  2BYT A;  4A8X C;  3P1M A;  1N63 A;  1FNV A;  1YMH E;  1QT9 A;  2V3N A;  3IXS A;  1P7F A;  2IDY A;  1CJE A;  3DWG C;  2DYO A;  3VRB B;  5AUI A;  1AN8 A;  3VQI A;  4C80 A;  2BBC A;  4MH8 A;  1AWD A;  1F2R C;  1JWM D;  3AE3 B;  3P42 A;  4L2Y A;  3AN1 A;  4C7Z A;  3U4E G;  1WSP A;  1ZUD 2;  1FNW A;  1SJE D;  5C2T B;  3W9C B;  1NVI D;  2W55 A;  4UDU C;  5JXV A;  4HKQ A;  3P4Q B;  1L0X B;  2K22 A;  2BS4 B;  3Q8F A;  2DBY A;  3AH7 A;  4KGR A;  1NI3 A;  4NZL B;  3ZJV A;  3Q8C A;  1N5X A;  1EM7 A;  3HRD D;  1FRD A;  1FXI A;  4WQM A;  2EEL A;  4ZRP A;  1YQ4 B;  1N5W A;  1SJH D;  2QEJ C;  1KFY B;  5D3D A;  4A55 A;  3MHZ A;  1XLN A;  4LTU A;  1RYJ A;  1UUP A;  1YN3 A;  5EE9 A;  1MHH E;  2IJ0 A;  4OZC A;  3KWL A;  2PLP A;  3NRZ A;  1JWS D;  3TEX A;  1NYQ A;  4AQ7 A;  1K52 A;  1UWM A;  1WWT A;  4NJC A;  1EU3 A;  3EUB 2;  4US8 A;  2VZK B;  3GB1 A;  3SR6 A;  2Y5P A;  4TMA B;  4YSX B;  3MJ5 A;  1SB3 C;  1KRH A;  2L32 A;  3PZ8 A;  4YTP B;  4USA A;  2PTL A;  1VZ7 A;  4EE2 A;  2G1E A;  2XNA C;  3AE4 B;  4NAM A;  1YJJ A;  1KLU D;  3H8H A;  3LB8 C;  1ACC A;  1V1P A;  2WXI A;  3J9C A;  3HUI A;  3MFG A;  2DWQ A;  4M0W A;  1FXA A;  1XCQ L;  3VR9 B;  1MVK A;  5HI1 A;  3B2G A;  3AEA B;  3BYT B;  1FCC C;  1DOY A;  2AQ2 B;  2FBW B;  3Q69 A;  4REZ A;  1F0Z A;  1OFF A;  2N9L A;  1UGJ A;  2L52 A;  3R2T A;  4RFB A;  4ARC A;  2KQ4 X;  1IGD A;  1GB4 A;  5H8Y E;  2J53 A;  3B9J A;  1SSN A;  3SFE B;  1YNT E;  5D3I B;  5BYS A;  2E3T A;  1WXQ A;  2PVG C;  1V97 A;  2L1A A;  5G5G A;  3P4R B;  4KGT A;  1C4A A;  3W5V B;  1Q10 A;  2ICI A;  4XDD A;  3ZYY X;  1C4P A;  5BYR A;  4AS1 A;  4PT5 A;  1I7H A;  2WXJ A;  1SE2 A;  1ZDX A;  2ACZ B;  5GXG B;  4TSS A;  3KWV A;  1TJE A;  1YQ3 B;  1E9M A;  2NTT A;  3EGR A;  4Q2J A;  1BXT A;  2WU2 B;  3AE2 B;  1BML C;  2LHD A;  3W1S A;  2D5G A;  3BK2 A;  5E6J A;  4CQN A;  2JX5 A;  2TSS A;  5H92 C;  2M56 B;  5TSS A;  1JQ4 A;  4KGS A;  2MJ3 A;  2J52 A;  2JYE A;  1DGJ A;  1KLG D;  4JWS C;  4DQO C;  4RNA A;  3GS2 A;  2QMT A;  4TQ0 A;  1T3Q A;  3IAS 1;  1ZP0 B;  1C4C A;  3U7Z A;  2K3U A;  5EE3 A;  4YSY B;  3BZD B;  3AE1 B;  3ETR A;  1IGC A;  2WS3 B;  2L83 A;  4GDK B;  1I4Q A;  2M0A A;  3BVM A;  2IGG A;  3EA6 A;  1I4H A;  5HG2 A;  1NEK B;  2WQY B;  2ONQ A;  4KKJ A;  3P4P B;  2KAJ A;  2W3R A;  4HEA 1;  4A90 A;  3Q8B A;  3R8B A;  1J7A A;  1D5M C;  1EWY C;  3AEC B;  3VR8 B;  2IGD A;  2JYT A;  1M4V A;  1L6U A;  1TY2 A;  1VRA B;  1TKE A;  2WU5 B;  5HFY A;  2Z8L A;  1ET6 A;  1ROE A;  2BB6 A;  2MEK A;  2PVO D;  1HXY D;  1YN4 A;  5LNK 1;  1IUE A;  3AMZ A;  2LEK A;  2GI9 A;  4ZHP A;  3R2I A;  4NAW B;  1C76 A;  2ON8 A;  3IAM 1;  4OVZ A;  3NVZ A;  3CWI A;  3OWE B;  4DXG A;  2V0G A;  1XLO A;  3KQ4 A;  4GLS C;  3TEY A;  1NYR A;  4OHJ A;  2BB5 A;  1K51 A;  1PUT A;  1XCT L;  4JX1 C;  1QQR A;  4L23 A;  3Q8A A;  1XLQ A;  3W5U B;  2FE8 A;  2AQ1 B;  1CQV A;  4WUR A;  2ZW1 A;  3BVG A;  1B1Z A;  2YEP B;  1C79 A;  1FM0 D;  1SE4 A;  1L5P A;  1WGK A;  2WXK A;  1FRR A;  2MH7 A;  1IBX A;  1QOA A;  1SBB B;  2CU3 A;  3FAH A;  2IPK D;  3AEF B;  1E10 A;  1I4G A;  4MM3 B;  3E9S A;  4HRO A;  1JW9 D;  1XF5 L;  1I4P A;  1MPE A;  2WXM A;  1NEN B;  1RM6 C;  4P16 A;  2INP E;  1JWB D;  3Q8E A;  3URY A;  2BTE A;  1J7B A;  1C78 A;  2MJD A;  4GDL B;  3FIL A;  3KLS X;  3U52 E;  1K53 A;  4JWU C;  2JU6 X;  1FMA D;  4YTN B;  2W54 A;  2MJE A;  4YXD B;  1VDV A;  1SXT A;  2VZK D;  3ABV B;  1FIQ A;  4O1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...