3SR6A

Crystal structure of reduced bovine xanthine oxidase in complex with arsenite
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 37
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3sr6A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sr6A01
1OQRA 1NEKB 1FXAA 3NVZA 3AMZA 4JWUC 4USAA 1EWYC 2WDRB 4YSZB 3WCQA 5EE3A 1T3QA 1YJJA 1VJKA 1E9MA 3HUIA 4HRSA 2WP9B 1FFUA 1XLPA 1FIQA 2FBWB 1XO3A 2OHFA 3BIID 1L6UA 4ZOHC 3SR6A 1AWDA 2Q5WD 3AE8B 1NVID 1ROEA 3HVZA 1WXQA 2W55A 3KWLA 3FAHA 1E10A 1WWTA 1ZXIA 3EUB2 1NYRA 2PKOA 1IUEA 4ITKA 3CIRB 5AUKA 5MPOA 2M56B 2H88B 1I7HA 2N0SB 1A70A 2WLBA 1DGJA 1L0VB 1JW9D 3DWMA 1JRPA 3LXFA 1XLQA 5GXGB 1WRIA 2LEKA 4ZHPA 2PVGC 2WDQB 1E0ZA 3AE9B 1UWMA 1N5XA 2B76B 2JX5A 4YTMB 2BS3B 3VRAB 3AEGB 2WDVB 3NVVA 1R7SA 1RFKA 3SFEB 1L5PA 2PVOD 1FO4A 1CZPA 1FM0D 2PIAA 5H92C 1QF6A 3AECB 1F0ZA 4US9A 3AE6B 4N59A 1KRHA 1TKYA 1FFVA 1DOXA 4A9AA 5EE9A 1YQ4B 3AV8A 1N61A 4JX1C 1PFDA 1KF6B 3W5VB 3B2FA 1L6VA 1ZUD2 2H89B 3NVYA 3AE2B 5G5HA 1PUTA 1SF0A 4JWSC 1FRDA 4N6EB 1NENB 3ETRA 3P4SB 3P4QB 1ZOYB 3NS1A 2QJLA 4LTUA 1SB3C 1WGKA 2DBYA 4C80A 3NRZA 2QIEB 2KMMA 2L52A 3L4PA 3AB5A 2E3TA 2G1EA 1B9RA 5G5GA 2MJ3A 3P1MA 3P63A 3P4PB 5EE1A 2MH7A 1KFYB 1SIJA 1XLNA 1JROA 1TKEA 2WU2B 3AE5B 1N5WA 3CWIA 3AE3B 2WU5B 4C7YA 2CJOA 3AE1B 3AEBB 1J7BA 1QOFA 4P6VF 4FXCA 2K5PA 1VLBA 2Y5CA 4HROA 1RM6C 2CU3A 1V97A 3AE4B 5C2TB 4YT0B 2CJNA 1JWAD 1TJEA 4C7ZA 2WS3B 3PO0A 4IDIA 1N60A 5C3JB 2L83A 1J7AA 2HTME 1FMAD 3FC4A 1NYQA 1QT9A 3DWGC 1JALA 1JWBD 2K22A 1RWSA 1WYGA 1DOYA 1E6EB 2W54A 1NI3A 1OQQA 3VRBB 2MJEA 2BS2B 1AYFA 1E7PB 5EE0A 2MJDA 1TYGB 4YTNB 2DWQA 3HRDD 3AE7B 1QOGA 4YSYB 2JQRB 2K9XA 4WWMA 3AM9A 3AEFB 2AX5A 2BS4B 2WQYB 3AEEB 3VR8B 3SFDB 3B9JA 1RYJA 1GAQB 5AUIA 4YXDB 1N63A 1QOAA 2BT6A 2M19A 3AEDB 3RPFC 1QOBA 3VR9B 1VDVA 4ZHOA 3LB8C 4KX6B 3AN1A 1PDXA 4YTPB 3P4RB 1QLBB 1CJEA 2W3SA 1DOIA 2KAJA 3AEAB 1XLOA 1N62A 1FRRA 1FXIA 3B2GA 3AH7A 2W3RA 1TKGA 2EKIA 4N58A 1JQ4A 3W9CB 3ABVB 1V8CA 1YJIA 1GPXA 5H8YE 1OFFA 1J7CA 4US8A 1ZP0B 3NVWA 2ACZB 3ZYYX 3W5UB 4YSXB 1YQ3B 4WQMA
chains in the Genus database with same CATH superfamily
4ED1A 2G06A 2VA8A 3H0MB 5F9NA 4O0IA 3N9YC 2BQRA 4KSLC 9ICEA 2AQ0A 5DPWA 3ZRFA 3PHWB 1UBQA 1XLPA 5KFBA 2ZIXA 1E8ZA 2IPKD 4M01A 3H40A 4JV1A 2Q5WD 2WF7A 1ROEA 5ALTA 3U7ZA 3TADC 2HTHA 5ALFA 2WXOA 5ALGA 2XCPA 3C19A 4ICVA 3GS2A 5AZGA 5AI8A 4EZ9A 4DHJB 2DYOA 2BCUA 3C28A 2HI0A 2FIDA 4ECXA 3TAPA 3PY8A 3H0LB 4NPNA 4XX5A 1D5ZC 1BPBA 4DSFA 3RJGA 5KFPA 2B76B 1JWSD 5KFYA 2G4DB 4HDQA 3ECIA 1L8OA 1D8YA 1R4NB 2Z8LA 5KFHA 3M95A 2C2RA 2R2QA 4W9EA 1XWLA 1RG6A 1XO1A 4TUSA 2QLTA 5ALMA 1TKYA 1SKRA 2WXPA 1DOXA 3MDCA 3UF8A 4IKGA 4A90A 3W5VB 1V85A 1L6VA 1SIFA 1ZUD2 2ZTCA 3TAQA 2HDEA 1S1QB 2PFOA 2PFNA 2UWQA 3IAM1 3TSSA 3O13A 5J0YA 2A4ZA 2BB6A 4KGRA 1TE2A 1UT5A 4IM3A 7ICEA 4AOFA 3SHQA 2ASDA 1TIFA 1IXRA 3QEAZ 4C4RA 4FULA 5EWEA 3MR5A 2ZJ5A 3SAGA 4U7CA 3KUZA 4R8UA 1AN8A 4IR9A 4F5QA 3TEYA 8ICYA 4C8MA 3OHBA 2BW2A 1P7FA 1WGRA 3EW9A 2DL0A 5KFAA 4EYHB 2BYEA 4KVGB 3E58A 1ZPSA 2KE7A 5BPCA 2L1AA 2KK0A 4IWQA 2K8AA 4NAMA 4M00A 4XZ4A 4MSQB 1U4BA 3TCAA 1D4BA 1N60A 3A9JB 3F2DA 1JWBD 4U6PA 4Q44A 2BCVA 2FUG1 1V9JA 2K22A 2KICA 3SAHA 1OTRB 2HBMA 2BS2B 2KFKB 4F92B 2AQ3B 5BO4B 2ESEA 3SAFA 1E0ZA 1QOGA 4ZRQA 4KLDA 2RDGA 5AEKB 2LUMA 2MHJA 5IIIA 2KDEB 3JPTA 9ICJA 2DHZA 3QE9Y 1ZQOA 3C5GA 3KWVA 2F77X 3PMLA 4LCDE 1QOBA 4Y2XA 1HTOA 2DNFA 2MUTB 3GIIA 2ASLA 3MABA 5ALLA 1MQ3A 1XC9A 1S77D 2KEYA 1XF5L 4DLGA 4O3RA 3AEAB 2KJ6A 1N62A 3GZNB 1ENFA 2ICIA 3PHXB 4S0RA 3Q8LA 5T8IA 4WWNA 5AM5A 1HQRD 2CXYA 1TK0A 4UW9A 3RJFA 2SEBD 1YJIA 2EZYA 3ZJVA 2DGZA 9ICIA 2IZVB 1ZQXA 1YQ3B 3TL5A 4ECVA 3KH0A 4AP9A 4DFPA 5ALXA 4J9NA 4NQKE 1JXEA 3ZQ4A 9ICWA 2ZIVA 2JEIA 1K53A 2KIVA 2ZXHA 1E9MA 1URJA 2W9BA 2WXLA 2O6VD 3V6JA 9ICLA 3H7SA 4DXFA 2FBWB 3N1ZC 1NJYA 4P4PA 2OHFA 5ALYA 2KWVB 5DB7A 2ZNVB 1ACCA 4HPLB 1UQVA 1FNUA 1OEYA 1TK8A 4JWNA 1S0VA 3AEVA 2KTQA 4LJPB 4FADA 1GJZA 3PPAA 2XY7A 1KH0A 3T9LA 1QSSA 5KFLA 5J2JA 2KVSA 3QUCA 4KKIA 4FN2A 2ES6A 1DK3A 1OUQA 1JW9D 2GMIC 2DZKA 5EWGA 1SL0A 1WGHA 1UCVA 4LZGA 2KJ8A 4DS4A 2VKQA 4F2SA 3A4SC 4DFKA 3RYTA 3X0WA 4PHPA 1PGAA 1RQNA 2JX5A 4YN4A 5J0OA 9ICCA 3C2LA 2LHDA 2FJ6A 2ISOA 2G4SA 3TFRA 1S76D 4OO1J 1EXNA 8ICNA 4HK2A 4XWWA 3IV6A 3BWUD 1IGCA 3QJZA 3V6CB 2H89B 4ED2A 1MJDA 3Q8SB 4KN7A 1E90A 2FCSA 3C21A 3GZFA 2JXTA 3UXNA 4EBEA 5FR6A 4IRKA 2IGDA 1SWWA 4GDLA 1WGKA 2NBWB 2N9EB 3DCGA 4BKSD 1NZBA 4DL6A 1X40A 3L4PA 1DYQA 2MBBB 1S0OA 2WU2B 4PS8A 2NR2A 4KLGA 4P0QA 2CRXA 4BOZB 2M8SA 4C7YA 4I2FA 3N3KB 3DBRB 4M9HA 2RPQA 2LRUA 1H8CA 4RQ1A 3GQCA 4M6WB 3L16A 3PO0A 2JZBB 3JSVA 3WKEA 1NYQA 3OSPA 3H9DA 4QNLA 4GC7A 4W9DA 1WYGA 2NRZA 1TZ1A 4W9FA 4BDPA 2KN4A 3PX0A 3PZPA 3BDPA 4IWOA 4P1BC 3MTNB 3WKCA 4JK1A 3ZDDA 2QB1A 1F2RI 9ICQA 1NJXA 4M0WA 3UMGA 2VH1A 2JHDA 1WGDA 4AWJA 2F44A 2M19A 4JLCA 4WWPA 4C8KA 3IT6B 3ZO5B 5CA7A 5DB9A 1H38A 1Z2MA 2KC2A 1Z1VA 2D2QA 3GDXA 4KLQA 2E8PA 2GOLA 2Z59B 4C8LA 2KX0A 1A76A 1TKGA 3PVXA 1XS9D 2F8KA 4CGZA 1SE3A 4Z6CA 2QMTA 4REZA 1J7CA 4P1CC 4A3OA 1L7OA 4I2HA 2H3IA 3V6EB 2K8BA 4GOCA 3ED5A 2LASA 3G6YA 3KFUF 1ZRNA 3OJSA 2NPTA 4BAXA 5IP4D 5KL1B 1TS2A 3H8JA 3WCQA 2F2AB 4DK5A 2VRRB 4FJYA 3VUXA 2KO3A 4DHZE 3ZDMC 4N9F4 2KMDA 4MGKE 2BKRB 2P35A 5F9LA 4ZRJA 3ZLZA 2Y0SC 3SI8A 5ALPA 1L7MA 4ZH4A 1P0RA 2Y9UA 2JF5A 2O6VA 4RGMA 5GMVA 4GXJA 5AUKA 3CIRB 4WJ3B 4QWCA 3ISCA 3KLSX 4W9HA 4OJOA 1KFDA 2R8HA 1I35A 4F7ZA 1Z00B 3RB0A 2AQ1B 2GH1A 3WIMA 1BPEA 5KFOA 3KHRA 3KYDD 2BPCA 3NVVA 1TTNA 2CHZA 4IRCA 2ZTDA 3ML8A 3N97B 4FA6A 3A9KA 9ICOA 1L3TA 3CRXA 1P9DU 1RYSA 2G08A 5D46A 3Q8MA 4JQWC 3PLVA 3RR7A 1EF1A 3A1QA 5AM1A 2LGIA 3BS5B 2WXJA 2LYHA 1PUTA 3LVVA 2PXIA 3BY4B 3M9MB 1RPLA 3KOOA 3ZDAA 1BUIC 3B0YA 1X9WA 3X23A 5KL8B 4W9IA 4LTUA 5J18A 3GV8B 1ZQCA 2OEHA 4NLBA 3C1YA 2KZRA 3VXWA 3KBBA 2QIEB 3ORYA 2LBOA 2H3FA 4XDDA 5KFWA 3CSTA 2MH7A 1TKEA 5J2GA 1MFWA 5D7GA 3RI7C 5KT6A 3ZDCA 2IHMA 4LLGM 1GC7A 3HPOA 4GC6A 1TS4A 4MHVA 1OXJA 2QCZA 1CK1A 1UNSA 1V97A 3DBLB 4IM2A 4Y2JA 1TJEA 4RT2A 2Y0SF 5HFYA 2CN1A 4NL9C 1QQ5A 1CEZA 2LYBA 2MAXA 1T3NA 1RWSA 1E8WA 4RNAA 3W1YA 5AI5A 4DWIA 1ZD5A 2DF4B 1KLNA 2KQ7A 3VRBB 1YD8U 1NKBA 1B4FA 3O65B 3FKYA 3V3XA 3AM9A 1C3TA 3BVZA 3ZXVA 1TKDA 4LDTD 2W03A 2Y3AA 1IBXA 3RTVA 2W8LA 1WH3A 4O3NA 1J2MA 2RDBC 4KMOB 1Z4OA 3SENA 5JHAA 1PGBA 5ALHA 3IM1A 1TV9A 5B5EU 1Q10A 3SD7A 3ML9A 4A8EA 1ET6A 1QLNA 3OSNA 4GDKA 2LI6A 3R2TA 1NK4A 1L7YA 3PZ7A 3QC8B 2AXTU 4YXMA 2XC9A 4N58A 4J9PA 5KFTA 4QZIA 1V86A 1HE8A 3IVFA 2KHQA 3W9CB 3ETLA 3BZDB 1FCLA 2R61A 3IFWB 3F53A 2ZZPB 4MFCA 2UVVA 2INCC 3ZDBA 2MBHA 1C4PA 3QCAA 5L1MA 1Y8RC 4TQ1A 2JT4B 2JUOA 4EEKA 2OYYA 2HHTA 3KW5B 8ICCA 5E6JA 4ARCA 2W9CA 2DYMA 1K50A 2IO2B 3NZ3A 2X8XX 5D49A 2WP9B 5G55A 3N1YC 1IPGA 5A0LA 4O9MA 3NRWA 1PGXA 3JPRA 2M0NA 2F8LA 2WF9A 2D6FC 5HNKA 4X5VA 5DCNA 4TQSA 3Q6BA 4K4GA 3PW7A 5BYQA 3TFSA 2FLNA 4M8NA 3IP4B 4ANWA 4QZ9A 1FNWA 4LDTB 2WLBA 4RPXA 4MSMB 4RGNA 3VFKA 2KOBA 2BTEA 2JY6A 1UWMA 1ZQPA 3QU7A 1TT5B 4JWMA 4ACFA 1O03A 1BPDA 3DBHB 2HE7A 2WDVB 2I1JA 1ZQ1C 2FDRA 4UB1A 2NO4A 3U2SC 5DBBA 2FE8A 1T7PA 3PW4A 2KWUB 3WANA 4C8NA 5CB1A 4EENA 3B2FA 4LNNA 1WM2A 8ICOA 2G0AA 2KJHB 3I5JC 4C0ZA 4P4OA 4RPZA 9ICSA 3C23A 4Z6DA 2KYWA 2DFLA 4Y2VA 5AKEA 3LK9A 5JUMA 3ZI4A 3GP7A 1D6EC 1VR9A 1TS5A 4KLSA 4MM3A 2LFIA 1SKSA 4WQOB 1L7PA 2XBBC 1GC6A 4QZEA 4UAZA 2J52A 3N7PD 2VJ5A 7ICHA 2FE9A 4CDGA 3RZWC 4QZ8A 1ZDVA 1QQ6A 2N7JA 3N28A 4P6VF 4FXCA 4F5RA 4F5PA 4KIKA 3MDAA 3IDWA 4DQRA 1M94A 1MN8A 5C2TB 2PI5A 4BUGA 3KZIU 2YN4A 2DKXA 3TARA 3MFGA 2ASJA 3C29A 3SYZA 1QT9A 3PSFA 4IQTA 5TR5A 4K7UA 2IOFA 2NCNA 2MSNA 3CMMB 2VIXA 1X42A 2JGAA 2W7OA 3OLMD 5C1ZA 3HRDD 1IG6A 2AJQA 4NJ8A 4HCPB 2N9LA 5KG4A 3NZSA 3IG3A 5J2FA 2HOQA 2ZCCA 1ZQSA 2V3PA 2ATLA 1BVSA 3Q8QB 2ZW0A 1PUZA 4Q8EA 2I1QA 1D9FA 4KLHA 1VD2A 3C5FA 2LGDA 3P42A 4MELA 2DQNB 2E1EA 3ZD8A 2I1KA 4MGYE 4NJ6A 4PT5A 2HOIA 2JVCA 4II2B 1JXLA 4XQ8A 3K4GA 1L5UA 3ABVB 2ZTEA 1V8CA 4RM9A 3GFKB 3I28A 2AH5A 2PTLA 2PE6B 1YQBA 2BKEA 1C4CA 3ZDTA 4O5CA 5KFDA 2KFZA 4I6PA 3C1ZA 2DENB 1R4MI 3MGIA 4B9TA 3HUIA 2J7QB 4PHEA 3BYTB 2KDBA 3SQIA 5CHVC 3WALA 3CW2C 3EPGA 2M1MA 3NZUA 1WMHA 3BQ1A 4YMNA 3T5HA 2QARA 2BVCA 2BPGA 4K1RB 4LNOA 5ALZA 4Y2QA 1A70A 4MEMA 4LNKA 3KYCD 1D3ZA 1XLQA 2ZW1A 3IAS1 4BVUC 4RNOA 4J9KA 2MRPA 2WDQB 3RAQA 2JYEA 3SU8X 3TADA 5DDYA 4YL8A 2BWFA 4URKA 2BS3B 2IY1B 4FLHA 4ANVA 2ZJ8A 5H92C 1FM0D 2P6RA 1YJ1A 3BINA 5KFJA 3PW5A 3MC0B 1LVHA 3A0HU 4B9NA 5H2FU 2VH2A 3QUTA 2IOHA 5DKWA 1TGZB 1PFDA 1WRDB 1RDFA 1D9DA 3OJ3A 4GLXA 3V72A 1XSPA 3T8MA 3WK7A 2JV3A 1SEBD 4PHAA 1PK1B 4MACA 1TFRA 3QWZB 1T94A 4PJ0U 1NENB 2V4IB 3V60A 2J42A 5J2AA 3PV8A 1A5RA 2BKFA 2K89A 1SB3C 5JRTA 3HILA 3BQ2A 4RZRA 4LZDA 2L52A 4RNNA 1HZ5A 5IAAC 2FI1A 2DAFA 2D8CA 4DSLA 3KHHA 1RFAA 4O3PA 3E0FA 4FBJB 4J9LA 1YIWA 2MA9B 4XRHA 3RB6A 1KTQA 3AE1B 1MQ2A 4LJOB 1SXTA 1SV0C 2C2EA 4P2HA 1X66A 2GWSA 2QC8A 4EUTA 1Q5WB 3Q8FA 5KFMA 2ZIXB 4YP3A 2WS3B 5J0WA 4TKNA 4DDID 4HPMB 1X6IA 1L3SA 3V6HA 3DVGY 2NRXA 5CHFA 1JN3A 1S8OA 1AYFA 1QCKA 3PR5B 1E7PB 1FEHA 2M0AA 2WXFA 4ZRKA 5IOIA 2OM6A 3NASA 4BX9C 2HSZA 4UB5A 2AX5A 2B3AA 4GIVA 3JPPA 3OJUA 2MP2A 5CWRA 4QZHA 2R8KA 1I4RA 2DPIA 2V3NA 1MHXA 1VZ7A 3MP9A 4EZJA 2OWOA 5LXHA 1T0QC 4M47A 5GTHU 2HBJA 1WXSA 2KK8A 3U8ZA 4C00A 5DG8A 5IN7A 2J6UA 4DF8A 3ZNZB 3M9OB 4KTQA 3APCA 3E9SA 4MGZE 1S0MA 2GB1A 4ELTA 1K5OA 2PI4A 4BZAA 1HUZA 4DL5A 3G6XA 3RF9A 1C79A 4A55A 1WR1A 2CU1A 4PYUA 1YJJA 5JH5C 4I2GA 3DOWA 1FFUA 2A3VA 2HVIA 4R65A 5DPTA 1LM8B 2WXIA 1CUKA 4R8UB 5EWFA 4YMMA 1NVID 2KT7A 1UGJA 1ZQLA 1WWVA 3WK8A 3D32A 3H4DA 2Z7JA 2ZEQA 8ICKA 2PKOA 4GSWA 2KKVA 4K7WA 5BOLA 2YEPB 2JRIB 3RRHA 3H7PA 3WK6A 3LXFA 3K1ZA 4YXJA 4QZAA 3VUYA 1JMLA 5KFKA 1WM3A 2I6XA 1WRIA 4DQQA 4KZ0A 5HHHA 1WX8A 1F1HA 1EUVB 7ICUA 1KW4A 3SFEB 1F44A 1QQ7A 1L5PA 2F76X 4KX5A 4I2BA 1CMXB 4LVSA 1OW5A 9ICHA 3AE6B 2N1WA 3T5KA 4UAUA 5ALEA 5C5JA 1T6BX 1M6YA 1YQ4B 4HKQA 3QYPA 1WXAA 4IL6U 4NAWA 4RGOS 2LZ6A 1E7UA 5KFUA 1VRAB 3T5LA 3Q69A 4XUSA 1I42A 1T5XD 2BGWA 1I4QA 3OG5A 3Q8BA 3PS6A 4GU2A 3BYYB 3FM9A 2V1YA 3A4RA 3MC1A 4I27A 1UGMA 2LKYA 4KX3A 9ICVA 2MJ3A 4ANXA 4M0AA 3KHLA 1KJTA 1K1SA 2LUEA 5J2EA 5J2KA 2H3QA 4E71A 2UVRA 2LVQA 1X9SA 5J2HA 5TISU 2IDYA 2ZIVB 2IYDB 4XE0A 5CP2A 4QZCA 2WHIA 2W9BB 3PSPA 3ZNHB 4DEZA 4DOCA 2J0KA 4IDIA 2NO5A 2V9WA 4C4VA 4FE3A 3T79A 1OEYJ 1WY8A 2DZJA 2KLCA 1RRBA 4OVVA 1E6EB 2MJEA 2HBLA 1NK0A 1E5WA 5EE0A 4E0DA 4F8RA 1C78A 5AHXA 3WKDA 3DVGX 5DPRA 3IG8A 1P1AA 2KWDA 2WQYB 4TV3A 2LM4A 2BZFA 2J6TA 8ICWA 3SFDB 1RYJA 2XK5A 2L8JA 2Z0EB 3UQ2A 4L23A 4RQ6A 5J8YC 2MCNB 2MLBA 2AL6A 4DSKA 3KZXA 3J81j 3VTVA 1CJEA 2W3SA 3RNGC 8ICEA 1T8EA 2JZPA 4C56C 4UB8U 5J0UA 2OCEA 3Q3JA 3RBEA 4G3IA 1BGXT 1ESFA 1SGHA 2LJ5A 2JSVX 3PMNA 4IM0A 8ICIA 4RNMA 5ALDA 4DQOC 2MSED 3AU4A 2WX1A 1IGDA 3NVZA 4DLEA 2JEJA 3H6NA 4GDLB 4XC2A 3UM9A 1KEJA 8ICBA 2BB5A 2KC1A 3GE8C 5KG2A 1EM7A 9ICKA 1K52A 1T3QA 4EELA 4CE6A 4FZMA 3AU5A 1WR6E 2GOWA 2L0FA 3I1YA 4ACOA 4F91B 4ECYA 4P0QB 2HHSA 1AWDA 2PFQA 3AQFA 3HM6X 4EX7A 4QZBA 3SV3A 4HJGE 4TQRA 2XCAA 3CF6E 2JRHA 1KFTA 4MF2A 2H88B 2FCQA 4WH4A 3U4EG 4M9NA 3JSVB 5AKHA 9ICGA 4EBCA 2BPFA 1ZQKA 2KFJA 1V38A 8ICSA 3RH6A 1KKXA 1MSWD 3ICXA 4DL3A 3QNMA 4CO7A 5BMHA 3VVWB 1FO4A 1WIAA 1WX9A 4M0WB 4ICUA 3ZTCA 3M8SA 4KKJA 1HEZE 3HK0A 1CI4A 3RB4A 1YOVB 9ICFA 2LD9A 2BYFA 4ZRIA 4ELUA 1R4NI 5AKYA 3NVYA 1QILA 5IILA 4ECTA 1BPXA 2W9MA 2I9GA 5J0SA 3ETRA 4OD0A 8ICPA 3QARA 4B6JA 3RZFA 4W9JA 1TK5A 2RLTA 4UBCA 3T3NA 4BXOA 1RXWA 2V9HA 2KHVA 3NY5A 3S2AA 4RQMA 1V1PA 2RDJA 2A1JA 4MH0E 3CWIA 4R3DA 3Q8CA 5J29A 2GO7A 2KXJA 2OOBB 2NRVA 5BYSA 3K9OB 2K8BB 1WYWB 3UIOB 4Z6EA 2ZIWA 2NPTB 5BMGA 1VLBA 4ED3A 4BFRA 3ZGZA 4FJZA 2W43A 5IA7A 1WZ3A 1F0MA 1D8LA 1S5LU 1JWMD 4NM2A 5KTQA 2DZMA 3A33B 3G6VA 2C7NB 1J7AA 1K1QA 7ICKA 2L5YA 3HWTA 2Y5BB 4M8MA 3E56A 3W1SA 2O6VB 4MH8A 1YZ6A 3N7SC 2M9NA 3UXOA 3WU2U 4UB2A 4TUQA 1ZQDA 3Q8KA 2G5HB 2EDUA 2BCSA 1ZQGA 4RQ8A 1AW7A 2K9XA 2BYVE 1VCBA 2NRWA 2YB4A 5AKXA 3NS8A 3BQ0A 2D3DA 3RB3A 3VAWA 3EGRA 2BQUA 2QB0A 4WJOA 1N63A 2K4EA 1WJUA 2HDOA 2YLMA 2OJWA 2BT6A 1U47A 3VQIA 3A9KB 4JPSA 3DEEA 2AGOA 1XSLA 3GB1A 2HHQA 5D2MB 2NRTA 2C7HA 5IIOA 3GILA 2KFKA 1L2NA 1J19A 4ZRPA 2WF6A 1DOQA 4XA5A 4L2YA 3A1QB 2AEHA 2MBQA 1JQ4A 1WGYA 8ICJA 3MBYA 4DL4A 3C0RB 1U4AA 1GPXA 4C4TA 4UB3A 3WAMA 2WAQF 4Z6FA 2KZ3A 4IC9A 4J03A 2XGPA 1B1ZA 4FZNA 1UH6A 2AQ2B 2N7DA 4G0NB 5LLIA 2V0GA 4J9RA 3DV9A 3U7DA 3AMZA 5AKIA 1LXDA 3VCBA 1RQLA 4UAVA 1EF5A 3RNBC 1ZKHA 4HYKA 1KLUD 4HXDA 2E8MA 2LMRA 1XSNA 4KDIC 4CQNA 3APFA 5LNK1 3AE8B 3U52E 2AGPA 3RMKC 2IHNA 1JRUA 3HKZC 1L0XB 2YB1A 1BNOA 4IQWA 7ICOA 3D2NA 1Y88A 4Q8FA 4TQ0A 2YX8A 3HVDA 2LEKA 3BQ7A 3C2KA 5TZVA 2W9AA 3WA0A 3KKAA 2PIAA 3UGBB 4AYBF 3Q8RB 4JV2A 1N2XA 4RQ3A 5KFZA 2FPMA 1FFVA 3RCZA 2KSOA 3RNAC 2JU6X 1IBXB 3GIKA 4ECRA 3PRZA 2G9HD 3VH4B 2RMMA 2RR9A 3MHZA 2WXHA 2RRDA 3R9KA 4CF3A 4GDKB 5L1JA 1A0PA 1UZXB 3NS1A 1UBIA 2IGHA 3IHPC 4CYEA 8ICQA 2C60A 4RH6A 2EQYA 2K4IA 4PZNA 2XVTA 4YR0A 3LWMA 3EZ5A 3HIZA 4B0EA 2G1EA 3MC9A 2DZIA 4HAIA 3AULA 1JROA 1AARA 3DQVA 1MC8A 3AE3B 4PZOA 4IS7A 3N32A 3V7KA 4DFDA 7ICNA 3R2IA 2CJOA 2FMPA 1OQYA 4W9LA 2KD1A 2BHNA 2W9CB 4UBBA 3OHAA 4NXZA 1DK2A 5AI9A 1FXTB 1DGSA 3UQAA 1SL1A 2FLLA 3HKZF 2UVWA 2HTME 1T0RC 2RQ5A 2RSUA 3DWGC 2WWZA 3RULA 1ISNA 1FEZA 3UMBA 1MPEA 4KDLB 3L17A 5ALSA 9ICPA 2C2DA 1VZ6A 3TBLD 2QHOA 1MHHE 5ALRA 2YEPF 4RGTA 4MJSA 5CHWA 2V4RA 5IIKA 2W82A 2H3ZA 2KQSA 1OGWA 4NQLB 4EZLA 4B9MA 2N9XA 1SL2A 9ICBA 2FNJB 5KG5A 2GLEA 2KX3A 3F5AA 4O3QA 4BKTA 2YMPA 1LV5A 2IJ0A 2LI5A 4NJCA 3N4MB 3RNCC 3P4RB 1TY2A 3UIPB 4CF5A 5CR0A 1XLOA 2M4NA 3TANA 4I2AA 4UQGA 1ZQIA 4KSKC 4F4YA 4M2YA 1BPYA 1P7DA 2LVOA 2A19A 2MBEA 5J0PA 1ZP0B 4WAFA 4RCOA 4XWTA 1A77A 4QAYA 1NEKB 3MJWA 3PSEB 2FPKA 5L9XA 5CRXA 1SGGA 4PGXA 4ECQA 1EWYC 2PMZF 5HMLA 5AK6A 4GN1A 4MM3B 3PSIA 3WAOA 4HRSA 1SXEA 1GG3A 1COKA 1J2NA 3I3TB 4DOBA 5HR6A 3HVZA 2XEWA 1V6EA 3N7RC 3UI3A 1E10A 5KFFA 2FMSA 1FNVA 5MPOA 2KIWA 1WJNA 1TAMA 2W04A 2DKZA 2M0XA 1JRPA 4O3OA 2H3VA 1UA1A 3SZ2A 1YX6B 2NBVB 5KHQA 3JPOA 4K4HA 4WAAA 5D94A 2KP7A 1WFYA 2Y5PA 4PPXA 4CHKA 2ZPNA 1KRPA 1QTMA 4B0MA 3O0FA 2MA1A 2DAJA 2LMCA 3PT2B 4Y2SA 1KRHA 3SEBA 2W11A 5ALUA 4YMOA 5KT4A 5T14A 2XY6A 3UQBA 2EAMA 5EE9A 2JZ3B 1JMSA 2JEFA 4RQ2A 2KZZA 3Q3OC 4JX1C 7ICTA 5KFGA 2J4XA 3Q8PB 3MHSD 1TVAA 2KHWB 2OH2A 2HHWA 1SF0A 3PO5A 1STEA 3AI5A 3OGUA 2UU7A 5CTRC 2ZNVC 3BK2A 5DQHA 1ZD2P 1U45A 1PQSA 1F2RC 4ELVA 2DBYA 1V1OA 3RH4A 2C5LC 1CRXA 2NTTA 4DSEA 4K4IA 2JYTA 4DXGA 1F5SA 5G5GA 3P1MA 1N6ZA 4BBNC 2PE9A 4HJKA 3ZJTA 4TUUA 5KFEA 1BNPA 5AI4A 2ZUBA 1Y56A 3H8WA 4EEYA 2FCMA 2ON8A 2WU5B 1ZQHA 3J9CA 4RF0A 2KZMA 3RH5A 3TIXA 3LVWA 2FUHB 3GV5B 2K8CA 4BGDA 5BYRA 2HHXA 4C7ZA 2K8HA 3AQEA 2QEJC 2AU0A 3EFUA 2G09A 2JH1A 5DPSA 5I4DA 2J6SA 5AKKA 1R4MB 2Q0ZX 1WMHB 2JWUA 5KFNA 4PYZA 1SV0A 2IBKA 3ZUNA 1N48A 2QARB 3DBLI 4Q45A 3TEXA 1C7YA 1WJ4A 1S9FA 1F52A 4YVZA 4YTNB 1EWCA 4DWFA 2JQRB 1MVKA 3EECA 3ZTDA 2YY6A 3Q8EA 4JMUA 2WDTB 4ED7A 3K9PB 2YMLA 1QOAA 2ASQA 4G11A 2YTUA 2ZVOA 3LDZE 5ALNA 4UAWA 2AHOB 2Y9TA 1LGRA 4B9UA 1QKZA 2LHTA 5L1LA 3HHMA 4MGIE 2RHFA 3B0AA 1XU4A 1FRRA 5AM4A 4MDKE 2EKIA 2KTRA 2KVCA 2VANA 4OHJA 2G3QB 5E6OA 4RQ4A 5FKAC 1ET9A 1PK3A 1ZQUA 8ICXA 2F1IA 1O08A 4MF8A 2WXMA 3DHGC 5E6PA 4JL9A 4BBNF 1ZQZA 1ZYQA 2W9NA 2INDC 5JZEB 3KHGA 2Y1JA 4B9SA 4AS1A 5ALKA 1NNLA 2R8JA 3BIID 2K3UA 4QZFA 4LK0M 3M7DA 2D10A 1ZD3A 3I9V1 4HVBA 3CP8A 3OTQA 1TAUA 5AIBA 3MC8A 1CQVA 1J97A 1IUEA 4EE2A 5HI1A 4ZDVA 3AU2A 4UB4A 2NBUA 4NNJB 2XICA 2INPE 5HHIA 3HX0A 3BK1A 4W9GA 4QIWC 3BZCA 4DHZB 1HJPA 4FJVB 1D5MC 3VRAB 4M02A 1U49A 4NLGA 3NUQA 2ZCBA 3BVMA 4US9A 1NK5A 2CHXA 7ICIA 3U26A 2O2VA 3RNEC 5L1IA 3VTUA 4AJYB 4II3B 1VZ8A 2XY5A 1N61A 1KF6B 3EA6A 2E8OA 4OJ5A 2MP2B 3GOEA 2K0PA 1GUAB 2WNMA 3NUHB 2JXXA 2EAPA 5G5HA 4P7IA 3W2DA 1AROP 1FRDA 2F3NA 3M6KA 3V05A 4KLJA 2WX0A 2N1VA 2PKEA 9ICTA 2WXKA 2RGFA 4KLLA 1BT0A 3L08A 2WF5A 4IRDA 4HEA1 3CNHA 4DL2A 3QUBA 3MR6A 4UATA 3ZW3A 3F2CA 1BPZA 2PEAA 3PVLA 1LKYA 2KKPA 1L3VA 1KFYB 5KG6A 5KFQA 1IP9A 5E6NA 2RP5A 1MG4A 4F4WA 3KTQA 3AEBB 1C4AA 1IM4A 4NWIA 2O6KA 1QOFA 1QH9A 4B9VA 4DS5A 3C2MA 4C4SA 4KLFA 4KLEA 4IR1A 2KLGA 2MQJA 4NZLB 5ALIA 3LWLA 4PS3A 4PHDA 1WF9A 2YVCA 1KBUA 2H5XA 4NLNA 2MRLA 1Q1OA 3B08A 1Z3EB 4KZCA 2EZXA 1N56A 1DOYA 1KM7A 4YQWA 1SKWA 2EANA 5KFCA 2ALZA 4JE3B 4ECZA 5KT7A 1NJZA 2E5SA 3AE7B 3H7PB 4QIWF 4LNFA 1FPYA 1ZQVA 5DBCA 4FZLA 4PL1A 1GAQB 4EEWA 5HMMA 3M62B 3S6JA 3EPIA 3VR9B 2KACA 7ICRA 4KX6B 2J0MA 1HA5A 2KAJA 5J0TA 4M9JA 3EHVA 3M8RA 5AZHA 1YT3A 4NAWB 1GB1A 2K4PA 4L1BA 3RBDA 4UB6U 2XIDA 1MA7A 2L76A 4OCZA 4S17A 4USAA 5F3XB 3TACB 2P6UA 5EE3A 2N9KA 3KD3A 1VJKA 4F3OA 2ZJDA 3P2BA 2BQQA 4IW0A 4X57B 8ICUA 4XGAB 4GMVA 1UT8A 1KFSA 4IOIE 8ICLA 3BVGA 3JPNA 4WJPA 2LM1A 5IIJA 3SMVA 2BR0A 1SJED 3M1YA 4OVZA 3FAHA 4GXKA 4I29A 4GXBA 3VTWA 2FMQA 4KLOA 1Z5SB 2N0SB 5HR7A 5DGBA 4LNIA 3DWMA 2UVUA 4C4VB 2M17A 2Z0DB 5DDMA 4QZGA 5KNIA 4ECWA 3KUDB 4YTMB 2IOFK 3WK5A 2HW3A 1WJ6A 2JPHA 2PVOD 3Q14C 3HJEA 3Q3MC 3QEBZ 9ICNA 2NVUI 4RUAA 3GIMA 4HLEA 2WFAA 2XK5B 3WK9A 3AV8A 4J9QA 5HG2A 4R63A 3SV4A 1Q8KA 1ZQQA 4NLKA 2IO1B 4Q43A 4N6EB 5FK9C 5L1KA 2K6DB 3P4SB 1SE9A 3ENEA 1WE7A 3ZNID 3MFIA 1SSNA 9ICRA 4KLMA 3NRZA 2C9WB 1V5OA 4GXIA 1KL9A 2E3TA 2DYBA 4J6IA 4QJFB 4HCNB 5KHOA 2KJ5A 1ZQTA 1NKCA 4EZ6A 3ONNA 1F9JA 5J2RA 4MT5A 2ZG6A 5DB8A 4QWEA 2E1FA 2BGFA 1S10A 3Q8AA 4BOSC 4BWJA 2E8NA 4KGTA 2HCFA 1C9FA 3QZ8A 4ED6A 3PX4A 3NJTA 1VJ5A 4DQIA 1FMAD 5HHDG 4IC7B 2KMCA 1TBEA 4DSJA 2KTFA 5AM2A 1SJHD 8ICHA 2OJRA 2D3GA 3BQTA 4FFDA 2G45B 2MWSB 4WJQA 1YN4A 2B0CA 4IQVA 3AEFB 2BDPA 1T0SC 3AEEB 4KGSA 5AUIA 4DOAA 4YR3A 3QQ8B 4FHJA 4KLUA 4QZDA 8ICVA 3V6KA 4OZBA 2XGQA 5D4BA 3AEDB 3VH3B 2YMQA 3AN1A 2EKEC 4HPPA 2HJ1A 2FPLA 2KNBA 3RN9C 1QLBB 3M9NB 1FXIA 5IINA 5ALWA 3SDLC 1KQQA 1KOTA 2ZIUA 4QWBA 2HHUA 2ACZB 2RD0A 4G50A 5JTIA 2OEDA 3QUQA 4WURA 2XN9C 4G3XB 2Q4TA 3JPQA 2LRWA 2LWPA 4JWUC 4BXOB 4RM8A 2LJIA 9ICAA 1WSPA 4EKUA 4ASWC 4FS2A 1V1PB 3EC8A 2A1JB 2AL3A 1L0YB 5ALOA 3PGEA 3PZ8A 1J0GA 1FIQA 5AK5A 3DHHC 3H8HA 1XNSA 4ZOHC 3RUIB 1WXQA 2ZIWB 4I2DA 1BXTA 3ONSA 2KDIA 4MFFA 1ZXIA 4I2IA 4FS1A 8ICRA 2DPJA 2R8GA 3LYYA 3TEWA 1I7HA 1B43A 2EZZA 2NS5A 1SZHA 5ALVA 2Y1IA 1C1YB 2ISPA 1C20A 4UARA 1TY0A 1WCNA 1S3SG 1FCCC 2IO3B 5J0XA 3AUOA 4A6QA 2K25A 3I76A 5DBAA 1CZPA 3ZNGC 2MEKA 2I38A 4N59A 4P0PA 4XDCA 2LGYA 2EAOA 3KVFB 4UAYA 2QB0B 4O1NA 2WXNA 3FILA 2R18A 1K51A 2REXA 4I6LB 4NJ7A 2G5IB 3PW0A 3GIJA 4RPYA 2BDUA 5KFVA 1JWUD 5ALJA 3PR4A 1WXMA 1SXDA 3I63C 2QJLA 1HTQA 7ICMA 1WX7A 1WG8A 5J2DA 2KMMA 2WB1C 7ICLA 1V80A 4F5OA 1P98A 1ZXHA 3P63A 3P4PB 1XLNA 1ZD4A 1T4GA 3NGDA 4Y2UA 1XD3B 4M9GA 7ICFA 4I6NB 5D3IB 2BYTA 4AP4C 3HM3A 2EMSA 1Q46A 2SAKA 5C23A 1WZ0A 3AE4B 4MEYA 2CJNA 4HKZE 4DSIA 4LJXA 1JI7A 3MGVA 4Y2YA 4YCXA 3TEZA 2JXJA 3U30A 5AK3A 3RRGA 5AK4A 4NLZA 1I4PA 2CKHB 3PTFC 1NI3A 3BJYA 5FR3A 4BJQA 1HUOA 2WAQC 1U48A 2MJDA 5GTIU 4ECSA 2A1AA 3MR3A 2VZKD 4TUPA 1PVRA 4FBTA 1V2YA 2BS4B 2K6QA 4GLSC 3RD2A 4QWDA 1GOZA 4NV0A 2A5UA 2EMTA 1KLGD 2K60A 4QW8A 1C77A 3PLUA 4JV0A 1PDXA 2LXCA 4YTPB 1ZQNA 4HDOA 4ICAA 5KG3A 5KG7A 4O3SA 3ZD9A 1RAXA 2JZZA 2KSOB 2N1RA 2KNJA 4PK1A 2JMGA 1WGGA 1NOMA 2GBKA 4KITB 3GV7B 4UASA 1HEKA 4IQUA 2L32A 4RU9A 2CPRA 3DPDA 3PRMB 5H8YE 3URYA 2KANA 3NVWA 5KG0A 2IY0B 2V3SA 2AWTA 3W5UB 4E3CA 1S0NA 2WB1F 1KDHA 4NL9A 4F1SA 4NY0A 4AYBC 5KT3A 2WHEA 4DF4A 1WE6A 1TAQA 4OZCA 1XO3A 2RDIA 1X1MA 4I2EA 4M9LA 1L6UA 3A9JA 2VZKB 1BMLC 5DG9A 5AIAA 3TKAA 4F71A 1NYRA 3ISDA 4ED8A 1ZQRA 1YZ7A 2M56B 1GB4A 3QU5A 2KN5A 3SEIA 4ARIA 4DL7A 1T0YA 2GBNA 4O5KA 1N5XA 2K1FA 3GZNI 3D2SA 3MR2A 2NMQA 3OJ4B 1Z19A 4B9KA 1RFKA 3HP6A 2FLPA 3VHTC 5L95C 2MUTA 2KOXA 1XT9B 3EWAA 1EO6A 2PPHA 4MJSB 3AXCA 2PJHA 3Q3FA 4A9AA 1AQ6A 2JH7A 1ZQBA 4P16A 3AE2B 3FYHA 1Q3UA 2ODGA 7ICVA 1B0XA 8ICGA 5AKLA 4RF1A 3LYSA 4J9OA 1NKEA 5AKJA 1ZE3D 3EYZA 3AB5A 2MBOA 3M63B 1B9RA 2C28A 5AZFA 2BBCA 4YSXB 5EE1A 2KDMA 2R2OA 1SBBB 2D5GA 1N5WA 3IBEA 5HKHA 2FCNA 2WXGA 3NTUA 1ED1A 2DX5B 1D8BA 4Y2PA 5C0YA 2AYOB 2Y5CA 4HROA 5ALQA 3R7QA 5DLFA 2WF8A 3K1RB 3M3JA 3D6JA 3LDAA 8ICMA 1HXYD 1EU3A 4GGQA 1GO3F 2BQ3A 1E8YA 1F77A 4XYCA 4KN4A 3QU9A 1JALA 2LHEA 2RDHA 5AI0A 2JR5A 4ED0A 4I2CA 2CHWA 4KMUA 1OQQA 1XXGA 4CF4A 3JW0X 3RT3B 2WGSA 2DWQA 4YR2A 3F2BA 4B9LA 2KJRA 3L0WB 1JIHA 4WWMA 5K4LA 5KAIU 3V7JA 3RJJA 2PMZC 3B9JA 1X9XA 3UINB 2HBKA 4OVUA 3TJPA 5L83A 4OJ6A 4ZHOA 3QU2A 3NHEB 5BMIA 4DO9A 3H0RB 4AJWA 1DOIA 1M4VA 2EELA 1ZQEA 9ICMA 2W3RA 3APDA 4O3MA 2IO0B 3DBRI 3RFAA 1QSYA 2PLPA 1JUDA 2AGQA 1V9PA 4J9SA 3VUWA 5FP0A 1L4DB 1L7NA 4K81A 2KQ4X 3N1XC 1SE4A 1V49A 1WUDA 4QWAA 4PH5A 4TSSA 2G07A 3NG0A 4AUQC 4C8OA 2D3CA 5EDSA 3MFHA 1NDDA 4M6WA 2JZBA 4YG2A 1NK7A 1I4XA 2HVHA 3DDCB 4JIOU 3SR6A 3R8BA 4M04A 1KTKA 2HD5B 4EYIB 4OJLA 3KWLA 2ZUCA 4KLTA 3EUB2 4A3PA 2K8CB 4ITKA 5AM0A 3JPSA 3LB8C 5J2BA 2L05A 3IHQB 1DXSA 3B1LX 3QA8A 4I2JA 3OAWA 2K39A 4F93B 2KJ9A 3UPQA 3AEGB 5J0RA 1YMHE 2N9PC 3PRPB 3CYMA 4BKSA 1F0ZA 3DDHA 1ZOLA 5BOMA 7ICPA 4CRXA 5DGAA 4PGYA 3KQ4A 1PVPA 3W1SC 4FBUA 3BZKA 4HWIB 3T3FA 4PGQA 3ALBA 2X38A 4PS7A 1WXVA 4CCHA 2GBJA 2BWES 4Y2TA 4K3BA 3MGHA 7ICGA 4KIKB 2ZUDA 9ICXA 4RUCA 1C76A 4K3CA 2LGSA 4WIPA 1ZOYB 3JVZX 1X6JA 4YWGG 2JRZA 4C80A 2KTRB 1NBFC 2BPSA 2B21A 2XI9A 2QDFA 2HJ8A 4YD2A 5TSSA 3UXPA 2KKCA 4DQSA 2GBMA 4TURA 1XEEA 2KDFB 2KFNA 4CNQA 4YT0B 1QZEA 1P3QU 3GE3C 3LJ3A 2D07B 3DBSA 3FC4A 1MG8A 3KUCB 3TMPB 2QSDA 1Z00A 2W54A 1I4GA 3I57A 3QHTA 1WCLA 3TQ1A 5AI6A 4RMAA 4OZAA 5KFSA 1UELA 1ZW7A 4DBGA 4F8CB 1ZRMA 4J9MA 3VC8A 2NTSA 1X9MA 4W9CA 4YXDB 3RAXA 2QKQA 4YFKA 4EFOA 1Q3VA 4KV2A 2VJ4A 3BS5A 3WAPA 4GB9A 3QAQA 2PW9A 2INNE 3H7IA 1SWVA 2HOFA 2O2VB 2R8IA 3PNCA 2JEGA 4JB3A 3B2GA 1G6JA 3L13A 4BKGA 5DG7A 3KKAC 2LGXA 2BF8B 2EH9A 3M6ZA 1FD6A 2P66A 4F50A 3N30A 4DFMA 3V61A 1ZJNA 2NV3A 1OFFA 5J2IA 1NK9A 1DRGA 7ICJA 7ICQA 1XCTL 5JU5A 3R3MA 4WQMA 3ZDEA 2MU2A 2IA6A 4GFJA 1QSLA 1WI0A 3JYUA 1FXAA 1LO5D 3MJ5A 4YSZB 3AL0B 1S97A 2WYQA 1RLFA 4RQ0A 1LKYB 2GRIA 4DXAB 4IUMB 1NK8A 4R64A 4ZYSA 5B66U 1EU4A 1UD7A 2W55A 4DFJA 1ZDXA 3T3OA 3QXGA 2W7PA 4RQ5A 1WWTA 2F1HA 1L6NA 2IBIB 3AU6A 4FO6A 3D2QA 1K8RB 1PZNA 3QU4A 3IRUA 1DGJA 1L0VB 2L3ZA 1I4HA 1L3UA 2J0JA 3ZJUA 1RXVA 3NOBA 2DLBA 3ZKJC 4ZHPA 2L7RA 1ZQMA 3AE9B 2UYZB 4KLIA 1R7SA 2F1JA 3PW2A 1ZGUB 2D11A 4GIBA 1QF6A 3AECB 2IMWP 4K7SA 2PMVA 8ICAA 8ICTA 1KSPA 1P7EA 1UPHA 1TZOA 4DQPA 1PYWD 1ZQYA 1ZETA 3C8YA 4JWSC 2J53A 2GBRA 2GLSA 1B22A 2KD0A 5KG1A 3P4QB 1NZPA 4F2RA 4DCCA 3H8MA 3L10B 1D5XC 1SV4A 5IKCM 1ZQAA 5KFXA 5LXIB 1E7VA 1Z1BA 5KFRA 3AE5B 1ECWA 4BWMA 2V4QA 2YQEA 1XCQL 4JGHB 4OW0A 2CR5A 2KN7A 3DVNU 1HIWA 1YNTE 1YN5A 4FHKA 2KG5A 5AKGA 1KN5A 5CEHA 1WWUA 2K5PA 3IXSA 1KLVA 4MEXA 4F4ZA 1ZQJA 2YMMA 1TS3A 2AQ4A 1NK6A 3DBHI 1JWAD 5CX3A 1J8CA 5DLGA 1JX4A 1LFDA 2ONQA 2ZXIA 2I5HA 2JWZA 3WK4A 2L83A 5C3JB 1Z4NA 3UQ0A 3L5KA 2D3BA 1IIPA 3PO4A 5AICA 1H4RA 3ALRA 2GI9A 5AKZA 4IWPA 4F4KA 1JCKB 1LQBA 3Q3NC 3PSTA 1IYFA 4PL2A 4ZYNA 1ZJMA 2E6XA 3BS7A 1ZQFA 2LVPA 2WXQA 4J3OD 2I2YA 5E79U 5JHBA 4EX6A 1V81A 3Q2AC 5CJ7A 8ICFA 2N4FA 2D3AA 3RJHA 1GNUA 3L3FX 3FDSA 1COOA 2HMXA 3PV1A 5HP4A 2C22A 5KT2A 1UHUA 5IIMA 4H2AA 3IT4B 1U9LA 4Y2RA 2BCRA 7ICSA 3B0XA 3ISBA 3TI0A 1L4ZB 3GU3A 3H8SA 4WJNA 1OQRA 4OJPA 5DB6A 1Q0WB 4EZKA 1MI0A 2WDRB 4F5NA 1RYRA 4I28A 2LXAA 3V62A 2OXOA 1YN3A 3RJKA 3RJIA 2BCQA 1RZTA 2KMAA 3HW8A 1UUPA 3QZ7A 1LB2B 2N7EA 4F72A 4D2KA 4G9BA 4IG7B 3H4BA 2L0TA 2QILA 3K75D 3N20C 2XNAC 4ECUA 4DDGD 2ZPYA 2FIFA 5GXGB 2PVGC 5J8YA 2CS4A 5J0QA 2B6GA 3T5JA 3VDZA 4Q2JA 2ZJAA 4E74A 1QQRA 2KVZA 2K4HA 3RJEA 4B6WA 2PFPA 2C7MB 3PREA 3WKAA 4UDUC 4P4MA 4MFAA 4A20A 3RR8A 1IV8A 1L8LA 3PX6A 3ZVVA 1A6SA 3CSFA 1SE2A 2DUYA 3ZRCA 4A8XC 4YD1A 2VA2A 3R7RA 3RNFC 1X2IA 3R66C 5DQIA 1SZPA 2HHVA 5KFIA 2KVRA 3DHIC 2WXRA 2W8KA 2ZIUB 5D6JB 2KV2A 3E2EA 1SIJA 4JUZA 3SD5A 3WKBA 4ANUA 2MW5A 2L00B 9ICUA 3OPXA 3UMCA 1V5TA 1HZ6A 3QX1A 1UWXA 1J7BA 1PVQA 5AM3A 3V7LA 1RM6C 2WTFA 2CU3A 4NY8A 5D3DA 4TMAB 4W9KA 3QX7A 3QK0A 4B95A 1RYUA 5DQGA 4RQNA 4RT3A 4O5EA 4EOYA 3HT3A 5EOZA 3IN5A 3TUOA 2TSSA 1XO0A 1ZQWA 1TYGB 2V4LA 4EBDA 1YX5B 4YSYB 2ZVNA 4RQ7A 3A0BU 5J17A 3OWEB 5G2NA 3VR8B 3PZDA 2RPVA 4DHJD 3L54A 3ZXRA 3ZIMA 2FAZA 4AQ7A 3DVNV 5KAFU 3RPFC 2MX2A 3QIJA 1VDVA 2VA3A 4QW9A 3H1UA 4WWOA 3RFZB 1PK1A 2KWCA 3THVA 4R66A 4NM1A 2IGGA 4P0PB 8ICZA 3EFCA 1UF0A 1UA0A 2XO7A 5J2CA 4F4XA 3AH7A 4RFBA 2LPEA 3FILB 5IO9A 5JXVA 1NJWA 4NLCA 2NYVA 5KT5A 3ZYYX 4US8A 3IG5A 5CHGA 2LYAA 1E8XA 1NI2A 1XQQA 3F5EA
chains in the Genus database with same CATH topology
1C4CA 1NEKB 3N9YC 1EWYC 4MM3B 3HUIA 4HRSA 4OZCA 1XLPA 1XO3A 2IPKD 3BYTB 1L6UA 2Q5WD 3HVZA 1ROEA 3U7ZA 2VZKB 1BMLC 3UI3A 1E10A 1FNVA 1NYRA 2WXOA 5MPOA 2M56B 3GS2A 1GB4A 1A70A 2DYOA 1JRPA 1XLQA 2ZW1A 3IAS1 2WDQB 4ARIA 1E0ZA 2JYEA 1D5ZC 1N5XA 2B76B 1JWSD 2Y5PA 2NMQA 2Z8LA 2BS3B 1RFKA 5H92C 1FM0D 4B0MA 2LMCA 3SEBA 1KRHA 1TKYA 3MC0B 2WXPA 1DOXA 4A9AA 5EE9A 4IKGA 4JX1C 4A90A 1PFDA 3W5VB 1L6VA 1ZUD2 2J4XA 4P16A 1SEBD 2HDEA 3AE2B 1SF0A 1STEA 4MACA 3IAM1 3TSSA 3O13A 2V4IB 1NENB 2J42A 3BK2A 4RF1A 2BB6A 1SB3C 1F2RC 4KGRA 2DBYA 1V1OA 1ZE3D 2NTTA 2L52A 2JYTA 3AB5A 1HZ5A 4DXGA 1B9RA 5G5GA 3P1MA 2BBCA 4YSXB 2KDMA 5EE1A 1SBBB 2D5GA 3ZJTA 1N5WA 1Y56A 2ON8A 2WU5B 3J9CA 4RF0A 2WXGA 3AE1B 1AN8A 1SXTA 3TEYA 2BW2A 2Y5CA 1P7FA 4HROA 1ZPSA 2L1AA 4NAMA 1HXYD 1EU3A 3Q8FA 4C7ZA 5BYRA 2WS3B 1D4BA 2QEJC 1N60A 1F77A 5I4DA 1JALA 1JWBD 2FUG1 2JWUA 2K22A 2LHEA 2RDHA 1OQQA 1XXGA 3TEXA 2BS2B 1AYFA 1E7PB 1FEHA 2AQ3B 2M0AA 2WXFA 4YTNB 2DWQA 1QOGA 1EWCA 4ZRQA 2JQRB 1MVKA 2RDGA 2LUMA 4WWMA 2AX5A 3Q8EA 3B9JA 1QOAA 3KWVA 1I4RA 1QOBA 2V3NA 4ZHOA 1MHXA 1QKZA 1VZ7A 3MP9A 5BMIA 1DOIA 1M4VA 1XF5L 2EELA 3AEAB 1N62A 1ENFA 1FRRA 2ICIA 2W3RA 5T8IA 2EKIA 1HQRD 4OHJA 5FKAC 2SEBD 1YJIA 1ET9A 3ZJVA 2PLPA 3E9SA 2GB1A 1YQ3B 2WXMA 1L4DB 2KQ4X 1C79A 4A55A 1SE4A 3ZQ4A 1K53A 4TSSA 1YJJA 1E9MA 2WXLA 1FFUA 4DXFA 4AS1A 2FBWB 2WXIA 1I4XA 2OHFA 3BIID 3R8BA 3SR6A 2K3UA 1ACCA 1KTKA 1NVID 1FNUA 1UGJA 3KWLA 4LK0M 3I9V1 1KH0A 3EUB2 1CQVA 2PKOA 1IUEA 4ITKA 4KKIA 3LB8C 2YEPB 4EE2A 5HI1A 1JW9D 3LXFA 1JMLA 1WRIA 2INPE 3BK1A 1PGAA 2JX5A 1D5MC 3VRAB 3AEGB 3SFEB 1YMHE 2LHDA 1L5PA 1F0ZA 3BVMA 4US9A 3AE6B 3KQ4A 1T6BX 4XWWA 1VZ8A 1YQ4B 3BWUD 4HKQA 1N61A 2X38A 1IGCA 1KF6B 3EA6A 4RGOS 2K0PA 1VRAB 2H89B 3Q69A 3NUHB 2WNMA 5G5HA 3W2DA 2JXTA 1FRDA 1C76A 1T5XD 3V05A 4WIPA 1I4QA 1ZOYB 2WXKA 4YWGG 2IGDA 3Q8BA 1WGKA 3BYYB 4C80A 4HEA1 3L4PA 1DYQA 2MJ3A 1KFYB 2WU2B 4C7YA 5TSSA 3AEBB 1C4AA 1QOFA 2IDYA 4XE0A 1XEEA 4NZLB 4YT0B 3PO0A 4IDIA 1NYQA 3FC4A 1DOYA 1WYGA 2QSDA 1E6EB 4JE3B 2W54A 2KN4A 2MJEA 1I4GA 3I57A 5EE0A 1C78A 3AE7B 4OZAA 1F2RI 4M0WA 2KWDA 2WQYB 3SFDB 2NTSA 1RYJA 1GAQB 4YXDB 4L23A 2M19A 3VR9B 2KACA 2PW9A 3IT6B 2INNE 4KX6B 1HA5A 2KAJA 1CJEA 2W3SA 3B2GA 2JZPA 4C56C 1TKGA 4NAWB 1ESFA 1FD6A 1GB1A 1SE3A 2JSVX 2QMTA 4L1BA 4REZA 1OFFA 1J7CA 1XCTL 4WQMA 4DQOC 1IGDA 1FXAA 3NVZA 4GDLB 1LO5D 3MJ5A 2BB5A 4USAA 4YSZB 1EM7A 1TS2A 1K52A 1T3QA 2N9KA 5EE3A 3WCQA 1VJKA 2GRIA 4IOIE 4ZYSA 3BVGA 1SJED 1AWDA 1EU4A 1ZDXA 2W55A 3T3OA 4OVZA 3FAHA 4HJGE 1WWTA 4RGMA 5AUKA 3CIRB 2H88B 2N0SB 4WH4A 1DGJA 1L0VB 3U4EG 3DWMA 1I4HA 3ZJUA 3KLSX 2DLBA 4ZHPA 3AE9B 2AQ1B 4YTMB 5BMHA 3NVVA 1R7SA 2PVOD 1FO4A 1QF6A 3AECB 4KKJA 1HEZE 2PMVA 1P7EA 1TZOA 3AV8A 5HG2A 2LGIA 3NVYA 1PYWD 1QILA 2WXJA 3C8YA 1PUTA 4JWSC 2J53A 4N6EB 5FK9C 3ETRA 1BUIC 3P4SB 3P4QB 4LTUA 1SSNA 3T3NA 1D5XC 3NRZA 2QIEB 4XDDA 2E3TA 1V1PA 4R3DA 2MH7A 3CWIA 3AE5B 3Q8CA 1TKEA 1XCQL 5D7GA 4OW0A 5BYSA 1YNTE 4LLGM 1YN5A 4MT5A 3IXSA 1TS4A 2K5PA 1VLBA 3Q8AA 5BMGA 3ZGZA 1CK1A 1UNSA 1V97A 4KGTA 1TS3A 1JWAD 1C9FA 1TJEA 1JWMD 2ONQA 5HFYA 5C3JB 2L83A 1J7AA 1FMAD 5HHDG 1RWSA 4RNAA 2GI9A 3E56A 3W1SA 1SJHD 3VRBB 4MH8A 4O1NA 1JCKB 1AW7A 2K9XA 3V3XA 3AM9A 1YN4A 3AEFB 3BVZA 3AEEB 2E6XA 4KGSA 2WXQA 3EGRA 5AUIA 2Y3AA 1IBXA 4J3OD 2I2YA 1N63A 4OZBA 2BT6A 3AEDB 1PGBA 1Q10A 3VQIA 3AN1A 1ET6A 4JPSA 3GB1A 1QLBB 3R2TA 1FXIA 3PZ7A 4ZRPA 4L2YA 4N58A 4H2AA 1JQ4A 3IT4B 3W9CB 1GPXA 2ACZB 3BZDB 1FCLA 2R61A 1L4ZB 1B1ZA 2AQ2B 2OEDA 4TQ1A 4WURA 1C4PA 1OQRA 2XN9C 2V0GA 3AMZA 1MI0A 4JWUC 2LJIA 2WDRB 4ARCA 1WSPA 5E6JA 2DYMA 1K50A 3NZ3A 1V1PB 3PZ8A 1KLUD 1L0YB 1YN3A 2WP9B 1FIQA 3H8HA 4CQNA 4ZOHC 1PGXA 5LNK1 3AE8B 1UUPA 3U52E 1WXQA 1BXTA 4D2KA 5BYQA 1ZXIA 1L0XB 2QILA 3LYYA 3TEWA 1FNWA 2WLBA 2XNAC 1I7HA 4TQ0A 4RGNA 1TY0A 5GXGB 3HVDA 2LEKA 2PVGC 2BTEA 1UWMA 1FCCC 4Q2JA 4A6QA 1QQRA 2WDVB 1CZPA 2PIAA 3U2SC 2MEKA 2I38A 2FE8A 4N59A 4XDCA 1FFVA 4UDUC 1IBXB 2JU6X 2WXNA 3B2FA 3FILA 1K51A 1SE2A 2G9HD 4A8XC 2RMMA 3MHZA 2WXHA 1JWUD 4GDKB 3NS1A 2QJLA 2IGHA 2WXRA 3GP7A 4RH6A 1D6EC 1VR9A 1TS5A 2KMMA 4B0EA 2LFIA 2G1EA 1ZXHA 3P63A 3P4PB 1XLNA 1SIJA 1JROA 2J52A 3AE3B 1HZ6A 3R2IA 5D3IB 1ZDVA 2CJOA 4P6VF 1UWXA 1J7BA 2N7JA 2BYTA 4FXCA 2SAKA 1RM6C 2CU3A 5D3DA 3AE4B 5C2TB 4TMAB 2CJNA 3MFGA 4HKZE 3TEZA 2HTME 1QT9A 3DWGC 1I4PA 1NI3A 3TUOA 5FR3A 1MPEA 2TSSA 2MJDA 1TYGB 3HRDD 1VZ6A 2VZKD 4YSYB 1MHHE 4RGTA 2YEPF 2N9LA 2BS4B 2W82A 3W5UB 3OWEB 3VR8B 4GLSC 2RPVA 2V3PA 1GOZA 2ZW0A 4AQ7A 1KLGD 3RPFC 1VDVA 3RFZB 1C77A 2IJ0A 1PDXA 3P42A 4NJCA 4YTPB 3P4RB 1TY2A 2IGGA 4PT5A 1XLOA 3AH7A 4RFBA 3FILB 5JXVA 3ABVB 1V8CA 2L32A 5H8YE 3ZYYX 3URYA 4US8A 1ZP0B 3NVWA 4WAFA 4RCOA 2PTLA 4XWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQR A;  1NEK B;  1FXA A;  3NVZ A;  3AMZ A;  4JWU C;  4USA A;  1EWY C;  2WDR B;  4YSZ B;  3WCQ A;  5EE3 A;  1T3Q A;  1YJJ A;  1VJK A;  1E9M A;  3HUI A;  4HRS A;  2WP9 B;  1FFU A;  1XLP A;  1FIQ A;  2FBW B;  1XO3 A;  2OHF A;  3BII D;  1L6U A;  4ZOH C;  3SR6 A;  1AWD A;  2Q5W D;  3AE8 B;  1NVI D;  1ROE A;  3HVZ A;  1WXQ A;  2W55 A;  3KWL A;  3FAH A;  1E10 A;  1WWT A;  1ZXI A;  3EUB 2;  1NYR A;  2PKO A;  1IUE A;  4ITK A;  3CIR B;  5AUK A;  5MPO A;  2M56 B;  2H88 B;  1I7H A;  2N0S B;  1A70 A;  2WLB A;  1DGJ A;  1L0V B;  1JW9 D;  3DWM A;  1JRP A;  3LXF A;  1XLQ A;  5GXG B;  1WRI A;  2LEK A;  4ZHP A;  2PVG C;  2WDQ B;  1E0Z A;  3AE9 B;  1UWM A;  1N5X A;  2B76 B;  2JX5 A;  4YTM B;  2BS3 B;  3VRA B;  3AEG B;  2WDV B;  3NVV A;  1R7S A;  1RFK A;  3SFE B;  1L5P A;  2PVO D;  1FO4 A;  1CZP A;  1FM0 D;  2PIA A;  5H92 C;  1QF6 A;  3AEC B;  1F0Z A;  4US9 A;  3AE6 B;  4N59 A;  1KRH A;  1TKY A;  1FFV A;  1DOX A;  4A9A A;  5EE9 A;  1YQ4 B;  3AV8 A;  1N61 A;  4JX1 C;  1PFD A;  1KF6 B;  3W5V B;  3B2F A;  1L6V A;  1ZUD 2;  2H89 B;  3NVY A;  3AE2 B;  5G5H A;  1PUT A;  1SF0 A;  4JWS C;  1FRD A;  4N6E B;  1NEN B;  3ETR A;  3P4S B;  3P4Q B;  1ZOY B;  3NS1 A;  2QJL A;  4LTU A;  1SB3 C;  1WGK A;  2DBY A;  4C80 A;  3NRZ A;  2QIE B;  2KMM A;  2L52 A;  3L4P A;  3AB5 A;  2E3T A;  2G1E A;  1B9R A;  5G5G A;  2MJ3 A;  3P1M A;  3P63 A;  3P4P B;  5EE1 A;  2MH7 A;  1KFY B;  1SIJ A;  1XLN A;  1JRO A;  1TKE A;  2WU2 B;  3AE5 B;  1N5W A;  3CWI A;  3AE3 B;  2WU5 B;  4C7Y A;  2CJO A;  3AE1 B;  3AEB B;  1J7B A;  1QOF A;  4P6V F;  4FXC A;  2K5P A;  1VLB A;  2Y5C A;  4HRO A;  1RM6 C;  2CU3 A;  1V97 A;  3AE4 B;  5C2T B;  4YT0 B;  2CJN A;  1JWA D;  1TJE A;  4C7Z A;  2WS3 B;  3PO0 A;  4IDI A;  1N60 A;  5C3J B;  2L83 A;  1J7A A;  2HTM E;  1FMA D;  3FC4 A;  1NYQ A;  1QT9 A;  3DWG C;  1JAL A;  1JWB D;  2K22 A;  1RWS A;  1WYG A;  1DOY A;  1E6E B;  2W54 A;  1NI3 A;  1OQQ A;  3VRB B;  2MJE A;  2BS2 B;  1AYF A;  1E7P B;  5EE0 A;  2MJD A;  1TYG B;  4YTN B;  2DWQ A;  3HRD D;  3AE7 B;  1QOG A;  4YSY B;  2JQR B;  2K9X A;  4WWM A;  3AM9 A;  3AEF B;  2AX5 A;  2BS4 B;  2WQY B;  3AEE B;  3VR8 B;  3SFD B;  3B9J A;  1RYJ A;  1GAQ B;  5AUI A;  4YXD B;  1N63 A;  1QOA A;  2BT6 A;  2M19 A;  3AED B;  3RPF C;  1QOB A;  3VR9 B;  1VDV A;  4ZHO A;  3LB8 C;  4KX6 B;  3AN1 A;  1PDX A;  4YTP B;  3P4R B;  1QLB B;  1CJE A;  2W3S A;  1DOI A;  2KAJ A;  3AEA B;  1XLO A;  1N62 A;  1FRR A;  1FXI A;  3B2G A;  3AH7 A;  2W3R A;  1TKG A;  2EKI A;  4N58 A;  1JQ4 A;  3W9C B;  3ABV B;  1V8C A;  1YJI A;  1GPX A;  5H8Y E;  1OFF A;  1J7C A;  4US8 A;  1ZP0 B;  3NVW A;  2ACZ B;  3ZYY X;  3W5U B;  4YSX B;  1YQ3 B;  4WQM A; 
#chains in the Genus database with same CATH topology
 4ED1 A;  2G06 A;  2VA8 A;  3H0M B;  5F9N A;  4O0I A;  3N9Y C;  2BQR A;  4KSL C;  9ICE A;  2AQ0 A;  5DPW A;  3ZRF A;  3PHW B;  1UBQ A;  1XLP A;  5KFB A;  2ZIX A;  1E8Z A;  2IPK D;  4M01 A;  3H40 A;  4JV1 A;  2Q5W D;  2WF7 A;  1ROE A;  5ALT A;  3U7Z A;  3TAD C;  2HTH A;  5ALF A;  2WXO A;  5ALG A;  2XCP A;  3C19 A;  4ICV A;  3GS2 A;  5AZG A;  5AI8 A;  4EZ9 A;  4DHJ B;  2DYO A;  2BCU A;  3C28 A;  2HI0 A;  2FID A;  4ECX A;  3TAP A;  3PY8 A;  3H0L B;  4NPN A;  4XX5 A;  1D5Z C;  1BPB A;  4DSF A;  3RJG A;  5KFP A;  2B76 B;  1JWS D;  5KFY A;  2G4D B;  4HDQ A;  3ECI A;  1L8O A;  1D8Y A;  1R4N B;  2Z8L A;  5KFH A;  3M95 A;  2C2R A;  2R2Q A;  4W9E A;  1XWL A;  1RG6 A;  1XO1 A;  4TUS A;  2QLT A;  5ALM A;  1TKY A;  1SKR A;  2WXP A;  1DOX A;  3MDC A;  3UF8 A;  4IKG A;  4A90 A;  3W5V B;  1V85 A;  1L6V A;  1SIF A;  1ZUD 2;  2ZTC A;  3TAQ A;  2HDE A;  1S1Q B;  2PFO A;  2PFN A;  2UWQ A;  3IAM 1;  3TSS A;  3O13 A;  5J0Y A;  2A4Z A;  2BB6 A;  4KGR A;  1TE2 A;  1UT5 A;  4IM3 A;  7ICE A;  4AOF A;  3SHQ A;  2ASD A;  1TIF A;  1IXR A;  3QEA Z;  4C4R A;  4FUL A;  5EWE A;  3MR5 A;  2ZJ5 A;  3SAG A;  4U7C A;  3KUZ A;  4R8U A;  1AN8 A;  4IR9 A;  4F5Q A;  3TEY A;  8ICY A;  4C8M A;  3OHB A;  2BW2 A;  1P7F A;  1WGR A;  3EW9 A;  2DL0 A;  5KFA A;  4EYH B;  2BYE A;  4KVG B;  3E58 A;  1ZPS A;  2KE7 A;  5BPC A;  2L1A A;  2KK0 A;  4IWQ A;  2K8A A;  4NAM A;  4M00 A;  4XZ4 A;  4MSQ B;  1U4B A;  3TCA A;  1D4B A;  1N60 A;  3A9J B;  3F2D A;  1JWB D;  4U6P A;  4Q44 A;  2BCV A;  2FUG 1;  1V9J A;  2K22 A;  2KIC A;  3SAH A;  1OTR B;  2HBM A;  2BS2 B;  2KFK B;  4F92 B;  2AQ3 B;  5BO4 B;  2ESE A;  3SAF A;  1E0Z A;  1QOG A;  4ZRQ A;  4KLD A;  2RDG A;  5AEK B;  2LUM A;  2MHJ A;  5III A;  2KDE B;  3JPT A;  9ICJ A;  2DHZ A;  3QE9 Y;  1ZQO A;  3C5G A;  3KWV A;  2F77 X;  3PML A;  4LCD E;  1QOB A;  4Y2X A;  1HTO A;  2DNF A;  2MUT B;  3GII A;  2ASL A;  3MAB A;  5ALL A;  1MQ3 A;  1XC9 A;  1S77 D;  2KEY A;  1XF5 L;  4DLG A;  4O3R A;  3AEA B;  2KJ6 A;  1N62 A;  3GZN B;  1ENF A;  2ICI A;  3PHX B;  4S0R A;  3Q8L A;  5T8I A;  4WWN A;  5AM5 A;  1HQR D;  2CXY A;  1TK0 A;  4UW9 A;  3RJF A;  2SEB D;  1YJI A;  2EZY A;  3ZJV A;  2DGZ A;  9ICI A;  2IZV B;  1ZQX A;  1YQ3 B;  3TL5 A;  4ECV A;  3KH0 A;  4AP9 A;  4DFP A;  5ALX A;  4J9N A;  4NQK E;  1JXE A;  3ZQ4 A;  9ICW A;  2ZIV A;  2JEI A;  1K53 A;  2KIV A;  2ZXH A;  1E9M A;  1URJ A;  2W9B A;  2WXL A;  2O6V D;  3V6J A;  9ICL A;  3H7S A;  4DXF A;  2FBW B;  3N1Z C;  1NJY A;  4P4P A;  2OHF A;  5ALY A;  2KWV B;  5DB7 A;  2ZNV B;  1ACC A;  4HPL B;  1UQV A;  1FNU A;  1OEY A;  1TK8 A;  4JWN A;  1S0V A;  3AEV A;  2KTQ A;  4LJP B;  4FAD A;  1GJZ A;  3PPA A;  2XY7 A;  1KH0 A;  3T9L A;  1QSS A;  5KFL A;  5J2J A;  2KVS A;  3QUC A;  4KKI A;  4FN2 A;  2ES6 A;  1DK3 A;  1OUQ A;  1JW9 D;  2GMI C;  2DZK A;  5EWG A;  1SL0 A;  1WGH A;  1UCV A;  4LZG A;  2KJ8 A;  4DS4 A;  2VKQ A;  4F2S A;  3A4S C;  4DFK A;  3RYT A;  3X0W A;  4PHP A;  1PGA A;  1RQN A;  2JX5 A;  4YN4 A;  5J0O A;  9ICC A;  3C2L A;  2LHD A;  2FJ6 A;  2ISO A;  2G4S A;  3TFR A;  1S76 D;  4OO1 J;  1EXN A;  8ICN A;  4HK2 A;  4XWW A;  3IV6 A;  3BWU D;  1IGC A;  3QJZ A;  3V6C B;  2H89 B;  4ED2 A;  1MJD A;  3Q8S B;  4KN7 A;  1E90 A;  2FCS A;  3C21 A;  3GZF A;  2JXT A;  3UXN A;  4EBE A;  5FR6 A;  4IRK A;  2IGD A;  1SWW A;  4GDL A;  1WGK A;  2NBW B;  2N9E B;  3DCG A;  4BKS D;  1NZB A;  4DL6 A;  1X40 A;  3L4P A;  1DYQ A;  2MBB B;  1S0O A;  2WU2 B;  4PS8 A;  2NR2 A;  4KLG A;  4P0Q A;  2CRX A;  4BOZ B;  2M8S A;  4C7Y A;  4I2F A;  3N3K B;  3DBR B;  4M9H A;  2RPQ A;  2LRU A;  1H8C A;  4RQ1 A;  3GQC A;  4M6W B;  3L16 A;  3PO0 A;  2JZB B;  3JSV A;  3WKE A;  1NYQ A;  3OSP A;  3H9D A;  4QNL A;  4GC7 A;  4W9D A;  1WYG A;  2NRZ A;  1TZ1 A;  4W9F A;  4BDP A;  2KN4 A;  3PX0 A;  3PZP A;  3BDP A;  4IWO A;  4P1B C;  3MTN B;  3WKC A;  4JK1 A;  3ZDD A;  2QB1 A;  1F2R I;  9ICQ A;  1NJX A;  4M0W A;  3UMG A;  2VH1 A;  2JHD A;  1WGD A;  4AWJ A;  2F44 A;  2M19 A;  4JLC A;  4WWP A;  4C8K A;  3IT6 B;  3ZO5 B;  5CA7 A;  5DB9 A;  1H38 A;  1Z2M A;  2KC2 A;  1Z1V A;  2D2Q A;  3GDX A;  4KLQ A;  2E8P A;  2GOL A;  2Z59 B;  4C8L A;  2KX0 A;  1A76 A;  1TKG A;  3PVX A;  1XS9 D;  2F8K A;  4CGZ A;  1SE3 A;  4Z6C A;  2QMT A;  4REZ A;  1J7C A;  4P1C C;  4A3O A;  1L7O A;  4I2H A;  2H3I A;  3V6E B;  2K8B A;  4GOC A;  3ED5 A;  2LAS A;  3G6Y A;  3KFU F;  1ZRN A;  3OJS A;  2NPT A;  4BAX A;  5IP4 D;  5KL1 B;  1TS2 A;  3H8J A;  3WCQ A;  2F2A B;  4DK5 A;  2VRR B;  4FJY A;  3VUX A;  2KO3 A;  4DHZ E;  3ZDM C;  4N9F 4;  2KMD A;  4MGK E;  2BKR B;  2P35 A;  5F9L A;  4ZRJ A;  3ZLZ A;  2Y0S C;  3SI8 A;  5ALP A;  1L7M A;  4ZH4 A;  1P0R A;  2Y9U A;  2JF5 A;  2O6V A;  4RGM A;  5GMV A;  4GXJ A;  5AUK A;  3CIR B;  4WJ3 B;  4QWC A;  3ISC A;  3KLS X;  4W9H A;  4OJO A;  1KFD A;  2R8H A;  1I35 A;  4F7Z A;  1Z00 B;  3RB0 A;  2AQ1 B;  2GH1 A;  3WIM A;  1BPE A;  5KFO A;  3KHR A;  3KYD D;  2BPC A;  3NVV A;  1TTN A;  2CHZ A;  4IRC A;  2ZTD A;  3ML8 A;  3N97 B;  4FA6 A;  3A9K A;  9ICO A;  1L3T A;  3CRX A;  1P9D U;  1RYS A;  2G08 A;  5D46 A;  3Q8M A;  4JQW C;  3PLV A;  3RR7 A;  1EF1 A;  3A1Q A;  5AM1 A;  2LGI A;  3BS5 B;  2WXJ A;  2LYH A;  1PUT A;  3LVV A;  2PXI A;  3BY4 B;  3M9M B;  1RPL A;  3KOO A;  3ZDA A;  1BUI C;  3B0Y A;  1X9W A;  3X23 A;  5KL8 B;  4W9I A;  4LTU A;  5J18 A;  3GV8 B;  1ZQC A;  2OEH A;  4NLB A;  3C1Y A;  2KZR A;  3VXW A;  3KBB A;  2QIE B;  3ORY A;  2LBO A;  2H3F A;  4XDD A;  5KFW A;  3CST A;  2MH7 A;  1TKE A;  5J2G A;  1MFW A;  5D7G A;  3RI7 C;  5KT6 A;  3ZDC A;  2IHM A;  4LLG M;  1GC7 A;  3HPO A;  4GC6 A;  1TS4 A;  4MHV A;  1OXJ A;  2QCZ A;  1CK1 A;  1UNS A;  1V97 A;  3DBL B;  4IM2 A;  4Y2J A;  1TJE A;  4RT2 A;  2Y0S F;  5HFY A;  2CN1 A;  4NL9 C;  1QQ5 A;  1CEZ A;  2LYB A;  2MAX A;  1T3N A;  1RWS A;  1E8W A;  4RNA A;  3W1Y A;  5AI5 A;  4DWI A;  1ZD5 A;  2DF4 B;  1KLN A;  2KQ7 A;  3VRB B;  1YD8 U;  1NKB A;  1B4F A;  3O65 B;  3FKY A;  3V3X A;  3AM9 A;  1C3T A;  3BVZ A;  3ZXV A;  1TKD A;  4LDT D;  2W03 A;  2Y3A A;  1IBX A;  3RTV A;  2W8L A;  1WH3 A;  4O3N A;  1J2M A;  2RDB C;  4KMO B;  1Z4O A;  3SEN A;  5JHA A;  1PGB A;  5ALH A;  3IM1 A;  1TV9 A;  5B5E U;  1Q10 A;  3SD7 A;  3ML9 A;  4A8E A;  1ET6 A;  1QLN A;  3OSN A;  4GDK A;  2LI6 A;  3R2T A;  1NK4 A;  1L7Y A;  3PZ7 A;  3QC8 B;  2AXT U;  4YXM A;  2XC9 A;  4N58 A;  4J9P A;  5KFT A;  4QZI A;  1V86 A;  1HE8 A;  3IVF A;  2KHQ A;  3W9C B;  3ETL A;  3BZD B;  1FCL A;  2R61 A;  3IFW B;  3F53 A;  2ZZP B;  4MFC A;  2UVV A;  2INC C;  3ZDB A;  2MBH A;  1C4P A;  3QCA A;  5L1M A;  1Y8R C;  4TQ1 A;  2JT4 B;  2JUO A;  4EEK A;  2OYY A;  2HHT A;  3KW5 B;  8ICC A;  5E6J A;  4ARC A;  2W9C A;  2DYM A;  1K50 A;  2IO2 B;  3NZ3 A;  2X8X X;  5D49 A;  2WP9 B;  5G55 A;  3N1Y C;  1IPG A;  5A0L A;  4O9M A;  3NRW A;  1PGX A;  3JPR A;  2M0N A;  2F8L A;  2WF9 A;  2D6F C;  5HNK A;  4X5V A;  5DCN A;  4TQS A;  3Q6B A;  4K4G A;  3PW7 A;  5BYQ A;  3TFS A;  2FLN A;  4M8N A;  3IP4 B;  4ANW A;  4QZ9 A;  1FNW A;  4LDT B;  2WLB A;  4RPX A;  4MSM B;  4RGN A;  3VFK A;  2KOB A;  2BTE A;  2JY6 A;  1UWM A;  1ZQP A;  3QU7 A;  1TT5 B;  4JWM A;  4ACF A;  1O03 A;  1BPD A;  3DBH B;  2HE7 A;  2WDV B;  2I1J A;  1ZQ1 C;  2FDR A;  4UB1 A;  2NO4 A;  3U2S C;  5DBB A;  2FE8 A;  1T7P A;  3PW4 A;  2KWU B;  3WAN A;  4C8N A;  5CB1 A;  4EEN A;  3B2F A;  4LNN A;  1WM2 A;  8ICO A;  2G0A A;  2KJH B;  3I5J C;  4C0Z A;  4P4O A;  4RPZ A;  9ICS A;  3C23 A;  4Z6D A;  2KYW A;  2DFL A;  4Y2V A;  5AKE A;  3LK9 A;  5JUM A;  3ZI4 A;  3GP7 A;  1D6E C;  1VR9 A;  1TS5 A;  4KLS A;  4MM3 A;  2LFI A;  1SKS A;  4WQO B;  1L7P A;  2XBB C;  1GC6 A;  4QZE A;  4UAZ A;  2J52 A;  3N7P D;  2VJ5 A;  7ICH A;  2FE9 A;  4CDG A;  3RZW C;  4QZ8 A;  1ZDV A;  1QQ6 A;  2N7J A;  3N28 A;  4P6V F;  4FXC A;  4F5R A;  4F5P A;  4KIK A;  3MDA A;  3IDW A;  4DQR A;  1M94 A;  1MN8 A;  5C2T B;  2PI5 A;  4BUG A;  3KZI U;  2YN4 A;  2DKX A;  3TAR A;  3MFG A;  2ASJ A;  3C29 A;  3SYZ A;  1QT9 A;  3PSF A;  4IQT A;  5TR5 A;  4K7U A;  2IOF A;  2NCN A;  2MSN A;  3CMM B;  2VIX A;  1X42 A;  2JGA A;  2W7O A;  3OLM D;  5C1Z A;  3HRD D;  1IG6 A;  2AJQ A;  4NJ8 A;  4HCP B;  2N9L A;  5KG4 A;  3NZS A;  3IG3 A;  5J2F A;  2HOQ A;  2ZCC A;  1ZQS A;  2V3P A;  2ATL A;  1BVS A;  3Q8Q B;  2ZW0 A;  1PUZ A;  4Q8E A;  2I1Q A;  1D9F A;  4KLH A;  1VD2 A;  3C5F A;  2LGD A;  3P42 A;  4MEL A;  2DQN B;  2E1E A;  3ZD8 A;  2I1K A;  4MGY E;  4NJ6 A;  4PT5 A;  2HOI A;  2JVC A;  4II2 B;  1JXL A;  4XQ8 A;  3K4G A;  1L5U A;  3ABV B;  2ZTE A;  1V8C A;  4RM9 A;  3GFK B;  3I28 A;  2AH5 A;  2PTL A;  2PE6 B;  1YQB A;  2BKE A;  1C4C A;  3ZDT A;  4O5C A;  5KFD A;  2KFZ A;  4I6P A;  3C1Z A;  2DEN B;  1R4M I;  3MGI A;  4B9T A;  3HUI A;  2J7Q B;  4PHE A;  3BYT B;  2KDB A;  3SQI A;  5CHV C;  3WAL A;  3CW2 C;  3EPG A;  2M1M A;  3NZU A;  1WMH A;  3BQ1 A;  4YMN A;  3T5H A;  2QAR A;  2BVC A;  2BPG A;  4K1R B;  4LNO A;  5ALZ A;  4Y2Q A;  1A70 A;  4MEM A;  4LNK A;  3KYC D;  1D3Z A;  1XLQ A;  2ZW1 A;  3IAS 1;  4BVU C;  4RNO A;  4J9K A;  2MRP A;  2WDQ B;  3RAQ A;  2JYE A;  3SU8 X;  3TAD A;  5DDY A;  4YL8 A;  2BWF A;  4URK A;  2BS3 B;  2IY1 B;  4FLH A;  4ANV A;  2ZJ8 A;  5H92 C;  1FM0 D;  2P6R A;  1YJ1 A;  3BIN A;  5KFJ A;  3PW5 A;  3MC0 B;  1LVH A;  3A0H U;  4B9N A;  5H2F U;  2VH2 A;  3QUT A;  2IOH A;  5DKW A;  1TGZ B;  1PFD A;  1WRD B;  1RDF A;  1D9D A;  3OJ3 A;  4GLX A;  3V72 A;  1XSP A;  3T8M A;  3WK7 A;  2JV3 A;  1SEB D;  4PHA A;  1PK1 B;  4MAC A;  1TFR A;  3QWZ B;  1T94 A;  4PJ0 U;  1NEN B;  2V4I B;  3V60 A;  2J42 A;  5J2A A;  3PV8 A;  1A5R A;  2BKF A;  2K89 A;  1SB3 C;  5JRT A;  3HIL A;  3BQ2 A;  4RZR A;  4LZD A;  2L52 A;  4RNN A;  1HZ5 A;  5IAA C;  2FI1 A;  2DAF A;  2D8C A;  4DSL A;  3KHH A;  1RFA A;  4O3P A;  3E0F A;  4FBJ B;  4J9L A;  1YIW A;  2MA9 B;  4XRH A;  3RB6 A;  1KTQ A;  3AE1 B;  1MQ2 A;  4LJO B;  1SXT A;  1SV0 C;  2C2E A;  4P2H A;  1X66 A;  2GWS A;  2QC8 A;  4EUT A;  1Q5W B;  3Q8F A;  5KFM A;  2ZIX B;  4YP3 A;  2WS3 B;  5J0W A;  4TKN A;  4DDI D;  4HPM B;  1X6I A;  1L3S A;  3V6H A;  3DVG Y;  2NRX A;  5CHF A;  1JN3 A;  1S8O A;  1AYF A;  1QCK A;  3PR5 B;  1E7P B;  1FEH A;  2M0A A;  2WXF A;  4ZRK A;  5IOI A;  2OM6 A;  3NAS A;  4BX9 C;  2HSZ A;  4UB5 A;  2AX5 A;  2B3A A;  4GIV A;  3JPP A;  3OJU A;  2MP2 A;  5CWR A;  4QZH A;  2R8K A;  1I4R A;  2DPI A;  2V3N A;  1MHX A;  1VZ7 A;  3MP9 A;  4EZJ A;  2OWO A;  5LXH A;  1T0Q C;  4M47 A;  5GTH U;  2HBJ A;  1WXS A;  2KK8 A;  3U8Z A;  4C00 A;  5DG8 A;  5IN7 A;  2J6U A;  4DF8 A;  3ZNZ B;  3M9O B;  4KTQ A;  3APC A;  3E9S A;  4MGZ E;  1S0M A;  2GB1 A;  4ELT A;  1K5O A;  2PI4 A;  4BZA A;  1HUZ A;  4DL5 A;  3G6X A;  3RF9 A;  1C79 A;  4A55 A;  1WR1 A;  2CU1 A;  4PYU A;  1YJJ A;  5JH5 C;  4I2G A;  3DOW A;  1FFU A;  2A3V A;  2HVI A;  4R65 A;  5DPT A;  1LM8 B;  2WXI A;  1CUK A;  4R8U B;  5EWF A;  4YMM A;  1NVI D;  2KT7 A;  1UGJ A;  1ZQL A;  1WWV A;  3WK8 A;  3D32 A;  3H4D A;  2Z7J A;  2ZEQ A;  8ICK A;  2PKO A;  4GSW A;  2KKV A;  4K7W A;  5BOL A;  2YEP B;  2JRI B;  3RRH A;  3H7P A;  3WK6 A;  3LXF A;  3K1Z A;  4YXJ A;  4QZA A;  3VUY A;  1JML A;  5KFK A;  1WM3 A;  2I6X A;  1WRI A;  4DQQ A;  4KZ0 A;  5HHH A;  1WX8 A;  1F1H A;  1EUV B;  7ICU A;  1KW4 A;  3SFE B;  1F44 A;  1QQ7 A;  1L5P A;  2F76 X;  4KX5 A;  4I2B A;  1CMX B;  4LVS A;  1OW5 A;  9ICH A;  3AE6 B;  2N1W A;  3T5K A;  4UAU A;  5ALE A;  5C5J A;  1T6B X;  1M6Y A;  1YQ4 B;  4HKQ A;  3QYP A;  1WXA A;  4IL6 U;  4NAW A;  4RGO S;  2LZ6 A;  1E7U A;  5KFU A;  1VRA B;  3T5L A;  3Q69 A;  4XUS A;  1I42 A;  1T5X D;  2BGW A;  1I4Q A;  3OG5 A;  3Q8B A;  3PS6 A;  4GU2 A;  3BYY B;  3FM9 A;  2V1Y A;  3A4R A;  3MC1 A;  4I27 A;  1UGM A;  2LKY A;  4KX3 A;  9ICV A;  2MJ3 A;  4ANX A;  4M0A A;  3KHL A;  1KJT A;  1K1S A;  2LUE A;  5J2E A;  5J2K A;  2H3Q A;  4E71 A;  2UVR A;  2LVQ A;  1X9S A;  5J2H A;  5TIS U;  2IDY A;  2ZIV B;  2IYD B;  4XE0 A;  5CP2 A;  4QZC A;  2WHI A;  2W9B B;  3PSP A;  3ZNH B;  4DEZ A;  4DOC A;  2J0K A;  4IDI A;  2NO5 A;  2V9W A;  4C4V A;  4FE3 A;  3T79 A;  1OEY J;  1WY8 A;  2DZJ A;  2KLC A;  1RRB A;  4OVV A;  1E6E B;  2MJE A;  2HBL A;  1NK0 A;  1E5W A;  5EE0 A;  4E0D A;  4F8R A;  1C78 A;  5AHX A;  3WKD A;  3DVG X;  5DPR A;  3IG8 A;  1P1A A;  2KWD A;  2WQY B;  4TV3 A;  2LM4 A;  2BZF A;  2J6T A;  8ICW A;  3SFD B;  1RYJ A;  2XK5 A;  2L8J A;  2Z0E B;  3UQ2 A;  4L23 A;  4RQ6 A;  5J8Y C;  2MCN B;  2MLB A;  2AL6 A;  4DSK A;  3KZX A;  3J81 j;  3VTV A;  1CJE A;  2W3S A;  3RNG C;  8ICE A;  1T8E A;  2JZP A;  4C56 C;  4UB8 U;  5J0U A;  2OCE A;  3Q3J A;  3RBE A;  4G3I A;  1BGX T;  1ESF A;  1SGH A;  2LJ5 A;  2JSV X;  3PMN A;  4IM0 A;  8ICI A;  4RNM A;  5ALD A;  4DQO C;  2MSE D;  3AU4 A;  2WX1 A;  1IGD A;  3NVZ A;  4DLE A;  2JEJ A;  3H6N A;  4GDL B;  4XC2 A;  3UM9 A;  1KEJ A;  8ICB A;  2BB5 A;  2KC1 A;  3GE8 C;  5KG2 A;  1EM7 A;  9ICK A;  1K52 A;  1T3Q A;  4EEL A;  4CE6 A;  4FZM A;  3AU5 A;  1WR6 E;  2GOW A;  2L0F A;  3I1Y A;  4ACO A;  4F91 B;  4ECY A;  4P0Q B;  2HHS A;  1AWD A;  2PFQ A;  3AQF A;  3HM6 X;  4EX7 A;  4QZB A;  3SV3 A;  4HJG E;  4TQR A;  2XCA A;  3CF6 E;  2JRH A;  1KFT A;  4MF2 A;  2H88 B;  2FCQ A;  4WH4 A;  3U4E G;  4M9N A;  3JSV B;  5AKH A;  9ICG A;  4EBC A;  2BPF A;  1ZQK A;  2KFJ A;  1V38 A;  8ICS A;  3RH6 A;  1KKX A;  1MSW D;  3ICX A;  4DL3 A;  3QNM A;  4CO7 A;  5BMH A;  3VVW B;  1FO4 A;  1WIA A;  1WX9 A;  4M0W B;  4ICU A;  3ZTC A;  3M8S A;  4KKJ A;  1HEZ E;  3HK0 A;  1CI4 A;  3RB4 A;  1YOV B;  9ICF A;  2LD9 A;  2BYF A;  4ZRI A;  4ELU A;  1R4N I;  5AKY A;  3NVY A;  1QIL A;  5IIL A;  4ECT A;  1BPX A;  2W9M A;  2I9G A;  5J0S A;  3ETR A;  4OD0 A;  8ICP A;  3QAR A;  4B6J A;  3RZF A;  4W9J A;  1TK5 A;  2RLT A;  4UBC A;  3T3N A;  4BXO A;  1RXW A;  2V9H A;  2KHV A;  3NY5 A;  3S2A A;  4RQM A;  1V1P A;  2RDJ A;  2A1J A;  4MH0 E;  3CWI A;  4R3D A;  3Q8C A;  5J29 A;  2GO7 A;  2KXJ A;  2OOB B;  2NRV A;  5BYS A;  3K9O B;  2K8B B;  1WYW B;  3UIO B;  4Z6E A;  2ZIW A;  2NPT B;  5BMG A;  1VLB A;  4ED3 A;  4BFR A;  3ZGZ A;  4FJZ A;  2W43 A;  5IA7 A;  1WZ3 A;  1F0M A;  1D8L A;  1S5L U;  1JWM D;  4NM2 A;  5KTQ A;  2DZM A;  3A33 B;  3G6V A;  2C7N B;  1J7A A;  1K1Q A;  7ICK A;  2L5Y A;  3HWT A;  2Y5B B;  4M8M A;  3E56 A;  3W1S A;  2O6V B;  4MH8 A;  1YZ6 A;  3N7S C;  2M9N A;  3UXO A;  3WU2 U;  4UB2 A;  4TUQ A;  1ZQD A;  3Q8K A;  2G5H B;  2EDU A;  2BCS A;  1ZQG A;  4RQ8 A;  1AW7 A;  2K9X A;  2BYV E;  1VCB A;  2NRW A;  2YB4 A;  5AKX A;  3NS8 A;  3BQ0 A;  2D3D A;  3RB3 A;  3VAW A;  3EGR A;  2BQU A;  2QB0 A;  4WJO A;  1N63 A;  2K4E A;  1WJU A;  2HDO A;  2YLM A;  2OJW A;  2BT6 A;  1U47 A;  3VQI A;  3A9K B;  4JPS A;  3DEE A;  2AGO A;  1XSL A;  3GB1 A;  2HHQ A;  5D2M B;  2NRT A;  2C7H A;  5IIO A;  3GIL A;  2KFK A;  1L2N A;  1J19 A;  4ZRP A;  2WF6 A;  1DOQ A;  4XA5 A;  4L2Y A;  3A1Q B;  2AEH A;  2MBQ A;  1JQ4 A;  1WGY A;  8ICJ A;  3MBY A;  4DL4 A;  3C0R B;  1U4A A;  1GPX A;  4C4T A;  4UB3 A;  3WAM A;  2WAQ F;  4Z6F A;  2KZ3 A;  4IC9 A;  4J03 A;  2XGP A;  1B1Z A;  4FZN A;  1UH6 A;  2AQ2 B;  2N7D A;  4G0N B;  5LLI A;  2V0G A;  4J9R A;  3DV9 A;  3U7D A;  3AMZ A;  5AKI A;  1LXD A;  3VCB A;  1RQL A;  4UAV A;  1EF5 A;  3RNB C;  1ZKH A;  4HYK A;  1KLU D;  4HXD A;  2E8M A;  2LMR A;  1XSN A;  4KDI C;  4CQN A;  3APF A;  5LNK 1;  3AE8 B;  3U52 E;  2AGP A;  3RMK C;  2IHN A;  1JRU A;  3HKZ C;  1L0X B;  2YB1 A;  1BNO A;  4IQW A;  7ICO A;  3D2N A;  1Y88 A;  4Q8F A;  4TQ0 A;  2YX8 A;  3HVD A;  2LEK A;  3BQ7 A;  3C2K A;  5TZV A;  2W9A A;  3WA0 A;  3KKA A;  2PIA A;  3UGB B;  4AYB F;  3Q8R B;  4JV2 A;  1N2X A;  4RQ3 A;  5KFZ A;  2FPM A;  1FFV A;  3RCZ A;  2KSO A;  3RNA C;  2JU6 X;  1IBX B;  3GIK A;  4ECR A;  3PRZ A;  2G9H D;  3VH4 B;  2RMM A;  2RR9 A;  3MHZ A;  2WXH A;  2RRD A;  3R9K A;  4CF3 A;  4GDK B;  5L1J A;  1A0P A;  1UZX B;  3NS1 A;  1UBI A;  2IGH A;  3IHP C;  4CYE A;  8ICQ A;  2C60 A;  4RH6 A;  2EQY A;  2K4I A;  4PZN A;  2XVT A;  4YR0 A;  3LWM A;  3EZ5 A;  3HIZ A;  4B0E A;  2G1E A;  3MC9 A;  2DZI A;  4HAI A;  3AUL A;  1JRO A;  1AAR A;  3DQV A;  1MC8 A;  3AE3 B;  4PZO A;  4IS7 A;  3N32 A;  3V7K A;  4DFD A;  7ICN A;  3R2I A;  2CJO A;  2FMP A;  1OQY A;  4W9L A;  2KD1 A;  2BHN A;  2W9C B;  4UBB A;  3OHA A;  4NXZ A;  1DK2 A;  5AI9 A;  1FXT B;  1DGS A;  3UQA A;  1SL1 A;  2FLL A;  3HKZ F;  2UVW A;  2HTM E;  1T0R C;  2RQ5 A;  2RSU A;  3DWG C;  2WWZ A;  3RUL A;  1ISN A;  1FEZ A;  3UMB A;  1MPE A;  4KDL B;  3L17 A;  5ALS A;  9ICP A;  2C2D A;  1VZ6 A;  3TBL D;  2QHO A;  1MHH E;  5ALR A;  2YEP F;  4RGT A;  4MJS A;  5CHW A;  2V4R A;  5IIK A;  2W82 A;  2H3Z A;  2KQS A;  1OGW A;  4NQL B;  4EZL A;  4B9M A;  2N9X A;  1SL2 A;  9ICB A;  2FNJ B;  5KG5 A;  2GLE A;  2KX3 A;  3F5A A;  4O3Q A;  4BKT A;  2YMP A;  1LV5 A;  2IJ0 A;  2LI5 A;  4NJC A;  3N4M B;  3RNC C;  3P4R B;  1TY2 A;  3UIP B;  4CF5 A;  5CR0 A;  1XLO A;  2M4N A;  3TAN A;  4I2A A;  4UQG A;  1ZQI A;  4KSK C;  4F4Y A;  4M2Y A;  1BPY A;  1P7D A;  2LVO A;  2A19 A;  2MBE A;  5J0P A;  1ZP0 B;  4WAF A;  4RCO A;  4XWT A;  1A77 A;  4QAY A;  1NEK B;  3MJW A;  3PSE B;  2FPK A;  5L9X A;  5CRX A;  1SGG A;  4PGX A;  4ECQ A;  1EWY C;  2PMZ F;  5HML A;  5AK6 A;  4GN1 A;  4MM3 B;  3PSI A;  3WAO A;  4HRS A;  1SXE A;  1GG3 A;  1COK A;  1J2N A;  3I3T B;  4DOB A;  5HR6 A;  3HVZ A;  2XEW A;  1V6E A;  3N7R C;  3UI3 A;  1E10 A;  5KFF A;  2FMS A;  1FNV A;  5MPO A;  2KIW A;  1WJN A;  1TAM A;  2W04 A;  2DKZ A;  2M0X A;  1JRP A;  4O3O A;  2H3V A;  1UA1 A;  3SZ2 A;  1YX6 B;  2NBV B;  5KHQ A;  3JPO A;  4K4H A;  4WAA A;  5D94 A;  2KP7 A;  1WFY A;  2Y5P A;  4PPX A;  4CHK A;  2ZPN A;  1KRP A;  1QTM A;  4B0M A;  3O0F A;  2MA1 A;  2DAJ A;  2LMC A;  3PT2 B;  4Y2S A;  1KRH A;  3SEB A;  2W11 A;  5ALU A;  4YMO A;  5KT4 A;  5T14 A;  2XY6 A;  3UQB A;  2EAM A;  5EE9 A;  2JZ3 B;  1JMS A;  2JEF A;  4RQ2 A;  2KZZ A;  3Q3O C;  4JX1 C;  7ICT A;  5KFG A;  2J4X A;  3Q8P B;  3MHS D;  1TVA A;  2KHW B;  2OH2 A;  2HHW A;  1SF0 A;  3PO5 A;  1STE A;  3AI5 A;  3OGU A;  2UU7 A;  5CTR C;  2ZNV C;  3BK2 A;  5DQH A;  1ZD2 P;  1U45 A;  1PQS A;  1F2R C;  4ELV A;  2DBY A;  1V1O A;  3RH4 A;  2C5L C;  1CRX A;  2NTT A;  4DSE A;  4K4I A;  2JYT A;  4DXG A;  1F5S A;  5G5G A;  3P1M A;  1N6Z A;  4BBN C;  2PE9 A;  4HJK A;  3ZJT A;  4TUU A;  5KFE A;  1BNP A;  5AI4 A;  2ZUB A;  1Y56 A;  3H8W A;  4EEY A;  2FCM A;  2ON8 A;  2WU5 B;  1ZQH A;  3J9C A;  4RF0 A;  2KZM A;  3RH5 A;  3TIX A;  3LVW A;  2FUH B;  3GV5 B;  2K8C A;  4BGD A;  5BYR A;  2HHX A;  4C7Z A;  2K8H A;  3AQE A;  2QEJ C;  2AU0 A;  3EFU A;  2G09 A;  2JH1 A;  5DPS A;  5I4D A;  2J6S A;  5AKK A;  1R4M B;  2Q0Z X;  1WMH B;  2JWU A;  5KFN A;  4PYZ A;  1SV0 A;  2IBK A;  3ZUN A;  1N48 A;  2QAR B;  3DBL I;  4Q45 A;  3TEX A;  1C7Y A;  1WJ4 A;  1S9F A;  1F52 A;  4YVZ A;  4YTN B;  1EWC A;  4DWF A;  2JQR B;  1MVK A;  3EEC A;  3ZTD A;  2YY6 A;  3Q8E A;  4JMU A;  2WDT B;  4ED7 A;  3K9P B;  2YML A;  1QOA A;  2ASQ A;  4G11 A;  2YTU A;  2ZVO A;  3LDZ E;  5ALN A;  4UAW A;  2AHO B;  2Y9T A;  1LGR A;  4B9U A;  1QKZ A;  2LHT A;  5L1L A;  3HHM A;  4MGI E;  2RHF A;  3B0A A;  1XU4 A;  1FRR A;  5AM4 A;  4MDK E;  2EKI A;  2KTR A;  2KVC A;  2VAN A;  4OHJ A;  2G3Q B;  5E6O A;  4RQ4 A;  5FKA C;  1ET9 A;  1PK3 A;  1ZQU A;  8ICX A;  2F1I A;  1O08 A;  4MF8 A;  2WXM A;  3DHG C;  5E6P A;  4JL9 A;  4BBN F;  1ZQZ A;  1ZYQ A;  2W9N A;  2IND C;  5JZE B;  3KHG A;  2Y1J A;  4B9S A;  4AS1 A;  5ALK A;  1NNL A;  2R8J A;  3BII D;  2K3U A;  4QZF A;  4LK0 M;  3M7D A;  2D10 A;  1ZD3 A;  3I9V 1;  4HVB A;  3CP8 A;  3OTQ A;  1TAU A;  5AIB A;  3MC8 A;  1CQV A;  1J97 A;  1IUE A;  4EE2 A;  5HI1 A;  4ZDV A;  3AU2 A;  4UB4 A;  2NBU A;  4NNJ B;  2XIC A;  2INP E;  5HHI A;  3HX0 A;  3BK1 A;  4W9G A;  4QIW C;  3BZC A;  4DHZ B;  1HJP A;  4FJV B;  1D5M C;  3VRA B;  4M02 A;  1U49 A;  4NLG A;  3NUQ A;  2ZCB A;  3BVM A;  4US9 A;  1NK5 A;  2CHX A;  7ICI A;  3U26 A;  2O2V A;  3RNE C;  5L1I A;  3VTU A;  4AJY B;  4II3 B;  1VZ8 A;  2XY5 A;  1N61 A;  1KF6 B;  3EA6 A;  2E8O A;  4OJ5 A;  2MP2 B;  3GOE A;  2K0P A;  1GUA B;  2WNM A;  3NUH B;  2JXX A;  2EAP A;  5G5H A;  4P7I A;  3W2D A;  1ARO P;  1FRD A;  2F3N A;  3M6K A;  3V05 A;  4KLJ A;  2WX0 A;  2N1V A;  2PKE A;  9ICT A;  2WXK A;  2RGF A;  4KLL A;  1BT0 A;  3L08 A;  2WF5 A;  4IRD A;  4HEA 1;  3CNH A;  4DL2 A;  3QUB A;  3MR6 A;  4UAT A;  3ZW3 A;  3F2C A;  1BPZ A;  2PEA A;  3PVL A;  1LKY A;  2KKP A;  1L3V A;  1KFY B;  5KG6 A;  5KFQ A;  1IP9 A;  5E6N A;  2RP5 A;  1MG4 A;  4F4W A;  3KTQ A;  3AEB B;  1C4A A;  1IM4 A;  4NWI A;  2O6K A;  1QOF A;  1QH9 A;  4B9V A;  4DS5 A;  3C2M A;  4C4S A;  4KLF A;  4KLE A;  4IR1 A;  2KLG A;  2MQJ A;  4NZL B;  5ALI A;  3LWL A;  4PS3 A;  4PHD A;  1WF9 A;  2YVC A;  1KBU A;  2H5X A;  4NLN A;  2MRL A;  1Q1O A;  3B08 A;  1Z3E B;  4KZC A;  2EZX A;  1N56 A;  1DOY A;  1KM7 A;  4YQW A;  1SKW A;  2EAN A;  5KFC A;  2ALZ A;  4JE3 B;  4ECZ A;  5KT7 A;  1NJZ A;  2E5S A;  3AE7 B;  3H7P B;  4QIW F;  4LNF A;  1FPY A;  1ZQV A;  5DBC A;  4FZL A;  4PL1 A;  1GAQ B;  4EEW A;  5HMM A;  3M62 B;  3S6J A;  3EPI A;  3VR9 B;  2KAC A;  7ICR A;  4KX6 B;  2J0M A;  1HA5 A;  2KAJ A;  5J0T A;  4M9J A;  3EHV A;  3M8R A;  5AZH A;  1YT3 A;  4NAW B;  1GB1 A;  2K4P A;  4L1B A;  3RBD A;  4UB6 U;  2XID A;  1MA7 A;  2L76 A;  4OCZ A;  4S17 A;  4USA A;  5F3X B;  3TAC B;  2P6U A;  5EE3 A;  2N9K A;  3KD3 A;  1VJK A;  4F3O A;  2ZJD A;  3P2B A;  2BQQ A;  4IW0 A;  4X57 B;  8ICU A;  4XGA B;  4GMV A;  1UT8 A;  1KFS A;  4IOI E;  8ICL A;  3BVG A;  3JPN A;  4WJP A;  2LM1 A;  5IIJ A;  3SMV A;  2BR0 A;  1SJE D;  3M1Y A;  4OVZ A;  3FAH A;  4GXK A;  4I29 A;  4GXB A;  3VTW A;  2FMQ A;  4KLO A;  1Z5S B;  2N0S B;  5HR7 A;  5DGB A;  4LNI A;  3DWM A;  2UVU A;  4C4V B;  2M17 A;  2Z0D B;  5DDM A;  4QZG A;  5KNI A;  4ECW A;  3KUD B;  4YTM B;  2IOF K;  3WK5 A;  2HW3 A;  1WJ6 A;  2JPH A;  2PVO D;  3Q14 C;  3HJE A;  3Q3M C;  3QEB Z;  9ICN A;  2NVU I;  4RUA A;  3GIM A;  4HLE A;  2WFA A;  2XK5 B;  3WK9 A;  3AV8 A;  4J9Q A;  5HG2 A;  4R63 A;  3SV4 A;  1Q8K A;  1ZQQ A;  4NLK A;  2IO1 B;  4Q43 A;  4N6E B;  5FK9 C;  5L1K A;  2K6D B;  3P4S B;  1SE9 A;  3ENE A;  1WE7 A;  3ZNI D;  3MFI A;  1SSN A;  9ICR A;  4KLM A;  3NRZ A;  2C9W B;  1V5O A;  4GXI A;  1KL9 A;  2E3T A;  2DYB A;  4J6I A;  4QJF B;  4HCN B;  5KHO A;  2KJ5 A;  1ZQT A;  1NKC A;  4EZ6 A;  3ONN A;  1F9J A;  5J2R A;  4MT5 A;  2ZG6 A;  5DB8 A;  4QWE A;  2E1F A;  2BGF A;  1S10 A;  3Q8A A;  4BOS C;  4BWJ A;  2E8N A;  4KGT A;  2HCF A;  1C9F A;  3QZ8 A;  4ED6 A;  3PX4 A;  3NJT A;  1VJ5 A;  4DQI A;  1FMA D;  5HHD G;  4IC7 B;  2KMC A;  1TBE A;  4DSJ A;  2KTF A;  5AM2 A;  1SJH D;  8ICH A;  2OJR A;  2D3G A;  3BQT A;  4FFD A;  2G45 B;  2MWS B;  4WJQ A;  1YN4 A;  2B0C A;  4IQV A;  3AEF B;  2BDP A;  1T0S C;  3AEE B;  4KGS A;  5AUI A;  4DOA A;  4YR3 A;  3QQ8 B;  4FHJ A;  4KLU A;  4QZD A;  8ICV A;  3V6K A;  4OZB A;  2XGQ A;  5D4B A;  3AED B;  3VH3 B;  2YMQ A;  3AN1 A;  2EKE C;  4HPP A;  2HJ1 A;  2FPL A;  2KNB A;  3RN9 C;  1QLB B;  3M9N B;  1FXI A;  5IIN A;  5ALW A;  3SDL C;  1KQQ A;  1KOT A;  2ZIU A;  4QWB A;  2HHU A;  2ACZ B;  2RD0 A;  4G50 A;  5JTI A;  2OED A;  3QUQ A;  4WUR A;  2XN9 C;  4G3X B;  2Q4T A;  3JPQ A;  2LRW A;  2LWP A;  4JWU C;  4BXO B;  4RM8 A;  2LJI A;  9ICA A;  1WSP A;  4EKU A;  4ASW C;  4FS2 A;  1V1P B;  3EC8 A;  2A1J B;  2AL3 A;  1L0Y B;  5ALO A;  3PGE A;  3PZ8 A;  1J0G A;  1FIQ A;  5AK5 A;  3DHH C;  3H8H A;  1XNS A;  4ZOH C;  3RUI B;  1WXQ A;  2ZIW B;  4I2D A;  1BXT A;  3ONS A;  2KDI A;  4MFF A;  1ZXI A;  4I2I A;  4FS1 A;  8ICR A;  2DPJ A;  2R8G A;  3LYY A;  3TEW A;  1I7H A;  1B43 A;  2EZZ A;  2NS5 A;  1SZH A;  5ALV A;  2Y1I A;  1C1Y B;  2ISP A;  1C20 A;  4UAR A;  1TY0 A;  1WCN A;  1S3S G;  1FCC C;  2IO3 B;  5J0X A;  3AUO A;  4A6Q A;  2K25 A;  3I76 A;  5DBA A;  1CZP A;  3ZNG C;  2MEK A;  2I38 A;  4N59 A;  4P0P A;  4XDC A;  2LGY A;  2EAO A;  3KVF B;  4UAY A;  2QB0 B;  4O1N A;  2WXN A;  3FIL A;  2R18 A;  1K51 A;  2REX A;  4I6L B;  4NJ7 A;  2G5I B;  3PW0 A;  3GIJ A;  4RPY A;  2BDU A;  5KFV A;  1JWU D;  5ALJ A;  3PR4 A;  1WXM A;  1SXD A;  3I63 C;  2QJL A;  1HTQ A;  7ICM A;  1WX7 A;  1WG8 A;  5J2D A;  2KMM A;  2WB1 C;  7ICL A;  1V80 A;  4F5O A;  1P98 A;  1ZXH A;  3P63 A;  3P4P B;  1XLN A;  1ZD4 A;  1T4G A;  3NGD A;  4Y2U A;  1XD3 B;  4M9G A;  7ICF A;  4I6N B;  5D3I B;  2BYT A;  4AP4 C;  3HM3 A;  2EMS A;  1Q46 A;  2SAK A;  5C23 A;  1WZ0 A;  3AE4 B;  4MEY A;  2CJN A;  4HKZ E;  4DSI A;  4LJX A;  1JI7 A;  3MGV A;  4Y2Y A;  4YCX A;  3TEZ A;  2JXJ A;  3U30 A;  5AK3 A;  3RRG A;  5AK4 A;  4NLZ A;  1I4P A;  2CKH B;  3PTF C;  1NI3 A;  3BJY A;  5FR3 A;  4BJQ A;  1HUO A;  2WAQ C;  1U48 A;  2MJD A;  5GTI U;  4ECS A;  2A1A A;  3MR3 A;  2VZK D;  4TUP A;  1PVR A;  4FBT A;  1V2Y A;  2BS4 B;  2K6Q A;  4GLS C;  3RD2 A;  4QWD A;  1GOZ A;  4NV0 A;  2A5U A;  2EMT A;  1KLG D;  2K60 A;  4QW8 A;  1C77 A;  3PLU A;  4JV0 A;  1PDX A;  2LXC A;  4YTP B;  1ZQN A;  4HDO A;  4ICA A;  5KG3 A;  5KG7 A;  4O3S A;  3ZD9 A;  1RAX A;  2JZZ A;  2KSO B;  2N1R A;  2KNJ A;  4PK1 A;  2JMG A;  1WGG A;  1NOM A;  2GBK A;  4KIT B;  3GV7 B;  4UAS A;  1HEK A;  4IQU A;  2L32 A;  4RU9 A;  2CPR A;  3DPD A;  3PRM B;  5H8Y E;  3URY A;  2KAN A;  3NVW A;  5KG0 A;  2IY0 B;  2V3S A;  2AWT A;  3W5U B;  4E3C A;  1S0N A;  2WB1 F;  1KDH A;  4NL9 A;  4F1S A;  4NY0 A;  4AYB C;  5KT3 A;  2WHE A;  4DF4 A;  1WE6 A;  1TAQ A;  4OZC A;  1XO3 A;  2RDI A;  1X1M A;  4I2E A;  4M9L A;  1L6U A;  3A9J A;  2VZK B;  1BML C;  5DG9 A;  5AIA A;  3TKA A;  4F71 A;  1NYR A;  3ISD A;  4ED8 A;  1ZQR A;  1YZ7 A;  2M56 B;  1GB4 A;  3QU5 A;  2KN5 A;  3SEI A;  4ARI A;  4DL7 A;  1T0Y A;  2GBN A;  4O5K A;  1N5X A;  2K1F A;  3GZN I;  3D2S A;  3MR2 A;  2NMQ A;  3OJ4 B;  1Z19 A;  4B9K A;  1RFK A;  3HP6 A;  2FLP A;  3VHT C;  5L95 C;  2MUT A;  2KOX A;  1XT9 B;  3EWA A;  1EO6 A;  2PPH A;  4MJS B;  3AXC A;  2PJH A;  3Q3F A;  4A9A A;  1AQ6 A;  2JH7 A;  1ZQB A;  4P16 A;  3AE2 B;  3FYH A;  1Q3U A;  2ODG A;  7ICV A;  1B0X A;  8ICG A;  5AKL A;  4RF1 A;  3LYS A;  4J9O A;  1NKE A;  5AKJ A;  1ZE3 D;  3EYZ A;  3AB5 A;  2MBO A;  3M63 B;  1B9R A;  2C28 A;  5AZF A;  2BBC A;  4YSX B;  5EE1 A;  2KDM A;  2R2O A;  1SBB B;  2D5G A;  1N5W A;  3IBE A;  5HKH A;  2FCN A;  2WXG A;  3NTU A;  1ED1 A;  2DX5 B;  1D8B A;  4Y2P A;  5C0Y A;  2AYO B;  2Y5C A;  4HRO A;  5ALQ A;  3R7Q A;  5DLF A;  2WF8 A;  3K1R B;  3M3J A;  3D6J A;  3LDA A;  8ICM A;  1HXY D;  1EU3 A;  4GGQ A;  1GO3 F;  2BQ3 A;  1E8Y A;  1F77 A;  4XYC A;  4KN4 A;  3QU9 A;  1JAL A;  2LHE A;  2RDH A;  5AI0 A;  2JR5 A;  4ED0 A;  4I2C A;  2CHW A;  4KMU A;  1OQQ A;  1XXG A;  4CF4 A;  3JW0 X;  3RT3 B;  2WGS A;  2DWQ A;  4YR2 A;  3F2B A;  4B9L A;  2KJR A;  3L0W B;  1JIH A;  4WWM A;  5K4L A;  5KAI U;  3V7J A;  3RJJ A;  2PMZ C;  3B9J A;  1X9X A;  3UIN B;  2HBK A;  4OVU A;  3TJP A;  5L83 A;  4OJ6 A;  4ZHO A;  3QU2 A;  3NHE B;  5BMI A;  4DO9 A;  3H0R B;  4AJW A;  1DOI A;  1M4V A;  2EEL A;  1ZQE A;  9ICM A;  2W3R A;  3APD A;  4O3M A;  2IO0 B;  3DBR I;  3RFA A;  1QSY A;  2PLP A;  1JUD A;  2AGQ A;  1V9P A;  4J9S A;  3VUW A;  5FP0 A;  1L4D B;  1L7N A;  4K81 A;  2KQ4 X;  3N1X C;  1SE4 A;  1V49 A;  1WUD A;  4QWA A;  4PH5 A;  4TSS A;  2G07 A;  3NG0 A;  4AUQ C;  4C8O A;  2D3C A;  5EDS A;  3MFH A;  1NDD A;  4M6W A;  2JZB A;  4YG2 A;  1NK7 A;  1I4X A;  2HVH A;  3DDC B;  4JIO U;  3SR6 A;  3R8B A;  4M04 A;  1KTK A;  2HD5 B;  4EYI B;  4OJL A;  3KWL A;  2ZUC A;  4KLT A;  3EUB 2;  4A3P A;  2K8C B;  4ITK A;  5AM0 A;  3JPS A;  3LB8 C;  5J2B A;  2L05 A;  3IHQ B;  1DXS A;  3B1L X;  3QA8 A;  4I2J A;  3OAW A;  2K39 A;  4F93 B;  2KJ9 A;  3UPQ A;  3AEG B;  5J0R A;  1YMH E;  2N9P C;  3PRP B;  3CYM A;  4BKS A;  1F0Z A;  3DDH A;  1ZOL A;  5BOM A;  7ICP A;  4CRX A;  5DGA A;  4PGY A;  3KQ4 A;  1PVP A;  3W1S C;  4FBU A;  3BZK A;  4HWI B;  3T3F A;  4PGQ A;  3ALB A;  2X38 A;  4PS7 A;  1WXV A;  4CCH A;  2GBJ A;  2BWE S;  4Y2T A;  4K3B A;  3MGH A;  7ICG A;  4KIK B;  2ZUD A;  9ICX A;  4RUC A;  1C76 A;  4K3C A;  2LGS A;  4WIP A;  1ZOY B;  3JVZ X;  1X6J A;  4YWG G;  2JRZ A;  4C80 A;  2KTR B;  1NBF C;  2BPS A;  2B21 A;  2XI9 A;  2QDF A;  2HJ8 A;  4YD2 A;  5TSS A;  3UXP A;  2KKC A;  4DQS A;  2GBM A;  4TUR A;  1XEE A;  2KDF B;  2KFN A;  4CNQ A;  4YT0 B;  1QZE A;  1P3Q U;  3GE3 C;  3LJ3 A;  2D07 B;  3DBS A;  3FC4 A;  1MG8 A;  3KUC B;  3TMP B;  2QSD A;  1Z00 A;  2W54 A;  1I4G A;  3I57 A;  3QHT A;  1WCL A;  3TQ1 A;  5AI6 A;  4RMA A;  4OZA A;  5KFS A;  1UEL A;  1ZW7 A;  4DBG A;  4F8C B;  1ZRM A;  4J9M A;  3VC8 A;  2NTS A;  1X9M A;  4W9C A;  4YXD B;  3RAX A;  2QKQ A;  4YFK A;  4EFO A;  1Q3V A;  4KV2 A;  2VJ4 A;  3BS5 A;  3WAP A;  4GB9 A;  3QAQ A;  2PW9 A;  2INN E;  3H7I A;  1SWV A;  2HOF A;  2O2V B;  2R8I A;  3PNC A;  2JEG A;  4JB3 A;  3B2G A;  1G6J A;  3L13 A;  4BKG A;  5DG7 A;  3KKA C;  2LGX A;  2BF8 B;  2EH9 A;  3M6Z A;  1FD6 A;  2P66 A;  4F50 A;  3N30 A;  4DFM A;  3V61 A;  1ZJN A;  2NV3 A;  1OFF A;  5J2I A;  1NK9 A;  1DRG A;  7ICJ A;  7ICQ A;  1XCT L;  5JU5 A;  3R3M A;  4WQM A;  3ZDE A;  2MU2 A;  2IA6 A;  4GFJ A;  1QSL A;  1WI0 A;  3JYU A;  1FXA A;  1LO5 D;  3MJ5 A;  4YSZ B;  3AL0 B;  1S97 A;  2WYQ A;  1RLF A;  4RQ0 A;  1LKY B;  2GRI A;  4DXA B;  4IUM B;  1NK8 A;  4R64 A;  4ZYS A;  5B66 U;  1EU4 A;  1UD7 A;  2W55 A;  4DFJ A;  1ZDX A;  3T3O A;  3QXG A;  2W7P A;  4RQ5 A;  1WWT A;  2F1H A;  1L6N A;  2IBI B;  3AU6 A;  4FO6 A;  3D2Q A;  1K8R B;  1PZN A;  3QU4 A;  3IRU A;  1DGJ A;  1L0V B;  2L3Z A;  1I4H A;  1L3U A;  2J0J A;  3ZJU A;  1RXV A;  3NOB A;  2DLB A;  3ZKJ C;  4ZHP A;  2L7R A;  1ZQM A;  3AE9 B;  2UYZ B;  4KLI A;  1R7S A;  2F1J A;  3PW2 A;  1ZGU B;  2D11 A;  4GIB A;  1QF6 A;  3AEC B;  2IMW P;  4K7S A;  2PMV A;  8ICA A;  8ICT A;  1KSP A;  1P7E A;  1UPH A;  1TZO A;  4DQP A;  1PYW D;  1ZQY A;  1ZET A;  3C8Y A;  4JWS C;  2J53 A;  2GBR A;  2GLS A;  1B22 A;  2KD0 A;  5KG1 A;  3P4Q B;  1NZP A;  4F2R A;  4DCC A;  3H8M A;  3L10 B;  1D5X C;  1SV4 A;  5IKC M;  1ZQA A;  5KFX A;  5LXI B;  1E7V A;  1Z1B A;  5KFR A;  3AE5 B;  1ECW A;  4BWM A;  2V4Q A;  2YQE A;  1XCQ L;  4JGH B;  4OW0 A;  2CR5 A;  2KN7 A;  3DVN U;  1HIW A;  1YNT E;  1YN5 A;  4FHK A;  2KG5 A;  5AKG A;  1KN5 A;  5CEH A;  1WWU A;  2K5P A;  3IXS A;  1KLV A;  4MEX A;  4F4Z A;  1ZQJ A;  2YMM A;  1TS3 A;  2AQ4 A;  1NK6 A;  3DBH I;  1JWA D;  5CX3 A;  1J8C A;  5DLG A;  1JX4 A;  1LFD A;  2ONQ A;  2ZXI A;  2I5H A;  2JWZ A;  3WK4 A;  2L83 A;  5C3J B;  1Z4N A;  3UQ0 A;  3L5K A;  2D3B A;  1IIP A;  3PO4 A;  5AIC A;  1H4R A;  3ALR A;  2GI9 A;  5AKZ A;  4IWP A;  4F4K A;  1JCK B;  1LQB A;  3Q3N C;  3PST A;  1IYF A;  4PL2 A;  4ZYN A;  1ZJM A;  2E6X A;  3BS7 A;  1ZQF A;  2LVP A;  2WXQ A;  4J3O D;  2I2Y A;  5E79 U;  5JHB A;  4EX6 A;  1V81 A;  3Q2A C;  5CJ7 A;  8ICF A;  2N4F A;  2D3A A;  3RJH A;  1GNU A;  3L3F X;  3FDS A;  1COO A;  2HMX A;  3PV1 A;  5HP4 A;  2C22 A;  5KT2 A;  1UHU A;  5IIM A;  4H2A A;  3IT4 B;  1U9L A;  4Y2R A;  2BCR A;  7ICS A;  3B0X A;  3ISB A;  3TI0 A;  1L4Z B;  3GU3 A;  3H8S A;  4WJN A;  1OQR A;  4OJP A;  5DB6 A;  1Q0W B;  4EZK A;  1MI0 A;  2WDR B;  4F5N A;  1RYR A;  4I28 A;  2LXA A;  3V62 A;  2OXO A;  1YN3 A;  3RJK A;  3RJI A;  2BCQ A;  1RZT A;  2KMA A;  3HW8 A;  1UUP A;  3QZ7 A;  1LB2 B;  2N7E A;  4F72 A;  4D2K A;  4G9B A;  4IG7 B;  3H4B A;  2L0T A;  2QIL A;  3K75 D;  3N20 C;  2XNA C;  4ECU A;  4DDG D;  2ZPY A;  2FIF A;  5GXG B;  2PVG C;  5J8Y A;  2CS4 A;  5J0Q A;  2B6G A;  3T5J A;  3VDZ A;  4Q2J A;  2ZJA A;  4E74 A;  1QQR A;  2KVZ A;  2K4H A;  3RJE A;  4B6W A;  2PFP A;  2C7M B;  3PRE A;  3WKA A;  4UDU C;  4P4M A;  4MFA A;  4A20 A;  3RR8 A;  1IV8 A;  1L8L A;  3PX6 A;  3ZVV A;  1A6S A;  3CSF A;  1SE2 A;  2DUY A;  3ZRC A;  4A8X C;  4YD1 A;  2VA2 A;  3R7R A;  3RNF C;  1X2I A;  3R66 C;  5DQI A;  1SZP A;  2HHV A;  5KFI A;  2KVR A;  3DHI C;  2WXR A;  2W8K A;  2ZIU B;  5D6J B;  2KV2 A;  3E2E A;  1SIJ A;  4JUZ A;  3SD5 A;  3WKB A;  4ANU A;  2MW5 A;  2L00 B;  9ICU A;  3OPX A;  3UMC A;  1V5T A;  1HZ6 A;  3QX1 A;  1UWX A;  1J7B A;  1PVQ A;  5AM3 A;  3V7L A;  1RM6 C;  2WTF A;  2CU3 A;  4NY8 A;  5D3D A;  4TMA B;  4W9K A;  3QX7 A;  3QK0 A;  4B95 A;  1RYU A;  5DQG A;  4RQN A;  4RT3 A;  4O5E A;  4EOY A;  3HT3 A;  5EOZ A;  3IN5 A;  3TUO A;  2TSS A;  1XO0 A;  1ZQW A;  1TYG B;  2V4L A;  4EBD A;  1YX5 B;  4YSY B;  2ZVN A;  4RQ7 A;  3A0B U;  5J17 A;  3OWE B;  5G2N A;  3VR8 B;  3PZD A;  2RPV A;  4DHJ D;  3L54 A;  3ZXR A;  3ZIM A;  2FAZ A;  4AQ7 A;  3DVN V;  5KAF U;  3RPF C;  2MX2 A;  3QIJ A;  1VDV A;  2VA3 A;  4QW9 A;  3H1U A;  4WWO A;  3RFZ B;  1PK1 A;  2KWC A;  3THV A;  4R66 A;  4NM1 A;  2IGG A;  4P0P B;  8ICZ A;  3EFC A;  1UF0 A;  1UA0 A;  2XO7 A;  5J2C A;  4F4X A;  3AH7 A;  4RFB A;  2LPE A;  3FIL B;  5IO9 A;  5JXV A;  1NJW A;  4NLC A;  2NYV A;  5KT5 A;  3ZYY X;  4US8 A;  3IG5 A;  5CHG A;  2LYA A;  1E8X A;  1NI2 A;  1XQQ A;  3F5E A; 
#chains in the Genus database with same CATH homology
 1C4C A;  1NEK B;  3N9Y C;  1EWY C;  4MM3 B;  3HUI A;  4HRS A;  4OZC A;  1XLP A;  1XO3 A;  2IPK D;  3BYT B;  1L6U A;  2Q5W D;  3HVZ A;  1ROE A;  3U7Z A;  2VZK B;  1BML C;  3UI3 A;  1E10 A;  1FNV A;  1NYR A;  2WXO A;  5MPO A;  2M56 B;  3GS2 A;  1GB4 A;  1A70 A;  2DYO A;  1JRP A;  1XLQ A;  2ZW1 A;  3IAS 1;  2WDQ B;  4ARI A;  1E0Z A;  2JYE A;  1D5Z C;  1N5X A;  2B76 B;  1JWS D;  2Y5P A;  2NMQ A;  2Z8L A;  2BS3 B;  1RFK A;  5H92 C;  1FM0 D;  4B0M A;  2LMC A;  3SEB A;  1KRH A;  1TKY A;  3MC0 B;  2WXP A;  1DOX A;  4A9A A;  5EE9 A;  4IKG A;  4JX1 C;  4A90 A;  1PFD A;  3W5V B;  1L6V A;  1ZUD 2;  2J4X A;  4P16 A;  1SEB D;  2HDE A;  3AE2 B;  1SF0 A;  1STE A;  4MAC A;  3IAM 1;  3TSS A;  3O13 A;  2V4I B;  1NEN B;  2J42 A;  3BK2 A;  4RF1 A;  2BB6 A;  1SB3 C;  1F2R C;  4KGR A;  2DBY A;  1V1O A;  1ZE3 D;  2NTT A;  2L52 A;  2JYT A;  3AB5 A;  1HZ5 A;  4DXG A;  1B9R A;  5G5G A;  3P1M A;  2BBC A;  4YSX B;  2KDM A;  5EE1 A;  1SBB B;  2D5G A;  3ZJT A;  1N5W A;  1Y56 A;  2ON8 A;  2WU5 B;  3J9C A;  4RF0 A;  2WXG A;  3AE1 B;  1AN8 A;  1SXT A;  3TEY A;  2BW2 A;  2Y5C A;  1P7F A;  4HRO A;  1ZPS A;  2L1A A;  4NAM A;  1HXY D;  1EU3 A;  3Q8F A;  4C7Z A;  5BYR A;  2WS3 B;  1D4B A;  2QEJ C;  1N60 A;  1F77 A;  5I4D A;  1JAL A;  1JWB D;  2FUG 1;  2JWU A;  2K22 A;  2LHE A;  2RDH A;  1OQQ A;  1XXG A;  3TEX A;  2BS2 B;  1AYF A;  1E7P B;  1FEH A;  2AQ3 B;  2M0A A;  2WXF A;  4YTN B;  2DWQ A;  1QOG A;  1EWC A;  4ZRQ A;  2JQR B;  1MVK A;  2RDG A;  2LUM A;  4WWM A;  2AX5 A;  3Q8E A;  3B9J A;  1QOA A;  3KWV A;  1I4R A;  1QOB A;  2V3N A;  4ZHO A;  1MHX A;  1QKZ A;  1VZ7 A;  3MP9 A;  5BMI A;  1DOI A;  1M4V A;  1XF5 L;  2EEL A;  3AEA B;  1N62 A;  1ENF A;  1FRR A;  2ICI A;  2W3R A;  5T8I A;  2EKI A;  1HQR D;  4OHJ A;  5FKA C;  2SEB D;  1YJI A;  1ET9 A;  3ZJV A;  2PLP A;  3E9S A;  2GB1 A;  1YQ3 B;  2WXM A;  1L4D B;  2KQ4 X;  1C79 A;  4A55 A;  1SE4 A;  3ZQ4 A;  1K53 A;  4TSS A;  1YJJ A;  1E9M A;  2WXL A;  1FFU A;  4DXF A;  4AS1 A;  2FBW B;  2WXI A;  1I4X A;  2OHF A;  3BII D;  3R8B A;  3SR6 A;  2K3U A;  1ACC A;  1KTK A;  1NVI D;  1FNU A;  1UGJ A;  3KWL A;  4LK0 M;  3I9V 1;  1KH0 A;  3EUB 2;  1CQV A;  2PKO A;  1IUE A;  4ITK A;  4KKI A;  3LB8 C;  2YEP B;  4EE2 A;  5HI1 A;  1JW9 D;  3LXF A;  1JML A;  1WRI A;  2INP E;  3BK1 A;  1PGA A;  2JX5 A;  1D5M C;  3VRA B;  3AEG B;  3SFE B;  1YMH E;  2LHD A;  1L5P A;  1F0Z A;  3BVM A;  4US9 A;  3AE6 B;  3KQ4 A;  1T6B X;  4XWW A;  1VZ8 A;  1YQ4 B;  3BWU D;  4HKQ A;  1N61 A;  2X38 A;  1IGC A;  1KF6 B;  3EA6 A;  4RGO S;  2K0P A;  1VRA B;  2H89 B;  3Q69 A;  3NUH B;  2WNM A;  5G5H A;  3W2D A;  2JXT A;  1FRD A;  1C76 A;  1T5X D;  3V05 A;  4WIP A;  1I4Q A;  1ZOY B;  2WXK A;  4YWG G;  2IGD A;  3Q8B A;  1WGK A;  3BYY B;  4C80 A;  4HEA 1;  3L4P A;  1DYQ A;  2MJ3 A;  1KFY B;  2WU2 B;  4C7Y A;  5TSS A;  3AEB B;  1C4A A;  1QOF A;  2IDY A;  4XE0 A;  1XEE A;  4NZL B;  4YT0 B;  3PO0 A;  4IDI A;  1NYQ A;  3FC4 A;  1DOY A;  1WYG A;  2QSD A;  1E6E B;  4JE3 B;  2W54 A;  2KN4 A;  2MJE A;  1I4G A;  3I57 A;  5EE0 A;  1C78 A;  3AE7 B;  4OZA A;  1F2R I;  4M0W A;  2KWD A;  2WQY B;  3SFD B;  2NTS A;  1RYJ A;  1GAQ B;  4YXD B;  4L23 A;  2M19 A;  3VR9 B;  2KAC A;  2PW9 A;  3IT6 B;  2INN E;  4KX6 B;  1HA5 A;  2KAJ A;  1CJE A;  2W3S A;  3B2G A;  2JZP A;  4C56 C;  1TKG A;  4NAW B;  1ESF A;  1FD6 A;  1GB1 A;  1SE3 A;  2JSV X;  2QMT A;  4L1B A;  4REZ A;  1OFF A;  1J7C A;  1XCT L;  4WQM A;  4DQO C;  1IGD A;  1FXA A;  3NVZ A;  4GDL B;  1LO5 D;  3MJ5 A;  2BB5 A;  4USA A;  4YSZ B;  1EM7 A;  1TS2 A;  1K52 A;  1T3Q A;  2N9K A;  5EE3 A;  3WCQ A;  1VJK A;  2GRI A;  4IOI E;  4ZYS A;  3BVG A;  1SJE D;  1AWD A;  1EU4 A;  1ZDX A;  2W55 A;  3T3O A;  4OVZ A;  3FAH A;  4HJG E;  1WWT A;  4RGM A;  5AUK A;  3CIR B;  2H88 B;  2N0S B;  4WH4 A;  1DGJ A;  1L0V B;  3U4E G;  3DWM A;  1I4H A;  3ZJU A;  3KLS X;  2DLB A;  4ZHP A;  3AE9 B;  2AQ1 B;  4YTM B;  5BMH A;  3NVV A;  1R7S A;  2PVO D;  1FO4 A;  1QF6 A;  3AEC B;  4KKJ A;  1HEZ E;  2PMV A;  1P7E A;  1TZO A;  3AV8 A;  5HG2 A;  2LGI A;  3NVY A;  1PYW D;  1QIL A;  2WXJ A;  3C8Y A;  1PUT A;  4JWS C;  2J53 A;  4N6E B;  5FK9 C;  3ETR A;  1BUI C;  3P4S B;  3P4Q B;  4LTU A;  1SSN A;  3T3N A;  1D5X C;  3NRZ A;  2QIE B;  4XDD A;  2E3T A;  1V1P A;  4R3D A;  2MH7 A;  3CWI A;  3AE5 B;  3Q8C A;  1TKE A;  1XCQ L;  5D7G A;  4OW0 A;  5BYS A;  1YNT E;  4LLG M;  1YN5 A;  4MT5 A;  3IXS A;  1TS4 A;  2K5P A;  1VLB A;  3Q8A A;  5BMG A;  3ZGZ A;  1CK1 A;  1UNS A;  1V97 A;  4KGT A;  1TS3 A;  1JWA D;  1C9F A;  1TJE A;  1JWM D;  2ONQ A;  5HFY A;  5C3J B;  2L83 A;  1J7A A;  1FMA D;  5HHD G;  1RWS A;  4RNA A;  2GI9 A;  3E56 A;  3W1S A;  1SJH D;  3VRB B;  4MH8 A;  4O1N A;  1JCK B;  1AW7 A;  2K9X A;  3V3X A;  3AM9 A;  1YN4 A;  3AEF B;  3BVZ A;  3AEE B;  2E6X A;  4KGS A;  2WXQ A;  3EGR A;  5AUI A;  2Y3A A;  1IBX A;  4J3O D;  2I2Y A;  1N63 A;  4OZB A;  2BT6 A;  3AED B;  1PGB A;  1Q10 A;  3VQI A;  3AN1 A;  1ET6 A;  4JPS A;  3GB1 A;  1QLB B;  3R2T A;  1FXI A;  3PZ7 A;  4ZRP A;  4L2Y A;  4N58 A;  4H2A A;  1JQ4 A;  3IT4 B;  3W9C B;  1GPX A;  2ACZ B;  3BZD B;  1FCL A;  2R61 A;  1L4Z B;  1B1Z A;  2AQ2 B;  2OED A;  4TQ1 A;  4WUR A;  1C4P A;  1OQR A;  2XN9 C;  2V0G A;  3AMZ A;  1MI0 A;  4JWU C;  2LJI A;  2WDR B;  4ARC A;  1WSP A;  5E6J A;  2DYM A;  1K50 A;  3NZ3 A;  1V1P B;  3PZ8 A;  1KLU D;  1L0Y B;  1YN3 A;  2WP9 B;  1FIQ A;  3H8H A;  4CQN A;  4ZOH C;  1PGX A;  5LNK 1;  3AE8 B;  1UUP A;  3U52 E;  1WXQ A;  1BXT A;  4D2K A;  5BYQ A;  1ZXI A;  1L0X B;  2QIL A;  3LYY A;  3TEW A;  1FNW A;  2WLB A;  2XNA C;  1I7H A;  4TQ0 A;  4RGN A;  1TY0 A;  5GXG B;  3HVD A;  2LEK A;  2PVG C;  2BTE A;  1UWM A;  1FCC C;  4Q2J A;  4A6Q A;  1QQR A;  2WDV B;  1CZP A;  2PIA A;  3U2S C;  2MEK A;  2I38 A;  2FE8 A;  4N59 A;  4XDC A;  1FFV A;  4UDU C;  1IBX B;  2JU6 X;  2WXN A;  3B2F A;  3FIL A;  1K51 A;  1SE2 A;  2G9H D;  4A8X C;  2RMM A;  3MHZ A;  2WXH A;  1JWU D;  4GDK B;  3NS1 A;  2QJL A;  2IGH A;  2WXR A;  3GP7 A;  4RH6 A;  1D6E C;  1VR9 A;  1TS5 A;  2KMM A;  4B0E A;  2LFI A;  2G1E A;  1ZXH A;  3P63 A;  3P4P B;  1XLN A;  1SIJ A;  1JRO A;  2J52 A;  3AE3 B;  1HZ6 A;  3R2I A;  5D3I B;  1ZDV A;  2CJO A;  4P6V F;  1UWX A;  1J7B A;  2N7J A;  2BYT A;  4FXC A;  2SAK A;  1RM6 C;  2CU3 A;  5D3D A;  3AE4 B;  5C2T B;  4TMA B;  2CJN A;  3MFG A;  4HKZ E;  3TEZ A;  2HTM E;  1QT9 A;  3DWG C;  1I4P A;  1NI3 A;  3TUO A;  5FR3 A;  1MPE A;  2TSS A;  2MJD A;  1TYG B;  3HRD D;  1VZ6 A;  2VZK D;  4YSY B;  1MHH E;  4RGT A;  2YEP F;  2N9L A;  2BS4 B;  2W82 A;  3W5U B;  3OWE B;  3VR8 B;  4GLS C;  2RPV A;  2V3P A;  1GOZ A;  2ZW0 A;  4AQ7 A;  1KLG D;  3RPF C;  1VDV A;  3RFZ B;  1C77 A;  2IJ0 A;  1PDX A;  3P42 A;  4NJC A;  4YTP B;  3P4R B;  1TY2 A;  2IGG A;  4PT5 A;  1XLO A;  3AH7 A;  4RFB A;  3FIL B;  5JXV A;  3ABV B;  1V8C A;  2L32 A;  5H8Y E;  3ZYY X;  3URY A;  4US8 A;  1ZP0 B;  3NVW A;  4WAF A;  4RCO A;  2PTL A;  4XWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...