3SR6A

Crystal structure of reduced bovine xanthine oxidase in complex with arsenite
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of Arsenite-Inhibited Xanthine Oxidase: Mu-Sulfido,Mu-Oxo Double Bridge between Molybdenum and Arsenic in the Active Site.
pubmed doi rcsb
total genus 37
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2011-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3sr6A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sr6A01
1AYFA 2W55A 3AEDB 1WXQA 1JALA 1FRRA 1N5XA 2H89B 4JWUC 3NVYA 2K9XA 1DOXA 1QLBB 4C7ZA 2BS2B 2PKOA 1I7HA 1WYGA 4IDIA 3W5UB 1FMAD 3NVZA 4US9A 3AEBB 2DBYA 3AN1A 1KF6B 2BS3B 2L52A 1GAQB 1PDXA 1DGJA 1R7SA 1QOAA 3VR8B 3ZYYX 1F0ZA 2QJLA 1QOGA 1NEKB 1A70A 1VDVA 1OQQA 3L4PA 5MPOA 2WDVB 2WU2B 3P4PB 2JX5A 3AE6B 1RM6C 1VJKA 3B2GA 3P1MA 1B9RA 2QIEB 2ACZB 1L0VB 1E7PB 1NVID 3BIID 2WQYB 1ZOYB 1N63A 4KX6B 1QF6A 1N5WA 3AEGB 2MJEA 3HVZA 3HRDD 4YSXB 5G5GA 1XLQA 2N0SB 3P4SB 1SB3C 3HUIA 3VR9B 1NENB 2BS4B 2WS3B 5EE3A 2CU3A 3NVVA 1EWYC 1NYQA 2L83A 2PIAA 3P63A 2Q5WD 1ZXIA 3VRBB 3AEFB 1FRDA 2JQRB 1WWTA 4C7YA 1AWDA 3W9CB 4ZHOA 3ETRA 1FIQA 1E9MA 3SR6A 1GPXA 3ABVB 3AH7A 3RPFC 2WU5B 4YTNB 1SIJA 3NVWA 2EKIA 1JW9D 3KWLA 3PO0A 3VRAB 1YQ4B 1JQ4A 3FC4A 2MJ3A 1PFDA 1PUTA 5EE0A 2DWQA 2HTME 1QOFA 4HRSA 1RWSA 4YSYB 4YSZB 4N58A 1DOIA 2CJNA 3AEEB 3LXFA 3AM9A 3AE3B 1OFFA 2MH7A 2E3TA 2PVGC 1NI3A 1SF0A 1TKYA 1ZUD2 2BT6A 4ITKA 4ZHPA 4N6EB 1CZPA 3P4QB 3CWIA 1E6EB 2WLBA 3AE1B 2G1EA 4C80A 3AE8B 4WWMA 1TKGA 5H92C 4P6VF 1RYJA 4ZOHC 3NRZA 4JX1C 1IUEA 4YXDB 1JWAD 1FM0D 1JWBD 1YJJA 2KMMA 3AE9B 1J7CA 5EE1A 4A9AA 1XLNA 2W54A 3DWMA 3AE7B 2B76B 4N59A 1VLBA 1J7AA 1QOBA 1UWMA 3AEAB 3SFEB 1JRPA 3FAHA 5AUKA 2PVOD 1FXAA 3LB8C 1DOYA 1YQ3B 1N62A 1YJIA 3AV8A 2WP9B 5C3JB 3AE4B 2M56B 1E10A 3AB5A 2H88B 3B2FA 3WCQA 5EE9A 4YTPB 2LEKA 1FFVA 4HROA 1XLOA 1ROEA 1KFYB 1L6UA 2OHFA 3SFDB 1FFUA 1L6VA 1RFKA 3B9JA 1WGKA 1XO3A 4LTUA 2AX5A 4YTMB 1QT9A 1T3QA 1TKEA 1CJEA 1N61A 1XLPA 2KAJA 1TYGB 2K5PA 2W3SA 3AECB 2WDQB 3EUB2 1FO4A 1NYRA 3AMZA 2Y5CA 3P4RB 4WQMA 1ZP0B 2M19A 2MJDA 5C2TB 3NS1A 1FXIA 5G5HA 2CJOA 3W5VB 1OQRA 1V8CA 3AE2B 1V97A 1J7BA 5AUIA 2FBWB 3DWGC 3AE5B 2W3RA 4US8A 1N60A 2K22A 4FXCA 4JWSC 4YT0B 5H8YE 1TJEA 1KRHA 5GXGB 2WDRB 1WRIA 1JROA 1L5PA 4USAA 3CIRB 1E0ZA
chains in the Genus database with same CATH superfamily
3I9V1 3PTFC 4W9KA 2JZBB 4IRCA 5FKAC 1SEBD 4BOZB 3N3KB 3PRZA 1QLBB 2OJRA 2MQJA 1FMAD 1YIWA 3DPDA 1V81A 3C23A 1TVAA 2K8HA 2KV2A 2VZKB 4J9KA 2BCRA 3TKAA 1NK4A 5KFLA 1NDDA 4R8UA 2GB1A 2KIVA 2OCEA 2JEGA 3W2DA 1V38A 4RNNA 2LI6A 2OM6A 5ALZA 5GTHU 5KFEA 1UBIA 3RZWC 4F5OA 2WFAA 2N7DA 3R2TA 4RNAA 4YR3A 1MQ3A 1LGRA 4NV0A 1NVID 1WJNA 5DPRA 3F53A 1EXNA 3VUYA 5AIBA 4PPXA 3M9NB 1AROP 4NPNA 2KIWA 3HUIA 4P1BC 4DFJA 2A5UA 1V85A 5I4DA 2WS3B 2CU3A 2LVOA 1ZQRA 2WF5A 5BOMA 5HHDG 3ZDTA 1CMXB 3VRBB 5KT3A 2OEDA 2YQEA 3HX0A 3Q8QB 4J3OD 5E6PA 2L8JA 1FD6A 4EZ6A 5AI8A 2KWUB 1KFDA 2HJ8A 5IINA 2CHXA 2FCQA 4AJYB 2CJNA 3UQ0A 3T5KA 1D8YA 2AQ2B 4LNFA 2PFOA 1JXLA 2V4IB 1CEZA 4KLFA 4ED6A 1ESFA 2HBKA 2LGDA 3H8SA 4UAZA 8ICSA 3BQ0A 5ALPA 4WWMA 1BUIC 1WGRA 2RD0A 1LKYA 3UMGA 4B95A 3MP9A 5AM2A 4WWOA 3F5AA 8ICPA 3H8HA 9ICVA 3DWMA 4N59A 2NMQA 1JRPA 3IT4B 4DBGA 3AXCA 3IVFA 2KOBA 5IKCM 2VIXA 1N62A 4JPSA 3BVZA 1E5WA 4F5PA 2L76A 1OUQA 4GXIA 4MDKE 2ZIWB 1WM2A 2VA3A 2ZJ5A 4BKSA 2BCUA 2ASDA 1ZKHA 4BVUC 1C79A 1T94A 4Z6EA 2LXAA 2G45B 4FZLA 2CHZA 5KFDA 1ZD5A 3BJYA 2DZIA 4WQOB 2PFQA 4HCNB 4EYHB 3F5EA 1RYSA 2IYDB 5D7GA 4UATA 5J0TA 2MA1A 3JPPA 3L54A 4RUAA 5ALOA 3TFSA 1O08A 7ICQA 2JEFA 3E58A 1QQRA 3GV7B 4JWSC 1FCLA 1SWVA 4KDIC 4WJNA 1S9FA 1NJXA 1JROA 2R2QA 1SL0A 1UT8A 2RP5A 2KDMA 3N1ZC 5J0QA 3WA0A 3HILA 1TAUA 2DAFA 2PJHA 3GIMA 4RF1A 1X6JA 2CS4A 3F2CA 5BMHA 1ZQGA 4L2YA 2I5HA 2OYYA 3AEBB 5KG6A 4REZA 1Y56A 2LVQA 4W9CA 1JXEA 1SV0C 4ANUA 5IN7A 4GLXA 1KLGD 5AICA 1TE2A 4QWDA 3W1SC 4DSKA 1OQQA 3Q3NC 1F5SA 2WDVB 5KG3A 5ALHA 2HHXA 3LDAA 1V1PB 4KITB 3SDLC 3UIOB 4C8OA 3AQEA 4IL6U 4ECTA 4BXOA 3BIID 3MJWA 4LNKA 5KT2A 4TQRA 4YSXB 3DV9A 2INCC 4ECXA 2IO3B 1U48A 1IXRA 4QZ8A 2ZPNA 4Z6DA 3PZ8A 5C5JA 3VR9B 4YCXA 3GU3A 3V6JA 1HZ6A 5AZGA 2ONQA 2MP2A 2IOFA 5L1IA 1HUOA 1WX7A 1Z5SB 1PYWD 7ICKA 2RDJA 1HIWA 1OXJA 3L5KA 3W9CB 2L05A 7ICJA 3EA6A 1SJED 5ALNA 4RH6A 1J8CA 4KVGB 1TY2A 2HCFA 3PLUA 3PMNA 4ELUA 2WAQC 1ZQNA 4YTNB 2V4RA 3IG5A 3V6CB 2M1MA 2V1YA 2W9MA 2A1JB 5HR6A 4YSYB 2LM1A 5J2CA 1RYRA 5J0YA 4TQ1A 4GFJA 1C1YB 5AKJA 2K4IA 4MHVA 3AU2A 2G5IB 2LMCA 3KQ4A 2R61A 2R8IA 3DBHB 1UA1A 3D6JA 2GBMA 4C80A 2JWUA 2JSVX 3MC9A 1L8LA 2BKEA 4DDID 2K89A 2F76X 5ALKA 5KG5A 1YX5B 5KFYA 3OG5A 3PVXA 4HWIB 4RUCA 4KLJA 4KLQA 4M02A 2JXTA 2BQ3A 4WJPA 3SFEB 3GFKB 8ICLA 2AGOA 2HHWA 3UQBA 2MRLA 2ZIUA 3OHAA 2XC9A 1EO6A 2QARA 3IG8A 4C4SA 4WWPA 2F1JA 5GMVA 2KMAA 1HTOA 4KLOA 2LYAA 1JIHA 3HIZA 4FBTA 2F3NA 1XXGA 4DXFA 1QQ7A 5AKHA 3PSFA 3RCZA 2KSOB 3PT2B 3U30A 5KT6A 2KACA 2XN9C 4GLSC 1RXVA 4ZYNA 1SGHA 3T3OA 2KZRA 2KVCA 9ICEA 2H3QA 3BK2A 3R8BA 1OGWA 2XGQA 4UBCA 1SV0A 3THVA 1N6ZA 5KFVA 2ZJ8A 3W1SA 4QWCA 3OPXA 2HHSA 3RZFA 2IO1B 2FMSA 2C60A 1H8CA 4CO7A 2BWFA 4F92B 1KRHA 3M6KA 1RXWA 2FIFA 1AYFA 3WAPA 4Z6FA 4JWUC 1QKZA 4Y2PA 4DF4A 2MHJA 3T79A 2JZZA 1WXSA 2DBYA 1TTNA 2J7QB 2C7NB 4I2GA 4G50A 4B6JA 4PGXA 1YJ1A 1BPBA 1MHXA 1TV9A 1QOAA 3IBEA 2QJLA 4DFMA 2OOBB 2G07A 3UMCA 3N7SC 4TQSA 4WURA 1NZBA 3L10B 2KOXA 4DFPA 7ICSA 2KE7A 3CW2C 2PKEA 2KVZA 1Q46A 2QIEB 1LXDA 3Q8EA 1E7PB 5TSSA 4YXMA 2BW2A 3SEIA 3K1ZA 2H3IA 5DB8A 4MEYA 3UQAA 1DOQA 1LQBA 4QZCA 5CHWA 4EKUA 2AEHA 2YB1A 5T14A 2GBRA 2N7JA 2NCNA 4DQSA 2Q4TA 1B1ZA 1NK9A 1RAXA 4YXJA 2Q5WD 1ZDXA 3JW0X 1XSNA 2A4ZA 4AS1A 1RYUA 4F5QA 1ACCA 1VZ7A 4ZHOA 1AWDA 2KHQA 4Y2VA 3ETRA 2Y0SC 3EZ5A 1SXEA 4Y2XA 4RQ8A 3ZXRA 1PVPA 2LMRA 3D32A 3EGRA 5L1LA 3RJFA 3OGUA 1XS9D 1M94A 2EKIA 1KEJA 3ZDMC 2UYZB 4M6WB 2DENB 5KFMA 3QHTA 2F1IA 1RZTA 2K39A 2SAKA 4HDOA 1X42A 4PT5A 3ICXA 3BVGA 2A1AA 4P0PB 1RFAA 4UQGA 1LM8B 5AM3A 2KO3A 1NK8A 1T4GA 5AK4A 1TKYA 1ZUD2 4N6EB 1UT5A 5DDYA 2C7HA 2VH2A 3SD7A 1E6EB 1KTQA 3IT6B 2W8LA 1YN3A 4WWNA 3TSSA 2ASLA 4KMOB 4BX9C 1JWAD 1Q0WB 4PH5A 1JWUD 2GBNA 3AEVA 3H7SA 2KTFA 3DHHC 1S0MA 3TARA 2FUG1 4PK1A 2AL3A 4FO6A 4B9UA 2MSED 4PS3A 2B6GA 2KMCA 2EZXA 2PMZF 3MDAA 4ZDVA 2KLCA 1L4ZB 5DB9A 5AKLA 3WIMA 4HPPA 1QH9A 2L0TA 3TAPA 2L00B 3M95A 4YTPB 3BVMA 1UH6A 3SYZA 2KJ5A 2LHEA 3HM6X 2INPE 3IM1A 4YD2A 4EBDA 1L3SA 5E79U 2JH7A 4NNJB 2QSDA 5DQHA 3H4BA 2WDQB 3EUB2 3HPOA 1P1AA 5BYRA 3RAQA 1BPXA 3ZDDA 2IY1B 2YVCA 1C4CA 3QQ8B 4M8NA 2W9CB 4EE2A 2BWES 5HKHA 1KFTA 1KJTA 3JPNA 1TK5A 7ICEA 1D6EC 3ZI4A 3AE5B 1L5UA 5FK9C 3EPIA 2RPVA 1NBFC 5GXGB 1ZGUB 1KDHA 4GDKA 5KFCA 3RB3A 2MH7A 4USAA 4ECSA 5DBAA 3WK9A 5AM4A 4DWFA 3SU8X 1TAQA 1YN4A 4UAUA 1SZHA 1C9FA 3NVYA 4M0WB 1IIPA 2IO0B 1DOXA 3CRXA 2ZNVB 2H3FA 2YMPA 4G3XB 4JLCA 1ZQLA 1DGJA 4UB3A 3N1YC 2MBOA 3EW9A 3GB1A 5F9LA 3PX0A 4FJZA 4NLNA 3GS2A 4Q44A 1AARA 4BOSC 2C2RA 2MUTA 2WF6A 1WXVA 2K6QA 1A6SA 4K7UA 3P4PB 4GU2A 2LGYA 1RM6C 3PSEB 4KLSA 3JSVB 4TSSA 1ZD4A 5AI6A 2KJHB 1SXDA 1O03A 3PX6A 3PY8A 2J42A 4PYUA 2KZMA 4NLKA 3P4SB 4P4PA 4EOYA 4XWWA 2F2AB 1IYFA 3WAMA 3GIKA 3RD2A 2YTUA 9ICOA 4W9LA 5KG4A 1SBBB 3HK0A 4MEMA 4G0NB 3C2KA 2KANA 5ALTA 2BGWA 2XVTA 2PXIA 4I6PA 2KNJA 1S1QB 2D3CA 4O1NA 4EBEA 2XIDA 2K8CA 3ZNHB 2MBHA 2MJ3A 4DOBA 4JV2A 4R65A 3EHVA 4F8RA 4BAXA 4KKJA 4DL3A 4KSKC 4A20A 9ICRA 3AM9A 2ZUDA 4ZHPA 2YY6A 1SF0A 2WXPA 2RDGA 4B0EA 3P4QB 4GGQA 2BQRA 2WLBA 4YL8A 1LB2B 1Q3VA 2WF7A 2DAJA 3ZNGC 4MSMB 3SAFA 4LNIA 3I63C 2DGZA 4KLLA 4YXDB 3SV3A 2ZXIA 4RNMA 5ALQA 3RR7A 2ON8A 4KLDA 5DB7A 2DL0A 1PZNA 2C7MB 3ZIMA 4W9DA 4EZKA 2EMSA 5DBCA 2C5LC 3OLMD 1G6JA 4I2FA 1B43A 4OVZA 1D9FA 2O6KA 3N7RC 2M0XA 1COOA 4DSLA 2K8BA 2RPQA 1C77A 2HJ1A 1QCKA 3NZ3A 3TL5A 1IM4A 3UM9A 3BS5A 1MPEA 2RLTA 4H2AA 1QILA 3FM9A 4QZFA 4B9KA 1KLVA 5CJ7A 1KTKA 2RRDA 2KAJA 3KUZA 1K53A 4LCDE 3QUCA 1TS2A 4FS1A 3N32A 4BKTA 1FEHA 4KLHA 5D4BA 2FLNA 4J9RA 2G09A 3W5VB 5KFHA 3EYZA 1WGDA 2IMWP 3E0FA 3PREA 5L1JA 2XK5A 3V6HA 2R8HA 1MG4A 3KYCD 1ED1A 3KH0A 1JWMD 4I6NB 5KFIA 5IIIA 3CIRB 2ZTDA 4TUQA 2BCSA 8ICGA 2LXCA 4IUMB 5DPSA 4W9JA 3RB6A 5ALRA 1HA5A 4UASA 2IOHA 3SQIA 1ZQPA 2VJ4A 1PGBA 3AULA 5EWEA 3QC8B 4TQ0A 3NS8A 5HI1A 3H4DA 2F8LA 2Y5PA 3QUQA 2JZBA 3KTQA 4HXDA 3DVNU 1N48A 1P3QU 5CP2A 2ZW1A 4KMUA 1EF1A 2LZ6A 5MPOA 1MG8A 2HVIA 4A55A 3M62B 3MR3A 5AK6A 1P9DU 1L0XB 3KW5B 1B9RA 2AQ4A 2JEJA 5ALEA 5AM5A 4QWAA 4NLCA 3RRGA 1TK0A 2MLBA 3PW2A 7ICGA 2KICA 3WKBA 2KFJA 3NUHB 2PIAA 3RNFC 4GXBA 3VUXA 4HKQA 3LVWA 2BCVA 1MC8A 4QWEA 7ICHA 1UGJA 4N9F4 4HYKA 3QZ7A 4JWNA 3IN5A 3DVGY 1A76A 1D9DA 1SKRA 1JCKB 4LJXA 2WXJA 3O13A 1VZ6A 2DZMA 3T9LA 4QZGA 2FE8A 4JMUA 4NAWA 2DQNB 4CF5A 3V05A 2IHMA 2JV3A 4NM2A 4OJOA 2EH9A 1MN8A 7ICPA 4HAIA 3QAQA 1SV4A 2WTFA 2WXFA 3GZNI 5L95C 3P2BA 4ANVA 1HEZE 2CPRA 5H92C 1NKEA 2HVHA 2KWDA 2KK8A 2NTSA 4K7WA 3NRZA 3GILA 4K7SA 1UHUA 1P7DA 1XU4A 2UU7A 3JPTA 1C4AA 2KX0A 2L1AA 4M0AA 4ECWA 2Q0ZX 4PL2A 4CNQA 3DBLI 2KVSA 1IBXB 1FXAA 5D94A 5ALVA 4XWTA 5AKGA 3OSNA 4M9LA 1X9MA 3AE4B 3B08A 1SKWA 2ASQA 2LM4A 2B0CA 2ZIXB 1XLOA 5J0PA 2ASJA 1WWUA 4QWBA 2PTLA 5ALXA 3BYTB 1RFKA 4EFOA 2PW9A 3C5GA 3K75D 4Y2QA 1EU4A 3D2SA 2C9WB 4P16A 5KFOA 4F2RA 4FJVB 1FO4A 3D2QA 4QZDA 3ZDAA 2KN4A 3PS6A 4ZRJA 1ZP0B 5F9NA 3G6YA 2ZIWA 1ZXHA 1I35A 4EZJA 4WAFA 4ECYA 1B4FA 1L3UA 4I2AA 1ZQKA 3UGBB 1XCTL 4OZAA 4MH8A 4RM8A 9ICKA 2F44A 5AI0A 1C7YA 3NUQA 5B66U 1TJEA 1V5OA 1WRIA 4JV0A 1EUVB 3A0HU 4ED8A 1VRAB 1DK2A 5J2HA 4RPZA 4GIVA 2H89B 3MGHA 3QNMA 2KDFB 4HK2A 3PR4A 3RAXA 4RQ7A 1ZQVA 4JIOU 4XX5A 1BXTA 4FULA 4BFRA 2KQSA 3TEYA 3AN1A 2D10A 1TZOA 4W9GA 2KHVA 2MBQA 3RI7C 3ZYYX 5J29A 3QYPA 3PNCA 1C76A 1QOGA 4I2BA 1A70A 1EF5A 2UVRA 3H8MA 2CKHB 2G06A 1M4VA 4A8EA 5ALUA 2W7PA 3R3MA 4FS2A 2KKPA 3H1UA 3KKAC 1L0VB 4MJSB 3QEAZ 3U52E 2AWTA 4O3OA 1N5WA 2L3ZA 4I2HA 3C0RB 4II2B 3DBRB 2N0SB 3L08A 4J9QA 1S0OA 3M8RA 1V1PA 2HTHA 3M6ZA 4YP3A 5JTIA 4HEA1 4XYCA 3MTNB 4AQ7A 3Q8PB 3QU5A 4BZAA 4DDGD 2NTTA 3GV8B 5BOLA 4RNOA 4PHEA 3NJTA 3RPFC 4AYBF 3ISCA 5F3XB 4O5EA 2LUEA 5EOZA 1RLFA 3WANA 3A4SC 5KFNA 3H0MB 4JB3A 2V0GA 2KN7A 3FILB 4ARIA 2UVUA 2L0FA 4DFKA 4F5NA 2KMDA 4QIWC 5HG2A 1SJHD 1WE6A 3JPRA 1QQ6A 2ODGA 1ZRNA 4NXZA 4PGYA 3U8ZA 2HHTA 4J6IA 2KHWB 1D5MC 2A1JA 1TKGA 1TFRA 4UB5A 4RMAA 2ZJAA 3GP7A 9ICIA 5C1ZA 5C23A 4I27A 4MELA 4F8CB 1WM3A 1KM7A 3AE7B 3B0AA 1UWMA 1C78A 4ED7A 1WSPA 5J18A 4YN4A 1S3SG 4Y2RA 4ZYSA 3WK8A 1KLUD 5ALMA 3UF8A 3WAOA 2D8CA 4HPLB 1D3ZA 2V9WA 5KNIA 4ACFA 2GWSA 1SL2A 2M17A 4HROA 1KFYB 1L6UA 4IQUA 2MW5A 2WF8A 5BPCA 1X66A 2BQQA 3EFCA 1QT9A 4DHJB 1YZ6A 2LJIA 3PO0A 1WUDA 5IA7A 3PZPA 1X9WA 1JMSA 2KSOA 1F2RC 1DK3A 4M9GA 3I76A 1KQQA 4L23A 3ZRCA 2CJOA 2JZ3B 4UDUC 1V97A 4F4ZA 3DWGC 3WK5A 5T8IA 2K22A 3L0WB 5H8YE 3P42A 4RQ6A 3S2AA 3N9YC 1F9JA 2W55A 3ZJVA 4DFDA 1YZ7A 3PZ7A 3KOOA 3ZNZB 3RRHA 4NJCA 1MJDA 4F72A 4L1BA 1WX8A 1FEZA 2W82A 4IKGA 1V2YA 3B1LX 5KFBA 1ET9A 1WXAA 2BBCA 3BK1A 4FN2A 2WF9A 2KN5A 4LDTD 4DLGA 5DKWA 3VDZA 1J19A 3ED5A 2WXLA 4XE0A 4FJYA 2HBJA 3VH3B 4MGIE 5KFUA 2KDBA 5AK3A 2JX5A 3CMMB 1KFSA 4P2HA 3QA8A 4DXAB 3R9KA 4EENA 5J0SA 4GMVA 3SAHA 5KFGA 2ISPA 3R2IA 4RGOS 1J2MA 2LUMA 2MJEA 3DHIC 4M8MA 3RBEA 5KFFA 3H40A 2FDRA 2IA6A 3U7DA 2EDUA 3RFAA 3B0XA 3C1ZA 5KT5A 5C0YA 9ICGA 2O2VB 5BYQA 1L2NA 2WWZA 2BDUA 3PX4A 1FRDA 1WJUA 2V3SA 4FZMA 5ALSA 4J03A 4C7YA 4HCPB 4F4XA 8ICYA 3A9JB 1T0QC 4RQ1A 4P1CC 4WAAA 4AWJA 2LD9A 3IHQB 2FCMA 4GIBA 1RPLA 1M6YA 3WK7A 2UVVA 2ZNVC 3MC8A 4S17A 2XICA 1F52A 1HXYD 4HRSA 3R66C 2FPKA 2O6VD 5KL1B 1Y8RC 4M9NA 4A6QA 4JK1A 5JUMA 4MFFA 7ICOA 2NBWB 4O5KA 5DB6A 5BMGA 3SHQA 1ISNA 5J2FA 2FUHB 4M6WA 2XY5A 2ZXHA 4DXGA 3Q8MA 5KG7A 4G9BA 5ALFA 4B9SA 2N9XA 4C56C 4P0PA 1V5TA 5D3DA 3T3NA 3FKYA 2IY0B 3WK4A 4ECRA 3TJPA 2HI0A 2DHZA 4RPXA 3SMVA 2KTRB 2BQUA 3HJEA 3NTUA 3SI8A 1ZJMA 1J7AA 4EEWA 3FAHA 2R8GA 5KFAA 5JXVA 2NS5A 1U9LA 3M7DA 3BDPA 5KHQA 4MSQB 1Z2MA 2M56B 3EPGA 4UBBA 3B2FA 9ICPA 4BJQA 4CF4A 2NO4A 2ZG6A 5J2DA 2OH2A 1WGGA 4EUTA 2RQ5A 4RT2A 4O3SA 5DLFA 1NJZA 4LTUA 3OJ4B 4CGZA 2L7RA 3RR8A 5AI5A 3AECB 1NYRA 4XC2A 1UBQA 5E6JA 2CRXA 9ICAA 4PZOA 2G9HD 1WG8A 4J9MA 3NS1A 4DL4A 5C2TB 3BQ1A 1Y88A 1QSLA 2BB6A 4ECQA 2EANA 2VJ5A 4OCZA 3BY4B 4RQ4A 5DBBA 1FNWA 3DVNV 1UGMA 4DQQA 2NRWA 2K8AA 8ICKA 4Q43A 4LJOB 4WJQA 2BPFA 1E0ZA 2HHUA 2W9CA 1WXQA 9ICNA 1RRBA 4R3DA 4B9MA 2BS2B 4IDIA 4CE6A 2E6XA 3CP8A 2KD1A 1F77A 4GSWA 2C2EA 2JY6A 4I28A 3Q3FA 5EDSA 4FZNA 4DLEA 3VHTC 4UAYA 4YQWA 3RBDA 4ANWA 4KLUA 4UB8U 1KLNA 3AU6A 3M63B 3UXPA 4UAWA 4M0WA 1LV5A 2E1FA 4DL6A 3WK6A 2OWOA 3PHXB 1L7NA 1STEA 1MQ2A 1COKA 2WU2B 2M9NA 3IAM1 4IG7B 4IQVA 1TK8A 2WAQF 8ICHA 5KAIU 5J0OA 1E8WA 3PGEA 1PUZA 2ACZB 5E6NA 5KFZA 2RR9A 1ZQAA 1J97A 1V9PA 3RH5A 5AK5A 2VH1A 3IDWA 2IPKD 2XBBC 1XLQA 1L6NA 3IG3A 2G08A 5ALIA 5EE3A 4NM1A 3GE8C 3LJ3A 2YN4A 5J2KA 3JSVA 4W9IA 4O3NA 4X5VA 2W9NA 3M1YA 1B0XA 3MHSD 1WMHB 4NLGA 2RMMA 1E9MA 2JPHA 2KD0A 4IM3A 1SIJA 3VRAB 5KFKA 4KIKB 4F4KA 5KG0A 1JMLA 4PS7A 5EE0A 2ATLA 2LRWA 8ICWA 4F93B 3PRMB 2V4LA 1RWSA 3LXFA 4JUZA 3UPQA 1R4NI 5FR6A 3DBSA 4RQ2A 2WGSA 3VFKA 3LYSA 5KFWA 7ICRA 1XCQL 2J0KA 1L8OA 5L9XA 4BBNC 5KFRA 4UB1A 2WHIA 4P6VF 1HE8A 2MCNB 3Q3OC 1I4XA 2DNFA 2ZUBA 2FPMA 4HLEA 1XQQA 4S0RA 5CR0A 2GBKA 3LDZE 3CSTA 4LJPB 3UQ2A 4BGDA 4U7CA 4O0IA 1X6IA 1T8EA 3N7PD 9ICLA 3GQCA 1FNVA 2NPTA 2V4QA 4KLTA 4XUSA 4UB4A 1WYWB 2MEKA 4I6LB 3WCQA 2QMTA 2JXXA 1IP9A 3NASA 2EAOA 9ICTA 4A8XC 4K4IA 1FFUA 3Q8SB 5J0WA 3F2DA 1RG6A 1Q8KA 5J2IA 4C8LA 1ZETA 1XLPA 1X9XA 4GC7A 9ICSA 2GRIA 3KD3A 3PVLA 2Y9TA 4LDTB 5KAFU 4ELTA 5IIMA 1TKDA 2J0JA 3QJZA 2ZCCA 2V3NA 3PHWB 1NK7A 3QZ8A 1EU3A 2KFKB 3QX1A 2PE9A 2QCZA 3AEDB 4ED2A 9ICBA 2KJ8A 2K9XA 3OHBA 4Y2SA 5KG1A 2W7OA 3VH4B 2W03A 9ICQA 2IBKA 2C2DA 3I5JC 3U2SC 1BNPA 1P7EA 5H2FU 2ZW0A 4F5RA 2DZKA 4RFBA 2V9HA 1CK1A 4Z6CA 1K51A 1GO3F 1T0RC 1F0ZA 3JPOA 1P98A 4DS5A 3N97B 1VDVA 1PGXA 3L4PA 4B9NA 2Y0SF 1QZEA 3E9SA 5AKXA 2K4HA 5E6OA 3Q6BA 5JHBA 4KLIA 4ED0A 1ZQEA 2JEIA 1U45A 4MACA 5K4LA 3I57A 5ALJA 1K5OA 3PW5A 1I4GA 2O6VB 3Q8AA 4IM2A 5G5GA 5IO9A 5HMMA 2D5GA 2YEPF 2AXTU 4IR1A 2N7EA 1NYQA 3DOWA 3OAWA 5CHFA 2ZPYA 1A77A 3EECA 2HMXA 3M3JA 5J17A 3D2NA 1GPXA 2YB4A 1L7YA 3KWLA 3KHLA 3ZLZA 2ICIA 4JL9A 5DG7A 4CRXA 3LVVA 4E71A 2VA2A 1AQ6A 3IAS1 8ICJA 2NYVA 2QB0B 1ZQDA 8ICBA 4ITKA 2X38A 4GN1A 2XGPA 4GDLB 2G1EA 1ZQIA 1BPYA 3DBHI 5D2MB 2G5HB 4IS7A 3OJSA 4DSEA 3JPQA 8ICUA 2OXOA 1IGCA 1YJJA 8ICRA 1J7CA 3LWMA 2F77X 2D3GA 5AM0A 5IIOA 3AE9B 2W54A 3HP6A 2MX2A 4F7ZA 1VLBA 1D8BA 1QOBA 1UWXA 2LFIA 4GXKA 4HJKA 3NG0A 5AUKA 2XCPA 2CU1A 5TISU 4MGKE 5JHAA 1YJIA 3UMBA 1XNSA 1E10A 3AB5A 3DCGA 3A4RA 2BHNA 2DPJA 5JRTA 1F0MA 1ZPSA 2K4PA 3TBLD 4LK0M 3MDCA 5L1KA 4KDLB 1L6VA 3HKZC 4YMNA 2GBJA 2AX5A 2GH1A 3AI5A 1IBXA 4KTQA 2ESEA 4GXJA 2W8KA 2AHOB 2ZTCA 5J8YC 8ICCA 4K81A 2AYOB 2JRIB 1NKBA 4KLMA 2ZIXA 1MVKA 5CRXA 5D3IB 1OQRA 3C29A 4ICVA 3TEZA 1TAMA 5IOIA 4DHZB 2KWCA 3R7QA 2DLBA 2KEYA 3WKAA 3SENA 4KV2A 4FA6A 2KKVA 2NV3A 1EM7A 5A0LA 1J0GA 2KP7A 2AQ0A 4OJPA 7ICTA 4DO9A 1Q5WB 1KL9A 1GB4A 2MBEA 2LRUA 4HPMB 1Q1OA 1XO1A 3K9OB 1GAQB 3IFWB 3VR8B 3VC8A 7ICLA 4U6PA 1WY8A 4JWMA 2KKCA 2LHDA 2JR5A 1WGYA 3KWVA 4NJ8A 2M8SA 1S5LU 4MEXA 3GOEA 1D4BA 4C4TA 3C8YA 4IC7B 5BO4B 4W9EA 5KG2A 2WQYB 3MC1A 2VANA 4OJLA 4DSIA 1ZJNA 1SIFA 3ZRFA 4XGAB 2G3QB 5D46A 1P7FA 4NQKE 4OJ5A 3AQFA 4O9MA 2N1VA 4YTMB 4EELA 3WU2U 4R64A 3T5JA 3V6KA 2M0AA 4DHJD 2WB1C 1E8ZA 8ICEA 3PSIA 1WX9A 1WXMA 1ZDVA 3VTVA 5LNK1 4K1RB 4MJSA 3ALBA 4ECZA 4NJ6A 2I1JA 4DQRA 2P35A 8ICMA 2KYWA 2N1WA 3RNCC 4Q45A 2QKQA 2WU5B 5J2AA 5CWRA 1ZQZA 4C8KA 1BVSA 4A9AA 4RQ3A 3PV8A 1PFDA 2JXJA 5TZVA 2HD5B 4E74A 2JH1A 4I2DA 1UF0A 5KFXA 9ICXA 1LFDA 4XDCA 8ICAA 4ANXA 3AEEB 4FADA 2VA8A 4UARA 4KGSA 3ZKJC 3FILA 3DDHA 3ZDBA 1SE2A 3AE8B 5KFQA 5J8YA 1TY0A 2G0AA 1FM0D 2IJ0A 4OVUA 3GE3C 4IQTA 2PMVA 5ALDA 4OHJA 2J53A 2FCSA 1K1SA 3ALRA 4C4VB 3GIIA 2AGPA 3MGIA 1TS4A 3PRPB 3TFRA 5JU5A 5J0RA 2WXOA 1S8OA 4ED1A 1ROEA 2D3AA 2BCQA 2W9AA 4DF8A 4ARCA 4K3BA 1XWLA 4LNOA 1L7OA 2A3VA 5KFJA 5DG9A 4M9JA 3APDA 9ICUA 1K52A 2Y5CA 5DPTA 4BDPA 3ZW3A 3RT3B 5J0XA 1BPEA 1WJ4A 2J0MA 3MABA 2LKYA 5G5HA 2Y1JA 4PHPA 4J9NA 1ZQFA 3TCAA 3QU4A 3C2LA 1DGSA 4PJ0U 1Z4NA 2FMQA 2REXA 4YT0B 1Z1BA 1S97A 2KLGA 3UINB 1NKCA 3Q8RB 4DQIA 2I38A 4BKGA 2JRZA 3M9MB 2KQ4X 2GLSA 2XY6A 3RH6A 4YVZA 2CHWA 1KSPA 2SEBD 3Q14C 2PKOA 4DSFA 3H9DA 4R63A 2JT4B 3A1QB 4YR0A 1X9SA 1X1MA 4RQ5A 2W9BB 4NWIA 2WXKA 5JZEB 3RJHA 1AN8A 2R2OA 4AOFA 1GG3A 3CYMA 3KYDD 2JYTA 4UB2A 3VCBA 3Q2AC 3A9KB 4C0ZA 4DS4A 1NEKB 2MWSB 1HUZA 2YMMA 2JGAA 2ZUCA 4RPYA 2R8JA 2HBLA 5AZFA 3ZNID 3QARA 3RUIB 5CEHA 3Q8KA 1VJKA 2WXQA 4Y2TA 4NL9C 1UNSA 5DG8A 1QTMA 2JF5A 3E56A 3Q8BA 4J9LA 4KX6B 1ZW7A 1Z00B 3HRDD 1TIFA 3ZO5B 4MGYE 1GUAB 3O65B 1SE3A 3MFGA 3QE9Y 3RNEC 2FLPA 2ISOA 4BUGA 1ZXIA 1L3TA 3VUWA 1C4PA 3ZQ4A 1FXTB 2N9KA 4TV3A 2BPGA 3RNGC 2LPEA 2BYFA 5AKZA 4NLZA 3JPSA 2CR5A 2IGHA 3NVWA 2O2VA 1JI7A 7ICFA 1IG6A 1K1QA 3N30A 5J2RA 2K4EA 1T6BX 2DWQA 2D3BA 3H7PB 4KN4A 2OJWA 3TEXA 1Z19A 2BTEA 3A9JA 4M01A 4N58A 4YSZB 1JUDA 2FIDA 2KX3A 1ENFA 1BGXT 4UW9A 2MU2A 2KXJA 4ASWC 1MSWD 9ICWA 4J9SA 3AE1B 3V3XA 2PFPA 2PI5A 3Q8LA 1N56A 1QSSA 1S0VA 1EWCA 5IIJA 4F91B 2KMMA 3NZSA 2I6XA 1XLNA 1OEYJ 5AKKA 3PMLA 1IGDA 1SWWA 2XEWA 1HQRD 5AZHA 5IAAC 1V80A 5HMLA 2WXMA 3H8WA 5AI9A 1UCVA 5C3JB 2I9GA 4UB6U 3CNHA 4DK5A 4C4RA 1L4DB 4M04A 2CN1A 2KTRA 2KJ9A 1FFVA 2EZYA 5EWFA 2LEKA 1Q3UA 3HW8A 4P7IA 3VTWA 5AKYA 2KZZA 3SFDB 3MBYA 2BPCA 1CQVA 1TKEA 2WXRA 1N61A 3QUTA 5GTIU 1TYGB 1PK3A 2W11A 4P0QB 2MJDA 3RFZB 2BPSA 3DVGX 1YX6B 4BKSD 3ZJTA 4RU9A 2D11A 4Q2JA 4FXCA 2K60A 1BPZA 2YMLA 4A3PA 1C3TA 1A0PA 4DL7A 4M9HA 4NL9A 1SGGA 2E5SA 2Y5BB 4J9PA 2JWZA 2PLPA 4ACOA 2I2YA 1ZRMA 3RJKA 1TS5A 4KLGA 2N9LA 3KHRA 9ICCA 7ICVA 2GI9A 5J0UA 1XSPA 4NAWB 4QZIA 3RTVA 2P6RA 1HTQA 4A90A 3N1XC 2LWPA 3PO4A 1FNUA 1LVHA 3ECIA 3C21A 4ED3A 4MH0E 3QCAA 4W9FA 3A0BU 3Q69A 3TMPB 1R4NB 3NZUA 4ZRPA 4QZAA 3RMKC 2E8OA 3N4MB 2NRTA 2MA9B 1ZD3A 3Q8CA 1KBUA 3H0RB 3KKAA 2C22A 4F4WA 5AHXA 2QHOA 4B9VA 8ICXA 4OD0A 1SKSA 4F1SA 4MT5A 4OVVA 4QIWF 1PVQA 2BS4B 1UD7A 3MR2A 2L83A 5LLIA 1XD3B 3PV1A 3MJ5A 3ZUNA 1BT0A 2JU6X 2TSSA 2JQRB 1ZQBA 3GV5B 1X2IA 4B6WA 3TAQA 5DDMA 1FIQA 2ZIVB 3QU2A 3L17A 1YNTE 1Q10A 3SZ2A 5FR3A 4QZBA 1JW9D 5AIAA 3RJIA 4JGHB 5HHIA 1GC7A 3TANA 4DQOC 4PGQA 1NNLA 1WMHA 4B9LA 1J2NA 1FPYA 3NHEB 4AUQC 1TS3A 2HOQA 4OJ6A 5IIKA 3AE3B 1NI3A 1SL1A 3ML9A 2W43A 3WALA 2HHVA 3CWIA 4KIKA 4G11A 1YD8U 1R4MI 1Z4OA 1PK1B 4EEYA 1TGZB 2DYOA 2MRPA 4ZOHC 5KFSA 4JX1C 2IBIB 2KK0A 8ICZA 2IGDA 1D5XC 2LYBA 3TI0A 1GOZA 1LO5D 5KFPA 1TZ1A 1JN3A 3O0FA 1ZQCA 4MM3B 2BYVE 3PR5B 4F2SA 2AL6A 3QWZB 1E7VA 1ZQQA 2K3UA 1WZ0A 4EYIB 5CX3A 1XSLA 1T3NA 3QUBA 2H88B 3M9OB 3DQVA 3T5HA 4YR2A 3BQTA 1PGAA 2ZTEA 5BYSA 3NGDA 4HDQA 4MF2A 1ZQJA 1WGKA 5CTRC 4QZEA 4RGMA 2ALZA 4DEZA 3PZDA 1OTRB 4DWIA 5AKEA 4O3RA 3TADC 2DFLA 2GMIC 4AP9A 3CSFA 2HW3A 3F2BA 4JQWC 3ZXVA 1ZQXA 2GOLA 1X40A 4YWGG 2WNMA 1V9JA 2JUOA 1S10A 4ICAA 1V8CA 2N9EB 2LI5A 1HJPA 2W3RA 3IHPC 4NZLB 4D2KA 2MAXA 4CF3A 2DZJA 3APCA 3N28A 1QSYA 1XO3A 2J4XA 4NQLB 4RQ0A 1QQ5A 5CHGA 2KG5A 1ZYQA 3H8JA 2OEHA 1JALA 5AKIA 4R8UB 3V72A 2DX5B 3HVDA 3ZDCA 1WYGA 1I7HA 2KT7A 2D2QA 3SAGA 4I2CA 4RF0A 5EWGA 4XZ4A 3NVZA 4US9A 1ZQWA 2KFKA 1U47A 4QZ9A 4LLGM 4BWMA 1PDXA 1TT5B 4MGZE 4IWPA 1WRDB 4AJWA 2K1FA 3KZXA 4FHKA 1WCNA 2YLMA 4P4MA 3LYYA 1F1HA 1ZQTA 3WKCA 1I4RA 1K8RB 5IILA 2RDIA 1ZQMA 3B2GA 4LNNA 4YMOA 4QNLA 4XQ8A 3KFUF 4NY0A 2BYEA 4NLBA 5CB1A 4XRHA 3RH4A 3QX7A 1XF5L 3U26A 2DPIA 1VCBA 1ZOYB 2KJ6A 1QF6A 4KZCA 1V6EA 4XA5A 4X57B 8ICFA 3P63A 4YG2A 2HOIA 3DBRI 4DL2A 2F8KA 4KN7A 1D5ZC 3ENEA 3QK0A 3KHGA 2FMPA 4M47A 2FAZA 2O6VA 2Y3AA 2BB5A 4OW0A 3V7LA 1ZQUA 2YX8A 1SE9A 2BKRB 4NY8A 1VJ5A 4TUUA 2Y1IA 4E0DA 3FC4A 2BKFA 1SXTA 1T5XD 4DHZE 4QAYA 2AGQA 1ET6A 2KWVB 4I2JA 2WXHA 1LKYB 4UAVA 4FHJA 1YT3A 2L5YA 3QEBZ 1E8YA 1NJYA 1L7MA 1OFFA 2LGSA 2PVGC 5AEKB 2BT6A 2K25A 1JWSD 3V60A 1H38A 2H5XA 2JMGA 1S77D 7ICIA 9ICMA 4K4GA 3L16A 3N20C 5DQGA 5L1MA 2PPHA 2Z0EB 2ZVOA 2IOFK 1RYJA 3TADA 1IUEA 4ICUA 2QB0A 2IHNA 4FBJB 1V1OA 2PEAA 1T0YA 3M8SA 2P6UA 1VR9A 3OSPA 3AEAB 4F50A 3C5FA 2INDC 4GDLA 2PVOD 1TBEA 4DOCA 2KDIA 4LZDA 3LB8C 4EEKA 1Z3EB 1YQ3B 3AV8A 2WP9B 4URKA 3I3TB 2RHFA 4CCHA 2ZZPB 3X0WA 1NJWA 4RGNA 5IP4D 2KC2A 2FPLA 2G4DB 3BWUD 1CI4A 3TEWA 2WDTB 2Z8LA 1P0RA 2XCAA 2AQ1B 4RQMA 2WYQA 4TURA 3TQ1A 5HP4A 4E3CA 4HVBA 3T3FA 2QILA 3AMZA 1D8LA 2EMTA 3IXSA 2GLEA 2PMZC 3G6XA 3WKDA 3PSTA 1MFWA 4ECVA 4KKIA 2FBWB 4PHAA 1B22A 3T8MA 1SZPA 4GOCA 2WHEA 1CRXA 2Z59B 4AP4C 4RT3A 1OQYA 3TIXA 5CHVC 3SD5A 1FRRA 3IRUA 4F71A 2QB1A 3UI3A 2NBUA 4WH4A 4IC9A 1T7PA 4IQWA 4W9HA 2FE9A 3X23A 2BS3B 2HDEA 2EKEC 4BXOB 5LXHA 1S0NA 2WX0A 3V6EB 4JV1A 2WXIA 3EWAA 1WZ3A 3MFIA 3C2MA 8ICTA 1JRUA 2BGFA 2VRRB 2AJQA 4LVSA 4TUPA 4EBCA 4FFDA 3P1MA 4ZRIA 2MP2B 4K4HA 1FCCC 3UXOA 2JZPA 3ZJUA 3Q3JA 4QZHA 3DHGC 3RJEA 3IP4B 3IV6A 3DEEA 5AI4A 4EX6A 3KBBA 3G6VA 4WJOA 4Y2YA 2R8KA 4KZ0A 2Z0DB 3ML8A 2NR2A 3HWTA 1WWTA 1VZ8A 1WF9A 2BVCA 4BBNF 2LYHA 2ZEQA 3TACB 2I1QA 2BZFA 5D6JB 1UELA 3ABVB 4MFAA 1DXSA 2HDOA 5HNKA 2LGXA 4F4YA 1XO0A 2KTQA 3UXNA 1DRGA 2EELA 2HE7A 2RGFA 1ZQYA 1QOFA 4RCOA 2V3PA 2KQ7A 4I2IA 1ZQ1C 3GZNB 3U7ZA 4O5CA 3MC0B 5AM1A 4I2EA 2LGIA 1BNOA 3A33B 3QIJA 1I42A 4PZNA 1C20A 2ZIUB 2AQ3B 1H4RA 2QARB 1WWVA 4C8NA 5ALLA 4OO1J 5HFYA 4TUSA 2LASA 4II3B 2N1RA 2XI9A 2C28A 3C1YA 1N2XA 5EE1A 3OJUA 2J52A 3DBLB 2QDFA 1E7UA 3UIPB 4QW8A 1YOVB 1KN5A 2YMQA 2QEJC 4RM9A 1RQLA 3R7RA 3RNAC 4KGTA 4GC6A 1A5RA 2BF8B 1U4AA 2QC8A 4O3QA 4ECUA 2KJRA 3GIJA 4FLHA 2J6SA 1V49A 5HR7A 2BYTA 3PW0A 3ZVVA 1NK5A 3C28A 1ZQHA 3B9JA 2N9PC 2D07B 1T3QA 2UVWA 4C4VA 2W3SA 1HZ5A 1ZD2P 2LBOA 1PQSA 8ICQA 3GZFA 2IZVB 5J2JA 2ES6A 9ICHA 5HHHA 3FDSA 3V61A 1KOTA 4WJ3B 2JVCA 2NO5A 2I1KA 2KC1A 1WCLA 3B0YA 3T5LA 3Q8FA 2NBVB 3K1RB 3RB4A 3PLVA 2UWQA 5KL8B 4PL1A 4Q8EA 1SSNA 3VVWB 3ZDEA 2IDYA 1GC6A 2JRHA 1Z1VA 2FNJB 1WH3A 2L52A 3EFUA 3AU4A 5G2NA 5DQIA 1R7SA 4C00A 2L32A 5DGBA 4Q8FA 2J6UA 3A1QA 5L83A 5DPWA 3ZGZA 3ETLA 3AE6B 2W9BA 3BQ7A 4IRDA 1L7PA 2JYEA 1N63A 1IV8A 3AEGB 2KFZA 3QU7A 5ALWA 3HVZA 3A9KA 4TKNA 2JHDA 3EC8A 2G4SA 2LVPA 1NENB 2Y9UA 3NVVA 4KX3A 2B21A 1EWYC 2VZKD 4DSJA 3U4EG 4Y2UA 5DLGA 1V86A 2NPTB 1KRPA 1Z00A 5J2GA 8ICOA 2E8NA 3BZKA 9ICFA 2EQYA 2QLTA 2RDHA 2H3ZA 3KVFB 2X8XX 1WR6E 2IO2B 2N4FA 2W04A 1YQ4B 5CA7A 4EZLA 1JQ4A 3SV4A 9ICJA 4CYEA 2NVUI 2DUYA 2HTME 3KUDB 4M00A 3WKEA 4K3CA 3PW7A 5KT4A 3H6NA 1DOIA 1I4QA 2DYBA 5KFTA 3LK9A 1WJ6A 1K50A 2M4NA 2E3TA 1I4HA 4YFKA 3KLSX 4TMAB 2MSNA 3MR6A 3V7JA 4RGTA 1SE4A 3H7PA 1BPDA 2F1HA 2NRXA 4FE3A 2XY7A 3HM3A 4KGRA 4DOAA 4RQNA 3HKZF 1BMLC 2GO7A 2PI4A 4KSLC 1L3VA 4OZCA 5ALGA 3VAWA 3BYYB 3ZD8A 2KVRA 1KKXA 4B9TA 4IR9A 5B5EU 2PFNA 1KW4A 3BS7A 3LWLA 1PVRA 3OTQA 4CQNA 4QW9A 3ZTDA 1WR1A 4FBUA 1YN5A 2D3DA 4J9OA 2EZZA 2VKQA 3K4GA 5EE9A 1KH0A 2WX1A 1RQNA 2HSZA 4LZGA 4GB9A 4ZH4A 1WI0A 3ORYA 4IOIE 5ALYA 3H7IA 1NI2A 3BZCA 1E90A 1YQBA 1F2RI 2WXGA 2K5PA 4GDKB 2XNAC 4WIPA 3QU9A 1XC9A 3P4RB 2M19A 4R66A 3L3FX 4IRKA 1GNUA 2M0NA 3E2EA 1FXIA 4A3OA 2A19A 2EAPA 1L0YB 1WGHA 3AE2B 5AUIA 2BDPA 4US8A 2LHTA 3KZIU 2NRZA 2RSUA 3KUCB 5DGAA 4P0QA 1L5PA 1OEYA 1UPHA 2WXNA 2K6DB 7ICUA 1N5XA 3KHHA 2BR0A 3I1YA 3MGVA 4I29A 3W1YA 3I28A 4DQPA 4NAMA 4DCCA 4C7ZA 5J2BA 3ISBA 3BQ2A 2MUTB 1T0SC 3MHZA 8ICVA 2PE6B 2EAMA 3VTUA 1UQVA 1IPGA 5KTQA 5KT7A 3W5UB 1U4BA 1MA7A 2HBMA 3JYUA 3JVZX 1KF6B 4MFCA 4G3IA 1I4PA 3C19A 4BWJA 2WB1F 5TR5A 4EX7A 2P66A 1XT9B 2DYMA 2YEPB 3ZD9A 2H3VA 1GB1A 1OW5A 3ISDA 2B3AA 3ONNA 3HT3A 1ECWA 1ZE3D 3NY5A 1AW7A 4PYZA 4YD1A 2R18A 1NOMA 7ICNA 3RJJA 3BINA 4IM0A 4C8MA 3BZDB 4NJ7A 1R4MB 1ZQSA 2HHQA 5J2EA 1SB3C 4ELVA 4QJFB 2K8CB 2D6FC 5FP0A 1UUPA 2MBBB 2E8MA 4Y2JA 1JX4A 4KLEA 3AEFB 1NK0A 4DL5A 3PO5A 2CXYA 2Z7JA 3RYTA 1CUKA 2FI1A 3J81j 3RJGA 3SR6A 3RULA 3CF6E 3V62A 2ZJDA 4ZRQA 3AH7A 1XEEA 4CHKA 4PS8A 4EZ9A 4CDGA 4IWQA 2KDEB 2DKZA 2ZVNA 1YMHE 2FCNA 2GOWA 3NOBA 2LJ5A 1PUTA 2J6TA 3AU5A 1UA0A 1UZXB 3OWEB 3H0LB 4IW0A 3TUOA 5BMIA 3PW4A 1QLNA 2E8PA 4YMMA 2ZIVA 5D49A 4MF8A 2IGGA 3DDCB 2E1EA 1DYQA 5KHOA 4O3MA 1E8XA 4B0MA 2AU0A 1CZPA 1ZOLA 2ZCBA 4P4OA 2RDBC 4RZRA 3L13A 3HHMA 2FJ6A 7ICMA 3RN9C 3VQIA 2DKXA 2K8BB 3APFA 5G55A 1JWBD 5DCNA 4AYBC 5LXIB 3MR5A 3RF9A 1MI0A 4OZBA 3VXWA 4F3OA 4O3PA 2KZ3A 1U49A 3BS5B 4M2YA 2B76B 3Q3MC 4XDDA 3AL0B 1ZQOA 3AUOA 1MHHE 2AH5A 2INNE 1PK1A 1F44A 4ZRKA 5JH5C 1DOYA 3K9PB 3QXGA 2KNBA 3S6JA 1URJA 3SEBA 8ICNA 3J9CA 3NRWA 1VD2A 4JE3B 3RB0A 4MM3A 2KFNA 3FYHA 3GDXA 2OHFA 2K0PA 3ZTCA 1WFYA 4HJGE 1GJZA 3ONSA 1S76D 1HEKA 3RNBC 4KX5A 2NRVA 4HKZE 2XK5B 1CJEA 4IWOA 2FLLA 3MFHA 1NZPA 1WIAA 4PHDA 3PSPA 8ICIA 2HOFA 4WQMA 3OJ3A 1RDFA 1NK6A 1J7BA 1N60A 3V7KA 3PPAA 3URYA 2DF4B 2XO7A 2WDRB 1WE7A
chains in the Genus database with same CATH topology
3I9V1 3AEDB 1JALA 5FKAC 1SEBD 2K9XA 1HA5A 1QLBB 3HVDA 1I7HA 1WYGA 4RF0A 1FMAD 3NVZA 4US9A 1PGBA 2VZKB 3U2SC 4TQ0A 4LLGM 1P7EA 1PDXA 2ZW0A 5HI1A 2Y5PA 4RFBA 2GB1A 1CK1A 1F0ZA 1K51A 2ZW1A 3W2DA 1VDVA 1PGXA 3L4PA 3LYYA 5MPOA 3E9SA 4A55A 1I4RA 3R2TA 1L0XB 3B2GA 4RNAA 1B9RA 1NVID 1ZOYB 4MACA 1XF5L 1QF6A 3I57A 3Q8AA 1I4GA 5G5GA 3HUIA 2D5GA 2YEPF 2WS3B 5I4DA 2CU3A 3NUHB 2PIAA 1NYQA 3P63A 5HHDG 3VRBB 4HKQA 1D5ZC 1UGJA 2OEDA 2Y3AA 2BB5A 4OW0A 1GPXA 1JCKB 3KWLA 4J3OD 2WXJA 3O13A 1FD6A 1VZ6A 3FC4A 2ICIA 2FE8A 1SXTA 1T5XD 3V05A 1ET6A 2WXHA 3IAS1 2CJNA 2AQ2B 1OFFA 2PVGC 4ITKA 2BT6A 1JWSD 2V4IB 2X38A 1ESFA 2WXFA 1HEZE 4GDLB 2G1EA 4WWMA 1BUIC 5H92C 2KWDA 1RYJA 2NTSA 3NRZA 1IUEA 2RDHA 1YJJA 1IGCA 1V1OA 1J7CA 3AE9B 4A9AA 3MP9A 3H8HA 3DWMA 2W54A 1VR9A 4N59A 1VLBA 1C4AA 1QOBA 2L1AA 1UWXA 2LFIA 3AEAB 2NMQA 1JRPA 3IT4B 5AUKA 2PVOD 1IBXB 1FXAA 3LB8C 1YQ3B 1N62A 1YJIA 3AV8A 2WP9B 4JPSA 3AE4B 3BVZA 4XWTA 1E10A 3AB5A 4RGNA 1ZPSA 1XLOA 4LK0M 1C79A 2PTLA 3BWUD 3BYTB 1L6VA 1RFKA 3TEWA 1IBXA 2AX5A 2PW9A 2Z8LA 4P16A 2AQ1B 1EU4A 1FO4A 2QILA 3AMZA 2KN4A 1ZP0B 1ZXHA 3IXSA 5D7GA 4WAFA 1MVKA 5D3IB 1OQRA 1QQRA 1XCTL 4OZAA 3TEZA 4KKIA 2FBWB 4JWSC 4MH8A 1FCLA 2DLBA 1TJEA 1WRIA 1JROA 1VRAB 2KDMA 1EM7A 1FRRA 2H89B 4RF1A 3UI3A 5BMHA 4WH4A 1GB4A 4L2YA 3AEBB 1BXTA 4REZA 1Y56A 3TEYA 3AN1A 2BS3B 2HDEA 1GAQB 1KLGD 1TZOA 3VR8B 2WXIA 3ZYYX 1C76A 1QOGA 1A70A 2LHDA 1OQQA 3KWVA 2WDVB 1M4VA 1V1PB 1D4BA 3P1MA 3C8YA 1L0VB 3BIID 1FCCC 2WQYB 3U52E 2JZPA 1N5WA 3ZJUA 4YSXB 2N0SB 3PZ8A 1P7FA 3VR9B 4YTMB 1HZ6A 1V1PA 2M0AA 4HEA1 2ONQA 5LNK1 1ZDVA 4AQ7A 1PYWD 1WWTA 1VZ8A 2NTTA 3W9CB 3EA6A 1SJED 4RH6A 1TY2A 3ABVB 3RPFC 2WU5B 4YTNB 2V0GA 1PFDA 3FILB 2EELA 1QOFA 4RCOA 2V3PA 4ARIA 4XDCA 4YSYB 3AEEB 4TQ1A 5HG2A 1SJHD 3KQ4A 3U7ZA 2LMCA 3MC0B 2R61A 2LGIA 4KGSA 4C80A 1D5MC 2AQ3B 1SE2A 2JWUA 3AE8B 1TKGA 2JSVX 3FILA 5HFYA 3GP7A 1TY0A 1FM0D 2J52A 5EE1A 2IJ0A 2JXTA 3AE7B 2QEJC 1UWMA 1C78A 2PMVA 3SFEB 1WSPA 4OHJA 4KGTA 2J53A 1C9FA 4ZYSA 1KLUD 1TS4A 1XXGA 4DXFA 2WXOA 2XN9C 2KACA 2BYTA 4HROA 1ROEA 1KFYB 1L6UA 4GLSC 3T3OA 3B9JA 4ARCA 1QT9A 1T3QA 3BK2A 3R8BA 2LJIA 3PO0A 2W3SA 1K52A 2Y5CA 1HZ5A 1F2RC 3W1SA 5G5HA 4L23A 2CJOA 4UDUC 1V97A 3DWGC 5T8IA 2K22A 4YT0B 5H8YE 3P42A 2I38A 1KRHA 3N9YC 2KQ4X 3Q8FA 1AYFA 2W55A 3ZJVA 4JWUC 3PZ7A 1QKZA 2SEBD 1SSNA 4NJCA 2PKOA 4IKGA 2W82A 4L1BA 2IDYA 2DBYA 1ET9A 2BBCA 2WXKA 2L52A 3BK1A 1AN8A 1R7SA 1MHXA 1QOAA 2JYTA 2L32A 2QJLA 2WXLA 4XE0A 1NEKB 4WURA 2JX5A 3ZGZA 3AE6B 1VJKA 2WXQA 1UNSA 2JYEA 2QIEB 3E56A 3Q8BA 1E7PB 3Q8EA 5TSSA 2BW2A 3R2IA 4KX6B 1N63A 4RGOS 2LUMA 2MJEA 3AEGB 3HRDD 3HVZA 1SE3A 3MFGA 2N7JA 1NENB 1B1ZA 3NVVA 1EWYC 2VZKD 5BYQA 2Q5WD 1ZXIA 1ZDXA 3U4EG 1C4PA 1FRDA 3ZQ4A 1ACCA 4AS1A 2N9KA 1VZ7A 4C7YA 1AWDA 4ZHOA 3ETRA 2IGHA 3EGRA 3NVWA 2EKIA 1YQ4B 1JQ4A 1T6BX 2DWQA 2HTME 1HXYD 3TEXA 4HRSA 2SAKA 2BTEA 4YSZB 4N58A 4PT5A 1DOIA 1I4QA 3BVGA 1K50A 1ENFA 4A6QA 2E3TA 5BMGA 1I4HA 1TKYA 1ZUD2 4N6EB 3KLSX 4TMAB 3IT6B 1E6EB 4RGTA 1SE4A 1YN3A 3AE1B 3V3XA 3TSSA 4DXGA 4KGRA 1EWCA 1BMLC 1JWAD 4OZCA 1JWUD 4C56C 2KMMA 5D3DA 3T3NA 3BYYB 2FUG1 1XLNA 1IGDA 1HQRD 1J7AA 3FAHA 2WXMA 5JXVA 4CQNA 1L4ZB 5C3JB 2M56B 1YN5A 3B2FA 1L4DB 5EE9A 1KH0A 4YTPB 3BVMA 2LEKA 1FFVA 2LHEA 2INPE 4IOIE 3SFDB 1CQVA 4LTUA 1F2RI 2QSDA 2WXGA 1TKEA 2WXRA 1N61A 1TYGB 2K5PA 3AECB 2WDQB 3EUB2 1NYRA 2XNAC 4GDKB 4WIPA 5E6JA 3P4RB 2M19A 2MJDA 5BYRA 2G9HD 5C2TB 3NS1A 1C4CA 1FXIA 2BB6A 4EE2A 3RFZB 3ZJTA 1L0YB 1D6EC 3AE2B 5AUIA 4Q2JA 1FNWA 3AE5B 4FXCA 4US8A 5FK9C 2RPVA 5GXGB 2MH7A 1L5PA 4USAA 1E0ZA 2WXNA 1WXQA 1YN4A 1N5XA 2PLPA 2I2YA 3NVYA 4R3DA 1TS5A 4NAMA 2N9LA 2BS2B 4C7ZA 1DOXA 4IDIA 3MHZA 2E6XA 2GI9A 1F77A 3W5UB 4NAWB 1KF6B 4A90A 1I4PA 1FNUA 1DGJA 3GB1A 4M0WA 2DYMA 2YEPB 3GS2A 1STEA 3Q69A 1GB1A 2WU2B 3IAM1 3P4PB 4ZRPA 1ZE3D 1RM6C 1AW7A 4TSSA 2ACZB 3Q8CA 3BZDB 2J42A 2IPKD 1XLQA 3P4SB 1SB3C 4MT5A 4XWWA 1UUPA 2BS4B 5EE3A 2L83A 1SBBB 3MJ5A 2JU6X 2TSSA 3AEFB 2JQRB 2RMMA 4O1NA 1FIQA 1E9MA 3SR6A 4ZRQA 3AH7A 1XEEA 1YNTE 1Q10A 1SIJA 5FR3A 1JW9D 3VRAB 1YMHE 4DQOC 2MJ3A 1JMLA 1PUTA 5EE0A 3OWEB 3TUOA 1RWSA 5BMIA 3LXFA 4KKJA 2IGGA 1TS3A 3AM9A 1DYQA 3AE3B 4ZHPA 1NI3A 1SF0A 1XCQL 2WXPA 2RDGA 4B0MA 1CZPA 4B0EA 3P4QB 3CWIA 2WLBA 4P6VF 3VQIA 2DYOA 4JX1C 4ZOHC 4YXDB 1JWBD 1I4XA 2ON8A 1MI0A 4OZBA 2IGDA 1D5XC 1GOZA 1LO5D 2B76B 4MM3B 4XDDA 4OVZA 1MHHE 2INNE 2K3UA 1DOYA 1C77A 1FNVA 3NZ3A 3SEBA 2H88B 2MEKA 3WCQA 2QMTA 3J9CA 4H2AA 1MPEA 4JE3B 1PGAA 1QILA 5BYSA 2K0PA 2OHFA 4A8XC 1FFUA 4HJGE 1WGKA 4RGMA 1KTKA 4HKZE 1CJEA 1XLPA 2KAJA 1K53A 1TS2A 2GRIA 4WQMA 4YWGG 1FEHA 2WNMA 3W5VB 1V8CA 1J7BA 2W3RA 4NZLB 1N60A 2V3NA 4D2KA 3URYA 1EU3A 2WDRB 1JWMD 1XO3A 2J4XA 3CIRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYF A;  2W55 A;  3AED B;  1WXQ A;  1JAL A;  1FRR A;  1N5X A;  2H89 B;  4JWU C;  3NVY A;  2K9X A;  1DOX A;  1QLB B;  4C7Z A;  2BS2 B;  2PKO A;  1I7H A;  1WYG A;  4IDI A;  3W5U B;  1FMA D;  3NVZ A;  4US9 A;  3AEB B;  2DBY A;  3AN1 A;  1KF6 B;  2BS3 B;  2L52 A;  1GAQ B;  1PDX A;  1DGJ A;  1R7S A;  1QOA A;  3VR8 B;  3ZYY X;  1F0Z A;  2QJL A;  1QOG A;  1NEK B;  1A70 A;  1VDV A;  1OQQ A;  3L4P A;  5MPO A;  2WDV B;  2WU2 B;  3P4P B;  2JX5 A;  3AE6 B;  1RM6 C;  1VJK A;  3B2G A;  3P1M A;  1B9R A;  2QIE B;  2ACZ B;  1L0V B;  1E7P B;  1NVI D;  3BII D;  2WQY B;  1ZOY B;  1N63 A;  4KX6 B;  1QF6 A;  1N5W A;  3AEG B;  2MJE A;  3HVZ A;  3HRD D;  4YSX B;  5G5G A;  1XLQ A;  2N0S B;  3P4S B;  1SB3 C;  3HUI A;  3VR9 B;  1NEN B;  2BS4 B;  2WS3 B;  5EE3 A;  2CU3 A;  3NVV A;  1EWY C;  1NYQ A;  2L83 A;  2PIA A;  3P63 A;  2Q5W D;  1ZXI A;  3VRB B;  3AEF B;  1FRD A;  2JQR B;  1WWT A;  4C7Y A;  1AWD A;  3W9C B;  4ZHO A;  3ETR A;  1FIQ A;  1E9M A;  3SR6 A;  1GPX A;  3ABV B;  3AH7 A;  3RPF C;  2WU5 B;  4YTN B;  1SIJ A;  3NVW A;  2EKI A;  1JW9 D;  3KWL A;  3PO0 A;  3VRA B;  1YQ4 B;  1JQ4 A;  3FC4 A;  2MJ3 A;  1PFD A;  1PUT A;  5EE0 A;  2DWQ A;  2HTM E;  1QOF A;  4HRS A;  1RWS A;  4YSY B;  4YSZ B;  4N58 A;  1DOI A;  2CJN A;  3AEE B;  3LXF A;  3AM9 A;  3AE3 B;  1OFF A;  2MH7 A;  2E3T A;  2PVG C;  1NI3 A;  1SF0 A;  1TKY A;  1ZUD 2;  2BT6 A;  4ITK A;  4ZHP A;  4N6E B;  1CZP A;  3P4Q B;  3CWI A;  1E6E B;  2WLB A;  3AE1 B;  2G1E A;  4C80 A;  3AE8 B;  4WWM A;  1TKG A;  5H92 C;  4P6V F;  1RYJ A;  4ZOH C;  3NRZ A;  4JX1 C;  1IUE A;  4YXD B;  1JWA D;  1FM0 D;  1JWB D;  1YJJ A;  2KMM A;  3AE9 B;  1J7C A;  5EE1 A;  4A9A A;  1XLN A;  2W54 A;  3DWM A;  3AE7 B;  2B76 B;  4N59 A;  1VLB A;  1J7A A;  1QOB A;  1UWM A;  3AEA B;  3SFE B;  1JRP A;  3FAH A;  5AUK A;  2PVO D;  1FXA A;  3LB8 C;  1DOY A;  1YQ3 B;  1N62 A;  1YJI A;  3AV8 A;  2WP9 B;  5C3J B;  3AE4 B;  2M56 B;  1E10 A;  3AB5 A;  2H88 B;  3B2F A;  3WCQ A;  5EE9 A;  4YTP B;  2LEK A;  1FFV A;  4HRO A;  1XLO A;  1ROE A;  1KFY B;  1L6U A;  2OHF A;  3SFD B;  1FFU A;  1L6V A;  1RFK A;  3B9J A;  1WGK A;  1XO3 A;  4LTU A;  2AX5 A;  4YTM B;  1QT9 A;  1T3Q A;  1TKE A;  1CJE A;  1N61 A;  1XLP A;  2KAJ A;  1TYG B;  2K5P A;  2W3S A;  3AEC B;  2WDQ B;  3EUB 2;  1FO4 A;  1NYR A;  3AMZ A;  2Y5C A;  3P4R B;  4WQM A;  1ZP0 B;  2M19 A;  2MJD A;  5C2T B;  3NS1 A;  1FXI A;  5G5H A;  2CJO A;  3W5V B;  1OQR A;  1V8C A;  3AE2 B;  1V97 A;  1J7B A;  5AUI A;  2FBW B;  3DWG C;  3AE5 B;  2W3R A;  4US8 A;  1N60 A;  2K22 A;  4FXC A;  4JWS C;  4YT0 B;  5H8Y E;  1TJE A;  1KRH A;  5GXG B;  2WDR B;  1WRI A;  1JRO A;  1L5P A;  4USA A;  3CIR B;  1E0Z A; 
#chains in the Genus database with same CATH topology
 3I9V 1;  3PTF C;  4W9K A;  2JZB B;  4IRC A;  5FKA C;  1SEB D;  4BOZ B;  3N3K B;  3PRZ A;  1QLB B;  2OJR A;  2MQJ A;  1FMA D;  1YIW A;  3DPD A;  1V81 A;  3C23 A;  1TVA A;  2K8H A;  2KV2 A;  2VZK B;  4J9K A;  2BCR A;  3TKA A;  1NK4 A;  5KFL A;  1NDD A;  4R8U A;  2GB1 A;  2KIV A;  2OCE A;  2JEG A;  3W2D A;  1V38 A;  4RNN A;  2LI6 A;  2OM6 A;  5ALZ A;  5GTH U;  5KFE A;  1UBI A;  3RZW C;  4F5O A;  2WFA A;  2N7D A;  3R2T A;  4RNA A;  4YR3 A;  1MQ3 A;  1LGR A;  4NV0 A;  1NVI D;  1WJN A;  5DPR A;  3F53 A;  1EXN A;  3VUY A;  5AIB A;  4PPX A;  3M9N B;  1ARO P;  4NPN A;  2KIW A;  3HUI A;  4P1B C;  4DFJ A;  2A5U A;  1V85 A;  5I4D A;  2WS3 B;  2CU3 A;  2LVO A;  1ZQR A;  2WF5 A;  5BOM A;  5HHD G;  3ZDT A;  1CMX B;  3VRB B;  5KT3 A;  2OED A;  2YQE A;  3HX0 A;  3Q8Q B;  4J3O D;  5E6P A;  2L8J A;  1FD6 A;  4EZ6 A;  5AI8 A;  2KWU B;  1KFD A;  2HJ8 A;  5IIN A;  2CHX A;  2FCQ A;  4AJY B;  2CJN A;  3UQ0 A;  3T5K A;  1D8Y A;  2AQ2 B;  4LNF A;  2PFO A;  1JXL A;  2V4I B;  1CEZ A;  4KLF A;  4ED6 A;  1ESF A;  2HBK A;  2LGD A;  3H8S A;  4UAZ A;  8ICS A;  3BQ0 A;  5ALP A;  4WWM A;  1BUI C;  1WGR A;  2RD0 A;  1LKY A;  3UMG A;  4B95 A;  3MP9 A;  5AM2 A;  4WWO A;  3F5A A;  8ICP A;  3H8H A;  9ICV A;  3DWM A;  4N59 A;  2NMQ A;  1JRP A;  3IT4 B;  4DBG A;  3AXC A;  3IVF A;  2KOB A;  5IKC M;  2VIX A;  1N62 A;  4JPS A;  3BVZ A;  1E5W A;  4F5P A;  2L76 A;  1OUQ A;  4GXI A;  4MDK E;  2ZIW B;  1WM2 A;  2VA3 A;  2ZJ5 A;  4BKS A;  2BCU A;  2ASD A;  1ZKH A;  4BVU C;  1C79 A;  1T94 A;  4Z6E A;  2LXA A;  2G45 B;  4FZL A;  2CHZ A;  5KFD A;  1ZD5 A;  3BJY A;  2DZI A;  4WQO B;  2PFQ A;  4HCN B;  4EYH B;  3F5E A;  1RYS A;  2IYD B;  5D7G A;  4UAT A;  5J0T A;  2MA1 A;  3JPP A;  3L54 A;  4RUA A;  5ALO A;  3TFS A;  1O08 A;  7ICQ A;  2JEF A;  3E58 A;  1QQR A;  3GV7 B;  4JWS C;  1FCL A;  1SWV A;  4KDI C;  4WJN A;  1S9F A;  1NJX A;  1JRO A;  2R2Q A;  1SL0 A;  1UT8 A;  2RP5 A;  2KDM A;  3N1Z C;  5J0Q A;  3WA0 A;  3HIL A;  1TAU A;  2DAF A;  2PJH A;  3GIM A;  4RF1 A;  1X6J A;  2CS4 A;  3F2C A;  5BMH A;  1ZQG A;  4L2Y A;  2I5H A;  2OYY A;  3AEB B;  5KG6 A;  4REZ A;  1Y56 A;  2LVQ A;  4W9C A;  1JXE A;  1SV0 C;  4ANU A;  5IN7 A;  4GLX A;  1KLG D;  5AIC A;  1TE2 A;  4QWD A;  3W1S C;  4DSK A;  1OQQ A;  3Q3N C;  1F5S A;  2WDV B;  5KG3 A;  5ALH A;  2HHX A;  3LDA A;  1V1P B;  4KIT B;  3SDL C;  3UIO B;  4C8O A;  3AQE A;  4IL6 U;  4ECT A;  4BXO A;  3BII D;  3MJW A;  4LNK A;  5KT2 A;  4TQR A;  4YSX B;  3DV9 A;  2INC C;  4ECX A;  2IO3 B;  1U48 A;  1IXR A;  4QZ8 A;  2ZPN A;  4Z6D A;  3PZ8 A;  5C5J A;  3VR9 B;  4YCX A;  3GU3 A;  3V6J A;  1HZ6 A;  5AZG A;  2ONQ A;  2MP2 A;  2IOF A;  5L1I A;  1HUO A;  1WX7 A;  1Z5S B;  1PYW D;  7ICK A;  2RDJ A;  1HIW A;  1OXJ A;  3L5K A;  3W9C B;  2L05 A;  7ICJ A;  3EA6 A;  1SJE D;  5ALN A;  4RH6 A;  1J8C A;  4KVG B;  1TY2 A;  2HCF A;  3PLU A;  3PMN A;  4ELU A;  2WAQ C;  1ZQN A;  4YTN B;  2V4R A;  3IG5 A;  3V6C B;  2M1M A;  2V1Y A;  2W9M A;  2A1J B;  5HR6 A;  4YSY B;  2LM1 A;  5J2C A;  1RYR A;  5J0Y A;  4TQ1 A;  4GFJ A;  1C1Y B;  5AKJ A;  2K4I A;  4MHV A;  3AU2 A;  2G5I B;  2LMC A;  3KQ4 A;  2R61 A;  2R8I A;  3DBH B;  1UA1 A;  3D6J A;  2GBM A;  4C80 A;  2JWU A;  2JSV X;  3MC9 A;  1L8L A;  2BKE A;  4DDI D;  2K89 A;  2F76 X;  5ALK A;  5KG5 A;  1YX5 B;  5KFY A;  3OG5 A;  3PVX A;  4HWI B;  4RUC A;  4KLJ A;  4KLQ A;  4M02 A;  2JXT A;  2BQ3 A;  4WJP A;  3SFE B;  3GFK B;  8ICL A;  2AGO A;  2HHW A;  3UQB A;  2MRL A;  2ZIU A;  3OHA A;  2XC9 A;  1EO6 A;  2QAR A;  3IG8 A;  4C4S A;  4WWP A;  2F1J A;  5GMV A;  2KMA A;  1HTO A;  4KLO A;  2LYA A;  1JIH A;  3HIZ A;  4FBT A;  2F3N A;  1XXG A;  4DXF A;  1QQ7 A;  5AKH A;  3PSF A;  3RCZ A;  2KSO B;  3PT2 B;  3U30 A;  5KT6 A;  2KAC A;  2XN9 C;  4GLS C;  1RXV A;  4ZYN A;  1SGH A;  3T3O A;  2KZR A;  2KVC A;  9ICE A;  2H3Q A;  3BK2 A;  3R8B A;  1OGW A;  2XGQ A;  4UBC A;  1SV0 A;  3THV A;  1N6Z A;  5KFV A;  2ZJ8 A;  3W1S A;  4QWC A;  3OPX A;  2HHS A;  3RZF A;  2IO1 B;  2FMS A;  2C60 A;  1H8C A;  4CO7 A;  2BWF A;  4F92 B;  1KRH A;  3M6K A;  1RXW A;  2FIF A;  1AYF A;  3WAP A;  4Z6F A;  4JWU C;  1QKZ A;  4Y2P A;  4DF4 A;  2MHJ A;  3T79 A;  2JZZ A;  1WXS A;  2DBY A;  1TTN A;  2J7Q B;  2C7N B;  4I2G A;  4G50 A;  4B6J A;  4PGX A;  1YJ1 A;  1BPB A;  1MHX A;  1TV9 A;  1QOA A;  3IBE A;  2QJL A;  4DFM A;  2OOB B;  2G07 A;  3UMC A;  3N7S C;  4TQS A;  4WUR A;  1NZB A;  3L10 B;  2KOX A;  4DFP A;  7ICS A;  2KE7 A;  3CW2 C;  2PKE A;  2KVZ A;  1Q46 A;  2QIE B;  1LXD A;  3Q8E A;  1E7P B;  5TSS A;  4YXM A;  2BW2 A;  3SEI A;  3K1Z A;  2H3I A;  5DB8 A;  4MEY A;  3UQA A;  1DOQ A;  1LQB A;  4QZC A;  5CHW A;  4EKU A;  2AEH A;  2YB1 A;  5T14 A;  2GBR A;  2N7J A;  2NCN A;  4DQS A;  2Q4T A;  1B1Z A;  1NK9 A;  1RAX A;  4YXJ A;  2Q5W D;  1ZDX A;  3JW0 X;  1XSN A;  2A4Z A;  4AS1 A;  1RYU A;  4F5Q A;  1ACC A;  1VZ7 A;  4ZHO A;  1AWD A;  2KHQ A;  4Y2V A;  3ETR A;  2Y0S C;  3EZ5 A;  1SXE A;  4Y2X A;  4RQ8 A;  3ZXR A;  1PVP A;  2LMR A;  3D32 A;  3EGR A;  5L1L A;  3RJF A;  3OGU A;  1XS9 D;  1M94 A;  2EKI A;  1KEJ A;  3ZDM C;  2UYZ B;  4M6W B;  2DEN B;  5KFM A;  3QHT A;  2F1I A;  1RZT A;  2K39 A;  2SAK A;  4HDO A;  1X42 A;  4PT5 A;  3ICX A;  3BVG A;  2A1A A;  4P0P B;  1RFA A;  4UQG A;  1LM8 B;  5AM3 A;  2KO3 A;  1NK8 A;  1T4G A;  5AK4 A;  1TKY A;  1ZUD 2;  4N6E B;  1UT5 A;  5DDY A;  2C7H A;  2VH2 A;  3SD7 A;  1E6E B;  1KTQ A;  3IT6 B;  2W8L A;  1YN3 A;  4WWN A;  3TSS A;  2ASL A;  4KMO B;  4BX9 C;  1JWA D;  1Q0W B;  4PH5 A;  1JWU D;  2GBN A;  3AEV A;  3H7S A;  2KTF A;  3DHH C;  1S0M A;  3TAR A;  2FUG 1;  4PK1 A;  2AL3 A;  4FO6 A;  4B9U A;  2MSE D;  4PS3 A;  2B6G A;  2KMC A;  2EZX A;  2PMZ F;  3MDA A;  4ZDV A;  2KLC A;  1L4Z B;  5DB9 A;  5AKL A;  3WIM A;  4HPP A;  1QH9 A;  2L0T A;  3TAP A;  2L00 B;  3M95 A;  4YTP B;  3BVM A;  1UH6 A;  3SYZ A;  2KJ5 A;  2LHE A;  3HM6 X;  2INP E;  3IM1 A;  4YD2 A;  4EBD A;  1L3S A;  5E79 U;  2JH7 A;  4NNJ B;  2QSD A;  5DQH A;  3H4B A;  2WDQ B;  3EUB 2;  3HPO A;  1P1A A;  5BYR A;  3RAQ A;  1BPX A;  3ZDD A;  2IY1 B;  2YVC A;  1C4C A;  3QQ8 B;  4M8N A;  2W9C B;  4EE2 A;  2BWE S;  5HKH A;  1KFT A;  1KJT A;  3JPN A;  1TK5 A;  7ICE A;  1D6E C;  3ZI4 A;  3AE5 B;  1L5U A;  5FK9 C;  3EPI A;  2RPV A;  1NBF C;  5GXG B;  1ZGU B;  1KDH A;  4GDK A;  5KFC A;  3RB3 A;  2MH7 A;  4USA A;  4ECS A;  5DBA A;  3WK9 A;  5AM4 A;  4DWF A;  3SU8 X;  1TAQ A;  1YN4 A;  4UAU A;  1SZH A;  1C9F A;  3NVY A;  4M0W B;  1IIP A;  2IO0 B;  1DOX A;  3CRX A;  2ZNV B;  2H3F A;  2YMP A;  4G3X B;  4JLC A;  1ZQL A;  1DGJ A;  4UB3 A;  3N1Y C;  2MBO A;  3EW9 A;  3GB1 A;  5F9L A;  3PX0 A;  4FJZ A;  4NLN A;  3GS2 A;  4Q44 A;  1AAR A;  4BOS C;  2C2R A;  2MUT A;  2WF6 A;  1WXV A;  2K6Q A;  1A6S A;  4K7U A;  3P4P B;  4GU2 A;  2LGY A;  1RM6 C;  3PSE B;  4KLS A;  3JSV B;  4TSS A;  1ZD4 A;  5AI6 A;  2KJH B;  1SXD A;  1O03 A;  3PX6 A;  3PY8 A;  2J42 A;  4PYU A;  2KZM A;  4NLK A;  3P4S B;  4P4P A;  4EOY A;  4XWW A;  2F2A B;  1IYF A;  3WAM A;  3GIK A;  3RD2 A;  2YTU A;  9ICO A;  4W9L A;  5KG4 A;  1SBB B;  3HK0 A;  4MEM A;  4G0N B;  3C2K A;  2KAN A;  5ALT A;  2BGW A;  2XVT A;  2PXI A;  4I6P A;  2KNJ A;  1S1Q B;  2D3C A;  4O1N A;  4EBE A;  2XID A;  2K8C A;  3ZNH B;  2MBH A;  2MJ3 A;  4DOB A;  4JV2 A;  4R65 A;  3EHV A;  4F8R A;  4BAX A;  4KKJ A;  4DL3 A;  4KSK C;  4A20 A;  9ICR A;  3AM9 A;  2ZUD A;  4ZHP A;  2YY6 A;  1SF0 A;  2WXP A;  2RDG A;  4B0E A;  3P4Q B;  4GGQ A;  2BQR A;  2WLB A;  4YL8 A;  1LB2 B;  1Q3V A;  2WF7 A;  2DAJ A;  3ZNG C;  4MSM B;  3SAF A;  4LNI A;  3I63 C;  2DGZ A;  4KLL A;  4YXD B;  3SV3 A;  2ZXI A;  4RNM A;  5ALQ A;  3RR7 A;  2ON8 A;  4KLD A;  5DB7 A;  2DL0 A;  1PZN A;  2C7M B;  3ZIM A;  4W9D A;  4EZK A;  2EMS A;  5DBC A;  2C5L C;  3OLM D;  1G6J A;  4I2F A;  1B43 A;  4OVZ A;  1D9F A;  2O6K A;  3N7R C;  2M0X A;  1COO A;  4DSL A;  2K8B A;  2RPQ A;  1C77 A;  2HJ1 A;  1QCK A;  3NZ3 A;  3TL5 A;  1IM4 A;  3UM9 A;  3BS5 A;  1MPE A;  2RLT A;  4H2A A;  1QIL A;  3FM9 A;  4QZF A;  4B9K A;  1KLV A;  5CJ7 A;  1KTK A;  2RRD A;  2KAJ A;  3KUZ A;  1K53 A;  4LCD E;  3QUC A;  1TS2 A;  4FS1 A;  3N32 A;  4BKT A;  1FEH A;  4KLH A;  5D4B A;  2FLN A;  4J9R A;  2G09 A;  3W5V B;  5KFH A;  3EYZ A;  1WGD A;  2IMW P;  3E0F A;  3PRE A;  5L1J A;  2XK5 A;  3V6H A;  2R8H A;  1MG4 A;  3KYC D;  1ED1 A;  3KH0 A;  1JWM D;  4I6N B;  5KFI A;  5III A;  3CIR B;  2ZTD A;  4TUQ A;  2BCS A;  8ICG A;  2LXC A;  4IUM B;  5DPS A;  4W9J A;  3RB6 A;  5ALR A;  1HA5 A;  4UAS A;  2IOH A;  3SQI A;  1ZQP A;  2VJ4 A;  1PGB A;  3AUL A;  5EWE A;  3QC8 B;  4TQ0 A;  3NS8 A;  5HI1 A;  3H4D A;  2F8L A;  2Y5P A;  3QUQ A;  2JZB A;  3KTQ A;  4HXD A;  3DVN U;  1N48 A;  1P3Q U;  5CP2 A;  2ZW1 A;  4KMU A;  1EF1 A;  2LZ6 A;  5MPO A;  1MG8 A;  2HVI A;  4A55 A;  3M62 B;  3MR3 A;  5AK6 A;  1P9D U;  1L0X B;  3KW5 B;  1B9R A;  2AQ4 A;  2JEJ A;  5ALE A;  5AM5 A;  4QWA A;  4NLC A;  3RRG A;  1TK0 A;  2MLB A;  3PW2 A;  7ICG A;  2KIC A;  3WKB A;  2KFJ A;  3NUH B;  2PIA A;  3RNF C;  4GXB A;  3VUX A;  4HKQ A;  3LVW A;  2BCV A;  1MC8 A;  4QWE A;  7ICH A;  1UGJ A;  4N9F 4;  4HYK A;  3QZ7 A;  4JWN A;  3IN5 A;  3DVG Y;  1A76 A;  1D9D A;  1SKR A;  1JCK B;  4LJX A;  2WXJ A;  3O13 A;  1VZ6 A;  2DZM A;  3T9L A;  4QZG A;  2FE8 A;  4JMU A;  4NAW A;  2DQN B;  4CF5 A;  3V05 A;  2IHM A;  2JV3 A;  4NM2 A;  4OJO A;  2EH9 A;  1MN8 A;  7ICP A;  4HAI A;  3QAQ A;  1SV4 A;  2WTF A;  2WXF A;  3GZN I;  5L95 C;  3P2B A;  4ANV A;  1HEZ E;  2CPR A;  5H92 C;  1NKE A;  2HVH A;  2KWD A;  2KK8 A;  2NTS A;  4K7W A;  3NRZ A;  3GIL A;  4K7S A;  1UHU A;  1P7D A;  1XU4 A;  2UU7 A;  3JPT A;  1C4A A;  2KX0 A;  2L1A A;  4M0A A;  4ECW A;  2Q0Z X;  4PL2 A;  4CNQ A;  3DBL I;  2KVS A;  1IBX B;  1FXA A;  5D94 A;  5ALV A;  4XWT A;  5AKG A;  3OSN A;  4M9L A;  1X9M A;  3AE4 B;  3B08 A;  1SKW A;  2ASQ A;  2LM4 A;  2B0C A;  2ZIX B;  1XLO A;  5J0P A;  2ASJ A;  1WWU A;  4QWB A;  2PTL A;  5ALX A;  3BYT B;  1RFK A;  4EFO A;  2PW9 A;  3C5G A;  3K75 D;  4Y2Q A;  1EU4 A;  3D2S A;  2C9W B;  4P16 A;  5KFO A;  4F2R A;  4FJV B;  1FO4 A;  3D2Q A;  4QZD A;  3ZDA A;  2KN4 A;  3PS6 A;  4ZRJ A;  1ZP0 B;  5F9N A;  3G6Y A;  2ZIW A;  1ZXH A;  1I35 A;  4EZJ A;  4WAF A;  4ECY A;  1B4F A;  1L3U A;  4I2A A;  1ZQK A;  3UGB B;  1XCT L;  4OZA A;  4MH8 A;  4RM8 A;  9ICK A;  2F44 A;  5AI0 A;  1C7Y A;  3NUQ A;  5B66 U;  1TJE A;  1V5O A;  1WRI A;  4JV0 A;  1EUV B;  3A0H U;  4ED8 A;  1VRA B;  1DK2 A;  5J2H A;  4RPZ A;  4GIV A;  2H89 B;  3MGH A;  3QNM A;  2KDF B;  4HK2 A;  3PR4 A;  3RAX A;  4RQ7 A;  1ZQV A;  4JIO U;  4XX5 A;  1BXT A;  4FUL A;  4BFR A;  2KQS A;  3TEY A;  3AN1 A;  2D10 A;  1TZO A;  4W9G A;  2KHV A;  2MBQ A;  3RI7 C;  3ZYY X;  5J29 A;  3QYP A;  3PNC A;  1C76 A;  1QOG A;  4I2B A;  1A70 A;  1EF5 A;  2UVR A;  3H8M A;  2CKH B;  2G06 A;  1M4V A;  4A8E A;  5ALU A;  2W7P A;  3R3M A;  4FS2 A;  2KKP A;  3H1U A;  3KKA C;  1L0V B;  4MJS B;  3QEA Z;  3U52 E;  2AWT A;  4O3O A;  1N5W A;  2L3Z A;  4I2H A;  3C0R B;  4II2 B;  3DBR B;  2N0S B;  3L08 A;  4J9Q A;  1S0O A;  3M8R A;  1V1P A;  2HTH A;  3M6Z A;  4YP3 A;  5JTI A;  4HEA 1;  4XYC A;  3MTN B;  4AQ7 A;  3Q8P B;  3QU5 A;  4BZA A;  4DDG D;  2NTT A;  3GV8 B;  5BOL A;  4RNO A;  4PHE A;  3NJT A;  3RPF C;  4AYB F;  3ISC A;  5F3X B;  4O5E A;  2LUE A;  5EOZ A;  1RLF A;  3WAN A;  3A4S C;  5KFN A;  3H0M B;  4JB3 A;  2V0G A;  2KN7 A;  3FIL B;  4ARI A;  2UVU A;  2L0F A;  4DFK A;  4F5N A;  2KMD A;  4QIW C;  5HG2 A;  1SJH D;  1WE6 A;  3JPR A;  1QQ6 A;  2ODG A;  1ZRN A;  4NXZ A;  4PGY A;  3U8Z A;  2HHT A;  4J6I A;  2KHW B;  1D5M C;  2A1J A;  1TKG A;  1TFR A;  4UB5 A;  4RMA A;  2ZJA A;  3GP7 A;  9ICI A;  5C1Z A;  5C23 A;  4I27 A;  4MEL A;  4F8C B;  1WM3 A;  1KM7 A;  3AE7 B;  3B0A A;  1UWM A;  1C78 A;  4ED7 A;  1WSP A;  5J18 A;  4YN4 A;  1S3S G;  4Y2R A;  4ZYS A;  3WK8 A;  1KLU D;  5ALM A;  3UF8 A;  3WAO A;  2D8C A;  4HPL B;  1D3Z A;  2V9W A;  5KNI A;  4ACF A;  2GWS A;  1SL2 A;  2M17 A;  4HRO A;  1KFY B;  1L6U A;  4IQU A;  2MW5 A;  2WF8 A;  5BPC A;  1X66 A;  2BQQ A;  3EFC A;  1QT9 A;  4DHJ B;  1YZ6 A;  2LJI A;  3PO0 A;  1WUD A;  5IA7 A;  3PZP A;  1X9W A;  1JMS A;  2KSO A;  1F2R C;  1DK3 A;  4M9G A;  3I76 A;  1KQQ A;  4L23 A;  3ZRC A;  2CJO A;  2JZ3 B;  4UDU C;  1V97 A;  4F4Z A;  3DWG C;  3WK5 A;  5T8I A;  2K22 A;  3L0W B;  5H8Y E;  3P42 A;  4RQ6 A;  3S2A A;  3N9Y C;  1F9J A;  2W55 A;  3ZJV A;  4DFD A;  1YZ7 A;  3PZ7 A;  3KOO A;  3ZNZ B;  3RRH A;  4NJC A;  1MJD A;  4F72 A;  4L1B A;  1WX8 A;  1FEZ A;  2W82 A;  4IKG A;  1V2Y A;  3B1L X;  5KFB A;  1ET9 A;  1WXA A;  2BBC A;  3BK1 A;  4FN2 A;  2WF9 A;  2KN5 A;  4LDT D;  4DLG A;  5DKW A;  3VDZ A;  1J19 A;  3ED5 A;  2WXL A;  4XE0 A;  4FJY A;  2HBJ A;  3VH3 B;  4MGI E;  5KFU A;  2KDB A;  5AK3 A;  2JX5 A;  3CMM B;  1KFS A;  4P2H A;  3QA8 A;  4DXA B;  3R9K A;  4EEN A;  5J0S A;  4GMV A;  3SAH A;  5KFG A;  2ISP A;  3R2I A;  4RGO S;  1J2M A;  2LUM A;  2MJE A;  3DHI C;  4M8M A;  3RBE A;  5KFF A;  3H40 A;  2FDR A;  2IA6 A;  3U7D A;  2EDU A;  3RFA A;  3B0X A;  3C1Z A;  5KT5 A;  5C0Y A;  9ICG A;  2O2V B;  5BYQ A;  1L2N A;  2WWZ A;  2BDU A;  3PX4 A;  1FRD A;  1WJU A;  2V3S A;  4FZM A;  5ALS A;  4J03 A;  4C7Y A;  4HCP B;  4F4X A;  8ICY A;  3A9J B;  1T0Q C;  4RQ1 A;  4P1C C;  4WAA A;  4AWJ A;  2LD9 A;  3IHQ B;  2FCM A;  4GIB A;  1RPL A;  1M6Y A;  3WK7 A;  2UVV A;  2ZNV C;  3MC8 A;  4S17 A;  2XIC A;  1F52 A;  1HXY D;  4HRS A;  3R66 C;  2FPK A;  2O6V D;  5KL1 B;  1Y8R C;  4M9N A;  4A6Q A;  4JK1 A;  5JUM A;  4MFF A;  7ICO A;  2NBW B;  4O5K A;  5DB6 A;  5BMG A;  3SHQ A;  1ISN A;  5J2F A;  2FUH B;  4M6W A;  2XY5 A;  2ZXH A;  4DXG A;  3Q8M A;  5KG7 A;  4G9B A;  5ALF A;  4B9S A;  2N9X A;  4C56 C;  4P0P A;  1V5T A;  5D3D A;  3T3N A;  3FKY A;  2IY0 B;  3WK4 A;  4ECR A;  3TJP A;  2HI0 A;  2DHZ A;  4RPX A;  3SMV A;  2KTR B;  2BQU A;  3HJE A;  3NTU A;  3SI8 A;  1ZJM A;  1J7A A;  4EEW A;  3FAH A;  2R8G A;  5KFA A;  5JXV A;  2NS5 A;  1U9L A;  3M7D A;  3BDP A;  5KHQ A;  4MSQ B;  1Z2M A;  2M56 B;  3EPG A;  4UBB A;  3B2F A;  9ICP A;  4BJQ A;  4CF4 A;  2NO4 A;  2ZG6 A;  5J2D A;  2OH2 A;  1WGG A;  4EUT A;  2RQ5 A;  4RT2 A;  4O3S A;  5DLF A;  1NJZ A;  4LTU A;  3OJ4 B;  4CGZ A;  2L7R A;  3RR8 A;  5AI5 A;  3AEC B;  1NYR A;  4XC2 A;  1UBQ A;  5E6J A;  2CRX A;  9ICA A;  4PZO A;  2G9H D;  1WG8 A;  4J9M A;  3NS1 A;  4DL4 A;  5C2T B;  3BQ1 A;  1Y88 A;  1QSL A;  2BB6 A;  4ECQ A;  2EAN A;  2VJ5 A;  4OCZ A;  3BY4 B;  4RQ4 A;  5DBB A;  1FNW A;  3DVN V;  1UGM A;  4DQQ A;  2NRW A;  2K8A A;  8ICK A;  4Q43 A;  4LJO B;  4WJQ A;  2BPF A;  1E0Z A;  2HHU A;  2W9C A;  1WXQ A;  9ICN A;  1RRB A;  4R3D A;  4B9M A;  2BS2 B;  4IDI A;  4CE6 A;  2E6X A;  3CP8 A;  2KD1 A;  1F77 A;  4GSW A;  2C2E A;  2JY6 A;  4I28 A;  3Q3F A;  5EDS A;  4FZN A;  4DLE A;  3VHT C;  4UAY A;  4YQW A;  3RBD A;  4ANW A;  4KLU A;  4UB8 U;  1KLN A;  3AU6 A;  3M63 B;  3UXP A;  4UAW A;  4M0W A;  1LV5 A;  2E1F A;  4DL6 A;  3WK6 A;  2OWO A;  3PHX B;  1L7N A;  1STE A;  1MQ2 A;  1COK A;  2WU2 B;  2M9N A;  3IAM 1;  4IG7 B;  4IQV A;  1TK8 A;  2WAQ F;  8ICH A;  5KAI U;  5J0O A;  1E8W A;  3PGE A;  1PUZ A;  2ACZ B;  5E6N A;  5KFZ A;  2RR9 A;  1ZQA A;  1J97 A;  1V9P A;  3RH5 A;  5AK5 A;  2VH1 A;  3IDW A;  2IPK D;  2XBB C;  1XLQ A;  1L6N A;  3IG3 A;  2G08 A;  5ALI A;  5EE3 A;  4NM1 A;  3GE8 C;  3LJ3 A;  2YN4 A;  5J2K A;  3JSV A;  4W9I A;  4O3N A;  4X5V A;  2W9N A;  3M1Y A;  1B0X A;  3MHS D;  1WMH B;  4NLG A;  2RMM A;  1E9M A;  2JPH A;  2KD0 A;  4IM3 A;  1SIJ A;  3VRA B;  5KFK A;  4KIK B;  4F4K A;  5KG0 A;  1JML A;  4PS7 A;  5EE0 A;  2ATL A;  2LRW A;  8ICW A;  4F93 B;  3PRM B;  2V4L A;  1RWS A;  3LXF A;  4JUZ A;  3UPQ A;  1R4N I;  5FR6 A;  3DBS A;  4RQ2 A;  2WGS A;  3VFK A;  3LYS A;  5KFW A;  7ICR A;  1XCQ L;  2J0K A;  1L8O A;  5L9X A;  4BBN C;  5KFR A;  4UB1 A;  2WHI A;  4P6V F;  1HE8 A;  2MCN B;  3Q3O C;  1I4X A;  2DNF A;  2ZUB A;  2FPM A;  4HLE A;  1XQQ A;  4S0R A;  5CR0 A;  2GBK A;  3LDZ E;  3CST A;  4LJP B;  3UQ2 A;  4BGD A;  4U7C A;  4O0I A;  1X6I A;  1T8E A;  3N7P D;  9ICL A;  3GQC A;  1FNV A;  2NPT A;  2V4Q A;  4KLT A;  4XUS A;  4UB4 A;  1WYW B;  2MEK A;  4I6L B;  3WCQ A;  2QMT A;  2JXX A;  1IP9 A;  3NAS A;  2EAO A;  9ICT A;  4A8X C;  4K4I A;  1FFU A;  3Q8S B;  5J0W A;  3F2D A;  1RG6 A;  1Q8K A;  5J2I A;  4C8L A;  1ZET A;  1XLP A;  1X9X A;  4GC7 A;  9ICS A;  2GRI A;  3KD3 A;  3PVL A;  2Y9T A;  4LDT B;  5KAF U;  4ELT A;  5IIM A;  1TKD A;  2J0J A;  3QJZ A;  2ZCC A;  2V3N A;  3PHW B;  1NK7 A;  3QZ8 A;  1EU3 A;  2KFK B;  3QX1 A;  2PE9 A;  2QCZ A;  3AED B;  4ED2 A;  9ICB A;  2KJ8 A;  2K9X A;  3OHB A;  4Y2S A;  5KG1 A;  2W7O A;  3VH4 B;  2W03 A;  9ICQ A;  2IBK A;  2C2D A;  3I5J C;  3U2S C;  1BNP A;  1P7E A;  5H2F U;  2ZW0 A;  4F5R A;  2DZK A;  4RFB A;  2V9H A;  1CK1 A;  4Z6C A;  1K51 A;  1GO3 F;  1T0R C;  1F0Z A;  3JPO A;  1P98 A;  4DS5 A;  3N97 B;  1VDV A;  1PGX A;  3L4P A;  4B9N A;  2Y0S F;  1QZE A;  3E9S A;  5AKX A;  2K4H A;  5E6O A;  3Q6B A;  5JHB A;  4KLI A;  4ED0 A;  1ZQE A;  2JEI A;  1U45 A;  4MAC A;  5K4L A;  3I57 A;  5ALJ A;  1K5O A;  3PW5 A;  1I4G A;  2O6V B;  3Q8A A;  4IM2 A;  5G5G A;  5IO9 A;  5HMM A;  2D5G A;  2YEP F;  2AXT U;  4IR1 A;  2N7E A;  1NYQ A;  3DOW A;  3OAW A;  5CHF A;  2ZPY A;  1A77 A;  3EEC A;  2HMX A;  3M3J A;  5J17 A;  3D2N A;  1GPX A;  2YB4 A;  1L7Y A;  3KWL A;  3KHL A;  3ZLZ A;  2ICI A;  4JL9 A;  5DG7 A;  4CRX A;  3LVV A;  4E71 A;  2VA2 A;  1AQ6 A;  3IAS 1;  8ICJ A;  2NYV A;  2QB0 B;  1ZQD A;  8ICB A;  4ITK A;  2X38 A;  4GN1 A;  2XGP A;  4GDL B;  2G1E A;  1ZQI A;  1BPY A;  3DBH I;  5D2M B;  2G5H B;  4IS7 A;  3OJS A;  4DSE A;  3JPQ A;  8ICU A;  2OXO A;  1IGC A;  1YJJ A;  8ICR A;  1J7C A;  3LWM A;  2F77 X;  2D3G A;  5AM0 A;  5IIO A;  3AE9 B;  2W54 A;  3HP6 A;  2MX2 A;  4F7Z A;  1VLB A;  1D8B A;  1QOB A;  1UWX A;  2LFI A;  4GXK A;  4HJK A;  3NG0 A;  5AUK A;  2XCP A;  2CU1 A;  5TIS U;  4MGK E;  5JHA A;  1YJI A;  3UMB A;  1XNS A;  1E10 A;  3AB5 A;  3DCG A;  3A4R A;  2BHN A;  2DPJ A;  5JRT A;  1F0M A;  1ZPS A;  2K4P A;  3TBL D;  4LK0 M;  3MDC A;  5L1K A;  4KDL B;  1L6V A;  3HKZ C;  4YMN A;  2GBJ A;  2AX5 A;  2GH1 A;  3AI5 A;  1IBX A;  4KTQ A;  2ESE A;  4GXJ A;  2W8K A;  2AHO B;  2ZTC A;  5J8Y C;  8ICC A;  4K81 A;  2AYO B;  2JRI B;  1NKB A;  4KLM A;  2ZIX A;  1MVK A;  5CRX A;  5D3I B;  1OQR A;  3C29 A;  4ICV A;  3TEZ A;  1TAM A;  5IOI A;  4DHZ B;  2KWC A;  3R7Q A;  2DLB A;  2KEY A;  3WKA A;  3SEN A;  4KV2 A;  4FA6 A;  2KKV A;  2NV3 A;  1EM7 A;  5A0L A;  1J0G A;  2KP7 A;  2AQ0 A;  4OJP A;  7ICT A;  4DO9 A;  1Q5W B;  1KL9 A;  1GB4 A;  2MBE A;  2LRU A;  4HPM B;  1Q1O A;  1XO1 A;  3K9O B;  1GAQ B;  3IFW B;  3VR8 B;  3VC8 A;  7ICL A;  4U6P A;  1WY8 A;  4JWM A;  2KKC A;  2LHD A;  2JR5 A;  1WGY A;  3KWV A;  4NJ8 A;  2M8S A;  1S5L U;  4MEX A;  3GOE A;  1D4B A;  4C4T A;  3C8Y A;  4IC7 B;  5BO4 B;  4W9E A;  5KG2 A;  2WQY B;  3MC1 A;  2VAN A;  4OJL A;  4DSI A;  1ZJN A;  1SIF A;  3ZRF A;  4XGA B;  2G3Q B;  5D46 A;  1P7F A;  4NQK E;  4OJ5 A;  3AQF A;  4O9M A;  2N1V A;  4YTM B;  4EEL A;  3WU2 U;  4R64 A;  3T5J A;  3V6K A;  2M0A A;  4DHJ D;  2WB1 C;  1E8Z A;  8ICE A;  3PSI A;  1WX9 A;  1WXM A;  1ZDV A;  3VTV A;  5LNK 1;  4K1R B;  4MJS A;  3ALB A;  4ECZ A;  4NJ6 A;  2I1J A;  4DQR A;  2P35 A;  8ICM A;  2KYW A;  2N1W A;  3RNC C;  4Q45 A;  2QKQ A;  2WU5 B;  5J2A A;  5CWR A;  1ZQZ A;  4C8K A;  1BVS A;  4A9A A;  4RQ3 A;  3PV8 A;  1PFD A;  2JXJ A;  5TZV A;  2HD5 B;  4E74 A;  2JH1 A;  4I2D A;  1UF0 A;  5KFX A;  9ICX A;  1LFD A;  4XDC A;  8ICA A;  4ANX A;  3AEE B;  4FAD A;  2VA8 A;  4UAR A;  4KGS A;  3ZKJ C;  3FIL A;  3DDH A;  3ZDB A;  1SE2 A;  3AE8 B;  5KFQ A;  5J8Y A;  1TY0 A;  2G0A A;  1FM0 D;  2IJ0 A;  4OVU A;  3GE3 C;  4IQT A;  2PMV A;  5ALD A;  4OHJ A;  2J53 A;  2FCS A;  1K1S A;  3ALR A;  4C4V B;  3GII A;  2AGP A;  3MGI A;  1TS4 A;  3PRP B;  3TFR A;  5JU5 A;  5J0R A;  2WXO A;  1S8O A;  4ED1 A;  1ROE A;  2D3A A;  2BCQ A;  2W9A A;  4DF8 A;  4ARC A;  4K3B A;  1XWL A;  4LNO A;  1L7O A;  2A3V A;  5KFJ A;  5DG9 A;  4M9J A;  3APD A;  9ICU A;  1K52 A;  2Y5C A;  5DPT A;  4BDP A;  3ZW3 A;  3RT3 B;  5J0X A;  1BPE A;  1WJ4 A;  2J0M A;  3MAB A;  2LKY A;  5G5H A;  2Y1J A;  4PHP A;  4J9N A;  1ZQF A;  3TCA A;  3QU4 A;  3C2L A;  1DGS A;  4PJ0 U;  1Z4N A;  2FMQ A;  2REX A;  4YT0 B;  1Z1B A;  1S97 A;  2KLG A;  3UIN B;  1NKC A;  3Q8R B;  4DQI A;  2I38 A;  4BKG A;  2JRZ A;  3M9M B;  2KQ4 X;  2GLS A;  2XY6 A;  3RH6 A;  4YVZ A;  2CHW A;  1KSP A;  2SEB D;  3Q14 C;  2PKO A;  4DSF A;  3H9D A;  4R63 A;  2JT4 B;  3A1Q B;  4YR0 A;  1X9S A;  1X1M A;  4RQ5 A;  2W9B B;  4NWI A;  2WXK A;  5JZE B;  3RJH A;  1AN8 A;  2R2O A;  4AOF A;  1GG3 A;  3CYM A;  3KYD D;  2JYT A;  4UB2 A;  3VCB A;  3Q2A C;  3A9K B;  4C0Z A;  4DS4 A;  1NEK B;  2MWS B;  1HUZ A;  2YMM A;  2JGA A;  2ZUC A;  4RPY A;  2R8J A;  2HBL A;  5AZF A;  3ZNI D;  3QAR A;  3RUI B;  5CEH A;  3Q8K A;  1VJK A;  2WXQ A;  4Y2T A;  4NL9 C;  1UNS A;  5DG8 A;  1QTM A;  2JF5 A;  3E56 A;  3Q8B A;  4J9L A;  4KX6 B;  1ZW7 A;  1Z00 B;  3HRD D;  1TIF A;  3ZO5 B;  4MGY E;  1GUA B;  3O65 B;  1SE3 A;  3MFG A;  3QE9 Y;  3RNE C;  2FLP A;  2ISO A;  4BUG A;  1ZXI A;  1L3T A;  3VUW A;  1C4P A;  3ZQ4 A;  1FXT B;  2N9K A;  4TV3 A;  2BPG A;  3RNG C;  2LPE A;  2BYF A;  5AKZ A;  4NLZ A;  3JPS A;  2CR5 A;  2IGH A;  3NVW A;  2O2V A;  1JI7 A;  7ICF A;  1IG6 A;  1K1Q A;  3N30 A;  5J2R A;  2K4E A;  1T6B X;  2DWQ A;  2D3B A;  3H7P B;  4KN4 A;  2OJW A;  3TEX A;  1Z19 A;  2BTE A;  3A9J A;  4M01 A;  4N58 A;  4YSZ B;  1JUD A;  2FID A;  2KX3 A;  1ENF A;  1BGX T;  4UW9 A;  2MU2 A;  2KXJ A;  4ASW C;  1MSW D;  9ICW A;  4J9S A;  3AE1 B;  3V3X A;  2PFP A;  2PI5 A;  3Q8L A;  1N56 A;  1QSS A;  1S0V A;  1EWC A;  5IIJ A;  4F91 B;  2KMM A;  3NZS A;  2I6X A;  1XLN A;  1OEY J;  5AKK A;  3PML A;  1IGD A;  1SWW A;  2XEW A;  1HQR D;  5AZH A;  5IAA C;  1V80 A;  5HML A;  2WXM A;  3H8W A;  5AI9 A;  1UCV A;  5C3J B;  2I9G A;  4UB6 U;  3CNH A;  4DK5 A;  4C4R A;  1L4D B;  4M04 A;  2CN1 A;  2KTR A;  2KJ9 A;  1FFV A;  2EZY A;  5EWF A;  2LEK A;  1Q3U A;  3HW8 A;  4P7I A;  3VTW A;  5AKY A;  2KZZ A;  3SFD B;  3MBY A;  2BPC A;  1CQV A;  1TKE A;  2WXR A;  1N61 A;  3QUT A;  5GTI U;  1TYG B;  1PK3 A;  2W11 A;  4P0Q B;  2MJD A;  3RFZ B;  2BPS A;  3DVG X;  1YX6 B;  4BKS D;  3ZJT A;  4RU9 A;  2D11 A;  4Q2J A;  4FXC A;  2K60 A;  1BPZ A;  2YML A;  4A3P A;  1C3T A;  1A0P A;  4DL7 A;  4M9H A;  4NL9 A;  1SGG A;  2E5S A;  2Y5B B;  4J9P A;  2JWZ A;  2PLP A;  4ACO A;  2I2Y A;  1ZRM A;  3RJK A;  1TS5 A;  4KLG A;  2N9L A;  3KHR A;  9ICC A;  7ICV A;  2GI9 A;  5J0U A;  1XSP A;  4NAW B;  4QZI A;  3RTV A;  2P6R A;  1HTQ A;  4A90 A;  3N1X C;  2LWP A;  3PO4 A;  1FNU A;  1LVH A;  3ECI A;  3C21 A;  4ED3 A;  4MH0 E;  3QCA A;  4W9F A;  3A0B U;  3Q69 A;  3TMP B;  1R4N B;  3NZU A;  4ZRP A;  4QZA A;  3RMK C;  2E8O A;  3N4M B;  2NRT A;  2MA9 B;  1ZD3 A;  3Q8C A;  1KBU A;  3H0R B;  3KKA A;  2C22 A;  4F4W A;  5AHX A;  2QHO A;  4B9V A;  8ICX A;  4OD0 A;  1SKS A;  4F1S A;  4MT5 A;  4OVV A;  4QIW F;  1PVQ A;  2BS4 B;  1UD7 A;  3MR2 A;  2L83 A;  5LLI A;  1XD3 B;  3PV1 A;  3MJ5 A;  3ZUN A;  1BT0 A;  2JU6 X;  2TSS A;  2JQR B;  1ZQB A;  3GV5 B;  1X2I A;  4B6W A;  3TAQ A;  5DDM A;  1FIQ A;  2ZIV B;  3QU2 A;  3L17 A;  1YNT E;  1Q10 A;  3SZ2 A;  5FR3 A;  4QZB A;  1JW9 D;  5AIA A;  3RJI A;  4JGH B;  5HHI A;  1GC7 A;  3TAN A;  4DQO C;  4PGQ A;  1NNL A;  1WMH A;  4B9L A;  1J2N A;  1FPY A;  3NHE B;  4AUQ C;  1TS3 A;  2HOQ A;  4OJ6 A;  5IIK A;  3AE3 B;  1NI3 A;  1SL1 A;  3ML9 A;  2W43 A;  3WAL A;  2HHV A;  3CWI A;  4KIK A;  4G11 A;  1YD8 U;  1R4M I;  1Z4O A;  1PK1 B;  4EEY A;  1TGZ B;  2DYO A;  2MRP A;  4ZOH C;  5KFS A;  4JX1 C;  2IBI B;  2KK0 A;  8ICZ A;  2IGD A;  1D5X C;  2LYB A;  3TI0 A;  1GOZ A;  1LO5 D;  5KFP A;  1TZ1 A;  1JN3 A;  3O0F A;  1ZQC A;  4MM3 B;  2BYV E;  3PR5 B;  4F2S A;  2AL6 A;  3QWZ B;  1E7V A;  1ZQQ A;  2K3U A;  1WZ0 A;  4EYI B;  5CX3 A;  1XSL A;  1T3N A;  3QUB A;  2H88 B;  3M9O B;  3DQV A;  3T5H A;  4YR2 A;  3BQT A;  1PGA A;  2ZTE A;  5BYS A;  3NGD A;  4HDQ A;  4MF2 A;  1ZQJ A;  1WGK A;  5CTR C;  4QZE A;  4RGM A;  2ALZ A;  4DEZ A;  3PZD A;  1OTR B;  4DWI A;  5AKE A;  4O3R A;  3TAD C;  2DFL A;  2GMI C;  4AP9 A;  3CSF A;  2HW3 A;  3F2B A;  4JQW C;  3ZXV A;  1ZQX A;  2GOL A;  1X40 A;  4YWG G;  2WNM A;  1V9J A;  2JUO A;  1S10 A;  4ICA A;  1V8C A;  2N9E B;  2LI5 A;  1HJP A;  2W3R A;  3IHP C;  4NZL B;  4D2K A;  2MAX A;  4CF3 A;  2DZJ A;  3APC A;  3N28 A;  1QSY A;  1XO3 A;  2J4X A;  4NQL B;  4RQ0 A;  1QQ5 A;  5CHG A;  2KG5 A;  1ZYQ A;  3H8J A;  2OEH A;  1JAL A;  5AKI A;  4R8U B;  3V72 A;  2DX5 B;  3HVD A;  3ZDC A;  1WYG A;  1I7H A;  2KT7 A;  2D2Q A;  3SAG A;  4I2C A;  4RF0 A;  5EWG A;  4XZ4 A;  3NVZ A;  4US9 A;  1ZQW A;  2KFK A;  1U47 A;  4QZ9 A;  4LLG M;  4BWM A;  1PDX A;  1TT5 B;  4MGZ E;  4IWP A;  1WRD B;  4AJW A;  2K1F A;  3KZX A;  4FHK A;  1WCN A;  2YLM A;  4P4M A;  3LYY A;  1F1H A;  1ZQT A;  3WKC A;  1I4R A;  1K8R B;  5IIL A;  2RDI A;  1ZQM A;  3B2G A;  4LNN A;  4YMO A;  4QNL A;  4XQ8 A;  3KFU F;  4NY0 A;  2BYE A;  4NLB A;  5CB1 A;  4XRH A;  3RH4 A;  3QX7 A;  1XF5 L;  3U26 A;  2DPI A;  1VCB A;  1ZOY B;  2KJ6 A;  1QF6 A;  4KZC A;  1V6E A;  4XA5 A;  4X57 B;  8ICF A;  3P63 A;  4YG2 A;  2HOI A;  3DBR I;  4DL2 A;  2F8K A;  4KN7 A;  1D5Z C;  3ENE A;  3QK0 A;  3KHG A;  2FMP A;  4M47 A;  2FAZ A;  2O6V A;  2Y3A A;  2BB5 A;  4OW0 A;  3V7L A;  1ZQU A;  2YX8 A;  1SE9 A;  2BKR B;  4NY8 A;  1VJ5 A;  4TUU A;  2Y1I A;  4E0D A;  3FC4 A;  2BKF A;  1SXT A;  1T5X D;  4DHZ E;  4QAY A;  2AGQ A;  1ET6 A;  2KWV B;  4I2J A;  2WXH A;  1LKY B;  4UAV A;  4FHJ A;  1YT3 A;  2L5Y A;  3QEB Z;  1E8Y A;  1NJY A;  1L7M A;  1OFF A;  2LGS A;  2PVG C;  5AEK B;  2BT6 A;  2K25 A;  1JWS D;  3V60 A;  1H38 A;  2H5X A;  2JMG A;  1S77 D;  7ICI A;  9ICM A;  4K4G A;  3L16 A;  3N20 C;  5DQG A;  5L1M A;  2PPH A;  2Z0E B;  2ZVO A;  2IOF K;  1RYJ A;  3TAD A;  1IUE A;  4ICU A;  2QB0 A;  2IHN A;  4FBJ B;  1V1O A;  2PEA A;  1T0Y A;  3M8S A;  2P6U A;  1VR9 A;  3OSP A;  3AEA B;  4F50 A;  3C5F A;  2IND C;  4GDL A;  2PVO D;  1TBE A;  4DOC A;  2KDI A;  4LZD A;  3LB8 C;  4EEK A;  1Z3E B;  1YQ3 B;  3AV8 A;  2WP9 B;  4URK A;  3I3T B;  2RHF A;  4CCH A;  2ZZP B;  3X0W A;  1NJW A;  4RGN A;  5IP4 D;  2KC2 A;  2FPL A;  2G4D B;  3BWU D;  1CI4 A;  3TEW A;  2WDT B;  2Z8L A;  1P0R A;  2XCA A;  2AQ1 B;  4RQM A;  2WYQ A;  4TUR A;  3TQ1 A;  5HP4 A;  4E3C A;  4HVB A;  3T3F A;  2QIL A;  3AMZ A;  1D8L A;  2EMT A;  3IXS A;  2GLE A;  2PMZ C;  3G6X A;  3WKD A;  3PST A;  1MFW A;  4ECV A;  4KKI A;  2FBW B;  4PHA A;  1B22 A;  3T8M A;  1SZP A;  4GOC A;  2WHE A;  1CRX A;  2Z59 B;  4AP4 C;  4RT3 A;  1OQY A;  3TIX A;  5CHV C;  3SD5 A;  1FRR A;  3IRU A;  4F71 A;  2QB1 A;  3UI3 A;  2NBU A;  4WH4 A;  4IC9 A;  1T7P A;  4IQW A;  4W9H A;  2FE9 A;  3X23 A;  2BS3 B;  2HDE A;  2EKE C;  4BXO B;  5LXH A;  1S0N A;  2WX0 A;  3V6E B;  4JV1 A;  2WXI A;  3EWA A;  1WZ3 A;  3MFI A;  3C2M A;  8ICT A;  1JRU A;  2BGF A;  2VRR B;  2AJQ A;  4LVS A;  4TUP A;  4EBC A;  4FFD A;  3P1M A;  4ZRI A;  2MP2 B;  4K4H A;  1FCC C;  3UXO A;  2JZP A;  3ZJU A;  3Q3J A;  4QZH A;  3DHG C;  3RJE A;  3IP4 B;  3IV6 A;  3DEE A;  5AI4 A;  4EX6 A;  3KBB A;  3G6V A;  4WJO A;  4Y2Y A;  2R8K A;  4KZ0 A;  2Z0D B;  3ML8 A;  2NR2 A;  3HWT A;  1WWT A;  1VZ8 A;  1WF9 A;  2BVC A;  4BBN F;  2LYH A;  2ZEQ A;  3TAC B;  2I1Q A;  2BZF A;  5D6J B;  1UEL A;  3ABV B;  4MFA A;  1DXS A;  2HDO A;  5HNK A;  2LGX A;  4F4Y A;  1XO0 A;  2KTQ A;  3UXN A;  1DRG A;  2EEL A;  2HE7 A;  2RGF A;  1ZQY A;  1QOF A;  4RCO A;  2V3P A;  2KQ7 A;  4I2I A;  1ZQ1 C;  3GZN B;  3U7Z A;  4O5C A;  3MC0 B;  5AM1 A;  4I2E A;  2LGI A;  1BNO A;  3A33 B;  3QIJ A;  1I42 A;  4PZN A;  1C20 A;  2ZIU B;  2AQ3 B;  1H4R A;  2QAR B;  1WWV A;  4C8N A;  5ALL A;  4OO1 J;  5HFY A;  4TUS A;  2LAS A;  4II3 B;  2N1R A;  2XI9 A;  2C28 A;  3C1Y A;  1N2X A;  5EE1 A;  3OJU A;  2J52 A;  3DBL B;  2QDF A;  1E7U A;  3UIP B;  4QW8 A;  1YOV B;  1KN5 A;  2YMQ A;  2QEJ C;  4RM9 A;  1RQL A;  3R7R A;  3RNA C;  4KGT A;  4GC6 A;  1A5R A;  2BF8 B;  1U4A A;  2QC8 A;  4O3Q A;  4ECU A;  2KJR A;  3GIJ A;  4FLH A;  2J6S A;  1V49 A;  5HR7 A;  2BYT A;  3PW0 A;  3ZVV A;  1NK5 A;  3C28 A;  1ZQH A;  3B9J A;  2N9P C;  2D07 B;  1T3Q A;  2UVW A;  4C4V A;  2W3S A;  1HZ5 A;  1ZD2 P;  2LBO A;  1PQS A;  8ICQ A;  3GZF A;  2IZV B;  5J2J A;  2ES6 A;  9ICH A;  5HHH A;  3FDS A;  3V61 A;  1KOT A;  4WJ3 B;  2JVC A;  2NO5 A;  2I1K A;  2KC1 A;  1WCL A;  3B0Y A;  3T5L A;  3Q8F A;  2NBV B;  3K1R B;  3RB4 A;  3PLV A;  2UWQ A;  5KL8 B;  4PL1 A;  4Q8E A;  1SSN A;  3VVW B;  3ZDE A;  2IDY A;  1GC6 A;  2JRH A;  1Z1V A;  2FNJ B;  1WH3 A;  2L52 A;  3EFU A;  3AU4 A;  5G2N A;  5DQI A;  1R7S A;  4C00 A;  2L32 A;  5DGB A;  4Q8F A;  2J6U A;  3A1Q A;  5L83 A;  5DPW A;  3ZGZ A;  3ETL A;  3AE6 B;  2W9B A;  3BQ7 A;  4IRD A;  1L7P A;  2JYE A;  1N63 A;  1IV8 A;  3AEG B;  2KFZ A;  3QU7 A;  5ALW A;  3HVZ A;  3A9K A;  4TKN A;  2JHD A;  3EC8 A;  2G4S A;  2LVP A;  1NEN B;  2Y9U A;  3NVV A;  4KX3 A;  2B21 A;  1EWY C;  2VZK D;  4DSJ A;  3U4E G;  4Y2U A;  5DLG A;  1V86 A;  2NPT B;  1KRP A;  1Z00 A;  5J2G A;  8ICO A;  2E8N A;  3BZK A;  9ICF A;  2EQY A;  2QLT A;  2RDH A;  2H3Z A;  3KVF B;  2X8X X;  1WR6 E;  2IO2 B;  2N4F A;  2W04 A;  1YQ4 B;  5CA7 A;  4EZL A;  1JQ4 A;  3SV4 A;  9ICJ A;  4CYE A;  2NVU I;  2DUY A;  2HTM E;  3KUD B;  4M00 A;  3WKE A;  4K3C A;  3PW7 A;  5KT4 A;  3H6N A;  1DOI A;  1I4Q A;  2DYB A;  5KFT A;  3LK9 A;  1WJ6 A;  1K50 A;  2M4N A;  2E3T A;  1I4H A;  4YFK A;  3KLS X;  4TMA B;  2MSN A;  3MR6 A;  3V7J A;  4RGT A;  1SE4 A;  3H7P A;  1BPD A;  2F1H A;  2NRX A;  4FE3 A;  2XY7 A;  3HM3 A;  4KGR A;  4DOA A;  4RQN A;  3HKZ F;  1BML C;  2GO7 A;  2PI4 A;  4KSL C;  1L3V A;  4OZC A;  5ALG A;  3VAW A;  3BYY B;  3ZD8 A;  2KVR A;  1KKX A;  4B9T A;  4IR9 A;  5B5E U;  2PFN A;  1KW4 A;  3BS7 A;  3LWL A;  1PVR A;  3OTQ A;  4CQN A;  4QW9 A;  3ZTD A;  1WR1 A;  4FBU A;  1YN5 A;  2D3D A;  4J9O A;  2EZZ A;  2VKQ A;  3K4G A;  5EE9 A;  1KH0 A;  2WX1 A;  1RQN A;  2HSZ A;  4LZG A;  4GB9 A;  4ZH4 A;  1WI0 A;  3ORY A;  4IOI E;  5ALY A;  3H7I A;  1NI2 A;  3BZC A;  1E90 A;  1YQB A;  1F2R I;  2WXG A;  2K5P A;  4GDK B;  2XNA C;  4WIP A;  3QU9 A;  1XC9 A;  3P4R B;  2M19 A;  4R66 A;  3L3F X;  4IRK A;  1GNU A;  2M0N A;  3E2E A;  1FXI A;  4A3O A;  2A19 A;  2EAP A;  1L0Y B;  1WGH A;  3AE2 B;  5AUI A;  2BDP A;  4US8 A;  2LHT A;  3KZI U;  2NRZ A;  2RSU A;  3KUC B;  5DGA A;  4P0Q A;  1L5P A;  1OEY A;  1UPH A;  2WXN A;  2K6D B;  7ICU A;  1N5X A;  3KHH A;  2BR0 A;  3I1Y A;  3MGV A;  4I29 A;  3W1Y A;  3I28 A;  4DQP A;  4NAM A;  4DCC A;  4C7Z A;  5J2B A;  3ISB A;  3BQ2 A;  2MUT B;  1T0S C;  3MHZ A;  8ICV A;  2PE6 B;  2EAM A;  3VTU A;  1UQV A;  1IPG A;  5KTQ A;  5KT7 A;  3W5U B;  1U4B A;  1MA7 A;  2HBM A;  3JYU A;  3JVZ X;  1KF6 B;  4MFC A;  4G3I A;  1I4P A;  3C19 A;  4BWJ A;  2WB1 F;  5TR5 A;  4EX7 A;  2P66 A;  1XT9 B;  2DYM A;  2YEP B;  3ZD9 A;  2H3V A;  1GB1 A;  1OW5 A;  3ISD A;  2B3A A;  3ONN A;  3HT3 A;  1ECW A;  1ZE3 D;  3NY5 A;  1AW7 A;  4PYZ A;  4YD1 A;  2R18 A;  1NOM A;  7ICN A;  3RJJ A;  3BIN A;  4IM0 A;  4C8M A;  3BZD B;  4NJ7 A;  1R4M B;  1ZQS A;  2HHQ A;  5J2E A;  1SB3 C;  4ELV A;  4QJF B;  2K8C B;  2D6F C;  5FP0 A;  1UUP A;  2MBB B;  2E8M A;  4Y2J A;  1JX4 A;  4KLE A;  3AEF B;  1NK0 A;  4DL5 A;  3PO5 A;  2CXY A;  2Z7J A;  3RYT A;  1CUK A;  2FI1 A;  3J81 j;  3RJG A;  3SR6 A;  3RUL A;  3CF6 E;  3V62 A;  2ZJD A;  4ZRQ A;  3AH7 A;  1XEE A;  4CHK A;  4PS8 A;  4EZ9 A;  4CDG A;  4IWQ A;  2KDE B;  2DKZ A;  2ZVN A;  1YMH E;  2FCN A;  2GOW A;  3NOB A;  2LJ5 A;  1PUT A;  2J6T A;  3AU5 A;  1UA0 A;  1UZX B;  3OWE B;  3H0L B;  4IW0 A;  3TUO A;  5BMI A;  3PW4 A;  1QLN A;  2E8P A;  4YMM A;  2ZIV A;  5D49 A;  4MF8 A;  2IGG A;  3DDC B;  2E1E A;  1DYQ A;  5KHO A;  4O3M A;  1E8X A;  4B0M A;  2AU0 A;  1CZP A;  1ZOL A;  2ZCB A;  4P4O A;  2RDB C;  4RZR A;  3L13 A;  3HHM A;  2FJ6 A;  7ICM A;  3RN9 C;  3VQI A;  2DKX A;  2K8B B;  3APF A;  5G55 A;  1JWB D;  5DCN A;  4AYB C;  5LXI B;  3MR5 A;  3RF9 A;  1MI0 A;  4OZB A;  3VXW A;  4F3O A;  4O3P A;  2KZ3 A;  1U49 A;  3BS5 B;  4M2Y A;  2B76 B;  3Q3M C;  4XDD A;  3AL0 B;  1ZQO A;  3AUO A;  1MHH E;  2AH5 A;  2INN E;  1PK1 A;  1F44 A;  4ZRK A;  5JH5 C;  1DOY A;  3K9P B;  3QXG A;  2KNB A;  3S6J A;  1URJ A;  3SEB A;  8ICN A;  3J9C A;  3NRW A;  1VD2 A;  4JE3 B;  3RB0 A;  4MM3 A;  2KFN A;  3FYH A;  3GDX A;  2OHF A;  2K0P A;  3ZTC A;  1WFY A;  4HJG E;  1GJZ A;  3ONS A;  1S76 D;  1HEK A;  3RNB C;  4KX5 A;  2NRV A;  4HKZ E;  2XK5 B;  1CJE A;  4IWO A;  2FLL A;  3MFH A;  1NZP A;  1WIA A;  4PHD A;  3PSP A;  8ICI A;  2HOF A;  4WQM A;  3OJ3 A;  1RDF A;  1NK6 A;  1J7B A;  1N60 A;  3V7K A;  3PPA A;  3URY A;  2DF4 B;  2XO7 A;  2WDR B;  1WE7 A; 
#chains in the Genus database with same CATH homology
 3I9V 1;  3AED B;  1JAL A;  5FKA C;  1SEB D;  2K9X A;  1HA5 A;  1QLB B;  3HVD A;  1I7H A;  1WYG A;  4RF0 A;  1FMA D;  3NVZ A;  4US9 A;  1PGB A;  2VZK B;  3U2S C;  4TQ0 A;  4LLG M;  1P7E A;  1PDX A;  2ZW0 A;  5HI1 A;  2Y5P A;  4RFB A;  2GB1 A;  1CK1 A;  1F0Z A;  1K51 A;  2ZW1 A;  3W2D A;  1VDV A;  1PGX A;  3L4P A;  3LYY A;  5MPO A;  3E9S A;  4A55 A;  1I4R A;  3R2T A;  1L0X B;  3B2G A;  4RNA A;  1B9R A;  1NVI D;  1ZOY B;  4MAC A;  1XF5 L;  1QF6 A;  3I57 A;  3Q8A A;  1I4G A;  5G5G A;  3HUI A;  2D5G A;  2YEP F;  2WS3 B;  5I4D A;  2CU3 A;  3NUH B;  2PIA A;  1NYQ A;  3P63 A;  5HHD G;  3VRB B;  4HKQ A;  1D5Z C;  1UGJ A;  2OED A;  2Y3A A;  2BB5 A;  4OW0 A;  1GPX A;  1JCK B;  3KWL A;  4J3O D;  2WXJ A;  3O13 A;  1FD6 A;  1VZ6 A;  3FC4 A;  2ICI A;  2FE8 A;  1SXT A;  1T5X D;  3V05 A;  1ET6 A;  2WXH A;  3IAS 1;  2CJN A;  2AQ2 B;  1OFF A;  2PVG C;  4ITK A;  2BT6 A;  1JWS D;  2V4I B;  2X38 A;  1ESF A;  2WXF A;  1HEZ E;  4GDL B;  2G1E A;  4WWM A;  1BUI C;  5H92 C;  2KWD A;  1RYJ A;  2NTS A;  3NRZ A;  1IUE A;  2RDH A;  1YJJ A;  1IGC A;  1V1O A;  1J7C A;  3AE9 B;  4A9A A;  3MP9 A;  3H8H A;  3DWM A;  2W54 A;  1VR9 A;  4N59 A;  1VLB A;  1C4A A;  1QOB A;  2L1A A;  1UWX A;  2LFI A;  3AEA B;  2NMQ A;  1JRP A;  3IT4 B;  5AUK A;  2PVO D;  1IBX B;  1FXA A;  3LB8 C;  1YQ3 B;  1N62 A;  1YJI A;  3AV8 A;  2WP9 B;  4JPS A;  3AE4 B;  3BVZ A;  4XWT A;  1E10 A;  3AB5 A;  4RGN A;  1ZPS A;  1XLO A;  4LK0 M;  1C79 A;  2PTL A;  3BWU D;  3BYT B;  1L6V A;  1RFK A;  3TEW A;  1IBX A;  2AX5 A;  2PW9 A;  2Z8L A;  4P16 A;  2AQ1 B;  1EU4 A;  1FO4 A;  2QIL A;  3AMZ A;  2KN4 A;  1ZP0 B;  1ZXH A;  3IXS A;  5D7G A;  4WAF A;  1MVK A;  5D3I B;  1OQR A;  1QQR A;  1XCT L;  4OZA A;  3TEZ A;  4KKI A;  2FBW B;  4JWS C;  4MH8 A;  1FCL A;  2DLB A;  1TJE A;  1WRI A;  1JRO A;  1VRA B;  2KDM A;  1EM7 A;  1FRR A;  2H89 B;  4RF1 A;  3UI3 A;  5BMH A;  4WH4 A;  1GB4 A;  4L2Y A;  3AEB B;  1BXT A;  4REZ A;  1Y56 A;  3TEY A;  3AN1 A;  2BS3 B;  2HDE A;  1GAQ B;  1KLG D;  1TZO A;  3VR8 B;  2WXI A;  3ZYY X;  1C76 A;  1QOG A;  1A70 A;  2LHD A;  1OQQ A;  3KWV A;  2WDV B;  1M4V A;  1V1P B;  1D4B A;  3P1M A;  3C8Y A;  1L0V B;  3BII D;  1FCC C;  2WQY B;  3U52 E;  2JZP A;  1N5W A;  3ZJU A;  4YSX B;  2N0S B;  3PZ8 A;  1P7F A;  3VR9 B;  4YTM B;  1HZ6 A;  1V1P A;  2M0A A;  4HEA 1;  2ONQ A;  5LNK 1;  1ZDV A;  4AQ7 A;  1PYW D;  1WWT A;  1VZ8 A;  2NTT A;  3W9C B;  3EA6 A;  1SJE D;  4RH6 A;  1TY2 A;  3ABV B;  3RPF C;  2WU5 B;  4YTN B;  2V0G A;  1PFD A;  3FIL B;  2EEL A;  1QOF A;  4RCO A;  2V3P A;  4ARI A;  4XDC A;  4YSY B;  3AEE B;  4TQ1 A;  5HG2 A;  1SJH D;  3KQ4 A;  3U7Z A;  2LMC A;  3MC0 B;  2R61 A;  2LGI A;  4KGS A;  4C80 A;  1D5M C;  2AQ3 B;  1SE2 A;  2JWU A;  3AE8 B;  1TKG A;  2JSV X;  3FIL A;  5HFY A;  3GP7 A;  1TY0 A;  1FM0 D;  2J52 A;  5EE1 A;  2IJ0 A;  2JXT A;  3AE7 B;  2QEJ C;  1UWM A;  1C78 A;  2PMV A;  3SFE B;  1WSP A;  4OHJ A;  4KGT A;  2J53 A;  1C9F A;  4ZYS A;  1KLU D;  1TS4 A;  1XXG A;  4DXF A;  2WXO A;  2XN9 C;  2KAC A;  2BYT A;  4HRO A;  1ROE A;  1KFY B;  1L6U A;  4GLS C;  3T3O A;  3B9J A;  4ARC A;  1QT9 A;  1T3Q A;  3BK2 A;  3R8B A;  2LJI A;  3PO0 A;  2W3S A;  1K52 A;  2Y5C A;  1HZ5 A;  1F2R C;  3W1S A;  5G5H A;  4L23 A;  2CJO A;  4UDU C;  1V97 A;  3DWG C;  5T8I A;  2K22 A;  4YT0 B;  5H8Y E;  3P42 A;  2I38 A;  1KRH A;  3N9Y C;  2KQ4 X;  3Q8F A;  1AYF A;  2W55 A;  3ZJV A;  4JWU C;  3PZ7 A;  1QKZ A;  2SEB D;  1SSN A;  4NJC A;  2PKO A;  4IKG A;  2W82 A;  4L1B A;  2IDY A;  2DBY A;  1ET9 A;  2BBC A;  2WXK A;  2L52 A;  3BK1 A;  1AN8 A;  1R7S A;  1MHX A;  1QOA A;  2JYT A;  2L32 A;  2QJL A;  2WXL A;  4XE0 A;  1NEK B;  4WUR A;  2JX5 A;  3ZGZ A;  3AE6 B;  1VJK A;  2WXQ A;  1UNS A;  2JYE A;  2QIE B;  3E56 A;  3Q8B A;  1E7P B;  3Q8E A;  5TSS A;  2BW2 A;  3R2I A;  4KX6 B;  1N63 A;  4RGO S;  2LUM A;  2MJE A;  3AEG B;  3HRD D;  3HVZ A;  1SE3 A;  3MFG A;  2N7J A;  1NEN B;  1B1Z A;  3NVV A;  1EWY C;  2VZK D;  5BYQ A;  2Q5W D;  1ZXI A;  1ZDX A;  3U4E G;  1C4P A;  1FRD A;  3ZQ4 A;  1ACC A;  4AS1 A;  2N9K A;  1VZ7 A;  4C7Y A;  1AWD A;  4ZHO A;  3ETR A;  2IGH A;  3EGR A;  3NVW A;  2EKI A;  1YQ4 B;  1JQ4 A;  1T6B X;  2DWQ A;  2HTM E;  1HXY D;  3TEX A;  4HRS A;  2SAK A;  2BTE A;  4YSZ B;  4N58 A;  4PT5 A;  1DOI A;  1I4Q A;  3BVG A;  1K50 A;  1ENF A;  4A6Q A;  2E3T A;  5BMG A;  1I4H A;  1TKY A;  1ZUD 2;  4N6E B;  3KLS X;  4TMA B;  3IT6 B;  1E6E B;  4RGT A;  1SE4 A;  1YN3 A;  3AE1 B;  3V3X A;  3TSS A;  4DXG A;  4KGR A;  1EWC A;  1BML C;  1JWA D;  4OZC A;  1JWU D;  4C56 C;  2KMM A;  5D3D A;  3T3N A;  3BYY B;  2FUG 1;  1XLN A;  1IGD A;  1HQR D;  1J7A A;  3FAH A;  2WXM A;  5JXV A;  4CQN A;  1L4Z B;  5C3J B;  2M56 B;  1YN5 A;  3B2F A;  1L4D B;  5EE9 A;  1KH0 A;  4YTP B;  3BVM A;  2LEK A;  1FFV A;  2LHE A;  2INP E;  4IOI E;  3SFD B;  1CQV A;  4LTU A;  1F2R I;  2QSD A;  2WXG A;  1TKE A;  2WXR A;  1N61 A;  1TYG B;  2K5P A;  3AEC B;  2WDQ B;  3EUB 2;  1NYR A;  2XNA C;  4GDK B;  4WIP A;  5E6J A;  3P4R B;  2M19 A;  2MJD A;  5BYR A;  2G9H D;  5C2T B;  3NS1 A;  1C4C A;  1FXI A;  2BB6 A;  4EE2 A;  3RFZ B;  3ZJT A;  1L0Y B;  1D6E C;  3AE2 B;  5AUI A;  4Q2J A;  1FNW A;  3AE5 B;  4FXC A;  4US8 A;  5FK9 C;  2RPV A;  5GXG B;  2MH7 A;  1L5P A;  4USA A;  1E0Z A;  2WXN A;  1WXQ A;  1YN4 A;  1N5X A;  2PLP A;  2I2Y A;  3NVY A;  4R3D A;  1TS5 A;  4NAM A;  2N9L A;  2BS2 B;  4C7Z A;  1DOX A;  4IDI A;  3MHZ A;  2E6X A;  2GI9 A;  1F77 A;  3W5U B;  4NAW B;  1KF6 B;  4A90 A;  1I4P A;  1FNU A;  1DGJ A;  3GB1 A;  4M0W A;  2DYM A;  2YEP B;  3GS2 A;  1STE A;  3Q69 A;  1GB1 A;  2WU2 B;  3IAM 1;  3P4P B;  4ZRP A;  1ZE3 D;  1RM6 C;  1AW7 A;  4TSS A;  2ACZ B;  3Q8C A;  3BZD B;  2J42 A;  2IPK D;  1XLQ A;  3P4S B;  1SB3 C;  4MT5 A;  4XWW A;  1UUP A;  2BS4 B;  5EE3 A;  2L83 A;  1SBB B;  3MJ5 A;  2JU6 X;  2TSS A;  3AEF B;  2JQR B;  2RMM A;  4O1N A;  1FIQ A;  1E9M A;  3SR6 A;  4ZRQ A;  3AH7 A;  1XEE A;  1YNT E;  1Q10 A;  1SIJ A;  5FR3 A;  1JW9 D;  3VRA B;  1YMH E;  4DQO C;  2MJ3 A;  1JML A;  1PUT A;  5EE0 A;  3OWE B;  3TUO A;  1RWS A;  5BMI A;  3LXF A;  4KKJ A;  2IGG A;  1TS3 A;  3AM9 A;  1DYQ A;  3AE3 B;  4ZHP A;  1NI3 A;  1SF0 A;  1XCQ L;  2WXP A;  2RDG A;  4B0M A;  1CZP A;  4B0E A;  3P4Q B;  3CWI A;  2WLB A;  4P6V F;  3VQI A;  2DYO A;  4JX1 C;  4ZOH C;  4YXD B;  1JWB D;  1I4X A;  2ON8 A;  1MI0 A;  4OZB A;  2IGD A;  1D5X C;  1GOZ A;  1LO5 D;  2B76 B;  4MM3 B;  4XDD A;  4OVZ A;  1MHH E;  2INN E;  2K3U A;  1DOY A;  1C77 A;  1FNV A;  3NZ3 A;  3SEB A;  2H88 B;  2MEK A;  3WCQ A;  2QMT A;  3J9C A;  4H2A A;  1MPE A;  4JE3 B;  1PGA A;  1QIL A;  5BYS A;  2K0P A;  2OHF A;  4A8X C;  1FFU A;  4HJG E;  1WGK A;  4RGM A;  1KTK A;  4HKZ E;  1CJE A;  1XLP A;  2KAJ A;  1K53 A;  1TS2 A;  2GRI A;  4WQM A;  4YWG G;  1FEH A;  2WNM A;  3W5V B;  1V8C A;  1J7B A;  2W3R A;  4NZL B;  1N60 A;  2V3N A;  4D2K A;  3URY A;  1EU3 A;  2WDR B;  1JWM D;  1XO3 A;  2J4X A;  3CIR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...