3NRZA

Crystal structure of bovine xanthine oxidase in complex with hypoxanthine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nrzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nrzA01
4JWSC 2N0SB 2CJOA 1TJEA 1N62A 1WXQA 2BS4B 1FO4A 1XLPA 3NRZA 1FRRA 3AH7A 2E3TA 2MJ3A 1J7CA 3ABVB 4N58A 1V97A 2AX5A 1NYQA 3B2FA 2DWQA 2FBWB 2WLBA 3AEFB 3AE5B 3PO0A 4N6EB 1RWSA 4A9AA 1F0ZA 3HRDD 2OHFA 1E9MA 1QOGA 2Q5WD 1XO3A 1DOIA 2PVGC 3AEDB 3VRAB 1YQ4B 1FFUA 4YSYB 1TKYA 5EE1A 1DOXA 1N60A 4ITKA 3HVZA 3B9JA 1WRIA 2MJDA 2HTME 4US8A 3KWLA 1YJJA 1RFKA 1PFDA 4N59A 1NI3A 1XLQA 1E0ZA 2K22A 1TKGA 1JROA 2H89B 3AE3B 1CJEA 2Y5CA 2CU3A 3VRBB 1FXAA 3AMZA 1B9RA 1SIJA 3L4PA 1UWMA 2WDRB 5AUKA 3AEAB 1N63A 3AE9B 3LB8C 1AWDA 4ZHOA 3AEGB 1YJIA 5AUIA 1GPXA 2QJLA 1FMAD 2JX5A 4JX1C 1GAQB 4YTPB 3P4SB 1JW9D 1OFFA 1JWBD 1NYRA 1OQRA 5C3JB 1VJKA 3P1MA 3SFDB 4HRSA 3P4QB 1PUTA 1IUEA 1J7AA 1N61A 4US9A 3W9CB 2W55A 4YSXB 3SR6A 1RYJA 3AE1B 1WGKA 2W3SA 1VDVA 2LEKA 3AE7B 4YSZB 1DGJA 2MH7A 2JQRB 3NVWA 2W54A 3LXFA 1E7PB 1OQQA 1QOFA 1KFYB 2B76B 3DWGC 3AE6B 1WYGA 2W3RA 1PDXA 1ZUD2 3NVYA 3CIRB 5H8YE 1JALA 3AM9A 5G5GA 1TKEA 2KAJA 3BIID 1ZXIA 1RM6C 2PVOD 3AEBB 1FM0D 1FRDA 1E10A 3NVZA 1FIQA 1ZP0B 4KX6B 2WDQB 5H92C 2BS2B 1ROEA 1NENB 3DWMA 1XLOA 1L6UA 1XLNA 2M19A 3ZYYX 4WWMA 4LTUA 3RPFC 2WDVB 2BS3B 3NVVA 2K9XA 3AE2B 4YTMB 1J7BA 2H88B 1NVID 1T3QA 1VLBA 4C7ZA 1CZPA 2KMMA 4IDIA 1FXIA 1QLBB 4JWUC 1KF6B 3P4PB 3VR8B 1FFVA 1L6VA 2WU2B 3SFEB 1JWAD 2WP9B 1V8CA 1QT9A 3CWIA 5EE9A 4ZHPA 5EE3A 3FC4A 5C2TB 3W5UB 2MJEA 2WU5B 1KRHA 3WCQA 1R7SA 4C7YA 4ZOHC 4P6VF 1QOAA 3EUB2 3ETRA 1NEKB 2K5PA 2WQYB 3VR9B 1TYGB 1E6EB 1ZOYB 2L52A 2PIAA 4USAA 1QOBA 2BT6A 2M56B 3AV8A 1JRPA 1SF0A 2L83A 3P63A 3AE4B 4HROA 4YXDB 5MPOA 3AE8B 1DOYA 5EE0A 1A70A 3AECB 1I7HA 3HUIA 3FAHA 2DBYA 1SB3C 4C80A 4YTNB 1WWTA 1YQ3B 2WS3B 1L5PA 3W5VB 1L0VB 3B2GA 4FXCA 1N5XA 1N5WA 3AB5A 3AEEB 4YT0B 5GXGB 1JQ4A 4WQMA 2PKOA 2CJNA 1AYFA 2ACZB 3P4RB 2G1EA 5G5HA 2EKIA 1EWYC 2QIEB 3AN1A 3NS1A 1QF6A
chains in the Genus database with same CATH superfamily
2IY0B 4IRCA 2ZJAA 5JTIA 4F7ZA 4FBJB 1FRRA 3O65B 3PREA 1WUDA 1S5LU 2M0XA 3RFZB 2DPJA 4N9F4 3B2FA 2BTEA 7ICUA 4YMNA 4FJZA 4A9AA 3VUXA 5KG6A 5ALIA 4YP3A 3H0MB 5KL8B 2KN4A 2JZBA 2Q5WD 3VHTC 4D2KA 1D4BA 4M9HA 1NK8A 4BWMA 2R8GA 2D3GA 4QJFB 5IIKA 4F3OA 4II3B 4OJLA 1SKSA 2DUYA 2HDEA 2C7MB 4Q43A 2CR5A 3DV9A 4DQPA 1PFDA 1D8LA 1VZ6A 5AK5A 2LGYA 3RH4A 1WGYA 2M4NA 2C9WB 4REZA 4MEXA 2JZPA 4NAMA 2JYEA 2HHUA 3ZO5B 5ALVA 2L0FA 1IYFA 1EWCA 2AL6A 2C7NB 4QWBA 1YJIA 2WF5A 3QYPA 4ANVA 5BYSA 3QEBZ 2KWCA 3TEWA 1V1OA 8ICAA 3GV8B 2I1KA 4ED7A 5DBAA 4CRXA 1YN3A 1VJKA 2LKYA 3GZNB 3P4QB 3CW2C 3R8BA 2KFNA 2DHZA 5D94A 1RYJA 5KT7A 5KFAA 3GDXA 1VDVA 1Z19A 2BQQA 3KHGA 1E7PB 1TZOA 4MFAA 7ICOA 9ICJA 2PLPA 5J8YC 3ALRA 3NVYA 2XNAC 3MC8A 2HVIA 2QARA 1H4RA 3M8SA 4QZCA 1X9SA 2A19A 2HBLA 1YJ1A 9ICRA 1GC6A 3SYZA 4JUZA 2QDFA 3RNGC 4Q8FA 4PZOA 4KLHA 5CA7A 4RNOA 3ISBA 3Q14C 5KFYA 3PR5B 4DWIA 2XCAA 2W9BB 2XGPA 2RDIA 1YX6B 3ZW3A 2K9XA 3AE2B 1VCBA 1Q46A 3BZKA 1C3TA 1WJ6A 3LYYA 2N1RA 5J17A 4I2HA 3A1QB 3RB4A 1VD2A 4WJQA 4MM3B 3OLMD 1TT5B 5LXHA 2W8LA 2KTRA 2QB0A 4DOAA 4XC2A 2RDBC 1JX4A 4CNQA 4W9KA 3VR9B 1TYGB 1ZQUA 1WE7A 5EDSA 1ZRMA 2KKPA 4CCHA 4GGQA 5KFIA 1EF1A 2LASA 4CDGA 4WQOB 1UELA 4I6LB 4MSQB 2HJ8A 5FK9C 1P0RA 2FCNA 2LXCA 1L8LA 3ZDCA 3HUIA 5DB8A 3MHSD 4DXFA 3H0RB 3G6VA 2NYVA 2RLTA 4HCNB 4FHJA 4MF2A 1Z00A 2ALZA 2KFZA 9ICFA 3VTUA 1SKRA 5G55A 4CF3A 5CR0A 2HD5B 4DQIA 5AKJA 4HXDA 9ICHA 3L54A 3ENEA 2Y0SC 4KGSA 4PH5A 4LJXA 5HHDG 4GXJA 1L7NA 3V72A 2K6DB 1XO1A 4A3PA 3A9KA 1PUZA 4IQVA 7ICTA 3VCBA 3PT2B 2NCNA 4TQRA 1XO3A 4WAAA 1JIHA 2ZUCA 2SAKA 2BHNA 4YSYB 3PX6A 3QUCA 4OCZA 3TAPA 3HVZA 2G08A 1ET6A 1E0ZA 2NPTA 1TK8A 4BKTA 2BW2A 2ZTEA 2ZCCA 1KW4A 2MSNA 2WXJA 2V4QA 2IOFA 4RQ5A 3BWUD 2UVVA 3RZWC 3HJEA 2ZIUB 2G0AA 1KQQA 4LNNA 4JL9A 3THVA 9ICLA 2RR9A 4YD2A 4K1RB 8ICXA 1SWVA 2INPE 4Y2SA 4GLSC 4RGNA 3RBDA 1P7DA 2REXA 1D6EC 3QU2A 2H3FA 1ZQVA 2DNFA 2N7DA 5KT5A 3IN5A 1V80A 3ZJVA 5DBBA 2IGHA 2I38A 4JIOU 5AI8A 1L7YA 2B76B 2HHSA 2HHQA 2HDOA 3L3FX 5J0PA 1V1PB 1ZUD2 1LXDA 5HR7A 4ZRQA 4J9RA 4BKGA 4NZLB 2D8CA 4BBNF 2PFOA 2JF5A 3MFIA 1Q3VA 2VIXA 4AWJA 1GB4A 3PHXB 4KLUA 3F2CA 2XCPA 4KMUA 4O5CA 1XS9D 5KFBA 3DWMA 4GDLB 2EKEC 4QWDA 2GBJA 3U30A 4MGZE 2A4ZA 1RAXA 4FULA 5AK3A 4YTMB 2GBNA 1UHUA 1T3QA 3RJIA 1CZPA 1KFSA 1FXIA 1SWWA 4BXOA 3D2NA 2BKEA 2MU2A 4ICVA 3LDZE 2KJ8A 2ZTDA 4O5KA 1R7SA 4ZOHC 4M9JA 3H4BA 2F1HA 1SGGA 4DL3A 3QK0A 2WTFA 2JH7A 1QOBA 2NBVB 3AV8A 3SMVA 1A77A 3UM9A 4KZCA 3UF8A 3AE8B 2BB5A 4MT5A 2Y3AA 2WHEA 2O6VB 5CEHA 2KOXA 3JVZX 3DBRI 3MR3A 4I29A 2L5YA 3DVNU 3NZSA 4YT0B 1Z4NA 3TCAA 3OTQA 4WJOA 2N9EB 2AQ4A 4R8UB 4RUCA 1Q3UA 5G5HA 4OZAA 1EWYC 3PSTA 3C5GA 2KOBA 5E6PA 1M94A 2CJOA 5KHOA 4M6WA 2A1JA 4DFKA 7ICEA 1GO3F 3NHEB 3GIIA 1ZQHA 4AQ7A 1C9FA 2K8BB 4LK0M 1QSSA 2KHQA 2LI6A 3PV8A 1A6SA 2LUMA 4DL4A 3W1SA 1BGXT 4XDCA 4PS7A 5L1JA 1UT8A 5T8IA 5JXVA 5AKEA 4BWJA 1H8CA 9ICSA 2Y9UA 4QZFA 3KUZA 4ECUA 1EU4A 3V6JA 4W9CA 3BYTB 5L83A 1RFKA 2M0AA 2XK5A 3G6YA 1XLQA 3RNAC 4M9NA 5CHGA 4DSFA 5HKHA 5IILA 3LB8C 1SXEA 4F93B 2AJQA 1YD8U 2ZVNA 1ZQFA 3IG8A 4DFPA 4BDPA 2M17A 3EZ5A 4HPMB 3I5JC 5ALHA 1ZQBA 4KLLA 1ZQMA 4P0PB 9ICIA 3F5EA 3ALBA 1NZPA 2A1AA 2DX5B 4TUPA 3QX7A 4IWQA 4MSMB 4TQ1A 3T8MA 3QWZB 2BB6A 5J0WA 3L08A 3AU2A 4UBCA 1P98A 5KFUA 2W55A 1R4MI 2FCQA 4DFJA 3PSPA 4L2YA 3UMCA 4CF5A 2D3CA 4XQ8A 4PJ0U 3UIPB 4OO1J 4A90A 2WFAA 4RQ0A 1SJED 2NS5A 3DWGC 1V81A 3JPPA 3QUTA 2J4XA 3NGDA 4ECSA 1F2RI 2CS4A 2WXOA 3IHPC 3M63B 4EKUA 1NK7A 1KL9A 3B1LX 1FNVA 1FXTB 4NAWA 4GMVA 5ALRA 3RNBC 4MFFA 2VA8A 1NOMA 1ROEA 2K0PA 4RM9A 2MP2A 1CMXB 2KD1A 3WK9A 4GLXA 2BPGA 4B9UA 1XLOA 4Y2JA 2BYEA 2MWSB 4MJSA 3PO4A 3RPFC 2WDVB 2BS3B 1RDFA 4KSKC 3TEZA 4RU9A 3BJYA 3IRUA 1UA1A 3ZLZA 3Q2AC 3SV4A 1RYSA 1D5MC 1TFRA 5IIMA 1ZQLA 2KTFA 1WZ3A 3Q3JA 4NQLB 4XYCA 4BOZB 2DYOA 3A0BU 5DG7A 2WU5B 3JPRA 1HZ5A 4K7UA 2K5PA 4OW0A 4IUMB 5ALDA 1ZPSA 4DHJB 2ESEA 4BUGA 2ZIWA 4CE6A 2OWOA 3BS5B 3BDPA 1KTKA 1WGHA 4M00A 3ZDEA 3OHBA 2KLGA 4GN1A 5E6OA 5DDMA 3N7SC 4K4GA 4G3IA 5IKCM 3BK2A 1WWTA 2QMTA 1WJNA 2KQ7A 8ICQA 2WXPA 5AKIA 4FXCA 3AB5A 1SJHD 1WX9A 4TV3A 4C0ZA 5J29A 2LJIA 4TKNA 3BQ7A 4CYEA 2R2QA 3KKAA 2ZPYA 4ED8A 4H2AA 5ALSA 4CO7A 2W9MA 2GH1A 5TISU 2NBWB 2BCQA 3EFCA 3NZUA 3ABVB 4QNLA 1TS4A 1WX7A 2ASJA 3ZJTA 2ZXHA 4J9MA 2Z8LA 1UBQA 4ZRPA 4MACA 3L16A 1JRUA 2KK0A 5C0YA 4B9LA 2LFIA 4E74A 4NLNA 1C4AA 3GE8C 4EOYA 3RZFA 4NLKA 3RUIB 4QWEA 1NI3A 4DSJA 4KLEA 2KJ5A 1HTOA 1IGDA 1QQRA 3PLVA 1S9FA 4PYZA 1BPYA 1X6IA 3TEYA 5D3DA 3RN9C 4F71A 3SD5A 2KJRA 4EZ6A 2IBIB 2KSOA 4EEYA 1S76D 2O6VD 3PZDA 1ZQAA 4DL5A 1UZXB 2LGIA 2D5GA 1IXRA 4RGOS 4O9MA 5EWGA 3H8WA 2ZJ8A 5KT6A 3MGHA 1ZOLA 2AXTU 2N4FA 4EZKA 4QZBA 1Z1BA 1AARA 1IBXB 2INNE 5KFGA 2IO0B 2FPKA 3RNCC 1SBBB 1S3SG 1BNOA 5BPCA 3ZRCA 5J2RA 2J6UA 2NVUI 4O0IA 1SL1A 9ICBA 4BGDA 2KICA 4J3OD 1U4BA 1WH3A 4XX5A 4AP9A 3HIZA 3O13A 2O2VB 1BPBA 2GOLA 2PMVA 3MP9A 1HIWA 2KYWA 3ED5A 4PGYA 1PVQA 1FIQA 3H8MA 2J0KA 1FNWA 2LYHA 1ZQZA 2LM1A 1I4PA 2L8JA 3IBEA 2CPRA 1JMSA 3ZDBA 2N9LA 2MEKA 2J53A 2FCMA 1WJUA 2WXIA 3SZ2A 2A3VA 4C7ZA 3R9KA 1NKEA 5BYRA 1Q0WB 3VFKA 3SEBA 4F91B 1JWAD 2LYAA 4PHEA 4FE3A 1OEYJ 3U52E 2XGQA 1ZD4A 4M2YA 2ZZPB 3OG5A 4NXZA 2HBJA 3PY8A 1RLFA 5DG8A 5F9LA 5FP0A 3MDAA 2BT6A 3DEEA 3GS2A 2JXTA 3M9OB 4GU2A 4ELVA 2CHZA 3WIMA 1JUDA 3RTVA 1GOZA 2DBYA 2I1QA 4KDLB 4C80A 5AM1A 2D07B 3VDZA 1J2MA 1L5PA 2L00B 5J8YA 1WYWB 4IRDA 1Z2MA 2FCSA 2K4HA 2FIDA 2G1EA 3MDCA 2EKIA 4XDDA 2J52A 2WB1C 8ICSA 1LO5D 1N62A 5AM5A 3T3OA 1F77A 2AGQA 2N7JA 2ON8A 2H5XA 4NJ7A 4O5EA 4KDIC 3RULA 3L13A 7ICGA 2ZUBA 3Q8EA 1MC8A 2Z7JA 7ICJA 3ICXA 3M95A 4ANWA 4YMOA 3U4EG 1AW7A 3QCAA 5KFQA 2DZKA 4DBGA 4M8NA 2HTME 2KFKA 1S97A 3PMNA 2D6FC 3I9V1 4DDID 3K1RB 5KFLA 2CXYA 4MH8A 2H89B 2Q0ZX 5AM2A 3RJJA 3CF6E 2OYYA 1QH9A 3SV3A 3H7PB 4TSSA 1UWMA 5AUKA 4OHJA 2GO7A 2J42A 1AQ6A 2LGXA 4NY0A 2YX8A 2BQRA 2LVOA 3GIKA 1FMAD 3IAM1 5ALPA 4M0AA 4EBEA 4AOFA 5J2KA 1WJ4A 4F8RA 5KFFA 2V4LA 5KNIA 1GNUA 2Y9TA 1N61A 5EWFA 1PUTA 2V3SA 4KSLC 2JEGA 3V7KA 4KX5A 4MHVA 2VKQA 2LEKA 1V49A 2MRLA 2KO3A 2LRWA 5KFDA 1OQQA 5KFXA 2MBHA 1QOFA 2D3AA 5ALXA 3U7ZA 3QARA 2KZRA 5G5GA 5CP2A 2EELA 2KWUB 1TBEA 3FILA 3ZD9A 4HPPA 3S2AA 1S0MA 1V6EA 4QIWF 5KTQA 2FUHB 2GOWA 3WK5A 3KZIU 2UU7A 3QNMA 1XCTL 4A8EA 2ZIVA 2PJHA 5F9NA 4FBUA 2B21A 2BF8B 2GRIA 3H8SA 2ZIXA 4Y2UA 3GV5B 2F76X 4JK1A 3RJEA 1TAMA 5AM4A 5IIJA 1XD3B 5D7GA 2ATLA 3TEXA 3ZDDA 4XRHA 4KGRA 4U6PA 3HP6A 4NJCA 4QZIA 4BKSA 3RB3A 1SE9A 5C2TB 2NO5A 2UVWA 2VH1A 4P4PA 2UYZB 2WXFA 3KLSX 3NG0A 2FE8A 3BZDB 1TS3A 1U9LA 3Q8QB 3WKDA 2NTTA 3P2BA 2BWFA 2QARB 3GIJA 4QZ8A 1X9XA 1E8WA 4CHKA 1RPLA 2IYDB 1WXSA 3BZCA 4IM3A 4B6WA 3AECB 1Z4OA 2EDUA 4GIVA 3BQ0A 2DLBA 3RMKC 4YTNB 2PTLA 3PW5A 2AHOB 1URJA 2IGDA 1XT9B 4FHKA 2KWVB 5GXGB 5FR3A 4LJPB 2JHDA 2PKOA 2I6XA 2KZZA 1PYWD 4A3OA 5ALOA 4QWCA 5J0SA 1QF6A 1NBFC 1IIPA 2YB4A 4EZ9A 2KC2A 2I5HA 2W9CA 2W43A 3IT4B 4NNJB 1XXGA 5IO9A 2QILA 3PR4A 4UASA 4R3DA 1C76A 2KTRB 4WAFA 3ZDMC 2QB0B 3R2IA 3AE5B 4EYIB 2GLSA 1L7MA 1DOXA 4EBDA 8ICPA 3UIOB 4PYUA 1ISNA 4UAWA 4ED6A 1QZEA 4US8A 4AYBC 2LJ5A 7ICSA 5HR6A 2N7EA 1ZRNA 1JROA 3WU2U 3AE3B 3VRBB 4JWNA 3V6HA 4URKA 1Z00B 1B9RA 1E90A 1CEZA 1KTQA 4O3OA 2LHDA 4ZHOA 3DBHI 2AL3A 4LLGM 4WWPA 2IA6A 3J81j 3P4SB 1KN5A 1JW9D 2FPLA 1NK6A 2NO4A 4ZH4A 1EM7A 3PMLA 3C2KA 2IMWP 1RXVA 9ICQA 2QC8A 3C23A 2JY6A 3W9CB 3K9OB 1B22A 1WG8A 1C4PA 2RSUA 1D9FA 4J9OA 1F5SA 4HKQA 5KFZA 1VZ7A 2NV3A 2WAQF 5IIIA 2QHOA 2KZ3A 3AE6B 2K8AA 4C8OA 3CRXA 1ZW7A 3JPOA 4FBTA 5DQHA 2MHJA 2NPTB 3HM6X 5EWEA 3ZUNA 4RM8A 1VR9A 3NRWA 2C2DA 2CRXA 1UQVA 4DSEA 3QU9A 4KVGB 2YMMA 4WWOA 4PHAA 1J0GA 1RZTA 4O3MA 1L6NA 3NASA 5CWRA 5J2DA 3RBEA 2MUTA 5DLFA 3ZYYX 4LDTD 1NKBA 1SE3A 5IINA 5LXIB 4IQWA 2NRWA 5E6JA 5J2BA 3ZI4A 3EPGA 2LRUA 3TADC 1FFVA 3GZFA 3RR8A 1Q8KA 5DGAA 2L3ZA 1T94A 2V9WA 4P7IA 2E8MA 3W5UB 4S17A 3WCQA 2HOQA 4YQWA 2SEBD 1L7PA 4IKGA 4ELUA 4EE2A 3M3JA 1G6JA 2KQSA 9ICNA 9ICEA 4RQNA 4DWFA 4QZEA 2DKZA 2V3PA 2AQ3B 2INCC 4HLEA 4LZGA 4F8CB 4QZ9A 1ZQJA 1I4RA 1WZ0A 1WGGA 4HEA1 7ICQA 2KK8A 4R63A 1KH0A 4F72A 1TKYA 4RQ1A 8ICTA 3JPSA 4BXOB 2N0SB 1HTQA 4I6NB 2RPQA 3RAQA 4MEYA 2WX0A 1ESFA 3MJWA 4DO9A 4I2CA 4NV0A 1L0YB 4RQ4A 2F8LA 1TKDA 4N6EB 3M9MB 1XSPA 2JV3A 2KVZA 2DYMA 2JRZA 2L32A 1FCCC 1X9WA 4QW8A 1NJYA 4ITKA 3RFAA 4XA5A 1SIFA 4FS1A 4K4IA 1Z3EB 3RF9A 2JPHA 3V6EB 4UAZA 2VA3A 3CP8A 4UB5A 5AIAA 3RJKA 2DZJA 5KG3A 4P1CC 4RGMA 3VXWA 3VC8A 2CU3A 3LK9A 2ZNVB 3ZXVA 3SHQA 1CQVA 2ISOA 8ICZA 2GLEA 1N63A 1PGAA 3AEGB 5E79U 3PW2A 2LVPA 4NPNA 2FLLA 1FD6A 2K4EA 1XCQL 3RYTA 4GIBA 4P0QA 3URYA 1ZQDA 4M6WB 3QE9Y 4JX1C 2C2RA 3UQ0A 4B6JA 5DBCA 1COKA 3MJ5A 2DAJA 1TIFA 1I35A 1OXJA 1OQRA 5CB1A 3R7QA 3GB1A 1DYQA 1K52A 4Y2VA 2RPVA 2DQNB 4EX6A 5HP4A 1ZQIA 1ENFA 1IUEA 4RGTA 5KAFU 2KDBA 3PW7A 2BZFA 4KLJA 1CRXA 9ICXA 2D11A 2JGAA 4YG2A 3LJ3A 4U7CA 1L7OA 2BDUA 2L7RA 4KLFA 1KFYB 4K4HA 2FLPA 3CIRB 1JXEA 4RPXA 4RT3A 2XK5B 3J9CA 5H8YE 3ZNID 9ICTA 2IBKA 4E3CA 5HI1A 4NQKE 4LCDE 1RFAA 3MR2A 2JZ3B 3TL5A 3M8RA 2I2YA 8ICCA 4M01A 1FRDA 1SKWA 1YIWA 2K4IA 3VUWA 3HM3A 1FEHA 4IC9A 1L6UA 1XLNA 2MBQA 1ZQOA 4F5RA 3PZPA 8ICVA 1WWUA 3HVDA 4ZYSA 1J7BA 4I2JA 4GXBA 4ICAA 3NUQA 5ALFA 3WKCA 1CUKA 2L76A 4UDUC 2CU1A 1TGZB 4NM1A 4UB6U 4YD1A 2LD9A 3SFEB 1C78A 2WP9B 5AZGA 3F2DA 4BBNC 4ZHPA 3DQVA 3ONSA 3NS8A 3EC8A 2WF7A 4NJ8A 4DSKA 3OWEB 4TMAB 4DHZB 4P6VF 2JEFA 3EUB2 3PO5A 5AK4A 1NEKB 3DHGC 1E6EB 1K53A 1ZOYB 2BPCA 4USAA 5L1LA 4C00A 1HJPA 4ECQA 2OH2A 2F3NA 2NTSA 4NAWB 4KTQA 2KNBA 2MA1A 4UQGA 5EE0A 1WMHA 2YEPB 5CJ7A 2MQJA 4OZCA 2MP2B 3Q8LA 9ICKA 1YQBA 4R66A 4GXIA 4MJSB 3WKBA 4Q45A 1KSPA 2MBOA 3A9JA 3APDA 3PRPB 3HPOA 1GC7A 4S0RA 4ACFA 4Z6CA 4M0WA 2KX0A 1I4HA 2QSDA 2XVTA 2XY5A 2FMPA 3QU5A 2PW9A 4JWSC 8ICKA 3Q3MC 4I2AA 2K6QA 3M6KA 2YVCA 3H0LB 3TQ1A 4LZDA 2V0GA 1N56A 2MLBA 5FR6A 1RWSA 3VH3B 2OHFA 1WM3A 5ALJA 4RPZA 4BZAA 2JH1A 3AEDB 1T8EA 1YQ4B 1HEZE 5J2AA 2UVUA 2ZIWB 1N60A 1J19A 1P1AA 5H2FU 4MM3A 4GFJA 3U7DA 1ZD5A 5HMMA 3FM9A 1SV0C 1UGMA 2R8KA 2IDYA 3GZNI 1LM8B 4PS3A 3AULA 4B0MA 3IM1A 4X5VA 4B9NA 4PZNA 3ZKJC 1QKZA 1FXAA 3OGUA 1SIJA 1RQLA 2HOIA 8ICWA 2MW5A 1X66A 4WH4A 1ED1A 2F44A 2JSVX 5JZEB 4M9GA 5DPRA 1XQQA 2MBEA 4OJPA 4B9TA 4UW9A 2LZ6A 4ACOA 2WWZA 4NJ6A 2XN9C 3ONNA 1KM7A 2HBMA 4AUQC 4B9VA 2QKQA 4YVZA 2FI1A 3QU7A 3DBSA 3SFDB 3VH4B 3QZ7A 3GU3A 4P1BC 1JN3A 9ICAA 2LMCA 2OCEA 3Q8FA 3MC9A 3PRMB 2P66A 3EA6A 1X42A 1OW5A 5ALYA 5KFPA 2J6TA 4MEMA 4M47A 1PDXA 5C1ZA 1BXTA 3OHAA 1SV4A 3OJ3A 3D2QA 1F52A 2YTUA 5AHXA 1J97A 3NJTA 1ZQRA 4TURA 3IXSA 1UD7A 4RQ3A 3TI0A 4HDQA 2PMZF 3PSEB 2UWQA 2KP7A 5GTHU 2KSOB 4IS7A 1ZQWA 4TUSA 1SGHA 4OZBA 2BVCA 3PRZA 4KN4A 2WF6A 3N7RC 5DPTA 1E8YA 2AH5A 3R66C 5AZFA 1PVPA 2KE7A 5KFKA 3GOEA 2E8OA 1ZQNA 3Q3FA 2NRZA 3AUOA 1KF6B 3IDWA 4K3CA 3VR8B 3CMMB 4ZDVA 4NLCA 4UB1A 3RH5A 1S8OA 1KDHA 1TAUA 5EE9A 1D8BA 1QT9A 5KFEA 4XZ4A 2DENB 2EMTA 4BOSC 1A76A 2Y5BB 3ZXRA 4B0EA 2QB1A 1HXYD 3ZNHB 4C7YA 4IR1A 4HAIA 3B0AA 2BQ3A 1M4VA 2AYOB 1GB1A 5GTIU 3JYUA 1NJZA 3IHQB 2PIAA 3GIMA 2BCUA 3U8ZA 1DOYA 2W11A 2HW3A 4FLHA 3PVXA 3ZJUA 5L1KA 4W9LA 3EHVA 4Q44A 5HHIA 4I2DA 4KLQA 2F1IA 3TARA 4KLOA 1QSLA 3SENA 1N5XA 4UARA 4HVBA 5J18A 1T6BX 1V38A 3PZ8A 5AKYA 2ACZB 3JSVB 2P6UA 5J2EA 4OVZA 1L6VA 3KHHA 3GQCA 5ALUA 1KBUA 2V1YA 1TJEA 1WXQA 1XLPA 8ICUA 4I6PA 4N58A 4DSLA 3KTQA 3Q3OC 2WLBA 3TFRA 3QC8B 5D6JB 4QZGA 5C23A 2VZKD 5IIOA 2NRXA 2ZVOA 2JYTA 3K75D 2FLNA 1F0MA 4RQMA 1CJEA 2JWZA 3ZDTA 4CQNA 4F4XA 2WXGA 1N48A 1ZJMA 1WFYA 2LYBA 4QZHA 1GG3A 2G5IB 3L10B 3GV7B 4HYKA 1LKYA 1WCLA 3C5FA 4Y2XA 2G4SA 3C19A 2RDGA 5I4DA 1MG8A 1JWBD 4OVUA 3SDLC 1E7VA 2E1FA 3PW0A 4M9LA 4KGTA 2B3AA 2HBKA 7ICLA 2KN5A 8ICLA 3N30A 4O3RA 3ZNGC 1D5XC 3AE7B 3DBLB 1KFTA 4ZRIA 3NOBA 4DL6A 1LQBA 1AN8A 2KHWB 2G06A 3PVLA 5J0XA 5IN7A 3NUHB 2BQUA 4NL9C 5D46A 3UQ2A 2KFKB 1UNSA 4HK2A 3AM9A 1TV9A 1P3QU 2MSED 1ZXIA 2KVSA 5FKAC 5KG0A 3LVVA 2BPFA 1VZ8A 4QZDA 2DAFA 2KWDA 4ED1A 4DF4A 1ZP0B 3ECIA 2ZW0A 5LLIA 1UUPA 3WKEA 3H8JA 3VAWA 4Y2RA 4Z6DA 1QTMA 1X1MA 2ZJDA 3NVVA 3ZQ4A 2Z59B 1MHHE 2P6RA 1RQNA 1ET9A 5KT3A 2W7OA 4EYHB 3Q69A 3QAQA 4DEZA 3CWIA 5T14A 1UA0A 4P0PA 2QLTA 2MJEA 1L4ZB 2KIWA 1V9PA 3IG3A 2RQ5A 2N9KA 2VJ4A 5AI6A 3ETRA 3SAGA 2DZIA 4DFDA 5J0YA 2IHMA 1LV5A 3FILB 1NK9A 3OJ4B 2FIFA 3WK7A 1I4GA 4YXDB 3K4GA 4YR0A 2ZCBA 2CN1A 2ZIVB 3IVFA 4UB2A 2ZW1A 2ZIXB 2HMXA 1EUVB 5HMLA 1QLNA 3B2GA 3VQIA 1N5WA 2E8NA 3H6NA 3APCA 2CJNA 5D3IB 2GWSA 4A6QA 3T79A 3NS1A 8ICNA 1TTNA 1P9DU 2E8PA 3E58A 3RCZA 5BO4B 2NRVA 3ZDAA 2PE6B 3Q8RB 4ECTA 1FPYA 4Q2JA 3RI7C 1H38A 2AQ0A 1ZQKA 4WJPA 1XNSA 1WGRA 4JPSA 4YL8A 5KG4A 1LGRA 2G4DB 2L0TA 4M02A 4HCPB 3WAPA 1ZQXA 5GMVA 3V3XA 3VTWA 3A0HU 4LNOA 3TADA 2KHVA 4FJYA 2Y5CA 1RYUA 3T5LA 5D2MB 2KX3A 3RRHA 3Q8BA 4XGAB 1UBIA 3E56A 3N7PD 3ETLA 3PX0A 3KOOA 5KFRA 1X40A 3KVFB 3N1XC 3I63C 2KEYA 1R4NI 4HWIB 2JX5A 3N32A 5KG2A 3B0YA 4TQSA 3LDAA 2EZYA 2W9CB 3MGIA 5TZVA 1ZQQA 5AIBA 4B95A 3QEAZ 5ALLA 2YQEA 5TSSA 1TE2A 1IPGA 3ISDA 2ASLA 3L5KA 3SR6A 3H7IA 5C5JA 4IQTA 1WGKA 1YMHE 2H3IA 1IGCA 5DB7A 5J2IA 2H3QA 2W54A 4LVSA 2KMCA 2YMQA 1Y56A 2BGWA 5CHVC 3KHLA 1TS5A 5ALWA 4LDTB 4P16A 4F5QA 5BOLA 1U47A 2N9XA 2W03A 4YN4A 3RNEC 4ED2A 4Z6FA 3SQIA 1C77A 1X6JA 4J9QA 5J2CA 2I9GA 3TAQA 1SXDA 7ICPA 1SL0A 4IL6U 1UGJA 1WCNA 2OEHA 1BPDA 1T0QC 3KUCB 2PFQA 3N28A 3AU5A 1FNUA 2MBBB 4YMMA 4WJNA 4DQQA 2JZBB 1I4QA 1QLBB 1X9MA 1V5TA 4NLZA 2WU2B 2EH9A 4TUUA 4UAVA 2AEHA 2LGSA 4GOCA 2FPMA 2R8HA 4QIWC 2HTHA 9ICCA 1YN4A 3K1ZA 4ECWA 1WI0A 3MC0B 2PPHA 8ICJA 3CYMA 4Y2QA 4J03A 3CSFA 1K5OA 1QQ7A 2M56B 2IO1B 3HK0A 2NMQA 3P63A 5MPOA 2ODGA 5KFHA 2JXXA 2YEPF 2OOBB 4UB3A 2MX2A 4KLDA 2K60A 2AU0A 2W7PA 2EANA 1L0VB 2MUTB 2KKCA 1HEKA 2B6GA 2BDPA 1SEBD 3V6KA 1WY8A 2BPSA 2KT7A 3P42A 4KLSA 5AKXA 5KG7A 3QXGA 1Z5SB 2JMGA 7ICRA 3OJUA 4F1SA 3SU8X 3TMPB 4F5OA 2IGGA 5HFYA 7ICHA 1U4AA 3WAMA 4FN2A 3DPDA 3EGRA 1BPXA 4NLBA 2DWQA 4GDKA 4EZLA 3HRDD 2N9PC 1E9MA 1TS2A 3RH6A 1DOIA 4EELA 2DF4B 4XUSA 4O3PA 1S0VA 1QQ6A 2K8CA 5ALKA 3C2MA 5BOMA 2KJHB 2HVHA 4N59A 1TVAA 2F1JA 5AKGA 2RP5A 2F8KA 9ICOA 3KFUF 2DZMA 1E8ZA 1IV8A 9ICUA 1Y8RC 3N1ZC 5CTRC 4FA6A 1TZ1A 5LNK1 2IO3B 4HKZE 4DS4A 5DPWA 4ECVA 2NBUA 1ZQ1C 1O08A 2HHVA 1D5ZC 2GI9A 5E6NA 3L0WB 2WXRA 3KZXA 4DFMA 4IG7B 2YLMA 1S10A 2LPEA 4YTPB 1S0NA 3WALA 2FUG1 3FDSA 3K9PB 2AQ2B 2OJRA 3GILA 5C3JB 3P1MA 1PK1A 1UF0A 5KFSA 1F44A 2G3QB 4ECXA 3E0FA 1B4FA 3LYSA 3NVWA 3H9DA 3EECA 8ICYA 3LXFA 1BPEA 1VRAB 3M7DA 2CKHB 4BKSD 1YZ6A 2C2EA 3SI8A 4XWTA 1BPZA 5KL1B 5DGBA 1JALA 2KFJA 4E71A 2I1JA 2ZUDA 4RNNA 4HDOA 1EF5A 4JV1A 3Q8SB 3PV1A 4RT2A 4ICUA 4A20A 4MGIE 1EO6A 4RNAA 3RJHA 4JGHB 3WK8A 1RXWA 1ZQCA 4KX6B 2WDQB 4LNFA 4WURA 4RPYA 3UGBB 2KDMA 2V9HA 1SV0A 4JV0A 2CHXA 2XEWA 4I27A 3A9KB 8ICGA 3RAXA 2WAQC 2WXQA 3H7PA 2WX1A 1V9JA 2YY6A 2PFNA 2PFPA 5AM3A 5D4BA 1SSNA 3DVGX 5AI9A 2GBMA 5DDYA 1ZJNA 2HOFA 2FAZA 4J6IA 1WX8A 3GE3C 1XO0A 2WNMA 4FJVB 4NM2A 3Q8MA 4UB8U 1HE8A 3NZ3A 1XWLA 3PX4A 3I28A 1B43A 3S6JA 4UBBA 4KLTA 2L83A 1NJXA 2D10A 3H7SA 3L17A 3JW0X 1C20A 4EZJA 1TY0A 3FAHA 4C4VA 3ZD8A 1KKXA 2X38A 1JI7A 8ICOA 7ICKA 4RFBA 4ARIA 1WXAA 4KITB 3TBLD 4AP4C 2KC1A 1NK0A 3BQ2A 3AEEB 3SEIA 4ELTA 3ZVVA 2QIEB 2ZG6A 3AN1A 3BVMA 4P4OA 2XBBC 2Z0DB 1D3ZA 2PI5A 2VH2A 1ZQGA 4DQRA 4F50A 1N6ZA 3MBYA 3MGVA 4GXKA 4EBCA 2WXLA 4KIKA 2L05A 1BNPA 2FBWB 3BQ1A 2IPKD 3HILA 3A4RA 2E1EA 2JXJA 2KV2A 3B0XA 3EW9A 4O3QA 3RB6A 4DK5A 5ALTA 1J2NA 3DBRB 2RRDA 3VRAB 3H1UA 4I2IA 4PPXA 1A5RA 1WMHB 4JB3A 2G09A 2D2QA 1T7PA 1TY2A 1TKGA 5F3XB 3UPQA 3T5HA 4WIPA 3A9JB 2O6KA 1NJWA 3AEAB 4M0WB 1EXNA 2KLCA 5L1MA 3U2SC 2NR2A 4G50A 1IM4A 3LWLA 3MHZA 5CHWA 4F4YA 8ICMA 2QJLA 4HJKA 1P7FA 5J0UA 4IOIE 2CHWA 5G2NA 4TQ0A 2QEJC 4HPLB 1HA5A 4RCOA 3VUYA 3AQFA 2ISPA 4UB4A 3D6JA 1MVKA 5JUMA 3SAFA 4DDGD 1O03A 1XC9A 2INDC 2EQYA 4UATA 1DXSA 1JMLA 2DFLA 1HUZA 1JWUD 2MH7A 4PT5A 2JQRB 5AEKB 3E9SA 2KQ4X 3JPQA 2DYBA 2E6XA 4MDKE 1ZYQA 1TKEA 2KANA 2UVRA 9ICGA 3QZ8A 5BYQA 5J0TA 3I76A 3BS7A 1MA7A 1NNLA 1S0OA 2A1JB 4Q8EA 4RF0A 3QA8A 2DL0A 3V6CB 4JMUA 1R4MB 5DLGA 2FMQA 3AEVA 2R2OA 5AI0A 4QZAA 4RQ8A 1RYRA 4LTUA 5IP4D 1ZQYA 2NRTA 4II2B 3HWTA 1VLBA 2KN7A 3APFA 2JT4B 2C60A 2D3DA 2IHNA 1GUAB 2DGZA 1L0XB 2ZJ5A 3BY4B 4F2RA 3DDHA 3C29A 3PTFC 1WGDA 3D32A 3ZTCA 3GFKB 1ZE3D 3R7RA 3PS6A 4R65A 4YR2A 3WKAA 2KTQA 4DOBA 1QOAA 2KMDA 2J0MA 2Y1IA 4W9EA 4DXAB 2JVCA 1OEYA 2Y0SF 1P7EA 1MI0A 4XE0A 4DOCA 4NWIA 5B5EU 1JWSD 2ONQA 4G11A 1PGXA 4RQ2A 4J9NA 3M9NB 2ES6A 1SB3C 2VRRB 4KV2A 3ZTDA 5BMIA 3LVWA 1KLNA 1SE2A 5KFNA 5ALGA 2IJ0A 3W5VB 2KDIA 3DHIC 2LWPA 1B1ZA 4G9BA 4NL9A 2G9HD 4WQMA 4EEWA 2MCNB 4AS1A 4FZLA 2VZKB 4ANUA 2WF9A 4ZYNA 4UAYA 2YB1A 3NRZA 3DCGA 3C0RB 1V97A 3F2BA 5J2FA 3TANA 4IM0A 2V4RA 2EAOA 3AEFB 1ZQTA 2BBCA 4F4ZA 1YN5A 4MFCA 3AU4A 4BJQA 4B9SA 4B9MA 1OQYA 4MGYE 4PL2A 3HX0A 3KQ4A 1ZGUB 4IWPA 2H3VA 1L8OA 1ECWA 2V3NA 3DVGY 3JPTA 3KWLA 4RF1A 4FADA 3JPNA 1T5XD 5ALQA 3Q6BA 2LHTA 2LXAA 1NZBA 2KD0A 3UQAA 4C4SA 4DS5A 4F4WA 2FNJB 1K8RB 2FDRA 1KFDA 1QCKA 1AWDA 1PGBA 1WE6A 3M1YA 4JLCA 1NKCA 4QWAA 1Y88A 1XU4A 3IP4B 5AUIA 2W9BA 3OSPA 1JCKB 4KLGA 1Q1OA 1SL2A 1TK0A 2BCRA 2IY1B 2QCZA 1OFFA 3OPXA 1COOA 2XIDA 2A5UA 4GC6A 1BT0A 3WK4A 2ZTCA 4CGZA 4CF4A 4R64A 3A1QA 3PNCA 3LWMA 3X23A 1T3NA 4LJOB 8ICRA 3AE1B 3AU6A 4XWWA 2E5SA 4RNMA 2YMLA 8ICEA 3PPAA 5CX3A 1S77D 3VVWB 1WIAA 1L3TA 2J7QB 3IAS1 2OEDA 4K3BA 5AI5A 5L9XA 4I2BA 1WYGA 2W3RA 2FMSA 1GJZA 1UPHA 3PGEA 1MQ3A 7ICFA 2KMAA 1EU3A 4J9SA 2RMMA 1RM6C 3ORYA 1FEZA 2PVOD 3AEBB 5AZHA 4PL1A 1D8YA 2VANA 1STEA 3PZ7A 4DCCA 2AWTA 2WDTB 2R18A 4K81A 2BS2B 2GBKA 4J9PA 3BK1A 1LKYB 4IW0A 5EOZA 1T0YA 1WXVA 4PHPA 4DL2A 1ZXHA 3WA0A 3EWAA 1L3SA 2YMPA 2PXIA 3ML8A 3VTVA 2H88B 1NVID 4YR3A 2LHEA 2RDHA 4JWUC 4YWGG 5KFCA 2G07A 2BCVA 1PQSA 3I1YA 5AKHA 3RNFC 5BMHA 3OSNA 1BVSA 5ALEA 4FO6A 1KRHA 2JEIA 4F92B 1KLVA 2PMZC 4IR9A 5D49A 4RZRA 4P2HA 2L52A 1MQ2A 2M0NA 3QQ8B 1JRPA 4HROA 2IO2B 2J6SA 5DG9A 1RRBA 4X57B 5L1IA 2WXHA 2JWUA 5KHQA 1I7HA 3UXNA 3W1YA 3V7LA 5KAIU 1UH6A 3N1YC 2W04A 2G45B 3MC1A 3HKZC 3H8HA 4LNKA 3Q8KA 1AYFA 3P4RB 4RH6A 4PS8A 3T3NA 3KHRA 1NK4A 3M6ZA 2ZIUA 3HKZF 2JZZA 5BMGA 4DQSA 2M9NA 1ZD2P 3O0FA 3V60A 1FO4A 3RJGA 3N20C 2Y1JA 5KFMA 5ALMA 3AH7A 4PK1A 3ZRFA 1J7CA 2OXOA 1TK5A 3N4MB 1DK3A 2VA2A 5KFVA 4QW9A 7ICIA 1F0ZA 3FYHA 3UXPA 1MN8A 3AQEA 2LBOA 4ECRA 8ICFA 4W9HA 2R8IA 1T0RC 4W9GA 3H4DA 2PVGC 1FCLA 1PZNA 3RB0A 3U26A 1V5OA 3TKAA 2W9AA 4ECYA 1SE4A 3PSFA 1YJJA 4KZ0A 1C1YB 1V1PA 2JR5A 4YFKA 2K22A 5KFJA 3I3TB 3UQBA 2BR0A 3AMZA 3T3FA 3UI3A 1R4NB 2WDRB 2KVRA 2LUEA 1MFWA 3AE9B 5J2JA 2D3BA 1U49A 2R8JA 4MELA 3ISCA 4GDLA 2JUOA 3ZIMA 8ICIA 2JU6X 5A0LA 4RQ6A 3M62B 1I42A 1ZKHA 2HE7A 1NYRA 3AI5A 3AL0B 2R61A 2DKXA 4M04A 4KLMA 1E8XA 2ZEQA 3A33B 3PW4A 9ICPA 1C7YA 4BX9C 1HQRD 3TIXA 4A55A 1Z1VA 2BGFA 2IOFK 4O3SA 4W9JA 1K1SA 1VJ5A 4ARCA 4YSZB 1DGJA 3C21A 4EENA 1OTRB 1OGWA 4YCXA 3G6XA 1LFDA 2EAMA 2WGSA 2EZZA 3NY5A 2KAJA 3BQTA 3BIID 1N2XA 3OAWA 4KLIA 2HHWA 3DDCB 1E10A 2RHFA 4KMOB 4PHDA 1KOTA 4MH0E 1DGSA 2O6VA 1QILA 4WJ3B 4K7WA 2W9NA 3V62A 2M19A 2WYQA 4WWMA 4GSWA 3KUDB 3A4SC 4R8UA 4EFOA 3MFGA 4IDIA 4L1BA 1DOQA 3ZNZB 2B0CA 4UAUA 3H40A 4DHZE 1HUOA 1WR6E 2Q4TA 1V8CA 2BKFA 2BYFA 3FC4A 3AXCA 4EEKA 4JV2A 3EPIA 1KLUD 2K8BA 3PHWB 5JHAA 4IM2A 1XSNA 1C79A 2RD0A 4W9DA 3D2SA 2WQYB 1WF9A 2K25A 3RR7A 1JWMD 5DB9A 3MR6A 4JWMA 1X2IA 3DOWA 3HHMA 1SF0A 3AE4B 2F2AB 1JXLA 2XI9A 1A70A 1MHXA 4GB9A 3V7JA 4J9LA 1K50A 4QAYA 1B0XA 5DQGA 1CK1A 2WS3B 3KYCD 3WAOA 5JH5C 3TACB 9ICVA 2OJWA 3V61A 2DPIA 2V4IB 3FKYA 1F1HA 1A0PA 5DB6A 1V85A 5HG2A 1E5WA 1UWXA 2BS4B 2K3UA 4OVVA 4OJOA 4A8XC 4DF8A 1TAQA 2G5HB 2E3TA 5KG1A 1WRDB 2XICA 8ICBA 2HHTA 2AX5A 5DKWA 2C7HA 2RDJA 3ML9A 1F9JA 1DRGA 3PO0A 2WXKA 3NTUA 2LM4A 5KG5A 4F5PA 3CSTA 2IZVB 1FFUA 5EE1A 4NY8A 1ZQEA 3MR5A 2Y5PA 1XF5L 4KN7A 5K4LA 2AQ1B 4E0DA 1SXTA 1IP9A 1L4DB 2EAPA 4ED0A 1QSYA 2MRPA 4DQOC 1UT5A 3QUQA 3WANA 4IQUA 1L3UA 4F4KA 1MG4A 5CHFA 5HHHA 4I2GA 9ICWA 5J2HA 3C1YA 1MSWD 3DHHC 3TFSA 3KW5B 2BYVE 2BYTA 1GPXA 3KWVA 2KG5A 3C28A 2KKVA 1ZQPA 4HJGE 4MGKE 2EZXA 2ICIA 4M8MA 3N97B 3T5KA 4C8NA 2KACA 2VJ5A 4HRSA 3QJZA 4GDKB 1J7AA 4US9A 2C22A 1HZ6A 2KJ6A 3JSVA 3MTNB 4ANXA 1YOVB 1ZD3A 3BINA 3MABA 2W3SA 4W9FA 4DXGA 2LVQA 2ZNVC 2JRHA 1I4XA 3DBHB 2K8CB 5AM0A 2M8SA 1IG6A 4G3XB 4YSXB 3QHTA 3TJPA 4AJYB 2ZXIA 2HCFA 2KDEB 4ECZA 3B08A 4C56C 4RQ7A 4IWOA 5L95C 1LVHA 5HNKA 3BS5A 4FS2A 7ICNA 2PE9A 4Y2PA 1Q5WB 5B66U 2EMSA 5H92C 1NK5A 1NENB 4ASWC 5IA7A 3DVNV 3W1SC 2H3ZA 4F5NA 1RG6A 4KKJA 2XC9A 3SAHA 1Q10A 1F2RC 2MA9B 4J9KA 1PK1B 2X8XX 4P4MA 9ICMA 1LB2B 1SZPA 2C5LC 2N1VA 4I2EA 1T4GA 3T9LA 5EE3A 1L2NA 5KT2A 5DPSA 4EX7A 4TUQA 4F2SA 2WXMA 2ASDA 4Y2YA 2GBRA 3F5AA 2WB1F 3KD3A 3UXOA 2W8KA 4NLGA 2HJ1A 5AKKA 5J2GA 1NI2A 1WXMA 2AGOA 1ZDVA 4PGXA 5CRXA 3Q8AA 4LNIA 1UCVA 3UMGA 7ICVA 2BCSA 4YXJA 4C8KA 2TSSA 3X0WA 2N1WA 1XSLA 3RD2A 4C8MA 2LGDA 1WR1A 3EYZA 4DHJD 1J8CA 2K1FA 1YQ3B 4EUTA 2LMRA 2AGPA 3IT6B 4RUAA 3Q8CA 1SZHA 4DLEA 3BVGA 2HI0A 3N9YC 2PKEA 4C4RA 2MJ3A 2M1MA 5JHBA 1NYQA 4DLGA 2HHXA 2KJ9A 3QUBA 4ED3A 2LI5A 4FZNA 1IBXA 2KDFB 1NDDA 4IC7B 1QOGA 3N3KB 4Y2TA 4MF8A 4I28A 3BYYB 3CNHA 3C1ZA 1KRPA 1MJDA 1K51A 2W82A 3W2DA 4G0NB 3B9JA 1WRIA 2KNJA 4IRKA 2MJDA 5AKLA 3PSIA 3R3MA 4C4VB 1M6YA 2K39A 2O2VA 3T5JA 2ZPNA 3DBLI 4DSIA 1ACCA 3KBBA 2YN4A 3IG5A 3L4PA 4PGQA 4W9IA 3TSSA 1DK2A 4YXMA 7ICMA 5AK6A 1WM2A 1PVRA 1ZQSA 1KEJA 1OUQA 2K8HA 4O1NA 1K1QA 4RMAA 1T0SC 3GP7A 1GAQB 3BVZA 2XY7A 3IFWB 2RGFA 1V2YA 4BFRA 1WWVA 4I2FA 3QU4A 3C2LA 2KZMA 1XEEA 5KT4A 4KIKB 3WK6A 5IAAC 4C8LA 1C4CA 5JRTA 5AKZA 3UINB 3EFUA 3Q3NC 4K7SA 1KJTA 3TUOA 4KX3A 3MFHA 4AJWA 4BVUC 1ZDXA 2IOHA 2ASQA 2WHIA 2OM6A 5J0QA 2HSZA 1WSPA 2BKRB 2L1AA 1BUIC 5IOIA 3RRGA 4ZRJA 3KKAC 2KVCA 2P35A 1YNTE 5DQIA 1FM0D 3PLUA 5ALNA 2Z0EB 5TR5A 2FJ6A 2XY6A 1U45A 2WXNA 3NVZA 1L3VA 5J0RA 1KLGD 2PEAA 2F77X 2XO7A 5KFTA 3QIJA 1AROP 4O3NA 3UMBA 4GC7A 2PI4A 1D9DA 3F53A 1U48A 4B9KA 3SD7A 1YZ7A 4WWNA 2KMMA 4ZRKA 2GB1A 2K89A 4DL7A 3Q8PB 3P4PB 2J0JA 2MAXA 3RJFA 4JQWC 4KKIA 3V05A 3HW8A 1L5UA 3E2EA 2KIVA 3C8YA 4FFDA 3R2TA 1PK3A 5KFWA 1QQ5A 1V86A 2BWES 2GMIC 4BAXA 4C4TA 2JEJA 3ZGZA 2WF8A 5J0OA 5ALZA 1YX5B 4FZMA 3QX1A 3HT3A 4OD0A 4OJ6A 4L23A 5DCNA 1YT3A 3KYDD 1E7UA 2KXJA 4JE3B 1MPEA 5AICA 3IV6A 4P0QB 1BMLC 4Z6EA 4OJ5A 1ZETA 5JU5A 1S1QB 5AI4A 3KH0A 8ICHA 1JQ4A 1CI4A 2JRIB 2C28A 5KFOA 2FE9A 4AYBF 3OJSA 3RT3B 2K4PA 3I57A
chains in the Genus database with same CATH topology
1LO5D 1N62A 1TJEA 1WXQA 3T3OA 1XLPA 1F77A 3NRZA 1FRRA 2N7JA 4N58A 2ON8A 1V97A 3RFZB 3B2FA 2BTEA 2WLBA 3AEFB 4A9AA 2BBCA 1YN5A 2KN4A 3Q8EA 4D2KA 2Q5WD 1D4BA 2VZKD 3U4EG 3KQ4A 1AW7A 2HDEA 2JYTA 2V3NA 2HTME 3KWLA 4RF1A 1PFDA 1T5XD 3I9V1 1VZ6A 4MH8A 2H89B 1CJEA 4REZA 4NAMA 2JZPA 4CQNA 2JYEA 4TSSA 1UWMA 5AUKA 2J42A 1AWDA 2WXGA 1PGBA 1EWCA 1YJIA 5BYSA 5AUIA 1FMAD 3IAM1 3TEWA 1JCKB 1V1OA 2RDGA 5I4DA 1OFFA 1JWBD 1YN3A 1VJKA 4KGTA 3P4QB 1PUTA 1N61A 3R8BA 3AE1B 1RYJA 4XWWA 1VDVA 2LEKA 1D5XC 3AE7B 1E7PB 1OQQA 1AN8A 1QOFA 1TZOA 2PLPA 3IAS1 2OEDA 3NUHB 3U7ZA 1WYGA 2W3RA 3NVYA 2XNAC 1UNSA 3AM9A 5G5GA 2EELA 1ZXIA 1EU3A 5FKAC 3FILA 2RMMA 1RM6C 2PVOD 3AEBB 1VZ8A 1STEA 2KWDA 3PZ7A 1ZP0B 4XDDA 1XCTL 2ZW0A 2BS2B 1UUPA 2GRIA 3BK1A 1ZXHA 2K9XA 3NVVA 3AE2B 2H88B 1NVID 3LYYA 5D7GA 3ZQ4A 2LHEA 2RDHA 4JWUC 4YWGG 1MHHE 3TEXA 4KGRA 1ET9A 3Q69A 4MM3B 3CWIA 4NJCA 5BMHA 5C2TB 2MJEA 1L4ZB 1KRHA 2WXFA 3KLSX 2FE8A 2N9KA 1TS3A 3BZDB 3ETRA 2NTTA 3VR9B 1TYGB 2L52A 3FILB 1JRPA 1I4GA 4HROA 4YXDB 5FK9C 2WXHA 2JWUA 3AECB 1I7HA 3HUIA 4DXFA 2DLBA 4YTNB 2PTLA 2ZW1A 2IGDA 3B2GA 3H8HA 3VQIA 1N5WA 5GXGB 5FR3A 2PKOA 2CJNA 1AYFA 3P4RB 4RH6A 5D3IB 1PYWD 3T3NA 4A6QA 3NS1A 1QF6A 5BMGA 1FO4A 4KGSA 3IT4B 1XXGA 3AH7A 4Q2JA 5HHDG 1J7CA 2QILA 4R3DA 1C76A 4WAFA 3R2IA 3AE5B 4JPSA 1F0ZA 1XO3A 2PVGC 2SAKA 1DOXA 3V3XA 4YSYB 3HVZA 1SE4A 1ET6A 4US8A 1YJJA 1V1PA 1E0ZA 2K22A 2BW2A 1JROA 3AE3B 3VRBB 2Y5CA 3AMZA 2WXJA 3Q8BA 1B9RA 3UI3A 3E56A 2WDRB 3AE9B 2LHDA 4ZHOA 3BWUD 4LLGM 2JX5A 2JU6X 3P4SB 2INPE 1JW9D 4GLSC 4RGNA 1NYRA 1EM7A 1D6EC 2R61A 4OHJA 5TSSA 1HQRD 4A55A 3W9CB 3SR6A 1C4PA 1WGKA 1YMHE 3ZJVA 4ARCA 4YSZB 1DGJA 1IGCA 2I38A 2IGHA 4HKQA 2W54A 1VZ7A 1Y56A 2B76B 1TS5A 3AE6B 1ZUD2 4P16A 1V1PB 4ZRQA 2KAJA 3BIID 4NZLB 1VR9A 1GB4A 1C77A 1E10A 1UGJA 1QILA 3DWMA 4GDLB 2M19A 3ZYYX 4WWMA 1FNUA 4YTMB 1SE3A 1T3QA 3MFGA 1CZPA 1I4QA 4IDIA 1FXIA 1QLBB 4L1BA 5E6JA 1FFVA 2WU2B 1V8CA 3FC4A 1KLUD 3W5UB 1YN4A 3WCQA 1R7SA 4ZOHC 3MC0B 1C79A 2SEBD 2WQYB 1JWMD 4IKGA 1QOBA 2M56B 3AV8A 2NMQA 1SF0A 3P63A 4EE2A 5MPOA 3AE4B 3AE8B 2BB5A 4MT5A 1A70A 1MHXA 2YEPF 2Y3AA 2V3PA 2AQ3B 1K50A 1CK1A 2WS3B 1L0VB 1SEBD 1I4RA 2V4IB 4YT0B 4HEA1 3P42A 5G5HA 1KH0A 1EWYC 4OZAA 1TKYA 5HG2A 2N0SB 1UWXA 2CJOA 2BS4B 2K3UA 4A8XC 2IGGA 5HFYA 3EGRA 2E3TA 1ESFA 2AX5A 4AQ7A 1C9FA 4LK0M 1L0YB 2DWQA 3PO0A 3W1SA 2LUMA 4N6EB 2WXKA 3HRDD 4XDCA 1E9MA 1TS2A 2DYMA 2L32A 5T8IA 1FCCC 1DOIA 5JXVA 1FFUA 5EE1A 4ITKA 2Y5PA 1EU4A 1XF5L 2AQ1B 3BYTB 1SXTA 1L4DB 1RFKA 2M0AA 4N59A 1XLQA 4DQOC 4RGMA 2CU3A 5LNK1 1CQVA 4HKZE 3LB8C 1N63A 1PGAA 3AEGB 1D5ZC 2GI9A 2WXRA 1FD6A 1XCQL 2BYTA 1GPXA 3URYA 4JX1C 3KWVA 4YTPB 2FUG1 4HJGE 3MJ5A 2AQ2B 4TQ1A 1OQRA 2ICIA 3GB1A 1DYQA 1K52A 5C3JB 3P1MA 2RPVA 2KACA 2BB6A 4HRSA 4GDKB 1ENFA 4RGTA 1IUEA 1J7AA 4US9A 1HZ6A 2W55A 4DXGA 2W3SA 3NVWA 3LXFA 4L2YA 1FCLA 1VRAB 4A90A 1KFYB 1I4XA 4XWTA 1SJED 3DWGC 2J4XA 3CIRB 4YSXB 1F2RI 3J9CA 5H8YE 2WXOA 1JALA 5HI1A 4C56C 2I2YA 1FNVA 1FRDA 4RNAA 4KX6B 2WDQB 5H92C 1ROEA 2K0PA 1FEHA 1NENB 4WURA 1XLOA 1L6UA 1XLNA 2KDMA 4KKJA 3RPFC 2WDVB 2BS3B 3HVDA 1Q10A 1J7BA 4ZYSA 1F2RC 3TEZA 2WXQA 4UDUC 1D5MC 3SFEB 1C78A 2WP9B 1SSNA 4ZHPA 2DYOA 5EE3A 4TMAB 3OWEB 2WU5B 2WXMA 4P6VF 1HZ5A 2WNMA 3EUB2 1NEKB 2K5PA 3NZ3A 1E6EB 1K53A 4OW0A 1ZOYB 1ZPSA 4USAA 1ZDVA 2L83A 2NTSA 4NAWB 2YEPB 1KTKA 5EE0A 3Q8AA 1TY0A 3FAHA 2X38A 4OZCA 4RFBA 3BK2A 1WWTA 4ARIA 2QMTA 2TSSA 4FXCA 2WXPA 3AB5A 1SJHD 3AEEB 4M0WA 2LJIA 1I4HA 2QSDA 4H2AA 2QIEB 1YQ3B 3AN1A 3BVMA 2PW9A 4JWSC 3IT6B 3Q8CA 3BVGA 3N9YC 2MJ3A 1TS4A 3ABVB 2WXLA 3ZJTA 2V0GA 1NYQA 2FBWB 2IPKD 1IBXA 1RWSA 2Z8LA 4ZRPA 2OHFA 4MACA 1QOGA 3AEDB 3VRAB 3BYYB 1YQ4B 1HEZE 1N60A 1K51A 2LFIA 2W82A 3W2DA 1C4AA 3B9JA 1WRIA 2IDYA 2MJDA 1TY2A 1NI3A 1TKGA 4B0MA 1IGDA 1QQRA 1QKZA 1ACCA 1FXAA 4WIPA 1SIJA 3L4PA 3TSSA 3AEAB 3TEYA 5D3DA 4WH4A 3U2SC 2JSVX 3MHZA 4O1NA 2QJLA 3GP7A 1GAQB 2LGIA 1P7FA 3BVZA 4IOIE 2D5GA 4RGOS 4TQ0A 2XN9C 2QEJC 1HA5A 1XEEA 4RCOA 3SFDB 1C4CA 1MVKA 1IBXB 2INNE 2LMCA 1SBBB 1JMLA 3Q8FA 1JWUD 2MH7A 4PT5A 2JQRB 3TUOA 3E9SA 2KQ4X 3EA6A 1ZDXA 2E6XA 4J3OD 1WSPA 1PDXA 2L1AA 1BXTA 3O13A 1BUIC 1TKEA 1YNTE 2PMVA 1FM0D 3MP9A 5BYQA 3IXSA 2WXNA 3NVZA 1FIQA 1FNWA 1KLGD 1I4PA 4RF0A 4OZBA 2N9LA 2MEKA 2J53A 4LTUA 2WXIA 1VLBA 4C7ZA 2KMMA 2GB1A 1KF6B 3P4PB 5BYRA 3VR8B 4KKIA 3V05A 3SEBA 1JWAD 1L0XB 3C8YA 1QT9A 5EE9A 3R2TA 1ZE3D 3U52E 4B0EA 1HXYD 3ZGZA 4C7YA 1QOAA 1M4VA 1GB1A 4L23A 2PIAA 1P7EA 1MI0A 2BT6A 3GS2A 2JXTA 4XE0A 2ONQA 1JWSD 1DOYA 3ZJUA 4JE3B 1PGXA 1MPEA 1GOZA 1BMLC 2DBYA 1SB3C 4C80A 5BMIA 1SE2A 2IJ0A 1L5PA 3W5VB 1N5XA 1B1ZA 1JQ4A 1T6BX 2G9HD 4WQMA 3PZ8A 2ACZB 3I57A 2G1EA 4AS1A 2VZKB 2EKIA 4OVZA 1L6VA 2J52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWS C;  2N0S B;  2CJO A;  1TJE A;  1N62 A;  1WXQ A;  2BS4 B;  1FO4 A;  1XLP A;  3NRZ A;  1FRR A;  3AH7 A;  2E3T A;  2MJ3 A;  1J7C A;  3ABV B;  4N58 A;  1V97 A;  2AX5 A;  1NYQ A;  3B2F A;  2DWQ A;  2FBW B;  2WLB A;  3AEF B;  3AE5 B;  3PO0 A;  4N6E B;  1RWS A;  4A9A A;  1F0Z A;  3HRD D;  2OHF A;  1E9M A;  1QOG A;  2Q5W D;  1XO3 A;  1DOI A;  2PVG C;  3AED B;  3VRA B;  1YQ4 B;  1FFU A;  4YSY B;  1TKY A;  5EE1 A;  1DOX A;  1N60 A;  4ITK A;  3HVZ A;  3B9J A;  1WRI A;  2MJD A;  2HTM E;  4US8 A;  3KWL A;  1YJJ A;  1RFK A;  1PFD A;  4N59 A;  1NI3 A;  1XLQ A;  1E0Z A;  2K22 A;  1TKG A;  1JRO A;  2H89 B;  3AE3 B;  1CJE A;  2Y5C A;  2CU3 A;  3VRB B;  1FXA A;  3AMZ A;  1B9R A;  1SIJ A;  3L4P A;  1UWM A;  2WDR B;  5AUK A;  3AEA B;  1N63 A;  3AE9 B;  3LB8 C;  1AWD A;  4ZHO A;  3AEG B;  1YJI A;  5AUI A;  1GPX A;  2QJL A;  1FMA D;  2JX5 A;  4JX1 C;  1GAQ B;  4YTP B;  3P4S B;  1JW9 D;  1OFF A;  1JWB D;  1NYR A;  1OQR A;  5C3J B;  1VJK A;  3P1M A;  3SFD B;  4HRS A;  3P4Q B;  1PUT A;  1IUE A;  1J7A A;  1N61 A;  4US9 A;  3W9C B;  2W55 A;  4YSX B;  3SR6 A;  1RYJ A;  3AE1 B;  1WGK A;  2W3S A;  1VDV A;  2LEK A;  3AE7 B;  4YSZ B;  1DGJ A;  2MH7 A;  2JQR B;  3NVW A;  2W54 A;  3LXF A;  1E7P B;  1OQQ A;  1QOF A;  1KFY B;  2B76 B;  3DWG C;  3AE6 B;  1WYG A;  2W3R A;  1PDX A;  1ZUD 2;  3NVY A;  3CIR B;  5H8Y E;  1JAL A;  3AM9 A;  5G5G A;  1TKE A;  2KAJ A;  3BII D;  1ZXI A;  1RM6 C;  2PVO D;  3AEB B;  1FM0 D;  1FRD A;  1E10 A;  3NVZ A;  1FIQ A;  1ZP0 B;  4KX6 B;  2WDQ B;  5H92 C;  2BS2 B;  1ROE A;  1NEN B;  3DWM A;  1XLO A;  1L6U A;  1XLN A;  2M19 A;  3ZYY X;  4WWM A;  4LTU A;  3RPF C;  2WDV B;  2BS3 B;  3NVV A;  2K9X A;  3AE2 B;  4YTM B;  1J7B A;  2H88 B;  1NVI D;  1T3Q A;  1VLB A;  4C7Z A;  1CZP A;  2KMM A;  4IDI A;  1FXI A;  1QLB B;  4JWU C;  1KF6 B;  3P4P B;  3VR8 B;  1FFV A;  1L6V A;  2WU2 B;  3SFE B;  1JWA D;  2WP9 B;  1V8C A;  1QT9 A;  3CWI A;  5EE9 A;  4ZHP A;  5EE3 A;  3FC4 A;  5C2T B;  3W5U B;  2MJE A;  2WU5 B;  1KRH A;  3WCQ A;  1R7S A;  4C7Y A;  4ZOH C;  4P6V F;  1QOA A;  3EUB 2;  3ETR A;  1NEK B;  2K5P A;  2WQY B;  3VR9 B;  1TYG B;  1E6E B;  1ZOY B;  2L52 A;  2PIA A;  4USA A;  1QOB A;  2BT6 A;  2M56 B;  3AV8 A;  1JRP A;  1SF0 A;  2L83 A;  3P63 A;  3AE4 B;  4HRO A;  4YXD B;  5MPO A;  3AE8 B;  1DOY A;  5EE0 A;  1A70 A;  3AEC B;  1I7H A;  3HUI A;  3FAH A;  2DBY A;  1SB3 C;  4C80 A;  4YTN B;  1WWT A;  1YQ3 B;  2WS3 B;  1L5P A;  3W5V B;  1L0V B;  3B2G A;  4FXC A;  1N5X A;  1N5W A;  3AB5 A;  3AEE B;  4YT0 B;  5GXG B;  1JQ4 A;  4WQM A;  2PKO A;  2CJN A;  1AYF A;  2ACZ B;  3P4R B;  2G1E A;  5G5H A;  2EKI A;  1EWY C;  2QIE B;  3AN1 A;  3NS1 A;  1QF6 A; 
#chains in the Genus database with same CATH topology
 2IY0 B;  4IRC A;  2ZJA A;  5JTI A;  4F7Z A;  4FBJ B;  1FRR A;  3O65 B;  3PRE A;  1WUD A;  1S5L U;  2M0X A;  3RFZ B;  2DPJ A;  4N9F 4;  3B2F A;  2BTE A;  7ICU A;  4YMN A;  4FJZ A;  4A9A A;  3VUX A;  5KG6 A;  5ALI A;  4YP3 A;  3H0M B;  5KL8 B;  2KN4 A;  2JZB A;  2Q5W D;  3VHT C;  4D2K A;  1D4B A;  4M9H A;  1NK8 A;  4BWM A;  2R8G A;  2D3G A;  4QJF B;  5IIK A;  4F3O A;  4II3 B;  4OJL A;  1SKS A;  2DUY A;  2HDE A;  2C7M B;  4Q43 A;  2CR5 A;  3DV9 A;  4DQP A;  1PFD A;  1D8L A;  1VZ6 A;  5AK5 A;  2LGY A;  3RH4 A;  1WGY A;  2M4N A;  2C9W B;  4REZ A;  4MEX A;  2JZP A;  4NAM A;  2JYE A;  2HHU A;  3ZO5 B;  5ALV A;  2L0F A;  1IYF A;  1EWC A;  2AL6 A;  2C7N B;  4QWB A;  1YJI A;  2WF5 A;  3QYP A;  4ANV A;  5BYS A;  3QEB Z;  2KWC A;  3TEW A;  1V1O A;  8ICA A;  3GV8 B;  2I1K A;  4ED7 A;  5DBA A;  4CRX A;  1YN3 A;  1VJK A;  2LKY A;  3GZN B;  3P4Q B;  3CW2 C;  3R8B A;  2KFN A;  2DHZ A;  5D94 A;  1RYJ A;  5KT7 A;  5KFA A;  3GDX A;  1VDV A;  1Z19 A;  2BQQ A;  3KHG A;  1E7P B;  1TZO A;  4MFA A;  7ICO A;  9ICJ A;  2PLP A;  5J8Y C;  3ALR A;  3NVY A;  2XNA C;  3MC8 A;  2HVI A;  2QAR A;  1H4R A;  3M8S A;  4QZC A;  1X9S A;  2A19 A;  2HBL A;  1YJ1 A;  9ICR A;  1GC6 A;  3SYZ A;  4JUZ A;  2QDF A;  3RNG C;  4Q8F A;  4PZO A;  4KLH A;  5CA7 A;  4RNO A;  3ISB A;  3Q14 C;  5KFY A;  3PR5 B;  4DWI A;  2XCA A;  2W9B B;  2XGP A;  2RDI A;  1YX6 B;  3ZW3 A;  2K9X A;  3AE2 B;  1VCB A;  1Q46 A;  3BZK A;  1C3T A;  1WJ6 A;  3LYY A;  2N1R A;  5J17 A;  4I2H A;  3A1Q B;  3RB4 A;  1VD2 A;  4WJQ A;  4MM3 B;  3OLM D;  1TT5 B;  5LXH A;  2W8L A;  2KTR A;  2QB0 A;  4DOA A;  4XC2 A;  2RDB C;  1JX4 A;  4CNQ A;  4W9K A;  3VR9 B;  1TYG B;  1ZQU A;  1WE7 A;  5EDS A;  1ZRM A;  2KKP A;  4CCH A;  4GGQ A;  5KFI A;  1EF1 A;  2LAS A;  4CDG A;  4WQO B;  1UEL A;  4I6L B;  4MSQ B;  2HJ8 A;  5FK9 C;  1P0R A;  2FCN A;  2LXC A;  1L8L A;  3ZDC A;  3HUI A;  5DB8 A;  3MHS D;  4DXF A;  3H0R B;  3G6V A;  2NYV A;  2RLT A;  4HCN B;  4FHJ A;  4MF2 A;  1Z00 A;  2ALZ A;  2KFZ A;  9ICF A;  3VTU A;  1SKR A;  5G55 A;  4CF3 A;  5CR0 A;  2HD5 B;  4DQI A;  5AKJ A;  4HXD A;  9ICH A;  3L54 A;  3ENE A;  2Y0S C;  4KGS A;  4PH5 A;  4LJX A;  5HHD G;  4GXJ A;  1L7N A;  3V72 A;  2K6D B;  1XO1 A;  4A3P A;  3A9K A;  1PUZ A;  4IQV A;  7ICT A;  3VCB A;  3PT2 B;  2NCN A;  4TQR A;  1XO3 A;  4WAA A;  1JIH A;  2ZUC A;  2SAK A;  2BHN A;  4YSY B;  3PX6 A;  3QUC A;  4OCZ A;  3TAP A;  3HVZ A;  2G08 A;  1ET6 A;  1E0Z A;  2NPT A;  1TK8 A;  4BKT A;  2BW2 A;  2ZTE A;  2ZCC A;  1KW4 A;  2MSN A;  2WXJ A;  2V4Q A;  2IOF A;  4RQ5 A;  3BWU D;  2UVV A;  3RZW C;  3HJE A;  2ZIU B;  2G0A A;  1KQQ A;  4LNN A;  4JL9 A;  3THV A;  9ICL A;  2RR9 A;  4YD2 A;  4K1R B;  8ICX A;  1SWV A;  2INP E;  4Y2S A;  4GLS C;  4RGN A;  3RBD A;  1P7D A;  2REX A;  1D6E C;  3QU2 A;  2H3F A;  1ZQV A;  2DNF A;  2N7D A;  5KT5 A;  3IN5 A;  1V80 A;  3ZJV A;  5DBB A;  2IGH A;  2I38 A;  4JIO U;  5AI8 A;  1L7Y A;  2B76 B;  2HHS A;  2HHQ A;  2HDO A;  3L3F X;  5J0P A;  1V1P B;  1ZUD 2;  1LXD A;  5HR7 A;  4ZRQ A;  4J9R A;  4BKG A;  4NZL B;  2D8C A;  4BBN F;  2PFO A;  2JF5 A;  3MFI A;  1Q3V A;  2VIX A;  4AWJ A;  1GB4 A;  3PHX B;  4KLU A;  3F2C A;  2XCP A;  4KMU A;  4O5C A;  1XS9 D;  5KFB A;  3DWM A;  4GDL B;  2EKE C;  4QWD A;  2GBJ A;  3U30 A;  4MGZ E;  2A4Z A;  1RAX A;  4FUL A;  5AK3 A;  4YTM B;  2GBN A;  1UHU A;  1T3Q A;  3RJI A;  1CZP A;  1KFS A;  1FXI A;  1SWW A;  4BXO A;  3D2N A;  2BKE A;  2MU2 A;  4ICV A;  3LDZ E;  2KJ8 A;  2ZTD A;  4O5K A;  1R7S A;  4ZOH C;  4M9J A;  3H4B A;  2F1H A;  1SGG A;  4DL3 A;  3QK0 A;  2WTF A;  2JH7 A;  1QOB A;  2NBV B;  3AV8 A;  3SMV A;  1A77 A;  3UM9 A;  4KZC A;  3UF8 A;  3AE8 B;  2BB5 A;  4MT5 A;  2Y3A A;  2WHE A;  2O6V B;  5CEH A;  2KOX A;  3JVZ X;  3DBR I;  3MR3 A;  4I29 A;  2L5Y A;  3DVN U;  3NZS A;  4YT0 B;  1Z4N A;  3TCA A;  3OTQ A;  4WJO A;  2N9E B;  2AQ4 A;  4R8U B;  4RUC A;  1Q3U A;  5G5H A;  4OZA A;  1EWY C;  3PST A;  3C5G A;  2KOB A;  5E6P A;  1M94 A;  2CJO A;  5KHO A;  4M6W A;  2A1J A;  4DFK A;  7ICE A;  1GO3 F;  3NHE B;  3GII A;  1ZQH A;  4AQ7 A;  1C9F A;  2K8B B;  4LK0 M;  1QSS A;  2KHQ A;  2LI6 A;  3PV8 A;  1A6S A;  2LUM A;  4DL4 A;  3W1S A;  1BGX T;  4XDC A;  4PS7 A;  5L1J A;  1UT8 A;  5T8I A;  5JXV A;  5AKE A;  4BWJ A;  1H8C A;  9ICS A;  2Y9U A;  4QZF A;  3KUZ A;  4ECU A;  1EU4 A;  3V6J A;  4W9C A;  3BYT B;  5L83 A;  1RFK A;  2M0A A;  2XK5 A;  3G6Y A;  1XLQ A;  3RNA C;  4M9N A;  5CHG A;  4DSF A;  5HKH A;  5IIL A;  3LB8 C;  1SXE A;  4F93 B;  2AJQ A;  1YD8 U;  2ZVN A;  1ZQF A;  3IG8 A;  4DFP A;  4BDP A;  2M17 A;  3EZ5 A;  4HPM B;  3I5J C;  5ALH A;  1ZQB A;  4KLL A;  1ZQM A;  4P0P B;  9ICI A;  3F5E A;  3ALB A;  1NZP A;  2A1A A;  2DX5 B;  4TUP A;  3QX7 A;  4IWQ A;  4MSM B;  4TQ1 A;  3T8M A;  3QWZ B;  2BB6 A;  5J0W A;  3L08 A;  3AU2 A;  4UBC A;  1P98 A;  5KFU A;  2W55 A;  1R4M I;  2FCQ A;  4DFJ A;  3PSP A;  4L2Y A;  3UMC A;  4CF5 A;  2D3C A;  4XQ8 A;  4PJ0 U;  3UIP B;  4OO1 J;  4A90 A;  2WFA A;  4RQ0 A;  1SJE D;  2NS5 A;  3DWG C;  1V81 A;  3JPP A;  3QUT A;  2J4X A;  3NGD A;  4ECS A;  1F2R I;  2CS4 A;  2WXO A;  3IHP C;  3M63 B;  4EKU A;  1NK7 A;  1KL9 A;  3B1L X;  1FNV A;  1FXT B;  4NAW A;  4GMV A;  5ALR A;  3RNB C;  4MFF A;  2VA8 A;  1NOM A;  1ROE A;  2K0P A;  4RM9 A;  2MP2 A;  1CMX B;  2KD1 A;  3WK9 A;  4GLX A;  2BPG A;  4B9U A;  1XLO A;  4Y2J A;  2BYE A;  2MWS B;  4MJS A;  3PO4 A;  3RPF C;  2WDV B;  2BS3 B;  1RDF A;  4KSK C;  3TEZ A;  4RU9 A;  3BJY A;  3IRU A;  1UA1 A;  3ZLZ A;  3Q2A C;  3SV4 A;  1RYS A;  1D5M C;  1TFR A;  5IIM A;  1ZQL A;  2KTF A;  1WZ3 A;  3Q3J A;  4NQL B;  4XYC A;  4BOZ B;  2DYO A;  3A0B U;  5DG7 A;  2WU5 B;  3JPR A;  1HZ5 A;  4K7U A;  2K5P A;  4OW0 A;  4IUM B;  5ALD A;  1ZPS A;  4DHJ B;  2ESE A;  4BUG A;  2ZIW A;  4CE6 A;  2OWO A;  3BS5 B;  3BDP A;  1KTK A;  1WGH A;  4M00 A;  3ZDE A;  3OHB A;  2KLG A;  4GN1 A;  5E6O A;  5DDM A;  3N7S C;  4K4G A;  4G3I A;  5IKC M;  3BK2 A;  1WWT A;  2QMT A;  1WJN A;  2KQ7 A;  8ICQ A;  2WXP A;  5AKI A;  4FXC A;  3AB5 A;  1SJH D;  1WX9 A;  4TV3 A;  4C0Z A;  5J29 A;  2LJI A;  4TKN A;  3BQ7 A;  4CYE A;  2R2Q A;  3KKA A;  2ZPY A;  4ED8 A;  4H2A A;  5ALS A;  4CO7 A;  2W9M A;  2GH1 A;  5TIS U;  2NBW B;  2BCQ A;  3EFC A;  3NZU A;  3ABV B;  4QNL A;  1TS4 A;  1WX7 A;  2ASJ A;  3ZJT A;  2ZXH A;  4J9M A;  2Z8L A;  1UBQ A;  4ZRP A;  4MAC A;  3L16 A;  1JRU A;  2KK0 A;  5C0Y A;  4B9L A;  2LFI A;  4E74 A;  4NLN A;  1C4A A;  3GE8 C;  4EOY A;  3RZF A;  4NLK A;  3RUI B;  4QWE A;  1NI3 A;  4DSJ A;  4KLE A;  2KJ5 A;  1HTO A;  1IGD A;  1QQR A;  3PLV A;  1S9F A;  4PYZ A;  1BPY A;  1X6I A;  3TEY A;  5D3D A;  3RN9 C;  4F71 A;  3SD5 A;  2KJR A;  4EZ6 A;  2IBI B;  2KSO A;  4EEY A;  1S76 D;  2O6V D;  3PZD A;  1ZQA A;  4DL5 A;  1UZX B;  2LGI A;  2D5G A;  1IXR A;  4RGO S;  4O9M A;  5EWG A;  3H8W A;  2ZJ8 A;  5KT6 A;  3MGH A;  1ZOL A;  2AXT U;  2N4F A;  4EZK A;  4QZB A;  1Z1B A;  1AAR A;  1IBX B;  2INN E;  5KFG A;  2IO0 B;  2FPK A;  3RNC C;  1SBB B;  1S3S G;  1BNO A;  5BPC A;  3ZRC A;  5J2R A;  2J6U A;  2NVU I;  4O0I A;  1SL1 A;  9ICB A;  4BGD A;  2KIC A;  4J3O D;  1U4B A;  1WH3 A;  4XX5 A;  4AP9 A;  3HIZ A;  3O13 A;  2O2V B;  1BPB A;  2GOL A;  2PMV A;  3MP9 A;  1HIW A;  2KYW A;  3ED5 A;  4PGY A;  1PVQ A;  1FIQ A;  3H8M A;  2J0K A;  1FNW A;  2LYH A;  1ZQZ A;  2LM1 A;  1I4P A;  2L8J A;  3IBE A;  2CPR A;  1JMS A;  3ZDB A;  2N9L A;  2MEK A;  2J53 A;  2FCM A;  1WJU A;  2WXI A;  3SZ2 A;  2A3V A;  4C7Z A;  3R9K A;  1NKE A;  5BYR A;  1Q0W B;  3VFK A;  3SEB A;  4F91 B;  1JWA D;  2LYA A;  4PHE A;  4FE3 A;  1OEY J;  3U52 E;  2XGQ A;  1ZD4 A;  4M2Y A;  2ZZP B;  3OG5 A;  4NXZ A;  2HBJ A;  3PY8 A;  1RLF A;  5DG8 A;  5F9L A;  5FP0 A;  3MDA A;  2BT6 A;  3DEE A;  3GS2 A;  2JXT A;  3M9O B;  4GU2 A;  4ELV A;  2CHZ A;  3WIM A;  1JUD A;  3RTV A;  1GOZ A;  2DBY A;  2I1Q A;  4KDL B;  4C80 A;  5AM1 A;  2D07 B;  3VDZ A;  1J2M A;  1L5P A;  2L00 B;  5J8Y A;  1WYW B;  4IRD A;  1Z2M A;  2FCS A;  2K4H A;  2FID A;  2G1E A;  3MDC A;  2EKI A;  4XDD A;  2J52 A;  2WB1 C;  8ICS A;  1LO5 D;  1N62 A;  5AM5 A;  3T3O A;  1F77 A;  2AGQ A;  2N7J A;  2ON8 A;  2H5X A;  4NJ7 A;  4O5E A;  4KDI C;  3RUL A;  3L13 A;  7ICG A;  2ZUB A;  3Q8E A;  1MC8 A;  2Z7J A;  7ICJ A;  3ICX A;  3M95 A;  4ANW A;  4YMO A;  3U4E G;  1AW7 A;  3QCA A;  5KFQ A;  2DZK A;  4DBG A;  4M8N A;  2HTM E;  2KFK A;  1S97 A;  3PMN A;  2D6F C;  3I9V 1;  4DDI D;  3K1R B;  5KFL A;  2CXY A;  4MH8 A;  2H89 B;  2Q0Z X;  5AM2 A;  3RJJ A;  3CF6 E;  2OYY A;  1QH9 A;  3SV3 A;  3H7P B;  4TSS A;  1UWM A;  5AUK A;  4OHJ A;  2GO7 A;  2J42 A;  1AQ6 A;  2LGX A;  4NY0 A;  2YX8 A;  2BQR A;  2LVO A;  3GIK A;  1FMA D;  3IAM 1;  5ALP A;  4M0A A;  4EBE A;  4AOF A;  5J2K A;  1WJ4 A;  4F8R A;  5KFF A;  2V4L A;  5KNI A;  1GNU A;  2Y9T A;  1N61 A;  5EWF A;  1PUT A;  2V3S A;  4KSL C;  2JEG A;  3V7K A;  4KX5 A;  4MHV A;  2VKQ A;  2LEK A;  1V49 A;  2MRL A;  2KO3 A;  2LRW A;  5KFD A;  1OQQ A;  5KFX A;  2MBH A;  1QOF A;  2D3A A;  5ALX A;  3U7Z A;  3QAR A;  2KZR A;  5G5G A;  5CP2 A;  2EEL A;  2KWU B;  1TBE A;  3FIL A;  3ZD9 A;  4HPP A;  3S2A A;  1S0M A;  1V6E A;  4QIW F;  5KTQ A;  2FUH B;  2GOW A;  3WK5 A;  3KZI U;  2UU7 A;  3QNM A;  1XCT L;  4A8E A;  2ZIV A;  2PJH A;  5F9N A;  4FBU A;  2B21 A;  2BF8 B;  2GRI A;  3H8S A;  2ZIX A;  4Y2U A;  3GV5 B;  2F76 X;  4JK1 A;  3RJE A;  1TAM A;  5AM4 A;  5IIJ A;  1XD3 B;  5D7G A;  2ATL A;  3TEX A;  3ZDD A;  4XRH A;  4KGR A;  4U6P A;  3HP6 A;  4NJC A;  4QZI A;  4BKS A;  3RB3 A;  1SE9 A;  5C2T B;  2NO5 A;  2UVW A;  2VH1 A;  4P4P A;  2UYZ B;  2WXF A;  3KLS X;  3NG0 A;  2FE8 A;  3BZD B;  1TS3 A;  1U9L A;  3Q8Q B;  3WKD A;  2NTT A;  3P2B A;  2BWF A;  2QAR B;  3GIJ A;  4QZ8 A;  1X9X A;  1E8W A;  4CHK A;  1RPL A;  2IYD B;  1WXS A;  3BZC A;  4IM3 A;  4B6W A;  3AEC B;  1Z4O A;  2EDU A;  4GIV A;  3BQ0 A;  2DLB A;  3RMK C;  4YTN B;  2PTL A;  3PW5 A;  2AHO B;  1URJ A;  2IGD A;  1XT9 B;  4FHK A;  2KWV B;  5GXG B;  5FR3 A;  4LJP B;  2JHD A;  2PKO A;  2I6X A;  2KZZ A;  1PYW D;  4A3O A;  5ALO A;  4QWC A;  5J0S A;  1QF6 A;  1NBF C;  1IIP A;  2YB4 A;  4EZ9 A;  2KC2 A;  2I5H A;  2W9C A;  2W43 A;  3IT4 B;  4NNJ B;  1XXG A;  5IO9 A;  2QIL A;  3PR4 A;  4UAS A;  4R3D A;  1C76 A;  2KTR B;  4WAF A;  3ZDM C;  2QB0 B;  3R2I A;  3AE5 B;  4EYI B;  2GLS A;  1L7M A;  1DOX A;  4EBD A;  8ICP A;  3UIO B;  4PYU A;  1ISN A;  4UAW A;  4ED6 A;  1QZE A;  4US8 A;  4AYB C;  2LJ5 A;  7ICS A;  5HR6 A;  2N7E A;  1ZRN A;  1JRO A;  3WU2 U;  3AE3 B;  3VRB B;  4JWN A;  3V6H A;  4URK A;  1Z00 B;  1B9R A;  1E90 A;  1CEZ A;  1KTQ A;  4O3O A;  2LHD A;  4ZHO A;  3DBH I;  2AL3 A;  4LLG M;  4WWP A;  2IA6 A;  3J81 j;  3P4S B;  1KN5 A;  1JW9 D;  2FPL A;  1NK6 A;  2NO4 A;  4ZH4 A;  1EM7 A;  3PML A;  3C2K A;  2IMW P;  1RXV A;  9ICQ A;  2QC8 A;  3C23 A;  2JY6 A;  3W9C B;  3K9O B;  1B22 A;  1WG8 A;  1C4P A;  2RSU A;  1D9F A;  4J9O A;  1F5S A;  4HKQ A;  5KFZ A;  1VZ7 A;  2NV3 A;  2WAQ F;  5III A;  2QHO A;  2KZ3 A;  3AE6 B;  2K8A A;  4C8O A;  3CRX A;  1ZW7 A;  3JPO A;  4FBT A;  5DQH A;  2MHJ A;  2NPT B;  3HM6 X;  5EWE A;  3ZUN A;  4RM8 A;  1VR9 A;  3NRW A;  2C2D A;  2CRX A;  1UQV A;  4DSE A;  3QU9 A;  4KVG B;  2YMM A;  4WWO A;  4PHA A;  1J0G A;  1RZT A;  4O3M A;  1L6N A;  3NAS A;  5CWR A;  5J2D A;  3RBE A;  2MUT A;  5DLF A;  3ZYY X;  4LDT D;  1NKB A;  1SE3 A;  5IIN A;  5LXI B;  4IQW A;  2NRW A;  5E6J A;  5J2B A;  3ZI4 A;  3EPG A;  2LRU A;  3TAD C;  1FFV A;  3GZF A;  3RR8 A;  1Q8K A;  5DGA A;  2L3Z A;  1T94 A;  2V9W A;  4P7I A;  2E8M A;  3W5U B;  4S17 A;  3WCQ A;  2HOQ A;  4YQW A;  2SEB D;  1L7P A;  4IKG A;  4ELU A;  4EE2 A;  3M3J A;  1G6J A;  2KQS A;  9ICN A;  9ICE A;  4RQN A;  4DWF A;  4QZE A;  2DKZ A;  2V3P A;  2AQ3 B;  2INC C;  4HLE A;  4LZG A;  4F8C B;  4QZ9 A;  1ZQJ A;  1I4R A;  1WZ0 A;  1WGG A;  4HEA 1;  7ICQ A;  2KK8 A;  4R63 A;  1KH0 A;  4F72 A;  1TKY A;  4RQ1 A;  8ICT A;  3JPS A;  4BXO B;  2N0S B;  1HTQ A;  4I6N B;  2RPQ A;  3RAQ A;  4MEY A;  2WX0 A;  1ESF A;  3MJW A;  4DO9 A;  4I2C A;  4NV0 A;  1L0Y B;  4RQ4 A;  2F8L A;  1TKD A;  4N6E B;  3M9M B;  1XSP A;  2JV3 A;  2KVZ A;  2DYM A;  2JRZ A;  2L32 A;  1FCC C;  1X9W A;  4QW8 A;  1NJY A;  4ITK A;  3RFA A;  4XA5 A;  1SIF A;  4FS1 A;  4K4I A;  1Z3E B;  3RF9 A;  2JPH A;  3V6E B;  4UAZ A;  2VA3 A;  3CP8 A;  4UB5 A;  5AIA A;  3RJK A;  2DZJ A;  5KG3 A;  4P1C C;  4RGM A;  3VXW A;  3VC8 A;  2CU3 A;  3LK9 A;  2ZNV B;  3ZXV A;  3SHQ A;  1CQV A;  2ISO A;  8ICZ A;  2GLE A;  1N63 A;  1PGA A;  3AEG B;  5E79 U;  3PW2 A;  2LVP A;  4NPN A;  2FLL A;  1FD6 A;  2K4E A;  1XCQ L;  3RYT A;  4GIB A;  4P0Q A;  3URY A;  1ZQD A;  4M6W B;  3QE9 Y;  4JX1 C;  2C2R A;  3UQ0 A;  4B6J A;  5DBC A;  1COK A;  3MJ5 A;  2DAJ A;  1TIF A;  1I35 A;  1OXJ A;  1OQR A;  5CB1 A;  3R7Q A;  3GB1 A;  1DYQ A;  1K52 A;  4Y2V A;  2RPV A;  2DQN B;  4EX6 A;  5HP4 A;  1ZQI A;  1ENF A;  1IUE A;  4RGT A;  5KAF U;  2KDB A;  3PW7 A;  2BZF A;  4KLJ A;  1CRX A;  9ICX A;  2D11 A;  2JGA A;  4YG2 A;  3LJ3 A;  4U7C A;  1L7O A;  2BDU A;  2L7R A;  4KLF A;  1KFY B;  4K4H A;  2FLP A;  3CIR B;  1JXE A;  4RPX A;  4RT3 A;  2XK5 B;  3J9C A;  5H8Y E;  3ZNI D;  9ICT A;  2IBK A;  4E3C A;  5HI1 A;  4NQK E;  4LCD E;  1RFA A;  3MR2 A;  2JZ3 B;  3TL5 A;  3M8R A;  2I2Y A;  8ICC A;  4M01 A;  1FRD A;  1SKW A;  1YIW A;  2K4I A;  3VUW A;  3HM3 A;  1FEH A;  4IC9 A;  1L6U A;  1XLN A;  2MBQ A;  1ZQO A;  4F5R A;  3PZP A;  8ICV A;  1WWU A;  3HVD A;  4ZYS A;  1J7B A;  4I2J A;  4GXB A;  4ICA A;  3NUQ A;  5ALF A;  3WKC A;  1CUK A;  2L76 A;  4UDU C;  2CU1 A;  1TGZ B;  4NM1 A;  4UB6 U;  4YD1 A;  2LD9 A;  3SFE B;  1C78 A;  2WP9 B;  5AZG A;  3F2D A;  4BBN C;  4ZHP A;  3DQV A;  3ONS A;  3NS8 A;  3EC8 A;  2WF7 A;  4NJ8 A;  4DSK A;  3OWE B;  4TMA B;  4DHZ B;  4P6V F;  2JEF A;  3EUB 2;  3PO5 A;  5AK4 A;  1NEK B;  3DHG C;  1E6E B;  1K53 A;  1ZOY B;  2BPC A;  4USA A;  5L1L A;  4C00 A;  1HJP A;  4ECQ A;  2OH2 A;  2F3N A;  2NTS A;  4NAW B;  4KTQ A;  2KNB A;  2MA1 A;  4UQG A;  5EE0 A;  1WMH A;  2YEP B;  5CJ7 A;  2MQJ A;  4OZC A;  2MP2 B;  3Q8L A;  9ICK A;  1YQB A;  4R66 A;  4GXI A;  4MJS B;  3WKB A;  4Q45 A;  1KSP A;  2MBO A;  3A9J A;  3APD A;  3PRP B;  3HPO A;  1GC7 A;  4S0R A;  4ACF A;  4Z6C A;  4M0W A;  2KX0 A;  1I4H A;  2QSD A;  2XVT A;  2XY5 A;  2FMP A;  3QU5 A;  2PW9 A;  4JWS C;  8ICK A;  3Q3M C;  4I2A A;  2K6Q A;  3M6K A;  2YVC A;  3H0L B;  3TQ1 A;  4LZD A;  2V0G A;  1N56 A;  2MLB A;  5FR6 A;  1RWS A;  3VH3 B;  2OHF A;  1WM3 A;  5ALJ A;  4RPZ A;  4BZA A;  2JH1 A;  3AED B;  1T8E A;  1YQ4 B;  1HEZ E;  5J2A A;  2UVU A;  2ZIW B;  1N60 A;  1J19 A;  1P1A A;  5H2F U;  4MM3 A;  4GFJ A;  3U7D A;  1ZD5 A;  5HMM A;  3FM9 A;  1SV0 C;  1UGM A;  2R8K A;  2IDY A;  3GZN I;  1LM8 B;  4PS3 A;  3AUL A;  4B0M A;  3IM1 A;  4X5V A;  4B9N A;  4PZN A;  3ZKJ C;  1QKZ A;  1FXA A;  3OGU A;  1SIJ A;  1RQL A;  2HOI A;  8ICW A;  2MW5 A;  1X66 A;  4WH4 A;  1ED1 A;  2F44 A;  2JSV X;  5JZE B;  4M9G A;  5DPR A;  1XQQ A;  2MBE A;  4OJP A;  4B9T A;  4UW9 A;  2LZ6 A;  4ACO A;  2WWZ A;  4NJ6 A;  2XN9 C;  3ONN A;  1KM7 A;  2HBM A;  4AUQ C;  4B9V A;  2QKQ A;  4YVZ A;  2FI1 A;  3QU7 A;  3DBS A;  3SFD B;  3VH4 B;  3QZ7 A;  3GU3 A;  4P1B C;  1JN3 A;  9ICA A;  2LMC A;  2OCE A;  3Q8F A;  3MC9 A;  3PRM B;  2P66 A;  3EA6 A;  1X42 A;  1OW5 A;  5ALY A;  5KFP A;  2J6T A;  4MEM A;  4M47 A;  1PDX A;  5C1Z A;  1BXT A;  3OHA A;  1SV4 A;  3OJ3 A;  3D2Q A;  1F52 A;  2YTU A;  5AHX A;  1J97 A;  3NJT A;  1ZQR A;  4TUR A;  3IXS A;  1UD7 A;  4RQ3 A;  3TI0 A;  4HDQ A;  2PMZ F;  3PSE B;  2UWQ A;  2KP7 A;  5GTH U;  2KSO B;  4IS7 A;  1ZQW A;  4TUS A;  1SGH A;  4OZB A;  2BVC A;  3PRZ A;  4KN4 A;  2WF6 A;  3N7R C;  5DPT A;  1E8Y A;  2AH5 A;  3R66 C;  5AZF A;  1PVP A;  2KE7 A;  5KFK A;  3GOE A;  2E8O A;  1ZQN A;  3Q3F A;  2NRZ A;  3AUO A;  1KF6 B;  3IDW A;  4K3C A;  3VR8 B;  3CMM B;  4ZDV A;  4NLC A;  4UB1 A;  3RH5 A;  1S8O A;  1KDH A;  1TAU A;  5EE9 A;  1D8B A;  1QT9 A;  5KFE A;  4XZ4 A;  2DEN B;  2EMT A;  4BOS C;  1A76 A;  2Y5B B;  3ZXR A;  4B0E A;  2QB1 A;  1HXY D;  3ZNH B;  4C7Y A;  4IR1 A;  4HAI A;  3B0A A;  2BQ3 A;  1M4V A;  2AYO B;  1GB1 A;  5GTI U;  3JYU A;  1NJZ A;  3IHQ B;  2PIA A;  3GIM A;  2BCU A;  3U8Z A;  1DOY A;  2W11 A;  2HW3 A;  4FLH A;  3PVX A;  3ZJU A;  5L1K A;  4W9L A;  3EHV A;  4Q44 A;  5HHI A;  4I2D A;  4KLQ A;  2F1I A;  3TAR A;  4KLO A;  1QSL A;  3SEN A;  1N5X A;  4UAR A;  4HVB A;  5J18 A;  1T6B X;  1V38 A;  3PZ8 A;  5AKY A;  2ACZ B;  3JSV B;  2P6U A;  5J2E A;  4OVZ A;  1L6V A;  3KHH A;  3GQC A;  5ALU A;  1KBU A;  2V1Y A;  1TJE A;  1WXQ A;  1XLP A;  8ICU A;  4I6P A;  4N58 A;  4DSL A;  3KTQ A;  3Q3O C;  2WLB A;  3TFR A;  3QC8 B;  5D6J B;  4QZG A;  5C23 A;  2VZK D;  5IIO A;  2NRX A;  2ZVO A;  2JYT A;  3K75 D;  2FLN A;  1F0M A;  4RQM A;  1CJE A;  2JWZ A;  3ZDT A;  4CQN A;  4F4X A;  2WXG A;  1N48 A;  1ZJM A;  1WFY A;  2LYB A;  4QZH A;  1GG3 A;  2G5I B;  3L10 B;  3GV7 B;  4HYK A;  1LKY A;  1WCL A;  3C5F A;  4Y2X A;  2G4S A;  3C19 A;  2RDG A;  5I4D A;  1MG8 A;  1JWB D;  4OVU A;  3SDL C;  1E7V A;  2E1F A;  3PW0 A;  4M9L A;  4KGT A;  2B3A A;  2HBK A;  7ICL A;  2KN5 A;  8ICL A;  3N30 A;  4O3R A;  3ZNG C;  1D5X C;  3AE7 B;  3DBL B;  1KFT A;  4ZRI A;  3NOB A;  4DL6 A;  1LQB A;  1AN8 A;  2KHW B;  2G06 A;  3PVL A;  5J0X A;  5IN7 A;  3NUH B;  2BQU A;  4NL9 C;  5D46 A;  3UQ2 A;  2KFK B;  1UNS A;  4HK2 A;  3AM9 A;  1TV9 A;  1P3Q U;  2MSE D;  1ZXI A;  2KVS A;  5FKA C;  5KG0 A;  3LVV A;  2BPF A;  1VZ8 A;  4QZD A;  2DAF A;  2KWD A;  4ED1 A;  4DF4 A;  1ZP0 B;  3ECI A;  2ZW0 A;  5LLI A;  1UUP A;  3WKE A;  3H8J A;  3VAW A;  4Y2R A;  4Z6D A;  1QTM A;  1X1M A;  2ZJD A;  3NVV A;  3ZQ4 A;  2Z59 B;  1MHH E;  2P6R A;  1RQN A;  1ET9 A;  5KT3 A;  2W7O A;  4EYH B;  3Q69 A;  3QAQ A;  4DEZ A;  3CWI A;  5T14 A;  1UA0 A;  4P0P A;  2QLT A;  2MJE A;  1L4Z B;  2KIW A;  1V9P A;  3IG3 A;  2RQ5 A;  2N9K A;  2VJ4 A;  5AI6 A;  3ETR A;  3SAG A;  2DZI A;  4DFD A;  5J0Y A;  2IHM A;  1LV5 A;  3FIL B;  1NK9 A;  3OJ4 B;  2FIF A;  3WK7 A;  1I4G A;  4YXD B;  3K4G A;  4YR0 A;  2ZCB A;  2CN1 A;  2ZIV B;  3IVF A;  4UB2 A;  2ZW1 A;  2ZIX B;  2HMX A;  1EUV B;  5HML A;  1QLN A;  3B2G A;  3VQI A;  1N5W A;  2E8N A;  3H6N A;  3APC A;  2CJN A;  5D3I B;  2GWS A;  4A6Q A;  3T79 A;  3NS1 A;  8ICN A;  1TTN A;  1P9D U;  2E8P A;  3E58 A;  3RCZ A;  5BO4 B;  2NRV A;  3ZDA A;  2PE6 B;  3Q8R B;  4ECT A;  1FPY A;  4Q2J A;  3RI7 C;  1H38 A;  2AQ0 A;  1ZQK A;  4WJP A;  1XNS A;  1WGR A;  4JPS A;  4YL8 A;  5KG4 A;  1LGR A;  2G4D B;  2L0T A;  4M02 A;  4HCP B;  3WAP A;  1ZQX A;  5GMV A;  3V3X A;  3VTW A;  3A0H U;  4LNO A;  3TAD A;  2KHV A;  4FJY A;  2Y5C A;  1RYU A;  3T5L A;  5D2M B;  2KX3 A;  3RRH A;  3Q8B A;  4XGA B;  1UBI A;  3E56 A;  3N7P D;  3ETL A;  3PX0 A;  3KOO A;  5KFR A;  1X40 A;  3KVF B;  3N1X C;  3I63 C;  2KEY A;  1R4N I;  4HWI B;  2JX5 A;  3N32 A;  5KG2 A;  3B0Y A;  4TQS A;  3LDA A;  2EZY A;  2W9C B;  3MGI A;  5TZV A;  1ZQQ A;  5AIB A;  4B95 A;  3QEA Z;  5ALL A;  2YQE A;  5TSS A;  1TE2 A;  1IPG A;  3ISD A;  2ASL A;  3L5K A;  3SR6 A;  3H7I A;  5C5J A;  4IQT A;  1WGK A;  1YMH E;  2H3I A;  1IGC A;  5DB7 A;  5J2I A;  2H3Q A;  2W54 A;  4LVS A;  2KMC A;  2YMQ A;  1Y56 A;  2BGW A;  5CHV C;  3KHL A;  1TS5 A;  5ALW A;  4LDT B;  4P16 A;  4F5Q A;  5BOL A;  1U47 A;  2N9X A;  2W03 A;  4YN4 A;  3RNE C;  4ED2 A;  4Z6F A;  3SQI A;  1C77 A;  1X6J A;  4J9Q A;  5J2C A;  2I9G A;  3TAQ A;  1SXD A;  7ICP A;  1SL0 A;  4IL6 U;  1UGJ A;  1WCN A;  2OEH A;  1BPD A;  1T0Q C;  3KUC B;  2PFQ A;  3N28 A;  3AU5 A;  1FNU A;  2MBB B;  4YMM A;  4WJN A;  4DQQ A;  2JZB B;  1I4Q A;  1QLB B;  1X9M A;  1V5T A;  4NLZ A;  2WU2 B;  2EH9 A;  4TUU A;  4UAV A;  2AEH A;  2LGS A;  4GOC A;  2FPM A;  2R8H A;  4QIW C;  2HTH A;  9ICC A;  1YN4 A;  3K1Z A;  4ECW A;  1WI0 A;  3MC0 B;  2PPH A;  8ICJ A;  3CYM A;  4Y2Q A;  4J03 A;  3CSF A;  1K5O A;  1QQ7 A;  2M56 B;  2IO1 B;  3HK0 A;  2NMQ A;  3P63 A;  5MPO A;  2ODG A;  5KFH A;  2JXX A;  2YEP F;  2OOB B;  4UB3 A;  2MX2 A;  4KLD A;  2K60 A;  2AU0 A;  2W7P A;  2EAN A;  1L0V B;  2MUT B;  2KKC A;  1HEK A;  2B6G A;  2BDP A;  1SEB D;  3V6K A;  1WY8 A;  2BPS A;  2KT7 A;  3P42 A;  4KLS A;  5AKX A;  5KG7 A;  3QXG A;  1Z5S B;  2JMG A;  7ICR A;  3OJU A;  4F1S A;  3SU8 X;  3TMP B;  4F5O A;  2IGG A;  5HFY A;  7ICH A;  1U4A A;  3WAM A;  4FN2 A;  3DPD A;  3EGR A;  1BPX A;  4NLB A;  2DWQ A;  4GDK A;  4EZL A;  3HRD D;  2N9P C;  1E9M A;  1TS2 A;  3RH6 A;  1DOI A;  4EEL A;  2DF4 B;  4XUS A;  4O3P A;  1S0V A;  1QQ6 A;  2K8C A;  5ALK A;  3C2M A;  5BOM A;  2KJH B;  2HVH A;  4N59 A;  1TVA A;  2F1J A;  5AKG A;  2RP5 A;  2F8K A;  9ICO A;  3KFU F;  2DZM A;  1E8Z A;  1IV8 A;  9ICU A;  1Y8R C;  3N1Z C;  5CTR C;  4FA6 A;  1TZ1 A;  5LNK 1;  2IO3 B;  4HKZ E;  4DS4 A;  5DPW A;  4ECV A;  2NBU A;  1ZQ1 C;  1O08 A;  2HHV A;  1D5Z C;  2GI9 A;  5E6N A;  3L0W B;  2WXR A;  3KZX A;  4DFM A;  4IG7 B;  2YLM A;  1S10 A;  2LPE A;  4YTP B;  1S0N A;  3WAL A;  2FUG 1;  3FDS A;  3K9P B;  2AQ2 B;  2OJR A;  3GIL A;  5C3J B;  3P1M A;  1PK1 A;  1UF0 A;  5KFS A;  1F44 A;  2G3Q B;  4ECX A;  3E0F A;  1B4F A;  3LYS A;  3NVW A;  3H9D A;  3EEC A;  8ICY A;  3LXF A;  1BPE A;  1VRA B;  3M7D A;  2CKH B;  4BKS D;  1YZ6 A;  2C2E A;  3SI8 A;  4XWT A;  1BPZ A;  5KL1 B;  5DGB A;  1JAL A;  2KFJ A;  4E71 A;  2I1J A;  2ZUD A;  4RNN A;  4HDO A;  1EF5 A;  4JV1 A;  3Q8S B;  3PV1 A;  4RT2 A;  4ICU A;  4A20 A;  4MGI E;  1EO6 A;  4RNA A;  3RJH A;  4JGH B;  3WK8 A;  1RXW A;  1ZQC A;  4KX6 B;  2WDQ B;  4LNF A;  4WUR A;  4RPY A;  3UGB B;  2KDM A;  2V9H A;  1SV0 A;  4JV0 A;  2CHX A;  2XEW A;  4I27 A;  3A9K B;  8ICG A;  3RAX A;  2WAQ C;  2WXQ A;  3H7P A;  2WX1 A;  1V9J A;  2YY6 A;  2PFN A;  2PFP A;  5AM3 A;  5D4B A;  1SSN A;  3DVG X;  5AI9 A;  2GBM A;  5DDY A;  1ZJN A;  2HOF A;  2FAZ A;  4J6I A;  1WX8 A;  3GE3 C;  1XO0 A;  2WNM A;  4FJV B;  4NM2 A;  3Q8M A;  4UB8 U;  1HE8 A;  3NZ3 A;  1XWL A;  3PX4 A;  3I28 A;  1B43 A;  3S6J A;  4UBB A;  4KLT A;  2L83 A;  1NJX A;  2D10 A;  3H7S A;  3L17 A;  3JW0 X;  1C20 A;  4EZJ A;  1TY0 A;  3FAH A;  4C4V A;  3ZD8 A;  1KKX A;  2X38 A;  1JI7 A;  8ICO A;  7ICK A;  4RFB A;  4ARI A;  1WXA A;  4KIT B;  3TBL D;  4AP4 C;  2KC1 A;  1NK0 A;  3BQ2 A;  3AEE B;  3SEI A;  4ELT A;  3ZVV A;  2QIE B;  2ZG6 A;  3AN1 A;  3BVM A;  4P4O A;  2XBB C;  2Z0D B;  1D3Z A;  2PI5 A;  2VH2 A;  1ZQG A;  4DQR A;  4F50 A;  1N6Z A;  3MBY A;  3MGV A;  4GXK A;  4EBC A;  2WXL A;  4KIK A;  2L05 A;  1BNP A;  2FBW B;  3BQ1 A;  2IPK D;  3HIL A;  3A4R A;  2E1E A;  2JXJ A;  2KV2 A;  3B0X A;  3EW9 A;  4O3Q A;  3RB6 A;  4DK5 A;  5ALT A;  1J2N A;  3DBR B;  2RRD A;  3VRA B;  3H1U A;  4I2I A;  4PPX A;  1A5R A;  1WMH B;  4JB3 A;  2G09 A;  2D2Q A;  1T7P A;  1TY2 A;  1TKG A;  5F3X B;  3UPQ A;  3T5H A;  4WIP A;  3A9J B;  2O6K A;  1NJW A;  3AEA B;  4M0W B;  1EXN A;  2KLC A;  5L1M A;  3U2S C;  2NR2 A;  4G50 A;  1IM4 A;  3LWL A;  3MHZ A;  5CHW A;  4F4Y A;  8ICM A;  2QJL A;  4HJK A;  1P7F A;  5J0U A;  4IOI E;  2CHW A;  5G2N A;  4TQ0 A;  2QEJ C;  4HPL B;  1HA5 A;  4RCO A;  3VUY A;  3AQF A;  2ISP A;  4UB4 A;  3D6J A;  1MVK A;  5JUM A;  3SAF A;  4DDG D;  1O03 A;  1XC9 A;  2IND C;  2EQY A;  4UAT A;  1DXS A;  1JML A;  2DFL A;  1HUZ A;  1JWU D;  2MH7 A;  4PT5 A;  2JQR B;  5AEK B;  3E9S A;  2KQ4 X;  3JPQ A;  2DYB A;  2E6X A;  4MDK E;  1ZYQ A;  1TKE A;  2KAN A;  2UVR A;  9ICG A;  3QZ8 A;  5BYQ A;  5J0T A;  3I76 A;  3BS7 A;  1MA7 A;  1NNL A;  1S0O A;  2A1J B;  4Q8E A;  4RF0 A;  3QA8 A;  2DL0 A;  3V6C B;  4JMU A;  1R4M B;  5DLG A;  2FMQ A;  3AEV A;  2R2O A;  5AI0 A;  4QZA A;  4RQ8 A;  1RYR A;  4LTU A;  5IP4 D;  1ZQY A;  2NRT A;  4II2 B;  3HWT A;  1VLB A;  2KN7 A;  3APF A;  2JT4 B;  2C60 A;  2D3D A;  2IHN A;  1GUA B;  2DGZ A;  1L0X B;  2ZJ5 A;  3BY4 B;  4F2R A;  3DDH A;  3C29 A;  3PTF C;  1WGD A;  3D32 A;  3ZTC A;  3GFK B;  1ZE3 D;  3R7R A;  3PS6 A;  4R65 A;  4YR2 A;  3WKA A;  2KTQ A;  4DOB A;  1QOA A;  2KMD A;  2J0M A;  2Y1I A;  4W9E A;  4DXA B;  2JVC A;  1OEY A;  2Y0S F;  1P7E A;  1MI0 A;  4XE0 A;  4DOC A;  4NWI A;  5B5E U;  1JWS D;  2ONQ A;  4G11 A;  1PGX A;  4RQ2 A;  4J9N A;  3M9N B;  2ES6 A;  1SB3 C;  2VRR B;  4KV2 A;  3ZTD A;  5BMI A;  3LVW A;  1KLN A;  1SE2 A;  5KFN A;  5ALG A;  2IJ0 A;  3W5V B;  2KDI A;  3DHI C;  2LWP A;  1B1Z A;  4G9B A;  4NL9 A;  2G9H D;  4WQM A;  4EEW A;  2MCN B;  4AS1 A;  4FZL A;  2VZK B;  4ANU A;  2WF9 A;  4ZYN A;  4UAY A;  2YB1 A;  3NRZ A;  3DCG A;  3C0R B;  1V97 A;  3F2B A;  5J2F A;  3TAN A;  4IM0 A;  2V4R A;  2EAO A;  3AEF B;  1ZQT A;  2BBC A;  4F4Z A;  1YN5 A;  4MFC A;  3AU4 A;  4BJQ A;  4B9S A;  4B9M A;  1OQY A;  4MGY E;  4PL2 A;  3HX0 A;  3KQ4 A;  1ZGU B;  4IWP A;  2H3V A;  1L8O A;  1ECW A;  2V3N A;  3DVG Y;  3JPT A;  3KWL A;  4RF1 A;  4FAD A;  3JPN A;  1T5X D;  5ALQ A;  3Q6B A;  2LHT A;  2LXA A;  1NZB A;  2KD0 A;  3UQA A;  4C4S A;  4DS5 A;  4F4W A;  2FNJ B;  1K8R B;  2FDR A;  1KFD A;  1QCK A;  1AWD A;  1PGB A;  1WE6 A;  3M1Y A;  4JLC A;  1NKC A;  4QWA A;  1Y88 A;  1XU4 A;  3IP4 B;  5AUI A;  2W9B A;  3OSP A;  1JCK B;  4KLG A;  1Q1O A;  1SL2 A;  1TK0 A;  2BCR A;  2IY1 B;  2QCZ A;  1OFF A;  3OPX A;  1COO A;  2XID A;  2A5U A;  4GC6 A;  1BT0 A;  3WK4 A;  2ZTC A;  4CGZ A;  4CF4 A;  4R64 A;  3A1Q A;  3PNC A;  3LWM A;  3X23 A;  1T3N A;  4LJO B;  8ICR A;  3AE1 B;  3AU6 A;  4XWW A;  2E5S A;  4RNM A;  2YML A;  8ICE A;  3PPA A;  5CX3 A;  1S77 D;  3VVW B;  1WIA A;  1L3T A;  2J7Q B;  3IAS 1;  2OED A;  4K3B A;  5AI5 A;  5L9X A;  4I2B A;  1WYG A;  2W3R A;  2FMS A;  1GJZ A;  1UPH A;  3PGE A;  1MQ3 A;  7ICF A;  2KMA A;  1EU3 A;  4J9S A;  2RMM A;  1RM6 C;  3ORY A;  1FEZ A;  2PVO D;  3AEB B;  5AZH A;  4PL1 A;  1D8Y A;  2VAN A;  1STE A;  3PZ7 A;  4DCC A;  2AWT A;  2WDT B;  2R18 A;  4K81 A;  2BS2 B;  2GBK A;  4J9P A;  3BK1 A;  1LKY B;  4IW0 A;  5EOZ A;  1T0Y A;  1WXV A;  4PHP A;  4DL2 A;  1ZXH A;  3WA0 A;  3EWA A;  1L3S A;  2YMP A;  2PXI A;  3ML8 A;  3VTV A;  2H88 B;  1NVI D;  4YR3 A;  2LHE A;  2RDH A;  4JWU C;  4YWG G;  5KFC A;  2G07 A;  2BCV A;  1PQS A;  3I1Y A;  5AKH A;  3RNF C;  5BMH A;  3OSN A;  1BVS A;  5ALE A;  4FO6 A;  1KRH A;  2JEI A;  4F92 B;  1KLV A;  2PMZ C;  4IR9 A;  5D49 A;  4RZR A;  4P2H A;  2L52 A;  1MQ2 A;  2M0N A;  3QQ8 B;  1JRP A;  4HRO A;  2IO2 B;  2J6S A;  5DG9 A;  1RRB A;  4X57 B;  5L1I A;  2WXH A;  2JWU A;  5KHQ A;  1I7H A;  3UXN A;  3W1Y A;  3V7L A;  5KAI U;  1UH6 A;  3N1Y C;  2W04 A;  2G45 B;  3MC1 A;  3HKZ C;  3H8H A;  4LNK A;  3Q8K A;  1AYF A;  3P4R B;  4RH6 A;  4PS8 A;  3T3N A;  3KHR A;  1NK4 A;  3M6Z A;  2ZIU A;  3HKZ F;  2JZZ A;  5BMG A;  4DQS A;  2M9N A;  1ZD2 P;  3O0F A;  3V60 A;  1FO4 A;  3RJG A;  3N20 C;  2Y1J A;  5KFM A;  5ALM A;  3AH7 A;  4PK1 A;  3ZRF A;  1J7C A;  2OXO A;  1TK5 A;  3N4M B;  1DK3 A;  2VA2 A;  5KFV A;  4QW9 A;  7ICI A;  1F0Z A;  3FYH A;  3UXP A;  1MN8 A;  3AQE A;  2LBO A;  4ECR A;  8ICF A;  4W9H A;  2R8I A;  1T0R C;  4W9G A;  3H4D A;  2PVG C;  1FCL A;  1PZN A;  3RB0 A;  3U26 A;  1V5O A;  3TKA A;  2W9A A;  4ECY A;  1SE4 A;  3PSF A;  1YJJ A;  4KZ0 A;  1C1Y B;  1V1P A;  2JR5 A;  4YFK A;  2K22 A;  5KFJ A;  3I3T B;  3UQB A;  2BR0 A;  3AMZ A;  3T3F A;  3UI3 A;  1R4N B;  2WDR B;  2KVR A;  2LUE A;  1MFW A;  3AE9 B;  5J2J A;  2D3B A;  1U49 A;  2R8J A;  4MEL A;  3ISC A;  4GDL A;  2JUO A;  3ZIM A;  8ICI A;  2JU6 X;  5A0L A;  4RQ6 A;  3M62 B;  1I42 A;  1ZKH A;  2HE7 A;  1NYR A;  3AI5 A;  3AL0 B;  2R61 A;  2DKX A;  4M04 A;  4KLM A;  1E8X A;  2ZEQ A;  3A33 B;  3PW4 A;  9ICP A;  1C7Y A;  4BX9 C;  1HQR D;  3TIX A;  4A55 A;  1Z1V A;  2BGF A;  2IOF K;  4O3S A;  4W9J A;  1K1S A;  1VJ5 A;  4ARC A;  4YSZ B;  1DGJ A;  3C21 A;  4EEN A;  1OTR B;  1OGW A;  4YCX A;  3G6X A;  1LFD A;  2EAM A;  2WGS A;  2EZZ A;  3NY5 A;  2KAJ A;  3BQT A;  3BII D;  1N2X A;  3OAW A;  4KLI A;  2HHW A;  3DDC B;  1E10 A;  2RHF A;  4KMO B;  4PHD A;  1KOT A;  4MH0 E;  1DGS A;  2O6V A;  1QIL A;  4WJ3 B;  4K7W A;  2W9N A;  3V62 A;  2M19 A;  2WYQ A;  4WWM A;  4GSW A;  3KUD B;  3A4S C;  4R8U A;  4EFO A;  3MFG A;  4IDI A;  4L1B A;  1DOQ A;  3ZNZ B;  2B0C A;  4UAU A;  3H40 A;  4DHZ E;  1HUO A;  1WR6 E;  2Q4T A;  1V8C A;  2BKF A;  2BYF A;  3FC4 A;  3AXC A;  4EEK A;  4JV2 A;  3EPI A;  1KLU D;  2K8B A;  3PHW B;  5JHA A;  4IM2 A;  1XSN A;  1C79 A;  2RD0 A;  4W9D A;  3D2S A;  2WQY B;  1WF9 A;  2K25 A;  3RR7 A;  1JWM D;  5DB9 A;  3MR6 A;  4JWM A;  1X2I A;  3DOW A;  3HHM A;  1SF0 A;  3AE4 B;  2F2A B;  1JXL A;  2XI9 A;  1A70 A;  1MHX A;  4GB9 A;  3V7J A;  4J9L A;  1K50 A;  4QAY A;  1B0X A;  5DQG A;  1CK1 A;  2WS3 B;  3KYC D;  3WAO A;  5JH5 C;  3TAC B;  9ICV A;  2OJW A;  3V61 A;  2DPI A;  2V4I B;  3FKY A;  1F1H A;  1A0P A;  5DB6 A;  1V85 A;  5HG2 A;  1E5W A;  1UWX A;  2BS4 B;  2K3U A;  4OVV A;  4OJO A;  4A8X C;  4DF8 A;  1TAQ A;  2G5H B;  2E3T A;  5KG1 A;  1WRD B;  2XIC A;  8ICB A;  2HHT A;  2AX5 A;  5DKW A;  2C7H A;  2RDJ A;  3ML9 A;  1F9J A;  1DRG A;  3PO0 A;  2WXK A;  3NTU A;  2LM4 A;  5KG5 A;  4F5P A;  3CST A;  2IZV B;  1FFU A;  5EE1 A;  4NY8 A;  1ZQE A;  3MR5 A;  2Y5P A;  1XF5 L;  4KN7 A;  5K4L A;  2AQ1 B;  4E0D A;  1SXT A;  1IP9 A;  1L4D B;  2EAP A;  4ED0 A;  1QSY A;  2MRP A;  4DQO C;  1UT5 A;  3QUQ A;  3WAN A;  4IQU A;  1L3U A;  4F4K A;  1MG4 A;  5CHF A;  5HHH A;  4I2G A;  9ICW A;  5J2H A;  3C1Y A;  1MSW D;  3DHH C;  3TFS A;  3KW5 B;  2BYV E;  2BYT A;  1GPX A;  3KWV A;  2KG5 A;  3C28 A;  2KKV A;  1ZQP A;  4HJG E;  4MGK E;  2EZX A;  2ICI A;  4M8M A;  3N97 B;  3T5K A;  4C8N A;  2KAC A;  2VJ5 A;  4HRS A;  3QJZ A;  4GDK B;  1J7A A;  4US9 A;  2C22 A;  1HZ6 A;  2KJ6 A;  3JSV A;  3MTN B;  4ANX A;  1YOV B;  1ZD3 A;  3BIN A;  3MAB A;  2W3S A;  4W9F A;  4DXG A;  2LVQ A;  2ZNV C;  2JRH A;  1I4X A;  3DBH B;  2K8C B;  5AM0 A;  2M8S A;  1IG6 A;  4G3X B;  4YSX B;  3QHT A;  3TJP A;  4AJY B;  2ZXI A;  2HCF A;  2KDE B;  4ECZ A;  3B08 A;  4C56 C;  4RQ7 A;  4IWO A;  5L95 C;  1LVH A;  5HNK A;  3BS5 A;  4FS2 A;  7ICN A;  2PE9 A;  4Y2P A;  1Q5W B;  5B66 U;  2EMS A;  5H92 C;  1NK5 A;  1NEN B;  4ASW C;  5IA7 A;  3DVN V;  3W1S C;  2H3Z A;  4F5N A;  1RG6 A;  4KKJ A;  2XC9 A;  3SAH A;  1Q10 A;  1F2R C;  2MA9 B;  4J9K A;  1PK1 B;  2X8X X;  4P4M A;  9ICM A;  1LB2 B;  1SZP A;  2C5L C;  2N1V A;  4I2E A;  1T4G A;  3T9L A;  5EE3 A;  1L2N A;  5KT2 A;  5DPS A;  4EX7 A;  4TUQ A;  4F2S A;  2WXM A;  2ASD A;  4Y2Y A;  2GBR A;  3F5A A;  2WB1 F;  3KD3 A;  3UXO A;  2W8K A;  4NLG A;  2HJ1 A;  5AKK A;  5J2G A;  1NI2 A;  1WXM A;  2AGO A;  1ZDV A;  4PGX A;  5CRX A;  3Q8A A;  4LNI A;  1UCV A;  3UMG A;  7ICV A;  2BCS A;  4YXJ A;  4C8K A;  2TSS A;  3X0W A;  2N1W A;  1XSL A;  3RD2 A;  4C8M A;  2LGD A;  1WR1 A;  3EYZ A;  4DHJ D;  1J8C A;  2K1F A;  1YQ3 B;  4EUT A;  2LMR A;  2AGP A;  3IT6 B;  4RUA A;  3Q8C A;  1SZH A;  4DLE A;  3BVG A;  2HI0 A;  3N9Y C;  2PKE A;  4C4R A;  2MJ3 A;  2M1M A;  5JHB A;  1NYQ A;  4DLG A;  2HHX A;  2KJ9 A;  3QUB A;  4ED3 A;  2LI5 A;  4FZN A;  1IBX A;  2KDF B;  1NDD A;  4IC7 B;  1QOG A;  3N3K B;  4Y2T A;  4MF8 A;  4I28 A;  3BYY B;  3CNH A;  3C1Z A;  1KRP A;  1MJD A;  1K51 A;  2W82 A;  3W2D A;  4G0N B;  3B9J A;  1WRI A;  2KNJ A;  4IRK A;  2MJD A;  5AKL A;  3PSI A;  3R3M A;  4C4V B;  1M6Y A;  2K39 A;  2O2V A;  3T5J A;  2ZPN A;  3DBL I;  4DSI A;  1ACC A;  3KBB A;  2YN4 A;  3IG5 A;  3L4P A;  4PGQ A;  4W9I A;  3TSS A;  1DK2 A;  4YXM A;  7ICM A;  5AK6 A;  1WM2 A;  1PVR A;  1ZQS A;  1KEJ A;  1OUQ A;  2K8H A;  4O1N A;  1K1Q A;  4RMA A;  1T0S C;  3GP7 A;  1GAQ B;  3BVZ A;  2XY7 A;  3IFW B;  2RGF A;  1V2Y A;  4BFR A;  1WWV A;  4I2F A;  3QU4 A;  3C2L A;  2KZM A;  1XEE A;  5KT4 A;  4KIK B;  3WK6 A;  5IAA C;  4C8L A;  1C4C A;  5JRT A;  5AKZ A;  3UIN B;  3EFU A;  3Q3N C;  4K7S A;  1KJT A;  3TUO A;  4KX3 A;  3MFH A;  4AJW A;  4BVU C;  1ZDX A;  2IOH A;  2ASQ A;  2WHI A;  2OM6 A;  5J0Q A;  2HSZ A;  1WSP A;  2BKR B;  2L1A A;  1BUI C;  5IOI A;  3RRG A;  4ZRJ A;  3KKA C;  2KVC A;  2P35 A;  1YNT E;  5DQI A;  1FM0 D;  3PLU A;  5ALN A;  2Z0E B;  5TR5 A;  2FJ6 A;  2XY6 A;  1U45 A;  2WXN A;  3NVZ A;  1L3V A;  5J0R A;  1KLG D;  2PEA A;  2F77 X;  2XO7 A;  5KFT A;  3QIJ A;  1ARO P;  4O3N A;  3UMB A;  4GC7 A;  2PI4 A;  1D9D A;  3F53 A;  1U48 A;  4B9K A;  3SD7 A;  1YZ7 A;  4WWN A;  2KMM A;  4ZRK A;  2GB1 A;  2K89 A;  4DL7 A;  3Q8P B;  3P4P B;  2J0J A;  2MAX A;  3RJF A;  4JQW C;  4KKI A;  3V05 A;  3HW8 A;  1L5U A;  3E2E A;  2KIV A;  3C8Y A;  4FFD A;  3R2T A;  1PK3 A;  5KFW A;  1QQ5 A;  1V86 A;  2BWE S;  2GMI C;  4BAX A;  4C4T A;  2JEJ A;  3ZGZ A;  2WF8 A;  5J0O A;  5ALZ A;  1YX5 B;  4FZM A;  3QX1 A;  3HT3 A;  4OD0 A;  4OJ6 A;  4L23 A;  5DCN A;  1YT3 A;  3KYD D;  1E7U A;  2KXJ A;  4JE3 B;  1MPE A;  5AIC A;  3IV6 A;  4P0Q B;  1BML C;  4Z6E A;  4OJ5 A;  1ZET A;  5JU5 A;  1S1Q B;  5AI4 A;  3KH0 A;  8ICH A;  1JQ4 A;  1CI4 A;  2JRI B;  2C28 A;  5KFO A;  2FE9 A;  4AYB F;  3OJS A;  3RT3 B;  2K4P A;  3I57 A; 
#chains in the Genus database with same CATH homology
 1LO5 D;  1N62 A;  1TJE A;  1WXQ A;  3T3O A;  1XLP A;  1F77 A;  3NRZ A;  1FRR A;  2N7J A;  4N58 A;  2ON8 A;  1V97 A;  3RFZ B;  3B2F A;  2BTE A;  2WLB A;  3AEF B;  4A9A A;  2BBC A;  1YN5 A;  2KN4 A;  3Q8E A;  4D2K A;  2Q5W D;  1D4B A;  2VZK D;  3U4E G;  3KQ4 A;  1AW7 A;  2HDE A;  2JYT A;  2V3N A;  2HTM E;  3KWL A;  4RF1 A;  1PFD A;  1T5X D;  3I9V 1;  1VZ6 A;  4MH8 A;  2H89 B;  1CJE A;  4REZ A;  4NAM A;  2JZP A;  4CQN A;  2JYE A;  4TSS A;  1UWM A;  5AUK A;  2J42 A;  1AWD A;  2WXG A;  1PGB A;  1EWC A;  1YJI A;  5BYS A;  5AUI A;  1FMA D;  3IAM 1;  3TEW A;  1JCK B;  1V1O A;  2RDG A;  5I4D A;  1OFF A;  1JWB D;  1YN3 A;  1VJK A;  4KGT A;  3P4Q B;  1PUT A;  1N61 A;  3R8B A;  3AE1 B;  1RYJ A;  4XWW A;  1VDV A;  2LEK A;  1D5X C;  3AE7 B;  1E7P B;  1OQQ A;  1AN8 A;  1QOF A;  1TZO A;  2PLP A;  3IAS 1;  2OED A;  3NUH B;  3U7Z A;  1WYG A;  2W3R A;  3NVY A;  2XNA C;  1UNS A;  3AM9 A;  5G5G A;  2EEL A;  1ZXI A;  1EU3 A;  5FKA C;  3FIL A;  2RMM A;  1RM6 C;  2PVO D;  3AEB B;  1VZ8 A;  1STE A;  2KWD A;  3PZ7 A;  1ZP0 B;  4XDD A;  1XCT L;  2ZW0 A;  2BS2 B;  1UUP A;  2GRI A;  3BK1 A;  1ZXH A;  2K9X A;  3NVV A;  3AE2 B;  2H88 B;  1NVI D;  3LYY A;  5D7G A;  3ZQ4 A;  2LHE A;  2RDH A;  4JWU C;  4YWG G;  1MHH E;  3TEX A;  4KGR A;  1ET9 A;  3Q69 A;  4MM3 B;  3CWI A;  4NJC A;  5BMH A;  5C2T B;  2MJE A;  1L4Z B;  1KRH A;  2WXF A;  3KLS X;  2FE8 A;  2N9K A;  1TS3 A;  3BZD B;  3ETR A;  2NTT A;  3VR9 B;  1TYG B;  2L52 A;  3FIL B;  1JRP A;  1I4G A;  4HRO A;  4YXD B;  5FK9 C;  2WXH A;  2JWU A;  3AEC B;  1I7H A;  3HUI A;  4DXF A;  2DLB A;  4YTN B;  2PTL A;  2ZW1 A;  2IGD A;  3B2G A;  3H8H A;  3VQI A;  1N5W A;  5GXG B;  5FR3 A;  2PKO A;  2CJN A;  1AYF A;  3P4R B;  4RH6 A;  5D3I B;  1PYW D;  3T3N A;  4A6Q A;  3NS1 A;  1QF6 A;  5BMG A;  1FO4 A;  4KGS A;  3IT4 B;  1XXG A;  3AH7 A;  4Q2J A;  5HHD G;  1J7C A;  2QIL A;  4R3D A;  1C76 A;  4WAF A;  3R2I A;  3AE5 B;  4JPS A;  1F0Z A;  1XO3 A;  2PVG C;  2SAK A;  1DOX A;  3V3X A;  4YSY B;  3HVZ A;  1SE4 A;  1ET6 A;  4US8 A;  1YJJ A;  1V1P A;  1E0Z A;  2K22 A;  2BW2 A;  1JRO A;  3AE3 B;  3VRB B;  2Y5C A;  3AMZ A;  2WXJ A;  3Q8B A;  1B9R A;  3UI3 A;  3E56 A;  2WDR B;  3AE9 B;  2LHD A;  4ZHO A;  3BWU D;  4LLG M;  2JX5 A;  2JU6 X;  3P4S B;  2INP E;  1JW9 D;  4GLS C;  4RGN A;  1NYR A;  1EM7 A;  1D6E C;  2R61 A;  4OHJ A;  5TSS A;  1HQR D;  4A55 A;  3W9C B;  3SR6 A;  1C4P A;  1WGK A;  1YMH E;  3ZJV A;  4ARC A;  4YSZ B;  1DGJ A;  1IGC A;  2I38 A;  2IGH A;  4HKQ A;  2W54 A;  1VZ7 A;  1Y56 A;  2B76 B;  1TS5 A;  3AE6 B;  1ZUD 2;  4P16 A;  1V1P B;  4ZRQ A;  2KAJ A;  3BII D;  4NZL B;  1VR9 A;  1GB4 A;  1C77 A;  1E10 A;  1UGJ A;  1QIL A;  3DWM A;  4GDL B;  2M19 A;  3ZYY X;  4WWM A;  1FNU A;  4YTM B;  1SE3 A;  1T3Q A;  3MFG A;  1CZP A;  1I4Q A;  4IDI A;  1FXI A;  1QLB B;  4L1B A;  5E6J A;  1FFV A;  2WU2 B;  1V8C A;  3FC4 A;  1KLU D;  3W5U B;  1YN4 A;  3WCQ A;  1R7S A;  4ZOH C;  3MC0 B;  1C79 A;  2SEB D;  2WQY B;  1JWM D;  4IKG A;  1QOB A;  2M56 B;  3AV8 A;  2NMQ A;  1SF0 A;  3P63 A;  4EE2 A;  5MPO A;  3AE4 B;  3AE8 B;  2BB5 A;  4MT5 A;  1A70 A;  1MHX A;  2YEP F;  2Y3A A;  2V3P A;  2AQ3 B;  1K50 A;  1CK1 A;  2WS3 B;  1L0V B;  1SEB D;  1I4R A;  2V4I B;  4YT0 B;  4HEA 1;  3P42 A;  5G5H A;  1KH0 A;  1EWY C;  4OZA A;  1TKY A;  5HG2 A;  2N0S B;  1UWX A;  2CJO A;  2BS4 B;  2K3U A;  4A8X C;  2IGG A;  5HFY A;  3EGR A;  2E3T A;  1ESF A;  2AX5 A;  4AQ7 A;  1C9F A;  4LK0 M;  1L0Y B;  2DWQ A;  3PO0 A;  3W1S A;  2LUM A;  4N6E B;  2WXK A;  3HRD D;  4XDC A;  1E9M A;  1TS2 A;  2DYM A;  2L32 A;  5T8I A;  1FCC C;  1DOI A;  5JXV A;  1FFU A;  5EE1 A;  4ITK A;  2Y5P A;  1EU4 A;  1XF5 L;  2AQ1 B;  3BYT B;  1SXT A;  1L4D B;  1RFK A;  2M0A A;  4N59 A;  1XLQ A;  4DQO C;  4RGM A;  2CU3 A;  5LNK 1;  1CQV A;  4HKZ E;  3LB8 C;  1N63 A;  1PGA A;  3AEG B;  1D5Z C;  2GI9 A;  2WXR A;  1FD6 A;  1XCQ L;  2BYT A;  1GPX A;  3URY A;  4JX1 C;  3KWV A;  4YTP B;  2FUG 1;  4HJG E;  3MJ5 A;  2AQ2 B;  4TQ1 A;  1OQR A;  2ICI A;  3GB1 A;  1DYQ A;  1K52 A;  5C3J B;  3P1M A;  2RPV A;  2KAC A;  2BB6 A;  4HRS A;  4GDK B;  1ENF A;  4RGT A;  1IUE A;  1J7A A;  4US9 A;  1HZ6 A;  2W55 A;  4DXG A;  2W3S A;  3NVW A;  3LXF A;  4L2Y A;  1FCL A;  1VRA B;  4A90 A;  1KFY B;  1I4X A;  4XWT A;  1SJE D;  3DWG C;  2J4X A;  3CIR B;  4YSX B;  1F2R I;  3J9C A;  5H8Y E;  2WXO A;  1JAL A;  5HI1 A;  4C56 C;  2I2Y A;  1FNV A;  1FRD A;  4RNA A;  4KX6 B;  2WDQ B;  5H92 C;  1ROE A;  2K0P A;  1FEH A;  1NEN B;  4WUR A;  1XLO A;  1L6U A;  1XLN A;  2KDM A;  4KKJ A;  3RPF C;  2WDV B;  2BS3 B;  3HVD A;  1Q10 A;  1J7B A;  4ZYS A;  1F2R C;  3TEZ A;  2WXQ A;  4UDU C;  1D5M C;  3SFE B;  1C78 A;  2WP9 B;  1SSN A;  4ZHP A;  2DYO A;  5EE3 A;  4TMA B;  3OWE B;  2WU5 B;  2WXM A;  4P6V F;  1HZ5 A;  2WNM A;  3EUB 2;  1NEK B;  2K5P A;  3NZ3 A;  1E6E B;  1K53 A;  4OW0 A;  1ZOY B;  1ZPS A;  4USA A;  1ZDV A;  2L83 A;  2NTS A;  4NAW B;  2YEP B;  1KTK A;  5EE0 A;  3Q8A A;  1TY0 A;  3FAH A;  2X38 A;  4OZC A;  4RFB A;  3BK2 A;  1WWT A;  4ARI A;  2QMT A;  2TSS A;  4FXC A;  2WXP A;  3AB5 A;  1SJH D;  3AEE B;  4M0W A;  2LJI A;  1I4H A;  2QSD A;  4H2A A;  2QIE B;  1YQ3 B;  3AN1 A;  3BVM A;  2PW9 A;  4JWS C;  3IT6 B;  3Q8C A;  3BVG A;  3N9Y C;  2MJ3 A;  1TS4 A;  3ABV B;  2WXL A;  3ZJT A;  2V0G A;  1NYQ A;  2FBW B;  2IPK D;  1IBX A;  1RWS A;  2Z8L A;  4ZRP A;  2OHF A;  4MAC A;  1QOG A;  3AED B;  3VRA B;  3BYY B;  1YQ4 B;  1HEZ E;  1N60 A;  1K51 A;  2LFI A;  2W82 A;  3W2D A;  1C4A A;  3B9J A;  1WRI A;  2IDY A;  2MJD A;  1TY2 A;  1NI3 A;  1TKG A;  4B0M A;  1IGD A;  1QQR A;  1QKZ A;  1ACC A;  1FXA A;  4WIP A;  1SIJ A;  3L4P A;  3TSS A;  3AEA B;  3TEY A;  5D3D A;  4WH4 A;  3U2S C;  2JSV X;  3MHZ A;  4O1N A;  2QJL A;  3GP7 A;  1GAQ B;  2LGI A;  1P7F A;  3BVZ A;  4IOI E;  2D5G A;  4RGO S;  4TQ0 A;  2XN9 C;  2QEJ C;  1HA5 A;  1XEE A;  4RCO A;  3SFD B;  1C4C A;  1MVK A;  1IBX B;  2INN E;  2LMC A;  1SBB B;  1JML A;  3Q8F A;  1JWU D;  2MH7 A;  4PT5 A;  2JQR B;  3TUO A;  3E9S A;  2KQ4 X;  3EA6 A;  1ZDX A;  2E6X A;  4J3O D;  1WSP A;  1PDX A;  2L1A A;  1BXT A;  3O13 A;  1BUI C;  1TKE A;  1YNT E;  2PMV A;  1FM0 D;  3MP9 A;  5BYQ A;  3IXS A;  2WXN A;  3NVZ A;  1FIQ A;  1FNW A;  1KLG D;  1I4P A;  4RF0 A;  4OZB A;  2N9L A;  2MEK A;  2J53 A;  4LTU A;  2WXI A;  1VLB A;  4C7Z A;  2KMM A;  2GB1 A;  1KF6 B;  3P4P B;  5BYR A;  3VR8 B;  4KKI A;  3V05 A;  3SEB A;  1JWA D;  1L0X B;  3C8Y A;  1QT9 A;  5EE9 A;  3R2T A;  1ZE3 D;  3U52 E;  4B0E A;  1HXY D;  3ZGZ A;  4C7Y A;  1QOA A;  1M4V A;  1GB1 A;  4L23 A;  2PIA A;  1P7E A;  1MI0 A;  2BT6 A;  3GS2 A;  2JXT A;  4XE0 A;  2ONQ A;  1JWS D;  1DOY A;  3ZJU A;  4JE3 B;  1PGX A;  1MPE A;  1GOZ A;  1BML C;  2DBY A;  1SB3 C;  4C80 A;  5BMI A;  1SE2 A;  2IJ0 A;  1L5P A;  3W5V B;  1N5X A;  1B1Z A;  1JQ4 A;  1T6B X;  2G9H D;  4WQM A;  3PZ8 A;  2ACZ B;  3I57 A;  2G1E A;  4AS1 A;  2VZK B;  2EKI A;  4OVZ A;  1L6V A;  2J52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...