3NRZA

Crystal structure of bovine xanthine oxidase in complex with hypoxanthine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nrzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nrzA01
3AM9A 3AEGB 1GAQB 1TKGA 4YT0B 3AB5A 3AEDB 2N0SB 2Y5CA 3B9JA 1FO4A 1KRHA 4ZOHC 1ZUD2 1F0ZA 4JWUC 3B2FA 3DWMA 2W55A 1ROEA 4JX1C 3P4RB 4ZHPA 3VR8B 3AMZA 1RFKA 1V8CA 1KFYB 1WYGA 3AE7B 3RPFC 5C3JB 1L6UA 1QLBB 2M56B 4YXDB 5G5GA 1OFFA 4YSXB 1DGJA 5EE1A 3SFEB 2KAJA 3AE1B 3NVZA 4KX6B 5AUKA 1WGKA 3P4SB 1J7BA 5G5HA 1RWSA 2AX5A 3BIID 3VR9B 1E9MA 1NI3A 1WWTA 1E7PB 2BS2B 1NYRA 3P4QB 1FMAD 3SR6A 1IUEA 2WS3B 1TYGB 1QT9A 1AYFA 1J7CA 3W5UB 1FM0D 3ABVB 4N6EB 4C7YA 1XLNA 1E0ZA 2K5PA 1N5XA 1JW9D 3ZYYX 1TJEA 3AE9B 1CJEA 2H89B 2FBWB 4WWMA 1QOBA 1JROA 2MJEA 1EWYC 2PVOD 5H8YE 3FAHA 2HTME 3VRBB 3AH7A 1WXQA 4US8A 2CJNA 4ZHOA 3NVWA 1KF6B 3W9CB 4LTUA 2WLBA 1L6VA 1N61A 2K9XA 3AE3B 2BT6A 1NVID 1A70A 1VLBA 2W54A 5C2TB 2WDVB 1OQRA 2LEKA 3AEFB 3P4PB 5GXGB 1RYJA 1VJKA 4YSYB 2WU5B 1TKEA 1NENB 2L52A 3NVYA 2B76B 2K22A 2G1EA 2DBYA 2DWQA 1ZXIA 1L0VB 1JWAD 4YTNB 2BS3B 1JALA 1QOAA 2W3SA 3P63A 1FFVA 1PFDA 3SFDB 2MJDA 1WRIA 4C7ZA 2WDRB 2KMMA 1V97A 1OQQA 1YJIA 2JX5A 2QJLA 3HUIA 4N58A 1RM6C 1SF0A 1ZOYB 3NVVA 4USAA 1B9RA 1YQ4B 1GPXA 4N59A 4WQMA 2WQYB 1NEKB 3L4PA 2L83A 3HRDD 2PVGC 3WCQA 1QOGA 3AEAB 4FXCA 2PIAA 3AV8A 3LXFA 4A9AA 1I7HA 1DOIA 1SIJA 3AE2B 3AE4B 4YSZB 1DOXA 1N5WA 1ZP0B 3CIRB 2JQRB 1JRPA 3AE5B 4YTMB 1FRDA 1PDXA 4C80A 4HRSA 1QOFA 1N62A 1JWBD 5EE9A 1FFUA 3EUB2 3DWGC 3HVZA 5AUIA 5MPOA 2CJOA 3CWIA 3FC4A 1N63A 5H92C 5EE3A 1YJJA 2BS4B 2PKOA 1FRRA 1N60A 3AE6B 2WU2B 4IDIA 2EKIA 2ACZB 3KWLA 1T3QA 4US9A 1SB3C 1NYQA 1XO3A 3NS1A 4ITKA 2WDQB 1QF6A 1TKYA 3NRZA 3AECB 2MJ3A 4YTPB 1PUTA 1YQ3B 1XLPA 1XLOA 3AEEB 3ETRA 1AWDA 1FXAA 5EE0A 2Q5WD 2QIEB 1E6EB 1L5PA 2OHFA 2M19A 1VDVA 3LB8C 2W3RA 3B2GA 1DOYA 1E10A 3AE8B 3W5VB 1FXIA 3P1MA 3AEBB 1CZPA 2CU3A 2MH7A 4JWSC 2E3TA 1UWMA 2H88B 1XLQA 1JQ4A 3PO0A 2WP9B 1J7AA 1R7SA 1FIQA 4HROA 3VRAB 3AN1A 4P6VF
chains in the Genus database with same CATH superfamily
5J2CA 4KLGA 4KDLB 5HHDG 3KYCD 1FPYA 5CHGA 1F0ZA 1KSPA 1C78A 2KXJA 1BPBA 2JF5A 4FE3A 4DQRA 8ICBA 4DS4A 3HWTA 2EAPA 2BCVA 3M7DA 3SQIA 1MG8A 3SAFA 3H0RB 1OFFA 4PGQA 4XA5A 4YSXB 2XNAC 4FN2A 4YD1A 2F1IA 4Q2JA 1G6JA 3JPOA 1M4VA 3BVMA 4XDCA 2ON8A 1TS3A 2X38A 4BWMA 4XUSA 3GZFA 2FLNA 2YMMA 1WZ0A 3SR6A 1Y88A 2BDPA 7ICPA 2HE7A 3N7RC 4GXJA 5AI8A 1PK1B 3VXWA 3W5UB 5AK4A 2JEFA 3R3MA 5AKHA 4DLGA 2RPVA 4N6EB 4HEA1 1EM7A 4BUGA 2WX0A 4Y2RA 4W9LA 4DL7A 3TBLD 4C56C 3UMGA 2WXLA 5IINA 4EUTA 5DCNA 4WURA 4RUCA 1HZ6A 3F53A 4P1BC 3QYPA 4M9GA 1KLVA 4KLFA 3PX6A 1SXTA 2G07A 2KIVA 3RB4A 4IQVA 3C8YA 3WALA 4HROA 3AEFB 3QU4A 4GFJA 2RDJA 4K4GA 4F5NA 4Y2XA 3GOEA 3NVYA 2K22A 1L3VA 1PK1A 3Q8RB 3QCAA 3MR5A 5DGAA 4M9JA 1D5XC 1SE2A 3KFUF 4F4XA 3PRMB 4DDGD 5KFXA 3T79A 1UBIA 4GU2A 2KMMA 4FA6A 1Z2MA 4UB4A 1IG6A 2G5IB 4F93B 5CA7A 3MTNB 2ZJAA 4II2B 2JRIB 4HJGE 1EXNA 2IYDB 8ICMA 1FCCC 3APCA 5A0LA 5KFPA 1VCBA 1D8LA 3T5HA 1ZQAA 4A9AA 5KG3A 4FS1A 1ZE3D 1DOIA 1P98A 1GC7A 1F52A 4PK1A 1WJ4A 1E8ZA 3AE5B 2D5GA 1MA7A 3RZWC 1AQ6A 4DHZE 2QLTA 3RTVA 4KLIA 3HT3A 1N62A 2RSUA 2KIWA 4FBUA 2DZIA 2K3UA 3J81j 4ACFA 1AROP 2ZIVB 1ZQJA 3VDZA 4QAYA 1CUKA 4KSKC 4QIWC 2AQ3B 3R2IA 2K8HA 1FD6A 2ACZB 2M0AA 2JUOA 2E8NA 3QWZB 4B9VA 4MH8A 4XZ4A 3RNGC 4DWFA 5J0YA 3KUZA 3LWMA 1HEZE 2Y5BB 1VDVA 3PTFC 2W3RA 1V80A 2MA9B 4O0IA 4B9NA 3AE8B 4BX9C 3ZDEA 1DOYA 3ISBA 1SJHD 3M62B 4YR2A 3DDHA 1JQ4A 2KMDA 1DK2A 4PHAA 1OW5A 4MH0E 2KQSA 2ZIVA 4YMMA 4GXKA 2K4PA 1WGRA 5KFVA 1R4MB 1ZGUB 1FO4A 4OHJA 5ALYA 4MFAA 1ZUD2 3R2TA 3W1SC 3E9SA 4URKA 2HTHA 1L7OA 2K4IA 4OJPA 1RFKA 1KFYB 3ZUNA 3QX7A 1K1SA 5IIOA 3WU2U 2K4HA 3BZDB 2KO3A 8ICYA 3O0FA 4LNFA 3ALRA 4QZHA 3AU5A 2PFNA 4M8MA 4KKIA 5AUKA 4AJYB 5G5HA 2JH1A 3LDZE 4TUSA 2N9KA 3ZDMC 5KFBA 3N97B 7ICRA 3MC1A 1FMAD 1HZ5A 2L8JA 4AS1A 1T6BX 3Q8MA 3TAQA 3UQBA 2ODGA 3TKAA 3LYSA 2UVVA 3TEXA 3C1YA 3HPOA 4J9OA 4ELUA 1RAXA 2BYFA 3ZYYX 1WM3A 1NK8A 3QARA 4F1SA 2JZZA 5E6OA 4RQ2A 1Z00B 3WKCA 1EWYC 2PVOD 3KYDD 1D9FA 2HHQA 2WXJA 2KX3A 4B9LA 1IPGA 1RRBA 3W1SA 3NVWA 4HLEA 4EX6A 4RQ0A 4KLTA 2EANA 3QUTA 9ICCA 1WXAA 4ZRIA 3WKAA 3RH4A 2H5XA 5BYRA 2W9AA 1JXLA 5ALVA 5KAFU 2BF8B 3P4PB 3NGDA 4B9MA 2PE6B 3GE3C 5HR6A 5E6JA 3KH0A 1XQQA 2ZCCA 3U8ZA 3H4BA 2J0JA 2W82A 2YEPF 1S1QB 2J4XA 2W3SA 3GIKA 4M0WB 3KHHA 1QSSA 4KX5A 3SDLC 1Z00A 2F77X 3WAPA 3RF9A 3Q8QB 1YX6B 1OTRB 2KFKB 3HRDD 1F2RI 4WWOA 1QCKA 4RGTA 1O08A 4ECWA 1QOGA 2J52A 2KWCA 3EZ5A 1F77A 2PIAA 5DDMA 2ZJ5A 5KT2A 3E0FA 5J29A 4IRDA 3N32A 4YL8A 3AE2B 2ZUCA 3CIRB 2KJ9A 3M9NB 2ZJDA 4YXMA 5L1MA 4DQPA 1K8RB 5ALXA 2LZ6A 1S3SG 4AP4C 4REZA 1XO0A 2WF5A 4M0WA 1N63A 9ICBA 2P6RA 4NLGA 3X23A 2HVHA 2F76X 9ICUA 4I2HA 1C79A 1XF5L 3RNCC 2KX0A 5ALWA 5DQHA 3RJHA 2KFKA 1CEZA 1XLOA 4BOZB 1X66A 4KX3A 2LGYA 4I2GA 4K7WA 3OGUA 3TMPB 3PREA 2BKEA 4MF2A 1WGDA 8ICCA 3NG0A 5DB8A 1CZPA 2MA1A 4ZRPA 4C8NA 1I4PA 5HMMA 5LXIB 4D2KA 3AM9A 4I2EA 2F8KA 3W2DA 1BPZA 4M01A 2PW9A 4I29A 5KFJA 1ZQPA 4PS3A 4QWAA 5AM3A 4ZOHC 4X5VA 4W9JA 2YLMA 4ECSA 4N9F4 5IP4D 3TCAA 4GIBA 3PRPB 3VAWA 5J0PA 2HDEA 2WF9A 3ENEA 2CHZA 1L2NA 1V5TA 2FMPA 5KFMA 4F4KA 4A20A 1PK3A 4AYBF 3Q8CA 5J2GA 1V5OA 2KK8A 4JUZA 1KLNA 1L8OA 3V7KA 2WF8A 4A55A 1WWTA 2KLCA 2HI0A 2Z0DB 2A1JB 2KDIA 2W7OA 1SSNA 3VUWA 2LI6A 3VHTC 3LVVA 4WAFA 2BPCA 2K5PA 3I63C 4KLMA 5AEKB 4DHZB 3NUHB 2D10A 3WA0A 1ZOLA 2CJNA 5I4DA 3W9CB 1WGYA 7ICKA 5KFZA 2KE7A 1HA5A 1PQSA 5ALJA 3V6EB 3Q14C 2KHVA 1LVHA 3NTUA 4ECTA 4C8LA 1KQQA 4XE0A 4IQUA 7ICMA 1T0QC 2A1JA 2FMQA 3VFKA 3BQ2A 3PW2A 2PE9A 1QOAA 2AHOB 9ICRA 1YX5B 7ICLA 4Q45A 4R65A 5ALTA 2E8MA 2YY6A 2ESEA 1P7EA 4NQKE 5ALOA 5DLGA 4N58A 2IHMA 1IGDA 1TAMA 1ZQNA 5KFGA 1VZ8A 7ICQA 3Q3NC 2HMXA 2BQUA 2L83A 4HKZE 4XYCA 3WCQA 2Z7JA 1S10A 2C7HA 4ECZA 2NMQA 3MC0B 8ICTA 3MGHA 1ZP0B 4LNKA 1WGGA 2BTEA 2LM4A 4UBBA 4BGDA 1WRDB 2DL0A 2KJ5A 2XCPA 1WXVA 2ZPNA 4IM3A 3TSSA 4BFRA 2WB1C 3RJEA 4W9GA 2ZJ8A 4RQ3A 3ZD9A 1QQRA 4IWOA 4ED2A 5DQIA 4IKGA 1KOTA 2BS4B 5AM5A 3CRXA 2LUMA 4YCXA 2I6XA 1L4ZB 4A8EA 4Y2QA 1RQLA 5K4LA 4IW0A 4MELA 2PLPA 3NRZA 4F71A 3SZ2A 3U30A 5IIMA 1PUTA 4H2AA 1B0XA 4OJOA 5EE0A 4W9FA 2XO7A 3JPSA 1VZ6A 4MGIE 3OJ4B 3JYUA 5GTIU 3ZTCA 4ARIA 4UAZA 2INCC 2V4IB 3ZNGC 2JXTA 3OLMD 1B4FA 2KFNA 3LDAA 5AM2A 2KJHB 4RNAA 3AN1A 1XU4A 2NYVA 1TKGA 3ZNID 1SKSA 1ZPSA 1SWWA 4F4ZA 3CF6E 3I5JC 3TEWA 2KMAA 4JWUC 2QHOA 2A3VA 4O3RA 2ZTCA 3AMZA 3Q3MC 4PL1A 4I2JA 3RNAC 3AE7B 3ED5A 2AYOB 4DSKA 3HKZF 2DZJA 4I2AA 1F1HA 1TE2A 2ZXHA 2PI4A 4QZCA 3VUYA 4EELA 3RH5A 4M9LA 1K1QA 3BJYA 5D94A 4RT2A 4ANUA 5ALGA 4DHJD 4WJOA 2KTFA 4HDOA 2VJ5A 4OO1J 2YN4A 5EWGA 1L7NA 2ZCBA 4G3IA 2W7PA 3N1YC 3PGEA 2LVOA 3SHQA 2JZBB 3Q8LA 1JW9D 3R9KA 4FJYA 2JRZA 1YD8U 5DBCA 4BAXA 4WWMA 3EW9A 1LO5D 4UASA 9ICSA 3AEVA 2ZIWB 2WXPA 4FHKA 5D3IB 1HIWA 2V4LA 4M8NA 3KLSX 4Y2PA 9ICFA 3JPRA 4ECVA 2WTFA 1UPHA 1OXJA 2W54A 4B9SA 2DENB 2IPKD 2UYZB 2HBKA 3RFAA 1S97A 4RNNA 1D3ZA 1JN3A 4YSYB 4LVSA 4CO7A 4P0QA 1V2YA 3ZNHB 4CGZA 4CNQA 3QU9A 4RM8A 4CF4A 1C1YB 8ICJA 1ZW7A 4B9UA 3AUOA 1P1AA 2JZBA 5AI6A 2BKFA 1PFDA 5AKLA 3HW8A 1SZHA 5IILA 2XY6A 1IM4A 5BMGA 1RM6C 2ZIWA 2KHQA 4UAUA 4UB5A 2L0TA 4N59A 4RZRA 3VC8A 4BXOB 1NBFC 4ICVA 3C2KA 1F2RC 5HI1A 3O13A 3RUIB 5J18A 9ICOA 1KW4A 1WCNA 4BWJA 4KZCA 3V6JA 1SZPA 4NAWB 4NY0A 5DPTA 4UATA 1CK1A 2K39A 2KN5A 3DOWA 4FFDA 4FS2A 2BQ3A 2ZPYA 3S2AA 5KFKA 1Q10A 5AKJA 1ZDXA 3UI3A 3QEAZ 3DWGC 2QMTA 1WX7A 2YQEA 4QW9A 1NDDA 3M6ZA 2D3DA 5ALKA 4KLDA 5JZEB 1L4DB 4F5RA 2KKCA 2GH1A 5KG0A 1BPYA 5KG7A 3PHWB 3IXSA 1AN8A 1WSPA 3Q3FA 3G6YA 2KJ8A 1VJ5A 4BXOA 1UGJA 4GC7A 1MPEA 3AEEB 1FXAA 4IM2A 4ZRQA 1ZQEA 1FCLA 1E6EB 1L5PA 2LFIA 4NAWA 7ICSA 2IJ0A 4B9TA 2HHTA 4HJKA 4L1BA 5J2DA 4PT5A 5ALMA 3M63B 2JMGA 5JHBA 2F2AB 1FIQA 2DPIA 1PUZA 5EWFA 7ICOA 2RR9A 5DBAA 4GXBA 4F5PA 1MQ2A 4F4WA 1Q1OA 3MR3A 2D3CA 2W8LA 2B0CA 3P4RB 1TS5A 3APDA 4ZHPA 2FE8A 5AKYA 3VR8B 3IG8A 4ECYA 4ED3A 2JYEA 1LGRA 5JU5A 2V4RA 2KD0A 4W9DA 3H0LB 4JIOU 2KTRB 3N4MB 1MHXA 3RB3A 5J8YC 5KFSA 4ICUA 2IY1B 4DL5A 1E7PB 2DYOA 2HOFA 3IFWB 3R66C 4A6QA 3T5KA 3RAXA 5JRTA 3U52E 4JB3A 4Y2VA 1EUVB 2C9WB 2I2YA 2INNE 2JHDA 5GMVA 3ISDA 3KVFB 4LLGM 2KKVA 3VTUA 3VRBB 3DHGC 1Y8RC 5KL8B 4IC7B 4QW8A 4TQ0A 2V4QA 1F5SA 4UBCA 5J17A 1FNWA 1T7PA 2KVSA 3GS2A 2ZIUB 2KTRA 1E7VA 2VA8A 2A5UA 2H3ZA 3PVXA 1RYJA 1WE6A 1S77D 1HEKA 5J8YA 2R8HA 9ICNA 2FIDA 2AGOA 2BKRB 1H8CA 4CF5A 4A3OA 2D3GA 1H38A 3DCGA 5HHHA 3HUIA 3UPQA 3T8MA 2BR0A 1YJ1A 4WQMA 2WQYB 2ZG6A 2G3QB 3WK8A 4ASWC 5LNK1 3AEAB 4DSJA 2HHSA 3UMBA 4CRXA 4RPZA 2HOIA 4PHEA 1NK7A 2ZIUA 1SIJA 5D49A 3AE4B 3EFCA 1S9FA 1JRPA 4K81A 3T5LA 1FRDA 5DPSA 4LJXA 3I57A 2M8SA 4K3BA 4YR0A 4QWDA 1ZQZA 4EOYA 2MHJA 4A90A 4C00A 4GLSC 5KHOA 2RPQA 1V49A 5H92C 1F44A 3BS5B 4P4OA 3KUDB 3ETLA 2DAFA 1E90A 3LWLA 1SL0A 2Y0SC 4Y2UA 3G6VA 1NYQA 3CSFA 1J2MA 4KLJA 2WDQB 1IYFA 4O5KA 5LLIA 9ICXA 3QC8B 3BQ7A 4IC9A 1ZJNA 3PZDA 3VQIA 4I2BA 3OAWA 5KFQA 2QILA 1YIWA 3PV1A 9ICGA 4HPMB 3ZW3A 1XT9B 3M9MB 2O6VD 3PVLA 4MEMA 2KVRA 1UF0A 1WIAA 3SD7A 4HCNB 2JVCA 2VA2A 4NLZA 2BPGA 2LYHA 2ZNVC 2A19A 2RD0A 3BS5A 3KHGA 2BCUA 1I4XA 2ZNVB 3UINB 3ZGZA 2W55A 2LBOA 2KN7A 4E3CA 4Q8FA 4IRKA 5LXHA 1TBEA 3AULA 4DHJB 3ZO5B 2LYBA 1ECWA 3MHZA 4RQ7A 5AK6A 3RRHA 1PGBA 2N4FA 4J9LA 5G2NA 1J7BA 2AX5A 1KDHA 3EPGA 1MC8A 3TEZA 1A0PA 3GP7A 4KV2A 3BZKA 3HJEA 2N7EA 2PMZF 1K5OA 1LQBA 3DHIC 2DYMA 4MACA 5DG9A 1XD3B 2TSSA 3AH7A 2VA3A 2KDFB 2OWOA 3C1ZA 3GV7B 4DFMA 2KANA 4RF0A 3ZJUA 4EBEA 2XVTA 1X9WA 3H7IA 1XNSA 4R8UB 3BY4B 1L7YA 1UZXB 7ICVA 1P9DU 5JXVA 5IKCM 1VJKA 3QQ8B 4EZJA 2QCZA 1PVQA 1NENB 2L52A 2GLEA 4ED1A 9ICTA 3TAPA 3P42A 3KHLA 4HPLB 4M02A 4EEYA 2LGXA 3V6HA 1WYWB 5HKHA 3T3FA 2CRXA 4L23A 2KTQA 3B08A 4AUQC 4K4IA 4IQWA 4U6PA 2GBNA 1OEYJ 3NZ3A 4USAA 2WHEA 3SV4A 1R4NI 4G9BA 4ELVA 1QQ5A 2EKEC 2KVZA 1UBQA 5AHXA 1RPLA 2K1FA 2KT7A 5ALSA 1ZQCA 1PYWD 2KQ4X 3PLVA 2LRWA 3MFGA 4EBDA 4R8UA 4LDTB 1Z3EB 4KLLA 4RM9A 2JQRB 4B6JA 3QZ7A 1PDXA 1TGZB 3EYZA 3MFIA 3QNMA 3EC8A 3MJWA 4NZLB 4AOFA 5JH5C 4PJ0U 3GFKB 3PO4A 2AH5A 1MFWA 4BKTA 2CR5A 2M4NA 2JXJA 4KLOA 2NBWB 4BBNF 3EUB2 2AL3A 4TUUA 3GIJA 1E7UA 1WWUA 3DBHI 3HP6A 4KLEA 3GQCA 2INPE 5F9LA 2Z8LA 5E6PA 3IT6B 4MSQB 4HCPB 5ALPA 4I6PA 1CMXB 2CXYA 2W8KA 1D9DA 3OSNA 3RJGA 3MHSD 2DNFA 3UGBB 4IS7A 3HILA 5KFTA 5G55A 3OWEB 2E3TA 3MBYA 2RDHA 3PO0A 8ICHA 1WZ3A 5D3DA 2NS5A 4MT5A 2HW3A 5AK3A 3E56A 2FCSA 2SEBD 1I4RA 4J9PA 5HFYA 3V61A 2G4DB 5AKZA 2WGSA 4LK0M 2D3AA 4RGOS 4I2IA 1WYGA 4UB1A 3F5AA 4NM1A 1NNLA 3R8BA 1WG8A 1XCTL 5C5JA 5ALDA 2AQ4A 1L0YB 2K0PA 3H8HA 1I4QA 9ICIA 1PGXA 2BS2B 4CQNA 4JWMA 7ICGA 2R2OA 1MJDA 2ZW1A 1N6ZA 1EF1A 4EKUA 4PH5A 4WJQA 1ZD2P 4B6WA 1E0ZA 4Z6DA 4WQOB 4KN4A 5KFCA 4P2HA 3N7SC 1YN5A 2H89B 5EDSA 3TL5A 2E1EA 1BNPA 2GI9A 2KDBA 4C4SA 4X57B 1SV4A 5AIBA 1YMHE 3HM3A 2GBMA 3UM9A 9ICKA 3D2SA 1T4GA 3E2EA 4JQWC 4C4VB 3N7PD 2YTUA 1N61A 4Q8EA 1COKA 4DOCA 2FPLA 1X9MA 5C2TB 2EAOA 4RGMA 5IIKA 4DQQA 1L7PA 5CEHA 3UMCA 2XGPA 1KBUA 2LXAA 1YNTE 1D4BA 3A4RA 3MC9A 4P0PB 1S76D 3GB1A 2LHEA 4KLHA 5KG6A 1UCVA 1V97A 4GXIA 1CRXA 3EGRA 4LNNA 4NQLB 1SF0A 4NM2A 3NVVA 7ICUA 8ICIA 2W9CB 1KFTA 1ET6A 1YQ4B 2PFPA 2CS4A 3RNBC 8ICPA 1NEKB 2VZKD 3ZDTA 4EENA 4CF3A 5L1JA 2XY7A 1DXSA 3BDPA 4C8KA 4C4VA 2NRTA 1V9JA 1MG4A 1ZJMA 2AQ2B 4YSZB 2H3VA 4K3CA 1RYRA 3DEEA 2NVUI 4C80A 4K4HA 1PVPA 1JIHA 1COOA 3F2CA 3BWUD 1WJNA 4NLKA 2RDBC 2WX1A 5KFRA 2P66A 1BGXT 4FLHA 4P0PA 5AUIA 5JHAA 2FCQA 2WFAA 5D46A 5DQGA 7ICIA 4I6NB 3X0WA 4JE3B 3OHAA 4C0ZA 2XEWA 5CB1A 2VH1A 2W9CA 3MR6A 1T0YA 3UQ2A 4G0NB 4MFCA 3ZTDA 2J6UA 3RMKC 3V72A 2K6QA 5DDYA 1LV5A 2OHFA 3URYA 3LB8C 2O6VB 4HDQA 4J9MA 2KEYA 2LWPA 5KFNA 4EEKA 4RQ5A 1KKXA 1FXIA 3DQVA 4FULA 4HPPA 5HMLA 5AI0A 2BQRA 1K50A 4DL6A 2PFQA 1Z19A 3CYMA 1RQNA 2G5HB 4M2YA 4RCOA 5KAIU 3AEGB 5DG8A 1NZBA 3B0XA 3V7LA 5ALUA 3PMLA 1QSLA 4A3PA 5KT5A 1TAQA 2N7JA 1JRUA 2M17A 2WAQF 9ICPA 2MBOA 2QEJC 3Q8KA 2LJIA 3PSIA 1QLBB 2MU2A 3UIOB 3BVZA 2KNBA 3PHXB 3D6JA 2Y1JA 4PYZA 3RNEC 2O6VA 2W43A 4O3PA 1NI3A 3PS6A 4QNLA 2LHDA 1H4RA 1FM0D 4WWNA 3RYTA 3KWVA 3MGVA 2HCFA 3WKEA 4QZGA 4F3OA 4M47A 4BOSC 2M9NA 1TAUA 1TJEA 2WF6A 5BPCA 1CJEA 3JPTA 4NJ7A 3VUXA 4QZAA 2B6GA 4I6LB 3ZJVA 5H8YE 3QK0A 2HTME 3GE8C 4DK5A 5J2AA 4BKSD 1KF6B 4PPXA 4XC2A 3R7RA 3L08A 1D5ZC 1RXVA 4O5CA 8ICZA 1Q5WB 3RR8A 1NVID 3ZLZA 2LMCA 2NRVA 2PI5A 2KZZA 4J9SA 5FKAC 4QJFB 2GOWA 2B76B 3AU6A 1BPXA 4GIVA 1EU3A 3DDCB 1JALA 2QARB 2A1AA 3QA8A 4YMOA 2IBIB 4P16A 1UGMA 2DHZA 4BVUC 3HM6X 4HWIB 2KFZA 2MRLA 3WK6A 2KFJA 4DQSA 4JV1A 5IAAC 2G09A 4I2FA 2N1WA 2L05A 3SEBA 1EU4A 2IGDA 1QQ6A 2MLBA 4RNOA 2FLPA 4OW0A 1XEEA 5ALLA 5KFDA 3M8RA 1T94A 4OZBA 4WWPA 1NZPA 1DOXA 1OEYA 1Z5SB 4J9NA 1X6IA 3AU2A 2G9HD 2GMIC 3BQ0A 2ASQA 1UQVA 3ZRFA 1U4AA 4Q43A 2HHXA 1N2XA 2EMSA 2Z59B 2YMPA 4KMUA 1C9FA 2LVQA 2Y3AA 2WXGA 2QARA 4W9KA 1SWVA 3PLUA 3SEIA 5KT7A 4Z6CA 2YEPB 2K4EA 2VH2A 2PMVA 1V85A 2XCAA 3D2QA 2NBUA 3DBHB 4J03A 3KZIU 2EKIA 3GILA 2CPRA 3QU5A 1WM2A 1QF6A 3EPIA 2D07B 4W9HA 3HHMA 3ZDCA 3DV9A 1XLPA 2NR2A 4PYUA 4Y2JA 4XGAB 3Q8SB 3DBLI 2K8BB 4UB2A 3WK5A 4QZ8A 4FO6A 4FHJA 2ALZA 4JV2A 1JMLA 1EWCA 2MUTB 3C28A 2HHVA 4QWEA 2EQYA 3PW5A 4LZGA 4UAWA 3T5JA 4G3XB 2H88B 3H9DA 5JUMA 1WGKA 1WXSA 4TKNA 3RZFA 3APFA 1WY8A 5ALRA 4KN7A 1Q0WB 1TY0A 3VTWA 2WXQA 4XDDA 1ZQLA 3AEDB 2Y5CA 3B9JA 4KDIC 4RPYA 4Y2YA 2XK5B 2KSOB 3B0YA 2ZXIA 2CKHB 1J19A 2KICA 3IRUA 3AI5A 4NAMA 5FP0A 4G50A 4R3DA 4MHVA 2M56B 2J6SA 4NPNA 4WJ3B 2GB1A 1MSWD 1WCLA 1OQYA 2K8BA 2P6UA 2DQNB 2MUTA 2IGGA 3AXCA 3PR5B 5KFHA 4RU9A 2R8GA 2EDUA 1IUEA 3NJTA 1TYGB 1QQ7A 1QT9A 4JV0A 3PSTA 1VRAB 4C7YA 1XLNA 1N56A 1GG3A 1MQ3A 1WE7A 2KDEB 3H8JA 1FEHA 4F7ZA 2BBCA 2E6XA 2O2VB 2JZPA 2XK5A 3F2DA 2KSOA 1QKZA 3LJ3A 4IOIE 1TIFA 4JGHB 3D32A 2WHIA 2MP2B 5IA7A 1S0MA 4YXJA 3GIMA 1BUIC 4FBTA 1A70A 3H40A 2C2DA 4HVBA 1ACCA 3PSEB 4RMAA 3D2NA 4AYBC 1OQRA 3BS7A 4GSWA 2PKEA 1BPDA 4LJPB 2DBYA 2YB4A 4P0QB 3NS8A 1L0VB 3Q6BA 4YTNB 1GB4A 1SE9A 3NUQA 4K1RB 5ALHA 2CHWA 3FM9A 3PV8A 3PPAA 4KITB 2I1KA 3M95A 5FR6A 3ECIA 4DQOC 1D8YA 1WRIA 3HK0A 2O2VA 3Q8AA 3QUCA 2NV3A 1NKEA 1ZOYB 3LYYA 4BKGA 4YN4A 1BMLC 2MP2A 7ICJA 2WXKA 4E0DA 2JYTA 3EA6A 3QHTA 1WJ6A 4I28A 3P2BA 2BW2A 3UIPB 3A0BU 3V7JA 4PHDA 1KH0A 1KLUD 4MEXA 4HRSA 5HG2A 2XICA 3SENA 1DYQA 2AQ1B 4DL2A 1SJED 4RH6A 1JWBD 4JMUA 3KOOA 2HSZA 1FFUA 3SAGA 5CR0A 3EWAA 3L0WB 5TZVA 2LUEA 8ICGA 1NJZA 3FC4A 2FLLA 5EE3A 3WK9A 5TISU 1YJJA 2OCEA 5KFWA 2K89A 5KFOA 3TIXA 3VVWB 3L13A 1OUQA 4IDIA 5IOIA 3QZ8A 4DSFA 1IXRA 4I27A 2KOBA 1T0SC 2BVCA 3NS1A 3AL0B 1DK3A 5ALIA 5KL1B 4EE2A 1AWDA 3T3NA 3E58A 5D7GA 2E1FA 5AKEA 3IG3A 1ZQOA 1KL9A 4DWIA 2RDGA 5DG7A 1RXWA 2JGAA 3B0AA 2V1YA 2H3IA 1VZ7A 4XQ8A 2MH7A 3WANA 2GBJA 4NWIA 1EF5A 2O6KA 3N20C 3U4EG 1J0GA 4P4MA 8ICNA 3N30A 1U49A 4WAAA 2V3PA 1WUDA 3VH3B 2C28A 4EYHB 1V81A 2KG5A 4C8MA 8ICQA 3K9OB 2LHTA 1U45A 2M0NA 1KRHA 1ZQRA 1I42A 5J2JA 3FDSA 4RQ6A 3C5FA 2KDMA 2L3ZA 4TQSA 1XS9D 2G4SA 3SYZA 1TZOA 3H8MA 3OTQA 4AP9A 3UQAA 2XBBC 2JR5A 3RJFA 4E74A 2DFLA 2W11A 2PFOA 1TK0A 1T0RC 3WIMA 3P4SB 3KD3A 3RBDA 2MAXA 5C0YA 4RF1A 2DZKA 4TQRA 2C2RA 4EZ9A 4GB9A 4OVZA 1QILA 4DXAB 1TTNA 1AYFA 4ZYSA 3M3JA 2XIDA 2JPHA 4KTQA 2Y5PA 5BMIA 4O5EA 2D2QA 1Z4OA 5AI9A 2KWUB 2HDOA 2DF4B 2OJWA 1X1MA 3CW2C 1L6NA 2FUHB 1KFDA 4IUMB 1WF9A 3IT4B 4KZ0A 2V0GA 1I4HA 2KJ6A 3QIJA 2WYQA 2NCNA 2M1MA 3Q8BA 1CI4A 2FI1A 2JEJA 1ZXHA 5J2FA 4R63A 2LPEA 3HKZC 1ZQMA 1YZ6A 5AM1A 2WDVB 4IG7B 3H7PB 4KKJA 2WXIA 5DPWA 1WR6E 1SIFA 5ALQA 5BOMA 1YQBA 1SL2A 2REXA 3F5EA 1Q46A 5KFLA 4PL2A 2EELA 4PS7A 4KLSA 2WXNA 4EZ6A 5D6JB 4BKSA 3GIIA 2Y9UA 1UUPA 2IO3B 1Q3VA 4DOAA 2QJLA 4LCDE 1P0RA 4XWWA 1B9RA 1GPXA 2JEIA 1U48A 5KT6A 4PGYA 2DKXA 3IN5A 4QWCA 1SKRA 2WXMA 4GC6A 3AV8A 8ICWA 3ONNA 1ZQGA 5F9NA 2FCNA 1TZ1A 3H7PA 1X40A 2IOFK 9ICAA 3BYYB 4O1NA 5EE9A 2C5LC 5MPOA 2CJOA 3I3TB 2BB5A 4S17A 3V62A 2GO7A 2R18A 3Q3OC 4RQMA 4LZDA 9ICJA 3I1YA 5FK9C 1L8LA 2RHFA 4MF8A 4GN1A 3PRZA 1C3TA 5T14A 1XSPA 1MN8A 2DPJA 5J0UA 2YB1A 3CP8A 1LKYB 3K9PB 2AXTU 2MJ3A 2OJRA 3ETRA 2QDFA 3TQ1A 4DSLA 3N9YC 2M0XA 5TSSA 5CX3A 3SMVA 4UDUC 5EWEA 3DBLB 2G45B 3P1MA 1HUZA 4WJPA 3OSPA 1KLGD 3WKDA 1UWMA 1XLQA 2NRWA 2LMRA 4QZIA 1J7AA 1R7SA 4MGYE 3VRAB 4DS5A 2JH7A 2W03A 2JXXA 1JXEA 1CQVA 2LKYA 1T8EA 2RLTA 1QTMA 3Q2AC 2JSVX 3VH4B 5AI5A 4EZKA 1LKYA 1HXYD 3OG5A 2QB1A 5EE1A 4GLXA 4F72A 4OJLA 2KAJA 4TSSA 3NVZA 3IBEA 3L16A 3UF8A 3J9CA 3BIID 2FPKA 1M94A 1ZQXA 2N1RA 1P7FA 1NK5A 4Z6FA 2G06A 2ASLA 1J7CA 4Z6EA 1SKWA 2BGFA 1AW7A 2I1QA 3AE9B 2AL6A 3PW0A 1XSNA 1JROA 4ED6A 1S5LU 3FAHA 1ZQKA 2F1JA 2IZVB 2K9XA 2LGSA 3A1QB 2DLBA 5T8IA 1WX8A 2LASA 2K25A 3PZ8A 2IMWP 4QZDA 1TK5A 3ZQ4A 3KHRA 2LEKA 2JRHA 3WKBA 2R2QA 4QZBA 3MDAA 2WU5B 1TKEA 2FJ6A 3RNFC 1JCKB 3THVA 3C0RB 1ZXIA 2G0AA 2CHXA 4ED0A 1SGGA 4F8RA 3NY5A 4ECXA 1MHHE 4W9CA 3TADC 5GTHU 1NOMA 1HTOA 4QIWF 1UA0A 4WIPA 3SFDB 3A0HU 4C7ZA 5CWRA 2F1HA 2MSNA 4ANVA 3PNCA 2ZVNA 3SV3A 3RN9C 4IL6U 3QJZA 2AJQA 3BQTA 4YQWA 1F9JA 4L2YA 1Q8KA 4J6IA 3LXFA 1XCQL 2GOLA 3A1QA 2I5HA 3BK2A 1I7HA 1RYSA 3ZNZB 2HBJA 4RUAA 1TS4A 1EO6A 4M04A 3AQFA 4IR9A 4C4RA 3A9KB 4CYEA 1WWVA 4M6WB 4OD0A 2FNJB 4CDGA 2JY6A 4ED7A 2N9XA 2MRPA 2R61A 2L7RA 4HK2A 3H0MB 3ICXA 3TADA 1IV8A 5KG5A 2I9GA 3ZDAA 1FRRA 3PSPA 2PXIA 1XO3A 3L17A 4K7SA 1ZKHA 2MX2A 2N7DA 3C5GA 1NJYA 2GRIA 3WAMA 1FNVA 3EECA 4HYKA 3V3XA 2Q5WD 2MQJA 1GNUA 2AGPA 1IIPA 4J9KA 2NTSA 1LB2B 3K4GA 2E8PA 4DSIA 1V1PB 1L5UA 4KGTA 1ZQQA 3MFHA 3C29A 1SE3A 1WX9A 1KN5A 3A9KA 3MR2A 4M6WA 3PX4A 3G6XA 2NO4A 4NJ8A 1TKDA 1L0XB 2DZMA 3DWMA 4PHPA 2ZVOA 4FZLA 2HHWA 2H3FA 1BVSA 1V8CA 1URJA 2VANA 1HTQA 4DXGA 1ZQ1C 4YXDB 5G5GA 3ISCA 1DGJA 3U26A 2KACA 3DVNV 2BPSA 2BCQA 2DKZA 1V38A 1RWSA 1L3TA 3VR9B 9ICVA 1V1PA 3RT3B 3H1UA 8ICRA 3L3FX 2L76A 2N9PC 4JK1A 3AQEA 1C4PA 1YZ7A 1VR9A 5IO9A 4Y2SA 4RQ4A 2ISOA 3PY8A 2F3NA 2FBWB 9ICQA 1L3UA 4AQ7A 4O3OA 1JUDA 2A4ZA 2OYYA 2LRUA 3K1RB 5DGBA 5TR5A 3I9V1 3C23A 4RQ1A 2MEKA 1BT0A 1LFDA 5J0WA 5DBBA 2PJHA 4PZOA 2IHNA 2BT6A 1D8BA 1GC6A 2JZ3B 3KZXA 1DOQA 2RMMA 1NJXA 1ZDVA 2PEAA 2HJ1A 3QEBZ 4NV0A 1NK0A 4YD2A 3IM1A 4DF4A 1XC9A 3ML9A 4NXZA 4MDKE 2EZXA 3RH6A 3QX1A 2WF7A 1KM7A 1Z1BA 1UA1A 3LVWA 3NRWA 2NRZA 2PMZC 3JPNA 2V9HA 2MJDA 1DRGA 3KKAC 4TV3A 2GWSA 1T5XD 2QB0B 2HHUA 3L54A 5C1ZA 1BNOA 5CHWA 2K6DB 5IN7A 1ZD5A 4RQNA 1KFSA 3C2LA 1ZQIA 1E8XA 2VRRB 3A33B 3DVGY 1GB1A 3FILB 4FXCA 1WMHB 2OOBB 3NZSA 3ZRCA 3K75D 3C21A 4YVZA 4O3SA 2RQ5A 4XWTA 1X9XA 4NLCA 5CTRC 9ICWA 4F5QA 4ECRA 3HIZA 2FUG1 5CHVC 4KGSA 1WJUA 4TUQA 3HVZA 2I38A 1NI2A 2W9NA 2MSED 2J6TA 4GOCA 2EMTA 4IM0A 2HJ8A 4J3OD 2LGIA 2C22A 2WDTB 1UT8A 4RPXA 2K8AA 1N48A 3RJJA 4I2DA 2DAJA 1TY2A 3AU4A 1T3QA 2QB0A 1SB3C 3KKAA 2NRXA 1C20A 5KFAA 1JWSD 3IV6A 2K60A 1IGCA 4QZEA 1YQ3B 1GJZA 1UWXA 2IDYA 3FILA 1WMHA 4EBCA 3TFRA 2RGFA 1SEBD 2BB6A 2WXRA 1XXGA 4JL9A 4MM3B 4RGNA 1QH9A 8ICVA 2WXFA 4TUPA 3CSTA 4YG2A 1WR1A 1BXTA 1BPEA 3JPPA 8ICKA 2BWES 2OH2A 4DF8A 3BINA 3BYTB 4DFJA 4NY8A 5AKXA 1GAQB 4ZDVA 4BBNC 2BCSA 2MBBB 2CN1A 5J2KA 1J8CA 1TT5B 4RQ8A 1X2IA 2XN9C 4YFKA 1L7MA 1ROEA 4JX1C 5C23A 4JPSA 1KTKA 2NTTA 4UB8U 5KG4A 4IRCA 4DFDA 3OHBA 4TQ1A 2KZMA 3I28A 5J2IA 4XX5A 4UB6U 2BQQA 4B0MA 1YN4A 3UXNA 2RP5A 3GV5B 3F2BA 1SGHA 3SD5A 3T9LA 4A8XC 2KK0A 5ALNA 2HD5B 4RNMA 4MM3A 1NYRA 2KN4A 2WS3B 4MFFA 3ZIMA 2YMLA 4BZAA 4FZMA 2Q0ZX 2OEHA 1C77A 5KTQA 2EZZA 1TVAA 2HVIA 5AZFA 4OJ5A 3IAS1 2BPFA 2EZYA 4FZNA 1RZTA 4LNIA 2W9BB 4OCZA 5KFUA 3TFSA 3PZPA 1ZQDA 3B1LX 4J9RA 1X6JA 1D6EC 5KFEA 2ICIA 4O3MA 1QSYA 1WXQA 2D3BA 3MJ5A 5CP2A 3M9OB 1WXMA 4GDKB 1JI7A 3H6NA 3N1ZC 3V05A 5D4BA 4DFPA 1NJWA 5CRXA 8ICEA 1L6VA 2LJ5A 4OJ6A 4ICAA 1X9SA 3BQ1A 4K7UA 3DBSA 4UAYA 3C2MA 4M00A 4ELTA 1V9PA 2Q4TA 5GXGB 2KLGA 4F5OA 2WB1F 3KBBA 2KWVB 3W1YA 5AZHA 1QZEA 2BDUA 4ECQA 5AM0A 1ZQSA 4F92B 2L0FA 2J42A 5JTIA 4ZRKA 2KZRA 5EOZA 1ZETA 3TARA 3C19A 5J0OA 1TFRA 2W9BA 2JX5A 2AGQA 5KFYA 3RCZA 4FJVB 3TANA 3IHPC 1S0OA 3L4PA 4LJOB 2PVGC 4GDKA 2E8OA 5B5EU 3WK7A 4KLQA 2ZIXB 3BZCA 2PPHA 2J7QB 4F91B 4OZAA 4GMVA 3QUBA 3QU2A 3V60A 1NK6A 3VCBA 2D11A 2MBQA 4MSMB 3ZJTA 4O9MA 2QKQA 2G08A 3TI0A 8ICOA 4MGKE 3Q8PB 2KD1A 7ICHA 1JWMD 2JWZA 3CWIA 3R7QA 3M1YA 9ICHA 5D2MB 2ZTEA 4C4TA 4ECUA 3U2SC 1B43A 2MBEA 2BZFA 4ED8A 3JSVB 1N60A 4KGRA 4ZRJA 4OZCA 7ICNA 1V86A 1ZD4A 2BYVE 2GBKA 5AM4A 5KFIA 3DPDA 3KUCB 3MP9A 4MEYA 8ICUA 2YMQA 1R4NB 4M0AA 2KKPA 1F0MA 5DPRA 2UVRA 5L1LA 1PZNA 2ZIXA 2PTLA 3B2GA 2JU6X 2FDRA 3S6JA 1RYUA 3GDXA 4WJNA 1ENFA 2CU3A 4DLEA 5J0XA 2WP9B 3H4DA 3RI7C 4RT3A 5KHQA 4KVGB 3RRGA 2KHWB 3OJSA 1Z4NA 2QSDA 2SAKA 1TK8A 3AB5A 2BWFA 3Q69A 4PS8A 2XGQA 3TJPA 4F8CB 2AEHA 3JSVA 3MABA 2EH9A 3HVDA 3PW7A 1P7DA 1ZQFA 4YWGG 2KNJA 5C3JB 7ICEA 1V1OA 5DB7A 1A5RA 3K1ZA 1B22A 2MCNB 4OVUA 4P1CC 4S0RA 2H3QA 4AJWA 3P4QB 4IQTA 1ZQTA 4DL3A 3GZNI 5AIAA 4B9KA 2XC9A 3KTQA 5BO4B 2P35A 4ZYNA 2FIFA 1N5XA 4WH4A 1D5MC 2N1VA 4DDID 2IGHA 2RDIA 2ZZPB 4RFBA 4HXDA 4TURA 3OPXA 2WAQC 5J0TA 4G11A 2GBRA 2WLBA 2GLSA 5AKGA 3DHHC 3AE3B 5AI4A 4DL4A 2KVCA 1WFYA 4NJ6A 3ALBA 5J2BA 1VLBA 2ISPA 3CMMB 4HKQA 3ZXRA 5DKWA 4YMNA 5FR3A 4DO9A 2OEDA 2FPMA 4BDPA 1J97A 1ET9A 1K53A 2DWQA 3ZXVA 2IOFA 1YT3A 2ASDA 3UXPA 1TS2A 4P4PA 1V6EA 4KSLC 1SV0C 3JPQA 2INDC 2D8CA 2BYTA 1M6YA 2WDRB 2WWZA 1OQQA 1YJIA 2MWSB 1UD7A 1KRPA 2L00B 3T3OA 2K8CB 8ICXA 1GOZA 1K51A 4E71A 8ICSA 2WXOA 2ES6A 1WI0A 1T3NA 4UAVA 2ZUBA 3O65B 4ARCA 1IP9A 3WK4A 4YR3A 3WAOA 2IBKA 1A6SA 3QAQA 2UWQA 3ORYA 1QOFA 1C4CA 3TUOA 2I1JA 1C7YA 2VZKB 4HAIA 7ICTA 3NOBA 3N1XC 1SV0A 1NKBA 3ONSA 3I76A 5BMHA 2WXHA 2C60A 3PX0A 3KQ4A 1U47A 3RFZB 1XWLA 2BHNA 5J2RA 5KFFA 2K8CA 3AECB 4YTPB 2Y9TA 2KC2A 3DBRI 2C7MB 4EYIB 2M19A 4JWNA 2UU7A 1E10A 1FXTB 1RG6A 1ESFA 4JWSC 4R66A 4NJCA 3UXOA 2ZEQA 2AWTA 5L1KA 4M9HA 4YT0B 2X8XX 5KNIA 1ED1A 4W9EA 1GUAB 3RJIA 2L5YA 3V6CB 4IWQA 2KZ3A 5L1IA 3B2FA 4GGQA 3IVFA 3HX0A 3IAM1 3TACB 2R8KA 2IO1B 2L32A 3RPFC 4F4YA 2WNMA 5F3XB 3RJKA 4DQIA 5J2EA 3AE1B 1JMSA 3SU8X 5BOLA 4KX6B 4P7IA 3ML8A 1NK9A 1E9MA 5KT4A 4CHKA 5BYSA 4EX7A 3SAHA 2MW5A 2OXOA 3CNHA 3U7DA 2B21A 1PVRA 5E6NA 3OJUA 1SXEA 2LYAA 3IG5A 2BCRA 2R8IA 1I4GA 3ABVB 3DVGX 2BYEA 3TEYA 3FKYA 1UH6A 1L3SA 4EZLA 4QWBA 3RB0A 2UVUA 2MJEA 4FADA 1ZQYA 1C4AA 1B1ZA 3PT2B 4NLNA 1JWUD 4TMAB 4US8A 4EEWA 1ZQWA 1RDFA 1OGWA 3MC8A 2J53A 4IR1A 1E5WA 2N9LA 2LVPA 1VD2A 4B95A 2JWUA 2KQ7A 1UT5A 1S0NA 3KW5B 4MGZE 4J9QA 3JVZX 4FBJB 4Y2TA 2G1EA 4LDTD 2V9WA 4F50A 2D6FC 1YN3A 4DXFA 3P63A 1KTQA 1A77A 3RAQA 4DEZA 5B66U 2L1AA 4XRHA 1WGHA 1FFVA 3RBEA 5DLFA 1ZQBA 1KEJA 2Y0SF 5DB6A 2FE9A 2KV2A 3ZVVA 3MGIA 2KOXA 2RRDA 4AWJA 2FAZA 5KG1A 4Q44A 3M8SA 3PMNA 1STEA 4F2RA 5ALZA 2ATLA 1HE8A 3N3KB 1SBBB 3A4SC 1S8OA 4GDLB 4YTMB 2IO2B 2DGZA 3ZDDA 3RB6A 1WH3A 3ZI4A 8ICAA 2HOQA 1YOVB 5CHFA 2B3AA 2LI5A 1SXDA 4KMOB 3PZ7A 1PGAA 2ONQA 1HQRD 1ZQUA 2EAMA 2BGWA 2PKOA 1NK4A 1HUOA 1NKCA 1LM8B 1IBXB 3AE6B 4US9A 1ZD3A 3GV8B 2JT4B 4ITKA 1TKYA 4BJQA 4LNOA 2YVCA 4W9IA 3N28A 4U7CA 3LK9A 1TV9A 3OJ3A 2QIEB 2ZUDA 4M9NA 3ZD8A 3EHVA 2AQ0A 4ANWA 2IY0B 1MI0A 4KLUA 3IHQB 3ZDBA 3RULA 3W5VB 1ZQHA 4ACOA 1GO3F 3A9JB 1UNSA 4GDLA 3AEBB 5AK5A 3H8SA 5J0RA 1Q3UA 3GU3A 3BVGA 3NZUA 2V3NA 1HJPA 2W9MA 2VKQA 2ZW0A 1J2NA 4I2CA 4P6VF 3ZKJC 3QE9Y 1R4MI 2JV3A 1SE4A 1E8YA 4II3B 1O03A 4JLCA 2N0SB 3NHEB 1A76A 5L83A 1U4BA 1IBXA 4NL9C 5DB9A 3PW4A 2UVWA 1DGSA 4DOBA 5AKKA 1XSLA 4MJSB 4ANXA 2C2EA 1L6UA 3QUQA 4OVVA 2MBHA 4ZH4A 2YX8A 5IIJA 3SFEB 2JEGA 2IA6A 3RD2A 2ASJA 4YP3A 1AARA 9ICMA 4DBGA 7ICFA 5KT3A 3A9JA 2J0MA 4UB3A 2LGDA 2Y1IA 3GZNB 3PSFA 4B0EA 2HBMA 1ISNA 1ZYQA 3JW0X 4R64A 3IDWA 2KC1A 1QOBA 2HBLA 1E8WA 3FYHA 1RFAA 1RLFA 3QXGA 4DFKA 3PO5A 8ICLA 4ZHOA 1UHUA 4UARA 5L95C 1P3QU 2KWDA 2DX5B 4LTUA 4NL9A 1UELA 4MJSA 3BK1A 5J0SA 4KIKB 4O3NA 5BYQA 1I35A 1KJTA 4DSEA 3L10B 2LM1A 2KMCA 5HP4A 4O3QA 2ZTDA 1XO1A 2V3SA 1S0VA 3PR4A 2VIXA 3U7ZA 4PGXA 3MDCA 3Q8EA 3V6KA 1JWAD 2BS3B 2NPTB 4UW9A 1FNUA 2IO0B 5H2FU 3DVNU 2R8JA 5CJ7A 4QZ9A 2F44A 4CCHA 1Z1VA 4FJZA 1QLNA 4IWPA 9ICLA 4F2SA 1C76A 4NLBA 2OM6A 5J2HA 4KIKA 3H7SA 5IIIA 1N5WA 5E79U 2IOHA 3Q3JA 1K52A 5AZGA 1FEZA 2NO5A 4CE6A 4EFOA 3QU7A 2NPTA 2VJ4A 1MVKA 5AKIA 5HNKA 2C7NB 2FMSA 3M6KA 3SI8A 2AU0A 1U9LA 2W04A 2LXCA 2WU2B 4C8OA 2XI9A 3KWLA 2J0KA 5ALEA 1JX4A 2CU1A 3UQ0A 3RR7A 9ICEA 1X42A 4NNJB 3IP4B 2F8LA 5HHIA 2KP7A 4DCCA 5J0QA 2LD9A 3EFUA 3NASA 4UQGA 1LXDA 1ZQVA 4QZFA 2KJRA 3DBRB 3Q8FA 5AICA 5HR7A 8ICFA 2QC8A 2KYWA 2N9EB 2Z0EB 2DYBA 1ZRNA 3L5KA 3H8WA 1SL1A 4PZNA 1Y56A 3VTVA 2XY5A 1ZRMA 5L9XA 2DUYA 2E5SA 5ALFA 5KG2A 2FCMA 2NBVB
chains in the Genus database with same CATH topology
1GAQB 1TY0A 5HHDG 2WXQA 4XDDA 3AEDB 2Y5CA 3B9JA 1F0ZA 1C78A 2XN9C 1ROEA 4JX1C 3P4RB 1TS5A 4JPSA 1KTKA 2NTTA 2FE8A 4ZHPA 3VR8B 4NAMA 4R3DA 2JYEA 2M56B 4TQ1A 1OFFA 4YSXB 2XNAC 4B0MA 2GB1A 4Q2JA 1MHXA 1M4VA 1YN4A 3BVMA 4XDCA 2ON8A 4A8XC 1TS3A 2X38A 1E7PB 2IGGA 1NYRA 2DYOA 3SR6A 1IUEA 2KN4A 2WS3B 4A6QA 1TYGB 1QT9A 3W5UB 1C77A 3U52E 4N6EB 2RPVA 1VRAB 4C7YA 1XLNA 4HEA1 2I2YA 2INNE 1EM7A 3IAS1 4C56C 1FEHA 2WXLA 2BBCA 2E6XA 4LLGM 4WURA 1D6EC 2JZPA 1HZ6A 1QKZA 2ICIA 3VRBB 1WXQA 3MJ5A 4IOIE 4TQ0A 4GDKB 3V05A 1L6VA 1SXTA 1FNWA 3GS2A 1BUIC 1A70A 3C8YA 1ACCA 1OQRA 3AEFB 5GXGB 1RYJA 3NVYA 2K22A 2DBYA 1L0VB 1GB4A 4YTNB 2J42A 1D5XC 1SE2A 4DQOC 1WRIA 2KMMA 2JX5A 3Q8AA 3HUIA 1ZOYB 3LYYA 4WQMA 2WQYB 4HJGE 3L4PA 2PVGC 1FCCC 1BMLC 3AEAB 5LNK1 2WXKA 3EA6A 2JYTA 2BW2A 1ZE3D 4A9AA 1DOIA 1SIJA 3AE4B 4OZAA 1JRPA 1KH0A 1KLUD 2D5GA 3AE5B 1FRDA 4HRSA 5HG2A 3I57A 1DYQA 2AQ1B 3ZJTA 1N62A 1SJED 4A90A 4RH6A 1JWBD 1FFUA 2K3UA 1JWMD 3CWIA 4GLSC 3FC4A 5H92C 5EE3A 1YJJA 3U2SC 2AQ3B 3R2IA 4KGRA 1N60A 1FD6A 4OZCA 4IDIA 2ACZB 1NYQA 2M0AA 3NS1A 2WDQB 3MP9A 4MH8A 4EE2A 1AWDA 3T3NA 5D7GA 1HEZE 1VDVA 2PTLA 2RDGA 2W3RA 2JU6X 3B2GA 3VQIA 1DOYA 3AE8B 2QILA 1VZ7A 1ENFA 2CU3A 1SJHD 2MH7A 1JQ4A 2WP9B 3U4EG 2V3PA 3AB5A 2SAKA 2QSDA 3Q69A 4OHJA 1FO4A 1I4XA 1KRHA 1ZUD2 3R2TA 3ZGZA 3E9SA 2W55A 2KDMA 3HVDA 1RFKA 1TZOA 1KFYB 4YWGG 5C3JB 3BZDB 1V1OA 3MHZA 1PGBA 5AUKA 3P4SB 4KKIA 1J7BA 5G5HA 2AX5A 2N9KA 4RF1A 3P4QB 4OVZA 1QILA 1FMAD 1HZ5A 3TEZA 4AS1A 3GP7A 1T6BX 1AYFA 4ZYSA 3TEXA 2Y5PA 5BMIA 1N5XA 3ZYYX 4WH4A 1D5MC 2DYMA 2IGHA 4MACA 1EWYC 2PVOD 2TSSA 3IT4B 4RFBA 2WXJA 3AH7A 2V0GA 1I4HA 3W1SA 3NVWA 4RF0A 3ZJUA 2WLBA 3Q8BA 3AE3B 1ZXHA 5BYRA 1VLBA 4HKQA 2WDVB 3P4PB 4KKJA 5FR3A 5JXVA 2OEDA 1VJKA 2WXIA 5E6JA 1ET9A 1NENB 2L52A 1K53A 2DWQA 2W82A 2YEPF 2J4XA 3P42A 1TS2A 2W3SA 2EELA 2WXNA 4L23A 2BYTA 2WDRB 1UUPA 1OQQA 1YJIA 2QJLA 3NZ3A 4XWWA 4USAA 1B9RA 1GPXA 3T3OA 3HRDD 1F2RI 2WXMA 4RGTA 1GOZA 1PYWD 1K51A 1QOGA 2J52A 2KQ4X 1F77A 2PIAA 3AV8A 2WXOA 3MFGA 3AE2B 4ARCA 3CIRB 2JQRB 1PDXA 4NZLB 1QOFA 3BYYB 1C4CA 4O1NA 3TUOA 5EE9A 3EUB2 4REZA 5MPOA 2CJOA 2BB5A 4M0WA 1N63A 2VZKB 5FK9C 2INPE 5BMHA 2WXHA 1C79A 3KQ4A 1XF5L 3RFZB 2Z8LA 3IT6B 3AECB 2MJ3A 4YTPB 1XLOA 3ETRA 3N9YC 2M19A 5TSSA 4UDUC 1E10A 3P1MA 1CZPA 1ESFA 4JWSC 3OWEB 2E3TA 1KLGD 1UWMA 1XLQA 4ZRPA 2RDHA 3PO0A 1J7AA 1R7SA 1I4PA 4NJCA 5D3DA 3VRAB 4MT5A 4D2KA 3AM9A 3W2DA 3E56A 1CQVA 4YT0B 2PW9A 2SEBD 1I4RA 4ZOHC 5HFYA 3B2FA 2JSVX 3IAM1 4LK0M 2HDEA 4RGOS 2L32A 3RPFC 1WYGA 3R8BA 1HXYD 2WNMA 1XCTL 3Q8CA 5EE1A 2KAJA 3AE1B 4TSSA 3NVZA 1L0YB 2K0PA 3H8HA 3J9CA 4KX6B 1I4QA 3BIID 4A55A 1E9MA 1WWTA 1PGXA 2BS2B 1P7FA 4CQNA 5BYSA 1SSNA 2ZW1A 1J7CA 1I4GA 3ABVB 1AW7A 4WAFA 1E0ZA 2K5PA 3TEYA 3AE9B 2H89B 1YN5A 1JROA 2MJEA 2GI9A 3NUHB 1C4AA 3FAHA 1B1ZA 1YMHE 1JWUD 4TMAB 4US8A 2CJNA 5I4DA 3W9CB 1HA5A 1N61A 2J53A 2K9XA 2DLBA 5T8IA 3PZ8A 2N9LA 5C2TB 4RGMA 2JWUA 3ZQ4A 2LEKA 4XE0A 2WU5B 1TKEA 1JCKB 2G1EA 1YNTE 1ZXIA 1D4BA 1MHHE 1YN3A 4DXFA 1QOAA 3P63A 3GB1A 2LHEA 2L1AA 1FFVA 4WIPA 3SFDB 4C7ZA 1P7EA 1V97A 3EGRA 4N58A 1SF0A 1IGDA 3NVVA 1ET6A 1YQ4B 1VZ8A 1NEKB 4HKZE 2L83A 2VZKD 3WCQA 4L2YA 1STEA 3LXFA 1XCQL 3BK2A 2NMQA 1I7HA 2AQ2B 3MC0B 4YSZB 1SBBB 1ZP0B 4GDLB 4YTMB 1TS4A 2BTEA 4C80A 3BWUD 3TSSA 1QQRA 3PZ7A 1PGAA 2ONQA 5AUIA 1HQRD 2R61A 4IKGA 2BS4B 4JE3B 2PKOA 1FRRA 1IBXB 2LUMA 3AE6B 1L4ZB 4US9A 1XO3A 2PLPA 4ITKA 1TKYA 3NRZA 2GRIA 1PUTA 4H2AA 1FNVA 3V3XA 5EE0A 2Q5WD 2QIEB 1VZ6A 3URYA 2OHFA 3LB8C 4ARIA 1MI0A 2V4IB 2NTSA 1V1PB 2JXTA 4KGTA 3W5VB 1FXIA 4XWTA 1UNSA 3AEBB 3BVGA 1K50A 1SE3A 2V3NA 4RCOA 4RNAA 3AN1A 2ZW0A 3AEGB 4P6VF 1SE4A 1TKGA 1ZPSA 2N0SB 3TEWA 2N7JA 1L0XB 4JWUC 3DWMA 1IBXA 2QEJC 3AMZA 2LJIA 1V8CA 3AE7B 1L6UA 1QLBB 4DXGA 4YXDB 5G5GA 1DGJA 2KACA 3BVZA 3SFEB 1RWSA 3VR9B 1NI3A 1V1PA 2LHDA 1FM0D 1C4PA 1VR9A 3KWVA 4B0EA 1JW9D 1TJEA 1CJEA 2FBWB 4WWMA 1QOBA 4AQ7A 1LO5D 3ZJVA 2WXPA 5D3IB 5H8YE 2HTME 3I9V1 3KLSX 4ZHOA 1KF6B 2KWDA 2MEKA 4LTUA 1D5ZC 3BK1A 5BYQA 2BT6A 1NVID 2W54A 2IPKD 2RMMA 2LMCA 1ZDVA 5FKAC 4YSYB 3U7ZA 2B76B 3Q8EA 1JWAD 1EU3A 2BS3B 1JALA 1FNUA 1PFDA 4P16A 2MJDA 1FIQA 5BMGA 1T5XD 1RM6C 4N59A 1C76A 3SEBA 1EU4A 2IGDA 1GB1A 1F2RC 5HI1A 3O13A 4OW0A 1XEEA 3FILB 4FXCA 4NAWB 4OZBA 1CK1A 1DOXA 1N5WA 2G9HD 1K52A 1Q10A 2FUG1 1C9FA 4KGSA 1ZDXA 2Y3AA 3UI3A 2WXGA 3DWGC 2I38A 2QMTA 3HVZA 1MVKA 4J3OD 2LGIA 2YEPB 1L4DB 2PMVA 2WU2B 2EKIA 1TY2A 3KWLA 1T3QA 1SB3C 3IXSA 1AN8A 1JWSD 1WSPA 1QF6A 1IGCA 1UGJA 1MPEA 1YQ3B 1XLPA 3AEEB 1UWXA 1FXAA 4ZRQA 2IDYA 3FILA 1FCLA 1E6EB 1L5PA 2LFIA 1JMLA 1SEBD 1EWCA 2BB6A 2WXRA 3Q8FA 2IJ0A 1XXGA 4MM3B 4RGNA 4L1BA 2WXFA 4PT5A 2H88B 1Y56A 1BXTA 1WGKA 4HROA 3BYTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AM9 A;  3AEG B;  1GAQ B;  1TKG A;  4YT0 B;  3AB5 A;  3AED B;  2N0S B;  2Y5C A;  3B9J A;  1FO4 A;  1KRH A;  4ZOH C;  1ZUD 2;  1F0Z A;  4JWU C;  3B2F A;  3DWM A;  2W55 A;  1ROE A;  4JX1 C;  3P4R B;  4ZHP A;  3VR8 B;  3AMZ A;  1RFK A;  1V8C A;  1KFY B;  1WYG A;  3AE7 B;  3RPF C;  5C3J B;  1L6U A;  1QLB B;  2M56 B;  4YXD B;  5G5G A;  1OFF A;  4YSX B;  1DGJ A;  5EE1 A;  3SFE B;  2KAJ A;  3AE1 B;  3NVZ A;  4KX6 B;  5AUK A;  1WGK A;  3P4S B;  1J7B A;  5G5H A;  1RWS A;  2AX5 A;  3BII D;  3VR9 B;  1E9M A;  1NI3 A;  1WWT A;  1E7P B;  2BS2 B;  1NYR A;  3P4Q B;  1FMA D;  3SR6 A;  1IUE A;  2WS3 B;  1TYG B;  1QT9 A;  1AYF A;  1J7C A;  3W5U B;  1FM0 D;  3ABV B;  4N6E B;  4C7Y A;  1XLN A;  1E0Z A;  2K5P A;  1N5X A;  1JW9 D;  3ZYY X;  1TJE A;  3AE9 B;  1CJE A;  2H89 B;  2FBW B;  4WWM A;  1QOB A;  1JRO A;  2MJE A;  1EWY C;  2PVO D;  5H8Y E;  3FAH A;  2HTM E;  3VRB B;  3AH7 A;  1WXQ A;  4US8 A;  2CJN A;  4ZHO A;  3NVW A;  1KF6 B;  3W9C B;  4LTU A;  2WLB A;  1L6V A;  1N61 A;  2K9X A;  3AE3 B;  2BT6 A;  1NVI D;  1A70 A;  1VLB A;  2W54 A;  5C2T B;  2WDV B;  1OQR A;  2LEK A;  3AEF B;  3P4P B;  5GXG B;  1RYJ A;  1VJK A;  4YSY B;  2WU5 B;  1TKE A;  1NEN B;  2L52 A;  3NVY A;  2B76 B;  2K22 A;  2G1E A;  2DBY A;  2DWQ A;  1ZXI A;  1L0V B;  1JWA D;  4YTN B;  2BS3 B;  1JAL A;  1QOA A;  2W3S A;  3P63 A;  1FFV A;  1PFD A;  3SFD B;  2MJD A;  1WRI A;  4C7Z A;  2WDR B;  2KMM A;  1V97 A;  1OQQ A;  1YJI A;  2JX5 A;  2QJL A;  3HUI A;  4N58 A;  1RM6 C;  1SF0 A;  1ZOY B;  3NVV A;  4USA A;  1B9R A;  1YQ4 B;  1GPX A;  4N59 A;  4WQM A;  2WQY B;  1NEK B;  3L4P A;  2L83 A;  3HRD D;  2PVG C;  3WCQ A;  1QOG A;  3AEA B;  4FXC A;  2PIA A;  3AV8 A;  3LXF A;  4A9A A;  1I7H A;  1DOI A;  1SIJ A;  3AE2 B;  3AE4 B;  4YSZ B;  1DOX A;  1N5W A;  1ZP0 B;  3CIR B;  2JQR B;  1JRP A;  3AE5 B;  4YTM B;  1FRD A;  1PDX A;  4C80 A;  4HRS A;  1QOF A;  1N62 A;  1JWB D;  5EE9 A;  1FFU A;  3EUB 2;  3DWG C;  3HVZ A;  5AUI A;  5MPO A;  2CJO A;  3CWI A;  3FC4 A;  1N63 A;  5H92 C;  5EE3 A;  1YJJ A;  2BS4 B;  2PKO A;  1FRR A;  1N60 A;  3AE6 B;  2WU2 B;  4IDI A;  2EKI A;  2ACZ B;  3KWL A;  1T3Q A;  4US9 A;  1SB3 C;  1NYQ A;  1XO3 A;  3NS1 A;  4ITK A;  2WDQ B;  1QF6 A;  1TKY A;  3NRZ A;  3AEC B;  2MJ3 A;  4YTP B;  1PUT A;  1YQ3 B;  1XLP A;  1XLO A;  3AEE B;  3ETR A;  1AWD A;  1FXA A;  5EE0 A;  2Q5W D;  2QIE B;  1E6E B;  1L5P A;  2OHF A;  2M19 A;  1VDV A;  3LB8 C;  2W3R A;  3B2G A;  1DOY A;  1E10 A;  3AE8 B;  3W5V B;  1FXI A;  3P1M A;  3AEB B;  1CZP A;  2CU3 A;  2MH7 A;  4JWS C;  2E3T A;  1UWM A;  2H88 B;  1XLQ A;  1JQ4 A;  3PO0 A;  2WP9 B;  1J7A A;  1R7S A;  1FIQ A;  4HRO A;  3VRA B;  3AN1 A;  4P6V F; 
#chains in the Genus database with same CATH topology
 5J2C A;  4KLG A;  4KDL B;  5HHD G;  3KYC D;  1FPY A;  5CHG A;  1F0Z A;  1KSP A;  1C78 A;  2KXJ A;  1BPB A;  2JF5 A;  4FE3 A;  4DQR A;  8ICB A;  4DS4 A;  3HWT A;  2EAP A;  2BCV A;  3M7D A;  3SQI A;  1MG8 A;  3SAF A;  3H0R B;  1OFF A;  4PGQ A;  4XA5 A;  4YSX B;  2XNA C;  4FN2 A;  4YD1 A;  2F1I A;  4Q2J A;  1G6J A;  3JPO A;  1M4V A;  3BVM A;  4XDC A;  2ON8 A;  1TS3 A;  2X38 A;  4BWM A;  4XUS A;  3GZF A;  2FLN A;  2YMM A;  1WZ0 A;  3SR6 A;  1Y88 A;  2BDP A;  7ICP A;  2HE7 A;  3N7R C;  4GXJ A;  5AI8 A;  1PK1 B;  3VXW A;  3W5U B;  5AK4 A;  2JEF A;  3R3M A;  5AKH A;  4DLG A;  2RPV A;  4N6E B;  4HEA 1;  1EM7 A;  4BUG A;  2WX0 A;  4Y2R A;  4W9L A;  4DL7 A;  3TBL D;  4C56 C;  3UMG A;  2WXL A;  5IIN A;  4EUT A;  5DCN A;  4WUR A;  4RUC A;  1HZ6 A;  3F53 A;  4P1B C;  3QYP A;  4M9G A;  1KLV A;  4KLF A;  3PX6 A;  1SXT A;  2G07 A;  2KIV A;  3RB4 A;  4IQV A;  3C8Y A;  3WAL A;  4HRO A;  3AEF B;  3QU4 A;  4GFJ A;  2RDJ A;  4K4G A;  4F5N A;  4Y2X A;  3GOE A;  3NVY A;  2K22 A;  1L3V A;  1PK1 A;  3Q8R B;  3QCA A;  3MR5 A;  5DGA A;  4M9J A;  1D5X C;  1SE2 A;  3KFU F;  4F4X A;  3PRM B;  4DDG D;  5KFX A;  3T79 A;  1UBI A;  4GU2 A;  2KMM A;  4FA6 A;  1Z2M A;  4UB4 A;  1IG6 A;  2G5I B;  4F93 B;  5CA7 A;  3MTN B;  2ZJA A;  4II2 B;  2JRI B;  4HJG E;  1EXN A;  2IYD B;  8ICM A;  1FCC C;  3APC A;  5A0L A;  5KFP A;  1VCB A;  1D8L A;  3T5H A;  1ZQA A;  4A9A A;  5KG3 A;  4FS1 A;  1ZE3 D;  1DOI A;  1P98 A;  1GC7 A;  1F52 A;  4PK1 A;  1WJ4 A;  1E8Z A;  3AE5 B;  2D5G A;  1MA7 A;  3RZW C;  1AQ6 A;  4DHZ E;  2QLT A;  3RTV A;  4KLI A;  3HT3 A;  1N62 A;  2RSU A;  2KIW A;  4FBU A;  2DZI A;  2K3U A;  3J81 j;  4ACF A;  1ARO P;  2ZIV B;  1ZQJ A;  3VDZ A;  4QAY A;  1CUK A;  4KSK C;  4QIW C;  2AQ3 B;  3R2I A;  2K8H A;  1FD6 A;  2ACZ B;  2M0A A;  2JUO A;  2E8N A;  3QWZ B;  4B9V A;  4MH8 A;  4XZ4 A;  3RNG C;  4DWF A;  5J0Y A;  3KUZ A;  3LWM A;  1HEZ E;  2Y5B B;  1VDV A;  3PTF C;  2W3R A;  1V80 A;  2MA9 B;  4O0I A;  4B9N A;  3AE8 B;  4BX9 C;  3ZDE A;  1DOY A;  3ISB A;  1SJH D;  3M62 B;  4YR2 A;  3DDH A;  1JQ4 A;  2KMD A;  1DK2 A;  4PHA A;  1OW5 A;  4MH0 E;  2KQS A;  2ZIV A;  4YMM A;  4GXK A;  2K4P A;  1WGR A;  5KFV A;  1R4M B;  1ZGU B;  1FO4 A;  4OHJ A;  5ALY A;  4MFA A;  1ZUD 2;  3R2T A;  3W1S C;  3E9S A;  4URK A;  2HTH A;  1L7O A;  2K4I A;  4OJP A;  1RFK A;  1KFY B;  3ZUN A;  3QX7 A;  1K1S A;  5IIO A;  3WU2 U;  2K4H A;  3BZD B;  2KO3 A;  8ICY A;  3O0F A;  4LNF A;  3ALR A;  4QZH A;  3AU5 A;  2PFN A;  4M8M A;  4KKI A;  5AUK A;  4AJY B;  5G5H A;  2JH1 A;  3LDZ E;  4TUS A;  2N9K A;  3ZDM C;  5KFB A;  3N97 B;  7ICR A;  3MC1 A;  1FMA D;  1HZ5 A;  2L8J A;  4AS1 A;  1T6B X;  3Q8M A;  3TAQ A;  3UQB A;  2ODG A;  3TKA A;  3LYS A;  2UVV A;  3TEX A;  3C1Y A;  3HPO A;  4J9O A;  4ELU A;  1RAX A;  2BYF A;  3ZYY X;  1WM3 A;  1NK8 A;  3QAR A;  4F1S A;  2JZZ A;  5E6O A;  4RQ2 A;  1Z00 B;  3WKC A;  1EWY C;  2PVO D;  3KYD D;  1D9F A;  2HHQ A;  2WXJ A;  2KX3 A;  4B9L A;  1IPG A;  1RRB A;  3W1S A;  3NVW A;  4HLE A;  4EX6 A;  4RQ0 A;  4KLT A;  2EAN A;  3QUT A;  9ICC A;  1WXA A;  4ZRI A;  3WKA A;  3RH4 A;  2H5X A;  5BYR A;  2W9A A;  1JXL A;  5ALV A;  5KAF U;  2BF8 B;  3P4P B;  3NGD A;  4B9M A;  2PE6 B;  3GE3 C;  5HR6 A;  5E6J A;  3KH0 A;  1XQQ A;  2ZCC A;  3U8Z A;  3H4B A;  2J0J A;  2W82 A;  2YEP F;  1S1Q B;  2J4X A;  2W3S A;  3GIK A;  4M0W B;  3KHH A;  1QSS A;  4KX5 A;  3SDL C;  1Z00 A;  2F77 X;  3WAP A;  3RF9 A;  3Q8Q B;  1YX6 B;  1OTR B;  2KFK B;  3HRD D;  1F2R I;  4WWO A;  1QCK A;  4RGT A;  1O08 A;  4ECW A;  1QOG A;  2J52 A;  2KWC A;  3EZ5 A;  1F77 A;  2PIA A;  5DDM A;  2ZJ5 A;  5KT2 A;  3E0F A;  5J29 A;  4IRD A;  3N32 A;  4YL8 A;  3AE2 B;  2ZUC A;  3CIR B;  2KJ9 A;  3M9N B;  2ZJD A;  4YXM A;  5L1M A;  4DQP A;  1K8R B;  5ALX A;  2LZ6 A;  1S3S G;  4AP4 C;  4REZ A;  1XO0 A;  2WF5 A;  4M0W A;  1N63 A;  9ICB A;  2P6R A;  4NLG A;  3X23 A;  2HVH A;  2F76 X;  9ICU A;  4I2H A;  1C79 A;  1XF5 L;  3RNC C;  2KX0 A;  5ALW A;  5DQH A;  3RJH A;  2KFK A;  1CEZ A;  1XLO A;  4BOZ B;  1X66 A;  4KX3 A;  2LGY A;  4I2G A;  4K7W A;  3OGU A;  3TMP B;  3PRE A;  2BKE A;  4MF2 A;  1WGD A;  8ICC A;  3NG0 A;  5DB8 A;  1CZP A;  2MA1 A;  4ZRP A;  4C8N A;  1I4P A;  5HMM A;  5LXI B;  4D2K A;  3AM9 A;  4I2E A;  2F8K A;  3W2D A;  1BPZ A;  4M01 A;  2PW9 A;  4I29 A;  5KFJ A;  1ZQP A;  4PS3 A;  4QWA A;  5AM3 A;  4ZOH C;  4X5V A;  4W9J A;  2YLM A;  4ECS A;  4N9F 4;  5IP4 D;  3TCA A;  4GIB A;  3PRP B;  3VAW A;  5J0P A;  2HDE A;  2WF9 A;  3ENE A;  2CHZ A;  1L2N A;  1V5T A;  2FMP A;  5KFM A;  4F4K A;  4A20 A;  1PK3 A;  4AYB F;  3Q8C A;  5J2G A;  1V5O A;  2KK8 A;  4JUZ A;  1KLN A;  1L8O A;  3V7K A;  2WF8 A;  4A55 A;  1WWT A;  2KLC A;  2HI0 A;  2Z0D B;  2A1J B;  2KDI A;  2W7O A;  1SSN A;  3VUW A;  2LI6 A;  3VHT C;  3LVV A;  4WAF A;  2BPC A;  2K5P A;  3I63 C;  4KLM A;  5AEK B;  4DHZ B;  3NUH B;  2D10 A;  3WA0 A;  1ZOL A;  2CJN A;  5I4D A;  3W9C B;  1WGY A;  7ICK A;  5KFZ A;  2KE7 A;  1HA5 A;  1PQS A;  5ALJ A;  3V6E B;  3Q14 C;  2KHV A;  1LVH A;  3NTU A;  4ECT A;  4C8L A;  1KQQ A;  4XE0 A;  4IQU A;  7ICM A;  1T0Q C;  2A1J A;  2FMQ A;  3VFK A;  3BQ2 A;  3PW2 A;  2PE9 A;  1QOA A;  2AHO B;  9ICR A;  1YX5 B;  7ICL A;  4Q45 A;  4R65 A;  5ALT A;  2E8M A;  2YY6 A;  2ESE A;  1P7E A;  4NQK E;  5ALO A;  5DLG A;  4N58 A;  2IHM A;  1IGD A;  1TAM A;  1ZQN A;  5KFG A;  1VZ8 A;  7ICQ A;  3Q3N C;  2HMX A;  2BQU A;  2L83 A;  4HKZ E;  4XYC A;  3WCQ A;  2Z7J A;  1S10 A;  2C7H A;  4ECZ A;  2NMQ A;  3MC0 B;  8ICT A;  3MGH A;  1ZP0 B;  4LNK A;  1WGG A;  2BTE A;  2LM4 A;  4UBB A;  4BGD A;  1WRD B;  2DL0 A;  2KJ5 A;  2XCP A;  1WXV A;  2ZPN A;  4IM3 A;  3TSS A;  4BFR A;  2WB1 C;  3RJE A;  4W9G A;  2ZJ8 A;  4RQ3 A;  3ZD9 A;  1QQR A;  4IWO A;  4ED2 A;  5DQI A;  4IKG A;  1KOT A;  2BS4 B;  5AM5 A;  3CRX A;  2LUM A;  4YCX A;  2I6X A;  1L4Z B;  4A8E A;  4Y2Q A;  1RQL A;  5K4L A;  4IW0 A;  4MEL A;  2PLP A;  3NRZ A;  4F71 A;  3SZ2 A;  3U30 A;  5IIM A;  1PUT A;  4H2A A;  1B0X A;  4OJO A;  5EE0 A;  4W9F A;  2XO7 A;  3JPS A;  1VZ6 A;  4MGI E;  3OJ4 B;  3JYU A;  5GTI U;  3ZTC A;  4ARI A;  4UAZ A;  2INC C;  2V4I B;  3ZNG C;  2JXT A;  3OLM D;  1B4F A;  2KFN A;  3LDA A;  5AM2 A;  2KJH B;  4RNA A;  3AN1 A;  1XU4 A;  2NYV A;  1TKG A;  3ZNI D;  1SKS A;  1ZPS A;  1SWW A;  4F4Z A;  3CF6 E;  3I5J C;  3TEW A;  2KMA A;  4JWU C;  2QHO A;  2A3V A;  4O3R A;  2ZTC A;  3AMZ A;  3Q3M C;  4PL1 A;  4I2J A;  3RNA C;  3AE7 B;  3ED5 A;  2AYO B;  4DSK A;  3HKZ F;  2DZJ A;  4I2A A;  1F1H A;  1TE2 A;  2ZXH A;  2PI4 A;  4QZC A;  3VUY A;  4EEL A;  3RH5 A;  4M9L A;  1K1Q A;  3BJY A;  5D94 A;  4RT2 A;  4ANU A;  5ALG A;  4DHJ D;  4WJO A;  2KTF A;  4HDO A;  2VJ5 A;  4OO1 J;  2YN4 A;  5EWG A;  1L7N A;  2ZCB A;  4G3I A;  2W7P A;  3N1Y C;  3PGE A;  2LVO A;  3SHQ A;  2JZB B;  3Q8L A;  1JW9 D;  3R9K A;  4FJY A;  2JRZ A;  1YD8 U;  5DBC A;  4BAX A;  4WWM A;  3EW9 A;  1LO5 D;  4UAS A;  9ICS A;  3AEV A;  2ZIW B;  2WXP A;  4FHK A;  5D3I B;  1HIW A;  2V4L A;  4M8N A;  3KLS X;  4Y2P A;  9ICF A;  3JPR A;  4ECV A;  2WTF A;  1UPH A;  1OXJ A;  2W54 A;  4B9S A;  2DEN B;  2IPK D;  2UYZ B;  2HBK A;  3RFA A;  1S97 A;  4RNN A;  1D3Z A;  1JN3 A;  4YSY B;  4LVS A;  4CO7 A;  4P0Q A;  1V2Y A;  3ZNH B;  4CGZ A;  4CNQ A;  3QU9 A;  4RM8 A;  4CF4 A;  1C1Y B;  8ICJ A;  1ZW7 A;  4B9U A;  3AUO A;  1P1A A;  2JZB A;  5AI6 A;  2BKF A;  1PFD A;  5AKL A;  3HW8 A;  1SZH A;  5IIL A;  2XY6 A;  1IM4 A;  5BMG A;  1RM6 C;  2ZIW A;  2KHQ A;  4UAU A;  4UB5 A;  2L0T A;  4N59 A;  4RZR A;  3VC8 A;  4BXO B;  1NBF C;  4ICV A;  3C2K A;  1F2R C;  5HI1 A;  3O13 A;  3RUI B;  5J18 A;  9ICO A;  1KW4 A;  1WCN A;  4BWJ A;  4KZC A;  3V6J A;  1SZP A;  4NAW B;  4NY0 A;  5DPT A;  4UAT A;  1CK1 A;  2K39 A;  2KN5 A;  3DOW A;  4FFD A;  4FS2 A;  2BQ3 A;  2ZPY A;  3S2A A;  5KFK A;  1Q10 A;  5AKJ A;  1ZDX A;  3UI3 A;  3QEA Z;  3DWG C;  2QMT A;  1WX7 A;  2YQE A;  4QW9 A;  1NDD A;  3M6Z A;  2D3D A;  5ALK A;  4KLD A;  5JZE B;  1L4D B;  4F5R A;  2KKC A;  2GH1 A;  5KG0 A;  1BPY A;  5KG7 A;  3PHW B;  3IXS A;  1AN8 A;  1WSP A;  3Q3F A;  3G6Y A;  2KJ8 A;  1VJ5 A;  4BXO A;  1UGJ A;  4GC7 A;  1MPE A;  3AEE B;  1FXA A;  4IM2 A;  4ZRQ A;  1ZQE A;  1FCL A;  1E6E B;  1L5P A;  2LFI A;  4NAW A;  7ICS A;  2IJ0 A;  4B9T A;  2HHT A;  4HJK A;  4L1B A;  5J2D A;  4PT5 A;  5ALM A;  3M63 B;  2JMG A;  5JHB A;  2F2A B;  1FIQ A;  2DPI A;  1PUZ A;  5EWF A;  7ICO A;  2RR9 A;  5DBA A;  4GXB A;  4F5P A;  1MQ2 A;  4F4W A;  1Q1O A;  3MR3 A;  2D3C A;  2W8L A;  2B0C A;  3P4R B;  1TS5 A;  3APD A;  4ZHP A;  2FE8 A;  5AKY A;  3VR8 B;  3IG8 A;  4ECY A;  4ED3 A;  2JYE A;  1LGR A;  5JU5 A;  2V4R A;  2KD0 A;  4W9D A;  3H0L B;  4JIO U;  2KTR B;  3N4M B;  1MHX A;  3RB3 A;  5J8Y C;  5KFS A;  4ICU A;  2IY1 B;  4DL5 A;  1E7P B;  2DYO A;  2HOF A;  3IFW B;  3R66 C;  4A6Q A;  3T5K A;  3RAX A;  5JRT A;  3U52 E;  4JB3 A;  4Y2V A;  1EUV B;  2C9W B;  2I2Y A;  2INN E;  2JHD A;  5GMV A;  3ISD A;  3KVF B;  4LLG M;  2KKV A;  3VTU A;  3VRB B;  3DHG C;  1Y8R C;  5KL8 B;  4IC7 B;  4QW8 A;  4TQ0 A;  2V4Q A;  1F5S A;  4UBC A;  5J17 A;  1FNW A;  1T7P A;  2KVS A;  3GS2 A;  2ZIU B;  2KTR A;  1E7V A;  2VA8 A;  2A5U A;  2H3Z A;  3PVX A;  1RYJ A;  1WE6 A;  1S77 D;  1HEK A;  5J8Y A;  2R8H A;  9ICN A;  2FID A;  2AGO A;  2BKR B;  1H8C A;  4CF5 A;  4A3O A;  2D3G A;  1H38 A;  3DCG A;  5HHH A;  3HUI A;  3UPQ A;  3T8M A;  2BR0 A;  1YJ1 A;  4WQM A;  2WQY B;  2ZG6 A;  2G3Q B;  3WK8 A;  4ASW C;  5LNK 1;  3AEA B;  4DSJ A;  2HHS A;  3UMB A;  4CRX A;  4RPZ A;  2HOI A;  4PHE A;  1NK7 A;  2ZIU A;  1SIJ A;  5D49 A;  3AE4 B;  3EFC A;  1S9F A;  1JRP A;  4K81 A;  3T5L A;  1FRD A;  5DPS A;  4LJX A;  3I57 A;  2M8S A;  4K3B A;  4YR0 A;  4QWD A;  1ZQZ A;  4EOY A;  2MHJ A;  4A90 A;  4C00 A;  4GLS C;  5KHO A;  2RPQ A;  1V49 A;  5H92 C;  1F44 A;  3BS5 B;  4P4O A;  3KUD B;  3ETL A;  2DAF A;  1E90 A;  3LWL A;  1SL0 A;  2Y0S C;  4Y2U A;  3G6V A;  1NYQ A;  3CSF A;  1J2M A;  4KLJ A;  2WDQ B;  1IYF A;  4O5K A;  5LLI A;  9ICX A;  3QC8 B;  3BQ7 A;  4IC9 A;  1ZJN A;  3PZD A;  3VQI A;  4I2B A;  3OAW A;  5KFQ A;  2QIL A;  1YIW A;  3PV1 A;  9ICG A;  4HPM B;  3ZW3 A;  1XT9 B;  3M9M B;  2O6V D;  3PVL A;  4MEM A;  2KVR A;  1UF0 A;  1WIA A;  3SD7 A;  4HCN B;  2JVC A;  2VA2 A;  4NLZ A;  2BPG A;  2LYH A;  2ZNV C;  2A19 A;  2RD0 A;  3BS5 A;  3KHG A;  2BCU A;  1I4X A;  2ZNV B;  3UIN B;  3ZGZ A;  2W55 A;  2LBO A;  2KN7 A;  4E3C A;  4Q8F A;  4IRK A;  5LXH A;  1TBE A;  3AUL A;  4DHJ B;  3ZO5 B;  2LYB A;  1ECW A;  3MHZ A;  4RQ7 A;  5AK6 A;  3RRH A;  1PGB A;  2N4F A;  4J9L A;  5G2N A;  1J7B A;  2AX5 A;  1KDH A;  3EPG A;  1MC8 A;  3TEZ A;  1A0P A;  3GP7 A;  4KV2 A;  3BZK A;  3HJE A;  2N7E A;  2PMZ F;  1K5O A;  1LQB A;  3DHI C;  2DYM A;  4MAC A;  5DG9 A;  1XD3 B;  2TSS A;  3AH7 A;  2VA3 A;  2KDF B;  2OWO A;  3C1Z A;  3GV7 B;  4DFM A;  2KAN A;  4RF0 A;  3ZJU A;  4EBE A;  2XVT A;  1X9W A;  3H7I A;  1XNS A;  4R8U B;  3BY4 B;  1L7Y A;  1UZX B;  7ICV A;  1P9D U;  5JXV A;  5IKC M;  1VJK A;  3QQ8 B;  4EZJ A;  2QCZ A;  1PVQ A;  1NEN B;  2L52 A;  2GLE A;  4ED1 A;  9ICT A;  3TAP A;  3P42 A;  3KHL A;  4HPL B;  4M02 A;  4EEY A;  2LGX A;  3V6H A;  1WYW B;  5HKH A;  3T3F A;  2CRX A;  4L23 A;  2KTQ A;  3B08 A;  4AUQ C;  4K4I A;  4IQW A;  4U6P A;  2GBN A;  1OEY J;  3NZ3 A;  4USA A;  2WHE A;  3SV4 A;  1R4N I;  4G9B A;  4ELV A;  1QQ5 A;  2EKE C;  2KVZ A;  1UBQ A;  5AHX A;  1RPL A;  2K1F A;  2KT7 A;  5ALS A;  1ZQC A;  1PYW D;  2KQ4 X;  3PLV A;  2LRW A;  3MFG A;  4EBD A;  4R8U A;  4LDT B;  1Z3E B;  4KLL A;  4RM9 A;  2JQR B;  4B6J A;  3QZ7 A;  1PDX A;  1TGZ B;  3EYZ A;  3MFI A;  3QNM A;  3EC8 A;  3MJW A;  4NZL B;  4AOF A;  5JH5 C;  4PJ0 U;  3GFK B;  3PO4 A;  2AH5 A;  1MFW A;  4BKT A;  2CR5 A;  2M4N A;  2JXJ A;  4KLO A;  2NBW B;  4BBN F;  3EUB 2;  2AL3 A;  4TUU A;  3GIJ A;  1E7U A;  1WWU A;  3DBH I;  3HP6 A;  4KLE A;  3GQC A;  2INP E;  5F9L A;  2Z8L A;  5E6P A;  3IT6 B;  4MSQ B;  4HCP B;  5ALP A;  4I6P A;  1CMX B;  2CXY A;  2W8K A;  1D9D A;  3OSN A;  3RJG A;  3MHS D;  2DNF A;  3UGB B;  4IS7 A;  3HIL A;  5KFT A;  5G55 A;  3OWE B;  2E3T A;  3MBY A;  2RDH A;  3PO0 A;  8ICH A;  1WZ3 A;  5D3D A;  2NS5 A;  4MT5 A;  2HW3 A;  5AK3 A;  3E56 A;  2FCS A;  2SEB D;  1I4R A;  4J9P A;  5HFY A;  3V61 A;  2G4D B;  5AKZ A;  2WGS A;  4LK0 M;  2D3A A;  4RGO S;  4I2I A;  1WYG A;  4UB1 A;  3F5A A;  4NM1 A;  1NNL A;  3R8B A;  1WG8 A;  1XCT L;  5C5J A;  5ALD A;  2AQ4 A;  1L0Y B;  2K0P A;  3H8H A;  1I4Q A;  9ICI A;  1PGX A;  2BS2 B;  4CQN A;  4JWM A;  7ICG A;  2R2O A;  1MJD A;  2ZW1 A;  1N6Z A;  1EF1 A;  4EKU A;  4PH5 A;  4WJQ A;  1ZD2 P;  4B6W A;  1E0Z A;  4Z6D A;  4WQO B;  4KN4 A;  5KFC A;  4P2H A;  3N7S C;  1YN5 A;  2H89 B;  5EDS A;  3TL5 A;  2E1E A;  1BNP A;  2GI9 A;  2KDB A;  4C4S A;  4X57 B;  1SV4 A;  5AIB A;  1YMH E;  3HM3 A;  2GBM A;  3UM9 A;  9ICK A;  3D2S A;  1T4G A;  3E2E A;  4JQW C;  4C4V B;  3N7P D;  2YTU A;  1N61 A;  4Q8E A;  1COK A;  4DOC A;  2FPL A;  1X9M A;  5C2T B;  2EAO A;  4RGM A;  5IIK A;  4DQQ A;  1L7P A;  5CEH A;  3UMC A;  2XGP A;  1KBU A;  2LXA A;  1YNT E;  1D4B A;  3A4R A;  3MC9 A;  4P0P B;  1S76 D;  3GB1 A;  2LHE A;  4KLH A;  5KG6 A;  1UCV A;  1V97 A;  4GXI A;  1CRX A;  3EGR A;  4LNN A;  4NQL B;  1SF0 A;  4NM2 A;  3NVV A;  7ICU A;  8ICI A;  2W9C B;  1KFT A;  1ET6 A;  1YQ4 B;  2PFP A;  2CS4 A;  3RNB C;  8ICP A;  1NEK B;  2VZK D;  3ZDT A;  4EEN A;  4CF3 A;  5L1J A;  2XY7 A;  1DXS A;  3BDP A;  4C8K A;  4C4V A;  2NRT A;  1V9J A;  1MG4 A;  1ZJM A;  2AQ2 B;  4YSZ B;  2H3V A;  4K3C A;  1RYR A;  3DEE A;  2NVU I;  4C80 A;  4K4H A;  1PVP A;  1JIH A;  1COO A;  3F2C A;  3BWU D;  1WJN A;  4NLK A;  2RDB C;  2WX1 A;  5KFR A;  2P66 A;  1BGX T;  4FLH A;  4P0P A;  5AUI A;  5JHA A;  2FCQ A;  2WFA A;  5D46 A;  5DQG A;  7ICI A;  4I6N B;  3X0W A;  4JE3 B;  3OHA A;  4C0Z A;  2XEW A;  5CB1 A;  2VH1 A;  2W9C A;  3MR6 A;  1T0Y A;  3UQ2 A;  4G0N B;  4MFC A;  3ZTD A;  2J6U A;  3RMK C;  3V72 A;  2K6Q A;  5DDY A;  1LV5 A;  2OHF A;  3URY A;  3LB8 C;  2O6V B;  4HDQ A;  4J9M A;  2KEY A;  2LWP A;  5KFN A;  4EEK A;  4RQ5 A;  1KKX A;  1FXI A;  3DQV A;  4FUL A;  4HPP A;  5HML A;  5AI0 A;  2BQR A;  1K50 A;  4DL6 A;  2PFQ A;  1Z19 A;  3CYM A;  1RQN A;  2G5H B;  4M2Y A;  4RCO A;  5KAI U;  3AEG B;  5DG8 A;  1NZB A;  3B0X A;  3V7L A;  5ALU A;  3PML A;  1QSL A;  4A3P A;  5KT5 A;  1TAQ A;  2N7J A;  1JRU A;  2M17 A;  2WAQ F;  9ICP A;  2MBO A;  2QEJ C;  3Q8K A;  2LJI A;  3PSI A;  1QLB B;  2MU2 A;  3UIO B;  3BVZ A;  2KNB A;  3PHX B;  3D6J A;  2Y1J A;  4PYZ A;  3RNE C;  2O6V A;  2W43 A;  4O3P A;  1NI3 A;  3PS6 A;  4QNL A;  2LHD A;  1H4R A;  1FM0 D;  4WWN A;  3RYT A;  3KWV A;  3MGV A;  2HCF A;  3WKE A;  4QZG A;  4F3O A;  4M47 A;  4BOS C;  2M9N A;  1TAU A;  1TJE A;  2WF6 A;  5BPC A;  1CJE A;  3JPT A;  4NJ7 A;  3VUX A;  4QZA A;  2B6G A;  4I6L B;  3ZJV A;  5H8Y E;  3QK0 A;  2HTM E;  3GE8 C;  4DK5 A;  5J2A A;  4BKS D;  1KF6 B;  4PPX A;  4XC2 A;  3R7R A;  3L08 A;  1D5Z C;  1RXV A;  4O5C A;  8ICZ A;  1Q5W B;  3RR8 A;  1NVI D;  3ZLZ A;  2LMC A;  2NRV A;  2PI5 A;  2KZZ A;  4J9S A;  5FKA C;  4QJF B;  2GOW A;  2B76 B;  3AU6 A;  1BPX A;  4GIV A;  1EU3 A;  3DDC B;  1JAL A;  2QAR B;  2A1A A;  3QA8 A;  4YMO A;  2IBI B;  4P16 A;  1UGM A;  2DHZ A;  4BVU C;  3HM6 X;  4HWI B;  2KFZ A;  2MRL A;  3WK6 A;  2KFJ A;  4DQS A;  4JV1 A;  5IAA C;  2G09 A;  4I2F A;  2N1W A;  2L05 A;  3SEB A;  1EU4 A;  2IGD A;  1QQ6 A;  2MLB A;  4RNO A;  2FLP A;  4OW0 A;  1XEE A;  5ALL A;  5KFD A;  3M8R A;  1T94 A;  4OZB A;  4WWP A;  1NZP A;  1DOX A;  1OEY A;  1Z5S B;  4J9N A;  1X6I A;  3AU2 A;  2G9H D;  2GMI C;  3BQ0 A;  2ASQ A;  1UQV A;  3ZRF A;  1U4A A;  4Q43 A;  2HHX A;  1N2X A;  2EMS A;  2Z59 B;  2YMP A;  4KMU A;  1C9F A;  2LVQ A;  2Y3A A;  2WXG A;  2QAR A;  4W9K A;  1SWV A;  3PLU A;  3SEI A;  5KT7 A;  4Z6C A;  2YEP B;  2K4E A;  2VH2 A;  2PMV A;  1V85 A;  2XCA A;  3D2Q A;  2NBU A;  3DBH B;  4J03 A;  3KZI U;  2EKI A;  3GIL A;  2CPR A;  3QU5 A;  1WM2 A;  1QF6 A;  3EPI A;  2D07 B;  4W9H A;  3HHM A;  3ZDC A;  3DV9 A;  1XLP A;  2NR2 A;  4PYU A;  4Y2J A;  4XGA B;  3Q8S B;  3DBL I;  2K8B B;  4UB2 A;  3WK5 A;  4QZ8 A;  4FO6 A;  4FHJ A;  2ALZ A;  4JV2 A;  1JML A;  1EWC A;  2MUT B;  3C28 A;  2HHV A;  4QWE A;  2EQY A;  3PW5 A;  4LZG A;  4UAW A;  3T5J A;  4G3X B;  2H88 B;  3H9D A;  5JUM A;  1WGK A;  1WXS A;  4TKN A;  3RZF A;  3APF A;  1WY8 A;  5ALR A;  4KN7 A;  1Q0W B;  1TY0 A;  3VTW A;  2WXQ A;  4XDD A;  1ZQL A;  3AED B;  2Y5C A;  3B9J A;  4KDI C;  4RPY A;  4Y2Y A;  2XK5 B;  2KSO B;  3B0Y A;  2ZXI A;  2CKH B;  1J19 A;  2KIC A;  3IRU A;  3AI5 A;  4NAM A;  5FP0 A;  4G50 A;  4R3D A;  4MHV A;  2M56 B;  2J6S A;  4NPN A;  4WJ3 B;  2GB1 A;  1MSW D;  1WCL A;  1OQY A;  2K8B A;  2P6U A;  2DQN B;  2MUT A;  2IGG A;  3AXC A;  3PR5 B;  5KFH A;  4RU9 A;  2R8G A;  2EDU A;  1IUE A;  3NJT A;  1TYG B;  1QQ7 A;  1QT9 A;  4JV0 A;  3PST A;  1VRA B;  4C7Y A;  1XLN A;  1N56 A;  1GG3 A;  1MQ3 A;  1WE7 A;  2KDE B;  3H8J A;  1FEH A;  4F7Z A;  2BBC A;  2E6X A;  2O2V B;  2JZP A;  2XK5 A;  3F2D A;  2KSO A;  1QKZ A;  3LJ3 A;  4IOI E;  1TIF A;  4JGH B;  3D32 A;  2WHI A;  2MP2 B;  5IA7 A;  1S0M A;  4YXJ A;  3GIM A;  1BUI C;  4FBT A;  1A70 A;  3H40 A;  2C2D A;  4HVB A;  1ACC A;  3PSE B;  4RMA A;  3D2N A;  4AYB C;  1OQR A;  3BS7 A;  4GSW A;  2PKE A;  1BPD A;  4LJP B;  2DBY A;  2YB4 A;  4P0Q B;  3NS8 A;  1L0V B;  3Q6B A;  4YTN B;  1GB4 A;  1SE9 A;  3NUQ A;  4K1R B;  5ALH A;  2CHW A;  3FM9 A;  3PV8 A;  3PPA A;  4KIT B;  2I1K A;  3M95 A;  5FR6 A;  3ECI A;  4DQO C;  1D8Y A;  1WRI A;  3HK0 A;  2O2V A;  3Q8A A;  3QUC A;  2NV3 A;  1NKE A;  1ZOY B;  3LYY A;  4BKG A;  4YN4 A;  1BML C;  2MP2 A;  7ICJ A;  2WXK A;  4E0D A;  2JYT A;  3EA6 A;  3QHT A;  1WJ6 A;  4I28 A;  3P2B A;  2BW2 A;  3UIP B;  3A0B U;  3V7J A;  4PHD A;  1KH0 A;  1KLU D;  4MEX A;  4HRS A;  5HG2 A;  2XIC A;  3SEN A;  1DYQ A;  2AQ1 B;  4DL2 A;  1SJE D;  4RH6 A;  1JWB D;  4JMU A;  3KOO A;  2HSZ A;  1FFU A;  3SAG A;  5CR0 A;  3EWA A;  3L0W B;  5TZV A;  2LUE A;  8ICG A;  1NJZ A;  3FC4 A;  2FLL A;  5EE3 A;  3WK9 A;  5TIS U;  1YJJ A;  2OCE A;  5KFW A;  2K89 A;  5KFO A;  3TIX A;  3VVW B;  3L13 A;  1OUQ A;  4IDI A;  5IOI A;  3QZ8 A;  4DSF A;  1IXR A;  4I27 A;  2KOB A;  1T0S C;  2BVC A;  3NS1 A;  3AL0 B;  1DK3 A;  5ALI A;  5KL1 B;  4EE2 A;  1AWD A;  3T3N A;  3E58 A;  5D7G A;  2E1F A;  5AKE A;  3IG3 A;  1ZQO A;  1KL9 A;  4DWI A;  2RDG A;  5DG7 A;  1RXW A;  2JGA A;  3B0A A;  2V1Y A;  2H3I A;  1VZ7 A;  4XQ8 A;  2MH7 A;  3WAN A;  2GBJ A;  4NWI A;  1EF5 A;  2O6K A;  3N20 C;  3U4E G;  1J0G A;  4P4M A;  8ICN A;  3N30 A;  1U49 A;  4WAA A;  2V3P A;  1WUD A;  3VH3 B;  2C28 A;  4EYH B;  1V81 A;  2KG5 A;  4C8M A;  8ICQ A;  3K9O B;  2LHT A;  1U45 A;  2M0N A;  1KRH A;  1ZQR A;  1I42 A;  5J2J A;  3FDS A;  4RQ6 A;  3C5F A;  2KDM A;  2L3Z A;  4TQS A;  1XS9 D;  2G4S A;  3SYZ A;  1TZO A;  3H8M A;  3OTQ A;  4AP9 A;  3UQA A;  2XBB C;  2JR5 A;  3RJF A;  4E74 A;  2DFL A;  2W11 A;  2PFO A;  1TK0 A;  1T0R C;  3WIM A;  3P4S B;  3KD3 A;  3RBD A;  2MAX A;  5C0Y A;  4RF1 A;  2DZK A;  4TQR A;  2C2R A;  4EZ9 A;  4GB9 A;  4OVZ A;  1QIL A;  4DXA B;  1TTN A;  1AYF A;  4ZYS A;  3M3J A;  2XID A;  2JPH A;  4KTQ A;  2Y5P A;  5BMI A;  4O5E A;  2D2Q A;  1Z4O A;  5AI9 A;  2KWU B;  2HDO A;  2DF4 B;  2OJW A;  1X1M A;  3CW2 C;  1L6N A;  2FUH B;  1KFD A;  4IUM B;  1WF9 A;  3IT4 B;  4KZ0 A;  2V0G A;  1I4H A;  2KJ6 A;  3QIJ A;  2WYQ A;  2NCN A;  2M1M A;  3Q8B A;  1CI4 A;  2FI1 A;  2JEJ A;  1ZXH A;  5J2F A;  4R63 A;  2LPE A;  3HKZ C;  1ZQM A;  1YZ6 A;  5AM1 A;  2WDV B;  4IG7 B;  3H7P B;  4KKJ A;  2WXI A;  5DPW A;  1WR6 E;  1SIF A;  5ALQ A;  5BOM A;  1YQB A;  1SL2 A;  2REX A;  3F5E A;  1Q46 A;  5KFL A;  4PL2 A;  2EEL A;  4PS7 A;  4KLS A;  2WXN A;  4EZ6 A;  5D6J B;  4BKS A;  3GII A;  2Y9U A;  1UUP A;  2IO3 B;  1Q3V A;  4DOA A;  2QJL A;  4LCD E;  1P0R A;  4XWW A;  1B9R A;  1GPX A;  2JEI A;  1U48 A;  5KT6 A;  4PGY A;  2DKX A;  3IN5 A;  4QWC A;  1SKR A;  2WXM A;  4GC6 A;  3AV8 A;  8ICW A;  3ONN A;  1ZQG A;  5F9N A;  2FCN A;  1TZ1 A;  3H7P A;  1X40 A;  2IOF K;  9ICA A;  3BYY B;  4O1N A;  5EE9 A;  2C5L C;  5MPO A;  2CJO A;  3I3T B;  2BB5 A;  4S17 A;  3V62 A;  2GO7 A;  2R18 A;  3Q3O C;  4RQM A;  4LZD A;  9ICJ A;  3I1Y A;  5FK9 C;  1L8L A;  2RHF A;  4MF8 A;  4GN1 A;  3PRZ A;  1C3T A;  5T14 A;  1XSP A;  1MN8 A;  2DPJ A;  5J0U A;  2YB1 A;  3CP8 A;  1LKY B;  3K9P B;  2AXT U;  2MJ3 A;  2OJR A;  3ETR A;  2QDF A;  3TQ1 A;  4DSL A;  3N9Y C;  2M0X A;  5TSS A;  5CX3 A;  3SMV A;  4UDU C;  5EWE A;  3DBL B;  2G45 B;  3P1M A;  1HUZ A;  4WJP A;  3OSP A;  1KLG D;  3WKD A;  1UWM A;  1XLQ A;  2NRW A;  2LMR A;  4QZI A;  1J7A A;  1R7S A;  4MGY E;  3VRA B;  4DS5 A;  2JH7 A;  2W03 A;  2JXX A;  1JXE A;  1CQV A;  2LKY A;  1T8E A;  2RLT A;  1QTM A;  3Q2A C;  2JSV X;  3VH4 B;  5AI5 A;  4EZK A;  1LKY A;  1HXY D;  3OG5 A;  2QB1 A;  5EE1 A;  4GLX A;  4F72 A;  4OJL A;  2KAJ A;  4TSS A;  3NVZ A;  3IBE A;  3L16 A;  3UF8 A;  3J9C A;  3BII D;  2FPK A;  1M94 A;  1ZQX A;  2N1R A;  1P7F A;  1NK5 A;  4Z6F A;  2G06 A;  2ASL A;  1J7C A;  4Z6E A;  1SKW A;  2BGF A;  1AW7 A;  2I1Q A;  3AE9 B;  2AL6 A;  3PW0 A;  1XSN A;  1JRO A;  4ED6 A;  1S5L U;  3FAH A;  1ZQK A;  2F1J A;  2IZV B;  2K9X A;  2LGS A;  3A1Q B;  2DLB A;  5T8I A;  1WX8 A;  2LAS A;  2K25 A;  3PZ8 A;  2IMW P;  4QZD A;  1TK5 A;  3ZQ4 A;  3KHR A;  2LEK A;  2JRH A;  3WKB A;  2R2Q A;  4QZB A;  3MDA A;  2WU5 B;  1TKE A;  2FJ6 A;  3RNF C;  1JCK B;  3THV A;  3C0R B;  1ZXI A;  2G0A A;  2CHX A;  4ED0 A;  1SGG A;  4F8R A;  3NY5 A;  4ECX A;  1MHH E;  4W9C A;  3TAD C;  5GTH U;  1NOM A;  1HTO A;  4QIW F;  1UA0 A;  4WIP A;  3SFD B;  3A0H U;  4C7Z A;  5CWR A;  2F1H A;  2MSN A;  4ANV A;  3PNC A;  2ZVN A;  3SV3 A;  3RN9 C;  4IL6 U;  3QJZ A;  2AJQ A;  3BQT A;  4YQW A;  1F9J A;  4L2Y A;  1Q8K A;  4J6I A;  3LXF A;  1XCQ L;  2GOL A;  3A1Q A;  2I5H A;  3BK2 A;  1I7H A;  1RYS A;  3ZNZ B;  2HBJ A;  4RUA A;  1TS4 A;  1EO6 A;  4M04 A;  3AQF A;  4IR9 A;  4C4R A;  3A9K B;  4CYE A;  1WWV A;  4M6W B;  4OD0 A;  2FNJ B;  4CDG A;  2JY6 A;  4ED7 A;  2N9X A;  2MRP A;  2R61 A;  2L7R A;  4HK2 A;  3H0M B;  3ICX A;  3TAD A;  1IV8 A;  5KG5 A;  2I9G A;  3ZDA A;  1FRR A;  3PSP A;  2PXI A;  1XO3 A;  3L17 A;  4K7S A;  1ZKH A;  2MX2 A;  2N7D A;  3C5G A;  1NJY A;  2GRI A;  3WAM A;  1FNV A;  3EEC A;  4HYK A;  3V3X A;  2Q5W D;  2MQJ A;  1GNU A;  2AGP A;  1IIP A;  4J9K A;  2NTS A;  1LB2 B;  3K4G A;  2E8P A;  4DSI A;  1V1P B;  1L5U A;  4KGT A;  1ZQQ A;  3MFH A;  3C29 A;  1SE3 A;  1WX9 A;  1KN5 A;  3A9K A;  3MR2 A;  4M6W A;  3PX4 A;  3G6X A;  2NO4 A;  4NJ8 A;  1TKD A;  1L0X B;  2DZM A;  3DWM A;  4PHP A;  2ZVO A;  4FZL A;  2HHW A;  2H3F A;  1BVS A;  1V8C A;  1URJ A;  2VAN A;  1HTQ A;  4DXG A;  1ZQ1 C;  4YXD B;  5G5G A;  3ISC A;  1DGJ A;  3U26 A;  2KAC A;  3DVN V;  2BPS A;  2BCQ A;  2DKZ A;  1V38 A;  1RWS A;  1L3T A;  3VR9 B;  9ICV A;  1V1P A;  3RT3 B;  3H1U A;  8ICR A;  3L3F X;  2L76 A;  2N9P C;  4JK1 A;  3AQE A;  1C4P A;  1YZ7 A;  1VR9 A;  5IO9 A;  4Y2S A;  4RQ4 A;  2ISO A;  3PY8 A;  2F3N A;  2FBW B;  9ICQ A;  1L3U A;  4AQ7 A;  4O3O A;  1JUD A;  2A4Z A;  2OYY A;  2LRU A;  3K1R B;  5DGB A;  5TR5 A;  3I9V 1;  3C23 A;  4RQ1 A;  2MEK A;  1BT0 A;  1LFD A;  5J0W A;  5DBB A;  2PJH A;  4PZO A;  2IHN A;  2BT6 A;  1D8B A;  1GC6 A;  2JZ3 B;  3KZX A;  1DOQ A;  2RMM A;  1NJX A;  1ZDV A;  2PEA A;  2HJ1 A;  3QEB Z;  4NV0 A;  1NK0 A;  4YD2 A;  3IM1 A;  4DF4 A;  1XC9 A;  3ML9 A;  4NXZ A;  4MDK E;  2EZX A;  3RH6 A;  3QX1 A;  2WF7 A;  1KM7 A;  1Z1B A;  1UA1 A;  3LVW A;  3NRW A;  2NRZ A;  2PMZ C;  3JPN A;  2V9H A;  2MJD A;  1DRG A;  3KKA C;  4TV3 A;  2GWS A;  1T5X D;  2QB0 B;  2HHU A;  3L54 A;  5C1Z A;  1BNO A;  5CHW A;  2K6D B;  5IN7 A;  1ZD5 A;  4RQN A;  1KFS A;  3C2L A;  1ZQI A;  1E8X A;  2VRR B;  3A33 B;  3DVG Y;  1GB1 A;  3FIL B;  4FXC A;  1WMH B;  2OOB B;  3NZS A;  3ZRC A;  3K75 D;  3C21 A;  4YVZ A;  4O3S A;  2RQ5 A;  4XWT A;  1X9X A;  4NLC A;  5CTR C;  9ICW A;  4F5Q A;  4ECR A;  3HIZ A;  2FUG 1;  5CHV C;  4KGS A;  1WJU A;  4TUQ A;  3HVZ A;  2I38 A;  1NI2 A;  2W9N A;  2MSE D;  2J6T A;  4GOC A;  2EMT A;  4IM0 A;  2HJ8 A;  4J3O D;  2LGI A;  2C22 A;  2WDT B;  1UT8 A;  4RPX A;  2K8A A;  1N48 A;  3RJJ A;  4I2D A;  2DAJ A;  1TY2 A;  3AU4 A;  1T3Q A;  2QB0 A;  1SB3 C;  3KKA A;  2NRX A;  1C20 A;  5KFA A;  1JWS D;  3IV6 A;  2K60 A;  1IGC A;  4QZE A;  1YQ3 B;  1GJZ A;  1UWX A;  2IDY A;  3FIL A;  1WMH A;  4EBC A;  3TFR A;  2RGF A;  1SEB D;  2BB6 A;  2WXR A;  1XXG A;  4JL9 A;  4MM3 B;  4RGN A;  1QH9 A;  8ICV A;  2WXF A;  4TUP A;  3CST A;  4YG2 A;  1WR1 A;  1BXT A;  1BPE A;  3JPP A;  8ICK A;  2BWE S;  2OH2 A;  4DF8 A;  3BIN A;  3BYT B;  4DFJ A;  4NY8 A;  5AKX A;  1GAQ B;  4ZDV A;  4BBN C;  2BCS A;  2MBB B;  2CN1 A;  5J2K A;  1J8C A;  1TT5 B;  4RQ8 A;  1X2I A;  2XN9 C;  4YFK A;  1L7M A;  1ROE A;  4JX1 C;  5C23 A;  4JPS A;  1KTK A;  2NTT A;  4UB8 U;  5KG4 A;  4IRC A;  4DFD A;  3OHB A;  4TQ1 A;  2KZM A;  3I28 A;  5J2I A;  4XX5 A;  4UB6 U;  2BQQ A;  4B0M A;  1YN4 A;  3UXN A;  2RP5 A;  3GV5 B;  3F2B A;  1SGH A;  3SD5 A;  3T9L A;  4A8X C;  2KK0 A;  5ALN A;  2HD5 B;  4RNM A;  4MM3 A;  1NYR A;  2KN4 A;  2WS3 B;  4MFF A;  3ZIM A;  2YML A;  4BZA A;  4FZM A;  2Q0Z X;  2OEH A;  1C77 A;  5KTQ A;  2EZZ A;  1TVA A;  2HVI A;  5AZF A;  4OJ5 A;  3IAS 1;  2BPF A;  2EZY A;  4FZN A;  1RZT A;  4LNI A;  2W9B B;  4OCZ A;  5KFU A;  3TFS A;  3PZP A;  1ZQD A;  3B1L X;  4J9R A;  1X6J A;  1D6E C;  5KFE A;  2ICI A;  4O3M A;  1QSY A;  1WXQ A;  2D3B A;  3MJ5 A;  5CP2 A;  3M9O B;  1WXM A;  4GDK B;  1JI7 A;  3H6N A;  3N1Z C;  3V05 A;  5D4B A;  4DFP A;  1NJW A;  5CRX A;  8ICE A;  1L6V A;  2LJ5 A;  4OJ6 A;  4ICA A;  1X9S A;  3BQ1 A;  4K7U A;  3DBS A;  4UAY A;  3C2M A;  4M00 A;  4ELT A;  1V9P A;  2Q4T A;  5GXG B;  2KLG A;  4F5O A;  2WB1 F;  3KBB A;  2KWV B;  3W1Y A;  5AZH A;  1QZE A;  2BDU A;  4ECQ A;  5AM0 A;  1ZQS A;  4F92 B;  2L0F A;  2J42 A;  5JTI A;  4ZRK A;  2KZR A;  5EOZ A;  1ZET A;  3TAR A;  3C19 A;  5J0O A;  1TFR A;  2W9B A;  2JX5 A;  2AGQ A;  5KFY A;  3RCZ A;  4FJV B;  3TAN A;  3IHP C;  1S0O A;  3L4P A;  4LJO B;  2PVG C;  4GDK A;  2E8O A;  5B5E U;  3WK7 A;  4KLQ A;  2ZIX B;  3BZC A;  2PPH A;  2J7Q B;  4F91 B;  4OZA A;  4GMV A;  3QUB A;  3QU2 A;  3V60 A;  1NK6 A;  3VCB A;  2D11 A;  2MBQ A;  4MSM B;  3ZJT A;  4O9M A;  2QKQ A;  2G08 A;  3TI0 A;  8ICO A;  4MGK E;  3Q8P B;  2KD1 A;  7ICH A;  1JWM D;  2JWZ A;  3CWI A;  3R7Q A;  3M1Y A;  9ICH A;  5D2M B;  2ZTE A;  4C4T A;  4ECU A;  3U2S C;  1B43 A;  2MBE A;  2BZF A;  4ED8 A;  3JSV B;  1N60 A;  4KGR A;  4ZRJ A;  4OZC A;  7ICN A;  1V86 A;  1ZD4 A;  2BYV E;  2GBK A;  5AM4 A;  5KFI A;  3DPD A;  3KUC B;  3MP9 A;  4MEY A;  8ICU A;  2YMQ A;  1R4N B;  4M0A A;  2KKP A;  1F0M A;  5DPR A;  2UVR A;  5L1L A;  1PZN A;  2ZIX A;  2PTL A;  3B2G A;  2JU6 X;  2FDR A;  3S6J A;  1RYU A;  3GDX A;  4WJN A;  1ENF A;  2CU3 A;  4DLE A;  5J0X A;  2WP9 B;  3H4D A;  3RI7 C;  4RT3 A;  5KHQ A;  4KVG B;  3RRG A;  2KHW B;  3OJS A;  1Z4N A;  2QSD A;  2SAK A;  1TK8 A;  3AB5 A;  2BWF A;  3Q69 A;  4PS8 A;  2XGQ A;  3TJP A;  4F8C B;  2AEH A;  3JSV A;  3MAB A;  2EH9 A;  3HVD A;  3PW7 A;  1P7D A;  1ZQF A;  4YWG G;  2KNJ A;  5C3J B;  7ICE A;  1V1O A;  5DB7 A;  1A5R A;  3K1Z A;  1B22 A;  2MCN B;  4OVU A;  4P1C C;  4S0R A;  2H3Q A;  4AJW A;  3P4Q B;  4IQT A;  1ZQT A;  4DL3 A;  3GZN I;  5AIA A;  4B9K A;  2XC9 A;  3KTQ A;  5BO4 B;  2P35 A;  4ZYN A;  2FIF A;  1N5X A;  4WH4 A;  1D5M C;  2N1V A;  4DDI D;  2IGH A;  2RDI A;  2ZZP B;  4RFB A;  4HXD A;  4TUR A;  3OPX A;  2WAQ C;  5J0T A;  4G11 A;  2GBR A;  2WLB A;  2GLS A;  5AKG A;  3DHH C;  3AE3 B;  5AI4 A;  4DL4 A;  2KVC A;  1WFY A;  4NJ6 A;  3ALB A;  5J2B A;  1VLB A;  2ISP A;  3CMM B;  4HKQ A;  3ZXR A;  5DKW A;  4YMN A;  5FR3 A;  4DO9 A;  2OED A;  2FPM A;  4BDP A;  1J97 A;  1ET9 A;  1K53 A;  2DWQ A;  3ZXV A;  2IOF A;  1YT3 A;  2ASD A;  3UXP A;  1TS2 A;  4P4P A;  1V6E A;  4KSL C;  1SV0 C;  3JPQ A;  2IND C;  2D8C A;  2BYT A;  1M6Y A;  2WDR B;  2WWZ A;  1OQQ A;  1YJI A;  2MWS B;  1UD7 A;  1KRP A;  2L00 B;  3T3O A;  2K8C B;  8ICX A;  1GOZ A;  1K51 A;  4E71 A;  8ICS A;  2WXO A;  2ES6 A;  1WI0 A;  1T3N A;  4UAV A;  2ZUB A;  3O65 B;  4ARC A;  1IP9 A;  3WK4 A;  4YR3 A;  3WAO A;  2IBK A;  1A6S A;  3QAQ A;  2UWQ A;  3ORY A;  1QOF A;  1C4C A;  3TUO A;  2I1J A;  1C7Y A;  2VZK B;  4HAI A;  7ICT A;  3NOB A;  3N1X C;  1SV0 A;  1NKB A;  3ONS A;  3I76 A;  5BMH A;  2WXH A;  2C60 A;  3PX0 A;  3KQ4 A;  1U47 A;  3RFZ B;  1XWL A;  2BHN A;  5J2R A;  5KFF A;  2K8C A;  3AEC B;  4YTP B;  2Y9T A;  2KC2 A;  3DBR I;  2C7M B;  4EYI B;  2M19 A;  4JWN A;  2UU7 A;  1E10 A;  1FXT B;  1RG6 A;  1ESF A;  4JWS C;  4R66 A;  4NJC A;  3UXO A;  2ZEQ A;  2AWT A;  5L1K A;  4M9H A;  4YT0 B;  2X8X X;  5KNI A;  1ED1 A;  4W9E A;  1GUA B;  3RJI A;  2L5Y A;  3V6C B;  4IWQ A;  2KZ3 A;  5L1I A;  3B2F A;  4GGQ A;  3IVF A;  3HX0 A;  3IAM 1;  3TAC B;  2R8K A;  2IO1 B;  2L32 A;  3RPF C;  4F4Y A;  2WNM A;  5F3X B;  3RJK A;  4DQI A;  5J2E A;  3AE1 B;  1JMS A;  3SU8 X;  5BOL A;  4KX6 B;  4P7I A;  3ML8 A;  1NK9 A;  1E9M A;  5KT4 A;  4CHK A;  5BYS A;  4EX7 A;  3SAH A;  2MW5 A;  2OXO A;  3CNH A;  3U7D A;  2B21 A;  1PVR A;  5E6N A;  3OJU A;  1SXE A;  2LYA A;  3IG5 A;  2BCR A;  2R8I A;  1I4G A;  3ABV B;  3DVG X;  2BYE A;  3TEY A;  3FKY A;  1UH6 A;  1L3S A;  4EZL A;  4QWB A;  3RB0 A;  2UVU A;  2MJE A;  4FAD A;  1ZQY A;  1C4A A;  1B1Z A;  3PT2 B;  4NLN A;  1JWU D;  4TMA B;  4US8 A;  4EEW A;  1ZQW A;  1RDF A;  1OGW A;  3MC8 A;  2J53 A;  4IR1 A;  1E5W A;  2N9L A;  2LVP A;  1VD2 A;  4B95 A;  2JWU A;  2KQ7 A;  1UT5 A;  1S0N A;  3KW5 B;  4MGZ E;  4J9Q A;  3JVZ X;  4FBJ B;  4Y2T A;  2G1E A;  4LDT D;  2V9W A;  4F50 A;  2D6F C;  1YN3 A;  4DXF A;  3P63 A;  1KTQ A;  1A77 A;  3RAQ A;  4DEZ A;  5B66 U;  2L1A A;  4XRH A;  1WGH A;  1FFV A;  3RBE A;  5DLF A;  1ZQB A;  1KEJ A;  2Y0S F;  5DB6 A;  2FE9 A;  2KV2 A;  3ZVV A;  3MGI A;  2KOX A;  2RRD A;  4AWJ A;  2FAZ A;  5KG1 A;  4Q44 A;  3M8S A;  3PMN A;  1STE A;  4F2R A;  5ALZ A;  2ATL A;  1HE8 A;  3N3K B;  1SBB B;  3A4S C;  1S8O A;  4GDL B;  4YTM B;  2IO2 B;  2DGZ A;  3ZDD A;  3RB6 A;  1WH3 A;  3ZI4 A;  8ICA A;  2HOQ A;  1YOV B;  5CHF A;  2B3A A;  2LI5 A;  1SXD A;  4KMO B;  3PZ7 A;  1PGA A;  2ONQ A;  1HQR D;  1ZQU A;  2EAM A;  2BGW A;  2PKO A;  1NK4 A;  1HUO A;  1NKC A;  1LM8 B;  1IBX B;  3AE6 B;  4US9 A;  1ZD3 A;  3GV8 B;  2JT4 B;  4ITK A;  1TKY A;  4BJQ A;  4LNO A;  2YVC A;  4W9I A;  3N28 A;  4U7C A;  3LK9 A;  1TV9 A;  3OJ3 A;  2QIE B;  2ZUD A;  4M9N A;  3ZD8 A;  3EHV A;  2AQ0 A;  4ANW A;  2IY0 B;  1MI0 A;  4KLU A;  3IHQ B;  3ZDB A;  3RUL A;  3W5V B;  1ZQH A;  4ACO A;  1GO3 F;  3A9J B;  1UNS A;  4GDL A;  3AEB B;  5AK5 A;  3H8S A;  5J0R A;  1Q3U A;  3GU3 A;  3BVG A;  3NZU A;  2V3N A;  1HJP A;  2W9M A;  2VKQ A;  2ZW0 A;  1J2N A;  4I2C A;  4P6V F;  3ZKJ C;  3QE9 Y;  1R4M I;  2JV3 A;  1SE4 A;  1E8Y A;  4II3 B;  1O03 A;  4JLC A;  2N0S B;  3NHE B;  1A76 A;  5L83 A;  1U4B A;  1IBX A;  4NL9 C;  5DB9 A;  3PW4 A;  2UVW A;  1DGS A;  4DOB A;  5AKK A;  1XSL A;  4MJS B;  4ANX A;  2C2E A;  1L6U A;  3QUQ A;  4OVV A;  2MBH A;  4ZH4 A;  2YX8 A;  5IIJ A;  3SFE B;  2JEG A;  2IA6 A;  3RD2 A;  2ASJ A;  4YP3 A;  1AAR A;  9ICM A;  4DBG A;  7ICF A;  5KT3 A;  3A9J A;  2J0M A;  4UB3 A;  2LGD A;  2Y1I A;  3GZN B;  3PSF A;  4B0E A;  2HBM A;  1ISN A;  1ZYQ A;  3JW0 X;  4R64 A;  3IDW A;  2KC1 A;  1QOB A;  2HBL A;  1E8W A;  3FYH A;  1RFA A;  1RLF A;  3QXG A;  4DFK A;  3PO5 A;  8ICL A;  4ZHO A;  1UHU A;  4UAR A;  5L95 C;  1P3Q U;  2KWD A;  2DX5 B;  4LTU A;  4NL9 A;  1UEL A;  4MJS A;  3BK1 A;  5J0S A;  4KIK B;  4O3N A;  5BYQ A;  1I35 A;  1KJT A;  4DSE A;  3L10 B;  2LM1 A;  2KMC A;  5HP4 A;  4O3Q A;  2ZTD A;  1XO1 A;  2V3S A;  1S0V A;  3PR4 A;  2VIX A;  3U7Z A;  4PGX A;  3MDC A;  3Q8E A;  3V6K A;  1JWA D;  2BS3 B;  2NPT B;  4UW9 A;  1FNU A;  2IO0 B;  5H2F U;  3DVN U;  2R8J A;  5CJ7 A;  4QZ9 A;  2F44 A;  4CCH A;  1Z1V A;  4FJZ A;  1QLN A;  4IWP A;  9ICL A;  4F2S A;  1C76 A;  4NLB A;  2OM6 A;  5J2H A;  4KIK A;  3H7S A;  5III A;  1N5W A;  5E79 U;  2IOH A;  3Q3J A;  1K52 A;  5AZG A;  1FEZ A;  2NO5 A;  4CE6 A;  4EFO A;  3QU7 A;  2NPT A;  2VJ4 A;  1MVK A;  5AKI A;  5HNK A;  2C7N B;  2FMS A;  3M6K A;  3SI8 A;  2AU0 A;  1U9L A;  2W04 A;  2LXC A;  2WU2 B;  4C8O A;  2XI9 A;  3KWL A;  2J0K A;  5ALE A;  1JX4 A;  2CU1 A;  3UQ0 A;  3RR7 A;  9ICE A;  1X42 A;  4NNJ B;  3IP4 B;  2F8L A;  5HHI A;  2KP7 A;  4DCC A;  5J0Q A;  2LD9 A;  3EFU A;  3NAS A;  4UQG A;  1LXD A;  1ZQV A;  4QZF A;  2KJR A;  3DBR B;  3Q8F A;  5AIC A;  5HR7 A;  8ICF A;  2QC8 A;  2KYW A;  2N9E B;  2Z0E B;  2DYB A;  1ZRN A;  3L5K A;  3H8W A;  1SL1 A;  4PZN A;  1Y56 A;  3VTV A;  2XY5 A;  1ZRM A;  5L9X A;  2DUY A;  2E5S A;  5ALF A;  5KG2 A;  2FCM A;  2NBV B; 
#chains in the Genus database with same CATH homology
 1GAQ B;  1TY0 A;  5HHD G;  2WXQ A;  4XDD A;  3AED B;  2Y5C A;  3B9J A;  1F0Z A;  1C78 A;  2XN9 C;  1ROE A;  4JX1 C;  3P4R B;  1TS5 A;  4JPS A;  1KTK A;  2NTT A;  2FE8 A;  4ZHP A;  3VR8 B;  4NAM A;  4R3D A;  2JYE A;  2M56 B;  4TQ1 A;  1OFF A;  4YSX B;  2XNA C;  4B0M A;  2GB1 A;  4Q2J A;  1MHX A;  1M4V A;  1YN4 A;  3BVM A;  4XDC A;  2ON8 A;  4A8X C;  1TS3 A;  2X38 A;  1E7P B;  2IGG A;  1NYR A;  2DYO A;  3SR6 A;  1IUE A;  2KN4 A;  2WS3 B;  4A6Q A;  1TYG B;  1QT9 A;  3W5U B;  1C77 A;  3U52 E;  4N6E B;  2RPV A;  1VRA B;  4C7Y A;  1XLN A;  4HEA 1;  2I2Y A;  2INN E;  1EM7 A;  3IAS 1;  4C56 C;  1FEH A;  2WXL A;  2BBC A;  2E6X A;  4LLG M;  4WUR A;  1D6E C;  2JZP A;  1HZ6 A;  1QKZ A;  2ICI A;  3VRB B;  1WXQ A;  3MJ5 A;  4IOI E;  4TQ0 A;  4GDK B;  3V05 A;  1L6V A;  1SXT A;  1FNW A;  3GS2 A;  1BUI C;  1A70 A;  3C8Y A;  1ACC A;  1OQR A;  3AEF B;  5GXG B;  1RYJ A;  3NVY A;  2K22 A;  2DBY A;  1L0V B;  1GB4 A;  4YTN B;  2J42 A;  1D5X C;  1SE2 A;  4DQO C;  1WRI A;  2KMM A;  2JX5 A;  3Q8A A;  3HUI A;  1ZOY B;  3LYY A;  4WQM A;  2WQY B;  4HJG E;  3L4P A;  2PVG C;  1FCC C;  1BML C;  3AEA B;  5LNK 1;  2WXK A;  3EA6 A;  2JYT A;  2BW2 A;  1ZE3 D;  4A9A A;  1DOI A;  1SIJ A;  3AE4 B;  4OZA A;  1JRP A;  1KH0 A;  1KLU D;  2D5G A;  3AE5 B;  1FRD A;  4HRS A;  5HG2 A;  3I57 A;  1DYQ A;  2AQ1 B;  3ZJT A;  1N62 A;  1SJE D;  4A90 A;  4RH6 A;  1JWB D;  1FFU A;  2K3U A;  1JWM D;  3CWI A;  4GLS C;  3FC4 A;  5H92 C;  5EE3 A;  1YJJ A;  3U2S C;  2AQ3 B;  3R2I A;  4KGR A;  1N60 A;  1FD6 A;  4OZC A;  4IDI A;  2ACZ B;  1NYQ A;  2M0A A;  3NS1 A;  2WDQ B;  3MP9 A;  4MH8 A;  4EE2 A;  1AWD A;  3T3N A;  5D7G A;  1HEZ E;  1VDV A;  2PTL A;  2RDG A;  2W3R A;  2JU6 X;  3B2G A;  3VQI A;  1DOY A;  3AE8 B;  2QIL A;  1VZ7 A;  1ENF A;  2CU3 A;  1SJH D;  2MH7 A;  1JQ4 A;  2WP9 B;  3U4E G;  2V3P A;  3AB5 A;  2SAK A;  2QSD A;  3Q69 A;  4OHJ A;  1FO4 A;  1I4X A;  1KRH A;  1ZUD 2;  3R2T A;  3ZGZ A;  3E9S A;  2W55 A;  2KDM A;  3HVD A;  1RFK A;  1TZO A;  1KFY B;  4YWG G;  5C3J B;  3BZD B;  1V1O A;  3MHZ A;  1PGB A;  5AUK A;  3P4S B;  4KKI A;  1J7B A;  5G5H A;  2AX5 A;  2N9K A;  4RF1 A;  3P4Q B;  4OVZ A;  1QIL A;  1FMA D;  1HZ5 A;  3TEZ A;  4AS1 A;  3GP7 A;  1T6B X;  1AYF A;  4ZYS A;  3TEX A;  2Y5P A;  5BMI A;  1N5X A;  3ZYY X;  4WH4 A;  1D5M C;  2DYM A;  2IGH A;  4MAC A;  1EWY C;  2PVO D;  2TSS A;  3IT4 B;  4RFB A;  2WXJ A;  3AH7 A;  2V0G A;  1I4H A;  3W1S A;  3NVW A;  4RF0 A;  3ZJU A;  2WLB A;  3Q8B A;  3AE3 B;  1ZXH A;  5BYR A;  1VLB A;  4HKQ A;  2WDV B;  3P4P B;  4KKJ A;  5FR3 A;  5JXV A;  2OED A;  1VJK A;  2WXI A;  5E6J A;  1ET9 A;  1NEN B;  2L52 A;  1K53 A;  2DWQ A;  2W82 A;  2YEP F;  2J4X A;  3P42 A;  1TS2 A;  2W3S A;  2EEL A;  2WXN A;  4L23 A;  2BYT A;  2WDR B;  1UUP A;  1OQQ A;  1YJI A;  2QJL A;  3NZ3 A;  4XWW A;  4USA A;  1B9R A;  1GPX A;  3T3O A;  3HRD D;  1F2R I;  2WXM A;  4RGT A;  1GOZ A;  1PYW D;  1K51 A;  1QOG A;  2J52 A;  2KQ4 X;  1F77 A;  2PIA A;  3AV8 A;  2WXO A;  3MFG A;  3AE2 B;  4ARC A;  3CIR B;  2JQR B;  1PDX A;  4NZL B;  1QOF A;  3BYY B;  1C4C A;  4O1N A;  3TUO A;  5EE9 A;  3EUB 2;  4REZ A;  5MPO A;  2CJO A;  2BB5 A;  4M0W A;  1N63 A;  2VZK B;  5FK9 C;  2INP E;  5BMH A;  2WXH A;  1C79 A;  3KQ4 A;  1XF5 L;  3RFZ B;  2Z8L A;  3IT6 B;  3AEC B;  2MJ3 A;  4YTP B;  1XLO A;  3ETR A;  3N9Y C;  2M19 A;  5TSS A;  4UDU C;  1E10 A;  3P1M A;  1CZP A;  1ESF A;  4JWS C;  3OWE B;  2E3T A;  1KLG D;  1UWM A;  1XLQ A;  4ZRP A;  2RDH A;  3PO0 A;  1J7A A;  1R7S A;  1I4P A;  4NJC A;  5D3D A;  3VRA B;  4MT5 A;  4D2K A;  3AM9 A;  3W2D A;  3E56 A;  1CQV A;  4YT0 B;  2PW9 A;  2SEB D;  1I4R A;  4ZOH C;  5HFY A;  3B2F A;  2JSV X;  3IAM 1;  4LK0 M;  2HDE A;  4RGO S;  2L32 A;  3RPF C;  1WYG A;  3R8B A;  1HXY D;  2WNM A;  1XCT L;  3Q8C A;  5EE1 A;  2KAJ A;  3AE1 B;  4TSS A;  3NVZ A;  1L0Y B;  2K0P A;  3H8H A;  3J9C A;  4KX6 B;  1I4Q A;  3BII D;  4A55 A;  1E9M A;  1WWT A;  1PGX A;  2BS2 B;  1P7F A;  4CQN A;  5BYS A;  1SSN A;  2ZW1 A;  1J7C A;  1I4G A;  3ABV B;  1AW7 A;  4WAF A;  1E0Z A;  2K5P A;  3TEY A;  3AE9 B;  2H89 B;  1YN5 A;  1JRO A;  2MJE A;  2GI9 A;  3NUH B;  1C4A A;  3FAH A;  1B1Z A;  1YMH E;  1JWU D;  4TMA B;  4US8 A;  2CJN A;  5I4D A;  3W9C B;  1HA5 A;  1N61 A;  2J53 A;  2K9X A;  2DLB A;  5T8I A;  3PZ8 A;  2N9L A;  5C2T B;  4RGM A;  2JWU A;  3ZQ4 A;  2LEK A;  4XE0 A;  2WU5 B;  1TKE A;  1JCK B;  2G1E A;  1YNT E;  1ZXI A;  1D4B A;  1MHH E;  1YN3 A;  4DXF A;  1QOA A;  3P63 A;  3GB1 A;  2LHE A;  2L1A A;  1FFV A;  4WIP A;  3SFD B;  4C7Z A;  1P7E A;  1V97 A;  3EGR A;  4N58 A;  1SF0 A;  1IGD A;  3NVV A;  1ET6 A;  1YQ4 B;  1VZ8 A;  1NEK B;  4HKZ E;  2L83 A;  2VZK D;  3WCQ A;  4L2Y A;  1STE A;  3LXF A;  1XCQ L;  3BK2 A;  2NMQ A;  1I7H A;  2AQ2 B;  3MC0 B;  4YSZ B;  1SBB B;  1ZP0 B;  4GDL B;  4YTM B;  1TS4 A;  2BTE A;  4C80 A;  3BWU D;  3TSS A;  1QQR A;  3PZ7 A;  1PGA A;  2ONQ A;  5AUI A;  1HQR D;  2R61 A;  4IKG A;  2BS4 B;  4JE3 B;  2PKO A;  1FRR A;  1IBX B;  2LUM A;  3AE6 B;  1L4Z B;  4US9 A;  1XO3 A;  2PLP A;  4ITK A;  1TKY A;  3NRZ A;  2GRI A;  1PUT A;  4H2A A;  1FNV A;  3V3X A;  5EE0 A;  2Q5W D;  2QIE B;  1VZ6 A;  3URY A;  2OHF A;  3LB8 C;  4ARI A;  1MI0 A;  2V4I B;  2NTS A;  1V1P B;  2JXT A;  4KGT A;  3W5V B;  1FXI A;  4XWT A;  1UNS A;  3AEB B;  3BVG A;  1K50 A;  1SE3 A;  2V3N A;  4RCO A;  4RNA A;  3AN1 A;  2ZW0 A;  3AEG B;  4P6V F;  1SE4 A;  1TKG A;  1ZPS A;  2N0S B;  3TEW A;  2N7J A;  1L0X B;  4JWU C;  3DWM A;  1IBX A;  2QEJ C;  3AMZ A;  2LJI A;  1V8C A;  3AE7 B;  1L6U A;  1QLB B;  4DXG A;  4YXD B;  5G5G A;  1DGJ A;  2KAC A;  3BVZ A;  3SFE B;  1RWS A;  3VR9 B;  1NI3 A;  1V1P A;  2LHD A;  1FM0 D;  1C4P A;  1VR9 A;  3KWV A;  4B0E A;  1JW9 D;  1TJE A;  1CJE A;  2FBW B;  4WWM A;  1QOB A;  4AQ7 A;  1LO5 D;  3ZJV A;  2WXP A;  5D3I B;  5H8Y E;  2HTM E;  3I9V 1;  3KLS X;  4ZHO A;  1KF6 B;  2KWD A;  2MEK A;  4LTU A;  1D5Z C;  3BK1 A;  5BYQ A;  2BT6 A;  1NVI D;  2W54 A;  2IPK D;  2RMM A;  2LMC A;  1ZDV A;  5FKA C;  4YSY B;  3U7Z A;  2B76 B;  3Q8E A;  1JWA D;  1EU3 A;  2BS3 B;  1JAL A;  1FNU A;  1PFD A;  4P16 A;  2MJD A;  1FIQ A;  5BMG A;  1T5X D;  1RM6 C;  4N59 A;  1C76 A;  3SEB A;  1EU4 A;  2IGD A;  1GB1 A;  1F2R C;  5HI1 A;  3O13 A;  4OW0 A;  1XEE A;  3FIL B;  4FXC A;  4NAW B;  4OZB A;  1CK1 A;  1DOX A;  1N5W A;  2G9H D;  1K52 A;  1Q10 A;  2FUG 1;  1C9F A;  4KGS A;  1ZDX A;  2Y3A A;  3UI3 A;  2WXG A;  3DWG C;  2I38 A;  2QMT A;  3HVZ A;  1MVK A;  4J3O D;  2LGI A;  2YEP B;  1L4D B;  2PMV A;  2WU2 B;  2EKI A;  1TY2 A;  3KWL A;  1T3Q A;  1SB3 C;  3IXS A;  1AN8 A;  1JWS D;  1WSP A;  1QF6 A;  1IGC A;  1UGJ A;  1MPE A;  1YQ3 B;  1XLP A;  3AEE B;  1UWX A;  1FXA A;  4ZRQ A;  2IDY A;  3FIL A;  1FCL A;  1E6E B;  1L5P A;  2LFI A;  1JML A;  1SEB D;  1EWC A;  2BB6 A;  2WXR A;  3Q8F A;  2IJ0 A;  1XXG A;  4MM3 B;  4RGN A;  4L1B A;  2WXF A;  4PT5 A;  2H88 B;  1Y56 A;  1BXT A;  1WGK A;  4HRO A;  3BYT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...