3NRZA

Crystal structure of bovine xanthine oxidase in complex with hypoxanthine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nrzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nrzA01
3AN1A 4C7ZA 3P4QB 3AMZA 3DWGC 1TKGA 2PVGC 3VRAB 1PUTA 3RPFC 4C7YA 2L83A 3CWIA 4YSYB 1WWTA 3AECB 1A70A 2BS4B 1N63A 3AB5A 1YJIA 2L52A 1XLOA 3FC4A 3B9JA 1T3QA 2W54A 2PVOD 3FAHA 1DGJA 2WP9B 1SF0A 1ZUD2 1WXQA 4N6EB 1NI3A 3ABVB 1RFKA 3P63A 1AWDA 4N58A 2DWQA 2WDRB 3P4RB 1NEKB 3AE2B 1N61A 2KMMA 3AE9B 1NVID 1XO3A 2WU5B 5MPOA 3AE1B 4ITKA 3P1MA 3W5VB 4ZHPA 1EWYC 1B9RA 4WQMA 2AX5A 1J7AA 2E3TA 2OHFA 2EKIA 4US8A 1F0ZA 3L4PA 1QOBA 2QIEB 3VRBB 3HRDD 1YQ3B 2WLBA 3AEFB 2M56B 3HUIA 1YJJA 1L5PA 3NVWA 1JALA 1NYQA 2CU3A 1L6UA 2FBWB 2W3RA 1FFUA 2ACZB 2H89B 1E6EB 2CJOA 2Q5WD 3AEDB 1V97A 3AH7A 1KRHA 3B2GA 1JRPA 4FXCA 1R7SA 4WWMA 3ZYYX 2BT6A 3AV8A 4ZOHC 5EE1A 3NVYA 1FXIA 1V8CA 1NENB 2BS2B 1L6VA 1ZP0B 1JROA 4YSXB 3SR6A 5G5HA 1FRRA 1QT9A 1RM6C 2DBYA 3AE4B 3LB8C 1E9MA 1SIJA 1GAQB 1WYGA 1ZXIA 1TYGB 4YT0B 5AUKA 5C3JB 1FO4A 1E7PB 4N59A 2K22A 1OFFA 1QLBB 1WGKA 1J7CA 3PO0A 4ZHOA 1DOIA 1JQ4A 4YXDB 3ETRA 3HVZA 4JWUC 2QJLA 4JWSC 1N5WA 3NRZA 2H88B 1AYFA 1CJEA 1TKEA 3VR8B 3NVZA 3NS1A 4LTUA 1OQQA 3AE7B 5EE0A 2WDQB 1FIQA 2N0SB 3AEGB 1CZPA 5GXGB 1FM0D 1PDXA 1L0VB 2LEKA 3P4PB 4KX6B 4YTPB 1XLPA 4P6VF 1DOXA 1RWSA 1E0ZA 1IUEA 1WRIA 2Y5CA 4IDIA 1PFDA 1QOFA 1QOAA 2B76B 2MJ3A 5G5GA 3SFDB 3AEEB 1VDVA 3AEAB 1KF6B 4USAA 4YTNB 1RYJA 2G1EA 2K5PA 3P4SB 1ZOYB 4YTMB 1YQ4B 4HROA 1QOGA 5AUIA 1VLBA 1N60A 1FFVA 2KAJA 2MH7A 2MJEA 2W55A 3AE8B 5C2TB 2W3SA 1TKYA 1JWAD 1XLNA 1I7HA 3NVVA 4C80A 1JWBD 1FXAA 3VR9B 3WCQA 2JX5A 4HRSA 1NYRA 3W9CB 3AM9A 4YSZB 2WU2B 3SFEB 2MJDA 1OQRA 1GPXA 4US9A 2BS3B 2HTME 1N5XA 3B2FA 1UWMA 1ROEA 2CJNA 3AE5B 3EUB2 1TJEA 4A9AA 2WDVB 3BIID 1N62A 1JW9D 2WQYB 1FMAD 2M19A 3AE3B 1DOYA 2WS3B 3DWMA 3AE6B 3CIRB 4JX1C 1VJKA 5H92C 1FRDA 3KWLA 1E10A 2JQRB 5EE9A 2K9XA 2PKOA 1QF6A 1XLQA 2PIAA 1J7BA 1KFYB 5H8YE 3W5UB 1SB3C 3AEBB 5EE3A 3LXFA
chains in the Genus database with same CATH superfamily
4IQUA 3P4QB 1STEA 3AMZA 4M0AA 5AKEA 3KBBA 1UPHA 4F50A 1U47A 4C4SA 5AKHA 3ZLZA 1A70A 3KYDD 4ICAA 4Y2SA 5ALUA 1FEHA 3T8MA 1IYFA 2LZ6A 1T6BX 2LGIA 3MFGA 2BB6A 4KKJA 4GXJA 1SKWA 5DPWA 1NZPA 3UXOA 4F4KA 5CA7A 4LNOA 4NAWB 1H4RA 1E8ZA 1J97A 1BPDA 5AK3A 1WJUA 5KG4A 1EWYC 5KG6A 5AKYA 2NRVA 2E3TA 1C7YA 5HP4A 2HBMA 1SBBB 2ZTCA 4US8A 4U7CA 4YP3A 1F0ZA 1HE8A 3HRDD 2QB0A 3LWLA 4RPYA 1YN4A 2IY1B 4FJVB 2V4IB 3Q2AC 1L5PA 1S77D 2CHWA 3SENA 1VZ8A 3V60A 2BCQA 3AH7A 1B22A 2Q5WD 2HDOA 3JVZX 2QHOA 5EE1A 3AV8A 4ZOHC 2ESEA 5BO4B 5J2FA 1S0NA 4PS7A 2KN5A 3SR6A 1XSLA 3RUIB 1TYGB 2VA8A 5ALEA 2D3BA 3BVZA 3WKBA 5AM3A 2BYVE 5IKCM 1D5XC 5HR6A 3C28A 3Q8BA 3ETRA 4ECWA 3GFKB 2AU0A 4QZ8A 4JWUC 7ICVA 5D2MB 2INNE 1K5OA 3SAFA 1SL0A 5L1MA 3ZD8A 4KGTA 2V9HA 1LFDA 3RAXA 2AQ1B 5L95C 2I2YA 4WAAA 2FPLA 5J0YA 1CZPA 2ZZPB 1XD3B 3JPTA 3NUQA 2GLEA 1V38A 1SL2A 1ACCA 1X1MA 2KQSA 1PK3A 4ELVA 7ICHA 4WJOA 2LVPA 2D8CA 1WRIA 2QILA 3WAOA 1D8BA 2I6XA 1ZD2P 3HKZC 4Y2PA 4EEYA 2GB1A 3WAMA 3T3FA 3TIXA 4EBCA 4FULA 4ZRKA 2ZIWB 2MBBB 5IA7A 3APCA 7ICSA 5EOZA 1Y56A 2KP7A 1QH9A 5DGAA 2ZNVB 2OEDA 1E90A 3M1YA 3IAM1 1T4GA 3KZXA 1GPXA 3MHZA 3E9SA 3HWTA 2ASDA 2NTSA 2UYZB 5A0LA 3R7RA 2HOFA 3DHGC 3VCBA 1C4PA 4KVGB 3ZVVA 3B08A 2F1HA 2RDIA 2LXCA 2AQ0A 1NK6A 5KFIA 4J9RA 3ETLA 2KNJA 4P1BC 1AN8A 3ZO5B 2DENB 1UZXB 4EKUA 3T3OA 2E1EA 3C5FA 2H88B 4W9LA 4G9BA 4UATA 2UWQA 3Q8CA 4BBNF 4BWJA 2PXIA 1E7UA 2K8CA 4C8LA 5BYRA 2E1FA 2ZIUA 2IBKA 4B9UA 1O08A 3RFZB 1NNLA 3QK0A 3U26A 4NQKE 3AU4A 3SAGA 2ISOA 5DQGA 5KFBA 5BOLA 1JN3A 3WK7A 1NZBA 5KG1A 2BW2A 1X66A 2DAJA 1MQ3A 4R65A 7ICFA 1Q10A 4BJQA 1XO1A 3WA0A 2EAPA 4BKGA 4ITKA 5CR0A 5E79U 3U2SC 2ZJAA 2OHFA 2J6SA 4OJPA 3ZXVA 2EMSA 3F2CA 3L4PA 2ZIXB 2QIEB 2IPKD 4IW0A 1AARA 4RT2A 2ZW1A 2N1VA 3IG3A 3R2IA 3V62A 1L6UA 1WCNA 5ALGA 2R8KA 3M6KA 1WGGA 5JRTA 3APDA 2A1JB 4MSMB 2E6XA 8ICKA 2WAQC 4O5CA 3ONSA 1HZ5A 3RB4A 3LB8C 4J9LA 1F2RI 3KHHA 3LDAA 4C8OA 1E7PB 2PI5A 1C1YB 1K53A 3HJEA 1FCCC 3PV8A 1L7OA 5J2BA 4KLFA 1BNPA 4RNAA 1T7PA 2LBOA 1ZQLA 4IRDA 1RLFA 2L3ZA 4CQNA 3JPNA 2FUG1 4EBEA 2YB4A 3H8SA 3T5JA 4HJGE 4RF1A 1GNUA 3PVLA 2LPEA 3ZJTA 5J2DA 2ZW0A 4ED3A 4RQ0A 3QZ7A 2DLBA 4YTPB 5CB1A 1BNOA 2LI6A 4GGQA 2HOQA 4ECQA 4F5PA 2MJ3A 4QZ9A 4YD1A 3FDSA 3QEAZ 2HHTA 4J9NA 3H8MA 1R4MB 4HPLB 9ICFA 4YR2A 3M9MB 1N2XA 2KIVA 5JU5A 3EZ5A 4Y2XA 2FI1A 3E0FA 2BQQA 8ICTA 4GN1A 2QARB 5J8YC 1GO3F 3OTQA 4PPXA 2WXNA 3TADA 1JWSD 4GC6A 2R2QA 1LQBA 4GXBA 2D3DA 4WURA 4LCDE 2OM6A 5C0YA 4BKSD 2BDUA 3Q8RB 1N5XA 4ELUA 4L2YA 4RCOA 5AZHA 2SAKA 2HBKA 1IBXB 7ICGA 3MDAA 3HKZF 1PGXA 2KWUB 3APFA 2K3UA 5CP2A 2KE7A 1BMLC 2YX8A 2K6QA 1ZQUA 1RPLA 3AE3B 3QU7A 1SE4A 4ED8A 2KC1A 3BYTB 3TEXA 4ZDVA 3V6HA 2CXYA 9ICWA 1WXMA 1L0YB 3TANA 1SIFA 1XLQA 2PIAA 4BOSC 4PK1A 4MGIE 4J3OD 1NI2A 1XCQL 9ICBA 1SZPA 3A9JB 3IHPC 3H8WA 1DRGA 3TJPA 4MFFA 4GOCA 5JHAA 3OSPA 5L1JA 4IM2A 1ZJMA 4YSYB 3GV7B 1WX7A 4A20A 4BAXA 1IP9A 2HBLA 1GC7A 4XUSA 2H3VA 2GOWA 1ZQRA 4Y2UA 5BPCA 4F5OA 2JGAA 1QILA 2MEKA 2ZXHA 3W1SA 2EZYA 1L2NA 2EELA 4M00A 2KTRA 3WALA 9ICOA 1E8YA 2G45B 4XZ4A 3F53A 5DKWA 2XEWA 3QZ8A 3VDZA 1EU3A 5IN7A 5L1IA 3VXWA 3GE8C 3QU5A 3QE9Y 1Z2MA 2CKHB 2YEPF 2LYAA 3MC1A 4LJPB 3EPGA 3HUIA 3NGDA 1NYQA 4J9KA 4ED0A 2IYDB 1RXVA 5KFJA 4PYZA 3ZNID 2QB0B 4LZDA 1CQVA 3AE4B 5CX3A 4DFJA 3DHHC 4JK1A 2FCNA 4M47A 2F3NA 1OFFA 4ZHOA 2BCSA 4NLZA 1HJPA 1BGXT 4ANUA 9ICHA 3ZNHB 2WNMA 4LNFA 1MFWA 3AEGB 2NBVB 4R3DA 3I28A 4J03A 8ICWA 1WUDA 5KFSA 1KTQA 2LGSA 5DPSA 2K8AA 2LGYA 2WAQF 2KDFB 3IVFA 2M17A 5J2RA 3DEEA 1V49A 3VFKA 2AQ3B 4HWIB 4U6PA 1ZQQA 3V7LA 4M8NA 4BUGA 1KF6B 2E5SA 4KLGA 3IDWA 4KLEA 1Y88A 2KYWA 1VCBA 2JRZA 2DYOA 2BF8B 2FMQA 3P4SB 3PW0A 1SSNA 2Y1IA 1XSNA 2KX3A 2WXPA 3VH3B 5AI4A 1WMHA 2LUEA 2NRWA 3WK5A 3MGIA 3H8JA 4M02A 3QWZB 3LVVA 3AU2A 4EEKA 5F9NA 2KZRA 4HCPB 3LDZE 3W9CB 3ZD9A 3MC9A 2WU2B 1BXTA 2MJDA 2WX1A 2BB5A 2JEJA 1C79A 1B43A 3PRZA 3Q8PB 1KFTA 1XWLA 4QWBA 4BGDA 2AQ4A 3PW2A 2CHXA 4CF4A 4CRXA 2HHWA 1WZ3A 1SKSA 2XY7A 4R66A 2LKYA 1TT5B 2FLNA 1MN8A 4Y2YA 3VRAB 5AHXA 4M9GA 1J19A 4QW8A 4OHJA 8ICAA 3RJHA 4IR9A 4NLGA 1PUTA 4O5EA 4DF8A 3WKAA 1K1QA 4GSWA 4FE3A 4R8UA 3DBLB 2UU7A 3PX6A 2L52A 2LYBA 1DK2A 5BYQA 3FILA 2HE7A 3GS2A 1JXEA 1XO0A 1AQ6A 2K8CB 3FYHA 4F5QA 1EUVB 3PT2B 3N32A 2RMMA 1CEZA 3WKDA 4KGSA 2ZIUB 1D9FA 2W9CA 2UVWA 2E8MA 3UMCA 4QJFB 4AQ7A 5CHVC 4BZAA 4S0RA 3F5EA 4QIWC 2KHQA 5ALVA 1P7FA 2NPTA 2F76X 1A6SA 4AP9A 3HX0A 4M9NA 1WY8A 1QSSA 1UGMA 1UT8A 2WWZA 3IT4B 1RYRA 3L3FX 2IJ0A 1WGHA 2FCSA 1QKZA 4F3OA 5C23A 4DL7A 4LJXA 1E6EB 1ZQNA 4W9IA 2I1QA 4WWMA 2BT6A 4ECVA 1AW7A 1TGZB 2BS2B 3JSVA 4FO6A 4AWJA 4BKSA 1L3TA 2LFIA 4W9GA 2G5HB 5I4DA 4R64A 5AKLA 4BWMA 5J0OA 4UB8U 3Q3JA 5KHOA 4QZCA 3PS6A 4PGYA 3DVNU 5DB8A 4ZRPA 4TQRA 3GZNB 1OQQA 4F92B 4KLSA 5EE0A 5IIJA 3BZDB 4RGOS 2A4ZA 4YMOA 1PDXA 4KLQA 2LRUA 1E7VA 2OJRA 3RH5A 3ZXRA 1U4BA 2BCRA 3X0WA 2B76B 2IA6A 2JVCA 1HTOA 1YOVB 2VRRB 3BVMA 4PHEA 4OJ5A 2XC9A 1NJXA 3Q3MC 4USAA 5AI8A 1YX5B 2XY5A 1SKRA 1D9DA 3KVFB 3NZUA 1V5TA 9ICQA 1I4PA 1V6EA 3N1XC 4MF8A 2HCFA 2FDRA 2LASA 1E5WA 4GLXA 1QLNA 4P4PA 1TFRA 4FBUA 3O13A 1V85A 4QZGA 4DQQA 3F5AA 2P6RA 2M8SA 4NAMA 3M9OB 4PHAA 2TSSA 1WGYA 9ICKA 5D6JB 4M8MA 1L0XB 4GDLA 5KT4A 2WQYB 5KNIA 2W82A 3TFSA 4F1SA 3UQAA 3QIJA 1ZDXA 1UH6A 2QEJC 1H8CA 4ZRQA 4IWOA 1QF6A 2MU2A 2H5XA 1QQ7A 3PO4A 3UINB 4J9QA 2LRWA 5B5EU 1WXAA 2XBBC 2JXJA 2DPIA 3B0YA 4FBTA 3H6NA 2ZIVB 2NBWB 2BKFA 2BS4B 1KRPA 1N63A 3WANA 3C8YA 2L00B 1ED1A 2AGQA 1KQQA 3JPRA 4HVBA 2WF9A 2G06A 2W54A 2G4DB 3RTVA 1NI3A 3CW2C 2KJRA 2M4NA 3PMLA 3I5JC 2MSNA 2AGPA 2NCNA 1I4RA 3ED5A 2F8KA 3MR5A 4GDKA 4TUQA 2QSDA 2LMCA 5IILA 4NLKA 2OJWA 8ICXA 1PVPA 4DEZA 1B9RA 4UB4A 4JMUA 3C5GA 2ASJA 4UAWA 2KD0A 2M1MA 4RZRA 3RF9A 4NXZA 3PR4A 1NK0A 4JLCA 3AL0B 4A6QA 1ZQBA 3IT6B 4YVZA 2KTRB 3OWEB 1SWWA 4F8RA 1HXYD 2LJIA 2RLTA 3RZWC 5KG2A 1FFUA 3M3JA 4KX5A 4C4TA 4FXCA 1IV8A 4MF2A 1F1HA 1LO5D 1V1PA 2FNJB 3FM9A 3PSIA 3GV5B 3N4MB 3SHQA 2N9KA 4YT0B 4J9OA 5T14A 2XNAC 2KMAA 4UW9A 1WGKA 1R4NB 4QIWF 1J7CA 1X9MA 3OJUA 3H7PA 2B6GA 2CU1A 2KSOA 2KK0A 1RQLA 1WI0A 4ZYSA 3GZFA 3D32A 4TKNA 3AE7B 2AQ2B 2J4XA 5KFNA 2KJ5A 2ATLA 2M0XA 4URKA 2JF5A 9ICEA 3A4SC 2W9AA 4ECXA 4AOFA 3QHTA 3KTQA 4O3NA 5ALMA 2L05A 1WX8A 1ZQVA 4QWDA 4HDQA 4OO1J 4RGTA 3RD2A 1YX6B 3EECA 3MBYA 4B9MA 3V05A 1QOGA 4YG2A 4S17A 4FZLA 4QWAA 3DV9A 4RQ6A 2HHUA 1HEZE 2KAJA 3KLSX 4BDPA 4MEYA 1BPXA 4KIKB 4IRKA 4FJZA 2WGSA 1MC8A 3GILA 1V9PA 1UBIA 2FMSA 3PO5A 7ICJA 4CGZA 1LKYB 4US9A 3MDCA 3T5HA 3U7ZA 1WXVA 1COOA 2L0FA 1ZRNA 4M9HA 1WMHB 3VUYA 3T3NA 2MA1A 5KT3A 1KEJA 2R18A 8ICYA 3V7KA 1TKDA 2C5LC 4KKIA 5EWFA 2WDVB 1JW9D 2FE9A 2WXHA 2VH2A 4PHDA 4I2DA 1ZQEA 5J0TA 1YD8U 4WIPA 4YFKA 5AIBA 3A4RA 3AQFA 1ZQMA 2I38A 1GB1A 4HDOA 4HPPA 1UCVA 3ZDCA 2BKEA 4II3B 3QUTA 3ZI4A 2ZTEA 1GUAB 1SB3C 1QQ5A 4NV0A 4CE6A 2MBOA 3LXFA 4ACFA 3PLVA 1GB4A 1IBXA 4YMNA 1NJYA 3VTUA 4GXKA 4EOYA 4C7YA 2XCPA 1KOTA 2INCC 4QWEA 1UA1A 3AB5A 1ZQYA 2GBJA 3KHRA 1Z4OA 4UB3A 9ICXA 1YJIA 2YMQA 1KLNA 2KX0A 2MSED 3UPQA 3BQTA 4FJYA 3PSTA 8ICVA 4GLSC 1CK1A 1YJ1A 1ZXHA 2E8NA 3V6EB 3P4RB 2BYEA 1N61A 4R8UB 5DLGA 3VTWA 1QQ6A 3LYSA 1SE2A 2VKQA 2HW3A 2KDMA 5DPRA 7ICTA 3FILB 4I2JA 2W43A 2JR5A 5KFKA 3ZNGC 3BZCA 2D3GA 4Q8FA 1WFYA 3OJSA 2GRIA 1QSLA 2LGXA 3AULA 2BWES 3NJTA 2W9CB 2Y1JA 2NVUI 4XC2A 5EDSA 1YJJA 3Q14C 2Y5PA 4I6LB 2OOBB 2AWTA 1T5XD 2W3RA 1O03A 1KFDA 2W8KA 2GOLA 3M8SA 2CJOA 2CR5A 3BS7A 2NPTB 2ZVOA 4QNLA 1NK8A 3NVYA 1FCLA 4HKQA 5AI5A 3P42A 4PS3A 5KTQA 1L6VA 3BQ7A 1V2YA 2JV3A 3N28A 3L54A 2KZZA 1SWVA 2E8PA 1KM7A 4RM8A 3F2BA 2ZUCA 2QJLA 3JSVB 1L5UA 2G4SA 5AK4A 2BHNA 1YZ6A 2ON8A 2ZPYA 8ICRA 3QAQA 3SV3A 2GWSA 1ZQFA 1WWVA 2I9GA 1XSPA 1WGDA 2KVSA 1SE3A 1DOXA 2C28A 4CF5A 8ICFA 2DQNB 1X6IA 2JRIB 2WXRA 4KLJA 3I76A 3RJFA 1ESFA 5HHIA 2L76A 3ML9A 5FR3A 5G5GA 4B9LA 2D3AA 3T9LA 3SD5A 3UXNA 3U8ZA 3RNEC 2XN9C 3AEAB 3SV4A 4YN4A 4GB9A 4NQLB 3TEWA 2L7RA 5AUIA 2IGDA 1X40A 5KFFA 4PGQA 5DG7A 3TUOA 4IOIE 1JX4A 4KITB 2EDUA 4QZHA 4IC9A 3MTNB 5LXHA 3NVVA 4C80A 3AXCA 2C7MB 2WXLA 4HRSA 2I1KA 2W04A 4ED7A 5E6JA 2LHEA 4HXDA 3RFAA 2HMXA 4EZ6A 1L4DB 3C1ZA 2A19A 5LLIA 2Z0DB 2K25A 1UD7A 5AK6A 3UMBA 2AJQA 1RDFA 4HEA1 1ZRMA 2ALZA 1CMXB 3AE6B 1P3QU 2GMIC 3KWLA 2K6DB 1C77A 3EYZA 2PKOA 3KQ4A 4GDLB 4NM1A 1KFYB 5J2CA 1S10A 3R8BA 4TUSA 1B1ZA 3NTUA 5GTIU 2J6UA 2N9EB 4ICVA 4K3BA 4WJNA 3RPFC 2C22A 1MVKA 4DSLA 4B0EA 4K7WA 1OGWA 4YXMA 1PGAA 4F4YA 3WKEA 5KFCA 3GV8B 3B9JA 1ZD3A 4A8EA 2EZZA 2ASLA 1J0GA 2O2VB 1X6JA 3K1ZA 4N6EB 4N58A 1T8EA 1KKXA 3KZIU 1MJDA 1L8OA 1NEKB 4C8NA 1K8RB 3A9KA 2RPQA 2KFNA 4HCNB 3DBHI 9ICTA 3RJIA 1F0MA 3VC8A 2BDPA 1K50A 5CHFA 1WF9A 4DOAA 3WAPA 1C76A 4IS7A 5AM2A 2JXTA 5DDYA 5HHHA 5AKIA 1C9FA 4NLBA 1YQ3B 1Q3UA 7ICLA 3L17A 4GDKB 2MUTB 4ED6A 4KLTA 1JALA 3RH6A 1SV0A 3SQIA 3QU9A 2ACZB 3AEDB 3KUZA 1JWMD 2XICA 3AQEA 4NY8A 4OJOA 2IGGA 2KN7A 1OEYA 2KKVA 1RM6C 3AI5A 4G3XB 4J6IA 4OVUA 2B3AA 1S76D 2LVOA 4EUTA 7ICEA 2AL3A 2MQJA 2W03A 2A1AA 3MR6A 3GIJA 1MPEA 3PO0A 2N7DA 2KTQA 1V1PB 3G6YA 5KAFU 3SD7A 4I2FA 1S0VA 3QX7A 4A3OA 2FE8A 2ASQA 1MHXA 1HUOA 4EZKA 3ZDEA 3HM3A 2KKCA 5AM5A 4CYEA 3UGBB 1FIQA 4RT3A 2EKEC 2BTEA 5TSSA 1JI7A 2V1YA 3H7PB 4RNNA 3HPOA 3WK9A 4KX6B 1ZQTA 2J0MA 2KSOB 5J2EA 3WU2U 2OCEA 2K4HA 4YCXA 2Y5CA 5D46A 3IG5A 4NWIA 4I27A 4W9JA 4FLHA 3GIIA 2WDTB 5KHQA 5ALXA 2JWZA 4AYBC 2BPFA 4Q8EA 3UIPB 3V72A 1A76A 1FFVA 1UF0A 3NZ3A 1TAMA 4EENA 4F4XA 3KOOA 1WG8A 1TKYA 1LXDA 2DZJA 4WAFA 1YZ7A 3Q8SB 1XLNA 1RAXA 1ZQPA 2KFJA 2IHMA 3PRMB 4BFRA 2KJ8A 2WB1F 3RN9C 1Z3EB 3VQIA 3RH4A 4DF4A 2R8HA 4ED2A 1MSWD 4WJQA 2ICIA 4BXOA 3H0MB 3EFUA 5JHBA 4NL9A 1FMAD 3MC8A 5KG3A 1YN3A 2JPHA 3BK1A 4Z6CA 2C7NB 4NM2A 2I5HA 2Q4TA 2MCNB 3QU2A 1E10A 1SXEA 5KT5A 1U9LA 4DDGD 7ICQA 8ICMA 2Q0ZX 4DBGA 3AU5A 3S6JA 4FZMA 4NZLB 1K52A 3C21A 4I29A 5KFOA 1L3UA 2WF7A 2DYBA 2J53A 5C1ZA 5D7GA 2KOBA 3CF6E 3BK2A 4KLIA 2B0CA 4NY0A 4UAYA 3EA6A 1SF0A 1ZQSA 3DVNV 1ZYQA 1UQVA 1Z19A 3JW0X 2DF4B 4M6WB 3RT3B 9ICCA 3UXPA 4TQSA 4P16A 3N7PD 1N6ZA 3H4BA 2VA3A 3NG0A 2ZIVA 2IY0B 2XVTA 4IC7B 3KKAC 5D49A 5AK5A 4OD0A 1ZQOA 2IHNA 2REXA 3KHGA 4AJYB 3NVWA 3ZJVA 3MGHA 4XWTA 4XQ8A 2OXOA 1RG6A 2H89B 2D6FC 2GBRA 1Q46A 3D2NA 3RR8A 4DFKA 3RB6A 1UWXA 2G5IB 5TR5A 1WR1A 3KH0A 4RUAA 5KFDA 4ACOA 1GG3A 3BQ1A 1WYGA 3BQ2A 5DPTA 5C3JB 5C5JA 3V3XA 4NNJB 2HSZA 3HVZA 4DDID 5J0QA 2QC8A 5FR6A 4A90A 3ISBA 4GXIA 1PQSA 2RDHA 4DXGA 9ICVA 2CPRA 1VR9A 2PMVA 4JB3A 4PHPA 2WF8A 1F5SA 4Y2TA 3B0AA 1TY0A 5KT2A 4MFAA 1D5MC 2HTHA 4EBDA 2WXKA 1D4BA 3C29A 2LD9A 4P6VF 3SU8X 7ICIA 3R9KA 3QYPA 4IWPA 2P6UA 4O3RA 4DFMA 4HYKA 2EQYA 2LGDA 2RD0A 1Q1OA 1SGHA 4B6WA 4YTNB 1X42A 1YT3A 1SJHD 3ZKJC 4KZCA 2VJ4A 5KFLA 1UNSA 4WWNA 2Y9UA 3RJGA 4HK2A 3Q3FA 5DLFA 2BYFA 4KLLA 1S0OA 3AE8B 3BQ0A 2W55A 3GQCA 2C9WB 1JWUD 4E71A 3PZDA 3Q3NC 3J9CA 1ZGUB 4Q2JA 2ZNVC 5ALZA 3RAQA 3LYYA 1Y8RC 4EE2A 3MC0B 2XIDA 2GBNA 3DDCB 4JUZA 5K4LA 1SJED 4DHZB 5KG5A 2DX5B 4ZRJA 5HKHA 1SEBD 1IPGA 2JEGA 4B9KA 4CNQA 4OJ6A 1MI0A 2KQ4X 2X38A 3A33B 3WK8A 4AYBF 3JPOA 4W9KA 4KIKA 1VJKA 1P1AA 2HJ8A 2QDFA 2JQRB 2K9XA 2Y3AA 1WXSA 4REZA 5CHWA 4NLCA 1LKYA 2KFZA 5IIIA 2KN4A 3IFWB 5ALDA 2KJ9A 3AN1A 5HR7A 2NS5A 3KUDB 4DHJD 2BBCA 4EZJA 1V80A 1Z1BA 2LUMA 2L5YA 3Q69A 2MLBA 3AECB 4PT5A 1KW4A 4K1RB 1OQYA 2HBJA 4FBJB 1X2IA 2WX0A 3L16A 2PVOD 4JPSA 3TBLD 2ES6A 2XGPA 2JRHA 3ABVB 8ICUA 2DWQA 5KFYA 1SV4A 3HM6X 9ICJA 2KMMA 3QQ8B 5J2IA 3UQ0A 2GBMA 2NBUA 2NO4A 3DPDA 5D4BA 3TKAA 2UVUA 2RHFA 3A9KB 4B0MA 5CHGA 5F9LA 5IINA 3EWAA 2W9BB 2WHIA 5AZGA 2ZCBA 1Z4NA 2K60A 2QCZA 2RSUA 4LZGA 3SZ2A 3LVWA 2N9PC 1JRPA 2KIWA 1WJ6A 3HIZA 2YN4A 3ZW3A 3M8RA 1XF5L 3R2TA 4HLEA 1EU4A 1FXIA 1LM8B 7ICOA 1J2NA 5AKKA 2FPKA 5G5HA 3KHLA 5AUKA 1E9MA 1ZQJA 2F1JA 4I6NB 2QB1A 4Z6FA 3QX1A 3Q8LA 2BPSA 2DPJA 4K4GA 4EELA 2J0JA 2VJ5A 5KL8B 4JV1A 2F77X 3F2DA 4IR1A 1WE6A 3ZUNA 1ZETA 4KDLB 2WHEA 3Q8AA 3KUCB 3MJ5A 2ZJ5A 2FJ6A 3UQBA 2X8XX 3BVGA 1VZ7A 1S9FA 2LI5A 3U4EG 3VUWA 5IP4D 1RWSA 4DSKA 1MG4A 4RUCA 3WK4A 3RULA 3UIOB 4MH8A 3RNFC 2KLGA 3RBEA 3Q3OC 3RNAC 5IIMA 2FIDA 4P0PA 4EX7A 1CRXA 3M63B 4KMUA 2W9NA 3N7RC 4W9DA 2JZBA 4HROA 1NK5A 3PX4A 4KLMA 5E6NA 5J18A 2G9HD 4G50A 4O3MA 4LLGM 4IWQA 1BPEA 2J42A 4MELA 2VH1A 4QZAA 4MHVA 4FHJA 5KG7A 5E6PA 5KT7A 4NJ7A 4EFOA 4LVSA 1QZEA 4NJCA 3H7IA 2KZMA 3VTVA 4DFDA 4EYHB 1JMLA 2JUOA 4ASWC 3PY8A 5BMGA 2CRXA 1LVHA 3GP7A 3DVGX 4RNMA 4GIVA 1I42A 3WK6A 1BPZA 2PPHA 4BXOB 1J7BA 4W9CA 2P66A 4ECUA 4DQSA 4TV3A 4ANWA 3I3TB 1PK1B 5L9XA 4RFBA 4RQ5A 4IL6U 3C2KA 4PYUA 2M9NA 3KYCD 2MA9B 2BQUA 3GE3C 2Z7JA 2L83A 4II2B 4WQOB 3ZDMC 2V0GA 3RI7C 2J52A 2MAXA 5J17A 2HVHA 2MWSB 2WXJA 5AEKB 2XK5A 4E74A 1ZQXA 4KSLC 2PLPA 3FAHA 1HEKA 4OJLA 5DBAA 1WYWB 2D5GA 1XNSA 2C2DA 2A3VA 4KX3A 3SAHA 1KL9A 3W5VB 1C78A 1NKEA 4F2SA 5JZEB 5ALYA 2Y9TA 3KW5B 4M01A 3GIKA 3ZDAA 2EKIA 1IM4A 3B0XA 3Q6BA 3VRBB 4YR0A 1XCTL 2J7QB 4HJKA 2H3ZA 2W7OA 3ECIA 3OSNA 4K4IA 2O2VA 3RCZA 1NDDA 9ICRA 4FZNA 9ICPA 1Q8KA 3V7JA 1UT5A 1ZDVA 3V6KA 1QQRA 2GBKA 4MEMA 3OGUA 5L1KA 4WWOA 5E6OA 3ZYYX 5AIAA 5L1LA 1S0MA 3TMPB 5F3XB 3V6CB 4XGAB 3T5LA 5HG2A 4F71A 1KN5A 2YMPA 1TE2A 4DS4A 1TV9A 4B9TA 4KV2A 1OW5A 4BX9C 1FO4A 4O0IA 4CCHA 2K89A 3IHQB 4YD2A 1XS9D 4P1CC 2MUTA 5DQHA 4E3CA 4JGHB 3BS5A 4M2YA 3ENEA 1AYFA 4KDIC 1BPBA 8ICJA 4LTUA 3VVWB 2PFOA 3ZDBA 2N9LA 4KLDA 2YVCA 2ZJDA 3N9YC 1V1OA 4RGNA 3ALRA 2JY6A 1FM0D 2ZPNA 3J81j 2KVCA 2MBHA 5JUMA 2RR9A 1I4XA 4P0QA 3PW5A 2FMPA 3MFIA 4UAZA 2D10A 4KLUA 3SI8A 5D3DA 4B6JA 1IUEA 1SGGA 5DG9A 4UASA 2DHZA 2RRDA 3RBDA 2G08A 4EX6A 4Z6EA 4L23A 4RQ8A 2EANA 2NRTA 2XCAA 8ICIA 2LMRA 1LV5A 4JV2A 1RRBA 3ZGZA 2GLSA 3CRXA 3PTFC 4UB6U 3ISCA 2IO1B 4TMAB 4XE0A 3ZJUA 4NLNA 2WTFA 4GU2A 2F44A 2JT4B 3JYUA 1I7HA 4ZYNA 3TACB 1L3VA 3NOBA 3PHXB 1OTRB 2ZG6A 3AM9A 2MX2A 2J6TA 2ZCCA 2BS3B 2HTME 4DL6A 4DSJA 5KAIU 2IO3B 4MGYE 1PGBA 2ZUBA 1TS4A 2V4RA 3BYYB 1SE9A 1EWCA 2PEAA 4JX1C 4NPNA 5H92C 4QZFA 3PZ8A 3H7SA 2CN1A 3RNBC 3ML8A 4L1BA 5HMMA 3C19A 4FN2A 1KLUD 4OZBA 3LWMA 2KOXA 5H8YE 4XRHA 2W8LA 3AEBB 1UA0A 3CP8A 4MJSA 1TBEA 1U49A 3DWGC 2PVGC 2YEPB 4RQ4A 1K51A 3RB0A 1WE7A 2RDGA 3CWIA 3DBRI 4DL2A 4RH6A 1P98A 2HJ1A 4XWWA 2ZTDA 3P2BA 1LGRA 3FC4A 4DK5A 2YB1A 3QC8B 8ICGA 2O6KA 4D2KA 4IUMB 1SV0C 2FUHB 3SYZA 1TS3A 3H0LB 1WIAA 2EMTA 1IG6A 4UAUA 2D07B 2LJ5A 1S97A 1QCKA 4F5RA 3H8HA 4QW9A 4PGXA 4MH0E 1TZOA 3CSFA 2IMWP 4C8KA 2Z8LA 4WQMA 5KFAA 2MP2A 4DXFA 1ZD4A 3K1RB 2PI4A 3OAWA 2QKQA 4DSFA 5KFPA 4M0WA 1WJ4A 2LHDA 4ED1A 2JHDA 3C2MA 1ZQIA 2Z59B 5T8IA 5HMLA 1DK3A 1L7PA 1V5OA 5JXVA 4K7UA 3EHVA 1MHHE 4M6WA 3PZ7A 1EXNA 3U30A 4PJ0U 2K39A 3M62B 3TEYA 2L1AA 2R2OA 1DOQA 3ZDTA 3PGEA 2FLLA 4W9HA 9ICIA 1XEEA 3AEVA 2FAZA 2IOFA 4JE3B 4N59A 1S5LU 3Q8EA 1ZQZA 7ICUA 1KLGD 3RMKC 3NRZA 1TKEA 5JTIA 1YN5A 5HNKA 4DL4A 1WM3A 3A0BU 1TS5A 5DB7A 2KQ7A 4F4WA 1P7EA 4OVVA 2V4LA 2LEKA 4FA6A 3EPIA 4C0ZA 1Z5SB 1T0YA 1CUKA 2KXJA 4FFDA 1EO6A 1ZW7A 4KTQA 1VD2A 2Y5BB 4AS1A 1IGCA 2G1EA 3RRHA 5CWRA 2R8IA 4YTMB 1TAUA 2V4QA 2C60A 5BMHA 2JMGA 1N60A 1ET6A 3D6JA 2KVZA 3O65B 1A0PA 4DLGA 4P0PB 1C20A 1D3ZA 5AM0A 2WF5A 4RPXA 3N1ZC 1RZTA 1JWBD 3WCQA 5AKGA 5J2HA 1YQBA 5J0PA 1NJZA 4DOBA 3N97B 1ZQAA 3RJEA 1V86A 2LM1A 2JZBB 3BZKA 2ZJ8A 8ICNA 1C3TA 1CI4A 3JPQA 3GB1A 5AI6A 2XO7A 1NK7A 2L0TA 2WB1C 2E8OA 4IKGA 8ICEA 1TIFA 1WWUA 1KBUA 3TADC 4ICUA 2V9WA 3U7DA 3AE5B 2AXTU 4ECTA 5HI1A 2BWFA 4A9AA 3BIID 1N62A 4MM3A 2PE9A 3MGVA 3GDXA 2NTTA 1B4FA 4C56C 3VH4B 3H40A 4F5NA 2RPVA 2KG5A 4A8XC 1T0QC 3PSFA 3PW7A 3DOWA 4KZ0A 3I9V1 2CS4A 5G55A 4KMOB 4EZ9A 5IO9A 3ONNA 3PRPB 2WFAA 2HVIA 1TKGA 9ICUA 4E0DA 4UB2A 1FXTB 4DHZE 4RQ7A 4RQ2A 4AJWA 1BT0A 3GOEA 5KFXA 2KNBA 2NR2A 2ZVNA 4IG7B 4IQWA 1A77A 2WP9B 3TL5A 1WXQA 2IO2B 1I4GA 3ISDA 5KG0A 3Q8QB 2WDRB 4KN4A 4Z6DA 2QMTA 5ALPA 5FP0A 1NVID 2XK5B 4O3PA 1L7MA 4XYCA 2WU5B 4G11A 2NMQA 2XGQA 2N9XA 3DBHB 1FEZA 4CDGA 2G09A 3PVXA 4TURA 4EYIB 5CRXA 1QOBA 3W1SC 4RPZA 4PS8A 2KZ3A 1SXDA 4F93B 3IN5A 1VJ5A 3TQ1A 4AP4C 4DWFA 3CMMB 4RQ1A 2HHVA 3MR2A 4M9LA 1ZQ1C 4GIBA 2D11A 5AZFA 1WM2A 1V8CA 3DCGA 4YSXB 1ZOLA 3O0FA 2YMMA 2BCUA 5FKAC 1X9SA 2K0PA 1L3SA 1QLBB 5CTRC 2W9BA 1DOIA 4G3IA 4O1NA 1N5WA 2BVCA 2K8BA 3ZRCA 2DZMA 3ORYA 3PZPA 1C4AA 5AI9A 2PE6B 2V3NA 1RFAA 1TY2A 5AICA 1AROP 3U52E 5KFTA 3DHIC 3RJJA 5KT6A 3QUQA 3BS5B 5DBBA 1HUZA 2VZKB 5KFRA 5KFWA 9ICLA 3L10B 5KFHA 3RR7A 1UUPA 3TAPA 4IDIA 1PFDA 4IRCA 1LB2B 4JWNA 4RQMA 2JXXA 1EF5A 5JH5C 4F8CB 1HTQA 4P0QB 3QCAA 4O9MA 3I1YA 3M7DA 3JPPA 3DQVA 3PV1A 4I2GA 2KLCA 2KVRA 4DHJB 3ZNZB 5C2TB 2KDBA 2H3FA 4LK0M 4PZOA 1JWAD 3M95A 3PREA 4QZEA 3HP6A 3TARA 3URYA 2KHWB 1U45A 4FHKA 2LM4A 4XX5A 1TVAA 4O3OA 8ICZA 1NK4A 2HHQA 1UWMA 3VHTC 3FKYA 3VAWA 2PW9A 2YTUA 3PSEB 2AEHA 5G2NA 1DXSA 8ICOA 4YR3A 3DWMA 4I2EA 1FD6A 4XA5A 3CIRB 1ZPSA 2LYHA 2V3SA 1PZNA 4C4VB 5DBCA 2F2AB 3TI0A 3S2AA 2BR0A 9ICNA 2DNFA 3KD3A 1SL1A 1WGRA 4Q44A 2O6VD 3W1YA 4C7ZA 4RNOA 4K3CA 2JEIA 2I1JA 3DVGY 5J0WA 8ICLA 1WWTA 1I35A 1WH3A 2LVQA 3DDHA 2LXAA 2PKEA 4RM9A 4JQWC 4MJSB 5ALJA 2DYMA 1DGSA 2JYEA 4FS2A 4BKTA 2B21A 4UBCA 2AH5A 4M04A 1JUDA 1WCLA 2IOHA 1IXRA 7ICNA 3AE2B 1MQ2A 3EFCA 4C00A 1PK1A 5ALWA 1I4QA 4C4RA 1JMSA 4H2AA 2VA2A 3PX0A 5IIOA 3P1MA 4UDUC 3QA8A 5DG8A 2EH9A 4O3QA 5CEHA 1J7AA 2AX5A 2G3QB 4J9SA 4X57B 3RB3A 4J9PA 1NKBA 1HZ6A 3ZTDA 3JPSA 1ZE3D 4TQ0A 1YMHE 5KFVA 3Q8KA 2WXMA 4DL3A 3EW9A 4YXJA 3TFRA 1RYSA 2KANA 4I2IA 1GC6A 3H1UA 4LDTD 4XDCA 2OEHA 5J2AA 1WJNA 3B2GA 3PHWB 2OYYA 2MP2B 1XXGA 3ZDDA 2DKZA 2J0KA 8ICCA 4M0WB 1MG8A 4AUQC 2KD1A 4RU9A 2W7PA 1EF1A 1GAQB 8ICSA 2PTLA 4UAVA 1TK8A 2KICA 1E8XA 4PH5A 4RMAA 2KMCA 1JQ4A 4CO7A 4YXDB 2RDBC 4J9MA 4ELTA 2KV2A 5J0RA 2K8HA 1ZD5A 3VR8B 2WXGA 4LNKA 2MBEA 3WIMA 3NS1A 4YWGG 2SEBD 8ICQA 1SXTA 3L5KA 2N4FA 2V3PA 4GMVA 1N48A 4DS5A 4IM0A 4OW0A 5GXGB 2KWVB 3MR3A 1L0VB 3SEBA 3E56A 3P4PB 3PW4A 2AYOB 3N30A 2MW5A 4DWIA 1R4MI 1E0ZA 1QOAA 3MP9A 4CF3A 1RXWA 2R8JA 4I2AA 3QNMA 1EM7A 1KTKA 3NUHB 4P7IA 3OG5A 4XDDA 2P35A 4F2RA 4RQ3A 1ET9A 3W2DA 4O3SA 2MH7A 2MJEA 2YY6A 1TZ1A 4NJ6A 1ZQKA 2L8JA 1PVRA 3GU3A 5ALNA 3QEBZ 1FXAA 3PR5B 5ALHA 4RGMA 2HD5B 4YSZB 3T5KA 2XY6A 1QSYA 1COKA 3TEZA 5ALOA 1JIHA 2BGWA 1KJTA 3PLUA 4WWPA 5DDMA 5FK9C 2LWPA 2ZEQA 4EEWA 1B0XA 1ECWA 1J8CA 4NJ8A 5ALTA 4LNNA 2WXIA 3NRWA 2WYQA 3I57A 5AKXA 1VRAB 1Q5WB 3CNHA 4MM3B 2MHJA 2DFLA 3QUCA 2G07A 5KFMA 2AL6A 3KWVA 2PJHA 3LK9A 4MEXA 1XT9B 4A55A 4YL8A 1BUIC 3A1QA 4Q45A 3NZSA 1XLOA 2R8GA 9ICMA 1KFSA 5ALKA 2WXFA 4TUPA 4ANVA 3SEIA 3RJKA 4ARCA 2C2RA 1GOZA 3RNGC 4WH4A 3C23A 1AWDA 1D8LA 4ECRA 2VZKD 4QAYA 1RYUA 5AM1A 2IBIB 4ZRIA 2KWDA 2MBQA 1ISNA 2DUYA 2KO3A 2JZZA 2BGFA 2W11A 3MABA 4DSIA 2LHTA 3R3MA 5EWGA 2M56B 1ZQDA 1FNVA 1TK5A 1U4AA 1WSPA 2A5UA 2BPCA 2PMZC 2FBWB 3AU6A 2KDEB 2DZIA 1J2MA 5ALFA 2DZKA 3K9OB 3TCAA 4Y2JA 5GTHU 1KRHA 2EAMA 5ALIA 1R7SA 4LNIA 1TTNA 1FPYA 3TSSA 1ZQGA 3K75D 4F91B 4BOZB 4OCZA 4UB1A 3LJ3A 1FRRA 1QT9A 2D3CA 2KFKA 2AHOB 3UI3A 5KFGA 2K22A 4OZCA 8ICBA 2BKRB 3PSPA 1F2RC 5IIKA 3THVA 4N9F4 1VZ6A 4JWSC 2VANA 3G6VA 4EZLA 1PYWD 5DCNA 2MRPA 5D94A 3NVZA 4JWMA 1KLVA 4DOCA 4ECZA 3QJZA 2Y0SC 3NY5A 1A5RA 1E8WA 4I28A 4I2HA 4ZH4A 2K8BB 3QUBA 4OZAA 2O6VA 5AKZA 1X9XA 1ZQCA 4MDKE 1T3NA 4WJ3B 2KACA 1QOFA 3ALBA 3HW8A 4JV0A 3V6JA 4DQRA 1VDVA 1IGDA 3HILA 3KFUF 3OHBA 1RYJA 3BINA 4TQ1A 1ZOYB 4HPMB 2KMDA 1NK9A 2DGZA 4B9NA 3SDLC 3BJYA 1UELA 1ZQHA 3N1YC 2JH1A 3N20C 2W3SA 4BVUC 3VR9B 1IIPA 4Y2RA 3OHAA 5ALRA 1NYRA 3IBEA 2M0NA 4I6PA 2JZPA 2VIXA 4C8MA 1D8YA 2N7JA 1Z00A 1HQRD 1ROEA 3EUB2 4PL1A 4UBBA 5J8YA 4K4HA 2BZFA 3E58A 4JL9A 4I2BA 2WS3B 9ICSA 4WJPA 3OPXA 1K1SA 1FRDA 1WR6E 1DYQA 4ARIA 4F4ZA 5EE9A 4DFPA 3ZRFA 3ZIMA 3OLMD 4ECSA 3K9PB 1NOMA 2JWUA 3HVDA 4FADA 2KJHB 3W5UB 3MHSD 3GIMA 3H0RB 2GI9A 1L6NA 1M6YA 3DBLI 2PFPA 1BVSA 3WKCA 3ZQ4A 2H3IA 3MJWA 2KWCA 1Z1VA 4NAWA 3QU4A 1L7YA 3CSTA 2ZXIA 4HKZE 1ZUD2 3CYMA 5HFYA 3KKAA 3I63C 2RDJA 5B66U 3Q8FA 5J0SA 1FNWA 3AE9B 3IP4B 3M6ZA 5J0XA 1XO3A 2BYTA 3DBSA 4ZHPA 2RP5A 2N1RA 1P0RA 1U48A 2GO7A 2WLBA 4R63A 3AEFB 1TS2A 8ICHA 1JCKB 1T94A 2IDYA 1JRUA 1QTMA 2KC2A 4DO9A 3EC8A 4YQWA 2YMLA 1M94A 3VUXA 5AI0A 3MFHA 4Q43A 3NHEB 4W9FA 1PUZA 3NASA 1F52A 1NENB 1ZP0B 1JROA 3HT3A 3PNCA 3N3KB 4DQPA 1P9DU 7ICKA 1SIJA 4MT5A 3C2LA 3T79A 3C0RB 3RZFA 1UBQA 2WF6A 2K4EA 4TUUA 3BDPA 4DCCA 3L13A 3GZNI 4TSSA 1RQNA 4F72A 5KFEA 1L7NA 1KDHA 1CJEA 1OEYJ 3OJ3A 4KGRA 1M4VA 2ODGA 3IG8A 1KSPA 1BPYA 2HI0A 2PMZF 2KTFA 1V81A 2IO0B 2JSVX 2N0SB 3UQ2A 3OJ4B 1S8OA 2DL0A 3D2SA 1ZKHA 9ICGA 3BWUD 1XLPA 5ALLA 4QWCA 1WZ0A 1F44A 2WXQA 3HK0A 5BYSA 2ZIWA 3R66C 2KKPA 2OH2A 5KL1B 3IM1A 3SFDB 4UARA 2KJ6A 3Q8MA 2NRXA 1FNUA 5J0UA 3H4DA 5TISU 3RNCC 1UHUA 4MACA 4GC7A 4X5VA 4P4MA 1XQQA 4HAIA 2INPE 2C7HA 4W9EA 4IQTA 3X23A 1T0SC 4DQIA 4CHKA 1C4CA 2Y0SF 2PFQA 1YIWA 3AUOA 2EAOA 2KHVA 2MRLA 3PPAA 4K7SA 5DB9A 3EGRA 4IQVA 4YMMA 5BOMA 2FCQA 2K1FA 2JH7A 2NYVA 3RYTA 3SFEB 4QZDA 1OQRA 2UVVA 3V61A 3B2FA 4MGKE 4DQOC 4B95A 2IGHA 2NO5A 1GJZA 3IAS1 2XI9A 5HHDG 5ALSA 2DAFA 2HDEA 2KT7A 3SMVA 4PZNA 2M19A 1DOYA 4Y2QA 2F1IA 2H3QA 4UQGA 2KDIA 5AM4A 5KFUA 2BCVA 1ZJNA 4ECYA 9ICAA 2QLTA 3HHMA 4UB5A 5D3IB 2IZVB 3TAQA 5EE3A 1F77A 1WX9A 5CJ7A 4B9SA 1ZQWA 5LNK1 3UMGA 3PMNA 4P2HA 3H9DA 1D5ZC 4K81A 2L32A 3DBRB 1T3QA 1XU4A 3NS8A 1DGJA 3IV6A 4C4VA 5DQIA 2G0AA 3M9NB 1RFKA 3P63A 5KFZA 3R7QA 2JYTA 3A1QB 5L83A 2ZIXA 2KEYA 4DL5A 1X9WA 1PVQA 1OUQA 4B9VA 2N7EA 1XC9A 2DKXA 5KFQA 3RRGA 5MPOA 1NJWA 3AE1B 2OWOA 2F8LA 1SZHA 2CHZA 2AGOA 2A1JA 2N1WA 3G6XA 2ISPA 1L8LA 5LXIB 3L08A 2NV3A 2D2QA 2CU3A 2WXOA 1V97A 5ALQA 4DSEA 1D6EC 7ICMA 4LJOB 3IXSA 5BMIA 5H2FU 3A0HU 5J2KA 1R4NI 4JIOU 2DBYA 4GFJA 1ZXIA 4PL2A 1H38A 2FIFA 1NBFC 2ZUDA 4Y2VA 2BPGA 3B1LX 1TAQA 2JEFA 2NRZA 1URJA 2KFKB 4MSQB 3BY4B 4A3PA 2BQRA 1N56A 1HIWA 4O5KA 1KH0A 2WDQB 3E2EA 1Q0WB 2RGFA 2RQ5A 3ZTCA 4G0NB 2UVRA 2INDC 5IAAC 4DXAB 3IRUA 2W9MA 1NKCA 3UM9A 1F9JA 4KLOA 7ICPA 2HHXA 1S3SG 1WRDB 1T0RC 2QARA 2M0AA 4OVZA 1G6JA 1S1QB 4MFCA 3AEEB 4P4OA 2IOFK 4FS1A 1P7DA 4I2CA 4M9JA 1I4HA 5AKJA 5J2GA 2K5PA 4QZIA 2FCMA 2O6VB 3L0WB 3D2QA 1YQ4B 1VLBA 5DB6A 2Z0EB 2FLPA 2HOIA 2K4IA 2YQEA 4RQNA 3QXGA 2BQ3A 2EZXA 3N7SC 2JX5A 3C1YA 4F7ZA 1OXJA 4KLHA 4BBNC 5EWEA 4QZBA 5TZVA 2ONQA 2YLMA 8ICPA 3K4GA 1L4ZB 1YNTE 3ICXA 5J2JA 7ICRA 1TK0A 1JXLA 4KSKC 2CJNA 5DGBA 1TJEA 4MGZE 1HA5A 1MA7A 2HHSA 3A9JA 5J29A 3UF8A 2FPMA 2PFNA 4ANXA 2KK8A 2JU6X 5IOIA 2C2EA 4RF0A 1Z00B 1UGJA 2JZ3B 4KN7A 2K4PA 3QARA 4LDTB 4NL9C 1Q3VA 5GMVA 1ENFA 2GH1A 2R61A 1V9JA 4IM3A 4DLEA
chains in the Genus database with same CATH topology
3AN1A 4C7ZA 1STEA 3AMZA 2BBCA 3P4QB 2LUMA 3Q69A 1WWTA 3AECB 4PT5A 1A70A 2BS4B 1N63A 1FEHA 3C8YA 1T6BX 2LGIA 3MFGA 2BB6A 4KKJA 2W54A 2PVOD 2DYMA 4JPSA 2JYEA 1NI3A 3ABVB 2DWQA 3AE2B 1I4RA 2KMMA 1I4QA 4NAWB 2QSDA 4H2AA 2LMCA 3P1MA 4UDUC 1EWYC 1B9RA 2AX5A 1J7AA 2E3TA 1HZ6A 1SBBB 4US8A 1F0ZA 4A6QA 4B0MA 3HRDD 1ZE3D 4TQ0A 1YMHE 1YN4A 2WXMA 3IT6B 3OWEB 2V4IB 1L5PA 1HXYD 2LJIA 1VZ8A 4XDCA 1FFUA 3AH7A 4FXCA 2Q5WD 3B2GA 1JRPA 1XXGA 1LO5D 1XF5L 3AV8A 4ZOHC 3R2TA 5EE1A 1EU4A 1FXIA 1V1PA 3SR6A 5G5HA 2N9KA 4YT0B 5AUKA 1E9MA 1GAQB 2PTLA 1TYGB 3BVZA 2XNAC 1D5XC 1WGKA 3Q8BA 1J7CA 1JQ4A 4YXDB 3ETRA 4JWUC 2INNE 3VR8B 2WXGA 4KGTA 3NS1A 4YWGG 2SEBD 4ZYSA 1SXTA 3AE7B 3Q8AA 2AQ1B 2AQ2B 2V3PA 3MJ5A 5GXGB 1CZPA 4OW0A 2I2YA 2J4XA 1L0VB 1ACCA 3BVGA 1VZ7A 3E56A 3SEBA 3U4EG 3P4PB 1RWSA 1E0ZA 1WRIA 4MH8A 2QILA 1QOAA 3MP9A 1EM7A 3NUHB 1KTKA 2GB1A 4XDDA 4RGTA 3V05A 4HROA 1QOGA 1ET9A 1HEZE 3W2DA 2KAJA 2MH7A 2MJEA 3KLSX 1Y56A 2G9HD 4LLGM 1FXAA 2J42A 4RGMA 2OEDA 4YSZB 3IAM1 1GPXA 4US9A 3MHZA 3U7ZA 3TEZA 3E9SA 3T3NA 2NTSA 4KKIA 4NJCA 1C4PA 2WDVB 1JW9D 1JMLA 5FK9C 2WXHA 5BMGA 4WIPA 3GP7A 2WXIA 1AN8A 3I57A 2I38A 1GB1A 1VRAB 1J7BA 3T3OA 4MM3B 2H88B 1SB3C 4RFBA 3KWVA 3LXFA 1GB4A 1IBXA 3Q8CA 4A55A 4C7YA 5BYRA 2L83A 1BUIC 2V0GA 3AB5A 2J52A 2WXJA 1YJIA 3RFZB 1XLOA 2WXFA 2PLPA 3FAHA 4ARCA 4GLSC 1CK1A 1GOZA 1ZXHA 4WH4A 1AWDA 2D5GA 2BW2A 3P4RB 2VZKD 1N61A 1Q10A 1SE2A 2KDMA 2KWDA 3FILB 4ITKA 3W5VB 1C78A 3U2SC 2OHFA 2EKIA 2GRIA 3L4PA 3VRBB 2QIEB 2IPKD 1XCTL 2M56B 1FNVA 2ZW1A 1YJJA 2Y5PA 1WSPA 2FBWB 3R2IA 1L6UA 1T5XD 2W3RA 2CJOA 1KRHA 1ZDVA 1QQRA 1R7SA 3ZYYX 3TSSA 2E6XA 3NVYA 1FCLA 4HKQA 3P42A 1L6VA 5HG2A 1FRRA 1HZ5A 1QT9A 3LB8C 1F2RI 3UI3A 1FO4A 1E7PB 2K22A 4OZCA 1K53A 1FCCC 1F2RC 2QJLA 1VZ6A 4JWSC 1PYWD 1AYFA 2ON8A 4RNAA 3NVZA 4LTUA 4CQNA 2N9LA 2FUG1 3N9YC 1V1OA 4RF1A 4HJGE 4RGNA 1FM0D 3ZJTA 2ZW0A 1I4XA 4OZAA 1SE3A 2DLBA 4YTPB 1DOXA 5D3DA 2WXRA 1IUEA 2KACA 1ESFA 1QOFA 2MJ3A 5FR3A 5G5GA 1VDVA 1IGDA 2XN9C 3AEAB 4L23A 1RYJA 4TQ1A 3TEWA 1ZOYB 3ZGZA 5AUIA 2IGDA 4TMAB 4XE0A 3TUOA 3ZJUA 2W3SA 4IOIE 2WXNA 1JWSD 3NVVA 4C80A 1I7HA 3VR9B 2WXLA 4WURA 4HRSA 1NYRA 3AM9A 2JZPA 5E6JA 2LHEA 2BS3B 2HTME 1N5XA 4L2YA 4RCOA 1PGBA 2N7JA 1L4DB 2SAKA 1IBXB 1HQRD 1ROEA 1TS4A 3EUB2 1PGXA 2K3UA 1BMLC 3AE3B 3BYYB 4HEA1 2WS3B 1EWCA 3AE6B 1SE4A 4JX1C 3BYTB 3TEXA 5H92C 1FRDA 3KWLA 3PZ8A 1C77A 1DYQA 4ARIA 1L0YB 5EE9A 2PKOA 4L1BA 1XLQA 2PIAA 3KQ4A 4GDLB 1KLUD 2JWUA 3HVDA 4OZBA 1KFYB 4J3OD 5H8YE 3W5UB 1XCQL 3AEBB 2GI9A 3R8BA 1B1ZA 3DWGC 2PVGC 2YEPB 3RPFC 1K51A 2RDGA 3CWIA 4RH6A 4YSYB 1MVKA 3ZQ4A 4B0EA 1PGAA 4XWWA 3FC4A 3B9JA 4HKZE 4D2KA 1ZUD2 5HFYA 4N6EB 4N58A 1QILA 1TS3A 3Q8FA 1NEKB 2MEKA 3W1SA 1FNWA 3AE9B 2EELA 3H8HA 1K50A 1XO3A 1TZOA 2BYTA 4ZHPA 1C76A 2Z8LA 4WQMA 4DXFA 1EU3A 2JXTA 1C9FA 2YEPF 1YQ3B 2WLBA 4GDKB 4M0WA 3AEFB 2LHDA 3HUIA 1TS2A 1JALA 1JCKB 1NYQA 5T8IA 2IDYA 2ACZB 3AEDB 5JXVA 1JWMD 1MHHE 3PZ7A 1CQVA 1NENB 3TEYA 2L1AA 1ZP0B 1JROA 2IGGA 3AE4B 1RM6C 1XEEA 1SIJA 4MT5A 4JE3B 4N59A 1MPEA 1OFFA 3Q8EA 3PO0A 4ZHOA 1KLGD 1V1PB 4TSSA 3NRZA 1CJEA 1TKEA 2FE8A 1M4VA 1MHXA 1YN5A 4KGRA 2WNMA 1TS5A 3AEGB 1FIQA 2N0SB 2BTEA 4R3DA 2JSVX 5TSSA 1P7EA 2LEKA 4KX6B 3BWUD 1XLPA 2WXQA 5BYSA 2Y5CA 3SFDB 2AQ3B 4AS1A 1FNUA 1KF6B 1IGCA 2DYOA 2G1EA 4MACA 3P4SB 4YTMB 2INPE 5BMHA 1SSNA 1N60A 1FFVA 1ET6A 3NZ3A 1TKYA 2WXPA 4WAFA 1C4CA 1XLNA 1JWBD 3WCQA 3EGRA 3W9CB 3GB1A 2WU2B 1BXTA 2MJDA 1OQRA 3SFEB 3VQIA 4DQOC 3B2FA 2BB5A 2IGHA 4IKGA 1C79A 3IAS1 2ICIA 3AE5B 5HHDG 5HI1A 4A9AA 2HDEA 3BIID 1N62A 1FMAD 2M19A 1YN3A 1DOYA 3BK1A 2NTTA 4C56C 2RPVA 1E10A 4A8XC 3I9V1 5D3IB 3VRAB 5EE3A 4NZLB 1K52A 4OHJA 1F77A 1TKGA 1PUTA 2J53A 5D7GA 5LNK1 3BK2A 1D5ZC 2L52A 2L32A 5BYQA 1T3QA 3EA6A 3FILA 1DGJA 2WP9B 1SF0A 3GS2A 1WXQA 1I4GA 1RFKA 3P63A 2WDRB 2JYTA 2RMMA 4KGSA 2QMTA 1NVID 4P16A 4AQ7A 2WU5B 5MPOA 3AE1B 2NMQA 1P7FA 1QOBA 3IT4B 2IJ0A 3NVWA 2CU3A 3ZJVA 1QKZA 4XWTA 2H89B 1E6EB 2WXOA 1V97A 1D6EC 4WWMA 2BT6A 1UWXA 1AW7A 1V8CA 2BS2B 3IXSA 5BMIA 4YSXB 2DBYA 1WYGA 1ZXIA 2LFIA 5FKAC 5C3JB 2K0PA 1QLBB 5I4DA 1DOIA 3V3XA 3HVZA 4O1NA 1N5WA 4A90A 2RDHA 4DXGA 1VR9A 4ZRPA 2PMVA 1C4AA 1OQQA 2V3NA 1TY2A 1KH0A 1TY0A 2WDQB 3BZDB 4RGOS 5EE0A 3U52E 1D5MC 1PDXA 2WXKA 1D4BA 2VZKB 4P6VF 1UUPA 4IDIA 1PFDA 2B76B 2M0AA 4OVZA 3BVMA 3AEEB 4USAA 4YTNB 1SJHD 1I4HA 2K5PA 1UNSA 1YQ4B 1VLBA 3AE8B 1I4PA 2W55A 5C2TB 4LK0M 1JWAD 1JWUD 3URYA 3J9CA 2JX5A 4Q2JA 3O13A 3LYYA 4EE2A 3MC0B 2ONQA 1SJED 4NAMA 2TSSA 1L4ZB 1UWMA 1YNTE 1L0XB 1SEBD 2CJNA 1TJEA 2PW9A 1MI0A 2WQYB 2W82A 1HA5A 2KQ4X 2X38A 3DWMA 1FD6A 3CIRB 1ZDXA 1VJKA 2QEJC 1ZPSA 4ZRQA 2JU6X 4RF0A 1UGJA 2JQRB 2K9XA 1QF6A 2Y3AA 4REZA 1ENFA 2R61A 2KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN1 A;  4C7Z A;  3P4Q B;  3AMZ A;  3DWG C;  1TKG A;  2PVG C;  3VRA B;  1PUT A;  3RPF C;  4C7Y A;  2L83 A;  3CWI A;  4YSY B;  1WWT A;  3AEC B;  1A70 A;  2BS4 B;  1N63 A;  3AB5 A;  1YJI A;  2L52 A;  1XLO A;  3FC4 A;  3B9J A;  1T3Q A;  2W54 A;  2PVO D;  3FAH A;  1DGJ A;  2WP9 B;  1SF0 A;  1ZUD 2;  1WXQ A;  4N6E B;  1NI3 A;  3ABV B;  1RFK A;  3P63 A;  1AWD A;  4N58 A;  2DWQ A;  2WDR B;  3P4R B;  1NEK B;  3AE2 B;  1N61 A;  2KMM A;  3AE9 B;  1NVI D;  1XO3 A;  2WU5 B;  5MPO A;  3AE1 B;  4ITK A;  3P1M A;  3W5V B;  4ZHP A;  1EWY C;  1B9R A;  4WQM A;  2AX5 A;  1J7A A;  2E3T A;  2OHF A;  2EKI A;  4US8 A;  1F0Z A;  3L4P A;  1QOB A;  2QIE B;  3VRB B;  3HRD D;  1YQ3 B;  2WLB A;  3AEF B;  2M56 B;  3HUI A;  1YJJ A;  1L5P A;  3NVW A;  1JAL A;  1NYQ A;  2CU3 A;  1L6U A;  2FBW B;  2W3R A;  1FFU A;  2ACZ B;  2H89 B;  1E6E B;  2CJO A;  2Q5W D;  3AED B;  1V97 A;  3AH7 A;  1KRH A;  3B2G A;  1JRP A;  4FXC A;  1R7S A;  4WWM A;  3ZYY X;  2BT6 A;  3AV8 A;  4ZOH C;  5EE1 A;  3NVY A;  1FXI A;  1V8C A;  1NEN B;  2BS2 B;  1L6V A;  1ZP0 B;  1JRO A;  4YSX B;  3SR6 A;  5G5H A;  1FRR A;  1QT9 A;  1RM6 C;  2DBY A;  3AE4 B;  3LB8 C;  1E9M A;  1SIJ A;  1GAQ B;  1WYG A;  1ZXI A;  1TYG B;  4YT0 B;  5AUK A;  5C3J B;  1FO4 A;  1E7P B;  4N59 A;  2K22 A;  1OFF A;  1QLB B;  1WGK A;  1J7C A;  3PO0 A;  4ZHO A;  1DOI A;  1JQ4 A;  4YXD B;  3ETR A;  3HVZ A;  4JWU C;  2QJL A;  4JWS C;  1N5W A;  3NRZ A;  2H88 B;  1AYF A;  1CJE A;  1TKE A;  3VR8 B;  3NVZ A;  3NS1 A;  4LTU A;  1OQQ A;  3AE7 B;  5EE0 A;  2WDQ B;  1FIQ A;  2N0S B;  3AEG B;  1CZP A;  5GXG B;  1FM0 D;  1PDX A;  1L0V B;  2LEK A;  3P4P B;  4KX6 B;  4YTP B;  1XLP A;  4P6V F;  1DOX A;  1RWS A;  1E0Z A;  1IUE A;  1WRI A;  2Y5C A;  4IDI A;  1PFD A;  1QOF A;  1QOA A;  2B76 B;  2MJ3 A;  5G5G A;  3SFD B;  3AEE B;  1VDV A;  3AEA B;  1KF6 B;  4USA A;  4YTN B;  1RYJ A;  2G1E A;  2K5P A;  3P4S B;  1ZOY B;  4YTM B;  1YQ4 B;  4HRO A;  1QOG A;  5AUI A;  1VLB A;  1N60 A;  1FFV A;  2KAJ A;  2MH7 A;  2MJE A;  2W55 A;  3AE8 B;  5C2T B;  2W3S A;  1TKY A;  1JWA D;  1XLN A;  1I7H A;  3NVV A;  4C80 A;  1JWB D;  1FXA A;  3VR9 B;  3WCQ A;  2JX5 A;  4HRS A;  1NYR A;  3W9C B;  3AM9 A;  4YSZ B;  2WU2 B;  3SFE B;  2MJD A;  1OQR A;  1GPX A;  4US9 A;  2BS3 B;  2HTM E;  1N5X A;  3B2F A;  1UWM A;  1ROE A;  2CJN A;  3AE5 B;  3EUB 2;  1TJE A;  4A9A A;  2WDV B;  3BII D;  1N62 A;  1JW9 D;  2WQY B;  1FMA D;  2M19 A;  3AE3 B;  1DOY A;  2WS3 B;  3DWM A;  3AE6 B;  3CIR B;  4JX1 C;  1VJK A;  5H92 C;  1FRD A;  3KWL A;  1E10 A;  2JQR B;  5EE9 A;  2K9X A;  2PKO A;  1QF6 A;  1XLQ A;  2PIA A;  1J7B A;  1KFY B;  5H8Y E;  3W5U B;  1SB3 C;  3AEB B;  5EE3 A;  3LXF A; 
#chains in the Genus database with same CATH topology
 4IQU A;  3P4Q B;  1STE A;  3AMZ A;  4M0A A;  5AKE A;  3KBB A;  1UPH A;  4F50 A;  1U47 A;  4C4S A;  5AKH A;  3ZLZ A;  1A70 A;  3KYD D;  4ICA A;  4Y2S A;  5ALU A;  1FEH A;  3T8M A;  1IYF A;  2LZ6 A;  1T6B X;  2LGI A;  3MFG A;  2BB6 A;  4KKJ A;  4GXJ A;  1SKW A;  5DPW A;  1NZP A;  3UXO A;  4F4K A;  5CA7 A;  4LNO A;  4NAW B;  1H4R A;  1E8Z A;  1J97 A;  1BPD A;  5AK3 A;  1WJU A;  5KG4 A;  1EWY C;  5KG6 A;  5AKY A;  2NRV A;  2E3T A;  1C7Y A;  5HP4 A;  2HBM A;  1SBB B;  2ZTC A;  4US8 A;  4U7C A;  4YP3 A;  1F0Z A;  1HE8 A;  3HRD D;  2QB0 A;  3LWL A;  4RPY A;  1YN4 A;  2IY1 B;  4FJV B;  2V4I B;  3Q2A C;  1L5P A;  1S77 D;  2CHW A;  3SEN A;  1VZ8 A;  3V60 A;  2BCQ A;  3AH7 A;  1B22 A;  2Q5W D;  2HDO A;  3JVZ X;  2QHO A;  5EE1 A;  3AV8 A;  4ZOH C;  2ESE A;  5BO4 B;  5J2F A;  1S0N A;  4PS7 A;  2KN5 A;  3SR6 A;  1XSL A;  3RUI B;  1TYG B;  2VA8 A;  5ALE A;  2D3B A;  3BVZ A;  3WKB A;  5AM3 A;  2BYV E;  5IKC M;  1D5X C;  5HR6 A;  3C28 A;  3Q8B A;  3ETR A;  4ECW A;  3GFK B;  2AU0 A;  4QZ8 A;  4JWU C;  7ICV A;  5D2M B;  2INN E;  1K5O A;  3SAF A;  1SL0 A;  5L1M A;  3ZD8 A;  4KGT A;  2V9H A;  1LFD A;  3RAX A;  2AQ1 B;  5L95 C;  2I2Y A;  4WAA A;  2FPL A;  5J0Y A;  1CZP A;  2ZZP B;  1XD3 B;  3JPT A;  3NUQ A;  2GLE A;  1V38 A;  1SL2 A;  1ACC A;  1X1M A;  2KQS A;  1PK3 A;  4ELV A;  7ICH A;  4WJO A;  2LVP A;  2D8C A;  1WRI A;  2QIL A;  3WAO A;  1D8B A;  2I6X A;  1ZD2 P;  3HKZ C;  4Y2P A;  4EEY A;  2GB1 A;  3WAM A;  3T3F A;  3TIX A;  4EBC A;  4FUL A;  4ZRK A;  2ZIW B;  2MBB B;  5IA7 A;  3APC A;  7ICS A;  5EOZ A;  1Y56 A;  2KP7 A;  1QH9 A;  5DGA A;  2ZNV B;  2OED A;  1E90 A;  3M1Y A;  3IAM 1;  1T4G A;  3KZX A;  1GPX A;  3MHZ A;  3E9S A;  3HWT A;  2ASD A;  2NTS A;  2UYZ B;  5A0L A;  3R7R A;  2HOF A;  3DHG C;  3VCB A;  1C4P A;  4KVG B;  3ZVV A;  3B08 A;  2F1H A;  2RDI A;  2LXC A;  2AQ0 A;  1NK6 A;  5KFI A;  4J9R A;  3ETL A;  2KNJ A;  4P1B C;  1AN8 A;  3ZO5 B;  2DEN B;  1UZX B;  4EKU A;  3T3O A;  2E1E A;  3C5F A;  2H88 B;  4W9L A;  4G9B A;  4UAT A;  2UWQ A;  3Q8C A;  4BBN F;  4BWJ A;  2PXI A;  1E7U A;  2K8C A;  4C8L A;  5BYR A;  2E1F A;  2ZIU A;  2IBK A;  4B9U A;  1O08 A;  3RFZ B;  1NNL A;  3QK0 A;  3U26 A;  4NQK E;  3AU4 A;  3SAG A;  2ISO A;  5DQG A;  5KFB A;  5BOL A;  1JN3 A;  3WK7 A;  1NZB A;  5KG1 A;  2BW2 A;  1X66 A;  2DAJ A;  1MQ3 A;  4R65 A;  7ICF A;  1Q10 A;  4BJQ A;  1XO1 A;  3WA0 A;  2EAP A;  4BKG A;  4ITK A;  5CR0 A;  5E79 U;  3U2S C;  2ZJA A;  2OHF A;  2J6S A;  4OJP A;  3ZXV A;  2EMS A;  3F2C A;  3L4P A;  2ZIX B;  2QIE B;  2IPK D;  4IW0 A;  1AAR A;  4RT2 A;  2ZW1 A;  2N1V A;  3IG3 A;  3R2I A;  3V62 A;  1L6U A;  1WCN A;  5ALG A;  2R8K A;  3M6K A;  1WGG A;  5JRT A;  3APD A;  2A1J B;  4MSM B;  2E6X A;  8ICK A;  2WAQ C;  4O5C A;  3ONS A;  1HZ5 A;  3RB4 A;  3LB8 C;  4J9L A;  1F2R I;  3KHH A;  3LDA A;  4C8O A;  1E7P B;  2PI5 A;  1C1Y B;  1K53 A;  3HJE A;  1FCC C;  3PV8 A;  1L7O A;  5J2B A;  4KLF A;  1BNP A;  4RNA A;  1T7P A;  2LBO A;  1ZQL A;  4IRD A;  1RLF A;  2L3Z A;  4CQN A;  3JPN A;  2FUG 1;  4EBE A;  2YB4 A;  3H8S A;  3T5J A;  4HJG E;  4RF1 A;  1GNU A;  3PVL A;  2LPE A;  3ZJT A;  5J2D A;  2ZW0 A;  4ED3 A;  4RQ0 A;  3QZ7 A;  2DLB A;  4YTP B;  5CB1 A;  1BNO A;  2LI6 A;  4GGQ A;  2HOQ A;  4ECQ A;  4F5P A;  2MJ3 A;  4QZ9 A;  4YD1 A;  3FDS A;  3QEA Z;  2HHT A;  4J9N A;  3H8M A;  1R4M B;  4HPL B;  9ICF A;  4YR2 A;  3M9M B;  1N2X A;  2KIV A;  5JU5 A;  3EZ5 A;  4Y2X A;  2FI1 A;  3E0F A;  2BQQ A;  8ICT A;  4GN1 A;  2QAR B;  5J8Y C;  1GO3 F;  3OTQ A;  4PPX A;  2WXN A;  3TAD A;  1JWS D;  4GC6 A;  2R2Q A;  1LQB A;  4GXB A;  2D3D A;  4WUR A;  4LCD E;  2OM6 A;  5C0Y A;  4BKS D;  2BDU A;  3Q8R B;  1N5X A;  4ELU A;  4L2Y A;  4RCO A;  5AZH A;  2SAK A;  2HBK A;  1IBX B;  7ICG A;  3MDA A;  3HKZ F;  1PGX A;  2KWU B;  3APF A;  2K3U A;  5CP2 A;  2KE7 A;  1BML C;  2YX8 A;  2K6Q A;  1ZQU A;  1RPL A;  3AE3 B;  3QU7 A;  1SE4 A;  4ED8 A;  2KC1 A;  3BYT B;  3TEX A;  4ZDV A;  3V6H A;  2CXY A;  9ICW A;  1WXM A;  1L0Y B;  3TAN A;  1SIF A;  1XLQ A;  2PIA A;  4BOS C;  4PK1 A;  4MGI E;  4J3O D;  1NI2 A;  1XCQ L;  9ICB A;  1SZP A;  3A9J B;  3IHP C;  3H8W A;  1DRG A;  3TJP A;  4MFF A;  4GOC A;  5JHA A;  3OSP A;  5L1J A;  4IM2 A;  1ZJM A;  4YSY B;  3GV7 B;  1WX7 A;  4A20 A;  4BAX A;  1IP9 A;  2HBL A;  1GC7 A;  4XUS A;  2H3V A;  2GOW A;  1ZQR A;  4Y2U A;  5BPC A;  4F5O A;  2JGA A;  1QIL A;  2MEK A;  2ZXH A;  3W1S A;  2EZY A;  1L2N A;  2EEL A;  4M00 A;  2KTR A;  3WAL A;  9ICO A;  1E8Y A;  2G45 B;  4XZ4 A;  3F53 A;  5DKW A;  2XEW A;  3QZ8 A;  3VDZ A;  1EU3 A;  5IN7 A;  5L1I A;  3VXW A;  3GE8 C;  3QU5 A;  3QE9 Y;  1Z2M A;  2CKH B;  2YEP F;  2LYA A;  3MC1 A;  4LJP B;  3EPG A;  3HUI A;  3NGD A;  1NYQ A;  4J9K A;  4ED0 A;  2IYD B;  1RXV A;  5KFJ A;  4PYZ A;  3ZNI D;  2QB0 B;  4LZD A;  1CQV A;  3AE4 B;  5CX3 A;  4DFJ A;  3DHH C;  4JK1 A;  2FCN A;  4M47 A;  2F3N A;  1OFF A;  4ZHO A;  2BCS A;  4NLZ A;  1HJP A;  1BGX T;  4ANU A;  9ICH A;  3ZNH B;  2WNM A;  4LNF A;  1MFW A;  3AEG B;  2NBV B;  4R3D A;  3I28 A;  4J03 A;  8ICW A;  1WUD A;  5KFS A;  1KTQ A;  2LGS A;  5DPS A;  2K8A A;  2LGY A;  2WAQ F;  2KDF B;  3IVF A;  2M17 A;  5J2R A;  3DEE A;  1V49 A;  3VFK A;  2AQ3 B;  4HWI B;  4U6P A;  1ZQQ A;  3V7L A;  4M8N A;  4BUG A;  1KF6 B;  2E5S A;  4KLG A;  3IDW A;  4KLE A;  1Y88 A;  2KYW A;  1VCB A;  2JRZ A;  2DYO A;  2BF8 B;  2FMQ A;  3P4S B;  3PW0 A;  1SSN A;  2Y1I A;  1XSN A;  2KX3 A;  2WXP A;  3VH3 B;  5AI4 A;  1WMH A;  2LUE A;  2NRW A;  3WK5 A;  3MGI A;  3H8J A;  4M02 A;  3QWZ B;  3LVV A;  3AU2 A;  4EEK A;  5F9N A;  2KZR A;  4HCP B;  3LDZ E;  3W9C B;  3ZD9 A;  3MC9 A;  2WU2 B;  1BXT A;  2MJD A;  2WX1 A;  2BB5 A;  2JEJ A;  1C79 A;  1B43 A;  3PRZ A;  3Q8P B;  1KFT A;  1XWL A;  4QWB A;  4BGD A;  2AQ4 A;  3PW2 A;  2CHX A;  4CF4 A;  4CRX A;  2HHW A;  1WZ3 A;  1SKS A;  2XY7 A;  4R66 A;  2LKY A;  1TT5 B;  2FLN A;  1MN8 A;  4Y2Y A;  3VRA B;  5AHX A;  4M9G A;  1J19 A;  4QW8 A;  4OHJ A;  8ICA A;  3RJH A;  4IR9 A;  4NLG A;  1PUT A;  4O5E A;  4DF8 A;  3WKA A;  1K1Q A;  4GSW A;  4FE3 A;  4R8U A;  3DBL B;  2UU7 A;  3PX6 A;  2L52 A;  2LYB A;  1DK2 A;  5BYQ A;  3FIL A;  2HE7 A;  3GS2 A;  1JXE A;  1XO0 A;  1AQ6 A;  2K8C B;  3FYH A;  4F5Q A;  1EUV B;  3PT2 B;  3N32 A;  2RMM A;  1CEZ A;  3WKD A;  4KGS A;  2ZIU B;  1D9F A;  2W9C A;  2UVW A;  2E8M A;  3UMC A;  4QJF B;  4AQ7 A;  5CHV C;  4BZA A;  4S0R A;  3F5E A;  4QIW C;  2KHQ A;  5ALV A;  1P7F A;  2NPT A;  2F76 X;  1A6S A;  4AP9 A;  3HX0 A;  4M9N A;  1WY8 A;  1QSS A;  1UGM A;  1UT8 A;  2WWZ A;  3IT4 B;  1RYR A;  3L3F X;  2IJ0 A;  1WGH A;  2FCS A;  1QKZ A;  4F3O A;  5C23 A;  4DL7 A;  4LJX A;  1E6E B;  1ZQN A;  4W9I A;  2I1Q A;  4WWM A;  2BT6 A;  4ECV A;  1AW7 A;  1TGZ B;  2BS2 B;  3JSV A;  4FO6 A;  4AWJ A;  4BKS A;  1L3T A;  2LFI A;  4W9G A;  2G5H B;  5I4D A;  4R64 A;  5AKL A;  4BWM A;  5J0O A;  4UB8 U;  3Q3J A;  5KHO A;  4QZC A;  3PS6 A;  4PGY A;  3DVN U;  5DB8 A;  4ZRP A;  4TQR A;  3GZN B;  1OQQ A;  4F92 B;  4KLS A;  5EE0 A;  5IIJ A;  3BZD B;  4RGO S;  2A4Z A;  4YMO A;  1PDX A;  4KLQ A;  2LRU A;  1E7V A;  2OJR A;  3RH5 A;  3ZXR A;  1U4B A;  2BCR A;  3X0W A;  2B76 B;  2IA6 A;  2JVC A;  1HTO A;  1YOV B;  2VRR B;  3BVM A;  4PHE A;  4OJ5 A;  2XC9 A;  1NJX A;  3Q3M C;  4USA A;  5AI8 A;  1YX5 B;  2XY5 A;  1SKR A;  1D9D A;  3KVF B;  3NZU A;  1V5T A;  9ICQ A;  1I4P A;  1V6E A;  3N1X C;  4MF8 A;  2HCF A;  2FDR A;  2LAS A;  1E5W A;  4GLX A;  1QLN A;  4P4P A;  1TFR A;  4FBU A;  3O13 A;  1V85 A;  4QZG A;  4DQQ A;  3F5A A;  2P6R A;  2M8S A;  4NAM A;  3M9O B;  4PHA A;  2TSS A;  1WGY A;  9ICK A;  5D6J B;  4M8M A;  1L0X B;  4GDL A;  5KT4 A;  2WQY B;  5KNI A;  2W82 A;  3TFS A;  4F1S A;  3UQA A;  3QIJ A;  1ZDX A;  1UH6 A;  2QEJ C;  1H8C A;  4ZRQ A;  4IWO A;  1QF6 A;  2MU2 A;  2H5X A;  1QQ7 A;  3PO4 A;  3UIN B;  4J9Q A;  2LRW A;  5B5E U;  1WXA A;  2XBB C;  2JXJ A;  2DPI A;  3B0Y A;  4FBT A;  3H6N A;  2ZIV B;  2NBW B;  2BKF A;  2BS4 B;  1KRP A;  1N63 A;  3WAN A;  3C8Y A;  2L00 B;  1ED1 A;  2AGQ A;  1KQQ A;  3JPR A;  4HVB A;  2WF9 A;  2G06 A;  2W54 A;  2G4D B;  3RTV A;  1NI3 A;  3CW2 C;  2KJR A;  2M4N A;  3PML A;  3I5J C;  2MSN A;  2AGP A;  2NCN A;  1I4R A;  3ED5 A;  2F8K A;  3MR5 A;  4GDK A;  4TUQ A;  2QSD A;  2LMC A;  5IIL A;  4NLK A;  2OJW A;  8ICX A;  1PVP A;  4DEZ A;  1B9R A;  4UB4 A;  4JMU A;  3C5G A;  2ASJ A;  4UAW A;  2KD0 A;  2M1M A;  4RZR A;  3RF9 A;  4NXZ A;  3PR4 A;  1NK0 A;  4JLC A;  3AL0 B;  4A6Q A;  1ZQB A;  3IT6 B;  4YVZ A;  2KTR B;  3OWE B;  1SWW A;  4F8R A;  1HXY D;  2LJI A;  2RLT A;  3RZW C;  5KG2 A;  1FFU A;  3M3J A;  4KX5 A;  4C4T A;  4FXC A;  1IV8 A;  4MF2 A;  1F1H A;  1LO5 D;  1V1P A;  2FNJ B;  3FM9 A;  3PSI A;  3GV5 B;  3N4M B;  3SHQ A;  2N9K A;  4YT0 B;  4J9O A;  5T14 A;  2XNA C;  2KMA A;  4UW9 A;  1WGK A;  1R4N B;  4QIW F;  1J7C A;  1X9M A;  3OJU A;  3H7P A;  2B6G A;  2CU1 A;  2KSO A;  2KK0 A;  1RQL A;  1WI0 A;  4ZYS A;  3GZF A;  3D32 A;  4TKN A;  3AE7 B;  2AQ2 B;  2J4X A;  5KFN A;  2KJ5 A;  2ATL A;  2M0X A;  4URK A;  2JF5 A;  9ICE A;  3A4S C;  2W9A A;  4ECX A;  4AOF A;  3QHT A;  3KTQ A;  4O3N A;  5ALM A;  2L05 A;  1WX8 A;  1ZQV A;  4QWD A;  4HDQ A;  4OO1 J;  4RGT A;  3RD2 A;  1YX6 B;  3EEC A;  3MBY A;  4B9M A;  3V05 A;  1QOG A;  4YG2 A;  4S17 A;  4FZL A;  4QWA A;  3DV9 A;  4RQ6 A;  2HHU A;  1HEZ E;  2KAJ A;  3KLS X;  4BDP A;  4MEY A;  1BPX A;  4KIK B;  4IRK A;  4FJZ A;  2WGS A;  1MC8 A;  3GIL A;  1V9P A;  1UBI A;  2FMS A;  3PO5 A;  7ICJ A;  4CGZ A;  1LKY B;  4US9 A;  3MDC A;  3T5H A;  3U7Z A;  1WXV A;  1COO A;  2L0F A;  1ZRN A;  4M9H A;  1WMH B;  3VUY A;  3T3N A;  2MA1 A;  5KT3 A;  1KEJ A;  2R18 A;  8ICY A;  3V7K A;  1TKD A;  2C5L C;  4KKI A;  5EWF A;  2WDV B;  1JW9 D;  2FE9 A;  2WXH A;  2VH2 A;  4PHD A;  4I2D A;  1ZQE A;  5J0T A;  1YD8 U;  4WIP A;  4YFK A;  5AIB A;  3A4R A;  3AQF A;  1ZQM A;  2I38 A;  1GB1 A;  4HDO A;  4HPP A;  1UCV A;  3ZDC A;  2BKE A;  4II3 B;  3QUT A;  3ZI4 A;  2ZTE A;  1GUA B;  1SB3 C;  1QQ5 A;  4NV0 A;  4CE6 A;  2MBO A;  3LXF A;  4ACF A;  3PLV A;  1GB4 A;  1IBX A;  4YMN A;  1NJY A;  3VTU A;  4GXK A;  4EOY A;  4C7Y A;  2XCP A;  1KOT A;  2INC C;  4QWE A;  1UA1 A;  3AB5 A;  1ZQY A;  2GBJ A;  3KHR A;  1Z4O A;  4UB3 A;  9ICX A;  1YJI A;  2YMQ A;  1KLN A;  2KX0 A;  2MSE D;  3UPQ A;  3BQT A;  4FJY A;  3PST A;  8ICV A;  4GLS C;  1CK1 A;  1YJ1 A;  1ZXH A;  2E8N A;  3V6E B;  3P4R B;  2BYE A;  1N61 A;  4R8U B;  5DLG A;  3VTW A;  1QQ6 A;  3LYS A;  1SE2 A;  2VKQ A;  2HW3 A;  2KDM A;  5DPR A;  7ICT A;  3FIL B;  4I2J A;  2W43 A;  2JR5 A;  5KFK A;  3ZNG C;  3BZC A;  2D3G A;  4Q8F A;  1WFY A;  3OJS A;  2GRI A;  1QSL A;  2LGX A;  3AUL A;  2BWE S;  3NJT A;  2W9C B;  2Y1J A;  2NVU I;  4XC2 A;  5EDS A;  1YJJ A;  3Q14 C;  2Y5P A;  4I6L B;  2OOB B;  2AWT A;  1T5X D;  2W3R A;  1O03 A;  1KFD A;  2W8K A;  2GOL A;  3M8S A;  2CJO A;  2CR5 A;  3BS7 A;  2NPT B;  2ZVO A;  4QNL A;  1NK8 A;  3NVY A;  1FCL A;  4HKQ A;  5AI5 A;  3P42 A;  4PS3 A;  5KTQ A;  1L6V A;  3BQ7 A;  1V2Y A;  2JV3 A;  3N28 A;  3L54 A;  2KZZ A;  1SWV A;  2E8P A;  1KM7 A;  4RM8 A;  3F2B A;  2ZUC A;  2QJL A;  3JSV B;  1L5U A;  2G4S A;  5AK4 A;  2BHN A;  1YZ6 A;  2ON8 A;  2ZPY A;  8ICR A;  3QAQ A;  3SV3 A;  2GWS A;  1ZQF A;  1WWV A;  2I9G A;  1XSP A;  1WGD A;  2KVS A;  1SE3 A;  1DOX A;  2C28 A;  4CF5 A;  8ICF A;  2DQN B;  1X6I A;  2JRI B;  2WXR A;  4KLJ A;  3I76 A;  3RJF A;  1ESF A;  5HHI A;  2L76 A;  3ML9 A;  5FR3 A;  5G5G A;  4B9L A;  2D3A A;  3T9L A;  3SD5 A;  3UXN A;  3U8Z A;  3RNE C;  2XN9 C;  3AEA B;  3SV4 A;  4YN4 A;  4GB9 A;  4NQL B;  3TEW A;  2L7R A;  5AUI A;  2IGD A;  1X40 A;  5KFF A;  4PGQ A;  5DG7 A;  3TUO A;  4IOI E;  1JX4 A;  4KIT B;  2EDU A;  4QZH A;  4IC9 A;  3MTN B;  5LXH A;  3NVV A;  4C80 A;  3AXC A;  2C7M B;  2WXL A;  4HRS A;  2I1K A;  2W04 A;  4ED7 A;  5E6J A;  2LHE A;  4HXD A;  3RFA A;  2HMX A;  4EZ6 A;  1L4D B;  3C1Z A;  2A19 A;  5LLI A;  2Z0D B;  2K25 A;  1UD7 A;  5AK6 A;  3UMB A;  2AJQ A;  1RDF A;  4HEA 1;  1ZRM A;  2ALZ A;  1CMX B;  3AE6 B;  1P3Q U;  2GMI C;  3KWL A;  2K6D B;  1C77 A;  3EYZ A;  2PKO A;  3KQ4 A;  4GDL B;  4NM1 A;  1KFY B;  5J2C A;  1S10 A;  3R8B A;  4TUS A;  1B1Z A;  3NTU A;  5GTI U;  2J6U A;  2N9E B;  4ICV A;  4K3B A;  4WJN A;  3RPF C;  2C22 A;  1MVK A;  4DSL A;  4B0E A;  4K7W A;  1OGW A;  4YXM A;  1PGA A;  4F4Y A;  3WKE A;  5KFC A;  3GV8 B;  3B9J A;  1ZD3 A;  4A8E A;  2EZZ A;  2ASL A;  1J0G A;  2O2V B;  1X6J A;  3K1Z A;  4N6E B;  4N58 A;  1T8E A;  1KKX A;  3KZI U;  1MJD A;  1L8O A;  1NEK B;  4C8N A;  1K8R B;  3A9K A;  2RPQ A;  2KFN A;  4HCN B;  3DBH I;  9ICT A;  3RJI A;  1F0M A;  3VC8 A;  2BDP A;  1K50 A;  5CHF A;  1WF9 A;  4DOA A;  3WAP A;  1C76 A;  4IS7 A;  5AM2 A;  2JXT A;  5DDY A;  5HHH A;  5AKI A;  1C9F A;  4NLB A;  1YQ3 B;  1Q3U A;  7ICL A;  3L17 A;  4GDK B;  2MUT B;  4ED6 A;  4KLT A;  1JAL A;  3RH6 A;  1SV0 A;  3SQI A;  3QU9 A;  2ACZ B;  3AED B;  3KUZ A;  1JWM D;  2XIC A;  3AQE A;  4NY8 A;  4OJO A;  2IGG A;  2KN7 A;  1OEY A;  2KKV A;  1RM6 C;  3AI5 A;  4G3X B;  4J6I A;  4OVU A;  2B3A A;  1S76 D;  2LVO A;  4EUT A;  7ICE A;  2AL3 A;  2MQJ A;  2W03 A;  2A1A A;  3MR6 A;  3GIJ A;  1MPE A;  3PO0 A;  2N7D A;  2KTQ A;  1V1P B;  3G6Y A;  5KAF U;  3SD7 A;  4I2F A;  1S0V A;  3QX7 A;  4A3O A;  2FE8 A;  2ASQ A;  1MHX A;  1HUO A;  4EZK A;  3ZDE A;  3HM3 A;  2KKC A;  5AM5 A;  4CYE A;  3UGB B;  1FIQ A;  4RT3 A;  2EKE C;  2BTE A;  5TSS A;  1JI7 A;  2V1Y A;  3H7P B;  4RNN A;  3HPO A;  3WK9 A;  4KX6 B;  1ZQT A;  2J0M A;  2KSO B;  5J2E A;  3WU2 U;  2OCE A;  2K4H A;  4YCX A;  2Y5C A;  5D46 A;  3IG5 A;  4NWI A;  4I27 A;  4W9J A;  4FLH A;  3GII A;  2WDT B;  5KHQ A;  5ALX A;  2JWZ A;  4AYB C;  2BPF A;  4Q8E A;  3UIP B;  3V72 A;  1A76 A;  1FFV A;  1UF0 A;  3NZ3 A;  1TAM A;  4EEN A;  4F4X A;  3KOO A;  1WG8 A;  1TKY A;  1LXD A;  2DZJ A;  4WAF A;  1YZ7 A;  3Q8S B;  1XLN A;  1RAX A;  1ZQP A;  2KFJ A;  2IHM A;  3PRM B;  4BFR A;  2KJ8 A;  2WB1 F;  3RN9 C;  1Z3E B;  3VQI A;  3RH4 A;  4DF4 A;  2R8H A;  4ED2 A;  1MSW D;  4WJQ A;  2ICI A;  4BXO A;  3H0M B;  3EFU A;  5JHB A;  4NL9 A;  1FMA D;  3MC8 A;  5KG3 A;  1YN3 A;  2JPH A;  3BK1 A;  4Z6C A;  2C7N B;  4NM2 A;  2I5H A;  2Q4T A;  2MCN B;  3QU2 A;  1E10 A;  1SXE A;  5KT5 A;  1U9L A;  4DDG D;  7ICQ A;  8ICM A;  2Q0Z X;  4DBG A;  3AU5 A;  3S6J A;  4FZM A;  4NZL B;  1K52 A;  3C21 A;  4I29 A;  5KFO A;  1L3U A;  2WF7 A;  2DYB A;  2J53 A;  5C1Z A;  5D7G A;  2KOB A;  3CF6 E;  3BK2 A;  4KLI A;  2B0C A;  4NY0 A;  4UAY A;  3EA6 A;  1SF0 A;  1ZQS A;  3DVN V;  1ZYQ A;  1UQV A;  1Z19 A;  3JW0 X;  2DF4 B;  4M6W B;  3RT3 B;  9ICC A;  3UXP A;  4TQS A;  4P16 A;  3N7P D;  1N6Z A;  3H4B A;  2VA3 A;  3NG0 A;  2ZIV A;  2IY0 B;  2XVT A;  4IC7 B;  3KKA C;  5D49 A;  5AK5 A;  4OD0 A;  1ZQO A;  2IHN A;  2REX A;  3KHG A;  4AJY B;  3NVW A;  3ZJV A;  3MGH A;  4XWT A;  4XQ8 A;  2OXO A;  1RG6 A;  2H89 B;  2D6F C;  2GBR A;  1Q46 A;  3D2N A;  3RR8 A;  4DFK A;  3RB6 A;  1UWX A;  2G5I B;  5TR5 A;  1WR1 A;  3KH0 A;  4RUA A;  5KFD A;  4ACO A;  1GG3 A;  3BQ1 A;  1WYG A;  3BQ2 A;  5DPT A;  5C3J B;  5C5J A;  3V3X A;  4NNJ B;  2HSZ A;  3HVZ A;  4DDI D;  5J0Q A;  2QC8 A;  5FR6 A;  4A90 A;  3ISB A;  4GXI A;  1PQS A;  2RDH A;  4DXG A;  9ICV A;  2CPR A;  1VR9 A;  2PMV A;  4JB3 A;  4PHP A;  2WF8 A;  1F5S A;  4Y2T A;  3B0A A;  1TY0 A;  5KT2 A;  4MFA A;  1D5M C;  2HTH A;  4EBD A;  2WXK A;  1D4B A;  3C29 A;  2LD9 A;  4P6V F;  3SU8 X;  7ICI A;  3R9K A;  3QYP A;  4IWP A;  2P6U A;  4O3R A;  4DFM A;  4HYK A;  2EQY A;  2LGD A;  2RD0 A;  1Q1O A;  1SGH A;  4B6W A;  4YTN B;  1X42 A;  1YT3 A;  1SJH D;  3ZKJ C;  4KZC A;  2VJ4 A;  5KFL A;  1UNS A;  4WWN A;  2Y9U A;  3RJG A;  4HK2 A;  3Q3F A;  5DLF A;  2BYF A;  4KLL A;  1S0O A;  3AE8 B;  3BQ0 A;  2W55 A;  3GQC A;  2C9W B;  1JWU D;  4E71 A;  3PZD A;  3Q3N C;  3J9C A;  1ZGU B;  4Q2J A;  2ZNV C;  5ALZ A;  3RAQ A;  3LYY A;  1Y8R C;  4EE2 A;  3MC0 B;  2XID A;  2GBN A;  3DDC B;  4JUZ A;  5K4L A;  1SJE D;  4DHZ B;  5KG5 A;  2DX5 B;  4ZRJ A;  5HKH A;  1SEB D;  1IPG A;  2JEG A;  4B9K A;  4CNQ A;  4OJ6 A;  1MI0 A;  2KQ4 X;  2X38 A;  3A33 B;  3WK8 A;  4AYB F;  3JPO A;  4W9K A;  4KIK A;  1VJK A;  1P1A A;  2HJ8 A;  2QDF A;  2JQR B;  2K9X A;  2Y3A A;  1WXS A;  4REZ A;  5CHW A;  4NLC A;  1LKY A;  2KFZ A;  5III A;  2KN4 A;  3IFW B;  5ALD A;  2KJ9 A;  3AN1 A;  5HR7 A;  2NS5 A;  3KUD B;  4DHJ D;  2BBC A;  4EZJ A;  1V80 A;  1Z1B A;  2LUM A;  2L5Y A;  3Q69 A;  2MLB A;  3AEC B;  4PT5 A;  1KW4 A;  4K1R B;  1OQY A;  2HBJ A;  4FBJ B;  1X2I A;  2WX0 A;  3L16 A;  2PVO D;  4JPS A;  3TBL D;  2ES6 A;  2XGP A;  2JRH A;  3ABV B;  8ICU A;  2DWQ A;  5KFY A;  1SV4 A;  3HM6 X;  9ICJ A;  2KMM A;  3QQ8 B;  5J2I A;  3UQ0 A;  2GBM A;  2NBU A;  2NO4 A;  3DPD A;  5D4B A;  3TKA A;  2UVU A;  2RHF A;  3A9K B;  4B0M A;  5CHG A;  5F9L A;  5IIN A;  3EWA A;  2W9B B;  2WHI A;  5AZG A;  2ZCB A;  1Z4N A;  2K60 A;  2QCZ A;  2RSU A;  4LZG A;  3SZ2 A;  3LVW A;  2N9P C;  1JRP A;  2KIW A;  1WJ6 A;  3HIZ A;  2YN4 A;  3ZW3 A;  3M8R A;  1XF5 L;  3R2T A;  4HLE A;  1EU4 A;  1FXI A;  1LM8 B;  7ICO A;  1J2N A;  5AKK A;  2FPK A;  5G5H A;  3KHL A;  5AUK A;  1E9M A;  1ZQJ A;  2F1J A;  4I6N B;  2QB1 A;  4Z6F A;  3QX1 A;  3Q8L A;  2BPS A;  2DPJ A;  4K4G A;  4EEL A;  2J0J A;  2VJ5 A;  5KL8 B;  4JV1 A;  2F77 X;  3F2D A;  4IR1 A;  1WE6 A;  3ZUN A;  1ZET A;  4KDL B;  2WHE A;  3Q8A A;  3KUC B;  3MJ5 A;  2ZJ5 A;  2FJ6 A;  3UQB A;  2X8X X;  3BVG A;  1VZ7 A;  1S9F A;  2LI5 A;  3U4E G;  3VUW A;  5IP4 D;  1RWS A;  4DSK A;  1MG4 A;  4RUC A;  3WK4 A;  3RUL A;  3UIO B;  4MH8 A;  3RNF C;  2KLG A;  3RBE A;  3Q3O C;  3RNA C;  5IIM A;  2FID A;  4P0P A;  4EX7 A;  1CRX A;  3M63 B;  4KMU A;  2W9N A;  3N7R C;  4W9D A;  2JZB A;  4HRO A;  1NK5 A;  3PX4 A;  4KLM A;  5E6N A;  5J18 A;  2G9H D;  4G50 A;  4O3M A;  4LLG M;  4IWQ A;  1BPE A;  2J42 A;  4MEL A;  2VH1 A;  4QZA A;  4MHV A;  4FHJ A;  5KG7 A;  5E6P A;  5KT7 A;  4NJ7 A;  4EFO A;  4LVS A;  1QZE A;  4NJC A;  3H7I A;  2KZM A;  3VTV A;  4DFD A;  4EYH B;  1JML A;  2JUO A;  4ASW C;  3PY8 A;  5BMG A;  2CRX A;  1LVH A;  3GP7 A;  3DVG X;  4RNM A;  4GIV A;  1I42 A;  3WK6 A;  1BPZ A;  2PPH A;  4BXO B;  1J7B A;  4W9C A;  2P66 A;  4ECU A;  4DQS A;  4TV3 A;  4ANW A;  3I3T B;  1PK1 B;  5L9X A;  4RFB A;  4RQ5 A;  4IL6 U;  3C2K A;  4PYU A;  2M9N A;  3KYC D;  2MA9 B;  2BQU A;  3GE3 C;  2Z7J A;  2L83 A;  4II2 B;  4WQO B;  3ZDM C;  2V0G A;  3RI7 C;  2J52 A;  2MAX A;  5J17 A;  2HVH A;  2MWS B;  2WXJ A;  5AEK B;  2XK5 A;  4E74 A;  1ZQX A;  4KSL C;  2PLP A;  3FAH A;  1HEK A;  4OJL A;  5DBA A;  1WYW B;  2D5G A;  1XNS A;  2C2D A;  2A3V A;  4KX3 A;  3SAH A;  1KL9 A;  3W5V B;  1C78 A;  1NKE A;  4F2S A;  5JZE B;  5ALY A;  2Y9T A;  3KW5 B;  4M01 A;  3GIK A;  3ZDA A;  2EKI A;  1IM4 A;  3B0X A;  3Q6B A;  3VRB B;  4YR0 A;  1XCT L;  2J7Q B;  4HJK A;  2H3Z A;  2W7O A;  3ECI A;  3OSN A;  4K4I A;  2O2V A;  3RCZ A;  1NDD A;  9ICR A;  4FZN A;  9ICP A;  1Q8K A;  3V7J A;  1UT5 A;  1ZDV A;  3V6K A;  1QQR A;  2GBK A;  4MEM A;  3OGU A;  5L1K A;  4WWO A;  5E6O A;  3ZYY X;  5AIA A;  5L1L A;  1S0M A;  3TMP B;  5F3X B;  3V6C B;  4XGA B;  3T5L A;  5HG2 A;  4F71 A;  1KN5 A;  2YMP A;  1TE2 A;  4DS4 A;  1TV9 A;  4B9T A;  4KV2 A;  1OW5 A;  4BX9 C;  1FO4 A;  4O0I A;  4CCH A;  2K89 A;  3IHQ B;  4YD2 A;  1XS9 D;  4P1C C;  2MUT A;  5DQH A;  4E3C A;  4JGH B;  3BS5 A;  4M2Y A;  3ENE A;  1AYF A;  4KDI C;  1BPB A;  8ICJ A;  4LTU A;  3VVW B;  2PFO A;  3ZDB A;  2N9L A;  4KLD A;  2YVC A;  2ZJD A;  3N9Y C;  1V1O A;  4RGN A;  3ALR A;  2JY6 A;  1FM0 D;  2ZPN A;  3J81 j;  2KVC A;  2MBH A;  5JUM A;  2RR9 A;  1I4X A;  4P0Q A;  3PW5 A;  2FMP A;  3MFI A;  4UAZ A;  2D10 A;  4KLU A;  3SI8 A;  5D3D A;  4B6J A;  1IUE A;  1SGG A;  5DG9 A;  4UAS A;  2DHZ A;  2RRD A;  3RBD A;  2G08 A;  4EX6 A;  4Z6E A;  4L23 A;  4RQ8 A;  2EAN A;  2NRT A;  2XCA A;  8ICI A;  2LMR A;  1LV5 A;  4JV2 A;  1RRB A;  3ZGZ A;  2GLS A;  3CRX A;  3PTF C;  4UB6 U;  3ISC A;  2IO1 B;  4TMA B;  4XE0 A;  3ZJU A;  4NLN A;  2WTF A;  4GU2 A;  2F44 A;  2JT4 B;  3JYU A;  1I7H A;  4ZYN A;  3TAC B;  1L3V A;  3NOB A;  3PHX B;  1OTR B;  2ZG6 A;  3AM9 A;  2MX2 A;  2J6T A;  2ZCC A;  2BS3 B;  2HTM E;  4DL6 A;  4DSJ A;  5KAI U;  2IO3 B;  4MGY E;  1PGB A;  2ZUB A;  1TS4 A;  2V4R A;  3BYY B;  1SE9 A;  1EWC A;  2PEA A;  4JX1 C;  4NPN A;  5H92 C;  4QZF A;  3PZ8 A;  3H7S A;  2CN1 A;  3RNB C;  3ML8 A;  4L1B A;  5HMM A;  3C19 A;  4FN2 A;  1KLU D;  4OZB A;  3LWM A;  2KOX A;  5H8Y E;  4XRH A;  2W8L A;  3AEB B;  1UA0 A;  3CP8 A;  4MJS A;  1TBE A;  1U49 A;  3DWG C;  2PVG C;  2YEP B;  4RQ4 A;  1K51 A;  3RB0 A;  1WE7 A;  2RDG A;  3CWI A;  3DBR I;  4DL2 A;  4RH6 A;  1P98 A;  2HJ1 A;  4XWW A;  2ZTD A;  3P2B A;  1LGR A;  3FC4 A;  4DK5 A;  2YB1 A;  3QC8 B;  8ICG A;  2O6K A;  4D2K A;  4IUM B;  1SV0 C;  2FUH B;  3SYZ A;  1TS3 A;  3H0L B;  1WIA A;  2EMT A;  1IG6 A;  4UAU A;  2D07 B;  2LJ5 A;  1S97 A;  1QCK A;  4F5R A;  3H8H A;  4QW9 A;  4PGX A;  4MH0 E;  1TZO A;  3CSF A;  2IMW P;  4C8K A;  2Z8L A;  4WQM A;  5KFA A;  2MP2 A;  4DXF A;  1ZD4 A;  3K1R B;  2PI4 A;  3OAW A;  2QKQ A;  4DSF A;  5KFP A;  4M0W A;  1WJ4 A;  2LHD A;  4ED1 A;  2JHD A;  3C2M A;  1ZQI A;  2Z59 B;  5T8I A;  5HML A;  1DK3 A;  1L7P A;  1V5O A;  5JXV A;  4K7U A;  3EHV A;  1MHH E;  4M6W A;  3PZ7 A;  1EXN A;  3U30 A;  4PJ0 U;  2K39 A;  3M62 B;  3TEY A;  2L1A A;  2R2O A;  1DOQ A;  3ZDT A;  3PGE A;  2FLL A;  4W9H A;  9ICI A;  1XEE A;  3AEV A;  2FAZ A;  2IOF A;  4JE3 B;  4N59 A;  1S5L U;  3Q8E A;  1ZQZ A;  7ICU A;  1KLG D;  3RMK C;  3NRZ A;  1TKE A;  5JTI A;  1YN5 A;  5HNK A;  4DL4 A;  1WM3 A;  3A0B U;  1TS5 A;  5DB7 A;  2KQ7 A;  4F4W A;  1P7E A;  4OVV A;  2V4L A;  2LEK A;  4FA6 A;  3EPI A;  4C0Z A;  1Z5S B;  1T0Y A;  1CUK A;  2KXJ A;  4FFD A;  1EO6 A;  1ZW7 A;  4KTQ A;  1VD2 A;  2Y5B B;  4AS1 A;  1IGC A;  2G1E A;  3RRH A;  5CWR A;  2R8I A;  4YTM B;  1TAU A;  2V4Q A;  2C60 A;  5BMH A;  2JMG A;  1N60 A;  1ET6 A;  3D6J A;  2KVZ A;  3O65 B;  1A0P A;  4DLG A;  4P0P B;  1C20 A;  1D3Z A;  5AM0 A;  2WF5 A;  4RPX A;  3N1Z C;  1RZT A;  1JWB D;  3WCQ A;  5AKG A;  5J2H A;  1YQB A;  5J0P A;  1NJZ A;  4DOB A;  3N97 B;  1ZQA A;  3RJE A;  1V86 A;  2LM1 A;  2JZB B;  3BZK A;  2ZJ8 A;  8ICN A;  1C3T A;  1CI4 A;  3JPQ A;  3GB1 A;  5AI6 A;  2XO7 A;  1NK7 A;  2L0T A;  2WB1 C;  2E8O A;  4IKG A;  8ICE A;  1TIF A;  1WWU A;  1KBU A;  3TAD C;  4ICU A;  2V9W A;  3U7D A;  3AE5 B;  2AXT U;  4ECT A;  5HI1 A;  2BWF A;  4A9A A;  3BII D;  1N62 A;  4MM3 A;  2PE9 A;  3MGV A;  3GDX A;  2NTT A;  1B4F A;  4C56 C;  3VH4 B;  3H40 A;  4F5N A;  2RPV A;  2KG5 A;  4A8X C;  1T0Q C;  3PSF A;  3PW7 A;  3DOW A;  4KZ0 A;  3I9V 1;  2CS4 A;  5G55 A;  4KMO B;  4EZ9 A;  5IO9 A;  3ONN A;  3PRP B;  2WFA A;  2HVI A;  1TKG A;  9ICU A;  4E0D A;  4UB2 A;  1FXT B;  4DHZ E;  4RQ7 A;  4RQ2 A;  4AJW A;  1BT0 A;  3GOE A;  5KFX A;  2KNB A;  2NR2 A;  2ZVN A;  4IG7 B;  4IQW A;  1A77 A;  2WP9 B;  3TL5 A;  1WXQ A;  2IO2 B;  1I4G A;  3ISD A;  5KG0 A;  3Q8Q B;  2WDR B;  4KN4 A;  4Z6D A;  2QMT A;  5ALP A;  5FP0 A;  1NVI D;  2XK5 B;  4O3P A;  1L7M A;  4XYC A;  2WU5 B;  4G11 A;  2NMQ A;  2XGQ A;  2N9X A;  3DBH B;  1FEZ A;  4CDG A;  2G09 A;  3PVX A;  4TUR A;  4EYI B;  5CRX A;  1QOB A;  3W1S C;  4RPZ A;  4PS8 A;  2KZ3 A;  1SXD A;  4F93 B;  3IN5 A;  1VJ5 A;  3TQ1 A;  4AP4 C;  4DWF A;  3CMM B;  4RQ1 A;  2HHV A;  3MR2 A;  4M9L A;  1ZQ1 C;  4GIB A;  2D11 A;  5AZF A;  1WM2 A;  1V8C A;  3DCG A;  4YSX B;  1ZOL A;  3O0F A;  2YMM A;  2BCU A;  5FKA C;  1X9S A;  2K0P A;  1L3S A;  1QLB B;  5CTR C;  2W9B A;  1DOI A;  4G3I A;  4O1N A;  1N5W A;  2BVC A;  2K8B A;  3ZRC A;  2DZM A;  3ORY A;  3PZP A;  1C4A A;  5AI9 A;  2PE6 B;  2V3N A;  1RFA A;  1TY2 A;  5AIC A;  1ARO P;  3U52 E;  5KFT A;  3DHI C;  3RJJ A;  5KT6 A;  3QUQ A;  3BS5 B;  5DBB A;  1HUZ A;  2VZK B;  5KFR A;  5KFW A;  9ICL A;  3L10 B;  5KFH A;  3RR7 A;  1UUP A;  3TAP A;  4IDI A;  1PFD A;  4IRC A;  1LB2 B;  4JWN A;  4RQM A;  2JXX A;  1EF5 A;  5JH5 C;  4F8C B;  1HTQ A;  4P0Q B;  3QCA A;  4O9M A;  3I1Y A;  3M7D A;  3JPP A;  3DQV A;  3PV1 A;  4I2G A;  2KLC A;  2KVR A;  4DHJ B;  3ZNZ B;  5C2T B;  2KDB A;  2H3F A;  4LK0 M;  4PZO A;  1JWA D;  3M95 A;  3PRE A;  4QZE A;  3HP6 A;  3TAR A;  3URY A;  2KHW B;  1U45 A;  4FHK A;  2LM4 A;  4XX5 A;  1TVA A;  4O3O A;  8ICZ A;  1NK4 A;  2HHQ A;  1UWM A;  3VHT C;  3FKY A;  3VAW A;  2PW9 A;  2YTU A;  3PSE B;  2AEH A;  5G2N A;  1DXS A;  8ICO A;  4YR3 A;  3DWM A;  4I2E A;  1FD6 A;  4XA5 A;  3CIR B;  1ZPS A;  2LYH A;  2V3S A;  1PZN A;  4C4V B;  5DBC A;  2F2A B;  3TI0 A;  3S2A A;  2BR0 A;  9ICN A;  2DNF A;  3KD3 A;  1SL1 A;  1WGR A;  4Q44 A;  2O6V D;  3W1Y A;  4C7Z A;  4RNO A;  4K3C A;  2JEI A;  2I1J A;  3DVG Y;  5J0W A;  8ICL A;  1WWT A;  1I35 A;  1WH3 A;  2LVQ A;  3DDH A;  2LXA A;  2PKE A;  4RM9 A;  4JQW C;  4MJS B;  5ALJ A;  2DYM A;  1DGS A;  2JYE A;  4FS2 A;  4BKT A;  2B21 A;  4UBC A;  2AH5 A;  4M04 A;  1JUD A;  1WCL A;  2IOH A;  1IXR A;  7ICN A;  3AE2 B;  1MQ2 A;  3EFC A;  4C00 A;  1PK1 A;  5ALW A;  1I4Q A;  4C4R A;  1JMS A;  4H2A A;  2VA2 A;  3PX0 A;  5IIO A;  3P1M A;  4UDU C;  3QA8 A;  5DG8 A;  2EH9 A;  4O3Q A;  5CEH A;  1J7A A;  2AX5 A;  2G3Q B;  4J9S A;  4X57 B;  3RB3 A;  4J9P A;  1NKB A;  1HZ6 A;  3ZTD A;  3JPS A;  1ZE3 D;  4TQ0 A;  1YMH E;  5KFV A;  3Q8K A;  2WXM A;  4DL3 A;  3EW9 A;  4YXJ A;  3TFR A;  1RYS A;  2KAN A;  4I2I A;  1GC6 A;  3H1U A;  4LDT D;  4XDC A;  2OEH A;  5J2A A;  1WJN A;  3B2G A;  3PHW B;  2OYY A;  2MP2 B;  1XXG A;  3ZDD A;  2DKZ A;  2J0K A;  8ICC A;  4M0W B;  1MG8 A;  4AUQ C;  2KD1 A;  4RU9 A;  2W7P A;  1EF1 A;  1GAQ B;  8ICS A;  2PTL A;  4UAV A;  1TK8 A;  2KIC A;  1E8X A;  4PH5 A;  4RMA A;  2KMC A;  1JQ4 A;  4CO7 A;  4YXD B;  2RDB C;  4J9M A;  4ELT A;  2KV2 A;  5J0R A;  2K8H A;  1ZD5 A;  3VR8 B;  2WXG A;  4LNK A;  2MBE A;  3WIM A;  3NS1 A;  4YWG G;  2SEB D;  8ICQ A;  1SXT A;  3L5K A;  2N4F A;  2V3P A;  4GMV A;  1N48 A;  4DS5 A;  4IM0 A;  4OW0 A;  5GXG B;  2KWV B;  3MR3 A;  1L0V B;  3SEB A;  3E56 A;  3P4P B;  3PW4 A;  2AYO B;  3N30 A;  2MW5 A;  4DWI A;  1R4M I;  1E0Z A;  1QOA A;  3MP9 A;  4CF3 A;  1RXW A;  2R8J A;  4I2A A;  3QNM A;  1EM7 A;  1KTK A;  3NUH B;  4P7I A;  3OG5 A;  4XDD A;  2P35 A;  4F2R A;  4RQ3 A;  1ET9 A;  3W2D A;  4O3S A;  2MH7 A;  2MJE A;  2YY6 A;  1TZ1 A;  4NJ6 A;  1ZQK A;  2L8J A;  1PVR A;  3GU3 A;  5ALN A;  3QEB Z;  1FXA A;  3PR5 B;  5ALH A;  4RGM A;  2HD5 B;  4YSZ B;  3T5K A;  2XY6 A;  1QSY A;  1COK A;  3TEZ A;  5ALO A;  1JIH A;  2BGW A;  1KJT A;  3PLU A;  4WWP A;  5DDM A;  5FK9 C;  2LWP A;  2ZEQ A;  4EEW A;  1B0X A;  1ECW A;  1J8C A;  4NJ8 A;  5ALT A;  4LNN A;  2WXI A;  3NRW A;  2WYQ A;  3I57 A;  5AKX A;  1VRA B;  1Q5W B;  3CNH A;  4MM3 B;  2MHJ A;  2DFL A;  3QUC A;  2G07 A;  5KFM A;  2AL6 A;  3KWV A;  2PJH A;  3LK9 A;  4MEX A;  1XT9 B;  4A55 A;  4YL8 A;  1BUI C;  3A1Q A;  4Q45 A;  3NZS A;  1XLO A;  2R8G A;  9ICM A;  1KFS A;  5ALK A;  2WXF A;  4TUP A;  4ANV A;  3SEI A;  3RJK A;  4ARC A;  2C2R A;  1GOZ A;  3RNG C;  4WH4 A;  3C23 A;  1AWD A;  1D8L A;  4ECR A;  2VZK D;  4QAY A;  1RYU A;  5AM1 A;  2IBI B;  4ZRI A;  2KWD A;  2MBQ A;  1ISN A;  2DUY A;  2KO3 A;  2JZZ A;  2BGF A;  2W11 A;  3MAB A;  4DSI A;  2LHT A;  3R3M A;  5EWG A;  2M56 B;  1ZQD A;  1FNV A;  1TK5 A;  1U4A A;  1WSP A;  2A5U A;  2BPC A;  2PMZ C;  2FBW B;  3AU6 A;  2KDE B;  2DZI A;  1J2M A;  5ALF A;  2DZK A;  3K9O B;  3TCA A;  4Y2J A;  5GTH U;  1KRH A;  2EAM A;  5ALI A;  1R7S A;  4LNI A;  1TTN A;  1FPY A;  3TSS A;  1ZQG A;  3K75 D;  4F91 B;  4BOZ B;  4OCZ A;  4UB1 A;  3LJ3 A;  1FRR A;  1QT9 A;  2D3C A;  2KFK A;  2AHO B;  3UI3 A;  5KFG A;  2K22 A;  4OZC A;  8ICB A;  2BKR B;  3PSP A;  1F2R C;  5IIK A;  3THV A;  4N9F 4;  1VZ6 A;  4JWS C;  2VAN A;  3G6V A;  4EZL A;  1PYW D;  5DCN A;  2MRP A;  5D94 A;  3NVZ A;  4JWM A;  1KLV A;  4DOC A;  4ECZ A;  3QJZ A;  2Y0S C;  3NY5 A;  1A5R A;  1E8W A;  4I28 A;  4I2H A;  4ZH4 A;  2K8B B;  3QUB A;  4OZA A;  2O6V A;  5AKZ A;  1X9X A;  1ZQC A;  4MDK E;  1T3N A;  4WJ3 B;  2KAC A;  1QOF A;  3ALB A;  3HW8 A;  4JV0 A;  3V6J A;  4DQR A;  1VDV A;  1IGD A;  3HIL A;  3KFU F;  3OHB A;  1RYJ A;  3BIN A;  4TQ1 A;  1ZOY B;  4HPM B;  2KMD A;  1NK9 A;  2DGZ A;  4B9N A;  3SDL C;  3BJY A;  1UEL A;  1ZQH A;  3N1Y C;  2JH1 A;  3N20 C;  2W3S A;  4BVU C;  3VR9 B;  1IIP A;  4Y2R A;  3OHA A;  5ALR A;  1NYR A;  3IBE A;  2M0N A;  4I6P A;  2JZP A;  2VIX A;  4C8M A;  1D8Y A;  2N7J A;  1Z00 A;  1HQR D;  1ROE A;  3EUB 2;  4PL1 A;  4UBB A;  5J8Y A;  4K4H A;  2BZF A;  3E58 A;  4JL9 A;  4I2B A;  2WS3 B;  9ICS A;  4WJP A;  3OPX A;  1K1S A;  1FRD A;  1WR6 E;  1DYQ A;  4ARI A;  4F4Z A;  5EE9 A;  4DFP A;  3ZRF A;  3ZIM A;  3OLM D;  4ECS A;  3K9P B;  1NOM A;  2JWU A;  3HVD A;  4FAD A;  2KJH B;  3W5U B;  3MHS D;  3GIM A;  3H0R B;  2GI9 A;  1L6N A;  1M6Y A;  3DBL I;  2PFP A;  1BVS A;  3WKC A;  3ZQ4 A;  2H3I A;  3MJW A;  2KWC A;  1Z1V A;  4NAW A;  3QU4 A;  1L7Y A;  3CST A;  2ZXI A;  4HKZ E;  1ZUD 2;  3CYM A;  5HFY A;  3KKA A;  3I63 C;  2RDJ A;  5B66 U;  3Q8F A;  5J0S A;  1FNW A;  3AE9 B;  3IP4 B;  3M6Z A;  5J0X A;  1XO3 A;  2BYT A;  3DBS A;  4ZHP A;  2RP5 A;  2N1R A;  1P0R A;  1U48 A;  2GO7 A;  2WLB A;  4R63 A;  3AEF B;  1TS2 A;  8ICH A;  1JCK B;  1T94 A;  2IDY A;  1JRU A;  1QTM A;  2KC2 A;  4DO9 A;  3EC8 A;  4YQW A;  2YML A;  1M94 A;  3VUX A;  5AI0 A;  3MFH A;  4Q43 A;  3NHE B;  4W9F A;  1PUZ A;  3NAS A;  1F52 A;  1NEN B;  1ZP0 B;  1JRO A;  3HT3 A;  3PNC A;  3N3K B;  4DQP A;  1P9D U;  7ICK A;  1SIJ A;  4MT5 A;  3C2L A;  3T79 A;  3C0R B;  3RZF A;  1UBQ A;  2WF6 A;  2K4E A;  4TUU A;  3BDP A;  4DCC A;  3L13 A;  3GZN I;  4TSS A;  1RQN A;  4F72 A;  5KFE A;  1L7N A;  1KDH A;  1CJE A;  1OEY J;  3OJ3 A;  4KGR A;  1M4V A;  2ODG A;  3IG8 A;  1KSP A;  1BPY A;  2HI0 A;  2PMZ F;  2KTF A;  1V81 A;  2IO0 B;  2JSV X;  2N0S B;  3UQ2 A;  3OJ4 B;  1S8O A;  2DL0 A;  3D2S A;  1ZKH A;  9ICG A;  3BWU D;  1XLP A;  5ALL A;  4QWC A;  1WZ0 A;  1F44 A;  2WXQ A;  3HK0 A;  5BYS A;  2ZIW A;  3R66 C;  2KKP A;  2OH2 A;  5KL1 B;  3IM1 A;  3SFD B;  4UAR A;  2KJ6 A;  3Q8M A;  2NRX A;  1FNU A;  5J0U A;  3H4D A;  5TIS U;  3RNC C;  1UHU A;  4MAC A;  4GC7 A;  4X5V A;  4P4M A;  1XQQ A;  4HAI A;  2INP E;  2C7H A;  4W9E A;  4IQT A;  3X23 A;  1T0S C;  4DQI A;  4CHK A;  1C4C A;  2Y0S F;  2PFQ A;  1YIW A;  3AUO A;  2EAO A;  2KHV A;  2MRL A;  3PPA A;  4K7S A;  5DB9 A;  3EGR A;  4IQV A;  4YMM A;  5BOM A;  2FCQ A;  2K1F A;  2JH7 A;  2NYV A;  3RYT A;  3SFE B;  4QZD A;  1OQR A;  2UVV A;  3V61 A;  3B2F A;  4MGK E;  4DQO C;  4B95 A;  2IGH A;  2NO5 A;  1GJZ A;  3IAS 1;  2XI9 A;  5HHD G;  5ALS A;  2DAF A;  2HDE A;  2KT7 A;  3SMV A;  4PZN A;  2M19 A;  1DOY A;  4Y2Q A;  2F1I A;  2H3Q A;  4UQG A;  2KDI A;  5AM4 A;  5KFU A;  2BCV A;  1ZJN A;  4ECY A;  9ICA A;  2QLT A;  3HHM A;  4UB5 A;  5D3I B;  2IZV B;  3TAQ A;  5EE3 A;  1F77 A;  1WX9 A;  5CJ7 A;  4B9S A;  1ZQW A;  5LNK 1;  3UMG A;  3PMN A;  4P2H A;  3H9D A;  1D5Z C;  4K81 A;  2L32 A;  3DBR B;  1T3Q A;  1XU4 A;  3NS8 A;  1DGJ A;  3IV6 A;  4C4V A;  5DQI A;  2G0A A;  3M9N B;  1RFK A;  3P63 A;  5KFZ A;  3R7Q A;  2JYT A;  3A1Q B;  5L83 A;  2ZIX A;  2KEY A;  4DL5 A;  1X9W A;  1PVQ A;  1OUQ A;  4B9V A;  2N7E A;  1XC9 A;  2DKX A;  5KFQ A;  3RRG A;  5MPO A;  1NJW A;  3AE1 B;  2OWO A;  2F8L A;  1SZH A;  2CHZ A;  2AGO A;  2A1J A;  2N1W A;  3G6X A;  2ISP A;  1L8L A;  5LXI B;  3L08 A;  2NV3 A;  2D2Q A;  2CU3 A;  2WXO A;  1V97 A;  5ALQ A;  4DSE A;  1D6E C;  7ICM A;  4LJO B;  3IXS A;  5BMI A;  5H2F U;  3A0H U;  5J2K A;  1R4N I;  4JIO U;  2DBY A;  4GFJ A;  1ZXI A;  4PL2 A;  1H38 A;  2FIF A;  1NBF C;  2ZUD A;  4Y2V A;  2BPG A;  3B1L X;  1TAQ A;  2JEF A;  2NRZ A;  1URJ A;  2KFK B;  4MSQ B;  3BY4 B;  4A3P A;  2BQR A;  1N56 A;  1HIW A;  4O5K A;  1KH0 A;  2WDQ B;  3E2E A;  1Q0W B;  2RGF A;  2RQ5 A;  3ZTC A;  4G0N B;  2UVR A;  2IND C;  5IAA C;  4DXA B;  3IRU A;  2W9M A;  1NKC A;  3UM9 A;  1F9J A;  4KLO A;  7ICP A;  2HHX A;  1S3S G;  1WRD B;  1T0R C;  2QAR A;  2M0A A;  4OVZ A;  1G6J A;  1S1Q B;  4MFC A;  3AEE B;  4P4O A;  2IOF K;  4FS1 A;  1P7D A;  4I2C A;  4M9J A;  1I4H A;  5AKJ A;  5J2G A;  2K5P A;  4QZI A;  2FCM A;  2O6V B;  3L0W B;  3D2Q A;  1YQ4 B;  1VLB A;  5DB6 A;  2Z0E B;  2FLP A;  2HOI A;  2K4I A;  2YQE A;  4RQN A;  3QXG A;  2BQ3 A;  2EZX A;  3N7S C;  2JX5 A;  3C1Y A;  4F7Z A;  1OXJ A;  4KLH A;  4BBN C;  5EWE A;  4QZB A;  5TZV A;  2ONQ A;  2YLM A;  8ICP A;  3K4G A;  1L4Z B;  1YNT E;  3ICX A;  5J2J A;  7ICR A;  1TK0 A;  1JXL A;  4KSK C;  2CJN A;  5DGB A;  1TJE A;  4MGZ E;  1HA5 A;  1MA7 A;  2HHS A;  3A9J A;  5J29 A;  3UF8 A;  2FPM A;  2PFN A;  4ANX A;  2KK8 A;  2JU6 X;  5IOI A;  2C2E A;  4RF0 A;  1Z00 B;  1UGJ A;  2JZ3 B;  4KN7 A;  2K4P A;  3QAR A;  4LDT B;  4NL9 C;  1Q3V A;  5GMV A;  1ENF A;  2GH1 A;  2R61 A;  1V9J A;  4IM3 A;  4DLE A; 
#chains in the Genus database with same CATH homology
 3AN1 A;  4C7Z A;  1STE A;  3AMZ A;  2BBC A;  3P4Q B;  2LUM A;  3Q69 A;  1WWT A;  3AEC B;  4PT5 A;  1A70 A;  2BS4 B;  1N63 A;  1FEH A;  3C8Y A;  1T6B X;  2LGI A;  3MFG A;  2BB6 A;  4KKJ A;  2W54 A;  2PVO D;  2DYM A;  4JPS A;  2JYE A;  1NI3 A;  3ABV B;  2DWQ A;  3AE2 B;  1I4R A;  2KMM A;  1I4Q A;  4NAW B;  2QSD A;  4H2A A;  2LMC A;  3P1M A;  4UDU C;  1EWY C;  1B9R A;  2AX5 A;  1J7A A;  2E3T A;  1HZ6 A;  1SBB B;  4US8 A;  1F0Z A;  4A6Q A;  4B0M A;  3HRD D;  1ZE3 D;  4TQ0 A;  1YMH E;  1YN4 A;  2WXM A;  3IT6 B;  3OWE B;  2V4I B;  1L5P A;  1HXY D;  2LJI A;  1VZ8 A;  4XDC A;  1FFU A;  3AH7 A;  4FXC A;  2Q5W D;  3B2G A;  1JRP A;  1XXG A;  1LO5 D;  1XF5 L;  3AV8 A;  4ZOH C;  3R2T A;  5EE1 A;  1EU4 A;  1FXI A;  1V1P A;  3SR6 A;  5G5H A;  2N9K A;  4YT0 B;  5AUK A;  1E9M A;  1GAQ B;  2PTL A;  1TYG B;  3BVZ A;  2XNA C;  1D5X C;  1WGK A;  3Q8B A;  1J7C A;  1JQ4 A;  4YXD B;  3ETR A;  4JWU C;  2INN E;  3VR8 B;  2WXG A;  4KGT A;  3NS1 A;  4YWG G;  2SEB D;  4ZYS A;  1SXT A;  3AE7 B;  3Q8A A;  2AQ1 B;  2AQ2 B;  2V3P A;  3MJ5 A;  5GXG B;  1CZP A;  4OW0 A;  2I2Y A;  2J4X A;  1L0V B;  1ACC A;  3BVG A;  1VZ7 A;  3E56 A;  3SEB A;  3U4E G;  3P4P B;  1RWS A;  1E0Z A;  1WRI A;  4MH8 A;  2QIL A;  1QOA A;  3MP9 A;  1EM7 A;  3NUH B;  1KTK A;  2GB1 A;  4XDD A;  4RGT A;  3V05 A;  4HRO A;  1QOG A;  1ET9 A;  1HEZ E;  3W2D A;  2KAJ A;  2MH7 A;  2MJE A;  3KLS X;  1Y56 A;  2G9H D;  4LLG M;  1FXA A;  2J42 A;  4RGM A;  2OED A;  4YSZ B;  3IAM 1;  1GPX A;  4US9 A;  3MHZ A;  3U7Z A;  3TEZ A;  3E9S A;  3T3N A;  2NTS A;  4KKI A;  4NJC A;  1C4P A;  2WDV B;  1JW9 D;  1JML A;  5FK9 C;  2WXH A;  5BMG A;  4WIP A;  3GP7 A;  2WXI A;  1AN8 A;  3I57 A;  2I38 A;  1GB1 A;  1VRA B;  1J7B A;  3T3O A;  4MM3 B;  2H88 B;  1SB3 C;  4RFB A;  3KWV A;  3LXF A;  1GB4 A;  1IBX A;  3Q8C A;  4A55 A;  4C7Y A;  5BYR A;  2L83 A;  1BUI C;  2V0G A;  3AB5 A;  2J52 A;  2WXJ A;  1YJI A;  3RFZ B;  1XLO A;  2WXF A;  2PLP A;  3FAH A;  4ARC A;  4GLS C;  1CK1 A;  1GOZ A;  1ZXH A;  4WH4 A;  1AWD A;  2D5G A;  2BW2 A;  3P4R B;  2VZK D;  1N61 A;  1Q10 A;  1SE2 A;  2KDM A;  2KWD A;  3FIL B;  4ITK A;  3W5V B;  1C78 A;  3U2S C;  2OHF A;  2EKI A;  2GRI A;  3L4P A;  3VRB B;  2QIE B;  2IPK D;  1XCT L;  2M56 B;  1FNV A;  2ZW1 A;  1YJJ A;  2Y5P A;  1WSP A;  2FBW B;  3R2I A;  1L6U A;  1T5X D;  2W3R A;  2CJO A;  1KRH A;  1ZDV A;  1QQR A;  1R7S A;  3ZYY X;  3TSS A;  2E6X A;  3NVY A;  1FCL A;  4HKQ A;  3P42 A;  1L6V A;  5HG2 A;  1FRR A;  1HZ5 A;  1QT9 A;  3LB8 C;  1F2R I;  3UI3 A;  1FO4 A;  1E7P B;  2K22 A;  4OZC A;  1K53 A;  1FCC C;  1F2R C;  2QJL A;  1VZ6 A;  4JWS C;  1PYW D;  1AYF A;  2ON8 A;  4RNA A;  3NVZ A;  4LTU A;  4CQN A;  2N9L A;  2FUG 1;  3N9Y C;  1V1O A;  4RF1 A;  4HJG E;  4RGN A;  1FM0 D;  3ZJT A;  2ZW0 A;  1I4X A;  4OZA A;  1SE3 A;  2DLB A;  4YTP B;  1DOX A;  5D3D A;  2WXR A;  1IUE A;  2KAC A;  1ESF A;  1QOF A;  2MJ3 A;  5FR3 A;  5G5G A;  1VDV A;  1IGD A;  2XN9 C;  3AEA B;  4L23 A;  1RYJ A;  4TQ1 A;  3TEW A;  1ZOY B;  3ZGZ A;  5AUI A;  2IGD A;  4TMA B;  4XE0 A;  3TUO A;  3ZJU A;  2W3S A;  4IOI E;  2WXN A;  1JWS D;  3NVV A;  4C80 A;  1I7H A;  3VR9 B;  2WXL A;  4WUR A;  4HRS A;  1NYR A;  3AM9 A;  2JZP A;  5E6J A;  2LHE A;  2BS3 B;  2HTM E;  1N5X A;  4L2Y A;  4RCO A;  1PGB A;  2N7J A;  1L4D B;  2SAK A;  1IBX B;  1HQR D;  1ROE A;  1TS4 A;  3EUB 2;  1PGX A;  2K3U A;  1BML C;  3AE3 B;  3BYY B;  4HEA 1;  2WS3 B;  1EWC A;  3AE6 B;  1SE4 A;  4JX1 C;  3BYT B;  3TEX A;  5H92 C;  1FRD A;  3KWL A;  3PZ8 A;  1C77 A;  1DYQ A;  4ARI A;  1L0Y B;  5EE9 A;  2PKO A;  4L1B A;  1XLQ A;  2PIA A;  3KQ4 A;  4GDL B;  1KLU D;  2JWU A;  3HVD A;  4OZB A;  1KFY B;  4J3O D;  5H8Y E;  3W5U B;  1XCQ L;  3AEB B;  2GI9 A;  3R8B A;  1B1Z A;  3DWG C;  2PVG C;  2YEP B;  3RPF C;  1K51 A;  2RDG A;  3CWI A;  4RH6 A;  4YSY B;  1MVK A;  3ZQ4 A;  4B0E A;  1PGA A;  4XWW A;  3FC4 A;  3B9J A;  4HKZ E;  4D2K A;  1ZUD 2;  5HFY A;  4N6E B;  4N58 A;  1QIL A;  1TS3 A;  3Q8F A;  1NEK B;  2MEK A;  3W1S A;  1FNW A;  3AE9 B;  2EEL A;  3H8H A;  1K50 A;  1XO3 A;  1TZO A;  2BYT A;  4ZHP A;  1C76 A;  2Z8L A;  4WQM A;  4DXF A;  1EU3 A;  2JXT A;  1C9F A;  2YEP F;  1YQ3 B;  2WLB A;  4GDK B;  4M0W A;  3AEF B;  2LHD A;  3HUI A;  1TS2 A;  1JAL A;  1JCK B;  1NYQ A;  5T8I A;  2IDY A;  2ACZ B;  3AED B;  5JXV A;  1JWM D;  1MHH E;  3PZ7 A;  1CQV A;  1NEN B;  3TEY A;  2L1A A;  1ZP0 B;  1JRO A;  2IGG A;  3AE4 B;  1RM6 C;  1XEE A;  1SIJ A;  4MT5 A;  4JE3 B;  4N59 A;  1MPE A;  1OFF A;  3Q8E A;  3PO0 A;  4ZHO A;  1KLG D;  1V1P B;  4TSS A;  3NRZ A;  1CJE A;  1TKE A;  2FE8 A;  1M4V A;  1MHX A;  1YN5 A;  4KGR A;  2WNM A;  1TS5 A;  3AEG B;  1FIQ A;  2N0S B;  2BTE A;  4R3D A;  2JSV X;  5TSS A;  1P7E A;  2LEK A;  4KX6 B;  3BWU D;  1XLP A;  2WXQ A;  5BYS A;  2Y5C A;  3SFD B;  2AQ3 B;  4AS1 A;  1FNU A;  1KF6 B;  1IGC A;  2DYO A;  2G1E A;  4MAC A;  3P4S B;  4YTM B;  2INP E;  5BMH A;  1SSN A;  1N60 A;  1FFV A;  1ET6 A;  3NZ3 A;  1TKY A;  2WXP A;  4WAF A;  1C4C A;  1XLN A;  1JWB D;  3WCQ A;  3EGR A;  3W9C B;  3GB1 A;  2WU2 B;  1BXT A;  2MJD A;  1OQR A;  3SFE B;  3VQI A;  4DQO C;  3B2F A;  2BB5 A;  2IGH A;  4IKG A;  1C79 A;  3IAS 1;  2ICI A;  3AE5 B;  5HHD G;  5HI1 A;  4A9A A;  2HDE A;  3BII D;  1N62 A;  1FMA D;  2M19 A;  1YN3 A;  1DOY A;  3BK1 A;  2NTT A;  4C56 C;  2RPV A;  1E10 A;  4A8X C;  3I9V 1;  5D3I B;  3VRA B;  5EE3 A;  4NZL B;  1K52 A;  4OHJ A;  1F77 A;  1TKG A;  1PUT A;  2J53 A;  5D7G A;  5LNK 1;  3BK2 A;  1D5Z C;  2L52 A;  2L32 A;  5BYQ A;  1T3Q A;  3EA6 A;  3FIL A;  1DGJ A;  2WP9 B;  1SF0 A;  3GS2 A;  1WXQ A;  1I4G A;  1RFK A;  3P63 A;  2WDR B;  2JYT A;  2RMM A;  4KGS A;  2QMT A;  1NVI D;  4P16 A;  4AQ7 A;  2WU5 B;  5MPO A;  3AE1 B;  2NMQ A;  1P7F A;  1QOB A;  3IT4 B;  2IJ0 A;  3NVW A;  2CU3 A;  3ZJV A;  1QKZ A;  4XWT A;  2H89 B;  1E6E B;  2WXO A;  1V97 A;  1D6E C;  4WWM A;  2BT6 A;  1UWX A;  1AW7 A;  1V8C A;  2BS2 B;  3IXS A;  5BMI A;  4YSX B;  2DBY A;  1WYG A;  1ZXI A;  2LFI A;  5FKA C;  5C3J B;  2K0P A;  1QLB B;  5I4D A;  1DOI A;  3V3X A;  3HVZ A;  4O1N A;  1N5W A;  4A90 A;  2RDH A;  4DXG A;  1VR9 A;  4ZRP A;  2PMV A;  1C4A A;  1OQQ A;  2V3N A;  1TY2 A;  1KH0 A;  1TY0 A;  2WDQ B;  3BZD B;  4RGO S;  5EE0 A;  3U52 E;  1D5M C;  1PDX A;  2WXK A;  1D4B A;  2VZK B;  4P6V F;  1UUP A;  4IDI A;  1PFD A;  2B76 B;  2M0A A;  4OVZ A;  3BVM A;  3AEE B;  4USA A;  4YTN B;  1SJH D;  1I4H A;  2K5P A;  1UNS A;  1YQ4 B;  1VLB A;  3AE8 B;  1I4P A;  2W55 A;  5C2T B;  4LK0 M;  1JWA D;  1JWU D;  3URY A;  3J9C A;  2JX5 A;  4Q2J A;  3O13 A;  3LYY A;  4EE2 A;  3MC0 B;  2ONQ A;  1SJE D;  4NAM A;  2TSS A;  1L4Z B;  1UWM A;  1YNT E;  1L0X B;  1SEB D;  2CJN A;  1TJE A;  2PW9 A;  1MI0 A;  2WQY B;  2W82 A;  1HA5 A;  2KQ4 X;  2X38 A;  3DWM A;  1FD6 A;  3CIR B;  1ZDX A;  1VJK A;  2QEJ C;  1ZPS A;  4ZRQ A;  2JU6 X;  4RF0 A;  1UGJ A;  2JQR B;  2K9X A;  1QF6 A;  2Y3A A;  4REZ A;  1ENF A;  2R61 A;  2KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...