3NRZA

Crystal structure of bovine xanthine oxidase in complex with hypoxanthine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nrzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nrzA01
2L52A 4KX6B 1VLBA 3AM9A 2M56B 4WWMA 1NVID 2FBWB 1JROA 4US9A 5GXGB 1DOXA 2BT6A 5MPOA 4YT0B 1GAQB 1ZXIA 3DWGC 3B9JA 2BS4B 1ZOYB 2WU2B 2JQRB 1QOAA 1XO3A 2PVGC 3AEAB 4C7ZA 1WYGA 1NI3A 3KWLA 2CJOA 1PUTA 1PDXA 1GPXA 1JWBD 1AYFA 2AX5A 4ITKA 1FXIA 2PIAA 1VJKA 1J7CA 3AE8B 2K22A 1CJEA 5AUKA 3SFDB 3VR8B 1E0ZA 3NVZA 1OQQA 1XLPA 1V8CA 3AEEB 3HUIA 4HRSA 1FFUA 2DBYA 1NENB 1YQ3B 1E6EB 3FAHA 1PFDA 1L6VA 1N62A 2CU3A 4C7YA 2WQYB 3AE9B 4YXDB 2HTME 3P4PB 1EWYC 3ETRA 3ABVB 1TKYA 3AV8A 1JRPA 1WGKA 2W3SA 5G5GA 1XLOA 2K9XA 3P1MA 3AE4B 2H88B 2WDRB 1VDVA 1QOFA 3BIID 4FXCA 1N60A 4ZHPA 1IUEA 1NEKB 1RFKA 3HRDD 3W5VB 1QOGA 2KMMA 2JX5A 3AE7B 1SB3C 3AECB 2WDVB 1ROEA 1KF6B 4YSXB 4YTMB 1E10A 1A70A 1FRRA 1FRDA 2L83A 1UWMA 1TKGA 1I7HA 2Q5WD 1J7BA 1FMAD 3CWIA 2MH7A 3P4SB 1N5XA 1R7SA 1ZUD2 1KFYB 2KAJA 4N58A 1F0ZA 2E3TA 1NYQA 3DWMA 1YQ4B 1SF0A 3AEDB 1FIQA 1FM0D 2G1EA 5C3JB 5EE3A 1YJJA 1YJIA 3W9CB 3CIRB 2B76B 3B2GA 4N59A 3AN1A 4YSZB 1DGJA 3NVWA 3AEGB 4ZHOA 3ZYYX 4YTNB 3P4RB 4A9AA 3AEFB 1OQRA 4JWSC 1J7AA 3PO0A 1V97A 2OHFA 1QF6A 1JW9D 2K5PA 1TJEA 1RM6C 3RPFC 3EUB2 3WCQA 2BS3B 3NVVA 3LXFA 3SR6A 2MJ3A 4C80A 2DWQA 3AE1B 3AB5A 1L6UA 4JWUC 5EE9A 3B2FA 3L4PA 2W54A 5H92C 1WWTA 1XLNA 3NS1A 1ZP0B 3NRZA 2PVOD 1FO4A 3AE2B 2N0SB 1QT9A 3AE6B 4WQMA 3VR9B 1E9MA 2QIEB 1N5WA 3AE5B 4LTUA 1DOYA 1SIJA 3AMZA 1B9RA 4N6EB 1NYRA 1JQ4A 4US8A 2WS3B 2Y5CA 2WU5B 5G5HA 2CJNA 1L5PA 2H89B 2LEKA 3VRBB 2QJLA 3VRAB 1JALA 3P4QB 1OFFA 3W5UB 1JWAD 3AEBB 1DOIA 1E7PB 1TYGB 5H8YE 1RYJA 3AE3B 5C2TB 5AUIA 4ZOHC 1WRIA 2PKOA 4YSYB 1WXQA 5EE0A 2WP9B 1TKEA 5EE1A 1T3QA 4USAA 1KRHA 4IDIA 1N61A 3FC4A 1AWDA 2W55A 1QLBB 2ACZB 2W3RA 2EKIA 1FFVA 1N63A 1RWSA 2MJDA 2WDQB 4JX1C 4P6VF 4YTPB 1QOBA 1CZPA 3SFEB 1L0VB 3AH7A 3HVZA 3LB8C 4HROA 2MJEA 2WLBA 2BS2B 2M19A 3NVYA 1FXAA 3P63A 1XLQA
chains in the Genus database with same CATH superfamily
9ICIA 1OEYJ 2JWUA 3HIZA 1H4RA 1TV9A 2OYYA 3TMPB 4EYHB 2ZIVB 1L3SA 2Z8LA 2LUEA 5IIJA 2XK5A 1ZXIA 3NHEB 3EECA 3U26A 3IT6B 2ZUCA 2ZXIA 1NI3A 2DKXA 1XCQL 1PUTA 2CJOA 2NYVA 3R2IA 5KHQA 4NLBA 3LJ3A 1JWBD 5CP2A 2NPTA 3AE8B 1ET6A 1WH3A 1Z1BA 1A6SA 3SFDB 1C3TA 3CP8A 1OQQA 2BCSA 1HZ5A 2XNAC 1L8LA 4M8MA 4KLTA 4M8NA 5AK3A 5AM0A 2CU3A 2DLBA 3PS6A 4G9BA 5J8YC 2I5HA 5KFXA 5I4DA 1TKDA 1R4NB 1PVPA 3CMMB 4LLGM 1QQ7A 2XGPA 1NOMA 3WK5A 4CQNA 3WKBA 2MBEA 2AQ0A 1VDVA 2K4PA 1VD2A 2JWZA 1LO5D 3SAHA 4G50A 2G0AA 4DFDA 2HVHA 4KZCA 1KF6B 5J17A 1ZQVA 3T3OA 3RJGA 3H7SA 1L5UA 1D6EC 2F8LA 1NKBA 4Z6DA 1S10A 3JPQA 3CWIA 1IXRA 3E0FA 3P4SB 4F5RA 2EAMA 1PVQA 4F91B 2LGXA 3PV1A 4KLFA 1F0ZA 1U45A 3K75D 1V9JA 5KFHA 4J9NA 2OEHA 2PE6B 3OSPA 3WALA 1WUDA 1BNOA 3AEGB 3C19A 1TK0A 2HDEA 2JYEA 3IRUA 4EZ9A 2PFPA 3HHMA 1E8ZA 4Q2JA 2VJ5A 3BZKA 2D2QA 3PO0A 2Y0SC 2K5PA 3LVWA 2KJ6A 4B9LA 2E5SA 3NUQA 2GOWA 2KZRA 3PW4A 1QSSA 3C2MA 1FXTB 4RF1A 3E9SA 2RHFA 4RUAA 1IV8A 3L4PA 1N2XA 3VTUA 2AHOB 3BVZA 3ISCA 3ISDA 1XLNA 1L2NA 5DBCA 1E7VA 3GV7B 3H8WA 3KHLA 3TAQA 4E3CA 3NZ3A 1C4AA 5IO9A 5HHIA 3AQFA 1ZQPA 4N6EB 1JN3A 3PPAA 4QWDA 2K1FA 1RG6A 5D46A 2FUG1 2IO0B 2WXOA 3D32A 2FJ6A 4NLCA 4QZCA 4IM3A 1QSYA 2Y5BB 3RFAA 4QZHA 2LJIA 4JK1A 2MSNA 5J2FA 4G3XB 9ICQA 4DL4A 3QZ8A 1E7PB 3RTVA 1ZQAA 2X38A 3IFWB 4LZDA 2IBIB 5KHOA 3M6KA 3PMLA 2BVCA 4USAA 2KJ5A 4RT3A 1S77D 9ICUA 2C5LC 2DNFA 3PLVA 1RQNA 4JWUC 4RNAA 3V61A 2IGHA 3ML9A 2ZTDA 4NV0A 4RMAA 1L3VA 4NQLB 2DYBA 4TSSA 3SFEB 2ON8A 1L0VB 4HROA 3KTQA 3DBSA 5C5JA 4EBDA 1QLNA 4QAYA 4DK5A 4KX6B 1Z5SB 2WXKA 1X9XA 3ZRFA 4P0QB 2AL3A 2LM4A 3RFZB 2UYZB 5IILA 3GZNB 1ZQCA 1GAQB 3H7PA 1K1SA 2Q0ZX 1QOAA 2ZPNA 2KEYA 2YX8A 1WYGA 4CYEA 5J2IA 2DHZA 4HJKA 3BQ1A 1ZJNA 4DOCA 2PFOA 1HE8A 3WAOA 4CF3A 4TUPA 3BVGA 2HJ1A 3MC0B 1NKCA 2J6SA 3C8YA 5KFTA 1QQRA 4PHPA 2ZPYA 2WYQA 2UWQA 2C9WB 2M0XA 3MJWA 2NTSA 2YN4A 4KLSA 2ICIA 4AJYB 2LJ5A 2N7EA 2G4DB 2INPE 2E8PA 2ZIWB 3KZXA 2P6UA 5KG1A 4A8EA 4J9KA 1ZQDA 4M9GA 4F4WA 1TIFA 5AK6A 1E0ZA 4RQ5A 1QOGA 3QHTA 2EH9A 2CHXA 2XC9A 1F9JA 4MGKE 4ANXA 4NLGA 3PHXB 4BOZB 1XSNA 5D2MB 2E8MA 2O6KA 3MGIA 2VJ4A 3A33B 4W9JA 4LJOB 4IR1A 4EEYA 1SXDA 3CW2C 2KD0A 3GE8C 4F92B 1LXDA 2AYOB 4JV2A 2BQUA 4BOSC 1M4VA 1V2YA 2KQSA 5FKAC 3OG5A 2UVUA 5C3JB 4YL8A 1WCLA 4BXOA 4F2SA 3W9CB 4EELA 1UQVA 3OJSA 1PK1A 4KLUA 4HLEA 2V3NA 4IQVA 4EZJA 3ALBA 5ALNA 4J3OD 4LDTB 3H9DA 2WF5A 4ZDVA 4XWWA 3RCZA 1F1HA 4AJWA 4DWIA 2F2AB 2IDYA 3RH4A 3NVVA 3N3KB 1UGJA 4WJ3B 4K3BA 2ZJ5A 1WCNA 4ACFA 4DEZA 4WJOA 2LMRA 1ZP0B 4MGZE 3N1ZC 1Y56A 4O3MA 3OHAA 3V7JA 2XY7A 8ICIA 3ZDTA 4W9FA 2GBRA 3SMVA 2KDIA 2M0NA 3E58A 1RYUA 3JPTA 8ICLA 2KC2A 3H7PB 3RB0A 1FCLA 5J0RA 2KFNA 3NTUA 2JZPA 4KSKC 1WWUA 2F1HA 2NRXA 2KFKB 3EC8A 4FZLA 3V6EB 8ICHA 2NR2A 4KITB 1KFSA 3WK4A 2LFIA 3RNFC 2KNBA 4QZ9A 4IUMB 2N9XA 2OEDA 5H8YE 5AK4A 3Q3MC 3FKYA 4EE2A 3LK9A 4X5VA 3IM1A 2G45B 4ZOHC 4A6QA 2KX0A 1XC9A 2AH5A 4GC7A 2WP9B 1WIAA 2W7OA 4PL1A 1OEYA 4IDIA 2BKFA 2GB1A 1NK9A 4UAVA 4QWBA 3TAPA 7ICGA 1KTKA 2W3RA 3JPRA 2C28A 2JRHA 4YTPB 1HIWA 1ZXHA 5DB8A 4QWCA 2KTRA 4I2IA 4WJQA 3EW9A 4IL6U 3KUCB 2NBUA 1MFWA 1TAUA 4IRKA 1BPDA 2XGQA 3MBYA 5KT7A 1ZYQA 2CHWA 1WJUA 1T4GA 4XA5A 4ZRQA 2E1EA 2L0FA 4Y2JA 4DF4A 4M01A 2ASQA 5GTHU 1ZKHA 4GN1A 4RPYA 2L1AA 4JWMA 3IXSA 4F4XA 1ZQQA 3F5EA 2REXA 5J18A 1VJKA 1ZQEA 2IMWP 5T14A 4JE3B 3U2SC 2K22A 2IGGA 5J0WA 2WXIA 3HUIA 2ISOA 3QE9Y 5BYQA 4BZAA 4CF4A 4RCOA 2D3BA 5ALTA 1F2RC 4AWJA 3H1UA 5E6PA 2NS5A 1WX9A 2AQ4A 4TQRA 3AV8A 2XY6A 1X9WA 5IOIA 2FAZA 1CQVA 2AQ3B 2WXFA 2UVRA 3R8BA 4ELUA 3IVFA 2H3VA 4RM8A 2W03A 3JW0X 2JR5A 1ZQLA 4F2RA 1RFKA 1J0GA 1XU4A 4JV1A 3MGHA 1Q3UA 3C1ZA 1MHXA 1ZD3A 4OD0A 1UH6A 1KLVA 2WXMA 4EZKA 3KBBA 1J7BA 2JRIB 4J9MA 3QNMA 4WAAA 3TL5A 3MP9A 1VRAB 3DBHB 2WGSA 5BMGA 2JYTA 3WK6A 2K60A 4A3OA 3DPDA 4RGTA 4I2DA 2XK5B 3KLSX 4N59A 1YOVB 2ZIVA 2PI5A 4P16A 2MRPA 1UZXB 2RD0A 2ZIUB 2O2VB 3FILA 2R8KA 1KDHA 4F93B 2HTHA 4OVVA 2WFAA 1JW9D 4ICVA 2ODGA 4W9IA 2FMQA 2D8CA 3SR6A 4C80A 1L0YB 3T3NA 1S5LU 3Q8MA 4C8KA 4RNMA 4NY0A 2IOHA 4L2YA 3PRZA 4PZOA 4ECWA 1QT9A 1COKA 1E8XA 2NPTB 2RMMA 4TKNA 4GMVA 2MA9B 3NJTA 1N5WA 3ZDDA 2G08A 4BKTA 5G5HA 1AROP 3ONSA 4QNLA 4AUQC 5L1JA 2JZ3B 2EDUA 4FZNA 3PSPA 3GIJA 3HILA 3C28A 1HUOA 2FPLA 5TISU 2BQQA 2A1JA 1OFFA 3DBHI 2BDUA 4LVSA 1JWAD 5KG5A 1TVAA 1V49A 4HK2A 5E6NA 3OJUA 5KG7A 4D2KA 4DFPA 5DB6A 2HJ8A 4W9CA 2KFZA 3TEYA 2C2EA 1L3UA 5DLFA 1V1PB 1SL1A 1LKYA 4LNOA 2JSVX 8ICMA 2DZIA 2O6VD 2MA1A 2CXYA 4RGMA 5DBBA 1OTRB 2ZTEA 1QOBA 3MFGA 1XCTL 3RN9C 1BPZA 3ZLZA 2QSDA 3AEFB 2D10A 5J0PA 5J2DA 2FUHB 4YD2A 1WGGA 2FBWB 9ICEA 5GXGB 3N7RC 1ZOLA 1K8RB 5KG0A 3TIXA 3C1YA 1ZQ1C 4ECZA 4KLMA 3HX0A 2PVGC 1GPXA 5IA7A 3B0YA 1I4GA 3IT4B 3RNBC 1T6BX 1DYQA 1YD8U 5DBAA 1PK3A 2AQ2B 1CJEA 4I2AA 3MDCA 1WYWB 1ZQZA 2H3QA 1D8YA 4ED0A 3DDHA 3L54A 1KL9A 4QZFA 2KFKA 3SV3A 5L1LA 1I4XA 1N62A 5BMIA 2G5HB 2KN4A 2WQYB 5DGBA 3RH6A 4KVGB 4TQSA 2W3SA 1C78A 4FXCA 3KYCD 2C22A 5EOZA 1V85A 4WURA 4YVZA 2B6GA 4ZRPA 2O6VB 2KVSA 3ALRA 1ZQMA 1KH0A 4KLQA 4R65A 3ZI4A 5DCNA 2AU0A 2HOQA 3UPQA 2RR9A 5JH5C 1ACCA 9ICGA 4DLEA 3Q3NC 4MACA 3DBLB 3RB4A 2LPEA 5LXIB 4M6WA 3EPGA 2FCSA 3SAFA 4PT5A 4RQNA 1PK1B 1T5XD 3ZJUA 1UWXA 3SI8A 4QZDA 2KDEB 4NM1A 3AN1A 1M94A 3WK7A 4F4ZA 4W9HA 5KFYA 3QX1A 4XC2A 2P66A 1SGGA 4TMAB 2LASA 1L7MA 1V97A 3QZ7A 7ICLA 1WGDA 5L95C 3RF9A 4YR2A 3PX4A 2KMCA 3RPFC 4BBNC 5J2HA 1GC7A 2NVUI 2RSUA 1QKZA 3M9NB 1SE3A 5AKGA 1N56A 4ACOA 4NWIA 4DQPA 3N7PD 3PMNA 4DHZE 8ICFA 2H3ZA 3V3XA 2I38A 3N7SC 5KFSA 1TBEA 3V05A 2M9NA 2ZEQA 4GXKA 2XBBC 2NV3A 4ANUA 2ZIWA 5AKJA 4US8A 2MSED 4MEYA 3KHHA 4DXAB 3WKEA 3ECIA 3KUZA 4YN4A 1WJ4A 2Y1IA 4NJ6A 3AEBB 4RUCA 2NRTA 4F71A 1YT3A 2R8GA 1MHHE 3HM3A 2LGDA 4EEWA 2DYOA 3UMGA 2R18A 2N7DA 4DSLA 4NJ7A 4QZEA 5KG3A 4KLLA 4BFRA 3EZ5A 4O3NA 1PVRA 2YMMA 4GXJA 2JEIA 4YMOA 4B9TA 2KHQA 1Z00A 5CR0A 2KJ9A 4AP9A 3O65B 3Q3OC 2IGDA 2K0PA 3K9PB 4JIOU 4DSEA 4ECUA 4MF8A 3QU9A 1KLGD 4MM3A 4KMUA 3A0HU 2UVWA 4ICUA 2RPQA 1FEHA 5CB1A 2FI1A 1D8BA 1UBQA 3AEAB 4W9DA 4OVUA 4ED7A 4LJXA 4NLNA 3DHHC 1QQ5A 4MJSB 3TBLD 2LBOA 2KV2A 4KKJA 4EFOA 8ICBA 2KSOB 3RT3B 3TEXA 3BJYA 1BT0A 4KGSA 4NAMA 3ZW3A 1SWWA 5CJ7A 3GIIA 3BQTA 1FCCC 2Y9UA 1RDFA 1F0MA 5DG7A 1UD7A 4WJNA 4HYKA 3ZJTA 5AM1A 4DOBA 3IP4B 2WXPA 3DBRB 2J0KA 1V81A 4ECQA 4E0DA 3UQ0A 2LM1A 4UAYA 1ZQHA 2PFNA 2HHQA 3TUOA 2H88B 2C7HA 2F3NA 2Z7JA 4TV3A 4ECSA 8ICEA 2V4IB 2ZJ8A 3CSTA 1NEKB 3W5VB 2KDBA 5J2RA 1SB3C 1KLUD 1SE4A 4CNQA 4DSFA 3N20C 1A70A 2FDRA 3T5LA 3QJZA 3NZSA 4HPLB 1V38A 3VAWA 3UI3A 5KFPA 2KN7A 2UU7A 7ICJA 8ICGA 4FS1A 3Q8BA 3RULA 5HR7A 1S1QB 1V5TA 2BYFA 2WF7A 2E3TA 5ALLA 4P0PA 5ALRA 4F8RA 2P35A 1SKRA 1SKSA 4FS2A 5EE3A 2MWSB 3I63C 1S0VA 9ICOA 4WH4A 1DGJA 2CRXA 2HHXA 1CEZA 3N9YC 3RUIB 2NRVA 3P4RB 4BVUC 1SEBD 2KJ8A 1OQRA 2G4SA 1GO3F 1BPEA 5BOMA 2LGYA 5AI4A 4NQKE 3N30A 2KE7A 2KD1A 5J0SA 1Q5WB 4K4IA 4KSLC 3U52E 2VA2A 1O08A 2ISPA 3RJHA 1V86A 2FNJB 1E9MA 4DQRA 2WXLA 3WIMA 4AYBF 4IQTA 5H2FU 3PSFA 4AP4C 2MBOA 2NBVB 4DXFA 3RR8A 3GV8B 1FNWA 2MHJA 3VTWA 2KT7A 4O5KA 1MN8A 1SJED 3RNGC 1A77A 5ALGA 3KKAA 2KICA 4FJZA 1WXAA 1VR9A 3EFCA 2VZKD 1AQ6A 3I76A 1WMHA 2EMTA 3RYTA 1XNSA 4N9F4 4YSYB 1JXLA 4IC7B 5EE1A 1Q3VA 1Y8RC 4S0RA 1TS4A 2YB1A 3QU5A 5HMLA 1DGSA 3HKZC 2LVQA 1K52A 5AKXA 3NZUA 2NCNA 4RH6A 4MM3B 3WK8A 4MEMA 2BS2B 5BYSA 3NVYA 2MBHA 2E8NA 4Z6CA 2LMCA 3A9JB 2ZVOA 1XEEA 1HJPA 1RFAA 4C4RA 1DOXA 2W7PA 3ZVVA 4R64A 4YT0B 1IYFA 3B9JA 5JU5A 3IG3A 5KG4A 3KWLA 4NL9C 3A4SC 4IRCA 4JL9A 2AX5A 5AI8A 5KFMA 3PZDA 1D9DA 2VIXA 2Y9TA 4QIWC 1L8OA 5KL1B 2F1JA 4O0IA 1MI0A 3HP6A 2BTEA 5AI5A 3PVLA 2YMQA 4K7WA 5FK9C 3JPSA 4O1NA 1E6EB 1PUZA 3MHSD 1SZHA 2ZIXA 2HHWA 4YXDB 2DZJA 3PLUA 1WGKA 4YCXA 1E8YA 2LYHA 2BPCA 1C76A 5AIBA 2NRZA 2YLMA 3SV4A 1UCVA 5A0LA 5AEKB 3AE7B 4YSXB 4IM2A 2OWOA 5KFEA 1X40A 1J2MA 1S9FA 5AKYA 8ICVA 2WXGA 1BPYA 4Q45A 2BYVE 3SHQA 1N5XA 5IIIA 3PT2B 1S97A 4Q8EA 5F9LA 2HBMA 2Q4TA 5AKEA 2KWDA 1P0RA 2PJHA 3BK2A 4HJGE 3UQAA 3LYYA 2DENB 3OHBA 3Q3FA 3C5FA 3PTFC 3DQVA 2FE9A 4W9KA 1YJJA 3C21A 1NZBA 1VZ8A 1COOA 3SDLC 3PVXA 4B9KA 3ZYYX 4G11A 4KZ0A 1SIFA 4YTNB 3Q3JA 5ALQA 1TFRA 2WXRA 3Q69A 2M0AA 3RBEA 1DK2A 5AZHA 2CR5A 3C23A 3QXGA 2V3PA 3GZNI 2KHVA 2Y5PA 1ZQJA 1ESFA 3Q8PB 5ALJA 3M9OB 3C2KA 2WDTB 3TADC 1RYSA 9ICSA 1L6UA 4XGAB 4TUSA 2W9CB 1WWTA 4ECTA 2OJWA 4BKGA 2EQYA 2JHDA 3VR9B 3PV8A 4K81A 2JU6X 4IR9A 2Z0EB 3EA6A 3ZUNA 2JY6A 5DQIA 1D5XC 4A55A 4Y2XA 4NZLB 2MP2B 5KFIA 5KTQA 3ORYA 1T3NA 2XVTA 2KK8A 3FYHA 2CPRA 5KFQA 2HVIA 2KN5A 3RJKA 1WE6A 4IQWA 2F8KA 4F4KA 1RYJA 2ASJA 1P7EA 2HMXA 1R4MB 1YMHE 4MH0E 2KLGA 1IG6A 5KT4A 2KMAA 1DXSA 3RNEC 4OJLA 3RBDA 1N61A 5KL8B 1S0MA 1OGWA 1MG4A 3SU8X 3CSFA 4C56C 1KOTA 1L4DB 4DFJA 3I3TB 1T0YA 2QB0B 2HDOA 5AM4A 1NK0A 4KLOA 4XUSA 1K51A 2VH1A 3MTNB 1QSLA 4M0AA 1FXAA 9ICHA 4KLHA 1EUVB 1T7PA 3VVWB 2KZMA 2OCEA 3NG0A 2H5XA 3BWUD 5E79U 2R8IA 2PLPA 1WE7A 3QWZB 5DQGA 1BXTA 2BW2A 1GC6A 5KAFU 4O3PA 1WG8A 5AI6A 3M9MB 3BS5A 4R8UB 1ZQTA 1J7CA 2JZBB 8ICYA 2WWZA 3W1SA 4UB5A 3GDXA 4IG7B 2K6QA 3M7DA 1FFUA 3RJJA 3RB6A 4GDLA 4FJVB 2FIFA 2Y1JA 2DBYA 2HI0A 1NENB 1YQ3B 3FAHA 1PFDA 2W82A 2L7RA 4M9HA 8ICNA 2VRRB 4NM2A 2G5IB 1C7YA 5JHBA 3P1MA 1NK7A 3A0BU 1PGBA 4ZHPA 1RLFA 1UELA 4ELVA 2B3AA 3AECB 5FR3A 1HTOA 3RJIA 1XQQA 3PW5A 1L7YA 1FEZA 1IBXA 1JRUA 4M04A 2J0MA 2BPGA 3MR3A 1TKGA 1I7HA 5GMVA 4K1RB 1Q1OA 4RQ8A 4O3QA 4B6JA 3MFHA 4GGQA 1K5OA 4UB3A 3IV6A 1NYQA 1UA1A 1YQ4B 5J0UA 3G6XA 2AGQA 1D9FA 3NASA 2ZIUA 1FNVA 4IWOA 4A20A 4OVZA 3QQ8B 4O3OA 1JX4A 5IAAC 3UQBA 4ZHOA 4FN2A 5J0TA 2F44A 3H8HA 3M1YA 4DL5A 4DL3A 3IAS1 1UT5A 4P4PA 4HAIA 1TY2A 1X1MA 1YJ1A 3PR5B 3DVGY 4S17A 4QZGA 1A0PA 1RRBA 1ZQXA 2JH7A 4KLEA 4I2JA 4NNJB 4PGXA 3EUB2 2C7MB 2RRDA 1NJWA 2BWFA 3Q8LA 2DUYA 2M17A 3SQIA 3ZDBA 9ICCA 3VH4B 2GLEA 2YVCA 2YMLA 2GO7A 4M0WA 4IC9A 4B9MA 2JV3A 1WXSA 2W9CA 2FPMA 3CYMA 3AMZA 3ISBA 3TANA 1ZQRA 2R8JA 2JF5A 2QCZA 2WU5B 3GS2A 2K4HA 2PE9A 4IKGA 3ZD9A 1LQBA 3QUQA 5D49A 3AI5A 1TZ1A 3ZIMA 1ISNA 5L9XA 4UB8U 1HZ6A 3SZ2A 3HVDA 1ZD5A 5C2TB 4IW0A 3VCBA 1WGHA 1BVSA 5LNK1 5EE0A 3I1YA 4EUTA 1ZQIA 4NLKA 3RNCC 2C60A 1N48A 4GDKB 4C0ZA 1VZ6A 5ALMA 1LM8B 2DZKA 1U49A 5DPSA 3UINB 3TEWA 1WRDB 1WXVA 1GJZA 4ZRIA 4KTQA 3PO5A 3P2BA 1KJTA 1ED1A 4MFCA 7ICHA 3AM9A 3ZXVA 4WQOB 4US9A 2XCAA 1AARA 2KTRB 1S0NA 1TS2A 2WF8A 1WM2A 4B95A 4KLIA 2KJRA 4PGYA 4YXMA 2FLNA 1ZOYB 4YMMA 3QAQA 3M8RA 1E90A 3M95A 3GZFA 1PGXA 3CRXA 2J7QB 4HPMB 2N9LA 5BOLA 2OJRA 5KFLA 3QA8A 9ICJA 2R2OA 2ALZA 4KLGA 2KQ4X 4ED8A 3VR8B 4UBBA 3HKZF 4HRSA 3OWEB 4W9EA 1KFDA 3S2AA 3F2CA 2FCQA 5F3XB 1ZQWA 3JSVA 4HEA1 3LDAA 2ZJAA 3AL0B 1STEA 3OGUA 3AXCA 3RH5A 2LHTA 2HTME 3P4PB 3ABVB 2DX5B 1JRPA 5L83A 2K9XA 4IWPA 4UAUA 2PEAA 1WZ0A 2H3FA 3T79A 2C2DA 4PGQA 4Q44A 1F5SA 2IYDB 2ZUBA 1IPGA 2W43A 1XSLA 3L5KA 2IOFK 2V1YA 1B1ZA 4FHJA 3VUXA 1SV4A 2IZVB 1FMAD 1LGRA 1Y88A 2OH2A 9ICWA 4HKQA 5AM2A 2EELA 1ZW7A 2XICA 4G3IA 2CHZA 3TFRA 1C1YB 4I2HA 4M9LA 4GXIA 4JPSA 2BBCA 3S6JA 3PZ8A 4GIBA 1EWCA 2RDIA 2D5GA 4LNNA 2E8OA 4KN7A 3KZIU 2EANA 7ICUA 3Q8FA 5AM3A 2EAPA 2ZW1A 1WY8A 2LYBA 2BB6A 4CDGA 2IJ0A 5E6JA 4WWNA 2L05A 4M02A 3O0FA 1C77A 3C0RB 2JXTA 4F5NA 2K6DB 2Z59B 5ALOA 4KMOB 4KIKA 3AE2B 1P98A 1UUPA 3Q14C 2YTUA 3A9KB 3HWTA 2EKEC 4IWQA 1NYRA 1JQ4A 3G6VA 2CJNA 3ED5A 4P1CC 8ICWA 5E6OA 5KFWA 3PR4A 5LXHA 2YMPA 4LK0M 4RT2A 1KW4A 1NJXA 2BCUA 1V1OA 2KC1A 5GTIU 2QJLA 4OHJA 4QJFB 2N1WA 2D11A 2MQJA 2BYTA 3AU4A 1WRIA 3PSIA 3PRMB 4JLCA 2YB4A 3OAWA 4BGDA 3VXWA 1KRHA 3OJ3A 1SZPA 1J8CA 4P0PB 1QLBB 3NRWA 1MQ2A 1EM7A 2ONQA 4JX1C 4P6VF 1JIHA 2N9PC 1CMXB 1BPXA 4LCDE 4CGZA 1L7PA 4FBTA 3D2QA 7ICNA 2Y3AA 2KQ7A 3QX7A 1SJHD 3EFUA 4IOIE 4PYZA 4MELA 2WXHA 1VLBA 3MC8A 4AYBC 1L7OA 5HMMA 2IHMA 1QCKA 2FLPA 4M47A 5AK5A 3WU2U 3M63B 2WB1C 3QU7A 1UF0A 4JGHB 5J0QA 1XD3B 2IPKD 5DPWA 2PW9A 2H3IA 4C7ZA 4LJPB 3ZNGC 1ZQUA 1AYFA 5ALWA 3E2EA 3G6YA 3DCGA 2GMIC 2PIAA 2W9BA 4B0MA 1ET9A 5KT2A 1V8CA 4M2YA 1QQ6A 1AN8A 5KFRA 3UXPA 1WJNA 2W9BB 3QYPA 5AICA 4DO9A 3Q2AC 2K4IA 5IIKA 5IIOA 3AE9B 5KFFA 2A3VA 9ICPA 3GP7A 3KW5B 1XLOA 5AKIA 5G5GA 3C2LA 3AE4B 3H8JA 4LZGA 5L1IA 1ZQBA 3APDA 1E10A 4JB3A 2RDJA 1P3QU 4CCHA 2J6TA 4WIPA 1SWVA 5KFBA 3QU2A 2L83A 1D5MC 2NTTA 2ZG6A 3K1RB 2KHWB 1Z00B 3DVNU 4B9NA 2CN1A 3DDCB 3ZD8A 1HEZE 5BO4B 4EENA 1FIQA 3H40A 1UA0A 5HKHA 1Z19A 1YJIA 3LYSA 3EYZA 1WJ6A 4YSZB 2MU2A 4F72A 2W04A 2ZW0A 2TSSA 4RGNA 1K50A 2GBKA 1NJZA 1FPYA 2KWUB 1ZQGA 4LNKA 5HG2A 2J52A 1YN3A 4OZAA 1KKXA 3DBLI 2MRLA 4PJ0U 2ASDA 1XT9B 3R7RA 2MEKA 3AU2A 1ZJMA 3ZTCA 4O5CA 2WX1A 4UB4A 3A9KA 3GE3C 4B9SA 4WQMA 2V0GA 2N0SB 2WHIA 3U4EG 4ED1A 2B0CA 3BS5B 4Q43A 3AE5B 4I6NB 4LTUA 2QKQA 4ZRJA 1UPHA 2HHUA 2QC8A 3L10B 4I6PA 3B0AA 3ZO5B 1UT8A 2BKEA 8ICKA 3BY4B 4P1BC 2K4EA 8ICTA 4DQIA 3IN5A 3P42A 2WB1F 1K1QA 5KG6A 3N97B 2MBBB 2D6FC 3W5UB 2ESEA 5DG8A 3TI0A 4YG2A 2QB0A 2JH1A 3R2TA 2KOBA 1NK6A 3SEIA 2RQ5A 4KLDA 4C8MA 3I57A 2EZXA 3WKCA 1AWDA 4C4VA 2L3ZA 1TY0A 1CZPA 5CHGA 1C20A 1N6ZA 2AEHA 4AQ7A 3B0XA 1JXEA 1KFTA 5EDSA 2HSZA 5AI9A 4Z6FA 2BS4B 2BQ3A 4BBNF 4A90A 5IKCM 5JZEB 1TAMA 3SEBA 3Q8KA 4H2AA 2JEFA 4BKSD 5CA7A 4EX7A 2ZVNA 2WHEA 4LNFA 4DS4A 9ICTA 3TEZA 4DSJA 3LWLA 2BGWA 5D3IB 5AUKA 3EWAA 3PX6A 1ZQSA 1QZEA 2FCMA 3EGRA 3KUDB 1SV0C 5J0XA 2XI9A 3TARA 1D5ZC 5ALSA 4C7YA 2J4XA 5KAIU 3L13A 4DOAA 1EWYC 3ETRA 2YEPF 3DHGC 3H0MB 1WX7A 5KFCA 3PY8A 2MX2A 2L5YA 2A4ZA 1V6EA 4IRDA 3HW8A 1IGCA 3D2NA 4TQ1A 5DPRA 1EF1A 2YQEA 3M8SA 4YR0A 1JMSA 3MGVA 3NY5A 3ZTDA 5KFDA 2VA8A 9ICXA 1D8LA 1M6YA 1Q46A 2PKEA 1TTNA 3MC9A 3PHWB 4N58A 3BQ7A 3V7LA 3HPOA 2BZFA 5AM5A 1QILA 1VJ5A 1FM0D 5KFUA 2MLBA 4NLZA 1MVKA 3A1QA 2DFLA 2JZZA 1LB2B 4UB2A 1JWMD 4CHKA 3NVWA 1RAXA 5ALEA 3PZPA 4K4GA 2C7NB 3KYDD 4MFAA 2JEJA 4A9AA 4Y2TA 4RQ1A 4CO7A 3TADA 2ZIXB 8ICJA 1GUAB 4XDDA 2DPIA 1TJEA 3L0WB 4DHJB 2W9NA 4I27A 4DL7A 1F52A 2J6UA 2JUOA 3ZDMC 1BPBA 2BS3B 2V4RA 3IHPC 2LD9A 2N1VA 4C4VB 4EZLA 3PX0A 5H92C 2FMPA 4J9QA 8ICCA 2GRIA 2BQRA 2PVOD 2PFQA 4F4YA 2FE8A 5D4BA 4UBCA 4MH8A 5ALYA 4XRHA 1IGDA 3Q6BA 2WS3B 3AQEA 4RQMA 1WSPA 3T9LA 2H89B 3QIJA 2OXOA 5DG9A 4F3OA 2L00B 2QHOA 3R66C 2I1QA 4HKZE 3WKDA 4ECRA 3URYA 3KFUF 2O2VA 4K7SA 2DL0A 3NS8A 2V4LA 3R3MA 1LFDA 2J42A 7ICKA 2PKOA 4YFKA 2KDFB 2MAXA 3N4MB 3H7IA 3CNHA 1P7FA 4NPNA 4TUUA 2N1RA 3VDZA 5CRXA 1KQQA 3Q8QB 3BYTB 1RWSA 3BVMA 2X8XX 2PMVA 4ASWC 3LB8C 3PREA 1MA7A 5BPCA 3WK9A 4DHZB 4RPXA 1U47A 4WWMA 1H8CA 1BMLC 4L23A 1JMLA 1SXEA 4M9JA 2KWVB 2EZYA 3DWGC 4DDID 5TR5A 4RQ0A 1RPLA 3V72A 3KKAC 3DVGX 1YQBA 5KFJA 2R8HA 1NKEA 4JWNA 3Q8EA 5FR6A 2KVCA 4I29A 4U6PA 1X6JA 1AW7A 2WF9A 3H8SA 3ZJVA 4P4MA 4DL2A 2N9KA 4PS7A 5EWFA 4AOFA 4OZCA 2JZBA 4EX6A 1ZQNA 2ZJDA 2FPKA 1F44A 1QTMA 3PNCA 4QW8A 3FM9A 3H6NA 2JGAA 1EF5A 1N60A 5L1MA 1R4NI 1HA5A 2HHSA 2JX5A 1X2IA 3B1LX 4PHDA 1D3ZA 3EHVA 1NK5A 9ICFA 4PK1A 3Q8SB 7ICMA 4UARA 2LRWA 2MH7A 1YNTE 5LLIA 2QARA 4I2FA 1PYWD 1KTQA 5J8YA 2JVCA 5KT6A 1PZNA 1T8EA 4FULA 1RQLA 9ICMA 2B76B 3BINA 4HDOA 2IOFA 9ICKA 4GFJA 5J2CA 1ECWA 2HCFA 4CF5A 1X66A 1ZD4A 2BDPA 2QB1A 4Y2UA 3R7QA 1TK5A 3U8ZA 4RNOA 3T5KA 3JYUA 1HXYD 3JPNA 1OUQA 1T0RC 2MP2A 1HUZA 4EEKA 3ZXRA 5BYRA 3T5JA 1X9SA 8ICUA 1WR1A 4RQ4A 2WNMA 4C8LA 3AUOA 4DBGA 4KX5A 3IDWA 4Y2VA 2UVVA 3AE6B 3Q8CA 4Y2QA 1KBUA 2IBKA 3GB1A 4MJSA 3VC8A 1ZQFA 4DF8A 3WANA 2K8AA 2N7JA 2F77X 3ICXA 4ZYNA 2I6XA 2KNJA 1URJA 3P4QB 4BWJA 1TGZB 2OM6A 3MABA 1SSNA 1SXTA 4A8XC 1GB1A 1CK1A 2CU1A 2EZZA 1KLNA 1WGRA 1WXQA 4UASA 4KIKB 2WTFA 3V6CB 2JMGA 4J9RA 4F5QA 2GOLA 1E8WA 3MR2A 4J6IA 4DCCA 3QCAA 7ICTA 3RNAC 2MJEA 3APCA 4IM0A 3MDAA 3RB3A 4IS7A 4FZMA 2XCPA 3TQ1A 3QEBZ 2BCRA 8ICRA 2M56B 4HCPB 1NVID 2BKRB 1WGYA 1WF9A 1Q8KA 1HQRD 8ICPA 2FLLA 1BUIC 1I4HA 1WM3A 4GSWA 2KKPA 1WR6E 4MSQB 3J81j 4FE3A 2F1IA 2N9EB 2LYAA 1IIPA 2HD5B 4HVBA 4M9NA 2KMDA 3F53A 3L08A 3NVZA 2PMZC 7ICVA 3AULA 5JUMA 4PYUA 2PMZF 2PPHA 3OLMD 4HPPA 3UIPB 2LGIA 5ALDA 3KWVA 4MSMB 3UXNA 5IINA 3DV9A 2LXCA 8ICOA 5B66U 9ICBA 2KO3A 2KK0A 2N4FA 2A1AA 3K9OB 2IO3B 2FCNA 1B9RA 1MSWD 2P6RA 3H4BA 4CRXA 4YTMB 4RF0A 2A19A 3K4GA 3AU5A 2XY5A 1SE2A 8ICSA 1TT5B 5CHWA 3F5AA 4FLHA 3QK0A 4A3PA 1RYRA 4BKSA 3VHTC 4Y2RA 2KXJA 2PXIA 4C4SA 2DZMA 2VZKB 7ICSA 4O3SA 1NK8A 4I2GA 1S8OA 2G1EA 4II3B 2KFJA 4II2B 4MDKE 4O3RA 5DQHA 5G55A 4BUGA 3GV5B 3MR6A 2IA6A 4DHJD 3ZDAA 4XQ8A 5JTIA 3A1QB 3JPOA 2V9HA 3BZDB 4UQGA 1CI4A 4CE6A 4EBEA 4J9PA 1Z3EB 2I1KA 2QDFA 2VKQA 3L17A 4Y2YA 1GNUA 4FA6A 5B5EU 4ZYSA 1SE9A 3NOBA 4R3DA 1RXWA 4P2HA 2BGFA 3MJ5A 2INCC 4TQ0A 5DLGA 2WX0A 1A5RA 3QARA 2J0JA 1EU4A 7ICOA 3IHQB 2W8LA 4J9SA 2AL6A 1DOQA 1JI7A 1JUDA 4E71A 4BJQA 3THVA 3ZDCA 4KV2A 4XYCA 1A76A 1Z1VA 5FP0A 2DYMA 1SL2A 1JALA 5KFKA 2ATLA 1BNPA 5D6JB 8ICAA 4B0EA 2D3DA 2W9AA 3V6JA 2AGPA 3V60A 1TS5A 2DGZA 3OSNA 1H38A 2IHNA 4M0WB 4KDIC 1E7UA 1I4RA 4X57B 2B21A 1F77A 1BGXT 1FNUA 1SBBB 2RDHA 2ACZB 3ONNA 5HNKA 4JV0A 3X0WA 1N63A 3SD7A 4LNIA 4TUQA 1D4BA 1B43A 4GB9A 3AH7A 1I42A 3LVVA 3VRBB 4PZNA 4NJCA 3SENA 2L52A 3VTVA 3RRHA 1JROA 2BT6A 3T5HA 4QWEA 2JRZA 2INDC 3N1YC 2G3QB 2NO4A 1ZETA 2JQRB 2KVRA 1CRXA 5DDMA 1PDXA 4IQUA 5CEHA 3QEAZ 3F2BA 2QARB 5BMHA 3I28A 1EO6A 4FHKA 5L1KA 5DB9A 5AHXA 2VA3A 2W8KA 2OOBB 5JHAA 4GU2A 2KSOA 1ZRMA 2DAFA 3MR5A 2HHVA 2JXXA 4EYIB 1L6VA 4RZRA 2BWES 3VUYA 4I6LB 1L7NA 4KX3A 1UHUA 5EWEA 1TS3A 1TZOA 4GOCA 3KVFB 4F8CB 2R2QA 1QOFA 3BIID 4KKIA 4FO6A 2HW3A 2NMQA 3HRDD 5HHHA 2KMMA 4PHAA 1LVHA 1WX8A 1FRRA 1XO0A 3DHIC 4K3CA 1S3SG 2Q5WD 2HOFA 2LVOA 2L8JA 1R4MI 5CHFA 2DKZA 4JMUA 2AQ1B 3C5GA 3GIKA 2AGOA 1EU3A 2GBNA 2ZZPB 3JPPA 5CHVC 3UGBB 3A4RA 4UATA 5KFGA 4GLXA 1YIWA 1WFYA 1V80A 1YZ6A 5CTRC 5AI0A 2JEGA 4JWSC 3RD2A 2HE7A 3ZDEA 1V5OA 3N1XC 3WAPA 2OHFA 1QF6A 5KFAA 4W9GA 1CUKA 4YR3A 5TSSA 1C4PA 3KOOA 5EE9A 1ZDVA 2LI5A 3LXFA 2LKYA 3OJ4B 2ZCCA 2W54A 2WAQF 2CKHB 4UW9A 4ARIA 5CWRA 1IP9A 3NS1A 2D3AA 3NRZA 2INNE 2WXQA 3L16A 4L1BA 4R8UA 1YN5A 5KNIA 3GOEA 1U9LA 1WXMA 3V6KA 2K8BA 2LUMA 4P7IA 1QH9A 4GXBA 1L5PA 4G0NB 4PPXA 2KWCA 2KIWA 3IBEA 4FJYA 4WWPA 3VRAB 1G6JA 2DF4B 3H4DA 2AXTU 2KP7A 1LV5A 4K4HA 1DOIA 1NNLA 5D94A 5AIAA 2F76X 2V9WA 2M8SA 1MPEA 4R66A 1JWSD 2KACA 1IM4A 4M6WB 4YXJA 4HDQA 2IY1B 4QZIA 2WDQB 3VUWA 1DK3A 5AKKA 2KKVA 4RQ3A 3VH3B 4E74A 3B08A 1ZD2P 3HJEA 4ICAA 2ZCBA 5HHDG 5J2KA 1SKWA 3ZNHB 4B9VA 1B0XA 1E5WA 2M19A 4B6WA 4QWAA 7ICIA 3DOWA 2A5UA 2KOXA 3RI7C 2O6VA 3HM6X 5ALHA 2M4NA 3D6JA 4RGOS 4NY8A 1B22A 2MW5A 2KYWA 1I35A 2KZZA 5AKZA 3MFIA 1U48A 3V6HA 9ICLA 2WU2B 3WKAA 3BDPA 5ALZA 2IO2B 2L76A 2V3SA 3PZ7A 3T8MA 3NGDA 2I1JA 4ITKA 3W1SC 4R63A 2GH1A 5HFYA 5JRTA 3BZCA 2CS4A 3WA0A 4FBUA 3AEEB 3N32A 2G09A 5KFZA 3PO4A 1XO1A 1XSPA 3QUBA 2AJQA 1KN5A 1Z4OA 1GOZA 4FBJB 2DQNB 4KN4A 1NJYA 5J2AA 3UQ2A 4KDLB 1ZGUB 4UDUC 4DS5A 3TCAA 9ICNA 2Y0SF 3KQ4A 2WDRB 4ED6A 1UBIA 1OXJA 1MC8A 2BHNA 3UM9A 3RRGA 4W9LA 2RDBC 1XWLA 4OJ6A 1ROEA 2LWPA 5AZFA 1KSPA 1YN4A 1FRDA 4UAZA 3KD3A 2QLTA 4DDGD 7ICFA 3H0RB 1XF5L 5DKWA 3UMCA 4DFKA 1L3TA 2KTQA 2LZ6A 1R7SA 1UNSA 4PHEA 4BDPA 4REZA 3DVNV 2EAOA 8ICXA 1P9DU 4YP3A 1PQSA 3DWMA 1F2RI 3TJPA 5IN7A 3O13A 2KIVA 2RP5A 5DB7A 4ZRKA 3CIRB 3QUCA 4I2BA 7ICEA 1V9PA 1T0QC 7ICRA 5IIMA 4WWOA 3GU3A 1I4PA 3CF6E 2RPVA 5KFVA 4Z6EA 3PGEA 2KVZA 2V4QA 5KG2A 2KZ3A 5ALVA 4QW9A 3NUHB 3WCQA 2GWSA 1HTQA 4PH5A 3IG5A 4XWTA 3B2FA 3RAXA 3ZQ4A 5EWGA 2MUTA 4F5PA 4BAXA 5IP4D 4OJ5A 3APFA 3GFKB 3PSTA 5CX3A 4KGTA 4YD1A 1WMHB 3SYZA 1DOYA 2EMSA 2XO7A 3EPIA 3ETLA 4DWFA 5D3DA 1SL0A 1MJDA 3LDZE 5C0YA 2Y5CA 3QC8B 1ZDXA 1JWUD 4C4TA 1L6NA 2KTFA 1C4CA 3PSEB 1VCBA 2LEKA 3ZGZA 3JSVB 2D3GA 5ALKA 2WXJA 3DBRI 2G06A 4F50A 1DRGA 3RMKC 2HHTA 1EXNA 2ZTCA 4HWIB 5J29A 3FILB 3Q8AA 4XE0A 5ALIA 5AUIA 4MEXA 2RLTA 1L0XB 2AWTA 2YEPB 2M1MA 5HP4A 3TSSA 4UB6U 3MHZA 2PI4A 9ICRA 5D7GA 5J2EA 2J53A 4NAWA 3FC4A 4QZ8A 1ZQOA 4I28A 2GLSA 2I2YA 5F9NA 2MCNB 2YY6A 1GB4A 3I9V1 3V7KA 1XLQA 2E6XA 2K8CA 3R9KA 5TZVA 5J2BA 2BCVA 1NZPA 4ED2A 4ELTA 4YQWA 5ALXA 4JUZA 4OO1J 1XO3A 4JQWC 3M3JA 2KDMA 2RDGA 2LRUA 1KRPA 4GIVA 4ANVA 4RPZA 3RR7A 2K8HA 3Q8RB 2GBJA 1VZ7A 2BCQA 4O5EA 1XLPA 4URKA 4XX5A 3RJEA 4O9MA 5ALUA 2C2RA 2W11A 3N28A 2LVPA 3PW7A 5HI1A 3PRPB 2SAKA 2MBQA 1TE2A 2NBWB 2KG5A 2XN9C 3IAM1 4FFDA 4F1SA 5J2GA 2KJHB 8ICQA 5KFOA 1IUEA 3MC1A 4C8OA 2HOIA 2WDVB 3U7ZA 2K8CB 4U7CA 1Q10A 2LXAA 2Z0DB 1UWMA 1J2NA 4OJOA 3GQCA 2RGFA 3IG8A 1ZUD2 1KFYB 2KAJA 2WAQC 4OJPA 9ICAA 2IY0B 1GG3A 2L32A 4ED3A 1SF0A 4NAWB 3U7DA 3C29A 3QU4A 2HBJA 4P4OA 1SV0A 3B2GA 1B4FA 2K89A 5J0YA 4RNNA 4KLJA 4OW0A 4WJPA 3BQ2A 5KFNA 2IO1B 4XZ4A 3F2DA 2BR0A 4QZBA 2WXNA 2LHDA 4KGRA 3W1YA 1O03A 1TK8A 3ZRCA 3VQIA 5G2NA 3ZNZB 1NK4A 1WWVA 1SGHA 4QIWF 3BQ0A 3PW0A 2ES6A 2MJ3A 3L3FX 3DEEA 3W2DA 3UXOA 1T94A 1OQYA 1IBXB 4RQ2A 1J97A 4TURA 1FO4A 4BX9C 2JPHA 2KLCA 2MUTB 4B9UA 1S0OA 4NL9A 3KH0A 4HXDA 1UGMA 3ZNID 3KHGA 2VH2A 5J2JA 5HR6A 9ICVA 2W9MA 3V62A 7ICQA 3WAMA 1L4ZB 4GDLB 2WF6A 4RU9A 2DPJA 2LGSA 3OPXA 4J9OA 1Q0WB 2KX3A 5AKHA 2PTLA 3RZWC 3SAGA 1ZE3D 1XS9D 1KM7A 2R61A 1MQ3A 2E1FA 2I9GA 4BXOB 1TKEA 2HBKA 1ZQKA 2W55A 4RQ6A 2MJDA 4FADA 2EKIA 1FFVA 3RAQA 2BB5A 4C00A 4AS1A 4NXZA 3H0LB 5J0OA 3KHRA 4HCNB 2KKCA 3HVZA 4J03A 4Y2SA 2WLBA 5T8IA 1WZ3A 1ZQYA 1TAQA 4F5OA 4GC6A 4DQSA 2D3CA 4ECXA 1X42A 2G9HD 3TKAA 2GI9A 4MF2A 2SEBD 1ZPSA 4RQ7A 1I4QA 3J9CA 3SD5A 2ZNVC 3AU6A 1YX5B 3K1ZA 2G07A 3BS7A 4YMNA 2ASLA 2JXJA 3OTQA 4C8NA 3LWMA 2XEWA 4EOYA 4ECVA 3ZKJC 4OZBA 4DLGA 1FXIA 1MG8A 3RZFA 4Y2PA 1OW5A 3GILA 4Q8FA 1KEJA 1NBFC 2QMTA 1U4AA 2XIDA 2QILA 5K4LA 1J19A 4ANWA 3AEVA 2ZUDA 4UAWA 2KANA 5DPTA 4YWGG 4PL2A 4RFBA 1TKYA 2BPSA 3U30A 3UMBA 4F7ZA 4M00A 4PS3A 1ENFA 1ZRNA 4K7UA 4MT5A 1P1AA 2HBLA 2FIDA 4P0QA 8ICZA 4DSIA 5DDYA 3T3FA 1NI2A 1S76D 3UF8A 3PW2A 7ICPA 5KT3A 5ALPA 1XXGA 4ZH4A 1RXVA 4DQOC 2D07B 2VANA 3FDSA 4I2CA 1JCKB 3AEDB 5ALFA 1X6IA 4BWMA 2K25A 1T0SC 4GLSC 3M6ZA 2ZXHA 5DGAA 5AZGA 1J7AA 2LI6A 2JT4B 4EZ6A 2ZNVB 4XDCA 4ECYA 1C79A 3BK1A 4MGYE 4OCZA 5KT5A 3QUTA 5JXVA 3JVZX 1RM6C 4UB1A 1NDDA 3X23A 5MPOA 4QZAA 2GBMA 2DWQA 3AE1B 3AB5A 4MHVA 2BYEA 4GDKA 4NJ8A 2K8BB 4MFFA 1Z2MA 2BPFA 1K53A 4RM9A 2FMSA 4MGIE 3HK0A 2K39A 5C23A 4ARCA 1FD6A 2QIEB 3VFKA 2K3UA 1SIJA 5C1ZA 3H8MA 3TACB 2A1JB 1P7DA 2LHEA 3BYYB 3ML8A 3HT3A 3E56A 3M62B 1PGAA 2QEJC 3GIMA 3RJFA 3UIOB 1TYGB 1YZ7A 3AE3B 1Z4NA 2NRWA 1X9MA 4WAFA 1RZTA 4LDTD 4DXGA 2BF8B 4DL6A 4EKUA 3TFSA 4PS8A 2L0TA 4DFMA 4I2EA 2DAJA 1T3QA 3I5JC 3D2SA 4EBCA 1U4BA 1LKYB 4DSKA 3ENEA 1YX6B 1V1PA 4J9LA 4DQQA 1WI0A 1C9FA 1HEKA 3A9JA 5AKLA 3P63A 2NO5A
chains in the Genus database with same CATH topology
4NJCA 2L52A 2WXHA 1VLBA 1KLGD 2JWUA 1JROA 2BT6A 2Z8LA 1ZXIA 1FEHA 2IPKD 2JQRB 3AEAB 2PW9A 3IT6B 4C7ZA 1NI3A 1XCQL 2CJOA 1PUTA 1PDXA 3R2IA 1JWBD 1AYFA 2PIAA 3AE8B 4KKJA 5BMHA 1ET6A 4B0MA 3TEXA 1ET9A 3SFDB 4KGSA 4NAMA 1OQQA 1V8CA 1HZ5A 1FCCC 2XNAC 1AN8A 3ZJTA 2WXPA 2CU3A 1L6VA 2DLBA 3AE9B 3GP7A 5I4DA 1XLOA 4LLGM 5G5GA 1TS3A 1TZOA 3TUOA 3AE4B 2H88B 4CQNA 1VDVA 1QOFA 3BIID 2V4IB 4KKIA 1LO5D 1NEKB 2NMQA 3W5VB 3HRDD 2KMMA 1E10A 1SB3C 1KLUD 1KF6B 1SE4A 1A70A 4WIPA 3T3OA 1FRRA 2NTTA 2L83A 1D5MC 1D6EC 3UI3A 2Q5WD 3CWIA 3P4SB 3Q8BA 1F0ZA 2E3TA 1HEZE 2AQ1B 1FIQA 1EU3A 5EE3A 1YJIA 4WH4A 4YSZB 1DGJA 3AEGB 2HDEA 2ZW0A 2JYEA 2TSSA 3N9YC 3P4RB 4RGNA 1K50A 1SEBD 1OQRA 4JWSC 4Q2JA 3PO0A 5HG2A 2J52A 1YN3A 2OHFA 4OZAA 1QF6A 2K5PA 5TSSA 1C4PA 2MEKA 1ZDVA 3LXFA 5EE9A 4RF1A 3E9SA 3L4PA 2W54A 3U52E 3BVZA 1XLNA 4ARIA 3NS1A 2INNE 3NRZA 4L1BA 2WXQA 4WQMA 2N0SB 2V0GA 3U4EG 1YN5A 1E9MA 3AE5B 3NZ3A 4LTUA 1C4AA 2WXLA 2LUMA 4N6EB 2FUG1 4DXFA 2WXOA 1L5PA 1FNWA 3P42A 2LJIA 1SJED 3VRAB 3W5UB 1DOIA 1E7PB 1VR9A 2VZKD 2X38A 1MPEA 4YSYB 3R2TA 1JWSD 2KACA 5EE1A 4USAA 3I57A 1AWDA 4JWUC 2WDQB 4RNAA 2IGHA 1TY0A 1TS4A 1CZPA 4RH6A 4TSSA 3SFEB 1K52A 2ON8A 1L0VB 4HROA 5HHDG 4MM3B 2BS2B 2M19A 5BYSA 3NVYA 4AQ7A 2LMCA 4KX6B 2WXKA 1XEEA 1DOXA 4RGOS 3RFZB 4YT0B 1GAQB 3B9JA 2BS4B 2WU2B 4A90A 1QOAA 1WYGA 3KWLA 3PZ7A 3SEBA 2AX5A 4H2AA 4ITKA 3TEZA 3BVGA 5HFYA 5D3IB 5AUKA 1MI0A 3MC0B 2BTEA 3AEEB 3EGRA 3C8YA 1QQRA 5FK9C 2NTSA 4O1NA 1GOZA 2ICIA 1E6EB 1D5ZC 4C7YA 2J4XA 4YXDB 1EWYC 3ETRA 2YEPF 4UDUC 2INPE 1WGKA 3KQ4A 1C76A 2WDRB 1IGCA 1E0ZA 4TQ1A 1QOGA 3AE7B 1ROEA 4YSXB 1YN4A 1FRDA 2WXGA 1XF5L 1N5XA 1R7SA 1UNSA 4N58A 4REZA 1QILA 2KWDA 3DWMA 1M4VA 3BK2A 1F2RI 4HJGE 5FKAC 3LYYA 1FM0D 5C3JB 3O13A 1YJJA 1MVKA 3W9CB 3CIRB 1VZ8A 1JWMD 3NVWA 3ZYYX 4YTNB 2WXRA 4A9AA 1I4PA 2V3NA 3Q69A 2M0AA 4J3OD 2RPVA 2V3PA 4XWWA 4XDDA 1TJEA 2Y5PA 2IDYA 3NUHB 1ESFA 3WCQA 2BS3B 3NVVA 1UGJA 4XWTA 1L6UA 3B2FA 5H92C 3ZQ4A 1WWTA 2GRIA 1ZP0B 2PVOD 3VR9B 2FE8A 2JU6X 4KGTA 1Y56A 4MH8A 1DOYA 3EA6A 1IGDA 5D3DA 2WS3B 2Y5CA 1D5XC 1ZDXA 4A55A 1JWUD 4NZLB 1FCLA 1WSPA 1C4CA 2JZPA 2H89B 2LEKA 3ZGZA 2WXJA 4HKZE 2LFIA 3URYA 2OEDA 5H8YE 3FILB 3Q8AA 1RYJA 4XE0A 4EE2A 5AUIA 2J42A 1P7EA 1L0XB 4ZOHC 1YMHE 2PKOA 2YEPB 4A6QA 3TSSA 3MHZA 2WP9B 1P7FA 4IDIA 2GB1A 5D7GA 1N61A 2J53A 3FC4A 4C56C 1KTKA 2W3RA 3BYTB 1RWSA 1L4DB 2I2YA 3BVMA 4YTPB 1ZXHA 2PMVA 1GB4A 3LB8C 1K51A 1FXAA 3I9V1 1XLQA 2E6XA 4WWMA 1BMLC 4ZRQA 4L23A 1JMLA 3BWUD 2PLPA 3DWGC 1BXTA 2L1AA 1XO3A 2BW2A 3IXSA 2KDMA 2RDGA 1VJKA 1J7CA 3Q8EA 4JE3B 3U2SC 2K22A 1VZ7A 2IGGA 1AW7A 2WXIA 1XLPA 3HUIA 3W1SA 3ZJVA 2N9KA 5BYQA 1FFUA 4RCOA 5HI1A 1F2RC 4OZCA 2DBYA 1NENB 1YQ3B 3FAHA 2SAKA 1PFDA 2W82A 2XN9C 3IAM1 3AV8A 3P1MA 1CQVA 2AQ3B 2WXFA 1PGBA 3R8BA 1N60A 4ZHPA 1IUEA 1RFKA 1HA5A 2JX5A 3AECB 5FR3A 2WDVB 3U7ZA 1MHXA 1Q10A 1IBXA 1UWMA 1TKGA 1I7HA 2WXMA 1J7BA 2MH7A 1ZUD2 1KFYB 1YNTE 2KAJA 1VRAB 3MP9A 5BMGA 1PYWD 2JYTA 2L32A 1NYQA 1YQ4B 1SF0A 4NAWB 1FNVA 4RGTA 4OVZA 2B76B 3B2GA 3KLSX 4N59A 4OW0A 4P16A 4ZHOA 3H8HA 3FILA 2WXNA 2LHDA 3IAS1 1TY2A 4KGRA 3VQIA 1JW9D 1HXYD 3EUB2 3SR6A 2MJ3A 4C80A 3W2DA 1L0YB 5BYRA 3T3NA 1IBXB 2WNMA 4L2YA 1FO4A 3AE6B 3Q8CA 1QT9A 2RMMA 4M0WA 3GB1A 1N5WA 3AMZA 1B9RA 3GS2A 2WU5B 5G5HA 4IKGA 2N7JA 1L4ZB 4GDLB 3P4QB 1OFFA 1JWAD 1HZ6A 1SSNA 1SXTA 3HVDA 2PTLA 4A8XC 5C2TB 4D2KA 1GB1A 1CK1A 3TEYA 1WXQA 1ZE3D 5LNK1 5EE0A 1V1PB 2R61A 1TKEA 2JSVX 4GDKB 2MJDA 1VZ6A 2W55A 4RGMA 2EKIA 1FFVA 2BB5A 4AS1A 1QOBA 3TEWA 3MFGA 1XCTL 3HVZA 2QSDA 2MJEA 2WLBA 3AEFB 3AM9A 2G9HD 2M56B 1NVID 2FBWB 2GI9A 4US9A 5GXGB 2SEBD 1ZPSA 1TS2A 1I4QA 3J9CA 1HQRD 1BUIC 1ZOYB 1I4HA 2PVGC 1GPXA 1PGXA 1I4GA 3IT4B 2N9LA 4OZBA 1T6BX 1FXIA 1DYQA 2AQ2B 1CJEA 2KQ4X 3VR8B 3NVZA 2QMTA 4HRSA 2QILA 3OWEB 4HEA1 1STEA 1I4XA 2LGIA 1N62A 5BMIA 2KN4A 2WQYB 3KWVA 2HTME 3P4PB 3ABVB 4YWGG 4RFBA 1TKYA 1JRPA 2W3SA 2K9XA 1C78A 4FXCA 1ENFA 4MT5A 4WURA 4ZRPA 4YTMB 4RF0A 1SE2A 1KH0A 1B1ZA 1FMAD 4HKQA 1ACCA 1XXGA 2EELA 4MACA 4DQOC 2VZKB 3AEDB 1JCKB 4PT5A 2G1EA 1T5XD 3ZJUA 1UWXA 4JPSA 4GLSC 2BBCA 3AN1A 3PZ8A 1EWCA 3BZDB 2D5GA 1J7AA 4TMAB 4XDCA 1C79A 1V97A 3BK1A 3Q8FA 5JXVA 2ZW1A 1RM6C 3RPFC 2BB6A 4ZYSA 2IJ0A 5E6JA 4R3DA 1QKZA 2DWQA 1SE3A 3AB5A 3AE1B 5MPOA 1C77A 2JXTA 3MJ5A 1K53A 4TQ0A 3V3XA 3AE2B 2I38A 1UUPA 1EU4A 3V05A 4ARCA 1FD6A 2QIEB 2K3UA 1SIJA 1NYRA 1JQ4A 4US8A 2CJNA 2LHEA 3BYYB 2DYMA 3E56A 4LK0M 3VRBB 1PGAA 1V1OA 2QEJC 2QJLA 4OHJA 1JALA 3AEBB 1TYGB 4B0EA 3AE3B 1MHHE 1TS5A 4WAFA 4DXGA 2BYTA 1WRIA 1I4RA 2DYOA 1F77A 1FNUA 1SBBB 1T3QA 1KRHA 2RDHA 1QLBB 2ACZB 4JX1C 1EM7A 2ONQA 1N63A 1V1PA 4P6VF 1C9FA 1D4BA 3AH7A 2IGDA 2K0PA 2Y3AA 4IOIE 1SJHD 3P63A 5T8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L52 A;  4KX6 B;  1VLB A;  3AM9 A;  2M56 B;  4WWM A;  1NVI D;  2FBW B;  1JRO A;  4US9 A;  5GXG B;  1DOX A;  2BT6 A;  5MPO A;  4YT0 B;  1GAQ B;  1ZXI A;  3DWG C;  3B9J A;  2BS4 B;  1ZOY B;  2WU2 B;  2JQR B;  1QOA A;  1XO3 A;  2PVG C;  3AEA B;  4C7Z A;  1WYG A;  1NI3 A;  3KWL A;  2CJO A;  1PUT A;  1PDX A;  1GPX A;  1JWB D;  1AYF A;  2AX5 A;  4ITK A;  1FXI A;  2PIA A;  1VJK A;  1J7C A;  3AE8 B;  2K22 A;  1CJE A;  5AUK A;  3SFD B;  3VR8 B;  1E0Z A;  3NVZ A;  1OQQ A;  1XLP A;  1V8C A;  3AEE B;  3HUI A;  4HRS A;  1FFU A;  2DBY A;  1NEN B;  1YQ3 B;  1E6E B;  3FAH A;  1PFD A;  1L6V A;  1N62 A;  2CU3 A;  4C7Y A;  2WQY B;  3AE9 B;  4YXD B;  2HTM E;  3P4P B;  1EWY C;  3ETR A;  3ABV B;  1TKY A;  3AV8 A;  1JRP A;  1WGK A;  2W3S A;  5G5G A;  1XLO A;  2K9X A;  3P1M A;  3AE4 B;  2H88 B;  2WDR B;  1VDV A;  1QOF A;  3BII D;  4FXC A;  1N60 A;  4ZHP A;  1IUE A;  1NEK B;  1RFK A;  3HRD D;  3W5V B;  1QOG A;  2KMM A;  2JX5 A;  3AE7 B;  1SB3 C;  3AEC B;  2WDV B;  1ROE A;  1KF6 B;  4YSX B;  4YTM B;  1E10 A;  1A70 A;  1FRR A;  1FRD A;  2L83 A;  1UWM A;  1TKG A;  1I7H A;  2Q5W D;  1J7B A;  1FMA D;  3CWI A;  2MH7 A;  3P4S B;  1N5X A;  1R7S A;  1ZUD 2;  1KFY B;  2KAJ A;  4N58 A;  1F0Z A;  2E3T A;  1NYQ A;  3DWM A;  1YQ4 B;  1SF0 A;  3AED B;  1FIQ A;  1FM0 D;  2G1E A;  5C3J B;  5EE3 A;  1YJJ A;  1YJI A;  3W9C B;  3CIR B;  2B76 B;  3B2G A;  4N59 A;  3AN1 A;  4YSZ B;  1DGJ A;  3NVW A;  3AEG B;  4ZHO A;  3ZYY X;  4YTN B;  3P4R B;  4A9A A;  3AEF B;  1OQR A;  4JWS C;  1J7A A;  3PO0 A;  1V97 A;  2OHF A;  1QF6 A;  1JW9 D;  2K5P A;  1TJE A;  1RM6 C;  3RPF C;  3EUB 2;  3WCQ A;  2BS3 B;  3NVV A;  3LXF A;  3SR6 A;  2MJ3 A;  4C80 A;  2DWQ A;  3AE1 B;  3AB5 A;  1L6U A;  4JWU C;  5EE9 A;  3B2F A;  3L4P A;  2W54 A;  5H92 C;  1WWT A;  1XLN A;  3NS1 A;  1ZP0 B;  3NRZ A;  2PVO D;  1FO4 A;  3AE2 B;  2N0S B;  1QT9 A;  3AE6 B;  4WQM A;  3VR9 B;  1E9M A;  2QIE B;  1N5W A;  3AE5 B;  4LTU A;  1DOY A;  1SIJ A;  3AMZ A;  1B9R A;  4N6E B;  1NYR A;  1JQ4 A;  4US8 A;  2WS3 B;  2Y5C A;  2WU5 B;  5G5H A;  2CJN A;  1L5P A;  2H89 B;  2LEK A;  3VRB B;  2QJL A;  3VRA B;  1JAL A;  3P4Q B;  1OFF A;  3W5U B;  1JWA D;  3AEB B;  1DOI A;  1E7P B;  1TYG B;  5H8Y E;  1RYJ A;  3AE3 B;  5C2T B;  5AUI A;  4ZOH C;  1WRI A;  2PKO A;  4YSY B;  1WXQ A;  5EE0 A;  2WP9 B;  1TKE A;  5EE1 A;  1T3Q A;  4USA A;  1KRH A;  4IDI A;  1N61 A;  3FC4 A;  1AWD A;  2W55 A;  1QLB B;  2ACZ B;  2W3R A;  2EKI A;  1FFV A;  1N63 A;  1RWS A;  2MJD A;  2WDQ B;  4JX1 C;  4P6V F;  4YTP B;  1QOB A;  1CZP A;  3SFE B;  1L0V B;  3AH7 A;  3HVZ A;  3LB8 C;  4HRO A;  2MJE A;  2WLB A;  2BS2 B;  2M19 A;  3NVY A;  1FXA A;  3P63 A;  1XLQ A; 
#chains in the Genus database with same CATH topology
 9ICI A;  1OEY J;  2JWU A;  3HIZ A;  1H4R A;  1TV9 A;  2OYY A;  3TMP B;  4EYH B;  2ZIV B;  1L3S A;  2Z8L A;  2LUE A;  5IIJ A;  2XK5 A;  1ZXI A;  3NHE B;  3EEC A;  3U26 A;  3IT6 B;  2ZUC A;  2ZXI A;  1NI3 A;  2DKX A;  1XCQ L;  1PUT A;  2CJO A;  2NYV A;  3R2I A;  5KHQ A;  4NLB A;  3LJ3 A;  1JWB D;  5CP2 A;  2NPT A;  3AE8 B;  1ET6 A;  1WH3 A;  1Z1B A;  1A6S A;  3SFD B;  1C3T A;  3CP8 A;  1OQQ A;  2BCS A;  1HZ5 A;  2XNA C;  1L8L A;  4M8M A;  4KLT A;  4M8N A;  5AK3 A;  5AM0 A;  2CU3 A;  2DLB A;  3PS6 A;  4G9B A;  5J8Y C;  2I5H A;  5KFX A;  5I4D A;  1TKD A;  1R4N B;  1PVP A;  3CMM B;  4LLG M;  1QQ7 A;  2XGP A;  1NOM A;  3WK5 A;  4CQN A;  3WKB A;  2MBE A;  2AQ0 A;  1VDV A;  2K4P A;  1VD2 A;  2JWZ A;  1LO5 D;  3SAH A;  4G50 A;  2G0A A;  4DFD A;  2HVH A;  4KZC A;  1KF6 B;  5J17 A;  1ZQV A;  3T3O A;  3RJG A;  3H7S A;  1L5U A;  1D6E C;  2F8L A;  1NKB A;  4Z6D A;  1S10 A;  3JPQ A;  3CWI A;  1IXR A;  3E0F A;  3P4S B;  4F5R A;  2EAM A;  1PVQ A;  4F91 B;  2LGX A;  3PV1 A;  4KLF A;  1F0Z A;  1U45 A;  3K75 D;  1V9J A;  5KFH A;  4J9N A;  2OEH A;  2PE6 B;  3OSP A;  3WAL A;  1WUD A;  1BNO A;  3AEG B;  3C19 A;  1TK0 A;  2HDE A;  2JYE A;  3IRU A;  4EZ9 A;  2PFP A;  3HHM A;  1E8Z A;  4Q2J A;  2VJ5 A;  3BZK A;  2D2Q A;  3PO0 A;  2Y0S C;  2K5P A;  3LVW A;  2KJ6 A;  4B9L A;  2E5S A;  3NUQ A;  2GOW A;  2KZR A;  3PW4 A;  1QSS A;  3C2M A;  1FXT B;  4RF1 A;  3E9S A;  2RHF A;  4RUA A;  1IV8 A;  3L4P A;  1N2X A;  3VTU A;  2AHO B;  3BVZ A;  3ISC A;  3ISD A;  1XLN A;  1L2N A;  5DBC A;  1E7V A;  3GV7 B;  3H8W A;  3KHL A;  3TAQ A;  4E3C A;  3NZ3 A;  1C4A A;  5IO9 A;  5HHI A;  3AQF A;  1ZQP A;  4N6E B;  1JN3 A;  3PPA A;  4QWD A;  2K1F A;  1RG6 A;  5D46 A;  2FUG 1;  2IO0 B;  2WXO A;  3D32 A;  2FJ6 A;  4NLC A;  4QZC A;  4IM3 A;  1QSY A;  2Y5B B;  3RFA A;  4QZH A;  2LJI A;  4JK1 A;  2MSN A;  5J2F A;  4G3X B;  9ICQ A;  4DL4 A;  3QZ8 A;  1E7P B;  3RTV A;  1ZQA A;  2X38 A;  3IFW B;  4LZD A;  2IBI B;  5KHO A;  3M6K A;  3PML A;  2BVC A;  4USA A;  2KJ5 A;  4RT3 A;  1S77 D;  9ICU A;  2C5L C;  2DNF A;  3PLV A;  1RQN A;  4JWU C;  4RNA A;  3V61 A;  2IGH A;  3ML9 A;  2ZTD A;  4NV0 A;  4RMA A;  1L3V A;  4NQL B;  2DYB A;  4TSS A;  3SFE B;  2ON8 A;  1L0V B;  4HRO A;  3KTQ A;  3DBS A;  5C5J A;  4EBD A;  1QLN A;  4QAY A;  4DK5 A;  4KX6 B;  1Z5S B;  2WXK A;  1X9X A;  3ZRF A;  4P0Q B;  2AL3 A;  2LM4 A;  3RFZ B;  2UYZ B;  5IIL A;  3GZN B;  1ZQC A;  1GAQ B;  3H7P A;  1K1S A;  2Q0Z X;  1QOA A;  2ZPN A;  2KEY A;  2YX8 A;  1WYG A;  4CYE A;  5J2I A;  2DHZ A;  4HJK A;  3BQ1 A;  1ZJN A;  4DOC A;  2PFO A;  1HE8 A;  3WAO A;  4CF3 A;  4TUP A;  3BVG A;  2HJ1 A;  3MC0 B;  1NKC A;  2J6S A;  3C8Y A;  5KFT A;  1QQR A;  4PHP A;  2ZPY A;  2WYQ A;  2UWQ A;  2C9W B;  2M0X A;  3MJW A;  2NTS A;  2YN4 A;  4KLS A;  2ICI A;  4AJY B;  2LJ5 A;  2N7E A;  2G4D B;  2INP E;  2E8P A;  2ZIW B;  3KZX A;  2P6U A;  5KG1 A;  4A8E A;  4J9K A;  1ZQD A;  4M9G A;  4F4W A;  1TIF A;  5AK6 A;  1E0Z A;  4RQ5 A;  1QOG A;  3QHT A;  2EH9 A;  2CHX A;  2XC9 A;  1F9J A;  4MGK E;  4ANX A;  4NLG A;  3PHX B;  4BOZ B;  1XSN A;  5D2M B;  2E8M A;  2O6K A;  3MGI A;  2VJ4 A;  3A33 B;  4W9J A;  4LJO B;  4IR1 A;  4EEY A;  1SXD A;  3CW2 C;  2KD0 A;  3GE8 C;  4F92 B;  1LXD A;  2AYO B;  4JV2 A;  2BQU A;  4BOS C;  1M4V A;  1V2Y A;  2KQS A;  5FKA C;  3OG5 A;  2UVU A;  5C3J B;  4YL8 A;  1WCL A;  4BXO A;  4F2S A;  3W9C B;  4EEL A;  1UQV A;  3OJS A;  1PK1 A;  4KLU A;  4HLE A;  2V3N A;  4IQV A;  4EZJ A;  3ALB A;  5ALN A;  4J3O D;  4LDT B;  3H9D A;  2WF5 A;  4ZDV A;  4XWW A;  3RCZ A;  1F1H A;  4AJW A;  4DWI A;  2F2A B;  2IDY A;  3RH4 A;  3NVV A;  3N3K B;  1UGJ A;  4WJ3 B;  4K3B A;  2ZJ5 A;  1WCN A;  4ACF A;  4DEZ A;  4WJO A;  2LMR A;  1ZP0 B;  4MGZ E;  3N1Z C;  1Y56 A;  4O3M A;  3OHA A;  3V7J A;  2XY7 A;  8ICI A;  3ZDT A;  4W9F A;  2GBR A;  3SMV A;  2KDI A;  2M0N A;  3E58 A;  1RYU A;  3JPT A;  8ICL A;  2KC2 A;  3H7P B;  3RB0 A;  1FCL A;  5J0R A;  2KFN A;  3NTU A;  2JZP A;  4KSK C;  1WWU A;  2F1H A;  2NRX A;  2KFK B;  3EC8 A;  4FZL A;  3V6E B;  8ICH A;  2NR2 A;  4KIT B;  1KFS A;  3WK4 A;  2LFI A;  3RNF C;  2KNB A;  4QZ9 A;  4IUM B;  2N9X A;  2OED A;  5H8Y E;  5AK4 A;  3Q3M C;  3FKY A;  4EE2 A;  3LK9 A;  4X5V A;  3IM1 A;  2G45 B;  4ZOH C;  4A6Q A;  2KX0 A;  1XC9 A;  2AH5 A;  4GC7 A;  2WP9 B;  1WIA A;  2W7O A;  4PL1 A;  1OEY A;  4IDI A;  2BKF A;  2GB1 A;  1NK9 A;  4UAV A;  4QWB A;  3TAP A;  7ICG A;  1KTK A;  2W3R A;  3JPR A;  2C28 A;  2JRH A;  4YTP B;  1HIW A;  1ZXH A;  5DB8 A;  4QWC A;  2KTR A;  4I2I A;  4WJQ A;  3EW9 A;  4IL6 U;  3KUC B;  2NBU A;  1MFW A;  1TAU A;  4IRK A;  1BPD A;  2XGQ A;  3MBY A;  5KT7 A;  1ZYQ A;  2CHW A;  1WJU A;  1T4G A;  4XA5 A;  4ZRQ A;  2E1E A;  2L0F A;  4Y2J A;  4DF4 A;  4M01 A;  2ASQ A;  5GTH U;  1ZKH A;  4GN1 A;  4RPY A;  2L1A A;  4JWM A;  3IXS A;  4F4X A;  1ZQQ A;  3F5E A;  2REX A;  5J18 A;  1VJK A;  1ZQE A;  2IMW P;  5T14 A;  4JE3 B;  3U2S C;  2K22 A;  2IGG A;  5J0W A;  2WXI A;  3HUI A;  2ISO A;  3QE9 Y;  5BYQ A;  4BZA A;  4CF4 A;  4RCO A;  2D3B A;  5ALT A;  1F2R C;  4AWJ A;  3H1U A;  5E6P A;  2NS5 A;  1WX9 A;  2AQ4 A;  4TQR A;  3AV8 A;  2XY6 A;  1X9W A;  5IOI A;  2FAZ A;  1CQV A;  2AQ3 B;  2WXF A;  2UVR A;  3R8B A;  4ELU A;  3IVF A;  2H3V A;  4RM8 A;  2W03 A;  3JW0 X;  2JR5 A;  1ZQL A;  4F2R A;  1RFK A;  1J0G A;  1XU4 A;  4JV1 A;  3MGH A;  1Q3U A;  3C1Z A;  1MHX A;  1ZD3 A;  4OD0 A;  1UH6 A;  1KLV A;  2WXM A;  4EZK A;  3KBB A;  1J7B A;  2JRI B;  4J9M A;  3QNM A;  4WAA A;  3TL5 A;  3MP9 A;  1VRA B;  3DBH B;  2WGS A;  5BMG A;  2JYT A;  3WK6 A;  2K60 A;  4A3O A;  3DPD A;  4RGT A;  4I2D A;  2XK5 B;  3KLS X;  4N59 A;  1YOV B;  2ZIV A;  2PI5 A;  4P16 A;  2MRP A;  1UZX B;  2RD0 A;  2ZIU B;  2O2V B;  3FIL A;  2R8K A;  1KDH A;  4F93 B;  2HTH A;  4OVV A;  2WFA A;  1JW9 D;  4ICV A;  2ODG A;  4W9I A;  2FMQ A;  2D8C A;  3SR6 A;  4C80 A;  1L0Y B;  3T3N A;  1S5L U;  3Q8M A;  4C8K A;  4RNM A;  4NY0 A;  2IOH A;  4L2Y A;  3PRZ A;  4PZO A;  4ECW A;  1QT9 A;  1COK A;  1E8X A;  2NPT B;  2RMM A;  4TKN A;  4GMV A;  2MA9 B;  3NJT A;  1N5W A;  3ZDD A;  2G08 A;  4BKT A;  5G5H A;  1ARO P;  3ONS A;  4QNL A;  4AUQ C;  5L1J A;  2JZ3 B;  2EDU A;  4FZN A;  3PSP A;  3GIJ A;  3HIL A;  3C28 A;  1HUO A;  2FPL A;  5TIS U;  2BQQ A;  2A1J A;  1OFF A;  3DBH I;  2BDU A;  4LVS A;  1JWA D;  5KG5 A;  1TVA A;  1V49 A;  4HK2 A;  5E6N A;  3OJU A;  5KG7 A;  4D2K A;  4DFP A;  5DB6 A;  2HJ8 A;  4W9C A;  2KFZ A;  3TEY A;  2C2E A;  1L3U A;  5DLF A;  1V1P B;  1SL1 A;  1LKY A;  4LNO A;  2JSV X;  8ICM A;  2DZI A;  2O6V D;  2MA1 A;  2CXY A;  4RGM A;  5DBB A;  1OTR B;  2ZTE A;  1QOB A;  3MFG A;  1XCT L;  3RN9 C;  1BPZ A;  3ZLZ A;  2QSD A;  3AEF B;  2D10 A;  5J0P A;  5J2D A;  2FUH B;  4YD2 A;  1WGG A;  2FBW B;  9ICE A;  5GXG B;  3N7R C;  1ZOL A;  1K8R B;  5KG0 A;  3TIX A;  3C1Y A;  1ZQ1 C;  4ECZ A;  4KLM A;  3HX0 A;  2PVG C;  1GPX A;  5IA7 A;  3B0Y A;  1I4G A;  3IT4 B;  3RNB C;  1T6B X;  1DYQ A;  1YD8 U;  5DBA A;  1PK3 A;  2AQ2 B;  1CJE A;  4I2A A;  3MDC A;  1WYW B;  1ZQZ A;  2H3Q A;  1D8Y A;  4ED0 A;  3DDH A;  3L54 A;  1KL9 A;  4QZF A;  2KFK A;  3SV3 A;  5L1L A;  1I4X A;  1N62 A;  5BMI A;  2G5H B;  2KN4 A;  2WQY B;  5DGB A;  3RH6 A;  4KVG B;  4TQS A;  2W3S A;  1C78 A;  4FXC A;  3KYC D;  2C22 A;  5EOZ A;  1V85 A;  4WUR A;  4YVZ A;  2B6G A;  4ZRP A;  2O6V B;  2KVS A;  3ALR A;  1ZQM A;  1KH0 A;  4KLQ A;  4R65 A;  3ZI4 A;  5DCN A;  2AU0 A;  2HOQ A;  3UPQ A;  2RR9 A;  5JH5 C;  1ACC A;  9ICG A;  4DLE A;  3Q3N C;  4MAC A;  3DBL B;  3RB4 A;  2LPE A;  5LXI B;  4M6W A;  3EPG A;  2FCS A;  3SAF A;  4PT5 A;  4RQN A;  1PK1 B;  1T5X D;  3ZJU A;  1UWX A;  3SI8 A;  4QZD A;  2KDE B;  4NM1 A;  3AN1 A;  1M94 A;  3WK7 A;  4F4Z A;  4W9H A;  5KFY A;  3QX1 A;  4XC2 A;  2P66 A;  1SGG A;  4TMA B;  2LAS A;  1L7M A;  1V97 A;  3QZ7 A;  7ICL A;  1WGD A;  5L95 C;  3RF9 A;  4YR2 A;  3PX4 A;  2KMC A;  3RPF C;  4BBN C;  5J2H A;  1GC7 A;  2NVU I;  2RSU A;  1QKZ A;  3M9N B;  1SE3 A;  5AKG A;  1N56 A;  4ACO A;  4NWI A;  4DQP A;  3N7P D;  3PMN A;  4DHZ E;  8ICF A;  2H3Z A;  3V3X A;  2I38 A;  3N7S C;  5KFS A;  1TBE A;  3V05 A;  2M9N A;  2ZEQ A;  4GXK A;  2XBB C;  2NV3 A;  4ANU A;  2ZIW A;  5AKJ A;  4US8 A;  2MSE D;  4MEY A;  3KHH A;  4DXA B;  3WKE A;  3ECI A;  3KUZ A;  4YN4 A;  1WJ4 A;  2Y1I A;  4NJ6 A;  3AEB B;  4RUC A;  2NRT A;  4F71 A;  1YT3 A;  2R8G A;  1MHH E;  3HM3 A;  2LGD A;  4EEW A;  2DYO A;  3UMG A;  2R18 A;  2N7D A;  4DSL A;  4NJ7 A;  4QZE A;  5KG3 A;  4KLL A;  4BFR A;  3EZ5 A;  4O3N A;  1PVR A;  2YMM A;  4GXJ A;  2JEI A;  4YMO A;  4B9T A;  2KHQ A;  1Z00 A;  5CR0 A;  2KJ9 A;  4AP9 A;  3O65 B;  3Q3O C;  2IGD A;  2K0P A;  3K9P B;  4JIO U;  4DSE A;  4ECU A;  4MF8 A;  3QU9 A;  1KLG D;  4MM3 A;  4KMU A;  3A0H U;  2UVW A;  4ICU A;  2RPQ A;  1FEH A;  5CB1 A;  2FI1 A;  1D8B A;  1UBQ A;  3AEA B;  4W9D A;  4OVU A;  4ED7 A;  4LJX A;  4NLN A;  3DHH C;  1QQ5 A;  4MJS B;  3TBL D;  2LBO A;  2KV2 A;  4KKJ A;  4EFO A;  8ICB A;  2KSO B;  3RT3 B;  3TEX A;  3BJY A;  1BT0 A;  4KGS A;  4NAM A;  3ZW3 A;  1SWW A;  5CJ7 A;  3GII A;  3BQT A;  1FCC C;  2Y9U A;  1RDF A;  1F0M A;  5DG7 A;  1UD7 A;  4WJN A;  4HYK A;  3ZJT A;  5AM1 A;  4DOB A;  3IP4 B;  2WXP A;  3DBR B;  2J0K A;  1V81 A;  4ECQ A;  4E0D A;  3UQ0 A;  2LM1 A;  4UAY A;  1ZQH A;  2PFN A;  2HHQ A;  3TUO A;  2H88 B;  2C7H A;  2F3N A;  2Z7J A;  4TV3 A;  4ECS A;  8ICE A;  2V4I B;  2ZJ8 A;  3CST A;  1NEK B;  3W5V B;  2KDB A;  5J2R A;  1SB3 C;  1KLU D;  1SE4 A;  4CNQ A;  4DSF A;  3N20 C;  1A70 A;  2FDR A;  3T5L A;  3QJZ A;  3NZS A;  4HPL B;  1V38 A;  3VAW A;  3UI3 A;  5KFP A;  2KN7 A;  2UU7 A;  7ICJ A;  8ICG A;  4FS1 A;  3Q8B A;  3RUL A;  5HR7 A;  1S1Q B;  1V5T A;  2BYF A;  2WF7 A;  2E3T A;  5ALL A;  4P0P A;  5ALR A;  4F8R A;  2P35 A;  1SKR A;  1SKS A;  4FS2 A;  5EE3 A;  2MWS B;  3I63 C;  1S0V A;  9ICO A;  4WH4 A;  1DGJ A;  2CRX A;  2HHX A;  1CEZ A;  3N9Y C;  3RUI B;  2NRV A;  3P4R B;  4BVU C;  1SEB D;  2KJ8 A;  1OQR A;  2G4S A;  1GO3 F;  1BPE A;  5BOM A;  2LGY A;  5AI4 A;  4NQK E;  3N30 A;  2KE7 A;  2KD1 A;  5J0S A;  1Q5W B;  4K4I A;  4KSL C;  3U52 E;  2VA2 A;  1O08 A;  2ISP A;  3RJH A;  1V86 A;  2FNJ B;  1E9M A;  4DQR A;  2WXL A;  3WIM A;  4AYB F;  4IQT A;  5H2F U;  3PSF A;  4AP4 C;  2MBO A;  2NBV B;  4DXF A;  3RR8 A;  3GV8 B;  1FNW A;  2MHJ A;  3VTW A;  2KT7 A;  4O5K A;  1MN8 A;  1SJE D;  3RNG C;  1A77 A;  5ALG A;  3KKA A;  2KIC A;  4FJZ A;  1WXA A;  1VR9 A;  3EFC A;  2VZK D;  1AQ6 A;  3I76 A;  1WMH A;  2EMT A;  3RYT A;  1XNS A;  4N9F 4;  4YSY B;  1JXL A;  4IC7 B;  5EE1 A;  1Q3V A;  1Y8R C;  4S0R A;  1TS4 A;  2YB1 A;  3QU5 A;  5HML A;  1DGS A;  3HKZ C;  2LVQ A;  1K52 A;  5AKX A;  3NZU A;  2NCN A;  4RH6 A;  4MM3 B;  3WK8 A;  4MEM A;  2BS2 B;  5BYS A;  3NVY A;  2MBH A;  2E8N A;  4Z6C A;  2LMC A;  3A9J B;  2ZVO A;  1XEE A;  1HJP A;  1RFA A;  4C4R A;  1DOX A;  2W7P A;  3ZVV A;  4R64 A;  4YT0 B;  1IYF A;  3B9J A;  5JU5 A;  3IG3 A;  5KG4 A;  3KWL A;  4NL9 C;  3A4S C;  4IRC A;  4JL9 A;  2AX5 A;  5AI8 A;  5KFM A;  3PZD A;  1D9D A;  2VIX A;  2Y9T A;  4QIW C;  1L8O A;  5KL1 B;  2F1J A;  4O0I A;  1MI0 A;  3HP6 A;  2BTE A;  5AI5 A;  3PVL A;  2YMQ A;  4K7W A;  5FK9 C;  3JPS A;  4O1N A;  1E6E B;  1PUZ A;  3MHS D;  1SZH A;  2ZIX A;  2HHW A;  4YXD B;  2DZJ A;  3PLU A;  1WGK A;  4YCX A;  1E8Y A;  2LYH A;  2BPC A;  1C76 A;  5AIB A;  2NRZ A;  2YLM A;  3SV4 A;  1UCV A;  5A0L A;  5AEK B;  3AE7 B;  4YSX B;  4IM2 A;  2OWO A;  5KFE A;  1X40 A;  1J2M A;  1S9F A;  5AKY A;  8ICV A;  2WXG A;  1BPY A;  4Q45 A;  2BYV E;  3SHQ A;  1N5X A;  5III A;  3PT2 B;  1S97 A;  4Q8E A;  5F9L A;  2HBM A;  2Q4T A;  5AKE A;  2KWD A;  1P0R A;  2PJH A;  3BK2 A;  4HJG E;  3UQA A;  3LYY A;  2DEN B;  3OHB A;  3Q3F A;  3C5F A;  3PTF C;  3DQV A;  2FE9 A;  4W9K A;  1YJJ A;  3C21 A;  1NZB A;  1VZ8 A;  1COO A;  3SDL C;  3PVX A;  4B9K A;  3ZYY X;  4G11 A;  4KZ0 A;  1SIF A;  4YTN B;  3Q3J A;  5ALQ A;  1TFR A;  2WXR A;  3Q69 A;  2M0A A;  3RBE A;  1DK2 A;  5AZH A;  2CR5 A;  3C23 A;  3QXG A;  2V3P A;  3GZN I;  2KHV A;  2Y5P A;  1ZQJ A;  1ESF A;  3Q8P B;  5ALJ A;  3M9O B;  3C2K A;  2WDT B;  3TAD C;  1RYS A;  9ICS A;  1L6U A;  4XGA B;  4TUS A;  2W9C B;  1WWT A;  4ECT A;  2OJW A;  4BKG A;  2EQY A;  2JHD A;  3VR9 B;  3PV8 A;  4K81 A;  2JU6 X;  4IR9 A;  2Z0E B;  3EA6 A;  3ZUN A;  2JY6 A;  5DQI A;  1D5X C;  4A55 A;  4Y2X A;  4NZL B;  2MP2 B;  5KFI A;  5KTQ A;  3ORY A;  1T3N A;  2XVT A;  2KK8 A;  3FYH A;  2CPR A;  5KFQ A;  2HVI A;  2KN5 A;  3RJK A;  1WE6 A;  4IQW A;  2F8K A;  4F4K A;  1RYJ A;  2ASJ A;  1P7E A;  2HMX A;  1R4M B;  1YMH E;  4MH0 E;  2KLG A;  1IG6 A;  5KT4 A;  2KMA A;  1DXS A;  3RNE C;  4OJL A;  3RBD A;  1N61 A;  5KL8 B;  1S0M A;  1OGW A;  1MG4 A;  3SU8 X;  3CSF A;  4C56 C;  1KOT A;  1L4D B;  4DFJ A;  3I3T B;  1T0Y A;  2QB0 B;  2HDO A;  5AM4 A;  1NK0 A;  4KLO A;  4XUS A;  1K51 A;  2VH1 A;  3MTN B;  1QSL A;  4M0A A;  1FXA A;  9ICH A;  4KLH A;  1EUV B;  1T7P A;  3VVW B;  2KZM A;  2OCE A;  3NG0 A;  2H5X A;  3BWU D;  5E79 U;  2R8I A;  2PLP A;  1WE7 A;  3QWZ B;  5DQG A;  1BXT A;  2BW2 A;  1GC6 A;  5KAF U;  4O3P A;  1WG8 A;  5AI6 A;  3M9M B;  3BS5 A;  4R8U B;  1ZQT A;  1J7C A;  2JZB B;  8ICY A;  2WWZ A;  3W1S A;  4UB5 A;  3GDX A;  4IG7 B;  2K6Q A;  3M7D A;  1FFU A;  3RJJ A;  3RB6 A;  4GDL A;  4FJV B;  2FIF A;  2Y1J A;  2DBY A;  2HI0 A;  1NEN B;  1YQ3 B;  3FAH A;  1PFD A;  2W82 A;  2L7R A;  4M9H A;  8ICN A;  2VRR B;  4NM2 A;  2G5I B;  1C7Y A;  5JHB A;  3P1M A;  1NK7 A;  3A0B U;  1PGB A;  4ZHP A;  1RLF A;  1UEL A;  4ELV A;  2B3A A;  3AEC B;  5FR3 A;  1HTO A;  3RJI A;  1XQQ A;  3PW5 A;  1L7Y A;  1FEZ A;  1IBX A;  1JRU A;  4M04 A;  2J0M A;  2BPG A;  3MR3 A;  1TKG A;  1I7H A;  5GMV A;  4K1R B;  1Q1O A;  4RQ8 A;  4O3Q A;  4B6J A;  3MFH A;  4GGQ A;  1K5O A;  4UB3 A;  3IV6 A;  1NYQ A;  1UA1 A;  1YQ4 B;  5J0U A;  3G6X A;  2AGQ A;  1D9F A;  3NAS A;  2ZIU A;  1FNV A;  4IWO A;  4A20 A;  4OVZ A;  3QQ8 B;  4O3O A;  1JX4 A;  5IAA C;  3UQB A;  4ZHO A;  4FN2 A;  5J0T A;  2F44 A;  3H8H A;  3M1Y A;  4DL5 A;  4DL3 A;  3IAS 1;  1UT5 A;  4P4P A;  4HAI A;  1TY2 A;  1X1M A;  1YJ1 A;  3PR5 B;  3DVG Y;  4S17 A;  4QZG A;  1A0P A;  1RRB A;  1ZQX A;  2JH7 A;  4KLE A;  4I2J A;  4NNJ B;  4PGX A;  3EUB 2;  2C7M B;  2RRD A;  1NJW A;  2BWF A;  3Q8L A;  2DUY A;  2M17 A;  3SQI A;  3ZDB A;  9ICC A;  3VH4 B;  2GLE A;  2YVC A;  2YML A;  2GO7 A;  4M0W A;  4IC9 A;  4B9M A;  2JV3 A;  1WXS A;  2W9C A;  2FPM A;  3CYM A;  3AMZ A;  3ISB A;  3TAN A;  1ZQR A;  2R8J A;  2JF5 A;  2QCZ A;  2WU5 B;  3GS2 A;  2K4H A;  2PE9 A;  4IKG A;  3ZD9 A;  1LQB A;  3QUQ A;  5D49 A;  3AI5 A;  1TZ1 A;  3ZIM A;  1ISN A;  5L9X A;  4UB8 U;  1HZ6 A;  3SZ2 A;  3HVD A;  1ZD5 A;  5C2T B;  4IW0 A;  3VCB A;  1WGH A;  1BVS A;  5LNK 1;  5EE0 A;  3I1Y A;  4EUT A;  1ZQI A;  4NLK A;  3RNC C;  2C60 A;  1N48 A;  4GDK B;  4C0Z A;  1VZ6 A;  5ALM A;  1LM8 B;  2DZK A;  1U49 A;  5DPS A;  3UIN B;  3TEW A;  1WRD B;  1WXV A;  1GJZ A;  4ZRI A;  4KTQ A;  3PO5 A;  3P2B A;  1KJT A;  1ED1 A;  4MFC A;  7ICH A;  3AM9 A;  3ZXV A;  4WQO B;  4US9 A;  2XCA A;  1AAR A;  2KTR B;  1S0N A;  1TS2 A;  2WF8 A;  1WM2 A;  4B95 A;  4KLI A;  2KJR A;  4PGY A;  4YXM A;  2FLN A;  1ZOY B;  4YMM A;  3QAQ A;  3M8R A;  1E90 A;  3M95 A;  3GZF A;  1PGX A;  3CRX A;  2J7Q B;  4HPM B;  2N9L A;  5BOL A;  2OJR A;  5KFL A;  3QA8 A;  9ICJ A;  2R2O A;  2ALZ A;  4KLG A;  2KQ4 X;  4ED8 A;  3VR8 B;  4UBB A;  3HKZ F;  4HRS A;  3OWE B;  4W9E A;  1KFD A;  3S2A A;  3F2C A;  2FCQ A;  5F3X B;  1ZQW A;  3JSV A;  4HEA 1;  3LDA A;  2ZJA A;  3AL0 B;  1STE A;  3OGU A;  3AXC A;  3RH5 A;  2LHT A;  2HTM E;  3P4P B;  3ABV B;  2DX5 B;  1JRP A;  5L83 A;  2K9X A;  4IWP A;  4UAU A;  2PEA A;  1WZ0 A;  2H3F A;  3T79 A;  2C2D A;  4PGQ A;  4Q44 A;  1F5S A;  2IYD B;  2ZUB A;  1IPG A;  2W43 A;  1XSL A;  3L5K A;  2IOF K;  2V1Y A;  1B1Z A;  4FHJ A;  3VUX A;  1SV4 A;  2IZV B;  1FMA D;  1LGR A;  1Y88 A;  2OH2 A;  9ICW A;  4HKQ A;  5AM2 A;  2EEL A;  1ZW7 A;  2XIC A;  4G3I A;  2CHZ A;  3TFR A;  1C1Y B;  4I2H A;  4M9L A;  4GXI A;  4JPS A;  2BBC A;  3S6J A;  3PZ8 A;  4GIB A;  1EWC A;  2RDI A;  2D5G A;  4LNN A;  2E8O A;  4KN7 A;  3KZI U;  2EAN A;  7ICU A;  3Q8F A;  5AM3 A;  2EAP A;  2ZW1 A;  1WY8 A;  2LYB A;  2BB6 A;  4CDG A;  2IJ0 A;  5E6J A;  4WWN A;  2L05 A;  4M02 A;  3O0F A;  1C77 A;  3C0R B;  2JXT A;  4F5N A;  2K6D B;  2Z59 B;  5ALO A;  4KMO B;  4KIK A;  3AE2 B;  1P98 A;  1UUP A;  3Q14 C;  2YTU A;  3A9K B;  3HWT A;  2EKE C;  4IWQ A;  1NYR A;  1JQ4 A;  3G6V A;  2CJN A;  3ED5 A;  4P1C C;  8ICW A;  5E6O A;  5KFW A;  3PR4 A;  5LXH A;  2YMP A;  4LK0 M;  4RT2 A;  1KW4 A;  1NJX A;  2BCU A;  1V1O A;  2KC1 A;  5GTI U;  2QJL A;  4OHJ A;  4QJF B;  2N1W A;  2D11 A;  2MQJ A;  2BYT A;  3AU4 A;  1WRI A;  3PSI A;  3PRM B;  4JLC A;  2YB4 A;  3OAW A;  4BGD A;  3VXW A;  1KRH A;  3OJ3 A;  1SZP A;  1J8C A;  4P0P B;  1QLB B;  3NRW A;  1MQ2 A;  1EM7 A;  2ONQ A;  4JX1 C;  4P6V F;  1JIH A;  2N9P C;  1CMX B;  1BPX A;  4LCD E;  4CGZ A;  1L7P A;  4FBT A;  3D2Q A;  7ICN A;  2Y3A A;  2KQ7 A;  3QX7 A;  1SJH D;  3EFU A;  4IOI E;  4PYZ A;  4MEL A;  2WXH A;  1VLB A;  3MC8 A;  4AYB C;  1L7O A;  5HMM A;  2IHM A;  1QCK A;  2FLP A;  4M47 A;  5AK5 A;  3WU2 U;  3M63 B;  2WB1 C;  3QU7 A;  1UF0 A;  4JGH B;  5J0Q A;  1XD3 B;  2IPK D;  5DPW A;  2PW9 A;  2H3I A;  4C7Z A;  4LJP B;  3ZNG C;  1ZQU A;  1AYF A;  5ALW A;  3E2E A;  3G6Y A;  3DCG A;  2GMI C;  2PIA A;  2W9B A;  4B0M A;  1ET9 A;  5KT2 A;  1V8C A;  4M2Y A;  1QQ6 A;  1AN8 A;  5KFR A;  3UXP A;  1WJN A;  2W9B B;  3QYP A;  5AIC A;  4DO9 A;  3Q2A C;  2K4I A;  5IIK A;  5IIO A;  3AE9 B;  5KFF A;  2A3V A;  9ICP A;  3GP7 A;  3KW5 B;  1XLO A;  5AKI A;  5G5G A;  3C2L A;  3AE4 B;  3H8J A;  4LZG A;  5L1I A;  1ZQB A;  3APD A;  1E10 A;  4JB3 A;  2RDJ A;  1P3Q U;  4CCH A;  2J6T A;  4WIP A;  1SWV A;  5KFB A;  3QU2 A;  2L83 A;  1D5M C;  2NTT A;  2ZG6 A;  3K1R B;  2KHW B;  1Z00 B;  3DVN U;  4B9N A;  2CN1 A;  3DDC B;  3ZD8 A;  1HEZ E;  5BO4 B;  4EEN A;  1FIQ A;  3H40 A;  1UA0 A;  5HKH A;  1Z19 A;  1YJI A;  3LYS A;  3EYZ A;  1WJ6 A;  4YSZ B;  2MU2 A;  4F72 A;  2W04 A;  2ZW0 A;  2TSS A;  4RGN A;  1K50 A;  2GBK A;  1NJZ A;  1FPY A;  2KWU B;  1ZQG A;  4LNK A;  5HG2 A;  2J52 A;  1YN3 A;  4OZA A;  1KKX A;  3DBL I;  2MRL A;  4PJ0 U;  2ASD A;  1XT9 B;  3R7R A;  2MEK A;  3AU2 A;  1ZJM A;  3ZTC A;  4O5C A;  2WX1 A;  4UB4 A;  3A9K A;  3GE3 C;  4B9S A;  4WQM A;  2V0G A;  2N0S B;  2WHI A;  3U4E G;  4ED1 A;  2B0C A;  3BS5 B;  4Q43 A;  3AE5 B;  4I6N B;  4LTU A;  2QKQ A;  4ZRJ A;  1UPH A;  2HHU A;  2QC8 A;  3L10 B;  4I6P A;  3B0A A;  3ZO5 B;  1UT8 A;  2BKE A;  8ICK A;  3BY4 B;  4P1B C;  2K4E A;  8ICT A;  4DQI A;  3IN5 A;  3P42 A;  2WB1 F;  1K1Q A;  5KG6 A;  3N97 B;  2MBB B;  2D6F C;  3W5U B;  2ESE A;  5DG8 A;  3TI0 A;  4YG2 A;  2QB0 A;  2JH1 A;  3R2T A;  2KOB A;  1NK6 A;  3SEI A;  2RQ5 A;  4KLD A;  4C8M A;  3I57 A;  2EZX A;  3WKC A;  1AWD A;  4C4V A;  2L3Z A;  1TY0 A;  1CZP A;  5CHG A;  1C20 A;  1N6Z A;  2AEH A;  4AQ7 A;  3B0X A;  1JXE A;  1KFT A;  5EDS A;  2HSZ A;  5AI9 A;  4Z6F A;  2BS4 B;  2BQ3 A;  4BBN F;  4A90 A;  5IKC M;  5JZE B;  1TAM A;  3SEB A;  3Q8K A;  4H2A A;  2JEF A;  4BKS D;  5CA7 A;  4EX7 A;  2ZVN A;  2WHE A;  4LNF A;  4DS4 A;  9ICT A;  3TEZ A;  4DSJ A;  3LWL A;  2BGW A;  5D3I B;  5AUK A;  3EWA A;  3PX6 A;  1ZQS A;  1QZE A;  2FCM A;  3EGR A;  3KUD B;  1SV0 C;  5J0X A;  2XI9 A;  3TAR A;  1D5Z C;  5ALS A;  4C7Y A;  2J4X A;  5KAI U;  3L13 A;  4DOA A;  1EWY C;  3ETR A;  2YEP F;  3DHG C;  3H0M B;  1WX7 A;  5KFC A;  3PY8 A;  2MX2 A;  2L5Y A;  2A4Z A;  1V6E A;  4IRD A;  3HW8 A;  1IGC A;  3D2N A;  4TQ1 A;  5DPR A;  1EF1 A;  2YQE A;  3M8S A;  4YR0 A;  1JMS A;  3MGV A;  3NY5 A;  3ZTD A;  5KFD A;  2VA8 A;  9ICX A;  1D8L A;  1M6Y A;  1Q46 A;  2PKE A;  1TTN A;  3MC9 A;  3PHW B;  4N58 A;  3BQ7 A;  3V7L A;  3HPO A;  2BZF A;  5AM5 A;  1QIL A;  1VJ5 A;  1FM0 D;  5KFU A;  2MLB A;  4NLZ A;  1MVK A;  3A1Q A;  2DFL A;  2JZZ A;  1LB2 B;  4UB2 A;  1JWM D;  4CHK A;  3NVW A;  1RAX A;  5ALE A;  3PZP A;  4K4G A;  2C7N B;  3KYD D;  4MFA A;  2JEJ A;  4A9A A;  4Y2T A;  4RQ1 A;  4CO7 A;  3TAD A;  2ZIX B;  8ICJ A;  1GUA B;  4XDD A;  2DPI A;  1TJE A;  3L0W B;  4DHJ B;  2W9N A;  4I27 A;  4DL7 A;  1F52 A;  2J6U A;  2JUO A;  3ZDM C;  1BPB A;  2BS3 B;  2V4R A;  3IHP C;  2LD9 A;  2N1V A;  4C4V B;  4EZL A;  3PX0 A;  5H92 C;  2FMP A;  4J9Q A;  8ICC A;  2GRI A;  2BQR A;  2PVO D;  2PFQ A;  4F4Y A;  2FE8 A;  5D4B A;  4UBC A;  4MH8 A;  5ALY A;  4XRH A;  1IGD A;  3Q6B A;  2WS3 B;  3AQE A;  4RQM A;  1WSP A;  3T9L A;  2H89 B;  3QIJ A;  2OXO A;  5DG9 A;  4F3O A;  2L00 B;  2QHO A;  3R66 C;  2I1Q A;  4HKZ E;  3WKD A;  4ECR A;  3URY A;  3KFU F;  2O2V A;  4K7S A;  2DL0 A;  3NS8 A;  2V4L A;  3R3M A;  1LFD A;  2J42 A;  7ICK A;  2PKO A;  4YFK A;  2KDF B;  2MAX A;  3N4M B;  3H7I A;  3CNH A;  1P7F A;  4NPN A;  4TUU A;  2N1R A;  3VDZ A;  5CRX A;  1KQQ A;  3Q8Q B;  3BYT B;  1RWS A;  3BVM A;  2X8X X;  2PMV A;  4ASW C;  3LB8 C;  3PRE A;  1MA7 A;  5BPC A;  3WK9 A;  4DHZ B;  4RPX A;  1U47 A;  4WWM A;  1H8C A;  1BML C;  4L23 A;  1JML A;  1SXE A;  4M9J A;  2KWV B;  2EZY A;  3DWG C;  4DDI D;  5TR5 A;  4RQ0 A;  1RPL A;  3V72 A;  3KKA C;  3DVG X;  1YQB A;  5KFJ A;  2R8H A;  1NKE A;  4JWN A;  3Q8E A;  5FR6 A;  2KVC A;  4I29 A;  4U6P A;  1X6J A;  1AW7 A;  2WF9 A;  3H8S A;  3ZJV A;  4P4M A;  4DL2 A;  2N9K A;  4PS7 A;  5EWF A;  4AOF A;  4OZC A;  2JZB A;  4EX6 A;  1ZQN A;  2ZJD A;  2FPK A;  1F44 A;  1QTM A;  3PNC A;  4QW8 A;  3FM9 A;  3H6N A;  2JGA A;  1EF5 A;  1N60 A;  5L1M A;  1R4N I;  1HA5 A;  2HHS A;  2JX5 A;  1X2I A;  3B1L X;  4PHD A;  1D3Z A;  3EHV A;  1NK5 A;  9ICF A;  4PK1 A;  3Q8S B;  7ICM A;  4UAR A;  2LRW A;  2MH7 A;  1YNT E;  5LLI A;  2QAR A;  4I2F A;  1PYW D;  1KTQ A;  5J8Y A;  2JVC A;  5KT6 A;  1PZN A;  1T8E A;  4FUL A;  1RQL A;  9ICM A;  2B76 B;  3BIN A;  4HDO A;  2IOF A;  9ICK A;  4GFJ A;  5J2C A;  1ECW A;  2HCF A;  4CF5 A;  1X66 A;  1ZD4 A;  2BDP A;  2QB1 A;  4Y2U A;  3R7Q A;  1TK5 A;  3U8Z A;  4RNO A;  3T5K A;  3JYU A;  1HXY D;  3JPN A;  1OUQ A;  1T0R C;  2MP2 A;  1HUZ A;  4EEK A;  3ZXR A;  5BYR A;  3T5J A;  1X9S A;  8ICU A;  1WR1 A;  4RQ4 A;  2WNM A;  4C8L A;  3AUO A;  4DBG A;  4KX5 A;  3IDW A;  4Y2V A;  2UVV A;  3AE6 B;  3Q8C A;  4Y2Q A;  1KBU A;  2IBK A;  3GB1 A;  4MJS A;  3VC8 A;  1ZQF A;  4DF8 A;  3WAN A;  2K8A A;  2N7J A;  2F77 X;  3ICX A;  4ZYN A;  2I6X A;  2KNJ A;  1URJ A;  3P4Q B;  4BWJ A;  1TGZ B;  2OM6 A;  3MAB A;  1SSN A;  1SXT A;  4A8X C;  1GB1 A;  1CK1 A;  2CU1 A;  2EZZ A;  1KLN A;  1WGR A;  1WXQ A;  4UAS A;  4KIK B;  2WTF A;  3V6C B;  2JMG A;  4J9R A;  4F5Q A;  2GOL A;  1E8W A;  3MR2 A;  4J6I A;  4DCC A;  3QCA A;  7ICT A;  3RNA C;  2MJE A;  3APC A;  4IM0 A;  3MDA A;  3RB3 A;  4IS7 A;  4FZM A;  2XCP A;  3TQ1 A;  3QEB Z;  2BCR A;  8ICR A;  2M56 B;  4HCP B;  1NVI D;  2BKR B;  1WGY A;  1WF9 A;  1Q8K A;  1HQR D;  8ICP A;  2FLL A;  1BUI C;  1I4H A;  1WM3 A;  4GSW A;  2KKP A;  1WR6 E;  4MSQ B;  3J81 j;  4FE3 A;  2F1I A;  2N9E B;  2LYA A;  1IIP A;  2HD5 B;  4HVB A;  4M9N A;  2KMD A;  3F53 A;  3L08 A;  3NVZ A;  2PMZ C;  7ICV A;  3AUL A;  5JUM A;  4PYU A;  2PMZ F;  2PPH A;  3OLM D;  4HPP A;  3UIP B;  2LGI A;  5ALD A;  3KWV A;  4MSM B;  3UXN A;  5IIN A;  3DV9 A;  2LXC A;  8ICO A;  5B66 U;  9ICB A;  2KO3 A;  2KK0 A;  2N4F A;  2A1A A;  3K9O B;  2IO3 B;  2FCN A;  1B9R A;  1MSW D;  2P6R A;  3H4B A;  4CRX A;  4YTM B;  4RF0 A;  2A19 A;  3K4G A;  3AU5 A;  2XY5 A;  1SE2 A;  8ICS A;  1TT5 B;  5CHW A;  3F5A A;  4FLH A;  3QK0 A;  4A3P A;  1RYR A;  4BKS A;  3VHT C;  4Y2R A;  2KXJ A;  2PXI A;  4C4S A;  2DZM A;  2VZK B;  7ICS A;  4O3S A;  1NK8 A;  4I2G A;  1S8O A;  2G1E A;  4II3 B;  2KFJ A;  4II2 B;  4MDK E;  4O3R A;  5DQH A;  5G55 A;  4BUG A;  3GV5 B;  3MR6 A;  2IA6 A;  4DHJ D;  3ZDA A;  4XQ8 A;  5JTI A;  3A1Q B;  3JPO A;  2V9H A;  3BZD B;  4UQG A;  1CI4 A;  4CE6 A;  4EBE A;  4J9P A;  1Z3E B;  2I1K A;  2QDF A;  2VKQ A;  3L17 A;  4Y2Y A;  1GNU A;  4FA6 A;  5B5E U;  4ZYS A;  1SE9 A;  3NOB A;  4R3D A;  1RXW A;  4P2H A;  2BGF A;  3MJ5 A;  2INC C;  4TQ0 A;  5DLG A;  2WX0 A;  1A5R A;  3QAR A;  2J0J A;  1EU4 A;  7ICO A;  3IHQ B;  2W8L A;  4J9S A;  2AL6 A;  1DOQ A;  1JI7 A;  1JUD A;  4E71 A;  4BJQ A;  3THV A;  3ZDC A;  4KV2 A;  4XYC A;  1A76 A;  1Z1V A;  5FP0 A;  2DYM A;  1SL2 A;  1JAL A;  5KFK A;  2ATL A;  1BNP A;  5D6J B;  8ICA A;  4B0E A;  2D3D A;  2W9A A;  3V6J A;  2AGP A;  3V60 A;  1TS5 A;  2DGZ A;  3OSN A;  1H38 A;  2IHN A;  4M0W B;  4KDI C;  1E7U A;  1I4R A;  4X57 B;  2B21 A;  1F77 A;  1BGX T;  1FNU A;  1SBB B;  2RDH A;  2ACZ B;  3ONN A;  5HNK A;  4JV0 A;  3X0W A;  1N63 A;  3SD7 A;  4LNI A;  4TUQ A;  1D4B A;  1B43 A;  4GB9 A;  3AH7 A;  1I42 A;  3LVV A;  3VRB B;  4PZN A;  4NJC A;  3SEN A;  2L52 A;  3VTV A;  3RRH A;  1JRO A;  2BT6 A;  3T5H A;  4QWE A;  2JRZ A;  2IND C;  3N1Y C;  2G3Q B;  2NO4 A;  1ZET A;  2JQR B;  2KVR A;  1CRX A;  5DDM A;  1PDX A;  4IQU A;  5CEH A;  3QEA Z;  3F2B A;  2QAR B;  5BMH A;  3I28 A;  1EO6 A;  4FHK A;  5L1K A;  5DB9 A;  5AHX A;  2VA3 A;  2W8K A;  2OOB B;  5JHA A;  4GU2 A;  2KSO A;  1ZRM A;  2DAF A;  3MR5 A;  2HHV A;  2JXX A;  4EYI B;  1L6V A;  4RZR A;  2BWE S;  3VUY A;  4I6L B;  1L7N A;  4KX3 A;  1UHU A;  5EWE A;  1TS3 A;  1TZO A;  4GOC A;  3KVF B;  4F8C B;  2R2Q A;  1QOF A;  3BII D;  4KKI A;  4FO6 A;  2HW3 A;  2NMQ A;  3HRD D;  5HHH A;  2KMM A;  4PHA A;  1LVH A;  1WX8 A;  1FRR A;  1XO0 A;  3DHI C;  4K3C A;  1S3S G;  2Q5W D;  2HOF A;  2LVO A;  2L8J A;  1R4M I;  5CHF A;  2DKZ A;  4JMU A;  2AQ1 B;  3C5G A;  3GIK A;  2AGO A;  1EU3 A;  2GBN A;  2ZZP B;  3JPP A;  5CHV C;  3UGB B;  3A4R A;  4UAT A;  5KFG A;  4GLX A;  1YIW A;  1WFY A;  1V80 A;  1YZ6 A;  5CTR C;  5AI0 A;  2JEG A;  4JWS C;  3RD2 A;  2HE7 A;  3ZDE A;  1V5O A;  3N1X C;  3WAP A;  2OHF A;  1QF6 A;  5KFA A;  4W9G A;  1CUK A;  4YR3 A;  5TSS A;  1C4P A;  3KOO A;  5EE9 A;  1ZDV A;  2LI5 A;  3LXF A;  2LKY A;  3OJ4 B;  2ZCC A;  2W54 A;  2WAQ F;  2CKH B;  4UW9 A;  4ARI A;  5CWR A;  1IP9 A;  3NS1 A;  2D3A A;  3NRZ A;  2INN E;  2WXQ A;  3L16 A;  4L1B A;  4R8U A;  1YN5 A;  5KNI A;  3GOE A;  1U9L A;  1WXM A;  3V6K A;  2K8B A;  2LUM A;  4P7I A;  1QH9 A;  4GXB A;  1L5P A;  4G0N B;  4PPX A;  2KWC A;  2KIW A;  3IBE A;  4FJY A;  4WWP A;  3VRA B;  1G6J A;  2DF4 B;  3H4D A;  2AXT U;  2KP7 A;  1LV5 A;  4K4H A;  1DOI A;  1NNL A;  5D94 A;  5AIA A;  2F76 X;  2V9W A;  2M8S A;  1MPE A;  4R66 A;  1JWS D;  2KAC A;  1IM4 A;  4M6W B;  4YXJ A;  4HDQ A;  2IY1 B;  4QZI A;  2WDQ B;  3VUW A;  1DK3 A;  5AKK A;  2KKV A;  4RQ3 A;  3VH3 B;  4E74 A;  3B08 A;  1ZD2 P;  3HJE A;  4ICA A;  2ZCB A;  5HHD G;  5J2K A;  1SKW A;  3ZNH B;  4B9V A;  1B0X A;  1E5W A;  2M19 A;  4B6W A;  4QWA A;  7ICI A;  3DOW A;  2A5U A;  2KOX A;  3RI7 C;  2O6V A;  3HM6 X;  5ALH A;  2M4N A;  3D6J A;  4RGO S;  4NY8 A;  1B22 A;  2MW5 A;  2KYW A;  1I35 A;  2KZZ A;  5AKZ A;  3MFI A;  1U48 A;  3V6H A;  9ICL A;  2WU2 B;  3WKA A;  3BDP A;  5ALZ A;  2IO2 B;  2L76 A;  2V3S A;  3PZ7 A;  3T8M A;  3NGD A;  2I1J A;  4ITK A;  3W1S C;  4R63 A;  2GH1 A;  5HFY A;  5JRT A;  3BZC A;  2CS4 A;  3WA0 A;  4FBU A;  3AEE B;  3N32 A;  2G09 A;  5KFZ A;  3PO4 A;  1XO1 A;  1XSP A;  3QUB A;  2AJQ A;  1KN5 A;  1Z4O A;  1GOZ A;  4FBJ B;  2DQN B;  4KN4 A;  1NJY A;  5J2A A;  3UQ2 A;  4KDL B;  1ZGU B;  4UDU C;  4DS5 A;  3TCA A;  9ICN A;  2Y0S F;  3KQ4 A;  2WDR B;  4ED6 A;  1UBI A;  1OXJ A;  1MC8 A;  2BHN A;  3UM9 A;  3RRG A;  4W9L A;  2RDB C;  1XWL A;  4OJ6 A;  1ROE A;  2LWP A;  5AZF A;  1KSP A;  1YN4 A;  1FRD A;  4UAZ A;  3KD3 A;  2QLT A;  4DDG D;  7ICF A;  3H0R B;  1XF5 L;  5DKW A;  3UMC A;  4DFK A;  1L3T A;  2KTQ A;  2LZ6 A;  1R7S A;  1UNS A;  4PHE A;  4BDP A;  4REZ A;  3DVN V;  2EAO A;  8ICX A;  1P9D U;  4YP3 A;  1PQS A;  3DWM A;  1F2R I;  3TJP A;  5IN7 A;  3O13 A;  2KIV A;  2RP5 A;  5DB7 A;  4ZRK A;  3CIR B;  3QUC A;  4I2B A;  7ICE A;  1V9P A;  1T0Q C;  7ICR A;  5IIM A;  4WWO A;  3GU3 A;  1I4P A;  3CF6 E;  2RPV A;  5KFV A;  4Z6E A;  3PGE A;  2KVZ A;  2V4Q A;  5KG2 A;  2KZ3 A;  5ALV A;  4QW9 A;  3NUH B;  3WCQ A;  2GWS A;  1HTQ A;  4PH5 A;  3IG5 A;  4XWT A;  3B2F A;  3RAX A;  3ZQ4 A;  5EWG A;  2MUT A;  4F5P A;  4BAX A;  5IP4 D;  4OJ5 A;  3APF A;  3GFK B;  3PST A;  5CX3 A;  4KGT A;  4YD1 A;  1WMH B;  3SYZ A;  1DOY A;  2EMS A;  2XO7 A;  3EPI A;  3ETL A;  4DWF A;  5D3D A;  1SL0 A;  1MJD A;  3LDZ E;  5C0Y A;  2Y5C A;  3QC8 B;  1ZDX A;  1JWU D;  4C4T A;  1L6N A;  2KTF A;  1C4C A;  3PSE B;  1VCB A;  2LEK A;  3ZGZ A;  3JSV B;  2D3G A;  5ALK A;  2WXJ A;  3DBR I;  2G06 A;  4F50 A;  1DRG A;  3RMK C;  2HHT A;  1EXN A;  2ZTC A;  4HWI B;  5J29 A;  3FIL B;  3Q8A A;  4XE0 A;  5ALI A;  5AUI A;  4MEX A;  2RLT A;  1L0X B;  2AWT A;  2YEP B;  2M1M A;  5HP4 A;  3TSS A;  4UB6 U;  3MHZ A;  2PI4 A;  9ICR A;  5D7G A;  5J2E A;  2J53 A;  4NAW A;  3FC4 A;  4QZ8 A;  1ZQO A;  4I28 A;  2GLS A;  2I2Y A;  5F9N A;  2MCN B;  2YY6 A;  1GB4 A;  3I9V 1;  3V7K A;  1XLQ A;  2E6X A;  2K8C A;  3R9K A;  5TZV A;  5J2B A;  2BCV A;  1NZP A;  4ED2 A;  4ELT A;  4YQW A;  5ALX A;  4JUZ A;  4OO1 J;  1XO3 A;  4JQW C;  3M3J A;  2KDM A;  2RDG A;  2LRU A;  1KRP A;  4GIV A;  4ANV A;  4RPZ A;  3RR7 A;  2K8H A;  3Q8R B;  2GBJ A;  1VZ7 A;  2BCQ A;  4O5E A;  1XLP A;  4URK A;  4XX5 A;  3RJE A;  4O9M A;  5ALU A;  2C2R A;  2W11 A;  3N28 A;  2LVP A;  3PW7 A;  5HI1 A;  3PRP B;  2SAK A;  2MBQ A;  1TE2 A;  2NBW B;  2KG5 A;  2XN9 C;  3IAM 1;  4FFD A;  4F1S A;  5J2G A;  2KJH B;  8ICQ A;  5KFO A;  1IUE A;  3MC1 A;  4C8O A;  2HOI A;  2WDV B;  3U7Z A;  2K8C B;  4U7C A;  1Q10 A;  2LXA A;  2Z0D B;  1UWM A;  1J2N A;  4OJO A;  3GQC A;  2RGF A;  3IG8 A;  1ZUD 2;  1KFY B;  2KAJ A;  2WAQ C;  4OJP A;  9ICA A;  2IY0 B;  1GG3 A;  2L32 A;  4ED3 A;  1SF0 A;  4NAW B;  3U7D A;  3C29 A;  3QU4 A;  2HBJ A;  4P4O A;  1SV0 A;  3B2G A;  1B4F A;  2K89 A;  5J0Y A;  4RNN A;  4KLJ A;  4OW0 A;  4WJP A;  3BQ2 A;  5KFN A;  2IO1 B;  4XZ4 A;  3F2D A;  2BR0 A;  4QZB A;  2WXN A;  2LHD A;  4KGR A;  3W1Y A;  1O03 A;  1TK8 A;  3ZRC A;  3VQI A;  5G2N A;  3ZNZ B;  1NK4 A;  1WWV A;  1SGH A;  4QIW F;  3BQ0 A;  3PW0 A;  2ES6 A;  2MJ3 A;  3L3F X;  3DEE A;  3W2D A;  3UXO A;  1T94 A;  1OQY A;  1IBX B;  4RQ2 A;  1J97 A;  4TUR A;  1FO4 A;  4BX9 C;  2JPH A;  2KLC A;  2MUT B;  4B9U A;  1S0O A;  4NL9 A;  3KH0 A;  4HXD A;  1UGM A;  3ZNI D;  3KHG A;  2VH2 A;  5J2J A;  5HR6 A;  9ICV A;  2W9M A;  3V62 A;  7ICQ A;  3WAM A;  1L4Z B;  4GDL B;  2WF6 A;  4RU9 A;  2DPJ A;  2LGS A;  3OPX A;  4J9O A;  1Q0W B;  2KX3 A;  5AKH A;  2PTL A;  3RZW C;  3SAG A;  1ZE3 D;  1XS9 D;  1KM7 A;  2R61 A;  1MQ3 A;  2E1F A;  2I9G A;  4BXO B;  1TKE A;  2HBK A;  1ZQK A;  2W55 A;  4RQ6 A;  2MJD A;  4FAD A;  2EKI A;  1FFV A;  3RAQ A;  2BB5 A;  4C00 A;  4AS1 A;  4NXZ A;  3H0L B;  5J0O A;  3KHR A;  4HCN B;  2KKC A;  3HVZ A;  4J03 A;  4Y2S A;  2WLB A;  5T8I A;  1WZ3 A;  1ZQY A;  1TAQ A;  4F5O A;  4GC6 A;  4DQS A;  2D3C A;  4ECX A;  1X42 A;  2G9H D;  3TKA A;  2GI9 A;  4MF2 A;  2SEB D;  1ZPS A;  4RQ7 A;  1I4Q A;  3J9C A;  3SD5 A;  2ZNV C;  3AU6 A;  1YX5 B;  3K1Z A;  2G07 A;  3BS7 A;  4YMN A;  2ASL A;  2JXJ A;  3OTQ A;  4C8N A;  3LWM A;  2XEW A;  4EOY A;  4ECV A;  3ZKJ C;  4OZB A;  4DLG A;  1FXI A;  1MG8 A;  3RZF A;  4Y2P A;  1OW5 A;  3GIL A;  4Q8F A;  1KEJ A;  1NBF C;  2QMT A;  1U4A A;  2XID A;  2QIL A;  5K4L A;  1J19 A;  4ANW A;  3AEV A;  2ZUD A;  4UAW A;  2KAN A;  5DPT A;  4YWG G;  4PL2 A;  4RFB A;  1TKY A;  2BPS A;  3U30 A;  3UMB A;  4F7Z A;  4M00 A;  4PS3 A;  1ENF A;  1ZRN A;  4K7U A;  4MT5 A;  1P1A A;  2HBL A;  2FID A;  4P0Q A;  8ICZ A;  4DSI A;  5DDY A;  3T3F A;  1NI2 A;  1S76 D;  3UF8 A;  3PW2 A;  7ICP A;  5KT3 A;  5ALP A;  1XXG A;  4ZH4 A;  1RXV A;  4DQO C;  2D07 B;  2VAN A;  3FDS A;  4I2C A;  1JCK B;  3AED B;  5ALF A;  1X6I A;  4BWM A;  2K25 A;  1T0S C;  4GLS C;  3M6Z A;  2ZXH A;  5DGA A;  5AZG A;  1J7A A;  2LI6 A;  2JT4 B;  4EZ6 A;  2ZNV B;  4XDC A;  4ECY A;  1C79 A;  3BK1 A;  4MGY E;  4OCZ A;  5KT5 A;  3QUT A;  5JXV A;  3JVZ X;  1RM6 C;  4UB1 A;  1NDD A;  3X23 A;  5MPO A;  4QZA A;  2GBM A;  2DWQ A;  3AE1 B;  3AB5 A;  4MHV A;  2BYE A;  4GDK A;  4NJ8 A;  2K8B B;  4MFF A;  1Z2M A;  2BPF A;  1K53 A;  4RM9 A;  2FMS A;  4MGI E;  3HK0 A;  2K39 A;  5C23 A;  4ARC A;  1FD6 A;  2QIE B;  3VFK A;  2K3U A;  1SIJ A;  5C1Z A;  3H8M A;  3TAC B;  2A1J B;  1P7D A;  2LHE A;  3BYY B;  3ML8 A;  3HT3 A;  3E56 A;  3M62 B;  1PGA A;  2QEJ C;  3GIM A;  3RJF A;  3UIO B;  1TYG B;  1YZ7 A;  3AE3 B;  1Z4N A;  2NRW A;  1X9M A;  4WAF A;  1RZT A;  4LDT D;  4DXG A;  2BF8 B;  4DL6 A;  4EKU A;  3TFS A;  4PS8 A;  2L0T A;  4DFM A;  4I2E A;  2DAJ A;  1T3Q A;  3I5J C;  3D2S A;  4EBC A;  1U4B A;  1LKY B;  4DSK A;  3ENE A;  1YX6 B;  1V1P A;  4J9L A;  4DQQ A;  1WI0 A;  1C9F A;  1HEK A;  3A9J A;  5AKL A;  3P63 A;  2NO5 A; 
#chains in the Genus database with same CATH homology
 4NJC A;  2L52 A;  2WXH A;  1VLB A;  1KLG D;  2JWU A;  1JRO A;  2BT6 A;  2Z8L A;  1ZXI A;  1FEH A;  2IPK D;  2JQR B;  3AEA B;  2PW9 A;  3IT6 B;  4C7Z A;  1NI3 A;  1XCQ L;  2CJO A;  1PUT A;  1PDX A;  3R2I A;  1JWB D;  1AYF A;  2PIA A;  3AE8 B;  4KKJ A;  5BMH A;  1ET6 A;  4B0M A;  3TEX A;  1ET9 A;  3SFD B;  4KGS A;  4NAM A;  1OQQ A;  1V8C A;  1HZ5 A;  1FCC C;  2XNA C;  1AN8 A;  3ZJT A;  2WXP A;  2CU3 A;  1L6V A;  2DLB A;  3AE9 B;  3GP7 A;  5I4D A;  1XLO A;  4LLG M;  5G5G A;  1TS3 A;  1TZO A;  3TUO A;  3AE4 B;  2H88 B;  4CQN A;  1VDV A;  1QOF A;  3BII D;  2V4I B;  4KKI A;  1LO5 D;  1NEK B;  2NMQ A;  3W5V B;  3HRD D;  2KMM A;  1E10 A;  1SB3 C;  1KLU D;  1KF6 B;  1SE4 A;  1A70 A;  4WIP A;  3T3O A;  1FRR A;  2NTT A;  2L83 A;  1D5M C;  1D6E C;  3UI3 A;  2Q5W D;  3CWI A;  3P4S B;  3Q8B A;  1F0Z A;  2E3T A;  1HEZ E;  2AQ1 B;  1FIQ A;  1EU3 A;  5EE3 A;  1YJI A;  4WH4 A;  4YSZ B;  1DGJ A;  3AEG B;  2HDE A;  2ZW0 A;  2JYE A;  2TSS A;  3N9Y C;  3P4R B;  4RGN A;  1K50 A;  1SEB D;  1OQR A;  4JWS C;  4Q2J A;  3PO0 A;  5HG2 A;  2J52 A;  1YN3 A;  2OHF A;  4OZA A;  1QF6 A;  2K5P A;  5TSS A;  1C4P A;  2MEK A;  1ZDV A;  3LXF A;  5EE9 A;  4RF1 A;  3E9S A;  3L4P A;  2W54 A;  3U52 E;  3BVZ A;  1XLN A;  4ARI A;  3NS1 A;  2INN E;  3NRZ A;  4L1B A;  2WXQ A;  4WQM A;  2N0S B;  2V0G A;  3U4E G;  1YN5 A;  1E9M A;  3AE5 B;  3NZ3 A;  4LTU A;  1C4A A;  2WXL A;  2LUM A;  4N6E B;  2FUG 1;  4DXF A;  2WXO A;  1L5P A;  1FNW A;  3P42 A;  2LJI A;  1SJE D;  3VRA B;  3W5U B;  1DOI A;  1E7P B;  1VR9 A;  2VZK D;  2X38 A;  1MPE A;  4YSY B;  3R2T A;  1JWS D;  2KAC A;  5EE1 A;  4USA A;  3I57 A;  1AWD A;  4JWU C;  2WDQ B;  4RNA A;  2IGH A;  1TY0 A;  1TS4 A;  1CZP A;  4RH6 A;  4TSS A;  3SFE B;  1K52 A;  2ON8 A;  1L0V B;  4HRO A;  5HHD G;  4MM3 B;  2BS2 B;  2M19 A;  5BYS A;  3NVY A;  4AQ7 A;  2LMC A;  4KX6 B;  2WXK A;  1XEE A;  1DOX A;  4RGO S;  3RFZ B;  4YT0 B;  1GAQ B;  3B9J A;  2BS4 B;  2WU2 B;  4A90 A;  1QOA A;  1WYG A;  3KWL A;  3PZ7 A;  3SEB A;  2AX5 A;  4H2A A;  4ITK A;  3TEZ A;  3BVG A;  5HFY A;  5D3I B;  5AUK A;  1MI0 A;  3MC0 B;  2BTE A;  3AEE B;  3EGR A;  3C8Y A;  1QQR A;  5FK9 C;  2NTS A;  4O1N A;  1GOZ A;  2ICI A;  1E6E B;  1D5Z C;  4C7Y A;  2J4X A;  4YXD B;  1EWY C;  3ETR A;  2YEP F;  4UDU C;  2INP E;  1WGK A;  3KQ4 A;  1C76 A;  2WDR B;  1IGC A;  1E0Z A;  4TQ1 A;  1QOG A;  3AE7 B;  1ROE A;  4YSX B;  1YN4 A;  1FRD A;  2WXG A;  1XF5 L;  1N5X A;  1R7S A;  1UNS A;  4N58 A;  4REZ A;  1QIL A;  2KWD A;  3DWM A;  1M4V A;  3BK2 A;  1F2R I;  4HJG E;  5FKA C;  3LYY A;  1FM0 D;  5C3J B;  3O13 A;  1YJJ A;  1MVK A;  3W9C B;  3CIR B;  1VZ8 A;  1JWM D;  3NVW A;  3ZYY X;  4YTN B;  2WXR A;  4A9A A;  1I4P A;  2V3N A;  3Q69 A;  2M0A A;  4J3O D;  2RPV A;  2V3P A;  4XWW A;  4XDD A;  1TJE A;  2Y5P A;  2IDY A;  3NUH B;  1ESF A;  3WCQ A;  2BS3 B;  3NVV A;  1UGJ A;  4XWT A;  1L6U A;  3B2F A;  5H92 C;  3ZQ4 A;  1WWT A;  2GRI A;  1ZP0 B;  2PVO D;  3VR9 B;  2FE8 A;  2JU6 X;  4KGT A;  1Y56 A;  4MH8 A;  1DOY A;  3EA6 A;  1IGD A;  5D3D A;  2WS3 B;  2Y5C A;  1D5X C;  1ZDX A;  4A55 A;  1JWU D;  4NZL B;  1FCL A;  1WSP A;  1C4C A;  2JZP A;  2H89 B;  2LEK A;  3ZGZ A;  2WXJ A;  4HKZ E;  2LFI A;  3URY A;  2OED A;  5H8Y E;  3FIL B;  3Q8A A;  1RYJ A;  4XE0 A;  4EE2 A;  5AUI A;  2J42 A;  1P7E A;  1L0X B;  4ZOH C;  1YMH E;  2PKO A;  2YEP B;  4A6Q A;  3TSS A;  3MHZ A;  2WP9 B;  1P7F A;  4IDI A;  2GB1 A;  5D7G A;  1N61 A;  2J53 A;  3FC4 A;  4C56 C;  1KTK A;  2W3R A;  3BYT B;  1RWS A;  1L4D B;  2I2Y A;  3BVM A;  4YTP B;  1ZXH A;  2PMV A;  1GB4 A;  3LB8 C;  1K51 A;  1FXA A;  3I9V 1;  1XLQ A;  2E6X A;  4WWM A;  1BML C;  4ZRQ A;  4L23 A;  1JML A;  3BWU D;  2PLP A;  3DWG C;  1BXT A;  2L1A A;  1XO3 A;  2BW2 A;  3IXS A;  2KDM A;  2RDG A;  1VJK A;  1J7C A;  3Q8E A;  4JE3 B;  3U2S C;  2K22 A;  1VZ7 A;  2IGG A;  1AW7 A;  2WXI A;  1XLP A;  3HUI A;  3W1S A;  3ZJV A;  2N9K A;  5BYQ A;  1FFU A;  4RCO A;  5HI1 A;  1F2R C;  4OZC A;  2DBY A;  1NEN B;  1YQ3 B;  3FAH A;  2SAK A;  1PFD A;  2W82 A;  2XN9 C;  3IAM 1;  3AV8 A;  3P1M A;  1CQV A;  2AQ3 B;  2WXF A;  1PGB A;  3R8B A;  1N60 A;  4ZHP A;  1IUE A;  1RFK A;  1HA5 A;  2JX5 A;  3AEC B;  5FR3 A;  2WDV B;  3U7Z A;  1MHX A;  1Q10 A;  1IBX A;  1UWM A;  1TKG A;  1I7H A;  2WXM A;  1J7B A;  2MH7 A;  1ZUD 2;  1KFY B;  1YNT E;  2KAJ A;  1VRA B;  3MP9 A;  5BMG A;  1PYW D;  2JYT A;  2L32 A;  1NYQ A;  1YQ4 B;  1SF0 A;  4NAW B;  1FNV A;  4RGT A;  4OVZ A;  2B76 B;  3B2G A;  3KLS X;  4N59 A;  4OW0 A;  4P16 A;  4ZHO A;  3H8H A;  3FIL A;  2WXN A;  2LHD A;  3IAS 1;  1TY2 A;  4KGR A;  3VQI A;  1JW9 D;  1HXY D;  3EUB 2;  3SR6 A;  2MJ3 A;  4C80 A;  3W2D A;  1L0Y B;  5BYR A;  3T3N A;  1IBX B;  2WNM A;  4L2Y A;  1FO4 A;  3AE6 B;  3Q8C A;  1QT9 A;  2RMM A;  4M0W A;  3GB1 A;  1N5W A;  3AMZ A;  1B9R A;  3GS2 A;  2WU5 B;  5G5H A;  4IKG A;  2N7J A;  1L4Z B;  4GDL B;  3P4Q B;  1OFF A;  1JWA D;  1HZ6 A;  1SSN A;  1SXT A;  3HVD A;  2PTL A;  4A8X C;  5C2T B;  4D2K A;  1GB1 A;  1CK1 A;  3TEY A;  1WXQ A;  1ZE3 D;  5LNK 1;  5EE0 A;  1V1P B;  2R61 A;  1TKE A;  2JSV X;  4GDK B;  2MJD A;  1VZ6 A;  2W55 A;  4RGM A;  2EKI A;  1FFV A;  2BB5 A;  4AS1 A;  1QOB A;  3TEW A;  3MFG A;  1XCT L;  3HVZ A;  2QSD A;  2MJE A;  2WLB A;  3AEF B;  3AM9 A;  2G9H D;  2M56 B;  1NVI D;  2FBW B;  2GI9 A;  4US9 A;  5GXG B;  2SEB D;  1ZPS A;  1TS2 A;  1I4Q A;  3J9C A;  1HQR D;  1BUI C;  1ZOY B;  1I4H A;  2PVG C;  1GPX A;  1PGX A;  1I4G A;  3IT4 B;  2N9L A;  4OZB A;  1T6B X;  1FXI A;  1DYQ A;  2AQ2 B;  1CJE A;  2KQ4 X;  3VR8 B;  3NVZ A;  2QMT A;  4HRS A;  2QIL A;  3OWE B;  4HEA 1;  1STE A;  1I4X A;  2LGI A;  1N62 A;  5BMI A;  2KN4 A;  2WQY B;  3KWV A;  2HTM E;  3P4P B;  3ABV B;  4YWG G;  4RFB A;  1TKY A;  1JRP A;  2W3S A;  2K9X A;  1C78 A;  4FXC A;  1ENF A;  4MT5 A;  4WUR A;  4ZRP A;  4YTM B;  4RF0 A;  1SE2 A;  1KH0 A;  1B1Z A;  1FMA D;  4HKQ A;  1ACC A;  1XXG A;  2EEL A;  4MAC A;  4DQO C;  2VZK B;  3AED B;  1JCK B;  4PT5 A;  2G1E A;  1T5X D;  3ZJU A;  1UWX A;  4JPS A;  4GLS C;  2BBC A;  3AN1 A;  3PZ8 A;  1EWC A;  3BZD B;  2D5G A;  1J7A A;  4TMA B;  4XDC A;  1C79 A;  1V97 A;  3BK1 A;  3Q8F A;  5JXV A;  2ZW1 A;  1RM6 C;  3RPF C;  2BB6 A;  4ZYS A;  2IJ0 A;  5E6J A;  4R3D A;  1QKZ A;  2DWQ A;  1SE3 A;  3AB5 A;  3AE1 B;  5MPO A;  1C77 A;  2JXT A;  3MJ5 A;  1K53 A;  4TQ0 A;  3V3X A;  3AE2 B;  2I38 A;  1UUP A;  1EU4 A;  3V05 A;  4ARC A;  1FD6 A;  2QIE B;  2K3U A;  1SIJ A;  1NYR A;  1JQ4 A;  4US8 A;  2CJN A;  2LHE A;  3BYY B;  2DYM A;  3E56 A;  4LK0 M;  3VRB B;  1PGA A;  1V1O A;  2QEJ C;  2QJL A;  4OHJ A;  1JAL A;  3AEB B;  1TYG B;  4B0E A;  3AE3 B;  1MHH E;  1TS5 A;  4WAF A;  4DXG A;  2BYT A;  1WRI A;  1I4R A;  2DYO A;  1F77 A;  1FNU A;  1SBB B;  1T3Q A;  1KRH A;  2RDH A;  1QLB B;  2ACZ B;  4JX1 C;  1EM7 A;  2ONQ A;  1N63 A;  1V1P A;  4P6V F;  1C9F A;  1D4B A;  3AH7 A;  2IGD A;  2K0P A;  2Y3A A;  4IOI E;  1SJH D;  3P63 A;  5T8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...