3NRZA

Crystal structure of bovine xanthine oxidase in complex with hypoxanthine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation and catalytic specificity in the action of xanthine oxidase: the sequential hydroxylation of hypoxanthine to uric acid.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nrzA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nrzA01
3BIID 4YTNB 1NYRA 1CJEA 5C2TB 1ZOYB 3AE4B 1JWBD 2L83A 3AEEB 3FC4A 4C80A 1KF6B 1QT9A 1N60A 1CZPA 1ZUD2 2H89B 3AV8A 2N0SB 2QJLA 1KFYB 1QOAA 1TYGB 1XLPA 1E0ZA 1ZP0B 1FRRA 2JX5A 2W3SA 1L6VA 4YSYB 1N62A 3L4PA 1IUEA 2AX5A 2WDVB 3NVZA 1YJIA 1TKYA 1NEKB 5AUIA 4C7YA 1V8CA 1QOFA 1J7BA 2M56B 3CWIA 3LB8C 4JWSC 4YTPB 1E10A 3VRAB 3W9CB 2WS3B 1PFDA 1DOXA 1PDXA 2WDRB 4HRSA 3WCQA 3B2FA 3AECB 3HUIA 1J7AA 1OQQA 2ACZB 3AMZA 4US9A 1J7CA 2DBYA 2M19A 1N61A 4FXCA 1JWAD 2JQRB 4ZHOA 1N5WA 4N59A 2K9XA 3AN1A 2W55A 1JQ4A 1SF0A 1GPXA 3AB5A 1DOIA 1FFUA 3AM9A 1FRDA 3P63A 1QF6A 1ZXIA 3ETRA 1QLBB 1OQRA 4LTUA 4YT0B 3NVVA 1FO4A 2MJDA 3AEFB 1DGJA 3P4QB 1XLOA 4P6VF 1YQ4B 2BS3B 1SIJA 4US8A 2Y5CA 2H88B 2EKIA 1KRHA 3LXFA 4WQMA 2W54A 4IDIA 2WP9B 5H8YE 1N5XA 1R7SA 1L5PA 3DWGC 3B2GA 2DWQA 5MPOA 1RWSA 2CJNA 3ZYYX 1VJKA 5G5HA 5G5GA 1WRIA 3B9JA 1VLBA 2WU5B 1WGKA 5GXGB 2HTME 3ABVB 1SB3C 4N6EB 3W5VB 1XO3A 3SR6A 5H92C 2B76B 4WWMA 2WDQB 1FXAA 1JALA 1FM0D 2KAJA 1XLQA 3SFDB 2K22A 1QOBA 1N63A 1NVID 3FAHA 1UWMA 2MJ3A 1F0ZA 1FIQA 1JRPA 3KWLA 1NI3A 2L52A 1OFFA 4ITKA 3NVWA 1NENB 3P4RB 4JX1C 2CU3A 1QOGA 1GAQB 3AE6B 3P1MA 4C7ZA 2PVOD 2WLBA 2PIAA 1TKEA 1YQ3B 3AE5B 3P4PB 3AE3B 4KX6B 4HROA 2Q5WD 3AE9B 1FMAD 1B9RA 1TKGA 2KMMA 1FXIA 1RYJA 3NRZA 3AEBB 3PO0A 3DWMA 5EE0A 5AUKA 1E6EB 2MH7A 2FBWB 1RFKA 2PVGC 1A70A 2CJOA 3HVZA 5EE1A 3AH7A 4N58A 4YSXB 2BT6A 2BS2B 3AE8B 3AE7B 1PUTA 1WXQA 1AYFA 1RM6C 3AEDB 3P4SB 3CIRB 1AWDA 2LEKA 5EE3A 2OHFA 2WQYB 3VRBB 1FFVA 4ZHPA 4A9AA 1JW9D 1EWYC 1WWTA 3EUB2 1JROA 2WU2B 3AE2B 1XLNA 3VR9B 3VR8B 1TJEA 3NVYA 1VDVA 1L0VB 1L6UA 1E9MA 3RPFC 3AE1B 2PKOA 3AEGB 3W5UB 5C3JB 1DOYA 2BS4B 2G1EA 1E7PB 2K5PA 3AEAB 4JWUC 3SFEB 4YSZB 4ZOHC 4YXDB 4YTMB 2QIEB 5EE9A 1T3QA 1I7HA 3NS1A 1WYGA 2W3RA 4USAA 1NYQA 1ROEA 2MJEA 1V97A 3HRDD 1YJJA 2E3TA
chains in the Genus database with same CATH superfamily
4NXZA 4RPZA 2O2VB 1NJZA 3HILA 2I6XA 2LXAA 3KZIU 1L8OA 3W2DA 2WXGA 4F7ZA 5AKEA 4JV0A 2JX5A 3C19A 4EENA 1EXNA 4AOFA 3GV5B 2H3QA 2ASLA 1WYWB 2ZIXB 2FE9A 2A4ZA 2WGSA 8ICCA 2IPKD 4P2HA 3IVFA 2E8OA 5J0QA 5FR3A 1FEHA 8ICIA 2IDYA 3KHHA 2NRVA 3AECB 5J2DA 3QZ8A 1BPZA 2V9HA 4JQWC 8ICUA 1WX7A 2WXPA 4ZHOA 1XT9B 5IA7A 2VH1A 3OHAA 1L4ZB 5KFSA 1ZQKA 4BWMA 4K7WA 4M9JA 1UUPA 3DQVA 1WFYA 4DDGD 2WTFA 2B6GA 4M04A 3APCA 3ORYA 1X9XA 4LZGA 3WK9A 3I76A 2KICA 2YMPA 4JUZA 2KOXA 2DYMA 5IIMA 2FAZA 5DGBA 2KVCA 4OD0A 2YY6A 5KFBA 3B9JA 1S97A 4NL9C 1GOZA 1R4NB 2ISPA 2Y5PA 1LFDA 1D4BA 4PS7A 3UIPB 1WXAA 2IJ0A 2C7HA 5LXIB 2EZZA 2E1EA 3SR6A 4C4TA 5KFKA 1KLGD 1FM0D 2KAJA 4II2B 3N9YC 1V5OA 2BWES 2R2QA 5KFTA 5FK9C 1UQVA 3HWTA 1WJ6A 1OFFA 4MFFA 2WYQA 4ZRIA 2RP5A 1TZ1A 2BPFA 1TKDA 4C7ZA 3HKZF 2AQ3B 2RGFA 2KD0A 3TFSA 4KX6B 5JUMA 1WR6E 5J0WA 4LDTB 5KFAA 2DKZA 2JEIA 5DPTA 3M63B 3R2IA 5ALLA 2DAJA 3MABA 1IBXA 3MTNB 4P4MA 1V81A 1ZKHA 4QAYA 5AKYA 1L3UA 9ICIA 4A3OA 4J03A 2F1IA 2JHDA 4HDQA 4MEYA 1V1OA 7ICLA 3RB4A 2PJHA 3WAOA 1MN8A 4RU9A 1L6NA 3AEDB 3ONNA 2ZIVA 2OHFA 2QILA 3RYTA 9ICLA 2C7NB 4ANVA 1P98A 3ALBA 4OVVA 1CMXB 1U4BA 2ZIWB 1RAXA 3BZKA 4Y2UA 3LWMA 2BCQA 2KJ9A 4DFMA 2BYFA 3MGIA 2QB1A 4YSZB 2KJ6A 1PUZA 2JZBA 4JLCA 1S1QB 4CHKA 4ECSA 1BNOA 3WKDA 3MDCA 3TAPA 3IG8A 2DX5B 4DWFA 4UB6U 4XUSA 3L10B 2KKCA 2NCNA 1KOTA 4LNNA 2BKEA 1BT0A 3JSVA 4MGIE 1JWBD 1P3QU 3AV8A 3N1XC 3GZNI 4HKQA 3H0RB 1NK0A 3OSPA 1EUVB 3FDSA 1TBEA 2YMQA 2PFNA 1GB1A 4R8UA 4EUTA 4HPMB 4F50A 2NO5A 4NWIA 2M56B 2OOBB 2DF4B 2JRHA 3T8MA 2WS3B 1XF5L 4CE6A 3TI0A 2V3NA 4Z6FA 3SQIA 2KANA 1OQQA 4OW0A 2Q0ZX 4YD2A 9ICMA 2J0MA 4KLTA 3O0FA 3GDXA 1TFRA 2FI1A 8ICOA 3JPRA 4ZRJA 3UQ0A 1RQNA 5KFWA 3DOWA 1GPXA 5JTIA 1M94A 2V1YA 1YN3A 1SL0A 4ANXA 4GB9A 1ZXIA 4FHJA 2M8SA 3KFUF 1QLBB 1OQRA 2REXA 3NVVA 2ZIVB 3AEFB 1DGJA 2C2DA 3ZDTA 5G55A 4US8A 2TSSA 8ICFA 2G4DB 1ZQRA 2PFOA 2C9WB 2KIVA 3PRPB 3NRWA 5G5GA 4NLZA 3RUIB 3RB3A 3SMVA 1A0PA 1EWCA 4QWCA 3P42A 2G08A 1EF5A 1Q3UA 3ZVVA 1B43A 4EELA 1O03A 4WURA 9ICFA 2Y0SC 2G09A 2K25A 3L0WB 2XCAA 1MPEA 3BQ7A 3DBLB 2M17A 2KZRA 3GV7B 3EGRA 5AZGA 4C4VA 2VZKD 5HMLA 3Q8FA 1JRPA 1BXTA 4AQ7A 4F2RA 3NVWA 2Q4TA 3M3JA 3EFCA 4DSIA 3SEBA 2XY6A 1MHXA 3IG3A 4M02A 1X40A 3SU8X 3EPIA 1V1PA 2HVIA 3RNAC 4RH6A 5AM2A 2W7PA 9ICSA 3AE3B 1WGHA 2L32A 1FMAD 1PQSA 3I1YA 4BKGA 4NLKA 4KGTA 3UXPA 5ALEA 1KFSA 1TZOA 3BQ2A 1TE2A 1URJA 2ZXHA 2PVGC 3B0AA 4P0QA 4YWGG 4RNNA 5CTRC 1OEYJ 3DVNV 3Q3FA 3PO5A 3PNCA 4ED3A 2BS2B 4W9GA 1I4HA 2MUTB 2WXFA 2D6FC 1HTOA 1NJWA 2C22A 2LRWA 2JGAA 5EE3A 3ECIA 3GB1A 3PZ7A 4FZNA 1T0RC 5E6JA 7ICQA 1XU4A 2H3VA 2D3DA 2LYHA 1L0VB 1S5LU 7ICHA 3I28A 2N1RA 2N9EB 2X38A 3V62A 2M0XA 1UT5A 1NYQA 2NYVA 4ED7A 4CRXA 3KH0A 3IBEA 2LMCA 4KLEA 1CK1A 3NZUA 2EDUA 3WKAA 1EF1A 4QZ8A 2EAPA 2MCNB 4HWIB 1EU4A 4NLGA 1LKYA 1O08A 4KSLC 3OHBA 4RF0A 4QZEA 2HHQA 5DDYA 1Q0WB 4IM0A 1L6VA 4YD1A 4UB8U 2UWQA 4M00A 4YFKA 1NEKB 1E5WA 4JWSC 5AUIA 4BXOA 3RJFA 1Z19A 2ESEA 1TT5B 2RDGA 1WWVA 3IFWB 4A20A 2YLMA 3GQCA 1WJNA 1HXYD 5HMMA 1J7AA 4K4IA 1T0QC 1ZQVA 5FKAC 3RTVA 2L05A 2K9XA 4M0WA 3RMKC 5DPSA 3W1YA 3MJWA 4XRHA 4KLMA 4YN4A 5JRTA 2W9CA 2KDBA 4MFAA 3PS6A 4ACFA 1UWXA 4J6IA 2MJDA 3EYZA 3RRHA 5BYRA 4URKA 2F2AB 3EZ5A 4Y2JA 3LXFA 4WQMA 4FBJB 8ICPA 2H3IA 5KFGA 1Q10A 3PRZA 4LDTD 4RGMA 5HR6A 5IN7A 1NZBA 3OJSA 1VR9A 3BQ1A 2PW9A 1A6SA 1E7UA 2KACA 8ICLA 4ANUA 2BQQA 3LWLA 5C0YA 2D11A 1WGKA 1RYSA 1NI2A 3ABVB 2AL6A 4RT3A 2F3NA 2M1MA 2G0AA 1I4GA 3PHWB 8ICYA 4DQIA 2V3SA 4MACA 4GIVA 2WHIA 1XLQA 3UQ2A 4ICUA 4RQ2A 2E8PA 1NVID 1KN5A 2DAFA 2DHZA 4ECVA 3TEXA 3OJ3A 4K81A 4HCPB 1EU3A 5DPRA 2K39A 2KQ4X 5E79U 1X2IA 4WWOA 4I28A 5AKJA 1U48A 1RXWA 4MH0E 5KG6A 4DL5A 2LZ6A 4RQ8A 3TARA 1VZ6A 4GXJA 1FXIA 5DBBA 3NRZA 3C5FA 2PKEA 5AUKA 3H4BA 3AULA 1C9FA 4LJOB 2HHXA 3ZJTA 1C4AA 1YZ7A 3HKZC 5ALTA 2Y5BB 4MF8A 3PV8A 1NBFC 3V7KA 3RJIA 4KLHA 2W9NA 4O9MA 3AE8B 3Q8LA 2N9PC 5DLGA 3T3FA 2XBBC 3CIRB 5KNIA 3TJPA 1TS2A 3ISDA 1LKYB 3F2BA 3VQIA 2W8KA 2J6SA 2WXNA 4AJWA 1L3TA 3DBLI 3MJ5A 3NVYA 2XN9C 3RNGC 3AL0B 4UDUC 2MBQA 3A1QB 4A90A 2BS4B 1N6ZA 2G45B 1WIAA 2ZEQA 3TQ1A 3Q2AC 4IC7B 4XGAB 3RRGA 3ZGZA 5L1LA 2ZG6A 2KQ7A 2IGGA 5HHHA 3V6CB 3SYZA 4B9LA 4YTNB 1BGXT 3T3NA 1D8YA 1CJEA 1WUDA 2M0NA 1WZ3A 1TS5A 3FC4A 3AEVA 2GLEA 4S17A 3N7PD 1JCKB 2N0SB 2UVUA 4QIWC 3N97B 2RDJA 4D2KA 1MA7A 1VD2A 2IOFA 2LM1A 4RM9A 5GTHU 4A55A 1DOQA 2X8XX 1SZPA 2WXHA 1PDXA 3Q3MC 4JWMA 2OCEA 1OEYA 2EAMA 1GO3F 2FMPA 1D5MC 2KTRB 5ALKA 5TSSA 1PVPA 3RD2A 4QZHA 5J2AA 2KD1A 2C2EA 1TIFA 4W9FA 5KFNA 5G2NA 2K4PA 8ICWA 7ICVA 4P4PA 1UH6A 4FBTA 2G9HD 3RNFC 1J8CA 2K8CA 3ZLZA 2ZIUA 2YMMA 2N4FA 1SV0C 1T4GA 2KJ8A 2XEWA 3E2EA 5A0LA 2JH7A 2GWSA 1TTNA 1XLOA 2BKFA 4B9UA 4DBGA 3RT3B 1F2RI 3JSVB 1LO5D 3UINB 2WX0A 2KFZA 1QCKA 5CHGA 1L5PA 3SAGA 7ICKA 3WA0A 2CJNA 3L5KA 2XI9A 1BPEA 4F5NA 2WF8A 4M8NA 1ZDXA 1IIPA 2WU5B 3E9SA 1WG8A 3VXWA 4KLOA 5D94A 1ZQNA 2PTLA 3TFRA 1RDFA 5KG2A 4QZIA 2K22A 1LQBA 3EWAA 3AU5A 4QZFA 3QYPA 4YQWA 4F4XA 1F0ZA 2KG5A 1Z00B 4RPXA 2IO0B 4ITKA 4DQRA 4FZLA 1LM8B 4FULA 2Y0SF 3TADC 1P7FA 3P4PB 3F2CA 3DVGY 1E7VA 3H8WA 1ZQJA 2DZIA 2MP2B 2FBWB 1QILA 2JMGA 3LK9A 2BR0A 1ZGUB 1K51A 2IZVB 1HA5A 3QA8A 3GZNB 3I63C 3C23A 3ZO5B 1FEZA 1XNSA 4HPPA 3VUXA 4C4SA 1X9MA 1RM6C 2FDRA 5CX3A 1SWVA 2YQEA 3I3TB 2JXTA 1AWDA 3P4SB 3OPXA 2ZTDA 3OG5A 1XCTL 1WSPA 4E3CA 4ECYA 2WU2B 1Z1BA 1TJEA 1TK5A 2EELA 2ALZA 3RPFC 2VKQA 1SV4A 3CP8A 8ICXA 2D07B 3RNCC 1UNSA 2NPTA 2WDTB 3W5UB 1RQLA 2OWOA 2J0KA 2A1AA 3C8YA 5C3JB 2LUMA 5L1JA 1T3QA 1K1SA 5ALGA 4RCOA 2KTRA 2K8AA 4UQGA 2ODGA 3CRXA 1UGMA 4UAWA 4M9GA 1SKRA 4KLSA 1UD7A 2AL3A 1NYRA 2OH2A 1TS3A 3QAQA 1U4AA 1YQBA 1GUAB 4B9SA 1MG4A 4G3XB 4LJPB 3SAHA 2NBVB 5J0TA 3OJUA 3MR6A 4YXMA 1N60A 4PHEA 2H89B 3RNEC 1SIFA 2K8BB 2C5LC 2G5HB 3HW8A 1ZQCA 4IRDA 1BPYA 3L4PA 2WDVB 1MC8A 4C4VB 3PX0A 8ICRA 4EBEA 3HK0A 1J7BA 4IQUA 3X23A 3MC8A 4HEA1 2KC2A 2B21A 2K4IA 4GDKB 4KTQA 5KT4A 2OYYA 9ICRA 4HRSA 4IWQA 4OJ5A 4XWTA 3GU3A 3K1RB 1J7CA 1XSNA 4QW8A 5AI4A 2W55A 4DSFA 3ZDCA 2HW3A 1C4CA 5AM5A 1SE4A 2AGQA 1DOIA 3FYHA 4QZGA 3ETRA 1SJED 4MJSB 3MR2A 2QCZA 1P1AA 4II3B 3MC1A 4M2YA 3U7ZA 2LWPA 2W8LA 3ZQ4A 1C76A 5KFDA 2BS3B 5KG5A 2L7RA 2JPHA 2KK8A 4GIBA 2BW2A 3DDCB 1JI7A 2WP9B 4PYZA 7ICEA 3CSTA 4IQTA 4FHKA 4MH8A 3BS7A 4FN2A 4UASA 1VZ7A 5AIBA 2I9GA 1SL2A 3E58A 5IIKA 3BZCA 1C1YB 1TV9A 1WMHB 1WGRA 2IYDB 2D3CA 4K3CA 4CDGA 4QWAA 5HHIA 2EH9A 3Q3NC 5J8YA 1NNLA 1Y56A 4ECUA 3T79A 2DZKA 4NAMA 5CEHA 1ESFA 4LCDE 1ZXHA 2WX1A 4MEMA 4ZRQA 1OUQA 2LJIA 3JVZX 3KWVA 3TEYA 1RXVA 3MBYA 4NM2A 2BBCA 2ZNVB 1RYJA 3O13A 1E6EB 2MH7A 4XQ8A 5DQGA 5AK4A 3RH5A 5AKKA 4HCNB 1ZQXA 4A8EA 1JXLA 1VCBA 2K8HA 1ZRMA 4I27A 5B5EU 1D8BA 3Q8CA 5F9NA 3TL5A 3PSTA 5TR5A 3SHQA 4ZDVA 4O0IA 1LV5A 5BYQA 2W11A 3QEAZ 3GOEA 1NKEA 4ARIA 2ZXIA 4YR3A 3GILA 1UA0A 5AKIA 4EEKA 3J9CA 1FFVA 2Y9TA 1JW9D 1JROA 4KLIA 1TY0A 4IR1A 3HP6A 2KNJA 4Y2SA 2JEJA 4QZ9A 3L08A 1XD3B 1KBUA 3ZTDA 2KSOA 1HEZE 2KN4A 4F5RA 4JV1A 4YXDB 4M9HA 4XC2A 4J9LA 4JGHB 4AP9A 1RFAA 3EPGA 1HEKA 4USAA 3JYUA 5KHQA 2OM6A 2GOWA 3W1SA 2DPIA 2W03A 4C8MA 3SAFA 1SGHA 3RJEA 4HAIA 3LJ3A 4FLHA 2BCUA 3K4GA 5JXVA 3VVWB 5KAIU 2K0PA 1QLNA 2BWFA 4BZAA 4IWPA 3A0BU 1QSSA 3G6VA 4F92B 3HJEA 3RULA 1ZQBA 4TMAB 3JPSA 2LI6A 2WF7A 3C2KA 2I1QA 1YJIA 2FLPA 4Y2VA 5DCNA 2Y9UA 4IQVA 4YTPB 3WKBA 2CXYA 2W9CB 4KLJA 2NS5A 4L2YA 1IXRA 2AEHA 2MU2A 2KJ5A 4OHJA 3PRMB 4EOYA 4B0EA 5AKLA 4OO1J 2V4IB 1KEJA 5AM4A 4MGKE 2KIWA 2IBIB 1T8EA 3AM9A 5ALSA 1DGSA 3L13A 2MBBB 2FPLA 2VZKB 2IO2B 2NR2A 2JEGA 2P66A 2FE8A 2Z8LA 2ASJA 4O3PA 1D9FA 2LJ5A 1KRHA 2MA9B 5ALYA 4RPYA 2NRWA 4ECWA 1ZQDA 1YJ1A 1TK0A 2FUHB 1H38A 5J18A 5G5HA 1KFDA 5HNKA 9ICQA 1WRIA 2KDMA 5LXHA 1VLBA 3MR3A 2FCMA 2HTME 4J9NA 3SEIA 2BPGA 4UAVA 4J9PA 2FPMA 2H5XA 1NK5A 3ZDMC 3QU2A 2WDQB 4C8OA 4RNAA 2QEJC 2K4HA 4RQMA 3NS8A 5L95C 1QOBA 3L3FX 3SD5A 1L8LA 5KT3A 4FO6A 2D3GA 2JSVX 4WJQA 4JE3B 1QOGA 4RGNA 3V7LA 1DK3A 3P1MA 3LDAA 3QIJA 2CRXA 2QB0A 2M0AA 2MUTA 2MRPA 4ZH4A 3TSSA 4BDPA 3RBDA 4DL4A 3KHGA 2Q5WD 8ICTA 2RLTA 4RF1A 3GP7A 3PW7A 5CWRA 2MBHA 2O2VA 3NOBA 4EFOA 4KLGA 5AHXA 5IINA 4KDLB 4EKUA 3N20C 2KLGA 4AYBF 3BK2A 1K53A 2LI5A 3CF6E 4UW9A 3AUOA 3AE7B 3DCGA 2YX8A 3ICXA 3ZXRA 5HHDG 1WE6A 3RB0A 2KFJA 5E6PA 2CPRA 3VRBB 4HVBA 2WFAA 1SL1A 1EWYC 2MQJA 4NAWA 1OXJA 3EUB2 3IM1A 4I6PA 1HTQA 3L16A 3V60A 2LGIA 3VR8B 1VDVA 2I38A 2GBMA 3UPQA 3NUHB 1R4MI 1MI0A 4TUPA 4K3BA 4G3IA 1KFTA 4ELVA 3PMLA 3ZDAA 2PFPA 2RMMA 1FCCC 2HSZA 2D3AA 2OJWA 1PGAA 1WX9A 2MJEA 4EX6A 1WZ0A 4KV2A 4DFPA 2G4SA 3QUCA 1Z2MA 1XQQA 1F5SA 8ICSA 2MP2A 2WXIA 1SJHD 3F2DA 2HE7A 3URYA 3JPQA 2UVWA 4KN7A 2PPHA 3RH4A 1KF6B 4MHVA 1ZD4A 4WIPA 1WCNA 1MQ2A 4TUQA 1KFYB 4AWJA 3C2MA 3CNHA 1MG8A 2KTQA 3O65B 2ZTEA 4QWEA 2AX5A 3NVZA 3VHTC 5BMGA 2WXMA 2KEYA 4TQ0A 2K8CB 3M6KA 1ZRNA 4JMUA 2WXQA 1JWSD 3W9CB 1V6EA 3QXGA 7ICTA 3T5HA 2WDRB 4A8XC 8ICVA 2RR9A 4DL3A 4HLEA 4FXCA 1KTKA 4KLUA 2L1AA 2ZJ5A 4KMUA 4KX3A 3PV1A 2D10A 2W9MA 3B08A 1KL9A 3B0YA 4CCHA 4MDKE 3Q8QB 3HHMA 1X6IA 2IBKA 1D3ZA 3Q3JA 4YR2A 2J6TA 1HIWA 5J2FA 1FO4A 2NRZA 4F91B 1PK1B 3WANA 5AK5A 2RRDA 1GC7A 1MJDA 3RR7A 1HQRD 4FJYA 2N1WA 2MAXA 5KT7A 1ZQ1C 4RQ7A 1SE2A 1N5XA 2W43A 2LBOA 1UA1A 3WK7A 2HBMA 3N4MB 4O3SA 1WY8A 5KFPA 3MFGA 5KFLA 2W82A 2KE7A 5GXGB 4J9MA 4N6EB 3W5VB 3BS5A 2W7OA 1I4PA 5AIAA 2N7EA 4UB1A 5KG7A 3ZDDA 2QARA 3UQAA 3PVXA 1N63A 2XICA 1RG6A 3FAHA 5J2IA 4XYCA 3VC8A 3U7DA 2KZZA 4ARCA 1ZQUA 3F5EA 2AGPA 3R66C 3ZDEA 1SBBB 2KTFA 1TKEA 5HFYA 3GFKB 2K8BA 3PY8A 3AE9B 2KLCA 4ACOA 1CRXA 3APDA 2MHJA 1T0YA 4NM1A 1GB4A 3ZXVA 2CJOA 2HDOA 2E8NA 1WR1A 2MSED 1S8OA 8ICGA 3PR5B 2NRTA 2GRIA 3N28A 4J9RA 1ZQSA 2VA3A 1WXQA 3NUQA 2VH2A 3IAS1 3UMBA 2KDFB 2ZCCA 1M6YA 1L7NA 4KLLA 5AICA 2MLBA 4ED8A 4KKIA 2VRRB 1F52A 5BMIA 4C4RA 5CHVC 5J2KA 3WAPA 8ICQA 2CS4A 2MBEA 4DQPA 3WU2U 4EBDA 4F2SA 1V38A 2LHEA 4LLGM 5KFJA 4Y2XA 2PKOA 1ZQZA 4WJ3B 2EMTA 2K5PA 5JZEB 4I2DA 2KMAA 1B0XA 4JK1A 1ZJMA 2ZJ8A 2KJHB 2AWTA 3A33B 3RZFA 3K1ZA 5DG7A 2BDUA 2PE6B 2KHVA 5L83A 3ZJUA 2C60A 1UPHA 3AE4B 4DQSA 5D49A 3UQBA 1MVKA 4OJLA 1PYWD 3F53A 4DSKA 1A77A 3N32A 1UZXB 4MFCA 2KV2A 3TMPB 4L1BA 2YEPB 5D7GA 2F44A 2HJ8A 4GGQA 9ICVA 4OZBA 2BGFA 5AM1A 3IDWA 5IIJA 1Q3VA 3JPPA 3NTUA 3FKYA 4US9A 1SXTA 1ZOLA 2KFNA 1N5WA 4N59A 2ON8A 3PW2A 4KIKB 1B1ZA 4UARA 3M9OB 1JQ4A 3DV9A 2WAQF 3G6XA 1HE8A 2NTTA 4LNOA 3VDZA 4OZAA 1QF6A 2J52A 4OJPA 3ZW3A 3U4EG 3M1YA 4J9OA 2HMXA 4RFBA 4YT0B 1KKXA 3R2TA 2M4NA 1QH9A 3ALRA 3P4QB 2CN1A 4QZAA 5J2GA 1WX8A 2EKIA 4MGZE 1I35A 2E1FA 3WAMA 4RQ4A 4KVGB 2LVPA 1YN4A 2JRZA 3R9KA 1F9JA 2HCFA 2L0TA 3TEZA 3K9PB 2KZ3A 2KDEB 5DGAA 2HD5B 1T3NA 4XE0A 3Q8SB 3VTVA 1ZD2P 4B9VA 2V4LA 2LMRA 2O6VD 4MSQB 2N9KA 3ZNHB 4ASWC 1XSLA 5AZFA 2AHOB 1XCQL 4UB2A 4ZRPA 1MSWD 3L54A 1FIQA 1E90A 4WWPA 4BJQA 3DBRI 1Q46A 4BOSC 1V80A 1J19A 1B4FA 4GXKA 4NV0A 3U52E 4H2AA 4AJYB 2WF9A 4CYEA 4HROA 3OWEB 4PS8A 1L7MA 5J8YC 9ICAA 2LUEA 4XWWA 2BCSA 2CHWA 2VANA 2FNJB 2DFLA 5CR0A 1KRPA 5ALXA 2ZW1A 1QQ7A 4XZ4A 4F3OA 1ET9A 2J0JA 3GZFA 2AYOB 2XNAC 8ICNA 4IM3A 4Y2PA 3BVZA 2LGSA 2FLLA 1E8WA 4XDCA 3VR9B 1H8CA 5KL8B 4I2JA 1TK8A 3QARA 4NLNA 2CU1A 2HVHA 1ZQAA 3KYCD 3Q69A 4ZRKA 3QUQA 5LLIA 2HHWA 1I4XA 2NVUI 7ICFA 1NK4A 3PZPA 2ATLA 4TQSA 2RD0A 4B9KA 3N7RC 1WF9A 2AQ0A 2LGXA 5AI8A 2HOQA 4L23A 1AARA 3NASA 5EWEA 3JPTA 1X9WA 2W9BB 3VTUA 1S76D 2JY6A 4YVZA 2G5IB 1N56A 1QOAA 2A1JB 3H4DA 1P0RA 3BWUD 4GMVA 4KLQA 1ZP0B 4NQKE 2ZIWA 1IUEA 4TSSA 3PVLA 1TS4A 4M01A 4JPSA 1V85A 2K1FA 4B6JA 4DFJA 4F72A 4IRKA 5C5JA 5L1KA 9ICOA 3N3KB 3DBHI 3QX1A 1NK6A 2M19A 1N61A 4DK5A 5IKCM 2DZJA 2NBWB 1SWWA 3Q8MA 3JW0X 4K7UA 2ISOA 4F71A 4M47A 1SF0A 2HOFA 1PK3A 2N1VA 2GB1A 1FFUA 3UI3A 1FNWA 3ZNZB 4IC9A 3M8RA 4DDID 1STEA 4LTUA 4XA5A 2EQYA 9ICPA 2D5GA 1SIJA 3GE3C 1PK1A 3NZSA 7ICMA 1IYFA 1Q8KA 1LGRA 3H8HA 3IHQB 4EEYA 1KTQA 4ECRA 2N9LA 1VJKA 3ZD9A 9ICNA 2MWSB 5KHOA 4F93B 4XX5A 4FBUA 3LVVA 4QWBA 4P1BC 1SB3C 4TQRA 1QTMA 2E5SA 4C8NA 3IG5A 5KFVA 1WM3A 2KWCA 2ASQA 4Y2YA 4U6PA 2XGPA 3A4SC 3KKAC 1IGCA 2BGWA 1UWMA 3WIMA 4AP4C 2ZZPB 3T3OA 1VJ5A 4YP3A 2L52A 4CNQA 4JX1C 2A1JA 4ZYNA 4KDIC 2WNMA 3GIJA 4JV2A 5ALIA 3PREA 4DHZE 2J53A 5D2MB 2N9XA 2WF5A 4DSEA 4I2CA 2DYOA 4WJOA 5HI1A 2MRLA 3V72A 1YNTE 4DOBA 4FFDA 1SE9A 3VH3B 3T5JA 4TURA 2LRUA 4U7CA 4JL9A 4N9F4 4FADA 4BWJA 1ZETA 2R8JA 1L3VA 2K3UA 5ALFA 5CHFA 7ICIA 4ECTA 4HXDA 4P0PB 1V9JA 4NJ7A 3VAWA 3D2SA 1QSLA 2YEPF 4ZHPA 3W1SC 4MT5A 3AU4A 1WWTA 4G50A 1ZQLA 3KQ4A 3U26A 4KX5A 1F77A 2G1EA 2KWDA 2B0CA 4F5PA 1MHHE 2JRIB 2RSUA 2WXOA 2GBJA 4G0NB 4XDDA 3WK6A 1PVRA 2IO3B 5AEKB 2AXTU 4CO7A 3MC0B 3OAWA 1G6JA 1WJ4A 3R3MA 5KFOA 3N30A 3HRDD 5DQHA 4B9TA 1HZ6A 2BYEA 3SV3A 4QIWF 1H4RA 1WM2A 1WI0A 2HHSA 4DXAB 2EZXA 2AGOA 3H6NA 2L83A 1SXEA 4C80A 3DHIC 3UGBB 4DL2A 2QDFA 5D4BA 3PSIA 3GIKA 1XC9A 2KX3A 3C2LA 1FRRA 1SKSA 5KFRA 3MC9A 2JR5A 4EX7A 4IQWA 7ICUA 2I1KA 1T94A 2JWZA 3UMGA 4F4KA 1V8CA 3NY5A 1UGJA 3CWIA 2LD9A 3A9JB 1GJZA 4LNFA 1J97A 4O5CA 9ICWA 4BBNC 3RJHA 2PXIA 4DHZB 1SSNA 1T6BX 4NZLB 3B2FA 1QZEA 5CRXA 8ICBA 3AMZA 3SV4A 3NG0A 3ONSA 2WXRA 2J42A 3H0MB 4IS7A 2SEBD 3EECA 3RI7C 1ZE3D 2FCSA 2P6UA 2XK5A 1B22A 3KUDB 3GIMA 1X1MA 4DO9A 4JIOU 4F4YA 2BQUA 3ISCA 3AB5A 3KOOA 4MM3B 4RQ1A 3PPAA 3D2NA 4EZKA 3QJZA 3N1ZC 3PZ8A 4P6VF 2HHUA 2WAQC 4DCCA 5AK3A 1WXVA 2QARB 2INDC 1J2MA 2A19A 3B2GA 4WWNA 1XXGA 9ICTA 1V49A 1RWSA 2ZJDA 1SXDA 2FUG1 3C29A 5J17A 4WJNA 5C1ZA 2JZBB 5AI5A 2KJRA 3KHRA 4Q44A 4MGYE 5KG1A 4IL6U 4DEZA 2DYBA 4Y2RA 2L0FA 3NJTA 3UM9A 1XO3A 4AUQC 5H92C 3X0WA 2HTHA 5BYSA 1WH3A 4RGOS 1T5XD 3FM9A 1V86A 5KFUA 1TGZB 3ZD8A 2BB6A 2KN5A 3V05A 2F1HA 1SEBD 5D46A 3RB6A 1E8ZA 3HX0A 8ICZA 3AE5B 2QMTA 2ZUCA 4O3QA 4UATA 3ZNGC 1IGDA 3AQEA 4O3RA 3VTWA 3PO0A 4E74A 4C00A 1PGXA 4W9IA 1QQ5A 2KN7A 4F5QA 3DBSA 1JWMD 4UBBA 3LYSA 4CF3A 4DSJA 2LVQA 3OSNA 3GE8C 9ICKA 4ECZA 4B9MA 2LGDA 3PSPA 1JX4A 2LEKA 4DL6A 5KL1B 1IV8A 2OXOA 5AZHA 4BKSA 3ZI4A 4TKNA 1PZNA 4W9LA 1YMHE 3KVFB 1D5XC 4OVUA 4LZDA 5DBCA 1BUIC 3D32A 3CSFA 3PLVA 3BJYA 1DOYA 2WB1C 1L2NA 4DQOC 1E7PB 2AQ4A 3H8JA 2P35A 2KVRA 2LYAA 4ZOHC 1VRAB 4GN1A 4ANWA 5EE9A 4OVZA 2W3RA 5J2HA 2H3FA 4RUCA 5KG4A 1XS9D 4M6WA 2HOIA 4KLDA 3KHLA 2Y3AA 2JUOA 3TIXA 2KSOB 3TUOA 3BDPA 1U45A 4MSMB 3K75D 3JPOA 3AEEB 4R64A 3PSFA 3AXCA 2FCNA 4WAAA 5HG2A 1NKBA 2IY1B 4YSYB 1N62A 1KLUD 2O6VA 1FPYA 2KC1A 3LB8C 4W9EA 2C2RA 3H7SA 3N1YC 1HUZA 1WMHA 4HDOA 4YCXA 2LGYA 3UMCA 1ZJNA 4F4ZA 2V0GA 1I42A 5I4DA 2NV3A 1PVQA 2FCQA 1Z4OA 3WKCA 3AN1A 4RGTA 1Q1OA 1J0GA 2EKEC 2V4QA 4J9SA 3B0XA 5J0XA 3MDAA 3FILA 3OLMD 2BQ3A 4GC6A 1F44A 2BYTA 2ZW0A 4FS1A 2GBRA 3V3XA 4TQ1A 2QHOA 4MM3A 2D3BA 1YQ4B 2CHZA 2B3AA 3DVNU 3H9DA 2L5YA 1RYRA 2R2OA 5BO4B 2GMIC 4CF5A 1F2RC 5KG0A 3DWGC 4I6NB 4DQQA 1X42A 3QEBZ 2JXJA 4LJXA 2KFKB 5E6OA 5ALZA 4EYIB 1KM7A 3RAXA 1XO1A 3UXOA 3DPDA 3AI5A 3GS2A 2JT4B 9ICGA 2XO7A 2LASA 1A5RA 4B0MA 1ZQIA 5IIOA 3PW0A 3V6JA 4B9NA 4Q8FA 2JF5A 9ICUA 1YZ6A 4FE3A 1ACCA 4Z6DA 1ZQTA 3TEWA 1NKCA 1YOVB 1TAQA 2HBKA 2CU3A 1GAQB 3AE6B 2W9BA 3M9MB 3K9OB 2JZPA 5GMVA 3C21A 2AQ1B 5AI0A 1K1QA 4W9CA 2RHFA 2ZJAA 1DRGA 3A9KA 5IILA 1XO0A 1U47A 4P16A 2MX2A 3GV8B 1AROP 1OQYA 3KBBA 1NZPA 1V9PA 4YSXB 5AM3A 2JU6X 2LM4A 4RT2A 1FCLA 4QZCA 1AYFA 1BPXA 1JMLA 4BFRA 3RJKA 3TACB 3RR8A 1Z5SB 2BPCA 5KFQA 2EAOA 3H7IA 2Z0DB 3I57A 7ICSA 5CP2A 1HUOA 8ICAA 3AEGB 4F5OA 4DS4A 4IUMB 3QU4A 4NPNA 4TV3A 1K5OA 5KFCA 5KTQA 2KZMA 4CQNA 4M9NA 2IMWP 1V97A 1CEZA 4J9KA 1Z3EB 3AU6A 3QUTA 1F1HA 5J2CA 3M6ZA 2KWUB 3C1ZA 5KG3A 1ZOYB 2A5UA 3ZRCA 1TAUA 2QB0B 4C8KA 3QE9Y 4W9JA 1RYUA 5KAFU 4I2BA 2O6KA 3F5AA 1E0ZA 1SGGA 1ZYQA 2W3SA 3PW4A 2PMZC 1WGGA 3S6JA 4F8CB 3EW9A 2HDEA 1SKWA 5CJ7A 1NK7A 2INCC 9ICHA 3EA6A 3IAM1 1K52A 2VJ5A 3PSEB 4RNMA 3R7RA 3HUIA 4YL8A 4O5EA 3D6JA 5AKZA 2BF8B 2GLSA 3TBLD 5ALMA 3QUBA 4PGYA 1KLNA 5EWFA 5J29A 5JHAA 1ZQGA 2V3PA 1S0VA 3H0LB 5ALHA 2NRXA 3KYDD 3P63A 2K6QA 3IHPC 3SENA 4QZDA 3V7JA 3H7PA 4UB4A 2WXJA 4MF2A 2UU7A 1P9DU 2KKVA 2JV3A 3DHHC 2AH5A 2RPVA 1JRUA 5KFMA 2W54A 1TY2A 4FJZA 4IDIA 2ZNVC 3CYMA 2J7QB 1WWUA 7ICPA 2XIDA 2MW5A 2BTEA 4GDLA 4FJVB 3VUWA 4QNLA 3ZYYX 2F8LA 3RCZA 4RNOA 1UBIA 4HKZE 3R7QA 5BMHA 2G06A 1TAMA 2BYVE 4MELA 4RM8A 4GU2A 1UF0A 2DPJA 4QJFB 2ICIA 5ALUA 3IT6B 1C20A 3QU9A 5J2BA 2D2QA 3WK4A 4DF8A 3PX6A 2YMLA 2PEAA 2J6UA 2FIFA 3OJ4B 2EMSA 1NI3A 5D3DA 3H8SA 3C0RB 2FIDA 4LK0M 2KNBA 5GTIU 4UB3A 3HM6X 2PVOD 2WLBA 4O3OA 4AYBC 4PGXA 4IWOA 3RNBC 1TKGA 3E56A 3N7SC 3AEBB 8ICHA 3DWMA 2ZCBA 2FJ6A 3ZNID 2H3ZA 3RJJA 1A70A 1X9SA 3Q8RB 5EE1A 3A9JA 3AU2A 4N58A 3A9KB 3RZWC 4P0QB 1QKZA 2K89A 5DB9A 4GSWA 3EHVA 2HHTA 4K7SA 1GC6A 3Q3OC 1KDHA 2R8GA 3NZ3A 3IP4B 2BCRA 2WWZA 3ML8A 4DHJD 2D8CA 3QX7A 1XLNA 3GIIA 1UT8A 1COOA 4PL2A 1E9MA 1ZQMA 3AE1B 2DQNB 5J0UA 5BPCA 4BGDA 4F1SA 2BQRA 3AEAB 5KFXA 1KW4A 5F9LA 2YB1A 3H1UA 4JWUC 4M8MA 5J2JA 3I5JC 4KGSA 2BZFA 1YIWA 2KHQA 2IHNA 3LVWA 1UHUA 1C78A 2ONQA 3APFA 3PGEA 4O1NA 3BK1A 4EEWA 2NTSA 5C2TB 3Q8BA 1QT9A 3DHGC 1CZPA 5DG9A 2HBJA 5BOMA 1Z00A 3D2QA 3BY4B 3QC8B 1FD6A 3HPOA 2VA2A 3PO4A 5DLFA 1KLVA 7ICNA 1S9FA 1SE3A 4UB5A 1X66A 2K60A 3BS5B 2N7JA 3VRAB 3EC8A 1HJPA 2IA6A 2BPSA 4EZ9A 1ZQHA 1D5ZC 1GG3A 4PHAA 4UAZA 1V5TA 4WQOB 2YB4A 5BOLA 2R18A 4PJ0U 3WK5A 1FRDA 1WE7A 8ICEA 3V6KA 3QCAA 2QLTA 3KZXA 2NO4A 3SD7A 2NMQA 4RQ5A 4PZOA 4IR9A 2OJRA 5KT2A 2ZVOA 3LYYA 4G11A 2J4XA 2Y5CA 4C0ZA 4A6QA 4S0RA 3H7PB 1YN5A 4KIKA 7ICGA 1C4PA 1R7SA 2RDIA 2DWQA 5MPOA 4I29A 1ZD3A 4F4WA 1JN3A 2IOFK 5J2RA 4Q8EA 3BVMA 2YN4A 1AN8A 5IP4D 2ES6A 3HIZA 4C8LA 3ZRFA 3E0FA 2KFKA 4EZLA 4Q45A 4BAXA 5AKHA 2KT7A 4DF4A 2W04A 3PMNA 4IW0A 3T5LA 3OGUA 1E8YA 3HM3A 2IY0B 2PE9A 2ZUBA 3KW5B 7ICJA 4BKTA 3KLSX 4NNJB 5F3XB 2PIAA 3ZKJC 2BVCA 3FILB 3MFHA 3M62B 3QNMA 4P0PA 4WH4A 5IOIA 4RUAA 2FMQA 4EE2A 1UCVA 2UVRA 2IO1B 5FP0A 2XGQA 4HK2A 1XWLA 3MHZA 2SAKA 2VJ4A 4CGZA 4W9HA 9ICCA 3Q14C 3ED5A 9ICEA 4NLBA 1P7DA 1C79A 2BHNA 4GXBA 2BT6A 3PW5A 5EDSA 1FNVA 5KT6A 3M95A 2XY5A 4KLFA 4IRCA 2E8MA 4REZA 5J0OA 2WXKA 3NHEB 2AU0A 1RLFA 3L17A 1L0YB 4X57B 2BCVA 4KGRA 2L00B 5D6JB 5DB7A 4NQLB 4IG7B 1SZHA 4EZJA 2LHTA 4PHDA 3BZDB 1YD8U 2KWVB 3R8BA 4GXIA 3HVDA 5TISU 2LPEA 3OTQA 4DSLA 4M0AA 5E6NA 3QU5A 2HJ1A 4YTMB 1MQ3A 4ED1A 3WK8A 3VH4B 2DUYA 4LNKA 1L7PA 3Q8AA 1JMSA 5ALVA 4G9BA 1JWUD 5AI9A 4ECXA 3QWZB 2GO7A 2JH1A 3MGHA 2LXCA 3BIID 2KO3A 4EYHB 2R61A 2HI0A 4HPLB 2LKYA 2EZYA 2MBOA 3B1LX 8ICKA 2QJLA 2I2YA 1TYGB 3V6EB 1XLPA 2LHDA 5T8IA 2ZUDA 4C7YA 3MR5A 2JEFA 1QOFA 2EANA 1BNPA 1E10A 1D8LA 2KMCA 2VIXA 2R8IA 5ALJA 4ED0A 1EO6A 1U9LA 1XSPA 4LNIA 3RJGA 2Z0EB 2ACZB 5L1MA 2GBKA 1JWAD 4KSKC 5H2FU 1IG6A 3RAQA 2Z7JA 3BQ0A 1M4VA 3BQTA 2ZTCA 4QW9A 4OJ6A 3Q6BA 2W9AA 2JYTA 2KHWB 4DLEA 9ICJA 2C7MB 5DQIA 3PTFC 4NAWB 8ICMA 4ICAA 2ZIUB 1Z4NA 4TUSA 5JHBA 2PI4A 5EWGA 1P7EA 2DNFA 3KUZA 4MJSA 4E0DA 3IV6A 4RQ3A 2YVCA 9ICXA 2RDHA 4ECQA 5B66U 4GC7A 2LFIA 4W9DA 3U30A 3VFKA 3VUYA 1IM4A 3ZJVA 4B6WA 4ED6A 1ZW7A 2CR5A 3ZTCA 4F8RA 4YG2A 1QQRA 4UAUA 2KQSA 1YX6B 4YR0A 4Q43A 1ISNA 3AQFA 3DVGX 5DBAA 2B76B 4KITB 1JALA 2LYBA 3ZUNA 1AQ6A 1WXSA 1N2XA 4ELTA 2MA1A 2L8JA 5CB1A 4KZCA 3V6HA 2DKXA 1ZQWA 1D9DA 2IHMA 1YT3A 3KWLA 3MP9A 7ICRA 1NENB 4O5KA 4YXJA 1S77D 1PGBA 2WF6A 2KVZA 3PLUA 3A0HU 2KXJA 2WHEA 4O3NA 1NOMA 3UXNA 3G6YA 2PFQA 1YQ3B 1MFWA 4NJCA 4RQ0A 5ALQA 2C28A 2QC8A 4GOCA 4Z6CA 2RPQA 4I2IA 5L1IA 1YX5B 3ZDBA 2DGZA 1Q5WB 4TUUA 3HVZA 3MFIA 3I9V1 2A3VA 2KOBA 2OEHA 3A1QA 1PUTA 2AJQA 4RZRA 4GLXA 1NK9A 3RF9A 3UIOB 3BINA 7ICOA 5DPWA 5L9XA 2WB1F 1OW5A 4KMOB 1WXMA 4WAFA 2KX0A 2WQYB 4EBCA 4FS2A 5IAAC 4BOZB 4I2FA 1ENFA 1FXTB 3M8SA 5DKWA 1HZ5A 4J3OD 3QHTA 5AKGA 1QQ6A 4IM2A 2PLPA 4PHPA 3H8MA 4A3PA 2QIEB 1ZQOA 3Q8PB 3V61A 1WYGA 5KFZA 4B95A 5JH5C 1QSYA 1TVAA 3DEEA 4MEXA 2LVOA 4OCZA 4J9QA 1I4RA 2JVCA 1ZUD2 4R66A 3SDLC 4CF4A 3BYYB 4P4OA 4PZNA 4PYUA 2F1JA 1L7YA 5ALDA 2XY7A 4LVSA 4BKSD 3KD3A 5HP4A 3THVA 1TKYA 3BVGA 3QQ8B 3A4RA 2DENB 1L5UA 2MEKA 4YMMA 4P1CC 3VCBA 2XC9A 3JPNA 4HYKA 1PFDA 1DOXA 1KQQA 2HBLA 2BDPA 5DB6A 2JZ3B 4KKJA 4BVUC 1AW7A 2DBYA 4FA6A 2V9WA 3S2AA 4KN4A 2PI5A 2JQRB 5KFHA 2NPTB 3U2SC 1ZDVA 2CKHB 4C56C 1X6JA 4DOCA 1JXEA 2K4EA 2VA8A 2IGDA 4NY8A 4IOIE 1LB2B 3PR4A 1S0MA 5CA7A 1ZQFA 2FLNA 1GNUA 3IN5A 4DS5A 4X5VA 4PL1A 2Y1JA 2INPE 1ZD5A 1KJTA 1UBQA 2QSDA 3Q8KA 1DYQA 1XEEA 4NJ8A 1S0NA 1ED1A 3QK0A 1RPLA 3RFAA 2ZPYA 5ALPA 1SV0A 4DLGA 2Y1IA 4PPXA 4PT5A 2AQ2B 2I5HA 1ZQQA 2ASDA 2DL0A 2KK0A 2JWUA 2KDIA 3LDZE 5D3IB 4YMNA 4BUGA 3IXSA 4GDKA 4NY0A 4DFDA 3DBHB 4WWMA 2M9NA 1FXAA 4OZCA 2R8KA 2JZZA 3ZIMA 1K8RB 5ALOA 3MGVA 3SFDB 3WALA 2HHVA 4YMOA 3RH6A 2MJ3A 1J2NA 4I2HA 4R63A 2IGHA 1JIHA 4O3MA 5DDMA 5KT5A 2JYEA 4ED2A 3P4RB 4QWDA 1IPGA 1ET6A 2GI9A 1JUDA 5KFEA 1S10A 1U49A 2I1JA 2GOLA 4ZYSA 5AM0A 2MSNA 3C1YA 4Z6EA 2KMMA 3U8ZA 5EE0A 1IBXB 1Z1VA 2XK5B 2NBUA 4I2AA 4GLSC 2PMVA 4IKGA 5LNK1 4PS3A 2Z59B 2F76X 5J0YA 4P7IA 1V1PB 2IOHA 3QU7A 1OTRB 2INNE 4Y2QA 2RDBC 5KFYA 1CUKA 4DXFA 1KH0A 1C3TA 4EZ6A 1L0XB 1WRDB 4NL9A 4GFJA 5ALWA 2L76A 3QZ7A 1L6UA 2G07A 1UELA 4ICVA 3HT3A 4PGQA 2N7DA 3CMMB 2F77X 3PT2B 1ZQYA 2KKPA 2FMSA 1ZQEA 1I7HA 3TKAA 3WKEA 1ROEA 4BX9C 4NLCA 2XVTA 2GBNA 1RZTA 2E3TA 1F0MA 4Y2TA 1N48A 2P6RA 1E8XA 2RQ5A 3TADA 1BMLC 4DL7A 3TAQA 4JWNA 2YTUA 3WCQA 1OGWA 5TZVA 3RFZB 2R8HA 4ELUA 2ZIXA 4I6LB 2KMDA 4R8UB 1WGYA 5C23A 4BBNF 4NJ6A 2KYWA 3CW2C 1R4NI 2KVSA 1K50A 2OEDA 2CHXA 2V4RA 5J0PA 3NGDA 1NK8A 3KUCB 1L3SA 3J81j 4HJGE 1D6EC 1WJUA 3ENEA 3T9LA 5ALNA 2PMZF 1BPDA 9ICBA 1EM7A 4DOAA 3H40A 5K4LA 2DZMA 1KSPA 2O6VB 1FNUA 3ISBA 1NJXA 4GDLB 3UF8A 5KFIA 3BYTB 5J0RA 1DXSA 4R3DA 3RBEA 4R65A 1A76A 4RQNA 5DB8A 1WCLA 1S0OA 2H88B 3PX4A 2UYZB 4M0WB 1CI4A 1C77A 2DLBA 3PZDA 4W9KA 5H8YE 2L3ZA 4M6WB 4PK1A 2XCPA 4DFKA 1BPBA 4RMAA 3MHSD 3KTQA 2KP7A 3M9NB 5KFFA 5HKHA 4JB3A 1ZPSA 1T7PA 4OJOA 3RN9C 1CQVA 1VZ8A 3DBRB 3C5GA 5IO9A 8ICJA 2K6DB 3SI8A 5J2EA 5ALRA 1LVHA 2BB5A 1T0SC 4E71A 2UVVA 4K4GA 4KZ0A 2G3QB 4DHJB 3Q8EA 2QKQA 1R4MB 5J0SA 4RQ6A 4UBCA 1Y88A 1COKA 4WJPA 2BKRB 4AS1A 2GH1A 4UAYA 4HJKA 4K1RB 1B9RA 5DG8A 2E6XA 1DK2A 3ETLA 3IRUA 3KKAA 2ZPNA 2FPKA 1ZQPA 1RFKA 5T14A 2ZVNA 2F8KA 3AH7A 5AI6A 5HR7A 3SZ2A 3IT4B 2JXXA 3T5KA 1ECWA 3DDHA 3TANA 1NJYA 4BXOB 5IIIA 5EOZA 4DXGA 1NDDA 1Y8RC 2WXLA 4A9AA 1S3SG 3M7DA 1RRBA 1C7YA 4QZBA 3AE2B 1LXDA 1V2YA 5JU5A 4DWIA 3EFUA 4PH5A 3ML9A 5AKXA 4Q2JA 5CHWA 1I4QA 1BVSA 3TCAA 4M9LA 3PHXB 3SFEB 1WGDA 1L7OA 3C28A 3NS1A 4I2EA 5FR6A 3P2BA 4FZMA 1IP9A 4K4HA 5AK6A 1L4DB 4I2GA 1YJJA
chains in the Genus database with same CATH topology
1NYRA 4L23A 1TS3A 4O1NA 3BK1A 2NTSA 5C2TB 3Q8BA 3W2DA 1QT9A 2WXGA 1N60A 1CZPA 2H89B 1QOAA 3BWUD 1ZP0B 2JX5A 1FD6A 3L4PA 1IUEA 2WDVB 4TSSA 1TS4A 4JPSA 1J7BA 2IPKD 4HEA1 1SE3A 2N7JA 4GDKB 3VRAB 5FR3A 1FEHA 4HRSA 2IDYA 3AECB 4XWTA 1J7CA 1D5ZC 2M19A 1N61A 2WXPA 4ZHOA 2W55A 1C4CA 1SF0A 1SE4A 1L4ZB 2GB1A 1DOIA 1FFUA 1FRDA 3UI3A 1FNWA 3ETRA 1SJED 1STEA 1UUPA 4LTUA 2NMQA 3U7ZA 3ZQ4A 3LYYA 2D5GA 1C76A 2BS3B 1SIJA 2J4XA 2Y5CA 4A6QA 2BW2A 1YN5A 1C4PA 2WP9B 3H8HA 1R7SA 2DYMA 2DWQA 5MPOA 4MH8A 2N9LA 1VJKA 1VZ7A 3B9JA 1GOZA 3BVMA 2Y5PA 1AN8A 1D4BA 1SB3C 2IJ0A 3SR6A 1KLGD 1FM0D 2KAJA 3N9YC 1IGCA 1UWMA 5FK9C 3T3OA 1Y56A 2L52A 1OFFA 4NAMA 4JX1C 1ESFA 4C7ZA 3KLSX 2PIAA 2WNMA 1ZXHA 2AQ3B 3FILB 4ZRQA 4KX6B 2LJIA 3KWVA 4WH4A 3TEYA 2J53A 4EE2A 2BBCA 1RYJA 2DYOA 3O13A 3R2IA 1E6EB 2MH7A 3MHZA 5HI1A 1YNTE 2SAKA 1IBXA 3Q8CA 1C79A 2BT6A 1FNVA 2K3UA 1V1OA 5BYQA 4REZA 3AEDB 2WXKA 4ARIA 1L0YB 2OHFA 2QILA 2YEPF 1FFVA 3J9CA 4KGRA 4ZHPA 1JW9D 4MT5A 1WWTA 1JROA 1TY0A 3BZDB 3R8BA 3HVDA 3KQ4A 1F77A 1HEZE 2KN4A 2G1EA 2KWDA 4YSZB 4YXDB 1MHHE 4YTMB 2WXOA 4XDDA 3Q8AA 4USAA 3MC0B 1JWUD 3W1SA 3HRDD 1HZ6A 3BIID 2R61A 5JXVA 1JWBD 2L83A 2K0PA 4C80A 3AV8A 2QJLA 2I2YA 1TYGB 1XLPA 4HKQA 1FRRA 4TMAB 2LHDA 1GB1A 5T8IA 1YJIA 4C7YA 1V8CA 1QOFA 1UGJA 2M56B 3CWIA 4YTPB 1E10A 2WS3B 1XF5L 2V3NA 4L2YA 1SSNA 1T6BX 4NZLB 3B2FA 1OQQA 4OW0A 2ACZB 3AMZA 4OHJA 4B0EA 2V4IB 1JWAD 2WXRA 2J42A 2SEBD 1ZE3D 1M4VA 1GPXA 3AB5A 2JYTA 1YN3A 3AM9A 4MM3B 1ZXIA 1QLBB 2VZKB 4NAWB 1OQRA 3NVVA 3AEFB 2FE8A 3PZ8A 1DGJA 2Z8LA 1P7EA 4P6VF 4US8A 1KRHA 2TSSA 2RDHA 3B2GA 2LFIA 1RWSA 2FUG1 5G5HA 5G5GA 3ZJVA 1WRIA 2KDMA 1VLBA 1EWCA 1QQRA 3P42A 2HTME 1XO3A 5H92C 2B76B 4WURA 2WDQB 4RNAA 5BYSA 1JALA 2QEJC 1T5XD 1MPEA 4RGOS 1QOBA 3V05A 2BB6A 3EGRA 2VZKD 4AQ7A 2JSVX 1JRPA 1BXTA 1SEBD 3KWLA 3MP9A 3Q8FA 3NVWA 1NENB 1PGBA 4JE3B 3SEBA 1MHXA 1QOGA 4RGNA 3P1MA 1V1PA 1YQ3B 2M0AA 2QMTA 3AE5B 4NJCA 3AE3B 4RH6A 4RF1A 2Q5WD 2L32A 3TSSA 1FMAD 1IGDA 3GP7A 3PO0A 4KGTA 1TZOA 2PVGC 1PGXA 4YWGG 3HVZA 3I9V1 3BK2A 1K53A 1JWMD 2BS2B 3AE7B 1I4HA 1PUTA 2WXFA 5HHDG 2LEKA 5EE3A 4WAFA 3GB1A 3PZ7A 2WQYB 3VRBB 5E6JA 1EWYC 3EUB2 1ENFA 1YMHE 1D5XC 2LGIA 3VR8B 1VDVA 1L0VB 2I38A 1HZ5A 1BUIC 4J3OD 3NUHB 1DOYA 1MI0A 1E7PB 2PLPA 2X38A 4DQOC 4ZOHC 1VRAB 2QIEB 5EE9A 2RMMA 4OVZA 1WYGA 2W3RA 1FCCC 1NYQA 1PGAA 2MJEA 2Y3AA 2LMCA 2WXIA 1CK1A 1SJHD 3TUOA 3URYA 1I4RA 3AEEB 1KF6B 1ZUD2 1EU4A 4WIPA 1KFYB 3BYYB 4RF0A 5HG2A 1L6VA 4YSYB 1N62A 1KLUD 2AX5A 3NVZA 1TKYA 2WXMA 1NEKB 3BVGA 5AUIA 4JWSC 5BMGA 3LB8C 4TQ0A 2MEKA 2RDGA 2WXQA 3W9CB 1JWSD 1PFDA 1DOXA 4A8XC 2WDRB 1HXYD 4KKJA 1J7AA 1AW7A 2DBYA 2V0GA 4FXCA 1KTKA 5FKAC 2JQRB 2L1AA 5I4DA 3U2SC 1ZDVA 4C56C 2K9XA 4M0WA 3AN1A 4RGTA 2IGDA 4IOIE 3FILA 2BYTA 1UWXA 2ZW0A 1FO4A 2MJDA 2INPE 3V3XA 4TQ1A 5BYRA 2QSDA 1YQ4B 1DYQA 1HQRD 1XEEA 3LXFA 4WQMA 1SE2A 1Q10A 4RGMA 1F2RC 1N5XA 3DWGC 1VR9A 2PW9A 2AQ2B 4PT5A 2KACA 3MFGA 2W82A 2JWUA 1WGKA 5D3IB 5GXGB 3ABVB 4N6EB 1I4GA 3GS2A 3W5VB 3IXSA 1I4PA 4B0MA 4WWMA 4OZCA 1FXAA 4MACA 1XLQA 3SFDB 1N63A 1NVID 3FAHA 1ACCA 2MJ3A 3TEXA 2IGHA 3TEWA 4ARCA 2JYEA 1EU3A 3P4RB 2CU3A 2KQ4X 1GAQB 3AE6B 1ET6A 2GI9A 1SBBB 1TKEA 5HFYA 2JZPA 3AE9B 4ZYSA 2AQ1B 1VZ6A 2KMMA 1FXIA 5AUKA 3NRZA 5EE0A 1IBXB 4GLSC 1GB4A 2PMVA 4IKGA 1C9FA 2CJOA 4P16A 1C4AA 5LNK1 3ZJTA 4YSXB 3AE8B 2JU6X 1V1PB 2GRIA 3IAS1 1WXQA 2INNE 1FCLA 1AYFA 3CIRB 4DXFA 1TS2A 1KH0A 1JMLA 4KKIA 3VQIA 5BMIA 2WXNA 1L0XB 3I57A 3MJ5A 3NVYA 2XN9C 1L6UA 2LHEA 4LLGM 4UDUC 4A90A 2PKOA 3AEGB 2BS4B 2K5PA 1I7HA 1ROEA 3ZGZA 4CQNA 1V97A 2IGGA 2E3TA 4YTNB 3T3NA 1BMLC 3ZJUA 1CJEA 1ZOYB 3AE4B 3WCQA 1TS5A 3FC4A 1JCKB 2N0SB 3RFZB 1MVKA 1PYWD 1E0ZA 2W3SA 4D2KA 1K50A 2OEDA 2HDEA 4L1BA 2YEPB 5D7GA 4A55A 4OZBA 3EA6A 2WXHA 3IAM1 1K52A 1PDXA 4HJGE 1D5MC 3HUIA 1D6EC 5TSSA 4US9A 1SXTA 1EM7A 1N5WA 4N59A 2ON8A 2V3PA 1B1ZA 1FNUA 2G9HD 1JQ4A 2NTTA 4GDLB 4OZAA 1QF6A 2J52A 3P63A 3BYTB 3U4EG 4R3DA 4RFBA 4YT0B 2WXJA 3R2TA 3P4QB 1XLOA 2RPVA 2H88B 1F2RI 1LO5D 2EKIA 1TY2A 2W54A 4IDIA 2DLBA 1C77A 5H8YE 1L5PA 1YN4A 3TEZA 2CJNA 3ZYYX 2BTEA 5BMHA 4HKZE 1ZDXA 1ZPSA 2WU5B 3E9SA 4XE0A 1CQVA 1VZ8A 2ICIA 2PTLA 2N9KA 3IT6B 2K22A 1XCQL 4ZRPA 2BB5A 1F0ZA 1FIQA 1NI3A 4ITKA 5D3DA 4LK0M 3Q8EA 2PVOD 2WLBA 1P7FA 3P4PB 3U52E 4H2AA 4HROA 4AS1A 3OWEB 1B9RA 1TKGA 3E56A 3AEBB 3DWMA 2E6XA 2FBWB 4XWWA 1QILA 1RFKA 1A70A 1K51A 1HA5A 5EE1A 3AH7A 4N58A 2ZW1A 1QKZA 3IT4B 1ET9A 1RM6C 3P4SB 2JXTA 1AWDA 3NZ3A 4DXGA 1XCTL 2WXLA 2XNAC 1WSPA 4A9AA 3BVZA 2WU2B 3AE2B 1XLNA 4XDCA 3VR9B 1TJEA 2EELA 3RPFC 1E9MA 3AE1B 4Q2JA 1I4QA 1UNSA 3W5UB 5C3JB 3Q69A 3AEAB 3C8YA 4JWUC 3SFEB 2LUMA 1I4XA 1T3QA 4KGSA 4RCOA 3NS1A 1L4DB 1XXGA 1C78A 2ONQA 1YJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BII D;  4YTN B;  1NYR A;  1CJE A;  5C2T B;  1ZOY B;  3AE4 B;  1JWB D;  2L83 A;  3AEE B;  3FC4 A;  4C80 A;  1KF6 B;  1QT9 A;  1N60 A;  1CZP A;  1ZUD 2;  2H89 B;  3AV8 A;  2N0S B;  2QJL A;  1KFY B;  1QOA A;  1TYG B;  1XLP A;  1E0Z A;  1ZP0 B;  1FRR A;  2JX5 A;  2W3S A;  1L6V A;  4YSY B;  1N62 A;  3L4P A;  1IUE A;  2AX5 A;  2WDV B;  3NVZ A;  1YJI A;  1TKY A;  1NEK B;  5AUI A;  4C7Y A;  1V8C A;  1QOF A;  1J7B A;  2M56 B;  3CWI A;  3LB8 C;  4JWS C;  4YTP B;  1E10 A;  3VRA B;  3W9C B;  2WS3 B;  1PFD A;  1DOX A;  1PDX A;  2WDR B;  4HRS A;  3WCQ A;  3B2F A;  3AEC B;  3HUI A;  1J7A A;  1OQQ A;  2ACZ B;  3AMZ A;  4US9 A;  1J7C A;  2DBY A;  2M19 A;  1N61 A;  4FXC A;  1JWA D;  2JQR B;  4ZHO A;  1N5W A;  4N59 A;  2K9X A;  3AN1 A;  2W55 A;  1JQ4 A;  1SF0 A;  1GPX A;  3AB5 A;  1DOI A;  1FFU A;  3AM9 A;  1FRD A;  3P63 A;  1QF6 A;  1ZXI A;  3ETR A;  1QLB B;  1OQR A;  4LTU A;  4YT0 B;  3NVV A;  1FO4 A;  2MJD A;  3AEF B;  1DGJ A;  3P4Q B;  1XLO A;  4P6V F;  1YQ4 B;  2BS3 B;  1SIJ A;  4US8 A;  2Y5C A;  2H88 B;  2EKI A;  1KRH A;  3LXF A;  4WQM A;  2W54 A;  4IDI A;  2WP9 B;  5H8Y E;  1N5X A;  1R7S A;  1L5P A;  3DWG C;  3B2G A;  2DWQ A;  5MPO A;  1RWS A;  2CJN A;  3ZYY X;  1VJK A;  5G5H A;  5G5G A;  1WRI A;  3B9J A;  1VLB A;  2WU5 B;  1WGK A;  5GXG B;  2HTM E;  3ABV B;  1SB3 C;  4N6E B;  3W5V B;  1XO3 A;  3SR6 A;  5H92 C;  2B76 B;  4WWM A;  2WDQ B;  1FXA A;  1JAL A;  1FM0 D;  2KAJ A;  1XLQ A;  3SFD B;  2K22 A;  1QOB A;  1N63 A;  1NVI D;  3FAH A;  1UWM A;  2MJ3 A;  1F0Z A;  1FIQ A;  1JRP A;  3KWL A;  1NI3 A;  2L52 A;  1OFF A;  4ITK A;  3NVW A;  1NEN B;  3P4R B;  4JX1 C;  2CU3 A;  1QOG A;  1GAQ B;  3AE6 B;  3P1M A;  4C7Z A;  2PVO D;  2WLB A;  2PIA A;  1TKE A;  1YQ3 B;  3AE5 B;  3P4P B;  3AE3 B;  4KX6 B;  4HRO A;  2Q5W D;  3AE9 B;  1FMA D;  1B9R A;  1TKG A;  2KMM A;  1FXI A;  1RYJ A;  3NRZ A;  3AEB B;  3PO0 A;  3DWM A;  5EE0 A;  5AUK A;  1E6E B;  2MH7 A;  2FBW B;  1RFK A;  2PVG C;  1A70 A;  2CJO A;  3HVZ A;  5EE1 A;  3AH7 A;  4N58 A;  4YSX B;  2BT6 A;  2BS2 B;  3AE8 B;  3AE7 B;  1PUT A;  1WXQ A;  1AYF A;  1RM6 C;  3AED B;  3P4S B;  3CIR B;  1AWD A;  2LEK A;  5EE3 A;  2OHF A;  2WQY B;  3VRB B;  1FFV A;  4ZHP A;  4A9A A;  1JW9 D;  1EWY C;  1WWT A;  3EUB 2;  1JRO A;  2WU2 B;  3AE2 B;  1XLN A;  3VR9 B;  3VR8 B;  1TJE A;  3NVY A;  1VDV A;  1L0V B;  1L6U A;  1E9M A;  3RPF C;  3AE1 B;  2PKO A;  3AEG B;  3W5U B;  5C3J B;  1DOY A;  2BS4 B;  2G1E A;  1E7P B;  2K5P A;  3AEA B;  4JWU C;  3SFE B;  4YSZ B;  4ZOH C;  4YXD B;  4YTM B;  2QIE B;  5EE9 A;  1T3Q A;  1I7H A;  3NS1 A;  1WYG A;  2W3R A;  4USA A;  1NYQ A;  1ROE A;  2MJE A;  1V97 A;  3HRD D;  1YJJ A;  2E3T A; 
#chains in the Genus database with same CATH topology
 4NXZ A;  4RPZ A;  2O2V B;  1NJZ A;  3HIL A;  2I6X A;  2LXA A;  3KZI U;  1L8O A;  3W2D A;  2WXG A;  4F7Z A;  5AKE A;  4JV0 A;  2JX5 A;  3C19 A;  4EEN A;  1EXN A;  4AOF A;  3GV5 B;  2H3Q A;  2ASL A;  1WYW B;  2ZIX B;  2FE9 A;  2A4Z A;  2WGS A;  8ICC A;  2IPK D;  4P2H A;  3IVF A;  2E8O A;  5J0Q A;  5FR3 A;  1FEH A;  8ICI A;  2IDY A;  3KHH A;  2NRV A;  3AEC B;  5J2D A;  3QZ8 A;  1BPZ A;  2V9H A;  4JQW C;  8ICU A;  1WX7 A;  2WXP A;  4ZHO A;  1XT9 B;  5IA7 A;  2VH1 A;  3OHA A;  1L4Z B;  5KFS A;  1ZQK A;  4BWM A;  4K7W A;  4M9J A;  1UUP A;  3DQV A;  1WFY A;  4DDG D;  2WTF A;  2B6G A;  4M04 A;  3APC A;  3ORY A;  1X9X A;  4LZG A;  3WK9 A;  3I76 A;  2KIC A;  2YMP A;  4JUZ A;  2KOX A;  2DYM A;  5IIM A;  2FAZ A;  5DGB A;  2KVC A;  4OD0 A;  2YY6 A;  5KFB A;  3B9J A;  1S97 A;  4NL9 C;  1GOZ A;  1R4N B;  2ISP A;  2Y5P A;  1LFD A;  1D4B A;  4PS7 A;  3UIP B;  1WXA A;  2IJ0 A;  2C7H A;  5LXI B;  2EZZ A;  2E1E A;  3SR6 A;  4C4T A;  5KFK A;  1KLG D;  1FM0 D;  2KAJ A;  4II2 B;  3N9Y C;  1V5O A;  2BWE S;  2R2Q A;  5KFT A;  5FK9 C;  1UQV A;  3HWT A;  1WJ6 A;  1OFF A;  4MFF A;  2WYQ A;  4ZRI A;  2RP5 A;  1TZ1 A;  2BPF A;  1TKD A;  4C7Z A;  3HKZ F;  2AQ3 B;  2RGF A;  2KD0 A;  3TFS A;  4KX6 B;  5JUM A;  1WR6 E;  5J0W A;  4LDT B;  5KFA A;  2DKZ A;  2JEI A;  5DPT A;  3M63 B;  3R2I A;  5ALL A;  2DAJ A;  3MAB A;  1IBX A;  3MTN B;  4P4M A;  1V81 A;  1ZKH A;  4QAY A;  5AKY A;  1L3U A;  9ICI A;  4A3O A;  4J03 A;  2F1I A;  2JHD A;  4HDQ A;  4MEY A;  1V1O A;  7ICL A;  3RB4 A;  2PJH A;  3WAO A;  1MN8 A;  4RU9 A;  1L6N A;  3AED B;  3ONN A;  2ZIV A;  2OHF A;  2QIL A;  3RYT A;  9ICL A;  2C7N B;  4ANV A;  1P98 A;  3ALB A;  4OVV A;  1CMX B;  1U4B A;  2ZIW B;  1RAX A;  3BZK A;  4Y2U A;  3LWM A;  2BCQ A;  2KJ9 A;  4DFM A;  2BYF A;  3MGI A;  2QB1 A;  4YSZ B;  2KJ6 A;  1PUZ A;  2JZB A;  4JLC A;  1S1Q B;  4CHK A;  4ECS A;  1BNO A;  3WKD A;  3MDC A;  3TAP A;  3IG8 A;  2DX5 B;  4DWF A;  4UB6 U;  4XUS A;  3L10 B;  2KKC A;  2NCN A;  1KOT A;  4LNN A;  2BKE A;  1BT0 A;  3JSV A;  4MGI E;  1JWB D;  1P3Q U;  3AV8 A;  3N1X C;  3GZN I;  4HKQ A;  3H0R B;  1NK0 A;  3OSP A;  1EUV B;  3FDS A;  1TBE A;  2YMQ A;  2PFN A;  1GB1 A;  4R8U A;  4EUT A;  4HPM B;  4F50 A;  2NO5 A;  4NWI A;  2M56 B;  2OOB B;  2DF4 B;  2JRH A;  3T8M A;  2WS3 B;  1XF5 L;  4CE6 A;  3TI0 A;  2V3N A;  4Z6F A;  3SQI A;  2KAN A;  1OQQ A;  4OW0 A;  2Q0Z X;  4YD2 A;  9ICM A;  2J0M A;  4KLT A;  3O0F A;  3GDX A;  1TFR A;  2FI1 A;  8ICO A;  3JPR A;  4ZRJ A;  3UQ0 A;  1RQN A;  5KFW A;  3DOW A;  1GPX A;  5JTI A;  1M94 A;  2V1Y A;  1YN3 A;  1SL0 A;  4ANX A;  4GB9 A;  1ZXI A;  4FHJ A;  2M8S A;  3KFU F;  1QLB B;  1OQR A;  2REX A;  3NVV A;  2ZIV B;  3AEF B;  1DGJ A;  2C2D A;  3ZDT A;  5G55 A;  4US8 A;  2TSS A;  8ICF A;  2G4D B;  1ZQR A;  2PFO A;  2C9W B;  2KIV A;  3PRP B;  3NRW A;  5G5G A;  4NLZ A;  3RUI B;  3RB3 A;  3SMV A;  1A0P A;  1EWC A;  4QWC A;  3P42 A;  2G08 A;  1EF5 A;  1Q3U A;  3ZVV A;  1B43 A;  4EEL A;  1O03 A;  4WUR A;  9ICF A;  2Y0S C;  2G09 A;  2K25 A;  3L0W B;  2XCA A;  1MPE A;  3BQ7 A;  3DBL B;  2M17 A;  2KZR A;  3GV7 B;  3EGR A;  5AZG A;  4C4V A;  2VZK D;  5HML A;  3Q8F A;  1JRP A;  1BXT A;  4AQ7 A;  4F2R A;  3NVW A;  2Q4T A;  3M3J A;  3EFC A;  4DSI A;  3SEB A;  2XY6 A;  1MHX A;  3IG3 A;  4M02 A;  1X40 A;  3SU8 X;  3EPI A;  1V1P A;  2HVI A;  3RNA C;  4RH6 A;  5AM2 A;  2W7P A;  9ICS A;  3AE3 B;  1WGH A;  2L32 A;  1FMA D;  1PQS A;  3I1Y A;  4BKG A;  4NLK A;  4KGT A;  3UXP A;  5ALE A;  1KFS A;  1TZO A;  3BQ2 A;  1TE2 A;  1URJ A;  2ZXH A;  2PVG C;  3B0A A;  4P0Q A;  4YWG G;  4RNN A;  5CTR C;  1OEY J;  3DVN V;  3Q3F A;  3PO5 A;  3PNC A;  4ED3 A;  2BS2 B;  4W9G A;  1I4H A;  2MUT B;  2WXF A;  2D6F C;  1HTO A;  1NJW A;  2C22 A;  2LRW A;  2JGA A;  5EE3 A;  3ECI A;  3GB1 A;  3PZ7 A;  4FZN A;  1T0R C;  5E6J A;  7ICQ A;  1XU4 A;  2H3V A;  2D3D A;  2LYH A;  1L0V B;  1S5L U;  7ICH A;  3I28 A;  2N1R A;  2N9E B;  2X38 A;  3V62 A;  2M0X A;  1UT5 A;  1NYQ A;  2NYV A;  4ED7 A;  4CRX A;  3KH0 A;  3IBE A;  2LMC A;  4KLE A;  1CK1 A;  3NZU A;  2EDU A;  3WKA A;  1EF1 A;  4QZ8 A;  2EAP A;  2MCN B;  4HWI B;  1EU4 A;  4NLG A;  1LKY A;  1O08 A;  4KSL C;  3OHB A;  4RF0 A;  4QZE A;  2HHQ A;  5DDY A;  1Q0W B;  4IM0 A;  1L6V A;  4YD1 A;  4UB8 U;  2UWQ A;  4M00 A;  4YFK A;  1NEK B;  1E5W A;  4JWS C;  5AUI A;  4BXO A;  3RJF A;  1Z19 A;  2ESE A;  1TT5 B;  2RDG A;  1WWV A;  3IFW B;  4A20 A;  2YLM A;  3GQC A;  1WJN A;  1HXY D;  5HMM A;  1J7A A;  4K4I A;  1T0Q C;  1ZQV A;  5FKA C;  3RTV A;  2L05 A;  2K9X A;  4M0W A;  3RMK C;  5DPS A;  3W1Y A;  3MJW A;  4XRH A;  4KLM A;  4YN4 A;  5JRT A;  2W9C A;  2KDB A;  4MFA A;  3PS6 A;  4ACF A;  1UWX A;  4J6I A;  2MJD A;  3EYZ A;  3RRH A;  5BYR A;  4URK A;  2F2A B;  3EZ5 A;  4Y2J A;  3LXF A;  4WQM A;  4FBJ B;  8ICP A;  2H3I A;  5KFG A;  1Q10 A;  3PRZ A;  4LDT D;  4RGM A;  5HR6 A;  5IN7 A;  1NZB A;  3OJS A;  1VR9 A;  3BQ1 A;  2PW9 A;  1A6S A;  1E7U A;  2KAC A;  8ICL A;  4ANU A;  2BQQ A;  3LWL A;  5C0Y A;  2D11 A;  1WGK A;  1RYS A;  1NI2 A;  3ABV B;  2AL6 A;  4RT3 A;  2F3N A;  2M1M A;  2G0A A;  1I4G A;  3PHW B;  8ICY A;  4DQI A;  2V3S A;  4MAC A;  4GIV A;  2WHI A;  1XLQ A;  3UQ2 A;  4ICU A;  4RQ2 A;  2E8P A;  1NVI D;  1KN5 A;  2DAF A;  2DHZ A;  4ECV A;  3TEX A;  3OJ3 A;  4K81 A;  4HCP B;  1EU3 A;  5DPR A;  2K39 A;  2KQ4 X;  5E79 U;  1X2I A;  4WWO A;  4I28 A;  5AKJ A;  1U48 A;  1RXW A;  4MH0 E;  5KG6 A;  4DL5 A;  2LZ6 A;  4RQ8 A;  3TAR A;  1VZ6 A;  4GXJ A;  1FXI A;  5DBB A;  3NRZ A;  3C5F A;  2PKE A;  5AUK A;  3H4B A;  3AUL A;  1C9F A;  4LJO B;  2HHX A;  3ZJT A;  1C4A A;  1YZ7 A;  3HKZ C;  5ALT A;  2Y5B B;  4MF8 A;  3PV8 A;  1NBF C;  3V7K A;  3RJI A;  4KLH A;  2W9N A;  4O9M A;  3AE8 B;  3Q8L A;  2N9P C;  5DLG A;  3T3F A;  2XBB C;  3CIR B;  5KNI A;  3TJP A;  1TS2 A;  3ISD A;  1LKY B;  3F2B A;  3VQI A;  2W8K A;  2J6S A;  2WXN A;  4AJW A;  1L3T A;  3DBL I;  3MJ5 A;  3NVY A;  2XN9 C;  3RNG C;  3AL0 B;  4UDU C;  2MBQ A;  3A1Q B;  4A90 A;  2BS4 B;  1N6Z A;  2G45 B;  1WIA A;  2ZEQ A;  3TQ1 A;  3Q2A C;  4IC7 B;  4XGA B;  3RRG A;  3ZGZ A;  5L1L A;  2ZG6 A;  2KQ7 A;  2IGG A;  5HHH A;  3V6C B;  3SYZ A;  4B9L A;  4YTN B;  1BGX T;  3T3N A;  1D8Y A;  1CJE A;  1WUD A;  2M0N A;  1WZ3 A;  1TS5 A;  3FC4 A;  3AEV A;  2GLE A;  4S17 A;  3N7P D;  1JCK B;  2N0S B;  2UVU A;  4QIW C;  3N97 B;  2RDJ A;  4D2K A;  1MA7 A;  1VD2 A;  2IOF A;  2LM1 A;  4RM9 A;  5GTH U;  4A55 A;  1DOQ A;  2X8X X;  1SZP A;  2WXH A;  1PDX A;  3Q3M C;  4JWM A;  2OCE A;  1OEY A;  2EAM A;  1GO3 F;  2FMP A;  1D5M C;  2KTR B;  5ALK A;  5TSS A;  1PVP A;  3RD2 A;  4QZH A;  5J2A A;  2KD1 A;  2C2E A;  1TIF A;  4W9F A;  5KFN A;  5G2N A;  2K4P A;  8ICW A;  7ICV A;  4P4P A;  1UH6 A;  4FBT A;  2G9H D;  3RNF C;  1J8C A;  2K8C A;  3ZLZ A;  2ZIU A;  2YMM A;  2N4F A;  1SV0 C;  1T4G A;  2KJ8 A;  2XEW A;  3E2E A;  5A0L A;  2JH7 A;  2GWS A;  1TTN A;  1XLO A;  2BKF A;  4B9U A;  4DBG A;  3RT3 B;  1F2R I;  3JSV B;  1LO5 D;  3UIN B;  2WX0 A;  2KFZ A;  1QCK A;  5CHG A;  1L5P A;  3SAG A;  7ICK A;  3WA0 A;  2CJN A;  3L5K A;  2XI9 A;  1BPE A;  4F5N A;  2WF8 A;  4M8N A;  1ZDX A;  1IIP A;  2WU5 B;  3E9S A;  1WG8 A;  3VXW A;  4KLO A;  5D94 A;  1ZQN A;  2PTL A;  3TFR A;  1RDF A;  5KG2 A;  4QZI A;  2K22 A;  1LQB A;  3EWA A;  3AU5 A;  4QZF A;  3QYP A;  4YQW A;  4F4X A;  1F0Z A;  2KG5 A;  1Z00 B;  4RPX A;  2IO0 B;  4ITK A;  4DQR A;  4FZL A;  1LM8 B;  4FUL A;  2Y0S F;  3TAD C;  1P7F A;  3P4P B;  3F2C A;  3DVG Y;  1E7V A;  3H8W A;  1ZQJ A;  2DZI A;  2MP2 B;  2FBW B;  1QIL A;  2JMG A;  3LK9 A;  2BR0 A;  1ZGU B;  1K51 A;  2IZV B;  1HA5 A;  3QA8 A;  3GZN B;  3I63 C;  3C23 A;  3ZO5 B;  1FEZ A;  1XNS A;  4HPP A;  3VUX A;  4C4S A;  1X9M A;  1RM6 C;  2FDR A;  5CX3 A;  1SWV A;  2YQE A;  3I3T B;  2JXT A;  1AWD A;  3P4S B;  3OPX A;  2ZTD A;  3OG5 A;  1XCT L;  1WSP A;  4E3C A;  4ECY A;  2WU2 B;  1Z1B A;  1TJE A;  1TK5 A;  2EEL A;  2ALZ A;  3RPF C;  2VKQ A;  1SV4 A;  3CP8 A;  8ICX A;  2D07 B;  3RNC C;  1UNS A;  2NPT A;  2WDT B;  3W5U B;  1RQL A;  2OWO A;  2J0K A;  2A1A A;  3C8Y A;  5C3J B;  2LUM A;  5L1J A;  1T3Q A;  1K1S A;  5ALG A;  4RCO A;  2KTR A;  2K8A A;  4UQG A;  2ODG A;  3CRX A;  1UGM A;  4UAW A;  4M9G A;  1SKR A;  4KLS A;  1UD7 A;  2AL3 A;  1NYR A;  2OH2 A;  1TS3 A;  3QAQ A;  1U4A A;  1YQB A;  1GUA B;  4B9S A;  1MG4 A;  4G3X B;  4LJP B;  3SAH A;  2NBV B;  5J0T A;  3OJU A;  3MR6 A;  4YXM A;  1N60 A;  4PHE A;  2H89 B;  3RNE C;  1SIF A;  2K8B B;  2C5L C;  2G5H B;  3HW8 A;  1ZQC A;  4IRD A;  1BPY A;  3L4P A;  2WDV B;  1MC8 A;  4C4V B;  3PX0 A;  8ICR A;  4EBE A;  3HK0 A;  1J7B A;  4IQU A;  3X23 A;  3MC8 A;  4HEA 1;  2KC2 A;  2B21 A;  2K4I A;  4GDK B;  4KTQ A;  5KT4 A;  2OYY A;  9ICR A;  4HRS A;  4IWQ A;  4OJ5 A;  4XWT A;  3GU3 A;  3K1R B;  1J7C A;  1XSN A;  4QW8 A;  5AI4 A;  2W55 A;  4DSF A;  3ZDC A;  2HW3 A;  1C4C A;  5AM5 A;  1SE4 A;  2AGQ A;  1DOI A;  3FYH A;  4QZG A;  3ETR A;  1SJE D;  4MJS B;  3MR2 A;  2QCZ A;  1P1A A;  4II3 B;  3MC1 A;  4M2Y A;  3U7Z A;  2LWP A;  2W8L A;  3ZQ4 A;  1C76 A;  5KFD A;  2BS3 B;  5KG5 A;  2L7R A;  2JPH A;  2KK8 A;  4GIB A;  2BW2 A;  3DDC B;  1JI7 A;  2WP9 B;  4PYZ A;  7ICE A;  3CST A;  4IQT A;  4FHK A;  4MH8 A;  3BS7 A;  4FN2 A;  4UAS A;  1VZ7 A;  5AIB A;  2I9G A;  1SL2 A;  3E58 A;  5IIK A;  3BZC A;  1C1Y B;  1TV9 A;  1WMH B;  1WGR A;  2IYD B;  2D3C A;  4K3C A;  4CDG A;  4QWA A;  5HHI A;  2EH9 A;  3Q3N C;  5J8Y A;  1NNL A;  1Y56 A;  4ECU A;  3T79 A;  2DZK A;  4NAM A;  5CEH A;  1ESF A;  4LCD E;  1ZXH A;  2WX1 A;  4MEM A;  4ZRQ A;  1OUQ A;  2LJI A;  3JVZ X;  3KWV A;  3TEY A;  1RXV A;  3MBY A;  4NM2 A;  2BBC A;  2ZNV B;  1RYJ A;  3O13 A;  1E6E B;  2MH7 A;  4XQ8 A;  5DQG A;  5AK4 A;  3RH5 A;  5AKK A;  4HCN B;  1ZQX A;  4A8E A;  1JXL A;  1VCB A;  2K8H A;  1ZRM A;  4I27 A;  5B5E U;  1D8B A;  3Q8C A;  5F9N A;  3TL5 A;  3PST A;  5TR5 A;  3SHQ A;  4ZDV A;  4O0I A;  1LV5 A;  5BYQ A;  2W11 A;  3QEA Z;  3GOE A;  1NKE A;  4ARI A;  2ZXI A;  4YR3 A;  3GIL A;  1UA0 A;  5AKI A;  4EEK A;  3J9C A;  1FFV A;  2Y9T A;  1JW9 D;  1JRO A;  4KLI A;  1TY0 A;  4IR1 A;  3HP6 A;  2KNJ A;  4Y2S A;  2JEJ A;  4QZ9 A;  3L08 A;  1XD3 B;  1KBU A;  3ZTD A;  2KSO A;  1HEZ E;  2KN4 A;  4F5R A;  4JV1 A;  4YXD B;  4M9H A;  4XC2 A;  4J9L A;  4JGH B;  4AP9 A;  1RFA A;  3EPG A;  1HEK A;  4USA A;  3JYU A;  5KHQ A;  2OM6 A;  2GOW A;  3W1S A;  2DPI A;  2W03 A;  4C8M A;  3SAF A;  1SGH A;  3RJE A;  4HAI A;  3LJ3 A;  4FLH A;  2BCU A;  3K4G A;  5JXV A;  3VVW B;  5KAI U;  2K0P A;  1QLN A;  2BWF A;  4BZA A;  4IWP A;  3A0B U;  1QSS A;  3G6V A;  4F92 B;  3HJE A;  3RUL A;  1ZQB A;  4TMA B;  3JPS A;  2LI6 A;  2WF7 A;  3C2K A;  2I1Q A;  1YJI A;  2FLP A;  4Y2V A;  5DCN A;  2Y9U A;  4IQV A;  4YTP B;  3WKB A;  2CXY A;  2W9C B;  4KLJ A;  2NS5 A;  4L2Y A;  1IXR A;  2AEH A;  2MU2 A;  2KJ5 A;  4OHJ A;  3PRM B;  4EOY A;  4B0E A;  5AKL A;  4OO1 J;  2V4I B;  1KEJ A;  5AM4 A;  4MGK E;  2KIW A;  2IBI B;  1T8E A;  3AM9 A;  5ALS A;  1DGS A;  3L13 A;  2MBB B;  2FPL A;  2VZK B;  2IO2 B;  2NR2 A;  2JEG A;  2P66 A;  2FE8 A;  2Z8L A;  2ASJ A;  4O3P A;  1D9F A;  2LJ5 A;  1KRH A;  2MA9 B;  5ALY A;  4RPY A;  2NRW A;  4ECW A;  1ZQD A;  1YJ1 A;  1TK0 A;  2FUH B;  1H38 A;  5J18 A;  5G5H A;  1KFD A;  5HNK A;  9ICQ A;  1WRI A;  2KDM A;  5LXH A;  1VLB A;  3MR3 A;  2FCM A;  2HTM E;  4J9N A;  3SEI A;  2BPG A;  4UAV A;  4J9P A;  2FPM A;  2H5X A;  1NK5 A;  3ZDM C;  3QU2 A;  2WDQ B;  4C8O A;  4RNA A;  2QEJ C;  2K4H A;  4RQM A;  3NS8 A;  5L95 C;  1QOB A;  3L3F X;  3SD5 A;  1L8L A;  5KT3 A;  4FO6 A;  2D3G A;  2JSV X;  4WJQ A;  4JE3 B;  1QOG A;  4RGN A;  3V7L A;  1DK3 A;  3P1M A;  3LDA A;  3QIJ A;  2CRX A;  2QB0 A;  2M0A A;  2MUT A;  2MRP A;  4ZH4 A;  3TSS A;  4BDP A;  3RBD A;  4DL4 A;  3KHG A;  2Q5W D;  8ICT A;  2RLT A;  4RF1 A;  3GP7 A;  3PW7 A;  5CWR A;  2MBH A;  2O2V A;  3NOB A;  4EFO A;  4KLG A;  5AHX A;  5IIN A;  4KDL B;  4EKU A;  3N20 C;  2KLG A;  4AYB F;  3BK2 A;  1K53 A;  2LI5 A;  3CF6 E;  4UW9 A;  3AUO A;  3AE7 B;  3DCG A;  2YX8 A;  3ICX A;  3ZXR A;  5HHD G;  1WE6 A;  3RB0 A;  2KFJ A;  5E6P A;  2CPR A;  3VRB B;  4HVB A;  2WFA A;  1SL1 A;  1EWY C;  2MQJ A;  4NAW A;  1OXJ A;  3EUB 2;  3IM1 A;  4I6P A;  1HTQ A;  3L16 A;  3V60 A;  2LGI A;  3VR8 B;  1VDV A;  2I38 A;  2GBM A;  3UPQ A;  3NUH B;  1R4M I;  1MI0 A;  4TUP A;  4K3B A;  4G3I A;  1KFT A;  4ELV A;  3PML A;  3ZDA A;  2PFP A;  2RMM A;  1FCC C;  2HSZ A;  2D3A A;  2OJW A;  1PGA A;  1WX9 A;  2MJE A;  4EX6 A;  1WZ0 A;  4KV2 A;  4DFP A;  2G4S A;  3QUC A;  1Z2M A;  1XQQ A;  1F5S A;  8ICS A;  2MP2 A;  2WXI A;  1SJH D;  3F2D A;  2HE7 A;  3URY A;  3JPQ A;  2UVW A;  4KN7 A;  2PPH A;  3RH4 A;  1KF6 B;  4MHV A;  1ZD4 A;  4WIP A;  1WCN A;  1MQ2 A;  4TUQ A;  1KFY B;  4AWJ A;  3C2M A;  3CNH A;  1MG8 A;  2KTQ A;  3O65 B;  2ZTE A;  4QWE A;  2AX5 A;  3NVZ A;  3VHT C;  5BMG A;  2WXM A;  2KEY A;  4TQ0 A;  2K8C B;  3M6K A;  1ZRN A;  4JMU A;  2WXQ A;  1JWS D;  3W9C B;  1V6E A;  3QXG A;  7ICT A;  3T5H A;  2WDR B;  4A8X C;  8ICV A;  2RR9 A;  4DL3 A;  4HLE A;  4FXC A;  1KTK A;  4KLU A;  2L1A A;  2ZJ5 A;  4KMU A;  4KX3 A;  3PV1 A;  2D10 A;  2W9M A;  3B08 A;  1KL9 A;  3B0Y A;  4CCH A;  4MDK E;  3Q8Q B;  3HHM A;  1X6I A;  2IBK A;  1D3Z A;  3Q3J A;  4YR2 A;  2J6T A;  1HIW A;  5J2F A;  1FO4 A;  2NRZ A;  4F91 B;  1PK1 B;  3WAN A;  5AK5 A;  2RRD A;  1GC7 A;  1MJD A;  3RR7 A;  1HQR D;  4FJY A;  2N1W A;  2MAX A;  5KT7 A;  1ZQ1 C;  4RQ7 A;  1SE2 A;  1N5X A;  2W43 A;  2LBO A;  1UA1 A;  3WK7 A;  2HBM A;  3N4M B;  4O3S A;  1WY8 A;  5KFP A;  3MFG A;  5KFL A;  2W82 A;  2KE7 A;  5GXG B;  4J9M A;  4N6E B;  3W5V B;  3BS5 A;  2W7O A;  1I4P A;  5AIA A;  2N7E A;  4UB1 A;  5KG7 A;  3ZDD A;  2QAR A;  3UQA A;  3PVX A;  1N63 A;  2XIC A;  1RG6 A;  3FAH A;  5J2I A;  4XYC A;  3VC8 A;  3U7D A;  2KZZ A;  4ARC A;  1ZQU A;  3F5E A;  2AGP A;  3R66 C;  3ZDE A;  1SBB B;  2KTF A;  1TKE A;  5HFY A;  3GFK B;  2K8B A;  3PY8 A;  3AE9 B;  2KLC A;  4ACO A;  1CRX A;  3APD A;  2MHJ A;  1T0Y A;  4NM1 A;  1GB4 A;  3ZXV A;  2CJO A;  2HDO A;  2E8N A;  1WR1 A;  2MSE D;  1S8O A;  8ICG A;  3PR5 B;  2NRT A;  2GRI A;  3N28 A;  4J9R A;  1ZQS A;  2VA3 A;  1WXQ A;  3NUQ A;  2VH2 A;  3IAS 1;  3UMB A;  2KDF B;  2ZCC A;  1M6Y A;  1L7N A;  4KLL A;  5AIC A;  2MLB A;  4ED8 A;  4KKI A;  2VRR B;  1F52 A;  5BMI A;  4C4R A;  5CHV C;  5J2K A;  3WAP A;  8ICQ A;  2CS4 A;  2MBE A;  4DQP A;  3WU2 U;  4EBD A;  4F2S A;  1V38 A;  2LHE A;  4LLG M;  5KFJ A;  4Y2X A;  2PKO A;  1ZQZ A;  4WJ3 B;  2EMT A;  2K5P A;  5JZE B;  4I2D A;  2KMA A;  1B0X A;  4JK1 A;  1ZJM A;  2ZJ8 A;  2KJH B;  2AWT A;  3A33 B;  3RZF A;  3K1Z A;  5DG7 A;  2BDU A;  2PE6 B;  2KHV A;  5L83 A;  3ZJU A;  2C60 A;  1UPH A;  3AE4 B;  4DQS A;  5D49 A;  3UQB A;  1MVK A;  4OJL A;  1PYW D;  3F53 A;  4DSK A;  1A77 A;  3N32 A;  1UZX B;  4MFC A;  2KV2 A;  3TMP B;  4L1B A;  2YEP B;  5D7G A;  2F44 A;  2HJ8 A;  4GGQ A;  9ICV A;  4OZB A;  2BGF A;  5AM1 A;  3IDW A;  5IIJ A;  1Q3V A;  3JPP A;  3NTU A;  3FKY A;  4US9 A;  1SXT A;  1ZOL A;  2KFN A;  1N5W A;  4N59 A;  2ON8 A;  3PW2 A;  4KIK B;  1B1Z A;  4UAR A;  3M9O B;  1JQ4 A;  3DV9 A;  2WAQ F;  3G6X A;  1HE8 A;  2NTT A;  4LNO A;  3VDZ A;  4OZA A;  1QF6 A;  2J52 A;  4OJP A;  3ZW3 A;  3U4E G;  3M1Y A;  4J9O A;  2HMX A;  4RFB A;  4YT0 B;  1KKX A;  3R2T A;  2M4N A;  1QH9 A;  3ALR A;  3P4Q B;  2CN1 A;  4QZA A;  5J2G A;  1WX8 A;  2EKI A;  4MGZ E;  1I35 A;  2E1F A;  3WAM A;  4RQ4 A;  4KVG B;  2LVP A;  1YN4 A;  2JRZ A;  3R9K A;  1F9J A;  2HCF A;  2L0T A;  3TEZ A;  3K9P B;  2KZ3 A;  2KDE B;  5DGA A;  2HD5 B;  1T3N A;  4XE0 A;  3Q8S B;  3VTV A;  1ZD2 P;  4B9V A;  2V4L A;  2LMR A;  2O6V D;  4MSQ B;  2N9K A;  3ZNH B;  4ASW C;  1XSL A;  5AZF A;  2AHO B;  1XCQ L;  4UB2 A;  4ZRP A;  1MSW D;  3L54 A;  1FIQ A;  1E90 A;  4WWP A;  4BJQ A;  3DBR I;  1Q46 A;  4BOS C;  1V80 A;  1J19 A;  1B4F A;  4GXK A;  4NV0 A;  3U52 E;  4H2A A;  4AJY B;  2WF9 A;  4CYE A;  4HRO A;  3OWE B;  4PS8 A;  1L7M A;  5J8Y C;  9ICA A;  2LUE A;  4XWW A;  2BCS A;  2CHW A;  2VAN A;  2FNJ B;  2DFL A;  5CR0 A;  1KRP A;  5ALX A;  2ZW1 A;  1QQ7 A;  4XZ4 A;  4F3O A;  1ET9 A;  2J0J A;  3GZF A;  2AYO B;  2XNA C;  8ICN A;  4IM3 A;  4Y2P A;  3BVZ A;  2LGS A;  2FLL A;  1E8W A;  4XDC A;  3VR9 B;  1H8C A;  5KL8 B;  4I2J A;  1TK8 A;  3QAR A;  4NLN A;  2CU1 A;  2HVH A;  1ZQA A;  3KYC D;  3Q69 A;  4ZRK A;  3QUQ A;  5LLI A;  2HHW A;  1I4X A;  2NVU I;  7ICF A;  1NK4 A;  3PZP A;  2ATL A;  4TQS A;  2RD0 A;  4B9K A;  3N7R C;  1WF9 A;  2AQ0 A;  2LGX A;  5AI8 A;  2HOQ A;  4L23 A;  1AAR A;  3NAS A;  5EWE A;  3JPT A;  1X9W A;  2W9B B;  3VTU A;  1S76 D;  2JY6 A;  4YVZ A;  2G5I B;  1N56 A;  1QOA A;  2A1J B;  3H4D A;  1P0R A;  3BWU D;  4GMV A;  4KLQ A;  1ZP0 B;  4NQK E;  2ZIW A;  1IUE A;  4TSS A;  3PVL A;  1TS4 A;  4M01 A;  4JPS A;  1V85 A;  2K1F A;  4B6J A;  4DFJ A;  4F72 A;  4IRK A;  5C5J A;  5L1K A;  9ICO A;  3N3K B;  3DBH I;  3QX1 A;  1NK6 A;  2M19 A;  1N61 A;  4DK5 A;  5IKC M;  2DZJ A;  2NBW B;  1SWW A;  3Q8M A;  3JW0 X;  4K7U A;  2ISO A;  4F71 A;  4M47 A;  1SF0 A;  2HOF A;  1PK3 A;  2N1V A;  2GB1 A;  1FFU A;  3UI3 A;  1FNW A;  3ZNZ B;  4IC9 A;  3M8R A;  4DDI D;  1STE A;  4LTU A;  4XA5 A;  2EQY A;  9ICP A;  2D5G A;  1SIJ A;  3GE3 C;  1PK1 A;  3NZS A;  7ICM A;  1IYF A;  1Q8K A;  1LGR A;  3H8H A;  3IHQ B;  4EEY A;  1KTQ A;  4ECR A;  2N9L A;  1VJK A;  3ZD9 A;  9ICN A;  2MWS B;  5KHO A;  4F93 B;  4XX5 A;  4FBU A;  3LVV A;  4QWB A;  4P1B C;  1SB3 C;  4TQR A;  1QTM A;  2E5S A;  4C8N A;  3IG5 A;  5KFV A;  1WM3 A;  2KWC A;  2ASQ A;  4Y2Y A;  4U6P A;  2XGP A;  3A4S C;  3KKA C;  1IGC A;  2BGW A;  1UWM A;  3WIM A;  4AP4 C;  2ZZP B;  3T3O A;  1VJ5 A;  4YP3 A;  2L52 A;  4CNQ A;  4JX1 C;  2A1J A;  4ZYN A;  4KDI C;  2WNM A;  3GIJ A;  4JV2 A;  5ALI A;  3PRE A;  4DHZ E;  2J53 A;  5D2M B;  2N9X A;  2WF5 A;  4DSE A;  4I2C A;  2DYO A;  4WJO A;  5HI1 A;  2MRL A;  3V72 A;  1YNT E;  4DOB A;  4FFD A;  1SE9 A;  3VH3 B;  3T5J A;  4TUR A;  2LRU A;  4U7C A;  4JL9 A;  4N9F 4;  4FAD A;  4BWJ A;  1ZET A;  2R8J A;  1L3V A;  2K3U A;  5ALF A;  5CHF A;  7ICI A;  4ECT A;  4HXD A;  4P0P B;  1V9J A;  4NJ7 A;  3VAW A;  3D2S A;  1QSL A;  2YEP F;  4ZHP A;  3W1S C;  4MT5 A;  3AU4 A;  1WWT A;  4G50 A;  1ZQL A;  3KQ4 A;  3U26 A;  4KX5 A;  1F77 A;  2G1E A;  2KWD A;  2B0C A;  4F5P A;  1MHH E;  2JRI B;  2RSU A;  2WXO A;  2GBJ A;  4G0N B;  4XDD A;  3WK6 A;  1PVR A;  2IO3 B;  5AEK B;  2AXT U;  4CO7 A;  3MC0 B;  3OAW A;  1G6J A;  1WJ4 A;  3R3M A;  5KFO A;  3N30 A;  3HRD D;  5DQH A;  4B9T A;  1HZ6 A;  2BYE A;  3SV3 A;  4QIW F;  1H4R A;  1WM2 A;  1WI0 A;  2HHS A;  4DXA B;  2EZX A;  2AGO A;  3H6N A;  2L83 A;  1SXE A;  4C80 A;  3DHI C;  3UGB B;  4DL2 A;  2QDF A;  5D4B A;  3PSI A;  3GIK A;  1XC9 A;  2KX3 A;  3C2L A;  1FRR A;  1SKS A;  5KFR A;  3MC9 A;  2JR5 A;  4EX7 A;  4IQW A;  7ICU A;  2I1K A;  1T94 A;  2JWZ A;  3UMG A;  4F4K A;  1V8C A;  3NY5 A;  1UGJ A;  3CWI A;  2LD9 A;  3A9J B;  1GJZ A;  4LNF A;  1J97 A;  4O5C A;  9ICW A;  4BBN C;  3RJH A;  2PXI A;  4DHZ B;  1SSN A;  1T6B X;  4NZL B;  3B2F A;  1QZE A;  5CRX A;  8ICB A;  3AMZ A;  3SV4 A;  3NG0 A;  3ONS A;  2WXR A;  2J42 A;  3H0M B;  4IS7 A;  2SEB D;  3EEC A;  3RI7 C;  1ZE3 D;  2FCS A;  2P6U A;  2XK5 A;  1B22 A;  3KUD B;  3GIM A;  1X1M A;  4DO9 A;  4JIO U;  4F4Y A;  2BQU A;  3ISC A;  3AB5 A;  3KOO A;  4MM3 B;  4RQ1 A;  3PPA A;  3D2N A;  4EZK A;  3QJZ A;  3N1Z C;  3PZ8 A;  4P6V F;  2HHU A;  2WAQ C;  4DCC A;  5AK3 A;  1WXV A;  2QAR B;  2IND C;  1J2M A;  2A19 A;  3B2G A;  4WWN A;  1XXG A;  9ICT A;  1V49 A;  1RWS A;  2ZJD A;  1SXD A;  2FUG 1;  3C29 A;  5J17 A;  4WJN A;  5C1Z A;  2JZB B;  5AI5 A;  2KJR A;  3KHR A;  4Q44 A;  4MGY E;  5KG1 A;  4IL6 U;  4DEZ A;  2DYB A;  4Y2R A;  2L0F A;  3NJT A;  3UM9 A;  1XO3 A;  4AUQ C;  5H92 C;  3X0W A;  2HTH A;  5BYS A;  1WH3 A;  4RGO S;  1T5X D;  3FM9 A;  1V86 A;  5KFU A;  1TGZ B;  3ZD8 A;  2BB6 A;  2KN5 A;  3V05 A;  2F1H A;  1SEB D;  5D46 A;  3RB6 A;  1E8Z A;  3HX0 A;  8ICZ A;  3AE5 B;  2QMT A;  2ZUC A;  4O3Q A;  4UAT A;  3ZNG C;  1IGD A;  3AQE A;  4O3R A;  3VTW A;  3PO0 A;  4E74 A;  4C00 A;  1PGX A;  4W9I A;  1QQ5 A;  2KN7 A;  4F5Q A;  3DBS A;  1JWM D;  4UBB A;  3LYS A;  4CF3 A;  4DSJ A;  2LVQ A;  3OSN A;  3GE8 C;  9ICK A;  4ECZ A;  4B9M A;  2LGD A;  3PSP A;  1JX4 A;  2LEK A;  4DL6 A;  5KL1 B;  1IV8 A;  2OXO A;  5AZH A;  4BKS A;  3ZI4 A;  4TKN A;  1PZN A;  4W9L A;  1YMH E;  3KVF B;  1D5X C;  4OVU A;  4LZD A;  5DBC A;  1BUI C;  3D32 A;  3CSF A;  3PLV A;  3BJY A;  1DOY A;  2WB1 C;  1L2N A;  4DQO C;  1E7P B;  2AQ4 A;  3H8J A;  2P35 A;  2KVR A;  2LYA A;  4ZOH C;  1VRA B;  4GN1 A;  4ANW A;  5EE9 A;  4OVZ A;  2W3R A;  5J2H A;  2H3F A;  4RUC A;  5KG4 A;  1XS9 D;  4M6W A;  2HOI A;  4KLD A;  3KHL A;  2Y3A A;  2JUO A;  3TIX A;  2KSO B;  3TUO A;  3BDP A;  1U45 A;  4MSM B;  3K75 D;  3JPO A;  3AEE B;  4R64 A;  3PSF A;  3AXC A;  2FCN A;  4WAA A;  5HG2 A;  1NKB A;  2IY1 B;  4YSY B;  1N62 A;  1KLU D;  2O6V A;  1FPY A;  2KC1 A;  3LB8 C;  4W9E A;  2C2R A;  3H7S A;  3N1Y C;  1HUZ A;  1WMH A;  4HDO A;  4YCX A;  2LGY A;  3UMC A;  1ZJN A;  4F4Z A;  2V0G A;  1I42 A;  5I4D A;  2NV3 A;  1PVQ A;  2FCQ A;  1Z4O A;  3WKC A;  3AN1 A;  4RGT A;  1Q1O A;  1J0G A;  2EKE C;  2V4Q A;  4J9S A;  3B0X A;  5J0X A;  3MDA A;  3FIL A;  3OLM D;  2BQ3 A;  4GC6 A;  1F44 A;  2BYT A;  2ZW0 A;  4FS1 A;  2GBR A;  3V3X A;  4TQ1 A;  2QHO A;  4MM3 A;  2D3B A;  1YQ4 B;  2CHZ A;  2B3A A;  3DVN U;  3H9D A;  2L5Y A;  1RYR A;  2R2O A;  5BO4 B;  2GMI C;  4CF5 A;  1F2R C;  5KG0 A;  3DWG C;  4I6N B;  4DQQ A;  1X42 A;  3QEB Z;  2JXJ A;  4LJX A;  2KFK B;  5E6O A;  5ALZ A;  4EYI B;  1KM7 A;  3RAX A;  1XO1 A;  3UXO A;  3DPD A;  3AI5 A;  3GS2 A;  2JT4 B;  9ICG A;  2XO7 A;  2LAS A;  1A5R A;  4B0M A;  1ZQI A;  5IIO A;  3PW0 A;  3V6J A;  4B9N A;  4Q8F A;  2JF5 A;  9ICU A;  1YZ6 A;  4FE3 A;  1ACC A;  4Z6D A;  1ZQT A;  3TEW A;  1NKC A;  1YOV B;  1TAQ A;  2HBK A;  2CU3 A;  1GAQ B;  3AE6 B;  2W9B A;  3M9M B;  3K9O B;  2JZP A;  5GMV A;  3C21 A;  2AQ1 B;  5AI0 A;  1K1Q A;  4W9C A;  2RHF A;  2ZJA A;  1DRG A;  3A9K A;  5IIL A;  1XO0 A;  1U47 A;  4P16 A;  2MX2 A;  3GV8 B;  1ARO P;  1OQY A;  3KBB A;  1NZP A;  1V9P A;  4YSX B;  5AM3 A;  2JU6 X;  2LM4 A;  4RT2 A;  1FCL A;  4QZC A;  1AYF A;  1BPX A;  1JML A;  4BFR A;  3RJK A;  3TAC B;  3RR8 A;  1Z5S B;  2BPC A;  5KFQ A;  2EAO A;  3H7I A;  2Z0D B;  3I57 A;  7ICS A;  5CP2 A;  1HUO A;  8ICA A;  3AEG B;  4F5O A;  4DS4 A;  4IUM B;  3QU4 A;  4NPN A;  4TV3 A;  1K5O A;  5KFC A;  5KTQ A;  2KZM A;  4CQN A;  4M9N A;  2IMW P;  1V97 A;  1CEZ A;  4J9K A;  1Z3E B;  3AU6 A;  3QUT A;  1F1H A;  5J2C A;  3M6Z A;  2KWU B;  3C1Z A;  5KG3 A;  1ZOY B;  2A5U A;  3ZRC A;  1TAU A;  2QB0 B;  4C8K A;  3QE9 Y;  4W9J A;  1RYU A;  5KAF U;  4I2B A;  2O6K A;  3F5A A;  1E0Z A;  1SGG A;  1ZYQ A;  2W3S A;  3PW4 A;  2PMZ C;  1WGG A;  3S6J A;  4F8C B;  3EW9 A;  2HDE A;  1SKW A;  5CJ7 A;  1NK7 A;  2INC C;  9ICH A;  3EA6 A;  3IAM 1;  1K52 A;  2VJ5 A;  3PSE B;  4RNM A;  3R7R A;  3HUI A;  4YL8 A;  4O5E A;  3D6J A;  5AKZ A;  2BF8 B;  2GLS A;  3TBL D;  5ALM A;  3QUB A;  4PGY A;  1KLN A;  5EWF A;  5J29 A;  5JHA A;  1ZQG A;  2V3P A;  1S0V A;  3H0L B;  5ALH A;  2NRX A;  3KYD D;  3P63 A;  2K6Q A;  3IHP C;  3SEN A;  4QZD A;  3V7J A;  3H7P A;  4UB4 A;  2WXJ A;  4MF2 A;  2UU7 A;  1P9D U;  2KKV A;  2JV3 A;  3DHH C;  2AH5 A;  2RPV A;  1JRU A;  5KFM A;  2W54 A;  1TY2 A;  4FJZ A;  4IDI A;  2ZNV C;  3CYM A;  2J7Q B;  1WWU A;  7ICP A;  2XID A;  2MW5 A;  2BTE A;  4GDL A;  4FJV B;  3VUW A;  4QNL A;  3ZYY X;  2F8L A;  3RCZ A;  4RNO A;  1UBI A;  4HKZ E;  3R7Q A;  5BMH A;  2G06 A;  1TAM A;  2BYV E;  4MEL A;  4RM8 A;  4GU2 A;  1UF0 A;  2DPJ A;  4QJF B;  2ICI A;  5ALU A;  3IT6 B;  1C20 A;  3QU9 A;  5J2B A;  2D2Q A;  3WK4 A;  4DF8 A;  3PX6 A;  2YML A;  2PEA A;  2J6U A;  2FIF A;  3OJ4 B;  2EMS A;  1NI3 A;  5D3D A;  3H8S A;  3C0R B;  2FID A;  4LK0 M;  2KNB A;  5GTI U;  4UB3 A;  3HM6 X;  2PVO D;  2WLB A;  4O3O A;  4AYB C;  4PGX A;  4IWO A;  3RNB C;  1TKG A;  3E56 A;  3N7S C;  3AEB B;  8ICH A;  3DWM A;  2ZCB A;  2FJ6 A;  3ZNI D;  2H3Z A;  3RJJ A;  1A70 A;  1X9S A;  3Q8R B;  5EE1 A;  3A9J A;  3AU2 A;  4N58 A;  3A9K B;  3RZW C;  4P0Q B;  1QKZ A;  2K89 A;  5DB9 A;  4GSW A;  3EHV A;  2HHT A;  4K7S A;  1GC6 A;  3Q3O C;  1KDH A;  2R8G A;  3NZ3 A;  3IP4 B;  2BCR A;  2WWZ A;  3ML8 A;  4DHJ D;  2D8C A;  3QX7 A;  1XLN A;  3GII A;  1UT8 A;  1COO A;  4PL2 A;  1E9M A;  1ZQM A;  3AE1 B;  2DQN B;  5J0U A;  5BPC A;  4BGD A;  4F1S A;  2BQR A;  3AEA B;  5KFX A;  1KW4 A;  5F9L A;  2YB1 A;  3H1U A;  4JWU C;  4M8M A;  5J2J A;  3I5J C;  4KGS A;  2BZF A;  1YIW A;  2KHQ A;  2IHN A;  3LVW A;  1UHU A;  1C78 A;  2ONQ A;  3APF A;  3PGE A;  4O1N A;  3BK1 A;  4EEW A;  2NTS A;  5C2T B;  3Q8B A;  1QT9 A;  3DHG C;  1CZP A;  5DG9 A;  2HBJ A;  5BOM A;  1Z00 A;  3D2Q A;  3BY4 B;  3QC8 B;  1FD6 A;  3HPO A;  2VA2 A;  3PO4 A;  5DLF A;  1KLV A;  7ICN A;  1S9F A;  1SE3 A;  4UB5 A;  1X66 A;  2K60 A;  3BS5 B;  2N7J A;  3VRA B;  3EC8 A;  1HJP A;  2IA6 A;  2BPS A;  4EZ9 A;  1ZQH A;  1D5Z C;  1GG3 A;  4PHA A;  4UAZ A;  1V5T A;  4WQO B;  2YB4 A;  5BOL A;  2R18 A;  4PJ0 U;  3WK5 A;  1FRD A;  1WE7 A;  8ICE A;  3V6K A;  3QCA A;  2QLT A;  3KZX A;  2NO4 A;  3SD7 A;  2NMQ A;  4RQ5 A;  4PZO A;  4IR9 A;  2OJR A;  5KT2 A;  2ZVO A;  3LYY A;  4G11 A;  2J4X A;  2Y5C A;  4C0Z A;  4A6Q A;  4S0R A;  3H7P B;  1YN5 A;  4KIK A;  7ICG A;  1C4P A;  1R7S A;  2RDI A;  2DWQ A;  5MPO A;  4I29 A;  1ZD3 A;  4F4W A;  1JN3 A;  2IOF K;  5J2R A;  4Q8E A;  3BVM A;  2YN4 A;  1AN8 A;  5IP4 D;  2ES6 A;  3HIZ A;  4C8L A;  3ZRF A;  3E0F A;  2KFK A;  4EZL A;  4Q45 A;  4BAX A;  5AKH A;  2KT7 A;  4DF4 A;  2W04 A;  3PMN A;  4IW0 A;  3T5L A;  3OGU A;  1E8Y A;  3HM3 A;  2IY0 B;  2PE9 A;  2ZUB A;  3KW5 B;  7ICJ A;  4BKT A;  3KLS X;  4NNJ B;  5F3X B;  2PIA A;  3ZKJ C;  2BVC A;  3FIL B;  3MFH A;  3M62 B;  3QNM A;  4P0P A;  4WH4 A;  5IOI A;  4RUA A;  2FMQ A;  4EE2 A;  1UCV A;  2UVR A;  2IO1 B;  5FP0 A;  2XGQ A;  4HK2 A;  1XWL A;  3MHZ A;  2SAK A;  2VJ4 A;  4CGZ A;  4W9H A;  9ICC A;  3Q14 C;  3ED5 A;  9ICE A;  4NLB A;  1P7D A;  1C79 A;  2BHN A;  4GXB A;  2BT6 A;  3PW5 A;  5EDS A;  1FNV A;  5KT6 A;  3M95 A;  2XY5 A;  4KLF A;  4IRC A;  2E8M A;  4REZ A;  5J0O A;  2WXK A;  3NHE B;  2AU0 A;  1RLF A;  3L17 A;  1L0Y B;  4X57 B;  2BCV A;  4KGR A;  2L00 B;  5D6J B;  5DB7 A;  4NQL B;  4IG7 B;  1SZH A;  4EZJ A;  2LHT A;  4PHD A;  3BZD B;  1YD8 U;  2KWV B;  3R8B A;  4GXI A;  3HVD A;  5TIS U;  2LPE A;  3OTQ A;  4DSL A;  4M0A A;  5E6N A;  3QU5 A;  2HJ1 A;  4YTM B;  1MQ3 A;  4ED1 A;  3WK8 A;  3VH4 B;  2DUY A;  4LNK A;  1L7P A;  3Q8A A;  1JMS A;  5ALV A;  4G9B A;  1JWU D;  5AI9 A;  4ECX A;  3QWZ B;  2GO7 A;  2JH1 A;  3MGH A;  2LXC A;  3BII D;  2KO3 A;  4EYH B;  2R61 A;  2HI0 A;  4HPL B;  2LKY A;  2EZY A;  2MBO A;  3B1L X;  8ICK A;  2QJL A;  2I2Y A;  1TYG B;  3V6E B;  1XLP A;  2LHD A;  5T8I A;  2ZUD A;  4C7Y A;  3MR5 A;  2JEF A;  1QOF A;  2EAN A;  1BNP A;  1E10 A;  1D8L A;  2KMC A;  2VIX A;  2R8I A;  5ALJ A;  4ED0 A;  1EO6 A;  1U9L A;  1XSP A;  4LNI A;  3RJG A;  2Z0E B;  2ACZ B;  5L1M A;  2GBK A;  1JWA D;  4KSK C;  5H2F U;  1IG6 A;  3RAQ A;  2Z7J A;  3BQ0 A;  1M4V A;  3BQT A;  2ZTC A;  4QW9 A;  4OJ6 A;  3Q6B A;  2W9A A;  2JYT A;  2KHW B;  4DLE A;  9ICJ A;  2C7M B;  5DQI A;  3PTF C;  4NAW B;  8ICM A;  4ICA A;  2ZIU B;  1Z4N A;  4TUS A;  5JHB A;  2PI4 A;  5EWG A;  1P7E A;  2DNF A;  3KUZ A;  4MJS A;  4E0D A;  3IV6 A;  4RQ3 A;  2YVC A;  9ICX A;  2RDH A;  4ECQ A;  5B66 U;  4GC7 A;  2LFI A;  4W9D A;  3U30 A;  3VFK A;  3VUY A;  1IM4 A;  3ZJV A;  4B6W A;  4ED6 A;  1ZW7 A;  2CR5 A;  3ZTC A;  4F8R A;  4YG2 A;  1QQR A;  4UAU A;  2KQS A;  1YX6 B;  4YR0 A;  4Q43 A;  1ISN A;  3AQF A;  3DVG X;  5DBA A;  2B76 B;  4KIT B;  1JAL A;  2LYB A;  3ZUN A;  1AQ6 A;  1WXS A;  1N2X A;  4ELT A;  2MA1 A;  2L8J A;  5CB1 A;  4KZC A;  3V6H A;  2DKX A;  1ZQW A;  1D9D A;  2IHM A;  1YT3 A;  3KWL A;  3MP9 A;  7ICR A;  1NEN B;  4O5K A;  4YXJ A;  1S77 D;  1PGB A;  2WF6 A;  2KVZ A;  3PLU A;  3A0H U;  2KXJ A;  2WHE A;  4O3N A;  1NOM A;  3UXN A;  3G6Y A;  2PFQ A;  1YQ3 B;  1MFW A;  4NJC A;  4RQ0 A;  5ALQ A;  2C28 A;  2QC8 A;  4GOC A;  4Z6C A;  2RPQ A;  4I2I A;  5L1I A;  1YX5 B;  3ZDB A;  2DGZ A;  1Q5W B;  4TUU A;  3HVZ A;  3MFI A;  3I9V 1;  2A3V A;  2KOB A;  2OEH A;  3A1Q A;  1PUT A;  2AJQ A;  4RZR A;  4GLX A;  1NK9 A;  3RF9 A;  3UIO B;  3BIN A;  7ICO A;  5DPW A;  5L9X A;  2WB1 F;  1OW5 A;  4KMO B;  1WXM A;  4WAF A;  2KX0 A;  2WQY B;  4EBC A;  4FS2 A;  5IAA C;  4BOZ B;  4I2F A;  1ENF A;  1FXT B;  3M8S A;  5DKW A;  1HZ5 A;  4J3O D;  3QHT A;  5AKG A;  1QQ6 A;  4IM2 A;  2PLP A;  4PHP A;  3H8M A;  4A3P A;  2QIE B;  1ZQO A;  3Q8P B;  3V61 A;  1WYG A;  5KFZ A;  4B95 A;  5JH5 C;  1QSY A;  1TVA A;  3DEE A;  4MEX A;  2LVO A;  4OCZ A;  4J9Q A;  1I4R A;  2JVC A;  1ZUD 2;  4R66 A;  3SDL C;  4CF4 A;  3BYY B;  4P4O A;  4PZN A;  4PYU A;  2F1J A;  1L7Y A;  5ALD A;  2XY7 A;  4LVS A;  4BKS D;  3KD3 A;  5HP4 A;  3THV A;  1TKY A;  3BVG A;  3QQ8 B;  3A4R A;  2DEN B;  1L5U A;  2MEK A;  4YMM A;  4P1C C;  3VCB A;  2XC9 A;  3JPN A;  4HYK A;  1PFD A;  1DOX A;  1KQQ A;  2HBL A;  2BDP A;  5DB6 A;  2JZ3 B;  4KKJ A;  4BVU C;  1AW7 A;  2DBY A;  4FA6 A;  2V9W A;  3S2A A;  4KN4 A;  2PI5 A;  2JQR B;  5KFH A;  2NPT B;  3U2S C;  1ZDV A;  2CKH B;  4C56 C;  1X6J A;  4DOC A;  1JXE A;  2K4E A;  2VA8 A;  2IGD A;  4NY8 A;  4IOI E;  1LB2 B;  3PR4 A;  1S0M A;  5CA7 A;  1ZQF A;  2FLN A;  1GNU A;  3IN5 A;  4DS5 A;  4X5V A;  4PL1 A;  2Y1J A;  2INP E;  1ZD5 A;  1KJT A;  1UBQ A;  2QSD A;  3Q8K A;  1DYQ A;  1XEE A;  4NJ8 A;  1S0N A;  1ED1 A;  3QK0 A;  1RPL A;  3RFA A;  2ZPY A;  5ALP A;  1SV0 A;  4DLG A;  2Y1I A;  4PPX A;  4PT5 A;  2AQ2 B;  2I5H A;  1ZQQ A;  2ASD A;  2DL0 A;  2KK0 A;  2JWU A;  2KDI A;  3LDZ E;  5D3I B;  4YMN A;  4BUG A;  3IXS A;  4GDK A;  4NY0 A;  4DFD A;  3DBH B;  4WWM A;  2M9N A;  1FXA A;  4OZC A;  2R8K A;  2JZZ A;  3ZIM A;  1K8R B;  5ALO A;  3MGV A;  3SFD B;  3WAL A;  2HHV A;  4YMO A;  3RH6 A;  2MJ3 A;  1J2N A;  4I2H A;  4R63 A;  2IGH A;  1JIH A;  4O3M A;  5DDM A;  5KT5 A;  2JYE A;  4ED2 A;  3P4R B;  4QWD A;  1IPG A;  1ET6 A;  2GI9 A;  1JUD A;  5KFE A;  1S10 A;  1U49 A;  2I1J A;  2GOL A;  4ZYS A;  5AM0 A;  2MSN A;  3C1Y A;  4Z6E A;  2KMM A;  3U8Z A;  5EE0 A;  1IBX B;  1Z1V A;  2XK5 B;  2NBU A;  4I2A A;  4GLS C;  2PMV A;  4IKG A;  5LNK 1;  4PS3 A;  2Z59 B;  2F76 X;  5J0Y A;  4P7I A;  1V1P B;  2IOH A;  3QU7 A;  1OTR B;  2INN E;  4Y2Q A;  2RDB C;  5KFY A;  1CUK A;  4DXF A;  1KH0 A;  1C3T A;  4EZ6 A;  1L0X B;  1WRD B;  4NL9 A;  4GFJ A;  5ALW A;  2L76 A;  3QZ7 A;  1L6U A;  2G07 A;  1UEL A;  4ICV A;  3HT3 A;  4PGQ A;  2N7D A;  3CMM B;  2F77 X;  3PT2 B;  1ZQY A;  2KKP A;  2FMS A;  1ZQE A;  1I7H A;  3TKA A;  3WKE A;  1ROE A;  4BX9 C;  4NLC A;  2XVT A;  2GBN A;  1RZT A;  2E3T A;  1F0M A;  4Y2T A;  1N48 A;  2P6R A;  1E8X A;  2RQ5 A;  3TAD A;  1BML C;  4DL7 A;  3TAQ A;  4JWN A;  2YTU A;  3WCQ A;  1OGW A;  5TZV A;  3RFZ B;  2R8H A;  4ELU A;  2ZIX A;  4I6L B;  2KMD A;  4R8U B;  1WGY A;  5C23 A;  4BBN F;  4NJ6 A;  2KYW A;  3CW2 C;  1R4N I;  2KVS A;  1K50 A;  2OED A;  2CHX A;  2V4R A;  5J0P A;  3NGD A;  1NK8 A;  3KUC B;  1L3S A;  3J81 j;  4HJG E;  1D6E C;  1WJU A;  3ENE A;  3T9L A;  5ALN A;  2PMZ F;  1BPD A;  9ICB A;  1EM7 A;  4DOA A;  3H40 A;  5K4L A;  2DZM A;  1KSP A;  2O6V B;  1FNU A;  3ISB A;  1NJX A;  4GDL B;  3UF8 A;  5KFI A;  3BYT B;  5J0R A;  1DXS A;  4R3D A;  3RBE A;  4R65 A;  1A76 A;  4RQN A;  5DB8 A;  1WCL A;  1S0O A;  2H88 B;  3PX4 A;  2UYZ B;  4M0W B;  1CI4 A;  1C77 A;  2DLB A;  3PZD A;  4W9K A;  5H8Y E;  2L3Z A;  4M6W B;  4PK1 A;  2XCP A;  4DFK A;  1BPB A;  4RMA A;  3MHS D;  3KTQ A;  2KP7 A;  3M9N B;  5KFF A;  5HKH A;  4JB3 A;  1ZPS A;  1T7P A;  4OJO A;  3RN9 C;  1CQV A;  1VZ8 A;  3DBR B;  3C5G A;  5IO9 A;  8ICJ A;  2K6D B;  3SI8 A;  5J2E A;  5ALR A;  1LVH A;  2BB5 A;  1T0S C;  4E71 A;  2UVV A;  4K4G A;  4KZ0 A;  2G3Q B;  4DHJ B;  3Q8E A;  2QKQ A;  1R4M B;  5J0S A;  4RQ6 A;  4UBC A;  1Y88 A;  1COK A;  4WJP A;  2BKR B;  4AS1 A;  2GH1 A;  4UAY A;  4HJK A;  4K1R B;  1B9R A;  5DG8 A;  2E6X A;  1DK2 A;  3ETL A;  3IRU A;  3KKA A;  2ZPN A;  2FPK A;  1ZQP A;  1RFK A;  5T14 A;  2ZVN A;  2F8K A;  3AH7 A;  5AI6 A;  5HR7 A;  3SZ2 A;  3IT4 B;  2JXX A;  3T5K A;  1ECW A;  3DDH A;  3TAN A;  1NJY A;  4BXO B;  5III A;  5EOZ A;  4DXG A;  1NDD A;  1Y8R C;  2WXL A;  4A9A A;  1S3S G;  3M7D A;  1RRB A;  1C7Y A;  4QZB A;  3AE2 B;  1LXD A;  1V2Y A;  5JU5 A;  4DWI A;  3EFU A;  4PH5 A;  3ML9 A;  5AKX A;  4Q2J A;  5CHW A;  1I4Q A;  1BVS A;  3TCA A;  4M9L A;  3PHX B;  3SFE B;  1WGD A;  1L7O A;  3C28 A;  3NS1 A;  4I2E A;  5FR6 A;  3P2B A;  4FZM A;  1IP9 A;  4K4H A;  5AK6 A;  1L4D B;  4I2G A;  1YJJ A; 
#chains in the Genus database with same CATH homology
 1NYR A;  4L23 A;  1TS3 A;  4O1N A;  3BK1 A;  2NTS A;  5C2T B;  3Q8B A;  3W2D A;  1QT9 A;  2WXG A;  1N60 A;  1CZP A;  2H89 B;  1QOA A;  3BWU D;  1ZP0 B;  2JX5 A;  1FD6 A;  3L4P A;  1IUE A;  2WDV B;  4TSS A;  1TS4 A;  4JPS A;  1J7B A;  2IPK D;  4HEA 1;  1SE3 A;  2N7J A;  4GDK B;  3VRA B;  5FR3 A;  1FEH A;  4HRS A;  2IDY A;  3AEC B;  4XWT A;  1J7C A;  1D5Z C;  2M19 A;  1N61 A;  2WXP A;  4ZHO A;  2W55 A;  1C4C A;  1SF0 A;  1SE4 A;  1L4Z B;  2GB1 A;  1DOI A;  1FFU A;  1FRD A;  3UI3 A;  1FNW A;  3ETR A;  1SJE D;  1STE A;  1UUP A;  4LTU A;  2NMQ A;  3U7Z A;  3ZQ4 A;  3LYY A;  2D5G A;  1C76 A;  2BS3 B;  1SIJ A;  2J4X A;  2Y5C A;  4A6Q A;  2BW2 A;  1YN5 A;  1C4P A;  2WP9 B;  3H8H A;  1R7S A;  2DYM A;  2DWQ A;  5MPO A;  4MH8 A;  2N9L A;  1VJK A;  1VZ7 A;  3B9J A;  1GOZ A;  3BVM A;  2Y5P A;  1AN8 A;  1D4B A;  1SB3 C;  2IJ0 A;  3SR6 A;  1KLG D;  1FM0 D;  2KAJ A;  3N9Y C;  1IGC A;  1UWM A;  5FK9 C;  3T3O A;  1Y56 A;  2L52 A;  1OFF A;  4NAM A;  4JX1 C;  1ESF A;  4C7Z A;  3KLS X;  2PIA A;  2WNM A;  1ZXH A;  2AQ3 B;  3FIL B;  4ZRQ A;  4KX6 B;  2LJI A;  3KWV A;  4WH4 A;  3TEY A;  2J53 A;  4EE2 A;  2BBC A;  1RYJ A;  2DYO A;  3O13 A;  3R2I A;  1E6E B;  2MH7 A;  3MHZ A;  5HI1 A;  1YNT E;  2SAK A;  1IBX A;  3Q8C A;  1C79 A;  2BT6 A;  1FNV A;  2K3U A;  1V1O A;  5BYQ A;  4REZ A;  3AED B;  2WXK A;  4ARI A;  1L0Y B;  2OHF A;  2QIL A;  2YEP F;  1FFV A;  3J9C A;  4KGR A;  4ZHP A;  1JW9 D;  4MT5 A;  1WWT A;  1JRO A;  1TY0 A;  3BZD B;  3R8B A;  3HVD A;  3KQ4 A;  1F77 A;  1HEZ E;  2KN4 A;  2G1E A;  2KWD A;  4YSZ B;  4YXD B;  1MHH E;  4YTM B;  2WXO A;  4XDD A;  3Q8A A;  4USA A;  3MC0 B;  1JWU D;  3W1S A;  3HRD D;  1HZ6 A;  3BII D;  2R61 A;  5JXV A;  1JWB D;  2L83 A;  2K0P A;  4C80 A;  3AV8 A;  2QJL A;  2I2Y A;  1TYG B;  1XLP A;  4HKQ A;  1FRR A;  4TMA B;  2LHD A;  1GB1 A;  5T8I A;  1YJI A;  4C7Y A;  1V8C A;  1QOF A;  1UGJ A;  2M56 B;  3CWI A;  4YTP B;  1E10 A;  2WS3 B;  1XF5 L;  2V3N A;  4L2Y A;  1SSN A;  1T6B X;  4NZL B;  3B2F A;  1OQQ A;  4OW0 A;  2ACZ B;  3AMZ A;  4OHJ A;  4B0E A;  2V4I B;  1JWA D;  2WXR A;  2J42 A;  2SEB D;  1ZE3 D;  1M4V A;  1GPX A;  3AB5 A;  2JYT A;  1YN3 A;  3AM9 A;  4MM3 B;  1ZXI A;  1QLB B;  2VZK B;  4NAW B;  1OQR A;  3NVV A;  3AEF B;  2FE8 A;  3PZ8 A;  1DGJ A;  2Z8L A;  1P7E A;  4P6V F;  4US8 A;  1KRH A;  2TSS A;  2RDH A;  3B2G A;  2LFI A;  1RWS A;  2FUG 1;  5G5H A;  5G5G A;  3ZJV A;  1WRI A;  2KDM A;  1VLB A;  1EWC A;  1QQR A;  3P42 A;  2HTM E;  1XO3 A;  5H92 C;  2B76 B;  4WUR A;  2WDQ B;  4RNA A;  5BYS A;  1JAL A;  2QEJ C;  1T5X D;  1MPE A;  4RGO S;  1QOB A;  3V05 A;  2BB6 A;  3EGR A;  2VZK D;  4AQ7 A;  2JSV X;  1JRP A;  1BXT A;  1SEB D;  3KWL A;  3MP9 A;  3Q8F A;  3NVW A;  1NEN B;  1PGB A;  4JE3 B;  3SEB A;  1MHX A;  1QOG A;  4RGN A;  3P1M A;  1V1P A;  1YQ3 B;  2M0A A;  2QMT A;  3AE5 B;  4NJC A;  3AE3 B;  4RH6 A;  4RF1 A;  2Q5W D;  2L32 A;  3TSS A;  1FMA D;  1IGD A;  3GP7 A;  3PO0 A;  4KGT A;  1TZO A;  2PVG C;  1PGX A;  4YWG G;  3HVZ A;  3I9V 1;  3BK2 A;  1K53 A;  1JWM D;  2BS2 B;  3AE7 B;  1I4H A;  1PUT A;  2WXF A;  5HHD G;  2LEK A;  5EE3 A;  4WAF A;  3GB1 A;  3PZ7 A;  2WQY B;  3VRB B;  5E6J A;  1EWY C;  3EUB 2;  1ENF A;  1YMH E;  1D5X C;  2LGI A;  3VR8 B;  1VDV A;  1L0V B;  2I38 A;  1HZ5 A;  1BUI C;  4J3O D;  3NUH B;  1DOY A;  1MI0 A;  1E7P B;  2PLP A;  2X38 A;  4DQO C;  4ZOH C;  1VRA B;  2QIE B;  5EE9 A;  2RMM A;  4OVZ A;  1WYG A;  2W3R A;  1FCC C;  1NYQ A;  1PGA A;  2MJE A;  2Y3A A;  2LMC A;  2WXI A;  1CK1 A;  1SJH D;  3TUO A;  3URY A;  1I4R A;  3AEE B;  1KF6 B;  1ZUD 2;  1EU4 A;  4WIP A;  1KFY B;  3BYY B;  4RF0 A;  5HG2 A;  1L6V A;  4YSY B;  1N62 A;  1KLU D;  2AX5 A;  3NVZ A;  1TKY A;  2WXM A;  1NEK B;  3BVG A;  5AUI A;  4JWS C;  5BMG A;  3LB8 C;  4TQ0 A;  2MEK A;  2RDG A;  2WXQ A;  3W9C B;  1JWS D;  1PFD A;  1DOX A;  4A8X C;  2WDR B;  1HXY D;  4KKJ A;  1J7A A;  1AW7 A;  2DBY A;  2V0G A;  4FXC A;  1KTK A;  5FKA C;  2JQR B;  2L1A A;  5I4D A;  3U2S C;  1ZDV A;  4C56 C;  2K9X A;  4M0W A;  3AN1 A;  4RGT A;  2IGD A;  4IOI E;  3FIL A;  2BYT A;  1UWX A;  2ZW0 A;  1FO4 A;  2MJD A;  2INP E;  3V3X A;  4TQ1 A;  5BYR A;  2QSD A;  1YQ4 B;  1DYQ A;  1HQR D;  1XEE A;  3LXF A;  4WQM A;  1SE2 A;  1Q10 A;  4RGM A;  1F2R C;  1N5X A;  3DWG C;  1VR9 A;  2PW9 A;  2AQ2 B;  4PT5 A;  2KAC A;  3MFG A;  2W82 A;  2JWU A;  1WGK A;  5D3I B;  5GXG B;  3ABV B;  4N6E B;  1I4G A;  3GS2 A;  3W5V B;  3IXS A;  1I4P A;  4B0M A;  4WWM A;  4OZC A;  1FXA A;  4MAC A;  1XLQ A;  3SFD B;  1N63 A;  1NVI D;  3FAH A;  1ACC A;  2MJ3 A;  3TEX A;  2IGH A;  3TEW A;  4ARC A;  2JYE A;  1EU3 A;  3P4R B;  2CU3 A;  2KQ4 X;  1GAQ B;  3AE6 B;  1ET6 A;  2GI9 A;  1SBB B;  1TKE A;  5HFY A;  2JZP A;  3AE9 B;  4ZYS A;  2AQ1 B;  1VZ6 A;  2KMM A;  1FXI A;  5AUK A;  3NRZ A;  5EE0 A;  1IBX B;  4GLS C;  1GB4 A;  2PMV A;  4IKG A;  1C9F A;  2CJO A;  4P16 A;  1C4A A;  5LNK 1;  3ZJT A;  4YSX B;  3AE8 B;  2JU6 X;  1V1P B;  2GRI A;  3IAS 1;  1WXQ A;  2INN E;  1FCL A;  1AYF A;  3CIR B;  4DXF A;  1TS2 A;  1KH0 A;  1JML A;  4KKI A;  3VQI A;  5BMI A;  2WXN A;  1L0X B;  3I57 A;  3MJ5 A;  3NVY A;  2XN9 C;  1L6U A;  2LHE A;  4LLG M;  4UDU C;  4A90 A;  2PKO A;  3AEG B;  2BS4 B;  2K5P A;  1I7H A;  1ROE A;  3ZGZ A;  4CQN A;  1V97 A;  2IGG A;  2E3T A;  4YTN B;  3T3N A;  1BML C;  3ZJU A;  1CJE A;  1ZOY B;  3AE4 B;  3WCQ A;  1TS5 A;  3FC4 A;  1JCK B;  2N0S B;  3RFZ B;  1MVK A;  1PYW D;  1E0Z A;  2W3S A;  4D2K A;  1K50 A;  2OED A;  2HDE A;  4L1B A;  2YEP B;  5D7G A;  4A55 A;  4OZB A;  3EA6 A;  2WXH A;  3IAM 1;  1K52 A;  1PDX A;  4HJG E;  1D5M C;  3HUI A;  1D6E C;  5TSS A;  4US9 A;  1SXT A;  1EM7 A;  1N5W A;  4N59 A;  2ON8 A;  2V3P A;  1B1Z A;  1FNU A;  2G9H D;  1JQ4 A;  2NTT A;  4GDL B;  4OZA A;  1QF6 A;  2J52 A;  3P63 A;  3BYT B;  3U4E G;  4R3D A;  4RFB A;  4YT0 B;  2WXJ A;  3R2T A;  3P4Q B;  1XLO A;  2RPV A;  2H88 B;  1F2R I;  1LO5 D;  2EKI A;  1TY2 A;  2W54 A;  4IDI A;  2DLB A;  1C77 A;  5H8Y E;  1L5P A;  1YN4 A;  3TEZ A;  2CJN A;  3ZYY X;  2BTE A;  5BMH A;  4HKZ E;  1ZDX A;  1ZPS A;  2WU5 B;  3E9S A;  4XE0 A;  1CQV A;  1VZ8 A;  2ICI A;  2PTL A;  2N9K A;  3IT6 B;  2K22 A;  1XCQ L;  4ZRP A;  2BB5 A;  1F0Z A;  1FIQ A;  1NI3 A;  4ITK A;  5D3D A;  4LK0 M;  3Q8E A;  2PVO D;  2WLB A;  1P7F A;  3P4P B;  3U52 E;  4H2A A;  4HRO A;  4AS1 A;  3OWE B;  1B9R A;  1TKG A;  3E56 A;  3AEB B;  3DWM A;  2E6X A;  2FBW B;  4XWW A;  1QIL A;  1RFK A;  1A70 A;  1K51 A;  1HA5 A;  5EE1 A;  3AH7 A;  4N58 A;  2ZW1 A;  1QKZ A;  3IT4 B;  1ET9 A;  1RM6 C;  3P4S B;  2JXT A;  1AWD A;  3NZ3 A;  4DXG A;  1XCT L;  2WXL A;  2XNA C;  1WSP A;  4A9A A;  3BVZ A;  2WU2 B;  3AE2 B;  1XLN A;  4XDC A;  3VR9 B;  1TJE A;  2EEL A;  3RPF C;  1E9M A;  3AE1 B;  4Q2J A;  1I4Q A;  1UNS A;  3W5U B;  5C3J B;  3Q69 A;  3AEA B;  3C8Y A;  4JWU C;  3SFE B;  2LUM A;  1I4X A;  1T3Q A;  4KGS A;  4RCO A;  3NS1 A;  1L4D B;  1XXG A;  1C78 A;  2ONQ A;  1YJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...