2CN1A

Crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)(casp target)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cn1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2cn1A01
2OA0A 3QU2A 1L7MA 1YV9A 2GHTA 4UMVA 3U7GA 1TE2A 4BNDA 2GHQA 3FPSA 4Y2RA 1U7OA 3ESRA 5AW7A 3R09A 4YCMA 3I76A 3WGVA 5AI9A 2EATA 3S6JA 2I33A 4AS3A 3PDWA 2C8KA 1RRCA 4G9BA 3OCXA 3FVVA 4Y2YA 1YDFA 1SWVA 4YH1A 2ZG6A 3MN1A 5A3QA 3MC1A 5AVZA 1L7NA 5A3SA 4Y2VA 5A3RA 5ALIA 4XPZA 3WKCA 3HLTA 4EELA 2OBBA 2QLTA 5ALFA 1Z4PX 1AQ6A 3FZQA 3QX7A 2C8LA 1Q92A 4HGPA 5IS2A 5AKZA 2ZOSA 4FFDA 3SMVA 4F71A 4GIBA 1VJ5A 1ZD3A 2CFTA 3WKDA 1X42A 2RBKA 5AKKA 4KX3A 2EARA 3QU9A 5AESA 3QU7A 4RETA 2FPXA 3QU5A 1Z4JA 1T5TA 4HYTA 4B6JA 1QYIA 3SHQA 3OCZA 5AKEA 5ALYA 1TA0A 5AK6A 1NF2A 1U2TA 3N8GA 3KC2A 5ALSA 3WK7A 2WHEA 1U02A 4G63A 3RF6A 1WVIA 2HSZA 3DAOA 1L8LA 1JUDA 4HGNA 3ZVNA 2AH5A 4IFTA 1SU4A 3ZWKA 3CNHA 1T5SA 1N8NA 4NAVA 3IJ5A 2FI1A 5AKXA 3L8HA 3ZWDA 3RFUA 3UMGA 2X4DA 2YJ4A 1O03A 4DFDA 2HI0A 3TLMA 1QQ7A 3WKBA 5IT0A 2YFYA 4OCZA 4BNDB 4L6AA 1VJRA 2ZXEA 4MUMA 3U7FB 3F9RA 2I55A 3U7EB 4Y2UA 5T41A 5ALVA 2B1RA 2MU1A 1RKQA 1WR8A 2PKEA 2YJ6A 5ALUA 2HDOA 5AVUA 3R9KA 4UW9A 5AM2A 4KNWA 1Y8AA 2AUTA 5ALHA 5ALMA 1RMYA 4CNQA 5ALNA 3AR3A 2JARA 4UASA 2GO7A 4CE6A 2P11A 2IOFA 2D2VA 3SKYA 4UMEA 4EX6A 4BX0A 4L57A 2C4NA 1RC8A 3KZXA 4YCNA 3WK8A 1TJ4A 4UATA 4UMDA 3DV9A 5AK5A 4Y3UA 1J97A 1EK2A 3OCUA 4CF4A 4ZEXA 1CR6A 3B9RA 2FUCA 4L6CA 3DDHA 4DCCA 4HGOA 4C4TA 3M1YA 2IA5A 3A1CA 4JDPA 4QQFA 3AR9A 3WGUA 1Z4IA 1Z4MA 2WF8A 3GYGA 3QNMA 5AI8A 5AI0A 1Z4OA 5AKGA 2W11A 4XOUA 1J8DA 4BEVA 5ALXA 1PW5A 4BX2A 2B30A 4FYPA 1L6RA 5AM3A 1FEZA 4BBJA 5AIBA 2IYEA 1LTQA 2ODAA 3EF1A 1ZOLA 1L8OA 3AR5A 3L8EA 3ZVMA 3OCVA 4IG4A 3ONNA 5AW1A 1XP5A 5ALJA 1VFPA 3L1UA 1RKUA 4YIHA 5AKIA 2IOFK 4YGYA 3WKEA 2R8YA 2CFRA 2R8ZA 2FDRA 2B1QA 5AW6A 5ALRA 2C88A 1L7PA 3E58A 3MPOA 4OHFA 4UAVA 3W5DA 1ZJJA 3QYPA 1T9ZA 3QXGA 3A3YA 5FP0A 3L0CA 3SKXA 3KD3A 5AW4A 3IRUA 3A1DA 2Q5EA 3E84A 3KBBA 4C4SA 1ZD5A 1IWOA 4BX3A 4UM7A 4EZEA 3QUTA 3KDPA 4Y2SA 5AVRA 5ALLA 5AM4A 1RPZA 3ZX4A 3P96A 4Y2XA 3ESQA 1RDFA 1CQZA 1YS9A 3N5KA 1ZS9A 5AVSA 3E8MA 3U19A 3L0YA 3UMCA 1RQNA 4DW8A 5AM0A 4EEKA 2G1AA 2B0CA 4H1WA 1Z4KA 4XQ0A 4NWIA 3I6BA 3MMZA 5E0OA 5JJBA 2I34A 3ET5A 1TJ3A 2JAOA 4OD0A 3M9LA 3IB6A 3ZTWA 1Z5GA 2GMWA 4XE5A 1RKVA 5ALPA 3OCWA 2W4MA 3A1EA 1XPJA 1NNLA 2GFHA 4BKMA 2FPWA 3ZW7A 2O2XA 1YMQA 3FM9A 5AW2A 2JGAA 5ALWA 4JB3A 3EWIA 4F72A 2R8XA 1TJ5A 4PNHA 2OM6A 3K1ZA 3AR6A 2FPRA 2JAUA 3L0BA 4I9FA 3U26A 3W5AA 3L7YA 4UMFA 1RLTA 5ALTA 2ZBDA 1U2SA 2YJ3A 1XVIA 5AI6A 5ALOA 1Q91A 2RAVA 3EPRA 1QQ5A 4UU1A 1KYTA 3SD7A 5AW8A 2PR7A 3NIWA 2WM8A 2I54A 3ET4A 2IOHA 3R4CA 1EK1A 5AKJA 2YJ5A 3WKAA 1ZRMA 2YMPA 2YN4A 1Z4QA 2YMLA 1NRWA 1RMQA 4NABA 4NFLA 5AM1A 3EF0A 2VKQA 5AKLA 2FUEA 5AK3A 5AI4A 3N07A 3W5BA 2B8EA 4Y2JA 3NANA 3AR7A 4UU0A 2YY6A 4OFZA 2WF6A 2WF9A 1RQLA 2AMYA 3VAYA 3WK6A 2G09A 1QH9A 2HOQA 5AIAA 5AVXA 3U13A 5AM5A 2PQ0A 4I9GA 1Z88A 1RLMA 4BYGA 2BY4A 1Z4NA 3BWVA 3SLRA 3AR8A 4CF5A 1S2OA 4HAIA 2W43A 2Q4TA 4FE3A 3U7HB 3AR4A 3I28A 1ZD2P 3BA6A 2R8EA 5AW5A 2WF5A 4DWOA 2B8JA 4KX5A 5AKYA 3L5KA 3QUBA 4YCLA 3N1UA 5AVQA 1Z5UA 3SF0A 2P9JA 3B8EA 3W5CA 4UAUA 2HCFA 3L1VA 5ALZA 2FPUA 4EX7A 4HGRA 2EAUA 5IT4A 5AW9A 2BDEA 3KOOA 4QJBA 3L8FA 5ALGA 2QYHA 4J03A 5AW0A 3ZTYA 1ZRNA 5AVYA 4Y2PA 2HF2A 4NV0A 2I7DA 3QLEA 2RARA 3ED5A 2RB5A 2P69A 2HX1A 3DNPA 3QU4A 3NASA 1SWWA 4J2TA 4CF3A 3NALA 4Y2TA 1YJ5A 4KNVA 2HO4A 2CN1A 2ZBFA 2HF7A 2FEAA 3QGMA 1QQ6A 5ALQA 1L7OA 3N28A 2G80A 1WZCA 3WK5A 4GXTA 1K1EA 5AK4A 1O08A 2NYVA 4Y2QA 4MWOA 3ZI4A 2B82A 2JAWA 5AVWA 3WK4A 2G06A 3ZX5A 4YIKA 3NUQA 3ZUPA 5AW3A 2G07A 3NAMA 2HEGA 2G0AA 4KN8A 1N9KA 5ALDA 3D6JA 3OPXA 4HGQA 4KYTA 4EENA 1LVHA 2ZBEA 1S8OA 3UMBA 4BEWA 3OTQA 3UM9A 2P27A 4ZEWA 4C4RA 5AI5A 5AHXA 3NRJA 3ZU6A 2G08A 2YMMA 4E88A 1Z4LA 3HYCA 5AVTA 3ZVLA 5AVVA 2YMQA 3B9BA 4UM5A 4AP9A 2WFAA 2MSNA 2C9MA 3J7TA 4ZEVA 2YBDA 3PGVA 3E81A 3I1YA 2WF7A 3FPBA 1RMTA 3WK9A 1F5SA 2OYCA 5ALKA 4O8CA 5AKHA 1RLOA 3PGLA 1WPGA 2BDUA 2NO5A 3L8GA 1MH9A 2I6XA 2ZBGA 4RESA 4AS2A 4UARA 2O9JA 3CZ4A 3QUQA 3OCYA 1ZD4A 2HHLA 2FPSA 3QUCA 2CFSA 3FGOA 1YNSA 2AGVA 2DQSA 3AR2A 1U7PA 3PCTA 5ALEA 2Q4RA 5AICA 2NO4A
chains in the Genus database with same CATH superfamily
1XQ6A 1HFJA 1E2KA 3DF9A 2Q2OA 2PMZC 2CVZA 3OOHA 4JLPA 4XSVA 3EPKA 4OOEA 1JEYB 2JANA 2C8KA 2FEKA 3Q9LA 2C0QA 3UK7A 2CCJA 1N62A 5DLYA 3G1UA 4LZOA 2Y9PB 2GN6A 2XTAA 4BLSA 1CWUA 4EHFA 3Q10A 3N7UA 3EK2A 1DS6A 4B7ZA 5GONB 2XVXA 2HA3A 4QA9A 1IHOA 3G1TA 5M3BA 3UAWA 2VNKA 2POCA 5JJCA 1XQYA 2VHWA 4KYIB 1L8LA 3KLOA 1QBKC 3UA4A 3ETGA 3S2FA 2E2WA 4KPEC 4RYLA 3SQXA 3DVQX 3BMCA 3WKBA 1JR3A 5DHRA 1D5WA 3U7FB 1PZGA 3GQBB 4BATA 4HADA 5CLQA 3I2HA 1VIVA 1D2CA 1P0PA 1SUWA 4I55B 5KINB 1HEUA 4RGQA 2C0CA 3BSYA 5AK5A 3L7MA 4LG1A 2XCPA 1XLWA 2HMXA 1DHRA 1SVOA 1F51E 2X4IA 2FVXA 1N0WA 3PFGA 3AR9A 3HJAA 1PP4A 1RU3A 4K86A 4WNAA 9ICPA 1A7JA 1RZRA 5ELLA 1GV0A 2XCSB 1UJ4A 2B0JA 3NH9A 1HE4A 1OCEA 2QD5A 2Q0XA 2ODAA 1UK9A 4YK7A 4ZGGA 1Y98A 3L1UA 3ADPA 2E1FA 3BMNA 1G2OA 5FTWA 2J0VA 4M98A 4P4TA 2E0IA 1DKMA 3RYFA 2VANA 4KC0A 2NTYC 4UB1A 3I05A 3M6FA 3TD9A 1QZTA 4YN4A 4QWCA 2X3YA 4UM9D 1J09A 2D7CA 3CGWA 3AEZA 1FFBA 4DC0A 3IDWA 1FLDA 5J0QA 2R6JA 3RNOA 1EBBA 4UNQA 4YRMA 4PSDA 3MMZA 4CM5A 4U6PA 2KJ8A 3SZMA 3A1EA 2W6JA 2XMRA 1LVUA 4NIMA 5IAGA 3FUVA 1M2VB 3UG6A 2V59A 3STWA 3KJHA 2K7FA 4DSTA 3K9CA 4XR9A 1HNNA 3LGXA 2XRFA 3M3HA 2CUZA 4R4JA 4ND1A 4NS4A 1U3TA 4B8YA 1B74A 3KEMA 2R5NA 1YL7A 2ZUVA 3AP1A 4G1MB 4V2IA 5FB3A 2NO0A 5KDLA 3TVTA 1WYGA 4DQVA 4NCAA 3AF2A 3IJPA 1DMSA 4R3UC 2BTQB 1NBIA 3HBJA 5KWIA 2B5OA 3HXQA 2ZRFA 1G7SA 1S7GA 1Z74A 5BVHA 4P58A 2VZ8A 5U9CA 1EFVA 5A2QA 5CA7A 2FPUA 2QQ0A 3ND7A 5A5FA 4DRZA 3NB0A 2CNOA 4GMGA 4XX0B 3F8TA 4CMAA 3OIGA 2IZ7A 1NT4A 3NATA 2AFRA 1XG5A 2KG5A 1KYYA 1SKUA 1XTBA 2D1TA 3JQ8A 3EIUA 1EFCA 5BN3A 1DEXA 2AD5A 1ODKA 2EKPA 3NS7A 1X87A 4NYJR 2QZSA 4FDAA 3ZIUA 3LXUX 2RGAA 3PE4A 2ALZA 3C2QA 3AHGA 2V96A 2JEIA 2ZE7A 4EO4A 3HRIA 1JIXA 3LUBA 3JAMA 1ECFA 4B74A 2ZTVA 1FMTA 4UB5A 3RB6A 1G60A 1YQWA 1AK2A 2QAJA 4EG5A 2BFCA 1KVQA 1R0LA 4DZTA 3I2JA 3QUCA 1CUIA 5DLQC 1HQKA 1XYGA 3PWZA 5KNBH 1DXSA 5JMPA 1PEYA 1A8QA 1QSSA 2NPIA 5GOTA 4ZI7F 4EW6A 2VJDA 2H4XA 3WGVA 3AINA 3G6YA 5LC1A 2ENWA 5A9SB 2BZ1A 1JFFA 3KM0A 1NVXQ 1ADCA 4PHPA 5AXAA 4Z9YA 5JMWA 3QX7A 2GSWA 3T34A 3UZUA 2GPTA 1L6NA 4FGJA 3QELA 1UWKA 3CW9A 4IWXA 1KJQA 4DMCA 2IL1A 1TK0A 1H4TA 4D25A 3DAOA 2QUJA 4DLRA 1OHHA 4UEWA 2X1LA 3WE7A 2VDUE 3HO8A 2ZI5A 4D4LA 1JU4A 3GJYA 2C2EA 3O92A 2VO1A 1EH5A 1WZEA 5KNLA 4IRDA 3R5HA 5TVKA 4QGGA 4ELUA 3SDZA 3LBYA 4MV3A 2P9TA 1TAUA 4TV8B 4LE2A 1S2IA 4EX6A 4JLWA 4YP5A 4YMTA 1ORDA 2YVUA 1LH0A 1JHYA 1JG6A 1PRYA 2YQZA 1AS2A 2R47A 4RHXA 1S3IA 3EGXA 1KKXA 2WHPB 4GOOD 4U2GA 1YF3A 5KB3A 5LQNA 4UE2A 3GYGA 1ZFNA 3DULA 2B4KA 4C87A 4J9PA 2YC4C 1PJBA 3OFKA 4IV0A 4KIGA 1JMYA 4E4YA 5E9JA 1U8AA 3IDOA 1I4EB 3X2EA 3AR5A 2HXYA 3M5PA 3IQIX 4GUAA 4FFOA 2WINI 2C95A 1OLOA 4WPGA 2WNSA 1ZK1A 4HDMB 1P73A 3GFPA 3TRFA 4IDEA 1XHLA 3LF1A 3LW8A 1XHFA 1VLLA 1TI7A 5EE5B 3KQVA 1P1CA 3ADDA 3RTEA 5TNXA 1QUFA 3AQ4A 2VAMA 4DMHA 3VDQA 3FC4A 1SHLA 4XD7D 1FBNA 3ND5A 3R7AA 2BM1A 3DOJA 4YUWA 3QA9A 4WY5A 4HX5A 2V7GA 3HUDA 4PTZA 2HL6A 4D9HA 4ECWA 4AG6A 4ZOHC 5ITSA 4RWEA 1EWQA 2UVUA 1JIIA 1YMQA 1YRBA 1QANA 5JZVA 1M54A 3STVA 4H7HA 4NZZA 3NOVA 4DDHA 1NONA 3IUJA 2CL6X 3A6LA 3Q8MA 3RG2A 3QVTA 1KDHA 2P8JA 2DPGA 4OL0A 3OIUA 4G8CA 1Q11A 4NABA 3AUFA 3FWZA 3W5BA 1NIJA 2R7AA 3GLKA 1X1RA 3NANA 2XI4A 3QXCA 3WS7A 4LGMA 3EJWA 1IZYA 5LBTA 2W37A 2EWMA 1NUSA 2FPMA 4IM7A 2XQGA 1MA7A 1X94A 3GLQA 3QG1A 2XQIA 3WNQA 3SLRA 2ZYDA 2RG7A 4NEGA 4ENSA 2WAAA 1UBUS 3T4UA 5TARA 4B0OA 1U9IC 1TU4A 4IMPA 2BFDA 2CNKA 3LX5A 1GARA 1CVLA 4ITUA 4I19A 2NQ8A 1N63A 2JHFA 3A1TA 3TE6A 3OURA 3F8SA 1TQ6A 4QARA 1F48A 4LKRA 4HQFA 4F1JA 5AUNB 2VK2A 2CYCA 3T7AA 3SR3A 1LC3A 3RFTA 2XITA 1NJZA 2GVNA 4IJKA 4AYWA 3OOWA 5EMHA 3L1JA 7ICKA 4P4SB 3OTIA 5AH0A 4TQUS 1RBYA 2A30A 4LRTB 4AKIA 4M1OA 4BPRA 5BSGA 4TGLA 3E3NA 1O87A 4CIAA 1VRVA 2HFJA 4IJQA 4XTCS 1I2DA 7ICEA 2EZZA 4JLUA 3OZFA 1Z17A 2J59A 1NP7A 1RS0A 1CUHA 4Y6PA 4XYBA 1UFRA 5BUZA 1ZPDA 2XB2A 4AYBC 1H2AS 4KVGA 5IBRA 1QP7A 4PSVA 1WPGA 2G4VA 2AFHB 1SZJG 4EUFA 4RPHA 2XCIA 1MR3F 1YVPA 7ICIA 3T3MB 1XXHE 5TGDA 3T7KA 3N0WA 5T64A 3CLTC 3EUB2 1W0KA 3SQIA 3L1IA 4OQZA 3OPVA 4KH0A 2P7IA 2X86A 3RGWS 1B26A 3T3HA 4UAZA 3UXEA 4ZYZA 3MBKA 3GOQA 4RPCA 2OUIA 3L06A 3SMVA 2ZETA 3A3PA 4MAAA 4HNGA 1B8NA 1UR5A 5DJ5A 3QU7A 4BIIA 5C1PA 3A26A 1I6KA 3WYGA 3LWLA 3B51X 1R4MA 3R0ZA 2RJOA 2X40A 1SVSA 3CVVA 4G3XA 4NAVA 3M6AA 4PAGA 1JLSA 5HK9A 4PPYA 1WWVA 3M5DA 4RKQA 2ZBRA 2NYUA 4F8JA 3CUUA 1WB6A 5DDIP 3VMMA 5C35A 3MCUA 5KNIA 5CFLA 1UKYA 4JVOA 2FJPA 4HNAA 2NP6A 2HRZA 2PSDA 1X1CA 4MQLA 3D7KA 2FVYA 4Q4AB 1FDSA 4HAYA 1SZCA 4F91B 3WLHA 1ZP6A 1R0WA 3QVOA 3T38A 3M34A 5HCNA 3THXB 1KY4A 4X6UA 2ZRIA 3F6CA 3MJFA 2JAPA 1QQTA 4H7DA 5E7MA 4HEQA 2QY6A 2XE6A 2DB3A 5K0JA 3T5BA 3UWSA 4PZLA 1Z4OA 3NHYA 3PF8A 1JGTA 1HT2E 1SG6A 3Q1LA 1Z63A 4QIWF 3EQZA 3IKLA 2ZWOA 4A5SA 3B6MA 3KIPA 2VYNA 2IV7A 1E94E 4R54A 4RH0A 4L8YA 3SX2A 3W9BA 1E62A 5TDHA 3DBVO 4OQYA 1P8AA 1EHIA 2CFRA 3ZDDA 5LOVB 3V7LA 2JZOA 1N9GB 1HUZA 4DQKA 5LJLA 4TWJA 2G5PA 3O1LA 3C1YA 4TKLA 1BHQ1 2ZWAA 1OGYA 2FJ6A 4DF8A 4GKJB 1EWVA 3TFWA 2ZYIA 4X00A 3HPRA 3NVDA 2OY0A 1BDJA 4XB1A 1TPYA 2IC5A 3ASUA 3QUAA 3GEEA 5IYZA 3H0RB 4LYDA 1Y1KE 3IEXA 4XWWA 5AM0A 2FSIA 4OI2A 4C5AA 3CX7A 2I1VB 1ZRHA 4K4GA 4MYDA 4QYXA 3FB4A 4I1YA 3VO1A 2IYTA 1GAXA 1BE8A 2NZ8A 3P0EA 2JH1A 2HJGA 2NXWA 4EWLA 4QPPA 2J31A 3K0CA 4I4TB 1LGYA 5A5EA 3IEIA 3LT0A 4MWGA 2JPDA 4L5YA 4E32A 3E8SA 3RH4A 4DQSA 3FKSA 2LVBA 4X84A 3MBOA 1F6DA 1UK6A 3MUNA 3PICA 3KQYA 3JQAB 3C15C 1Z2DA 4E4TA 3VU3A 1UT6A 4RIEA 1N7HA 2M9NA 3L1HA 9ICJA 1ST2A 5FBRB 1RQLA 1C2TA 4WY8A 1KSGA 5DHPA 2EBWA 3A4LA 5A4FS 1YZUA 5K7SA 2H3HA 2J6HA 4B3BA 2YRWA 1RWKA 4ZRDA 5B58C 1TYBE 3B8EA 4CMKA 1MB9A 5SZHB 2COKA 2X6QA 2GN2A 2QYHA 3LDUA 1K06A 5P21A 4JXZA 3RE1A 2XRZA 4TMWA 5LQUA 3HDQA 4Q37A 3I04A 1KKLA 3ZQ4A 2PUCA 3BRSA 1SG0A 5BOLA 2FE4A 2BONA 3LP5A 2CV1A 2XUPA 1PGOA 3SEZA 2I22A 3EULA 1Q16A 9ICEA 2UVRA 2G3YA 2W2KB 3ZWAA 4R31A 2O4CA 4ICAA 1AD2A 2EX4A 4YLYA 3BFVA 4FDUA 2QVXX 4P84A 2QAIA 3PDUA 3C7AA 2QSUA 3PR4A 3CVYA 2QMOA 1M8GA 1H8HD 2FEWB 3PYLA 1JSRA 3V32A 1QC5B 4C0HA 1V16A 3D0KA 3P9CA 2ZIUB 4RESA 1S2LA 1KN5A 3TAHA 3WQBA 5DX0A 2ZUUA 3AM4A 5J3JA 3ZWVA 4EPXA 4RTPA 4M9XA 3NDRA 1RXYA 2NRXA 3OIYA 1YZGA 2H92A 3FYUA 3KYDB 1J1IA 1FTQA 2WYWA 5BR7A 3PUKA 4TWBA 1E7WA 4Q9LA 3VJRA 1LQTA 5JASA 2DULA 5KS2A 4PPGA 1PQUA 2ZUTA 3PMLA 1C3LA 5TEVA 2JI6A 3BTUA 5KJFA 4A1OA 3A10A 3ZD7A 3TDMA 2QAGB 4FZ3A 3H83A 1C81A 5H82A 3ICEA 1QYIA 3I8OA 3E18A 4R1QA 4LHVA 3ZBTA 1RWBA 3H5OA 2Y66A 1MV8A 1THZA 4B3SB 4J0DA 5IDQA 4NJMA 2V6FA 4NXZA 1GPH1 4IUDS 5JYDA 4G01B 2G70A 1Q20A 1O95C 4G2TA 4EA9A 1EBFA 2IEAA 1I10A 2BEWB 1MSWD 4TKVA 2Z09A 2FG7C 3FWHA 4LE1A 2REQA 1QIGA 2QS9A 2Y92A 4HC4A 4JEIA 4R2XA 2FPPB 2J8ZA 4R9NA 4TKMA 3T7RA 2FW7A 3PQ2A 2HADA 4DHWA 3BT7A 4HRYA 3WL7A 5EIFA 2QE6A 1E9DA 4C04A 8ICUA 2IFTA 2XNKA 3F6RA 2R5WA 1I7NA 1CUKA 5KNDH 4QU5A 2PVPA 1GT6A 4CYMA 2RHHA 1A9SA 4MQEA 3WRXC 1XPRA 1PG0A 4E5SA 2IOQA 4WOBA 1GPKA 2NQTA 4RBNA 3UMYA 4YT8A 3PA6A 3OLYA 3IP3A 1KEPA 4RY8A 1ZN8A 1RYRA 1OX4B 3MAJA 4ZDIA 2YTZA 1T8EA 1HG0A 2UYHA 3I01M 4Q15A 1J06A 4DV3B 4QNRA 2RHJA 5CCDA 1EJBA 1DJLA 4CU2A 5BSWA 2PR2A 3L6DA 3EXFA 2YZMA 1KYIA 3TRJA 1KEWA 1AHIA 1VI2A 5D87A 3RIYA 4PCUA 3A04A 4E7OA 2P6PA 2P6NA 2HSDA 4JBNA 2FN4A 3GHYA 1CUYA 4JITA 5F3WB 2GD1O 5J2TA 1I0LA 1VMKA 5KTQA 1F2VA 2CD9A 2WJ6A 3NHLA 4WZBE 3OCWA 2R3SA 4ACAA 3LVRE 2Q1WA 1Y7LA 4N3GA 2EWVA 3DZBA 4Z3KA 3ZU3A 3ZI7A 4Z0HO 2LTAA 4DV4B 2WOJA 3T99A 2YS7A 3CUTA 4I9FA 1R16A 4PYLA 1NW3A 3ZGNA 1EVKA 4V0MA 3MTEA 3B9PA 1GKKA 2J09A 5DNAA 1UKZA 4GPEA 4MI9A 1Q1GA 4UFOA 3IERA 1EB9A 4XGIA 5DULA 3G2OA 3AEUA 4DREA 4EQZA 1TCVA 4N0PA 4GOND 3H19A 2FRDC 1FFCA 1YJBA 1DV2A 1Z0UA 4MV8A 5HPYB 3NPAA 1T8UA 1NBEA 4OI1A 1VRWA 5AIAA 1ILWA 1ZCJA 4G81A 1IY1A 1ZQVA 2J7KA 4GOMD 3EMDA 3K72B 2XV1A 1X80B 5FQNA 4WCDA 2RGBA 2PSHA 1UOOA 3CC8A 3NDJA 1E0DA 3L1VA 4W6QA 5EESA 3U4HA 1WXDA 3D3WA 3HKEB 1V7QA 3OCCA 2OFWA 4J2TA 5ANRB 8GPBA 5GZ1A 4UHJA 2HSWA 5DP2A 5K8TA 4AKTA 3U37A 3B1VA 1US8A 1K1EA 2CJFA 1A77A 3LOQA 2XGSA 2OXEA 1XDZA 1C3OA 3R3HA 2JVKA 1T6NA 3A6JA 2R5FA 3HMQA 4D9BA 4J1TA 3GG2A 2L0XA 1ZW1A 3EAFA 3T6KA 4GOKA 4JJ8A 1KR2A 1RHQA 2OBMA 4MUNA 3RS2A 3WGTA 2Y0CA 5BOSB 3BD7A 4HLUC 3GFQA 5JWHA 1JQBA 3L8GA 4I8IA 2DLDA 1EK0A 1ENYA 4OA8A 3MGKA 3UXYA 2FWNA 3ENNA 4ZYWA 4FX2A 3BQNB 3QU2A 2CHVA 5TXGA 4F04A 1GFWA 2FN3A 1SM4A 4OU4A 4UBLA 3RC9A 1T2AA 4TV9A 4XI9A 4AN1A 3Q2OA 1MA0A 1EQ2A 2W2NA 4PN3A 2NO6A 4WXEA 4LMAA 3G13A 1KERA 5IK2D 1Q0UA 4D8YA 4LF7B 4MGYR 3GUCA 2TSYB 2QK4A 2ZSIA 4RM2A 1Z06A 2PS1A 2AD1A 4QHTA 1E3IA 1SCUB 5JYEA 2VDMB 1Y6RA 2RBKA 3C2MA 2HKIA 2RGRA 4D44A 1PJTA 3OZGA 2GF9A 5CFMA 3W79A 3ZR4B 2O8EB 3DVSX 4LZLA 2DTXA 3RRJA 2AG8A 4KITB 1KVSA 4C8MA 2Y99A 1VCMA 4O5CA 1KQQA 3CIFA 1KMHB 3ZWOA 1R4ZA 1C3JA 3EC2A 1FTSA 1MX3A 1ZXBA 3PNQA 3S0JA 4FCVA 2LWIA 1Z7WA 3FNGA 2H1LA 3BUSA 2P2YA 4WJ3B 1A3CA 2KSOB 3JWIA 4OHRA 4IR9A 2JGKA 2D2VA 3N9IA 1IM5A 1PK1B 4RACA 4J9SA 5EWFA 3MILA 3HPQA 1IH8A 3W77A 1XEXA 5KNCA 2XVYA 3V1UA 1P4GA 1XF9A 3ZBQA 4YFKA 2VYVD 2W58A 5AI8A 1M2FA 1VL8A 2NIPA 3BHNA 1L4GA 4AF8A 3SHWA 521PA 3B1YA 1RWOA 2VN8A 3ONNA 3M1LA 5DXJA 4IHJA 4F56A 4FBUA 4G41A 4FMDB 3HBMA 5CNMA 9ICSA 5CFNA 1YIAA 4EMBA 3Q2IA 1CUUA 1AO0A 1R0XA 1UBLS 3DBRA 3R9IA 2CJYA 3VDMA 1CEYA 3GLFB 4JVSB 2BI8A 3RREA 2G5HB 4KHZA 2BM8A 2ASJA 2VEOA 1O57A 3K8OE 4J90A 1CUAA 1E2LA 5J5AA 1QDEA 3SGLA 4XUGB 3R5FA 1C4WA 5A4KA 2G5IB 3VH2A 2GYWA 4IR1A 1ADGA 4LZZA 2FHPA 5DASA 4ZGWA 4MS1B 1WHSA 1MIOA 4G8BA 1YQEA 2W7PA 4GG1A 4QU0A 1HEYA 5ALOA 1NNUA 3A1FA 2VG8A 3V7NA 4JJAA 2CCGA 3PRKE 3FMOB 2C57A 4MRNA 1I3CA 3H5WA 4Z3DA 4NFLA 3PU6A 1RYUA 4Z0TA 3TJRA 1Q0PA 1KHHA 3WLJA 1KKUA 1ZYUA 2OV6A 3JZAA 4OY3A 3K2IA 1PHRA 3TZQA 1CRPA 1NJ2A 5ESRA 3LHFA 4DWOA 3HVUA 5FOUA 2MYPA 2L18A 1CUEA 4BAZA 2VAXA 1BFDA 3LP6A 1NM5C 2EZUA 5E6RB 1JP7A 1GEGA 3HLYA 2OL4A 5JADA 2VT3A 4FGLA 3UO8B 1KO1A 1DBRA 4M60A 2F77X 3GV0A 4FILA 2VBFA 3IJEB 2Y0EA 4AICA 1FS4A 5C18A 2NX2A 5TGZA 1GPJA 2BHNA 1ZCBA 4HN2A 5G4KB 1YFZA 4BVEA 4MEYA 4Y2HA 3SAFA 2R86A 1H2XA 1ZIXA 1RR6A 3ZWYA 4EATA 3SI7A 3NRJA 5CPFA 2XDAA 3PHIA 5AVVA 5DHQA 2C9MA 3E4DA 1RMTA 2XAUA 2YCLA 1RWXA 3CNNA 3IG5A 2OENG 4DJ5X 2XUAA 3SXUA 3GFFA 1KOJA 1K3TA 3NWEA 3EVFA 5KDOA 1SKSA 4FYIA 1VCHA 2NO4A 3FCYA 5CW1A 3KKAA 4C7BA 2FG5A 2F00A 4YLEA 2QTGA 2LRHA 4LRYA 4FHZA 2ZJ2A 1FZQA 1SO8A 1D8LA 4P0QA 2IOYA 1GFIA 2Y1CA 3OCXA 5KNBD 1I9GA 3AKYA 1NXXA 3WLQA 3CW2A 2ZG6A 1PJ8A 3OE5A 3LYLA 4WZAA 4ZJPA 3H9JA 3A6DA 1AQ6A 1MD9A 1TEVA 4JYPA 3PNVA 1D0IA 3BGWA 4B2IA 4HD8A 5BR8B 1VG9B 1Y4AE 1RIIA 2NTEA 5FL7D 1ZQ9A 2PKQO 3SHQA 5ALYA 1WU7A 2REOA 2Z1DA 4EPYA 5F2KA 1WVIA 5J0OA 4OSPA 4J6EA 5SZJA 1U7XA 1J4AA 2FLKA 1T5SA 2RFLA 2V3VA 4RVUA 4BN5A 2IQIA 4PGHA 4L16A 1YUNA 4Z2YA 3QFRA 4X7BA 3TLZA 5LP6C 4B87A 4KXWA 5ALVA 2BFBB 1X38A 2H4JA 3A6HA 3GGJA 5TMPA 4RULA 3AR3A 1XJWA 4K9LA 4P4PA 3T9FA 2VSNA 3KWFA 2CPRA 2OC9A 4N39A 1QVRA 3S7TA 1CR4A 1N6PA 1VZ2A 1FX1A 3CZQA 1MPXA 4J7CA 8ICEA 1N9ZA 3IPCA 2B35A 2ZQZA 4NPHA 1K8XB 4LCBA 1J1ZA 2AOTB 2EDCA 3AZQA 3E9YA 3LC0A 5KMGA 3ZCRA 2X8LA 4KMUA 3JVVA 4JLSA 4CKBB 1KFKB 5CNKA 3C39A 3OCVA 3EDQA 2ZR0A 2C2WA 4QZVA 4YIHA 3AY3A 4OG2A 1WD7A 2FP4B 5ETJA 3PGA1 5E8RA 2H1VA 3EC1A 2PGJA 4KIUA 1NDUA 1SIWA 3LUDA 5DI3B 4L07A 4N0DA 1AZTA 2P77A 4WKPA 4F4JA 2ASEA 3QUTA 4C7XA 3KQQA 4DLTA 2VPZA 1KQPA 2PUVA 3F6BX 4QYMA 2D3DA 1IWBB 3F90A 4CR7A 2I76A 2AN5A 3L6UA 3D6VA 3L4BC 3GAAA 1UBMS 3UOWA 2ZB7A 4CR6A 1FVHA 1ISGA 1M2OA 4HUJA 5LNK6 1U9ZA 1VA5A 2VJMA 1DXOA 3D3JA 4LXGA 4L75A 9ICWA 4P4LA 5GM1A 4ER6A 2X9GA 2PMCA 1V9LA 2OCKA 5THXA 3JVIA 3DYIA 4AJNA 1OXXK 2JIOA 4J75A 2WWXA 3H9QA 3MK31 2GCIA 4QBFA 2AB0A 3TOCA 3IUQA 4II3A 1W8IA 3CM0A 4HK4A 5CEFA 5T5QA 5K01A 3T1VA 3VHRA 1UK8A 4XQEA 2A86A 4RTQA 2XKJE 2YY5A 3QJYA 4MFAA 2HCRA 3A58B 4CQLA 1ZD2P 3KOMA 3QKRA 5DMHA 1BG6A 1UIRA 3GN2A 1T2UA 5KFDA 3H5NA 1QK4A 3BMQB 4PO9A 1AGNA 1KJZA 2QARB 3OKPA 1PS8A 3ZDEA 2C3YA 1YGPA 1XN4A 3F46A 2VP3A 1M7BA 2LP4Y 4PO3X 1N2CB 4NLZA 1TLLA 1PVOA 1J0XO 4DPKA 1GZ7A 3KXIA 1S1CA 3C1UA 1AKEA 1DDGA 1HO3A 3F3KA 4MW5A 3HC7A 1IBKB 3BXPA 4DSOA 2ZJ5A 5EWLB 1TJPB 1HH4A 3BF7A 4D0SA 4ZKDA 4Z9XA 4CCYB 3I52A 3G2HA 3C3EA 2AJLI 2LIPA 5C0YA 1YRAA 1WCXA 3IBFA 2OCIA 2H0AA 4YASA 4HN9A 4AJIA 3TIVA 3C3XA 2ZT5A 1TTHA 3CS3A 2OK8A 5F7JA 5GONA 5L8VA 1GFSA 2GEKA 2QI9F 4HDNB 4DL3A 2Q6LA 1N0VC 5JAIA 8ICWA 1ZGBA 3PR1A 2GZDA 3SXPA 4A2CA 3QOWA 1PSZA 1UL1X 2JFPA 3U7GA 1HETA 3ENWA 4YAOA 4X62B 4NULA 1U1CA 4WOPA 3GQBA 1PL6A 4PYIA 1UPCA 1Z5NA 2EEPA 4NY1A 3UICA 3BE8A 4FCTA 3W0LB 7ICGA 1QRUA 5JAZA 4QLAA 4I55A 3WZMA 3HKBA 4EAAA 2VQSA 3NYQA 4LXYA 4BL5A 1K66A 3NIBA 3JATB 3AJDA 3IELA 5HFNA 2Z5LA 4ALNA 1WS6A 3BWMA 4TL7A 2VSOA 4RIGA 1JUDA 4M49A 1JHMA 1XAHA 3CZ9A 3HVKA 3VNRA 2CNWA 1PAUA 2DUMA 2NNLD 3FX2A 2POQX 3PUIA 3N0VA 4G5RA 4HO1X 5KT5A 1GPYA 4QXRA 4DDMA 2P6UA 4Z6CA 5DTMA 2NXEA 2JFNA 5BQ3A 3GPLA 5A71A 4MMXB 3L8ZA 3MGHA 1UWVA 3PDIB 5HE9A 2QT0A 3LV8A 4TZKA 4W9NC 2AUMA 2JLSA 1JA9A 3LIPA 2VDQB 2OZLB 4OO1J 1YJXA 5FYDA 4TSFA 3UY4A 1LLQA 4DIBA 2FEXA 2YDYA 3KVVA 3RFXA 2UZ1B 3JARB 1ZQXA 3H97A 1ZQGA 3HA5A 4RZ2A 4JI7B 1GRNA 3ONDA 2XNCA 3CHYA 3PDCA 3FOWA 5E2IA 3OPYB 3WNZA 4QZGA 1DWOA 1M2VA 4OXXA 1RI3A 4FGKA 1UODA 3U44B 2JKZA 2OVBA 3LNCA 3HCWA 3ZPXA 2O6LA 3B1KA 2I87A 1BA2A 2ZANA 3U7QB 3NI2A 5DGDA 3IV9A 3A3YA 1XO0A 3KPVA 3AEYA 3AFMA 2BDPA 4IEFB 1A5BB 4KDFA 3UBTA 5FEMA 1TQ4A 2ERXA 5LP6B 2CCKA 2F1JA 5AVRA 4OKNA 4UVDA 3L77A 5DK6A 4W5NA 2H4HA 4P5EA 4D3DA 1UDAA 2QX7A 2BTQA 4EI7A 4US1R 3D2NA 1VIYA 3R7LA 4PLHA 1LJUA 4MWDA 4LSWA 3A70A 3AUSA 2W7OA 2IBKA 3CP8A 5IVKA 3PHLA 5KYKA 3FM9A 1F4LA 3ZZ1A 1U7DA 2FPLA 2R62A 4F5PA 4XX0A 5ECWA 2OQVA 4NBNA 2ZDGA 4QU8A 2DBQA 3UJBA 3N76A 3ROTA 3I8SA 4M1ZA 1YVUA 5EIOA 4DSFA 4M7RA 2IOHA 5DEIA 1Q3HA 4MYRA 3P0HA 2VJ4A 1YZ6A 3B6KA 1YS7A 3TB6A 4ZJZA 4YMOA 2ZAGA 2WTFA 1PK9A 2XY6A 5TC4A 4KI0A 1D2HA 3U13A 2ZIWA 2COEA 3EGOA 2OFPA 2C5HA 4UXIA 3UB3A 2A1IA 4HRAA 1ADYA 1V8DA 1IXRA 5KYXA 1O5TA 2Q0ZX 4YJGB 2O7VA 1XQWA 4BVJA 1EX6A 1U3FA 2VHCA 2HO5A 1IXYA 3ANLA 3C6XA 3M4XA 1JLHA 4D82A 4WD3A 3OJCA 5GINE 4KLJA 1SWWA 1YJ5A 1GGFA 2XBMA 4MULA 3CX4A 4KQMA 4R8SA 2ZRBA 3KNZA 3CKKA 2VC2B 4CTJA 3R8XA 2YNMC 1QH1B 1N7JA 3A6FA 4YIKA 3NTOA 5DHTA 1KJJA 1CP2A 2XEDA 2VJLA 4EABA 4A6DA 4KO3S 3IO5A 4ZO9A 5J2GA 2PBLA 4QDOA 2G08A 3F4BA 2YDXA 3KZ1E 3NIGB 1TKBA 1NLFA 4U63A 1LKYA 2FY8A 2NT4A 4RKWA 1KL7A 4RZRA 4IIEA 4MQ5A 3W6ZA 3HU2A 3UA3A 2HIHA 4X3CA 1C4KA 1HSOA 3O4RA 8ICOA 3MUOA 2BEVA 4BNMA 3PW5A 3T0IA 2CKMA 2Z2KA 3JQ9A 3IQWA 4CMIB 3SEIA 4C0XA 2DG2A 2EP8A 2G5GX 4V3BA 1XQXA 1DI0A 5AW7A 2R2GA 2Y1KA 2E49A 5JPCA 3G2NA 4YEDA 2BFOA 1H6DA 5D2CA 1DINA 4WK6A 4EB8A 2Y0DA 2BFPA 1RE1A 1ZH6A 5ALIA 4IZHA 4WFQA 2J1LA 1VKNA 3OD5A 3TLAA 4ZOAA 2G7MC 5KFZA 4JCOA 2WHPA 5TV2A 3BZKA 3JPOA 4LZGA 4XJXA 1R27A 3B12A 3RS7A 2IBTA 3OAAA 3N2YA 3CZ5A 1HGXA 1OGIA 3DMGA 1D0VA 1N36B 5J8YA 1FUIA 3GRUA 2ODBA 3D02A 2IYAA 1SBYA 3M9NB 1SUSA 4QRIA 2WIBA 3GRZA 4HDMA 4EB3A 1XRNA 1ZOIA 4OLFA 2B1RA 3OUZA 3AKCA 4JSYA 1N5DA 2XMSA 2G9VA 1KXZA 1QAOA 5JJIA 2I80A 1WPQA 2WK1A 4CN9A 2P11A 1I4OA 2P66A 3J81k 4L9SA 3HB4X 1YDMA 3ASVA 3WLIA 1LK5A 4W99A 4CHTA 1COKA 4Z4QA 3CLHA 5H3HA 2OHOA 4OTZA 4L95C 5I7UA 4E5YA 1SVKA 1BAPA 1H3NA 1L5SA 1GIAA 3QPVA 4KN4A 1RRKA 5DT9A 5K6AA 3H5AA 1YHYA 4Y0AA 4EA7A 4FHDA 1DFIA 4LY9A 3AOGA 2EJUA 1Z18A 1ZQQA 2P2CA 2PD6A 2YHIB 4Q03A 5EJ6A 3ZJ5A 4IUBS 2B6NA 1XHEA 4GXKA 3KHHA 4CMGA 1J6UA 1VE6A 3L4EA 4YT4A 4RVCA 4Y2SA 4A6XA 1KSFX 2EL7A 2ZS7A 4J9RA 4Y2XA 4DL2A 2SCUB 3PNYA 1J0DA 2VR1A 3R5JA 4GP9A 4LYJA 4R2LA 4E7PA 3OP1A 1Y7HA 4MI3A 4GMXA 1IC6A 1P5ZB 2FPWA 1GZHB 4MGKR 2D0IA 1ZXXA 3G0BA 1NVVQ 1JWBB 4RWZA 2IYUA 1EGQA 1G291 4O3RA 3ZK8A 1LTHR 1NXPA 2VHVA 2PMKA 4OIFA 1PFUA 2GLEA 4OXQA 3CR3C 3CLKA 5FWYB 5THQA 4ER7A 5LMUB 3GPDG 3OJOA 4P4SA 1TQ2A 4R9VA 5JPDA 1YA6A 1NQUA 2HMWA 2WKRA 4G37A 5CFZA 3FSGD 4HAOA 3LDHA 2WWVD 1JEEA 4MF2A 4OQEA 1X7GA 3TD6A 3EDCA 4GXQA 4PHDA 5DNCA 3LYUA 3MELA 1ZETA 2F8TA 3C29A 1IJKA 8MHTA 3PFWO 4BFUA 2VKTA 3MA0A 3K70B 2X4LA 1I80A 4FJ2A 2P9JA 1NJWA 4EI2A 1VE7A 2JZBB 2JFUA 2XB8A 1OYWA 1SH7A 4HWTA 1E1QD 2AFHA 3I2YX 4H18A 3U3MA 2W6NA 4CF3A 1HY3A 2FE9A 6CHYA 1YH3A 6ABPA 4R65A 3PL5A 1L7OA 2QRQA 2OV3A 2ERCA 3FA2A 2Q46A 1VC2A 4BVBA 4TKUB 1KZHA 4JJZA 4LSZA 5DGTA 2BBSA 3KZVA 3C5GA 4MUGA 3CBQA 5H7XA 1SKMA 3E03A 4OJOA 2I1LA 2V7VA 1FDVA 5DRTA 5TIIA 4RMNA 4YYZA 3DM9B 4C8LA 3E3AA 3DO8A 3PEWA 3ZJYA 4PIVA 16PKA 1LPNA 2NO5A 3PSHA 1OF1A 4L5AA 2CXRA 4C0BA 3M6XA 1ABFA 5CT5A 3T8YA 2XMBA 4NL9A 1BD3A 1DADA 2PK3A 5EHNA 1JTEA 3PEYA 1P72A 4DMRA 4EYOA 4LJSA 4INPA 1R12A 4AS3A 4K9NA 3Q0EA 1S8FA 4PZ0A 3ZCQA 2FPIB 3A05A 5FA6A 3L40A 4Q4AA 3LHSA 4NCKA 3TTVA 1ZZEA 3VR5A 4AMZA 2PZEA 3THXA 3LWMA 4LZNA 1G19A 5KG6A 2Y93A 2ZBUA 1NN1A 3DH0A 5I7WA 4OYYA 1W8DA 2O19A 1XZGA 2CLCX 2JGRA 4G63A 3BILA 1XA0A 3WI7A 1FRFS 3BA1A 4L28A 3W3ZB 1RABA 5GV8A 1L9KA 2WAXA 1E3MA 2Q3BA 3N3BC 1TT5B 3T61A 3ACDA 4S24A 2FMPA 3AERB 5KX5B 3U39A 4YRIA 2BMVA 3IRVA 2R1TB 4RK4A 1N9GA 2HJSA 4WVLA 3TIIA 3MCZA 3OT4A 1F8XA 1L4BA 4ZVRA 1TJ4A 1WCWA 4JV5B 1OLXA 3A7DA 4UEOA 2PD4A 4Z6EA 3TS1A 2I0FA 5LQKA 1X7HA 3QNMA 1RYBA 3RTBA 1KH2A 3LZ6A 1TAMA 1IK4A 3KHLA 1J2EA 2AX3A 2CGEA 3HEMA 2J5XA 2FEMA 2CVQA 4RO0A 4RHFA 1M1XB 1BVSA 2J48A 1DC5A 1J0BA 4P4NA 3UT0A 3KSBC 4BLVA 4RMIA 5ES4B 3NUGA 2OSVA 3H9UA 2GWSA 1BQEA 1G6HA 2M98A 5JS8A 4M4SA 2IYXA 2WLTA 2I6FA 3MPOA 3G2LA 4OJYA 3W78A 1AU9A 3DHVA 3TW8B 1H2BA 4QG7A 3FCOA 2I6QA 2BGTA 3UPQA 1X3SA 2IZ5A 2Y8EA 3QFSA 3CE6A 8ICMA 4YRGA 4D9IA 5BORA 1CQZA 2PFGA 1KK3A 4QDXA 2NO7A 2CXPA 3GIWA 1R0SA 1K88A 3VVMA 3UUFA 3BWBA 1SA0B 5IUNC 3SYMA 3ID6C 2BCVA 3DEEA 1NK9A 3KHSA 4BKMA 3ILSA 3OZRA 3B3QA 1IJBA 3IURA 3A6KA 2PMFA 2OTCA 3LHDA 3B85A 1SUIA 1HTWA 3OJFA 2AKEA 1L5NA 5JYCA 4ZCMA 4LBVA 3EF0A 3DWEX 4OP1A 4Y1RB 2JEOA 3CRNA 3W2TA 5C32A 4NV1A 3I1IA 3BCSA 4A2PA 2OD2A 2W2KA 4I9GA 2BY4A 4OHKA 5CJPA 2RMKA 2GN1A 1SHTX 2NM0A 4A8JC 4ZU3A 2L82A 4AKEA 3DB2A 3I39X 3GEDA 5KG2A 4IXTA 5LA6B 2GM9A 1QTQA 1WEKA 1UBEA 4BLUA 1QC5A 4BRUA 1CNMA 1WCIB 4QPZA 4PS1A 4M1QA 3H1FA 5HSGA 1M0SA 3GP3A 2PSEA 2PWBA 2GJSA 3IMKA 4NECA 4HNQA 3P9YA 1BU8A 2VXCA 1QAQA 5B2EA 3UHOA 2K4PA 3KYDA 4PJ0U 1JNXX 1R0CA 2C61A 4JYCA 1D4FA 1JEOA 5CEJA 1B0UA 4ZTBA 5LQMA 1LW7A 2WRZA 3TCNA 2C2HA 4H7JA 5ABPA 3LYSA 5JMTA 5BPCA 2QAGA 4ZEWA 3KQUA 3NYWA 3ISVA 4W5JA 1CEQA 4E46A 2Q0SA 3CN9A 3AMVA 2KBFA 3PI6A 2HBMA 5EP1A 3SZOA 5C4IA 1KKMA 1Z00B 1TNDA 1A7AA 8ICFA 1NVDA 1YI1A 1V7ZA 2JRZA 4P3XA 3DHWC 3NKFA 1CEEA 3HA2A 4QDZA 1QXSA 2JH9A 4F4FA 1NPDA 4F8YA 3VUEA 1SXIA 4ZN6A 3OT1B 4EBDA 3E9RA 3QNWA 3RWMB 3P9ZA 2E1PA 2IU4A 1ZQOA 4MQFA 1KO4A 2YX1A 1UKEA 4YH1A 3DE1X 2FPPA 3WU2U 4CQMB 4P54A 4PHFA 5KU1A 1F44A 2WG0A 3JQQA 4N03A 4O63O 3HWWA 4BE7B 3KJXA 4TLCA 2HMYB 1G4HA 4QEDA 3M6WA 2DPMA 5HKLA 1VDZA 1KEVA 1UKBA 1EP2B 2VF4X 2F2TA 4U3JB 4AJJA 1D3AA 4KXXA 4JC5A 3ND8A 1VJGA 1NFRA 3AUYA 3RFUA 3ZKWB 4AWAA 1PK7A 4IDNA 1PJQA 1ZISA 1OX4A 1Z8NA 3FNHA 4KSBA 1HE3A 2NT3A 3ZCSA 4GEGA 4PXSA 1RKQA 1XZQA 1TKCA 2CL0X 3IQDB 4L4XA 3QEMA 4AWXA 2ZWVA 2Q5OA 4D9EA 3ZLTA 2JARA 2AK3A 1BDIA 2PX4A 2HHWA 2FPGB 2ZB3A 1N4DA 2R66A 3B9RA 3VPBA 2OV8A 3NHUA 1JDNA 3WB9A 3ICCA 2QJFA 1F1BA 2EL9A 3KZOA 4RZHA 3MBIA 1W36D 3ZZNA 3GLHB 3CT6A 1WO8A 3HXTA 2UXBB 1NZJA 4D8TA 1E1YA 1AJEA 3JD3A 2ZM5A 3IAHA 3SI8A 3OT5A 3H75A 3OZBA 3ILXA 1P1HA 2BF7A 4KMOB 1ISJA 5LL6P 3G02A 3VMFA 1H94A 1OBVA 1XTJA 1ISHA 2X7JA 5GTDA 3BAZA 5KHLB 3AJ9A 3EZ7A 3HADA 1TKDA 1PV1A 3ITDA 5LXTB 3H65A 4QYIB 3A3OA 1K0UA 4Q9AA 2Q5EA 4QWMA 2FK7A 4PO1A 5DYYA 2O3UA 2Q50A 4NOJA 4UJ5A 3W4JA 1U4NA 1Z0JA 3PSPA 3CZAA 3PUWA 3QPUA 4RXMA 2C1ZA 1QPGA 3LFUA 4ZOLB 3OETA 1X80A 1XWIA 1Z6ZA 2BR0A 4GF5A 4J9OA 1F8UA 4KLZA 2LYAA 3HKEA 1OTHA 1Z3CA 2D3TA 3S2SA 3DTVB 1LWOA 3H42B 1R6TA 3RIGA 5IWAB 2RAVA 4REQB 2AR0A 1M2KA 2K89A 4M9QA 5IIMA 1NRWA 2DT8A 1R6AA 1UBOS 1NK0A 3NC1C 1F0KA 4MHOA 1YQQA 1HFEL 2WF9A 1T3SA 3A1UA 1MNQA 5J29A 2YR0A 4GQBA 5FPQA 2AJDA 4A5OA 3RK0A 1EFAA 4BFWA 2EZXA 1URJA 3W8NA 4F2DA 3SQMA 2I62A 5BOSA 3L6EA 5HMMA 2KJ9A 1M8KA 3UV6A 2WYOA 2FMUA 1N1GA 4OOFA 2YKGA 2P30A 1P74A 1GL9B 2P6RA 2CHUA 1Z39A 3P2MA 2OV1A 4JVMA 2OZVA 5EWJB 5IFLA 5AK4A 4L78A 3GA7A 1VXOA 5AVWA 1FDIA 2IGTA 2ZUWA 2GVDC 3KB8A 2FGJA 4A0RA 2CJWB 1JIHA 1A27A 3RT9A 3N74A 3QITA 1PNQA 1SCUA 5FWXA 3YASA 3EXG1 4DQXA 4WECA 4I5EA 2J33A 3RJGA 1YZTA 2HFKA 4UZSA 2O7SA 2O8EA 3AGPA 2NV0A 2PUEA 1WSBA 3PX0A 4P5PA 2YWEA 4A8JB 2YY7A 5AICA 1KMHA 4PL2A 2QRHA 3GP8A 2E82A 4LHWA 3X1JA 1WB4A 2XKBA 4P81A 4HRXA 5IAKA 2KSQA 4J1NA 1CUDA 5EUBA 4P08A 2CB0A 4E33A 3WXBA 2Q3EA 3KKNA 5A3RA 1CERA 1IY2A 3U9TA 2OBBA 1OU0A 1RM6C 3JXEA 3SBOA 5EFOA 4QOSA 5B1IA 3JVEA 2F9LA 3D4IA 1JLRA 4LK3A 1JV2B 1V8ZA 3OHPA 1IHYA 2DFTA 3AJAA 1KZ4A 3WMRA 5A5GA 3LLUA 3L7LA 1A9XB 5A1TA 2XODA 1IN7A 2I2DA 4FHEA 3JYLA 2HVHA 1LSJA 3C3YA 4IQ4A 3WYEA 2OXOA 4OCZA 3MT9A 5BV2P 4U6NA 3TRHA 3F9RA 2SHKA 4LW8A 2Q1YA 4O4HF 5CLFA 2ONZA 3K6JA 1JKIA 1TYZA 2E9SA 3JPPA 4HTAA 3GLFA 4I2IA 5IIJA 4BO5A 1U3VA 2PFKA 4UATA 2FP3A 1H9BA 2PUBA 1SBZA 2K8BB 2RHRA 1PSWA 5KTTA 4JUDX 5J5VA 4MYHA 4IW3B 1H6AA 3NH6A 1P6UA 1VG0B 3HUEA 1A88A 1IOVA 2AOXA 3I9JA 5JFOA 4PPQA 2D7DA 3G6XA 3ICPA 5FBLB 1GZ4A 1K6JA 5SV2A 3K9WA 4PY2A 4C2TA 4YJKA 3ACBA 4JUCA 5CFOA 3KQPA 3U16A 2ZYHA 4X66B 3G49A 2Q2VA 3L7JA 1C7EA 1D2AA 5D3ZA 5CAEA 1Y37A 3DDWA 2X0NA 1BXGA 5EJGA 2J7PD 5D01A 4OJLA 1GV1A 2I3AA 3QYJA 3E5MA 9ICGA 4HDOB 1A5SB 3JPYA 1YS9A 4M0DA 4YDRA 3QVSA 4LBWA 3TUJC 2EQ5A 2EHDA 3C8DA 4Q4HB 3O0FA 4JJKA 3NFYA 2VP0A 3PQ4A 2OB2A 1BXRB 1U0NA 4JFAA 4EZ6A 1A2OA 4AN0A 1V41E 4K1XA 2BGNA 4Y7DA 1GU7A 2H65A 3ZUGA 1U1FA 3OMLA 2W9BB 5B53A 1SPXA 4D5EA 1Y33E 1Q5PA 1J8VA 3H1BA 1NQOA 2AR7A 2ENUA 1HKUA 5FNVF 4AZVA 2WMYA 5REQB 3SLGA 2CD7A 2I54A 4WINA 4KACA 3ST7A 4JI2B 5J0SA 4GICA 4PINA 5G4KA 4LV6A 4FR2A 2IF0A 4H6WA 1HF3A 2NUAB 5AM5A 3OM0A 1ID1A 3F5QA 5J0RA 1VSVA 5JWOA 2R9VA 1M34B 3CWQA 4O4LA 4KLLA 3UTDA 3GF4A 4CV0A 1SCJA 5F5LA 1GO2A 2G0TA 4RCZA 4BO1A 1R6BX 2AT1A 1RP1A 5DNWA 5T4HA 5I7VA 4MV7A 3EA0A 3D9QX 4QJBA 3SK0A 2EF1A 5EP4A 1WQ3A 3HDVA 5TSDA 4YMHA 3PT9A 1Z73A 4FCCA 1ZLXA 1I7DA 3G59A 1WX1A 1RJGA 4GGOA 3ZIAD 3FYCA 5DVZA 4COKA 4J16C 1KBOA 4IXDA 3IT0A 3JD1A 5KQMA 3HP6A 3A2KA 3PK0A 3E4CA 2OZKA 2P2DA 5I47A 1J0CA 3LFTA 3K9NA 1ECPA 4Q7LA 2P27A 3F7NA 3ZVLA 5C1BA 1NUAA 3B78A 1OTYA 2QN1A 3I1YA 1B7GO 4XWAA 5G4LA 1THTA 3S2GA 4HQKA 4QSMA 4ENTA 2GK3A 2XKAA 3CZPA 1FU4A 2BGKA 2IU0A 4PCVA 4ZJUA 4QUGA 2RH4A 2XPCA 3D81A 2GHTA 4MZDA 2OEHA 3ANMA 1KIAA 2BFBA 3BKWA 2QBYA 2Q4BA 2ZYWX 1QK3A 3D43A 3JQBA 4RTJA 5A3JA 4R3NA 3HLTA 3SSMA 4EELA 3HNRA 4WLVA 1JPJA 5KFIA 2J3IA 4CL0A 1BKDR 3O6VA 3CW8X 4ENWA 4KR7A 3SYLA 3NEJA 3PBKA 1H1TA 3TG2A 2Q45A 2DJIA 2QROA 4ZPJA 1Q8KA 1H2FA 4C5CA 1UWCA 1G17A 2AOTA 1QG6A 3W5UA 5DBAA 2JLCA 4IFTA 2C98A 4LN1A 1PYDA 2Z98A 4FD3A 2KD1A 2D2FA 3IS3A 4G0WA 4X3PA 2V7UA 1CZRA 2RC6A 4N7JA 2C3UA 2Z6VA 4O3NA 4DY4A 1CRWG 1KNXA 2OCBA 4DANA 1DO0A 1O97C 3G9UA 5JH7F 3THVA 2GEBA 1PFGA 1MU0A 3DEJA 4ZAFA 1TO2E 5CPBA 5CM8B 3UQ2A 1OT3A 2P2GA 3R6GA 1CUCA 3TDNA 4MV9A 1CIVA 1SC6A 2WUGA 2YINC 2AXQA 3CYFA 1ZESA 5LKAA 2F43B 3CEJA 4UUOA 3P0RA 4QPNA 3KXKA 4BX2A 3EQ7A 1DEHA 3UT5B 4GE3A 4AJ9A 2ASDA 1FJGB 4IFBA 1AUXA 1QGZA 3M7DA 4EVIA 2ZFUA 4QLOA 2FU5C 2A84A 3OQIB 2DWPA 4Q7JB 3P9SA 3ETHA 4WA8A 3E0FA 5LN1A 1LPMA 1U8YA 1YU6A 5EEHA 3MDAA 5CA1F 3V7YA 4Z6DA 5DBFA 1IBRA 2MSWA 3OIDA 2BKAA 4HWOA 1ZVMA 2X5JO 1WULS 4WUTA 1ZQ1C 4IGEA 1CUXA 1DKLA 2C8VA 2YXEA 1YE8A 2V55B 1PT7A 3HCBA 1ISIA 2APJA 4J2HA 4MQUA 4LTMA 1B4DA 1X13A 4NYIR 4TVBA 3FKJA 1L1FA 1OC4A 3HBNA 1Z75A 3H4TA 1ENZA 4FUQA 3AU8A 3TIFA 2JASA 4RGBA 1I1NA 3I01A 2C78A 4Y2GA 1UQRA 2BFWA 3DP9A 4DA4A 2BHSA 4FHCA 1N2CA 4LTDA 4Z5XA 1QQ5A 4KLAA 1AXEA 3FMFA 4B7XA 3RTGA 3PUJA 5FTJA 2AJBA 2GK6A 4OHPA 3P9KA 2SICE 1YD7A 5FA5A 2HT6A 2QVGA 5JSUA 3RJMA 4KR6A 4LA4A 2W2PA 2J9GA 1MHTA 4CCYA 3HXMA 2WF6A 1Z82A 5DN6D 1C30B 2LXNA 1DIBA 2CK3A 3FNFA 1L3UA 1WBJB 2XTJA 3MRSA 2WUFA 3QEBZ 1N78A 4JQCA 5KVSA 2NSDA 1QIIA 1BEUB 1U2DC 1I13A 3F6SA 3EDYA 1VXRA 4AMBA 1EFLA 1FRZA 4HYKA 1AOXA 1O6BA 4OJ6A 2HA5A 3ORYA 3WISA 5K8LA 2R8GA 2ZQ5A 1B4FA 3T12A 1U0BB 1T25A 3TNYA 4RC9A 2ZJ3A 4F5RA 1MA3A 2WYUA 4IQ0A 4X7RA 3KQWA 5ERYA 1FFVA 3RAFC 2AQKA 4YXWA 5HJ5A 1HZZC 1NGSA 2ATXA 3EC7A 1NK6A 4JOQA 2RAUA 1NW9B 3HR8A 2NSJA 3FRIA 4R1TA 2A7XA 4C7MA 2AZ4A 2E1RA 1SBHA 3I61A 3PO5A 3ZU6A 5GWXA 2M0NA 1NFFA 3PW4A 3GMTA 3LQKA 1JFTA 1AKNA 3CONA 4OH1A 2V7BA 5B7PA 1WY5A 5HE8A 1T9CA 5BXQC 3UOGA 1PVVA 4DA0A 4C7OB 1YK1A 5DCUA 4HNTA 1C4XA 1FYFA 4UD6A 1ZQDA 1T1SA 2PVSA 3G5TA 2F67A 3X1WA 3A4MA 2CVPA 3BL5A 1ONSA 5AI9A 1GL3A 2IU3A 1R9JA 3R7WB 4Y6RA 3PDIA 5DG9A 3EOBI 4B9MA 2OZLA 3TVYA 2CLIB 1Z4PX 4BGDA 3GWZA 1NXSA 1UOEA 2ANCA 3VR4H 5G5HA 1YRHA 3QY0A 1TYEB 3RBVA 1GSOA 3KVNA 5L1MA 2KYRA 1AKMA 2UZ1A 1JG1A 3JARA 3GV8B 3ZY6A 3OPYI 3TSWA 4ER0A 1X7WA 1L4KA 1OH8A 5FV4A 3O1JC 4FDLA 9ICHA 4MS3B 4UQGA 4CT5A 2Q3LA 2JK1A 1P19A 4ENQA 4H35A 2PKEA 4CM8A 1V47A 5FUQA 5CVJA 1A8IA 1BIFA 1LFDB 1PG2A 2AN4A 3GVHA 5HF9A 1ZLYA 1TMKA 1W88B 1CJUC 4DQPA 1NUPA 1L7BA 1RC8A 4URUR 8ICHA 1XSLA 5LP6A 2BDTA 2ECQA 1WZIA 3SDSA 5BV0A 2WF8A 1EXMA 3NEPX 1J0AA 1GCOA 2C4MA 5LDGA 2KMLA 4E2ZA 2JCVA 4J6FA 3UK2A 3UNXA 4XIGS 1WIWA 5JD5A 1LI5A 1ZG3A 4RY0A 3ROKA 5FR2A 3NRCA 5CWRA 4RD0A 1JR2A 2GS9A 3PGMA 1E2JA 4K88A 5HIIA 4Z86A 1FFWA 4CTNA 1S0VA 5KKCA 1N2EA 1NVGA 3QYPA 2L19A 1KH3A 1GD1O 2OD9A 3RUHA 2IEBA 4DZZA 4CDNA 4LJ5A 1K86A 1N2IA 3EUFA 2GTIA 2EU8A 3S8EA 2E18A 3TBKA 4EKIA 1FO4A 5F3XB 4C1BA 2PKRA 4N82A 4M9UA 3EOZA 3NRZA 1CT9A 4IIGA 1PTJC 1SOMA 1JEYA 2I2BA 1KDOA 5IAAA 3D3EA 5T3UA 4YJGA 1Z2OX 4IDPA 2J0UB 1A8UA 1RC1A 4PIPA 1TJ5A 1N3IA 1UUFA 5B3LA 2F7SA 3PFIA 1NJYA 3VPDA 2PMDA 4IC9A 3HZRA 1QHSA 3G7SA 1OZGA 3WKAA 1ZIPA 1W48A 1RJDA 4GQIA 2V58A 2YMLA 2C2ZA 4IJ5A 3HUTA 5LUAA 4J0FA 3WYAA 4KVAA 2C99A 3LKDA 2BRUC 2DZDA 3CFYA 4QELA 3GT7A 4NDZA 2D0DA 2FOLA 4A36A 4BFVA 1NRXA 4ZVMA 3QLVA 1DFGA 1LV5A 5JDIA 4TTIA 4RCYA 2P9BA 2QVCA 1RXIA 3A9RA 5EJ5A 5FFFA 3RG8A 2QUKA 4ZRMA 1AUPA 4Q1AA 1V26A 2V7PA 1P45A 5A0VA 3GLIB 4E07A 5E2AA 2YB4A 3FXAA 1I0ZA 2ZBFA 2WV7A 4EHLA 3PUXA 4ND2A 4PRLA 2CSXA 3KLBA 2BH9A 2WJYA 3QX3A 3TM5A 4CMIA 3N28A 2PBFA 3EEFA 4DLGA 1YR2A 4ALLA 2JGIA 2IITA 3BRWA 1FNBA 4KFRA 2OLJA 5DTEA 3K5PA 3QKTA 5JCJA 3C4VA 2AMJA 2AXPA 4TZTA 2BP7B 2IV2X 2FSSA 4B3TB 5ECYA 2QG9A 5GIPE 2WI8A 4PNPA 2C2XA 4B3GA 4XIIA 2QNBA 2MSNA 1YDWA 2WF7A 1DIGA 3RVMA 1HRKA 3NAGA 1P7DA 5LB2A 2ZREA 4AY5A 3SV3A 3BGSA 4DPLA 3FPHA 2C2KA 3MJHA 4MKGA 3CZ4A 4QG3A 2B7BA 5TR9A 4DMKA 4YJ2B 4CIDA 1KO8A 3N6VA 4EYKA 1XNGA 3HRKA 1EIWA 4HVAA 5HZHA 2ZZKA 5KWJA 3G3EA 1XZJA 4ER3A 2AE2A 2B8WA 2EXXA 4KRXA 1QYRA 1TFRA 2HU8A 3SIXA 2RH5A 2FR8C 5C2JB 3D2CA 4GLBA 1TVMA 3EB9A 3HB5X 3WKCA 1TU0A 1QJ4A 3QW2A 4HWRA 4IAOA 4E09A 4TSRA 1HYHA 1SXHA 1PLKA 3BM5A 4DNOA 1ZQBA 4FONA 4FFDA 2AVDA 3IAFA 2GEUA 3M4ZA 4N1AA 2CLLB 2C58A 2RAPA 5IJXA 1Q3VA 4UUMA 3OCJA 3QEOA 4DFKA 2IH5A 1RAHA 2ZRJA 5FOTA 4BDPA 1SPBS 2W6MA 4MB6A 3SSNA 8ICJA 2X9LA 5EPUA 3NOOA 1WJGA 4EQ6B 3C24A 1RTKA 1IEVA 4C2UA 3KEQA 4I1RA 4Q7KA 3ML1A 2Z8ZA 4R64A 2O2CA 1QV7A 5JS7A 3GRKA 4KLUA 3F78A 3SLKA 4DBZA 2YHIA 4UASA 3OUUA 1YZNA 1V1RB 5J59A 1JT9A 2A9JA 1VHTA 2QMHA 1XV5A 4XH9B 2HXGA 3RS3A 3GT3A 1AKTA 4Z99A 1J56A 4OYLA 1IQRA 2DXIA 1Y3CE 2SCUA 3DCYA 2PAFA 3K9FC 3HJBA 1J22A 3FYSA 2FDXA 2KEYA 3MAAC 1K6MA 1OIVA 1BHO1 3FTFA 1ZUWA 1PGJA 1KC3A 1UBHS 5JI3E 5KSZA 3W6UA 1K5GA 3NGDA 1OV6A 1T9KA 3H0LB 3IP9A 4M9GA 2B9VA 4M8NE 5CHEA 2KVCA 2WM9B 2DPLA 1BQ4A 1NAHA 3HT3A 3RRYA 2ZULA 3NXKA 3TZLA 2DC1A 3HQ4O 1IHXA 2WU8A 3R3SA 4P34A 4S1PA 5FWYA 1CNEA 2IODA 3TPZA 3UW1A 3RAXA 5C52B 1UJMA 1YR3A 4DV2B 1PZFA 5EGSA 4H1TA 1NSTA 5AT1A 2V1UA 2FK8A 3WYFA 1HXHA 4R6XA 4G0YA 5LCXA 2VDPB 2JLYA 1RCFA 4BV2A 3ANNA 3E7XA 4QQKA 2FQWA 5TJHA 2QD2A 1XEWY 1A0PA 3IBCA 3BRCA 2RK6A 1KFEB 4IV8A 2I2CA 4AZ3B 5A9SA 4DTIA 5JAMA 5ALPA 2AA3A 3G0OA 4FYYA 1QO0D 2UVQA 4PSAA 5HUHA 2JZBA 2W93A 5HRCA 4DWWA 4BJQA 1OYVA 1GGHA 1R4NB 1I30A 2JCSA 1KP9A 2FPOA 2EJVA 3P2KA 4X91A 3MIIA 2YJ5A 4FPXA 3KFLA 3AZOA 1FFDA 4IY1A 1QVWA 3AYZB 2BPOA 3NHFA 3PPWA 3UXMA 2WKPA 1VE9A 1ZI9A 1BPEA 4EIWA 1PIWA 1MQ9A 1XR3A 4RZ3A 3ZWPA 1FX0B 3EEQA 4TV8A 5SYNA 1YTLA 1WW8A 2BELA 3MTQA 5BO5A 3NV7A 3NVYA 2HRBA 4EZIA 3TR0A 4PWYA 5A5DA 2WWTA 2FEOA 2VF5X 4E3ZA 2QQEA 1FFUA 1ZQYA 4YLGA 1BDHA 4E1AA 1WRBA 4BX8A 2E4YA 1N1MA 1JHOA 3R3ZA 2IHTA 1KRWA 4ZYXA 4R51A 3E9EA 3VPAA 4DNQA 2AN9A 2AFVA 3NUQA 3F98A 2UUOA 5DM4A 3LCVB 4YI5A 4G07A 1YWGO 2JBWA 1VJ1A 3PG5A 1VKOA 4DJEC 4NL4H 1OYYA 2ZBEA 2JIMA 1QZ3A 1XD2B 5DZSA 1ZVVA 2MINB 4NX2A 4C8OA 1V43A 1PK3A 3Q88A 4GBMA 2I6TA 2HRRA 3B53X 4KI7A 4KLFA 1Y9EA 4E2FA 2KIWA 1DAKA 3V4SA 3LBFA 2C84A 1ZK4A 4XQ9A 1O0BA 3JSAA 1BJTA 2O3SA 5IXSA 4BTEA 1S4QA 3LP8A 3K6RA 3HKZF 2Y67A 3EA4A 5KT3A 3K5HA 3C97A 3C74A 1SBQA 1KZGB 2WJJA 1KGSA 3AERA 5KX5A 1XWWA 3TL6A 3U7IA 1C1HA 1FSFA 4HATA 5AHKA 5HR7A 5KNDD 1OXJA 2R1TA 3DV2A 1JWAB 4Y2VA 5EHXA 2DWUA 4XSHA 4JYBA 4I2EA 1ZMXA 3TMYA 1L8QA 1PX0A 3KQNA 3GJ6A 5AR1A 3WWCA 3NGLA 4C05A 1GNPA 4KLRA 5EXTA 1GEEA 1CX9B 1U1DA 5HZGA 1U2TA 3V7FA 2PNJA 4N18A 3WK7A 1E9VA 1BW9B 2UZAA 3BJEA 1WPRA 4YPVA 3CA8A 3GJ5A 1ZY2A 1WEHA 4MHTA 5AOBA 4ARSA 4L0MA 4MIYA 1EA5A 1V2HE 1TCAA 2DFKB 4IDGA 2I5HA 1H5UA 2OZPA 2RIRA 3RI3A 4BCCA 2RDIA 3PXAA 1ZNWA 3A0RB 4R1NA 1NNEA 2FG6C 5TPZA 2CXUA 2QX4A 1W4CA 1UJBA 3I2FA 4IQGA 4DC1A 4DWVA 3QHPA 2XH8A 1MVLA 5DB7A 5F2EA 3HCRA 3FGZA 1UEJA 2GCNA 2ID4A 3TLBA 4CUZA 3JZIA 3D31A 1QLWA 1U3UA 3PNMA 2V4UA 3H2SA 1SA0A 1M2JA 3RS4A 3WB1A 2NVBA 4ECQA 1QUEA 1FOEB 4I3GA 5ESXA 3EGIA 5BW6B 1N0IA 1AURA 3ICWA 1HC7A 1W29A 3C14C 1EAMA 4CR8A 2FWIA 4B9LA 4HLCA 1Y3DE 1ES9A 3G85A 3WGNA 5CG2A 4Y1RA 3GWGA 4HX2A 4PRKA 4BB0A 5K09A 5FOXA 1LX6A 5DF1A 4G5QA 1YC5A 3EQ2A 1R3UA 4DSIA 4RNDB 1QRDA 1DEKA 3K75D 1ZHHA 3KEFA 2V5AA 2W04A 4W7HA 1WOMA 4M9NA 4EW2A 4CCWA 3WIEA 4RVHA 2IYLD 5DCWA 5LA6A 5E2BA 4EG3A 5HXAA 5BSVA 1D4AA 1ZM3A 1SB9A 1J25A 1WCIA 3AKDA 3O3NB 1X1TA 4PG4A 1N92A 2JAUA 3B9JA 4KXLA 5BNWA 1E6WA 3O8DA 4YXMA 3NOQA 3ZH9B 1JR4A 2XADA 1GKYA 3K9HA 1EE1A 5LQAA 2RQ5A 4NCXA 1XDUA 4F3NA 5CT9A 4LOHA 2IP4A 2V6IA 3NNNA 4Y6SA 4QQNA 2EQYA 3RWBA 2H9IA 4PZEA 3UMVA 4WXYB 4AK9A 3E48A 7ICNA 2H52A 4W8OA 4ZYLA 4KFUA 3LZDA 4G5FA 3T5AA 1SEVA 4O2BB 3L05A 1K7XB 3GIKA 3ELYA 3HILA 1FF9A 4B82A 3RSOA 4RQ0A 2R8EA 1N0UA 3E2MA 4R8LA 3LH5A 3X1YA 3N75A 3R5TA 1A4RA 4MW7A 3R6DA 2YIDA 5CLJA 2HCFA 2MWMA 5FBHA 3ZDQA 4X24A 4IS2A 2ONYA 1MJHA 2LKDA 1V85A 3T95A 2D2EA 2OFXA 3C8ZA 5J2HA 3JQ7B 3K1AB 2IT1A 3CVWA 3EXEB 5ALQA 3GMIA 3TZEA 1DK3A 2P4SA 3OT1A 2OAGA 1DJOA 3SR0A 4GXJA 1XZFA 2QORA 1D4ZA 1WG8A 5FV7A 2EKDA 3H86A 1V9CA 3U3XA 2UUPA 1Z3IX 1VTKA 5LD2C 1Z6YA 1NOIA 3JAKB 4CIWA 4YQFA 4FZVA 4N0QA 2O0JA 4C4RA 4KE7A 5LOVA 3VR3A 1E20A 4UM5A 1CY2A 1CY7A 1EG2A 1JPNA 4O4IF 3K9GA 3BXEA 1FY2A 3DLBA 4Z4CA 2A78A 1BXZA 4U3JA 4XYGA 2ZDHA 3PI7A 2XY5A 1HT1E 3ZKWA 2RKOA 4KWCA 2FFQA 2QZ9A 2BI4A 3MFYA 3KEGA 1OC2A 4JUIA 4W82A 3X2SA 3QVKA 1RRCA 2RDJA 4H2DA 3B8HA 1PR1A 1QFZA 3TINA 1JN0A 3ZEAA 3I6ZA 3DHEA 4I4TA 1G2IA 2VTBB 4OX9B 3H1PA 1W5BA 2FMFA 4O2AB 1SQ0A 1NHGA 3Q4GA 3EUWA 1JTFA 3FLBA 5AESA 3NWBA 1YUBA 3CGGA 2FYTA 3LA6A 4YR0A 2XKKA 4NAUA 1NZPA 4JJ7A 2XUJA 2ODQA 3ZGXA 3GUYA 3JQAA 1DQSA 5K0LA 1DEAA 3GLHA 1A71A 1QKKA 5ILOA 1MLDA 2RGEA 1ISFA 1PWHA 3HB7A 1I1HA 2X9QA 4NG4A 3QBJA 3K1RB 2OUKA 2WYIA 1PJAA 4KMOA 1L7AA 2RBEA 1JH8A 2JLXA 3NYIA 1GUDA 5JISA 3AILA 1D1SA 4HOYA 1QHXA 3CEAA 1GADO 4WJLA 3LVFO 4Z4IA 5LXTA 2YRXA 4QYIA 3PLRA 4UOQA 3L8MA 1CSEE 2XLCA 4TYPA 1E2EA 1V9PA 4UAGA 5ITWA 4G9GA 5KTPA 2XVZA 4IWNA 4HDKB 9LDTA 4WA7A 4FYPA 1Q7BA 1D8TA 4QXAA 3IMEA 4X94A 4OJKA 3WBJA 2HCJB 4IQFA 3DTVA 4IH1A 2WR8A 1TAQA 2WYVA 4REQA 3LUFA 2D6FC 3PGJA 5FFMA 5DI9A 3E58A 4EG7A 3TQSA 3NHKA 1EQAA 4KFSA 5FP0A 2ZIUA 4IVNA 3NNDA 2DEUA 3EPPA 3D0QA 1WXXA 1QHGA 4D92A 1P9OA 1PEKE 1ZNXA 4D1YA 6PFKA 1GDHA 1RNLA 2GEDA 5AM4A 1U9IA 3TEFA 3SOPA 3BBLA 4IDBA 3U19A 3KV1A 3AW8A 1P2DA 2QZ4A 1OOEA 5L1KA 4MWTA 1Z16A 3L4KA 1RADA 4UKDA 1Z5GA 2ZZMA 4A2QA 3CVXA 2CLKB 3NP7A 2XMDA 5FUMA 1GCUA 4RANA 1XJQA 1YRQA 5ER9A 3KPJA 3FNQA 2Y4OA 5LP1A 5AW8A 1XSPA 1U5BB 2AQIA 3MABA 4G5GA 1AO3A 1QE5A 3IAEA 5EWJA 1Z4QA 4F3TA 5DYGA 1JMVA 2C5SA 4URHA 5J2BA 1ARZA 4G4GA 1G41A 1WOYA 1GNVA 1TJNA 2BMFA 3I73A 4UU7A 4X6YA 3O94A 5B5EU 2PBRA 1NJSA 1V3VA 4PYNA 3TF5A 3GPBA 1NYLA 1JFLA 2BEWA 4HAIA 2JC3A 4ID3A 3KYIB 3N2KB 4JVLA 3BD8A 4I46A 4HJXA 1EYZA 4QYTA 4B6GA 3R0QA 1ESEA 2WMDA 3FBGA 3BDPA 1H3EA 2C3PA 4RX1A 4ENPA 3EQ6A 4F12A 5KEIA 4YHBA 3CE9A 3OEHD 5BUSA 4JC0A 2X42A 3L6RA 821PA 1E7MA 3ESBA 1B14A 4JODA 2JNWA 3RAGA 3T7CA 3V48A 3FN4A 4YUZA 5F33A 5E1BA 5BR1A 5EOZA 4UOEA 2WFLB 3EXIB 4PXAA 3DKVA 2R8OA 3BDIA 4KN8A 5DMXA 1LV7A 3D6JA 4IUCS 3GEIA 4HS9A 2WB4A 4P2GA 3HCFA 4Y8VA 2VJ5A 5FOVA 1D7AA 1YHNA 1CZKA 2N75A 4TZ0A 1U2GC 3OWXA 2HHAA 1PEDA 1QRRA 4RSGA 4B6OA 3LCUA 2DR0A 4WWHA 4JSRA 1QOPB 5IZCC 5TQJA 4YMMA 4QOFA 1HA3A 1A9XA 3VU9B 1OLUB 4G23A 3V7UA 1DO8A 1GITA 1D8YA 3IEKA 1XPUA 4BOYA 1IVYA 1R15A 4PYKA 4E70A 4F9FA 4RQ2A 5AQEA 2BEUB 4OJQA 5K8VA 5B1HA 4Q4DA 5LJIA 2Q0HA 2XQFA 4E1BA 1XTZA 4LDQA 4YAWA 2H54A 5KDDA 1OXMA 4NMXB 5CH5A 3RJEA 5INTA 2RLTA 1EUCB 1WUTA 5G1OA 3QTBA 5H3CA 4KH1A 5BSHA 4PAQA 1FP6A 4Z49A 2BCUA 1NF2A 1ZD9A 3E22B 2DCUA 1ONPA 5TS2A 4S2EA 1VJDA 4CLRB 4C4YA 4LQLA 4MVXA 2AN1A 4G0PA 1X74A 5CCXA 3A8TA 4WK4B 3ZWDA 4DC9A 4PCLA 4UM8B 1MVNA 1WP4A 2QTRA 3KQSA 1X6IA 4BAUA 1QV6A 1JE1A 1IQPA 5FBVB 3G6WA 3C3CA 3WG9A 1LNSA 4LOAA 4INJA 1TMYA 5K9ZA 2VDLB 3X0DA 3P8ZA 3O91A 2BTOA 4ASUA 3OZAA 3K0FB 4ZQIA 1A9OA 3JY6A 4XCXA 1DJNA 2PXCA 4UCXA 2EAMA 3HXKA 2ZYUX 4B35A 3W5HA 4Q4HA 3K3PA 7ICLA 4X9XA 3WRWA 3AF6A 2XNDA 3RU3A 1LRKA 4JX9A 2ADMA 4JKOA 2B4RO 1XZKA 2AX4A 2G1JA 4BBPA 4L4UA 3TARA 1KZ7B 3FD8A 5IP5A 2W9BA 5BW8A 1JFVA 1CQPA 5LIRA 1K5PA 1GVNB 4UFNA 3V9AA 3GP5A 4AJKA 2F64A 1V38A 4L7VA 3K0BA 3ZE8A 4NBSA 5REQA 3WYBA 2FKNA 4N7BA 2XZDA 4MRMB 4LSMA 4DCPA 3KAKA 1MB3A 1OFVA 4BVLA 2EIXA 4JBGA 2EH9A 5DDYA 2ZCUA 5IF9A 1QTNA 2ZCJA 2GHIA 1FMFA 3UG7A 4LXTA 1GQYA 1E5QA 4KXNA 5L3RA 1R74A 4D0GA 3QVMA 1M34A 2O50A 2WNIA 5DU2A 1C2YA 3DOFA 4D0NA 1DAEA 4FFRA 3U56A 2J3MA 2B1IA 2VPPA 2ZIFA 2HA6A 4BU1A 4GWKA 4IQVA 3JPSA 5F78A 3Q3EA 3CURA 5KTOA 5H9WA 5ER6A 3SENA 2R8XA 2Q8QA 2XQVA 4TRJA 2AFIB 3M6ZA 2PWPA 4UHDA 2AQ8A 1T2FA 5ALTA 2HN9A 3NAZA 2X8AA 10MHA 4MDYA 2VNJA 2WIFA 3DQZA 2NVWA 4AY6A 2X8WA 4Q3AA 5LLTA 4GSKA 3EEBA 2I78A 3QVJA 8ICRA 3ZE7A 3LT5A 5CXUA 1E92A 2H1SA 1U8UA 3AU6A 3OPQA 2QE7A 3PX3A 3DP7A 5LQSA 1XZAA 4YHHB 4MIKA 2QRUA 3C7CB 4RA6B 3C3JA 4IJWA 3FVWA 2QQGA 2CFCA 1QFJA 3DC7A 2KSOA 1GU0A 5BV1A 5KVVA 3FPEA 3WGKA 2JIBA 5BV7A 2IWHA 1PK1A 1WA5A 3DOUA 1KI2A 1VMAA 3NTLA 1EK5A 3W5SA 1KRPA 4O0LA 5G3ZA 3DBIA 4O5AA 2VT2A 4CG3A 2OHVA 3DZIA 3VC3A 1QK5A 2XWQA 3DSRA 3SBXA 3LQ1A 1TM4E 1UZAA 4N7RA 1KAMA 4JK3A 3AFOA 2GZ3A 4XIYA 1GRVA 1O08A 1VLBA 3N4MB 5GM2A 2DQYA 3HY4A 2QL5A 2WSLA 4UHFA 3U1TA 1F12A 3UENA 4HNUA 4C88A 2HK7A 3H11B 1XDBA 2VPXA 4UNIA 4EMTA 3G2KA 3RARA 4CLOB 1CB0A 9ICIA 1JSXA 5BWNA 2GEVA 3CO5A 3KKEA 4LDRA 5IT5A 2HLDA 3C85A 5FIUA 5FI1B 4C43A 5DM1A 3F5SA 1R4AA 3R8CA 1T8PA 1B93A 1MDFA 1P2FA 3ZJUA 3GRYA 1O95A 2J87A 4JGIA 1GILA 5DM60 2WB1C 2HHUA 4QHSA 2PI5A 3G0CA 3ER8A 5JDCC 4DYHA 3TEMA 4J0JA 3QHQA 3EZXA 2Y27A 3FPLA 4TS4A 1UAAA 2G82A 3M0EA 1P1BA 3KJEA 4PS0A 5T4EA 3CUKA 4JOBA 5EE0A 3F5EA 1PHPA 1MO3A 2H11A 3BZWA 4HVLA 5I7OA 3SNHA 4DLWA 4MS1A 1E59A 4FNAA 5JNTA 3LJKA 4DILA 3WRXA 5EMNA 1DAHA 3VV2A 2CMFA 3UWPA 2UYOA 5ELMA 1T5TA 4WLEA 3H2IA 3AIKA 1JHXA 3G88A 3H6GA 2VP9A 4WDQA 5IVHA 2F43A 1USKA 5CB4F 1HDCA 2CHGA 3PNSA 1CIJA 3UT5A 3CEMA 2C8JA 5JNLA 3FWPA 3K9LA 1OVGA 3VKWA 5JD4A 2AJTA 1L3IA 4WXPA 5T7BA 1XKQA 1JKXA 3OQIA 2MSLA 5EE9A 2A8YA 1F2DA 1X19A 2Z2YA 3PDHA 1VZ3A 3K09C 3E7WA 5L4SA 3JQFC 3D5QA 5AVJA 3TQHA 5ALMA 5FWDA 2OLKA 3A9WA 3HVHA 4YXFA 1T5BA 1X2EA 5E6RA 3QLTA 2O3RA 1OW5A 1IBCA 4KBFA 3WO0A 1CXZA 4P4MA 3NW9A 2O7QA 5CDFE 4DT1B 2O8BB 4DXHA 4KU4A 2XX3A 3IEMA 5AKGA 2YWCA 1SIJA 3O4HA 2CJPA 2EF0A 4DL9A 2RHBA 2I4LA 2QZPA 4YQZA 5HILA 1QFMA 3UXNA 4RFSB 3A28A 3LPAA 4MP8A 1HOTA 1NVMB 1KVTA 2FRDA 2ZYVX 2QXUA 3SR6A 2C31A 1PLLA 4D3YA 3BE5A 4K9QA 4MLPA 3NCTA 3AF0A 1P2BA 2JJ1D 3PC4A 4UM7A 3MUEA 4C08A 4REOA 5JAUA 4WBNB 2VH2A 2F9MA 3K0SA 1RRFA 2G17A 1WHTB 3O8NA 1ETUA 1Z4KA 3DCIA 4AZTA 2DPIA 4JV1A 5E0OA 5IKMA 1EUYA 1ND5A 4J94A 4B31A 1RSZA 1CJTC 3EA5A 3AHDA 1X1BA 4L1KA 1X7YB 4NK4A 3K1ZA 1R5OA 3UEOA 1RVV1 2IYVA 1FA9A 5IHXA 1Z7BA 3V55A 3Q7PA 5BNTA 4MW4A 4I2JA 1MOPA 5COBA 2DLNA 4OQ4A 3E82A 5KFSA 1JAYA 2QTWB 3S4YA