2CN1A

Crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)(casp target)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
b'NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cn1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2cn1A01
4BNDB 5AKKA 5AHXA 2CFTA 2ZG6A 3NALA 2CFSA 2YMLA 2YN4A 1RPZA 4NFLA 5ALTA 4FE3A 3SHQA 2B8EA 3MC1A 2GHQA 2R8ZA 4UASA 4UATA 1U02A 1Z4JA 5AKJA 5ALIA 3QU4A 1NF2A 2G80A 2HHLA 2NO5A 5ALSA 5AW7A 4F71A 3VAYA 4C4SA 5AVWA 4UARA 4XPZA 3WK9A 3A1DA 2HEGA 3M9LA 4CF4A 3L7YA 5AM3A 5AVVA 4BX0A 2YMQA 3W5CA 1LVHA 1ZOLA 4HAIA 3QLEA 2ZBEA 1WPGA 5IT4A 2FEAA 4HYTA 3L0YA 5IS2A 3WKCA 4YH1A 4RETA 3I76A 1RKUA 1MH9A 2HO4A 1Z4LA 4FYPA 5AVXA 2IA5A 2RAVA 4UMVA 1QQ7A 3PGLA 2EATA 5AM0A 5FP0A 4YCNA 3R09A 2JGAA 4UAVA 2IOFA 3A1CA 3ZW7A 5AESA 2W43A 3S6JA 3AR8A 5AW2A 2FPXA 2GHTA 2BDUA 3U7FB 1VJ5A 1YJ5A 4BYGA 1RMQA 2G07A 2GFHA 2G06A 1L7PA 3K1ZA 2YJ5A 1N9KA 1WVIA 2YFYA 3GYGA 3L5KA 3NAMA 3DDHA 5ALJA 1L7NA 4Y2PA 4HGNA 2WF8A 2WM8A 5AI5A 5AW4A 3B9BA 4KNVA 1O08A 2MSNA 4Y2TA 2P69A 2R8YA 3ZWDA 5AW5A 2RB5A 4YCLA 3U19A 2HF7A 4EX6A 1ZRNA 3ET4A 5AW3A 2P9JA 3RF6A 2ODAA 2C4NA 1FEZA 5ALMA 2B30A 3MPOA 2WFAA 4UAUA 3ZTWA 2I34A 3FM9A 5ALNA 3ZX5A 1AQ6A 1RC8A 2B1RA 4G63A 5ALLA 4XQ0A 4XE5A 5AKXA 4UM5A 3ZTYA 3A1EA 5ALFA 1RLTA 4OCZA 1NNLA 1XP5A 1VJRA 3E8MA 5ALDA 3WKEA 1Z4OA 3E84A 3W5BA 2WF6A 2AMYA 5AVQA 2FPUA 2YMMA 4JB3A 4C4RA 4OFZA 4L6AA 4UM7A 1Z4PX 3QU9A 4AS2A 3FPSA 4OHFA 2FUEA 3SF0A 4EEKA 3SD7A 3AR3A 3L8GA 3HYCA 3SKYA 3AR2A 4NABA 2QYHA 3BWVA 3FZQA 1WR8A 3AR6A 2YJ4A 3AR5A 3WK8A 1RMTA 3QUBA 5AVSA 1SU4A 1Z5GA 2PKEA 4BX2A 5A3RA 3D6JA 3QXGA 3R4CA 4BX3A 2B8JA 3ZX4A 4DCCA 5ALUA 2W11A 5ALQA 4Y2UA 1RLMA 5ALZA 4YCMA 5AKHA 1L8OA 1U2SA 5IT0A 3KDPA 5AVZA 2FUCA 3WK7A 4AP9A 1TE2A 4BEVA 5ALVA 1S2OA 1L8LA 3UMGA 3SKXA 2O9JA 3N8GA 3BA6A 4Y2JA 5AKYA 4DFDA 1ZD3A 1ZS9A 3PDWA 4CF3A 5ALKA 2HF2A 1PW5A 3WGVA 1RKQA 3L1UA 5AVUA 2I6XA 2HI0A 2Q4TA 1RDFA 4MUMA 1ZRMA 3QUTA 4UU0A 4ZEVA 3KOOA 3QYPA 2O2XA 3AR9A 4UMDA 3ED5A 4B6JA 4QQFA 3EWIA 2I7DA 1YNSA 4G9BA 5AKEA 2FPSA 4KYTA 2IYEA 3N28A 4YGYA 1ZJJA 1O03A 2QLTA 3WKAA 3L8HA 3OPXA 1K1EA 3E58A 4Y3UA 3ESRA 4GIBA 1U2TA 3N07A 1L7MA 3ZVLA 2C8LA 4ZEWA 4I9FA 3SMVA 3W5DA 5AK5A 5ALRA 5AI6A 1QQ6A 2GMWA 3EF1A 2D2VA 3ZVNA 2HDOA 3DV9A 1RLOA 2FI1A 5AKZA 5AK4A 3B9RA 5AW1A 1YMQA 5E0OA 4JDPA 2VKQA 3FPBA 3E81A 3ZUPA 1L6RA 3ZVMA 4AS3A 3M1YA 3CZ4A 1XPJA 2X4DA 2ZXEA 3DNPA 1KYTA 3L8FA 3OCZA 2NYVA 5AI4A 1CR6A 4BBJA 3NASA 2G0AA 2YJ6A 3QGMA 3N5KA 1CQZA 5ALWA 3L1VA 3NUQA 1EK1A 4Y2VA 3MMZA 3OCXA 5AK6A 1Z4KA 2HCFA 4J2TA 3QX7A 5AKIA 2JAWA 3QU2A 1TA0A 2PR7A 4UMEA 4CE6A 1T9ZA 5AM4A 3L8EA 1Z4QA 4YIKA 4ZEXA 1F5SA 4UMFA 2YY6A 2WF9A 3ZWKA 1ZD2P 3AR7A 2PQ0A 3DAOA 3IJ5A 2OYCA 3U7GA 4H1WA 3UMBA 2R8EA 2RBKA 3N1UA 2BY4A 3FGOA 3OCUA 4Y2QA 5AKGA 3EF0A 4GXTA 5ALXA 3L0BA 4HGQA 2YMPA 1Q91A 4UW9A 2CN1A 3FVVA 4CF5A 3ZU6A 3U26A 1TJ4A 4EZEA 3QNMA 2C9MA 2DQSA 3MN1A 1RKVA 4L57A 4O8CA 5AIAA 1Z88A 3W5AA 1T5TA 4KX5A 3SLRA 2ZBGA 2P11A 3OCVA 3WGUA 2C88A 3RFUA 1N8NA 2W4MA 5ALHA 1QQ5A 5AW6A 5ALYA 2I54A 3QUQA 2G08A 3NRJA 1IWOA 4XOUA 2FPRA 1Q92A 4MWOA 3UMCA 1JUDA 2AH5A 3PCTA 3QU5A 1LTQA 4HGOA 2IOHA 1J8DA 4BNDA 3WK5A 4L6CA 4NV0A 1L7OA 5AM2A 2JAOA 1SWVA 2Q4RA 2EARA 4Y2RA 3U13A 1VFPA 2NO4A 1T5SA 1Z5UA 3QU7A 4E88A 2EAUA 2HX1A 3ET5A 2ZOSA 2FPWA 5AW0A 4I9GA 2B0CA 2WHEA 2G1AA 4EELA 3PGVA 5AI8A 2JARA 3OTQA 2YBDA 1RQLA 3KBBA 3ESQA 4IG4A 1RQNA 2HSZA 2R8XA 3WKBA 5AVYA 1Y8AA 2FDRA 4OD0A 1ZD5A 4HGPA 4Y2XA 1TJ3A 5AW9A 2MU1A 3I1YA 2I33A 4RESA 5ALEA 2B1QA 3I28A 2JAUA 4KNWA 1RRCA 3NANA 3UM9A 5AK3A 4CNQA 1QYIA 3IB6A 4EENA 4NAVA 4KX3A 2ZBDA 4YIHA 3I6BA 4Y2YA 4KN8A 5AICA 1TJ5A 2YJ3A 5ALPA 1YDFA 2B82A 5T41A 3WK4A 2HOQA 5ALGA 5AM5A 1YS9A 2ZBFA 1Z4IA 3F9RA 5AW8A 3B8EA 3L0CA 3AR4A 4FFDA 2CFRA 2OM6A 5ALOA 4C4TA 1S8OA 3TLMA 1J97A 1U7PA 2C8KA 3J7TA 4Y2SA 4J03A 3ZI4A 5AI0A 1Z4MA 1ZD4A 1QH9A 3QUCA 5A3QA 4HGRA 3OCYA 2BDEA 5A3SA 3WK6A 1U7OA 4F72A 3KZXA 3CNHA 3IRUA 3EPRA 5AIBA 2WF7A 1RMYA 2IOFK 4DW8A 4UU1A 4EX7A 3HLTA 5AVTA 1X42A 2P27A 1Z4NA 4QJBA 3ONNA 2WF5A 3P96A 4DWOA 2OBBA 3WKDA 4BEWA 3A3YA 3KD3A 4PNHA 1NRWA 2AUTA 3U7EB 1EK2A 1WZCA 5JJBA 3KC2A 2OA0A 2RARA 1SWWA 2Q5EA 3OCWA 2I55A 5AVRA 2G09A 4BKMA 3R9KA 4NWIA 1XVIA 1YV9A 5AM1A 5AI9A 3U7HB 2GO7A 5AKLA 3NIWA 2AGVA 4IFTA
chains in the Genus database with same CATH superfamily
2Q4DA 2QTWB 1CE8A 4YJDA 4RKFA 3H3JA 1R6UA 3FYTA 1MAWA 5AVWA 3D9QX 2Q1SA 1W8DA 1PS0A 1KMHB 5FUWA 1O97D 1Q7BA 1WIWA 3DV0B 3W5CA 4UTZA 4UULA 4YRMA 4CKEB 1KYVA 3JW8A 5DBFA 3RG8A 4EB6B 2J3QA 2ONZA 1F8FA 3VC3A 2PMWB 5B1YA 3AKCA 2JHDA 4ETIA 4W63A 5IVKA 4LF6B 3PQ3A 4LECA 5FAXA 1RNLA 2A7XA 1RAEA 3CA8A 3LZDA 5HCNA 3V7JA 1YJ5A 2OT3B 4R2KA 3FKSD 1BKYA 5BSRA 3R40A 3LG2A 1ZKDA 4R1MA 2XQKA 1H2EA 3HKDB 1A97A 3H5TA 4L6IA 1VB3A 1WUYA 4Y2TA 1X15A 3BE6A 4AMVA 1YB7A 3DJYA 3ZJVA 1AGYA 2GPNA 3P2KA 1FQJA 1HDXA 1HTWA 4KTQA 2ZUBA 3UFXA 4I4TA 3NT4A 1GD1O 1SKWA 1PW7A 4C0HA 4XJVA 3ONEA 5FQNA 4PZ0A 1VYUA 2FU5C 1OTYA 5KYTA 4NQZA 1DO0A 5EHGA 2JIBA 1SVIA 3OM1A 1I7PA 1I1OA 4DCVA 1L4MA 2ZVQX 1KZ6A 1PUIA 4EPWA 1JDUA 3TDKA 1CUBA 3K0AA 4OUKX 2O2DA 3K0CC 9ICGA 1YC2A 5AJHA 2I4TA 1RG6A 5HTOA 4FKBA 4ETMA 5DK6A 1EIZA 4RNMA 2A1AA 1AZWA 1RYDA 4GGOA 1AV6A 4HTAA 3RSCA 2W9AA 5KTKA 2PRIA 3I58A 3QOXA 5HW0A 2HMWA 5CCXA 3GFBA 3OU7A 2VKQA 1TMKA 1COZA 1B2LA 1QTRA 3AO0B 1PYOA 3L8MA 4AO6A 3PXEA 1J2MA 2R4UA 5HZHA 3UPDA 1C7ZA 3KJIA 3CUEF 2YJTD 3ICVA 1BX0A 3PO4A 3OBIA 4TTRA 2Q4BA 3I9V1 1G5PA 1NU6A 3D64A 4L9WA 4PU0A 2KVCA 1GDTA 4MJXA 4CXMA 3V34A 1V8BA 4HWOA 3PX4A 3C98A 1O1YA 3QKSA 9ICFA 1IHPA 4FP9A 1DAOA 4BFUA 3U4DA 3EZGA 1TIBA 1OI7A 1LKZA 4D6PA 3G2MA 4RCZA 3B1FA 5EEGA 2QY6A 4CW7A 2DLDA 2PQMA 3RREA 1EWYA 1F6DA 3O9ZA 5B7GA 4II7A 3OETA 3WK5A 1X19A 3INTA 4OMFG 2AK2A 2PL5A 5E4YA 4XWTA 5A4AA 1U0FA 2HX1A 1T4CB 3KEGA 4CM8B 2PEYA 3L8DA 2BLNA 1YR1A 3C87A 5E9AA 1EFRA 1AKQA 4F4IA 2ZXUA 1ESMA 2DF4B 5IKXA 1WDTA 2PX0A 3PEFA 4PAGA 1N9ZA 4NK4A 3Q2IA 2W54A 1GA6A 4Q4HA 1CEQA 2EJWA 2QG9A 3S8MA 2JJ8A 1QH1B 4CQLB 1EXWA 1XMPA 3Q85A 4KXWA 1UPXA 1CHNA 2VF2A 5AW8A 4FFDA 2CV2A 2GDJA 3HACA 4WKOA 1WBBA 4AF6A 4QYXA 2BCGY 3BEDA 1FLNA 2BGKA 3GLFA 5KS2A 1M7GA 4KW7A 4IJQA 3ZEAA 1LEHA 3SX4A 3PNYA 4YJ2B 2Q9AA 1XQVA 2ZAOA 3RVNA 3NHKA 3H2JA 5EWGA 5K8CA 1PS8A 3FPJA 3UWPA 1BWRA 2IY9A 4PXYA 4PLWA 1ZXBA 2YIVX 3UJBA 1U4NA 2Y0CA 4IL5A 4QGFA 4Z0NA 4MUEA 3STUA 1OYOA 3LU1A 2AXEA 1RBYA 2AG6A 4NLCA 2HMYB 1JQEA 3IE0A 4EK9A 2VNIA 1NK7A 1RKBA 3D4OA 5JU6A 1X6JA 5I3CA 3BZWA 3L4JA 3RNOA 3MMXA 4EKNB 4G4SO 5JFOA 4FD3A 2DHCA 1IIPA 2RHHA 3TE7A 2PZKA 1JKFA 4PFSA 4F06A 4JP3A 5CGQB 3GV0A 5KWSA 4Z4IA 4X62B 2V9WA 1N77A 3ER6A 1WB9A 1FUIA 4I7EA 3IOYA 2HPZA 1YZ6A 1YF3A 4GRDA 2Z4TA 1UKYA 4AY2A 3VO9A 4PYQA 1YCGA 3SSNA 1GTRA 1XXLA 3DDWA 3G6WA 3UV3A 2POQX 1VYVA 4XM1A 2RHTA 1A69A 4DKXA 4XA8A 1LF5A 3TEJA 3GLKA 1GQQA 4TLLB 2G71A 4ZCTA 4C76A 4IFIA 4QHSA 3JVUA 4ZO9A 4ZJYA 3HP7A 5JC8A 4IEFB 3N70A 3HCRA 2ZB7A 5EKXA 4BTLA 3DAYA 5COBA 1OXKB 3HRHA 3WLEA 1W8IA 4ARUA 3F5AA 1ULHA 5KVVA 1IBSA 1DHRA 2PR2A 4XYLA 5IKPA 3PWZA 1P1CA 2QSJA 3AH8A 1PFYA 1Z37A 1TZBA 3VAAA 2F1JA 1L5ZA 2WNHA 2DSTA 1ZD3A 4CF3A 4X94A 5ES3A 3OMWA 4ED8A 3ANSA 3RD5A 1MAVA 2PRYA 5B1HA 4ND1A 3IESA 4L4ZA 1E9FA 1U3FA 4GW3A 3U7QA 1YNSA 4LZAA 5J0SA 1B8NA 3L8ZA 4WX2B 3WQRA 4Q44A 4ASUD 3SIPA 1PU2A 4Y7CA 2ZTVA 3X1YA 1TYBE 3B6IA 3PRHA 3ZDRA 1XVAA 4KJXA 2RGNA 2NRXA 4Z9XA 1MC4A 3G5LA 1E9CA 2ORVA 1OQAA 3L0ZA 1B14A 2LKDA 1Q20A 2UVWA 1K6MA 4RA9B 1PTJC 2OBFA 3IMEA 1NR1A 4B3HA 1F5SA 2I7VA 3OFJA 1MB4A 3MSXA 1DKLA 3EIEA 1FOEB 1USGA 5I48A 4I2FA 4RPLA 2V7WA 2A35A 1Q1EA 2J0SA 2JGDA 4MW1A 3U7RA 2FV8A 2HRBA 1OFUX 2XQFA 3WGUA 2A5LA 3DHVA 1CUHA 1KMCA 5GZ1A 2C2WA 2ANCA 3ETDA 5K8JB 2VXYA 5DLYA 3F97A 3EVAA 1ZSNA 1ZD1A 2KOBA 2VAPA 3CMCO 1W36D 4O4LF 4UZFA 1QV9A 2H59A 1W5TA 2BFBA 2Y8EA 1TT5B 5HS6A 4YT4A 4M9NA 3HKBA 5C0YA 3I4FA 2VYNA 1SVSA 3ZBUA 4M22A 4Q9NA 1A77A 4HVCA 5IULC 4KNYA 3OZWA 5D84A 1ZCAA 2IBKA 3EXIA 1Y3CE 4C7KA 3A1FA 2LHTA 1SAYA 1CR0A 2ZYGA 3SHTA 5IAGA 2Q5QA 2ZANA 2Y1OA 1LRJA 4K0KB 1DAFA 3RK1A 3TAPA 1Y9DA 5JVDF 4WEQA 1NK5A 4MVJI 4IBOA 1U80A 1HE1C 4HNHA 1PAUA 1VIYA 3JASA 4RTOA 5T4BA 1XG5A 1NY5A 1R9MA 1UZUA 2J08A 2GD0A 1LLCA 4QO7A 2WKRA 4B3CA 3HI4A 4NE7A 2O19A 5AVRA 3B36A 4GM4A 4U7TB 1PT7A 3PR3A 4B7XA 1ISJA 1NRJB 2XQIA 2YN4A 1I1QB 1G21E 4R7GA 4ME6A 1M34E 5H9WA 3MG9A 4IH9A 1PEAA 8ICTA 2GERA 4Y6RA 2BPGA 5MN5A 4OHBA 4C05A 5AJZA 1N1EA 4BKOA 2ABWA 3C5CA 2V9PA 5E9WA 1BDJA 3DF7A 2PL1A 4U5QA 4A7PA 1VLHA 3D4LA 4DB2A 2R97A 5DLPA 2AWOA 4MK4A 5KTMA 4O3RA 2XW6A 1ENYA 1AMUA 4QHYA 4FW8A 1DPFA 3GEIA 5B30A 5L3SB 2V6GA 2OZLA 1KKXA 4DLUA 3FWHA 3K32A 4DJAA 3DOJA 4GHWA 1K98A 2SECE 3FYSA 4TPKA 3MFYA 2DUYA 3K1ZA 4R7TA 4XYBA 4LIPD 1WMBA 2FA9A 5K0FA 1V8FA 1AMOA 3DLHA 5F9LA 4L4SA 2OY0A 4DWIA 1G6OA 4G5OA 3DZFA 1NATA 1XYVA 1LRLA 4WMLA 2QM8A 1NGSA 3O82A 3HB5X 3R2JA 4O5KA 4OO1J 1MB3A 5KOIA 5U4XA 2JGEA 4IQ8A 3E03A 4KLLA 2XUIA 1QIEA 2J9ZB 1N25A 1MEEA 3PDCA 3QOWA 5FNVA 3L4PA 4UBJA 3QHQA 3X3HA 5TGDA 1NKEA 1QMPA 2AL7A 2OV1A 3VJMA 3TL6A 3BGIA 3QMVA 1S0UA 2CXYA 2D1TA 3SZ3A 3UKJA 4CL2A 1E98A 4MR7A 2D0DA 1L9XA 3LQKA 3CLKA 2ES6A 5ALKA 3BD9A 4ZVQA 1CVLA 3CM0A 2AR7A 1DFIA 3CSDA 4LVNA 3EPPA 1Z2DA 5SY6A 4PWYA 4QUAA 4N03A 1TMOA 4OJYA 1V9LA 3Q5EA 1ZJJA 1QRTA 4LJYA 4BJ6A 3OZIA 3RU3A 4HLCA 3FX2A 1OROA 3EDQA 4ZOAA 1JTEA 2J4CA 2ZB4A 3OX2A 4FBUA 2NP7A 1EGVB 5ICMA 4JLUA 5LUBA 3NUQA 4ARZB 3D02A 4GU5A 3V7FA 1KAMA 3DOHA 3R6TA 1Y48E 5DI9A 4QT0A 1J99A 4ZT4A 4LOHA 3FWKA 5TS2A 2ZWIA 1XQYA 4XOIA 3BHMA 1FRZA 2N75A 3VZRA 1JL3A 1Q3UA 2OKGA 3QWBA 3K9LA 2FE9A 4KPEC 3F6RA 1HDOA 4KEAA 2YR0A 1JDTA 2VJMA 5EPEA 5I7HA 1EAMA 4S2EA 3SLRA 3CKYA 4EYSA 4JA0A 4WBNA 5EL0A 3RFUA 4RVSA 4PSUA 2J3MA 3LY7A 3PBKA 1W9MA 1TEHA 4RNDB 3P19A 4E88A 3N7TA 3TDNA 3IUQA 4ENTA 2ID8A 1CERA 2Q3LA 4LCJA 3V42A 2XYQA 1LPMA 2B83A 3MMSA 1WTCA 3H0EA 3MYRA 5T4FA 2B25A 4JB2A 3ZE7A 2B7LA 3R0XA 2RH5A 3EZ5A 3WHLA 3WYBA 3HA5A 1DRWA 4EYQA 5JYBA 4N3CA 4YCBA 1CUSA 5JH7A 4ZVMA 2EL9A 4CV1A 2PPLA 2OM6A 2UU9B 3CZQA 4ZV7A 4PC2A 3SX2A 3PJEA 5JUMA 2DBVO 4RWEA 1QIHA 2I3DA 4FBGA 4L28A 3KZXA 2O7VA 3LY5A 3OU6A 1AMNA 1GAQA 1COWA 2P6PA 5EMKA 4CIXA 3H9UA 2G5PA 8ICSA 1NF3A 4WEOA 1E62A 4YMHA 4XEUA 2QDXA 4DRXA 3CVVA 4Y1EA 1JYFA 4KDRA 1RYFA 1EUCA 1U31A 1JHUA 1SG0A 5BSHA 5KDLA 3QRWA 2OV4A 2V7VA 1GL6A 3SN6A 1SHTX 4CFYA 2JIZA 4XD2A 3ZYCA 3U7QB 4U6QA 1TCBA 3EPIA 2ONYA 3DDUA 1O4WA 2EBFX 3R9WA 1J21A 5J9FA 2C9DA 4PGAA 3VCBA 2J3KA 3HSSA 2VUIB 3GUUA 1UDAA 1GNTA 3W3AA 3QZ8A 4Z7JA 1T9KA 4RK7A 4I2CA 3U6KA 4G0PA 2NZUG 2QRHA 3TGLA 4O4HB 1IXSB 4J0FA 4YRGA 1CS0A 4C1BA 4XVHA 4ON9A 4WXEA 4YAKA 4WZ6A 3ZI7A 4RVGA 4C9BA 4MYHA 4O0IA 2PV7A 1RJ9A 1E20A 3RJJA 4A4DA 4ZCQA 3ACCA 1GQ2A 1US8B 4CI0B 3LCUA 2O5CA 1XQ6A 4HATA 3K2QA 2VO1A 3AETA 1NJZA 1EA5A 2XMBA 1ORVA 4IZIA 2J41A 3E8SA 4UCQA 1WP9A 2O3SA 4ER3A 3F53A 1BDMA 3LUAA 4I27A 1Z4OA 3JQQA 2ZLBA 5LQMA 4QATA 1WRBA 2RC6A 4N7JA 1RM4A 3Q8XB 5IM4F 1K8QA 2GZ2A 1V1RA 3ZD8A 4ETWA 1GM5A 1EAYA 4J3NA 2W55A 2OV3A 2HF8A 2QU7A 3RIHA 4QYTA 5M5BA 2E4YA 4B33A 5JI2E 2XZDA 3Q2KA 3BA6A 3VU9B 4IIFA 1N3BA 5J2IA 5JALA 4PX2A 1WPRA 1RWOA 4PZPA 2FKAA 3RANA 3SXJA 3E7DA 2LIVA 3I6YA 1YI1A 1J2JA 3NETA 5AVOA 4UD6A 4OU4A 1DL5A 4JKYA 3N07A 5T6MA 3GEDA 4BO0A 5AI6A 2X1HA 3GFPA 1ORDA 4RU1A 1YRQA 2BGUA 1Y8QA 4TS1A 1A7UA 1JHMA 4MV8A 1Q7EA 1FYXA 3I9V6 4HUQB 3JARA 2V97A 3PNMA 2P5TB 4A2PA 1FFAA 3OPNA 2N0SA 4BV2A 3IOEA 4LOJA 4V39A 5IJWA 2BTOA 5EIEA 3AUXA 2PLAA 4GX5A 3CF4A 4AZ3A 3S81A 1E4YA 5G0VA 1I51A 4BNYA 3FVVA 5HUQA 1YGPA 4WUTA 3HKCB 3EARA 4O2BB 4QGGA 1KP9A 2H06A 3QYAA 2I54A 5EQTA 1E5TA 1S2NA 4RZ2A 3LXRA 1GQRA 3OHAA 2P1DA 2GYUA 2JAOA 2HBZA 5B7PA 1V5IA 2ZYUX 1PWYE 2P2ZA 3ET5A 3ZR4B 5KNCD 2JI7A 5CIYA 9MHTA 3S4YA 4QZFA 1E2KA 2AW5A 4GRAA 4B82A 2R1VA 3AEKA 4CG0A 1JB1A 2MTBA 2WTNA 1FTSA 1JT9A 4GMFA 1XSNA 3EUFA 4L07A 3OE7D 2H6EA 2Y0SC 2FPOA 3ZV3A 2R96A 1EE2A 2CDBA 4BNFA 3EDCA 1G20A 2VHJA 1BCRA 4JCCA 2VXCA 1P39A 4PPFA 8ICZA 3K6SA 4HLUC 3UHPA 1BXRA 1V47A 4Y2SA 2OHGA 3JR7A 2VHQA 4OMDA 4F5OA 2IT1A 3IEKA 1W0KD 3NV7A 3ZQUA 1WEHA 5AUNB 1X42A 3HNRA 4IIDA 2ZYIA 4AJNA 4WN9B 3WOVA 3KJZA 4P81A 2IIBA 4A5SA 2YVUA 3T6KA 3RYIA 2A9PA 1ZZGA 3SJCA 5HUJA 4MYCA 4ATNA 3UQ2A 4B40A 4HYYA 3IIEA 3PR4A 4W5RA 1X1CA 2NZYA 4OQPA 4K26A 5D4BA 2IXAA 3AEUA 2KB0A 3LNCA 3BXEA 4HI0E 3T4EA 1E8NA 1KBZA 2C95A 1CUXA 3STHA 5CB0A 3H8SA 2NZ2A 2E8MA 4QYIA 1C8LA 4KAAA 1UMCA 1WW8A 1HYEA 4F45A 3QVLA 1ULAA 4EEZA 4Q4CA 5CFZA 9ICVA 4TX1A 3WYCA 3OE4A 2HHUA 3TLYA 2GEUA 2PSSA 1L3CA 2AOWA 1NA5A 1ESCA 1MFZA 4IGKA 2GD2A 5DP2A 4AKIA 4UUQA 1ECGA 1RRFA 1TK8A 4QNMA 5KWIA 2I9GA 2GKSA 4LY6A 5JQGB 5BURA 1AKUA 2JBHA 2W22A 5M29A 1CF2O 1GPKA 1COKA 3AY7A 4HEJA 3M6AA 1P1HA 3ZHBA 4E11A 3TIIA 1QHHA 3QE0A 4AS2A 3GFGA 2BJHA 3E9DA 4GEGA 2YVQA 3RSSA 4KV7A 1VJGA 4I50A 2QL5A 2KV2A 4IIBA 3F6YA 1DJNA 4EUSA 3A36A 2M0NA 2CHFA 1T3SA 3ZX4A 2BGWA 3B6JA 1U5CA 1JECA 4DSZA 1OF1A 1FZQA 5E95A 2H2WA 1IHUA 4G56A 5F2NA 5IMSA 2EU8A 4G5QA 1GU7A 3VUEA 1DIAA 4OLFA 2EFGA 3LIPA 2J48A 3TLXA 1Y4SA 4HY3A 3DAPA 4PSVA 2IS1A 1EUZA 5BVHB 5LBTA 1TU4A 5KYXB 5LFAA 3EA4A 1EQ2A 4M1EA 4RE5A 1BMQA 3C2QA 3BSYA 4YLGA 3HUUA 1QAQA 2G8NA 4NXZA 4S1NA 4E15A 1B15A 4PW0A 4DLRA 3WB1A 2WDZA 4BKQA 4MIOA 1T1IA 3CY6A 4PX3A 2ZIAA 4IDNA 2HCFA 3CH4B 3QEOA 3PIRA 3NYQA 1UBLS 4E3WA 3IODA 3IXMA 3O74A 1RXWA 3EISA 4K2HA 4ER0A 3L7CA 1QH8B 1NW3A 4ERNA 3O2SB 2QIOA 4MUHA 1SJ9A 5EIOA 1GFWA 3UMYA 4HGQA 4ZCPA 4QODA 5KNCA 2W90A 2GGSA 1W75A 4AG6A 4B3MB 4RDXA 2BSQA 2BW0A 2CDNA 3LC2O 4MEXA 1BYIA 1PJLA 4MWEA 5EE1A 4RHYA 1IBKB 5JD3A 4C3VA 4QDJA 3CJRA 5EVJA 4PIMA 4QAJA 3OE5A 2IOHA 3IPLA 4M7OA 2DKZA 2UYCA 1DLJA 4W5WA 2LD4A 5FADA 1WXQA 3RH6A 5K6AA 4RLFA 1GZHB 2PI4A 1VHLA 1KJWA 2KG5A 4BB6A 4G5YA 4JI1B 3I62A 1S4MA 4YIHA 2LZ0A 4E5DA 1UWVA 1E60A 3ED1A 4WZAE 1M54A 2B4TO 1OXMA 3A9RA 1M1YE 4I5FA 2PZMA 4KB5A 4YQWA 3ZGVA 5BYJA 4L9RA 1Z3IX 3ZI4A 1JZSA 3WTCA 5KIAA 5CFOA 3WK6A 1KC3A 1IWPB 1CXZA 1JR6A 4M88A 1RXEA 1T5HX 1V1RB 4KR2A 1ZYQA 4BEWA 1HR0B 1HLDA 1NVVR 2AB0A 1NM5C 2YHAA 3KQPA 1KEEA 4ARAA 2X2EA 2JHFA 2GKGA 1DKQA 5AM1A 1C9MA 1YR9A 3H1AA 3PW5A 4LJ5A 1Y1LA 3T5TA 3K1RB 2NAFA 1U8EA 3E2EA 1R0CA 2IDJA 4PS1A 1IVNA 5CCBA 3FTQA 3Q88A 5J4YA 4EABA 1NR7A 4A8HA 4KRGA 2WWWA 4FHCA 5HF9A 1EH5A 4F6CA 3PUWA 3DONA 3SS8A 5K99A 2QOEA 2E7ZA 4NHEA 1JKXA 1DJPA 5UKDA 1YZTA 1VHWA 2DFTA 1ZQRA 4G0ZA 4HWGA 5CYFA 3OP1A 2OECA 1C8BA 2GBLC 4D3YA 3W5SA 1KETA 2J67A 1K8ZB 3LX6A 1H22A 1DBRA 4C7VA 3B1KA 5CBPA 3EHEA 3RIYA 2AN4A 16PKA 4GZ3A 2ORWA 3RNLA 1E79D 1NBIA 4ZU3A 1N1DA 2PFSA 1VRVA 2F8MA 4GRIA 3ZU5A 2YVLA 1J2TA 4RVHA 5E3IA 4UCFA 2E85A 4Q5IA 1E2JA 4BO9A 2Y05A 1BRTA 3MPOA 4DZTA 3TRJA 2VH1A 3BIFA 3X1DA 3HUDA 3GLGE 4ZVVA 4V0OA 5LLTA 4EP1A 1XLVA 2ZUVA 4JP2A 3HP6A 4FX2A 1MRNA 3PGXA 1OLSB 1EUQA 1PNOA 1C5KA 3WAKA 5FT9A 1FE8A 4YJ3B 4QZGA 4H59A 4P36A 1WA5A 3PQ7A 2CE2X 1XC7A 4BX2A 3UAYA 2Q49A 3OF5A 4YNBA 1U5BB 1R0YA 3BSSA 2P9FA 1CDEA 4TTQA 3SM3A 1NU8A 1EVLA 5BR8B 2R1VB 4D2IA 3AEKB 4P86A 3FYUA 2CMDA 4AYXA 3U37A 3PB3A 1RPJA 3HE3A 2Z83A 1PFUA 4XIYA 4C0QC 1XAIA 3AWIA 3S2GA 4BEJA 3UWOA 2NVBA 3BRSA 1BPEA 1YCDA 4B8WA 4FJ1A 4BO4A 1ZMBA 3VZPA 2FE1A 1GGVA 3STXA 4POOA 1YTUA 4HDNA 2WT9A 2BGTA 5CVEA 3KE9A 5DE3A 1H4SA 2VZ8A 4ND7A 3D0RA 2FPKA 4J90A 1JDVA 4BNWA 2EYUA 4N9QA 8ICOA 3ASYA 4ZAVA 2Z3WA 3BSWA 2OB1A 1TM2A 3EYAA 3T38A 2RGGA 3U1BA 4KL8S 2H9AA 2FPPB 4KDFA 1MQ2A 4G0WA 4LDPA 2VSNA 1AA6A 1JG3A 2G1JA 4P58A 1GCGA 1P5JA 2DM6A 2R2GA 1GVNB 3FTNA 3NEJA 4RZXA 4ZD6A 4C0KA 1XDDA 2G0NA 3MN1A 5AK0A 4WD3A 1C8KA 3OCVA 4CIYA 3NT2A 3TR5A 1T35A 4DJJA 3CVOA 5ALYA 1FNMA 1NOMA 4YI3A 1U9CA 4R8UA 3G6YA 3MCWA 4WECA 3K4PA 4M0KA 5REQA 2J8ZA 5G53C 2BZ0A 1XWFA 3ICPA 2OG1A 1XRLA 2FEKA 5JSHA 5HX7A 3LT5A 9ICJA 3WGZA 4ZI2A 3RS3A 3M33A 1SCIA 4X8OA 2VL7A 3G2LA 4DL3A 4PTZA 3SYKA 1YZHA 5LP6B 1Z18A 2OP0A 1P8JA 4FQ7A 4W1RA 2P62A 4INAA 1N63A 3SY8A 3BJZA 3HP1A 3ZDEA 5FQOA 5TQ0B 4TYQA 2I4RA 3A25A 3I8XA 2CUZA 1B6RA 1PI3A 2IU3A 1POXA 1I36A 4EQZA 1QK5A 1MDFA 1C7RA 2Q6OA 3PYXA 4V1CA 5EGNA 2X0DA 2P9GA 3WWEA 4QXPA 4HB4A 5JT1A 1E2UA 4R71A 3ZDAA 1JKMA 2OXOA 2F9MA 3RU2A 2EJTA 3WKDA 4QUKA 3IA7A 4USAA 5LMZA 2JVJA 2G09A 2YIMA 3BH7A 1OGJA 1HNZB 4TRNA 2XKJE 1FJXA 1AKWA 4AS1A 5B1IA 1BEZA 4I66A 1BXKA 1XNGA 3OC0A 3K4GA 1KKLA 5KNDA 2WJIA 1PT8A 2HHLA 3HCFA 5C1DA 1E79A 3E27A 1PJBA 1L5QA 3NB0A 3HP4A 4KKXB 1XXHB 5JAZA 3Q1LA 2NVOA 4B45A 3QLEA 5A4JA 1GO3F 2FW7A 3KTAA 4R16A 1Q1GA 5GY7A 2UYHA 2RONA 4O2AA 1DAKA 2F9LA 2C2BA 5T7BA 4FD2A 3C6XA 4CEIA 2VG8A 4I46A 3S44A 4ZVPA 2BEVB 1G8AA 2HHAA 3ANNA 5EZQA 3GZFA 5IAOA 4URFA 1KSGA 5HCIA 3O6VA 5DFAA 4CTMA 1CUCA 1QGUA 1O94A 3BERA 5G4KB 1BPXA 1ZA2A 4C7BA 5L40A 4GBED 2ERXA 3CYMA 2P4QA 1SM4A 4K9SA 3WWOA 4TLDA 5BWNA 4TZTA 3HXKA 2B61A 5ENZA 3HA7A 3P4XA 4TS9A 2OHFA 4F5NA 5EJGA 3HYCA 5I4KA 3OMLA 3QVKA 2BRUA 3IPRA 1THMA 4MV6A 2JZCA 1NT4A 3I9FA 4YCSA 2W11A 1NVKA 2P3LA 1X70A 2VRCD 4JD5A 1T36A 1M6VA 4KXQA 3C21A 1B26A 3UG7A 2IE8A 2YXDA 1RVDA 5AOAA 4PS0A 4US2R 3ES9A 3V1KA 4PHFA 4FMDF 4OHRA 4UMDA 1I94B 5LDDC 3UC9A 1QP7A 3OLQA 5BQFA 1YJCA 4N5HX 3IKLA 2CJWB 4Y30A 1JEEA 2GKOA 1PQUA 2NUPA 3QHAA 1HT0A 3RVSA 3P9IA 3OPYA 4Q9LA 3NTUA 5ILOA 4OG2A 3WS7A 3PPWA 1CZOA 1JEQA 1QYCA 2Z08A 5IG2A 4GS5A 1IJBA 3F90A 4UHEA 1DX6A 3BZBA 4RY8A 3BMNA 4GSYA 1D7OA 3M0EA 1WQ1R 3ZCSA 4KH0A 4PZOA 5KG3A 5EE3A 2A30A 4QOGA 2D62A 1ESNA 3VR6A 5CNKA 1KZ4A 3A7DA 5ILQA 2C4WA 4MA5A 2QJRA 3IOMA 5FA8A 3JQPA 1YACA 2YW2A 3CNLA 4B1FA 3CUSA 4KO3S 1XWIA 2DHRA 2C2RA 1BE0A 1OBCA 3RAPR 3ER8A 4GXIA 1DDIA 4RHTA 1YBFA 5TQJA 4ZT5A 2AZ4A 3HTXA 1OGYA 1CF9A 2K4PA 3NXKA 3BB1A 3JZAA 3KHGA 3JWHA 4OIFA 1E3IA 1X1SA 1JUDA 4MYUA 3PO5A 1TKDA 3MUFA 1MN6A 2RHCA 4AQ7A 3ZH9B 4IXWA 1B73A 3MS7A 3A26A 3O8LA 1BXGB 3K9CA 4I3GA 2Q1XA 4UBLA 4QUDA 4H0CA 2QRKA 5KYWA 3PFFA 5FWAA 3DTNA 1SXQA 1I3CA 1KY3A 3EEOA 4PWZA 4PHGA 2GLEA 3TRIA 2C57A 1ZUD1 5ECWA 1H6DA 2B8WA 1PZMA 4QZIA 2BFCB 5I9BA 2D3DA 1ACLA 4ZIRA 1EVJA 2CBZA 2ZP1A 3NBFA 3MR6A 4C7MA 2B82A 2WKSA 4YQZA 4NMWA 4JQSA 3KKPA 4C4TA 4Z9YA 2IVFA 5K3CA 4IIXA 4TSFA 1RBMA 2GPSA 2HSEA 4RPKA 3CNHA 1OXSC 1HFJA 1I01A 4TYYA 3S5UA 2VYCA 1Z4NA 3A32A 4IRXA 4IXMA 3RBVA 3A4LA 3NOOA 5MFPA 4OKIA 1C3EA 1QVWA 5AFSA 4RFVA 1L7RA 4D8WA 4ER6A 2QLLA 2IHYA 4H7JA 4BV9A 2BEUB 1DBPA 3CE6A 5LMUB 3T9EA 2WSIA 4NBLA 2I5PO 3DAHA 3IV6A 4MITA 5K8VA 5FLXA 1N3LA 4BX0A 3EX7C 2IKSA 1SKAA 3CW2A 5KQPA 1VE9A 3EZ6A 3T35A 2X2PA 5KMGB 1X8JA 4E5NA 2PWYA 2VP6A 4Z6DA 2IPOA 3PKZA 1H93A 4DNQA 1NBME 4US9A 3AT1A 1GTMA 1JH9A 9ICRA 3CRMA 4KR6A 3JZDA 4X7RA 4TUYA 2I1WA 4AAYA 4OX9B 1M1NA 3B7GA 2W2LD 4NY8A 1XRMA 3GYGA 3FNQA 4I5EA 4HGNA 2WNSA 1TK5A 2YZKA 3TSCA 4NFSA 3D2CA 3L07A 3LGSA 2ODNA 2I2XB 4BGVA 2B4AA 4IY1A 1Z6TA 1YHYA 3LVFO 4WA8A 1Q44A 2DWQA 2ZT5A 5D5HA 3CYFA 4RTRA 3NBUA 2JLQA 3I37X 1RYNA 1VRWA 1W59A 3RH0A 4PQEA 1HFWA 2VH2A 3E84A 4IUCS 3AJ8A 4WN3A 5IP5A 4ZYLA 3GNTA 4N8DA 1EEXB 3HKZF 3PQ5A 5KEIA 5BSGA 1DUVG 9ICKA 2KJ5A 3L9WA 1XKLA 4J4HA 3R3WA 3QNUA 1D9DA 3OJOA 4DOMA 1OR8A 2NUTB 4HMQA 3LVVA 2O1XA 4XVCA 2ZTCA 3C70A 1LPBB 3GZTB 3VOTA 1TZMA 3CLRC 3KAKA 1FFEA 4YP1A 3H1BA 2XOKD 2HI0A 1GG2A 5IZCC 2IC5A 1K7EB 3GFFA 1DLIA 5LPNA 1JW9B 2ZVJA 3ADCA 1K7YA 3ED5A 1BVRA 3UAGA 4KYVA 3H5OA 3MRVA 2YUIA 1VLBA 1U8UA 2GEDA 3AP1A 3T5HA 5K8IA 1TECE 3MT7A 3AHFA 3CONA 1C30A 2X1MA 2QRVA 1JG6A 4B6QA 4CIWA 1SEVA 1MLDA 2ZULA 3PTAA 4DNPA 2R6DA 1FU8A 3K0EA 1VJDA 3HPRA 1W4ZA 4P1ZA 3BM5A 2YOHA 2C5SA 4WZZA 4Q82A 1A5TA 1P1BA 5CB4F 3JQ8B 2UYOA 4WOCA 3WWZA 3IKTA 3JQGA 3F5MA 4XUEA 2N1MA 4BQRA 1QLJA 4UHDA 5DYYA 2ZEJA 4EMTA 4LMAA 3HZHA 4KIGA 1IV8A 1N6RA 4Q4JB 3ADOA 3C14C 4M98A 2NO9A 1ZW6A 2XMCA 1RBQA 5TDHA 3NATA 3W5AA 2NIPA 3CW9A 1EMDA 3JVDA 1CIPA 4DSEA 4OHZA 3N59A 4IL6U 1AHPA 3ZLTA 4NMLA 3F7OA 4YC7A 3ORHA 1QC5A 2VP3A 4QDKA 5DXJA 3M3PA 1O87A 2AH5A 5C37A 5HF5A 1NJ8A 4ZGBA 1P5FA 1HEUA 1Z5WA 5BN5A 2REXB 4V0LA 1CB0A 3TVDA 2YHUA 5ADUS 4BP9A 3FKSA 1KQNA 2VPXA 4FSDA 1MT0A 4RS4A 1XZPA 2UVDA 4R8RA 4UHFA 4UNNA 4REMA 5FBVB 1SZDA 5FTKA 4MI3A 4NONA 1PDWA 3E9YA 3CPHA 2HBQA 2CLDX 3IHKA 2Q6VA 7ICPA 3RC7A 4GZ6A 1GN9A 4HWPA 1ZQAA 1CJMA 3IUSA 2X0IA 3U31A 3ILXA 1LV7A 2AQ4A 2H57A 4DIMA 4F1JA 4OI2A 1YB2A 1X38A 3QA9A 1JG7A 2BMDA 5CCDA 4QUGA 1S0VA 1KGDA 3M5DA 4D6YA 1RAHA 3Q98A 3C7KA 2MDTA 1U3CA 2H5EA 3R1IA 3J7TA 2COUA 1ENPA 4UB2A 3NYWA 1USUA 4BVGA 1X80B 1KP3A 1A8IA 6ABPA 3PSIA 1A7JA 4RS3A 4N1AA 2W5UA 4EG3A 4RUAA 4Q7LA 1FTQA 1M72A 2LDXA 3LYSA 1A4UA 3F7NA 3PQEA 3L0SA 4R68A 3O3OB 2CFSA 5M2QA 5ITWA 3K0BA 5EZYB 3UA3A 3D7SA 2AYXA 1EI9A 4ZMBA 1TQ4A 3C6KA 2XBLA 5FWXA 4PFJA 2DQKA 3W34A 3FD8A 3GZNB 1TK2A 3WGYA 4HDAA 2WZCA 1YOVA 1Z68A 4NYMQ 3DW3X 4GEKA 3BXFA 3NWJA 3HJEA 4EPRA 4G8DA 3SHFA 3QE3A 4NZZA 3VVMA 1PR2A 3ZZUA 4IDHA 1NVFA 1QB7A 3E70C 4FPXA 1ICEA 4OO3A 1CT9A 3RS7A 2AI2A 3F71A 3H1PA 1C8VB 1OVGA 2XQJA 3VRHA 5CU7A 1QSYA 4DRZA 1G19A 1R4MA 3RSOA 3CGGA 3UT5B 4O5CA 3GG9A 2YJNA 1QIKA 1ZK4A 2E18A 3NNSA 1K92A 3UAVA 2ZJYA 3E5HA 2HMAA 5TPZD 4D98A 4J4BA 4AJEA 1JNYA 1U7DA 3CF2A 4FOPA 4GI3A 4O4JF 4BLUA 1DTSA 1SRRA 4L3OA 3RRHA 3UXNA 3MMPA 1TCVA 4YMWA 3RPEA 5EPOA 1MVLA 1CE8B 4YDQA 5A3RA 1TW3A 4QOHA 3U5TA 4PBTA 3W05A 3ZQKA 3E7PA 1OGIA 1OJ7A 3FMPB 3JQRA 1OWNA 3SKXA 9ICQA 3WRXA 1CR2A 4JI8B 1OWOA 2QPAA 5KCMA 3VYSB 2GM4A 4B71A 4MVJF 5KX5F 2JFWA 1A9RA 1FSGA 5KTTA 4UUAA 2XCAA 4PGQA 5LUAA 3N5CA 2FEMA 3L8HA 5EWLA 4RPIA 3A05A 1G3IA 4NYMR 4KOEC 3IUNA 5IDQA 1F1JA 1B74A 2BCVA 3LP8A 4MOWA 2JCYA 5DNEA 5HFNA 2M1ZA 1OLOA 2HHXA 4M76B 4N6GA 1JQDA 4MROA 4DT1A 1BE1A 4W7SA 1E6KA 4H9GA 3REQA 4LYHA 5AOCA 2KFZA 2Q8QA 2ZI9A 3UFXB 3CUKA 4I4TB 3WMXA 5DWDA 1WCYA 3AB8A 2QLBA 4IKOA 2X9LA 1KO1A 1A27A 5HJ2A 2YWCA 1SQ5A 3PIIA 4B44A 4RNCA 2QBYA 1M33A 4KXXA 1MX3A 2RG7A 1DBIA 4E0DA 1PV1A 4EHHA 3R4VA 4IDEA 1LJUA 3FDFA 4JV1A 3DMHA 4UEOA 4W9RA 1KE2A 4IUDS 4KXFB 3BFPA 4ICIA 3C45A 1HE2A 2O5VA 3QKIA 5DJ5A 4GECA 3PSPA 1YJAA 3K0AB 3BJRA 3IBFA 1A5BB 5KFPA 4B4WA 1KWGA 4AYTA 4J0DA 2HMXA 4FUQA 2HA0A 5JJKA 2DVMA 1E3DA 3L9XA 4AJ4A 4FGSA 3KBBA 4D25A 3IDZA 4QXOA 1U0OC 4DJDC 2CEKA 2GJ9A 3TINA 1W5SA 5IIOA 4ZT3A 1F20A 1Y4ZA 2DQ4A 3CRNA 3W2HA 4HOYA 1A8HA 3QVSA 2XVAA 4ISCA 4WCFA 5E2BA 3TFOA 2GPYA 1AKVA 4B3BA 2YV3A 4B7ZA 1ZQZA 1S8AA 1MC5A 3PG5A 4OI4A 2IHBA 4BEBA 4A6DA 3QKUA 2JH3A 4XJXA 3W9YA 4UJ3A 1G9SA 1ZAKA 4FM9A 4MVJE 2RGYA 3QKSB 4I19A 1ZJ5A 1RYUA 5EHZA 5F5NA 5HHIA 1IN4A 1EXVA 4S04A 3BIXA 4R8SA 2PQ2A 3A3YA 5C1BA 3CE9A 2HHTA 1ZMTA 2D0IA 1IQRA 2O8CA 3KC2A 2G9VA 1P0QA 3OCWA 1GRNA 1PFVA 2OQ2A 4B31A 5IC4A 4JHLA 5CDFE 4DQQA 4FLMA 4L5BA 2R2AA 3GJ7A 4ZQBA 3ENKA 1DWOA 1E7QA 4ASUA 3A27A 3AM5A 4YMIA 1HURA 4DCUA 2ZIXA 4ITUA 3DXYA 4YY3B 2P75A 2P9CA 4BAGA 5LN1A 4MVXA 1XDSA 1AS2A 4RTSA 3BJMA 1ZVKA 2CB9A 1RZUA 3ZGLA 1EBBA 2QRVB 2JFQA 2R6CA 3K3PA 5FI5A 3IXLA 1QG2A 1H2YA 1E89A 1Z4LA 3FLAA 3I9LA 5CTAA 2SCUA 4DMRA 2BE9A 3IO5A 4Q4HB 2P9BA 5HBRA 3NBMA 1URPA 3JZMA 4YMGA 2ZBVA 4K9RA 2WSMA 1SHKA 3JQGB 1J22A 1N2SA 1KMNA 4N0MA 2ZIVA 3ZXXA 4RIGA 3RF9A 3GOHA 3GLFB 5TF0A 1TB4A 3BILA 2QD4A 4EM6A 5WRFA 4BDPA 1UBHS 2SKDA 2RHGB 3F6CA 1UZLA 5J2UA 3WIBA 5A6SA 3PS9A 3DUFA 1EWRA 1PL0A 3C3CA 3FRHA 3WKEA 5CVVA 2WQ6A 4U2KA 3LDAA 2HCBA 4PGGA 4DPLA 2NV3A 2FPUA 2XSZD 4CF6A 4XFDA 3VOAA 5ITZA 3QU9A 5IMBA 3RRYA 4C1NA 4TTSA 1AS3A 1SVUA 3OF2A 5CP8A 2Y1XA 5D7BA 3QUAA 2R8OA 5CA1F 3C23A 1XV5A 3LK9A 5CNIA 4KFRA 1XS9D 3ABOB 4IIJF 1JZQA 2VQ6A 1F0MA 2NPIA 3QYJA 3GAFA 4IOJA 2O48X 3QM1A 1LFAA 2EF1A 4UVGA 2I2AA 5IC5A 5A9TA 4NE2A 1FDSA 3WICA 4JLOA 4BFCA 4XJSA 1JILA 2IXEA 2QX6A 3SMVA 4KKVA 3WBBA 2PFPA 2ZDHA 4X95A 1GG8A 5GGXA 2PMBA 2GLXA 5CPBA 3R3ZA 2KKPA 1YRYE 1W96A 4P32A 2ID4A 3V3TA 4DLBA 1ZJNA 2D5LA 3OX4A 2E3JA 2ETVA 4Y2GA 3KG2A 3LQRA 1I3MA 2C7GA 1C7EA 3G0BA 3WI7A 4JJFA 4PYMA 5AKIA 3D1LA 5AM4A 2FSHA 4WVFA 4CBVA 5BWMA 4GQIA 3DAOA 4D8UA 1E2HA 3DOIA 3ZV7A 4H1WA 5HGJA 5H8WA 3EZXA 3AF5A 1EFKA 5ULLA 3DDCA 4O0MA 2DLNA 3RJHA 1QRDA 4LOLA 2EKBA 4WGGA 2E4AA 4KQGA 4BVBA 1JWBB 2PD4A 3HSKA 3SC3A 3NTOA 2OP1A 1BAPA 4OHVA 4OL0A 1YKFA 3VYVA 4G8BA 821PA 5DCWA 4M47A 1NT2A 3G5AA 3GGGA 1N7GA 5EEHA 3OT1A 1XLTA 3HI6A 3UGJA 2DFVA 2JFPA 4FWBA 3R7DA 5A06A 3ZXYA 2K4HA 1ECLA 2IYUA 1P7DA 1SKUA 1BHQ1 1HV8A 1ESEA 3HCCA 1AUQA 5KTYA 4DL5A 1WBDA 1CRXA 4QBFA 1ADYA 3DSRA 4IJMA 1OXJA 2YJZA 3Q3IA 2OCKA 5IF9A 4OKNA 1PG0A 2WJPA 2VT3A 2HU7A 4LBVA 4CLHA 1XA4A 2JGIA 3RBDA 2LKYA 3GPCA 5TQVA 8ABPA 2GUWA 4QPPA 2ZBUA 2DR3A 5KFEA 2VA3A 3A4MA 8ICBA 2ATLA 1IDOA 5EUMA 3HPOA 2JGDB 2JKVA 5DSTA 4LQCA 2WK1A 4LYDA 4MP3A 3OG9A 4IJWA 3WRYC 1XVTA 2BGRA 4FGWA 4XXHA 5DCLA 1CHDA 3NJ8A 4TURA 2HD4A 1CJTC 4DS3A 1QGZA 3OOWA 3CW8X 3OM8A 3HJHA 3MWKA 3FPKA 2AKYA 2JGNA 3RVBA 2BFBB 2XBMA 3OWHA 4KPFC 4OP3A 1KSPA 4N01A 4E2ZA 5HHHA 2QD5A 3SPXA 3MGKA 3K5HA 4PFQA 1UAYA 4E12A 3BH6A 3QKRA 3HKBB 1HYGA 1EDEA 4WGFA 1XCGB 2BFNA 3BIOA 1ADGA 1WPGA 2JBAA 4U9UA 2YTUA 1LK5A 3U17A 2PO7A 3OSZA 3EXIB 4GKJB 4JUZA 1ESDA 1SU6A 3H5NA 4ZAFA 2OFOA 4C4ZA 3VR5D 2VNSA 4DCOA 4HS9A 1GZSA 4V3CA 3TARA 4E4RA 4BYGA 1WLYA 4DC0A 1V9PA 1ORTA 2XSZA 2AJQA 5CFMA 4GOMD 4IP0A 1CY2A 5L3ZA 3O7WA 3AFMA 2AMVA 2MSLA 4LX0A 4RC9A 3JASB 4QBTA 1QTQA 1B6SA 4IGIA 2VCYA 1EP2B 3G0HA 3I0NA 4KXMA 4J9QA 1KJ8A 2XT6A 4QBGB 2ZSHA 5I8PA 1ZN9A 2FUEA 2TMDA 4PANA 2PU5A 2Y6VA 2PZLA 3FDZA 4KRFA 1RZTA 2GK7A 4L73A 3AR5A 3ZK9A 3QXXA 3OESA 4NLGA 2GB4A 2EQ5A 4RX1A 3AVYA 3SI7A 1VLJA 4NV3A 1QFJA 4FDTA 1DAEA 4HVTA 3IAFA 4W9NC 1LWOA 1MJGA 2JLYA 3LBFA 5CW2A 1QE3A 3F9CA 4R2MA 5J2TF 3UKDA 5AVUA 1DQRA 1WP4A 3KIPA 4JJ7A 5JAMA 1HLPA 2OZLB 3SLGA 5T57A 2G4VA 5IIIA 1CY8A 4G9BA 2P68A 3EXFA 3BGVA 1EFUA 5C8YA 1U2TA 2OBLA 1GAWA 4ARIA 4LF5B 4L75A 4D74A 2HPAA 1ZH8A 4XI9A 1PYGA 2V7EA 2M1XA 3R5FA 3QVVA 3CZ5A 2Z1DA 1OWMA 2CT8A 1NV8A 2C2MA 1UZAA 1F6BA 2J4DA 4Z99A 4F9FA 1TZ2A 3DNPA 3S2FA 2P5YA 1TRHA 3CJQA 5LOVA 5ECDA 3JPNA 4A0QA 1TVKA 3PX3A 5B66U 4WZBE 1KDTA 2BELA 3GP8A 4GX2A 2O8CB 2EKZA 4K6KA 4Q9HA 4NZNA 4TUSA 5FNVB 1JSZA 5BRAA 3RE1A 4TKLA 1P5ZB 2XUDA 1U7HA 3OIWA 1DC6A 1PZXA 3QOFA 4BQFA 1WDKA 3AEVA 3V72A 2AFHA 3H0MB 3ZWOA 2GCPA 3TOVA 4CM5A 1J6UA 2N47A 4MR7B 2ODQA 1VLVA 3ZWAA 4YRNA 4JENA 2Y4OA 1UODA 1ZESA 3W2EA 4UNQA 4Q1BA 3AINA 1TFUA 3A4IA 4FJ2A 1T0IA 5KNIA 1NJSA 3ZCUA 1HE5A 4OL9A 5EWFA 4IF6A 4IOMA 4IVPA 4PBSA 5C8VA 4OJMX 1ECPA 3TRFA 3OQNA 4GKBA 3I9KA 1D2NA 2OQVA 5H3HA 1YBHA 3IM1A 2A7QA 2Q4OA 2YQEA 3O75A 4P3KA 4MUKA 1T2DA 3STYA 4DR1B 4C14A 1S02A 1G18A 2FSUA 4IVRA 3MJSA 4DEXA 3FOEC 4UBBA 3LZCA 3T9DA 1W36B 3SV4A 1UBEA 4FUTA 2P8SA 4GLBA 1U81A 1VCMA 2X1LA 3MCTA 5E1BA 2VJMB 2JEZA 1O58A 4L22A 5CRIA 1BWQA 4NLZA 4X60A 4MB2A 4WBNB 4MHOA 4KP7A 1V1MA 4JA2A 2DFLA 4Y2HA 1JHAA 3N86A 3GIIA 3DL4A 5DMHA 2NZJA 3CMMA 4BTVA 3MWDA 1M6YA 2BGLA 3ZZ0A 3F2IA 1VPEA 3RUIA 1MEJA 1GTJ1 2HLNA 4MFFA 3ZQ6A 4IQFA 1CUGA 3I39X 2IODA 4IOKA 3GU3A 3RYHA 1WZIA 4O4IF 5BT9A 4J0IA 2OHJA 3EBOA 5JZSA 1NXTA 2HDNB 3S29A 3IN5A 4UVEA 3BXGA 4BZXA 3AU6A 4DDVA 4ENWA 1DG1G 4Q7QA 1FZTA 4J1TA 3WP0A 5FBZA 2P0EA 4XH9B 3KWJA 3GEPA 5JH7B 1XMJA 1VDVA 5FV7A 1DJOA 3CTMA 2PH5A 5B3KA 2ZI7A 1YVRA 4KR9A 3V9PA 5EOZA 3OWXA 4LZNA 3FUVA 4WBSA 3L41A 2QPLA 5TVKA 3P9ZA 1R6AA 1X7YA 3U7JA 4XUSA 2GTIA 3NONA 2YHSA 1NVVQ 2HWUA 5ALFA 1VL6A 3RS8A 2JHCA 1QR2A 4NQRA 4DRXB 5ERXA 1USIA 3WQHA 1EUCB 4ZO8A 3AEYA 3WAJA 3QUBA 3EMDA 4BGUA 2ZITA 1AXRA 1P0MA 4DSLA 4TOIA 2OMEA 3HNOA 3BBPA 4DLZA 2ZRQA 3RSLA 3OE7A 3DC7A 4I1RA 2FMHA 1RP7A 2MYTA 3ORSA 3T95A 4MVWA 3IP6A 3K8OE 5K3FA 3G6KA 2HGZA 4EZ6A 1CRPA 7ICGA 1VSTA 2FMTA 3E5MA 3T5BA 5C5IA 1O0BA 1V38A 4CMJA 2BFDA 3RB3A 3L7MA 2PX6A 3KOUA 5SYAA 1CS0B 1KYYA 3KDSE 5HYVA 3SLKA 1W0KA 1VYTA 1TLFA 3M1LA 5ALRA 1IOVA 1XO0A 3HJFA 1RJ9B 3NVKI 4RDHA 2VWQA 4AJPA 4AJJA 3QJ5A 4OFWA 4UXJA 4EYKA 3ROGA 2PKRA 3B60A 3VZQA 4JDUA 5J2GA 3ZVMA 3M5WA 2X4DA 1LSUA 3AETB 2OZEA 2WAXA 3RFCA 3FJOA 1AHHA 1IEXA 2IHZA 4YMMA 2KSOA 3QX7A 3G1WA 3WWYA 5KZMB 4Q0MA 3BDIA 3DF9A 1Z5NA 1ZD2P 2JZBA 2Q3BA 2JEIA 3JX9A 4OXRA 5IDXA 3CRRA 3FUWA 1U5AA 3AY6A 1PL6A 3EUB2 3IJPA 1HETA 3MUOA 1EHYA 2IPAB 2IEZA 2IYAA 3COPA 2MR6A 4UQGA 5A02A 3KEMA 4HDMA 1KO7A 3D8UA 3ISTA 5THQA 2A0KA 5AOBA 4CQMD 2WDPA 5KT2A 1S76D 3ZE8A 2VF7A 4BMVA 2BHRA 3AG6A 5DXAA 4BLWA 2AD5A 4G1EB 1UZNA 2H1IA 3IEUA 3NTLA 3DVQX 3LX4A 5BORA 1YZLA 4B6SA 3V4ZA 3MNFA 4HN4B 1FYVA 1HE3A 5KVSA 1Y8QB 3N0VA 3ROFA 2VK1A 3UHOA 1KOFA 1GQFA 3ALRA 3CEPB 3JARB 3NHYA 1IY1A 1DKPA 2K5UA 3RTCA 1VGRA 4TTPA 4RW0A 3AWDA 1W5EA 1Q0UA 2QHXA 1SQGA 3ZTTA 5DM70 3FWYA 1QIJA 4DQUA 2C98A 4CMHA 3MVEA 3ZS9A 5CGZA 4AZ3B 3BPSA 2IOFK 1ZIPA 1LX7A 2G88A 3GMSA 3G79A 1WKVA 1R0KA 2QL7A 4L5AA 4BLTA 1UBKS 1Z26A 3BXPA 2F90A 1KS9A 4YRIA 2H9IA 1NUQA 2RHOA 4ZOCA 2OOSA 2XAAA 3OM9A 4MMXB 3WQSB 1QHGA 1VMDA 1EFPA 1ZQIA 1X9MA 2WD8A 2CSXA 1JHPA 1M10A 3TTTA 2NWQA 5KQSA 4YJFA 3A9VA 4IUBS 3H2IA 1ZM9A 5GTIU 3OF3A 1VIDA 4OQXA 7ICTA 4IMRA 5C8YB 2Z8ZA 2QG6A 4MYDA 4JWTA 5EWEA 1RD4A 1X7ZA 4CEHA 5KFUA 4OREX 4WLOA 3BORA 4FZRA 1ID8A 1JDJA 5SY9A 4BUCA 1AOXA 4FYPA 3FWNA 1BFDA 5BW8A 3PGLA 4D80A 1G20B 4CCWA 1YB5A 4R2HA 1BCRB 3C16C 4YHBA 5C81A 2PS3A 1PJSA 3K6SB 4IQ4A 2AJBA 3VSCA 2XZOA 3KM0A 3N7AA 3KXKA 2BZSA 2ZQ5A 3ELUA 5K7SA 1MIHA 1BXRB 3H9EO 3RI3A 2I03A 1TYDE 3CRVA 3DE1X 1OREA 2VYQA 4C8LA 3ONDA 1MTZA 1BX3A 3IBSA 4L7QA 1ZHOA 1R0RE 3R23A 8ICKA 2L42A 2PGLA 4GYKA 1BJKA 4UAUA 5HRUA 1K66A 3GX1A 3U0BA 1MXFA 1JR3D 4MJLA 2PFQA 4HWKA 1XP8A 2NU6A 3SAJA 4J94A 3ELDA 4UQOA 2PA3A 3RYIB 4F1WA 5MF6A 4N0DA 3DMTA 4L4YA 1PGPA 4DCSA 1MAUA 2VBGA 1LRKA 1UBOS 3D2BA 1UBSB 4DQDA 2RGDA 3C3XA 1Z0ZA 3AEUB 4KUEA 3GVXA 4AZTA 2VQ3A 4YCCA 1IIBA 1NBEA 4OXYA 3D3EA 4DWWA 2WMNB 3KOXA 4Z9BA 1OZFA 4QYIB 4AP9A 3LO8A 1UMCB 3A9CA 1PJZA 3MJRA 3ANMA 3M7DA 1XCOA 4UREA 4H7EA 3WGVA 2VUHB 3GI1A 2IBSA 3ESDA 2OD9A 1WUTA 5G41A 5B4UA 2FPSA 3KQLA 2YYSA 1AC5A 4ZP1A 1YIDA 4R6XA 5A71A 2Z6AA 1NP3A 4R6WA 1PV2A 1FA9A 3F3KA 1GZ3A 1A50B 4D7AA 3MDAA 1JWAB 2XCPA 1DRGA 2PCLA 3L6UA 4K9QA 3ZJ5A 3GF4A 2LPMA 2IUTA 1I2ZA 4NCXA 3X44A 4NNPA 3OQPA 2ZYHA 4G5HA 4V0SA 3H3XA 4TMFA 4E5KA 4DR5B 1DK3A 5L3RA 3KQQA 1DEOA 3IJ5A 2R66A 1NK6A 1QHHB 3DV2A 2XB9A 3WVNA 4EI2A 4AQDA 3KKNA 2XQGA 2ZS7A 1XCBA 2R48A 4B6RA 4I50B 1U8ZA 3U26A 5L9XA 1IPEA 3GRYA 2E8PA 2DQSA 2IXTA 3AHIA 4JLSA 4D9MA 3FBGA 4JT8A 2N1BA 4QWCA 1XALA 1EFHA 4PVCA 1XE3A 2FMFA 3F5FA 2XT0A 4OVKA 1K7CA 3EEYA 1J2EA 3ZHYA 1Z0JA 3RYHB 3IT0A 4NYIR 4MQUA 2NO4A 3A2LA 5BYAA 1KVRA 1KLNA 3T0GA 1V7CA 4DVGA 5HCUA 4GZMA 5JCPA 4G25A 1RYMA 4HXGA 2XDYA 4GPAA 3SMQA 1ZWLA 3N05A 3B1WA 4CWAA 4EW1A 3WLMA 4CNQA 1ZIYA 5ELXA 3KZNA 2VIIA 4AVYA 3RHSA 4UBOA 1Y7IA 2IF2A 4KOAA 1WYGA 3WK4A 1I8TA 1LDGA 2PWBA 2ZBFA 2VDKB 2ZJ3A 4PFKA 3ND9A 2Q2QA 3IXQA 1J97A 4Q3OA 5K51A 5CB8A 4JSYA 1FXWA 1X1DA 4WV3A 3KV3O 5GMOA 2CLEB 1PFKA 1FVXA 4ZOBA 3KJEA 1ECWA 4DWOA 1G0OA 1JA1A 2OBBA 5JHHB 4ZVLA 1L2TA 3W2FA 4FCCA 3K9QO 1NUUA 4F5RA 2O05A 5DX8A 4ECTA 3GP5A 1Z00A 1OTHA 3AIOA 1BD3A 1DIGA 2E5SA 2WAMA 3PWKA 4QJ5A 1XTZA 5IXJA 1OV4A 1Y6RA 3AV3A 1HQDA 5EFZA 4LHSA 4O5AA 2B8EA 5DBHX 4O3PA 3G9QA 1LNSA 2YNMC 1ULUA 3GQBA 2PBFA 1Y5RA 2GPWA 3H40A 1NASA 4KQ9A 4MWGA 1NRXA 3OIYA 2C3MA 4RD1A 5TEVA 3ILVA 3AVQA 2AMJA 2UUBB 3EGIA 1IBLB 4XA5A 1RKUA 1W76A 1ZRHA 3USCS 4IRMA 4IOLA 3ZE6A 1T13A 2CWDA 4NCNA 4QIWC 5AM0A 5SV2A 3RYFA 1Q7TA 4X1IA 1IZZA 1ZH2A 4L0QA 5DGCA 3VKWA 4EG4A 1WVIA 2KQUA 1L7NA 2PLRA 1YDMA 2G9ZA 4L78A 2BUBA 4A03A 3PLAE 3N6XA 2QI9F 3BEOA 4ESVA 8ICQA 2XLBA 2WA2A 1S1MA 2MYUA 1NYTA 2WTMA 1XDZA 4PBRA 1JLKA 3X1KA 3H9CA 4A3SA 1T2AA 1WHTA 4UAYA 2A1TS 2QX8A 1KEEB 4L1KA 5L1JA 4OGGA 5LYJA 2E4UA 3A0UA 2FWAA 2PU7A 2CKDA 2IH2A 5JE8A 4M60A 1G8YA 1YDHA 4TXMA 4DOCA 1KOLA 3B20A 3KWFA 4KGXA 4QIWF 4HUTA 5A5GA 1QTNA 5C1OA 4AB1A 4D45A 2HWYA 2TS1A 1QXSA 4MW9A 2QTZA 3D2LA 2E6KA 5JSQA 5DCYA 3ZEIA 4Q16A 2RDJA 4HN9A 2RHJA 1K6IA 1Q7CA 5D5PA 2BKLA 3CSUA 1E5VA 1HX7A 4KWIA 4XWOA 3FOCA 1J20A 3SFVA 4GUDA 1CEEA 3L04A 2PRJA 4Z1MD 3ZWCA 4YV0A 3B1ZA 3MQ4A 1YMVA 3N28A 5CBPB 1XL1A 2VNKA 3I9MA 4ZALA 4L8YA 3CP8A 4KIFA 3RVKA 2JLRA 3QENA 3W5DA 5KNBH 1YZFA 3I6IA 2XMQA 4A2WA 2NPOA 1JFVA 4AZVA 3UOAB 4RD4A 1K5PA 2OEHA 3GRAA 3EGVA 2ET6A 2Y93A 5KFKA 3F2BA 2AZTA 1CB7A 3K8ZA 2RIRA 4B8ZA 3RC8A 1XN4A 3TEMA 3MMZA 5A0LA 1W0JD 2OKCA 3BK7A 2FZ4A 3GPLA 3FFBA 1JP7A 3PDHA 1O0SA 1TO2E 2CL6X 4GUAA 3IDQA 2CFCA 1K7XB 2GO1A 2VCEA 3O1IC 4G07A 3ZY4A 1N0VC 1EYZA 2YV4A 4PSKA 1EFPB 3ZBPA 4I3FA 3I83A 1YVEI 3W1WA 3BTUA 2Z30A 1GSIA 1KJ9A 3FYUB 4N9WA 3TQHA 1VFPA 3BFKA 3PPVA 1Z5UA 4FDMA 4YJGA 4EYIB 4TUPA 2ERYA 2DH6A 2X7JA 3EXEA 4N48A 4I2EA 2WWYA 2AQ8A 4YJ2F 1QO0D 1I5OA 2NXJA 5HXAA 1ODCA 4HDNB 4D42A 2QQ5A 1GY8A 1TF7A 1U9YA 4V1CI 3QMMA 5DV9A 1XTSA 3GCGA 3HKZC 5LIPA 1WKCA 3ZU2A 4EYEA 2FN4A 4ECYA 3TOCA 5COAA 3GJXC 5ALPA 4JYCA 2PJDA 2P78A 4Q39A 1J7KA 4WLNA 4LMBA 1ZC3A 3ENZA 2OCAA 4GR5A 1BHSA 5CEJA 1D04A 2FX2A 3AM1A 1YE8A 2C8KA 2D4AA 4B32A 3CH6A 1FYEA 2QN1A 4JHXA 4H35A 3BQNB 3OCYA 3EJWA 4DJ5X 4F6LA 1VJTA 4Z0PA 3RRXA 4JH0A 2B4KA 1F6WA 2VRCA 2B2CA 1PKEA 1FC0A 4EI8A 4AN0A 3DPIA 3RH4A 3AHDA 4PX5A 1Q0LA 1E2EA 3AMVA 4Z54A 1M3SA 2NRWA 2VH5R 4G2TA 3FCCA 1S01A 1T5DX 4R8UB 2UZ1A 3PFCA 4S1WA 1Z5PA 1R6DA 5REQB 1ZQ1A 8ICEA 2OBYA 1PJ3A 9GPBA 1YE3A 4ENSA 3H65A 2HA2A 3L1HA 5F9FA 2ZSBA 2O0MA 1RXYA 2YY7A 3QOYA 4LZOA 3GD7A 2BBWA 1QDEA 1E2QA 5BNTA 1HFEL 3TJRA 2PSEA 2JJMA 4KQXA 4HYTA 2HXGA 1YQXA 4KFUA 4YRJA 3IP8A 3TM5A 1SC9A 4ZAYA 5L95A 4UAVA 1U7ZA 3S1AA 3FMVA 3ON5A 4M83A 1I3LA 4HC4A 4M04A 2WLTA 1T5BA 1ZUNA 3WSVA 2LCQA 4WQMA 3WLOA 4V1CB 4JEHA 2VDPB 1WU7A 2R6GA 1A4XA 2F76X 5KI6A 1VI6A 4QZHA 4M9GA 1QZXA 3RF6A 3T54A 3K6RA 4ZRMA 3ZIAD 3FM9A 3CUUA 3FSGD 4JJ6A 4K6CA 2HMSA 5IC6A 1TCAA 1YRLA 2KE7A 2BZ1A 3H9QA 4IFEA 4MQEA 3SD7A 4QYWA 1NXVA 5BSTA 2F77X 3K1YA 1R6TA 1WQ4A 2Q2NA 4XB2A 1CNEA 1T24A 3B12A 4R4JA 3WGJA 4EG7A 1FQWA 3HDTA 3D31A 1RWBA 1PJRA 1H2AS 2IZ6A 5AVZA 1S0NA 2EQYA 3UMFA 2O9JA 4QUJA 3LHDA 1L4HA 3UBTA 4C7YA 4DLTA 4IDFA 1T8TA 3KTAB 2VYVD 1TZKA 3MQ2A 4DREA 3HVIA 1D7AA 1W0JA 4O2AB 3GRFA 1E3WA 1I2CA 3SDZA 1N2CE 3I3SR 4YUZA 2HBYA 2X42A 1O03A 5K3EA 4WTOA 4CEIB 2JEOA 4D9IA 5HDBB 1NUPA 3KTFA 3E58A 3ROQA 3TLJA 2C8LA 2QT0A 2ZAIA 3WHPA 4HNVA 3O4RA 2F1RA 3TRDA 1XTKA 4GKKB 1Z0UA 2B8NA 1T6ZA 3E61A 3ZDYB 5H2FU 1QGUB 1G60A 2F59A 2CHGA 1OOEA 4JBNA 4Y1GA 5EJEA 1HEKA 1ETUA 4NBUA 4DSFA 3H8JA 3AFOA 4AXXA 4R8VA 3S8YA 4R3WA 5D00A 2HSWA 1FU4A 3OD1A 2OHOA 3QPDA 1QO0A 4LVCA 3WBKA 4KX5A 1IN1A 2BMVA 3E4CA 4OI1A 2JLCA 4MVJH 5LQSA 4KO4S 1QQ5A 4L5YA 1DKOA 5JD5A 4L72A 1T36B 3HKEA 3NRJA 1M6VB 2ZSIA 3ZIUA 4P6VF 1XTQA 3HDJA 1ZN2A 2QL6A 3N8NA 4RJTA 4G36A 1DKUA 3H11A 3PSTA 1E1MA 2GUGA 3G6VA 1GQSA 3IYLW 2W2LA 2V7GA 2RH4A 1MQAA 3WJAA 2Q5OA 4K5QA 5IJZA 4KN7A 4DGSA 2NUPB 4KZPA 3ZE2B 2ILTA 3ULKA 3OPYB 3BB4A 1NR5A 4LFCB 2I3GA 3UWDA 1L5LA 2CFIA 4JMPA 1JEQB 3VSEA 3IHTA 4FZ5A 1ZOPA 2JAUA 2WZBA 4P54A 4P5DA 3BXZA 4CN8A 4WDRA 4F56A 5DX0A 3BMNB 5H80A 5EXXA 4IV5A 3C43A 1FS6A 5EMMA 1PNVA 2Y0PA 1JJ7A 3HWX1 5FUQA 3LY9A 5IKEA 4B3FX 2W03A 1UKBA 3VBCA 4B9EA 2V7XA 1HSZA 5DPMA 4FQ8A 2H2GA 5K4AA 2NPFA 1LNQA 3C3AA 1QLHA 5ELLA 2ASVA 1RHUA 3JZIA 2ZJZA 4KMUA 2GEVA 3H1FA 2EIHA 1GO2A 4YALA 4F5QA 3IVAA 4DQIA 5FFNA 5HGXA 3EZ2A 1JQKA 4WOBA 1CFJA 3GZ4A 1MVNA 1E1DA 3LUKA 3E1GA 2XOKA 5L3VA 2Q5EA 5CMLA 1CUWA 1NFRA 2B6HA 4IDBA 3IQEA 3IPAA 5D01A 1CCWA 5BSUA 3CH7A 5AHXA 3PQCA 4MB0A 4ECEA 4M1TA 3GV8B 5ED0A 3G8YA 5IJ9A 3ZCPA 4D3ZA 3GJ4A 1SVLA 5A3VA 1TF2A 4UATA 1HDRA 1Z8HA 1OYWA 4QYMA 5H4HA 3VAYA 1U6KA 4J9KA 1R8YA 3MTBA 2OESA 5KYWB 2I2BA 3PI7A 3LOQA 2RBEA 2HQ1A 3LJKA 4O2RA 3QXJA 4Y9TA 2YWJA 2D8MA 3KP1A 5DLFA 1ZN7A 1GIAA 4ZIRB 2QAGC 3FSGA 2Q5LA 3ZW7A 5MDHA 1S96A 2EP8A 2J5RA 3EPLA 3EQ9A 1WCWA 4U2EA 3LTNC 4B6FA 3UQ0A 3DE2X 2VLBA 4R83A 4MRNA 4OIMA 2KZZA 5F3RA 2VPTA 3PUIA 2DAPA 2XLCA 2ZCVA 1MJFA 2QRPA 3MLAA 1MN8A 3PX0A 3ZV4A 1F2DA 2JGRA 4K87A 1NX6A 2Q45A 5GJVC 1KDPA 3Q12A 1OAAA 2IUFA 1A9ZA 1DNPA 4Q48A 3T7DA 2GTHA 4EEYA 4R1PA 4NCAA 2C31A 3FCYA 3UJAA 1DC8A 2NX2A 2VHZA 5BWOA 3KHHA 2Q6IA 3UGKA 5HIAA 1EGHA 1D1SA 5TPWA 2JHGA 4UTVA 4KITB 3ZLJA 1L4GA 4B2PA 1SB9A 1MC8A 2PKEA 3EXEB 4J0GA 1U8AA 4M0CA 3KDPA 2HHVA 2BR4A 1RAGA 1G8KA 3C5GA 1P9NA 4LSWA 2CUTA 2CMHA 2NV2B 1AHNA 5I8ZA 1NXQA 4LNAA 3TTWA 4YFKA 1TIKA 4AYBF 1JU9A 4GWGA 3AI1A 1Y4DE 4I5GA 1Q22A 4CNBA 4J16C 4Q8EA 3PHJA 4NEQA 4TUYB 1M1NB 1FFSA 1DXHA 1L5FA 4P98A 1L7MA 1S97A 3CBQA 3EY9A 4JI6B 2JAQA 2VRNA 1ML3A 1GNPA 3A3PA 1L3BA 3IMCA 4YRQA 1YFLA 5DTIA 5DB6A 5BN4A 4ECWA 4LSZA 1CULC 4EVIA 5F2OA 3K75D 5H3LA 2PV0A 3NWEA 3N0RA 4JK1A 1QJ4A 1T9ZA 1Z15A 6GPBA 1WTAA 3LWLA 1ZDMA 4Q3CA 4BO1A 2XTMA 4K2AA 2FW6A 4LDZA 2PQ0A 4Q7KA 1XMQB 3KPWA 3HVUA 1F0NA 3LH5A 2QUHA 4A8TA 2K6GA 2YRWA 1DRUA 2VQDA 4JUDX 2LCFA 4L2IA 1H8ED 5JCZA 1TU3A 2IL1A 1N6KA 5F9HA 1ECBA 4B6PA 3OQJA 3R24A 2YFKA 1M6NA 2VSQA 1SN7A 3U6BA 3VPDA 3TLZA 1R4NA 5JZ9A 4X65B 3ZOKA 5KVCA 3TX6A 2N3ZA 2F1KA 1NJWA 1JZTA 4HQ6A 2OAQ1 1EB8A 3L82B 3V7NA 2VVTA 4GGMX 1XSEA 5HJEA 4KIWA 4R5HA 1LSOA 5JJCA 2IHUA 4B3TB 1QYXA 1NLMA 3HYRA 5D6OA 1C30B 5FLYA 1GXSA 3VDXA 4LZWA 1O96A 3UM9A 1ZQKA 5FCDA 4CLDA 2AT1A 5TPZA 1TX4B 2QJFA 4TTVA 5CRXA 2CZCA 1UP4A 4NHOA 3CXRA 4OQFA 5JMWA 1M1ZA 1NRIA 4MDYA 3OPVA 4F4UA 2FOIA 3DXZA 3I9NA 3TI9A 4FNAA 2XIDA 4RSMA 4I2VA 3LBYA 1G1AA 1QUEA 2JKZA 4E07A 1Z19A 1PR5A 2WG0A 4MF2A 3A9TA 1T2FA 1QC5B 4DF8A 2KJ9A 5EUCA 1A0OA 3LHFA 1F2VA 5JSUA 4CKXA 1QM5A 4BX8A 2BCUA 3S0JA 1FXSA 1BEEA 1Z0IA 5BN5B 2X9VA 4V0QA 3ZKWA 3PXCX 3PD0A 4K6FA 1LBIA 5DEIA 4KQKA 2DERA 1JAYA 1JHQA 3HFGA 3LAWA 2VJDA 4OGKA 4GXQA 4EO7A 4IRCA 2WIGA 1MW8X 3HGTA 3M4YA 2JIOA 4B09A 5JEEA 1AKEA 1AURA 2H5IA 2BKUA 2GVDC 1KJIA 3TG8A 1JKIA 5GADl 1VMEA 5FORA 3AHEA 5MN6A 2Z5GA 1JIXA 1HYHA 3DPUA 1CS4C 2GETA 1ZEJA 1QZ3A 2O8VA 4QM7A 4CT4B 3RF7A 4M8NE 4G0OA 1KR2A 1G64A 1BMDA 3W6PA 1VJCA 3FCXA 4ZT6A 4Q66C 4YEDA 4MJ3A 3DD1A 3TCKA 1V5FA 4X3OA 5EJ2A 1DSSG 4MKZA 4KO8A 2QUJA 1F8UA 5HKLA 5LJIA 10MHA 4BGEA 3OKPA 4HX5A 4XASA 5ALNA 3HXTA 5IN5A 1N3IA 3ZTYA 1LX6A 4L8FA 1MSWD 2QN7A 1FFVA 4XYGA 3E9EA 4JC5A 1MABA 4C8KA 1A4IA 2PPVA 3GA5A 4MEJA 1BH6A 3H11B 4PHDA 4JITA 3RUAA 2FG6C 1YD7A 2JASA 5FWXB 4RULA 1VRCA 3RTGA 3LD9A 4LFBB 4HZIA 1DAHA 1YOVB 4WXRA 1FLVA 4BXOA 1JAIA 3JS5A 1X1BA 4RNOA 5D6NA 1UKAA 3ERCA 1Y9AA 4DBLE 2CNOA 3HJNA 2VWPA 1COOA 3OJUA 1SKQA 2JIPA 3QVMA 4TLEA 3CLSD 1N4DA 2W6JD 4JLPA 1R4MB 3WGGA 3X1WA 1YOBA 3TZEA 3E81A 1HT3A 2I87A 4R1QA 2PUEA 1VLMA 4NAHA 2IHTA 3QIAA 1A2OA 3N5KA 4N54A 2COEA 2UZ0A 3UJHA 3VSDA 3U62A 2DGZA 2ZUWA 3EB9A 4OGFA 4N47A 3X1MA 4MO2A 2RBKA 2UKDA 5FI3A 3FGOA 4Y2QA 2PYZA 2XE8A 4BQQA 2HCRA 2O8FA 3C6YA 1TAMA 3SIRA 1P4RA 1ZOOA 1VE6A 5M3BA 5IJ9B 4F7DA 1Z88A 3DEZA 1P19A 4YJHA 1EFVA 2JCVA 2UUCB 4YMTA 2A88A 2OD2A 4EW3A 2WIDA 3QLUC 1RSZA 4LNHA 3CEMA 3B1VA 1YCFA 4DMKA 2WABA 2B7BA 4N41A 1OI4A 1RHRA 1R64A 1XLUA 4KFTA 2EW8A 4LQLA 1YU9A 2WHEA 4BNTA 2B6NA 5EWLB 3LUHA 2GEKA 2B34A 4CLRA 1H0RA 1O9HA 3OX3A 4EEXA 1I13A 3A9UA 5CPFA 2GF2A 4FS8A 3F47A 3D4NA 5KFZA 4S0ZA 4YT5A 2BFAA 4DT1B 4DQKA 5KO2A 5K2MA 4UB6U 3REQB 3QJGA 4PGFA 3C2MA 3L7IA 4DWJA 1EZ4A 3AVWA 4BJHB 3LP6A 3KE8A 4FZ3A 2PNJA 2AN5A 3PW4A 5A3QA 2BZGA 4LNUA 4OTZA 1WOMA 3SK0A 3NX4A 3W90A 4UUOA 3ZJYA 2QBYB 4D5GA 4PYIA 2HHCA 3RVLA 4QLOA 1Z36A 5BYBA 2Z5VA 5KC8A 4TKMA 4QJFB 3DG9A 5U4QA 7ADHA 4MRRA 4EGSA 4CG1A 3MXOA 2HJHA 2WY2D 5E4TA 2O50A 2P9HA 5ALTA 1ZI6A 5KT5A 2OMKA 3KUXA 2CXXA 1Z4JA 1SUSA 1ZCBA 2OV8A 5BV8A 1BD4A 4ENQA 7REQA 2FUG1 1PFWA 1ZQTA 1ZA1A 1N2XA 5E7MA 2QTFA 3KYBA 1T3TA 2IFTA 4F4XA 1BMFD 1PCXA 3RTVA 2YVKA 5A04A 3NGXA 5K0CA 4WCFB 4RF4A 3MJEA 5JATA 4PY2A 4XB1A 1F3LA 1TF5A 2NSHA 1ZM4A 4D96A 1GSHA 3QEKA 3VX3A 2O7NA 1EP3B 4NDNE 4XB6B 4FZNA 2KWIA 4N7BA 2IZZA 1Q0SA 3R0IA 3EUWA 2P69A 5JZOA 1GYRA 5AW5A 2YWBA 4L2IB 5DKFA 4X44A 4HWTA 4YQYA 1G6Q1 4XQ0A 2KS6A 3RUDA 1ZI8A 2FPMA 2AXTU 1T6BY 5CJ7A 2HC9A 3EZ9A 3FG9A 5KDDA 4WLVA 4ZDWA 3KB8A 1P4AA 4RV9A 1HUOA 2N46A 1B8VA 1H5UA 2GRJA 4ALMA 2ZIXB 2C59A 3IAEA 3UH1A 4ITRC 3BCRA 3GARA 3E0XA 4RPZA 3PGJA 1BDIA 2W6JA 4OHMA 5DTRA 2CUNA 4LYEA 4DMHA 3JPOA 4Y18A 4XFKA 2FUCA 1DQZA 9ICUA 5C5EA 2H4HA 4PZCA 1C1XA 3R76A 5KB3A 2VZ9A 3Q8RB 1FSZA 3KLPX 4DB4A 2SCUB 1SBYA 1CTQA 5IAKA 1H5NA 1LVUA 4QRDA 1GTZA 1YS4A 3FHOA 3D6MA 4RM2A 1N4AA 3PQDA 4MFAA 2HBJA 1VG8A 4J9MA 3ZVNA 1KFKB 2PKWA 1OX5A 4M8KA 4LRTB 1IY8A 2Y1IA 2AJCA 1U2GC 2ZIVB 2ATXA 4HRYA 2P2NA 3E15A 4DM4A 1V6CA 4Z0HO 1IK6A 3KKLA 4B9AA 4EKGA 9ICNA 4A36A 5J2UB 1CY1A 4F3KA 4OQEA 4N82A 5A6SB 3DUFB 3AIMA 1H2XA 3LVRE 4U6NA 3IV7A 2G5HB 1E0JA 5ITZB 2DFDA 2GARA 4DDTA 5B58T 3DDSA 4QDUA 3PITA 3W8EA 4UBIA 3C2KA 3A9WA 2CSUA 2LYAA 5KFLA 3PRJA 3CR3C 1N8NA 3SVZA 2C3PA 1GAXA 4CFZA 1C41A 1GV0A 3FVWA 4AZSA 1JHVA 3VR5A 1IYZA 1VSUA 4JBYA 1WB5A 5CT4A 1WE2A 3G02A 1C4WA 4Q1VA 3N2GA 3LDGA 1ZK0A 3IGFA 1D6NA 5JCOA 4KMOA 4BMPB 5L6MB 4OBEA 1NSTA 1UP6A 2J9YB 3I45A 2FZ5A 1Q1BA 5HOEA 3JPQA 1PR6A 4A23A 4FB5A 5JMOA 3AEXA 2QG4A 1R15A 1YS2X 2WJWA 1ZQVA 4EYGA 3EXG1 8ICCA 3GDOA 4AURA 4M87A 3FWPA 2CL5A 2JLBA 3GZJA 2P0AA 4MGIR 2C9BA 3A1SA 1YA4A 1G5TA 1N2GA 4GOLD 3G0DA 5GVRA 2A3NA 3EBPA 2JH7A 1M0SA 1UPAA 5TVGA 3IV9A 1A9TA 1H69A 3UCFA 4BX9A 2PS9A 4ARVA 3ZDCA