2CN1A

Crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)(casp target)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cn1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2cn1A01
2HOQA 2ZBGA 1LVHA 2JGAA 3AR7A 3RF6A 1YV9A 1PW5A 4O8CA 4Y2TA 1ZD2P 2YFYA 2B82A 3RFUA 3KDPA 3WGVA 3A1EA 2FPRA 3ZX4A 2C8LA 1Z4IA 3MPOA 3QU9A 3KOOA 3U26A 2FEAA 3WK4A 4AS2A 1EK2A 4CE6A 3R09A 3A3YA 3QU7A 3FM9A 4YCNA 2YMLA 2YMPA 4KNVA 4KNWA 3R9KA 3ESRA 2C88A 3ZVMA 5IT4A 5ALDA 1Z4OA 3R4CA 1U7OA 3FGOA 3PCTA 2YMMA 1TE2A 3B9RA 2RB5A 1RPZA 4C4RA 5AHXA 4DWOA 3N1UA 1RLOA 3TLMA 3QGMA 4BX3A 3HYCA 4G63A 4UMFA 4ZEVA 4HYTA 1Z4KA 4XPZA 2I34A 2G08A 1U7PA 3KZXA 3OTQA 3GYGA 3W5BA 3E84A 1SWWA 2IOFK 1RKUA 4YCLA 1RMTA 2RBKA 4UAVA 2FPSA 1ZD5A 2DQSA 2ZG6A 5ALGA 2P9JA 3FVVA 2WF8A 2GHQA 3OPXA 1XPJA 2FDRA 3L0BA 4NWIA 3AR9A 1ZRNA 4Y2RA 4UU1A 4Y2JA 2YJ3A 3L8GA 1Q92A 5AW1A 3ZVNA 3WKCA 2AUTA 2I6XA 2YJ5A 3BA6A 3KBBA 1Z4QA 3ZTWA 1Z88A 1ZJJA 5AVQA 2W11A 3WK6A 4E88A 1JUDA 4YGYA 5AW9A 1RMYA 3FPBA 4OD0A 3UM9A 3ET5A 5AVVA 4KN8A 3M9LA 5AVSA 3ZW7A 3DDHA 2P69A 5AM0A 3ZX5A 3MMZA 2MU1A 4Y2QA 3FZQA 3P96A 5AVZA 2JAOA 1RC8A 2HHLA 1S8OA 3NUQA 4Y2XA 1YJ5A 2I33A 3QLEA 4Y2YA 2JARA 3DV9A 5ALUA 3QU5A 4HGNA 3OCXA 4BNDA 3E81A 5ALKA 1QQ7A 3CZ4A 5ALOA 4BX0A 4RESA 3WK8A 5AVWA 4I9FA 2NO4A 4KX5A 3PGLA 4JB3A 3F9RA 3L7YA 2D2VA 2HF2A 3U7HB 5AVUA 3ESQA 3I28A 3ZWKA 1YDFA 2ZOSA 4UW9A 1T5TA 1ZD4A 4Y2SA 1S2OA 2FPXA 2O2XA 3SKYA 2GHTA 1T9ZA 4HGQA 3L8HA 4G9BA 1TJ5A 1YMQA 4BEVA 3B9BA 3M1YA 1XP5A 3SF0A 1AQ6A 3EF1A 4NABA 5ALXA 3BWVA 2I54A 2MSNA 1Z4MA 4QJBA 3QU4A 3MC1A 3W5CA 3W5DA 3L1VA 3ED5A 2YN4A 1N8NA 1YNSA 1Z4LA 3ZTYA 4GXTA 2IA5A 5AW7A 5AKLA 2FPUA 5A3SA 2R8EA 1L8OA 4UAUA 1L7MA 3SD7A 1XVIA 2GFHA 5AK5A 3AR8A 4BKMA 1MH9A 1LTQA 1NF2A 3OCWA 4PNHA 3EF0A 1QYIA 3WKBA 4UASA 1VJRA 3PDWA 5AM5A 4UARA 3OCYA 4CNQA 3NIWA 5JJBA 3E58A 4I9GA 3WKDA 3OCUA 3PGVA 3I1YA 5AIBA 3L8EA 3L0YA 5AI0A 1WPGA 2PR7A 1RDFA 2W43A 2BY4A 2G06A 1RLTA 2B0CA 3I76A 3ZVLA 5AW2A 3WK7A 5ALLA 3ET4A 2PKEA 4JDPA 2G07A 5AI8A 2O9JA 3QUTA 1RMQA 1L6RA 4OHFA 5AM1A 4F72A 2VKQA 3NAMA 3QX7A 1RQLA 4HAIA 1U2SA 5ALJA 2YMQA 5A3QA 3WK9A 2BDEA 3U19A 1SU4A 1U2TA 3KD3A 2ZBEA 2C8KA 3N5KA 2FI1A 3NASA 2HX1A 4UU0A 2EAUA 2NYVA 3CNHA 4XE5A 5AK6A 4CF3A 2I55A 5ALRA 4AS3A 1NRWA 1TA0A 4L57A 1L7OA 5FP0A 3DAOA 5ALSA 5A3RA 2RAVA 4UM5A 5AICA 3I6BA 4UMVA 4C4SA 4DW8A 1O08A 5AKEA 5AM4A 4L6AA 3A1CA 4BBJA 2BDUA 2YY6A 4Y2VA 4NFLA 4H1WA 3QUQA 2WF9A 3QXGA 2B8EA 5AESA 2HF7A 2P11A 5AKGA 3N8GA 2WF7A 2B1RA 4HGRA 5AI6A 5AVYA 3QUBA 4YCMA 1Z5GA 1IWOA 4BNDB 3L5KA 2OA0A 3HLTA 3QU2A 2R8XA 2IOFA 4DFDA 1CQZA 2R8YA 4J03A 2C4NA 2P27A 2HEGA 2GO7A 5ALFA 5ALIA 4YIHA 1RQNA 2IYEA 1T5SA 1WZCA 3E8MA 5AKKA 2JAUA 2C9MA 1K1EA 3FPSA 1X42A 2WFAA 1J97A 1TJ4A 2Q4TA 4KX3A 4C4TA 3K1ZA 3SLRA 4YIKA 2WM8A 2NO5A 3L0CA 4GIBA 3N28A 5AK3A 3N07A 1FEZA 1RLMA 4QQFA 1ZOLA 1Z4JA 1ZS9A 2AMYA 1N9KA 2ZBFA 4Y2PA 2JAWA 5AW8A 3UMBA 5AM3A 1QQ5A 3SMVA 4L6CA 1RRCA 5ALZA 4CF4A 4F71A 5AW3A 1QH9A 2OYCA 5AI5A 5AVRA 1CR6A 4BYGA 3A1DA 3SKXA 3VAYA 1NNLA 5AK4A 5ALHA 4NV0A 2PQ0A 4B6JA 3IB6A 5T41A 4DCCA 5ALPA 4EZEA 2WHEA 4EEKA 1WVIA 2CN1A 1Q91A 1VFPA 1J8DA 2B1QA 3NALA 4UATA 1Z4NA 5ALWA 3AR6A 4MWOA 4HGOA 5ALTA 2FUCA 2G09A 2IOHA 2OBBA 5E0OA 1SWVA 1U02A 3IJ5A 5AVXA 1VJ5A 5AKJA 4CF5A 3EPRA 5IS2A 2EARA 5AKHA 2GMWA 3U7GA 1Y8AA 4XQ0A 3ONNA 4IFTA 4AP9A 3D6JA 3U7FB 3QUCA 4Y3UA 1KYTA 3QYPA 5AKYA 3NANA 4UMDA 3SHQA 4OCZA 3S6JA 1F5SA 3WKAA 2I7DA 5ALNA 1YS9A 4EX7A 5AI9A 1RKVA 3ZUPA 4HGPA 4FYPA 3WK5A 3KC2A 3MN1A 2ODAA 5IT0A 1L7PA 2G0AA 5AI4A 1Z5UA 4MUMA 3UMCA 5AM2A 4IG4A 2EATA 2X4DA 5ALMA 3U13A 4ZEXA 1ZRMA 5AVTA 2OM6A 2CFRA 2YJ4A 5ALYA 4Y2UA 2HDOA 3ZU6A 2FUEA 3ZWDA 4ZEWA 3NRJA 5AKXA 5AW4A 1RKQA 4NAVA 1Z4PX 2CFSA 4J2TA 5ALVA 1ZD3A 1L8LA 5ALEA 2WF6A 2CFTA 1WR8A 3U7EB 2QYHA 1L7NA 2W4MA 5AW0A 4XOUA 3QNMA 4EELA 3AR3A 3AR4A 1QQ6A 4OFZA 4EENA 3J7TA 2RARA 3WGUA 2AH5A 5AKZA 2HI0A 2QLTA 3L1UA 5AW6A 1EK1A 5ALQA 4EX6A 3DNPA 3AR5A 2B30A 2B8JA 3OCVA 3OCZA 5AW5A 2HCFA 3W5AA 2AGVA 4YH1A 2WF5A 2ZBDA 3AR2A 4UMEA 1O03A 2HSZA 2YJ6A 3L8FA 3WKEA 4RETA 2R8ZA 4UM7A 3EWIA 4BX2A 2Q5EA 4FFDA 2FPWA 5AKIA 2G80A 3B8EA 5AIAA 4KYTA 2ZXEA 3IRUA 2Q4RA 2YBDA 2G1AA 3UMGA 4FE3A 2HO4A 3ZI4A 1TJ3A 4BEWA
chains in the Genus database with same CATH superfamily
4TTRA 1BGXT 2H4HA 1LVHA 4J7CA 3WYEA 9ABPA 2JBHA 2P9FA 5TMEA 1KSGA 1T5DX 1IM2A 3ETJA 2PNFA 1VB5A 4LGMA 4AY6A 3SSMA 2JEZA 3N87A 4JGIA 4FMCB 1XZDA 3Q8XB 4X90A 1U0FA 4YMWA 2O8NA 3PT5A 3RFUA 3KL2A 5HIAA 1JI0A 3FUTA 1KO1A 4QUIA 3AQFA 3A6LA 3AHCA 3KOOA 1V37A 1RKXA 2IW1A 1QK4A 3FX2A 3KSRA 1VBFA 3LJKA 3QBEA 4IKPA 1YH3A 3RJIA 5J2UA 3PL5A 4M8NE 1LGYA 1UODA 2OWDA 4JVMA 4DM7A 5IXJA 5JXIA 2UXBB 4UTOA 3HT3A 1RABA 1ACMA 1BS1A 3H7IA 4G0ZA 2R8GA 2ZB4A 2H4YA 5EUQB 3UTCA 4C7BA 4Z4HA 4YVZA 4MGYR 5K01A 1G8MA 3U1BA 1RAFA 3OVMA 2L19A 4LE0A 1J1ZA 2YWCA 4G5HA 1X19A 5INTA 4GR4A 2ZB7A 1HUZA 2H1CA 7ICHA 1U65A 2F3TA 1K8YB 3C3WA 3FCSB 3KL4A 4YO8A 1MDBA 2K87A 4R7GA 3S2EA 3KG2A 4E5SA 2LDXA 5JJLA 3Q5GA 4CEHB 1U7OA 2ZE5A 3OFJA 2VWHA 2NYRA 4HAOA 1KQ3A 4L0DA 4DDUA 5LMCA 5DE3A 4LHZA 1TE2A 3HYLA 3LSTA 2JEYA 2PD3A 4YV1A 2G28A 3AUTA 3BMCA 3LD9A 3LI2A 4N01A 2P2CA 3D6NB 3FPCA 1AKVA 3Q3IA 5DX0A 2ZUDA 4P33A 2QV7A 1SBZA 4G63A 4UPDA 4MS1A 3HU2A 3GGPA 2XF8A 5J2JA 1I4TD 4HYTA 2Z2YA 2W98A 4RY9A 3KT3A 2YCBA 1UMDA 2ZTDA 1W9MA 1OYWA 1KZ1A 4MV6A 3WWCA 2J9GA 4EQ6A 1MUUA 4Y2HA 3V7LA 2Y1OA 3UFBA 3VJMA 5BRJA 2IOFK 2E3JA 1T0PA 1UBJS 4DC9A 2ZAOA 4M9XA 4YUVA 1YZ3A 1JDBB 4Q16A 3M4YA 2CY0A 5DI3B 1P18A 2FPSA 3HVJA 3G5TA 3GOQA 3RRJA 1ODKA 1GR0A 2R8BA 4JITA 2LIVA 3C2KA 4J6EA 2PT7A 2PJRA 2HDHA 4JUAA 4PC7A 5IF9A 3TIFA 4C0JA 1QLWA 4Y2JA 4LW8A 4HMPA 4PLWA 1J0XO 1JBKA 1RXSA 5LQAA 4IPTA 1JU9A 1QRAA 1XZFA 3L7IA 1RSZA 1XDGA 2AVNA 2P78A 2XKAA 3EWSA 1WW2A 4ED0A 2L18A 2QRNA 3NHRA 3P19A 4HUQB 4ILEA 3LTEA 3ZCXA 2LTAA 3CH6A 1YVEI 5ANRB 4DMUB 5DDYA 3BJEA 4R81A 4Z9XA 1M75A 3U44B 4KLDA 2QRLA 3G2JA 1RMYA 2OXFA 3EZNA 4OB7A 4DSUA 4EFDA 3KB8A 4LOHA 2UU9B 5B7QA 4BJHB 1HM5A 2A78A 3C5CA 3JR3A 4GXJA 4PXYA 3UICA 1CJMA 1EMDA 1V3VA 3ZQKA 1BX1A 4R40A 3T5HA 4LVNA 4EMBA 1FSZA 3BERA 5JV5A 1SC4A 1S9FA 5ESWA 4X62B 3TVTA 1ZLYA 1AXEA 2YWGA 2ZIEA 5CNMA 4ZI2A 4IQTA 3MMZA 4P4SB 4UHBA 2D74A 3DBIA 1RC8A 1QH1A 1KJZA 7ICTA 4ENRA 1JAIA 4W5RA 3UH0A 2G6BA 1U3DA 2GAIA 1YJ5A 1W4BA 1WCNA 3OZSA 3NH6A 3QU5A 2RKWA 4B3IA 4F2HA 4PYMA 3T7RA 1ZXXA 4TQSA 3EH1A 1D7OA 2I80A 2O6HA 5CR0A 4DR6B 4IRKA 1JG2A 3CLTC 3JPSA 2C07A 3E22B 2A3NA 4ID3A 3HJRA 4FNOA 3E9YA 3H13A 4IQFA 4RDCA 4D1YA 4K9MA 5AVWA 3HJEA 3OTGA 3KZMA 5E9JA 4B35A 1RXCA 1QGYA 1EXVA 1OW5A 4PL2A 1D9FA 1E4VA 4RGBA 1U8YA 2D2VA 3AXSA 3P71T 5FOSA 3I2YX 5JCOC 3VNUA 1X8LA 4JOQA 1ZBDA 4C01A 2SCUA 5EP3A 2ODBA 4UW9A 2ZOSA 5IKOA 1ZD4A 3DE5X 4E07A 4F3NA 2FPXA 3LV8A 3KR0A 4CV1A 3C43A 5F76A 2I2CA 4UULA 3GLQA 4DT1A 5CYPA 2BKUA 5ED0A 4I4CA 3G6YA 4OSPA 3QKUA 3IP4B 1EWQA 1NK0A 1YK1A 1XSEA 1XV5A 1UBRS 4FEYA 2WIKA 1ZSNA 3CGGA 5CG1A 2XTAA 3WRVA 4BL5A 4R54A 4YJGA 2F3SA 2Z9CA 4Q00A 2OLEA 1N6KA 3HVKA 2FJ0A 2C2KA 1T4CA 3DFFA 4UMFA 3VPHA 3WADA 4JI0B 2CHFA 4URVR 2D5BA 3EUAA 4OGKA 2A9FA 1JRLA 4RQTA 3OURA 4W5OA 2ARKA 3TTSA 4LGCA 4RMNA 1Y48E 4GXTA 2Q0XA 4HPWA 3U9TA 1PNQA 4LYFA 3ZC3A 3DFKA 5GJCA 4RV5A 1IBLB 2HWUA 4M88A 1YZGA 2CK3D 3MFQA 1QG2A 4MIYA 4TN5A 4IRUB 3PC4A 2AEMA 4WLNA 4CMGA 1G7RA 1FFHA 1X1DA 2WG2A 1PV2A 3AR8A 5G3ZA 1MGOA 1MH9A 8ICUA 2HWXA 3FYHA 13PKA 3C8ZA 3E82A 4IBOA 3RC7A 4CV2A 4TYNA 1QFJA 1BEUB 2V6GA 2P1ZA 5DBEX 4DBLC 1X14A 1HURA 4GMDA 1RM4A 5BQXA 2IP1A 4CNQA 3DNMA 1ODFA 1W1WA 2Z83A 1M2JA 3BB4A 4QULA 4TQAA 3EE6A 2GDZA 2VAMA 3CNBA 5LA6A 2W2KB 1KE2A 1XTPA 1SB9A 3EDCA 2PGJA 4OAQA 1B4DA 3SI8A 4QFBA 1N5WA 5BNZA 3GK3A 4PSCA 2KG5A 1BXGB 3WB2A 4P4TA 2H3ZA 1DBWA 1SK9A 4DABA 2Q3CA 1DAKA 1EXMA 3AF0A 2AGPA 1M9NA 3MAJA 2VR1A 4PPQA 5JW6A 5K8TA 2IU3A 2WYHA 3D7SA 4ETIA 4P4GA 2OO7A 4IO1A 5KG3A 4BRWA 4EIWA 2CXXA 4TV9B 3ICOA 5DSZA 4BE9A 3KHKA 2XT9A 1QJ4A 1JIXA 2JHAA 2VHEA 5A71A 4F4UA 1NFFA 4CIDA 5B1EA 4EKDA 4ZCMA 1WY5A 3LGXA 1H0RA 1CRPA 4IMIB 2PRSA 3L05A 2FRDC 5FV7A 3W2EA 3G1UA 1GTVA 1Z3IX 2XCLA 3NEAA 2HLNA 4ND2A 4NMMA 4QEKA 2KN7A 4U2EA 5AOBA 3TYXA 4Y9RA 2ZZMA 3FYDA 4O5AA 1A69A 1P2SA 1L5WA 4RV4A 4TWRA 2P0EA 3PEWA 2W7TA 3EXHB 3U3XA 2Q3FA 3BFJA 5BVGB 4BKQA 1G5QA 1ZZGA 2H06A 4WZAE 3LYUA 3P9PA 1GPKA 4BNHA 1NRIA 1I24A 1GYQA 2NU6B 3VR6D 1TCBA 2HRQA 3D0QA 3IAXA 3N8HA 4FBLA 3EISA 2DU8A 3PPVA 3IPAA 1F4LA 3OE1A 3D8BA 4UM5A 3VR2A 1XBTA 2LWIA 3E5HA 5JZOA 3ONFA 3FUUA 2A30A 2CDRA 1J9ZA 1CULC 3WAJA 4O4IB 5AXDA 3ZNQA 4A8TA 1KN5A 1Q6ZA 2CUKA 4YCDA 1O08A 1N7JA 3HADA 1FFAA 3WNZA 5L1LA 4RW0A 1U1CA 2Q41A 2VP0A 1FP1D 2WP8J 1QO0A 4KLNA 4CKEB 4BBJA 3NHFA 4MPJA 4URZR 2Q6OA 4WECA 1J1UA 4I1IA 2IITA 1OHHA 4LQDA 1XZHA 2XWJI 4R16A 1SPXA 2BEVB 2Y1IA 5IIOA 3MTBA 3HN6A 4CDRA 2R6ZA 1HDXA 2WJ3A 1ZMRA 2B1RA 3EVAA 2VHYA 2I6QA 2P4UA 5KJ6A 4DFKA 4YCMA 2PKRA 1B14A 2AFHA 3VR0A 3WB0A 2ZPAA 4KXWA 2QARB 2BMVA 1M8JA 5BNTA 4OHRA 1L3CA 2JHFA 3HLTA 4Q3OA 4WOCA 1EYZA 1I13A 4L5CA 4P93A 2DBZA 2VCEA 1T9HA 2I1LA 1DZ3A 1UOEA 1CQZA 3JZDA 4GECA 1EVJA 1ZQLA 1BXRB 3AEUA 4DJJA 1KJYA 1ECCA 4WRRA 3DL2A 5KIAA 3EODA 1RCUA 5EXTA 2YQZA 4FYVA 3W8NA 3FLMA 4Z9FA 1SHLA 4R41A 1JI7A 2Q46A 2H5IA 1FW8A 3OD1A 5CURA 1Z6QA 4GXIA 4RPYA 5EL0A 2XC9A 3NHJA 4RCVA 3ABIA 3VM6A 2B21A 5BT8A 4DEVA 1NVWQ 5JHGB 3AKYA 4WAUA 1QE5A 4QUEA 1U2RA 3JXEA 3BZCA 1P8JA 1WYGA 1E2JA 1UIMA 1S0NA 1ZL0A 4NIMA 3DFZA 4DLSA 4QUDA 4HD8A 1E1DA 4I1OA 2NO6A 3N75A 1T3QA 4KPEC 2WD8A 5E2AA 4ZTBA 2YWHA 4QJIA 4MCAA 3N28A 2IYVA 4LV6A 5CCEA 5CVUA 5LLDA 4OXXA 4LFAB 3D6UA 3ZJ4A 5L4NA 1QXSA 4AKSA 2O1WA 2R66A 1MD9A 2XY7A 1Q0HA 2X9NA 3W9UA 3ZJ5A 1GR1A 5LOVB 4M0AA 1KR5A 5ITZA 3ASUA 1EBUA 1EAMA 4YDHB 4P83A 5AW8A 1B93A 1IL0A 4I3HA 1DHTA 4BTEA 2KBFA 2QENA 1U3VA 3EBPA 5LUAA 1TKDA 1RWBA 5ALZA 1A97A 4WX2B 5JD5A 3L7BA 4CIBA 1QH9A 1GG5A 3GV0A 3T41A 1QHGA 3OF2A 2WINI 4DQXA 1D7AA 4BE7B 2R97A 2WB1C 4HNRA 4NV0A 4L5AA 1R4NB 2Y0SF 2EYUA 1CR4A 1KJ9A 2Q1SA 2REQA 3B6KA 3OIUA 4KYUA 4DCMA 4G37A 5BVHA 2YRWA 2BKXA 1J00A 1X74A 1E5XA 4PZEA 1Y34E 4ZVRA 4PLVA 1DC6A 1JT2A 3R0QA 2IRWA 1AQYA 2UYOA 3JQ6A 4GRIA 5E3JA 5EPUA 4EL5A 5JECA 5KNCA 4NL9A 1XRNA 3CF4A 4I1SA 3DMTA 3G7SA 4QU9A 4PJ0U 2PCJA 2ZWMA 3GT0A 1HFWA 1MC1A 3UJNA 5CCBA 1LI4A 3N97B 5BN4A 5IKXA 4HJRA 5JI2E 1O6FA 3E4DA 1WS6A 3OEYA 4R8RA 2V74B 1IIBA 3HCCA 3TDMA 1TM3E 3F90A 3IT1A 3QOWA 4FFOA 1ZQNA 1XRQA 4K4IA 1Z9BA 2WYVA 2YWFA 2ZT7A 1JDSA 4GC5A 1UT6A 4MLPA 4PS0A 1WMEA 4Q0MA 3MMNA 3AM4A 3JYHA 3NW9A 3RGWS 3U4HA 3W3ZB 4ZZ0A 4D26A 1E7QA 9MHTA 3CJRA 1QYVA 8ICEA 2Q3HA 4HBZA 2V9WA 4XPIB 1MG0A 1F6DA 2SKDA 1DE0A 4EUHA 4QOJA 3TNYA 4MWTA 1E9SA 2WMYA 5GTDA 4FZMA 3MNFA 2ZUSA 2MR5A 3CYFA 5F3WB 5LNK6 1OWLA 4ALKA 1F5SA 4R1LA 5TE9A 3ZHVA 4IHJF 4FNGA 4KRFA 3ZD8A 4NJOA 4PZCA 2R1ZA 4RFVA 4AC9A 3BL6A 3SYZA 3AVQA 3HRHA 3VGJA 2BYTA 2HJSA 1M0WA 2ZRIA 3JAWB 4U7CA 3BSSA 1GAQA 7GPBA 3FHJA 4R0NA 5F5NA 3EVTA 1E9DA 2Q3DA 3I04M 4P58A 3PEYA 2QNRA 2ATIA 4QUKA 4XB6B 3BXGA 1TT5B 4Z6EA 4Q4CA 1COOA 1K88A 4OLHA 2Q7XA 5T4FA 2X4DA 5FR1A 2H1HA 5FFFA 5FBKA 3EGDB 2R7KA 3R20A 5MN6A 1SQ0A 2DFPA 1NXVA 2CUNA 4H7IA 3WXMA 5ECDA 1DGSA 5PNTA 2BBSA 4B2IA 1X39A 2W6PA 1P5FA 2MSCB 3TLJA 2IZZA 1I2DA 1KGDA 2H9AA 2UYYA 5CLJA 2BT4A 2J41A 4C05A 2XQGA 1YACA 4UNSA 5HQJA 2ZWOA 4DS5A 4MEYA 4I7EA 5IX8A 2RGWA 2J4FA 3UQ0A 3H05A 1U0EA 1MW8X 2CFSA 2E2WA 2BGNA 3VPXA 3GRPA 3ZJUA 4QUGA 3VYRB 3M7DA 2WD9A 4QARA 4A82A 4V1CI 3NH9A 2HQSA 1TA4A 4UOQA 4E30A 1ZGJA 2IZOA 3U5TA 1XNRB 4D81A 4GPBA 4R6WA 1LSUA 4F4YA 4ZARA 4NAHA 1JYSA 4W1PA 721PA 5IJ9A 1JAYA 2ORWA 2YC4C 2YXEA 1BXGA 4RORA 4O4LF 1NP6A 2YN2A 3AR4A 1BS9A 3X44A 4REQB 1NYQA 1G64A 2QZSA 3PX0A 2YYZA 1K8ZB 5DGTA 3UOAB 2JCXA 1UKBA 2CDBA 1H2RS 2GZ3A 2YWJA 1Y7LA 1DWPA 4ED7A 1C8VB 4JB2A 5TXGA 4EA6A 3WOVA 4Q66C 1FTSA 5AW6A 1IXZA 1VLVA 3FRHA 2ZJZA 2ZB3A 1EK6A 4RA9A 4LHSA 4XUGB 1V4BA 4ZKEA 1N62A 3HBAA 1MQSA 3LT1A 3TMAA 3TECE 2B30A 3GGGA 4R05A 2I0FA 3RUPA 2YQ5A 4W4TA 5AD1A 2B36A 3TAHA 4ITUA 1O94D 3NWOA 1IBCA 3TSWA 4X93A 3OCCA 2OZKA 3PEUA 3PR4A 3DPIA 3KUKA 1IOZA 3L4EA 1LJLA 1LUAA 4GMHA 2DWCA 1WKVA 2R8ZA 1K92A 3DFMA 5SY9A 3T3GA 4Q3NA 4I6EA 3I1JA 4LZWA 3VNSA 4ZVOA 5BVGA 5C9ZA 1DS6A 1FYXA 1NR7A 1E3EA 4FGZA 4YRGA 4IINA 3RU3A 1SKYE 5L1KA 1AV7A 1CZHA 4YD1A 1Y6JA 1B8OA 4L8LA 1TQ8A 2YBDA 4P34A 4Q9DA 4B5LA 4M49A 4NPHA 5EEGA 2I8AA 2J0EA 4RT3A 2CHQA 2J6IA 2QI9F 3H75A 4DQRA 2WUWE 1T4CB 2R3SA 2IF0A 1GDDA 1ML3A 2DT8A 2F64A 3A0BU 2P9GA 4N8DA 2JVIA 1XWIA 2VDOB 4NC9A 2Y6VA 1XNQB 5L4LA 4PL1A 1PJ2A 4YK7A 2XXBA 3JYQA 1UBTS 5DWQA 3SN6A 4JBHA 1QIIA 1W34A 1GUZA 2VH2A 3OA2A 4OY3A 5ITWA 2A35A 2P1RA 2HWKA 3L1JA 1TUIA 1ZQ1A 3KDPA 4IWYA 4OXRA 5F3DA 3WGVA 1DWQA 3H8VA 3I6YA 4F96A 3GFBA 4TS4A 1PFYA 3WLIA 1ZUHA 5BV0A 1FBTA 2B4QA 2J6HA 2VCHA 5LFAA 3TRFA 1ELOA 3AL2A 1EVEA 3IA7A 1M73E 3R09A 4R69A 1FMJA 3IOCA 4KGZA 2Z2ZA 4QELA 2FPPB 2OCIA 3GQVA 4BAGA 3SE7A 1QIFA 3O1IC 3VPFA 1AHPA 4W63A 3VVLA 4BKRA 4ZQEA 4RGYA 3VR4H 4YALA 2X9GA 1AZTA 3DV2A 2QB1A 1AS2A 1U49A 4LI0A 3KKOA 3V8MA 1Z7GA 1QIGA 3B6JA 1CP3A 3EW7A 5KX5A 1M74A 5D5QA 5IT4A 1S4QA 2H52A 3GUCA 5J5VA 3CU5A 3MGHA 4AF7A 1FRVA 1SBYA 3DEFA 3WJ1A 3GA0A 1GYPA 4HX2A 3S7ZA 1EJ2A 2BM1A 1QRRA 4IJWA 1E3JA 4IXNA 4S05A 3GZNA 5CAEA 4CRXA 1JH8A 1PFQA 2H1FA 5JC1A 3CN9A 4LHWA 2GEVA 1T3GA 4D82A 1VKHA 4MRRA 2XUZA 1C4WA 4DC0A 3J81A 2IDMA 4WNAB 1SHUX 3RS0A 1J9GA 3RSLA 3L4PA 1X6JA 4RVOA 2JFYA 1CETA 4I8DA 1Y3DE 3I23A 2ERYA 2G7MC 1SRRA 1H2YA 1T6NA 2C8JA 4UZSA 2XNSA 4XB1A 4YCLA 2UYHA 3I62A 5KG2A 2E8MA 2H4ZA 4Z7QB 1HQYE 3MT0A 2FFHA 1NZJA 4GZMA 1PE0A 5CGQB 2ZREA 1C9DB 1KAOA 1WVMA 4XTCS 1SKQA 4F5WA 2Q3BA 3O1JC 1Q84A 2Q2OA 2IZ7A 5AP9A 2FDRA 4R2XA 5J9FA 3CVYA 3IE0A 1G8FA 2C2XA 3AR9A 2X23A 3A6HA 3WSTA 5LOVA 3KB6A 4JI2B 5JXGA 2GCGA 5F2KA 4TTJA 4ZVNA 4B79A 3S3TA 2GN8A 4I2HA 2NVOA 1ML4A 1Z34A 2EOAA 3BAFA 3CIFA 3FCUB 2CWDA 1FS4A 2WJZB 3GFOA 3QA3E 5DMXA 3V4LA 3CRNA 3GRUA 3NHYA 1JW9B 4L4UA 4ZJYA 4EHLA 4CKCA 2WHXA 2NRZA 4BLSA 2OGZA 2Q3MA 2Y4OA 2ASJA 2JH7A 3NVWA 1YCGA 3CWQA 1PJRA 4KFRA 1CDEA 1F1BA 4BVGA 3QFHA 4TURA 4J9KA 3TSZA 1Y6ZA 1KXZA 2C5HA 3DTNA 4OD0A 3FSGD 4INJA 4PPFA 4B0OA 5I5EA 5BOMA 1Y6FA 1QVWA 1Y4UA 3DOCA 1OIWA 3P8ZA 4J9UE 5JQGA 1Z82A 5FFNA 3BHMA 3G6KA 4HX5A 1E2FA 1BCSA 4ZRNA 3U7IA 3UK2A 4MEAA 3PZBA 5AVSA 2FW1A 3JVUA 3QLTA 1TF5A 4BN4A 4ZQHA 2P69A 1RPNA 5KSYA 5HJ2A 4BNVA 3IL2A 3U5ZB 3F7NA 3JPQA 5CVCA 3ZZNA 4B47A 3UMFA 1E64A 3CBQA 3OSNA 3VPSA 4TWAA 2G1JA 1AG9A 1DQSA 3ANLA 4R9SA 5K3FB 1WDMA 2I6SA 3GDGA 3H97A 2BTEA 1ZN2A 3OHAA 4ZCPA 2W58A 1P1HA 2R4UA 1JKMA 3DFIA 3Q98A 3ZCVA 4R68A 1W94A 4QX6A 4C03A 2FH5B 1VJGA 3QY9A 3TOXA 4EL0A 5J3JA 2D1YA 4B32A 1EGMB 1BXRA 3AEUB 3OUZA 4JLAA 4L8GA 4XPIA 4BEBA 4Z7NB 4EDHA 2FDCA 3WE7A 1VPDA 2AJCA 3RRZA 4MMYB 5TQ0A 4KQEA 1NJXA 2QUBA 5IZ4A 1MSWD 2C97A 1O54A 4I2FA 1RRMA 2YYYA 4IVQA 3SKYA 4AQYB 3HCNA 3LUAA 1OIXA 2H9IA 2FPLA 4L4XA 4HT3B 4HGQA 4K1XA 3UPUA 1A04A 2FZ4A 1H6CA 1M1UA 3PQ2A 4JJ6A 3V4RA 3EOBI 5E7MA 4NYIQ 1Z62A 4HZUA 3UHPA 5A6SB 4K9LA 2V65A 3HY6A 4K2AA 3ZV7A 3SPXA 1BX0A 2AZMA 4UDXX 5DLEA 1IYZA 1N34B 3QI2A 2INGX 3JQGB 1Z6TA 1I80A 2RHOA 4A0QA 5ABPA 1WOYA 1S2LA 3WZLA 4BJ3A 1K6XA 4HYYA 3UFXA 2DFTA 3JQFA 4KQIA 3KJIA 4IFEA 3QY0A 2FDXA 2KKPA 4S12A 3PIIA 2OMEA 3D0OA 1P0QA 3MDCA 3HMKA 1NLMA 2EWMA 3I45A 2VTBA 1NU6A 4NCAA 3OZTA 1MORA 2X6RA 1KTQA 1VKNA 4D44A 5JASA 2J0UB 5JS8A 4GC9A 2HW3A 4O8ZA 5JSKA 3BQ1A 3KAPA 5DPMA 5I01A 2H2GA 1ECBA 2L2QA 1Z07A 2OBMA 4MFFA 3I72A 4JU8A 2F9FA 4ED1A 4WBNA 1PR6A 4J0FA 2LXNA 4MI3A 2WJHA 3OX2A 4U3JA 2QV0A 4NNJA 3CSDA 3MCTA 3K1YA 3IDZA 4X66B 4JP1A 1T9GS 7ABPA 2WAYA 4BQIA 5CBPA 2NTNA 2ODNA 4HXFB 4QDJA 4U4AA 8ICRA 2W9XA 1WVGA 3IJPA 1VSVA 5EE9A 4KQWA 1CZUA 4P4MA 3TG8A 2C2ZA 4LYGA 1E4YA 4G67A 1HNNA 3LPDA 4QOGA 4D9BA 4NZ9A 5CCDA 1J7KA 3GELA 2ZRNA 3GB9A 5LXTB 3FETA 4EDFA 1OTXA 3AVPA 5EKSA 4IILA 2W43A 4MQ4A 3H2YA 4TMXA 4BFVA 3MJSA 4AYBC 2VBGA 4UBMA 1RAGA 5IFLA 1ZPDA 1XD2B 3LQRA 2B7CA 3PSFA 5EFOA 4OF4A 4QHSA 4C3OB 3NEPX 4JJEA 1G0OA 3JV7A 4LF4B 3NGLA 3K4QA 3EVGA 1TTQB 4B3JA 4EI2A 1H6AA 4TSFA 1JSRA 2FPGA 3OMWA 2FZ5A 2R6DA 3MJCA 5JSQA 3CH4B 1U8ZA 1OZAA 3KKKA 1EVKA 4F38A 5WRFA 3KSZO 1ZQAA 3RM3A 4BB9A 2GD2A 3JQ9C 4R7ZA 4RM2A 3MM4A 3WNDA 4BNYA 4DCJA 1J2RA 3OCJA 4UPVA 4Z8YA 1R0WA 1ZAKA 2Z0MA 4Q4LA 3GLFB 1EA5A 1FRZA 1PR5A 4O33A 4TS3A 4CTMA 2OBXA 3EXAA 7AT1A 1RXYA 3L7KA 4L0QA 1VG0B 1VCMA 1XG5A 4MA4A 4U2BA 4WUVA 3T61A 4QQKA 3B1KA 3PLRA 1OFTA 1P4SA 4MQFB 4RD6A 1N2XA 3CNHA 1PG2A 2OMKA 2PTGA 2Y1KA 1WMBA 2VA8A 1COZA 2H5LA 3AXTA 3P4UA 2OXTA 4CF7A 4D9EA 3AMVA 3SV3A 3MWJA 4MVXA 5B7PA 4O4JF 4HWRA 1QG6A 1Z7YA 3JVDA 1H1TA 1L7BA 3M9XA 3ZLBA 2EVWX 3H8WA 2FW6A 1R9MA 2VHQA 3WJ7A 3RFXA 5IM5A 1OMOA 3PV8A 1MFPA 2VNIA 1XVAA 4RQ2A 2R6GA 4PZZA 2CXTA 1LPSA 2K2WA 4DQIA 5TNXA 2QORA 4DLAA 3J80A 2JFGA 4L4ZA 2REOA 3R23A 1LI5A 3OIGA 1TL7C 3BD6A 1EWRA 3K9GA 3RC9A 4HB0A 4EB6A 4YACA 2AXQA 3EVDA 2C57A 4YJFA 2EQAA 3I83A 3PKJA 4U2CA 2BDUA 2YY6A 4J76A 3TTXA 4L8VA 3NRWA 4BQRA 2PGDA 1H4SA 1RC1A 3QXGA 2IUEA 1MZVA 4M1WA 4P6VF 1ES9A 3FKSA 1KDHA 2YUIA 1L7DA 1NYRA 4FYMA 4ISBA 4PYOA 4TV8F 2P0YA 1CIJA 2PUWA 5AKGA 4XGIA 5ENVA 3AK4A 3MDAA 4MKGA 3KYDB 2A1JB 3Q8MA 2AOUB 2H8GA 2OV2A 4BMPB 4BMCA 3U6BA 2GF9A 2VK2A 1L5HA 1PTJA 1TCUA 2IP4A 3AGPA 4QDTA 4IGAA 1P4JA 3T1YB 2FEMA 3TR5A 1CRZA 2IHUA 3CWZA 3QA9A 1H5NA 1PJZA 2C4HA 3PMLA 1OT3A 5J2AA 4UB2A 1Q77A 2V5AA 2FWBA 4DFDA 2V3CC 4RQ1A 2BDTA 4Q3CA 3RHSA 4TV8B 1YXMA 3CLTD 3JVIA 3C70A 4HQRA 4RZXA 1XB2A 2YYSA 1GLGA 5CJ7A 4B45A 2PGLA 4FMDF 1AK2A 4Y6SA 2JLSA 2OG2A 2FZLA 2PPLA 1V0JA 3IIJA 2IZ0A 4K9QA 4C7XA 5CD1A 3AV3A 1G66A 2BMEA 3ILXA 1H9AA 4M1TA 1IMOA 3AEQA 3E1GA 4A03A 1NJFA 2Z3VA 3RTBA 1SVLA 1NVAA 3AJ8A 4MVCA 3IVGA 4J49A 3WHKA 1ZQGA 5SZIA 3TTTA 4CLRA 3BIOA 3L01A 2H57A 3FNGA 1M6NA 3HKCB 2BFPA 2WJ6A 4CM9D 3B1XA 2NO5A 1D8BA 1G2QA 4YUAA 2HRRA 2Q3EA 4XEUA 4D9CA 3K5IA 5G0VA 2ZRPA 1ULTA 1EDOA 3LLMA 5LBIA 3M8KA 5JH7A 2IODA 4RTQA 2PQ2A 2C61A 3ZWNA 4JNKA 2Q07A 4QZHA 2FOXA 4QQFA 5EKDA 1M2GA 1GZUA 1N92A 2Q5QA 3PYMA 1M2OA 3R8FA 1SULA 4Y2PA 1NN0A 2RIRA 4OFBA 1QYRA 1LKYA 2XOXA 4RJ2A 4EG3A 1E79A 5SZJA 2L42A 5TF4A 3T5TA 4J75A 4G0XA 2QXTA 4MTLA 5D3QA 2YWRA 2O8CB 2CC2A 1Z18A 1WQ4A 3PC6A 9GPBA 4JWMA 2QRVA 4FN5A 2XE7A 5F35A 5AW3A 4R01A 5LKAA 1N3LA 2KFNA 2IVFA 5L1MA 2J7PD 4G4SO 2QNIA 1ZXBA 3I5UA 4JX8A 1A2KC 1NW4A 2ANCA 1OZHA 3IMCA 1C7JA 2FLLA 1F2DA 1NWCA 3PF9A 4AXXA 2C2DA 3GFRA 3UK7A 4EZEA 4POAA 4DSFA 4F3RA 1AS3A 2O0LA 3FH0A 1BXKA 4Z6CA 4FJ2A 5IZCC 3NWPA 2OE2A 3EGVA 2WV9A 3FPEA 3N39C 3QUAA 3VR4A 1L5YA 1F51E 3LVVA 1WOMA 4RULA 2OXOA 3ZV3A 4CMKA 3ZI0A 1Q20A 3DULA 5EP4A 3SOZA 1PR0A 4CV3A 2G72A 4IL5A 1N8TA 4HGOA 4L0MA 1CKEA 1W4ZA 3PXDA 1ZC4A 5DCYA 1YBMA 3VDQA 2BEUB 3C3EA 3DUFB 1H38A 4NF2A 2G09A 3JPNA 1OAKA 4D5EA 4DSAA 4JQZA 3GHHA 4WCFC 1SUFA 2DWUA 1L5MA 4BLQA 2WNSA 2NTYC 1QIKA 5B58T 5AKHA 5JYEA 4U9UA 1NJSA 5DK4A 4KREA 3DFUA 4M0UA 4OBWA 1UT5A 2WPNA 5A05A 5HK9A 3LS2A 2XE6A 1LNSA 1Y9ZA 1R8XA 2X9QA 1MR3F 2CHEA 3H7AA 3ROFA 2VSOA 4B3DA 1VLHA 4INPA 1NYLA 3P2JA 3LUDA 5JTUA 5KG7A 5FUYA 1OV6A 1QK3A 2WAQF 2TS1A 1QSLA 5AH0A 1RI3A 4NBVA 3QBJA 2DULA 3HM9A 3MJRA 2PMWB 9ICOA 2GZ1A 3GJRA 1ADGA 2HO5A 4IIJA 4RC9A 1QV7A 2NZYA 1H2BA 3ADOA 2ZANA 3PXEA 3EFOA 3EVEA 2GARA 4FOSA 2QLFA 3IELA 2XD9A 4RJLA 3QYAA 3TMYA 1J6UA 1GOTA 3G9ZA 1VL5A 3PDHA 8ICHA 3ZY5A 2YVLA 4N9QA 3DL0A 1L7PA 5KFJA 3GJQA 5KTQA 1WSBA 2YHIA 3ZZUA 4Q34A 2PFQA 4RYLA 1V39A 2XI4A 3EUFA 2R8PA 4JGGA 3TD6A 3RYCA 1K1SA 4K1LA 4ENTA 3RTEA 5F1KA 1L4MA 4EYGA 3L1HA 3AHGA 2XCTB 2VDRB 3DYBA 1D0SA 4J29A 5IXYA 3KXKA 3T1QA 4IHJB 3R9WA 4CM7A 3NJ4A 2B7LA 4K6GA 3X1XA 1FNNA 4MUXA 4PS1A 3IO3A 3RUFA 5EIEA 1XT6A 4UUBA 2GK7A 4BCCA 3E23A 3HN2A 2OORC 1UQVA 2YJZA 521PA 4BCBA 4EAQA 5CA0A 2D62A 3FXAA 4BQSA 4RS4A 4A8EA 2WTMA 4EHKA 3I2JA 1VPEA 4HYKA 4J2TA 4MQUA 3RJGA 2F4VB 1TRHA 4RVNA 2QB0B 1VKOA 3UAGA 4WBXC 4NM1A 1SCQA 1UQRA 5A5EA 4NBSA 3ECSA 3OZIA 4QXRA 4I3FA 5KNBD 2W4MA 2P6OA 2JIMA 3AEKA 2VL7A 1RD4A 2FGKA 2R1VB 5GY7A 5MN4A 2VDQB 2B1GA 3F53A 3NTLA 1MVLA 1THGA 2GNAA 4TLBA 4MB0A 3UJCA 5K0EA 5K3FA 1Y8ZA 3V72A 1SU7A 1ZCJA 3D0KA 3Q10A 3GMIA 3L82B 3TLXA 4F2SA 3U4CA 2FZKA 4B33A 1LNQA 1A2BA 1ZUIA 2ZIAA 1E0JA 4RENA 1JAXA 2Q8PA 4YUWA 4UKDA 3HHEA 3EDRA 4HDNA 2BFBA 3BK2A 1KP2A 4YAWA 4IUDS 5ALQA 1C7FA 4YP1A 3REQB 5LBUA 3WL5A 3CF0A 3BXPA 1Q0PA 1KYVA 2RC5A 4YVFA 2C42A 3PNLA 1GTG1 2B8JA 2BGUA 1M6VA 1YHZA 2G83A 3L04A 4UBOA 3N2ZB 5E1BA 5G0TA 2B9EA 4Q7JB 5GQSA 4ZAFA 3SQIA 3NJRA 5LN1A 1JLLA 1KAQA 1QIDA 2AL7A 3Q72A 1HDYA 3QF7A 4WINA 4PICA 4ES6A 4IJUA 1SKAA 4TTIA 2V0NA 3OT1B 2PKQP 4EYSA 4LZDA 1WIWA 1IEXA 1OTYA 2DTXA 2I4MA 3K94A 4PGAA 5IBRA 4P3OA 1T36B 2PH7A 3DL7A 4B76A 1OWMA 1A0PA 2BOVA 2QRZA 5AKIA 4DMHA 1KJQA 5JEDA 3WQSB 4EO9A 4LF8B 2J30A 4FHDA 2H5EA 1GJRA 1FE8A 3PIDA 4INZA 5G4KA 1E5LA 4YP5A 1LH0A 4P2HA 1LPNA 4IJ6A 1U0RA 3BQ2A 4MPPA 1ULBA 1ZQYA 1ZK1A 3PX4A 4R8KA 5G40A 1Z12A 2P5SA 1EA7A 2WWTA 3VKWA 2VHUA 1SCJA 5C81A 1JEOA 3UFXB 2GPJA 1AA9A 3G8YA 4NFLA 4ROTA 3P0JA 1K75A 1IONA 2UVDA 2XMQA 4MVYA 4Q1EA 1N7HA 3ICWA 5FBWB 2YH2A 5J2UB 1MTOA 4HWSA 1YF3A 1Z5VA 3D1VA 2BFWA 1OYOA 1V5GA 1U2PA 2PLFA 1PR4A 4YWHA 3S2YA 4YRMA 4LHYA 4KO4S 3F4BA 4G09A 5CDSA 4NHOA 4P7BA 4QU5A 5CG2A 3DUWA 3N2NA 2KLHA 4ZO9A 1JP7A 1CY0A 1MRZA 1JPNA 1LQ2A 1NMXA 1Y37A 2FPRA 1DRJA 1FFGA 3AUAA 1RYHA 3BMQA 4DSOA 3QU9A 3UAOA 3FMOB 2Z6UA 3R7SA 1BCRB 3HXKA 4I55A 1TUEA 3RU2A 4YJ2A 4CNBA 3E0XA 4DNPA 2DLDA 4DDKA 4L9AA 1JE1A 4YLGA 5ICCA 4KNWA 3ELDA 2I67A 1FDIA 2XB8A 1L5HB 1RWOA 3I2KA 3OOJA 4LZJA 3SP1A 4DGSA 3WRYC 4WY2A 4KQ9A 4YMTA 2NRXA 1RE1A 4F4ZA 2P3LA 2D8CA 2IBKA 2F77X 3F7MA 3R4CA 2DUWA 3NKVA 2DTEA 2KEYA 2PGNA 2FK8A 3GVHA 3JQ8A 3PCTA 4IOLA 1N25A 1UMDB 4MUAA 3ENKA 5FOUA 3U2QA 2FPKA 2ATVA 5J2BA 3NM4A 4EQ6B 2F00A 3GJ8A 4QDXA 3FMVA 1VL6A 4O2BF 3WO1A 5HQTA 1US8A 3IAEA 4BO1A 5EMJA 1N6NA 2VA2A 4RUKA 2ZTCA 3ZDRA 1P6UA 2EX4A 3KFVA 4PGHA 4AUMA 5LLSA 1UBOS 4XDZA 2G9VA 3M2TA 3OM1A 3DCYA 1TK0A 2VYNA 3JSXA 1XVUA 3GYGA 3M5DA 2DUMA 3RBDA 3ZXSA 4DLRA 1KO8A 1RXWA 1LRKA 1TM5E 2QIPA 3AJ9A 3CHYA 3CN7A 4TMKA 5DSXA 2WJJA 5HOEA 1ADFA 1E3QA 4I2JA 1SBNE 1JBQA 4YPVA 1TIKA 5DGXA 2F76X 3RVNA 4ZZ1A 1HMYA 9ICIA 1D2EA 3A06A 3ZV5A 1RYSA 3IS3A 4A2QA 4UNPA 4XLZA 5ER9A 4DYHA 4RLFA 1NFQA 2Z98A 4ZYWA 1TJNA 5EQTA 1D04A 4MROA 1Z08A 3R3JA 1PSDA 1ZVJA 1KVUA 3EYAA 1M2OB 1W87A 1N2OA 1VOTA 4O5KA 2DH6A 3AU6A 2P7HA 1XMVA 1CUYA 3OI7A 3J81k 1GXSA 1R10A 4N5LA 4HP8A 2O8FA 2V7QD 4ID9A 4IDCA 4J0IA 5FLKA 1V16B 2H2FA 5FUMA 3BA6A 5ILOA 2WQ7A 1QKKA 5E6RB 3MEQA 4S04A 1JTVA 4DVGA 2OECA 3B0YA 3BYZA 3NYRA 3S1AB 3TIXB 1R37A 3K20A 4R98A 2PEYA 1E6MA 3QWIA 5FB3A 2FFAA 1X6IA 1LPMA 1EXWA 4C0AC 3Q6NA 1UIRA 3ZE0B 5DFAA 1S2GA 1VYVA 4MQEB 3RR7A 1I6LA 4XH9B 1PLKA 5LDDC 1N0WA 1IAVA 4I2CA 3ZWXA 2RDMA 1OFIA 3ES9A 3C1ZA 4YD2A 2ZYDA 3ZLJA 4ARIA 2M6LA 3MABA 4C7ZA 5AVVA 4AW9A 1KFDA 1SZCA 3C2QA 1Q2UA 5AJUA 3PI6A 4BFZA 3H3XA 2J7KA 1USWA 4FYJA 4KR2A 3ALRA 3ZBUA 3P97A 4LBZA 4X1KA 1K6JA 4O1MA 2JD2A 3FZQA 1YA8A 4H31A 5HEKA 2HRDA 4B40A 1GEEA 8ABPA 5JD4A 5BWMA 1JEYB 2QTGA 1L4EA 3G3EA 1JVBA 5G2OA 4L8WB 5K45A 1KWGA 2MSDB 1NVVQ 1W48A 4ND3A 2GILA 3IP7A 4KIGA 1JVNA 3LLSA 5C5JA 1UOOA 3DXXA 4HGNA 3ZHBA 4C4PA 4LFBB 1DBQA 2CXOA 3TFQA 3GDFA 1II8B 1KAGA 2JAQA 5EWJB 4KFCA 4QKQA 5IASA 4GFDA 3COYA 4JJGA 5A6VA 4PAMA 1ZWKA 3OQHA 3GD7A 1ZINA 3VO2A 2P6NA 2BM8A 4REMA 1UXKA 3GLIA 2OQIA 3N70A 2IP2A 2JGRA 3ZCUA 3QHPA 5HJEA 4RA6A 2V5UA 1U7TA 1S2OA 1T1JA 2DBVO 3IIIA 1YT3A 3MSCA 3PX3A 4GO1A 4CDNA 1URPA 4YRQA 1JYFA 3AEQB 3EA4A 1Z2EA 4EFMA 4U7TB 2ZJ0A 1B22A 1P2BA 2C4KA 4IAOA 5DSTA 4HAWA 3OUUA 2WHPB 2RHDA 3RKRA 3BWVA 3GJ0A 2N75A 3M9WA 4OOFA 3RSQA 5GONB 2VXCA 2VANA 1F3LA 1XQ6A 3EZ7A 5B1YA 3TB4A 3MC1A 1RCFA 4UEWA 2PRIA 5JH7B 3T3OA 3H42B 4TN1A 3MQFA 1JYEA 4IYJA 3OJWA 5E9WA 5IEJA 2EKQA 2GB4A 3K2EA 1OREA 3L7NA 1IDN1 4DLYA 2V7BA 3NBZC 2CMKA 1JR2A 2QJOA 3RE1A 4BB0A 1U0LA 4EJ2A 2PGOA 3AFMA 3PWSA 3PHHA 2XICA 2R87A 2RHRA 3QXXA 4MW7A 3WIUA 5A4JA 3JATB 4UCWA 4UU7A 4ZKDA 4F7WA 3D31A 1WB4A 2FZCA 4OFWA 1KI7A 2OLKA 3NIGB 2VF5X 2LUOA 3G7UA 1TYBE 3QKWA 5BMVF 1ZRHA 5I7HA 2ODWA 2CVPA 1SL1A 1PUZA 1FNCA 2Y0CA 3OIWA 1DBSA 2BKLA 2H2HA 1SL2A 4PNHA 1Z8DA 1G42A 3H11B 1WEHA 1YAJA 3PQ3A 1W19A 4RSMA 1ZH2A 3KZCA 3LCCA 1CLUA 4D6PA 4DUGA 2GPTA 2KVSA 3PW2A 2HA3A 2OCPA 2UV8A 4FS3A 3IHKA 1A5SB 3H2ZA 2ZTEA 5KMGA 3MW8A 4XIIA 3D3EA 3G8AA 3RAFC 3H2IA 1T9CA 4NLLA 4PRKA 1XLTC 3L8EA 4QUHA 1UC9A 1K5OA 2MWMA 3KAQA 2N1MA 4URHA 1KBZA 2MU2A 2C04A 2RGGA 3A4TA 3O4HA 4QGFA 4EZIA 5BWOA 3GLGA 3RNLA 1YC5A 2JFBA 4V02A 3U3DA 2Z4RA 1DHRA 1MG5A 2EWWA 3EIOA 1GV1A 3IERA 2K8CB 4K4GA 3E9EA 2H2IA 5A04A 3RSOA 3DD5A 5B7NA 2YZMA 2RIPA 3IG8A 5KFXA 2I4NA 3HBJA 3EQ2A 3QUTA 2QTWB 3ZDXB 3P0HA 5DWVA 4HI0E 1Z2CA 2OHOA 4B9UA 3KHRA 2FSFA 2WM9B 4AJ1A 3ONDA 4W5QA 2B37A 2A57A 4LC0A 3AZPA 3ZWVA 5D7NA 1GFSA 4BNIA 5KAPA 1SKRA 2OPHA 3H2JA 3VAAA 3RRYA 3NDBB 1V9LA 4KMOB 1UBSB 4JP2A 5CA0F 2V54A 4K3UA 3FDXA 1GUBA 3WISA 5A02A 4LVCA 4AS3A 4BLRA 4X95A 1EFKA 4JOCA 4J7UA 1CRXA 2VZ8A 4KLTA 3EZFA 3F6CA 3P2EA 1XZQA 1YMVA 3KQQA 3UYLA 4FZ3A 3ZE1B 2JD0A 3SXJA 2IYOA 4XWKA 1V96A 2E89A 1IN5A 1XEWY 1HRDA 2HK6A 1UINA 2D0OB 2NM0A 2WD7B 4HLUC 1WABA 2H16A 4WFQA 1QZ3A 1YZLA 4P36A 3CRRA 3SEZA 5DXJA 3HA5A 1EP9A 1M1YA 4FBUA 1GARA 1UOQA 2R751 3N6RA 2LIPA 1AX9A 4JLDA 1I1OA 1QDLB 2JIZA 1E59A 5EZYB 1UDRA 1X7XB 4FBTA 3PFHA 4OSOA 1U4BA 1V7ZA 3ORYA 2OK8A 2OXIA 3EQ8A 2GM4A 1TK8A 3PC2A 5HK8A 4BZZA 4K5QA 1ESEA 4TMVA 7ICJA 3RD5A 1L7RA 2A67A 3O93A 2FWRA 3O9MA 4M9JA 3KKNA 2B8EA 2M98A 1K66A 1CUJA 5KFKA 1MJNA 2BISA 2BN4A 2PSHA 2ZTSA 3NV9A 3UT6A 4X3OA 4DG9A 1JV2B 3INRA 3G2NA 3N8GA 5J8YC 5IK2D 1X7ZA 2DR0A 4R8SA 4I2AA 3DWGA 4FGKA 3RGGA 3TTVA 4EPRA 2AZTA 1G21E 2CXSA 3W4KA 4BPBA 2WQZA 1QCKA 4FNAA 1K3UB 2O6LA 4JASB 1HT2E 2XE4A 3S1SA 1DNPA 3G68A 3Q8QB 1GNSA 4DDMA 2IOFA 1YS6A 1E32A 4FFLA 3CNOA 3GVCA 3OH8A 3SX2A 4JK1A 5EEHA 1EWVA 2VHWA 3OHBA 1ICIA 3VNRA 1MAHA 2JFOA 1II9A 4GOLD 1NC1A 1BD4A 2HEGA 3BRQA 2IJGX 1H22A 1E9CA 5ALIA 4XGQA 1UP7A 4Y0AA 2ZXIA 3VZSA 5DQIA 1F4VA 4PINA 1GGMA 4B6OA 2J3LA 2GBGA 3OZAA 2N47A 4ARVA 3EHEA 1U6KA 2A5FA 2VTEA 4MJ7A 2ABWA 4A23A 1GLVA 3D59A 3L7JA 1R0CA 1SOVA 2CNDA 4C14A 1RU3A 1F7VA 3DVSX 2R25B 3GQBA 2OCAA 4NARA 4LOAA 2WSIA 5D00A 5M7EA 3WJ2A 5KYXA 1OH8A 4Z0NA 2FWNA 4YT4A 5KTOA 1M1ZA 2MINB 4NV3A 3TNDA 2HOFA 3B51X 2C3MA 2ZBUA 5TLSA 2G1KA 5DHAA 3MMXA 1HZZA 1R6AA 4YJ2F 3LT4A 3RJHA 4HWGA 2W5UA 1RM0A 2E7ZA 3AONB 3GXBA 3DDOA 4JHLA 5SZHB 2TMKA 2QVGA 4EP1A 3LCUA 3SZ3A 4YRIA 1XRMA 1U3TA 2B2XA 4US8A 3N8NA 3NNSA 4UEOA 1PVVA 4RXMA 4ZU3A 1NZDA 1OFUA 2O06A 7ICLA 2BQUA 5E2BA 5EZQA 1CJVC 2LKCA 2HNAA 1CZNA 1VZ2A 3B3JA 5BQPA 2JAWA 3TARA 1ZX1A 2AK2A 2XYPA 2AHRA 4JT2A 1D8TA 1XZNA 4Q3LA 4IEFB 3HXQA 1E3DA 2X13A 4KLFA 1V11A 2OQ2A 4R6XA 3RVLA 5BV2P 5KINB 5AI5A 2NGRA 5BWCA 4JV5B 3CPJB 5D51S 3HUFA 2IH2A 3D2AA 3IAM6 4Q4AA 5COBA 1QKJA 1QHHB 4EHBA 4CMIB 3UWDA 4DCCA 5ALPA 3ISCA 1DKMA 2VYVD 3K92A 4EEKA 1SIBE 3ND8A 3QPWA 3QRWA 4RCZA 3B3FA 4TTAA 2QTMA 2HREA 3CH5A 3RIEA 5B7GA 2LMRA 2PZ8A 1EXDA 4JC8A 4ZVLA 1ECLA 2XCIA 2F62A 3R5FA 4CETA 5F9LA 1HV8A 3WLEA 1YZHA 1OI3A 3KHGA 5ALWA 4AICA 4HNVA 1IH8A 5CR9A 1NQUA 1XS9D 1U7WA 2JGEA 3BGIA 1JIQA 1U1DA 4DGQA 2E5LB 3JQ8B 5DULA 3HWTA 2PZLA 5FNVF 4TSKA 5H16A 4F1JA 3IEVA 1U02A 2FX5A 4PZOA 2JS7A 4I4NA 4G85A 4Q3AA 4XEHA 5EMHA 4GX5A 4CF5A 1AGNA 5AFSA 3H1TA 2FPIA 1B0PA 1AN9A 1FQKA 3B52X 4RA6B 1Q7CA 4OXYA 1MOZA 4XQ0A 3ONNA 1C8KA 1IIRA 1AGXA 2DCUA 4HNAB 3PR3A 1QF9A 2H11A 3JARA 2ZT6A 4DIMA 1ZQCA 4FINA 1C0LA 5FBVB 3ETRA 2JGIA 5G0SA 3NCHA 5KWVA 1KIAA 2PZBA 3SC6A 5BN3B 5JSHA 1USIA 1P29A 1TA9A 4H15A 4OCZA 1V6AA 1TT5A 2XVAA 3MRSA 3N74A 4K05A 4NP6A 1JDPA 5D1HA 4EG5A 5ALNA 1A2OA 3O8CA 2ZR8A 1NNEA 1C3OB 2OKCA 4TVOA 5DHSA 1J39A 3ZUPA 5A4KA 4WZBE 1XIVA 4RZRA 4UHEA 2QU8A 2WFMA 1I9GA 2GJ8A 4DWIA 3CO5A 4LWZA 5HHTA 3EGEA 4IGKA 1WZ2A 4ZOCA 3NPMA 2UVPB 4CCHA 1A9QA 3WJAA 4W9MC 3H65A 2XGGA 4Q18A 1H1LA 4RTKA 4JCOA 4HY3A 5E6RA 4G5RA 3TQCA 4PHEA 1P7DA 1RKBA 2VNKA 3IHWA 3SJ7A 1NW9B 2VWGA 4EW6A 5JHHB 5MDHA 1BN6A 1JXAA 3PHLA 4KBGA 5G53C 1J06A 3UAWA 3CLRD 2NP7A 4XLTA 3ZWDA 3H6HA 5HP4A 4OMDA 1ZKDA 1TEXA 2CDCA 4XQ8A 1JKFA 3NWJA 1NE7A 1Q16A 3O26A 4RIGA 5JSZB 4AM8A 4DG8A 5F7JA 1FFBA 1ZQXA 3TI7A 1DI0A 3L9XA 1JG3A 1Y4AE 4XFKA 3U7EB 1RYNA 5KFDA 1JB9A 2OAP1 3G1WA 2GTIA 1ZR4A 4URFA 3WQRA 1J07A 1PS0A 4XOUA 3RAPR 4PSDA 2R4TA 1FVOA 3HLYA 3E5RA 3VR3D 3VHQA 4BDSA 2GYYA 1DUIA 5A1JA 1RQRA 5B6IA 5DBCA 2PU5A 2WSSD 4RU1A 5DHFA 3WGUA 2HTEA 3D54D 1G8YA 4MUEA 2HU7A 3G0BA 3HMQA 1L8QA 1HDGO 2IVZA 5LWQA 1NJZA 3QE3A 5FTMA 1ZQWA 1ZK0A 1Y1TA 1EM8A 1W6UA 1WP9A 4Q4DA 3RK0A 3RROA 5JMOA 3D8HA 4EX6A 3GEIA 3FDFA 2HRBA 3NYIA 5GVSA 1SO8A 1UAYA 5KTSA 2V8OA 9ICXA 5H0IA 5CB4F 3UKDA 5KJEA 2QTCA 1WPQA 2VA9A 3AG5A 4G8JA 4E70A 3AKZA 2I2DA 3C5GA 1OYVA 1ULZA 3Q8RB 1ZU5A 3JZMA 5EG5A 4FE4A 2ZBDA 4M60A 4MS3B 3GFVA 3ZKAA 2NQ2C 2WW8A 3WSVA 1UH5A 5LQUA 3M6UA 4F5QA 7YASA 4ERNA 3LXXA 4MGKR 1FVHA 1W8DA 1KDTA 1KO5A 1NQ5A 2YV4A 2FPWA 1WUKS 2XMGA 5HM8A 1M34A 1G21A 3NBQA 3GPBA 5IULC 4N40A 2DUJA 1T25A 2FP4A 1P1FA 2WHPA 4C0LA 1SZJG 5F64A 1QAQA 3O1LA 3S27A 5BWLA 3BQ9A 1SV0A 5G5HA 2YWDA 2BSAA 3RFFA 3NIDB 2VYND 4K9DA 1AV6A 2H85A 3GROA 2G1UA 2GN9A 4QWEA 3O5AA 1J2TA 3QVGA 4AD8A 4D8XA 3PY8A 3OE5A 3OPYI 5FQOA 3TQIA 3ASYA 3ZE6A 3AR7A 2ANBA 3UTDA 3H18A 4LZZA 4I66A 1ZXLA 1YV9A 3R3UA 3ADCA 1DGQA 1U2QA 4WN3A 2OOSA 4WN9A 3O4FA 1SZPA 3TADC 2G5TA 4JBYA 2W70A 1AN0A 2ZATA 3SS8A 2O20A 1GT6A 3V48A 3GJXC 1Z4IA 4B80A 1PKEA 2VDKB 1U1FA 3DC2A 1L4NA 4HPXB 5T4BA 3B9JA 4O3MA 9ICAA 1XTUA 2G63A 2K2QB 3AB8A 1LV7A 3AKDA 3QVJA 3WK4A 2G77B 1WCV1 1BOOA 3DZBA 8ICJA 5KSPA 1PR1A 5DLGA 3DAHA 3N2YA 4FS8A 5HIKA 3D5EA 1JKXA 1ISSA 1QDEA 1JHRA 2LCIA 3LCJA 5CAEB 3IIKA 3FFXA 4LRYA 4CQJA 1OLUA 2QSZA 3KE8A 4PG7A 3KQWA 1I3OA 4IV0A 1XO0A 4IDAA 2CDAA 5G4LA 3TW8A 3FTQA 5CCXA 3HGQA 1XQYA 3BS5A 1FDTA 1I14A 3I58A 2IL1A 2YFHA 4IQ8A 4J0HA 4OM8A 3T0IA 2ASLA 3ZDCA 1AXGA 2QN1A 2PVCA 2XQFA 3AI7A 1WSWA 1MJGA 4MARA 4KCGA 4TUYF 3GFQA 1G98A 3IOEA 5K0GA 5L7WA 1K6MA 2JC3A 3TL6A 3PSAA 2QMYA 5ERYA 4KLOA 1XD9A 2OGUA 2NQ8A 3AHDA 4NOMA 1Z4KA 3A7EA 3HJAA 2J6UA 2PGIA 1U7PA 2X3YA 3LGSA 4ZOBA 4B4VA 3SY8A 4KPFC 2FP4B 2QD5A 2B83A 4JX9A 1D07A 2CDNA 3G9UA 2FEWB 3CUWA 2VPIA 1XHEA 1IQPA 1K7FB 3RKUA 1QUFA 3UJ7A 1YFLA 4Q6BA 4ZO6A 1LA2A 4ZCSA 3BS7A 5SV2A 3TZQA 3ADBA 4EY5A 3PUWA 5F5XA 2ZWPA 3FVVA 3ERCA 4P84A 5AUQA 1ZK2A 5KDLA 5DDIP 2JBAB 4WZZA 3RWBA 4C08A 5M2QA 4D98A 1TADA 1ZQHA 4NWIA 3WDKA 1ZRNA 5DBGA 4AJ9A 4EF5A 3WKCA 2AUTA 2P7IA 5BYBA 4KLJA 1J0AA 3VJLA 2CXNA 2PQMA 5GTHU 4NU5A 4NMWA 4RQ0A 4KLMA 1E77A 5FI3A 2F8TA 1JX6A 2IA6A 3UMYA 2IHMA 1XRLA 2UZ1B 5F2NA 3SHWA 5EZYA 3MCAA 2V4RA 3N0VA 1IB0A 5TIIA 1LSOA 3UM9A 2WKQA 2V7EA 4R1TA 5G0UA 3QI7A 3DR3A 1LFDB 2IYLD 3B1VA 4UBJA 1VHWA 2WAXA 4HLDA 5TGTA 2AN4A 1K5HA 2MJLA 4Q7KA 3V7WA 1DGJA 4FLEA 5JS7A 2C77A 3OZGA 5AM0A 2AFIA 2WFLB 3RWMB 4CCYA 2V1UA 5JMPA 1ZY2A 3G13A 2AKAB 1JJFA 2AOTA 3V6HA 1NK7A 2AWNA 2HHLA 3DEZA 4GYJA 1X1BA 4BNGA 4G5OA 3RC2A 1G7CA 1UBEA 3ZGXA 1GZ7A 1PSWA 3CB4A 4G8DA 2JARA 5DHUA 1NMZA 1YQUA 2CK3A 2P5UA 2P66A 1HLGA 2YASA 4U63A 4OB6A 5TQ0B 1YJCA 1XU9A 3UW3A 1HI9A 1QYDA 4EEXA 2VZ0A 3QFCA 5B64A 4PGMA 2XTZA 3LWLA 2PI4A 1PN3A 4JL8A 4O4LB 3WK8A 1TAMA 1Z33A 2Q6LA 3P2IA 3A2MA 1RYMA 2IDZA 1B2LA 3PUJA 4XKJA 4RY2A 4YMSA 2FN9A 2HVIA 3AHHA 2O57A 3KRTA 3WL4A 3K9QO 4WOKA 2HF2A 1R8SA 2O23A 2X5KO 4UUQA 3BWXA 4MAFA 3IDWA 5HIMA 3ZWKA 2QL6A 3A4YA 2A5DA 5CK5A 2NLOA 3E61A 2EZZA 3UA4A 4MWZA 4MF2A 4AWAA 5A3JA 3LVQE 5HF9A 5JY1A 5LYJF 5HFNA 4ITVA 3WQQA 4YDQA 3NLLA 4WHMA 4QVKA 1QTIA 1RFGE 2WAOA 3LDAA 4WSOA 2HYDA 4KKXB 3EEIA 4CM5A 1E8DA 4OIMA 1HSOA 3RLFA 4ARCA 4NEGA 4Q3DA 4U5QA 3HKBA 3N59A 1N2CA 2VBFA 3HS3A 4EYEA 4JYZA 1MV8A 3N5CA 2RG7A 3QELA 4HWPA 3RBAA 4JUBA 1U8TA 4P2GA 2R7NA 4PO3X 4RU9A 2JGDB 4FKZA 5B3LA 5KU7A 3QU4A 2ZUVA 4IRMA 4I3GA 3L1VA 4DG5A 3HCAA 3W5DA 3BIJA 1C81A 1EFVA 2BUCA 3OLCX 3DO5A 5C7LO 2PE5A 2BLNA 4WBNB 1MT0A 1NQAO 3DOHA 2AW3A 1OBFO 1U4OA 4AK9A 1NNSA 1OXMA 3CEPB 2QMZA 4FLFA 1XZMA 4GT1A 4GU5A 4F60A 3E9DA 3IBCA 4GOND 1KNQA 3EZXA 4DUYB 3VRHA 1BHO1 1O4WA 1AZSC 3LPLA 2HLDA 1VHQA 2EQBA 1GGVA 2BGKA 1V11B 3OE7D 1PD1A 3L92A 1JQKA 2RGBA 2DH5A 4BMVA 4AG3A 1Q1AA 5BORA 1IEVA 1S2NA 3FUVA 1T34A 3NGMA 4OREX 1Z19A 2E6KA 2OUKA 4C5BA 1V8FA 1A98A 1QYCA 4W7IA 5FHRA 4IXWA 3EF0A 2QZ4A 2DKXA 4UARA 2WT8A 1ZK4A 1XI2A 1XYGA 2J5XA 3EZGA 5K3CA 4L3OA 5FNVA 4AL4A 2PO7A 4TKMA 3WKDA 3I42A 3BSYA 3DXFA 3GAAA 3QYFA 1UF9A 2FE9A 2I7VA 2XQVA 3L6DA 4XFJA 3GN2A 4K9OA 3W5HA 1QH0A 5H80A 5AIBA 3BK7A 3AU9A 4FWTA 3L4BC 1Q5PA 2OCDA 1ZGBA 2VZLA 1PV1A 5HDQA 2E4AA 5IYZA 2DL0A 2Z6AA 4DS4A 4DT1B 2Q6IA 3PFIA 4CM6A 1SHZA 3T5BA 4O4JA 3URKA 5LBTA 3D8SA 3OTWA 1G55A 2D1QA 3M5WA 2Q0ZX 3MBOA 1PFGA 2FPIB 3D6VA 2WILA 2WJWA 2A92A 4CTJA 1J09A 5CFMA 2G40A 3HFGA 3GFTA 1F0NA 2QUJA 4H18A 4TRMA 1HNXB 2A3RA 2EGUA 2O9JA 1Q2XA 1NF9A 4GM0A 4J16C 1SQSA 4DR3B 5CB0A 1PT8A 2WM2A 1F2TB 4PHTA 3MTAA 4KH1A 4KXYA 5KFBA 4I8IA 3QWHA 3UOGA 2OV8A 4L1KA 5IN4A 3W5IA 3V4SA 3SC2A 5IVKA 4R9UC 1P3Y1 1XGKA 4AF8A 5HW0A 3GV7B 3ENNA 2QJTA 1NKEA 1NPTO 1BHSA 3KOUA 4KK4A 1XEXB 2ZBEA 1Z5NA 4ENWA 5KYTA 4BV9A 4B3TB 2ZPUA 3IAS6 3SDBA 3FPKA 2FZVA 4LYAA 3E70C 3COSA 4PPXA 5KAFU 2YXPX 1JRPA 2X5XA 3B48A 3I8SA 4JJKA 3T0GA 4BWFB 1ECFA 1N2SA 2JCGA 4I50F 1QMGA 3GLTA 1UBKS 3SNHA 2AQ8A 3GBVA 3K0FA 4IIDA 1J2NA 3F73A 2NVWA 1OX5A 2R9VA 2UVPA 1DEAA 5CX1A 3W3AD 1SMKA 1Y4SA 4FBGA 3M1LA 1J24A 3T5CA 4F06A 1HO3A 1SD5A 3E2EA 3G82C 3KJEA 4OQMA 4F6RA 6ADHA 3CLUD 5HDBB 1IEWA 2W2KA 4BS9A 5CHGA 4TXMA 3CYMA 2C2EA 4IUYA 2XWQA 4OQQA 4QUJA 1RBMA 1KFBB 1LTHR 1P74A 1ZUNA 1DEHA 3QE2A 1G3IA 3L6RA 4DRXB 3SJCA 2F9MA 3STUA 2V0GA 2QP4A 3IB3A 1A27A 3HRKA 2AF3C 2BVNA 2C4VA 3K0AB 4LJ8A 5CFOA 2QJFA 3K8YA 5G5GA 1I5RA 3G7NA 2RCYA 4E5VA 3HKZF 1A88A 1YGYA 3EPIA 3K73O 4HQ6A 4NE9A 4BVKA 4DV2B 3NC4A 3FIUA 4Z2YA 4JI3B 5CJJA 2IV2X 4LRTB 3AJDA 3TO5A 4IO0A 3TW8B 5K4GA 4KWIA 1NSYA 3H5IA 5BW8A 1QK5A 2MTBA 3UJAA 5C8XA 5PGMA 5JMTA 4IR9A 4R2WA 3PZPA 4DTIA 3ONWA 2FR0A 4E1AA 2N3ZA 2VG8A 3P9ZA 4YV7A 2ZM5A 2DERA 1E0KA 3F6BX 1JU3A 3UENA 1Z6YA 1WZNA 2D8AA 2IIPA 1RHUA 4KIFA 7REQB 5JPCA 4QQ8A 1KK2A 3Q0IA 2E3TA 4MRPA 4QIWC 5JU5A 4I1RA 3WRXA 5IT9A 1PVQA 1FUUA 5T4HA 3WP0A 3BH6A 1XUOA 2AN3A 4B9VA 1K98A 3AP1A 2NNWB 2ZSEA 4MGHA 1N1GA 3IE2A 4I1VA 5C8YA 2QN2A 2I22A 3HA2A 4R65A 2CZQA 2HFJA 4L51A 2DF8A 3LUBA 1D2CA 1W36B 1T5SA 3NEJA 1L4GA 1QGZA 3HJTA 4M1SA 4OK3A 2ZB2A 1ODCA 2D3DA 1LX7A 4TM7A 1TYZA 3GFFA 4RTOA 1JTEA 1U0GA 2BH2A 2HPAA 1Z06A 4G0OA 2P8SA 4ZV4A 4L5JA 3PXGA 4RNCA 4UAWA 1C2TA 5CWRA 1I0LA 3GT7A 4XX1A 4RK4A 5FBHA 5JAMA 3C7DB 1M34B 2XMDA 4J8PA 1G8SA 1P7WA 4EPVA 1LKYB 3C5VA 3GEPA 3IRVA 3QJ5A 4GIBA 1XQ9A 2E5SA 2JEIA 4P0QB 1IVNA 1ZGGA 4GMKA 4QRIA 1KH3A 3TLBA 4QGAA 3N07A 4D0SA 4K0KB 1UMBA 3HEAA 1XZBA 2DHCA 2PZAA 5HKOA 3PNMA 2ATLA 1RRKA 5HBGA 1ZMBA 3TW0A 1CUEA 3HLKA 5CDFA 1XQVA 4EVIA 1G59A 4ECUA 3CONA 2K7FA 1CZOA 1NU8A 4JMLA 4L95C 1ZS9A 2QG6A 1N9KA 3C5FA 9ICCA 1C5KA 2AX3A 4B71A 2D2XA 2R6FA 3S28A 4M47A 4WBSA 3TR6A 2O8BA 5CLLA 1IPEA 7ICGA 2Y4NA 1THMA 3LE8A 1O8BA 1GZ4A 1C9KA 3P9QA 2QBYA 3M5PA 5COQA 3LXMA 5JAIA 1SXJB 2X0KA 3H9CA 1FLNA 1KDRA 4TXNA 1V6CA 1K9SA 1UK9A 1YI1A 5DBBA 2XE8A 4LDJA 4OGGA 2HT6A 5E4FA 4OI1A 3N58A 1XAHA 2PUCA 1OW3B 2WTEA 2PVPA 1UZMA 3W7VA 3OIFA 4U2KA 3ZWOA 3ILYA 4EGAA 1ZQSA 3THVA 4O5EA 3DB1A 2DKNA 1S2DA 1G9SA 1G3UA 2R65A 4NCHA 4B3CA 5KWJA 5F3RA 5IH3A 2XNCA 2EH9A 2F8KA 1T9GR 2QI9C 4QOIA 3SF8A 1NRJB 1ZLXA 2WM3A 4JYBA 5FAXA 5FD8A 5F1OA 3BBLA 4NYJQ 5EWLB 5DNUA 3K70B 4B82A 3ELWA 3KKMA 3OKFA 4KOAA 1NVBA 3UWMA 4W6ZA 2QX6A 3U0BA 3KVNA 4E32A 4BFYA 2IOHA 2C82A 7MDHA 4OJNA 9ICJA 2E4YA 4FFPA 3GUUA 5KREA 2I3ZA 5IAGA 3DVAA 4AT1A 1A72A 1SGGA 4MQ6A 2BE9A 3IESA 2GN1A 3RK1A 4PQFA 1WWUA 3R5KA 3RT7A 2ZJ2A 3B5EA 1DQPA 4ZZ3A 2ZBVA 1AKRA 1T0BA 1GKIA 3KS9A 2VJMB 2H0AA 3UPDA 4ARAA 4BZWA 5CLIA 4AP9A 2Q3JA 3TAXA 3GLHE 1IUKA 5BQ3A 1RYBA 1UQTA 1OCEA 2ZUBA 1Y8QA 1YC2A 2ZSFA 3D43A 2WIGA 1XCGB 4DDVA 2WB2A 1N2CB 2HBRA 4JJFA 3I09A 2HCRA 3K30A 3O2QB 4OGFA 3UMSA 2DC1A 3IIEA 9ICBA 4WXPA 3DJFA 2GT1A 4FOOA 2G8LA 2Q6KA 2KJQA 3NIFB 3GIKA 2V7XA 4MUKA 1EFVB 1H05A 1OXXK 1CUCA 1QJCA 4FYPA 4MV3A 4OHUA 4A7PA 1BU5A 2Z56A 2BI8A 1T1GA 3PYLA 4ZJUA 3HRIA 1GY8A 3C3CA 4LZPA 2D6FC 1WCIA 1KFTA 2G0AA 2IXFA 3LSYA 4O2BA 3PTAA 2QBYB 1R88A 1DQZA 1JWAB 2V45A 2YX1A 3ONVA 2CSUA 2A0WA 1YKSA 4QT0A 5GZ1A 5J58A 3HEMA 4R2JA 3WGLA 2ZYUX 4KLEA 2RK3A 4QXMA 6REQA 3F8WA 2Z2XA 4EG8A 2H7VA 4M04A 1BPBA 3ABSB 5ALYA 2BRUC 2ZCUA 3HB4X 4WZBB 3SZUA 4D4JA 1C20A 3OP4A 4LMRA 5KSOA 2OGTA 1X1RA 3P2KA 2O7VA 2Z08A 3AO0B 2EJBA 2R44A 4HXYA 2OHGA 4X00A 3TUIC 5KYKA 2BI7A 1G0NA 3O3MB 4GNRA 5SICE 1ZP6A 1K27A 4V03A 3AM5A 3THOA 4EBBA 4ADSG 2R68A 1G18A 1A5AB 3K2BA 5K7SA 1ISFA 4Y30A 2FA9A 1NBMD 3DTVA 1IY8A 2J85A 4GBJA 3BXFA 2X9VA 5E4JA 3CE6A 3KKLA 4Q82A 1EGVB 2VAPA 1BJTA 2CNKA 3I0ZA 3NBKA 1B8NA 3QIAA 4I8XA 4QO8A 3WLLA 1R27A 4BP9A 3EY4A 4BRSA 4ZYVA 3QNUA 2PL9A 4WXYB 3WIVA 2C5LA 4O9MA 1Y3HA 4DAOA 1UKYA 5CLQA 1KHHA 4CT5A 1O95D 2WVJA 2VLIA 5BRNA 4QZFA 4DF4A 2PXXA 1M2EA 1IFXA 3FNHA 1MJGM 1RM5A 4O3FA 2HBZA 4UDYX 4BVEA 2HBYA 1FA9A 2NTEA 3ZPXA 4MA5A 3R41A 3GGDA 2F8SA 4A91A 3MA0A 2Y67A 3MELA 4LRQA 3WLMA 4D46A 3G0GA 1PHPA 1TFUA 5G4KB 4YQEA 1T0UA 4B75A 2LCFA 5KVCA 4ZAZA 2JRZA 3N8DA 4FGUA 4RETA 4DQQA 4B5KA 3W9SA 2SNIE 4GR5A 3UH1A 1K3FA 4QWWA 1G5FA 2VUTA 3TW4A 2X40A 4N5NA 2CBXA 4M8LA 1D6SA 4N0QA 1EP1B 1K7XB 4PQYA 5IJAA 4ZT6A 1N78A 1JKJA 3KKZA 3DLPX 2BAGA 4DWVA 4MR8A 4RV9A 2EF0A 2PBZA 3VHRA 1DKLA 1GQ2A 3QKRA 4FE3A 3NBYC 4HRXA 2IWRA 3ZBPA 1M5RA 1DC3A 2J3EA 2HQBA 2O2YA 3GF4A 4ZHSA 1NK6A 1BCRA 1NL3A 3P7MA 3MILA 2F3QA 3V3TA 3V8BA 5K0LA 2W9BA 1VIMA 1J9EA 2NSYA 5EJGA 2QVZX 5ILQA 4I5DA 4LGVA 4MHTA 3IP8A 4RH1A 1E62A 2FG5A 2C3OA 1CLEA 2PUFA 3WYFA 4MR9B 4BMNA 4CODB 1P44A 2WICA 4P31A 1Q7BA 5DCLA 2BM0A 2C98A 1I2AA 3JRXA 1F06A 5ADHA 1CC1S 1KSHA 3OU7A 2VUSA 1M7BA 4WOJA 3ZXYA 1YBVA 4RA9B 4YCNA 1FZTA 2NT4A 4KNVA 4HWTA 3NHPA 4ZALA 1UKZA 5A7HA 1W0KD 4KIWA 4M6WA 2PLNA 4YXWA 3T12A 1N2CE 2V7VA 1KEWA 3AIKA 1BSVA 4DSKA 5I8ZA 2CLEB 2XLBA 2RHMA 4D74A 4PANA 3HCEA 4DA9A 3WSWA 4EJFA 3VSBA 2G0NA 2O2EA 1KP3A 3DT9A 3D8RA 3PHJA 3F46A 4RQBA 3UO8B 4AZVA 5L3QA 4G5GA 4MI6A 2DM6A 4EHHA 1GITA 1R1DA 4A3SA 2HNKA 5CMLA 1UFOA 2I62A 4X44A 1XO1A 2QTAA 1SV4A 1OI7A 2AEJA 4W5WA 3E7PA 1UEXC 3KQTA 4H1UA 5DVZA 2I34A 4JI1B 4Z4EA 1VL1A 1ETHA 4OQLA 1B0ZA 1ZEMA 2EC5A 4AZ0B 4KLHA 3E84A 4HDCA 1NOIA 4Q37A 4W1RA 1H5QA 4LCJA 1AKWA 1ZJWA 1KF0A 2E82A 2VJ5A 2GCOB 2ZETA 4X64B 1L5NA 4EY4A 3LK7A 3U56A 5ELXA 1VKZA 1GQQA 3R7FA 2O8FB 3F5AA 1EWTA 1KEVA 1QCZA 1G8JA 1PU2A 4MUHA 1SQ5A 4RL6A 3T35A 2AGQA 1YTLA 3OECA 4DRYA 5BSUA 3AVUA 3RASA 3B9PA 1PVPA 1QR6A 3TH5A 3O31A 4MEXA 2H08A 1S9DA 3LFUA 1IATA 2JFQA 1MTZA 3MGKA 4S2EA 3AF5A 4UNQA 2CJPA 1T8PA 4FGJA 3I9FA 3VTKA 1WZIA 5GWXA 1FDSA 1H8EA 1T3HA 3V32A 3CFYA 4KMMA 4MICA 3H2GA 1H1DA 1IWPB 2FSVA 4IDEA 1U4SA 2V3WA 4KFSA 3A9VA 4DL3A 4IYRA 2IZ6A 1KETA 5GAJA 1Q83A 5E95A 2CL7X 2H1SA 1I6KA 2YN0A 1KKUA 4X94A 5JSYA 4LF5B 4X1KB 2AQ0A 3TLKA 4DPMA 4PW0A 4ECTA 1SCUB 3U3JA 3GNQA 4DSTA 4OHZA 1MC8A 3FDSA 5K2OA 4M46A 4Z4IA 4RF2A 1E1RA 1NZFA 1M76A 2CMDA 3CLRC 3GMSA 4N0PA 5EZSA 5CBKA 1U9CA 2QLNA 4HF7A 1FRFS 4OI0A 1HEIA 3FGZA 1IOVA 1U7HA 2AHOA 4XZ3A 3U3OA 1KSPA 2FMHA 2MU1A 4ZK6A 1P2UA 4IRDA 1XDWA 1I36A 2QD4A 3ZIUA 3EGCA 3QHAA 4ICIA 3AOGA 3L7CA 4QICA 4M9RA 2AGOA 3FG9A 3I2HA 1TYAE 1NPDA 4XJXA 3NO4A 4EHIA 4MUBA 2FTKE 4GXNA 3FPGA 1Y42X 1BRMA 1Q1EA 4HVAA 4JXKA 3S29A 3P9IA 3ZHUA 4NBLA 5ALKA 1PP4A 2C3PA 4CM4B 2J6CA 4C7MA 4Y1GA 1D1TA 1Z6ZA 2P6UA 2O8VA 2ZSDA 3LYHA 2B94A 3PQ4A 1BPZA 3PD0A 8GPBA 5D46A 2HH9A 3BMNA 4F5ZA 4RD2A 4OMCA 3VVMA 2QZ9A 1OZ0A 1X7WA 3PYXA 5KYUB 4Z4FA 2W6ZA 4B8YA 2FX2A 4FNMA 5JR3A 2PXHA 1YDFA 3RUHA 5KTRA 4YP6A 5KNLA 2ZRGA 2DY1A 4EJSB 4M9QA 7ICKA 5GONA 4PAQA 5H81A 3TLAA 2JCYA 3WNCA 4X7RA 3VZPA 3KBOA 1TTPB 4OHMA 3CKMA 5D85A 4G9BA 3ICEA 4GP9A 1ZYUA 3C3BA 2JLRA 2OXEA 3C98A 1FJHA 4J0CA 3IULA 1X9MA 2B35A 3BWDD 1LQUA 2W2LD 4NABA 4ZO7A 5FPKA 4O2BB 3EBOA 1BMTA 3V6LA 1HSZA 2VFAA 4Q1VA 4YBRA 9ICFA 2X0JA 3N3AC 1UMBB 2VAVA 5DQGA 3TAQA 4P82A 3M82A 2YN4A 2ISPA 4X1YA 2QAGC 1NW8A 2ZU6A 4LI3X 1QGOA 2XJ9A 4MIEA 1BMDA 2OFFA 1XLVA 3MCVA 4WZBA 4BNTA 3K2QA 6YASA 1OTHA 3GJ6A 1WEKA 1VIVA 1YWGO 5B6PA 1KS2A 5GADl 2IE0A 1V85A 1RJ9B 2IA5A 2WTBA 1XDZA 3OPQA 4RLHA 4KGVA 2PWPA 5A3SA 3D3QA 3DT8A 2EV9A 3IV6A 2IHVA 3U1VA 3GEDA 1IN1A 1V8ZA 4FZNA 3HB1A 4WEQA 4JBGA 1HYEA 4DMRA 3O7MA 5T5QA 1SC1A 3T95A 4BMXA 5BR1A 1IK4A 3MPUA 4L85A 2O8EA 2Y1XA 1DAHA 2W9MA 1NUPA 2KPOA 2VSFA 3BHIA 1NF2A 3G02A 3NS7A 4Q7MB 3E15A 4CHGA 3W06A 1QPZA 3I0MA 5KL8B 5LB4A 2ZULA 3H5WA 2P75A 2WKSA 3AJEA 2PYIA 1DIGA 3ANMA 4N0DA 4RK0A 3A25A 3AZOA 4KLAA 2H1LA 5HKKA 1MA0A 2A1TR 3C1TA 3Q7SA 4O6VA 5DYNA