2CN1A

Crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)(casp target)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cn1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2cn1A01
1T5SA 5ALKA 3KDPA 4UM5A 2X4DA 5ALQA 1TE2A 2MSNA 4L6CA 5ALUA 3RFUA 1QQ6A 3WKCA 2WF9A 5AVVA 3K1ZA 2G08A 3DV9A 4B6JA 5ALXA 3MN1A 2RAVA 5ALTA 4EX6A 3AR6A 5ALJA 2GFHA 1SWWA 4G63A 4DFDA 3MMZA 5ALYA 5AKJA 3ZTYA 2ZBGA 4J2TA 1Y8AA 2G1AA 1RDFA 3CZ4A 2B30A 1YMQA 2FDRA 1L6RA 1ZD2P 4HGQA 4EENA 3PGVA 3ZW7A 2HSZA 3A1EA 4IG4A 4J03A 3L8FA 3L8GA 3ESRA 2HF7A 1L7MA 4EZEA 4BX3A 2CFSA 2FPUA 1O08A 3OCXA 4FYPA 3IB6A 5AKGA 1EK2A 1NNLA 4EELA 1IWOA 2YBDA 3WKBA 3ZWKA 5AI8A 5AIAA 3ZX5A 3EPRA 4F72A 4H1WA 1RKUA 2JARA 4RETA 2YN4A 3QLEA 4DW8A 4Y2JA 2WHEA 1U7OA 1EK1A 2YFYA 5AW0A 3M1YA 5AVSA 3W5DA 3EF0A 1NF2A 3NALA 1CR6A 1SU4A 3ET5A 1RPZA 2W43A 5ALOA 2O9JA 5JJBA 3OPXA 3ZVNA 2ZXEA 4QJBA 4HYTA 2C88A 3L7YA 4CF4A 3W5BA 2EAUA 2P27A 4CF5A 2C9MA 3N28A 3N07A 2B8EA 1Z88A 1RMYA 5A3RA 4YIHA 4NV0A 1XP5A 3SMVA 4RESA 3NIWA 5AKIA 2YY6A 2HCFA 3QUBA 3RF6A 3KD3A 1S8OA 3QYPA 3DNPA 1U2SA 2EATA 4CF3A 4BEVA 1QH9A 3WK5A 1XVIA 3ZU6A 3KBBA 3M9LA 5AW3A 2DQSA 3QUCA 4NWIA 5AW1A 2HOQA 4DCCA 3FGOA 3PDWA 4Y2RA 1U7PA 1RLMA 2GHTA 4UU1A 3A1CA 3ET4A 1K1EA 3U7HB 2AGVA 3J7TA 2EARA 2FPSA 3WK7A 4KYTA 3MC1A 3B9BA 3VAYA 2W4MA 5AM1A 2YJ4A 3L8HA 5AI9A 1RRCA 2CFRA 4C4TA 1Q91A 3QU9A 3ESQA 3L1VA 4L57A 2HHLA 2AMYA 2QYHA 1JUDA 5T41A 2HO4A 1WVIA 1FEZA 1J8DA 3ZUPA 4CNQA 3IJ5A 1S2OA 1Z4JA 2I6XA 4UARA 3QGMA 2OM6A 3OCVA 2FPXA 2CN1A 4BX2A 2RB5A 5AVYA 3UMCA 1CQZA 5AK4A 3SF0A 2BY4A 1YJ5A 2WF8A 3I28A 4JB3A 5ALHA 4XE5A 5IT4A 3U19A 5AW8A 3QU7A 4XOUA 3WGUA 1Z4KA 3KOOA 4NABA 5ALIA 3DDHA 2YMMA 4YCLA 3QUQA 4I9FA 3WK6A 2R8XA 3U7FB 3SHQA 3E8MA 4HAIA 4KX5A 1AQ6A 3CNHA 1ZRMA 1O03A 2I55A 2B0CA 5AVZA 3ONNA 5AKKA 4ZEWA 1Z4NA 3WKEA 2JAWA 3SLRA 5A3SA 1Z4PX 1Z4QA 5AVQA 1L7NA 3ZI4A 2W11A 2PR7A 2VKQA 3W5AA 2G06A 2BDUA 2GO7A 5AM0A 4E88A 2WF6A 3GYGA 5AESA 1PW5A 3KZXA 3EWIA 4Y2SA 2RBKA 3A3YA 4UMVA 4XPZA 2JGAA 5AHXA 1ZRNA 5AKZA 3EF1A 1T9ZA 2P11A 4NAVA 2O2XA 1VJ5A 4HGNA 5AI6A 1SWVA 1N9KA 3WK4A 2Q4RA 1WZCA 2BDEA 2NYVA 2G07A 4Y2VA 3OCYA 2I7DA 2I34A 5ALPA 2PKEA 5FP0A 1RQLA 1WR8A 5AVRA 5AICA 5AVWA 1Z4OA 3AR8A 3QU5A 3SD7A 3FPSA 5AK3A 4MUMA 5ALNA 4BYGA 3NASA 1F5SA 4YGYA 2R8YA 1L8OA 2I33A 4OHFA 4UM7A 3ZX4A 2Q5EA 2FI1A 1Q92A 2RARA 4AS2A 4FE3A 3N1UA 3AR7A 5A3QA 3WKDA 2HX1A 2HF2A 3R4CA 4BKMA 3TLMA 1L7PA 3U26A 1Z4LA 2C8LA 4CE6A 1RMTA 2AH5A 2WF5A 1YNSA 5AK5A 2R8ZA 3WK9A 3PGLA 1Z4MA 2FUCA 3ZTWA 2JAOA 2OA0A 4QQFA 4KX3A 5AVUA 1ZOLA 2G09A 4HGOA 4UW9A 2YJ3A 5AKXA 4YH1A 3E84A 3UM9A 3I1YA 4ZEXA 1WPGA 1NRWA 1RLTA 1VFPA 4UMDA 5ALMA 1Z5UA 3L8EA 5AKHA 2YMLA 1U2TA 3HLTA 3E81A 3B8EA 3DAOA 5AKLA 4Y3UA 5ALWA 1RC8A 5ALVA 4Y2TA 2B82A 5AW7A 1QQ7A 1TJ5A 2HI0A 3A1DA 5ALSA 1YDFA 2QLTA 5AW6A 2IYEA 3HYCA 2P9JA 4F71A 2FPRA 2ODAA 1KYTA 3U13A 1LTQA 3AR3A 1T5TA 3I76A 2ZOSA 4YCNA 3N5KA 2B8JA 2OBBA 1ZD3A 2FPWA 1N8NA 2IOFA 4KNWA 4BBJA 5AI4A 4EX7A 3FM9A 3UMGA 3BWVA 2NO4A 3NRJA 4KN8A 3KC2A 3ZWDA 5AI5A 3OCWA 2GMWA 4Y2XA 5ALZA 2IA5A 4I9GA 5AKEA 4GXTA 3QXGA 2WFAA 1YS9A 2AUTA 5AM2A 3AR9A 2C8KA 4FFDA 1L8LA 3WK8A 3F9RA 5AW4A 2WM8A 5AK6A 5ALRA 3W5CA 1XPJA 4DWOA 5AM5A 1TA0A 3IRUA 1MH9A 3AR4A 4HGRA 3NANA 5ALEA 4PNHA 2B1RA 3QNMA 5AVTA 3P96A 5AI0A 3ZVLA 3OTQA 5IT0A 4MWOA 1Z5GA 3MPOA 3L1UA 3ED5A 4G9BA 2CFTA 4C4SA 2IOFK 1LVHA 2YMPA 1ZJJA 1TJ4A 2Q4TA 5E0OA 5AW9A 4BX0A 2D2VA 5ALDA 2FUEA 4OD0A 2G80A 3NAMA 3I6BA 1RLOA 4BEWA 3D6JA 1VJRA 4UATA 1RKVA 3OCUA 4OCZA 3SKXA 4Y2UA 3U7GA 2IOHA 1YV9A 2P69A 4JDPA 3B9RA 4AS3A 5AM4A 4UMFA 2NO5A 1U02A 2OYCA 4OFZA 3OCZA 4GIBA 3R09A 3QX7A 5AM3A 3FPBA 4EEKA 1ZS9A 2ZBFA 3QUTA 2GHQA 3E58A 2G0AA 3NUQA 3PCTA 3QU4A 2YJ5A 3S6JA 2PQ0A 4UASA 3SKYA 3WKAA 4UAVA 2ZG6A 3N8GA 2MU1A 5AVXA 1L7OA 3AR5A 5AKYA 5IS2A 5ALLA 5AW2A 5AIBA 3WGVA 4UMEA 1QQ5A 1J97A 4C4RA 2WF7A 2HEGA 4AP9A 2ZBDA 4Y2QA 3L5KA 4IFTA 4L6AA 5ALGA 1ZD5A 1TJ3A 4BNDA 2R8EA 3R9KA 1RQNA 2B1QA 4UU0A 3U7EB 4KNVA 1RKQA 2HDOA 4YIKA 3L0CA 2YJ6A 4ZEVA 1ZD4A 4NFLA 1Z4IA 3AR2A 4O8CA 5AW5A 4BNDB 3L0YA 1RMQA 1QYIA 4XQ0A 3ZVMA 2JAUA 2C4NA 3QU2A 4HGPA 2FEAA 3FZQA 2I54A 3L0BA 1X42A 5ALFA 2YMQA 4YCMA 2ZBEA 3FVVA 3BA6A 4UAUA 4Y2YA 3UMBA 4Y2PA
chains in the Genus database with same CATH superfamily
3B6JA 3OTIA 1GSOA 1S2NA 5I4BA 1X13A 4BO2A 1J0XO 3LA6A 3GEBA 3SBXA 4LPKA 2X19A 3X43A 2E55A 1YZYA 3HKDB 2FW8A 2K8CB 2VJQA 1FXWA 2HY7A 4UUNA 1V37A 3U7RA 9ICEA 1H5UA 2J9FB 3GEIA 3VVMA 3HABA 5D6NA 1OXJA 3BVPA 3UJPA 3V4ZA 4X00A 2IITA 4AJPA 1UQTA 3SDZA 4Q47A 2VF4X 4Q9LA 4NP6A 4LE2A 1QFSA 4EPVA 2QUKA 3IB6A 2IZOA 4NLLA 3TB6A 4FZVA 1BA3A 1QF6A 4N41A 3UWKA 3IELA 3EOBI 4NS1A 3U1BA 1B6GA 3FKQA 3PEYA 4O59O 5BSEA 4YJDA 1WXWA 3I8XA 4GVPA 1PR6A 3H1BA 3KAPA 2NT3A 1JA9A 3K9NA 3ESDA 3CKKA 4F9GA 1Q0RA 5CDGA 2CJXA 1NVEA 1MX1A 4RX1A 4HDKA 5AW3A 4Y2GA 1C7QA 1OCEA 3P2EA 5F2OA 3HJAA 4OBBA 4HNUA 4NYMQ 2FQYA 1T3LA 1KAEA 3FZEA 2H5LA 5HJ2A 4KODA 1JQKA 3GLHA 2P6PA 3ND7A 1H3NA 5A5DA 3CVJA 2HHXA 2BFWA 2UKDA 1OAAA 1LBQA 1WPXA 1BHO1 2QOEA 3QUAA 1N6NA 4FUQA 1Q7BA 1N32B 2MYPA 3T1NA 2XQVA 4KLLA 1MVOA 1NYLA 5J63A 1SVNA 1CEXA 3SFVA 3TN7A 1CRZA 3K35A 4JGBA 3MW8A 1AHIA 4RQAA 2C5EA 3RBZA 1OFTA 4JP1A 2OZLA 3KXPA 5ICGA 1M76A 3L0IB 2QTWB 1AF7A 5AOBA 5AM0A 1C9MA 3UJCA 5B4TA 4HWTA 2BQ3A 4U2CA 1IM4A 2GEDA 5LQMA 4IEFB 1VA4A 3WS7A 3TDMA 1DZIA 1HDCA 4XGKA 4URZR 4UCXA 4TKVB 3C6BA 1W44A 1JF8A 3ZGXA 2FMUA 4MDYA 2BUBA 3OIFA 4MPTA 1D1PA 3TECE 1AUXA 1N7IA 2JHFA 2XTAA 3HMQA 3D2NA 2GJAA 1RPLA 1EJ6A 5LZ4A 1IPHA 3HDTA 2N9UA 5AHKA 3OPYI 4DM7A 2OCXA 5C51B 3HLTA 4KVGA 4Y3UA 3CWZA 2IYQA 1F38A 1TJ5A 3GFPA 2VHUA 3TCNA 2YV1A 4AXXA 3OJLA 5K0TA 4UDYX 1BHJA 3D7LA 2J4FA 1E18A 1VBFA 3Q3JB 4Z5XA 4NESA 3LQ1A 2LHTA 4WOJA 2AN4A 2QTCA 1KYYA 3DE5X 3L7NA 3CIOA 1XNSA 2HR1A 5AD1A 4QZ9A 3WDSA 3CPSA 3NBYC 3W6PA 3KFVA 2CYBA 4PWZA 4E2FA 4MQBA 5JUMA 3V8QA 4YT5A 4BQIA 2E18A 5HE8A 2HJ9A 4ZCLA 3TLYA 4OH1A 3A4VA 5EXSA 3ZHZA 4YAGA 3DBVO 4W5QA 3QTBA 5FAKA 4EYHB 3REOA 5F3RA 5J47A 3ZE1B 4OCZA 3L4SO 4PC3A 3S2UA 1QIGA 1Q1BA 4RZHA 3PG5A 1Y33E 3NJ8A 3RV3A 4G1CA 3MJVA 4C89A 3KYBA 1RXCA 2V65A 3AQ4A 5DNAA 1OV4A 2NTVA 1JHZA 3C3BA 2YTUA 2WJAA 1PL6A 3G13A 3FD8A 2JA2A 3RD5A 3PSTA 1GGKA 3D7NA 5J8YC 3QJ5A 5FLXA 4CM8B 5AW5A 1DBWA 1RMQA 4CKWA 1V3VA 3W9BA 3EVTA 3N0WA 1LS1A 3DG9A 2ZBEA 2G1JA 3U44A 1CUKA 4LWOA 1BEZA 1L7XA 1ZINA 2A9JA 3QEMA 4QFDA 1OREA 5B4VA 1RJ9A 1SHTX 1I36A 2H8KA 4C0HA 4WZAE 1D1SA 2WQ7A 2BCJQ 3A9UA 1NI3A 4I5DA 5EWLA 5JOQA 1I3MA 3NHRA 3P26A 4XTCS 3X1WA 4ETNA 4ZTBA 3TVYA 4JBXA 4XWKA 3CP8A 1SCIA 8ICCA 1U2QA 4GM0A 3OEHA 1JTEA 1IUPA 1CULC 4R5MA 3ZWKA 1U9JA 5E2AA 3EGXB 4DREA 1KQGA 2ZS8A 4OHBA 1ZQFA 1SZPA 1T15A 3DUFB 3L1KA 2QV7A 5MGNA 4FDVA 5AVSA 2F1RA 1V38A 4RULA 2EAOA 3AY0A 1BN6A 4ZP1A 3C2QA 3AERB 3HWTA 5AR1A 3WE7A 2KJ9A 4FLEA 5G4KA 3CW2C 1G5QA 4JMUA 3FVQA 2P27A 4TQGA 1NONA 3VSEA 2B5WA 2LZ0A 1HUQA 3FAHA 4MV5A 1EM6A 1TEVA 1Q8KA 2GZHA 1NBME 4IJUA 3WK5A 3KB8A 2C42A 3M9LA 4B9TA 2G8NA 1FTWA 1L7DA 4EL5A 1CUGA 2G88A 4FBLA 4LSZA 2AC4A 5IJ0B 1LQ2A 3C3DA 2DBQA 1E3MA 2H4WA 4L5YA 4NPCA 3GWGA 3F9CA 3KDSE 3OQHA 5U4QA 4QSMA 2ZT7A 4IWYA 1VYHA 4K3VA 2VT7A 4GGMX 1O6BA 4QDUA 1BKSB 4BRWA 1IONA 1PKXA 4M89A 5GTDA 3FPCA 3QPCA 2RONA 2ZCJA 3P0JA 1F6WA 5KHLB 1E2NA 3MRSA 4BE7B 4QDKA 3GDOA 1EINA 4HGZA 4PBSA 4BN4A 3BRSA 5KU1A 2I2BA 3B1JA 2D1TA 4DMFA 1IBKB 1JHAA 3PUVA 1SO8A 4ZCSA 1Z63A 4QGFA 3L77A 4DA4A 1A76A 4C22A 3V8RA 4EPWA 3NFRA 1VCNA 1AKWA 3UJHA 3GZNB 3JATA 2JFZA 3OZGA 4A2CA 3RVNA 1ZWKA 3KEMA 3MLEA 1N60A 4DB4A 2VJKA 1FNMA 3THXB 3QV2A 2FWBA 4BEBA 2FWJA 5IANA 1GR1A 1ARZA 2CHEA 4TUPA 4GDMA 3S68A 3SSAA 2WF5A 4OYRA 1DP4A 3AZOA 1DV1A 4YDQA 1Z2PX 4BVGA 2NXWA 2DF8A 1U3UA 3S8YA 2Y0BA 4PZPA 3E84A 3LX5A 5CVTA 4MWSA 3K31A 2NRXA 1QLHA 1C8KA 3K0CA 4JBHA 3WMXA 1XX6A 1VE5A 3EHEA 4E6EA 4AULA 1U2TA 4MRNA 2KHQA 4YRFA 3FWKA 2FE4A 3GT3A 1I7DA 1A5SB 1ULAA 4KWIA 1KYVA 1J8YF 1YK0A 4XLTA 3TXXA 3E7WA 1FRNA 2RHTA 3MRVA 5HRCA 3MB5A 4CLRA 2QXYA 1ND5A 2FPWA 2VUHB 2ZRBA 2H9IA 4BWFB 3O4RA 3HLKA 4RAOA 4PO1A 3RHSA 1UMCA 2AKYA 4GNRA 3RB8A 1PSDA 4N82A 1SEPA 4BQNA 5AKEA 1ZQ9A 3Q0TA 1EQ2A 4IQTA 1E60A 3MHPA 3UYKA 3BOSA 3THVA 3EFHA 3THRA 3BH0A 1ZD8A 2E0IA 5DGHA 2WWWA 3T9BA 2EIXA 1SQSA 2V98A 4CYMA 3EAGA 3CS3A 5DO9A 3PPXA 1QFYA 5KI6A 2CLCX 1JEAA 2M6KA 2IV2X 3H1PA 2DLDA 3RJIA 5SZJA 1NDHA 1SUPA 3HT3A 4C87A 2RK3A 2OV6A 3KYCB 2IQIA 1WHTA 1O0BA 3AMVA 1F48A 3OJFA 4RVSA 1EUZA 4L8YA 1Q0UA 4DEVA 1JDPA 1HTBA 3I5MA 2GASA 4HRYA 2QRQA 9ATCA 2PPLA 1NK8A 1R2QA 3SV3A 1FVOA 2R2GA 3ECSA 1MRZA 3K16A 4LISA 3SZLA 2JH3A 3ZKWB 5IRCD 3N2GA 4CM4B 3FTEA 1QRUA 5CB1A 1OXBB 1GDDA 4RKYA 4F4ZA 2JRZA 1YR9A 1AO0A 5J4LA 2BBOA 1QVRA 4KLJA 3IEIA 3D2BA 4Y2YA 3WYCA 4UUAA 1UINA 2FFAA 3OESA 5BSTA 2FPGA 3EUAA 3V46A 1MO6A 3SCZA 2SKEA 4CMKA 2QIOA 3TG2A 5J2UB 4R2IA 4A10A 2WAQF 4KGVA 4JBNA 3GLFA 4AY4A 2P2DA 3E61A 4N3CA 4Z0NA 3UAGA 1V2HE 4FFLA 5DNDA 1RWVA 4E14A 1JFTA 4N7BA 4A7PA 4N7RA 2JFPA 1PNRA 3H13A 4N5MA 2IYVA 4BPBA 3ORSA 5F51A 3OSPA 2QE7D 3GRZA 3O0DA 3TZCA 4YJ3F 5I01A 5KNIA 4Q9IA 3R9WA 3P5SA 4L8LA 1E5QA 1Y7PA 2E1PA 1JDTA 3SM3A 1KFKB 4FDAA 1SRRA 3SMVA 5CD1A 4DCSA 4JOBA 1XTKA 3BFKA 3ZDFA 4OM7A 5CEEA 4PC1A 4Z8XA 3RK0A 3QFTA 4RQMA 2GZ2A 2EZUA 2WUGA 1NFRA 3T38A 1F9EA 1KFCB 2R1TA 4H3KB 2A3VA 1AKVA 3DBRB 3V6JA 3O92A 4B6PA 4JCOA 5CBPB 4Q7EA 3PUJA 5D6OA 5KFOA 3QVGB 1JI0A 4IIVA 2PUJA 4MVYA 5IDYA 3PNKA 2HM7A 4V0ME 3MJ4A 1QG0A 1J2MA 3OZBA 5KNBH 2K2WA 1WE2A 1U8AA 1PO7A 1ZN8A 2PQ6A 4XFDA 4WY2A 3HPRA 1BWQA 2EGUA 3MGVA 2IIQA 3O2NA 1P0QA 3LPMA 3HBLA 3KOXA 4YP9A 1HT1E 1YFLA 2VZ0A 1RXUA 1Y34E 2IEDA 3GNQA 1NMXA 4EF5A 2AFHE 3KXDA 3UWSA 1R0LA 4LGMA 1ONSA 4UB4A 1X1AA 3TX6A 1NJ8A 2IXDA 3DZHA 4JK1A 1U7XA 4U2KA 4WASA 5SZIA 1N1EA 3UICA 3LPLA 4FFRA 2HPVA 2QT9A 1PAUA 1G5HA 4OJOA 3BFPA 5H9WA 3HB7A 3JQAD 5FWAA 4KRFA 4J75A 2GNOA 4EAQA 4O33A 4HNQA 3OQIB 1XVLA 4EY5A 4QOFA 1ZCFA 3F6YA 4UEWA 1AKMA 5ETJA 1LSOA 1R6TA 4IVNA 5FHQA 1XSPA 2VAVA 4EJSA 4TSKA 1RQ2A 4TM7A 1I13A 2JLCA 2GXAA 1L4BA 1T1IA 3IVGA 1CFJA 1LU9A 4J49A 1DOQA 3GFQA 3WNZA 1VPEA 4O25A 2KYRA 1N92A 2Y1LA 3R7DA 1UADA 2I2FA 1C7EA 4C6TA 4H16A 3AB8A 1MN6A 2W6QA 3DJFA 2VZEA 2FMXA 1W88A 2AFIE 1VQ1A 1RZRD 3VC3A 3UXEA 2FLPA 1ISJA 3TAPA 1PK3A 2HLHA 1KSPA 1WZIA 3M6ZA 1LX7A 3VR3A 3FDIA 3QJGA 4CMEA 2JFXA 2H1RA 2W2XA 3MDAA 3LS2A 5KU7A 2ISPA 5I9BA 4U7TB 4B4WA 1XRSB 1OH7A 4GVLA 1TKDA 5JNUA 5EKSA 1Z1BA 2AOUB 3KSMA 4ISCA 4C6HA 4CCYB 5IM4A 1U02A 1DLIA 3PQ2A 3SVTA 2CB9A 4ELUA 3ZQKA 3KV3O 4LRYA 3ROZA 1ORTA 1G7TA 1CDOA 3KLNA 2G82A 2GAFA 4JI4B 3ZJ5A 5ECWA 3N86A 5CDHA 3UIEA 3SAJA 2VNJA 2E87A 1IHUA 2QS9A 1ZD4A 2HCTA 3ZWNA 1WMDA 3IXQA 3G2KA 2XCRB 2VNIA 3O84A 4MPRA 2GN9A 2HUNA 4OQMA 2PMZC 1G5RA 3BXPA 2NU9A 1T1RA 4GOJA 2B69A 5AVVA 4DLPA 3CRMA 4G63A 1M0TA 1ZETA 1BA2A 2PL9A 2PQMA 1CUUA 4DIFA 4NU6A 2XCAA 2QSYA 4IDGA 1D6SA 5MFZA 3N7SC 5EPUA 13PKA 2C28A 1T2AA 2PRJA 2ZKLA 5BRNA 4LZWA 3QY9A 3ZX5A 4R8KA 2BDPA 1G3RA 4H6XA 4DQDA 2BFFA 4BFTA 1G60A 4P4UA 3PJFA 2JEJA 1XTIA 3F7MA 3I32A 4CQMD 3JVUA 4BCDA 3EZGA 3CEAA 3WYDA 5ILQA 1MAWA 3BQ9A 1ZU4A 4LE0A 2W0MA 4CF4A 3PYLA 4OBWA 2W48A 5JJKA 1XNQB 1FP1D 5BVGA 1G20A 3MSCA 4RVCA 4YR7A 1XRNA 2W8LA 2W6OA 3HJHA 4FIDA 1RQ7A 1CUAA 4I4TA 4GH5A 4NWIA 5HKAA 1YIOA 4MP8A 1TQ4A 4XIYA 1Z6XA 4JZYA 2YUIA 4HQRA 2ZCVA 1K8YB 3IG5A 4F21A 1NIJA 1KDZA 4D0LB 2J7PD 1SXGA 2BR5A 3VPSA 1I6MA 1T8SA 3TD2A 1WMEA 4GQAA 2X0EA 1OY1A 4G8DA 1WBDA 3INRA 7ICQA 1VLHA 3G9TA 1V5IA 3GNSA 2X1MA 5DV9A 1FFYA 3CF0A 1TCVA 2H2FA 1L9KA 5EPEA 4LBWA 4NX2A 2V7GA 3D7MA 2I4NA 4UXIA 3AG6A 2VKQA 1WCWA 1L5UA 4L73A 4MGYR 1DTSA 3THWA 1CIJA 2NWQA 3GYGA 4UQOA 2H3HA 5GIPE 3BZCA 2JIZA 3KE8A 4ZZ2A 2QTLA 5HIMA 5IG2A 1U5BB 4YJKA 3DLHA 1GDHA 2JAXA 4MDEA 1OSNA 4RPGA 2ONZA 4M8SA 2GKOA 2XEDA 3NJRA 4RW0A 2C9BA 1Q16A 4NYIQ 3VKFA 4UFPA 3DT6A 1CD5A 3T8YA 2OGTA 2FOIA 5JZVA 5KB3A 4EUSA 4W5NA 3RI3A 3O03A 3D6TB 4MUFA 4KPGA 1JZTA 5ITZB 2C9DA 3LFUA 3Q0IA 2FRVA 1TO1E 4ALMA 4K0KB 1WU8A 2WSBA 2H5XA 2O8DA 2XJ9A 2UZ0A 1QHHB 2R8BA 3PQEA 4XVCA 4LOHA 1FS6A 4KO8A 1MVLA 2HU8A 2B0JA 5KPDA 2J0EA 5AJXA 1U7UA 3FOZA 2BCGY 3H4MA 1B6SA 2FQQA 4W7IA 1FDRA 4C06A 3H40A 1JG4A 1EWRA 3UK6A 5JD6A 3ZBPA 4AO8A 2HPHA 3IALA 1US8A 5IABA 3CLVA 5ALZA 2JB9A 3HU2A 2WYOA 3ISCA 1YVDA 3ZN2A 4JI0B 4NLBA 1KU6A 4X8LA 4OA5A 2FFHA 1K89A 1LRKA 3D3WA 3AUJB 1X1SA 3LU1A 4F4JA 121PA 4F9TA 4I9NA 3K5PA 4ZU3A 5E0OA 1BPYA 2ZTLA 1F7VA 1LK0A 1LLUA 4GOKA 4HLUA 2LUOA 1PWHA 4O1IA 3HA7A 4DL6A 1ZIDA 4Q15A 3BSFA 3UPDA 2A9RA 3CPJB 4M6WA 3A1UA 1ZIPA 1TRHA 1TJYA 3D2AA 1X2IA 4DC1A 5EA2A 4A0FA 5GV7A 2PUEA 4FUTA 4LOIA 2HBQA 4I5IA 4IILA 3ZDZB 1GZ6A 5HCNA 4YUZA 5DWQA 1U0BB 3RSZA 1RYBA 1O94A 3TKAA 2P35A 4TWBA 4MMXB 2VA2A 2OXRA 2I4TA 4G3IA 5LP6A 5DTRA 5KSWB 3RBEA 1CUYA 1C30B 2OTCA 1GPBA 4GR5A 2C2DA 3S5UA 1PL8A 4I14A 5BORA 3RH5A 2W2MA 2AVNA 1D2RA 4QGBA 2REQB 5DLYA 2V7BA 3T0IA 1TQ8A 4RYDA 2PGLA 5HWSA 3B1ZA 1N2IA 2D3TA 4MVWA 4L4RA 5FKJA 1WG8A 5NULA 3THYA 1PT7A 1SN7A 5IJ9A 1RM6C 2WWHA 3CVWA 4P9NA 4EKGA 3KPYA 2BFNA 2WT4A 3T35A 5G53C 5LDDC 2NPFA 1YE5A 2ZVJA 1WUIS 2JK1A 1FFSA 4ND7A 2N75A 5AXBA 4RGVA 5DIFA 2FLLA 2P1DA 3B9QA 3I0MA 2VBFA 5KTSA 8ICHA 16PKA 4RK1A 4MGKR 4HXFB 2LPEA 2AC2A 4Z9XA 3TG8A 3N28A 2AOVA 2XW6A 1EJBA 3KALA 2YIVX 3QF4B 2H3FA 1H2HA 3KVVA 4HQ0A 3K05A 1QHSA 4UNSA 3BTSA 3OM8A 2YWHA 2WVAA 2C3OA 4DRXB 4OMCA 3IAM1 2ACEA 2AU0A 4MTLA 1JR4A 3M3DA 1BE0A 3M7IA 2O05A 4I4IA 4J9PA 1BVYF 2AD5A 4KE8A 2C9ZA 1G9TA 1D5CA 1AGNA 2DCMA 1Q91A 4DOAA 1CHNA 4Q9AA 5T41A 4RFSB 3C1AA 1N8KA 3PPVA 1G59A 4Y6OA 3QGMA 2JATA 1JJ7A 1VL0A 2BH9A 1MEJA 4X8MA 1HGXA 1SXPA 1V3UA 2M9MA 2RHOA 2G5IB 3NO4A 1Q57A 4CM3A 1DKOA 2L2QA 4GI7A 3NDJA 1Z8DA 4RGQA 3ETEA 4IIDA 4RGYA 4UULA 5THQA 3J81A 3WL4A 2VDRB 1ONOA 3AVTA 2HIAA 3RH4A 2B99A 4W9NA 2EBFX 2Y6VA 2X9GA 4AZ0B 3FJYA 1ESNA 5FLYA 3U7QA 2J31A 4P36A 3ERCA 3WRVA 1ZUNA 4KQ1A 3K1RB 3ICQB 1XK6A 1ORHA 3SD7A 1IPFA 3UGKA 2ZPAA 2IBSA 3QVTA 5AXDA 2MA1A 5CGQB 2R8YA 4G1EB 3FNRA 5BN5A 4GPD1 5J0TA 3V2GA 2HMUA 3NHAA 3TLMA 1W6RA 4Z4GA 3THSA 4D9EA 2ODQA 4JB8A 4ENPA 1CY2A 1HG1A 3PQDA 4ZZIA 4AJJA 2FUG1 4O2LA 3TSAA 3NRCA 1Y8RA 5AJHA 3IP8A 1X9XA 1WCYA 4YDSA 2C29D 4XD7A 1OX6A 1W75A 4MCAA 3GGJA 2XUFA 2V5UA 4DPKA 5I7OA 2OHFA 4XWOA 1T9DA 1ZD3A 1EGAA 1Y9JA 3KP1A 1JA1A 1E1LA 4HK4A 1FDTA 2QQ5A 1CY4A 1QCCA 1SL1A 5AI5A 2FSUA 1Q7RA 3IGFA 5CLQA 2IFTA 2PSJA 3PX4A 2A67A 3WIVA 2LDXA 1DAOA 2XOXA 4J1TA 4UFNA 1Q2UA 4JUDX 2X58A 1T4MA 1RS0A 5ALEA 3KX2A 5D87A 2F43B 1XZ8A 4I2EA 3UWOA 2K89A 1YA4A 1K3FA 4GE3A 4BCCA 1V9SA 3LF1A 4JBWA 3TFSA 5J2TF 1Y5NA 4Q1DA 1T3GA 3DO8A 2C8JA 5CVCA 2BRUA 4RD2A 3DT8A 5AHOA 3ABSB 4NOLA 3LY5A 4LFBB 5EGSA 1NK4A 1XU7A 4OU4A 2NYAA 2I66A 4O4LF 2NUBA 3Q11A 3RLFA 3QF7A 5DDYA 2PCJA 4Z0TA 3HVHA 4UE6A 4WFQA 3H2IA 5HXAA 4E94A 3EEIA 3QXXA 2YHBA 5ALLA 4RNMA 1RI4A 1UOEA 2EHDA 1C9DB 3LOUA 2NV0A 3GMSA 1LZKA 2W9CA 2WIFA 1F0YA 3N2YA 5AWFC 3GJQA 3IP1A 3KVYA 1MLDA 3LDHA 3DZDA 2BP7B 4EW2A 5JD5A 3KKNA 1WWUA 2E3TA 1H4TA 3KQWA 1UM8A 4HQOA 2WWYA 4FQ8A 1E4VA 3NYQA 2BEVB 2GN8A 3H4BA 4NE7A 4K2AA 2IYZA 1KA9H 4E1VA 2YRXA 4IDQA 4QW8A 3QVOA 1WPRA 2Q99A 5BN3A 1QB7A 2I99A 4EOGA 5DX8A 4JY7A 2YIJA 5JR3A 4ECTA 3I5UA 1Q0TA 4UTVA 3I83A 3GFTA 4G36A 3H8SA 5LWHA 3L7YA 3VR3D 2Q6KA 4US9A 2GCIA 2AOTB 3LGSA 2O57A 1S89A 3D8TA 2WTAA 3I9LA 3NBQA 3L01A 3OJWA 4IKEA 5CP2A 2MIIA 2JCXA 4OQNA 1LPAB 5IWAB 4PRYA 2ZRDA 3I6MA 3VTAA 2VK4A 4CTKA 1EFVB 3GA0A 1C14A 1OYOA 3VHRA 2XLCA 4RANA 5F35A 1Q11A 1QGUA 4KR2A 2YQEA 5JZ9A 5F1PA 3G79A 4XUSA 3L04A 1ISGA 1SOUA 2HJRA 9ICWA 2HYIC 1G17A 1N6PA 3MMNA 2JIPA 3OQPA 4FTWA 2VDMB 3RAFC 4CETA 3JQ9C 2OO7A 3N75A 3LLCA 4MLZA 4ZI7B 4I2JA 1PIWA 3UENA 3DEAA 1UJ6A 3JQ7B 1J24A 7ICSA 4BE9A 3EY9A 3L7KA 4LXIA 4WXRA 2ZPTX 4M55A 1TK3A 3NYWA 1CQXA 2H1FA 3PXEA 3MTJA 4H27A 1W85B 2VQ6A 2QORA 3UOWA 2FW1A 1T8WA 5FBHA 2OXOA 9ICHA 2Y1KA 4P82A 3S1LA 2OKCA 1KYXA 3IA2A 5H1YA 1EP3B 2NU7A 4ERXA 3T7AA 3BULA 4FOLA 4MO9A 4LK3A 2DECA 3C3JA 4X71A 2Q3LA 4Q1EA 2FTKE 4YMUA 3T5KA 1N4DA 2CVFA 3QZ8A 1SOVA 1JLRA 1Z17A 1JH8A 3PGLA 3IJPA 2XVYA 4RQ8A 2I6QA 3RC7A 1MIHA 4X1YA 3ZNQA 4PZ0A 2ZWIA 1IFXA 3L4KA 4CG3A 4D74A 4RKFA 3I5AA 4R9VA 3MPUA 4M0FA 2H07A 2GAAA 1GVNB 2FZLA 2PGIA 1D9FA 1F2TB 2OQVA 2F4VB 4DY4A 3KB2A 5LB4A 4XWGA 2W2LD 4KAJA 3RYFA 2ODNA 5IAGA 1L4HA 3STWA 2GBGA 4INPA 4EHLA 1YB5A 2WM8A 3I3SR 2O6HA 1K0UA 3LBYA 1FVHA 1MGPA 3WGNA 5JBNA 1AXRA 1N75A 3QNMA 2PIDA 1WB4A 3GUCA 5LMCA 3RS3A 3Q6IA 2OXCA 4KWHA 1BCRA 4J4BA 4MQLA 1M74A 4ARIA 2JIZD 5KFIA 3CLSD 2BGKA 3D4OA 3N0RA 5ARBA 1KHTA 1E89A 4DJEC 3ND6A 3TJRA 2AJQA 4ITUA 9ICUA 4YP6A 3NBZC 3WGOA 3DHEA 4KBFA 5EJ7A 3N05A 5G3YA 1DDGA 1K3TA 3H9BA 4DXAA 4FS3A 1JQAA 1TM5E 1SZHA 3PU6A 4Q9JA 5CT6A 2HA4A 1QAQA 3M1IA 1X9HA 3JASB 2CKDA 1HDOA 2QRGA 1ZIYA 5KPJA 2BBSA 3NHFA 1GPNA 4R1TA 2X2EA 3F2IA 5BWMA 2JLWA 4UHCA 1JX6A 3FPKA 1YULA 1DSSG 1B42A 4Y1RB 1R0ZA 2VT2A 3JQEA 4KLHA 4Z8YA 1Q3TA 2E4UA 2OG1A 4KPFC 3ENZA 1RQPA 1Z00A 1DX6A 4BDSA 5ESWA 3K1TA 3DDOA 4PU0A 4Q05A 2GA8A 2RGUA 2VDPB 3M6XA 1FTYA 5EP2A 1J2NA 2YV3A 1JAHA 1JX4A 1C7JA 2DM6A 4M3NA 5AVJA 1YCDA 5C7OO 2ANCA 4ZOCA 4IIJA 1E0DA 3W5DA 3Q7RA 5G2OA 3X3HA 2Z8ZA 1VI2A 3C28A 3PFHA 3TAXA 3BJIC 3PHCA 3SJCA 1A1SA 3VSBA 5JAMA 4ODIA 2KD1A 5BV2P 3IV9A 5A9TA 3OHPA 1LXCA 1Q14A 1IBSA 3VHQA 4L8VA 2HDHA 1SIOA 5TRTA 3DNPA 3GL9A 3UO8B 4YMMA 2ZI6A 1FFHA 3VR6H 2DFDA 4EUNA 2YWJA 3AU6A 5TR9A 3A04A 4PIPA 3JZIA 4COKA 3RVDA 1D8BA 1AN9A 3CLTD 4XFKA 1I30A 2ZDGA 2XUZA 4EHDA 2P6MA 3T99A 3BD8A 4L57A 3CUSA 1O94D 1Y82A 1JFFB 3T7CA 4ND8B 1OV6A 3KJIA 3VU3A 2WF8A 3WLAA 3BS5B 4HL6A 3NB0A 3GRRA 4J16A 3WI7A 2Q7DA 1Y8ZA 1A5ZA 4LRUA 4L4XA 4BGIA 1WB9A 4B9EA 4I3FA 2QE7A 1QTMA 1MQSA 5CA0F 3TINA 2P5TB 3EZLA 4QSHA 4PCLA 4ZAXA 4QPPA 2ZRQA 1KEKA 2EZ9A 4MRMA 4D0NA 4YN4A 1NT2A 3NAGA 4OUKX 3EWSA 1JIHA 4DIKA 2C7VA 3P45A 4ACAA 1D03A 3PA6A 5KG5A 2P0AA 1XXHA 2WM2A 1ZRSA 4HYYA 1JHUA 1XEXA 2NP6A 4AO7A 1XRMA 1ZUWA 2W37A 3B60A 3T52A 5J1TB 3N1UA 4F9FA 1WB5A 3QTTA 1S0VA 1XVVA 2WU1A 4QUBA 5EMHA 3A37A 5THKA 4TPKA 4EYIB 2GH1A 4I2VA 2I62A 1CUBA 3CN7A 1P1FA 5A4AA 1NRWA 4YYZA 1VFPA 4PRZA 2RAPA 4Q39A 3CZ5A 3T7IA 4OIMA 3PUXA 3PCRB 8LDHA 1FQWA 3HBFA 4ON9A 1DAKA 3OQ6A 4LXGA 1MTZA 3KTAB 3U13A 4B3HA 5C0YA 2RLTA 1RWXA 3BSYA 1O9GA 4LEIA 4BGUA 1FDIA 1JEQA 3LDGA 5KFRA 2Z6AA 4DTIA 4PZLA 4AKTA 4WNAB 4FR0A 3TJZA 1WUHS 4ACBA 5BSRA 1N62A 1CERA 1XRPA 5AI0A 4MWOA 4Q3DA 3X44A 1WHSA 1FTNA 1J2YA 2W04A 3IHTA 4AIIA 4YV1A 3DE6X 9ICFA 1I1NA 5C2JB 1E3WB 2QB5A 1J2TA 2X9QA 2O23A 3H2BA 4MVJP 3QLVA 2ZYVX 3OD5A 5CLFA 4C20A 1VLVA 3JQAA 1QGAA 3M5PA 1IHPA 5U4XA 5CK5A 4UMFA 2R00C 1F2VA 1EM8A 1GO3F 1OXMA 1QZXA 1O3YA 3CW8X 3IILA 4ZZ0A 3FZNA 3AKCA 1M2FA 1OBCA 4QUIA 1DG3A 1K6XA 3ECCA 2WDPA 5JBIA 1WXHA 4PHHA 1RKQA 3L0CA 3AP1A 5DGTA 3GWZA 4A8TA 5D84A 2QQEA 1SB9A 2R96A 4FGKA 4ZT3A 2XUJA 1VLMA 3EXIB 3SYRA 4KJXA 4YRTA 4RMHA 1JG7A 3TTTA 4QYXA 1RZRA 4XD7D 3N87A 3BM5A 1U9IA 1P2GA 1UBHS 1EVIA 3KTFA 1B41A 4J76A 4KB5A 5BRJA 2OZPA 3VKWA 2PWAA 3NEJA 4HUTA 3A6DA 2Z5GA 4F5OA 4TL6A 3F2DA 5GVRA 2NW6A 4PNEA 3HCNA 1YRYE 3IP5A 3RC8A 1MO2A 1WLSA 1PU2A 2XE7A 1IZYA 2PFSA 3F98A 3M1YA 2H3IA 1QOQB 1NSYA 3CX6A 4FCTA 5IINA 1Z16A 2C5GA 4TLLB 3GBVA 4RZXA 3DB2A 4ETIA 4IR7A 2O4UX 3PJEA 3FE2A 4XX0A 4ATNA 4YRGA 4CLHA 4KXVA 2IU3A 3AFOA 4HKTA 1UM9A 3ALRA 1WQ4A 3OM0A 5K8JB 4C8LA 3O4GA 4OGLA 4AI6A 4F5WA 3IR6A 3DAGA 3VZQA 1RRKA 4DCUA 2XYVA 1R0WA 3A9VA 5CYFA 4YJ2B 4HDKB 2GSWA 2ZJ0A 4P53A 3IVCA 1X9IA 5DU2A 4UQPA 4PHCA 4YRZA 3ZPXA 5CTJA 4ZGBA 2VXYA 1ZVMA 2YX8A 4XJSA 3REGA 4LFCB 2H1IA 1E4OA 3GLHB 3COYA 2OORA 2C7PA 5KG4A 1UZNA 4E4YA 4WFIA 1TVCA 1JAXA 3OO0A 3V42A 1QRRA 3G5TA 2FSVA 1OYWA 5KFVA 4D26A 3RBXA 3W1EA 3T54A 1BH6A 3OJ0A 1VL8A 4J29A 4DDKA 5G5HA 2LTAA 1GFIA 3TO5A 5AO9A 1SK8A 2PT6A 2DSTA 4DSFA 1EGHA 3BDVA 2XT6A 1Y3FE 2Y27A 4QE3A 3KL4A 4CQMA 1RACA 3O6VA 4S04A 2OZLB 1HE8B 3DTVD 1JQ5A 4XSHA 3B2QA 2YL2A 4ZVOA 3H7IA 5IDQA 5EUMA 5AKZA 4C7VA 5EL0A 1IY8A 4W5JA 3I58A 1AY0A 4UEOA 4Z6EA 4BVFA 1DKMA 1DJQA 1U3TA 4AX8A 5K8UA 2BBWA 1SVWA 4PONA 4GP7A 5ALNA 2Y9MB 1P81A 4GXQA 2JJ1D 1IM8A 3PNBA 2C3YA 4GI2A 1YK1A 3FDFA 1HEKA 1Z0ZA 2B9VA 3QW2A 3P52A 1FSFA 4I50A 1QIMA 4ED9A 3IAAA 4TRJA 2JAOA 3KZOA 2GPSA 2J7PA 2PEYA 2ZREA 3WGIA 4I66A 4GLOA 4R8UA 3K6JA 3G6YA 1RPJA 3K0HA 2JGLA 2IW3A 2X76A 3KUCA 3WLKX 2XZLA 4GPIB 1GP2A 4GS5A 2MSKA 1GAJA 2LKDA 4I8XA 4CV2A 4YRQA 5FLEX 5DF1A 3W8FA 3IMCA 4A3SA 4QTZA 1HOTA 2D1RA 2BFPA 4S05A 3EVEA 1IU9A 1P77A 4RCVA 1KGDA 1O96A 2WHYA 1XPJA 1YQXA 2FGJA 3TFQA 3SEAA 4DKJA 4RZSA 3IDAA 1ZQVA 1JG1A 1OF1A 4LQLA 1PTJC 3BICA 3P32A 3P20A 4C1BA 1DJNA 4OPMA 1DOAA 2QN2A 1PUZA 3Q8XB 5J4YA 4GMFA 5DSTA 3TW8A 3QA3E 4LA4A 1GU7A 5CXQA 1MORA 3V3KA 2OQRA 2HIGA 2Y68A 1L7QA 4BB0A 1OXSC 1YTUA 5CJ7A 3RVOA 4JBLA 4QZGA 4F4XA 1Q74A 4YT8A 5HW0A 2QJWA 1MC5A 3W5SA 1F3LA 4LXTA 4DQLA 3ZHVA 4YRPA 3JWPA 5CD9A 3ZEIA 4AYXA 4M46A 3DQQA 2BH2A 2OK7A 1NUTA 4CIWA 4EPTA 3H5RA 3EEQA 1JJAA 4CKWB 4ZI5A 1KL9A 4DMCA 5CIYA 3PHGA 5BWBA 2ZGVA 3UWMA 3U44B 1J1UA 3QEMB 4IZ6A 2IXEA 4A1OA 3JQ6A 4XGRA 2B21A 2VWPA 1KQQA 1RJ9B 1E1NA 2QUBA 3M2TA 4YO7A 1DXYA 2VHEA 1UXGA 3WGMA 3L8FA 1CETA 2J8ZA 2I9PA 3WIEA 4C7OB 5LNK1 4TV8F 5JO9A 1N77A 5EWLB 3L5OA 3TNJA 2OBMA 1KPGA 1M2WA 1KJIA 2EJCA 2G17A 4RVHA 4JLSA 4KAXA 2GAOA 3WB2A 3QWBA 1QQAA 4FEGA 1G8PA 1QUEA 1JW9B 2MR6A 2ODGA 3NORA 5MN4A 2HFKA 4ZANA 2ZAOA 3T5DA 3BRQA 5KNBD 4P4SA 1SD1A 1JALA 2ZIGA 1EXDA 5G4KB 1RHUA 1A7UA 4MRPA 4US8A 3B5JA 1CIPA 1O57A 1YJQA 2YV4A 2XMDA 1GA1A 1EE2A 1YDHA 4WJLA 3A4MA 1H69A 3JPNA 3FUVA 1ZESA 1LVGA 1L3UA 3LHFA 1C8BA 4HDMA 4O3PA 5BN4A 2WKSA 4XGIA 3HKBA 4HH3C 1S8NA 4N0EA 5FRDA 3OUUA 1KJQA 3P4YA 5I9NA 4PLWA 1XNRB 1FVXA 4Y9SA 2NO1A 3IG8A 5A9SA 5EQTA 3HWWA 1OI4A 4XOUA 3LUCA 4RTPA 3TFWA 4R1SA 2IIPA 2PD4A 3MR5A 1S1MA 1W34A 3BORA 1RJGA 3H86A 5EZYF 3ZI4A 5KYVA 4EJ2A 4JODA 3VH1A 2F44A 4QYIA 1RW4A 4KBYA 3TQQA 2CFOA 5LXTF 1YQQA 2GZAA 4HAVA 2DQZA 4UM9B 5EZ6B 2ZR9A 4LRTB 4RTKA 2PA3A 1C4OA 3PFGA 4X54A 3W77A 3VDMA 3IODA 2EYUA 3FLEA 4GLFA 1NFQA 3ZJUA 1BGVA 3ZZNA 4KMSA 2Z30A 2QLJA 1SQ0A 5AXCA 3JATB 2RBGA 3IP7A 4RLQA 1MGOA 2B1JA 2P41A 4BECA 1OOEA 3H4TA 4Q00A 1C7IA 4UBIA 2YVUA 3RAXA 4B2PA 1U8TA 4IGKA 4YMHA 3OMXA 1HQYE 3EMKA 3RROA 1YU6A 1RI5A 1XROA 2CVHA 4GKKB 4IVPA 5HF8A 3L7JA 1QP8A 3X1MA 2R8HA 4QZEA 3ABQB 4A23A 4BNFA 5C5DA 1DVRA 4UNQA 5DGBA 1JHQA 3CE6A 1KFEB 1QQ7A 3MWFA 2FW6A 3TTSA 2ODAA 3H2HA 2ID8A 5I9LA 4KRGA 1AUQA 2XECA 5DX1A 2D0DA 2XCQA 1J1IA 4CLRB 2DBYA 2AQ8A 4OH7A 1H3EA 2ZTMA 1QU3A 3G89A 1N5LA 3WIDA 1UMCB 2JKVA 1TCUA 2IY8A 3WWPA 1Z6YA 2J0QA 1LI7A 3OIYA 4PPNA 3GMDA 1TF5A 5FWXA 3F7TA 1DEXA 3K94A 3NNDA 2PM8A 3T12A 2BJWA 4FFWA 4FX5A 4ICIA 1GNQA 1P6QA 2NO7A 2GF9A 3QLUC 3I2JA 3O9VA 5KG3A 5JH7F 2JH9A 3G5MA 2QE6A 5BQFA 3R09A 5AM3A 3FPBA 2GPWA 1KMHA 1BS2A 2C7GA 1N34B 4MYDA 1GEEA 2D4HA 4ZHQF 1JKFA 2VO1A 5TGDA 2A9KA 1OGJA 4ZV4A 3N2GB 3OZAA 1V6CA 2OH2A 4YP3A 4AQYB 1WUYA 5F4ZA 3DT9A 3VM6A 3RF9A 3LF2A 5J0YA 3B7GA 1KJNA 1ZY2A 5JS2A 4FD3A 3EC7A 3G5LA 2ONKA 4YAEA 4Y7DA 5E0KB 3HVJA 2FPGB 2ESEA 4X7MA 1V8DA 4LUCA 2C9YA 2DLCX 3MA0A 2HSZA 3F8SA 3GLFB 1S7GA 2Q2QA 3QW4B 1XU9A 2HREA 5K03A 4B76A 1AK9A 1Z13A 1ORDA 2OMKA 2JARA 1XVAA 1E9DA 3ZLBA 1JEEA 2ODEA 2ESRA 4MUXA 3GPBA 3C1UA 3IT0A 3ZLTA 5HK9A 2UXDB 1ZSNA 4RVGA 2AN3A 1FU8A 2GDJA 4CLXA 5JYEA 4BBAA 3TLXA 2VDVE 4RCYA 3GRPA 3ELYA 2C5LA 2V0NA 3QUBA 5DW3A 4XAQA 1S0NA 4BEVA 1P9RA 3KT3A 3IVMA 2I5PO 1YBVA 4ED8A 3IAS6 5I8WA 4CGYA 4IJKA 3TW0A 3DLBA 4QWWA 3MWEA 4ADSG 4HUJA 2R1TB 3E27A 4GE0A 3GQVA 1DBVO 3AXTA 3VC7A 4IDPA 2PFPA 4YA6A 1NX9A 4AKHA 4FE4A 3CRRA 2Y4OA 4I8DA 4MW4A 4N9QA 2D7CA 2JJ8A 2FK7A 2WUVA 1E69A 3L6CA 4OP2A 2CFIA 3G1WA 8ICFA 2ZSHA 5AKKA 4QGGA 3U40A 4YHBA 2IYWA 3DOEA 1EVEA 1JGTA 3TLJA 2Y2UA 5JDCA 4IQVA 1KY3A 2CL0X 4N9WA 3C74A 3X1XA 2AGOA 1MQ2A 5CVJA 1YR3A 3CUTA 1K4KA 1ZXXA 4RD4A 1RSZA 5KAMA 2Z2JA 5I4KA 1RHMA 2VHJA 5I9TA 3TQRA 1I9CA 2QL9A 4DBVO 1VIMA 1F6BA 4BVJA 1HZJA 1B7GO 1ZQHA 4C2UA 3AVUA 4LYAA 2NZUG 3C6XA 1ZL0A 3PV8A 4TMXA 1DU4A 5JQGF 3O94A 4JEMA 3JYQA 3HCBA 1L0BA 3K92A 3ETLA 1DXOA 5JEDA 2H1SA 5JAPA 4RF5A 3H5OA 1SQ6A 3K4HA 4QEDA 4EKIA 4GX2A 1ENZA 4EJSB 2W2TA 2EGHA 3Q3IA 1U65A 1KERA 2B8JA 3KB1A 3UXPA 1DKNA 2GVZC 4PZCA 3NKFA 3OZWA 4HLQB 5HM8A 1VG1A 3NGXA 3KKOA 1TU3A 3V9PA 2E21A 3AM1A 1PG0A 4C6TB 3W5CA 4LFAB 4BO9A 5P21A 1W88B 4NNPA 3VO1A 4WW0A 3PKZA 2W2KB 3OJUA 3WV5A 3DYVA 3ROEA 1TJ4A 2C59A 4RJIA 1QJCA 2PLRA 1BNCA 4DLUA 5LUAA 1ZEJA 2O48X 1JDNA 2CE2X 1DE0A 4WK0B 5KUTA 5G41A 2ID9A 2EG5A 1XAHA 1MO5A 2JEYA 5LDGA 2VP0A 1JXAA 2J3LA 2WKWA 2O0KA 5A62A 4BVKA 5KX5F 5JAIA 2GOLA 4OJMX 4OREX 2PPVA 2UUPA 2WZQA 4JZKA 1W52X 4D8TA 1Q95A 1IK4A 3WL8A 1Z2DA 1AF4A 3T4UA 5HIJA 2R8IA 1Z0JA 1YS2X 3C7KA 4RMGA 1CJTC 4MP6A 2W2LA 3BL6A 4AVYA 4YJGA 2EH9A 3H6GA 3QIAA 4OQFA 2NU9B 1IN7A 1T2VA 4WK2B 5LU9A 4P5DA 3OT4A 3HSKA 1JJVA 3BE5A 5K4GA 4I2NA 2AL7A 1NVAA 1O95D 1X2EA 1XB2A 1P18A 4RKRA 4EHHA 2HF7A 2XYQA 1J2RA 2GWSA 1P91A 4A1FA 2ZIWA 2IHNA 3NC0C 3PVSA 4GSLA 2VA3A 4EP1A 4J6EA 2PJUA 3SX4A 2O2EA 2CT8A 3FYCA 4BMYA 1OVMA 3CJTA 1FU7A 2CDRA 3L4BC 4H0FA 5K6AC 1DL5A 1ZOOA 2BFFB 1H4QA 1L5KA 2FPMA 5KQRA 4P4LA 4PAGA 3AL2A 2PRYA 3RG2A 1I5EA 3G3EA 3UB3A 5DBBA 4IUYA 4RKEA 1SNYA 4BB9A 2I7TA 3W5HA 4EUFA 1IVSA 1IQ0A 3I45A 3TIGA 3EASA 1T3TA 3SYKA 3TLCA 5BVGB 1GTMA 1P1RA 2Y4NA 2UZAA 3CR8A 4WZBA 1UPBA 3GILA 2VSNA 2Q49A 4Y0VA 4UNRA 2AIRA 3A0HU 3OPQA 4I4TB 5TDHA 1TMYA 2N1RA 1GNLA 4JBYA 4D8YA 2EF1A 2IZ5A 2RB4A 3VKGA 2HJSA 3IDQA 3AESA 3RSSA 1U1CA 3W4JA 2VK1A 4H7JA 5FQNA 4M0MA 3PW2A 2H2WA 4MIYA 1IQUA 1RYZA 3OLWA 2XZDA 3VCBA 2ZT5A 3AI7A 3P97A 1OH6A 4FFSA 5K9ZA 4X20A 3NYIA 2EKQA 3DTTA 4R3NA 4JJEA 4TMTA 1MV5A 2VBCA 4YVZA 2G4CA 2OP1A 1A27A 3THWB 3MQFA 2B34A 4M8LA 3FPEA 2PXHA 2P11A 3I23A 2O8CA 3EPJA 4EL0A 1Y6ZA 3F47A 1RXEA 3BXOA 2WB2A 4RMNA 4YWHA 1U0FA 4N48A 3VPGA 1VJ0A 1KH1A 3TR5A 4YR9A 3N6VA 3ZLUA 4PG7A 3K2IA 2H6EA 1M2NA 2YS6A 2Q6VA 5A5FA 2R8ZA 2JMGA 1FU4A 2D5IA 5TQJA 3T7DA 1IBMB 2X13A 3I1YA 1IIPA 2AR0A 3SMQA 4DGQA 2G5GX 4HZUB 5B1EA 5CVEA 1KOFA 4R1PA 2O8DB 4JQYA 2A0YA 4YMGA 2JEZA 4MHSA 4DR3B 4OHZA 2LCQA 4A2PA 2GT1A 2HZ7A 2V7QA 4C0JA 1NZBA 4EYSA 4MUIA 2D3WA 1H5NA 2B3TA 1U45A 2KVSA 3BFVA 1DFGA 1C0IA 5BSUA 3RTVA 5KC9A 4IXWA 3R41A 5G40A 4TRMA 2BHLA 4GXTA 4LC0A 3O8RA 3BL5A 3A6FA 3P1JA 2W42A 4ER6A 1OMOA 3D3KA 1X9GA 4KLEA 2BSXA 3D3WB 2HHTA 1YKSA 1M2VA 3EH2A 2X22A 1SVSA 5C46F 2DWPA 3N76A 1WABA 1NBAA 4EIWA 5E79U 1Z5WA 4B2IA 3KJGA 3I6ZA 2IWRA 1IMOA 4UB8U 2OPHA 3E7FA 4EMBA 1NMEA 3B78A 3GNTA 3PDHA 5EEGA 1UT8A 5T3YA 3SKYA 4M6WB 3PC7A 2ZYTX 5LOVF 3FYSA 3ISBA 2F00A 4LJSA 3HUFA 3KJZA 4H3HB 4DDHA 2Q5FA 3GNLA 4WZ6A 5IT5A 3ZE7A 5C3UA 3H84A 1G5FA 3UZUA 3AJ8A 5EFOA 2O8BA 4INZA 2XE8A 1CUJA 2JAUA 2BISA 3OT1A 4DF3A 4R69A 3C1YA 5LP6B 5KAFU 3BA6A 3JWGA 1R5OA 5CURA 1QSGA 1WETA 2V4UA 3KQPA 1YFJA 3DL0A 3ORHA 2PSEA 3QUSA 4OUDA 3TPCA 3GIMA 4AD8A 2C99A 3V80A 2OO3A 1U0RA 1RDFA 1NKSA 1PFVA 2NSYA 1M66A 4M9JA 2Z56A 2AWNA 3QSYA 1TUEA 4KOAA 4ED2A 5FOQA 2HCJB 2FUNB 1BMDA 5IJ9B 1L9XA 1P73A 5B6PA 2WVJA 3MXTA 3GGOA 4OATA 2X1VA 1SHZA 4CIAA 1TV9A 1OWNA 5T3UA 3P19A 1PEKE 1ZIOA 1GFWA 3FG9A 3GEGA 3HVUA 2QD1A 2FAXA 2EFDB 1E99A 1N1GA 4MV0A 4HYTA 1NW4A 2X7HA 1HIWA 4LRXA 1ZGJA 3NPAA 2QNIA 2XY5A 3JYNA 3EN0A 1QG6A 3VR2D 1M1NA 4KIJA 2HLPA 2VHCA 4NTZA 2F1HA 4FPXA 3GA7A 2NXJA 5TQ2A 4AN1A 4KC0A 2WRZA 3L1JA 2W8BA 3CM0A 4OJQA 5FPYA 3IYLW 1JR3A 4P7BA 5EXDA 2YWRA 4TXJA 2D1FA 1H2AS 3BMNA 1EZ4A 3F3YA 1P61B 4EW6A 1SXDA 5ER6A 4RF4A 4AAYA 2B92A 3R44A 4N65A 2KMDA 3OBBA 5DHTA 5J23A 5FADA 4MROA 4NARA 1Z74A 1TK0A 9LDBA 3ZY4A 5CXXA 1BDHA 3CR7A 1SVOA 2ZBPA 2IF0A 1Z2OX 4KTVE 4GM4A 1NZFA 1EWKA 3MT9A 4HFJA 1IE3A 1Y37A 4HG2A 3SNHA 3LVVA 1DT3A 2HW3A 1XTUA 3H9CA 1N3LA 4PC7A 3TD9A 5LQDA 4EB3A 5FULA 4P22A 1TW3A 3BK1A 1LV8A 5AVKA 3W06A 1R10A 2XOKD 1MC8A 1FJXA 4BZWA 3SYLA 4GLLA 5D3MA 2GEKA 2JGFA 1VSTA 3FBTA 4RIGA 2P4SA 3VBCA 1HDZA 3R5SA 3P9RA 1OWLA 4PG8A 4F2PA 3U7QB 1UHUA 1ZUNB 1U49A 4B9SA 3R0QA 2G70A 4YS6A 2KKPA 3VOBA 5LN1A 2GLXA 3RVMA 2Q46A 5BN5B 4EECA 1U3DA 4D79A 4DR6B 4RQ6A 2CHGA 1E6CA 1PJ3A 4E07A 5F3WB 1GUFA 3I9KA 3CPHA 2ZSBA 1Y8RB 2P78A 3EA0A 1KNQA 4M88A 2HJWA 3RYIA 2ZAGA 1WZEA 1RPTA 3CZQA 3RPEA 3F2VA 3P2JA 5B1SA 2QX9A 5DX0A 2LWIA 2RJOA 4RHTA 2QN9A 2C1ZA 5IJWA 1FOEB 2R6CA 5DE3A 4DIEA 3OP4A 4ETMA 1U90A 2QRNA 4NXMB 3DTVA 4XCXA 3S0JA 5J0UA 3QXGA 1ENPA 3UANA 3GN1A 1ZRHA 4A73A 4TTJA 2EQYA 5IJAA 1D9XA 5AM5A 3AINA 3OPMA 4DILA 1ISSA 2ZJ2A 3NBXX 3B8HA 1RZ3A 5G3ZA 4GC5A 3CVXA 4RPYA 5DP2A 4GI5A 2XOEA 5E8RA 5ALDA 3UAVA 1VGQA 1T1SA 2JJ1A 3L41A 4F4KA 4YJ3A 1T9AA 3HN7A 2CLIB 1DQNA 1ZMBA 4E33A 3DV2A 2R4UA 1AXGA 4I55F 4OMUA 1BVRA 4A4DA 3CX8A 1RZVA 4M7OA 2FP3A 4A82A 3BAZA 2XI9A 4IIBA 2OECA 3RQSA 1L5LA 3M9MB 5JRDS 2NRZA 4LX8A 2HA0A 1Z6ZA 4C03A 1KH3A 5CM8B 3L7OA 1QK5A 2ASEA 3HJGA 1YB2A 3DOUA 3S5JA 5A1TA 4GT1A 4LHYA 2W9CB 4O6VA 4IDNA 5IF3A 3CLHA 3JQCA 2JI9A 4RH0A 3WBBA 5DK6A 3CKYA 3O4VA 2HMWA 3CJQA 2FZKA 1NZJA 2WU3A 1HETA 1CRPA 2I65A 3EEYA 2YZ2A 3VR6D 2Q3CA 4A6EA 4UDXX 3E9YA 1BROA 5B2FA 3HN2A 2L0XA 3BYZA 3HADA 2P65A 3TUJC 2H63A 4Q4DA 4PY2A 3F1LA 2VHQA 3O2SB 2FSSA 5KYWB 1X80A 3TBKA 5BN3B 1CQPA 4JYCA 1ZN9A 1Z6TA 1TO6A 2HNBA 2G40A 1P3DA 5GTHU 1I4OA 3SAFA 4L5BA 1USGA 4AMGA 4QWMA 3R3UA 4A6XA 3USZA 2MSEB 2V7VA 4Q7KA 3PCXA 3LRPA 4B9AA 4D42A 3QMPA 4ZZ3A 2RGNA 3F7OA 4ZAWA 3FOFC 2IDKA 2P7HA 2KQUA 2K4EA 2I8LA 1K1EA 3GN2A 4DF4A 5TJHA 3F6CA 4YRNA 2Q9AA 3D0OA 1VLQA 5K7SA 3CLUC 1OTXA 2I4LA 3ENWA 4B6EA 5BSWA 4IV0A 1QGUB 2QYHA 2LKCA 2AFRA 4BRSA 3MCWA 2NIPA 3FJOA 2E6UX 4QATA 3CGGA 5CJPA 3R7NA 1RADA 1M0EA 4RQ7A 1NBEA 4P7FA 4JVMA 1TNDA 3F53A 1GJRA 5L3QA 3PIRA 1RIIA 3ZOKA 3WKEA 4KLRA 1GU0A 4BWYA 3TLGA 5GOTA 4DUYB 1E61A 4LF4B 3M70A 4DSTA 5JISA 1KP9A 5BYKA 1XVUA 2KMLA 4WNCA 5KNBA 2AV6A 4LKRA 3H7AA 1ZJ4A 5B53A 1L5NA 1T9ZA 3PYXA 1MZVA 3QIVA 4I81A 5EOVA 4XIGS 4Q7QA 5BSMA 4NSNA 2PX6A 4S3MA 4EHIA 3LT4A 3DFUA 2R18A 3NCHA 2NU7B 2AR7A 2Q5HA 3ZCSA 2PCLA 7AT1A 3CEPB 4FI3F 1TA9A 1MOQA 1T0IA 2A3RA 2WIBA 1PFYA 2I7VA 3VISA 1HKUA 1DC6A 4Y6LA 1Y6QA 4NECA 1SXJC 3W5IA 1KKXA 1DC8A 5DGXA 1KEUA 1I7QB 3BILA 3OHSX 2E5SA 2CXPA 2QMEA 1C8VB 3S7ZA 1P4GA 4MWZA 3N6RA 1KFJB 2C7QA 3DVLA 1TQDA 2P5UA 2YOHA 3WLPA 3DP9A 1ODTC 3MRXA 2HRQA 4F96A 2GESA 2V96A 2HVIA 4X1YB 4O2AF 1JLKA 4AL4A 1XDBA 9ICJA 3KTDA 1EX1A 1BYUA 3R5JA 3GZJA 4QZIA 1EWVA 4B6RA 3GB9A 2NADA 3INYA 1OXXK 4KMRA 4N4AA 1EFTA 5IVKA 1OA0A 3EZ9A 2DWQA 3C3AA 1BD4A 3JV7A 2Y05A 4AJ9A 3IO5A 3RYFB 1H2RS 4LZOA 4DR2B 2WY2D 3HZOA 2YDXA 4RVNA 4MUAA 1T91A 1OJ7A 2Q1YA 4RH1A 5AVTA 1U04A 4U6SA 1F2UA 1VI6A 5B1IA 3K0FB 5DXFA 1ZWLA 1G7SA 1HT0A 1P5RA 3O31A 2FG5A 2X6RA 1DFHA 3BGDA 2RHRA 2VP6A 5DBGA 1HYGA 1BCRB 3WLIA 2DBZA 4YR3A 3NWEA 1VKJA 1DQYA 3WMGA 2PUVA 2O8FA 5FOSA 4RK5A 1IIBA 2X8BA 5EWEA 3OX1A 4F04A 1HC7A 1EZ1A 2ZJYA 4BLTA 3TQCA 2A3NA 1XCPA 3J81k 4I4LA 1MG5A 4YQYA 3C6YA 1V7QA 2HXGA 1H1TA 1ISIA 1CS4C 5A2GA 5J4HA 3O2QB 3PX0A 1G98A 3UW1A 3NWOA 1LQTA 5K0BA 5M7EA 2C82A 4E5YA 4RELA 3CCCA 1M2KA 1R0YA 5J59A 2I2DA 3A9SA 4IGFA 1CNFA 3NDBB 4YAFA 1TC1A 1X7ZB 4XWWA 3R7SA 1FMJA 1K5PA 1JWLA 5TSDA 2ES4A 1LFAA 3PVCA 3LYAA 1Z00B 2KSQA 2V7QD 4IG4A 4MJLA 1L7MA 2BKUA 5K3CA 1NI4A 3QI2A 3N8IA 1DBRA 1ISFA 1P1HA 3PGMA 4YMNA 2GCNA 3RG8A 4MRSA 4W8OA 4AUNA 4W7SA 4ETWA 4WXHA 2WAMA 3VZRA 2HK7A 1NF2A 5BR1A 3C2LA 4IIJB 1U7WA 3F5FA 3V7WA 3ETHA 3EG5A 3ZVNA 5KTNA 1QBGA 4F11A 4PTLA 3MTAA 4MGHA 4WDQA 5K0FA 2FLNA 1JDVA 4HY3A 3UHJA 4BLWA 1OHHD 2YH2A 2BPGA 4P3XA 3HKCB 2BL4A 3MGHA 4HYQA 5U9CA 2FEXA 1Z0FA 1ORIA 1AKEA 4ILEA 5COBA 2FRDC 2FJUA 1R3UA 1SUIA 2KP7A 3OF3A 3KVNA 2FGKA 4N0PA 1F5NA 2W4MA 1M8KA 3HJRA 5KYUB 2ZR7A 1EK0A 3QEOA 4W5OA 3NFYA 5SY9A 1HBJA 3WYBA 1OH5A 1ISRA 2OM6A 2CN1A 2VT6A 2VVTA 5C4MA 1IL0A 1YJ5A 3KFUF 5LKAA 4G4SO 2XICA 4YRJA 5KYKA 1Y7IA 4WXYB 2Z2KA 1KI1A 3VPHA 4JEUA 3VKHA 3FNQA 2OLEA 4CIXA 4JJIA 4BLQA 1CLEA 2KIWA 3M33A 2IHZA 4ZO6A 4DHEA 2BKLA 1UBGA 2OILA 3WGYA 1Y3IA 3OZFA 4MRMB 4N7MA 4KR9A 1BX1A 2VYCA 1I2BA 4S1NA 1E1CA 4R8RA 3QU5A 2XUAA 1YT5A 4LXQA 2VPZA 4DBZA 1Y5MA 1XXHB 2LMRA 3P5BA 1JQEA 1PJZA 2CLMB 4EARA 3RFAA 1XEXB 1NQXA 1CJMA 4L15A 5J2KA 4M4SA 3NONA 2GPBA 4M76B 2AYXA 5KG1A 1Y88A 4AYBC 1JMVA 2VSXA 4G9EA 3VUFA 1CU1A 4WUVA 4JU8A 2ZUCA 2I1LA 4AKIA 2KHZA 4GNKA 4IZHA 4D3XA 3L8EA 3A3KA 1H94A 1ILWA 5LZ2A 3JVVA 1J06A 4ZO9A 2VJOA 5I7HA 5JJLA 1MW9X 2HEIA 2WTXA 4Z49A 2VYVD 4C4AA 1ZK4A 5BPCA 1K7CA 1MPXA 4OBXA 3JQFC 1JR3D 5JAQA 4TQAA 2MTBA 4R84A 4JVNA 4LOLA 4HJXA 3M83A 3A3PA 4D25A 2NPIA 4YLEA 1R4MA 4P1ZA 5KOYA 4GICA 2QW1A 3AO0B 2FQ1A 2ASJA 2IA5A 2R8OA 3T7TA 1KK1A 4L8FA 1JEQB 2CXUA 3W9UA 4TTPA 8ICTA 4RADA 3H0KA 3A58B 1ZH2A 1SXQA 1AB5A 2X0DA 4EH1A 3UHAA 2WNIA 2P91A 3N7AA 4MS1A 2HSGA 3LAWA 5HA5A 2O54A 4CMJA 1WHSB 1NVGA 2Z3ZA 4OBEA 5DYYA 4TYPA 3MEQA 2Q6OA 2GETA 1X15A 4ZOQI 2KB0A 3JQAB 4ZA2A 5FUVA 1ZS9A 1A8IA 2HN9A 2OHOA 2VA9A 5EJFA 2NM0A 4UC0A 3JQRA 1ODSA 4GKJB 4KI0A 3Q40A 1EM8B 1W46A 1ZQGA 4M1WA 3PE3A 1GPUA 5AJZA 3PGA1 1TYEB 4BO7A 5LQUA 4UPVA 1UA0A 2D54A 2FN4A 4JC4A 3RIEA 5IX8A 3W8EA 2RFLA 4GM1A 2B7LA 4UAUA 3U0VA 1E6KA 3VZPA 2I1WA 2HRZA 3M1AA 5ALJA 1JE0A 4MKZA 4ZI2A 4DLVA 1LDNA 1EDEA 4FFVA 1PR0A 1VHTA 2D5AA 4LC9A 5E95A 4UUPA 5EMKA 3V97A 1JHRA 1NK0A 5K0CA 3FN4A 5CH3A 5C8VA 2XNSA 1FX0A 4RTQA 3B0YA 3NETA 2I6UA 1PWEA 4ZAGA 4BVBA 4JBIA 4YACA 2DPHA 4RNOA 1Z6QA 3PY8A 2ECQA 4F6CA 2TMGA 1JQLB 1Y7HA 4DW8A 2R7NA 2IYXA 2QUJA 4HTFA 5DMHA 4IH4A 1RYRA 4R1LA 3AI3A 2Z3WA 3M6MD 4DV1B 3F97A 4DDWA 4BDPA 4X61A 1X7XA 1E9VA 2NZ8A 2B8EA 2ETXA 2C2HA 5KWIA 2PYDA 2IX3A 7MDHA 4QZHA 4XX0B 2XX3A 4YV0A 3SY8A 1NV9A 1CV2A 1O4WA 1MXHA 1MVNA 1T5IA 1UM9B 3FOBA 1QH9A 1Y6JA 6AT1A 4USAA 1KETA 4LF6B 3MJFA 5GADl 1XPUA 1WQ1R 3IO3A 2FLKA 1XLTC 2Q2VA 4KYTA 3GOQA 3L3BA 4ZKEA 5IVIA 2QR5A 1IK6A 1NUPA 1MFZA 3WWYA 1FFXA 1YC2A 1N2EA 2Z8YA 3U60B 1K1QA 3NDPA 4Y30A 4H4EA 1O95A 3O2JA 4RWZA 1RABA 2IS1A 3DDHA 1F7UA 1NK9A 1C3EA 4GZ5A 3PGKA 1UL1X 4QQKA 1NMYA 1ZRMA 2IA6A 1ZO8A 2WZDA 5JY6A 4PHEA 5AVQA 1IOWA 4UHJA 1MO4A 2A78A 3WGJA 2DJ5A 2IP4A 1VMIA 3N9IA 3AM3A 1T1GA 4TZKA 4CQMB 1IBLB 2EDAA 2GLTA 1BVHA 3CXUA 1NJXA 4WCFC 3V1MA 4LJ9A 3W2EA 3SZMA 5DLPA 1TJPB 2WIDA 2NYVA 4MV7A 1BQ3A 4IIFA 5J2TA 3BWDD 1XDDA 2FJ6A 4DLEA 1N5KA 2J0VA 4HNAA 4PPQA 1QSSA 1FTSA 1HM5A 2G9UA 3NVMB 2O2HA 3VYVA 4W4TA 2GK4A 3P2YA 4O4LA 2WJIA 3SSNA 1X92A 5LZ7A 2BM1A 4TVKA 5BUCA 4LYGA 4I50B 5GM2A 4EA8A 2AJ8A 2OCPA 3U09A 2J48A 2PMEA 3KZIU 2V6MA 1G0NA 1IMJA 1PHPA 1UJNA 3PKIA 4R8UB 5K8TA 4FYIA 3OLZA 4ECZA 1UIRA 1MJ5A 4BP8A 5HTOA 3E8XA 3ZBTA 2H4JA 3LWNA 4CV3A 2EX1A 4MVCA 4BBJA 1DAEA 4GOOD 2I3ZA 1ZBDA 3ZWDA 1J0BA 2AB0A 4WLEA 2QRUA 5COQA 3DLAA 5FPKA 3CLRD 2V0GA 3VJKA 3CPEA 1XLWA 5KFHA 2QX8A 2ZP1A 1O96B 2DEUA 2WPDD 1E7QA 2CFTA 1CKEA 4MWGA 5FA8A 2XZPA 1CY6A 5C32A 4LJAA 3GFRA 4OG2A 5BNTA 1E0JA 3O82A 4QXMA 1E7WA 4NBNA 4JX9A 3OCUA 3TW8B 5DRTA 1G5IA 1DXQA 2O5VA 1SIWA 3A0UA 2AHRA 4GR9A 2IPOA 1T9HA 1EVYA 4G4IA 4PAOA 3RSGA 1XT6A 4QDTA 3KJQA 3PQ6A 4JS0A 4NBSA 1RAHA 1ATZA 1J7KA 2G28A 1DHRA 4Q6BA 4IXDA 4YLYA 2EBUA 4HC4A 3OFJA 1RTKA 3UMBA 1E0KA 4LQDA 3P0EA 1J8QA 1WRBA 3QQPA 4LJYA 4YFYA 1MF7A 1R6VA 3ANSA 3ABRB 4N47A 5TZVA 1SUCA 1CUEA 2YZGA 1UP7A 4U7WA 2ODPA 1NUHA 3PJDA 2VJYA 5F7JA 1KC1A 3RCBA 1ZP6A 2GN6A 2DHEA 3OCXA 1Z28A 4JT8A 1RM5A 1PBNA 4QVIA 3VHXA 2P4UA 4LJKA 3PTLA 1B16A 2DOKA 4U63A 4RA9A 3RWOA 4HNVA 3WMFA 3U4GA 4EFDA 5TGZA 2F8KA 2OCAA 5ALOA 1C9KA 4BFWA 4ENUA 2V9CA 1JWBB 4PZUA 1XJ0A 3L07A 4RD1A 3SF8A 2DKXA 4PYJA 1RMYA 1ST2A 2EFHB 5AFSA 4P4SB 1RP7A 1NJWA 1BFDA 1XP5A 4JYBA 3V6LA 2HCFA 3VYUB 1DTWA 1GGFA 1NNSA 4O2RA 2ZE5A 3CKLA 2OKGA 1ULBA 3I2YX 3HFJA 3QG1A 4OXKA 2A5FA 3LT1A 4EEYA 4RK0A 1Z33A 1BGXT 4K6HA 4HDMB 5BN4B 3D43A 3HKBB 2BGRA 3QU9A 1DZ3A 5BY2A 4LOJA 1KOGA 2E82A 1NULA 4ANFA 3T7SA 2QYTA 1KVSA 1ED1A 4RU1A 5A9SB 3IEKA 1WS6A 4KXYA 1Z15A 1NQTA 4S1OA 5KL1B 3D59A 3AYXB 1U3WA 1DRGA 5DM4A 3D54D 3CQ9A 3KJXA 1G8AA 3L8CA 3ZD6A 2CMKA 3QFFA 4Y2SA 1KNXA 4WXEA 4D3YA 3UOAB 4QYIB 4B34A 2V6IA 2PBRA 3DKVA 5COAA 1QYRA 4B3XA 1TAHA 2P3OA 1LPOA 3VR2A 3C7DB 1YS6A 4M47A 1MX5A 1U11A 2ECKA 5HZGA 1I01A 4AY3A 4QZBA 4B2LA 3OHAA 4YT2A 4IOJA 3DMTA 4YI3A 4OTZA 1XDZA 1NN5A 3IB3A 3KELA 3LBFA 1KZ7B 5JXJA 4RF3A 2ZWVA 5KINB 1ZX1A 1R7RA 4MV9A 3WJ1A 2PWPA 2VPYA 2LBPA 1G5TA 2VDWA 2Q5JA 1PNVA 1WHTB 2FSIA 5HHIA 3NM5A 3WFIA 4MKXA 2V6JA 4X3PA 1F6DA 5EKDA 1E64A 4R64A 2ECPA 1BIFA 1L4LA 3PEUA 1CCWA 1E7SA 3K8ZA 4IJMA 1LBTA 1BQEA 1EAMA 2WHRA 3JALA 3KK0A 4K9KA 3RTGA 6CHYA 1KYZA 1OGIA 5T4EA 5JO0A 3OU6A 1FUYB 3G0CA 5HJ5A 3U4CA 1OWMA 2BMJA 3H5TA 3W8RA 3P0HA 2PJDA 2IV3A 2OGZA 2XOKA 5BSHA 3F9RA 2HBYA 1MOPA 1IBCA 2XTMA 3BE4A 3CRXA 5KSZA 2GDZA 1N5IA 1VFNA 2YVQA 4W8HA 3ZD7A 2DKFA 2WUDA 5FWXB 4U2BA 1GKIA 1DG1G 5HR6A 1BH2A 2PAFA 1ZR2A 1A2BA 3OX3A 2QRVA 4XD2A 2YY5A 1AQUA 3RFVA 2Z4TA 4Q3LA 3VOTA 4J9KA 4RQNA 1LPNA 1GNRA 3IA7A 3S8EA 4IJWA 3WIBA 4A36A 5KG0A 2QM0A 3PUZA 4XX1A 3Q3GE 4GWKA 4ECXA 1KMHB 1BDMA 2ZBDA 3TE7A 3ACDA 3WSTA 1SBQA 4P35A 1Z18A 4BWJA 1W1IA 1H65A 2CJPA 3ZQ6A 3P9QA 2NT4A 4AG5A 4LY3A 4X6YA 3P0IA 4JQZA 3TCXB 2HDNB 3TTVA 4JLOA 4RIFA 4EGAA 2P2CA 1PR4A 1T0PA 3P9SA 5E7IA 2QAIA 1XTSA 3VR4H 2VTKA 2EVWX 1SB8A 4N49A 3DA8A 1XRLA 2I2WA 6REQA 4J03A 4XZ3A 4OAOA 5ELMA 4NF2A 5G5GA 3ITKA 1UEIA 2PVSA 1IXKA 4J90A 1MA7A 2WJPA 3K70C 4TTTS 5GZ6A 1NDUA 5F12A 3DMYA 5B58T 2B4AA 2Q8PA 2XUDA 3DZCA 4LCBA 3GV7B 5J4KA 3BRCA 1I1QB 1T6ZA 5CA0A 4O3SA 2HPAA 2Q1WA 1GR0A 3JVDA 4WTOA 4X8OA 1QH0A 1ZI9A 2H2GA 3QE2A 4ECUA 4DL9A 3M8RA 1NBIA 1PEAA 1DO0A 4MS4A 1T0HB 1GZ5A 8ICWA 3FZYA 5G1OA 4DSIA 3TL3A 4LGYA 2GERA 3EUEA 1QLWA 3L0SA 4B40A 2QKYA 1U2GA 4HS9A 3JQDA 4WKCA 4K4GA 3VO9A 3HYSA 3GUYA 4HN2A 2NTNA 1IXSB 3GIKA 1PZMA 3FIJA 2OBYA 5ECDA 3G6XA 3MWEB 1ZA2A 2W93A 3VR6A 4KLOA 1B74A 3NHLA 3FW1A 3KFLA 1P1BA 2BKXA 1EBUA 2IH2A 2LP4Y 4FZ5A 4NCAA 4KQCA 2V9ZA 1J2EA 1PW7A 1P9OA 4HAIA 2IHTA 4IUBS 3L05A 5K05A 1NW6A 3IBTA 3U7JA 3P27A 1W47A 4NMLA 1NQAO 2H3VA 4BX8A 1RXVA 1DGJA 1JYSA 1VG0B 4XQEA 3O8NA 1FFCA 2QEQA 4RQ2A 4NYJR 4WZZA 5FOWA 4BTVA 3O3OB 7ICKA 1GFZA 4HWKA 5FX2A 5KQMA 3WC4A 5CFLA 4FJ1A 1SD5A 4QWBA 5KVCA 4PZ9A 1D8AA 1ONBA 2W8KA 1WNFA 3V9AA 2X5NA 4M7RA 4NDNE 1JG2A 3LPNA 3AR7A 4FZMA 4L0DA 2JEFA 3DM9B 3EBPA 4IQ8A 5KJ6A 2ZIVA 2VJLA 1XMJA 4J9UE 4P7GA 3RWBA 4DCPA 1SKBA 1JIVA 2QU7A 3CSSA 3ETGA 1HLFA 4RVUA 2XUPA 1P0PA 4HNGA 4KGZA 5BRAA 4MTCA 1ZD1A 3MWGA 1BTOA 1FQOA 4AY6A 1SPXA 2Y0SF 4QHYA 1TKAA 1PEDA 4XWTA 1ZJ5A 2OBBA 3JQBC 1M2JA 3PE4A 4MI1A 2J85A 5HZKA 1XQ9A 2J9GA 2Z1MA 4ECRA 2RH4A 1ZQRA 3U37A 3BT7A 3HDVA 5ES4B 1QCYA 3HRIA 1L8LA 4YREA 2IIBA 2DTXA 2DPJA 2IZZA 3NG1A 5JXGA 1F0KA 1R12A 4MVJH 3DULA 3S70A 1PJBA 2JI6A 2JBAA 4OD0A 4B3RB 1IG6A 1UDRA 4LSWA 4BEWA 3Q3EA 1CDEA 1Y9ZA 4HAXA 5B1DA 5FEUA 4Y9TA 1QX3A 1G8YA 3E58A 1V1JA 4PHTA 2MU1A 1F8UA 3STYA 4TTSA 1G20B 3HDGA 4QOEA 4IFTA 1I8TA 3K1JA 4TMFA 4U7JA 4HRAA 5F3DA 4I08A 3NT2A 4XTRA 4JI5B 4YIKA 1Q0LA 5KTMA 2QVLA 1IXYA 3EIUA 3O7WA 1W36D 1K6IA 1DG9A 3SC3A 4QL3A 3GLQA 2HRRA 1VP3A 3BJRA 1NJZA 4LMAA 1ECBA 3UMVA 4OXYA 3M5CA 5BT9A 3T0GA 1L5FA 2WD7A 3DV9A 2BI8A 1EX6A 1D2AA 3KKZA 4EVSA 2G1AA 4K1LA 4D9IA 2X77A 1O87A 4HGQA 3FMOB 4BAGA 1N3BA 4P34A 1AUOA 1Y5LA 2XA1A 2W9XA 4I5EA 4XUEA 5D7BA 2K6GA 4YRIA 1PZEA 5BUZA 1FTGA 3K5IA 3EBOA 4G1MB 2ZIWB 2AEEA 3SJ7A 3NRBA 1OD6A 4D9JA 3HCDA 1E66A 4KMOA 3FETA 3AKEA 2GARA 3R7FA 1WLYA 4H7IA 2YXLA 4JENA 4Q03A 4BOYA 9ICXA 1N5XA 2C4WA 4X41A 4H7FA 1CEEA 1P0CA 2B4KA 2Z95A 4K7JA 1UAYA 2O5EA 4MVJF 2RQ5A 3L4EA 2OV8A 2OHVA 3K7EA 1S2LA 1NVUQ 3Q0EA 1EQUA 3OZUA 4YEDA 2HT6A 1V8OA 3S1SA 1OILA 4BU0A 1NJ2A 3MBIA 1ADCA 4RSMA 3CUEF 2DZDA 3IPXA 1BNOA 1ZNWA 3KHTA 1KZ6A 4X95A 2HOQA 1NNEA 2ACKA 3QJYA 4WZBB 5MN6A 4BQRA 3NGLA 5IP5A 4WK4B 3UUGA 5HS4A 3OETA 2FCRA 3AIIA 1RC0A 1JV2B 3A6LA 2VAMA 2VQEB 5DCUA 2UXBB 1JVBA 4ZALA 4WESA 5EUQB 3ZY3A 3UTDA 3LGXA 4CNQA 3PXDA 3LBAA 4Q3NA 3BHMA 3N6XA 3OCVA 4YRDA 3AESB 3IUSA 5JDIA 1E4EA 2ZXFA 1VE1A 5IT4A 2WEKA 1HDXA 3CG0A 1A8UA 3NBKA 5BYAA 1H9BA 1X9SA 1US8B 4TMYA 3KUUA 3DW1X 4NS4A 2QI9C 5C0OE 1NMZA 1WXDA 1SHLA 3KOZA 1RCFA 4REOA 3PNCA 1HYQA 2KE7A 4N5DA 3BMQA 1A5TA 3NX4A 2I6FA 1L7BA 3MFQA 4PJ0U 3AVYA 1KIFA 1NM5A 9ICGA 2B94A 1OHHA 2DR0A 1PWXA 3RU7A 3DB1A 4Z1MD 1CQIA 2O8CB 3AEKA 3JAKA 3KZ1E 3A0RB 1UKAA 1DV2A 3K9QO 3ODPA 3T61A 3E2MA 4X5OA 1FYEA 4FYJA 1PJ8A 2CBXA 1GQSA 4GXRA 2RARA 3NQ41 4AS2A 3PO5A 2J9ZB 4DGSA 1U3FA 4G0NA 5AK5A 4U5QA 1T5BA 2OCDA 1UAGA 1PVVA 4B7UA 5G0TA 2VCYA 2E37A 4GZMA 3MIZA 4ND6A 4QU5A 2D0OB 4P93A 3T3EA 3CLKA 1L7AA 2E1EA 3DVRX 3SC6A 1BFKA 3F6EX 1CZUA 2D0IA 1DJLA 1NDQA 1KYTA 4XEHA 2BE7A 1MCZA 1XZMA 1NRJB 1U4BA 2YIDA 4OVKA 1J7JA 2VHWA 1TVKA 5IK2D 5LYJF 5JMPA 1AZWA 2AQHA 4BNJA 2VKTA 1E62A 3KLOA 2ZTDA 3L3FX 1X1DA 1WX1A 3NCTA 2GYUA 5EWMA 3HCWA 3THYB 2QJOA 4TV8A 1LD3A 5T8KC 4QQ8A 3QWHA 3GIWA 2PYZA 4O3OA 4YAKA 3GRUA 1M2VB 2YYAA 1S2IA 5CX1A 3KRTA 2K60A 1MNQA 2PX4A 3KJEA 4IHAA 3UQ0A 2B1IA 3V8EA 3KT6A 4AROA 3RNOA 3OSNA 1RYYA 2A33A 1I32A