2CN1A

Crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)(casp target)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
273
structure length
273
Chain Sequence
NPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Cytosolic 5'-Nucleotidase II: Insights Into Allosteric Regulation and Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CYTOSOLIC 5'-NUCLEOTIDASE III
total genus 100
structure length 273
sequence length 273
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05822 UMPH-1 Pyrimidine 5'-nucleotidase (UMPH-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.340 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cn1A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2cn1A01
3B9RA 2ZXEA 1Z4OA 3QU7A 4H1WA 3QU9A 4Y2UA 1VFPA 4CF3A 1J97A 3A1DA 3FM9A 2BDEA 1S8OA 4UATA 2OM6A 5ALEA 5AW9A 2OYCA 4B6JA 4HAIA 5AVXA 2G09A 2Q4RA 1ZD4A 3BWVA 3GYGA 1N8NA 3NASA 2I34A 5AW6A 3U26A 2R8EA 1ZD2P 5AVTA 3NIWA 3ZX4A 4FE3A 1Z5UA 2C8LA 3I1YA 2YJ3A 4YCMA 5AVSA 4BNDA 2I54A 1J8DA 4UW9A 4ZEVA 1ZD3A 4UARA 3I28A 3AR9A 1T5SA 3N07A 1RKUA 5AKZA 4AS2A 1WPGA 3M9LA 4YCLA 2C88A 2HHLA 1XP5A 3L0BA 4L6CA 2C4NA 1WVIA 3IJ5A 4I9GA 2GHQA 2IOFA 4IG4A 5ALQA 3L1UA 3KD3A 1Z4JA 1ZS9A 1X42A 2B82A 3SF0A 1TJ5A 3F9RA 3W5DA 3DAOA 5AI9A 1Z4LA 5AICA 2GFHA 2NYVA 2P11A 1T5TA 1CR6A 1RLOA 2MU1A 1RRCA 4RETA 4UU0A 2AUTA 3U7FB 2YY6A 2IOFK 2FDRA 5ALMA 4J03A 4YIKA 3CZ4A 4DFDA 1XPJA 1PW5A 2I55A 4IFTA 4XE5A 3NUQA 1Z88A 4DWOA 4Y2PA 1RMQA 3KOOA 3QU5A 5AK4A 1Q91A 3A1EA 5AVZA 3ZX5A 2HOQA 5AK6A 3MPOA 2R8ZA 3A3YA 5AVRA 2PQ0A 3WK7A 1QQ5A 4UMVA 2OA0A 3E81A 5AVVA 1FEZA 3L7YA 2O9JA 3ZTYA 2FUCA 2ZBEA 2ODAA 1L8LA 2QYHA 4C4SA 3ZVMA 3AR5A 4Y2JA 4FYPA 4EENA 5AIBA 1O03A 4CE6A 1NF2A 4UMDA 4MWOA 2JAOA 1RQNA 4F72A 2G1AA 2YFYA 4HYTA 3VAYA 3U13A 2B1QA 2PKEA 1ZRMA 3D6JA 3WGUA 1O08A 2ZBGA 1RLMA 4NAVA 4UMEA 4L6AA 1F5SA 4UMFA 1CQZA 3N1UA 5ALHA 3WKCA 1RPZA 5AKLA 2MSNA 3E84A 2HO4A 5FP0A 2HX1A 2B30A 1YMQA 1L6RA 5ALDA 5AVUA 3KDPA 2WF8A 3RF6A 3EF0A 4YGYA 4NV0A 2PR7A 4BKMA 2ZG6A 4G9BA 1ZJJA 3N8GA 3DV9A 2O2XA 3OCWA 4DW8A 2G06A 1RC8A 3M1YA 4KN8A 5AK5A 3TLMA 5IT4A 1YJ5A 2BDUA 2NO5A 3UMGA 3SLRA 3W5AA 3KC2A 2YJ5A 1Z4KA 2WHEA 4EX6A 3I76A 1T9ZA 1ZRNA 4JDPA 3QUTA 5AW7A 3N28A 1VJ5A 3R9KA 2B1RA 5ALKA 1XVIA 4Y2XA 2GO7A 2HEGA 5AI4A 2FUEA 5T41A 5IT0A 5AKEA 4CNQA 4BEWA 3UMCA 1WR8A 3L0YA 2ZOSA 5AM0A 4XOUA 2NO4A 5AM1A 3ZWKA 2WF5A 1L7NA 3RFUA 5A3RA 3EF1A 3AR6A 2FPXA 3ZVLA 4QJBA 5AVWA 5AM3A 1QQ7A 3ET4A 4J2TA 2JARA 3UM9A 5AI5A 4Y2TA 2R8YA 4Y2SA 3OCYA 5AI6A 1L7OA 1U7OA 4Y2YA 3WK4A 5AKKA 4OFZA 3WK9A 4AS3A 3W5CA 3IB6A 2B8JA 2RB5A 2AGVA 3U19A 2EATA 1U2SA 4KNVA 4C4TA 1YNSA 3BA6A 2RAVA 1K1EA 1ZOLA 2G07A 3ZTWA 2AH5A 4XPZA 2JAUA 1VJRA 3ZWDA 1Y8AA 2JAWA 2Q5EA 3AR7A 4EZEA 1IWOA 2RBKA 4NWIA 3QNMA 1KYTA 4F71A 3FPSA 1TJ4A 1YV9A 1Z4QA 2WF7A 4FFDA 4KNWA 5AW0A 5AW3A 4Y2QA 4EEKA 4YIHA 3FVVA 3ZU6A 4BX2A 3SHQA 5AM2A 2FPSA 3OCVA 1AQ6A 2WF9A 2W43A 3WGVA 4BNDB 2YMMA 4PNHA 3R4CA 4AP9A 3SD7A 3ED5A 2YJ4A 2VKQA 2D2VA 5AKIA 3U7EB 5AW8A 4UU1A 1NRWA 3L8GA 4BYGA 2YBDA 4Y2RA 3FPBA 1RKQA 5AKJA 3SKXA 4EELA 3WK8A 2G08A 2GMWA 2B0CA 3NRJA 4UM7A 4QQFA 2YMQA 1WZCA 3QUQA 3ZW7A 5AKGA 2P69A 2WF6A 5AM4A 2HF7A 1RLTA 1L7PA 4UAUA 3QX7A 3WKBA 1TJ3A 5AKHA 5AHXA 3W5BA 1U02A 1EK1A 1L7MA 3OCZA 1S2OA 3NANA 3HYCA 3OTQA 3P96A 5AKXA 4RESA 5JJBA 2DQSA 4HGPA 2IYEA 4UAVA 3ZI4A 1YS9A 5ALZA 2QLTA 1RQLA 1Z4MA 4YCNA 3NALA 2G0AA 2AMYA 4DCCA 1SU4A 1LVHA 3AR8A 1Z4IA 2FPWA 4XQ0A 5ALFA 3DNPA 5AVYA 3IRUA 3HLTA 5ALIA 2GHTA 2JGAA 3SMVA 2Q4TA 1L8OA 2I6XA 4ZEXA 4KX5A 3EPRA 5AVQA 5A3SA 2I33A 5IS2A 5ALXA 1QQ6A 1RDFA 3QUCA 5ALUA 4HGNA 3OCUA 3ESRA 4HGRA 3AR2A 3L5KA 1RKVA 5ALPA 5ALRA 1RMTA 1RMYA 5AK3A 1NNLA 4GXTA 5AI8A 3KBBA 4OHFA 2FPRA 4BBJA 3L8HA 4OD0A 3SKYA 3WKEA 2HSZA 3L0CA 4BX0A 2HF2A 4CF5A 5AW2A 3ZVNA 2IA5A 4MUMA 3KZXA 4HGOA 1YDFA 4BEVA 2WM8A 5ALWA 4OCZA 5ALYA 4C4RA 5A3QA 5AW4A 3FZQA 4L57A 3AR3A 3QLEA 3I6BA 3B8EA 3QUBA 5ALSA 4E88A 3K1ZA 2B8EA 1QYIA 3MN1A 2ZBDA 5ALNA 4I9FA 1SWWA 3A1CA 5AESA 3PDWA 4UM5A 2CFSA 3MMZA 4KYTA 2P27A 1QH9A 1SWVA 3ONNA 2YN4A 3B9BA 3QYPA 2YMLA 3PGVA 2R8XA 1ZD5A 2X4DA 1LTQA 3PGLA 2FPUA 4GIBA 2W11A 2WFAA 5AKYA 3WKAA 4Y2VA 2HI0A 2RARA 2C9MA 1EK2A 3J7TA 3OCXA 4EX7A 3QXGA 4Y3UA 3QU4A 2FEAA 5E0OA 2CN1A 3ESQA 5AW1A 2W4MA 3UMBA 4CF4A 1Z5GA 3L8FA 5AI0A 1JUDA 2C8KA 5AW5A 2CFTA 1Q92A 5AM5A 4ZEWA 4NABA 1N9KA 3PCTA 4JB3A 3WK5A 5ALTA 3MC1A 3NAMA 5ALGA 3QU2A 2ZBFA 2YMPA 3N5KA 1MH9A 2EARA 2EAUA 1U2TA 3L1VA 4YH1A 1Z4NA 2CFRA 3E8MA 1TA0A 2FI1A 3AR4A 1TE2A 5ALVA 3DDHA 2HCFA 3S6JA 3OPXA 3ZUPA 2BY4A 2IOHA 4NFLA 5ALJA 3E58A 4BX3A 3EWIA 3R09A 4G63A 3ET5A 3QGMA 4KX3A 3CNHA 3U7GA 4HGQA 1U7PA 2I7DA 2YJ6A 4O8CA 1Z4PX 2G80A 3WKDA 5ALOA 3L8EA 3U7HB 3FGOA 5ALLA 2P9JA 2HDOA 5AIAA 2OBBA 3WK6A 4UASA
chains in the Genus database with same CATH superfamily
2F3QA 3ZLJA 3QU7A 4GP7A 5HBGA 4BWFB 1U9IC 1ZUNA 4MWCA 4HUJA 1LK5A 4XFDA 1C0KA 2H18A 3QE4A 4W6QA 3D7KA 3HN2A 5BT9A 4UATA 4FMCF 4MKZA 3ICPA 2J3KA 1FTWA 1EP1B 2W48A 3FUCA 3EVDA 3SAFA 3H1BA 3OOSA 3O8OB 4KN5A 4HEQA 3GFFA 5EP4A 1S2GA 1T10A 1WIWA 3QK7A 4R7ZA 3RVOA 3V34A 3A70A 2PKQP 4BFZA 4YRDA 4ZOAA 4I50F 4Y1GA 2YFKA 3R74A 1QP8A 1GTRA 4LVCA 1YR6A 4PYQA 3NIWA 3VHXB 5CFPA 3OZAA 4D97A 2C9DA 4NCAA 4ETIA 4US8A 3A58B 3KHSA 2EU8A 4F5DA 4FE3A 1TU3A 1PE0A 1FUYB 4PL2A 5CEHA 4ELVA 4F8RA 5A5VA 2AXPA 3GCWA 3TAUA 1Z63A 1DP4A 4P0QA 1DBSA 1BIFA 1Z82A 2PUJA 3N0VA 2NSHA 3K1RB 3M5PA 3NDRA 4EGFA 4FGWA 3N3BC 3K1YA 2Y1FA 3HSKA 5FWDA 4I2FA 1B26A 2DBVO 3BPSA 4FU0A 1HNWB 5KAIU 1G5PA 2OXOA 2PLWA 5EMNA 4EJSC 1IDOA 3IQFA 3WBBA 3W05A 1RYRA 5C31A 2J9RA 5IKEA 4I9GA 3G6WA 3TXAA 5K6TA 2AQ8A 2QS9A 3ETDA 3LF2A 5EYPB 4D4JA 1NJ1A 3DGEC 1WXDA 3VTKA 1X42A 1L7XA 1TJ5A 1IHDA 2QENA 1I0IA 4I1OA 4I1SA 4TVBA 1RRMA 4WXHA 2H92A 3DTVD 3MYYA 3I9LA 4C3UA 5FIUA 4H18A 4V2IA 5JJ5A 3E8SA 4D43A 1ZN7A 1I7LA 1SD2A 2IGBA 3OSZA 2YB1A 4WBXC 2WTUA 1NK5A 1PR4A 2AUTA 2J45A 3UC5A 2V59A 1RJWA 3BF7A 3H97A 1K92A 4WJKB 4JI0B 2A30A 3UT5A 1I3CA 4HS9A 5KTYA 2ALZA 3UCFA 3C7CB 3NWPA 2HMUA 2P8JA 3MTAA 1RMQA 3H4DA 4QDZA 4Z1MA 4D9CA 5KO2A 4F04A 2XYPA 4O29A 2QTRA 2C2WA 1JV2B 4BNWA 1NK0A 2XB4A 4IR7A 2CNWA 5L3RA 3T7KA 2CJFA 2FHPA 4NBNA 1BWPA 4IIDA 4ZU1X 2K8BB 1QNFA 4WCFC 3RTAA 4YECA 1ZDMA 4HC4A 4AY6A 3LCMA 4B6PA 2EWVA 2JKZA 2XYHA 4XB6B 1VKOA 1QAMA 4W82A 3JQEA 2Q1YA 3BFVA 2J4FA 4ZPJA 4G84A 4DRXB 3K20A 1WBJB 3CGGA 4DNOA 4NL9A 4EY5A 5DTQA 2FFBA 3PV8A 4P83A 2ES4A 2R7KA 3K0KA 4BAUA 4DIFA 4XVRA 4A6EA 1G4UR 1N5RA 3MXOA 3VNRA 1K4MA 1KI8A 1PEAA 2YJTD 1DBIA 4UUPA 1WW8A 2JGLA 4G65A 1W0JA 2GK3A 4HTFB 4K88A 1WKCA 3S2UA 3FDZB 3BAFA 2A9RA 1LV5A 5C52B 4DV6B 2V74B 2BFEA 4YUAA 3ZJYA 1MPXA 2ZANA 4OUKX 5K3FA 1B8OA 1KI4A 1UPCA 2GETA 1Q14A 1HA3A 2ZJAA 2AZDA 4QQ8A 5DTRA 1RC1A 2XNHA 1PO7A 3CLHA 4HYTA 5B4TA 9ICNA 5JBIA 1GGMA 2QGNA 5K1ZA 3H5VA 4N40A 3HKEB 2P4SA 2JFGA 1VI6A 5TB5A 3SX4A 3U16A 1RLMA 2BHSA 4JAVC 4AMZA 4BASA 1TYDE 2FB9A 2ZJZA 3WKCA 5HXAA 4GRIA 1GQ2A 2PI4A 2VP4A 3L9WA 4RZQA 3SQNA 1FFYA 6Q21A 2D59A 2MSNA 5DGBA 3L02A 5FUQA 1QFSA 3A05A 4N5MA 5JUWA 3EG5A 4KBGA 1NG1A 3RSGA 2VJ5A 5TGZA 4EUSA 2P9BA 4L4YA 4F9TA 1QP7A 1Y8QA 3JPOA 1CWUA 1EXMA 1FRFS 1P7ZA 1XXHA 2EF0A 3CW8X 3WFIA 5JBNA 3GO4A 4RY9A 3FNEA 3V4SA 1WXEA 3EPIA 2P35A 5EJAA 5JEEA 1VQ1A 1DEOA 5IILA 2GAIA 3ED1A 1SH7A 4F45A 3QX3A 4YB8A 2OFWA 2ZSFA 4M9XA 3WYFA 2CLCX 3ZCXA 2NO0A 5J2GA 2MINB 5AQ1A 4EB6B 4NF2A 1Y42X 3WSTA 3LZCA 2W4IA 1U0GA 1OWLA 4DQPA 2QRUA 5CLFA 1R5NA 1T4CA 2O2EA 3O94A 4TMKA 1ACLA 5BRNA 1PL0A 4G4GA 4PLPA 4IRCA 3T5JA 4AD8A 2G7MC 4JJFA 4I9HA 4D92A 3EH2A 5DYNA 2Q4BA 3WRVA 3JD2A 2Y1DA 3CBGA 3OCJA 2VIIA 4HKTA 1J2UA 1EA5A 4U3JB 1TM5E 2W2PA 5JZMA 4IDNA 4JROA 1Y6FA 2ACEA 1PR9A 3HKDA 1U3CA 3QUTA 3CM0A 3H8JA 2FKAA 3DWGA 3BJRA 3MOGA 4RDHA 1KFDA 3I2GA 4ZO4A 4AX4A 4CM8A 1Q3HA 5HSGA 4DLAA 1ODKA 5HYVA 2HYIC 2QMHA 4KXLA 4LSMA 1L7RA 3HSYA 3GGOA 3C8MA 2QMEA 4FBMA 3L0YA 4FR2A 3OTWA 5BWMA 4QLOA 1ISSA 5KCZA 1XROA 3BBLA 1GN9A 5KG4A 4AZ0B 4BLRA 2FJ6A 4J29A 1OI7A 4KLRA 4KMRA 2QLFA 3W7BA 2ST1A 4RGVA 4NL9C 2A3RA 4F50A 3ZWXA 1SBHA 1U1IA 2P9ZA 3WXBA 1U48A 1OKKA 5BV8A 5AM3A 4AQYB 4Q3CA 2PUDA 3HYNA 5EMLA 1SHLA 2CXSA 5AI5A 3FCOA 3VR4D 1OAOC 1MEEA 3ZCUA 4B74A 3O9MA 3GIKA 1L7OA 5HVNA 1SPBS 5I8PA 4CCAA 4D9GA 4XSGA 2DTEA 2OHFA 1T8TA 2LKDA 3HCCA 4L4SA 4QPCA 3RJJA 1R37A 1Y5IA 2IYQA 3AF4A 1FQOA 4BQPA 1JG2A 5FPPA 3RAXA 3NFYA 4RQAA 4AXXA 3AERB 2X6TA 2F43B 1FTQA 2TMYA 4MVJF 3GV5B 1E9AA 1KBUA 2HC9A 2WV7A 4XCVA 4XPZA 3HJTA 5FTNA 5KFHA 4E14A 5HUJA 1A1VA 4K9DA 5I9NA 1PDOA 2OV4A 3C3CA 2PT6A 2IPMA 3II6X 4WERA 3Q8MA 4P4MA 1RVV1 1E1QA 1JHXA 2APJA 3VSBA 1RXUA 3INNA 5I8WA 3M34A 1NP3A 5THKA 1XKXA 2VDOB 3KHTA 3ZZUA 4QE3A 2E6UX 3HEBA 5LOVB 3TW8B 2R6CA 2Q9AA 5HR5A 4F5OA 1HORA 4I2GA 3DUWA 1ZQ1C 5B37A 3T3NA 2ON6A 2FPKA 2LPEA 3C2LA 1L1RA 4GAEA 4RD3A 2QJRA 2V7WA 1WCIA 2PYZA 4CMAA 1E5XA 5KC9A 5FBRB 3TW0A 2JAQA 3PLRA 3AIMA 1E6UA 1FTGA 3NVMB 4CLOA 2BR4A 1ICIA 2WVHA 3H4VA 2WF9A 1H0HA 4G8CA 4Q45A 1VLJA 3A25A 4D4KA 1QIIA 1SCNE 1HQCA 2QA5A 4IIFA 1G8SA 2NWQA 1YCHA 4GBED 4OHCA 3CZ5A 3RUHA 5KQSA 1NI5A 4UHDA 4EA6A 1G7SA 5FWXB 2IU6A 2P4QA 5F4BA 1HLDA 4P35A 3O2JA 3U3XA 3ZZNA 4DM3A 4DJEC 2PUBA 1U7ZA 1H4TA 2WTEA 2XBLA 4F5YA 4JJAA 2X8JA 4RV5A 2K4IA 2OB1A 4X7PA 2IYTA 3JQRA 1CUGA 1A7UA 1HOXA 1WJGA 2P9HA 3D5EA 4QPPA 1EJ6A 5HZHA 2GYVA 4ZXPA 4GQIA 1LBEA 4ENWA 1FYFA 1PK1B 2FX5A 1OLSB 1S4MA 4JSRA 4JI3B 2BCGY 4EELA 1YZKA 4FZVA 3PQ2A 4REOA 5GONA 5ADWA 2GMWA 3ZXIA 1QM5A 1JH9A 4BFXA 2XZDA 4PZ0A 1SCDA 2EP8A 1LLQA 1RWXA 4UB6U 2C9YA 4HR7A 2F55A 4KFCA 3AM3A 3ETGA 4CLXA 1FLVA 2GNOA 2ZRQA 3BSSA 5H68A 3FXAA 3WNBA 1K9VF 5AM4A 4NLNA 1Z39A 4B7ZA 2W8ZA 4IXMA 4D41A 1XUOA 2AXQA 5IDWA 3QX7A 4ZMBA 1BVUA 1TJ3A 1I4EB 4AJPA 2NRTA 4FB5A 3SWWA 4P7FA 5AHXA 1ZQVA 1UBOS 2JLAA 3IHWA 4YLGA 4Q48A 4V0SA 4ZZ1A 3T4PA 4FLFA 4GO1A 1YNOA 2HMAA 4KFRA 1QRTA 2DC1A 1F60A 2EKQA 2J07A 1XZJA 3D8BA 4O4HA 5KZMB 1EBUA 1U80A 1NVUQ 5AKXA 4O5KA 2BUCA 3WGHA 3SYLA 1SURA 4AMGA 1MB0A 3NBFA 3RSZA 2VZ8A 8AT1A 2FW8A 4PBRA 3NOXA 1JHQA 5ALZA 2EJCA 2P65A 1X0XA 3K2EA 1VG0B 1YC5A 2PNJA 1XT6A 3T7EA 4TXHA 3OUUA 2ZWIA 4CKXA 4JQZA 2KG5A 2ISQA 4YCNA 1D07A 3FHJA 1UDRA 4RVFA 3P0IA 3ZBQA 4RVNA 2FMUA 4MPTA 2XCRB 1ZETA 1U04A 4C03A 3LQ4A 3SR3A 4FD3A 5F23A 1ELOA 1Z4IA 2YX8A 3AYXB 4XQ0A 3DNPA 1NKBA 1E1NA 4Q9KA 5DHFA 4PHTA 1ZQ1A 3U4HA 3RBDA 4J1TA 1PCXA 3PQ8A 3PCXA 3SMVA 5L1KA 2Q4TA 3TGWA 3FBGA 4IW3B 1TVEA 3DR5A 3MTJA 1A8PA 2WTMA 4ECTA 1L5NA 3V4OA 3W5HA 3IR7A 2AD1A 3OJ0A 4I28A 1D8TA 1KHHA 1DSSG 1CB7A 2HMTA 3QKSB 2QTGA 3BQ2A 2J3MA 1CFJA 2Q1XA 2X9QA 2FSPA 2WJWA 1QRDA 5TMEA 4DBLC 2D54A 3UAGA 3T1OA 3H2SA 4CMIB 3TD2A 1KK0A 1NLFA 2YXBA 2JXJA 1ISRA 1EGHA 4ZHSA 2J3QA 2HBRA 2IXAA 4AWBA 2VLBA 1IVSA 1Z34A 3P94A 4I6GA 4HVLA 4FN4A 1QANA 4FYYA 1KU6A 1ZBQA 3OLWA 4P1ZA 3IPXA 1HZZA 4EY6A 2EW1A 4D7AA 3TJRA 3I9V1 1FRQA 2LCQA 3NT2A 1VIMA 3DL7A 5KWJA 4ETWA 3V9AA 4A92A 4E1VA 4D3YA 2P41A 2RAPA 1G2QA 4KBFA 1W96A 2KLBA 3WBJA 4DSUA 3G2JA 1JNYA 1GZ5A 3KOUA 4N9WA 3LOUA 1XZFA 1MFPA 3BVPA 3QUBA 5D84A 1FFXB 1JVBA 3QELA 1W25A 4ZVTA 2BT4A 3JTMA 2GESA 2A0YA 3Q85A 1U3UA 2XT0A 2BRUA 3FLEA 4CFYA 1VPTA 2WB2A 2BCEA 1NQAO 4G2TA 4ZZ2A 5KVQA 2QXUA 4G2NA 3SLGA 1CE8A 2D5BA 4EZEA 4R3UC 1WETA 4OAQA 4RZXA 1MG0A 1QH9A 3MR5A 1M83A 1U1FA 1I2ZA 3D5TA 4GYYA 1BX3A 1P2UA 1SEVA 4D8XA 4HOYA 2QE6A 2E6KA 2VPQA 3K15A 3EFBA 2Q41A 1SRQA 4NULA 4ED9A 3D7NA 4RFSB 3HU1A 4MR7A 2ZYAA 2GAOA 2YZKA 2VAVA 2CWWA 4ME6A 1SCJA 3O8RA 1IULA 1BJKA 2W5UA 4M8IA 2B36A 4HDOB 4ENPA 4Q3DA 1MW9X 1PGJA 4ZKEA 1U28A 4JI2B 4P93A 5LB4A 1IFXA 2O2IA 1HT2E 1C5KA 4MTCA 2ONKA 2IOYA 5F2KA 3MRTA 5BO5A 3K71B 1H1LA 2PQ2A 3J7TA 3TL2A 3NHZA 2FEAA 4O5OA 2DR3A 1JQEA 2LBPA 1HYEA 4L51A 4RTRA 9ICJA 4JLWA 4RTJA 4QLAA 4XTRA 1T1JA 1GUFA 1NLYA 1Q74A 2DKOA 1SXJA 4F11A 2WJIA 5KVCA 3ME5A 2RK6A 4HG2A 3DDCA 4OTZA 3A04A 3HB7A 3OJCA 4ZYTA 3DQPA 4QOJA 4ZDKA 1RS0A 4K86A 4P4LA 7GPBA 5CFZA 1I5OA 2IPOA 3JATB 1CJTC 4DMGA 2HK6A 4K6GA 1NVTA 1XV5A 5ALTA 1G0NA 5B1EA 2UVWA 1H1TA 3L2OB 2RONA 3RODA 1PSDA 2RFLA 3B9QA 5JDCA 2EARA 2P9FA 2PA3A 2W8BA 3LTEA 3PXXA 4Z0TA 4HMPA 1XEXA 5D3MA 4XIIA 4QPNA 4ZYUA 1TA0A 4DIDA 1BJRE 1C81A 2XLBA 2NPOA 4PR3A 5CYGA 1JHAA 3SIWA 3FVRA 4LJ9A 4LOIA 4IX9A 1GSIA 3B6ZA 2NUTA 1FOEB 3IBCA 4ECZA 2BY4A 3Q7QA 5FTJA 2VR1A 3GP5A 2FZ4A 3KUKA 1EK0A 1UDXA 1PBTA 4HMOA 1G3IA 3BTOA 1CUXA 3NFRA 3IJEB 1JIVA 3P9RA 3V5NA 5KNIA 1VL0A 3LO8A 3W06A 3MGAA 4LSZA 5HHTA 2KKPA 1T8SA 2PKXA 3LP6A 4CMBA 4KX3A 5HMLA 1RXVA 2V7XA 3BE5A 4ZPXA 4AJ2A 3U7GA 1CETA 1JZQA 1KAQA 1XEAA 5DB6A 2EKPA 3G2LA 3HPQA 3PJDA 3B53X 4G26A 5C81A 1G21A 2IK8A 2PT7A 1OE0A 4QXPA 4Z9AA 2ASLA 1QPBA 4FEEA 1LVUA 4YAWA 5ITSA 1XO1A 1ZN9A 4OB8A 5FL3A 4K4IA 2GHIA 2XKAA 3DM5A 4EHIA 5JDIA 1LKYA 3ONWA 5HFJA 2IYAA 3QU9A 1V5IA 3EBLA 3HP7A 4RNDB 3SIRA 5CG2A 1BX0A 5I4CA 2G8NA 1TF7A 1X7HA 2X2PA 3A2LA 4KUEA 1D2MA 1WXXA 1XTQA 2R4QA 2CC2A 4NBVA 1DBPA 4WK2B 3F9IA 1XK6A 1BPXA 3NP7A 4RMJA 3I9MA 4LG1A 3D43A 2PU7A 2CEKA 4BJ6A 5ARBA 4Y7CA 1JR3E 1N5DA 4LDNA 4P32A 5GZ1A 4L9RA 1R6BX 3DWFA 3EC7A 3M6ZA 4ER0A 5L4NA 3LWLA 5K8UA 3EW9A 4KRGA 5DMHA 3TTXA 2I5PO 2KMLA 5HX7A 4EWLA 3CNOA 1N3LA 4IGEA 4KPUA 4XA5A 5FWYA 3JPQA 4DL7A 1K5HA 2YJ3A 4Z7OB 1XDSA 3GLSA 1TIBA 1N77A 2H2WA 3MD9A 3JATA 4O2LA 5D3ZA 4MGKR 4UZEA 3RS5A 2BP7B 1RKUA 3SIPA 9ICPA 2R18A 1WPGA 2J9FA 2E55A 2WU4A 3BCUA 2D1TA 3I9V6 1XTBA 3FFXA 3KDAA 3LYLA 4FILA 5FBHA 3EZYA 2B4AA 3L0BA 1S3FA 4A8JA 2NOAA 2C4NA 4R68A 4IDHA 5IARA 4AURA 4TVKA 1D9ZA 1ZQUA 1RHMA 2GEDA 2X8JB 3EJ6A 3QBTA 3RD5A 5IFKA 4EG3A 2Q99A 3KQPA 5LKRA 4CR7A 5DG8A 2WT4A 5EE1A 1CR1A 1NPDA 2BW0A 2JIRA 4ZQEA 2ORIA 2CK3D 3CUSA 4O3SA 3FUUA 1KA9H 1LPMA 4PZDA 2YASA 1MQ3A 2HBJA 5J2AA 5FUMA 3OE1A 4RJIA 2MUTA 5EGNA 4RS4A 5E9QA 1VLZA 2FMFA 4A9AA 1YJXA 3IEXA 2RE8A 2E5LB 1OZGA 3PPWA 1JA0A 1QWOA 3SVZA 1V39A 3CUVA 4D8VA 2KVSA 3AI1A 4ZTUB 3NDBB 3DBLA 4PL1A 4R3WA 2JH1A 2ETXA 3ECAA 4HYKA 3CGWA 2XE6A 3CZ4A 4ASUA 3WJ2A 5JXJA 5LQJA 4EBFA 4WCVA 3LT5A 4K3UA 5J2TA 4DR1B 2O8BB 1LI5A 5B5EU 5KFFA 1M34E 2QD1A 3RU9A 4EIWA 1V8FA 3ZWCA 5IF3A 1SOVA 1X8XA 1WB9A 5LPNA 2WB4A 1MKYA 4U8HA 1GPJA 3V00A 4DGQA 4MDFA 2G5GX 1JLHA 1UDAA 3GZTB 4GPIB 1KFSA 1ZQTA 4RHYA 1HDRA 1YDEA 4R2MA 3TOCA 1E9SA 1NVGA 1RYYA 1T8RA 3QFHA 1DRKA 4XWGA 3WQBA 2QPTA 3PKIA 1AQIA 2BM1A 2PUTA 5TMPA 1Q12A 4Z4IA 2EDUA 4IOLA 3NU1A 3QPCA 4GL2A 4EHJA 4L07A 3HFGA 5F52A 2B25A 6ADHA 4DR5B 2AQIA 1KHTA 3ETCA 3TYXA 2GN8A 1L8LA 4FX2A 4CM4A 4UBCA 2CJXA 3PWZA 2NRZA 2NU9B 4ZGBA 2Q2NA 3JQ6A 1T9DA 3JASB 1FSSA 4IOMA 3T8YA 1Z7WA 2FVYA 4XDYA 2F1KA 1N6PA 1YI1A 1UPHA 3A1VA 1B76A 3UWPA 4DJDC 2GXAA 2V0GA 4UMDA 1AV6A 5C80A 3OQIA 2CWDA 2J0VA 1NSYA 1XU7A 1M8JA 2JCGA 3NOVA 4GLFA 3WFJA 4C4OA 4EVQA 4E2WA 5CYOA 3GJRA 2JC3A 5DXJA 5SZKB 4DDHA 1P2GA 1XL0A 5CDSA 4QOEA 5CFMA 3BIWA 3GQVA 5JTTA 1XZCA 1PWHA 2ZXFA 3HDJA 2OCBA 2OFXA 4JP2A 2KEYA 4Q7MB 4CMEA 1SZDA 2JFXA 3NJRA 4NAVA 7ICPA 1MO5A 4L6AA 4RJTA 1NW8A 2CLFB 4OA8A 4RFVA 4TLDA 3RFVA 4DLYA 1EWKA 2W42A 1YB7A 5JADA 2YJGA 4TUPA 2EZXA 2HZ7A 5FO0A 2IYSA 3UA3A 2R6AA 3OQ1A 4HLUC 5EZ6B 3CW2A 4LJXA 1E3EA 2JD2A 4HRVA 1B41A 2EJWA 2JRZA 1R0LA 4KAJA 3FUXA 4LDRA 5ENZA 4EJFA 3V6KA 3PLAE 1N62A 2C5AA 1F12A 3ROKA 4MLZA 3OX1A 3RF6A 3OIVA 4BV2A 2BJVA 2YHAA 3FMFA 1PUZA 3ADBA 1DTSA 1ZJ5A 2PR7A 3O92A 3QBJA 1H4QA 3QENA 2FFJA 4GDMA 5EIEA 4DB4A 2FW0A 3N8GA 1VG8A 4PZOA 2XRMA 3CC8A 3CH4B 3UJCA 1HLFA 2ICAA 1G1AA 1YQEA 4K9SA 4L2IA 4P33A 4PQFA 2EX0A 3Q2IA 5LMCA 1SKBA 2QL5A 1JTEA 1FP4A 1SB3C 2XUFA 3RUCA 3RUPA 1VE5A 1IBRA 1CFZA 1EHIA 2P75A 3GW8A 3B1XA 3NBUA 3OVMA 4UUQA 4B3TB 1EVIA 1E9VA 1V6SA 1XWFA 2PFSA 1Q2UA 2JIQA 5F78A 5FOTA 3U3MA 3GVCA 1P3Y1 2FPPA 3FH0A 3EGXB 3M82A 1Z2EA 3KYBA 4JIGA 3W04A 3AHIA 2CHVA 2OCXA 3L9XA 4TTIA 3RJTA 2QPLA 1Y9ZA 3MT9A 5A04A 3F5EA 4KLSA 1UFOA 1V7ZA 5EP1A 4GKBA 4GKJB 2DL0A 2QQFA 3LLSA 1UDCA 3KUCA 2CCGA 3C7AA 2YIVX 4Z1OA 5E3JA 1SV0A 3PHIA 3QYJA 3IIJA 1T25A 1DO8A 2FEPA 3AO0B 4R69A 2NO4A 3V6JA 4Y6LA 2VRCD 5TNXA 4MITA 3S2YA 4JL8A 4C0ZA 1IXKA 4GYKA 5IN5A 1YVUA 4CLRA 2G63A 1E2UA 4YR3A 3RJGA 3D7MA 4HX5A 5I9SA 1PU2A 5IVIA 4GVXA 4UB4A 1EWRA 3EIWA 3C97A 1A4UA 1N3IA 2HN9A 2WR8A 5GAJA 4GOJA 4URYR 3E5MA 4E2YA 1F0PA 2OCDA 2ZRFA 3EVZA 1J9EA 3ZLBA 1DGJA 2AXNA 3GLHE 4DQLA 3AL0B 3ACCA 3DZ8A 2WKWA 1MENA 2OLJA 3L6RA 3V3KA 3QKTA 3TG8A 3EFOA 1U7OA 4BO5A 5BVHA 1R8SA 1QCZA 9ABPA 3UJAA 3V72A 3PUYA 1PJ3A 3C3BA 4TROA 2C00A 3IELA 3LKZA 2IUUA 3SXUB 1K4KA 1GZHB 2ZTHA 3JWIA 3I04A 1G7RA 1G8MA 4G5QA 4C3OB 3TLJA 1J24A 1TF2A 2OKCA 3GJYA 3R3XA 3AOEA 4M0CA 3F2IA 2ZFUA 2ZIXB 2AHOA 2PFGA 2PMDA 4PGHA 1RHUA 3ZW8A 3P9PA 4C3ZA 4CYMA 5LIPA 1UKCA 2QG4A 3TIXB 1CZKA 3E7PA 4FCVA 4HWOA 2XD4A 2JLQA 3ADOA 3JWPA 5DASA 5KYVA 3UOGA 4BMVA 5HZGA 4NBSA 4CBVA 4GXIA 4Y6SA 3V2GA 1M2VA 3MT7A 4O4JF 4DILA 5CITA 8ADHA 1B93A 4DLGA 2BGJA 2PGIA 3EGCA 3OX3A 4H4DA 4RDCA 1FBNA 1GOTA 3HJNA 2FX3A 4GI5A 4PAOA 3KV1A 5JSUA 2M6RA 1Q0QA 2CBZA 3T3PB 2WYIA 4G9EA 4B4WA 3W9YA 2XI4A 3DW1X 1SXDA 4FFDA 1A8SA 1WQ3A 3DAGA 3GJ8A 3MPUA 4NPHA 4Q66C 4R1UA 3WHIA 5I9LA 4UPEA 3KSBC 2VTBA 4CEHB 4CEJB 4ML3A 4B7UA 4C0QC 5C51B 4LAFA 5I7HA 2YWXA 4GMXA 1SUWA 3HBAA 1DIGA 1Z0IA 2FVXA 4NDNE 1CVLA 2X1LA 4U39A 1XGKA 1XNGA 4YRQA 2PJRA 1D8AA 2OC9A 4GS5A 1Z0DA 1DKNA 2ZULA 3X2EA 3LC7O 4PXSA 4N0PA 4M8SA 1UDWA 1KQQA 1QV7A 2RBEA 3MCAA 3KQHA 1STOA 4WW0A 4WN9B 1QZ3A 3BK2A 4I50A 2C2OA 2QORA 2AI2A 1W85B 4MRSA 3N70A 1XXHE 1J0DA 3UOAB 3QLJA 5J2UB 4BVGA 5HIIA 3RRGA 1FUKA 4L72A 3V2HA 1Y6GA 1SKWA 4OJ6A 1F0NA 1ZOPA 2PS0A 3HR7A 4U63A 5SYMA 2QRKA 2WIAA 3HDGA 5GV8A 3T5TA 2EXXA 5JO9A 4DTIA 4NG5A 4B6SA 3K9WA 4DUGA 5DBCA 3VRHA 3ORQA 4PZEA 4UU7A 2FEMA 3FPBA 2RGEA 1M1YA 4PWZA 4NY8A 1EB9A 4LE1A 5EJ4A 1RIIA 1P5ZB 5IJWA 5KC8A 8ICEA 1O57A 2PMWB 2XD9A 4YO8A 4OA5A 4PW0A 1PJCA 4DFKA 3CLSD 3I1IA 2GBIA 5TSDA 4ER7A 4JITA 3SY8A 2YZGA 2A9VA 4FYIA 4PHCA 5IH3A 7ICJA 2I4NA 3LPAA 3KKNA 3T61A 1YRWA 4TQ9A 4EYIB 1GLGA 1Z36A 4P6VF 1BS2A 3CNEA 2A84A 1PG0A 3KT3A 4P80A 4XIGS 4EPWA 4ELUA 4W9NC 5TT1A 5KTKA 5IT9A 2J0UA 4B8YA 3EGVA 1XLTA 1KMNA 2EERA 1FDRA 2GR9A 5DV9A 3SAJA 1XZIA 2HJ9A 3KNZA 2FW6A 3MJHA 3HYLA 1K3UB 3NX4A 4FMCB 4JJZA 2K4MA 4MCIA 4O1IA 3WLRA 1V96A 4P22A 1IC6A 4EUFA 4LJ7A 3R3VA 4CETA 3AF1A 4RPGA 2ZXIA 3RB4A 1OA0A 3WL4A 4AAYA 1RZUA 2OECA 1K4YA 1E6MA 3GYBA 3Q9UA 4MH0R 1XNQB 2C61A 2WM9B 3M5CA 2PXAA 2O4UX 1PL7A 1L5QA 5GOTA 3AHJA 3H11A 1SA0A 3IX7A 5IXYA 2QVZX 3AF6A 3SV3A 4FDMA 2CFIA 1YS9A 3EQ7A 2AE1A 1CLEA 1ZI9A 5YASA 3GUCA 4I8IA 1U0SY 4QOHA 3RG8A 4YNBA 3WLPA 1Z4MA 1JG6A 4FFOA 1PFGA 3RVRA 3HSSA 3IFSA 3LYAA 2XUKA 3N0RA 2NXNA 5GP1A 4WA7A 1KRPA 5D51S 5ERGB 4XGIA 3UATA 1AS0A 2ES6A 1HDYA 1Y98A 2JFPA 2XB9A 2XQKA 3GFVA 1CUZA 2CKDA 3FTQA 4REQA 4GOLD 3WOHA 4OK3A 4QJFB 1Y0BA 3CLRC 4YAUA 1KSFX 3DHNA 1ZGBA 4H17A 3QVLA 1Z33A 2HW3A 2ASDA 3HKDB 4A0FA 2HIAA 1PJTA 1FFAA 1ZNXA 4EBBA 1M34A 1GYRA 1I7NA 1F7UA 4F4ZA 1VL8A 1XP8A 1HBJA 1ONBA 4PX2A 5KHOC 3VVBA 4J7UA 4F6RB 4ZVUA 2AR7A 3OKCA 5IJAA 1VIVA 2XCLA 3A1UA 1N2CA 2RG7A 1BE8A 4HGRA 1SZPA 1EFLA 5J4VA 2G4LA 1E2LA 5DP2A 3IEMA 1BQEA 2RHBA 2IV7A 1QJ4A 3N7RC 4G5RA 1U0OC 5ALPA 2C2HA 3GWZA 4S1TA 4YMVA 2JEOA 2QZ9A 4CLRB 1CR4A 2ZB3A 2NU9A 3FTDA 4M8NE 3ZQ4A 3C4VA 1NNLA 2I7TA 2DKXA 1X9MA 2RKOA 1P33A 4BMNA 4D4MA 1OIXA 3R9WA 1N75A 3FKSA 3NTUA 4JP8A 4M87A 4BBJA 3SSMA 3WKEA 2C0PA 2RGWA 1Q5PA 4ZCRA 4LF7B 2WJAA 3EYWA 2KP7A 4F3TA 1VSVA 1C1DB 4MUMA 5FORA 4D98A 1GQQA 3H9GA 1ZQHA 3NHKA 4UTZA 1TQ4A 5C0OE 2J5BA 4F93B 2E1PA 1WY7A 5B7NA 1UZMA 1JHZA 2W6OA 2FPMA 4P3XA 4UM9D 2ZTVA 4QSMA 5F35A 3I6BA 4BNKA 4MGHA 2RJNA 3M9MB 3PVXA 1F8UA 2DF4B 3KJQA 3K1ZA 2WFZA 3ZU2A 2DSTA 4QZIA 3ZE2B 5D46A 4MW1A 2Q1SA 4MW4A 3AQEA 3IT1A 4H2DA 4FN5A 4N4AA 1V45E 4EGCB 4Z3KA 4DJFC 5KOHA 3VR1A 3I61A 4M1KA 3BK1A 3PVCA 3UAYA 1ZCFA 2YHIA 3CPHA 4JP5A 2P6OA 2B2XA 2O8DB 1XA3A 3IVMA 3L0ZA 3VKUA 4N5HX 1EGQA 16PKA 3N2KA 1B4DA 3KFUF 3HUTA 3PDUA 4FVTA 4IRDA 4KDEA 3AINA 1I3NA 2E89A 5IIJA 5F7JA 1MT3A 4NBRA 4WZBE 4F2HA 4A91A 2ORYA 3PC6A 4CLHA 3RFAA 3G1WA 4EI7A 3GLGB 4IQVA 4TYPA 1RYZA 1I4OA 2GZRA 1N4AA 2IDMA 3BKXA 3AJ8A 3H2GA 1QV9A 4ENSA 2C7PA 1I0LA 3NHBA 4MS4B 4FGUA 2WFAA 4B4KA 4TVSA 1C7ZA 4H7EA 3L07A 3JW8A 2AOUB 1HWYA 3G0DA 1ZHOA 4QNMA 2GPNA 1AF7A 4UUAA 4HAXA 3NYRA 5ABPA 1X9HA 4YWHA 3VVLA 3TVDA 4NXZA 4HGZA 4YUXA 4UBJA 1T5BA 2BMEA 2W4MA 1M6WA 2NT3A 3UMBA 2G7ZA 4PHGA 4CMIA 2VDVE 4B3GA 2O5CA 2ACVA 1Z5GA 2OESA 2V03A 3OZ7A 4V0KA 1KE1A 4CKWB 2X5KO 3E9CA 1JMVA 4G1FA 4XR4A 2QP3A 5EKXA 1YD7A 4ZAZA 3ZHYA 1N5KA 1C2YA 1RKXA 3MJSA 4WZZA 1QRUA 1W93A 3GJZA 2DLDA 1X7DA 4GBJA 4KJXA 4X8MA 3RU7A 4AU1A 3CX8A 3BD9A 2QMUA 3FYCA 3I6YA 1U2DA 3G8DA 4NK4A 4XPIB 4LDAA 3L49A 2P2SA 3R7WB 3BHNA 2M6LA 2MDTA 1JYSA 1LBTA 2R1VA 1FNMA 4AULA 4AY4A 3O91A 1BDBA 3REFA 2YMPA 4Y6QA 3SBXA 4IMPA 2O59A 1NV9A 1U2TA 1K8QA 1KZ7B 1W30A 4WNCA 3C74A 1RXIA 2H29A 3KZNA 5DISB 3ELWA 4DB2A 1IVYA 2VJQA 2OM2A 5B6JA 1ZY2A 3PFGA 3IGFA 4LV8B 4BNIA 4C5BA 2XGMA 1GTL1 3F4KA 4RD4A 1NOJA 3AESB 1DQRA 3KTQA 3IBSA 4P08A 2HHJA 3PPIA 2VEOA 5FR1A 4BNNA 4ZI2A 3SXUA 4OFBA 1CTQA 2NX2A 5DLFA 3TQQA 4BZXA 1YC2A 2D3DA 1Z3CA 1JKIA 4M8LA 4Q7JB 1V2HE 4JASB 4G63A 3E4CA 2XNDD 1PX2A 1SHJA 1YUBA 2GTHA 1SN7A 1DLJA 1PVPA 2Y9TA 3A4IA 3TTWA 3I2KA 3R5TA 1OSNA 5JH7A 2AOWA 1S3GA 2W37A 2SKDA 1DTEA 4BQQA 5LL6P 4BNUA 1CQIB 2CMKA 5BN4B 3HEAA 1O94A 3CR7A 1GXSB 1Y4UA 2ILTA 2BEWA 1RABA 2VXOA 3CH6A 4BJ3A 3MJCA 4FHCA 5HE9A 4BYGA 4Z49A 4TZ6A 2HLPA 4CGZA 1S9HA 2VYVA 2ZXEA 1Z4OA 2HBLA 3ETLA 1UOOA 1ZSNA 4J0QA 4KC0A 4B3FX 1TUBB 1VFPA 4GI7A 5CVDA 4DQVA 1J97A 4UCFA 1EG2A 4UCWA 4CGYA 4Z1MD 3RC7A 1ES9A 1RZVA 2VTEA 4KXXA 4LRUA 4MWDA 2X8WA 4CQNA 3T3OA 4DCUA 1YS1X 1C7IA 2FG5A 3ZCQA 5KFJA 3O2NA 4YRKA 1N92A 2OHOA 5IDXA 4WPGA 3VH2A 1OXMA 1HURA 2R8EA 4DRXA 1N61A 3NWBA 4X3PA 3I8XA 4BVJA 5AVTA 4BO6A 1JILA 4HX9A 1GUBA 2ZYHA 1S2MA 3DFIA 4MW0A 3ZX4A 3L7KA 1D09A 1W4ZA 3T9FA 4BNFA 1ZK3A 3RVBA 2V3CC 1WCXA 3TFSA 3RFTA 1X1EA 3TJMA 3USCS 1N78A 3RTVA 2AVDA 1GGKA 3MM4A 5BSTA 2H0AA 4OQLA 1SV0C 3V4LA 1S5LU 4UW9A 1J8DA 3P2MA 3N7PD 2OLEA 3L43A 2QRZA 5CT6A 2C88A 3GEHA 4ZHQA 5HUHA 1NW9B 1H8EA 1XFDA 4Q7QA 2HF8A 3ABIA 3VTZA 1GLVA 1XNHA 2PGNA 3HY4A 1GZ4A 3A6ZA 4LBYA 2BZFA 1YS7A 2LGJA 3HMQA 1EVYA 5EWJA 3R75A 2GN4A 1M5TA 5TE9A 5ALQA 2XADA 1XSPA 3KKEA 1TFRA 2CB0A 3A6HA 1QE3A 3IG5A 2FK7A 4Q1CA 5ESWA 3WYBA 2H54A 3VNVA 3SF0A 1RBQA 3CRXA 3H3FA 1B0PA 1PGOA 5MHTA 2NYVA 2P11A 3EXIB 4Q1AA 3C2KA 1FTSA 2EKZA 2R00A 4I3FA 5K03A 1O0CA 4Z4GA 2FTKE 3IKJA 1YZVA 1JI7A 3IT0A 2R6JA 1KO5A 5I9BA 2Q5QA 4UTNA 2GPBA 2RDJA 2OWEA 5TC4A 3TO5A 4K6KA 2Q6IA 1Z73A 2VNKA 2IGTA 3AGQA 3ZUGA 5AO9A 3IE1A 3LFTA 3DBIA 2H4XA 3THWA 4M53A 5E6SB 3S5UA 1W36D 4N7BA 2D3TA 1ZQZA 4Y2PA 2YZNA 3C1UA 3CZRA 3PHBE 2ZJ7A 3FDSA 1Z62A 2HIMA 5G1PA 5GZ6A 1WXWA 2VATA 1ECCA 4PCAA 2KBFA 3NONA 1QAOA 5CPBA 3NS7A 1CY8A 4YFYA 4JLJA 1N8KA 3NGDA 4Q18A 4QUEA 4EMBA 4RVGA 3R5HA 5CDTA 4D46A 3AP3A 4UC0A 3GLGA 1JG1A 1SVOA 4KDFA 1ZMBA 3HLYA 3WK7A 3QOWA 2ZSDA 4ZVNA 1RHRA 3RVPA 4DNPA 3K09A 5DM4A 2OCIA 3D1VA 1OHHD 3LLCA 4RIGA 1ZLYA 3WLMA 1EGAA 4AN1A 3I1JA 3LRPA 1XMQB 1ANKA 2W9CA 3BD6A 4BWGA 1H5NA 1ZD1A 5L6MB 4Q3NA 3GPBA 4RQNA 2C57A 2QL7A 4U7JA 5FLEX 2Z5LA 4E2XA 5L45A 2GBFA 2EF1A 2VA8A 4Y2JA 4NJEB 1ZQDA 2ZQZA 3ASUA 3VV3A 1SQGA 1SU6A 1NF2A 1HDZA 3EVFA 5C8YB 1W0JD 1TEXA 1BTOA 4ENQA 1E79A 1CZNA 1RQNA 3C5CA 2CHUA 5K2OA 1F4LA 1RZ3A 1JA1A 1DK2A 2YFYA 7ICGA 1N5WA 3H7IA 5IIOA 2A0UA 4EFDA 1N36B 2JIMA 1V6CA 2Y99A 1WCNA 5E1BA 1POWA 2VRWA 1GFIA 4KQGA 2AW5A 1ZRMA 3VDNB 1NHGA 1TQ2A 5CR9A 2ZKIA 1LK7A 4FMDF 1GPMA 2R48A 1ISIA 1QKJA 4CV0A 1SGWA 2I2WA 2Q49A 5KTMA 1GKLA 2R8PA 3Q2KA 1G0OA 3GEPA 3WGMA 1DXSA 3D6VA 3UFXA 2QB0A 5KFLA 2VK1A 5J2IA 1PJSA 1XTZA 1Z1BA 1MEJA 3ELUA 3HJCA 3K7EA 4LEIA 4RKQA 2DH6A 3DZFA 5KBYA 1JR6A 3F5QA 4AMBA 4U4AA 1G6Q1 3CVYA 4J9MA 1OUQA 3JWGA 3KDPA 3REGA 3STUA 4A0SA 5MF6A 4LOHA 3OU7A 1IE3A 3P9XA 4C8OA 3RV4A 3B6EA 1L7AA 5TS3A 4NV0A 1J07A 4C7YA 1NW4A 3M6WA 5IAJA 3ROZA 4UTVA 2PD4A 4U2FA 4LFAB 3RTCA 3ZHOA 1D6JA 2VNJA 3BF8A 3PW2A 3B36A 3D4NA 1JWLA 2PH3A 4YN4A 4K03A 3GFGA 3RR7A 1HL3A 5DTJA 4AO6A 3JAKA 2QUIA 1TAMA 3LXUX 3EPLA 2JG3A 1S2NA 3C7TA 2V98A 4IUBS 4JI1B 3RYIB 5E8JA 2NO5A 2FK8A 4UBIA 5G02A 1NNI1 2Q9BA 1ZNQO 2C58A 4G5YA 3W6ZA 3H1TA 2XBMA 3JQ9A 4ZXFA 3A1SA 3GRKA 5DHUA 4YJGA 4L5AA 4D0SA 4AY5A 4JBYA 2GNAA 2MSDB 4N65A 3GJXC 3R23A 1LUAA 4LWOA 5FFNA 2J9YB 1KDVA 4AZSA 1EP3B 10MHA 3RM3A 1EEXB 1P0PA 1XPRA 2PANA 5C7IO 1OT5A 4QZFA 3C2QA 1LLCA 3PEYA 1T1GA 3WLLA 4JBIA 3G2QA 5IW8A 2B37A 1J2YA 3C8HA 4KN6A 3ZLUA 3DT6A 4UTPA 5AJVB 4NU0A 3RSLA 4CKBB 3DXZA 5IJ0A 1KOJA 2YZMA 4GZLA 4QQKA 3ZDXB 3P9YA 1L5SA 1O6BA 4JI8B 5J0UA 1YZUA 4TMFA 4PYIA 2GZ2A 4AC9A 3VDQA 1Q7RA 1XF9A 2WIDA 2FJPA 4Q7LA 3WL7A 3SFZA 1SXJE 2W9AA 2CSXA 4R4JA 1A2KC 1N5JA 1X1BA 4UQOA 4QXMA 3TUIC 1QFJA 5IVKA 1Y37A 9ICMA 1KY2A 2PXHA 2FPIB 2FCAA 2R8YA 2PO5A 3U6KA 1FSPA 4QYIA 3NIGB 1QHYA 1JX4A 3GDOA 4F5ZA 4UEWA 2P3QA 5LA6B 1T2EA 5BUZA 4BFCA 1COOA 2C5SA 3G6VA 2AGVA 3U19A 3N2GB 3I2HA 3RVKA 1EFUA 3ENNA 1JPJA 3KFVA 4Z9XA 2V6GA 4D02A 4YT2A 1ZUIA 3MCWA 4X20A 3UHFA 4OJNA 3VR2D 1Y5RA 3TRDA 3F3SA 3VV2A 2REXB 2EYQA 3R24A 3CLSC 2C83A 4H1VA 1Z7BA 5D01A 4C8LA 3TEJA 3DCJA 5AUOB 3BMXA 1F9AA 9ICQA 1IH8A 3ST7A 3EXIA 3KEFA 1RYUA 3GJQA 4A8JC 1IJFA 1RD4A 1PDWA 2RHOA 3NLLA 2WSLA 3WIBA 2HMVA 4B9AA 1P80A 1RWVA 3LUBA 3Q0TA 3BRWA 1K06A 2YZ7A 3QEOA 4HQKA 4RBNA 4WY5A 5ULLA 4BJ1A 4C6TA 5BUSA 2WNSA 3EXHA 1C4KA 1U7TA 4B6GA 2V6IA 1X70A 1YV9A 2QAGA 5FQNA 4XWWA 5EKUA 1U3TA 4M54A 4KLUA 1S01A 2ZQ5A 3G9UA 4FHEA 4HZUB 4X6UA 4YJFA 4ZV9A 2DF8A 3I6ZA 4EEKA 2HHUA 5K4AA 1X6JA 1PJQA 1E3MA 4OHWA 2N0SA 3EZ2A 4B4OA 4B71A 3A37A 1SJ9A 2FF7A 4CF6A 1D03A 1V1MB 3LQQA 3NI2A 4BX2A 1JEEA 1G8YA 1TPYA 2HAEA 2QN7A 4Z4HA 2H07A 5EJ9A 3JX9A 3NT5A 1SIUA 4N03A 3VHXA 3KTAB 1A98A 4ZAVA 2E1FA 4YP3A 1AQUA 3K5PA 3S1SA 3ZWOA 1IBLB 4V24A 5EUQB 2FWMX 2XBUA 2HYDA 3G8BA 1ZR2A 5JNTA 4BNDB 2WTAA 1B6RA 1TI7A 4EP1A 3G6XA 4O3OA 3GIDA 4F4KA 4LY6A 1SCKA 4CG1A 4MQ4A 1GL9B 2O3QA 2PVSA 1JG7A 1XR3A 4IRXA 3WDMA 4DCTA 2GN0A 1DAKA 3L8MA 4OO3A 3G2IA 4ERXA 3E48A 1Y48E 3JARB 4WJ3B 4MNTA 1A8IA 1QTQA 2LP4Y 2CEAA 2YIJA 2QQ0A 1M7BA 4MQEA 5DNYB 4ZP1A 3FFAA 4K46A 2W70A 2KN7A 5C8YA 1XB2A 2FH5B 2YNMD 1VIDA 2A1TS 1DEXA 4Q19A 1T7PA 1H0SA 4UEKA 3ADCA 4G25A 1FQWA 1KMMA 3QITA 1JN3A 1IHOA 5FPKA 1MAHA 5K20A 1NPTO 3FZEA 3W3AD 4BNZA 4FNAA 3M1LA 3QYAA 5I4BA 4BATA 4E5NA 1G5TA 4X20B 1CHNA 1NIPA 1WZCA 1A9PA 3OZUA 4X45A 3ZW7A 4Q47A 2WPDA 3RC2A 2NIPA 3FTEA 3I5UA 3LHFA 2YNMC 4M1TA 1IG0A 3D9QX 4OQYA 5AWFC 3NAZA 2OH2A 2BHLA 1GADO 2XF2A 4RM2A 1APBA 3GN2A 2FEWB 2PZ8A 4EJSB 5GINE 2GOLA 3C3WA 3W5BA 1QIEA 1E5QA 1Q16A 4M0AA 1D2HA 1JR2A 1E94E 1R6VA 5LC1A 3UYKA 4AZTA 5A05A 3ZZMA 1TYZA 1MCZA 5GONF 1JSZA 3BQNB 3TKLA 1YO6A 4PX5A 2BHNA 3WYAA 2HHQA 2FN9A 2EZ8A 4H77A 4OBEA 2AG8A 1YL6A 2MIIA 5KJEA 1H85A 1YHZA 1DIOB 2VH2A 4IKOA 3EUB2 2B83A 1J33A 3MFYA 4GMKA 3NBMA 3Q3IA 4CMJA 4YT4A 1X1TA 2FQWA 2H9YA 5C5IA 4B84A 1T36B 1VGQA 3VX4A 4RL4A 4XQEA 2QR3A 4KVFA 1LVHA 1XELA 1JXEA 3MBYA 1DAOA 1Q83A 4OQMA 2AU0A 2R11A 4P4SB 5DBHX 5JH7F 4AUKA 2O8FB 3BH7A 5PGMA 3RSOA 1DCFA 3HLTA 3FPJA 1PGPA 1U4OA 3H65A 3M6AA 2GM3A 4J16A 2OP1A 2XJ4A 1EX1A 1QIFA 3D02A 5EZYA 2CV1A 1A50B 4IXNA 5EOVA 1NRXA 2AMLA 3OD1A 1JHMA 4RQUA 4ARIA 1L9KA 2QMYA 3PICA 4GC6A 4EB3A 4F2SA 5IC4A 1H1DA 3PJRA 2ENWA 2AMJA 4HQNA 2WY2D 5KQPA 5GTIU 1PW7A 3NCTA 2DWUA 4DHWA 2WU1A 2XODA 3LH5A 2Z43A 2OCPA 4RYLA 2P79A 4R2KA 1JAIA 1UXKA 3V1NA 3VGJA 3T1TA 1TTHA 4X66B 3ER6A 1JIQA 4QZGA 2O2GA 4M2YA 1V9PA 1S7GA 4DF4A 1KC3A 2NO9A 2WMDA 9ICWA 4W6ZA 2G36A 2G4CA 2O14A 3C48A 4Z2AA 5K8VA 2YB4A 2VJDA 3A9TA 1TDJA 4HWPA 4PO8A 3TFWA 5KQMA 1TLLA 2OR3A 4IH1A 2H59A 1BS1A 4CM9D 5LQMA 1JIIA 4O08A 3PCRB 1HETA 1QSSA 4DUZB 4DY4A 2JI4A 1A04A 1Z17A 2EFJA 2GF2A 2CV2A 4DDKA 2B61A 2QT9A 4K40A 1B43A 4C88A 5GADl 3L8YA 4DR3B 4WLVA 4OCZA 2DH5A 1EZ4A 2K4EA 1ORVA 4LXQA 2X5JO 3AR3A 3LCCA 5CLGA 3ADPA 5AW4A 4FI3C 1J2RA 2J30A 4ARCA 3DJYA 5B1SA 2GUGA 2G9NA 1LNZA 1LZKA 2JA2A 1N5LA 3AHCA 3W7AA 4C05A 2R9VA 3LSYA 1IUPA 2B4KA 2CD9A 1K5PA 2ZYIA 3LQYA 1GL3A 2WWGA 3IIIA 5EERA 3L6DA 5HBRA 3W79A 4F06A 2CPRA 3B1ZA 5TPZA 3EUAA 1HE3A 1YRBA 2D1FA 4RORA 2Q6KA 1HUQA 4H16A 4Q0MA 1WV1A 4PIPA 1G5QA 2CFSA 1QOPB 1E5DA 2RHMA 4OYLA 2X0EA 5K8IA 4P3OA 3TZQA 1GP2A 4EMUA 1UM9A 1WUJS 1OXUA 2D3WA 1NUTA 5FXMA 5A03A 5CBKA 1WDMA 5KDOA 4JQYA 5DDYA 2X5OA 4L7VA 4I14A 3INRA 2YVLA 2TMDA 3WQHA 2IU3A 5I7RA 3JPSA 3H2JA 3DZGA 2RJOA 1LTQA 1Z37A 2GEFA 3DVLA 1DX4A 1E9FA 4GWKA 3TIFA 5EXSA 1KE2A 4L5JA 3AEXA 3KXKA 4R64A 2OC4A 4Q3OA 1RZTA 4FBUA 4GX2A 1ORIA 2EL9A 2PNFA 2X2EA 3N8HA 3RVQA 4A7PA 4JYZA 3AM1A 3B2NA 3L0IB 5GVRA 4NZNA 1TU4A 4QBKA 2NPFA 3HT3A 1H2XA 2XYQA 4LRXA 4XLZA 4DT1B 5ICSA 3QXGA 3SZ2A 1NURA 2I76A 2VBCA 3OFKA 3SQDA 1VYVA 4O25A 2ZE8A 4BKRA 5I4IA 4QUKA 4XPIA 9ICSA 3QY0A 4IIUA 3T3DA 3PK0A 5KINB 4RXUA 1YB4A 1IY8A 3Q7IA 3NEYA 4UEOA 1D2EA 1O9BA 1NXPA 1U6JA 1N6KA 1BOOA 1M6YA 3WL5A 4E5YA 1GVNB 5EE5B 1E5TA 2VWHA 4UBNA 3SBDA 1VLBA 3OJWA 1KJZA 1Z15A 2C95A 4ZCTA 4RADA 4OFWA 1DQNA 3STTA 3BYZA 3EPJA 4WFIA 2W8KA 4X1IB 4FHDA 1E58A 3I2YX 4P5EA 1HNXB 1G9TA 4U7HA 2OD2A 2ZKLA 4A1OA 5DTMA 2BLLA 2KB0A 3DCIA 4YMIA 2YW2A 2WABA 1VHWA 1RI1A 4IQTA 4HQRA 5JASA 1PAUA 3BMQA 2JJ1D 5LDGA 3U39A 4V0ME 3TSZA 3GBPA 2E8NA 3EFHA 4DSJA 2QRMA 3EZNA 4GD3Q 3DVAB 3OU2A 4X3OA 1YAHA 1V48A 5CB4F 3N0WA 5L95A 3A6PC 5J2BA 3QX9A 1A2OA 1U0RA 3K0EA 3WRYC 3GLFB 1PV4A 1DCTA 2IOHA 1YCFA 1Z13A 1ZSVA 3IV7A 5JJIA 5GIPE 4I1UA 3B20A 3KYDA 3SEQA 3UK2A 4X3CA 3VKVA 1K27A 3H2IA 1IEVA 2G40A 4FFBA 4BOYA 4EJSA 4UBLA 1EYZA 1DJQA 2HOFA 4RABA 3CRZA 4AJOA 2LI6A 5J2FA 3C5HA 5JY1A 2SCUB 1FFEA 2D2XA 3H9UA 3KLBA 2KVCA 3DOJA 5CNKA 5H82A 2V7BA 4O8CA 1F51E 5FPYA 3ZI0A 2AN9A 4F46A 5J1SB 1MIHA 1TIPA 5IKPA 4MP3A 1MAWA 5CCDA 1DG1G 1GGNA 2QYSA 2PZMA 2JEJA 2QTNA 1WCV1 1KKUA 4WI1A 5J2TF 5IIIA 3SOZA 4QATA 2O7NA 3EXFA 2VHUA 3S2ZA 1VPDA 4M9LA 3E2MA 1SBZA 2FNAA 2V0CA 2B6GA 1JLLA 4B6OA 3SQXA 4RZ2A 1WCYA 4Y2UA 4EB0A 3AEQA 3I01M 3OZDA 4X8OA 1OHHA 4QYWA 3OFND 4AECA 4CFSA 3OESA 2XIQA 4Z8YA 4YMNA 4RH0A 2H1IA 2JFWA 1ZWKA 5T64A 5A9SB 3GJ5A 2YVKA 5DYTA 4DJAA 1ED1A 1R4NB 2IDKA 4O8ZA 2GJ8A 3BWVA 5KT4A 3I0NA 5A7GA 3ZGYA 4LHVA 1ZQSA 1ACJA 5JPIA 5GZ3A 1QF9A 4ZRDA 5KNCD 5FUYA 3IPAA 4LPKA 2FLKA 3HADA 2FV8A 2A1JB 4A27A 4H7DA 1V41E 1XKTA 1KJIA 1URPA 3QG1A 2XUDA 2FJ0A 4C7BA 5KHLB 2XB2A 5IKMA 2RAFA 2PTHA 2KZ3A 1E2FA 1TM4E 3I1YA 1Z5UA 4PZLA 2IEYA 2FZCA 1Z3EB 1AZTA 5TT0A 4ECSA 4DS5A 2YV2A 3AXSA 2PMZF 5JSFA 1N3YA 4O3QA 4L0MA 4ZAWA 3TB4A 4AXBA 4KLEA 2JCYA 5EWMA 4EAQA 1MB3A 4ZI7A 2NTYC 4KN9S 4HLUA 4AS2A 1Z6YA 2O4CA 3ZHRA 1PZGA 2GCGA 1B0UA 4MA0A 1DFGA 3TPFA 4C7OA 4XRHA 2ZWAA 4MVJE 1BZYA 2VVTA 5DQIA 2ATVA 1E7MA 3BFJA 5JE8A 3JYHA 1CNMA 3LGAA 4I1VA 4EA8A 1XLTC 4HFNA 3GEBA 4J9RA 1CJMA 4GICA 4IG4A 1DBWA 4EW6A 5EJ5A 1LTKA 5F7ZA 5JECA 3A4TA 1NJWA 3T95A 4DRZA 5CEEA 1L7VC 1O0BA 1T8YA 1EHCA 3THVA 3I45A 1MN8A 4EQ6A 1RC0A 3LFUA 2BI7A 3LUFA 2N42A 5AJTA 1T26A 1R27A 4JJKA 1BDJA 1RM3A 3LY8A 2AX4A 3M2TA 3QPAA 2FCRA 4YAJA 5HKKD 3WMGA 2XDQA 4DOMA 2IY8A 1JDJA 2BKVA 2MAXA 5B64A 2PFQA 1NMXA 1CS0B 1W59A 5KFKA 5L3ZA 5KQRA 1K63A 2XCQA 1Q0PA 1OZ0A 4PYRA 4EG1A 3FGZA 1OOEA 1ZMRA 2V4ZA 1P4JA 4LXIA 2JFVA 5K0TA 1K7EB 4DWOA 4B85A 2H2HA 8ICXA 4BFUA 2FA9A 4AJ1A 2FZ5A 4JD5A 2XZOA 1G17A 5CP8A 4YQFA 4G0VA 4U2CA 4ZDIA 1CY2A 4J4TA 1E3QA 1B42A 1KDTA 4TS3A 2PUAA 1WSBA 1S4QA 1VJ0A 2IP4A 1BE1A 3ITDA 3ZLVA 4EI2A 2J9GA 2Z58A 2QDXA 1URJA 1EVLA 2ESRA 3GFBA 4TUYF 4NBWA 1QAQA 1FFHA 1ONOA 5ITZB 4K8OA 1NDUA 4KAAA 4L9SA 3IUYA 1L4MA 3L6UA 4I4IA 4MARA 4QU8A 1UK8A 1P3JA 3MMNA 2OORC 2YXEA 4Q01A 4RHFA 3UMRA 4DSFA 1DARA 1FLNA 1YDGA 2KS6A 3GFOA 4K9NA 3GU3A 3TQHA 3AR5A 1GITA 1R15A 3CF4A 2BPCA 2ZIZA 2PPLA 3T35A 5JVDA 3F5DA 1JIXA 3ZHUA 1LRJA 2EW2A 1AK9A 1MEOA 4PQYA 5T8KC 2V6BA 2IKQA 2P6RA 1NJFA 4C1BA 3B48A 5BQFA 4IHQA 3DVSX 4UD6A 4RV9A 2XNCA 3ZHCA 2GZHA 1W8IA 2GM4A 2JGRA 3P2JA 3IR6A 4IRMA 1SVKA 4JVLA 1U7WA 4TV8F 4DIOA 4FZRA 2PRZA 1CEQA 3ISVA 3KKAA 3CX4A 1YJ8A 1P0FA 1NVDA 1SXJD 5DB9A 2XUHA 3A3OA 2ZI9A 1BGWA 5ILGA 5KUTA 3GLKA 3ORRA 2YRFA 3PSAA 2P6UA 4MIKA 4U7CA 4G4SP 3TW4A 2QP9X 5LXTB 4DDMA 2ZZMA 1O6CA 1HX7A 2ASJA 4Z0PA 4BNLA 1AB6A 5CVCA 3ND8A 2HSEA 1OW5A 2HRBA 1YMQA 1ORRA 3BQ7A 4DIUA 1FTNA 421PA 4IIJA 3PYLA 3QMPA 1MAUA 1RP1A 5KI6A 4I8DA 2VHYA 1WPRA 2FN4A 3EF0A 4I08A 4CI9A 3TE7A 2QTMA 1ZMTA 2EGHA 3ACBA 4X63A 5DGTA 2ZG6A 1SKQA 3X43A 3VYVA 3FKJA 4KI0A 1IXZA 2BBWA 1UP4A 2I3BA 5IEJA 5KTPA 2PUGA 4DCJA 3IQIX 2WU8A 3GT0A 2YV3A 5LR6A 3BWMA 1H8HA 3LNTA 3CLUD 4LY3A 2GPSA 4QTZA 4ZMRA 2XXAB 1S2IA 5E0KB 3ZIDA 1NONA 1PFKA 3BWCA 1XCJA 1WHTB 2PWZA 1UPUA 2XVAA 4NYIR 5DHQA 1Z4KA 3NBQA 1E1RD 2J5KA 2WHEA 3EGWA 1A77A 4RMIA 3ISBA 8ICSA 2FR0A 1DZ3A 3T7AA 3ISCA 1KS9A 1IHUA 3VO8A 2C4MA 1MV8A 4I3GA 4QEDA 1NLMA 3SZUA 1J21A 2HEGA 3OIGA 4XJVA 4Q82A 4AO7A 4F4UA 5LP6A 2AXEA 1UH5A 1J8QA 2CJYA 4D56A 1P19A 2ZUWA 5IUKC 1MA3A 2V54A 4OUDB 2RHJA 3T4UA 2EEZA 2QTLA 2VIXA 1I1HA 3IIKA 2ATCA 1VLQA 5T4BA 4YQZA 3VR5H 4AYWA 4PO9A 4CM5A 1KI2A 4C08A 4X7RA 1Y63A 3MJDA 3R6WA 3AJAA 3N2YA 2RGBA 4R2WA 3KXIA 5KYWA 1X2IA 1M1XB 2VPTA 2B4RO 3DCYA 3UJPA 4X6YA 4EI9A 2F1JA 3FMPB 3OWOA 1O96B 3U0VA 3DLCA 5BN3A 4NBLA 5EUMA 1N7JA 3HRIA 3QP9A 1UIMA 1QPZA 1QIGA 4Y2YA 1K7SN 2Y77A 4M83A 4AZWA 5HR6A 1W5TA 2B8JA 4G41A 4LTNA 4CV2A 1Y4ZA 5KSWB 2CNWD 3A1TA 4HH4A 4TKLA 3IJPA 2R8JA 5LJLA 5AHWA 4YXWD 3BXHA 2J85A 4R9VA 2H1SA 1Z5NA 1HG1A 2F3RA 4N6GA 1QZTA 1GL7A 4RF5A 4UNSA 3LVQE 8ICVA 1JQKA 3UK6A 3WMRA 1TMKA 5JJLA 3ZWDA 4ZTZB 1VKHA 4XD2A 4ABYA 3PZPA 1CE8B 3CR3C 3EBOA 1OA1A 1PV1A 2R7NA 4XM2A 3W0LB 1GUDA 3NXSA 3SZRA 3CY6A 3LKBA 2XVMA 3IHTA 3QE0A 3EZ7A 4WMLA 4CL3A 2C82A 1H3FA 3NEAA 4HYQA 4ZQIA 5FWXA 1DU4A 1GA4A 1GILA 1WW3A 2ZSJA 3IAEA 4J9UE 5AHKA 5AW3A 3ICQB 4QRHA 2HVIA 4G8JA 1YK1A 2ONZA 4O63O 3RS3A 4KBYA 4MUNA 4BNHA 3QEKA 4MJ7A 4AO8A 2IS4A 1BO6A 3AHFA 3FVVA 3RHZA 2XW6A 3HJAA 4ZGGA 4Z7NB 5T7BA 2VNSA 3OCVA 2ZIWA 5I3ZA 3SC2B 3MSCA 2V9CA 4JT2A 2FEXA 1QIJA 2XTMA 1XVLA 5FUBA 1RRFA 1IUOA 1DTWA 3C3JA 1QH8B 2OO3A 1M2OB 5J0YA 2XMZA 3EQ8A 3I42A 3K0CC 1ZINA 3GVPA 4AP9A 3D64A 3FFTA 3FTPA 4EZBA 1G2PA 4PHEA 4ES6A 1X1QA 1YR7A 4AIIA 2JHAA 3WG9A 3QVVA 1Z83A 2H6EA 3GFRA 3DD5A 2EL7A 4LV5B 4PC6A 2GZAA 3GRUA 2PL9A 3UGQA 1NRWA 2EJTA 3QPDA 3TQ1A 4D9MA 6REQB 3U37A 4X7MA 2GVZC 3DAHA 1A3CA 2R6FA 1KKLA 1QX3A 2ZRKA 3AUXA 3ENQA 3IAFA 3IQHX 1IOVA 4OXYA 4Z99A 3ZV5A 4CTNA 3EZLA 2PFPA 3PFWO 4GXRA 5FPHA 3TFQA 3WIDA 5LWQA 5CFQA 3H0MB 3O84A 4TLBA 2G3YA 1Q11A 2Z2YA 1CI4A 1RQ2A 1RFLA 2DM6A 4F3NA 2G71A 4FR0A 3CSDA 4RY8A 3WMEA 4QU9A 2G08A 3MJEA 1E8NA 2ZT8A 1W88A 3GGCA 3ZXSA 1VHDA 4LMBA 2A1IA 2AL7A 4WGFA 4LFBB 1J2NA 2AT1A 4KFUA 5CFNA 4HAYA 3I5XA 1DC8A 3BSFA 4X91A 1XNJA 1R5JA 4ZA2A 2WK1A 5B12A 2DQYA 3MLBA 1XQXA 1Y9EA 4LZPA 2PWYA 4XFJA 3ZQJA 4NP6A 3AFNA 3U4MA 4D8YA 3LBYA 2PH7A 1X7XA 1YSCA 3K2IA 3IAAA 5FL7A 3JSXA 3NBAA 3MWFA 1U31A 3MT0A 2GXQA 4TOIA 4EY8A 4HLNA 1O94D 3R3SA 3IAM6 5KL8B 3CA8A 3DJFA 5GGYA 4RSMA 1R0WA 4WRRA 3DAPA 4B4UA 3EULA 4I2NA 4M0FA 2AHRA 5EQFA 3SVTA 1IUKA 3FNGA 1RBYA 3ZI4A 2MINA 3KOYA 4QFCA 4WKNA 4DUGD 5A2QA 4QUIA 1HMPA 3VAAA 4C2UA 3GNSA 3L4KA 4MCAA 5K99A 1EFKA 4RGYA 3S81A 3WP0A 1MQAA 1TT5B 5ESXA 3W8DA 5C35A 3AEYA 1HEUA 5TDHA 2FZGA 4QBIA 4CQLB 2XKJE 2NP6A 1DC6A 3AONB 3ICXA 4PIMA 3IRUA 3BRCA 5BYJA 2ZYUX 1L4YA 1CS4C 4KVAA 2P0AA 2PEYA 3BXFA 3QEJA 3TVTA 6GPBA 3JQAA 3HBMA 3KXPA 3HPRA 1FMFA 3RS9A 2JH9A 3EY9A 1RRGA 4JUFA 3QIVA 4NYMR 4O33A 5C34B 4I66A 4I5FA 1SBNE 4UNRA 5K3OA 1D8BA 2I33A 1ZK4A 5KG1A 4DIBA 3I2FA 5L3SB 2JAHA 3E5RA 4M46A 4C4YA 4EA9A 3EVTA 1QHEA 3G0GA 1M73E 2RI0A 4HDMB 1UFQA 3WSWA 4R8LA 1QWSA 1P1FA 2JD0A 2Y27A 3FYTA 1N2CE 4XX1A 5IYZB 4MVJH 2HCTA 4WZAE 1M34B 3KUDA 1AZLA 5ALRA 3F71A 4MFAA 1PZFA 3NKFA 4BZWA 1R64A 3F2DA 1E6EA 1E9EA 1ETHA 2UYOA 3GDFA 3LM8A 5DKFA 3TTSA 4BRSA 2E4AA 2BCJQ 2ZSIA 2BFDB 1HSOA 3WYGA 4UAGA 2AGPA 3W8RA 1HLGA 1E96A 2A57A 4JELA 4FGSA 2IA5A 3D3KA 4LVOA 3UC9A 4YMHA 4F2DA 1IG3A 2L42A 4IWXA 2IS6A 1PEDA 2A5YB 2NTNA 3PC8A 4IQ8A 3OTHA 4KLIA 3H5RA 3VMFA 4DJJA 1H6AA 2C31A 4DWWA 4DV5B 1X7YA 3EYZA 5HJ7A 1I7PA 1RHKA 3WO0A 4RQ0A 4HQ6A 1FP4B 1D04A 4PEVA 3LXXA 3ZV4A 5LQUA 2JIOA 1Q3VA 3EG9A 1Q6ZA 4LYAA 2N1MA 4OHOA 2ZTDA 2ATEA 5JOQA 1JFRA 3V48A 2OCLA 2UUAB 5JS1A 2VA2A 5HRCA 5IDQA 5EEGA 2I29A 4CIBA 3V1YA 1KVUA 1PFVA 4IIJB 4US0R 4Q7KA 2NVWA 4QSHA 5IPFA 2VA3A 4GZMA 2FY8A 5LQNA 3B1KA 3O90A 5CDFE 1FJHA 1TCUA 3KE9A 4LJ4A 1DOHA 1J9ZA 4B31A 2YN4A 1YDMA 2IZ5A 2ATLA 2V3WA 4CKCB 4MV3A 3GILA 4Q03A 3E18A 4V3BA 5FAKA 1YHYA 2Y05A 1BKDR 4EW1A 4A0GA 1DQSA 2YHIB 4JYCA 5IP5A 3H42B 4RK5A 2QY6A 3Q15C 2XO7A 2BGRA 4DCSA 4ZC8A 3NQ41 4FK8A 2DZDA 3Q7PA 2R8RA 4R05A 3Q8XB 1KTQA 3IOYA 4WIAA 3THXB 4IJMA 4K1XA 1HXHA 2KSQA 3FNIA 4C3VA 1W5EA 2C1XA 2NM0A 3MQFA 1U9JA 2AYYA 4RLSA 2CBGA 2WT9A 3SYMA 3ESQA 3OQIB 3FOBA 2H1RA 4QYXA 2R6HA 2X4GA 4JLBA 4M0PA 4PZNA 4FGZA 1ZMXA 3H2YA 4CM7A 1P1IA 4OHZA 3GMIA 5KU1A 3K9NA 4JLUA 3RB3A 2CFTA 3K92A 3OZBA 3PIIA 5IAKA 4IIJF 4KXQA 2JR5A 4JB3A 5G5GA 2RSLA 5IAAA 2OILA 2V58A 1P81A 4XDZA 3W8NA 5U1PA 1AVTA 3AX6A 1GPLA 4HLCA 2XX3A 4OV6B 1MA7A 2CE2X 4HBZA 2ZWMA 5CLHA 3ROGA 2KJ5A 5TEVA 4F9GA 4HSGA 3NJ8A 1Y3HA 3B1JA 3H1GA 5DHAA 4MWZA 4NJ8A 4HDNB 4Q7EA 2K60A 2QZZA 1R5OA 4GM4A 2NVBA 1Y8CA 2J08A 4RKRA 3T54A 4RQTA 1YRYE 8ICZA 4LZAA 5C4MA 4RL6A 1GJRA 2BM9A 2CMDA 2ZBUA 1RAIA 2PUWA 4IIHA 1WZUA 3UKOA 4BX9A 2GCOA 3ICVA 1ZC4A 4D3ZA 3HB0A 7REQA 4LNAA 2IYYA 3GCDA 3LPCA 1L5KA 2GXSA 1DCKA 1HDXA 2IVFA 1YR2A 3H19A 2FOLA 1SEPA 4HGQA 4HMQA 4J0EA 5UKDA 5AUQA 3UAVA 5IZCC 4X61A 5AOCA 5TPZD 4RGQA 4C4AA 2NAPA 4O3NA 1JIJA 3HXOA 1Q1EA 1Q7CA 1Y8RA 2OQRA 4PPYA 5LMUB 2FQQA 2TYSB 4R51A 2VPWA 1V7QA 4RVSA 2GD2A 2GJSA 3MR6A 4TS4A 4GH5A 4S04A 1YQTA 3BJZA 5T57A 5BSRA 3WK6A 3OZTA 1W4RA 1Z8DA 3LT4A 2EAPA 2LDXA 3F6CA 3I2IA 4DC1A 2DOKA 3NHFA 1GAQA 2OHXA 3W4IA 4ZHQF 4NEGA 4B6JA 2C5LA 5HKKA 3GP8A 3F78A 4EPYA 3OTGA 3P0RA 1AHIA 1SK9A 1QQTA 3C4QA 1ZD4A 2W71A 3GYGA 4HEJA 4JQOA 4O4LF 3NASA 4DA9A 4B3MB 2HHAA 1EXNA 2LPMA 5L9XA 4WNAA 3LXMA 4EHLA 1F48A 1NA5A 2XITA 3HL4A 4FPXA 3OC6A 1KO8A 5HNKA 4DEYA 3HP6A 1R3DA 4D0LB 1DGQA 1I4LD 1R0XA 1YE8A 4IQFA 2FUG6 3V4RA 5BNWA 5JZVA 1N1DA 2KFZA 2BZSA 8OHMA 5AVSA 4OLBA 3OE7A 2MOKA 4LZWA 2WICA 1ZGGA 4PLGA 1KYIA 4H6WA 1EFPA 5EYPA 4ZD6A 2BELA 1WBDA 4HF7A 4BEBA 4CEIA 2M2IA 3WRWA 5KT6A 3TD9A 1YOVB 3UZUA 2O8VA 1SZJG 2XAUA 1JIHA 1LSOA 3UMFA 3A6JA 1Z5PA 2QBYA 5J2UF 3O93A 3UK0A 4K9MA 3SZGA 5BNFA 3SAHA 1GRCA 1U6KA 1WU7A 3AF0A 1MLDA 4HDNA 1JJIA 4DDTA 4Z7JA 2XGJA 4BBZA 4H08A 5JSZB 3LPNA 2RRDA 5FD8A 4ZHQB 1OTXA 3D6MA 4GFJA 1KEEB 2R3SA 3FBWA 3GRFA 4RMHA 2ZJ8A 2JJ1A 1NRIA 1C14A 3K0BA 3EOAI 2QD3A 2VUTA 3R2JA 1YA8A 4CM6A 5K7SA 1N32B 1D0IA 1OXXK 1UEIA 4TXJA 4XI9A 3V7NA 3SZOA 1JDTA 4OATA 3L8ZA 1CSEE 2BSAA 5AYVA 5M7EA 3OY2A 4YJDA 4JVMA 4XE5A 3RC8A 1PZNA 5IBQA 4L8WB 4LZNA 1QGDA 1YB5A 3TLEA 3NRCA 2LD4A 3DKIA 1AY0A 3JRNA 3NOOA 4FD2A 1P6XA 3JQ7B 4PPQA 4U7GA 1G6KA 2GBPA 1UFRA 5KTNA 1W5AA 2G0TA 5BSFA 5LLDA 2CBXA 4MYUA 4OK6A 4MS3B 1BXGB 3DHWC 3DV0A 4J7AA 1UBHS 3O8CA 4WZAA 5J58A 4O2RA 2PKQO 1IN4A 4YMMA 1FXWF 2R62A 4PC2A 4QGAA 3M9OB 2QLLA 4YQWA 3GJ6A 3JRXA 3EMVA 2UKDA 3N2EA 2A1TR 2AOTA 2H57A 4UMVA 5AJWA 3WWEA 2ZTEA 3K0FB 4INPA 5CB0A 1W6RA 1Q15A 3L1KA 3SJCA 4DREA 1I4DD 5E6RB 3ZTYA 4YUWA 5K3FB 4MZXA 5FTKA 4I2BA 1Y1QA 4W8GA 2H5XA 3DNFA 3DEKA 3O9ZA 1Q0ZA 3QHAA 3HA3A 2UZ1A 4RDIA 2PEZA 3ZVMA 3HJRA 4BU1A 1Q8KA 3SAGA 2PSEA 4J9VA 2BTQA 2EFGA 1ZIYA 1PX0A 4Z51A 3U9TA 2ECPA 2PL3A 3H2ZA 3ZXUB 4RFLA 3M70A 4BMYA 3PFNA 2H3ZA 2G1AA 4WXYB 5TLSA 1G3MA 2EANA 2GTIA 1OZFA 3AL3A 2AF3C 5K2MA 3TR5A 4CN9A 4D81A 3RBEA 1NVEA 2VT7A 4MW7A 3V1UA 3GRRA 3NC0C 3WGYA 4YX9A 5L3SA 1MB4A 1YOBA 1K5DA 4X64B 2ZYVX 1AK2A 3GEDA 2CL5A 4GG1A 1GT6A 4MRPA 4QEKA 2RHRA 5LZ8A 2NO1A 4IZIA 3UWMA 3VSEA 3WGIA 5LQRA 1E1KA 4ZICA 1BNPA 1OILA 1PF7E 2E0IA 2O07A 1AMUA 3ZCSA 3HXQA 2H85A 2HTEA 1NQ5A 2ZB2A 3MJTA 2HO4A 1KXZA 2IV3A 5KTRA 5LQKA 3DEZA 1JHVA 5CFLA 1B00A 1I1NA 2HX1A 4ENTA 2H2IA 5GY7A 4ECRA 1DRJA 1P18A 4GR5A 2R7LA 4DNXA 2HSDA 4MXDA 3HVJA 1FYVA 5EXDA 3PZBA 5KOJA 2ZSBA 3QFRA 2VK4A 5EP2A 1OFIA 1G66A 5D00A 4G3IA 1ZI6A 3QOXA 4ND1A 4F7WA 4HDQB 5LYJB 3HC7A 4YVFA 4JL5A 1HFWA 1A9YA 3U5ZB 1P61B 3DHVA 2O2XA 2DX7A 8ICFA 5HFAA 3K8ZA 2DWPA 4IUYA 3RARA 3TS1A 5F1KA 3H4BA 4CCWA 5IASA 1SL2A 5BOLA 1UJBA 4IM7A 4P0PA 4IRUB 4BB0A 3SC4A 3LUKA 1OX6A 3HR8A 2R1ZA 3NKLA 2W83A 3BXXA 2W7PA 4KACA 1QZZA 1UJ2A 1LQTA 1OFUX 4REQB 2Y1EA 4WFJA 4DRYA 5LP1A 3DO6A 2ZIGA 3FCUB 3Q4GA 3Q5GA 4YDQA 1WUYA 3MINA 4CG3A 2QK4A 5KWSA 1S9FA 1KFKB 1SUAA 2B8NA 4WV3A 1YHNA 4YV0A 2C2GA 2R5FA 2XEXA 3N9IA 1ISPA 1P1KA 1YJBA 2O0HA 3DTVB 3G8YA 4BB6A 1T8PA 3UB3A 3CSUA 2BBSA 3IE0A 2PRJA 2JLCA 2LIVA 3N6RA 3ZKAA 2NV0A 3ZU5A 3IUMA 3SYRA 4CNQA 3PF9A 3HYSA 4JX8A 3JZDA 4PXYA 2YTUA 1ISMA 1WMEA 2IPAB 3K9QO 2F00A 2IP1A 3CKLA 2BGIA 1J0CA 3SC3A 1RAEA 4IX1A 4IIBA 5JSHA 1UADA 2WLTA 2Z5FA 1L7NA 3SHOA 1WMDA 5A3RA 1LB1B 4BLOA 1VB3A 2P4HX 3IUPA 5EQDA 2QV0A 4UUMA 1Q57A 1S9DA 4X1YB 3S5JA 2UZ3A 2W8BB 3F5FA 4G36A 4JLNA 2Y1IA 3F7TA 2X19A 4XA8A 3UUEA 5AVWA 4RVOA 4L0QA 3AM4A 1GG8A 5KPJA 5CBPA 5AJHA 4P38A 5DI3B 5IEBA 3UW1A 2VHTA 1PNVA 5IJ9A 2VDPB 1VL5A 2DQZA 3DE7X 4B7AA 4R65A 4N5IX 5GTDA 1O95C 1LQ2A 1UBKS 1YZ3A 9ICOA 2MYTA 3F5SA 5ICCA 5DU2A 3A27A 3ZHXA 1F4PA 1M8GA 3FPFA 5EJMA 4ZT3A 5K0LA 1CZHA 5EOZA 3A1WA 4QOFA 1ZQMA 2YWRA 1E7SA 5M5BA 3ROPA 1BYUA 2QW0X 2WILA 4TGLA 3UNXA 1V4BA 3X3HA 1WU8A