1V38A

Solution structure of the sterile alpha motif (sam) domain of mouse samsn1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
GSSGSSGRRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-domain protein SAMSN-1
publication title Solution structure of the Sterile Alpha Motif (SAM) domain of mouse SAMSN1
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1v38A00
1PK3A 2B6GA 2FE9A 5L1MA 1KW4A 2EAPA 2KG5A 1RG6A 2F3NA 1SV4A 1PK1A 2F8KA 2E8PA 3BS7A 2DKZA 2DL0A 2QB0B 5F3XB 5JU5A 2DKXA 2D3DA 2JV3A 3KKAC 3SENA 4NL9C 1X66A 1SV0C 1SXEA 1V38A 3KKAA 4RQNA 2EAOA 4NL9A 2KMDA 1SV0A 2EANA 1X40A 1OW5A 3SEIA 2KE7A 1B0XA 2QB0A 2LMRA 5JRTA 1F0MA 2ES6A 1SXDA 2LPEA 4RQMA 1LKYA 3BS5A 1Z1VA 2QARB 2GLEA 2E8MA 2KSOB 1JI7A 2K60A 2QARA 2QB1A 2KSOA 1SGGA 1WWUA 4MHVA 2ESEA 5KNIA 2YTUA 2Y9UA 3HILA 4PZOA 3TADC 2E8OA 1V85A 5JTIA 2E8NA 1OXJA 2Y9TA 3TADA 1UCVA 2QKQA 1WWVA 2KIVA 3BQ7A 1COKA 1B4FA 1X9XA 4PZNA 3TACB 3K1RB 2L5YA 2F44A 4NJ8A 1UQVA 1DXSA 3H8MA 4IS7A 2EAMA 5J8YC 1PK1B 3IDWA 1LKYB 2D8CA 3BS5B 5J8YA 2K4PA
chains in the Genus database with same CATH superfamily
2WF5A 8ICNA 3SR6A 1N63A 2B6GA 3FC4A 7ICRA 1ZQDA 2AU0A 3GIIA 3Q8QB 3T5HA 1CI4A 2W8LA 4P4MA 3L3FX 1TAUA 5TISU 8ICQA 4KLTA 2GOLA 1X66A 3F2CA 8ICKA 4US8A 3SAFA 5B66U 4XA5A 2VKQA 1B0XA 1CEZA 3QXGA 1JXLA 4O5EA 1Q46A 3H4DA 2PXIA 2UVUA 3VCBA 2KFZA 2G5HB 3PO5A 3Q8LA 2OYYA 3I28A 3UXOA 5ALGA 4R63A 2D6FC 4USAA 5KFHA 4P4PA 9ICPA 2AH5A 3I1YA 2JXJA 2H3QA 5AK5A 4UAZA 2KHQA 5J2GA 2YMPA 3RH6A 2I9GA 4CRXA 4O3SA 5L1LA 3G6YA 7ICGA 1WWUA 2MRLA 5AKKA 1S9FA 3HKZF 2CN1A 5KNIA 3V6JA 4F2SA 4DQQA 1Z00B 4R8UA 2FPMA 2KNJA 4KLJA 1KFSA 5J0WA 4RQ8A 4UBCA 3PX6A 2QKQA 3M9NB 5ALJA 4C8MA 2BHNA 5AM4A 4TUPA 2W43A 2P6RA 4J9OA 5EWFA 1RXVA 5CWRA 1JMSA 3LYSA 3CRXA 2F44A 4EYIB 2ATLA 3PO4A 5KG1A 3KTQA 4RT3A 5KFTA 4YMOA 1KW4A 5AI0A 5GTHU 3N97B 5EWGA 4RQ1A 3BS7A 1X6IA 3F2BA 4YR2A 4FBUA 4XRHA 3F53A 1TKDA 1A0PA 4KLFA 1ZQNA 4KMOB 4ECSA 1ZQGA 4UB8U 3HP6A 5HP4A 3GV5B 3BQ2A 5BPCA 5DBBA 3ISBA 4I2CA 1IM4A 4FS2A 1T8EA 4RQ2A 3QU4A 1XSLA 1HIWA 4ELUA 2LPEA 1NOMA 8ICTA 2K8BB 2RQ5A 4RQ5A 2PMZC 7ICOA 1UA1A 1ZQLA 4C8LA 4DOBA 4GXJA 3CP8A 2GO7A 5FP0A 2IBKA 5DDYA 4C4SA 4GC6A 2HI0A 4F5RA 3KZXA 4QZDA 3B0YA 4C8NA 2WHEA 4DF8A 2AQ0A 3SAHA 3OSPA 2XCAA 5ALSA 2QARA 4KITB 2HOQA 4DL4A 5DLFA 4KLEA 3QU2A 4YN4A 1VJ5A 4FS1A 4X5VA 1ZQPA 4TQRA 1FO4A 2FLPA 4A8EA 8ICCA 4RPXA 1J97A 2BR0A 3TADA 3QEAZ 2KIVA 1XU4A 1SKWA 2ZXHA 5J2AA 2H3FA 4IQWA 2FPKA 2L5YA 4C80A 2G07A 4ECVA 1ZRNA 2Q0ZX 5KAIU 5J0OA 4Q45A 3RRGA 2EAMA 2JHDA 1PK1B 2WF7A 1T94A 2J6TA 4YMNA 3SI8A 2LYBA 5C5JA 2DWQA 4M6WB 3RJFA 1QSSA 4RQ0A 3OSNA 4UB2A 3UPQA 7ICNA 3NRWA 1WG8A 4QZBA 2DKZA 5F3XB 5JU5A 2ZIWA 1SL1A 1WUDA 3SV4A 1SIJA 1L8LA 3QU9A 5GTIU 2DPJA 1M6YA 4K4HA 3N7RC 4DEZA 3JPRA 3HJEA 5KFIA 2PFOA 1U49A 2BCRA 4DL6A 4Z6EA 1RQNA 2NRWA 2P35A 5IIIA 2XY7A 3D2QA 4NLZA 4TUQA 4ECXA 8ICPA 3V6KA 2KN7A 1U48A 2HBJA 3H0MB 1KDHA 4J9QA 4M9HA 1V97A 4B9NA 4M9GA 1N2XA 1ZQYA 4DQPA 1B43A 3AEVA 4UB4A 1T4GA 3EYZA 1DK2A 5HHIA 3JPSA 3Q8MA 2I5HA 4KLQA 4KTQA 1SGGA 1BGXT 1IG6A 1Y88A 4ECRA 1PUZA 3MR5A 5KFRA 4I2JA 3BQ0A 7ICVA 1BPZA 2ASDA 5J2BA 3KHLA 1URJA 2ZIUA 2VJ5A 1ZQAA 5T14A 4TQSA 1BPDA 2KIWA 2DUYA 2QLTA 5IIMA 4F4XA 5J2EA 3LVWA 3QUBA 5TZVA 3BZKA 5KFGA 2ZJAA 3K1RB 2HSZA 3H8MA 3SZ2A 4C0ZA 1FIQA 1NNLA 2IOFA 5AKXA 4FZMA 3KHHA 2W54A 3C5GA 3K1ZA 5ALRA 4UAYA 1F44A 1PK3A 3TFRA 5AIAA 1KTQA 3KHRA 5AIBA 2RDJA 3OTQA 2MAXA 1NKEA 4MEXA 3WKCA 4RNMA 5EE9A 3HW8A 4J9NA 4KLLA 4QZHA 5F9NA 3KKAC 1V9PA 2XIDA 4NLKA 1NZPA 1NKCA 8ICAA 2BPGA 4DFDA 4O3QA 1X40A 3SEIA 5HR7A 2BCUA 3OJSA 2DFLA 5J0XA 2BDUA 4DO9A 7ICIA 1N5XA 2FDRA 2F8LA 1ZQQA 1DRGA 5D49A 2Y0SF 4DLGA 3AM9A 3N4MB 2JRZA 5ALPA 4NY8A 1TAMA 3PNCA 4B9SA 2NRZA 4QZEA 3T5JA 2GWSA 2IOHA 1K1SA 4RUCA 2W9CB 3T5KA 3PV8A 2IHNA 4GFJA 4UATA 3WK9A 1ZQVA 2XY5A 7ICPA 1A6SA 7ICHA 4I2FA 4PZOA 3AQEA 4C4TA 4Y2XA 1A76A 4UW9A 4DWIA 3G6VA 3PZPA 4NV0A 4RQ4A 4YXJA 2K8AA 2JR5A 4RQ3A 3GQCA 3DEEA 2WF8A 4Y2UA 5KG5A 2O6KA 4MF8A 1EXNA 4HAIA 5DGAA 1NK5A 4U7CA 4XQ8A 4PL1A 2JZBB 3WK6A 2BCQA 4OJ6A 2G08A 2KG5A 2Q4TA 4CF5A 5KFUA 3CYMA 2R8HA 5KT6A 4DS4A 4C7ZA 3AQFA 2BQ3A 1ZQXA 4YMMA 1N60A 5AK4A 1U45A 3GIJA 8ICJA 1SV0C 3TI0A 4KLGA 5J0RA 3M9MB 1D8YA 3PY8A 3UMCA 4QWBA 4EX6A 5CB1A 2YB4A 5AKEA 2G0AA 3F2DA 3G6XA 5ALWA 4IRCA 4Q8FA 2KV2A 2ISOA 2F77X 3H0RB 4CE6A 3D6JA 1ZQEA 4C4RA 1ZQFA 3M7DA 3ONNA 1BVSA 4AP9A 2J6UA 3PSIA 1XO1A 3BS5A 4QIWF 4O9MA 1H38A 4F4WA 3MDAA 5J2CA 1IIPA 1U4BA 3RTVA 3QNMA 2ZJ5A 4AYBF 5KL8B 2XY6A 4M2YA 3QEBZ 4ED8A 2FI1A 4B6JA 2KJ8A 2F1IA 4Y2TA 4Y2PA 4KMUA 3VC8A 4MFCA 4MHVA 2ZIVB 1ZQUA 1SB3C 1S0VA 2Y9UA 5KFWA 2F76X 2W3SA 1NJYA 2HHVA 2E8OA 3B9JA 1FFUA 4I29A 5ALFA 5DKWA 4OD0A 4DL5A 9ICEA 1ZQOA 7ICTA 7ICEA 5D4BA 1MA7A 2IHMA 4JV0A 3ETRA 3PX4A 3PSTA 1B4FA 5AM2A 3ZI4A 1ZETA 2W03A 2PI5A 3ISCA 3OPXA 1N5WA 9ICMA 4KLIA 1T3NA 4OO1J 2OXOA 4F92B 4FE3A 2FE9A 3OJUA 4DL7A 3EPGA 4MFFA 3BDPA 2FJ6A 9ICKA 4YR0A 5ALDA 5KFSA 2F2AB 2H3IA 1SWVA 2W9MA 1JX4A 5AI6A 4RZRA 2KFNA 2R18A 3IV6A 4J9KA 4P0PA 3D2SA 1V38A 3KKAA 5CEHA 3UMGA 4KLDA 2W55A 3EW9A 2PFQA 2KE7A 2KHVA 2A1AA 2NRTA 9ICRA 3A0BU 3N7PD 4PHAA 1BPYA 4O3PA 2VIXA 1KEJA 3HWTA 1KSPA 4DQRA 2RRDA 4AYBC 5IIKA 3AMZA 3GILA 1S10A 4UB1A 4O3RA 2DF4B 2MA1A 5BOMA 4UQGA 2PI4A 1ZD2P 2AJQA 3GFKB 2ZTDA 4UB5A 1ZXIA 1IV8A 3IG8A 1QQ6A 5KT5A 2C22A 5HR6A 3RR7A 1ZOLA 4C7YA 7ICFA 4BWJA 2FLNA 4GXIA 2OH2A 4ZOHC 1UT5A 1Z1BA 5AKYA 5J0YA 4DSIA 4DL3A 4JWMA 5DLGA 2ZTCA 2BKEA 1DGSA 8ICXA 1S77D 2XGQA 4Y2RA 3IG5A 3H8WA 1ZQRA 3RJHA 1L7NA 4EX7A 2HOIA 9ICVA 5CA7A 3E58A 1X9XA 4NJ8A 3Q8KA 1S97A 3IDWA 2E5SA 4CDGA 5AI4A 1S0MA 3QX7A 2JEJA 5KFBA 1NK6A 2NRXA 4KLMA 1PK1A 1L3SA 4UB6U 2EDUA 3C2KA 2BQRA 4O3MA 1N56A 3NVWA 2K89A 3NVVA 2HDOA 2D3DA 2K8CB 3C2MA 4P0QB 3ZDCA 4DCCA 2KKVA 4M6WA 4FBTA 3PW2A 2W8KA 1RDFA 3AL0B 1SL2A 1SV0A 2EANA 3OHAA 2OHFA 1Z4OA 2KJ5A 2WF9A 2BZFA 1TK8A 1ZJMA 1TVAA 4RQMA 1LKYA 3ETLA 4JV1A 2HBLA 1PVRA 4KN7A 3O0FA 1ZD5A 2E8MA 3TKAA 1QTMA 2LM4A 1RPLA 2W11A 4CNQA 3RF9A 3WU2U 3WKBA 8ICZA 4NWIA 4KLSA 2AXTU 5ALTA 1NK9A 2OWOA 5AKHA 5DBAA 1J2NA 8ICVA 2R8JA 3EUB2 2W7OA 9ICNA 4KLUA 5IILA 1JALA 2W7PA 5DG8A 2P6UA 1X9WA 4ZH4A 1IXRA 3ZD8A 4UAUA 3JPNA 5IINA 1JUDA 3CW2C 2VA2A 1UA0A 3NGDA 2PFNA 3HKZC 4LVSA 3K75D 4Q43A 2VA8A 2W3RA 9ICCA 3TACB 3ALRA 2G06A 1UQVA 1WCNA 4EZ9A 5KG0A 2JH7A 4F72A 2E1FA 3BZCA 3RJEA 2LBOA 2WB1F 2EZYA 4GC7A 3PW5A 5DQHA 1KBUA 2ASJA 1Z4NA 3F5EA 2F8KA 1ZQTA 9ICWA 2YMLA 4QZGA 1ZYQA 2DL0A 5J0UA 3RBDA 4EBCA 3RB6A 3SYZA 4NL9C 5J2HA 1NK7A 4DLEA 2KK0A 3FM9A 5J2FA 5ALIA 5KFOA 5ALYA 5J0TA 1U47A 3FAHA 2ODGA 1X9SA 3NVZA 4O0IA 4OJPA 4I28A 1S0OA 4BJQA 4DS5A 2HHSA 1UPHA 2KSOB 3TAPA 2MUTB 1QCKA 5G5GA 3M6KA 1Z3EB 2IMWP 2A19A 4I2HA 5HMMA 4DOAA 4CF4A 1FEZA 5ALEA 2XGPA 5KFXA 4PGXA 2KZMA 3MGIA 1NJZA 7ICUA 9ICLA 1ZQSA 1A77A 5DB6A 1PVPA 3MFHA 2G09A 4M9NA 3HX0A 1WWVA 2LM1A 2BDPA 3ICXA 3Q8PB 5L1KA 1ZQIA 3M1YA 3MFIA 4R64A 4YXMA 4YR3A 4DF4A 2IOFK 8ICWA 5DB7A 2Z7JA 4PL2A 4JUZA 4QWCA 4I2GA 4F2RA 2D8CA 2C2RA 1CUKA 1QQ5A 4IC9A 5KT2A 3E0FA 3C23A 5HHHA 4B9MA 2KVCA 3NASA 1S0NA 4M04A 2K4EA 4FFDA 4XUSA 1RM6C 5J29A 2C2EA 5KT7A 2JMGA 2QB0B 4NLCA 2DKXA 5AM3A 2JV3A 5CHGA 4YFKA 5D46A 3LDAA 2ZUDA 2JGAA 5B5EU 3MR3A 4EZ6A 1ZQWA 2ZXIA 2HBMA 4BXOB 4EBEA 2R8GA 2ZIXB 4O3OA 3QE9Y 2A3VA 2FLLA 1Q8KA 2KVSA 2P66A 1Z1VA 3FYHA 3KZIU 1AROP 2M9NA 3MC1A 2I1QA 4UB3A 2KKPA 1XS9D 2JEFA 2ZJ8A 4US9A 4YVZA 3TARA 2R8IA 4ECZA 1T7PA 2OCEA 3MGVA 5E79U 4PPXA 3NTUA 3LWLA 2ZIWB 4UAVA 3V6HA 3KBBA 2ZUCA 7ICJA 1COKA 4IQUA 7ICSA 2LKYA 1NK8A 3GV8B 5ALZA 4TURA 1JROA 2AHOB 2IA6A 3RJKA 4NM1A 4Y2QA 1NK0A 2HCFA 2K4PA 1O08A 5KFKA 2NO4A 3C1ZA 4MF2A 1NK4A 5KG2A 1RG6A 1PVQA 3RB0A 3WKAA 5DGBA 5KG3A 1DGJA 2KZ3A 3ZD9A 4QNLA 4B9VA 3MBYA 3WK8A 4QWAA 3BQTA 2NYVA 1WYGA 3ISDA 1S8OA 4NL9A 5KFVA 4DSEA 1YZ6A 3PMLA 5J2JA 5J0QA 1QLNA 1TK5A 2ZIUB 5KFZA 2ISPA 5A0LA 4QZIA 5DG9A 4RPZA 1JXEA 3WKDA 4TUSA 4F5QA 2AQ4A 1ZQCA 4F71A 1CRXA 2GLEA 2HHTA 1JI7A 1QSLA 4RPYA 4ED0A 3HT3A 4JK1A 1VDVA 2Y0SC 3C29A 4IR9A 1X6JA 3LK9A 2HMXA 5KFMA 5DBCA 2RP5A 1D9DA 2PFPA 3RJGA 1SZHA 1X42A 5AHXA 2ESEA 5ALNA 1ZD3A 1LVHA 2BPCA 4O3NA 2MSNA 4O5CA 3V72A 3H4BA 4ED1A 3UXPA 4K4GA 2E1EA 2W9BB 3QU5A 3GIMA 4DFMA 3RH4A 3M9OB 2CPRA 5HMLA 5H2FU 4YP3A 3BQ7A 4I2BA 3IM1A 4EEYA 1SKRA 2W04A 3RAQA 4QZAA 2Y1IA 4EBDA 1BPEA 4J9LA 4EEKA 5J8YC 5DQGA 3EZ5A 5AKJA 3PX0A 2UVWA 1ED1A 4M9JA 2KICA 5AK6A 5C0YA 4ED7A 1Z00A 3M8RA 5KTQA 3GZFA 3WK7A 2FMQA 3PSFA 4EELA 3MR6A 3QUTA 5KG7A 2WAQF 3SENA 4ED2A 4E0DA 3R9KA 4MEYA 1TV9A 1WCLA 2KMDA 2LYAA 3J81j 2Y1JA 3UM9A 4WJ3B 5AI8A 2G5IB 4J9RA 3RJJA 4F3OA 1YT3A 4P0QA 4F5NA 1D8BA 1ZRMA 2UVVA 4RNNA 4PGYA 4DSKA 9ICJA 4G9BA 4DL2A 5ALHA 5KFFA 2YB1A 4M9LA 4DFPA 2FMSA 5AKGA 3MR2A 8ICSA 4QIWC 4J03A 2QB1A 2DBYA 5AI5A 5IIOA 3QUQA 3GU3A 4RQ7A 3I76A 3BQ1A 7ICKA 2YQEA 5J2DA 1Q3UA 1MC8A 1B22A 5JTIA 4Y2VA 2DPIA 4YG2A 4B9UA 2KD1A 2A1JB 4LJXA 3NVYA 5J2IA 3PW7A 5L1JA 3JPPA 1ZQKA 2V4RA 2WFAA 1BPBA 2WF6A 4B9LA 4NM2A 3BS5B 4HYKA 3DV9A 4OJLA 1MN8A 4UAWA 8ICGA 2EAPA 3A0HU 2WAQC 5AM1A 2BCSA 3WK4A 4I2AA 2E8PA 5ALKA 1RYRA 4BWMA 4Z6FA 4F50A 2ZTEA 3RBEA 5EE0A 2EZZA 4FZLA 1NZBA 1SXEA 4P4OA 5CP2A 3MDCA 4JB3A 2PMZF 1KFTA 5CR0A 2FPLA 3PR4A 5EE1A 3RJIA 1ZD4A 3TFSA 1XSPA 4QWDA 1TK0A 5AK3A 1SL0A 2V4QA 2UVRA 1TE2A 3JPQA 1MSWD 1SKSA 1RXWA 1HJPA 1KN5A 3D2NA 4RT2A 1N62A 8ICEA 8ICMA 2K60A 3C5FA 1C7YA 1Q3VA 3U26A 1YZ7A 1NKBA 4QJFB 2KSOA 1NJWA 3C28A 2MUTA 1FFVA 1XO0A 3T79A 3L4PA 9ICUA 4CF3A 3QUCA 2E8NA 4I2DA 8ICYA 3BJYA 9ICAA 2V9WA 1QSYA 4BGDA 2AGOA 4P0PB 4NLBA 5AKIA 1X2IA 3WKEA 5KFAA 2PKEA 2AGPA 3T3FA 1U9LA 3KD3A 4IS7A 2HBKA 4P2HA 4G3IA 2F1HA 4NLGA 2KEYA 2ZUBA 1KL9A 3UMBA 4DQSA 1D9FA 5ALUA 3ZDAA 5J8YA 5AICA 4OJ5A 2VJ4A 1BPXA 3F5AA 4F4KA 2W9AA 1SV4A 2JH1A 4QWEA 1OUQA 4YQWA 3SD7A 1DK3A 1KQQA 2YMQA 5ALLA 2HVIA 1ZJNA 1ZQBA 2EAOA 3S6JA 4F93B 2ZG6A 3M8SA 2KZZA 3IP4B 1RYSA 3QYPA 3GV7B 4ECYA 4ELVA 2YMMA 2QB0A 2LMRA 3RB4A 5JRTA 3QZ8A 1ZQMA 2RLTA 2CXYA 4IL6U 7ICMA 4RU9A 4BXOA 3WK5A 4DOCA 5ALXA 2HHUA 3K4GA 3RH5A 2ZIXA 4U6PA 1K1QA 4GXKA 8ICBA 3MGHA 2BCVA 2NO5A 3RFAA 4R8UB 4YCXA 1N48A 2H5XA 4CGZA 4R66A 4ED3A 5KFCA 4DSLA 4PGQA 2HHXA 1L3VA 2HOFA 1MQ2A 1VLBA 2NRVA 2HW3A 5J0SA 5DB9A 4ED6A 2YTUA 1SZPA 8ICUA 1K5OA 1S5LU 4RNOA 4KN4A 1KKXA 1V85A 4Z6DA 1DOQA 3SV3A 3C21A 2DQNB 4PZNA 4RQ6A 1L6NA 4KLOA 3THVA 1XNSA 1DXSA 1L7OA 2W9CA 4M0AA 4GIBA 3QZ7A 5HNKA 3TQ1A 1LKYB 2KOBA 3ZDDA 5F9LA 3H8SA 4YD2A 3Q8SB 5J0PA 4F5OA 1RZTA 2VA3A 7ICQA 3IN5A 4I2IA 3UQ2A 5ALMA 3ORYA 3M6ZA 4OJOA 4PH5A 1MQ3A 4F8RA 3V7LA 5KG6A 9ICGA 2DGZA 2I6XA 4I27A 2C2DA 2WB1C 3H40A 4JWNA 1XWLA 9ICXA 5CRXA 5KFNA 2CRXA 4Q8EA 1PZNA 3L5KA 3TANA 4OCZA 5G5HA 4J9SA 3AU2A 4B9TA 1O03A 4Y2YA 3LVVA 2AGQA 1X9MA 2MU2A 1AQ6A 2ES6A 3H0LB 3NRZA 2OEHA 1UHUA 3PW0A 3FDSA 1HUOA 2H3ZA 3JPTA 3RAXA 2JZBA 1NI3A 2QARB 3T5LA 2OM6A 5AI9A 1BNOA 2YN4A 4IRKA 1SWWA 4ACOA 4PHDA 7ICLA 1JN3A 4Q44A 4IRDA 1D8LA 2JEGA 4K4IA 5EOZA 3RRHA 2KJ9A 3PR5B 1JIHA 8ICRA 9ICOA 3PMNA 2Y9TA 4JV2A 3NS1A 1ZQJA 4M47A 1UCVA 3RR8A 3AUOA 4GLXA 2LHTA 2ALZA 2LYHA 3AU6A 4QW8A 8ICHA 3HPOA 1QH9A 2FMPA 2W9BA 5AM5A 5L9XA 1COOA 3N28A 5DB8A 4DSJA 5KAFU 1KLNA 2LI6A 3PSPA 5KL1B 1F5SA 8ICIA 1J2MA 4O5KA 4DQIA 5ALQA 2JEIA 5KFYA 8ICFA 3DDHA 5KT4A 3B0XA 4F91B 2HVHA 2ZIVA 1L3UA 3NUQA 3ZDEA 5KFQA 2XO7A 2N1RA 4NXZA 2C28A 2YX8A 3SAGA 5KT3A 5KFEA 4EYHB 2E3TA 5DDMA 4DFKA 1S76D 1OW5A 3IHQB 2BQUA 5KG4A 4J9PA 3ZDBA 4Y2SA 2M0NA 3KHGA 3GDXA 1LV5A 4QZCA 2RHFA 2EQYA 1GO3F 3UXNA 3H7IA 4IQTA 4BX9C 4IR1A 4MFAA 3HRDD 4IQVA 4DFJA 2KTQA 3TAQA 1HEKA 4PJ0U 3GIKA 4YD1A 8ICOA 3V7JA 1N61A 2VANA 4LZGA 1HUZA 3PW4A 3CNHA 4PHPA 9ICSA 2GH1A 2B0CA 2XCPA 2XI9A 2R8KA 4C8OA 3AN1A 4ELTA 4J9MA 4ECUA 1BNPA 2K4HA 1RQLA 3SMVA 9ICIA 2NV3A 5K4LA 2ASLA 4Y2JA 1L7MA 4QW9A 2XC9A 4KLHA 5IIJA 4BDPA 4I2EA 4JMUA 1LB2B 1NJXA 4F5PA 5AM0A 2A1JA 4LZDA 4BUGA 1XSNA 3N7SC 5AKLA 5L1MA 4EENA 3V7KA 9ICQA 5DQIA 2F3NA 5KFPA 3KFUF 5BOLA 4R65A 2F1JA 2B21A 4ECWA 3H8JA 1L5UA 2KP7A 2RDIA 2EH9A 4FZNA 4RQNA 2HHQA 1ZQHA 4UARA 2XICA 5KFDA 3ED5A 4ECTA 3PVXA 1KFDA 1L3TA 3UQ0A 8ICLA 2EZXA 4F4ZA 4F4YA 2XVTA 3OGUA 9ICFA 1ECWA 9ICBA 4QZ9A 1TAQA 1F0MA 1L8OA 1SXDA 5KFJA 3C1YA 4DSFA 4PHEA 3E2EA 4KX5A 5AKZA 2BGWA 4C8KA 2HHWA 1P7DA 4NLNA 3EWAA 9ICTA 1JRPA 4Z6CA 4FO6A 5KFLA 1UT8A 9ICHA 3EPIA 3JPOA 1QQ7A 3IRUA 5L1IA 2K4IA 2YY6A 5EE3A 4QZFA 1ZQ1C 1RYUA 1Z19A 2H3VA 2BPFA 1TFRA 3HILA 3MABA 1L7PA 3TADC 5J2KA 5CJ7A 3RB3A 1OXJA 4QZ8A 4UBBA 5DG7A 1KRPA 4RUAA 3QU7A 4ECQA 3SQIA 5EWEA 5ALOA 5ALVA 1C20A 4ICAA 5JUMA 3C2LA 1XC9A 4UASA 2J6SA 3OHBA 3LWMA 3KOOA 2WTFA 3Q8RB 4CCHA 4KX3A 1T3QA 1ZQZA
chains in the Genus database with same CATH topology
1PK3A 2B6GA 2FE9A 5L1MA 1KW4A 2EAPA 2KG5A 1RG6A 2F3NA 1SV4A 1PK1A 2F8KA 2E8PA 3BS7A 2DKZA 2DL0A 2QB0B 5F3XB 5JU5A 2DKXA 2D3DA 2JV3A 3KKAC 3SENA 4NL9C 1X66A 1SV0C 1SXEA 1V38A 3KKAA 4RQNA 2EAOA 4NL9A 2KMDA 1SV0A 2EANA 1X40A 1OW5A 3SEIA 2KE7A 1B0XA 2QB0A 2LMRA 5JRTA 1F0MA 2ES6A 1SXDA 2LPEA 4RQMA 1LKYA 3BS5A 1Z1VA 2QARB 2GLEA 2E8MA 2KSOB 1JI7A 2K60A 2QARA 2QB1A 2KSOA 1SGGA 1WWUA 4MHVA 2ESEA 5KNIA 2YTUA 2Y9UA 3HILA 4PZOA 3TADC 2E8OA 1V85A 5JTIA 2E8NA 1OXJA 2Y9TA 3TADA 1UCVA 2QKQA 1WWVA 2KIVA 3BQ7A 1COKA 1B4FA 1X9XA 4PZNA 3TACB 3K1RB 2L5YA 2F44A 4NJ8A 1UQVA 1DXSA 3H8MA 4IS7A 2EAMA 5J8YC 1PK1B 3IDWA 1LKYB 2D8CA 3BS5B 5J8YA 2K4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK3 A;  2B6G A;  2FE9 A;  5L1M A;  1KW4 A;  2EAP A;  2KG5 A;  1RG6 A;  2F3N A;  1SV4 A;  1PK1 A;  2F8K A;  2E8P A;  3BS7 A;  2DKZ A;  2DL0 A;  2QB0 B;  5F3X B;  5JU5 A;  2DKX A;  2D3D A;  2JV3 A;  3KKA C;  3SEN A;  4NL9 C;  1X66 A;  1SV0 C;  1SXE A;  1V38 A;  3KKA A;  4RQN A;  2EAO A;  4NL9 A;  2KMD A;  1SV0 A;  2EAN A;  1X40 A;  1OW5 A;  3SEI A;  2KE7 A;  1B0X A;  2QB0 A;  2LMR A;  5JRT A;  1F0M A;  2ES6 A;  1SXD A;  2LPE A;  4RQM A;  1LKY A;  3BS5 A;  1Z1V A;  2QAR B;  2GLE A;  2E8M A;  2KSO B;  1JI7 A;  2K60 A;  2QAR A;  2QB1 A;  2KSO A;  1SGG A;  1WWU A;  4MHV A;  2ESE A;  5KNI A;  2YTU A;  2Y9U A;  3HIL A;  4PZO A;  3TAD C;  2E8O A;  1V85 A;  5JTI A;  2E8N A;  1OXJ A;  2Y9T A;  3TAD A;  1UCV A;  2QKQ A;  1WWV A;  2KIV A;  3BQ7 A;  1COK A;  1B4F A;  1X9X A;  4PZN A;  3TAC B;  3K1R B;  2L5Y A;  2F44 A;  4NJ8 A;  1UQV A;  1DXS A;  3H8M A;  4IS7 A;  2EAM A;  5J8Y C;  1PK1 B;  3IDW A;  1LKY B;  2D8C A;  3BS5 B;  5J8Y A;  2K4P A; 
#chains in the Genus database with same CATH topology
 2WF5 A;  8ICN A;  3SR6 A;  1N63 A;  2B6G A;  3FC4 A;  7ICR A;  1ZQD A;  2AU0 A;  3GII A;  3Q8Q B;  3T5H A;  1CI4 A;  2W8L A;  4P4M A;  3L3F X;  1TAU A;  5TIS U;  8ICQ A;  4KLT A;  2GOL A;  1X66 A;  3F2C A;  8ICK A;  4US8 A;  3SAF A;  5B66 U;  4XA5 A;  2VKQ A;  1B0X A;  1CEZ A;  3QXG A;  1JXL A;  4O5E A;  1Q46 A;  3H4D A;  2PXI A;  2UVU A;  3VCB A;  2KFZ A;  2G5H B;  3PO5 A;  3Q8L A;  2OYY A;  3I28 A;  3UXO A;  5ALG A;  4R63 A;  2D6F C;  4USA A;  5KFH A;  4P4P A;  9ICP A;  2AH5 A;  3I1Y A;  2JXJ A;  2H3Q A;  5AK5 A;  4UAZ A;  2KHQ A;  5J2G A;  2YMP A;  3RH6 A;  2I9G A;  4CRX A;  4O3S A;  5L1L A;  3G6Y A;  7ICG A;  1WWU A;  2MRL A;  5AKK A;  1S9F A;  3HKZ F;  2CN1 A;  5KNI A;  3V6J A;  4F2S A;  4DQQ A;  1Z00 B;  4R8U A;  2FPM A;  2KNJ A;  4KLJ A;  1KFS A;  5J0W A;  4RQ8 A;  4UBC A;  3PX6 A;  2QKQ A;  3M9N B;  5ALJ A;  4C8M A;  2BHN A;  5AM4 A;  4TUP A;  2W43 A;  2P6R A;  4J9O A;  5EWF A;  1RXV A;  5CWR A;  1JMS A;  3LYS A;  3CRX A;  2F44 A;  4EYI B;  2ATL A;  3PO4 A;  5KG1 A;  3KTQ A;  4RT3 A;  5KFT A;  4YMO A;  1KW4 A;  5AI0 A;  5GTH U;  3N97 B;  5EWG A;  4RQ1 A;  3BS7 A;  1X6I A;  3F2B A;  4YR2 A;  4FBU A;  4XRH A;  3F53 A;  1TKD A;  1A0P A;  4KLF A;  1ZQN A;  4KMO B;  4ECS A;  1ZQG A;  4UB8 U;  3HP6 A;  5HP4 A;  3GV5 B;  3BQ2 A;  5BPC A;  5DBB A;  3ISB A;  4I2C A;  1IM4 A;  4FS2 A;  1T8E A;  4RQ2 A;  3QU4 A;  1XSL A;  1HIW A;  4ELU A;  2LPE A;  1NOM A;  8ICT A;  2K8B B;  2RQ5 A;  4RQ5 A;  2PMZ C;  7ICO A;  1UA1 A;  1ZQL A;  4C8L A;  4DOB A;  4GXJ A;  3CP8 A;  2GO7 A;  5FP0 A;  2IBK A;  5DDY A;  4C4S A;  4GC6 A;  2HI0 A;  4F5R A;  3KZX A;  4QZD A;  3B0Y A;  4C8N A;  2WHE A;  4DF8 A;  2AQ0 A;  3SAH A;  3OSP A;  2XCA A;  5ALS A;  2QAR A;  4KIT B;  2HOQ A;  4DL4 A;  5DLF A;  4KLE A;  3QU2 A;  4YN4 A;  1VJ5 A;  4FS1 A;  4X5V A;  1ZQP A;  4TQR A;  1FO4 A;  2FLP A;  4A8E A;  8ICC A;  4RPX A;  1J97 A;  2BR0 A;  3TAD A;  3QEA Z;  2KIV A;  1XU4 A;  1SKW A;  2ZXH A;  5J2A A;  2H3F A;  4IQW A;  2FPK A;  2L5Y A;  4C80 A;  2G07 A;  4ECV A;  1ZRN A;  2Q0Z X;  5KAI U;  5J0O A;  4Q45 A;  3RRG A;  2EAM A;  2JHD A;  1PK1 B;  2WF7 A;  1T94 A;  2J6T A;  4YMN A;  3SI8 A;  2LYB A;  5C5J A;  2DWQ A;  4M6W B;  3RJF A;  1QSS A;  4RQ0 A;  3OSN A;  4UB2 A;  3UPQ A;  7ICN A;  3NRW A;  1WG8 A;  4QZB A;  2DKZ A;  5F3X B;  5JU5 A;  2ZIW A;  1SL1 A;  1WUD A;  3SV4 A;  1SIJ A;  1L8L A;  3QU9 A;  5GTI U;  2DPJ A;  1M6Y A;  4K4H A;  3N7R C;  4DEZ A;  3JPR A;  3HJE A;  5KFI A;  2PFO A;  1U49 A;  2BCR A;  4DL6 A;  4Z6E A;  1RQN A;  2NRW A;  2P35 A;  5III A;  2XY7 A;  3D2Q A;  4NLZ A;  4TUQ A;  4ECX A;  8ICP A;  3V6K A;  2KN7 A;  1U48 A;  2HBJ A;  3H0M B;  1KDH A;  4J9Q A;  4M9H A;  1V97 A;  4B9N A;  4M9G A;  1N2X A;  1ZQY A;  4DQP A;  1B43 A;  3AEV A;  4UB4 A;  1T4G A;  3EYZ A;  1DK2 A;  5HHI A;  3JPS A;  3Q8M A;  2I5H A;  4KLQ A;  4KTQ A;  1SGG A;  1BGX T;  1IG6 A;  1Y88 A;  4ECR A;  1PUZ A;  3MR5 A;  5KFR A;  4I2J A;  3BQ0 A;  7ICV A;  1BPZ A;  2ASD A;  5J2B A;  3KHL A;  1URJ A;  2ZIU A;  2VJ5 A;  1ZQA A;  5T14 A;  4TQS A;  1BPD A;  2KIW A;  2DUY A;  2QLT A;  5IIM A;  4F4X A;  5J2E A;  3LVW A;  3QUB A;  5TZV A;  3BZK A;  5KFG A;  2ZJA A;  3K1R B;  2HSZ A;  3H8M A;  3SZ2 A;  4C0Z A;  1FIQ A;  1NNL A;  2IOF A;  5AKX A;  4FZM A;  3KHH A;  2W54 A;  3C5G A;  3K1Z A;  5ALR A;  4UAY A;  1F44 A;  1PK3 A;  3TFR A;  5AIA A;  1KTQ A;  3KHR A;  5AIB A;  2RDJ A;  3OTQ A;  2MAX A;  1NKE A;  4MEX A;  3WKC A;  4RNM A;  5EE9 A;  3HW8 A;  4J9N A;  4KLL A;  4QZH A;  5F9N A;  3KKA C;  1V9P A;  2XID A;  4NLK A;  1NZP A;  1NKC A;  8ICA A;  2BPG A;  4DFD A;  4O3Q A;  1X40 A;  3SEI A;  5HR7 A;  2BCU A;  3OJS A;  2DFL A;  5J0X A;  2BDU A;  4DO9 A;  7ICI A;  1N5X A;  2FDR A;  2F8L A;  1ZQQ A;  1DRG A;  5D49 A;  2Y0S F;  4DLG A;  3AM9 A;  3N4M B;  2JRZ A;  5ALP A;  4NY8 A;  1TAM A;  3PNC A;  4B9S A;  2NRZ A;  4QZE A;  3T5J A;  2GWS A;  2IOH A;  1K1S A;  4RUC A;  2W9C B;  3T5K A;  3PV8 A;  2IHN A;  4GFJ A;  4UAT A;  3WK9 A;  1ZQV A;  2XY5 A;  7ICP A;  1A6S A;  7ICH A;  4I2F A;  4PZO A;  3AQE A;  4C4T A;  4Y2X A;  1A76 A;  4UW9 A;  4DWI A;  3G6V A;  3PZP A;  4NV0 A;  4RQ4 A;  4YXJ A;  2K8A A;  2JR5 A;  4RQ3 A;  3GQC A;  3DEE A;  2WF8 A;  4Y2U A;  5KG5 A;  2O6K A;  4MF8 A;  1EXN A;  4HAI A;  5DGA A;  1NK5 A;  4U7C A;  4XQ8 A;  4PL1 A;  2JZB B;  3WK6 A;  2BCQ A;  4OJ6 A;  2G08 A;  2KG5 A;  2Q4T A;  4CF5 A;  5KFU A;  3CYM A;  2R8H A;  5KT6 A;  4DS4 A;  4C7Z A;  3AQF A;  2BQ3 A;  1ZQX A;  4YMM A;  1N60 A;  5AK4 A;  1U45 A;  3GIJ A;  8ICJ A;  1SV0 C;  3TI0 A;  4KLG A;  5J0R A;  3M9M B;  1D8Y A;  3PY8 A;  3UMC A;  4QWB A;  4EX6 A;  5CB1 A;  2YB4 A;  5AKE A;  2G0A A;  3F2D A;  3G6X A;  5ALW A;  4IRC A;  4Q8F A;  2KV2 A;  2ISO A;  2F77 X;  3H0R B;  4CE6 A;  3D6J A;  1ZQE A;  4C4R A;  1ZQF A;  3M7D A;  3ONN A;  1BVS A;  4AP9 A;  2J6U A;  3PSI A;  1XO1 A;  3BS5 A;  4QIW F;  4O9M A;  1H38 A;  4F4W A;  3MDA A;  5J2C A;  1IIP A;  1U4B A;  3RTV A;  3QNM A;  2ZJ5 A;  4AYB F;  5KL8 B;  2XY6 A;  4M2Y A;  3QEB Z;  4ED8 A;  2FI1 A;  4B6J A;  2KJ8 A;  2F1I A;  4Y2T A;  4Y2P A;  4KMU A;  3VC8 A;  4MFC A;  4MHV A;  2ZIV B;  1ZQU A;  1SB3 C;  1S0V A;  2Y9U A;  5KFW A;  2F76 X;  2W3S A;  1NJY A;  2HHV A;  2E8O A;  3B9J A;  1FFU A;  4I29 A;  5ALF A;  5DKW A;  4OD0 A;  4DL5 A;  9ICE A;  1ZQO A;  7ICT A;  7ICE A;  5D4B A;  1MA7 A;  2IHM A;  4JV0 A;  3ETR A;  3PX4 A;  3PST A;  1B4F A;  5AM2 A;  3ZI4 A;  1ZET A;  2W03 A;  2PI5 A;  3ISC A;  3OPX A;  1N5W A;  9ICM A;  4KLI A;  1T3N A;  4OO1 J;  2OXO A;  4F92 B;  4FE3 A;  2FE9 A;  3OJU A;  4DL7 A;  3EPG A;  4MFF A;  3BDP A;  2FJ6 A;  9ICK A;  4YR0 A;  5ALD A;  5KFS A;  2F2A B;  2H3I A;  1SWV A;  2W9M A;  1JX4 A;  5AI6 A;  4RZR A;  2KFN A;  2R18 A;  3IV6 A;  4J9K A;  4P0P A;  3D2S A;  1V38 A;  3KKA A;  5CEH A;  3UMG A;  4KLD A;  2W55 A;  3EW9 A;  2PFQ A;  2KE7 A;  2KHV A;  2A1A A;  2NRT A;  9ICR A;  3A0B U;  3N7P D;  4PHA A;  1BPY A;  4O3P A;  2VIX A;  1KEJ A;  3HWT A;  1KSP A;  4DQR A;  2RRD A;  4AYB C;  5IIK A;  3AMZ A;  3GIL A;  1S10 A;  4UB1 A;  4O3R A;  2DF4 B;  2MA1 A;  5BOM A;  4UQG A;  2PI4 A;  1ZD2 P;  2AJQ A;  3GFK B;  2ZTD A;  4UB5 A;  1ZXI A;  1IV8 A;  3IG8 A;  1QQ6 A;  5KT5 A;  2C22 A;  5HR6 A;  3RR7 A;  1ZOL A;  4C7Y A;  7ICF A;  4BWJ A;  2FLN A;  4GXI A;  2OH2 A;  4ZOH C;  1UT5 A;  1Z1B A;  5AKY A;  5J0Y A;  4DSI A;  4DL3 A;  4JWM A;  5DLG A;  2ZTC A;  2BKE A;  1DGS A;  8ICX A;  1S77 D;  2XGQ A;  4Y2R A;  3IG5 A;  3H8W A;  1ZQR A;  3RJH A;  1L7N A;  4EX7 A;  2HOI A;  9ICV A;  5CA7 A;  3E58 A;  1X9X A;  4NJ8 A;  3Q8K A;  1S97 A;  3IDW A;  2E5S A;  4CDG A;  5AI4 A;  1S0M A;  3QX7 A;  2JEJ A;  5KFB A;  1NK6 A;  2NRX A;  4KLM A;  1PK1 A;  1L3S A;  4UB6 U;  2EDU A;  3C2K A;  2BQR A;  4O3M A;  1N56 A;  3NVW A;  2K89 A;  3NVV A;  2HDO A;  2D3D A;  2K8C B;  3C2M A;  4P0Q B;  3ZDC A;  4DCC A;  2KKV A;  4M6W A;  4FBT A;  3PW2 A;  2W8K A;  1RDF A;  3AL0 B;  1SL2 A;  1SV0 A;  2EAN A;  3OHA A;  2OHF A;  1Z4O A;  2KJ5 A;  2WF9 A;  2BZF A;  1TK8 A;  1ZJM A;  1TVA A;  4RQM A;  1LKY A;  3ETL A;  4JV1 A;  2HBL A;  1PVR A;  4KN7 A;  3O0F A;  1ZD5 A;  2E8M A;  3TKA A;  1QTM A;  2LM4 A;  1RPL A;  2W11 A;  4CNQ A;  3RF9 A;  3WU2 U;  3WKB A;  8ICZ A;  4NWI A;  4KLS A;  2AXT U;  5ALT A;  1NK9 A;  2OWO A;  5AKH A;  5DBA A;  1J2N A;  8ICV A;  2R8J A;  3EUB 2;  2W7O A;  9ICN A;  4KLU A;  5IIL A;  1JAL A;  2W7P A;  5DG8 A;  2P6U A;  1X9W A;  4ZH4 A;  1IXR A;  3ZD8 A;  4UAU A;  3JPN A;  5IIN A;  1JUD A;  3CW2 C;  2VA2 A;  1UA0 A;  3NGD A;  2PFN A;  3HKZ C;  4LVS A;  3K75 D;  4Q43 A;  2VA8 A;  2W3R A;  9ICC A;  3TAC B;  3ALR A;  2G06 A;  1UQV A;  1WCN A;  4EZ9 A;  5KG0 A;  2JH7 A;  4F72 A;  2E1F A;  3BZC A;  3RJE A;  2LBO A;  2WB1 F;  2EZY A;  4GC7 A;  3PW5 A;  5DQH A;  1KBU A;  2ASJ A;  1Z4N A;  3F5E A;  2F8K A;  1ZQT A;  9ICW A;  2YML A;  4QZG A;  1ZYQ A;  2DL0 A;  5J0U A;  3RBD A;  4EBC A;  3RB6 A;  3SYZ A;  4NL9 C;  5J2H A;  1NK7 A;  4DLE A;  2KK0 A;  3FM9 A;  5J2F A;  5ALI A;  5KFO A;  5ALY A;  5J0T A;  1U47 A;  3FAH A;  2ODG A;  1X9S A;  3NVZ A;  4O0I A;  4OJP A;  4I28 A;  1S0O A;  4BJQ A;  4DS5 A;  2HHS A;  1UPH A;  2KSO B;  3TAP A;  2MUT B;  1QCK A;  5G5G A;  3M6K A;  1Z3E B;  2IMW P;  2A19 A;  4I2H A;  5HMM A;  4DOA A;  4CF4 A;  1FEZ A;  5ALE A;  2XGP A;  5KFX A;  4PGX A;  2KZM A;  3MGI A;  1NJZ A;  7ICU A;  9ICL A;  1ZQS A;  1A77 A;  5DB6 A;  1PVP A;  3MFH A;  2G09 A;  4M9N A;  3HX0 A;  1WWV A;  2LM1 A;  2BDP A;  3ICX A;  3Q8P B;  5L1K A;  1ZQI A;  3M1Y A;  3MFI A;  4R64 A;  4YXM A;  4YR3 A;  4DF4 A;  2IOF K;  8ICW A;  5DB7 A;  2Z7J A;  4PL2 A;  4JUZ A;  4QWC A;  4I2G A;  4F2R A;  2D8C A;  2C2R A;  1CUK A;  1QQ5 A;  4IC9 A;  5KT2 A;  3E0F A;  3C23 A;  5HHH A;  4B9M A;  2KVC A;  3NAS A;  1S0N A;  4M04 A;  2K4E A;  4FFD A;  4XUS A;  1RM6 C;  5J29 A;  2C2E A;  5KT7 A;  2JMG A;  2QB0 B;  4NLC A;  2DKX A;  5AM3 A;  2JV3 A;  5CHG A;  4YFK A;  5D46 A;  3LDA A;  2ZUD A;  2JGA A;  5B5E U;  3MR3 A;  4EZ6 A;  1ZQW A;  2ZXI A;  2HBM A;  4BXO B;  4EBE A;  2R8G A;  2ZIX B;  4O3O A;  3QE9 Y;  2A3V A;  2FLL A;  1Q8K A;  2KVS A;  2P66 A;  1Z1V A;  3FYH A;  3KZI U;  1ARO P;  2M9N A;  3MC1 A;  2I1Q A;  4UB3 A;  2KKP A;  1XS9 D;  2JEF A;  2ZJ8 A;  4US9 A;  4YVZ A;  3TAR A;  2R8I A;  4ECZ A;  1T7P A;  2OCE A;  3MGV A;  5E79 U;  4PPX A;  3NTU A;  3LWL A;  2ZIW B;  4UAV A;  3V6H A;  3KBB A;  2ZUC A;  7ICJ A;  1COK A;  4IQU A;  7ICS A;  2LKY A;  1NK8 A;  3GV8 B;  5ALZ A;  4TUR A;  1JRO A;  2AHO B;  2IA6 A;  3RJK A;  4NM1 A;  4Y2Q A;  1NK0 A;  2HCF A;  2K4P A;  1O08 A;  5KFK A;  2NO4 A;  3C1Z A;  4MF2 A;  1NK4 A;  5KG2 A;  1RG6 A;  1PVQ A;  3RB0 A;  3WKA A;  5DGB A;  5KG3 A;  1DGJ A;  2KZ3 A;  3ZD9 A;  4QNL A;  4B9V A;  3MBY A;  3WK8 A;  4QWA A;  3BQT A;  2NYV A;  1WYG A;  3ISD A;  1S8O A;  4NL9 A;  5KFV A;  4DSE A;  1YZ6 A;  3PML A;  5J2J A;  5J0Q A;  1QLN A;  1TK5 A;  2ZIU B;  5KFZ A;  2ISP A;  5A0L A;  4QZI A;  5DG9 A;  4RPZ A;  1JXE A;  3WKD A;  4TUS A;  4F5Q A;  2AQ4 A;  1ZQC A;  4F71 A;  1CRX A;  2GLE A;  2HHT A;  1JI7 A;  1QSL A;  4RPY A;  4ED0 A;  3HT3 A;  4JK1 A;  1VDV A;  2Y0S C;  3C29 A;  4IR9 A;  1X6J A;  3LK9 A;  2HMX A;  5KFM A;  5DBC A;  2RP5 A;  1D9D A;  2PFP A;  3RJG A;  1SZH A;  1X42 A;  5AHX A;  2ESE A;  5ALN A;  1ZD3 A;  1LVH A;  2BPC A;  4O3N A;  2MSN A;  4O5C A;  3V72 A;  3H4B A;  4ED1 A;  3UXP A;  4K4G A;  2E1E A;  2W9B B;  3QU5 A;  3GIM A;  4DFM A;  3RH4 A;  3M9O B;  2CPR A;  5HML A;  5H2F U;  4YP3 A;  3BQ7 A;  4I2B A;  3IM1 A;  4EEY A;  1SKR A;  2W04 A;  3RAQ A;  4QZA A;  2Y1I A;  4EBD A;  1BPE A;  4J9L A;  4EEK A;  5J8Y C;  5DQG A;  3EZ5 A;  5AKJ A;  3PX0 A;  2UVW A;  1ED1 A;  4M9J A;  2KIC A;  5AK6 A;  5C0Y A;  4ED7 A;  1Z00 A;  3M8R A;  5KTQ A;  3GZF A;  3WK7 A;  2FMQ A;  3PSF A;  4EEL A;  3MR6 A;  3QUT A;  5KG7 A;  2WAQ F;  3SEN A;  4ED2 A;  4E0D A;  3R9K A;  4MEY A;  1TV9 A;  1WCL A;  2KMD A;  2LYA A;  3J81 j;  2Y1J A;  3UM9 A;  4WJ3 B;  5AI8 A;  2G5I B;  4J9R A;  3RJJ A;  4F3O A;  1YT3 A;  4P0Q A;  4F5N A;  1D8B A;  1ZRM A;  2UVV A;  4RNN A;  4PGY A;  4DSK A;  9ICJ A;  4G9B A;  4DL2 A;  5ALH A;  5KFF A;  2YB1 A;  4M9L A;  4DFP A;  2FMS A;  5AKG A;  3MR2 A;  8ICS A;  4QIW C;  4J03 A;  2QB1 A;  2DBY A;  5AI5 A;  5IIO A;  3QUQ A;  3GU3 A;  4RQ7 A;  3I76 A;  3BQ1 A;  7ICK A;  2YQE A;  5J2D A;  1Q3U A;  1MC8 A;  1B22 A;  5JTI A;  4Y2V A;  2DPI A;  4YG2 A;  4B9U A;  2KD1 A;  2A1J B;  4LJX A;  3NVY A;  5J2I A;  3PW7 A;  5L1J A;  3JPP A;  1ZQK A;  2V4R A;  2WFA A;  1BPB A;  2WF6 A;  4B9L A;  4NM2 A;  3BS5 B;  4HYK A;  3DV9 A;  4OJL A;  1MN8 A;  4UAW A;  8ICG A;  2EAP A;  3A0H U;  2WAQ C;  5AM1 A;  2BCS A;  3WK4 A;  4I2A A;  2E8P A;  5ALK A;  1RYR A;  4BWM A;  4Z6F A;  4F50 A;  2ZTE A;  3RBE A;  5EE0 A;  2EZZ A;  4FZL A;  1NZB A;  1SXE A;  4P4O A;  5CP2 A;  3MDC A;  4JB3 A;  2PMZ F;  1KFT A;  5CR0 A;  2FPL A;  3PR4 A;  5EE1 A;  3RJI A;  1ZD4 A;  3TFS A;  1XSP A;  4QWD A;  1TK0 A;  5AK3 A;  1SL0 A;  2V4Q A;  2UVR A;  1TE2 A;  3JPQ A;  1MSW D;  1SKS A;  1RXW A;  1HJP A;  1KN5 A;  3D2N A;  4RT2 A;  1N62 A;  8ICE A;  8ICM A;  2K60 A;  3C5F A;  1C7Y A;  1Q3V A;  3U26 A;  1YZ7 A;  1NKB A;  4QJF B;  2KSO A;  1NJW A;  3C28 A;  2MUT A;  1FFV A;  1XO0 A;  3T79 A;  3L4P A;  9ICU A;  4CF3 A;  3QUC A;  2E8N A;  4I2D A;  8ICY A;  3BJY A;  9ICA A;  2V9W A;  1QSY A;  4BGD A;  2AGO A;  4P0P B;  4NLB A;  5AKI A;  1X2I A;  3WKE A;  5KFA A;  2PKE A;  2AGP A;  3T3F A;  1U9L A;  3KD3 A;  4IS7 A;  2HBK A;  4P2H A;  4G3I A;  2F1H A;  4NLG A;  2KEY A;  2ZUB A;  1KL9 A;  3UMB A;  4DQS A;  1D9F A;  5ALU A;  3ZDA A;  5J8Y A;  5AIC A;  4OJ5 A;  2VJ4 A;  1BPX A;  3F5A A;  4F4K A;  2W9A A;  1SV4 A;  2JH1 A;  4QWE A;  1OUQ A;  4YQW A;  3SD7 A;  1DK3 A;  1KQQ A;  2YMQ A;  5ALL A;  2HVI A;  1ZJN A;  1ZQB A;  2EAO A;  3S6J A;  4F93 B;  2ZG6 A;  3M8S A;  2KZZ A;  3IP4 B;  1RYS A;  3QYP A;  3GV7 B;  4ECY A;  4ELV A;  2YMM A;  2QB0 A;  2LMR A;  3RB4 A;  5JRT A;  3QZ8 A;  1ZQM A;  2RLT A;  2CXY A;  4IL6 U;  7ICM A;  4RU9 A;  4BXO A;  3WK5 A;  4DOC A;  5ALX A;  2HHU A;  3K4G A;  3RH5 A;  2ZIX A;  4U6P A;  1K1Q A;  4GXK A;  8ICB A;  3MGH A;  2BCV A;  2NO5 A;  3RFA A;  4R8U B;  4YCX A;  1N48 A;  2H5X A;  4CGZ A;  4R66 A;  4ED3 A;  5KFC A;  4DSL A;  4PGQ A;  2HHX A;  1L3V A;  2HOF A;  1MQ2 A;  1VLB A;  2NRV A;  2HW3 A;  5J0S A;  5DB9 A;  4ED6 A;  2YTU A;  1SZP A;  8ICU A;  1K5O A;  1S5L U;  4RNO A;  4KN4 A;  1KKX A;  1V85 A;  4Z6D A;  1DOQ A;  3SV3 A;  3C21 A;  2DQN B;  4PZN A;  4RQ6 A;  1L6N A;  4KLO A;  3THV A;  1XNS A;  1DXS A;  1L7O A;  2W9C A;  4M0A A;  4GIB A;  3QZ7 A;  5HNK A;  3TQ1 A;  1LKY B;  2KOB A;  3ZDD A;  5F9L A;  3H8S A;  4YD2 A;  3Q8S B;  5J0P A;  4F5O A;  1RZT A;  2VA3 A;  7ICQ A;  3IN5 A;  4I2I A;  3UQ2 A;  5ALM A;  3ORY A;  3M6Z A;  4OJO A;  4PH5 A;  1MQ3 A;  4F8R A;  3V7L A;  5KG6 A;  9ICG A;  2DGZ A;  2I6X A;  4I27 A;  2C2D A;  2WB1 C;  3H40 A;  4JWN A;  1XWL A;  9ICX A;  5CRX A;  5KFN A;  2CRX A;  4Q8E A;  1PZN A;  3L5K A;  3TAN A;  4OCZ A;  5G5H A;  4J9S A;  3AU2 A;  4B9T A;  1O03 A;  4Y2Y A;  3LVV A;  2AGQ A;  1X9M A;  2MU2 A;  1AQ6 A;  2ES6 A;  3H0L B;  3NRZ A;  2OEH A;  1UHU A;  3PW0 A;  3FDS A;  1HUO A;  2H3Z A;  3JPT A;  3RAX A;  2JZB A;  1NI3 A;  2QAR B;  3T5L A;  2OM6 A;  5AI9 A;  1BNO A;  2YN4 A;  4IRK A;  1SWW A;  4ACO A;  4PHD A;  7ICL A;  1JN3 A;  4Q44 A;  4IRD A;  1D8L A;  2JEG A;  4K4I A;  5EOZ A;  3RRH A;  2KJ9 A;  3PR5 B;  1JIH A;  8ICR A;  9ICO A;  3PMN A;  2Y9T A;  4JV2 A;  3NS1 A;  1ZQJ A;  4M47 A;  1UCV A;  3RR8 A;  3AUO A;  4GLX A;  2LHT A;  2ALZ A;  2LYH A;  3AU6 A;  4QW8 A;  8ICH A;  3HPO A;  1QH9 A;  2FMP A;  2W9B A;  5AM5 A;  5L9X A;  1COO A;  3N28 A;  5DB8 A;  4DSJ A;  5KAF U;  1KLN A;  2LI6 A;  3PSP A;  5KL1 B;  1F5S A;  8ICI A;  1J2M A;  4O5K A;  4DQI A;  5ALQ A;  2JEI A;  5KFY A;  8ICF A;  3DDH A;  5KT4 A;  3B0X A;  4F91 B;  2HVH A;  2ZIV A;  1L3U A;  3NUQ A;  3ZDE A;  5KFQ A;  2XO7 A;  2N1R A;  4NXZ A;  2C28 A;  2YX8 A;  3SAG A;  5KT3 A;  5KFE A;  4EYH B;  2E3T A;  5DDM A;  4DFK A;  1S76 D;  1OW5 A;  3IHQ B;  2BQU A;  5KG4 A;  4J9P A;  3ZDB A;  4Y2S A;  2M0N A;  3KHG A;  3GDX A;  1LV5 A;  4QZC A;  2RHF A;  2EQY A;  1GO3 F;  3UXN A;  3H7I A;  4IQT A;  4BX9 C;  4IR1 A;  4MFA A;  3HRD D;  4IQV A;  4DFJ A;  2KTQ A;  3TAQ A;  1HEK A;  4PJ0 U;  3GIK A;  4YD1 A;  8ICO A;  3V7J A;  1N61 A;  2VAN A;  4LZG A;  1HUZ A;  3PW4 A;  3CNH A;  4PHP A;  9ICS A;  2GH1 A;  2B0C A;  2XCP A;  2XI9 A;  2R8K A;  4C8O A;  3AN1 A;  4ELT A;  4J9M A;  4ECU A;  1BNP A;  2K4H A;  1RQL A;  3SMV A;  9ICI A;  2NV3 A;  5K4L A;  2ASL A;  4Y2J A;  1L7M A;  4QW9 A;  2XC9 A;  4KLH A;  5IIJ A;  4BDP A;  4I2E A;  4JMU A;  1LB2 B;  1NJX A;  4F5P A;  5AM0 A;  2A1J A;  4LZD A;  4BUG A;  1XSN A;  3N7S C;  5AKL A;  5L1M A;  4EEN A;  3V7K A;  9ICQ A;  5DQI A;  2F3N A;  5KFP A;  3KFU F;  5BOL A;  4R65 A;  2F1J A;  2B21 A;  4ECW A;  3H8J A;  1L5U A;  2KP7 A;  2RDI A;  2EH9 A;  4FZN A;  4RQN A;  2HHQ A;  1ZQH A;  4UAR A;  2XIC A;  5KFD A;  3ED5 A;  4ECT A;  3PVX A;  1KFD A;  1L3T A;  3UQ0 A;  8ICL A;  2EZX A;  4F4Z A;  4F4Y A;  2XVT A;  3OGU A;  9ICF A;  1ECW A;  9ICB A;  4QZ9 A;  1TAQ A;  1F0M A;  1L8O A;  1SXD A;  5KFJ A;  3C1Y A;  4DSF A;  4PHE A;  3E2E A;  4KX5 A;  5AKZ A;  2BGW A;  4C8K A;  2HHW A;  1P7D A;  4NLN A;  3EWA A;  9ICT A;  1JRP A;  4Z6C A;  4FO6 A;  5KFL A;  1UT8 A;  9ICH A;  3EPI A;  3JPO A;  1QQ7 A;  3IRU A;  5L1I A;  2K4I A;  2YY6 A;  5EE3 A;  4QZF A;  1ZQ1 C;  1RYU A;  1Z19 A;  2H3V A;  2BPF A;  1TFR A;  3HIL A;  3MAB A;  1L7P A;  3TAD C;  5J2K A;  5CJ7 A;  3RB3 A;  1OXJ A;  4QZ8 A;  4UBB A;  5DG7 A;  1KRP A;  4RUA A;  3QU7 A;  4ECQ A;  3SQI A;  5EWE A;  5ALO A;  5ALV A;  1C20 A;  4ICA A;  5JUM A;  3C2L A;  1XC9 A;  4UAS A;  2J6S A;  3OHB A;  3LWM A;  3KOO A;  2WTF A;  3Q8R B;  4CCH A;  4KX3 A;  1T3Q A;  1ZQZ A; 
#chains in the Genus database with same CATH homology
 1PK3 A;  2B6G A;  2FE9 A;  5L1M A;  1KW4 A;  2EAP A;  2KG5 A;  1RG6 A;  2F3N A;  1SV4 A;  1PK1 A;  2F8K A;  2E8P A;  3BS7 A;  2DKZ A;  2DL0 A;  2QB0 B;  5F3X B;  5JU5 A;  2DKX A;  2D3D A;  2JV3 A;  3KKA C;  3SEN A;  4NL9 C;  1X66 A;  1SV0 C;  1SXE A;  1V38 A;  3KKA A;  4RQN A;  2EAO A;  4NL9 A;  2KMD A;  1SV0 A;  2EAN A;  1X40 A;  1OW5 A;  3SEI A;  2KE7 A;  1B0X A;  2QB0 A;  2LMR A;  5JRT A;  1F0M A;  2ES6 A;  1SXD A;  2LPE A;  4RQM A;  1LKY A;  3BS5 A;  1Z1V A;  2QAR B;  2GLE A;  2E8M A;  2KSO B;  1JI7 A;  2K60 A;  2QAR A;  2QB1 A;  2KSO A;  1SGG A;  1WWU A;  4MHV A;  2ESE A;  5KNI A;  2YTU A;  2Y9U A;  3HIL A;  4PZO A;  3TAD C;  2E8O A;  1V85 A;  5JTI A;  2E8N A;  1OXJ A;  2Y9T A;  3TAD A;  1UCV A;  2QKQ A;  1WWV A;  2KIV A;  3BQ7 A;  1COK A;  1B4F A;  1X9X A;  4PZN A;  3TAC B;  3K1R B;  2L5Y A;  2F44 A;  4NJ8 A;  1UQV A;  1DXS A;  3H8M A;  4IS7 A;  2EAM A;  5J8Y C;  1PK1 B;  3IDW A;  1LKY B;  2D8C A;  3BS5 B;  5J8Y A;  2K4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...