1V38A

Solution structure of the sterile alpha motif (sam) domain of mouse samsn1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
GSSGSSGRRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Sterile Alpha Motif (SAM) domain of mouse SAMSN1
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords SAM-domain protein SAMSN-1
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1v38A00
2F3NA 2E8NA 2KMDA 3BS5B 1DXSA 1V85A 2ESEA 1PK1A 5KNIA 3KKAC 1B4FA 1OXJA 2QB0A 5F3XB 1SV4A 1WWUA 4NL9C 4RQNA 3BS7A 3TADA 5J8YA 1SV0A 2QARB 2EANA 1OW5A 1X66A 2D8CA 4NJ8A 2Y9UA 2KSOA 2E8PA 1SV0C 4RQMA 3H8MA 3HILA 2QARA 1UQVA 2FE9A 3KKAA 1X9XA 1Z1VA 2B6GA 3BQ7A 5JTIA 2KSOB 3BS5A 3TACB 1V38A 1UCVA 4NL9A 2KG5A 2F8KA 5JU5A 3K1RB 2E8MA 1PK1B 1KW4A 1WWVA 1RG6A 1LKYA 2GLEA 4PZOA 2EAOA 2K4PA 4MHVA 5J8YC 2EAPA 1SGGA 2L5YA 2Y9TA 2K60A 1COKA 1F0MA 2LPEA 2KE7A 2E8OA 2F44A 2QB0B 5JRTA 3TADC 1JI7A 3SENA 2QKQA 1SXEA 2DKZA 2JV3A 1LKYB 2KIVA 3IDWA 2DKXA 1PK3A 2D3DA 2QB1A 2EAMA 2YTUA 2ES6A 1X40A 2DL0A 4IS7A 2LMRA 5L1MA 3SEIA 1SXDA 4PZNA 1B0XA
chains in the Genus database with same CATH superfamily
2W55A 5KFQA 3QNMA 5AM4A 2K89A 3BS5B 2R8GA 4I2DA 2G5HB 1TAUA 2AH5A 1COOA 1S10A 5H2FU 2OCEA 4DL3A 4G9BA 5TISU 4B9LA 3H0MB 4F4XA 2R18A 2RDJA 4GXKA 2Y9UA 4F2SA 2ALZA 3PX0A 3WK7A 3AEVA 3Q8PB 3ETRA 4YXMA 2V4QA 4F2RA 4NV0A 2EZZA 3AUOA 5AK6A 1X9XA 4BDPA 2OEHA 1SWWA 4YN4A 3C21A 2R8KA 1RXVA 4IQWA 2AHOB 1NJZA 2C2RA 5G5HA 2G09A 2VKQA 2EAPA 3LVWA 4P4OA 3HP6A 1JUDA 4I2BA 9ICBA 4FZNA 4F5NA 3M6ZA 5ALLA 2H3ZA 1LVHA 3SV3A 3H4BA 3WKCA 5DG8A 4F93B 9ICKA 1ZQOA 3NRZA 1LV5A 2AXTU 3DEEA 1X42A 1HEKA 3Q8KA 2QB1A 2K4EA 2PFNA 4EENA 2ZXHA 2PFPA 1X40A 4DL7A 2ZIXB 9ICMA 1ZQLA 3SEIA 4RNNA 1ZRNA 1MQ3A 2CN1A 1ZETA 3LYSA 5J2BA 1B0XA 3WKAA 1QSYA 4P0PA 2KHVA 3N7SC 3OSNA 4PGXA 2ZTDA 4I2JA 3MBYA 3WK5A 2HBKA 5DB8A 1MSWD 1BPXA 2Q4TA 2XIDA 5JUMA 1N62A 2QB0A 5AKYA 5F3XB 4I27A 2ZJ5A 4RQNA 3TFRA 1WCLA 2ZUBA 8ICLA 2GH1A 1SV0C 7ICGA 3M8RA 1RQNA 3THVA 3K75D 4UARA 1ZD3A 5CJ7A 2WF6A 1QCKA 4RPYA 4R8UA 1DGJA 4QWEA 2KFZA 2R8JA 4YR2A 9ICNA 1BVSA 1RM6C 5KFWA 4BXOB 1NKEA 4Z6EA 4CNQA 4DFKA 3V7LA 3H40A 3IG5A 4FZMA 3JPNA 4TUPA 4GLXA 1H38A 3EPGA 1CRXA 3HWTA 2MUTB 4C4TA 4PZOA 1XSLA 5AKLA 5EE9A 4P4MA 3GV5B 4RQ4A 2C2EA 4US8A 3U26A 2LKYA 4Y2TA 5KT4A 3TI0A 2NRTA 7ICIA 2DFLA 4Q44A 2F44A 5KFBA 4F4KA 5DGAA 3ED5A 1DK3A 4UB6U 4O5CA 3RJGA 2ZJ8A 2DWQA 2DKXA 1PK3A 4Y2UA 5ALHA 1Q46A 3QU5A 4QZ8A 4PHPA 2H3IA 5L1MA 4YP3A 1NJWA 2NO4A 7ICUA 4YR3A 5ALXA 3QU7A 2PKEA 4RQ7A 4EYHB 1ZQCA 2ISPA 3IV6A 3AQEA 5KFPA 4YFKA 2EZXA 3KTQA 2WF8A 1L8LA 4P2HA 5GTHU 1NK7A 1UPHA 4DFPA 2JZBA 3NS1A 5J2HA 1ZQRA 1QQ7A 4NXZA 2F8LA 4DQSA 1T3NA 5KFIA 5HMLA 1SV0A 1BPYA 4RPZA 3PY8A 9ICVA 4M9NA 2KTQA 4BJQA 1PUZA 3RBEA 2QARA 3GV7B 8ICUA 3V6KA 3C1ZA 4F5OA 3IP4B 4YMNA 1J2NA 4IR9A 2AGQA 4DS5A 5KFYA 1IXRA 2WHEA 2OWOA 1Q3UA 3N7RC 1K5OA 3K1ZA 5L1JA 4Y2PA 2BR0A 3UMCA 3WKDA 4RUCA 2L5YA 3JPOA 7ICKA 4FO6A 1QH9A 1QSSA 1ZQEA 3SI8A 5AI5A 3V7KA 4ED2A 3WK9A 5JRTA 4DSIA 3EPIA 3ONNA 2HOFA 1XS9D 5KFSA 5IIMA 3B0XA 3UXPA 5AI0A 5KG4A 4C7ZA 1ZOLA 3IDWA 4ACOA 3C28A 2PFOA 2W7OA 3GIJA 2FMPA 4I2IA 1IM4A 1L3UA 2GO7A 2NO5A 4JB3A 5DDMA 3EW9A 5J2IA 2W8LA 5KT3A 2GOLA 2YMLA 5DQIA 1HUOA 2ZG6A 4PHDA 1NKBA 3H8SA 2W9AA 4OO1J 4M9JA 1N60A 4C8OA 3GU3A 2ASDA 4YCXA 2HVHA 1FFUA 4Y2VA 3I28A 4DF4A 4KLDA 2ESEA 4PGQA 5J2AA 3E2EA 1KDHA 3UM9A 1OXJA 1J2MA 3L5KA 4ZH4A 3A0BU 5AM5A 2V4RA 1XO1A 4NL9C 5F9LA 1NZBA 4Q45A 3V6HA 3H0LB 2K8CB 2E1FA 2ZIVA 3C1YA 4KLQA 1NJXA 3ALRA 3KZIU 2RDIA 4C7YA 1ZD4A 5J0QA 4MEYA 2LYHA 5J0OA 5AKXA 4IRKA 2F77X 1JXLA 3KHGA 1PK1B 4UASA 2XY6A 1KW4A 3RJKA 3NRWA 5AKJA 1ZQWA 2KNJA 2ZUDA 1D8BA 2W9CA 1DGSA 3UMGA 5EE1A 4DSKA 2ZTEA 2Y0SC 4JWMA 2E3TA 3M8SA 3PMLA 4NLBA 3KZXA 2G06A 4J9OA 3M7DA 4C8NA 3LWMA 3T5LA 8ICTA 4US9A 4TQRA 4O9MA 3T5JA 1X9SA 2EDUA 3MDCA 2QKQA 7ICRA 5AM2A 4KN4A 5B66U 2XO7A 4Y2XA 2JV3A 4QNLA 4R65A 4EBDA 3DDHA 5KAIU 3SD7A 2JGAA 4QZBA 3Q8SB 3AL0B 4UAUA 2BGWA 5IIOA 5DG7A 8ICOA 2P66A 2BCUA 2BQ3A 4O3SA 1ZQBA 1IG6A 1WG8A 1D8LA 4QWCA 2UVUA 1N5WA 1TAMA 5KFKA 2H5XA 3RB3A 1DXSA 3JPPA 3KHRA 5DDYA 3UXNA 2ZXIA 1D8YA 2YMMA 1UA0A 5ALMA 5L1IA 3IG8A 1JN3A 3SAHA 2P6UA 3HKZF 3MDAA 4QW9A 3PMNA 4DL2A 4NLNA 2LM1A 4IC9A 4K4HA 4ELUA 3EWAA 4QZHA 1N5XA 3ZDBA 5BPCA 5CA7A 2B6GA 4DO9A 4NY8A 9ICQA 1L3TA 4KITB 5E79U 1L5UA 4CGZA 2KG5A 3T3FA 4IQUA 1ZD5A 4GC6A 4KMOB 1S0VA 4J9MA 2C2DA 5J2DA 4XRHA 4RQ8A 1TFRA 2WB1F 1COKA 1AROP 2KKPA 2BCSA 2WB1C 4O3OA 5J0WA 4QZEA 5KG2A 5DG9A 4ECRA 1T94A 2EQYA 2YQEA 4JK1A 2F76X 4KLLA 1C20A 5EOZA 2DKZA 2VA8A 4IRDA 4YR0A 5KT7A 3N7PD 1MN8A 4QIWC 2NRWA 1L7NA 3EYZA 7ICLA 3K4GA 1NK5A 4F92B 1X6JA 3TARA 4JWNA 2VA2A 3LK9A 1J97A 3QUQA 3HKZC 8ICAA 2BDPA 1N56A 2KVSA 4Z6FA 1U4BA 3C23A 5J0RA 4MFCA 1CEZA 4A8EA 5ALZA 2XC9A 2JZBB 1KKXA 2CXYA 4TUSA 5KFAA 4J9NA 2IHMA 4I2EA 5DLFA 2FI1A 2I5HA 2J6SA 4M6WA 4P0QB 2CPRA 3LVVA 4C80A 3SMVA 2BPFA 9ICHA 3PW5A 2KZ3A 3TAQA 4QIWF 3N4MB 2FLNA 3KBBA 3OJSA 3WKEA 5GTIU 5IILA 4I2AA 4PPXA 3Q8RB 3CW2C 5JTIA 3RJEA 1KSPA 2HHTA 3RJHA 1SKWA 3BQTA 4B9UA 4F4YA 2J6TA 2KJ8A 1D9FA 2ZIUB 2YX8A 2RRDA 3RAQA 1Z19A 1TK8A 2R8HA 4DSLA 5DLGA 5AM0A 3HRDD 1RPLA 3EUB2 4RPXA 4I2HA 1WCNA 4UB8U 2E8OA 5KFNA 4I28A 3QU9A 3MR5A 1ZYQA 4FBTA 3C2KA 4ED7A 1S97A 2ISOA 1XWLA 3PV8A 2K4HA 5AK5A 4F3OA 9ICSA 5KFCA 1ECWA 2YTUA 3JPRA 2HSZA 4O3QA 4DFJA 2HOIA 1JRPA 3ZD9A 4ECXA 3PW0A 4DOCA 1U9LA 3GILA 5AKGA 2WAQF 5CWRA 3AMZA 2Y1JA 4UAWA 1JX4A 3PX4A 9ICOA 4F4WA 3AQFA 3MGHA 1T3QA 4BWMA 2YB1A 2RP5A 4O3RA 4TURA 4Z6CA 2JEFA 2VA3A 4EBCA 3TAPA 1SV4A 2HHQA 8ICSA 5B5EU 2MU2A 2BQUA 4Q8EA 5DQHA 2BHNA 9ICGA 2K8BB 2D8CA 4YD2A 4M0AA 4MEXA 4F8RA 3TKAA 2KFNA 2H3QA 2BQRA 4C4RA 4EX7A 4LVSA 5BOLA 1Z00B 2F2AB 4Q43A 2IBKA 5D4BA 4NLCA 2VJ5A 2W8KA 2W43A 5JU5A 5KTQA 2FLPA 4I2FA 1LKYA 1BPBA 5AKHA 2ZIVB 2HVIA 4O3PA 1F5SA 8ICEA 1ZQDA 1SGGA 3G6VA 4C8KA 2FJ6A 5L1KA 5EWEA 2JH7A 1SZHA 7ICMA 2HOQA 3WU2U 4J9LA 4CDGA 8ICKA 3SENA 4P0PB 4R8UB 1SWVA 3C5FA 2W03A 2KIVA 2PI5A 4ELTA 4CF4A 4LZGA 3RBDA 3RB6A 3PNCA 4XQ8A 2E1EA 2ASJA 5HR6A 2HBLA 4UAZA 3GFKB 3H0RB 2W3SA 1X6IA 7ICEA 4MFFA 1O03A 4USAA 5ALOA 2QLTA 2KJ5A 2DBYA 3OTQA 3ZI4A 2LBOA 1Y88A 3KKAC 2XY5A 4PH5A 4YQWA 2AGOA 5CHGA 1KLNA 3RH5A 5KFLA 3ZD8A 2RLTA 4BX9C 1RYUA 2Z7JA 1TVAA 3T5HA 1UHUA 5J8YA 8ICFA 1X66A 3H8WA 5KFXA 4QZIA 3TQ1A 2MUTA 4ECVA 1YZ7A 4RUAA 3QEBZ 4ECSA 3WK4A 2JHDA 2W7PA 3HILA 4CF3A 5ALSA 7ICQA 3QYPA 3Q8LA 3KOOA 3UXOA 4EELA 2M0NA 3TACB 8ICXA 2K4IA 5AM1A 3QE9Y 4KLHA 4F71A 8ICHA 3V7JA 1DK2A 3WKBA 3GIMA 3CYMA 3QUTA 2MRLA 5J0PA 1DRGA 2OH2A 4OJLA 2OYYA 2KZZA 1D9DA 3PSFA 1EXNA 2Q0ZX 1ZRMA 1SKRA 5TZVA 8ICNA 5CEHA 3ZDDA 3L4PA 3PR5B 3UQ0A 2HHXA 2AQ0A 5ALJA 4RNOA 5J2EA 4J9RA 1UT5A 2ATLA 1A6SA 4YVZA 2PMZC 2D3DA 5HNKA 2ES6A 2JEGA 1N61A 2VJ4A 1N48A 5CB1A 1ZQQA 1F44A 1ZQ1C 4RT3A 2HHUA 2DQNB 1ZQSA 1SXDA 4M9LA 3IM1A 5AI8A 4F5RA 3NVWA 4ECTA 3BQ0A 3M9MB 1Z00A 3AU6A 4FE3A 4KLEA 5KG6A 4EEYA 3GDXA 1Z4NA 1VJ5A 5AI6A 3D6JA 3ISCA 4XA5A 2C22A 4NWIA 2HDOA 3SAGA 2XVTA 1XSNA 1L7OA 3MR2A 4DFDA 4JV0A 4EYIB 2C28A 1NJYA 1NOMA 2KD1A 7ICSA 2Y0SF 4R63A 5AIAA 3BS7A 3A0HU 3PW7A 9ICEA 3VCBA 3MGVA 4PHEA 3NTUA 5IIJA 3PO5A 2K8AA 4EZ6A 1ZQIA 5ALWA 4F91B 1KQQA 2W9BA 4MF2A 3E0FA 1Z1VA 4EEKA 2BPCA 5KFDA 3MR6A 4IL6U 3WK6A 3G6YA 2F8KA 1BGXT 1AQ6A 5F9NA 5IINA 4GFJA 2KJ9A 5DGBA 3H8JA 2FMSA 3PSPA 1SKSA 1UA1A 3RH6A 4JMUA 1L7MA 4Q8FA 9ICJA 3PX6A 4BUGA 3BQ1A 9ICTA 2UVVA 2YN4A 1JI7A 2W54A 4Z6DA 4UBCA 1TE2A 3HX0A 1RDFA 2ZIXA 1URJA 3EZ5A 2ASLA 2HHVA 2KN7A 2ZTCA 4XUSA 2EAMA 2FDRA 4J9PA 3SQIA 9ICAA 4KLIA 4OD0A 2I1QA 2E8NA 1HJPA 4I29A 2LYAA 2W11A 3C2LA 2PFQA 1PK1A 5AK4A 5KNIA 4RQ0A 5L1LA 2DGZA 2HCFA 3SAFA 3GIIA 2W9CB 2KIWA 3PSTA 1WWUA 5KFVA 4QW8A 3QUBA 1A0PA 1RQLA 3TADA 1ZQYA 4QWAA 5A0LA 2YMPA 3RFAA 4DLGA 4RQMA 2XGQA 1RZTA 4E0DA 2MA1A 3T5KA 1SZPA 1QLNA 4F50A 8ICCA 8ICRA 9ICLA 2ZIWA 3GZFA 3IRUA 5AI9A 8ICWA 1NK4A 4QZAA 4Y2RA 5DBAA 4RQ1A 1HIWA 3F2DA 2YMQA 2XI9A 2XCAA 4QZDA 2NRXA 4R66A 1SL2A 4KLGA 1RG6A 5D49A 1Z4OA 2O6KA 4NLZA 3PVXA 4EZ9A 2KP7A 4IRCA 1RYRA 4G3IA 3RJJA 2NRVA 3D2QA 2KKVA 1A76A 5K4LA 4GIBA 1VLBA 1FFVA 1S0MA 3JPQA 3GQCA 3MR3A 1V9PA 3RRGA 4KX5A 1O08A 4YMMA 4F72A 5J0SA 2G0AA 3BDPA 4FS2A 1S0OA 1LKYB 5J0UA 3BJYA 2HMXA 1KFTA 1PZNA 4JUZA 4P4PA 3JPTA 3KFUF 4BGDA 3ZDAA 4QZFA 1NI3A 2HBMA 5KFMA 8ICMA 4ECUA 3MC1A 3AN1A 3PW2A 5KG1A 5ALFA 1ZQVA 1L3SA 4YXJA 5KFZA 3MABA 2FMQA 5AM3A 2JEJA 4KLTA 2BCQA 5ALGA 2XY7A 1ZQNA 4KLJA 4UAYA 4DSJA 4UW9A 2XICA 2HHSA 2JR5A 3F5AA 4OCZA 3T79A 3SZ2A 1NZPA 4O5EA 3C5GA 8ICZA 5J2JA 2AQ4A 2N1RA 1ZJMA 2QARB 4O0IA 3BZCA 2KHQA 4DQPA 2BDUA 4KTQA 4C0ZA 3KD3A 1N63A 3RJFA 5J0XA 4LZDA 2ZUCA 4ED1A 5AHXA 3BQ7A 3M1YA 5KFUA 1XNSA 3BS5A 5ALPA 4QJFB 1Z3EB 1UCVA 1TKDA 1JIHA 5EWFA 1TV9A 1WWVA 1ZJNA 5KT2A 9ICPA 2W9MA 2EAOA 3I76A 3RAXA 4DCCA 4B9TA 5J8YC 1QTMA 3HT3A 3R9KA 4K4GA 2R8IA 4KLUA 5ALDA 4UB3A 3H4DA 2LPEA 2IMWP 3OSPA 1VDVA 3M9NB 2IA6A 3ETLA 3PZPA 1L6NA 1NKCA 4P0QA 7ICOA 4QWBA 4F4ZA 4J9QA 2B21A 3GIKA 1KBUA 3MFHA 4Y2SA 4YMOA 4YD1A 1GO3F 1U45A 1TK0A 4UB1A 1ZXIA 3S6JA 4C4SA 4UQGA 2H3FA 4QZGA 1KN5A 1K1QA 5C0YA 4OJ5A 4DQRA 4DOBA 3GV8B 4KX3A 4F5PA 4ED3A 2RQ5A 4KLFA 3PR4A 2WF9A 5T14A 2KMDA 2FPLA 1JXEA 1L8OA 2JEIA 3KHHA 4F5QA 2NRZA 1NK6A 5BOMA 1PVRA 4DFMA 1BPDA 1NK8A 4FZLA 1NK0A 2WTFA 1OW5A 2E8PA 3CP8A 1KTQA 3C29A 5EE0A 4MFAA 3H8MA 1ZQJA 1UQVA 2ODGA 4PGYA 1XSPA 2KOBA 2J6UA 1SIJA 2KSOB 1IV8A 4NL9A 3FC4A 5DBBA 5HHIA 2JRZA 4M47A 2LHTA 5J2GA 1IIPA 2GLEA 1S9FA 8ICBA 3JPSA 2A1AA 4DL6A 2HI0A 4TQSA 1ZQMA 4R64A 5ALKA 1N2XA 3ICXA 1ZQFA 5J2CA 4C8LA 3SV4A 5KFFA 3F2BA 3I1YA 2K60A 2EZYA 4B9VA 3B0YA 2LYBA 5AKZA 4B6JA 1ZQXA 2QB0B 4ECQA 2D6FC 3QU4A 4BXOA 3HPOA 5EE3A 3CRXA 1A77A 5DB6A 1MC8A 1ZQTA 1BPEA 5ALNA 4KLSA 2G5IB 1OUQA 4OJ6A 4ICAA 1B22A 4U7CA 4FFDA 4Y2QA 1KRPA 3QUCA 2KK0A 3NVYA 2FLLA 3SYZA 1CUKA 3HW8A 4AYBF 4CF5A 4DQQA 3AU2A 4YG2A 1ZQGA 9ICXA 1RYSA 2MSNA 3ZDCA 3OHBA 1V85A 2AGPA 1DOQA 1B4FA 1QQ6A 2FPMA 5KFJA 1ZD2P 3Q8MA 5KG0A 2KZMA 4UB2A 4J9KA 3FM9A 1RXWA 8ICPA 5KG3A 4C8MA 3F2CA 2BKEA 3FAHA 4DF8A 7ICPA 4NJ8A 2KSOA 3M6KA 5KT6A 4KN7A 5KFTA 1PVQA 3N28A 3UPQA 2FE9A 4PHAA 4RNMA 2H3VA 3PO4A 1YZ6A 4UAVA 1XU4A 1MA7A 1T7PA 9ICCA 4ED8A 4DS4A 7ICNA 1V97A 1V38A 3OPXA 1WUDA 5ALEA 3ZDEA 2NYVA 2K4PA 1Z1BA 7ICVA 2I6XA 3D2SA 4UBBA 2BZFA 4HAIA 4MF8A 1X9WA 5IIIA 4TUQA 2G08A 3QEAZ 2WF7A 3MFIA 2BCVA 1LB2B 4CCHA 2GWSA 3C2MA 1JALA 1SL1A 3Q8QB 7ICFA 5HR7A 9ICWA 5KL1B 8ICGA 3FYHA 4J9SA 2LMRA 1S8OA 4NLGA 4ECYA 3OGUA 4DEZA 4UB4A 4M04A 8ICJA 4EBEA 8ICVA 2ZJAA 1Q8KA 1JMSA 2DUYA 1NNLA 5ALYA 5HHHA 1TAQA 5J29A 1XO0A 3NGDA 1T4GA 4M2YA 3TANA 1KL9A 4O3NA 2LM4A 3D2NA 5KFOA 1ZQAA 2CRXA 5KFEA 2F1HA 4PL2A 2EANA 2RHFA 2LI6A 1YT3A 2PXIA 5IIKA 2DF4B 1ZQZA 5C5JA 4OJPA 1KFDA 5DQGA 1ZQUA 5J0TA 2DPJA 5AK3A 5CP2A 4QZ9A 2BCRA 4M9HA 4DQIA 2FPKA 2A1JB 9ICIA 2NV3A 4FS1A 4NLKA 4ED6A 4B9MA 2W04A 3RJIA 1HUZA 5CR0A 3BZKA 2XCPA 1P7DA 5AKEA 1S76D 4QZCA 3BQ2A 5D46A 2Y9TA 4RQ3A 5L9XA 4ECWA 5KFRA 2JXJA 3H7IA 3RR7A 3CNHA 3TFSA 2KE7A 3L3FX 3ORYA 4HYKA 4IR1A 2UVRA 1BNOA 2P35A 5DBCA 1PVPA 3TADC 4ZOHC 1B43A 1SXEA 1U48A 1X9MA 2B0CA 4WJ3B 3LWLA 4LJXA 1XC9A 1TK5A 2W9BB 3OHAA 4PL1A 2PI4A 4OJOA 4NM2A 4B9NA 3MGIA 5G5GA 4ED0A 5CRXA 3SR6A 1BNPA 4GC7A 2IOFK 4DLEA 7ICJA 5KG7A 1K1SA 3FDSA 4J03A 5DKWA 3OJUA 2WF5A 3NASA 4AP9A 3QZ7A 8ICQA 2W3RA 1SB3C 4X5VA 2F3NA 4B9SA 1M6YA 4O5KA 1ZQPA 2A19A 3B9JA 2UVWA 2HW3A 8ICYA 4DL5A 1C7YA 1ED1A 1T8EA 3RR8A 3NUQA 1U49A 3HJEA 4FBUA 4DSEA 4I2GA 1QSLA 1BPZA 4Y2JA 5ALIA 3NVZA 1FO4A 5FP0A 3PSIA 9ICRA 2F1IA 7ICHA 5ALRA 2MAXA 3KHLA 2A1JA 2JH1A 3ISBA 3RH4A 1NK9A 5DB7A 4CRXA 5AI4A 2OM6A 2KV2A 2WFAA 2VANA 2I9GA 2BPGA 2EH9A 2PMZF 5KL8B 1KEJA 3K1RB 2E8MA 2M9NA 7ICTA 3J81j 5J2KA 4RU9A 4UATA 3UMBA 1UT8A 3VC8A 1MQ2A 2VIXA 4KLMA 2KICA 5AKKA 5HMMA 9ICUA 4DWIA 3V72A 2JMGA 2YY6A 1F0MA 2IHNA 4UB5A 3QZ8A 3IN5A 3QXGA 4QWDA 1Q3VA 3AM9A 3O0FA 4K4IA 2AJQA 2OHFA 2WAQC 4JV1A 2KEYA 1ZQHA 3IHQB 3G6XA 3PW4A 2HBJA 4RT2A 2DL0A 2V9WA 3M9OB 3RF9A 5AKIA 4KMUA 3RTVA 2E5SA 3UQ2A 4DOAA 3QU2A 4EX6A 3N97B 1SL0A 4PJ0U 3NVVA 2ZIWB 2KVCA 3RB0A 4RZRA 3RB4A 5HP4A 1CI4A 3WK8A 4ELVA 1WYGA 3ISDA 4AYBC 3F5EA 1S5LU 8ICIA 4NM1A 4Y2YA 1KFSA 1X2IA 5KG5A 5KFGA 4O3MA 4U6PA 4GXJA 3V6JA 2HHWA 4DSFA 2AU0A 1JROA 3QX7A 3KKAA 5ALVA 2OXOA 4JV2A 5ALTA 4IQVA 5DB9A 2YB4A 5EWGA 2G07A 3DV9A 9ICFA 5KFHA 4CE6A 4MHVA 1L3VA 2Y1IA 1FIQA 4RQ6A 4M6WB 2IOFA 4BWJA 2DPIA 4ECZA 2IOHA 1FEZA 4I2CA 4KLOA 5ALUA 4RQ5A 1L7PA 3F53A 5KAFU 1QQ5A 1ZQKA 5AIBA 5KT5A 4IQTA 2XGPA 2ZIUA 3E58A 2F1JA 2P6RA 5ALQA 3LDAA 4IS7A 1U47A 4RQ2A 3RRHA 2A3VA 5J0YA 4DL4A 5AICA 5J2FA 1S77D 1S0NA 4M9GA 4PZNA 4GXIA
chains in the Genus database with same CATH topology
2F3NA 2E8NA 2KMDA 3BS5B 1DXSA 1V85A 2ESEA 1PK1A 5KNIA 3KKAC 1B4FA 1OXJA 2QB0A 5F3XB 1SV4A 1WWUA 4NL9C 4RQNA 3BS7A 3TADA 5J8YA 1SV0A 2QARB 2EANA 1OW5A 1X66A 2D8CA 4NJ8A 2Y9UA 2KSOA 2E8PA 1SV0C 4RQMA 3H8MA 3HILA 2QARA 1UQVA 2FE9A 3KKAA 1X9XA 1Z1VA 2B6GA 3BQ7A 5JTIA 2KSOB 3BS5A 3TACB 1V38A 1UCVA 4NL9A 2KG5A 2F8KA 5JU5A 3K1RB 2E8MA 1PK1B 1KW4A 1WWVA 1RG6A 1LKYA 2GLEA 4PZOA 2EAOA 2K4PA 4MHVA 5J8YC 2EAPA 1SGGA 2L5YA 2Y9TA 2K60A 1COKA 1F0MA 2LPEA 2KE7A 2E8OA 2F44A 2QB0B 5JRTA 3TADC 1JI7A 3SENA 2QKQA 1SXEA 2DKZA 2JV3A 1LKYB 2KIVA 3IDWA 2DKXA 1PK3A 2D3DA 2QB1A 2EAMA 2YTUA 2ES6A 1X40A 2DL0A 4IS7A 2LMRA 5L1MA 3SEIA 1SXDA 4PZNA 1B0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3N A;  2E8N A;  2KMD A;  3BS5 B;  1DXS A;  1V85 A;  2ESE A;  1PK1 A;  5KNI A;  3KKA C;  1B4F A;  1OXJ A;  2QB0 A;  5F3X B;  1SV4 A;  1WWU A;  4NL9 C;  4RQN A;  3BS7 A;  3TAD A;  5J8Y A;  1SV0 A;  2QAR B;  2EAN A;  1OW5 A;  1X66 A;  2D8C A;  4NJ8 A;  2Y9U A;  2KSO A;  2E8P A;  1SV0 C;  4RQM A;  3H8M A;  3HIL A;  2QAR A;  1UQV A;  2FE9 A;  3KKA A;  1X9X A;  1Z1V A;  2B6G A;  3BQ7 A;  5JTI A;  2KSO B;  3BS5 A;  3TAC B;  1V38 A;  1UCV A;  4NL9 A;  2KG5 A;  2F8K A;  5JU5 A;  3K1R B;  2E8M A;  1PK1 B;  1KW4 A;  1WWV A;  1RG6 A;  1LKY A;  2GLE A;  4PZO A;  2EAO A;  2K4P A;  4MHV A;  5J8Y C;  2EAP A;  1SGG A;  2L5Y A;  2Y9T A;  2K60 A;  1COK A;  1F0M A;  2LPE A;  2KE7 A;  2E8O A;  2F44 A;  2QB0 B;  5JRT A;  3TAD C;  1JI7 A;  3SEN A;  2QKQ A;  1SXE A;  2DKZ A;  2JV3 A;  1LKY B;  2KIV A;  3IDW A;  2DKX A;  1PK3 A;  2D3D A;  2QB1 A;  2EAM A;  2YTU A;  2ES6 A;  1X40 A;  2DL0 A;  4IS7 A;  2LMR A;  5L1M A;  3SEI A;  1SXD A;  4PZN A;  1B0X A; 
#chains in the Genus database with same CATH topology
 2W55 A;  5KFQ A;  3QNM A;  5AM4 A;  2K89 A;  3BS5 B;  2R8G A;  4I2D A;  2G5H B;  1TAU A;  2AH5 A;  1COO A;  1S10 A;  5H2F U;  2OCE A;  4DL3 A;  4G9B A;  5TIS U;  4B9L A;  3H0M B;  4F4X A;  2R18 A;  2RDJ A;  4GXK A;  2Y9U A;  4F2S A;  2ALZ A;  3PX0 A;  3WK7 A;  3AEV A;  3Q8P B;  3ETR A;  4YXM A;  2V4Q A;  4F2R A;  4NV0 A;  2EZZ A;  3AUO A;  5AK6 A;  1X9X A;  4BDP A;  2OEH A;  1SWW A;  4YN4 A;  3C21 A;  2R8K A;  1RXV A;  4IQW A;  2AHO B;  1NJZ A;  2C2R A;  5G5H A;  2G09 A;  2VKQ A;  2EAP A;  3LVW A;  4P4O A;  3HP6 A;  1JUD A;  4I2B A;  9ICB A;  4FZN A;  4F5N A;  3M6Z A;  5ALL A;  2H3Z A;  1LVH A;  3SV3 A;  3H4B A;  3WKC A;  5DG8 A;  4F93 B;  9ICK A;  1ZQO A;  3NRZ A;  1LV5 A;  2AXT U;  3DEE A;  1X42 A;  1HEK A;  3Q8K A;  2QB1 A;  2K4E A;  2PFN A;  4EEN A;  2ZXH A;  2PFP A;  1X40 A;  4DL7 A;  2ZIX B;  9ICM A;  1ZQL A;  3SEI A;  4RNN A;  1ZRN A;  1MQ3 A;  2CN1 A;  1ZET A;  3LYS A;  5J2B A;  1B0X A;  3WKA A;  1QSY A;  4P0P A;  2KHV A;  3N7S C;  3OSN A;  4PGX A;  2ZTD A;  4I2J A;  3MBY A;  3WK5 A;  2HBK A;  5DB8 A;  1MSW D;  1BPX A;  2Q4T A;  2XID A;  5JUM A;  1N62 A;  2QB0 A;  5AKY A;  5F3X B;  4I27 A;  2ZJ5 A;  4RQN A;  3TFR A;  1WCL A;  2ZUB A;  8ICL A;  2GH1 A;  1SV0 C;  7ICG A;  3M8R A;  1RQN A;  3THV A;  3K75 D;  4UAR A;  1ZD3 A;  5CJ7 A;  2WF6 A;  1QCK A;  4RPY A;  4R8U A;  1DGJ A;  4QWE A;  2KFZ A;  2R8J A;  4YR2 A;  9ICN A;  1BVS A;  1RM6 C;  5KFW A;  4BXO B;  1NKE A;  4Z6E A;  4CNQ A;  4DFK A;  3V7L A;  3H40 A;  3IG5 A;  4FZM A;  3JPN A;  4TUP A;  4GLX A;  1H38 A;  3EPG A;  1CRX A;  3HWT A;  2MUT B;  4C4T A;  4PZO A;  1XSL A;  5AKL A;  5EE9 A;  4P4M A;  3GV5 B;  4RQ4 A;  2C2E A;  4US8 A;  3U26 A;  2LKY A;  4Y2T A;  5KT4 A;  3TI0 A;  2NRT A;  7ICI A;  2DFL A;  4Q44 A;  2F44 A;  5KFB A;  4F4K A;  5DGA A;  3ED5 A;  1DK3 A;  4UB6 U;  4O5C A;  3RJG A;  2ZJ8 A;  2DWQ A;  2DKX A;  1PK3 A;  4Y2U A;  5ALH A;  1Q46 A;  3QU5 A;  4QZ8 A;  4PHP A;  2H3I A;  5L1M A;  4YP3 A;  1NJW A;  2NO4 A;  7ICU A;  4YR3 A;  5ALX A;  3QU7 A;  2PKE A;  4RQ7 A;  4EYH B;  1ZQC A;  2ISP A;  3IV6 A;  3AQE A;  5KFP A;  4YFK A;  2EZX A;  3KTQ A;  2WF8 A;  1L8L A;  4P2H A;  5GTH U;  1NK7 A;  1UPH A;  4DFP A;  2JZB A;  3NS1 A;  5J2H A;  1ZQR A;  1QQ7 A;  4NXZ A;  2F8L A;  4DQS A;  1T3N A;  5KFI A;  5HML A;  1SV0 A;  1BPY A;  4RPZ A;  3PY8 A;  9ICV A;  4M9N A;  2KTQ A;  4BJQ A;  1PUZ A;  3RBE A;  2QAR A;  3GV7 B;  8ICU A;  3V6K A;  3C1Z A;  4F5O A;  3IP4 B;  4YMN A;  1J2N A;  4IR9 A;  2AGQ A;  4DS5 A;  5KFY A;  1IXR A;  2WHE A;  2OWO A;  1Q3U A;  3N7R C;  1K5O A;  3K1Z A;  5L1J A;  4Y2P A;  2BR0 A;  3UMC A;  3WKD A;  4RUC A;  2L5Y A;  3JPO A;  7ICK A;  4FO6 A;  1QH9 A;  1QSS A;  1ZQE A;  3SI8 A;  5AI5 A;  3V7K A;  4ED2 A;  3WK9 A;  5JRT A;  4DSI A;  3EPI A;  3ONN A;  2HOF A;  1XS9 D;  5KFS A;  5IIM A;  3B0X A;  3UXP A;  5AI0 A;  5KG4 A;  4C7Z A;  1ZOL A;  3IDW A;  4ACO A;  3C28 A;  2PFO A;  2W7O A;  3GIJ A;  2FMP A;  4I2I A;  1IM4 A;  1L3U A;  2GO7 A;  2NO5 A;  4JB3 A;  5DDM A;  3EW9 A;  5J2I A;  2W8L A;  5KT3 A;  2GOL A;  2YML A;  5DQI A;  1HUO A;  2ZG6 A;  4PHD A;  1NKB A;  3H8S A;  2W9A A;  4OO1 J;  4M9J A;  1N60 A;  4C8O A;  3GU3 A;  2ASD A;  4YCX A;  2HVH A;  1FFU A;  4Y2V A;  3I28 A;  4DF4 A;  4KLD A;  2ESE A;  4PGQ A;  5J2A A;  3E2E A;  1KDH A;  3UM9 A;  1OXJ A;  1J2M A;  3L5K A;  4ZH4 A;  3A0B U;  5AM5 A;  2V4R A;  1XO1 A;  4NL9 C;  5F9L A;  1NZB A;  4Q45 A;  3V6H A;  3H0L B;  2K8C B;  2E1F A;  2ZIV A;  3C1Y A;  4KLQ A;  1NJX A;  3ALR A;  3KZI U;  2RDI A;  4C7Y A;  1ZD4 A;  5J0Q A;  4MEY A;  2LYH A;  5J0O A;  5AKX A;  4IRK A;  2F77 X;  1JXL A;  3KHG A;  1PK1 B;  4UAS A;  2XY6 A;  1KW4 A;  3RJK A;  3NRW A;  5AKJ A;  1ZQW A;  2KNJ A;  2ZUD A;  1D8B A;  2W9C A;  1DGS A;  3UMG A;  5EE1 A;  4DSK A;  2ZTE A;  2Y0S C;  4JWM A;  2E3T A;  3M8S A;  3PML A;  4NLB A;  3KZX A;  2G06 A;  4J9O A;  3M7D A;  4C8N A;  3LWM A;  3T5L A;  8ICT A;  4US9 A;  4TQR A;  4O9M A;  3T5J A;  1X9S A;  2EDU A;  3MDC A;  2QKQ A;  7ICR A;  5AM2 A;  4KN4 A;  5B66 U;  2XO7 A;  4Y2X A;  2JV3 A;  4QNL A;  4R65 A;  4EBD A;  3DDH A;  5KAI U;  3SD7 A;  2JGA A;  4QZB A;  3Q8S B;  3AL0 B;  4UAU A;  2BGW A;  5IIO A;  5DG7 A;  8ICO A;  2P66 A;  2BCU A;  2BQ3 A;  4O3S A;  1ZQB A;  1IG6 A;  1WG8 A;  1D8L A;  4QWC A;  2UVU A;  1N5W A;  1TAM A;  5KFK A;  2H5X A;  3RB3 A;  1DXS A;  3JPP A;  3KHR A;  5DDY A;  3UXN A;  2ZXI A;  1D8Y A;  2YMM A;  1UA0 A;  5ALM A;  5L1I A;  3IG8 A;  1JN3 A;  3SAH A;  2P6U A;  3HKZ F;  3MDA A;  4QW9 A;  3PMN A;  4DL2 A;  4NLN A;  2LM1 A;  4IC9 A;  4K4H A;  4ELU A;  3EWA A;  4QZH A;  1N5X A;  3ZDB A;  5BPC A;  5CA7 A;  2B6G A;  4DO9 A;  4NY8 A;  9ICQ A;  1L3T A;  4KIT B;  5E79 U;  1L5U A;  4CGZ A;  2KG5 A;  3T3F A;  4IQU A;  1ZD5 A;  4GC6 A;  4KMO B;  1S0V A;  4J9M A;  2C2D A;  5J2D A;  4XRH A;  4RQ8 A;  1TFR A;  2WB1 F;  1COK A;  1ARO P;  2KKP A;  2BCS A;  2WB1 C;  4O3O A;  5J0W A;  4QZE A;  5KG2 A;  5DG9 A;  4ECR A;  1T94 A;  2EQY A;  2YQE A;  4JK1 A;  2F76 X;  4KLL A;  1C20 A;  5EOZ A;  2DKZ A;  2VA8 A;  4IRD A;  4YR0 A;  5KT7 A;  3N7P D;  1MN8 A;  4QIW C;  2NRW A;  1L7N A;  3EYZ A;  7ICL A;  3K4G A;  1NK5 A;  4F92 B;  1X6J A;  3TAR A;  4JWN A;  2VA2 A;  3LK9 A;  1J97 A;  3QUQ A;  3HKZ C;  8ICA A;  2BDP A;  1N56 A;  2KVS A;  4Z6F A;  1U4B A;  3C23 A;  5J0R A;  4MFC A;  1CEZ A;  4A8E A;  5ALZ A;  2XC9 A;  2JZB B;  1KKX A;  2CXY A;  4TUS A;  5KFA A;  4J9N A;  2IHM A;  4I2E A;  5DLF A;  2FI1 A;  2I5H A;  2J6S A;  4M6W A;  4P0Q B;  2CPR A;  3LVV A;  4C80 A;  3SMV A;  2BPF A;  9ICH A;  3PW5 A;  2KZ3 A;  3TAQ A;  4QIW F;  3N4M B;  2FLN A;  3KBB A;  3OJS A;  3WKE A;  5GTI U;  5IIL A;  4I2A A;  4PPX A;  3Q8R B;  3CW2 C;  5JTI A;  3RJE A;  1KSP A;  2HHT A;  3RJH A;  1SKW A;  3BQT A;  4B9U A;  4F4Y A;  2J6T A;  2KJ8 A;  1D9F A;  2ZIU B;  2YX8 A;  2RRD A;  3RAQ A;  1Z19 A;  1TK8 A;  2R8H A;  4DSL A;  5DLG A;  5AM0 A;  3HRD D;  1RPL A;  3EUB 2;  4RPX A;  4I2H A;  1WCN A;  4UB8 U;  2E8O A;  5KFN A;  4I28 A;  3QU9 A;  3MR5 A;  1ZYQ A;  4FBT A;  3C2K A;  4ED7 A;  1S97 A;  2ISO A;  1XWL A;  3PV8 A;  2K4H A;  5AK5 A;  4F3O A;  9ICS A;  5KFC A;  1ECW A;  2YTU A;  3JPR A;  2HSZ A;  4O3Q A;  4DFJ A;  2HOI A;  1JRP A;  3ZD9 A;  4ECX A;  3PW0 A;  4DOC A;  1U9L A;  3GIL A;  5AKG A;  2WAQ F;  5CWR A;  3AMZ A;  2Y1J A;  4UAW A;  1JX4 A;  3PX4 A;  9ICO A;  4F4W A;  3AQF A;  3MGH A;  1T3Q A;  4BWM A;  2YB1 A;  2RP5 A;  4O3R A;  4TUR A;  4Z6C A;  2JEF A;  2VA3 A;  4EBC A;  3TAP A;  1SV4 A;  2HHQ A;  8ICS A;  5B5E U;  2MU2 A;  2BQU A;  4Q8E A;  5DQH A;  2BHN A;  9ICG A;  2K8B B;  2D8C A;  4YD2 A;  4M0A A;  4MEX A;  4F8R A;  3TKA A;  2KFN A;  2H3Q A;  2BQR A;  4C4R A;  4EX7 A;  4LVS A;  5BOL A;  1Z00 B;  2F2A B;  4Q43 A;  2IBK A;  5D4B A;  4NLC A;  2VJ5 A;  2W8K A;  2W43 A;  5JU5 A;  5KTQ A;  2FLP A;  4I2F A;  1LKY A;  1BPB A;  5AKH A;  2ZIV B;  2HVI A;  4O3P A;  1F5S A;  8ICE A;  1ZQD A;  1SGG A;  3G6V A;  4C8K A;  2FJ6 A;  5L1K A;  5EWE A;  2JH7 A;  1SZH A;  7ICM A;  2HOQ A;  3WU2 U;  4J9L A;  4CDG A;  8ICK A;  3SEN A;  4P0P B;  4R8U B;  1SWV A;  3C5F A;  2W03 A;  2KIV A;  2PI5 A;  4ELT A;  4CF4 A;  4LZG A;  3RBD A;  3RB6 A;  3PNC A;  4XQ8 A;  2E1E A;  2ASJ A;  5HR6 A;  2HBL A;  4UAZ A;  3GFK B;  3H0R B;  2W3S A;  1X6I A;  7ICE A;  4MFF A;  1O03 A;  4USA A;  5ALO A;  2QLT A;  2KJ5 A;  2DBY A;  3OTQ A;  3ZI4 A;  2LBO A;  1Y88 A;  3KKA C;  2XY5 A;  4PH5 A;  4YQW A;  2AGO A;  5CHG A;  1KLN A;  3RH5 A;  5KFL A;  3ZD8 A;  2RLT A;  4BX9 C;  1RYU A;  2Z7J A;  1TVA A;  3T5H A;  1UHU A;  5J8Y A;  8ICF A;  1X66 A;  3H8W A;  5KFX A;  4QZI A;  3TQ1 A;  2MUT A;  4ECV A;  1YZ7 A;  4RUA A;  3QEB Z;  4ECS A;  3WK4 A;  2JHD A;  2W7P A;  3HIL A;  4CF3 A;  5ALS A;  7ICQ A;  3QYP A;  3Q8L A;  3KOO A;  3UXO A;  4EEL A;  2M0N A;  3TAC B;  8ICX A;  2K4I A;  5AM1 A;  3QE9 Y;  4KLH A;  4F71 A;  8ICH A;  3V7J A;  1DK2 A;  3WKB A;  3GIM A;  3CYM A;  3QUT A;  2MRL A;  5J0P A;  1DRG A;  2OH2 A;  4OJL A;  2OYY A;  2KZZ A;  1D9D A;  3PSF A;  1EXN A;  2Q0Z X;  1ZRM A;  1SKR A;  5TZV A;  8ICN A;  5CEH A;  3ZDD A;  3L4P A;  3PR5 B;  3UQ0 A;  2HHX A;  2AQ0 A;  5ALJ A;  4RNO A;  5J2E A;  4J9R A;  1UT5 A;  2ATL A;  1A6S A;  4YVZ A;  2PMZ C;  2D3D A;  5HNK A;  2ES6 A;  2JEG A;  1N61 A;  2VJ4 A;  1N48 A;  5CB1 A;  1ZQQ A;  1F44 A;  1ZQ1 C;  4RT3 A;  2HHU A;  2DQN B;  1ZQS A;  1SXD A;  4M9L A;  3IM1 A;  5AI8 A;  4F5R A;  3NVW A;  4ECT A;  3BQ0 A;  3M9M B;  1Z00 A;  3AU6 A;  4FE3 A;  4KLE A;  5KG6 A;  4EEY A;  3GDX A;  1Z4N A;  1VJ5 A;  5AI6 A;  3D6J A;  3ISC A;  4XA5 A;  2C22 A;  4NWI A;  2HDO A;  3SAG A;  2XVT A;  1XSN A;  1L7O A;  3MR2 A;  4DFD A;  4JV0 A;  4EYI B;  2C28 A;  1NJY A;  1NOM A;  2KD1 A;  7ICS A;  2Y0S F;  4R63 A;  5AIA A;  3BS7 A;  3A0H U;  3PW7 A;  9ICE A;  3VCB A;  3MGV A;  4PHE A;  3NTU A;  5IIJ A;  3PO5 A;  2K8A A;  4EZ6 A;  1ZQI A;  5ALW A;  4F91 B;  1KQQ A;  2W9B A;  4MF2 A;  3E0F A;  1Z1V A;  4EEK A;  2BPC A;  5KFD A;  3MR6 A;  4IL6 U;  3WK6 A;  3G6Y A;  2F8K A;  1BGX T;  1AQ6 A;  5F9N A;  5IIN A;  4GFJ A;  2KJ9 A;  5DGB A;  3H8J A;  2FMS A;  3PSP A;  1SKS A;  1UA1 A;  3RH6 A;  4JMU A;  1L7M A;  4Q8F A;  9ICJ A;  3PX6 A;  4BUG A;  3BQ1 A;  9ICT A;  2UVV A;  2YN4 A;  1JI7 A;  2W54 A;  4Z6D A;  4UBC A;  1TE2 A;  3HX0 A;  1RDF A;  2ZIX A;  1URJ A;  3EZ5 A;  2ASL A;  2HHV A;  2KN7 A;  2ZTC A;  4XUS A;  2EAM A;  2FDR A;  4J9P A;  3SQI A;  9ICA A;  4KLI A;  4OD0 A;  2I1Q A;  2E8N A;  1HJP A;  4I29 A;  2LYA A;  2W11 A;  3C2L A;  2PFQ A;  1PK1 A;  5AK4 A;  5KNI A;  4RQ0 A;  5L1L A;  2DGZ A;  2HCF A;  3SAF A;  3GII A;  2W9C B;  2KIW A;  3PST A;  1WWU A;  5KFV A;  4QW8 A;  3QUB A;  1A0P A;  1RQL A;  3TAD A;  1ZQY A;  4QWA A;  5A0L A;  2YMP A;  3RFA A;  4DLG A;  4RQM A;  2XGQ A;  1RZT A;  4E0D A;  2MA1 A;  3T5K A;  1SZP A;  1QLN A;  4F50 A;  8ICC A;  8ICR A;  9ICL A;  2ZIW A;  3GZF A;  3IRU A;  5AI9 A;  8ICW A;  1NK4 A;  4QZA A;  4Y2R A;  5DBA A;  4RQ1 A;  1HIW A;  3F2D A;  2YMQ A;  2XI9 A;  2XCA A;  4QZD A;  2NRX A;  4R66 A;  1SL2 A;  4KLG A;  1RG6 A;  5D49 A;  1Z4O A;  2O6K A;  4NLZ A;  3PVX A;  4EZ9 A;  2KP7 A;  4IRC A;  1RYR A;  4G3I A;  3RJJ A;  2NRV A;  3D2Q A;  2KKV A;  1A76 A;  5K4L A;  4GIB A;  1VLB A;  1FFV A;  1S0M A;  3JPQ A;  3GQC A;  3MR3 A;  1V9P A;  3RRG A;  4KX5 A;  1O08 A;  4YMM A;  4F72 A;  5J0S A;  2G0A A;  3BDP A;  4FS2 A;  1S0O A;  1LKY B;  5J0U A;  3BJY A;  2HMX A;  1KFT A;  1PZN A;  4JUZ A;  4P4P A;  3JPT A;  3KFU F;  4BGD A;  3ZDA A;  4QZF A;  1NI3 A;  2HBM A;  5KFM A;  8ICM A;  4ECU A;  3MC1 A;  3AN1 A;  3PW2 A;  5KG1 A;  5ALF A;  1ZQV A;  1L3S A;  4YXJ A;  5KFZ A;  3MAB A;  2FMQ A;  5AM3 A;  2JEJ A;  4KLT A;  2BCQ A;  5ALG A;  2XY7 A;  1ZQN A;  4KLJ A;  4UAY A;  4DSJ A;  4UW9 A;  2XIC A;  2HHS A;  2JR5 A;  3F5A A;  4OCZ A;  3T79 A;  3SZ2 A;  1NZP A;  4O5E A;  3C5G A;  8ICZ A;  5J2J A;  2AQ4 A;  2N1R A;  1ZJM A;  2QAR B;  4O0I A;  3BZC A;  2KHQ A;  4DQP A;  2BDU A;  4KTQ A;  4C0Z A;  3KD3 A;  1N63 A;  3RJF A;  5J0X A;  4LZD A;  2ZUC A;  4ED1 A;  5AHX A;  3BQ7 A;  3M1Y A;  5KFU A;  1XNS A;  3BS5 A;  5ALP A;  4QJF B;  1Z3E B;  1UCV A;  1TKD A;  1JIH A;  5EWF A;  1TV9 A;  1WWV A;  1ZJN A;  5KT2 A;  9ICP A;  2W9M A;  2EAO A;  3I76 A;  3RAX A;  4DCC A;  4B9T A;  5J8Y C;  1QTM A;  3HT3 A;  3R9K A;  4K4G A;  2R8I A;  4KLU A;  5ALD A;  4UB3 A;  3H4D A;  2LPE A;  2IMW P;  3OSP A;  1VDV A;  3M9N B;  2IA6 A;  3ETL A;  3PZP A;  1L6N A;  1NKC A;  4P0Q A;  7ICO A;  4QWB A;  4F4Z A;  4J9Q A;  2B21 A;  3GIK A;  1KBU A;  3MFH A;  4Y2S A;  4YMO A;  4YD1 A;  1GO3 F;  1U45 A;  1TK0 A;  4UB1 A;  1ZXI A;  3S6J A;  4C4S A;  4UQG A;  2H3F A;  4QZG A;  1KN5 A;  1K1Q A;  5C0Y A;  4OJ5 A;  4DQR A;  4DOB A;  3GV8 B;  4KX3 A;  4F5P A;  4ED3 A;  2RQ5 A;  4KLF A;  3PR4 A;  2WF9 A;  5T14 A;  2KMD A;  2FPL A;  1JXE A;  1L8O A;  2JEI A;  3KHH A;  4F5Q A;  2NRZ A;  1NK6 A;  5BOM A;  1PVR A;  4DFM A;  1BPD A;  1NK8 A;  4FZL A;  1NK0 A;  2WTF A;  1OW5 A;  2E8P A;  3CP8 A;  1KTQ A;  3C29 A;  5EE0 A;  4MFA A;  3H8M A;  1ZQJ A;  1UQV A;  2ODG A;  4PGY A;  1XSP A;  2KOB A;  2J6U A;  1SIJ A;  2KSO B;  1IV8 A;  4NL9 A;  3FC4 A;  5DBB A;  5HHI A;  2JRZ A;  4M47 A;  2LHT A;  5J2G A;  1IIP A;  2GLE A;  1S9F A;  8ICB A;  3JPS A;  2A1A A;  4DL6 A;  2HI0 A;  4TQS A;  1ZQM A;  4R64 A;  5ALK A;  1N2X A;  3ICX A;  1ZQF A;  5J2C A;  4C8L A;  3SV4 A;  5KFF A;  3F2B A;  3I1Y A;  2K60 A;  2EZY A;  4B9V A;  3B0Y A;  2LYB A;  5AKZ A;  4B6J A;  1ZQX A;  2QB0 B;  4ECQ A;  2D6F C;  3QU4 A;  4BXO A;  3HPO A;  5EE3 A;  3CRX A;  1A77 A;  5DB6 A;  1MC8 A;  1ZQT A;  1BPE A;  5ALN A;  4KLS A;  2G5I B;  1OUQ A;  4OJ6 A;  4ICA A;  1B22 A;  4U7C A;  4FFD A;  4Y2Q A;  1KRP A;  3QUC A;  2KK0 A;  3NVY A;  2FLL A;  3SYZ A;  1CUK A;  3HW8 A;  4AYB F;  4CF5 A;  4DQQ A;  3AU2 A;  4YG2 A;  1ZQG A;  9ICX A;  1RYS A;  2MSN A;  3ZDC A;  3OHB A;  1V85 A;  2AGP A;  1DOQ A;  1B4F A;  1QQ6 A;  2FPM A;  5KFJ A;  1ZD2 P;  3Q8M A;  5KG0 A;  2KZM A;  4UB2 A;  4J9K A;  3FM9 A;  1RXW A;  8ICP A;  5KG3 A;  4C8M A;  3F2C A;  2BKE A;  3FAH A;  4DF8 A;  7ICP A;  4NJ8 A;  2KSO A;  3M6K A;  5KT6 A;  4KN7 A;  5KFT A;  1PVQ A;  3N28 A;  3UPQ A;  2FE9 A;  4PHA A;  4RNM A;  2H3V A;  3PO4 A;  1YZ6 A;  4UAV A;  1XU4 A;  1MA7 A;  1T7P A;  9ICC A;  4ED8 A;  4DS4 A;  7ICN A;  1V97 A;  1V38 A;  3OPX A;  1WUD A;  5ALE A;  3ZDE A;  2NYV A;  2K4P A;  1Z1B A;  7ICV A;  2I6X A;  3D2S A;  4UBB A;  2BZF A;  4HAI A;  4MF8 A;  1X9W A;  5III A;  4TUQ A;  2G08 A;  3QEA Z;  2WF7 A;  3MFI A;  2BCV A;  1LB2 B;  4CCH A;  2GWS A;  3C2M A;  1JAL A;  1SL1 A;  3Q8Q B;  7ICF A;  5HR7 A;  9ICW A;  5KL1 B;  8ICG A;  3FYH A;  4J9S A;  2LMR A;  1S8O A;  4NLG A;  4ECY A;  3OGU A;  4DEZ A;  4UB4 A;  4M04 A;  8ICJ A;  4EBE A;  8ICV A;  2ZJA A;  1Q8K A;  1JMS A;  2DUY A;  1NNL A;  5ALY A;  5HHH A;  1TAQ A;  5J29 A;  1XO0 A;  3NGD A;  1T4G A;  4M2Y A;  3TAN A;  1KL9 A;  4O3N A;  2LM4 A;  3D2N A;  5KFO A;  1ZQA A;  2CRX A;  5KFE A;  2F1H A;  4PL2 A;  2EAN A;  2RHF A;  2LI6 A;  1YT3 A;  2PXI A;  5IIK A;  2DF4 B;  1ZQZ A;  5C5J A;  4OJP A;  1KFD A;  5DQG A;  1ZQU A;  5J0T A;  2DPJ A;  5AK3 A;  5CP2 A;  4QZ9 A;  2BCR A;  4M9H A;  4DQI A;  2FPK A;  2A1J B;  9ICI A;  2NV3 A;  4FS1 A;  4NLK A;  4ED6 A;  4B9M A;  2W04 A;  3RJI A;  1HUZ A;  5CR0 A;  3BZK A;  2XCP A;  1P7D A;  5AKE A;  1S76 D;  4QZC A;  3BQ2 A;  5D46 A;  2Y9T A;  4RQ3 A;  5L9X A;  4ECW A;  5KFR A;  2JXJ A;  3H7I A;  3RR7 A;  3CNH A;  3TFS A;  2KE7 A;  3L3F X;  3ORY A;  4HYK A;  4IR1 A;  2UVR A;  1BNO A;  2P35 A;  5DBC A;  1PVP A;  3TAD C;  4ZOH C;  1B43 A;  1SXE A;  1U48 A;  1X9M A;  2B0C A;  4WJ3 B;  3LWL A;  4LJX A;  1XC9 A;  1TK5 A;  2W9B B;  3OHA A;  4PL1 A;  2PI4 A;  4OJO A;  4NM2 A;  4B9N A;  3MGI A;  5G5G A;  4ED0 A;  5CRX A;  3SR6 A;  1BNP A;  4GC7 A;  2IOF K;  4DLE A;  7ICJ A;  5KG7 A;  1K1S A;  3FDS A;  4J03 A;  5DKW A;  3OJU A;  2WF5 A;  3NAS A;  4AP9 A;  3QZ7 A;  8ICQ A;  2W3R A;  1SB3 C;  4X5V A;  2F3N A;  4B9S A;  1M6Y A;  4O5K A;  1ZQP A;  2A19 A;  3B9J A;  2UVW A;  2HW3 A;  8ICY A;  4DL5 A;  1C7Y A;  1ED1 A;  1T8E A;  3RR8 A;  3NUQ A;  1U49 A;  3HJE A;  4FBU A;  4DSE A;  4I2G A;  1QSL A;  1BPZ A;  4Y2J A;  5ALI A;  3NVZ A;  1FO4 A;  5FP0 A;  3PSI A;  9ICR A;  2F1I A;  7ICH A;  5ALR A;  2MAX A;  3KHL A;  2A1J A;  2JH1 A;  3ISB A;  3RH4 A;  1NK9 A;  5DB7 A;  4CRX A;  5AI4 A;  2OM6 A;  2KV2 A;  2WFA A;  2VAN A;  2I9G A;  2BPG A;  2EH9 A;  2PMZ F;  5KL8 B;  1KEJ A;  3K1R B;  2E8M A;  2M9N A;  7ICT A;  3J81 j;  5J2K A;  4RU9 A;  4UAT A;  3UMB A;  1UT8 A;  3VC8 A;  1MQ2 A;  2VIX A;  4KLM A;  2KIC A;  5AKK A;  5HMM A;  9ICU A;  4DWI A;  3V72 A;  2JMG A;  2YY6 A;  1F0M A;  2IHN A;  4UB5 A;  3QZ8 A;  3IN5 A;  3QXG A;  4QWD A;  1Q3V A;  3AM9 A;  3O0F A;  4K4I A;  2AJQ A;  2OHF A;  2WAQ C;  4JV1 A;  2KEY A;  1ZQH A;  3IHQ B;  3G6X A;  3PW4 A;  2HBJ A;  4RT2 A;  2DL0 A;  2V9W A;  3M9O B;  3RF9 A;  5AKI A;  4KMU A;  3RTV A;  2E5S A;  3UQ2 A;  4DOA A;  3QU2 A;  4EX6 A;  3N97 B;  1SL0 A;  4PJ0 U;  3NVV A;  2ZIW B;  2KVC A;  3RB0 A;  4RZR A;  3RB4 A;  5HP4 A;  1CI4 A;  3WK8 A;  4ELV A;  1WYG A;  3ISD A;  4AYB C;  3F5E A;  1S5L U;  8ICI A;  4NM1 A;  4Y2Y A;  1KFS A;  1X2I A;  5KG5 A;  5KFG A;  4O3M A;  4U6P A;  4GXJ A;  3V6J A;  2HHW A;  4DSF A;  2AU0 A;  1JRO A;  3QX7 A;  3KKA A;  5ALV A;  2OXO A;  4JV2 A;  5ALT A;  4IQV A;  5DB9 A;  2YB4 A;  5EWG A;  2G07 A;  3DV9 A;  9ICF A;  5KFH A;  4CE6 A;  4MHV A;  1L3V A;  2Y1I A;  1FIQ A;  4RQ6 A;  4M6W B;  2IOF A;  4BWJ A;  2DPI A;  4ECZ A;  2IOH A;  1FEZ A;  4I2C A;  4KLO A;  5ALU A;  4RQ5 A;  1L7P A;  3F53 A;  5KAF U;  1QQ5 A;  1ZQK A;  5AIB A;  5KT5 A;  4IQT A;  2XGP A;  2ZIU A;  3E58 A;  2F1J A;  2P6R A;  5ALQ A;  3LDA A;  4IS7 A;  1U47 A;  4RQ2 A;  3RRH A;  2A3V A;  5J0Y A;  4DL4 A;  5AIC A;  5J2F A;  1S77 D;  1S0N A;  4M9G A;  4PZN A;  4GXI A; 
#chains in the Genus database with same CATH homology
 2F3N A;  2E8N A;  2KMD A;  3BS5 B;  1DXS A;  1V85 A;  2ESE A;  1PK1 A;  5KNI A;  3KKA C;  1B4F A;  1OXJ A;  2QB0 A;  5F3X B;  1SV4 A;  1WWU A;  4NL9 C;  4RQN A;  3BS7 A;  3TAD A;  5J8Y A;  1SV0 A;  2QAR B;  2EAN A;  1OW5 A;  1X66 A;  2D8C A;  4NJ8 A;  2Y9U A;  2KSO A;  2E8P A;  1SV0 C;  4RQM A;  3H8M A;  3HIL A;  2QAR A;  1UQV A;  2FE9 A;  3KKA A;  1X9X A;  1Z1V A;  2B6G A;  3BQ7 A;  5JTI A;  2KSO B;  3BS5 A;  3TAC B;  1V38 A;  1UCV A;  4NL9 A;  2KG5 A;  2F8K A;  5JU5 A;  3K1R B;  2E8M A;  1PK1 B;  1KW4 A;  1WWV A;  1RG6 A;  1LKY A;  2GLE A;  4PZO A;  2EAO A;  2K4P A;  4MHV A;  5J8Y C;  2EAP A;  1SGG A;  2L5Y A;  2Y9T A;  2K60 A;  1COK A;  1F0M A;  2LPE A;  2KE7 A;  2E8O A;  2F44 A;  2QB0 B;  5JRT A;  3TAD C;  1JI7 A;  3SEN A;  2QKQ A;  1SXE A;  2DKZ A;  2JV3 A;  1LKY B;  2KIV A;  3IDW A;  2DKX A;  1PK3 A;  2D3D A;  2QB1 A;  2EAM A;  2YTU A;  2ES6 A;  1X40 A;  2DL0 A;  4IS7 A;  2LMR A;  5L1M A;  3SEI A;  1SXD A;  4PZN A;  1B0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...