1V38A

Solution structure of the sterile alpha motif (sam) domain of mouse samsn1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
GSSGSSGRRENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAESLLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SAM-domain protein SAMSN-1
publication title Solution structure of the Sterile Alpha Motif (SAM) domain of mouse SAMSN1
rcsb
source organism Mus musculus
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1v38A00
2EAMA 1SXEA 5J8YC 1X66A 2F8KA 3BQ7A 3KKAA 4MHVA 1V85A 4PZNA 5JU5A 4NL9C 2D8CA 2B6GA 1SV0A 5JRTA 2LMRA 1PK1B 2EAOA 2QARB 2GLEA 5F3XB 1PK3A 2KSOB 5JTIA 2ESEA 2DKXA 3H8MA 1SGGA 1LKYA 2YTUA 1OW5A 1COKA 1OXJA 1B0XA 1V38A 2E8NA 3BS5B 1KW4A 2DL0A 2K4PA 3HILA 2ES6A 1F0MA 2QB0B 2L5YA 1WWVA 2DKZA 4RQNA 3TADA 2F44A 1DXSA 3KKAC 3SEIA 1B4FA 2Y9UA 1RG6A 1SV4A 2LPEA 1SV0C 2JV3A 1Z1VA 3TACB 1SXDA 3BS5A 5L1MA 2E8MA 1UCVA 2KG5A 1UQVA 5J8YA 2F3NA 4RQMA 5KNIA 2KIVA 2Y9TA 1X40A 1PK1A 2QARA 2KMDA 3BS7A 2KSOA 3IDWA 4NL9A 1LKYB 4PZOA 2QB1A 4IS7A 2EAPA 3K1RB 1WWUA 3TADC 2EANA 2E8OA 2K60A 2KE7A 2E8PA 4NJ8A 2QKQA 2D3DA 2FE9A 2QB0A 3SENA 1X9XA 1JI7A
chains in the Genus database with same CATH superfamily
9ICJA 2HOQA 5KT3A 3BZKA 4JV2A 4UAYA 1NOMA 4MF8A 1Z4OA 2ZIUA 4DLGA 1SWWA 3KKAA 3RH4A 4PZNA 4B9VA 2RRDA 3GIJA 3NUQA 1N5XA 4OJ6A 1KSPA 5F3XB 4KLSA 8ICWA 2F77X 1Q46A 2FMPA 4CNQA 2Y0SF 2XGQA 1FO4A 3N7SC 3RJEA 3LWLA 3CW2C 4UB6U 3H8SA 4MEXA 4OCZA 7ICUA 3HT3A 2XCAA 1B0XA 1UT5A 4LZDA 2G06A 2JRZA 1IG6A 3RJHA 4Y2XA 4IRCA 4B6JA 2I6XA 5KFNA 1ZQLA 1ZJMA 5AM5A 2AH5A 5AIBA 4F5NA 5HNKA 2CPRA 1SV4A 3H4BA 1NI3A 3QNMA 2W9BB 4RQ2A 5DQIA 1M6YA 1JXLA 5DQHA 2YN4A 3M9NB 7ICIA 2KZ3A 4F5RA 3QEAZ 3WKDA 2K4EA 1A76A 2EAPA 5EWEA 5A0LA 2HHTA 9ICKA 1WWUA 5KFKA 1X42A 4J9PA 4CCHA 1X9MA 2FPKA 2E8PA 2BPGA 2BCSA 2ZIVB 5AKJA 5J2KA 3TAPA 2FE9A 3N7RC 5AI4A 2KIWA 2XI9A 5KL1B 5KFOA 9ICSA 2HVIA 3PW7A 1V97A 1KL9A 3RJJA 4QWAA 2LYHA 8ICVA 2CXYA 3RAXA 2HBJA 2EAMA 2FDRA 3I1YA 1SZPA 3T5HA 4XA5A 3NVYA 2W9BA 1UHUA 7ICNA 2HW3A 4F91B 1RPLA 4BWMA 3M8RA 4I2HA 5HR6A 2XIDA 1ED1A 5IIMA 4IL6U 7ICGA 5DB8A 2A1JB 1EXNA 3SQIA 5KG2A 1XC9A 3C28A 3T5KA 3ALRA 5AICA 8ICOA 3J81j 3WK9A 3NTUA 4Y2VA 1NKCA 1JALA 1F0MA 5AI6A 3ZI4A 2ZIVA 4J9MA 4F5QA 3QYPA 3KKAC 3SEIA 2PMZF 4KLUA 4U7CA 4Q45A 4FO6A 2R18A 5DG7A 2EQYA 5G5GA 2HSZA 4NLZA 4RNMA 1L3SA 3QU5A 5KFRA 1L3TA 2JV3A 2ASJA 1U45A 2BCRA 4ECTA 3GU3A 3LVWA 5AM3A 4B9TA 5KFSA 1NK8A 2Y9TA 4KLOA 1KBUA 5IIIA 2OXOA 5CJ7A 3GQCA 4ACOA 4KX5A 3PSFA 3B9JA 2A1JA 1ZYQA 4TUQA 1SL2A 5HMMA 3RB6A 2EANA 2C2DA 3FC4A 1RM6C 4QW8A 1RQNA 1SWVA 1JX4A 4FFDA 2XCPA 3SENA 8ICUA 1J97A 4NV0A 2LYAA 3RBEA 2KHVA 2WAQC 4C4TA 4YD1A 4XQ8A 3UQ2A 4BX9C 1TAQA 2DBYA 3H4DA 4F3OA 2XVTA 4F2SA 2B21A 5JRTA 1NK5A 5DDYA 2YB1A 7ICKA 2YY6A 3RB0A 4PL2A 1TK5A 3RAQA 4ZOHC 1QSYA 3ORYA 5ALXA 5T14A 9ICBA 5AM1A 4M0AA 5AKIA 4DFMA 2VIXA 4YXJA 3NVWA 1T4GA 3UM9A 1V38A 4GLXA 3D2SA 1Z00A 2DQNB 3PMNA 5DG9A 1VJ5A 4AP9A 4C8OA 1SIJA 3PW2A 2P66A 9ICOA 4YVZA 4X5VA 3N28A 4XRHA 5DBAA 1ZQ1C 2PFNA 3LVVA 3AU2A 1O03A 2VKQA 3QUQA 1CRXA 5DB9A 3PX4A 4PHPA 5KAIU 1IXRA 9ICPA 7ICHA 5HP4A 5KG7A 2IBKA 3RF9A 3SD7A 4RQ4A 4HAIA 1HEKA 2H3ZA 4CF4A 2JR5A 3MC1A 2MAXA 4EEYA 5ALOA 5KG0A 1KQQA 2W3SA 4IS7A 1X9WA 1SB3C 2C2EA 1RXVA 1JROA 3I28A 2KE7A 2RP5A 2C22A 4GFJA 4J9SA 3ZDDA 8ICJA 5KFQA 3EUB2 4DL7A 1JIHA 3AQFA 4KLGA 4TQRA 1KDHA 2GH1A 5KT4A 1ZQOA 4ELTA 5GTIU 5J2EA 4DFPA 4QZGA 2HOIA 4ED1A 5J0UA 1YZ6A 2ZJ8A 4MF2A 3D6JA 3PR4A 3F5AA 1ZQQA 2NRZA 4NXZA 1TAUA 5J2AA 2QARB 2GLEA 4I2AA 3RH5A 2AHOB 2H3IA 2ESEA 3V7LA 4YQWA 3WK4A 1UA0A 7ICVA 4B9UA 1S8OA 3GV5B 4M9NA 4RPYA 2MA1A 1V9PA 5ALRA 2Y1JA 3AEVA 4NLBA 9ICIA 2K4PA 4EELA 4KLQA 9ICEA 4CGZA 1CEZA 1TE2A 8ICFA 4NY8A 1S0VA 2HI0A 3PV8A 4I28A 2BCQA 4NLKA 2W8LA 3C2LA 4B9NA 2ZJAA 2W7OA 3PZPA 3T5LA 3SV3A 5C0YA 1HUOA 4NWIA 3JPSA 7ICFA 3TFSA 4JMUA 3PNCA 4A8EA 4US8A 5ALKA 2VA8A 2BKEA 5ALTA 5EE9A 3QXGA 4YFKA 5KFHA 3PX6A 1ZQBA 4ED8A 2QARA 3RJFA 4RQ3A 1S9FA 1ZOLA 2W54A 4BDPA 4PZOA 3UMGA 1B22A 1N60A 5J0WA 4JUZA 2EH9A 8ICQA 2PI4A 5AK6A 1TKDA 4TUSA 4QWDA 1ZQSA 2P6RA 4F92B 2CRXA 4MFFA 3C23A 5ALQA 3NASA 5AI0A 3UXNA 2IOHA 2WAQF 8ICMA 3V6HA 5ALNA 5J2GA 4RNNA 3CNHA 4EBCA 2VJ4A 4KLJA 5BOMA 2ZIWB 4KLHA 2NV3A 5J2IA 1BNOA 1N56A 1H38A 5KFPA 3SI8A 1ZD4A 4NLGA 3PO4A 4QZIA 2WF8A 3LWMA 1ZQUA 2OEHA 3E58A 3OJUA 3PMLA 3K75D 3RB3A 1KFSA 5KG3A 2IMWP 4CE6A 4CF3A 2PXIA 2LI6A 3KTQA 4KN7A 4OJLA 5CB1A 2NRWA 1U4BA 2OYYA 5EE1A 2W55A 1ZRNA 2P35A 1VDVA 2WF9A 4NLCA 5ALZA 5IIJA 2OCEA 4ELUA 4Z6CA 1KRPA 2XY7A 3C1ZA 1UPHA 4HYKA 2K8AA 2LM4A 4P4PA 3BS5A 4EENA 1Z4NA 1IIPA 2ZIWA 5J2DA 2G09A 7ICLA 3NRZA 5AIAA 4RQMA 4PH5A 4IR1A 1PZNA 4UB3A 3PR5B 3MR6A 2QLTA 4DWIA 3F53A 3UXPA 1HUZA 5ALIA 3C29A 5K4LA 4ECSA 3MDCA 4DL6A 4FZNA 2PMZC 4CF5A 4J03A 4QZ8A 4IQVA 3ETRA 3RRHA 3KHGA 3K4GA 2RQ5A 3TAQA 3ONNA 1QQ5A 2KKPA 5F9LA 4G3IA 4Y2RA 4TQSA 2XC9A 5AK5A 4R64A 4EEKA 1BGXT 5ALWA 2R8KA 1IM4A 4OD0A 4DFDA 1L3UA 1V85A 3C5GA 5DLFA 2YMPA 4PGXA 4TURA 2D8CA 2KFNA 2KOBA 5HMLA 4C8LA 4I2IA 9ICUA 3WK8A 2PFOA 1TAMA 7ICJA 1L6NA 8ICKA 4F4WA 4DSKA 4RQ1A 3ISDA 1K5OA 4M47A 1ZQGA 2R8GA 5EWGA 4K4GA 4P2HA 2MUTB 2KP7A 3RJIA 4DS4A 1QSSA 4RQ7A 2BQRA 3KHHA 3CP8A 2DUYA 2ZTEA 1ZQTA 3TACB 4DQPA 1XSPA 1SXDA 5ALUA 3JPPA 4BGDA 4MFCA 2E8MA 2KG5A 1UQVA 2JGAA 5AK3A 5AKZA 2HBKA 4F93B 1BPYA 5BPCA 2RLTA 2HHVA 5CR0A 4R63A 5L1LA 3RRGA 9ICRA 2KV2A 1N61A 2AQ0A 1LVHA 3T3FA 2VANA 4DEZA 1AQ6A 3ISBA 2IHMA 2KFZA 1DK3A 3GZFA 4ECXA 2FLNA 1BPDA 4O0IA 3QUCA 7ICOA 4I2JA 4F8RA 4UB5A 4C4RA 3C5FA 3HX0A 4KITB 2DPJA 4FS1A 1NK7A 1JUDA 8ICIA 2ODGA 2MUTA 2KK0A 1DGSA 1T3QA 1KN5A 5JUMA 4RZRA 1XO1A 4QZCA 2G07A 5KFCA 5J2FA 3B0XA 3RB4A 1ZQKA 2I9GA 1AROP 2HHWA 3NVZA 5KFUA 3L4PA 4ED0A 4DOBA 4BXOA 3A0BU 4ED7A 4I2DA 5AKLA 3SV4A 1FFUA 2HBMA 2H3FA 2NRTA 4RUCA 1FIQA 4B9LA 3ISCA 4M9JA 3GIMA 3ZDBA 2PFQA 3AM9A 2E8NA 3NGDA 4ED3A 1RYRA 1RDFA 4UAZA 3F5EA 4AYBF 4YR3A 2F76X 2Y9UA 2BR0A 5ALHA 3ZDEA 2HHUA 4UB4A 5J2BA 1L7NA 2ZG6A 4UB2A 1Z1VA 2KHQA 2NRXA 1TFRA 3S6JA 3U26A 3TFRA 4M2YA 1WUDA 1L8OA 2YMQA 5KG4A 3QU7A 4PJ0U 3IN5A 3SAFA 4Y2SA 1U9LA 2XICA 1T3NA 2M9NA 3M6KA 5J2CA 1F5SA 5DG8A 4PHDA 2K4IA 3FYHA 2JH1A 5J2HA 1ZRMA 4QZBA 2QKQA 4KLLA 3V6JA 1ZXIA 2GO7A 1JI7A 2W7PA 2UVWA 4WJ3B 2OH2A 3C1YA 1WCLA 1TVAA 1S97A 4C8NA 4Z6DA 4RPZA 4ECYA 3H8JA 3OHAA 4I2EA 2LM1A 1Z00B 3PSIA 4DO9A 3G6XA 2G5HB 3QU4A 2EAOA 3AQEA 4DSIA 2AGPA 3V7JA 3KFUF 3KZIU 4ECWA 5AKEA 1U47A 3Q8SB 4I29A 2KEYA 2YMMA 4NLNA 8ICBA 5KT2A 8ICXA 3EWAA 2UVRA 3HW8A 4Y2QA 5KT7A 1KLNA 5D49A 4UBCA 3R9KA 2DKZA 3MFHA 4RQ0A 5J0YA 3WU2U 2JXJA 1SL1A 3QX7A 7ICQA 3SAGA 5AM0A 3V72A 1L8LA 8ICTA 1NJZA 2YQEA 1YZ7A 1JMSA 3FM9A 5DB6A 1XSLA 5IIOA 2E5SA 1KKXA 1MQ2A 2ZUBA 4OJOA 3Q8RB 2AXTU 1IV8A 3BS7A 2PKEA 1QQ6A 3H0RB 5L1JA 1Z1BA 2K8CB 4QW9A 1ZQZA 4ELVA 1MC8A 2AQ4A 4DL4A 5ALSA 1ZQVA 3HPOA 5KFXA 3WKEA 7ICTA 4F2RA 4KLDA 4QZ9A 2MSNA 5CHGA 1XU4A 3RR8A 4FBTA 9ICAA 1ZJNA 4UB8U 3C2KA 2KZZA 3LDAA 5L1KA 4YD2A 2FMQA 3M9MB 4YCXA 9ICQA 3WK5A 5KG5A 3SYZA 5J2JA 2F2AB 1GO3F 1PK1B 3AMZA 4QZFA 4F72A 2EZZA 5KFIA 3HP6A 2DKXA 5DKWA 4NM2A 2HHQA 2KVSA 5D46A 5ALJA 3QZ8A 1NJYA 3QU2A 1X2IA 9ICCA 3GILA 3Q8QB 4PHEA 2JZBB 3PSPA 4QWEA 3E2EA 4UASA 1NK0A 4QIWF 5ALLA 1S76D 3HILA 2QB0B 3G6VA 2Z7JA 4TUPA 1QQ7A 2KJ8A 3ZD8A 2ZUCA 5BOLA 4F4YA 4DQSA 4Q44A 3KOOA 2E3TA 1BPBA 1NZPA 2F1IA 1NJWA 2ALZA 3F2CA 2BGWA 4USAA 3HKZF 4I2BA 2GWSA 1ECWA 3PSTA 3GV7B 2J6TA 1PK1A 1ZD3A 4ECZA 2BZFA 5D4BA 4Y2JA 3IDWA 4NL9A 2CN1A 2IA6A 2ZIXB 1S5LU 4Y2PA 3IHQB 5EOZA 5J0XA 2WFAA 4GXKA 5G5HA 2K60A 1XWLA 2JZBA 3C21A 1L3VA 2D3DA 1MSWD 4KLMA 1C7YA 1XS9D 2QB0A 5CEHA 4DF4A 1ZQJA 2NRVA 4B9SA 2ZTDA 5EWFA 3TARA 3PW4A 2F8KA 2P6UA 4MHVA 8ICZA 1QLNA 4MEYA 3OHBA 5JU5A 3M1YA 4FS2A 7ICPA 5ALGA 4M04A 4KLFA 3E0FA 4P4MA 4PHAA 4ECVA 1T8EA 4JV1A 2LMRA 1PK3A 3N7PD 5JTIA 3AL0B 4LVSA 4YP3A 3RJGA 3Q8PB 2F1HA 2YTUA 5AM2A 1JRPA 1ZQEA 4O3SA 2ZIXA 3ZDAA 1X9SA 4RUAA 4IC9A 3BS5B 3IG8A 3F2DA 9ICNA 3Q8KA 3HRDD 3GDXA 1FFVA 3VC8A 2KD1A 3T5JA 2K89A 5DQGA 8ICCA 4EX7A 5AKKA 5AM4A 4PGYA 3MABA 1L5UA 1UA1A 1L7PA 2H5XA 4M6WB 2KICA 3F2BA 2MRLA 3MFIA 3NRWA 5J8YA 2AGOA 3EPIA 3MGHA 4DL5A 4C8MA 2JMGA 3OJSA 2Y1IA 7ICMA 4DSEA 8ICLA 5IILA 2QB1A 2DFLA 4AYBC 5EE3A 1HJPA 1NZBA 2V4RA 2KJ5A 3PO5A 2BHNA 2GOLA 5ALFA 3SZ2A 4IQUA 2AU0A 4NJ8A 4QJFB 1D8BA 3JPQA 4XUSA 4GXIA 3A0HU 3B0YA 3PY8A 5KFMA 2BDUA 2K4HA 1PVPA 7ICSA 3BJYA 3OSNA 1S0NA 2FMSA 4PGQA 3BQ7A 1Z3EB 4M6WA 2IOFK 4E0DA 3WKAA 3M9OB 4NL9C 2HOFA 1KFDA 4BJQA 4DS5A 2HCFA 5AI9A 1UT8A 5F9NA 4KLTA 3IG5A 3QE9Y 5FP0A 1CI4A 1OW5A 5KFWA 1N48A 4OJ5A 2HHSA 5KFFA 1ZQPA 2F8LA 5ALEA 2ES6A 4F71A 2MU2A 4O3RA 4DCCA 5J0OA 1B4FA 2F1JA 5L9XA 2WB1C 2E1FA 1DRGA 2WHEA 5E79U 5DBBA 4GIBA 3WK7A 5DDMA 2K8BB 1ZETA 3DV9A 4IRDA 5ALDA 4M9GA 5KNIA 1K1QA 1RQLA 4LJXA 3IV6A 4QZEA 4Y2TA 2HVHA 3M6ZA 3K1RB 1T94A 3C2MA 4DOCA 2KTQA 4O9MA 2IOFA 4O3OA 5B5EU 1N5WA 2VJ5A 2OM6A 4R8UB 4YN4A 2J6SA 2WF7A 4CRXA 9ICWA 5H2FU 3PW0A 5KFAA 5AKYA 1SZHA 1X9XA 4DL2A 4BXOB 3ED5A 3FDSA 4KMUA 1DGJA 1C20A 5J29A 9ICTA 5J8YC 3KZXA 4C7YA 1X66A 8ICSA 1JN3A 3L3FX 4P0PB 2AJQA 5KFYA 4OO1J 2E1EA 4F50A 3BQ0A 4PL1A 2FLPA 2EDUA 3HWTA 1ZQXA 2BCUA 3KHLA 3QEBZ 1MN8A 4K4IA 3G6YA 3SMVA 3H8MA 8ICGA 1X6JA 2JHDA 3RTVA 1COKA 2ZJ5A 3I76A 2WF5A 4J9OA 4R8UA 4EZ9A 2L5YA 3GV8B 9ICLA 2F44A 1DXSA 4JK1A 2DWQA 2HDOA 4EYIB 4O3NA 2LPEA 1K1SA 4R65A 4IRKA 4BUGA 3UXOA 5HHHA 2ZUDA 1NK9A 4P0PA 2FJ6A 3JPTA 5AHXA 2F3NA 9ICXA 2W9AA 1URJA 3BQTA 2LHTA 4C0ZA 1X40A 1WG8A 2W03A 4QIWC 3MR2A 1QSLA 1LKYB 1ZQWA 7ICEA 2NO4A 2W8KA 5ALPA 1Q3UA 4YR2A 5KG1A 5GTHU 4IQWA 1T7PA 2Q0ZX 2EZYA 2FPLA 4J9LA 4DSFA 1OUQA 4DQRA 4UQGA 4O3PA 2ISOA 4ZH4A 4KX3A 5DB7A 4EZ6A 4LZGA 1KTQA 2ASDA 1S0MA 5KFTA 1KFTA 1B43A 3EW9A 3HKZC 3VCBA 2C2RA 4O5KA 3H8WA 4YG2A 4O5CA 3MR3A 3N97B 2YB4A 3UMCA 3ICXA 3UPQA 3OTQA 3KHRA 1SV0A 8ICAA 1MA7A 5TISU 2RDJA 2KSOB 4UARA 2UVUA 5KFVA 2JEFA 1Y88A 4F5OA 2B0CA 2BCVA 3GIKA 3IP4B 1LKYA 3NVVA 4J9NA 2HMXA 1A6SA 1KEJA 3V6KA 1WCNA 5DBCA 4EBDA 4DFKA 1ZQDA 2ZXIA 1NNLA 4C8KA 5HR7A 5J0TA 2HHXA 2A1AA 9ICGA 2G08A 5CA7A 1FEZA 2WB1F 5AKHA 1QTMA 3H7IA 1NKEA 3LYSA 2ZTCA 5AKXA 9ICVA 2DPIA 3SR6A 2UVVA 3GIIA 1HIWA 3CYMA 4I27A 3KBBA 5KT6A 3WKBA 4R66A 4YXMA 2J6UA 5ALVA 3EPGA 4QZHA 1UCVA 1WYGA 2FLLA 4JV0A 3TI0A 1QCKA 2JH7A 3EZ5A 9ICFA 2KIVA 5J0SA 2KMDA 4GC6A 1LV5A 3PW5A 2KSOA 4C80A 2RDIA 4US9A 2BQUA 1COOA 3H0LB 3QU9A 1ZQIA 5KFEA 2BPCA 2XY5A 1RYSA 2LKYA 4KTQA 2O6KA 2YMLA 1F44A 4RPXA 5B66U 5KFDA 4RQ8A 3MR5A 4YR0A 3RFAA 1JXEA 4F4XA 1CUKA 3BZCA 5J0QA 2H3VA 4O5EA 3MGVA 2KZMA 4UAUA 3OPXA 2JEJA 5IINA 4ECQA 2A3VA 2W3RA 8ICEA 2KNJA 2VA3A 2JEIA 9ICHA 4Q43A 1RZTA 1ZQMA 2IHNA 2XY6A 3WK6A 3PX0A 3D2QA 4U6PA 1XO0A 4OJPA 4RT2A 2W04A 2LBOA 3UQ0A 1NKBA 3TADA 4Q8FA 1D8YA 2G5IB 1J2MA 3DEEA 4QWCA 4ED6A 4C4SA 1RG6A 5IIKA 3EYZA 3CRXA 4UB1A 2KKVA 4DSJA 5CP2A 2W43A 1SV0C 3HJEA 4QZDA 1RYUA 2I5HA 3PVXA 1BPXA 3MGIA 8ICHA 5L1IA 4K4HA 4DFJA 4CDGA 4EYHB 2ASLA 1BNPA 1N63A 1N2XA 3UMBA 4UBBA 1YT3A 8ICPA 2KN7A 5KTQA 4DOAA 1MQ3A 4O3MA 3T79A 1U49A 1ZQYA 2V4QA 4NM1A 5AI5A 2DGZA 5KFZA 2E8OA 2C28A 2Q4TA 1TK0A 1RXWA 2VA2A 1ZD2P 4JWNA 4I2GA 2PFPA 2DF4B 4YMNA 3NS1A 2FPMA 3TQ1A 4I2CA 2W11A 4DQIA 4GXJA 1SXEA 4DQQA 1ZQCA 4Z6EA 4Z6FA 4Y2YA 1N62A 4RU9A 1Z19A 4RT3A 4DLEA 2NO5A 1NK4A 3BDPA 5KFBA 1BVSA 8ICYA 4RQ6A 1BPEA 1ZQFA 4RNOA 5TZVA 2BPFA 2EZXA 3H0MB 4O3QA 2XO7A 3TKAA 1A77A 2LYBA 4UATA 5J0PA 1D8LA 2Y0SC 5CWRA 3QZ7A 1A0PA 3O0FA 2ZXHA 3IM1A 5KFJA 4C7ZA 2DL0A 1QH9A 1ZQAA 2R8HA 4ED2A 4DL3A 5J0RA 1S77D 2H3QA 5C5JA 4DSLA 1WWVA 4KMOB 4RQNA 4G9BA 4P4OA 1XSNA 4FZLA 2KJ9A 2ISPA 2WF6A 4J9QA 1NK6A 1D9FA 2V9WA 5KG6A 4F4ZA 4GC7A 1S10A 4UW9A 4F5PA 1L7MA 4IQTA 4Y2UA 5DGAA 1X6IA 1ZQRA 1J2NA 4MFAA 3JPOA 4QZAA 4YMOA 4B9MA 4J9RA 4KLEA 5CRXA 3K1ZA 4ECRA 3ZD9A 3RH6A 2OWOA 4Q8EA 3FAHA 3QUBA 3WKCA 4I2FA 3ETLA 3OSPA 1D9DA 4YMMA 3TADC 4QNLA 1P7DA 4DF8A 5KAFU 1ZQHA 1ZQNA 3N4MB 1NJXA 1PVQA 1U48A 8ICRA 1TK8A 4EBEA 3DDHA 4JWMA 1SKSA 1VLBA 4EX6A 2AGQA 4ICAA 3RJKA 2XGPA 1Q8KA 2NYVA 4ECUA 5DLGA 3Q8LA 3MBYA 4KLIA 2YX8A 4F4KA 2B6GA 3H40A 9ICMA 2R8IA 4QWBA 3ZDCA 3M7DA 4PPXA 2PI5A 2G0AA 1L7OA 5ALYA 1SKWA 2OHFA 2D6FC 5AKGA 2I1QA 1SGGA 4KN4A 8ICNA 3SAHA 1OXJA 1SKRA 1ZD5A 2M0NA 3M8SA 5AI8A 1KW4A 1DK2A 4FZMA 1LB2B 3Q8MA 4M9HA 2N1RA 3L5KA 4JB3A 4RQ5A 2W9CB 4P0QB 2RHFA 5EE0A 3QUTA 1PUZA 3JPNA 5HHIA 3THVA 4FE3A 4M9LA 4IR9A 5KL8B 3V7KA 3AUOA 3IRUA 1PVRA 2ZIUB 3AU6A 1S0OA 1XNSA 2BDPA 4UAWA 1O08A 3BQ1A 5L1MA 3BQ2A 5KFLA 1DOQA 3TANA 3KD3A 5AK4A 5DGBA 4UAVA 1SL0A 2KVCA 3D2NA 1BPZA 5ALMA 2FI1A 3JPRA 4BWJA 5KFGA 2BQ3A 2JEGA 2W9MA 3LK9A 2WTFA 3AN1A 3MDAA 3RR7A 3OGUA 5KT5A 2ATLA 2A19A 1TV9A 4J9KA 2R8JA 3RBDA 2W9CA 4P0QA 2HBLA 7ICRA 4FBUA 3GFKB 1Q3VA
chains in the Genus database with same CATH topology
2EAMA 1SXEA 5J8YC 1X66A 2F8KA 3BQ7A 3KKAA 4MHVA 1V85A 4PZNA 5JU5A 4NL9C 2D8CA 2B6GA 1SV0A 5JRTA 2LMRA 1PK1B 2EAOA 2QARB 2GLEA 5F3XB 1PK3A 2KSOB 5JTIA 2ESEA 2DKXA 3H8MA 1SGGA 1LKYA 2YTUA 1OW5A 1COKA 1OXJA 1B0XA 1V38A 2E8NA 3BS5B 1KW4A 2DL0A 2K4PA 3HILA 2ES6A 1F0MA 2QB0B 2L5YA 1WWVA 2DKZA 4RQNA 3TADA 2F44A 1DXSA 3KKAC 3SEIA 1B4FA 2Y9UA 1RG6A 1SV4A 2LPEA 1SV0C 2JV3A 1Z1VA 3TACB 1SXDA 3BS5A 5L1MA 2E8MA 1UCVA 2KG5A 1UQVA 5J8YA 2F3NA 4RQMA 5KNIA 2KIVA 2Y9TA 1X40A 1PK1A 2QARA 2KMDA 3BS7A 2KSOA 3IDWA 4NL9A 1LKYB 4PZOA 2QB1A 4IS7A 2EAPA 3K1RB 1WWUA 3TADC 2EANA 2E8OA 2K60A 2KE7A 2E8PA 4NJ8A 2QKQA 2D3DA 2FE9A 2QB0A 3SENA 1X9XA 1JI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAM A;  1SXE A;  5J8Y C;  1X66 A;  2F8K A;  3BQ7 A;  3KKA A;  4MHV A;  1V85 A;  4PZN A;  5JU5 A;  4NL9 C;  2D8C A;  2B6G A;  1SV0 A;  5JRT A;  2LMR A;  1PK1 B;  2EAO A;  2QAR B;  2GLE A;  5F3X B;  1PK3 A;  2KSO B;  5JTI A;  2ESE A;  2DKX A;  3H8M A;  1SGG A;  1LKY A;  2YTU A;  1OW5 A;  1COK A;  1OXJ A;  1B0X A;  1V38 A;  2E8N A;  3BS5 B;  1KW4 A;  2DL0 A;  2K4P A;  3HIL A;  2ES6 A;  1F0M A;  2QB0 B;  2L5Y A;  1WWV A;  2DKZ A;  4RQN A;  3TAD A;  2F44 A;  1DXS A;  3KKA C;  3SEI A;  1B4F A;  2Y9U A;  1RG6 A;  1SV4 A;  2LPE A;  1SV0 C;  2JV3 A;  1Z1V A;  3TAC B;  1SXD A;  3BS5 A;  5L1M A;  2E8M A;  1UCV A;  2KG5 A;  1UQV A;  5J8Y A;  2F3N A;  4RQM A;  5KNI A;  2KIV A;  2Y9T A;  1X40 A;  1PK1 A;  2QAR A;  2KMD A;  3BS7 A;  2KSO A;  3IDW A;  4NL9 A;  1LKY B;  4PZO A;  2QB1 A;  4IS7 A;  2EAP A;  3K1R B;  1WWU A;  3TAD C;  2EAN A;  2E8O A;  2K60 A;  2KE7 A;  2E8P A;  4NJ8 A;  2QKQ A;  2D3D A;  2FE9 A;  2QB0 A;  3SEN A;  1X9X A;  1JI7 A; 
#chains in the Genus database with same CATH topology
 9ICJ A;  2HOQ A;  5KT3 A;  3BZK A;  4JV2 A;  4UAY A;  1NOM A;  4MF8 A;  1Z4O A;  2ZIU A;  4DLG A;  1SWW A;  3KKA A;  3RH4 A;  4PZN A;  4B9V A;  2RRD A;  3GIJ A;  3NUQ A;  1N5X A;  4OJ6 A;  1KSP A;  5F3X B;  4KLS A;  8ICW A;  2F77 X;  1Q46 A;  2FMP A;  4CNQ A;  2Y0S F;  2XGQ A;  1FO4 A;  3N7S C;  3RJE A;  3LWL A;  3CW2 C;  4UB6 U;  3H8S A;  4MEX A;  4OCZ A;  7ICU A;  3HT3 A;  2XCA A;  1B0X A;  1UT5 A;  4LZD A;  2G06 A;  2JRZ A;  1IG6 A;  3RJH A;  4Y2X A;  4IRC A;  4B6J A;  2I6X A;  5KFN A;  1ZQL A;  1ZJM A;  5AM5 A;  2AH5 A;  5AIB A;  4F5N A;  5HNK A;  2CPR A;  1SV4 A;  3H4B A;  1NI3 A;  3QNM A;  2W9B B;  4RQ2 A;  5DQI A;  1M6Y A;  1JXL A;  5DQH A;  2YN4 A;  3M9N B;  7ICI A;  2KZ3 A;  4F5R A;  3QEA Z;  3WKD A;  2K4E A;  1A76 A;  2EAP A;  5EWE A;  5A0L A;  2HHT A;  9ICK A;  1WWU A;  5KFK A;  1X42 A;  4J9P A;  4CCH A;  1X9M A;  2FPK A;  2E8P A;  2BPG A;  2BCS A;  2ZIV B;  5AKJ A;  5J2K A;  3TAP A;  2FE9 A;  3N7R C;  5AI4 A;  2KIW A;  2XI9 A;  5KL1 B;  5KFO A;  9ICS A;  2HVI A;  3PW7 A;  1V97 A;  1KL9 A;  3RJJ A;  4QWA A;  2LYH A;  8ICV A;  2CXY A;  3RAX A;  2HBJ A;  2EAM A;  2FDR A;  3I1Y A;  1SZP A;  3T5H A;  4XA5 A;  3NVY A;  2W9B A;  1UHU A;  7ICN A;  2HW3 A;  4F91 B;  1RPL A;  4BWM A;  3M8R A;  4I2H A;  5HR6 A;  2XID A;  1ED1 A;  5IIM A;  4IL6 U;  7ICG A;  5DB8 A;  2A1J B;  1EXN A;  3SQI A;  5KG2 A;  1XC9 A;  3C28 A;  3T5K A;  3ALR A;  5AIC A;  8ICO A;  3J81 j;  3WK9 A;  3NTU A;  4Y2V A;  1NKC A;  1JAL A;  1F0M A;  5AI6 A;  3ZI4 A;  2ZIV A;  4J9M A;  4F5Q A;  3QYP A;  3KKA C;  3SEI A;  2PMZ F;  4KLU A;  4U7C A;  4Q45 A;  4FO6 A;  2R18 A;  5DG7 A;  2EQY A;  5G5G A;  2HSZ A;  4NLZ A;  4RNM A;  1L3S A;  3QU5 A;  5KFR A;  1L3T A;  2JV3 A;  2ASJ A;  1U45 A;  2BCR A;  4ECT A;  3GU3 A;  3LVW A;  5AM3 A;  4B9T A;  5KFS A;  1NK8 A;  2Y9T A;  4KLO A;  1KBU A;  5III A;  2OXO A;  5CJ7 A;  3GQC A;  4ACO A;  4KX5 A;  3PSF A;  3B9J A;  2A1J A;  1ZYQ A;  4TUQ A;  1SL2 A;  5HMM A;  3RB6 A;  2EAN A;  2C2D A;  3FC4 A;  1RM6 C;  4QW8 A;  1RQN A;  1SWV A;  1JX4 A;  4FFD A;  2XCP A;  3SEN A;  8ICU A;  1J97 A;  4NV0 A;  2LYA A;  3RBE A;  2KHV A;  2WAQ C;  4C4T A;  4YD1 A;  4XQ8 A;  3UQ2 A;  4BX9 C;  1TAQ A;  2DBY A;  3H4D A;  4F3O A;  2XVT A;  4F2S A;  2B21 A;  5JRT A;  1NK5 A;  5DDY A;  2YB1 A;  7ICK A;  2YY6 A;  3RB0 A;  4PL2 A;  1TK5 A;  3RAQ A;  4ZOH C;  1QSY A;  3ORY A;  5ALX A;  5T14 A;  9ICB A;  5AM1 A;  4M0A A;  5AKI A;  4DFM A;  2VIX A;  4YXJ A;  3NVW A;  1T4G A;  3UM9 A;  1V38 A;  4GLX A;  3D2S A;  1Z00 A;  2DQN B;  3PMN A;  5DG9 A;  1VJ5 A;  4AP9 A;  4C8O A;  1SIJ A;  3PW2 A;  2P66 A;  9ICO A;  4YVZ A;  4X5V A;  3N28 A;  4XRH A;  5DBA A;  1ZQ1 C;  2PFN A;  3LVV A;  3AU2 A;  1O03 A;  2VKQ A;  3QUQ A;  1CRX A;  5DB9 A;  3PX4 A;  4PHP A;  5KAI U;  1IXR A;  9ICP A;  7ICH A;  5HP4 A;  5KG7 A;  2IBK A;  3RF9 A;  3SD7 A;  4RQ4 A;  4HAI A;  1HEK A;  2H3Z A;  4CF4 A;  2JR5 A;  3MC1 A;  2MAX A;  4EEY A;  5ALO A;  5KG0 A;  1KQQ A;  2W3S A;  4IS7 A;  1X9W A;  1SB3 C;  2C2E A;  1RXV A;  1JRO A;  3I28 A;  2KE7 A;  2RP5 A;  2C22 A;  4GFJ A;  4J9S A;  3ZDD A;  8ICJ A;  5KFQ A;  3EUB 2;  4DL7 A;  1JIH A;  3AQF A;  4KLG A;  4TQR A;  1KDH A;  2GH1 A;  5KT4 A;  1ZQO A;  4ELT A;  5GTI U;  5J2E A;  4DFP A;  4QZG A;  2HOI A;  4ED1 A;  5J0U A;  1YZ6 A;  2ZJ8 A;  4MF2 A;  3D6J A;  3PR4 A;  3F5A A;  1ZQQ A;  2NRZ A;  4NXZ A;  1TAU A;  5J2A A;  2QAR B;  2GLE A;  4I2A A;  3RH5 A;  2AHO B;  2H3I A;  2ESE A;  3V7L A;  4YQW A;  3WK4 A;  1UA0 A;  7ICV A;  4B9U A;  1S8O A;  3GV5 B;  4M9N A;  4RPY A;  2MA1 A;  1V9P A;  5ALR A;  2Y1J A;  3AEV A;  4NLB A;  9ICI A;  2K4P A;  4EEL A;  4KLQ A;  9ICE A;  4CGZ A;  1CEZ A;  1TE2 A;  8ICF A;  4NY8 A;  1S0V A;  2HI0 A;  3PV8 A;  4I28 A;  2BCQ A;  4NLK A;  2W8L A;  3C2L A;  4B9N A;  2ZJA A;  2W7O A;  3PZP A;  3T5L A;  3SV3 A;  5C0Y A;  1HUO A;  4NWI A;  3JPS A;  7ICF A;  3TFS A;  4JMU A;  3PNC A;  4A8E A;  4US8 A;  5ALK A;  2VA8 A;  2BKE A;  5ALT A;  5EE9 A;  3QXG A;  4YFK A;  5KFH A;  3PX6 A;  1ZQB A;  4ED8 A;  2QAR A;  3RJF A;  4RQ3 A;  1S9F A;  1ZOL A;  2W54 A;  4BDP A;  4PZO A;  3UMG A;  1B22 A;  1N60 A;  5J0W A;  4JUZ A;  2EH9 A;  8ICQ A;  2PI4 A;  5AK6 A;  1TKD A;  4TUS A;  4QWD A;  1ZQS A;  2P6R A;  4F92 B;  2CRX A;  4MFF A;  3C23 A;  5ALQ A;  3NAS A;  5AI0 A;  3UXN A;  2IOH A;  2WAQ F;  8ICM A;  3V6H A;  5ALN A;  5J2G A;  4RNN A;  3CNH A;  4EBC A;  2VJ4 A;  4KLJ A;  5BOM A;  2ZIW B;  4KLH A;  2NV3 A;  5J2I A;  1BNO A;  1N56 A;  1H38 A;  5KFP A;  3SI8 A;  1ZD4 A;  4NLG A;  3PO4 A;  4QZI A;  2WF8 A;  3LWM A;  1ZQU A;  2OEH A;  3E58 A;  3OJU A;  3PML A;  3K75 D;  3RB3 A;  1KFS A;  5KG3 A;  2IMW P;  4CE6 A;  4CF3 A;  2PXI A;  2LI6 A;  3KTQ A;  4KN7 A;  4OJL A;  5CB1 A;  2NRW A;  1U4B A;  2OYY A;  5EE1 A;  2W55 A;  1ZRN A;  2P35 A;  1VDV A;  2WF9 A;  4NLC A;  5ALZ A;  5IIJ A;  2OCE A;  4ELU A;  4Z6C A;  1KRP A;  2XY7 A;  3C1Z A;  1UPH A;  4HYK A;  2K8A A;  2LM4 A;  4P4P A;  3BS5 A;  4EEN A;  1Z4N A;  1IIP A;  2ZIW A;  5J2D A;  2G09 A;  7ICL A;  3NRZ A;  5AIA A;  4RQM A;  4PH5 A;  4IR1 A;  1PZN A;  4UB3 A;  3PR5 B;  3MR6 A;  2QLT A;  4DWI A;  3F53 A;  3UXP A;  1HUZ A;  5ALI A;  3C29 A;  5K4L A;  4ECS A;  3MDC A;  4DL6 A;  4FZN A;  2PMZ C;  4CF5 A;  4J03 A;  4QZ8 A;  4IQV A;  3ETR A;  3RRH A;  3KHG A;  3K4G A;  2RQ5 A;  3TAQ A;  3ONN A;  1QQ5 A;  2KKP A;  5F9L A;  4G3I A;  4Y2R A;  4TQS A;  2XC9 A;  5AK5 A;  4R64 A;  4EEK A;  1BGX T;  5ALW A;  2R8K A;  1IM4 A;  4OD0 A;  4DFD A;  1L3U A;  1V85 A;  3C5G A;  5DLF A;  2YMP A;  4PGX A;  4TUR A;  2D8C A;  2KFN A;  2KOB A;  5HML A;  4C8L A;  4I2I A;  9ICU A;  3WK8 A;  2PFO A;  1TAM A;  7ICJ A;  1L6N A;  8ICK A;  4F4W A;  4DSK A;  4RQ1 A;  3ISD A;  1K5O A;  4M47 A;  1ZQG A;  2R8G A;  5EWG A;  4K4G A;  4P2H A;  2MUT B;  2KP7 A;  3RJI A;  4DS4 A;  1QSS A;  4RQ7 A;  2BQR A;  3KHH A;  3CP8 A;  2DUY A;  2ZTE A;  1ZQT A;  3TAC B;  4DQP A;  1XSP A;  1SXD A;  5ALU A;  3JPP A;  4BGD A;  4MFC A;  2E8M A;  2KG5 A;  1UQV A;  2JGA A;  5AK3 A;  5AKZ A;  2HBK A;  4F93 B;  1BPY A;  5BPC A;  2RLT A;  2HHV A;  5CR0 A;  4R63 A;  5L1L A;  3RRG A;  9ICR A;  2KV2 A;  1N61 A;  2AQ0 A;  1LVH A;  3T3F A;  2VAN A;  4DEZ A;  1AQ6 A;  3ISB A;  2IHM A;  2KFZ A;  1DK3 A;  3GZF A;  4ECX A;  2FLN A;  1BPD A;  4O0I A;  3QUC A;  7ICO A;  4I2J A;  4F8R A;  4UB5 A;  4C4R A;  3C5F A;  3HX0 A;  4KIT B;  2DPJ A;  4FS1 A;  1NK7 A;  1JUD A;  8ICI A;  2ODG A;  2MUT A;  2KK0 A;  1DGS A;  1T3Q A;  1KN5 A;  5JUM A;  4RZR A;  1XO1 A;  4QZC A;  2G07 A;  5KFC A;  5J2F A;  3B0X A;  3RB4 A;  1ZQK A;  2I9G A;  1ARO P;  2HHW A;  3NVZ A;  5KFU A;  3L4P A;  4ED0 A;  4DOB A;  4BXO A;  3A0B U;  4ED7 A;  4I2D A;  5AKL A;  3SV4 A;  1FFU A;  2HBM A;  2H3F A;  2NRT A;  4RUC A;  1FIQ A;  4B9L A;  3ISC A;  4M9J A;  3GIM A;  3ZDB A;  2PFQ A;  3AM9 A;  2E8N A;  3NGD A;  4ED3 A;  1RYR A;  1RDF A;  4UAZ A;  3F5E A;  4AYB F;  4YR3 A;  2F76 X;  2Y9U A;  2BR0 A;  5ALH A;  3ZDE A;  2HHU A;  4UB4 A;  5J2B A;  1L7N A;  2ZG6 A;  4UB2 A;  1Z1V A;  2KHQ A;  2NRX A;  1TFR A;  3S6J A;  3U26 A;  3TFR A;  4M2Y A;  1WUD A;  1L8O A;  2YMQ A;  5KG4 A;  3QU7 A;  4PJ0 U;  3IN5 A;  3SAF A;  4Y2S A;  1U9L A;  2XIC A;  1T3N A;  2M9N A;  3M6K A;  5J2C A;  1F5S A;  5DG8 A;  4PHD A;  2K4I A;  3FYH A;  2JH1 A;  5J2H A;  1ZRM A;  4QZB A;  2QKQ A;  4KLL A;  3V6J A;  1ZXI A;  2GO7 A;  1JI7 A;  2W7P A;  2UVW A;  4WJ3 B;  2OH2 A;  3C1Y A;  1WCL A;  1TVA A;  1S97 A;  4C8N A;  4Z6D A;  4RPZ A;  4ECY A;  3H8J A;  3OHA A;  4I2E A;  2LM1 A;  1Z00 B;  3PSI A;  4DO9 A;  3G6X A;  2G5H B;  3QU4 A;  2EAO A;  3AQE A;  4DSI A;  2AGP A;  3V7J A;  3KFU F;  3KZI U;  4ECW A;  5AKE A;  1U47 A;  3Q8S B;  4I29 A;  2KEY A;  2YMM A;  4NLN A;  8ICB A;  5KT2 A;  8ICX A;  3EWA A;  2UVR A;  3HW8 A;  4Y2Q A;  5KT7 A;  1KLN A;  5D49 A;  4UBC A;  3R9K A;  2DKZ A;  3MFH A;  4RQ0 A;  5J0Y A;  3WU2 U;  2JXJ A;  1SL1 A;  3QX7 A;  7ICQ A;  3SAG A;  5AM0 A;  3V72 A;  1L8L A;  8ICT A;  1NJZ A;  2YQE A;  1YZ7 A;  1JMS A;  3FM9 A;  5DB6 A;  1XSL A;  5IIO A;  2E5S A;  1KKX A;  1MQ2 A;  2ZUB A;  4OJO A;  3Q8R B;  2AXT U;  1IV8 A;  3BS7 A;  2PKE A;  1QQ6 A;  3H0R B;  5L1J A;  1Z1B A;  2K8C B;  4QW9 A;  1ZQZ A;  4ELV A;  1MC8 A;  2AQ4 A;  4DL4 A;  5ALS A;  1ZQV A;  3HPO A;  5KFX A;  3WKE A;  7ICT A;  4F2R A;  4KLD A;  4QZ9 A;  2MSN A;  5CHG A;  1XU4 A;  3RR8 A;  4FBT A;  9ICA A;  1ZJN A;  4UB8 U;  3C2K A;  2KZZ A;  3LDA A;  5L1K A;  4YD2 A;  2FMQ A;  3M9M B;  4YCX A;  9ICQ A;  3WK5 A;  5KG5 A;  3SYZ A;  5J2J A;  2F2A B;  1GO3 F;  1PK1 B;  3AMZ A;  4QZF A;  4F72 A;  2EZZ A;  5KFI A;  3HP6 A;  2DKX A;  5DKW A;  4NM2 A;  2HHQ A;  2KVS A;  5D46 A;  5ALJ A;  3QZ8 A;  1NJY A;  3QU2 A;  1X2I A;  9ICC A;  3GIL A;  3Q8Q B;  4PHE A;  2JZB B;  3PSP A;  4QWE A;  3E2E A;  4UAS A;  1NK0 A;  4QIW F;  5ALL A;  1S76 D;  3HIL A;  2QB0 B;  3G6V A;  2Z7J A;  4TUP A;  1QQ7 A;  2KJ8 A;  3ZD8 A;  2ZUC A;  5BOL A;  4F4Y A;  4DQS A;  4Q44 A;  3KOO A;  2E3T A;  1BPB A;  1NZP A;  2F1I A;  1NJW A;  2ALZ A;  3F2C A;  2BGW A;  4USA A;  3HKZ F;  4I2B A;  2GWS A;  1ECW A;  3PST A;  3GV7 B;  2J6T A;  1PK1 A;  1ZD3 A;  4ECZ A;  2BZF A;  5D4B A;  4Y2J A;  3IDW A;  4NL9 A;  2CN1 A;  2IA6 A;  2ZIX B;  1S5L U;  4Y2P A;  3IHQ B;  5EOZ A;  5J0X A;  2WFA A;  4GXK A;  5G5H A;  2K60 A;  1XWL A;  2JZB A;  3C21 A;  1L3V A;  2D3D A;  1MSW D;  4KLM A;  1C7Y A;  1XS9 D;  2QB0 A;  5CEH A;  4DF4 A;  1ZQJ A;  2NRV A;  4B9S A;  2ZTD A;  5EWF A;  3TAR A;  3PW4 A;  2F8K A;  2P6U A;  4MHV A;  8ICZ A;  1QLN A;  4MEY A;  3OHB A;  5JU5 A;  3M1Y A;  4FS2 A;  7ICP A;  5ALG A;  4M04 A;  4KLF A;  3E0F A;  4P4M A;  4PHA A;  4ECV A;  1T8E A;  4JV1 A;  2LMR A;  1PK3 A;  3N7P D;  5JTI A;  3AL0 B;  4LVS A;  4YP3 A;  3RJG A;  3Q8P B;  2F1H A;  2YTU A;  5AM2 A;  1JRP A;  1ZQE A;  4O3S A;  2ZIX A;  3ZDA A;  1X9S A;  4RUA A;  4IC9 A;  3BS5 B;  3IG8 A;  3F2D A;  9ICN A;  3Q8K A;  3HRD D;  3GDX A;  1FFV A;  3VC8 A;  2KD1 A;  3T5J A;  2K89 A;  5DQG A;  8ICC A;  4EX7 A;  5AKK A;  5AM4 A;  4PGY A;  3MAB A;  1L5U A;  1UA1 A;  1L7P A;  2H5X A;  4M6W B;  2KIC A;  3F2B A;  2MRL A;  3MFI A;  3NRW A;  5J8Y A;  2AGO A;  3EPI A;  3MGH A;  4DL5 A;  4C8M A;  2JMG A;  3OJS A;  2Y1I A;  7ICM A;  4DSE A;  8ICL A;  5IIL A;  2QB1 A;  2DFL A;  4AYB C;  5EE3 A;  1HJP A;  1NZB A;  2V4R A;  2KJ5 A;  3PO5 A;  2BHN A;  2GOL A;  5ALF A;  3SZ2 A;  4IQU A;  2AU0 A;  4NJ8 A;  4QJF B;  1D8B A;  3JPQ A;  4XUS A;  4GXI A;  3A0H U;  3B0Y A;  3PY8 A;  5KFM A;  2BDU A;  2K4H A;  1PVP A;  7ICS A;  3BJY A;  3OSN A;  1S0N A;  2FMS A;  4PGQ A;  3BQ7 A;  1Z3E B;  4M6W A;  2IOF K;  4E0D A;  3WKA A;  3M9O B;  4NL9 C;  2HOF A;  1KFD A;  4BJQ A;  4DS5 A;  2HCF A;  5AI9 A;  1UT8 A;  5F9N A;  4KLT A;  3IG5 A;  3QE9 Y;  5FP0 A;  1CI4 A;  1OW5 A;  5KFW A;  1N48 A;  4OJ5 A;  2HHS A;  5KFF A;  1ZQP A;  2F8L A;  5ALE A;  2ES6 A;  4F71 A;  2MU2 A;  4O3R A;  4DCC A;  5J0O A;  1B4F A;  2F1J A;  5L9X A;  2WB1 C;  2E1F A;  1DRG A;  2WHE A;  5E79 U;  5DBB A;  4GIB A;  3WK7 A;  5DDM A;  2K8B B;  1ZET A;  3DV9 A;  4IRD A;  5ALD A;  4M9G A;  5KNI A;  1K1Q A;  1RQL A;  4LJX A;  3IV6 A;  4QZE A;  4Y2T A;  2HVH A;  3M6Z A;  3K1R B;  1T94 A;  3C2M A;  4DOC A;  2KTQ A;  4O9M A;  2IOF A;  4O3O A;  5B5E U;  1N5W A;  2VJ5 A;  2OM6 A;  4R8U B;  4YN4 A;  2J6S A;  2WF7 A;  4CRX A;  9ICW A;  5H2F U;  3PW0 A;  5KFA A;  5AKY A;  1SZH A;  1X9X A;  4DL2 A;  4BXO B;  3ED5 A;  3FDS A;  4KMU A;  1DGJ A;  1C20 A;  5J29 A;  9ICT A;  5J8Y C;  3KZX A;  4C7Y A;  1X66 A;  8ICS A;  1JN3 A;  3L3F X;  4P0P B;  2AJQ A;  5KFY A;  4OO1 J;  2E1E A;  4F50 A;  3BQ0 A;  4PL1 A;  2FLP A;  2EDU A;  3HWT A;  1ZQX A;  2BCU A;  3KHL A;  3QEB Z;  1MN8 A;  4K4I A;  3G6Y A;  3SMV A;  3H8M A;  8ICG A;  1X6J A;  2JHD A;  3RTV A;  1COK A;  2ZJ5 A;  3I76 A;  2WF5 A;  4J9O A;  4R8U A;  4EZ9 A;  2L5Y A;  3GV8 B;  9ICL A;  2F44 A;  1DXS A;  4JK1 A;  2DWQ A;  2HDO A;  4EYI B;  4O3N A;  2LPE A;  1K1S A;  4R65 A;  4IRK A;  4BUG A;  3UXO A;  5HHH A;  2ZUD A;  1NK9 A;  4P0P A;  2FJ6 A;  3JPT A;  5AHX A;  2F3N A;  9ICX A;  2W9A A;  1URJ A;  3BQT A;  2LHT A;  4C0Z A;  1X40 A;  1WG8 A;  2W03 A;  4QIW C;  3MR2 A;  1QSL A;  1LKY B;  1ZQW A;  7ICE A;  2NO4 A;  2W8K A;  5ALP A;  1Q3U A;  4YR2 A;  5KG1 A;  5GTH U;  4IQW A;  1T7P A;  2Q0Z X;  2EZY A;  2FPL A;  4J9L A;  4DSF A;  1OUQ A;  4DQR A;  4UQG A;  4O3P A;  2ISO A;  4ZH4 A;  4KX3 A;  5DB7 A;  4EZ6 A;  4LZG A;  1KTQ A;  2ASD A;  1S0M A;  5KFT A;  1KFT A;  1B43 A;  3EW9 A;  3HKZ C;  3VCB A;  2C2R A;  4O5K A;  3H8W A;  4YG2 A;  4O5C A;  3MR3 A;  3N97 B;  2YB4 A;  3UMC A;  3ICX A;  3UPQ A;  3OTQ A;  3KHR A;  1SV0 A;  8ICA A;  1MA7 A;  5TIS U;  2RDJ A;  2KSO B;  4UAR A;  2UVU A;  5KFV A;  2JEF A;  1Y88 A;  4F5O A;  2B0C A;  2BCV A;  3GIK A;  3IP4 B;  1LKY A;  3NVV A;  4J9N A;  2HMX A;  1A6S A;  1KEJ A;  3V6K A;  1WCN A;  5DBC A;  4EBD A;  4DFK A;  1ZQD A;  2ZXI A;  1NNL A;  4C8K A;  5HR7 A;  5J0T A;  2HHX A;  2A1A A;  9ICG A;  2G08 A;  5CA7 A;  1FEZ A;  2WB1 F;  5AKH A;  1QTM A;  3H7I A;  1NKE A;  3LYS A;  2ZTC A;  5AKX A;  9ICV A;  2DPI A;  3SR6 A;  2UVV A;  3GII A;  1HIW A;  3CYM A;  4I27 A;  3KBB A;  5KT6 A;  3WKB A;  4R66 A;  4YXM A;  2J6U A;  5ALV A;  3EPG A;  4QZH A;  1UCV A;  1WYG A;  2FLL A;  4JV0 A;  3TI0 A;  1QCK A;  2JH7 A;  3EZ5 A;  9ICF A;  2KIV A;  5J0S A;  2KMD A;  4GC6 A;  1LV5 A;  3PW5 A;  2KSO A;  4C80 A;  2RDI A;  4US9 A;  2BQU A;  1COO A;  3H0L B;  3QU9 A;  1ZQI A;  5KFE A;  2BPC A;  2XY5 A;  1RYS A;  2LKY A;  4KTQ A;  2O6K A;  2YML A;  1F44 A;  4RPX A;  5B66 U;  5KFD A;  4RQ8 A;  3MR5 A;  4YR0 A;  3RFA A;  1JXE A;  4F4X A;  1CUK A;  3BZC A;  5J0Q A;  2H3V A;  4O5E A;  3MGV A;  2KZM A;  4UAU A;  3OPX A;  2JEJ A;  5IIN A;  4ECQ A;  2A3V A;  2W3R A;  8ICE A;  2KNJ A;  2VA3 A;  2JEI A;  9ICH A;  4Q43 A;  1RZT A;  1ZQM A;  2IHN A;  2XY6 A;  3WK6 A;  3PX0 A;  3D2Q A;  4U6P A;  1XO0 A;  4OJP A;  4RT2 A;  2W04 A;  2LBO A;  3UQ0 A;  1NKB A;  3TAD A;  4Q8F A;  1D8Y A;  2G5I B;  1J2M A;  3DEE A;  4QWC A;  4ED6 A;  4C4S A;  1RG6 A;  5IIK A;  3EYZ A;  3CRX A;  4UB1 A;  2KKV A;  4DSJ A;  5CP2 A;  2W43 A;  1SV0 C;  3HJE A;  4QZD A;  1RYU A;  2I5H A;  3PVX A;  1BPX A;  3MGI A;  8ICH A;  5L1I A;  4K4H A;  4DFJ A;  4CDG A;  4EYH B;  2ASL A;  1BNP A;  1N63 A;  1N2X A;  3UMB A;  4UBB A;  1YT3 A;  8ICP A;  2KN7 A;  5KTQ A;  4DOA A;  1MQ3 A;  4O3M A;  3T79 A;  1U49 A;  1ZQY A;  2V4Q A;  4NM1 A;  5AI5 A;  2DGZ A;  5KFZ A;  2E8O A;  2C28 A;  2Q4T A;  1TK0 A;  1RXW A;  2VA2 A;  1ZD2 P;  4JWN A;  4I2G A;  2PFP A;  2DF4 B;  4YMN A;  3NS1 A;  2FPM A;  3TQ1 A;  4I2C A;  2W11 A;  4DQI A;  4GXJ A;  1SXE A;  4DQQ A;  1ZQC A;  4Z6E A;  4Z6F A;  4Y2Y A;  1N62 A;  4RU9 A;  1Z19 A;  4RT3 A;  4DLE A;  2NO5 A;  1NK4 A;  3BDP A;  5KFB A;  1BVS A;  8ICY A;  4RQ6 A;  1BPE A;  1ZQF A;  4RNO A;  5TZV A;  2BPF A;  2EZX A;  3H0M B;  4O3Q A;  2XO7 A;  3TKA A;  1A77 A;  2LYB A;  4UAT A;  5J0P A;  1D8L A;  2Y0S C;  5CWR A;  3QZ7 A;  1A0P A;  3O0F A;  2ZXH A;  3IM1 A;  5KFJ A;  4C7Z A;  2DL0 A;  1QH9 A;  1ZQA A;  2R8H A;  4ED2 A;  4DL3 A;  5J0R A;  1S77 D;  2H3Q A;  5C5J A;  4DSL A;  1WWV A;  4KMO B;  4RQN A;  4G9B A;  4P4O A;  1XSN A;  4FZL A;  2KJ9 A;  2ISP A;  2WF6 A;  4J9Q A;  1NK6 A;  1D9F A;  2V9W A;  5KG6 A;  4F4Z A;  4GC7 A;  1S10 A;  4UW9 A;  4F5P A;  1L7M A;  4IQT A;  4Y2U A;  5DGA A;  1X6I A;  1ZQR A;  1J2N A;  4MFA A;  3JPO A;  4QZA A;  4YMO A;  4B9M A;  4J9R A;  4KLE A;  5CRX A;  3K1Z A;  4ECR A;  3ZD9 A;  3RH6 A;  2OWO A;  4Q8E A;  3FAH A;  3QUB A;  3WKC A;  4I2F A;  3ETL A;  3OSP A;  1D9D A;  4YMM A;  3TAD C;  4QNL A;  1P7D A;  4DF8 A;  5KAF U;  1ZQH A;  1ZQN A;  3N4M B;  1NJX A;  1PVQ A;  1U48 A;  8ICR A;  1TK8 A;  4EBE A;  3DDH A;  4JWM A;  1SKS A;  1VLB A;  4EX6 A;  2AGQ A;  4ICA A;  3RJK A;  2XGP A;  1Q8K A;  2NYV A;  4ECU A;  5DLG A;  3Q8L A;  3MBY A;  4KLI A;  2YX8 A;  4F4K A;  2B6G A;  3H40 A;  9ICM A;  2R8I A;  4QWB A;  3ZDC A;  3M7D A;  4PPX A;  2PI5 A;  2G0A A;  1L7O A;  5ALY A;  1SKW A;  2OHF A;  2D6F C;  5AKG A;  2I1Q A;  1SGG A;  4KN4 A;  8ICN A;  3SAH A;  1OXJ A;  1SKR A;  1ZD5 A;  2M0N A;  3M8S A;  5AI8 A;  1KW4 A;  1DK2 A;  4FZM A;  1LB2 B;  3Q8M A;  4M9H A;  2N1R A;  3L5K A;  4JB3 A;  4RQ5 A;  2W9C B;  4P0Q B;  2RHF A;  5EE0 A;  3QUT A;  1PUZ A;  3JPN A;  5HHI A;  3THV A;  4FE3 A;  4M9L A;  4IR9 A;  5KL8 B;  3V7K A;  3AUO A;  3IRU A;  1PVR A;  2ZIU B;  3AU6 A;  1S0O A;  1XNS A;  2BDP A;  4UAW A;  1O08 A;  3BQ1 A;  5L1M A;  3BQ2 A;  5KFL A;  1DOQ A;  3TAN A;  3KD3 A;  5AK4 A;  5DGB A;  4UAV A;  1SL0 A;  2KVC A;  3D2N A;  1BPZ A;  5ALM A;  2FI1 A;  3JPR A;  4BWJ A;  5KFG A;  2BQ3 A;  2JEG A;  2W9M A;  3LK9 A;  2WTF A;  3AN1 A;  3MDA A;  3RR7 A;  3OGU A;  5KT5 A;  2ATL A;  2A19 A;  1TV9 A;  4J9K A;  2R8J A;  3RBD A;  2W9C A;  4P0Q A;  2HBL A;  7ICR A;  4FBU A;  3GFK B;  1Q3V A; 
#chains in the Genus database with same CATH homology
 2EAM A;  1SXE A;  5J8Y C;  1X66 A;  2F8K A;  3BQ7 A;  3KKA A;  4MHV A;  1V85 A;  4PZN A;  5JU5 A;  4NL9 C;  2D8C A;  2B6G A;  1SV0 A;  5JRT A;  2LMR A;  1PK1 B;  2EAO A;  2QAR B;  2GLE A;  5F3X B;  1PK3 A;  2KSO B;  5JTI A;  2ESE A;  2DKX A;  3H8M A;  1SGG A;  1LKY A;  2YTU A;  1OW5 A;  1COK A;  1OXJ A;  1B0X A;  1V38 A;  2E8N A;  3BS5 B;  1KW4 A;  2DL0 A;  2K4P A;  3HIL A;  2ES6 A;  1F0M A;  2QB0 B;  2L5Y A;  1WWV A;  2DKZ A;  4RQN A;  3TAD A;  2F44 A;  1DXS A;  3KKA C;  3SEI A;  1B4F A;  2Y9U A;  1RG6 A;  1SV4 A;  2LPE A;  1SV0 C;  2JV3 A;  1Z1V A;  3TAC B;  1SXD A;  3BS5 A;  5L1M A;  2E8M A;  1UCV A;  2KG5 A;  1UQV A;  5J8Y A;  2F3N A;  4RQM A;  5KNI A;  2KIV A;  2Y9T A;  1X40 A;  1PK1 A;  2QAR A;  2KMD A;  3BS7 A;  2KSO A;  3IDW A;  4NL9 A;  1LKY B;  4PZO A;  2QB1 A;  4IS7 A;  2EAP A;  3K1R B;  1WWU A;  3TAD C;  2EAN A;  2E8O A;  2K60 A;  2KE7 A;  2E8P A;  4NJ8 A;  2QKQ A;  2D3D A;  2FE9 A;  2QB0 A;  3SEN A;  1X9X A;  1JI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...