2KG5A

Nmr solution structure of arap3-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
HMAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILRLLQTGTEEGSLDPKSDSAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Arf-GAP, Rho-GAP domain, ANK repeat and PH domain-containing
publication title The Sam domain of the lipid phosphatase Ship2 adopts a common model to interact with Arap3-Sam and EphA2-Sam.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kg5A01
4NJ8A 2K60A 1V38A 2KSOB 3SENA 2QB0A 4IS7A 2B6GA 1SV4A 3TADA 1UQVA 3BS5A 3HILA 1OW5A 1B4FA 2EAPA 3SEIA 5JU5A 3K1RB 1X40A 1RG6A 2LPEA 1PK1B 4RQMA 1F0MA 2QB1A 5KNIA 2KSOA 1UCVA 4PZOA 1SGGA 2KIVA 2K4PA 1X9XA 3KKAC 5J8YC 4NL9C 2ESEA 2GLEA 2EAOA 2DL0A 2LMRA 2Y9UA 2KMDA 1Z1VA 2EAMA 1COKA 3BQ7A 2E8MA 1B0XA 3H8MA 2KE7A 1PK1A 2F3NA 2EANA 3KKAA 4MHVA 5J8YA 4NL9A 1WWVA 1PK3A 1V85A 1JI7A 2F44A 2QB0B 5F3XB 2DKZA 2QKQA 3IDWA 1LKYB 4PZNA 2KG5A 1X66A 2E8NA 3BS5B 3BS7A 2ES6A 2F8KA 5JRTA 1SXEA 1SV0C 2QARB 2YTUA 5JTIA 1OXJA 1DXSA 5L1MA 1LKYA 2D3DA 2E8PA 1WWUA 2Y9TA 2E8OA 3TACB 2DKXA 2L5YA 3TADC 1SV0A 2D8CA 2QARA 1SXDA 4RQNA 1KW4A 2JV3A 2FE9A
chains in the Genus database with same CATH superfamily
1NK6A 5AKIA 2MSNA 2VJ4A 5AICA 4C8MA 4UAWA 3N4MB 4I2JA 5T14A 1PVPA 2W9BB 2IA6A 2LYHA 4IS7A 1IM4A 1NZBA 3BZKA 4ED3A 4UBBA 4QZ8A 1T3NA 3RJHA 3WKEA 9ICPA 1N56A 3GIIA 2AJQA 1PZNA 1QQ7A 1ECWA 4F71A 2AH5A 1H38A 1F0MA 3RRGA 2V9WA 1T8EA 1NOMA 3LVVA 3NASA 4GXIA 4BXOB 1COOA 1Q46A 4NL9C 4GC7A 2F1IA 4IQVA 3BQ7A 4TURA 3QZ7A 4DWIA 2JEJA 2ZIWB 3ZDCA 3IN5A 2WTFA 2I1QA 2XY5A 1SWVA 4J9NA 4NL9A 1Y88A 1ZD4A 1ZQSA 2RDIA 5ALIA 5KAIU 2NO4A 2HHWA 8ICFA 1T94A 5KFYA 3G6YA 4AP9A 4RNNA 1B22A 2A1JB 2HHQA 3D2SA 4YMOA 2MAXA 4GFJA 4F92B 1ZQRA 7ICTA 2YTUA 2BR0A 1U4BA 2LBOA 1TFRA 3UMGA 7ICRA 4UATA 1NKBA 1BPZA 1K5OA 5HMLA 1BPDA 2HHXA 1NNLA 3PW4A 1ZJNA 8ICUA 5ALGA 3I1YA 8ICNA 3OGUA 2K4IA 1ZETA 3B9JA 2JV3A 1MC8A 4DOCA 4J9QA 4NJ8A 3PMNA 3KHLA 5KFAA 3V7JA 2W9MA 5J2GA 3NTUA 2B6GA 4DLGA 2BCUA 3H0MB 4ZH4A 2Y0SC 2PI4A 3IG5A 1L6NA 1NKCA 3D6JA 5FP0A 1A0PA 4KLHA 4KLUA 4EBCA 1ZXIA 1V9PA 1ZQNA 1LB2B 2PMZF 2JZBA 2N1RA 5AKKA 2PFOA 4PZOA 3V7LA 2CN1A 4QWBA 3MR6A 1RQNA 4DL6A 2YN4A 1KTQA 3QX7A 4Y2VA 3N7PD 4DCCA 3H0RB 3PSFA 2K89A 1N60A 5AIAA 4P0QA 2JMGA 4QZCA 4DFKA 4KLMA 4NLCA 2W03A 3ZD9A 4JV0A 2G08A 3QEBZ 3RR8A 4USAA 2EZYA 4NV0A 4RQ4A 1RXWA 2H3QA 2R18A 2NV3A 4PZNA 4FBTA 3UMCA 4R65A 4F72A 1TAMA 5ALZA 8ICVA 2K4EA 2DUYA 3QU9A 3BQ1A 2AGPA 4ECZA 1AROP 3JPTA 1BPEA 2WFAA 3RJFA 5AK4A 1NI3A 4O3NA 1LKYA 3MFHA 5D46A 3PSIA 1JMSA 1WWUA 4YXJA 1SL0A 1LV5A 1NK8A 2IHNA 3SAHA 2ZIUA 1L8OA 3WK7A 3FC4A 3C5FA 4J03A 3EZ5A 5ALYA 2KJ8A 4G3IA 3PX6A 3EYZA 4M9GA 2G5HB 1ZQYA 2BGWA 1SZHA 1XWLA 2W7OA 2KSOB 1Z00B 1SKWA 4DSIA 2C2EA 3M7DA 4CE6A 5EWGA 2CRXA 1CI4A 4I2DA 2LI6A 4Q44A 2RHFA 3UMBA 3HPOA 4UB3A 5KTQA 3UQ0A 2K8CB 4CF3A 1M6YA 1V97A 1NK7A 2BQ3A 4MFCA 2FPLA 1N2XA 3M8SA 3L3FX 2NRWA 3QZ8A 5A0LA 2NYVA 4Z6DA 4RT3A 1ZJMA 3C1YA 3JPOA 3ZDBA 5AI0A 4DS5A 2FMSA 4DQRA 2EANA 4DF8A 2OXOA 1RYSA 1K1QA 2B21A 4IL6U 2W11A 1RM6C 3ZDEA 2H5XA 3GIKA 4DOAA 3E58A 2W9CB 5F9NA 1XNSA 5KG1A 2DPJA 2C2RA 1KEJA 2I6XA 4JV1A 1S97A 4DL4A 2KJ5A 2HHUA 4RQ1A 1TK5A 1B43A 3SR6A 1QH9A 9ICIA 2JXJA 1HIWA 2VKQA 1BPXA 3MDCA 2BCVA 4ACOA 2BCQA 1KFSA 2A1AA 4IRCA 3CYMA 3WK8A 5CEHA 2W3SA 4UBCA 3KHGA 5DGAA 2E1FA 3GV5B 1C20A 4NLKA 1ZRNA 3AUOA 1L7NA 3SMVA 3DV9A 4P4OA 4XA5A 1Z1BA 1PVQA 4DL2A 3ED5A 3NVYA 4YR3A 4XUSA 5J29A 2VJ5A 2OEHA 4DS4A 4O3PA 1IV8A 5HHHA 2AQ0A 2WAQF 3CNHA 4GIBA 1ED1A 1N5WA 4YD2A 1UT8A 3MGIA 3ISCA 1U45A 5AM3A 4P0PA 2W9BA 2KP7A 4JV2A 1KLNA 2YMMA 2DBYA 2ZTDA 4M0AA 1TKDA 1ZQJA 3B0XA 2AXTU 5AI5A 2I9GA 2ODGA 3HRDD 4TQSA 2HBKA 3PW0A 3AU2A 2F3NA 4PHDA 3GDXA 2WF5A 1X42A 2KVSA 3IM1A 2ZIXA 5DQIA 3PNCA 5AKEA 2XY7A 2KZMA 1XS9D 1SKRA 4YQWA 3L5KA 1WWVA 3LWLA 5DG8A 4EX6A 1JRPA 3BQ2A 4C7YA 9ICEA 2ZIWA 1FFVA 3GFKB 2VANA 3FDSA 3RH6A 2W7PA 4PH5A 4ED2A 1SV0C 2QARB 3C21A 5ALTA 3J81j 5J0RA 2GH1A 3C2KA 3MFIA 2ZTCA 4KLOA 1ZQBA 2HHSA 1KFTA 5KFSA 2Q0ZX 3LYSA 5AM5A 4EX7A 3RBDA 3RB4A 3KOOA 1D9DA 2ZTEA 2A1JA 4UW9A 1N48A 3C2MA 2JH7A 2KKVA 1NK0A 3RF9A 3PW2A 1SV0A 5KFJA 4Q8FA 7ICPA 1L5UA 1NJWA 4B9SA 4DQPA 2FE9A 3TQ1A 3M9OB 4EYHB 2KNJA 4OJ6A 4Z6CA 4F4XA 3CRXA 2PFPA 1NKEA 5IILA 5AM4A 5K4LA 1YZ7A 4C8NA 1KBUA 5J0PA 3BS5A 3NVVA 5ALOA 4JUZA 1OW5A 4US8A 2BPGA 2BDUA 4R64A 2OWOA 4QZFA 5J2IA 3M1YA 1PK1B 4M9HA 4TUQA 2IOFA 1XU4A 5DB6A 4O5CA 2UVRA 3JPSA 4DFMA 3PVXA 1SL1A 4KLFA 2LKYA 2KK0A 4YR2A 3HWTA 5CP2A 5KFOA 4DSJA 4M9NA 4EEYA 2RP5A 4GXKA 2M0NA 1IG6A 1CRXA 4I2AA 2F2AB 1Z19A 4PHPA 2CPRA 1X9SA 1RQLA 1FFUA 5ALQA 1GO3F 1TK8A 5EE3A 3ZD8A 2F44A 2QB0B 4NXZA 3K75D 2R8HA 4F4YA 2W54A 1XSLA 5EWEA 2H3VA 1BVSA 4ECVA 5EOZA 5KFLA 3IHQB 3QE9Y 2F8LA 1XO0A 4F4ZA 8ICMA 2W8LA 5B5EU 4PL1A 5KG7A 4K4IA 1MSWD 4B9TA 2RDJA 3ONNA 9ICLA 2BCSA 4F3OA 2JEGA 2FPKA 1D8LA 4I2FA 3LWMA 2JEFA 5DBBA 3RRHA 1S0OA 3TADC 2K8BB 2BHNA 4M04A 1ZQTA 3C23A 3GU3A 1IXRA 5AKJA 3ZI4A 1AQ6A 1WUDA 3WK4A 2A3VA 1V38A 3OSNA 3QNMA 9ICGA 4YCXA 1N62A 1S76D 1BPYA 2UVVA 3TADA 4KLTA 3VCBA 5EE1A 1QQ6A 4KLLA 2HVHA 3RFAA 4MF2A 3QEAZ 3RB6A 4DSKA 1RG6A 1TVAA 2P35A 2LPEA 1XC9A 3A0BU 4Y2XA 2KSOA 2V4QA 4DF4A 1SL2A 1Z00A 2HOQA 4F5QA 4MFFA 1HUOA 2KIVA 3V72A 4KLGA 5IINA 3T3FA 2YMPA 5KFKA 4QZGA 3WK6A 2EAMA 1WG8A 4IQWA 9ICMA 2W43A 2OCEA 5HR7A 1FO4A 3IRUA 4O9MA 3QUBA 5ALPA 3UXOA 4DL3A 5ALDA 5J2FA 2ZUBA 3SD7A 4QZHA 3QXGA 4MHVA 2ASLA 4M9JA 2HBJA 5CJ7A 4YXMA 3C5GA 4YG2A 4GXJA 4FS2A 9ICRA 3AL0B 4O3MA 4I2GA 4M9LA 3IV6A 2WHEA 5HNKA 9ICBA 2Y0SF 2IBKA 3EWAA 4YD1A 4Y2UA 3QU5A 4O3QA 4QWAA 4E0DA 4F5NA 1JXLA 2F8KA 4J9RA 2R8IA 3V6HA 5BOLA 4CDGA 1X6IA 2BZFA 1ZQZA 5ALVA 1XSNA 2W9CA 1O08A 1TV9A 2KHVA 4ECYA 7ICLA 1NZPA 1BPBA 3T5LA 5DBAA 2R8JA 4A8EA 4UASA 1SXDA 3OPXA 3MGHA 3F5EA 3KTQA 3OJSA 3PX0A 9ICVA 2OYYA 4MEYA 5ALLA 3TKAA 8ICPA 7ICQA 2XVTA 3AU6A 4K4HA 1WCNA 3N7RC 3F53A 3S6JA 4NM2A 5TISU 4J9OA 1UCVA 4CNQA 4BWMA 4BUGA 1J97A 4RPXA 5KFHA 4YN4A 3UPQA 3KZIU 5C0YA 4GC6A 3RB0A 5AM0A 5AM2A 2KMDA 9ICXA 2JH1A 4DQQA 4J9KA 1URJA 9ICAA 1FIQA 3EW9A 5IIIA 4UB8U 4XQ8A 3PW5A 4CRXA 3CP8A 3WKAA 5G5GA 3WU2U 3HJEA 1KQQA 4B6JA 3TAQA 5AI9A 4KLQA 4M6WB 3BDPA 5AK6A 2KFNA 5KG2A 1LVHA 4YR0A 3SAGA 2M9NA 2ASDA 2FMQA 2HVIA 3GV7B 3OHBA 2XCAA 1VJ5A 2JHDA 5J2HA 5AM1A 1S9FA 1ZQVA 3H4DA 3ZDDA 2BPFA 2NRZA 4J9SA 4LZDA 2QARA 4ELTA 4O3SA 2FLPA 3C29A 1ZRMA 4FZLA 5KG0A 1J2MA 3QU7A 4DQIA 5J0OA 3QUQA 5J2EA 2K4HA 3RAQA 4ECTA 2ZJ8A 1RYUA 3RBEA 5ALJA 1D8YA 2BPCA 1U9LA 2G0AA 4J9PA 3RTVA 2IMWP 3RJGA 3D2QA 3HKZC 5E79U 5J8YC 4O0IA 2GLEA 3QYPA 5HR6A 3G6VA 2FDRA 2W55A 2YMLA 5GTIU 4QIWF 1F44A 3GQCA 5HP4A 4EENA 4IR1A 1ZQKA 3QUTA 1PK1A 2PMZC 5KG3A 4C0ZA 5J8YA 3GZFA 1QSLA 3PSPA 4AYBF 5J0YA 8ICQA 3SZ2A 4QZBA 2JRZA 4UB6U 2J6SA 4ELVA 2KJ9A 2OM6A 4UB2A 5CHGA 2UVUA 3PO5A 5KT6A 3V7KA 4PJ0U 1TK0A 4ECXA 9ICSA 2FPMA 4J9MA 2LYAA 4B9UA 4OO1J 2KFZA 1DXSA 4XRHA 5L1LA 4CF5A 1WYGA 4Z6FA 5KL8B 5IIMA 1ZQLA 5DB9A 3TFRA 1ZOLA 5C5JA 4RQ5A 4LJXA 2KN7A 2F77X 2ZIVA 2P6RA 5ALUA 1MQ3A 4FZNA 4I29A 4PGQA 1P7DA 4M2YA 3KZXA 3WKBA 2EH9A 4TUSA 3PX4A 2Q4TA 5KAFU 8ICOA 2O6KA 7ICNA 4F50A 3PMLA 3BJYA 2F76X 1TAUA 2AQ4A 4LVSA 5KT2A 4CF4A 3I76A 4F93B 4I2IA 4K4GA 2VA8A 4C4SA 1JXEA 1VLBA 2WB1C 1DRGA 1X9XA 4C4TA 1YZ6A 5AKLA 2LMRA 4B9VA 1Z1VA 2XO7A 4FBUA 3LDAA 5J0QA 2LM1A 3F2CA 3A0HU 2KZZA 3H8MA 4I28A 3N28A 4ZOHC 5J0TA 3Q8PB 1ZQEA 1DGSA 4HAIA 2KZ3A 3MGVA 1U47A 1XSPA 3PZPA 3ISDA 2C28A 1ZQGA 4C7ZA 5IIOA 4B9LA 2QKQA 3IDWA 4RQ3A 3HP6A 4KX5A 5J2JA 4EYIB 5ALXA 2KG5A 2VA2A 1T3QA 4X5VA 4R8UB 2G09A 2ASJA 4DOBA 1ZQFA 4F2SA 1ZD3A 2H3IA 2E1EA 3SV3A 3RJJA 3SI8A 4BXOA 4F8RA 4IR9A 4PPXA 5JUMA 4EBDA 3NRZA 3EPIA 1PUZA 4DSEA 4Q45A 2GO7A 5D49A 3ORYA 3NVZA 1Z3EB 1RXVA 1Q3UA 3EUB2 1QCKA 1T4GA 2W8KA 4KLSA 4RQNA 3BQTA 7ICMA 3SV4A 1HUZA 5CA7A 2A19A 1Q8KA 2ZJAA 3MR3A 3UQ2A 2AGOA 4CGZA 1NJYA 2LHTA 3UXPA 4FZMA 3GIJA 1BNPA 3PSTA 1UQVA 5B66U 1SIJA 4ECQA 3HW8A 3LK9A 3DDHA 5JU5A 1X40A 4OJOA 1S0MA 2DGZA 3PY8A 3LVWA 2AHOB 2D6FC 9ICOA 2YQEA 1BGXT 4BDPA 2KEYA 2F1JA 1ZQWA 2QLTA 2NRXA 2RLTA 1ZD2P 5AKHA 1L3UA 3WKCA 5HHIA 3AEVA 2WAQC 2EDUA 3NUQA 4ED6A 2PXIA 2XICA 4QZEA 3OTQA 2K8AA 1SKSA 5KG4A 4FE3A 3CW2C 4ECWA 4QZDA 1NJXA 2CXYA 4TQRA 4FFDA 3TANA 4KLDA 2AU0A 1KFDA 4BX9C 4F2RA 3NRWA 1WCLA 1NJZA 2I5HA 4DEZA 2ZXHA 3UM9A 2E8NA 5IIJA 4ED8A 3FM9A 4UARA 4I27A 1SXEA 4IC9A 8ICYA 3JPNA 4FO6A 1QQ5A 3ISBA 1MQ2A 5L1MA 1IIPA 5J0WA 3O0FA 3HT3A 4M6WA 7ICKA 3IP4B 3K1ZA 5DDMA 1NK5A 3TACB 2ZXIA 3Q8RB 3JPPA 4EELA 3PW7A 2HOIA 1N61A 5KFCA 2J6TA 4NLNA 9ICFA 3DEEA 3Q8MA 4O5EA 3ICXA 1L8LA 2HSZA 5AKYA 3HILA 4CCHA 2E5SA 1A77A 2ZJ5A 1S5LU 8ICWA 2WF7A 3V6JA 5J2CA 5KNIA 8ICEA 1JX4A 1L7OA 2KICA 2PI5A 4Y2QA 2R8KA 1JROA 3MC1A 1DK2A 3IG8A 4C8KA 2DL0A 3PR4A 2ZUDA 3C28A 1ZQIA 4RNOA 4JWNA 3H7IA 1TAQA 4UAYA 1SWWA 4QZ9A 2HCFA 2NRTA 2ZG6A 4WJ3B 5KG5A 3H8WA 5J2BA 3RJIA 7ICGA 4YMMA 4YFKA 5ALSA 3AN1A 5J0UA 1HEKA 2W3RA 2WF9A 2HMXA 5F3XB 1EXNA 1L3VA 3M6KA 4R63A 4OCZA 5HMMA 1JALA 2FLNA 9ICHA 9ICQA 2HOFA 2HW3A 4Y2JA 2W04A 4C8LA 1N5XA 3H0LB 2XC9A 5KFMA 5DQGA 4EEKA 5CRXA 4P0PB 8ICAA 8ICIA 3KD3A 2PFQA 1VDVA 5ALRA 4Y2TA 1ZQOA 3BQ0A 4F4KA 8ICHA 4PGYA 2E8OA 4QWEA 3Q8LA 2AGQA 1KW4A 8ICSA 5ALMA 3GV8B 1L7PA 4JMUA 2ZIXB 4PGXA 4P4PA 4RZRA 4UB5A 4OJ5A 1SV4A 4R66A 2KIWA 4FS1A 2V4RA 5KFUA 1B4FA 5TZVA 5KFXA 4C8OA 4DSFA 1DK3A 1U49A 4MEXA 1MA7A 5KG6A 4Y2PA 1KL9A 1SGGA 1S0NA 3SQIA 3WK5A 8ICRA 3QU4A 3MBYA 3ZDAA 4G9BA 4PHAA 2H3FA 4F5OA 2J6UA 5D4BA 4KN7A 3D2NA 9ICJA 1ZQHA 5CR0A 4B9MA 4ECSA 3PV8A 4MFAA 3ALRA 1SB3C 4QW9A 2FLLA 4ELUA 2YB1A 1ZQXA 1UT5A 1D8BA 4QJFB 4U7CA 3BZCA 9ICCA 3PO4A 1JI7A 2H3ZA 4IQTA 3RAXA 4I2BA 4F5PA 3GILA 3RJKA 5DLFA 3WKDA 4RPYA 3HX0A 4RQ2A 3TAPA 2C22A 7ICIA 2WF6A 5KT3A 2HBMA 3BS5B 3M8RA 5KFIA 3N97B 4NY8A 4MF8A 1ZQAA 1X2IA 8ICBA 4Y2SA 3HKZF 5DG9A 1KKXA 3F2DA 1S10A 3JPRA 4R8UA 5KFVA 3MR2A 2RQ5A 3H8SA 1Z4OA 4UB1A 4ED7A 3C2LA 2FI1A 1X9MA 3RH5A 7ICJA 5DBCA 3N7SC 1A76A 5DQHA 5L1KA 2BQRA 2IHMA 5DLGA 4UAVA 7ICVA 5DB7A 2IOHA 4KN4A 2IOFK 5EWFA 4ICAA 2XY6A 1Q3VA 5BOMA 5G5HA 1U48A 5AK3A 3TI0A 4NLBA 3M9NB 5L1JA 9ICKA 1ZQCA 3AQEA 2MUTB 4IRDA 1MN8A 4YP3A 1DOQA 4JK1A 3TFSA 4NM1A 2KTQA 3U26A 2Y1IA 1KN5A 3KKAC 4DL7A 5KT4A 1KRPA 3Q8KA 5KT7A 1FEZA 5DDYA 4P2HA 4UAUA 1J2NA 2Y9UA 4RU9A 1KSPA 1COKA 3OSPA 3UXNA 8ICTA 3MABA 1NK9A 4DSLA 4PL2A 5ALKA 3KKAA 2JR5A 3FYHA 2EZZA 3KHHA 5ALNA 5KFTA 1ZQQA 9ICWA 4EZ6A 2XI9A 1V85A 2KKPA 5DGBA 4RNMA 2BDPA 4ECRA 7ICUA 2FJ6A 1RDFA 2OHFA 4ECUA 3RB3A 2DFLA 3T5KA 4ED1A 1S77D 5JTIA 7ICHA 2WB1F 5ALEA 2LM4A 4DFJA 5AIBA 2Y1JA 2E8PA 5H2FU 5KFPA 5CWRA 1HJPA 4Y2YA 2W9AA 1QTMA 4QZAA 3EPGA 2PFNA 1N63A 1D9FA 5KFQA 2RRDA 2HHTA 2MRLA 4BJQA 5KFGA 2XGQA 2QB0A 3NGDA 2ALZA 5IIKA 1CEZA 3OHAA 2HHVA 3Q8SB 1S0VA 5J2DA 5J2KA 4US9A 1QLNA 1QSSA 1SZPA 4Q43A 2XCPA 2G06A 2DQNB 3RJEA 4M47A 3GIMA 4RQMA 2QB1A 2GWSA 5EE9A 2BCRA 2K4PA 1KDHA 2ESEA 4Q8EA 1UA0A 2ZUCA 2EAOA 5F9LA 2E3TA 3M9MB 1L3TA 1O03A 4RQ0A 3V6KA 2E8MA 3E2EA 2DF4B 9ICTA 1S8OA 3NS1A 4QWCA 4BWJA 4HYKA 1A6SA 4RQ7A 2YB4A 1CUKA 4JB3A 7ICOA 4QIWC 5KFRA 4GLXA 4DL5A 1NK4A 1X66A 1RPLA 3BS7A 3NVWA 4U6PA 2ISOA 5AKZA 4Y2RA 3THVA 4NWIA 5J2AA 5KL1B 3RH4A 4KTQA 4AYBC 2UVWA 2OH2A 5KFBA 8ICKA 2LYBA 4UB4A 3MDAA 2Y9TA 4C4RA 8ICGA 2KD1A 3R9KA 3H4BA 2HI0A 4RPZA 3K4GA 4KITB 4P4MA 3SAFA 4QW8A 2D3DA 2PKEA 4DFDA 1UA1A 2JZBB 3I28A 1RZTA 5KFWA 2K60A 2R8GA 4YMNA 1F5SA 3SENA 1ZQ1C 8ICJA 4EBEA 4F91B 1UHUA 3FAHA 5J0SA 3M6ZA 5ALWA 4P0QB 5KFFA 1Z4NA 2WF8A 5KT5A 2B0CA 1UPHA 3K1RB 3T5JA 5KFEA 3B0YA 4UQGA 3H8JA 2YX8A 2EZXA 2ATLA 4O3OA 4QZIA 4TUPA 1T7PA 5DB8A 4RUAA 3OJUA 4Z6EA 2JEIA 4KMUA 3E0FA 4O5KA 1B0XA 4F4WA 1C7YA 3QUCA 2KE7A 1L3SA 1ZQDA 3ETLA 2MA1A 1X9WA 3PR5B 4YVZA 3JPQA 2GOLA 2P66A 2DPIA 1PK3A 1XO1A 2Z7JA 1QSYA 2P6UA 2DWQA 3AMZA 1BNOA 5AKGA 1LKYB 2XIDA 4DLEA 3F5AA 5AI8A 1ZQMA 2ES6A 4NLZA 5GTHU 9ICNA 4B9NA 2ZIUB 5L1IA 4BGDA 2KHQA 5AK5A 5CB1A 5AI6A 5KFDA 7ICEA 4J9LA 1X6JA 4PHEA 3RR7A 1OXJA 2G5IB 2NO5A 3L4PA 3TARA 3AM9A 2F1HA 4RQ8A 4IQUA 4OD0A 4C80A 1RYRA 8ICZA 3KFUF 4QWDA 4JWMA 1ZQUA 2HDOA 2XGPA 9ICUA 4F5RA 2KV2A 5AHXA 7ICFA 1JUDA 1K1SA 8ICCA 4OJLA 2VIXA 4I2CA 7ICSA 5KFZA 3QU2A 2EAPA 2MU2A 3SEIA 1ZYQA 4ED0A 4UAZA 3KHRA 1ZQPA 2BKEA 2HBLA 1JN3A 5EE0A 5ALFA 2ISPA 5AKXA 3KBBA 1JIHA 2C2DA 5L9XA 4LZGA 3G6XA 5AI4A 3T5HA 3ETRA 5DG7A 8ICXA 4DQSA 5BPCA 2MUTA 1TE2A 1OUQA 4OJPA 4RQ6A 4O3RA 3H40A 1ZD5A 2ZIVB 1L7MA 3F2BA 4RUCA 4KLJA 2YY6A 3WK9A 4DO9A 2EQYA 4RT2A 4QNLA 2FMPA 4EZ9A 2VA3A 2KVCA 2YMQA 2DKZA 4KX3A 3AQFA 4DFPA 4I2EA 4I2HA 2JGAA 5ALHA 3C1ZA 5JRTA 1YT3A 4KMOB 4KLIA 5KFNA 3T79A 3VC8A 4KLEA 2NRVA 2KOBA 4NLGA 3Q8QB 3SYZA 1DGJA 5J0XA 1PVRA 5DKWA 2DKXA 2L5YA 4IRKA 2BQUA 2D8CA 2G07A 8ICLA 3MR5A
chains in the Genus database with same CATH topology
4NJ8A 2K60A 1V38A 2KSOB 3SENA 2QB0A 4IS7A 2B6GA 1SV4A 3TADA 1UQVA 3BS5A 3HILA 1OW5A 1B4FA 2EAPA 3SEIA 5JU5A 3K1RB 1X40A 1RG6A 2LPEA 1PK1B 4RQMA 1F0MA 2QB1A 5KNIA 2KSOA 1UCVA 4PZOA 1SGGA 2KIVA 2K4PA 1X9XA 3KKAC 5J8YC 4NL9C 2ESEA 2GLEA 2EAOA 2DL0A 2LMRA 2Y9UA 2KMDA 1Z1VA 2EAMA 1COKA 3BQ7A 2E8MA 1B0XA 3H8MA 2KE7A 1PK1A 2F3NA 2EANA 3KKAA 4MHVA 5J8YA 4NL9A 1WWVA 1PK3A 1V85A 1JI7A 2F44A 2QB0B 5F3XB 2DKZA 2QKQA 3IDWA 1LKYB 4PZNA 2KG5A 1X66A 2E8NA 3BS5B 3BS7A 2ES6A 2F8KA 5JRTA 1SXEA 1SV0C 2QARB 2YTUA 5JTIA 1OXJA 1DXSA 5L1MA 1LKYA 2D3DA 2E8PA 1WWUA 2Y9TA 2E8OA 3TACB 2DKXA 2L5YA 3TADC 1SV0A 2D8CA 2QARA 1SXDA 4RQNA 1KW4A 2JV3A 2FE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ8 A;  2K60 A;  1V38 A;  2KSO B;  3SEN A;  2QB0 A;  4IS7 A;  2B6G A;  1SV4 A;  3TAD A;  1UQV A;  3BS5 A;  3HIL A;  1OW5 A;  1B4F A;  2EAP A;  3SEI A;  5JU5 A;  3K1R B;  1X40 A;  1RG6 A;  2LPE A;  1PK1 B;  4RQM A;  1F0M A;  2QB1 A;  5KNI A;  2KSO A;  1UCV A;  4PZO A;  1SGG A;  2KIV A;  2K4P A;  1X9X A;  3KKA C;  5J8Y C;  4NL9 C;  2ESE A;  2GLE A;  2EAO A;  2DL0 A;  2LMR A;  2Y9U A;  2KMD A;  1Z1V A;  2EAM A;  1COK A;  3BQ7 A;  2E8M A;  1B0X A;  3H8M A;  2KE7 A;  1PK1 A;  2F3N A;  2EAN A;  3KKA A;  4MHV A;  5J8Y A;  4NL9 A;  1WWV A;  1PK3 A;  1V85 A;  1JI7 A;  2F44 A;  2QB0 B;  5F3X B;  2DKZ A;  2QKQ A;  3IDW A;  1LKY B;  4PZN A;  2KG5 A;  1X66 A;  2E8N A;  3BS5 B;  3BS7 A;  2ES6 A;  2F8K A;  5JRT A;  1SXE A;  1SV0 C;  2QAR B;  2YTU A;  5JTI A;  1OXJ A;  1DXS A;  5L1M A;  1LKY A;  2D3D A;  2E8P A;  1WWU A;  2Y9T A;  2E8O A;  3TAC B;  2DKX A;  2L5Y A;  3TAD C;  1SV0 A;  2D8C A;  2QAR A;  1SXD A;  4RQN A;  1KW4 A;  2JV3 A;  2FE9 A; 
#chains in the Genus database with same CATH topology
 1NK6 A;  5AKI A;  2MSN A;  2VJ4 A;  5AIC A;  4C8M A;  4UAW A;  3N4M B;  4I2J A;  5T14 A;  1PVP A;  2W9B B;  2IA6 A;  2LYH A;  4IS7 A;  1IM4 A;  1NZB A;  3BZK A;  4ED3 A;  4UBB A;  4QZ8 A;  1T3N A;  3RJH A;  3WKE A;  9ICP A;  1N56 A;  3GII A;  2AJQ A;  1PZN A;  1QQ7 A;  1ECW A;  4F71 A;  2AH5 A;  1H38 A;  1F0M A;  3RRG A;  2V9W A;  1T8E A;  1NOM A;  3LVV A;  3NAS A;  4GXI A;  4BXO B;  1COO A;  1Q46 A;  4NL9 C;  4GC7 A;  2F1I A;  4IQV A;  3BQ7 A;  4TUR A;  3QZ7 A;  4DWI A;  2JEJ A;  2ZIW B;  3ZDC A;  3IN5 A;  2WTF A;  2I1Q A;  2XY5 A;  1SWV A;  4J9N A;  4NL9 A;  1Y88 A;  1ZD4 A;  1ZQS A;  2RDI A;  5ALI A;  5KAI U;  2NO4 A;  2HHW A;  8ICF A;  1T94 A;  5KFY A;  3G6Y A;  4AP9 A;  4RNN A;  1B22 A;  2A1J B;  2HHQ A;  3D2S A;  4YMO A;  2MAX A;  4GFJ A;  4F92 B;  1ZQR A;  7ICT A;  2YTU A;  2BR0 A;  1U4B A;  2LBO A;  1TFR A;  3UMG A;  7ICR A;  4UAT A;  1NKB A;  1BPZ A;  1K5O A;  5HML A;  1BPD A;  2HHX A;  1NNL A;  3PW4 A;  1ZJN A;  8ICU A;  5ALG A;  3I1Y A;  8ICN A;  3OGU A;  2K4I A;  1ZET A;  3B9J A;  2JV3 A;  1MC8 A;  4DOC A;  4J9Q A;  4NJ8 A;  3PMN A;  3KHL A;  5KFA A;  3V7J A;  2W9M A;  5J2G A;  3NTU A;  2B6G A;  4DLG A;  2BCU A;  3H0M B;  4ZH4 A;  2Y0S C;  2PI4 A;  3IG5 A;  1L6N A;  1NKC A;  3D6J A;  5FP0 A;  1A0P A;  4KLH A;  4KLU A;  4EBC A;  1ZXI A;  1V9P A;  1ZQN A;  1LB2 B;  2PMZ F;  2JZB A;  2N1R A;  5AKK A;  2PFO A;  4PZO A;  3V7L A;  2CN1 A;  4QWB A;  3MR6 A;  1RQN A;  4DL6 A;  2YN4 A;  1KTQ A;  3QX7 A;  4Y2V A;  3N7P D;  4DCC A;  3H0R B;  3PSF A;  2K89 A;  1N60 A;  5AIA A;  4P0Q A;  2JMG A;  4QZC A;  4DFK A;  4KLM A;  4NLC A;  2W03 A;  3ZD9 A;  4JV0 A;  2G08 A;  3QEB Z;  3RR8 A;  4USA A;  2EZY A;  4NV0 A;  4RQ4 A;  1RXW A;  2H3Q A;  2R18 A;  2NV3 A;  4PZN A;  4FBT A;  3UMC A;  4R65 A;  4F72 A;  1TAM A;  5ALZ A;  8ICV A;  2K4E A;  2DUY A;  3QU9 A;  3BQ1 A;  2AGP A;  4ECZ A;  1ARO P;  3JPT A;  1BPE A;  2WFA A;  3RJF A;  5AK4 A;  1NI3 A;  4O3N A;  1LKY A;  3MFH A;  5D46 A;  3PSI A;  1JMS A;  1WWU A;  4YXJ A;  1SL0 A;  1LV5 A;  1NK8 A;  2IHN A;  3SAH A;  2ZIU A;  1L8O A;  3WK7 A;  3FC4 A;  3C5F A;  4J03 A;  3EZ5 A;  5ALY A;  2KJ8 A;  4G3I A;  3PX6 A;  3EYZ A;  4M9G A;  2G5H B;  1ZQY A;  2BGW A;  1SZH A;  1XWL A;  2W7O A;  2KSO B;  1Z00 B;  1SKW A;  4DSI A;  2C2E A;  3M7D A;  4CE6 A;  5EWG A;  2CRX A;  1CI4 A;  4I2D A;  2LI6 A;  4Q44 A;  2RHF A;  3UMB A;  3HPO A;  4UB3 A;  5KTQ A;  3UQ0 A;  2K8C B;  4CF3 A;  1M6Y A;  1V97 A;  1NK7 A;  2BQ3 A;  4MFC A;  2FPL A;  1N2X A;  3M8S A;  3L3F X;  2NRW A;  3QZ8 A;  5A0L A;  2NYV A;  4Z6D A;  4RT3 A;  1ZJM A;  3C1Y A;  3JPO A;  3ZDB A;  5AI0 A;  4DS5 A;  2FMS A;  4DQR A;  2EAN A;  4DF8 A;  2OXO A;  1RYS A;  1K1Q A;  2B21 A;  4IL6 U;  2W11 A;  1RM6 C;  3ZDE A;  2H5X A;  3GIK A;  4DOA A;  3E58 A;  2W9C B;  5F9N A;  1XNS A;  5KG1 A;  2DPJ A;  2C2R A;  1KEJ A;  2I6X A;  4JV1 A;  1S97 A;  4DL4 A;  2KJ5 A;  2HHU A;  4RQ1 A;  1TK5 A;  1B43 A;  3SR6 A;  1QH9 A;  9ICI A;  2JXJ A;  1HIW A;  2VKQ A;  1BPX A;  3MDC A;  2BCV A;  4ACO A;  2BCQ A;  1KFS A;  2A1A A;  4IRC A;  3CYM A;  3WK8 A;  5CEH A;  2W3S A;  4UBC A;  3KHG A;  5DGA A;  2E1F A;  3GV5 B;  1C20 A;  4NLK A;  1ZRN A;  3AUO A;  1L7N A;  3SMV A;  3DV9 A;  4P4O A;  4XA5 A;  1Z1B A;  1PVQ A;  4DL2 A;  3ED5 A;  3NVY A;  4YR3 A;  4XUS A;  5J29 A;  2VJ5 A;  2OEH A;  4DS4 A;  4O3P A;  1IV8 A;  5HHH A;  2AQ0 A;  2WAQ F;  3CNH A;  4GIB A;  1ED1 A;  1N5W A;  4YD2 A;  1UT8 A;  3MGI A;  3ISC A;  1U45 A;  5AM3 A;  4P0P A;  2W9B A;  2KP7 A;  4JV2 A;  1KLN A;  2YMM A;  2DBY A;  2ZTD A;  4M0A A;  1TKD A;  1ZQJ A;  3B0X A;  2AXT U;  5AI5 A;  2I9G A;  2ODG A;  3HRD D;  4TQS A;  2HBK A;  3PW0 A;  3AU2 A;  2F3N A;  4PHD A;  3GDX A;  2WF5 A;  1X42 A;  2KVS A;  3IM1 A;  2ZIX A;  5DQI A;  3PNC A;  5AKE A;  2XY7 A;  2KZM A;  1XS9 D;  1SKR A;  4YQW A;  3L5K A;  1WWV A;  3LWL A;  5DG8 A;  4EX6 A;  1JRP A;  3BQ2 A;  4C7Y A;  9ICE A;  2ZIW A;  1FFV A;  3GFK B;  2VAN A;  3FDS A;  3RH6 A;  2W7P A;  4PH5 A;  4ED2 A;  1SV0 C;  2QAR B;  3C21 A;  5ALT A;  3J81 j;  5J0R A;  2GH1 A;  3C2K A;  3MFI A;  2ZTC A;  4KLO A;  1ZQB A;  2HHS A;  1KFT A;  5KFS A;  2Q0Z X;  3LYS A;  5AM5 A;  4EX7 A;  3RBD A;  3RB4 A;  3KOO A;  1D9D A;  2ZTE A;  2A1J A;  4UW9 A;  1N48 A;  3C2M A;  2JH7 A;  2KKV A;  1NK0 A;  3RF9 A;  3PW2 A;  1SV0 A;  5KFJ A;  4Q8F A;  7ICP A;  1L5U A;  1NJW A;  4B9S A;  4DQP A;  2FE9 A;  3TQ1 A;  3M9O B;  4EYH B;  2KNJ A;  4OJ6 A;  4Z6C A;  4F4X A;  3CRX A;  2PFP A;  1NKE A;  5IIL A;  5AM4 A;  5K4L A;  1YZ7 A;  4C8N A;  1KBU A;  5J0P A;  3BS5 A;  3NVV A;  5ALO A;  4JUZ A;  1OW5 A;  4US8 A;  2BPG A;  2BDU A;  4R64 A;  2OWO A;  4QZF A;  5J2I A;  3M1Y A;  1PK1 B;  4M9H A;  4TUQ A;  2IOF A;  1XU4 A;  5DB6 A;  4O5C A;  2UVR A;  3JPS A;  4DFM A;  3PVX A;  1SL1 A;  4KLF A;  2LKY A;  2KK0 A;  4YR2 A;  3HWT A;  5CP2 A;  5KFO A;  4DSJ A;  4M9N A;  4EEY A;  2RP5 A;  4GXK A;  2M0N A;  1IG6 A;  1CRX A;  4I2A A;  2F2A B;  1Z19 A;  4PHP A;  2CPR A;  1X9S A;  1RQL A;  1FFU A;  5ALQ A;  1GO3 F;  1TK8 A;  5EE3 A;  3ZD8 A;  2F44 A;  2QB0 B;  4NXZ A;  3K75 D;  2R8H A;  4F4Y A;  2W54 A;  1XSL A;  5EWE A;  2H3V A;  1BVS A;  4ECV A;  5EOZ A;  5KFL A;  3IHQ B;  3QE9 Y;  2F8L A;  1XO0 A;  4F4Z A;  8ICM A;  2W8L A;  5B5E U;  4PL1 A;  5KG7 A;  4K4I A;  1MSW D;  4B9T A;  2RDJ A;  3ONN A;  9ICL A;  2BCS A;  4F3O A;  2JEG A;  2FPK A;  1D8L A;  4I2F A;  3LWM A;  2JEF A;  5DBB A;  3RRH A;  1S0O A;  3TAD C;  2K8B B;  2BHN A;  4M04 A;  1ZQT A;  3C23 A;  3GU3 A;  1IXR A;  5AKJ A;  3ZI4 A;  1AQ6 A;  1WUD A;  3WK4 A;  2A3V A;  1V38 A;  3OSN A;  3QNM A;  9ICG A;  4YCX A;  1N62 A;  1S76 D;  1BPY A;  2UVV A;  3TAD A;  4KLT A;  3VCB A;  5EE1 A;  1QQ6 A;  4KLL A;  2HVH A;  3RFA A;  4MF2 A;  3QEA Z;  3RB6 A;  4DSK A;  1RG6 A;  1TVA A;  2P35 A;  2LPE A;  1XC9 A;  3A0B U;  4Y2X A;  2KSO A;  2V4Q A;  4DF4 A;  1SL2 A;  1Z00 A;  2HOQ A;  4F5Q A;  4MFF A;  1HUO A;  2KIV A;  3V72 A;  4KLG A;  5IIN A;  3T3F A;  2YMP A;  5KFK A;  4QZG A;  3WK6 A;  2EAM A;  1WG8 A;  4IQW A;  9ICM A;  2W43 A;  2OCE A;  5HR7 A;  1FO4 A;  3IRU A;  4O9M A;  3QUB A;  5ALP A;  3UXO A;  4DL3 A;  5ALD A;  5J2F A;  2ZUB A;  3SD7 A;  4QZH A;  3QXG A;  4MHV A;  2ASL A;  4M9J A;  2HBJ A;  5CJ7 A;  4YXM A;  3C5G A;  4YG2 A;  4GXJ A;  4FS2 A;  9ICR A;  3AL0 B;  4O3M A;  4I2G A;  4M9L A;  3IV6 A;  2WHE A;  5HNK A;  9ICB A;  2Y0S F;  2IBK A;  3EWA A;  4YD1 A;  4Y2U A;  3QU5 A;  4O3Q A;  4QWA A;  4E0D A;  4F5N A;  1JXL A;  2F8K A;  4J9R A;  2R8I A;  3V6H A;  5BOL A;  4CDG A;  1X6I A;  2BZF A;  1ZQZ A;  5ALV A;  1XSN A;  2W9C A;  1O08 A;  1TV9 A;  2KHV A;  4ECY A;  7ICL A;  1NZP A;  1BPB A;  3T5L A;  5DBA A;  2R8J A;  4A8E A;  4UAS A;  1SXD A;  3OPX A;  3MGH A;  3F5E A;  3KTQ A;  3OJS A;  3PX0 A;  9ICV A;  2OYY A;  4MEY A;  5ALL A;  3TKA A;  8ICP A;  7ICQ A;  2XVT A;  3AU6 A;  4K4H A;  1WCN A;  3N7R C;  3F53 A;  3S6J A;  4NM2 A;  5TIS U;  4J9O A;  1UCV A;  4CNQ A;  4BWM A;  4BUG A;  1J97 A;  4RPX A;  5KFH A;  4YN4 A;  3UPQ A;  3KZI U;  5C0Y A;  4GC6 A;  3RB0 A;  5AM0 A;  5AM2 A;  2KMD A;  9ICX A;  2JH1 A;  4DQQ A;  4J9K A;  1URJ A;  9ICA A;  1FIQ A;  3EW9 A;  5III A;  4UB8 U;  4XQ8 A;  3PW5 A;  4CRX A;  3CP8 A;  3WKA A;  5G5G A;  3WU2 U;  3HJE A;  1KQQ A;  4B6J A;  3TAQ A;  5AI9 A;  4KLQ A;  4M6W B;  3BDP A;  5AK6 A;  2KFN A;  5KG2 A;  1LVH A;  4YR0 A;  3SAG A;  2M9N A;  2ASD A;  2FMQ A;  2HVI A;  3GV7 B;  3OHB A;  2XCA A;  1VJ5 A;  2JHD A;  5J2H A;  5AM1 A;  1S9F A;  1ZQV A;  3H4D A;  3ZDD A;  2BPF A;  2NRZ A;  4J9S A;  4LZD A;  2QAR A;  4ELT A;  4O3S A;  2FLP A;  3C29 A;  1ZRM A;  4FZL A;  5KG0 A;  1J2M A;  3QU7 A;  4DQI A;  5J0O A;  3QUQ A;  5J2E A;  2K4H A;  3RAQ A;  4ECT A;  2ZJ8 A;  1RYU A;  3RBE A;  5ALJ A;  1D8Y A;  2BPC A;  1U9L A;  2G0A A;  4J9P A;  3RTV A;  2IMW P;  3RJG A;  3D2Q A;  3HKZ C;  5E79 U;  5J8Y C;  4O0I A;  2GLE A;  3QYP A;  5HR6 A;  3G6V A;  2FDR A;  2W55 A;  2YML A;  5GTI U;  4QIW F;  1F44 A;  3GQC A;  5HP4 A;  4EEN A;  4IR1 A;  1ZQK A;  3QUT A;  1PK1 A;  2PMZ C;  5KG3 A;  4C0Z A;  5J8Y A;  3GZF A;  1QSL A;  3PSP A;  4AYB F;  5J0Y A;  8ICQ A;  3SZ2 A;  4QZB A;  2JRZ A;  4UB6 U;  2J6S A;  4ELV A;  2KJ9 A;  2OM6 A;  4UB2 A;  5CHG A;  2UVU A;  3PO5 A;  5KT6 A;  3V7K A;  4PJ0 U;  1TK0 A;  4ECX A;  9ICS A;  2FPM A;  4J9M A;  2LYA A;  4B9U A;  4OO1 J;  2KFZ A;  1DXS A;  4XRH A;  5L1L A;  4CF5 A;  1WYG A;  4Z6F A;  5KL8 B;  5IIM A;  1ZQL A;  5DB9 A;  3TFR A;  1ZOL A;  5C5J A;  4RQ5 A;  4LJX A;  2KN7 A;  2F77 X;  2ZIV A;  2P6R A;  5ALU A;  1MQ3 A;  4FZN A;  4I29 A;  4PGQ A;  1P7D A;  4M2Y A;  3KZX A;  3WKB A;  2EH9 A;  4TUS A;  3PX4 A;  2Q4T A;  5KAF U;  8ICO A;  2O6K A;  7ICN A;  4F50 A;  3PML A;  3BJY A;  2F76 X;  1TAU A;  2AQ4 A;  4LVS A;  5KT2 A;  4CF4 A;  3I76 A;  4F93 B;  4I2I A;  4K4G A;  2VA8 A;  4C4S A;  1JXE A;  1VLB A;  2WB1 C;  1DRG A;  1X9X A;  4C4T A;  1YZ6 A;  5AKL A;  2LMR A;  4B9V A;  1Z1V A;  2XO7 A;  4FBU A;  3LDA A;  5J0Q A;  2LM1 A;  3F2C A;  3A0H U;  2KZZ A;  3H8M A;  4I28 A;  3N28 A;  4ZOH C;  5J0T A;  3Q8P B;  1ZQE A;  1DGS A;  4HAI A;  2KZ3 A;  3MGV A;  1U47 A;  1XSP A;  3PZP A;  3ISD A;  2C28 A;  1ZQG A;  4C7Z A;  5IIO A;  4B9L A;  2QKQ A;  3IDW A;  4RQ3 A;  3HP6 A;  4KX5 A;  5J2J A;  4EYI B;  5ALX A;  2KG5 A;  2VA2 A;  1T3Q A;  4X5V A;  4R8U B;  2G09 A;  2ASJ A;  4DOB A;  1ZQF A;  4F2S A;  1ZD3 A;  2H3I A;  2E1E A;  3SV3 A;  3RJJ A;  3SI8 A;  4BXO A;  4F8R A;  4IR9 A;  4PPX A;  5JUM A;  4EBD A;  3NRZ A;  3EPI A;  1PUZ A;  4DSE A;  4Q45 A;  2GO7 A;  5D49 A;  3ORY A;  3NVZ A;  1Z3E B;  1RXV A;  1Q3U A;  3EUB 2;  1QCK A;  1T4G A;  2W8K A;  4KLS A;  4RQN A;  3BQT A;  7ICM A;  3SV4 A;  1HUZ A;  5CA7 A;  2A19 A;  1Q8K A;  2ZJA A;  3MR3 A;  3UQ2 A;  2AGO A;  4CGZ A;  1NJY A;  2LHT A;  3UXP A;  4FZM A;  3GIJ A;  1BNP A;  3PST A;  1UQV A;  5B66 U;  1SIJ A;  4ECQ A;  3HW8 A;  3LK9 A;  3DDH A;  5JU5 A;  1X40 A;  4OJO A;  1S0M A;  2DGZ A;  3PY8 A;  3LVW A;  2AHO B;  2D6F C;  9ICO A;  2YQE A;  1BGX T;  4BDP A;  2KEY A;  2F1J A;  1ZQW A;  2QLT A;  2NRX A;  2RLT A;  1ZD2 P;  5AKH A;  1L3U A;  3WKC A;  5HHI A;  3AEV A;  2WAQ C;  2EDU A;  3NUQ A;  4ED6 A;  2PXI A;  2XIC A;  4QZE A;  3OTQ A;  2K8A A;  1SKS A;  5KG4 A;  4FE3 A;  3CW2 C;  4ECW A;  4QZD A;  1NJX A;  2CXY A;  4TQR A;  4FFD A;  3TAN A;  4KLD A;  2AU0 A;  1KFD A;  4BX9 C;  4F2R A;  3NRW A;  1WCL A;  1NJZ A;  2I5H A;  4DEZ A;  2ZXH A;  3UM9 A;  2E8N A;  5IIJ A;  4ED8 A;  3FM9 A;  4UAR A;  4I27 A;  1SXE A;  4IC9 A;  8ICY A;  3JPN A;  4FO6 A;  1QQ5 A;  3ISB A;  1MQ2 A;  5L1M A;  1IIP A;  5J0W A;  3O0F A;  3HT3 A;  4M6W A;  7ICK A;  3IP4 B;  3K1Z A;  5DDM A;  1NK5 A;  3TAC B;  2ZXI A;  3Q8R B;  3JPP A;  4EEL A;  3PW7 A;  2HOI A;  1N61 A;  5KFC A;  2J6T A;  4NLN A;  9ICF A;  3DEE A;  3Q8M A;  4O5E A;  3ICX A;  1L8L A;  2HSZ A;  5AKY A;  3HIL A;  4CCH A;  2E5S A;  1A77 A;  2ZJ5 A;  1S5L U;  8ICW A;  2WF7 A;  3V6J A;  5J2C A;  5KNI A;  8ICE A;  1JX4 A;  1L7O A;  2KIC A;  2PI5 A;  4Y2Q A;  2R8K A;  1JRO A;  3MC1 A;  1DK2 A;  3IG8 A;  4C8K A;  2DL0 A;  3PR4 A;  2ZUD A;  3C28 A;  1ZQI A;  4RNO A;  4JWN A;  3H7I A;  1TAQ A;  4UAY A;  1SWW A;  4QZ9 A;  2HCF A;  2NRT A;  2ZG6 A;  4WJ3 B;  5KG5 A;  3H8W A;  5J2B A;  3RJI A;  7ICG A;  4YMM A;  4YFK A;  5ALS A;  3AN1 A;  5J0U A;  1HEK A;  2W3R A;  2WF9 A;  2HMX A;  5F3X B;  1EXN A;  1L3V A;  3M6K A;  4R63 A;  4OCZ A;  5HMM A;  1JAL A;  2FLN A;  9ICH A;  9ICQ A;  2HOF A;  2HW3 A;  4Y2J A;  2W04 A;  4C8L A;  1N5X A;  3H0L B;  2XC9 A;  5KFM A;  5DQG A;  4EEK A;  5CRX A;  4P0P B;  8ICA A;  8ICI A;  3KD3 A;  2PFQ A;  1VDV A;  5ALR A;  4Y2T A;  1ZQO A;  3BQ0 A;  4F4K A;  8ICH A;  4PGY A;  2E8O A;  4QWE A;  3Q8L A;  2AGQ A;  1KW4 A;  8ICS A;  5ALM A;  3GV8 B;  1L7P A;  4JMU A;  2ZIX B;  4PGX A;  4P4P A;  4RZR A;  4UB5 A;  4OJ5 A;  1SV4 A;  4R66 A;  2KIW A;  4FS1 A;  2V4R A;  5KFU A;  1B4F A;  5TZV A;  5KFX A;  4C8O A;  4DSF A;  1DK3 A;  1U49 A;  4MEX A;  1MA7 A;  5KG6 A;  4Y2P A;  1KL9 A;  1SGG A;  1S0N A;  3SQI A;  3WK5 A;  8ICR A;  3QU4 A;  3MBY A;  3ZDA A;  4G9B A;  4PHA A;  2H3F A;  4F5O A;  2J6U A;  5D4B A;  4KN7 A;  3D2N A;  9ICJ A;  1ZQH A;  5CR0 A;  4B9M A;  4ECS A;  3PV8 A;  4MFA A;  3ALR A;  1SB3 C;  4QW9 A;  2FLL A;  4ELU A;  2YB1 A;  1ZQX A;  1UT5 A;  1D8B A;  4QJF B;  4U7C A;  3BZC A;  9ICC A;  3PO4 A;  1JI7 A;  2H3Z A;  4IQT A;  3RAX A;  4I2B A;  4F5P A;  3GIL A;  3RJK A;  5DLF A;  3WKD A;  4RPY A;  3HX0 A;  4RQ2 A;  3TAP A;  2C22 A;  7ICI A;  2WF6 A;  5KT3 A;  2HBM A;  3BS5 B;  3M8R A;  5KFI A;  3N97 B;  4NY8 A;  4MF8 A;  1ZQA A;  1X2I A;  8ICB A;  4Y2S A;  3HKZ F;  5DG9 A;  1KKX A;  3F2D A;  1S10 A;  3JPR A;  4R8U A;  5KFV A;  3MR2 A;  2RQ5 A;  3H8S A;  1Z4O A;  4UB1 A;  4ED7 A;  3C2L A;  2FI1 A;  1X9M A;  3RH5 A;  7ICJ A;  5DBC A;  3N7S C;  1A76 A;  5DQH A;  5L1K A;  2BQR A;  2IHM A;  5DLG A;  4UAV A;  7ICV A;  5DB7 A;  2IOH A;  4KN4 A;  2IOF K;  5EWF A;  4ICA A;  2XY6 A;  1Q3V A;  5BOM A;  5G5H A;  1U48 A;  5AK3 A;  3TI0 A;  4NLB A;  3M9N B;  5L1J A;  9ICK A;  1ZQC A;  3AQE A;  2MUT B;  4IRD A;  1MN8 A;  4YP3 A;  1DOQ A;  4JK1 A;  3TFS A;  4NM1 A;  2KTQ A;  3U26 A;  2Y1I A;  1KN5 A;  3KKA C;  4DL7 A;  5KT4 A;  1KRP A;  3Q8K A;  5KT7 A;  1FEZ A;  5DDY A;  4P2H A;  4UAU A;  1J2N A;  2Y9U A;  4RU9 A;  1KSP A;  1COK A;  3OSP A;  3UXN A;  8ICT A;  3MAB A;  1NK9 A;  4DSL A;  4PL2 A;  5ALK A;  3KKA A;  2JR5 A;  3FYH A;  2EZZ A;  3KHH A;  5ALN A;  5KFT A;  1ZQQ A;  9ICW A;  4EZ6 A;  2XI9 A;  1V85 A;  2KKP A;  5DGB A;  4RNM A;  2BDP A;  4ECR A;  7ICU A;  2FJ6 A;  1RDF A;  2OHF A;  4ECU A;  3RB3 A;  2DFL A;  3T5K A;  4ED1 A;  1S77 D;  5JTI A;  7ICH A;  2WB1 F;  5ALE A;  2LM4 A;  4DFJ A;  5AIB A;  2Y1J A;  2E8P A;  5H2F U;  5KFP A;  5CWR A;  1HJP A;  4Y2Y A;  2W9A A;  1QTM A;  4QZA A;  3EPG A;  2PFN A;  1N63 A;  1D9F A;  5KFQ A;  2RRD A;  2HHT A;  2MRL A;  4BJQ A;  5KFG A;  2XGQ A;  2QB0 A;  3NGD A;  2ALZ A;  5IIK A;  1CEZ A;  3OHA A;  2HHV A;  3Q8S B;  1S0V A;  5J2D A;  5J2K A;  4US9 A;  1QLN A;  1QSS A;  1SZP A;  4Q43 A;  2XCP A;  2G06 A;  2DQN B;  3RJE A;  4M47 A;  3GIM A;  4RQM A;  2QB1 A;  2GWS A;  5EE9 A;  2BCR A;  2K4P A;  1KDH A;  2ESE A;  4Q8E A;  1UA0 A;  2ZUC A;  2EAO A;  5F9L A;  2E3T A;  3M9M B;  1L3T A;  1O03 A;  4RQ0 A;  3V6K A;  2E8M A;  3E2E A;  2DF4 B;  9ICT A;  1S8O A;  3NS1 A;  4QWC A;  4BWJ A;  4HYK A;  1A6S A;  4RQ7 A;  2YB4 A;  1CUK A;  4JB3 A;  7ICO A;  4QIW C;  5KFR A;  4GLX A;  4DL5 A;  1NK4 A;  1X66 A;  1RPL A;  3BS7 A;  3NVW A;  4U6P A;  2ISO A;  5AKZ A;  4Y2R A;  3THV A;  4NWI A;  5J2A A;  5KL1 B;  3RH4 A;  4KTQ A;  4AYB C;  2UVW A;  2OH2 A;  5KFB A;  8ICK A;  2LYB A;  4UB4 A;  3MDA A;  2Y9T A;  4C4R A;  8ICG A;  2KD1 A;  3R9K A;  3H4B A;  2HI0 A;  4RPZ A;  3K4G A;  4KIT B;  4P4M A;  3SAF A;  4QW8 A;  2D3D A;  2PKE A;  4DFD A;  1UA1 A;  2JZB B;  3I28 A;  1RZT A;  5KFW A;  2K60 A;  2R8G A;  4YMN A;  1F5S A;  3SEN A;  1ZQ1 C;  8ICJ A;  4EBE A;  4F91 B;  1UHU A;  3FAH A;  5J0S A;  3M6Z A;  5ALW A;  4P0Q B;  5KFF A;  1Z4N A;  2WF8 A;  5KT5 A;  2B0C A;  1UPH A;  3K1R B;  3T5J A;  5KFE A;  3B0Y A;  4UQG A;  3H8J A;  2YX8 A;  2EZX A;  2ATL A;  4O3O A;  4QZI A;  4TUP A;  1T7P A;  5DB8 A;  4RUA A;  3OJU A;  4Z6E A;  2JEI A;  4KMU A;  3E0F A;  4O5K A;  1B0X A;  4F4W A;  1C7Y A;  3QUC A;  2KE7 A;  1L3S A;  1ZQD A;  3ETL A;  2MA1 A;  1X9W A;  3PR5 B;  4YVZ A;  3JPQ A;  2GOL A;  2P66 A;  2DPI A;  1PK3 A;  1XO1 A;  2Z7J A;  1QSY A;  2P6U A;  2DWQ A;  3AMZ A;  1BNO A;  5AKG A;  1LKY B;  2XID A;  4DLE A;  3F5A A;  5AI8 A;  1ZQM A;  2ES6 A;  4NLZ A;  5GTH U;  9ICN A;  4B9N A;  2ZIU B;  5L1I A;  4BGD A;  2KHQ A;  5AK5 A;  5CB1 A;  5AI6 A;  5KFD A;  7ICE A;  4J9L A;  1X6J A;  4PHE A;  3RR7 A;  1OXJ A;  2G5I B;  2NO5 A;  3L4P A;  3TAR A;  3AM9 A;  2F1H A;  4RQ8 A;  4IQU A;  4OD0 A;  4C80 A;  1RYR A;  8ICZ A;  3KFU F;  4QWD A;  4JWM A;  1ZQU A;  2HDO A;  2XGP A;  9ICU A;  4F5R A;  2KV2 A;  5AHX A;  7ICF A;  1JUD A;  1K1S A;  8ICC A;  4OJL A;  2VIX A;  4I2C A;  7ICS A;  5KFZ A;  3QU2 A;  2EAP A;  2MU2 A;  3SEI A;  1ZYQ A;  4ED0 A;  4UAZ A;  3KHR A;  1ZQP A;  2BKE A;  2HBL A;  1JN3 A;  5EE0 A;  5ALF A;  2ISP A;  5AKX A;  3KBB A;  1JIH A;  2C2D A;  5L9X A;  4LZG A;  3G6X A;  5AI4 A;  3T5H A;  3ETR A;  5DG7 A;  8ICX A;  4DQS A;  5BPC A;  2MUT A;  1TE2 A;  1OUQ A;  4OJP A;  4RQ6 A;  4O3R A;  3H40 A;  1ZD5 A;  2ZIV B;  1L7M A;  3F2B A;  4RUC A;  4KLJ A;  2YY6 A;  3WK9 A;  4DO9 A;  2EQY A;  4RT2 A;  4QNL A;  2FMP A;  4EZ9 A;  2VA3 A;  2KVC A;  2YMQ A;  2DKZ A;  4KX3 A;  3AQF A;  4DFP A;  4I2E A;  4I2H A;  2JGA A;  5ALH A;  3C1Z A;  5JRT A;  1YT3 A;  4KMO B;  4KLI A;  5KFN A;  3T79 A;  3VC8 A;  4KLE A;  2NRV A;  2KOB A;  4NLG A;  3Q8Q B;  3SYZ A;  1DGJ A;  5J0X A;  1PVR A;  5DKW A;  2DKX A;  2L5Y A;  4IRK A;  2BQU A;  2D8C A;  2G07 A;  8ICL A;  3MR5 A; 
#chains in the Genus database with same CATH homology
 4NJ8 A;  2K60 A;  1V38 A;  2KSO B;  3SEN A;  2QB0 A;  4IS7 A;  2B6G A;  1SV4 A;  3TAD A;  1UQV A;  3BS5 A;  3HIL A;  1OW5 A;  1B4F A;  2EAP A;  3SEI A;  5JU5 A;  3K1R B;  1X40 A;  1RG6 A;  2LPE A;  1PK1 B;  4RQM A;  1F0M A;  2QB1 A;  5KNI A;  2KSO A;  1UCV A;  4PZO A;  1SGG A;  2KIV A;  2K4P A;  1X9X A;  3KKA C;  5J8Y C;  4NL9 C;  2ESE A;  2GLE A;  2EAO A;  2DL0 A;  2LMR A;  2Y9U A;  2KMD A;  1Z1V A;  2EAM A;  1COK A;  3BQ7 A;  2E8M A;  1B0X A;  3H8M A;  2KE7 A;  1PK1 A;  2F3N A;  2EAN A;  3KKA A;  4MHV A;  5J8Y A;  4NL9 A;  1WWV A;  1PK3 A;  1V85 A;  1JI7 A;  2F44 A;  2QB0 B;  5F3X B;  2DKZ A;  2QKQ A;  3IDW A;  1LKY B;  4PZN A;  2KG5 A;  1X66 A;  2E8N A;  3BS5 B;  3BS7 A;  2ES6 A;  2F8K A;  5JRT A;  1SXE A;  1SV0 C;  2QAR B;  2YTU A;  5JTI A;  1OXJ A;  1DXS A;  5L1M A;  1LKY A;  2D3D A;  2E8P A;  1WWU A;  2Y9T A;  2E8O A;  3TAC B;  2DKX A;  2L5Y A;  3TAD C;  1SV0 A;  2D8C A;  2QAR A;  1SXD A;  4RQN A;  1KW4 A;  2JV3 A;  2FE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...