2KG5A

Nmr solution structure of arap3-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
HMAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILRLLQTGTEEGSLDPKSDSAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arf-GAP, Rho-GAP domain, ANK repeat and PH domain-containing
publication title The Sam domain of the lipid phosphatase Ship2 adopts a common model to interact with Arap3-Sam and EphA2-Sam.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kg5A01
3BS7A 3TADA 1SXDA 3K1RB 2DL0A 2DKXA 3BQ7A 2EANA 4MHVA 4RQMA 1X40A 2D8CA 2KSOA 3BS5A 1F0MA 1SV0A 1B4FA 1UQVA 2QARA 1OXJA 2E8PA 2EAMA 3HILA 4PZOA 1SXEA 2DKZA 2GLEA 1SV0C 2K4PA 1V38A 4RQNA 1X9XA 1B0XA 5JTIA 5J8YA 1PK1B 2QB1A 3TACB 1UCVA 1COKA 1SGGA 3KKAA 3TADC 1V85A 1Z1VA 2LMRA 3KKAC 5F3XB 5KNIA 2E8OA 2EAOA 1KW4A 2KG5A 1JI7A 2ES6A 1PK1A 2EAPA 2Y9TA 1LKYB 2QKQA 2K60A 2E8NA 2F44A 4PZNA 3SENA 2QB0B 5J8YC 2KMDA 1WWVA 2E8MA 3H8MA 1SV4A 1X66A 2D3DA 4NL9A 2KIVA 5JRTA 1RG6A 2LPEA 4NL9C 2YTUA 2KSOB 1WWUA 1LKYA 4NJ8A 3BS5B 1PK3A 2JV3A 2B6GA 3IDWA 2Y9UA 5L1MA 2F8KA 1OW5A 2QB0A 1DXSA 2QARB 2FE9A 2KE7A 4IS7A 3SEIA 2ESEA 2F3NA 5JU5A 2L5YA
chains in the Genus database with same CATH superfamily
3TADA 3C1YA 2XO7A 4PHAA 2F1IA 3Q8MA 5CB1A 3E2EA 1M6YA 3C2KA 1ZQPA 4LZGA 2MRLA 1JRPA 2YY6A 2Z7JA 5DB6A 1NK7A 1DOQA 1D8LA 3EW9A 4DF8A 2HBLA 4DFMA 2ZTEA 1HUOA 5AM0A 7ICPA 3UXNA 3MDCA 3Q8RB 5AM5A 4QZAA 4PHDA 4ELUA 2ZJ8A 4BGDA 3EPIA 8ICBA 2E3TA 4QZBA 3ZI4A 3JPPA 5F3XB 7ICLA 3PW0A 8ICAA 5KFRA 5HR6A 4UB5A 3H8SA 2KZMA 3MR6A 4PHEA 3OJUA 1L3TA 2QKQA 4DQSA 2ZUBA 1N48A 4TQSA 2PXIA 4BXOA 5J2JA 2A3VA 5KG4A 3N97B 5HP4A 1S0NA 3IG8A 2D3DA 8ICLA 5BOLA 3QUBA 3QE9Y 3H0RB 4NM2A 5ALDA 3T79A 3MFIA 3T5KA 1NK8A 4GFJA 3H8JA 3RJIA 4Q8EA 4YP3A 1ZJNA 4KLIA 4P0PA 2OM6A 3NGDA 4KLUA 7ICTA 4UAYA 3M9MB 7ICIA 2MU2A 4YMOA 2NO4A 1K1SA 4RQ2A 1T3QA 2XICA 2AU0A 1QH9A 3KHGA 1HEKA 4M9GA 2DL0A 5J2GA 9ICFA 3QUTA 1QSYA 4JUZA 3JPNA 3PV8A 2XC9A 2ZJ5A 4CF4A 4UAUA 1KDHA 1SL0A 4KMOB 5A0LA 1SB3C 1NJYA 3JPTA 5J0YA 2W43A 3MABA 3MBYA 4IQUA 7ICJA 1UT8A 1PK1B 3PSFA 2XCAA 2UVVA 4F4YA 3DDHA 4FE3A 3QU4A 5DQHA 1O08A 4CE6A 3H4DA 1N63A 1BGXT 1ZQLA 4ECQA 2CN1A 1TFRA 2YX8A 2A1JB 1QQ6A 5ALSA 2MAXA 4UAWA 2V4QA 4QIWF 1MA7A 2KKPA 3GIIA 2OHFA 4ED3A 2JH1A 3NTUA 2UVWA 1S77D 3EPGA 1L7OA 3Q8PB 2HOQA 2ZTCA 1Z4NA 2VKQA 2B21A 4IQTA 2K8BB 3SQIA 9ICPA 1L7MA 5CHGA 2HBJA 2IOHA 2W04A 1RXWA 2PFPA 4K4IA 1ZD4A 2R8HA 1S9FA 4DSKA 4I2BA 4EX6A 4TUQA 4M6WA 4DOCA 3HRDD 4ED2A 2AQ0A 4PGXA 1L3VA 3SZ2A 7ICVA 4DLEA 3UMBA 4EX7A 4IRKA 4M9NA 2M0NA 5DB9A 1NK9A 2Y0SF 3QYPA 2C2EA 3DV9A 1IV8A 4PJ0U 2D8CA 1UA1A 3N28A 4KX5A 1Z4OA 1CI4A 3LYSA 3EWAA 2DQNB 1KKXA 1X6JA 5J29A 1V38A 3TKAA 4RPZA 4Y2QA 2ZIUA 2AH5A 1SGGA 2BDPA 3H0MB 7ICMA 4TQRA 5HHIA 4O3SA 2LMRA 5ALNA 4ECXA 2WAQF 5DLFA 2KHQA 2YMLA 1YZ6A 1T4GA 3LVVA 2ZUCA 3UPQA 5KFMA 2D6FC 1ZQHA 4FBUA 4DL5A 4Z6CA 2AGPA 4O3MA 3PO5A 2R8KA 2XCPA 2VANA 2R8GA 3SENA 5KAFU 4KMUA 4RUAA 4Y2SA 2F77X 2G5HB 4MF2A 2WB1C 2W8LA 3K1ZA 2P66A 4O9MA 2KV2A 4DCCA 5KG7A 3OJSA 4KLOA 4NL9C 1FFUA 5CEHA 3IV6A 2K8CB 2HSZA 5HMMA 1XSLA 2AJQA 3NRWA 4F5OA 1ZQSA 5KFGA 4YMMA 3RH4A 5C5JA 2KZZA 1Q8KA 5J2CA 3OPXA 1S97A 5L1LA 5KG6A 4EYHB 2W9AA 4EZ9A 2L5YA 4CDGA 2W7PA 3BDPA 2Q4TA 4YR2A 1ZQVA 3ZDCA 2NRTA 4I2EA 4J9LA 4X5VA 8ICUA 4UARA 1YZ7A 2IOFK 4GC6A 2JEFA 2C2RA 2HHQA 5CJ7A 3PW4A 1OXJA 2EAMA 3HILA 3RRHA 4Q45A 2BR0A 1ZQIA 4Y2JA 5KL8B 5HNKA 1ZQKA 3SYZA 4KX3A 2LI6A 3H7IA 2FPKA 9ICMA 4PGYA 2JRZA 3TAPA 2QB1A 1PUZA 1XO1A 5CP2A 2P6UA 1D8BA 5AKJA 3LWMA 9ICBA 1BNPA 2W9CA 1UPHA 4YR3A 2KD1A 4B9MA 5AI0A 3H8WA 4O3OA 4OJPA 2BPFA 5DQGA 2ZIWA 1KL9A 3O0FA 3M9OB 5F9NA 2LKYA 4I2JA 3KHHA 1NI3A 3B9JA 2BCVA 3RR8A 5KG5A 4F72A 5KT7A 9ICXA 2H3VA 3K75D 4J9QA 1BNOA 4BWMA 3H8MA 2UVUA 3RJFA 4NL9A 2V4RA 4LVSA 4UB4A 1SKSA 1MN8A 3RJKA 3MFHA 4Y2XA 1X42A 7ICSA 5KG3A 3KHRA 1B22A 2V9WA 4B9NA 3GV5B 5AKGA 2QB0A 1SWVA 1XU4A 4YD2A 5IIJA 4M04A 5J0RA 4MF8A 2H3QA 4R8UA 1RXVA 1Q3UA 1SXDA 1ZETA 1CEZA 2DKXA 2RQ5A 3BQ7A 4E0DA 3OHAA 2LYBA 4DL4A 2I6XA 2WF6A 2ISPA 5JUMA 1B4FA 5G5GA 3UM9A 3KZXA 3UMGA 1XWLA 4B6JA 4UW9A 2AHOB 4GIBA 1SV0C 2YMPA 3PR5B 1ZQGA 5ALGA 5KFKA 3Q8LA 4AYBF 1KFTA 2G0AA 2C22A 5DGBA 3RTVA 1JROA 2A1AA 3WK9A 4C7YA 3UXOA 3TADC 3KBBA 1MQ3A 5HR7A 3OTQA 1P7DA 3NRZA 3QUQA 2FPLA 4YN4A 2KFZA 1ZXIA 1TVAA 2DWQA 5DGAA 1KLNA 1ED1A 3QU7A 4CF5A 4ZH4A 3PSPA 1LKYB 3C29A 3EUB2 4IRCA 4EENA 3R9KA 2K4EA 2WFAA 3UQ0A 8ICTA 4F5PA 1ZQ1C 4EEYA 4QZIA 1KQQA 3GU3A 4K4HA 4KITB 5E79U 4DFKA 1MSWD 4OJLA 1U48A 2JEGA 3L3FX 5D49A 1RG6A 5AM3A 3T5LA 5ALMA 2C2DA 2K89A 5KFNA 3AM9A 1ZQJA 2VIXA 4RZRA 4QWEA 5IIMA 4NY8A 3MGHA 2W11A 1NNLA 3Q8SB 4C8MA 1SKRA 1L5UA 1CRXA 3WKAA 3M7DA 1V97A 3TARA 5DDYA 3F53A 1KEJA 1ZQNA 1RYUA 4DS5A 8ICFA 4JWMA 3C5FA 8ICIA 4M47A 3K1RB 5H2FU 3F5EA 4JB3A 4M9JA 3CW2C 2ZIXB 1SV0A 5DB7A 5J0XA 2JH7A 4QWBA 5DQIA 1UA0A 5EE1A 2FMSA 1NK5A 4I2HA 2JMGA 5FP0A 3NVVA 1X6IA 1B0XA 1RQNA 1VDVA 3UMCA 5AKXA 4FFDA 2H3FA 1K5OA 2MA1A 2OCEA 2H3IA 2MUTB 5F9LA 3JPRA 3CP8A 5KFVA 1COKA 4I2DA 1KSPA 1XO0A 3SAHA 5KG0A 3NVYA 8ICZA 3F2DA 4J9NA 3DEEA 4KLFA 4CRXA 5DBAA 2BQ3A 5D46A 3PW5A 4KLGA 4RUCA 5KFXA 1B43A 3D2SA 1ZOLA 1PK1A 3UXPA 1LV5A 2Y9TA 4QW8A 3HKZF 4YG2A 5EWEA 9ICOA 4KLQA 2ISOA 3RBDA 2F44A 3BQ2A 4PZNA 5J0WA 1RZTA 1NKEA 2HHTA 3QZ8A 4ED1A 3OSPA 4YXMA 5HHHA 4JV1A 4UAVA 4TURA 4RQ8A 5DG7A 4FS2A 2A1JA 5DKWA 5AIBA 3GDXA 1HUZA 3IN5A 9ICIA 1X9MA 2KSOB 4NJ8A 8ICEA 3M8SA 2JV3A 3D2NA 3WKEA 3IDWA 4JV2A 4QIWC 8ICVA 2IHMA 5DG8A 4KLEA 2Y9UA 4RT3A 3J81j 3CNHA 1JX4A 4RQ0A 3GQCA 1TE2A 5ALKA 1RYRA 2BQRA 3ZDAA 1JIHA 5ALTA 4CF3A 2KNJA 2FJ6A 4O5KA 3E0FA 1XC9A 3F2CA 2JXJA 3V7KA 1JMSA 5L9XA 2CPRA 4NXZA 3WK6A 1K1QA 2DKZA 2KJ5A 3KZIU 4NLGA 1LB2B 1D8YA 8ICMA 2GO7A 4QZCA 4F4WA 2ASDA 2ZIVB 4Q43A 3RJEA 5DB8A 3H4BA 2JEJA 3AEVA 1O03A 4QZDA 3B0YA 1KBUA 2NYVA 4F8RA 3IG5A 2Y0SC 2F2AB 1T8EA 3QEAZ 4DF4A 2IHNA 1ZQZA 3M6ZA 1DK2A 4DL3A 4J9MA 2E5SA 1WYGA 4F5NA 5ALEA 1EXNA 3BZCA 3LDAA 2IMWP 3PY8A 4NLKA 1N56A 4IRDA 8ICKA 2GH1A 2YB4A 2YMMA 3E58A 3ICXA 5EE0A 1Z3EB 1X66A 2HDOA 5ALPA 2WAQC 4XUSA 4KN4A 5AI8A 3ZDEA 5ALXA 4RQ6A 1QLNA 5J2IA 2HHWA 3RAXA 4HYKA 1NJZA 2B6GA 4IC9A 3T3FA 3LVWA 4BWJA 4ECSA 4RQ3A 5KFAA 4CNQA 2ASLA 1DGSA 3FYHA 3G6YA 3C21A 4LZDA 3RR7A 3PVXA 1MC8A 3F2BA 3QEBZ 4NLNA 7ICFA 4KLHA 3PX4A 4PPXA 1Z19A 5KFLA 1D9FA 4DFDA 3QNMA 1J2MA 2XY7A 1QCKA 2Q0ZX 7ICEA 3AU6A 3N7SC 4RQNA 2GWSA 2E1EA 9ICAA 1AROP 1TAMA 2JHDA 1D9DA 1FIQA 1ZQYA 4QZFA 2H3ZA 4RNMA 2YMQA 4US9A 3BQTA 4UBCA 2BCUA 2R8JA 5KNIA 1L7PA 1UHUA 4Y2VA 1JALA 1NK6A 9ICQA 4R66A 3SMVA 2EAOA 1ZQEA 3G6VA 2PKEA 3FAHA 1DRGA 3WU2U 4MFFA 3RAQA 4UASA 2CXYA 2HVIA 3L4PA 2HBKA 5ALRA 4DQIA 2AGQA 5KFSA 2HCFA 3KOOA 7ICRA 1PZNA 3SD7A 4NLBA 4QZ8A 2PI4A 1JXLA 4RQ7A 4HAIA 4O5CA 5T14A 3IM1A 5KFHA 2G08A 3JPQA 3VCBA 2YTUA 3WKDA 1ZQRA 4RNOA 1WG8A 3PR4A 9ICEA 1SZHA 2R8IA 1OW5A 3SI8A 3C28A 1RM6C 1S76D 1Q46A 2OYYA 1F5SA 5B66U 2I9GA 5J2DA 2AQ4A 3GIJA 5IINA 4DSFA 4RQMA 4KLLA 2OEHA 3HPOA 2W03A 2YQEA 9ICLA 5ALJA 2O6KA 5ALHA 7ICHA 3GFKB 3NVWA 2GLEA 2K4PA 5GTHU 2IA6A 1X9XA 1N62A 2K4HA 4DO9A 4P0QB 2EZXA 5KFTA 1SKWA 3TACB 5DG9A 1UCVA 5KFIA 3LWLA 3PO4A 1L6NA 1FFVA 3U26A 3C23A 4GLXA 1U4BA 3RB6A 1Y88A 3PMNA 5AICA 4DFPA 5D4BA 3SV4A 4M9LA 1RPLA 1U47A 2NRXA 2F76X 5EE9A 4F2SA 3PZPA 3RFAA 2I1QA 2KG5A 4DSEA 5AM2A 3TANA 1T94A 4NV0A 4AYBC 4I2IA 4XQ8A 1T3NA 4DSLA 2OXOA 1URJA 5K4LA 2G07A 3NUQA 4KLSA 1A76A 2E1FA 2MSNA 2NO5A 3B0XA 2WF5A 2BPGA 3HX0A 1TK8A 1WUDA 1U45A 2XY6A 9ICWA 4O3PA 2KHVA 1LKYA 2IBKA 1IXRA 4YD1A 4MFAA 2M9NA 4C4TA 2XIDA 1ZQDA 3NS1A 4DSIA 2F8KA 3I1YA 2QARB 2EQYA 2FE9A 4YR0A 3QU2A 2KE7A 4J9RA 5AK4A 5AKYA 3THVA 4F71A 4KLJA 2HOFA 2P35A 4JK1A 4ECTA 3SAFA 1TAUA 1AQ6A 4G3IA 1YT3A 3C5GA 1JXEA 4QWAA 1SXEA 2KKVA 3GZFA 4PGQA 2WB1F 5AKKA 5ALOA 4I2CA 3RJHA 5KFYA 2F1JA 5AHXA 4DOBA 1NKCA 2W9BB 1C7YA 4DL2A 1XNSA 2W8KA 1PVQA 1UT5A 4F4KA 3PMLA 8ICQA 3ZDBA 4LJXA 4F2RA 1T7PA 5AM4A 2ZIXA 2KTQA 2OWOA 2NRVA 4I28A 2EH9A 1XS9D 5KFBA 3PX6A 3KKAC 3V6JA 2WTFA 3PSIA 1H38A 2KOBA 1ZQFA 4IQWA 2N1RA 4DSJA 2FLPA 2W3SA 3OSNA 1S0MA 2F1HA 2WHEA 3HW8A 1ZQAA 2MUTA 4QWDA 3BJYA 5ALIA 2UVRA 3RB4A 4WJ3B 4QZEA 4B9LA 3V7LA 4ZOHC 2Y1IA 2YN4A 1QQ5A 1WWVA 1OUQA 2FI1A 3WKBA 4DFJA 3VC8A 1MQ2A 2PFNA 2J6TA 3BQ0A 2LPEA 4F92B 5ALUA 4DQQA 3Q8QB 1WWUA 4OJ5A 2BCSA 1U9LA 4YCXA 5KT4A 2RDJA 3HKZC 4ED6A 1N5WA 1U49A 3I76A 1XSNA 1VJ5A 8ICJA 1XSPA 1IIPA 1QSSA 3RJGA 5J2BA 4F91B 3ZDDA 3C2MA 2J6SA 3NASA 2LHTA 1TK0A 4ECUA 2JZBB 3AL0B 2KSOA 3AQFA 4GXJA 1ZD2P 3GILA 3TFSA 2AGOA 4PZOA 4F5QA 1ZRMA 5J2EA 3BQ1A 1FEZA 2BHNA 4IQVA 3SR6A 3GIKA 4DLGA 4K4GA 2G06A 2NRZA 4J9PA 5J8YA 4QZ9A 4ED0A 1NJXA 4UB8U 3IP4B 4RQ4A 3KKAA 1TAQA 8ICPA 4FZNA 1BPEA 2LYHA 5AIAA 5CWRA 1L8OA 2P6RA 4RPXA 9ICCA 5CR0A 3WK8A 1L3SA 1J2NA 4CGZA 2W7OA 4TUPA 4O3RA 3MDAA 2ZUDA 1N5XA 4UB3A 1RYSA 3GV8B 3QUCA 4RPYA 2FDRA 2HBMA 2BGWA 3PX0A 5KFPA 4US8A 4Z6EA 1S8OA 1Z00B 1ZRNA 5AKEA 8ICSA 2KIVA 9ICUA 4RQ5A 4Y2RA 3MC1A 3TFRA 1F44A 3GV7B 1C20A 5KG2A 5GTIU 3BS5B 2VJ5A 4I2FA 2WF8A 4EBDA 2HVHA 4F4XA 2ZXIA 3PW2A 5DBBA 2PI5A 4UATA 1QTMA 4JWNA 2W9MA 1BPXA 3HP6A 8ICHA 3TQ1A 4EBCA 3JPSA 3UQ2A 3ONNA 3MR3A 1VLBA 4YFKA 5EWGA 1TV9A 4RT2A 3I28A 1BPYA 4EZ6A 2ODGA 3AU2A 5KFCA 3EZ5A 1ECWA 5DBCA 2AXTU 1LVHA 3M9NB 1NK0A 1ZQWA 4O3NA 4YVZA 1CUKA 5AKHA 1V85A 2K4IA 2DBYA 3TI0A 4MFCA 1KFSA 1Z1VA 4PHPA 3K4GA 4EELA 4M9HA 5KFWA 3RH5A 4IR9A 4FS1A 2KK0A 2PMZF 4R65A 2W55A 3ISDA 1ZQQA 4ECYA 9ICSA 5ALQA 1JUDA 3S6JA 5ALZA 1QQ7A 1NK4A 2DPJA 5AK3A 5KT3A 3H40A 1SV4A 5KFZA 5DLGA 4Z6DA 2QLTA 3OGUA 3KHLA 2DPIA 5J2KA 2JR5A 8ICXA 1ZQXA 5ALYA 2VA2A 4C8OA 1L3UA 4B9UA 2RP5A 3WK5A 3V7JA 2K8AA 5J0UA 4ECVA 4C4SA 4KTQA 1BPBA 2JEIA 2ESEA 5DDMA 3D6JA 3HT3A 1NJWA 5KFEA 5KT5A 3BS7A 4DQPA 4ECZA 3KTQA 2HMXA 1SWWA 4Z6FA 1N60A 2ALZA 1SL2A 7ICUA 5ALVA 4NLZA 1F0MA 5EOZA 2ASJA 2HI0A 2W3RA 3RJJA 2YB1A 1PVRA 4F50A 4J9SA 5AKLA 3ZD9A 2XGQA 4NM1A 2VJ4A 1IG6A 4J03A 3RB0A 2F8LA 5KFFA 4FZLA 3H0LB 2IOFA 5B5EU 2PFQA 3SV3A 2EZZA 3HJEA 2FMPA 1L8LA 4IL6U 5ALFA 3ORYA 4BXOB 2W54A 2BCQA 4OD0A 3CYMA 1IM4A 5TISU 3M1YA 3TAQA 5EWFA 5KFUA 5IIIA 2KIWA 5KFQA 4MEYA 4P0QA 4U7CA 4CCHA 2EAPA 4QJFB 5IILA 1KRPA 4P0PB 3ISCA 3AQEA 3QXGA 2E8NA 3EYZA 1X9WA 7ICNA 4ICAA 1HJPA 4KLTA 4DL6A 2I5HA 2ZJAA 5C0YA 2BCRA 4G9BA 4ED7A 3T5JA 4JV0A 2VA3A 4OJOA 4R64A 3IHQB 5L1KA 3JPOA 1Z1BA 1DXSA 3AN1A 4KLDA 2WF7A 3SEIA 4YXJA 2A19A 5KT2A 7ICGA 1NOMA 3A0HU 4XRHA 3AUOA 3MR5A 4UQGA 4ECWA 2BPCA 4MHVA 7ICKA 2KP7A 4RQ1A 1ZQBA 2HOIA 3A0BU 5IIOA 9ICNA 5AI6A 5J2HA 3N4MB 4QNLA 3MR2A 2QARA 1SZPA 4TUSA 2ZTDA 1KTQA 4O5EA 2R18A 4FZMA 8ICYA 2G09A 1WCNA 4J9OA 3M8RA 2LM1A 4QZHA 2FPMA 4B9VA 4UAZA 4F3OA 1S0OA 1ZD5A 2VA8A 4EEKA 4OO1J 1SIJA 4UB2A 2FLLA 4P2HA 5J0QA 1RQLA 3RF9A 3QU9A 4DOAA 5J0PA 4YQWA 3RB3A 1KFDA 5IIKA 4YMNA 4Y2TA 5BOMA 7ICQA 3HWTA 1ZJMA 2Y1JA 1COOA 4BUGA 2W9BA 1JI7A 4F4ZA 5KTQA 5CA7A 4M0AA 5ALWA 4C0ZA 4GC7A 4U6PA 3V72A 3ETLA 4M6WB 4Q44A 1BPDA 5G5HA 3FDSA 3WK7A 3ED5A 1TK5A 2BKEA 4GXIA 3LK9A 2LM4A 4F93B 5BPCA 4BDPA 2G5IB 1N61A 1ZQCA 2PFOA 2B0CA 3ALRA 5ALLA 8ICWA 1PK3A 2BDUA 1GO3F 4ACOA 4OCZA 4F5RA 4QWCA 2BZFA 1Q3VA 4O0IA 5CRXA 3OHBA 3QU5A 1J97A 4EYIB 2JGAA 3C2LA 1DGJA 5JU5A 3RBEA 4B9SA 4RNNA 2FLNA 5AI9A 5KAIU 5KG1A 1HIWA 4A8EA 4BJQA 5J2FA 2ZIUB 2EANA 1L7NA 2NV3A 2FMQA 4PL1A 1UQVA 4NWIA 1FO4A 5J0OA 4ELVA 1NKBA 2HHUA 9ICTA 3D2QA 2RRDA 2RDIA 2DGZA 5TZVA 4DWIA 5HMLA 1S5LU 5EE3A 4C4RA 2LYAA 4OJ6A 3G6XA 2JZBA 3PNCA 8ICRA 3C1ZA 1N2XA 2BQUA 1ZD3A 1ZQMA 3M6KA 2KEYA 3PW7A 3L5KA 4Q8FA 4FO6A 4FBTA 1X2IA 1KW4A 1ZQOA 2KN7A 4NLCA 8ICNA 5L1JA 2DUYA 5AI5A 2CRXA 3WK4A 4P4OA 2KFNA 5AK6A 1QSLA 1BVSA 8ICCA 2DF4B 5KFJA 2K60A 2XY5A 4O3QA 5J8YC 4P4PA 5J2AA 2EDUA 2HHVA 2KVCA 4QW9A 2HW3A 4XA5A 5AI4A 1WCLA 2RLTA 5KFOA 2KJ9A 4ED8A 3BZKA 4Y2YA 4DL7A 3V6HA 2LBOA 5L1MA 4J9KA 4UBBA 9ICHA 4MEXA 8ICOA 3IRUA 2ZG6A 3PSTA 4IS7A 2OH2A 4DQRA 2HHSA 4IR1A 4C8NA 1TKDA 1Z00A 3MGVA 1RDFA 4JMUA 2KICA 4Y2PA 3V6KA 4RU9A 1X40A 3ETRA 3KD3A 5AKIA 1KN5A 4PL2A 2NRWA 3BS5A 9ICRA 4PH5A 4I29A 3T5HA 4BX9C 2RHFA 4C7ZA 2E8PA 7ICOA 2W9CB 5AM1A 1S10A 4C8LA 4UB6U 4I27A 1A6SA 3QZ7A 5JTIA 5J0TA 2ZIWB 4EBEA 1NZPA 4R63A 1S0VA 4KLMA 3NVZA 1JN3A 4AP9A 4UB1A 1X9SA 3FC4A 2WF9A 3GIMA 5AK5A 1BPZA 4M2YA 2EZYA 4P4MA 3N7RC 2XI9A 4GXKA 5KT6A 3RH6A 2E8OA 2XVTA 3CRXA 4Y2UA 5J0SA 2HHXA 1PVPA 9ICVA 2C28A 5KFDA 3ISBA 4KN7A 3MGIA 2ES6A 1ZYQA 5L1IA 1NZBA 2H5XA 4DEZA 1A0PA 4USAA 8ICGA 4ELTA 1V9PA 3QX7A 2QB0B 3N7PD 2KMDA 2ZXHA 5KL1B 3FM9A 3ZD8A 1SL1A 3RRGA 2E8MA 4DS4A 1A77A 2ATLA 2J6UA 4I2AA 1ZQUA 5AKZA 5JRTA 4R8UB 3KFUF 2ZIVA 4C80A 9ICJA 4I2GA 9ICGA 2PMZC 3WKCA 2GOLA 2XGPA 4ECRA 3AMZA 3SAGA 2KZ3A 2KJ8A 4QZGA 2KVSA 2DFLA 4B9TA 3Q8KA 3F5AA 1DK3A 2F3NA 1ZQTA 4C8KA 9ICKA
chains in the Genus database with same CATH topology
3BS7A 3TADA 1SXDA 3K1RB 2DL0A 2DKXA 3BQ7A 2EANA 4MHVA 4RQMA 1X40A 2D8CA 2KSOA 3BS5A 1F0MA 1SV0A 1B4FA 1UQVA 2QARA 1OXJA 2E8PA 2EAMA 3HILA 4PZOA 1SXEA 2DKZA 2GLEA 1SV0C 2K4PA 1V38A 4RQNA 1X9XA 1B0XA 5JTIA 5J8YA 1PK1B 2QB1A 3TACB 1UCVA 1COKA 1SGGA 3KKAA 3TADC 1V85A 1Z1VA 2LMRA 3KKAC 5F3XB 5KNIA 2E8OA 2EAOA 1KW4A 2KG5A 1JI7A 2ES6A 1PK1A 2EAPA 2Y9TA 1LKYB 2QKQA 2K60A 2E8NA 2F44A 4PZNA 3SENA 2QB0B 5J8YC 2KMDA 1WWVA 2E8MA 3H8MA 1SV4A 1X66A 2D3DA 4NL9A 2KIVA 5JRTA 1RG6A 2LPEA 4NL9C 2YTUA 2KSOB 1WWUA 1LKYA 4NJ8A 3BS5B 1PK3A 2JV3A 2B6GA 3IDWA 2Y9UA 5L1MA 2F8KA 1OW5A 2QB0A 1DXSA 2QARB 2FE9A 2KE7A 4IS7A 3SEIA 2ESEA 2F3NA 5JU5A 2L5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS7 A;  3TAD A;  1SXD A;  3K1R B;  2DL0 A;  2DKX A;  3BQ7 A;  2EAN A;  4MHV A;  4RQM A;  1X40 A;  2D8C A;  2KSO A;  3BS5 A;  1F0M A;  1SV0 A;  1B4F A;  1UQV A;  2QAR A;  1OXJ A;  2E8P A;  2EAM A;  3HIL A;  4PZO A;  1SXE A;  2DKZ A;  2GLE A;  1SV0 C;  2K4P A;  1V38 A;  4RQN A;  1X9X A;  1B0X A;  5JTI A;  5J8Y A;  1PK1 B;  2QB1 A;  3TAC B;  1UCV A;  1COK A;  1SGG A;  3KKA A;  3TAD C;  1V85 A;  1Z1V A;  2LMR A;  3KKA C;  5F3X B;  5KNI A;  2E8O A;  2EAO A;  1KW4 A;  2KG5 A;  1JI7 A;  2ES6 A;  1PK1 A;  2EAP A;  2Y9T A;  1LKY B;  2QKQ A;  2K60 A;  2E8N A;  2F44 A;  4PZN A;  3SEN A;  2QB0 B;  5J8Y C;  2KMD A;  1WWV A;  2E8M A;  3H8M A;  1SV4 A;  1X66 A;  2D3D A;  4NL9 A;  2KIV A;  5JRT A;  1RG6 A;  2LPE A;  4NL9 C;  2YTU A;  2KSO B;  1WWU A;  1LKY A;  4NJ8 A;  3BS5 B;  1PK3 A;  2JV3 A;  2B6G A;  3IDW A;  2Y9U A;  5L1M A;  2F8K A;  1OW5 A;  2QB0 A;  1DXS A;  2QAR B;  2FE9 A;  2KE7 A;  4IS7 A;  3SEI A;  2ESE A;  2F3N A;  5JU5 A;  2L5Y A; 
#chains in the Genus database with same CATH topology
 3TAD A;  3C1Y A;  2XO7 A;  4PHA A;  2F1I A;  3Q8M A;  5CB1 A;  3E2E A;  1M6Y A;  3C2K A;  1ZQP A;  4LZG A;  2MRL A;  1JRP A;  2YY6 A;  2Z7J A;  5DB6 A;  1NK7 A;  1DOQ A;  1D8L A;  3EW9 A;  4DF8 A;  2HBL A;  4DFM A;  2ZTE A;  1HUO A;  5AM0 A;  7ICP A;  3UXN A;  3MDC A;  3Q8R B;  5AM5 A;  4QZA A;  4PHD A;  4ELU A;  2ZJ8 A;  4BGD A;  3EPI A;  8ICB A;  2E3T A;  4QZB A;  3ZI4 A;  3JPP A;  5F3X B;  7ICL A;  3PW0 A;  8ICA A;  5KFR A;  5HR6 A;  4UB5 A;  3H8S A;  2KZM A;  3MR6 A;  4PHE A;  3OJU A;  1L3T A;  2QKQ A;  4DQS A;  2ZUB A;  1N48 A;  4TQS A;  2PXI A;  4BXO A;  5J2J A;  2A3V A;  5KG4 A;  3N97 B;  5HP4 A;  1S0N A;  3IG8 A;  2D3D A;  8ICL A;  5BOL A;  3QUB A;  3QE9 Y;  3H0R B;  4NM2 A;  5ALD A;  3T79 A;  3MFI A;  3T5K A;  1NK8 A;  4GFJ A;  3H8J A;  3RJI A;  4Q8E A;  4YP3 A;  1ZJN A;  4KLI A;  4P0P A;  2OM6 A;  3NGD A;  4KLU A;  7ICT A;  4UAY A;  3M9M B;  7ICI A;  2MU2 A;  4YMO A;  2NO4 A;  1K1S A;  4RQ2 A;  1T3Q A;  2XIC A;  2AU0 A;  1QH9 A;  3KHG A;  1HEK A;  4M9G A;  2DL0 A;  5J2G A;  9ICF A;  3QUT A;  1QSY A;  4JUZ A;  3JPN A;  3PV8 A;  2XC9 A;  2ZJ5 A;  4CF4 A;  4UAU A;  1KDH A;  1SL0 A;  4KMO B;  5A0L A;  1SB3 C;  1NJY A;  3JPT A;  5J0Y A;  2W43 A;  3MAB A;  3MBY A;  4IQU A;  7ICJ A;  1UT8 A;  1PK1 B;  3PSF A;  2XCA A;  2UVV A;  4F4Y A;  3DDH A;  4FE3 A;  3QU4 A;  5DQH A;  1O08 A;  4CE6 A;  3H4D A;  1N63 A;  1BGX T;  1ZQL A;  4ECQ A;  2CN1 A;  1TFR A;  2YX8 A;  2A1J B;  1QQ6 A;  5ALS A;  2MAX A;  4UAW A;  2V4Q A;  4QIW F;  1MA7 A;  2KKP A;  3GII A;  2OHF A;  4ED3 A;  2JH1 A;  3NTU A;  2UVW A;  1S77 D;  3EPG A;  1L7O A;  3Q8P B;  2HOQ A;  2ZTC A;  1Z4N A;  2VKQ A;  2B21 A;  4IQT A;  2K8B B;  3SQI A;  9ICP A;  1L7M A;  5CHG A;  2HBJ A;  2IOH A;  2W04 A;  1RXW A;  2PFP A;  4K4I A;  1ZD4 A;  2R8H A;  1S9F A;  4DSK A;  4I2B A;  4EX6 A;  4TUQ A;  4M6W A;  4DOC A;  3HRD D;  4ED2 A;  2AQ0 A;  4PGX A;  1L3V A;  3SZ2 A;  7ICV A;  4DLE A;  3UMB A;  4EX7 A;  4IRK A;  4M9N A;  2M0N A;  5DB9 A;  1NK9 A;  2Y0S F;  3QYP A;  2C2E A;  3DV9 A;  1IV8 A;  4PJ0 U;  2D8C A;  1UA1 A;  3N28 A;  4KX5 A;  1Z4O A;  1CI4 A;  3LYS A;  3EWA A;  2DQN B;  1KKX A;  1X6J A;  5J29 A;  1V38 A;  3TKA A;  4RPZ A;  4Y2Q A;  2ZIU A;  2AH5 A;  1SGG A;  2BDP A;  3H0M B;  7ICM A;  4TQR A;  5HHI A;  4O3S A;  2LMR A;  5ALN A;  4ECX A;  2WAQ F;  5DLF A;  2KHQ A;  2YML A;  1YZ6 A;  1T4G A;  3LVV A;  2ZUC A;  3UPQ A;  5KFM A;  2D6F C;  1ZQH A;  4FBU A;  4DL5 A;  4Z6C A;  2AGP A;  4O3M A;  3PO5 A;  2R8K A;  2XCP A;  2VAN A;  2R8G A;  3SEN A;  5KAF U;  4KMU A;  4RUA A;  4Y2S A;  2F77 X;  2G5H B;  4MF2 A;  2WB1 C;  2W8L A;  3K1Z A;  2P66 A;  4O9M A;  2KV2 A;  4DCC A;  5KG7 A;  3OJS A;  4KLO A;  4NL9 C;  1FFU A;  5CEH A;  3IV6 A;  2K8C B;  2HSZ A;  5HMM A;  1XSL A;  2AJQ A;  3NRW A;  4F5O A;  1ZQS A;  5KFG A;  4YMM A;  3RH4 A;  5C5J A;  2KZZ A;  1Q8K A;  5J2C A;  3OPX A;  1S97 A;  5L1L A;  5KG6 A;  4EYH B;  2W9A A;  4EZ9 A;  2L5Y A;  4CDG A;  2W7P A;  3BDP A;  2Q4T A;  4YR2 A;  1ZQV A;  3ZDC A;  2NRT A;  4I2E A;  4J9L A;  4X5V A;  8ICU A;  4UAR A;  1YZ7 A;  2IOF K;  4GC6 A;  2JEF A;  2C2R A;  2HHQ A;  5CJ7 A;  3PW4 A;  1OXJ A;  2EAM A;  3HIL A;  3RRH A;  4Q45 A;  2BR0 A;  1ZQI A;  4Y2J A;  5KL8 B;  5HNK A;  1ZQK A;  3SYZ A;  4KX3 A;  2LI6 A;  3H7I A;  2FPK A;  9ICM A;  4PGY A;  2JRZ A;  3TAP A;  2QB1 A;  1PUZ A;  1XO1 A;  5CP2 A;  2P6U A;  1D8B A;  5AKJ A;  3LWM A;  9ICB A;  1BNP A;  2W9C A;  1UPH A;  4YR3 A;  2KD1 A;  4B9M A;  5AI0 A;  3H8W A;  4O3O A;  4OJP A;  2BPF A;  5DQG A;  2ZIW A;  1KL9 A;  3O0F A;  3M9O B;  5F9N A;  2LKY A;  4I2J A;  3KHH A;  1NI3 A;  3B9J A;  2BCV A;  3RR8 A;  5KG5 A;  4F72 A;  5KT7 A;  9ICX A;  2H3V A;  3K75 D;  4J9Q A;  1BNO A;  4BWM A;  3H8M A;  2UVU A;  3RJF A;  4NL9 A;  2V4R A;  4LVS A;  4UB4 A;  1SKS A;  1MN8 A;  3RJK A;  3MFH A;  4Y2X A;  1X42 A;  7ICS A;  5KG3 A;  3KHR A;  1B22 A;  2V9W A;  4B9N A;  3GV5 B;  5AKG A;  2QB0 A;  1SWV A;  1XU4 A;  4YD2 A;  5IIJ A;  4M04 A;  5J0R A;  4MF8 A;  2H3Q A;  4R8U A;  1RXV A;  1Q3U A;  1SXD A;  1ZET A;  1CEZ A;  2DKX A;  2RQ5 A;  3BQ7 A;  4E0D A;  3OHA A;  2LYB A;  4DL4 A;  2I6X A;  2WF6 A;  2ISP A;  5JUM A;  1B4F A;  5G5G A;  3UM9 A;  3KZX A;  3UMG A;  1XWL A;  4B6J A;  4UW9 A;  2AHO B;  4GIB A;  1SV0 C;  2YMP A;  3PR5 B;  1ZQG A;  5ALG A;  5KFK A;  3Q8L A;  4AYB F;  1KFT A;  2G0A A;  2C22 A;  5DGB A;  3RTV A;  1JRO A;  2A1A A;  3WK9 A;  4C7Y A;  3UXO A;  3TAD C;  3KBB A;  1MQ3 A;  5HR7 A;  3OTQ A;  1P7D A;  3NRZ A;  3QUQ A;  2FPL A;  4YN4 A;  2KFZ A;  1ZXI A;  1TVA A;  2DWQ A;  5DGA A;  1KLN A;  1ED1 A;  3QU7 A;  4CF5 A;  4ZH4 A;  3PSP A;  1LKY B;  3C29 A;  3EUB 2;  4IRC A;  4EEN A;  3R9K A;  2K4E A;  2WFA A;  3UQ0 A;  8ICT A;  4F5P A;  1ZQ1 C;  4EEY A;  4QZI A;  1KQQ A;  3GU3 A;  4K4H A;  4KIT B;  5E79 U;  4DFK A;  1MSW D;  4OJL A;  1U48 A;  2JEG A;  3L3F X;  5D49 A;  1RG6 A;  5AM3 A;  3T5L A;  5ALM A;  2C2D A;  2K89 A;  5KFN A;  3AM9 A;  1ZQJ A;  2VIX A;  4RZR A;  4QWE A;  5IIM A;  4NY8 A;  3MGH A;  2W11 A;  1NNL A;  3Q8S B;  4C8M A;  1SKR A;  1L5U A;  1CRX A;  3WKA A;  3M7D A;  1V97 A;  3TAR A;  5DDY A;  3F53 A;  1KEJ A;  1ZQN A;  1RYU A;  4DS5 A;  8ICF A;  4JWM A;  3C5F A;  8ICI A;  4M47 A;  3K1R B;  5H2F U;  3F5E A;  4JB3 A;  4M9J A;  3CW2 C;  2ZIX B;  1SV0 A;  5DB7 A;  5J0X A;  2JH7 A;  4QWB A;  5DQI A;  1UA0 A;  5EE1 A;  2FMS A;  1NK5 A;  4I2H A;  2JMG A;  5FP0 A;  3NVV A;  1X6I A;  1B0X A;  1RQN A;  1VDV A;  3UMC A;  5AKX A;  4FFD A;  2H3F A;  1K5O A;  2MA1 A;  2OCE A;  2H3I A;  2MUT B;  5F9L A;  3JPR A;  3CP8 A;  5KFV A;  1COK A;  4I2D A;  1KSP A;  1XO0 A;  3SAH A;  5KG0 A;  3NVY A;  8ICZ A;  3F2D A;  4J9N A;  3DEE A;  4KLF A;  4CRX A;  5DBA A;  2BQ3 A;  5D46 A;  3PW5 A;  4KLG A;  4RUC A;  5KFX A;  1B43 A;  3D2S A;  1ZOL A;  1PK1 A;  3UXP A;  1LV5 A;  2Y9T A;  4QW8 A;  3HKZ F;  4YG2 A;  5EWE A;  9ICO A;  4KLQ A;  2ISO A;  3RBD A;  2F44 A;  3BQ2 A;  4PZN A;  5J0W A;  1RZT A;  1NKE A;  2HHT A;  3QZ8 A;  4ED1 A;  3OSP A;  4YXM A;  5HHH A;  4JV1 A;  4UAV A;  4TUR A;  4RQ8 A;  5DG7 A;  4FS2 A;  2A1J A;  5DKW A;  5AIB A;  3GDX A;  1HUZ A;  3IN5 A;  9ICI A;  1X9M A;  2KSO B;  4NJ8 A;  8ICE A;  3M8S A;  2JV3 A;  3D2N A;  3WKE A;  3IDW A;  4JV2 A;  4QIW C;  8ICV A;  2IHM A;  5DG8 A;  4KLE A;  2Y9U A;  4RT3 A;  3J81 j;  3CNH A;  1JX4 A;  4RQ0 A;  3GQC A;  1TE2 A;  5ALK A;  1RYR A;  2BQR A;  3ZDA A;  1JIH A;  5ALT A;  4CF3 A;  2KNJ A;  2FJ6 A;  4O5K A;  3E0F A;  1XC9 A;  3F2C A;  2JXJ A;  3V7K A;  1JMS A;  5L9X A;  2CPR A;  4NXZ A;  3WK6 A;  1K1Q A;  2DKZ A;  2KJ5 A;  3KZI U;  4NLG A;  1LB2 B;  1D8Y A;  8ICM A;  2GO7 A;  4QZC A;  4F4W A;  2ASD A;  2ZIV B;  4Q43 A;  3RJE A;  5DB8 A;  3H4B A;  2JEJ A;  3AEV A;  1O03 A;  4QZD A;  3B0Y A;  1KBU A;  2NYV A;  4F8R A;  3IG5 A;  2Y0S C;  2F2A B;  1T8E A;  3QEA Z;  4DF4 A;  2IHN A;  1ZQZ A;  3M6Z A;  1DK2 A;  4DL3 A;  4J9M A;  2E5S A;  1WYG A;  4F5N A;  5ALE A;  1EXN A;  3BZC A;  3LDA A;  2IMW P;  3PY8 A;  4NLK A;  1N56 A;  4IRD A;  8ICK A;  2GH1 A;  2YB4 A;  2YMM A;  3E58 A;  3ICX A;  5EE0 A;  1Z3E B;  1X66 A;  2HDO A;  5ALP A;  2WAQ C;  4XUS A;  4KN4 A;  5AI8 A;  3ZDE A;  5ALX A;  4RQ6 A;  1QLN A;  5J2I A;  2HHW A;  3RAX A;  4HYK A;  1NJZ A;  2B6G A;  4IC9 A;  3T3F A;  3LVW A;  4BWJ A;  4ECS A;  4RQ3 A;  5KFA A;  4CNQ A;  2ASL A;  1DGS A;  3FYH A;  3G6Y A;  3C21 A;  4LZD A;  3RR7 A;  3PVX A;  1MC8 A;  3F2B A;  3QEB Z;  4NLN A;  7ICF A;  4KLH A;  3PX4 A;  4PPX A;  1Z19 A;  5KFL A;  1D9F A;  4DFD A;  3QNM A;  1J2M A;  2XY7 A;  1QCK A;  2Q0Z X;  7ICE A;  3AU6 A;  3N7S C;  4RQN A;  2GWS A;  2E1E A;  9ICA A;  1ARO P;  1TAM A;  2JHD A;  1D9D A;  1FIQ A;  1ZQY A;  4QZF A;  2H3Z A;  4RNM A;  2YMQ A;  4US9 A;  3BQT A;  4UBC A;  2BCU A;  2R8J A;  5KNI A;  1L7P A;  1UHU A;  4Y2V A;  1JAL A;  1NK6 A;  9ICQ A;  4R66 A;  3SMV A;  2EAO A;  1ZQE A;  3G6V A;  2PKE A;  3FAH A;  1DRG A;  3WU2 U;  4MFF A;  3RAQ A;  4UAS A;  2CXY A;  2HVI A;  3L4P A;  2HBK A;  5ALR A;  4DQI A;  2AGQ A;  5KFS A;  2HCF A;  3KOO A;  7ICR A;  1PZN A;  3SD7 A;  4NLB A;  4QZ8 A;  2PI4 A;  1JXL A;  4RQ7 A;  4HAI A;  4O5C A;  5T14 A;  3IM1 A;  5KFH A;  2G08 A;  3JPQ A;  3VCB A;  2YTU A;  3WKD A;  1ZQR A;  4RNO A;  1WG8 A;  3PR4 A;  9ICE A;  1SZH A;  2R8I A;  1OW5 A;  3SI8 A;  3C28 A;  1RM6 C;  1S76 D;  1Q46 A;  2OYY A;  1F5S A;  5B66 U;  2I9G A;  5J2D A;  2AQ4 A;  3GIJ A;  5IIN A;  4DSF A;  4RQM A;  4KLL A;  2OEH A;  3HPO A;  2W03 A;  2YQE A;  9ICL A;  5ALJ A;  2O6K A;  5ALH A;  7ICH A;  3GFK B;  3NVW A;  2GLE A;  2K4P A;  5GTH U;  2IA6 A;  1X9X A;  1N62 A;  2K4H A;  4DO9 A;  4P0Q B;  2EZX A;  5KFT A;  1SKW A;  3TAC B;  5DG9 A;  1UCV A;  5KFI A;  3LWL A;  3PO4 A;  1L6N A;  1FFV A;  3U26 A;  3C23 A;  4GLX A;  1U4B A;  3RB6 A;  1Y88 A;  3PMN A;  5AIC A;  4DFP A;  5D4B A;  3SV4 A;  4M9L A;  1RPL A;  1U47 A;  2NRX A;  2F76 X;  5EE9 A;  4F2S A;  3PZP A;  3RFA A;  2I1Q A;  2KG5 A;  4DSE A;  5AM2 A;  3TAN A;  1T94 A;  4NV0 A;  4AYB C;  4I2I A;  4XQ8 A;  1T3N A;  4DSL A;  2OXO A;  1URJ A;  5K4L A;  2G07 A;  3NUQ A;  4KLS A;  1A76 A;  2E1F A;  2MSN A;  2NO5 A;  3B0X A;  2WF5 A;  2BPG A;  3HX0 A;  1TK8 A;  1WUD A;  1U45 A;  2XY6 A;  9ICW A;  4O3P A;  2KHV A;  1LKY A;  2IBK A;  1IXR A;  4YD1 A;  4MFA A;  2M9N A;  4C4T A;  2XID A;  1ZQD A;  3NS1 A;  4DSI A;  2F8K A;  3I1Y A;  2QAR B;  2EQY A;  2FE9 A;  4YR0 A;  3QU2 A;  2KE7 A;  4J9R A;  5AK4 A;  5AKY A;  3THV A;  4F71 A;  4KLJ A;  2HOF A;  2P35 A;  4JK1 A;  4ECT A;  3SAF A;  1TAU A;  1AQ6 A;  4G3I A;  1YT3 A;  3C5G A;  1JXE A;  4QWA A;  1SXE A;  2KKV A;  3GZF A;  4PGQ A;  2WB1 F;  5AKK A;  5ALO A;  4I2C A;  3RJH A;  5KFY A;  2F1J A;  5AHX A;  4DOB A;  1NKC A;  2W9B B;  1C7Y A;  4DL2 A;  1XNS A;  2W8K A;  1PVQ A;  1UT5 A;  4F4K A;  3PML A;  8ICQ A;  3ZDB A;  4LJX A;  4F2R A;  1T7P A;  5AM4 A;  2ZIX A;  2KTQ A;  2OWO A;  2NRV A;  4I28 A;  2EH9 A;  1XS9 D;  5KFB A;  3PX6 A;  3KKA C;  3V6J A;  2WTF A;  3PSI A;  1H38 A;  2KOB A;  1ZQF A;  4IQW A;  2N1R A;  4DSJ A;  2FLP A;  2W3S A;  3OSN A;  1S0M A;  2F1H A;  2WHE A;  3HW8 A;  1ZQA A;  2MUT A;  4QWD A;  3BJY A;  5ALI A;  2UVR A;  3RB4 A;  4WJ3 B;  4QZE A;  4B9L A;  3V7L A;  4ZOH C;  2Y1I A;  2YN4 A;  1QQ5 A;  1WWV A;  1OUQ A;  2FI1 A;  3WKB A;  4DFJ A;  3VC8 A;  1MQ2 A;  2PFN A;  2J6T A;  3BQ0 A;  2LPE A;  4F92 B;  5ALU A;  4DQQ A;  3Q8Q B;  1WWU A;  4OJ5 A;  2BCS A;  1U9L A;  4YCX A;  5KT4 A;  2RDJ A;  3HKZ C;  4ED6 A;  1N5W A;  1U49 A;  3I76 A;  1XSN A;  1VJ5 A;  8ICJ A;  1XSP A;  1IIP A;  1QSS A;  3RJG A;  5J2B A;  4F91 B;  3ZDD A;  3C2M A;  2J6S A;  3NAS A;  2LHT A;  1TK0 A;  4ECU A;  2JZB B;  3AL0 B;  2KSO A;  3AQF A;  4GXJ A;  1ZD2 P;  3GIL A;  3TFS A;  2AGO A;  4PZO A;  4F5Q A;  1ZRM A;  5J2E A;  3BQ1 A;  1FEZ A;  2BHN A;  4IQV A;  3SR6 A;  3GIK A;  4DLG A;  4K4G A;  2G06 A;  2NRZ A;  4J9P A;  5J8Y A;  4QZ9 A;  4ED0 A;  1NJX A;  4UB8 U;  3IP4 B;  4RQ4 A;  3KKA A;  1TAQ A;  8ICP A;  4FZN A;  1BPE A;  2LYH A;  5AIA A;  5CWR A;  1L8O A;  2P6R A;  4RPX A;  9ICC A;  5CR0 A;  3WK8 A;  1L3S A;  1J2N A;  4CGZ A;  2W7O A;  4TUP A;  4O3R A;  3MDA A;  2ZUD A;  1N5X A;  4UB3 A;  1RYS A;  3GV8 B;  3QUC A;  4RPY A;  2FDR A;  2HBM A;  2BGW A;  3PX0 A;  5KFP A;  4US8 A;  4Z6E A;  1S8O A;  1Z00 B;  1ZRN A;  5AKE A;  8ICS A;  2KIV A;  9ICU A;  4RQ5 A;  4Y2R A;  3MC1 A;  3TFR A;  1F44 A;  3GV7 B;  1C20 A;  5KG2 A;  5GTI U;  3BS5 B;  2VJ5 A;  4I2F A;  2WF8 A;  4EBD A;  2HVH A;  4F4X A;  2ZXI A;  3PW2 A;  5DBB A;  2PI5 A;  4UAT A;  1QTM A;  4JWN A;  2W9M A;  1BPX A;  3HP6 A;  8ICH A;  3TQ1 A;  4EBC A;  3JPS A;  3UQ2 A;  3ONN A;  3MR3 A;  1VLB A;  4YFK A;  5EWG A;  1TV9 A;  4RT2 A;  3I28 A;  1BPY A;  4EZ6 A;  2ODG A;  3AU2 A;  5KFC A;  3EZ5 A;  1ECW A;  5DBC A;  2AXT U;  1LVH A;  3M9N B;  1NK0 A;  1ZQW A;  4O3N A;  4YVZ A;  1CUK A;  5AKH A;  1V85 A;  2K4I A;  2DBY A;  3TI0 A;  4MFC A;  1KFS A;  1Z1V A;  4PHP A;  3K4G A;  4EEL A;  4M9H A;  5KFW A;  3RH5 A;  4IR9 A;  4FS1 A;  2KK0 A;  2PMZ F;  4R65 A;  2W55 A;  3ISD A;  1ZQQ A;  4ECY A;  9ICS A;  5ALQ A;  1JUD A;  3S6J A;  5ALZ A;  1QQ7 A;  1NK4 A;  2DPJ A;  5AK3 A;  5KT3 A;  3H40 A;  1SV4 A;  5KFZ A;  5DLG A;  4Z6D A;  2QLT A;  3OGU A;  3KHL A;  2DPI A;  5J2K A;  2JR5 A;  8ICX A;  1ZQX A;  5ALY A;  2VA2 A;  4C8O A;  1L3U A;  4B9U A;  2RP5 A;  3WK5 A;  3V7J A;  2K8A A;  5J0U A;  4ECV A;  4C4S A;  4KTQ A;  1BPB A;  2JEI A;  2ESE A;  5DDM A;  3D6J A;  3HT3 A;  1NJW A;  5KFE A;  5KT5 A;  3BS7 A;  4DQP A;  4ECZ A;  3KTQ A;  2HMX A;  1SWW A;  4Z6F A;  1N60 A;  2ALZ A;  1SL2 A;  7ICU A;  5ALV A;  4NLZ A;  1F0M A;  5EOZ A;  2ASJ A;  2HI0 A;  2W3R A;  3RJJ A;  2YB1 A;  1PVR A;  4F50 A;  4J9S A;  5AKL A;  3ZD9 A;  2XGQ A;  4NM1 A;  2VJ4 A;  1IG6 A;  4J03 A;  3RB0 A;  2F8L A;  5KFF A;  4FZL A;  3H0L B;  2IOF A;  5B5E U;  2PFQ A;  3SV3 A;  2EZZ A;  3HJE A;  2FMP A;  1L8L A;  4IL6 U;  5ALF A;  3ORY A;  4BXO B;  2W54 A;  2BCQ A;  4OD0 A;  3CYM A;  1IM4 A;  5TIS U;  3M1Y A;  3TAQ A;  5EWF A;  5KFU A;  5III A;  2KIW A;  5KFQ A;  4MEY A;  4P0Q A;  4U7C A;  4CCH A;  2EAP A;  4QJF B;  5IIL A;  1KRP A;  4P0P B;  3ISC A;  3AQE A;  3QXG A;  2E8N A;  3EYZ A;  1X9W A;  7ICN A;  4ICA A;  1HJP A;  4KLT A;  4DL6 A;  2I5H A;  2ZJA A;  5C0Y A;  2BCR A;  4G9B A;  4ED7 A;  3T5J A;  4JV0 A;  2VA3 A;  4OJO A;  4R64 A;  3IHQ B;  5L1K A;  3JPO A;  1Z1B A;  1DXS A;  3AN1 A;  4KLD A;  2WF7 A;  3SEI A;  4YXJ A;  2A19 A;  5KT2 A;  7ICG A;  1NOM A;  3A0H U;  4XRH A;  3AUO A;  3MR5 A;  4UQG A;  4ECW A;  2BPC A;  4MHV A;  7ICK A;  2KP7 A;  4RQ1 A;  1ZQB A;  2HOI A;  3A0B U;  5IIO A;  9ICN A;  5AI6 A;  5J2H A;  3N4M B;  4QNL A;  3MR2 A;  2QAR A;  1SZP A;  4TUS A;  2ZTD A;  1KTQ A;  4O5E A;  2R18 A;  4FZM A;  8ICY A;  2G09 A;  1WCN A;  4J9O A;  3M8R A;  2LM1 A;  4QZH A;  2FPM A;  4B9V A;  4UAZ A;  4F3O A;  1S0O A;  1ZD5 A;  2VA8 A;  4EEK A;  4OO1 J;  1SIJ A;  4UB2 A;  2FLL A;  4P2H A;  5J0Q A;  1RQL A;  3RF9 A;  3QU9 A;  4DOA A;  5J0P A;  4YQW A;  3RB3 A;  1KFD A;  5IIK A;  4YMN A;  4Y2T A;  5BOM A;  7ICQ A;  3HWT A;  1ZJM A;  2Y1J A;  1COO A;  4BUG A;  2W9B A;  1JI7 A;  4F4Z A;  5KTQ A;  5CA7 A;  4M0A A;  5ALW A;  4C0Z A;  4GC7 A;  4U6P A;  3V72 A;  3ETL A;  4M6W B;  4Q44 A;  1BPD A;  5G5H A;  3FDS A;  3WK7 A;  3ED5 A;  1TK5 A;  2BKE A;  4GXI A;  3LK9 A;  2LM4 A;  4F93 B;  5BPC A;  4BDP A;  2G5I B;  1N61 A;  1ZQC A;  2PFO A;  2B0C A;  3ALR A;  5ALL A;  8ICW A;  1PK3 A;  2BDU A;  1GO3 F;  4ACO A;  4OCZ A;  4F5R A;  4QWC A;  2BZF A;  1Q3V A;  4O0I A;  5CRX A;  3OHB A;  3QU5 A;  1J97 A;  4EYI B;  2JGA A;  3C2L A;  1DGJ A;  5JU5 A;  3RBE A;  4B9S A;  4RNN A;  2FLN A;  5AI9 A;  5KAI U;  5KG1 A;  1HIW A;  4A8E A;  4BJQ A;  5J2F A;  2ZIU B;  2EAN A;  1L7N A;  2NV3 A;  2FMQ A;  4PL1 A;  1UQV A;  4NWI A;  1FO4 A;  5J0O A;  4ELV A;  1NKB A;  2HHU A;  9ICT A;  3D2Q A;  2RRD A;  2RDI A;  2DGZ A;  5TZV A;  4DWI A;  5HML A;  1S5L U;  5EE3 A;  4C4R A;  2LYA A;  4OJ6 A;  3G6X A;  2JZB A;  3PNC A;  8ICR A;  3C1Z A;  1N2X A;  2BQU A;  1ZD3 A;  1ZQM A;  3M6K A;  2KEY A;  3PW7 A;  3L5K A;  4Q8F A;  4FO6 A;  4FBT A;  1X2I A;  1KW4 A;  1ZQO A;  2KN7 A;  4NLC A;  8ICN A;  5L1J A;  2DUY A;  5AI5 A;  2CRX A;  3WK4 A;  4P4O A;  2KFN A;  5AK6 A;  1QSL A;  1BVS A;  8ICC A;  2DF4 B;  5KFJ A;  2K60 A;  2XY5 A;  4O3Q A;  5J8Y C;  4P4P A;  5J2A A;  2EDU A;  2HHV A;  2KVC A;  4QW9 A;  2HW3 A;  4XA5 A;  5AI4 A;  1WCL A;  2RLT A;  5KFO A;  2KJ9 A;  4ED8 A;  3BZK A;  4Y2Y A;  4DL7 A;  3V6H A;  2LBO A;  5L1M A;  4J9K A;  4UBB A;  9ICH A;  4MEX A;  8ICO A;  3IRU A;  2ZG6 A;  3PST A;  4IS7 A;  2OH2 A;  4DQR A;  2HHS A;  4IR1 A;  4C8N A;  1TKD A;  1Z00 A;  3MGV A;  1RDF A;  4JMU A;  2KIC A;  4Y2P A;  3V6K A;  4RU9 A;  1X40 A;  3ETR A;  3KD3 A;  5AKI A;  1KN5 A;  4PL2 A;  2NRW A;  3BS5 A;  9ICR A;  4PH5 A;  4I29 A;  3T5H A;  4BX9 C;  2RHF A;  4C7Z A;  2E8P A;  7ICO A;  2W9C B;  5AM1 A;  1S10 A;  4C8L A;  4UB6 U;  4I27 A;  1A6S A;  3QZ7 A;  5JTI A;  5J0T A;  2ZIW B;  4EBE A;  1NZP A;  4R63 A;  1S0V A;  4KLM A;  3NVZ A;  1JN3 A;  4AP9 A;  4UB1 A;  1X9S A;  3FC4 A;  2WF9 A;  3GIM A;  5AK5 A;  1BPZ A;  4M2Y A;  2EZY A;  4P4M A;  3N7R C;  2XI9 A;  4GXK A;  5KT6 A;  3RH6 A;  2E8O A;  2XVT A;  3CRX A;  4Y2U A;  5J0S A;  2HHX A;  1PVP A;  9ICV A;  2C28 A;  5KFD A;  3ISB A;  4KN7 A;  3MGI A;  2ES6 A;  1ZYQ A;  5L1I A;  1NZB A;  2H5X A;  4DEZ A;  1A0P A;  4USA A;  8ICG A;  4ELT A;  1V9P A;  3QX7 A;  2QB0 B;  3N7P D;  2KMD A;  2ZXH A;  5KL1 B;  3FM9 A;  3ZD8 A;  1SL1 A;  3RRG A;  2E8M A;  4DS4 A;  1A77 A;  2ATL A;  2J6U A;  4I2A A;  1ZQU A;  5AKZ A;  5JRT A;  4R8U B;  3KFU F;  2ZIV A;  4C80 A;  9ICJ A;  4I2G A;  9ICG A;  2PMZ C;  3WKC A;  2GOL A;  2XGP A;  4ECR A;  3AMZ A;  3SAG A;  2KZ3 A;  2KJ8 A;  4QZG A;  2KVS A;  2DFL A;  4B9T A;  3Q8K A;  3F5A A;  1DK3 A;  2F3N A;  1ZQT A;  4C8K A;  9ICK A; 
#chains in the Genus database with same CATH homology
 3BS7 A;  3TAD A;  1SXD A;  3K1R B;  2DL0 A;  2DKX A;  3BQ7 A;  2EAN A;  4MHV A;  4RQM A;  1X40 A;  2D8C A;  2KSO A;  3BS5 A;  1F0M A;  1SV0 A;  1B4F A;  1UQV A;  2QAR A;  1OXJ A;  2E8P A;  2EAM A;  3HIL A;  4PZO A;  1SXE A;  2DKZ A;  2GLE A;  1SV0 C;  2K4P A;  1V38 A;  4RQN A;  1X9X A;  1B0X A;  5JTI A;  5J8Y A;  1PK1 B;  2QB1 A;  3TAC B;  1UCV A;  1COK A;  1SGG A;  3KKA A;  3TAD C;  1V85 A;  1Z1V A;  2LMR A;  3KKA C;  5F3X B;  5KNI A;  2E8O A;  2EAO A;  1KW4 A;  2KG5 A;  1JI7 A;  2ES6 A;  1PK1 A;  2EAP A;  2Y9T A;  1LKY B;  2QKQ A;  2K60 A;  2E8N A;  2F44 A;  4PZN A;  3SEN A;  2QB0 B;  5J8Y C;  2KMD A;  1WWV A;  2E8M A;  3H8M A;  1SV4 A;  1X66 A;  2D3D A;  4NL9 A;  2KIV A;  5JRT A;  1RG6 A;  2LPE A;  4NL9 C;  2YTU A;  2KSO B;  1WWU A;  1LKY A;  4NJ8 A;  3BS5 B;  1PK3 A;  2JV3 A;  2B6G A;  3IDW A;  2Y9U A;  5L1M A;  2F8K A;  1OW5 A;  2QB0 A;  1DXS A;  2QAR B;  2FE9 A;  2KE7 A;  4IS7 A;  3SEI A;  2ESE A;  2F3N A;  5JU5 A;  2L5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...