2KG5A

Nmr solution structure of arap3-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
HMAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILRLLQTGTEEGSLDPKSDSAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arf-GAP, Rho-GAP domain, ANK repeat and PH domain-containing
publication title The Sam domain of the lipid phosphatase Ship2 adopts a common model to interact with Arap3-Sam and EphA2-Sam.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kg5A01
1LKYA 1UCVA 2KSOB 5F3XB 2LPEA 3BS5B 2KSOA 2QARB 2FE9A 2QARA 2K4PA 5KNIA 4PZOA 2KE7A 3K1RB 3TADC 4NJ8A 2Y9TA 1SXDA 2QB0A 4NL9C 2F3NA 2EAOA 3BS7A 2DL0A 4NL9A 2KMDA 1DXSA 5JTIA 1X9XA 1V38A 2GLEA 1OXJA 3BS5A 1COKA 1OW5A 4PZNA 2B6GA 1F0MA 1JI7A 3TACB 3IDWA 1SXEA 1UQVA 1WWVA 3HILA 3H8MA 4RQMA 5JU5A 2K60A 1PK3A 5L1MA 3BQ7A 2Y9UA 1RG6A 2KIVA 2D8CA 2JV3A 2E8MA 1SGGA 2D3DA 1WWUA 2ESEA 2KG5A 1SV4A 2E8NA 2E8PA 4IS7A 4MHVA 2F44A 3KKAC 1V85A 2DKZA 2F8KA 3KKAA 1PK1B 2DKXA 2ES6A 2LMRA 1LKYB 1KW4A 1X66A 4RQNA 1B0XA 1Z1VA 1X40A 1B4FA 3SENA 2EAPA 2YTUA 1SV0C 2EAMA 2E8OA 2QKQA 2QB0B 2L5YA 1SV0A 2EANA 3TADA 5J8YC 3SEIA 5JRTA 5J8YA 1PK1A 2QB1A
chains in the Genus database with same CATH superfamily
4DLEA 3L5KA 4RT3A 5KG3A 2LPEA 3F5AA 4RZRA 2WAQF 4KMUA 5KT3A 4IL6U 5J0WA 2FE9A 2JR5A 4C0ZA 4P2HA 2KE7A 4UAUA 2H3FA 1FEZA 2H5XA 9ICJA 3RJHA 1RQNA 2H3VA 4RNOA 9ICVA 3TFRA 3PY8A 3Q8PB 3SR6A 1JROA 2YX8A 2PI5A 2KJ5A 4M0AA 1ZQEA 4US9A 2GLEA 1QCKA 4ECZA 3O0FA 1BPXA 8ICTA 4DL2A 9ICXA 4Z6CA 4Y2RA 2RQ5A 5ALKA 2P6RA 2UVWA 9ICMA 5EE0A 5KFFA 2G06A 4RQMA 4CCHA 1SWVA 4XRHA 2AXTU 4R65A 1NK9A 1PVRA 4DS4A 3RB6A 2HBJA 3AEVA 1SL2A 2ASLA 7ICFA 3H7IA 5KFCA 4I29A 3QU4A 2F76X 4DL6A 1WCNA 1Q3VA 1Q46A 3MDCA 3SAFA 2IA6A 2FPMA 2XCPA 2ODGA 2LM1A 1N2XA 4DFDA 4PGXA 1Z19A 3PO5A 3H8JA 8ICQA 4Y2VA 2BR0A 2I9GA 4RU9A 3RR8A 2KHQA 2VA2A 1XWLA 5AKYA 4O3SA 2A1JA 3ZDDA 3A0HU 1MN8A 4DFMA 4YXMA 3LWLA 3EYZA 2HVHA 2RLTA 1QTMA 8ICRA 2HCFA 2JH1A 4MFCA 2DUYA 1S0NA 5ALIA 1ZQDA 4F92B 1QSLA 2YB1A 5E79U 5J8YA 3MGVA 4Y2TA 2G5HB 4NLCA 5AKEA 2R8GA 5JUMA 2ASDA 3UXOA 2ZXHA 4MFAA 2E5SA 2IMWP 2HW3A 1ZQVA 5KFQA 4I2HA 4B9VA 3GU3A 5IINA 4U6PA 1ZOLA 2FMSA 4Q44A 8ICLA 3B0YA 4FZNA 4F8RA 2A3VA 9ICRA 5ALFA 4I27A 5H2FU 4YD1A 2P6UA 4C7YA 2G09A 4NM2A 3UMCA 4UQGA 4DF4A 2OYYA 2C2DA 3PW2A 3RBEA 5ALYA 4Q8FA 3QU9A 4CNQA 4ED6A 3QNMA 2JV3A 4NLGA 4LJXA 7ICGA 3PSIA 3V6KA 5ALQA 4BGDA 2AHOB 5KFGA 4ICAA 4YQWA 4RT2A 3BJYA 5IIOA 3I76A 4Y2SA 3IN5A 1Y88A 1IG6A 3FAHA 4GXKA 3MGIA 2JXJA 2JZBA 2GWSA 1ECWA 2NRWA 4OJPA 2J6SA 2LM4A 1U49A 3QEBZ 4TUSA 4FS2A 1BGXT 1NJWA 3AQFA 4OCZA 4OJ5A 4Q8EA 3N7PD 3F2CA 1N62A 1F5SA 2WHEA 5BPCA 1PK1A 2BGWA 3D2NA 5DBCA 4DWIA 1KFTA 3LVWA 4JV1A 3RH5A 2KSOB 4M6WB 2WFAA 3IP4B 2ZIWB 1XO1A 3GZFA 4PGQA 5HHHA 4RQ7A 3TI0A 5C5JA 5DBAA 1CEZA 3TADC 3C5GA 1U48A 1BPEA 3AQEA 3C2LA 2ZIVA 3G6YA 1L7NA 4YXJA 4DSKA 3Q8LA 2BDUA 3JPRA 1NOMA 3OSPA 4YR3A 4XA5A 4C8NA 2ZJ8A 2WB1F 4F4YA 4KLUA 4KMOB 1T3QA 5CJ7A 4UAYA 1AQ6A 5FP0A 4C8OA 4YG2A 1XC9A 1ZETA 1N56A 4BX9C 4QWAA 3BQ7A 2CPRA 5KT5A 4A8EA 3MGHA 4O5EA 2K8CB 3EWAA 2BPCA 5J2EA 3D2QA 4OJLA 1ZQKA 1RYUA 3QU7A 4UAZA 1NK7A 2EZXA 5EWGA 2YMPA 2DKZA 3RRGA 3KKAA 4OJOA 2K8BB 2HBMA 9ICSA 1X9WA 1WCLA 3QU5A 2FLNA 1X66A 4EENA 3PW4A 3JPPA 2HDOA 3QYPA 1QH9A 1B4FA 4R8UA 5ALUA 3PZPA 2KZZA 2EAPA 3TKAA 4KLHA 4UAWA 2BZFA 1Z00A 4YN4A 2OCEA 3H0LB 1ZQOA 5KFNA 3MFHA 2VKQA 3RRHA 4K4GA 2KKPA 2W9AA 2C2EA 4O0IA 1RDFA 4RQ4A 4UB4A 1NK6A 5KAIU 4YR2A 2XI9A 5AI4A 5F9NA 5ALPA 1L7OA 7ICKA 2KFZA 4NY8A 1A6SA 1KSPA 2UVVA 2CN1A 1IXRA 4EZ9A 4WJ3B 9ICCA 3HRDD 2AGOA 3KHRA 5KG0A 1ZQTA 8ICHA 3PSPA 1DXSA 4I2BA 5ALEA 3WK5A 5L1IA 2V4RA 4KLDA 1FO4A 3H40A 5L1KA 4EX6A 2H3ZA 3IM1A 4G9BA 3MFIA 5TISU 4R64A 3RJFA 2JZBB 8ICSA 2F1IA 3DDHA 3ZDCA 5EE3A 2GH1A 5CRXA 1RXWA 1BPDA 4I2IA 3NUQA 3AMZA 1ZRNA 3QUCA 1SGGA 5AM0A 1VDVA 4IRCA 4O3OA 5ALDA 4RNNA 4IQVA 4MHVA 3RH6A 2HMXA 3KZIU 2DQNB 4IR9A 4OO1J 3WK9A 3TAQA 1PK1B 2FJ6A 1X6JA 4KLQA 3SZ2A 5ALOA 3ZD9A 4KTQA 1QLNA 1ZD2P 4KLLA 1Z3EB 5J2GA 2VJ4A 3KFUF 4Z6EA 4ELUA 7ICNA 8ICNA 2W7OA 1IM4A 3Q8QB 1SL1A 2XY6A 3PR5B 2ZIVB 1SV0A 2ALZA 3IRUA 3RB3A 4USAA 4UW9A 3MR3A 3PV8A 4B9MA 4M9NA 4RQ6A 1JN3A 2FLPA 2QB1A 4NM1A 2BHNA 4QWDA 3F2DA 3UQ0A 4RQ5A 1ZQIA 4ECTA 2EH9A 4RQ2A 3PVXA 4NL9C 3JPSA 2B0CA 4ELVA 1P7DA 2I6XA 4DQPA 4Q43A 5KFXA 1BPZA 4DSJA 4IC9A 3TFSA 1ZD3A 1J2MA 4JWNA 4DF8A 4M9HA 7ICQA 4F71A 1NNLA 4DSEA 1SXEA 3BQ1A 3OJUA 4ECXA 4O3MA 1HJPA 5AKXA 3PX4A 5KT7A 5DDYA 1X9SA 3MBYA 9ICGA 2FPKA 3T5HA 2HVIA 5ALTA 2D3DA 2J6UA 3F2BA 2AJQA 2DPJA 4FBUA 1ZQPA 3WU2U 3R9KA 1S76D 4HAIA 3NVWA 4BJQA 4F5PA 1U45A 4DOCA 2EZYA 4C8KA 5AK6A 7ICOA 2JEJA 4TQSA 3GQCA 4EELA 4UBCA 9ICBA 1A0PA 3RJIA 4IQUA 3S6JA 4NWIA 5ALXA 2ZUDA 3GIIA 2LI6A 3C2MA 1C7YA 5AKKA 3DV9A 3IG5A 5J2HA 1D8LA 3TADA 5KG5A 2W9CA 2OM6A 4F50A 3ETLA 5ALGA 4AYBC 4YR0A 3M8SA 4FE3A 3ISCA 5AICA 4P0QB 2WF5A 2HBLA 1SWWA 2MAXA 2G0AA 2XICA 2W43A 3M9OB 3ISBA 3TQ1A 4F4WA 1T8EA 2QARA 4O9MA 2F1JA 2FPLA 4UBBA 1NJXA 4NJ8A 3SQIA 2F3NA 5AKHA 2KFNA 1N63A 2DPIA 3RJGA 4QW9A 5CA7A 2VANA 1VLBA 2W54A 3THVA 2VIXA 1C20A 4QJFB 3M6ZA 3NASA 5DQHA 3ONNA 1JMSA 1KBUA 1COKA 3CP8A 4PZNA 1F0MA 4QWEA 1ZQHA 1MSWD 5J0SA 3KHHA 2HOFA 1UQVA 1WWVA 2Y0SC 1TV9A 3HT3A 1NI3A 1NKEA 4DEZA 1PK3A 2YQEA 5DLGA 2JHDA 2WTFA 1NKCA 1UPHA 5AM5A 1TK5A 1SB3C 1KFDA 3KTQA 3QZ8A 2F77X 4MF8A 1ZQJA 2E8PA 4J9LA 4IS7A 2ZXIA 3J81j 1ZQFA 1TFRA 4QNLA 2ZIUA 4DLGA 4QZEA 5GTIU 4C80A 1DGJA 1RYRA 4PH5A 4PJ0U 2GOLA 2E1FA 3SENA 3N7SC 4DL5A 4RPZA 4DS5A 2E8OA 2QKQA 4ED2A 4QZDA 4I2CA 3PX6A 3T5KA 1BNOA 4K4HA 1MA7A 4RQ0A 3C5FA 5D46A 2O6KA 1L7MA 8ICKA 1S0MA 4G3IA 4E0DA 1XSNA 1O03A 4PZOA 2JMGA 4Y2JA 5AK4A 2XGPA 2JH7A 3SV3A 1SXDA 1X2IA 4UB8U 4KX5A 4F5RA 4DQIA 4UAVA 3HKZC 2C22A 1L3TA 4B6JA 3WKDA 2KKVA 4QZHA 3PX0A 4ECQA 3HW8A 1VJ5A 3M8RA 1V38A 1OXJA 8ICBA 4DSIA 4EYHB 2KD1A 3IDWA 2D6FC 4JV2A 3ZD8A 1ZQZA 3ISDA 1BPBA 4KLEA 4Q45A 3SYZA 3QZ7A 1JALA 2NV3A 2K60A 2BDPA 1Z1BA 5EE9A 1ZQCA 1LV5A 3JPOA 4AYBF 2KN7A 1WWUA 7ICMA 1NZPA 1Z4NA 5KFIA 4PHAA 2XY7A 1NK4A 2F44A 3NRZA 3H8SA 5KG1A 3CRXA 2KIWA 5G5HA 4ECUA 2XO7A 2HI0A 3H0MB 3UXNA 2I1QA 5CEHA 1L7PA 3L3FX 1HUOA 4F2SA 3NVYA 3TANA 5J2CA 2YN4A 1V97A 2KTQA 5L1LA 3WKAA 1X40A 5AM2A 3G6XA 4RNMA 1YZ6A 5AM3A 4F72A 5K4LA 4O3NA 3Q8KA 1KL9A 4IQTA 5HMLA 4KITB 2W3RA 4BXOA 2Y0SF 4ED7A 3C2KA 9ICIA 4QZCA 1LKYA 3T5LA 4UB2A 4KLFA 2OH2A 4QZFA 3I28A 4RUCA 4XQ8A 4DOBA 1L3SA 2Q4TA 4U7CA 3EPGA 1X9MA 1SKSA 1DK2A 3G6VA 2WF9A 5ALJA 3WKBA 4UARA 5IIMA 2OXOA 2W9BA 2C2RA 4KLMA 5DQIA 1KN5A 4QZBA 3AUOA 4Y2PA 2ISOA 1JRPA 5KG6A 2WF7A 7ICPA 1D8BA 2OWOA 2RRDA 2ZIUB 3LWMA 9ICNA 1QQ5A 7ICUA 9ICQA 2Q0ZX 4F5NA 1FIQA 4GLXA 4GIBA 2KK0A 1CRXA 2PKEA 2XCAA 2D8CA 2J6TA 3ALRA 2PFOA 5J0RA 1UT5A 4C4RA 1N48A 5J2AA 1ED1A 4ED1A 8ICYA 5KG7A 2BPFA 3VC8A 4DSLA 1FFUA 3D6JA 2UVUA 1ZQGA 4DSFA 4J9RA 2Y1IA 2V4QA 3GIKA 3OHBA 3HKZF 1L3VA 2A1JB 2FMQA 1URJA 5J2KA 8ICJA 3F53A 2FMPA 1QQ6A 3C1ZA 4J9MA 3FM9A 5KFEA 4B9UA 4I2FA 5EE1A 3AL0B 5DGBA 3HWTA 3SEIA 1TE2A 8ICFA 4QIWC 3PMLA 4JV0A 3T5JA 4DL4A 4CGZA 1KFSA 3RAQA 4QWCA 2G5IB 3KHLA 8ICZA 4IR1A 4YVZA 1V9PA 3A0BU 5KFKA 1ZQAA 4K4IA 4M9LA 5KNIA 4TUPA 4QZAA 2AQ4A 8ICIA 5G5GA 5DG8A 1TAQA 4PL1A 3LVVA 3QXGA 2W04A 2HHSA 4Z6DA 2DL0A 8ICUA 4Y2YA 4C7ZA 3GV8B 4ECRA 5AIBA 4QZIA 2KV2A 1S5LU 1M6YA 3ETRA 1ZQMA 5ALLA 3RB4A 3WK7A 2BCRA 1OW5A 2AH5A 4B9LA 4RQ3A 1L5UA 4LZGA 5L9XA 2JRZA 1JI7A 4ELTA 5J0TA 2K89A 4ACOA 1ZQLA 1YT3A 5HR6A 3HILA 5ALZA 7ICHA 4X5VA 3H0RB 4BDPA 2HHXA 3CNHA 4IQWA 5DB9A 1RG6A 2VA8A 5KFZA 2E8MA 2ZUCA 3V72A 4PHPA 5D4BA 2E8NA 1XSLA 3KD3A 4C8MA 1D8YA 4NLKA 2ZJAA 4F93B 5AI0A 1PUZA 2IHMA 1LKYB 4RQNA 4GXJA 3KZXA 2AGQA 4B9SA 2YTUA 8ICCA 7ICSA 1JIHA 4OJ6A 4P4PA 3QE9Y 3LDAA 3Q8RB 3C23A 5J8YC 2JEIA 9ICUA 2K4EA 3LYSA 4J9PA 3RJKA 2LYHA 3GIJA 2R18A 3NVZA 5AI5A 2YMQA 2HHQA 3UM9A 3OSNA 4KN7A 4FO6A 4DFPA 1ZQSA 2PXIA 8ICWA 8ICPA 3BZKA 5DGAA 7ICTA 2ZTCA 4GC6A 1ZXIA 5ALSA 2AU0A 5J2DA 4C8LA 5CWRA 2KMDA 2A1AA 1XO0A 1B43A 2OEHA 4DOAA 1S77D 1XNSA 3QX7A 1B22A 5AK3A 3PW5A 3FYHA 4JMUA 3V7KA 3WKEA 3KBBA 2W9MA 4C4TA 2P66A 1SZPA 1U9LA 2C28A 1YZ7A 2NRXA 4DQQA 1HIWA 2AQ0A 4KLJA 4BUGA 1TVAA 4QIWF 3AN1A 4MEYA 3DEEA 3C1YA 3Q8MA 4J9QA 7ICRA 8ICGA 4EBEA 2HHTA 3OHAA 4F3OA 3E0FA 2NRTA 5KL1B 2KZ3A 2KEYA 2LMRA 2HHUA 3SI8A 4Y2XA 5DG9A 3MC1A 4EYIB 3SAGA 4F4ZA 1FFVA 4US8A 1H38A 2FDRA 4FZMA 4R8UB 4YD2A 4Y2UA 2MUTA 5KL8B 4GXIA 5CB1A 1MQ3A 9ICFA 4PL2A 2EQYA 3V7JA 4ED8A 1Z00B 2DBYA 2L5YA 4MFFA 2MU2A 5IIJA 1Z4OA 3K1ZA 2KNJA 5TZVA 3UXPA 4DQSA 4NLBA 1CI4A 4BWMA 1PZNA 4O3QA 4ECYA 5KFAA 5AI6A 4P4MA 1TKDA 1UT8A 2E1EA 4UB5A 4ECSA 2JEFA 1CUKA 1BNPA 4JWMA 5CHGA 2K8AA 5IIIA 2P35A 1BVSA 5KFDA 2BQRA 5KFTA 3M6KA 3V7LA 3EW9A 2BKEA 9ICKA 2ZTEA 1X6IA 2ZG6A 4EX7A 3KHGA 3Q8SB 8ICXA 3TACB 5D49A 4M04A 2KZMA 5B66U 1TAMA 2HHWA 5KG4A 4UASA 4TUQA 4FFDA 4LVSA 3AU2A 5KFLA 3OTQA 5BOLA 4NLNA 5J2IA 1T4GA 4YMNA 5DBBA 1ZQ1C 3KKAC 5HP4A 2BCUA 7ICIA 1WG8A 3NRWA 4I28A 2KJ8A 1KW4A 2AGPA 3IHQB 4EEKA 1BPYA 4I2DA 1S97A 2JGAA 4CF4A 3AU6A 4DQRA 1PVQA 1K1QA 2K4IA 1UHUA 5AKGA 2HOIA 2ZTDA 1COOA 5DQGA 2E3TA 4DFJA 5CP2A 8ICOA 2KSOA 4M6WA 4NV0A 3T3FA 1ZD4A 2ZIWA 4P0PA 4I2GA 5KFHA 1ZRMA 1K1SA 5CR0A 4TURA 2F1HA 3BS7A 4FBTA 4ECVA 4F4KA 4M9GA 3WK4A 1KLNA 5AKZA 5JTIA 1X9XA 2PI4A 5HHIA 1N5XA 5IILA 8ICVA 3BQ2A 4CF3A 4KLOA 1AROP 4BWJA 2ASJA 4KLIA 2HOQA 2PFQA 3EUB2 4I2AA 5KAFU 4YMMA 2LKYA 2BQ3A 2WB1C 5KFRA 2LHTA 2MUTB 2ZUBA 3PW7A 4LZDA 5J0YA 5J29A 5L1JA 2KG5A 5AKJA 4F5QA 3MR5A 1XS9D 3NTUA 4IRDA 5J2FA 3RAXA 5KFPA 3M9MB 3PSFA 2MRLA 9ICHA 2Z7JA 5DKWA 2DFLA 1WYGA 4F5OA 2ES6A 2K4HA 2FLLA 5GTHU 5DDMA 3EZ5A 1N60A 1RZTA 5J2BA 3MABA 2EDUA 4M2YA 1XU4A 3H8WA 4FZLA 1S9FA 1OUQA 3JPNA 2N1RA 1SV0C 2ZIXA 3E2EA 1UA1A 2NRZA 2W3SA 3ORYA 9ICAA 3E58A 3GDXA 4GFJA 4J9SA 2W9CB 4JUZA 4RPXA 1A76A 7ICVA 5C0YA 2KJ9A 4RUAA 3FDSA 3GFKB 5IIKA 8ICAA 3HP6A 2WF6A 3RF9A 2QARB 1DRGA 4JK1A 2K4PA 2B21A 5AHXA 2HBKA 2G07A 2KP7A 4XUSA 9ICTA 2PFPA 5AIAA 5KFSA 2KHVA 1L6NA 4NL9A 5DB7A 2G08A 3TAPA 4OD0A 2IOFK 1RXVA 2VJ5A 1RPLA 1ZQNA 4UB3A 3N4MB 2PMZC 5ALHA 3C29A 4NXZA 2B6GA 5J2JA 1L8LA 5EOZA 3QU2A 3L4PA 3IV6A 4CF5A 5L1MA 5DB6A 3RH4A 9ICPA 4KX3A 2GO7A 2IOHA 1U47A 2EZZA 4NLZA 3KOOA 3RFAA 3AM9A 3K75D 1MC8A 4J9OA 3N28A 4B9NA 1DK3A 1JXLA 4KLTA 4QZ8A 3ZDBA 2F8KA 4GC7A 3VCBA 1SKRA 1KTQA 3LK9A 4EBCA 2R8JA 4QZ9A 1HEKA 1HUZA 2IHNA 3N97B 2A19A 4P0PB 1SZHA 1Z1VA 4ZH4A 5J0XA 5KFWA 4TQRA 2RDJA 1NZBA 2NO5A 3RJEA 3JPQA 3OPXA 1S0VA 1GO3F 2BCSA 2W55A 3OJSA 4QZGA 4YP3A 3MR2A 2WF8A 1KEJA 3JPTA 2BPGA 1ZQXA 1SL0A 5JRTA 4YFKA 4ED0A 7ICEA 2ATLA 5KFUA 1KKXA 1RQLA 3V6HA 3WK8A 2DGZA 3N7RC 2KICA 1KDHA 3PMNA 2NRVA 3OGUA 2BCVA 3PW0A 3RR7A 2H3QA 2DWQA 3T79A 4UB1A 2QB0A 5J0QA 4AP9A 1D9DA 2EAOA 8ICMA 2W8LA 3CYMA 5F9LA 3BQ0A 4IRKA 1JXEA 5KT6A 4EEYA 1Q3UA 1IIPA 3B9JA 4QWBA 1JX4A 3BS5A 3BZCA 5KTQA 4O3PA 5DG7A 4MF2A 2HSZA 4PGYA 3ZDEA 2RHFA 1IV8A 1EXNA 4P4OA 4M9JA 4R63A 3MR6A 1L8OA 3H8MA 5AKIA 4HYKA 1S0OA 1D9FA 2YMMA 2Y9UA 3RB0A 2KIVA 3SV4A 2LYBA 1NJYA 2ESEA 1ZQWA 3ICXA 1N61A 2ZIXB 1TK8A 3ZI4A 3RBDA 1Q8KA 3PR4A 1PVPA 1T3NA 3PO4A 3M1YA 4DCCA 4ED3A 1L3UA 2ISPA 2XIDA 3D2SA 4ZOHC 1UA0A 5AK5A 4DFKA 2RDIA 5KT2A 2KVSA 4DL3A 1N5WA 5KG2A 2UVRA 2BCQA 1ZQQA 2PMZF 2BQUA 2EANA 1ZD5A 4BXOB 5AI8A 5KFVA 4QW8A 5HNKA 4P0QA 5KFOA 1UCVA 5F3XB 1S8OA 5ALVA 5BOMA 2YY6A 5AI9A 3MDAA 3UMGA 4KN4A 2F2AB 2RP5A 3GILA 4O5CA 2YMLA 1SKWA 4PPXA 8ICEA 1T7PA 4J03A 3QUQA 4UATA 2IBKA 2OHFA 5HMMA 2W8KA 3PSTA 5HR7A 2W9BB 2ZJ5A 5A0LA 3GIMA 1DGSA 1NK8A 2LBOA 1WUDA 1K5OA 1SIJA 2R8HA 4I2EA 2CRXA 2V9WA 2JEGA 2VA3A 3HX0A 4PHEA 5ALMA 2R8IA 1NK5A 3FC4A 3SMVA 2M9NA 5EWEA 1MQ2A 5KFBA 5AM1A 5KFJA 5KFYA 1A77A 3BQTA 2M0NA 3WKCA 5DLFA 2W11A 2WAQC 2XC9A 2CXYA 2W03A 4ECWA 1S10A 2IOFA 3HPOA 4Y2QA 4EBDA 2HHVA 1SV4A 3IG8A 3V6JA 2DF4B 1RM6C 3I1YA 1ZJMA 2F8LA 5ALWA 3QUTA 1V85A 4F4XA 1TAUA 3UQ2A 4O3RA 3NGDA 4RPYA 1QSSA 3H4DA 1U4BA 1LB2B 3TARA 3PNCA 4JB3A 5B5EU 1RYSA 1QSYA 1ZQYA 2H3IA 3ED5A 3M9NB 3C28A 3RJJA 4F2RA 2I5HA 2QLTA 5AKLA 1F44A 2EAMA 2XGQA 1NK0A 2QB0B 4PHDA 3BDPA 1ZYQA 1KQQA 5EWFA 4C4SA 3C21A 2FI1A 4RQ1A 5DB8A 1O08A 1TK0A 1X42A 3ZDAA 3BS5B 3NS1A 3WK6A 4CE6A 5ALNA 3K1RB 2XVTA 9ICOA 4MEXA 3U26A 2Y9TA 3M7DA 1T94A 4KLGA 2Y1JA 2YB4A 2MSNA 5J0PA 2MA1A 3UPQA 4J9NA 5ALRA 1J2NA 2NYVA 5AM4A 1NKBA 9ICLA 3GV7B 5KFMA 5J0UA 2XY5A 1ZJNA 4UB6U 5JU5A 2KOBA 1ZQBA 4FS1A 1ZQRA 2NO4A 1NJZA 1XSPA 4CDGA 2LYAA 4R66A 4RQ8A 2KVCA 4DL7A 2R8KA 3GV5B 1JUDA 3HJEA 4O5KA 3K4GA 3F5EA 3CW2C 3QUBA 4F91B 2W7PA 4M47A 2DKXA 3RTVA 7ICLA 4KLSA 4EZ6A 3UMBA 4CRXA 1ZQUA 1QQ7A 3QEAZ 3SAHA 1KRPA 4DO9A 9ICEA 1B0XA 3H4BA 1J97A 5J0OA 1LVHA 4I2JA 4YMOA 1DOQA 9ICWA 3B0XA 5KT4A 3SD7A 7ICJA 4Z6FA 3NVVA 4B9TA 4YCXA 5T14A 3EPIA 2PFNA 4J9KA
chains in the Genus database with same CATH topology
1LKYA 1UCVA 2KSOB 5F3XB 2LPEA 3BS5B 2KSOA 2QARB 2FE9A 2QARA 2K4PA 5KNIA 4PZOA 2KE7A 3K1RB 3TADC 4NJ8A 2Y9TA 1SXDA 2QB0A 4NL9C 2F3NA 2EAOA 3BS7A 2DL0A 4NL9A 2KMDA 1DXSA 5JTIA 1X9XA 1V38A 2GLEA 1OXJA 3BS5A 1COKA 1OW5A 4PZNA 2B6GA 1F0MA 1JI7A 3TACB 3IDWA 1SXEA 1UQVA 1WWVA 3HILA 3H8MA 4RQMA 5JU5A 2K60A 1PK3A 5L1MA 3BQ7A 2Y9UA 1RG6A 2KIVA 2D8CA 2JV3A 2E8MA 1SGGA 2D3DA 1WWUA 2ESEA 2KG5A 1SV4A 2E8NA 2E8PA 4IS7A 4MHVA 2F44A 3KKAC 1V85A 2DKZA 2F8KA 3KKAA 1PK1B 2DKXA 2ES6A 2LMRA 1LKYB 1KW4A 1X66A 4RQNA 1B0XA 1Z1VA 1X40A 1B4FA 3SENA 2EAPA 2YTUA 1SV0C 2EAMA 2E8OA 2QKQA 2QB0B 2L5YA 1SV0A 2EANA 3TADA 5J8YC 3SEIA 5JRTA 5J8YA 1PK1A 2QB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKY A;  1UCV A;  2KSO B;  5F3X B;  2LPE A;  3BS5 B;  2KSO A;  2QAR B;  2FE9 A;  2QAR A;  2K4P A;  5KNI A;  4PZO A;  2KE7 A;  3K1R B;  3TAD C;  4NJ8 A;  2Y9T A;  1SXD A;  2QB0 A;  4NL9 C;  2F3N A;  2EAO A;  3BS7 A;  2DL0 A;  4NL9 A;  2KMD A;  1DXS A;  5JTI A;  1X9X A;  1V38 A;  2GLE A;  1OXJ A;  3BS5 A;  1COK A;  1OW5 A;  4PZN A;  2B6G A;  1F0M A;  1JI7 A;  3TAC B;  3IDW A;  1SXE A;  1UQV A;  1WWV A;  3HIL A;  3H8M A;  4RQM A;  5JU5 A;  2K60 A;  1PK3 A;  5L1M A;  3BQ7 A;  2Y9U A;  1RG6 A;  2KIV A;  2D8C A;  2JV3 A;  2E8M A;  1SGG A;  2D3D A;  1WWU A;  2ESE A;  2KG5 A;  1SV4 A;  2E8N A;  2E8P A;  4IS7 A;  4MHV A;  2F44 A;  3KKA C;  1V85 A;  2DKZ A;  2F8K A;  3KKA A;  1PK1 B;  2DKX A;  2ES6 A;  2LMR A;  1LKY B;  1KW4 A;  1X66 A;  4RQN A;  1B0X A;  1Z1V A;  1X40 A;  1B4F A;  3SEN A;  2EAP A;  2YTU A;  1SV0 C;  2EAM A;  2E8O A;  2QKQ A;  2QB0 B;  2L5Y A;  1SV0 A;  2EAN A;  3TAD A;  5J8Y C;  3SEI A;  5JRT A;  5J8Y A;  1PK1 A;  2QB1 A; 
#chains in the Genus database with same CATH topology
 4DLE A;  3L5K A;  4RT3 A;  5KG3 A;  2LPE A;  3F5A A;  4RZR A;  2WAQ F;  4KMU A;  5KT3 A;  4IL6 U;  5J0W A;  2FE9 A;  2JR5 A;  4C0Z A;  4P2H A;  2KE7 A;  4UAU A;  2H3F A;  1FEZ A;  2H5X A;  9ICJ A;  3RJH A;  1RQN A;  2H3V A;  4RNO A;  9ICV A;  3TFR A;  3PY8 A;  3Q8P B;  3SR6 A;  1JRO A;  2YX8 A;  2PI5 A;  2KJ5 A;  4M0A A;  1ZQE A;  4US9 A;  2GLE A;  1QCK A;  4ECZ A;  3O0F A;  1BPX A;  8ICT A;  4DL2 A;  9ICX A;  4Z6C A;  4Y2R A;  2RQ5 A;  5ALK A;  2P6R A;  2UVW A;  9ICM A;  5EE0 A;  5KFF A;  2G06 A;  4RQM A;  4CCH A;  1SWV A;  4XRH A;  2AXT U;  4R65 A;  1NK9 A;  1PVR A;  4DS4 A;  3RB6 A;  2HBJ A;  3AEV A;  1SL2 A;  2ASL A;  7ICF A;  3H7I A;  5KFC A;  4I29 A;  3QU4 A;  2F76 X;  4DL6 A;  1WCN A;  1Q3V A;  1Q46 A;  3MDC A;  3SAF A;  2IA6 A;  2FPM A;  2XCP A;  2ODG A;  2LM1 A;  1N2X A;  4DFD A;  4PGX A;  1Z19 A;  3PO5 A;  3H8J A;  8ICQ A;  4Y2V A;  2BR0 A;  2I9G A;  4RU9 A;  3RR8 A;  2KHQ A;  2VA2 A;  1XWL A;  5AKY A;  4O3S A;  2A1J A;  3ZDD A;  3A0H U;  1MN8 A;  4DFM A;  4YXM A;  3LWL A;  3EYZ A;  2HVH A;  2RLT A;  1QTM A;  8ICR A;  2HCF A;  2JH1 A;  4MFC A;  2DUY A;  1S0N A;  5ALI A;  1ZQD A;  4F92 B;  1QSL A;  2YB1 A;  5E79 U;  5J8Y A;  3MGV A;  4Y2T A;  2G5H B;  4NLC A;  5AKE A;  2R8G A;  5JUM A;  2ASD A;  3UXO A;  2ZXH A;  4MFA A;  2E5S A;  2IMW P;  2HW3 A;  1ZQV A;  5KFQ A;  4I2H A;  4B9V A;  3GU3 A;  5IIN A;  4U6P A;  1ZOL A;  2FMS A;  4Q44 A;  8ICL A;  3B0Y A;  4FZN A;  4F8R A;  2A3V A;  9ICR A;  5ALF A;  4I27 A;  5H2F U;  4YD1 A;  2P6U A;  4C7Y A;  2G09 A;  4NM2 A;  3UMC A;  4UQG A;  4DF4 A;  2OYY A;  2C2D A;  3PW2 A;  3RBE A;  5ALY A;  4Q8F A;  3QU9 A;  4CNQ A;  4ED6 A;  3QNM A;  2JV3 A;  4NLG A;  4LJX A;  7ICG A;  3PSI A;  3V6K A;  5ALQ A;  4BGD A;  2AHO B;  5KFG A;  4ICA A;  4YQW A;  4RT2 A;  3BJY A;  5IIO A;  3I76 A;  4Y2S A;  3IN5 A;  1Y88 A;  1IG6 A;  3FAH A;  4GXK A;  3MGI A;  2JXJ A;  2JZB A;  2GWS A;  1ECW A;  2NRW A;  4OJP A;  2J6S A;  2LM4 A;  1U49 A;  3QEB Z;  4TUS A;  4FS2 A;  1BGX T;  1NJW A;  3AQF A;  4OCZ A;  4OJ5 A;  4Q8E A;  3N7P D;  3F2C A;  1N62 A;  1F5S A;  2WHE A;  5BPC A;  1PK1 A;  2BGW A;  3D2N A;  5DBC A;  4DWI A;  1KFT A;  3LVW A;  4JV1 A;  3RH5 A;  2KSO B;  4M6W B;  2WFA A;  3IP4 B;  2ZIW B;  1XO1 A;  3GZF A;  4PGQ A;  5HHH A;  4RQ7 A;  3TI0 A;  5C5J A;  5DBA A;  1CEZ A;  3TAD C;  3C5G A;  1U48 A;  1BPE A;  3AQE A;  3C2L A;  2ZIV A;  3G6Y A;  1L7N A;  4YXJ A;  4DSK A;  3Q8L A;  2BDU A;  3JPR A;  1NOM A;  3OSP A;  4YR3 A;  4XA5 A;  4C8N A;  2ZJ8 A;  2WB1 F;  4F4Y A;  4KLU A;  4KMO B;  1T3Q A;  5CJ7 A;  4UAY A;  1AQ6 A;  5FP0 A;  4C8O A;  4YG2 A;  1XC9 A;  1ZET A;  1N56 A;  4BX9 C;  4QWA A;  3BQ7 A;  2CPR A;  5KT5 A;  4A8E A;  3MGH A;  4O5E A;  2K8C B;  3EWA A;  2BPC A;  5J2E A;  3D2Q A;  4OJL A;  1ZQK A;  1RYU A;  3QU7 A;  4UAZ A;  1NK7 A;  2EZX A;  5EWG A;  2YMP A;  2DKZ A;  3RRG A;  3KKA A;  4OJO A;  2K8B B;  2HBM A;  9ICS A;  1X9W A;  1WCL A;  3QU5 A;  2FLN A;  1X66 A;  4EEN A;  3PW4 A;  3JPP A;  2HDO A;  3QYP A;  1QH9 A;  1B4F A;  4R8U A;  5ALU A;  3PZP A;  2KZZ A;  2EAP A;  3TKA A;  4KLH A;  4UAW A;  2BZF A;  1Z00 A;  4YN4 A;  2OCE A;  3H0L B;  1ZQO A;  5KFN A;  3MFH A;  2VKQ A;  3RRH A;  4K4G A;  2KKP A;  2W9A A;  2C2E A;  4O0I A;  1RDF A;  4RQ4 A;  4UB4 A;  1NK6 A;  5KAI U;  4YR2 A;  2XI9 A;  5AI4 A;  5F9N A;  5ALP A;  1L7O A;  7ICK A;  2KFZ A;  4NY8 A;  1A6S A;  1KSP A;  2UVV A;  2CN1 A;  1IXR A;  4EZ9 A;  4WJ3 B;  9ICC A;  3HRD D;  2AGO A;  3KHR A;  5KG0 A;  1ZQT A;  8ICH A;  3PSP A;  1DXS A;  4I2B A;  5ALE A;  3WK5 A;  5L1I A;  2V4R A;  4KLD A;  1FO4 A;  3H40 A;  5L1K A;  4EX6 A;  2H3Z A;  3IM1 A;  4G9B A;  3MFI A;  5TIS U;  4R64 A;  3RJF A;  2JZB B;  8ICS A;  2F1I A;  3DDH A;  3ZDC A;  5EE3 A;  2GH1 A;  5CRX A;  1RXW A;  1BPD A;  4I2I A;  3NUQ A;  3AMZ A;  1ZRN A;  3QUC A;  1SGG A;  5AM0 A;  1VDV A;  4IRC A;  4O3O A;  5ALD A;  4RNN A;  4IQV A;  4MHV A;  3RH6 A;  2HMX A;  3KZI U;  2DQN B;  4IR9 A;  4OO1 J;  3WK9 A;  3TAQ A;  1PK1 B;  2FJ6 A;  1X6J A;  4KLQ A;  3SZ2 A;  5ALO A;  3ZD9 A;  4KTQ A;  1QLN A;  1ZD2 P;  4KLL A;  1Z3E B;  5J2G A;  2VJ4 A;  3KFU F;  4Z6E A;  4ELU A;  7ICN A;  8ICN A;  2W7O A;  1IM4 A;  3Q8Q B;  1SL1 A;  2XY6 A;  3PR5 B;  2ZIV B;  1SV0 A;  2ALZ A;  3IRU A;  3RB3 A;  4USA A;  4UW9 A;  3MR3 A;  3PV8 A;  4B9M A;  4M9N A;  4RQ6 A;  1JN3 A;  2FLP A;  2QB1 A;  4NM1 A;  2BHN A;  4QWD A;  3F2D A;  3UQ0 A;  4RQ5 A;  1ZQI A;  4ECT A;  2EH9 A;  4RQ2 A;  3PVX A;  4NL9 C;  3JPS A;  2B0C A;  4ELV A;  1P7D A;  2I6X A;  4DQP A;  4Q43 A;  5KFX A;  1BPZ A;  4DSJ A;  4IC9 A;  3TFS A;  1ZD3 A;  1J2M A;  4JWN A;  4DF8 A;  4M9H A;  7ICQ A;  4F71 A;  1NNL A;  4DSE A;  1SXE A;  3BQ1 A;  3OJU A;  4ECX A;  4O3M A;  1HJP A;  5AKX A;  3PX4 A;  5KT7 A;  5DDY A;  1X9S A;  3MBY A;  9ICG A;  2FPK A;  3T5H A;  2HVI A;  5ALT A;  2D3D A;  2J6U A;  3F2B A;  2AJQ A;  2DPJ A;  4FBU A;  1ZQP A;  3WU2 U;  3R9K A;  1S76 D;  4HAI A;  3NVW A;  4BJQ A;  4F5P A;  1U45 A;  4DOC A;  2EZY A;  4C8K A;  5AK6 A;  7ICO A;  2JEJ A;  4TQS A;  3GQC A;  4EEL A;  4UBC A;  9ICB A;  1A0P A;  3RJI A;  4IQU A;  3S6J A;  4NWI A;  5ALX A;  2ZUD A;  3GII A;  2LI6 A;  3C2M A;  1C7Y A;  5AKK A;  3DV9 A;  3IG5 A;  5J2H A;  1D8L A;  3TAD A;  5KG5 A;  2W9C A;  2OM6 A;  4F50 A;  3ETL A;  5ALG A;  4AYB C;  4YR0 A;  3M8S A;  4FE3 A;  3ISC A;  5AIC A;  4P0Q B;  2WF5 A;  2HBL A;  1SWW A;  2MAX A;  2G0A A;  2XIC A;  2W43 A;  3M9O B;  3ISB A;  3TQ1 A;  4F4W A;  1T8E A;  2QAR A;  4O9M A;  2F1J A;  2FPL A;  4UBB A;  1NJX A;  4NJ8 A;  3SQI A;  2F3N A;  5AKH A;  2KFN A;  1N63 A;  2DPI A;  3RJG A;  4QW9 A;  5CA7 A;  2VAN A;  1VLB A;  2W54 A;  3THV A;  2VIX A;  1C20 A;  4QJF B;  3M6Z A;  3NAS A;  5DQH A;  3ONN A;  1JMS A;  1KBU A;  1COK A;  3CP8 A;  4PZN A;  1F0M A;  4QWE A;  1ZQH A;  1MSW D;  5J0S A;  3KHH A;  2HOF A;  1UQV A;  1WWV A;  2Y0S C;  1TV9 A;  3HT3 A;  1NI3 A;  1NKE A;  4DEZ A;  1PK3 A;  2YQE A;  5DLG A;  2JHD A;  2WTF A;  1NKC A;  1UPH A;  5AM5 A;  1TK5 A;  1SB3 C;  1KFD A;  3KTQ A;  3QZ8 A;  2F77 X;  4MF8 A;  1ZQJ A;  2E8P A;  4J9L A;  4IS7 A;  2ZXI A;  3J81 j;  1ZQF A;  1TFR A;  4QNL A;  2ZIU A;  4DLG A;  4QZE A;  5GTI U;  4C80 A;  1DGJ A;  1RYR A;  4PH5 A;  4PJ0 U;  2GOL A;  2E1F A;  3SEN A;  3N7S C;  4DL5 A;  4RPZ A;  4DS5 A;  2E8O A;  2QKQ A;  4ED2 A;  4QZD A;  4I2C A;  3PX6 A;  3T5K A;  1BNO A;  4K4H A;  1MA7 A;  4RQ0 A;  3C5F A;  5D46 A;  2O6K A;  1L7M A;  8ICK A;  1S0M A;  4G3I A;  4E0D A;  1XSN A;  1O03 A;  4PZO A;  2JMG A;  4Y2J A;  5AK4 A;  2XGP A;  2JH7 A;  3SV3 A;  1SXD A;  1X2I A;  4UB8 U;  4KX5 A;  4F5R A;  4DQI A;  4UAV A;  3HKZ C;  2C22 A;  1L3T A;  4B6J A;  3WKD A;  2KKV A;  4QZH A;  3PX0 A;  4ECQ A;  3HW8 A;  1VJ5 A;  3M8R A;  1V38 A;  1OXJ A;  8ICB A;  4DSI A;  4EYH B;  2KD1 A;  3IDW A;  2D6F C;  4JV2 A;  3ZD8 A;  1ZQZ A;  3ISD A;  1BPB A;  4KLE A;  4Q45 A;  3SYZ A;  3QZ7 A;  1JAL A;  2NV3 A;  2K60 A;  2BDP A;  1Z1B A;  5EE9 A;  1ZQC A;  1LV5 A;  3JPO A;  4AYB F;  2KN7 A;  1WWU A;  7ICM A;  1NZP A;  1Z4N A;  5KFI A;  4PHA A;  2XY7 A;  1NK4 A;  2F44 A;  3NRZ A;  3H8S A;  5KG1 A;  3CRX A;  2KIW A;  5G5H A;  4ECU A;  2XO7 A;  2HI0 A;  3H0M B;  3UXN A;  2I1Q A;  5CEH A;  1L7P A;  3L3F X;  1HUO A;  4F2S A;  3NVY A;  3TAN A;  5J2C A;  2YN4 A;  1V97 A;  2KTQ A;  5L1L A;  3WKA A;  1X40 A;  5AM2 A;  3G6X A;  4RNM A;  1YZ6 A;  5AM3 A;  4F72 A;  5K4L A;  4O3N A;  3Q8K A;  1KL9 A;  4IQT A;  5HML A;  4KIT B;  2W3R A;  4BXO A;  2Y0S F;  4ED7 A;  3C2K A;  9ICI A;  4QZC A;  1LKY A;  3T5L A;  4UB2 A;  4KLF A;  2OH2 A;  4QZF A;  3I28 A;  4RUC A;  4XQ8 A;  4DOB A;  1L3S A;  2Q4T A;  4U7C A;  3EPG A;  1X9M A;  1SKS A;  1DK2 A;  3G6V A;  2WF9 A;  5ALJ A;  3WKB A;  4UAR A;  5IIM A;  2OXO A;  2W9B A;  2C2R A;  4KLM A;  5DQI A;  1KN5 A;  4QZB A;  3AUO A;  4Y2P A;  2ISO A;  1JRP A;  5KG6 A;  2WF7 A;  7ICP A;  1D8B A;  2OWO A;  2RRD A;  2ZIU B;  3LWM A;  9ICN A;  1QQ5 A;  7ICU A;  9ICQ A;  2Q0Z X;  4F5N A;  1FIQ A;  4GLX A;  4GIB A;  2KK0 A;  1CRX A;  2PKE A;  2XCA A;  2D8C A;  2J6T A;  3ALR A;  2PFO A;  5J0R A;  1UT5 A;  4C4R A;  1N48 A;  5J2A A;  1ED1 A;  4ED1 A;  8ICY A;  5KG7 A;  2BPF A;  3VC8 A;  4DSL A;  1FFU A;  3D6J A;  2UVU A;  1ZQG A;  4DSF A;  4J9R A;  2Y1I A;  2V4Q A;  3GIK A;  3OHB A;  3HKZ F;  1L3V A;  2A1J B;  2FMQ A;  1URJ A;  5J2K A;  8ICJ A;  3F53 A;  2FMP A;  1QQ6 A;  3C1Z A;  4J9M A;  3FM9 A;  5KFE A;  4B9U A;  4I2F A;  5EE1 A;  3AL0 B;  5DGB A;  3HWT A;  3SEI A;  1TE2 A;  8ICF A;  4QIW C;  3PML A;  4JV0 A;  3T5J A;  4DL4 A;  4CGZ A;  1KFS A;  3RAQ A;  4QWC A;  2G5I B;  3KHL A;  8ICZ A;  4IR1 A;  4YVZ A;  1V9P A;  3A0B U;  5KFK A;  1ZQA A;  4K4I A;  4M9L A;  5KNI A;  4TUP A;  4QZA A;  2AQ4 A;  8ICI A;  5G5G A;  5DG8 A;  1TAQ A;  4PL1 A;  3LVV A;  3QXG A;  2W04 A;  2HHS A;  4Z6D A;  2DL0 A;  8ICU A;  4Y2Y A;  4C7Z A;  3GV8 B;  4ECR A;  5AIB A;  4QZI A;  2KV2 A;  1S5L U;  1M6Y A;  3ETR A;  1ZQM A;  5ALL A;  3RB4 A;  3WK7 A;  2BCR A;  1OW5 A;  2AH5 A;  4B9L A;  4RQ3 A;  1L5U A;  4LZG A;  5L9X A;  2JRZ A;  1JI7 A;  4ELT A;  5J0T A;  2K89 A;  4ACO A;  1ZQL A;  1YT3 A;  5HR6 A;  3HIL A;  5ALZ A;  7ICH A;  4X5V A;  3H0R B;  4BDP A;  2HHX A;  3CNH A;  4IQW A;  5DB9 A;  1RG6 A;  2VA8 A;  5KFZ A;  2E8M A;  2ZUC A;  3V72 A;  4PHP A;  5D4B A;  2E8N A;  1XSL A;  3KD3 A;  4C8M A;  1D8Y A;  4NLK A;  2ZJA A;  4F93 B;  5AI0 A;  1PUZ A;  2IHM A;  1LKY B;  4RQN A;  4GXJ A;  3KZX A;  2AGQ A;  4B9S A;  2YTU A;  8ICC A;  7ICS A;  1JIH A;  4OJ6 A;  4P4P A;  3QE9 Y;  3LDA A;  3Q8R B;  3C23 A;  5J8Y C;  2JEI A;  9ICU A;  2K4E A;  3LYS A;  4J9P A;  3RJK A;  2LYH A;  3GIJ A;  2R18 A;  3NVZ A;  5AI5 A;  2YMQ A;  2HHQ A;  3UM9 A;  3OSN A;  4KN7 A;  4FO6 A;  4DFP A;  1ZQS A;  2PXI A;  8ICW A;  8ICP A;  3BZK A;  5DGA A;  7ICT A;  2ZTC A;  4GC6 A;  1ZXI A;  5ALS A;  2AU0 A;  5J2D A;  4C8L A;  5CWR A;  2KMD A;  2A1A A;  1XO0 A;  1B43 A;  2OEH A;  4DOA A;  1S77 D;  1XNS A;  3QX7 A;  1B22 A;  5AK3 A;  3PW5 A;  3FYH A;  4JMU A;  3V7K A;  3WKE A;  3KBB A;  2W9M A;  4C4T A;  2P66 A;  1SZP A;  1U9L A;  2C28 A;  1YZ7 A;  2NRX A;  4DQQ A;  1HIW A;  2AQ0 A;  4KLJ A;  4BUG A;  1TVA A;  4QIW F;  3AN1 A;  4MEY A;  3DEE A;  3C1Y A;  3Q8M A;  4J9Q A;  7ICR A;  8ICG A;  4EBE A;  2HHT A;  3OHA A;  4F3O A;  3E0F A;  2NRT A;  5KL1 B;  2KZ3 A;  2KEY A;  2LMR A;  2HHU A;  3SI8 A;  4Y2X A;  5DG9 A;  3MC1 A;  4EYI B;  3SAG A;  4F4Z A;  1FFV A;  4US8 A;  1H38 A;  2FDR A;  4FZM A;  4R8U B;  4YD2 A;  4Y2U A;  2MUT A;  5KL8 B;  4GXI A;  5CB1 A;  1MQ3 A;  9ICF A;  4PL2 A;  2EQY A;  3V7J A;  4ED8 A;  1Z00 B;  2DBY A;  2L5Y A;  4MFF A;  2MU2 A;  5IIJ A;  1Z4O A;  3K1Z A;  2KNJ A;  5TZV A;  3UXP A;  4DQS A;  4NLB A;  1CI4 A;  4BWM A;  1PZN A;  4O3Q A;  4ECY A;  5KFA A;  5AI6 A;  4P4M A;  1TKD A;  1UT8 A;  2E1E A;  4UB5 A;  4ECS A;  2JEF A;  1CUK A;  1BNP A;  4JWM A;  5CHG A;  2K8A A;  5III A;  2P35 A;  1BVS A;  5KFD A;  2BQR A;  5KFT A;  3M6K A;  3V7L A;  3EW9 A;  2BKE A;  9ICK A;  2ZTE A;  1X6I A;  2ZG6 A;  4EX7 A;  3KHG A;  3Q8S B;  8ICX A;  3TAC B;  5D49 A;  4M04 A;  2KZM A;  5B66 U;  1TAM A;  2HHW A;  5KG4 A;  4UAS A;  4TUQ A;  4FFD A;  4LVS A;  3AU2 A;  5KFL A;  3OTQ A;  5BOL A;  4NLN A;  5J2I A;  1T4G A;  4YMN A;  5DBB A;  1ZQ1 C;  3KKA C;  5HP4 A;  2BCU A;  7ICI A;  1WG8 A;  3NRW A;  4I28 A;  2KJ8 A;  1KW4 A;  2AGP A;  3IHQ B;  4EEK A;  1BPY A;  4I2D A;  1S97 A;  2JGA A;  4CF4 A;  3AU6 A;  4DQR A;  1PVQ A;  1K1Q A;  2K4I A;  1UHU A;  5AKG A;  2HOI A;  2ZTD A;  1COO A;  5DQG A;  2E3T A;  4DFJ A;  5CP2 A;  8ICO A;  2KSO A;  4M6W A;  4NV0 A;  3T3F A;  1ZD4 A;  2ZIW A;  4P0P A;  4I2G A;  5KFH A;  1ZRM A;  1K1S A;  5CR0 A;  4TUR A;  2F1H A;  3BS7 A;  4FBT A;  4ECV A;  4F4K A;  4M9G A;  3WK4 A;  1KLN A;  5AKZ A;  5JTI A;  1X9X A;  2PI4 A;  5HHI A;  1N5X A;  5IIL A;  8ICV A;  3BQ2 A;  4CF3 A;  4KLO A;  1ARO P;  4BWJ A;  2ASJ A;  4KLI A;  2HOQ A;  2PFQ A;  3EUB 2;  4I2A A;  5KAF U;  4YMM A;  2LKY A;  2BQ3 A;  2WB1 C;  5KFR A;  2LHT A;  2MUT B;  2ZUB A;  3PW7 A;  4LZD A;  5J0Y A;  5J29 A;  5L1J A;  2KG5 A;  5AKJ A;  4F5Q A;  3MR5 A;  1XS9 D;  3NTU A;  4IRD A;  5J2F A;  3RAX A;  5KFP A;  3M9M B;  3PSF A;  2MRL A;  9ICH A;  2Z7J A;  5DKW A;  2DFL A;  1WYG A;  4F5O A;  2ES6 A;  2K4H A;  2FLL A;  5GTH U;  5DDM A;  3EZ5 A;  1N60 A;  1RZT A;  5J2B A;  3MAB A;  2EDU A;  4M2Y A;  1XU4 A;  3H8W A;  4FZL A;  1S9F A;  1OUQ A;  3JPN A;  2N1R A;  1SV0 C;  2ZIX A;  3E2E A;  1UA1 A;  2NRZ A;  2W3S A;  3ORY A;  9ICA A;  3E58 A;  3GDX A;  4GFJ A;  4J9S A;  2W9C B;  4JUZ A;  4RPX A;  1A76 A;  7ICV A;  5C0Y A;  2KJ9 A;  4RUA A;  3FDS A;  3GFK B;  5IIK A;  8ICA A;  3HP6 A;  2WF6 A;  3RF9 A;  2QAR B;  1DRG A;  4JK1 A;  2K4P A;  2B21 A;  5AHX A;  2HBK A;  2G07 A;  2KP7 A;  4XUS A;  9ICT A;  2PFP A;  5AIA A;  5KFS A;  2KHV A;  1L6N A;  4NL9 A;  5DB7 A;  2G08 A;  3TAP A;  4OD0 A;  2IOF K;  1RXV A;  2VJ5 A;  1RPL A;  1ZQN A;  4UB3 A;  3N4M B;  2PMZ C;  5ALH A;  3C29 A;  4NXZ A;  2B6G A;  5J2J A;  1L8L A;  5EOZ A;  3QU2 A;  3L4P A;  3IV6 A;  4CF5 A;  5L1M A;  5DB6 A;  3RH4 A;  9ICP A;  4KX3 A;  2GO7 A;  2IOH A;  1U47 A;  2EZZ A;  4NLZ A;  3KOO A;  3RFA A;  3AM9 A;  3K75 D;  1MC8 A;  4J9O A;  3N28 A;  4B9N A;  1DK3 A;  1JXL A;  4KLT A;  4QZ8 A;  3ZDB A;  2F8K A;  4GC7 A;  3VCB A;  1SKR A;  1KTQ A;  3LK9 A;  4EBC A;  2R8J A;  4QZ9 A;  1HEK A;  1HUZ A;  2IHN A;  3N97 B;  2A19 A;  4P0P B;  1SZH A;  1Z1V A;  4ZH4 A;  5J0X A;  5KFW A;  4TQR A;  2RDJ A;  1NZB A;  2NO5 A;  3RJE A;  3JPQ A;  3OPX A;  1S0V A;  1GO3 F;  2BCS A;  2W55 A;  3OJS A;  4QZG A;  4YP3 A;  3MR2 A;  2WF8 A;  1KEJ A;  3JPT A;  2BPG A;  1ZQX A;  1SL0 A;  5JRT A;  4YFK A;  4ED0 A;  7ICE A;  2ATL A;  5KFU A;  1KKX A;  1RQL A;  3V6H A;  3WK8 A;  2DGZ A;  3N7R C;  2KIC A;  1KDH A;  3PMN A;  2NRV A;  3OGU A;  2BCV A;  3PW0 A;  3RR7 A;  2H3Q A;  2DWQ A;  3T79 A;  4UB1 A;  2QB0 A;  5J0Q A;  4AP9 A;  1D9D A;  2EAO A;  8ICM A;  2W8L A;  3CYM A;  5F9L A;  3BQ0 A;  4IRK A;  1JXE A;  5KT6 A;  4EEY A;  1Q3U A;  1IIP A;  3B9J A;  4QWB A;  1JX4 A;  3BS5 A;  3BZC A;  5KTQ A;  4O3P A;  5DG7 A;  4MF2 A;  2HSZ A;  4PGY A;  3ZDE A;  2RHF A;  1IV8 A;  1EXN A;  4P4O A;  4M9J A;  4R63 A;  3MR6 A;  1L8O A;  3H8M A;  5AKI A;  4HYK A;  1S0O A;  1D9F A;  2YMM A;  2Y9U A;  3RB0 A;  2KIV A;  3SV4 A;  2LYB A;  1NJY A;  2ESE A;  1ZQW A;  3ICX A;  1N61 A;  2ZIX B;  1TK8 A;  3ZI4 A;  3RBD A;  1Q8K A;  3PR4 A;  1PVP A;  1T3N A;  3PO4 A;  3M1Y A;  4DCC A;  4ED3 A;  1L3U A;  2ISP A;  2XID A;  3D2S A;  4ZOH C;  1UA0 A;  5AK5 A;  4DFK A;  2RDI A;  5KT2 A;  2KVS A;  4DL3 A;  1N5W A;  5KG2 A;  2UVR A;  2BCQ A;  1ZQQ A;  2PMZ F;  2BQU A;  2EAN A;  1ZD5 A;  4BXO B;  5AI8 A;  5KFV A;  4QW8 A;  5HNK A;  4P0Q A;  5KFO A;  1UCV A;  5F3X B;  1S8O A;  5ALV A;  5BOM A;  2YY6 A;  5AI9 A;  3MDA A;  3UMG A;  4KN4 A;  2F2A B;  2RP5 A;  3GIL A;  4O5C A;  2YML A;  1SKW A;  4PPX A;  8ICE A;  1T7P A;  4J03 A;  3QUQ A;  4UAT A;  2IBK A;  2OHF A;  5HMM A;  2W8K A;  3PST A;  5HR7 A;  2W9B B;  2ZJ5 A;  5A0L A;  3GIM A;  1DGS A;  1NK8 A;  2LBO A;  1WUD A;  1K5O A;  1SIJ A;  2R8H A;  4I2E A;  2CRX A;  2V9W A;  2JEG A;  2VA3 A;  3HX0 A;  4PHE A;  5ALM A;  2R8I A;  1NK5 A;  3FC4 A;  3SMV A;  2M9N A;  5EWE A;  1MQ2 A;  5KFB A;  5AM1 A;  5KFJ A;  5KFY A;  1A77 A;  3BQT A;  2M0N A;  3WKC A;  5DLF A;  2W11 A;  2WAQ C;  2XC9 A;  2CXY A;  2W03 A;  4ECW A;  1S10 A;  2IOF A;  3HPO A;  4Y2Q A;  4EBD A;  2HHV A;  1SV4 A;  3IG8 A;  3V6J A;  2DF4 B;  1RM6 C;  3I1Y A;  1ZJM A;  2F8L A;  5ALW A;  3QUT A;  1V85 A;  4F4X A;  1TAU A;  3UQ2 A;  4O3R A;  3NGD A;  4RPY A;  1QSS A;  3H4D A;  1U4B A;  1LB2 B;  3TAR A;  3PNC A;  4JB3 A;  5B5E U;  1RYS A;  1QSY A;  1ZQY A;  2H3I A;  3ED5 A;  3M9N B;  3C28 A;  3RJJ A;  4F2R A;  2I5H A;  2QLT A;  5AKL A;  1F44 A;  2EAM A;  2XGQ A;  1NK0 A;  2QB0 B;  4PHD A;  3BDP A;  1ZYQ A;  1KQQ A;  5EWF A;  4C4S A;  3C21 A;  2FI1 A;  4RQ1 A;  5DB8 A;  1O08 A;  1TK0 A;  1X42 A;  3ZDA A;  3BS5 B;  3NS1 A;  3WK6 A;  4CE6 A;  5ALN A;  3K1R B;  2XVT A;  9ICO A;  4MEX A;  3U26 A;  2Y9T A;  3M7D A;  1T94 A;  4KLG A;  2Y1J A;  2YB4 A;  2MSN A;  5J0P A;  2MA1 A;  3UPQ A;  4J9N A;  5ALR A;  1J2N A;  2NYV A;  5AM4 A;  1NKB A;  9ICL A;  3GV7 B;  5KFM A;  5J0U A;  2XY5 A;  1ZJN A;  4UB6 U;  5JU5 A;  2KOB A;  1ZQB A;  4FS1 A;  1ZQR A;  2NO4 A;  1NJZ A;  1XSP A;  4CDG A;  2LYA A;  4R66 A;  4RQ8 A;  2KVC A;  4DL7 A;  2R8K A;  3GV5 B;  1JUD A;  3HJE A;  4O5K A;  3K4G A;  3F5E A;  3CW2 C;  3QUB A;  4F91 B;  2W7P A;  4M47 A;  2DKX A;  3RTV A;  7ICL A;  4KLS A;  4EZ6 A;  3UMB A;  4CRX A;  1ZQU A;  1QQ7 A;  3QEA Z;  3SAH A;  1KRP A;  4DO9 A;  9ICE A;  1B0X A;  3H4B A;  1J97 A;  5J0O A;  1LVH A;  4I2J A;  4YMO A;  1DOQ A;  9ICW A;  3B0X A;  5KT4 A;  3SD7 A;  7ICJ A;  4Z6F A;  3NVV A;  4B9T A;  4YCX A;  5T14 A;  3EPI A;  2PFN A;  4J9K A; 
#chains in the Genus database with same CATH homology
 1LKY A;  1UCV A;  2KSO B;  5F3X B;  2LPE A;  3BS5 B;  2KSO A;  2QAR B;  2FE9 A;  2QAR A;  2K4P A;  5KNI A;  4PZO A;  2KE7 A;  3K1R B;  3TAD C;  4NJ8 A;  2Y9T A;  1SXD A;  2QB0 A;  4NL9 C;  2F3N A;  2EAO A;  3BS7 A;  2DL0 A;  4NL9 A;  2KMD A;  1DXS A;  5JTI A;  1X9X A;  1V38 A;  2GLE A;  1OXJ A;  3BS5 A;  1COK A;  1OW5 A;  4PZN A;  2B6G A;  1F0M A;  1JI7 A;  3TAC B;  3IDW A;  1SXE A;  1UQV A;  1WWV A;  3HIL A;  3H8M A;  4RQM A;  5JU5 A;  2K60 A;  1PK3 A;  5L1M A;  3BQ7 A;  2Y9U A;  1RG6 A;  2KIV A;  2D8C A;  2JV3 A;  2E8M A;  1SGG A;  2D3D A;  1WWU A;  2ESE A;  2KG5 A;  1SV4 A;  2E8N A;  2E8P A;  4IS7 A;  4MHV A;  2F44 A;  3KKA C;  1V85 A;  2DKZ A;  2F8K A;  3KKA A;  1PK1 B;  2DKX A;  2ES6 A;  2LMR A;  1LKY B;  1KW4 A;  1X66 A;  4RQN A;  1B0X A;  1Z1V A;  1X40 A;  1B4F A;  3SEN A;  2EAP A;  2YTU A;  1SV0 C;  2EAM A;  2E8O A;  2QKQ A;  2QB0 B;  2L5Y A;  1SV0 A;  2EAN A;  3TAD A;  5J8Y C;  3SEI A;  5JRT A;  5J8Y A;  1PK1 A;  2QB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...