2KG5A

Nmr solution structure of arap3-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
HMAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILRLLQTGTEEGSLDPKSDSAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Sam domain of the lipid phosphatase Ship2 adopts a common model to interact with Arap3-Sam and EphA2-Sam.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Arf-GAP, Rho-GAP domain, ANK repeat and PH domain-containing
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kg5A01
3SENA 1WWVA 3KKAA 3TADC 2QARB 1DXSA 2E8PA 1UQVA 2E8MA 2DKZA 2QKQA 1X40A 1F0MA 2EAOA 4IS7A 1SXDA 1RG6A 1V85A 2KG5A 2F8KA 4NL9C 2QB1A 1SXEA 2D8CA 4RQMA 3BS5A 5L1MA 2EAMA 2YTUA 1UCVA 3BQ7A 1COKA 1PK1A 4NL9A 2B6GA 2QB0A 1JI7A 1Z1VA 2KSOB 1SV4A 1SGGA 3TADA 5JTIA 3IDWA 2LMRA 1V38A 2QARA 1SV0A 3BS7A 2D3DA 2LPEA 4MHVA 2KSOA 2JV3A 5J8YC 5JRTA 2KMDA 1WWUA 2E8NA 1LKYA 1X9XA 2L5YA 1PK3A 2E8OA 2KIVA 2KE7A 2FE9A 2F3NA 1B0XA 5JU5A 1X66A 2DKXA 2EANA 2F44A 2QB0B 1OXJA 2Y9UA 4RQNA 2EAPA 2DL0A 1LKYB 1OW5A 2GLEA 2K4PA 1KW4A 3H8MA 4PZOA 3K1RB 5F3XB 2ES6A 5KNIA 1SV0C 2K60A 3SEIA 1PK1B 3KKAC 3HILA 3TACB 4PZNA 5J8YA 4NJ8A 2ESEA 3BS5B 2Y9TA 1B4FA
chains in the Genus database with same CATH superfamily
2BPFA 5J2AA 1RPLA 4DL6A 7ICLA 4PHEA 3AQFA 3RB4A 4KLJA 4CGZA 3NS1A 4F5RA 2MA1A 4YQWA 5KFEA 2EZXA 4ECSA 4FS1A 4YP3A 2MRLA 3ZD9A 2D8CA 4C4RA 2CN1A 8ICBA 7ICKA 1ZD4A 4QZGA 5KFQA 3AU2A 2PI5A 4AYBF 4PGQA 2NRZA 4GC7A 3TADA 4EEYA 1TAQA 5DQIA 4JB3A 3QUQA 4QWBA 3V7LA 3H4BA 2KSOA 1MN8A 2VA8A 1RXVA 2I9GA 2A19A 3N4MB 1L8OA 2H3VA 3TI0A 4LVSA 1JALA 3V6HA 4I2EA 8ICVA 3HW8A 3PSFA 4J9QA 2FE9A 2W9AA 1X66A 2GWSA 3OHBA 1KL9A 1S10A 2W54A 1X9SA 3WK8A 4XA5A 7ICRA 3H40A 3QU4A 2BCQA 4RQ4A 2JEJA 1ED1A 5AKEA 2MUTA 3ZDAA 3H8SA 1SV0C 4FZMA 5DB8A 2ASJA 3SV4A 2PFOA 4FZNA 2JH7A 2G5HB 4B9MA 2BQRA 1ZQIA 2HOFA 4DQQA 5KT5A 1SWVA 3QZ8A 2KTQA 4MF8A 4OO1J 2BQ3A 2Y1IA 4Y2PA 3RAQA 1ZXIA 2F1JA 2EZYA 2E8MA 3FM9A 5J0QA 3D2NA 3CRXA 4YVZA 5BOMA 4LZDA 4QIWC 1RYSA 1L7PA 4BDPA 4C4TA 1DRGA 2R18A 4DOCA 4ECYA 2KIWA 4ECRA 4TUSA 5KG2A 3QX7A 4F5OA 1NZBA 4JK1A 1SKSA 3DDHA 1ZD5A 1JI7A 4ICAA 5KFPA 2XCPA 5KFOA 3NRWA 2KSOB 3TFSA 1SGGA 3NGDA 2F8LA 2KJ9A 2BCVA 3MR5A 2B21A 5ALZA 5AI5A 1NK0A 5HHIA 2EQYA 2I6XA 4YG2A 5J8YC 4IRDA 4PHAA 4DSEA 4TUPA 2ZTEA 4OJ5A 2ASLA 4F91B 1WWUA 1BGXT 1SL2A 2CPRA 2W7PA 3BZKA 4P4MA 3EYZA 3B9JA 4ECWA 8ICUA 1N60A 4QNLA 3HWTA 3AM9A 2K8BB 2JEGA 5HR7A 1HJPA 4KLEA 1ZQVA 4DL7A 3NVWA 5J2FA 5HMMA 4UB8U 3QEAZ 3KHGA 5D46A 3MBYA 4KTQA 2IOHA 4CF5A 1PK1B 4UB1A 3T79A 3C29A 4J9KA 1KQQA 4O9MA 3MDAA 3OTQA 2DFLA 8ICTA 3QNMA 3AU6A 5AM2A 5J0PA 1L3UA 2V4QA 4KMUA 2H3ZA 2FLNA 3A0BU 2G5IB 3UXPA 2QARB 5T14A 5EWGA 1KBUA 4UASA 2JR5A 4C8KA 3PX4A 5J2DA 5D49A 3N28A 3I1YA 4QWEA 2A3VA 1Z00B 3O0FA 3E2EA 3L5KA 4CCHA 5KT4A 4M47A 2C22A 2HOQA 2YMMA 4EBEA 5CP2A 2EAMA 4X5VA 1SKRA 2F1IA 1C7YA 4XQ8A 1KFTA 5KT2A 1SV4A 4M9HA 4ED0A 1UT8A 4O3QA 1S8OA 2LMRA 2HW3A 4MFFA 2H3QA 9ICQA 3E58A 5AM1A 2G07A 2BPCA 3UMGA 1DK3A 5IIOA 3M1YA 1ZQHA 1LKYA 3AN1A 2JH1A 2HHVA 4MFAA 2KFNA 1HEKA 1PK3A 4DQPA 9ICUA 3BZCA 2QB0B 1WG8A 2KJ5A 4PJ0U 2EAPA 3BQTA 3H0MB 3M7DA 4YFKA 2PFPA 3ETLA 1NKBA 2HSZA 4JV1A 1NKEA 2BCUA 3D2SA 4RQ6A 5C0YA 3PR4A 3PNCA 3N7RC 4MF2A 5F9LA 4IR1A 2KJ8A 4P4PA 2BGWA 1TKDA 2YQEA 3GDXA 4NY8A 5EE9A 1ZQZA 5AM4A 2PFQA 3E0FA 2ZJAA 3KZXA 2W55A 5BOLA 3MFHA 9ICSA 1S5LU 4I2DA 1SB3C 4C8NA 3GV8B 4Z6CA 1ZOLA 2P66A 2LHTA 3TAQA 5ALVA 4J9PA 4ED2A 2ODGA 5KFAA 4C0ZA 3MC1A 1FEZA 2KG5A 1L3VA 1X9MA 4XRHA 4I29A 3IG8A 3BQ2A 1NK4A 5CWRA 3SV3A 2JGAA 2OHFA 1D9FA 2QB0A 1KLNA 4QZEA 1SWWA 1Z1VA 1N56A 1Q3VA 3GZFA 3VCBA 5CHGA 5DB9A 2BCSA 3F2CA 4QZIA 4RNNA 2MU2A 3M8RA 3NVYA 1RM6C 3M8SA 5AKZA 5KG1A 2ALZA 2HHQA 4OCZA 1B22A 1TE2A 3OJUA 4CF3A 5DQHA 4DS4A 5KG4A 1T8EA 3PR5B 2GOLA 4QZFA 3PW2A 4QZ9A 3UXOA 4GC6A 4Y2SA 1KFSA 4F5NA 2RDJA 2A1JB 2DPJA 5CEHA 2NRWA 2JEIA 3G6YA 5L1IA 1JROA 4PZOA 2KFZA 3RB6A 3I76A 3PVXA 3F2DA 2XIDA 5ALEA 4B9UA 4OJ6A 2J6UA 2JRZA 3ISCA 5ALWA 4OD0A 3PZPA 5DDMA 3CNHA 5AK5A 1GO3F 3JPTA 5AKHA 3TACB 4PZNA 2HOIA 5K4LA 1XC9A 4GXIA 2ISOA 1TK5A 4RUAA 1MQ2A 3PMLA 2XCAA 4QZBA 4IRKA 3TQ1A 2E8PA 1F5SA 4O0IA 2FDRA 1ZYQA 4F93B 5ALOA 2VIXA 4NLKA 3FDSA 8ICMA 5CR0A 4GFJA 3LVVA 4DWIA 3PW4A 3WKEA 2YTUA 5ALXA 5DB6A 2NRXA 1ZQTA 4PL2A 4J9OA 3F53A 1KTQA 2C2EA 3PO5A 1NK9A 4DQIA 4Y2VA 1JN3A 2FJ6A 1RZTA 5HMLA 4TQRA 4ECQA 1DOQA 4YMMA 4BXOA 4ACOA 1M6YA 1ZQJA 4F4XA 1S0NA 2LYAA 4Q45A 5KFXA 2WF6A 1KEJA 4FZLA 5AIBA 4RQNA 5KFGA 5KT7A 3KOOA 5J0RA 2W3SA 3RAXA 4KLUA 5JUMA 1LKYB 4F4ZA 1H38A 1OW5A 5ALJA 1ZQXA 4I27A 4DF4A 4DLEA 2G0AA 4ED3A 1TAUA 8ICAA 3GFKB 2ZUBA 3K75D 1RQNA 2ES6A 5ALYA 1B43A 3Q8SB 7ICUA 2ZTCA 1KSPA 1XSPA 3KKAC 2PI4A 4M04A 2ESEA 4CDGA 1LVHA 2AHOB 3MR2A 4F92B 3T5HA 3V7KA 3MGIA 4P0QA 4UARA 3PSIA 3M6KA 1WCNA 2H3FA 1A0PA 4RNOA 4YMOA 2LM1A 5KFRA 3G6XA 2PXIA 7ICMA 3RBEA 2AQ0A 2KNJA 8ICRA 5J2GA 4NL9C 3TFRA 3C1ZA 1NK5A 4EX6A 1XO0A 4DFPA 4I2JA 4YR3A 4RPXA 2XC9A 2R8GA 3SAHA 3SI8A 5HP4A 4F2RA 3WK7A 4Y2UA 5AK3A 1ZQQA 2KD1A 4F50A 4R65A 1V38A 3BS7A 1SV0A 9ICGA 2RDIA 2PFNA 1NJYA 4YR0A 1Z19A 4YXMA 5JRTA 3RJEA 4O5CA 3HRDD 5J0YA 2RLTA 2DPIA 3PW5A 4F4WA 7ICSA 3V7JA 1MSWD 1NOMA 3HT3A 3RTVA 3PO4A 4Q8FA 2UVUA 4BWJA 1PVRA 9ICLA 4ECVA 3H4DA 2MUTB 1VJ5A 3QYPA 3JPSA 2K8CB 1KRPA 2UVVA 3IG5A 2R8HA 5KTQA 2KVSA 4B9NA 3OJSA 4J03A 4CNQA 1PZNA 2YX8A 5ALPA 3RFAA 1ZQAA 3RBDA 4NJ8A 4NXZA 9ICTA 1PVPA 5L9XA 4ED1A 3WU2U 3SD7A 1NK8A 4Z6DA 9ICOA 4EYIB 1IV8A 3F5EA 2UVWA 2HBLA 5IIKA 1QTMA 1FFUA 2KZMA 1BPBA 1N48A 3S6JA 3EW9A 2W11A 1JX4A 1NK7A 2F8KA 1TV9A 5KAIU 3GIJA 4DQRA 9ICVA 2ZIWA 2F2AB 1ZQFA 9ICJA 3BS5A 4Z6FA 4EENA 1ZQWA 8ICOA 4EZ9A 1SKWA 4K4GA 2JHDA 5KFLA 1RYRA 2B0CA 2KZZA 2ZIXB 5CB1A 4BWMA 4UB3A 3UPQA 2PMZC 1D8YA 3GV7B 3RR7A 2KV2A 3ORYA 2I5HA 3TANA 3AMZA 4KLDA 5AM3A 3SQIA 3LYSA 2JZBA 2F77X 1Z4NA 4A8EA 1BPXA 4O5EA 1BNPA 2VJ4A 4PGYA 5AM5A 3GIIA 3KZIU 2IHMA 3GIMA 9ICNA 3NRZA 5KL1B 3J81j 1DGSA 2L5YA 5KFSA 1T3NA 4B6JA 1UHUA 8ICIA 5DDYA 3RB0A 3Q8MA 9ICAA 1MC8A 7ICJA 3ZDBA 3G6VA 1JXLA 3K1ZA 3RB3A 1N61A 7ICVA 3RF9A 1L3TA 2JEFA 2NV3A 3H8MA 4JWMA 1CEZA 1XU4A 1TK0A 5F3XB 5HNKA 8ICGA 5ALQA 4PGXA 7ICIA 4RQ7A 3D6JA 1KKXA 1X9WA 1QCKA 4J9LA 4E0DA 1QQ7A 3PX6A 3HILA 4RT3A 2W8KA 1TFRA 3M6ZA 2FPLA 2ZUDA 1B4FA 4IL6U 1QSSA 3WK9A 1Q46A 1ZQ1C 3C2MA 3H8WA 1L5UA 1LV5A 4B9TA 4F71A 2KOBA 1XNSA 1ZQNA 3EPIA 1ZRMA 1NI3A 5KT6A 3RJHA 1WUDA 2W43A 4QZAA 4Y2JA 4PL1A 4CE6A 1L7MA 2QB1A 2MSNA 3MGHA 2XGQA 1X6IA 7ICHA 2BHNA 4IC9A 2WHEA 4DCCA 4EEKA 2B6GA 4QW9A 2AJQA 4DFDA 2FMSA 2LBOA 1D8LA 3L3FX 1VDVA 2HHTA 8ICYA 1HUOA 4ECTA 2D3DA 3RH4A 3B0XA 2EDUA 1V97A 2JV3A 9ICRA 2KMDA 5KFDA 4DQSA 3UQ2A 4KLGA 3V6JA 1OUQA 1RYUA 3RH6A 4FFDA 4YN4A 4JV0A 2MAXA 3OSPA 5DG7A 2DGZA 3MR3A 2Y9UA 4M9GA 2F1HA 5DKWA 2HHUA 3Q8RB 1L8LA 1WCLA 4Y2YA 4OJPA 3NTUA 2Y0SC 2R8IA 2K60A 3NVZA 3SEIA 3U26A 3N7SC 4JWNA 5AK6A 5AKYA 4QZ8A 5DLFA 2F76X 3ZDEA 5J2HA 2O6KA 5J2KA 2WB1C 4YD2A 2NRTA 2KP7A 4YR2A 3C23A 5JU5A 1T7PA 3ED5A 4ELUA 3HKZC 4UB4A 2GO7A 4YMNA 2WF5A 4RQ0A 3C5GA 4ELVA 5AI4A 8ICCA 2YMPA 5KAFU 1SIJA 2E3TA 3UM9A 4AP9A 2KKPA 5CA7A 3FYHA 1ZJNA 4IS7A 1SL1A 4QWDA 5DBBA 1S0OA 5KFVA 2ZIUA 2M0NA 2OCEA 1T3QA 2KEYA 2NO4A 2ZJ5A 5DQGA 3PV8A 1UCVA 3WKDA 2WF8A 3BQ7A 5KFNA 1DGJA 4F4KA 3N7PD 8ICEA 3V6KA 3TKAA 2LYBA 5IIJA 5J0OA 2KN7A 3T3FA 3UQ0A 5H2FU 5KFFA 4LZGA 4UAWA 4KLOA 3RRGA 4P0PA 4DSFA 1FIQA 3KD3A 5AICA 5CRXA 2DQNB 4I2IA 3Q8LA 2QLTA 4RUCA 1HUZA 5G5GA 4KX3A 5AI6A 2F3NA 2EANA 1ZJMA 3C1YA 2ZG6A 5KFHA 2BDPA 2LM4A 4K4HA 5AI8A 4YD1A 1X6JA 1XSLA 2R8KA 2WF7A 3K1RB 1QSLA 2IHNA 4CRXA 5TISU 1CRXA 4ED6A 1KN5A 2M9NA 4IQWA 8ICXA 2WF9A 4EBCA 2XY5A 1Z1BA 1BVSA 3Q8KA 2DBYA 2OYYA 3KKAA 4IQVA 2A1JA 4GLXA 3KFUF 1RQLA 1DXSA 2DWQA 2G08A 2HCFA 1MQ3A 3ZD8A 3PW7A 3GILA 4M9NA 4KLFA 3A0HU 3QU5A 2RHFA 5DGBA 3QXGA 3OSNA 2P6UA 4OJLA 3WK4A 3WKCA 4DSJA 3QEBZ 5KFCA 2IOFK 4Q8EA 2AU0A 5DB7A 5AK4A 4PH5A 2W9BB 8ICJA 5EE3A 2ZUCA 5AKKA 3MABA 4O3PA 4YXJA 4NL9A 1BPEA 4UAUA 1ZQUA 5KFBA 1NZPA 5JTIA 3MFIA 2KZ3A 2ASDA 1F44A 4UATA 1AROP 4MEXA 1U47A 4MFCA 5AKLA 1QQ6A 3RRHA 1ZQCA 2Y0SF 3HX0A 8ICQA 2C2DA 1S0VA 3RH5A 2KIVA 4B9SA 1D8BA 2KE7A 3CW2C 3KHLA 3L4PA 4UBBA 4O3MA 8ICWA 2BZFA 8ICNA 7ICPA 3D2QA 2KKVA 3HKZF 4OJOA 3F2BA 5ALMA 4RU9A 2IOFA 4DEZA 3QU7A 1YZ7A 2WTFA 1IIPA 1BPZA 1ZQMA 8ICFA 5L1JA 8ICZA 3ETRA 2BR0A 5J0UA 3PSTA 2ZIVB 2K8AA 4TUQA 2EH9A 4NV0A 3VC8A 5KG6A 1T94A 2VANA 5L1KA 5J8YA 4UAYA 5AKIA 4YCXA 5KT3A 5FP0A 1ZQKA 1L7OA 4K4IA 4GXKA 3BJYA 4UB6U 1ZQYA 1ZQRA 1JMSA 4I2FA 4GXJA 9ICXA 1O08A 2XO7A 2HVIA 4B9VA 1TVAA 4F5PA 4FBUA 3HJEA 4RPZA 4QZHA 4QWCA 3UMBA 4NLBA 4C7ZA 2CRXA 4M6WB 3C21A 5EWEA 1RG6A 1D9DA 4CF4A 4U6PA 1SXEA 4RQ2A 4KITB 1ZQSA 1N63A 5L1MA 5KG5A 2XY6A 4M9LA 1Q3UA 3SAFA 4Y2QA 5IINA 1PK1A 3UMCA 4C4SA 4BX9C 1K5OA 2AGQA 2V9WA 4NWIA 1L7NA 1ZQOA 2VJ5A 2LPEA 9ICPA 2FMQA 2Q0ZX 2EZZA 5EE1A 3AL0B 2HI0A 4R63A 1FO4A 3EUB2 5IILA 4FE3A 2E8OA 1DK2A 3KTQA 4IRCA 2HBMA 2HHXA 3NVVA 5ALGA 2LKYA 3SZ2A 4F2SA 3QUCA 2BQUA 5ALLA 2HMXA 4ELTA 1Z4OA 3CYMA 4F4YA 4PHDA 2DUYA 4FBTA 9ICIA 1NKCA 5J0SA 3AUOA 3WKAA 3IRUA 2C28A 1A77A 5KFJA 1BNOA 3MR6A 2W03A 2Q4TA 4KLTA 2Y9TA 2CXYA 2FPKA 3OPXA 4PHPA 4BUGA 2DKZA 1X40A 3PW0A 2VA3A 2IA6A 4RQ1A 2EAOA 5KFZA 2FI1A 2FMPA 3ICXA 1U4BA 1V85A 4RQ5A 1PVQA 4NLCA 3NUQA 1J2MA 4F72A 4RQMA 2K89A 1XS9D 2ZIUB 5ALRA 1PUZA 2N1RA 2DF4B 1ZQPA 9ICMA 1RXWA 3LDAA 4O3NA 2YY6A 4NM1A 2ISPA 1X42A 1U48A 1XWLA 4C80A 3AEVA 1VLBA 4Y2XA 3AQEA 4IR9A 5B5EU 1S0MA 2QARA 2P35A 5GTHU 4P2HA 1UA1A 2K4EA 2UVRA 4MEYA 4XUSA 4KN4A 3K4GA 1ZD2P 2E8NA 3DV9A 4USAA 3ZDDA 3RJFA 1RDFA 3I28A 3JPQA 4UB5A 3H0LB 2ZIWB 2ZIVA 4I2BA 3MGVA 3EZ5A 1JUDA 4EZ6A 2HDOA 3PX0A 3PSPA 3ZI4A 2DL0A 2ZXIA 1N5WA 4I2HA 4C7YA 1KW4A 5J29A 3OGUA 5EE0A 1TAMA 4M6WA 3FAHA 4RPYA 1T4GA 3SMVA 1NJXA 3M9NB 5KG3A 3PMNA 3C2LA 1N2XA 2H3IA 4KLQA 9ICEA 3SENA 2HVHA 4DOBA 1S76D 3V72A 5AKGA 3B0YA 5ALIA 2QKQA 4BXOB 1A76A 1F0MA 1IXRA 2YMQA 4KN7A 4DS5A 3M9OB 4P0PB 1U49A 4JV2A 2XGPA 3GQCA 4I2AA 2W9BA 4PPXA 4DFKA 3KHHA 3M9MB 2Z7JA 3QE9Y 7ICFA 2K4IA 2AXTU 2G06A 3Q8PB 4DL2A 1J97A 2W8LA 4BJQA 4O5KA 7ICTA 4R66A 1O03A 3HPOA 3ISDA 5J2JA 2PKEA 2W7OA 3T5KA 4HAIA 3ISBA 3C5FA 1V9PA 9ICBA 1JXEA 4O3SA 1A6SA 4M9JA 4ECXA 1NNLA 1X9XA 1JRPA 9ICKA 9ICHA 4Q44A 4DO9A 1QLNA 3BDPA 5J0TA 5ALKA 1TK8A 4KLHA 1UPHA 3IP4B 2DKXA 2WAQC 5KFWA 5CJ7A 4B9LA 3RJKA 5DBAA 1SZPA 7ICNA 3JPRA 2V4RA 4UBCA 4Z6EA 3N97B 3LWMA 4TURA 4QZDA 4ECUA 5EOZA 4KLIA 3IM1A 3EWAA 3ONNA 8ICPA 5KG7A 7ICGA 2RRDA 4R8UB 3TAPA 2WFAA 1JIHA 2NYVA 5J0XA 2G09A 1HIWA 3QZ7A 1S77D 3Q8QB 5ALSA 4DL3A 1K1QA 4ZOHC 1L6NA 3H0RB 2J6TA 3GV5B 9ICWA 3ALRA 5KG0A 5A0LA 2RQ5A 3WK5A 3OHAA 3DEEA 2ZIXA 5AI9A 2WAQF 4Q43A 4EELA 1S9FA 4DSLA 4ECZA 2BPGA 2HBKA 4HYKA 3RJGA 2Y1JA 3QU2A 5F9NA 4DSKA 2HHWA 4US8A 2GH1A 4DL5A 5J2EA 2E1EA 4GIBA 2AH5A 4KMOB 5KFIA 2HBJA 2YMLA 3JPOA 3UXNA 2IMWP 5KFTA 4EYHB 1ZRNA 1QH9A 5DBCA 2HHSA 1UA0A 1N62A 4MHVA 2WB1F 1Z3EB 2NRVA 5E79U 4JMUA 3SYZA 5HR6A 5IIMA 2JXJA 2FLLA 1MA7A 2KICA 2W9CA 2OH2A 4J9NA 3LVWA 9ICFA 5DG8A 2OWOA 5AKJA 1ZQBA 1ZQDA 2P6RA 2XICA 3QUBA 4UAZA 4DOAA 3CP8A 1CI4A 5J0WA 5DGAA 2GLEA 5EWFA 2NO5A 4RQ3A 2XI9A 4NM2A 5L1LA 4DSIA 5ALNA 1EXNA 2IBKA 4QZCA 3SAGA 5AIAA 2W9CB 5ALTA 4NLZA 2E1FA 4F3OA 4IQTA 1K1SA 3BS5B 4UQGA 1BPYA 4BGDA 2OXOA 1FFVA 2E5SA 1SZHA 1LB2B 1CUKA 2K4HA 2BCRA 5KFUA 4RZRA 2KVCA 4DLGA 3C2KA 4WJ3B 4R64A 4U7CA 5ALHA 1URJA 3FC4A 5D4BA 3KHRA 4EBDA 4I2CA 2FLPA 7ICQA 4FS2A 1ZD3A 4JUZA 3HP6A 2AGOA 1BPDA 1U9LA 4G3IA 5AI0A 1YZ6A 2J6SA 3SR6A 1NJZA 1C20A 2FPMA 2AQ4A 5B66U 2D6FC 5ALFA 5J2IA 1COKA 3IHQB 1U45A 1COOA 2PMZF 3RJJA 1Z00A 1Q8KA 2OM6A 4ED8A 5AKXA 4G9BA 1Y88A 4KX5A 3WKBA 2RP5A 1ZQLA 2KHQA 3JPNA 4NLNA 2YB4A 1ZETA 4M0AA 4J9RA 1J2NA 1SL0A 9ICCA 4R8UA 3KBBA 2JMGA 4LJXA 2LI6A 2F44A 4P4OA 1OXJA 1UT5A 8ICHA 4FO6A 4O3RA 2VA2A 1IG6A 2K4PA 5BPCA 5AM0A 5C5JA 3IN5A 1X2IA 5KNIA 2YN4A 4RNMA 4IQUA 2XVTA 2BKEA 5KFKA 2KHVA 4ZH4A 3BQ1A 3GIKA 2ZTDA 2AGPA 1XSNA 7ICEA 4UB2A 2W3RA 1WWVA 3TADC 1YT3A 4US9A 5AHXA 7ICOA 4KLMA 4J9MA 1UQVA 4DFMA 5IIIA 4UW9A 5KFMA 3NASA 3T5LA 1P7DA 5DLGA 2VKQA 8ICLA 5ALDA 4DFJA 3BQ0A 2ATLA 3QUTA 3T5JA 1SXDA 3GU3A 3F5AA 3RJIA 5J2CA 5J2BA 4F8RA 2OEHA 4I28A 1L3SA 4J9SA 3C28A 3JPPA 5DG9A 5TZVA 1N5XA 2W9MA 4F5QA 4C8LA 3H8JA 3ZDCA 4QJFB 4TQSA 1ECWA 1NJWA 4NLGA 4UAVA 3IDWA 2ZJ8A 4EX7A 4C8OA 8ICKA 4O3OA 2KK0A 4QIWF 2BDUA 4M2YA 1WYGA 3QU9A 5KFYA 8ICSA 4DF8A 2W04A 1ZQGA 3EPGA 3WK6A 3H7IA 2JZBB 1IM4A 3LWLA 4Y2RA 4KLLA 3TARA 3THVA 1QSYA 4QWAA 4C8MA 5G5HA 1B0XA 4RQ8A 5GTIU 1ZQEA 4P0QB 4ED7A 1S97A 2ZXHA 5HHHA 2YB1A 4RT2A 4DL4A 2I1QA 4I2GA 3LK9A 5KL8B 3MDCA 3RR8A 3PY8A 2A1AA 2C2RA 2LYHA 4AYBC 4QW8A 1KFDA 1NK6A 5ALUA 1KDHA 1XO1A 3R9KA 4Y2TA 4KLSA 2R8JA 1QQ5A 1AQ6A 2XY7A 2H5XA 3IV6A
chains in the Genus database with same CATH topology
3SENA 1WWVA 3KKAA 3TADC 2QARB 1DXSA 2E8PA 1UQVA 2E8MA 2DKZA 2QKQA 1X40A 1F0MA 2EAOA 4IS7A 1SXDA 1RG6A 1V85A 2KG5A 2F8KA 4NL9C 2QB1A 1SXEA 2D8CA 4RQMA 3BS5A 5L1MA 2EAMA 2YTUA 1UCVA 3BQ7A 1COKA 1PK1A 4NL9A 2B6GA 2QB0A 1JI7A 1Z1VA 2KSOB 1SV4A 1SGGA 3TADA 5JTIA 3IDWA 2LMRA 1V38A 2QARA 1SV0A 3BS7A 2D3DA 2LPEA 4MHVA 2KSOA 2JV3A 5J8YC 5JRTA 2KMDA 1WWUA 2E8NA 1LKYA 1X9XA 2L5YA 1PK3A 2E8OA 2KIVA 2KE7A 2FE9A 2F3NA 1B0XA 5JU5A 1X66A 2DKXA 2EANA 2F44A 2QB0B 1OXJA 2Y9UA 4RQNA 2EAPA 2DL0A 1LKYB 1OW5A 2GLEA 2K4PA 1KW4A 3H8MA 4PZOA 3K1RB 5F3XB 2ES6A 5KNIA 1SV0C 2K60A 3SEIA 1PK1B 3KKAC 3HILA 3TACB 4PZNA 5J8YA 4NJ8A 2ESEA 3BS5B 2Y9TA 1B4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEN A;  1WWV A;  3KKA A;  3TAD C;  2QAR B;  1DXS A;  2E8P A;  1UQV A;  2E8M A;  2DKZ A;  2QKQ A;  1X40 A;  1F0M A;  2EAO A;  4IS7 A;  1SXD A;  1RG6 A;  1V85 A;  2KG5 A;  2F8K A;  4NL9 C;  2QB1 A;  1SXE A;  2D8C A;  4RQM A;  3BS5 A;  5L1M A;  2EAM A;  2YTU A;  1UCV A;  3BQ7 A;  1COK A;  1PK1 A;  4NL9 A;  2B6G A;  2QB0 A;  1JI7 A;  1Z1V A;  2KSO B;  1SV4 A;  1SGG A;  3TAD A;  5JTI A;  3IDW A;  2LMR A;  1V38 A;  2QAR A;  1SV0 A;  3BS7 A;  2D3D A;  2LPE A;  4MHV A;  2KSO A;  2JV3 A;  5J8Y C;  5JRT A;  2KMD A;  1WWU A;  2E8N A;  1LKY A;  1X9X A;  2L5Y A;  1PK3 A;  2E8O A;  2KIV A;  2KE7 A;  2FE9 A;  2F3N A;  1B0X A;  5JU5 A;  1X66 A;  2DKX A;  2EAN A;  2F44 A;  2QB0 B;  1OXJ A;  2Y9U A;  4RQN A;  2EAP A;  2DL0 A;  1LKY B;  1OW5 A;  2GLE A;  2K4P A;  1KW4 A;  3H8M A;  4PZO A;  3K1R B;  5F3X B;  2ES6 A;  5KNI A;  1SV0 C;  2K60 A;  3SEI A;  1PK1 B;  3KKA C;  3HIL A;  3TAC B;  4PZN A;  5J8Y A;  4NJ8 A;  2ESE A;  3BS5 B;  2Y9T A;  1B4F A; 
#chains in the Genus database with same CATH topology
 2BPF A;  5J2A A;  1RPL A;  4DL6 A;  7ICL A;  4PHE A;  3AQF A;  3RB4 A;  4KLJ A;  4CGZ A;  3NS1 A;  4F5R A;  2MA1 A;  4YQW A;  5KFE A;  2EZX A;  4ECS A;  4FS1 A;  4YP3 A;  2MRL A;  3ZD9 A;  2D8C A;  4C4R A;  2CN1 A;  8ICB A;  7ICK A;  1ZD4 A;  4QZG A;  5KFQ A;  3AU2 A;  2PI5 A;  4AYB F;  4PGQ A;  2NRZ A;  4GC7 A;  3TAD A;  4EEY A;  1TAQ A;  5DQI A;  4JB3 A;  3QUQ A;  4QWB A;  3V7L A;  3H4B A;  2KSO A;  1MN8 A;  2VA8 A;  1RXV A;  2I9G A;  2A19 A;  3N4M B;  1L8O A;  2H3V A;  3TI0 A;  4LVS A;  1JAL A;  3V6H A;  4I2E A;  8ICV A;  3HW8 A;  3PSF A;  4J9Q A;  2FE9 A;  2W9A A;  1X66 A;  2GWS A;  3OHB A;  1KL9 A;  1S10 A;  2W54 A;  1X9S A;  3WK8 A;  4XA5 A;  7ICR A;  3H40 A;  3QU4 A;  2BCQ A;  4RQ4 A;  2JEJ A;  1ED1 A;  5AKE A;  2MUT A;  3ZDA A;  3H8S A;  1SV0 C;  4FZM A;  5DB8 A;  2ASJ A;  3SV4 A;  2PFO A;  4FZN A;  2JH7 A;  2G5H B;  4B9M A;  2BQR A;  1ZQI A;  2HOF A;  4DQQ A;  5KT5 A;  1SWV A;  3QZ8 A;  2KTQ A;  4MF8 A;  4OO1 J;  2BQ3 A;  2Y1I A;  4Y2P A;  3RAQ A;  1ZXI A;  2F1J A;  2EZY A;  2E8M A;  3FM9 A;  5J0Q A;  3D2N A;  3CRX A;  4YVZ A;  5BOM A;  4LZD A;  4QIW C;  1RYS A;  1L7P A;  4BDP A;  4C4T A;  1DRG A;  2R18 A;  4DOC A;  4ECY A;  2KIW A;  4ECR A;  4TUS A;  5KG2 A;  3QX7 A;  4F5O A;  1NZB A;  4JK1 A;  1SKS A;  3DDH A;  1ZD5 A;  1JI7 A;  4ICA A;  5KFP A;  2XCP A;  5KFO A;  3NRW A;  2KSO B;  3TFS A;  1SGG A;  3NGD A;  2F8L A;  2KJ9 A;  2BCV A;  3MR5 A;  2B21 A;  5ALZ A;  5AI5 A;  1NK0 A;  5HHI A;  2EQY A;  2I6X A;  4YG2 A;  5J8Y C;  4IRD A;  4PHA A;  4DSE A;  4TUP A;  2ZTE A;  4OJ5 A;  2ASL A;  4F91 B;  1WWU A;  1BGX T;  1SL2 A;  2CPR A;  2W7P A;  3BZK A;  4P4M A;  3EYZ A;  3B9J A;  4ECW A;  8ICU A;  1N60 A;  4QNL A;  3HWT A;  3AM9 A;  2K8B B;  2JEG A;  5HR7 A;  1HJP A;  4KLE A;  1ZQV A;  4DL7 A;  3NVW A;  5J2F A;  5HMM A;  4UB8 U;  3QEA Z;  3KHG A;  5D46 A;  3MBY A;  4KTQ A;  2IOH A;  4CF5 A;  1PK1 B;  4UB1 A;  3T79 A;  3C29 A;  4J9K A;  1KQQ A;  4O9M A;  3MDA A;  3OTQ A;  2DFL A;  8ICT A;  3QNM A;  3AU6 A;  5AM2 A;  5J0P A;  1L3U A;  2V4Q A;  4KMU A;  2H3Z A;  2FLN A;  3A0B U;  2G5I B;  3UXP A;  2QAR B;  5T14 A;  5EWG A;  1KBU A;  4UAS A;  2JR5 A;  4C8K A;  3PX4 A;  5J2D A;  5D49 A;  3N28 A;  3I1Y A;  4QWE A;  2A3V A;  1Z00 B;  3O0F A;  3E2E A;  3L5K A;  4CCH A;  5KT4 A;  4M47 A;  2C22 A;  2HOQ A;  2YMM A;  4EBE A;  5CP2 A;  2EAM A;  4X5V A;  1SKR A;  2F1I A;  1C7Y A;  4XQ8 A;  1KFT A;  5KT2 A;  1SV4 A;  4M9H A;  4ED0 A;  1UT8 A;  4O3Q A;  1S8O A;  2LMR A;  2HW3 A;  4MFF A;  2H3Q A;  9ICQ A;  3E58 A;  5AM1 A;  2G07 A;  2BPC A;  3UMG A;  1DK3 A;  5IIO A;  3M1Y A;  1ZQH A;  1LKY A;  3AN1 A;  2JH1 A;  2HHV A;  4MFA A;  2KFN A;  1HEK A;  1PK3 A;  4DQP A;  9ICU A;  3BZC A;  2QB0 B;  1WG8 A;  2KJ5 A;  4PJ0 U;  2EAP A;  3BQT A;  3H0M B;  3M7D A;  4YFK A;  2PFP A;  3ETL A;  1NKB A;  2HSZ A;  4JV1 A;  1NKE A;  2BCU A;  3D2S A;  4RQ6 A;  5C0Y A;  3PR4 A;  3PNC A;  3N7R C;  4MF2 A;  5F9L A;  4IR1 A;  2KJ8 A;  4P4P A;  2BGW A;  1TKD A;  2YQE A;  3GDX A;  4NY8 A;  5EE9 A;  1ZQZ A;  5AM4 A;  2PFQ A;  3E0F A;  2ZJA A;  3KZX A;  2W55 A;  5BOL A;  3MFH A;  9ICS A;  1S5L U;  4I2D A;  1SB3 C;  4C8N A;  3GV8 B;  4Z6C A;  1ZOL A;  2P66 A;  2LHT A;  3TAQ A;  5ALV A;  4J9P A;  4ED2 A;  2ODG A;  5KFA A;  4C0Z A;  3MC1 A;  1FEZ A;  2KG5 A;  1L3V A;  1X9M A;  4XRH A;  4I29 A;  3IG8 A;  3BQ2 A;  1NK4 A;  5CWR A;  3SV3 A;  2JGA A;  2OHF A;  1D9F A;  2QB0 A;  1KLN A;  4QZE A;  1SWW A;  1Z1V A;  1N56 A;  1Q3V A;  3GZF A;  3VCB A;  5CHG A;  5DB9 A;  2BCS A;  3F2C A;  4QZI A;  4RNN A;  2MU2 A;  3M8R A;  3NVY A;  1RM6 C;  3M8S A;  5AKZ A;  5KG1 A;  2ALZ A;  2HHQ A;  4OCZ A;  1B22 A;  1TE2 A;  3OJU A;  4CF3 A;  5DQH A;  4DS4 A;  5KG4 A;  1T8E A;  3PR5 B;  2GOL A;  4QZF A;  3PW2 A;  4QZ9 A;  3UXO A;  4GC6 A;  4Y2S A;  1KFS A;  4F5N A;  2RDJ A;  2A1J B;  2DPJ A;  5CEH A;  2NRW A;  2JEI A;  3G6Y A;  5L1I A;  1JRO A;  4PZO A;  2KFZ A;  3RB6 A;  3I76 A;  3PVX A;  3F2D A;  2XID A;  5ALE A;  4B9U A;  4OJ6 A;  2J6U A;  2JRZ A;  3ISC A;  5ALW A;  4OD0 A;  3PZP A;  5DDM A;  3CNH A;  5AK5 A;  1GO3 F;  3JPT A;  5AKH A;  3TAC B;  4PZN A;  2HOI A;  5K4L A;  1XC9 A;  4GXI A;  2ISO A;  1TK5 A;  4RUA A;  1MQ2 A;  3PML A;  2XCA A;  4QZB A;  4IRK A;  3TQ1 A;  2E8P A;  1F5S A;  4O0I A;  2FDR A;  1ZYQ A;  4F93 B;  5ALO A;  2VIX A;  4NLK A;  3FDS A;  8ICM A;  5CR0 A;  4GFJ A;  3LVV A;  4DWI A;  3PW4 A;  3WKE A;  2YTU A;  5ALX A;  5DB6 A;  2NRX A;  1ZQT A;  4PL2 A;  4J9O A;  3F53 A;  1KTQ A;  2C2E A;  3PO5 A;  1NK9 A;  4DQI A;  4Y2V A;  1JN3 A;  2FJ6 A;  1RZT A;  5HML A;  4TQR A;  4ECQ A;  1DOQ A;  4YMM A;  4BXO A;  4ACO A;  1M6Y A;  1ZQJ A;  4F4X A;  1S0N A;  2LYA A;  4Q45 A;  5KFX A;  2WF6 A;  1KEJ A;  4FZL A;  5AIB A;  4RQN A;  5KFG A;  5KT7 A;  3KOO A;  5J0R A;  2W3S A;  3RAX A;  4KLU A;  5JUM A;  1LKY B;  4F4Z A;  1H38 A;  1OW5 A;  5ALJ A;  1ZQX A;  4I27 A;  4DF4 A;  4DLE A;  2G0A A;  4ED3 A;  1TAU A;  8ICA A;  3GFK B;  2ZUB A;  3K75 D;  1RQN A;  2ES6 A;  5ALY A;  1B43 A;  3Q8S B;  7ICU A;  2ZTC A;  1KSP A;  1XSP A;  3KKA C;  2PI4 A;  4M04 A;  2ESE A;  4CDG A;  1LVH A;  2AHO B;  3MR2 A;  4F92 B;  3T5H A;  3V7K A;  3MGI A;  4P0Q A;  4UAR A;  3PSI A;  3M6K A;  1WCN A;  2H3F A;  1A0P A;  4RNO A;  4YMO A;  2LM1 A;  5KFR A;  3G6X A;  2PXI A;  7ICM A;  3RBE A;  2AQ0 A;  2KNJ A;  8ICR A;  5J2G A;  4NL9 C;  3TFR A;  3C1Z A;  1NK5 A;  4EX6 A;  1XO0 A;  4DFP A;  4I2J A;  4YR3 A;  4RPX A;  2XC9 A;  2R8G A;  3SAH A;  3SI8 A;  5HP4 A;  4F2R A;  3WK7 A;  4Y2U A;  5AK3 A;  1ZQQ A;  2KD1 A;  4F50 A;  4R65 A;  1V38 A;  3BS7 A;  1SV0 A;  9ICG A;  2RDI A;  2PFN A;  1NJY A;  4YR0 A;  1Z19 A;  4YXM A;  5JRT A;  3RJE A;  4O5C A;  3HRD D;  5J0Y A;  2RLT A;  2DPI A;  3PW5 A;  4F4W A;  7ICS A;  3V7J A;  1MSW D;  1NOM A;  3HT3 A;  3RTV A;  3PO4 A;  4Q8F A;  2UVU A;  4BWJ A;  1PVR A;  9ICL A;  4ECV A;  3H4D A;  2MUT B;  1VJ5 A;  3QYP A;  3JPS A;  2K8C B;  1KRP A;  2UVV A;  3IG5 A;  2R8H A;  5KTQ A;  2KVS A;  4B9N A;  3OJS A;  4J03 A;  4CNQ A;  1PZN A;  2YX8 A;  5ALP A;  3RFA A;  1ZQA A;  3RBD A;  4NJ8 A;  4NXZ A;  9ICT A;  1PVP A;  5L9X A;  4ED1 A;  3WU2 U;  3SD7 A;  1NK8 A;  4Z6D A;  9ICO A;  4EYI B;  1IV8 A;  3F5E A;  2UVW A;  2HBL A;  5IIK A;  1QTM A;  1FFU A;  2KZM A;  1BPB A;  1N48 A;  3S6J A;  3EW9 A;  2W11 A;  1JX4 A;  1NK7 A;  2F8K A;  1TV9 A;  5KAI U;  3GIJ A;  4DQR A;  9ICV A;  2ZIW A;  2F2A B;  1ZQF A;  9ICJ A;  3BS5 A;  4Z6F A;  4EEN A;  1ZQW A;  8ICO A;  4EZ9 A;  1SKW A;  4K4G A;  2JHD A;  5KFL A;  1RYR A;  2B0C A;  2KZZ A;  2ZIX B;  5CB1 A;  4BWM A;  4UB3 A;  3UPQ A;  2PMZ C;  1D8Y A;  3GV7 B;  3RR7 A;  2KV2 A;  3ORY A;  2I5H A;  3TAN A;  3AMZ A;  4KLD A;  5AM3 A;  3SQI A;  3LYS A;  2JZB A;  2F77 X;  1Z4N A;  4A8E A;  1BPX A;  4O5E A;  1BNP A;  2VJ4 A;  4PGY A;  5AM5 A;  3GII A;  3KZI U;  2IHM A;  3GIM A;  9ICN A;  3NRZ A;  5KL1 B;  3J81 j;  1DGS A;  2L5Y A;  5KFS A;  1T3N A;  4B6J A;  1UHU A;  8ICI A;  5DDY A;  3RB0 A;  3Q8M A;  9ICA A;  1MC8 A;  7ICJ A;  3ZDB A;  3G6V A;  1JXL A;  3K1Z A;  3RB3 A;  1N61 A;  7ICV A;  3RF9 A;  1L3T A;  2JEF A;  2NV3 A;  3H8M A;  4JWM A;  1CEZ A;  1XU4 A;  1TK0 A;  5F3X B;  5HNK A;  8ICG A;  5ALQ A;  4PGX A;  7ICI A;  4RQ7 A;  3D6J A;  1KKX A;  1X9W A;  1QCK A;  4J9L A;  4E0D A;  1QQ7 A;  3PX6 A;  3HIL A;  4RT3 A;  2W8K A;  1TFR A;  3M6Z A;  2FPL A;  2ZUD A;  1B4F A;  4IL6 U;  1QSS A;  3WK9 A;  1Q46 A;  1ZQ1 C;  3C2M A;  3H8W A;  1L5U A;  1LV5 A;  4B9T A;  4F71 A;  2KOB A;  1XNS A;  1ZQN A;  3EPI A;  1ZRM A;  1NI3 A;  5KT6 A;  3RJH A;  1WUD A;  2W43 A;  4QZA A;  4Y2J A;  4PL1 A;  4CE6 A;  1L7M A;  2QB1 A;  2MSN A;  3MGH A;  2XGQ A;  1X6I A;  7ICH A;  2BHN A;  4IC9 A;  2WHE A;  4DCC A;  4EEK A;  2B6G A;  4QW9 A;  2AJQ A;  4DFD A;  2FMS A;  2LBO A;  1D8L A;  3L3F X;  1VDV A;  2HHT A;  8ICY A;  1HUO A;  4ECT A;  2D3D A;  3RH4 A;  3B0X A;  2EDU A;  1V97 A;  2JV3 A;  9ICR A;  2KMD A;  5KFD A;  4DQS A;  3UQ2 A;  4KLG A;  3V6J A;  1OUQ A;  1RYU A;  3RH6 A;  4FFD A;  4YN4 A;  4JV0 A;  2MAX A;  3OSP A;  5DG7 A;  2DGZ A;  3MR3 A;  2Y9U A;  4M9G A;  2F1H A;  5DKW A;  2HHU A;  3Q8R B;  1L8L A;  1WCL A;  4Y2Y A;  4OJP A;  3NTU A;  2Y0S C;  2R8I A;  2K60 A;  3NVZ A;  3SEI A;  3U26 A;  3N7S C;  4JWN A;  5AK6 A;  5AKY A;  4QZ8 A;  5DLF A;  2F76 X;  3ZDE A;  5J2H A;  2O6K A;  5J2K A;  2WB1 C;  4YD2 A;  2NRT A;  2KP7 A;  4YR2 A;  3C23 A;  5JU5 A;  1T7P A;  3ED5 A;  4ELU A;  3HKZ C;  4UB4 A;  2GO7 A;  4YMN A;  2WF5 A;  4RQ0 A;  3C5G A;  4ELV A;  5AI4 A;  8ICC A;  2YMP A;  5KAF U;  1SIJ A;  2E3T A;  3UM9 A;  4AP9 A;  2KKP A;  5CA7 A;  3FYH A;  1ZJN A;  4IS7 A;  1SL1 A;  4QWD A;  5DBB A;  1S0O A;  5KFV A;  2ZIU A;  2M0N A;  2OCE A;  1T3Q A;  2KEY A;  2NO4 A;  2ZJ5 A;  5DQG A;  3PV8 A;  1UCV A;  3WKD A;  2WF8 A;  3BQ7 A;  5KFN A;  1DGJ A;  4F4K A;  3N7P D;  8ICE A;  3V6K A;  3TKA A;  2LYB A;  5IIJ A;  5J0O A;  2KN7 A;  3T3F A;  3UQ0 A;  5H2F U;  5KFF A;  4LZG A;  4UAW A;  4KLO A;  3RRG A;  4P0P A;  4DSF A;  1FIQ A;  3KD3 A;  5AIC A;  5CRX A;  2DQN B;  4I2I A;  3Q8L A;  2QLT A;  4RUC A;  1HUZ A;  5G5G A;  4KX3 A;  5AI6 A;  2F3N A;  2EAN A;  1ZJM A;  3C1Y A;  2ZG6 A;  5KFH A;  2BDP A;  2LM4 A;  4K4H A;  5AI8 A;  4YD1 A;  1X6J A;  1XSL A;  2R8K A;  2WF7 A;  3K1R B;  1QSL A;  2IHN A;  4CRX A;  5TIS U;  1CRX A;  4ED6 A;  1KN5 A;  2M9N A;  4IQW A;  8ICX A;  2WF9 A;  4EBC A;  2XY5 A;  1Z1B A;  1BVS A;  3Q8K A;  2DBY A;  2OYY A;  3KKA A;  4IQV A;  2A1J A;  4GLX A;  3KFU F;  1RQL A;  1DXS A;  2DWQ A;  2G08 A;  2HCF A;  1MQ3 A;  3ZD8 A;  3PW7 A;  3GIL A;  4M9N A;  4KLF A;  3A0H U;  3QU5 A;  2RHF A;  5DGB A;  3QXG A;  3OSN A;  2P6U A;  4OJL A;  3WK4 A;  3WKC A;  4DSJ A;  3QEB Z;  5KFC A;  2IOF K;  4Q8E A;  2AU0 A;  5DB7 A;  5AK4 A;  4PH5 A;  2W9B B;  8ICJ A;  5EE3 A;  2ZUC A;  5AKK A;  3MAB A;  4O3P A;  4YXJ A;  4NL9 A;  1BPE A;  4UAU A;  1ZQU A;  5KFB A;  1NZP A;  5JTI A;  3MFI A;  2KZ3 A;  2ASD A;  1F44 A;  4UAT A;  1ARO P;  4MEX A;  1U47 A;  4MFC A;  5AKL A;  1QQ6 A;  3RRH A;  1ZQC A;  2Y0S F;  3HX0 A;  8ICQ A;  2C2D A;  1S0V A;  3RH5 A;  2KIV A;  4B9S A;  1D8B A;  2KE7 A;  3CW2 C;  3KHL A;  3L4P A;  4UBB A;  4O3M A;  8ICW A;  2BZF A;  8ICN A;  7ICP A;  3D2Q A;  2KKV A;  3HKZ F;  4OJO A;  3F2B A;  5ALM A;  4RU9 A;  2IOF A;  4DEZ A;  3QU7 A;  1YZ7 A;  2WTF A;  1IIP A;  1BPZ A;  1ZQM A;  8ICF A;  5L1J A;  8ICZ A;  3ETR A;  2BR0 A;  5J0U A;  3PST A;  2ZIV B;  2K8A A;  4TUQ A;  2EH9 A;  4NV0 A;  3VC8 A;  5KG6 A;  1T94 A;  2VAN A;  5L1K A;  5J8Y A;  4UAY A;  5AKI A;  4YCX A;  5KT3 A;  5FP0 A;  1ZQK A;  1L7O A;  4K4I A;  4GXK A;  3BJY A;  4UB6 U;  1ZQY A;  1ZQR A;  1JMS A;  4I2F A;  4GXJ A;  9ICX A;  1O08 A;  2XO7 A;  2HVI A;  4B9V A;  1TVA A;  4F5P A;  4FBU A;  3HJE A;  4RPZ A;  4QZH A;  4QWC A;  3UMB A;  4NLB A;  4C7Z A;  2CRX A;  4M6W B;  3C21 A;  5EWE A;  1RG6 A;  1D9D A;  4CF4 A;  4U6P A;  1SXE A;  4RQ2 A;  4KIT B;  1ZQS A;  1N63 A;  5L1M A;  5KG5 A;  2XY6 A;  4M9L A;  1Q3U A;  3SAF A;  4Y2Q A;  5IIN A;  1PK1 A;  3UMC A;  4C4S A;  4BX9 C;  1K5O A;  2AGQ A;  2V9W A;  4NWI A;  1L7N A;  1ZQO A;  2VJ5 A;  2LPE A;  9ICP A;  2FMQ A;  2Q0Z X;  2EZZ A;  5EE1 A;  3AL0 B;  2HI0 A;  4R63 A;  1FO4 A;  3EUB 2;  5IIL A;  4FE3 A;  2E8O A;  1DK2 A;  3KTQ A;  4IRC A;  2HBM A;  2HHX A;  3NVV A;  5ALG A;  2LKY A;  3SZ2 A;  4F2S A;  3QUC A;  2BQU A;  5ALL A;  2HMX A;  4ELT A;  1Z4O A;  3CYM A;  4F4Y A;  4PHD A;  2DUY A;  4FBT A;  9ICI A;  1NKC A;  5J0S A;  3AUO A;  3WKA A;  3IRU A;  2C28 A;  1A77 A;  5KFJ A;  1BNO A;  3MR6 A;  2W03 A;  2Q4T A;  4KLT A;  2Y9T A;  2CXY A;  2FPK A;  3OPX A;  4PHP A;  4BUG A;  2DKZ A;  1X40 A;  3PW0 A;  2VA3 A;  2IA6 A;  4RQ1 A;  2EAO A;  5KFZ A;  2FI1 A;  2FMP A;  3ICX A;  1U4B A;  1V85 A;  4RQ5 A;  1PVQ A;  4NLC A;  3NUQ A;  1J2M A;  4F72 A;  4RQM A;  2K89 A;  1XS9 D;  2ZIU B;  5ALR A;  1PUZ A;  2N1R A;  2DF4 B;  1ZQP A;  9ICM A;  1RXW A;  3LDA A;  4O3N A;  2YY6 A;  4NM1 A;  2ISP A;  1X42 A;  1U48 A;  1XWL A;  4C80 A;  3AEV A;  1VLB A;  4Y2X A;  3AQE A;  4IR9 A;  5B5E U;  1S0M A;  2QAR A;  2P35 A;  5GTH U;  4P2H A;  1UA1 A;  2K4E A;  2UVR A;  4MEY A;  4XUS A;  4KN4 A;  3K4G A;  1ZD2 P;  2E8N A;  3DV9 A;  4USA A;  3ZDD A;  3RJF A;  1RDF A;  3I28 A;  3JPQ A;  4UB5 A;  3H0L B;  2ZIW B;  2ZIV A;  4I2B A;  3MGV A;  3EZ5 A;  1JUD A;  4EZ6 A;  2HDO A;  3PX0 A;  3PSP A;  3ZI4 A;  2DL0 A;  2ZXI A;  1N5W A;  4I2H A;  4C7Y A;  1KW4 A;  5J29 A;  3OGU A;  5EE0 A;  1TAM A;  4M6W A;  3FAH A;  4RPY A;  1T4G A;  3SMV A;  1NJX A;  3M9N B;  5KG3 A;  3PMN A;  3C2L A;  1N2X A;  2H3I A;  4KLQ A;  9ICE A;  3SEN A;  2HVH A;  4DOB A;  1S76 D;  3V72 A;  5AKG A;  3B0Y A;  5ALI A;  2QKQ A;  4BXO B;  1A76 A;  1F0M A;  1IXR A;  2YMQ A;  4KN7 A;  4DS5 A;  3M9O B;  4P0P B;  1U49 A;  4JV2 A;  2XGP A;  3GQC A;  4I2A A;  2W9B A;  4PPX A;  4DFK A;  3KHH A;  3M9M B;  2Z7J A;  3QE9 Y;  7ICF A;  2K4I A;  2AXT U;  2G06 A;  3Q8P B;  4DL2 A;  1J97 A;  2W8L A;  4BJQ A;  4O5K A;  7ICT A;  4R66 A;  1O03 A;  3HPO A;  3ISD A;  5J2J A;  2PKE A;  2W7O A;  3T5K A;  4HAI A;  3ISB A;  3C5F A;  1V9P A;  9ICB A;  1JXE A;  4O3S A;  1A6S A;  4M9J A;  4ECX A;  1NNL A;  1X9X A;  1JRP A;  9ICK A;  9ICH A;  4Q44 A;  4DO9 A;  1QLN A;  3BDP A;  5J0T A;  5ALK A;  1TK8 A;  4KLH A;  1UPH A;  3IP4 B;  2DKX A;  2WAQ C;  5KFW A;  5CJ7 A;  4B9L A;  3RJK A;  5DBA A;  1SZP A;  7ICN A;  3JPR A;  2V4R A;  4UBC A;  4Z6E A;  3N97 B;  3LWM A;  4TUR A;  4QZD A;  4ECU A;  5EOZ A;  4KLI A;  3IM1 A;  3EWA A;  3ONN A;  8ICP A;  5KG7 A;  7ICG A;  2RRD A;  4R8U B;  3TAP A;  2WFA A;  1JIH A;  2NYV A;  5J0X A;  2G09 A;  1HIW A;  3QZ7 A;  1S77 D;  3Q8Q B;  5ALS A;  4DL3 A;  1K1Q A;  4ZOH C;  1L6N A;  3H0R B;  2J6T A;  3GV5 B;  9ICW A;  3ALR A;  5KG0 A;  5A0L A;  2RQ5 A;  3WK5 A;  3OHA A;  3DEE A;  2ZIX A;  5AI9 A;  2WAQ F;  4Q43 A;  4EEL A;  1S9F A;  4DSL A;  4ECZ A;  2BPG A;  2HBK A;  4HYK A;  3RJG A;  2Y1J A;  3QU2 A;  5F9N A;  4DSK A;  2HHW A;  4US8 A;  2GH1 A;  4DL5 A;  5J2E A;  2E1E A;  4GIB A;  2AH5 A;  4KMO B;  5KFI A;  2HBJ A;  2YML A;  3JPO A;  3UXN A;  2IMW P;  5KFT A;  4EYH B;  1ZRN A;  1QH9 A;  5DBC A;  2HHS A;  1UA0 A;  1N62 A;  4MHV A;  2WB1 F;  1Z3E B;  2NRV A;  5E79 U;  4JMU A;  3SYZ A;  5HR6 A;  5IIM A;  2JXJ A;  2FLL A;  1MA7 A;  2KIC A;  2W9C A;  2OH2 A;  4J9N A;  3LVW A;  9ICF A;  5DG8 A;  2OWO A;  5AKJ A;  1ZQB A;  1ZQD A;  2P6R A;  2XIC A;  3QUB A;  4UAZ A;  4DOA A;  3CP8 A;  1CI4 A;  5J0W A;  5DGA A;  2GLE A;  5EWF A;  2NO5 A;  4RQ3 A;  2XI9 A;  4NM2 A;  5L1L A;  4DSI A;  5ALN A;  1EXN A;  2IBK A;  4QZC A;  3SAG A;  5AIA A;  2W9C B;  5ALT A;  4NLZ A;  2E1F A;  4F3O A;  4IQT A;  1K1S A;  3BS5 B;  4UQG A;  1BPY A;  4BGD A;  2OXO A;  1FFV A;  2E5S A;  1SZH A;  1LB2 B;  1CUK A;  2K4H A;  2BCR A;  5KFU A;  4RZR A;  2KVC A;  4DLG A;  3C2K A;  4WJ3 B;  4R64 A;  4U7C A;  5ALH A;  1URJ A;  3FC4 A;  5D4B A;  3KHR A;  4EBD A;  4I2C A;  2FLP A;  7ICQ A;  4FS2 A;  1ZD3 A;  4JUZ A;  3HP6 A;  2AGO A;  1BPD A;  1U9L A;  4G3I A;  5AI0 A;  1YZ6 A;  2J6S A;  3SR6 A;  1NJZ A;  1C20 A;  2FPM A;  2AQ4 A;  5B66 U;  2D6F C;  5ALF A;  5J2I A;  1COK A;  3IHQ B;  1U45 A;  1COO A;  2PMZ F;  3RJJ A;  1Z00 A;  1Q8K A;  2OM6 A;  4ED8 A;  5AKX A;  4G9B A;  1Y88 A;  4KX5 A;  3WKB A;  2RP5 A;  1ZQL A;  2KHQ A;  3JPN A;  4NLN A;  2YB4 A;  1ZET A;  4M0A A;  4J9R A;  1J2N A;  1SL0 A;  9ICC A;  4R8U A;  3KBB A;  2JMG A;  4LJX A;  2LI6 A;  2F44 A;  4P4O A;  1OXJ A;  1UT5 A;  8ICH A;  4FO6 A;  4O3R A;  2VA2 A;  1IG6 A;  2K4P A;  5BPC A;  5AM0 A;  5C5J A;  3IN5 A;  1X2I A;  5KNI A;  2YN4 A;  4RNM A;  4IQU A;  2XVT A;  2BKE A;  5KFK A;  2KHV A;  4ZH4 A;  3BQ1 A;  3GIK A;  2ZTD A;  2AGP A;  1XSN A;  7ICE A;  4UB2 A;  2W3R A;  1WWV A;  3TAD C;  1YT3 A;  4US9 A;  5AHX A;  7ICO A;  4KLM A;  4J9M A;  1UQV A;  4DFM A;  5III A;  4UW9 A;  5KFM A;  3NAS A;  3T5L A;  1P7D A;  5DLG A;  2VKQ A;  8ICL A;  5ALD A;  4DFJ A;  3BQ0 A;  2ATL A;  3QUT A;  3T5J A;  1SXD A;  3GU3 A;  3F5A A;  3RJI A;  5J2C A;  5J2B A;  4F8R A;  2OEH A;  4I28 A;  1L3S A;  4J9S A;  3C28 A;  3JPP A;  5DG9 A;  5TZV A;  1N5X A;  2W9M A;  4F5Q A;  4C8L A;  3H8J A;  3ZDC A;  4QJF B;  4TQS A;  1ECW A;  1NJW A;  4NLG A;  4UAV A;  3IDW A;  2ZJ8 A;  4EX7 A;  4C8O A;  8ICK A;  4O3O A;  2KK0 A;  4QIW F;  2BDU A;  4M2Y A;  1WYG A;  3QU9 A;  5KFY A;  8ICS A;  4DF8 A;  2W04 A;  1ZQG A;  3EPG A;  3WK6 A;  3H7I A;  2JZB B;  1IM4 A;  3LWL A;  4Y2R A;  4KLL A;  3TAR A;  3THV A;  1QSY A;  4QWA A;  4C8M A;  5G5H A;  1B0X A;  4RQ8 A;  5GTI U;  1ZQE A;  4P0Q B;  4ED7 A;  1S97 A;  2ZXH A;  5HHH A;  2YB1 A;  4RT2 A;  4DL4 A;  2I1Q A;  4I2G A;  3LK9 A;  5KL8 B;  3MDC A;  3RR8 A;  3PY8 A;  2A1A A;  2C2R A;  2LYH A;  4AYB C;  4QW8 A;  1KFD A;  1NK6 A;  5ALU A;  1KDH A;  1XO1 A;  3R9K A;  4Y2T A;  4KLS A;  2R8J A;  1QQ5 A;  1AQ6 A;  2XY7 A;  2H5X A;  3IV6 A; 
#chains in the Genus database with same CATH homology
 3SEN A;  1WWV A;  3KKA A;  3TAD C;  2QAR B;  1DXS A;  2E8P A;  1UQV A;  2E8M A;  2DKZ A;  2QKQ A;  1X40 A;  1F0M A;  2EAO A;  4IS7 A;  1SXD A;  1RG6 A;  1V85 A;  2KG5 A;  2F8K A;  4NL9 C;  2QB1 A;  1SXE A;  2D8C A;  4RQM A;  3BS5 A;  5L1M A;  2EAM A;  2YTU A;  1UCV A;  3BQ7 A;  1COK A;  1PK1 A;  4NL9 A;  2B6G A;  2QB0 A;  1JI7 A;  1Z1V A;  2KSO B;  1SV4 A;  1SGG A;  3TAD A;  5JTI A;  3IDW A;  2LMR A;  1V38 A;  2QAR A;  1SV0 A;  3BS7 A;  2D3D A;  2LPE A;  4MHV A;  2KSO A;  2JV3 A;  5J8Y C;  5JRT A;  2KMD A;  1WWU A;  2E8N A;  1LKY A;  1X9X A;  2L5Y A;  1PK3 A;  2E8O A;  2KIV A;  2KE7 A;  2FE9 A;  2F3N A;  1B0X A;  5JU5 A;  1X66 A;  2DKX A;  2EAN A;  2F44 A;  2QB0 B;  1OXJ A;  2Y9U A;  4RQN A;  2EAP A;  2DL0 A;  1LKY B;  1OW5 A;  2GLE A;  2K4P A;  1KW4 A;  3H8M A;  4PZO A;  3K1R B;  5F3X B;  2ES6 A;  5KNI A;  1SV0 C;  2K60 A;  3SEI A;  1PK1 B;  3KKA C;  3HIL A;  3TAC B;  4PZN A;  5J8Y A;  4NJ8 A;  2ESE A;  3BS5 B;  2Y9T A;  1B4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...