2KG5A

Nmr solution structure of arap3-sam
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
HMAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILRLLQTGTEEGSLDPKSDSAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Sam domain of the lipid phosphatase Ship2 adopts a common model to interact with Arap3-Sam and EphA2-Sam.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Arf-GAP, Rho-GAP domain, ANK repeat and PH domain-containing
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2kg5A01
1SV0A 4PZNA 1PK1A 5J8YA 2KE7A 1LKYA 1B0XA 4IS7A 2K4PA 3BS5A 2EAPA 3TADC 5JRTA 1X40A 2QARA 2KIVA 5JTIA 2F8KA 2DL0A 3KKAA 2GLEA 2KSOB 2E8NA 5JU5A 3H8MA 2DKZA 1PK1B 4NL9C 1Z1VA 1B4FA 2YTUA 1DXSA 1LKYB 2LPEA 5J8YC 2E8MA 2KG5A 2QKQA 4NJ8A 2EANA 1KW4A 2F3NA 1JI7A 1UQVA 4PZOA 2EAOA 3TACB 2EAMA 1X9XA 1SXEA 3BQ7A 3SEIA 2D3DA 3IDWA 1WWVA 1OW5A 2E8OA 1SV4A 3SENA 2QARB 1SGGA 2B6GA 2FE9A 4RQNA 2D8CA 4NL9A 5KNIA 5L1MA 3HILA 5F3XB 3BS7A 4MHVA 1PK3A 2KMDA 2DKXA 2ES6A 2Y9TA 1OXJA 2E8PA 2F44A 3TADA 3BS5B 1X66A 1WWUA 4RQMA 2ESEA 1UCVA 1F0MA 2JV3A 1SV0C 3KKAC 2QB0B 1SXDA 2Y9UA 2LMRA 2QB0A 1V38A 1COKA 3K1RB 2L5YA 2KSOA 2K60A 2QB1A 1V85A 1RG6A
chains in the Genus database with same CATH superfamily
4EX6A 5J8YA 5DB8A 3O0FA 1ZQFA 5AM0A 3NVVA 3MR2A 1BPBA 1L7NA 1NK8A 2DPJA 1C20A 4DLEA 3QU9A 3OHAA 5ALNA 4I2IA 3CNHA 4M6WB 7ICGA 1WCNA 4XUSA 2W03A 2HHSA 2YN4A 5JU5A 4FS2A 3OPXA 2WF7A 4F93B 4IQVA 4NM1A 9ICHA 3NVWA 2MUTB 2YTUA 1ZQKA 4B9VA 5KFOA 4ED2A 4DS4A 2MU2A 4ECUA 4QZEA 4I2JA 4KTQA 1ZETA 4GC6A 1K5OA 3NTUA 1NJXA 1A76A 1T94A 2BPGA 2FMPA 4ED1A 4BJQA 3SQIA 5KAFU 2QARB 5AK6A 1S9FA 4KLGA 3LWMA 1BPYA 2B0CA 2LYBA 3K75D 2ASLA 1HEKA 1WCLA 3JPNA 9ICMA 2PI5A 1BPXA 5B5EU 5CRXA 1AQ6A 2Q0ZX 3V7JA 4F2SA 8ICCA 2KNJA 1CEZA 2FLNA 3FAHA 2WB1C 4NLCA 1FEZA 1CI4A 2BDUA 8ICYA 4QZIA 4ECXA 5CJ7A 8ICKA 2ZIVB 4R8UB 1F44A 2MA1A 5J2BA 2OHFA 5AICA 3KD3A 3RH4A 2CRXA 4Y2RA 3HKZF 5KT6A 1IM4A 1FIQA 3RB0A 1P7DA 4NY8A 2BCQA 1KRPA 1ZQUA 5KFBA 2K60A 4Q8FA 8ICRA 1XSLA 1SV0A 4DL2A 4UARA 1ED1A 2XGQA 2KE7A 1LKYA 1JXLA 4I29A 4I2HA 2B21A 4C7ZA 3DEEA 4FFDA 4J9MA 3ISBA 4QNLA 4ED7A 4YR3A 1JROA 5AK4A 5JTIA 2A1AA 2H3IA 4I2EA 3N28A 2K4IA 5HMLA 5EE1A 4OJ6A 4DS5A 2YQEA 2JHDA 5L1JA 4CGZA 4ED8A 1PVQA 4NXZA 2LPEA 1SWVA 4NLBA 2ZIUB 2C2DA 4DF4A 1N61A 5DB7A 3RB3A 2NRXA 3RAXA 1Q3UA 1L8LA 3EW9A 3B9JA 4PHPA 1JX4A 7ICNA 3QU2A 4GC7A 4RT2A 2KJ9A 3GU3A 4PPXA 1WWVA 3MR6A 4QIWF 1OW5A 5KFMA 4MFFA 4NWIA 2KZZA 4C8KA 4DQPA 1DGJA 2R8GA 3DV9A 4DSLA 9ICVA 4DFPA 4LZDA 5IIOA 4ECVA 3MBYA 4OJPA 5B66U 2YMQA 1FFUA 4PHAA 1Z19A 1TAUA 1NI3A 2JEGA 2VKQA 4EBEA 3PX0A 3WKDA 1UHUA 4RUCA 5KT4A 3KFUF 8ICWA 3I28A 1ZD4A 2HOIA 3RBDA 2E1EA 2XI9A 8ICAA 4CCHA 3SI8A 5HR7A 4YR0A 3N7SC 1J97A 4FO6A 3Q8MA 3M9NB 3V7KA 2JEJA 5A0LA 3E2EA 3TQ1A 3PW5A 3L3FX 4OJOA 1U48A 5DG9A 4PZNA 5DB9A 1CUKA 1PK1A 4GFJA 4O5CA 4Q43A 5K4LA 2IOFK 3U26A 1Q3VA 2VA2A 3GZFA 4YG2A 5AI5A 4ED6A 3NS1A 2RHFA 2KIVA 4ICAA 1ZD5A 1NJZA 3CW2C 5EOZA 1RPLA 5AKJA 3T79A 2WF9A 9ICOA 8ICPA 3F5EA 2WFAA 3B0XA 5KL1B 5KG6A 1S0VA 2IMWP 3SMVA 4BGDA 5AKLA 4EZ9A 2UVRA 5EWFA 3THVA 3H0MB 3BZCA 4Y2VA 2F3NA 1ZQOA 2NRWA 3WKBA 2XC9A 3IV6A 4FE3A 3QUBA 3ISCA 2DF4B 4ZH4A 5IIIA 5HNKA 3PNCA 3V6JA 2AH5A 2RDIA 2PMZC 3L4PA 5GTHU 1U47A 2V9WA 1RQLA 5KFUA 3PSIA 1KEJA 5KFIA 4DO9A 3MGVA 3NRZA 4GXJA 1DRGA 4ZOHC 4NL9A 3LWLA 3SR6A 1XS9D 2Y1JA 2BHNA 4KLEA 5DG8A 5J2IA 5ALDA 2LYAA 3HWTA 1RXVA 4Y2PA 4FZMA 8ICGA 5CEHA 2ISPA 4JMUA 1YZ6A 4O0IA 1L3UA 3H0RB 3BQ2A 3CRXA 2AJQA 2C28A 4ELTA 2QB1A 1V85A 5ALJA 3OSNA 1WG8A 2WF6A 3SAFA 2WF8A 3QX7A 1ZQRA 4IS7A 3ZDDA 1JN3A 1MQ3A 2DBYA 4F3OA 4DL4A 1NK7A 2CXYA 5DLFA 2XY6A 3ZDBA 2MAXA 4RPXA 4RPYA 2OXOA 2YB4A 7ICMA 4C4TA 3RJJA 4Z6FA 1HJPA 8ICBA 4OCZA 3V6KA 2MUTA 4BWJA 1N63A 2EANA 2GOLA 3RFAA 1ZD2P 3PO5A 1KKXA 4FZNA 1KFDA 9ICFA 1PVPA 7ICKA 2FDRA 3VCBA 3BQ7A 3PW0A 4UBBA 1NKBA 1FFVA 2E8OA 4KLLA 4DSKA 3HPOA 3GIIA 4EENA 2H5XA 2LKYA 5KFDA 4P0PB 5KNIA 4I2CA 1HUOA 4YXMA 1NOMA 4K4HA 4P4MA 2DKXA 2NO5A 2QLTA 2W9MA 4RQ4A 1X66A 1DGSA 1L3VA 3N7RC 1Q46A 4KLOA 7ICTA 9ICEA 1JUDA 5ALSA 3WK6A 2W8KA 2LMRA 1V38A 1COOA 2FPMA 2ISOA 8ICHA 5CA7A 2K8BB 1KFSA 3T5LA 2AGOA 4EYIB 4JB3A 5KFRA 2CPRA 5DDMA 4QZHA 1H38A 5ALWA 2ASJA 4PGQA 4ECZA 4R64A 3MDAA 4ED3A 2F2AB 3SV3A 1L5UA 4M9LA 4C4RA 2YMMA 4RQ2A 2GWSA 3C5GA 4HYKA 2EZZA 2JZBA 2LI6A 3QU5A 1UA1A 1ZD3A 3M6ZA 9ICJA 2NRZA 3H8MA 4C7YA 2G5HB 2LM1A 2Y0SC 2ZIXA 4K4IA 1B4FA 1T3NA 9ICCA 4UB4A 4BXOA 4NM2A 2H3QA 2NRVA 3PR4A 4F5OA 3WK8A 5KFVA 2H3ZA 1TK5A 2AU0A 4O9MA 3RBEA 3VC8A 5GTIU 3RB4A 3JPQA 8ICUA 2ZUDA 3PMNA 2F1JA 4QZAA 2WHEA 4I2DA 4UB1A 4RQ8A 2A3VA 4J03A 1UA0A 4UB6U 1TV9A 3C5FA 2JXJA 1L7PA 3WK4A 2KIWA 2KZ3A 4DSJA 4JWNA 5KL8B 5ALRA 5KFCA 2ZG6A 2JEIA 4O3SA 4WJ3B 2HBLA 5J0TA 3ZDAA 1ZJNA 5KAIU 3AUOA 5CHGA 4X5VA 3QXGA 2NRTA 2KP7A 3MABA 9ICSA 4DF8A 3KHRA 3IM1A 3GV5B 3SAHA 2DGZA 1NK5A 1BNOA 5AHXA 1TK0A 1BPZA 2LYHA 4UW9A 2HBMA 3SD7A 3M9OB 4BUGA 2W3RA 9ICPA 4IL6U 3BQ0A 1SWWA 4YN4A 2KN7A 5FP0A 1X40A 1M6YA 4CDGA 2FMSA 3UMBA 4EELA 1PVRA 2K8AA 2DL0A 5IINA 1KN5A 5ALIA 4QZ8A 4UAZA 3FYHA 2DFLA 5KFQA 3M8RA 1PUZA 1J2NA 5KT5A 1X9MA 3OJUA 2YY6A 2F1IA 1KFTA 5DDYA 4IQTA 1ZQDA 5G5GA 1ZYQA 5EWEA 1X6IA 3MGIA 3Q8QB 4YQWA 4C4SA 5AKIA 4C8OA 3IHQB 4DEZA 4Y2QA 4DL7A 3ALRA 5BOMA 5DQIA 4B9SA 2K8CB 1BNPA 3OGUA 5J0QA 7ICFA 1O03A 4UATA 2VANA 1SGGA 2B6GA 5ALTA 3MDCA 3FM9A 5TZVA 3IG5A 1D9FA 2D8CA 4ECWA 1EXNA 3BQ1A 4YFKA 4UB2A 5G5HA 3N97B 2DWQA 1Z4OA 5F3XB 2YMLA 2LM4A 1BVSA 3ICXA 3PW2A 1PK3A 5ALLA 4DOAA 1ZQZA 4YXJA 3CP8A 3GV8B 1JIHA 4DQSA 3PSPA 3RRGA 2ZTCA 2BPFA 2PFPA 2R8KA 3C29A 3QYPA 4B9MA 4FBTA 4US8A 2F8LA 3AQFA 1GO3F 4QJFB 2ZUCA 2QB0A 5EWGA 3GILA 3AMZA 1ZRNA 5DBCA 1AROP 4P0QA 2W9BB 1RYSA 2UVWA 1S0NA 3Q8KA 1Z00A 2NO4A 1KTQA 2NYVA 2R18A 2KV2A 8ICLA 1DOQA 2YX8A 4PH5A 2DQNB 2H3FA 2AHOB 3G6YA 2G09A 1NKCA 3C2MA 3RF9A 4NLKA 4TUPA 2UVVA 4Y2XA 3AEVA 4F5NA 3B0YA 3LVVA 1TKDA 5KG5A 2FMQA 5AK3A 7ICEA 4B9UA 5KFWA 3ZI4A 4TUQA 2ZXHA 4RNOA 4MF2A 4F4KA 1ZQNA 4O5EA 8ICZA 1DXSA 5ALEA 4PJ0U 2EH9A 2W55A 3MFHA 4E0DA 5DBBA 4F4XA 4ELUA 3ETLA 3WK5A 3KHHA 3H8WA 2M9NA 4KLMA 4OO1J 4BWMA 3IDWA 3S6JA 4YVZA 4UBCA 2W7OA 5IIJA 2FI1A 2EQYA 3QU7A 1F5SA 7ICHA 3G6VA 2J6SA 3RJKA 4TQSA 3PY8A 4RQ5A 4JV0A 5HP4A 4ECTA 5AI8A 5ALKA 1TFRA 5ALPA 5H2FU 5ALVA 3BS7A 5D49A 5DQHA 1IXRA 3PSTA 4CNQA 4QWAA 1ZQSA 8ICNA 2Y1IA 1RYUA 2P6UA 1Z3EB 2W11A 5DLGA 1L3TA 2DUYA 1WWUA 2E5SA 1NJWA 1SL1A 2W3SA 1QTMA 1IV8A 2KJ8A 2HSZA 4PHDA 4KLQA 2Y9UA 9ICLA 4EBCA 2W7PA 3QUQA 2BDPA 4OJLA 2FLLA 4DL5A 2HHVA 5EE9A 2RLTA 2WF5A 1X6JA 2KVSA 4RPZA 5D4BA 8ICSA 4Z6EA 4YR2A 2PFQA 3NGDA 2BQRA 1QLNA 2G07A 8ICXA 1BPEA 1ZQTA 2GLEA 1KSPA 3OTQA 1BPDA 2HHQA 2ZIWB 1YT3A 5J0XA 4J9LA 4F5QA 5AKHA 9ICTA 2KJ5A 4FZLA 1S0MA 2HHTA 5AM2A 5CR0A 2OEHA 7ICUA 5J0OA 4BX9C 4F2RA 4IRKA 1SKWA 1SKSA 4J9RA 2KK0A 5J2JA 4M2YA 4I28A 4M04A 5J2CA 4IR9A 1ZQHA 5J29A 4KLUA 2G0AA 3MFIA 1NK4A 1URJA 2HHXA 4MEYA 4KLTA 3NASA 5KT7A 4DQQA 4IRDA 3EZ5A 5T14A 1NZBA 1S0OA 1QQ6A 3NVZA 3GQCA 4O3RA 3ZDCA 2ES6A 1ZQJA 2Y9TA 2KHVA 2XVTA 5AM3A 3PW4A 2XY7A 3BS5B 4R66A 4RQMA 2JR5A 4P0QB 3ETRA 2KKPA 2V4QA 1NJYA 1SV0C 4QZBA 1B43A 3PMLA 3H4DA 4O3QA 1XWLA 3C1ZA 1L7MA 4U7CA 2F76X 1B0XA 4UB5A 3TARA 4F71A 4DOCA 1X9SA 5BPCA 1KL9A 5J0RA 3TADC 3GIKA 3G6XA 3PSFA 4GXIA 2KD1A 1D8BA 2GH1A 2BGWA 4MEXA 1C7YA 2HBKA 2XY5A 3Q8PB 4TUSA 4O5KA 3GIMA 1TVAA 3RR7A 1LKYB 5IILA 4F4ZA 3AU6A 2KHQA 5ALOA 1S97A 4NJ8A 5J2KA 1RM6C 4DLGA 2P66A 3BZKA 1A0PA 4RZRA 4TURA 2KZMA 5AI0A 4P0PA 3MR5A 2HVIA 1B22A 5AI4A 3NUQA 2I5HA 4KMUA 1XO0A 2N1RA 1YZ7A 1J2MA 2BCUA 4YCXA 2GO7A 4I27A 2W54A 4RT3A 1Z1BA 3EWAA 2P6RA 4C8NA 2K4EA 1L6NA 1ZJMA 4DFDA 4M47A 2KMDA 1TK8A 3GV7B 4F4WA 2A19A 2WAQC 3ISDA 4LZGA 3TANA 2HBJA 3H8JA 4QWCA 4YMOA 3TKAA 4UAWA 3H4BA 9ICBA 5DQGA 2BKEA 2QB0B 4CF5A 2G08A 3JPPA 1LV5A 3E0FA 4ECRA 1COKA 2JMGA 4US9A 2BCRA 1RG6A 5E79U 2HI0A 4NLZA 1QSYA 1ZQIA 3IRUA 2K4PA 5AIBA 4B9NA 3HRDD 3M1YA 1N5WA 3IP4B 4ECYA 2P35A 2PKEA 2IBKA 1QH9A 3D2QA 4F4YA 4KLSA 3KKAA 3QE9Y 1SZHA 1WYGA 2KSOB 2ZJAA 3E58A 4QZFA 1JMSA 4F5PA 5AKEA 1PK1B 4NL9C 3WU2U 4XQ8A 5J8YC 3UMGA 3M8SA 1N2XA 3UXPA 2C2RA 5KG3A 3ZD8A 2HDOA 1SB3C 5DB6A 1N48A 3AN1A 3PW7A 3F2CA 1TAQA 3TACB 4RNNA 3SEIA 3SYZA 4F72A 3AM9A 4UAVA 2OWOA 1MC8A 3SENA 2RP5A 2OH2A 5AM1A 4B9LA 1HUZA 3LDAA 4QIWC 2RQ5A 3Q8LA 4G9BA 3K1ZA 3M9MB 2LBOA 3SV4A 4JV2A 4EX7A 2J6UA 3KZIU 1O08A 5KFTA 4DL3A 1NNLA 5ALGA 3NVYA 1S77D 2W9CA 2AQ4A 3KKAC 2PFOA 4M9NA 4O3OA 4EYHB 2HVHA 4DSFA 3T5HA 2R8HA 2IOFA 8ICJA 5KG2A 2LHTA 3PX6A 4QZ9A 1MN8A 4EBDA 5L9XA 1KLNA 2KICA 2ODGA 9ICRA 3JPTA 5BOLA 4KX5A 3PR5B 5JRTA 4MFCA 4USAA 2ALZA 1TE2A 5C5JA 1A77A 5J0PA 3HKZC 7ICJA 5KFJA 4UAUA 3UQ2A 1XSNA 2ZTEA 2W9BA 5KFZA 1Z1VA 4M9JA 3BJYA 2IOHA 2QKQA 2ZXIA 2I1QA 4I2BA 2EAOA 2NV3A 3HT3A 1LVHA 1ZQAA 2W9AA 4LJXA 3PZPA 4UB3A 3MR3A 5HHHA 3OHBA 2FE9A 2BZFA 5AKGA 4GXKA 1ZQBA 4HAIA 2BCSA 2PI4A 8ICQA 4MHVA 5J2GA 4I2FA 5KFXA 4KLJA 1ZQMA 4I2AA 2E8PA 1JALA 2F44A 5KFLA 4M6WA 4Y2TA 3C2KA 1XU4A 3FC4A 4C0ZA 5ALUA 1ZQ1C 4TQRA 4UB8U 2XCPA 2XCAA 1K1QA 1SXDA 1ZQVA 4Y2SA 5F9NA 1X9WA 2DPIA 1OUQA 1ZQCA 3K1RB 3LVWA 4JWMA 4Z6CA 3KTQA 3ZDEA 3EPIA 3I1YA 8ICEA 3LK9A 1CRXA 3PV8A 5HR6A 4CE6A 5IIKA 2QARA 5KFHA 1D9DA 2F77X 2HMXA 9ICIA 3WKCA 2HW3A 4KITB 3V72A 2RRDA 4DSEA 4J9PA 1Y88A 1MSWD 4A8EA 4U6PA 1QCKA 4DQIA 5AM4A 1ZQYA 4Y2JA 4QWDA 2DKZA 3T5KA 4QW8A 2VJ5A 2V4RA 2E8MA 4KN4A 2JEFA 4QW9A 1N56A 3ORYA 1UT5A 4M9GA 2R8IA 3MGHA 1JI7A 4DWIA 4CF4A 2XO7A 3IG8A 2E1FA 3WKAA 4ECQA 4KLHA 2EAMA 2JZBB 1ZXIA 2W8LA 2OM6A 5J2HA 2PMZF 3JPRA 2PFNA 2G06A 4PGYA 4PL2A 4K4GA 3RJFA 4KLDA 1UT8A 9ICAA 1K1SA 7ICPA 2A1JB 3GFKB 5KTQA 4O3MA 3GIJA 3QNMA 1FO4A 4M0AA 3FDSA 3RJEA 4JV1A 4NV0A 1SZPA 3C28A 3F2DA 1QSSA 2JGAA 1S76D 3WKEA 4J9QA 2M0NA 2FPLA 5HHIA 5KT3A 7ICQA 2L5YA 2BR0A 1L8OA 2MSNA 4JK1A 8ICMA 4ELVA 4XA5A 1X2IA 3BS5A 2BQUA 3RH6A 1QSLA 2XICA 1ZQPA 4KLFA 5DGAA 3QUCA 9ICWA 3D2NA 3RH5A 4DFJA 4EEYA 2ZUBA 4GIBA 1IIPA 4Y2YA 1TAMA 1ZQXA 5J2AA 3TAPA 5CWRA 3T3FA 5ALYA 5ALHA 4IQWA 5KG0A 5L1IA 2EDUA 4IQUA 1KW4A 1N60A 5DG7A 5DKWA 3V7LA 5J2EA 5KFKA 3JPSA 3ZD9A 4O3PA 5AKKA 5KFYA 5ALQA 4Q8EA 3BDPA 2ZIUA 2W43A 4YMMA 2ZIVA 2MRLA 4B6JA 2HCFA 8ICTA 3H7IA 4QZCA 2JH1A 3AL0B 4QZGA 4O3NA 5ALXA 5EE0A 2FJ6A 5CP2A 4RU9A 5KFFA 4GLXA 4J9SA 4ECSA 3F5AA 5KFSA 5AI6A 3JPOA 4Q44A 2F1HA 4YMNA 3C21A 4J9OA 4ED0A 8ICOA 2ESEA 1UCVA 2EZYA 2IA6A 4LVSA 3DDHA 3TAQA 4F91B 4AP9A 4EZ6A 3QZ7A 3KHLA 3RR8A 8ICFA 3SAGA 4PL1A 3AQEA 4UAYA 1V97A 1D8LA 4KLIA 3KHGA 1XO1A 2AGPA 5C0YA 1X42A 1LB2B 1U49A 2ZIXB 1NK9A 1HIWA 4R8UA 1JRPA 3RAQA 1L7OA 4BXOB 2W04A 5D46A 2EAPA 2R8JA 2CN1A 3LYSA 3T5JA 4BDPA 4J9NA 5AKXA 3R9KA 4ACOA 5J0SA 4RQ1A 5KFAA 9ICNA 1NZPA 3H0LB 3EPGA 5IIMA 4F92B 1VLBA 1Z00B 2WAQF 2IHMA 3KZXA 2KG5A 4M9HA 4P4PA 1KDHA 4Q45A 4J9KA 3K4GA 1UQVA 4PZOA 3F2BA 1T8EA 1NK0A 1BGXT 4NLGA 3HP6A 2D3DA 4C8LA 2PXIA 2Z7JA 2AXTU 8ICVA 3D2SA 3PO4A 2KKVA 1ZQEA 5J0YA 4CRXA 2A1JA 1SL0A 1ECWA 4RQ3A 2W9CB 1QQ7A 5ALMA 4PHEA 3HILA 1DK2A 3TFRA 5KFGA 2ZJ5A 3HW8A 3QU4A 2G5IB 1A6SA 2FPKA 1OXJA 2ATLA 5DBAA 2BPCA 3C1YA 2ZTDA 5CB1A 1QQ5A 3TI0A 4IR1A 2RDJA 2Y0SF 3TFSA 4KX3A 3A0HU 2BCVA 3ED5A 4RQ6A 4DL6A 1N5XA 4DFKA 4RNMA 1IG6A 3UXNA 3UM9A 5AKYA 5J2FA 5TISU 1RDFA 1ZQLA 2AGQA 5KG7A 4R65A 9ICXA 4XRHA 3UQ0A 5AK5A 3L5KA 2OCEA 4PGXA 3H40A 3H8SA 2HHUA 2VIXA 2EZXA 7ICRA 2XGPA 3QUTA 2Q4TA 4P4OA 1MQ2A 1ZQGA 4KN7A 2JRZA 2HOFA 2D6FC 2JH7A 3CYMA 1VJ5A 4C8MA 2J6TA 4QWEA 1T3QA 2WB1F 3NRWA 2ASDA 4G3IA 4DCCA 1RYRA 3WK7A 3RJGA 2KVCA 5AKZA 3Q8RB 1MA7A 1L3SA 5AIAA 1ZQQA 3M6KA 2VJ4A 1SXEA 1RQNA 2VA8A 4IRCA 1V9PA 1SV4A 2ZIWA 4UQGA 2K4HA 5KT2A 1SIJA 4AYBC 1RXWA 3J81j 9ICGA 2I6XA 3MC1A 9ICUA 7ICLA 4MFAA 1U4BA 1UPHA 4DSIA 5AI9A 5J0UA 4QZDA 2ZJ8A 3OJSA 5JUMA 5J0WA 3V6HA 3PX4A 4C80A 3F53A 2E3TA 3TADA 4R63A 4CF3A 5J2DA 1U45A 4OD0A 5KFEA 1SL2A 1F0MA 1SKRA 1KQQA 3QEAZ 4I2GA 4DFMA 2KTQA 4QWBA 3A0BU 7ICSA 1T7PA 2C22A 3UPQA 4F8RA 4P2HA 3RRHA 4YD1A 1N62A 2VA3A 4KMOB 3D6JA 4DQRA 4F5RA 3OSPA 4RQ0A 1KBUA 1PZNA 1ZRMA 1RZTA 2FLPA 4B9TA 5F9LA 3WK9A 4NLNA 3KOOA 1NKEA 1Z4NA 5EE3A 3UMCA 4EEKA 2F8KA 5AM5A 4FS1A 4FBUA 1JXEA 3IN5A 2E8NA 2C2EA 2KFZA 1XC9A 5ALZA 1T4GA 1XNSA 3I76A 3QEBZ 3SZ2A 4IC9A 2HHWA 9ICKA 3EUB2 5KFNA 2O6KA 1NK6A 3Q8SB 1S5LU 5HMMA 2OYYA 3GDXA 2BQ3A 7ICOA 2WTFA 5L1KA 2I9GA 7ICIA 1X9XA 4Y2UA 2H3VA 3RJHA 3RTVA 2HOQA 1D8YA 2KOBA 1Q8KA 4OJ5A 3BQTA 4JUZA 3HX0A 5KG4A 2XIDA 9ICQA 3RB6A 4AYBF 3PVXA 3AU2A 2YMPA 1WUDA 4DOBA 4RQNA 4Z6DA 3RJIA 1U9LA 1XSPA 1ZQWA 5DGBA 2UVUA 7ICVA 5L1MA 2AQ0A 4RUAA 3EYZA 5KFPA 4MF8A 4F50A 1S8OA 3QZ8A 3HJEA 4RQ7A 8ICIA 3M7DA 1S10A 5KG1A 3ONNA 1DK3A 3KBBA 2KEYA 4YD2A 5ALFA 2JV3A 3N4MB 2K89A 3N7PD 4YP3A 5L1LA 2IHNA 1VDVA 3C23A 2KFNA 3C2LA 3UXOA 4UASA 2YB1A 2KSOA 1ZOLA
chains in the Genus database with same CATH topology
1SV0A 4PZNA 1PK1A 5J8YA 2KE7A 1LKYA 1B0XA 4IS7A 2K4PA 3BS5A 2EAPA 3TADC 5JRTA 1X40A 2QARA 2KIVA 5JTIA 2F8KA 2DL0A 3KKAA 2GLEA 2KSOB 2E8NA 5JU5A 3H8MA 2DKZA 1PK1B 4NL9C 1Z1VA 1B4FA 2YTUA 1DXSA 1LKYB 2LPEA 5J8YC 2E8MA 2KG5A 2QKQA 4NJ8A 2EANA 1KW4A 2F3NA 1JI7A 1UQVA 4PZOA 2EAOA 3TACB 2EAMA 1X9XA 1SXEA 3BQ7A 3SEIA 2D3DA 3IDWA 1WWVA 1OW5A 2E8OA 1SV4A 3SENA 2QARB 1SGGA 2B6GA 2FE9A 4RQNA 2D8CA 4NL9A 5KNIA 5L1MA 3HILA 5F3XB 3BS7A 4MHVA 1PK3A 2KMDA 2DKXA 2ES6A 2Y9TA 1OXJA 2E8PA 2F44A 3TADA 3BS5B 1X66A 1WWUA 4RQMA 2ESEA 1UCVA 1F0MA 2JV3A 1SV0C 3KKAC 2QB0B 1SXDA 2Y9UA 2LMRA 2QB0A 1V38A 1COKA 3K1RB 2L5YA 2KSOA 2K60A 2QB1A 1V85A 1RG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 A;  4PZN A;  1PK1 A;  5J8Y A;  2KE7 A;  1LKY A;  1B0X A;  4IS7 A;  2K4P A;  3BS5 A;  2EAP A;  3TAD C;  5JRT A;  1X40 A;  2QAR A;  2KIV A;  5JTI A;  2F8K A;  2DL0 A;  3KKA A;  2GLE A;  2KSO B;  2E8N A;  5JU5 A;  3H8M A;  2DKZ A;  1PK1 B;  4NL9 C;  1Z1V A;  1B4F A;  2YTU A;  1DXS A;  1LKY B;  2LPE A;  5J8Y C;  2E8M A;  2KG5 A;  2QKQ A;  4NJ8 A;  2EAN A;  1KW4 A;  2F3N A;  1JI7 A;  1UQV A;  4PZO A;  2EAO A;  3TAC B;  2EAM A;  1X9X A;  1SXE A;  3BQ7 A;  3SEI A;  2D3D A;  3IDW A;  1WWV A;  1OW5 A;  2E8O A;  1SV4 A;  3SEN A;  2QAR B;  1SGG A;  2B6G A;  2FE9 A;  4RQN A;  2D8C A;  4NL9 A;  5KNI A;  5L1M A;  3HIL A;  5F3X B;  3BS7 A;  4MHV A;  1PK3 A;  2KMD A;  2DKX A;  2ES6 A;  2Y9T A;  1OXJ A;  2E8P A;  2F44 A;  3TAD A;  3BS5 B;  1X66 A;  1WWU A;  4RQM A;  2ESE A;  1UCV A;  1F0M A;  2JV3 A;  1SV0 C;  3KKA C;  2QB0 B;  1SXD A;  2Y9U A;  2LMR A;  2QB0 A;  1V38 A;  1COK A;  3K1R B;  2L5Y A;  2KSO A;  2K60 A;  2QB1 A;  1V85 A;  1RG6 A; 
#chains in the Genus database with same CATH topology
 4EX6 A;  5J8Y A;  5DB8 A;  3O0F A;  1ZQF A;  5AM0 A;  3NVV A;  3MR2 A;  1BPB A;  1L7N A;  1NK8 A;  2DPJ A;  1C20 A;  4DLE A;  3QU9 A;  3OHA A;  5ALN A;  4I2I A;  3CNH A;  4M6W B;  7ICG A;  1WCN A;  4XUS A;  2W03 A;  2HHS A;  2YN4 A;  5JU5 A;  4FS2 A;  3OPX A;  2WF7 A;  4F93 B;  4IQV A;  4NM1 A;  9ICH A;  3NVW A;  2MUT B;  2YTU A;  1ZQK A;  4B9V A;  5KFO A;  4ED2 A;  4DS4 A;  2MU2 A;  4ECU A;  4QZE A;  4I2J A;  4KTQ A;  1ZET A;  4GC6 A;  1K5O A;  3NTU A;  1NJX A;  1A76 A;  1T94 A;  2BPG A;  2FMP A;  4ED1 A;  4BJQ A;  3SQI A;  5KAF U;  2QAR B;  5AK6 A;  1S9F A;  4KLG A;  3LWM A;  1BPY A;  2B0C A;  2LYB A;  3K75 D;  2ASL A;  1HEK A;  1WCL A;  3JPN A;  9ICM A;  2PI5 A;  1BPX A;  5B5E U;  5CRX A;  1AQ6 A;  2Q0Z X;  3V7J A;  4F2S A;  8ICC A;  2KNJ A;  1CEZ A;  2FLN A;  3FAH A;  2WB1 C;  4NLC A;  1FEZ A;  1CI4 A;  2BDU A;  8ICY A;  4QZI A;  4ECX A;  5CJ7 A;  8ICK A;  2ZIV B;  4R8U B;  1F44 A;  2MA1 A;  5J2B A;  2OHF A;  5AIC A;  3KD3 A;  3RH4 A;  2CRX A;  4Y2R A;  3HKZ F;  5KT6 A;  1IM4 A;  1FIQ A;  3RB0 A;  1P7D A;  4NY8 A;  2BCQ A;  1KRP A;  1ZQU A;  5KFB A;  2K60 A;  4Q8F A;  8ICR A;  1XSL A;  1SV0 A;  4DL2 A;  4UAR A;  1ED1 A;  2XGQ A;  2KE7 A;  1LKY A;  1JXL A;  4I29 A;  4I2H A;  2B21 A;  4C7Z A;  3DEE A;  4FFD A;  4J9M A;  3ISB A;  4QNL A;  4ED7 A;  4YR3 A;  1JRO A;  5AK4 A;  5JTI A;  2A1A A;  2H3I A;  4I2E A;  3N28 A;  2K4I A;  5HML A;  5EE1 A;  4OJ6 A;  4DS5 A;  2YQE A;  2JHD A;  5L1J A;  4CGZ A;  4ED8 A;  1PVQ A;  4NXZ A;  2LPE A;  1SWV A;  4NLB A;  2ZIU B;  2C2D A;  4DF4 A;  1N61 A;  5DB7 A;  3RB3 A;  2NRX A;  3RAX A;  1Q3U A;  1L8L A;  3EW9 A;  3B9J A;  4PHP A;  1JX4 A;  7ICN A;  3QU2 A;  4GC7 A;  4RT2 A;  2KJ9 A;  3GU3 A;  4PPX A;  1WWV A;  3MR6 A;  4QIW F;  1OW5 A;  5KFM A;  4MFF A;  4NWI A;  2KZZ A;  4C8K A;  4DQP A;  1DGJ A;  2R8G A;  3DV9 A;  4DSL A;  9ICV A;  4DFP A;  4LZD A;  5IIO A;  4ECV A;  3MBY A;  4OJP A;  5B66 U;  2YMQ A;  1FFU A;  4PHA A;  1Z19 A;  1TAU A;  1NI3 A;  2JEG A;  2VKQ A;  4EBE A;  3PX0 A;  3WKD A;  1UHU A;  4RUC A;  5KT4 A;  3KFU F;  8ICW A;  3I28 A;  1ZD4 A;  2HOI A;  3RBD A;  2E1E A;  2XI9 A;  8ICA A;  4CCH A;  3SI8 A;  5HR7 A;  4YR0 A;  3N7S C;  1J97 A;  4FO6 A;  3Q8M A;  3M9N B;  3V7K A;  2JEJ A;  5A0L A;  3E2E A;  3TQ1 A;  3PW5 A;  3L3F X;  4OJO A;  1U48 A;  5DG9 A;  4PZN A;  5DB9 A;  1CUK A;  1PK1 A;  4GFJ A;  4O5C A;  4Q43 A;  5K4L A;  2IOF K;  3U26 A;  1Q3V A;  2VA2 A;  3GZF A;  4YG2 A;  5AI5 A;  4ED6 A;  3NS1 A;  2RHF A;  2KIV A;  4ICA A;  1ZD5 A;  1NJZ A;  3CW2 C;  5EOZ A;  1RPL A;  5AKJ A;  3T79 A;  2WF9 A;  9ICO A;  8ICP A;  3F5E A;  2WFA A;  3B0X A;  5KL1 B;  5KG6 A;  1S0V A;  2IMW P;  3SMV A;  4BGD A;  5AKL A;  4EZ9 A;  2UVR A;  5EWF A;  3THV A;  3H0M B;  3BZC A;  4Y2V A;  2F3N A;  1ZQO A;  2NRW A;  3WKB A;  2XC9 A;  3IV6 A;  4FE3 A;  3QUB A;  3ISC A;  2DF4 B;  4ZH4 A;  5III A;  5HNK A;  3PNC A;  3V6J A;  2AH5 A;  2RDI A;  2PMZ C;  3L4P A;  5GTH U;  1U47 A;  2V9W A;  1RQL A;  5KFU A;  3PSI A;  1KEJ A;  5KFI A;  4DO9 A;  3MGV A;  3NRZ A;  4GXJ A;  1DRG A;  4ZOH C;  4NL9 A;  3LWL A;  3SR6 A;  1XS9 D;  2Y1J A;  2BHN A;  4KLE A;  5DG8 A;  5J2I A;  5ALD A;  2LYA A;  3HWT A;  1RXV A;  4Y2P A;  4FZM A;  8ICG A;  5CEH A;  2ISP A;  4JMU A;  1YZ6 A;  4O0I A;  1L3U A;  3H0R B;  3BQ2 A;  3CRX A;  2AJQ A;  2C28 A;  4ELT A;  2QB1 A;  1V85 A;  5ALJ A;  3OSN A;  1WG8 A;  2WF6 A;  3SAF A;  2WF8 A;  3QX7 A;  1ZQR A;  4IS7 A;  3ZDD A;  1JN3 A;  1MQ3 A;  2DBY A;  4F3O A;  4DL4 A;  1NK7 A;  2CXY A;  5DLF A;  2XY6 A;  3ZDB A;  2MAX A;  4RPX A;  4RPY A;  2OXO A;  2YB4 A;  7ICM A;  4C4T A;  3RJJ A;  4Z6F A;  1HJP A;  8ICB A;  4OCZ A;  3V6K A;  2MUT A;  4BWJ A;  1N63 A;  2EAN A;  2GOL A;  3RFA A;  1ZD2 P;  3PO5 A;  1KKX A;  4FZN A;  1KFD A;  9ICF A;  1PVP A;  7ICK A;  2FDR A;  3VCB A;  3BQ7 A;  3PW0 A;  4UBB A;  1NKB A;  1FFV A;  2E8O A;  4KLL A;  4DSK A;  3HPO A;  3GII A;  4EEN A;  2H5X A;  2LKY A;  5KFD A;  4P0P B;  5KNI A;  4I2C A;  1HUO A;  4YXM A;  1NOM A;  4K4H A;  4P4M A;  2DKX A;  2NO5 A;  2QLT A;  2W9M A;  4RQ4 A;  1X66 A;  1DGS A;  1L3V A;  3N7R C;  1Q46 A;  4KLO A;  7ICT A;  9ICE A;  1JUD A;  5ALS A;  3WK6 A;  2W8K A;  2LMR A;  1V38 A;  1COO A;  2FPM A;  2ISO A;  8ICH A;  5CA7 A;  2K8B B;  1KFS A;  3T5L A;  2AGO A;  4EYI B;  4JB3 A;  5KFR A;  2CPR A;  5DDM A;  4QZH A;  1H38 A;  5ALW A;  2ASJ A;  4PGQ A;  4ECZ A;  4R64 A;  3MDA A;  4ED3 A;  2F2A B;  3SV3 A;  1L5U A;  4M9L A;  4C4R A;  2YMM A;  4RQ2 A;  2GWS A;  3C5G A;  4HYK A;  2EZZ A;  2JZB A;  2LI6 A;  3QU5 A;  1UA1 A;  1ZD3 A;  3M6Z A;  9ICJ A;  2NRZ A;  3H8M A;  4C7Y A;  2G5H B;  2LM1 A;  2Y0S C;  2ZIX A;  4K4I A;  1B4F A;  1T3N A;  9ICC A;  4UB4 A;  4BXO A;  4NM2 A;  2H3Q A;  2NRV A;  3PR4 A;  4F5O A;  3WK8 A;  5KFV A;  2H3Z A;  1TK5 A;  2AU0 A;  4O9M A;  3RBE A;  3VC8 A;  5GTI U;  3RB4 A;  3JPQ A;  8ICU A;  2ZUD A;  3PMN A;  2F1J A;  4QZA A;  2WHE A;  4I2D A;  4UB1 A;  4RQ8 A;  2A3V A;  4J03 A;  1UA0 A;  4UB6 U;  1TV9 A;  3C5F A;  2JXJ A;  1L7P A;  3WK4 A;  2KIW A;  2KZ3 A;  4DSJ A;  4JWN A;  5KL8 B;  5ALR A;  5KFC A;  2ZG6 A;  2JEI A;  4O3S A;  4WJ3 B;  2HBL A;  5J0T A;  3ZDA A;  1ZJN A;  5KAI U;  3AUO A;  5CHG A;  4X5V A;  3QXG A;  2NRT A;  2KP7 A;  3MAB A;  9ICS A;  4DF8 A;  3KHR A;  3IM1 A;  3GV5 B;  3SAH A;  2DGZ A;  1NK5 A;  1BNO A;  5AHX A;  1TK0 A;  1BPZ A;  2LYH A;  4UW9 A;  2HBM A;  3SD7 A;  3M9O B;  4BUG A;  2W3R A;  9ICP A;  4IL6 U;  3BQ0 A;  1SWW A;  4YN4 A;  2KN7 A;  5FP0 A;  1X40 A;  1M6Y A;  4CDG A;  2FMS A;  3UMB A;  4EEL A;  1PVR A;  2K8A A;  2DL0 A;  5IIN A;  1KN5 A;  5ALI A;  4QZ8 A;  4UAZ A;  3FYH A;  2DFL A;  5KFQ A;  3M8R A;  1PUZ A;  1J2N A;  5KT5 A;  1X9M A;  3OJU A;  2YY6 A;  2F1I A;  1KFT A;  5DDY A;  4IQT A;  1ZQD A;  5G5G A;  1ZYQ A;  5EWE A;  1X6I A;  3MGI A;  3Q8Q B;  4YQW A;  4C4S A;  5AKI A;  4C8O A;  3IHQ B;  4DEZ A;  4Y2Q A;  4DL7 A;  3ALR A;  5BOM A;  5DQI A;  4B9S A;  2K8C B;  1BNP A;  3OGU A;  5J0Q A;  7ICF A;  1O03 A;  4UAT A;  2VAN A;  1SGG A;  2B6G A;  5ALT A;  3MDC A;  3FM9 A;  5TZV A;  3IG5 A;  1D9F A;  2D8C A;  4ECW A;  1EXN A;  3BQ1 A;  4YFK A;  4UB2 A;  5G5H A;  3N97 B;  2DWQ A;  1Z4O A;  5F3X B;  2YML A;  2LM4 A;  1BVS A;  3ICX A;  3PW2 A;  1PK3 A;  5ALL A;  4DOA A;  1ZQZ A;  4YXJ A;  3CP8 A;  3GV8 B;  1JIH A;  4DQS A;  3PSP A;  3RRG A;  2ZTC A;  2BPF A;  2PFP A;  2R8K A;  3C29 A;  3QYP A;  4B9M A;  4FBT A;  4US8 A;  2F8L A;  3AQF A;  1GO3 F;  4QJF B;  2ZUC A;  2QB0 A;  5EWG A;  3GIL A;  3AMZ A;  1ZRN A;  5DBC A;  1ARO P;  4P0Q A;  2W9B B;  1RYS A;  2UVW A;  1S0N A;  3Q8K A;  1Z00 A;  2NO4 A;  1KTQ A;  2NYV A;  2R18 A;  2KV2 A;  8ICL A;  1DOQ A;  2YX8 A;  4PH5 A;  2DQN B;  2H3F A;  2AHO B;  3G6Y A;  2G09 A;  1NKC A;  3C2M A;  3RF9 A;  4NLK A;  4TUP A;  2UVV A;  4Y2X A;  3AEV A;  4F5N A;  3B0Y A;  3LVV A;  1TKD A;  5KG5 A;  2FMQ A;  5AK3 A;  7ICE A;  4B9U A;  5KFW A;  3ZI4 A;  4TUQ A;  2ZXH A;  4RNO A;  4MF2 A;  4F4K A;  1ZQN A;  4O5E A;  8ICZ A;  1DXS A;  5ALE A;  4PJ0 U;  2EH9 A;  2W55 A;  3MFH A;  4E0D A;  5DBB A;  4F4X A;  4ELU A;  3ETL A;  3WK5 A;  3KHH A;  3H8W A;  2M9N A;  4KLM A;  4OO1 J;  4BWM A;  3IDW A;  3S6J A;  4YVZ A;  4UBC A;  2W7O A;  5IIJ A;  2FI1 A;  2EQY A;  3QU7 A;  1F5S A;  7ICH A;  3G6V A;  2J6S A;  3RJK A;  4TQS A;  3PY8 A;  4RQ5 A;  4JV0 A;  5HP4 A;  4ECT A;  5AI8 A;  5ALK A;  1TFR A;  5ALP A;  5H2F U;  5ALV A;  3BS7 A;  5D49 A;  5DQH A;  1IXR A;  3PST A;  4CNQ A;  4QWA A;  1ZQS A;  8ICN A;  2Y1I A;  1RYU A;  2P6U A;  1Z3E B;  2W11 A;  5DLG A;  1L3T A;  2DUY A;  1WWU A;  2E5S A;  1NJW A;  1SL1 A;  2W3S A;  1QTM A;  1IV8 A;  2KJ8 A;  2HSZ A;  4PHD A;  4KLQ A;  2Y9U A;  9ICL A;  4EBC A;  2W7P A;  3QUQ A;  2BDP A;  4OJL A;  2FLL A;  4DL5 A;  2HHV A;  5EE9 A;  2RLT A;  2WF5 A;  1X6J A;  2KVS A;  4RPZ A;  5D4B A;  8ICS A;  4Z6E A;  4YR2 A;  2PFQ A;  3NGD A;  2BQR A;  1QLN A;  2G07 A;  8ICX A;  1BPE A;  1ZQT A;  2GLE A;  1KSP A;  3OTQ A;  1BPD A;  2HHQ A;  2ZIW B;  1YT3 A;  5J0X A;  4J9L A;  4F5Q A;  5AKH A;  9ICT A;  2KJ5 A;  4FZL A;  1S0M A;  2HHT A;  5AM2 A;  5CR0 A;  2OEH A;  7ICU A;  5J0O A;  4BX9 C;  4F2R A;  4IRK A;  1SKW A;  1SKS A;  4J9R A;  2KK0 A;  5J2J A;  4M2Y A;  4I28 A;  4M04 A;  5J2C A;  4IR9 A;  1ZQH A;  5J29 A;  4KLU A;  2G0A A;  3MFI A;  1NK4 A;  1URJ A;  2HHX A;  4MEY A;  4KLT A;  3NAS A;  5KT7 A;  4DQQ A;  4IRD A;  3EZ5 A;  5T14 A;  1NZB A;  1S0O A;  1QQ6 A;  3NVZ A;  3GQC A;  4O3R A;  3ZDC A;  2ES6 A;  1ZQJ A;  2Y9T A;  2KHV A;  2XVT A;  5AM3 A;  3PW4 A;  2XY7 A;  3BS5 B;  4R66 A;  4RQM A;  2JR5 A;  4P0Q B;  3ETR A;  2KKP A;  2V4Q A;  1NJY A;  1SV0 C;  4QZB A;  1B43 A;  3PML A;  3H4D A;  4O3Q A;  1XWL A;  3C1Z A;  1L7M A;  4U7C A;  2F76 X;  1B0X A;  4UB5 A;  3TAR A;  4F71 A;  4DOC A;  1X9S A;  5BPC A;  1KL9 A;  5J0R A;  3TAD C;  3GIK A;  3G6X A;  3PSF A;  4GXI A;  2KD1 A;  1D8B A;  2GH1 A;  2BGW A;  4MEX A;  1C7Y A;  2HBK A;  2XY5 A;  3Q8P B;  4TUS A;  4O5K A;  3GIM A;  1TVA A;  3RR7 A;  1LKY B;  5IIL A;  4F4Z A;  3AU6 A;  2KHQ A;  5ALO A;  1S97 A;  4NJ8 A;  5J2K A;  1RM6 C;  4DLG A;  2P66 A;  3BZK A;  1A0P A;  4RZR A;  4TUR A;  2KZM A;  5AI0 A;  4P0P A;  3MR5 A;  2HVI A;  1B22 A;  5AI4 A;  3NUQ A;  2I5H A;  4KMU A;  1XO0 A;  2N1R A;  1YZ7 A;  1J2M A;  2BCU A;  4YCX A;  2GO7 A;  4I27 A;  2W54 A;  4RT3 A;  1Z1B A;  3EWA A;  2P6R A;  4C8N A;  2K4E A;  1L6N A;  1ZJM A;  4DFD A;  4M47 A;  2KMD A;  1TK8 A;  3GV7 B;  4F4W A;  2A19 A;  2WAQ C;  3ISD A;  4LZG A;  3TAN A;  2HBJ A;  3H8J A;  4QWC A;  4YMO A;  3TKA A;  4UAW A;  3H4B A;  9ICB A;  5DQG A;  2BKE A;  2QB0 B;  4CF5 A;  2G08 A;  3JPP A;  1LV5 A;  3E0F A;  4ECR A;  1COK A;  2JMG A;  4US9 A;  2BCR A;  1RG6 A;  5E79 U;  2HI0 A;  4NLZ A;  1QSY A;  1ZQI A;  3IRU A;  2K4P A;  5AIB A;  4B9N A;  3HRD D;  3M1Y A;  1N5W A;  3IP4 B;  4ECY A;  2P35 A;  2PKE A;  2IBK A;  1QH9 A;  3D2Q A;  4F4Y A;  4KLS A;  3KKA A;  3QE9 Y;  1SZH A;  1WYG A;  2KSO B;  2ZJA A;  3E58 A;  4QZF A;  1JMS A;  4F5P A;  5AKE A;  1PK1 B;  4NL9 C;  3WU2 U;  4XQ8 A;  5J8Y C;  3UMG A;  3M8S A;  1N2X A;  3UXP A;  2C2R A;  5KG3 A;  3ZD8 A;  2HDO A;  1SB3 C;  5DB6 A;  1N48 A;  3AN1 A;  3PW7 A;  3F2C A;  1TAQ A;  3TAC B;  4RNN A;  3SEI A;  3SYZ A;  4F72 A;  3AM9 A;  4UAV A;  2OWO A;  1MC8 A;  3SEN A;  2RP5 A;  2OH2 A;  5AM1 A;  4B9L A;  1HUZ A;  3LDA A;  4QIW C;  2RQ5 A;  3Q8L A;  4G9B A;  3K1Z A;  3M9M B;  2LBO A;  3SV4 A;  4JV2 A;  4EX7 A;  2J6U A;  3KZI U;  1O08 A;  5KFT A;  4DL3 A;  1NNL A;  5ALG A;  3NVY A;  1S77 D;  2W9C A;  2AQ4 A;  3KKA C;  2PFO A;  4M9N A;  4O3O A;  4EYH B;  2HVH A;  4DSF A;  3T5H A;  2R8H A;  2IOF A;  8ICJ A;  5KG2 A;  2LHT A;  3PX6 A;  4QZ9 A;  1MN8 A;  4EBD A;  5L9X A;  1KLN A;  2KIC A;  2ODG A;  9ICR A;  3JPT A;  5BOL A;  4KX5 A;  3PR5 B;  5JRT A;  4MFC A;  4USA A;  2ALZ A;  1TE2 A;  5C5J A;  1A77 A;  5J0P A;  3HKZ C;  7ICJ A;  5KFJ A;  4UAU A;  3UQ2 A;  1XSN A;  2ZTE A;  2W9B A;  5KFZ A;  1Z1V A;  4M9J A;  3BJY A;  2IOH A;  2QKQ A;  2ZXI A;  2I1Q A;  4I2B A;  2EAO A;  2NV3 A;  3HT3 A;  1LVH A;  1ZQA A;  2W9A A;  4LJX A;  3PZP A;  4UB3 A;  3MR3 A;  5HHH A;  3OHB A;  2FE9 A;  2BZF A;  5AKG A;  4GXK A;  1ZQB A;  4HAI A;  2BCS A;  2PI4 A;  8ICQ A;  4MHV A;  5J2G A;  4I2F A;  5KFX A;  4KLJ A;  1ZQM A;  4I2A A;  2E8P A;  1JAL A;  2F44 A;  5KFL A;  4M6W A;  4Y2T A;  3C2K A;  1XU4 A;  3FC4 A;  4C0Z A;  5ALU A;  1ZQ1 C;  4TQR A;  4UB8 U;  2XCP A;  2XCA A;  1K1Q A;  1SXD A;  1ZQV A;  4Y2S A;  5F9N A;  1X9W A;  2DPI A;  1OUQ A;  1ZQC A;  3K1R B;  3LVW A;  4JWM A;  4Z6C A;  3KTQ A;  3ZDE A;  3EPI A;  3I1Y A;  8ICE A;  3LK9 A;  1CRX A;  3PV8 A;  5HR6 A;  4CE6 A;  5IIK A;  2QAR A;  5KFH A;  1D9D A;  2F77 X;  2HMX A;  9ICI A;  3WKC A;  2HW3 A;  4KIT B;  3V72 A;  2RRD A;  4DSE A;  4J9P A;  1Y88 A;  1MSW D;  4A8E A;  4U6P A;  1QCK A;  4DQI A;  5AM4 A;  1ZQY A;  4Y2J A;  4QWD A;  2DKZ A;  3T5K A;  4QW8 A;  2VJ5 A;  2V4R A;  2E8M A;  4KN4 A;  2JEF A;  4QW9 A;  1N56 A;  3ORY A;  1UT5 A;  4M9G A;  2R8I A;  3MGH A;  1JI7 A;  4DWI A;  4CF4 A;  2XO7 A;  3IG8 A;  2E1F A;  3WKA A;  4ECQ A;  4KLH A;  2EAM A;  2JZB B;  1ZXI A;  2W8L A;  2OM6 A;  5J2H A;  2PMZ F;  3JPR A;  2PFN A;  2G06 A;  4PGY A;  4PL2 A;  4K4G A;  3RJF A;  4KLD A;  1UT8 A;  9ICA A;  1K1S A;  7ICP A;  2A1J B;  3GFK B;  5KTQ A;  4O3M A;  3GIJ A;  3QNM A;  1FO4 A;  4M0A A;  3FDS A;  3RJE A;  4JV1 A;  4NV0 A;  1SZP A;  3C28 A;  3F2D A;  1QSS A;  2JGA A;  1S76 D;  3WKE A;  4J9Q A;  2M0N A;  2FPL A;  5HHI A;  5KT3 A;  7ICQ A;  2L5Y A;  2BR0 A;  1L8O A;  2MSN A;  4JK1 A;  8ICM A;  4ELV A;  4XA5 A;  1X2I A;  3BS5 A;  2BQU A;  3RH6 A;  1QSL A;  2XIC A;  1ZQP A;  4KLF A;  5DGA A;  3QUC A;  9ICW A;  3D2N A;  3RH5 A;  4DFJ A;  4EEY A;  2ZUB A;  4GIB A;  1IIP A;  4Y2Y A;  1TAM A;  1ZQX A;  5J2A A;  3TAP A;  5CWR A;  3T3F A;  5ALY A;  5ALH A;  4IQW A;  5KG0 A;  5L1I A;  2EDU A;  4IQU A;  1KW4 A;  1N60 A;  5DG7 A;  5DKW A;  3V7L A;  5J2E A;  5KFK A;  3JPS A;  3ZD9 A;  4O3P A;  5AKK A;  5KFY A;  5ALQ A;  4Q8E A;  3BDP A;  2ZIU A;  2W43 A;  4YMM A;  2ZIV A;  2MRL A;  4B6J A;  2HCF A;  8ICT A;  3H7I A;  4QZC A;  2JH1 A;  3AL0 B;  4QZG A;  4O3N A;  5ALX A;  5EE0 A;  2FJ6 A;  5CP2 A;  4RU9 A;  5KFF A;  4GLX A;  4J9S A;  4ECS A;  3F5A A;  5KFS A;  5AI6 A;  3JPO A;  4Q44 A;  2F1H A;  4YMN A;  3C21 A;  4J9O A;  4ED0 A;  8ICO A;  2ESE A;  1UCV A;  2EZY A;  2IA6 A;  4LVS A;  3DDH A;  3TAQ A;  4F91 B;  4AP9 A;  4EZ6 A;  3QZ7 A;  3KHL A;  3RR8 A;  8ICF A;  3SAG A;  4PL1 A;  3AQE A;  4UAY A;  1V97 A;  1D8L A;  4KLI A;  3KHG A;  1XO1 A;  2AGP A;  5C0Y A;  1X42 A;  1LB2 B;  1U49 A;  2ZIX B;  1NK9 A;  1HIW A;  4R8U A;  1JRP A;  3RAQ A;  1L7O A;  4BXO B;  2W04 A;  5D46 A;  2EAP A;  2R8J A;  2CN1 A;  3LYS A;  3T5J A;  4BDP A;  4J9N A;  5AKX A;  3R9K A;  4ACO A;  5J0S A;  4RQ1 A;  5KFA A;  9ICN A;  1NZP A;  3H0L B;  3EPG A;  5IIM A;  4F92 B;  1VLB A;  1Z00 B;  2WAQ F;  2IHM A;  3KZX A;  2KG5 A;  4M9H A;  4P4P A;  1KDH A;  4Q45 A;  4J9K A;  3K4G A;  1UQV A;  4PZO A;  3F2B A;  1T8E A;  1NK0 A;  1BGX T;  4NLG A;  3HP6 A;  2D3D A;  4C8L A;  2PXI A;  2Z7J A;  2AXT U;  8ICV A;  3D2S A;  3PO4 A;  2KKV A;  1ZQE A;  5J0Y A;  4CRX A;  2A1J A;  1SL0 A;  1ECW A;  4RQ3 A;  2W9C B;  1QQ7 A;  5ALM A;  4PHE A;  3HIL A;  1DK2 A;  3TFR A;  5KFG A;  2ZJ5 A;  3HW8 A;  3QU4 A;  2G5I B;  1A6S A;  2FPK A;  1OXJ A;  2ATL A;  5DBA A;  2BPC A;  3C1Y A;  2ZTD A;  5CB1 A;  1QQ5 A;  3TI0 A;  4IR1 A;  2RDJ A;  2Y0S F;  3TFS A;  4KX3 A;  3A0H U;  2BCV A;  3ED5 A;  4RQ6 A;  4DL6 A;  1N5X A;  4DFK A;  4RNM A;  1IG6 A;  3UXN A;  3UM9 A;  5AKY A;  5J2F A;  5TIS U;  1RDF A;  1ZQL A;  2AGQ A;  5KG7 A;  4R65 A;  9ICX A;  4XRH A;  3UQ0 A;  5AK5 A;  3L5K A;  2OCE A;  4PGX A;  3H40 A;  3H8S A;  2HHU A;  2VIX A;  2EZX A;  7ICR A;  2XGP A;  3QUT A;  2Q4T A;  4P4O A;  1MQ2 A;  1ZQG A;  4KN7 A;  2JRZ A;  2HOF A;  2D6F C;  2JH7 A;  3CYM A;  1VJ5 A;  4C8M A;  2J6T A;  4QWE A;  1T3Q A;  2WB1 F;  3NRW A;  2ASD A;  4G3I A;  4DCC A;  1RYR A;  3WK7 A;  3RJG A;  2KVC A;  5AKZ A;  3Q8R B;  1MA7 A;  1L3S A;  5AIA A;  1ZQQ A;  3M6K A;  2VJ4 A;  1SXE A;  1RQN A;  2VA8 A;  4IRC A;  1V9P A;  1SV4 A;  2ZIW A;  4UQG A;  2K4H A;  5KT2 A;  1SIJ A;  4AYB C;  1RXW A;  3J81 j;  9ICG A;  2I6X A;  3MC1 A;  9ICU A;  7ICL A;  4MFA A;  1U4B A;  1UPH A;  4DSI A;  5AI9 A;  5J0U A;  4QZD A;  2ZJ8 A;  3OJS A;  5JUM A;  5J0W A;  3V6H A;  3PX4 A;  4C80 A;  3F53 A;  2E3T A;  3TAD A;  4R63 A;  4CF3 A;  5J2D A;  1U45 A;  4OD0 A;  5KFE A;  1SL2 A;  1F0M A;  1SKR A;  1KQQ A;  3QEA Z;  4I2G A;  4DFM A;  2KTQ A;  4QWB A;  3A0B U;  7ICS A;  1T7P A;  2C22 A;  3UPQ A;  4F8R A;  4P2H A;  3RRH A;  4YD1 A;  1N62 A;  2VA3 A;  4KMO B;  3D6J A;  4DQR A;  4F5R A;  3OSP A;  4RQ0 A;  1KBU A;  1PZN A;  1ZRM A;  1RZT A;  2FLP A;  4B9T A;  5F9L A;  3WK9 A;  4NLN A;  3KOO A;  1NKE A;  1Z4N A;  5EE3 A;  3UMC A;  4EEK A;  2F8K A;  5AM5 A;  4FS1 A;  4FBU A;  1JXE A;  3IN5 A;  2E8N A;  2C2E A;  2KFZ A;  1XC9 A;  5ALZ A;  1T4G A;  1XNS A;  3I76 A;  3QEB Z;  3SZ2 A;  4IC9 A;  2HHW A;  9ICK A;  3EUB 2;  5KFN A;  2O6K A;  1NK6 A;  3Q8S B;  1S5L U;  5HMM A;  2OYY A;  3GDX A;  2BQ3 A;  7ICO A;  2WTF A;  5L1K A;  2I9G A;  7ICI A;  1X9X A;  4Y2U A;  2H3V A;  3RJH A;  3RTV A;  2HOQ A;  1D8Y A;  2KOB A;  1Q8K A;  4OJ5 A;  3BQT A;  4JUZ A;  3HX0 A;  5KG4 A;  2XID A;  9ICQ A;  3RB6 A;  4AYB F;  3PVX A;  3AU2 A;  2YMP A;  1WUD A;  4DOB A;  4RQN A;  4Z6D A;  3RJI A;  1U9L A;  1XSP A;  1ZQW A;  5DGB A;  2UVU A;  7ICV A;  5L1M A;  2AQ0 A;  4RUA A;  3EYZ A;  5KFP A;  4MF8 A;  4F50 A;  1S8O A;  3QZ8 A;  3HJE A;  4RQ7 A;  8ICI A;  3M7D A;  1S10 A;  5KG1 A;  3ONN A;  1DK3 A;  3KBB A;  2KEY A;  4YD2 A;  5ALF A;  2JV3 A;  3N4M B;  2K89 A;  3N7P D;  4YP3 A;  5L1L A;  2IHN A;  1VDV A;  3C23 A;  2KFN A;  3C2L A;  3UXO A;  4UAS A;  2YB1 A;  2KSO A;  1ZOL A; 
#chains in the Genus database with same CATH homology
 1SV0 A;  4PZN A;  1PK1 A;  5J8Y A;  2KE7 A;  1LKY A;  1B0X A;  4IS7 A;  2K4P A;  3BS5 A;  2EAP A;  3TAD C;  5JRT A;  1X40 A;  2QAR A;  2KIV A;  5JTI A;  2F8K A;  2DL0 A;  3KKA A;  2GLE A;  2KSO B;  2E8N A;  5JU5 A;  3H8M A;  2DKZ A;  1PK1 B;  4NL9 C;  1Z1V A;  1B4F A;  2YTU A;  1DXS A;  1LKY B;  2LPE A;  5J8Y C;  2E8M A;  2KG5 A;  2QKQ A;  4NJ8 A;  2EAN A;  1KW4 A;  2F3N A;  1JI7 A;  1UQV A;  4PZO A;  2EAO A;  3TAC B;  2EAM A;  1X9X A;  1SXE A;  3BQ7 A;  3SEI A;  2D3D A;  3IDW A;  1WWV A;  1OW5 A;  2E8O A;  1SV4 A;  3SEN A;  2QAR B;  1SGG A;  2B6G A;  2FE9 A;  4RQN A;  2D8C A;  4NL9 A;  5KNI A;  5L1M A;  3HIL A;  5F3X B;  3BS7 A;  4MHV A;  1PK3 A;  2KMD A;  2DKX A;  2ES6 A;  2Y9T A;  1OXJ A;  2E8P A;  2F44 A;  3TAD A;  3BS5 B;  1X66 A;  1WWU A;  4RQM A;  2ESE A;  1UCV A;  1F0M A;  2JV3 A;  1SV0 C;  3KKA C;  2QB0 B;  1SXD A;  2Y9U A;  2LMR A;  2QB0 A;  1V38 A;  1COK A;  3K1R B;  2L5Y A;  2KSO A;  2K60 A;  2QB1 A;  1V85 A;  1RG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...