1WWVA

Solution structure of the sam domain of human connector enhancer of ksr-like protein cnk1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Connector enhancer of kinase suppressor of ras 1
publication title Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1
rcsb
source organism Homo sapiens
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1wwvA00
1B0XA 1KW4A 1LKYA 2EANA 2KE7A 2LPEA 1OXJA 2EAOA 4RQMA 2KSOB 4NL9C 3KKAA 3BQ7A 3SENA 3BS7A 2K60A 1F0MA 2LMRA 5J8YC 1X9XA 1RG6A 2Y9UA 2EAMA 2ES6A 2KMDA 1SGGA 3KKAC 1UQVA 1V38A 3BS5A 5J8YA 3SEIA 1DXSA 1WWVA 2Y9TA 1SV0A 2F8KA 2B6GA 3K1RB 2YTUA 2GLEA 2QB0B 2D8CA 3H8MA 4PZOA 5JTIA 1LKYB 5JRTA 1X66A 2ESEA 1PK1A 2QARA 2JV3A 2KG5A 1V85A 4PZNA 2FE9A 2DKXA 1SV0C 4MHVA 2L5YA 3TACB 1SXEA 2E8PA 2K4PA 2DL0A 3HILA 3IDWA 1COKA 1UCVA 2E8NA 1PK3A 5KNIA 1JI7A 3BS5B 1X40A 3TADA 2KIVA 4NJ8A 2F44A 2DKZA 2D3DA 1OW5A 2EAPA 1SV4A 2F3NA 2QB1A 2E8MA 4IS7A 1WWUA 1SXDA 2KSOA 2E8OA 5JU5A 3TADC 4RQNA 1PK1B 4NL9A 5F3XB 2QARB 1Z1VA 5L1MA 2QKQA 1B4FA 2QB0A
chains in the Genus database with same CATH superfamily
3T79A 2OCEA 4UQGA 2XCAA 4QZDA 4DSIA 4TQRA 2KP7A 7ICVA 3RB6A 3OHBA 3PO5A 3IHQB 1UHUA 3HPOA 5GTIU 3VC8A 2HHWA 4P4OA 2ES6A 5AHXA 5ALWA 3RBDA 1V38A 5L1IA 2YQEA 4I2BA 3OJUA 4C80A 3HX0A 4DSFA 3RFAA 4I2CA 2PMZC 3BZCA 2W9CA 4ED3A 1Q8KA 2AGQA 1XSLA 1N63A 2MUTA 3JPTA 1D9DA 2BCSA 1NNLA 1F44A 4G9BA 1NKCA 3WK5A 2JV3A 1TE2A 2BDUA 3KZIU 1TFRA 1L3TA 4BJQA 4EYHB 5ALQA 4I2EA 1V9PA 4Z6EA 4Y2SA 2DBYA 4UB8U 2K4PA 1KLNA 1ZQKA 2ZIWB 5J2BA 4KX3A 1S97A 3ZDBA 1T8EA 4OJPA 4BWJA 2WF6A 3TADA 4NJ8A 2PFQA 3UQ0A 5ALEA 4BX9C 3RJEA 3N7PD 2W11A 1MN8A 5AKIA 2BHNA 5DB7A 2E8MA 5DQIA 4IS7A 9ICBA 4ECRA 2KSOA 3ETLA 3HT3A 4PL1A 4I27A 2YMQA 3QU9A 1ZQXA 4Q8FA 3B9JA 3G6XA 5HNKA 2OHFA 1ZQIA 4ELTA 4I2HA 2P6RA 3QU4A 3ISDA 2NRTA 2WTFA 5ALNA 7ICGA 5J2KA 1S76D 2BCVA 1RDFA 2H3VA 4J9NA 2ISOA 1J97A 4JUZA 4R8UA 4PHEA 4GFJA 2UVVA 3NRWA 5EWFA 2JEJA 2ZIWA 5EWGA 1RG6A 9ICJA 5CR0A 1ZXIA 3EPGA 2LBOA 1C7YA 2OM6A 1SGGA 4JV2A 4TQSA 4YMMA 1PVPA 5CEHA 5KFIA 4M47A 1S0NA 3SAGA 4TUPA 1URJA 1ZQOA 3KOOA 4C4TA 2NO4A 1V97A 4M0AA 5HR7A 5ALGA 4UAWA 5KT3A 3AU6A 3IG5A 3L3FX 4Y2XA 4FBTA 3V72A 4CF3A 1RYUA 2RP5A 1XWLA 5KFVA 5DKWA 3U26A 1COKA 5J2AA 4O3OA 3IV6A 4KN4A 3ZDEA 3LVVA 3I1YA 3NTUA 5IILA 4B9NA 4Z6DA 1FO4A 2IMWP 1ZQVA 5DG8A 2HBJA 4KLDA 1JIHA 2W9BB 5KFGA 1PK1B 4CE6A 2HOIA 2LKYA 2V4QA 2HDOA 3JPRA 8ICUA 3GV5B 4PPXA 1EXNA 1X9SA 2BCQA 2LPEA 3CYMA 4O0IA 3ED5A 3M6ZA 1UA1A 3TFSA 4B9SA 1TKDA 4F50A 3SENA 4OJLA 3FAHA 2VJ5A 3F5EA 1UPHA 4EZ9A 2J6UA 2YN4A 2AQ0A 2MA1A 4J9LA 4F5RA 3KKAC 3T5JA 3RH4A 4KLIA 5G5GA 2VA3A 5J8YA 4PHPA 2KJ9A 3OPXA 2PKEA 4NLCA 2Q0ZX 2VA8A 9ICAA 1HUZA 2ZIVA 4RQ6A 2B6GA 2HVHA 4GC6A 2W9BA 3TI0A 3C2MA 1ZQNA 2VKQA 1PK1A 4EEYA 3I28A 2KNJA 4KLUA 5EE1A 4YFKA 1V85A 3VCBA 2YMMA 1S0OA 2JGAA 3HP6A 4MHVA 4TUSA 2W03A 3QXGA 5AI6A 4C0ZA 4US9A 1TAUA 2Y0SC 4NM1A 2KKVA 1YZ6A 3IM1A 2W04A 4Y2PA 2HCFA 2JHDA 9ICMA 5IIMA 2EZYA 1RQNA 4JB3A 4C8LA 3SV4A 2AXTU 4O5CA 4ZH4A 5FP0A 2EAPA 3PW4A 2R8IA 1NZBA 4AYBF 5B66U 3KHLA 2F2AB 4DQRA 3PMNA 5F9NA 4RQNA 1KSPA 1ZQEA 5F3XB 1QSSA 4GXIA 4FZNA 5KFXA 1L3UA 5KFSA 1T3QA 3TAQA 2KOBA 4RUAA 3T5HA 4Q45A 3UMBA 2P35A 4Z6CA 4F72A 4JWMA 4LVSA 2ISPA 5KFRA 7ICRA 2FMPA 3SD7A 2K60A 3MGVA 3SI8A 4F4ZA 4QIWF 1BPYA 5AICA 2HBKA 2ZIXB 3RR8A 3G6YA 1WG8A 1U49A 4PGXA 4PH5A 5AI8A 1MA7A 4NM2A 1QLNA 1WWVA 3NASA 5DBAA 3UQ2A 1Z19A 2JXJA 1KFDA 4UB6U 2C28A 9ICKA 9ICEA 4MEYA 4YQWA 2JR5A 3BQ1A 3KZXA 4KN7A 5CHGA 5J2EA 3ALRA 2DF4B 4NV0A 3PW2A 1X9WA 3H8SA 1ZD2P 2IHMA 4C8OA 3GQCA 2E5SA 4MFFA 1L5UA 5KFHA 2KJ8A 4R66A 4FS2A 1SZHA 3LK9A 4O3SA 4DOCA 3GV7B 5KFUA 2ZIUB 3QEBZ 2BQ3A 3H7IA 3AQEA 2ZIXA 3N7RC 4M9LA 4J9RA 5ALTA 4ECSA 3PSPA 4UB1A 3QX7A 4UAVA 4I2GA 5ALOA 2ZTDA 1QQ7A 5D49A 1Z1VA 1DOQA 1AROP 4O3MA 4DL5A 1N62A 1ZRNA 5IIKA 5KFEA 1S10A 4P4MA 2HBMA 1ZQYA 4OJ6A 4F8RA 4GLXA 1U4BA 3T5KA 4QW8A 1NJYA 1IV8A 2JEFA 7ICNA 1ZQLA 1L7PA 2AGOA 1F0MA 2FPLA 4GC7A 3EYZA 4DWIA 1HEKA 2NRZA 2W43A 2W8LA 1RZTA 4DQPA 3WK6A 2G5IB 1ZD3A 2WB1C 2HOFA 5KFBA 4RNOA 1A6SA 1K5OA 8ICPA 5ALHA 5TZVA 1BGXT 3GV8B 8ICRA 5KFJA 4DL3A 1RQLA 1NK7A 9ICVA 5J0RA 3HKZF 5CB1A 1Z00B 3V7KA 2M9NA 5KFNA 3SZ2A 4KLQA 3MGHA 5IIOA 4HAIA 2NRWA 4O9MA 4BDPA 4ED0A 5CA7A 4B9TA 5KG5A 1SKRA 2CN1A 5ALPA 2LM1A 3PX4A 4UARA 4NWIA 4XUSA 1N61A 1UT5A 1ZQWA 3PVXA 5KFCA 2WFAA 2ZJ8A 1Z4OA 4RQ3A 1S77D 2EZXA 1IIPA 1N56A 3T3FA 4KLSA 4OJ5A 1F5SA 3UXOA 2YB4A 2ZUBA 2W55A 3LDAA 4IQTA 5JUMA 1WCLA 4DQSA 4J9QA 3K75D 3HJEA 3R9KA 4RT3A 4PJ0U 5KFTA 3GZFA 2BGWA 2ZXHA 1ZQAA 4F4KA 9ICTA 3PV8A 3N4MB 1ZJNA 1PVRA 5AK4A 1CEZA 2R8JA 1ZD4A 4ED6A 1ZQJA 5J0YA 2MRLA 1KQQA 2LYHA 4UW9A 2XI9A 1U47A 1SWWA 2OYYA 4OCZA 2EAMA 4IRDA 5ALDA 4FS1A 4QZEA 3IG8A 2K4HA 4I29A 4BXOA 1ZQDA 1CI4A 4NLBA 3CW2C 3M9NB 2BCRA 3F5AA 1LKYB 3QZ7A 1X66A 3O0FA 4RNMA 1DGJA 2DPIA 4DLEA 2H3FA 2GH1A 1JRPA 2PFPA 1ED1A 3GIJA 3RJKA 4IRCA 4BGDA 4JWNA 4IR1A 2FI1A 2AGPA 1X2IA 2A1JA 2K8AA 2E8PA 1JXLA 4Z6FA 9ICPA 1RPLA 1VDVA 2RRDA 1JI7A 2DQNB 1TV9A 3BS5B 1L7OA 2KICA 2D3DA 4DOBA 4QZIA 4EZ6A 3Q8MA 3CRXA 3RAXA 8ICLA 3KHGA 5AK5A 4F91B 4DSEA 4EX7A 1SXDA 2E8OA 5AM5A 2QARB 5ALZA 5HMLA 4GXJA 5KFPA 5KFDA 2PI5A 1B4FA 7ICHA 4DFPA 9ICIA 1LKYA 5DBCA 1MSWD 1OUQA 4RQMA 5AKYA 4DFMA 2B21A 9ICQA 2PMZF 4QZFA 3PSFA 3K1ZA 5L1KA 3Q8PB 5DLFA 4DSKA 2JH1A 2KVCA 3F53A 4DFKA 2ZUDA 4CCHA 2JEGA 2HHXA 9ICRA 5ALFA 5KT7A 2BCUA 2JEIA 3OSPA 1BPDA 2EZZA 3WK8A 4DEZA 2PFNA 4O3PA 4KMUA 4EENA 3BS5A 1KKXA 2WAQC 4UB5A 5BOMA 2GWSA 4JMUA 1SWVA 4LZDA 7ICSA 4QWBA 3ONNA 3IP4B 1H38A 3UMCA 5KAIU 5ALRA 5KG4A 2YTUA 2D8CA 4Q43A 3G6VA 4DS5A 2QARA 4DSLA 4PZNA 1SV0C 4F5OA 3Q8SB 3MR6A 2FLLA 5A0LA 2LHTA 3AU2A 2H3ZA 1ZYQA 3SAHA 5KAFU 3LVWA 3NVZA 4UATA 2WF8A 3N97B 4EEKA 1KL9A 4ECXA 1ZETA 3HW8A 2R8GA 3H0RB 4XQ8A 5AM4A 1XU4A 1ZQQA 1LVHA 1NK8A 2F1HA 1NJXA 3ZDCA 5IIJA 4B9UA 1BPBA 2ASJA 2UVWA 1BNOA 3Q8QB 1AQ6A 3SMVA 2EANA 3M1YA 3C28A 1OXJA 2HHSA 3ORYA 3GIKA 4NL9C 5DB9A 5C5JA 1NZPA 5AIAA 3MBYA 2KEYA 5AIBA 2V9WA 4KTQA 4YR0A 2BPGA 4DL2A 5J8YC 3H8JA 4QWCA 1K1QA 4I2JA 1ZQCA 3KHHA 2W9AA 2KMDA 1QSYA 3AM9A 1LB2B 4YR3A 1JMSA 1HIWA 2VA2A 3Q8LA 8ICHA 3L4PA 5J29A 3QE9Y 1P7DA 2KFNA 3C1YA 5KG7A 3QUBA 2NO5A 2D6FC 5CP2A 3IN5A 2HSZA 4C8KA 5JTIA 5ALSA 3BQ2A 4DS4A 3PR5B 3THVA 1BNPA 5DBBA 1X6JA 2HW3A 2G09A 1ZJMA 3AEVA 4R65A 4YMNA 3E0FA 1QCKA 9ICSA 1TK5A 3I76A 3SQIA 5KNIA 3RBEA 3OHAA 3PW5A 1X40A 4YXJA 2DKZA 4QZHA 2R18A 3PNCA 8ICQA 5AM3A 4CDGA 4I2FA 5AM1A 3WKCA 1SV4A 1D8LA 4DFDA 4Q8EA 1HJPA 2LYAA 4FZLA 1S8OA 2XGQA 1S9FA 3WKEA 4Y2VA 2W7OA 1IG6A 3QU5A 2RLTA 5AKXA 4KLHA 5IINA 4P0PB 1Z1BA 8ICBA 3TARA 3BJYA 1N2XA 1S0MA 4ECWA 2KTQA 5KT2A 4MF8A 2MSNA 2XY6A 2XCPA 2EAOA 2KV2A 3EW9A 4WJ3B 2Q4TA 1T4GA 2AHOB 2K4EA 4NY8A 4O3QA 3HRDD 5KFQA 9ICXA 3NVVA 3KKAA 4ZOHC 3KD3A 3M6KA 4X5VA 4F2SA 5ALIA 8ICVA 1X9XA 4QIWC 5BOLA 4K4GA 5KG2A 5AI4A 2H3IA 1UT8A 3F2CA 1L3VA 4RQ7A 1UQVA 2UVUA 1IM4A 5CWRA 1C20A 5DB8A 2ASLA 2PI4A 3ZDAA 4KITB 2FPMA 8ICNA 4ED2A 2M0NA 2HMXA 4B6JA 5DB6A 4ED7A 1B22A 8ICZA 1NK6A 2ESEA 1ZD5A 4UASA 4UBBA 3BQTA 3C5GA 4E0DA 1N48A 3LWLA 4P0PA 1FEZA 5KFOA 2E1FA 2E3TA 3A0HU 4O3RA 3A0BU 5AKGA 5ALMA 9ICUA 9ICWA 5E79U 1J2MA 1J2NA 1PK3A 3PMLA 2XVTA 4DSJA 2HHVA 4DL7A 4CF5A 2KIVA 4IR9A 3MR3A 3V7JA 5GTHU 8ICMA 8ICJA 3PX0A 5KG6A 4Y2RA 3V7LA 4M2YA 3E2EA 4YG2A 5KTQA 3RJGA 5J0QA 3F2BA 1S0VA 2WHEA 2RDJA 3PW0A 3EPIA 1NK4A 7ICLA 5ALKA 1MC8A 3D2NA 3RF9A 4UB4A 4TURA 4Y2TA 2VJ4A 1TVAA 5KFLA 2HI0A 4ED1A 4F3OA 3TANA 4GIBA 4QNLA 1A76A 4RPZA 3V6HA 1JALA 1BPEA 1SL2A 4M9JA 2IBKA 5KFMA 3BQ7A 4OD0A 4XRHA 1KN5A 1N60A 2FMQA 4A8EA 3DEEA 5AI5A 1O08A 9ICHA 1WYGA 1XS9D 8ICYA 1M6YA 1NK0A 2KZMA 2Y9UA 4YMOA 3FC4A 1S5LU 3WK7A 1Q3VA 1RXWA 2P6UA 2I9GA 5HP4A 1TK0A 3V6KA 1NOMA 9ICCA 5DG9A 4IQVA 3HWTA 1ECWA 4F5QA 3V6JA 2IA6A 5KT5A 5KT4A 2KJ5A 3HKZC 2UVRA 1KRPA 1PUZA 1YT3A 2ZJ5A 4B9MA 1CUKA 3FM9A 2ZIUA 3UXNA 2DWQA 4FE3A 5HMMA 4R63A 4KLJA 3JPQA 4I2IA 1QQ5A 2A3VA 4O5EA 5J0XA 1QTMA 3BZKA 4QW9A 4DL4A 3BDPA 1DRGA 3QUQA 4R64A 2W7PA 4CGZA 2JZBB 3NVYA 4FO6A 2C2RA 8ICEA 3JPOA 3D2SA 2BR0A 1ZOLA 4DOAA 1Z4NA 2F77X 3WK9A 4EBEA 4MF2A 2R8HA 1Z3EB 2VIXA 3N7SC 2RHFA 5D46A 5JU5A 3ZDDA 1TK8A 3SR6A 4KLGA 4I28A 4IQUA 5L1MA 4NLKA 2WB1F 1X9MA 4YD1A 2Y1IA 5J2JA 4M6WB 2H5XA 1ZQZA 3ZI4A 1FIQA 4U6PA 3C23A 1KW4A 1SZPA 4G3IA 5HHHA 2B0CA 1UA0A 4UB3A 7ICOA 3NVWA 1ZQRA 1SIJA 5EE9A 2YB1A 5J0UA 1T7PA 2J6SA 2QLTA 4RU9A 3PW7A 4YVZA 4ACOA 4K4HA 4UAYA 5ALLA 3CP8A 2KFZA 1T94A 3LWMA 1Z00A 2FLNA 2JZBA 3H0LB 2KIWA 2F8KA 3RJIA 4B9VA 4DF4A 3AN1A 2FMSA 3FYHA 4JV1A 4Y2JA 2EDUA 4DCCA 3RRHA 4PZOA 3C1ZA 3C2KA 5JRTA 7ICFA 5IIIA 2W54A 2H3QA 2KK0A 4JV0A 4RNNA 1BVSA 4DFJA 4KLTA 2W9CB 1QQ6A 3RRGA 3MABA 3SYZA 2L5YA 2MUTB 3ETRA 2CPRA 1SXEA 3D6JA 3UXPA 3GDXA 4YXMA 7ICPA 3GILA 1BPZA 4ECTA 2ZJAA 2F8LA 3TQ1A 2XIDA 1NJZA 3UMGA 5J0PA 4DLGA 2HBLA 2IHNA 4B9LA 3TADC 3H4BA 4NLGA 1XO0A 1GO3F 5AK6A 5DDMA 3RJFA 5HR6A 2C2DA 2W8KA 1SL0A 2C22A 2KE7A 2N1RA 4DF8A 4OJOA 2E1EA 2KSOB 4RUCA 3JPPA 3H4DA 4QZ8A 2I5HA 3WKDA 8ICTA 2OXOA 4ECVA 1JX4A 5KFZA 2EQYA 2A19A 4QZBA 3GFKB 3EUB2 2K8BB 1NKEA 3SV3A 3CNHA 4ECYA 4ELVA 1L8LA 4R8UB 5DGBA 3QUCA 2G08A 1DK2A 1KEJA 4ICAA 4PL2A 3GIIA 3PSTA 3QU2A 4ECUA 2KZ3A 4QWAA 4RZRA 2YX8A 3SAFA 2HHQA 2ZUCA 2QB0B 3M7DA 1L3SA 5HHIA 2BPCA 5KFAA 3JPSA 1NK5A 5KFKA 7ICUA 1COOA 5KFWA 2K89A 1QH9A 4M9HA 1RYSA 3AQFA 4DO9A 2ATLA 3NS1A 2XY5A 1ZQUA 2RQ5A 2OH2A 2PXIA 4IL6U 2W3SA 2BZFA 4Y2QA 3TFRA 1SKSA 2G0AA 3AMZA 1XSPA 4J9MA 3QUTA 4RQ4A 4J03A 3KHRA 2NYVA 4U7CA 3C2LA 3RB0A 2F44A 2LI6A 3C21A 4USAA 1N5XA 1VJ5A 5J2FA 3M9OB 4AP9A 3AL0B 2XGPA 4EBDA 3MR2A 2O6KA 5J0WA 3MDAA 4P4PA 2I1QA 1KFTA 1ZQSA 1X6IA 3H0MB 2PFOA 2MAXA 1HUOA 1VLBA 1RYRA 8ICSA 1TAQA 3MFIA 2QB0A 1NI3A 2WAQF 2BDPA 3RAQA 4UB2A 2XICA 1PVQA 1ZQTA 5ALVA 8ICIA 5K4LA 4C7YA 9ICGA 3KTQA 3M8RA 5EOZA 3WKBA 2W9MA 3K4GA 5J0SA 3D2QA 4J9OA 1ZRMA 4MFCA 8ICGA 4UAUA 2AU0A 5J0OA 4UAZA 4C8MA 2AH5A 4TUQA 3SEIA 1DXSA 4FBUA 3OGUA 2Y1JA 1SV0A 2G06A 2KD1A 5CJ7A 3FDSA 2OEHA 2JMGA 4KLMA 5KL1B 8ICCA 2V4RA 5DQHA 5H2FU 1U9LA 3OJSA 1SKWA 2YY6A 4QWDA 2ZTCA 2ZIVB 3QEAZ 4YN4A 4M9GA 5AKJA 2DL0A 4QZAA 4Y2YA 7ICKA 4PHAA 3BQ0A 2JH7A 4ED8A 1KTQA 1B43A 2J6TA 5CRXA 5AKLA 2KKPA 2Z7JA 3H40A 2EH9A 4RPYA 9ICOA 2F76X 1YZ7A 5G5HA 5KG1A 4DQIA 1OW5A 3ZD8A 3Q8RB 3QNMA 1XO1A 1XC9A 4NLNA 3RB4A 1L8OA 2K8CB 4GXKA 2FJ6A 1JROA 2IOFA 4NL9A 4PGQA 4RQ8A 4PGYA 3AUOA 5DG7A 1MQ2A 1ZQFA 1JXEA 2G07A 9ICLA 4EELA 5AK3A 1B0XA 1O03A 9ICNA 3MDCA 3PR4A 4RQ2A 5AKKA 1MQ3A 2CRXA 3PY8A 1NKBA 4AYBC 4KX5A 3MC1A 1WUDA 3RH6A 4UBCA 5AM0A 4F5PA 1KBUA 1XSNA 3T5LA 1U45A 2CXYA 1DGSA 5B5EU 1BPXA 3OSNA 3ZD9A 4KLEA 3WU2U 1FFUA 1XNSA 3WK4A 2ASDA 4QZGA 2Y9TA 3C29A 1D9FA 2BPFA 1NK9A 3PX6A 1ZQMA 4DL6A 3K1RB 2GLEA 4C4RA 3H8MA 4J9PA 4YD2A 1SL1A 4F71A 4F92B 4J9KA 3JPNA 2XC9A 3EZ5A 2W3RA 5C0YA 4HYKA 2C2EA 3Q8KA 3NRZA 2F1IA 4YR2A 2Y0SF 3QYPA 2K4IA 1D8BA 1IXRA 3HILA 5J0TA 8ICKA 3MFHA 2FLPA 7ICIA 2E8NA 3LYSA 4EX6A 2R8KA 5L1JA 3KBBA 2MU2A 1X42A 3MGIA 4F2RA 2ZG6A 2KZZA 2GOLA 7ICTA 1SB3C 2WF5A 1Q46A 1WCNA 2KHVA 4KLLA 1QSLA 4IC9A 2F3NA 2IOFK 2QB1A 2NV3A 1U48A 2F1JA 3NUQA 4M04A 2GO7A 3QU7A 3E58A 2QKQA 2DUYA 2AJQA 1TAMA 4JK1A 4M9NA 4QZ9A 2LYBA 4LJXA 2WF9A 5KG3A 5KG0A 5AI0A 1RM6C 4F93B 5F9LA 5BPCA 4F4WA 2DPJA 1A0PA 4RQ5A 4P2HA 2LMRA 1ZQGA 2BQRA 3S6JA 3M9MB 5ALUA 4I2AA 4QJFB 9ICFA 5TISU 4RQ1A 5DQGA 3GU3A 5ALYA 4C4SA 1PZNA 4K4IA 4KMOB 4ELUA 1Y88A 3TKAA 7ICEA 4C7ZA 3ISCA 3DV9A 4FZMA 5AKEA 4YP3A 3UM9A 2HHUA 5AKHA 5DGAA 4O5KA 5ALJA 2HHTA 2P66A 5KFFA 5DDYA 1KFSA 5J2DA 7ICMA 4RPXA 5J2IA 2DGZA 4MEXA 3RTVA 2FPKA 4Q44A 2VANA 2HOQA 2KN7A 8ICWA 3N28A 2KHQA 3IDWA 5AM2A 5L1LA 2JRZA 2OWOA 1ZQ1C 5EE3A 4FFDA 1N5WA 2XY7A 1K1SA 4CRXA 1ZQHA 4NLZA 1LV5A 4Y2UA 4NXZA 5KFYA 2ALZA 1CRXA 4IRKA 3RB3A 1KDHA 4KLOA 3WKAA 1WWUA 2ODGA 2XO7A 2WF7A 3NGDA 3M8SA 4RT2A 1ZQPA 7ICJA 4US8A 1DK3A 4F4XA 3J81j 1Q3UA 3OTQA 4MFAA 5EWEA 4XA5A 4DQQA 2NRVA 4P0QB 8ICOA 4LZGA 2HVIA 4C8NA 5KL8B 3BS7A 2ZXIA 4RQ0A 3PZPA 7ICQA 3TAPA 3RJHA 2A1AA 2LM4A 4ECZA 4YCXA 1L7MA 3MR5A 2KVSA 3ICXA 2I6XA 4BWMA 4EYIB 4F4YA 4I2DA 1L6NA 3QZ8A 4CNQA 2BKEA 8ICXA 3IRUA 3GIMA 5J2CA 2AQ4A 5L9XA 3RR7A 5DLGA 3UPQA 1A77A 1FFVA 4QZCA 3B0XA 2KG5A 4O3NA 5AI9A 2DKXA 2FE9A 2BQUA 3RJJA 4BXOB 3KFUF 3H8WA 5EE0A 3TACB 3EWAA 4BUGA 4P0QA 3PSIA 1RXVA 5D4BA 1UCVA 2NRXA 2G5HB 3DDHA 4KLFA 3ISBA 4OO1J 8ICFA 2IOHA 3RH5A 1JN3A 5J2GA 4IQWA 4PHDA 3L5KA 2A1JB 1T3NA 1L7NA 4QWEA 8ICAA 5J2HA 4M6WA 4F5NA 5KT6A 2DFLA 2ZTEA 1NJWA 2YMLA 5AKZA 2FDRA 1JUDA 3C5FA 1ZQBA 5ALXA 4CF4A 5T14A 2YMPA 3B0YA 1D8YA 4J9SA 4EBCA 2RDIA 4ECQA 3PO4A 3F2DA
chains in the Genus database with same CATH topology
1B0XA 1KW4A 1LKYA 2EANA 2KE7A 2LPEA 1OXJA 2EAOA 4RQMA 2KSOB 4NL9C 3KKAA 3BQ7A 3SENA 3BS7A 2K60A 1F0MA 2LMRA 5J8YC 1X9XA 1RG6A 2Y9UA 2EAMA 2ES6A 2KMDA 1SGGA 3KKAC 1UQVA 1V38A 3BS5A 5J8YA 3SEIA 1DXSA 1WWVA 2Y9TA 1SV0A 2F8KA 2B6GA 3K1RB 2YTUA 2GLEA 2QB0B 2D8CA 3H8MA 4PZOA 5JTIA 1LKYB 5JRTA 1X66A 2ESEA 1PK1A 2QARA 2JV3A 2KG5A 1V85A 4PZNA 2FE9A 2DKXA 1SV0C 4MHVA 2L5YA 3TACB 1SXEA 2E8PA 2K4PA 2DL0A 3HILA 3IDWA 1COKA 1UCVA 2E8NA 1PK3A 5KNIA 1JI7A 3BS5B 1X40A 3TADA 2KIVA 4NJ8A 2F44A 2DKZA 2D3DA 1OW5A 2EAPA 1SV4A 2F3NA 2QB1A 2E8MA 4IS7A 1WWUA 1SXDA 2KSOA 2E8OA 5JU5A 3TADC 4RQNA 1PK1B 4NL9A 5F3XB 2QARB 1Z1VA 5L1MA 2QKQA 1B4FA 2QB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0X A;  1KW4 A;  1LKY A;  2EAN A;  2KE7 A;  2LPE A;  1OXJ A;  2EAO A;  4RQM A;  2KSO B;  4NL9 C;  3KKA A;  3BQ7 A;  3SEN A;  3BS7 A;  2K60 A;  1F0M A;  2LMR A;  5J8Y C;  1X9X A;  1RG6 A;  2Y9U A;  2EAM A;  2ES6 A;  2KMD A;  1SGG A;  3KKA C;  1UQV A;  1V38 A;  3BS5 A;  5J8Y A;  3SEI A;  1DXS A;  1WWV A;  2Y9T A;  1SV0 A;  2F8K A;  2B6G A;  3K1R B;  2YTU A;  2GLE A;  2QB0 B;  2D8C A;  3H8M A;  4PZO A;  5JTI A;  1LKY B;  5JRT A;  1X66 A;  2ESE A;  1PK1 A;  2QAR A;  2JV3 A;  2KG5 A;  1V85 A;  4PZN A;  2FE9 A;  2DKX A;  1SV0 C;  4MHV A;  2L5Y A;  3TAC B;  1SXE A;  2E8P A;  2K4P A;  2DL0 A;  3HIL A;  3IDW A;  1COK A;  1UCV A;  2E8N A;  1PK3 A;  5KNI A;  1JI7 A;  3BS5 B;  1X40 A;  3TAD A;  2KIV A;  4NJ8 A;  2F44 A;  2DKZ A;  2D3D A;  1OW5 A;  2EAP A;  1SV4 A;  2F3N A;  2QB1 A;  2E8M A;  4IS7 A;  1WWU A;  1SXD A;  2KSO A;  2E8O A;  5JU5 A;  3TAD C;  4RQN A;  1PK1 B;  4NL9 A;  5F3X B;  2QAR B;  1Z1V A;  5L1M A;  2QKQ A;  1B4F A;  2QB0 A; 
#chains in the Genus database with same CATH topology
 3T79 A;  2OCE A;  4UQG A;  2XCA A;  4QZD A;  4DSI A;  4TQR A;  2KP7 A;  7ICV A;  3RB6 A;  3OHB A;  3PO5 A;  3IHQ B;  1UHU A;  3HPO A;  5GTI U;  3VC8 A;  2HHW A;  4P4O A;  2ES6 A;  5AHX A;  5ALW A;  3RBD A;  1V38 A;  5L1I A;  2YQE A;  4I2B A;  3OJU A;  4C80 A;  3HX0 A;  4DSF A;  3RFA A;  4I2C A;  2PMZ C;  3BZC A;  2W9C A;  4ED3 A;  1Q8K A;  2AGQ A;  1XSL A;  1N63 A;  2MUT A;  3JPT A;  1D9D A;  2BCS A;  1NNL A;  1F44 A;  4G9B A;  1NKC A;  3WK5 A;  2JV3 A;  1TE2 A;  2BDU A;  3KZI U;  1TFR A;  1L3T A;  4BJQ A;  4EYH B;  5ALQ A;  4I2E A;  1V9P A;  4Z6E A;  4Y2S A;  2DBY A;  4UB8 U;  2K4P A;  1KLN A;  1ZQK A;  2ZIW B;  5J2B A;  4KX3 A;  1S97 A;  3ZDB A;  1T8E A;  4OJP A;  4BWJ A;  2WF6 A;  3TAD A;  4NJ8 A;  2PFQ A;  3UQ0 A;  5ALE A;  4BX9 C;  3RJE A;  3N7P D;  2W11 A;  1MN8 A;  5AKI A;  2BHN A;  5DB7 A;  2E8M A;  5DQI A;  4IS7 A;  9ICB A;  4ECR A;  2KSO A;  3ETL A;  3HT3 A;  4PL1 A;  4I27 A;  2YMQ A;  3QU9 A;  1ZQX A;  4Q8F A;  3B9J A;  3G6X A;  5HNK A;  2OHF A;  1ZQI A;  4ELT A;  4I2H A;  2P6R A;  3QU4 A;  3ISD A;  2NRT A;  2WTF A;  5ALN A;  7ICG A;  5J2K A;  1S76 D;  2BCV A;  1RDF A;  2H3V A;  4J9N A;  2ISO A;  1J97 A;  4JUZ A;  4R8U A;  4PHE A;  4GFJ A;  2UVV A;  3NRW A;  5EWF A;  2JEJ A;  2ZIW A;  5EWG A;  1RG6 A;  9ICJ A;  5CR0 A;  1ZXI A;  3EPG A;  2LBO A;  1C7Y A;  2OM6 A;  1SGG A;  4JV2 A;  4TQS A;  4YMM A;  1PVP A;  5CEH A;  5KFI A;  4M47 A;  1S0N A;  3SAG A;  4TUP A;  1URJ A;  1ZQO A;  3KOO A;  4C4T A;  2NO4 A;  1V97 A;  4M0A A;  5HR7 A;  5ALG A;  4UAW A;  5KT3 A;  3AU6 A;  3IG5 A;  3L3F X;  4Y2X A;  4FBT A;  3V72 A;  4CF3 A;  1RYU A;  2RP5 A;  1XWL A;  5KFV A;  5DKW A;  3U26 A;  1COK A;  5J2A A;  4O3O A;  3IV6 A;  4KN4 A;  3ZDE A;  3LVV A;  3I1Y A;  3NTU A;  5IIL A;  4B9N A;  4Z6D A;  1FO4 A;  2IMW P;  1ZQV A;  5DG8 A;  2HBJ A;  4KLD A;  1JIH A;  2W9B B;  5KFG A;  1PK1 B;  4CE6 A;  2HOI A;  2LKY A;  2V4Q A;  2HDO A;  3JPR A;  8ICU A;  3GV5 B;  4PPX A;  1EXN A;  1X9S A;  2BCQ A;  2LPE A;  3CYM A;  4O0I A;  3ED5 A;  3M6Z A;  1UA1 A;  3TFS A;  4B9S A;  1TKD A;  4F50 A;  3SEN A;  4OJL A;  3FAH A;  2VJ5 A;  3F5E A;  1UPH A;  4EZ9 A;  2J6U A;  2YN4 A;  2AQ0 A;  2MA1 A;  4J9L A;  4F5R A;  3KKA C;  3T5J A;  3RH4 A;  4KLI A;  5G5G A;  2VA3 A;  5J8Y A;  4PHP A;  2KJ9 A;  3OPX A;  2PKE A;  4NLC A;  2Q0Z X;  2VA8 A;  9ICA A;  1HUZ A;  2ZIV A;  4RQ6 A;  2B6G A;  2HVH A;  4GC6 A;  2W9B A;  3TI0 A;  3C2M A;  1ZQN A;  2VKQ A;  1PK1 A;  4EEY A;  3I28 A;  2KNJ A;  4KLU A;  5EE1 A;  4YFK A;  1V85 A;  3VCB A;  2YMM A;  1S0O A;  2JGA A;  3HP6 A;  4MHV A;  4TUS A;  2W03 A;  3QXG A;  5AI6 A;  4C0Z A;  4US9 A;  1TAU A;  2Y0S C;  4NM1 A;  2KKV A;  1YZ6 A;  3IM1 A;  2W04 A;  4Y2P A;  2HCF A;  2JHD A;  9ICM A;  5IIM A;  2EZY A;  1RQN A;  4JB3 A;  4C8L A;  3SV4 A;  2AXT U;  4O5C A;  4ZH4 A;  5FP0 A;  2EAP A;  3PW4 A;  2R8I A;  1NZB A;  4AYB F;  5B66 U;  3KHL A;  2F2A B;  4DQR A;  3PMN A;  5F9N A;  4RQN A;  1KSP A;  1ZQE A;  5F3X B;  1QSS A;  4GXI A;  4FZN A;  5KFX A;  1L3U A;  5KFS A;  1T3Q A;  3TAQ A;  2KOB A;  4RUA A;  3T5H A;  4Q45 A;  3UMB A;  2P35 A;  4Z6C A;  4F72 A;  4JWM A;  4LVS A;  2ISP A;  5KFR A;  7ICR A;  2FMP A;  3SD7 A;  2K60 A;  3MGV A;  3SI8 A;  4F4Z A;  4QIW F;  1BPY A;  5AIC A;  2HBK A;  2ZIX B;  3RR8 A;  3G6Y A;  1WG8 A;  1U49 A;  4PGX A;  4PH5 A;  5AI8 A;  1MA7 A;  4NM2 A;  1QLN A;  1WWV A;  3NAS A;  5DBA A;  3UQ2 A;  1Z19 A;  2JXJ A;  1KFD A;  4UB6 U;  2C28 A;  9ICK A;  9ICE A;  4MEY A;  4YQW A;  2JR5 A;  3BQ1 A;  3KZX A;  4KN7 A;  5CHG A;  5J2E A;  3ALR A;  2DF4 B;  4NV0 A;  3PW2 A;  1X9W A;  3H8S A;  1ZD2 P;  2IHM A;  4C8O A;  3GQC A;  2E5S A;  4MFF A;  1L5U A;  5KFH A;  2KJ8 A;  4R66 A;  4FS2 A;  1SZH A;  3LK9 A;  4O3S A;  4DOC A;  3GV7 B;  5KFU A;  2ZIU B;  3QEB Z;  2BQ3 A;  3H7I A;  3AQE A;  2ZIX A;  3N7R C;  4M9L A;  4J9R A;  5ALT A;  4ECS A;  3PSP A;  4UB1 A;  3QX7 A;  4UAV A;  4I2G A;  5ALO A;  2ZTD A;  1QQ7 A;  5D49 A;  1Z1V A;  1DOQ A;  1ARO P;  4O3M A;  4DL5 A;  1N62 A;  1ZRN A;  5IIK A;  5KFE A;  1S10 A;  4P4M A;  2HBM A;  1ZQY A;  4OJ6 A;  4F8R A;  4GLX A;  1U4B A;  3T5K A;  4QW8 A;  1NJY A;  1IV8 A;  2JEF A;  7ICN A;  1ZQL A;  1L7P A;  2AGO A;  1F0M A;  2FPL A;  4GC7 A;  3EYZ A;  4DWI A;  1HEK A;  2NRZ A;  2W43 A;  2W8L A;  1RZT A;  4DQP A;  3WK6 A;  2G5I B;  1ZD3 A;  2WB1 C;  2HOF A;  5KFB A;  4RNO A;  1A6S A;  1K5O A;  8ICP A;  5ALH A;  5TZV A;  1BGX T;  3GV8 B;  8ICR A;  5KFJ A;  4DL3 A;  1RQL A;  1NK7 A;  9ICV A;  5J0R A;  3HKZ F;  5CB1 A;  1Z00 B;  3V7K A;  2M9N A;  5KFN A;  3SZ2 A;  4KLQ A;  3MGH A;  5IIO A;  4HAI A;  2NRW A;  4O9M A;  4BDP A;  4ED0 A;  5CA7 A;  4B9T A;  5KG5 A;  1SKR A;  2CN1 A;  5ALP A;  2LM1 A;  3PX4 A;  4UAR A;  4NWI A;  4XUS A;  1N61 A;  1UT5 A;  1ZQW A;  3PVX A;  5KFC A;  2WFA A;  2ZJ8 A;  1Z4O A;  4RQ3 A;  1S77 D;  2EZX A;  1IIP A;  1N56 A;  3T3F A;  4KLS A;  4OJ5 A;  1F5S A;  3UXO A;  2YB4 A;  2ZUB A;  2W55 A;  3LDA A;  4IQT A;  5JUM A;  1WCL A;  4DQS A;  4J9Q A;  3K75 D;  3HJE A;  3R9K A;  4RT3 A;  4PJ0 U;  5KFT A;  3GZF A;  2BGW A;  2ZXH A;  1ZQA A;  4F4K A;  9ICT A;  3PV8 A;  3N4M B;  1ZJN A;  1PVR A;  5AK4 A;  1CEZ A;  2R8J A;  1ZD4 A;  4ED6 A;  1ZQJ A;  5J0Y A;  2MRL A;  1KQQ A;  2LYH A;  4UW9 A;  2XI9 A;  1U47 A;  1SWW A;  2OYY A;  4OCZ A;  2EAM A;  4IRD A;  5ALD A;  4FS1 A;  4QZE A;  3IG8 A;  2K4H A;  4I29 A;  4BXO A;  1ZQD A;  1CI4 A;  4NLB A;  3CW2 C;  3M9N B;  2BCR A;  3F5A A;  1LKY B;  3QZ7 A;  1X66 A;  3O0F A;  4RNM A;  1DGJ A;  2DPI A;  4DLE A;  2H3F A;  2GH1 A;  1JRP A;  2PFP A;  1ED1 A;  3GIJ A;  3RJK A;  4IRC A;  4BGD A;  4JWN A;  4IR1 A;  2FI1 A;  2AGP A;  1X2I A;  2A1J A;  2K8A A;  2E8P A;  1JXL A;  4Z6F A;  9ICP A;  1RPL A;  1VDV A;  2RRD A;  1JI7 A;  2DQN B;  1TV9 A;  3BS5 B;  1L7O A;  2KIC A;  2D3D A;  4DOB A;  4QZI A;  4EZ6 A;  3Q8M A;  3CRX A;  3RAX A;  8ICL A;  3KHG A;  5AK5 A;  4F91 B;  4DSE A;  4EX7 A;  1SXD A;  2E8O A;  5AM5 A;  2QAR B;  5ALZ A;  5HML A;  4GXJ A;  5KFP A;  5KFD A;  2PI5 A;  1B4F A;  7ICH A;  4DFP A;  9ICI A;  1LKY A;  5DBC A;  1MSW D;  1OUQ A;  4RQM A;  5AKY A;  4DFM A;  2B21 A;  9ICQ A;  2PMZ F;  4QZF A;  3PSF A;  3K1Z A;  5L1K A;  3Q8P B;  5DLF A;  4DSK A;  2JH1 A;  2KVC A;  3F53 A;  4DFK A;  2ZUD A;  4CCH A;  2JEG A;  2HHX A;  9ICR A;  5ALF A;  5KT7 A;  2BCU A;  2JEI A;  3OSP A;  1BPD A;  2EZZ A;  3WK8 A;  4DEZ A;  2PFN A;  4O3P A;  4KMU A;  4EEN A;  3BS5 A;  1KKX A;  2WAQ C;  4UB5 A;  5BOM A;  2GWS A;  4JMU A;  1SWV A;  4LZD A;  7ICS A;  4QWB A;  3ONN A;  3IP4 B;  1H38 A;  3UMC A;  5KAI U;  5ALR A;  5KG4 A;  2YTU A;  2D8C A;  4Q43 A;  3G6V A;  4DS5 A;  2QAR A;  4DSL A;  4PZN A;  1SV0 C;  4F5O A;  3Q8S B;  3MR6 A;  2FLL A;  5A0L A;  2LHT A;  3AU2 A;  2H3Z A;  1ZYQ A;  3SAH A;  5KAF U;  3LVW A;  3NVZ A;  4UAT A;  2WF8 A;  3N97 B;  4EEK A;  1KL9 A;  4ECX A;  1ZET A;  3HW8 A;  2R8G A;  3H0R B;  4XQ8 A;  5AM4 A;  1XU4 A;  1ZQQ A;  1LVH A;  1NK8 A;  2F1H A;  1NJX A;  3ZDC A;  5IIJ A;  4B9U A;  1BPB A;  2ASJ A;  2UVW A;  1BNO A;  3Q8Q B;  1AQ6 A;  3SMV A;  2EAN A;  3M1Y A;  3C28 A;  1OXJ A;  2HHS A;  3ORY A;  3GIK A;  4NL9 C;  5DB9 A;  5C5J A;  1NZP A;  5AIA A;  3MBY A;  2KEY A;  5AIB A;  2V9W A;  4KTQ A;  4YR0 A;  2BPG A;  4DL2 A;  5J8Y C;  3H8J A;  4QWC A;  1K1Q A;  4I2J A;  1ZQC A;  3KHH A;  2W9A A;  2KMD A;  1QSY A;  3AM9 A;  1LB2 B;  4YR3 A;  1JMS A;  1HIW A;  2VA2 A;  3Q8L A;  8ICH A;  3L4P A;  5J29 A;  3QE9 Y;  1P7D A;  2KFN A;  3C1Y A;  5KG7 A;  3QUB A;  2NO5 A;  2D6F C;  5CP2 A;  3IN5 A;  2HSZ A;  4C8K A;  5JTI A;  5ALS A;  3BQ2 A;  4DS4 A;  3PR5 B;  3THV A;  1BNP A;  5DBB A;  1X6J A;  2HW3 A;  2G09 A;  1ZJM A;  3AEV A;  4R65 A;  4YMN A;  3E0F A;  1QCK A;  9ICS A;  1TK5 A;  3I76 A;  3SQI A;  5KNI A;  3RBE A;  3OHA A;  3PW5 A;  1X40 A;  4YXJ A;  2DKZ A;  4QZH A;  2R18 A;  3PNC A;  8ICQ A;  5AM3 A;  4CDG A;  4I2F A;  5AM1 A;  3WKC A;  1SV4 A;  1D8L A;  4DFD A;  4Q8E A;  1HJP A;  2LYA A;  4FZL A;  1S8O A;  2XGQ A;  1S9F A;  3WKE A;  4Y2V A;  2W7O A;  1IG6 A;  3QU5 A;  2RLT A;  5AKX A;  4KLH A;  5IIN A;  4P0P B;  1Z1B A;  8ICB A;  3TAR A;  3BJY A;  1N2X A;  1S0M A;  4ECW A;  2KTQ A;  5KT2 A;  4MF8 A;  2MSN A;  2XY6 A;  2XCP A;  2EAO A;  2KV2 A;  3EW9 A;  4WJ3 B;  2Q4T A;  1T4G A;  2AHO B;  2K4E A;  4NY8 A;  4O3Q A;  3HRD D;  5KFQ A;  9ICX A;  3NVV A;  3KKA A;  4ZOH C;  3KD3 A;  3M6K A;  4X5V A;  4F2S A;  5ALI A;  8ICV A;  1X9X A;  4QIW C;  5BOL A;  4K4G A;  5KG2 A;  5AI4 A;  2H3I A;  1UT8 A;  3F2C A;  1L3V A;  4RQ7 A;  1UQV A;  2UVU A;  1IM4 A;  5CWR A;  1C20 A;  5DB8 A;  2ASL A;  2PI4 A;  3ZDA A;  4KIT B;  2FPM A;  8ICN A;  4ED2 A;  2M0N A;  2HMX A;  4B6J A;  5DB6 A;  4ED7 A;  1B22 A;  8ICZ A;  1NK6 A;  2ESE A;  1ZD5 A;  4UAS A;  4UBB A;  3BQT A;  3C5G A;  4E0D A;  1N48 A;  3LWL A;  4P0P A;  1FEZ A;  5KFO A;  2E1F A;  2E3T A;  3A0H U;  4O3R A;  3A0B U;  5AKG A;  5ALM A;  9ICU A;  9ICW A;  5E79 U;  1J2M A;  1J2N A;  1PK3 A;  3PML A;  2XVT A;  4DSJ A;  2HHV A;  4DL7 A;  4CF5 A;  2KIV A;  4IR9 A;  3MR3 A;  3V7J A;  5GTH U;  8ICM A;  8ICJ A;  3PX0 A;  5KG6 A;  4Y2R A;  3V7L A;  4M2Y A;  3E2E A;  4YG2 A;  5KTQ A;  3RJG A;  5J0Q A;  3F2B A;  1S0V A;  2WHE A;  2RDJ A;  3PW0 A;  3EPI A;  1NK4 A;  7ICL A;  5ALK A;  1MC8 A;  3D2N A;  3RF9 A;  4UB4 A;  4TUR A;  4Y2T A;  2VJ4 A;  1TVA A;  5KFL A;  2HI0 A;  4ED1 A;  4F3O A;  3TAN A;  4GIB A;  4QNL A;  1A76 A;  4RPZ A;  3V6H A;  1JAL A;  1BPE A;  1SL2 A;  4M9J A;  2IBK A;  5KFM A;  3BQ7 A;  4OD0 A;  4XRH A;  1KN5 A;  1N60 A;  2FMQ A;  4A8E A;  3DEE A;  5AI5 A;  1O08 A;  9ICH A;  1WYG A;  1XS9 D;  8ICY A;  1M6Y A;  1NK0 A;  2KZM A;  2Y9U A;  4YMO A;  3FC4 A;  1S5L U;  3WK7 A;  1Q3V A;  1RXW A;  2P6U A;  2I9G A;  5HP4 A;  1TK0 A;  3V6K A;  1NOM A;  9ICC A;  5DG9 A;  4IQV A;  3HWT A;  1ECW A;  4F5Q A;  3V6J A;  2IA6 A;  5KT5 A;  5KT4 A;  2KJ5 A;  3HKZ C;  2UVR A;  1KRP A;  1PUZ A;  1YT3 A;  2ZJ5 A;  4B9M A;  1CUK A;  3FM9 A;  2ZIU A;  3UXN A;  2DWQ A;  4FE3 A;  5HMM A;  4R63 A;  4KLJ A;  3JPQ A;  4I2I A;  1QQ5 A;  2A3V A;  4O5E A;  5J0X A;  1QTM A;  3BZK A;  4QW9 A;  4DL4 A;  3BDP A;  1DRG A;  3QUQ A;  4R64 A;  2W7P A;  4CGZ A;  2JZB B;  3NVY A;  4FO6 A;  2C2R A;  8ICE A;  3JPO A;  3D2S A;  2BR0 A;  1ZOL A;  4DOA A;  1Z4N A;  2F77 X;  3WK9 A;  4EBE A;  4MF2 A;  2R8H A;  1Z3E B;  2VIX A;  3N7S C;  2RHF A;  5D46 A;  5JU5 A;  3ZDD A;  1TK8 A;  3SR6 A;  4KLG A;  4I28 A;  4IQU A;  5L1M A;  4NLK A;  2WB1 F;  1X9M A;  4YD1 A;  2Y1I A;  5J2J A;  4M6W B;  2H5X A;  1ZQZ A;  3ZI4 A;  1FIQ A;  4U6P A;  3C23 A;  1KW4 A;  1SZP A;  4G3I A;  5HHH A;  2B0C A;  1UA0 A;  4UB3 A;  7ICO A;  3NVW A;  1ZQR A;  1SIJ A;  5EE9 A;  2YB1 A;  5J0U A;  1T7P A;  2J6S A;  2QLT A;  4RU9 A;  3PW7 A;  4YVZ A;  4ACO A;  4K4H A;  4UAY A;  5ALL A;  3CP8 A;  2KFZ A;  1T94 A;  3LWM A;  1Z00 A;  2FLN A;  2JZB A;  3H0L B;  2KIW A;  2F8K A;  3RJI A;  4B9V A;  4DF4 A;  3AN1 A;  2FMS A;  3FYH A;  4JV1 A;  4Y2J A;  2EDU A;  4DCC A;  3RRH A;  4PZO A;  3C1Z A;  3C2K A;  5JRT A;  7ICF A;  5III A;  2W54 A;  2H3Q A;  2KK0 A;  4JV0 A;  4RNN A;  1BVS A;  4DFJ A;  4KLT A;  2W9C B;  1QQ6 A;  3RRG A;  3MAB A;  3SYZ A;  2L5Y A;  2MUT B;  3ETR A;  2CPR A;  1SXE A;  3D6J A;  3UXP A;  3GDX A;  4YXM A;  7ICP A;  3GIL A;  1BPZ A;  4ECT A;  2ZJA A;  2F8L A;  3TQ1 A;  2XID A;  1NJZ A;  3UMG A;  5J0P A;  4DLG A;  2HBL A;  2IHN A;  4B9L A;  3TAD C;  3H4B A;  4NLG A;  1XO0 A;  1GO3 F;  5AK6 A;  5DDM A;  3RJF A;  5HR6 A;  2C2D A;  2W8K A;  1SL0 A;  2C22 A;  2KE7 A;  2N1R A;  4DF8 A;  4OJO A;  2E1E A;  2KSO B;  4RUC A;  3JPP A;  3H4D A;  4QZ8 A;  2I5H A;  3WKD A;  8ICT A;  2OXO A;  4ECV A;  1JX4 A;  5KFZ A;  2EQY A;  2A19 A;  4QZB A;  3GFK B;  3EUB 2;  2K8B B;  1NKE A;  3SV3 A;  3CNH A;  4ECY A;  4ELV A;  1L8L A;  4R8U B;  5DGB A;  3QUC A;  2G08 A;  1DK2 A;  1KEJ A;  4ICA A;  4PL2 A;  3GII A;  3PST A;  3QU2 A;  4ECU A;  2KZ3 A;  4QWA A;  4RZR A;  2YX8 A;  3SAF A;  2HHQ A;  2ZUC A;  2QB0 B;  3M7D A;  1L3S A;  5HHI A;  2BPC A;  5KFA A;  3JPS A;  1NK5 A;  5KFK A;  7ICU A;  1COO A;  5KFW A;  2K89 A;  1QH9 A;  4M9H A;  1RYS A;  3AQF A;  4DO9 A;  2ATL A;  3NS1 A;  2XY5 A;  1ZQU A;  2RQ5 A;  2OH2 A;  2PXI A;  4IL6 U;  2W3S A;  2BZF A;  4Y2Q A;  3TFR A;  1SKS A;  2G0A A;  3AMZ A;  1XSP A;  4J9M A;  3QUT A;  4RQ4 A;  4J03 A;  3KHR A;  2NYV A;  4U7C A;  3C2L A;  3RB0 A;  2F44 A;  2LI6 A;  3C21 A;  4USA A;  1N5X A;  1VJ5 A;  5J2F A;  3M9O B;  4AP9 A;  3AL0 B;  2XGP A;  4EBD A;  3MR2 A;  2O6K A;  5J0W A;  3MDA A;  4P4P A;  2I1Q A;  1KFT A;  1ZQS A;  1X6I A;  3H0M B;  2PFO A;  2MAX A;  1HUO A;  1VLB A;  1RYR A;  8ICS A;  1TAQ A;  3MFI A;  2QB0 A;  1NI3 A;  2WAQ F;  2BDP A;  3RAQ A;  4UB2 A;  2XIC A;  1PVQ A;  1ZQT A;  5ALV A;  8ICI A;  5K4L A;  4C7Y A;  9ICG A;  3KTQ A;  3M8R A;  5EOZ A;  3WKB A;  2W9M A;  3K4G A;  5J0S A;  3D2Q A;  4J9O A;  1ZRM A;  4MFC A;  8ICG A;  4UAU A;  2AU0 A;  5J0O A;  4UAZ A;  4C8M A;  2AH5 A;  4TUQ A;  3SEI A;  1DXS A;  4FBU A;  3OGU A;  2Y1J A;  1SV0 A;  2G06 A;  2KD1 A;  5CJ7 A;  3FDS A;  2OEH A;  2JMG A;  4KLM A;  5KL1 B;  8ICC A;  2V4R A;  5DQH A;  5H2F U;  1U9L A;  3OJS A;  1SKW A;  2YY6 A;  4QWD A;  2ZTC A;  2ZIV B;  3QEA Z;  4YN4 A;  4M9G A;  5AKJ A;  2DL0 A;  4QZA A;  4Y2Y A;  7ICK A;  4PHA A;  3BQ0 A;  2JH7 A;  4ED8 A;  1KTQ A;  1B43 A;  2J6T A;  5CRX A;  5AKL A;  2KKP A;  2Z7J A;  3H40 A;  2EH9 A;  4RPY A;  9ICO A;  2F76 X;  1YZ7 A;  5G5H A;  5KG1 A;  4DQI A;  1OW5 A;  3ZD8 A;  3Q8R B;  3QNM A;  1XO1 A;  1XC9 A;  4NLN A;  3RB4 A;  1L8O A;  2K8C B;  4GXK A;  2FJ6 A;  1JRO A;  2IOF A;  4NL9 A;  4PGQ A;  4RQ8 A;  4PGY A;  3AUO A;  5DG7 A;  1MQ2 A;  1ZQF A;  1JXE A;  2G07 A;  9ICL A;  4EEL A;  5AK3 A;  1B0X A;  1O03 A;  9ICN A;  3MDC A;  3PR4 A;  4RQ2 A;  5AKK A;  1MQ3 A;  2CRX A;  3PY8 A;  1NKB A;  4AYB C;  4KX5 A;  3MC1 A;  1WUD A;  3RH6 A;  4UBC A;  5AM0 A;  4F5P A;  1KBU A;  1XSN A;  3T5L A;  1U45 A;  2CXY A;  1DGS A;  5B5E U;  1BPX A;  3OSN A;  3ZD9 A;  4KLE A;  3WU2 U;  1FFU A;  1XNS A;  3WK4 A;  2ASD A;  4QZG A;  2Y9T A;  3C29 A;  1D9F A;  2BPF A;  1NK9 A;  3PX6 A;  1ZQM A;  4DL6 A;  3K1R B;  2GLE A;  4C4R A;  3H8M A;  4J9P A;  4YD2 A;  1SL1 A;  4F71 A;  4F92 B;  4J9K A;  3JPN A;  2XC9 A;  3EZ5 A;  2W3R A;  5C0Y A;  4HYK A;  2C2E A;  3Q8K A;  3NRZ A;  2F1I A;  4YR2 A;  2Y0S F;  3QYP A;  2K4I A;  1D8B A;  1IXR A;  3HIL A;  5J0T A;  8ICK A;  3MFH A;  2FLP A;  7ICI A;  2E8N A;  3LYS A;  4EX6 A;  2R8K A;  5L1J A;  3KBB A;  2MU2 A;  1X42 A;  3MGI A;  4F2R A;  2ZG6 A;  2KZZ A;  2GOL A;  7ICT A;  1SB3 C;  2WF5 A;  1Q46 A;  1WCN A;  2KHV A;  4KLL A;  1QSL A;  4IC9 A;  2F3N A;  2IOF K;  2QB1 A;  2NV3 A;  1U48 A;  2F1J A;  3NUQ A;  4M04 A;  2GO7 A;  3QU7 A;  3E58 A;  2QKQ A;  2DUY A;  2AJQ A;  1TAM A;  4JK1 A;  4M9N A;  4QZ9 A;  2LYB A;  4LJX A;  2WF9 A;  5KG3 A;  5KG0 A;  5AI0 A;  1RM6 C;  4F93 B;  5F9L A;  5BPC A;  4F4W A;  2DPJ A;  1A0P A;  4RQ5 A;  4P2H A;  2LMR A;  1ZQG A;  2BQR A;  3S6J A;  3M9M B;  5ALU A;  4I2A A;  4QJF B;  9ICF A;  5TIS U;  4RQ1 A;  5DQG A;  3GU3 A;  5ALY A;  4C4S A;  1PZN A;  4K4I A;  4KMO B;  4ELU A;  1Y88 A;  3TKA A;  7ICE A;  4C7Z A;  3ISC A;  3DV9 A;  4FZM A;  5AKE A;  4YP3 A;  3UM9 A;  2HHU A;  5AKH A;  5DGA A;  4O5K A;  5ALJ A;  2HHT A;  2P66 A;  5KFF A;  5DDY A;  1KFS A;  5J2D A;  7ICM A;  4RPX A;  5J2I A;  2DGZ A;  4MEX A;  3RTV A;  2FPK A;  4Q44 A;  2VAN A;  2HOQ A;  2KN7 A;  8ICW A;  3N28 A;  2KHQ A;  3IDW A;  5AM2 A;  5L1L A;  2JRZ A;  2OWO A;  1ZQ1 C;  5EE3 A;  4FFD A;  1N5W A;  2XY7 A;  1K1S A;  4CRX A;  1ZQH A;  4NLZ A;  1LV5 A;  4Y2U A;  4NXZ A;  5KFY A;  2ALZ A;  1CRX A;  4IRK A;  3RB3 A;  1KDH A;  4KLO A;  3WKA A;  1WWU A;  2ODG A;  2XO7 A;  2WF7 A;  3NGD A;  3M8S A;  4RT2 A;  1ZQP A;  7ICJ A;  4US8 A;  1DK3 A;  4F4X A;  3J81 j;  1Q3U A;  3OTQ A;  4MFA A;  5EWE A;  4XA5 A;  4DQQ A;  2NRV A;  4P0Q B;  8ICO A;  4LZG A;  2HVI A;  4C8N A;  5KL8 B;  3BS7 A;  2ZXI A;  4RQ0 A;  3PZP A;  7ICQ A;  3TAP A;  3RJH A;  2A1A A;  2LM4 A;  4ECZ A;  4YCX A;  1L7M A;  3MR5 A;  2KVS A;  3ICX A;  2I6X A;  4BWM A;  4EYI B;  4F4Y A;  4I2D A;  1L6N A;  3QZ8 A;  4CNQ A;  2BKE A;  8ICX A;  3IRU A;  3GIM A;  5J2C A;  2AQ4 A;  5L9X A;  3RR7 A;  5DLG A;  3UPQ A;  1A77 A;  1FFV A;  4QZC A;  3B0X A;  2KG5 A;  4O3N A;  5AI9 A;  2DKX A;  2FE9 A;  2BQU A;  3RJJ A;  4BXO B;  3KFU F;  3H8W A;  5EE0 A;  3TAC B;  3EWA A;  4BUG A;  4P0Q A;  3PSI A;  1RXV A;  5D4B A;  1UCV A;  2NRX A;  2G5H B;  3DDH A;  4KLF A;  3ISB A;  4OO1 J;  8ICF A;  2IOH A;  3RH5 A;  1JN3 A;  5J2G A;  4IQW A;  4PHD A;  3L5K A;  2A1J B;  1T3N A;  1L7N A;  4QWE A;  8ICA A;  5J2H A;  4M6W A;  4F5N A;  5KT6 A;  2DFL A;  2ZTE A;  1NJW A;  2YML A;  5AKZ A;  2FDR A;  1JUD A;  3C5F A;  1ZQB A;  5ALX A;  4CF4 A;  5T14 A;  2YMP A;  3B0Y A;  1D8Y A;  4J9S A;  4EBC A;  2RDI A;  4ECQ A;  3PO4 A;  3F2D A; 
#chains in the Genus database with same CATH homology
 1B0X A;  1KW4 A;  1LKY A;  2EAN A;  2KE7 A;  2LPE A;  1OXJ A;  2EAO A;  4RQM A;  2KSO B;  4NL9 C;  3KKA A;  3BQ7 A;  3SEN A;  3BS7 A;  2K60 A;  1F0M A;  2LMR A;  5J8Y C;  1X9X A;  1RG6 A;  2Y9U A;  2EAM A;  2ES6 A;  2KMD A;  1SGG A;  3KKA C;  1UQV A;  1V38 A;  3BS5 A;  5J8Y A;  3SEI A;  1DXS A;  1WWV A;  2Y9T A;  1SV0 A;  2F8K A;  2B6G A;  3K1R B;  2YTU A;  2GLE A;  2QB0 B;  2D8C A;  3H8M A;  4PZO A;  5JTI A;  1LKY B;  5JRT A;  1X66 A;  2ESE A;  1PK1 A;  2QAR A;  2JV3 A;  2KG5 A;  1V85 A;  4PZN A;  2FE9 A;  2DKX A;  1SV0 C;  4MHV A;  2L5Y A;  3TAC B;  1SXE A;  2E8P A;  2K4P A;  2DL0 A;  3HIL A;  3IDW A;  1COK A;  1UCV A;  2E8N A;  1PK3 A;  5KNI A;  1JI7 A;  3BS5 B;  1X40 A;  3TAD A;  2KIV A;  4NJ8 A;  2F44 A;  2DKZ A;  2D3D A;  1OW5 A;  2EAP A;  1SV4 A;  2F3N A;  2QB1 A;  2E8M A;  4IS7 A;  1WWU A;  1SXD A;  2KSO A;  2E8O A;  5JU5 A;  3TAD C;  4RQN A;  1PK1 B;  4NL9 A;  5F3X B;  2QAR B;  1Z1V A;  5L1M A;  2QKQ A;  1B4F A;  2QB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...