1WWVA

Solution structure of the sam domain of human connector enhancer of ksr-like protein cnk1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Connector enhancer of kinase suppressor of ras 1
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1wwvA00
2QB0B 1SXEA 2JV3A 2QKQA 2E8OA 1UQVA 4RQMA 1SV0A 1PK3A 1WWUA 2KG5A 2DKZA 2KSOB 3KKAA 1B4FA 2K60A 2QARB 1DXSA 1Z1VA 2GLEA 2K4PA 1PK1A 3BS7A 1KW4A 2F3NA 2EAOA 3TADA 2EAMA 1LKYB 2DL0A 2EAPA 2QB1A 4MHVA 1X9XA 2EANA 3TADC 5KNIA 3IDWA 2YTUA 2DKXA 1UCVA 1LKYA 2F8KA 1WWVA 2ES6A 2E8NA 1JI7A 5JTIA 3TACB 1OXJA 3HILA 5J8YA 2LPEA 1B0XA 2F44A 4IS7A 5L1MA 1SV0C 4PZOA 1PK1B 2QB0A 1X40A 2KIVA 2B6GA 1SV4A 5JU5A 3KKAC 1OW5A 1RG6A 2QARA 3SEIA 2E8MA 4NL9A 4PZNA 5JRTA 3BS5B 3K1RB 1SGGA 2KSOA 4NJ8A 2FE9A 3SENA 2L5YA 4NL9C 1SXDA 3BQ7A 1F0MA 2KMDA 2Y9UA 1COKA 2D8CA 2KE7A 1V38A 3H8MA 2ESEA 5F3XB 1V85A 3BS5A 4RQNA 2Y9TA 2LMRA 1X66A 2D3DA 2E8PA 5J8YC
chains in the Genus database with same CATH superfamily
2FMSA 3WKEA 3SV4A 4M47A 5EWFA 9ICCA 1X9SA 2KSOB 3TAQA 4QWBA 4DL7A 3I1YA 4C8LA 2KN7A 4O5KA 3KZIU 4IC9A 1L7OA 3PY8A 3RJKA 8ICFA 5KG4A 1U48A 4RUCA 1QSSA 5ALKA 2WHEA 5CJ7A 5J2AA 5ALYA 2CRXA 3HP6A 3C1ZA 2Q4TA 1TK8A 1S0OA 3ZDAA 5KFKA 5AKIA 2HHWA 1NI3A 4NLBA 1XS9D 4DLEA 2R18A 1WG8A 5A0LA 1JX4A 4LJXA 2FPLA 5T14A 1SL1A 4F4YA 5EWGA 3H0LB 3H0RB 3V72A 4KX3A 1N56A 4DS4A 4R66A 2MUTA 1SV0C 2QB0A 2UVRA 2XI9A 3OSPA 5CWRA 3KKAC 3PW7A 3JPQA 2BR0A 4KLUA 4RPXA 2E8MA 2F77X 1A76A 5KG7A 1C7YA 2C22A 2YMPA 3J81j 3SAFA 1Z4OA 2W04A 3OJSA 2PXIA 2HHSA 3FC4A 1P7DA 1N63A 3SENA 3RAQA 2OH2A 1YZ7A 5CB1A 2OYYA 3PSTA 1XNSA 3KBBA 5AKYA 4QIWF 3WKCA 5DBCA 3PMLA 4GFJA 3ISCA 2PI4A 2KZMA 2KE7A 4PH5A 5J2BA 2AU0A 5CR0A 4EEKA 2VKQA 2B21A 5J0RA 3OTQA 2ISPA 5KFSA 3QEAZ 5KG2A 4IQWA 3QU5A 1IIPA 5KT2A 1SXEA 4DSEA 2QKQA 2ASJA 2P6UA 1SV0A 1WWUA 3MFIA 3T3FA 1NJWA 2BCVA 4JV0A 3UMCA 4JK1A 1Q8KA 4I2AA 4J9MA 4RQ2A 1Z00B 2MUTB 4ECUA 2HOQA 2DL0A 2IBKA 5KG6A 4DEZA 2OCEA 1BGXT 3V7KA 2K4HA 5J2DA 2DKXA 1SB3C 8ICVA 1BNPA 1ZQHA 8ICBA 5K4LA 2W9CB 4QW9A 3UM9A 3BDPA 2E1FA 1TE2A 9ICNA 4UB5A 1B0XA 1ZOLA 2ODGA 1L6NA 1D8YA 3RB0A 8ICWA 1N62A 3MGIA 3SV3A 1SV4A 4C7YA 5KT5A 5CP2A 3ZDEA 4P0QB 2KSOA 4KLTA 2H3FA 4AP9A 4I28A 1J97A 1ZQDA 3B0XA 4Y2RA 4QZCA 5DG8A 9ICUA 2BQRA 4I2IA 5KT4A 4P4PA 5ALLA 2JHDA 2Y9UA 4KMUA 3G6YA 8ICTA 2EZZA 3H8SA 1SL2A 3Q8RB 2JRZA 5AI4A 4I2EA 4CCHA 1L8OA 4P0PA 7ICRA 2ZIVA 4QZHA 4F4ZA 1KQQA 4QIWC 1JMSA 3KKAA 3SD7A 1IM4A 3T5KA 1QH9A 2XVTA 1NNLA 5D46A 2KIWA 1BVSA 2K4PA 3B0YA 1S8OA 4Q8FA 1EXNA 3N97B 3CP8A 4GLXA 1TK0A 2FMQA 4USAA 2IHNA 4UB2A 3KHHA 5KG1A 1N60A 4I27A 8ICCA 4KN7A 2B0CA 2YTUA 1LKYA 4F72A 4I2DA 2KVCA 2W03A 5AKKA 4ZH4A 5J0UA 4KLLA 5HHHA 5ALNA 8ICZA 4QZEA 3LWMA 9ICRA 1Z4NA 2FPKA 1HJPA 2G07A 3MGHA 4CF5A 1V9PA 4F5QA 3K4GA 1PVQA 1RQNA 7ICEA 1RYUA 3THVA 4Y2TA 2AGOA 4I2CA 3S6JA 1ZQBA 3WU2U 3ISBA 4RPZA 5ALFA 9ICJA 3NVWA 1ZJNA 7ICMA 1SXDA 3BQ7A 2XGQA 1ZQVA 3NUQA 4GXJA 4O3MA 4FFDA 9ICAA 2VA3A 4B9TA 2NYVA 4QZBA 2KICA 2K8CB 1DOQA 4US9A 3LDAA 5F3XB 4DQRA 1ECWA 1ZQSA 3A0BU 4PHAA 4KLGA 2AH5A 2A1AA 8ICKA 3WK8A 1TV9A 4JUZA 1JXEA 2ZIWB 4XQ8A 2XY7A 1PK3A 1K1QA 2KP7A 3E58A 3R9KA 5J29A 2BCSA 7ICJA 5FP0A 2LI6A 2PI5A 4CF3A 4ECSA 2R8JA 3F53A 7ICIA 4YN4A 3H8WA 3GIKA 5C0YA 4KN4A 3RJGA 5IILA 3IV6A 4M2YA 3IP4B 2EZYA 5AI9A 3QZ8A 3GDXA 2K4EA 3C1YA 4PPXA 4QJFB 4JWNA 2F8KA 3EW9A 4DL6A 1NJYA 1WCNA 1JI7A 4LZGA 5DDYA 2ZTEA 1NKBA 2W8KA 2NRVA 3HWTA 4DL3A 3KZXA 4KLIA 5ALSA 3QUCA 2W9BA 3M6ZA 3ALRA 1O08A 1L3SA 1RG6A 2Y0SC 4DF4A 2FJ6A 2MSNA 1TKDA 1N5WA 2PFPA 4QZ9A 9ICOA 2C2RA 3N4MB 4DSIA 2FE9A 5F9LA 5KFQA 5D4BA 5KTQA 2ZIVB 2KFZA 1GO3F 1NK4A 3HRDD 4YG2A 1KFSA 1F0MA 1ZQWA 3M9NB 1COKA 1ZQJA 1DGJA 2KKPA 4EBEA 4XA5A 3D6JA 1S9FA 1U45A 5L1LA 1ZQ1C 3BS5A 4MF2A 3AMZA 4XUSA 4NM1A 5KFWA 2PMZF 4M6WA 3PR4A 4P0QA 2BPCA 2M9NA 4M9HA 2K60A 3MABA 2KNJA 4NLGA 3ZDBA 3NASA 4TUSA 2AGPA 2EQYA 2LYHA 2WF8A 3GQCA 7ICLA 4UB3A 2MAXA 3OJUA 2GWSA 1KLNA 2EAPA 4IQTA 4BXOB 4AYBF 2ZXIA 3NS1A 7ICQA 4DL2A 2K8BB 3QNMA 2XCAA 4M9GA 5AKLA 4EX6A 4Y2UA 4UATA 4JB3A 1TAQA 1MN8A 2ES6A 1PVPA 2ZTDA 3MC1A 4Z6EA 1Z19A 1NZBA 2MA1A 4PJ0U 3T5JA 2P6RA 1ZQGA 1UA1A 3GV5B 4CGZA 3VC8A 3BJYA 3WK5A 1HUZA 2PFQA 4YMOA 5KFJA 2V4RA 2H3VA 1ZQUA 3D2NA 7ICHA 1AROP 3SEIA 3ZDDA 4QZIA 4ECVA 7ICVA 3RB4A 1CRXA 3PX6A 5J0PA 2JZBA 2Y1JA 4TQSA 2HHTA 5E79U 5KFUA 1D8BA 1VJ5A 3O0FA 3PW0A 5J0SA 5DB6A 1YZ6A 1KFTA 5AKJA 2ESEA 4YQWA 3H4DA 3T5LA 5KG5A 4OJOA 2ZIXA 2LM1A 3N7RC 4PGQA 3F5EA 3ZD8A 8ICGA 1F5SA 4RT2A 4NLNA 2O6KA 4XRHA 3WK7A 3M8RA 3H4BA 4F5PA 2V4QA 2RLTA 1DRGA 4QWAA 1B4FA 4OCZA 1NK6A 5J2FA 1BPEA 4GIBA 2HVIA 2GLEA 4C80A 3UQ0A 5DG7A 2RQ5A 9ICFA 2F3NA 2G5IB 3BQ2A 3TADA 9ICBA 1Z3EB 2YMMA 2NO4A 4MHVA 1ZRNA 3B9JA 5J2JA 2I1QA 3GILA 4Y2PA 4ED1A 4QZFA 3M1YA 4TUQA 3C29A 4ED7A 1UCVA 4O5EA 2Q0ZX 3C5GA 3PW4A 2RDIA 3IHQB 5GTIU 4Z6DA 1D9DA 3MDCA 4DWIA 2LYAA 3HILA 2BDUA 4F4XA 5BOMA 3ZDCA 2B6GA 5KFHA 1U9LA 4KLHA 5HHIA 4WJ3B 2BHNA 3QEBZ 4C0ZA 4DQIA 4C4RA 2LYBA 2ZXHA 1D8LA 4IRDA 3RRGA 3F2DA 2JEGA 2I5HA 1ZD2P 3GIJA 5AK4A 4Y2XA 4YD1A 2IOFA 1NK7A 9ICKA 4EYIB 3MBYA 4MF8A 1Y88A 3IRUA 5DQIA 5EOZA 4O9MA 2AGQA 2KHVA 4C4SA 1X6JA 5EE1A 4KLQA 4ZOHC 5KFBA 1NOMA 4OJ5A 1JRPA 1L7PA 2AQ0A 1ZYQA 5J0OA 2IHMA 2NRWA 5KFFA 3RR8A 3PW2A 3MR2A 2QARB 3RAXA 2I6XA 1J2MA 3TANA 4F71A 3HPOA 2YMQA 3M6KA 1RXVA 4UQGA 3GIIA 2PFOA 3ONNA 5ALMA 2ZUDA 1X9XA 2KOBA 1L3VA 2IA6A 1ZQNA 5AM3A 1QSLA 2IOHA 2UVVA 3QUQA 9ICSA 2Y0SF 9ICLA 2A1JB 2HOIA 4J03A 5HR7A 2BGWA 3A0HU 5AM1A 1MQ2A 3LVWA 4DL4A 5EE9A 4DF8A 3PX0A 3CNHA 2HI0A 2CXYA 2F44A 4BDPA 4QZ8A 2WAQF 1OUQA 4FE3A 4DSJA 3KFUF 4FZLA 4UBBA 2WTFA 4PZOA 4R64A 1JN3A 2BCRA 1XWLA 1WCLA 8ICJA 5AM5A 3N28A 4C8MA 5AK5A 4OJPA 8ICUA 1ZRMA 4EYHB 2IMWP 1BNOA 3RJEA 3Q8MA 3NVZA 4U6PA 3QU7A 4KITB 1S5LU 8ICAA 2JMGA 3EYZA 4EEYA 2J6SA 4J9PA 2F2AB 2WF7A 1VLBA 7ICKA 1L5UA 4GC7A 1FEZA 2JGAA 5ALGA 1UHUA 1ZQCA 1Q3UA 4UAWA 2VJ5A 2ZJ5A 4IRCA 5J8YC 5KFXA 2XCPA 4KLSA 2BDPA 2LBOA 3WK4A 1ZQXA 4MFCA 3G6VA 3RRHA 4UB1A 1RYRA 5AK3A 3H8JA 3OPXA 5AKHA 4IL6U 7ICNA 7ICOA 4TUPA 2E3TA 1NZPA 3QUTA 4I2BA 3SI8A 2ISOA 2EAOA 1TFRA 2JH1A 4R8UA 3TARA 4PGYA 1JXLA 1MQ3A 2H3IA 2DBYA 3EPGA 4JWMA 4RNNA 3V7JA 4J9OA 2RP5A 5DBAA 4ICAA 3QU2A 4KLMA 3M7DA 1ZQQA 3AL0B 4FO6A 2XY5A 3DEEA 4QWEA 5AKGA 3M9MB 4Q44A 1ZQPA 5ALTA 3ZI4A 1NKCA 1JUDA 4F5OA 7ICUA 5KFIA 3GV8B 4BWMA 4IR9A 2BCUA 4M9LA 1VDVA 3D2QA 1S0NA 4IQUA 5AKZA 1ZQMA 2HHXA 5KL1B 4PHPA 3GV7B 4J9LA 5KFDA 3JPTA 5ALPA 3RTVA 1N48A 3WKAA 1JALA 4NV0A 4GC6A 2VA2A 4M04A 9ICWA 8ICIA 3CW2C 4IRKA 4QZDA 1SKSA 2DPIA 2ZTCA 4DSFA 4G9BA 4C4TA 2ZJAA 4ELTA 4UBCA 3EWAA 2KFNA 3IN5A 4ED3A 2GOLA 5J2HA 4RQ3A 2YMLA 2HBJA 1LB2B 4YFKA 3GIMA 3TFSA 1X66A 1NJXA 5HR6A 5EE0A 3C5FA 3RF9A 3H7IA 1COOA 1J2NA 4M0AA 5DGBA 3MR6A 2Y1IA 3JPOA 1X9MA 3AU6A 4RPYA 2AJQA 4FZNA 5DLFA 3PMNA 1ZJMA 5HMLA 1Z1BA 2GH1A 1QLNA 1L3TA 1KKXA 3V6KA 9ICXA 1QQ7A 2YB4A 4YD2A 4US8A 2LHTA 4ED0A 2KD1A 4DS5A 3L3FX 1N61A 3FAHA 2N1RA 1BPZA 3BZKA 2W3RA 5AICA 1Q3VA 4O3NA 8ICRA 4Y2YA 1S10A 1OXJA 2FLLA 5J8YA 1NK9A 4B9VA 2LPEA 2XIDA 3IG8A 3HW8A 1SKWA 3PO5A 3BQ0A 3TQ1A 4M9NA 4FS1A 1NJZA 4QWCA 1PK1B 5AI8A 5AIBA 8ICNA 4NL9A 4C7ZA 1ZQLA 2MU2A 3E0FA 3K1RB 2XGPA 1IV8A 4F93B 1TVAA 2W43A 3QU9A 1XSLA 3OHBA 3MGVA 3F5AA 5AM0A 2VANA 2DFLA 4ACOA 4C8KA 1C20A 4BUGA 3PX4A 3C21A 4RQ5A 4O3PA 2KZ3A 1DGSA 2UVWA 5ALDA 5KG0A 2G09A 2LMRA 2JEFA 2E8PA 2JH7A 3HT3A 5B5EU 4YXJA 1BPBA 2I9GA 3SAHA 1CUKA 1XSPA 5DB7A 5EE3A 3TFRA 4NM2A 2K89A 5KT7A 1T3NA 2HDOA 5KG3A 3PW5A 3SZ2A 2HCFA 9ICPA 1IXRA 1PK1A 1KW4A 3QX7A 2EAMA 3ED5A 1RPLA 5ALXA 1Q46A 7ICTA 3H40A 5HP4A 2BZFA 3LWLA 2HHUA 3PSIA 3TADC 2KKVA 3AU2A 5HMMA 1SZHA 3RBEA 3H0MB 2ZJ8A 1XO0A 2XY6A 1URJA 5AM4A 5BPCA 2EZXA 4UW9A 2YN4A 2OM6A 5J2EA 3I28A 1X40A 1BPDA 2P35A 4QZAA 4EZ6A 4CRXA 3LVVA 3RJIA 4RZRA 9ICIA 4F3OA 4ED8A 2J6TA 3QYPA 2V9WA 4IR1A 3GZFA 3UXPA 1T4GA 4Y2SA 1CI4A 2XICA 2NRTA 8ICOA 2FLPA 8ICMA 3RH5A 1DK3A 7ICSA 5ALEA 3PV8A 4DFDA 3T5HA 2Y9TA 1L7NA 4UB8U 2ASLA 4RNOA 2Z7JA 3RH4A 4UARA 2D3DA 5C5JA 1UT8A 3CYMA 1N2XA 3SAGA 4KLOA 5DQHA 1UQVA 4KTQA 3LK9A 4I2JA 4YMNA 4ECQA 2W9MA 4QZGA 3L4PA 3JPSA 1BPYA 3WKBA 3M8SA 2K4IA 1HEKA 3G6XA 2F1IA 4BJQA 2AXTU 4ED2A 4KMOB 2KJ8A 3PVXA 5KT6A 2HBMA 4PGXA 5DGAA 3V6HA 1ED1A 1ZXIA 2W3SA 3UXOA 2OHFA 5CHGA 4Q45A 3Q8QB 3IDWA 5AHXA 5JTIA 3NRZA 3GFKB 3TACB 8ICQA 3SR6A 1L3UA 4QW8A 2ATLA 5AI6A 4O3RA 3SYZA 2KHQA 5B66U 1SKRA 4R8UB 5KFCA 4CNQA 1T8EA 4F4WA 1ZQIA 5KFEA 4UB4A 1TK5A 2R8IA 4BGDA 2JXJA 1ZQEA 4B9MA 4I2FA 3WKDA 2BPGA 3AM9A 2H3ZA 3LYSA 4UAVA 4Y2QA 4F8RA 2G08A 2L5YA 5J0TA 1K5OA 2LM4A 1M6YA 4J9KA 1UT5A 2XO7A 3M9OB 2ZUBA 2PFNA 3PR5B 4F50A 2WAQC 1A0PA 3MFHA 1V38A 2OWOA 2A3VA 1TAUA 4C8OA 3UMGA 3VCBA 1FO4A 5D49A 2WF6A 4BWJA 1PUZA 4F2SA 3RR7A 1PZNA 3N7PD 3BQ1A 3AN1A 5CEHA 4B9LA 4R65A 3F2CA 4MEXA 5J2GA 1JROA 2PMZC 5KFTA 1QTMA 5KT3A 2HOFA 4ELVA 4YXMA 1KN5A 4HAIA 2CN1A 4RQ8A 3HKZC 1K1SA 4DO9A 3RJJA 5J2CA 5AM2A 3NTUA 3RJHA 1LV5A 3DDHA 2FMPA 5J0WA 3KOOA 3ISDA 3Q8SB 4QWDA 2DPJA 4RQ1A 5ALVA 2XC9A 2C28A 1L7MA 1UA0A 3TKAA 4OD0A 4QNLA 3HX0A 4CDGA 2YY6A 1RXWA 2KIVA 2JEJA 5JU5A 1OW5A 1TAMA 5CRXA 4ELUA 1ZD3A 2QARA 5KFRA 3L5KA 3UXNA 3V7LA 5BOLA 1SWVA 5JRTA 1RDFA 3T79A 2W7PA 1T7PA 4KX5A 3V6JA 4B9UA 2H5XA 3QU4A 4F91B 4NL9C 2ALZA 4FZMA 5ALQA 2JEIA 1T94A 2W11A 2W8LA 4DFJA 4B6JA 4YMMA 8ICLA 3UMBA 2D8CA 2AQ4A 1F44A 1S0VA 2VIXA 2OXOA 2NO5A 5AK6A 4I2GA 2IOFK 4AYBC 5EWEA 1O03A 2DUYA 2KK0A 1ZQTA 4J9RA 3MR3A 1UPHA 4DQQA 2DF4B 1KRPA 4OJ6A 1FFVA 2AHOB 4ECZA 5ALJA 4DOBA 5L1IA 5KFGA 1U47A 2KZZA 3UQ2A 5KAIU 4J9SA 3RB3A 2KVSA 5KFOA 4G3IA 4P4OA 3BS7A 1BPXA 2W7OA 4YVZA 9ICHA 2PKEA 3ETRA 2EANA 5CA7A 2A19A 3JPRA 1V97A 5GTHU 4PHEA 1NKEA 4FBTA 1U4BA 4F4KA 5AIAA 1SWWA 3Q8PB 2JZBB 3BZCA 3FYHA 3TAPA 3KHRA 1ZQAA 1A77A 5IIKA 2H3QA 4IS7A 3C2KA 2BPFA 4PL2A 1XO1A 4I29A 2D6FC 1QCKA 2GO7A 1YT3A 4Q8EA 8ICHA 4YCXA 4F2RA 3QUBA 4UAYA 3PSPA 2HHVA 2WF5A 1QQ5A 1QSYA 5IIOA 4FBUA 2M0NA 5ALZA 4ECYA 1XSNA 4EELA 3NGDA 4TURA 4DFPA 3TI0A 2HHQA 1SL0A 1ZD5A 4NLZA 2DQNB 3OGUA 4B9SA 1X9WA 4BXOA 2K8AA 4JV2A 4O3OA 4EBDA 3JPNA 3C23A 4ED6A 3AUOA 1HUOA 4LZDA 4OO1J 2E8OA 1RZTA 3SQIA 4RQMA 4BX9C 2KJ9A 2YB1A 2DKZA 4MEYA 4O3SA 1ZQKA 3C28A 8ICYA 4M9JA 4EENA 2JR5A 5HNKA 3RH6A 4P2HA 4DOAA 3EPIA 2ZG6A 2G06A 1DXSA 2F8LA 4RU9A 2C2EA 1X2IA 9ICGA 3KHLA 3DV9A 4K4IA 1LKYB 4PHDA 2CPRA 2QB1A 5L9XA 4YR2A 4MFFA 2P66A 3BQTA 2ZUCA 4ECTA 5J0XA 2R8GA 4CF4A 3FM9A 1FFUA 5KFMA 3AQEA 4A8EA 5DBBA 1MC8A 4ECXA 4F92B 2R8KA 5AI5A 2BKEA 5TZVA 4F5NA 2W55A 2LKYA 5ALHA 5F9NA 2BCQA 7ICPA 4J9NA 1B43A 1X6IA 2WB1C 3WK6A 2F76X 4GXKA 1FIQA 4KLEA 4YR3A 2NRXA 4HYKA 4UASA 4O0IA 3C2MA 4DQSA 7ICGA 5AKEA 3EZ5A 2KV2A 2ZIUA 1L8LA 4NJ8A 4CE6A 4IQVA 3KD3A 4U7CA 1D9FA 3PZPA 1XU4A 4F5RA 1LVHA 1KFDA 3ETLA 2KMDA 4NLKA 1RYSA 5ALRA 3MDAA 4RQ0A 2E5SA 3N7SC 3H8MA 4KLJA 4MFAA 9ICTA 2NV3A 3CRXA 2ASDA 3AQFA 4DSKA 9ICQA 2C2DA 1ZQZA 4UAUA 4Y2VA 1ZQFA 4RNMA 4X5VA 2FDRA 5H2FU 2VA8A 3RBDA 1ZETA 1T3QA 1SIJA 3UPQA 4DCCA 5J2KA 4O5CA 3D2SA 1WUDA 4YP3A 3SMVA 1Z1VA 3NVYA 3PSFA 3HKZF 2W9BB 4J9QA 4EZ9A 1N5XA 2RHFA 2RRDA 5KFZA 4GXIA 5KNIA 3KTQA 3WK9A 1WWVA 5IIJA 3U26A 2E8NA 2G5HB 2HW3A 4ECWA 5J0QA 1NK5A 5L1KA 5IIIA 3K75D 1ZQYA 7ICFA 4Y2JA 3RB6A 4NXZA 4UB6U 8ICPA 4RUAA 3AEVA 1KDHA 1A6SA 4K4HA 4JMUA 4P4MA 2HBLA 5AKXA 4PZNA 2ZIXB 1WYGA 2WF9A 4NY8A 1SGGA 1KL9A 2J6UA 2ZIWA 3NVVA 4TQRA 2HSZA 3OSNA 1QQ6A 3K1ZA 5TISU 2BQ3A 2BQUA 3MR5A 4NWIA 5ALWA 3PNCA 3ORYA 3OHAA 2HVHA 4Q43A 3EUB2 2F1JA 1H38A 4B9NA 1V85A 4PL1A 2VJ4A 3RFAA 5KAFU 5IINA 5L1JA 4I2HA 5KFLA 1JIHA 5KL8B 3PO4A 4NLCA 2KTQA 5KFVA 4OJLA 2QB0B 4DSLA 2JV3A 3QE9Y 4EX7A 9ICMA 3C2LA 5ALOA 1XC9A 5ALIA 5JUMA 2KG5A 3IM1A 8ICSA 3Q8LA 9ICVA 3ICXA 5KFAA 2EDUA 2OEHA 4LVSA 5G5GA 1S77D 4P0PB 4K4GA 3QZ7A 4EBCA 2W9AA 4Z6CA 5DB9A 2G0AA 2KEYA 4DFKA 5DLGA 5IIMA 1MA7A 2HBKA 4KLFA 4R63A 8ICXA 2WFAA 2YX8A 4RQ4A 1KBUA 8ICEA 4DL5A 3I76A 1ZQRA 2A1JA 4DOCA 1PVRA 4ECRA 1RM6C 5DB8A 2UVUA 4E0DA 2QLTA 1U49A 1HIWA 3RJFA 3GU3A 3QXGA 4KLDA 5J0YA 1S97A 2HMXA 4RT3A 2ZIUB 5AI0A 1NK8A 9ICEA 3NRWA 2FLNA 1ZQOA 3E2EA 5KFPA 5ALUA 5DQGA 4FS2A 1DK2A 4YR0A 2RDJA 1RQLA 5L1MA 5KFNA 1KSPA 3FDSA 4M6WB 5DG9A 2NRZA 2FPMA 4UAZA 1NK0A 1S76D 5J2IA 1X42A 1IG6A 1MSWD 4RQ6A 1AQ6A 2DWQA 2FI1A 4JV1A 4DLGA 3Q8KA 3BS5B 1KEJA 2F1HA 3HJEA 3F2BA 2WB1F 4DFMA 2W9CA 4C8NA 1CEZA 5DDMA 3KHGA 3ZD9A 3IG5A 2E1EA 2KJ5A 1B22A 4O3QA 5KFYA 4RQ7A 3JPPA 5DKWA 2MRLA 2W54A 1KTQA 4DQPA 1S0MA 4RQNA 1ZD4A 1Z00A 1SZPA 2YQEA 5G5HA 2DGZA 2R8HA 4Z6FA 2EH9A
chains in the Genus database with same CATH topology
2QB0B 1SXEA 2JV3A 2QKQA 2E8OA 1UQVA 4RQMA 1SV0A 1PK3A 1WWUA 2KG5A 2DKZA 2KSOB 3KKAA 1B4FA 2K60A 2QARB 1DXSA 1Z1VA 2GLEA 2K4PA 1PK1A 3BS7A 1KW4A 2F3NA 2EAOA 3TADA 2EAMA 1LKYB 2DL0A 2EAPA 2QB1A 4MHVA 1X9XA 2EANA 3TADC 5KNIA 3IDWA 2YTUA 2DKXA 1UCVA 1LKYA 2F8KA 1WWVA 2ES6A 2E8NA 1JI7A 5JTIA 3TACB 1OXJA 3HILA 5J8YA 2LPEA 1B0XA 2F44A 4IS7A 5L1MA 1SV0C 4PZOA 1PK1B 2QB0A 1X40A 2KIVA 2B6GA 1SV4A 5JU5A 3KKAC 1OW5A 1RG6A 2QARA 3SEIA 2E8MA 4NL9A 4PZNA 5JRTA 3BS5B 3K1RB 1SGGA 2KSOA 4NJ8A 2FE9A 3SENA 2L5YA 4NL9C 1SXDA 3BQ7A 1F0MA 2KMDA 2Y9UA 1COKA 2D8CA 2KE7A 1V38A 3H8MA 2ESEA 5F3XB 1V85A 3BS5A 4RQNA 2Y9TA 2LMRA 1X66A 2D3DA 2E8PA 5J8YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 B;  1SXE A;  2JV3 A;  2QKQ A;  2E8O A;  1UQV A;  4RQM A;  1SV0 A;  1PK3 A;  1WWU A;  2KG5 A;  2DKZ A;  2KSO B;  3KKA A;  1B4F A;  2K60 A;  2QAR B;  1DXS A;  1Z1V A;  2GLE A;  2K4P A;  1PK1 A;  3BS7 A;  1KW4 A;  2F3N A;  2EAO A;  3TAD A;  2EAM A;  1LKY B;  2DL0 A;  2EAP A;  2QB1 A;  4MHV A;  1X9X A;  2EAN A;  3TAD C;  5KNI A;  3IDW A;  2YTU A;  2DKX A;  1UCV A;  1LKY A;  2F8K A;  1WWV A;  2ES6 A;  2E8N A;  1JI7 A;  5JTI A;  3TAC B;  1OXJ A;  3HIL A;  5J8Y A;  2LPE A;  1B0X A;  2F44 A;  4IS7 A;  5L1M A;  1SV0 C;  4PZO A;  1PK1 B;  2QB0 A;  1X40 A;  2KIV A;  2B6G A;  1SV4 A;  5JU5 A;  3KKA C;  1OW5 A;  1RG6 A;  2QAR A;  3SEI A;  2E8M A;  4NL9 A;  4PZN A;  5JRT A;  3BS5 B;  3K1R B;  1SGG A;  2KSO A;  4NJ8 A;  2FE9 A;  3SEN A;  2L5Y A;  4NL9 C;  1SXD A;  3BQ7 A;  1F0M A;  2KMD A;  2Y9U A;  1COK A;  2D8C A;  2KE7 A;  1V38 A;  3H8M A;  2ESE A;  5F3X B;  1V85 A;  3BS5 A;  4RQN A;  2Y9T A;  2LMR A;  1X66 A;  2D3D A;  2E8P A;  5J8Y C; 
#chains in the Genus database with same CATH topology
 2FMS A;  3WKE A;  3SV4 A;  4M47 A;  5EWF A;  9ICC A;  1X9S A;  2KSO B;  3TAQ A;  4QWB A;  4DL7 A;  3I1Y A;  4C8L A;  2KN7 A;  4O5K A;  3KZI U;  4IC9 A;  1L7O A;  3PY8 A;  3RJK A;  8ICF A;  5KG4 A;  1U48 A;  4RUC A;  1QSS A;  5ALK A;  2WHE A;  5CJ7 A;  5J2A A;  5ALY A;  2CRX A;  3HP6 A;  3C1Z A;  2Q4T A;  1TK8 A;  1S0O A;  3ZDA A;  5KFK A;  5AKI A;  2HHW A;  1NI3 A;  4NLB A;  1XS9 D;  4DLE A;  2R18 A;  1WG8 A;  5A0L A;  1JX4 A;  4LJX A;  2FPL A;  5T14 A;  1SL1 A;  4F4Y A;  5EWG A;  3H0L B;  3H0R B;  3V72 A;  4KX3 A;  1N56 A;  4DS4 A;  4R66 A;  2MUT A;  1SV0 C;  2QB0 A;  2UVR A;  2XI9 A;  3OSP A;  5CWR A;  3KKA C;  3PW7 A;  3JPQ A;  2BR0 A;  4KLU A;  4RPX A;  2E8M A;  2F77 X;  1A76 A;  5KG7 A;  1C7Y A;  2C22 A;  2YMP A;  3J81 j;  3SAF A;  1Z4O A;  2W04 A;  3OJS A;  2PXI A;  2HHS A;  3FC4 A;  1P7D A;  1N63 A;  3SEN A;  3RAQ A;  2OH2 A;  1YZ7 A;  5CB1 A;  2OYY A;  3PST A;  1XNS A;  3KBB A;  5AKY A;  4QIW F;  3WKC A;  5DBC A;  3PML A;  4GFJ A;  3ISC A;  2PI4 A;  2KZM A;  2KE7 A;  4PH5 A;  5J2B A;  2AU0 A;  5CR0 A;  4EEK A;  2VKQ A;  2B21 A;  5J0R A;  3OTQ A;  2ISP A;  5KFS A;  3QEA Z;  5KG2 A;  4IQW A;  3QU5 A;  1IIP A;  5KT2 A;  1SXE A;  4DSE A;  2QKQ A;  2ASJ A;  2P6U A;  1SV0 A;  1WWU A;  3MFI A;  3T3F A;  1NJW A;  2BCV A;  4JV0 A;  3UMC A;  4JK1 A;  1Q8K A;  4I2A A;  4J9M A;  4RQ2 A;  1Z00 B;  2MUT B;  4ECU A;  2HOQ A;  2DL0 A;  2IBK A;  5KG6 A;  4DEZ A;  2OCE A;  1BGX T;  3V7K A;  2K4H A;  5J2D A;  2DKX A;  1SB3 C;  8ICV A;  1BNP A;  1ZQH A;  8ICB A;  5K4L A;  2W9C B;  4QW9 A;  3UM9 A;  3BDP A;  2E1F A;  1TE2 A;  9ICN A;  4UB5 A;  1B0X A;  1ZOL A;  2ODG A;  1L6N A;  1D8Y A;  3RB0 A;  8ICW A;  1N62 A;  3MGI A;  3SV3 A;  1SV4 A;  4C7Y A;  5KT5 A;  5CP2 A;  3ZDE A;  4P0Q B;  2KSO A;  4KLT A;  2H3F A;  4AP9 A;  4I28 A;  1J97 A;  1ZQD A;  3B0X A;  4Y2R A;  4QZC A;  5DG8 A;  9ICU A;  2BQR A;  4I2I A;  5KT4 A;  4P4P A;  5ALL A;  2JHD A;  2Y9U A;  4KMU A;  3G6Y A;  8ICT A;  2EZZ A;  3H8S A;  1SL2 A;  3Q8R B;  2JRZ A;  5AI4 A;  4I2E A;  4CCH A;  1L8O A;  4P0P A;  7ICR A;  2ZIV A;  4QZH A;  4F4Z A;  1KQQ A;  4QIW C;  1JMS A;  3KKA A;  3SD7 A;  1IM4 A;  3T5K A;  1QH9 A;  2XVT A;  1NNL A;  5D46 A;  2KIW A;  1BVS A;  2K4P A;  3B0Y A;  1S8O A;  4Q8F A;  1EXN A;  3N97 B;  3CP8 A;  4GLX A;  1TK0 A;  2FMQ A;  4USA A;  2IHN A;  4UB2 A;  3KHH A;  5KG1 A;  1N60 A;  4I27 A;  8ICC A;  4KN7 A;  2B0C A;  2YTU A;  1LKY A;  4F72 A;  4I2D A;  2KVC A;  2W03 A;  5AKK A;  4ZH4 A;  5J0U A;  4KLL A;  5HHH A;  5ALN A;  8ICZ A;  4QZE A;  3LWM A;  9ICR A;  1Z4N A;  2FPK A;  1HJP A;  2G07 A;  3MGH A;  4CF5 A;  1V9P A;  4F5Q A;  3K4G A;  1PVQ A;  1RQN A;  7ICE A;  1RYU A;  3THV A;  4Y2T A;  2AGO A;  4I2C A;  3S6J A;  1ZQB A;  3WU2 U;  3ISB A;  4RPZ A;  5ALF A;  9ICJ A;  3NVW A;  1ZJN A;  7ICM A;  1SXD A;  3BQ7 A;  2XGQ A;  1ZQV A;  3NUQ A;  4GXJ A;  4O3M A;  4FFD A;  9ICA A;  2VA3 A;  4B9T A;  2NYV A;  4QZB A;  2KIC A;  2K8C B;  1DOQ A;  4US9 A;  3LDA A;  5F3X B;  4DQR A;  1ECW A;  1ZQS A;  3A0B U;  4PHA A;  4KLG A;  2AH5 A;  2A1A A;  8ICK A;  3WK8 A;  1TV9 A;  4JUZ A;  1JXE A;  2ZIW B;  4XQ8 A;  2XY7 A;  1PK3 A;  1K1Q A;  2KP7 A;  3E58 A;  3R9K A;  5J29 A;  2BCS A;  7ICJ A;  5FP0 A;  2LI6 A;  2PI5 A;  4CF3 A;  4ECS A;  2R8J A;  3F53 A;  7ICI A;  4YN4 A;  3H8W A;  3GIK A;  5C0Y A;  4KN4 A;  3RJG A;  5IIL A;  3IV6 A;  4M2Y A;  3IP4 B;  2EZY A;  5AI9 A;  3QZ8 A;  3GDX A;  2K4E A;  3C1Y A;  4PPX A;  4QJF B;  4JWN A;  2F8K A;  3EW9 A;  4DL6 A;  1NJY A;  1WCN A;  1JI7 A;  4LZG A;  5DDY A;  2ZTE A;  1NKB A;  2W8K A;  2NRV A;  3HWT A;  4DL3 A;  3KZX A;  4KLI A;  5ALS A;  3QUC A;  2W9B A;  3M6Z A;  3ALR A;  1O08 A;  1L3S A;  1RG6 A;  2Y0S C;  4DF4 A;  2FJ6 A;  2MSN A;  1TKD A;  1N5W A;  2PFP A;  4QZ9 A;  9ICO A;  2C2R A;  3N4M B;  4DSI A;  2FE9 A;  5F9L A;  5KFQ A;  5D4B A;  5KTQ A;  2ZIV B;  2KFZ A;  1GO3 F;  1NK4 A;  3HRD D;  4YG2 A;  1KFS A;  1F0M A;  1ZQW A;  3M9N B;  1COK A;  1ZQJ A;  1DGJ A;  2KKP A;  4EBE A;  4XA5 A;  3D6J A;  1S9F A;  1U45 A;  5L1L A;  1ZQ1 C;  3BS5 A;  4MF2 A;  3AMZ A;  4XUS A;  4NM1 A;  5KFW A;  2PMZ F;  4M6W A;  3PR4 A;  4P0Q A;  2BPC A;  2M9N A;  4M9H A;  2K60 A;  3MAB A;  2KNJ A;  4NLG A;  3ZDB A;  3NAS A;  4TUS A;  2AGP A;  2EQY A;  2LYH A;  2WF8 A;  3GQC A;  7ICL A;  4UB3 A;  2MAX A;  3OJU A;  2GWS A;  1KLN A;  2EAP A;  4IQT A;  4BXO B;  4AYB F;  2ZXI A;  3NS1 A;  7ICQ A;  4DL2 A;  2K8B B;  3QNM A;  2XCA A;  4M9G A;  5AKL A;  4EX6 A;  4Y2U A;  4UAT A;  4JB3 A;  1TAQ A;  1MN8 A;  2ES6 A;  1PVP A;  2ZTD A;  3MC1 A;  4Z6E A;  1Z19 A;  1NZB A;  2MA1 A;  4PJ0 U;  3T5J A;  2P6R A;  1ZQG A;  1UA1 A;  3GV5 B;  4CGZ A;  3VC8 A;  3BJY A;  3WK5 A;  1HUZ A;  2PFQ A;  4YMO A;  5KFJ A;  2V4R A;  2H3V A;  1ZQU A;  3D2N A;  7ICH A;  1ARO P;  3SEI A;  3ZDD A;  4QZI A;  4ECV A;  7ICV A;  3RB4 A;  1CRX A;  3PX6 A;  5J0P A;  2JZB A;  2Y1J A;  4TQS A;  2HHT A;  5E79 U;  5KFU A;  1D8B A;  1VJ5 A;  3O0F A;  3PW0 A;  5J0S A;  5DB6 A;  1YZ6 A;  1KFT A;  5AKJ A;  2ESE A;  4YQW A;  3H4D A;  3T5L A;  5KG5 A;  4OJO A;  2ZIX A;  2LM1 A;  3N7R C;  4PGQ A;  3F5E A;  3ZD8 A;  8ICG A;  1F5S A;  4RT2 A;  4NLN A;  2O6K A;  4XRH A;  3WK7 A;  3M8R A;  3H4B A;  4F5P A;  2V4Q A;  2RLT A;  1DRG A;  4QWA A;  1B4F A;  4OCZ A;  1NK6 A;  5J2F A;  1BPE A;  4GIB A;  2HVI A;  2GLE A;  4C80 A;  3UQ0 A;  5DG7 A;  2RQ5 A;  9ICF A;  2F3N A;  2G5I B;  3BQ2 A;  3TAD A;  9ICB A;  1Z3E B;  2YMM A;  2NO4 A;  4MHV A;  1ZRN A;  3B9J A;  5J2J A;  2I1Q A;  3GIL A;  4Y2P A;  4ED1 A;  4QZF A;  3M1Y A;  4TUQ A;  3C29 A;  4ED7 A;  1UCV A;  4O5E A;  2Q0Z X;  3C5G A;  3PW4 A;  2RDI A;  3IHQ B;  5GTI U;  4Z6D A;  1D9D A;  3MDC A;  4DWI A;  2LYA A;  3HIL A;  2BDU A;  4F4X A;  5BOM A;  3ZDC A;  2B6G A;  5KFH A;  1U9L A;  4KLH A;  5HHI A;  4WJ3 B;  2BHN A;  3QEB Z;  4C0Z A;  4DQI A;  4C4R A;  2LYB A;  2ZXH A;  1D8L A;  4IRD A;  3RRG A;  3F2D A;  2JEG A;  2I5H A;  1ZD2 P;  3GIJ A;  5AK4 A;  4Y2X A;  4YD1 A;  2IOF A;  1NK7 A;  9ICK A;  4EYI B;  3MBY A;  4MF8 A;  1Y88 A;  3IRU A;  5DQI A;  5EOZ A;  4O9M A;  2AGQ A;  2KHV A;  4C4S A;  1X6J A;  5EE1 A;  4KLQ A;  4ZOH C;  5KFB A;  1NOM A;  4OJ5 A;  1JRP A;  1L7P A;  2AQ0 A;  1ZYQ A;  5J0O A;  2IHM A;  2NRW A;  5KFF A;  3RR8 A;  3PW2 A;  3MR2 A;  2QAR B;  3RAX A;  2I6X A;  1J2M A;  3TAN A;  4F71 A;  3HPO A;  2YMQ A;  3M6K A;  1RXV A;  4UQG A;  3GII A;  2PFO A;  3ONN A;  5ALM A;  2ZUD A;  1X9X A;  2KOB A;  1L3V A;  2IA6 A;  1ZQN A;  5AM3 A;  1QSL A;  2IOH A;  2UVV A;  3QUQ A;  9ICS A;  2Y0S F;  9ICL A;  2A1J B;  2HOI A;  4J03 A;  5HR7 A;  2BGW A;  3A0H U;  5AM1 A;  1MQ2 A;  3LVW A;  4DL4 A;  5EE9 A;  4DF8 A;  3PX0 A;  3CNH A;  2HI0 A;  2CXY A;  2F44 A;  4BDP A;  4QZ8 A;  2WAQ F;  1OUQ A;  4FE3 A;  4DSJ A;  3KFU F;  4FZL A;  4UBB A;  2WTF A;  4PZO A;  4R64 A;  1JN3 A;  2BCR A;  1XWL A;  1WCL A;  8ICJ A;  5AM5 A;  3N28 A;  4C8M A;  5AK5 A;  4OJP A;  8ICU A;  1ZRM A;  4EYH B;  2IMW P;  1BNO A;  3RJE A;  3Q8M A;  3NVZ A;  4U6P A;  3QU7 A;  4KIT B;  1S5L U;  8ICA A;  2JMG A;  3EYZ A;  4EEY A;  2J6S A;  4J9P A;  2F2A B;  2WF7 A;  1VLB A;  7ICK A;  1L5U A;  4GC7 A;  1FEZ A;  2JGA A;  5ALG A;  1UHU A;  1ZQC A;  1Q3U A;  4UAW A;  2VJ5 A;  2ZJ5 A;  4IRC A;  5J8Y C;  5KFX A;  2XCP A;  4KLS A;  2BDP A;  2LBO A;  3WK4 A;  1ZQX A;  4MFC A;  3G6V A;  3RRH A;  4UB1 A;  1RYR A;  5AK3 A;  3H8J A;  3OPX A;  5AKH A;  4IL6 U;  7ICN A;  7ICO A;  4TUP A;  2E3T A;  1NZP A;  3QUT A;  4I2B A;  3SI8 A;  2ISO A;  2EAO A;  1TFR A;  2JH1 A;  4R8U A;  3TAR A;  4PGY A;  1JXL A;  1MQ3 A;  2H3I A;  2DBY A;  3EPG A;  4JWM A;  4RNN A;  3V7J A;  4J9O A;  2RP5 A;  5DBA A;  4ICA A;  3QU2 A;  4KLM A;  3M7D A;  1ZQQ A;  3AL0 B;  4FO6 A;  2XY5 A;  3DEE A;  4QWE A;  5AKG A;  3M9M B;  4Q44 A;  1ZQP A;  5ALT A;  3ZI4 A;  1NKC A;  1JUD A;  4F5O A;  7ICU A;  5KFI A;  3GV8 B;  4BWM A;  4IR9 A;  2BCU A;  4M9L A;  1VDV A;  3D2Q A;  1S0N A;  4IQU A;  5AKZ A;  1ZQM A;  2HHX A;  5KL1 B;  4PHP A;  3GV7 B;  4J9L A;  5KFD A;  3JPT A;  5ALP A;  3RTV A;  1N48 A;  3WKA A;  1JAL A;  4NV0 A;  4GC6 A;  2VA2 A;  4M04 A;  9ICW A;  8ICI A;  3CW2 C;  4IRK A;  4QZD A;  1SKS A;  2DPI A;  2ZTC A;  4DSF A;  4G9B A;  4C4T A;  2ZJA A;  4ELT A;  4UBC A;  3EWA A;  2KFN A;  3IN5 A;  4ED3 A;  2GOL A;  5J2H A;  4RQ3 A;  2YML A;  2HBJ A;  1LB2 B;  4YFK A;  3GIM A;  3TFS A;  1X66 A;  1NJX A;  5HR6 A;  5EE0 A;  3C5F A;  3RF9 A;  3H7I A;  1COO A;  1J2N A;  4M0A A;  5DGB A;  3MR6 A;  2Y1I A;  3JPO A;  1X9M A;  3AU6 A;  4RPY A;  2AJQ A;  4FZN A;  5DLF A;  3PMN A;  1ZJM A;  5HML A;  1Z1B A;  2GH1 A;  1QLN A;  1L3T A;  1KKX A;  3V6K A;  9ICX A;  1QQ7 A;  2YB4 A;  4YD2 A;  4US8 A;  2LHT A;  4ED0 A;  2KD1 A;  4DS5 A;  3L3F X;  1N61 A;  3FAH A;  2N1R A;  1BPZ A;  3BZK A;  2W3R A;  5AIC A;  1Q3V A;  4O3N A;  8ICR A;  4Y2Y A;  1S10 A;  1OXJ A;  2FLL A;  5J8Y A;  1NK9 A;  4B9V A;  2LPE A;  2XID A;  3IG8 A;  3HW8 A;  1SKW A;  3PO5 A;  3BQ0 A;  3TQ1 A;  4M9N A;  4FS1 A;  1NJZ A;  4QWC A;  1PK1 B;  5AI8 A;  5AIB A;  8ICN A;  4NL9 A;  4C7Z A;  1ZQL A;  2MU2 A;  3E0F A;  3K1R B;  2XGP A;  1IV8 A;  4F93 B;  1TVA A;  2W43 A;  3QU9 A;  1XSL A;  3OHB A;  3MGV A;  3F5A A;  5AM0 A;  2VAN A;  2DFL A;  4ACO A;  4C8K A;  1C20 A;  4BUG A;  3PX4 A;  3C21 A;  4RQ5 A;  4O3P A;  2KZ3 A;  1DGS A;  2UVW A;  5ALD A;  5KG0 A;  2G09 A;  2LMR A;  2JEF A;  2E8P A;  2JH7 A;  3HT3 A;  5B5E U;  4YXJ A;  1BPB A;  2I9G A;  3SAH A;  1CUK A;  1XSP A;  5DB7 A;  5EE3 A;  3TFR A;  4NM2 A;  2K89 A;  5KT7 A;  1T3N A;  2HDO A;  5KG3 A;  3PW5 A;  3SZ2 A;  2HCF A;  9ICP A;  1IXR A;  1PK1 A;  1KW4 A;  3QX7 A;  2EAM A;  3ED5 A;  1RPL A;  5ALX A;  1Q46 A;  7ICT A;  3H40 A;  5HP4 A;  2BZF A;  3LWL A;  2HHU A;  3PSI A;  3TAD C;  2KKV A;  3AU2 A;  5HMM A;  1SZH A;  3RBE A;  3H0M B;  2ZJ8 A;  1XO0 A;  2XY6 A;  1URJ A;  5AM4 A;  5BPC A;  2EZX A;  4UW9 A;  2YN4 A;  2OM6 A;  5J2E A;  3I28 A;  1X40 A;  1BPD A;  2P35 A;  4QZA A;  4EZ6 A;  4CRX A;  3LVV A;  3RJI A;  4RZR A;  9ICI A;  4F3O A;  4ED8 A;  2J6T A;  3QYP A;  2V9W A;  4IR1 A;  3GZF A;  3UXP A;  1T4G A;  4Y2S A;  1CI4 A;  2XIC A;  2NRT A;  8ICO A;  2FLP A;  8ICM A;  3RH5 A;  1DK3 A;  7ICS A;  5ALE A;  3PV8 A;  4DFD A;  3T5H A;  2Y9T A;  1L7N A;  4UB8 U;  2ASL A;  4RNO A;  2Z7J A;  3RH4 A;  4UAR A;  2D3D A;  5C5J A;  1UT8 A;  3CYM A;  1N2X A;  3SAG A;  4KLO A;  5DQH A;  1UQV A;  4KTQ A;  3LK9 A;  4I2J A;  4YMN A;  4ECQ A;  2W9M A;  4QZG A;  3L4P A;  3JPS A;  1BPY A;  3WKB A;  3M8S A;  2K4I A;  1HEK A;  3G6X A;  2F1I A;  4BJQ A;  2AXT U;  4ED2 A;  4KMO B;  2KJ8 A;  3PVX A;  5KT6 A;  2HBM A;  4PGX A;  5DGA A;  3V6H A;  1ED1 A;  1ZXI A;  2W3S A;  3UXO A;  2OHF A;  5CHG A;  4Q45 A;  3Q8Q B;  3IDW A;  5AHX A;  5JTI A;  3NRZ A;  3GFK B;  3TAC B;  8ICQ A;  3SR6 A;  1L3U A;  4QW8 A;  2ATL A;  5AI6 A;  4O3R A;  3SYZ A;  2KHQ A;  5B66 U;  1SKR A;  4R8U B;  5KFC A;  4CNQ A;  1T8E A;  4F4W A;  1ZQI A;  5KFE A;  4UB4 A;  1TK5 A;  2R8I A;  4BGD A;  2JXJ A;  1ZQE A;  4B9M A;  4I2F A;  3WKD A;  2BPG A;  3AM9 A;  2H3Z A;  3LYS A;  4UAV A;  4Y2Q A;  4F8R A;  2G08 A;  2L5Y A;  5J0T A;  1K5O A;  2LM4 A;  1M6Y A;  4J9K A;  1UT5 A;  2XO7 A;  3M9O B;  2ZUB A;  2PFN A;  3PR5 B;  4F50 A;  2WAQ C;  1A0P A;  3MFH A;  1V38 A;  2OWO A;  2A3V A;  1TAU A;  4C8O A;  3UMG A;  3VCB A;  1FO4 A;  5D49 A;  2WF6 A;  4BWJ A;  1PUZ A;  4F2S A;  3RR7 A;  1PZN A;  3N7P D;  3BQ1 A;  3AN1 A;  5CEH A;  4B9L A;  4R65 A;  3F2C A;  4MEX A;  5J2G A;  1JRO A;  2PMZ C;  5KFT A;  1QTM A;  5KT3 A;  2HOF A;  4ELV A;  4YXM A;  1KN5 A;  4HAI A;  2CN1 A;  4RQ8 A;  3HKZ C;  1K1S A;  4DO9 A;  3RJJ A;  5J2C A;  5AM2 A;  3NTU A;  3RJH A;  1LV5 A;  3DDH A;  2FMP A;  5J0W A;  3KOO A;  3ISD A;  3Q8S B;  4QWD A;  2DPJ A;  4RQ1 A;  5ALV A;  2XC9 A;  2C28 A;  1L7M A;  1UA0 A;  3TKA A;  4OD0 A;  4QNL A;  3HX0 A;  4CDG A;  2YY6 A;  1RXW A;  2KIV A;  2JEJ A;  5JU5 A;  1OW5 A;  1TAM A;  5CRX A;  4ELU A;  1ZD3 A;  2QAR A;  5KFR A;  3L5K A;  3UXN A;  3V7L A;  5BOL A;  1SWV A;  5JRT A;  1RDF A;  3T79 A;  2W7P A;  1T7P A;  4KX5 A;  3V6J A;  4B9U A;  2H5X A;  3QU4 A;  4F91 B;  4NL9 C;  2ALZ A;  4FZM A;  5ALQ A;  2JEI A;  1T94 A;  2W11 A;  2W8L A;  4DFJ A;  4B6J A;  4YMM A;  8ICL A;  3UMB A;  2D8C A;  2AQ4 A;  1F44 A;  1S0V A;  2VIX A;  2OXO A;  2NO5 A;  5AK6 A;  4I2G A;  2IOF K;  4AYB C;  5EWE A;  1O03 A;  2DUY A;  2KK0 A;  1ZQT A;  4J9R A;  3MR3 A;  1UPH A;  4DQQ A;  2DF4 B;  1KRP A;  4OJ6 A;  1FFV A;  2AHO B;  4ECZ A;  5ALJ A;  4DOB A;  5L1I A;  5KFG A;  1U47 A;  2KZZ A;  3UQ2 A;  5KAI U;  4J9S A;  3RB3 A;  2KVS A;  5KFO A;  4G3I A;  4P4O A;  3BS7 A;  1BPX A;  2W7O A;  4YVZ A;  9ICH A;  2PKE A;  3ETR A;  2EAN A;  5CA7 A;  2A19 A;  3JPR A;  1V97 A;  5GTH U;  4PHE A;  1NKE A;  4FBT A;  1U4B A;  4F4K A;  5AIA A;  1SWW A;  3Q8P B;  2JZB B;  3BZC A;  3FYH A;  3TAP A;  3KHR A;  1ZQA A;  1A77 A;  5IIK A;  2H3Q A;  4IS7 A;  3C2K A;  2BPF A;  4PL2 A;  1XO1 A;  4I29 A;  2D6F C;  1QCK A;  2GO7 A;  1YT3 A;  4Q8E A;  8ICH A;  4YCX A;  4F2R A;  3QUB A;  4UAY A;  3PSP A;  2HHV A;  2WF5 A;  1QQ5 A;  1QSY A;  5IIO A;  4FBU A;  2M0N A;  5ALZ A;  4ECY A;  1XSN A;  4EEL A;  3NGD A;  4TUR A;  4DFP A;  3TI0 A;  2HHQ A;  1SL0 A;  1ZD5 A;  4NLZ A;  2DQN B;  3OGU A;  4B9S A;  1X9W A;  4BXO A;  2K8A A;  4JV2 A;  4O3O A;  4EBD A;  3JPN A;  3C23 A;  4ED6 A;  3AUO A;  1HUO A;  4LZD A;  4OO1 J;  2E8O A;  1RZT A;  3SQI A;  4RQM A;  4BX9 C;  2KJ9 A;  2YB1 A;  2DKZ A;  4MEY A;  4O3S A;  1ZQK A;  3C28 A;  8ICY A;  4M9J A;  4EEN A;  2JR5 A;  5HNK A;  3RH6 A;  4P2H A;  4DOA A;  3EPI A;  2ZG6 A;  2G06 A;  1DXS A;  2F8L A;  4RU9 A;  2C2E A;  1X2I A;  9ICG A;  3KHL A;  3DV9 A;  4K4I A;  1LKY B;  4PHD A;  2CPR A;  2QB1 A;  5L9X A;  4YR2 A;  4MFF A;  2P66 A;  3BQT A;  2ZUC A;  4ECT A;  5J0X A;  2R8G A;  4CF4 A;  3FM9 A;  1FFU A;  5KFM A;  3AQE A;  4A8E A;  5DBB A;  1MC8 A;  4ECX A;  4F92 B;  2R8K A;  5AI5 A;  2BKE A;  5TZV A;  4F5N A;  2W55 A;  2LKY A;  5ALH A;  5F9N A;  2BCQ A;  7ICP A;  4J9N A;  1B43 A;  1X6I A;  2WB1 C;  3WK6 A;  2F76 X;  4GXK A;  1FIQ A;  4KLE A;  4YR3 A;  2NRX A;  4HYK A;  4UAS A;  4O0I A;  3C2M A;  4DQS A;  7ICG A;  5AKE A;  3EZ5 A;  2KV2 A;  2ZIU A;  1L8L A;  4NJ8 A;  4CE6 A;  4IQV A;  3KD3 A;  4U7C A;  1D9F A;  3PZP A;  1XU4 A;  4F5R A;  1LVH A;  1KFD A;  3ETL A;  2KMD A;  4NLK A;  1RYS A;  5ALR A;  3MDA A;  4RQ0 A;  2E5S A;  3N7S C;  3H8M A;  4KLJ A;  4MFA A;  9ICT A;  2NV3 A;  3CRX A;  2ASD A;  3AQF A;  4DSK A;  9ICQ A;  2C2D A;  1ZQZ A;  4UAU A;  4Y2V A;  1ZQF A;  4RNM A;  4X5V A;  2FDR A;  5H2F U;  2VA8 A;  3RBD A;  1ZET A;  1T3Q A;  1SIJ A;  3UPQ A;  4DCC A;  5J2K A;  4O5C A;  3D2S A;  1WUD A;  4YP3 A;  3SMV A;  1Z1V A;  3NVY A;  3PSF A;  3HKZ F;  2W9B B;  4J9Q A;  4EZ9 A;  1N5X A;  2RHF A;  2RRD A;  5KFZ A;  4GXI A;  5KNI A;  3KTQ A;  3WK9 A;  1WWV A;  5IIJ A;  3U26 A;  2E8N A;  2G5H B;  2HW3 A;  4ECW A;  5J0Q A;  1NK5 A;  5L1K A;  5III A;  3K75 D;  1ZQY A;  7ICF A;  4Y2J A;  3RB6 A;  4NXZ A;  4UB6 U;  8ICP A;  4RUA A;  3AEV A;  1KDH A;  1A6S A;  4K4H A;  4JMU A;  4P4M A;  2HBL A;  5AKX A;  4PZN A;  2ZIX B;  1WYG A;  2WF9 A;  4NY8 A;  1SGG A;  1KL9 A;  2J6U A;  2ZIW A;  3NVV A;  4TQR A;  2HSZ A;  3OSN A;  1QQ6 A;  3K1Z A;  5TIS U;  2BQ3 A;  2BQU A;  3MR5 A;  4NWI A;  5ALW A;  3PNC A;  3ORY A;  3OHA A;  2HVH A;  4Q43 A;  3EUB 2;  2F1J A;  1H38 A;  4B9N A;  1V85 A;  4PL1 A;  2VJ4 A;  3RFA A;  5KAF U;  5IIN A;  5L1J A;  4I2H A;  5KFL A;  1JIH A;  5KL8 B;  3PO4 A;  4NLC A;  2KTQ A;  5KFV A;  4OJL A;  2QB0 B;  4DSL A;  2JV3 A;  3QE9 Y;  4EX7 A;  9ICM A;  3C2L A;  5ALO A;  1XC9 A;  5ALI A;  5JUM A;  2KG5 A;  3IM1 A;  8ICS A;  3Q8L A;  9ICV A;  3ICX A;  5KFA A;  2EDU A;  2OEH A;  4LVS A;  5G5G A;  1S77 D;  4P0P B;  4K4G A;  3QZ7 A;  4EBC A;  2W9A A;  4Z6C A;  5DB9 A;  2G0A A;  2KEY A;  4DFK A;  5DLG A;  5IIM A;  1MA7 A;  2HBK A;  4KLF A;  4R63 A;  8ICX A;  2WFA A;  2YX8 A;  4RQ4 A;  1KBU A;  8ICE A;  4DL5 A;  3I76 A;  1ZQR A;  2A1J A;  4DOC A;  1PVR A;  4ECR A;  1RM6 C;  5DB8 A;  2UVU A;  4E0D A;  2QLT A;  1U49 A;  1HIW A;  3RJF A;  3GU3 A;  3QXG A;  4KLD A;  5J0Y A;  1S97 A;  2HMX A;  4RT3 A;  2ZIU B;  5AI0 A;  1NK8 A;  9ICE A;  3NRW A;  2FLN A;  1ZQO A;  3E2E A;  5KFP A;  5ALU A;  5DQG A;  4FS2 A;  1DK2 A;  4YR0 A;  2RDJ A;  1RQL A;  5L1M A;  5KFN A;  1KSP A;  3FDS A;  4M6W B;  5DG9 A;  2NRZ A;  2FPM A;  4UAZ A;  1NK0 A;  1S76 D;  5J2I A;  1X42 A;  1IG6 A;  1MSW D;  4RQ6 A;  1AQ6 A;  2DWQ A;  2FI1 A;  4JV1 A;  4DLG A;  3Q8K A;  3BS5 B;  1KEJ A;  2F1H A;  3HJE A;  3F2B A;  2WB1 F;  4DFM A;  2W9C A;  4C8N A;  1CEZ A;  5DDM A;  3KHG A;  3ZD9 A;  3IG5 A;  2E1E A;  2KJ5 A;  1B22 A;  4O3Q A;  5KFY A;  4RQ7 A;  3JPP A;  5DKW A;  2MRL A;  2W54 A;  1KTQ A;  4DQP A;  1S0M A;  4RQN A;  1ZD4 A;  1Z00 A;  1SZP A;  2YQE A;  5G5H A;  2DGZ A;  2R8H A;  4Z6F A;  2EH9 A; 
#chains in the Genus database with same CATH homology
 2QB0 B;  1SXE A;  2JV3 A;  2QKQ A;  2E8O A;  1UQV A;  4RQM A;  1SV0 A;  1PK3 A;  1WWU A;  2KG5 A;  2DKZ A;  2KSO B;  3KKA A;  1B4F A;  2K60 A;  2QAR B;  1DXS A;  1Z1V A;  2GLE A;  2K4P A;  1PK1 A;  3BS7 A;  1KW4 A;  2F3N A;  2EAO A;  3TAD A;  2EAM A;  1LKY B;  2DL0 A;  2EAP A;  2QB1 A;  4MHV A;  1X9X A;  2EAN A;  3TAD C;  5KNI A;  3IDW A;  2YTU A;  2DKX A;  1UCV A;  1LKY A;  2F8K A;  1WWV A;  2ES6 A;  2E8N A;  1JI7 A;  5JTI A;  3TAC B;  1OXJ A;  3HIL A;  5J8Y A;  2LPE A;  1B0X A;  2F44 A;  4IS7 A;  5L1M A;  1SV0 C;  4PZO A;  1PK1 B;  2QB0 A;  1X40 A;  2KIV A;  2B6G A;  1SV4 A;  5JU5 A;  3KKA C;  1OW5 A;  1RG6 A;  2QAR A;  3SEI A;  2E8M A;  4NL9 A;  4PZN A;  5JRT A;  3BS5 B;  3K1R B;  1SGG A;  2KSO A;  4NJ8 A;  2FE9 A;  3SEN A;  2L5Y A;  4NL9 C;  1SXD A;  3BQ7 A;  1F0M A;  2KMD A;  2Y9U A;  1COK A;  2D8C A;  2KE7 A;  1V38 A;  3H8M A;  2ESE A;  5F3X B;  1V85 A;  3BS5 A;  4RQN A;  2Y9T A;  2LMR A;  1X66 A;  2D3D A;  2E8P A;  5J8Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...