1WWVA

Solution structure of the sam domain of human connector enhancer of ksr-like protein cnk1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGMEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Connector enhancer of kinase suppressor of ras 1
publication title Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1wwvA00
2QB0A 2LPEA 2ESEA 3K1RB 2DKXA 1OW5A 1KW4A 2F8KA 2KMDA 3TADC 1B4FA 1SV0A 4IS7A 3KKAA 1RG6A 1COKA 2FE9A 2ES6A 1X40A 2QARA 5J8YA 2Y9TA 2LMRA 2KE7A 5L1MA 1B0XA 2EAOA 1SV4A 1SXEA 4NL9A 1PK1B 4MHVA 1X9XA 2E8MA 1F0MA 2EAPA 2Y9UA 1SGGA 3KKAC 4PZNA 3H8MA 1V85A 2E8PA 1LKYB 2KIVA 2KG5A 3BS7A 2YTUA 3HILA 5JU5A 2KSOB 2QB1A 1SXDA 1X66A 1Z1VA 1OXJA 4PZOA 2GLEA 4NL9C 2K4PA 3TADA 2EANA 3TACB 3IDWA 3BQ7A 2JV3A 1PK3A 1SV0C 3BS5B 5KNIA 2D8CA 2F44A 1JI7A 2QB0B 2QKQA 5JTIA 5JRTA 1WWVA 3SEIA 5J8YC 1LKYA 2F3NA 5F3XB 2DL0A 1DXSA 1UQVA 4RQMA 2K60A 2KSOA 1UCVA 1WWUA 2B6GA 2QARB 1PK1A 2D3DA 2EAMA 4RQNA 3SENA 2E8OA 4NJ8A 2DKZA 1V38A 2E8NA 3BS5A 2L5YA
chains in the Genus database with same CATH superfamily
2QB0A 3Q8RB 1S8OA 2NRVA 2DPJA 5CP2A 8ICTA 5D4BA 3LVVA 4AP9A 3C2LA 1ZQCA 2XGQA 4F92B 1F5SA 8ICSA 5J2JA 3PMNA 5CHGA 3BZCA 3DEEA 2GWSA 3F2BA 8ICAA 4R64A 9ICCA 3MR2A 4ED2A 1FFVA 2MAXA 4PHEA 3V6KA 5F9NA 5AM2A 4P0PB 1S10A 2ZTDA 3NTUA 4KLIA 3MABA 5KFMA 5KFNA 4C4RA 1Z4NA 5HR7A 2H3VA 2KIVA 4I2IA 8ICYA 2LHTA 2LM4A 5JU5A 5A0LA 9ICQA 5KFBA 2IMWP 1SXDA 3M9MB 4P4PA 2G07A 9ICSA 8ICIA 1KSPA 3BJYA 2UVWA 1KFTA 2JH1A 3KBBA 1ZQGA 3BQ7A 5J2CA 3GV7B 2FI1A 3RRGA 2D8CA 3PSFA 2F44A 1JX4A 1NZBA 3F53A 3JPNA 2DWQA 2V4QA 4DFDA 2IBKA 2LYAA 1BVSA 1T94A 5DDMA 2JXJA 1DOQA 4NLBA 2YMPA 4QWDA 2RLTA 3SI8A 5EOZA 3UXPA 5IIMA 5BPCA 1NZPA 1HUZA 1NOMA 5KFLA 8ICRA 4IQWA 2QARB 4KMUA 5K4LA 4YCXA 5KTQA 4Q45A 3M8RA 3RR8A 4GC7A 3M6KA 5J0WA 5KAIU 2ZJ8A 2JRZA 1N60A 2C22A 4QZ9A 3Q8SB 3UPQA 3M7DA 4Z6FA 5KT5A 3NUQA 4QZFA 1O08A 3V6HA 3WK4A 8ICCA 4I2JA 3U26A 4OJLA 5CB1A 5AI0A 5J2IA 2WTFA 1DRGA 4YXJA 2I1QA 4JV0A 3ETLA 4EX7A 2KJ9A 4CNQA 3B0XA 7ICTA 2J6TA 1TE2A 5DG7A 1B0XA 1SV4A 4KLGA 3CYMA 1JMSA 2VJ5A 1ZQDA 4G9BA 1H38A 2XCPA 3G6VA 1Z00A 2E8MA 1V97A 5GTIU 4UB2A 2KKPA 3MFIA 2WF7A 2HVIA 3UMGA 1ZRMA 4C8NA 3WKCA 5KFWA 5AK4A 4C8KA 1PVPA 4QWCA 1RYRA 2K4IA 3LWMA 1A76A 1SL2A 4KLOA 1S76D 1IG6A 4ED6A 4R63A 4MFAA 1XNSA 3ISBA 5J0QA 3AL0B 5JTIA 2YMLA 3SV4A 1ZQZA 3RJIA 4JK1A 3QEAZ 2PI5A 2GOLA 1BNPA 2JZBB 2W55A 1BPXA 2EAMA 2F1JA 4B6JA 2K8AA 2JEIA 4QZCA 4ED7A 3RAQA 3PW0A 2P66A 4PHDA 5D46A 5ALPA 1BPBA 2MUTA 5EWFA 3NGDA 2N1RA 3HKZF 4FBTA 5KFAA 3HPOA 3I28A 2WHEA 2O6KA 3QU5A 7ICRA 1T8EA 2BQRA 4ELTA 2V9WA 4TURA 3HJEA 2P6UA 3DDHA 2BPGA 1RG6A 3T5LA 4YP3A 3HP6A 2HOQA 4UBCA 4GFJA 2ZTCA 2ZTEA 3QUTA 1L8OA 3FM9A 2KE7A 1QH9A 2ZUCA 1MA7A 9ICPA 2ZIUB 2VJ4A 2WFAA 3UQ2A 3N7PD 4UB5A 5J2AA 4KN4A 2BZFA 4QNLA 1BPYA 2YTUA 2K4EA 3OJSA 1OUQA 3F2DA 1TK0A 5CR0A 1QLNA 2QB1A 4Q8FA 4GXIA 4UAVA 3SAHA 4PZOA 2BCSA 4KLFA 2HDOA 4TUQA 3H8JA 5DQIA 9ICFA 2P6RA 5KG7A 1KKXA 2FPKA 5AI9A 9ICOA 1SWVA 4Y2PA 2LBOA 3MFHA 2BCVA 5DB6A 3T5HA 4QZ8A 5AKEA 4OJ5A 3C2KA 5AK5A 8ICHA 1ZQVA 1YT3A 5ALFA 2BR0A 5EE9A 5KFRA 5KFPA 3I76A 2NO4A 4IRKA 3KHHA 5AHXA 3CP8A 2ATLA 1L6NA 4F2RA 1URJA 5KFHA 3D2QA 5B66U 2E1FA 5DBCA 3RAXA 1RQNA 2GO7A 5ALHA 1L8LA 3D2NA 3PVXA 2BPFA 4F4KA 5HMLA 2DKXA 4EX6A 2KMDA 9ICNA 3RR7A 5KFQA 2OEHA 2K8BB 3RTVA 3GQCA 4DS5A 5KFVA 2HBKA 4Q44A 1JN3A 2R8HA 2YMQA 2KP7A 3C23A 4JUZA 4MEXA 2I9GA 4EYHB 1VDVA 2HHXA 4ECXA 2W9CB 5AI4A 5EE1A 4MF8A 3TFSA 1SGGA 1U9LA 3VCBA 2MU2A 2NYVA 4DOCA 3BS7A 3MDAA 8ICXA 2XO7A 1Q3VA 3RF9A 2KSOB 4RPYA 4FE3A 4J9SA 3GILA 4NLCA 3ZDDA 3PW5A 1ZQJA 4FS1A 4IRDA 2ALZA 5HR6A 4B9TA 1NK9A 5KFFA 2AQ4A 3EPGA 2HSZA 2W3RA 5AK6A 4RQ6A 2ZJ5A 3TAQA 3OJUA 2JMGA 5DB8A 4J9NA 1U48A 2E5SA 1KN5A 2EQYA 3F2CA 1MC8A 3N7SC 2ZUBA 7ICHA 3N7RC 3GFKB 3H40A 8ICEA 1WUDA 1N2XA 4RQ3A 4KN7A 5G5HA 1A77A 1KTQA 5AKKA 2HBMA 4Y2JA 2Y1JA 4BDPA 4EZ6A 3AU2A 4J9LA 4EZ9A 9ICBA 1AQ6A 3BQ1A 1ZQEA 2OCEA 3H8WA 3C28A 3RB3A 5KG6A 4M9NA 1SKRA 2FE9A 5KT6A 3AM9A 1N48A 2BDPA 2A1JB 4F5NA 2K4HA 2QARA 4DQIA 2A3VA 4QW9A 1Z1BA 1NK5A 4NL9A 4UB8U 5J0XA 2OH2A 3MC1A 4YN4A 4BXOB 1X9XA 1TAQA 1XU4A 4KLHA 4C7YA 2IHNA 2VA2A 1N56A 4M2YA 3G6XA 2BCQA 2IA6A 1V85A 2XI9A 4OO1J 3Q8PB 2H5XA 3ZD9A 2WF5A 1JROA 5TZVA 4YG2A 4UB1A 4F5RA 5ALKA 3GZFA 1ZQTA 3IN5A 5J2KA 1TVAA 2KN7A 5KFEA 5HNKA 5ALOA 2JEGA 4P2HA 3L3FX 1LB2B 4GLXA 4MEYA 1JI7A 4Y2XA 4UAUA 3C1ZA 4JV1A 1KRPA 4C4TA 1WG8A 4B9MA 1UA1A 4KLLA 5KG5A 2WF8A 4EBEA 2QLTA 2BPCA 4Y2UA 3H8SA 1QSLA 3I1YA 5EWGA 3KHRA 1D8YA 1IIPA 4K4HA 4R8UB 4RQNA 2UVRA 1VLBA 2KOBA 3AQFA 4B9LA 4J9MA 5DG9A 5G5GA 3OHAA 2V4RA 7ICOA 2ESEA 4UW9A 3QU4A 3QEBZ 4EEYA 1OW5A 2KVCA 3TADC 4M47A 4F8RA 4YMOA 3F5EA 8ICNA 4OD0A 3OHBA 2JZBA 5KG0A 4DFKA 1COKA 4C8OA 3N4MB 4KLEA 4EYIB 5KFOA 9ICMA 1C7YA 5AKGA 2FJ6A 1XSLA 2LMRA 3Q8QB 2LI6A 3C1YA 1C20A 1SXEA 3OPXA 5KL1B 2XY6A 4ELVA 2JR5A 5IINA 7ICFA 2W11A 4FS2A 1J97A 2RP5A 4QJFB 1ZYQA 2UVUA 2A19A 4KITB 4B9SA 4RQ0A 3PSTA 2W7OA 5CWRA 3JPTA 3QNMA 1UT5A 3HILA 5ALMA 3TANA 1U45A 2PMZF 1ZQOA 4I29A 8ICFA 2MSNA 1B43A 4CF5A 4QWBA 4C7ZA 3H0LB 4GXKA 1N63A 2RDIA 3RFAA 2J6UA 2HOFA 4DF4A 3ZD8A 2ZIUA 1XC9A 1SIJA 1SV0C 4O5CA 4YQWA 4QZIA 1L3TA 1X42A 2HCFA 5IIKA 3V7LA 2PKEA 1WWVA 3MR5A 4DL6A 3FDSA 1JXLA 3M8SA 4ICAA 5KFKA 1JXEA 3AN1A 9ICWA 2KZZA 3PZPA 1L5UA 2H3ZA 3ZDAA 4XUSA 4RNNA 4I2CA 1JUDA 3TI0A 3SENA 5EE3A 3ED5A 1KLNA 3ALRA 4F5PA 4DSJA 2KJ8A 2F1HA 1ZQYA 1TV9A 1HEKA 2H3IA 8ICPA 4KLUA 2YY6A 2KKVA 1A6SA 4MFCA 4NM2A 1NK8A 4TUPA 5L1LA 2EZZA 4ECSA 4US8A 4NV0A 4O3RA 1Z19A 2WF9A 1Q8KA 2M9NA 3PO5A 8ICLA 4RQ1A 2G5HB 3M9OB 2LKYA 2ZIWB 8ICVA 2XY7A 4OJ6A 2LM1A 3BDPA 2Y9UA 2RDJA 2NRTA 4BGDA 2WAQF 4J9PA 1LKYB 5T14A 4PGXA 3HRDD 5L1JA 4B9NA 4B9VA 7ICPA 3Q8KA 4HYKA 5KFYA 4RUCA 3T5KA 4DSKA 4LZDA 2FPMA 1O03A 1CRXA 4DSFA 2VIXA 4O5EA 3EYZA 2ZUDA 4FO6A 4OJPA 2AU0A 5DBBA 2W9CA 3RH6A 1QTMA 4CDGA 5JRTA 3SV3A 2ZIXA 5C5JA 1Y88A 4F4YA 2Z7JA 3B0YA 3AUOA 1IXRA 3QYPA 1DXSA 3NRZA 2K60A 2KSOA 1Q46A 4PGQA 2J6SA 1NKBA 4ED0A 3H0RB 2G08A 3CRXA 3RJKA 2PMZC 4B9UA 3RB0A 4RT3A 3BQTA 1ZQXA 5CEHA 2E8NA 3RJFA 4LZGA 5KFSA 5F9LA 2R8KA 1XS9D 4C8LA 5KAFU 1KW4A 2F8KA 4XQ8A 5EE0A 3WK8A 3A0BU 4RQ2A 7ICSA 3KKAA 3UQ0A 4GC6A 4MFFA 2OYYA 2KZMA 2FLPA 5AKJA 3RJEA 4NY8A 3OSPA 1TKDA 2VA3A 4PL2A 1ZQLA 4QZBA 4RPZA 8ICJA 4O5KA 1JALA 5AI6A 3ZI4A 5AI5A 3RB6A 2EZYA 1K1SA 2PXIA 1M6YA 4UAYA 3MGHA 5DQGA 2EAPA 2K89A 2BDUA 3PW7A 3M6ZA 2AGOA 4KTQA 3PMLA 9ICGA 3TFRA 5KFUA 8ICQA 2B21A 3Q8LA 2G09A 2A1JA 1ZOLA 4UAZA 3S6JA 4IC9A 1A0PA 8ICKA 4M04A 4F91B 1RPLA 5KG3A 3PY8A 2WB1F 4IQUA 4QZGA 3O0FA 2C2EA 1RXWA 2W04A 4BXOA 2QKQA 3RB4A 4ED1A 4X5VA 4Y2VA 3IG5A 4F5OA 2HHTA 7ICEA 1ZQNA 1N5WA 5DDYA 2HOIA 3PNCA 3WU2U 4AYBF 1J2MA 2WAQC 1UCVA 1L3SA 4IL6U 5KFTA 2Q0ZX 1WWUA 2NRWA 2B6GA 2C2DA 5CRXA 4QZDA 5AM1A 1PK1A 3ISCA 4NJ8A 1FIQA 4FZMA 4DOAA 1L3VA 5KFDA 1B22A 2CN1A 4F72A 2XGPA 2W9BB 3KTQA 3TARA 4DQSA 1PZNA 2KD1A 5FP0A 4DL5A 2R8IA 1Q3UA 7ICMA 5IIIA 4KLMA 8ICBA 8ICOA 3F5AA 7ICGA 2JH7A 1X40A 2KZ3A 3B9JA 5J0TA 2W8LA 1NK6A 5HHHA 4R8UA 2YB4A 4DLGA 1T3QA 4ECRA 2FDRA 4PH5A 2E1EA 4KX5A 4IR1A 4BUGA 4ECTA 3T5JA 4YD1A 2UVVA 1KL9A 4Y2QA 3GIIA 1BNOA 2HBJA 5EWEA 5DKWA 3NVVA 2F1IA 2ZJAA 1ZD4A 4I2AA 3KZIU 4OJOA 5DG8A 3PO4A 2GLEA 4CF3A 3C5FA 4DQPA 1SL1A 2W8KA 3WK5A 5ALVA 4DWIA 4M0AA 2JV3A 3CNHA 3KHGA 2Q4TA 4YVZA 1RDFA 2R8JA 1UHUA 5KT2A 4O3NA 3RJHA 3BQ0A 2KTQA 2FPLA 3T79A 3THVA 9ICKA 4QWAA 1Z00B 4FZLA 4CCHA 5BOLA 3JPRA 5KG4A 5ALDA 4K4IA 1XO0A 3GU3A 1UPHA 9ICTA 3H0MB 4P0PA 3QE9Y 2DBYA 3OTQA 3ZDEA 5AM4A 3RBEA 1Z4OA 2D6FC 4F5QA 4R66A 4ED3A 3K1RB 2KHVA 3V6JA 9ICXA 1XO1A 5L1IA 3PSPA 4MF2A 3PX4A 1TAMA 2WB1C 4PJ0U 3KOOA 2E3TA 1B4FA 3UMBA 3QU7A 4F93B 1QQ6A 4FBUA 1QSYA 4NM1A 4ECYA 4DF8A 2KFZA 1ZQPA 2P35A 4I2DA 3JPPA 2W9AA 2CXYA 2W3SA 4AYBC 3CW2C 5HMMA 4ECUA 1S9FA 4P0QB 4DL4A 2EAOA 1SL0A 2KHQA 4RT2A 5ALLA 4KLQA 4BJQA 1EXNA 5DQHA 4RQ4A 3NVYA 3KHLA 4UAWA 4R65A 2VKQA 1N61A 2I6XA 5J2FA 4M9JA 2B0CA 4G3IA 9ICLA 2KG5A 5L9XA 7ICNA 9ICVA 4Z6DA 1P7DA 4PGYA 5KFXA 1Z1VA 3IM1A 2CRXA 4JV2A 9ICUA 1WCNA 4NL9C 2LYBA 3SR6A 2XVTA 8ICWA 1JRPA 4O0IA 2ODGA 3IV6A 4IQTA 5ALQA 4EELA 4KMOB 4PHAA 3A0HU 5AKZA 3BS5B 1D8LA 4DEZA 2ZIWA 3LK9A 4KLSA 5J8YC 5DB7A 4Q8EA 1LKYA 4O3QA 3RJGA 1TAUA 1DK2A 5GTHU 5IILA 4O3MA 2OHFA 4I2HA 3RRHA 3C2MA 1ZD3A 4DOBA 1L7MA 4JWMA 5CJ7A 3KFUF 3PX6A 2D3DA 2HVHA 5DGBA 1V9PA 5ALZA 2DKZA 2BKEA 3GIJA 4PL1A 2XICA 3HT3A 4UBBA 4YMNA 1ZJMA 4J9RA 2LPEA 4IRCA 5TISU 1QQ5A 1X2IA 3GIKA 2OM6A 4M9LA 4KLDA 3FC4A 3MR6A 1GO3F 1TFRA 9ICHA 5AM0A 3J81j 4TQRA 4ZH4A 4E0DA 2Y9TA 5KFCA 2BQ3A 5J2EA 1S5LU 4C4SA 4IR9A 4A8EA 1ZD5A 1N5XA 4NWIA 2ZXHA 4MHVA 1ZQWA 5AICA 4DFJA 1ZQBA 3ZDBA 3K1ZA 5CA7A 3BQ2A 2W7PA 4JB3A 3QZ7A 1S77D 3K75D 5KT7A 1X9MA 1RXVA 5KFJA 2DGZA 2KNJA 3H7IA 5AKHA 4F4ZA 3ORYA 3LWLA 4TQSA 1X66A 3RJJA 5AI8A 1OXJA 7ICUA 7ICKA 1L3UA 5J2HA 2ASDA 1NK0A 3IP4B 3TADA 3TACB 1IM4A 4UATA 2ISOA 5ALJA 3UMCA 2R8GA 4QW8A 4I2BA 1X6IA 1D8BA 4DSLA 1FEZA 4RQ5A 1MQ3A 4YFKA 5AIBA 3M9NB 4C0ZA 2EZXA 2Y0SF 3GIMA 4J03A 5KFZA 2ZIVB 1BPEA 2DF4B 1X6JA 4XA5A 4GXJA 2XY5A 1T4GA 1S0MA 3FYHA 4I2FA 3FAHA 4I27A 3E58A 8ICUA 2E8OA 8ICZA 3QUQA 3V72A 4RNOA 5C0YA 4GIBA 5IIJA 5HHIA 2G0AA 2HMXA 4USAA 1KFDA 2DUYA 2DPIA 9ICEA 3PR5B 1SV0A 4IQVA 5H2FU 2HW3A 4IS7A 2F77X 2NO5A 4C8MA 2NV3A 4US9A 3IHQB 4M9GA 3PR4A 1QCKA 4RNMA 3AU6A 1SZPA 2FMSA 9ICAA 1MSWD 4DFMA 4PPXA 4J9QA 3ETRA 1HIWA 2W9BA 3EZ5A 1YZ7A 1SB3C 2LYHA 4Y2SA 2AGPA 1L7OA 3QU9A 5J2BA 3V7JA 2FLLA 2DQNB 4JMUA 4DCCA 1ZQ1C 3G6YA 3WK9A 2ZG6A 3R9KA 1SWWA 5ALYA 3WKEA 2EANA 3EUB2 1CUKA 3IDWA 2NRXA 1PK3A 3HX0A 2ISPA 1J2NA 3GV8B 3PW2A 5JUMA 2HHSA 2IHMA 2BHNA 3LVWA 3EPIA 3OSNA 2KFNA 4Y2YA 5KFGA 5ALTA 3NVWA 5KG2A 4RQMA 4U6PA 2IOFA 4YR0A 7ICQA 1X9WA 4Y2RA 2PFQA 2KEYA 4K4GA 1NJXA 3KD3A 1TK8A 4CE6A 1BPZA 2XC9A 1NK7A 3WK6A 5KFIA 2NRZA 1L7PA 1RM6C 5ALSA 3WK7A 2AJQA 5AM3A 5AM5A 4ACOA 1KEJA 2Y0SC 2A1AA 2HI0A 2YN4A 4TUSA 2I5HA 1LVHA 3QUBA 9ICJA 2ASJA 3T3FA 4DLEA 2AGQA 4DSIA 1T7PA 4ECWA 3PV8A 2AXTU 2YX8A 3UM9A 5D49A 1DGJA 3RH5A 1ED1A 1WYGA 2IOHA 1F0MA 4ECVA 3WKBA 3KKAC 4PZNA 5J29A 1RYSA 1ZQIA 1YZ6A 1COOA 1ZJNA 2BGWA 1CI4A 4M6WB 2EDUA 1D9DA 4CF4A 1ZQQA 3ZDCA 4RQ8A 2MA1A 4UARA 4C80A 4RQ7A 3C5GA 4F2SA 1ECWA 4P0QA 4O9MA 1BGXT 1NNLA 3NRWA 5J0RA 2ZXIA 7ICLA 2WF6A 5KNIA 1ZD2P 1AROP 1NJYA 2QB0B 1PVQA 4LVSA 1KFSA 5ALWA 3SEIA 3BZKA 1QQ7A 2KIWA 5J0UA 3GV5B 2DL0A 1U49A 3NS1A 2PFOA 1VJ5A 5J2GA 4ED8A 5J0OA 4RUAA 3EW9A 2KV2A 3JPQA 3MR3A 2YB1A 1U4BA 2XCAA 2BCRA 3NASA 3BS5A 3RBDA 2KJ5A 4HAIA 4EEKA 1F44A 2YMMA 3L5KA 5B5EU 4DQRA 2F76X 5AK3A 4O3OA 1SKSA 3SAFA 4QIWF 3MDCA 1ZQFA 4JWNA 2PFPA 3D6JA 1ZQHA 4FZNA 2BCUA 4PHPA 3JPSA 3ONNA 2K8CB 4UB3A 4ECQA 3M1YA 4BWJA 4DL3A 2GH1A 4J9OA 2CPRA 1UT8A 2HHWA 3QUCA 4KLJA 5BOMA 4KLTA 5ALIA 4YXMA 1D9FA 5ALEA 2KVSA 5HP4A 4NLNA 3TAPA 5AKIA 1BPDA 2MRLA 1PVRA 4YMMA 4F3OA 1K1QA 4YR3A 5ALXA 2K4PA 3IG8A 4UQGA 3SYZA 3HW8A 5L1KA 3LDAA 1S97A 2G06A 1JIHA 4RU9A 4I28A 4M9HA 1XSPA 1ZXIA 1FO4A 2F3NA 4KX3A 1ZQMA 5F3XB 4UB4A 4I2EA 4QZAA 2HHQA 1UA0A 1UQVA 2FMQA 4F71A 4NLZA 3Q8MA 2AQ0A 5DBAA 4I2GA 4OCZA 3WKAA 3GDXA 2PI4A 2G5IB 1ZRNA 4NLGA 3ISDA 1X9SA 1Z3EB 4DS4A 1ZQKA 4O3SA 4EBCA 1S0OA 1MN8A 4DQQA 2JEJA 4EBDA 1FFUA 4Y2TA 2BQUA 2ZIVA 1CEZA 2Y1IA 1DK3A 1L7NA 1RZTA 3D2SA 2H3FA 3UXOA 4BX9C 3QU2A 2ZIXB 4NXZA 3HKZC 1SKWA 4BWMA 3OGUA 2ES6A 1NKEA 9ICIA 3UXNA 1ZQUA 2W54A 5DLFA 4Z6EA 3H4DA 5KT4A 5ALNA 3SMVA 2W03A 4RPXA 5AIAA 2IOFK 1ZQSA 4LJXA 1WCLA 2EH9A 1ZQAA 1NJZA 4DL2A 1XWLA 1MQ2A 3AQEA 1HJPA 2RQ5A 5AKYA 2AH5A 2E8PA 2C28A 1T3NA 3TQ1A 3V7KA 3LYSA 4QIWC 3PW4A 4XRHA 5AKXA 3WKDA 3VC8A 3SZ2A 2OWOA 3DV9A 2KICA 4F4WA 1RQLA 2OXOA 2MUTB 1HUOA 5KT3A 2JEFA 4U7CA 3EWAA 5ALGA 2HBLA 3AMZA 2FMPA 4RZRA 3HWTA 2KK0A 3C21A 3KZXA 4ZOHC 3N28A 3PX0A 3N97B 3SD7A 2R18A 5J0YA 3QXGA 2DFLA 5ALUA 5IIOA 3H4BA 4EENA 1NK4A 4NLKA 4UASA 3SQIA 8ICMA 4DSEA 5E79U 4P4OA 2FLNA 1NI3A 2JHDA 4O3PA 3AEVA 3QZ8A 3C29A 1N62A 2ASLA 3E2EA 3MGIA 2L5YA 4P4MA 5DLGA 4FFDA 2VA8A 4ECZA 2F8LA 4WJ3B 1KDHA 4J9KA 2RRDA 2M0NA 4ELUA 3JPOA 2HHUA 4QZEA 4DFPA 8ICGA 5J8YA 2F2AB 4DO9A 3K4GA 4YR2A 3RH4A 3ICXA 1IV8A 5DGAA 5L1MA 3SAGA 4F4XA 2H3QA 2JGAA 1PK1B 5ALRA 4QZHA 3MBYA 1RYUA 3NVZA 1S0NA 1QSSA 3H8MA 2W9MA 5KG1A 4Q43A 1XSNA 2HHVA 9ICRA 3PSIA 3IRUA 1ZQRA 5J0PA 2VANA 1DGSA 4YD2A 2AHOB 5KL8B 4QWEA 4Z6CA 1SZHA 2YQEA 5J0SA 1KQQA 5J2DA 2RHFA 1KBUA 4CRXA 7ICJA 3MGVA 4CGZA 1PUZA 1NJWA 4M6WA 3TKAA 4F50A 4DL7A 1ZETA 4UB6U 1LV5A 3E0FA 2W43A 1U47A 2XIDA 2PFNA 1TK5A 1S0VA 3L4PA 7ICVA 3QX7A 5AKLA 1NKCA 5DB9A 1K5OA 2C2RA 1V38A 7ICIA
chains in the Genus database with same CATH topology
2QB0A 2LPEA 2ESEA 3K1RB 2DKXA 1OW5A 1KW4A 2F8KA 2KMDA 3TADC 1B4FA 1SV0A 4IS7A 3KKAA 1RG6A 1COKA 2FE9A 2ES6A 1X40A 2QARA 5J8YA 2Y9TA 2LMRA 2KE7A 5L1MA 1B0XA 2EAOA 1SV4A 1SXEA 4NL9A 1PK1B 4MHVA 1X9XA 2E8MA 1F0MA 2EAPA 2Y9UA 1SGGA 3KKAC 4PZNA 3H8MA 1V85A 2E8PA 1LKYB 2KIVA 2KG5A 3BS7A 2YTUA 3HILA 5JU5A 2KSOB 2QB1A 1SXDA 1X66A 1Z1VA 1OXJA 4PZOA 2GLEA 4NL9C 2K4PA 3TADA 2EANA 3TACB 3IDWA 3BQ7A 2JV3A 1PK3A 1SV0C 3BS5B 5KNIA 2D8CA 2F44A 1JI7A 2QB0B 2QKQA 5JTIA 5JRTA 1WWVA 3SEIA 5J8YC 1LKYA 2F3NA 5F3XB 2DL0A 1DXSA 1UQVA 4RQMA 2K60A 2KSOA 1UCVA 1WWUA 2B6GA 2QARB 1PK1A 2D3DA 2EAMA 4RQNA 3SENA 2E8OA 4NJ8A 2DKZA 1V38A 2E8NA 3BS5A 2L5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 A;  2LPE A;  2ESE A;  3K1R B;  2DKX A;  1OW5 A;  1KW4 A;  2F8K A;  2KMD A;  3TAD C;  1B4F A;  1SV0 A;  4IS7 A;  3KKA A;  1RG6 A;  1COK A;  2FE9 A;  2ES6 A;  1X40 A;  2QAR A;  5J8Y A;  2Y9T A;  2LMR A;  2KE7 A;  5L1M A;  1B0X A;  2EAO A;  1SV4 A;  1SXE A;  4NL9 A;  1PK1 B;  4MHV A;  1X9X A;  2E8M A;  1F0M A;  2EAP A;  2Y9U A;  1SGG A;  3KKA C;  4PZN A;  3H8M A;  1V85 A;  2E8P A;  1LKY B;  2KIV A;  2KG5 A;  3BS7 A;  2YTU A;  3HIL A;  5JU5 A;  2KSO B;  2QB1 A;  1SXD A;  1X66 A;  1Z1V A;  1OXJ A;  4PZO A;  2GLE A;  4NL9 C;  2K4P A;  3TAD A;  2EAN A;  3TAC B;  3IDW A;  3BQ7 A;  2JV3 A;  1PK3 A;  1SV0 C;  3BS5 B;  5KNI A;  2D8C A;  2F44 A;  1JI7 A;  2QB0 B;  2QKQ A;  5JTI A;  5JRT A;  1WWV A;  3SEI A;  5J8Y C;  1LKY A;  2F3N A;  5F3X B;  2DL0 A;  1DXS A;  1UQV A;  4RQM A;  2K60 A;  2KSO A;  1UCV A;  1WWU A;  2B6G A;  2QAR B;  1PK1 A;  2D3D A;  2EAM A;  4RQN A;  3SEN A;  2E8O A;  4NJ8 A;  2DKZ A;  1V38 A;  2E8N A;  3BS5 A;  2L5Y A; 
#chains in the Genus database with same CATH topology
 2QB0 A;  3Q8R B;  1S8O A;  2NRV A;  2DPJ A;  5CP2 A;  8ICT A;  5D4B A;  3LVV A;  4AP9 A;  3C2L A;  1ZQC A;  2XGQ A;  4F92 B;  1F5S A;  8ICS A;  5J2J A;  3PMN A;  5CHG A;  3BZC A;  3DEE A;  2GWS A;  3F2B A;  8ICA A;  4R64 A;  9ICC A;  3MR2 A;  4ED2 A;  1FFV A;  2MAX A;  4PHE A;  3V6K A;  5F9N A;  5AM2 A;  4P0P B;  1S10 A;  2ZTD A;  3NTU A;  4KLI A;  3MAB A;  5KFM A;  5KFN A;  4C4R A;  1Z4N A;  5HR7 A;  2H3V A;  2KIV A;  4I2I A;  8ICY A;  2LHT A;  2LM4 A;  5JU5 A;  5A0L A;  9ICQ A;  5KFB A;  2IMW P;  1SXD A;  3M9M B;  4P4P A;  2G07 A;  9ICS A;  8ICI A;  1KSP A;  3BJY A;  2UVW A;  1KFT A;  2JH1 A;  3KBB A;  1ZQG A;  3BQ7 A;  5J2C A;  3GV7 B;  2FI1 A;  3RRG A;  2D8C A;  3PSF A;  2F44 A;  1JX4 A;  1NZB A;  3F53 A;  3JPN A;  2DWQ A;  2V4Q A;  4DFD A;  2IBK A;  2LYA A;  1BVS A;  1T94 A;  5DDM A;  2JXJ A;  1DOQ A;  4NLB A;  2YMP A;  4QWD A;  2RLT A;  3SI8 A;  5EOZ A;  3UXP A;  5IIM A;  5BPC A;  1NZP A;  1HUZ A;  1NOM A;  5KFL A;  8ICR A;  4IQW A;  2QAR B;  4KMU A;  5K4L A;  4YCX A;  5KTQ A;  4Q45 A;  3M8R A;  3RR8 A;  4GC7 A;  3M6K A;  5J0W A;  5KAI U;  2ZJ8 A;  2JRZ A;  1N60 A;  2C22 A;  4QZ9 A;  3Q8S B;  3UPQ A;  3M7D A;  4Z6F A;  5KT5 A;  3NUQ A;  4QZF A;  1O08 A;  3V6H A;  3WK4 A;  8ICC A;  4I2J A;  3U26 A;  4OJL A;  5CB1 A;  5AI0 A;  5J2I A;  2WTF A;  1DRG A;  4YXJ A;  2I1Q A;  4JV0 A;  3ETL A;  4EX7 A;  2KJ9 A;  4CNQ A;  3B0X A;  7ICT A;  2J6T A;  1TE2 A;  5DG7 A;  1B0X A;  1SV4 A;  4KLG A;  3CYM A;  1JMS A;  2VJ5 A;  1ZQD A;  4G9B A;  1H38 A;  2XCP A;  3G6V A;  1Z00 A;  2E8M A;  1V97 A;  5GTI U;  4UB2 A;  2KKP A;  3MFI A;  2WF7 A;  2HVI A;  3UMG A;  1ZRM A;  4C8N A;  3WKC A;  5KFW A;  5AK4 A;  4C8K A;  1PVP A;  4QWC A;  1RYR A;  2K4I A;  3LWM A;  1A76 A;  1SL2 A;  4KLO A;  1S76 D;  1IG6 A;  4ED6 A;  4R63 A;  4MFA A;  1XNS A;  3ISB A;  5J0Q A;  3AL0 B;  5JTI A;  2YML A;  3SV4 A;  1ZQZ A;  3RJI A;  4JK1 A;  3QEA Z;  2PI5 A;  2GOL A;  1BNP A;  2JZB B;  2W55 A;  1BPX A;  2EAM A;  2F1J A;  4B6J A;  2K8A A;  2JEI A;  4QZC A;  4ED7 A;  3RAQ A;  3PW0 A;  2P66 A;  4PHD A;  5D46 A;  5ALP A;  1BPB A;  2MUT A;  5EWF A;  3NGD A;  2N1R A;  3HKZ F;  4FBT A;  5KFA A;  3HPO A;  3I28 A;  2WHE A;  2O6K A;  3QU5 A;  7ICR A;  1T8E A;  2BQR A;  4ELT A;  2V9W A;  4TUR A;  3HJE A;  2P6U A;  3DDH A;  2BPG A;  1RG6 A;  3T5L A;  4YP3 A;  3HP6 A;  2HOQ A;  4UBC A;  4GFJ A;  2ZTC A;  2ZTE A;  3QUT A;  1L8O A;  3FM9 A;  2KE7 A;  1QH9 A;  2ZUC A;  1MA7 A;  9ICP A;  2ZIU B;  2VJ4 A;  2WFA A;  3UQ2 A;  3N7P D;  4UB5 A;  5J2A A;  4KN4 A;  2BZF A;  4QNL A;  1BPY A;  2YTU A;  2K4E A;  3OJS A;  1OUQ A;  3F2D A;  1TK0 A;  5CR0 A;  1QLN A;  2QB1 A;  4Q8F A;  4GXI A;  4UAV A;  3SAH A;  4PZO A;  2BCS A;  4KLF A;  2HDO A;  4TUQ A;  3H8J A;  5DQI A;  9ICF A;  2P6R A;  5KG7 A;  1KKX A;  2FPK A;  5AI9 A;  9ICO A;  1SWV A;  4Y2P A;  2LBO A;  3MFH A;  2BCV A;  5DB6 A;  3T5H A;  4QZ8 A;  5AKE A;  4OJ5 A;  3C2K A;  5AK5 A;  8ICH A;  1ZQV A;  1YT3 A;  5ALF A;  2BR0 A;  5EE9 A;  5KFR A;  5KFP A;  3I76 A;  2NO4 A;  4IRK A;  3KHH A;  5AHX A;  3CP8 A;  2ATL A;  1L6N A;  4F2R A;  1URJ A;  5KFH A;  3D2Q A;  5B66 U;  2E1F A;  5DBC A;  3RAX A;  1RQN A;  2GO7 A;  5ALH A;  1L8L A;  3D2N A;  3PVX A;  2BPF A;  4F4K A;  5HML A;  2DKX A;  4EX6 A;  2KMD A;  9ICN A;  3RR7 A;  5KFQ A;  2OEH A;  2K8B B;  3RTV A;  3GQC A;  4DS5 A;  5KFV A;  2HBK A;  4Q44 A;  1JN3 A;  2R8H A;  2YMQ A;  2KP7 A;  3C23 A;  4JUZ A;  4MEX A;  2I9G A;  4EYH B;  1VDV A;  2HHX A;  4ECX A;  2W9C B;  5AI4 A;  5EE1 A;  4MF8 A;  3TFS A;  1SGG A;  1U9L A;  3VCB A;  2MU2 A;  2NYV A;  4DOC A;  3BS7 A;  3MDA A;  8ICX A;  2XO7 A;  1Q3V A;  3RF9 A;  2KSO B;  4RPY A;  4FE3 A;  4J9S A;  3GIL A;  4NLC A;  3ZDD A;  3PW5 A;  1ZQJ A;  4FS1 A;  4IRD A;  2ALZ A;  5HR6 A;  4B9T A;  1NK9 A;  5KFF A;  2AQ4 A;  3EPG A;  2HSZ A;  2W3R A;  5AK6 A;  4RQ6 A;  2ZJ5 A;  3TAQ A;  3OJU A;  2JMG A;  5DB8 A;  4J9N A;  1U48 A;  2E5S A;  1KN5 A;  2EQY A;  3F2C A;  1MC8 A;  3N7S C;  2ZUB A;  7ICH A;  3N7R C;  3GFK B;  3H40 A;  8ICE A;  1WUD A;  1N2X A;  4RQ3 A;  4KN7 A;  5G5H A;  1A77 A;  1KTQ A;  5AKK A;  2HBM A;  4Y2J A;  2Y1J A;  4BDP A;  4EZ6 A;  3AU2 A;  4J9L A;  4EZ9 A;  9ICB A;  1AQ6 A;  3BQ1 A;  1ZQE A;  2OCE A;  3H8W A;  3C28 A;  3RB3 A;  5KG6 A;  4M9N A;  1SKR A;  2FE9 A;  5KT6 A;  3AM9 A;  1N48 A;  2BDP A;  2A1J B;  4F5N A;  2K4H A;  2QAR A;  4DQI A;  2A3V A;  4QW9 A;  1Z1B A;  1NK5 A;  4NL9 A;  4UB8 U;  5J0X A;  2OH2 A;  3MC1 A;  4YN4 A;  4BXO B;  1X9X A;  1TAQ A;  1XU4 A;  4KLH A;  4C7Y A;  2IHN A;  2VA2 A;  1N56 A;  4M2Y A;  3G6X A;  2BCQ A;  2IA6 A;  1V85 A;  2XI9 A;  4OO1 J;  3Q8P B;  2H5X A;  3ZD9 A;  2WF5 A;  1JRO A;  5TZV A;  4YG2 A;  4UB1 A;  4F5R A;  5ALK A;  3GZF A;  1ZQT A;  3IN5 A;  5J2K A;  1TVA A;  2KN7 A;  5KFE A;  5HNK A;  5ALO A;  2JEG A;  4P2H A;  3L3F X;  1LB2 B;  4GLX A;  4MEY A;  1JI7 A;  4Y2X A;  4UAU A;  3C1Z A;  4JV1 A;  1KRP A;  4C4T A;  1WG8 A;  4B9M A;  1UA1 A;  4KLL A;  5KG5 A;  2WF8 A;  4EBE A;  2QLT A;  2BPC A;  4Y2U A;  3H8S A;  1QSL A;  3I1Y A;  5EWG A;  3KHR A;  1D8Y A;  1IIP A;  4K4H A;  4R8U B;  4RQN A;  2UVR A;  1VLB A;  2KOB A;  3AQF A;  4B9L A;  4J9M A;  5DG9 A;  5G5G A;  3OHA A;  2V4R A;  7ICO A;  2ESE A;  4UW9 A;  3QU4 A;  3QEB Z;  4EEY A;  1OW5 A;  2KVC A;  3TAD C;  4M47 A;  4F8R A;  4YMO A;  3F5E A;  8ICN A;  4OD0 A;  3OHB A;  2JZB A;  5KG0 A;  4DFK A;  1COK A;  4C8O A;  3N4M B;  4KLE A;  4EYI B;  5KFO A;  9ICM A;  1C7Y A;  5AKG A;  2FJ6 A;  1XSL A;  2LMR A;  3Q8Q B;  2LI6 A;  3C1Y A;  1C20 A;  1SXE A;  3OPX A;  5KL1 B;  2XY6 A;  4ELV A;  2JR5 A;  5IIN A;  7ICF A;  2W11 A;  4FS2 A;  1J97 A;  2RP5 A;  4QJF B;  1ZYQ A;  2UVU A;  2A19 A;  4KIT B;  4B9S A;  4RQ0 A;  3PST A;  2W7O A;  5CWR A;  3JPT A;  3QNM A;  1UT5 A;  3HIL A;  5ALM A;  3TAN A;  1U45 A;  2PMZ F;  1ZQO A;  4I29 A;  8ICF A;  2MSN A;  1B43 A;  4CF5 A;  4QWB A;  4C7Z A;  3H0L B;  4GXK A;  1N63 A;  2RDI A;  3RFA A;  2J6U A;  2HOF A;  4DF4 A;  3ZD8 A;  2ZIU A;  1XC9 A;  1SIJ A;  1SV0 C;  4O5C A;  4YQW A;  4QZI A;  1L3T A;  1X42 A;  2HCF A;  5IIK A;  3V7L A;  2PKE A;  1WWV A;  3MR5 A;  4DL6 A;  3FDS A;  1JXL A;  3M8S A;  4ICA A;  5KFK A;  1JXE A;  3AN1 A;  9ICW A;  2KZZ A;  3PZP A;  1L5U A;  2H3Z A;  3ZDA A;  4XUS A;  4RNN A;  4I2C A;  1JUD A;  3TI0 A;  3SEN A;  5EE3 A;  3ED5 A;  1KLN A;  3ALR A;  4F5P A;  4DSJ A;  2KJ8 A;  2F1H A;  1ZQY A;  1TV9 A;  1HEK A;  2H3I A;  8ICP A;  4KLU A;  2YY6 A;  2KKV A;  1A6S A;  4MFC A;  4NM2 A;  1NK8 A;  4TUP A;  5L1L A;  2EZZ A;  4ECS A;  4US8 A;  4NV0 A;  4O3R A;  1Z19 A;  2WF9 A;  1Q8K A;  2M9N A;  3PO5 A;  8ICL A;  4RQ1 A;  2G5H B;  3M9O B;  2LKY A;  2ZIW B;  8ICV A;  2XY7 A;  4OJ6 A;  2LM1 A;  3BDP A;  2Y9U A;  2RDJ A;  2NRT A;  4BGD A;  2WAQ F;  4J9P A;  1LKY B;  5T14 A;  4PGX A;  3HRD D;  5L1J A;  4B9N A;  4B9V A;  7ICP A;  3Q8K A;  4HYK A;  5KFY A;  4RUC A;  3T5K A;  4DSK A;  4LZD A;  2FPM A;  1O03 A;  1CRX A;  4DSF A;  2VIX A;  4O5E A;  3EYZ A;  2ZUD A;  4FO6 A;  4OJP A;  2AU0 A;  5DBB A;  2W9C A;  3RH6 A;  1QTM A;  4CDG A;  5JRT A;  3SV3 A;  2ZIX A;  5C5J A;  1Y88 A;  4F4Y A;  2Z7J A;  3B0Y A;  3AUO A;  1IXR A;  3QYP A;  1DXS A;  3NRZ A;  2K60 A;  2KSO A;  1Q46 A;  4PGQ A;  2J6S A;  1NKB A;  4ED0 A;  3H0R B;  2G08 A;  3CRX A;  3RJK A;  2PMZ C;  4B9U A;  3RB0 A;  4RT3 A;  3BQT A;  1ZQX A;  5CEH A;  2E8N A;  3RJF A;  4LZG A;  5KFS A;  5F9L A;  2R8K A;  1XS9 D;  4C8L A;  5KAF U;  1KW4 A;  2F8K A;  4XQ8 A;  5EE0 A;  3WK8 A;  3A0B U;  4RQ2 A;  7ICS A;  3KKA A;  3UQ0 A;  4GC6 A;  4MFF A;  2OYY A;  2KZM A;  2FLP A;  5AKJ A;  3RJE A;  4NY8 A;  3OSP A;  1TKD A;  2VA3 A;  4PL2 A;  1ZQL A;  4QZB A;  4RPZ A;  8ICJ A;  4O5K A;  1JAL A;  5AI6 A;  3ZI4 A;  5AI5 A;  3RB6 A;  2EZY A;  1K1S A;  2PXI A;  1M6Y A;  4UAY A;  3MGH A;  5DQG A;  2EAP A;  2K89 A;  2BDU A;  3PW7 A;  3M6Z A;  2AGO A;  4KTQ A;  3PML A;  9ICG A;  3TFR A;  5KFU A;  8ICQ A;  2B21 A;  3Q8L A;  2G09 A;  2A1J A;  1ZOL A;  4UAZ A;  3S6J A;  4IC9 A;  1A0P A;  8ICK A;  4M04 A;  4F91 B;  1RPL A;  5KG3 A;  3PY8 A;  2WB1 F;  4IQU A;  4QZG A;  3O0F A;  2C2E A;  1RXW A;  2W04 A;  4BXO A;  2QKQ A;  3RB4 A;  4ED1 A;  4X5V A;  4Y2V A;  3IG5 A;  4F5O A;  2HHT A;  7ICE A;  1ZQN A;  1N5W A;  5DDY A;  2HOI A;  3PNC A;  3WU2 U;  4AYB F;  1J2M A;  2WAQ C;  1UCV A;  1L3S A;  4IL6 U;  5KFT A;  2Q0Z X;  1WWU A;  2NRW A;  2B6G A;  2C2D A;  5CRX A;  4QZD A;  5AM1 A;  1PK1 A;  3ISC A;  4NJ8 A;  1FIQ A;  4FZM A;  4DOA A;  1L3V A;  5KFD A;  1B22 A;  2CN1 A;  4F72 A;  2XGP A;  2W9B B;  3KTQ A;  3TAR A;  4DQS A;  1PZN A;  2KD1 A;  5FP0 A;  4DL5 A;  2R8I A;  1Q3U A;  7ICM A;  5III A;  4KLM A;  8ICB A;  8ICO A;  3F5A A;  7ICG A;  2JH7 A;  1X40 A;  2KZ3 A;  3B9J A;  5J0T A;  2W8L A;  1NK6 A;  5HHH A;  4R8U A;  2YB4 A;  4DLG A;  1T3Q A;  4ECR A;  2FDR A;  4PH5 A;  2E1E A;  4KX5 A;  4IR1 A;  4BUG A;  4ECT A;  3T5J A;  4YD1 A;  2UVV A;  1KL9 A;  4Y2Q A;  3GII A;  1BNO A;  2HBJ A;  5EWE A;  5DKW A;  3NVV A;  2F1I A;  2ZJA A;  1ZD4 A;  4I2A A;  3KZI U;  4OJO A;  5DG8 A;  3PO4 A;  2GLE A;  4CF3 A;  3C5F A;  4DQP A;  1SL1 A;  2W8K A;  3WK5 A;  5ALV A;  4DWI A;  4M0A A;  2JV3 A;  3CNH A;  3KHG A;  2Q4T A;  4YVZ A;  1RDF A;  2R8J A;  1UHU A;  5KT2 A;  4O3N A;  3RJH A;  3BQ0 A;  2KTQ A;  2FPL A;  3T79 A;  3THV A;  9ICK A;  4QWA A;  1Z00 B;  4FZL A;  4CCH A;  5BOL A;  3JPR A;  5KG4 A;  5ALD A;  4K4I A;  1XO0 A;  3GU3 A;  1UPH A;  9ICT A;  3H0M B;  4P0P A;  3QE9 Y;  2DBY A;  3OTQ A;  3ZDE A;  5AM4 A;  3RBE A;  1Z4O A;  2D6F C;  4F5Q A;  4R66 A;  4ED3 A;  3K1R B;  2KHV A;  3V6J A;  9ICX A;  1XO1 A;  5L1I A;  3PSP A;  4MF2 A;  3PX4 A;  1TAM A;  2WB1 C;  4PJ0 U;  3KOO A;  2E3T A;  1B4F A;  3UMB A;  3QU7 A;  4F93 B;  1QQ6 A;  4FBU A;  1QSY A;  4NM1 A;  4ECY A;  4DF8 A;  2KFZ A;  1ZQP A;  2P35 A;  4I2D A;  3JPP A;  2W9A A;  2CXY A;  2W3S A;  4AYB C;  3CW2 C;  5HMM A;  4ECU A;  1S9F A;  4P0Q B;  4DL4 A;  2EAO A;  1SL0 A;  2KHQ A;  4RT2 A;  5ALL A;  4KLQ A;  4BJQ A;  1EXN A;  5DQH A;  4RQ4 A;  3NVY A;  3KHL A;  4UAW A;  4R65 A;  2VKQ A;  1N61 A;  2I6X A;  5J2F A;  4M9J A;  2B0C A;  4G3I A;  9ICL A;  2KG5 A;  5L9X A;  7ICN A;  9ICV A;  4Z6D A;  1P7D A;  4PGY A;  5KFX A;  1Z1V A;  3IM1 A;  2CRX A;  4JV2 A;  9ICU A;  1WCN A;  4NL9 C;  2LYB A;  3SR6 A;  2XVT A;  8ICW A;  1JRP A;  4O0I A;  2ODG A;  3IV6 A;  4IQT A;  5ALQ A;  4EEL A;  4KMO B;  4PHA A;  3A0H U;  5AKZ A;  3BS5 B;  1D8L A;  4DEZ A;  2ZIW A;  3LK9 A;  4KLS A;  5J8Y C;  5DB7 A;  4Q8E A;  1LKY A;  4O3Q A;  3RJG A;  1TAU A;  1DK2 A;  5GTH U;  5IIL A;  4O3M A;  2OHF A;  4I2H A;  3RRH A;  3C2M A;  1ZD3 A;  4DOB A;  1L7M A;  4JWM A;  5CJ7 A;  3KFU F;  3PX6 A;  2D3D A;  2HVH A;  5DGB A;  1V9P A;  5ALZ A;  2DKZ A;  2BKE A;  3GIJ A;  4PL1 A;  2XIC A;  3HT3 A;  4UBB A;  4YMN A;  1ZJM A;  4J9R A;  2LPE A;  4IRC A;  5TIS U;  1QQ5 A;  1X2I A;  3GIK A;  2OM6 A;  4M9L A;  4KLD A;  3FC4 A;  3MR6 A;  1GO3 F;  1TFR A;  9ICH A;  5AM0 A;  3J81 j;  4TQR A;  4ZH4 A;  4E0D A;  2Y9T A;  5KFC A;  2BQ3 A;  5J2E A;  1S5L U;  4C4S A;  4IR9 A;  4A8E A;  1ZD5 A;  1N5X A;  4NWI A;  2ZXH A;  4MHV A;  1ZQW A;  5AIC A;  4DFJ A;  1ZQB A;  3ZDB A;  3K1Z A;  5CA7 A;  3BQ2 A;  2W7P A;  4JB3 A;  3QZ7 A;  1S77 D;  3K75 D;  5KT7 A;  1X9M A;  1RXV A;  5KFJ A;  2DGZ A;  2KNJ A;  3H7I A;  5AKH A;  4F4Z A;  3ORY A;  3LWL A;  4TQS A;  1X66 A;  3RJJ A;  5AI8 A;  1OXJ A;  7ICU A;  7ICK A;  1L3U A;  5J2H A;  2ASD A;  1NK0 A;  3IP4 B;  3TAD A;  3TAC B;  1IM4 A;  4UAT A;  2ISO A;  5ALJ A;  3UMC A;  2R8G A;  4QW8 A;  4I2B A;  1X6I A;  1D8B A;  4DSL A;  1FEZ A;  4RQ5 A;  1MQ3 A;  4YFK A;  5AIB A;  3M9N B;  4C0Z A;  2EZX A;  2Y0S F;  3GIM A;  4J03 A;  5KFZ A;  2ZIV B;  1BPE A;  2DF4 B;  1X6J A;  4XA5 A;  4GXJ A;  2XY5 A;  1T4G A;  1S0M A;  3FYH A;  4I2F A;  3FAH A;  4I27 A;  3E58 A;  8ICU A;  2E8O A;  8ICZ A;  3QUQ A;  3V72 A;  4RNO A;  5C0Y A;  4GIB A;  5IIJ A;  5HHI A;  2G0A A;  2HMX A;  4USA A;  1KFD A;  2DUY A;  2DPI A;  9ICE A;  3PR5 B;  1SV0 A;  4IQV A;  5H2F U;  2HW3 A;  4IS7 A;  2F77 X;  2NO5 A;  4C8M A;  2NV3 A;  4US9 A;  3IHQ B;  4M9G A;  3PR4 A;  1QCK A;  4RNM A;  3AU6 A;  1SZP A;  2FMS A;  9ICA A;  1MSW D;  4DFM A;  4PPX A;  4J9Q A;  3ETR A;  1HIW A;  2W9B A;  3EZ5 A;  1YZ7 A;  1SB3 C;  2LYH A;  4Y2S A;  2AGP A;  1L7O A;  3QU9 A;  5J2B A;  3V7J A;  2FLL A;  2DQN B;  4JMU A;  4DCC A;  1ZQ1 C;  3G6Y A;  3WK9 A;  2ZG6 A;  3R9K A;  1SWW A;  5ALY A;  3WKE A;  2EAN A;  3EUB 2;  1CUK A;  3IDW A;  2NRX A;  1PK3 A;  3HX0 A;  2ISP A;  1J2N A;  3GV8 B;  3PW2 A;  5JUM A;  2HHS A;  2IHM A;  2BHN A;  3LVW A;  3EPI A;  3OSN A;  2KFN A;  4Y2Y A;  5KFG A;  5ALT A;  3NVW A;  5KG2 A;  4RQM A;  4U6P A;  2IOF A;  4YR0 A;  7ICQ A;  1X9W A;  4Y2R A;  2PFQ A;  2KEY A;  4K4G A;  1NJX A;  3KD3 A;  1TK8 A;  4CE6 A;  1BPZ A;  2XC9 A;  1NK7 A;  3WK6 A;  5KFI A;  2NRZ A;  1L7P A;  1RM6 C;  5ALS A;  3WK7 A;  2AJQ A;  5AM3 A;  5AM5 A;  4ACO A;  1KEJ A;  2Y0S C;  2A1A A;  2HI0 A;  2YN4 A;  4TUS A;  2I5H A;  1LVH A;  3QUB A;  9ICJ A;  2ASJ A;  3T3F A;  4DLE A;  2AGQ A;  4DSI A;  1T7P A;  4ECW A;  3PV8 A;  2AXT U;  2YX8 A;  3UM9 A;  5D49 A;  1DGJ A;  3RH5 A;  1ED1 A;  1WYG A;  2IOH A;  1F0M A;  4ECV A;  3WKB A;  3KKA C;  4PZN A;  5J29 A;  1RYS A;  1ZQI A;  1YZ6 A;  1COO A;  1ZJN A;  2BGW A;  1CI4 A;  4M6W B;  2EDU A;  1D9D A;  4CF4 A;  1ZQQ A;  3ZDC A;  4RQ8 A;  2MA1 A;  4UAR A;  4C80 A;  4RQ7 A;  3C5G A;  4F2S A;  1ECW A;  4P0Q A;  4O9M A;  1BGX T;  1NNL A;  3NRW A;  5J0R A;  2ZXI A;  7ICL A;  2WF6 A;  5KNI A;  1ZD2 P;  1ARO P;  1NJY A;  2QB0 B;  1PVQ A;  4LVS A;  1KFS A;  5ALW A;  3SEI A;  3BZK A;  1QQ7 A;  2KIW A;  5J0U A;  3GV5 B;  2DL0 A;  1U49 A;  3NS1 A;  2PFO A;  1VJ5 A;  5J2G A;  4ED8 A;  5J0O A;  4RUA A;  3EW9 A;  2KV2 A;  3JPQ A;  3MR3 A;  2YB1 A;  1U4B A;  2XCA A;  2BCR A;  3NAS A;  3BS5 A;  3RBD A;  2KJ5 A;  4HAI A;  4EEK A;  1F44 A;  2YMM A;  3L5K A;  5B5E U;  4DQR A;  2F76 X;  5AK3 A;  4O3O A;  1SKS A;  3SAF A;  4QIW F;  3MDC A;  1ZQF A;  4JWN A;  2PFP A;  3D6J A;  1ZQH A;  4FZN A;  2BCU A;  4PHP A;  3JPS A;  3ONN A;  2K8C B;  4UB3 A;  4ECQ A;  3M1Y A;  4BWJ A;  4DL3 A;  2GH1 A;  4J9O A;  2CPR A;  1UT8 A;  2HHW A;  3QUC A;  4KLJ A;  5BOM A;  4KLT A;  5ALI A;  4YXM A;  1D9F A;  5ALE A;  2KVS A;  5HP4 A;  4NLN A;  3TAP A;  5AKI A;  1BPD A;  2MRL A;  1PVR A;  4YMM A;  4F3O A;  1K1Q A;  4YR3 A;  5ALX A;  2K4P A;  3IG8 A;  4UQG A;  3SYZ A;  3HW8 A;  5L1K A;  3LDA A;  1S97 A;  2G06 A;  1JIH A;  4RU9 A;  4I28 A;  4M9H A;  1XSP A;  1ZXI A;  1FO4 A;  2F3N A;  4KX3 A;  1ZQM A;  5F3X B;  4UB4 A;  4I2E A;  4QZA A;  2HHQ A;  1UA0 A;  1UQV A;  2FMQ A;  4F71 A;  4NLZ A;  3Q8M A;  2AQ0 A;  5DBA A;  4I2G A;  4OCZ A;  3WKA A;  3GDX A;  2PI4 A;  2G5I B;  1ZRN A;  4NLG A;  3ISD A;  1X9S A;  1Z3E B;  4DS4 A;  1ZQK A;  4O3S A;  4EBC A;  1S0O A;  1MN8 A;  4DQQ A;  2JEJ A;  4EBD A;  1FFU A;  4Y2T A;  2BQU A;  2ZIV A;  1CEZ A;  2Y1I A;  1DK3 A;  1L7N A;  1RZT A;  3D2S A;  2H3F A;  3UXO A;  4BX9 C;  3QU2 A;  2ZIX B;  4NXZ A;  3HKZ C;  1SKW A;  4BWM A;  3OGU A;  2ES6 A;  1NKE A;  9ICI A;  3UXN A;  1ZQU A;  2W54 A;  5DLF A;  4Z6E A;  3H4D A;  5KT4 A;  5ALN A;  3SMV A;  2W03 A;  4RPX A;  5AIA A;  2IOF K;  1ZQS A;  4LJX A;  1WCL A;  2EH9 A;  1ZQA A;  1NJZ A;  4DL2 A;  1XWL A;  1MQ2 A;  3AQE A;  1HJP A;  2RQ5 A;  5AKY A;  2AH5 A;  2E8P A;  2C28 A;  1T3N A;  3TQ1 A;  3V7K A;  3LYS A;  4QIW C;  3PW4 A;  4XRH A;  5AKX A;  3WKD A;  3VC8 A;  3SZ2 A;  2OWO A;  3DV9 A;  2KIC A;  4F4W A;  1RQL A;  2OXO A;  2MUT B;  1HUO A;  5KT3 A;  2JEF A;  4U7C A;  3EWA A;  5ALG A;  2HBL A;  3AMZ A;  2FMP A;  4RZR A;  3HWT A;  2KK0 A;  3C21 A;  3KZX A;  4ZOH C;  3N28 A;  3PX0 A;  3N97 B;  3SD7 A;  2R18 A;  5J0Y A;  3QXG A;  2DFL A;  5ALU A;  5IIO A;  3H4B A;  4EEN A;  1NK4 A;  4NLK A;  4UAS A;  3SQI A;  8ICM A;  4DSE A;  5E79 U;  4P4O A;  2FLN A;  1NI3 A;  2JHD A;  4O3P A;  3AEV A;  3QZ8 A;  3C29 A;  1N62 A;  2ASL A;  3E2E A;  3MGI A;  2L5Y A;  4P4M A;  5DLG A;  4FFD A;  2VA8 A;  4ECZ A;  2F8L A;  4WJ3 B;  1KDH A;  4J9K A;  2RRD A;  2M0N A;  4ELU A;  3JPO A;  2HHU A;  4QZE A;  4DFP A;  8ICG A;  5J8Y A;  2F2A B;  4DO9 A;  3K4G A;  4YR2 A;  3RH4 A;  3ICX A;  1IV8 A;  5DGA A;  5L1M A;  3SAG A;  4F4X A;  2H3Q A;  2JGA A;  1PK1 B;  5ALR A;  4QZH A;  3MBY A;  1RYU A;  3NVZ A;  1S0N A;  1QSS A;  3H8M A;  2W9M A;  5KG1 A;  4Q43 A;  1XSN A;  2HHV A;  9ICR A;  3PSI A;  3IRU A;  1ZQR A;  5J0P A;  2VAN A;  1DGS A;  4YD2 A;  2AHO B;  5KL8 B;  4QWE A;  4Z6C A;  1SZH A;  2YQE A;  5J0S A;  1KQQ A;  5J2D A;  2RHF A;  1KBU A;  4CRX A;  7ICJ A;  3MGV A;  4CGZ A;  1PUZ A;  1NJW A;  4M6W A;  3TKA A;  4F50 A;  4DL7 A;  1ZET A;  4UB6 U;  1LV5 A;  3E0F A;  2W43 A;  1U47 A;  2XID A;  2PFN A;  1TK5 A;  1S0V A;  3L4P A;  7ICV A;  3QX7 A;  5AKL A;  1NKC A;  5DB9 A;  1K5O A;  2C2R A;  1V38 A;  7ICI A; 
#chains in the Genus database with same CATH homology
 2QB0 A;  2LPE A;  2ESE A;  3K1R B;  2DKX A;  1OW5 A;  1KW4 A;  2F8K A;  2KMD A;  3TAD C;  1B4F A;  1SV0 A;  4IS7 A;  3KKA A;  1RG6 A;  1COK A;  2FE9 A;  2ES6 A;  1X40 A;  2QAR A;  5J8Y A;  2Y9T A;  2LMR A;  2KE7 A;  5L1M A;  1B0X A;  2EAO A;  1SV4 A;  1SXE A;  4NL9 A;  1PK1 B;  4MHV A;  1X9X A;  2E8M A;  1F0M A;  2EAP A;  2Y9U A;  1SGG A;  3KKA C;  4PZN A;  3H8M A;  1V85 A;  2E8P A;  1LKY B;  2KIV A;  2KG5 A;  3BS7 A;  2YTU A;  3HIL A;  5JU5 A;  2KSO B;  2QB1 A;  1SXD A;  1X66 A;  1Z1V A;  1OXJ A;  4PZO A;  2GLE A;  4NL9 C;  2K4P A;  3TAD A;  2EAN A;  3TAC B;  3IDW A;  3BQ7 A;  2JV3 A;  1PK3 A;  1SV0 C;  3BS5 B;  5KNI A;  2D8C A;  2F44 A;  1JI7 A;  2QB0 B;  2QKQ A;  5JTI A;  5JRT A;  1WWV A;  3SEI A;  5J8Y C;  1LKY A;  2F3N A;  5F3X B;  2DL0 A;  1DXS A;  1UQV A;  4RQM A;  2K60 A;  2KSO A;  1UCV A;  1WWU A;  2B6G A;  2QAR B;  1PK1 A;  2D3D A;  2EAM A;  4RQN A;  3SEN A;  2E8O A;  4NJ8 A;  2DKZ A;  1V38 A;  2E8N A;  3BS5 A;  2L5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...