1WWVA

Solution structure of the sam domain of human connector enhancer of ksr-like protein cnk1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Connector enhancer of kinase suppressor of ras 1
publication title Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1wwvA00
5F3XB 2QKQA 3H8MA 1X66A 4IS7A 2KSOA 2QARB 4MHVA 5JRTA 2KMDA 2QB0A 2E8NA 1B0XA 2D3DA 2EANA 5KNIA 3BS5A 2DKXA 2KG5A 5JTIA 5JU5A 2KE7A 1Z1VA 1OW5A 2F44A 1V85A 1WWVA 1B4FA 1DXSA 3KKAA 1UQVA 2LPEA 1SV4A 2KSOB 2ESEA 2KIVA 3BQ7A 4NJ8A 1UCVA 2EAPA 1PK1A 1LKYA 1SV0A 2QB0B 2F8KA 2EAOA 3IDWA 4RQNA 1PK3A 1SXEA 2GLEA 4PZNA 1RG6A 3SENA 2L5YA 1V38A 2Y9TA 3BS5B 3K1RB 1SXDA 2YTUA 2ES6A 2F3NA 3SEIA 1WWUA 2EAMA 2DL0A 3TADA 2B6GA 2FE9A 1COKA 4NL9C 2LMRA 4RQMA 2E8OA 5J8YC 2E8MA 3HILA 3KKAC 1KW4A 1X40A 1PK1B 1LKYB 3BS7A 5L1MA 2JV3A 1SV0C 2QARA 3TACB 2Y9UA 2K4PA 2QB1A 1OXJA 2D8CA 4PZOA 1X9XA 2K60A 2DKZA 1F0MA 1JI7A 3TADC 4NL9A 1SGGA 2E8PA 5J8YA
chains in the Genus database with same CATH superfamily
4DL6A 5KFPA 2W8KA 2I5HA 5HHIA 4PL1A 2ALZA 4DFPA 4IRCA 3L5KA 3UPQA 3NGDA 4BGDA 4IRKA 1KSPA 4RT3A 2E8NA 1SWVA 2LI6A 3ZD9A 1ZQJA 4XUSA 1L6NA 4FBTA 3UQ2A 5J0UA 1BNOA 4DSKA 1CI4A 3H0MB 4QIWF 9ICMA 2WFAA 2KSOB 4C4RA 5L1LA 9ICQA 4DF8A 4DLGA 3KZIU 2KJ8A 3BZCA 4F91B 5CB1A 2MA1A 2R8JA 5AK5A 2GH1A 5ALWA 5EE1A 5AK6A 2L5YA 1BPEA 3D2QA 1A76A 1SXDA 5ALLA 2H3QA 5E79U 2ZIVA 3E58A 5KG4A 2VA2A 4CF3A 3C5GA 3N7RC 1ZYQA 9ICNA 4P0PB 2H3ZA 4UBCA 9ICVA 1C7YA 1L8LA 1DOQA 3ZDCA 4Q8FA 4CDGA 4QZDA 8ICRA 2OEHA 1N62A 5J0QA 2HOIA 2VANA 4R66A 4P0QB 2QLTA 4ECVA 2PFNA 4EBDA 2JV3A 4B6JA 4B9SA 2RP5A 2H3FA 4NM2A 5CEHA 1Y88A 1X9MA 9ICRA 4RU9A 1QQ7A 1NKEA 5J2FA 4MFFA 1NJYA 1BPDA 3N28A 2IBKA 1RXVA 1CUKA 2BHNA 2F2AB 4NL9A 1BPXA 2K4HA 4Y2QA 1X9SA 4C80A 8ICUA 4YG2A 2ZUCA 2V9WA 5ALGA 4C7YA 9ICGA 2I1QA 4WJ3B 4DLEA 4QZCA 4CGZA 3SYZA 4NXZA 2ZUBA 8ICNA 4K4IA 4O9MA 4QW8A 5D46A 4J9SA 4NLBA 2KVCA 4P2HA 1BVSA 1ZRMA 1K1QA 2XI9A 2I6XA 1L7MA 3Q8SB 1L7OA 4UB1A 3IN5A 2EAPA 2W9BA 1CEZA 1SV0A 3QEAZ 2IOFA 5IINA 5AKIA 1ZQLA 2ES6A 3MBYA 3RH5A 5DLFA 4RT2A 1WCLA 2HBJA 5KG2A 3SQIA 2E1EA 1NK0A 1BNPA 1BPBA 5KFCA 1Z3EB 5EWGA 1Q46A 3QUTA 4LZGA 2AGQA 4CCHA 5ALHA 2HW3A 5ALUA 3WK7A 4DOCA 3WK9A 3BS7A 5ALIA 4J03A 3WKDA 2WAQC 1TAMA 1XO0A 1JX4A 2HCFA 3K1ZA 1N5XA 4R64A 4JV0A 3H8JA 3HPOA 1NI3A 2G07A 2WF8A 2K4PA 2Y1IA 1ECWA 9ICBA 4QZAA 3QU9A 1X9XA 2A1JA 3PW4A 5HP4A 4Q43A 1SKSA 3AMZA 5AM5A 4X5VA 5ALMA 1K5OA 2DF4B 5KAIU 3GV8B 4ECXA 2EQYA 3GFKB 9ICFA 3ICXA 2M0NA 3Q8MA 3JPRA 1IG6A 3V7LA 1QSSA 2WHEA 2YMQA 1NOMA 1KLNA 2E3TA 1MN8A 4ELTA 5JTIA 1HIWA 5KFMA 2KD1A 3NVZA 3R9KA 2FLPA 3KKAA 4KLHA 1UQVA 4PHDA 4YR3A 2IHNA 5HNKA 5J2KA 3BQ7A 1JUDA 4UBBA 3M9OB 4YMOA 7ICGA 3Q8QB 1SL0A 4MEXA 1RG6A 2PMZF 5AI8A 1XS9D 2ZIWA 3SAFA 1MQ3A 5HR6A 1JALA 2WF9A 4ECSA 2J6UA 5ALQA 3MGHA 2FE9A 2LMRA 2XVTA 2R18A 4EBCA 2KK0A 1X42A 1S76D 3D6JA 4TQRA 3MGIA 2W9BB 4CF5A 5KT6A 1NJXA 2LM4A 2HHUA 5F9NA 5CR0A 2XICA 4FO6A 4BWMA 3GZFA 4M9JA 3N97B 4QZGA 4M9GA 2ODGA 4DL4A 4RPYA 5CA7A 2YMLA 3M8SA 1UT5A 5G5HA 3PZPA 4M9NA 1ZQRA 1Q3UA 1PVQA 4KLFA 3V6KA 8ICBA 2JRZA 4PJ0U 8ICVA 3KD3A 1L3VA 4OJ6A 1T8EA 4KLDA 2KOBA 2C2EA 5J0XA 4YN4A 5J2CA 1S77D 3PW0A 5ALKA 8ICWA 5TISU 2XO7A 2W7OA 4GC6A 4C8LA 2EANA 3C5FA 2F77X 3UXNA 2A1JB 4QZ8A 3PW5A 2DKXA 1MA7A 3LDAA 2W9MA 4DSJA 3BJYA 1V85A 3TANA 4Y2TA 4QZHA 1ZQYA 2JHDA 1X6JA 2RRDA 4M9LA 4M6WA 4Y2XA 1NZPA 4NLGA 3WKBA 5ALJA 4F5NA 4PZNA 2KKPA 3I1YA 2HBMA 2XY5A 5ALOA 4LVSA 4M9HA 2HMXA 4I2HA 4EBEA 4QWCA 4ED8A 4Y2SA 3FC4A 5AI9A 1VJ5A 2JMGA 1V97A 3THVA 9ICIA 3HJEA 5J0SA 1U49A 1J2MA 1XO1A 3HT3A 5DBCA 1RPLA 2KTQA 2AQ4A 3RRGA 7ICIA 2F1IA 2RQ5A 5H2FU 3Q8PB 1ZQTA 2ZIWB 5AKLA 1NJZA 1SV0C 1Z19A 5DGBA 2MUTA 3NUQA 1S9FA 3NASA 3F2CA 4FS1A 4PZOA 2JXJA 4F2RA 1KN5A 3KHGA 3PNCA 1S0MA 2RLTA 1P7DA 3QU4A 3Q8KA 4PHAA 3C29A 5KFKA 3ONNA 2KZ3A 4UAYA 2G06A 1QCKA 2V4QA 1JXLA 2LYAA 4ECQA 4KX5A 2C22A 2MAXA 4GIBA 5J2IA 2HHXA 3DEEA 3ZI4A 4P4MA 5KFJA 5ALNA 3QU2A 3CW2C 3M1YA 1MQ2A 1LVHA 2DPIA 2P35A 1LV5A 5AKZA 3B0YA 1BGXT 2OYYA 2PKEA 1ZJMA 2LM1A 2YMPA 1HUZA 1KBUA 1YZ6A 2K4IA 4RQ4A 2W43A 4US8A 3MR6A 2F8LA 8ICIA 4I2CA 4NJ8A 4ECRA 3QE9Y 4GLXA 3RJIA 2EAOA 3OSNA 5KFXA 2JH7A 3WK6A 5DKWA 5J2EA 5AKKA 1SKWA 4DQPA 5T14A 5AIBA 1HUOA 2BCUA 1JXEA 4BX9C 2WAQF 4I29A 4MFAA 3QUQA 3M6KA 1L3TA 4FZNA 4R63A 1UT8A 2BCVA 7ICJA 3QZ8A 4OJ5A 4M6WB 1SL1A 3KKAC 4YFKA 3E0FA 4E0DA 4HYKA 8ICPA 3N4MB 1F5SA 3IV6A 1L8OA 5IIOA 1ZOLA 4Y2RA 2HHVA 3M7DA 3C2LA 3LYSA 1LB2B 1U4BA 1N5WA 1SZHA 2IHMA 3OSPA 4F8RA 3V72A 4NLNA 4NV0A 1IXRA 3OPXA 4A8EA 3LVVA 3LVWA 1F0MA 2J6TA 2KIWA 3JPTA 4DQSA 1ZETA 3OJUA 4PL2A 1SGGA 1WCNA 3JPPA 2EDUA 4RNNA 2QKQA 1D8BA 3WKAA 3V7JA 4YXJA 4F5OA 4KLEA 2XC9A 4DQIA 1SZPA 3NTUA 4QZBA 5JRTA 4Y2VA 5AM4A 3DV9A 4PHPA 3KOOA 1OUQA 3BQ2A 1T94A 4RUAA 2KG5A 2KKVA 4G9BA 5KFBA 2IOHA 1IM4A 1X6IA 5KFWA 3PX6A 3ISDA 1T3NA 3WKEA 4FZMA 1NZBA 4F72A 5K4LA 1N60A 2Q0ZX 3C1YA 8ICEA 4C7ZA 3H40A 3PW2A 4F93B 3HKZF 4YR0A 3PY8A 4J9QA 4KLJA 2KVSA 3PMLA 2C2DA 2ZXHA 1JN3A 3HP6A 1Z4OA 5DG8A 8ICMA 5JUMA 2GWSA 4LZDA 3EPGA 2NV3A 1UPHA 3K1RB 4Z6DA 2C2RA 2JEIA 2LKYA 1L7NA 2FPMA 1WWUA 1TFRA 2B6GA 2K89A 4I2EA 3RH6A 4O3NA 2W7PA 2A19A 5J2DA 1K1SA 2FMQA 4J9NA 1Z00B 4C4TA 5GTHU 1TVAA 3OHAA 4XQ8A 2PFPA 2H3IA 2YQEA 3A0BU 5FP0A 3RAXA 1N56A 1ZQGA 3RBDA 4F2SA 2YY6A 2HHWA 2IOFK 2LHTA 3WK8A 1IIPA 4C8OA 1D9FA 4J9OA 1A77A 4O5EA 7ICNA 2BGWA 2UVRA 1AROP 1XSPA 4OJOA 4BDPA 1JI7A 4J9MA 4UW9A 3T5JA 4ZH4A 3ZDDA 3LWMA 2VA8A 2AJQA 8ICJA 4JWMA 3KBBA 2ASLA 3TAQA 3ZDAA 3S6JA 1QSLA 1ZQPA 5ALZA 5GTIU 3BZKA 1ZQXA 3ORYA 1ZQOA 5JU5A 2EZXA 3SR6A 1FFVA 3HW8A 4RUCA 4JB3A 1Z1VA 4DFDA 1OW5A 1TAQA 4F71A 3WK5A 4F5QA 4YMMA 5IILA 1A0PA 4EZ6A 3MC1A 7ICSA 4NLZA 4ED7A 4B9VA 3FYHA 2E1FA 2ZJ8A 3IDWA 2PI5A 5EWEA 4JV2A 3RRHA 8ICAA 5G5GA 1U47A 2W3SA 1ZXIA 2UVUA 2Y9TA 4K4HA 2E5SA 4RQ2A 3SEIA 3RAQA 1S5LU 2DFLA 2UVWA 2ISOA 5AICA 2O6KA 2DUYA 7ICLA 3F5EA 1EXNA 3GIMA 1FEZA 2E8MA 4FS2A 3NRWA 4F4YA 5L9XA 3QYPA 5KL8B 1L7PA 2F1JA 2ZJAA 4YP3A 4YXMA 5L1MA 8ICGA 3IHQB 3K75D 4RPXA 2HI0A 4UAUA 1RQLA 4P4OA 4HAIA 4YCXA 3F2DA 2VIXA 4F92B 4J9KA 3TFSA 3HX0A 4O0IA 3H7IA 1ZD4A 1TV9A 3AL0B 4IQTA 4GC7A 4M47A 2W03A 2BZFA 1ZQNA 1IV8A 2RDIA 3F5AA 4QZEA 3KHLA 3MGVA 1X66A 2ZIVB 2AGOA 4MHVA 4O3OA 3MDCA 3VCBA 3PR4A 4QWBA 5KFTA 2C28A 5AKGA 4RQ0A 4YVZA 3WU2U 5KG7A 3UQ0A 4ECUA 2KE7A 4B9LA 3QEBZ 1SIJA 2WF5A 2PI4A 8ICTA 4UB2A 5AKHA 3KZXA 4F4KA 9ICOA 3SV4A 9ICAA 2MU2A 4DL2A 2ESEA 5J2HA 7ICEA 4DOBA 4MFCA 3JPSA 3GIJA 1Z4NA 2ZIXA 5AIAA 4F3OA 3EUB2 5J0YA 3V6HA 1ZQMA 2HHQA 2YB1A 2JEFA 7ICTA 2EH9A 4JK1A 3KTQA 1KL9A 1T4GA 4B9TA 3IRUA 3PV8A 4DS4A 1XNSA 2FJ6A 3TARA 2W54A 4UQGA 3RB6A 1QTMA 5J8YC 3EWAA 5KG0A 2R8GA 2G5IB 3TQ1A 4Q45A 1S0OA 2HOFA 4YR2A 4O5KA 5KFGA 2QARA 3TACB 3PVXA 1RQNA 1ZQUA 3SZ2A 2ASJA 5AKXA 1ZQVA 2QB1A 2KHVA 3PX0A 2IMWP 5BPCA 1FFUA 1RYUA 3CRXA 4Y2PA 4BXOA 3ETLA 3H8MA 1MC8A 4USAA 4GFJA 3T5HA 4UATA 2XGQA 5ALFA 4TUSA 9ICTA 4PGQA 4IL6U 1RYRA 1PUZA 3H0RB 5AKEA 4QZFA 4AYBC 2ZTEA 5AM2A 1KKXA 1ZQEA 3ZDBA 1JIHA 3HWTA 2PXIA 4MF8A 3H8WA 3H4BA 3KHHA 5KG3A 4Y2YA 4ACOA 5DB7A 2KIVA 1N2XA 4EENA 4DL7A 2DGZA 2BPCA 2NRZA 4QNLA 1SWWA 4QJFB 3CYMA 5ALVA 2CN1A 3IG8A 1PK3A 1ZQCA 7ICVA 5AM1A 3QX7A 3QNMA 2P66A 1DRGA 2HVHA 4DQRA 2KJ5A 5J2BA 1KFSA 1N61A 1C20A 3TADA 3T5LA 4M04A 3G6XA 4NL9C 1Q8KA 5KFQA 1NKBA 3L3FX 3RJJA 1S0NA 5KFSA 2JEGA 2VA3A 2HDOA 5KFLA 3EZ5A 5ALXA 2ZIXB 1U9LA 2K8AA 8ICOA 7ICPA 2AGPA 2DWQA 4EEKA 1NKCA 5KT3A 4ELUA 4FZLA 4J9RA 5KFRA 3NVWA 3MDAA 1NK6A 4BWJA 2KP7A 5DBBA 4UASA 3PX4A 1D8YA 2D6FC 1J2NA 5DDYA 5IIMA 1ZQZA 5DB9A 5KFZA 4PGYA 4BJQA 3GIIA 5KFVA 2G09A 3PSPA 4OJLA 3OHBA 2NRTA 1FO4A 3MR2A 2HVIA 2RHFA 5L1IA 4PPXA 4IS7A 3NS1A 4CF4A 2QARB 2W9CA 2W8LA 1DK3A 3G6VA 3QUBA 3M6ZA 5ALSA 4J9LA 1B0XA 3I76A 4EX7A 4I2FA 4UAWA 2FPKA 1S10A 2MSNA 3GV7B 2R8IA 3QXGA 1DXSA 3RJEA 2KFZA 3N7PD 4DFMA 3PSTA 1ZQIA 3IG5A 1DGSA 2FMPA 3MFHA 4O3SA 3RTVA 2BQUA 3UXOA 3L4PA 4B9NA 4RNOA 4RQNA 5DGAA 2ZIUA 1ZQKA 4EEYA 2CPRA 4XRHA 3OGUA 3G6YA 4J9PA 1L3SA 2UVVA 2YTUA 9ICEA 2F3NA 2BDUA 3GU3A 2EAMA 8ICFA 3M8RA 1Z1BA 5AHXA 5C5JA 1COKA 5CP2A 2N1RA 1KTQA 2R8HA 3PSIA 2Z7JA 4Z6EA 4DEZA 2BCRA 4BUGA 4Z6FA 4EYHB 3QU5A 1QH9A 4KX3A 3Q8LA 2Y1JA 4EELA 3FAHA 1WYGA 2Y0SC 1JRPA 9ICWA 2F76X 2Y9UA 4RQ8A 2OHFA 3ED5A 2BCSA 1D8LA 2W55A 4UAVA 4O3QA 5CWRA 2BPGA 5CJ7A 2AU0A 2KICA 4CE6A 2BR0A 3N7SC 9ICSA 8ICCA 3C2KA 4R8UA 1U48A 1WUDA 4EX6A 4DSFA 5DQGA 5KFIA 1ZQQA 1N63A 4RQ3A 5ALYA 1HEKA 3J81j 1DGJA 4I2JA 5AM0A 4MEYA 4IQVA 5KG5A 4RQ1A 3M9NB 3PSFA 2RDJA 4KLUA 7ICHA 3EYZA 5KFDA 2W9CB 3UMBA 3RH4A 4K4GA 2MUTB 4F50A 3RJKA 3FM9A 3F53A 2ZXIA 1NK7A 4FBUA 4C8KA 3AU6A 3O0FA 2K8BB 2ATLA 1AQ6A 1ZD5A 1ZJNA 3EPIA 1UA0A 4LJXA 4DF4A 2I9GA 4NWIA 2BPFA 2ZJ5A 2OH2A 3TKAA 2E8OA 1XC9A 4OJPA 3HILA 3H0LB 4I2IA 5KG6A 5KAFU 4O3PA 5J2GA 4KLTA 4KN7A 2ZIUB 3ETRA 3E2EA 5KFNA 4OD0A 3DDHA 5ALTA 4QZIA 2J6SA 2KZZA 3ALRA 4B9MA 2ZTCA 4U7CA 8ICXA 1N48A 1DK2A 1YT3A 3TADC 3A0HU 1B22A 3MABA 3AM9A 7ICMA 4NLKA 3UMCA 4AYBF 3MR3A 2JEJA 1ZQSA 5KT4A 5AI0A 4F5PA 4UB4A 3B0XA 4I2BA 1KFTA 4RQ7A 4RPZA 5L1JA 3OTQA 3C1ZA 5HR7A 2D3DA 5TZVA 4IR1A 1KFDA 1JROA 3OJSA 1TKDA 1NNLA 1TK0A 3NVVA 2JH1A 1L5UA 4DWIA 5J2JA 1QLNA 4I28A 2M9NA 1V9PA 4DSIA 4YD1A 1UA1A 1M6YA 2FPLA 2F44A 2KHQA 9ICJA 1B4FA 3UMGA 5CRXA 4QZ9A 4KLQA 3CNHA 4R8UB 4O3RA 3AN1A 4ELVA 3EW9A 5D4BA 1D9DA 4ECTA 1UCVA 1PVPA 5AM3A 2P6UA 2F8KA 4KN4A 2ZUDA 1ZRNA 4DSLA 2YX8A 4PHEA 1NK8A 1MSWD 5B5EU 4YQWA 4F5RA 3SV3A 2P6RA 4DQQA 4ECWA 1GO3F 2BDPA 4B9UA 5J0TA 1WG8A 4ED3A 2KNJA 5KFFA 4ECYA 5KFHA 2OXOA 3IM1A 2BKEA 2BQRA 5KT5A 5DBAA 1NJWA 4KITB 3KFUF 2XY7A 3C2MA 5J0WA 1T7PA 2CXYA 4KLMA 5AKYA 4F4ZA 3RJGA 4C8NA 3LK9A 1TK5A 3FDSA 4MF2A 5KFUA 3AQFA 1A6SA 4IQWA 2KV2A 1SKRA 2H5XA 2KEYA 2F1HA 5KTQA 1ZQAA 3TI0A 5F3XB 1RYSA 2G5HB 3WKCA 5ALEA 2G0AA 3NRZA 4GXJA 4JUZA 4IC9A 7ICKA 2K8CB 4YD2A 2QB0A 1VDVA 5AK3A 4UB3A 2BQ3A 5KNIA 4KLOA 4GXIA 1HJPA 2FDRA 5EE0A 3JPOA 1ZQWA 5KT2A 2OCEA 1ED1A 4NY8A 3TAPA 5DLGA 2HSZA 3RB0A 4KLSA 3K4GA 3TFRA 1FIQA 1PK1A 2W11A 1LKYA 4UB8U 5KG1A 2V4RA 1L3UA 3RBEA 2GLEA 3SAGA 3SENA 3BQTA 8ICQA 1V38A 5CHGA 4YMNA 1ZD3A 2MRLA 1RZTA 5EE9A 4ECZA 2WB1C 4ED0A 4UAZA 3D2SA 2Y0SF 9ICUA 3C21A 2AH5A 2KFNA 2JGAA 5IIJA 3RR7A 5KFAA 4U6PA 1XSLA 3ZD8A 5J0RA 4C0ZA 1ZQHA 7ICFA 5B66U 1QSYA 2K4EA 2VJ5A 3VC8A 2ZG6A 2ASDA 4UB5A 3SI8A 2HHTA 4DCCA 5EE3A 3AEVA 3MFIA 5BOLA 3QU7A 5J2AA 3RR8A 3H8SA 1NK9A 1ZQFA 2NYVA 5HMMA 3Q8RB 1Q3VA 1BPZA 1ZD2P 4QWEA 1J97A 3MR5A 2FMSA 4I2GA 1XWLA 2B21A 5F9LA 2YMMA 1TAUA 4XA5A 2AXTU 2OM6A 1F44A 4Z6CA 5KT7A 4UB6U 3ISBA 1KQQA 1URJA 5KFOA 2DBYA 3GILA 3F2BA 5AI6A 3HKZC 2KZMA 3C28A 7ICQA 4ICAA 2R8KA 3KHRA 2JZBA 2QB0B 2NRXA 4F4WA 2WF6A 2KN7A 3RJFA 1VLBA 5ALDA 4KMOB 3U26A 1YZ7A 4Y2JA 4QWAA 1PVRA 4QIWC 5A0LA 4DSEA 1S8OA 1S0VA 2A1AA 4RQMA 3UXPA 2XGPA 4Y2UA 5DG7A 3RFAA 1ZQ1C 1X2IA 7ICUA 4DL5A 1S97A 2HHSA 1PK1B 1LKYB 5EWFA 2WF7A 5AK4A 3UM9A 2B0CA 3BQ0A 3ISCA 1JMSA 2VKQA 4PH5A 4NLCA 4I27A 2DPJA 1OXJA 2D8CA 4Q44A 4RZRA 3B9JA 3I28A 9ICXA 3GIKA 5AI5A 2Q4TA 4R65A 5AKJA 2XCAA 3PR5B 8ICKA 4TUQA 1SB3C 2NO5A 5KFEA 4RNMA 4KLLA 1B43A 5ALPA 1NK5A 2NO4A 2KMDA 4NM1A 8ICSA 3JPQA 1XSNA 4DS5A 3RF9A 3SD7A 4TURA 3C23A 4DO9A 3BS5A 1BPYA 2ZTDA 1QQ5A 4FE3A 5HMLA 5J29A 2ISPA 9ICHA 1WWVA 4F4XA 4PGXA 4DL3A 1RDFA 4JWNA 4QW9A 2GO7A 2LPEA 1SV4A 1X9WA 1KDHA 3ZDEA 2OWOA 4O3MA 1SXEA 2FI1A 2WTFA 2W04A 3T3FA 1XU4A 5D49A 8ICLA 1ZQDA 4I2DA 2JR5A 3PO4A 3PO5A 9ICKA 2LBOA 4DOAA 3GDXA 7ICRA 5DDMA 5KL1B 2DL0A 5J0PA 4AP9A 3CP8A 2XCPA 4BXOB 4G3IA 1ZQBA 1RXWA 2LYBA 4CRXA 1KW4A 1X40A 3RJHA 3BQ1A 2JZBB 2DQNB 3NVYA 1CRXA 3HRDD 3AUOA 3V7KA 1KRPA 5L1KA 4TUPA 4KMUA 2HBKA 8ICYA 3LWLA 1KEJA 1TK8A 2BCQA 3T79A 5J0OA 9ICLA 2XY6A 4QWDA 4M0AA 3V6JA 4I2AA 2DKZA 4ED6A 4IQUA 2FLNA 5DQIA 2E8PA 5ALRA 2CRXA 4OCZA 3BDPA 1O08A 2W9AA 4KLIA 4C4SA 8ICHA 5AI4A 3JPNA 4C8MA 3PW7A 2KSOA 4DFKA 2EZZA 2AHOB 4TQSA 1Z00A 2A3VA 1PZNA 4JMUA 1NK4A 2VJ4A 2NRVA 2HBLA 3H4DA 1TE2A 2FLLA 3AQEA 5BOMA 3GV5B 5EOZA 4P4PA 1SL2A 4ZOHC 4P0PA 3D2NA 5DB8A 1QQ6A 4RQ5A 3QZ7A 4RQ6A 1O03A 2WB1F 4ED1A 4EZ9A 4US9A 4GXKA 2G08A 4KLGA 2HOQA 4P0QA 7ICOA 3RB3A 4IRDA 3AU2A 5KFYA 9ICCA 3T5KA 2GOLA 4M2YA 5DG9A 3BS5B 4EYIB 4FFDA 4KTQA 5DB6A 9ICPA 1COOA 4CNQA 4IR9A 3GQCA 2PFOA 2XIDA 5HHHA 2PFQA 2YN4A 2KJ9A 2NRWA 2PMZC 5IIKA 2EZYA 2YB4A 4JV1A 2AQ0A 1UHUA 1T3QA 5DQHA 3WK4A 2IA6A 3SAHA 4ED2A 3SMVA 3QUCA 4DFJA 4OO1J 2H3VA 4UARA 3M9MB 4Q8EA 3PMNA 1H38A 5C0YA 1U45A 4O5CA 2K60A 3RB4A 2LYHA 1RM6C 8ICZA 3IP4B 2W3RA 5IIIA 5J8YA
chains in the Genus database with same CATH topology
5F3XB 2QKQA 3H8MA 1X66A 4IS7A 2KSOA 2QARB 4MHVA 5JRTA 2KMDA 2QB0A 2E8NA 1B0XA 2D3DA 2EANA 5KNIA 3BS5A 2DKXA 2KG5A 5JTIA 5JU5A 2KE7A 1Z1VA 1OW5A 2F44A 1V85A 1WWVA 1B4FA 1DXSA 3KKAA 1UQVA 2LPEA 1SV4A 2KSOB 2ESEA 2KIVA 3BQ7A 4NJ8A 1UCVA 2EAPA 1PK1A 1LKYA 1SV0A 2QB0B 2F8KA 2EAOA 3IDWA 4RQNA 1PK3A 1SXEA 2GLEA 4PZNA 1RG6A 3SENA 2L5YA 1V38A 2Y9TA 3BS5B 3K1RB 1SXDA 2YTUA 2ES6A 2F3NA 3SEIA 1WWUA 2EAMA 2DL0A 3TADA 2B6GA 2FE9A 1COKA 4NL9C 2LMRA 4RQMA 2E8OA 5J8YC 2E8MA 3HILA 3KKAC 1KW4A 1X40A 1PK1B 1LKYB 3BS7A 5L1MA 2JV3A 1SV0C 2QARA 3TACB 2Y9UA 2K4PA 2QB1A 1OXJA 2D8CA 4PZOA 1X9XA 2K60A 2DKZA 1F0MA 1JI7A 3TADC 4NL9A 1SGGA 2E8PA 5J8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3X B;  2QKQ A;  3H8M A;  1X66 A;  4IS7 A;  2KSO A;  2QAR B;  4MHV A;  5JRT A;  2KMD A;  2QB0 A;  2E8N A;  1B0X A;  2D3D A;  2EAN A;  5KNI A;  3BS5 A;  2DKX A;  2KG5 A;  5JTI A;  5JU5 A;  2KE7 A;  1Z1V A;  1OW5 A;  2F44 A;  1V85 A;  1WWV A;  1B4F A;  1DXS A;  3KKA A;  1UQV A;  2LPE A;  1SV4 A;  2KSO B;  2ESE A;  2KIV A;  3BQ7 A;  4NJ8 A;  1UCV A;  2EAP A;  1PK1 A;  1LKY A;  1SV0 A;  2QB0 B;  2F8K A;  2EAO A;  3IDW A;  4RQN A;  1PK3 A;  1SXE A;  2GLE A;  4PZN A;  1RG6 A;  3SEN A;  2L5Y A;  1V38 A;  2Y9T A;  3BS5 B;  3K1R B;  1SXD A;  2YTU A;  2ES6 A;  2F3N A;  3SEI A;  1WWU A;  2EAM A;  2DL0 A;  3TAD A;  2B6G A;  2FE9 A;  1COK A;  4NL9 C;  2LMR A;  4RQM A;  2E8O A;  5J8Y C;  2E8M A;  3HIL A;  3KKA C;  1KW4 A;  1X40 A;  1PK1 B;  1LKY B;  3BS7 A;  5L1M A;  2JV3 A;  1SV0 C;  2QAR A;  3TAC B;  2Y9U A;  2K4P A;  2QB1 A;  1OXJ A;  2D8C A;  4PZO A;  1X9X A;  2K60 A;  2DKZ A;  1F0M A;  1JI7 A;  3TAD C;  4NL9 A;  1SGG A;  2E8P A;  5J8Y A; 
#chains in the Genus database with same CATH topology
 4DL6 A;  5KFP A;  2W8K A;  2I5H A;  5HHI A;  4PL1 A;  2ALZ A;  4DFP A;  4IRC A;  3L5K A;  3UPQ A;  3NGD A;  4BGD A;  4IRK A;  1KSP A;  4RT3 A;  2E8N A;  1SWV A;  2LI6 A;  3ZD9 A;  1ZQJ A;  4XUS A;  1L6N A;  4FBT A;  3UQ2 A;  5J0U A;  1BNO A;  4DSK A;  1CI4 A;  3H0M B;  4QIW F;  9ICM A;  2WFA A;  2KSO B;  4C4R A;  5L1L A;  9ICQ A;  4DF8 A;  4DLG A;  3KZI U;  2KJ8 A;  3BZC A;  4F91 B;  5CB1 A;  2MA1 A;  2R8J A;  5AK5 A;  2GH1 A;  5ALW A;  5EE1 A;  5AK6 A;  2L5Y A;  1BPE A;  3D2Q A;  1A76 A;  1SXD A;  5ALL A;  2H3Q A;  5E79 U;  2ZIV A;  3E58 A;  5KG4 A;  2VA2 A;  4CF3 A;  3C5G A;  3N7R C;  1ZYQ A;  9ICN A;  4P0P B;  2H3Z A;  4UBC A;  9ICV A;  1C7Y A;  1L8L A;  1DOQ A;  3ZDC A;  4Q8F A;  4CDG A;  4QZD A;  8ICR A;  2OEH A;  1N62 A;  5J0Q A;  2HOI A;  2VAN A;  4R66 A;  4P0Q B;  2QLT A;  4ECV A;  2PFN A;  4EBD A;  2JV3 A;  4B6J A;  4B9S A;  2RP5 A;  2H3F A;  4NM2 A;  5CEH A;  1Y88 A;  1X9M A;  9ICR A;  4RU9 A;  1QQ7 A;  1NKE A;  5J2F A;  4MFF A;  1NJY A;  1BPD A;  3N28 A;  2IBK A;  1RXV A;  1CUK A;  2BHN A;  2F2A B;  4NL9 A;  1BPX A;  2K4H A;  4Y2Q A;  1X9S A;  4C80 A;  8ICU A;  4YG2 A;  2ZUC A;  2V9W A;  5ALG A;  4C7Y A;  9ICG A;  2I1Q A;  4WJ3 B;  4DLE A;  4QZC A;  4CGZ A;  3SYZ A;  4NXZ A;  2ZUB A;  8ICN A;  4K4I A;  4O9M A;  4QW8 A;  5D46 A;  4J9S A;  4NLB A;  2KVC A;  4P2H A;  1BVS A;  1ZRM A;  1K1Q A;  2XI9 A;  2I6X A;  1L7M A;  3Q8S B;  1L7O A;  4UB1 A;  3IN5 A;  2EAP A;  2W9B A;  1CEZ A;  1SV0 A;  3QEA Z;  2IOF A;  5IIN A;  5AKI A;  1ZQL A;  2ES6 A;  3MBY A;  3RH5 A;  5DLF A;  4RT2 A;  1WCL A;  2HBJ A;  5KG2 A;  3SQI A;  2E1E A;  1NK0 A;  1BNP A;  1BPB A;  5KFC A;  1Z3E B;  5EWG A;  1Q46 A;  3QUT A;  4LZG A;  2AGQ A;  4CCH A;  5ALH A;  2HW3 A;  5ALU A;  3WK7 A;  4DOC A;  3WK9 A;  3BS7 A;  5ALI A;  4J03 A;  3WKD A;  2WAQ C;  1TAM A;  1XO0 A;  1JX4 A;  2HCF A;  3K1Z A;  1N5X A;  4R64 A;  4JV0 A;  3H8J A;  3HPO A;  1NI3 A;  2G07 A;  2WF8 A;  2K4P A;  2Y1I A;  1ECW A;  9ICB A;  4QZA A;  3QU9 A;  1X9X A;  2A1J A;  3PW4 A;  5HP4 A;  4Q43 A;  1SKS A;  3AMZ A;  5AM5 A;  4X5V A;  5ALM A;  1K5O A;  2DF4 B;  5KAI U;  3GV8 B;  4ECX A;  2EQY A;  3GFK B;  9ICF A;  3ICX A;  2M0N A;  3Q8M A;  3JPR A;  1IG6 A;  3V7L A;  1QSS A;  2WHE A;  2YMQ A;  1NOM A;  1KLN A;  2E3T A;  1MN8 A;  4ELT A;  5JTI A;  1HIW A;  5KFM A;  2KD1 A;  3NVZ A;  3R9K A;  2FLP A;  3KKA A;  4KLH A;  1UQV A;  4PHD A;  4YR3 A;  2IHN A;  5HNK A;  5J2K A;  3BQ7 A;  1JUD A;  4UBB A;  3M9O B;  4YMO A;  7ICG A;  3Q8Q B;  1SL0 A;  4MEX A;  1RG6 A;  2PMZ F;  5AI8 A;  1XS9 D;  2ZIW A;  3SAF A;  1MQ3 A;  5HR6 A;  1JAL A;  2WF9 A;  4ECS A;  2J6U A;  5ALQ A;  3MGH A;  2FE9 A;  2LMR A;  2XVT A;  2R18 A;  4EBC A;  2KK0 A;  1X42 A;  1S76 D;  3D6J A;  4TQR A;  3MGI A;  2W9B B;  4CF5 A;  5KT6 A;  1NJX A;  2LM4 A;  2HHU A;  5F9N A;  5CR0 A;  2XIC A;  4FO6 A;  4BWM A;  3GZF A;  4M9J A;  3N97 B;  4QZG A;  4M9G A;  2ODG A;  4DL4 A;  4RPY A;  5CA7 A;  2YML A;  3M8S A;  1UT5 A;  5G5H A;  3PZP A;  4M9N A;  1ZQR A;  1Q3U A;  1PVQ A;  4KLF A;  3V6K A;  8ICB A;  2JRZ A;  4PJ0 U;  8ICV A;  3KD3 A;  1L3V A;  4OJ6 A;  1T8E A;  4KLD A;  2KOB A;  2C2E A;  5J0X A;  4YN4 A;  5J2C A;  1S77 D;  3PW0 A;  5ALK A;  8ICW A;  5TIS U;  2XO7 A;  2W7O A;  4GC6 A;  4C8L A;  2EAN A;  3C5F A;  2F77 X;  3UXN A;  2A1J B;  4QZ8 A;  3PW5 A;  2DKX A;  1MA7 A;  3LDA A;  2W9M A;  4DSJ A;  3BJY A;  1V85 A;  3TAN A;  4Y2T A;  4QZH A;  1ZQY A;  2JHD A;  1X6J A;  2RRD A;  4M9L A;  4M6W A;  4Y2X A;  1NZP A;  4NLG A;  3WKB A;  5ALJ A;  4F5N A;  4PZN A;  2KKP A;  3I1Y A;  2HBM A;  2XY5 A;  5ALO A;  4LVS A;  4M9H A;  2HMX A;  4I2H A;  4EBE A;  4QWC A;  4ED8 A;  4Y2S A;  3FC4 A;  5AI9 A;  1VJ5 A;  2JMG A;  1V97 A;  3THV A;  9ICI A;  3HJE A;  5J0S A;  1U49 A;  1J2M A;  1XO1 A;  3HT3 A;  5DBC A;  1RPL A;  2KTQ A;  2AQ4 A;  3RRG A;  7ICI A;  2F1I A;  2RQ5 A;  5H2F U;  3Q8P B;  1ZQT A;  2ZIW B;  5AKL A;  1NJZ A;  1SV0 C;  1Z19 A;  5DGB A;  2MUT A;  3NUQ A;  1S9F A;  3NAS A;  3F2C A;  4FS1 A;  4PZO A;  2JXJ A;  4F2R A;  1KN5 A;  3KHG A;  3PNC A;  1S0M A;  2RLT A;  1P7D A;  3QU4 A;  3Q8K A;  4PHA A;  3C29 A;  5KFK A;  3ONN A;  2KZ3 A;  4UAY A;  2G06 A;  1QCK A;  2V4Q A;  1JXL A;  2LYA A;  4ECQ A;  4KX5 A;  2C22 A;  2MAX A;  4GIB A;  5J2I A;  2HHX A;  3DEE A;  3ZI4 A;  4P4M A;  5KFJ A;  5ALN A;  3QU2 A;  3CW2 C;  3M1Y A;  1MQ2 A;  1LVH A;  2DPI A;  2P35 A;  1LV5 A;  5AKZ A;  3B0Y A;  1BGX T;  2OYY A;  2PKE A;  1ZJM A;  2LM1 A;  2YMP A;  1HUZ A;  1KBU A;  1YZ6 A;  2K4I A;  4RQ4 A;  2W43 A;  4US8 A;  3MR6 A;  2F8L A;  8ICI A;  4I2C A;  4NJ8 A;  4ECR A;  3QE9 Y;  4GLX A;  3RJI A;  2EAO A;  3OSN A;  5KFX A;  2JH7 A;  3WK6 A;  5DKW A;  5J2E A;  5AKK A;  1SKW A;  4DQP A;  5T14 A;  5AIB A;  1HUO A;  2BCU A;  1JXE A;  4BX9 C;  2WAQ F;  4I29 A;  4MFA A;  3QUQ A;  3M6K A;  1L3T A;  4FZN A;  4R63 A;  1UT8 A;  2BCV A;  7ICJ A;  3QZ8 A;  4OJ5 A;  4M6W B;  1SL1 A;  3KKA C;  4YFK A;  3E0F A;  4E0D A;  4HYK A;  8ICP A;  3N4M B;  1F5S A;  3IV6 A;  1L8O A;  5IIO A;  1ZOL A;  4Y2R A;  2HHV A;  3M7D A;  3C2L A;  3LYS A;  1LB2 B;  1U4B A;  1N5W A;  1SZH A;  2IHM A;  3OSP A;  4F8R A;  3V72 A;  4NLN A;  4NV0 A;  1IXR A;  3OPX A;  4A8E A;  3LVV A;  3LVW A;  1F0M A;  2J6T A;  2KIW A;  3JPT A;  4DQS A;  1ZET A;  3OJU A;  4PL2 A;  1SGG A;  1WCN A;  3JPP A;  2EDU A;  4RNN A;  2QKQ A;  1D8B A;  3WKA A;  3V7J A;  4YXJ A;  4F5O A;  4KLE A;  2XC9 A;  4DQI A;  1SZP A;  3NTU A;  4QZB A;  5JRT A;  4Y2V A;  5AM4 A;  3DV9 A;  4PHP A;  3KOO A;  1OUQ A;  3BQ2 A;  1T94 A;  4RUA A;  2KG5 A;  2KKV A;  4G9B A;  5KFB A;  2IOH A;  1IM4 A;  1X6I A;  5KFW A;  3PX6 A;  3ISD A;  1T3N A;  3WKE A;  4FZM A;  1NZB A;  4F72 A;  5K4L A;  1N60 A;  2Q0Z X;  3C1Y A;  8ICE A;  4C7Z A;  3H40 A;  3PW2 A;  4F93 B;  3HKZ F;  4YR0 A;  3PY8 A;  4J9Q A;  4KLJ A;  2KVS A;  3PML A;  2C2D A;  2ZXH A;  1JN3 A;  3HP6 A;  1Z4O A;  5DG8 A;  8ICM A;  5JUM A;  2GWS A;  4LZD A;  3EPG A;  2NV3 A;  1UPH A;  3K1R B;  4Z6D A;  2C2R A;  2JEI A;  2LKY A;  1L7N A;  2FPM A;  1WWU A;  1TFR A;  2B6G A;  2K89 A;  4I2E A;  3RH6 A;  4O3N A;  2W7P A;  2A19 A;  5J2D A;  1K1S A;  2FMQ A;  4J9N A;  1Z00 B;  4C4T A;  5GTH U;  1TVA A;  3OHA A;  4XQ8 A;  2PFP A;  2H3I A;  2YQE A;  3A0B U;  5FP0 A;  3RAX A;  1N56 A;  1ZQG A;  3RBD A;  4F2S A;  2YY6 A;  2HHW A;  2IOF K;  2LHT A;  3WK8 A;  1IIP A;  4C8O A;  1D9F A;  4J9O A;  1A77 A;  4O5E A;  7ICN A;  2BGW A;  2UVR A;  1ARO P;  1XSP A;  4OJO A;  4BDP A;  1JI7 A;  4J9M A;  4UW9 A;  3T5J A;  4ZH4 A;  3ZDD A;  3LWM A;  2VA8 A;  2AJQ A;  8ICJ A;  4JWM A;  3KBB A;  2ASL A;  3TAQ A;  3ZDA A;  3S6J A;  1QSL A;  1ZQP A;  5ALZ A;  5GTI U;  3BZK A;  1ZQX A;  3ORY A;  1ZQO A;  5JU5 A;  2EZX A;  3SR6 A;  1FFV A;  3HW8 A;  4RUC A;  4JB3 A;  1Z1V A;  4DFD A;  1OW5 A;  1TAQ A;  4F71 A;  3WK5 A;  4F5Q A;  4YMM A;  5IIL A;  1A0P A;  4EZ6 A;  3MC1 A;  7ICS A;  4NLZ A;  4ED7 A;  4B9V A;  3FYH A;  2E1F A;  2ZJ8 A;  3IDW A;  2PI5 A;  5EWE A;  4JV2 A;  3RRH A;  8ICA A;  5G5G A;  1U47 A;  2W3S A;  1ZXI A;  2UVU A;  2Y9T A;  4K4H A;  2E5S A;  4RQ2 A;  3SEI A;  3RAQ A;  1S5L U;  2DFL A;  2UVW A;  2ISO A;  5AIC A;  2O6K A;  2DUY A;  7ICL A;  3F5E A;  1EXN A;  3GIM A;  1FEZ A;  2E8M A;  4FS2 A;  3NRW A;  4F4Y A;  5L9X A;  3QYP A;  5KL8 B;  1L7P A;  2F1J A;  2ZJA A;  4YP3 A;  4YXM A;  5L1M A;  8ICG A;  3IHQ B;  3K75 D;  4RPX A;  2HI0 A;  4UAU A;  1RQL A;  4P4O A;  4HAI A;  4YCX A;  3F2D A;  2VIX A;  4F92 B;  4J9K A;  3TFS A;  3HX0 A;  4O0I A;  3H7I A;  1ZD4 A;  1TV9 A;  3AL0 B;  4IQT A;  4GC7 A;  4M47 A;  2W03 A;  2BZF A;  1ZQN A;  1IV8 A;  2RDI A;  3F5A A;  4QZE A;  3KHL A;  3MGV A;  1X66 A;  2ZIV B;  2AGO A;  4MHV A;  4O3O A;  3MDC A;  3VCB A;  3PR4 A;  4QWB A;  5KFT A;  2C28 A;  5AKG A;  4RQ0 A;  4YVZ A;  3WU2 U;  5KG7 A;  3UQ0 A;  4ECU A;  2KE7 A;  4B9L A;  3QEB Z;  1SIJ A;  2WF5 A;  2PI4 A;  8ICT A;  4UB2 A;  5AKH A;  3KZX A;  4F4K A;  9ICO A;  3SV4 A;  9ICA A;  2MU2 A;  4DL2 A;  2ESE A;  5J2H A;  7ICE A;  4DOB A;  4MFC A;  3JPS A;  3GIJ A;  1Z4N A;  2ZIX A;  5AIA A;  4F3O A;  3EUB 2;  5J0Y A;  3V6H A;  1ZQM A;  2HHQ A;  2YB1 A;  2JEF A;  7ICT A;  2EH9 A;  4JK1 A;  3KTQ A;  1KL9 A;  1T4G A;  4B9T A;  3IRU A;  3PV8 A;  4DS4 A;  1XNS A;  2FJ6 A;  3TAR A;  2W54 A;  4UQG A;  3RB6 A;  1QTM A;  5J8Y C;  3EWA A;  5KG0 A;  2R8G A;  2G5I B;  3TQ1 A;  4Q45 A;  1S0O A;  2HOF A;  4YR2 A;  4O5K A;  5KFG A;  2QAR A;  3TAC B;  3PVX A;  1RQN A;  1ZQU A;  3SZ2 A;  2ASJ A;  5AKX A;  1ZQV A;  2QB1 A;  2KHV A;  3PX0 A;  2IMW P;  5BPC A;  1FFU A;  1RYU A;  3CRX A;  4Y2P A;  4BXO A;  3ETL A;  3H8M A;  1MC8 A;  4USA A;  4GFJ A;  3T5H A;  4UAT A;  2XGQ A;  5ALF A;  4TUS A;  9ICT A;  4PGQ A;  4IL6 U;  1RYR A;  1PUZ A;  3H0R B;  5AKE A;  4QZF A;  4AYB C;  2ZTE A;  5AM2 A;  1KKX A;  1ZQE A;  3ZDB A;  1JIH A;  3HWT A;  2PXI A;  4MF8 A;  3H8W A;  3H4B A;  3KHH A;  5KG3 A;  4Y2Y A;  4ACO A;  5DB7 A;  2KIV A;  1N2X A;  4EEN A;  4DL7 A;  2DGZ A;  2BPC A;  2NRZ A;  4QNL A;  1SWW A;  4QJF B;  3CYM A;  5ALV A;  2CN1 A;  3IG8 A;  1PK3 A;  1ZQC A;  7ICV A;  5AM1 A;  3QX7 A;  3QNM A;  2P66 A;  1DRG A;  2HVH A;  4DQR A;  2KJ5 A;  5J2B A;  1KFS A;  1N61 A;  1C20 A;  3TAD A;  3T5L A;  4M04 A;  3G6X A;  4NL9 C;  1Q8K A;  5KFQ A;  1NKB A;  3L3F X;  3RJJ A;  1S0N A;  5KFS A;  2JEG A;  2VA3 A;  2HDO A;  5KFL A;  3EZ5 A;  5ALX A;  2ZIX B;  1U9L A;  2K8A A;  8ICO A;  7ICP A;  2AGP A;  2DWQ A;  4EEK A;  1NKC A;  5KT3 A;  4ELU A;  4FZL A;  4J9R A;  5KFR A;  3NVW A;  3MDA A;  1NK6 A;  4BWJ A;  2KP7 A;  5DBB A;  4UAS A;  3PX4 A;  1D8Y A;  2D6F C;  1J2N A;  5DDY A;  5IIM A;  1ZQZ A;  5DB9 A;  5KFZ A;  4PGY A;  4BJQ A;  3GII A;  5KFV A;  2G09 A;  3PSP A;  4OJL A;  3OHB A;  2NRT A;  1FO4 A;  3MR2 A;  2HVI A;  2RHF A;  5L1I A;  4PPX A;  4IS7 A;  3NS1 A;  4CF4 A;  2QAR B;  2W9C A;  2W8L A;  1DK3 A;  3G6V A;  3QUB A;  3M6Z A;  5ALS A;  4J9L A;  1B0X A;  3I76 A;  4EX7 A;  4I2F A;  4UAW A;  2FPK A;  1S10 A;  2MSN A;  3GV7 B;  2R8I A;  3QXG A;  1DXS A;  3RJE A;  2KFZ A;  3N7P D;  4DFM A;  3PST A;  1ZQI A;  3IG5 A;  1DGS A;  2FMP A;  3MFH A;  4O3S A;  3RTV A;  2BQU A;  3UXO A;  3L4P A;  4B9N A;  4RNO A;  4RQN A;  5DGA A;  2ZIU A;  1ZQK A;  4EEY A;  2CPR A;  4XRH A;  3OGU A;  3G6Y A;  4J9P A;  1L3S A;  2UVV A;  2YTU A;  9ICE A;  2F3N A;  2BDU A;  3GU3 A;  2EAM A;  8ICF A;  3M8R A;  1Z1B A;  5AHX A;  5C5J A;  1COK A;  5CP2 A;  2N1R A;  1KTQ A;  2R8H A;  3PSI A;  2Z7J A;  4Z6E A;  4DEZ A;  2BCR A;  4BUG A;  4Z6F A;  4EYH B;  3QU5 A;  1QH9 A;  4KX3 A;  3Q8L A;  2Y1J A;  4EEL A;  3FAH A;  1WYG A;  2Y0S C;  1JRP A;  9ICW A;  2F76 X;  2Y9U A;  4RQ8 A;  2OHF A;  3ED5 A;  2BCS A;  1D8L A;  2W55 A;  4UAV A;  4O3Q A;  5CWR A;  2BPG A;  5CJ7 A;  2AU0 A;  2KIC A;  4CE6 A;  2BR0 A;  3N7S C;  9ICS A;  8ICC A;  3C2K A;  4R8U A;  1U48 A;  1WUD A;  4EX6 A;  4DSF A;  5DQG A;  5KFI A;  1ZQQ A;  1N63 A;  4RQ3 A;  5ALY A;  1HEK A;  3J81 j;  1DGJ A;  4I2J A;  5AM0 A;  4MEY A;  4IQV A;  5KG5 A;  4RQ1 A;  3M9N B;  3PSF A;  2RDJ A;  4KLU A;  7ICH A;  3EYZ A;  5KFD A;  2W9C B;  3UMB A;  3RH4 A;  4K4G A;  2MUT B;  4F50 A;  3RJK A;  3FM9 A;  3F53 A;  2ZXI A;  1NK7 A;  4FBU A;  4C8K A;  3AU6 A;  3O0F A;  2K8B B;  2ATL A;  1AQ6 A;  1ZD5 A;  1ZJN A;  3EPI A;  1UA0 A;  4LJX A;  4DF4 A;  2I9G A;  4NWI A;  2BPF A;  2ZJ5 A;  2OH2 A;  3TKA A;  2E8O A;  1XC9 A;  4OJP A;  3HIL A;  3H0L B;  4I2I A;  5KG6 A;  5KAF U;  4O3P A;  5J2G A;  4KLT A;  4KN7 A;  2ZIU B;  3ETR A;  3E2E A;  5KFN A;  4OD0 A;  3DDH A;  5ALT A;  4QZI A;  2J6S A;  2KZZ A;  3ALR A;  4B9M A;  2ZTC A;  4U7C A;  8ICX A;  1N48 A;  1DK2 A;  1YT3 A;  3TAD C;  3A0H U;  1B22 A;  3MAB A;  3AM9 A;  7ICM A;  4NLK A;  3UMC A;  4AYB F;  3MR3 A;  2JEJ A;  1ZQS A;  5KT4 A;  5AI0 A;  4F5P A;  4UB4 A;  3B0X A;  4I2B A;  1KFT A;  4RQ7 A;  4RPZ A;  5L1J A;  3OTQ A;  3C1Z A;  5HR7 A;  2D3D A;  5TZV A;  4IR1 A;  1KFD A;  1JRO A;  3OJS A;  1TKD A;  1NNL A;  1TK0 A;  3NVV A;  2JH1 A;  1L5U A;  4DWI A;  5J2J A;  1QLN A;  4I28 A;  2M9N A;  1V9P A;  4DSI A;  4YD1 A;  1UA1 A;  1M6Y A;  2FPL A;  2F44 A;  2KHQ A;  9ICJ A;  1B4F A;  3UMG A;  5CRX A;  4QZ9 A;  4KLQ A;  3CNH A;  4R8U B;  4O3R A;  3AN1 A;  4ELV A;  3EW9 A;  5D4B A;  1D9D A;  4ECT A;  1UCV A;  1PVP A;  5AM3 A;  2P6U A;  2F8K A;  4KN4 A;  2ZUD A;  1ZRN A;  4DSL A;  2YX8 A;  4PHE A;  1NK8 A;  1MSW D;  5B5E U;  4YQW A;  4F5R A;  3SV3 A;  2P6R A;  4DQQ A;  4ECW A;  1GO3 F;  2BDP A;  4B9U A;  5J0T A;  1WG8 A;  4ED3 A;  2KNJ A;  5KFF A;  4ECY A;  5KFH A;  2OXO A;  3IM1 A;  2BKE A;  2BQR A;  5KT5 A;  5DBA A;  1NJW A;  4KIT B;  3KFU F;  2XY7 A;  3C2M A;  5J0W A;  1T7P A;  2CXY A;  4KLM A;  5AKY A;  4F4Z A;  3RJG A;  4C8N A;  3LK9 A;  1TK5 A;  3FDS A;  4MF2 A;  5KFU A;  3AQF A;  1A6S A;  4IQW A;  2KV2 A;  1SKR A;  2H5X A;  2KEY A;  2F1H A;  5KTQ A;  1ZQA A;  3TI0 A;  5F3X B;  1RYS A;  2G5H B;  3WKC A;  5ALE A;  2G0A A;  3NRZ A;  4GXJ A;  4JUZ A;  4IC9 A;  7ICK A;  2K8C B;  4YD2 A;  2QB0 A;  1VDV A;  5AK3 A;  4UB3 A;  2BQ3 A;  5KNI A;  4KLO A;  4GXI A;  1HJP A;  2FDR A;  5EE0 A;  3JPO A;  1ZQW A;  5KT2 A;  2OCE A;  1ED1 A;  4NY8 A;  3TAP A;  5DLG A;  2HSZ A;  3RB0 A;  4KLS A;  3K4G A;  3TFR A;  1FIQ A;  1PK1 A;  2W11 A;  1LKY A;  4UB8 U;  5KG1 A;  2V4R A;  1L3U A;  3RBE A;  2GLE A;  3SAG A;  3SEN A;  3BQT A;  8ICQ A;  1V38 A;  5CHG A;  4YMN A;  1ZD3 A;  2MRL A;  1RZT A;  5EE9 A;  4ECZ A;  2WB1 C;  4ED0 A;  4UAZ A;  3D2S A;  2Y0S F;  9ICU A;  3C21 A;  2AH5 A;  2KFN A;  2JGA A;  5IIJ A;  3RR7 A;  5KFA A;  4U6P A;  1XSL A;  3ZD8 A;  5J0R A;  4C0Z A;  1ZQH A;  7ICF A;  5B66 U;  1QSY A;  2K4E A;  2VJ5 A;  3VC8 A;  2ZG6 A;  2ASD A;  4UB5 A;  3SI8 A;  2HHT A;  4DCC A;  5EE3 A;  3AEV A;  3MFI A;  5BOL A;  3QU7 A;  5J2A A;  3RR8 A;  3H8S A;  1NK9 A;  1ZQF A;  2NYV A;  5HMM A;  3Q8R B;  1Q3V A;  1BPZ A;  1ZD2 P;  4QWE A;  1J97 A;  3MR5 A;  2FMS A;  4I2G A;  1XWL A;  2B21 A;  5F9L A;  2YMM A;  1TAU A;  4XA5 A;  2AXT U;  2OM6 A;  1F44 A;  4Z6C A;  5KT7 A;  4UB6 U;  3ISB A;  1KQQ A;  1URJ A;  5KFO A;  2DBY A;  3GIL A;  3F2B A;  5AI6 A;  3HKZ C;  2KZM A;  3C28 A;  7ICQ A;  4ICA A;  2R8K A;  3KHR A;  2JZB A;  2QB0 B;  2NRX A;  4F4W A;  2WF6 A;  2KN7 A;  3RJF A;  1VLB A;  5ALD A;  4KMO B;  3U26 A;  1YZ7 A;  4Y2J A;  4QWA A;  1PVR A;  4QIW C;  5A0L A;  4DSE A;  1S8O A;  1S0V A;  2A1A A;  4RQM A;  3UXP A;  2XGP A;  4Y2U A;  5DG7 A;  3RFA A;  1ZQ1 C;  1X2I A;  7ICU A;  4DL5 A;  1S97 A;  2HHS A;  1PK1 B;  1LKY B;  5EWF A;  2WF7 A;  5AK4 A;  3UM9 A;  2B0C A;  3BQ0 A;  3ISC A;  1JMS A;  2VKQ A;  4PH5 A;  4NLC A;  4I27 A;  2DPJ A;  1OXJ A;  2D8C A;  4Q44 A;  4RZR A;  3B9J A;  3I28 A;  9ICX A;  3GIK A;  5AI5 A;  2Q4T A;  4R65 A;  5AKJ A;  2XCA A;  3PR5 B;  8ICK A;  4TUQ A;  1SB3 C;  2NO5 A;  5KFE A;  4RNM A;  4KLL A;  1B43 A;  5ALP A;  1NK5 A;  2NO4 A;  2KMD A;  4NM1 A;  8ICS A;  3JPQ A;  1XSN A;  4DS5 A;  3RF9 A;  3SD7 A;  4TUR A;  3C23 A;  4DO9 A;  3BS5 A;  1BPY A;  2ZTD A;  1QQ5 A;  4FE3 A;  5HML A;  5J29 A;  2ISP A;  9ICH A;  1WWV A;  4F4X A;  4PGX A;  4DL3 A;  1RDF A;  4JWN A;  4QW9 A;  2GO7 A;  2LPE A;  1SV4 A;  1X9W A;  1KDH A;  3ZDE A;  2OWO A;  4O3M A;  1SXE A;  2FI1 A;  2WTF A;  2W04 A;  3T3F A;  1XU4 A;  5D49 A;  8ICL A;  1ZQD A;  4I2D A;  2JR5 A;  3PO4 A;  3PO5 A;  9ICK A;  2LBO A;  4DOA A;  3GDX A;  7ICR A;  5DDM A;  5KL1 B;  2DL0 A;  5J0P A;  4AP9 A;  3CP8 A;  2XCP A;  4BXO B;  4G3I A;  1ZQB A;  1RXW A;  2LYB A;  4CRX A;  1KW4 A;  1X40 A;  3RJH A;  3BQ1 A;  2JZB B;  2DQN B;  3NVY A;  1CRX A;  3HRD D;  3AUO A;  3V7K A;  1KRP A;  5L1K A;  4TUP A;  4KMU A;  2HBK A;  8ICY A;  3LWL A;  1KEJ A;  1TK8 A;  2BCQ A;  3T79 A;  5J0O A;  9ICL A;  2XY6 A;  4QWD A;  4M0A A;  3V6J A;  4I2A A;  2DKZ A;  4ED6 A;  4IQU A;  2FLN A;  5DQI A;  2E8P A;  5ALR A;  2CRX A;  4OCZ A;  3BDP A;  1O08 A;  2W9A A;  4KLI A;  4C4S A;  8ICH A;  5AI4 A;  3JPN A;  4C8M A;  3PW7 A;  2KSO A;  4DFK A;  2EZZ A;  2AHO B;  4TQS A;  1Z00 A;  2A3V A;  1PZN A;  4JMU A;  1NK4 A;  2VJ4 A;  2NRV A;  2HBL A;  3H4D A;  1TE2 A;  2FLL A;  3AQE A;  5BOM A;  3GV5 B;  5EOZ A;  4P4P A;  1SL2 A;  4ZOH C;  4P0P A;  3D2N A;  5DB8 A;  1QQ6 A;  4RQ5 A;  3QZ7 A;  4RQ6 A;  1O03 A;  2WB1 F;  4ED1 A;  4EZ9 A;  4US9 A;  4GXK A;  2G08 A;  4KLG A;  2HOQ A;  4P0Q A;  7ICO A;  3RB3 A;  4IRD A;  3AU2 A;  5KFY A;  9ICC A;  3T5K A;  2GOL A;  4M2Y A;  5DG9 A;  3BS5 B;  4EYI B;  4FFD A;  4KTQ A;  5DB6 A;  9ICP A;  1COO A;  4CNQ A;  4IR9 A;  3GQC A;  2PFO A;  2XID A;  5HHH A;  2PFQ A;  2YN4 A;  2KJ9 A;  2NRW A;  2PMZ C;  5IIK A;  2EZY A;  2YB4 A;  4JV1 A;  2AQ0 A;  1UHU A;  1T3Q A;  5DQH A;  3WK4 A;  2IA6 A;  3SAH A;  4ED2 A;  3SMV A;  3QUC A;  4DFJ A;  4OO1 J;  2H3V A;  4UAR A;  3M9M B;  4Q8E A;  3PMN A;  1H38 A;  5C0Y A;  1U45 A;  4O5C A;  2K60 A;  3RB4 A;  2LYH A;  1RM6 C;  8ICZ A;  3IP4 B;  2W3R A;  5III A;  5J8Y A; 
#chains in the Genus database with same CATH homology
 5F3X B;  2QKQ A;  3H8M A;  1X66 A;  4IS7 A;  2KSO A;  2QAR B;  4MHV A;  5JRT A;  2KMD A;  2QB0 A;  2E8N A;  1B0X A;  2D3D A;  2EAN A;  5KNI A;  3BS5 A;  2DKX A;  2KG5 A;  5JTI A;  5JU5 A;  2KE7 A;  1Z1V A;  1OW5 A;  2F44 A;  1V85 A;  1WWV A;  1B4F A;  1DXS A;  3KKA A;  1UQV A;  2LPE A;  1SV4 A;  2KSO B;  2ESE A;  2KIV A;  3BQ7 A;  4NJ8 A;  1UCV A;  2EAP A;  1PK1 A;  1LKY A;  1SV0 A;  2QB0 B;  2F8K A;  2EAO A;  3IDW A;  4RQN A;  1PK3 A;  1SXE A;  2GLE A;  4PZN A;  1RG6 A;  3SEN A;  2L5Y A;  1V38 A;  2Y9T A;  3BS5 B;  3K1R B;  1SXD A;  2YTU A;  2ES6 A;  2F3N A;  3SEI A;  1WWU A;  2EAM A;  2DL0 A;  3TAD A;  2B6G A;  2FE9 A;  1COK A;  4NL9 C;  2LMR A;  4RQM A;  2E8O A;  5J8Y C;  2E8M A;  3HIL A;  3KKA C;  1KW4 A;  1X40 A;  1PK1 B;  1LKY B;  3BS7 A;  5L1M A;  2JV3 A;  1SV0 C;  2QAR A;  3TAC B;  2Y9U A;  2K4P A;  2QB1 A;  1OXJ A;  2D8C A;  4PZO A;  1X9X A;  2K60 A;  2DKZ A;  1F0M A;  1JI7 A;  3TAD C;  4NL9 A;  1SGG A;  2E8P A;  5J8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...