1WWVA

Solution structure of the sam domain of human connector enhancer of ksr-like protein cnk1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Connector enhancer of kinase suppressor of ras 1
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1wwvA00
1V85A 3BS5A 3IDWA 2E8PA 1WWVA 5J8YC 2K4PA 5F3XB 1WWUA 2YTUA 2F44A 3SENA 1X40A 2K60A 4PZNA 3SEIA 1UCVA 1JI7A 4PZOA 1SV0A 2QB0B 3TACB 1UQVA 2QARA 3K1RB 5JTIA 2QKQA 2EANA 4RQMA 2EAMA 2EAPA 1OW5A 3KKAA 1B0XA 1LKYA 1COKA 2KSOB 1SGGA 1F0MA 2QB0A 2EAOA 1X9XA 2L5YA 4NJ8A 2QARB 2QB1A 3KKAC 4RQNA 3H8MA 2KSOA 5J8YA 5KNIA 1LKYB 3BS7A 3TADA 1V38A 1PK1B 2JV3A 1OXJA 2KG5A 2DL0A 5L1MA 5JU5A 5JRTA 1RG6A 2GLEA 2Y9UA 2Y9TA 2LMRA 1Z1VA 1X66A 1SV0C 2KE7A 1SXDA 2FE9A 2LPEA 4NL9A 3HILA 2DKXA 1PK1A 1KW4A 2E8OA 2D8CA 4NL9C 2F3NA 1SXEA 4MHVA 1SV4A 1PK3A 4IS7A 2KMDA 3BS5B 2B6GA 2E8NA 1B4FA 2E8MA 2F8KA 2ESEA 3BQ7A 2DKZA 3TADC 2KIVA 2D3DA 1DXSA 2ES6A
chains in the Genus database with same CATH superfamily
2YMLA 4QJFB 2R8KA 1J2NA 2KFNA 5ALGA 7ICEA 1FFUA 2IHNA 1L3UA 4USAA 1XSPA 3RAQA 2XCPA 3G6YA 4RPXA 9ICRA 4NY8A 4YR2A 2G08A 2EH9A 2ZUCA 4YQWA 1ZQEA 1B43A 1UT5A 3RBDA 2QARA 5ALXA 3C23A 4O3NA 2A3VA 4KLFA 2DGZA 4DOCA 2XIDA 2OWOA 4I2EA 7ICRA 3UM9A 1MQ2A 2F8LA 3K75D 4U7CA 7ICNA 4F93B 3KKAA 2JRZA 2B0CA 3KTQA 3H8SA 4JV0A 1LB2B 3G6XA 2A19A 4J03A 5KFWA 3KD3A 4US8A 3BZKA 4NJ8A 2W04A 5AKXA 5J2GA 1N5WA 3CP8A 3SI8A 1ZRMA 3EPGA 4B6JA 3GDXA 5TISU 4JV2A 3K4GA 1A77A 3IP4B 3M8RA 8ICOA 2ZIWB 4EYHB 1RM6C 4O5CA 2FPLA 3RJIA 3LWMA 3PX4A 4PHDA 2Y1JA 4YD2A 5ALRA 1QH9A 4EZ6A 4I2JA 4IQTA 1QSLA 4Y2YA 5HHHA 2KKPA 5KL8B 2MUTB 4OJ6A 4Z6EA 3GQCA 5H2FU 3M6KA 2E8NA 3LVWA 4RT2A 3VC8A 4DFKA 4RU9A 5KFIA 2HSZA 4GC6A 2N1RA 4NXZA 2OM6A 2RHFA 1U48A 5CP2A 1FO4A 3IG5A 5D49A 3AEVA 4UW9A 4QZBA 5J0OA 3RB3A 5HMLA 4DSJA 7ICJA 5DG9A 3KHRA 3EYZA 1DGSA 2F44A 4DOAA 2G0AA 1KTQA 4Q45A 1ZRNA 2YMQA 4PZOA 2NO5A 5CRXA 2QB0B 2W3SA 1O03A 3HX0A 2VIXA 4DSLA 4HYKA 2M9NA 4PHEA 3ZDBA 1J97A 2W7PA 3WK9A 1NJYA 1V9PA 1X42A 4C0ZA 4NLKA 3UMGA 5DBCA 1B0XA 3QU4A 1KN5A 5DG7A 4M9HA 2RQ5A 1RZTA 2ZJ8A 2H3IA 2BCUA 1JXEA 2NO4A 8ICGA 1S0OA 5KFEA 1NK9A 3H8MA 3AQFA 4NLGA 5KFUA 2ZUBA 4KLIA 1U4BA 2KKVA 4R8UA 4K4IA 4KMUA 2FLNA 5KAIU 1ZQQA 5KG7A 9ICKA 4ED6A 3M9MB 5F9LA 5L1IA 1SKSA 3SV3A 5KFVA 2FE9A 1X2IA 4ELVA 2WAQC 2K4HA 2BHNA 3RB4A 1RYSA 2YMPA 2E8OA 1JN3A 9ICSA 5KAFU 5HHIA 2A1JB 4EEYA 2ASLA 1QSSA 2MUTA 3WK8A 3KFUF 3HRDD 2AQ4A 4QWEA 2B6GA 2OHFA 4DL7A 3D2NA 1B4FA 2ZXHA 4DQRA 4DCCA 1QCKA 1DK2A 1LV5A 2FMPA 2C22A 5ALWA 4Z6DA 7ICIA 4ELUA 9ICNA 3BDPA 5J2DA 2BZFA 2OEHA 4IRDA 4IC9A 4ECRA 3UQ0A 3MGHA 3GIJA 5AKEA 1XSLA 4O5KA 3QX7A 1IG6A 1N5XA 3N97B 1X40A 3V7JA 4X5VA 4UAUA 3GFKB 3NVWA 3UXPA 4DL4A 3LK9A 2E1EA 2QKQA 3PY8A 4QZIA 5J2CA 4ECWA 1RQLA 3V6JA 1QSYA 1S8OA 3FYHA 3SMVA 1Y88A 2GOLA 2OCEA 5AK3A 4RQ5A 1L6NA 1X9XA 3QU7A 4KX3A 2W9AA 2QARB 2QB1A 2CPRA 5J2EA 4M9NA 4GFJA 3FM9A 4ECUA 3I76A 4ED1A 3IRUA 7ICUA 1U47A 1T7PA 7ICOA 1ZD5A 1D9DA 2HVHA 9ICVA 2M0NA 1TVAA 5JRTA 4P0QB 3PMLA 2KZMA 3SD7A 3V6KA 2K8AA 4PGXA 9ICFA 3QUBA 4NL9A 1HIWA 2ZJAA 4YMMA 2J6UA 2CN1A 4BXOB 4Q44A 4MFFA 1XWLA 4ZOHC 5AM4A 2BCRA 3N7SC 4ECSA 4F8RA 3HKZF 2HOIA 3CNHA 2KMDA 3PO5A 2YMMA 9ICJA 3KBBA 3NASA 1KBUA 4KN7A 4P4MA 2W03A 1DXSA 5J8YC 1X9SA 2R8GA 3NTUA 3BS5A 1JALA 4P4PA 5KFDA 5J2FA 4Q43A 3E0FA 2LKYA 4YP3A 4M0AA 2E3TA 1L3SA 1D8BA 1ZQTA 3FDSA 2HOFA 5KG0A 2A1AA 5AI8A 4RNOA 2BCVA 3H0LB 5KG4A 4JWMA 5AI4A 1VLBA 2ASJA 4F2SA 4F72A 3Q8MA 3C1YA 5J0WA 5K4LA 1CI4A 5KFLA 3UXOA 3ICXA 4RPYA 4DL6A 1RXVA 3WK7A 3PW5A 2EAOA 1IXRA 9ICBA 3F2CA 1NKCA 1N48A 3HT3A 3Q8RB 4UB8U 5J0UA 3F2DA 1Q3UA 2H5XA 2XVTA 5CR0A 2GLEA 1ZQOA 1HJPA 9ICHA 4M9GA 4BXOA 4F5OA 3PX6A 5GTIU 1SV0C 3RJJA 4C4SA 5KTQA 3KZIU 1NJZA 2DKXA 3IN5A 4P0PB 4DL2A 1BNPA 3MDAA 3H4DA 2VA2A 5KFTA 3PW2A 2Y0SC 4O3QA 2D8CA 2AGOA 1DGJA 3PW7A 1SXEA 2C2RA 4QZHA 1KSPA 5KFGA 4FS2A 1U9LA 4UB1A 1D9FA 2LYHA 4J9RA 3O0FA 4RQ1A 3C29A 2ESEA 1UHUA 1T8EA 4KLQA 2XY6A 1C7YA 4MEYA 3C2KA 5F3XB 3PR5B 2C2DA 4J9NA 5KT7A 2V9WA 4QZFA 2J6SA 5F9NA 1Z4OA 2VKQA 1BPZA 1KDHA 2XY7A 5KFOA 3SAHA 1HUZA 4NLBA 5AKYA 3LYSA 3JPQA 3HJEA 4MFCA 4DS5A 2K8BB 3RB6A 4PJ0U 1TK8A 3PSIA 1SIJA 4O3PA 2JEFA 3RRGA 4CE6A 4PHPA 1KFDA 4F4KA 1RYRA 4NWIA 2EZYA 5DB6A 1Q3VA 2NRWA 3RJHA 3NS1A 3ISDA 1N2XA 5A0LA 2KEYA 3T79A 1A6SA 8ICAA 3TADA 1UA0A 4UAYA 1X66A 4EX6A 2JEGA 3TAPA 4DQQA 2LPEA 1ZQMA 3QUTA 4DF4A 4R65A 2IHMA 1JROA 3SQIA 3T5LA 3QZ8A 3THVA 1ZQUA 3SR6A 5J0YA 2W55A 3ETLA 3QZ7A 3TAQA 4UBCA 4F50A 5AM3A 2F76X 8ICXA 2HBKA 1NK8A 5BPCA 4C8NA 4BX9C 2H3ZA 5DB7A 4RNMA 4ECYA 4C8LA 2E8MA 1QQ6A 2JHDA 1ZOLA 3MFHA 4I2HA 2ZTDA 4DSEA 2KIVA 5DQIA 2D3DA 3N4MB 1NOMA 1NZBA 2HHUA 4UASA 4UB5A 4KLUA 1XSNA 3BQ2A 4CDGA 4QNLA 4MF2A 5ALDA 8ICYA 2PFPA 7ICSA 3EWAA 4KX5A 4AYBC 5ALSA 4TUQA 4MF8A 4IRKA 3A0HU 3UMBA 9ICPA 1D8LA 1K1QA 2QLTA 2EAMA 1T94A 5DQGA 3GILA 1TAUA 1T3QA 5KFRA 1FFVA 2ZJ5A 4B9UA 3LVVA 4B9TA 3ISBA 4RQ8A 4IQVA 1LKYA 1VDVA 1WYGA 2UVVA 5JUMA 4G3IA 4FBTA 2YB4A 4UAVA 1TFRA 1ZYQA 3NVYA 3PZPA 4DOBA 4I2FA 2ZIUB 3AN1A 2G07A 2JZBB 1QLNA 2AQ0A 3LDAA 5DGBA 1V38A 4ECXA 1Z19A 1L3TA 5AICA 5JU5A 4LVSA 2WF6A 1F5SA 2Y9UA 3WKBA 5EWGA 2RDIA 4PGQA 1SXDA 4ED2A 3HILA 3RBEA 2ASDA 2PFQA 2NRTA 2K8CB 3ISCA 4DSIA 5L1LA 4CF4A 4GXIA 2HDOA 1IM4A 4KLJA 1SZPA 2W8KA 5C5JA 1D8YA 2G5HB 3MGVA 5ALQA 2AGQA 5DG8A 2XGPA 4UAWA 5EE9A 3N7RC 3BQ7A 2WF7A 5KG6A 9ICIA 1NNLA 1L8OA 3A0BU 4NLNA 2E8PA 4FZLA 1WWVA 2F1JA 2GO7A 5AKKA 1BPXA 5KG2A 4YCXA 8ICUA 4K4GA 5E79U 1WUDA 5AM0A 4I28A 1SL0A 3SEIA 1UCVA 5CB1A 1S97A 1L5UA 4QZGA 3WK4A 2MAXA 2KNJA 4BWMA 1ZD2P 5FP0A 4J9SA 4DL5A 4R66A 1OW5A 4US9A 1PVRA 2PI4A 2KOBA 2K4IA 7ICPA 4QZ9A 4DQPA 2BQRA 3CW2C 1NJWA 1O08A 4KTQA 1HEKA 2W9CA 5J2KA 3L3FX 2C2EA 1KKXA 4UARA 1X9WA 4F4YA 5AIAA 5DLFA 5J2AA 9ICQA 4U6PA 3RH4A 5KFJA 1PVPA 4CRXA 3R9KA 1COOA 2V4RA 4O9MA 4I2DA 4NM2A 4RT3A 1L7MA 1XO1A 4J9MA 3PW4A 2NRXA 2VJ5A 3RAXA 4K4HA 4PHAA 3HP6A 3C1ZA 1ZQLA 2K89A 1TV9A 1IV8A 4KLGA 2AHOB 2PKEA 2Q0ZX 2AJQA 1RDFA 8ICTA 1NK7A 3MABA 1WG8A 3JPRA 1S0NA 4BUGA 2IMWP 3CRXA 2ZIXB 3MC1A 4FO6A 4R64A 3M1YA 8ICSA 3IV6A 2JR5A 3NGDA 4UQGA 4GXJA 3NRZA 3IDWA 4DWIA 2KZZA 1Z4NA 3QYPA 2RLTA 4NM1A 2R8IA 2OH2A 4RQ3A 2BPCA 2KD1A 5DDYA 1ZQJA 3JPTA 2F77X 4IQUA 1JRPA 3AU2A 2WTFA 3MFIA 3SYZA 4YN4A 1UQVA 9ICGA 1URJA 1ZXIA 4RQMA 2HHSA 2ISPA 4DSFA 4EEKA 2YN4A 5L9XA 3MR5A 2H3VA 4RZRA 3DV9A 1BPEA 1N56A 1QTMA 1F0MA 2HCFA 4Y2RA 4I2GA 3E58A 5D4BA 3B9JA 5ALLA 3ZDEA 3I28A 2P6RA 4M04A 2KN7A 5KT5A 5KFXA 1FIQA 3S6JA 2BQUA 4BGDA 5EWEA 4O0IA 5IILA 2G5IB 3NVZA 2MU2A 2KE7A 1MA7A 1M6YA 3I1YA 4EBEA 1S77D 3ORYA 3V6HA 5B66U 2HW3A 4ECQA 9ICWA 5AK5A 1JXLA 4AYBF 3SAGA 1ZQGA 3ZDCA 2K4EA 7ICQA 2FPKA 5D46A 3QEAZ 8ICLA 4F5RA 2ZTCA 1UA1A 1BPDA 1ZQWA 4I2IA 4ED0A 4IR1A 3GV8B 1K5OA 1U49A 5AK4A 1UPHA 1MC8A 2CXYA 4F4ZA 1N62A 3BQ0A 2DFLA 1GO3F 1TAQA 2XY5A 2VA3A 3NUQA 2BGWA 4UAZA 1XNSA 1WWUA 2LYBA 4C8KA 3QXGA 1KL9A 3V7LA 5KFHA 1RPLA 2KICA 9ICCA 3H8WA 4F3OA 4EENA 1AROP 3WKAA 3MDCA 2R8HA 2KHQA 2F1IA 5CHGA 9ICMA 3K1RB 4Z6FA 4O3MA 5AM5A 4ELTA 5AM2A 2GWSA 3JPSA 3RH5A 2EAPA 5DQHA 3HWTA 2HBJA 1ZQRA 1MN8A 3GV7B 7ICVA 4QWBA 2WB1C 1T4GA 3BJYA 1Z00B 4DEZA 2YB1A 4YXMA 2KZ3A 4J9LA 2G06A 2ISOA 2IBKA 5J2JA 2KSOA 2WF8A 4XUSA 4R63A 1QQ7A 5G5GA 4M2YA 4DS4A 3ZDDA 5KFPA 5ALPA 5CEHA 9ICTA 3V72A 1ECWA 4XRHA 9ICUA 2AH5A 2JXJA 4YMNA 1Z00A 2Q4TA 1F44A 4OJLA 1PK1A 3GIKA 1KQQA 5AKJA 4P4OA 2HHWA 4ZH4A 5KT4A 3Q8QB 4DLGA 4CF3A 4O3RA 1YZ7A 2RDJA 4F4XA 1L3VA 3T3FA 2KVCA 5B5EU 3WKEA 4IS7A 5CJ7A 3BS5B 3D2QA 8ICFA 2R8JA 1P7DA 2F8KA 4J9KA 5J0QA 5HMMA 1TE2A 3TI0A 5KT2A 1SWWA 1OUQA 4GIBA 3PV8A 2IOHA 4TUSA 3RH6A 4UB3A 2HVIA 1SZHA 2WF5A 5EE3A 4C4TA 3HW8A 1RYUA 4RQ0A 4IR9A 2XC9A 2WF9A 2HHQA 2HBMA 1KEJA 2ZIUA 4NV0A 2FJ6A 1A76A 2A1JA 2OXOA 3UMCA 5ALHA 2KJ5A 2XICA 2VANA 5ALNA 4DFJA 4DFDA 4ACOA 5KFAA 4KITB 4QWAA 2PFOA 2DPIA 1ZJNA 2KTQA 3GIIA 4IQWA 5GTHU 4ED8A 3D2SA 2PMZC 2KSOB 1L8LA 5AI6A 9ICEA 4YFKA 4Q8FA 4HAIA 3H4BA 4Y2XA 2P6UA 1XC9A 5J0SA 4LZGA 4Y2QA 2LMRA 3WU2U 1TKDA 4QZAA 1ZQCA 4Y2JA 3WK6A 4I2CA 3MGIA 1TK0A 3Q8SB 2ZG6A 5AKGA 3Q8KA 3QU9A 1L7NA 2UVWA 1JIHA 2FPMA 4F2RA 2I1QA 1JUDA 1NI3A 4F91B 4OJ5A 8ICHA 1PK3A 1JX4A 4EZ9A 2W43A 1QQ5A 5ALEA 1TAMA 1XS9D 1SKWA 4MEXA 3AQEA 4FFDA 2DKZA 1S10A 3OSNA 3ZI4A 2BDUA 4PH5A 4KLSA 3D6JA 1A0PA 3MR6A 2YTUA 1IIPA 1XU4A 3PSPA 4OD0A 4NLZA 4F5PA 8ICBA 4RQ2A 2C28A 1S9FA 3WK5A 4YG2A 1PVQA 1ZQZA 5EE0A 4ECVA 5CA7A 4YR3A 1DK3A 1X6IA 1T3NA 3Q8PB 5ALUA 1NK5A 3ZDAA 5HR6A 4J9QA 4Q8EA 5ALOA 3N28A 5BOLA 7ICKA 2YY6A 3LWLA 5KNIA 3QE9Y 3SZ2A 1B22A 2DWQA 3IM1A 5J2IA 9ICOA 2JEIA 4KLLA 3OGUA 1CEZA 5ALYA 5ALMA 5ALJA 3N7PD 8ICPA 1VJ5A 5AK6A 3OJSA 4KLOA 1KRPA 5KG3A 2WFAA 4UB6U 3GIMA 7ICLA 1NJXA 4FE3A 1DRGA 3WKDA 7ICGA 1ZD4A 1ZQHA 4O5EA 4JWNA 2HI0A 1YT3A 5DB8A 2DBYA 8ICWA 2IOFK 2PFNA 1NK6A 4QIWF 4DFPA 1ZD3A 3RJGA 2JH1A 4ECTA 3F2BA 2ZIWA 2ALZA 4A8EA 4B9MA 1SB3C 2H3FA 1X6JA 2ZIXA 3QEBZ 1FEZA 2ZIVA 2OYYA 4Y2VA 4UB2A 4JB3A 4G9BA 3IG8A 5KFBA 5AI5A 4JV1A 2NRZA 4MFAA 3NRWA 4J9PA 2ODGA 4TURA 2KV2A 4IL6U 3GV5B 2W9BA 1NK0A 2JMGA 2K60A 4EX7A 5AM1A 3KZXA 5KFQA 2W8LA 1SV0A 4FBUA 4QZ8A 4RPZA 3GU3A 2EZXA 5ALTA 3RJEA 3C2MA 2KVSA 1PUZA 4I2AA 2CRXA 4M6WA 5AKZA 5KT3A 5IIOA 1ED1A 2NV3A 1RXWA 4DL3A 1SGGA 3AU6A 2XCAA 1NKEA 5KFKA 1KFSA 4OJOA 2FLPA 2BCSA 3OSPA 3KHGA 1BGXT 3PSTA 1PK1B 5KT6A 1S0MA 3E2EA 2XI9A 4UB4A 5KFMA 1ZQSA 4EYIB 3UPQA 5KFNA 2P35A 3K1ZA 1NK4A 4TQSA 2ZIVB 8ICVA 1PZNA 2HHXA 2AXTU 8ICQA 3DDHA 2AU0A 1MQ3A 2WB1F 4PGYA 2DQNB 4I2BA 1X9MA 4TUPA 2BPGA 8ICNA 5C0YA 2W9MA 4XA5A 5IINA 3L4PA 2PI5A 5TZVA 4LJXA 3H8JA 5J2HA 4RUAA 4KLEA 4C8OA 2W9CB 5DB9A 2NYVA 2FMSA 2BKEA 3M9NB 1XO0A 1ZJMA 3KHHA 5KFSA 4QZCA 1DOQA 1ZQBA 4AP9A 4Y2PA 4C7ZA 2KIWA 5J2BA 5KFCA 5AI0A 4QWDA 3PMNA 2ZUDA 4ICAA 4F4WA 5KFFA 4FZNA 2ZTEA 3RJKA 4P2HA 1C20A 4QWCA 5DGAA 4QZEA 4DFMA 1Z1BA 7ICFA 3G6VA 3B0XA 4JK1A 2LM1A 1KFTA 1RQNA 4KN4A 1YZ6A 5ALZA 2JH7A 4B9VA 1LKYB 3RR8A 7ICHA 4EBDA 3BS7A 3BQ1A 4PL2A 2KHVA 2KG5A 5L1MA 4RQ6A 4E0DA 2FMQA 2Z7JA 2DUYA 4P0PA 3UXNA 3TANA 2Y9TA 3J81j 5DLGA 4DF8A 4UATA 4B9LA 1S0VA 4XQ8A 1Z3EB 2JEJA 5J29A 1UT8A 2PMZF 3H0RB 3PO4A 4WJ3B 1SWVA 1AQ6A 1BNOA 2W3RA 4I29A 1N61A 8ICRA 1J2MA 5DKWA 2JZBA 5KG5A 1K1SA 2O6KA 4CF5A 3NVVA 3T5KA 1U45A 1ZQ1C 3EPIA 3F53A 1H38A 3OHBA 3TFSA 5DDMA 4CNQA 9ICAA 5BOMA 4UBBA 1ZQXA 4EELA 2HHVA 8ICZA 2GH1A 8ICJA 4GC7A 1ZQDA 2LI6A 4PZNA 4Z6CA 1SL1A 5J0RA 2IA6A 3HPOA 8ICKA 1ZQIA 2I9GA 3AMZA 4DQSA 2MSNA 1CUKA 1S5LU 1ZETA 1ZQKA 5AHXA 3C5FA 2FDRA 4M47A 8ICIA 4OCZA 2BR0A 1ZQFA 3GZFA 3ONNA 1Q8KA 4JUZA 4KLHA 3T5HA 5KFZA 4EBCA 3BQTA 4RQNA 5KFYA 5L1JA 4OJPA 3ETRA 5G5HA 3ZD8A 2I6XA 5ALFA 5EOZA 3RFAA 3Q8LA 4OO1J 2XGQA 4Y2UA 4RQ7A 2F1HA 4LZDA 5KL1B 4JMUA 4Y2TA 5EE1A 5ALIA 4B9SA 3PR4A 1KW4A 5HP4A 2FLLA 5ALKA 3C5GA 3L5KA 1WCNA 5T14A 3RTVA 4ED7A 3M7DA 3F5AA 4GXKA 3TQ1A 4BWJA 4C8MA 3C21A 2JGAA 2MRLA 4FZMA 2J6TA 4KLMA 2W9BB 1NZPA 3JPOA 3TADC 3JPNA 5AKLA 3QU5A 1V85A 5AIBA 3EUB2 2RP5A 3T5JA 4RUCA 2K4PA 5J0XA 3V7KA 4BJQA 4RQ4A 3H40A 1N63A 4F92B 3OTQA 4M6WB 2BCQA 5J0PA 3B0YA 4I27A 4QIWC 3PNCA 2HMXA 1JI7A 3ALRA 2B21A 4DSKA 2LHTA 3TACB 3C2LA 4QZDA 3PSFA 2KFZA 9ICXA 2D6FC 2V4QA 3VCBA 2WAQF 3KHLA 3FAHA 3PVXA 2UVRA 3QUCA 1TK5A 4PL1A 3WKCA 3RB0A 3MR3A 5CWRA 1COKA 3RJFA 5HNKA 4QW9A 1V97A 5DBBA 3MR2A 3UQ2A 2KJ9A 1L7PA 2ATLA 3KKAC 2G09A 3TFRA 4P0QA 1BPBA 3ZD9A 3TKAA 2VA8A 2JV3A 1OXJA 2Y1IA 2DL0A 3RF9A 2IOFA 3F5EA 3JPPA 2LYAA 4CCHA 4KLDA 2KK0A 1HUOA 3C28A 3PX0A 2W54A 1N60A 2BPFA 3DEEA 4B9NA 4NLCA 2YX8A 5J0TA 8ICEA 3SV4A 4KMOB 9ICLA 2HHTA 2E5SA 1JMSA 4R8UB 1ZQAA 2EDUA 1ZQNA 4KLTA 1CRXA 5HR7A 3QUQA 2LM4A 1SV4A 2XO7A 4ED3A 2ZXIA 4O3OA 3MBYA 8ICMA 2VJ4A 2R18A 5IIJA 4C7YA 3QNMA 3CYMA 5ALVA 3KOOA 3FC4A 4M9LA 3SAFA 1MSWD 2DPJA 3U26A 3BZCA 5IIKA 5IIMA 2NRVA 1EXNA 4TQRA 4C4RA 3ED5A 3M9OB 2KJ8A 2RRDA 4F5QA 2EZZA 4DLEA 3OHAA 4ECZA 2I5HA 1L7OA 2E1FA 3SENA 2Y0SF 2AGPA 1ZQVA 2WHEA 4YXJA 5DBAA 5AKIA 5KG1A 4QW8A 5AKHA 4IRCA 1WCLA 2FI1A 4F71A 1NKBA 2BQ3A 5JTIA 2EANA 4YVZA 4YMOA 7ICMA 2EQYA 4Y2SA 8ICCA 3IHQB 4FS1A 2H3QA 7ICTA 3EW9A 1S76D 2KP7A 2QB0A 4YD1A 2MA1A 1KLNA 2L5YA 5AI9A 4YR0A 3HKZC 3M6ZA 2BDPA 3OJUA 4PPXA 4DO9A 3AL0B 5J8YA 4C80A 1ZQPA 2HOQA 5L1KA 5IIIA 3QU2A 1BPYA 2W11A 1RG6A 2HBLA 1SKRA 2LBOA 4BDPA 3RR7A 3RRHA 1Z1VA 2W7OA 2YQEA 2P66A 2UVUA 1BVSA 3H0MB 3EZ5A 4J9OA 3M8SA 4GLXA 1SL2A 1LVHA 3AM9A 2F2AB 2PXIA 4CGZA 4NL9C 2F3NA 4MHVA 3PW0A 3OPXA 4DQIA 1ZQYA 4F5NA 4M9JA 5EWFA 3H7IA 3TARA 4RNNA 4O3SA 1Q46A 2DF4B 3AUOA 2ES6A
chains in the Genus database with same CATH topology
1V85A 3BS5A 3IDWA 2E8PA 1WWVA 5J8YC 2K4PA 5F3XB 1WWUA 2YTUA 2F44A 3SENA 1X40A 2K60A 4PZNA 3SEIA 1UCVA 1JI7A 4PZOA 1SV0A 2QB0B 3TACB 1UQVA 2QARA 3K1RB 5JTIA 2QKQA 2EANA 4RQMA 2EAMA 2EAPA 1OW5A 3KKAA 1B0XA 1LKYA 1COKA 2KSOB 1SGGA 1F0MA 2QB0A 2EAOA 1X9XA 2L5YA 4NJ8A 2QARB 2QB1A 3KKAC 4RQNA 3H8MA 2KSOA 5J8YA 5KNIA 1LKYB 3BS7A 3TADA 1V38A 1PK1B 2JV3A 1OXJA 2KG5A 2DL0A 5L1MA 5JU5A 5JRTA 1RG6A 2GLEA 2Y9UA 2Y9TA 2LMRA 1Z1VA 1X66A 1SV0C 2KE7A 1SXDA 2FE9A 2LPEA 4NL9A 3HILA 2DKXA 1PK1A 1KW4A 2E8OA 2D8CA 4NL9C 2F3NA 1SXEA 4MHVA 1SV4A 1PK3A 4IS7A 2KMDA 3BS5B 2B6GA 2E8NA 1B4FA 2E8MA 2F8KA 2ESEA 3BQ7A 2DKZA 3TADC 2KIVA 2D3DA 1DXSA 2ES6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V85 A;  3BS5 A;  3IDW A;  2E8P A;  1WWV A;  5J8Y C;  2K4P A;  5F3X B;  1WWU A;  2YTU A;  2F44 A;  3SEN A;  1X40 A;  2K60 A;  4PZN A;  3SEI A;  1UCV A;  1JI7 A;  4PZO A;  1SV0 A;  2QB0 B;  3TAC B;  1UQV A;  2QAR A;  3K1R B;  5JTI A;  2QKQ A;  2EAN A;  4RQM A;  2EAM A;  2EAP A;  1OW5 A;  3KKA A;  1B0X A;  1LKY A;  1COK A;  2KSO B;  1SGG A;  1F0M A;  2QB0 A;  2EAO A;  1X9X A;  2L5Y A;  4NJ8 A;  2QAR B;  2QB1 A;  3KKA C;  4RQN A;  3H8M A;  2KSO A;  5J8Y A;  5KNI A;  1LKY B;  3BS7 A;  3TAD A;  1V38 A;  1PK1 B;  2JV3 A;  1OXJ A;  2KG5 A;  2DL0 A;  5L1M A;  5JU5 A;  5JRT A;  1RG6 A;  2GLE A;  2Y9U A;  2Y9T A;  2LMR A;  1Z1V A;  1X66 A;  1SV0 C;  2KE7 A;  1SXD A;  2FE9 A;  2LPE A;  4NL9 A;  3HIL A;  2DKX A;  1PK1 A;  1KW4 A;  2E8O A;  2D8C A;  4NL9 C;  2F3N A;  1SXE A;  4MHV A;  1SV4 A;  1PK3 A;  4IS7 A;  2KMD A;  3BS5 B;  2B6G A;  2E8N A;  1B4F A;  2E8M A;  2F8K A;  2ESE A;  3BQ7 A;  2DKZ A;  3TAD C;  2KIV A;  2D3D A;  1DXS A;  2ES6 A; 
#chains in the Genus database with same CATH topology
 2YML A;  4QJF B;  2R8K A;  1J2N A;  2KFN A;  5ALG A;  7ICE A;  1FFU A;  2IHN A;  1L3U A;  4USA A;  1XSP A;  3RAQ A;  2XCP A;  3G6Y A;  4RPX A;  9ICR A;  4NY8 A;  4YR2 A;  2G08 A;  2EH9 A;  2ZUC A;  4YQW A;  1ZQE A;  1B43 A;  1UT5 A;  3RBD A;  2QAR A;  5ALX A;  3C23 A;  4O3N A;  2A3V A;  4KLF A;  2DGZ A;  4DOC A;  2XID A;  2OWO A;  4I2E A;  7ICR A;  3UM9 A;  1MQ2 A;  2F8L A;  3K75 D;  4U7C A;  7ICN A;  4F93 B;  3KKA A;  2JRZ A;  2B0C A;  3KTQ A;  3H8S A;  4JV0 A;  1LB2 B;  3G6X A;  2A19 A;  4J03 A;  5KFW A;  3KD3 A;  4US8 A;  3BZK A;  4NJ8 A;  2W04 A;  5AKX A;  5J2G A;  1N5W A;  3CP8 A;  3SI8 A;  1ZRM A;  3EPG A;  4B6J A;  3GDX A;  5TIS U;  4JV2 A;  3K4G A;  1A77 A;  3IP4 B;  3M8R A;  8ICO A;  2ZIW B;  4EYH B;  1RM6 C;  4O5C A;  2FPL A;  3RJI A;  3LWM A;  3PX4 A;  4PHD A;  2Y1J A;  4YD2 A;  5ALR A;  1QH9 A;  4EZ6 A;  4I2J A;  4IQT A;  1QSL A;  4Y2Y A;  5HHH A;  2KKP A;  5KL8 B;  2MUT B;  4OJ6 A;  4Z6E A;  3GQC A;  5H2F U;  3M6K A;  2E8N A;  3LVW A;  4RT2 A;  3VC8 A;  4DFK A;  4RU9 A;  5KFI A;  2HSZ A;  4GC6 A;  2N1R A;  4NXZ A;  2OM6 A;  2RHF A;  1U48 A;  5CP2 A;  1FO4 A;  3IG5 A;  5D49 A;  3AEV A;  4UW9 A;  4QZB A;  5J0O A;  3RB3 A;  5HML A;  4DSJ A;  7ICJ A;  5DG9 A;  3KHR A;  3EYZ A;  1DGS A;  2F44 A;  4DOA A;  2G0A A;  1KTQ A;  4Q45 A;  1ZRN A;  2YMQ A;  4PZO A;  2NO5 A;  5CRX A;  2QB0 B;  2W3S A;  1O03 A;  3HX0 A;  2VIX A;  4DSL A;  4HYK A;  2M9N A;  4PHE A;  3ZDB A;  1J97 A;  2W7P A;  3WK9 A;  1NJY A;  1V9P A;  1X42 A;  4C0Z A;  4NLK A;  3UMG A;  5DBC A;  1B0X A;  3QU4 A;  1KN5 A;  5DG7 A;  4M9H A;  2RQ5 A;  1RZT A;  2ZJ8 A;  2H3I A;  2BCU A;  1JXE A;  2NO4 A;  8ICG A;  1S0O A;  5KFE A;  1NK9 A;  3H8M A;  3AQF A;  4NLG A;  5KFU A;  2ZUB A;  4KLI A;  1U4B A;  2KKV A;  4R8U A;  4K4I A;  4KMU A;  2FLN A;  5KAI U;  1ZQQ A;  5KG7 A;  9ICK A;  4ED6 A;  3M9M B;  5F9L A;  5L1I A;  1SKS A;  3SV3 A;  5KFV A;  2FE9 A;  1X2I A;  4ELV A;  2WAQ C;  2K4H A;  2BHN A;  3RB4 A;  1RYS A;  2YMP A;  2E8O A;  1JN3 A;  9ICS A;  5KAF U;  5HHI A;  2A1J B;  4EEY A;  2ASL A;  1QSS A;  2MUT A;  3WK8 A;  3KFU F;  3HRD D;  2AQ4 A;  4QWE A;  2B6G A;  2OHF A;  4DL7 A;  3D2N A;  1B4F A;  2ZXH A;  4DQR A;  4DCC A;  1QCK A;  1DK2 A;  1LV5 A;  2FMP A;  2C22 A;  5ALW A;  4Z6D A;  7ICI A;  4ELU A;  9ICN A;  3BDP A;  5J2D A;  2BZF A;  2OEH A;  4IRD A;  4IC9 A;  4ECR A;  3UQ0 A;  3MGH A;  3GIJ A;  5AKE A;  1XSL A;  4O5K A;  3QX7 A;  1IG6 A;  1N5X A;  3N97 B;  1X40 A;  3V7J A;  4X5V A;  4UAU A;  3GFK B;  3NVW A;  3UXP A;  4DL4 A;  3LK9 A;  2E1E A;  2QKQ A;  3PY8 A;  4QZI A;  5J2C A;  4ECW A;  1RQL A;  3V6J A;  1QSY A;  1S8O A;  3FYH A;  3SMV A;  1Y88 A;  2GOL A;  2OCE A;  5AK3 A;  4RQ5 A;  1L6N A;  1X9X A;  3QU7 A;  4KX3 A;  2W9A A;  2QAR B;  2QB1 A;  2CPR A;  5J2E A;  4M9N A;  4GFJ A;  3FM9 A;  4ECU A;  3I76 A;  4ED1 A;  3IRU A;  7ICU A;  1U47 A;  1T7P A;  7ICO A;  1ZD5 A;  1D9D A;  2HVH A;  9ICV A;  2M0N A;  1TVA A;  5JRT A;  4P0Q B;  3PML A;  2KZM A;  3SD7 A;  3V6K A;  2K8A A;  4PGX A;  9ICF A;  3QUB A;  4NL9 A;  1HIW A;  2ZJA A;  4YMM A;  2J6U A;  2CN1 A;  4BXO B;  4Q44 A;  4MFF A;  1XWL A;  4ZOH C;  5AM4 A;  2BCR A;  3N7S C;  4ECS A;  4F8R A;  3HKZ F;  2HOI A;  3CNH A;  2KMD A;  3PO5 A;  2YMM A;  9ICJ A;  3KBB A;  3NAS A;  1KBU A;  4KN7 A;  4P4M A;  2W03 A;  1DXS A;  5J8Y C;  1X9S A;  2R8G A;  3NTU A;  3BS5 A;  1JAL A;  4P4P A;  5KFD A;  5J2F A;  4Q43 A;  3E0F A;  2LKY A;  4YP3 A;  4M0A A;  2E3T A;  1L3S A;  1D8B A;  1ZQT A;  3FDS A;  2HOF A;  5KG0 A;  2A1A A;  5AI8 A;  4RNO A;  2BCV A;  3H0L B;  5KG4 A;  4JWM A;  5AI4 A;  1VLB A;  2ASJ A;  4F2S A;  4F72 A;  3Q8M A;  3C1Y A;  5J0W A;  5K4L A;  1CI4 A;  5KFL A;  3UXO A;  3ICX A;  4RPY A;  4DL6 A;  1RXV A;  3WK7 A;  3PW5 A;  2EAO A;  1IXR A;  9ICB A;  3F2C A;  1NKC A;  1N48 A;  3HT3 A;  3Q8R B;  4UB8 U;  5J0U A;  3F2D A;  1Q3U A;  2H5X A;  2XVT A;  5CR0 A;  2GLE A;  1ZQO A;  1HJP A;  9ICH A;  4M9G A;  4BXO A;  4F5O A;  3PX6 A;  5GTI U;  1SV0 C;  3RJJ A;  4C4S A;  5KTQ A;  3KZI U;  1NJZ A;  2DKX A;  3IN5 A;  4P0P B;  4DL2 A;  1BNP A;  3MDA A;  3H4D A;  2VA2 A;  5KFT A;  3PW2 A;  2Y0S C;  4O3Q A;  2D8C A;  2AGO A;  1DGJ A;  3PW7 A;  1SXE A;  2C2R A;  4QZH A;  1KSP A;  5KFG A;  4FS2 A;  1U9L A;  4UB1 A;  1D9F A;  2LYH A;  4J9R A;  3O0F A;  4RQ1 A;  3C29 A;  2ESE A;  1UHU A;  1T8E A;  4KLQ A;  2XY6 A;  1C7Y A;  4MEY A;  3C2K A;  5F3X B;  3PR5 B;  2C2D A;  4J9N A;  5KT7 A;  2V9W A;  4QZF A;  2J6S A;  5F9N A;  1Z4O A;  2VKQ A;  1BPZ A;  1KDH A;  2XY7 A;  5KFO A;  3SAH A;  1HUZ A;  4NLB A;  5AKY A;  3LYS A;  3JPQ A;  3HJE A;  4MFC A;  4DS5 A;  2K8B B;  3RB6 A;  4PJ0 U;  1TK8 A;  3PSI A;  1SIJ A;  4O3P A;  2JEF A;  3RRG A;  4CE6 A;  4PHP A;  1KFD A;  4F4K A;  1RYR A;  4NWI A;  2EZY A;  5DB6 A;  1Q3V A;  2NRW A;  3RJH A;  3NS1 A;  3ISD A;  1N2X A;  5A0L A;  2KEY A;  3T79 A;  1A6S A;  8ICA A;  3TAD A;  1UA0 A;  4UAY A;  1X66 A;  4EX6 A;  2JEG A;  3TAP A;  4DQQ A;  2LPE A;  1ZQM A;  3QUT A;  4DF4 A;  4R65 A;  2IHM A;  1JRO A;  3SQI A;  3T5L A;  3QZ8 A;  3THV A;  1ZQU A;  3SR6 A;  5J0Y A;  2W55 A;  3ETL A;  3QZ7 A;  3TAQ A;  4UBC A;  4F50 A;  5AM3 A;  2F76 X;  8ICX A;  2HBK A;  1NK8 A;  5BPC A;  4C8N A;  4BX9 C;  2H3Z A;  5DB7 A;  4RNM A;  4ECY A;  4C8L A;  2E8M A;  1QQ6 A;  2JHD A;  1ZOL A;  3MFH A;  4I2H A;  2ZTD A;  4DSE A;  2KIV A;  5DQI A;  2D3D A;  3N4M B;  1NOM A;  1NZB A;  2HHU A;  4UAS A;  4UB5 A;  4KLU A;  1XSN A;  3BQ2 A;  4CDG A;  4QNL A;  4MF2 A;  5ALD A;  8ICY A;  2PFP A;  7ICS A;  3EWA A;  4KX5 A;  4AYB C;  5ALS A;  4TUQ A;  4MF8 A;  4IRK A;  3A0H U;  3UMB A;  9ICP A;  1D8L A;  1K1Q A;  2QLT A;  2EAM A;  1T94 A;  5DQG A;  3GIL A;  1TAU A;  1T3Q A;  5KFR A;  1FFV A;  2ZJ5 A;  4B9U A;  3LVV A;  4B9T A;  3ISB A;  4RQ8 A;  4IQV A;  1LKY A;  1VDV A;  1WYG A;  2UVV A;  5JUM A;  4G3I A;  4FBT A;  2YB4 A;  4UAV A;  1TFR A;  1ZYQ A;  3NVY A;  3PZP A;  4DOB A;  4I2F A;  2ZIU B;  3AN1 A;  2G07 A;  2JZB B;  1QLN A;  2AQ0 A;  3LDA A;  5DGB A;  1V38 A;  4ECX A;  1Z19 A;  1L3T A;  5AIC A;  5JU5 A;  4LVS A;  2WF6 A;  1F5S A;  2Y9U A;  3WKB A;  5EWG A;  2RDI A;  4PGQ A;  1SXD A;  4ED2 A;  3HIL A;  3RBE A;  2ASD A;  2PFQ A;  2NRT A;  2K8C B;  3ISC A;  4DSI A;  5L1L A;  4CF4 A;  4GXI A;  2HDO A;  1IM4 A;  4KLJ A;  1SZP A;  2W8K A;  5C5J A;  1D8Y A;  2G5H B;  3MGV A;  5ALQ A;  2AGQ A;  5DG8 A;  2XGP A;  4UAW A;  5EE9 A;  3N7R C;  3BQ7 A;  2WF7 A;  5KG6 A;  9ICI A;  1NNL A;  1L8O A;  3A0B U;  4NLN A;  2E8P A;  4FZL A;  1WWV A;  2F1J A;  2GO7 A;  5AKK A;  1BPX A;  5KG2 A;  4YCX A;  8ICU A;  4K4G A;  5E79 U;  1WUD A;  5AM0 A;  4I28 A;  1SL0 A;  3SEI A;  1UCV A;  5CB1 A;  1S97 A;  1L5U A;  4QZG A;  3WK4 A;  2MAX A;  2KNJ A;  4BWM A;  1ZD2 P;  5FP0 A;  4J9S A;  4DL5 A;  4R66 A;  1OW5 A;  4US9 A;  1PVR A;  2PI4 A;  2KOB A;  2K4I A;  7ICP A;  4QZ9 A;  4DQP A;  2BQR A;  3CW2 C;  1NJW A;  1O08 A;  4KTQ A;  1HEK A;  2W9C A;  5J2K A;  3L3F X;  2C2E A;  1KKX A;  4UAR A;  1X9W A;  4F4Y A;  5AIA A;  5DLF A;  5J2A A;  9ICQ A;  4U6P A;  3RH4 A;  5KFJ A;  1PVP A;  4CRX A;  3R9K A;  1COO A;  2V4R A;  4O9M A;  4I2D A;  4NM2 A;  4RT3 A;  1L7M A;  1XO1 A;  4J9M A;  3PW4 A;  2NRX A;  2VJ5 A;  3RAX A;  4K4H A;  4PHA A;  3HP6 A;  3C1Z A;  1ZQL A;  2K89 A;  1TV9 A;  1IV8 A;  4KLG A;  2AHO B;  2PKE A;  2Q0Z X;  2AJQ A;  1RDF A;  8ICT A;  1NK7 A;  3MAB A;  1WG8 A;  3JPR A;  1S0N A;  4BUG A;  2IMW P;  3CRX A;  2ZIX B;  3MC1 A;  4FO6 A;  4R64 A;  3M1Y A;  8ICS A;  3IV6 A;  2JR5 A;  3NGD A;  4UQG A;  4GXJ A;  3NRZ A;  3IDW A;  4DWI A;  2KZZ A;  1Z4N A;  3QYP A;  2RLT A;  4NM1 A;  2R8I A;  2OH2 A;  4RQ3 A;  2BPC A;  2KD1 A;  5DDY A;  1ZQJ A;  3JPT A;  2F77 X;  4IQU A;  1JRP A;  3AU2 A;  2WTF A;  3MFI A;  3SYZ A;  4YN4 A;  1UQV A;  9ICG A;  1URJ A;  1ZXI A;  4RQM A;  2HHS A;  2ISP A;  4DSF A;  4EEK A;  2YN4 A;  5L9X A;  3MR5 A;  2H3V A;  4RZR A;  3DV9 A;  1BPE A;  1N56 A;  1QTM A;  1F0M A;  2HCF A;  4Y2R A;  4I2G A;  3E58 A;  5D4B A;  3B9J A;  5ALL A;  3ZDE A;  3I28 A;  2P6R A;  4M04 A;  2KN7 A;  5KT5 A;  5KFX A;  1FIQ A;  3S6J A;  2BQU A;  4BGD A;  5EWE A;  4O0I A;  5IIL A;  2G5I B;  3NVZ A;  2MU2 A;  2KE7 A;  1MA7 A;  1M6Y A;  3I1Y A;  4EBE A;  1S77 D;  3ORY A;  3V6H A;  5B66 U;  2HW3 A;  4ECQ A;  9ICW A;  5AK5 A;  1JXL A;  4AYB F;  3SAG A;  1ZQG A;  3ZDC A;  2K4E A;  7ICQ A;  2FPK A;  5D46 A;  3QEA Z;  8ICL A;  4F5R A;  2ZTC A;  1UA1 A;  1BPD A;  1ZQW A;  4I2I A;  4ED0 A;  4IR1 A;  3GV8 B;  1K5O A;  1U49 A;  5AK4 A;  1UPH A;  1MC8 A;  2CXY A;  4F4Z A;  1N62 A;  3BQ0 A;  2DFL A;  1GO3 F;  1TAQ A;  2XY5 A;  2VA3 A;  3NUQ A;  2BGW A;  4UAZ A;  1XNS A;  1WWU A;  2LYB A;  4C8K A;  3QXG A;  1KL9 A;  3V7L A;  5KFH A;  1RPL A;  2KIC A;  9ICC A;  3H8W A;  4F3O A;  4EEN A;  1ARO P;  3WKA A;  3MDC A;  2R8H A;  2KHQ A;  2F1I A;  5CHG A;  9ICM A;  3K1R B;  4Z6F A;  4O3M A;  5AM5 A;  4ELT A;  5AM2 A;  2GWS A;  3JPS A;  3RH5 A;  2EAP A;  5DQH A;  3HWT A;  2HBJ A;  1ZQR A;  1MN8 A;  3GV7 B;  7ICV A;  4QWB A;  2WB1 C;  1T4G A;  3BJY A;  1Z00 B;  4DEZ A;  2YB1 A;  4YXM A;  2KZ3 A;  4J9L A;  2G06 A;  2ISO A;  2IBK A;  5J2J A;  2KSO A;  2WF8 A;  4XUS A;  4R63 A;  1QQ7 A;  5G5G A;  4M2Y A;  4DS4 A;  3ZDD A;  5KFP A;  5ALP A;  5CEH A;  9ICT A;  3V72 A;  1ECW A;  4XRH A;  9ICU A;  2AH5 A;  2JXJ A;  4YMN A;  1Z00 A;  2Q4T A;  1F44 A;  4OJL A;  1PK1 A;  3GIK A;  1KQQ A;  5AKJ A;  4P4O A;  2HHW A;  4ZH4 A;  5KT4 A;  3Q8Q B;  4DLG A;  4CF3 A;  4O3R A;  1YZ7 A;  2RDJ A;  4F4X A;  1L3V A;  3T3F A;  2KVC A;  5B5E U;  3WKE A;  4IS7 A;  5CJ7 A;  3BS5 B;  3D2Q A;  8ICF A;  2R8J A;  1P7D A;  2F8K A;  4J9K A;  5J0Q A;  5HMM A;  1TE2 A;  3TI0 A;  5KT2 A;  1SWW A;  1OUQ A;  4GIB A;  3PV8 A;  2IOH A;  4TUS A;  3RH6 A;  4UB3 A;  2HVI A;  1SZH A;  2WF5 A;  5EE3 A;  4C4T A;  3HW8 A;  1RYU A;  4RQ0 A;  4IR9 A;  2XC9 A;  2WF9 A;  2HHQ A;  2HBM A;  1KEJ A;  2ZIU A;  4NV0 A;  2FJ6 A;  1A76 A;  2A1J A;  2OXO A;  3UMC A;  5ALH A;  2KJ5 A;  2XIC A;  2VAN A;  5ALN A;  4DFJ A;  4DFD A;  4ACO A;  5KFA A;  4KIT B;  4QWA A;  2PFO A;  2DPI A;  1ZJN A;  2KTQ A;  3GII A;  4IQW A;  5GTH U;  4ED8 A;  3D2S A;  2PMZ C;  2KSO B;  1L8L A;  5AI6 A;  9ICE A;  4YFK A;  4Q8F A;  4HAI A;  3H4B A;  4Y2X A;  2P6U A;  1XC9 A;  5J0S A;  4LZG A;  4Y2Q A;  2LMR A;  3WU2 U;  1TKD A;  4QZA A;  1ZQC A;  4Y2J A;  3WK6 A;  4I2C A;  3MGI A;  1TK0 A;  3Q8S B;  2ZG6 A;  5AKG A;  3Q8K A;  3QU9 A;  1L7N A;  2UVW A;  1JIH A;  2FPM A;  4F2R A;  2I1Q A;  1JUD A;  1NI3 A;  4F91 B;  4OJ5 A;  8ICH A;  1PK3 A;  1JX4 A;  4EZ9 A;  2W43 A;  1QQ5 A;  5ALE A;  1TAM A;  1XS9 D;  1SKW A;  4MEX A;  3AQE A;  4FFD A;  2DKZ A;  1S10 A;  3OSN A;  3ZI4 A;  2BDU A;  4PH5 A;  4KLS A;  3D6J A;  1A0P A;  3MR6 A;  2YTU A;  1IIP A;  1XU4 A;  3PSP A;  4OD0 A;  4NLZ A;  4F5P A;  8ICB A;  4RQ2 A;  2C28 A;  1S9F A;  3WK5 A;  4YG2 A;  1PVQ A;  1ZQZ A;  5EE0 A;  4ECV A;  5CA7 A;  4YR3 A;  1DK3 A;  1X6I A;  1T3N A;  3Q8P B;  5ALU A;  1NK5 A;  3ZDA A;  5HR6 A;  4J9Q A;  4Q8E A;  5ALO A;  3N28 A;  5BOL A;  7ICK A;  2YY6 A;  3LWL A;  5KNI A;  3QE9 Y;  3SZ2 A;  1B22 A;  2DWQ A;  3IM1 A;  5J2I A;  9ICO A;  2JEI A;  4KLL A;  3OGU A;  1CEZ A;  5ALY A;  5ALM A;  5ALJ A;  3N7P D;  8ICP A;  1VJ5 A;  5AK6 A;  3OJS A;  4KLO A;  1KRP A;  5KG3 A;  2WFA A;  4UB6 U;  3GIM A;  7ICL A;  1NJX A;  4FE3 A;  1DRG A;  3WKD A;  7ICG A;  1ZD4 A;  1ZQH A;  4O5E A;  4JWN A;  2HI0 A;  1YT3 A;  5DB8 A;  2DBY A;  8ICW A;  2IOF K;  2PFN A;  1NK6 A;  4QIW F;  4DFP A;  1ZD3 A;  3RJG A;  2JH1 A;  4ECT A;  3F2B A;  2ZIW A;  2ALZ A;  4A8E A;  4B9M A;  1SB3 C;  2H3F A;  1X6J A;  2ZIX A;  3QEB Z;  1FEZ A;  2ZIV A;  2OYY A;  4Y2V A;  4UB2 A;  4JB3 A;  4G9B A;  3IG8 A;  5KFB A;  5AI5 A;  4JV1 A;  2NRZ A;  4MFA A;  3NRW A;  4J9P A;  2ODG A;  4TUR A;  2KV2 A;  4IL6 U;  3GV5 B;  2W9B A;  1NK0 A;  2JMG A;  2K60 A;  4EX7 A;  5AM1 A;  3KZX A;  5KFQ A;  2W8L A;  1SV0 A;  4FBU A;  4QZ8 A;  4RPZ A;  3GU3 A;  2EZX A;  5ALT A;  3RJE A;  3C2M A;  2KVS A;  1PUZ A;  4I2A A;  2CRX A;  4M6W A;  5AKZ A;  5KT3 A;  5IIO A;  1ED1 A;  2NV3 A;  1RXW A;  4DL3 A;  1SGG A;  3AU6 A;  2XCA A;  1NKE A;  5KFK A;  1KFS A;  4OJO A;  2FLP A;  2BCS A;  3OSP A;  3KHG A;  1BGX T;  3PST A;  1PK1 B;  5KT6 A;  1S0M A;  3E2E A;  2XI9 A;  4UB4 A;  5KFM A;  1ZQS A;  4EYI B;  3UPQ A;  5KFN A;  2P35 A;  3K1Z A;  1NK4 A;  4TQS A;  2ZIV B;  8ICV A;  1PZN A;  2HHX A;  2AXT U;  8ICQ A;  3DDH A;  2AU0 A;  1MQ3 A;  2WB1 F;  4PGY A;  2DQN B;  4I2B A;  1X9M A;  4TUP A;  2BPG A;  8ICN A;  5C0Y A;  2W9M A;  4XA5 A;  5IIN A;  3L4P A;  2PI5 A;  5TZV A;  4LJX A;  3H8J A;  5J2H A;  4RUA A;  4KLE A;  4C8O A;  2W9C B;  5DB9 A;  2NYV A;  2FMS A;  2BKE A;  3M9N B;  1XO0 A;  1ZJM A;  3KHH A;  5KFS A;  4QZC A;  1DOQ A;  1ZQB A;  4AP9 A;  4Y2P A;  4C7Z A;  2KIW A;  5J2B A;  5KFC A;  5AI0 A;  4QWD A;  3PMN A;  2ZUD A;  4ICA A;  4F4W A;  5KFF A;  4FZN A;  2ZTE A;  3RJK A;  4P2H A;  1C20 A;  4QWC A;  5DGA A;  4QZE A;  4DFM A;  1Z1B A;  7ICF A;  3G6V A;  3B0X A;  4JK1 A;  2LM1 A;  1KFT A;  1RQN A;  4KN4 A;  1YZ6 A;  5ALZ A;  2JH7 A;  4B9V A;  1LKY B;  3RR8 A;  7ICH A;  4EBD A;  3BS7 A;  3BQ1 A;  4PL2 A;  2KHV A;  2KG5 A;  5L1M A;  4RQ6 A;  4E0D A;  2FMQ A;  2Z7J A;  2DUY A;  4P0P A;  3UXN A;  3TAN A;  2Y9T A;  3J81 j;  5DLG A;  4DF8 A;  4UAT A;  4B9L A;  1S0V A;  4XQ8 A;  1Z3E B;  2JEJ A;  5J29 A;  1UT8 A;  2PMZ F;  3H0R B;  3PO4 A;  4WJ3 B;  1SWV A;  1AQ6 A;  1BNO A;  2W3R A;  4I29 A;  1N61 A;  8ICR A;  1J2M A;  5DKW A;  2JZB A;  5KG5 A;  1K1S A;  2O6K A;  4CF5 A;  3NVV A;  3T5K A;  1U45 A;  1ZQ1 C;  3EPI A;  3F53 A;  1H38 A;  3OHB A;  3TFS A;  5DDM A;  4CNQ A;  9ICA A;  5BOM A;  4UBB A;  1ZQX A;  4EEL A;  2HHV A;  8ICZ A;  2GH1 A;  8ICJ A;  4GC7 A;  1ZQD A;  2LI6 A;  4PZN A;  4Z6C A;  1SL1 A;  5J0R A;  2IA6 A;  3HPO A;  8ICK A;  1ZQI A;  2I9G A;  3AMZ A;  4DQS A;  2MSN A;  1CUK A;  1S5L U;  1ZET A;  1ZQK A;  5AHX A;  3C5F A;  2FDR A;  4M47 A;  8ICI A;  4OCZ A;  2BR0 A;  1ZQF A;  3GZF A;  3ONN A;  1Q8K A;  4JUZ A;  4KLH A;  3T5H A;  5KFZ A;  4EBC A;  3BQT A;  4RQN A;  5KFY A;  5L1J A;  4OJP A;  3ETR A;  5G5H A;  3ZD8 A;  2I6X A;  5ALF A;  5EOZ A;  3RFA A;  3Q8L A;  4OO1 J;  2XGQ A;  4Y2U A;  4RQ7 A;  2F1H A;  4LZD A;  5KL1 B;  4JMU A;  4Y2T A;  5EE1 A;  5ALI A;  4B9S A;  3PR4 A;  1KW4 A;  5HP4 A;  2FLL A;  5ALK A;  3C5G A;  3L5K A;  1WCN A;  5T14 A;  3RTV A;  4ED7 A;  3M7D A;  3F5A A;  4GXK A;  3TQ1 A;  4BWJ A;  4C8M A;  3C21 A;  2JGA A;  2MRL A;  4FZM A;  2J6T A;  4KLM A;  2W9B B;  1NZP A;  3JPO A;  3TAD C;  3JPN A;  5AKL A;  3QU5 A;  1V85 A;  5AIB A;  3EUB 2;  2RP5 A;  3T5J A;  4RUC A;  2K4P A;  5J0X A;  3V7K A;  4BJQ A;  4RQ4 A;  3H40 A;  1N63 A;  4F92 B;  3OTQ A;  4M6W B;  2BCQ A;  5J0P A;  3B0Y A;  4I27 A;  4QIW C;  3PNC A;  2HMX A;  1JI7 A;  3ALR A;  2B21 A;  4DSK A;  2LHT A;  3TAC B;  3C2L A;  4QZD A;  3PSF A;  2KFZ A;  9ICX A;  2D6F C;  2V4Q A;  3VCB A;  2WAQ F;  3KHL A;  3FAH A;  3PVX A;  2UVR A;  3QUC A;  1TK5 A;  4PL1 A;  3WKC A;  3RB0 A;  3MR3 A;  5CWR A;  1COK A;  3RJF A;  5HNK A;  4QW9 A;  1V97 A;  5DBB A;  3MR2 A;  3UQ2 A;  2KJ9 A;  1L7P A;  2ATL A;  3KKA C;  2G09 A;  3TFR A;  4P0Q A;  1BPB A;  3ZD9 A;  3TKA A;  2VA8 A;  2JV3 A;  1OXJ A;  2Y1I A;  2DL0 A;  3RF9 A;  2IOF A;  3F5E A;  3JPP A;  2LYA A;  4CCH A;  4KLD A;  2KK0 A;  1HUO A;  3C28 A;  3PX0 A;  2W54 A;  1N60 A;  2BPF A;  3DEE A;  4B9N A;  4NLC A;  2YX8 A;  5J0T A;  8ICE A;  3SV4 A;  4KMO B;  9ICL A;  2HHT A;  2E5S A;  1JMS A;  4R8U B;  1ZQA A;  2EDU A;  1ZQN A;  4KLT A;  1CRX A;  5HR7 A;  3QUQ A;  2LM4 A;  1SV4 A;  2XO7 A;  4ED3 A;  2ZXI A;  4O3O A;  3MBY A;  8ICM A;  2VJ4 A;  2R18 A;  5IIJ A;  4C7Y A;  3QNM A;  3CYM A;  5ALV A;  3KOO A;  3FC4 A;  4M9L A;  3SAF A;  1MSW D;  2DPJ A;  3U26 A;  3BZC A;  5IIK A;  5IIM A;  2NRV A;  1EXN A;  4TQR A;  4C4R A;  3ED5 A;  3M9O B;  2KJ8 A;  2RRD A;  4F5Q A;  2EZZ A;  4DLE A;  3OHA A;  4ECZ A;  2I5H A;  1L7O A;  2E1F A;  3SEN A;  2Y0S F;  2AGP A;  1ZQV A;  2WHE A;  4YXJ A;  5DBA A;  5AKI A;  5KG1 A;  4QW8 A;  5AKH A;  4IRC A;  1WCL A;  2FI1 A;  4F71 A;  1NKB A;  2BQ3 A;  5JTI A;  2EAN A;  4YVZ A;  4YMO A;  7ICM A;  2EQY A;  4Y2S A;  8ICC A;  3IHQ B;  4FS1 A;  2H3Q A;  7ICT A;  3EW9 A;  1S76 D;  2KP7 A;  2QB0 A;  4YD1 A;  2MA1 A;  1KLN A;  2L5Y A;  5AI9 A;  4YR0 A;  3HKZ C;  3M6Z A;  2BDP A;  3OJU A;  4PPX A;  4DO9 A;  3AL0 B;  5J8Y A;  4C80 A;  1ZQP A;  2HOQ A;  5L1K A;  5III A;  3QU2 A;  1BPY A;  2W11 A;  1RG6 A;  2HBL A;  1SKR A;  2LBO A;  4BDP A;  3RR7 A;  3RRH A;  1Z1V A;  2W7O A;  2YQE A;  2P66 A;  2UVU A;  1BVS A;  3H0M B;  3EZ5 A;  4J9O A;  3M8S A;  4GLX A;  1SL2 A;  1LVH A;  3AM9 A;  2F2A B;  2PXI A;  4CGZ A;  4NL9 C;  2F3N A;  4MHV A;  3PW0 A;  3OPX A;  4DQI A;  1ZQY A;  4F5N A;  4M9J A;  5EWF A;  3H7I A;  3TAR A;  4RNN A;  4O3S A;  1Q46 A;  2DF4 B;  3AUO A;  2ES6 A; 
#chains in the Genus database with same CATH homology
 1V85 A;  3BS5 A;  3IDW A;  2E8P A;  1WWV A;  5J8Y C;  2K4P A;  5F3X B;  1WWU A;  2YTU A;  2F44 A;  3SEN A;  1X40 A;  2K60 A;  4PZN A;  3SEI A;  1UCV A;  1JI7 A;  4PZO A;  1SV0 A;  2QB0 B;  3TAC B;  1UQV A;  2QAR A;  3K1R B;  5JTI A;  2QKQ A;  2EAN A;  4RQM A;  2EAM A;  2EAP A;  1OW5 A;  3KKA A;  1B0X A;  1LKY A;  1COK A;  2KSO B;  1SGG A;  1F0M A;  2QB0 A;  2EAO A;  1X9X A;  2L5Y A;  4NJ8 A;  2QAR B;  2QB1 A;  3KKA C;  4RQN A;  3H8M A;  2KSO A;  5J8Y A;  5KNI A;  1LKY B;  3BS7 A;  3TAD A;  1V38 A;  1PK1 B;  2JV3 A;  1OXJ A;  2KG5 A;  2DL0 A;  5L1M A;  5JU5 A;  5JRT A;  1RG6 A;  2GLE A;  2Y9U A;  2Y9T A;  2LMR A;  1Z1V A;  1X66 A;  1SV0 C;  2KE7 A;  1SXD A;  2FE9 A;  2LPE A;  4NL9 A;  3HIL A;  2DKX A;  1PK1 A;  1KW4 A;  2E8O A;  2D8C A;  4NL9 C;  2F3N A;  1SXE A;  4MHV A;  1SV4 A;  1PK3 A;  4IS7 A;  2KMD A;  3BS5 B;  2B6G A;  2E8N A;  1B4F A;  2E8M A;  2F8K A;  2ESE A;  3BQ7 A;  2DKZ A;  3TAD C;  2KIV A;  2D3D A;  1DXS A;  2ES6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...