1WWVA

Solution structure of the sam domain of human connector enhancer of ksr-like protein cnk1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GSSGSSGMEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Connector enhancer of kinase suppressor of ras 1
publication title Solution structure of the SAM domain of human connector enhancer of KSR-like protein CNK1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1wwvA00
1SV0A 4RQNA 2KSOB 5JTIA 1PK3A 2KIVA 1WWUA 1Z1VA 3TACB 2YTUA 2D3DA 3KKAC 2DKZA 2DL0A 4IS7A 3SENA 1JI7A 2KMDA 2QB0A 1UCVA 2KSOA 2QARB 2EAOA 1SV4A 4NL9A 5L1MA 3BQ7A 2ESEA 2K60A 3BS7A 1OXJA 3BS5B 1X66A 2QB0B 2QARA 3K1RB 3SEIA 1X9XA 1F0MA 2KE7A 3KKAA 1X40A 5F3XB 1COKA 3BS5A 4NJ8A 2Y9UA 2ES6A 3TADC 4RQMA 5JU5A 2E8MA 1SGGA 2E8PA 2EAMA 4PZOA 2F44A 5J8YC 2LPEA 1SXDA 1RG6A 1WWVA 2F8KA 1V85A 4PZNA 2FE9A 1OW5A 1B4FA 3TADA 3IDWA 2DKXA 1LKYB 2D8CA 1DXSA 1V38A 2EANA 2E8NA 1SV0C 2JV3A 1UQVA 1B0XA 2QKQA 2KG5A 1PK1A 5KNIA 2F3NA 5J8YA 2L5YA 2Y9TA 1LKYA 1KW4A 2K4PA 2LMRA 2E8OA 4MHVA 2EAPA 1SXEA 1PK1B 2GLEA 4NL9C 2B6GA 5JRTA 2QB1A 3HILA 3H8MA
chains in the Genus database with same CATH superfamily
4ECTA 4YVZA 1PK3A 4Y2RA 4JMUA 3NVWA 5AKJA 1ZQRA 2IOHA 3LWMA 1TVAA 5AKXA 4J9MA 2HCFA 4ED2A 8ICAA 1IV8A 1CEZA 3M8SA 1UT8A 1NK9A 3RH5A 2LHTA 3FC4A 1PUZA 5ALJA 1QTMA 2K8BB 1BPZA 1Z4OA 3MFHA 3QUQA 1YT3A 5ALXA 4TUSA 1ZQKA 3KKAA 3KBBA 9ICJA 1PVPA 1XWLA 1ZQXA 2ZIUA 4DSLA 2J6SA 2C28A 1NK5A 3PX4A 5DG8A 3T5HA 3UPQA 3PVXA 2LPEA 2OXOA 1KRPA 1ZQCA 3ICXA 4ECYA 3ZDAA 3C1ZA 5KL1B 4IR9A 3DEEA 4TQRA 2HOQA 3BQTA 1COOA 2W7OA 1WG8A 1ZQPA 2XGPA 5A0LA 2DQNB 4XRHA 2D6FC 2JXJA 4OJPA 3T5JA 4F91B 2JEFA 5C0YA 3CRXA 3ORYA 2JHDA 3LWLA 9ICWA 5DQHA 3HPOA 4F5NA 5KG6A 2W8LA 5KAFU 5KFDA 2B6GA 4QZBA 4JV1A 1L7OA 1HJPA 3UXOA 1SKWA 4ED7A 3HILA 5KFRA 2DUYA 3HKZC 4Q8FA 2KZZA 4DQPA 3KKAC 3IM1A 3GILA 3HP6A 4QZHA 1JMSA 1U47A 3SQIA 4NL9A 4I2BA 2LBOA 5KFMA 5DQGA 2A1AA 3MR6A 3WKDA 1JRPA 5ALFA 3UXPA 2M9NA 5AKIA 5FP0A 5KFHA 5DB7A 3VC8A 4P2HA 4I2EA 3TKAA 5KFVA 4QNLA 2ES6A 5KFYA 2I9GA 2E8MA 2HW3A 2LYHA 4Y2UA 3SZ2A 3AU2A 2EAMA 4I2GA 3T5KA 5KFNA 4B9TA 3BQ1A 1ZQEA 3A0HU 2BQUA 4UB6U 2V4RA 4RT3A 4MF8A 4KN4A 2BCRA 3KHLA 5DG7A 3QUBA 4P0QB 4LZDA 3TAPA 4OO1J 1NK4A 1XNSA 2KJ9A 1UT5A 8ICXA 3OPXA 5AK6A 2FMPA 5CHGA 9ICOA 4MEYA 4QZCA 2HBLA 1H38A 4C4RA 4DOAA 4C8KA 2R8HA 2JEGA 3TFRA 2ZIVB 3PZPA 4P4MA 5EE9A 5ALEA 4XUSA 1ZQ1C 1HUZA 5J0XA 4DFMA 5AI0A 1SXEA 4Y2YA 4NL9C 4TUPA 1XO0A 3D2SA 4QZGA 4MFAA 1D9DA 3NASA 5ALSA 3QNMA 2HMXA 4Z6FA 8ICOA 2FMSA 5KG7A 2R18A 2B21A 4KN7A 4USAA 3NTUA 2NRZA 2EQYA 4B9VA 4IS7A 4EBDA 2WFAA 1QSSA 1NK0A 2H3ZA 2ZXIA 1FEZA 2HI0A 1UCVA 5IIJA 5KG2A 5J2CA 3ISBA 3N4MB 3DDHA 3KOOA 4M0AA 4P0PA 3A0BU 5J0SA 2EZZA 5EWFA 3QX7A 1NZBA 3UMBA 2VJ5A 5IILA 2BPFA 2WF8A 3PV8A 1TE2A 5KFZA 2FMQA 3FAHA 4F72A 1L7NA 3PX0A 2R8KA 1X42A 4PJ0U 4DQSA 3LVVA 2V4QA 4P0QA 5DLFA 1T7PA 2VANA 3V6JA 3ZI4A 2PXIA 3PY8A 3BJYA 1FFVA 2E8NA 1DGJA 2YMLA 4DFJA 2KTQA 1RXWA 4UB2A 3AM9A 5DB9A 2KKPA 4O3SA 4NLZA 2L5YA 4F4WA 4GC6A 2KK0A 3G6YA 2HHVA 4B6JA 4EBCA 1JUDA 2LMRA 5DGBA 2Y0SF 2FPMA 2RRDA 5EE3A 1LV5A 8ICKA 2RLTA 2EZXA 1OUQA 4EZ9A 4F8RA 1WCNA 4O3OA 1LB2B 3RJGA 3QUCA 2JGAA 2I5HA 1ZQWA 4Y2JA 4EX6A 3B0XA 1QQ5A 3RB4A 4DO9A 1KQQA 3KTQA 1P7DA 3ISDA 7ICGA 4ECZA 1ZD3A 2GWSA 4KLMA 4YFKA 4EYIB 1K5OA 3JPNA 4YD1A 1S8OA 3IHQB 2ASJA 9ICRA 2ZTEA 4M9JA 4Q43A 9ICKA 4M47A 4QZ8A 4YMNA 1NK8A 4PHDA 1RYSA 4IR1A 1ZQHA 4IQVA 1X40A 3PX6A 2Z7JA 2R8JA 3EYZA 3EW9A 5KT7A 2KICA 1D8LA 5DQIA 3F2BA 3KHRA 2F2AB 1ZQMA 1C7YA 3GZFA 2GO7A 1S77D 5ALTA 2E1FA 3J81j 4I29A 3Q8RB 2KIWA 2F8KA 5GTHU 1CRXA 1CI4A 5J2BA 1B4FA 3N7PD 2NYVA 3DV9A 1SWWA 4KLOA 3IDWA 4DQRA 2H5XA 4NLBA 5J2FA 9ICQA 2JEJA 3F5AA 4UAUA 1UA0A 5HHHA 8ICTA 1LKYA 4C7ZA 2J6TA 4M9LA 4ECXA 1PK1B 3MGIA 3BZKA 2ZTDA 1TKDA 1ZD5A 2QB1A 4EELA 1PZNA 4BXOB 2CPRA 2BDPA 4J03A 4AYBF 2JH1A 3UMGA 2DPIA 2DKZA 2K8CB 3AN1A 3NUQA 4DL6A 4R66A 4ELVA 5KG3A 1S0VA 3QZ7A 1JIHA 2HDOA 4F2SA 1Q3VA 4KX3A 4RQ6A 4C8LA 5AIBA 2ZG6A 2ALZA 4UAYA 2NV3A 4X5VA 3H0MB 5ALIA 5IINA 2E5SA 3K75D 2UVVA 2HVHA 1SZPA 2W03A 3QUTA 2H3QA 3RJJA 2FLLA 2OWOA 4NY8A 1O08A 5BOMA 2HVIA 5C5JA 4QZEA 4Q44A 4GXJA 3WK5A 1Q46A 4F50A 3TFSA 3K1ZA 1V97A 4PZNA 4QZIA 2ISPA 4YXMA 4I2FA 5H2FU 2J6UA 2VKQA 2YX8A 4Y2SA 1NK6A 2KFNA 4I2CA 2AGPA 3ZD9A 4RQ8A 2W7PA 1KBUA 4ED8A 5DKWA 4F3OA 2QKQA 4KLGA 1PK1A 5KNIA 2W9CB 3G6XA 1L3UA 3SV4A 4ECRA 4B9LA 2WAQF 4BXOA 5AHXA 4O3PA 4MHVA 4DS4A 1DK2A 1ZQDA 5KFLA 1DRGA 2Y0SC 4JV0A 2NRWA 4Q45A 1ZQBA 2G0AA 1S9FA 4JWMA 2KSOB 1X6IA 2WF9A 5F9LA 4US8A 3GIKA 1TFRA 1NOMA 3Q8LA 5ALRA 3MR5A 2OEHA 4O0IA 1BPYA 3B0YA 4ACOA 1Q8KA 1ZQJA 5IIIA 4JV2A 3CYMA 2I6XA 2KFZA 9ICNA 2PKEA 5AK5A 3TANA 2K60A 4CRXA 3OHAA 1RYUA 3TI0A 3M6KA 1X9XA 2RDIA 5F3XB 2HOIA 5G5HA 1FFUA 4EZ6A 3H4BA 2PFOA 4O5KA 4RZRA 4YR3A 5KFIA 3LDAA 3H8WA 4ECSA 1MA7A 5KG1A 4O3RA 4CE6A 1SL0A 3FM9A 1ZQGA 2P66A 1ZETA 2YMMA 4YP3A 4GLXA 2E1EA 2UVWA 4QW9A 3GIIA 4A8EA 5KT5A 4RNMA 4EYHB 4DSFA 2W9CA 4K4GA 3KHGA 3HWTA 1N63A 2K4HA 3TARA 1FIQA 3HT3A 3I28A 4GC7A 1TAUA 1N56A 4U6PA 2GOLA 3UXNA 5IIMA 2G5HB 4PL2A 4OJ5A 5J0YA 2BPGA 2MUTA 3GFKB 4PL1A 1N62A 4M04A 5CP2A 4O3NA 3RRGA 5CR0A 5AICA 5HR7A 5J0WA 2BZFA 3HJEA 4UB4A 3M6ZA 5KT3A 1NNLA 4I2DA 3PW2A 5KTQA 3V6KA 2EH9A 4UB8U 3AL0B 3H0LB 2FPKA 1GO3F 4AYBC 3UQ2A 1X6JA 4DWIA 1L3SA 4M9GA 4IRCA 2ODGA 1X9WA 5L1MA 8ICJA 2KVCA 1O03A 4R63A 4ED1A 4UQGA 2MU2A 4PPXA 3V7KA 5EE1A 1D9FA 2YQEA 4EEYA 2QB0B 1QSYA 8ICVA 2NRVA 5J2KA 3SYZA 3WK4A 1KSPA 7ICVA 4C80A 5ALKA 1L5UA 8ICZA 5AM4A 3B9JA 1TV9A 2CRXA 2WHEA 3V7JA 2WF7A 1KTQA 3I1YA 1ZXIA 2RQ5A 4FZNA 5AI9A 4GXKA 4LJXA 3R9KA 3ED5A 3RJEA 2AXTU 3PW0A 5AI5A 3V6HA 2I1QA 3GU3A 1Z1BA 5CEHA 9ICTA 3ZDEA 3LYSA 4JB3A 5AKHA 2HBJA 2BQRA 4DOBA 3AQEA 1XU4A 3M7DA 1TK5A 8ICMA 3ZDBA 1FO4A 2HHUA 1SKSA 3KZXA 3JPPA 2OHFA 2EAPA 3EUB2 3JPRA 4R8UB 3WKAA 1N48A 2XY5A 1NKEA 2GLEA 8ICPA 5JRTA 2WAQC 4RNOA 5L1LA 2GH1A 2W54A 4RU9A 5KG4A 3WU2U 1L6NA 3WK7A 5CWRA 2XVTA 5DDYA 2ATLA 2RP5A 4UB5A 4M9HA 4F4XA 4J9KA 3SENA 5BOLA 9ICXA 1A6SA 3WKCA 3Q8SB 2QB0A 1RXVA 2ASDA 4TUQA 4O3QA 4R64A 3M8RA 3QEAZ 2VJ4A 2YY6A 2K4IA 4DL3A 1ZYQA 4O5CA 3MGHA 8ICNA 3BQ0A 1SZHA 4XQ8A 4F71A 4J9NA 9ICMA 3RRHA 1ZD4A 4NXZA 3JPOA 2Y9UA 2KHVA 1BPEA 2JH7A 4ECQA 5HR6A 4MFFA 3OJSA 1K1SA 5J2IA 2AU0A 4C8MA 5AM3A 1DOQA 2BKEA 1SXDA 3MGVA 4RQ0A 5AKEA 1TAMA 1TAQA 8ICYA 2FE9A 5KAIU 5D49A 1S76D 1OW5A 4UAWA 4QWAA 4F4ZA 3M9MB 1JROA 2XO7A 4GIBA 4CF5A 1SL1A 2D8CA 5J0TA 1DXSA 1V38A 1SIJA 4R8UA 4I2IA 3QE9Y 4YCXA 4FS2A 4MFCA 4LZGA 1KFDA 1BGXT 1TK0A 3PO5A 2XCAA 4ED6A 1M6YA 1ZRNA 2YB1A 4CNQA 4YQWA 2RDJA 4F5PA 5AM5A 2KOBA 5DBAA 1RQNA 4I2JA 2ZIVA 2K4EA 3VCBA 4QWCA 3ETLA 4ELTA 3IN5A 4DS5A 3RB6A 1WWUA 4QWEA 3IV6A 5J2AA 4Z6DA 4BWMA 2W3SA 1RYRA 3ZDDA 4UW9A 3OSPA 2V9WA 2QARB 5ALZA 2PMZF 1MQ3A 2G08A 1MQ2A 3MC1A 4F2RA 2WF6A 2FPLA 3BS7A 3LVWA 1ZJMA 3BS5B 1X66A 5ALDA 2QLTA 4RQ4A 4M9NA 5KFEA 4YD2A 4NM1A 5EE0A 3QU2A 2ASLA 4KLDA 5F9NA 1PVQA 4J9QA 5JU5A 7ICIA 3PSTA 4EX7A 4GXIA 4KLIA 1N61A 3RAXA 3RH6A 3GDXA 5KFUA 4Y2TA 9ICAA 1KFSA 4RPZA 4CCHA 9ICHA 4QZDA 3NVYA 2W9AA 1QH9A 4KX5A 1JXLA 2KD1A 2DFLA 4DFDA 2G07A 3SD7A 3O0FA 2JEIA 2BCVA 2IOFK 1XSNA 4FO6A 2JZBB 5AKZA 3RAQA 4MF2A 3AMZA 4Z6EA 4M6WB 1XSLA 5L1KA 2FLPA 2ZUCA 2PFPA 3RR8A 1KDHA 3ALRA 3C5FA 3H0RB 2HSZA 2KIVA 2LM4A 9ICBA 4B9UA 1D8BA 3RJFA 5KFSA 5L1JA 2YN4A 2A1JB 4FBUA 3SI8A 1N5WA 2XI9A 4FS1A 4AP9A 5ALGA 2BQ3A 2F1IA 3CP8A 2BR0A 1AQ6A 3MDAA 3GIMA 2XIDA 3QXGA 2ZIXB 2C22A 2C2EA 5KFGA 4KMUA 4IQWA 5ALMA 2W55A 4KITB 4CDGA 2AGOA 4BUGA 4DSJA 2KE7A 2HHQA 3C28A 5HP4A 1BNOA 4F5RA 1T4GA 1BPDA 3U26A 5KFPA 1NKCA 4KLSA 4DFKA 4NLGA 3PNCA 5BPCA 2DF4B 2LYAA 3BDPA 1L3TA 4I28A 2B0CA 2YB4A 3F5EA 2MAXA 7ICJA 3QEBZ 4RT2A 1RPLA 2DBYA 1ZQAA 4DSIA 2ZIWB 4TURA 2A19A 4DOCA 4QWBA 5L1IA 2JZBA 4HYKA 2MSNA 3Q8PB 4FZMA 3PW5A 3CW2C 1UQVA 3L5KA 2NRXA 5IIKA 2KG5A 2XC9A 8ICEA 2DGZA 3IRUA 3RBDA 4EEKA 1J2MA 1IM4A 2KV2A 3QU5A 5KT2A 3JPQA 2OH2A 4IQUA 2A3VA 4C8NA 3K4GA 2HHSA 5EOZA 2XGQA 2A1JA 7ICQA 1L8LA 3SAHA 3UQ0A 2AQ4A 2C2DA 5J2GA 2O6KA 2AHOB 4F4KA 1L3VA 4OJOA 2D3DA 4HAIA 2IHNA 3Q8QB 4RQ7A 7ICTA 1KEJA 2W8KA 3C21A 1XS9D 4DLGA 3GQCA 4ECUA 9ICLA 2EAOA 8ICCA 3RB3A 1QQ6A 4KLUA 3QU9A 2UVRA 5J0QA 2ZIUB 3H4DA 2PMZC 4P4OA 2HHWA 2F76X 2BGWA 1S97A 2F8LA 1N60A 2IMWP 1NKBA 4UB1A 5DBBA 4KLJA 3E58A 4BDPA 1NJYA 4NJ8A 1IXRA 2BDUA 3C5GA 2BCSA 2EZYA 5DG9A 3PW4A 2ZIWA 4UATA 3SAGA 3NS1A 4PZOA 1NJXA 4UAVA 4F4YA 2HBMA 2PFNA 3RFAA 9ICPA 2WTFA 1KKXA 2KZ3A 3KHHA 4C4SA 4RPYA 1WWVA 1BNPA 1V85A 5G5GA 5ALLA 5J2DA 3RJKA 1U48A 4RPXA 3F53A 3QYPA 1JN3A 3LK9A 2R8IA 7ICHA 5AKGA 2VA3A 1JALA 3E0FA 3QU7A 2XY7A 2JV3A 3PSPA 4FE3A 1X2IA 2E3TA 1BPXA 3KZIU 3L3FX 1ZD2P 3V72A 4O5EA 3QU4A 4M2YA 1URJA 4YR0A 1NI3A 1ZQNA 5AM2A 2P35A 5KT4A 4E0DA 4NWIA 5KFXA 4IRKA 3ISCA 7ICNA 1C20A 1S5LU 2YMPA 3RB0A 8ICUA 4KLFA 2KJ8A 5KFKA 1SV0A 1ZQOA 3NRZA 2WB1C 4WJ3B 4JWNA 4RUCA 1PVRA 2LI6A 3PW7A 1VDVA 8ICIA 5KFAA 1JX4A 3N7SC 2H3IA 2AGQA 2KMDA 1V9PA 2KSOA 5KFWA 1U49A 4I2HA 3F2CA 2RHFA 4QJFB 8ICRA 3T5LA 2FJ6A 2ZJ8A 1ED1A 1KL9A 1UHUA 5J2HA 3SR6A 4YR2A 3ZD8A 4OJLA 4DLEA 5HMLA 4PGQA 3PMLA 2ZJ5A 2EDUA 3M1YA 2NO5A 1A77A 2KP7A 1A0PA 4O9MA 3CNHA 5AKYA 1RQLA 2MRLA 3Q8KA 4IL6U 4Y2PA 4K4IA 8ICFA 2HHXA 5J0OA 4J9SA 2Y1IA 4NLCA 2IBKA 4KLTA 5IIOA 1YZ7A 4U7CA 5AKKA 5KG5A 2CXYA 3AU6A 4IRDA 5ALPA 3PR4A 1SV0C 1Z4NA 2C2RA 2BCUA 2F3NA 5DGAA 4ED3A 3TAQA 4CGZA 1WYGA 2F1JA 1KW4A 2K4PA 5DB8A 4RQ5A 4J9OA 1RZTA 3H7IA 3HX0A 3ETRA 5EWGA 2IA6A 3OHBA 5JTIA 3QZ8A 4QW8A 1Z1VA 3OJUA 1HUOA 3E2EA 4P0PB 1JXEA 5J0PA 4C7YA 9ICSA 4ICAA 2N1RA 1Z3EB 5ALUA 4PGXA 3WK8A 3Q8MA 4FZLA 2ZUBA 3BQ7A 3KD3A 3PSIA 1VLBA 3EPIA 2AJQA 3GV7B 3RJIA 1OXJA 2OM6A 5KFQA 5HHIA 1ZQQA 4K4HA 4NLNA 4YN4A 2PFQA 2FI1A 3H8JA 4Y2XA 5AI4A 3SEIA 1F0MA 2W43A 3C1YA 1KN5A 9ICCA 5DLGA 1ZQSA 1SKRA 4DL7A 1N5XA 4PHAA 3M9NB 1U4BA 5HMMA 2BHNA 3C2MA 4DCCA 2F44A 2VIXA 5EWEA 4GFJA 1NZPA 2HOFA 5DDMA 4DL4A 1EXNA 3JPTA 2W04A 4DL5A 8ICBA 3PR5B 3C2KA 2KVSA 5KFJA 3OSNA 4DQIA 1ZJNA 3RTVA 2R8GA 4DF4A 1QSLA 3TADA 1F44A 3L4PA 3N28A 4QWDA 1XC9A 4EENA 2HHTA 4QIWC 2EANA 2JMGA 4IC9A 4QZAA 1MC8A 1B0XA 3NRWA 4KTQA 4DQQA 2KJ5A 5E79U 3AQFA 2Y9TA 3MBYA 3RH4A 3ZDCA 1XO1A 2LM1A 4ECVA 4DSKA 4RQ2A 3D2QA 4UASA 4UB3A 2KZMA 3JPSA 3UMCA 1TK8A 8ICSA 3G6VA 4KLEA 4DL2A 4ZOHC 1Z19A 4RQNA 1S0MA 4B9MA 4BWJA 1QQ7A 3N97B 4G3IA 5AM1A 4PHEA 2ZTCA 2VA8A 3T79A 1VJ5A 1ZQUA 2W11A 3PMNA 1T3QA 1DK3A 5ALHA 3AEVA 3HW8A 1Q3UA 4J9PA 4YG2A 5HNKA 3C23A 2XCPA 4JUZA 1HEKA 4Y2QA 4J9RA 3MABA 5K4LA 4XA5A 5DBCA 1S0NA 4ZH4A 2W9BB 3K1RB 4I2AA 3S6JA 4ECWA 3BZCA 1IIPA 5AK4A 4F5QA 8ICHA 7ICLA 9ICUA 8ICGA 4KLLA 1ZQYA 2LKYA 3TADC 3H40A 4NM2A 4F5OA 5ALNA 4J9LA 3GIJA 5KFOA 1KFTA 1SWVA 4DFPA 1U45A 5AKLA 1SGGA 2E8PA 4YXJA 4NV0A 5J0UA 3EZ5A 4P4PA 3C2LA 1NJZA 1LVHA 2KHQA 5D46A 2F1HA 5ALQA 1WUDA 3D6JA 2G5IB 3T3FA 3WK6A 3F2DA 2XY6A 5AI8A 1QLNA 1QCKA 2Q4TA 5T14A 4RQ1A 2MA1A 4C8OA 4RQ3A 4CF3A 2DKXA 1LKYB 4F93B 4YMOA 3BQ2A 8ICWA 2ZUDA 5J2EA 2Y1JA 3PO4A 4F92B 1SL2A 2KNJA 4BGDA 4OD0A 1U9LA 1UPHA 4UAZA 3WKBA 4Z6CA 1ZQFA 4B9SA 4Y2VA 5ALYA 3MR3A 3N7RC 4UARA 5CJ7A 3RR7A 2M0NA 4PHPA 2VA2A 5ALVA 1MN8A 3AUOA 2DWQA 4G9BA 4UBBA 2G09A 3H8MA 4MEXA 7ICSA 1T8EA 3TACB 9ICFA 7ICKA 2YTUA 4C4TA 5B66U 2YMQA 2DL0A 1N2XA 4QZ9A 3WKEA 1ZQIA 2FLNA 1JI7A 5KFTA 1NK7A 3V7LA 2ZXHA 2PI5A 4FBTA 7ICMA 5DB6A 4DSEA 1L8OA 2W9BA 1WCLA 4ED0A 1SV4A 2NRTA 4DF8A 2WB1F 1B43A 1D8YA 3IP4B 3UM9A 4Q8EA 2QARA 7ICFA 4DEZA 4I27A 5ALWA 5J29A 5J2JA 3THVA 3SAFA 1A76A 2DPJA 3RF9A 1IG6A 2ISOA 4KMOB 5AI6A 1COKA 1X9SA 3BS5A 4RNNA 1J97A 5KFBA 4R65A 1T3NA 4PH5A 1Z00B 3RBEA 3GV5B 1BVSA 1YZ6A 5AK3A 3H8SA 4ELUA 5B5EU 3M9OB 3IG5A 1F5SA 9ICGA 3IG8A 2Q0ZX 2KN7A 1ZQVA 1L7MA 1RM6C 2WF5A 4KLHA 7ICUA 2P6RA 2KKVA 2W3RA 5J8YA 2BCQA 7ICOA 7ICPA 4YMMA 3FYHA 1BPBA 5CB1A 3NVZA 2NO4A 1ZQTA 3FDSA 1X9MA 1ZOLA 4OJ6A 2E8OA 3MFIA 3OTQA 3EWAA 1AROP 4FFDA 3HKZF 4PGYA 5ALOA 3WK9A 3NGDA 2CN1A 4IQTA 4NLKA 2FDRA 2UVUA 3TQ1A 1DGSA 5TISU 4TQSA 7ICEA 4M6WA 9ICEA 2KEYA 3D2NA 5AIAA 5D4BA 5TZVA 3ONNA 1J2NA 2IHMA 3GV8B 4KLQA 2G06A 3MDCA 8ICLA 1T94A 2W9MA 1ZQZA 7ICRA 3I76A 2HBKA 4OCZA 3MR2A 2ESEA 3C29A 5J0RA 1L7PA 4JK1A 1HIWA 5CA7A 9ICIA 3SV3A 1MSWD 1SB3C 1S0OA 2K89A 2AH5A 3EPGA 5KG0A 1S10A 2ZIXA 4LVSA 1Z00A 4RUAA 1NJWA 5KFCA 1B22A 4RQMA 2OYYA 5GTIU 1KLNA 5AM0A 4US9A 2XICA 5L9XA 1ZRMA 1K1QA 2H3FA 5JUMA 5J8YC 1RDFA 4BJQA 1ZQLA 4O3MA 1XSPA 3RJHA 1RG6A 2IOFA 2H3VA 4B9NA 4QZFA 3OGUA 4UBCA 4EBEA 3KFUF 3SMVA 2ZJAA 4CF4A 2MUTB 1ECWA 1Y88A 2BPCA 1CUKA 4BX9C 5CRXA 8ICQA 2F77X 2JRZA 5KT6A 3PSFA 2AQ0A 2LYBA 3HRDD 9ICVA 5KFFA 2JR5A 2OCEA 5KL8B 4QIWF 1UA1A 4C0ZA 2K8AA 2P6UA 3NVVA 2PI4A
chains in the Genus database with same CATH topology
1SV0A 4RQNA 2KSOB 5JTIA 1PK3A 2KIVA 1WWUA 1Z1VA 3TACB 2YTUA 2D3DA 3KKAC 2DKZA 2DL0A 4IS7A 3SENA 1JI7A 2KMDA 2QB0A 1UCVA 2KSOA 2QARB 2EAOA 1SV4A 4NL9A 5L1MA 3BQ7A 2ESEA 2K60A 3BS7A 1OXJA 3BS5B 1X66A 2QB0B 2QARA 3K1RB 3SEIA 1X9XA 1F0MA 2KE7A 3KKAA 1X40A 5F3XB 1COKA 3BS5A 4NJ8A 2Y9UA 2ES6A 3TADC 4RQMA 5JU5A 2E8MA 1SGGA 2E8PA 2EAMA 4PZOA 2F44A 5J8YC 2LPEA 1SXDA 1RG6A 1WWVA 2F8KA 1V85A 4PZNA 2FE9A 1OW5A 1B4FA 3TADA 3IDWA 2DKXA 1LKYB 2D8CA 1DXSA 1V38A 2EANA 2E8NA 1SV0C 2JV3A 1UQVA 1B0XA 2QKQA 2KG5A 1PK1A 5KNIA 2F3NA 5J8YA 2L5YA 2Y9TA 1LKYA 1KW4A 2K4PA 2LMRA 2E8OA 4MHVA 2EAPA 1SXEA 1PK1B 2GLEA 4NL9C 2B6GA 5JRTA 2QB1A 3HILA 3H8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 A;  4RQN A;  2KSO B;  5JTI A;  1PK3 A;  2KIV A;  1WWU A;  1Z1V A;  3TAC B;  2YTU A;  2D3D A;  3KKA C;  2DKZ A;  2DL0 A;  4IS7 A;  3SEN A;  1JI7 A;  2KMD A;  2QB0 A;  1UCV A;  2KSO A;  2QAR B;  2EAO A;  1SV4 A;  4NL9 A;  5L1M A;  3BQ7 A;  2ESE A;  2K60 A;  3BS7 A;  1OXJ A;  3BS5 B;  1X66 A;  2QB0 B;  2QAR A;  3K1R B;  3SEI A;  1X9X A;  1F0M A;  2KE7 A;  3KKA A;  1X40 A;  5F3X B;  1COK A;  3BS5 A;  4NJ8 A;  2Y9U A;  2ES6 A;  3TAD C;  4RQM A;  5JU5 A;  2E8M A;  1SGG A;  2E8P A;  2EAM A;  4PZO A;  2F44 A;  5J8Y C;  2LPE A;  1SXD A;  1RG6 A;  1WWV A;  2F8K A;  1V85 A;  4PZN A;  2FE9 A;  1OW5 A;  1B4F A;  3TAD A;  3IDW A;  2DKX A;  1LKY B;  2D8C A;  1DXS A;  1V38 A;  2EAN A;  2E8N A;  1SV0 C;  2JV3 A;  1UQV A;  1B0X A;  2QKQ A;  2KG5 A;  1PK1 A;  5KNI A;  2F3N A;  5J8Y A;  2L5Y A;  2Y9T A;  1LKY A;  1KW4 A;  2K4P A;  2LMR A;  2E8O A;  4MHV A;  2EAP A;  1SXE A;  1PK1 B;  2GLE A;  4NL9 C;  2B6G A;  5JRT A;  2QB1 A;  3HIL A;  3H8M A; 
#chains in the Genus database with same CATH topology
 4ECT A;  4YVZ A;  1PK3 A;  4Y2R A;  4JMU A;  3NVW A;  5AKJ A;  1ZQR A;  2IOH A;  3LWM A;  1TVA A;  5AKX A;  4J9M A;  2HCF A;  4ED2 A;  8ICA A;  1IV8 A;  1CEZ A;  3M8S A;  1UT8 A;  1NK9 A;  3RH5 A;  2LHT A;  3FC4 A;  1PUZ A;  5ALJ A;  1QTM A;  2K8B B;  1BPZ A;  1Z4O A;  3MFH A;  3QUQ A;  1YT3 A;  5ALX A;  4TUS A;  1ZQK A;  3KKA A;  3KBB A;  9ICJ A;  1PVP A;  1XWL A;  1ZQX A;  2ZIU A;  4DSL A;  2J6S A;  2C28 A;  1NK5 A;  3PX4 A;  5DG8 A;  3T5H A;  3UPQ A;  3PVX A;  2LPE A;  2OXO A;  1KRP A;  1ZQC A;  3ICX A;  4ECY A;  3ZDA A;  3C1Z A;  5KL1 B;  4IR9 A;  3DEE A;  4TQR A;  2HOQ A;  3BQT A;  1COO A;  2W7O A;  1WG8 A;  1ZQP A;  2XGP A;  5A0L A;  2DQN B;  4XRH A;  2D6F C;  2JXJ A;  4OJP A;  3T5J A;  4F91 B;  2JEF A;  5C0Y A;  3CRX A;  3ORY A;  2JHD A;  3LWL A;  9ICW A;  5DQH A;  3HPO A;  4F5N A;  5KG6 A;  2W8L A;  5KAF U;  5KFD A;  2B6G A;  4QZB A;  4JV1 A;  1L7O A;  1HJP A;  3UXO A;  1SKW A;  4ED7 A;  3HIL A;  5KFR A;  2DUY A;  3HKZ C;  4Q8F A;  2KZZ A;  4DQP A;  3KKA C;  3IM1 A;  3GIL A;  3HP6 A;  4QZH A;  1JMS A;  1U47 A;  3SQI A;  4NL9 A;  4I2B A;  2LBO A;  5KFM A;  5DQG A;  2A1A A;  3MR6 A;  3WKD A;  1JRP A;  5ALF A;  3UXP A;  2M9N A;  5AKI A;  5FP0 A;  5KFH A;  5DB7 A;  3VC8 A;  4P2H A;  4I2E A;  3TKA A;  5KFV A;  4QNL A;  2ES6 A;  5KFY A;  2I9G A;  2E8M A;  2HW3 A;  2LYH A;  4Y2U A;  3SZ2 A;  3AU2 A;  2EAM A;  4I2G A;  3T5K A;  5KFN A;  4B9T A;  3BQ1 A;  1ZQE A;  3A0H U;  2BQU A;  4UB6 U;  2V4R A;  4RT3 A;  4MF8 A;  4KN4 A;  2BCR A;  3KHL A;  5DG7 A;  3QUB A;  4P0Q B;  4LZD A;  3TAP A;  4OO1 J;  1NK4 A;  1XNS A;  2KJ9 A;  1UT5 A;  8ICX A;  3OPX A;  5AK6 A;  2FMP A;  5CHG A;  9ICO A;  4MEY A;  4QZC A;  2HBL A;  1H38 A;  4C4R A;  4DOA A;  4C8K A;  2R8H A;  2JEG A;  3TFR A;  2ZIV B;  3PZP A;  4P4M A;  5EE9 A;  5ALE A;  4XUS A;  1ZQ1 C;  1HUZ A;  5J0X A;  4DFM A;  5AI0 A;  1SXE A;  4Y2Y A;  4NL9 C;  4TUP A;  1XO0 A;  3D2S A;  4QZG A;  4MFA A;  1D9D A;  3NAS A;  5ALS A;  3QNM A;  2HMX A;  4Z6F A;  8ICO A;  2FMS A;  5KG7 A;  2R18 A;  2B21 A;  4KN7 A;  4USA A;  3NTU A;  2NRZ A;  2EQY A;  4B9V A;  4IS7 A;  4EBD A;  2WFA A;  1QSS A;  1NK0 A;  2H3Z A;  2ZXI A;  1FEZ A;  2HI0 A;  1UCV A;  5IIJ A;  5KG2 A;  5J2C A;  3ISB A;  3N4M B;  3DDH A;  3KOO A;  4M0A A;  4P0P A;  3A0B U;  5J0S A;  2EZZ A;  5EWF A;  3QX7 A;  1NZB A;  3UMB A;  2VJ5 A;  5IIL A;  2BPF A;  2WF8 A;  3PV8 A;  1TE2 A;  5KFZ A;  2FMQ A;  3FAH A;  4F72 A;  1L7N A;  3PX0 A;  2R8K A;  1X42 A;  4PJ0 U;  4DQS A;  3LVV A;  2V4Q A;  4P0Q A;  5DLF A;  1T7P A;  2VAN A;  3V6J A;  3ZI4 A;  2PXI A;  3PY8 A;  3BJY A;  1FFV A;  2E8N A;  1DGJ A;  2YML A;  4DFJ A;  2KTQ A;  1RXW A;  4UB2 A;  3AM9 A;  5DB9 A;  2KKP A;  4O3S A;  4NLZ A;  2L5Y A;  4F4W A;  4GC6 A;  2KK0 A;  3G6Y A;  2HHV A;  4B6J A;  4EBC A;  1JUD A;  2LMR A;  5DGB A;  2Y0S F;  2FPM A;  2RRD A;  5EE3 A;  1LV5 A;  8ICK A;  2RLT A;  2EZX A;  1OUQ A;  4EZ9 A;  4F8R A;  1WCN A;  4O3O A;  1LB2 B;  3RJG A;  3QUC A;  2JGA A;  2I5H A;  1ZQW A;  4Y2J A;  4EX6 A;  3B0X A;  1QQ5 A;  3RB4 A;  4DO9 A;  1KQQ A;  3KTQ A;  1P7D A;  3ISD A;  7ICG A;  4ECZ A;  1ZD3 A;  2GWS A;  4KLM A;  4YFK A;  4EYI B;  1K5O A;  3JPN A;  4YD1 A;  1S8O A;  3IHQ B;  2ASJ A;  9ICR A;  2ZTE A;  4M9J A;  4Q43 A;  9ICK A;  4M47 A;  4QZ8 A;  4YMN A;  1NK8 A;  4PHD A;  1RYS A;  4IR1 A;  1ZQH A;  4IQV A;  1X40 A;  3PX6 A;  2Z7J A;  2R8J A;  3EYZ A;  3EW9 A;  5KT7 A;  2KIC A;  1D8L A;  5DQI A;  3F2B A;  3KHR A;  2F2A B;  1ZQM A;  1C7Y A;  3GZF A;  2GO7 A;  1S77 D;  5ALT A;  2E1F A;  3J81 j;  4I29 A;  3Q8R B;  2KIW A;  2F8K A;  5GTH U;  1CRX A;  1CI4 A;  5J2B A;  1B4F A;  3N7P D;  2NYV A;  3DV9 A;  1SWW A;  4KLO A;  3IDW A;  4DQR A;  2H5X A;  4NLB A;  5J2F A;  9ICQ A;  2JEJ A;  3F5A A;  4UAU A;  1UA0 A;  5HHH A;  8ICT A;  1LKY A;  4C7Z A;  2J6T A;  4M9L A;  4ECX A;  1PK1 B;  3MGI A;  3BZK A;  2ZTD A;  1TKD A;  1ZD5 A;  2QB1 A;  4EEL A;  1PZN A;  4BXO B;  2CPR A;  2BDP A;  4J03 A;  4AYB F;  2JH1 A;  3UMG A;  2DPI A;  2DKZ A;  2K8C B;  3AN1 A;  3NUQ A;  4DL6 A;  4R66 A;  4ELV A;  5KG3 A;  1S0V A;  3QZ7 A;  1JIH A;  2HDO A;  4F2S A;  1Q3V A;  4KX3 A;  4RQ6 A;  4C8L A;  5AIB A;  2ZG6 A;  2ALZ A;  4UAY A;  2NV3 A;  4X5V A;  3H0M B;  5ALI A;  5IIN A;  2E5S A;  3K75 D;  2UVV A;  2HVH A;  1SZP A;  2W03 A;  3QUT A;  2H3Q A;  3RJJ A;  2FLL A;  2OWO A;  4NY8 A;  1O08 A;  5BOM A;  2HVI A;  5C5J A;  4QZE A;  4Q44 A;  4GXJ A;  3WK5 A;  1Q46 A;  4F50 A;  3TFS A;  3K1Z A;  1V97 A;  4PZN A;  4QZI A;  2ISP A;  4YXM A;  4I2F A;  5H2F U;  2J6U A;  2VKQ A;  2YX8 A;  4Y2S A;  1NK6 A;  2KFN A;  4I2C A;  2AGP A;  3ZD9 A;  4RQ8 A;  2W7P A;  1KBU A;  4ED8 A;  5DKW A;  4F3O A;  2QKQ A;  4KLG A;  1PK1 A;  5KNI A;  2W9C B;  3G6X A;  1L3U A;  3SV4 A;  4ECR A;  4B9L A;  2WAQ F;  4BXO A;  5AHX A;  4O3P A;  4MHV A;  4DS4 A;  1DK2 A;  1ZQD A;  5KFL A;  1DRG A;  2Y0S C;  4JV0 A;  2NRW A;  4Q45 A;  1ZQB A;  2G0A A;  1S9F A;  4JWM A;  2KSO B;  1X6I A;  2WF9 A;  5F9L A;  4US8 A;  3GIK A;  1TFR A;  1NOM A;  3Q8L A;  5ALR A;  3MR5 A;  2OEH A;  4O0I A;  1BPY A;  3B0Y A;  4ACO A;  1Q8K A;  1ZQJ A;  5III A;  4JV2 A;  3CYM A;  2I6X A;  2KFZ A;  9ICN A;  2PKE A;  5AK5 A;  3TAN A;  2K60 A;  4CRX A;  3OHA A;  1RYU A;  3TI0 A;  3M6K A;  1X9X A;  2RDI A;  5F3X B;  2HOI A;  5G5H A;  1FFU A;  4EZ6 A;  3H4B A;  2PFO A;  4O5K A;  4RZR A;  4YR3 A;  5KFI A;  3LDA A;  3H8W A;  4ECS A;  1MA7 A;  5KG1 A;  4O3R A;  4CE6 A;  1SL0 A;  3FM9 A;  1ZQG A;  2P66 A;  1ZET A;  2YMM A;  4YP3 A;  4GLX A;  2E1E A;  2UVW A;  4QW9 A;  3GII A;  4A8E A;  5KT5 A;  4RNM A;  4EYH B;  4DSF A;  2W9C A;  4K4G A;  3KHG A;  3HWT A;  1N63 A;  2K4H A;  3TAR A;  1FIQ A;  3HT3 A;  3I28 A;  4GC7 A;  1TAU A;  1N56 A;  4U6P A;  2GOL A;  3UXN A;  5IIM A;  2G5H B;  4PL2 A;  4OJ5 A;  5J0Y A;  2BPG A;  2MUT A;  3GFK B;  4PL1 A;  1N62 A;  4M04 A;  5CP2 A;  4O3N A;  3RRG A;  5CR0 A;  5AIC A;  5HR7 A;  5J0W A;  2BZF A;  3HJE A;  4UB4 A;  3M6Z A;  5KT3 A;  1NNL A;  4I2D A;  3PW2 A;  5KTQ A;  3V6K A;  2EH9 A;  4UB8 U;  3AL0 B;  3H0L B;  2FPK A;  1GO3 F;  4AYB C;  3UQ2 A;  1X6J A;  4DWI A;  1L3S A;  4M9G A;  4IRC A;  2ODG A;  1X9W A;  5L1M A;  8ICJ A;  2KVC A;  1O03 A;  4R63 A;  4ED1 A;  4UQG A;  2MU2 A;  4PPX A;  3V7K A;  5EE1 A;  1D9F A;  2YQE A;  4EEY A;  2QB0 B;  1QSY A;  8ICV A;  2NRV A;  5J2K A;  3SYZ A;  3WK4 A;  1KSP A;  7ICV A;  4C80 A;  5ALK A;  1L5U A;  8ICZ A;  5AM4 A;  3B9J A;  1TV9 A;  2CRX A;  2WHE A;  3V7J A;  2WF7 A;  1KTQ A;  3I1Y A;  1ZXI A;  2RQ5 A;  4FZN A;  5AI9 A;  4GXK A;  4LJX A;  3R9K A;  3ED5 A;  3RJE A;  2AXT U;  3PW0 A;  5AI5 A;  3V6H A;  2I1Q A;  3GU3 A;  1Z1B A;  5CEH A;  9ICT A;  3ZDE A;  3LYS A;  4JB3 A;  5AKH A;  2HBJ A;  2BQR A;  4DOB A;  3AQE A;  1XU4 A;  3M7D A;  1TK5 A;  8ICM A;  3ZDB A;  1FO4 A;  2HHU A;  1SKS A;  3KZX A;  3JPP A;  2OHF A;  2EAP A;  3EUB 2;  3JPR A;  4R8U B;  3WKA A;  1N48 A;  2XY5 A;  1NKE A;  2GLE A;  8ICP A;  5JRT A;  2WAQ C;  4RNO A;  5L1L A;  2GH1 A;  2W54 A;  4RU9 A;  5KG4 A;  3WU2 U;  1L6N A;  3WK7 A;  5CWR A;  2XVT A;  5DDY A;  2ATL A;  2RP5 A;  4UB5 A;  4M9H A;  4F4X A;  4J9K A;  3SEN A;  5BOL A;  9ICX A;  1A6S A;  3WKC A;  3Q8S B;  2QB0 A;  1RXV A;  2ASD A;  4TUQ A;  4O3Q A;  4R64 A;  3M8R A;  3QEA Z;  2VJ4 A;  2YY6 A;  2K4I A;  4DL3 A;  1ZYQ A;  4O5C A;  3MGH A;  8ICN A;  3BQ0 A;  1SZH A;  4XQ8 A;  4F71 A;  4J9N A;  9ICM A;  3RRH A;  1ZD4 A;  4NXZ A;  3JPO A;  2Y9U A;  2KHV A;  1BPE A;  2JH7 A;  4ECQ A;  5HR6 A;  4MFF A;  3OJS A;  1K1S A;  5J2I A;  2AU0 A;  4C8M A;  5AM3 A;  1DOQ A;  2BKE A;  1SXD A;  3MGV A;  4RQ0 A;  5AKE A;  1TAM A;  1TAQ A;  8ICY A;  2FE9 A;  5KAI U;  5D49 A;  1S76 D;  1OW5 A;  4UAW A;  4QWA A;  4F4Z A;  3M9M B;  1JRO A;  2XO7 A;  4GIB A;  4CF5 A;  1SL1 A;  2D8C A;  5J0T A;  1DXS A;  1V38 A;  1SIJ A;  4R8U A;  4I2I A;  3QE9 Y;  4YCX A;  4FS2 A;  4MFC A;  4LZG A;  1KFD A;  1BGX T;  1TK0 A;  3PO5 A;  2XCA A;  4ED6 A;  1M6Y A;  1ZRN A;  2YB1 A;  4CNQ A;  4YQW A;  2RDJ A;  4F5P A;  5AM5 A;  2KOB A;  5DBA A;  1RQN A;  4I2J A;  2ZIV A;  2K4E A;  3VCB A;  4QWC A;  3ETL A;  4ELT A;  3IN5 A;  4DS5 A;  3RB6 A;  1WWU A;  4QWE A;  3IV6 A;  5J2A A;  4Z6D A;  4BWM A;  2W3S A;  1RYR A;  3ZDD A;  4UW9 A;  3OSP A;  2V9W A;  2QAR B;  5ALZ A;  2PMZ F;  1MQ3 A;  2G08 A;  1MQ2 A;  3MC1 A;  4F2R A;  2WF6 A;  2FPL A;  3BS7 A;  3LVW A;  1ZJM A;  3BS5 B;  1X66 A;  5ALD A;  2QLT A;  4RQ4 A;  4M9N A;  5KFE A;  4YD2 A;  4NM1 A;  5EE0 A;  3QU2 A;  2ASL A;  4KLD A;  5F9N A;  1PVQ A;  4J9Q A;  5JU5 A;  7ICI A;  3PST A;  4EX7 A;  4GXI A;  4KLI A;  1N61 A;  3RAX A;  3RH6 A;  3GDX A;  5KFU A;  4Y2T A;  9ICA A;  1KFS A;  4RPZ A;  4CCH A;  9ICH A;  4QZD A;  3NVY A;  2W9A A;  1QH9 A;  4KX5 A;  1JXL A;  2KD1 A;  2DFL A;  4DFD A;  2G07 A;  3SD7 A;  3O0F A;  2JEI A;  2BCV A;  2IOF K;  1XSN A;  4FO6 A;  2JZB B;  5AKZ A;  3RAQ A;  4MF2 A;  3AMZ A;  4Z6E A;  4M6W B;  1XSL A;  5L1K A;  2FLP A;  2ZUC A;  2PFP A;  3RR8 A;  1KDH A;  3ALR A;  3C5F A;  3H0R B;  2HSZ A;  2KIV A;  2LM4 A;  9ICB A;  4B9U A;  1D8B A;  3RJF A;  5KFS A;  5L1J A;  2YN4 A;  2A1J B;  4FBU A;  3SI8 A;  1N5W A;  2XI9 A;  4FS1 A;  4AP9 A;  5ALG A;  2BQ3 A;  2F1I A;  3CP8 A;  2BR0 A;  1AQ6 A;  3MDA A;  3GIM A;  2XID A;  3QXG A;  2ZIX B;  2C22 A;  2C2E A;  5KFG A;  4KMU A;  4IQW A;  5ALM A;  2W55 A;  4KIT B;  4CDG A;  2AGO A;  4BUG A;  4DSJ A;  2KE7 A;  2HHQ A;  3C28 A;  5HP4 A;  1BNO A;  4F5R A;  1T4G A;  1BPD A;  3U26 A;  5KFP A;  1NKC A;  4KLS A;  4DFK A;  4NLG A;  3PNC A;  5BPC A;  2DF4 B;  2LYA A;  3BDP A;  1L3T A;  4I28 A;  2B0C A;  2YB4 A;  3F5E A;  2MAX A;  7ICJ A;  3QEB Z;  4RT2 A;  1RPL A;  2DBY A;  1ZQA A;  4DSI A;  2ZIW B;  4TUR A;  2A19 A;  4DOC A;  4QWB A;  5L1I A;  2JZB A;  4HYK A;  2MSN A;  3Q8P B;  4FZM A;  3PW5 A;  3CW2 C;  1UQV A;  3L5K A;  2NRX A;  5IIK A;  2KG5 A;  2XC9 A;  8ICE A;  2DGZ A;  3IRU A;  3RBD A;  4EEK A;  1J2M A;  1IM4 A;  2KV2 A;  3QU5 A;  5KT2 A;  3JPQ A;  2OH2 A;  4IQU A;  2A3V A;  4C8N A;  3K4G A;  2HHS A;  5EOZ A;  2XGQ A;  2A1J A;  7ICQ A;  1L8L A;  3SAH A;  3UQ0 A;  2AQ4 A;  2C2D A;  5J2G A;  2O6K A;  2AHO B;  4F4K A;  1L3V A;  4OJO A;  2D3D A;  4HAI A;  2IHN A;  3Q8Q B;  4RQ7 A;  7ICT A;  1KEJ A;  2W8K A;  3C21 A;  1XS9 D;  4DLG A;  3GQC A;  4ECU A;  9ICL A;  2EAO A;  8ICC A;  3RB3 A;  1QQ6 A;  4KLU A;  3QU9 A;  2UVR A;  5J0Q A;  2ZIU B;  3H4D A;  2PMZ C;  4P4O A;  2HHW A;  2F76 X;  2BGW A;  1S97 A;  2F8L A;  1N60 A;  2IMW P;  1NKB A;  4UB1 A;  5DBB A;  4KLJ A;  3E58 A;  4BDP A;  1NJY A;  4NJ8 A;  1IXR A;  2BDU A;  3C5G A;  2BCS A;  2EZY A;  5DG9 A;  3PW4 A;  2ZIW A;  4UAT A;  3SAG A;  3NS1 A;  4PZO A;  1NJX A;  4UAV A;  4F4Y A;  2HBM A;  2PFN A;  3RFA A;  9ICP A;  2WTF A;  1KKX A;  2KZ3 A;  3KHH A;  4C4S A;  4RPY A;  1WWV A;  1BNP A;  1V85 A;  5G5G A;  5ALL A;  5J2D A;  3RJK A;  1U48 A;  4RPX A;  3F53 A;  3QYP A;  1JN3 A;  3LK9 A;  2R8I A;  7ICH A;  5AKG A;  2VA3 A;  1JAL A;  3E0F A;  3QU7 A;  2XY7 A;  2JV3 A;  3PSP A;  4FE3 A;  1X2I A;  2E3T A;  1BPX A;  3KZI U;  3L3F X;  1ZD2 P;  3V72 A;  4O5E A;  3QU4 A;  4M2Y A;  1URJ A;  4YR0 A;  1NI3 A;  1ZQN A;  5AM2 A;  2P35 A;  5KT4 A;  4E0D A;  4NWI A;  5KFX A;  4IRK A;  3ISC A;  7ICN A;  1C20 A;  1S5L U;  2YMP A;  3RB0 A;  8ICU A;  4KLF A;  2KJ8 A;  5KFK A;  1SV0 A;  1ZQO A;  3NRZ A;  2WB1 C;  4WJ3 B;  4JWN A;  4RUC A;  1PVR A;  2LI6 A;  3PW7 A;  1VDV A;  8ICI A;  5KFA A;  1JX4 A;  3N7S C;  2H3I A;  2AGQ A;  2KMD A;  1V9P A;  2KSO A;  5KFW A;  1U49 A;  4I2H A;  3F2C A;  2RHF A;  4QJF B;  8ICR A;  3T5L A;  2FJ6 A;  2ZJ8 A;  1ED1 A;  1KL9 A;  1UHU A;  5J2H A;  3SR6 A;  4YR2 A;  3ZD8 A;  4OJL A;  4DLE A;  5HML A;  4PGQ A;  3PML A;  2ZJ5 A;  2EDU A;  3M1Y A;  2NO5 A;  1A77 A;  2KP7 A;  1A0P A;  4O9M A;  3CNH A;  5AKY A;  1RQL A;  2MRL A;  3Q8K A;  4IL6 U;  4Y2P A;  4K4I A;  8ICF A;  2HHX A;  5J0O A;  4J9S A;  2Y1I A;  4NLC A;  2IBK A;  4KLT A;  5IIO A;  1YZ7 A;  4U7C A;  5AKK A;  5KG5 A;  2CXY A;  3AU6 A;  4IRD A;  5ALP A;  3PR4 A;  1SV0 C;  1Z4N A;  2C2R A;  2BCU A;  2F3N A;  5DGA A;  4ED3 A;  3TAQ A;  4CGZ A;  1WYG A;  2F1J A;  1KW4 A;  2K4P A;  5DB8 A;  4RQ5 A;  4J9O A;  1RZT A;  3H7I A;  3HX0 A;  3ETR A;  5EWG A;  2IA6 A;  3OHB A;  5JTI A;  3QZ8 A;  4QW8 A;  1Z1V A;  3OJU A;  1HUO A;  3E2E A;  4P0P B;  1JXE A;  5J0P A;  4C7Y A;  9ICS A;  4ICA A;  2N1R A;  1Z3E B;  5ALU A;  4PGX A;  3WK8 A;  3Q8M A;  4FZL A;  2ZUB A;  3BQ7 A;  3KD3 A;  3PSI A;  1VLB A;  3EPI A;  2AJQ A;  3GV7 B;  3RJI A;  1OXJ A;  2OM6 A;  5KFQ A;  5HHI A;  1ZQQ A;  4K4H A;  4NLN A;  4YN4 A;  2PFQ A;  2FI1 A;  3H8J A;  4Y2X A;  5AI4 A;  3SEI A;  1F0M A;  2W43 A;  3C1Y A;  1KN5 A;  9ICC A;  5DLG A;  1ZQS A;  1SKR A;  4DL7 A;  1N5X A;  4PHA A;  3M9N B;  1U4B A;  5HMM A;  2BHN A;  3C2M A;  4DCC A;  2F44 A;  2VIX A;  5EWE A;  4GFJ A;  1NZP A;  2HOF A;  5DDM A;  4DL4 A;  1EXN A;  3JPT A;  2W04 A;  4DL5 A;  8ICB A;  3PR5 B;  3C2K A;  2KVS A;  5KFJ A;  3OSN A;  4DQI A;  1ZJN A;  3RTV A;  2R8G A;  4DF4 A;  1QSL A;  3TAD A;  1F44 A;  3L4P A;  3N28 A;  4QWD A;  1XC9 A;  4EEN A;  2HHT A;  4QIW C;  2EAN A;  2JMG A;  4IC9 A;  4QZA A;  1MC8 A;  1B0X A;  3NRW A;  4KTQ A;  4DQQ A;  2KJ5 A;  5E79 U;  3AQF A;  2Y9T A;  3MBY A;  3RH4 A;  3ZDC A;  1XO1 A;  2LM1 A;  4ECV A;  4DSK A;  4RQ2 A;  3D2Q A;  4UAS A;  4UB3 A;  2KZM A;  3JPS A;  3UMC A;  1TK8 A;  8ICS A;  3G6V A;  4KLE A;  4DL2 A;  4ZOH C;  1Z19 A;  4RQN A;  1S0M A;  4B9M A;  4BWJ A;  1QQ7 A;  3N97 B;  4G3I A;  5AM1 A;  4PHE A;  2ZTC A;  2VA8 A;  3T79 A;  1VJ5 A;  1ZQU A;  2W11 A;  3PMN A;  1T3Q A;  1DK3 A;  5ALH A;  3AEV A;  3HW8 A;  1Q3U A;  4J9P A;  4YG2 A;  5HNK A;  3C23 A;  2XCP A;  4JUZ A;  1HEK A;  4Y2Q A;  4J9R A;  3MAB A;  5K4L A;  4XA5 A;  5DBC A;  1S0N A;  4ZH4 A;  2W9B B;  3K1R B;  4I2A A;  3S6J A;  4ECW A;  3BZC A;  1IIP A;  5AK4 A;  4F5Q A;  8ICH A;  7ICL A;  9ICU A;  8ICG A;  4KLL A;  1ZQY A;  2LKY A;  3TAD C;  3H40 A;  4NM2 A;  4F5O A;  5ALN A;  4J9L A;  3GIJ A;  5KFO A;  1KFT A;  1SWV A;  4DFP A;  1U45 A;  5AKL A;  1SGG A;  2E8P A;  4YXJ A;  4NV0 A;  5J0U A;  3EZ5 A;  4P4P A;  3C2L A;  1NJZ A;  1LVH A;  2KHQ A;  5D46 A;  2F1H A;  5ALQ A;  1WUD A;  3D6J A;  2G5I B;  3T3F A;  3WK6 A;  3F2D A;  2XY6 A;  5AI8 A;  1QLN A;  1QCK A;  2Q4T A;  5T14 A;  4RQ1 A;  2MA1 A;  4C8O A;  4RQ3 A;  4CF3 A;  2DKX A;  1LKY B;  4F93 B;  4YMO A;  3BQ2 A;  8ICW A;  2ZUD A;  5J2E A;  2Y1J A;  3PO4 A;  4F92 B;  1SL2 A;  2KNJ A;  4BGD A;  4OD0 A;  1U9L A;  1UPH A;  4UAZ A;  3WKB A;  4Z6C A;  1ZQF A;  4B9S A;  4Y2V A;  5ALY A;  3MR3 A;  3N7R C;  4UAR A;  5CJ7 A;  3RR7 A;  2M0N A;  4PHP A;  2VA2 A;  5ALV A;  1MN8 A;  3AUO A;  2DWQ A;  4G9B A;  4UBB A;  2G09 A;  3H8M A;  4MEX A;  7ICS A;  1T8E A;  3TAC B;  9ICF A;  7ICK A;  2YTU A;  4C4T A;  5B66 U;  2YMQ A;  2DL0 A;  1N2X A;  4QZ9 A;  3WKE A;  1ZQI A;  2FLN A;  1JI7 A;  5KFT A;  1NK7 A;  3V7L A;  2ZXH A;  2PI5 A;  4FBT A;  7ICM A;  5DB6 A;  4DSE A;  1L8O A;  2W9B A;  1WCL A;  4ED0 A;  1SV4 A;  2NRT A;  4DF8 A;  2WB1 F;  1B43 A;  1D8Y A;  3IP4 B;  3UM9 A;  4Q8E A;  2QAR A;  7ICF A;  4DEZ A;  4I27 A;  5ALW A;  5J29 A;  5J2J A;  3THV A;  3SAF A;  1A76 A;  2DPJ A;  3RF9 A;  1IG6 A;  2ISO A;  4KMO B;  5AI6 A;  1COK A;  1X9S A;  3BS5 A;  4RNN A;  1J97 A;  5KFB A;  4R65 A;  1T3N A;  4PH5 A;  1Z00 B;  3RBE A;  3GV5 B;  1BVS A;  1YZ6 A;  5AK3 A;  3H8S A;  4ELU A;  5B5E U;  3M9O B;  3IG5 A;  1F5S A;  9ICG A;  3IG8 A;  2Q0Z X;  2KN7 A;  1ZQV A;  1L7M A;  1RM6 C;  2WF5 A;  4KLH A;  7ICU A;  2P6R A;  2KKV A;  2W3R A;  5J8Y A;  2BCQ A;  7ICO A;  7ICP A;  4YMM A;  3FYH A;  1BPB A;  5CB1 A;  3NVZ A;  2NO4 A;  1ZQT A;  3FDS A;  1X9M A;  1ZOL A;  4OJ6 A;  2E8O A;  3MFI A;  3OTQ A;  3EWA A;  1ARO P;  4FFD A;  3HKZ F;  4PGY A;  5ALO A;  3WK9 A;  3NGD A;  2CN1 A;  4IQT A;  4NLK A;  2FDR A;  2UVU A;  3TQ1 A;  1DGS A;  5TIS U;  4TQS A;  7ICE A;  4M6W A;  9ICE A;  2KEY A;  3D2N A;  5AIA A;  5D4B A;  5TZV A;  3ONN A;  1J2N A;  2IHM A;  3GV8 B;  4KLQ A;  2G06 A;  3MDC A;  8ICL A;  1T94 A;  2W9M A;  1ZQZ A;  7ICR A;  3I76 A;  2HBK A;  4OCZ A;  3MR2 A;  2ESE A;  3C29 A;  5J0R A;  1L7P A;  4JK1 A;  1HIW A;  5CA7 A;  9ICI A;  3SV3 A;  1MSW D;  1SB3 C;  1S0O A;  2K89 A;  2AH5 A;  3EPG A;  5KG0 A;  1S10 A;  2ZIX A;  4LVS A;  1Z00 A;  4RUA A;  1NJW A;  5KFC A;  1B22 A;  4RQM A;  2OYY A;  5GTI U;  1KLN A;  5AM0 A;  4US9 A;  2XIC A;  5L9X A;  1ZRM A;  1K1Q A;  2H3F A;  5JUM A;  5J8Y C;  1RDF A;  4BJQ A;  1ZQL A;  4O3M A;  1XSP A;  3RJH A;  1RG6 A;  2IOF A;  2H3V A;  4B9N A;  4QZF A;  3OGU A;  4UBC A;  4EBE A;  3KFU F;  3SMV A;  2ZJA A;  4CF4 A;  2MUT B;  1ECW A;  1Y88 A;  2BPC A;  1CUK A;  4BX9 C;  5CRX A;  8ICQ A;  2F77 X;  2JRZ A;  5KT6 A;  3PSF A;  2AQ0 A;  2LYB A;  3HRD D;  9ICV A;  5KFF A;  2JR5 A;  2OCE A;  5KL8 B;  4QIW F;  1UA1 A;  4C0Z A;  2K8A A;  2P6U A;  3NVV A;  2PI4 A; 
#chains in the Genus database with same CATH homology
 1SV0 A;  4RQN A;  2KSO B;  5JTI A;  1PK3 A;  2KIV A;  1WWU A;  1Z1V A;  3TAC B;  2YTU A;  2D3D A;  3KKA C;  2DKZ A;  2DL0 A;  4IS7 A;  3SEN A;  1JI7 A;  2KMD A;  2QB0 A;  1UCV A;  2KSO A;  2QAR B;  2EAO A;  1SV4 A;  4NL9 A;  5L1M A;  3BQ7 A;  2ESE A;  2K60 A;  3BS7 A;  1OXJ A;  3BS5 B;  1X66 A;  2QB0 B;  2QAR A;  3K1R B;  3SEI A;  1X9X A;  1F0M A;  2KE7 A;  3KKA A;  1X40 A;  5F3X B;  1COK A;  3BS5 A;  4NJ8 A;  2Y9U A;  2ES6 A;  3TAD C;  4RQM A;  5JU5 A;  2E8M A;  1SGG A;  2E8P A;  2EAM A;  4PZO A;  2F44 A;  5J8Y C;  2LPE A;  1SXD A;  1RG6 A;  1WWV A;  2F8K A;  1V85 A;  4PZN A;  2FE9 A;  1OW5 A;  1B4F A;  3TAD A;  3IDW A;  2DKX A;  1LKY B;  2D8C A;  1DXS A;  1V38 A;  2EAN A;  2E8N A;  1SV0 C;  2JV3 A;  1UQV A;  1B0X A;  2QKQ A;  2KG5 A;  1PK1 A;  5KNI A;  2F3N A;  5J8Y A;  2L5Y A;  2Y9T A;  1LKY A;  1KW4 A;  2K4P A;  2LMR A;  2E8O A;  4MHV A;  2EAP A;  1SXE A;  1PK1 B;  2GLE A;  4NL9 C;  2B6G A;  5JRT A;  2QB1 A;  3HIL A;  3H8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...