1SZHA

Crystal structure of c. elegans her-1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
STLTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNLMTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Caenorhabditis elegans HER-1 and characterization of the interaction between HER-1 and TRA-2A.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
molecule keywords Her-1 protein
total genus 58
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09232 Caenor_Her-1 Caenorhabditis elegans Her-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.360 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA01
1.10.150.370 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA02
1SZHA
chains in the Genus database with same CATH superfamily
1WWUA 4F4YA 4UB2A 3OHAA 2AXTU 2PKEA 5AKHA 1L7MA 5ALDA 5KFCA 2WAQF 1B43A 2P6UA 2ZIUB 1CI4A 5CHGA 2WF9A 4J9PA 4DS4A 3MABA 5IINA 5AM5A 1BPEA 3RR7A 3SI8A 1U48A 3HJEA 2XY5A 4ZOHC 1RXWA 4USAA 2H3IA 5KFFA 4TURA 4PL2A 5L9XA 3PW2A 4MFFA 4YR3A 1TK0A 2FE9A 4YP3A 4DOBA 1B4FA 1QQ7A 3QZ8A 1QSYA 4QNLA 5KAFU 1XO0A 4QZIA 4M2YA 2MA1A 1ZQ1C 5CJ7A 5J0RA 4PL1A 2ZG6A 4R65A 2HHWA 2IMWP 5KFEA 1BPXA 4UB3A 4UAWA 3QU9A 3PR5B 3ZDEA 3ISBA 4DL6A 2FLPA 3B0XA 7ICNA 2VIXA 3T5KA 4GIBA 1Y88A 8ICHA 3FYHA 2F2AB 4QZDA 1N56A 4UBBA 1ZQEA 2YTUA 4KLEA 5KFVA 2Q4TA 3EW9A 2CXYA 2ZXHA 1DK3A 5KFLA 4DSJA 1UT5A 3JPTA 2LI6A 2PFPA 4QW9A 5ALLA 1L7NA 5ALHA 5J2JA 3FDSA 4M6WA 1SWVA 5EE9A 1JALA 3QUQA 3LWLA 5IIMA 4EENA 4QZAA 1ZQXA 2FMQA 5J2HA 1XO1A 2JXJA 2KVCA 4FS1A 1SV4A 5KAIU 2ZIWA 1A77A 4B9TA 4NY8A 2HHUA 2BHNA 5HMMA 4U7CA 5DGBA 4FE3A 4QWCA 2D6FC 2KTQA 4EEYA 1JX4A 3DV9A 3WK6A 1TAMA 1MN8A 3D2QA 4DL4A 2V4RA 1S0VA 3ZI4A 4I2DA 3SQIA 3OJUA 4KLIA 4C4TA 5JRTA 2K4PA 2P6RA 4Y2RA 2D8CA 5B5EU 5J0XA 2HBJA 3JPOA 4DFMA 4DS5A 4DFKA 3F2BA 3DDHA 4ECZA 2OYYA 3ONNA 4OJPA 2M9NA 4M9HA 3SYZA 7ICTA 3AQFA 9ICEA 4XUSA 1ZQUA 3ORYA 2ZIUA 4Z6DA 1CRXA 4O5KA 1X6JA 8ICOA 5AKZA 2ZUBA 3ISDA 3WK4A 3OHBA 5DQHA 2O6KA 4KLSA 4C8MA 2PMZC 3SR6A 1ZYQA 4O3NA 3MGIA 1U45A 2MSNA 4U6PA 2E8MA 5DBBA 2JRZA 2ZIVA 1TK8A 9ICLA 2QB0A 1HIWA 2KSOB 3QX7A 9ICPA 2YY6A 1LB2B 4KLOA 3M7DA 4B9SA 1DXSA 4O5CA 4KLLA 4ED7A 3H7IA 1UA1A 2KFZA 3QE9Y 1BPZA 3HRDD 1M6YA 1FO4A 1N5WA 1L7OA 8ICVA 3M6ZA 3G6VA 4P0PB 4JV1A 3QUTA 2K8BB 2NRWA 1S97A 1S5LU 1ZQOA 5L1JA 3SV4A 2K4IA 4K4GA 5EWEA 5KFIA 1VDVA 2QKQA 4ECQA 7ICHA 5B66U 4NJ8A 5KFWA 4I2IA 3GV8B 3L4PA 2JEJA 4ECUA 4BJQA 3BJYA 5AIBA 4I2JA 3OTQA 1SWWA 1KKXA 8ICJA 4PGYA 4JK1A 4B9VA 2WF5A 3MR2A 5KT3A 2AGQA 1ZQWA 5IIJA 2YMMA 3H8WA 4KN7A 4GC6A 5KNIA 5BOLA 1ZQTA 3QEAZ 2C2DA 3D6JA 4UATA 2R8KA 2PMZF 3KHGA 2H5XA 2HDOA 2J6TA 4B6JA 4TUPA 4EYIB 4BXOB 2QB1A 2MUTA 4RZRA 3UMGA 3BQ1A 1PVQA 4ECRA 4CF4A 4QZBA 5KTQA 3C23A 4IRKA 1ZRNA 5KFNA 2ISPA 3WK9A 2AU0A 5BPCA 3IM1A 8ICBA 8ICTA 4MF8A 3GDXA 9ICJA 3C2MA 2UVVA 5KG6A 2PFQA 3EWAA 3PW7A 1L3TA 5T14A 1DGSA 4F93B 1Z4NA 1RM6C 4KLGA 1J2NA 3GIKA 1Z19A 1K5OA 2KVSA 5DB8A 1DOQA 2JV3A 1K1QA 4IRDA 3RJJA 4JV0A 5KT2A 3M9NB 1X9SA 4J03A 1SXDA 1BNOA 1NKBA 1ZQHA 2C2RA 4KTQA 4R63A 1X66A 1RQLA 1KLNA 5AK4A 4F5OA 4RQ3A 1PZNA 5DDMA 2LYAA 1DGJA 1QLNA 1GO3F 5ALKA 5JUMA 5L1MA 2HBLA 4PH5A 5HHIA 5HMLA 3ISCA 1S0MA 3MDCA 3HPOA 1YZ7A 2K4HA 1T3QA 2XI9A 5J2KA 3RH5A 3QUBA 1TAUA 1ZRMA 5ALJA 1ZQJA 4TQRA 5EE1A 1KFDA 4US9A 3L3FX 3N7SC 3QZ7A 9ICQA 3T3FA 9ICGA 4JWMA 4NXZA 3RB3A 1F0MA 4RNOA 2CN1A 4QZEA 4XA5A 1L3VA 3GILA 5J2IA 3IG8A 2DPJA 3RJIA 2JHDA 5ALIA 3JPQA 2WAQC 1L8OA 1B0XA 3KZXA 3H4BA 3LDAA 1Z00B 4Y2YA 2JZBA 7ICSA 3OPXA 2WB1C 4JWNA 2FLLA 3AL0B 4IRCA 1HJPA 2GWSA 3NVYA 3L5KA 3BS7A 4LJXA 1LVHA 5KFUA 1SV0A 1S9FA 1V97A 2E1FA 4ED6A 2R8HA 5CA7A 3MFHA 4O3OA 1RDFA 2PXIA 5CR0A 4F71A 1KFSA 1D8YA 3OSPA 1IXRA 5IIOA 1KL9A 1T94A 3MDAA 2FPLA 1SL2A 2HOFA 2QARA 4O0IA 2F8LA 4M47A 5HNKA 2C22A 2KV2A 2AQ0A 5AHXA 5DQIA 2LM1A 5ALPA 1ZQMA 2VJ4A 4DEZA 2DUYA 4Z6EA 4GXIA 4DL3A 2EANA 4QZHA 4KLFA 2XCPA 5G5GA 4YD2A 3LVWA 5IILA 1IIPA 4UB5A 4I2CA 5CWRA 4NLNA 3H0LB 2LHTA 1SZPA 2EZXA 1WWVA 4ECWA 3AM9A 9ICNA 1N5XA 5KFJA 2CPRA 5J8YA 7ICFA 5KFTA 4O3MA 2W9AA 3MBYA 4ECYA 1H38A 5AK6A 3RRHA 4F2SA 4YD1A 1T8EA 2DPIA 3RR8A 3EUB2 2KIVA 4YN4A 2KIWA 2KHQA 5ALGA 3RB0A 4FZNA 2Y0SF 3RJKA 4BWMA 3PY8A 5J2AA 3KZIU 2AQ4A 1L5UA 7ICIA 3RH4A 4P4MA 3H0RB 3BZKA 4O5EA 2KG5A 1F44A 4DL5A 4F50A 4I2HA 4ECTA 2VKQA 2EQYA 3NVVA 2W54A 3K1RB 4MHVA 4M04A 3MFIA 4DSIA 3PW4A 2KJ5A 1SL1A 4F72A 2AGOA 4ED1A 2XGQA 2PFNA 2BCUA 3SAFA 1D9DA 4P0QB 2QARB 1ZD3A 3RAXA 3EPGA 3N7RC 3KKAC 1PVPA 3N97B 2BGWA 4F5RA 2ESEA 4IL6U 4ACOA 4PHEA 2WFAA 4QZGA 4O3SA 5AK3A 8ICUA 3BQ0A 3ETLA 5ALEA 3NGDA 1SL0A 2Y9UA 3BS5A 4NWIA 1PK3A 1T3NA 5AI8A 1NK9A 1S8OA 3IG5A 2BQUA 2ZUCA 2F3NA 3KBBA 4C8LA 5C5JA 1ZQAA 4RQMA 1L7PA 3H8JA 3UPQA 1ZQKA 4CRXA 2Q0ZX 1DRGA 2OCEA 5AKGA 2K60A 5ALWA 4G3IA 3A0BU 2EAMA 3KHLA 5ALXA 2BPCA 5AKJA 3U26A 1N48A 3C1YA 4CNQA 2EZZA 3O0FA 2R8JA 3CNHA 4J9QA 1TVAA 2W43A 1D9FA 2HBMA 1ZQFA 3WKCA 5KFKA 5KFYA 1ZQBA 2MU2A 4MFAA 1NK5A 5AKYA 3UMBA 2HSZA 4F92B 2A1JB 3NUQA 5J2DA 1ZJMA 4BGDA 2OHFA 4NL9C 5ALVA 9ICIA 3QXGA 2YB1A 2ZTDA 2KHVA 3GZFA 1VLBA 3WKDA 2LBOA 3SEIA 3ZDBA 4A8EA 1ZQYA 3MR3A 2W9CB 1ZXIA 1ZQLA 4EEKA 5C0YA 4RU9A 7ICUA 4NLKA 1D8LA 5J29A 2NYVA 4AP9A 3NASA 4C7YA 2OEHA 2XO7A 2R18A 3ZDCA 3RAQA 5J2BA 4LVSA 1ECWA 4RQNA 3KTQA 1K1SA 2HBKA 3BS5B 1X9WA 4UAYA 3QEBZ 4Y2JA 1NK7A 1S0OA 3SMVA 4JUZA 3T5LA 4M9LA 4DQPA 5KL1B 5JU5A 3TFSA 1U4BA 4B9LA 1LKYB 2ZTEA 2KP7A 5F3XB 5DBAA 4RNMA 5DG9A 1PK1A 3KD3A 3RTVA 2H3FA 2W9CA 3SENA 2OXOA 2KMDA 5CP2A 2IA6A 4QWBA 2RQ5A 1UCVA 3UXOA 5KFMA 2K4EA 3LYSA 2MUTB 3IHQB 2R8IA 2BDUA 5AM4A 5J0TA 1RG6A 3FAHA 4NM2A 4C0ZA 4F4WA 4YXJA 1SGGA 4YR2A 3F5EA 5KFAA 2LYBA 1ZQSA 9ICVA 3RJHA 2JH7A 5EOZA 3AMZA 5KFBA 2FLNA 3NVZA 3M9OB 1BPDA 1XWLA 2QB0B 5HP4A 9ICXA 1ZQZA 5D4BA 5KG3A 5DLFA 2R8GA 1X42A 4NLGA 3MGHA 1JRPA 5AI9A 3BDPA 3ALRA 4F5QA 2HVIA 1QQ6A 8ICGA 1RPLA 4ZH4A 4QZ8A 4RQ5A 1SB3C 4RUCA 1QH9A 2ZIWB 1OUQA 4EX7A 1IM4A 3CP8A 2MRLA 5J0SA 1FFUA 2W8KA 4UAZA 1S76D 5D46A 4Y2PA 4BDPA 3Q8MA 3RJEA 2YMQA 3LWMA 3VC8A 1YZ6A 1NKEA 4KLQA 1SXEA 5AM3A 1JROA 4DF4A 1ZD4A 2VA8A 5ALOA 2BR0A 4ELUA 1CEZA 2HCFA 4EX6A 1UQVA 1VJ5A 2G08A 2N1RA 4O3QA 1V85A 2EZYA 5ALNA 2ASDA 3GFKB 4CF3A 1ZOLA 2M0NA 1NI3A 3DEEA 2DBYA 4Q8FA 4C4SA 2Y1IA 4IQTA 2KJ8A 1ZQQA 3ED5A 5J0QA 3KOOA 4AYBF 4DWIA 2L5YA 3NVWA 3QU4A 3TKAA 3V6HA 3KHRA 4F4KA 4JV2A 4NV0A 1FFVA 1L6NA 3HILA 3Q8KA 2XGPA 1XNSA 4RPZA 1TKDA 1BVSA 4B9NA 2GH1A 3PVXA 2I6XA 4J9MA 1NK6A 2HHXA 5J0YA 3PW5A 2BCVA 1FEZA 1B22A 5FP0A 3D2NA 3T5HA 5H2FU 2H3VA 7ICJA 2RP5A 1WCNA 9ICCA 4UW9A 3PSPA 2F1HA 1Z00A 1SKSA 3MC1A 1N2XA 4UAUA 4KN4A 4UB6U 5IIIA 2Z7JA 1WUDA 1RYRA 9ICTA 7ICVA 1S0NA 1C7YA 5KG1A 3AN1A 3IRUA 4EBDA 2RLTA 2DKXA 2V9WA 2EAOA 5AIAA 3K4GA 4MEXA 3IDWA 5DB7A 4FFDA 4DLGA 4P4OA 2W7OA 2E3TA 1TE2A 2RRDA 2BZFA 4QWAA 5DGAA 2KZZA 7ICKA 1SKRA 5KFPA 4I2AA 3KKAA 3T79A 1L8LA 3NTUA 2IHNA 4C8KA 5KG5A 2XICA 1U49A 3C5FA 5J2GA 4F4XA 4LZGA 4RT3A 8ICZA 3NRZA 5CB1A 3JPSA 2P66A 4GC7A 1UHUA 3VCBA 1NK8A 7ICPA 5DB6A 4DOCA 3CRXA 1X9MA 2VANA 5KFXA 2NO5A 4Z6FA 4ELVA 4ELTA 2YX8A 4O3PA 8ICNA 2UVRA 5IIKA 4OJ5A 1SKWA 3N7PD 2HW3A 2FPMA 1JMSA 1KBUA 4IC9A 3E0FA 5KT4A 8ICMA 5CEHA 2ASJA 2IHMA 4EYHB 4UB1A 3RJFA 8ICIA 2YN4A 2GO7A 5KFGA 5J2CA 4PHDA 1A76A 3JPPA 4KLUA 2HOQA 4PZNA 4Q44A 9ICAA 4K4IA 4R64A 3PSTA 4KX3A 3RFAA 4KITB 4KMUA 5F9NA 5EE0A 2WTFA 1PK1B 4QIWF 4OJOA 9ICWA 5DKWA 4Y2XA 5AKEA 2DL0A 1Z1BA 2AGPA 2KKVA 3NS1A 8ICXA 1EXNA 2W9BB 3GIMA 5G5HA 3RB6A 3MR5A 4I2EA 1NJXA 3PW0A 5TZVA 4KX5A 3PX6A 3BZCA 4P0PA 3QU2A 2BQRA 1XC9A 1J97A 5AI4A 3PNCA 4Z6CA 5KT7A 2AH5A 2F1JA 2A1JA 1V38A 3A0HU 5AI5A 3KFUF 3IN5A 4P0QA 3GQCA 2PFOA 4FZMA 4RQ6A 1ZQVA 3I28A 5DG7A 4BUGA 4YR0A 4MEYA 5GTIU 4DFPA 3AEVA 3M1YA 4DQIA 3WK7A 3Q8PB 3RH6A 1PUZA 2FMSA 1ED1A 4J9SA 4C8OA 3WK5A 8ICYA 1XS9D 5EWFA 2B21A 2BCRA 1JN3A 3GIJA 2ASLA 2F44A 5L1IA 1HEKA 3IV6A 4IQWA 4DFJA 1BPBA 5HR7A 1KRPA 2IOFA 2W7PA 1XU4A 2K89A 5KG7A 5J0WA 2CRXA 2W9MA 3PX4A 3D2SA 2B0CA 2ZJ5A 4CCHA 4CDGA 4YMOA 4QJFB 3RBDA 1X6IA 3TARA 1ZJNA 2KSOA 1RYSA 3C5GA 4RQ7A 3I76A 2E5SA 3F5AA 5J0OA 3TADC 1KDHA 3EYZA 3HP6A 5KT5A 2VA2A 2PI5A 2ZUDA 8ICQA 1AROP 2ZIXA 2RHFA 1MQ2A 2KICA 1NK4A 1N63A 4NM1A 7ICLA 4KLHA 3RB4A 2HHVA 5KG4A 7ICMA 4YXMA 3WU2U 5L1KA 2A19A 4NL9A 1BPYA 4FS2A 2E1EA 3TAQA 2ZJ8A 4F2RA 1ZQRA 3QU7A 2JGAA 1KFTA 4ED3A 2PI4A 1Z3EB 4FZLA 5KFHA 4QW8A 1PVRA 1T4GA 3C28A 2ZJAA 2OWOA 1RQNA 2JEGA 4IR9A 2AJQA 5J0UA 2F8KA 2H3ZA 1AQ6A 2FI1A 5KG2A 2XY6A 1TK5A 4WJ3B 4UBCA 1NOMA 3ZDAA 1L3UA 4F5PA 4RPXA 3RBEA 1COKA 5ALMA 2DQNB 2KK0A 5AI6A 7ICEA 4I29A 2BCQA 4ECSA 4J9NA 2GOLA 3C2KA 2EH9A 3MR6A 3QNMA 3ICXA 5J2FA 3V7LA 4KMOB 1NNLA 1QSLA 4JB3A 1RZTA 1KTQA 5E79U 4RPYA 4GXKA 4I27A 3WKBA 3C29A 1KQQA 2W55A 1MQ3A 2ODGA 5DDYA 9ICUA 2VA3A 8ICLA 8ICAA 4UAVA 4E0DA 5AK5A 3H8SA 4US8A 4DO9A 4EBEA 4ICAA 5ALTA 1JI7A 3HKZC 2V4QA 5AKXA 4BXOA 1Q8KA 3WKAA 4YVZA 2FDRA 3OGUA 1MC8A 4DFDA 1D8BA 5D49A 4RT2A 4DSEA 4Y2UA 4AYBC 5AM0A 4GLXA 3HT3A 5ALYA 5A0LA 1O08A 3AUOA 4UQGA 2E8OA 1P7DA 5BOMA 2UVUA 2WHEA 1NJYA 4Q43A 4DQRA 3V72A 2B6GA 4B9UA 2YQEA 2IOHA 3Q8LA 2UVWA 2ZXIA 4TQSA 1ZD5A 4F4ZA 1OXJA 1N61A 4QZCA 4OJ6A 2ZTCA 4RQ0A 2NRVA 1ZQGA 5AKIA 3F2DA 4B9MA 3CW2C 3NRWA 2I5HA 5DLGA 2BKEA 3Q8QB 4IQUA 4C80A 3UXPA 1V9PA 3K75D 9ICSA 2LYHA 1JUDA 1NJZA 2W9BA 5AKKA 5KFSA 1O03A 4RQ8A 1N62A 1TFRA 2YB4A 2HHQA 3GIIA 4IS7A 1NZPA 2ZIXB 3SV3A 3F2CA 2MAXA 9ICKA 4IR1A 4QWEA 4CE6A 2LMRA 1URJA 3JPNA 2E8NA 2JEFA 4KLTA 4F5NA 7ICGA 1QQ5A 2KZ3A 4JMUA 2WF6A 2ZIVB 5DBCA 5DB9A 4CF5A 2ATLA 9ICRA 1A0PA 1RYUA 9ICFA 2HOIA 2Y9TA 3BQ2A 3TADA 4FBUA 2DKZA 3GV7B 5CRXA 4ED0A 2NO4A 4DCCA 3KHHA 3SAHA 3V6JA 1NK0A 2LKYA 3MGVA 3JPRA 5KT6A 4RNNA 3PO5A 3QU5A 4DF8A 3TAPA 1NKCA 2XVTA 3SZ2A 3PR4A 3PSFA 1MSWD 4DQSA 4YQWA 1N60A 3HWTA 4Y2QA 1Q3VA 1ZETA 2DGZA 2FPKA 3PV8A 4R8UB 2KZMA 4DSFA 3PZPA 4C8NA 4DQQA 1LKYA 4YMNA 2RDJA 4DSLA 4Q45A 2KNJA 5K4LA 1SZHA 5KFOA 4TUSA 2P35A 4ED2A 1ZQPA 3PO4A 4EELA 2E8PA 3S6JA 3ETRA 4X5VA 4P4PA 4ED8A 5AM1A 4DL2A 2DF4B 3ZD9A 2NRXA 1KEJA 1TAQA 3TFRA 4UB4A 4NLZA 4K4HA 4M0AA 4J9KA 4CGZA 1RXVA 4BX9C 4MFCA 9ICBA 3PMLA 2D3DA 1S77D 2BCSA 1FIQA 3ZDDA 8ICCA 4M9NA 3TACB 2NRTA 4Y2SA 4QIWC 4PJ0U 1Z4OA 5ALZA 1Q3UA 4FBTA 4P2HA 2WB1F 2BQ3A 4OCZA 3OSNA 4GXJA 4OD0A 3Q8RB 2KE7A 2KEYA 1MA7A 2EAPA 2FMPA 3N4MB 1XSLA 1IG6A 3UMCA 3G6XA 2G5HB 2LPEA 2C2EA 1UT8A 4O3RA 3BQ7A 5EE3A 4KLDA 3UQ0A 2KD1A 3C2LA 1X9XA 2QLTA 1LV5A 4YCXA 2WF7A 2G0AA 3Q8SB 3AQEA 3E58A 2G07A 3WKEA 2YMPA 4I2FA 1X40A 1BNPA 1CUKA 2KN7A 1ZD2P 2W3SA 8ICKA 2A3VA 4YG2A 2NRZA 4RQ2A 4NLBA 1BGXT 4DOAA 3LVVA 2W11A 2W8LA 4ECXA 3UXNA 5ALUA 2IOFK 3FC4A 4C7ZA 4MF2A 4C4RA 7ICOA 5ALFA 3LK9A 3J81j 3G6YA 2G5IB 4I2GA 4M6WB 3UQ2A 1QTMA 9ICOA 1SIJA 1J2MA 2HMXA 3EPIA 2KOBA 3N28A 1ZQCA 3C21A 2DWQA 3TQ1A 2BDPA 2JEIA 4G9BA 1ZQDA 2W3RA 3RJGA 3M9MB 5HHHA 3ZD8A 8ICWA 4Q8EA 4PHAA 4PGXA 3E2EA 5J0PA 3GV5B 4EZ6A 3WK8A 1UA0A 4XRHA 1QCKA 2XC9A 2H3QA 4F3OA 4HAIA 1T7PA 4QWDA 3SAGA 2JMGA 1Z1VA 8ICSA 2BPFA 3IP4B 2XY7A 3QUCA 4OO1J 3PMNA 2HI0A 5F9LA 4M9GA 3K1ZA 4GFJA 5HR6A 2I1QA 4RQ1A 1WG8A 8ICRA 2OM6A 2F76X 1NZBA 4DL7A 2W04A 4UARA 2AHOB 1NJWA 1WCLA 4EBCA 4UASA 2OH2A 5ALRA 2DFLA 4F91B 1HUOA 5KG0A 4J9RA 4M9JA 5ALQA 3B9JA 2YMLA 3TI0A 1C20A 4O9MA 5J2EA 1A6SA 4J9OA 2WF8A 3PX0A 2IBKA 4TUQA 1XSPA 5JTIA 3TANA 2ES6A 4UB8U 1XSNA 5KFDA 4XQ8A 1UPHA 3GU3A 2Y1JA 4YFKA 2XIDA 2J6UA 2VJ5A 2F77X 2HVHA 4HYKA 4I28A 5EWGA 3UM9A 1U9LA 3CYMA 3V6KA 1X2IA 2JZBB 5AM2A 4IQVA 3M8RA 2HHSA 5KL8B 3V7KA 1OW5A 2RDIA 5AI0A 3RF9A 4F8RA 4PZOA 2K8AA 4EZ9A 3H40A 2EDUA 2W03A 4DSKA 1HUZA 1DK2A 4PHPA 4QZ9A 4R66A 1JXLA 2G09A 1S10A 2K8CB 3PSIA 3AU2A 1TV9A 1U47A 3HKZF 1L3SA 4RQ4A 2FJ6A 8ICFA 2LM4A 5TISU 5L1LA 2J6SA 4I2BA 1KSPA 9ICMA 3HX0A 3C1ZA 2A1AA 2KKPA 9ICHA 3R9KA 1KN5A 1KW4A 4PPXA 2JR5A 8ICPA 4FO6A 3FM9A 3QYPA 3H8MA 2XCAA 2ALZA 5AKLA 3V7JA 3H0MB 5AICA 7ICRA 4KLJA 3I1YA 1ZQIA 4J9LA 1WYGA 3HW8A 4Y2VA 2ISOA 3THVA 4Y2TA 2KFNA 4BWJA 1F5SA 3AU6A 4QZFA 2GLEA 2JH1A 3F53A 5DQGA 4R8UA 2I9GA 1YT3A 5KFZA 4YMMA 2Y0SC 3M6KA 2BPGA 3EZ5A 3BQTA 4RUAA 2KJ9A 2NV3A 1COOA 1Q46A 1JIHA 1IV8A 3OJSA 5KFRA 5ALSA 4KLMA 4LZDA 2HHTA 2G06A 5J8YC 1JXEA 4DLEA 3H4DA 7ICQA 5GTHU 3SD7A 4ECVA 4OJLA 4PGQA 3M8SA 5DG8A 1ZQNA 3T5JA 3RRGA 2F1IA 3B0YA 4NLCA 1SV0C 2C28A 5KFQA 1QSSA 8ICEA
chains in the Genus database with same CATH topology
2ZIWA 2YX8A 1ED1A 3H0RB 2YB4A 4AYBF 2DF4B 2K4EA 3LYSA 4OJ5A 4U7CA 1F44A 3RF9A 4FE3A 4NV0A 2K8AA 3M6ZA 2ZIXB 2D6FC 4CGZA 4P0PB 2BDUA 3N7PD 2K8BB 2HBMA 2W03A 3F2CA 2E1FA 1L6NA 2VKQA 2DQNB 2WAQF 4BX9C 1KBUA 2ZIUB 3E0FA 4IC9A 1XNSA 2G09A 2K4IA 1URJA 4C0ZA 2K8CB 3PSIA 1HEKA 2GH1A 3HKZF 1TAMA 2GOLA 4JMUA 4QIWC 5HR7A 3D2QA 2W7PA 2ZIVB 2K89A 3F5EA 3ICXA 1Q3UA 2CRXA 2LYBA 2KJ5A 2H3IA 2H3QA 1A0PA 2LYAA 4PL2A 3SQIA 2WB1F 3NUQA 3D2SA 4KMOB 2JH7A 3SAGA 2JMGA 1GO3F 2HOIA 1T94A 4BJQA 4CDGA 2HOQA 2HOFA 2YB1A 2HBJA 2KHVA 2F8LA 4QJFB 3D2NA 2HBLA 2KEYA 3IP4B 3GZFA 1MA7A 3C29A 4OO1J 3SAFA 2LBOA 2KKPA 4P0QB 5CRXA 2KV2A 3K1ZA 2G5HB 4GFJA 5HR6A 4A8EA 3PSTA 4QNLA 2H3VA 2K4HA 3F2BA 4KX3A 3RFAA 2RP5A 2VJ4A 2OYYA 2XI9A 2OM6A 3N7RC 3PSPA 5C0YA 3SAHA 2E5SA 3H0MB 2F76X 3ONNA 3F5AA 1XO0A 4OJPA 1NZBA 2LKYA 1PVPA 2KD1A 4ICAA 2MA1A 3ALRA 3MGVA 2W04A 2Z7JA 3HKZC 1ZQ1C 1WUDA 4OJOA 4QIWF 2PMZF 4PL1A 2ZG6A 2ZIXA 2RHFA 4ACOA 1Z1BA 3AQFA 2KKVA 2G0AA 2KICA 3LVWA 1D8BA 3AQEA 1IIPA 2XVTA 2G07A 2ZIUA 2ZIWB 3PSFA 2OH2A 2R18A 4AYBC 3H0LB 3L3FX 1OUQA 2LHTA 1CRXA 3N7SC 4KX5A 2JH1A 3F53A 5A0LA 1PVQA 1ECWA 2VIXA 3CP8A 1Q3VA 2MRLA 1YT3A 1P7DA 4NWIA 4P0PA 2DGZA 2Y0SC 2F2AB 3M6KA 2W7OA 2A3VA 2CN1A 2HBKA 3O0FA 2CPRA 2E1EA 2PMZC 2RRDA 4NLBA 3IG5A 1A6SA 4O3MA 3VC8A 2Q4TA 3PZPA 3IG8A 2KJ9A 3LVVA 4U6PA 2NV3A 2ZIVA 2ZXHA 2JGAA 2ZXIA 3SMVA 4CRXA 3T79A 5KL1B 2JHDA 1DRGA 1UPHA 2WAQC 2KNJA 2XICA 1SZHA 3GU3A 1HIWA 2KIWA 4OJ6A 2XIDA 2KHQA 2VJ5A 4FZNA 2F77X 2G08A 2Y0SF 4FZLA 2N1RA 3KZXA 5T14A 3F2DA 3M7DA 2G06A 3NRWA 1PVRA 2G5IB 3KFUF 3C28A 3IN5A 4P0QA 3VCBA 2M0NA 4FZMA 1Z19A 3CYMA 3DEEA 4OJLA 4BUGA 3OPXA 2WB1C 3AL0B 2H3FA 2H3ZA 2HMXA 3CRXA 4NLCA 2KVCA 2KJ8A 4WJ3B 5KL8B 2OXOA 2KOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZH A; 
#chains in the Genus database with same CATH topology
 1WWU A;  4F4Y A;  4UB2 A;  3OHA A;  2AXT U;  2PKE A;  5AKH A;  1L7M A;  5ALD A;  5KFC A;  2WAQ F;  1B43 A;  2P6U A;  2ZIU B;  1CI4 A;  5CHG A;  2WF9 A;  4J9P A;  4DS4 A;  3MAB A;  5IIN A;  5AM5 A;  1BPE A;  3RR7 A;  3SI8 A;  1U48 A;  3HJE A;  2XY5 A;  4ZOH C;  1RXW A;  4USA A;  2H3I A;  5KFF A;  4TUR A;  4PL2 A;  5L9X A;  3PW2 A;  4MFF A;  4YR3 A;  1TK0 A;  2FE9 A;  4YP3 A;  4DOB A;  1B4F A;  1QQ7 A;  3QZ8 A;  1QSY A;  4QNL A;  5KAF U;  1XO0 A;  4QZI A;  4M2Y A;  2MA1 A;  1ZQ1 C;  5CJ7 A;  5J0R A;  4PL1 A;  2ZG6 A;  4R65 A;  2HHW A;  2IMW P;  5KFE A;  1BPX A;  4UB3 A;  4UAW A;  3QU9 A;  3PR5 B;  3ZDE A;  3ISB A;  4DL6 A;  2FLP A;  3B0X A;  7ICN A;  2VIX A;  3T5K A;  4GIB A;  1Y88 A;  8ICH A;  3FYH A;  2F2A B;  4QZD A;  1N56 A;  4UBB A;  1ZQE A;  2YTU A;  4KLE A;  5KFV A;  2Q4T A;  3EW9 A;  2CXY A;  2ZXH A;  1DK3 A;  5KFL A;  4DSJ A;  1UT5 A;  3JPT A;  2LI6 A;  2PFP A;  4QW9 A;  5ALL A;  1L7N A;  5ALH A;  5J2J A;  3FDS A;  4M6W A;  1SWV A;  5EE9 A;  1JAL A;  3QUQ A;  3LWL A;  5IIM A;  4EEN A;  4QZA A;  1ZQX A;  2FMQ A;  5J2H A;  1XO1 A;  2JXJ A;  2KVC A;  4FS1 A;  1SV4 A;  5KAI U;  2ZIW A;  1A77 A;  4B9T A;  4NY8 A;  2HHU A;  2BHN A;  5HMM A;  4U7C A;  5DGB A;  4FE3 A;  4QWC A;  2D6F C;  2KTQ A;  4EEY A;  1JX4 A;  3DV9 A;  3WK6 A;  1TAM A;  1MN8 A;  3D2Q A;  4DL4 A;  2V4R A;  1S0V A;  3ZI4 A;  4I2D A;  3SQI A;  3OJU A;  4KLI A;  4C4T A;  5JRT A;  2K4P A;  2P6R A;  4Y2R A;  2D8C A;  5B5E U;  5J0X A;  2HBJ A;  3JPO A;  4DFM A;  4DS5 A;  4DFK A;  3F2B A;  3DDH A;  4ECZ A;  2OYY A;  3ONN A;  4OJP A;  2M9N A;  4M9H A;  3SYZ A;  7ICT A;  3AQF A;  9ICE A;  4XUS A;  1ZQU A;  3ORY A;  2ZIU A;  4Z6D A;  1CRX A;  4O5K A;  1X6J A;  8ICO A;  5AKZ A;  2ZUB A;  3ISD A;  3WK4 A;  3OHB A;  5DQH A;  2O6K A;  4KLS A;  4C8M A;  2PMZ C;  3SR6 A;  1ZYQ A;  4O3N A;  3MGI A;  1U45 A;  2MSN A;  4U6P A;  2E8M A;  5DBB A;  2JRZ A;  2ZIV A;  1TK8 A;  9ICL A;  2QB0 A;  1HIW A;  2KSO B;  3QX7 A;  9ICP A;  2YY6 A;  1LB2 B;  4KLO A;  3M7D A;  4B9S A;  1DXS A;  4O5C A;  4KLL A;  4ED7 A;  3H7I A;  1UA1 A;  2KFZ A;  3QE9 Y;  1BPZ A;  3HRD D;  1M6Y A;  1FO4 A;  1N5W A;  1L7O A;  8ICV A;  3M6Z A;  3G6V A;  4P0P B;  4JV1 A;  3QUT A;  2K8B B;  2NRW A;  1S97 A;  1S5L U;  1ZQO A;  5L1J A;  3SV4 A;  2K4I A;  4K4G A;  5EWE A;  5KFI A;  1VDV A;  2QKQ A;  4ECQ A;  7ICH A;  5B66 U;  4NJ8 A;  5KFW A;  4I2I A;  3GV8 B;  3L4P A;  2JEJ A;  4ECU A;  4BJQ A;  3BJY A;  5AIB A;  4I2J A;  3OTQ A;  1SWW A;  1KKX A;  8ICJ A;  4PGY A;  4JK1 A;  4B9V A;  2WF5 A;  3MR2 A;  5KT3 A;  2AGQ A;  1ZQW A;  5IIJ A;  2YMM A;  3H8W A;  4KN7 A;  4GC6 A;  5KNI A;  5BOL A;  1ZQT A;  3QEA Z;  2C2D A;  3D6J A;  4UAT A;  2R8K A;  2PMZ F;  3KHG A;  2H5X A;  2HDO A;  2J6T A;  4B6J A;  4TUP A;  4EYI B;  4BXO B;  2QB1 A;  2MUT A;  4RZR A;  3UMG A;  3BQ1 A;  1PVQ A;  4ECR A;  4CF4 A;  4QZB A;  5KTQ A;  3C23 A;  4IRK A;  1ZRN A;  5KFN A;  2ISP A;  3WK9 A;  2AU0 A;  5BPC A;  3IM1 A;  8ICB A;  8ICT A;  4MF8 A;  3GDX A;  9ICJ A;  3C2M A;  2UVV A;  5KG6 A;  2PFQ A;  3EWA A;  3PW7 A;  1L3T A;  5T14 A;  1DGS A;  4F93 B;  1Z4N A;  1RM6 C;  4KLG A;  1J2N A;  3GIK A;  1Z19 A;  1K5O A;  2KVS A;  5DB8 A;  1DOQ A;  2JV3 A;  1K1Q A;  4IRD A;  3RJJ A;  4JV0 A;  5KT2 A;  3M9N B;  1X9S A;  4J03 A;  1SXD A;  1BNO A;  1NKB A;  1ZQH A;  2C2R A;  4KTQ A;  4R63 A;  1X66 A;  1RQL A;  1KLN A;  5AK4 A;  4F5O A;  4RQ3 A;  1PZN A;  5DDM A;  2LYA A;  1DGJ A;  1QLN A;  1GO3 F;  5ALK A;  5JUM A;  5L1M A;  2HBL A;  4PH5 A;  5HHI A;  5HML A;  3ISC A;  1S0M A;  3MDC A;  3HPO A;  1YZ7 A;  2K4H A;  1T3Q A;  2XI9 A;  5J2K A;  3RH5 A;  3QUB A;  1TAU A;  1ZRM A;  5ALJ A;  1ZQJ A;  4TQR A;  5EE1 A;  1KFD A;  4US9 A;  3L3F X;  3N7S C;  3QZ7 A;  9ICQ A;  3T3F A;  9ICG A;  4JWM A;  4NXZ A;  3RB3 A;  1F0M A;  4RNO A;  2CN1 A;  4QZE A;  4XA5 A;  1L3V A;  3GIL A;  5J2I A;  3IG8 A;  2DPJ A;  3RJI A;  2JHD A;  5ALI A;  3JPQ A;  2WAQ C;  1L8O A;  1B0X A;  3KZX A;  3H4B A;  3LDA A;  1Z00 B;  4Y2Y A;  2JZB A;  7ICS A;  3OPX A;  2WB1 C;  4JWN A;  2FLL A;  3AL0 B;  4IRC A;  1HJP A;  2GWS A;  3NVY A;  3L5K A;  3BS7 A;  4LJX A;  1LVH A;  5KFU A;  1SV0 A;  1S9F A;  1V97 A;  2E1F A;  4ED6 A;  2R8H A;  5CA7 A;  3MFH A;  4O3O A;  1RDF A;  2PXI A;  5CR0 A;  4F71 A;  1KFS A;  1D8Y A;  3OSP A;  1IXR A;  5IIO A;  1KL9 A;  1T94 A;  3MDA A;  2FPL A;  1SL2 A;  2HOF A;  2QAR A;  4O0I A;  2F8L A;  4M47 A;  5HNK A;  2C22 A;  2KV2 A;  2AQ0 A;  5AHX A;  5DQI A;  2LM1 A;  5ALP A;  1ZQM A;  2VJ4 A;  4DEZ A;  2DUY A;  4Z6E A;  4GXI A;  4DL3 A;  2EAN A;  4QZH A;  4KLF A;  2XCP A;  5G5G A;  4YD2 A;  3LVW A;  5IIL A;  1IIP A;  4UB5 A;  4I2C A;  5CWR A;  4NLN A;  3H0L B;  2LHT A;  1SZP A;  2EZX A;  1WWV A;  4ECW A;  3AM9 A;  9ICN A;  1N5X A;  5KFJ A;  2CPR A;  5J8Y A;  7ICF A;  5KFT A;  4O3M A;  2W9A A;  3MBY A;  4ECY A;  1H38 A;  5AK6 A;  3RRH A;  4F2S A;  4YD1 A;  1T8E A;  2DPI A;  3RR8 A;  3EUB 2;  2KIV A;  4YN4 A;  2KIW A;  2KHQ A;  5ALG A;  3RB0 A;  4FZN A;  2Y0S F;  3RJK A;  4BWM A;  3PY8 A;  5J2A A;  3KZI U;  2AQ4 A;  1L5U A;  7ICI A;  3RH4 A;  4P4M A;  3H0R B;  3BZK A;  4O5E A;  2KG5 A;  1F44 A;  4DL5 A;  4F50 A;  4I2H A;  4ECT A;  2VKQ A;  2EQY A;  3NVV A;  2W54 A;  3K1R B;  4MHV A;  4M04 A;  3MFI A;  4DSI A;  3PW4 A;  2KJ5 A;  1SL1 A;  4F72 A;  2AGO A;  4ED1 A;  2XGQ A;  2PFN A;  2BCU A;  3SAF A;  1D9D A;  4P0Q B;  2QAR B;  1ZD3 A;  3RAX A;  3EPG A;  3N7R C;  3KKA C;  1PVP A;  3N97 B;  2BGW A;  4F5R A;  2ESE A;  4IL6 U;  4ACO A;  4PHE A;  2WFA A;  4QZG A;  4O3S A;  5AK3 A;  8ICU A;  3BQ0 A;  3ETL A;  5ALE A;  3NGD A;  1SL0 A;  2Y9U A;  3BS5 A;  4NWI A;  1PK3 A;  1T3N A;  5AI8 A;  1NK9 A;  1S8O A;  3IG5 A;  2BQU A;  2ZUC A;  2F3N A;  3KBB A;  4C8L A;  5C5J A;  1ZQA A;  4RQM A;  1L7P A;  3H8J A;  3UPQ A;  1ZQK A;  4CRX A;  2Q0Z X;  1DRG A;  2OCE A;  5AKG A;  2K60 A;  5ALW A;  4G3I A;  3A0B U;  2EAM A;  3KHL A;  5ALX A;  2BPC A;  5AKJ A;  3U26 A;  1N48 A;  3C1Y A;  4CNQ A;  2EZZ A;  3O0F A;  2R8J A;  3CNH A;  4J9Q A;  1TVA A;  2W43 A;  1D9F A;  2HBM A;  1ZQF A;  3WKC A;  5KFK A;  5KFY A;  1ZQB A;  2MU2 A;  4MFA A;  1NK5 A;  5AKY A;  3UMB A;  2HSZ A;  4F92 B;  2A1J B;  3NUQ A;  5J2D A;  1ZJM A;  4BGD A;  2OHF A;  4NL9 C;  5ALV A;  9ICI A;  3QXG A;  2YB1 A;  2ZTD A;  2KHV A;  3GZF A;  1VLB A;  3WKD A;  2LBO A;  3SEI A;  3ZDB A;  4A8E A;  1ZQY A;  3MR3 A;  2W9C B;  1ZXI A;  1ZQL A;  4EEK A;  5C0Y A;  4RU9 A;  7ICU A;  4NLK A;  1D8L A;  5J29 A;  2NYV A;  4AP9 A;  3NAS A;  4C7Y A;  2OEH A;  2XO7 A;  2R18 A;  3ZDC A;  3RAQ A;  5J2B A;  4LVS A;  1ECW A;  4RQN A;  3KTQ A;  1K1S A;  2HBK A;  3BS5 B;  1X9W A;  4UAY A;  3QEB Z;  4Y2J A;  1NK7 A;  1S0O A;  3SMV A;  4JUZ A;  3T5L A;  4M9L A;  4DQP A;  5KL1 B;  5JU5 A;  3TFS A;  1U4B A;  4B9L A;  1LKY B;  2ZTE A;  2KP7 A;  5F3X B;  5DBA A;  4RNM A;  5DG9 A;  1PK1 A;  3KD3 A;  3RTV A;  2H3F A;  2W9C A;  3SEN A;  2OXO A;  2KMD A;  5CP2 A;  2IA6 A;  4QWB A;  2RQ5 A;  1UCV A;  3UXO A;  5KFM A;  2K4E A;  3LYS A;  2MUT B;  3IHQ B;  2R8I A;  2BDU A;  5AM4 A;  5J0T A;  1RG6 A;  3FAH A;  4NM2 A;  4C0Z A;  4F4W A;  4YXJ A;  1SGG A;  4YR2 A;  3F5E A;  5KFA A;  2LYB A;  1ZQS A;  9ICV A;  3RJH A;  2JH7 A;  5EOZ A;  3AMZ A;  5KFB A;  2FLN A;  3NVZ A;  3M9O B;  1BPD A;  1XWL A;  2QB0 B;  5HP4 A;  9ICX A;  1ZQZ A;  5D4B A;  5KG3 A;  5DLF A;  2R8G A;  1X42 A;  4NLG A;  3MGH A;  1JRP A;  5AI9 A;  3BDP A;  3ALR A;  4F5Q A;  2HVI A;  1QQ6 A;  8ICG A;  1RPL A;  4ZH4 A;  4QZ8 A;  4RQ5 A;  1SB3 C;  4RUC A;  1QH9 A;  2ZIW B;  1OUQ A;  4EX7 A;  1IM4 A;  3CP8 A;  2MRL A;  5J0S A;  1FFU A;  2W8K A;  4UAZ A;  1S76 D;  5D46 A;  4Y2P A;  4BDP A;  3Q8M A;  3RJE A;  2YMQ A;  3LWM A;  3VC8 A;  1YZ6 A;  1NKE A;  4KLQ A;  1SXE A;  5AM3 A;  1JRO A;  4DF4 A;  1ZD4 A;  2VA8 A;  5ALO A;  2BR0 A;  4ELU A;  1CEZ A;  2HCF A;  4EX6 A;  1UQV A;  1VJ5 A;  2G08 A;  2N1R A;  4O3Q A;  1V85 A;  2EZY A;  5ALN A;  2ASD A;  3GFK B;  4CF3 A;  1ZOL A;  2M0N A;  1NI3 A;  3DEE A;  2DBY A;  4Q8F A;  4C4S A;  2Y1I A;  4IQT A;  2KJ8 A;  1ZQQ A;  3ED5 A;  5J0Q A;  3KOO A;  4AYB F;  4DWI A;  2L5Y A;  3NVW A;  3QU4 A;  3TKA A;  3V6H A;  3KHR A;  4F4K A;  4JV2 A;  4NV0 A;  1FFV A;  1L6N A;  3HIL A;  3Q8K A;  2XGP A;  1XNS A;  4RPZ A;  1TKD A;  1BVS A;  4B9N A;  2GH1 A;  3PVX A;  2I6X A;  4J9M A;  1NK6 A;  2HHX A;  5J0Y A;  3PW5 A;  2BCV A;  1FEZ A;  1B22 A;  5FP0 A;  3D2N A;  3T5H A;  5H2F U;  2H3V A;  7ICJ A;  2RP5 A;  1WCN A;  9ICC A;  4UW9 A;  3PSP A;  2F1H A;  1Z00 A;  1SKS A;  3MC1 A;  1N2X A;  4UAU A;  4KN4 A;  4UB6 U;  5III A;  2Z7J A;  1WUD A;  1RYR A;  9ICT A;  7ICV A;  1S0N A;  1C7Y A;  5KG1 A;  3AN1 A;  3IRU A;  4EBD A;  2RLT A;  2DKX A;  2V9W A;  2EAO A;  5AIA A;  3K4G A;  4MEX A;  3IDW A;  5DB7 A;  4FFD A;  4DLG A;  4P4O A;  2W7O A;  2E3T A;  1TE2 A;  2RRD A;  2BZF A;  4QWA A;  5DGA A;  2KZZ A;  7ICK A;  1SKR A;  5KFP A;  4I2A A;  3KKA A;  3T79 A;  1L8L A;  3NTU A;  2IHN A;  4C8K A;  5KG5 A;  2XIC A;  1U49 A;  3C5F A;  5J2G A;  4F4X A;  4LZG A;  4RT3 A;  8ICZ A;  3NRZ A;  5CB1 A;  3JPS A;  2P66 A;  4GC7 A;  1UHU A;  3VCB A;  1NK8 A;  7ICP A;  5DB6 A;  4DOC A;  3CRX A;  1X9M A;  2VAN A;  5KFX A;  2NO5 A;  4Z6F A;  4ELV A;  4ELT A;  2YX8 A;  4O3P A;  8ICN A;  2UVR A;  5IIK A;  4OJ5 A;  1SKW A;  3N7P D;  2HW3 A;  2FPM A;  1JMS A;  1KBU A;  4IC9 A;  3E0F A;  5KT4 A;  8ICM A;  5CEH A;  2ASJ A;  2IHM A;  4EYH B;  4UB1 A;  3RJF A;  8ICI A;  2YN4 A;  2GO7 A;  5KFG A;  5J2C A;  4PHD A;  1A76 A;  3JPP A;  4KLU A;  2HOQ A;  4PZN A;  4Q44 A;  9ICA A;  4K4I A;  4R64 A;  3PST A;  4KX3 A;  3RFA A;  4KIT B;  4KMU A;  5F9N A;  5EE0 A;  2WTF A;  1PK1 B;  4QIW F;  4OJO A;  9ICW A;  5DKW A;  4Y2X A;  5AKE A;  2DL0 A;  1Z1B A;  2AGP A;  2KKV A;  3NS1 A;  8ICX A;  1EXN A;  2W9B B;  3GIM A;  5G5H A;  3RB6 A;  3MR5 A;  4I2E A;  1NJX A;  3PW0 A;  5TZV A;  4KX5 A;  3PX6 A;  3BZC A;  4P0P A;  3QU2 A;  2BQR A;  1XC9 A;  1J97 A;  5AI4 A;  3PNC A;  4Z6C A;  5KT7 A;  2AH5 A;  2F1J A;  2A1J A;  1V38 A;  3A0H U;  5AI5 A;  3KFU F;  3IN5 A;  4P0Q A;  3GQC A;  2PFO A;  4FZM A;  4RQ6 A;  1ZQV A;  3I28 A;  5DG7 A;  4BUG A;  4YR0 A;  4MEY A;  5GTI U;  4DFP A;  3AEV A;  3M1Y A;  4DQI A;  3WK7 A;  3Q8P B;  3RH6 A;  1PUZ A;  2FMS A;  1ED1 A;  4J9S A;  4C8O A;  3WK5 A;  8ICY A;  1XS9 D;  5EWF A;  2B21 A;  2BCR A;  1JN3 A;  3GIJ A;  2ASL A;  2F44 A;  5L1I A;  1HEK A;  3IV6 A;  4IQW A;  4DFJ A;  1BPB A;  5HR7 A;  1KRP A;  2IOF A;  2W7P A;  1XU4 A;  2K89 A;  5KG7 A;  5J0W A;  2CRX A;  2W9M A;  3PX4 A;  3D2S A;  2B0C A;  2ZJ5 A;  4CCH A;  4CDG A;  4YMO A;  4QJF B;  3RBD A;  1X6I A;  3TAR A;  1ZJN A;  2KSO A;  1RYS A;  3C5G A;  4RQ7 A;  3I76 A;  2E5S A;  3F5A A;  5J0O A;  3TAD C;  1KDH A;  3EYZ A;  3HP6 A;  5KT5 A;  2VA2 A;  2PI5 A;  2ZUD A;  8ICQ A;  1ARO P;  2ZIX A;  2RHF A;  1MQ2 A;  2KIC A;  1NK4 A;  1N63 A;  4NM1 A;  7ICL A;  4KLH A;  3RB4 A;  2HHV A;  5KG4 A;  7ICM A;  4YXM A;  3WU2 U;  5L1K A;  2A19 A;  4NL9 A;  1BPY A;  4FS2 A;  2E1E A;  3TAQ A;  2ZJ8 A;  4F2R A;  1ZQR A;  3QU7 A;  2JGA A;  1KFT A;  4ED3 A;  2PI4 A;  1Z3E B;  4FZL A;  5KFH A;  4QW8 A;  1PVR A;  1T4G A;  3C28 A;  2ZJA A;  2OWO A;  1RQN A;  2JEG A;  4IR9 A;  2AJQ A;  5J0U A;  2F8K A;  2H3Z A;  1AQ6 A;  2FI1 A;  5KG2 A;  2XY6 A;  1TK5 A;  4WJ3 B;  4UBC A;  1NOM A;  3ZDA A;  1L3U A;  4F5P A;  4RPX A;  3RBE A;  1COK A;  5ALM A;  2DQN B;  2KK0 A;  5AI6 A;  7ICE A;  4I29 A;  2BCQ A;  4ECS A;  4J9N A;  2GOL A;  3C2K A;  2EH9 A;  3MR6 A;  3QNM A;  3ICX A;  5J2F A;  3V7L A;  4KMO B;  1NNL A;  1QSL A;  4JB3 A;  1RZT A;  1KTQ A;  5E79 U;  4RPY A;  4GXK A;  4I27 A;  3WKB A;  3C29 A;  1KQQ A;  2W55 A;  1MQ3 A;  2ODG A;  5DDY A;  9ICU A;  2VA3 A;  8ICL A;  8ICA A;  4UAV A;  4E0D A;  5AK5 A;  3H8S A;  4US8 A;  4DO9 A;  4EBE A;  4ICA A;  5ALT A;  1JI7 A;  3HKZ C;  2V4Q A;  5AKX A;  4BXO A;  1Q8K A;  3WKA A;  4YVZ A;  2FDR A;  3OGU A;  1MC8 A;  4DFD A;  1D8B A;  5D49 A;  4RT2 A;  4DSE A;  4Y2U A;  4AYB C;  5AM0 A;  4GLX A;  3HT3 A;  5ALY A;  5A0L A;  1O08 A;  3AUO A;  4UQG A;  2E8O A;  1P7D A;  5BOM A;  2UVU A;  2WHE A;  1NJY A;  4Q43 A;  4DQR A;  3V72 A;  2B6G A;  4B9U A;  2YQE A;  2IOH A;  3Q8L A;  2UVW A;  2ZXI A;  4TQS A;  1ZD5 A;  4F4Z A;  1OXJ A;  1N61 A;  4QZC A;  4OJ6 A;  2ZTC A;  4RQ0 A;  2NRV A;  1ZQG A;  5AKI A;  3F2D A;  4B9M A;  3CW2 C;  3NRW A;  2I5H A;  5DLG A;  2BKE A;  3Q8Q B;  4IQU A;  4C80 A;  3UXP A;  1V9P A;  3K75 D;  9ICS A;  2LYH A;  1JUD A;  1NJZ A;  2W9B A;  5AKK A;  5KFS A;  1O03 A;  4RQ8 A;  1N62 A;  1TFR A;  2YB4 A;  2HHQ A;  3GII A;  4IS7 A;  1NZP A;  2ZIX B;  3SV3 A;  3F2C A;  2MAX A;  9ICK A;  4IR1 A;  4QWE A;  4CE6 A;  2LMR A;  1URJ A;  3JPN A;  2E8N A;  2JEF A;  4KLT A;  4F5N A;  7ICG A;  1QQ5 A;  2KZ3 A;  4JMU A;  2WF6 A;  2ZIV B;  5DBC A;  5DB9 A;  4CF5 A;  2ATL A;  9ICR A;  1A0P A;  1RYU A;  9ICF A;  2HOI A;  2Y9T A;  3BQ2 A;  3TAD A;  4FBU A;  2DKZ A;  3GV7 B;  5CRX A;  4ED0 A;  2NO4 A;  4DCC A;  3KHH A;  3SAH A;  3V6J A;  1NK0 A;  2LKY A;  3MGV A;  3JPR A;  5KT6 A;  4RNN A;  3PO5 A;  3QU5 A;  4DF8 A;  3TAP A;  1NKC A;  2XVT A;  3SZ2 A;  3PR4 A;  3PSF A;  1MSW D;  4DQS A;  4YQW A;  1N60 A;  3HWT A;  4Y2Q A;  1Q3V A;  1ZET A;  2DGZ A;  2FPK A;  3PV8 A;  4R8U B;  2KZM A;  4DSF A;  3PZP A;  4C8N A;  4DQQ A;  1LKY A;  4YMN A;  2RDJ A;  4DSL A;  4Q45 A;  2KNJ A;  5K4L A;  1SZH A;  5KFO A;  4TUS A;  2P35 A;  4ED2 A;  1ZQP A;  3PO4 A;  4EEL A;  2E8P A;  3S6J A;  3ETR A;  4X5V A;  4P4P A;  4ED8 A;  5AM1 A;  4DL2 A;  2DF4 B;  3ZD9 A;  2NRX A;  1KEJ A;  1TAQ A;  3TFR A;  4UB4 A;  4NLZ A;  4K4H A;  4M0A A;  4J9K A;  4CGZ A;  1RXV A;  4BX9 C;  4MFC A;  9ICB A;  3PML A;  2D3D A;  1S77 D;  2BCS A;  1FIQ A;  3ZDD A;  8ICC A;  4M9N A;  3TAC B;  2NRT A;  4Y2S A;  4QIW C;  4PJ0 U;  1Z4O A;  5ALZ A;  1Q3U A;  4FBT A;  4P2H A;  2WB1 F;  2BQ3 A;  4OCZ A;  3OSN A;  4GXJ A;  4OD0 A;  3Q8R B;  2KE7 A;  2KEY A;  1MA7 A;  2EAP A;  2FMP A;  3N4M B;  1XSL A;  1IG6 A;  3UMC A;  3G6X A;  2G5H B;  2LPE A;  2C2E A;  1UT8 A;  4O3R A;  3BQ7 A;  5EE3 A;  4KLD A;  3UQ0 A;  2KD1 A;  3C2L A;  1X9X A;  2QLT A;  1LV5 A;  4YCX A;  2WF7 A;  2G0A A;  3Q8S B;  3AQE A;  3E58 A;  2G07 A;  3WKE A;  2YMP A;  4I2F A;  1X40 A;  1BNP A;  1CUK A;  2KN7 A;  1ZD2 P;  2W3S A;  8ICK A;  2A3V A;  4YG2 A;  2NRZ A;  4RQ2 A;  4NLB A;  1BGX T;  4DOA A;  3LVV A;  2W11 A;  2W8L A;  4ECX A;  3UXN A;  5ALU A;  2IOF K;  3FC4 A;  4C7Z A;  4MF2 A;  4C4R A;  7ICO A;  5ALF A;  3LK9 A;  3J81 j;  3G6Y A;  2G5I B;  4I2G A;  4M6W B;  3UQ2 A;  1QTM A;  9ICO A;  1SIJ A;  1J2M A;  2HMX A;  3EPI A;  2KOB A;  3N28 A;  1ZQC A;  3C21 A;  2DWQ A;  3TQ1 A;  2BDP A;  2JEI A;  4G9B A;  1ZQD A;  2W3R A;  3RJG A;  3M9M B;  5HHH A;  3ZD8 A;  8ICW A;  4Q8E A;  4PHA A;  4PGX A;  3E2E A;  5J0P A;  3GV5 B;  4EZ6 A;  3WK8 A;  1UA0 A;  4XRH A;  1QCK A;  2XC9 A;  2H3Q A;  4F3O A;  4HAI A;  1T7P A;  4QWD A;  3SAG A;  2JMG A;  1Z1V A;  8ICS A;  2BPF A;  3IP4 B;  2XY7 A;  3QUC A;  4OO1 J;  3PMN A;  2HI0 A;  5F9L A;  4M9G A;  3K1Z A;  4GFJ A;  5HR6 A;  2I1Q A;  4RQ1 A;  1WG8 A;  8ICR A;  2OM6 A;  2F76 X;  1NZB A;  4DL7 A;  2W04 A;  4UAR A;  2AHO B;  1NJW A;  1WCL A;  4EBC A;  4UAS A;  2OH2 A;  5ALR A;  2DFL A;  4F91 B;  1HUO A;  5KG0 A;  4J9R A;  4M9J A;  5ALQ A;  3B9J A;  2YML A;  3TI0 A;  1C20 A;  4O9M A;  5J2E A;  1A6S A;  4J9O A;  2WF8 A;  3PX0 A;  2IBK A;  4TUQ A;  1XSP A;  5JTI A;  3TAN A;  2ES6 A;  4UB8 U;  1XSN A;  5KFD A;  4XQ8 A;  1UPH A;  3GU3 A;  2Y1J A;  4YFK A;  2XID A;  2J6U A;  2VJ5 A;  2F77 X;  2HVH A;  4HYK A;  4I28 A;  5EWG A;  3UM9 A;  1U9L A;  3CYM A;  3V6K A;  1X2I A;  2JZB B;  5AM2 A;  4IQV A;  3M8R A;  2HHS A;  5KL8 B;  3V7K A;  1OW5 A;  2RDI A;  5AI0 A;  3RF9 A;  4F8R A;  4PZO A;  2K8A A;  4EZ9 A;  3H40 A;  2EDU A;  2W03 A;  4DSK A;  1HUZ A;  1DK2 A;  4PHP A;  4QZ9 A;  4R66 A;  1JXL A;  2G09 A;  1S10 A;  2K8C B;  3PSI A;  3AU2 A;  1TV9 A;  1U47 A;  3HKZ F;  1L3S A;  4RQ4 A;  2FJ6 A;  8ICF A;  2LM4 A;  5TIS U;  5L1L A;  2J6S A;  4I2B A;  1KSP A;  9ICM A;  3HX0 A;  3C1Z A;  2A1A A;  2KKP A;  9ICH A;  3R9K A;  1KN5 A;  1KW4 A;  4PPX A;  2JR5 A;  8ICP A;  4FO6 A;  3FM9 A;  3QYP A;  3H8M A;  2XCA A;  2ALZ A;  5AKL A;  3V7J A;  3H0M B;  5AIC A;  7ICR A;  4KLJ A;  3I1Y A;  1ZQI A;  4J9L A;  1WYG A;  3HW8 A;  4Y2V A;  2ISO A;  3THV A;  4Y2T A;  2KFN A;  4BWJ A;  1F5S A;  3AU6 A;  4QZF A;  2GLE A;  2JH1 A;  3F53 A;  5DQG A;  4R8U A;  2I9G A;  1YT3 A;  5KFZ A;  4YMM A;  2Y0S C;  3M6K A;  2BPG A;  3EZ5 A;  3BQT A;  4RUA A;  2KJ9 A;  2NV3 A;  1COO A;  1Q46 A;  1JIH A;  1IV8 A;  3OJS A;  5KFR A;  5ALS A;  4KLM A;  4LZD A;  2HHT A;  2G06 A;  5J8Y C;  1JXE A;  4DLE A;  3H4D A;  7ICQ A;  5GTH U;  3SD7 A;  4ECV A;  4OJL A;  4PGQ A;  3M8S A;  5DG8 A;  1ZQN A;  3T5J A;  3RRG A;  2F1I A;  3B0Y A;  4NLC A;  1SV0 C;  2C28 A;  5KFQ A;  1QSS A;  8ICE A; 
#chains in the Genus database with same CATH homology
 2ZIW A;  2YX8 A;  1ED1 A;  3H0R B;  2YB4 A;  4AYB F;  2DF4 B;  2K4E A;  3LYS A;  4OJ5 A;  4U7C A;  1F44 A;  3RF9 A;  4FE3 A;  4NV0 A;  2K8A A;  3M6Z A;  2ZIX B;  2D6F C;  4CGZ A;  4P0P B;  2BDU A;  3N7P D;  2K8B B;  2HBM A;  2W03 A;  3F2C A;  2E1F A;  1L6N A;  2VKQ A;  2DQN B;  2WAQ F;  4BX9 C;  1KBU A;  2ZIU B;  3E0F A;  4IC9 A;  1XNS A;  2G09 A;  2K4I A;  1URJ A;  4C0Z A;  2K8C B;  3PSI A;  1HEK A;  2GH1 A;  3HKZ F;  1TAM A;  2GOL A;  4JMU A;  4QIW C;  5HR7 A;  3D2Q A;  2W7P A;  2ZIV B;  2K89 A;  3F5E A;  3ICX A;  1Q3U A;  2CRX A;  2LYB A;  2KJ5 A;  2H3I A;  2H3Q A;  1A0P A;  2LYA A;  4PL2 A;  3SQI A;  2WB1 F;  3NUQ A;  3D2S A;  4KMO B;  2JH7 A;  3SAG A;  2JMG A;  1GO3 F;  2HOI A;  1T94 A;  4BJQ A;  4CDG A;  2HOQ A;  2HOF A;  2YB1 A;  2HBJ A;  2KHV A;  2F8L A;  4QJF B;  3D2N A;  2HBL A;  2KEY A;  3IP4 B;  3GZF A;  1MA7 A;  3C29 A;  4OO1 J;  3SAF A;  2LBO A;  2KKP A;  4P0Q B;  5CRX A;  2KV2 A;  3K1Z A;  2G5H B;  4GFJ A;  5HR6 A;  4A8E A;  3PST A;  4QNL A;  2H3V A;  2K4H A;  3F2B A;  4KX3 A;  3RFA A;  2RP5 A;  2VJ4 A;  2OYY A;  2XI9 A;  2OM6 A;  3N7R C;  3PSP A;  5C0Y A;  3SAH A;  2E5S A;  3H0M B;  2F76 X;  3ONN A;  3F5A A;  1XO0 A;  4OJP A;  1NZB A;  2LKY A;  1PVP A;  2KD1 A;  4ICA A;  2MA1 A;  3ALR A;  3MGV A;  2W04 A;  2Z7J A;  3HKZ C;  1ZQ1 C;  1WUD A;  4OJO A;  4QIW F;  2PMZ F;  4PL1 A;  2ZG6 A;  2ZIX A;  2RHF A;  4ACO A;  1Z1B A;  3AQF A;  2KKV A;  2G0A A;  2KIC A;  3LVW A;  1D8B A;  3AQE A;  1IIP A;  2XVT A;  2G07 A;  2ZIU A;  2ZIW B;  3PSF A;  2OH2 A;  2R18 A;  4AYB C;  3H0L B;  3L3F X;  1OUQ A;  2LHT A;  1CRX A;  3N7S C;  4KX5 A;  2JH1 A;  3F53 A;  5A0L A;  1PVQ A;  1ECW A;  2VIX A;  3CP8 A;  1Q3V A;  2MRL A;  1YT3 A;  1P7D A;  4NWI A;  4P0P A;  2DGZ A;  2Y0S C;  2F2A B;  3M6K A;  2W7O A;  2A3V A;  2CN1 A;  2HBK A;  3O0F A;  2CPR A;  2E1E A;  2PMZ C;  2RRD A;  4NLB A;  3IG5 A;  1A6S A;  4O3M A;  3VC8 A;  2Q4T A;  3PZP A;  3IG8 A;  2KJ9 A;  3LVV A;  4U6P A;  2NV3 A;  2ZIV A;  2ZXH A;  2JGA A;  2ZXI A;  3SMV A;  4CRX A;  3T79 A;  5KL1 B;  2JHD A;  1DRG A;  1UPH A;  2WAQ C;  2KNJ A;  2XIC A;  1SZH A;  3GU3 A;  1HIW A;  2KIW A;  4OJ6 A;  2XID A;  2KHQ A;  2VJ5 A;  4FZN A;  2F77 X;  2G08 A;  2Y0S F;  4FZL A;  2N1R A;  3KZX A;  5T14 A;  3F2D A;  3M7D A;  2G06 A;  3NRW A;  1PVR A;  2G5I B;  3KFU F;  3C28 A;  3IN5 A;  4P0Q A;  3VCB A;  2M0N A;  4FZM A;  1Z19 A;  3CYM A;  3DEE A;  4OJL A;  4BUG A;  3OPX A;  2WB1 C;  3AL0 B;  2H3F A;  2H3Z A;  2HMX A;  3CRX A;  4NLC A;  2KVC A;  2KJ8 A;  4WJ3 B;  5KL8 B;  2OXO A;  2KOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...