1SZHA

Crystal structure of c. elegans her-1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
STLTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNLMTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Her-1 protein
publication title Crystal structure of Caenorhabditis elegans HER-1 and characterization of the interaction between HER-1 and TRA-2A.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 58
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09232 Caenor_Her-1 Caenorhabditis elegans Her-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.360 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA01
1.10.150.370 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA02
1SZHA
chains in the Genus database with same CATH superfamily
2JH1A 5BPCA 8ICLA 2W8LA 3KFUF 5JUMA 2ZTEA 3PO4A 4KLUA 8ICWA 2ZIUB 4JV1A 4DO9A 9ICQA 2KZ3A 2HOIA 3KHRA 4ECVA 4UB2A 4C8MA 2K4HA 5GTHU 1ZD4A 2FMQA 2ZTCA 5AKJA 4NLNA 4Z6DA 5KG3A 5CRXA 4DQPA 3PVXA 2NRVA 2YTUA 4R63A 4I2FA 3GDXA 4ED7A 5ALMA 2LPEA 1N56A 4NJ8A 3PO5A 3ZDDA 1XS9D 9ICNA 4YMNA 3M7DA 8ICVA 4GXJA 4M6WB 3PX4A 4Y2QA 2G09A 4M47A 2ZJ5A 1F0MA 3BDPA 1SIJA 1ZQHA 4YN4A 2JZBA 2XICA 2JEIA 2W04A 3KZIU 3TI0A 2HDOA 4KLJA 4I2IA 2KTQA 1PK1A 3I1YA 9ICUA 2MA1A 3SV3A 5KFYA 1UHUA 3RB4A 8ICYA 9ICGA 4QWAA 4JWNA 9ICKA 5L1JA 1Q46A 4KLOA 8ICUA 3GU3A 5KG2A 4M9HA 3BS7A 3PNCA 2DPJA 3AEVA 4C80A 1N60A 4ECUA 1ZQGA 7ICLA 1N2XA 5KAIU 1SXEA 1ZQYA 4ECQA 4QIWF 3I76A 5EWGA 3MR5A 4UB8U 3SAFA 5J2JA 4FBTA 3SR6A 2LYHA 2LYBA 5KFOA 2GLEA 5CEHA 2H3VA 4KLTA 1DK2A 4EBCA 1X9XA 3ORYA 2Q0ZX 4F5RA 2E8MA 5KFAA 2EQYA 3IHQB 3KHHA 4US8A 3FDSA 2EAOA 2W9BA 3THVA 2DGZA 2JV3A 2OHFA 3PX0A 3E0FA 2G07A 3IRUA 4U6PA 2Y9UA 3KKAA 4TURA 3RH5A 7ICRA 3QE9Y 1WYGA 4K4IA 4R8UB 2DWQA 3GQCA 5J2FA 4PGXA 1K1SA 4P4OA 3QEBZ 4ELTA 2XC9A 2PFPA 4GLXA 4DSKA 4PJ0U 3WK9A 4CDGA 4KLHA 4OJ5A 4B9UA 4NXZA 2VJ5A 1L3TA 2NV3A 4Y2VA 4YD1A 4MFCA 2QB1A 2ISOA 1KKXA 1XO0A 4YR0A 3UMBA 5AI6A 4OJLA 4M2YA 2KSOA 3BJYA 3M9OB 4RZRA 2IBKA 3GFKB 4I27A 5KFZA 3OHBA 4C8OA 2KVCA 3RBEA 5DDYA 4QIWC 1S10A 2BPCA 5D4BA 2VJ4A 2DF4B 4UB6U 3CNHA 2G06A 1N48A 1SGGA 2ESEA 2WF5A 1KN5A 4OJ6A 2KKVA 1ZQDA 3NUQA 1UA1A 1NK5A 2W9AA 3F2DA 4US9A 4CNQA 3H7IA 2C2RA 2FMSA 5HHIA 1JXLA 4C8NA 1M6YA 2A1JA 5ALOA 4KLSA 2XI9A 3MDAA 3HWTA 1NKCA 5KFQA 1C20A 2WB1F 3C1ZA 3IV6A 3BQ0A 5DQIA 5F3XB 4ECYA 2WF9A 9ICRA 1U49A 4M9NA 2K8BB 1WG8A 1MA7A 4MHVA 9ICHA 1KSPA 3HX0A 8ICHA 3K1ZA 3QU2A 3NASA 1ZQSA 3FAHA 1BPXA 7ICTA 2ISPA 1DXSA 4O3QA 4Y2PA 3SENA 2YMLA 1SV0C 3Q8QB 1Z00B 5J0XA 5KT7A 5CB1A 5TZVA 1S8OA 3K4GA 1OW5A 2H3IA 5DQGA 2K60A 3A0HU 4J9RA 4UASA 3RB0A 3TADC 3QXGA 5DB7A 2HHTA 4DFPA 4JK1A 9ICIA 4EZ6A 5J0PA 4P0PB 3CYMA 1IIPA 2E3TA 1L3UA 4C4SA 1HEKA 4XRHA 2C2DA 4XQ8A 3NRZA 4UARA 4OO1J 2P66A 1ZXIA 4NY8A 4MFFA 4BWJA 3BZCA 3V7LA 3NVWA 5F9NA 4DOAA 4Y2RA 5H2FU 8ICBA 2FPLA 3AQEA 1KBUA 3DV9A 1NNLA 2J6SA 4QZDA 5KFPA 5KL1B 2A3VA 2KHQA 3MGVA 4YVZA 2R8JA 2KJ9A 2BCRA 2DUYA 8ICTA 3JPSA 5DGBA 5IIJA 2WB1C 1SKWA 2BPGA 3Q8MA 5AIAA 4DSIA 4JB3A 3M8SA 5DG9A 1QQ5A 4BGDA 4Y2JA 2E5SA 3KHLA 2Y0SF 4FZNA 4F50A 4O3PA 3LYSA 1ZD5A 4PL1A 3ZDEA 5AM0A 1PZNA 2F1JA 4J9LA 3FC4A 2WF8A 2AGQA 2KHVA 5AKXA 1O08A 3HPOA 1KFSA 7ICPA 2L5YA 2ZIWB 1ZQIA 2W9MA 5EE1A 3PSFA 1LV5A 5C0YA 3U26A 8ICMA 1UA0A 1COKA 3H8MA 5F9LA 2JH7A 3GIMA 4PHEA 3NS1A 2XCPA 2I5HA 3C5FA 2XY6A 4NLZA 3AL0B 2KG5A 4U7CA 5G5HA 1H38A 1LVHA 5KFRA 1J2NA 4B9VA 4Q44A 2W9CA 2QB0A 4F5PA 3R9KA 4J9MA 4YG2A 3AQFA 3FYHA 2YX8A 4DS4A 2JXJA 5J29A 1BPZA 5KNIA 4F5QA 2JZBB 2KMDA 1Z1BA 4CRXA 3N7PD 4I29A 2FLNA 5J8YC 3G6YA 5ALYA 4R65A 1JXEA 4QZEA 5KFXA 3DEEA 5E79U 3SZ2A 1BPBA 5EE9A 3PW4A 3IN5A 1RXWA 1X2IA 2Y0SC 1RYRA 3GIKA 1RQLA 2VA8A 5AHXA 1L6NA 4C4TA 4F4WA 1ZRMA 4KMUA 3ZI4A 4B9TA 2H3FA 2YQEA 2G5IB 2KK0A 2BKEA 5KT3A 4JV2A 2K4EA 2P35A 1Z4NA 4PZNA 4YD2A 1AROP 1N5WA 1N5XA 4G3IA 2EZXA 3PSIA 4B9LA 8ICRA 1FFVA 1BGXT 3MBYA 3ED5A 4RNMA 5AKHA 4DQSA 1TFRA 5KFWA 5DQHA 5BOLA 4O3OA 2JEFA 3IP4B 3JPTA 4OD0A 3RAXA 4YFKA 3VC8A 1ZD3A 7ICNA 4J9PA 3B0YA 2AXTU 3MC1A 4NWIA 1KTQA 4I2CA 5AK4A 2BQ3A 2VANA 2ZUCA 5J2CA 2D8CA 3WKDA 5J2IA 2ZIXB 3RJGA 1AQ6A 2NRTA 3NVYA 3H4BA 3HT3A 4RQ0A 2HOFA 5KFIA 2F1IA 4USAA 3AMZA 3N7RC 2LHTA 4E0DA 2R8IA 1BPYA 1T3NA 2BQRA 2HHWA 1PVPA 1GO3F 2OH2A 2P6UA 5KFFA 2HBLA 4QZAA 4QJFB 9ICBA 1LKYA 4NL9C 5KL8B 5AM5A 4I2BA 3BS5B 4ED2A 1B22A 4BDPA 1VJ5A 1NK0A 3M9NB 4LZDA 2AQ0A 1MSWD 1T7PA 4PPXA 3MGIA 1ZQRA 1N62A 4UAYA 2F77X 2DKXA 4UB5A 2BQUA 2J6UA 1RYUA 2ZIVA 2IOHA 2F3NA 2BGWA 4DOCA 3RH4A 4I2HA 2KSOB 3V72A 1NK7A 3WKEA 3TAQA 1QTMA 1QSSA 1U9LA 2DL0A 7ICOA 2ASJA 4RQ8A 2HSZA 2HHQA 2M0NA 4LVSA 4ECRA 4RPZA 2XO7A 1D9FA 5KFJA 3WK4A 2VKQA 3UXPA 2IHNA 5JU5A 8ICCA 3V6JA 3N7SC 2BR0A 4RUAA 1BPDA 1D8BA 4NM2A 1B43A 2ZJ8A 9ICAA 2A1JB 2FLLA 2B21A 1TAMA 3ZD9A 3PY8A 2QKQA 1J97A 1B4FA 3SAHA 3LK9A 3IM1A 3SV4A 3HP6A 3D2SA 8ICZA 3EPGA 3TARA 4F5OA 3GV7B 4KLQA 4A8EA 2QLTA 2HHUA 1NK8A 5KFBA 4YMMA 2BCQA 2F8LA 2W55A 4ZH4A 1TK5A 5KFCA 4Z6FA 3V6KA 4DEZA 4UATA 1TAQA 4GC7A 2IOFK 4TQRA 1TVAA 1XNSA 3D2QA 4IS7A 4YCXA 4GIBA 3C1YA 2RDJA 2MRLA 4RPXA 2WF6A 4QZIA 3V7JA 3A0BU 1ZQKA 1UQVA 1BPEA 3JPRA 1HUOA 1ZQCA 5KT2A 4F72A 2PFQA 1X9SA 3RR7A 8ICSA 8ICAA 2F2AB 2IOFA 2DFLA 1HJPA 1ZQXA 2OM6A 2I1QA 4FE3A 1JMSA 4O5KA 3SD7A 5J2BA 3ISBA 5ALIA 5KT6A 5J0WA 5IIMA 4RQ7A 2PI5A 2YB1A 3OHAA 2LM4A 2PMZF 4M9JA 4RT2A 5BOMA 1Q8KA 3LVWA 3ISCA 4EELA 4P4PA 1DRGA 3EW9A 2KV2A 5J0SA 4MF8A 5K4LA 1WCNA 2VA2A 1A77A 5AM2A 2YN4A 5KAFU 2ZXHA 5J2GA 2EH9A 3MDCA 2F8KA 4DL6A 1KFDA 2NYVA 5ALKA 4NLCA 4DSLA 3H0RB 4PH5A 4CGZA 4FBUA 1NJYA 5HP4A 4DFMA 2XY7A 4P2HA 3PMNA 3C21A 1NK9A 4F4KA 2CXYA 2MAXA 3LWLA 3HILA 4K4GA 3RB6A 4QZGA 3J81j 1UT5A 2PFOA 4EEKA 1RQNA 1NK6A 2BZFA 1ZQ1C 3KKAC 4DOBA 1OUQA 5HHHA 1T4GA 2BCUA 4NLGA 4O0IA 3RFAA 1SL0A 4YP3A 2D3DA 4RQ3A 2C2EA 2W9CB 4J9SA 1XSPA 2AJQA 5L1MA 1ZQUA 2HVHA 1DK3A 2H5XA 2WTFA 1WWVA 3UPQA 2PMZC 3PW5A 5KFSA 3QZ8A 3T3FA 3SAGA 4J9OA 2CRXA 4I2JA 4F2RA 1L8OA 1ZQMA 2ZIUA 2DQNB 2YMMA 4P0QB 1L8LA 8ICPA 1TK8A 4WJ3B 4IL6U 4UB4A 4Y2TA 3ETLA 4G9BA 1BVSA 2MSNA 1S77D 1J2MA 1WWUA 3UMCA 3QU9A 4DWIA 1KW4A 3QU4A 2RHFA 3PSTA 3ALRA 5AI4A 2XGPA 5AICA 4BXOB 3B0XA 5KG4A 5AK6A 3PSPA 4IQWA 2KD1A 5J0RA 2W3RA 3MFIA 4ECSA 4CF5A 4ED3A 3QU7A 1JX4A 4KLDA 4DQRA 1KFTA 3T5LA 3TADA 2V9WA 3V6HA 4F3OA 4OJOA 4M6WA 3Q8PB 4C8KA 4EYHB 9ICMA 2W11A 4MF2A 2MUTB 3SYZA 1S76D 5CHGA 1MC8A 1ECWA 2KFZA 4OJPA 2G08A 5KFMA 5B5EU 4O3SA 2GO7A 4RQ5A 1T8EA 1RXVA 1MN8A 3QEAZ 4GFJA 1QSYA 2QARB 2CN1A 4DSFA 2K89A 3UXNA 5AI5A 1SXDA 5ALWA 5DB6A 5KFHA 5L1IA 5AKKA 4M0AA 2Y1JA 5KTQA 4BWMA 1Q3UA 4I2EA 3RBDA 4XUSA 4DL2A 2PKEA 4CF4A 2BDUA 4YQWA 5D49A 3F2CA 2JHDA 4KLFA 1OXJA 2CPRA 8ICIA 5CA7A 1YZ6A 3HW8A 2NRWA 5CJ7A 3C2MA 1LKYB 4UQGA 1FO4A 4MEXA 5DB9A 5ALLA 3M9MB 2HBKA 1F44A 2K4PA 4R66A 1JIHA 4KX5A 5J0OA 4NV0A 5IIIA 1T94A 2F44A 4RPYA 2W43A 4UAVA 4EYIB 1S5LU 4F71A 1ZQWA 4YXJA 3TQ1A 3HJEA 5IIOA 2ASDA 4KITB 3GV5B 2AU0A 3ZDCA 2KN7A 1HUZA 1XSLA 2W7PA 4I2DA 1BNPA 4O5CA 4IR1A 1VLBA 3H4DA 3Q8RB 3QUQA 4TUSA 4IQTA 2UVWA 3Q8KA 3ETRA 3JPQA 4EBDA 4Q8EA 3PR5B 2OYYA 4J03A 1RZTA 4R8UA 3SI8A 3TFSA 3QNMA 4UAUA 9ICTA 2OXOA 1XU4A 3MR3A 1ZQLA 2IA6A 2FI1A 4UAZA 1FEZA 2ATLA 5AKEA 4RUCA 4KLMA 2ALZA 2W3SA 5AM4A 5AKLA 4C7ZA 2O6KA 3N97B 2EZZA 1PVRA 3EYZA 3UMGA 1SL2A 2YMPA 3AN1A 5AK3A 3RTVA 1S97A 3G6VA 9ICVA 1ED1A 7ICVA 5EWFA 1TK0A 2LYAA 3F5AA 2AGOA 4DS5A 3RB3A 4F91B 4KLLA 1B0XA 3PV8A 1U4BA 1S0VA 2K8AA 1PK1B 2DKZA 3MABA 2J6TA 4EX7A 1D8YA 1IG6A 4B9MA 4GXKA 1S0NA 4GC6A 5T14A 2K8CB 2IHMA 2LM1A 4DFDA 4DLEA 4IQVA 4QZCA 1ZYQA 1T3QA 2C28A 4EX6A 1WUDA 2FDRA 4PHPA 1HIWA 3TFRA 4QZBA 7ICGA 4QWCA 1S0OA 3OJSA 4DF4A 4FS1A 3PMLA 2GWSA 3OPXA 4UBBA 3V7KA 2FJ6A 1SZPA 1L7OA 4NM1A 4EZ9A 5KFTA 1QLNA 1X40A 1Y88A 3RRGA 2RRDA 5KG1A 5KG6A 4Y2YA 2B6GA 1V9PA 3C2KA 5AKIA 1ZRNA 4NLBA 5J0UA 2ZXIA 4RQNA 4IC9A 2LBOA 1D8LA 4IQUA 1DOQA 2E8PA 1TE2A 4RU9A 3UQ2A 1CI4A 1LB2B 1Z00A 3HKZF 7ICHA 5AKGA 3C28A 3T5JA 2W9BB 3RJFA 1ZQZA 5AK5A 5DG8A 3ICXA 1ZQQA 2EAMA 3CP8A 2N1RA 3C5GA 1YZ7A 3D2NA 4F2SA 3WK6A 4P0PA 7ICFA 4NL9A 5KFNA 2D6FC 3BQ1A 4QZ9A 4I2GA 3RJIA 2RDIA 9ICPA 3PZPA 2KJ8A 4DCCA 4DL5A 1QQ7A 2PFNA 2HHVA 1N63A 3GV8B 9ICCA 1O03A 2FPKA 4QW9A 4HAIA 4GXIA 3OJUA 4ED6A 2RP5A 1QSLA 4RNOA 3QYPA 5ALZA 2IMWP 3T5HA 2Z7JA 1KL9A 1ZQVA 4PZOA 2EDUA 5DGAA 2ES6A 3MGHA 4UB1A 2HHSA 4F93B 5L9XA 4BJQA 4ECTA 5C5JA 3G6XA 3QUCA 4B6JA 2BCSA 5GTIU 5J0YA 3GILA 3PW2A 1U47A 4KLEA 3BQ7A 3LDAA 1RDFA 5ALUA 4O3MA 5DBBA 9ICEA 4QZFA 5ALHA 5ALNA 4DQQA 1X9WA 1X9MA 2ZJAA 2KE7A 2HBJA 2E8OA 5HR6A 3ZDBA 1D9DA 7ICUA 4FZLA 5KG0A 2AGPA 2V4RA 5AI9A 1XO1A 2JR5A 3K75D 1Q3VA 1RYSA 2KZZA 1SKSA 4KMOB 2ZIWA 2LI6A 3HKZC 3NVVA 5DG7A 2ZG6A 2H3ZA 5DBAA 2R8HA 7ICJA 1ZOLA 3E58A 5DB8A 1V97A 1C7YA 4QZ8A 2W03A 1NK4A 4BX9C 5J2DA 2C22A 3EWAA 4DLGA 5ALVA 4PHAA 2V4QA 2E1FA 1ZETA 4ACOA 4ED8A 4PGQA 5DLFA 2P6RA 4ELUA 5HMLA 3TACB 2ODGA 2VIXA 2RLTA 3K1RB 5DDMA 5KFLA 5G5GA 3PX6A 1DGSA 3F5EA 2BDPA 4YR2A 1URJA 4BUGA 1ZQNA 3C29A 5KT4A 3F2BA 2ZUBA 3EPIA 1V85A 2UVUA 3HRDD 3NVZA 3OSNA 2PI4A 5ALXA 4FFDA 5FP0A 2JGAA 1SKRA 4Q8FA 3RAQA 3OTQA 1Z19A 1QH9A 1NKBA 3IDWA 2RQ5A 1KLNA 9ICWA 4Q45A 1ZQOA 1SZHA 2W54A 3H8WA 2EANA 5J2AA 3AM9A 3BZKA 8ICEA 1RG6A 7ICQA 2M9NA 4I2AA 1KEJA 4RNNA 5AKZA 5DLGA 2EAPA 1P7DA 1YT3A 3Q8SB 3RJKA 1A6SA 3S6JA 4KN7A 1ZQPA 1IM4A 2KIVA 1K1QA 3SMVA 3L4PA 3AUOA 2K4IA 2JRZA 1ZJNA 3RJHA 1ZQJA 5CR0A 4DF8A 3PR4A 2ZUDA 3C2LA 4LZGA 3AU2A 4QWDA 1U45A 3O0FA 4JV0A 4AYBF 5EWEA 3I28A 1PUZA 2PXIA 5KT5A 5KFKA 4RQ2A 3F53A 3KOOA 1L3SA 3MFHA 1QCKA 5ALQA 3OSPA 2ZIXA 2FLPA 3WK8A 3D6JA 4JMUA 5HMMA 2XCAA 3SEIA 2FPMA 2WF7A 1SWVA 4KN4A 8ICXA 1S0MA 5AM3A 2KFNA 4TUQA 3RRHA 2F76X 4YR3A 2JMGA 4B9NA 5ALGA 1U48A 2G5HB 2KNJA 2YB4A 5EOZA 4UAWA 3MR2A 1SV4A 4QNLA 5ALFA 4C7YA 3BS5A 1WCLA 5J2HA 4M04A 2MU2A 1ZQEA 4KLGA 2F1HA 2QB0B 2Y1IA 4ICAA 2KOBA 5AKYA 3OGUA 9ICFA 8ICJA 3BQ2A 2GOLA 2A19A 1TAUA 3KBBA 2WHEA 4FO6A 2HOQA 2XVTA 4CF3A 4O9MA 1Z4OA 5DKWA 4F4XA 3B9JA 4QW8A 2W7OA 3RR8A 3VCBA 1NJWA 5AM1A 4ECXA 2Y9TA 5ALJA 1KDHA 5EE3A 9ICLA 4QZHA 3ZD8A 4O3RA 1UPHA 5HNKA 4AYBC 4RT3A 1QQ6A 2NRXA 3FM9A 1EXNA 5L1KA 3TAPA 2BPFA 2KEYA 2JEJA 1X6IA 2OWOA 5TISU 9ICSA 2FE9A 4J9KA 3GIJA 1S9FA 3NTUA 1BNOA 4RQMA 3WKBA 5KFUA 2BHNA 4ECWA 4F8RA 1IV8A 1MQ3A 4C0ZA 1SV0A 2H3QA 2A1AA 2Q4TA 2HCFA 5J2EA 1NZPA 1F5SA 1NKEA 2XGQA 3QX7A 3T5KA 3N28A 5KFEA 3ONNA 1DGJA 1JUDA 2E8NA 3SQIA 1XC9A 3PW0A 2KKPA 1X66A 4Z6EA 4IR9A 4O5EA 3RF9A 4Y2SA 7ICMA 1X42A 4I28A 5JTIA 1JROA 4DL7A 4PL2A 4IRCA 2KVSA 2WAQF 1ZQFA 4KTQA 5IILA 4MEYA 7ICKA 1N61A 4Y2XA 4M9LA 4UB3A 3L3FX 4CE6A 4TQSA 1CEZA 4EEYA 1RPLA 1JN3A 4DFJA 1L7PA 3TKAA 3WK5A 4PHDA 3H0MB 2KZMA 2LMRA 1NI3A 4M9GA 4MFAA 1CUKA 4RQ6A 1CRXA 4NLKA 4C8LA 4KLIA 2UVRA 1NZBA 2ZIVB 1COOA 3CW2C 1A0PA 4LJXA 2AQ4A 5D46A 5EE0A 2HHXA 2W8KA 3JPNA 3AU6A 1FFUA 4RQ1A 4EENA 3TANA 4C4RA 2AHOB 4DL4A 4CCHA 4K4HA 3M1YA 5JRTA 5KFVA 3E2EA 4RQ4A 1FIQA 8ICNA 1L3VA 4DFKA 1TKDA 1JALA 1UCVA 1PK3A 9ICXA 4FS2A 3NRWA 2XIDA 5J0TA 1JI7A 3H0LB 2OEHA 7ICEA 4DSJA 2OCEA 1SWWA 2KICA 4ED0A 1KQQA 2UVVA 3QUBA 4ECZA 3ISDA 2HI0A 5IINA 4F5NA 2WAQC 2HBMA 3QUTA 4YMOA 3QZ7A 3GIIA 4DSEA 4FZMA 1SB3C 2YMQA 3EUB2 7ICIA 3NGDA 3M8RA 1TV9A 1X6JA 3QU5A 3RH6A 2BCVA 5J8YA 5L1LA 5KFGA 1IXRA 2YY6A 4ELVA 2R18A 5J0QA 2HW3A 3N4MB 5AI8A 4R64A 4AP9A 3Q8LA 3UQ0A 8ICQA 4X5VA 7ICSA 4QWEA 1ZQBA 2R8KA 2NO4A 3KTQA 2KJ5A 1Z3EB 4F4ZA 5CWRA 3LWMA 5KFDA 4ED1A 2AH5A 1JRPA 5A0LA 4DQIA 3GZFA 2E1EA 2WFAA 1ZD2P 1K5OA 2KIWA 4P0QA 5AI0A 1NJZA 4ZOHC 3LVVA 4PGYA 5J2KA 5KG7A 3WKCA 5AIBA 1ZJMA 1L7MA 4P4MA 2HMXA 4F4YA 3PW7A 3UXOA 2XY5A 8ICFA 2DBYA 2NO5A 4DL3A 3KD3A 4XA5A 3JPPA 3BQTA 2NRZA 4BXOA 3EZ5A 4OCZA 3KZXA 3WKAA 5ALTA 1ZQTA 4IRKA 4EBEA 1NJXA 5ALPA 4UW9A 5DBCA 2ZTDA 8ICGA 8ICKA 2HVIA 4F92B 1ZQAA 3IG8A 3C23A 1XWLA 3IG5A 3UM9A 4Q43A 3CRXA 2MUTA 5KG5A 5ALEA 4Y2UA 1Z1VA 3DDHA 1KRPA 2B0CA 2DPIA 5CP2A 9ICOA 4KX3A 2GH1A 3JPOA 3H8SA 3MR6A 4J9NA 2QARA 4IRDA 5ALSA 1NOMA 1RM6C 3L5KA 2LKYA 5ALRA 2JEGA 3ZDAA 3H40A 1UT8A 2KP7A 3KHGA 2EZYA 3RJEA 5IIKA 4Z6CA 4YXMA 2I9GA 3WU2U 4JUZA 5HR7A 1XSNA 4JWMA 4J9QA 1MQ2A 3H8JA 2ASLA 5B66U 1L7NA 1L5UA 5ALDA 8ICOA 1PVQA 1VDVA 3RJJA 4QWBA 2VA3A 1A76A 2G0AA 4UBCA 4TUPA 1SL1A 2I6XA 3WK7A 2FMPA 2R8GA 4B9SA 9ICJA 4O3NA 3M6ZA 3M6KA 1V38A 4HYKA 3T79A
chains in the Genus database with same CATH topology
4OJPA 2G08A 2VJ4A 2DF4B 1ZQ1C 3AQEA 1KBUA 2MRLA 1XNSA 2JH1A 3ICXA 3KFUF 2E1FA 2G06A 3CP8A 2ZIXA 4ACOA 1OUQA 1PVRA 2N1RA 4QIWF 5KL1B 2ZIUB 4OJ6A 2KKVA 2A3VA 4GFJA 2KHQA 3NUQA 3MGVA 3RFAA 2CN1A 3D2NA 3DEEA 3KZXA 2KJ9A 4JMUA 3NRWA 3SAFA 3F2DA 2K89A 2XIDA 4P0PA 3ONNA 3IN5A 2D6FC 3H0LB 3SQIA 2VIXA 1ED1A 2F77X 2WB1C 2Y0SC 2LYBA 2HOIA 2LYAA 3F5AA 2ZIVA 2KKPA 2H3VA 2F76X 2KICA 2K4HA 3IG8A 2F2AB 1Q3UA 3PZPA 2JMGA 2KJ8A 2XI9A 2E5SA 1L6NA 3RF9A 2Y0SF 2WB1F 3IG5A 4FZNA 2H3FA 2OM6A 3F5EA 2BDUA 4FE3A 2G5IB 2G5HB 2KNJA 2YB4A 3LYSA 2PMZC 1URJA 2HBMA 2JHDA 2WAQC 2CPRA 4BUGA 2K8AA 2K4EA 3F2CA 3CRXA 5CRXA 2RP5A 4PL1A 3C29A 4QNLA 3F2BA 2YB1A 4FZMA 3PSIA 3SAGA 4PL2A 2K8BB 2Z7JA 1MA7A 2CRXA 2DGZA 2M0NA 2PMZF 2K8CB 2WAQF 5T14A 3K1ZA 3LVWA 3E0FA 2G07A 2KHVA 2VKQA 4U6PA 1DRGA 2HBKA 1F44A 2ZIUA 2DQNB 2GH1A 3IP4B 4KX3A 4KX5A 4BJQA 4P0QB 2KV2A 1WUDA 4NV0A 2JGAA 1T94A 2KOBA 2ZIWB 3L3FX 4ICAA 4WJ3B 1HIWA 3M7DA 3PSFA 1Z19A 3N7SC 5C0YA 2LKYA 2GOLA 2R18A 3VC8A 1D8BA 1SZHA 2ZXHA 2G09A 2HOQA 5KL8B 2XVTA 4O3MA 3H0MB 4NWIA 2RHFA 3PSTA 3OPXA 2XICA 2JH7A 1TAMA 4CDGA 2W7OA 2W04A 3ALRA 3VCBA 2KJ5A 2H3IA 4OJ5A 2W7PA 2HBJA 2ZIXB 4NLCA 2RRDA 3SAHA 2MA1A 1P7DA 2VJ5A 1YT3A 2NV3A 1CRXA 3D2SA 3AL0B 5HR6A 4U7CA 5HR7A 5A0LA 1A6SA 3H0RB 4FZLA 3PSPA 3GZFA 4CGZA 3SMVA 2E1EA 4P0PB 3CYMA 1IIPA 2K4IA 2KD1A 2HOFA 4A8EA 1XO0A 1UPHA 1NZBA 4NLBA 4AYBC 1Q3VA 1HEKA 2KIWA 2ZIVB 4OJLA 4OO1J 2ZXIA 3N7RC 1A0PA 4KMOB 4P0QA 4IC9A 3GU3A 2KEYA 1PVQA 2OYYA 2ZIWA 2LHTA 2LBOA 3O0FA 3HKZC 3LVVA 2F8LA 3AQFA 2ZG6A 2YX8A 2H3ZA 4OJOA 4AYBF 2OXOA 2G0AA 1PVPA 1GO3F 2OH2A 2HBLA 3HKZF 2W03A 2HMXA 3M6ZA 3C28A 2KVCA 3M6KA 4C0ZA 4BX9C 4QJFB 2H3QA 4QIWC 1ECWA 3F53A 3D2QA 3N7PD 1Z1BA 3T79A 4CRXA 2Q4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZH A; 
#chains in the Genus database with same CATH topology
 2JH1 A;  5BPC A;  8ICL A;  2W8L A;  3KFU F;  5JUM A;  2ZTE A;  3PO4 A;  4KLU A;  8ICW A;  2ZIU B;  4JV1 A;  4DO9 A;  9ICQ A;  2KZ3 A;  2HOI A;  3KHR A;  4ECV A;  4UB2 A;  4C8M A;  2K4H A;  5GTH U;  1ZD4 A;  2FMQ A;  2ZTC A;  5AKJ A;  4NLN A;  4Z6D A;  5KG3 A;  5CRX A;  4DQP A;  3PVX A;  2NRV A;  2YTU A;  4R63 A;  4I2F A;  3GDX A;  4ED7 A;  5ALM A;  2LPE A;  1N56 A;  4NJ8 A;  3PO5 A;  3ZDD A;  1XS9 D;  9ICN A;  4YMN A;  3M7D A;  8ICV A;  4GXJ A;  4M6W B;  3PX4 A;  4Y2Q A;  2G09 A;  4M47 A;  2ZJ5 A;  1F0M A;  3BDP A;  1SIJ A;  1ZQH A;  4YN4 A;  2JZB A;  2XIC A;  2JEI A;  2W04 A;  3KZI U;  3TI0 A;  2HDO A;  4KLJ A;  4I2I A;  2KTQ A;  1PK1 A;  3I1Y A;  9ICU A;  2MA1 A;  3SV3 A;  5KFY A;  1UHU A;  3RB4 A;  8ICY A;  9ICG A;  4QWA A;  4JWN A;  9ICK A;  5L1J A;  1Q46 A;  4KLO A;  8ICU A;  3GU3 A;  5KG2 A;  4M9H A;  3BS7 A;  3PNC A;  2DPJ A;  3AEV A;  4C80 A;  1N60 A;  4ECU A;  1ZQG A;  7ICL A;  1N2X A;  5KAI U;  1SXE A;  1ZQY A;  4ECQ A;  4QIW F;  3I76 A;  5EWG A;  3MR5 A;  4UB8 U;  3SAF A;  5J2J A;  4FBT A;  3SR6 A;  2LYH A;  2LYB A;  5KFO A;  2GLE A;  5CEH A;  2H3V A;  4KLT A;  1DK2 A;  4EBC A;  1X9X A;  3ORY A;  2Q0Z X;  4F5R A;  2E8M A;  5KFA A;  2EQY A;  3IHQ B;  3KHH A;  4US8 A;  3FDS A;  2EAO A;  2W9B A;  3THV A;  2DGZ A;  2JV3 A;  2OHF A;  3PX0 A;  3E0F A;  2G07 A;  3IRU A;  4U6P A;  2Y9U A;  3KKA A;  4TUR A;  3RH5 A;  7ICR A;  3QE9 Y;  1WYG A;  4K4I A;  4R8U B;  2DWQ A;  3GQC A;  5J2F A;  4PGX A;  1K1S A;  4P4O A;  3QEB Z;  4ELT A;  2XC9 A;  2PFP A;  4GLX A;  4DSK A;  4PJ0 U;  3WK9 A;  4CDG A;  4KLH A;  4OJ5 A;  4B9U A;  4NXZ A;  2VJ5 A;  1L3T A;  2NV3 A;  4Y2V A;  4YD1 A;  4MFC A;  2QB1 A;  2ISO A;  1KKX A;  1XO0 A;  4YR0 A;  3UMB A;  5AI6 A;  4OJL A;  4M2Y A;  2KSO A;  3BJY A;  3M9O B;  4RZR A;  2IBK A;  3GFK B;  4I27 A;  5KFZ A;  3OHB A;  4C8O A;  2KVC A;  3RBE A;  5DDY A;  4QIW C;  1S10 A;  2BPC A;  5D4B A;  2VJ4 A;  2DF4 B;  4UB6 U;  3CNH A;  2G06 A;  1N48 A;  1SGG A;  2ESE A;  2WF5 A;  1KN5 A;  4OJ6 A;  2KKV A;  1ZQD A;  3NUQ A;  1UA1 A;  1NK5 A;  2W9A A;  3F2D A;  4US9 A;  4CNQ A;  3H7I A;  2C2R A;  2FMS A;  5HHI A;  1JXL A;  4C8N A;  1M6Y A;  2A1J A;  5ALO A;  4KLS A;  2XI9 A;  3MDA A;  3HWT A;  1NKC A;  5KFQ A;  1C20 A;  2WB1 F;  3C1Z A;  3IV6 A;  3BQ0 A;  5DQI A;  5F3X B;  4ECY A;  2WF9 A;  9ICR A;  1U49 A;  4M9N A;  2K8B B;  1WG8 A;  1MA7 A;  4MHV A;  9ICH A;  1KSP A;  3HX0 A;  8ICH A;  3K1Z A;  3QU2 A;  3NAS A;  1ZQS A;  3FAH A;  1BPX A;  7ICT A;  2ISP A;  1DXS A;  4O3Q A;  4Y2P A;  3SEN A;  2YML A;  1SV0 C;  3Q8Q B;  1Z00 B;  5J0X A;  5KT7 A;  5CB1 A;  5TZV A;  1S8O A;  3K4G A;  1OW5 A;  2H3I A;  5DQG A;  2K60 A;  3A0H U;  4J9R A;  4UAS A;  3RB0 A;  3TAD C;  3QXG A;  5DB7 A;  2HHT A;  4DFP A;  4JK1 A;  9ICI A;  4EZ6 A;  5J0P A;  4P0P B;  3CYM A;  1IIP A;  2E3T A;  1L3U A;  4C4S A;  1HEK A;  4XRH A;  2C2D A;  4XQ8 A;  3NRZ A;  4UAR A;  4OO1 J;  2P66 A;  1ZXI A;  4NY8 A;  4MFF A;  4BWJ A;  3BZC A;  3V7L A;  3NVW A;  5F9N A;  4DOA A;  4Y2R A;  5H2F U;  8ICB A;  2FPL A;  3AQE A;  1KBU A;  3DV9 A;  1NNL A;  2J6S A;  4QZD A;  5KFP A;  5KL1 B;  2A3V A;  2KHQ A;  3MGV A;  4YVZ A;  2R8J A;  2KJ9 A;  2BCR A;  2DUY A;  8ICT A;  3JPS A;  5DGB A;  5IIJ A;  2WB1 C;  1SKW A;  2BPG A;  3Q8M A;  5AIA A;  4DSI A;  4JB3 A;  3M8S A;  5DG9 A;  1QQ5 A;  4BGD A;  4Y2J A;  2E5S A;  3KHL A;  2Y0S F;  4FZN A;  4F50 A;  4O3P A;  3LYS A;  1ZD5 A;  4PL1 A;  3ZDE A;  5AM0 A;  1PZN A;  2F1J A;  4J9L A;  3FC4 A;  2WF8 A;  2AGQ A;  2KHV A;  5AKX A;  1O08 A;  3HPO A;  1KFS A;  7ICP A;  2L5Y A;  2ZIW B;  1ZQI A;  2W9M A;  5EE1 A;  3PSF A;  1LV5 A;  5C0Y A;  3U26 A;  8ICM A;  1UA0 A;  1COK A;  3H8M A;  5F9L A;  2JH7 A;  3GIM A;  4PHE A;  3NS1 A;  2XCP A;  2I5H A;  3C5F A;  2XY6 A;  4NLZ A;  3AL0 B;  2KG5 A;  4U7C A;  5G5H A;  1H38 A;  1LVH A;  5KFR A;  1J2N A;  4B9V A;  4Q44 A;  2W9C A;  2QB0 A;  4F5P A;  3R9K A;  4J9M A;  4YG2 A;  3AQF A;  3FYH A;  2YX8 A;  4DS4 A;  2JXJ A;  5J29 A;  1BPZ A;  5KNI A;  4F5Q A;  2JZB B;  2KMD A;  1Z1B A;  4CRX A;  3N7P D;  4I29 A;  2FLN A;  5J8Y C;  3G6Y A;  5ALY A;  4R65 A;  1JXE A;  4QZE A;  5KFX A;  3DEE A;  5E79 U;  3SZ2 A;  1BPB A;  5EE9 A;  3PW4 A;  3IN5 A;  1RXW A;  1X2I A;  2Y0S C;  1RYR A;  3GIK A;  1RQL A;  2VA8 A;  5AHX A;  1L6N A;  4C4T A;  4F4W A;  1ZRM A;  4KMU A;  3ZI4 A;  4B9T A;  2H3F A;  2YQE A;  2G5I B;  2KK0 A;  2BKE A;  5KT3 A;  4JV2 A;  2K4E A;  2P35 A;  1Z4N A;  4PZN A;  4YD2 A;  1ARO P;  1N5W A;  1N5X A;  4G3I A;  2EZX A;  3PSI A;  4B9L A;  8ICR A;  1FFV A;  1BGX T;  3MBY A;  3ED5 A;  4RNM A;  5AKH A;  4DQS A;  1TFR A;  5KFW A;  5DQH A;  5BOL A;  4O3O A;  2JEF A;  3IP4 B;  3JPT A;  4OD0 A;  3RAX A;  4YFK A;  3VC8 A;  1ZD3 A;  7ICN A;  4J9P A;  3B0Y A;  2AXT U;  3MC1 A;  4NWI A;  1KTQ A;  4I2C A;  5AK4 A;  2BQ3 A;  2VAN A;  2ZUC A;  5J2C A;  2D8C A;  3WKD A;  5J2I A;  2ZIX B;  3RJG A;  1AQ6 A;  2NRT A;  3NVY A;  3H4B A;  3HT3 A;  4RQ0 A;  2HOF A;  5KFI A;  2F1I A;  4USA A;  3AMZ A;  3N7R C;  2LHT A;  4E0D A;  2R8I A;  1BPY A;  1T3N A;  2BQR A;  2HHW A;  1PVP A;  1GO3 F;  2OH2 A;  2P6U A;  5KFF A;  2HBL A;  4QZA A;  4QJF B;  9ICB A;  1LKY A;  4NL9 C;  5KL8 B;  5AM5 A;  4I2B A;  3BS5 B;  4ED2 A;  1B22 A;  4BDP A;  1VJ5 A;  1NK0 A;  3M9N B;  4LZD A;  2AQ0 A;  1MSW D;  1T7P A;  4PPX A;  3MGI A;  1ZQR A;  1N62 A;  4UAY A;  2F77 X;  2DKX A;  4UB5 A;  2BQU A;  2J6U A;  1RYU A;  2ZIV A;  2IOH A;  2F3N A;  2BGW A;  4DOC A;  3RH4 A;  4I2H A;  2KSO B;  3V72 A;  1NK7 A;  3WKE A;  3TAQ A;  1QTM A;  1QSS A;  1U9L A;  2DL0 A;  7ICO A;  2ASJ A;  4RQ8 A;  2HSZ A;  2HHQ A;  2M0N A;  4LVS A;  4ECR A;  4RPZ A;  2XO7 A;  1D9F A;  5KFJ A;  3WK4 A;  2VKQ A;  3UXP A;  2IHN A;  5JU5 A;  8ICC A;  3V6J A;  3N7S C;  2BR0 A;  4RUA A;  1BPD A;  1D8B A;  4NM2 A;  1B43 A;  2ZJ8 A;  9ICA A;  2A1J B;  2FLL A;  2B21 A;  1TAM A;  3ZD9 A;  3PY8 A;  2QKQ A;  1J97 A;  1B4F A;  3SAH A;  3LK9 A;  3IM1 A;  3SV4 A;  3HP6 A;  3D2S A;  8ICZ A;  3EPG A;  3TAR A;  4F5O A;  3GV7 B;  4KLQ A;  4A8E A;  2QLT A;  2HHU A;  1NK8 A;  5KFB A;  4YMM A;  2BCQ A;  2F8L A;  2W55 A;  4ZH4 A;  1TK5 A;  5KFC A;  4Z6F A;  3V6K A;  4DEZ A;  4UAT A;  1TAQ A;  4GC7 A;  2IOF K;  4TQR A;  1TVA A;  1XNS A;  3D2Q A;  4IS7 A;  4YCX A;  4GIB A;  3C1Y A;  2RDJ A;  2MRL A;  4RPX A;  2WF6 A;  4QZI A;  3V7J A;  3A0B U;  1ZQK A;  1UQV A;  1BPE A;  3JPR A;  1HUO A;  1ZQC A;  5KT2 A;  4F72 A;  2PFQ A;  1X9S A;  3RR7 A;  8ICS A;  8ICA A;  2F2A B;  2IOF A;  2DFL A;  1HJP A;  1ZQX A;  2OM6 A;  2I1Q A;  4FE3 A;  1JMS A;  4O5K A;  3SD7 A;  5J2B A;  3ISB A;  5ALI A;  5KT6 A;  5J0W A;  5IIM A;  4RQ7 A;  2PI5 A;  2YB1 A;  3OHA A;  2LM4 A;  2PMZ F;  4M9J A;  4RT2 A;  5BOM A;  1Q8K A;  3LVW A;  3ISC A;  4EEL A;  4P4P A;  1DRG A;  3EW9 A;  2KV2 A;  5J0S A;  4MF8 A;  5K4L A;  1WCN A;  2VA2 A;  1A77 A;  5AM2 A;  2YN4 A;  5KAF U;  2ZXH A;  5J2G A;  2EH9 A;  3MDC A;  2F8K A;  4DL6 A;  1KFD A;  2NYV A;  5ALK A;  4NLC A;  4DSL A;  3H0R B;  4PH5 A;  4CGZ A;  4FBU A;  1NJY A;  5HP4 A;  4DFM A;  2XY7 A;  4P2H A;  3PMN A;  3C21 A;  1NK9 A;  4F4K A;  2CXY A;  2MAX A;  3LWL A;  3HIL A;  4K4G A;  3RB6 A;  4QZG A;  3J81 j;  1UT5 A;  2PFO A;  4EEK A;  1RQN A;  1NK6 A;  2BZF A;  1ZQ1 C;  3KKA C;  4DOB A;  1OUQ A;  5HHH A;  1T4G A;  2BCU A;  4NLG A;  4O0I A;  3RFA A;  1SL0 A;  4YP3 A;  2D3D A;  4RQ3 A;  2C2E A;  2W9C B;  4J9S A;  1XSP A;  2AJQ A;  5L1M A;  1ZQU A;  2HVH A;  1DK3 A;  2H5X A;  2WTF A;  1WWV A;  3UPQ A;  2PMZ C;  3PW5 A;  5KFS A;  3QZ8 A;  3T3F A;  3SAG A;  4J9O A;  2CRX A;  4I2J A;  4F2R A;  1L8O A;  1ZQM A;  2ZIU A;  2DQN B;  2YMM A;  4P0Q B;  1L8L A;  8ICP A;  1TK8 A;  4WJ3 B;  4IL6 U;  4UB4 A;  4Y2T A;  3ETL A;  4G9B A;  1BVS A;  2MSN A;  1S77 D;  1J2M A;  1WWU A;  3UMC A;  3QU9 A;  4DWI A;  1KW4 A;  3QU4 A;  2RHF A;  3PST A;  3ALR A;  5AI4 A;  2XGP A;  5AIC A;  4BXO B;  3B0X A;  5KG4 A;  5AK6 A;  3PSP A;  4IQW A;  2KD1 A;  5J0R A;  2W3R A;  3MFI A;  4ECS A;  4CF5 A;  4ED3 A;  3QU7 A;  1JX4 A;  4KLD A;  4DQR A;  1KFT A;  3T5L A;  3TAD A;  2V9W A;  3V6H A;  4F3O A;  4OJO A;  4M6W A;  3Q8P B;  4C8K A;  4EYH B;  9ICM A;  2W11 A;  4MF2 A;  2MUT B;  3SYZ A;  1S76 D;  5CHG A;  1MC8 A;  1ECW A;  2KFZ A;  4OJP A;  2G08 A;  5KFM A;  5B5E U;  4O3S A;  2GO7 A;  4RQ5 A;  1T8E A;  1RXV A;  1MN8 A;  3QEA Z;  4GFJ A;  1QSY A;  2QAR B;  2CN1 A;  4DSF A;  2K89 A;  3UXN A;  5AI5 A;  1SXD A;  5ALW A;  5DB6 A;  5KFH A;  5L1I A;  5AKK A;  4M0A A;  2Y1J A;  5KTQ A;  4BWM A;  1Q3U A;  4I2E A;  3RBD A;  4XUS A;  4DL2 A;  2PKE A;  4CF4 A;  2BDU A;  4YQW A;  5D49 A;  3F2C A;  2JHD A;  4KLF A;  1OXJ A;  2CPR A;  8ICI A;  5CA7 A;  1YZ6 A;  3HW8 A;  2NRW A;  5CJ7 A;  3C2M A;  1LKY B;  4UQG A;  1FO4 A;  4MEX A;  5DB9 A;  5ALL A;  3M9M B;  2HBK A;  1F44 A;  2K4P A;  4R66 A;  1JIH A;  4KX5 A;  5J0O A;  4NV0 A;  5III A;  1T94 A;  2F44 A;  4RPY A;  2W43 A;  4UAV A;  4EYI B;  1S5L U;  4F71 A;  1ZQW A;  4YXJ A;  3TQ1 A;  3HJE A;  5IIO A;  2ASD A;  4KIT B;  3GV5 B;  2AU0 A;  3ZDC A;  2KN7 A;  1HUZ A;  1XSL A;  2W7P A;  4I2D A;  1BNP A;  4O5C A;  4IR1 A;  1VLB A;  3H4D A;  3Q8R B;  3QUQ A;  4TUS A;  4IQT A;  2UVW A;  3Q8K A;  3ETR A;  3JPQ A;  4EBD A;  4Q8E A;  3PR5 B;  2OYY A;  4J03 A;  1RZT A;  4R8U A;  3SI8 A;  3TFS A;  3QNM A;  4UAU A;  9ICT A;  2OXO A;  1XU4 A;  3MR3 A;  1ZQL A;  2IA6 A;  2FI1 A;  4UAZ A;  1FEZ A;  2ATL A;  5AKE A;  4RUC A;  4KLM A;  2ALZ A;  2W3S A;  5AM4 A;  5AKL A;  4C7Z A;  2O6K A;  3N97 B;  2EZZ A;  1PVR A;  3EYZ A;  3UMG A;  1SL2 A;  2YMP A;  3AN1 A;  5AK3 A;  3RTV A;  1S97 A;  3G6V A;  9ICV A;  1ED1 A;  7ICV A;  5EWF A;  1TK0 A;  2LYA A;  3F5A A;  2AGO A;  4DS5 A;  3RB3 A;  4F91 B;  4KLL A;  1B0X A;  3PV8 A;  1U4B A;  1S0V A;  2K8A A;  1PK1 B;  2DKZ A;  3MAB A;  2J6T A;  4EX7 A;  1D8Y A;  1IG6 A;  4B9M A;  4GXK A;  1S0N A;  4GC6 A;  5T14 A;  2K8C B;  2IHM A;  2LM1 A;  4DFD A;  4DLE A;  4IQV A;  4QZC A;  1ZYQ A;  1T3Q A;  2C28 A;  4EX6 A;  1WUD A;  2FDR A;  4PHP A;  1HIW A;  3TFR A;  4QZB A;  7ICG A;  4QWC A;  1S0O A;  3OJS A;  4DF4 A;  4FS1 A;  3PML A;  2GWS A;  3OPX A;  4UBB A;  3V7K A;  2FJ6 A;  1SZP A;  1L7O A;  4NM1 A;  4EZ9 A;  5KFT A;  1QLN A;  1X40 A;  1Y88 A;  3RRG A;  2RRD A;  5KG1 A;  5KG6 A;  4Y2Y A;  2B6G A;  1V9P A;  3C2K A;  5AKI A;  1ZRN A;  4NLB A;  5J0U A;  2ZXI A;  4RQN A;  4IC9 A;  2LBO A;  1D8L A;  4IQU A;  1DOQ A;  2E8P A;  1TE2 A;  4RU9 A;  3UQ2 A;  1CI4 A;  1LB2 B;  1Z00 A;  3HKZ F;  7ICH A;  5AKG A;  3C28 A;  3T5J A;  2W9B B;  3RJF A;  1ZQZ A;  5AK5 A;  5DG8 A;  3ICX A;  1ZQQ A;  2EAM A;  3CP8 A;  2N1R A;  3C5G A;  1YZ7 A;  3D2N A;  4F2S A;  3WK6 A;  4P0P A;  7ICF A;  4NL9 A;  5KFN A;  2D6F C;  3BQ1 A;  4QZ9 A;  4I2G A;  3RJI A;  2RDI A;  9ICP A;  3PZP A;  2KJ8 A;  4DCC A;  4DL5 A;  1QQ7 A;  2PFN A;  2HHV A;  1N63 A;  3GV8 B;  9ICC A;  1O03 A;  2FPK A;  4QW9 A;  4HAI A;  4GXI A;  3OJU A;  4ED6 A;  2RP5 A;  1QSL A;  4RNO A;  3QYP A;  5ALZ A;  2IMW P;  3T5H A;  2Z7J A;  1KL9 A;  1ZQV A;  4PZO A;  2EDU A;  5DGA A;  2ES6 A;  3MGH A;  4UB1 A;  2HHS A;  4F93 B;  5L9X A;  4BJQ A;  4ECT A;  5C5J A;  3G6X A;  3QUC A;  4B6J A;  2BCS A;  5GTI U;  5J0Y A;  3GIL A;  3PW2 A;  1U47 A;  4KLE A;  3BQ7 A;  3LDA A;  1RDF A;  5ALU A;  4O3M A;  5DBB A;  9ICE A;  4QZF A;  5ALH A;  5ALN A;  4DQQ A;  1X9W A;  1X9M A;  2ZJA A;  2KE7 A;  2HBJ A;  2E8O A;  5HR6 A;  3ZDB A;  1D9D A;  7ICU A;  4FZL A;  5KG0 A;  2AGP A;  2V4R A;  5AI9 A;  1XO1 A;  2JR5 A;  3K75 D;  1Q3V A;  1RYS A;  2KZZ A;  1SKS A;  4KMO B;  2ZIW A;  2LI6 A;  3HKZ C;  3NVV A;  5DG7 A;  2ZG6 A;  2H3Z A;  5DBA A;  2R8H A;  7ICJ A;  1ZOL A;  3E58 A;  5DB8 A;  1V97 A;  1C7Y A;  4QZ8 A;  2W03 A;  1NK4 A;  4BX9 C;  5J2D A;  2C22 A;  3EWA A;  4DLG A;  5ALV A;  4PHA A;  2V4Q A;  2E1F A;  1ZET A;  4ACO A;  4ED8 A;  4PGQ A;  5DLF A;  2P6R A;  4ELU A;  5HML A;  3TAC B;  2ODG A;  2VIX A;  2RLT A;  3K1R B;  5DDM A;  5KFL A;  5G5G A;  3PX6 A;  1DGS A;  3F5E A;  2BDP A;  4YR2 A;  1URJ A;  4BUG A;  1ZQN A;  3C29 A;  5KT4 A;  3F2B A;  2ZUB A;  3EPI A;  1V85 A;  2UVU A;  3HRD D;  3NVZ A;  3OSN A;  2PI4 A;  5ALX A;  4FFD A;  5FP0 A;  2JGA A;  1SKR A;  4Q8F A;  3RAQ A;  3OTQ A;  1Z19 A;  1QH9 A;  1NKB A;  3IDW A;  2RQ5 A;  1KLN A;  9ICW A;  4Q45 A;  1ZQO A;  1SZH A;  2W54 A;  3H8W A;  2EAN A;  5J2A A;  3AM9 A;  3BZK A;  8ICE A;  1RG6 A;  7ICQ A;  2M9N A;  4I2A A;  1KEJ A;  4RNN A;  5AKZ A;  5DLG A;  2EAP A;  1P7D A;  1YT3 A;  3Q8S B;  3RJK A;  1A6S A;  3S6J A;  4KN7 A;  1ZQP A;  1IM4 A;  2KIV A;  1K1Q A;  3SMV A;  3L4P A;  3AUO A;  2K4I A;  2JRZ A;  1ZJN A;  3RJH A;  1ZQJ A;  5CR0 A;  4DF8 A;  3PR4 A;  2ZUD A;  3C2L A;  4LZG A;  3AU2 A;  4QWD A;  1U45 A;  3O0F A;  4JV0 A;  4AYB F;  5EWE A;  3I28 A;  1PUZ A;  2PXI A;  5KT5 A;  5KFK A;  4RQ2 A;  3F53 A;  3KOO A;  1L3S A;  3MFH A;  1QCK A;  5ALQ A;  3OSP A;  2ZIX A;  2FLP A;  3WK8 A;  3D6J A;  4JMU A;  5HMM A;  2XCA A;  3SEI A;  2FPM A;  2WF7 A;  1SWV A;  4KN4 A;  8ICX A;  1S0M A;  5AM3 A;  2KFN A;  4TUQ A;  3RRH A;  2F76 X;  4YR3 A;  2JMG A;  4B9N A;  5ALG A;  1U48 A;  2G5H B;  2KNJ A;  2YB4 A;  5EOZ A;  4UAW A;  3MR2 A;  1SV4 A;  4QNL A;  5ALF A;  4C7Y A;  3BS5 A;  1WCL A;  5J2H A;  4M04 A;  2MU2 A;  1ZQE A;  4KLG A;  2F1H A;  2QB0 B;  2Y1I A;  4ICA A;  2KOB A;  5AKY A;  3OGU A;  9ICF A;  8ICJ A;  3BQ2 A;  2GOL A;  2A19 A;  1TAU A;  3KBB A;  2WHE A;  4FO6 A;  2HOQ A;  2XVT A;  4CF3 A;  4O9M A;  1Z4O A;  5DKW A;  4F4X A;  3B9J A;  4QW8 A;  2W7O A;  3RR8 A;  3VCB A;  1NJW A;  5AM1 A;  4ECX A;  2Y9T A;  5ALJ A;  1KDH A;  5EE3 A;  9ICL A;  4QZH A;  3ZD8 A;  4O3R A;  1UPH A;  5HNK A;  4AYB C;  4RT3 A;  1QQ6 A;  2NRX A;  3FM9 A;  1EXN A;  5L1K A;  3TAP A;  2BPF A;  2KEY A;  2JEJ A;  1X6I A;  2OWO A;  5TIS U;  9ICS A;  2FE9 A;  4J9K A;  3GIJ A;  1S9F A;  3NTU A;  1BNO A;  4RQM A;  3WKB A;  5KFU A;  2BHN A;  4ECW A;  4F8R A;  1IV8 A;  1MQ3 A;  4C0Z A;  1SV0 A;  2H3Q A;  2A1A A;  2Q4T A;  2HCF A;  5J2E A;  1NZP A;  1F5S A;  1NKE A;  2XGQ A;  3QX7 A;  3T5K A;  3N28 A;  5KFE A;  3ONN A;  1DGJ A;  1JUD A;  2E8N A;  3SQI A;  1XC9 A;  3PW0 A;  2KKP A;  1X66 A;  4Z6E A;  4IR9 A;  4O5E A;  3RF9 A;  4Y2S A;  7ICM A;  1X42 A;  4I28 A;  5JTI A;  1JRO A;  4DL7 A;  4PL2 A;  4IRC A;  2KVS A;  2WAQ F;  1ZQF A;  4KTQ A;  5IIL A;  4MEY A;  7ICK A;  1N61 A;  4Y2X A;  4M9L A;  4UB3 A;  3L3F X;  4CE6 A;  4TQS A;  1CEZ A;  4EEY A;  1RPL A;  1JN3 A;  4DFJ A;  1L7P A;  3TKA A;  3WK5 A;  4PHD A;  3H0M B;  2KZM A;  2LMR A;  1NI3 A;  4M9G A;  4MFA A;  1CUK A;  4RQ6 A;  1CRX A;  4NLK A;  4C8L A;  4KLI A;  2UVR A;  1NZB A;  2ZIV B;  1COO A;  3CW2 C;  1A0P A;  4LJX A;  2AQ4 A;  5D46 A;  5EE0 A;  2HHX A;  2W8K A;  3JPN A;  3AU6 A;  1FFU A;  4RQ1 A;  4EEN A;  3TAN A;  4C4R A;  2AHO B;  4DL4 A;  4CCH A;  4K4H A;  3M1Y A;  5JRT A;  5KFV A;  3E2E A;  4RQ4 A;  1FIQ A;  8ICN A;  1L3V A;  4DFK A;  1TKD A;  1JAL A;  1UCV A;  1PK3 A;  9ICX A;  4FS2 A;  3NRW A;  2XID A;  5J0T A;  1JI7 A;  3H0L B;  2OEH A;  7ICE A;  4DSJ A;  2OCE A;  1SWW A;  2KIC A;  4ED0 A;  1KQQ A;  2UVV A;  3QUB A;  4ECZ A;  3ISD A;  2HI0 A;  5IIN A;  4F5N A;  2WAQ C;  2HBM A;  3QUT A;  4YMO A;  3QZ7 A;  3GII A;  4DSE A;  4FZM A;  1SB3 C;  2YMQ A;  3EUB 2;  7ICI A;  3NGD A;  3M8R A;  1TV9 A;  1X6J A;  3QU5 A;  3RH6 A;  2BCV A;  5J8Y A;  5L1L A;  5KFG A;  1IXR A;  2YY6 A;  4ELV A;  2R18 A;  5J0Q A;  2HW3 A;  3N4M B;  5AI8 A;  4R64 A;  4AP9 A;  3Q8L A;  3UQ0 A;  8ICQ A;  4X5V A;  7ICS A;  4QWE A;  1ZQB A;  2R8K A;  2NO4 A;  3KTQ A;  2KJ5 A;  1Z3E B;  4F4Z A;  5CWR A;  3LWM A;  5KFD A;  4ED1 A;  2AH5 A;  1JRP A;  5A0L A;  4DQI A;  3GZF A;  2E1E A;  2WFA A;  1ZD2 P;  1K5O A;  2KIW A;  4P0Q A;  5AI0 A;  1NJZ A;  4ZOH C;  3LVV A;  4PGY A;  5J2K A;  5KG7 A;  3WKC A;  5AIB A;  1ZJM A;  1L7M A;  4P4M A;  2HMX A;  4F4Y A;  3PW7 A;  3UXO A;  2XY5 A;  8ICF A;  2DBY A;  2NO5 A;  4DL3 A;  3KD3 A;  4XA5 A;  3JPP A;  3BQT A;  2NRZ A;  4BXO A;  3EZ5 A;  4OCZ A;  3KZX A;  3WKA A;  5ALT A;  1ZQT A;  4IRK A;  4EBE A;  1NJX A;  5ALP A;  4UW9 A;  5DBC A;  2ZTD A;  8ICG A;  8ICK A;  2HVI A;  4F92 B;  1ZQA A;  3IG8 A;  3C23 A;  1XWL A;  3IG5 A;  3UM9 A;  4Q43 A;  3CRX A;  2MUT A;  5KG5 A;  5ALE A;  4Y2U A;  1Z1V A;  3DDH A;  1KRP A;  2B0C A;  2DPI A;  5CP2 A;  9ICO A;  4KX3 A;  2GH1 A;  3JPO A;  3H8S A;  3MR6 A;  4J9N A;  2QAR A;  4IRD A;  5ALS A;  1NOM A;  1RM6 C;  3L5K A;  2LKY A;  5ALR A;  2JEG A;  3ZDA A;  3H40 A;  1UT8 A;  2KP7 A;  3KHG A;  2EZY A;  3RJE A;  5IIK A;  4Z6C A;  4YXM A;  2I9G A;  3WU2 U;  4JUZ A;  5HR7 A;  1XSN A;  4JWM A;  4J9Q A;  1MQ2 A;  3H8J A;  2ASL A;  5B66 U;  1L7N A;  1L5U A;  5ALD A;  8ICO A;  1PVQ A;  1VDV A;  3RJJ A;  4QWB A;  2VA3 A;  1A76 A;  2G0A A;  4UBC A;  4TUP A;  1SL1 A;  2I6X A;  3WK7 A;  2FMP A;  2R8G A;  4B9S A;  9ICJ A;  4O3N A;  3M6Z A;  3M6K A;  1V38 A;  4HYK A;  3T79 A; 
#chains in the Genus database with same CATH homology
 4OJP A;  2G08 A;  2VJ4 A;  2DF4 B;  1ZQ1 C;  3AQE A;  1KBU A;  2MRL A;  1XNS A;  2JH1 A;  3ICX A;  3KFU F;  2E1F A;  2G06 A;  3CP8 A;  2ZIX A;  4ACO A;  1OUQ A;  1PVR A;  2N1R A;  4QIW F;  5KL1 B;  2ZIU B;  4OJ6 A;  2KKV A;  2A3V A;  4GFJ A;  2KHQ A;  3NUQ A;  3MGV A;  3RFA A;  2CN1 A;  3D2N A;  3DEE A;  3KZX A;  2KJ9 A;  4JMU A;  3NRW A;  3SAF A;  3F2D A;  2K89 A;  2XID A;  4P0P A;  3ONN A;  3IN5 A;  2D6F C;  3H0L B;  3SQI A;  2VIX A;  1ED1 A;  2F77 X;  2WB1 C;  2Y0S C;  2LYB A;  2HOI A;  2LYA A;  3F5A A;  2ZIV A;  2KKP A;  2H3V A;  2F76 X;  2KIC A;  2K4H A;  3IG8 A;  2F2A B;  1Q3U A;  3PZP A;  2JMG A;  2KJ8 A;  2XI9 A;  2E5S A;  1L6N A;  3RF9 A;  2Y0S F;  2WB1 F;  3IG5 A;  4FZN A;  2H3F A;  2OM6 A;  3F5E A;  2BDU A;  4FE3 A;  2G5I B;  2G5H B;  2KNJ A;  2YB4 A;  3LYS A;  2PMZ C;  1URJ A;  2HBM A;  2JHD A;  2WAQ C;  2CPR A;  4BUG A;  2K8A A;  2K4E A;  3F2C A;  3CRX A;  5CRX A;  2RP5 A;  4PL1 A;  3C29 A;  4QNL A;  3F2B A;  2YB1 A;  4FZM A;  3PSI A;  3SAG A;  4PL2 A;  2K8B B;  2Z7J A;  1MA7 A;  2CRX A;  2DGZ A;  2M0N A;  2PMZ F;  2K8C B;  2WAQ F;  5T14 A;  3K1Z A;  3LVW A;  3E0F A;  2G07 A;  2KHV A;  2VKQ A;  4U6P A;  1DRG A;  2HBK A;  1F44 A;  2ZIU A;  2DQN B;  2GH1 A;  3IP4 B;  4KX3 A;  4KX5 A;  4BJQ A;  4P0Q B;  2KV2 A;  1WUD A;  4NV0 A;  2JGA A;  1T94 A;  2KOB A;  2ZIW B;  3L3F X;  4ICA A;  4WJ3 B;  1HIW A;  3M7D A;  3PSF A;  1Z19 A;  3N7S C;  5C0Y A;  2LKY A;  2GOL A;  2R18 A;  3VC8 A;  1D8B A;  1SZH A;  2ZXH A;  2G09 A;  2HOQ A;  5KL8 B;  2XVT A;  4O3M A;  3H0M B;  4NWI A;  2RHF A;  3PST A;  3OPX A;  2XIC A;  2JH7 A;  1TAM A;  4CDG A;  2W7O A;  2W04 A;  3ALR A;  3VCB A;  2KJ5 A;  2H3I A;  4OJ5 A;  2W7P A;  2HBJ A;  2ZIX B;  4NLC A;  2RRD A;  3SAH A;  2MA1 A;  1P7D A;  2VJ5 A;  1YT3 A;  2NV3 A;  1CRX A;  3D2S A;  3AL0 B;  5HR6 A;  4U7C A;  5HR7 A;  5A0L A;  1A6S A;  3H0R B;  4FZL A;  3PSP A;  3GZF A;  4CGZ A;  3SMV A;  2E1E A;  4P0P B;  3CYM A;  1IIP A;  2K4I A;  2KD1 A;  2HOF A;  4A8E A;  1XO0 A;  1UPH A;  1NZB A;  4NLB A;  4AYB C;  1Q3V A;  1HEK A;  2KIW A;  2ZIV B;  4OJL A;  4OO1 J;  2ZXI A;  3N7R C;  1A0P A;  4KMO B;  4P0Q A;  4IC9 A;  3GU3 A;  2KEY A;  1PVQ A;  2OYY A;  2ZIW A;  2LHT A;  2LBO A;  3O0F A;  3HKZ C;  3LVV A;  2F8L A;  3AQF A;  2ZG6 A;  2YX8 A;  2H3Z A;  4OJO A;  4AYB F;  2OXO A;  2G0A A;  1PVP A;  1GO3 F;  2OH2 A;  2HBL A;  3HKZ F;  2W03 A;  2HMX A;  3M6Z A;  3C28 A;  2KVC A;  3M6K A;  4C0Z A;  4BX9 C;  4QJF B;  2H3Q A;  4QIW C;  1ECW A;  3F53 A;  3D2Q A;  3N7P D;  1Z1B A;  3T79 A;  4CRX A;  2Q4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...