1SZHA

Crystal structure of c. elegans her-1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
STLTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNLMTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Caenorhabditis elegans HER-1 and characterization of the interaction between HER-1 and TRA-2A.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
molecule keywords Her-1 protein
total genus 58
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09232 Caenor_Her-1 Caenorhabditis elegans Her-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.360 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA01
1.10.150.370 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA02
1SZHA
chains in the Genus database with same CATH superfamily
3RB4A 4EEYA 2V9WA 4DQRA 5ALTA 1RQNA 3F5EA 1NKCA 1JXLA 3JPPA 5JRTA 3H7IA 3WK9A 4Z6EA 4YFKA 1URJA 3BQ7A 2BZFA 4B9MA 4PPXA 3LYSA 4IRCA 4Y2PA 2WF5A 4R63A 4Y2VA 3DEEA 1XO1A 1SL1A 1KFSA 2Y0SF 2FLPA 1ZOLA 5ALWA 5KFUA 4TUQA 4QZBA 3C2LA 4M9GA 9ICIA 2BPCA 1WWVA 3ORYA 5KG4A 2W9BB 4DFPA 1YZ6A 2ZUCA 1YZ7A 3QE9Y 3ETLA 3UPQA 2EDUA 3MGIA 3LVVA 3N4MB 5A0LA 5J8YA 2LMRA 1KFTA 4UBBA 1VJ5A 2DWQA 1BPZA 3TFSA 2G06A 3Q8KA 1S9FA 2NRTA 4RPZA 2IOHA 4BXOA 4QZFA 4UAVA 4QWDA 3N97B 3JPRA 4FZMA 1NK7A 4RQ2A 3PX0A 1TAMA 4CF4A 3KBBA 4ECVA 2KIWA 5GTHU 5ALVA 3LWLA 4RQ3A 1YT3A 4FBUA 3ZDCA 4RQ4A 2J6TA 8ICWA 1MC8A 1SV0A 3WK4A 3PW4A 2LHTA 5AI5A 1D9DA 4DL4A 4O3MA 3ISBA 8ICNA 2HHQA 3GIMA 4KLGA 2DUYA 3V6HA 2JZBB 5E79U 2R18A 2BDPA 4RQMA 4QJFB 3BQTA 4KN7A 5J2HA 3QEAZ 4KX3A 4QZAA 5KG7A 3RB0A 4O3SA 2LI6A 1U9LA 4DSJA 2F77X 3NASA 2W54A 3NVVA 1S0OA 2JMGA 2ES6A 5AKKA 5IINA 4NM1A 2W7OA 2BQRA 5DB9A 4JMUA 7ICPA 2PFOA 1OXJA 4G9BA 1X42A 3ZDBA 4O9MA 2W03A 4QWEA 1RM6C 2JZBA 2HHWA 4F4XA 3T5JA 3H40A 4NL9A 3TI0A 4C4RA 1HUOA 3AMZA 7ICOA 9ICEA 4XUSA 1V38A 4RQ1A 4FO6A 1F5SA 5ALRA 2H5XA 3ETRA 4E0DA 2R8IA 1N5XA 3M6ZA 4NLBA 4Y2UA 1SKSA 2VA2A 1ZQLA 3HILA 3Q8MA 4XA5A 1L3UA 4DSLA 2QKQA 1SZHA 4UB4A 7ICVA 8ICGA 1Q8KA 4DQIA 1ZQJA 1Z19A 2RQ5A 4C8KA 3SV4A 2QB1A 1COKA 1A77A 4KLJA 1MQ2A 2UVVA 4BXOB 1A0PA 1NK6A 3ZD8A 4CF5A 5KL8B 1JIHA 2JH7A 3RB6A 1N56A 1NOMA 4JUZA 4I2HA 1Q46A 2QB0A 4ZH4A 5J2JA 4RQ0A 4DS4A 3MR2A 4MF2A 1WCLA 4Q44A 3ISDA 8ICVA 1N61A 1KBUA 2XVTA 5KG2A 3BQ0A 4PZOA 5KT6A 2ISOA 4R65A 4KLQA 2DF4B 4TQRA 3QU7A 8ICBA 4NWIA 4O3OA 4DLEA 3GQCA 4I2CA 3F2BA 3PZPA 5CWRA 4USAA 2AQ0A 4DFDA 2KFNA 5AKIA 5KT5A 2ISPA 2HOFA 3K4GA 3BQ1A 5AI6A 3TKAA 3UQ2A 3I76A 3THVA 3RH6A 2R8HA 4ELVA 3LK9A 1L3TA 3NGDA 1XSLA 4I2JA 3MGHA 4P0PA 1D8YA 3WU2U 2HOQA 4Q8EA 4F5PA 4KLMA 2ZIWB 4PGYA 1X2IA 3V7KA 8ICHA 2BCUA 1WYGA 2KE7A 4DSIA 4PHEA 2BKEA 3WKBA 2AH5A 3BS5A 3NTUA 1KQQA 4TURA 3N28A 1U45A 4K4HA 2C2DA 5ALUA 4KLSA 1ECWA 4QZ8A 2RLTA 4NXZA 1J2NA 1ZXIA 5KFXA 2UVRA 1L7NA 3AL0B 4CNQA 3RJKA 2WF8A 3H8JA 1SGGA 3E2EA 1Z00B 1T3QA 3DDHA 3H8MA 3K1RB 3L5KA 1XWLA 2E3TA 2KSOA 5BPCA 2H3ZA 1PZNA 1SB3C 1U47A 3PSIA 1KN5A 2J6SA 2WTFA 2W55A 2XY5A 1C7YA 2KFZA 4F4WA 4J9OA 1HJPA 3KOOA 2PMZC 5EWEA 1ZQCA 4Y2SA 2Y9TA 1Z1VA 2YMLA 1PK3A 4J9LA 4PL1A 4PZNA 4CE6A 1MSWD 2B21A 3NVYA 4KLHA 3JPTA 5B5EU 1ZD5A 3OHBA 2D8CA 5J0RA 1MA7A 4DFJA 1UHUA 4M9NA 3KZXA 5AKGA 4GFJA 2NYVA 2WHEA 1IG6A 5HR6A 5J2GA 2ASJA 7ICGA 5DB6A 5KTQA 3M8SA 2W7PA 2R8GA 2W9BA 8ICKA 2XC9A 1L3SA 4I2BA 2KSOB 2KZZA 1OW5A 1RYSA 1RYRA 1J2MA 4R64A 4DLGA 5KFOA 3L3FX 2HMXA 2R8KA 2A1AA 5AI4A 5KFCA 3NUQA 3PSTA 3RJGA 2IA6A 1N63A 4Q45A 3RJFA 5KFRA 3V7LA 1JROA 1NZBA 3V6JA 1JRPA 1PK1A 3OSNA 5L1KA 5KFSA 5J0SA 5HMMA 5CEHA 2W3RA 3ISCA 1C20A 4P0QA 2HHVA 2K4IA 3EWAA 2BCSA 5D4BA 2KOBA 1B43A 2EZXA 1WWUA 4B9UA 2YX8A 5KFLA 1N48A 2OEHA 9ICNA 3ZDAA 1TAQA 2H3QA 5F9NA 2ZTDA 5DKWA 3T5KA 4F91B 4YD2A 3F2DA 4WJ3B 2P66A 3IDWA 2KN7A 4EZ9A 1DK3A 4DWIA 2KV2A 4EX6A 4YD1A 4G3IA 1BNPA 2P6RA 3RJEA 4ED7A 1JALA 4EZ6A 4JWNA 1LKYA 3TACB 3Q8RB 3HKZF 3QZ8A 3CNHA 5KNIA 3QX7A 2K8BB 1ZQOA 1PVPA 2QARB 1F0MA 4LJXA 3OPXA 5KFJA 5ALEA 2CPRA 2JEFA 2OXOA 7ICRA 2KJ9A 5DQGA 5KFEA 4LZGA 4OO1J 3SV3A 1GO3F 2KICA 2LYHA 5G5GA 4F93B 2VJ4A 4KX5A 2ALZA 5J0OA 7ICIA 4CDGA 1JMSA 1X6JA 4OJOA 9ICVA 3UMCA 4BX9C 4DS5A 4ECUA 2ZIVA 1IV8A 3OTQA 2YY6A 4F2RA 2LM1A 2ZIUB 3F2CA 4DL3A 3UXNA 4UBCA 4UATA 3AM9A 1T3NA 3IRUA 3PY8A 3JPSA 5G5HA 5J2DA 3TADC 1XS9D 4GIBA 1T7PA 4Y2JA 1MQ3A 4EYHB 5AKJA 4YMMA 3RRHA 4UAUA 2F8KA 4ED0A 5L1MA 1S0VA 3IM1A 3AEVA 4BGDA 8ICYA 3ZDEA 4PGXA 2WFAA 1XSNA 4B9SA 4KLEA 4EBDA 1QQ7A 4EEKA 4NLCA 4J9NA 2HHSA 2BGWA 4Q8FA 1BPEA 5DG7A 4BJQA 1B0XA 3TAQA 3WKAA 4DSFA 4MEXA 2IHNA 2MRLA 4NY8A 1N62A 4FBTA 4US9A 4Z6CA 4FS1A 1ZQZA 2M0NA 3VCBA 2DPIA 3PV8A 4GC6A 2YQEA 2XICA 2BCVA 1SL2A 4F92B 4I27A 1KLNA 2NRWA 5ALLA 1NKEA 1T8EA 1NNLA 1Y88A 4O3NA 5KAIU 4YR0A 2EAMA 3FDSA 2DKXA 3H0RB 1D8LA 7ICMA 4PHDA 3SI8A 2HCFA 2KZ3A 4UW9A 3AU2A 3CW2C 3GV7B 5J0UA 1ZQKA 3OGUA 4R8UB 1J97A 3SAFA 4C8OA 3FM9A 4C80A 2MU2A 3MR5A 5BOLA 3PW7A 2JRZA 2LPEA 4DOBA 1IM4A 3OHAA 4MEYA 2UVUA 3QUQA 1ZQXA 1LVHA 4CGZA 5DLFA 2Z7JA 3RBEA 4YR2A 5J2AA 2GLEA 3Q8LA 3C5FA 3EZ5A 3NVWA 4Y2YA 2E8OA 1RXVA 2HI0A 1S0NA 4LVSA 3F53A 4FS2A 2EZZA 5CR0A 1BVSA 1DRGA 1T94A 1QQ5A 4QZGA 5ALFA 4DSEA 1TVAA 2QB0B 9ICJA 2LYBA 8ICZA 2G0AA 1ZQBA 4QIWC 8ICQA 4NJ8A 2FLNA 1TV9A 2A19A 3ONNA 3WKCA 8ICTA 4B9VA 5J0PA 3I1YA 9ICTA 4P0PB 4GXJA 3CYMA 2J6UA 3RR7A 5KT4A 4IRDA 1XO0A 2NRXA 2F3NA 9ICPA 3MFHA 2NO5A 2Y1JA 4A8EA 2WAQF 4J9KA 4PHPA 3RJJA 3T79A 3WKDA 2BPFA 2PI4A 3PW2A 4M6WB 1Q3UA 4MHVA 4UAYA 3D2QA 4BWJA 2HBMA 7ICJA 9ICSA 3C5GA 5KFQA 3C1YA 2FLLA 1LB2B 3C23A 3LVWA 4HYKA 2PFNA 4C7ZA 2PXIA 3BZKA 3Q8QB 2PMZF 2ZUBA 2AGQA 2KK0A 2KD1A 2AXTU 4ECYA 1JUDA 2YTUA 3RTVA 4DFMA 1D9FA 2WAQC 1DXSA 4F5RA 1PVQA 1ZJNA 2UVWA 2HOIA 2KZMA 1SV4A 8ICRA 4F8RA 3BDPA 4O3QA 5KL1B 5L1JA 1HIWA 2ZUDA 2G5IB 1O03A 7ICSA 4F3OA 4RT3A 7ICHA 1BPDA 3HJEA 2K4PA 4C0ZA 2JGAA 4CF3A 5IILA 3RR8A 3KHGA 5EE3A 4I28A 3AQFA 3HX0A 5KFDA 4F72A 5KFYA 4C4SA 5AK5A 3KZIU 1RG6A 5IIKA 4Y2QA 4AYBC 4J9MA 3E0FA 2KKVA 2XY6A 2HVHA 4DL5A 3NVZA 2XI9A 3FC4A 2DPJA 2I9GA 2W3SA 1NI3A 7ICLA 1KRPA 2K4HA 5EE9A 1X6IA 2C28A 1TK0A 2FMQA 1TK5A 4P0QB 4IQWA 4ECTA 5CA7A 4RPXA 1RYUA 5GTIU 8ICPA 1X9XA 4O0IA 3MABA 4TUPA 5FP0A 3TADA 5AM2A 4O5EA 3TFRA 2G08A 4YXMA 2RDIA 4P4OA 3G6YA 4PH5A 4PHAA 3M8RA 5ALOA 3RAQA 7ICQA 4UAWA 2A3VA 2W8KA 3QU4A 3UXPA 4EBCA 1KEJA 3BS7A 3B0YA 3EUB2 3T5LA 2EAOA 4JV0A 4F5NA 5AK4A 3QUBA 1BGXT 3EPIA 5AI8A 4NL9C 4O3PA 4M6WA 3N7PD 2XCAA 2NO4A 2WB1F 1NK5A 7ICEA 2YMPA 2H3FA 2C2EA 1L3VA 1JN3A 4I2IA 5CP2A 2BHNA 1SV0C 5EWGA 1UPHA 4ED8A 5CRXA 2QLTA 4C8LA 4C8NA 4QZIA 3QZ7A 1QSYA 9ICCA 3HP6A 1ZQSA 1SKRA 2VIXA 2OM6A 5J2FA 2MAXA 4F71A 5HP4A 9ICGA 3RRGA 4TQSA 4MFFA 4IC9A 4Y2RA 1KDHA 1IXRA 2Y1IA 3RAXA 5DB7A 2HBKA 2F1HA 4IR9A 4B9TA 2HBLA 2VJ5A 5J2KA 2Y0SC 4ZOHC 2I5HA 4UB8U 3GILA 1JI7A 1N60A 3AQEA 1T4GA 3HRDD 2G07A 3FAHA 3KFUF 4AP9A 3M6KA 4QIWF 5AKLA 3HT3A 2H3IA 2PFQA 2FPKA 2F8LA 3D6JA 1RQLA 3GZFA 4RUCA 4UARA 2ZXHA 3PSFA 1FEZA 5ALPA 3OJUA 3HPOA 4YR3A 3C28A 5KFTA 5T14A 1HUZA 3L4PA 7ICNA 1BNOA 4KLTA 1ZQVA 4EELA 2AU0A 3PR5B 4JWMA 4K4IA 1O08A 4M2YA 4KTQA 1ZQGA 5KFZA 5DB8A 4ECXA 8ICEA 2ZIWA 3QNMA 4Y2TA 3MFIA 3GFKB 5C5JA 3KD3A 2JHDA 3M9NB 3RJIA 2W11A 4X5VA 3SENA 3KHLA 4QZEA 4NV0A 2IBKA 4KITB 4RT2A 2KP7A 5KFKA 3JPNA 5KG6A 3IV6A 5KG5A 2FE9A 1AROP 1N5WA 2B0CA 5AIAA 4NLZA 2H3VA 3MGVA 3PVXA 2DGZA 1XNSA 3EPGA 2ASDA 1ZQHA 1UA1A 2LYAA 3MDAA 5B66U 3KKAA 4RUAA 4F4YA 2BQ3A 5KFWA 4YN4A 3RH4A 1X9MA 3IHQB 5AICA 3EW9A 2W04A 1X66A 5KFAA 4J9PA 5CHGA 5AK6A 3PW5A 3KHHA 4DQSA 1SWWA 2ATLA 8ICLA 4ED6A 4B9NA 5AM1A 2EZYA 1NK0A 1QH9A 3C2MA 2OCEA 8ICSA 1XSPA 3M7DA 2KEYA 4DQPA 1ZQUA 4JK1A 5DQHA 5AKEA 4QZHA 2ZIXA 4YG2A 2FMPA 2E8MA 2MUTB 1JX4A 2JXJA 2ZJAA 4MF8A 2ASLA 1PK1B 1Q3VA 4DEZA 3EYZA 1HEKA 3A0BU 5KFIA 5KFPA 4I2DA 1ZQTA 9ICUA 1LV5A 5DG9A 4OCZA 3JPQA 2FPMA 1ZQMA 5J0YA 1K1QA 2JH1A 3ED5A 4EX7A 1B22A 5ALIA 1NZPA 4UB6U 1ZQDA 2I6XA 2BCQA 2AJQA 2MA1A 3WK6A 4ECZA 1UQVA 3SD7A 5HMLA 3WKEA 2PI5A 3SAHA 1ZQFA 5KFGA 2FMSA 4F4KA 3SR6A 1DOQA 3MDCA 1H38A 3H4DA 1D8BA 4LZDA 1S76D 4UB3A 5EE1A 2HHUA 1NK8A 4KLFA 4UAZA 1SKWA 4RQ6A 2EAPA 5AI0A 3PW0A 3H4BA 2DBYA 5AM4A 1ZRNA 2Q4TA 2EQYA 3BS5B 3IG8A 4CCHA 5ALMA 3QXGA 3N7RC 2YMQA 3RJHA 9ICXA 4J9QA 5ALDA 4PJ0U 1L6NA 1VDVA 5AKXA 4C8MA 1WCNA 2W9CA 4F50A 3GV5B 5J2EA 3H8SA 4HAIA 1Z4NA 4XQ8A 1SXEA 3RFAA 4ECWA 1NKBA 4JV2A 1V85A 1X40A 4BDPA 3KTQA 2DL0A 1SXDA 4F5QA 4KLDA 2YN4A 5ALQA 1S10A 3RF9A 2PFPA 5HHIA 4U7CA 1AQ6A 4OD0A 4ED2A 2DKZA 4IQUA 4FZLA 1Z00A 3CRXA 3KHRA 4IQVA 2QARA 4IL6U 8ICJA 1F44A 4ECRA 1TFRA 8ICFA 2FPLA 1ZD4A 1VLBA 1EXNA 5DG8A 1K1SA 2C22A 8ICOA 2K4EA 4KN4A 4IQTA 2LKYA 4DF8A 5KG1A 4M9LA 5J2BA 3IN5A 2NV3A 1TKDA 1Z3EB 2G5HB 2I1QA 2ZIVB 2Y9UA 1ZQ1C 4NLNA 2KMDA 3M9MB 5ALNA 3KKAC 5DGBA 3K75D 3AUOA 5TISU 2F2AB 4DOCA 1ZYQA 1QSLA 3QYPA 5DQIA 2BPGA 3IG5A 1CRXA 2E1FA 4EYIB 4QZDA 2BR0A 3T3FA 5DDYA 5DBCA 2EANA 2KKPA 5EWFA 4DQQA 4F2SA 1NJYA 2HW3A 5AI9A 2RP5A 1Z1BA 4QZ9A 2JEGA 4KMUA 1TAUA 3GIKA 1K5OA 1NJWA 1DK2A 2ZTEA 4CRXA 4RQ5A 2F76X 1ZRMA 2OYYA 4RNNA 3SYZA 1NJXA 4I2FA 3O0FA 3QU5A 1ZJMA 2C2RA 4I29A 2K89A 5ALXA 1L7PA 2E5SA 5ALGA 4J9RA 1KKXA 4Z6FA 2F1JA 2PKEA 2ZJ8A 3R9KA 2XIDA 5CJ7A 1ZQNA 1RPLA 2VKQA 4NLGA 2P35A 3HKZC 1UT8A 2YB1A 9ICLA 3AN1A 4P4PA 4GLXA 7ICKA 2IMWP 1SWVA 2EH9A 4KLLA 5TZVA 3UMGA 3JPOA 4ECQA 2ZJ5A 3FYHA 9ICHA 4RQ7A 2AGOA 4AYBF 5ALJA 3OJSA 1ZQPA 3RBDA 8ICAA 2AHOB 5EOZA 1BPXA 2DFLA 4XRHA 5J2CA 1X9SA 2KVCA 2WF7A 4DO9A 4JV1A 8ICCA 1V9PA 3QUTA 1COOA 1DGSA 5ALYA 5DLGA 2P6UA 2IOFA 1NK9A 4M9HA 3C1ZA 2W9AA 1L7OA 2ESEA 4YQWA 2KJ8A 5DGAA 2F44A 3DV9A 2JEJA 2Q0ZX 3PO5A 8ICIA 2KNJA 3QU2A 2FI1A 2ZG6A 2GO7A 4RNOA 5BOMA 5AKYA 3U26A 3PMNA 3HWTA 4J9SA 4ICAA 2XCPA 3BJYA 5ALSA 5D49A 1KL9A 4M47A 3ZD9A 4JB3A 1DGJA 2KJ5A 1CUKA 1M6YA 4BUGA 2F1IA 5CB1A 3SMVA 3BQ2A 2A1JB 1QCKA 4PL2A 4M04A 2L5YA 2A1JA 4R8UA 3NRWA 2AQ4A 1S77D 5AK3A 5JU5A 4P2HA 2E8PA 4DSKA 3PMLA 4MFCA 5KT7A 2ZTCA 3NS1A 1ZQWA 4RQNA 4YXJA 2D6FC 3S6JA 2KIVA 1NJZA 4TUSA 5ALKA 1QQ6A 2JEIA 8ICUA 1B4FA 2MSNA 2WF9A 4C7YA 5DBAA 5F3XB 4QNLA 5IIMA 7ICTA 1X9WA 4YCXA 5J29A 5JTIA 1FIQA 4Z6DA 2IHMA 4BWMA 4UB1A 1KFDA 3C2KA 9ICWA 3V72A 4DL2A 2V4RA 1FFVA 5KG3A 3N7SC 2CXYA 4ED3A 4YVZA 2W43A 3G6VA 1NK4A 5AM5A 2VA8A 4K4GA 4KMOB 1U49A 4GXKA 1Z4OA 1JXEA 3TANA 2KG5A 3PNCA 1KW4A 3F5AA 4OJ5A 3Q8SB 9ICOA 2KVSA 4C4TA 8ICMA 4Y2XA 2XO7A 2HHXA 7ICUA 4KLUA 1SIJA 4OJLA 4B6JA 4R66A 2KHVA 5KT3A 4GXIA 3D2NA 5AHXA 5ALHA 5HHHA 4O3RA 3PX6A 1S8OA 3ICXA 3GIJA 1XU4A 5AIBA 4OJ6A 1KSPA 3MC1A 2ZXIA 2AGPA 4KLOA 9ICRA 5KFMA 5KFBA 2YB4A 3B9JA 5D46A 4YP3A 3CP8A 3B0XA 4DL6A 3GDXA 4QW9A 4DOAA 1ZQAA 2YMMA 2R8JA 2NRZA 1PVRA 4RZRA 5JUMA 4NLKA 1FO4A 2O6KA 1QLNA 4IR1A 4EENA 3I28A 1PUZA 3RH5A 4RQ8A 1L7MA 4I2GA 2BCRA 9ICKA 2JR5A 5L1IA 1RZTA 9ICAA 3SZ2A 3QEBZ 5AKZA 2WF6A 1UA0A 1KTQA 3BZCA 4QWAA 2D3DA 5L9XA 2ZIUA 3QU9A 5KFNA 9ICBA 1WUDA 1L5UA 1ZQQA 4DFKA 9ICQA 2OWOA 1L8LA 4FFDA 1U4BA 1CI4A 3IP4B 1L8OA 1UCVA 3HW8A 2K60A 3MBYA 2OH2A 5J0WA 3WK7A 4I2EA 2NRVA 1N2XA 4UQGA 1BPBA 3C21A 4DF4A 4ACOA 2LBOA 2HDOA 4UB5A 2HHTA 2N1RA 4OJPA 5IIIA 4IRKA 3K1ZA 3A0HU 3C29A 3GIIA 2GH1A 2KHQA 3TAPA 1ZD2P 2ODGA 3GV8B 3SAGA 4EBEA 3TQ1A 1ZD3A 3G6XA 2BQUA 4RPYA 4KLIA 1IIPA 4DL7A 5AM0A 5EE0A 2W9MA 4O5CA 1P7DA 3V7JA 1S0MA 3E58A 1RXWA 2M9NA 5KFHA 2LM4A 2K8CB 5ALZA 1QTMA 3J81j 5DBBA 4F4ZA 2KTQA 2V4QA 3WK5A 4RU9A 3MR3A 2GOLA 1RDFA 4UB2A 4M0AA 2RRDA 4QZCA 5IIJA 3ALRA 1ZQRA 3PX4A 1TK8A 5C0YA 5J8YC 2CN1A 3LDAA 5KG0A 3QUCA 2RDJA 1S97A 5K4LA 3PR4A 2WB1C 2XY7A 3M1YA 9ICFA 3WK8A 3PSPA 4U6PA 1ZQYA 3LWMA 3T5HA 4ELUA 1ED1A 2IOFK 4F5OA 3D2SA 4M9JA 2HBJA 2CRXA 2DQNB 1V97A 2OHFA 5HNKA 4YMNA 1FFUA 5J0QA 3OSPA 3UMBA 1BPYA 4YMOA 1ZETA 1U48A 1CEZA 5KFFA 3MR6A 5F9LA 2B6GA 7ICFA 3ZDDA 4QWBA 4ECSA 3RB3A 1SZPA 2W9CB 3AU6A 2FDRA 2GWSA 4I2AA 5J2IA 3UXOA 1SL0A 3Q8PB 4IS7A 4Q43A 2W8LA 3GU3A 4QWCA 5J0TA 3H0MB 2ZIXB 3ZI4A 5KFVA 4US8A 3M9OB 5KT2A 3SQIA 1A76A 3V6KA 4ELTA 4O5KA 1ZQEA 3H8WA 3NRZA 4RNMA 2E8NA 3UM9A 1MN8A 5AKHA 2VA3A 1A6SA 4B9LA 2XGPA 8ICXA 5H2FU 5AM3A 2E1EA 1ZQIA 4FZNA 5L1LA 2VANA 2RHFA 1S5LU 4FE3A 3SEIA 5HR7A 3H0LB 4QW8A 2HVIA 1LKYB 5IIOA 9ICMA 5DDMA 4GC7A 1TE2A 4NM2A 1UT5A 2JV3A 2XGQA 5J0XA 1OUQA 3VC8A 4ED1A 3TARA 1WG8A 2MUTA 2K8AA 5KAFU 1XC9A 4MFAA 1QSSA 4J03A 4P4MA 4UASA 3UQ0A 2G09A 3PO4A 2HSZA 2FJ6A 2BDUA 4PGQA 4DCCA
chains in the Genus database with same CATH topology
2F76X 2N1RA 2KV2A 4OJPA 4OJLA 2PMZC 4P0QB 1KBUA 2H3IA 2KHVA 2OYYA 2XVTA 3CYMA 3D2NA 4P0PB 3F5EA 2F8LA 3K1ZA 3ICXA 2KJ5A 3C29A 4BUGA 2DF4B 1XO0A 3M7DA 2KEYA 2F77X 2GH1A 2KHQA 2M0NA 4OJ6A 1URJA 3VCBA 3O0FA 3GZFA 4NWIA 3RFAA 3SMVA 3SAGA 4A8EA 2K89A 2WAQF 2ZIXA 2ZXIA 2XICA 2JMGA 3LYSA 3F2BA 2E5SA 2ZXHA 4PL1A 3PSFA 4PL2A 3HKZF 3PZPA 3T79A 2YB4A 3DEEA 2G08A 3GU3A 1IIPA 2K8BB 2Y0SF 3C28A 2W7OA 5T14A 1PVPA 1Q3UA 2HOFA 3CP8A 3H0MB 3RF9A 2ZIXB 3D2QA 2XIDA 3OPXA 4JMUA 1Q3VA 4U7CA 1P7DA 3NRWA 2HBMA 2VKQA 1A6SA 3HKZC 2CPRA 2OXOA 3H0RB 1HEKA 2YB1A 4FZLA 3CRXA 1MA7A 2A3VA 2K8CB 2KJ9A 4CRXA 3SQIA 2W03A 3LVWA 4P0PA 3KZXA 1F44A 4OO1J 1GO3F 2HOQA 2KICA 4GFJA 2PMZF 1PVRA 2JH1A 3LVVA 5HR6A 2VJ4A 2ZIWB 4KX5A 2KD1A 3SAFA 2W7PA 2GOLA 5A0LA 4CDGA 2K4EA 2RRDA 4OJOA 3ALRA 2MA1A 2ZIWA 3N7PD 2WB1F 2WAQC 2G06A 4AYBF 4BX9C 2D6FC 5C0YA 2ZIVA 2H3FA 2JHDA 2E1EA 4FZNA 2CN1A 2ZIUB 2LKYA 3M6ZA 3F2CA 4NLBA 4NV0A 4QNLA 3L3FX 2HMXA 3SAHA 1PVQA 2RHFA 2HOIA 4CGZA 4FE3A 4FZMA 2Z7JA 2WB1C 1TAMA 1UPHA 3NUQA 1SZHA 2KVCA 3PSTA 5HR7A 1ECWA 3H0LB 2KIWA 3IN5A 5KL1B 5CRXA 2NV3A 3PSPA 1HIWA 2G5HB 2G5IB 4U6PA 1D8BA 2ZIVB 1Z19A 1ZQ1C 1YT3A 3AL0B 2H3VA 4C0ZA 3MGVA 2JGAA 2DGZA 2OM6A 2VIXA 1ED1A 1XNSA 3F53A 2ZIUA 3N7SC 3D2SA 1WUDA 2LYAA 2F2AB 4IC9A 1NZBA 1DRGA 2HBJA 1A0PA 1T94A 3AQFA 2CRXA 2DQNB 2KJ8A 1OUQA 3IG5A 2LHTA 3VC8A 1CRXA 2E1FA 4AYBC 2H3ZA 2HBKA 2JH7A 2K8AA 2Q4TA 2HBLA 4KMOB 2VJ5A 5KL8B 4O3MA 4P0QA 3PSIA 3E0FA 2K4IA 2Y0SC 2KKVA 2LYBA 2G0AA 3IP4B 2KOBA 2W04A 3IG8A 2KNJA 4QIWC 2KKPA 4NLCA 2XI9A 2OH2A 2LBOA 2ZG6A 2YX8A 2R18A 3AQEA 3F5AA 4OJ5A 4QJFB 3N7RC 2G07A 4BJQA 2G09A 2H3QA 2RP5A 3ONNA 4ICAA 1Z1BA 2BDUA 2K4HA 3KFUF 3F2DA 4ACOA 1L6NA 4WJ3B 3M6KA 4QIWF 2MRLA 4KX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZH A; 
#chains in the Genus database with same CATH topology
 3RB4 A;  4EEY A;  2V9W A;  4DQR A;  5ALT A;  1RQN A;  3F5E A;  1NKC A;  1JXL A;  3JPP A;  5JRT A;  3H7I A;  3WK9 A;  4Z6E A;  4YFK A;  1URJ A;  3BQ7 A;  2BZF A;  4B9M A;  4PPX A;  3LYS A;  4IRC A;  4Y2P A;  2WF5 A;  4R63 A;  4Y2V A;  3DEE A;  1XO1 A;  1SL1 A;  1KFS A;  2Y0S F;  2FLP A;  1ZOL A;  5ALW A;  5KFU A;  4TUQ A;  4QZB A;  3C2L A;  4M9G A;  9ICI A;  2BPC A;  1WWV A;  3ORY A;  5KG4 A;  2W9B B;  4DFP A;  1YZ6 A;  2ZUC A;  1YZ7 A;  3QE9 Y;  3ETL A;  3UPQ A;  2EDU A;  3MGI A;  3LVV A;  3N4M B;  5A0L A;  5J8Y A;  2LMR A;  1KFT A;  4UBB A;  1VJ5 A;  2DWQ A;  1BPZ A;  3TFS A;  2G06 A;  3Q8K A;  1S9F A;  2NRT A;  4RPZ A;  2IOH A;  4BXO A;  4QZF A;  4UAV A;  4QWD A;  3N97 B;  3JPR A;  4FZM A;  1NK7 A;  4RQ2 A;  3PX0 A;  1TAM A;  4CF4 A;  3KBB A;  4ECV A;  2KIW A;  5GTH U;  5ALV A;  3LWL A;  4RQ3 A;  1YT3 A;  4FBU A;  3ZDC A;  4RQ4 A;  2J6T A;  8ICW A;  1MC8 A;  1SV0 A;  3WK4 A;  3PW4 A;  2LHT A;  5AI5 A;  1D9D A;  4DL4 A;  4O3M A;  3ISB A;  8ICN A;  2HHQ A;  3GIM A;  4KLG A;  2DUY A;  3V6H A;  2JZB B;  5E79 U;  2R18 A;  2BDP A;  4RQM A;  4QJF B;  3BQT A;  4KN7 A;  5J2H A;  3QEA Z;  4KX3 A;  4QZA A;  5KG7 A;  3RB0 A;  4O3S A;  2LI6 A;  1U9L A;  4DSJ A;  2F77 X;  3NAS A;  2W54 A;  3NVV A;  1S0O A;  2JMG A;  2ES6 A;  5AKK A;  5IIN A;  4NM1 A;  2W7O A;  2BQR A;  5DB9 A;  4JMU A;  7ICP A;  2PFO A;  1OXJ A;  4G9B A;  1X42 A;  3ZDB A;  4O9M A;  2W03 A;  4QWE A;  1RM6 C;  2JZB A;  2HHW A;  4F4X A;  3T5J A;  3H40 A;  4NL9 A;  3TI0 A;  4C4R A;  1HUO A;  3AMZ A;  7ICO A;  9ICE A;  4XUS A;  1V38 A;  4RQ1 A;  4FO6 A;  1F5S A;  5ALR A;  2H5X A;  3ETR A;  4E0D A;  2R8I A;  1N5X A;  3M6Z A;  4NLB A;  4Y2U A;  1SKS A;  2VA2 A;  1ZQL A;  3HIL A;  3Q8M A;  4XA5 A;  1L3U A;  4DSL A;  2QKQ A;  1SZH A;  4UB4 A;  7ICV A;  8ICG A;  1Q8K A;  4DQI A;  1ZQJ A;  1Z19 A;  2RQ5 A;  4C8K A;  3SV4 A;  2QB1 A;  1COK A;  1A77 A;  4KLJ A;  1MQ2 A;  2UVV A;  4BXO B;  1A0P A;  1NK6 A;  3ZD8 A;  4CF5 A;  5KL8 B;  1JIH A;  2JH7 A;  3RB6 A;  1N56 A;  1NOM A;  4JUZ A;  4I2H A;  1Q46 A;  2QB0 A;  4ZH4 A;  5J2J A;  4RQ0 A;  4DS4 A;  3MR2 A;  4MF2 A;  1WCL A;  4Q44 A;  3ISD A;  8ICV A;  1N61 A;  1KBU A;  2XVT A;  5KG2 A;  3BQ0 A;  4PZO A;  5KT6 A;  2ISO A;  4R65 A;  4KLQ A;  2DF4 B;  4TQR A;  3QU7 A;  8ICB A;  4NWI A;  4O3O A;  4DLE A;  3GQC A;  4I2C A;  3F2B A;  3PZP A;  5CWR A;  4USA A;  2AQ0 A;  4DFD A;  2KFN A;  5AKI A;  5KT5 A;  2ISP A;  2HOF A;  3K4G A;  3BQ1 A;  5AI6 A;  3TKA A;  3UQ2 A;  3I76 A;  3THV A;  3RH6 A;  2R8H A;  4ELV A;  3LK9 A;  1L3T A;  3NGD A;  1XSL A;  4I2J A;  3MGH A;  4P0P A;  1D8Y A;  3WU2 U;  2HOQ A;  4Q8E A;  4F5P A;  4KLM A;  2ZIW B;  4PGY A;  1X2I A;  3V7K A;  8ICH A;  2BCU A;  1WYG A;  2KE7 A;  4DSI A;  4PHE A;  2BKE A;  3WKB A;  2AH5 A;  3BS5 A;  3NTU A;  1KQQ A;  4TUR A;  3N28 A;  1U45 A;  4K4H A;  2C2D A;  5ALU A;  4KLS A;  1ECW A;  4QZ8 A;  2RLT A;  4NXZ A;  1J2N A;  1ZXI A;  5KFX A;  2UVR A;  1L7N A;  3AL0 B;  4CNQ A;  3RJK A;  2WF8 A;  3H8J A;  1SGG A;  3E2E A;  1Z00 B;  1T3Q A;  3DDH A;  3H8M A;  3K1R B;  3L5K A;  1XWL A;  2E3T A;  2KSO A;  5BPC A;  2H3Z A;  1PZN A;  1SB3 C;  1U47 A;  3PSI A;  1KN5 A;  2J6S A;  2WTF A;  2W55 A;  2XY5 A;  1C7Y A;  2KFZ A;  4F4W A;  4J9O A;  1HJP A;  3KOO A;  2PMZ C;  5EWE A;  1ZQC A;  4Y2S A;  2Y9T A;  1Z1V A;  2YML A;  1PK3 A;  4J9L A;  4PL1 A;  4PZN A;  4CE6 A;  1MSW D;  2B21 A;  3NVY A;  4KLH A;  3JPT A;  5B5E U;  1ZD5 A;  3OHB A;  2D8C A;  5J0R A;  1MA7 A;  4DFJ A;  1UHU A;  4M9N A;  3KZX A;  5AKG A;  4GFJ A;  2NYV A;  2WHE A;  1IG6 A;  5HR6 A;  5J2G A;  2ASJ A;  7ICG A;  5DB6 A;  5KTQ A;  3M8S A;  2W7P A;  2R8G A;  2W9B A;  8ICK A;  2XC9 A;  1L3S A;  4I2B A;  2KSO B;  2KZZ A;  1OW5 A;  1RYS A;  1RYR A;  1J2M A;  4R64 A;  4DLG A;  5KFO A;  3L3F X;  2HMX A;  2R8K A;  2A1A A;  5AI4 A;  5KFC A;  3NUQ A;  3PST A;  3RJG A;  2IA6 A;  1N63 A;  4Q45 A;  3RJF A;  5KFR A;  3V7L A;  1JRO A;  1NZB A;  3V6J A;  1JRP A;  1PK1 A;  3OSN A;  5L1K A;  5KFS A;  5J0S A;  5HMM A;  5CEH A;  2W3R A;  3ISC A;  1C20 A;  4P0Q A;  2HHV A;  2K4I A;  3EWA A;  2BCS A;  5D4B A;  2KOB A;  1B43 A;  2EZX A;  1WWU A;  4B9U A;  2YX8 A;  5KFL A;  1N48 A;  2OEH A;  9ICN A;  3ZDA A;  1TAQ A;  2H3Q A;  5F9N A;  2ZTD A;  5DKW A;  3T5K A;  4F91 B;  4YD2 A;  3F2D A;  4WJ3 B;  2P66 A;  3IDW A;  2KN7 A;  4EZ9 A;  1DK3 A;  4DWI A;  2KV2 A;  4EX6 A;  4YD1 A;  4G3I A;  1BNP A;  2P6R A;  3RJE A;  4ED7 A;  1JAL A;  4EZ6 A;  4JWN A;  1LKY A;  3TAC B;  3Q8R B;  3HKZ F;  3QZ8 A;  3CNH A;  5KNI A;  3QX7 A;  2K8B B;  1ZQO A;  1PVP A;  2QAR B;  1F0M A;  4LJX A;  3OPX A;  5KFJ A;  5ALE A;  2CPR A;  2JEF A;  2OXO A;  7ICR A;  2KJ9 A;  5DQG A;  5KFE A;  4LZG A;  4OO1 J;  3SV3 A;  1GO3 F;  2KIC A;  2LYH A;  5G5G A;  4F93 B;  2VJ4 A;  4KX5 A;  2ALZ A;  5J0O A;  7ICI A;  4CDG A;  1JMS A;  1X6J A;  4OJO A;  9ICV A;  3UMC A;  4BX9 C;  4DS5 A;  4ECU A;  2ZIV A;  1IV8 A;  3OTQ A;  2YY6 A;  4F2R A;  2LM1 A;  2ZIU B;  3F2C A;  4DL3 A;  3UXN A;  4UBC A;  4UAT A;  3AM9 A;  1T3N A;  3IRU A;  3PY8 A;  3JPS A;  5G5H A;  5J2D A;  3TAD C;  1XS9 D;  4GIB A;  1T7P A;  4Y2J A;  1MQ3 A;  4EYH B;  5AKJ A;  4YMM A;  3RRH A;  4UAU A;  2F8K A;  4ED0 A;  5L1M A;  1S0V A;  3IM1 A;  3AEV A;  4BGD A;  8ICY A;  3ZDE A;  4PGX A;  2WFA A;  1XSN A;  4B9S A;  4KLE A;  4EBD A;  1QQ7 A;  4EEK A;  4NLC A;  4J9N A;  2HHS A;  2BGW A;  4Q8F A;  1BPE A;  5DG7 A;  4BJQ A;  1B0X A;  3TAQ A;  3WKA A;  4DSF A;  4MEX A;  2IHN A;  2MRL A;  4NY8 A;  1N62 A;  4FBT A;  4US9 A;  4Z6C A;  4FS1 A;  1ZQZ A;  2M0N A;  3VCB A;  2DPI A;  3PV8 A;  4GC6 A;  2YQE A;  2XIC A;  2BCV A;  1SL2 A;  4F92 B;  4I27 A;  1KLN A;  2NRW A;  5ALL A;  1NKE A;  1T8E A;  1NNL A;  1Y88 A;  4O3N A;  5KAI U;  4YR0 A;  2EAM A;  3FDS A;  2DKX A;  3H0R B;  1D8L A;  7ICM A;  4PHD A;  3SI8 A;  2HCF A;  2KZ3 A;  4UW9 A;  3AU2 A;  3CW2 C;  3GV7 B;  5J0U A;  1ZQK A;  3OGU A;  4R8U B;  1J97 A;  3SAF A;  4C8O A;  3FM9 A;  4C80 A;  2MU2 A;  3MR5 A;  5BOL A;  3PW7 A;  2JRZ A;  2LPE A;  4DOB A;  1IM4 A;  3OHA A;  4MEY A;  2UVU A;  3QUQ A;  1ZQX A;  1LVH A;  4CGZ A;  5DLF A;  2Z7J A;  3RBE A;  4YR2 A;  5J2A A;  2GLE A;  3Q8L A;  3C5F A;  3EZ5 A;  3NVW A;  4Y2Y A;  2E8O A;  1RXV A;  2HI0 A;  1S0N A;  4LVS A;  3F53 A;  4FS2 A;  2EZZ A;  5CR0 A;  1BVS A;  1DRG A;  1T94 A;  1QQ5 A;  4QZG A;  5ALF A;  4DSE A;  1TVA A;  2QB0 B;  9ICJ A;  2LYB A;  8ICZ A;  2G0A A;  1ZQB A;  4QIW C;  8ICQ A;  4NJ8 A;  2FLN A;  1TV9 A;  2A19 A;  3ONN A;  3WKC A;  8ICT A;  4B9V A;  5J0P A;  3I1Y A;  9ICT A;  4P0P B;  4GXJ A;  3CYM A;  2J6U A;  3RR7 A;  5KT4 A;  4IRD A;  1XO0 A;  2NRX A;  2F3N A;  9ICP A;  3MFH A;  2NO5 A;  2Y1J A;  4A8E A;  2WAQ F;  4J9K A;  4PHP A;  3RJJ A;  3T79 A;  3WKD A;  2BPF A;  2PI4 A;  3PW2 A;  4M6W B;  1Q3U A;  4MHV A;  4UAY A;  3D2Q A;  4BWJ A;  2HBM A;  7ICJ A;  9ICS A;  3C5G A;  5KFQ A;  3C1Y A;  2FLL A;  1LB2 B;  3C23 A;  3LVW A;  4HYK A;  2PFN A;  4C7Z A;  2PXI A;  3BZK A;  3Q8Q B;  2PMZ F;  2ZUB A;  2AGQ A;  2KK0 A;  2KD1 A;  2AXT U;  4ECY A;  1JUD A;  2YTU A;  3RTV A;  4DFM A;  1D9F A;  2WAQ C;  1DXS A;  4F5R A;  1PVQ A;  1ZJN A;  2UVW A;  2HOI A;  2KZM A;  1SV4 A;  8ICR A;  4F8R A;  3BDP A;  4O3Q A;  5KL1 B;  5L1J A;  1HIW A;  2ZUD A;  2G5I B;  1O03 A;  7ICS A;  4F3O A;  4RT3 A;  7ICH A;  1BPD A;  3HJE A;  2K4P A;  4C0Z A;  2JGA A;  4CF3 A;  5IIL A;  3RR8 A;  3KHG A;  5EE3 A;  4I28 A;  3AQF A;  3HX0 A;  5KFD A;  4F72 A;  5KFY A;  4C4S A;  5AK5 A;  3KZI U;  1RG6 A;  5IIK A;  4Y2Q A;  4AYB C;  4J9M A;  3E0F A;  2KKV A;  2XY6 A;  2HVH A;  4DL5 A;  3NVZ A;  2XI9 A;  3FC4 A;  2DPJ A;  2I9G A;  2W3S A;  1NI3 A;  7ICL A;  1KRP A;  2K4H A;  5EE9 A;  1X6I A;  2C28 A;  1TK0 A;  2FMQ A;  1TK5 A;  4P0Q B;  4IQW A;  4ECT A;  5CA7 A;  4RPX A;  1RYU A;  5GTI U;  8ICP A;  1X9X A;  4O0I A;  3MAB A;  4TUP A;  5FP0 A;  3TAD A;  5AM2 A;  4O5E A;  3TFR A;  2G08 A;  4YXM A;  2RDI A;  4P4O A;  3G6Y A;  4PH5 A;  4PHA A;  3M8R A;  5ALO A;  3RAQ A;  7ICQ A;  4UAW A;  2A3V A;  2W8K A;  3QU4 A;  3UXP A;  4EBC A;  1KEJ A;  3BS7 A;  3B0Y A;  3EUB 2;  3T5L A;  2EAO A;  4JV0 A;  4F5N A;  5AK4 A;  3QUB A;  1BGX T;  3EPI A;  5AI8 A;  4NL9 C;  4O3P A;  4M6W A;  3N7P D;  2XCA A;  2NO4 A;  2WB1 F;  1NK5 A;  7ICE A;  2YMP A;  2H3F A;  2C2E A;  1L3V A;  1JN3 A;  4I2I A;  5CP2 A;  2BHN A;  1SV0 C;  5EWG A;  1UPH A;  4ED8 A;  5CRX A;  2QLT A;  4C8L A;  4C8N A;  4QZI A;  3QZ7 A;  1QSY A;  9ICC A;  3HP6 A;  1ZQS A;  1SKR A;  2VIX A;  2OM6 A;  5J2F A;  2MAX A;  4F71 A;  5HP4 A;  9ICG A;  3RRG A;  4TQS A;  4MFF A;  4IC9 A;  4Y2R A;  1KDH A;  1IXR A;  2Y1I A;  3RAX A;  5DB7 A;  2HBK A;  2F1H A;  4IR9 A;  4B9T A;  2HBL A;  2VJ5 A;  5J2K A;  2Y0S C;  4ZOH C;  2I5H A;  4UB8 U;  3GIL A;  1JI7 A;  1N60 A;  3AQE A;  1T4G A;  3HRD D;  2G07 A;  3FAH A;  3KFU F;  4AP9 A;  3M6K A;  4QIW F;  5AKL A;  3HT3 A;  2H3I A;  2PFQ A;  2FPK A;  2F8L A;  3D6J A;  1RQL A;  3GZF A;  4RUC A;  4UAR A;  2ZXH A;  3PSF A;  1FEZ A;  5ALP A;  3OJU A;  3HPO A;  4YR3 A;  3C28 A;  5KFT A;  5T14 A;  1HUZ A;  3L4P A;  7ICN A;  1BNO A;  4KLT A;  1ZQV A;  4EEL A;  2AU0 A;  3PR5 B;  4JWM A;  4K4I A;  1O08 A;  4M2Y A;  4KTQ A;  1ZQG A;  5KFZ A;  5DB8 A;  4ECX A;  8ICE A;  2ZIW A;  3QNM A;  4Y2T A;  3MFI A;  3GFK B;  5C5J A;  3KD3 A;  2JHD A;  3M9N B;  3RJI A;  2W11 A;  4X5V A;  3SEN A;  3KHL A;  4QZE A;  4NV0 A;  2IBK A;  4KIT B;  4RT2 A;  2KP7 A;  5KFK A;  3JPN A;  5KG6 A;  3IV6 A;  5KG5 A;  2FE9 A;  1ARO P;  1N5W A;  2B0C A;  5AIA A;  4NLZ A;  2H3V A;  3MGV A;  3PVX A;  2DGZ A;  1XNS A;  3EPG A;  2ASD A;  1ZQH A;  1UA1 A;  2LYA A;  3MDA A;  5B66 U;  3KKA A;  4RUA A;  4F4Y A;  2BQ3 A;  5KFW A;  4YN4 A;  3RH4 A;  1X9M A;  3IHQ B;  5AIC A;  3EW9 A;  2W04 A;  1X66 A;  5KFA A;  4J9P A;  5CHG A;  5AK6 A;  3PW5 A;  3KHH A;  4DQS A;  1SWW A;  2ATL A;  8ICL A;  4ED6 A;  4B9N A;  5AM1 A;  2EZY A;  1NK0 A;  1QH9 A;  3C2M A;  2OCE A;  8ICS A;  1XSP A;  3M7D A;  2KEY A;  4DQP A;  1ZQU A;  4JK1 A;  5DQH A;  5AKE A;  4QZH A;  2ZIX A;  4YG2 A;  2FMP A;  2E8M A;  2MUT B;  1JX4 A;  2JXJ A;  2ZJA A;  4MF8 A;  2ASL A;  1PK1 B;  1Q3V A;  4DEZ A;  3EYZ A;  1HEK A;  3A0B U;  5KFI A;  5KFP A;  4I2D A;  1ZQT A;  9ICU A;  1LV5 A;  5DG9 A;  4OCZ A;  3JPQ A;  2FPM A;  1ZQM A;  5J0Y A;  1K1Q A;  2JH1 A;  3ED5 A;  4EX7 A;  1B22 A;  5ALI A;  1NZP A;  4UB6 U;  1ZQD A;  2I6X A;  2BCQ A;  2AJQ A;  2MA1 A;  3WK6 A;  4ECZ A;  1UQV A;  3SD7 A;  5HML A;  3WKE A;  2PI5 A;  3SAH A;  1ZQF A;  5KFG A;  2FMS A;  4F4K A;  3SR6 A;  1DOQ A;  3MDC A;  1H38 A;  3H4D A;  1D8B A;  4LZD A;  1S76 D;  4UB3 A;  5EE1 A;  2HHU A;  1NK8 A;  4KLF A;  4UAZ A;  1SKW A;  4RQ6 A;  2EAP A;  5AI0 A;  3PW0 A;  3H4B A;  2DBY A;  5AM4 A;  1ZRN A;  2Q4T A;  2EQY A;  3BS5 B;  3IG8 A;  4CCH A;  5ALM A;  3QXG A;  3N7R C;  2YMQ A;  3RJH A;  9ICX A;  4J9Q A;  5ALD A;  4PJ0 U;  1L6N A;  1VDV A;  5AKX A;  4C8M A;  1WCN A;  2W9C A;  4F50 A;  3GV5 B;  5J2E A;  3H8S A;  4HAI A;  1Z4N A;  4XQ8 A;  1SXE A;  3RFA A;  4ECW A;  1NKB A;  4JV2 A;  1V85 A;  1X40 A;  4BDP A;  3KTQ A;  2DL0 A;  1SXD A;  4F5Q A;  4KLD A;  2YN4 A;  5ALQ A;  1S10 A;  3RF9 A;  2PFP A;  5HHI A;  4U7C A;  1AQ6 A;  4OD0 A;  4ED2 A;  2DKZ A;  4IQU A;  4FZL A;  1Z00 A;  3CRX A;  3KHR A;  4IQV A;  2QAR A;  4IL6 U;  8ICJ A;  1F44 A;  4ECR A;  1TFR A;  8ICF A;  2FPL A;  1ZD4 A;  1VLB A;  1EXN A;  5DG8 A;  1K1S A;  2C22 A;  8ICO A;  2K4E A;  4KN4 A;  4IQT A;  2LKY A;  4DF8 A;  5KG1 A;  4M9L A;  5J2B A;  3IN5 A;  2NV3 A;  1TKD A;  1Z3E B;  2G5H B;  2I1Q A;  2ZIV B;  2Y9U A;  1ZQ1 C;  4NLN A;  2KMD A;  3M9M B;  5ALN A;  3KKA C;  5DGB A;  3K75 D;  3AUO A;  5TIS U;  2F2A B;  4DOC A;  1ZYQ A;  1QSL A;  3QYP A;  5DQI A;  2BPG A;  3IG5 A;  1CRX A;  2E1F A;  4EYI B;  4QZD A;  2BR0 A;  3T3F A;  5DDY A;  5DBC A;  2EAN A;  2KKP A;  5EWF A;  4DQQ A;  4F2S A;  1NJY A;  2HW3 A;  5AI9 A;  2RP5 A;  1Z1B A;  4QZ9 A;  2JEG A;  4KMU A;  1TAU A;  3GIK A;  1K5O A;  1NJW A;  1DK2 A;  2ZTE A;  4CRX A;  4RQ5 A;  2F76 X;  1ZRM A;  2OYY A;  4RNN A;  3SYZ A;  1NJX A;  4I2F A;  3O0F A;  3QU5 A;  1ZJM A;  2C2R A;  4I29 A;  2K89 A;  5ALX A;  1L7P A;  2E5S A;  5ALG A;  4J9R A;  1KKX A;  4Z6F A;  2F1J A;  2PKE A;  2ZJ8 A;  3R9K A;  2XID A;  5CJ7 A;  1ZQN A;  1RPL A;  2VKQ A;  4NLG A;  2P35 A;  3HKZ C;  1UT8 A;  2YB1 A;  9ICL A;  3AN1 A;  4P4P A;  4GLX A;  7ICK A;  2IMW P;  1SWV A;  2EH9 A;  4KLL A;  5TZV A;  3UMG A;  3JPO A;  4ECQ A;  2ZJ5 A;  3FYH A;  9ICH A;  4RQ7 A;  2AGO A;  4AYB F;  5ALJ A;  3OJS A;  1ZQP A;  3RBD A;  8ICA A;  2AHO B;  5EOZ A;  1BPX A;  2DFL A;  4XRH A;  5J2C A;  1X9S A;  2KVC A;  2WF7 A;  4DO9 A;  4JV1 A;  8ICC A;  1V9P A;  3QUT A;  1COO A;  1DGS A;  5ALY A;  5DLG A;  2P6U A;  2IOF A;  1NK9 A;  4M9H A;  3C1Z A;  2W9A A;  1L7O A;  2ESE A;  4YQW A;  2KJ8 A;  5DGA A;  2F44 A;  3DV9 A;  2JEJ A;  2Q0Z X;  3PO5 A;  8ICI A;  2KNJ A;  3QU2 A;  2FI1 A;  2ZG6 A;  2GO7 A;  4RNO A;  5BOM A;  5AKY A;  3U26 A;  3PMN A;  3HWT A;  4J9S A;  4ICA A;  2XCP A;  3BJY A;  5ALS A;  5D49 A;  1KL9 A;  4M47 A;  3ZD9 A;  4JB3 A;  1DGJ A;  2KJ5 A;  1CUK A;  1M6Y A;  4BUG A;  2F1I A;  5CB1 A;  3SMV A;  3BQ2 A;  2A1J B;  1QCK A;  4PL2 A;  4M04 A;  2L5Y A;  2A1J A;  4R8U A;  3NRW A;  2AQ4 A;  1S77 D;  5AK3 A;  5JU5 A;  4P2H A;  2E8P A;  4DSK A;  3PML A;  4MFC A;  5KT7 A;  2ZTC A;  3NS1 A;  1ZQW A;  4RQN A;  4YXJ A;  2D6F C;  3S6J A;  2KIV A;  1NJZ A;  4TUS A;  5ALK A;  1QQ6 A;  2JEI A;  8ICU A;  1B4F A;  2MSN A;  2WF9 A;  4C7Y A;  5DBA A;  5F3X B;  4QNL A;  5IIM A;  7ICT A;  1X9W A;  4YCX A;  5J29 A;  5JTI A;  1FIQ A;  4Z6D A;  2IHM A;  4BWM A;  4UB1 A;  1KFD A;  3C2K A;  9ICW A;  3V72 A;  4DL2 A;  2V4R A;  1FFV A;  5KG3 A;  3N7S C;  2CXY A;  4ED3 A;  4YVZ A;  2W43 A;  3G6V A;  1NK4 A;  5AM5 A;  2VA8 A;  4K4G A;  4KMO B;  1U49 A;  4GXK A;  1Z4O A;  1JXE A;  3TAN A;  2KG5 A;  3PNC A;  1KW4 A;  3F5A A;  4OJ5 A;  3Q8S B;  9ICO A;  2KVS A;  4C4T A;  8ICM A;  4Y2X A;  2XO7 A;  2HHX A;  7ICU A;  4KLU A;  1SIJ A;  4OJL A;  4B6J A;  4R66 A;  2KHV A;  5KT3 A;  4GXI A;  3D2N A;  5AHX A;  5ALH A;  5HHH A;  4O3R A;  3PX6 A;  1S8O A;  3ICX A;  3GIJ A;  1XU4 A;  5AIB A;  4OJ6 A;  1KSP A;  3MC1 A;  2ZXI A;  2AGP A;  4KLO A;  9ICR A;  5KFM A;  5KFB A;  2YB4 A;  3B9J A;  5D46 A;  4YP3 A;  3CP8 A;  3B0X A;  4DL6 A;  3GDX A;  4QW9 A;  4DOA A;  1ZQA A;  2YMM A;  2R8J A;  2NRZ A;  1PVR A;  4RZR A;  5JUM A;  4NLK A;  1FO4 A;  2O6K A;  1QLN A;  4IR1 A;  4EEN A;  3I28 A;  1PUZ A;  3RH5 A;  4RQ8 A;  1L7M A;  4I2G A;  2BCR A;  9ICK A;  2JR5 A;  5L1I A;  1RZT A;  9ICA A;  3SZ2 A;  3QEB Z;  5AKZ A;  2WF6 A;  1UA0 A;  1KTQ A;  3BZC A;  4QWA A;  2D3D A;  5L9X A;  2ZIU A;  3QU9 A;  5KFN A;  9ICB A;  1WUD A;  1L5U A;  1ZQQ A;  4DFK A;  9ICQ A;  2OWO A;  1L8L A;  4FFD A;  1U4B A;  1CI4 A;  3IP4 B;  1L8O A;  1UCV A;  3HW8 A;  2K60 A;  3MBY A;  2OH2 A;  5J0W A;  3WK7 A;  4I2E A;  2NRV A;  1N2X A;  4UQG A;  1BPB A;  3C21 A;  4DF4 A;  4ACO A;  2LBO A;  2HDO A;  4UB5 A;  2HHT A;  2N1R A;  4OJP A;  5III A;  4IRK A;  3K1Z A;  3A0H U;  3C29 A;  3GII A;  2GH1 A;  2KHQ A;  3TAP A;  1ZD2 P;  2ODG A;  3GV8 B;  3SAG A;  4EBE A;  3TQ1 A;  1ZD3 A;  3G6X A;  2BQU A;  4RPY A;  4KLI A;  1IIP A;  4DL7 A;  5AM0 A;  5EE0 A;  2W9M A;  4O5C A;  1P7D A;  3V7J A;  1S0M A;  3E58 A;  1RXW A;  2M9N A;  5KFH A;  2LM4 A;  2K8C B;  5ALZ A;  1QTM A;  3J81 j;  5DBB A;  4F4Z A;  2KTQ A;  2V4Q A;  3WK5 A;  4RU9 A;  3MR3 A;  2GOL A;  1RDF A;  4UB2 A;  4M0A A;  2RRD A;  4QZC A;  5IIJ A;  3ALR A;  1ZQR A;  3PX4 A;  1TK8 A;  5C0Y A;  5J8Y C;  2CN1 A;  3LDA A;  5KG0 A;  3QUC A;  2RDJ A;  1S97 A;  5K4L A;  3PR4 A;  2WB1 C;  2XY7 A;  3M1Y A;  9ICF A;  3WK8 A;  3PSP A;  4U6P A;  1ZQY A;  3LWM A;  3T5H A;  4ELU A;  1ED1 A;  2IOF K;  4F5O A;  3D2S A;  4M9J A;  2HBJ A;  2CRX A;  2DQN B;  1V97 A;  2OHF A;  5HNK A;  4YMN A;  1FFU A;  5J0Q A;  3OSP A;  3UMB A;  1BPY A;  4YMO A;  1ZET A;  1U48 A;  1CEZ A;  5KFF A;  3MR6 A;  5F9L A;  2B6G A;  7ICF A;  3ZDD A;  4QWB A;  4ECS A;  3RB3 A;  1SZP A;  2W9C B;  3AU6 A;  2FDR A;  2GWS A;  4I2A A;  5J2I A;  3UXO A;  1SL0 A;  3Q8P B;  4IS7 A;  4Q43 A;  2W8L A;  3GU3 A;  4QWC A;  5J0T A;  3H0M B;  2ZIX B;  3ZI4 A;  5KFV A;  4US8 A;  3M9O B;  5KT2 A;  3SQI A;  1A76 A;  3V6K A;  4ELT A;  4O5K A;  1ZQE A;  3H8W A;  3NRZ A;  4RNM A;  2E8N A;  3UM9 A;  1MN8 A;  5AKH A;  2VA3 A;  1A6S A;  4B9L A;  2XGP A;  8ICX A;  5H2F U;  5AM3 A;  2E1E A;  1ZQI A;  4FZN A;  5L1L A;  2VAN A;  2RHF A;  1S5L U;  4FE3 A;  3SEI A;  5HR7 A;  3H0L B;  4QW8 A;  2HVI A;  1LKY B;  5IIO A;  9ICM A;  5DDM A;  4GC7 A;  1TE2 A;  4NM2 A;  1UT5 A;  2JV3 A;  2XGQ A;  5J0X A;  1OUQ A;  3VC8 A;  4ED1 A;  3TAR A;  1WG8 A;  2MUT A;  2K8A A;  5KAF U;  1XC9 A;  4MFA A;  1QSS A;  4J03 A;  4P4M A;  4UAS A;  3UQ0 A;  2G09 A;  3PO4 A;  2HSZ A;  2FJ6 A;  2BDU A;  4PGQ A;  4DCC A; 
#chains in the Genus database with same CATH homology
 2F76 X;  2N1R A;  2KV2 A;  4OJP A;  4OJL A;  2PMZ C;  4P0Q B;  1KBU A;  2H3I A;  2KHV A;  2OYY A;  2XVT A;  3CYM A;  3D2N A;  4P0P B;  3F5E A;  2F8L A;  3K1Z A;  3ICX A;  2KJ5 A;  3C29 A;  4BUG A;  2DF4 B;  1XO0 A;  3M7D A;  2KEY A;  2F77 X;  2GH1 A;  2KHQ A;  2M0N A;  4OJ6 A;  1URJ A;  3VCB A;  3O0F A;  3GZF A;  4NWI A;  3RFA A;  3SMV A;  3SAG A;  4A8E A;  2K89 A;  2WAQ F;  2ZIX A;  2ZXI A;  2XIC A;  2JMG A;  3LYS A;  3F2B A;  2E5S A;  2ZXH A;  4PL1 A;  3PSF A;  4PL2 A;  3HKZ F;  3PZP A;  3T79 A;  2YB4 A;  3DEE A;  2G08 A;  3GU3 A;  1IIP A;  2K8B B;  2Y0S F;  3C28 A;  2W7O A;  5T14 A;  1PVP A;  1Q3U A;  2HOF A;  3CP8 A;  3H0M B;  3RF9 A;  2ZIX B;  3D2Q A;  2XID A;  3OPX A;  4JMU A;  1Q3V A;  4U7C A;  1P7D A;  3NRW A;  2HBM A;  2VKQ A;  1A6S A;  3HKZ C;  2CPR A;  2OXO A;  3H0R B;  1HEK A;  2YB1 A;  4FZL A;  3CRX A;  1MA7 A;  2A3V A;  2K8C B;  2KJ9 A;  4CRX A;  3SQI A;  2W03 A;  3LVW A;  4P0P A;  3KZX A;  1F44 A;  4OO1 J;  1GO3 F;  2HOQ A;  2KIC A;  4GFJ A;  2PMZ F;  1PVR A;  2JH1 A;  3LVV A;  5HR6 A;  2VJ4 A;  2ZIW B;  4KX5 A;  2KD1 A;  3SAF A;  2W7P A;  2GOL A;  5A0L A;  4CDG A;  2K4E A;  2RRD A;  4OJO A;  3ALR A;  2MA1 A;  2ZIW A;  3N7P D;  2WB1 F;  2WAQ C;  2G06 A;  4AYB F;  4BX9 C;  2D6F C;  5C0Y A;  2ZIV A;  2H3F A;  2JHD A;  2E1E A;  4FZN A;  2CN1 A;  2ZIU B;  2LKY A;  3M6Z A;  3F2C A;  4NLB A;  4NV0 A;  4QNL A;  3L3F X;  2HMX A;  3SAH A;  1PVQ A;  2RHF A;  2HOI A;  4CGZ A;  4FE3 A;  4FZM A;  2Z7J A;  2WB1 C;  1TAM A;  1UPH A;  3NUQ A;  1SZH A;  2KVC A;  3PST A;  5HR7 A;  1ECW A;  3H0L B;  2KIW A;  3IN5 A;  5KL1 B;  5CRX A;  2NV3 A;  3PSP A;  1HIW A;  2G5H B;  2G5I B;  4U6P A;  1D8B A;  2ZIV B;  1Z19 A;  1ZQ1 C;  1YT3 A;  3AL0 B;  2H3V A;  4C0Z A;  3MGV A;  2JGA A;  2DGZ A;  2OM6 A;  2VIX A;  1ED1 A;  1XNS A;  3F53 A;  2ZIU A;  3N7S C;  3D2S A;  1WUD A;  2LYA A;  2F2A B;  4IC9 A;  1NZB A;  1DRG A;  2HBJ A;  1A0P A;  1T94 A;  3AQF A;  2CRX A;  2DQN B;  2KJ8 A;  1OUQ A;  3IG5 A;  2LHT A;  3VC8 A;  1CRX A;  2E1F A;  4AYB C;  2H3Z A;  2HBK A;  2JH7 A;  2K8A A;  2Q4T A;  2HBL A;  4KMO B;  2VJ5 A;  5KL8 B;  4O3M A;  4P0Q A;  3PSI A;  3E0F A;  2K4I A;  2Y0S C;  2KKV A;  2LYB A;  2G0A A;  3IP4 B;  2KOB A;  2W04 A;  3IG8 A;  2KNJ A;  4QIW C;  2KKP A;  4NLC A;  2XI9 A;  2OH2 A;  2LBO A;  2ZG6 A;  2YX8 A;  2R18 A;  3AQE A;  3F5A A;  4OJ5 A;  4QJF B;  3N7R C;  2G07 A;  4BJQ A;  2G09 A;  2H3Q A;  2RP5 A;  3ONN A;  4ICA A;  1Z1B A;  2BDU A;  2K4H A;  3KFU F;  3F2D A;  4ACO A;  1L6N A;  4WJ3 B;  3M6K A;  4QIW F;  2MRL A;  4KX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...