1SZHA

Crystal structure of c. elegans her-1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
b'STLTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNLMTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYCEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Her-1 protein
publication title Crystal structure of Caenorhabditis elegans HER-1 and characterization of the interaction between HER-1 and TRA-2A.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 58
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09232 Caenor_Her-1 Caenorhabditis elegans Her-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.360 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA01
1.10.150.370 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA02
1SZHA
chains in the Genus database with same CATH superfamily
1L3SA 4R8UB 4J9QA 5EOZA 1FO4A 5J2FA 1SL2A 3ICXA 2V4QA 3BQ1A 2IMWP 1X66A 1S5LU 2EAMA 5J2HA 2BPGA 5CEHA 4ELVA 5F9LA 5AI5A 4AYBC 4EENA 5J8YC 2C2EA 4BX9C 3PV8A 2JV3A 1JXLA 1TE2A 4DWIA 4Y2PA 1F44A 1ZQ1C 4AYBF 2BCSA 7ICUA 4UB1A 3A0BU 3PSTA 5ALNA 4UATA 1BPYA 1Z00B 4M47A 4ZOHC 4M9NA 5HP4A 2WF7A 1ZQPA 5DG7A 5L1IA 3NRWA 3A0HU 4UQGA 3PMNA 1KTQA 1N56A 2K4PA 5KL1B 3C29A 5KFMA 1X9SA 4QWDA 4NJ8A 4NL9C 8ICCA 2IHNA 1LVHA 3V6KA 5J8YA 3RJEA 1TK0A 5IIKA 1ZQLA 2CN1A 3NVZA 1C7YA 3PNCA 9ICPA 2OYYA 4KLHA 2FLNA 4I2DA 1T3QA 2HW3A 1ZQXA 1C20A 4B9MA 4O3PA 5DB7A 3OPXA 3UXNA 5KG6A 3RTVA 1ZQWA 3MDAA 1ZQEA 3QXGA 1KN5A 5IIJA 1U45A 1YT3A 4C8KA 9ICRA 4DOAA 1QQ6A 3EYZA 3RB4A 3RB0A 4UB5A 2ISPA 4RQ4A 4PGXA 2QB0B 4ACOA 4NWIA 5E79U 1QQ7A 2BKEA 7ICTA 3L4PA 2R8JA 2K89A 2AQ0A 2JXJA 5L1MA 2WF6A 3RAXA 2W3SA 2JEIA 2IOFA 2G09A 2ZTEA 7ICFA 4RUAA 1X9MA 1ZQGA 2BR0A 9ICJA 1SGGA 4DL4A 5ALFA 2ZIXB 1JN3A 4LZGA 3QU2A 3FAHA 3HP6A 2W55A 4Y2YA 1COKA 4YR2A 3AU2A 2XY6A 2FMQA 2WAQC 4US9A 7ICHA 4J9SA 4BUGA 2E8NA 5DKWA 4QW9A 2YN4A 2H3ZA 2JEGA 4DO9A 2VA3A 1KKXA 2WAQF 1S0NA 4GLXA 3BZCA 2NRVA 4CNQA 1ZQMA 4DSFA 1OUQA 2J6UA 1D8YA 3BDPA 2JHDA 5C0YA 4UBBA 4K4HA 2Q0ZX 3WK7A 5KFXA 4C8LA 5KT2A 3IP4B 1S0OA 4KLFA 2YTUA 3DV9A 2NYVA 4R65A 3M9OB 5AI8A 2ZIXA 1V9PA 2P35A 5KG4A 4KMOB 8ICHA 4USAA 1WCLA 5ALOA 4QZAA 9ICAA 4I29A 1A77A 4B9SA 4J9NA 2D6FC 3NASA 4DFKA 5KFQA 1RYRA 2JMGA 4TUPA 4DQRA 1ZJMA 2PFQA 3KHGA 4C0ZA 2EAOA 3GFKB 5D4BA 1KL9A 2UVVA 3AN1A 4EZ9A 4F2SA 5JU5A 3NVYA 4DF8A 5KT7A 1DXSA 1NNLA 5KFYA 4PHAA 3ONNA 1RYUA 2Y0SF 4JV2A 1SXDA 1ZRNA 5HMLA 3HX0A 4RPXA 5HMMA 4DFPA 5AKKA 3C28A 3RH6A 4B9LA 4US8A 3T5JA 2HMXA 5CWRA 4I2HA 4MEYA 4UARA 3TANA 3QU9A 3ZDAA 1DGJA 2WB1F 2I9GA 4OJ6A 3TAPA 4J03A 4G3IA 3K1RB 2G08A 5KFAA 3AQFA 4RQ0A 2ASJA 3QNMA 2KZMA 4EEYA 8ICUA 1UA1A 3E2EA 2L5YA 2KZ3A 2QKQA 4ECYA 4LJXA 3M9NB 8ICTA 4MHVA 2PI5A 5L1JA 4X5VA 3GQCA 2A1AA 5J0PA 2KMDA 5AKGA 5D49A 5AM5A 5DG8A 5ALPA 4QZIA 3Q8KA 5AM1A 4O3OA 3MGIA 1MQ3A 1V38A 4KLQA 3MR5A 3D2QA 4O3NA 2BQUA 4KLMA 2H5XA 2PFNA 2G0AA 9ICMA 4Q44A 3QZ8A 1WCNA 3ZDBA 5ALZA 2VA8A 4GFJA 2IBKA 4RQ3A 9ICKA 2VKQA 5AKEA 4EBDA 4NLZA 2XGQA 2HHSA 4EEKA 4J9KA 3QUBA 5KFBA 3C21A 2BZFA 3KBBA 1T8EA 1QCKA 2HOIA 3LYSA 4DQPA 1GO3F 1FFUA 3FYHA 4TQSA 2FJ6A 4PPXA 5IILA 4J9OA 5F9NA 2NO4A 5EWFA 3MR2A 5BPCA 5J29A 1YZ7A 5KFOA 4JK1A 5DLGA 1RXVA 4BWMA 2CXYA 4CDGA 3V7JA 4I27A 4I2IA 1D8BA 5KAFU 2FLLA 1ZQBA 5ALEA 7ICGA 1ZQIA 4EBCA 2C28A 2MAXA 3RR7A 1D9FA 4IC9A 4YMMA 4JMUA 1ECWA 2XCPA 1D9DA 4UAUA 2LYAA 1JMSA 1MN8A 5J0XA 2Y1JA 4IR9A 2QB1A 4DSIA 3GU3A 3BS7A 5DQGA 2OCEA 4DCCA 2FE9A 1ZQTA 3HT3A 2VJ5A 1SIJA 3C1ZA 4QWEA 4EBEA 4RQ1A 3IG8A 4K4GA 3BZKA 2PI4A 2HHWA 2K60A 3RH5A 5J2GA 2OHFA 3WKDA 2YB1A 3UQ0A 3BQ2A 9ICLA 4TUQA 3K1ZA 3ALRA 4Q43A 4F5QA 5AK5A 4JV1A 3CRXA 3WKEA 2YY6A 4FS2A 5EWGA 1ZQHA 1AROP 2O6KA 3C23A 4FZLA 4M9GA 3OJUA 5CHGA 2KIVA 3IRUA 5J2BA 2OH2A 4GC7A 3MFHA 3KZIU 4O5CA 2B6GA 4NLKA 7ICQA 3QU4A 3ZDEA 3M9MB 4J9PA 4GXKA 3T5KA 4NM1A 2PXIA 3HKZC 4CF5A 5ALKA 1MQ2A 1LV5A 3TFRA 1SWVA 3ZI4A 1N48A 4IQTA 2KKPA 3PX4A 1WWVA 1N5XA 2D3DA 1NK0A 3HKZF 4F2RA 1F0MA 1TAQA 2K8CB 5KL8B 2A1JB 1V97A 2JZBB 3GV5B 1RDFA 1HUOA 4O5KA 5AM0A 1ZQYA 3NVWA 4J9MA 3GIKA 4R63A 4YXJA 1ZXIA 2AGPA 3ORYA 4QZ8A 3UXPA 1ZQFA 5ALUA 2ZUCA 4CE6A 2RDIA 2HHQA 1SV0C 5AIAA 2W9CA 3N7PD 4P4OA 5AK6A 5JUMA 3UMBA 3BS5A 1PVPA 2HBLA 3AM9A 7ICLA 1X9WA 3FM9A 1N62A 2M0NA 1X6JA 4UAZA 1N60A 4F4ZA 4WJ3B 4KLIA 5KFJA 1U9LA 1RM6C 8ICOA 4KX5A 1Z4OA 3RJFA 3V6HA 2B0CA 1L5UA 4MFFA 4C8OA 1KRPA 2R8KA 2GH1A 4BGDA 1Z19A 3PX0A 2E1EA 1MC8A 5GTHU 2H3QA 2ZTCA 9ICWA 4NY8A 5ALTA 3ZDCA 2HHTA 9ICXA 4GIBA 1SV0A 1QSSA 4DL7A 3H4DA 4XRHA 4IRKA 4F8RA 4DL3A 1ZQJA 2R18A 1PUZA 2F1IA 9ICTA 4DQQA 1N63A 2EQYA 2XC9A 3OHAA 4C4TA 4KLLA 4XQ8A 1SL1A 4YMOA 5K4LA 3LVWA 2HI0A 4IL6U 1JROA 1WUDA 1LB2B 2EANA 2NV3A 3AU6A 1S8OA 5AM4A 3ISDA 1PVQA 4YR3A 4DFMA 1Q8KA 4UAYA 5J0OA 4TURA 2ZIVA 5KNIA 3OSPA 2C2RA 9ICOA 4BJQA 2BPFA 1TAUA 5DGBA 2PKEA 1OXJA 5KT6A 2LM4A 4EX7A 4NXZA 2KE7A 2W03A 4P2HA 5DGAA 2AGQA 8ICGA 1URJA 8ICMA 2KIWA 3PSFA 4I2BA 2G5HB 2RQ5A 1XS9D 2R8GA 3C2MA 5J2EA 5KTQA 4NLBA 2HVHA 2MU2A 4NV0A 4QZ9A 3PW2A 4KLTA 2MA1A 3PY8A 5AKXA 2UVRA 4QZHA 4DF4A 5KFIA 2E5SA 1A6SA 2KN7A 3RF9A 3C5FA 2ASLA 2XGPA 4FBUA 3HPOA 3D2SA 4M9LA 4MFCA 1Q46A 3WU2U 4U7CA 4CF4A 2W9BA 1CUKA 5DB9A 3AEVA 5HHHA 4JB3A 3SD7A 3NUQA 2KJ8A 5KFHA 1J2NA 3AQEA 5HR6A 4F5NA 4O3RA 3RB6A 1ZRMA 4KLEA 1HUZA 2IOFK 4OD0A 4DSKA 2WF8A 2PFOA 1T4GA 8ICRA 1K1SA 3PR5B 2LHTA 8ICYA 1YZ6A 2E8OA 3QU7A 1BGXT 5KT4A 5D46A 4F5RA 4A8EA 3WKCA 3MC1A 3GIMA 4M2YA 7ICIA 3ED5A 2KEYA 4NL9A 4UB3A 3SV3A 1Z1VA 5KFVA 3JPNA 4C8NA 5KFTA 5EE9A 4QZBA 9ICIA 5ALVA 5KFWA 2NRXA 3SV4A 5CA7A 4F50A 5KFFA 4ECSA 2ZIUA 5KT5A 5C5JA 1DK3A 2DL0A 3PO4A 1BPBA 3G6XA 1ZQZA 2BPCA 3KKAC 2AGOA 1BNOA 2KFNA 2QARB 4DQSA 3GIIA 1IIPA 4KITB 3N28A 5AK3A 3BJYA 2FI1A 2R8IA 4Y2JA 4I28A 1AQ6A 2W9MA 3IG5A 3KHHA 2I6XA 4RQ5A 4M0AA 2LYBA 2KJ5A 4QWBA 3V6JA 3OSNA 2GWSA 4Y2TA 3UXOA 9ICFA 2FDRA 2G07A 2VJ4A 2W04A 3SENA 2P66A 4ECTA 1XC9A 5KFUA 5JRTA 4QZFA 3OGUA 3F5AA 4ED7A 4ELUA 3RB3A 5DBAA 4F92B 4DSJA 2GLEA 2HBKA 2F3NA 2D8CA 4YQWA 3GILA 1WWUA 2QARA 3RH4A 1S97A 4ECZA 7ICNA 3UM9A 1WG8A 2BDUA 1ZD5A 2EZYA 3F5EA 2DPIA 3JPSA 2AU0A 4YR0A 3EPIA 5DDMA 2HOFA 2OEHA 3I1YA 2DBYA 4RQ8A 7ICVA 3KTQA 1HIWA 5EE0A 5KFKA 1NJZA 3Q8PB 2F44A 3QEAZ 2KP7A 4RNNA 2E8PA 1NI3A 3RRHA 3PO5A 3LK9A 2CPRA 3JPOA 3IM1A 1NKBA 3R9KA 2Y0SC 1Y88A 4ICAA 2BCUA 7ICEA 2DUYA 1Z4NA 4RPZA 4R66A 1BPXA 9ICGA 3HW8A 2OXOA 3QYPA 5AKIA 2EZZA 3RJKA 4O3SA 1QTMA 4QWAA 3Q8RB 1U48A 1IV8A 2KFZA 1TK5A 4PL2A 3JPRA 1S10A 1Z3EB 1NJXA 2V9WA 2EH9A 1XNSA 4KLSA 1P7DA 3SYZA 5ALHA 4F3OA 2WB1C 1XO0A 2OM6A 2WF9A 2XVTA 3E58A 4ECXA 1QSLA 3T3FA 3K75D 3L5KA 4DLGA 3FDSA 4HYKA 2JEJA 1PVRA 4IRCA 3UMCA 5DB8A 1FFVA 2W54A 3SQIA 1X9XA 2F8KA 4M04A 2Y1IA 4RPYA 5KG3A 4EYIB 4KN7A 2ZUBA 2A3VA 4Z6FA 4P0PA 3CNHA 2F77X 4NLNA 4UAWA 2PMZF 2JR5A 3KOOA 1QLNA 3MDCA 1COOA 2JH7A 3TKAA 2DQNB 9ICSA 5KT3A 3TQ1A 5AKZA 5J2KA 1ZQCA 4NLCA 4B9NA 1T94A 3Q8SB 5DQHA 3M6ZA 1SWWA 4Q8FA 3GZFA 4OJ5A 2PFPA 2KG5A 2MRLA 2JRZA 2MUTA 2ZIWA 2QLTA 5KFNA 4FFDA 3ETLA 9ICUA 3DEEA 4XUSA 4RNOA 3ZDDA 2ALZA 4EYHB 4DFDA 3H8JA 4YN4A 1ZQVA 1WYGA 2W9AA 1X40A 4Y2XA 4I2FA 2RP5A 4UAVA 3QUQA 2YB4A 4PZOA 4C8MA 4QWCA 1HJPA 2HBMA 5HR7A 3MR6A 5KG2A 4ECQA 4PHPA 5J0QA 2K8AA 4DFJA 4I2JA 3BQ0A 1ZOLA 2WFAA 4QW8A 3EW9A 3WK6A 1VDVA 1UT5A 2AQ4A 4FZNA 4EX6A 4DS5A 2FPKA 3HRDD 2ZG6A 3G6YA 2FLPA 4F91B 5KG1A 4MEXA 5AI4A 3QUTA 5T14A 4DOBA 4RU9A 3PZPA 4IQWA 4LVSA 5KFEA 1NJWA 2E8MA 1OW5A 1ED1A 5AK4A 3PX6A 1N2XA 2LBOA 4DQIA 1UA0A 1SZPA 1RQNA 3KZXA 3SI8A 1DK2A 1BPZA 3ETRA 5B5EU 1QH9A 3HWTA 4YXMA 2DKZA 1UCVA 3C5GA 3Q8MA 2KKVA 2W9CB 3LVVA 3LWMA 3EWAA 5KFGA 3BS5B 3QUCA 3JPQA 4IR1A 3C2KA 5HNKA 7ICMA 3SZ2A 2KOBA 2OWOA 3DDHA 1ZQOA 1N61A 1ZQNA 4O3QA 1TK8A 1U47A 5KG0A 1ZD4A 2LYHA 4C4SA 5ALDA 1CEZA 2R8HA 1VJ5A 2LKYA 1Q3UA 4C4RA 3EUB2 4M9HA 3OJSA 2K4HA 5ALRA 4OJPA 5ALYA 3PW0A 2YMMA 4PHDA 3Q8QB 2V4RA 4E0DA 4O0IA 1DOQA 4IRDA 1B4FA 4QZEA 3TACB 4B6JA 5CJ7A 4UB6U 2VANA 3S6JA 3VCBA 4MFAA 3BQ7A 2H3IA 3MGHA 1JALA 4JUZA 3N97B 1UHUA 5DBCA 3RFAA 3F2DA 4F4XA 1QSYA 8ICNA 1NK9A 3NTUA 2BCVA 4F71A 1ZJNA 2KHQA 4YD2A 9ICHA 1TFRA 4KLGA 3NS1A 4DSEA 4YD1A 4UW9A 5AM2A 4QJFB 5CP2A 4CRXA 2LMRA 2HHXA 4RT3A 1SKRA 1X42A 1TV9A 1N5WA 4IQUA 5KFRA 2ASDA 2LPEA 2HCFA 2ZIVB 4QNLA 4IS7A 2EAPA 5ALQA 2F1HA 2GO7A 2ODGA 4DL5A 2W11A 3UMGA 4PGQA 1RZTA 4QZDA 8ICJA 4DLEA 3TI0A 4PGYA 4OCZA 9ICNA 2XCAA 3WKBA 1L8OA 1JI7A 3QEBZ 4C7ZA 3B9JA 4TQRA 3THVA 1NZBA 1KFTA 4TUSA 2HSZA 2FMSA 3PMLA 2UVUA 2KVCA 3I76A 1XSNA 4F72A 3N7RC 2DWQA 4DOCA 2ZTDA 1L3UA 2W9BB 1ZD2P 4YP3A 1UT8A 3VC8A 4R64A 1BNPA 4GC6A 7ICKA 1V85A 5AKLA 3OHBA 1FEZA 2I5HA 2Y9UA 5DQIA 4ELTA 1XO1A 4B9TA 3JPTA 1B0XA 5GTIU 2E1FA 4Q45A 5AHXA 3T79A 2C2DA 3RRGA 5KFZA 4U6PA 5H2FU 2YMQA 1JIHA 3H40A 4BXOA 3UQ2A 4GXJA 4RQMA 1SL0A 4Z6DA 1LKYA 3JPPA 2BQ3A 3SMVA 5BOMA 1KSPA 3PSPA 3C2LA 5J0RA 3D6JA 5KFSA 3FC4A 2BDPA 5B66U 9ICEA 4PZNA 1QQ5A 9ICCA 4CGZA 3HJEA 3NGDA 8ICAA 1BPDA 1IM4A 3B0XA 4R8UA 3GIJA 1KFSA 2ZIUB 8ICBA 5J0WA 3H0MB 2F8LA 2DGZA 4KLUA 2IOHA 5F3XB 3T5HA 2H3VA 1T3NA 4M6WB 1JXEA 1PZNA 5BOLA 3G6VA 3EPGA 1JUDA 1K1QA 5AKHA 4UB8U 1CI4A 1Z00A 2ES6A 2KV2A 2W8LA 2BQRA 5KFCA 4C7YA 4ED8A 4KLDA 1L3TA 2VA2A 3PW4A 3SAGA 2XY7A 1O08A 4QZCA 2JH1A 1RXWA 2KK0A 3ZD8A 1S77D 4AP9A 2YMPA 5AICA 2FPMA 3PSIA 1CRXA 3RAQA 4KN4A 1ZQAA 1NOMA 2MSNA 5J0SA 4I2AA 4O3MA 1ZQQA 1L7OA 7ICSA 4RQNA 3MABA 4G9BA 4M6WA 2F1JA 4Y2SA 4UB4A 4P4PA 1ZQRA 3MGVA 5KG7A 2W43A 3QZ7A 7ICPA 2XY5A 2BCRA 3K4GA 1BVSA 2JEFA 2CRXA 4IQVA 4QZGA 4J9RA 4RT2A 1ZQSA 1S0MA 3H7IA 1IG6A 3M1YA 2NO5A 2K8BB 4Z6CA 5DG9A 1KBUA 5AM3A 4BDPA 5CRXA 2G06A 8ICKA 4F4YA 2QB0A 3KD3A 2Z7JA 3KKAA 2ATLA 5TZVA 1J97A 4P0QB 1B22A 3F2CA 2HVIA 3M8SA 2N1RA 1NK5A 5EE1A 2K4EA 1T7PA 1M6YA 1RG6A 2NRWA 4QIWC 2FPLA 4JWMA 3AUOA 4YMNA 1F5SA 2WF5A 4UBCA 1ZYQA 2RLTA 3MFIA 8ICXA 7ICOA 2LI6A 3H8MA 4ZH4A 4QIWF 5AI0A 2DF4B 4KTQA 1SV4A 4ECVA 3QU5A 3WK4A 9ICVA 1XU4A 2ZJ5A 1L7NA 4P0PB 5CR0A 2BGWA 2EZXA 3V7KA 4LZDA 2KNJA 2ZXIA 1KFDA 5DLFA 4Y2RA 4KLJA 4ECWA 2RDJA 4P0QA 2GOLA 3U26A 1KDHA 5AI6A 2WHEA 3IN5A 3HILA 5G5GA 1SKSA 2RRDA 5EE3A 2BCQA 2NRTA 3D2NA 5KFDA 8ICQA 1KQQA 4ED0A 5A0LA 3GV8B 4F4KA 5J0TA 1X2IA 3AMZA 5ALWA 1X6IA 2M9NA 4Y2QA 5ALLA 5DBBA 5KAIU 3PW5A 3F53A 8ICEA 3GV7B 3ZD9A 4PJ0U 2F76X 2K4IA 3WK8A 5DB6A 2AH5A 3KHRA 1L6NA 2MUTB 2ZIWB 1SKWA 2PMZC 4RQ6A 4UB2A 4RZRA 2NRZA 4RQ2A 4ED3A 5KFLA 4FE3A 9ICBA 2ZJ8A 2HOQA 3H0RB 3TADC 1A0PA 4ED1A 3MR3A 3BQTA 4ECUA 5AIBA 2KD1A 1SZHA 4FBTA 2FMPA 3NRZA 2RHFA 2XICA 1KW4A 5JTIA 1NJYA 1IXRA 4PH5A 2YQEA 5IIIA 4JWNA 1O03A 3I28A 3SAFA 3H8SA 5IIMA 1EXNA 2KTQA 4F5PA 2KZZA 1XSPA 5ALSA 3CP8A 2P6UA 1RPLA 3LWLA 3IHQB 4YVZA 3M8RA 5DDYA 4YG2A 5ALJA 5KG5A 4OO1J 4CCHA 1TAMA 3H0LB 4HAIA 5AKYA 3TADA 2WTFA 2KVSA 4RUCA 4Z6EA 1SXEA 1L3VA 1L7MA 8ICVA 2XO7A 2Y9TA 3M7DA 1DRGA 4O5EA 4ED6A 1PK3A 4DS4A 1H38A 2W7PA 5FP0A 4CF3A 2DKXA 3SR6A 2W3RA 3RR8A 4YCXA 4M9JA 3H4BA 3MBYA 3B0YA 3QX7A 1UPHA 4KMUA 3M6KA 3RBEA 5L1KA 4DEZA 1ZETA 3SAHA 3O0FA 1KEJA 2G5IB 2HHUA 1TKDA 2W7OA 4P4MA 5ALXA 4FZMA 1NZPA 1L7PA 5TISU 3RJHA 1J2MA 3CYMA 4DSLA 3TARA 2IA6A 4EZ6A 3SEIA 5J0YA 3UPQA 2I1QA 3NVVA 4Q8EA 3IV6A 8ICLA 1MSWD 1NK4A 4OJOA 8ICFA 4F93B 1TVAA 4MF8A 4I2GA 2E3TA 1DGSA 1D8LA 5L9XA 4JV0A 2DPJA 3ISBA 3H8WA 1VLBA 4B9UA 3KFUF 2XI9A 4UASA 5J2IA 4MF2A 3Q8LA 2VIXA 5IIOA 5CB1A 2ISOA 2KICA 1SB3C 3GDXA 3WK5A 4O9MA 5AI9A 2ZJAA 2H3FA 1L8LA 1HEKA 4RQ7A 3RJJA 4YFKA 1NK6A 8ICZA 3N7SC 3L3FX 2J6SA 2B21A 2C22A 4ED2A 3TFSA 1S76D 2KSOB 5IINA 1PK1B 5J2CA 3V7LA 4PL1A 2HHVA 4Y2VA 2YX8A 3OTQA 2ZUDA 3QE9Y 2P6RA 5L1LA 3V72A 1MA7A 1ZQKA 8ICWA 4C80A 4FS1A 2BHNA 4EELA 5J2JA 3CW2C 4OJLA 3WK9A 2UVWA 1Z1BA 1ZD3A 5ALMA 1KLNA 2DFLA 2JGAA 1K5OA 3KHLA 4I2EA 1JX4A 4DL6A 1RQLA 4I2CA 5AKJA 1ZQUA 2J6TA 4J9LA 8ICIA 4K4IA 3RBDA 2XIDA 2HDOA 3AL0B 4ECRA 2KHVA 3E0FA 2AHOB 3PR4A 2KSOA 5G5HA 3ISCA 5J2DA 1U4BA 3PW7A 1PK1A 2AJQA 1XWLA 1U49A 4NLGA 7ICJA 4KLOA 4B9VA 5HHIA 2Q4TA 1RYSA 9ICQA 2IHMA 1JRPA 2A19A 3T5LA 4Y2UA 2ZXHA 1NKEA 3WKAA 2ESEA 2AXTU 4F5OA 3TAQA 4BWJA 3PVXA 1FIQA 2A1JA 3C1YA 5EWEA 2JZBA 4RNMA 3RJGA 3RJIA 1Q3VA 4XA5A 3N4MB 1NK7A 5J0UA 1BPEA 4BXOB 1A76A 2W8KA 3J81j 2KJ9A 5J2AA 5ALIA 2YMLA 3IDWA 4FO6A 4NM2A 1ZQDA 1LKYB 3F2BA 1B43A 2HBJA 8ICPA 8ICSA 4F4WA 1S0VA 2LM1A 1UQVA 3EZ5A 4KX3A 4GXIA 7ICRA 1NK8A 1XSLA 5ALGA 1S9FA 3LDAA 1NKCA 2F2AB 5KFPA 4DL2A 4PHEA 2EDUA
chains in the Genus database with same CATH topology
1Z1BA 2KHQA 5A0LA 2F77X 3SMVA 2OH2A 4GFJA 1UPHA 2PMZF 3M6KA 3MGVA 3F5AA 5T14A 2VKQA 3F53A 3PZPA 3PSPA 2JGAA 3SAHA 3O0FA 2HBKA 4ACOA 4NWIA 2F76X 2K4IA 4QJFB 2JMGA 2R18A 3ICXA 2G5IB 4CRXA 2LHTA 2W7OA 3HKZC 4CGZA 2HOIA 1L6NA 4C0ZA 2K89A 2CRXA 2ZIWB 3LYSA 1ED1A 2JH7A 4FZMA 2DQNB 2PMZC 2XIDA 2BDUA 1GO3F 3F5EA 3AL0B 2LBOA 2KKPA 2ZIVB 4QNLA 3CYMA 4AYBC 2KHVA 3E0FA 4NLCA 3KZXA 4BX9C 2K8BB 4A8EA 3HKZF 1T94A 2G09A 3LVWA 2HOFA 4FE3A 3M6ZA 1KBUA 5CRXA 2HOQA 1HIWA 2G06A 3GZFA 3ONNA 1WUDA 2Y0SF 2NV3A 3H0RB 1F44A 2K8CB 5KL8B 1ZQ1C 2Z7JA 4OJ5A 1A0PA 2ZIUB 2KKVA 4AYBF 2KEYA 2ZIXB 1PVQA 2KD1A 2MRLA 4P0QB 4OJOA 3H0MB 3F2CA 1SZHA 2F8LA 3LVVA 2Q4TA 2N1RA 2DGZA 2ZIWA 3PSTA 2RHFA 2K4EA 2CPRA 3DEEA 2H3VA 2WAQC 2ZIVA 2XICA 2KOBA 2Y0SC 4ICAA 4BJQA 4CDGA 3C28A 3KFUF 3NRWA 2XI9A 4BUGA 2HMXA 2ZXHA 4QIWC 1D8BA 1NZBA 3SAFA 2VIXA 2H3ZA 2OXOA 2W03A 2WAQF 2KICA 2KVCA 2WB1F 4OJ6A 2ZIUA 5KL1B 3CP8A 1URJA 4IC9A 2KIWA 3N7PD 3PSFA 3N7RC 3C29A 2G5HB 4QIWF 2G08A 2LKYA 2DF4B 4PL2A 1Q3UA 2RP5A 3AQFA 1Q3VA 4JMUA 2H3FA 2K4HA 1OUQA 1HEKA 1ECWA 2HBLA 1PVPA 4NLBA 2KV2A 4NV0A 4OJPA 3VC8A 2JHDA 2MA1A 2YB4A 3L3FX 3N7SC 1XNSA 1P7DA 5C0YA 1IIPA 2LYAA 2KJ9A 2WB1C 1XO0A 2OM6A 2XVTA 4OO1J 2E5SA 3GU3A 1TAMA 2M0NA 1A6SA 2HBMA 4P0PB 3H0LB 3RF9A 3SAGA 4WJ3B 5HR7A 3D2SA 2CN1A 2VJ5A 3IP4B 3F2BA 3IG5A 2K8AA 4PL1A 2KNJA 4U7CA 2HBJA 2OYYA 2ZXIA 3IG8A 4KX5A 2JH1A 2YX8A 2E1FA 2LYBA 2KJ5A 3M7DA 2ZIXA 3VCBA 3T79A 1PVRA 4P0QA 4U6PA 2GOLA 2H3IA 1DRGA 4KX3A 2YB1A 4FZNA 3PSIA 1CRXA 4KMOB 3SQIA 2W7PA 3IN5A 3K1ZA 3ALRA 3NUQA 2GH1A 2KJ8A 1Z19A 3AQEA 1MA7A 3OPXA 2E1EA 3CRXA 5HR6A 4O3MA 3RFAA 3F2DA 2G07A 2H3QA 3D2QA 2ZG6A 2VJ4A 2A3VA 1YT3A 2RRDA 2F2AB 4P0PA 4FZLA 2W04A 2G0AA 4OJLA 3D2NA 2D6FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZH A; 
#chains in the Genus database with same CATH topology
 1L3S A;  4R8U B;  4J9Q A;  5EOZ A;  1FO4 A;  5J2F A;  1SL2 A;  3ICX A;  2V4Q A;  3BQ1 A;  2IMW P;  1X66 A;  1S5L U;  2EAM A;  5J2H A;  2BPG A;  5CEH A;  4ELV A;  5F9L A;  5AI5 A;  4AYB C;  4EEN A;  5J8Y C;  2C2E A;  4BX9 C;  3PV8 A;  2JV3 A;  1JXL A;  1TE2 A;  4DWI A;  4Y2P A;  1F44 A;  1ZQ1 C;  4AYB F;  2BCS A;  7ICU A;  4UB1 A;  3A0B U;  3PST A;  5ALN A;  4UAT A;  1BPY A;  1Z00 B;  4M47 A;  4ZOH C;  4M9N A;  5HP4 A;  2WF7 A;  1ZQP A;  5DG7 A;  5L1I A;  3NRW A;  3A0H U;  4UQG A;  3PMN A;  1KTQ A;  1N56 A;  2K4P A;  5KL1 B;  3C29 A;  5KFM A;  1X9S A;  4QWD A;  4NJ8 A;  4NL9 C;  8ICC A;  2IHN A;  1LVH A;  3V6K A;  5J8Y A;  3RJE A;  1TK0 A;  5IIK A;  1ZQL A;  2CN1 A;  3NVZ A;  1C7Y A;  3PNC A;  9ICP A;  2OYY A;  4KLH A;  2FLN A;  4I2D A;  1T3Q A;  2HW3 A;  1ZQX A;  1C20 A;  4B9M A;  4O3P A;  5DB7 A;  3OPX A;  3UXN A;  5KG6 A;  3RTV A;  1ZQW A;  3MDA A;  1ZQE A;  3QXG A;  1KN5 A;  5IIJ A;  1U45 A;  1YT3 A;  4C8K A;  9ICR A;  4DOA A;  1QQ6 A;  3EYZ A;  3RB4 A;  3RB0 A;  4UB5 A;  2ISP A;  4RQ4 A;  4PGX A;  2QB0 B;  4ACO A;  4NWI A;  5E79 U;  1QQ7 A;  2BKE A;  7ICT A;  3L4P A;  2R8J A;  2K89 A;  2AQ0 A;  2JXJ A;  5L1M A;  2WF6 A;  3RAX A;  2W3S A;  2JEI A;  2IOF A;  2G09 A;  2ZTE A;  7ICF A;  4RUA A;  1X9M A;  1ZQG A;  2BR0 A;  9ICJ A;  1SGG A;  4DL4 A;  5ALF A;  2ZIX B;  1JN3 A;  4LZG A;  3QU2 A;  3FAH A;  3HP6 A;  2W55 A;  4Y2Y A;  1COK A;  4YR2 A;  3AU2 A;  2XY6 A;  2FMQ A;  2WAQ C;  4US9 A;  7ICH A;  4J9S A;  4BUG A;  2E8N A;  5DKW A;  4QW9 A;  2YN4 A;  2H3Z A;  2JEG A;  4DO9 A;  2VA3 A;  1KKX A;  2WAQ F;  1S0N A;  4GLX A;  3BZC A;  2NRV A;  4CNQ A;  1ZQM A;  4DSF A;  1OUQ A;  2J6U A;  1D8Y A;  3BDP A;  2JHD A;  5C0Y A;  4UBB A;  4K4H A;  2Q0Z X;  3WK7 A;  5KFX A;  4C8L A;  5KT2 A;  3IP4 B;  1S0O A;  4KLF A;  2YTU A;  3DV9 A;  2NYV A;  4R65 A;  3M9O B;  5AI8 A;  2ZIX A;  1V9P A;  2P35 A;  5KG4 A;  4KMO B;  8ICH A;  4USA A;  1WCL A;  5ALO A;  4QZA A;  9ICA A;  4I29 A;  1A77 A;  4B9S A;  4J9N A;  2D6F C;  3NAS A;  4DFK A;  5KFQ A;  1RYR A;  2JMG A;  4TUP A;  4DQR A;  1ZJM A;  2PFQ A;  3KHG A;  4C0Z A;  2EAO A;  3GFK B;  5D4B A;  1KL9 A;  2UVV A;  3AN1 A;  4EZ9 A;  4F2S A;  5JU5 A;  3NVY A;  4DF8 A;  5KT7 A;  1DXS A;  1NNL A;  5KFY A;  4PHA A;  3ONN A;  1RYU A;  2Y0S F;  4JV2 A;  1SXD A;  1ZRN A;  5HML A;  3HX0 A;  4RPX A;  5HMM A;  4DFP A;  5AKK A;  3C28 A;  3RH6 A;  4B9L A;  4US8 A;  3T5J A;  2HMX A;  5CWR A;  4I2H A;  4MEY A;  4UAR A;  3TAN A;  3QU9 A;  3ZDA A;  1DGJ A;  2WB1 F;  2I9G A;  4OJ6 A;  3TAP A;  4J03 A;  4G3I A;  3K1R B;  2G08 A;  5KFA A;  3AQF A;  4RQ0 A;  2ASJ A;  3QNM A;  2KZM A;  4EEY A;  8ICU A;  1UA1 A;  3E2E A;  2L5Y A;  2KZ3 A;  2QKQ A;  4ECY A;  4LJX A;  3M9N B;  8ICT A;  4MHV A;  2PI5 A;  5L1J A;  4X5V A;  3GQC A;  2A1A A;  5J0P A;  2KMD A;  5AKG A;  5D49 A;  5AM5 A;  5DG8 A;  5ALP A;  4QZI A;  3Q8K A;  5AM1 A;  4O3O A;  3MGI A;  1MQ3 A;  1V38 A;  4KLQ A;  3MR5 A;  3D2Q A;  4O3N A;  2BQU A;  4KLM A;  2H5X A;  2PFN A;  2G0A A;  9ICM A;  4Q44 A;  3QZ8 A;  1WCN A;  3ZDB A;  5ALZ A;  2VA8 A;  4GFJ A;  2IBK A;  4RQ3 A;  9ICK A;  2VKQ A;  5AKE A;  4EBD A;  4NLZ A;  2XGQ A;  2HHS A;  4EEK A;  4J9K A;  3QUB A;  5KFB A;  3C21 A;  2BZF A;  3KBB A;  1T8E A;  1QCK A;  2HOI A;  3LYS A;  4DQP A;  1GO3 F;  1FFU A;  3FYH A;  4TQS A;  2FJ6 A;  4PPX A;  5IIL A;  4J9O A;  5F9N A;  2NO4 A;  5EWF A;  3MR2 A;  5BPC A;  5J29 A;  1YZ7 A;  5KFO A;  4JK1 A;  5DLG A;  1RXV A;  4BWM A;  2CXY A;  4CDG A;  3V7J A;  4I27 A;  4I2I A;  1D8B A;  5KAF U;  2FLL A;  1ZQB A;  5ALE A;  7ICG A;  1ZQI A;  4EBC A;  2C28 A;  2MAX A;  3RR7 A;  1D9F A;  4IC9 A;  4YMM A;  4JMU A;  1ECW A;  2XCP A;  1D9D A;  4UAU A;  2LYA A;  1JMS A;  1MN8 A;  5J0X A;  2Y1J A;  4IR9 A;  2QB1 A;  4DSI A;  3GU3 A;  3BS7 A;  5DQG A;  2OCE A;  4DCC A;  2FE9 A;  1ZQT A;  3HT3 A;  2VJ5 A;  1SIJ A;  3C1Z A;  4QWE A;  4EBE A;  4RQ1 A;  3IG8 A;  4K4G A;  3BZK A;  2PI4 A;  2HHW A;  2K60 A;  3RH5 A;  5J2G A;  2OHF A;  3WKD A;  2YB1 A;  3UQ0 A;  3BQ2 A;  9ICL A;  4TUQ A;  3K1Z A;  3ALR A;  4Q43 A;  4F5Q A;  5AK5 A;  4JV1 A;  3CRX A;  3WKE A;  2YY6 A;  4FS2 A;  5EWG A;  1ZQH A;  1ARO P;  2O6K A;  3C23 A;  4FZL A;  4M9G A;  3OJU A;  5CHG A;  2KIV A;  3IRU A;  5J2B A;  2OH2 A;  4GC7 A;  3MFH A;  3KZI U;  4O5C A;  2B6G A;  4NLK A;  7ICQ A;  3QU4 A;  3ZDE A;  3M9M B;  4J9P A;  4GXK A;  3T5K A;  4NM1 A;  2PXI A;  3HKZ C;  4CF5 A;  5ALK A;  1MQ2 A;  1LV5 A;  3TFR A;  1SWV A;  3ZI4 A;  1N48 A;  4IQT A;  2KKP A;  3PX4 A;  1WWV A;  1N5X A;  2D3D A;  1NK0 A;  3HKZ F;  4F2R A;  1F0M A;  1TAQ A;  2K8C B;  5KL8 B;  2A1J B;  1V97 A;  2JZB B;  3GV5 B;  1RDF A;  1HUO A;  4O5K A;  5AM0 A;  1ZQY A;  3NVW A;  4J9M A;  3GIK A;  4R63 A;  4YXJ A;  1ZXI A;  2AGP A;  3ORY A;  4QZ8 A;  3UXP A;  1ZQF A;  5ALU A;  2ZUC A;  4CE6 A;  2RDI A;  2HHQ A;  1SV0 C;  5AIA A;  2W9C A;  3N7P D;  4P4O A;  5AK6 A;  5JUM A;  3UMB A;  3BS5 A;  1PVP A;  2HBL A;  3AM9 A;  7ICL A;  1X9W A;  3FM9 A;  1N62 A;  2M0N A;  1X6J A;  4UAZ A;  1N60 A;  4F4Z A;  4WJ3 B;  4KLI A;  5KFJ A;  1U9L A;  1RM6 C;  8ICO A;  4KX5 A;  1Z4O A;  3RJF A;  3V6H A;  2B0C A;  1L5U A;  4MFF A;  4C8O A;  1KRP A;  2R8K A;  2GH1 A;  4BGD A;  1Z19 A;  3PX0 A;  2E1E A;  1MC8 A;  5GTH U;  2H3Q A;  2ZTC A;  9ICW A;  4NY8 A;  5ALT A;  3ZDC A;  2HHT A;  9ICX A;  4GIB A;  1SV0 A;  1QSS A;  4DL7 A;  3H4D A;  4XRH A;  4IRK A;  4F8R A;  4DL3 A;  1ZQJ A;  2R18 A;  1PUZ A;  2F1I A;  9ICT A;  4DQQ A;  1N63 A;  2EQY A;  2XC9 A;  3OHA A;  4C4T A;  4KLL A;  4XQ8 A;  1SL1 A;  4YMO A;  5K4L A;  3LVW A;  2HI0 A;  4IL6 U;  1JRO A;  1WUD A;  1LB2 B;  2EAN A;  2NV3 A;  3AU6 A;  1S8O A;  5AM4 A;  3ISD A;  1PVQ A;  4YR3 A;  4DFM A;  1Q8K A;  4UAY A;  5J0O A;  4TUR A;  2ZIV A;  5KNI A;  3OSP A;  2C2R A;  9ICO A;  4BJQ A;  2BPF A;  1TAU A;  5DGB A;  2PKE A;  1OXJ A;  5KT6 A;  2LM4 A;  4EX7 A;  4NXZ A;  2KE7 A;  2W03 A;  4P2H A;  5DGA A;  2AGQ A;  8ICG A;  1URJ A;  8ICM A;  2KIW A;  3PSF A;  4I2B A;  2G5H B;  2RQ5 A;  1XS9 D;  2R8G A;  3C2M A;  5J2E A;  5KTQ A;  4NLB A;  2HVH A;  2MU2 A;  4NV0 A;  4QZ9 A;  3PW2 A;  4KLT A;  2MA1 A;  3PY8 A;  5AKX A;  2UVR A;  4QZH A;  4DF4 A;  5KFI A;  2E5S A;  1A6S A;  2KN7 A;  3RF9 A;  3C5F A;  2ASL A;  2XGP A;  4FBU A;  3HPO A;  3D2S A;  4M9L A;  4MFC A;  1Q46 A;  3WU2 U;  4U7C A;  4CF4 A;  2W9B A;  1CUK A;  5DB9 A;  3AEV A;  5HHH A;  4JB3 A;  3SD7 A;  3NUQ A;  2KJ8 A;  5KFH A;  1J2N A;  3AQE A;  5HR6 A;  4F5N A;  4O3R A;  3RB6 A;  1ZRM A;  4KLE A;  1HUZ A;  2IOF K;  4OD0 A;  4DSK A;  2WF8 A;  2PFO A;  1T4G A;  8ICR A;  1K1S A;  3PR5 B;  2LHT A;  8ICY A;  1YZ6 A;  2E8O A;  3QU7 A;  1BGX T;  5KT4 A;  5D46 A;  4F5R A;  4A8E A;  3WKC A;  3MC1 A;  3GIM A;  4M2Y A;  7ICI A;  3ED5 A;  2KEY A;  4NL9 A;  4UB3 A;  3SV3 A;  1Z1V A;  5KFV A;  3JPN A;  4C8N A;  5KFT A;  5EE9 A;  4QZB A;  9ICI A;  5ALV A;  5KFW A;  2NRX A;  3SV4 A;  5CA7 A;  4F50 A;  5KFF A;  4ECS A;  2ZIU A;  5KT5 A;  5C5J A;  1DK3 A;  2DL0 A;  3PO4 A;  1BPB A;  3G6X A;  1ZQZ A;  2BPC A;  3KKA C;  2AGO A;  1BNO A;  2KFN A;  2QAR B;  4DQS A;  3GII A;  1IIP A;  4KIT B;  3N28 A;  5AK3 A;  3BJY A;  2FI1 A;  2R8I A;  4Y2J A;  4I28 A;  1AQ6 A;  2W9M A;  3IG5 A;  3KHH A;  2I6X A;  4RQ5 A;  4M0A A;  2LYB A;  2KJ5 A;  4QWB A;  3V6J A;  3OSN A;  2GWS A;  4Y2T A;  3UXO A;  9ICF A;  2FDR A;  2G07 A;  2VJ4 A;  2W04 A;  3SEN A;  2P66 A;  4ECT A;  1XC9 A;  5KFU A;  5JRT A;  4QZF A;  3OGU A;  3F5A A;  4ED7 A;  4ELU A;  3RB3 A;  5DBA A;  4F92 B;  4DSJ A;  2GLE A;  2HBK A;  2F3N A;  2D8C A;  4YQW A;  3GIL A;  1WWU A;  2QAR A;  3RH4 A;  1S97 A;  4ECZ A;  7ICN A;  3UM9 A;  1WG8 A;  2BDU A;  1ZD5 A;  2EZY A;  3F5E A;  2DPI A;  3JPS A;  2AU0 A;  4YR0 A;  3EPI A;  5DDM A;  2HOF A;  2OEH A;  3I1Y A;  2DBY A;  4RQ8 A;  7ICV A;  3KTQ A;  1HIW A;  5EE0 A;  5KFK A;  1NJZ A;  3Q8P B;  2F44 A;  3QEA Z;  2KP7 A;  4RNN A;  2E8P A;  1NI3 A;  3RRH A;  3PO5 A;  3LK9 A;  2CPR A;  3JPO A;  3IM1 A;  1NKB A;  3R9K A;  2Y0S C;  1Y88 A;  4ICA A;  2BCU A;  7ICE A;  2DUY A;  1Z4N A;  4RPZ A;  4R66 A;  1BPX A;  9ICG A;  3HW8 A;  2OXO A;  3QYP A;  5AKI A;  2EZZ A;  3RJK A;  4O3S A;  1QTM A;  4QWA A;  3Q8R B;  1U48 A;  1IV8 A;  2KFZ A;  1TK5 A;  4PL2 A;  3JPR A;  1S10 A;  1Z3E B;  1NJX A;  2V9W A;  2EH9 A;  1XNS A;  4KLS A;  1P7D A;  3SYZ A;  5ALH A;  4F3O A;  2WB1 C;  1XO0 A;  2OM6 A;  2WF9 A;  2XVT A;  3E58 A;  4ECX A;  1QSL A;  3T3F A;  3K75 D;  3L5K A;  4DLG A;  3FDS A;  4HYK A;  2JEJ A;  1PVR A;  4IRC A;  3UMC A;  5DB8 A;  1FFV A;  2W54 A;  3SQI A;  1X9X A;  2F8K A;  4M04 A;  2Y1I A;  4RPY A;  5KG3 A;  4EYI B;  4KN7 A;  2ZUB A;  2A3V A;  4Z6F A;  4P0P A;  3CNH A;  2F77 X;  4NLN A;  4UAW A;  2PMZ F;  2JR5 A;  3KOO A;  1QLN A;  3MDC A;  1COO A;  2JH7 A;  3TKA A;  2DQN B;  9ICS A;  5KT3 A;  3TQ1 A;  5AKZ A;  5J2K A;  1ZQC A;  4NLC A;  4B9N A;  1T94 A;  3Q8S B;  5DQH A;  3M6Z A;  1SWW A;  4Q8F A;  3GZF A;  4OJ5 A;  2PFP A;  2KG5 A;  2MRL A;  2JRZ A;  2MUT A;  2ZIW A;  2QLT A;  5KFN A;  4FFD A;  3ETL A;  9ICU A;  3DEE A;  4XUS A;  4RNO A;  3ZDD A;  2ALZ A;  4EYH B;  4DFD A;  3H8J A;  4YN4 A;  1ZQV A;  1WYG A;  2W9A A;  1X40 A;  4Y2X A;  4I2F A;  2RP5 A;  4UAV A;  3QUQ A;  2YB4 A;  4PZO A;  4C8M A;  4QWC A;  1HJP A;  2HBM A;  5HR7 A;  3MR6 A;  5KG2 A;  4ECQ A;  4PHP A;  5J0Q A;  2K8A A;  4DFJ A;  4I2J A;  3BQ0 A;  1ZOL A;  2WFA A;  4QW8 A;  3EW9 A;  3WK6 A;  1VDV A;  1UT5 A;  2AQ4 A;  4FZN A;  4EX6 A;  4DS5 A;  2FPK A;  3HRD D;  2ZG6 A;  3G6Y A;  2FLP A;  4F91 B;  5KG1 A;  4MEX A;  5AI4 A;  3QUT A;  5T14 A;  4DOB A;  4RU9 A;  3PZP A;  4IQW A;  4LVS A;  5KFE A;  1NJW A;  2E8M A;  1OW5 A;  1ED1 A;  5AK4 A;  3PX6 A;  1N2X A;  2LBO A;  4DQI A;  1UA0 A;  1SZP A;  1RQN A;  3KZX A;  3SI8 A;  1DK2 A;  1BPZ A;  3ETR A;  5B5E U;  1QH9 A;  3HWT A;  4YXM A;  2DKZ A;  1UCV A;  3C5G A;  3Q8M A;  2KKV A;  2W9C B;  3LVV A;  3LWM A;  3EWA A;  5KFG A;  3BS5 B;  3QUC A;  3JPQ A;  4IR1 A;  3C2K A;  5HNK A;  7ICM A;  3SZ2 A;  2KOB A;  2OWO A;  3DDH A;  1ZQO A;  1N61 A;  1ZQN A;  4O3Q A;  1TK8 A;  1U47 A;  5KG0 A;  1ZD4 A;  2LYH A;  4C4S A;  5ALD A;  1CEZ A;  2R8H A;  1VJ5 A;  2LKY A;  1Q3U A;  4C4R A;  3EUB 2;  4M9H A;  3OJS A;  2K4H A;  5ALR A;  4OJP A;  5ALY A;  3PW0 A;  2YMM A;  4PHD A;  3Q8Q B;  2V4R A;  4E0D A;  4O0I A;  1DOQ A;  4IRD A;  1B4F A;  4QZE A;  3TAC B;  4B6J A;  5CJ7 A;  4UB6 U;  2VAN A;  3S6J A;  3VCB A;  4MFA A;  3BQ7 A;  2H3I A;  3MGH A;  1JAL A;  4JUZ A;  3N97 B;  1UHU A;  5DBC A;  3RFA A;  3F2D A;  4F4X A;  1QSY A;  8ICN A;  1NK9 A;  3NTU A;  2BCV A;  4F71 A;  1ZJN A;  2KHQ A;  4YD2 A;  9ICH A;  1TFR A;  4KLG A;  3NS1 A;  4DSE A;  4YD1 A;  4UW9 A;  5AM2 A;  4QJF B;  5CP2 A;  4CRX A;  2LMR A;  2HHX A;  4RT3 A;  1SKR A;  1X42 A;  1TV9 A;  1N5W A;  4IQU A;  5KFR A;  2ASD A;  2LPE A;  2HCF A;  2ZIV B;  4QNL A;  4IS7 A;  2EAP A;  5ALQ A;  2F1H A;  2GO7 A;  2ODG A;  4DL5 A;  2W11 A;  3UMG A;  4PGQ A;  1RZT A;  4QZD A;  8ICJ A;  4DLE A;  3TI0 A;  4PGY A;  4OCZ A;  9ICN A;  2XCA A;  3WKB A;  1L8O A;  1JI7 A;  3QEB Z;  4C7Z A;  3B9J A;  4TQR A;  3THV A;  1NZB A;  1KFT A;  4TUS A;  2HSZ A;  2FMS A;  3PML A;  2UVU A;  2KVC A;  3I76 A;  1XSN A;  4F72 A;  3N7R C;  2DWQ A;  4DOC A;  2ZTD A;  1L3U A;  2W9B B;  1ZD2 P;  4YP3 A;  1UT8 A;  3VC8 A;  4R64 A;  1BNP A;  4GC6 A;  7ICK A;  1V85 A;  5AKL A;  3OHB A;  1FEZ A;  2I5H A;  2Y9U A;  5DQI A;  4ELT A;  1XO1 A;  4B9T A;  3JPT A;  1B0X A;  5GTI U;  2E1F A;  4Q45 A;  5AHX A;  3T79 A;  2C2D A;  3RRG A;  5KFZ A;  4U6P A;  5H2F U;  2YMQ A;  1JIH A;  3H40 A;  4BXO A;  3UQ2 A;  4GXJ A;  4RQM A;  1SL0 A;  4Z6D A;  1LKY A;  3JPP A;  2BQ3 A;  3SMV A;  5BOM A;  1KSP A;  3PSP A;  3C2L A;  5J0R A;  3D6J A;  5KFS A;  3FC4 A;  2BDP A;  5B66 U;  9ICE A;  4PZN A;  1QQ5 A;  9ICC A;  4CGZ A;  3HJE A;  3NGD A;  8ICA A;  1BPD A;  1IM4 A;  3B0X A;  4R8U A;  3GIJ A;  1KFS A;  2ZIU B;  8ICB A;  5J0W A;  3H0M B;  2F8L A;  2DGZ A;  4KLU A;  2IOH A;  5F3X B;  3T5H A;  2H3V A;  1T3N A;  4M6W B;  1JXE A;  1PZN A;  5BOL A;  3G6V A;  3EPG A;  1JUD A;  1K1Q A;  5AKH A;  4UB8 U;  1CI4 A;  1Z00 A;  2ES6 A;  2KV2 A;  2W8L A;  2BQR A;  5KFC A;  4C7Y A;  4ED8 A;  4KLD A;  1L3T A;  2VA2 A;  3PW4 A;  3SAG A;  2XY7 A;  1O08 A;  4QZC A;  2JH1 A;  1RXW A;  2KK0 A;  3ZD8 A;  1S77 D;  4AP9 A;  2YMP A;  5AIC A;  2FPM A;  3PSI A;  1CRX A;  3RAQ A;  4KN4 A;  1ZQA A;  1NOM A;  2MSN A;  5J0S A;  4I2A A;  4O3M A;  1ZQQ A;  1L7O A;  7ICS A;  4RQN A;  3MAB A;  4G9B A;  4M6W A;  2F1J A;  4Y2S A;  4UB4 A;  4P4P A;  1ZQR A;  3MGV A;  5KG7 A;  2W43 A;  3QZ7 A;  7ICP A;  2XY5 A;  2BCR A;  3K4G A;  1BVS A;  2JEF A;  2CRX A;  4IQV A;  4QZG A;  4J9R A;  4RT2 A;  1ZQS A;  1S0M A;  3H7I A;  1IG6 A;  3M1Y A;  2NO5 A;  2K8B B;  4Z6C A;  5DG9 A;  1KBU A;  5AM3 A;  4BDP A;  5CRX A;  2G06 A;  8ICK A;  4F4Y A;  2QB0 A;  3KD3 A;  2Z7J A;  3KKA A;  2ATL A;  5TZV A;  1J97 A;  4P0Q B;  1B22 A;  3F2C A;  2HVI A;  3M8S A;  2N1R A;  1NK5 A;  5EE1 A;  2K4E A;  1T7P A;  1M6Y A;  1RG6 A;  2NRW A;  4QIW C;  2FPL A;  4JWM A;  3AUO A;  4YMN A;  1F5S A;  2WF5 A;  4UBC A;  1ZYQ A;  2RLT A;  3MFI A;  8ICX A;  7ICO A;  2LI6 A;  3H8M A;  4ZH4 A;  4QIW F;  5AI0 A;  2DF4 B;  4KTQ A;  1SV4 A;  4ECV A;  3QU5 A;  3WK4 A;  9ICV A;  1XU4 A;  2ZJ5 A;  1L7N A;  4P0P B;  5CR0 A;  2BGW A;  2EZX A;  3V7K A;  4LZD A;  2KNJ A;  2ZXI A;  1KFD A;  5DLF A;  4Y2R A;  4KLJ A;  4ECW A;  2RDJ A;  4P0Q A;  2GOL A;  3U26 A;  1KDH A;  5AI6 A;  2WHE A;  3IN5 A;  3HIL A;  5G5G A;  1SKS A;  2RRD A;  5EE3 A;  2BCQ A;  2NRT A;  3D2N A;  5KFD A;  8ICQ A;  1KQQ A;  4ED0 A;  5A0L A;  3GV8 B;  4F4K A;  5J0T A;  1X2I A;  3AMZ A;  5ALW A;  1X6I A;  2M9N A;  4Y2Q A;  5ALL A;  5DBB A;  5KAI U;  3PW5 A;  3F53 A;  8ICE A;  3GV7 B;  3ZD9 A;  4PJ0 U;  2F76 X;  2K4I A;  3WK8 A;  5DB6 A;  2AH5 A;  3KHR A;  1L6N A;  2MUT B;  2ZIW B;  1SKW A;  2PMZ C;  4RQ6 A;  4UB2 A;  4RZR A;  2NRZ A;  4RQ2 A;  4ED3 A;  5KFL A;  4FE3 A;  9ICB A;  2ZJ8 A;  2HOQ A;  3H0R B;  3TAD C;  1A0P A;  4ED1 A;  3MR3 A;  3BQT A;  4ECU A;  5AIB A;  2KD1 A;  1SZH A;  4FBT A;  2FMP A;  3NRZ A;  2RHF A;  2XIC A;  1KW4 A;  5JTI A;  1NJY A;  1IXR A;  4PH5 A;  2YQE A;  5III A;  4JWN A;  1O03 A;  3I28 A;  3SAF A;  3H8S A;  5IIM A;  1EXN A;  2KTQ A;  4F5P A;  2KZZ A;  1XSP A;  5ALS A;  3CP8 A;  2P6U A;  1RPL A;  3LWL A;  3IHQ B;  4YVZ A;  3M8R A;  5DDY A;  4YG2 A;  5ALJ A;  5KG5 A;  4OO1 J;  4CCH A;  1TAM A;  3H0L B;  4HAI A;  5AKY A;  3TAD A;  2WTF A;  2KVS A;  4RUC A;  4Z6E A;  1SXE A;  1L3V A;  1L7M A;  8ICV A;  2XO7 A;  2Y9T A;  3M7D A;  1DRG A;  4O5E A;  4ED6 A;  1PK3 A;  4DS4 A;  1H38 A;  2W7P A;  5FP0 A;  4CF3 A;  2DKX A;  3SR6 A;  2W3R A;  3RR8 A;  4YCX A;  4M9J A;  3H4B A;  3MBY A;  3B0Y A;  3QX7 A;  1UPH A;  4KMU A;  3M6K A;  3RBE A;  5L1K A;  4DEZ A;  1ZET A;  3SAH A;  3O0F A;  1KEJ A;  2G5I B;  2HHU A;  1TKD A;  2W7O A;  4P4M A;  5ALX A;  4FZM A;  1NZP A;  1L7P A;  5TIS U;  3RJH A;  1J2M A;  3CYM A;  4DSL A;  3TAR A;  2IA6 A;  4EZ6 A;  3SEI A;  5J0Y A;  3UPQ A;  2I1Q A;  3NVV A;  4Q8E A;  3IV6 A;  8ICL A;  1MSW D;  1NK4 A;  4OJO A;  8ICF A;  4F93 B;  1TVA A;  4MF8 A;  4I2G A;  2E3T A;  1DGS A;  1D8L A;  5L9X A;  4JV0 A;  2DPJ A;  3ISB A;  3H8W A;  1VLB A;  4B9U A;  3KFU F;  2XI9 A;  4UAS A;  5J2I A;  4MF2 A;  3Q8L A;  2VIX A;  5IIO A;  5CB1 A;  2ISO A;  2KIC A;  1SB3 C;  3GDX A;  3WK5 A;  4O9M A;  5AI9 A;  2ZJA A;  2H3F A;  1L8L A;  1HEK A;  4RQ7 A;  3RJJ A;  4YFK A;  1NK6 A;  8ICZ A;  3N7S C;  3L3F X;  2J6S A;  2B21 A;  2C22 A;  4ED2 A;  3TFS A;  1S76 D;  2KSO B;  5IIN A;  1PK1 B;  5J2C A;  3V7L A;  4PL1 A;  2HHV A;  4Y2V A;  2YX8 A;  3OTQ A;  2ZUD A;  3QE9 Y;  2P6R A;  5L1L A;  3V72 A;  1MA7 A;  1ZQK A;  8ICW A;  4C80 A;  4FS1 A;  2BHN A;  4EEL A;  5J2J A;  3CW2 C;  4OJL A;  3WK9 A;  2UVW A;  1Z1B A;  1ZD3 A;  5ALM A;  1KLN A;  2DFL A;  2JGA A;  1K5O A;  3KHL A;  4I2E A;  1JX4 A;  4DL6 A;  1RQL A;  4I2C A;  5AKJ A;  1ZQU A;  2J6T A;  4J9L A;  8ICI A;  4K4I A;  3RBD A;  2XID A;  2HDO A;  3AL0 B;  4ECR A;  2KHV A;  3E0F A;  2AHO B;  3PR4 A;  2KSO A;  5G5H A;  3ISC A;  5J2D A;  1U4B A;  3PW7 A;  1PK1 A;  2AJQ A;  1XWL A;  1U49 A;  4NLG A;  7ICJ A;  4KLO A;  4B9V A;  5HHI A;  2Q4T A;  1RYS A;  9ICQ A;  2IHM A;  1JRP A;  2A19 A;  3T5L A;  4Y2U A;  2ZXH A;  1NKE A;  3WKA A;  2ESE A;  2AXT U;  4F5O A;  3TAQ A;  4BWJ A;  3PVX A;  1FIQ A;  2A1J A;  3C1Y A;  5EWE A;  2JZB A;  4RNM A;  3RJG A;  3RJI A;  1Q3V A;  4XA5 A;  3N4M B;  1NK7 A;  5J0U A;  1BPE A;  4BXO B;  1A76 A;  2W8K A;  3J81 j;  2KJ9 A;  5J2A A;  5ALI A;  2YML A;  3IDW A;  4FO6 A;  4NM2 A;  1ZQD A;  1LKY B;  3F2B A;  1B43 A;  2HBJ A;  8ICP A;  8ICS A;  4F4W A;  1S0V A;  2LM1 A;  1UQV A;  3EZ5 A;  4KX3 A;  4GXI A;  7ICR A;  1NK8 A;  1XSL A;  5ALG A;  1S9F A;  3LDA A;  1NKC A;  2F2A B;  5KFP A;  4DL2 A;  4PHE A;  2EDU A; 
#chains in the Genus database with same CATH homology
 1Z1B A;  2KHQ A;  5A0L A;  2F77 X;  3SMV A;  2OH2 A;  4GFJ A;  1UPH A;  2PMZ F;  3M6K A;  3MGV A;  3F5A A;  5T14 A;  2VKQ A;  3F53 A;  3PZP A;  3PSP A;  2JGA A;  3SAH A;  3O0F A;  2HBK A;  4ACO A;  4NWI A;  2F76 X;  2K4I A;  4QJF B;  2JMG A;  2R18 A;  3ICX A;  2G5I B;  4CRX A;  2LHT A;  2W7O A;  3HKZ C;  4CGZ A;  2HOI A;  1L6N A;  4C0Z A;  2K89 A;  2CRX A;  2ZIW B;  3LYS A;  1ED1 A;  2JH7 A;  4FZM A;  2DQN B;  2PMZ C;  2XID A;  2BDU A;  1GO3 F;  3F5E A;  3AL0 B;  2LBO A;  2KKP A;  2ZIV B;  4QNL A;  3CYM A;  4AYB C;  2KHV A;  3E0F A;  4NLC A;  3KZX A;  4BX9 C;  2K8B B;  4A8E A;  3HKZ F;  1T94 A;  2G09 A;  3LVW A;  2HOF A;  4FE3 A;  3M6Z A;  1KBU A;  5CRX A;  2HOQ A;  1HIW A;  2G06 A;  3GZF A;  3ONN A;  1WUD A;  2Y0S F;  2NV3 A;  3H0R B;  1F44 A;  2K8C B;  5KL8 B;  1ZQ1 C;  2Z7J A;  4OJ5 A;  1A0P A;  2ZIU B;  2KKV A;  4AYB F;  2KEY A;  2ZIX B;  1PVQ A;  2KD1 A;  2MRL A;  4P0Q B;  4OJO A;  3H0M B;  3F2C A;  1SZH A;  2F8L A;  3LVV A;  2Q4T A;  2N1R A;  2DGZ A;  2ZIW A;  3PST A;  2RHF A;  2K4E A;  2CPR A;  3DEE A;  2H3V A;  2WAQ C;  2ZIV A;  2XIC A;  2KOB A;  2Y0S C;  4ICA A;  4BJQ A;  4CDG A;  3C28 A;  3KFU F;  3NRW A;  2XI9 A;  4BUG A;  2HMX A;  2ZXH A;  4QIW C;  1D8B A;  1NZB A;  3SAF A;  2VIX A;  2H3Z A;  2OXO A;  2W03 A;  2WAQ F;  2KIC A;  2KVC A;  2WB1 F;  4OJ6 A;  2ZIU A;  5KL1 B;  3CP8 A;  1URJ A;  4IC9 A;  2KIW A;  3N7P D;  3PSF A;  3N7R C;  3C29 A;  2G5H B;  4QIW F;  2G08 A;  2LKY A;  2DF4 B;  4PL2 A;  1Q3U A;  2RP5 A;  3AQF A;  1Q3V A;  4JMU A;  2H3F A;  2K4H A;  1OUQ A;  1HEK A;  1ECW A;  2HBL A;  1PVP A;  4NLB A;  2KV2 A;  4NV0 A;  4OJP A;  3VC8 A;  2JHD A;  2MA1 A;  2YB4 A;  3L3F X;  3N7S C;  1XNS A;  1P7D A;  5C0Y A;  1IIP A;  2LYA A;  2KJ9 A;  2WB1 C;  1XO0 A;  2OM6 A;  2XVT A;  4OO1 J;  2E5S A;  3GU3 A;  1TAM A;  2M0N A;  1A6S A;  2HBM A;  4P0P B;  3H0L B;  3RF9 A;  3SAG A;  4WJ3 B;  5HR7 A;  3D2S A;  2CN1 A;  2VJ5 A;  3IP4 B;  3F2B A;  3IG5 A;  2K8A A;  4PL1 A;  2KNJ A;  4U7C A;  2HBJ A;  2OYY A;  2ZXI A;  3IG8 A;  4KX5 A;  2JH1 A;  2YX8 A;  2E1F A;  2LYB A;  2KJ5 A;  3M7D A;  2ZIX A;  3VCB A;  3T79 A;  1PVR A;  4P0Q A;  4U6P A;  2GOL A;  2H3I A;  1DRG A;  4KX3 A;  2YB1 A;  4FZN A;  3PSI A;  1CRX A;  4KMO B;  3SQI A;  2W7P A;  3IN5 A;  3K1Z A;  3ALR A;  3NUQ A;  2GH1 A;  2KJ8 A;  1Z19 A;  3AQE A;  1MA7 A;  3OPX A;  2E1E A;  3CRX A;  5HR6 A;  4O3M A;  3RFA A;  3F2D A;  2G07 A;  2H3Q A;  3D2Q A;  2ZG6 A;  2VJ4 A;  2A3V A;  1YT3 A;  2RRD A;  2F2A B;  4P0P A;  4FZL A;  2W04 A;  2G0A A;  4OJL A;  3D2N A;  2D6F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...