1SZHA

Crystal structure of c. elegans her-1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
STLTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNLMTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Her-1 protein
publication title Crystal structure of Caenorhabditis elegans HER-1 and characterization of the interaction between HER-1 and TRA-2A.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein
total genus 58
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09232 Caenor_Her-1 Caenorhabditis elegans Her-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.360 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA01
1.10.150.370 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1szhA02
1SZHA
chains in the Genus database with same CATH superfamily
3KFUF 5AK4A 1Y88A 4DSIA 5ALNA 4I2BA 5IINA 3QEBZ 3M9MB 8ICPA 2E8OA 1T8EA 1ZQQA 4NLNA 1DOQA 4PH5A 2W43A 2ZUBA 5KFXA 4B9VA 5KFIA 1LV5A 1DGSA 1K1SA 2KIWA 3T5HA 1C20A 3QU2A 2H3ZA 1UT8A 4GLXA 4ELVA 5E79U 1ZQSA 4C8LA 3PMNA 4QIWC 4BWJA 4QJFB 5CEHA 3KD3A 4O0IA 1N48A 8ICNA 2Y9TA 2OHFA 3QXGA 1NJWA 2KVSA 4F92B 5KG7A 3Q8PB 4JV0A 4AYBF 5DGBA 2Y0SC 3OGUA 3IDWA 8ICQA 4ELTA 3A0BU 4YR2A 7ICJA 5IIJA 2HHVA 4M9HA 4NLZA 5AK5A 2HHSA 2I9GA 4DOAA 2JRZA 7ICUA 5AICA 3SV4A 3L5KA 1ZQXA 5AK6A 5AKEA 3HPOA 4KLDA 2XGQA 1ZXIA 4EBCA 1WWUA 1ZQJA 4QNLA 4FO6A 4I28A 2NRXA 2W3SA 5AK3A 4DL4A 4DFJA 2VA3A 2W9AA 5ALQA 3PO5A 3QEAZ 3RB0A 1X40A 2ISPA 1ZD3A 4IRDA 4O3OA 1ZJMA 1FFUA 3RB4A 3PY8A 3UXOA 2B0CA 1VDVA 2F1HA 4JK1A 4JMUA 1WUDA 1S97A 4JV2A 1VJ5A 2E8MA 3PW5A 3PZPA 5J2KA 4UB5A 1TAMA 3TARA 4IL6U 3FYHA 4F50A 4EELA 3GV8B 5DBBA 1S5LU 3QUQA 5DB6A 2Y9UA 4K4IA 1ZOLA 5L1LA 2WHEA 3R9KA 2K4EA 4KLMA 4PZOA 3S6JA 4M6WA 3QU5A 1X42A 1BGXT 2OYYA 2KD1A 2KICA 4F4XA 5KL8B 5HHIA 3WKDA 8ICKA 1KN5A 4UASA 5AM3A 2KG5A 9ICKA 3V6HA 2JH1A 4DFDA 2LPEA 3PSIA 2R8GA 1OW5A 5IIMA 4KLOA 3GU3A 3H0RB 3DEEA 4F4WA 5JTIA 1X2IA 4B9TA 1WG8A 3EZ5A 3BZKA 5DDYA 4PL2A 4J9LA 4C7YA 5ALSA 3SI8A 3HKZC 3TFSA 4I2EA 3MR6A 2WAQF 8ICXA 3BQ2A 4RUAA 4GXKA 3PNCA 2ZJAA 3IG5A 1HIWA 2XY6A 4PHDA 2ZTEA 2MAXA 2MUTA 4UAWA 3LYSA 3RJKA 5DDMA 1KLNA 3HJEA 5EE9A 4I27A 1B4FA 7ICEA 4I29A 4QZCA 4Z6EA 5CRXA 4DOBA 5J2DA 4DFPA 2WF6A 4I2FA 2KJ8A 5BOLA 4NL9A 1L5UA 2XI9A 4Z6FA 5ALHA 5J0RA 9ICMA 2YMQA 2MUTB 3M1YA 1SKRA 4IRCA 2H3FA 2ASJA 2GOLA 3C2KA 3C5FA 1KFTA 4KX3A 2XC9A 3EYZA 4NM2A 3RRGA 4FFDA 1VLBA 4BGDA 3RFAA 4YXJA 2FMSA 1DK3A 2YQEA 3C28A 3HRDD 1T7PA 5KFTA 1WCLA 4F5PA 4P2HA 1KBUA 7ICRA 4TUSA 4Z6DA 5D4BA 4LZDA 4FS2A 5J0TA 1SXDA 2G09A 4KX5A 1WWVA 2ZUCA 2HHTA 1N60A 5KL1B 5KFCA 5KAFU 4FBUA 2EAPA 2JR5A 2WF7A 4I2IA 1ZQWA 5ALLA 3M6ZA 4ED1A 1CUKA 4QZFA 3MGHA 3RJGA 3T79A 1ZETA 2MU2A 2JEFA 3D2NA 1YZ6A 1ZQ1C 4ECSA 3IG8A 3D2SA 1B22A 1ECWA 2FLPA 9ICXA 4CF4A 3NRWA 3JPSA 4ACOA 2AHOB 2CPRA 2RQ5A 3DDHA 3F5AA 1A76A 5HNKA 3RJFA 4ECUA 3AMZA 5ALYA 2PMZF 3KKAA 4C4SA 2P6RA 3E2EA 4GXJA 8ICHA 3WK9A 2WFAA 5L1KA 9ICOA 2M9NA 3H0MB 2OWOA 3H4BA 3N7PD 1RXWA 1ZQGA 1JXEA 2ASDA 5EWFA 2FJ6A 5KFRA 3THVA 4R64A 3OJSA 2Y1IA 3TAQA 2ZIVA 4UB8U 4ELUA 2WB1C 2WF8A 3AM9A 3UMBA 5L1IA 3KZIU 3PX6A 5AI0A 2YMLA 5ALOA 4I2HA 3F53A 3JPPA 5ALZA 4QWDA 8ICJA 1L3VA 1TK5A 1HUZA 3PW2A 4YFKA 5ALVA 1S0NA 4DSLA 5KT5A 2WTFA 1NK8A 3HW8A 3U26A 2HW3A 3SV3A 5DLGA 4F91B 5J0WA 1COKA 4O3MA 3K1RB 7ICPA 1SV4A 3F2CA 4G9BA 2LYHA 4DSFA 2QARA 2BKEA 4CDGA 2G5HB 4US8A 8ICWA 4ECWA 1ZQFA 1IXRA 4I2DA 1ZQUA 2YB4A 5CA7A 3AL0B 2LHTA 3H4DA 1X9XA 2DWQA 4NLGA 1BNOA 4M9JA 4XQ8A 3Q8KA 1Z00B 4QW9A 1AROP 4DS5A 5J2EA 5T14A 2KZZA 2QARB 3SAHA 3OSPA 4IQVA 3AQFA 3UQ2A 2UVVA 5EE0A 1SKSA 2KNJA 4KN7A 5AKHA 5IILA 5J0UA 3OPXA 2KVCA 4BWMA 4ECRA 1RXVA 5L1MA 4M9LA 4DWIA 1PUZA 3IN5A 3HT3A 1ZD2P 3GZFA 2YN4A 2XY5A 3B9JA 3ETRA 9ICJA 4F2SA 2FLLA 4KLQA 4UATA 4ZH4A 3KHLA 4F2RA 1RYSA 5TISU 4GFJA 4RQNA 3AN1A 1QQ6A 3I28A 4TUPA 9ICCA 4M0AA 4LZGA 2KSOB 4ED6A 3LK9A 5CR0A 4QZ9A 4MF8A 2HVIA 1NK0A 2V4QA 9ICVA 1BPYA 1JX4A 3M6KA 4DEZA 2BCUA 4KMOB 3QUCA 5DBCA 1Z19A 1QTMA 2BGWA 1SV0C 4OJ5A 3AU2A 4J9PA 1MN8A 5IIOA 3H40A 1S76D 4R8UA 2ALZA 4Y2RA 1NK6A 3HX0A 5ALJA 1S8OA 2K8AA 5AI5A 2QLTA 3UM9A 1XU4A 2B6GA 9ICWA 3OTQA 2E1FA 3A0HU 4TURA 3KOOA 5D49A 2BCRA 3RR7A 2N1RA 4R8UB 5J2GA 3OHBA 2H3IA 2RDIA 1X9WA 1TK8A 2YY6A 5F3XB 2K4PA 4DQRA 2EH9A 3GDXA 5J2JA 1UA1A 1CRXA 7ICNA 2EAMA 5AKYA 4AYBC 2HVHA 1JXLA 3C5GA 5AM0A 4RNNA 4KLGA 3ISBA 2ZXHA 5KFYA 2W9MA 4DCCA 1BPDA 4RQ4A 1COOA 2E3TA 5EE1A 1B0XA 1XS9D 9ICAA 3D6JA 4RUCA 4F8RA 3TADC 3LWLA 2EQYA 2K60A 7ICVA 2LYBA 7ICMA 2W55A 2IBKA 3B0YA 2ZIXA 2KV2A 4Y2VA 8ICBA 1NOMA 4CGZA 4MHVA 5KFNA 1SWWA 3WU2U 4B6JA 1CI4A 2KMDA 2HHUA 4RT2A 3M9OB 2RLTA 2XGPA 1X6JA 3NRZA 4NXZA 5KT6A 2FI1A 2HBJA 2EZYA 4IR1A 4TUQA 2ZIXB 3V6KA 5KFDA 3GV7B 9ICNA 1Z4NA 3MABA 2W11A 3PW4A 2H5XA 2VANA 3RF9A 5KFBA 2LYAA 2ZXIA 3LWMA 1N63A 4GIBA 5JUMA 3K4GA 3BZCA 1UA0A 2KFNA 2XICA 3QU9A 4MFFA 2ZG6A 4OJLA 5JU5A 2KJ5A 1UQVA 3PW0A 5CP2A 4YG2A 5J0QA 1XWLA 3F2BA 2ZUDA 3H8WA 4IQWA 4UB3A 2MSNA 7ICIA 2OXOA 3RJHA 1JUDA 2J6TA 5KG0A 1QSYA 2VA2A 4UW9A 2FPKA 1ZQHA 3RJJA 1NK4A 5AKXA 4JUZA 1Z1BA 5EWEA 4YMMA 1MSWD 5ALTA 2V9WA 3PR5B 4PPXA 3C1YA 2KEYA 4ZOHC 2EZXA 4O3PA 4DQPA 4RNOA 3C23A 8ICRA 2OH2A 9ICLA 3JPQA 4OJOA 2A19A 1TV9A 5KAIU 3BS5A 2FMPA 4QZBA 1A6SA 3MR3A 1T3QA 1XSPA 4Q44A 4EBDA 2QB0A 5J29A 4BX9C 3TANA 2GWSA 4JB3A 3BS7A 1RM6C 4DL5A 1IV8A 1RDFA 3M8SA 4YCXA 2KKVA 2F76X 3T5LA 7ICTA 1IIPA 5AIAA 1ZQZA 4NJ8A 1TVAA 4Y2YA 3HP6A 2DPIA 3JPNA 3BS5B 1SIJA 3RR8A 2E5SA 1AQ6A 4C8OA 4DQQA 1FO4A 4EZ6A 4O3RA 2G5IB 1V38A 1Z1VA 3ZDCA 2QB0B 3JPOA 5CJ7A 4YP3A 4I2GA 5K4LA 4QZDA 4G3IA 3IV6A 3MFIA 2OEHA 2OCEA 4QIWF 4BUGA 1NNLA 1TKDA 4Y2SA 2W8KA 5TZVA 3MC1A 1Q3VA 1DK2A 4DFKA 2NYVA 4KLJA 5AKJA 2DBYA 2BR0A 3M9NB 4O5KA 5FP0A 4LJXA 1U48A 4DQSA 2PKEA 1SKWA 1PZNA 5J8YC 3T5KA 2AGQA 3NS1A 5KFWA 2Z7JA 3AU6A 2F44A 2FE9A 2YMPA 2VKQA 3G6YA 4MEXA 5KFEA 1KL9A 3T5JA 2YTUA 4X5VA 2EAOA 4YXMA 2JXJA 5F9LA 3E0FA 1ZQMA 2R8JA 1YT3A 3UMCA 2FPLA 2EZZA 3L4PA 4J9QA 3NGDA 4Q8FA 1S9FA 2V4RA 1O03A 3LVVA 5DGAA 4P4MA 2HBKA 4RQMA 1ZJNA 2PFOA 4YMNA 5AM2A 3K1ZA 2DFLA 2HHWA 1XO1A 8ICIA 9ICTA 5DBAA 1XO0A 4Y2PA 5F9NA 4B9SA 5AKLA 2GO7A 1SXEA 3WK7A 2PFPA 8ICVA 4MEYA 3SAFA 2BPFA 7ICLA 2R8IA 3I1YA 5AM1A 3N28A 3SMVA 1D9DA 2KKPA 7ICQA 4UAYA 3LVWA 2D3DA 5KFQA 3MBYA 4QZIA 4JWNA 3UXNA 5DQGA 3B0XA 5J2BA 4F71A 4ECXA 3KHHA 5KFFA 1BPZA 1PVQA 3WK4A 2MRLA 3ALRA 3FM9A 4ED7A 4NM1A 2I1QA 5J2AA 4PGYA 4FZLA 2ODGA 3QU4A 4C4TA 3Q8MA 3QYPA 8ICMA 2KIVA 4J9SA 3RAXA 1V9PA 3SYZA 5J2CA 2YMMA 4GC7A 3IM1A 4F3OA 3SR6A 1DXSA 9ICIA 2JZBA 4Q43A 3DV9A 3Q8LA 2BQUA 5AI6A 3EWAA 2A1AA 5CWRA 3HKZF 1JIHA 4UQGA 3AEVA 1L7PA 1QLNA 3H8SA 4XUSA 5KFUA 1RPLA 2JMGA 1RYRA 5J0SA 1ZQTA 3OJUA 1FEZA 2JZBB 4K4HA 2RRDA 5DG9A 4RQ8A 1L3TA 1KSPA 1JMSA 3ZDDA 3PVXA 1D8BA 3H8MA 4NLKA 2AQ4A 1ZD5A 4JV1A 1BVSA 4OCZA 1ZQPA 1ED1A 2F1JA 2L5YA 2NRWA 1ZRMA 2C28A 3NTUA 1J97A 2K89A 2XO7A 1RQLA 5ALPA 1KRPA 4B9UA 1N5WA 4KLLA 5C5JA 4TQRA 4DLGA 2KTQA 2XVTA 2KN7A 4O9MA 4BDPA 1Z00A 4UARA 4ED3A 5D46A 1X9MA 4TQSA 4JWMA 4F5OA 4AP9A 3F2DA 4KLSA 4RPYA 3MGIA 2F8LA 5ALIA 2P35A 1NJZA 2W9CA 1KDHA 3RB6A 3D2QA 5DB7A 1IG6A 2W04A 3NVVA 8ICTA 2FDRA 2I5HA 2VIXA 2W7PA 2VJ4A 4R63A 4BJQA 9ICHA 3QE9Y 3V6JA 2H3QA 1ZQIA 4NLBA 2W54A 3TAPA 2W9CB 5KFHA 1S10A 1NKEA 5A0LA 4F4ZA 2ASLA 5ALMA 1WCNA 1Q8KA 4NV0A 1T94A 2KSOA 1S0VA 1NJYA 2BCVA 5KFSA 3NUQA 3AUOA 1N56A 3MFHA 4KLIA 2VJ5A 3I76A 4LVSA 2E8NA 5KG1A 1ZQBA 2AQ0A 1SL0A 4ECTA 3WKEA 1SL2A 2F1IA 1ZQKA 1ZQNA 3RBDA 3RTVA 2GLEA 2JV3A 3EPGA 8ICSA 3H7IA 5G5GA 2BQRA 3RH5A 1XSLA 2YB1A 2ES6A 2PFQA 5DKWA 4M9NA 2KE7A 1KKXA 2BZFA 1NKBA 5H2FU 2YX8A 1ZQLA 4QZ8A 2AGPA 1QCKA 3C29A 3JPTA 7ICSA 4FZNA 1NJXA 3GFKB 2ZIWA 2AH5A 8ICYA 2K4IA 1FIQA 3UQ0A 4RQ5A 2IOFA 1U9LA 1NZPA 4RQ3A 1HJPA 4QWBA 1BPEA 3Q8RB 7ICKA 4ECYA 5ALFA 9ICFA 2PXIA 4OJPA 3TFRA 2ATLA 2ZIWB 1F5SA 5ALRA 4F5QA 2JH7A 2R18A 1XSNA 1XNSA 5AKKA 4KLFA 4I2CA 1P7DA 4Y2TA 1BNPA 4DSEA 2NO5A 4C8KA 4DF4A 1Q46A 2AJQA 3SQIA 2K8CB 3TQ1A 5KFVA 4Z6CA 3Q8QB 3NVWA 2W03A 5L1JA 2B21A 2HHXA 4RQ6A 3PR4A 4DSKA 4K4GA 5DLFA 1X66A 1PK3A 2KZMA 5DG8A 4UBBA 2HDOA 3CW2C 3G6XA 4RQ2A 1RYUA 2HOQA 1F44A 2BDPA 3BDPA 8ICCA 2NRVA 4KN4A 4CF5A 4ED2A 5JRTA 4ECQA 1NK9A 2KFZA 1X6IA 1SV0A 4QZHA 4DL2A 4HYKA 4DL6A 4YQWA 2UVUA 4O3NA 1ZQYA 4R65A 3UPQA 4UBCA 3PX4A 5G5HA 1C7YA 3CRXA 7ICFA 3GIIA 1ZD4A 1JALA 5EE3A 1N62A 2QB1A 5DQIA 4J9RA 3TACB 4KITB 1KFDA 2H3VA 3SZ2A 1KQQA 5KFPA 4NLCA 1JI7A 2IHMA 4NY8A 1RQNA 4F4KA 1ZQDA 3ZI4A 4IS7A 4FZMA 4DO9A 2DPJA 2PFNA 3CP8A 3Q8SB 2ZIUA 3L3FX 2DKZA 4J03A 4USAA 4US9A 3QU7A 4EENA 3HILA 3MDCA 1L3UA 1X9SA 1PK1A 9ICRA 3G6VA 5ALDA 3KHGA 3SAGA 4YR3A 3N97B 1V97A 1PVRA 3RH4A 3GIMA 1D9FA 1TK0A 5GTHU 1KW4A 1S0OA 1S77D 2ZIUB 3RJIA 5AM5A 5EWGA 4PHAA 5AI8A 2RDJA 9ICQA 2ISOA 1SB3C 4DFMA 1EXNA 2W9BA 4XRHA 1MQ3A 4FBTA 3PV8A 2KOBA 4UB6U 1TAUA 3MR2A 3TADA 3BJYA 1YZ7A 1PK1B 5IIKA 3PO4A 1SZPA 2FMQA 2ZJ5A 4YN4A 1MA7A 2J6SA 2F8KA 3QX7A 8ICAA 5J2FA 5J0PA 4WJ3B 8ICLA 2W9BB 1B43A 1U47A 2HMXA 4MF2A 2OM6A 4EEYA 4OD0A 4RPZA 1SGGA 4Y2XA 5ALEA 5ALUA 3M8RA 3ETLA 1H38A 2BQ3A 2WAQC 2PI4A 5KFJA 5HR6A 4RT3A 1N2XA 3QZ7A 2DUYA 8ICUA 4QWCA 1SWVA 5IIIA 5KFLA 4KLUA 5AKZA 4QWAA 1QQ5A 4A8EA 9ICPA 2UVWA 5DB8A 5KT2A 3IRUA 2EANA 2W7OA 4M2YA 3PW7A 1DRGA 2MA1A 4F93B 3QZ8A 4FS1A 1UHUA 2HCFA 4KLEA 3F5EA 1KFSA 3RJEA 3C2MA 2PI5A 2HBLA 2DF4B 4EZ9A 3VC8A 2C2EA 4CNQA 4CRXA 2DKXA 3RAQA 5KT4A 4C8NA 2D6FC 5KFOA 1XC9A 5B66U 1SL1A 1BPXA 2QKQA 4C8MA 8ICFA 3IHQB 1DGJA 4NL9C 5HMMA 1L7OA 8ICEA 2Y0SF 2J6UA 8ICGA 4PGQA 3QUTA 3SENA 4RZRA 2AXTU 4YMOA 5KT7A 5AI9A 1ZQOA 2C2RA 2JGAA 3V7KA 5KTQA 1A77A 4QW8A 4XA5A 4M6WB 4DS4A 3VCBA 4UAUA 1BPBA 4KLHA 4P0PA 3MR5A 4DL7A 3WK5A 2BCQA 4DOCA 4YD2A 3GIJA 5EOZA 4BXOA 1A0PA 3OHAA 1WYGA 5CHGA 1K5OA 5DG7A 2W8LA 7ICGA 2LKYA 1Z3EB 5ALWA 5J0XA 2IHNA 5KNIA 1KTQA 3N4MB 4PHPA 2IA6A 3ISDA 4P0PB 2PMZC 2DGZA 7ICHA 4U7CA 2AGOA 2IMWP 5KG5A 1RZTA 2C2DA 3BQTA 3HWTA 1NI3A 4BXOB 1JN3A 1U49A 2FPMA 3FC4A 4RQ0A 4CF3A 4ECZA 4RPXA 3SD7A 1URJA 3ZD9A 2JEJA 3WKBA 4KMUA 5HP4A 3KHRA 4PZNA 3QUBA 3KKAC 2XCAA 2LM4A 5J8YA 2GH1A 3ISCA 4UB2A 3TKAA 4RNMA 5KG2A 4ECVA 4QZEA 3T3FA 3FAHA 1ZQRA 5KFMA 1L8LA 3GIKA 4ICAA 4F72A 3ONNA 4OO1J 4OJ6A 2BHNA 5AI4A 3NVZA 2LI6A 4I2AA 4CCHA 9ICUA 2NRTA 1L6NA 3IP4B 1U45A 3RH6A 2C22A 4NWIA 2R8KA 1JROA 3ZD8A 5KG6A 3TI0A 1NK5A 2KHQA 3BQ7A 5KFKA 2W3RA 9ICBA 5BOMA 1T4GA 3EW9A 4J9OA 3LDAA 1QQ7A 4MFCA 5AM4A 1JRPA 3C21A 5KG4A 5J2HA 4PHEA 3EUB2 3MDAA 1L7NA 5AIBA 5J0YA 1ZQEA 4QWEA 5J2IA 2Y1JA 4C0ZA 1OUQA 2UVRA 1N61A 3V7JA 4DQIA 1QH9A 2WF5A 4IC9A 1PVPA 4QZGA 4ED8A 3SEIA 3KZXA 3ZDEA 1N5XA 1UPHA 2FLNA 4YR0A 3V72A 2KP7A 4RQ1A 2Q0ZX 4M04A 2NRZA 1NKCA 3H8JA 2LMRA 1LVHA 3ED5A 3O0FA 2G06A 4F4YA 3UMGA 1ZQCA 4E0DA 1Q3UA 2IOHA 3PSTA 4J9KA 4UB4A 5GTIU 3RBEA 2KJ9A 2BPCA 7ICOA 4Q8EA 1QSSA 2K4HA 1L8OA 2ZIVB 2BPGA 1D8YA 2EDUA 2CXYA 2CRXA 5AHXA 2R8HA 4F5NA 1SZHA 4RU9A 4UAZA 3BQ0A 2M0NA 1L7MA 2RHFA 3C2LA 1V85A 2IOFK 9ICEA 2HSZA 3K75D 2XCPA 4IRKA 1ZRNA 1HUOA 5L9XA 2KK0A 4B9NA 2E8PA 2JHDA 2XY7A 1NK7A 5KFGA 1UT5A 2G0AA 1K1QA 1MC8A 4Y2JA 1O08A 1ZQVA 1KEJA 8ICZA 4KLTA 4IR9A 3RRHA 4C4RA 3PMLA 2G08A 1D8LA 2E1EA 4YD1A 2A1JA 4EEKA 3KBBA 3GQCA 4PJ0U 1S0MA 1GO3F 2AU0A 4QZAA 3CNHA 4P4PA 2XIDA 5KFZA 2WB1F 3NVYA 3ZDAA 1F0MA 3EPIA 4EX7A 4P4OA 2ZTDA 4R66A 4EBEA 2HBMA 3ORYA 2BDUA 3GV5B 4DF8A 5KFAA 1TAQA 3C1ZA 3WKCA 2HI0A 4O3QA 2A1JB 5KT3A 4I2JA 4F5RA 4Y2UA 3WK8A 1J2MA 1LB2B 4O3SA 1UCVA 3J81j 2KHVA 3WK6A 2DL0A 3CYMA 3NASA 9ICGA 2NV3A 5HMLA 2HOFA 4U6PA 4ED0A 3AQEA 5J0OA 3N7SC 1L3SA 5C0YA 4P0QA 4CE6A 4B9MA 1J2NA 4RQ7A 2NO4A 4HAIA 4O5CA 5AKGA 2I6XA 3WKAA 4M47A 3M7DA 2DQNB 3GILA 5BPCA 2Q4TA 2JEGA 1LKYA 4GC6A 4DSJA 4C80A 1MQ2A 2A3VA 2ESEA 2P66A 3ZDBA 3UXPA 4YVZA 1OXJA 4J9MA 4EYIB 4B9LA 1HEKA 1U4BA 4J9NA 2ZJ8A 4P0QB 5HR7A 2F3NA 5DQHA 4C7ZA 4PGXA 4MFAA 1QSLA 1M6YA 8ICOA 4DL3A 1LKYB 5KG3A 1TFRA 1IM4A 1FFVA 2K8BB 4EYHB 3PSPA 5DB9A 4IQUA 3FDSA 5ALKA 1NZBA 2F2AB 4UAVA 1T3NA 4PL1A 2HOIA 9ICSA 2LBOA 3H0LB 4IQTA 2P6UA 2VA8A 3PSFA 4KTQA 2ZTCA 3OSNA 2F77X 4M9GA 3KTQA 1Z4OA 5B5EU 2LM1A 4EX6A 1ZQAA 5HHHA 2KZ3A 1ZYQA 2BCSA 1CEZA 4O5EA 1RG6A 2HHQA 3V7LA 4DLEA 2G07A 3N7RC 3PX0A 3MGVA 2CN1A 2O6KA 4Q45A 4UB1A 2RP5A 2D8CA 3ICXA 4Y2QA 3QNMA 4FE3A 3JPRA 5CB1A 5ALGA 4GXIA 2JEIA 5ALXA 3RB3A 5AKIA 3E58A 2WF9A 3BQ1A 1TE2A
chains in the Genus database with same CATH topology
3ONNA 3KFUF 2DQNB 2ZIVA 2H3QA 3PZPA 2Q4TA 4NLBA 2WB1C 3LVVA 1P7DA 2KJ8A 2Y0SF 4OO1J 4OJ6A 2HBKA 1TAMA 2OH2A 2CRXA 2KOBA 2A3VA 2XI9A 3SQIA 1SZHA 2LYBA 2K8CB 3K1ZA 2JMGA 5A0LA 2M0NA 1L6NA 3IP4B 4OJOA 2RHFA 2W03A 4NV0A 1T94A 2ZIXA 3F53A 1HEKA 2KV2A 1A6SA 2H3FA 4NWIA 2RRDA 4P0QB 3NUQA 2JGAA 2KIWA 4CGZA 5HR7A 1MA7A 2GOLA 2H3ZA 1XO0A 4KX3A 2JHDA 2K4EA 1D8BA 2VJ5A 4WJ3B 4BX9C 2KHQA 3RFAA 2HOQA 1F44A 3M6KA 3VCBA 3C28A 2G0AA 4P0PA 2OYYA 4KMOB 4QIWC 1ED1A 2KD1A 2KKVA 2F76X 4QJFB 2KICA 2HMXA 3SAFA 1Z19A 1IIPA 2HBJA 2OM6A 5KL8B 4OJ5A 2K8BB 3SMVA 1KBUA 4ICAA 4O3MA 3PSPA 2KKPA 2K89A 2ZIXB 1A0PA 3F2CA 2JH1A 2G08A 2G09A 4CDGA 2E5SA 3LVWA 3CRXA 4AYBF 4C0ZA 2G5HB 2E1EA 3PSIA 4KX5A 1OUQA 2WAQC 2LKYA 1NZBA 2YB1A 5KL1B 5HR6A 2G5IB 3GU3A 2Y0SC 3RF9A 2F2AB 5CRXA 3H0RB 2YB4A 4PL1A 2LYAA 3DEEA 4IC9A 1GO3F 3M6ZA 2ZXIA 2XVTA 4P0PB 1PVPA 2PMZC 3AL0B 2HOIA 2LHTA 2DGZA 2H3VA 2XIDA 2K8AA 1PVQA 2YX8A 2LBOA 2WB1F 4QIWF 4BUGA 3KZXA 4U7CA 4NLCA 3H0LB 2MRLA 3ALRA 4A8EA 1UPHA 2XICA 3T79A 4PL2A 3C29A 5T14A 2ZG6A 4FZNA 1Q3VA 2E1FA 4OJLA 3D2NA 2W7OA 2HBMA 4FZLA 2ZIWA 2BDUA 3SAHA 2KJ5A 1DRGA 1ZQ1C 2MA1A 3AQFA 3IG8A 3PSFA 4FZMA 3F2DA 2F77X 3D2SA 3HKZC 3CP8A 3F2BA 2K4IA 1ECWA 2N1RA 2ZIUA 3L3FX 2KNJA 4QNLA 2H3IA 2WAQF 3NRWA 1URJA 4ACOA 2F8LA 3F5EA 3O0FA 2CPRA 2G06A 3OPXA 2HBLA 2DF4B 2OXOA 2KVCA 1HIWA 3F5AA 3IG5A 3VC8A 2KHVA 4CRXA 1Q3UA 3CYMA 2G07A 2Z7JA 2PMZF 3D2QA 3N7RC 2CN1A 3MGVA 3IN5A 2RP5A 2VKQA 3PSTA 2NV3A 1CRXA 2HOFA 4U6PA 3ICXA 2GH1A 4OJPA 3GZFA 2W04A 4AYBC 3SAGA 1Z1BA 3LYSA 2D6FC 4FE3A 3AQEA 3H0MB 4JMUA 3N7SC 3N7PD 1WUDA 1PVRA 5C0YA 2VIXA 2KJ9A 2VJ4A 2ZIWB 4P0QA 2W7PA 3E0FA 2JH7A 1YT3A 2R18A 1XNSA 2ZXHA 2ZIUB 4BJQA 2KEYA 2K4HA 3HKZF 4GFJA 3M7DA 2ZIVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZH A; 
#chains in the Genus database with same CATH topology
 3KFU F;  5AK4 A;  1Y88 A;  4DSI A;  5ALN A;  4I2B A;  5IIN A;  3QEB Z;  3M9M B;  8ICP A;  2E8O A;  1T8E A;  1ZQQ A;  4NLN A;  1DOQ A;  4PH5 A;  2W43 A;  2ZUB A;  5KFX A;  4B9V A;  5KFI A;  1LV5 A;  1DGS A;  1K1S A;  2KIW A;  3T5H A;  1C20 A;  3QU2 A;  2H3Z A;  1UT8 A;  4GLX A;  4ELV A;  5E79 U;  1ZQS A;  4C8L A;  3PMN A;  4QIW C;  4BWJ A;  4QJF B;  5CEH A;  3KD3 A;  4O0I A;  1N48 A;  8ICN A;  2Y9T A;  2OHF A;  3QXG A;  1NJW A;  2KVS A;  4F92 B;  5KG7 A;  3Q8P B;  4JV0 A;  4AYB F;  5DGB A;  2Y0S C;  3OGU A;  3IDW A;  8ICQ A;  4ELT A;  3A0B U;  4YR2 A;  7ICJ A;  5IIJ A;  2HHV A;  4M9H A;  4NLZ A;  5AK5 A;  2HHS A;  2I9G A;  4DOA A;  2JRZ A;  7ICU A;  5AIC A;  3SV4 A;  3L5K A;  1ZQX A;  5AK6 A;  5AKE A;  3HPO A;  4KLD A;  2XGQ A;  1ZXI A;  4EBC A;  1WWU A;  1ZQJ A;  4QNL A;  4FO6 A;  4I28 A;  2NRX A;  2W3S A;  5AK3 A;  4DL4 A;  4DFJ A;  2VA3 A;  2W9A A;  5ALQ A;  3PO5 A;  3QEA Z;  3RB0 A;  1X40 A;  2ISP A;  1ZD3 A;  4IRD A;  4O3O A;  1ZJM A;  1FFU A;  3RB4 A;  3PY8 A;  3UXO A;  2B0C A;  1VDV A;  2F1H A;  4JK1 A;  4JMU A;  1WUD A;  1S97 A;  4JV2 A;  1VJ5 A;  2E8M A;  3PW5 A;  3PZP A;  5J2K A;  4UB5 A;  1TAM A;  3TAR A;  4IL6 U;  3FYH A;  4F50 A;  4EEL A;  3GV8 B;  5DBB A;  1S5L U;  3QUQ A;  5DB6 A;  2Y9U A;  4K4I A;  1ZOL A;  5L1L A;  2WHE A;  3R9K A;  2K4E A;  4KLM A;  4PZO A;  3S6J A;  4M6W A;  3QU5 A;  1X42 A;  1BGX T;  2OYY A;  2KD1 A;  2KIC A;  4F4X A;  5KL8 B;  5HHI A;  3WKD A;  8ICK A;  1KN5 A;  4UAS A;  5AM3 A;  2KG5 A;  9ICK A;  3V6H A;  2JH1 A;  4DFD A;  2LPE A;  3PSI A;  2R8G A;  1OW5 A;  5IIM A;  4KLO A;  3GU3 A;  3H0R B;  3DEE A;  4F4W A;  5JTI A;  1X2I A;  4B9T A;  1WG8 A;  3EZ5 A;  3BZK A;  5DDY A;  4PL2 A;  4J9L A;  4C7Y A;  5ALS A;  3SI8 A;  3HKZ C;  3TFS A;  4I2E A;  3MR6 A;  2WAQ F;  8ICX A;  3BQ2 A;  4RUA A;  4GXK A;  3PNC A;  2ZJA A;  3IG5 A;  1HIW A;  2XY6 A;  4PHD A;  2ZTE A;  2MAX A;  2MUT A;  4UAW A;  3LYS A;  3RJK A;  5DDM A;  1KLN A;  3HJE A;  5EE9 A;  4I27 A;  1B4F A;  7ICE A;  4I29 A;  4QZC A;  4Z6E A;  5CRX A;  4DOB A;  5J2D A;  4DFP A;  2WF6 A;  4I2F A;  2KJ8 A;  5BOL A;  4NL9 A;  1L5U A;  2XI9 A;  4Z6F A;  5ALH A;  5J0R A;  9ICM A;  2YMQ A;  2MUT B;  3M1Y A;  1SKR A;  4IRC A;  2H3F A;  2ASJ A;  2GOL A;  3C2K A;  3C5F A;  1KFT A;  4KX3 A;  2XC9 A;  3EYZ A;  4NM2 A;  3RRG A;  4FFD A;  1VLB A;  4BGD A;  3RFA A;  4YXJ A;  2FMS A;  1DK3 A;  2YQE A;  3C28 A;  3HRD D;  1T7P A;  5KFT A;  1WCL A;  4F5P A;  4P2H A;  1KBU A;  7ICR A;  4TUS A;  4Z6D A;  5D4B A;  4LZD A;  4FS2 A;  5J0T A;  1SXD A;  2G09 A;  4KX5 A;  1WWV A;  2ZUC A;  2HHT A;  1N60 A;  5KL1 B;  5KFC A;  5KAF U;  4FBU A;  2EAP A;  2JR5 A;  2WF7 A;  4I2I A;  1ZQW A;  5ALL A;  3M6Z A;  4ED1 A;  1CUK A;  4QZF A;  3MGH A;  3RJG A;  3T79 A;  1ZET A;  2MU2 A;  2JEF A;  3D2N A;  1YZ6 A;  1ZQ1 C;  4ECS A;  3IG8 A;  3D2S A;  1B22 A;  1ECW A;  2FLP A;  9ICX A;  4CF4 A;  3NRW A;  3JPS A;  4ACO A;  2AHO B;  2CPR A;  2RQ5 A;  3DDH A;  3F5A A;  1A76 A;  5HNK A;  3RJF A;  4ECU A;  3AMZ A;  5ALY A;  2PMZ F;  3KKA A;  4C4S A;  2P6R A;  3E2E A;  4GXJ A;  8ICH A;  3WK9 A;  2WFA A;  5L1K A;  9ICO A;  2M9N A;  3H0M B;  2OWO A;  3H4B A;  3N7P D;  1RXW A;  1ZQG A;  1JXE A;  2ASD A;  5EWF A;  2FJ6 A;  5KFR A;  3THV A;  4R64 A;  3OJS A;  2Y1I A;  3TAQ A;  2ZIV A;  4UB8 U;  4ELU A;  2WB1 C;  2WF8 A;  3AM9 A;  3UMB A;  5L1I A;  3KZI U;  3PX6 A;  5AI0 A;  2YML A;  5ALO A;  4I2H A;  3F53 A;  3JPP A;  5ALZ A;  4QWD A;  8ICJ A;  1L3V A;  1TK5 A;  1HUZ A;  3PW2 A;  4YFK A;  5ALV A;  1S0N A;  4DSL A;  5KT5 A;  2WTF A;  1NK8 A;  3HW8 A;  3U26 A;  2HW3 A;  3SV3 A;  5DLG A;  4F91 B;  5J0W A;  1COK A;  4O3M A;  3K1R B;  7ICP A;  1SV4 A;  3F2C A;  4G9B A;  2LYH A;  4DSF A;  2QAR A;  2BKE A;  4CDG A;  2G5H B;  4US8 A;  8ICW A;  4ECW A;  1ZQF A;  1IXR A;  4I2D A;  1ZQU A;  2YB4 A;  5CA7 A;  3AL0 B;  2LHT A;  3H4D A;  1X9X A;  2DWQ A;  4NLG A;  1BNO A;  4M9J A;  4XQ8 A;  3Q8K A;  1Z00 B;  4QW9 A;  1ARO P;  4DS5 A;  5J2E A;  5T14 A;  2KZZ A;  2QAR B;  3SAH A;  3OSP A;  4IQV A;  3AQF A;  3UQ2 A;  2UVV A;  5EE0 A;  1SKS A;  2KNJ A;  4KN7 A;  5AKH A;  5IIL A;  5J0U A;  3OPX A;  2KVC A;  4BWM A;  4ECR A;  1RXV A;  5L1M A;  4M9L A;  4DWI A;  1PUZ A;  3IN5 A;  3HT3 A;  1ZD2 P;  3GZF A;  2YN4 A;  2XY5 A;  3B9J A;  3ETR A;  9ICJ A;  4F2S A;  2FLL A;  4KLQ A;  4UAT A;  4ZH4 A;  3KHL A;  4F2R A;  1RYS A;  5TIS U;  4GFJ A;  4RQN A;  3AN1 A;  1QQ6 A;  3I28 A;  4TUP A;  9ICC A;  4M0A A;  4LZG A;  2KSO B;  4ED6 A;  3LK9 A;  5CR0 A;  4QZ9 A;  4MF8 A;  2HVI A;  1NK0 A;  2V4Q A;  9ICV A;  1BPY A;  1JX4 A;  3M6K A;  4DEZ A;  2BCU A;  4KMO B;  3QUC A;  5DBC A;  1Z19 A;  1QTM A;  2BGW A;  1SV0 C;  4OJ5 A;  3AU2 A;  4J9P A;  1MN8 A;  5IIO A;  3H40 A;  1S76 D;  4R8U A;  2ALZ A;  4Y2R A;  1NK6 A;  3HX0 A;  5ALJ A;  1S8O A;  2K8A A;  5AI5 A;  2QLT A;  3UM9 A;  1XU4 A;  2B6G A;  9ICW A;  3OTQ A;  2E1F A;  3A0H U;  4TUR A;  3KOO A;  5D49 A;  2BCR A;  3RR7 A;  2N1R A;  4R8U B;  5J2G A;  3OHB A;  2H3I A;  2RDI A;  1X9W A;  1TK8 A;  2YY6 A;  5F3X B;  2K4P A;  4DQR A;  2EH9 A;  3GDX A;  5J2J A;  1UA1 A;  1CRX A;  7ICN A;  2EAM A;  5AKY A;  4AYB C;  2HVH A;  1JXL A;  3C5G A;  5AM0 A;  4RNN A;  4KLG A;  3ISB A;  2ZXH A;  5KFY A;  2W9M A;  4DCC A;  1BPD A;  4RQ4 A;  1COO A;  2E3T A;  5EE1 A;  1B0X A;  1XS9 D;  9ICA A;  3D6J A;  4RUC A;  4F8R A;  3TAD C;  3LWL A;  2EQY A;  2K60 A;  7ICV A;  2LYB A;  7ICM A;  2W55 A;  2IBK A;  3B0Y A;  2ZIX A;  2KV2 A;  4Y2V A;  8ICB A;  1NOM A;  4CGZ A;  4MHV A;  5KFN A;  1SWW A;  3WU2 U;  4B6J A;  1CI4 A;  2KMD A;  2HHU A;  4RT2 A;  3M9O B;  2RLT A;  2XGP A;  1X6J A;  3NRZ A;  4NXZ A;  5KT6 A;  2FI1 A;  2HBJ A;  2EZY A;  4IR1 A;  4TUQ A;  2ZIX B;  3V6K A;  5KFD A;  3GV7 B;  9ICN A;  1Z4N A;  3MAB A;  2W11 A;  3PW4 A;  2H5X A;  2VAN A;  3RF9 A;  5KFB A;  2LYA A;  2ZXI A;  3LWM A;  1N63 A;  4GIB A;  5JUM A;  3K4G A;  3BZC A;  1UA0 A;  2KFN A;  2XIC A;  3QU9 A;  4MFF A;  2ZG6 A;  4OJL A;  5JU5 A;  2KJ5 A;  1UQV A;  3PW0 A;  5CP2 A;  4YG2 A;  5J0Q A;  1XWL A;  3F2B A;  2ZUD A;  3H8W A;  4IQW A;  4UB3 A;  2MSN A;  7ICI A;  2OXO A;  3RJH A;  1JUD A;  2J6T A;  5KG0 A;  1QSY A;  2VA2 A;  4UW9 A;  2FPK A;  1ZQH A;  3RJJ A;  1NK4 A;  5AKX A;  4JUZ A;  1Z1B A;  5EWE A;  4YMM A;  1MSW D;  5ALT A;  2V9W A;  3PR5 B;  4PPX A;  3C1Y A;  2KEY A;  4ZOH C;  2EZX A;  4O3P A;  4DQP A;  4RNO A;  3C23 A;  8ICR A;  2OH2 A;  9ICL A;  3JPQ A;  4OJO A;  2A19 A;  1TV9 A;  5KAI U;  3BS5 A;  2FMP A;  4QZB A;  1A6S A;  3MR3 A;  1T3Q A;  1XSP A;  4Q44 A;  4EBD A;  2QB0 A;  5J29 A;  4BX9 C;  3TAN A;  2GWS A;  4JB3 A;  3BS7 A;  1RM6 C;  4DL5 A;  1IV8 A;  1RDF A;  3M8S A;  4YCX A;  2KKV A;  2F76 X;  3T5L A;  7ICT A;  1IIP A;  5AIA A;  1ZQZ A;  4NJ8 A;  1TVA A;  4Y2Y A;  3HP6 A;  2DPI A;  3JPN A;  3BS5 B;  1SIJ A;  3RR8 A;  2E5S A;  1AQ6 A;  4C8O A;  4DQQ A;  1FO4 A;  4EZ6 A;  4O3R A;  2G5I B;  1V38 A;  1Z1V A;  3ZDC A;  2QB0 B;  3JPO A;  5CJ7 A;  4YP3 A;  4I2G A;  5K4L A;  4QZD A;  4G3I A;  3IV6 A;  3MFI A;  2OEH A;  2OCE A;  4QIW F;  4BUG A;  1NNL A;  1TKD A;  4Y2S A;  2W8K A;  5TZV A;  3MC1 A;  1Q3V A;  1DK2 A;  4DFK A;  2NYV A;  4KLJ A;  5AKJ A;  2DBY A;  2BR0 A;  3M9N B;  4O5K A;  5FP0 A;  4LJX A;  1U48 A;  4DQS A;  2PKE A;  1SKW A;  1PZN A;  5J8Y C;  3T5K A;  2AGQ A;  3NS1 A;  5KFW A;  2Z7J A;  3AU6 A;  2F44 A;  2FE9 A;  2YMP A;  2VKQ A;  3G6Y A;  4MEX A;  5KFE A;  1KL9 A;  3T5J A;  2YTU A;  4X5V A;  2EAO A;  4YXM A;  2JXJ A;  5F9L A;  3E0F A;  1ZQM A;  2R8J A;  1YT3 A;  3UMC A;  2FPL A;  2EZZ A;  3L4P A;  4J9Q A;  3NGD A;  4Q8F A;  1S9F A;  2V4R A;  1O03 A;  3LVV A;  5DGA A;  4P4M A;  2HBK A;  4RQM A;  1ZJN A;  2PFO A;  4YMN A;  5AM2 A;  3K1Z A;  2DFL A;  2HHW A;  1XO1 A;  8ICI A;  9ICT A;  5DBA A;  1XO0 A;  4Y2P A;  5F9N A;  4B9S A;  5AKL A;  2GO7 A;  1SXE A;  3WK7 A;  2PFP A;  8ICV A;  4MEY A;  3SAF A;  2BPF A;  7ICL A;  2R8I A;  3I1Y A;  5AM1 A;  3N28 A;  3SMV A;  1D9D A;  2KKP A;  7ICQ A;  4UAY A;  3LVW A;  2D3D A;  5KFQ A;  3MBY A;  4QZI A;  4JWN A;  3UXN A;  5DQG A;  3B0X A;  5J2B A;  4F71 A;  4ECX A;  3KHH A;  5KFF A;  1BPZ A;  1PVQ A;  3WK4 A;  2MRL A;  3ALR A;  3FM9 A;  4ED7 A;  4NM1 A;  2I1Q A;  5J2A A;  4PGY A;  4FZL A;  2ODG A;  3QU4 A;  4C4T A;  3Q8M A;  3QYP A;  8ICM A;  2KIV A;  4J9S A;  3RAX A;  1V9P A;  3SYZ A;  5J2C A;  2YMM A;  4GC7 A;  3IM1 A;  4F3O A;  3SR6 A;  1DXS A;  9ICI A;  2JZB A;  4Q43 A;  3DV9 A;  3Q8L A;  2BQU A;  5AI6 A;  3EWA A;  2A1A A;  5CWR A;  3HKZ F;  1JIH A;  4UQG A;  3AEV A;  1L7P A;  1QLN A;  3H8S A;  4XUS A;  5KFU A;  1RPL A;  2JMG A;  1RYR A;  5J0S A;  1ZQT A;  3OJU A;  1FEZ A;  2JZB B;  4K4H A;  2RRD A;  5DG9 A;  4RQ8 A;  1L3T A;  1KSP A;  1JMS A;  3ZDD A;  3PVX A;  1D8B A;  3H8M A;  4NLK A;  2AQ4 A;  1ZD5 A;  4JV1 A;  1BVS A;  4OCZ A;  1ZQP A;  1ED1 A;  2F1J A;  2L5Y A;  2NRW A;  1ZRM A;  2C28 A;  3NTU A;  1J97 A;  2K89 A;  2XO7 A;  1RQL A;  5ALP A;  1KRP A;  4B9U A;  1N5W A;  4KLL A;  5C5J A;  4TQR A;  4DLG A;  2KTQ A;  2XVT A;  2KN7 A;  4O9M A;  4BDP A;  1Z00 A;  4UAR A;  4ED3 A;  5D46 A;  1X9M A;  4TQS A;  4JWM A;  4F5O A;  4AP9 A;  3F2D A;  4KLS A;  4RPY A;  3MGI A;  2F8L A;  5ALI A;  2P35 A;  1NJZ A;  2W9C A;  1KDH A;  3RB6 A;  3D2Q A;  5DB7 A;  1IG6 A;  2W04 A;  3NVV A;  8ICT A;  2FDR A;  2I5H A;  2VIX A;  2W7P A;  2VJ4 A;  4R63 A;  4BJQ A;  9ICH A;  3QE9 Y;  3V6J A;  2H3Q A;  1ZQI A;  4NLB A;  2W54 A;  3TAP A;  2W9C B;  5KFH A;  1S10 A;  1NKE A;  5A0L A;  4F4Z A;  2ASL A;  5ALM A;  1WCN A;  1Q8K A;  4NV0 A;  1T94 A;  2KSO A;  1S0V A;  1NJY A;  2BCV A;  5KFS A;  3NUQ A;  3AUO A;  1N56 A;  3MFH A;  4KLI A;  2VJ5 A;  3I76 A;  4LVS A;  2E8N A;  5KG1 A;  1ZQB A;  2AQ0 A;  1SL0 A;  4ECT A;  3WKE A;  1SL2 A;  2F1I A;  1ZQK A;  1ZQN A;  3RBD A;  3RTV A;  2GLE A;  2JV3 A;  3EPG A;  8ICS A;  3H7I A;  5G5G A;  2BQR A;  3RH5 A;  1XSL A;  2YB1 A;  2ES6 A;  2PFQ A;  5DKW A;  4M9N A;  2KE7 A;  1KKX A;  2BZF A;  1NKB A;  5H2F U;  2YX8 A;  1ZQL A;  4QZ8 A;  2AGP A;  1QCK A;  3C29 A;  3JPT A;  7ICS A;  4FZN A;  1NJX A;  3GFK B;  2ZIW A;  2AH5 A;  8ICY A;  2K4I A;  1FIQ A;  3UQ0 A;  4RQ5 A;  2IOF A;  1U9L A;  1NZP A;  4RQ3 A;  1HJP A;  4QWB A;  1BPE A;  3Q8R B;  7ICK A;  4ECY A;  5ALF A;  9ICF A;  2PXI A;  4OJP A;  3TFR A;  2ATL A;  2ZIW B;  1F5S A;  5ALR A;  4F5Q A;  2JH7 A;  2R18 A;  1XSN A;  1XNS A;  5AKK A;  4KLF A;  4I2C A;  1P7D A;  4Y2T A;  1BNP A;  4DSE A;  2NO5 A;  4C8K A;  4DF4 A;  1Q46 A;  2AJQ A;  3SQI A;  2K8C B;  3TQ1 A;  5KFV A;  4Z6C A;  3Q8Q B;  3NVW A;  2W03 A;  5L1J A;  2B21 A;  2HHX A;  4RQ6 A;  3PR4 A;  4DSK A;  4K4G A;  5DLF A;  1X66 A;  1PK3 A;  2KZM A;  5DG8 A;  4UBB A;  2HDO A;  3CW2 C;  3G6X A;  4RQ2 A;  1RYU A;  2HOQ A;  1F44 A;  2BDP A;  3BDP A;  8ICC A;  2NRV A;  4KN4 A;  4CF5 A;  4ED2 A;  5JRT A;  4ECQ A;  1NK9 A;  2KFZ A;  1X6I A;  1SV0 A;  4QZH A;  4DL2 A;  4HYK A;  4DL6 A;  4YQW A;  2UVU A;  4O3N A;  1ZQY A;  4R65 A;  3UPQ A;  4UBC A;  3PX4 A;  5G5H A;  1C7Y A;  3CRX A;  7ICF A;  3GII A;  1ZD4 A;  1JAL A;  5EE3 A;  1N62 A;  2QB1 A;  5DQI A;  4J9R A;  3TAC B;  4KIT B;  1KFD A;  2H3V A;  3SZ2 A;  1KQQ A;  5KFP A;  4NLC A;  1JI7 A;  2IHM A;  4NY8 A;  1RQN A;  4F4K A;  1ZQD A;  3ZI4 A;  4IS7 A;  4FZM A;  4DO9 A;  2DPJ A;  2PFN A;  3CP8 A;  3Q8S B;  2ZIU A;  3L3F X;  2DKZ A;  4J03 A;  4USA A;  4US9 A;  3QU7 A;  4EEN A;  3HIL A;  3MDC A;  1L3U A;  1X9S A;  1PK1 A;  9ICR A;  3G6V A;  5ALD A;  3KHG A;  3SAG A;  4YR3 A;  3N97 B;  1V97 A;  1PVR A;  3RH4 A;  3GIM A;  1D9F A;  1TK0 A;  5GTH U;  1KW4 A;  1S0O A;  1S77 D;  2ZIU B;  3RJI A;  5AM5 A;  5EWG A;  4PHA A;  5AI8 A;  2RDJ A;  9ICQ A;  2ISO A;  1SB3 C;  4DFM A;  1EXN A;  2W9B A;  4XRH A;  1MQ3 A;  4FBT A;  3PV8 A;  2KOB A;  4UB6 U;  1TAU A;  3MR2 A;  3TAD A;  3BJY A;  1YZ7 A;  1PK1 B;  5IIK A;  3PO4 A;  1SZP A;  2FMQ A;  2ZJ5 A;  4YN4 A;  1MA7 A;  2J6S A;  2F8K A;  3QX7 A;  8ICA A;  5J2F A;  5J0P A;  4WJ3 B;  8ICL A;  2W9B B;  1B43 A;  1U47 A;  2HMX A;  4MF2 A;  2OM6 A;  4EEY A;  4OD0 A;  4RPZ A;  1SGG A;  4Y2X A;  5ALE A;  5ALU A;  3M8R A;  3ETL A;  1H38 A;  2BQ3 A;  2WAQ C;  2PI4 A;  5KFJ A;  5HR6 A;  4RT3 A;  1N2X A;  3QZ7 A;  2DUY A;  8ICU A;  4QWC A;  1SWV A;  5III A;  5KFL A;  4KLU A;  5AKZ A;  4QWA A;  1QQ5 A;  4A8E A;  9ICP A;  2UVW A;  5DB8 A;  5KT2 A;  3IRU A;  2EAN A;  2W7O A;  4M2Y A;  3PW7 A;  1DRG A;  2MA1 A;  4F93 B;  3QZ8 A;  4FS1 A;  1UHU A;  2HCF A;  4KLE A;  3F5E A;  1KFS A;  3RJE A;  3C2M A;  2PI5 A;  2HBL A;  2DF4 B;  4EZ9 A;  3VC8 A;  2C2E A;  4CNQ A;  4CRX A;  2DKX A;  3RAQ A;  5KT4 A;  4C8N A;  2D6F C;  5KFO A;  1XC9 A;  5B66 U;  1SL1 A;  1BPX A;  2QKQ A;  4C8M A;  8ICF A;  3IHQ B;  1DGJ A;  4NL9 C;  5HMM A;  1L7O A;  8ICE A;  2Y0S F;  2J6U A;  8ICG A;  4PGQ A;  3QUT A;  3SEN A;  4RZR A;  2AXT U;  4YMO A;  5KT7 A;  5AI9 A;  1ZQO A;  2C2R A;  2JGA A;  3V7K A;  5KTQ A;  1A77 A;  4QW8 A;  4XA5 A;  4M6W B;  4DS4 A;  3VCB A;  4UAU A;  1BPB A;  4KLH A;  4P0P A;  3MR5 A;  4DL7 A;  3WK5 A;  2BCQ A;  4DOC A;  4YD2 A;  3GIJ A;  5EOZ A;  4BXO A;  1A0P A;  3OHA A;  1WYG A;  5CHG A;  1K5O A;  5DG7 A;  2W8L A;  7ICG A;  2LKY A;  1Z3E B;  5ALW A;  5J0X A;  2IHN A;  5KNI A;  1KTQ A;  3N4M B;  4PHP A;  2IA6 A;  3ISD A;  4P0P B;  2PMZ C;  2DGZ A;  7ICH A;  4U7C A;  2AGO A;  2IMW P;  5KG5 A;  1RZT A;  2C2D A;  3BQT A;  3HWT A;  1NI3 A;  4BXO B;  1JN3 A;  1U49 A;  2FPM A;  3FC4 A;  4RQ0 A;  4CF3 A;  4ECZ A;  4RPX A;  3SD7 A;  1URJ A;  3ZD9 A;  2JEJ A;  3WKB A;  4KMU A;  5HP4 A;  3KHR A;  4PZN A;  3QUB A;  3KKA C;  2XCA A;  2LM4 A;  5J8Y A;  2GH1 A;  3ISC A;  4UB2 A;  3TKA A;  4RNM A;  5KG2 A;  4ECV A;  4QZE A;  3T3F A;  3FAH A;  1ZQR A;  5KFM A;  1L8L A;  3GIK A;  4ICA A;  4F72 A;  3ONN A;  4OO1 J;  4OJ6 A;  2BHN A;  5AI4 A;  3NVZ A;  2LI6 A;  4I2A A;  4CCH A;  9ICU A;  2NRT A;  1L6N A;  3IP4 B;  1U45 A;  3RH6 A;  2C22 A;  4NWI A;  2R8K A;  1JRO A;  3ZD8 A;  5KG6 A;  3TI0 A;  1NK5 A;  2KHQ A;  3BQ7 A;  5KFK A;  2W3R A;  9ICB A;  5BOM A;  1T4G A;  3EW9 A;  4J9O A;  3LDA A;  1QQ7 A;  4MFC A;  5AM4 A;  1JRP A;  3C21 A;  5KG4 A;  5J2H A;  4PHE A;  3EUB 2;  3MDA A;  1L7N A;  5AIB A;  5J0Y A;  1ZQE A;  4QWE A;  5J2I A;  2Y1J A;  4C0Z A;  1OUQ A;  2UVR A;  1N61 A;  3V7J A;  4DQI A;  1QH9 A;  2WF5 A;  4IC9 A;  1PVP A;  4QZG A;  4ED8 A;  3SEI A;  3KZX A;  3ZDE A;  1N5X A;  1UPH A;  2FLN A;  4YR0 A;  3V72 A;  2KP7 A;  4RQ1 A;  2Q0Z X;  4M04 A;  2NRZ A;  1NKC A;  3H8J A;  2LMR A;  1LVH A;  3ED5 A;  3O0F A;  2G06 A;  4F4Y A;  3UMG A;  1ZQC A;  4E0D A;  1Q3U A;  2IOH A;  3PST A;  4J9K A;  4UB4 A;  5GTI U;  3RBE A;  2KJ9 A;  2BPC A;  7ICO A;  4Q8E A;  1QSS A;  2K4H A;  1L8O A;  2ZIV B;  2BPG A;  1D8Y A;  2EDU A;  2CXY A;  2CRX A;  5AHX A;  2R8H A;  4F5N A;  1SZH A;  4RU9 A;  4UAZ A;  3BQ0 A;  2M0N A;  1L7M A;  2RHF A;  3C2L A;  1V85 A;  2IOF K;  9ICE A;  2HSZ A;  3K75 D;  2XCP A;  4IRK A;  1ZRN A;  1HUO A;  5L9X A;  2KK0 A;  4B9N A;  2E8P A;  2JHD A;  2XY7 A;  1NK7 A;  5KFG A;  1UT5 A;  2G0A A;  1K1Q A;  1MC8 A;  4Y2J A;  1O08 A;  1ZQV A;  1KEJ A;  8ICZ A;  4KLT A;  4IR9 A;  3RRH A;  4C4R A;  3PML A;  2G08 A;  1D8L A;  2E1E A;  4YD1 A;  2A1J A;  4EEK A;  3KBB A;  3GQC A;  4PJ0 U;  1S0M A;  1GO3 F;  2AU0 A;  4QZA A;  3CNH A;  4P4P A;  2XID A;  5KFZ A;  2WB1 F;  3NVY A;  3ZDA A;  1F0M A;  3EPI A;  4EX7 A;  4P4O A;  2ZTD A;  4R66 A;  4EBE A;  2HBM A;  3ORY A;  2BDU A;  3GV5 B;  4DF8 A;  5KFA A;  1TAQ A;  3C1Z A;  3WKC A;  2HI0 A;  4O3Q A;  2A1J B;  5KT3 A;  4I2J A;  4F5R A;  4Y2U A;  3WK8 A;  1J2M A;  1LB2 B;  4O3S A;  1UCV A;  3J81 j;  2KHV A;  3WK6 A;  2DL0 A;  3CYM A;  3NAS A;  9ICG A;  2NV3 A;  5HML A;  2HOF A;  4U6P A;  4ED0 A;  3AQE A;  5J0O A;  3N7S C;  1L3S A;  5C0Y A;  4P0Q A;  4CE6 A;  4B9M A;  1J2N A;  4RQ7 A;  2NO4 A;  4HAI A;  4O5C A;  5AKG A;  2I6X A;  3WKA A;  4M47 A;  3M7D A;  2DQN B;  3GIL A;  5BPC A;  2Q4T A;  2JEG A;  1LKY A;  4GC6 A;  4DSJ A;  4C80 A;  1MQ2 A;  2A3V A;  2ESE A;  2P66 A;  3ZDB A;  3UXP A;  4YVZ A;  1OXJ A;  4J9M A;  4EYI B;  4B9L A;  1HEK A;  1U4B A;  4J9N A;  2ZJ8 A;  4P0Q B;  5HR7 A;  2F3N A;  5DQH A;  4C7Z A;  4PGX A;  4MFA A;  1QSL A;  1M6Y A;  8ICO A;  4DL3 A;  1LKY B;  5KG3 A;  1TFR A;  1IM4 A;  1FFV A;  2K8B B;  4EYH B;  3PSP A;  5DB9 A;  4IQU A;  3FDS A;  5ALK A;  1NZB A;  2F2A B;  4UAV A;  1T3N A;  4PL1 A;  2HOI A;  9ICS A;  2LBO A;  3H0L B;  4IQT A;  2P6U A;  2VA8 A;  3PSF A;  4KTQ A;  2ZTC A;  3OSN A;  2F77 X;  4M9G A;  3KTQ A;  1Z4O A;  5B5E U;  2LM1 A;  4EX6 A;  1ZQA A;  5HHH A;  2KZ3 A;  1ZYQ A;  2BCS A;  1CEZ A;  4O5E A;  1RG6 A;  2HHQ A;  3V7L A;  4DLE A;  2G07 A;  3N7R C;  3PX0 A;  3MGV A;  2CN1 A;  2O6K A;  4Q45 A;  4UB1 A;  2RP5 A;  2D8C A;  3ICX A;  4Y2Q A;  3QNM A;  4FE3 A;  3JPR A;  5CB1 A;  5ALG A;  4GXI A;  2JEI A;  5ALX A;  3RB3 A;  5AKI A;  3E58 A;  2WF9 A;  3BQ1 A;  1TE2 A; 
#chains in the Genus database with same CATH homology
 3ONN A;  3KFU F;  2DQN B;  2ZIV A;  2H3Q A;  3PZP A;  2Q4T A;  4NLB A;  2WB1 C;  3LVV A;  1P7D A;  2KJ8 A;  2Y0S F;  4OO1 J;  4OJ6 A;  2HBK A;  1TAM A;  2OH2 A;  2CRX A;  2KOB A;  2A3V A;  2XI9 A;  3SQI A;  1SZH A;  2LYB A;  2K8C B;  3K1Z A;  2JMG A;  5A0L A;  2M0N A;  1L6N A;  3IP4 B;  4OJO A;  2RHF A;  2W03 A;  4NV0 A;  1T94 A;  2ZIX A;  3F53 A;  1HEK A;  2KV2 A;  1A6S A;  2H3F A;  4NWI A;  2RRD A;  4P0Q B;  3NUQ A;  2JGA A;  2KIW A;  4CGZ A;  5HR7 A;  1MA7 A;  2GOL A;  2H3Z A;  1XO0 A;  4KX3 A;  2JHD A;  2K4E A;  1D8B A;  2VJ5 A;  4WJ3 B;  4BX9 C;  2KHQ A;  3RFA A;  2HOQ A;  1F44 A;  3M6K A;  3VCB A;  3C28 A;  2G0A A;  4P0P A;  2OYY A;  4KMO B;  4QIW C;  1ED1 A;  2KD1 A;  2KKV A;  2F76 X;  4QJF B;  2KIC A;  2HMX A;  3SAF A;  1Z19 A;  1IIP A;  2HBJ A;  2OM6 A;  5KL8 B;  4OJ5 A;  2K8B B;  3SMV A;  1KBU A;  4ICA A;  4O3M A;  3PSP A;  2KKP A;  2K89 A;  2ZIX B;  1A0P A;  3F2C A;  2JH1 A;  2G08 A;  2G09 A;  4CDG A;  2E5S A;  3LVW A;  3CRX A;  4AYB F;  4C0Z A;  2G5H B;  2E1E A;  3PSI A;  4KX5 A;  1OUQ A;  2WAQ C;  2LKY A;  1NZB A;  2YB1 A;  5KL1 B;  5HR6 A;  2G5I B;  3GU3 A;  2Y0S C;  3RF9 A;  2F2A B;  5CRX A;  3H0R B;  2YB4 A;  4PL1 A;  2LYA A;  3DEE A;  4IC9 A;  1GO3 F;  3M6Z A;  2ZXI A;  2XVT A;  4P0P B;  1PVP A;  2PMZ C;  3AL0 B;  2HOI A;  2LHT A;  2DGZ A;  2H3V A;  2XID A;  2K8A A;  1PVQ A;  2YX8 A;  2LBO A;  2WB1 F;  4QIW F;  4BUG A;  3KZX A;  4U7C A;  4NLC A;  3H0L B;  2MRL A;  3ALR A;  4A8E A;  1UPH A;  2XIC A;  3T79 A;  4PL2 A;  3C29 A;  5T14 A;  2ZG6 A;  4FZN A;  1Q3V A;  2E1F A;  4OJL A;  3D2N A;  2W7O A;  2HBM A;  4FZL A;  2ZIW A;  2BDU A;  3SAH A;  2KJ5 A;  1DRG A;  1ZQ1 C;  2MA1 A;  3AQF A;  3IG8 A;  3PSF A;  4FZM A;  3F2D A;  2F77 X;  3D2S A;  3HKZ C;  3CP8 A;  3F2B A;  2K4I A;  1ECW A;  2N1R A;  2ZIU A;  3L3F X;  2KNJ A;  4QNL A;  2H3I A;  2WAQ F;  3NRW A;  1URJ A;  4ACO A;  2F8L A;  3F5E A;  3O0F A;  2CPR A;  2G06 A;  3OPX A;  2HBL A;  2DF4 B;  2OXO A;  2KVC A;  1HIW A;  3F5A A;  3IG5 A;  3VC8 A;  2KHV A;  4CRX A;  1Q3U A;  3CYM A;  2G07 A;  2Z7J A;  2PMZ F;  3D2Q A;  3N7R C;  2CN1 A;  3MGV A;  3IN5 A;  2RP5 A;  2VKQ A;  3PST A;  2NV3 A;  1CRX A;  2HOF A;  4U6P A;  3ICX A;  2GH1 A;  4OJP A;  3GZF A;  2W04 A;  4AYB C;  3SAG A;  1Z1B A;  3LYS A;  2D6F C;  4FE3 A;  3AQE A;  3H0M B;  4JMU A;  3N7S C;  3N7P D;  1WUD A;  1PVR A;  5C0Y A;  2VIX A;  2KJ9 A;  2VJ4 A;  2ZIW B;  4P0Q A;  2W7P A;  3E0F A;  2JH7 A;  1YT3 A;  2R18 A;  1XNS A;  2ZXH A;  2ZIU B;  4BJQ A;  2KEY A;  2K4H A;  3HKZ F;  4GFJ A;  3M7D A;  2ZIV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...