4BXOB

Architecture and dna recognition elements of the fanconi anemia fancm- faap24 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
196
Chain Sequence
VHVPLGHIVANEKWRGSQLAEEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords FANCONI ANEMIA GROUP M PROTEIN
total genus 56
structure length 196
sequence length 203
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17949 PND FANCM pseudonuclease domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bxoB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bxoB01
2OWOA 3Q8RB 4FS2A 3RJEA 3PW7A 3RJJA 1ZQXA 7ICIA 4DFKA 1KFDA 4PHPA 4RT2A 2BCUA 2FMSA 4LZDA 8ICMA 7ICPA 1Y88A 5L1IA 4K4GA 5KG6A 4ELTA 3IHQB 4PGXA 1BPXA 4I2FA 2HHXA 1UT5A 1S0OA 3FDSA 4PGYA 4DO9A 3C21A 8ICBA 3UXOA 3PW5A 3PMNA 2MUTA 1RXVA 1ZQEA 4CCHA 4Z6DA 3PW0A 4F91B 5KG1A 4J9QA 4J9KA 3TARA 4C8OA 2I1QA 3GIKA 3GFKB 1RZTA 4JK1A 4DF4A 4ECYA 4QZFA 1QSYA 4GC6A 4O9MA 3FYHA 2XY6A 4M2YA 1EXNA 4I2JA 4DFPA 4BWJA 5J2KA 4DQRA 2JEGA 4PHEA 1BPDA 2ZJ8A 4ECTA 4XUSA 4NXZA 3MFHA 4YMNA 2XCAA 1A77A 1ZQYA 4R63A 3V7JA 4F5RA 1ZQNA 4B9SA 1BVSA 2ZUDA 3UXNA 4J9NA 3RAXA 1S77D 2A1IA 3NGDA 2IHMA 5J29A 1B22A 1ZQSA 1S76D 1X2IA 4IQWA 4P2HA 3G6YA 3BQ1A 7ICJA 1S0MA 5KFHA 3H4DA 1UT8A 4MFCA 5J0SA 4BDPA 3UQ2A 2AQ4A 3HT3A 2LYHA 1A76A 5J0RA 5KFSA 3RJFA 2H5XA 5KFVA 4RQ3A 1KEJA 5KTQA 1ZQQA 5J2JA 4O3OA 1ZQWA 4QWDA 1S97A 5DQGA 4TUSA 3JPPA 5KG4A 3MR5A 3GV8B 7ICMA 5DB8A 1X9MA 4QZGA 5CHGA 4EZ9A 1ZQVA 7ICTA 1BGXT 1NKBA 3EW9A 2XC9A 4C8LA 5L1KA 4Q45A 3JPRA 5J2FA 3OHBA 5IIOA 3KHHA 4EYIB 1ZYQA 1HUOA 3RR7A 4ELVA 5KG5A 2UVUA 1NJWA 3GV5B 3HP6A 2ISPA 9ICMA 9ICTA 3M9NB 4R65A 4DSEA 5IIIA 4DL7A 4C8MA 5L1LA 4DLEA 1JX4A 3MGHA 3ISDA 3ZDAA 3HPOA 4ELUA 8ICGA 1IXRA 5J2CA 4IQTA 2PFQA 2J6SA 1QSLA 2HHSA 4UBCA 4DQQA 3C2LA 2NRZA 1B43A 2IHNA 3TFSA 1BPBA 2KFNA 3TI0A 3EZ5A 1Z00A 4DQIA 2ZIWB 3K75D 4C8KA 1U4BA 4M9GA 3RB4A 5DB7A 3MABA 4MF2A 3H40A 3RH5A 3BDPA 2UVRA 4QZ9A 2ZJ5A 2W9CA 3RH4A 5KFTA 2BQ3A 3SZ2A 1ZQBA 4B9NA 4F5PA 4NLZA 5IIMA 4LZGA 4DOCA 2ZIXA 3V6KA 3JPSA 8ICQA 4DS4A 5KFBA 3V6HA 4ED3A 2AJQA 8ICLA 5IILA 3PMLA 1T4GA 4DSFA 1T7PA 3BQTA 4TURA 1TFRA 3M9MB 3RJKA 2ZUBA 3MFIA 4KLUA 4E0DA 5KFFA 4NM2A 5KFZA 4YD1A 2W8LA 2ASLA 2IBKA 5EWGA 1ZQCA 4M9JA 4DOAA 5J0XA 4YXJA 3QEAZ 1S0NA 4C8NA 4KLDA 4KMUA 1XS9D 4YR3A 1D8YA 3QEBZ 8ICZA 2PFOA 3M8SA 4O3SA 7ICUA 5J0QA 4I2AA 4G3IA 3C1YA 1NK7A 4JV1A 2A1JA 2NRWA 2FPMA 4RPXA 4TUPA 4I2HA 2AGPA 2B21A 5CR0A 1JXEA 4R64A 2DPJA 7ICRA 4XRHA 3ZDDA 2M9MA 2RDIA 1C7YA 4YXMA 3TAPA 4DSKA 4NM1A 4EBCA 4QZIA 3N97B 2FPKA 3H7IA 5KFMA 4TQSA 1NK4A 7ICKA 4KITB 5HMLA 5KFPA 5J2DA 3MGIA 3GILA 4DL5A 1SL0A 1NK9A 3RRGA 4I2GA 1D9FA 3B0YA 4MFFA 4RZRA 1QLNA 8ICKA 2FPLA 5J0OA 3GV7B 3ZD8A 3PW4A 4PGQA 1XSLA 4KLMA 5DGAA 4ECQA 1LV5A 2IA6A 3SI8A 1TV9A 1ZQGA 1J25A 2VA3A 3PO4A 4ECVA 3KHLA 2WTFA 3KHRA 3MR2A 1TK5A 2PFPA 2W9BB 4ED0A 4M0AA 3ETLA 4QWAA 4YN4A 3B0XA 3TQ1A 1L3UA 5KG3A 2BDPA 2R8JA 4F4XA 2FLLA 4EBDA 3JPQA 4DL6A 1U45A 2MUTB 4KLEA 4GXJA 4TQRA 2BGWA 4QZ8A 1SL1A 2BCVA 3PO5A 1DGSA 3M8RA 4J9OA 2KTQA 4DL4A 4B9MA 4YP3A 1KRPA 3LWMA 5KT3A 4BWMA 5JUMA 2ISOA 1ZJMA 4KN7A 4BGDA 8ICJA 4O0IA 1BPYA 1MQ2A 1H38A 7ICGA 4P4MA 4KLOA 5D49A 4GXKA 4ECRA 1ZQPA 1QTMA 5TZVA 4Q43A 2XCPA 3V72A 1L3TA 2VA8A 3GIMA 1ZQMA 4M9LA 1KLNA 3MDCA 9ICCA 5J0UA 1JXLA 2MAXA 4KLTA 3LDAA 2JZBB 3OSPA 1NJZA 4DL2A 3ZDEA 2W8KA 2R8HA 2W9AA 3JPTA 1XC9A 1TK8A 3Q8PB 3T3FA 4F2RA 4QZBA 4FBTA 1SKSA 4DF8A 4YQWA 5KFGA 4DLGA 2C2DA 1KDHA 4RQ0A 3V7LA 8ICTA 2I9GA 3PX0A 2ZTEA 8ICFA 2VANA 4ECXA 5IINA 5J2BA 4M6WB 3RBEA 2AU0A 4YD2A 2AGOA 2KZZA 3QZ8A 1KFTA 1ZQLA 2BCQA 1MSWD 4O3QA 2Y1IA 3RBDA 1HUZA 1UA0A 3HWTA 4DOBA 2Y1JA 9ICVA 2ASJA 4M9HA 4ECUA 5IIJA 4KLIA 8ICWA 5J2IA 2GWSA 4RUCA 5DQHA 8ICNA 5KFDA 4F4ZA 4RQ8A 2KZMA 1J22A 4PH5A 4YMMA 4NY8A 3V7KA 3RR8A 3C1ZA 4YMOA 1ZQKA 4F2SA 7ICLA 3RJHA 1KTQA 3H8WA 1BPZA 5DGBA 3PR4A 4QZCA 1RYSA 4DEZA 2XO7A 4J9RA 5KG0A 3RJIA 3PX6A 3RB3A 4DQSA 3G6VA 2XGPA 3SYZA 2Q0ZX 5KT4A 3MR3A 1ZQTA 8ICOA 4MEXA 1NJXA 8ICEA 1K1QA 4LVSA 7ICVA 1KFSA 1ZETA 3MDAA 9ICOA 3PNCA 7ICHA 1J23A 8ICYA 3AUOA 2V4QA 4YFKA 1WCLA 5HP4A 1U48A 1NK6A 4KLSA 2ZIVB 2JNWA 2W9BA 5DG7A 9ICUA 4UB2A 3SV3A 5KFIA 1K1SA 2F1IA 5KT6A 1IM4A 3ISCA 8ICSA 1S0VA 1S9FA 4I2DA 2JZBA 1XSNA 4JWNA 4UB5A 4RPZA 4RQ2A 4IRKA 4DSLA 4F50A 3KHGA 1SZPA 2PFNA 2BQUA 3C23A 4GLXA 4F4WA 2HHQA 1ZQFA 2JEFA 4NLKA 9ICRA 4ZH4A 1S10A 3N4MB 4MF8A 5KFLA 1T3NA 1LB2B 4O3PA 1NK0A 1U9LA 1L5UA 4F92B 4IRDA 5L1JA 9ICFA 2F1HA 4DQPA 4RUAA 4NLGA 4JV0A 1QSSA 1ZQAA 2JEJA 7ICNA 4DFJA 3Q8KA 4F3OA 2KN7A 4EEYA 5KFWA 2ZTDA 3PW2A 5KFKA 1SL2A 4QZDA 4IQUA 5DKWA 5J0PA 5D4BA 1SKWA 4RU9A 4Q44A 3H8JA 5J2AA 1SKRA 1ZQDA 3V6JA 2P6UA 5KT2A 2HW3A 5DQIA 1RPLA 4J9PA 3GIJA 3LK9A 4O5KA 2V9WA 2C28A 3RRHA 7ICEA 4UB1A 2IMWP 9ICWA 2W9MA 3RH6A 4EYHB 1NJYA 2UVVA 4J9MA 1HJPA 5IIKA 8ICAA 4IR9A 4F4YA 5BOLA 4QZAA 5DLFA 4RQ1A 4UAYA 3OHAA 4I29A 9ICKA 2BCSA 2VA2A 2F1JA 1AROP 5CWRA 3EPGA 3Q8LA 4ECSA 4QWBA 5HMMA 5J2EA 3H4BA 2BHNA 2XY7A 2C2RA 1XSPA 2NRXA 4I27A 5KFUA 4Z6CA 5KT7A 4ED8A 2R8GA 4Z6EA 4R66A 3PR5B 4O3NA 4DL3A 4M04A 9ICXA 4R8UB 3EPIA 4X5VA 3RB6A 2BPGA 2BKEA 4Z6FA 4RQ7A 1T8EA 7ICQA 8ICVA 2J6TA 4O3RA 4R8UA 2J6UA 1J24A 3NTUA 3EYZA 9ICJA 4P4PA 1WCNA 5BOMA 5J2GA 1X9WA 3G6XA 4JWMA 4P4OA 1ZQUA 5DBAA 4Q8FA 4RPYA 3HW8A 1MQ3A 4KLHA 4UBBA 4PHAA 5KG2A 3T5JA 9ICNA 4P0QB 5CA7A 1D8LA 3E2EA 1CUKA 4KLQA 3TAQA 4DSIA 4QWEA 3QE9Y 2DPIA 4YG2A 1NK5A 4I2EA 3THVA 2C2EA 5J0WA 3ZDBA 4RQ4A 1ZQRA 5BPCA 4XQ8A 4I2BA 4PPXA 3RAQA 2XY5A 4RNOA 1U47A 1CEZA 5KFCA 3RTVA 7ICOA 1ZQHA 4K4HA 2DFLA 4F5NA 4NLNA 4ED2A 3RB0A 4HYKA 5KFYA 9ICEA 3MR6A 4F5QA 4FS1A 4F5OA 2HHTA 4KLGA 1ZQOA 1X9SA 4MFAA 8ICUA 1TAQA 1ZQZA 9ICPA 3JPOA 2FLNA 3KTQA 5D46A 1TKDA 2BPFA 9ICIA 5KFEA 1COOA 5KFAA 4ED1A 1UA1A 4F8RA 2BQRA 3Q8MA 2FMQA 1MC8A 4Q8EA 8ICXA 4GXIA 3ORYA 3ZDCA 5J0TA 5J0YA 4KLFA 5CJ7A 4QW9A 5F9NA 4EZ6A 1PZNA 2ATLA 2FLPA 9ICBA 4UAWA 4UB3A 4PHDA 3GDXA 3OGUA 2NRVA 4I2CA 4RNMA 2PI4A 1KSPA 1L3VA 1D9DA 4JV2A 1JN3A 3Q8QB 5C5JA 2ZIUB 4KLLA 4UB4A 3PV8A 4KTQA 1V9PA 1Z00B 5DG9A 3OSNA 4DWIA 5DLGA 4O5CA 2JPDA 4RQ5A 3OJSA 1BPEA 4BXOA 2ASDA 4QWCA 4QZHA 5DBBA 2RDJA 1N48A 2ZUCA 4M47A 3C5GA 4I2IA 3Q8SB 4BXOB 4DS5A 5KFJA 3TANA 5HNKA 1TAUA 9ICQA 5KFXA 2NRTA 2BR0A 3BQ2A 1NOMA 4ECZA 5J2HA 4QZEA 4O5EA 1Z3EB 2P66A 3M9OB 2BPCA 3H8SA 1TVAA 3GIIA 3JPNA 5EOZA 4F4KA 3SV4A 3RJGA 2HHUA 4YVZA 9ICSA 4P0PB 4B9VA 3T5KA 4M9NA 1ZQIA 3C2KA 2R8IA 4B9UA 4J9SA 4YR0A 4ED6A 1NK8A 7ICFA 2FMPA 8ICIA 2W9CB 8ICRA 2ZTCA 4F93B 3BJYA 4GC7A 3GQCA 1TK0A 4UAZA 4FO6A 4FBUA 1N56A 1ZQJA 3C2MA 4B9LA 1JMSA 4KLJA 9ICHA 3MBYA 1NKEA 5F9LA 3QZ7A 4ED7A 1NKCA 5CP2A 9ICGA 3PVXA 2C22A 4YR2A 5DDYA 9ICLA 2M9NA 5L9XA 3PX4A 8ICPA 3AU6A 2UVWA 4IRCA 4RT3A 2KFZA 1JIHA 4M6WA 4B9TA 5DDMA 1DOQA 1RYRA 2HVHA 2BCRA 1XWLA 4IQVA 3HX0A 3LWLA 5HHHA 5KG7A 3BQ0A 2ZJAA 5DB9A 3ISBA 2HHWA 3AU2A 3K4GA 1L3SA 2A1JB 3PY8A 7ICSA 4ECWA 2R8KA 3C5FA 2JEIA 1RXWA 5EWEA 5KT5A 2AGQA 4K4IA 5EWFA 4RQ6A 3T5LA 2PI5A 2P6RA 3IM1A 4QW8A 4XA5A 1U49A 5KFQA 5DBCA 4EBEA 2HHVA 2AQ0A 5KFRA 3ZD9A 3OJUA 9ICAA 3UXPA 4UQGA 5KFOA 5DG8A 4TUQA 3T5HA 2HVIA 8ICCA 4I28A 1XO1A 1XU4A 3UPQA 4KN4A 4IR1A 4YCXA 2V4RA 4JUZA 5CB1A 4DFMA 8ICHA 4J9LA 4MEYA 2KZ3A 4RNNA 2XGQA 5HHIA 2PXIA 3UQ0A 5KFNA 3TFRA 3EWAA 2ALZA 1ZJNA 4DSJA 5DB6A
chains in the Genus database with same CATH superfamily
4ZV7A 1T4DA 2ZR9A 4JELA 5LXTA 3BE5A 1U0SY 1VGRA 1Z8FA 4BNLA 4KJXA 4DKXA 4YXWD 4J91A 4AD8A 1OYYA 3FXAA 4JUFA 1QOPB 1XWWA 5L1IA 3K6SB 3HCNA 2R751 2FE4A 2VLIA 3IT1A 4LRSB 7MHTA 1XTVA 1BJTA 5LDGA 3WADA 4C20A 2AJTA 2KW5A 1GG8A 3UB3A 2QB0B 4JKYA 3DDNA 4B5LA 1UDRA 4NZ9A 3RVMA 2RGCA 4IDHA 2VJLA 3T7CA 5IJ9A 1XUOA 3RFAA 1D4OA 3WSWA 1OPXA 2W98A 4QIWF 1T29A 2AMVA 3PC8A 4Y1RB 3E2MA 3BSYA 2NVWA 3PCRB 3OEWA 3IYLW 5EKTA 3OQMA 3A2NA 1BMDA 4L8LA 5EIBD 4O9MA 3CEPB 1L3BA 2IBTA 1WW3A 1ZXBA 4DQRA 3WJ7A 1QC5B 3QFFA 1NX6A 3AIIA 3HYRA 4PAMA 3LT4A 3R74A 4NXZA 1SKMA 3AHEA 2AC2A 3H0KA 3K53A 4S05A 4CV3A 4AJEA 4J3FA 2P35A 4P35A 2AMYA 2I2FA 3QA9A 5EJ8A 1WO8A 2O7NA 4DMGA 4RHUA 1TX4B 5K0LA 3ZU2A 2A4KA 1PGPA 1ZQSA 1E3IA 3FKSA 4LJ7A 2I6GA 2A5YB 4DDWA 1NLZA 3NT4A 3LHFA 4MYRA 1XWIA 5A7GA 1C1DA 2Q3DA 3WICA 2VZEA 1C41A 2AVDA 2EARA 3QFHA 4D41A 2DHDA 4F6RB 1AX9A 3P9QA 4X1IA 3ZCVA 3MRVA 2PS1A 3P0HA 2J67A 4KACA 1MBZA 1GRNA 1X70A 2ZRPA 5J2JA 2XADA 4O3OA 4QWDA 2AQIA 1NA5A 3FY4A 4QOFA 3OPQA 3GYBA 1U2DA 1WLYA 3ROXA 5LYJB 1O96A 2EF1A 3HCWA 3MR5A 3TR0A 3JPPA 3HEBA 5TPZA 3WMGA 3AERA 3N59A 2EWWA 4JJEA 1ECPA 7ICTA 4GZMA 5J5CA 3P1JA 5KREA 4EEXA 3RF9A 1O94A 3I2YX 3THXA 2PH7A 4DADA 4TVSA 2C8LA 1A7UA 1S3FA 1Y80A 2I1LA 4K1XA 1E1QD 4DJFC 9ICTA 4NJ8A 2JFOA 4HTFA 5IIIA 1TCCA 3E5NA 2JZNA 3N2GB 4QJ4A 4CUKA 2ZBRA 4RABA 8ICGA 4LXQA 5J2CA 2AXEA 1FJGB 3DAGA 3U3MA 3UB2A 4O1MA 4R2IA 2R00C 1BPBA 3ZNQA 1U1IA 3M3HA 4BE4A 2QORA 4QELA 1CDEA 4DG5A 4EF5A 3FWKA 3D7RA 1YD7A 3HP7A 3AKZA 4V0LA 4W4TA 1S5LU 1PV2A 3NZEA 2V1UA 1N5IA 2R4TA 3G8YA 1ODKA 2PSEA 1OTHA 5CT9A 3ZWYA 2XUIA 4FM9A 3L1HA 3EXFA 4GEGA 3UAGA 5J1TB 2BELA 1DRKA 1ICEA 1SD1A 3MS2A 1XZIA 2FX2A 2O2GA 4G26A 3NTOA 4CCYB 4ES6A 3TMYA 1DC7A 1WF6A 3IRVA 2C20A 3D54D 4NMWA 3TEMA 3ZCXA 3DP7A 4BQEA 4EF4A 5JHGB 1EFLA 2Q2NA 3OCUA 5AK4A 1SZCA 1U7PA 3JXEA 2D1RA 1AF7A 2HL6A 3SQXA 2Z8YM 5K0TA 4NM2A 2P2CA 2YZ7A 2HLHA 2C7GA 2IXDA 1MENA 1UC4B 2D2XA 2RGXA 4H7DA 1U7DA 4JX8A 2BHSA 3RV3A 1XPOA 2JBHA 3NONA 1I4TD 4YP9A 4H4EA 1WVMA 5J4KA 3D7MA 2GVZC 1IUKA 2G1JA 3F6EX 5FORA 3HJGA 3Q9UA 4WKGA 1K8QA 2ZBDA 2FQQA 3Q1KA 4HDNA 4OHOA 5EKXA 3W6UA 3ZCRA 1RWBA 1N6RA 1F5SA 2XE6A 4L0DA 4MVJH 1X8KA 4F6RA 3KAQA 2CL7X 5LOVF 4MARA 2HNBA 2VJ5A 2HLNA 4K28A 3UJCA 3DDSA 2E55A 3PCXA 1DAMA 1EUZA 1JG2A 1O9HA 3C1TA 2W2KA 4FW8A 2ONJA 2CXXA 1T1EA 3WLTA 6AT1A 3KYBA 4BC0A 4CQMD 1A1VA 1Y7PA 3I01A 1CBUA 4BMZA 4KR2A 5KFMA 3GEDA 2FPUA 1Q46A 2NYRA 2P9EA 2GXQA 2Q2OA 2WWRA 2ZJ2A 4IQ4A 4HAIA 4R1QA 5DW0A 2IDJA 5KNIA 2EX0A 4AZTA 5JAHA 1PZGA 5E9JA 2GYVA 2IEIA 3WLPA 4AO6A 1H6CA 2FRDC 5IM4A 1H9CA 1EA5A 1MIOA 1SXJE 1LV5A 4MW9A 4A3SA 2JGDA 4D0GA 4F9GA 5IT4A 3IP1A 2WSYB 4UB8U 2OENG 3I45A 4YJHB 5EXDA 4F12A 5C8YA 5CJ2A 4URHA 1K6MA 4PG5A 2WKRA 3FCOA 4KRFA 1DQSA 2HWWA 4GNKA 5F1KA 4QULA 2AOTA 5K8UA 3TSCA 7ADHA 3IP9A 1KIFA 1Q6ZA 2W2NA 3K0AA 4R9VA 5HFNA 4DL6A 4YGXB 1NQVA 4V1CB 1E61A 4WIAA 4LGYA 1NYRA 4KLEA 4TPKA 2WUGA 5B1SA 2ZRJA 3FCYA 5CYGA 4EYGA 4B9MA 4Y1RA 2P4HX 1L1EA 2OBYA 4M76B 4DARA 4N41A 2KEYA 4EI8A 2ZJ6A 2O4CA 7REQA 3PRYA 2Q62A 5HK9A 1MQ2A 4NMMA 1TQ8A 4D5EA 1JDTA 3BWYA 1L7PA 2P3SA 4Q9LA 4HAYA 2QW8A 1U9CA 2JFHA 2ZEJA 5K3OA 3G2PA 1CQIB 3E84A 4X6XA 5IBQA 4TKUA 3MDCA 5HKOA 3HWWA 4HXEB 4AMYA 4DRXB 3R44A 4EIWA 2R9VA 1JKJB 5AOAA 2AOUB 2P2YA 1Z5WA 1ZK2A 1KI9A 2VDPB 3OJWA 4RXTA 3WO1A 2TS1A 5JXWA 1J9GA 1O3YA 5B1EA 2IYLD 1L4KA 4LJKA 5F33A 2QDKA 3EUEA 1SIWA 3T1HB 1TK9A 4UEQA 5IM5A 1LBSA 2YRFA 3A31A 4QT4A 1VMIA 1E2UA 1XK7A 3VU9A 5F2NA 1SGWA 5U4QA 3FN4A 4ER5A 4ARZA 1JVNA 4UHEA 1EINA 2DBQA 4TWAA 1UINA 4D80A 2VQFB 5FBVB 4JENA 3HXQA 1J39A 2YV4A 4DA8A 1SQGA 3LPCA 3OWXA 3E0FA 3RC7A 3OF3A 1V16B 4RF5A 2PTGA 1PVQA 1Z4QA 1RAAA 5EZSA 2WWIA 3TL3A 4DOBA 4B9AA 3B36A 2YV3A 1ZXIA 1OHHA 1XTTA 4KTVE 3RANA 4I3HA 4ECUA 3U5TA 2O8EB 1SUDA 1WOMA 4P4LA 3UMYA 1OXVA 2J3EA 2EP8A 2Q4EA 2WP8J 4UEWA 3EA0A 8ICNA 4UDXX 5EFZA 3GP3A 3JYLA 4KE6A 4V39A 9LDBA 4XJTA 4FIZA 1H1LA 5U1PA 4Q21A 3BF7A 2APJA 2NSJA 4MB0A 4BN5A 1YB2A 4RWZA 4IQFA 2J1LA 1RXIA 1XJ0A 3D7NA 4JNKA 4MWCA 4NBTA 3I5UA 5ES4B 2CYCA 3QY0A 2HH9A 3R9KA 1CZRA 2OV3A 4AS2A 2IS4A 2XGPA 3SYZA 1X2BA 3PITA 1OGJA 5J8YA 1NJXA 3LUAA 2JL1A 4ENWA 5HZHA 3B9RA 1F2VA 1BCRB 1J42A 2A0XA 2AB0A 7ICVA 2B99A 1FIQA 2VDKB 3MGKA 1KFSA 5AD1A 4ZYZA 2IH4A 3MDAA 4FK8A 2CJPA 2PLNA 1QP4A 1DOZA 4K9RA 2C1XA 1YVEI 4G5QA 4QUEA 2BT4A 1ZISA 3EZNA 4FD2A 1Y4AE 4LAFA 2QA5A 4PICA 2W9BA 4JJKA 1NVFA 4CVNA 4EZBA 3DE5X 1X42A 3SV3A 5ICEA 1NI3A 3IVCA 3EW7A 5IXYA 2I67A 2C4WA 1YZ7A 5AI5A 9MHTA 2BGJA 3L2OB 4BLSA 3DFFA 3VYRB 1ZNQO 5B2FA 4JWNA 4IDOA 2OXFA 5IVKA 2EAMA 2DKZA 4YJFA 5BNIA 3ZU3A 3TQSA 2J48A 3S2UA 2JIPA 1RQPA 2HHQA 3REOA 1FYFA 2WAMA 2Z56A 3OQ1A 1B8UA 1VLBA 4CXMA 4K1LA 2JAPA 4L0QA 3SHQA 2ACWA 3SQOA 4BWFB 4CI0B 2AFVA 3T79A 1M10A 5CNJA 1GTSA 4I7EA 3VR3D 4ESOA 3DUWA 4IINA 1DO8A 1U81A 4JV0A 3AW8A 3FYUB 7ICPA 3S2ZA 3D6FA 1JA9A 3STUA 3BXEA 3VDRA 3X2SA 2RAFA 2GN8A 3WL5A 5J0PA 1OI4A 5BUCA 3RARA 1HQDA 4BWYA 2D3DA 4KNYA 1EGVB 4B47A 1N1DA 1RPLA 3QEJA 2VF8A 4YA6A 4MUJA 5D3MB 2ODWA 2Q6OA 1T26A 4UB1A 4IKOA 3DC7A 4F5YA 2VT6A 4N0MA 2QZJA 5TQ0B 2YWDA 3O4HA 2UVVA 1RI5A 4YJHA 3REFA 4Z6KA 4DLLA 3EXEB 5BN1A 2A0YA 3B7GA 3QWHA 3ROMA 4BVLA 4XQEA 2NQTA 1E1DA 2V6MA 2OMKA 1H2AS 5DU2A 4UAYA 4AYXA 2P3LA 1RZRA 3HN6A 5DTMA 2VA2A 3NNSA 4LZOA 2XCOA 5LZ5A 5IAJA 2J5XA 5TY0A 2IA5A 2MIIA 1THMA 5CCDA 4ECSA 1NZPA 5HMMA 4QWBA 1FA9A 2PCLA 1K5HA 4QDXA 1VSVA 5JQWA 1ZN7A 2RGEA 2B8TA 2N42A 2XXJA 1SXDA 5KFUA 3DQPA 4E03A 3G2LA 5C2JB 4UNNA 3I12A 3LXMA 1LS6A 2GD6A 1G5HA 4ZZ1A 2BPGA 3RS8A 4G5YA 1EGAA 4X1KA 1G6HA 5AW9A 5CD1A 1VJ5A 4RQ7A 1WSAA 1Q95A 1FW8A 2ZKIA 5T64A 4HTAA 3RVBA 4DCPA 4KJZA 4Z49A 3I8XA 2UZ1A 4P4PA 4MP6A 1WCNA 4HR7A 4RXUA 1R4MB 1Z2NX 4BKPA 4LOJA 1VL1A 3ZE9A 1ND5A 2FRDA 5KC9A 2WYIA 4NIMA 5HM8A 9ICNA 3FGZA 3SYMA 3FCCA 2RI6A 1GCAA 2ISQA 3QI7A 3ZPXA 2IOFA 2ZCVA 4ER3A 2HK9A 3E9RA 4MV5A 4Y6GB 1EDDA 1GYPA 2D0IA 2YFQA 3I30X 3NI2A 3O2SB 4PTLA 3WQHA 1JALA 4JB3A 2XB4A 4UBIA 1IOLA 1Y37A 2BVNA 4XQ8A 1ISHA 4RTQA 4HUJA 5DBIA 2ZB4A 3EPKA 4L5IA 1MVNA 4GZ3A 2AZXA 3EVFA 1GTG1 2QL6A 3QVOA 3RYCB 1CULC 3FZQA 4MWTA 5CW2A 1M1YE 2ZUEA 3SF0A 1QGAA 2EZ8A 1QVWA 1N25A 2BKVA 3DEIA 3NHRA 4GWKA 3T0IA 4C0KA 3O2QB 2ZE7A 2F9FA 1A9PA 2O3JA 1L1QA 4L22A 4UVEA 3SZLA 4EQ6B 1X1RA 2ZE5A 1X1QA 3DAPA 3CTPA 3FNGA 3GAAA 3M2PA 4NCIA 4RMIA 5K8VA 1X9SA 1LS1A 3BB1A 1L5QA 4C06A 2BR3A 3EHEA 4M38A 4ITRC 4MEBA 4CETA 1BJRE 2C2MA 3HO6A 1YT3A 1JBQA 4L9SA 3AYXB 1JFSA 5D2CA 1C0EA 1R6UA 1ZOSA 8ICXA 4HOYA 3WJ1A 2R4QA 3ZDCA 1DUVG 4LNUB 4DV5B 4RHTA 4R51A 3FAHA 1XLWA 5EE3A 1JDUA 1FXWF 1ZM9A 1Z3CA 3Q3JB 2RHJA 4JYBA 5IDXA 2XHEA 3JZIA 1RC0A 1ZY2A 2JARA 3BRWA 4Y3UA 1YDMA 4MW2A 3H11A 5B4UA 2Y67A 4ZTBA 2MMGA 3QXXA 3X1MA 3GOHA 2E21A 4U02A 1AD2A 2Z2XA 4Q4HB 5TQ2A 4V24A 4G65A 1AZSC 2WIAA 4OTZA 2NGRA 4X44A 1XLTA 1RKVA 5FWAA 3RUDA 1HTWA 3HKCB 2GJ9A 1LPSA 2VSYA 4CTJA 5JQGA 4WKCA 1KRWA 4NDNE 1H5QA 4IICA 3ASVA 3LUGA 1JDVA 1Q3TA 4FFOA 5JFTA 3TANA 1A8HA 2LDXA 2RGGA 3I6QA 3CTMA 4NE2A 5ALPA 4QG7A 3BQ2A 1QU2A 2C92A 3UHPA 4ENUA 4D92A 5JIBA 5T4EA 1TVKB 3GI1A 4BTEA 2R00A 4IJKA 5LA6A 3T1QA 3EGOA 4F4KA 3H05A 2O5CA 3QWFA 4HWKA 3PXDA 3W6PA 4B76A 1J5EB 1CPYA 5BN4A 1BA2A 1S3GA 3IAS1 3OFKA 1ZUNA 3C85A 3G9UA 3LBYA 2GBLC 5CTAA 2H3HA 5D85A 1WTCA 5JTUA 1VYHA 2H3VA 3KOOA 2K87A 2WSSD 1Q6YA 2BFBB 3GRPA 4RK0A 2NTEA 4U2DA 1ZXXA 2R8IA 4MQEB 3BG5A 1SHUX 2GEBA 4J9SA 4GX5A 4ED6A 4H6XA 1BIFA 1DC8A 2JFUA 4EPRA 1GNRA 3GBSA 5K0FA 2JGEA 2Y0BA 5JJCA 4FO6A 3F71A 1Z12A 3UHOA 4H35A 4A4DA 4UE3S 3IQGX 3T9CA 2JF0A 2OORC 4MB6A 1U2DC 4P3OA 3RTDA 5BQOA 3TK1A 5BMVF 1DC6A 1F2UB 5JZOA 9ICHA 3V8QA 2BMEA 4E32A 4NI5A 2HHHB 4EY8A 1C4XA 3J7AC 3BWVA 3ST7A 5EEHA 1GGKA 4HJXA 3X1XA 4LXUA 4Q16A 5L9XA 2BGMA 4NG5A 5CB0A 2PX5A 3QVLA 5DX8A 4RT3A 1KEZA 5TE9A 1R0XA 1VL0A 3GUYA 4N48A 3JVIA 1THGA 3LVFO 1QR2A 1SVLA 4BO6A 3DTVB 2D06A 1T2NA 3OOEA 2J6BA 3O8OA 2MCFA 4GNRA 2SHKA 1DG3A 4JBYA 5JZSA 4JBHA 3EXEA 4L6IA 2JLZA 1A8QA 1ADCA 1UXOA 4XX0B 3W4JA 4K4IA 2AC7A 2AGQA 3OO1A 1I36A 2JBWA 1KMHA 1PUZA 1VZ2A 5DBCA 4ZT2A 1D7OA 2C2ZA 1HZZC 1JSXA 5C8ZA 1P2BA 2DYKA 2YZKA 4G0QA 4KPFC 2LCIA 4X41A 5KFOA 1PR2A 2EL7A 3RVQA 1JQEA 1PV1A 3ZI0A 4BRSA 1XU4A 2H3IA 4OA8A 1BXGA 3RSZA 2VJQA 3EVTA 1XAHA 1G9SA 5ALWA 3BK7A 3YASA 5EIEA 4UXJA 3B13B 4RGQA 5EJEA 3WB1A 1ZJNA 3S5UA 4I9NA 4K5QA 3M3DA 3FDZA 1Y8QA 3L6DA 3GLFE 5K3EA 2B4YA 4CFSA 4RF4A 4BKRA 3F2DA 3CEHA 3ETCA 4M9CA 2Z6QA 1YT5A 3WGOA 2I7VA 1BZYA 1WZIA 1EWQA 1IN1A 4IVRA 2H4YA 1P29A 4S12A 4DCGA 3DXZA 3R7LA 3OLQA 2KPOA 1W87A 2QP9X 3MMXA 4GUDA 2LCFA 3WLOA 2LPMA 4DPLA 1F4LA 3HCDA 4K9OA 3NJ8A 4TXLA 5J23A 1G8JA 2QBYA 3ACBA 4BNNA 4XIFA 1UAAA 1CRZA 1G21A 2XE4A 1ZIXA 1BDJA 3N53A 2IYVA 2K2WA 4FX2A 5C5IA 5CA0B 4L16A 5HRAA 2VDJA 3IEKA 3V7WA 5T8KC 4JK1A 4D43A 1UANA 4UQPA 1MA3A 4EK9A 2AOVA 2X7XA 1TJ5A 3CUWA 3OY2A 1EXNA 2ZS8A 3DOFA 5J2KA 4ZRMA 1K63A 1P19A 3EF1A 4DLSA 2B7LA 2X3FA 3A26A 3NLLA 4OLJA 5REQB 4DLAA 4R63A 4UBKA 1ISJA 4L3VA 1BGWA 2ZUDA 1LDGA 5DYIA 1C9DB 1TJYA 5HPYB 3IB3A 3FUTA 1IBKB 2J9ZB 4MQUA 4QRIA 1QFSA 1DP4A 2ERXA 1O2DA 2PX8A 1WZEA 3OFNA 1XN4A 5B58T 1WEKA 2ZK7A 3DEZA 3IFSA 1T3GA 3PQCA 2FCRA 2LYHA 2IVZA 1A76A 1D2GA 3A9TA 5EZQA 5EJ7A 1PP4A 1QIHA 4MQEA 2CXYA 5ERXA 4NZOA 4KR0A 4NZMA 5KYUA 4DNOA 1YC2A 4MDEA 3HCCA 1KJJA 2YOGA 2F67A 2QX8A 2DP4E 4YECA 8AT1A 3L3BA 4FN4A 3VU8A 5EZYA 4YRMA 3R3WA 4TTJA 1J20A 2EX4A 3LCCA 1QX4A 5AVWA 4HDOB 2IPXA 1HE1C 3ONNA 5F76A 3WBKA 1S1CA 1US8B 4EKNB 2QTNA 3JQAB 4G09A 1CY7A 5ER6A 3W7AA 1Q17A 1JX4A 4XASA 2Q5JA 1K5OA 1PVRA 3HMQA 4B7ZA 1L7QA 1TGYA 2J9XB 2MSEB 3HDYA 3D8SA 4Q4AA 1N2CB 2H2IA 3E15A 4H9GA 4PF1A 4XJSA 4ABYA 4BEWA 3H83A 4LCBA 2W22A 4FP9A 3ND9A 1S3IA 1OMOA 1POWA 1JIXA 1VPDA 1HV8A 1L5WA 3AHHA 3DE4X 3D4LA 4OBXA 3PTLA 4QYWA 5TQVA 2AI3A 4O5OA 4R6XA 2QPLA 3U4AA 3DNFA 3M6LA 2A0KA 3LP8A 1XFDA 5M29A 1JKMA 2ZIXB 2JLBA 3ICCA 5KFTA 2F1OA 3SZ2A 2HCTA 3M8KA 3KTOA 4HH4A 3I6YA 4LYEA 5TVGA 2CXSA 1Y1KE 1TDJA 1SCJA 2H5LA 4CDGA 3WQRA 2HSJA 3K94A 2VNKA 5D6OA 3JVUA 1UBTS 2O3UA 4Q7KA 5CJPA 5KC8A 3NO4A 2J32A 1AUQA 2J4CA 2FG5A 4WH0A 3DYIA 1P75A 1G20E 1GYRA 3DXXA 1L4GA 3E5MA 1TADA 1BXGB 4JSTA 4RACA 3VTZA 1RCUA 4MUNA 2B6NA 4KUHA 1N2CE 3JD2A 5EQFA 3CYFA 3T3HA 2GLTA 4M1TA 5DI3A 3UMCA 4DLUA 5TQ0A 4PCUA 4KYVA 4OLAA 2P78A 2P2SA 2J0EA 3LT1A 5BQ5A 3ZV4A 1J33A 4B85A 1ZFNA 4BO7A 3EQ7A 2OZLB 1Z7WA 2PUWA 1TGVA 1XTUA 3HDHA 4IIBA 3LDGA 4PQYA 4MVJF 5EPOA 1SV0C 3U4HA 5LLSA 2OC4A 3A25A 1UJ2A 2C2HA 3UXEA 5JH7F 3P27A 1NKTA 3B85A 4FGZA 4GL4A 5AUQA 3SZRA 5CX1A 3QUAA 2R6GA 1MABA 3FI9A 1NMQA 3D31A 3KZOA 4HAOA 2HBKA 1KQFA 1CFZA 2O2YA 1K3UB 5ALKA 1RRPA 2BEUA 3TAXA 1S4QA 5D7NA 2C84A 4PC7A 1AQYA 2P8JA 3MW8A 1MAAA 5KFPA 2GNAA 3S8MA 1SL0A 1K6EA 3ESZA 2YXPX 3BC1A 3L4JA 1XZBA 1EVIA 2AFRA 4WUTA 1IAVA 4RZRA 2R8BA 3C43A 2OFXA 1OFHA 2PUJA 3KYIB 3NBUA 2O3QA 3OPMA 3Q88A 5DNDA 3MTDA 4BVJA 1C4OA 1SD5A 4BZWA 2QZPA 5LWHA 3MINB 1HDRA 2WWXA 4H4CA 3LT2A 2WJIA 4X20A 3W9BA 1VYUA 2X5JO 2IA6A 3IGFA 4WK6A 3SKXA 2Z2JA 3E0XA 1Y1SA 4ENSA 1OAOC 4ZICA 1YDEA 4WT7A 2DQNB 1CTQA 3OT5A 3PNSA 4ED0A 2WJGA 2XLBA 5KOYA 1XPJA 5EUBA 4ZAZA 3EGIA 5C8YB 4FFDA 2XXBA 2RK6A 2QLFA 4MVJM 3U7FB 3KB2A 2V98A 2FQYA 5FUXA 1EX9A 5FBZA 2YIJA 3UWDA 1D2EA 4EBDA 4B87A 3AFMA 2XNJA 3OQIA 1I7LA 3VGJA 4EHFA 2KTQA 3HXLA 4KI7A 5I6DA 4KWIA 1RYHA 3H0RB 3EXG1 3K6KA 5AVUA 4PG6A 2QUHA 5JTIA 2NYUA 4RLFA 4CBVA 3ABZA 4LI0A 4ALLA 1URJA 1RNLA 3DMGA 3T9BA 4C0WA 3TLGA 4II2A 4OQPA 1ZSNA 4MQBA 1RQ7A 3QWIA 4V0KA 1OWLA 3SX0A 1BD3A 2FW1A 2FSHA 3Q9NA 5D01A 2YNMD 4UZSA 4ZD6A 3QPAA 2Q5CA 1Q5PA 2O57A 1YRBA 3G0OA 4O63O 3WGKA 5EE0A 2I8LA 2C95A 1DQPA 1KTVA 4M9QA 5C32A 4CIBA 2W8KA 2R8HA 3AUFA 4C30A 4BB0A 1UDXA 1OC2A 1N2CA 3QE2A 4QTXA 1YOBA 4XX1A 2IHUA 1ZD8A 2Y6UA 5ALNA 1SBQA 2SICE 4JDUA 3V8MA 1RMQA 4AJKA 4CM1A 1C2YA 1E2FA 1PG0A 4V0QA 4QOJA 3RYHB 1KDHA 3H2JA 4S35A 1UJMA 3UUGA 4CPDA 1NIPA 1LKYA 3VO8A 4LV6A 4RCYA 4V0ME 3KSUA 4L57A 2GSWA 8ICFA 1SV4A 3L6BA 4Z1OA 2FH5B 1XKXA 4TUYF 2DF4B 2QPOA 2AU0A 2WC1A 2WV7A 3EUAA 3BB3A 1O6ZA 3FRJA 2EQBA 4FLFA 4Q7LA 2VPIA 3QZ8A 1JQBA 2B4KA 4XH9B 5CVUA 2R7LA 1LB1B 3HFJA 4ZHQA 2UUAB 3TCXB 1DXYA 1KEUA 5HEKA 3L40A 4BHTA 3SVTA 3ADKA 2DR0A 1P1RA 3E3AA 5BSFA 3FTNA 1HUZA 1DJLA 1PSDA 9ICVA 2WIFA 4KO4S 1WS6A 2F3PA 3AMVA 1DGQA 8ICWA 3N9IA 3D7KA 5GONF 5DWDA 1P45A 1Y89A 5HF6A 5C4GB 2PANA 1J1UA 5LZ9A 4K7JA 1M6VA 4RFLA 4O4JB 1AMOA 4C4YA 1TZCA 4JX9A 4EJ2A 4B83A 4LE1A 1NV8A 3AF1A 3KTAB 1H1LB 3D4IA 3LW8A 1Z0JA 3PSIA 4DQSA 2ZSIA 4PFSA 4QPZA 4X7BA 1CYDA 1G7SA 1NIJA 1CF9A 2QRLA 3VVCA 1GGNA 4D9EA 3DJYA 3GLUA 8ICOA 5B5EU 1E4VA 1ICIA 2X6QA 3A9WA 4DDHA 1K1QA 4LVSA 2O7SA 5FOXA 2FOLA 3L92A 1E4EB 2OHOA 1OYWA 2W8ZA 3ENVA 4WK0B 5TQJA 1HK7A 3VGPA 1IRXA 1EEXB 1JYFA 2NSHA 3MUNA 4CIDA 5JYDA 1I13A 2JFBA 5A2QA 5HP4A 2LUOA 1V8DA 1I6MA 2X5NA 4IIJA 4F7DA 1NC1A 2O6HA 5GIOE 1XRMA 2XOKD 2FN7A 3NDJA 4RMHA 4B0OA 1G2PA 4QICA 1LWOA 4I9HA 1E2KA 2DTEA 3N7RC 2FPWA 2VO1A 3IMCA 1MT3A 5IKMA 4LF6B 2D4AA 4ND8B 3OM8A 3W5UA 4FIDA 5LQCA 5EJ5A 1ISPA 2WQZA 3RFTA 4BNDA 1VRWA 1XKTA 2R5WA 3GJ0A 4PYOA 3DZGA 4J0GA 2CD7A 4BEBA 2BQUA 1ESMA 1M83A 1PQUA 1N6NA 1UK7A 4LISA 2HHLA 2PSSA 4K9QA 2WR8A 3EOZA 2DPXA 5EYPA 3DW1X 3RAGA 4UKDA 1DK2A 9ICRA 3OWHA 3GLSA 1FL9A 4KDRA 3V7YA 5LIPA 3U26A 2BEUB 1I01A 2YWEA 1U9LA 1RXCA 3QHQA 4RMGA 5A5DA 5L1JA 1WP4A 1XZQA 1YCDA 4TZ0A 4A03A 1Q7EA 1WZNA 4FHFA 1QH0A 3CBGA 3D81A 3PW2A 4RKRA 1SL2A 2AJ8A 2ZROA 1IBMB 4KE7A 1SKWA 2FY8A 4KYTA 4Q6BA 1J8YF 5IJWA 3H8JA 1DL5A 1N7HA 4YFVA 2Y4NA 2CT8A 2SKEA 1ZH6A 2RB4A 3GRAA 5GJCA 2D8AA 1IYZA 1GQRA 3LK9A 1PJ8A 3E2IA 4U7WA 3W5HA 2WV9A 4TMWA 4ZOBA 5EN4A 5DI9A 2IV7A 5EKDA 2QUAA 2FTKE 4OJOA 3RH6A 2JHGA 3BGDA 3DKIA 4J9MA 5HIAA 5ITWA 3R8FA 3PXCX 4B3XA 4C6SA 2NO0A 2ABWA 2HU2A 3GEHA 4MIEA 3C6XA 4O4LF 3U7QA 3GH3A 4RJTA 3Q3VA 5MFZA 2WE7A 3NM6B 1N32B 4I29A 1UJCA 3DDCA 4KPUA 1KZHA 4LK3A 2JA2A 3ZDRA 4RKFA 4JVNA 2AXPA 2QLBA 3BSWA 4QQFA 1KGSA 1P80A 1WPXA 4M55A 5HZGA 2G1PA 1N2JA 3DTTA 1ZONA 4CEIB 3HL0A 3PNOA 4L4RA 4GXTA 4J1SA 3PR5B 4P83A 5E7JA 4LOIA 1T5IA 2ZXUA 1JFVA 2Q0HA 2RHBA 1U0OC 1J0AA 4FHEA 1L3IA 5DN6A 1YI8A 4DPKA 4I4CA 4ZIRA 2RGRA 1MX9A 1KKLA 4M1KA 3VPGA 1FLVA 3HY4A 4A6XA 1AGXA 2ADFA 3MEQA 4YAWA 4X85A 1OI7A 5JD5A 2YTZA 3RYTC 3G6XA 3I2KA 4FDVA 4KIGA 4Q8FA 2NZ8A 1FFCA 5A1TA 1EWKA 3A9RA 3NOXA 2HBMA 1R0BA 1Z0FA 3CLRD 3TAQA 4HQFA 4EUEA 4EUSA 1X1BA 1GV0A 1GITA 4D5GA 3HKBB 4OHBA 3KV3O 5CG1A 2DEUA 3C45A 4O1HA 3IDFA 4TS4A 3E05A 3QELA 5BVGA 2I29A 5LQDA 1KO1A 4E0BA 5IT0A 3E8MA 2Y71A 2VRCD 1LKYB 1ZQHA 1LQ2A 1E7WA 2AC4A 2XEXA 3GVIA 4PTZA 4PVDA 1BU8A 1ULAA 2EDCA 3HJAA 3NCTA 4HXFB 1HA3A 2HIGA 1OV6A 2ZRQA 3EH2A 2P7IA 3MYRA 4YCCA 2HJRA 3GP8A 3FTFA 1MZPA 1OH6A 4FS1A 1L7BA 4BV2A 1K9SA 2AFHB 3WNCA 2CF5A 1VG9B 2FJUA 2IELA 2JS7A 3ABQB 4QVKA 4E6EA 5EERA 1TKDA 3MWKA 2RDMA 3M6FA 5D1NA 4Z8XA 2ZJ4A 1A9TA 3AWIA 2CK3D 1CYEA 4E46A 1L0BA 4L6AA 4R05A 1MEOA 4IM7A 2R6FA 2XJ4A 4KKVA 4LCJA 4JI2B 3WU2U 1T0IA 3EFOA 1C3OB 1AKMA 1HG1A 5JATA 1OA0A 2NYAA 1M66A 5EWMA 2OQIA 4I2CA 4YAJA 1N0IA 4H77A 4PYNA 1AZLA 2JI9A 1U5AA 3HZOA 1MB0A 3ISJA 4ZO9A 2GVDC 1OX5A 1KPHA 3R0QA 2GYUA 2JVIA 4NQRA 3U56A 1PX2A 2R1VB 3E4CA 3L0SA 3SJCA 4ZDIA 2CEAA 2Q8PA 5DBBA 3KYJB 3TMKA 2XCLA 2NZUG 5AW0A 4RBNA 3HSSA 3SQNA 5JPDA 1XNRB 3V1LA 1S2DA 3KVOA 3NHUA 5FEUA 1E9CA 1B2LA 1QNFA 3I2HA 1QU3A 4OH1A 1Z3EB 4NOJA 3RYIB 3K9QO 1JLKA 3HZHA 3I92A 4IDQA 4I6EA 4M1WA 3PEVA 4N4AA 1EZZA 3O8OB 5FTJA 2HHUA 3Q2KA 3ZWNA 1UBGA 4MUAA 2ZRLA 1F6BA 3FZNA 3EY9A 1UBHS 3MWDA 4RF2A 3LQ2A 4R8RA 5FTNA 1ZQIA 1J2UA 2G67A 2FMUA 1PE0A 4HDQB 4DRXA 3RC9A 3KR9A 4R81A 5KQLA 1OKKD 3ADCA 3BGWA 4DJ5X 1V3VA 1GLGA 2CBXA 2VDWB 5ESDA 2C78A 3WOHA 5DOVA 2P9CA 2PZLA 4PL2A 1QYRA 2RBKA 2WSSA 3HI6A 1QIJA 3IS3A 4P7BA 1XB2A 2CXOA 2Q0QA 2RJNA 4Y1FA 3RHTA 4B9LA 4CV2A 1NM5C 4RPHA 2OCGA 4MGYR 2C3OA 2RLTA 3QEKA 4OXYA 2XIJA 5CP2A 2HN9A 4W5WA 1G9XA 4BFVA 3WSTA 4DA7A 5TIIA 1OR8A 3OPXA 4YR2A 3ZNNA 5DDYA 1YRLA 5HCNA 3DBHB 3KZXA 3MC1A 1GT91 1O54A 2JRCA 2QTBA 1H2FA 3DE0X 3AU6A 3RRJA 3AN1A 1GY8A 1LJLA 4HQRA 4KGXA 4UHBA 1Y42X 2OGTA 4OGFA 4FE4A 3GJ5A 5G0VA 4RCVA 1RM6C 3SY8A 3DTVA 4DV3B 2BFBA 1DOQA 3LYLA 1RYRA 2IS2A 5H02A 2H3EA 5LUBA 4YONB 4OI4A 5KG7A 2QU7A 3G88A 2ZJAA 4Q4CA 2LKYA 1Y6RA 5FBKA 1PFYA 4H0CA 4KFCA 4IUYA 1B6SA 3BVPA 3A4NA 4MMYB 2YINC 1IG3A 2B35A 2DHRA 3FJ1A 1WWVA 4YX9A 3OZFA 2HDOA 4FGWA 3CR3C 4UARA 1UFRA 3CMMA 3P52A 2QVLA 3VNSA 4GP6A 1U8AA 4CN8A 3EXFB 4ZCSA 3KLMX 1E7MA 3GUZA 3CNNA 2G04A 3ZWVA 1IONA 3R1IA 3KKPA 3DT6A 5BVGB 5C51B 2HVIA 3INGA 2FWJA 3OC6A 1R0LA 4KN9S 3PD7A 3TDMA 1W0KD 5DM70 3LVVA 3GRYA 5DM1A 3F90A 2A9QA 3BREA 3M4ZA 621PA 1MD9A 4Y6RA 3NVZA 3CVXA 4HDSB 3UQ0A 1KVTA 3UAYA 4YAUA 4U6PA 3NEAA 1ZJ4A 3CYMA 1F2DA 4OGGA 2RAUA 5HJ7A 2FLKA 1IXYA 2DB3A 2VAPA 1IL0A 2OWOA 3Q8RB 3NWJA 3RJJA 5BNZA 3SVZA 4GEKA 4YRZA 2WF5A 1USGA 4P3NA 1XRQA 5DLYA 2OHVA 3D3WB 2KJQA 4GFDA 2GOYA 2ZXIA 1B0UA 4O4LA 3ZYZA 4O3FA 4ZALA 4B75A 4ELTA 3IHQB 4DBLC 4AO7A 1UT5A 3R7WB 5IZ4A 2Z04A 4XIJA 5LQKA 1VHLA 2AEJA 2Z3ZA 5EUMA 3C48A 5IC5A 2OECA 5C1DA 1U1DA 1R8JA 3RTEA 4HZUA 3LE8A 1HFJA 1JZSA 1OLXA 4QU0A 4CE6A 4FTWA 3MYYA 3Q72A 4M9RA 1E0JA 1KK0A 4TV9F 1V5IA 2NTNA 4DLXA 2ZAGA 3IMKA 1XXHA 1C9NA 3AEUB 4O4HB 1FDVA 4JJ6A 1PK9A 1TNDA 1XELA 2X0JA 3FPEA 4P3PA 1WUDA 2XY6A 3GO4A 2RHMA 3IUQA 4JGBA 4KKXB 5H3CA 2H2GA 3PFKA 3IMGA 4N0DA 3ZJ5A 1BPDA 2ECOA 2F3SA 2UV8A 4U7GA 5CH3A 1QS0B 2NSLA 4FWTA 4TMVA 1J07A 1PU2A 2HK7A 4XYLA 5EJAA 3KNZA 2QTFA 3UXNA 4GT1A 4AECA 5A06A 1O8BA 1UOEA 3U0BA 2BSQA 4OK6A 1JDZA 3FCAA 1GILA 3WK5A 1OWNA 3OZTA 3BQ1A 1Z4NA 1JDPA 1TJ4A 3O8CA 3KJXA 5MGNA 5AJVB 5L51A 3UQ2A 2UXDB 3O8DA 4GVLA 4TV8A 1YU6A 4AWXA 3O9VA 5B53A 4C76A 2PSDA 4EY3A 2OUKA 3DTYA 3JQFA 3WLJA 2F77X 3EE6A 2XW6A 1HM5A 3T4EA 1L4FA 1Z26A 2I2WA 3O1IC 1Q44A 2JLUA 1YZGA 3CKKA 2OFFA 4A8JB 4Q1AA 1ST2A 2X14A 1CIVA 3QVTA 1J09A 1E6EA 1GL6A 3SR4A 4B3DA 1RWNA 1QM5A 3V42A 5IZCC 3WKDA 1WBJB 3F5AA 4ME6A 5J2FA 1ZYQA 4MO2A 2ZT8A 3DWFA 5TARA 2ISPA 5JAMA 3VC3A 3FOFC 2WT8A 3UN1A 5C3UA 1PF7E 5JNWA 4EAAA 5K0BA 3VO1A 4HNAB 4CKYA 4HLUC 1GPKA 3KJHA 5FQNA 2EZTA 4LWQA 5BQ3A 5FOUA 2I4NA 2GN0A 3QIVA 4JLOA 2G7MC 5JS7A 5DIZA 5AM2A 3TI0A 1G19A 1P0CA 1SCQA 2L2QA 3PWZA 2IDMA 4LY9A 4ZKEA 5TEVA 3ET4A 2P67A 3B89A 3VKWA 1HR0B 3IQXA 2OZPA 4OHZA 5CDYA 2GPBA 5CM9C 1I14A 4Q3EA 3ZNPA 4U2KA 1NATA 5AT1A 1EFDN 2CV1A 1H1TA 3BJMA 3BT7A 3NXKA 3GA0A 3IOCA 4HZIA 1ISSA 4Y7DA 1IU9A 3F8WA 5SYNA 5HYVA 5T3UA 4O4IA 1BC5A 3BS4A 4IX9A 1XEWY 1PEAA 4N03A 5ED0A 5I7HA 2OORA 3HCPA 4PS1A 5IH3A 1CY6A 5HUHA 3RNOA 1SOAA 1RQRA 2C5EA 2C98A 3DEJA 4HFMA 4J3NA 3FUVA 4P3YA 4YXJA 3FNFA 1AUOA 3G2IA 4CMAA 2DUMA 3OF2A 3ZDZB 1EKXA 4PSDA 1SG6A 5C53B 2ZITA 4WXYB 3QMPA 1XS9D 3AL0B 2CXTA 4KMOA 3BJIC 4QXRA 1NZDA 2K6GA 1TEXA 1Q0ZA 2VH1A 1ZH4A 4MVXA 4AY5A 5IHXA 1Z4PX 3OZIA 3PQDA 5CR0A 4KLNA 3QV2A 3R7WA 2NYVA 4WJZA 4MPJA 4AT1A 4O2RA 4XD7D 1AV6A 1S02A 5J5AA 3T95A 5AW6A 2PRYA 3FE2A 4K8RB 4QBGB 3JWPA 1I4WA 1R7RA 2CHUA 1DEKA 4GAEA 1KYQA 4OU5A 4AS3A 4CNQA 3F46A 5HMLA 3C6MA 4KQWA 2P6NA 4LSWA 4WOPA 5F1OA 1ULTA 4RXMA 4G1EB 1PJ3A 4NS4A 2CLLB 2GJSA 4MFFA 5SV2A 1AKUA 2FPLA 3AP2A 4M1YA 2ICAA 3IURA 4HDSA 2J45A 3WLAA 2QMHA 3AI1A 3FMVA 5IEBA 5BSKA 3AETB 1IHXA 2ADMA 4XGRA 2CE2X 4K6KA 4R9UC 2H18A 3OJFA 3OESA 4LWOA 2IXEA 2WI8A 5DK6A 3RIYA 1JT2A 3RTGA 5BNTA 2CXPA 2ZU0C 4KO3S 5AVOA 2IRWA 3RAJA 3RBZA 1JXAA 2RE8A 1NWCA 3N1UA 2H1HA 1BEEA 2CNWA 2O50A 1YFLA 1G3QA 1W9MA 1KI1A 1ORHA 4D3XA 1PNVA 2EQYA 3D3NA 2KBEA 1BEZA 2QR5A 3PJRA 2QD1A 4GOOD 4YRRA 3MBIA 2W93A 1R5JA 1KI7A 2I2BA 4W7HA 2FR8C 3BD9A 2GA8A 3LW7A 3ESYA 1HLDA 4U2CA 3E9NA 4A8JC 1E3DA 1WUIS 1ML4A 1O95A 4J0IA 3L8FA 2GN6A 4J4BA 1XZEA 4H6VA 2P9JA 1U0JA 1BCSB 3C6BA 4KK3A 2GPSA 2CXNA 3IALA 4JIMA 3DH0A 5DYGA 2JH3A 1Z7YA 2FFAA 1T9HA 2MU2A 2EKQA 4C7KA 1ENYA 1IWOA 1E8MA 4BJ1A 1KMMA 3H5NA 2WRZA 4D9NA 1ZGHA 1K86A 3RM3A 4E4YA 5I7AA 1QK3A 3PA8A 3GLHB 4HD8A 3K1TA 4U7JA 4BDSA 2WJJA 4JIGA 4UPEA 5L4LA 3O1LA 4ZQCB 3OICA 4DMMA 3Q2OA 4WPGA 3TW8A 3OOYA 4UHDA 4M0CA 4JT4A 4ZT6A 5IK2A 4AUKA 4GXRA 4RQUA 3IEIA 5HGJA 3AUUA 5GPBA 3D2AA 4CODB 1S01A 3M1AA 4IDPA 1JFLA 1BE1A 1QH9A 3KOYA 4UJ5A 3B5IA 4EWLA 5MN5A 3UMFA 4U0KA 2BLLA 3C14C 2KZZA 4EFMA 3PFFA 5FL3A 2H1RA 1HFKA 4FSHA 4OXXA 1Y81A 4RA6B 2YWBA 2AN9A 2Z58A 5ECDA 2IUUA 3HQ4O 4QJFB 1MSWD 1P2GA 3F74A 3NP9A 2IX9A 4FXOA 3PUHA 1UBKS 1MQ8B 3BYZA 4FJ0A 4DCOA 1AKYA 1FTSA 1E7SA 3H8MA 1JKFA 1X9GA 1J2TA 2CFRA 2EZ4A 3H0LB 3A1FA 3GUUA 3UCFA 4QQKA 2CLDX 2GLUA 2OCLA 3FBTA 4J90A 3MJFA 2YY5A 3RADC 1ZOLA 1RP1A 1QDEA 4L85A 2UVPB 1SHJA 4P4SA 1IJBA 4W1QA 1C1HA 4EUFA 1L7VC 4WBNA 3KVRA 1WY5A 3RR8A 2I5PO 3F4KA 3TLAA 3C1ZA 5LZ7A 2J4FA 1AS2A 4QO8A 4UZFA 3TOCA 1OKKA 4JXKA 3F3KA 5EYPB 1GD1O 3D4PA 3EXIA 4R2XA 2KSOA 1DRGA 1PSZA 5BO5A 1QAMA 3MJHA 2C3MA 2VK4A 3ZHTA 2XI9A 3PX6A 2HT6A 5AKLA 1E99A 2YMPA 1P6XA 1PJCA 2DM6A 3BMNA 3PQ6A 4EY6A 5IUJC 1N34B 1LBIA 2P4QA 3C8UA 4ND4A 1HLFA 3QVMA 4Z5XA 5CTJA 1CEYA 1LC0A 1TA9A 3G2MA 4Y2XA 4G84A 1Z29A 2FF7A 4JS0A 4URUR 1CUSA 3OLCX 3EXHB 1ZICA 1KQ3A 4L8FA 4Y2JA 3G7NA 3QKWA 4KO8A 2B0JA 3JD1A 4EVQA 4CLRA 1SUWA 4JL8A 2VP4A 1JE1A 1U48A 3H87A 1N6KA 4ZU1X 4BMCA 5HUQA 2QW1A 3ESDA 4M60A 3CN7A 2GFHA 4JOBA 2F1IA 1JL3A 3CM0A 4G1VA 2FETA 4O0LA 4PPYA 1EX6A 4LC0A 4B84A 1O8CA 3EAQA 5L3SB 3PHHA 1ZC4A 1MX3A 2XCUA 4D97A 1MFZA 1EFCA 3OWOA 4DSLA 4RJLA 2J87A 4HAXA 4HJRA 4BX0A 3VSAA 3PEWA 1A1SA 4Z2AA 4FYIA 1EM6A 3LTNC 3OQ6A 4UW9A 3WL6A 4RJIA 2HBRA 4R31A 4CWAA 2HWUA 1R5NA 3EDMA 1U0NA 4N8SA 2LBOA 2IZ5A 4J2OA 4JL5A 4NCXA 4Q3BA 3EARA 2FFBA 3SK0A 5BY2A 4ZVQA 3Q5EA 3IXMA 4ZZIA 1ZYUA 3AU9A 4GI1A 3R0VA 4RUAA 1VDZA 2WUWE 4EFLA 2WHPA 3Q8KA 4ZU3A 4AYWA 4C0AC 5KFWA 3OLZA 5LA6B 4QZDA 3AOEC 3AR5A 2ZXHA 2PRSA 4DR2B 3LWBA 1CRWG 2HADA 1GU1A 3U40A 5KT2A 2IZ1A 2GN1A 1MJGM 2W4MA 3CF4A 4XLTA 4MR9A 4DIOA 2AS0A 2NXEA 2KE5A 1Y33E 1KH3A 4MS4A 4UQLA 5DHFA 1HJPA 3U4MA 3RBXA 1I3MA 3P4YA 5ARBA 2E1RA 5L8VA 4AIRA 1OYVA 5KB3A 2FNAA 1SVNA 2BCSA 3CB2A 3WLKX 1RHMA 4IFTA 4V02A 2F76X 2F8LA 4M83A 3EPGA 1UMCB 1N63A 1ZD9A 3I1IA 3OU6A 3H4BA 4OPMA 4EG4A 5I3CA 4QGFA 2X0DA 3HRHA 1Z9BA 1Z38A 2CFOA 3HPQA 4F85A 3DL0A 3WBFA 1IY9A 1PJSA 1T1IA 2UYGA 2E37A 2ZIFA 3AEKB 4NBVA 3TPFA 4EG0A 2O1WA 2OCYC 3THSA 1MVOA 3PB3A 3IHWA 4XIGS 1EUCB 9ICXA 3EPIA 1POXA 2GKSA 2W4QA 2V6JA 2FX5A 3G5MA 3LQ4A 3IR5A 1QGOA 3LDHA 7ICQA 8ICVA 1NF8A 3C5EA 3KK0A 3NIWA 2PX0A 3Q8XB 3NTUA 3WYAA 2ZM5A 1N8NA 3LF2A 5AM5A 4D74A 1ND6A 3AU8A 4BRWA 3ZWOA 2JIMA 1F3OA 1SXIA 5H3HA 1VE1A 2OY0A 1WM1A 1LDEA 2JIOA 1YH3A 1NV9A 3H2HA 1WW8A 4HLQB 4IOKA 5CNKA 4WCDA 3VR4H 4ZK2A 5AVZA 4QWEA 1Y3HA 4I2EA 1KMIY 1KOJA 1RJEA 2D1QA 2PMDA 2Q2QA 2X0KA 4IIEA 1D8TA 1UFOA 1W76A 2EGUA 3ZZNA 2ZPUA 3OEEA 3IKTA 2O0KA 2XRFA 4PGHA 4EYEA 3HZRA 1WY7A 5IVPA 5JANA 3HJFA 1CZNA 2V59A 1S0UA 4OI0A 1K4YA 3EN0A 3O0FA 3PNQA 1R0ZA 1Z45A 2QDXA 4NLNA 3SG0A 3T0GA 2ZJOA 1A5TA 2O06A 3AERB 4X9XA 4A6PA 3V46A 3KV1A 2C7OA 3AJRA 4GQBA 2QMOA 5F23A 5LYJA 1GG5A 1QRTA 3EH1A 5CDTA 2OUIA 2JGKA 5F3XB 3NMUF 3Q7TA 3LPNA 3C2QA 2B8WA 2W2MA 4C9BA 3N2KA 1C9MA 3W2GA 2AFIA 2YCBA 3WB2A 2BPFA 4OUDB 2EKLA 3MRXA 2V0GA 3GEGA 4BMOB 1UA1A 2BY4A 1N3BA 3KD2A 1OAKA 3Q85A 2J5QA 3IUMA 2BUAA 3OX3A 2W54A 5JJIA 5F9NA 5CLJA 2LI6A 1PNOA 3JARB 3DR3A 5CLHA 3I1JA 1EVKA 1WCWA 2MA1A 1N5XA 1U0TA 4E5SA 1YMVA 1HKHA 2PI4A 1EDBA 1VHWA 1Z2OX 2CC2A 2FQXA 1C3OA 1UAGA 3JRNA 2D1TA 1E60A 4DWOA 3F73A 1JSCA 3F0TA 4RM2A 3TPZA 1VIVA 3C7AA 1Z00B 3NFYA 1E6UA 2JJQA 4W5HA 3WGQA 1IV8A 4AUEA 4MHOA 4QJBA 4BZZA 1KGDA 4X5OA 2ASDA 1L5VA 3Q3CA 1U2QA 2R5FA 2XOKA 1CR6A 2C07A 3BCSA 3KS9A 3R6DA 4JITA 4LY3A 1KC1A 3VO2A 4DS5A 1JMYA 4ZOLB 3W2IA 5KTOA 3VU0A 2X8JB 2BR0A 4I0WB 4ECZA 3M6KA 3RU2A 1E4EA 5JCJA 4JSYA 2WHYA 5EHXA 5K0EA 1VIYA 5BMVB 1XTPA 3M9OB 1E9SA 3UHFA 3TSYA 5AJZA 4Z4FA 5FPPA 3HYSA 4IEFB 3NEJA 1U6JA 3QU7A 5AVTA 1DQRA 1J0XO 1F38A 2PQ0A 3NOQA 4O1IA 3IG8A 3ZCUA 2FW9A 3EIQA 1HEIA 5U4XA 3VR4D 3KB1A 3KBOA 2QAGC 3TOZA 5DNCA 1C30A 4YR0A 4KVFA 4N3CA 1PK3A 1M2KA 1CR0A 8ICIA 1V43A 1ZM3A 2PWBA 2ZETA 3LC7O 2QMZA 3N70A 4G9GA 2IPLA 1Q7BA 4Q01A 2XCTB 4UAZA 1T1JA 1KZGB 3MPOA 2CK3A 4QNNA 4UOQA 1L3CA 3ED5A 1H2WA 3U80A 3ANNA 5IDVA 1GEEA 3D2QA 3NDBB 4DMUB 2OD2A 1NKEA 2WFLA 3OE5A 5SZIA 2ORVA 4F71A 1W2HA 2DERA 2HI0A 1W96A 2AMLA 4L27A 1JLSA 2IY8A 3BMCA 2I4LA 1HURA 2M9NA 4D6PA 2HYIC 3V4FA 2BR5A 1KYXA 4IYJA 4IVNA 1SGGA 4DCCA 4B9TA 4RVDA 1U3CA 2XUPA 3JYPA 5I7FA 5CMLA 1YR6A 1DIRA 4I50A 2HVHA 4HLUA 4AKSA 2NQ8A 3AR8A 3BH0A 1ZDMA 4H3SA 4PNPA 2CCGA 1EX7A 1W36C 3C5HA 3SZUA 4Q9DA 1ZMRA 2R25B 1MLDA 1N9ZA 1JTEA 7ICSA 3N0XA 4BZPA 1NYTA 2C82A 2DSNA 4FC6A 4LXYA 4UD2A 3QX8A 3UK2A 3AHIA 2JI4A 5EWFA 4RQ6A 4QNLA 1CUHA 2VDNB 3P32A 4HPJB 3PUVA 2C2OA 4MI3A 3WHIA 5FDFA 3OE7A 4Z4EA 3T7IA 5KFRA 2PKXA 4BFXA 3OJUA 2XCQA 4OSEA 2E89A 2QPAA 2TMDA 2G36A 1IVNA 1O94C 3A10A 3SHFA 4PAQA 1IPHA 5E1OA 4KN4A 2QM0A 3R40A 5ISMA 4BFSA 1UHUA 3EIFA 1X38A 3KC2A 3ESQA 4DFMA 1SXJC 2ZYGA 3AJ9A 3QPCA 3C3XA 2XV1A 4WEQA 4WX2B 5EIOA 3KU1A 5DE3A 3BFVA 3ZHCA 2Z8YA 5DB6A 3L6CA 4YAIA 2CLMB 1OI2A 1J2NA 1YVUA 5KYTA 3DPIA 2B6HA 3K9CA 1FFYA 3HP1A 3RRNA 4CU2A 7ICIA 3V1YA 3QX9A 3M6ZA 2GBIA 4PGFA 4BLOA 2VAMA 3MMPA 3WMXA 1BS9A 1DQNA 1G8MA 2QSYA 2EW8A 3QLEA 3PJEA 5JSZB 2CNWD 1Z73A 3FZEA 1NYLA 2NWQA 5CX1B 1S0OA 4BX9C 2R6HA 4NG4A 2WKSA 4ZXFA 4FJ2A 3HCFA 1F0YA 1WBBA 3TI9A 2A7XA 6NULA 4K6MA 2MUTA 1RXVA 5HJEA 4R84A 5IKEA 2PUEA 2D8CA 2AOUA 2GJ4A 3A6FA 4R71A 5HR5A 1NNLA 2JBAA 1WMDA 3GIKA 1W6UA 2PVSA 1NBWB 2ZUTA 3BMQA 5IFLA 3VSDA 1TMOA 4KFSA 5AXAA 1LVGA 3MWGA 3P9KA 4DV4B 1WETA 4M2YA 1IXZA 2I54A 1V8BA 1IHPA 4I2JA 4W8HA 1XVAA 4ZARA 4S1NA 2OCEA 4PHEA 3A4VA 5FJIA 2DVMA 5BW6B 5LQSA 4YMTA 1E3WA 4RETA 4L8WB 5CXQA 2V6GA 3V7JA 1HE2A 2GEVA 4GKBA 4L7VA 5FWYA 1U2TA 2QHXA 3ANSA 4IJUA 4FDAA 2QG4A 4BNTA 4BX3A 1JG3A 3P9SA 3LUPA 1ORTA 2OOKA 3IKLA 4NU5A 5J29A 3MN1A 3CVVA 5H9VA 3OBIA 4ZDKA 5EWLB 1OXKB 2EOAA 3GJTA 4TLDA 5CDGA 4FFMA 1RYEA 3HC7A 1X7WA 3HDJA 3QVKA 5AXBA 3FJOA 1N0WA 3K5HA 4H6WA 2MINA 3ILHA 4L9RA 1WQ3A 4R5HA 5FB3A 4BGIA 3RAPR 4HSGA 3VR4A 4M0FA 4PXSA 3KPYA 1RVV1 4BN0A 4NATA 4Q4DA 5JNUA 3G59A 3NC1C 1KFJB 3QOYA 1D07A 1BE8A 5DB8A 1X9MA 3LYHA 2C8JA 5AJWA 5FUQA 1T4BA 5BWCA 1YTUA 4HAVA 4GFJA 2Z1MA 2CNDA 1TD9A 1YZ6A 2O5VA 1QPGA 2FOIA 2OGUA 4L07A 2DOKA 4OLHA 2IWHA 5L9AA 1IG0A 2XUDA 1UBEA 2AUTA 4WNAB 4DEVA 2H1IA 5GTHU 2OO5C 5CVEA 1NWHA 1Q20A 1AC5A 1INLA 4EL0A 1PD1A 5HK8A 2Q6KA 2V3VA 2X5XA 1ZCFA 3GROA 2OT3B 4BLPA 2YHBA 3WBBA 1Z6TA 2AG8A 2GKOA 2I4IA 2Q28A 5FTLA 1HTBA 3FTQA 1ADJA 2HA0A 5D5QA 2PK3A 1CZKA 4EATA 3OKCA 1ZQ9A 2BW0A 3JTMA 2ZUWA 4F11A 5K0JA 1U6KA 5BRAA 3QG5A 4HXYA 4HUQB 4LMPA 2BQ3A 3GAFA 5DV9A 2VQ3A 1RLJA 3LC1O 2VBGA 1VFNA 2AG6A 1REQB 1H0HA 2GN9A 3C28A 2OFOA 2VUSA 3TAUA 3VPXA 1NN1A 4AMVA 1QDLB 1QYDA 3ZCSA 2NO1A 2I6UA 5KVSA 2JG3A 1YKSA 2EFYA 1W85B 2E4VA 2QLJA 4KQIA 4ZYTA 2N1MA 1L4LA 1WRBA 1KKXA 1T7PA 4JNCA 1IEQA 4TURA 2P62A 2HMSA 4OM7A 4R4JA 4KLUA 4A9AA 4X54A 1KW4A 5AHOA 2WYVA 5BUZA 1GCUA 2A2ZA 2X4LA 3UGQA 2AGVA 3JQGA 3OJOA 3KQLA 4MS4B 4C8NA 5CJJA 1FTGA 5F2OA 1ZHOA 3KDPA 3HYLA 3M8SA 1SVIA 2IBSA 1I0IA 2XXAB 3EEBA 3NPAA 2DJIA 2ZSBA 3PXUA 2C61A 3ANXA 4PLTA 4RPXA 2A9RA 3JR3A 2R7MA 2PS3A 3NG1A 5FJJA 5SYAA 3KQUA 1ZOIA 4XRHA 3O9ZA 2QRMA 2OKCA 1CI4A 3L04A 4YALA 5F9HA 4RWEA 2V6BA 2FWMX 5CAEB 3I4LA 2VBCA 1GUFA 3KALA 5IH7A 4MMZB 1L5NA 1IUOA 1GZVA 9ICOA 1NK4A 1V1JA 3RRGA 1D8AA 1ZMTA 3ABIA 1E4OA 3BMOA 3B53X 1X8XA 3R5KA 3Q7QA 4FZ3A 4LQDA 4DUZB 1TMKA 2PMKA 3KAJA 1NVMB 1QLNA 1M6WA 1V5FA 3UHJA 2BC9A 1SXPA 3RKUA 3PHBE 1Z25A 3VO9A 1WMAA 2OXRA 3ROQA 4YMHA 2XTZA 4BATA 1YCHA 1NOKA 2P9FA 1FSPA 4RAOA 1NW4A 1Z33A 4WLNA 3GT7A 3RFCA 3L7YA 2WTFA 1F17A 1ZNZA 4JLUA 3IODA 3KWMA 3LBNA 2AXQA 1NG9A 2IS6A 2ZGVA 4XOUA 9ATCA 3TQ1A 2BDPA 3CRW1 5DM0A 2H6EA 1E89A 3L49A 2G9QA 5DGTA 221PA 4L4XA 1NXPA 5KNCD 5IP5A 1PV4A 4CMBA 1SAYA 4I8DA 2BGWA 1P8JA 4DJJA 2YJNA 1DGSA 3E22B 5PNTA 5KJ6A 4MEAA 4EMUA 5KAPA 4BB5A 3EF3A 2ISSD 5HTKA 3CVJA 3MT8A 1RRCA 1C1YA 5IXJA 1T6YA 3PNPA 2N1BA 3QYPA 2RHDA 1K8XB 4M0KA 1KEWA 1H38A 5IAEA 4LDNA 2JK0A 5CLGA 4OX9Y 1RW4A 1P8AA 1ENZA 2B30A 5TZVA 4Q43A 1E8NA 2XCPA 4C14A 4CCSA 1HKUA 3H5WA 4KOAA 1TK2A 4KDCA 4Y6QA 1Y4DE 3LKBA 1Z2CA 1WB9A 2PUFA 4MI6A 2JDIA 1ZUIA 2HUPA 4ND6A 3RODA 4E5YA 2EYUA 1DKQA 3UUEA 4DT1B 3U3DA 2OBBA 5FXMA 2VI5A 2VOEA 2X2FA 3PJFA 4REQA 521PA 1RYUA 4IDFA 3DW3X 4D6YA 3OE7D 4OO1J 4GYYA 1ZLXA 2BMVA 5D6NA 4UNRA 1LVHA 1FDIA 3G0GA 2IZ6A 2PL3A 4R0MA 4FZMA 1M2OA 3DE7X 3DUFA 4W9NA 3PX0A 3OT4A 3P0FA 3OTHA 2XH8A 1BHSA 5NULA 1OW5A 2YJ3A 1WNTA 5EVJA 5FHRA 2W03A 4YR9A 2W6QA 3JZMA 3GARA 1QZXA 1XP8A 5BWNA 3WIEA 2P1DA 4E5MA 1HF3A 4RVSA 2QT0A 5BOSA 1QIIA 5CB6A 2CDNA 2JGAA 3UA4A 5AW4A 4QM6A 4PG7A 3RRMA 4ZVNA 1OLSB 3QUCA 1T9AA 3EOBI 3N2IA 1JAIA 1M8FA 1NF2A 1EFPA 3JYHA 3E9CA 2FSGA 3BGVA 3H2IA 2IHKA 3KVYA 4LWZA 4BO5A 5LOVB 3JWEA 3A06A 1D9ZA 2OV6A 4I66A 4RGYA 4RQMA 2CKDA 2I80A 1JHUA 3F4BA 5KFDA 2IZZA 4OA5A 5T4FA 4TMXA 3ISVA 1XZNA 3TLZA 1ESNA 4MW6A 5HKBA 1VB3A 3V4VB 7ICLA 3G23A 2Q1YA 2HBQA 4ZVPA 1TM3E 4FS8A 3ADOA 4XXHA 3ZIDA 4EO7A 4QZCA 1X80A 4TSRA 3PHJA 1MJHA 1R8SA 4EY5A 1GSHA 2QRGA 4QD3A 3TE7A 4FNOA 3G6VA 3K0CA 1FBNA 1KF0A 2PT9A 1RE0A 3LY9A 2P27A 4PO3X 4R3NA 3LLSA 1MP0A 4UFPA 3FYTA 1M0TA 4GPD1 1DJOA 2ZULA 1QZZA 2PRJA 1Y6FA 1OBHA 1HG0A 4YBRA 1PFWA 2C5BA 4UBMA 4AJHA 1J23A 4B4KA 3PDIA 2RC5A 2WYWA 4KFTA 1JR3A 3KFLA 2IYPA 3GGJA 4Y0AA 2C9BA 3CO5A 4OP3A 1MJFA 5JCJD 1T43A 4Y18A 3PPIA 2GPNA 3EWNA 4FGLA 2POCA 3ECSA 3B1FA 3DZ8A 2V8BA 2I7CA 3L0YA 5HOQA 4HAUA 5FLKA 4K6GA 4IRKA 3QK7A 1SXJD 1GL9B 2GS9A 3Q7EA 2ODTX 3HACA 4Q9KA 3KVVA 4LXXA 1U80A 2VQEB 1KK1A 5KYYB 3CKYA 3HBNA 3O94A 3QQPA 1O96B 1FVOA 3PDJA 4C0LA 4DQ0A 1N60A 4MUYA 1EFAA 2ZZNA 3LPMA 2ZPAA 1JEAA 1R8QA 4Q03A 9ICFA 1E2QA 2CLIB 2R1TA 4QA9A 3UK0A 2G8LA 3L4PA 4C4OA 1Z7GA 4TMFA 2KN7A 5DEIA 1JV2B 5DCLA 1NUPA 3JAWA 3WLMA 3PIDA 3F78A 2PH1A 3HP4A 3NGLA 3OY7A 3F9RA 4YMUA 1U11A 4K87A 2BKXA 3DZBA 1QG6A 1NUHA 2II6A 4D2IA 2BFEA 1GUZA 3RYCA 4NP6A 2HV8A 1GZ3A 1IHUA 1TKAA 1Y7HA 4NU6A 4OK5A 4RPIA 1SXQA 2DXIA 3AV0B 5BOLA 2B8EA 3CZ4A 2BZ0A 3F6BX 3LPDA 2HMUA 3UUWA 2K4EA 3K8QA 9ICKA 5K7SA 2V5AA 2Q46A 2NTVA 1U9ZA 4MIKA 4MVJI 5LCXA 2WSBA 5T6MA 3SZMA 2QL5A 5BQXA 4N76A 1G21B 4J9VA 4MW0A 3T3EA 2DE0X 6ADHA 4G0UA 2DLCX 1E79D 4YS6A 2XY7A 5H8WA 4LCEA 5KYWB 1RMTA 3HL4A 4I27A 5DGXA 5KDLA 1D4ZA 2ANBA 3L8HA 5HG0A 1E59A 3WX0A 4ACOA 4H7HA 5EMHA 4YCBA 2ONCA 3INNA 1ESZA 1Y5MA 2PO7A 1PZXA 2ZTVA 4Z6FA 2PAAA 4YDHB 1UKVY 3DOOA 1OB5A 2J6TA 5F64A 1WPRA 3LCMA 5BOMA 3COZA 1P5FA 4JI6B 2J9GA 2O2HA 4KGDA 5C34B 4RPYA 4DXAA 4UBBA 2B2NA 1SBCA 1WVGA 3ELWA 1QMGA 2YV5A 4ZEXA 5KSWB 3NHLA 4DSIA 3R7SA 3U37A 1LX7A 5LSAA 3PHGA 3KB8A 4H1TA 1RXSA 4JXJA 3AQIA 5LBUA 3NHPA 1FP6A 2HJGA 2B37A 3R09A 2YH2A 3LX5A 3ZDFA 1NYQA 1YC5A 2EQ5A 1VLZA 5KTTA 4YEDA 1N6LA 3GLIB 4MGEA 3THOA 4ZI5A 2Q6IA 2VCYA 3ZY6A 1STOA 5J8YC 4FR0A 4FT2A 2QT1A 3AM4A 1BMFD 1CJUC 1NVVR 4P7GA 5B4VA 4RL4A 1KJWA 2GO7A 4BY9E 3P8ZA 3MHPA 2NUTB 1EGQA 1SO8A 1QGYA 1ZOPA 4D25A 2VHZA 4P86A 3IA2A 3PNLA 1JHXA 4JOCA 5JXHA 1LI4A 2BQRA 4LMRA 4RK4A 3B9BA 2VXOA 1XROA 2N0SA 4HB3A 5LVAA 1VI5A 3LGXA 4POOA 1Q0QA 5IUKC 1Q7GA 1QFYA 2GAIA 1PZNA 3QJYA 1WSWA 3PPYA 4EG7A 3PXEA 3U7IA 1DAGA 3ZXXA 2QQ0A 5JSQA 4MQ6A 4JASB 1D9DA 5DHUA 2YVKA 2MSKA 2ODAA 4OAPA 2ZIUB 4WE3A 4UB4A 3T41A 3HB5X 1K6IA 1ECCA 2XSZD 3AEQB 4IDEA 3WYCA 3FCXA 4O4HA 3ZEAA 1IK4A 3BORA 3H2SA 4DMRA 1JLHA 4HGNA 3AUJB 3JQ8B 4ZI2A 1KA9H 1ONNA 2HRBA 4XCXA 3SU8A 4M47A 1E1RD 3FTPA 1Q7CA 4BXOB 1I1HA 3L7KA 2NNWB 1IHYA 2YC2C 2FYTA 2ACVA 1Y4SA 3IOEA 2FEMA 1V35A 3LG2A 1N5JA 2LYAA 1WXEA 3I53A 4DQLA 2EJTA 2P66A 2VPWA 1EXWA 1VIDA 2RGNA 3ECCA 5CM2Z 1YF3A 1F48A 2CUZA 2EHDA 1PVVA 2RHHA 2V7WA 2XSZA 3MCVA 3GPBA 3SV4A 3RJGA 4FZJA 4IIVA 5HOEA 3WNDA 5L40A 3IAUA 1AURA 1EAYA 5D5HA 4YVZA 1W47A 1TE2A 3BRWD 4BQOA 3S99A 2QN6A 3GLHA 4BLVA 5T7BA 3S68A 3ER8A 3KVNA 1MHTA 4CQLB 1MJNA 1GXSB 2CY0A 3MJTA 4MVJD 2PKCA 5JO9A 1U0FA 2G63A 1DBQA 2GXSA 2HA5A 3LX8A 4UNSA 1SC4A 2VVTA 4EPXA 1BOOA 2H1FA 4ZQIA 3WLNA 3GFSA 1RI1A 3ZW8A 2RC6A 1K92A 2ID9A 3BMOB 4B31A 5ALVA 4FX5A 1M7BA 1NXQA 1Y4ZA 1XA3A 1IJKA 1FB5A 2VSOA 3CUSA 2Y93A 4KRGA 4PLYA 4WZBE 4TUYA 4E5UA 2PE5A 3E23A 3E7PA 3GX1A 3GCDA 4LKOA 3NQ41 1BMFA 4YCAA 3AESA 1YZFA 3F3YA 3IDAA 4YJ3F 1QK4A 4WASA 2G0AA 4JCOA 1N1EA 2YZMA 4LC1A 1GL7A 4BVHA 4ZHQF 1LRKA 5K6AA 1JIHA 4D0SA 2E18A 4CLRB 2KLBA 2MDTA 4UHFA 1NQUA 7GPBA 2WFAA 3EGWA 1U2PA 1NY6A 1FP1D 1D2NA 1OWOA 1Y1PA 4IL6U 1F8GA 1RIIA 1LW6E 2QRJA 5ECYA 3QJ5A 3GGCA 1CF4A 4G41A 3VR5H 2YZGA 1XHLA 2QQ5A 5AYVA 2C9CA 2OK8A 2V7QD 1QZTA 5HQTA 3TJRA 4J03A 5EWEA 5KT5A 1A4UA 3WYEA 4CM7A 2OAQ1 3UJBA 1W0CA 3GVPA 3R6TA 2F8SA 5IK2D 1W5AA 1WPGA 2K60A 4J9UE 4U6SA 1KAOA 1NQ5A 1RDFA 9ICAA 5JBQA 3FCSB 4WXPA 3NOVA 1MN8A 1N8SA 5TT0A 1T10A 1KJ8A 3TLEA 3PQ8A 3GFPA 3UPQA 3OIVA 1NY5A 1SCAA 2WNIA 5G3YA 9ABPA 4TL7A 1NQWA 1LX6A 3G5UA 4XQ0A 3L18A 1T3SA 2O6LA 4M0LA 2WMDA 3R0JA 5KX5A 4RNNA 2GK6A 3IJRA 5KFNA 3WL8A 2X0NA 2C04A 3AHGA 1QIMA 1QVVA 2VS1A 4B3SB 3PW7A 2ZRMA 4G3XA 4ZMRA 1R5BA 5L53A 1Z4IA 1E5LA 1CQZA 2RI1A 4I99A 5AVSA 4TYWA 2P91A 3ZJ4A 1W29A 1E2JA 4OJ5A 2BFWA 2CZGA 1TT7A 3IHKA 4IZHA 1YZVA 2GTPA 2HLPA 2KMDA 3D6MA 3FCEA 4HQOA 1MDBA 4IBOA 5FNVA 4M9SA 1YE8A 2C5HA 5LJIA 3B3QA 1QP7A 2G72A 1W48A 1X94A 4IHAA 4DS3A 4HGYA 2EFGA 2QTAA 3KFVA 3BERA 1ULZA 3MAGA 4JBIA 3UWPA 1JIIA 4HDNB 2XGJA 2R1VA 1V1RB 2DFNA 3BF8A 3GFKB 3EFEA 4KO2S 5DTQA 4ECYA 1DO2A 4I1YA 3VYVA 4YXWA 2IX3A 3QEOA 1EK1A 2HSDA 4RZIA 3U1TA 5FWYB 5JAUA 4LDPA 2XCAA 2XUQA 3TFOA 2ZWIA 3B7PA 5FCDA 3JCZA 4O2BF 4EJSA 4J4TA 2NPFA 2BV3A 1NQAO 3U39A 4J8PA 2Q29A 3CY6A 3DEHA 3EY4A 3HJRA 4IF4A 4PHGA 4IQWA 4RAQA 5CVDA 4ZC1A 3UIEA 2WB4A 3K1JA 3QTTA 1O6BA 1GPAA 4O4JF 2Q6VA 1RWQA 3BIFA 3KUDA 5CYFA 5KVVA 2JLWA 2E1PA 3IBYA 1TYBE 4NH4A 5DYYA 1IZ0A 3CRNA 3IVAA 5IZCA 3KKNA 3AEZA 2G8NA 4MX8A 2OYRA 4HDRA 1YQEA 2MT9A 3RUFA