4BXOB

Architecture and dna recognition elements of the fanconi anemia fancm- faap24 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
196
Chain Sequence
VHVPLGHIVANEKWRGSQLAEEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords FANCONI ANEMIA GROUP M PROTEIN
total genus 56
structure length 196
sequence length 203
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17949 PND FANCM pseudonuclease domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bxoB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bxoB01
1ZQQA 2PFNA 3RJFA 2UVWA 4I27A 5IIIA 2LYHA 5DBCA 4GXIA 3TANA 4DSJA 3V7LA 2KFZA 8ICCA 3TI0A 2FPLA 4I2EA 3QEAZ 4O0IA 4RPYA 5C5JA 1UA1A 4BWJA 5DB8A 3PX0A 4JK1A 4DQSA 1ZQOA 2HHTA 3SI8A 4KITB 5KT4A 4YMMA 3PW0A 3MFHA 2I1QA 4R8UB 3C2MA 3C5FA 1LV5A 4PHPA 4QZ8A 2BCUA 1TK5A 8ICQA 4KLDA 1Z00B 4KLSA 4Q8FA 3M8SA 4QZEA 4Q44A 1BPZA 2HHUA 8ICNA 1ZQJA 2ZIUB 1QSLA 4IRCA 2HHSA 7ICUA 4C8LA 3MGIA 4EBDA 1ZQPA 4XUSA 1S10A 4ECWA 4O5CA 2B21A 5KFGA 4E0DA 5J0WA 3RH6A 2BQ3A 1LB2B 2BCQA 2W8KA 4EYHB 4XQ8A 5KFYA 3Q8KA 1KRPA 4DO9A 8ICRA 3ZDCA 4EYIB 2JEJA 3T5LA 3PX4A 2NRXA 4I2BA 4DQIA 3MR3A 4F5PA 4RNNA 3RBDA 4QW8A 1ZYQA 2ZIVB 3HP6A 4Z6CA 3TAQA 5DBAA 4I2GA 4RPXA 2FLNA 4J9KA 2ASDA 1SKRA 4RT3A 4UAWA 3RB4A 5J2KA 4YFKA 5KTQA 3NGDA 4J9LA 4FS1A 5TZVA 1TKDA 2VA2A 4YD2A 3OHAA 7ICRA 1A76A 5KFRA 3HPOA 1SZPA 2JPDA 3KHLA 2ZIWB 3UXNA 5DG7A 1X9WA 4DSKA 9ICIA 3FDSA 4YG2A 1U4BA 1SL0A 5BPCA 2AGQA 1NKBA 1ZJNA 3EPIA 4UQGA 5DB6A 2W9BB 8ICUA 4J9PA 3TFRA 4J9RA 3RBEA 5KT3A 5CP2A 1ZQWA 1KSPA 4YD1A 3ZDBA 1D8LA 2NRWA 4BGDA 4F5RA 3V6JA 3RAXA 1NK9A 2XO7A 4EEYA 8ICYA 4QZ9A 4ZH4A 4YXMA 4FO6A 3PX6A 4M9HA 2AQ0A 4LZGA 1ZQGA 1QTMA 2MAXA 5IILA 3Q8RB 3TFSA 3QE9Y 5DQGA 3GIKA 2M9NA 4RUAA 3HT3A 3BQ1A 3V7JA 1HUZA 3MDAA 8ICXA 5J2AA 1ZQDA 2VA8A 1ZQYA 2ZUBA 5L9XA 4M9LA 4DL3A 2DFLA 4FS2A 2C2RA 4F5NA 3OGUA 1XSPA 3GDXA 9ICRA 4EBCA 7ICVA 2R8KA 4JWNA 4GC6A 2NRTA 4PGYA 3GIIA 1XU4A 4NLNA 3E2EA 3K4GA 3GIJA 4X5VA 1MC8A 2ZUCA 5KFQA 1NJWA 3HW8A 2IHMA 4GLXA 3MGHA 2FPKA 4O9MA 5IIOA 3AUOA 1NK4A 5KFFA 1KFDA 3EW9A 4IQVA 4QZIA 5HP4A 4Q8EA 3EWAA 4F92B 1V9PA 1EXNA 2ISPA 4KLTA 5BOMA 8ICIA 4R66A 3MFIA 2R8GA 5F9LA 1XO1A 3GV8B 3OSPA 4P0PB 3RJIA 2ZJAA 5D49A 9ICFA 4UBBA 3OSNA 1XSNA 5J0RA 4IQTA 4P4OA 1NOMA 3PW2A 4EBEA 1PZNA 3IHQB 1JMSA 4QWDA 5KFEA 3Q8SB 1NKCA 4DS5A 3PR5B 4ED6A 3OHBA 4ECSA 4KLLA 4Z6FA 1TFRA 3H8WA 2C2EA 2J6SA 9ICWA 2PFQA 1WCNA 7ICHA 5DKWA 2J6TA 4RQ7A 4KTQA 5JUMA 4I2HA 1U9LA 5KFXA 4BWMA 3RH4A 4MFFA 1U49A 8ICKA 4KLEA 4KLMA 4RNMA 5J2CA 2FMSA 4DL6A 4J9OA 2BCVA 5HHHA 2M9MA 4F4ZA 1SKSA 3ZDEA 1DGSA 5KFLA 2W9BA 3RJJA 4JV2A 1QLNA 3LDAA 8ICJA 4RQ0A 7ICFA 4M9GA 3Q8LA 2FMQA 1XS9D 5J0YA 2ZIXA 4YR3A 1L5UA 3AU2A 4P4PA 8ICMA 5KT7A 1ZQNA 2KZMA 4I2DA 5IINA 1TK8A 4BDPA 1MQ2A 4G3IA 9ICVA 4RPZA 5KFBA 3PMLA 1JN3A 2P66A 4KLQA 4DFKA 3RR8A 7ICSA 4RQ1A 4F2SA 7ICMA 1SL1A 1J24A 4UB4A 1ZQCA 2XC9A 4B9MA 3H4DA 4O5KA 5KFSA 1NK7A 4ED8A 3GILA 4DOCA 4TURA 1S0MA 1B43A 4F93B 2HHXA 4IRDA 4O3NA 4M6WA 3OJSA 4O3OA 2MUTB 1TV9A 2FLPA 4B9LA 3BQ2A 4F4XA 3PW4A 1L3VA 4ECQA 1COOA 4RNOA 2XCPA 1L3TA 2UVVA 5J0XA 1HUOA 1SKWA 2DPIA 3GFKB 3EPGA 4YQWA 2JEFA 2AQ4A 2UVRA 1B22A 5KFCA 3UQ0A 4MFCA 2UVUA 5CA7A 3ISBA 5J2DA 3GV5B 1S77D 1ZQIA 5J2JA 4TQSA 4KLHA 3PW7A 5J0PA 2I9GA 1RZTA 2ZTDA 9ICGA 4ED1A 4NM2A 4F50A 4J9SA 5KFIA 2JZBA 2XGQA 9ICTA 1NK6A 2ZTEA 4B9TA 4LZDA 5DQIA 3BQ0A 4NLGA 4JV0A 3EYZA 4TUQA 3LWLA 1HJPA 4PHAA 3C2LA 2R8IA 3UXPA 2V9WA 3UPQA 7ICEA 9ICNA 2JNWA 1ZQBA 4YVZA 4I2CA 8ICLA 1WCLA 4RZRA 5KG1A 3PR4A 4TUSA 3LWMA 5KT6A 4ECUA 3RRHA 5KG7A 2DPJA 7ICOA 9ICQA 5KFMA 1ZQAA 4O3SA 4FBTA 5L1LA 3RH5A 1X9SA 2JEGA 3AU6A 2HHWA 5DLFA 1X2IA 1TK0A 2KFNA 4IQWA 4ED7A 1N48A 1NKEA 2BPGA 4QZBA 4DL4A 9ICHA 4RQ2A 1BGXT 3M9OB 3GV7B 1JXEA 1S0OA 3KHGA 3PMNA 3MABA 4I2FA 3V6KA 3SZ2A 3Q8PB 1IXRA 1L3SA 7ICKA 5KFWA 5L1KA 4RT2A 3OJUA 2F1HA 4Z6DA 1Z3EB 2A1JA 2PI5A 2PFPA 4NXZA 4DQPA 3GIMA 3G6YA 1KEJA 5KFTA 1MQ3A 3TAPA 3ETLA 5DDMA 4M2YA 2W9CA 4K4IA 5DDYA 3PO5A 4QZCA 5KT2A 2AU0A 1TAUA 9ICXA 3JPOA 4M9NA 8ICGA 4UAYA 2MUTA 1NJYA 1RYRA 5J2FA 2BDPA 4M6WB 4I2IA 2P6UA 4YR0A 4KLUA 4DWIA 1K1SA 5KG5A 1ZQTA 2BPFA 5KFHA 4O5EA 2AJQA 3M9MB 1DOQA 1UA0A 4XA5A 1TAQA 4ELTA 3H4BA 5IIJA 4YCXA 2Y1JA 2P6RA 2KZZA 3G6VA 2A1JB 4ECXA 2A1IA 4PHEA 4F91B 4RQ5A 1T3NA 3C23A 1ZQEA 2R8HA 2JZBB 3HX0A 5EWGA 4B9VA 5DBBA 4R65A 3C1YA 1RXWA 1BPEA 4MF2A 5J0TA 8ICOA 1NK0A 1S0NA 5J29A 4K4GA 4PGXA 3Q8MA 4IQUA 4Z6EA 5KFUA 3JPTA 3PO4A 4ED0A 4R8UA 3MR2A 3V6HA 4EZ6A 4B9NA 2AGPA 4M04A 8ICVA 2ZTCA 4KLIA 2ZUDA 2HVIA 5KFDA 5KG4A 3ISCA 4DF4A 2HVHA 2ZJ8A 4QZFA 1ZQFA 1D9DA 3EZ5A 2F1JA 4UB1A 3RJKA 1J22A 2W9AA 4DSFA 8ICBA 1NK8A 9ICEA 2FPMA 1ZQSA 4QWBA 2IBKA 2HHQA 3NTUA 4O3PA 4C8KA 1UT8A 5J2BA 5J0QA 1T7PA 3QZ8A 4R63A 4NM1A 4JWMA 3ISDA 1UT5A 1A77A 7ICIA 2R8JA 4UB5A 2XY7A 3KTQA 1D8YA 1T4GA 3JPNA 4QZHA 1AROP 1RXVA 4PHDA 1XSLA 2VA3A 1X9MA 4YXJA 2PI4A 2V4QA 5DGAA 2OWOA 4RUCA 2XY6A 4EZ9A 1BPXA 1U45A 1XWLA 3H7IA 1KDHA 3TQ1A 5J2IA 3PV8A 4Q45A 1TVAA 4J9QA 2ALZA 5CB1A 8ICZA 1ZQLA 1ZQUA 4NY8A 3BQTA 9ICKA 5KG3A 3M8RA 4QZDA 2F1IA 3THVA 1NK5A 1ZQVA 1D9FA 5J2GA 5DLGA 2ASJA 4IRKA 4QW9A 4KLOA 4GC7A 7ICNA 3JPQA 2BQUA 4P0QB 4UB2A 2PXIA 2BCRA 3RJHA 4QZAA 2KTQA 1JXLA 1KTQA 9ICPA 4PPXA 4F5QA 5IIKA 4QWCA 3G6XA 4B9UA 4YMOA 3JPRA 3BJYA 5EOZA 4F2RA 3MR5A 1ZJMA 2JEIA 5HMLA 3RB3A 1ZQMA 4JV1A 9ICCA 3C2KA 3C1ZA 2RDJA 1H38A 4KN4A 4RQ4A 4ECVA 4DSIA 7ICJA 4ED2A 5CHGA 2BCSA 4DS4A 5BOLA 4M0AA 2KZ3A 4P2HA 5J2EA 3RJGA 1CEZA 7ICTA 3SV4A 8ICPA 4DSLA 4F4KA 3Q8QB 4DFMA 2PFOA 4F3OA 4RQ3A 2Q0ZX 3KHRA 5KG2A 5CWRA 3T5HA 3BDPA 2NRVA 5HHIA 2RDIA 3RRGA 5KFZA 5KG6A 4NLZA 3UXOA 2WTFA 3JPPA 1KLNA 2FLLA 4F8RA 4J9MA 5KG0A 1Y88A 1XC9A 4ECRA 2BGWA 3PW5A 1ZQRA 4FBUA 4QWEA 1ZQXA 4O3QA 2XGPA 3T5JA 1U48A 3N4MB 5J0SA 5DB7A 3C5GA 3RR7A 4MFAA 2BQRA 2W9MA 4YR2A 4IR9A 1J23A 3GQCA 4UBCA 2W8LA 5J2HA 7ICGA 4M47A 4GXJA 3TARA 3QZ7A 3V7KA 5CJ7A 3ZD8A 5L1IA 5CR0A 1KFSA 8ICEA 8ICFA 2IHNA 3H8SA 1SL2A 9ICBA 1RPLA 4IR1A 3ZD9A 2XY5A 4RQ6A 3LK9A 4DL7A 3RB6A 5DGBA 1JIHA 4UAZA 2AGOA 3SV3A 3SYZA 3C21A 9ICUA 5L1JA 3H8JA 5IIMA 4DL5A 2ASLA 3QEBZ 1NJXA 5DQHA 1S9FA 3PVXA 4YP3A 4DFJA 4MEXA 4KLFA 5J0OA 3PNCA 1BPBA 4DLGA 1ZETA 5DB9A 3RAQA 2C22A 4BXOA 5F9NA 5KFVA 2NRZA 4DF8A 7ICLA 3RJEA 4M9JA 2FMPA 4P4MA 2W9CB 2BHNA 3V72A 1NJZA 7ICPA 4QZGA 4NLKA 4ECYA 7ICQA 5EWEA 4F4YA 3T5KA 5DG9A 2HW3A 4C8NA 1BPDA 4TUPA 3H40A 4I29A 4KLGA 4F5OA 4MEYA 2GWSA 4XRHA 5KFNA 9ICSA 3ORYA 4DLEA 2Y1IA 1QSYA 3MBYA 4RQ8A 4O3RA 4F4WA 4YN4A 3ZDDA 4C8OA 4DL2A 4B9SA 4DSEA 2VANA 2HHVA 1KFTA 3MDCA 1QSSA 4K4HA 4HYKA 1CUKA 1BVSA 3JPSA 3MR6A 2J6UA 4DOAA 1S0VA 8ICAA 9ICOA 1BPYA 8ICSA 3B0YA 4KN7A 4PGQA 2H5XA 3RTVA 4DOBA 1L3UA 1MSWD 9ICMA 4C8MA 4ECTA 5D4BA 2BPCA 1N56A 3FYHA 4YMNA 2KN7A 2IMWP 4DEZA 5KFAA 3ZDAA 2C2DA 4I28A 1C7YA 4Q43A 1K1QA 4ELVA 3RB0A 2BKEA 4GXKA 4QWAA 1T8EA 4PH5A 4TQRA 2V4RA 4DQRA 2IA6A 4I2JA 5KFKA 4CCHA 3UQ2A 2C28A 1RYSA 3T3FA 4DFPA 4ELUA 4LVSA 9ICLA 4MF8A 3PY8A 5KFJA 4R64A 4KLJA 5KT5A 3HWTA 4DQQA 2ISOA 8ICHA 9ICJA 4KMUA 1Z00A 4ECZA 4RU9A 3M9NB 3N97B 2ZJ5A 1IM4A 2XCAA 3B0XA 1J25A 5J0UA 1ZQKA 2BR0A 8ICWA 4UB3A 2ATLA 1ZQZA 4JUZA 5HNKA 1JX4A 3IM1A 5KFOA 5EWFA 4ED3A 5HMMA 1ZQHA 4I2AA 5KFPA 3KHHA 4J9NA 8ICTA 3K75D 5DG8A 5D46A 1S97A 4BXOB 9ICAA 1S76D 1U47A
chains in the Genus database with same CATH superfamily
3GRFA 3RJFA 3MGCA 3HFGA 3JYLA 3KWLA 4GKBA 4HI0E 1XD2B 2BFNA 3MZ0A 4HWRA 2HL6A 3AYXB 4ENTA 2VTBA 1DKOA 3EXG1 3LE8A 2ONZA 5BQXA 2GN4A 2IDKA 2SICE 2VT7A 3DNFA 3H4TA 4H3SA 1G3RA 1ZOIA 1O95D 3DMYA 3ETNA 4G36A 2VIXA 1A1SA 4RABA 5JDCC 3ZXSA 1B15A 2IBTA 4GG1A 4ZJUA 1WF3A 5IX8A 2TSYB 3NP7A 1T9HA 1JQEA 3PGA1 2IRWA 5JR3A 3EBOA 4YAWA 2VAVA 5K4LA 2ZSDA 4IQ0A 2MHCA 3E35A 3HH8A 5T64A 3NIFB 3IQXA 4HGNA 3M5WA 1YASA 5DTRA 5G1OA 1BMTA 3PFGA 1E79D 4WZ6A 2H1WA 1NNSA 1HC7A 1XDWA 2YV1A 4JZYA 2FZLA 3UK0A 4CNBA 1LB2B 5DRTA 4IXDA 2F2AB 5AI6A 1KRPA 4QXRA 5J40A 3BS5B 3C3YA 2WG1A 4M9ZA 4BVFA 1URJA 3HFSA 4ZQBA 5JY6A 4PSKA 2A1AA 1KIMA 2JAXA 2NYUA 4B8ZA 3H2IA 3MAGA 5JXGA 1ZOLA 1XTBA 2NNLD 1UPTA 1I1NA 1G17A 1VSTA 3Q3JB 4MHTA 8LDHA 2CDNA 3HVIA 4UAUA 1FQKA 2XWBF 4C2UA 3NIDB 4F1KA 2BCEA 2A0KA 2GX6A 4WECA 1DJOA 1YQUA 3L1IA 2G7MC 3BFJA 4IJQA 4QDTA 1L7QA 2HRQA 4EI9A 3D4LA 4UNNA 1IH8A 1Z0IA 2WPDA 3S68A 3TR6A 2XGMA 1GCOA 2X58A 1XLTA 4XX1A 3GHYA 4XM0A 4WNYA 1FJ2A 1G41A 1N6LA 5LM3A 3AI2A 4HQ0A 3TEMA 1BVRA 2AG6A 2B5VA 2WFMA 4L5AA 5IJ0A 5JFGA 3NALA 2IU0A 3UWPA 2O1WA 4YMVA 1U98A 2QE7D 2DQ4A 3E5RA 5FWNA 4YXMA 5K0ZA 4Y3UA 1ZZEA 4Z0NA 4IM7A 3ASYA 4TVBA 4RFSB 3SSNA 3TTWA 1QHSA 1CR1A 1U2GA 4BAGA 1YR7A 2O14A 1VLLA 2VA8A 2NTEA 3MK31 2JAPA 5H7XA 1K88A 3UC9A 4B2PA 5HQ3B 1WMEA 5EUMA 2FR8C 1U2ZA 2I7XA 3QBTA 4AKIA 1O57A 1QUEA 3I6BA 1G1MA 1Z9BA 4L76A 2VQSA 4ND4A 1Z19A 4DC0A 2IV3A 3KYCB 3P2EA 1ZRMA 1UDRA 4CFYA 3ROGA 2FWIA 1BVYF 2ZW9A 1N2CA 4ZQHA 5B55A 4I4NA 1KI6A 2V3CC 4IQGA 3BQ7A 2IH4A 4PU0A 3VJKA 2AEFA 2PUDA 1I24A 1JAXA 1X87A 1UZAA 1CETA 2XDWA 3KYBA 3MWEA 4WOJA 2WF9A 3UGQA 1CDOA 4DA4A 2ZYDA 5HP4A 3L3FX 2NUTB 3EWAA 3QVXA 3MIIA 4F3NA 3DLPX 5JAOA 8ICIA 5C52B 4Y6LA 1ISIA 2R8GA 3LQ2A 3RTCA 2O6LA 4II2A 5IBRA 2ZJAA 3GDGA 4QUEA 4EI7A 5CD1A 1B93A 3D2QA 1YOVA 3BGSA 4U4AA 2D8CA 5JCPA 2JD0A 1L8XA 1TPYA 3HV2A 1P1KA 3GJZA 4BP8A 4OD0A 4DLSA 5AKGA 1NBME 3B8HA 4IDDA 4YBZA 5TPWA 4DXAA 4UW9A 1XEAA 1V97A 5F1YA 1TFRA 5WRFA 3SI7A 2RIRA 2J6SA 1BCRA 2VF8A 5AVZA 1VFPA 2HIAA 1Y7HA 3I2IA 4PLGA 1VIVA 4KQWA 3EQ6A 1S0UA 3M5PA 2O50A 3PIIA 4AO8A 4MFFA 4HH4A 4K7JA 4QG3A 4LF6B 4PBRA 1MC1A 2FFHA 3G8BA 2XYQA 1GL6A 3ROFA 1P73A 4EQ6A 3IVGA 3HRDD 2E49A 4K1XA 3MS2A 3O8QB 2H54A 1DGSA 1EZZA 4HSGA 3T5MA 3KHUA 3F71A 4QTTB 1FX0B 1ZGCA 2AZ4A 3OEHD 5CFNA 4MS4B 1QOZA 1E2EA 4B5LA 4R0MA 3AU2A 4HEQA 3ZEAA 5HW0A 4HX5A 5F2EA 3KQUA 3ADCA 1RYBA 1YJCA 3H86A 5DX0A 2HLNA 2QD2A 4OXNA 4AWXA 5LUAA 3SEFA 2BFAA 3PSTA 3E8SA 4L28A 2W11A 2OCPA 4ZEOA 3RREA 4CM1A 1F8YA 5JZSA 4M2LA 1CY7A 4HQFA 4HC4A 3EFBA 4QL3A 4AURA 2B4TO 3DBHB 3G5AA 4J6EA 1GU0A 4OO3A 3PNLA 2QVBA 5HJ2A 3SD7A 4E4TA 3GILA 2P2ZA 1BX0A 4H7DA 4QM7A 4IHQA 1NOIA 1VLZA 1M8KA 1SURA 1C1DB 1W2GA 2I67A 2Z95A 1T9CA 3O2SB 4NDZA 2O0LA 3C3XA 3SIXA 3I8OA 4BO6A 4F3RA 3TLEA 3GP3A 4RPJA 3H4IA 3JQAB 1G8HA 2PKYX 1BXRA 4Q9LA 2Z8ZA 2GTPA 1EB8A 1SCUA 3KFXA 4OQQA 2IXEA 3GNLA 1K97A 3GPIA 3PD1A 4G9BA 1ZJ6A 3BSYA 3I6ZA 3JRXA 4MH0R 1GG5A 4LDAA 4XQ0A 1JU3A 5AHWA 4HDAA 3FPEA 4RETA 4N6OA 4C5BA 3SGLA 4AJPA 4K9QA 5HRCA 2OWDA 3HCDA 2IPOA 3KVYA 4JLWA 4E2XA 3OCWA 1RJWA 4ED1A 3SQNA 1H4VB 4TYYA 1AKEA 3GPCA 1M8JA 2HHHB 3UANA 3LUHA 1C1XB 9ICTA 2VUSA 2MOKA 4QLOA 4F9EA 1H4QA 4LZDA 3WK8A 2OUKA 3L4JA 1SB8A 3L1HA 5D8DA 3IBFA 4O33A 4DQKA 4EFLA 1UKVY 4PHAA 3CF4G 3SSOA 1ICEA 4MR8A 1R3DA 1AKMA 1FW8A 4BP3A 4BBJA 3N2GA 4II3A 4BVJA 3NEPX 1RR6A 2BDTA 3NVWA 1TECE 2O2YA 5AVOA 4BB9A 4TUSA 1Z8DA 1GUZA 3QKTA 3NANA 9ICQA 3OKFA 5KYXB 2HSJA 2XWPA 3D54D 3PF8A 3ESRA 3AHHA 1N1DA 5G4LA 6AT1A 1I80A 1Q1BA 4QZBA 3BS4A 3IKJA 3TEFA 1T3LA 1V3UA 3K0AA 1L5GB 5AVVA 2FI1A 3MABA 2YZ7A 3OT1B 3PJDA 3QTLA 4FLMA 5C8DA 3PCRB 3TUZC 1Z74A 1YDGA 5HK9A 2C99A 1J8YF 3T5BA 3UMMA 3HBMA 5LLDA 2IZ7A 3JU3A 4R2XA 1UPXA 5BSUA 3RM3A 1P3JA 2X0IA 1JHRA 5CH3A 3GMSA 4TTTS 1VBNA 4KRYA 4QKQA 4QT4A 2DFDA 3HRIA 3CNHA 1FS6A 3X2FA 4D1YA 1H2XA 5IP5A 3P9KA 5ER6A 4TTSA 4JUAA 3WVNA 2O1XA 3L7YA 4YQZA 5A5FA 4RSGA 3LL7A 1KSFX 4EI8A 1FLVA 5AVWA 1M33A 3ZJVA 3K1ZA 1C9DB 2BFWA 5E3IA 3AU8A 4XUGB 2AOWA 3MQ2A 3NDJA 4PS0A 1S3SA 2C8VA 3R20A 3JAWB 4E1VA 1I7DA 2L19A 2GYWA 1Z1BA 3VKVA 1W5SA 2H2FA 3PEVA 3U7FB 4FGKA 1MORA 4ZCRA 5BW4A 2W6NA 3ZQKA 2OEPA 4CTKA 5FR1A 4EKGA 3WYAA 1UP6A 1Z83A 3LUAA 1KZYC 2QROA 4P38A 1TIPA 1ZYUA 5JAQA 1CUXA 1OXSC 1IQRA 4NH0A 2B1IA 3WNVA 2RSLA 2WG0A 2FMHA 3E23A 3FAZA 3D6JA 5G41A 3K0FB 1VIAA 3IVAA 3H5NA 4J0KA 4NU8X 4AM8A 4U7DA 4RVGA 3EIFA 2GEKA 2FQWA 3FPHA 3K9NA 3HP4A 4LQ4A 4UQLA 2O57A 2WYVA 1W5EA 5CCDA 1QHEA 5DLPA 1E32A 2OXEA 2Z43A 3BXXA 3PQ5A 4RMIA 3NC1C 3B82A 2WWRA 4G56A 5AO9A 6GPBA 4LJRA 2OAP1 3A10A 1R4MA 1KAOA 1L5MA 1MOZA 1XZCA 2HA0A 2OP0A 4QZFA 3PFIA 5EZ6B 1HEIA 1XJ0A 3DBOB 2YJNA 3S40A 3SLGA 1VL0A 1ZQSA 2VT3A 3ROTA 2ZROA 1YHYA 1GQFA 1D2CA 2ACVA 2W2KA 4MQEB 3D3NA 3LHKA 1JI3A 2H2AA 3ISDA 1NQWA 4AULA 1EKXA 2PA3A 4A6XA 4EM6A 3TO5A 5FBZA 4BO3A 3E82A 2C4KA 4MZXA 1H93A 4BNUA 4OHWA 2BMJA 3GZTB 1E1KA 1DQRA 3VPXA 4YUYA 1UXKA 2P5SA 4J6FA 4FHZA 8ATCA 2C61A 1P7CA 3C3CA 4EZ9A 1UK6A 2LDXA 4BMPB 2BFOA 2HBKA 1RQGA 5CUQA 1EI9A 2QN3A 3PGJA 4AP5A 3MHTA 2X4IA 3ZIAD 2LDBA 4OAQA 5J2IA 3C48A 3LWBA 5BMVF 3CWQA 4IDAA 8ICZA 1TEHA 2YJ6A 5I9NA 2GZRA 2IZ6A 4P7FA 4TLDA 1RPZA 1NW7A 5J2TF 2AJCA 1KGDA 2Y0PA 2W4MA 4JL8A 1JDJA 1QHFA 2YHSA 4EQ6B 2GLTA 4WLUA 4MRMA 1E1LA 1OY1A 4X62B 4KLOA 4L74A 4RGVA 3OQJA 4L1KA 1OLXB 2Y77A 2PL3A 1PLKA 3AT1A 1JXLA 1KTQA 1ZUD1 4W7SA 1RCTE 1WJGA 3H8VA 3NHPA 5FHRA 2B7LA 5I5GA 3U1TA 2AEMA 1ZJMA 4BFYA 2PA0A 3I9JA 3FNBA 4RH0A 2R96A 5CDSA 4FWTA 2RDJA 4C0XA 4BNDA 1K4KA 3D3WA 3KTFA 4O0MA 2IVFA 3ZU3A 5A6SB 4BLUA 2PFGA 1YFJA 2ODNA 4PG7A 5J47A 4IH9A 1OX4B 5EYPB 4ZICA 1B73A 2DTEA 3LXMA 2KZ3A 3ND7A 3E7FA 1QH0A 2EFJA 4BQFA 5T4HA 8ICPA 3TWOA 3IX7A 3NYWA 5KHOC 1N1GA 4NAUA 3ET5A 1MOSA 2R7NA 4TYQA 3BTUA 3L7NA 3NPAA 4IG4A 3ENNA 4G1CA 1SVOA 3ZVMA 3KHRA 4FFNA 2IYTA 4ZRMA 4JEHA 5KNIA 2SKCA 5CWRA 3T5HA 3WP1B 5LMUB 2QBYB 3ITEA 5C46F 4MPTA 2ECOA 5IK2A 5KG6A 5BR7A 2FLWA 1PNVA 2C20A 2X41A 4X44A 3LX6A 3NT4A 3KT8A 5ESRA 1XC9A 3KALA 2BGWA 5TQJA 3MERA 2OV8A 3D4NA 1D9ZA 2FZKA 1KQFA 1RHMA 1R8YA 1TMOA 2PMFA 2IWHA 4EL0A 5K3EA 1TA4A 3LK7A 4Y30A 5DB7A 4IIXA 5F3XB 3KD3A 2VJ4A 1JVNA 1CP3A 5E9JA 1THGA 4O3FA 4CM5A 1JTVA 3OPYB 4I8XA 4NZOA 1QAOA 5BUQA 5BV2P 2WAQC 1WNTA 4XSVA 3GJQA 4US9A 4U2KA 2BAGA 1PT7A 2E18A 3ZY3A 2ZIEA 3BMOA 3SEZA 4R2JA 4YRGA 1XK7A 4YEDA 4M49A 3V8EA 4B6PA 1SL2A 1HXHA 1NJ1A 4JXJA 3ETGA 2ZIWA 1EVLA 2FPOA 2WZQA 5LC1A 3ST7A 1FSZA 3QPBA 4KSBA 3UCXA 2HUPA 2DERA 1E9AA 3N2NA 4RJ2A 1U9JA 2CUNA 3ICXA 2OR3A 3LWNA 5DNYB 4QO8A 4QTZA 2YRXA 3EK2A 1W0JA 3KOUA 4NDNE 2ON6A 4G5FA 3ZCUA 3AKCA 4ZI2A 5IZCA 1M5UA 2CWDA 4C0ZA 3IR7A 3JAWA 4FYVA 3IILA 4WOCA 3OCXA 5CU7A 1PLJA 4F86A 2DPHA 5J4VA 5EE1A 1BE1A 2NVWA 4XGRA 1JHVA 1NKVA 4GMGA 2CJPA 3PNCA 4R2MA 4RF2A 7MHTA 1NJFA 5CHEA 2YDXA 1E3SA 2A9FA 5JTIA 2N46A 2VPIA 3DMHA 4CF6A 1I3NA 3RK0A 5H3HA 2VJMA 4ETIA 5IT0A 4I4CA 1T5OA 5D3QA 3U4MA 3KYDB 1UDAA 3CG0A 4J8PA 2W4QA 3SHFA 4ARSA 4ERNA 1H5UA 1S2NA 4YUXA 1C0LA 3RRJA 4M0CA 3OE5A 4QQKA 3R4VA 5EVCA 4WV3A 5JNVA 2Y1IA 5KVVA 2Q2NA 1BX3A 2NV6A 4YN4A 2GOYA 3GXBA 3QX7A 1A98A 1X7GA 2GEBA 5CVVA 1KI7A 1LDNA 2GNOA 3A26A 1V16B 1I6LA 1HFWA 1GPYA 1KI9A 4CRXA 4CCAA 2I1LA 4EEXA 1W7AA 1XEXA 1Z0ZA 5L6LB 1XZQA 4ZEVA 5JI3E 1CULC 1A9RA 2Y1OA 2OKGA 1BQ4A 1JGTA 1NRWA 1YB6A 2NNWB 2YIVX 2ZRIA 3AF6A 2R47A 5ER9A 1CDEA 2X9QA 4F4DA 5JC1A 1YI1A 5KVQA 1AIPA 2B4KA 4AFNA 3PXAA 3QNMA 1GKLA 3B5EA 1UDCA 3AMZA 4QSHA 3LK6A 3ZDAA 3VBCA 6REQB 5DP1A 1YOVB 3F5DA 5D3MB 3WLPA 4BFCA 1GR0A 5SYAA 1JR6A 2TECE 2X23A 1DAEA 2V5UA 3PGMA 4KPEC 3ACDA 1Z6QA 3PNQA 2EYUA 4YP6A 1JQ3A 4PH5A 1SB9A 3P2YA 3ICVA 4M54A 4RWEA 5KFKA 1D5CA 1G9XA 3OZXA 4I1IA 3TQRA 2C28A 5CB4F 1WKBA 4LVSA 4V39A 1TQ4A 4ISBA 4KLJA 4JQYA 2F62A 2VF2A 1ZKDA 1Z56C 1C8KA 3R8CA 3NWBA 1OFVA 2WIKA 5I7HA 2CKDA 4YJ3F 4CQLB 4HQOA 1YA6A 1GZ3A 4HPXB 1O4WA 1FX1A 4FFBA 3RRZA 4PFQA 3FUXA 1ZQZA 4PLHA 3R7WB 3GRKA 3QSYA 1BXRB 1P33A 2JGKA 2XUPA 2XB2A 3RHFA 1T2AA 5HILA 1I2MA 2CXXA 1A9OA 4YHBA 2W2LA 3U4QA 3CS3A 4JLUA 3OTOB 1BOFA 1XTIA 3CVOA 1Y6FA 5KYVA 3N8KA 1JYSA 2P2NA 4CM8A 2OSVA 1LSOA 3OC6A 5DOZA 4PLTA 1XOIA 1XRMA 2G25A 2YWCA 2CNKA 2Z7JA 2GXQA 4I46A 5HQJA 1M2VA 1YO6A 1SR8A 1VG1A 4V3BA 1ZNYA 4TM7A 3SI8A 3GCDA 1XZGA 3KLNA 5CXQA 1KQGA 1H2BA 1E9DA 2P4HX 1TKRA 2NU6A 2R00C 3LT4A 3QVMA 5JFOA 1G8KA 4BE7B 2JIBA 2RHFA 2ARKA 1L6IA 3M89A 3QE4A 3E9ZA 1YIOA 2I6GA 5L3QA 3C6ZA 5GGXA 2C57A 3KJNA 1IUKA 3ONVA 4WY5A 2RG7A 1NJGA 1U8FO 1FX0A 1PTJC 4CJXA 5IF9A 1ZNQO 1R6DA 4V0MA 4JLNA 4O5CA 3I5MA 2EAPA 1DZ3A 3GJ4A 3PUVA 3AB7A 1E5XA 2OHXA 2CVOA 3KLBA 1W8IA 4BRUA 4CEJB 3WWZA 1VLQA 4ZCSA 1CQIB 1V85A 1W76A 2L17A 2HMYB 2ZR9A 3LT5A 3PUYA 2JEJA 4RLSA 4XH9B 5KWJA 4EKYA 1GNTA 1R0WA 3I32A 4IIJF 2QE7A 4JEUA 4MRVA 4IIFA 3O3NB 3MPOA 3N58A 2FLNA 4J9KA 1I13A 1VIYA 3O2JA 5GJWC 5HUQA 3RB4A 4J9LA 2J32A 2PZAA 4KN8A 2UUPA 3HXPA 2Y0SC 4LRWA 4DOMA 4EA6A 3JZMA 3SZGA 4HCJA 4WSOA 4JGBA 1QHGA 4EPXA 3LFUA 2I2BA 4BFWA 3T6KA 3UXNA 1U6KA 1ZUNB 1NVBA 1FDWA 1RC0A 3DFFA 1F4LA 2YASA 5EJ7A 3UQYS 1N8TA 5BPCA 1K5PA 1NGSA 1TYDE 2EZ9A 4KAFA 1M66A 3GRVA 4OH7A 4CYMA 5MGBA 2O23A 4TS3A 4F2DA 2AYXA 1V9CA 1BD4A 5T4FA 5L1MA 1BKYA 2C54A 4BWYA 4L4RA 4ZZ1A 5A3VA 1CY2A 1SAYA 3P9IA 3E18A 1NI3A 3ZOZA 1Q16A 5K2OA 3EQ8A 4IYJA 2MYUA 4R2IA 4ZH4A 4IZIA 4YP7A 4JWKA 3HEAA 4JI7B 3GD5A 3IEXA 1QYRA 1VP3A 2R87A 2VG8A 3RFFA 1QTMA 1M10A 3GPBA 3KQSA 5HIMA 4DWVA 1I33A 3F98A 1JXQA 1NUUA 1PSDA 4QPNA 2VO1A 5IJWA 4C07A 4NXNB 3I53A 2WNHA 1GNSA 3WRXA 4ETMA 2AW3A 3DO8A 5T57A 1M0TA 5F1PA 3TQOA 3DAGA 1BA2A 3HY3A 4XPZA 3O0TA 3TRFA 4DBLC 2A5LA 4JWNA 4TMZA 3ZE6A 2VOJA 1F2TB 1KSGA 1MZPA 1NMZA 4O5OA 3OQ6A 5JALA 2FZVA 1L5QA 4D6XA 1ZD9A 5T6MA 3G8CA 2IUFA 5JQGA 4NNOA 4HS4A 3T34A 4J1TC 1NJWA 5H0IA 5LZ2A 4RK5A 1QYCA 2IHMA 1MIOA 2IEAA 4FMCB 1U8XX 2BISA 3CN9A 4MR7B 4J3FA 2QZZA 5IDYA 2PWYA 1Z2AA 1KTIA 3LBAA 3S5JA 4HNUA 2JFHA 1J90A 5F9LA 3GV8B 2REQB 1T36B 1YDMA 4PQYA 2VYVA 4U2GA 5ALMA 1JEYA 2D2IA 4MV5A 1C20A 2CLKB 3LUCA 3DOHA 4PGFA 4DZRA 1AXEA 2WR8A 2FUG6 1NKCA 3KJZA 4XQEA 5F7JA 4ED6A 3A37A 4LXQA 1TO6A 2MINB 5DSXA 4LJ6A 3U4QB 3HPRA 2PT7A 2BM9A 5LZ9A 3GN1A 3JQ9A 3RTBA 3BSSA 2V54A 1BS2A 1WQ4A 1NKSA 2IK8A 3VPSA 4ND1A 4KLMA 4LY6A 5KC9A 4RNMA 2G8LA 2PZFA 2CDBA 1GRQA 2QTBA 3QVJA 3GB9A 3SYTA 2EZYA 3DXXA 4DHWA 5LFAA 3JWGA 4UOQA 4DYHA 3QV2A 3LIPA 1MH9A 3H2GA 7ICFA 1P2SA 1JEDA 5KUTA 1RAFA 4C1BA 3IDFA 4M8KA 4O4IF 3SOPA 3VR4H 4P3XA 3BMNB 1T3HA 3JPYA 4UTNA 4TKZA 3M7DA 4CIDA 1JDSA 2DWQA 1DC4A 3FNEA 1H94A 2WINI 4YJDA 1VJDA 2NV0A 3DTYA 3ZDXB 3CURA 5FI0B 4RQ1A 3KKAA 5EEHA 2R00A 4CMHA 3AY0A 1SXPA 3WO0A 3WO1A 4LHSA 1IVSA 3IIEA 4UB4A 1PV4A 4OLAA 1I0LA 3VPGA 4RA6B 2I54A 3JWIA 2FFRA 2LYAA 1DRGA 2PD4A 3NHZA 5A6VA 1OWPA 2ZIGA 5FH9A 1N2IA 2FA9A 1YGPA 2NO4A 2JGFA 4Z9BA 5DF1A 4KACA 3TW0A 3EISA 1EFUA 2K4MA 2SCUA 1W5AA 2QMZA 4G9EA 4UMFA 3FYUA 3B9PA 4UVGA 4B9LA 1FFGA 1OI2A 3LG2A 3F2CA 4G5SA 4JKYA 4QRHA 4R51A 1FFXA 4K9SA 4U6QA 5FWAA 2XKAA 3NWEA 4D4MA 4ENSA 2CYAA 4TXMA 2OG1A 4FD3A 3VR3A 4NBSA 3NNSA 4OEHA 3QMMA 1GDHA 1TCCA 4C80A 4AG6A 2CSXA 1TVKA 2G70A 3INNA 4JB2A 2QTLA 2X0JA 3C3DA 3O03A 2XGJA 4G2NA 2EQYA 2I34A 4BBPA 3T7IA 3VR5A 1S3FA 3TW6A 2ZS7A 4YX9A 4MUJA 3BERA 2VHXA 1OTYA 3B7GA 2P3SA 4C0BA 1U3CA 2VHUA 1JR4A 3G0DA 3EPLA 2X8JA 5DIZA 5JMWA 1RDFA 4D8VA 4M37A 4E2ZA 2V9WA 2PL5A 2VHQA 3I61A 1CUVA 4ALNA 4MV3A 3ZHVA 1GRCA 3KT6A 4Q4AA 3BTSA 5I01A 7ICOA 3PUJA 1ZMOA 4F56A 1Z13A 2QL5A 1NBIA 3FNQA 2PBLA 2HJGA 5EQJB 3LSYA 5AK6A 5KHAA 1K06A 3UOGA 1GLVA 2WB4A 4BO9A 3KTAB 1KAMA 1YNSA 1XL0A 1IU9A 5DEIA 4I4IA 4FHEA 1CJBA 3JPWA 1XWWA 2LM1A 3PEFA 1KH1A 3O26A 3ZK9A 2H1SA 4QHTA 2MSWA 5JZBA 1RXIA 1W4AA 1Z7EA 4RJJA 1JWAB 1ZWKA 2DTXA 5ITVA 5L1KA 3FFWA 5L4LA 2HR1A 5LWHA 3RYTC 4NVRA 1DXHA 2F17A 2RAFA 2J5BA 2PGLA 1SHKA 3FPBA 1C3OB 2ZT6A 4TLLB 3RIGA 4A16A 4HNRA 3B7PA 4ZTBA 3C6YA 2OMEA 1P9NA 3LAWA 2W9CA 1RYFA 2F7SA 1CBUA 1AUXA 4NENA 5IBCA 5G0SA 3FLAA 2OCDA 3CR8A 4LRQA 5GM1A 4D92A 2IQIA 3TK1A 4M6WB 1PDWA 1RVDA 5EI5A 1WTAA 2IXAA 2JIMA 1E4OA 1ZDMA 2RGEA 4BS9A 4D26A 1YHNA 521PA 4HZGA 3FG9A 1PK9A 1ZJ4A 4Q9NA 1SU8A 3BA6A 1PX2A 1V16A 3QXSA 4UZSA 3TW8A 3QBVA 5E4JA 2JK0A 3PVZA 4ELTA 1IPHA 4F5YA 3N2LA 2Y1JA 4XE5A 1QWOA 4GSYA 5C8XA 2P41A 4R3NA 5TT0A 2RK4A 4BQEA 4JY7A 4EWLA 2M2IA 4F3TA 2A1JB 4PZDA 4KQ6A 3NVMB 4CT5A 4E21A 3ZDYB 1YDEA 4U9HS 2CD9A 2FSFA 3GFOA 4AS2A 5C2JB 4H7PA 3H5LA 2OCKA 2GBPA 3C1YA 2W48A 3P2JA 3OCCA 1S0NA 2B2XA 1H3FA 1TVMA 2XF8A 3JQGB 4DMMA 1E98A 3HSKA 3UWDA 2X9GA 1YR8A 4IFIA 4V0OA 1QB8A 4DZZA 2LUOA 2K89A 1OXUA 1WO8A 3REGA 5KFDA 1TJ3A 3I62A 4DF4A 3GAFA 2DQZA 3ESDA 4E7OA 1ZQFA 2QARB 2C8LA 3A1DA 2ZUSA 1SXQA 1QAMA 2COUA 3LPMA 4OLHA 2L18A 4UM5A 3HGTA 3JYNA 3Q3HA 3UT5B 2IXDA 4Q21A 4CG3A 1NATA 1UDXA 2CPRA 3AP3A 5K8IA 3I42A 1ACLA 2I03A 2Q3HA 2JA2A 1KZHA 1N61A 1WM1A 5CA1F 3PXBA 5KDOA 2BHSA 1S6YA 3BZKA 4QZHA 1EAMA 1T4DA 2Q4TA 2PSSA 2TYSB 4TL8A 4IHKA 4Y6QA 1AMOA 2PUCA 1XZJA 4PY2A 3IDZA 1MR3F 1TTQB 2IEBA 3HCAA 4M0UA 1L5ZA 4NL4H 1JEQA 3F5EA 2ORVA 4Z0TA 2OCLA 5CNMA 2A1UB 3T41A 3D8RA 3GJ5A 1WU8A 1YZNA 1TVAA 3AVWA 4Q7LA 3AYZB 2FZEA 1J99A 3VC2A 1OB2A 3ZBQA 4XUCA 1UJNA 9ICKA 2IF0A 3OA0A 4ZAXA 2PZBA 4JELA 4YRNA 4RTKA 2Z5FA 1UL1X 2VF4X 4G0PA 5J2GA 2QLTA 1DBWA 3QG5A 1KFEB 1Y4SA 1T3TA 5F21A 5JBNA 3IL2A 1C7JA 2B1RA 3WRVA 1ZI8A 1I2AA 1NTRA 3D3EA 3BMCA 3EIUA 2E1RA 1PFGA 2NPOA 4CKBB 4F5QA 2FKNA 3NVZA 4B9UA 2YS7A 1XCJA 1NVUQ 2JEIA 3IP5A 4F2RA 4WT7A 4Y98A 3V34A 3KQHA 4IJ6A 1PUXA 1UQUA 3HJCA 1JU4A 1XTJA 2MU1A 2ZWMA 2Y1KA 2RJ3A 4Y6RA 4BU1A 2ES6A 2DWPA 2FR1A 5CHGA 3FGPA 4ZVUA 2X8BA 5LLSA 2I6XA 1AUPA 4ZDWA 4Z86A 2C2XA 2VF7A 3H2BA 4MYRA 1WUIS 3VVCA 1PL8A 1OREA 1DG9A 1L4YA 5C51B 3H6GA 2LIVA 4DV4B 3HTXA 2OVFA 4GOKA 2VDWB 3LF1A 2NVOA 1U8YA 1VL1A 3BXFA 4OIMA 2G36A 2NZWA 3FHLA 4M1YA 4NARA 4PYMA 5CJJA 4YASA 1BX1A 5DLEA 5EEGA 3D1VA 2NVUB 1NW6A 4U6PA 5H83A 3WWYA 5KIAA 1WHTA 3ITKA 1KI6B 4TV9F 4E13A 1T9AA 3AR2A 2XB8A 4PYQA 3H75A 2WB1C 3M4NA 2EYQA 3MQ4A 5JLAA 4BN5A 1FBTA 2ZYAA 3ICCA 1ZQXA 1EQAA 3D8HA 3SZLA 1R6BX 4PCVA 3LBHA 2B94A 3UPUA 2ACWA 1NBHA 2ORWA 4R7TA 3C5GA 5BNZA 5AKLA 3R5HA 2ODWA 3ZS9A 1CQIA 3GLIA 5J2HA 1WXGA 4CKEB 1YUNA 3ONEA 2F77X 3N05A 4IIGA 3I39X 2MWMA 3TARA 1SVSA 2AG8A 2EOAA 3EOZA 4G5HA 1CUBA 2CE7A 4EOGA 2ZOSA 4NZPA 5C53B 5C1DA 1ONNA 2DU8A 4O2AB 4CIYA 4GEKA 4YT2A 2VHJA 5DRYA 2XNJA 3GD7A 1CE8B 2UYQA 2A4MA 3FFXA 3ZD9A 3GLKA 3WP0A 2XY5A 4AIRA 3VU8A 4E09A 2OGSA 1QH1A 4OBXA 1CDZA 4RQ6A 2ZYRA 4I5GA 2YN2A 3RWOA 1HQCA 2KBEA 4RENA 5T41A 2AGOA 4C0AC 4D9GA 4DV6B 5B30A 4HZUA 1NG9A 5SZJA 3A3NA 5FX2A 2PZEA 3Q40A 2Y9PB 1VMIA 2WW8A 2H1LA 2XDAA 3CEPB 2BBOA 3OTQA 3WX0A 3GRZA 2BJHA 3QKSB 4RKRA 4L6CA 5IVHA 1FL9A 5K8TA 1Y3HA 2HH9A 3V7NA 2JFZA 4M0FA 2YC4C 2C9CA 2DHEA 3BQNB 3C8ZA 4RHXA 5FOVA 5GONF 3QXGA 5I47A 1ZIXA 2Z2YA 5ICMA 3Q7RA 5LP6F 4C08A 3ELBA 3OMLA 4G26A 4ANFA 4FM9A 1BNCA 3DF9A 4BIMA 5B12A 2W93A 1H0HA 1R4NB 2FR8A 1P7YA 3ZK7A 1CLUA 1WD5A 4LWZA 3C5CA 1M1YB 1UKEA 3GL9A 1XKTA 2FZWA 4HB3A 1W46A 4ND2A 5B3JC 4NC9A 1GU1A 2QRUA 7ICPA 3DBHA 5EXEA 2OXTA 4B3HA 2NQ8A 4U5QA 2PXHA 2HW3A 5JD3A 3R8XA 3EG5A 2GWSA 1VPLA 1B7GO 4UVHA 1P1HA 4DLEA 4XRRA 3MBYA 1QIGA 1T5SA 4BNMA 2YX1A 4AXBA 4CLHA 4UB6U 4FX5A 4KQEA 4HS9A 4X3OA 2HHVA 4YBRA 1KFTA 2Q5QA 3PA6A 3A4LA 3EVBA 2O7VA 5CBKA 3V32A 1G6KA 2I2DA 2H5LA 4Y2HA 4WZAA 3I1FA 1NQVA 3ANSA 3ASUA 4I6EA 1SGGA 1A7AA 2ODQA 4MPJA 2B2CA 1XMPA 4LV5B 3SYNA 3TL2A 1EYZA 2FPIB 1G5PA 4DT1B 1FB5A 2DWCA 5DM1A 5F52A 5AOBA 2WYOA 2YWXA 2ZRBA 3KBBA 1LBIA 1QG6A 2R1VB 3HU5A 2VQ6A 2WIDA 2ZPUA 4D80A 4B4WA 1R0ZA 1EUDA 1ZN9A 1T9BA 1ESEA 1A9XA 2JRZA 1Q0LA 4JQCA 4CCHA 4F7DA 4G1EB 1ZY2A 2IIBA 3O4RA 2B4RO 1C9YA 4AW9A 4P8RA 2R6AA 4GOJA 2RI0A 3DKPA 3IDWA 1LPOA 5LBIA 3VC3A 5HOEA 1Z28A 2ZSFA 3IAM6 1II9A 4INAA 4JP1A 9ICJA 5IAKA 1Z3IX 4C22A 3ONNA 2WJZB 3JQ7B 4NXMB 5J5VA 3WWPA 1J2TA 1AQLA 3KC2A 2BP7B 3I5XA 2NO9A 4F6LA 1H42A 1KOGA 1KS2A 3CB2A 4BNYA 2E8OA 4KTVE 3EZ7A 5E9AA 3E15A 4ZYXA 3A6ZA 4Q9JA 2FW1A 4Q3CA 1B0UA 1Q74A 1R2QA 2FVXA 5TVGA 4IKEA 3K75D 5I7EA 1AVTA 1ORIA 4U5XA 1X77A 4EVRA 3KHSA 2Y92A 1ILEA 1DLJA 3NRBA 3C4QA 1CB0A 1C81A 4IY1A 1G5HA 1C8BA 3MJ4A 5B6IA 3GZJA 2BCUA 3C5FA 1LV5A 5JVDF 3CU5A 1KJWA 1OXMA 2ZUEA 1MEOA 8ICQA 4PL1A 2IHJA 3GJXC 4KR7A 3UJCA 1V9SA 3FDIA 3EEFA 4Q6BA 3VYVA 3WMEA 3BAZA 5DYTA 3BD8A 2PJZA 4A27A 4Q37A 4UNPA 4BX2A 3M6KA 4PAOA 5LJLA 4LYJA 4WZBB 1I5EA 2I6TA 1JAHA 1T8YA 4YTEA 3UY4A 1LK5A 3MM4A 1EP2B 1OX5A 4GHWA 1PR2A 1U1IA 2HV8A 3KTAA 3P1JA 4RIEA 5IT5A 2XYGA 2ZSJA 1TVKB 4FZNA 4IJMA 3E3NA 2NQ2C 2HJVA 4HBZA 3TBHA 2YMLA 2A58A 3TPCA 4BNNA 3DL7A 1H69A 2XE7A 3CLVA 1WQ1R 3ZDCA 1Y8QA 3Q8WA 4WOKA 2EJCA 1N2JA 4C4SA 1QGZA 2AQKA 3OPMA 4A8JC 4F8EA 4QYIA 3PKZA 3OJ0A 4FLEA 1U99A 4V02A 3IQGX 2OQ2A 4WA7A 4Z7OB 1TQ2A 4OTZA 16PKA 2WA2A 1LU9A 2B20A 4GGOA 3BJMA 4P4NA 4WL0A 3X3HA 7ICRA 4E88A 4EYEA 5EHZA 4KJZA 1FYEA 1UZNA 4EPWA 1FIQA 1QIKA 2Q4RA 3KQNA 1O6CA 4N5DA 1LRKA 5LCXA 2KG5A 5KQGA 3ERCA 4M8NE 4BJ6A 2IQ5A 1GUFA 1SL0A 2E4ZA 3I2GA 4FHGA 1YAJA 4HZUB 2Z4TA 4HPJB 4RNCA 1QP0A 5COAA 2HDOA 3E0XA 3HUDA 5A9TA 5AJHA 2CUTA 2H59A 3WQSB 3KR1A 1OZHA 4UMVA 4YACA 2Z83A 4CDNA 3ZDBA 1QQ6A 2ZVDA 3QITA 3QELB 4ZCIA 3K96A 1VLHA 3TW8B 5C34B 3RAXA 4ENQA 3JYPA 5FPPA 1L7BA 4TL7A 2H1VA 1UBGA 4Z2YA 1KEUA 4L4SA 3H4VA 2FW0A 1OVGA 3DEIA 1DMSA 4LPKA 4DV5B 3CHYA 1HUZA 3L07A 4BKQA 4DJTA 2C7RA 3T4PA 3BK2A 5DGIA 3BT7A 1YC5A 1ZU4A 4RV9A 4ZP1A 2JZOA 4N6GA 4FS2A 4F5NA 1ZL2A 2I5PO 2Z3ZA 1QGUA 4XLTA 5KQMA 5LSAA 4IIVA 1CU1A 3IPCA 5K03A 2I8AA 1QQBA 5EG5A 4PGYA 1Z5VA 3GIWA 3PE4A 4IVPA 5C37A 1JAIA 4LXXA 2UVQA 3R2JA 4ZK2A 4P3NA 3FWNA 1Q95A 4FHCA 2GH1A 1S2GA 5B2FA 5ALZA 2G6TA 3ZWAA 1G21B 3C3EA 2XNCA 4WHMA 2O2IA 1V6SA 2FB9A 2JKVA 4GLXA 3IKMB 3MGHA 3I45A 4RQAA 3TBKA 1GNLA 2HU5A 1EGMB 1ESDA 3AR8A 3R3YA 2QXUA 2W2PA 3IOBA 4P9NA 5F1OA 3WNQA 3IPXA 3JASA 4DGSA 3FB1A 4ZFNA 1I7SB 3M6IA 1EE9A 2WHRA 4O2AF 4F84A 4A15A 3EC1A 2WVGA 3IEKA 1WOYA 1X2BA 4UVDA 5MHTA 3KR9A 3PW2A 5HKBA 4X1KB 4GOOD 5FHQA 4L8VA 3CW2C 5JAHA 4U7CA 3AUKA 3WNBA 4KV7A 4OBEA 4RVCA 2VZ9A 1G20A 3I5AA 5DMXA 1NT2A 3K15A 4L73A 3PPYA 4ZVKA 3DOUA 3IR5A 3TRJA 2Z98A 4LJXA 2JAQA 3LVBA 2I4LA 1HDRA 2WY2D 2P8JA 3NH9A 1U81A 3HCPA 1T5TA 4L08A 2ATCA 4BVEA 3DLBA 2G80A 5AM1A 4PBSA 3RO7A 2QX7A 4D3XA 4O3MA 4IZ6A 2QEQA 1IZ9A 1GTL1 2GZHA 3BGDA 4YPVA 3FOZA 1W36B 4BUJA 4D79A 1FXSA 1M2EA 2Q6TA 2JD2A 3VI4B 1QIEA 5DYGA 5LA6F 3Q8LA 1K75A 3QMWA 5FOXA 3KS9A 2ZIXA 4I5DA 4L2IB 1EINA 4U02A 3MBIA 3HXMA 1ZQNA 1IN8A 2KZMA 5JG7A 1C4OA 4UPEA 3ZJYA 4BNDB 2QAGB 3I4LA 3VAYA 4FBLA 3W4KA 3ZQUA 4EY5A 1JJVA 5B2EA 5CB4A 1X9GA 3OSZA 4F2SA 1O77A 3IDSA 3OM1A 5HF8A 2PO5A 4AS3A 1NLMA 5DYYA 3KDAA 2CFIA 3RH0A 2FFBA 3VZCA 1W5TA 4E5SA 4ED8A 1NYRA 1XK6A 3OF3A 4BVHA 3DC2A 4DRXB 1WAMA 4QTYA 1R10A 4HDCA 4K6MA 4PYKA 8OHMA 1EJ2A 3CUTA 4KE8A 1L9KA 5HDQA 1CCWA 2RIPA 2O2GA 3EAFA 1CK4A 2H1FA 2QQEA 1EQUA 1XTKA 5FF9A 4OHXA 2UVVA 4EW6A 2CV0A 4TROA 2ZT7A 4ZYZA 4HV4A 4HAIA 1E8NA 3LKZA 4RNDB 4ZO7A 3GQVA 1O0BA 2PFKA 3T4EA 1SBHA 1SB3C 1RPAA 2NUPA 3PRYA 2E4VA 1FFCA 4Z99A 4CU2A 2G04A 1VE9A 2BM8A 2J3QA 2PMCA 4ZVVA 2UVUA 4LSZA 5TQ0A 2AF3C 4GH5A 3OCYA 2IPMA 2JCSA 3PW7A 3QGMA 3MTIA 3IVMA 4IOLA 1OI7A 4A7PA 1A69A 4ZT5A 3OICA 4WGGA 1WW8A 4J91A 3K6SA 1JHDA 3PT5A 2PXXA 3OLXA 4RTRA 1XT6A 2CHUA 4P83A 4LJAA 1QHNA 1JILA 3P45A 1DX9A 1U1GA 4TUQA 1WEHA 3JARB 2PGJA 3KAJA 4ZTZB 4CEIB 5BV7A 5A06A 1IRXA 1K7SN 4EQZA 1ZQBA 1TIBA 2OORC 3T7AA 1ECGA 4KQJA 3O8RA 1M2WA 1KR2A 1MJ5A 3F4KA 1X0XA 5KG7A 1YSCA 1QQ5A 1QTIA 3PC4A 4TSFD 3UENA 1AHIA 4OYLA 1AGXA 3D81A 4RUKA 5KTPA 2HHWA 4BV3A 2PUGA 4Z8XA 3H6KA 3VC1A 2ADMA 2B8NA 5AXDA 1GR1A 3F97A 2ST1A 1EX7A 1BGXT 1A6SA 1WMFA 1JHMA 1X1BA 1WDKA 2CMFA 3GRPA 4YECA 1HT1E 3RGGA 5HRUA 4KG7A 1CIJA 3ZE2B 1RE0A 1QDLB 5DCLA 4B4UA 5KYUB 4JX8A 4Y2RA 1JI0A 1OYYA 1RLOA 1CF2O 3AG5A 2P75A 4ZV7A 1YFLA 4COKA 3OWHA 3IERA 1LRJA 3FFBA 1YR2A 4LOJA 4LXHA 2OZPA 5E6UB 3ZWMA 4PNEA 4FFRA 3VR4D 2PIAA 3CNEA 5FTLA 4NXZA 4DQPA 1FMCA 2DLNA 2EJTA 4FQ5A 1AS0A 5C4GB 2O5VA 3O2NA 1DAFA 1UMBA 5CXSA 3R7FA 1M2VB 1ZO8A 3DH0A 5SY6A 5IM4A 3OTGA 1DRJA 2KHZA 3LPCA 5JXIA 1C30B 4G0NA 5AM5A 4LVOA 3OAAD 1HG0A 2O2HA 4GRIA 3P0EA 3COYA 2LKYA 4KI7A 1L8LA 2ZI7A 1BN6A 3HVHA 3OFKA 2BN4A 2WUFA 3IMKA 4GMXA 4WGFA 1R1DA 5FYDA 2I4RA 5TX7A 2Z6VA 3BWEA 1QG4A 1YRYE 4U9IS 1IZ0A 1KKLA 1U65A 1ZOOA 3AXTA 3GEBA 2PMEA 3V4PB 4C0WA 4EJ6A 3S2UA 3H2JA 2P6RA 1KJJA 5B4UA 2WSSA 5C8YF 5E4TA 3UHPA 4HRXA 4O4LB 4U0JA 1V35A 2ZBFA 3ZLJA 3C1UA 2D6FA 1ZK2A 2ZRGA 1PGQA 4KHPB 1P1JA 1U02A 3C23A 4UUPA 1YQGA 1EDOA 2JZBB 1WVGA 1D2GA 3N6XA 3D0OA 5C5IA 4YJFB 4F38A 3OJOA 2H2GA 1I6WA 1CW2B 1F0KA 1R5OA 3GLSA 1EK6A 2H3QA 2RE8A 1P0QA 1FRVA 4PGXA 3CF4A 4OA5A 2VAXA 1MZVA 4AYXA 4YCCA 5C3UA 4ZJYA 4ED0A 3MR2A 1P62B 1H6BA 3GT3A 1AMUA 4NG5A 3ELUA 1AQNA 1Z88A 4MK4A 3EIXA 3VKFA 3LNTA 5KEIA 1O2DA 2AD1A 3WE7A 3I12A 3ISCA 2Z04A 2IY8A 5CT6A 2ZJ8A 1FRFS 1O54A 3TMYA 1YZFA 4ONEA 3TAXA 4ZZ0A 1EM8A 5H16A 2Y1WA 4C6RA 1S89A 2QRPA 3ZKWA 2IBKA 2HHQA 2DKFA 3T7KA 4DQUA 1OB5A 3WLJA 1JSXA 5BOVA 4LGCA 1TMYA 3GZ4A 3D6TB 4TWRA 1YTUA 1JXMA 2QN1A 3G2MA 5KTMA 4GLJA 3SYMA 1E6EA 4QHSA 2XI4A 2UAGA 4IQ4A 1T4GA 1F6WA 1Z4QA 1BMDA 4BASA 3L04A 1JHZA 2J08A 3L0OA 2BRUC 4OHRA 1FCJA 2R6JA 5DBIA 4B4KA 4AXXA 1SXJC 1ZIYA 4U7GA 4D4JA 4S1OA 5EIWA 4NS4A 3FTPA 3OETA 4TKVA 2JMGA 1FTGA 3FLBA 4R7GA 1P0MA 4QPZA 2J67A 3NFRA 4X97A 2EIHA 3NTQA 4L3WA 3REFA 7MDHA 4J9QA 2RGBA 5K0LA 4GI5A 3LBYA 2FJPA 2FK7A 5F33A 1FW6A 4XR4A 1EFDN 5E0OA 2AXNA 3DV2A 1U8UA 1BH2A 2DX7A 1EDZA 3GBVA 4N3NA 4DLLA 1EVEA 2PHZA 4MV0A 4BYGA 5HUJA 4NMLA 4KWCA 1NXVA 2R4QA 2GPNA 4N0DA 2HEIA 5KYWB 1JFRA 3DFUA 3DEZA 4GAEA 4EG7A 4I1RA 1ADJA 3C1AA 3AIMA 3RJHA 4BNFA 5HKKA 4ADSG 3HXOA 1CS4C 4FFBB 4DV2B 2IV2X 2V9PA 3GT0A 4LPSA 4GP7A 3E4DA 3DBLA 2R3SA 1GNQA 3NBFA 9ICCA 1YS9A 2NUAB 3IAS6 3SAJA 4OKSA 4FEGA 5KX5F 1JEYB 1ADGA 3LHFA 4QJ5A 3PV0A 3T1QA 4P33A 4FR0A 1JIXA 3EVCA 1C9NA 3MD0A 4FYXA 1XC7A 5F5XA 1Y8RA 4RULA 3TRIA 2PFOA 2PH5A 3WDSA 1A50B 4AUNA 2RQ5A 1N7HA 3GLTA 4LYFA 4FB5A 1NL3A 4WBNF 4BAZA 4Q18A 5KQPA 1R6VA 3SM9A 4XEUA 1BE6A 1YDWA 4WBNA 3WK4A 3QTTA 1ZGHA 1IMOA 4URXR 5JANA 1VLJA 4J9MA 3B1XA 2QMEA 2BFPA 4YT8A 5HFJA 4ZOAA 4UASA 4RACA 2EFDB 1SPBS 5KAMA 4KB5A 3N4MB 3E3LA 4TMXA 3UICA 2HJHA 3AUAA 5DCWA 1R0RE 5BT8A 4L0DA 4IR9A 2WJ3A 1JKIA 1MX1A 3HNOA 3HS3A 4DNQA 1O4VA 2W8LA 2OLKA 4PWYA 4O8CA 5NLLA 2AEEA 2I2CA 1Z22A 4WXRA 3R7LA 3QUAA 4CQMD 4MW0A 1N5MA 1MFPA 4E46A 1HV8A 2H7CA 5IN4A 3K70C 5T4EA 1SOWA 3A1SA 1UMDB 3NNDA 5GZ6A 1KP9A 1TQHA 3AG6A 1VCMA 1SOAA 2IE8A 2ZBEA 3L43A 3QYPA 1SVIA 3LGXA 3QOYA 1DB3A 1L1EA 1Y4AE 1ZBDA 1TM4E 2LXNA 2JHCA 3ZW9A 5LQJA 2H0QA 1LBHA 2FRVA 3MJDA 4YIHA 1NNUA 2PRKA 4GEGA 3PFKA 1PO7A 3RB6A 1X1SA 3M6FA 4Q1AA 3KYCA 3UFXB 2WUGA 2SCUB 4NE7A 3U4AA 2C3OA 2J0QA 3LTNC 3TD2A 3GEMA 1N6OA 1U28C 3V8QA 2WWYA 5JMPA 3TSOA 1XO0A 3T3GA 1WCIA 3WG9A 3WL7A 1KO1A 2J3EA 3DLTA 2PSHA 3HA2A 3ILSA 1T8UA 4MULA 2FF7A 4RD3A 5A0FA 1EFVB 4MAAA 4NI5A 4CHGA 1YRBA 3CPEA 1BZYA 4GBMA 1RYYA 3DW1X 1J00A 3N8NA 3L7LA 4UARA 1QBGA 3PQ2A 5BQPA 3THRA 5CB4B 2C22A 1NIPA 1TD9A 3C4JA 4WXEA 1B16A 2PR2A 5CM8B 2BGKA 2WP8J 4TGLA 3L4BC 3ANXA 1J4AA 3AZPA 3E8XA 4I0WB 3NWJA 1BVUA 4YJFA 2ID9A 3G9ZA 2BHNA 5SV2A 1K27A 3QVTA 4RJLA 4WIAA 3F67A 5MFZA 4TLCA 2CV1A 3M4YA 2ZI5A 1RBMA 4NZNA 4MEYA 4MAMA 2Y9MB 9ICSA 3ENVA 4LY0A 2H9YA 1QCZA 1ZLXA 2QMUA 4OB6A 3CVUA 2RGRA 5CLGA 3V8PA 2ZIZA 3O4JA 3WXBA 5AW5A 1GT91 4TXHA 3GLFE 4MS3B 3ZTWA 4EKNB 4L2IA 4MVXA 3G5LA 2PLWA 2ZAMA 1QHYA 2HSZA 1BVSA 2PGOA 3GZNB 1VDVA 1E5QA 3KAPA 4H7FA 8ICAA 4IXTA 9ICOA 4DLZA 1HMYA 4PCAA 3RIHA 1JYEA 3RJ5A 4KFCA 2VWGA 2G17A 4BX0A 4NYMQ 1DPFA 3A8TA 2HUNA 2VYND 3BUSA 4UVEA 4AMBA 1OT5A 4DJ5X 1U6IA 2K7ZA 2W83A 3E7WA 3HR4A 2P62A 2GERA 1ZEMA 3L0SA 1CRWG 4RKFA 3I6QA 3MELA 1ZK1A 5B1IA 1T13A 2PH7A 3DAPA 3LWDA 4ZEWA 5BSTA 3VHXB 4AP6A 1EUQA 1PV2A 1YQWA 2BKEA 2A67A 2AI2A 4FUQA 3N2YA 3SZMA 3IAXA 4FSXA 4ZWNA 4N5LA 4N8SA 3NMUF 3UQ2A 3OKPA 1X3SA 1YZUA 3I83A 2ERYA 9ICLA 4OK3A 3CRMA 5A7HA 1QWSA 4JJ4A 2WTNA 1DRVA 1EAYA 2J0SA 3N9IA 3RYIB 4HWKA 3ZTYA 4ECZA 3SQXA 3F5AA 5F2NA 4YRRA 3IHTA 2ZDQA 3Q87B 1AURA 2FSPA 1J25A 1GGJA 3FLEA 2ECKA 1S5PA 4NHOA 2NUPB 1GAJA 3WBFA 5AVQA 2K2QB 4UB3A 3SVZA 1G9TA 1UWVA 3WQQA 1L2TA 4Y2PA 1TEVA 3FVQA 3B53X 4M76B 1M8PA 4BNIA 2C0CA 3I2KA 2XUAA 1TIKA 3HZZA 5D3ZA 5TMDA 4J9NA 3STWA 3V1KA 3NXSA 1S97A 4BXOB 2X9LA 3WLNA 1E99A 1GTJ1 3QMVA 2PFNA 4OXRA 1NVVQ 1XVTA 1B0AA 3HMQA 4KR2A 2WVJA 2Y0DA 3K9CA 1EFTA 1XGKA 1SN7A 1YRAA 2BEUA 2O8EA 3RYHB 4WJLA 4B81A 5KOHB 3QEAZ 3HU3A 2JI7A 2VHZA 3GUVA 4XB1A 5COQA 4NU5A 1Z63A 2M6LA 1YDHA 2D0IA 1HQKA 2GZ1A 4KITB 1Q83A 3KCQA 1F0MA 4KGVA 3KQOA 1S2MA 4M98A 4N7JA 4UXIA 4EI2A 3OLZA 1KY2A 3DKKA 2QU8A 3AR5A 1GT6A 3OU7A 3B5JA 3EGCA 4PSDA 4D3ZA 4DCOA 1QFXA 2JJ2D 4EW2A 4KLDA 1Z00B 2CCKA 2H9AA 3A04A 1JG2A 2GA8A 1E1CA 1DG1G 1BPZA 2IYVA 3E84A 5E2BA 3WIUA 4C7XA 2WAMA 4M1KA 2C7QA 1Y48E 2AQHA 5E1DA 5BUCA 2HHSA 3D7SA 4ZJZA 2E5WA 3NHWA 5EQFA 1UPCA 1LQ2A 4GFDA 4YR9A 5AM2A 5LWQA 3UJBA 2ISCA 1BDHA 2BE7A 3WJ7A 4AP9A 3B3FA 3HCOA 3MRSA 4N39A 2BZGA 2YFHA 4N48A 2BCQA 4EYHB 1HZZC 2N1BA 1IQUA 4WRRA 5CCBA 2JXJA 4KWIA 4ZRDA 1XTRA 4MWTA 1K6JA 2IXFA 2PKEA 1FF9A 1CHDA 3ESBA 4F5PA 5C8YA 3D6MA 4KRXA 3AOGA 4CNQA 1LNZA 4NU0A 5DBAA 2OCEA 4OY3A 4RPXA 3RBVA 3UMSA 1WCWA 3DB2A 5EJ2A 3LZCA 2H57A 4DWWA 4UAWA 3K5IA 5J2KA 4FS1A 1WW2A 4LJ5A 5DXJA 1Z6AA 4DG8A 1GZUA 4TLMB 3TDMA 5BV0A 2VJKA 2VK2A 5EAIA 1A5BB 2LWIA 2WFLA 3O0FA 1DS6A 1AKYA 4AKGA 4O4IA 9ICIA 3MJTA 1QKIA 1QPBA 1GKUB 3HXTA 4UQGA 2W9BB 1R6UA 2PQ0A 2Q5FA 3RBEA 2QLFA 3HRHA 3BIOA 1L5RA 3K0HA 3KRTA 4IDOA 3N28A 4YVFA 1B6TA 4ML3A 1CF4A 4G5YA 3UTCA 1L7OA 5FBHA 1BDIA 3RVNA 4FDVA 3HJFA 8ICYA 3LYAA 2XO7A 3WAJA 3I0MA 3M70A 1M7HA 4RXMA 4FO6A 2DFTA 1DQYA 4J16C 4B2IA 2PMKA 1JAZA 1L6NA 3OZIA 2IVZA 1S7GA 4W1SA 4F9FA 1GSIA 5DQGA 3ZV7A 4RUAA 1OFTA 5F3RA 3EZNA 1E96A 1V3QE 1JJAA 4LJ8A 5ITZA 4EEKA 2MDTA 3KQTA 3CZ9A 3EF0A 5FUWA 2QGFA 4E7PA 1UFRA 5KDLA 2YWBA 3GGGA 2W6QA 3G5UA 5DW0A 3CLRD 7ICVA 1GPAA 1M7BA 3N7RC 4EFNA 1CEXA 3GEHA 4QFCA 4XR9A 5DTJA 1KQQA 1QIHA 3P96A 4RA9B 3GMDA 1V8BA 3W2FA 1GA4A 3TIVA 1U2DC 3IXLA 3T5GA 1QC5B 2JGMA 3B36A 4FOSA 4PRKA 5IDVA 3CX8A 4JJEA 2G76A 1MVLA 4W5WA 3MUFA 3QFSA 2VJOA 4EDFA 4I36A 2P3OA 2ATEA 2VK8A 5EJ5A 2D2XA 5CJPA 4H4DA 3AJAA 1TJYA 3K4HA 2V7EA 4TZ6A 4P0PB 4PL2A 3M1LA 5TR9A 3WHKA 821PA 3W8FA 4E5KA 5DLYA 1ZHHA 3H9BA 1WKVA 3HXQA 2RAUA 3D2BA 3T1YB 4TLEA 1Q12A 1QYXA 4KQKA 4B43A 4M9XA 1YZQA 4ENPA 4A0SA 3NJRA 2E0IA 3PNMA 2ICAA 1LW7A 3WGNA 4NFSA 1PQUA 4ZKEA 3U16A 1RWWA 2AOVA 1F8XA 3W8RA 4OMFG 1PX0A 2WJYA 5AIAA 1ATIA 1PNQA 4L4XA 1OHHD 2Z2ZA 5JPIA 2KVSA 4FS8A 2J3DA 4KEAA 5LDHA 3QZUA 2JFNA 5CA0A 1NF3A 1MO5A 2B83A 3OQIA 5FL7D 5KFXA 1Q15A 1GQOA 4U8HA 5BVHA 4WY2A 4CT0A 3NHJA 2QRGA 1P0CA 3FWYA 5AK4A 3QA9A 1KK1A 2CSUA 1OV4A 2ENWA 2Q5HA 3IP8A 3KEOA 1TAHA 2DKOA 2YV4A 3PC3A 8ICJA 2ZUTA 1PF7E 3QPWA 4WK0B 4BGIA 3ZJTA 2Q46A 4M9GA 2ZYIA 2QI9F 3A1UA 3R7BA 1AX9A 3AETA 3RT7A 1UF9A 4DR6B 2VAPA 1SCUB 4KRFA 4CM4A 4QPJC 4P4PA 4N3CA 4AX8A 1TEXA 3VSDA 1UBNA 1NQTA 1K6IA 2VUHB 4BDPA 1TAMA 3NIGB 5FTMA 1MQ2A 1PW7A 3IPYA 3V33A 3E1SA 4CM9D 1E0AA 5BYJA 2AYZA 4X94A 1UBHS 3PE3A 1Z5OA 5CXXA 1PR6A 1XZIA 2EZXA 2ZIVA 3IOMA 3MCAA 4PLZA 3RRBA 1JG6A 5JNRA 4PF1A 5DGHA 1PEDA 1Z7BA 3KZ1E 4CKCB 3WLEA 1ODTC 3A0UA 4O5KA 4P7BA 1IM8A 3JV7A 2HCBA 2GEDA 2NT3A 4YJGA 3A11A 4WACA 2OH2A 1I6KA 4J2OA 1ABBA 5BWBA 2VRCA 2GZMA 1EK0A 3V8MA 2PCLA 4JI5B 4EA8A 2V98A 4PFSA 1R5BA 2VHCA 3C39A 5D84A 4W1RA 5CDUA 3IT3A 3ZNQA 1UEXC 2LV8A 3R8FA 2F44A 5FUMA 4F4XA 2VRNA 4ECQA 3EYAA 2D0OB 2FN4A 1MJGM 1EHYA 2KM1A 1Z25A 2CJFA 3CJQA 2WWFA 1BMFA 3B6MA 4FGZA 1NN3A 3W8DA 1G4UR 4A4DA 2JF0A 2XVAA 4UUAA 4XSHA 5D51S 1GRNA 2C7GA 4TKUB 4P36A 2O2EA 4XWYA 3BE8A 5U4QA 3KX2A 2EX1A 5FBWB 1MB0A 2FX3A 3VR2A 3TVDA 4UVIA 2XIJA 1DIAA 3RVKA 3IAM1 3GLUA 3LQFA 1LJ8A 3ASZA 3D7MA 3NVVA 3OEED 4KXXA 4UPDA 1JALA 3GLIB 1SZJG 4UBIA 4C4TA 2Z3WA 2XNDD 3EDYA 3N3BC 4LYEA 2G6BA 5KFIA 2H65A 3ZGXA 2JLCA 2OCAA 3KU4A 4YMLA 4LJ7A 2O2JA 3VUFA 4O2AA 2AF4C 3LSTA 3CSSA 5DYNA 2Q45A 2VJQA 1K7CA 1JAYA 4LRXA 1DAOA 1YZ3A 4IJUA 2GZ2A 4I2CA 4UBKA 1SCDA 3PR4A 4PC6A 1I2ZA 3RKSA 4CCYA 3RRHA 2GPBA 2Q9CA 1U0NA 1TGYA 4QQRA 3OLVA 3QJGA 2CDRA 5DBEX 1TZMA 4BEBA 2R8OA 1P44A 1E2GA 3LBNA 1FTSA 3IAAA 4DCUA 5BN4A 1XROA 1C7RA 1LI5A 3WJ2A 1WZ2A 4Q3EA 4G09A 4JOSA 1NKEA 4O2LA 3I9NA 3ND8A 5I4CA 2ZXFA 5FWXA 4MGZR 3VU3A 3PMNA 2UDPA 4LC9A 3V6KA 2O54A 1JZSA 3UCFA 4XFDA 4L3OA 4YXWA 4BZZA 1Q6YA 3GXOA 5AIBA 3EGWA 1GSHA 3H9UA 3MRXA 2UZ3A 4WUTA 4RT2A 1V37A 2Q5JA 3G1WA 3OSUA 4MV9A 2Z1MA 4E5NA 5BSEA 3MTGA 1Q7EA 1HE3A 3SMQA 4ZTUB 4JI0B 5THQA 4EBBA 1B3RA 2WKRA 4JBNA 4TS4A 3RVBA 5IEJA 1XYYA 1KEJA 5KFTA 3JQ6A 5LP1A 1Y81A 5ITWA 4GQIA 1FU8A 4V2UA 2P9HA 2X4LA 4XD7A 1J5PA 3WXMA 4UCFA 3FN4A 4QO7A 1OWOA 4FFWA 5IMBA 1WA5A 2HGSA 3MSXA 1KE2A 4MVJG 2MUTA 4KXYA 1OC2A 3TOSA 3V8BA 4I2IA 1XDSA 2WT8A 3VX3A 5CA1A 2NO0A 1PQPA 3KG2A 2WMNB 2H3VA 4DWIA 4ZVQA 4PHTA 1ZQTA 1LY1A 2YINC 3RVRA 3TZLA 3WKAA 1DU4A 5KFHA 1UK8A 3VVBA 4EY7A 3EUWA 1P7DA 2XOKD 3O8OA 1E7QA 4XB6B 2A9JA 2P8SA 1TAQA 4ARUA 3IIMA 4EJMA 2FPIA 1CXZA 4NPCA 3UHOA 2VXBA 3Q41A 1QF6A 3F73A 2PLAA 2OT3B 5T8KA 1KW4A 721PA 1N33B 1T3NA 3DWGA 1INLA 1LC3A 1ZQEA 1NMYA 3ZY2A 1UFOA 2NW6A 3CH7A 1NXTA 3THXB 1NKTA 2VATA 3CRVA 3PHGA 4B9VA 3KLPX 4OP2A 5TB5A 4HNAB 4A6EA 4KR6A 1RXWA 1H6DA 3KEQA 4FQ8A 1V7CA 4C6SA 3DBRB 2HNKA 4KIFA 3NHYA 4R41A 4RIFA 5GVSA 3Q8MA 1XXHE 2ATVA 4LDRA 2FRXA 3EASA 1YJ5A 3TN7A 5EIXA 3VOBA 1U7WA 4KREA 4PC1A 1DP4A 2IW1A 2ZR8A 5KG4A 2YBEA 2WYWA 2QORA 1NVTA 3QKSA 3QWBA 2B99A 1SD2A 4UB1A 2ZI9A 4CBVA 4M9QA 4PLCA 3R9KA 3H05A 4CDRA 2W2XA 4R71A 3WK6A 3NTUA 1T5HX 4ZGGA 2HK7A 2J3MA 2TMGA 4P86A 3KR2A 5L3VA 3TZ6A 4AC9A 4R63A 1ZMTA 3BFXA 4QM6A 2F1KA 4BLTA 3ZCSA 4DNOA 1RZVA 2OBXA 4QU9A 3ES9A 2E4YA 4UB5A 5EJ9A 1YFKA 2VF5X 2XT6A 1MIHA 1UJ5A 1AN0A 1ULHA 3KFUF 2XRYA 5FAXA 4CUJA 1DAPA 2GJ4A 2OWOA 2B34A 3OZ7A 1RQPA 3K2IA 4HNQA 1VPVA 5BORA 1PRYA 1VL8A 5CRIA 2J4CA 1LA2A 2KQUA 4CEHA 1QLWA 3PXEA 4BAUA 4UBOA 5K4HA 3PV8A 3CR7A 2UYHA 3TW4A 1FP7A 3VXKA 2POQX 1E1CB 5CA0B 3ETDA 3LPNA 4NY8A 4JUDX 4QUGA 1PP4A 3D6HA 1HE1C 2E48A 5FTNA 4CCWA 1Q50A 2PZGA 3HDJA 4G1BA 2NADA 1OCEA 5AM0A 1XA4A 2R11A 4LDPA 3BMQA 5LYYA 2ASJA 421PA 4IICA 5IHPA 3PSFA 1DCMA 1H23A 4PYOA 4DLYA 3OT5A 4W7IA 3OF5A 5IIKA 3DVLA 4R1TA 5EOZA 2DF4B 5H68A 4MLDA 4AN4A 2C2ZA 3VV3A 4A10A 3A6LA 7ICJA 3QUCA 1P2GA 3O83A 2OFXA 3RS8A 1RKXA 1QONA 4LRYA 3RS9A 2ZE8A 4H3VA 4L78A 4I1PA 4LF5B 4AG5A 5E79U 4DS4A 3L4KA 3EDMA 5DM4A 1F2DA 4ZCMA 4G4GA 4KRGA 3RC1A 2W2NA 3DR3A 4TN1A 3F90A 2QGZA 4M9RA 2VP4A 3K1TA 4OFXA 4FT2A 1P6QA 4F4KA 1P9LA 2RHHA 3OOHA 3IDQA 4Q3DA 3WA6A 4R2HA 1P5JA 3C3MA 2DB3A 1COZA 4N0QA 4FD2A 1D2MA 3GNTA 1NPTO 4DPMA 2BEVB 4FDLA 3ZGNA 3FUUA 1J7JA 2WFLB 1T0BA 3RLFA 4KFUA 3T3OA 2V6IA 3SJUA 3I9V1 4OOEA 3GC6A 3K0CA 4J0HA 4RA9A 5DN6A 5E3HA 1CVRA 3AERA 1UP7A 1MHTA 5AHOA 1E1RD 2I2FA 4P3YA 2XIDA 4RD4A 4RKYA 2ZAYA 4LG1A 1G18A 1SZDA 2TMYA 4FCWA 3R0XA 2X77A 4TUYF 1WDTA 2QVXX 3IEPA 2JRCA 2AE1A 3LZ6A 3TLYA 4BMSA 5FLXA 2KHVA 2BR4A 2YHIA 3IP1A 4JVNA 4EYOA 2HQOA 2GILA 5BPFA 4R0NA 3VJLA 4FNMA 2VAMA 3AEUB 1H9CA 3T1OA 1Z75A 1Z0FA 3FYDA 1OLSA 3HJHA 4JN6B 1WHSA 5CYFA 4O0LA 2O3RA 3RJ9A 1MAAA 2DE0X 1G6HA 3ECSA 2VDLB 4CMAA 4J7UA 5ED4A 1XWFA 1VB3A 3A9RA 5AKEA 2OD7A 1DTWB 4HNHA 4MTLA 1ODLA 4R8MA 4P54A 4D9BA 3PUWA 5IIMA 1J9ZA 3FDZB 3HILA 3PDJA 1IUPA 2J3HA 5I7OA 1A82A 1NJXA 1C9JA 1ZP6A 1ZM2A 3DZ8A 3ETEA 1K5HA 3GVHA 1H0RA 3RSGA 1OD6A 4ASUD 1LFDB 3EXFB 4QUDA 3VM6A 3CLKA 3L7JA 4Y2XA 4K28A 1PR0A 4NG4A 5AVRA 2IJGX 3RAQA 4BN0A 3PZRA 4FZRA 3CYFA 3EFOA 2PQ2A 3WAGA 4FVTA 3PWKA 5K6TA 3E9EA 4DA6A 5JBIA 1N5OX 1RLUA 2CNBA 2EF1A 2JKZA 3IJ5A 1I6MA 2OBLA 2XA1A 4QDJA 4CMGA 4KBYA 2FDXA 2GESA 2HBLA 2E9SA 4F5DA 4ZDIA 1Y8CA 4KV9A 1F4PA 1T2VA 4MWDA 5EZYF 4WFQA 4Z49A 3A1EA 3T9DA 3H1EA 1Z08A 2O1SA 2XE6A 5FBRB 3CLUC 1QH8A 1FJXA 1VXOA 4I1OA 1XAGA 3EVFA 3K0CC 4JQZA 1UHUA 3TI9A 4WFJA 5L7TA 1A1VA 1IOLA 2XIQA 3QH4A 5JZMA 2ZU0C 4GZLA 1SVMA 2V97A 5CVTA 4LRSB 2IOHA 1L5VA 1USUA 1YL5A 2AI3A 1KOFA 5KJ6A 4CIWA 1UJMA 4HYKA 1AZSC 1O97C 2P5TB 2PZMA 4MROA 3SKXA 1QU2A 4H6PA 3OIVA 1N0HA 3ODGA 3EGOA 2X42A 1ZD5A 1TK3A 5JC8A 1MSWD 1JE1A 2CHGA 2EW1A 1VI2A 1AHPA 5D4BA 2YYYA 2G9RA 3PEUA 4K6HA 3Q8XB 4GNRA 1U7HA 2VNKA 4C4PA 1PS0A 5AW2A 3QU9A 1HLGA 2IZ1A 1B6GA 1A2BA 1LLFA 5IZ4A 3ZCPA 2CJWA 1GCGA 1TLTA 4UNIA 1NN0A 3SJBA 3UBMA 2QF7A 3VV2A 3WSTA 4FDMA 5B5EU 1UBTS 1MMFB 1IG0A 1I4EB 4NICA 3UG6A 1E2BA 4P5PA 5J58A 2R8ZA 5A9SA 1N57A 3WZLA 5HTOA 2PANA 4IXNA 5ERYA 2QMYA 4AQ7A 1WEKA 2B30A 2PY6A 2WF8A 2IYAA 3BM5A 1HNXB 3SJZA 1NMEA 1G55A 3DT9A 4PG8A 2BR0A 1P4SA 3VHLB 1NV8A 1KNXA 4AYBC 3ZGOA 1RTKA 3PQ4A 3G5MA 2ZG6A 5HNKA 4TV8B 3SR4A 1NBAA 2AFHB 3IUQA 4G1VA 4MCIA 4US0R 1O94C 5SY9A 3WNCA 4BV8A 4ED3A 4ES6A 2OO7A 2D7DA 2KOBA 2DULA 4D44A 4YJ3B 2XEDA 4DDUA 1XA0A 1GFZA 1XPJA 2NTJA 2WVAA 3FBTA 3N39C 5IS2A 3RLIA 3R23A 1Y98A 3KKZA 2PD6A 2KFZA 2HTEA 4G5RA 2JJQA 3WYEA 4BQNA 3BORA 1YB5A 4HFMA 3FWZA 4GR9A 2Y1XA 3URMA 3GGJA 2FPLA 2WYIA 4B3SB 2P78A 2HHTA 5IRCD 1XXHB 5ALOA 3B1JA 5COBA 1FUEA 3R9IA 3LOUA 4AS1A 5K6AC 3OLQA 3H0MB 1YS1X 2E1FA 2FHPA 3D64A 4QOHA 3PCXA 3KNZA 4WZAE 2IHKA 4GT1A 2R25B 4JVMA 5DSTA 1Y7PA 4CZ2A 1ZQJA 4P5DA 4OQEA 1QSLA 4IRCA 4HX2A 4MQUA 2FRDA 7ICUA 4C8LA 4POAA 1KGSA 2VBCA 5J23A 4Z51A 5J8YC 1N4DA 4Z4CA 5KSWB 3K5HA 2WABA 2J4DA 3RF7A 1GQQA 3T1NA 3ZCRA 4D43A 2PZLA 3F5FA 5TNXA 5K4GA 1BIFA 5BT9A 4ZQCB 8ICRA 1Y5MA 3HYRA 4E03A 4C0SA 4AZWA 4RX1A 2NRXA 1IXZA 2YWDA 3A7DA 3OFJA 4UEOA 1Y9ZA 1RWXA 5IAJA 1ZYQA 4BRWA 3TAQA 1BU8A 3F1LA 2P9QA 1SXGA 2ASDA 1AF4A 1SBTA 3CZ4A 3MWFA 1GNVA 4GP9A 1E3QA 1BS1A 5FL7A 5TZVA 1TKDA 4KAXA 1ADFA 4KXWA 1E9RA 2JFPA 4GLOA 2X5NA 2JPDA 4LTNA 4U7PB 4OL0A 4OQMA 4FMDB 3RASA 1F9AA 2I7VA 3GCZA 4WJZA 1TF5A 4K9MA