4BXOB

Architecture and dna recognition elements of the fanconi anemia fancm- faap24 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
196
Chain Sequence
VHVPLGHIVANEKWRGSQLAEEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FANCONI ANEMIA GROUP M PROTEIN
publication title Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
total genus 56
structure length 196
sequence length 203
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17949 PND FANCM pseudonuclease domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bxoB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bxoB01
2AGQA 2UVWA 3Q8MA 2AQ4A 5KFVA 4DSLA 4DSJA 5KG6A 2FLNA 8ICXA 2DFLA 5KFOA 5DB8A 7ICIA 3PW5A 1J24A 3RB3A 4DL2A 5CP2A 4QWEA 2JEIA 3GILA 5L9XA 4GXKA 3PMLA 4KITB 4YR2A 4DL4A 5KFJA 1ZQCA 3RR7A 5KFUA 3BJYA 1BPBA 4M9GA 3BQ0A 1ZQWA 9ICMA 1NJXA 2Q0ZX 3H7IA 4O0IA 8ICZA 4ZH4A 5KT4A 7ICRA 5HP4A 3RJFA 4RT2A 4XQ8A 3TARA 1ZQTA 3IHQB 2R8KA 1ZYQA 5HHHA 2BKEA 1L3SA 3FYHA 4XRHA 1BPEA 9ICFA 4DOBA 1MQ2A 8ICTA 4F8RA 1S77D 4I2GA 4ECUA 4DO9A 4KLUA 3MR3A 9ICBA 1J25A 1BVSA 1ZQMA 5KFKA 3GFKB 5KG1A 4JV1A 4M6WB 4DL7A 1U4BA 3T5HA 4ECZA 4UB4A 2W9BB 3UXNA 3RH6A 1EXNA 3HPOA 3RJKA 1UA0A 5J2KA 1XSLA 4NLGA 4QZCA 3JPPA 8ICEA 3LK9A 5DQHA 2ZTDA 2ZUBA 3SZ2A 5KG0A 4DFKA 9ICRA 5DG7A 2W8LA 5KFPA 2ZUDA 5KFWA 3V7KA 3PV8A 4ELVA 3SYZA 2IBKA 3THVA 4KLQA 1JXEA 1TVAA 1S0VA 3LWMA 4QWDA 1K1QA 1ZQNA 1TFRA 1ZQSA 2P6RA 4YXJA 3PMNA 4B9LA 9ICAA 4RNNA 3PY8A 4F3OA 3ETLA 4ECXA 3PW4A 1RXVA 1HJPA 2W9CB 5KFXA 4ECWA 2IHNA 1TAUA 7ICNA 4ELUA 2Y1IA 1H38A 4BXOA 8ICBA 4TQRA 2ATLA 4RQ8A 9ICOA 5DGBA 4PHAA 3V72A 5DBBA 1U9LA 2R8IA 4Q8EA 4DQIA 3EYZA 5DDYA 3OJSA 8ICHA 4TQSA 4F50A 2W9MA 5J2DA 2HHQA 3KHHA 4RU9A 1T3NA 1ZQGA 3TFRA 5KFBA 2JEGA 4B9UA 2VANA 4QZEA 9ICIA 4O5CA 4O3QA 3LWLA 1SL1A 7ICGA 4QZDA 5BOMA 1NK8A 1NKEA 2I9GA 4O3SA 4RPYA 2IA6A 5KFFA 4UAWA 4NXZA 1D8LA 5KFTA 5F9NA 3GIJA 1ZQLA 2V9WA 3RH5A 4KLOA 2ZTCA 5J2FA 1L5UA 4R66A 5DB6A 4FBTA 4F4YA 9ICKA 4RUCA 5J0PA 5HMLA 2HHUA 5CHGA 2HVHA 4KLIA 2XGPA 5EWEA 1U49A 1X9MA 4KLEA 4RQ0A 2BGWA 3GV7B 1L3VA 3C2LA 3G6YA 9ICHA 4DQQA 3OSNA 5KFAA 4DL3A 2BQUA 3Q8QB 4MFCA 2HHSA 4GXJA 1LB2B 4B9VA 2XCAA 3MR6A 5KG4A 3PW2A 2KZ3A 3MGHA 5KFZA 1HUOA 1X2IA 3OHBA 1KFDA 4O3OA 4YD1A 3C2MA 4RQ5A 4I2CA 3JPSA 9ICSA 1UA1A 1NK9A 7ICUA 4RQ6A 2ZIVB 3ZDEA 3OJUA 4EBEA 2ZJAA 4Q44A 3K75D 4LZGA 9ICTA 4UB3A 2FMPA 3QZ8A 4DL6A 5EWFA 1QTMA 2H5XA 4R65A 4QZ8A 2A1IA 1CUKA 3AUOA 3KHRA 4KN4A 4ED2A 1SKRA 3M9MB 1ZQFA 1CEZA 4PGYA 2HHVA 5CWRA 4YR3A 3C5GA 9ICLA 3TQ1A 5J0TA 3T5LA 3RB6A 1SZPA 5KFDA 1KEJA 3BQTA 2WTFA 5BOLA 1NOMA 4NM1A 5KFRA 3NGDA 4BWJA 4JV2A 1DOQA 4RNMA 5IINA 2VA8A 4EBDA 4B9NA 1BPXA 3ZDBA 1TAQA 4J9PA 4ED6A 2PXIA 2PFPA 2JZBA 4UB2A 1A77A 1BPZA 2B21A 2W8KA 4DLGA 5DDMA 3GIKA 4NLKA 2JPDA 1S97A 2MAXA 4JK1A 4YMNA 4PHDA 4P2HA 4BWMA 4K4IA 2F1JA 3JPOA 4EZ6A 4LVSA 3OSPA 3BQ1A 4DQSA 4IRDA 4PH5A 3MABA 5IIJA 4R64A 4EYIB 4ECRA 1KDHA 3RRGA 4M9NA 3EPGA 2ALZA 4CCHA 1B43A 5IIOA 4F5OA 1PZNA 3RAXA 1T8EA 1TK5A 4QZHA 2V4RA 8ICQA 1MC8A 8ICPA 2JNWA 3C21A 4YFKA 4R63A 2BQRA 1T4GA 5J29A 3PR4A 2AU0A 2KTQA 4X5VA 4MFAA 3MFIA 4M47A 4R8UA 1XU4A 3RJHA 4RZRA 4O3NA 1WCNA 1ZQOA 1XSNA 2C22A 9ICQA 4Q43A 2P6UA 4KLHA 4MEYA 3PX4A 1ZQAA 1ZQVA 3MGIA 1TK0A 3HT3A 5KT3A 1T7PA 1SL0A 2PFOA 2FMQA 1RYSA 4NM2A 4EBCA 4MFFA 4M0AA 4C8LA 4FS2A 4G3IA 1U47A 1S9FA 2PFQA 1ZQYA 2BCQA 4E0DA 4NLNA 5KTQA 4P4MA 4I2DA 3RJIA 4K4HA 3V6HA 3QE9Y 5J0WA 1COOA 5L1KA 3M8SA 4F5PA 2BPGA 2IHMA 4F4WA 3RJGA 2ASLA 2BCRA 4JWMA 1XS9D 3JPTA 1NKBA 4F5NA 2XY5A 1KLNA 4YXMA 3TFSA 1KTQA 3Q8KA 4C8KA 2I1QA 3FDSA 4QZIA 5DG8A 3T5KA 1BPYA 3NTUA 4MF8A 4Z6FA 5KG7A 2M9NA 5KG5A 4QZGA 3PR5B 3Q8RB 4DSEA 1L3UA 4IRCA 4EYHB 1ZJNA 2C28A 2AQ0A 4FBUA 4KTQA 7ICJA 4JWNA 4O5KA 7ICTA 4J9KA 5HMMA 4DS5A 4M6WA 5J0UA 2KFZA 1NJYA 9ICUA 1TV9A 2VA3A 4EZ9A 4Z6CA 1JIHA 4UBCA 1D8YA 1RPLA 1QSLA 4FO6A 3TANA 3UQ2A 5KFNA 5CA7A 1NK4A 4IQWA 1D9DA 2ZJ8A 5L1LA 3V6JA 4DLEA 1ZQDA 4GC6A 4F2RA 4RT3A 1U45A 2XC9A 1XC9A 3V6KA 2BCSA 2UVRA 3ISDA 2DPIA 7ICEA 5D46A 2ASJA 3JPNA 9ICCA 4I28A 1ZQJA 2XY7A 2DPJA 4M9JA 4F93B 7ICVA 1BPDA 2VA2A 4FS1A 4RQ1A 3UPQA 4ECYA 4MF2A 5DB9A 7ICSA 3RJEA 2W9CA 3MFHA 2P66A 4B9MA 4ELTA 3HW8A 5J2EA 2HHTA 1TK8A 1MSWD 3PX0A 4UAYA 3ZD9A 1NK5A 2R8GA 4I27A 5KFLA 1X9SA 1NKCA 2A1JA 3PW0A 2AJQA 5J2GA 4ED7A 1S10A 2MUTA 2ZJ5A 3H8JA 4DS4A 2FPLA 5EOZA 5J0YA 4TUSA 3RTVA 4KLTA 3Q8LA 4NLZA 5J0QA 3QEBZ 5CR0A 4QWCA 5KFEA 4M04A 4P4OA 1Z00A 5KG2A 1NJWA 9ICXA 4DFJA 1QLNA 1S0MA 5CJ7A 4QZAA 3KTQA 3GIMA 5HNKA 2NRZA 7ICHA 3C1ZA 9ICNA 3EW9A 8ICFA 2W9AA 5J0OA 4DWIA 2PI4A 4PPXA 8ICLA 2UVUA 4YR0A 1NK7A 3T3FA 4BDPA 1S0OA 1ZQRA 4KMUA 1Z3EB 1D9FA 1KFTA 4YN4A 3ZDAA 3QEAZ 1JN3A 1V9PA 1N48A 4RPXA 1N56A 4YVZA 2V4QA 1NK6A 7ICMA 3PNCA 1XWLA 4NY8A 2PI5A 3LDAA 1UT8A 1ZQUA 1QSYA 4IQTA 3BQ2A 1S0NA 2IMWP 4F2SA 3OGUA 1RXWA 5D4BA 4K4GA 3GV5B 3RH4A 4KLDA 5DB7A 3GV8B 2KZZA 4UB5A 4J9NA 4DL5A 3TAPA 2ISPA 4M9HA 8ICWA 2ZIWB 5KT6A 4DSFA 3RB4A 9ICJA 4IQUA 4J9MA 4KLFA 3K4GA 4F4KA 3RBEA 4DEZA 4DF8A 1RZTA 4J9LA 2BR0A 1ZQEA 4IR9A 4YQWA 1U48A 2F1HA 2FMSA 2JEFA 4O9MA 4JUZA 5DQGA 2NRXA 3E2EA 3GIIA 5DGAA 3EWAA 2LYHA 3PVXA 2BCUA 5J2IA 4DQRA 2KZMA 3RAQA 7ICPA 3HP6A 4YD2A 5IIMA 1LV5A 1SKSA 1K1SA 3B0YA 2C2DA 4KN7A 3B0XA 4DOAA 4J9QA 8ICRA 8ICVA 4J9SA 2ZUCA 8ICCA 2GWSA 4KLLA 4RQ3A 4I2JA 4UB1A 5J2JA 3ZD8A 3JPRA 4F91B 4I2AA 4Z6DA 4DFPA 3H4DA 8ICSA 4EEYA 1J22A 3MBYA 3PO5A 3HWTA 4YG2A 5KT5A 5L1IA 5DKWA 4O3RA 5J2AA 4F5RA 4QWBA 4YP3A 3V7JA 3C1YA 4ED0A 1QSSA 7ICFA 9ICEA 1AROP 2ZTEA 1ZETA 4GLXA 1DGSA 2BQ3A 4RQ7A 2BDPA 4I2HA 3SI8A 4M2YA 3Q8PB 4P0QB 3KHLA 2XY6A 4KLJA 4XA5A 9ICVA 3H8SA 2R8JA 4B9SA 3AU6A 1ZQXA 4BXOB 1IXRA 3PO4A 9ICGA 4RQ4A 3PW7A 2XCPA 4I2IA 4BGDA 5KFGA 4C8NA 2RDJA 5CB1A 4P0PB 2BPFA 4LZDA 5KFSA 2NRTA 1IM4A 3OHAA 2C2RA 2OWOA 4I2FA 2C2EA 4DSKA 4I2EA 4M9LA 3RBDA 1NK0A 5KT7A 2BCVA 1ZQIA 2ASDA 3UQ0A 2HHXA 1SKWA 2KFNA 9ICWA 3C5FA 5DQIA 4PHEA 5IIIA 1KSPA 5EWGA 3G6XA 5KFQA 3MR2A 4TUPA 1SL2A 4KLMA 1MQ3A 3ZDCA 3RRHA 2ZIXA 2ZIUB 9ICPA 1NJZA 7ICOA 1B22A 3C23A 5TZVA 1UT5A 4IR1A 2J6TA 4TURA 5DG9A 4QZBA 4TUQA 2W9BA 4GC7A 5DLFA 1RYRA 4YMMA 2FLLA 4KLGA 5J0SA 5JUMA 2FPKA 5KFCA 5DBCA 3GQCA 2NRWA 4C8MA 4IQVA 2ISOA 5J2CA 4QW9A 5J0XA 3PX6A 5KT2A 3ZDDA 1X9WA 4C8OA 3EPIA 2HW3A 4P4PA 5KG3A 2HVIA 3UXPA 3M8RA 2FPMA 3M9NB 4DFMA 2J6UA 8ICGA 8ICKA 1A76A 2XGQA 1C7YA 2A1JB 8ICIA 8ICJA 5J0RA 4F4XA 2MUTB 4PGQA 4Q8FA 3TAQA 8ICUA 2XO7A 4YCXA 4ED3A 7ICLA 1Z00B 4QZ9A 1KRPA 4PHPA 4UBBA 2R8HA 7ICKA 1J23A 2J6SA 4UQGA 4QWAA 5J2HA 4I2BA 8ICNA 4F4ZA 1JMSA 4RNOA 3EZ5A 5IIKA 3MR5A 4ECVA 3ORYA 3HX0A 4ED8A 2BHNA 3N97B 1ZJMA 8ICMA 2AGPA 4RPZA 1XSPA 3KHGA 3T5JA 4HYKA 1KFSA 3RJJA 1S76D 3UXOA 3GDXA 2AGOA 1ZQZA 4F5QA 4Q45A 8ICAA 3H4BA 4O5EA 5F9LA 3Q8SB 4ECTA 2RDIA 3MDAA 3G6VA 8ICOA 1BGXT 3C2KA 2F1IA 4QZFA 3N4MB 2HHWA 3ISCA 5KFIA 3BDPA 1TKDA 3V7LA 2KN7A 1XO1A 3H40A 4GXIA 5HHIA 4RUAA 3SV4A 4ECSA 2BPCA 3AU2A 4PGXA 5C5JA 4O3PA 3RB0A 5DLGA 5KFMA 3ISBA 1HUZA 2FLPA 7ICQA 2M9MA 3M9OB 5IILA 4KLSA 4DSIA 2Y1JA 5L1JA 4DQPA 3SV3A 2NRVA 1ZQQA 1Y88A 5D49A 2JZBB 1JXLA 4RQ2A 1ZQKA 1ZQBA 4Z6EA 1L3TA 4JV0A 2PFNA 4B9TA 3QZ7A 4I29A 4YMOA 3TI0A 3IM1A 4DF4A 3RR8A 2UVVA 3H8WA 4J9RA 4MEXA 4IRKA 1WCLA 4UAZA 8ICYA 4ECQA 4QW8A 4DOCA 1ZQHA 2JEJA 4J9OA 3MDCA 3JPQA 4XUSA 5J2BA 5KFYA 5DBAA 5KFHA 4ED1A 1JX4A 1ZQPA 5BPCA 4R8UB 4F92B
chains in the Genus database with same CATH superfamily
3OAAA 4CEHB 5THXA 4FOSA 1H2HA 1WCV1 2GN6A 1XTBA 3VR2A 3FCAA 4UU8A 2JI9A 5CA0A 3EUFA 1TGYA 5BWBA 2XSZA 4Q3KA 3N7TA 5CR9A 3FDZA 1KSHA 2IS4A 1C0LA 3DOEA 1L4EA 4ECZA 3ZE6A 3PGXA 2J46A 4LS3A 3KFXA 3PC8A 2H9YA 3I62A 2NUAA 2HPZA 4X1IB 2CF5A 4P5DA 4BHTA 5LQAA 4CDNA 4RNNA 1MJGM 3T79A 4O2AF 4UCFA 3ZYZA 5DGBA 1KKLA 1N1EA 4PL1A 1HLGA 2IT1A 1F5NA 1PFUA 3TMAA 1OI2A 4O3QA 1H3NA 4RKRA 2XZTA 1UMDA 3GJXC 3RODA 2ZAYA 4QXAA 4LY3A 3VNBA 1FNCA 3D2SA 5B2EA 4DUPA 4LAFA 4KLEA 3JQDA 3V7YA 2XI4A 2VHQA 2REOA 4KYIB 4C5BA 2C3MA 3ZY3A 4DPMA 2VO1A 1B41A 4O2AB 2JGIA 1S9HA 4DLZA 3GT0A 3C8DA 3W7BA 2MHCA 1ANKA 4LV6A 2VTDA 1HDIA 5FWXB 1B7GO 4IBOA 1X80B 1IK6A 4Z99A 4EA7A 4R7GA 4XAQA 2FI1A 4DAOA 1US8A 3KQWA 4ZKEA 4AO8A 1H6CA 2AX4A 1EFTA 1UQRA 4MQ4A 2PY6A 3HDVA 3QSYA 1QLHA 4IZOA 2ZJOA 2F3RA 2YVQA 3FB4A 2FV8A 3JPOA 3QLVA 2WINI 3X44A 2XA2A 2VBFA 1PJZA 4CMBA 1AKVA 2D3DA 2AU0A 3IV9A 3MWYW 4ASUA 2AC4A 1U0HC 4MRMB 5DEOA 1R8XA 5BW8A 2H2AA 1OX4A 1QFYA 1LF0A 4UCWA 4W5OA 2VQDA 1JHVA 4R41A 4C1NA 4E0DA 4EG6A 3QE9Y 1VKOA 4YI5A 1KE1A 1IEQA 2ASLA 3U6KA 2A5LA 1AUPA 3WHPA 3PP8A 5AM5A 1C9EA 3S8YA 1NE7A 1SXJD 3VUEA 3M6XA 1NN3A 3VNRA 4C7ZA 3VZCA 2QLLA 1SOMA 1NNSA 1V8DA 1OZGA 1B8VA 2PX5A 5CFQA 2WF5A 2XOKD 3QPCA 2V54A 4KLTA 4JITA 1KYVA 4HWRA 5CVEA 3KX2A 2J0QA 3ZLVA 4EM6A 1WQ4A 2BMEA 5JE8A 3QEAZ 3OIFA 3WSVA 5FWYA 3UAZA 4F72A 3HPRA 4Z51A 1TAMA 2VRCD 4H1HA 2FR8A 1QS0B 2QS9A 4WKBA 4N41A 1X1EA 4XJTA 4QG3A 3PL1A 2ZWAA 2A3RA 3HP6A 3L40A 3Q6IA 4CU5A 4Q6BA 4TXNA 1MO6A 2LXNA 2Y9UA 2Y66A 4RL6A 4P0QB 4K9OA 3T3GA 3RJ9A 2QN8A 4TSFA 1QBGA 3E0XA 1RXIA 4KG7A 3TI7A 3VC3A 5G4KA 1QFXA 1EX7A 1CY4A 1MV8A 4OHXA 1MABB 2YWFA 2GESA 2O8FA 3AHDA 4DREA 2HD4A 3FPLA 3S40A 1L9XA 5FTWA 1TKCA 3NRBA 5LWQA 4P4PA 1FOEB 2HHAA 2O2DA 1A9XA 2X8AA 5CDFE 3G2MA 3P0IA 1R3UA 3F97A 3I1JA 3OPXA 2RJ3A 4WHMA 3MW8A 4B09A 1C3XA 2EIXA 1DXYA 4E4YA 2XVYA 2IXDA 4DRYA 4TYWA 4C06A 1W0JD 1GXSA 3NORA 1D09A 2BWJA 3SFVA 2DE0X 1TIBA 1C0IA 2H7XA 3O9VA 1C8VB 1YQQA 2YW2A 3I73A 2HWXA 2DU8A 3C8ZA 1FYVA 4NLCA 4RTSA 2DFLA 4WKNA 4U7DA 4JT8A 4KITB 1UF9A 2C4WA 3HLTA 4N54A 2YN4A 2VHZA 3KELA 4YT4A 3ICPA 4GLLA 3ZWKA 4ENUA 3RUCA 2JFPA 3HEMA 3WKCA 1U3TA 1EK5A 2FW8A 3SR3A 4MYUA 3QKSB 3UFBA 4JB3A 3AR8A 3UANA 2X15A 4XSHA 3EC2A 3VTZA 4XVHA 3A4VA 3O1LA 4ZPXA 4Z4CA 4YJGA 4QG7A 4JI1B 1P8JA 2NX2A 3F47A 3FB1A 3PZPA 1ZJJA 1U02A 3EODA 2JKYA 4BQQA 2IXAA 4ZODA 3KJXA 1KFKB 2FPIB 1J33A 3LW7A 1YZFA 1GDDA 2WG0A 2J5KA 1XDWA 3AEUB 3ZBQA 2CK3A 4YV1A 1Q50A 3KLOA 1EWRA 1L7QA 4MIYA 2JDID 3ZNOA 1JTVA 2HO5A 4K6KA 4CM7A 5AJTA 1ESMA 1PQYA 1P0CA 3CX4A 3W2TA 4YWHA 1L9KA 3OJCA 2WEKA 4EB8A 4GZLA 3G13A 4NM1A 2Z1MA 1EQUA 3DZFA 3F7OA 3FR7A 3QLUA 1RXSA 1H1TA 2AFRA 1UJBA 4LF4B 3WGIA 3HY6A 2ZSBA 2IIVA 1W4RA 4L9SA 1E1RD 1FYEA 2VUTA 2X2PA 3WGJA 1ODJA 3RAXA 1XZMA 4R63A 5CRIA 3D8NA 4K1XA 4IY1A 1N9KA 4HDRA 3LJKA 1EXMA 3SXUA 4XCQA 3MRVA 4C87A 4MP8A 3BGOS 3IJ5A 2FSGA 3IE2A 3AP2A 2LDBA 5IK2A 3W0LB 2Q07A 2ZTMA 4TWAA 1NW3A 1O87A 3L93A 3LX6A 1BPYA 3LZ6A 1F06A 4MQ6A 3BN3A 1E1YA 1Z22A 4YFYA 1QGAA 2R6ZA 4NCAA 3O7WA 4LBWA 1VPTA 1TMOA 1X87A 2WFZA 1OV6A 2WJ6A 4RENA 4NH4A 1DAKA 3LBIA 2VC2B 1G17A 1HRKA 3BD6A 3IURA 1AGNA 2AT1A 3WIOA 5KCZA 5AFSA 3ZD9A 1I7SB 3Q72A 4E33A 1A9RA 2Z5GA 4BVFA 1ZEJA 3PXCX 1NNLA 3FKQA 3V4PB 5IN4A 1MAWA 4QOJA 5ADVA 1W9HA 2BTQB 3B20A 5I7WA 2GBFA 2I9PA 1X19A 4MCJA 5JPDA 1IK4A 4D80A 4WV3A 3ZVNA 2W7OA 4CETA 4G97A 1ZQUA 5C4IA 3TBHA 1CUXA 3CISA 5B5SA 3WSWA 2FP4B 4OQMA 1KK0A 1M8KA 3R5KA 1IL0A 2EQ5A 1B3BA 1BS1A 4N03A 2NRXA 3GIIA 3VO9A 3KB2A 5DCWA 1JG6A 3H4MA 2CMDA 3SF8B 3F73A 2W93A 2M6SA 3GZJA 4A1OA 3ZCRA 3BWVA 2CSXA 3VTFA 1BVYF 3M9LA 2B98A 4M9CA 5K3AA 3PGKA 1PRYA 4BGVA 1V7ZA 5YASA 1DEXA 2YS7A 1RU3A 4I2EA 3KUUA 3Q3GE 5DGDA 2I65A 4IQ0A 1REQA 4DLRA 1BFDA 1R0WA 3X1DA 3NHLA 4MP6A 1XZJA 1QCKA 3F6EX 3HO8A 3P7MA 3O93A 4ICAA 2CMGA 1W73A 2VKQA 4AWXA 4PZYA 3LLCA 4GECA 4GFDA 1WV0A 2RH9B 5CM9C 2GHTA 4F5QA 2D2IA 1IAVA 4MPPA 4KSCA 1BN7A 2LNDA 3F67A 1N2SA 3MM4A 5CD1A 2CHEA 4UE3S 3G68A 1NVKA 3AKEA 3LV8A 2PWPA 2WU4A 4M9QA 4DRXA 2W2OA 4BE7B 1OGYA 5IDXA 2AQ4A 1S5PA 4ZCQA 2DR3A 4MUJA 3LA8A 4BC0A 3K94A 5LU9A 3M1YA 1KI6A 1HNNA 4MPDA 2OGZA 3DEKA 1R7RA 3R5JA 3S2IA 3GLGE 4L1KA 3HL4A 1LFDB 2V6GA 3V33A 2XMSA 2GZHA 4EJSB 1FFVA 3A1SA 2FFQA 1KAEA 3R3SA 3STVA 5EIBD 1IDOA 2VSOA 4GO1A 4JJEA 5JFGA 2VHUA 4FP9A 3L1KA 3ZHCA 3SI7A 5DBOA 1W96A 3FRJA 1EX6A 1U1GA 4OO3A 5CBKA 3TR6A 2F8TA 5G53C 1GHTA 2NZWA 4OJTA 5KC9A 4Y2PA 2JKZA 1H0RA 4AAYA 1NHGA 4I3FA 5F33A 3FTCA 5J0PA 2PRIA 1UQUA 2XODA 4MYHA 3PXGA 4WGFA 5AUPB 3D0RA 3OLYA 2XWJI 3D54D 2W6NA 5B7PA 2WHYA 1JZQA 2CFCA 2HXGA 4BNNA 4DCGA 5FYDA 2QTZA 4ZV4A 4M1QA 5HG0A 5AKGA 1LGYA 3NPAA 5I9LA 1XD2A 4ER5A 1RKUA 2ZM6B 1COWD 1ZEMA 2GAOA 4CKBB 1X9IA 2HBJA 5JJKA 5IAKA 3LU1A 1KIFA 5J4VA 1PQUA 2PD3A 4UPEA 2RK6A 1LF5A 2F6RA 3SYMA 1K08A 4OQYA 1DWQA 1YDHA 4IIJA 4JL6A 4XM1A 1C3VA 5AHWA 1RM4A 1FYFA 4BB5A 4G3IA 4J91A 5A3SA 2JIPA 2YMPA 4IKEA 5TF4A 3EE6A 4ENQA 2H1OA 4C8KA 4GNKA 1PK3A 4LFCB 4LJAA 4WOCA 5TX7A 1ZX1A 4GR4A 1DGQA 4Y6SA 2DFKB 3RKUA 1ORVA 2CCJA 1MIOB 3TCNA 3H04A 4EF4A 1LNZA 2JIZA 4GD3Q 3UPUA 4RM2A 3U4GA 3ENZA 5DASA 2IFTA 2HIHA 3ZHUA 4EFNA 2QRVA 3F2IA 2CJXA 2I4LA 4DLYA 5L53A 3MINA 4DLSA 1WUJS 3RSGA 2GEKA 2YUTA 4H7PA 1JLLB 5M3BA 4FFBA 6PFKA 4IGKA 1ORDA 3A0HU 4BDPA 3RAFC 2WYWA 2CSUA 1U04A 4POAA 3TECE 2QL7A 4TZTA 4A82A 3DTTA 1XVIA 4Z49A 1I5RA 1VDMA 3DBHB 3HH8A 2B99A 4JK3A 1Z4JA 5B2FA 2ZIVA 1PNRA 4CXMA 5KX5F 3OZIA 4CMHA 3ISVA 1E1LA 3BRCA 3OOSA 1EKXA 2BFMA 2OPBA 3O8DA 4NQZA 4D9MA 1NC3A 3AFMA 2C5EA 3N6XA 3AETB 3ZU5A 3EQ9A 1WHSA 2NZVG 1PWYE 1ELOA 2XVZA 3RADC 1A4RA 1NUHA 1ZH8A 3EH1A 1NFQA 1ZO8A 1J5PA 2GCGA 3C23A 7MDHA 4HNSA 1E6UA 3O73A 5KX5B 4UATA 1ZC3A 2QN7A 4FM9A 1KFCB 4GHWA 3PNQA 4J76A 4Z7OB 3HXLA 1G3QA 1Y42X 3W3AD 4R2IA 1X38A 4DUZB 3X1KA 4RPZA 1Q15A 1Y4AE 1UBCA 1EGHA 4P4TA 3FG9A 3OZUA 2FA9A 4BZQA 2VAVA 4ESHA 2HO4A 1J2NA 4Y2XA 5C5JA 2VYVA 3O7MA 4YO8A 5JBIA 2FYTA 1DCFA 1MZVA 3QZ7A 3HJTA 4FEYA 2HWYA 5CNKA 1GPMA 1T3GA 5BQOA 4A0SA 3CBGA 2IK8A 2G72A 3N2LA 1CQJA 5LJIA 1GIAA 1MB9A 3PFHA 1T8UA 1ZU5A 1P1HA 3O47A 1E0DA 4QAJA 1BJTA 3AZQA 4TLBA 2EJTA 3HO1A 4D3DA 3OI7A 4QLAA 4TTVA 2XT6A 3V7UA 4TRNA 2W7PA 1OB2A 4RFSB 4N7JA 1VRCA 4FQ5A 1WHTB 5B66U 4QVGA 5L3VA 5IDQA 3VYSB 4R84A 3RV4A 1T1GA 4G65A 2AI1A 4OFZA 1J06A 4HRXA 3UAXA 1N5LA 1CNEA 2EZ8A 4HNGA 3CUEF 1FDWA 4X93A 3W05A 2A5JA 3S3TA 10MHA 2F2TA 3RPEA 2IVZA 3AOEC 4JZKA 1ZIXA 1XZDA 4PIPA 3MJFA 1I0ZA 2YFQA 4PFQA 1H8HA 5BNIA 1UBGA 3FUXA 4IIYA 1KR5A 1E9VA 1TVEA 5D7BA 1ZJ6A 1WNTA 2PMFA 1R6VA 2TYSB 3THWA 5AM2A 3VHXA 3WYAA 1WBDA 1POXA 4NXMB 4KQ9A 2VJOA 3I9V6 5JH7A 1YS4A 4RMIA 2WMDA 3AYXB 4ZJZA 3PSPA 1PTJC 5M7EA 4C6TA 4JI8B 1RCUA 3SE0A 5CJPA 3N8NA 1G21B 4FHEA 4C4AA 3KBOA 2O0MA 4JENA 4I50F 3L6BA 4I1IA 1FIUA 1JECA 5DIZA 2Q3CA 1KPIA 3GJ6A 2FK8A 2V4UA 3B48A 2PLAA 4DYDA 4F12A 4BNXA 2NTEA 5E7MA 6Q21A 5DO9A 3DV2A 1MAVA 3EXFA 3DVSX 3OWOA 5FR1A 4DQXA 2M9NA 1W93A 1U3CA 2XNDD 4I50B 4KTQA 4P0PA 1CR4A 3CS3A 1JIHA 1BDIA 1U45A 2ZCVA 3ERCA 2QARB 2Q29A 3GK3A 1KDZA 5BOSB 5HR7A 1F0KA 5H83A 5C53B 1M2FA 5KYTA 4RLFA 4F2GA 1EFKA 5KSOA 3OLQA 5K8CA 2BF7A 5JASA 3IG5A 1TK8A 4BS9A 2R4UA 3EMDA 2P0YA 5J2GA 4TUSA 3RTVA 1JS1X 1BMTA 3NGXA 3U7IA 4NU5A 5L6MB 1W36C 1HE8B 3R23A 1SXEA 3RFFA 5T3YA 3VV3A 4NE2A 4CM9A 3I9MA 1N48A 3I37X 4YVZA 4D99A 4ESEA 3R7SA 4L3OA 3JQAA 4Y2UA 2HR1A 2D3TA 4XFKA 1PSDA 4PIMA 1YVEI 1ZK1A 3NIWA 4BV8A 1IBKB 4B6FA 2E1FA 2ZXEA 5JCZA 1QLWA 2WJZB 1M34E 4B80A 3C29A 4I5IA 1YJ8A 3DAPA 2KVCA 3CUTA 3T35A 3UMVA 2L5YA 4WBNF 1QSSA 2ID7A 4AZVA 3CKYA 1AK1A 3CLSD 1PJBA 1RPZA 2C7VA 2VJYA 1TK3A 2CXTA 4RY2A 4OJ5A 2ZRNA 3NLLA 4ERNA 3W1EA 5CH5A 2XUJA 2ZIXA 3RCBA 1JE1A 2OPHA 4OHUA 4RE6A 2EV9A 3ZY5A 4LDNA 3B8EA 4ZHQF 4EG4A 2WU3A 3DVLA 3OO1A 5KQMA 3K15A 3B3GA 3ICWA 3MGKA 4WBNB 2JJ1A 2J6SA 5J1TB 4KUGA 4HS9A 3RS4A 3TLZA 5IIKA 4QATA 3PRJA 4QM6A 1RKVA 3IOBA 1NP3A 1GFWA 4G0VA 2PFKA 1M6VA 3GDFA 1ZU4A 3HCNA 3GLFA 1YRHA 2CEKA 2QRPA 1X2EA 5EP3A 4CEIA 4ZHQB 1IFXA 3FIUA 5EVJA 1WCLA 1L5YA 3F2VA 4OHKA 4WJLA 3G82C 3PU6A 1MV5A 4R8UB 2LE0A 3AEVA 4RMHA 5P21A 2OCYC 5LJLA 2HDOA 3HXMA 5I7FA 2XGMA 4QYTA 1RHQA 1QO0A 4XQ8A 4LXIA 5FTNA 2COEA 4X71A 2ZYVX 5GONA 5HRAA 3QPAA 2DSNA 4DOBA 4DSTA 1WCIB 4X5OA 3UIEA 2QLMA 3V8EA 3LWZA 3FC4A 5C46F 5LQDA 4DPLA 3TQIA 5A9SB 3MUEA 3UWPA 4FE7A 2VS1A 4EUKA 4H3HB 3KM0A 5KFWA 4JJGA 2V7QA 3A6LA 4QPNA 1KMHB 2GX6A 1ZQNA 4GZ6A 1JVNA 4RDCA 2POCA 2P6PA 4IEFB 5KFXA 3QUAA 3I0ZA 3NUQA 1ECBA 3FZYA 4LF7B 4EUNA 5HSGA 2E4VA 2JEGA 5NULA 1YIAA 1E94E 3RRMA 4CMKA 5HUHA 2QW8A 5G3ZA 3EXHA 5I47A 1OOEA 4KO1S 4Y9RA 2QSZA 4LGYA 5CHGA 2Y2UA 1PDVA 1ZXIA 2KNJA 1N6RA 4B3TB 1MT0A 2Q6OA 4GWGA 4E7OA 4IDPA 1JZSA 5K4HA 2ZJAA 1E3JA 5KAMA 2Q6IA 3P19A 3OCCA 4FMCB 1CEZA 4F4DA 1D4ZA 2J5BA 3FOBA 1JR4A 4AG3A 1XTKA 4H35A 1FE8A 4EHLA 4TRMA 3CNOA 2W2VA 4ALIA 5BYBA 2GKOA 1I10A 2B94A 1E9CA 1UR5A 1VFNA 1PJRA 3ZZUA 5C9ZA 3UMRA 2PZFA 5ALGA 1CSEE 3W1WA 3LY8A 3B1FA 4MLCA 1OCEA 3CSUA 2P2ZA 1NJ8A 4TS3A 3D4NA 1L5LA 1FW6A 2A5FA 1PX0A 1T1RA 3E5RA 4L8YA 3I5YA 1U2DC 5FPHA 4HN4B 1KJYA 4GPTA 2ON6A 2AEEA 1ZI6A 2DWUA 2LTAA 3N2IA 1HXHA 1KL7A 1FSZA 3HBJA 3TLCA 4DG9A 4M6WA 4CM4A 3QKTA 2EJVA 3T6KA 5HKKD 5IDYA 1KY5A 4HNQA 3LQ1A 5KHAA 9ICCA 2BOVA 5AI0A 3BE6A 4B3XA 2OD9A 5HK8A 3B6JA 3HB9A 1TPZA 2Y0DA 1DOAA 1SHJA 3BK2A 1CJSA 3C1AA 1Q1BA 2JFZA 1DPFA 2O2JA 2PQ6A 1AJEA 5HNKA 2D6FC 4LDAA 3EULA 1JIXA 3ZGZA 5J0OA 2R44A 3N58A 1OLSA 4QOFA 1XRMA 2W2QA 3QVGA 5KOHA 1AZLA 4OJOA 2ORYA 3H6KA 2QPTA 3TAPA 3E6AA 1F2TB 4K1LA 4J9MA 2H2WA 1Z5PA 3D2AA 1ICIA 4A03A 4WGGA 2H1LA 4G2NA 1CIPA 3DPIA 2HWWA 4UHBA 1T3ZA 2WYUA 3D4LA 2Q3DA 4ER7A 3NBAA 2FRDA 3LA6A 1Q74A 4O5OA 4XVRA 3EEBA 1BVHA 2OBLA 4WN9A 1I5OA 3IIEA 2QIPA 1QFJA 4ARUA 5AM0A 2G63A 3R44A 1QRAA 3EFOB 3DDNA 1VDVA 1BHSA 3GUHA 2R1ZA 5DG9A 4W1PA 5JNLA 1JROA 1WUKS 1E2KA 4FYIA 3H0EA 3HB7A 5DGIA 5K0JA 3BXEA 4C78A 1RCFA 3CHYA 3GPDG 2RC5A 3SSOA 5CB4F 2PZEA 5IKOA 2JBAB 3MRSA 4FHFA 1JG3A 1VLHA 5KNDD 2J1LA 4ZA2A 2IXTA 3WNVA 1PJ2A 1H9CA 4DUGA 3EUB2 1TAGA 2IV3A 5HIMA 3SAFA 4U0JA 4O3PA 3A9UA 2CUTA 1RYHA 1UBNA 4QO7A 2AG5A 5BRNA 5EWJB 5I7RA 3M4ZA 4RIHA 1N33B 2HCJB 1A8IA 4HSEA 3DP7A 1TMKA 2J9FB 3TL6A 4FZLA 5J5AA 5KVVA 4EYSA 1VIYA 1JH8A 1BE6A 2XNJA 5C7LO 5CB4B 1LSSA 3D6FA 1SVLA 2HRCA 4OYLA 1R18A 2DETA 2PSSA 2EFEB 3MSXA 5HOQA 4YJ3A 4XYLA 4ZMBA 2JATA 1HNWB 2Z8ZA 1UWLA 3PFFA 4PZ0A 3PV0A 1P2SA 3HS3A 3WGOA 4YHBA 1N34B 1P6QA 3REOA 1FQWA 2G08A 2XOXA 1ZQMA 5ESRA 1W87A 1I0IA 2B3DA 3DL2A 3LM8A 3ASYA 4G0UA 1NSYA 5I4IA 1J2YA 1M8GA 3RSQA 3N8GA 5L45A 5EZSA 1D2HA 2IPXA 2FMUA 2W4IA 3FTDA 4DLTA 4G8DA 4JU9A 1SXJB 1Y7IA 3D4OA 3KT0A 4GUAA 2I55A 1SM4A 5IF3A 4Q12A 2HPVA 2ZWVA 4BAUA 3OM8A 2OYYA 1EI9A 5CNJA 1GJRA 1TA4A 1F8XA 1GQQA 1GGVA 5IEBA 5CG2A 1CS0B 3EAFA 1W8IA 2ZKIA 2ZB8A 4F4YA 4CZ2A 4K26A 1IJEA 4BFXA 2CNDA 5I4KA 3RROA 1HLFA 1Z29A 2YX1A 2ZSJA 1NPTO 3REFA 1NK9A 1N6LA 1USUA 3AJEA 3GUZA 4KE7A 4YAOA 2HK9A 1IG6A 5LBUA 3W8FA 4LYDA 3SN6A 4DSUA 2KB0A 1NQUA 1BPZA 1MR3F 4E7PA 4AN4A 2FF7A 4J16A 4TVOA 3GT3A 2WZCA 1SBZA 4AKGA 4F5OA 3NO4A 4R1OA 2AG1A 2KTQA 2OM2A 4CF3A 3KFLA 4KKXB 2KHZA 3JQ7B 3HBFA 2BCGY 2LR0A 2XWBF 1ZQ1C 1XQ1A 4HEHA 3HJFA 3JTEA 4QOIA 2JIRA 2NGRA 2I1QA 2ORWA 2ORED 3RYHB 1DTWA 4J0CA 1RNLA 3ENVA 5K3FB 1NW9B 3ZQJA 1TLFA 4H16A 5KVCA 3UXMA 1KZYC 4U2DA 1OVMA 4LRXA 3SEFA 5EC8A 3WQSB 1NXOA 3KHSA 1PYOA 1NMXA 1P60A 2P66A 4F6RA 4NKRA 1Z0DA 4ZVMA 3SHFA 3T9FA 5FDFA 4BO4A 2FR1A 5CYPA 1AUOA 1S0MA 3FHOA 1KJWA 3RSSA 4XR4A 1A9SA 4DWIA 3RS8A 2VYFA 2BGGA 1HQYE 1M0EA 4NMMA 3BOSA 1NV8A 4OXXA 5EP1A 3EVAA 4DR6B 1TF5A 1VQ1A 4YJHB 1K7XB 2Z4RA 4LW8A 4LHEA 4CI9A 1PG5A 5H3LA 1LK5A 1V6AA 1PGJA 4IS7A 4NJMA 2BH2A 3FHCB 3HDJA 4MGZR 4U00A 1K6XA 5EERA 1N9ZA 1W46A 3NWOA 2LYHA 3FUVA 5DP1A 4XYEA 2B5OA 1OXUA 4JUCA 2MJLA 3LKBA 4GC9A 1A2KC 1AS3A 2ZS9A 1E20A 3KKKA 4CIXA 2XY6A 1KC3A 4E21A 1IV8A 4IIVA 3KZ1E 1LQUA 5CB1A 1T0IA 4YR7A 4E5UA 2ZT7A 2YWEA 1KI9A 1YZ6A 5KFQA 4IMJB 1BDJA 1SCKA 3HJHA 5GM2A 1CUHA 4CLDA 2DY0A 3LXXA 2FG6C 2UZ1A 1NIJA 4I9UA 2QRQA 2N1BA 5IZCC 3GGOA 5KJFA 1NMYA 3JQPA 3HUTA 1QTIA 1P0PA 3N8HA 3O95A 2H5EA 2FQ1A 4ZMRA 4HR7A 4CLOB 4X41A 3WWEA 4PGGA 3FMVA 4DKJA 1NMZA 4Z3OA 1P5HA 1M72A 1CETA 4TYPA 3AVVA 4X7BA 5B4TA 3LLMA 1T2UA 5CU7A 1JDPA 1JEQB 4DBVO 1ONNA 1GYQA 3WL3A 2PYZA 3UG6A 1IZ7A 3U3MA 2CLDX 4PNEA 4YV0A 1BXGB 4BMOB 5AVQA 3P71T 1C2TA 3THSA 2BGMA 1RRCA 3SBDA 3EPPA 4TMVA 3TEJA 5E38A 1WUDA 3QA3E 4CKEB 4J6EA 4ILKA 1TT5B 2IP2A 3F8SA 4Q1BA 4AZSA 4TKUB 3IAEA 1G8KA 1IZ8A 1M83A 2AHRA 3L8GA 2PUGA 2GLEA 4KW7A 4DO9A 1IN7A 2JI4A 5GOZA 1QVWA 4DJTA 2IZ1A 5K0BA 5B3KA 3NDBB 2JKVA 1HSZA 2HYDA 1B0PA 3L7JA 4KN9S 2FB9A 1NM5C 4AZ3A 4RGQA 1WXIA 3EVZA 4F21A 2G9VA 4Q8EA 1TZJA 4LCJA 4EX7A 3QX8A 1L1FA 2UXBB 1EFHA 2DF4B 4GLFA 1QC5A 1XO0A 2KPOA 1VSUA 3GV0A 4URWR 5F3XB 1IVYA 5BOMA 3GCGA 4HFMA 4DCTA 3UMCA 3EF0A 2VH5R 3ETCA 3M89A 5J2TF 2JD1A 3PSIA 1W30A 5KFAA 3RVPA 2GERA 2VA2A 4O3OA 3NGMA 2QD2A 5EI5A 1AC5A 1XRNA 2VDVE 3SQLA 3ZR4B 4RPJA 4PZUA 4EBEA 1E7SA 3RUHA 5LQJA 1P39A 3RIMA 2UYOA 3AUOA 2PIDA 5L40A 3W06A 4NAUA 1NV9A 5TQVA 2JW5A 1XNRB 4FZVA 3A26A 3LP8A 5KYNA 1BXRB 5EA2A 5HKBA 3DFMA 1TJNA 2J6CA 2C00A 3QU2A 1ADBA 3AY3A 3DEJA 5J2TB 4RKYA 2R6HA 4C9BA 5IAEA 4BPBA 3I9V1 2ALZA 3MJ4A 4QU9A 2JNWA 1DO8A 1IN6A 4N0QA 4OA8A 2C4KA 4FCTA 4AYTA 3HSSA 1ZQOA 3LKVA 5KTOA 4HYYA 1C0KA 1EUDB 4C8LA 3PVSA 1TJPB 4BBZA 4ETNA 3Q15C 4QUKA 5LBIA 2N46A 1IWPB 3O26A 4ENPA 2UZIR 4OQZA 3F0TA 2R1UA 4CYMA 1AQUA 4EZBA 3I8SA 3GLRA 3IV6A 4HNAB 4X20B 1DO2A 1JDBC 2UVRA 1HIWA 3CW2C 1EGVB 1O6ZA 2PD4A 2QM0A 2I1VB 3QPVA 1ZLXA 2BZFA 2HA5A 2JGMA 1D8BA 2OCGA 5BY2A 2R751 5KJEA 5JDIA 4HQKA 3FSGA 4JLAA 3OLCX 1DJQA 4H7IA 4NZZA 1XTVA 3E9MA 3W6UA 1UXJA 2XMQA 2WNSA 4B0PA 3IALA 1U5BB 4L27A 4XD2A 5J59A 1R6UA 4LHZA 3Q7RA 4CMIB 5AW5A 4R1QA 1RXWA 1TAHA 5CNIA 1GNTA 1QOZA 1J0BA 4IAOA 5BVHB 3JVEA 3TK1A 1Z45A 3NHKA 3AOEA 4HRVA 2Z2YA 2O8DB 4HB0A 1QIFA 1GZ7A 1SQGA 2OUIA 4DBLC 3B6ZA 3L7NA 4FZNA 2UXCB 1TO6A 2DQKA 2XUPA 1M6HA 3ZYCA 2WZDA 2JIQA 1DG9A 3LWDA 4NULA 3J7TA 4Q1CA 4FI3F 4EF6A 2PH7A 5TVKA 3A8TA 1RYNA 4Q9AA 4YGXB 5KNCH 3KTOA 2BF4A 2JFOA 5EFOA 4MR9A 3H16A 2ZRHA 2J48A 3BEDA 3R5SA 4MQ5A 2P35A 2VXBA 2WD7B 3HADA 3IBGA 4KRYA 4K0KB 1NZDA 5E3HA 5J0SA 3BXXA 5KSWB 1GTZA 2CUZA 4H7FA 3ODPA 1YC2A 1FYDA 5GOTA 1R12A 3CXRA 5CK4A 3TNDA 1HT3A 5LD2C 3AIIA 1Z00B 3R0JA 4LYYA 1H3EA 4ZDJA 3AVQA 5FEMA 1UOQA 2GASA 1QH0A 2HGSA 3X2SA 3RJJA 1XKXA 1IXKA 3UMGA 1WB5A 3R6WA 3K6SB 4J3FA 4IIGA 5EMNA 2NSHA 1L3BA 1NN1A 4Q03A 1UC8A 2JLQA 1T0PA 3W2FA 2PXAA 5TMBA 4TTQA 3HFJA 3DLCA 3MXOA 1XLVA 2H06A 4ENWA 1Z8NA 3JPQA 3G1UA 2A19A 1JWAB 5LU8A 1XNHA 1C30B 3PSFA 1XELA 2FWIA 3MEQA 1GQFA 5JSYA 3H3FA 4LY9A 4E5MA 3HKBA 4BTLA 3BJYA 4WAUA 3HXQA 4C76A 4PWZA 4Y6GB 1UDXA 4CQLB 1PD0A 8ICTA 3MK31 2FWMX 2AOVA 1U4BA 2WP0A 3P9NA 1F6WA 3ET4A 2ZWOA 1JF8A 3B9PA 1D04A 2PLWA 4TLMB 5KTPA 1HT1E 1WKVA 4AP6A 4N3BA 2JCYA 3NOVA 1Z7GA 3TAXA 4RHUA 5D2CA 3FVQA 1DAFA 3JZFA 2VXOA 2AC2A 4UBMA 4RO0A 3PKJA 1IMJA 5HZHA 1P18A 2PMWB 4ARIA 1X92A 2EFDB 2CXNA 5FOUA 1DZ3A 1KEWA 2IVFA 4ER0A 3DXXA 1DCMA 4TV9F 1E62A 2XXBA 2OP0A 4A91A 4J2HA 3IP7A 2FEPA 4ZAYA 4MSUA 1UA1A 1D4FA 3UMSA 3BL8A 4RC9A 2ZE8A 3ND9A 1G8FA 1MN8A 2FWJA 2G09A 1XP5A 2HHVA 1LDYA 4GXNA 2IPOA 3F1KA 4D8WA 3QBEA 2FWBA 3GIKA 3DZGA 2OO5C 4Y9TA 4MS4A 4F1KA 1FSSA 3D1LA 4TV9B 1D6SA 1MO3A 4HDSB 2L18A 1FP4A 3VHQA 2WSSA 1WPGA 3PR4A 1O54A 4GICA 5CIQA 3P9KA 2N9UA 2QX6A 2OL4A 3PPYA 3BGVA 4BCBA 5CB0A 1XMJA 2GAIA 3DGFC 3NS7A 3QJGA 4JOCA 5JATA 3HBMA 4EBCA 1FLVA 1QQAA 2ERCA 5B3LA 1TYDE 1STOA 2PUTA 3TFSA 5DI3A 2FLWA 5A02A 3S2UA 1SUBA 2IH5A 4BNVA 3T5BA 4PSAA 4HEJA 2OBBA 4AUEA 4DLBA 2D1FA 2Y9PB 3IR7A 1QQ6A 3A2NA 5A0LA 3SLRA 2QZZA 5BW6B 1PJCA 2IWHA 3AVUA 4BKMA 2EJWA 4FNAA 3DF7A 4WADA 3TFWA 2E2WA 5IBPA 2Y0PA 4UUMA 4JSRA 4JI5B 1JVSA 2AI3A 1Z4PX 3GRZA 1BDMA 4BNIA 4PPXA 2O57A 2A9FA 3TLEA 3QVTA 1S0OA 4FDAA 1U7DA 1RAFA 3O31A 1KH2A 1XROA 4BFWA 2B9EA 3M6AA 2G0TA 4ZTUB 1DMRA 2BFDA 4ZYYA 1TIPA 1RHUA 2FGKA 1LVUA 4LQ4A 1Z5GA 4WZAB 5B7QA 1JALA 3L3FX 3N2KB 4DABA 4I2JA 1RBYA 3OUTA 4ROTA 3ZD8A 5L1IA 1YC5A 1F4LA 2ZTEA 2GUWA 4RV4A 1YJAA 2HAEA 1H8EA 4LZWA 3BXZA 2VQ6A 1NXTA 1QHEA 1A8UA 1WD7A 4OKSA 4AS2A 1UMCB 3NH9A 2VIIA 3WMEA 1WQ1R 2H6EA 4HN9A 2XQFA 1T8SA 3QUSA 3G3EA 1R5NA 5DK4A 4C8OA 2QVCA 2DJIA 2P68A 3FLEA 5DHRA 2A1JB 4HNUA 3SMQA 4PGQA 1XVUA 1T9CA 2GZ3A 3RYIA 1QGZA 2F8KA 5CH8A 4JU8A 3VYTB 5DLPA 1IXSB 1XEAA 1MH9A 4IVRA 3WYEA 3SX0A 1J00A 3H4BA 3T1QA 2HK7A 4EUEA 4HNRA 4H7JA 4DOMA 2VPQA 1OQAA 3GJ0A 1A8SA 5TQ0A 4A8JA 5EKXA 3MTQA 3NV9A 1RWKA 2Y77A 5D3MB 5DLGA 5FBHA 4BJQA 2EXXA 1OC4A 3U17A 2ONKA 4WDQA 4P92A 3NR2A 4G09A 4BB0A 4A27A 3CQ9A 1CNMA 7GPBA 3OWXA 2Y92A 4E1AA 4OX9Y 4GYJA 3F6YA 4IFIA 2VF4X 2QKYA 3KKLA 4G1UC 1NBMA 1FSPA 1T4CA 1ZUD1 4ZV7A 4GXKA 2P11A 3C41J 3GLFE 2CUKA 3AERB 3QKUA 2JFQA 3HP4A 1BHJA 2XRYA 3HB4X 4LNUB 1DC3A 4LTNA 4WIAA 1V71A 2H1FA 1GR0A 4MV9A 1JLHA 4M2LA 2FUCA 2OCDA 4DSAA 1XX6A 4AY6A 3ZK7A 4RXTA 3GH1A 2C4TA 3V1MA 5L95A 1XRSB 5J58A 4H08A 3BKXA 4CTOA 4OBXA 1EA5A 1PGOA 5CDHA 1H4TA 3N75A 1KP9A 4Z9BA 1P3Y1 4QHTA 2X23A 1IC6A 1KYIA 3PHLA 2IUSA 3MJRA 2W90A 5KYKA 4LC1A 4UFPA 1ATIA 1I4OA 2NO5A 1WCXA 4JFAA 3OQIB 1N2XA 4E5KA 5GV8A 1JJBA 3NAZA 2IHBA 4EYOA 2WB1F 2WWTA 1UK9A 3EAQA 3CRW1 1WMDA 3KTFA 2UVQA 1AGYA 3KVRA 3HBAA 4ADSG 4BO7A 2EYQA 3EW7A 4O5AA 2XYHA 2DKOA 4MOWA 3WE7A 4E09A 1B23P 4B9NA 4BLRA 3CGWA 4DMGA 1NXSA 4Q5IA 5DDMA 3IP8A 5E1BA 2EZUA 2OHIA 2GTHA 4DLUA 4UTVA 5J29A 4B4WA 3QF4B 1E4YA 2VP5A 1GNQA 5LZ8A 4HX2A 5KT3A 3RJ5A 4AYBC 4MFFA 3A14A 5FEUA 5B57C 4UEWA 4CT5A 1K4KA 4Q4AA 2VJ4A 4RCYA 4COKA 4FQ8A 4PHTA 3PVZA 1GPNA 4R2MA 3QX7A 1NBWB 3RAPR 1LLQA 1MGOA 2GRAA 4P2GA 1KEPA 4IQGA 5K3BA 3OTIA 3OC0A 4BLUA 3DE6X 1TO2E 4LNAA 2AN9A 2ZSFA 3E2PA 4TLDA 1PR5A 4EIWA 3SZLA 2OFOA 3RS2A 3OLWA 3P0EA 3WDSA 2QR5A 2O0LA 2YXBA 3IUNA 2R8GA 2WD9A 2RGDA 4MHTA 3IT2A 1H42A 4XYMA 5DOVA 5KVAA 3BWMA 1HE2A 1IEXA 1PG0A 4HWKA 1KYTA 4M1EA 2AS0A 4DJAA 2HEGA 5AOAA 3ZDZB 4KMUA 4OXYA 5B3JC 4RL4A 3M5CA 4O2RA 1ZOSA 3ED1A 3WLLA 1AGPA 4PCLA 2Q5QA 3MN1A 2ACKA 2ZXFA 4BMZA 4DR7B 1NZPA 1M5UA 4YDHB 3G89A 1TA9A 4HDNB 3MZ0A 3D7SA 1P2UA 2QVBA 3KWLA 2RI0A 3S7TA 4Q15A 4QUDA 1W1WA 2DUUA 2VJKA 4C8NA 4QULA 3E9CA 3OSUA 3H0LB 4L0QA 1BA2A 2OHOA 2DSTA 5MFZA 4V0OA 1HYHA 2O0HA 5BR7A 2X6TA 1UBHS 4QUAA 4R40A 3SWWA 1M1NA 1XTSA 2AFVA 1X9HA 1U2GA 4UFNA 2HUNA 3B1YA 2ZIEA 3JD3A 1ZM7A 5KNBD 2BY4A 2KSOB 4NBUA 2QVYX 1YCDA 1KFSA 3Q8SB 4C0WA 3W1VA 2Q28A 3LVBA 5TMDA 3HZZA 3QYPA 3WAJA 4IG9A 2C2WA 5CAEB 4DIOA 1IM8A 1LK0A 3QW4B 3ICCA 4XUEA 3VISA 4QW8A 3FVWA 4U9UA 4AJ9A 1KHTA 1USVA 1QHSA 1J07A 2UVWA 3GMIA 5CHYA 2ZB7A 3E7WA 2VYNA 1OX6A 2G9QA 2PRSA 3KOYA 1BYIA 1U7UA 1ZQWA 4GP7A 4IFEA 4FFPA 5E6SA 4QBFA 1WXEA 3U3JA 3AB8A 3PE6A 4CNBA 4FKMA 2BZ0A 2MR5A 2VK2A 3B2EA 5C4GB 4B3DA 3M1AA 2ZUEA 3OT1A 1SC9A 2DYKA 2R25B 3IBSA 4DNOA 2QQEA 4EHBA 4BNFA 4GVLA 1H5NA 5KTNA 2IHZA 3JYNA 4EATA 2C4MA 2AJCA 3IA7A 4XGKA 1HDYA 4JBYA 1N5KA 4WACA 4P34A 3T3IA 4NCJA 3HSKA 5DBBA 3WK7A 1XZPA 4DCJA 1NAHA 1C80A 1CRXA 3RNLA 3SP1A 1SL1A 1NRJB 1XEXA 3LWBA 4UHDA 2IE0A 4KR2A 3ZE1B 3RTGA 4C7OA 2PX6A 3E4DA 1L5UA 3RG8A 4P3NA 4H4DA 3E9ZA 1ZUNB 2AGVA 1T25A 1EZ4A 4O4JA 5FTMA 3OX1A 5LPNA 1U7WA 2YNMA 3EXEB 4ARAA 4GAEA 4LE0A 3RYFA 3NVKI 2PR2A 4PGFA 3LPNA 4F4HA 4RM3A 2P91A 5DSXA 3PT5A 4YXWD 3EH2A 3DM5A 4EB6B 5KFDA 3O2QB 1E69A 4WX2B 1E2HA 5K09A 3S0JA 4F9TA 3WLNA 4AY4A 2AN1A 2MSEB 1L7OA 4OGGA 5IZCA 4BWMA 3VPCA 4LVSA 4MYCA 1AVTA 1P9OA 5JWHA 5BNFA 1Z36A 4QU0A 1FDOA 1CUEA 1U3GA 3NHAA 3ZV5A 2HN9A 3QJYA 4YQFA 2IPMA 3E84A 1NVWQ 3O8QB 3LYUA 3EEOA 3NT2A 1SBCA 4PYQA 4IJUA 4LKOA 2V8OA 5CBPB 1A04A 3AF3A 2E4YA 3DLBA 4G4IA 1RIIA 3A7DA 5CVJA 3EPHA 4A92A 2JIBA 3OQOA 3WLJA 1YZHA 2J87A 1HFEL 4EYEA 3QOXA 3KJNA 2FOXA 1QH9A 1PF7E 3GDOA 2ZAGA 4CCYA 4WK6A 4CN9A 1X2BA 1Q92A 4RNDB 5EJIA 1GG8A 4MVXA 3FZQA 5AJUA 3QWHA 5CA7A 4CVNA 2P9GA 1P7VA 2BM1A 5EUMA 2GA8A 1B6SA 4WPGA 5BPFA 1TD9A 3GVCA 3ABOB 3ESYA 2XMZA 2KV2A 1SB8A 5GVSA 3O84A 4NECA 1VLJA 3G0HA 3PF8A 1XV5A 1DARA 1N6HA 4JSYA 1O6GA 1SBIA 1HTTA 2VDQB 2F00A 5HEKA 1Z3EB 4RZUA 3AW8A 2QAIA 2VEOA 2C2YA 3ND7A 1G4AE 1GAWA 1FTNA 5A3VA 2B25A 1QJCA 1ESCA 5B7NA 2R86A 1F6BA 2LRHA 1J0AA 2H00A 1U8UA 3GNQA 5CLGA 1N9GA 2HBKA 4B7UA 2QL9A 2UYGA 4EPXA 1LV5A 1SG6A 1OA1A 3BE4A 3QXXA 2FAXA 4JJZA 1T8PA 3NVZA 2WKPA 2YN0A 2VWGA 3U80A 1MVNA 3GZFA 4GH5A 1V1MB 1XZIA 2AJLI 4YNBA 3FCYA 2VQEB 2WP8J 3CVVA 2FJ6A 1EDBA 2QRUA 1YZKA 3KYDA 3WGHA 2SKCA 1KBUA 3ZXIA 4XB2A 5ECGC 4QW9A 1Z18A 4H0FA 3H2JA 5KG3A 3VR3A 3GRFA 5HZKA 4QTYA 3K0CC 2XO7A 1Y34E 3UJ6A 3O4HA 3U0VA 4AKTA 1ZONA 3UXOA 3OIYA 1HOXA 2QDKA 1YFKA 3PHJA 4O4IB 3PFIA 4JUDX 5FOXA 4YRBA 2OBYA 2CHVA 3OIGA 1WDTA 2YWRA 5EN4A 1C9JA 5ECDA 1EJBA 3L0PA 3MDCA 3PICA 3HNRA 4URFA 2G0AA 2RHBA 2CW5A 2TMDA 3CLTC 4P0TA 3RB3A 5FYQA 1H69A 2JEIA 1YZVA 2Z95A 1IJFA 5EPEA 4YBRA 2PUJA 1CP2A 2GZ1A 5LQMA 3IHQB 1YBMA 1XEWY 1P77A 1TCAA 1N7HA 2RHOA 5TJHA 2ZW9A 1U0BB 4UHFA 2RGBA 1GGNA 1EXVA 3SAJA 4NCKA 5CMLA 4MWTA 4OP3A 3EX7C 1A7KA 1TVAA 1YL5A 2LPEA 2XGGA 1J2JA 4PRLA 4CL8A 3H8MA 4HQLA 4WA7A 3E2MA 2PA3A 5JEDA 2C7OA 4KUEA 1D1QA 1QYVA 3RT1A 3Q8WA 1N63A 1QHFA 3E3OA 1VKNA 4UMDA 2JEYA 1CUYA 2XMRA 3K1RB 5F76A 5IJ0B 4BQEA 3E9DA 3IBYA 2WJGA 2XI9A 4W1SA 4I2CA 2PSEA 5EIAA 2QTVA 2BVNA 4Q44A 3AVPA 3ADOA 4FGJA 2OC4A 1L5SA 1X1BA 3EEIA 3LGXA 5IBCA 3IVAA 1UUFA 1UKZA 4ER6A 3PNOA 3TNLA 4J9UE 1GAEO 3VVCA 3K4HA 1IZ9A 2HCFA 4P2HA 4KO2S 4NVRA 3U5ZB 3L1IA 3ZGXA 3N39C 5B6JA 4CEJA 2I7TA 5BYKA 4F2HA 2VUHB 4KP7A 3MAAC 5HVNA 7ADHA 3EOZA 1T3TA 3QNWA 3H3JA 5ENDA 2WHPB 3K70C 4G8JA 1Z19A 1P17A 2WAOA 1CR2A 5B1YA 4HWSA 1EAMA 3WNBA 1SUEA 3ZJUA 3DTYA 3KKQA 1BCRA 2H1WA 1HQCA 1CIVA 2XXAB 1X1TA 5SZHB 1JJFA 5I7VA 4K9SA 3UH1A 3UKOA 3JQ8B 5T5QA 3GLGB 4A15A 5EIXA 5TV2A 2V7BA 1B8OA 4M1OA 4N1AA 1AQJA 4P4OA 3A4NA 3GI1A 2FEXA 1RE1A 5JCJA 4ND5A 4YROA 2YASA 3EPJA 1JL3A 3AR5A 2OV4A 1E0AA 3X1XA 2CXQA 2GEFA 3LUAA 3S8EA 2QMUA 1C29B 1ZWLA 3PYMA 4OHYA 2WWIA 4F4KA 2AI2A 2VDLB 4DDHA 1D3AA 3CYFA 1YMQA 1GNVA 4DY6A 3HGQA 1UADA 2Y1DA 1T9ZA 4QPCA 3UICA 2CD7A 4KQKA 1Z28A 2NVUA 1MDBA 5DTMA 2VL7A 1KJJA 3EIQA 1MG5A 1V4VA 3U9LA 1Z07A 2WSBA 1SUSA 2IYSA 2WIKA 4OJQA 1OTHA 4DQDA 1BN6A 2ZIWA 1KOLA 4ZD6A 2OQIA 3I72A 2A14A 3FNBA 2ZI3A 1G4UR 1EE1A 3A4LA 5BQXA 1PWZA 1UQTA 5FLKA 4W7HA 4MVJH 4DFMA 1LSOA 4Y6PA 3B3FA 1QZZA 4HNTA 2NU7B 4FMCF 3WQRA 1CUJA 5ALXA 4QWAA 2GTIA 3B82A 5ER6A 3N97B 4K9KA 5H81A 2XDQA 3ONNA 3PFBA 1KWGA 3AMVA 2G4LA 4QQRA 1M2JA 2J09A 5B53A 1KI4A 1TQ4A 1CIJA 5ALMA 2EZTA 4B6QA 4RD0A 5B36A 1ZD3A 3NVYA 3AUXA 3RIXA 3ULKA 3TKAA 4UU7A 1Y88A 2C1EA 4MZXA 2RAFA 3PC6A 4Y6QA 1KQOA 3EY9A 3E48A 2QWXA 1GG9A 3G5MA 3UF0A 1R0ZA 3HP7A 4BN5A 4DV6B 5COQA 3EVNA 3Q6MA 5EYPA 4DN6A 2QV7A 3M4NA 2HBRA 4ZXFA 3IDOA 2AQ8A 3DHEA 4CM8A 6ADHA 1JHAA 1Z0ZA 2JJ2A 4QXMA 4O3MA 1RYYA 1I3LA 5FA5A 2IS2A 1GADO 2RJOA 1ILEA 3CEPB 3RJFA 1RJGA 1ZQTA 1V0JA 1QE5A 4UEOA 1G7CA 1JNXX 3SJAA 1GD1O 1ES9A 1YB7A 3MELA 1LRLA 1Y3FE 5IFKA 5AKHA 5JS2A 4HDQB 1RLTA 4G6ZA 3T7KA 1CG6A 1CRPA 3DKPA 2CJFA 4H9GA 1K5PA 2BDEA 1E6WA 1ZQSA 3G8BA 5EZYA 3ETLA 2Z56A 1CT9A 3WS7A 2MIIA 1RFGE 3CU5A 1ZVKA 1T2DA 3EYZA 3Q2KA 4TKLA 3A1CA 4LXUA 4KO8A 1QU2A 4QDZA 4F2DA 1YHYA 4GI5A 1AKMA 2C59A 5DCUA 2V9WA 2B3TA 3G6KA 2LIVA 1CF2O 2HV8A 1EFLA 4KQEA 3NEYA 1WXWA 3Q6NA 3SVLA 5JADA 2G4CA 16PKA 5DNUA 2GAJA 3O8OA 3K1JA 4DDVA 3CE9A 4MHOA 2NV0A 3OZTA 1FX0B 4IHJA 4PGYA 2V9PA 1UMBB 3RQIA 1NI5A 1KEJA 1QIHA 2WTFA 5HQ3A 2XQKA 2O07A 3K0BA 3CRZA 1JJAA 1RQXA 1GNSA 4L8VA 4DM4A 3QK7A 3O0DA 2XQVA 3OZ7A 3ZHRA 2FUEA 4RSHA 5C3UA 3CRQA 4X44A 2VP9A 1LS6A 3LZDA 4L76A 3L8HA 3H1EA 1YOBA 4NYMQ 1HZJA 3IAAA 2VP4A 4PG7A 1Y6GA 3CLVA 4HTFA 1P4HA 2GPJA 3KAKA 3I5XA 4GNRA 4RPIA 4Y7DA 2JAXA 2AB0A 1THGA 1R4NA 4EGFA 4PGMA 1M1YA 2UYHA 2UZ4A 3PR5B 3R0XA 4BIIA 2ILVA 4BNDA 2H1CA 4DZRA 3T7SA 1U2RA 1P5ZB 4L4RA 1UBTS 2MU1A 2X4IA 4ZQGA 3TEMA 1ML3A 4LZPA 2CLEB 4JJAA 2W2TA 2HZ7A 1QO7A 4CM9D 1IXZA 5FORA 3AR6A 4Z9YA 1HE3A 4NX2A 4AU1A 3UNXA 5AUOB 4D6YA 5A4JA 1OLXB 1FNBA 4ZCRA 4W5JA 1TADA 4HO1X 4LXGA 1TNDA 4ZFNA 3QEKA 1UPCA 2UV8A 5JXWA 2R0QC 3LRPA 5C7IO 3D2LA 5K4GA 3QQ5A 5EJ8A 2AHOB 5F98A 4WRRA 1HDZA 4WT7A 5LSAA 5EHQA 1IAQA 2JCXA 4K9MA 4JJKA 4H17A 4Z6DA 2PMCA 3NHZA 2CNBA 2Z4SA 4QGAA 3OQNA 1RRMA 1JDZA 3MMNA 3D0QA 1Q1QA 1WDMA 3VV2A 1G3UA 4XXHA 2EJUA 1R37A 1KQFA 1YJXA 2VPWA 3T0GA 2YXEA 1AF7A 3BA6A 3R7WA 5DIFA 3IYLW 3MF4A 2QMQA 1RMTA 3I53A 4F71A 1IUKA 5KYXB 1R0YA 4LQDA 2C4HA 1RTKA 4KPYA 2W3RA 3U3ZA 4U63A 4KODA 1I9GA 4KXYA 4B8YA 4CW7A 3E7XA 2Q21A 2UUCB 4EEZA 1C9KA 1T6BY 3HN6A 2KICA 3CRMA 1NF2A 4FYHA 2FCAA 5BV1A 3L8DA 5KNLA 1VHQA 3GGGA 3AI1A 4EAQA 1LX7A 3VH3A 3WG9A 5T4FA 4Z9XA 2IYVA 1B1AA 3DW1X 4FONA 1KRXA 4N76A 2X0IA 3G2NA 1JHQA 1FSFA 1RWVA 1H2AS 1HFJA 4I4LA 4NWIA 2YWBA 4HS4A 1YB4A 5FLXA 2O2HA 2J9GA 1QK5A 4N5IX 4TMWA 1P0MA 1NJXA 4UBIA 5DTEA 1YR2A 2V7QD 2W6OA 4OLAA 2RBGA 3P2MA 3H05A 4U39A 2Y1FA 2GOYA 2AOTA 5JO9A 4RGVA 3OKFA 2HNAA 1WXQA 3GYBA 2AFHA 3Q7IA 1N5RA 3CT6A 1PKXA 1NNEA 5HJ5A 3PW4A 1NBME 1RI4A 4LYEA 4D9EA 1M34B 3SBXA 5J4LA 3DFUA 3Q98A 3AL3A 1MLDA 4LJKA 5FPYA 5AXDA 1H05A 3FOZA 5E6RA 4BE9A 1C8BA 4ETWA 1GKIA 3IOEA 1U0FA 2ZTCA 1JU9A 2A35A 2HWUA 2PG3A 1RM5A 3B2QA 1WF3A 3JAWB 2I3DA 4PL2A 1M75A 1KTIA 2GJSA 3VXKA 2G67A 1Y7TA 1CZRA 4E2WA 3TQCA 3ZCSA 2DEUA 5D6OA 2QSUA 3MRTA 2P4EA 5KZMB 4UM7A 3R6GA 1PJLA 4TXHA 2WIGA 2BGKA 1RKXA 1WBBA 1NZBA 2CVPA 4NFLA 2WYOA 4ECAA 2VCHA 3BKWA 5JNTA 1QGED 1Z2DA 2CPRA 2PQ0A 3C5EA 4DR1B 5DRTA 3R20A 3RS0A 2XT0A 3E7FA 3H6GA 1KZ7B 4RJIA 3PX4A 3LNCA 1JPJA 2ECFA 3TINA 4MZDA 5KB3A 1OHHA 4OXQA 3RBVA 3LDUA 3QFTA 4PYMA 3S70A 4X95A 3FDFA 1KI7A 4JT4A 3T06B 4JGGA 3CLRC 2GN4A 4TKMA 2WT4A 3T7DA 2FE4A 4R1SA 1L3UA 3D02A 4B4VA 1ODKA 2GF9A 1K97A 3DWFA 2AXQA 3NHUA 3GW8A 5T4BA 1D8YA 4BVEA 3CNNA 4FNOA 4ECEA 2AD1A 3A6DA 3Q1LA 2ZITA 3LX5A 2E1PA 3OJLA 5DB9A 1HNZB 1W4CA 1R0SA 4UAYA 2GN8A 1WW2A 2CLKB 4DR5B 2LD4A 2BE9A 3QEBZ 3PWTA 4EZEA 2JF0A 4Y98A 2CYCA 3D7KA 4XGIA 2G6BA 1ZRMA 2W9AA 3C7CB 4MQFA 1AV6A 3QUQA 3QVWA 2VK4A 3ZDAA 2W8BB 4TMYA 4JYPA 5G1PA 3DAFA 3V8BA 4L15A 2C98A 1BU5A 2EKBA 3FDZB 1X9XA 4KZPA 2YZ2A 2B1RA 3RAQA 3I2JA 3NFYA 3IPAA 4KLLA 3EZFA 1W9MA 4KL8S 2RK4A 4BE4A 2QUAA 4QNNA 2HNBA 4C0SA 4HV4A 4TTAA 2BR5A 5FJIA 1C81A 3ACDA 4ZI2A 4YIKA 1CZUA 4F97A 2IS1A 1XE3A 4E4TA 2DP4E 1XJCA 4YP5A 4RKWA 4X24A 2Q4RA 5TSDA 3BMCB 5KFCA 1SCIA 2HW3A 4M8NE 1FLDA 4M0CA 1BMFD 3VUFA 3KR9A 2XUGA 2OBMA 4DUGD 3K9LA 2N0SA 3ZV4A 1Z8DA 3BREA 3UJ8A 3EGVA 2VTEA 1AUVA 5ARCA 4CV2A 4C4PA 3ORYA 3VH4A 5M5BA 1Z9BA 3KHGA 3AQIA 2QTNA 3DDOA 2PJRA 4Q1FA 3MDAA 2XNCA 4G81A 4DLKA 1EBBA 1FS6A 2NSLA 4R98A 3O3OB 2IIQA 3LQKA 2V3VA 4BO8A 3SC4A 2PPVA 2REBA 1L3TA 5SZJA 4F5YA 4C4YA 2J6BA 4KIJA 5KEIA 1RW4A 5JS8A 1GKLA 3WNZA 2FWRA 1EVKA 3D8HA 4MI9A 1EBFA 2GZMA 1F1BA 3OO0A 4FIDA 1C4XA 3DV9A 4MUBA 1DK3A 2E8MA 3BZKA 3GAFA 3HGTA 1RHMA 3MJHA 1J7KA 2HDNB 3I42A 3GJ5A 1KR2A 3EGCA 2FFHA 3EYWA 3F5AA 1XMXA 3QWFA 1J25A 2Q49A 3HNOA 1FFBA 4R8RA 4U2GA 3JSAA 2QYHA 2O54A 1UA0A 4LHYA 1RRVA 5KG0A 1JLMA 5DG7A 2FF5A 1LI4A 5EOVA 1ZW1A 8ICBA 2DHEA 3B51X 3L9XA 1NPYA 4FKZA 3F6BX 2EGUA 3EWSA 3L0OA 2JZCA 5EG5A 4XJXA 3TACB 1ZQGA 3IPLA 5ER9A 4EELA 3V1YA 4UNPA 2Q0XA 2PRYA 4BKPA 1D7AA 3DP9A 4D45A 3AV3A 4LCBA 3DSRA 2IA6A 1MFPA 4L51A 4JODA 4OI4A 5FWYB 2ZB3A 1JEYA 1PZMA 1QFSA 3P26A 3HFRA 1E5DA 5EUCA 4GXJA 1D6MA 2HMSA 1OBOA 2ZB2A 2I8CA 3AUSA 2DERA 1E77A 3B1XA 4DR2B 3AQFA 1HI9A 2JFFA 4LZGA 1TEHA 3LPAA 1W35A 2V7UA 3TF5A 5JT1A 1G9SA 1DIBA 4MIEA 1GTMA 4FCCA 1Q2XA 2QX9A 2P2NA 1CU1A 3HACA 3LT1A 1L7PA 2B6NA 4MUYA 5JRJA 2BFBA 5IIJA 4DTCA 5B55A 2BV3A 4B2LA 1RSZA 3AI7A 4A10A 2B8NA 2C7QA 1ZD9A 1H4QA 1E9RA 4NPAA 5TS3A 3NI2A 2XICA 3BQ7A 2CDBA 3DXZA 3GLUA 1T5TA 1A9XB 3GFRA 5KTQA 1ULZA 5BUZA 4F5NA 2XY5A 1YD7A 4NBLA 2BP7B 2C2MA 1BH2A 3ZIAA 4RA6A 3D3WA 4PSKA 1J2TA 1SQSA 4J9KA 4L9WA 2B9VA 3P2KA 3JQGA 4RCZA 3QYAA 3UQ2A 1GXSB 3D5TA 5J9FA 5ELXA 1PTJA 4NZMA 3WGUA 1Z2OX 4IV5A 4HWGA 1ULSA 4BTVA 3L6CA 3K1TA 1SQ5A 3V48A 4I5EA 5IT9A 3LXRA 2JJ8A 5J0YA 4D4IA 2ZRJA 1S3IA 2NWQA 2VTBA 2KWIA 2FN7A 5AOCA 1A9PA 5CXUA 9ICNA 3OETA 3NIBA 3HRKA 4PFKA 4JXXA 1A4UA 1BKSB 4PTLA 5C80A 5CG1A 2PO5A 3RTBA 3OKCA 1YVDA 3I6BA 5C7YA 3GV5B 3SBOA 4X1KA 3TVDA 3E0QA 1QZUA 2PH1A 4FR0A 2JIMA 1CS4C 1XZ8A 4G0PA 4XH9B 5AHKA 4MKFA 2J31A 1K1SA 2JZOA 3QWIA 5EIWA 4YI3A 4D4KA 3CZ4A 3QUBA 4ZAXA 2Z1DA 5HA5A 1YTLA 3B85A 4WE3A 5HFAA 3NXSA 1OAAA 1S8OA 5HYVA 1G1AA 2ATEA 1GZVA 3GVHA 4LSZA 2XA9A 5IDWA 1KYYA 2I6TA 3OF2A 3L8FA 4ZZIA 3NEPX 4GPD1 4JYBA 2XTMA 3HSYA 3AZOA 4LXQA 4HN2A 5C8XA 2OCLA 5J2UA 4IPTA 3LC1O 4BRUA 3KT6A 2IE8A 3DG9A 3S5JA 4AB1A 1U2TA 2HCRA 1ZMXA 1RRPA 2CNOA 3AF5A 2FDRA 2OUKA 4PU0A 1A8QA 1F38A 3ANLA 3H87A 1HETA 4KXWA 3UUGA 4ED8A 4WLUA 2AG6A 2G06A 3C7TA 3COPA 5HE9A 2P6MA 5CCEA 1N2EA 4CUJA 5FR2A 2J32A 1HUZA 5KFMA 5A5FA 1NTOA 1P5RA 4Q01A 4P98A 1CZOA 3CRXA 3TADC 5KHOC 1ZQHA 3WHKA 4B79A 5IM4F 5HE8A 4G1BA 3RU7A 2ESEA 1IUPA 1ZVQA 1CVRA 4GC5A 4Q4LA 5E1OA 2GCOB 4UD6A 2UVPB 1KU0A 3GILA 4N9QA 2YHIB 3DDSA 4QYMA 4YB8A 2XXJA 3KYCB 1AKEA 1I36A 2R5NA 4JBIA 4KIUA 1L3SA 3KQSA 2PWBA 2B4YA 3D9QX 3FGPA 5I7OA 2JMGA 5AW8A 4OUDB 4LJXA 4AL4A 3BGIA 1M9NA 4MTCA 3C7KA 3FPEA 2BMVA 4RQMA 2H2IA 2E0IA 3K9GA 2P9TA 2ZZMA 2XUZA 4JP5A 3HU3A 2NYUA 3WTBA 1TX4B 2A88A 1CRLA 1T35A 4Q66C 1B0UA 3BWEA 1LBIA 2SNIE 3TSOA 2X7JA 1DWUA 3H4VA 2QM7A 1TU0A 2DT5A 4BX3A 3OJSA 3I0MA 3DAOA 2GVZC 5FOSA 2G6TA 2I7CA 5KJCA 3KCNA 2JFWA 2OFXA 3WXMA 1DKMA 4M0FA 2VCEA 4M0MA 3RQSA 1RYMA 3HNPA 5DBGA 4CKCB 1YXMA 1L5GB 4PY2A 2NU8A 3VR1A 2WE8A 2NSJA 4RQ6A 3MGCA 1TCVA 3NIDB 2D1TA 3CX3A 4MX8A 3V9AA 3NONA 2ZR0A 5C8ZA 1WKCA 1K5OA 2QN1A 2C9DA 3FAHA 4X9XA 3OT5A 1QPBA 1NOMA 1NAIA 1YMVA 3L01A 1XKLA 1U98A 3T52A 5LCXA 4AY3A 4CMJA 3FH0A 5LQNA 4TT8A 4DBLE 1ZRHA 1USWA 4B33A 4QT4A 2F1JA 1XZAA 5TB5A 1FP7A 1AY0A 2I2WA 8ICPA 3LPDA 1REQB 2H65A 2AE2A 2R1VB 4YLGA 3DUWA 2OR3A 4JOQA 4RPLA 2C8JA 3HDQA 4PVCA 2PWYA 1NPDA 4ZO6A 3W6OA 1QOPB 4QQNA 1QTQA 1P1RA 3RC9A 4M0AA 3PIIA 1ZQYA 5DYTA 3VVBA 3T5MA 4DCPA 2DR0A 1HYBA 4EHHA 2CJPA 2D2EA 2CV0A 4N01A 3EXG2 4JLKA 5SYAA 5EEGA 5K0FA 2D8AA 3B89A 5HKLA 1QVRA 4IOKA 1ZSNA 3SQDA 5C7OO 3O4GA 3OTHA 4LV8B 3TN7A 3JYQA 1MC1A 4GLBA 2D5BA 2IU4A 2XCSB 4PYNA 1Y1SA 3H2HA 3VC7A 1HKHA 1M10A 4DRXB 1GT91 3PJDA 3D0OA 5J0QA 1FA9A 3FHTA 1JSXA 4Q3CA 3IDWA 3OAAD 4J7AA 2Q5IA 3HP1A 3H1TA 1TPYA 2BRUC 2EAUA 3VR2D 4IUDS 4IXTA 1KI6B 5CCXA 3F3MA 2XADA 4QYSA 1U2DA 1PHPA 2JFNA 2XSZD 5J43A 1KZ6A 2UZ3A 3K09C 1UOEA 3T1OA 4K86A 2DJ5A 1Z75A 1RKQA 1C5KA 4KB5A 2F43A 4HB3A 1TKRA 2IDJA 2FN8A 5JXIA 5CVVA 2R6AA 3ETDA 2C94A 2RAVA 3VVMA 3KWMA 2JASA 3TH5A 2YRFA 4KMSA 2D6FA 5DHQA 4WCVA 5DLDA 1P2TA 1UDWA 1OASA 1XUOA 1EJ6A 1U8TA 1N3IA 2AQHA 5J2CA 2VWQA 3TRDA 2E3TA 4B7ZA 2PBRA 5ECYA 4XJVA 1CYEA 2NT4A 5NLLA 3WP0A 3RD5A 1HOTA 1G8HA 1PJ4A 2B37A 4IIJF 4DQ0A 1EEXB 3UMJA 3EC1A 5CH3A 3G5UA 1HDEA 1FJ2A 3CWZA 1I6MA 3VYUB 5JMTA 3KV3O 3SOZA 3FCUB 3MQFA 2NO4A 1J8VA 3GAZA 3QWAA 4OHWA 3L79A 1IHUA 2E8NA 4RD6A 4QOHA 3QYFA 2BISA 2E87A 4ABTA 2F44A 4ASUD 5C1DA 1G5TA 4IIJB 2QX7A 1ZQCA 2C9BA 3TLAA 3HJUA 4ZQIA 2XMPA 2HA7A 5E3JA 4KPFC 1QK4A 5CW2A 3O4JA 3HKEB 2ZM5A 5CCDA 1XTUA 2W2LA 4Q9IA 4O59O 4C2AA 3C5HA 1E8NA 3I34X 4J03A 1RCTE 3QVJA 4B82A 1AMNA 1KRHA 1KYQA 3MINB 1YZ7A 5J2DA 4UBNA 3PXBA 1NSTA 4AF8A 4M88A 3UB3A 3T3DA 3X1ZA 2VJPA 1OBVA 3MT7A 1Y9ZA 1WABA 4MCAA 3IDSA 2KJQA 1FTSA 4EEKA 2B7LA 5KFZA 2ZIVB 3IG8A 4TWIA 2Y93A 5JZOA 2IYQA 3W6PA 4OG2A 3C5GA 1GLNA 2NXEA 2VJMB 4HG2A 4YBZA 2X7HA 3GUVA 1C3LA 4H7KA 5JAUA 1NY6A 3PIRA 4RK7A 4EO7A 1WHSB 2PX3A 3I2GA 4QIWC 4JKIA 1DDGA 1TTTA 2VQ3A 1BS2A 4TSFD 1KEKA 5AXBA 4YMIA 5DRYA 5CFMA 1W4ZA 3KR2A 1RWQA 3ET5A 4ND7A 4H59A 1TJ5A 3T9AA 2XZLA 2EATA 4FUTA 3IL2A 3HJRA 3VBEA 3VR5A 2GHQA 2BCQA 2IXBA 3KUKA 4OQXA 1MA0A 2LZ0A 5FIUA 5B64A 2SCUB 4M55A 4I8IA 4LWQA 1N2HA 4CHTA 4MRNA 2JRLA 1I2ZA 8ADHA 1G55A 3OPYA 2X9LA 2ZAMA 1R8YA 2WUEA 3ISDA 3C1OA 4EI9A 1WY5A 3N7SC 2B4RO 2H92A 2BFEA 1WE2A 4D3SA 5J2EA 2JL1A 2OCEA 3V4FA 3TLXA 2YQZA 1XN4A 5EOZA 2YWDA 4FOLA 1QV6A 1E2JA 2PT5A 2GM4A 4Y7CA 2CXOA 1I51A 1M1YE 2GFIA 1PUXA 3IPXA 3UWOA 1BWSA 3PBKA 1ZQ1A 2O8VA 4HX5A 5C8VA 4CCAA 1QB7A 3AIKA 4IEIA 1NW6A 1KQGA 4ARSA 4D0LB 5KAPA 1N8TA 2Y0EA 2J59A 4PG6A 1H8ED 3K96A 3TB4A 3O0TA 2FPOA 1JYFA 2WKQA 2P65A 1DHRA 5H3HA 4RS4A 2ZPTX 5J2IA 2PL5A 3T34A 2NAFA 2D1SA 1EPUA 5H4HA 1PGQA 4PFSA 4B0OA 4NK5A 3EDRA 1ZD1A 3JRXA 3GZNA 2XB2A 2QHXA 4PZOA 4RELA 3PC2A 3BJIC 2YJGA 4KDCA 1UPXA 3CO0S 3PEVA 2JJQA 4EA6A 2ZUWA 1R64A 1MW8X 4FOOA 3RO7A 5A2GA 3FF1A 5DGCA 3N74A 1DJMA 4CF7A 1VMAA 2ISOA 2WMYA 4OHMA 4PONA 3UBMA 1GCOA 4QM7A 4G24A 1VGRA 2CK3D 1UZUA 3OQHA 3THWB 4UTXA 4GMGA 3NP7A 1HTBA 1XDBA 3WHIA 3EZLA 2H3EA 1IG3A 1LPBB 4C6TB 1XO1A 2AJDA 4KBYA 3KZVA 4UXIA 2YC4C 1EDZA 1JA9A 3AVXA 4EVIA 1NBMD 3LSYA 3M6WA 2WU1A 1DEHA 1RRFA 3N0RA 5BWNA 3THYB 4DMCA 4CM1A 1N5JA 4DSJA 1EVJA 3AKDA 1U63A 1HMYA 2GD1O 4AJ2A 1KKXA 1UBJS 4TS1A 2AKYA 4RS3A 4D7AA 2FEOA 3EXFB 1R6AA 2J41A 3H7IA 5IK2D 3VO1A 2I4TA 5KOYA 1XMPA 1Q3TA 2UUOA 1S77D 4DA9A 2DQSA 2ZROA 1TYEB 1SO8A 4PSDA 3KJZA 4JH0A 4JV1A 2EZ9A 3V4ZA 2ZSAA 8ICEA 1EAYA 1S2NA 3EZGA 1BX1A 1E6LA 2IH2A 1PK7A 2EKZA 5KWEA 4XIGS 1HEIA 1XDGA 1SXIA 2C3YA 5H3CA 4YPFA 4CKYA 3H99A 3DZDA 3HKDA 1OU4A 4PTYA 5JY1A 3T3OA 1JFSA 1RJDA 3TFRA 2PIAA 5DISB 4MUEA 1VMKA 4O2LA 3P9RA 1RQNA 5EKSA 3NHRA 5KU1A 1D8LA 5F9NA 1X14A 2ERXA 1ZPDA 4KLIA 1WPQA 1SVWA 5KQSA 1IQ0A 1RI5A 1GUBA 1JDUA 3C74A 1CQIA 1JIKA 1BG6A 2WPDA 4AUNA 1X6VA 5KKNB 3AJ9A 3NGDA 4BASA 4QGGA 1NM5A 5A5EA 4MR8A 4JQOA 1FNMA 3KVOA 3FETA 3ILVA 1EP3B 5I9BA 3ZVKA 3KQTA 3NJ4A 1QH8B 5FKJA 1F17A 4BLWA 1WRBA 4Z1MA 3O03A 3KXDA 3B9JA 3KV1A 4BO6A 3PPXA 1XRRA 2H4XA 4D0NA 3GJ4A 3RRZA 1AURA 1C2YA 1BNCA 2DTEA 4R1TA 4DQVA 4XOUA 3W5AA 4MW2A 1E66A 5BUCA 4YK7A 3DO8A 3B5EA 4UHEA 4XKJA 1NURA 5EINA 4B4DA 4