4BXOB

Architecture and dna recognition elements of the fanconi anemia fancm- faap24 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
196
Chain Sequence
VHVPLGHIVANEKWRGSQLAEEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords FANCONI ANEMIA GROUP M PROTEIN
publication title Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 196
sequence length 203
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17949 PND FANCM pseudonuclease domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4bxoB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bxoB01
1NJZA 3JPOA 1JX4A 9ICGA 1Y88A 4J9PA 4BXOA 2HVHA 4Q8FA 2JPDA 4ECQA 4DOCA 3RJKA 2DFLA 4QW8A 3PR4A 3RH5A 3V72A 3QE9Y 4B9SA 2NRVA 3C2KA 1S0VA 3GFKB 3H8SA 3M9NB 1RXWA 4PH5A 3ZD9A 3FDSA 4K4HA 3QEBZ 5KT4A 1B22A 2HHXA 3T5LA 8ICIA 8ICLA 3MBYA 1U49A 2JEIA 1KEJA 4ECZA 3GV5B 1NKEA 2FLPA 3PW7A 9ICFA 1BPXA 3AU2A 5CWRA 7ICEA 7ICPA 4DS4A 2ZJ5A 4J9SA 4MFAA 5J2HA 3OHAA 1QTMA 3M8RA 5J0SA 1K1SA 4M6WA 5J0RA 1TK8A 1BPEA 1CEZA 4PGYA 5C5JA 5J29A 2PFQA 4ED8A 4J9RA 4DF8A 5KFEA 1TV9A 3Q8RB 4JV0A 3V6KA 1PZNA 1BPBA 5DKWA 4UB2A 4R65A 3PMLA 9ICQA 8ICOA 9ICJA 3FYHA 4KLSA 2BCRA 3AU6A 1D9FA 9ICCA 3RJIA 3SZ2A 3RJHA 4PHAA 2XO7A 4C8LA 4DWIA 5KT2A 2BQ3A 1NKCA 4C8NA 2P6RA 4TQSA 8ICKA 4ECTA 4DFMA 2PFPA 1ZQSA 2R8GA 2P6UA 4NY8A 4ZH4A 3HW8A 4RUAA 5KFUA 2PFOA 4UAYA 1T8EA 1TVAA 3RBEA 4IRDA 2Y1JA 4DQSA 8ICEA 2ZTDA 5KFRA 4J9KA 2C22A 4DQPA 5J0UA 5CHGA 1RYRA 7ICGA 1BPZA 5IIOA 4RT3A 3MGHA 3G6VA 2JEJA 4F8RA 4K4GA 2V4RA 1C7YA 8ICSA 9ICRA 3MR6A 4QZ9A 4J9OA 2Y1IA 2F1JA 1XSLA 4XQ8A 4RQ4A 4RQ6A 2V9WA 5KG2A 3PX0A 4TUPA 4YVZA 2HHVA 5IIKA 4F92B 4C8KA 5HHIA 4RU9A 3PX4A 3K75D 2ISPA 4YR2A 4F50A 4KLFA 3Q8LA 1NK9A 2BCVA 3ZDCA 1ZJNA 1NJWA 4QZFA 2FPMA 4ECYA 4M9JA 3Q8PB 4HYKA 1UT5A 4Q44A 5DDYA 4UB3A 2FMPA 4P0PB 1KSPA 3HX0A 8ICTA 4QZ8A 4QW9A 4B9LA 4IQUA 2W9BB 2MAXA 4DOAA 4UB5A 3C23A 5DLGA 4ED7A 3GDXA 2UVVA 4NLGA 9ICMA 5DBBA 5L1LA 9ICNA 5KTQA 4IR9A 4PHDA 3OGUA 5J0YA 1ZQOA 1ZQBA 2ISOA 5IIIA 2C2RA 2XC9A 1KRPA 3RRHA 5L1JA 2ZUDA 1A77A 4LZDA 9ICIA 1B43A 4I29A 1TAUA 5D4BA 8ICHA 1BGXT 5DDMA 4NLNA 8ICWA 9ICKA 1TFRA 4YN4A 1A76A 3LWMA 7ICOA 4J9MA 4KLTA 3V7KA 3GILA 3KHLA 4F4KA 4YMNA 1WCNA 3MFIA 2HW3A 1UA1A 1NJYA 4KLJA 4KLQA 3MGIA 4B9VA 2ASJA 1XWLA 3EYZA 7ICIA 4EBDA 5KFJA 2ATLA 5DG8A 1SKWA 2FMQA 5CR0A 9ICWA 3Q8SB 4PHPA 4ECUA 1NK7A 3BDPA 3HWTA 3EZ5A 4TURA 2VA2A 4IQWA 2GWSA 4DL3A 3PMNA 2ZTEA 1NK8A 4O9MA 3OJSA 1U45A 4PPXA 7ICKA 4QWBA 4DF4A 1XO1A 9ICSA 1SKSA 1BPYA 4RPXA 1ZQWA 2BPCA 5J2KA 2KTQA 2UVRA 2MUTB 1ZETA 3UPQA 3GV8B 2BPGA 5TZVA 4QZHA 4Z6EA 1ZQFA 4I2BA 2NRWA 4RQ0A 5J2BA 4YG2A 4P4MA 7ICVA 1ZQQA 3PO5A 5J2EA 4G3IA 2FMSA 3H8JA 1D8LA 2AGPA 5KFCA 1TK5A 1RZTA 2ASLA 1QSSA 4J9LA 2BDPA 9ICLA 4I2IA 2P66A 1KLNA 2Q0ZX 3OJUA 4JK1A 4YXMA 5KFLA 5KFKA 4RQ2A 1X9WA 3THVA 3H7IA 2RDIA 1Z3EB 3ISCA 1NK4A 2W9CB 2ZIXA 4UB1A 1KFSA 4I2GA 2PI4A 4IR1A 2FPKA 1U47A 5KFFA 3MDAA 4KITB 3KHHA 8ICZA 1NKBA 3MFHA 4O3SA 2UVUA 7ICUA 1J25A 3PNCA 4R8UA 3GQCA 4TUSA 5DB9A 4QWCA 2XY7A 3Q8KA 2A1JB 1RXVA 5HHHA 5CP2A 4UB4A 2HHQA 1SL0A 3EW9A 1ZQHA 1S0OA 4BXOB 4LZGA 4FBUA 1D8YA 1IM4A 4KLEA 4KLUA 5J2AA 7ICSA 5DQGA 3BQ1A 5L9XA 3QZ7A 4KN4A 2FLNA 1X9SA 3GIKA 3H4DA 4I27A 5DBCA 1MQ3A 1HUOA 3GIMA 2ZTCA 3E2EA 4EYIB 3G6XA 3TAQA 1JN3A 8ICRA 3IHQB 4BGDA 4ED3A 1L3VA 2IHNA 4UQGA 1ZQCA 4F5PA 2ALZA 4Q45A 3KHGA 3JPRA 4EZ6A 4GXJA 3ZDDA 3GIJA 3C2MA 2BQRA 4KTQA 2HVIA 4GC6A 4GXKA 3RBDA 4F93B 4DSIA 3EPGA 5J2DA 4UBBA 5J0OA 5IIMA 5IIJA 1Z00B 4QZDA 4RQ3A 5DG9A 4PHEA 3TI0A 2KN7A 1ZQRA 4I2EA 1UA0A 4J9QA 1AROP 3BQ2A 2VA3A 4DQRA 4O3NA 3HP6A 4FS2A 4P0QB 1DOQA 1ZJMA 4KLDA 1J23A 2FPLA 1KDHA 5F9LA 3OHBA 4ECXA 2BCQA 1WCLA 2JNWA 2AQ0A 3RR7A 4YP3A 2PXIA 2F1HA 1RYSA 4QZIA 4O0IA 4NM1A 4NXZA 3PW0A 3LWLA 4M04A 4MFCA 1S77D 2AJQA 4KLMA 5HNKA 2BQUA 8ICVA 3RTVA 3PV8A 4PGQA 1COOA 3OSNA 1TKDA 5KT7A 4UBCA 3ZD8A 4ED6A 4NLKA 3N97B 3JPTA 7ICJA 2R8KA 4M9LA 8ICFA 3SYZA 4EBCA 1XU4A 1SL1A 1ZQJA 3C5GA 2IBKA 7ICMA 4P4OA 4M9HA 2W9AA 4YQWA 4KLGA 2V4QA 1S0NA 4IQTA 2A1IA 4UAZA 5KFNA 4QWEA 1LB2B 2R8JA 4O5EA 3EPIA 3TFSA 1HUZA 4R63A 4KMUA 8ICAA 1L3UA 2PFNA 4KLIA 3C5FA 4KLOA 2XCAA 3PO4A 4YD1A 3EWAA 5J0TA 1ZYQA 3M8SA 3ZDBA 4KLLA 4EYHB 2JZBB 4RT2A 4DQQA 4ECWA 3PVXA 4JV1A 5D46A 2XGPA 4C8OA 5KFBA 4YR3A 5KFQA 5EOZA 4ECVA 4X5VA 3T5HA 5KG5A 4ED1A 4ED0A 3JPQA 3TANA 2AGQA 2JEFA 4I2AA 9ICOA 4DSKA 4DL4A 2AGOA 4F4YA 1TK0A 4YMOA 1HJPA 3RJGA 7ICQA 4YXJA 2BKEA 3M9OB 4DFKA 2OWOA 5KFDA 1U9LA 9ICAA 2XY6A 1NK0A 1ZQTA 3RJEA 4FBTA 1SL2A 1RPLA 1EXNA 4JV2A 8ICGA 4UAWA 4Q8EA 1U48A 8ICCA 4P2HA 2HHTA 4DOBA 1N48A 3RJJA 1TAQA 4I2JA 4Z6DA 1J24A 5J2IA 8ICJA 1ZQPA 2MUTA 3G6YA 2C28A 5J0XA 4ECRA 5KFWA 1NK6A 3ZDEA 4KN7A 1L3TA 3PY8A 3H8WA 2W8LA 4EEYA 3LK9A 3SV4A 3ISDA 5KFZA 3UXPA 1XS9D 1ZQMA 3RB0A 3RH4A 4O5CA 5CA7A 3GIIA 5DGAA 2JEGA 4RUCA 3HPOA 4B9NA 4EZ9A 3MR2A 5IINA 3BJYA 4IRKA 1V9PA 4QZGA 1SKRA 1L5UA 2NRXA 5KG4A 1ZQIA 2J6UA 5BOLA 4QWDA 2W9CA 3KHRA 7ICLA 2IHMA 2AQ4A 1S10A 1NJXA 1MC8A 2IA6A 3TARA 3V6HA 2C2DA 2BR0A 4F5OA 4E0DA 4DQIA 5KG3A 3C2LA 1CUKA 4BWJA 4RPZA 2FLLA 2ZJ8A 4Z6FA 4DSEA 1JXEA 1ZQNA 5KFSA 4TQRA 3RB4A 2RDJA 1XSPA 1BVSA 5DB8A 4F4WA 3TFRA 4M9GA 3MABA 4YCXA 5EWFA 5KFXA 4EBEA 1U4BA 4F5RA 4MF2A 2I9GA 4J9NA 2IMWP 5J2FA 5J0WA 5DQIA 4RNOA 5KG1A 4YR0A 7ICFA 4RZRA 4RQ5A 3QEAZ 4R64A 3B0XA 4IQVA 3MR5A 4K4IA 4R66A 3PR5B 3M9MB 3H40A 4GC7A 1KFTA 5DQHA 4O3PA 3C1YA 5DLFA 5KT3A 3V7JA 2H5XA 1UT8A 4MF8A 4KLHA 1JXLA 4QZEA 1X2IA 5DB6A 3IM1A 4DSFA 4B9MA 1KTQA 2ZJAA 4F91B 3H4BA 4DO9A 1ZQDA 4R8UB 3TQ1A 4O5KA 5KT6A 9ICHA 4DLEA 1ZQGA 4DSLA 4YFKA 4ELTA 4YMMA 4NM2A 1QSYA 4O3RA 3C1ZA 5J2CA 3PW5A 5J2JA 1X9MA 2KZZA 4M6WB 3T5KA 4DEZA 1Z00A 1ZQYA 5F9NA 4I2HA 1S76D 7ICTA 4B9UA 1SZPA 3ETLA 2DPIA 4NLZA 4M0AA 4F4XA 3RB6A 2XY5A 4DL5A 4B9TA 2KFNA 4ECSA 2BGWA 3MR3A 2HHUA 4XRHA 3HT3A 4MEXA 3V6JA 4DL6A 3V7LA 4QZCA 2KFZA 8ICPA 7ICNA 1ZQKA 2BCUA 2I1QA 4BWMA 2DPJA 1T7PA 4XUSA 9ICBA 4RPYA 3GV7B 2J6SA 5DB7A 3RR8A 5CB1A 5KFVA 4XA5A 5KFHA 5EWEA 8ICNA 4Z6CA 4YD2A 2XGQA 5KFIA 3ISBA 2ZIWB 1JMSA 2NRTA 3JPSA 3N4MB 4M47A 7ICHA 3ZDAA 4IRCA 2ZIVB 1T4GA 3RB3A 2J6TA 4O3QA 5DBAA 5J0PA 1JIHA 4RQ1A 2M9NA 3B0YA 8ICYA 9ICTA 3K4GA 5KFTA 1N56A 2W9BA 4FS1A 3Q8QB 1LV5A 3NGDA 4O3OA 4RQ7A 5D49A 2LYHA 2KZ3A 2VANA 1QSLA 3UXOA 3NTUA 1MSWD 2B21A 1D9DA 4DFPA 2WTFA 5KFMA 4F2RA 5KFYA 4BDPA 4M9NA 2JZBA 5EWGA 3BQ0A 1T3NA 8ICBA 4DLGA 8ICMA 5KG7A 8ICQA 4DFJA 1BPDA 1K1QA 1S9FA 2M9MA 5KFGA 9ICXA 2ZIUB 5KG6A 1J22A 5KFPA 2R8IA 4ELVA 9ICEA 1QLNA 2VA8A 2W9MA 2HHWA 1NOMA 5CJ7A 2PI5A 3RAQA 4DS5A 3RRGA 2ZUCA 5DG7A 4ELUA 1MQ2A 2AU0A 1L3SA 3UXNA 1ZQEA 3TAPA 4GLXA 3PW4A 3ORYA 9ICPA 3OSPA 4I2CA 4TUQA 4DL2A 3SI8A 2ZUBA 2BCSA 2UVWA 5HP4A 4JWMA 5KFOA 4RNNA 4DSJA 5L1KA 2F1IA 5BOMA 3SV3A 4C8MA 5KFAA 5IILA 4FO6A 4LVSA 8ICXA 7ICRA 1IXRA 4F5QA 5HMLA 4QZBA 4F4ZA 4I2FA 4JWNA 3BQTA 3QZ8A 1S97A 5L1IA 2XCPA 3T5JA 2BHNA 4F2SA 1ZQZA 1ZQVA 4QZAA 4P4PA 3LDAA 4DL7A 2ASDA 3MDCA 4PGXA 2R8HA 5J2GA 2BPFA 4QWAA 3UQ0A 4MFFA 5KG0A 3PX6A 1XSNA 9ICVA 3UQ2A 2HHSA 1KFDA 3JPNA 2KZMA 4I28A 1ZQUA 1ZQXA 5JUMA 4I2DA 1ZQAA 5BPCA 4MEYA 1DGSA 2W8KA 3AUOA 3RAXA 3PW2A 3JPPA 3KTQA 1NK5A 1XC9A 8ICUA 4Q43A 3Q8MA 4RQ8A 1S0MA 4CCHA 2C2EA 1ZQLA 4JUZA 5J0QA 3T3FA 2NRZA 3C21A 4GXIA 3RH6A 4ED2A 5KT5A 4M2YA 3RJFA 4F3OA 4RNMA 5DGBA 4F5NA 1H38A 5HMMA 9ICUA 2A1JA
chains in the Genus database with same CATH superfamily
2ZB8A 4ZGWA 1GWNA 5B3JA 3NP9A 4DCNA 4N5HX 3OM8A 2RKBA 1BE8A 2FE1A 5I7UA 4N5IX 4FM9A 4RE5A 1I7PA 3OUZA 1YZQA 1P75A 4I19A 4J9SA 1J0EA 2IYZA 1X6JA 4PYOA 5CH3A 3GLIB 5IKPA 4YO7A 4M36A 3OE7D 2IXEA 3K9NA 3M4YA 3VV3A 3GH3A 3K5HA 4NFLA 1WZCA 2COKA 3GMDA 3QXSA 3D81A 2IUUA 2YS7A 4JI5B 2H4FA 2WD9A 2PMFA 4F92B 3DBHB 2FPMA 4CMJA 5AO9A 3C3EA 2W2LA 2EAPA 3HDGA 1U7UA 3JR7A 3G02A 1T26A 3ITEA 4LJ8A 2WHEA 1BGXT 5EJAA 5AW2A 1G59A 4XM2A 4I1RA 1XXHE 2WJ6A 4X62B 1FYWA 1ZESA 4OOFA 1ZCZA 5BOSA 2IZ1A 4MGEA 2NO4A 1YR7A 4M0CA 1VSUA 5AKEA 3NHFA 2FRDC 5T5QA 3CFYA 1H4SA 2ASLA 2WIDA 3NHJA 1G2OA 1QYVA 4DUPA 3H7IA 4KIJA 1K6MA 1AO3A 1XQWA 1XNQB 3KHHA 4FYWA 3JZMA 2DG2A 2Q5FA 4QBTA 1Y4AE 3NT4A 1E4EA 1MZPA 3NCTA 1L6IA 1E0KA 5KOJB 3OTQA 1KGDA 5FV7A 2FSVC 4MWOA 3SBEA 3EPGA 4MA4A 4QDTA 5IFKA 4QATA 4RVHA 2F9LA 4RTKA 4XQGA 2I1WA 5AJHA 2AQ0A 4ZAYA 4YCSA 1TEVA 1V1RA 5JSZB 5BV0A 1BWSA 5G4KB 5F2OA 1E4VA 1I33A 1TE2A 3RWMB 4TLMB 3PNPA 3AKZA 4I5EA 4Y9TA 5AOBA 1BTOA 5AHKA 3C14C 3TVYA 4MRAA 4KQ2A 1KDRA 1FVOA 1JEOA 2WUDA 3RWOA 3NIFB 3AM1A 3A70A 4G26A 1O0SA 4N8SA 3AY3A 3NHUA 3ACDA 3FG9A 3RHTA 4MICA 3AG5A 4B3BA 1NRIA 5EHXA 1TUEA 1T1RA 4A03A 4KFTA 2IEAA 3H2IA 1R0RE 3ZCPA 2X9QA 5KYUA 1K86A 1V8OA 2PGLA 2FSHA 3MABA 3MTBA 4DTCA 4E51A 2QW0X 4PPFA 1L7AA 4BATA 3C6XA 4P33A 1KS2A 2EEPA 2ZCVA 4XYMA 4YUWA 2XMCA 3VX3A 1PTJC 2JCBA 3D6UA 5LYYA 3VOAA 1YKSA 3ZKAA 1XHEA 5EJ5A 3OLVA 1CJSA 2JH9A 4YFYA 3NWEA 3IURA 3BSYA 3NVKI 1V9LA 4LECA 4GW3A 3RSOA 2XLBA 3RWBA 4BHTA 1HT3A 4YD2A 4UULA 3M70A 1WA5A 4M47A 1WWVA 4J9UE 4QPNA 2XHZA 3HXTA 3IEPA 3B0YA 5MN4A 3EVGA 2AI3A 4O3OA 4HAWA 2XUOA 2QXUA 1KI4A 4E46A 3ROTA 5CG1A 2C03A 1ZIXA 4EI9A 1C80A 4CMBA 4GPIB 3GGPA 1ORDA 1GGHA 2O7RA 5DLPA 1TC2A 2AE1A 4WJ3B 4EI2A 3FBWA 3F9CA 4I2FA 2J5QA 2NGRA 4FHCA 5JD6A 3UFXA 4H60A 1PUZA 4JMPA 1ICIA 4C5BA 1W2HA 2D6FA 1Z5OA 1JHRA 3R3ZA 1OYWA 1ANKA 4AK9A 1VXOA 2Y0CA 2O4UX 5U1PA 4PYLA 2YYYA 4J3JA 2J85A 5ALXA 3PNMA 1M3SA 4EYQA 2V1UA 4B8YA 2LMRA 2C4WA 1RFLA 2FQYA 2C2XA 5EIFA 1YR8A 1A9SA 3L4SO 5DI3A 4X85A 1T3ZA 4PCLA 1NN5A 3B5JA 4Y2VA 3TX2A 1SIWA 3SSMA 3BS4A 1LV7A 4MVCA 3ZDFA 5KYWB 4K3VA 4AXBA 1TKAA 3WRYA 3BE5A 3R77A 1J1ZA 4XH9B 2HGSA 1ZH0A 4E2FA 4E94A 1RYRA 1S8FA 2RHBA 3KOZA 4W1SA 5FF9A 3U26A 2CJWA 3O31A 1G8JA 5AXAA 1MKYA 2GZRA 1JKIA 1MEJA 1PBNA 1NXPA 1WNFA 3JYOA 4U0JA 2DTEA 5DIFA 1PFKA 3K09C 4V0SA 2XX3A 4Q7MB 4TMKA 4MYCA 2G5CA 1DJQA 3SXUB 4JBLA 1GT6A 4WH0A 3VDMA 2YUTA 3OBIA 3PK0A 4A2PA 3OJ0A 1HR0B 4FLEA 1HTWA 1JI3A 2D13A 4CTNA 5HZHA 2VHYA 2JGNA 1GR1A 3U17A 2DFNA 1ZICA 2DM6A 2G40A 3WKCA 4GD3Q 1XZGA 2Q3HA 4BVBA 2B1IA 5AUNB 2XB2A 4D4IA 3T52A 2PZBA 4KFUA 1TK3A 1P7YA 1EJ6A 1K3UB 3CCCA 1O89A 7ICUA 4J1NA 4QOEA 1DKQA 5TF0A 4B83A 4MGHA 3D3NA 4M22A 2Q41A 5HYVA 4BFWA 3GIKA 2BAGA 1MH1A 4PICA 5G1OA 1BFDA 1SVNA 2HBYA 1C2TA 1X77A 4CRXA 1UF9A 4YAIA 4IOJA 1P91A 3BXXA 3UAXA 5THXA 4KSCA 2PT9A 4OJLA 1N2IA 5KVSA 4PN7A 3GPLA 4YP5A 3U4IA 1P1HA 4J6FA 5JWOA 3Q8XB 4KXWA 1V8DA 4HK4A 2PTGA 1E5VA 3BFKA 2D2VA 3W6UA 4HRAA 2R5FA 2BEWB 2O8DA 1BNOA 1PP4A 3ADDA 2DEUA 4R3NA 2PK3A 2V3WA 5EOZA 1Y9EA 2Q4EA 3AKEA 4ZEVA 1YFLA 2ZUTA 2Z2JA 2QL6A 4YFVA 1ZQTA 4JVLA 3V55A 5IDYA 4Y2PA 4N0EA 3C43A 3RSSA 1GO3F 4V24A 1X7XA 3RC3A 1NN3A 1K75A 1W35A 3DBOB 2NRXA 2AUMA 4LJ4A 3NWOA 1E61A 2JEZA 3GNLA 2H18A 5GVRA 1ABFA 2P11A 3FNFA 5IHPA 4HSGA 2KM1A 4KQIA 3I0NA 1RI5A 1W49A 5KFXA 4YRTA 2I9GA 1WU7A 1ZZGA 3KB6A 4JB3A 4HEA6 1E5TA 2Q6TA 1AKWA 3IJRA 1KYIA 3ZNOA 3W04A 4UUOA 1DJLA 1ZKDA 3TF5A 2YWHA 1THGA 3CW2A 1SZPA 4B2IA 1Q0HA 4BV9A 4F5EA 2HHUA 4PF1A 2YXNA 1M9NA 1QFZA 1ZUHA 1EDOA 1L5QA 4DNFA 5DTEA 3GHHA 3C8ZA 3G1TA 1ZO8A 4RF3A 1ENYA 3AOEC 1J9GA 5KFTA 3EEQA 4RKRA 2YQ5A 2VANA 3PX2A 4XE5A 5JWHA 4RIGA 1V11A 3HILA 5I4BA 1Z4JA 2WWFA 3B1YA 2YXLA 5JIBA 1NBWB 2VQDA 4TPKA 4NL9C 5A3SA 1RKVA 4AJ4A 4ETMA 1WSBA 2JGDB 2FEWB 5JY6A 1HL3A 4RK1A 1YB7A 4HH3C 4WECA 2CBZA 3HRKA 4KE8A 4LSGA 2EP8A 3P2IA 4NJ8A 2HI0A 5CXXA 4YMUA 2OR3A 2B3DA 3UMMA 4B7ZA 2LIVA 3GC6A 4QFBA 2CGEA 1EEHA 3QLUC 3DBLA 4P2GA 1L8OA 4B9SA 1F6WA 3GELA 1L0BA 3Q0TA 3TCXB 1JG4A 1AQ6A 3W0LB 3CNBA 3LT5A 3RS7A 3GFOA 3FSRA 1H9BA 1KVQA 1HQDA 4EHNA 1BPBA 4UBJA 3NC0C 3SMVA 2BCGY 4J0EA 1ZN8A 5ALEA 3T7TA 2P6UA 2XXAA 2ODGA 2WIAA 4UAYA 3HFJA 4PYMA 4J9KA 5HIJA 4WERA 3GA7A 2B1GA 1EM6A 1V39A 1KJZA 4CTOA 4PQFA 2ZJ7A 4ZVVA 4S12A 3F47A 2RGWA 4TS3A 1Q0SA 2ZAOA 4YCDA 4OX9B 1RXEA 3DTNA 1NI4A 2WTBA 4NLGA 1US8B 3PNVA 4LXHA 4KLAA 2FQXA 3P71T 3WL8A 5ALSA 5HF8A 4U39A 1OV4A 1WCNA 2OZPA 2QZ4A 4IJUA 4OGLA 1T5LA 2H16A 4B74A 3SF8A 4QREA 4IJVA 2XNSA 2HA6A 4JMUA 1ZETA 1K0UA 4P5DA 1NKSA 5G3YA 3WE7A 4MUGA 5BMVF 2C31A 5K3DA 1ZW1A 5A9TA 2EZZA 3FTDA 2HXYA 4W5TA 3JAWB 1W0KA 2FKNA 3O83A 5B1YA 4JOSA 3FD8A 3OQ1A 4M54A 4HHEA 5K5EA 4IIEA 3I5AA 5LQKA 1M75A 3SHQA 2WYOA 4L5IA 4AY2A 4GOMD 3NRZA 2GJKA 3H19A 3THYA 4NHOA 2PRKA 1Y6ZA 1VCHA 4MV8A 2INGX 3EXEA 1XVUA 2QTLA 1AB6A 2PH1A 3W8EA 5TF4A 3OZCA 1PJ4A 2GM4A 2IYYA 2A92A 1N5IA 1BJRE 3OETA 1G9TA 4JJZA 3RK1A 1P61B 1BO6A 4V02A 4GGMX 1TT5B 2H1HA 5CH8A 4F4YA 1GR0A 1OBCA 3NUQA 1G20A 4YXJA 2BKEA 4XD7A 4EM6A 3I9V1 3E48A 4WN9A 4AY3A 1WW2A 1K2VN 3GIIA 5DGAA 3P0HA 3EDMA 3N2LA 1MDBA 3RUAA 4BWJA 1N4DA 3E5RA 4EARA 3WYCA 1WVIA 2I8CA 3I73A 4EPVA 3HYSA 3TFRA 1R6DA 3FDXA 5K05A 2JRCA 2P2GA 1CE8B 4IQVA 4JLNA 1NW8A 5KT3A 1EXVA 1EA7A 4HB0A 1VRWA 1AK2A 4WDQA 3R2JA 3F1KA 5KWIA 4NPCA 4CJXA 3R7FA 2GM3A 2CVZA 1P4AA 5JCOC 3OOWA 2Y71A 2GESA 1KPGA 3UKJA 3CLHA 5EIXA 5DB4A 3C7KA 1BX3A 3HJFA 2Z0MA 1P1BA 4XGKA 2W11A 3MWKA 2HBJA 5ADWA 2C2BA 2ZRQA 3H2ZA 3MS7A 3UA3A 2GD1O 4HNQA 4FYMA 3MAGA 4U3JB 3EDQA 4AULA 1VBFA 4ZKEA 5I4CA 4Y9UA 5KVCA 5L7TA 3WAGA 2ZUBA 3AZOA 4RHXA 3JQRA 3SMQA 1P5JA 1GRCA 3TAHA 3ZYCA 2G1JA 3QU2A 4C30A 1J4AA 3NFYA 4ENTA 4LRSB 1UPCA 4U7PB 3HV2A 1N3LA 1E7SA 3Q8MA 3JYPA 2EZ8A 1Q3VA 3L9WA 3IBYA 1IUOA 4IG4A 2V7VA 4DRZA 4QLBA 1AUVA 3MMZA 1TUBB 1VRCA 5JD4A 2HRRA 3H8SA 2J48A 5DM1A 1Z28A 3NWPA 4AO8A 3FR7A 4C03A 3KLBA 4PBTA 3CF4G 4L08A 5J2HA 1BQ3A 1Z73A 3L0DA 2GSDA 4F2DA 4JV0A 5TE9A 3PJDA 4D98A 4BC0A 1YRYE 4QARA 5BMVA 2H2WA 1P8JA 1Q95A 2Z8ZA 2O1WA 3AF2A 4GLLA 2DGDA 2C8LA 5DGXA 2EARA 4QXPA 4YUYA 3ROXA 1DJNA 2PRIA 2V9WA 3IMFA 3OFNA 2PUWA 1XZHA 4RTOA 1UFRA 4GZ3A 4YMLA 2YWDA 2YCLA 4C4YA 3H2KA 3L46A 5DCUA 1H2XA 1NVBA 5DYIA 1IVSA 4K1LA 1SHZA 3C48A 4Z8XA 1X7DA 2DB3A 2JJ8A 4B33A 5DMHA 1HYBA 9ICKA 3LWMA 3ELUA 3PUJA 5GM2A 3THWB 1UA1A 4D9JA 3CLRD 1IHXA 1K89A 3PVSA 3I04M 4FFNA 5AI5A 3TQFA 2QRMA 3Q15C 2F3PA 1UBEA 5KUTA 5EXTA 3PKJA 3TSAA 2HK9A 3R7NA 4YQZA 5AXCA 3FWYA 2SKDA 1UBFA 1OBFO 2D1QA 4BAZA 5DBGA 1R5JA 1KQ3A 1HOXA 4PLYA 5I9SA 5HQ3B 2XY7A 3VYVA 3CNNA 1U5BB 1OLUA 1PK7A 1FZQA 5IC4A 2EX0A 4LI3X 3G89A 8ICRA 4RQMA 3ILHA 1VLHA 4HXFB 2VQFB 4F93B 3N7TA 3PE6A 2WLSA 4D44A 2DOKA 4UDOA 1ML4A 2O6KA 3R3VA 1UC9A 4OB8A 3RSQA 1ST2A 3HJAA 2A4KA 3LLMA 1AD2A 1V4BA 4HUQA 4WLVA 4JI3B 1OZ0A 2I99A 2X4LA 4KKVA 2JMGA 1H22A 2V4QA 3K4HA 4HNHA 1J8YF 2C78A 5HILA 3PJEA 4ZQGA 3MJFA 3ZGOA 5BSHA 3SLRA 4XJTA 2H2AA 1IQ0A 5DYTA 4IXMA 1R27A 3W79A 4IIJB 2QENA 1R0WA 1QAQA 5ELMA 5M29A 3MJHA 3HXOA 4ZZ3A 4FBTA 4MXDA 1ONBA 3OOJA 3CQ9A 3CO0S 4YRMA 4H7IA 3AJ9A 3K0HA 2HQSA 1R8YA 4F5WA 4LYHA 3L4PA 4D9HA 5BSTA 4OHFA 1IM2A 2AOXA 3CNLA 3FYSA 3RRYA 5C8ZA 1MOSA 1YO6A 2D6FC 1L5UA 1N5MA 3G2LA 5K3CA 3RYIA 1SEVA 4DQIA 3GBVA 4NQZA 2HF9A 2F3QA 1SVLA 5BNWA 1QP0A 1GV1A 3HN7A 3ZIAD 1QP7A 5GGXA 5K0JA 4B40A 2OFXA 5SYMA 5GJWC 5GJBA 3K15A 2WTEA 5JRDS 1NZBA 5KYVA 1IDN1 5BW8A 3QEMA 4XRHA 1EDEA 2JAXA 3OO1A 4YT4A 4R8MA 4C7MA 4ZPJA 2V0NA 3TIFA 5J2UA 2G77B 5F5LA 2QN6A 2IU3A 1ZLYA 1XTTA 1T6YA 3WWPA 2OHVA 4QYTA 1ZN2A 3AUUA 2I3AA 1QG0A 4QDXA 4QPJC 4XVRA 4GUDA 3UT6A 2UYHA 1GCGA 1ZJJA 4YCCA 1QLNA 2YOGA 3WWOA 1U1CA 5ES4B 2PSFA 3JZAA 4W9RA 2AXNA 3A9CA 3GV0A 3OPYB 4G8DA 1YCGA 3F2IA 3D2QA 5CD1A 3SNHA 1PRYA 2YZNA 3LDAA 3UYKA 2CNKA 3F6CA 3ICOA 1AKMA 3REQA 4JP2A 3LC2O 2DU8A 4BJ6A 2DPLA 4W7IA 4FUQA 3U2QA 3FF1A 1P3DA 5BVGA 4Z3KA 1GEEA 4TTQA 2J0UB 4LUCA 3UK6A 1GRVA 3P45A 2ZRAA 3S1AB 3GLHB 5HA5A 1G8MA 2HCTA 2AZMA 4MSUA 4GXNA 3DH0A 1BPXA 1NE7A 4EO9A 1V16B 1SA0A 4HAOA 4Q4CA 4MHOA 2Q8QA 4CMIA 4F46A 1JXQA 4KIFA 3PXDA 3WAJA 2YDXA 2JEOA 3OD1A 4MQEB 3AKYA 4GMHA 1PW7A 5HGXA 3ZHOA 4CIYA 2W3SA 1YHNA 1M0SA 3HPQA 3RUPA 4DXDA 4MVJF 2NUPA 4LV6A 4GQIA 4RSGA 1ORVA 4BBPA 1QH8A 4KE6A 2VK2A 2G0TA 3RVKA 2CDAA 4GBMA 2HHVA 3PX4A 2HO4A 4INZA 1YMUA 1L7OA 1N5JA 1M34A 1RPNA 1TCBA 2KD1A 1LKZA 4IGFA 4FZVA 4YCNA 1OAAA 2W0MA 4C7YA 3QBDA 2Z57A 4BMCA 5TMEA 3H17A 2PJDA 1ODFA 3GLVA 1KFEB 3E0QA 4IZOA 1TFRA 3U4MA 4YDQA 3JASA 1FFAA 4YMNA 3V1LA 1LDMA 1Z7GA 4RORA 3T5DA 5KTKA 1AK1A 4IQ8A 1A27A 4Q16A 5DHAA 3DV2A 4XJXA 1KE2A 3QVUA 3NT5A 5T67A 3GAFA 4DFDA 3OURA 1UIMA 1Q7GA 1CDZA 1R74A 2DWOA 4NNJA 1UKAA 2A9PA 5IF9A 1NRXA 1XYVA 5ICEA 3C7DB 2O7NA 1C20A 1D0IA 1LWNA 2GT1A 2YCBA 2VLIA 5HX7A 4EVQA 2ZJ6A 1WSWA 2X1VA 4ZODA 4EGQA 4QYWA 4V0RA 2NO5A 1IIPA 5J2AA 2IYUA 1X1DA 3HCAA 4GYYA 1Y1SA 1G8AA 2FJPA 2RGBA 2C4MA 3CW2C 1WB6A 4U6QA 5J2DA 4PHFA 4DR2B 5G0UA 4WQMA 5KQRA 4ZOQI 1NI3A 3AJDA 4MLCA 1PNRA 4EZIA 3K72B 3EXIB 1GD1O 2MMCA 1A9RA 2RCYA 4P4OA 2W00A 4DSZA 3K92A 4NOMA 1Z63A 2XMPA 4YMHA 1BMQA 3EIHA 4F45A 4ZOCA 5A71A 5G3ZA 5C1IA 3FYDA 2HK8A 2G6BA 3V8QA 1EZ4A 3QQ5A 3MD0A 4P84A 4KVFA 1Z35A 2M6KA 2LHTA 1TM7E 4IDEA 2EKBA 3G3EA 3UJPA 4L6IA 3EUFA 3VSCA 3E9YA 3T0FA 2CVQA 4URFA 2NADA 3MYYA 1I6LA 4ETWA 3VR6A 5CT6A 3E03A 5KMGB 2FPSA 3DWFA 1A4IA 3WMFA 2W42A 4HDSA 3MXTA 3AEYA 2DJIA 1AN9A 5K4AA 3MMXA 3NHKA 1R1DA 2O57A 4II7A 3B85A 3WZMA 2FN3A 1T3SA 2O06A 1VI6A 2Q1YA 2E1PA 4HOYA 2QLMA 4YFKA 5B37A 2IW1A 3BE8A 3KKEA 2H85A 4V0ME 7ICTA 1FMCA 2P6NA 2Q6IA 4C4SA 2DBVO 3NNNA 4V0NA 1Z2AA 3VSAA 1F2UB 4O2RA 2OMEA 3CZQA 3EFHA 3WY9A 3VUEA 4IRUB 4QT0A 3K2QA 4F21A 4NRDA 3N75A 3CTMA 1UBCA 1E9VA 4JLUA 2XT6A 1DC6A 1E1NA 4YPOA 3PEFA 3C3CA 4K3UA 1ZMOA 1KL7A 5IVHA 4BC1A 3FFBA 1J06A 5D85A 2KQUA 3IAM1 4UM9B 2B0CA 4F71A 4NENB 3NKVA 4CQLA 2NUAA 4ZCRA 3FWZA 4MVJA 3JQPA 4OJTA 3IKVA 1GJRA 1D5CA 4UTRA 2XE7A 4RW0A 1T9HA 3A2LA 2P90A 2Y1EA 1QQ7A 2ERCA 3DGEC 4E5UA 3RIHA 3PXXA 4R1TA 4Y6LA 3IXMA 4PNHA 4BNMA 1K9VF 3MA0A 5J5VA 3Q85A 1ZM9A 5KNCH 1XEXB 4HPXB 3EARA 4ED2A 4DA4A 5TPZD 4EX7A 3KDSE 2XDYA 3CA8A 1G8YA 1CQIA 1LXCA 1HF3A 4J9PA 3D5QA 3NYQA 4CM9D 4LFBB 4RELA 1Z08A 1W94A 2LKDA 3U7HB 2A57A 2AG1A 3G1WA 4ZHQF 4HLNA 4AJLA 2P5SA 1RXYA 5H3CA 4KUHA 4B48A 3ISTA 5FCDA 1OH5A 1XXLA 3WNDA 3LHSA 4KQFA 1M72A 3NIWA 2X13A 2JAUA 5AW7A 4CKBB 2UUCB 5AM4A 2WU0A 4PX9A 1RWBA 4MI6A 2FY8A 4IIFA 1IN5A 4PVDA 1YFJA 1NRJB 4IKPA 3FKSD 4XIYA 3BL5A 3EHDA 1AS3A 1YNOA 3P5SA 1EXDA 3TLGA 4F8EA 3DZDA 2HA2A 2QMQA 1GILA 2Q0QA 1FDOA 5AVRA 5CIYA 2C58A 5AW5A 5FLYA 2CVOA 1T29A 2DC1A 5K3FA 4B0PA 3OJSA 3G2MA 2CJXA 5KCMA 4ND6A 5JH7B 2FWBA 3ASZA 2YV1A 1OXBB 1E3IA 5HF9A 1VL5A 3BEOA 4BASA 1B8UA 2IUFA 3WISA 3L40A 1EX6A 4ARBA 1U7TA 5IM4A 5A6VA 4X3OA 1SU8A 2MSEB 2UVUA 2NQ2C 1E0JA 4IILA 3RFXA 1A8SA 1G21B 3MCTA 4GPD1 3JZIA 2QTWB 1XDBA 2QRLA 5K01A 3RABA 2IXBA 4NIMA 2FFJA 3MXOA 1JNYA 3ADKA 4QTTB 3LX5A 2GEDA 4H4EA 3IAXA 5F12A 1J0AA 4B8ZA 1CTQA 1KAHA 4KX3A 3WKEA 1SKQA 1YONA 1NQWA 4QZIA 3HBLA 2AJQA 3UXYA 2FEMA 3X1WA 2LTAA 4R5HA 1XRNA 5L1MA 1VKZA 5CUQA 4BEJA 3COWA 4D8XA 3L7KA 1K6XA 3DZGA 1T5OA 3P0FA 4ASUA 3GOQA 5GMOA 1BG6A 3A0UA 3VH4A 4WEQA 1KYZA 2ZGVA 1KETA 2VJMA 4GT1A 3D3EA 4LHZA 4J0QA 5B58T 2BGTA 3D6NB 4DC9A 2P68A 3JQGB 4P2HA 3ZEIA 4RSHA 7REQB 2ZDGA 3STTA 3BTSA 3PQ7A 3PY8A 3BOSA 3CRZA 4J75A 1NW9B 4L1KA 2QT1A 4N8DA 3CRMA 3Q7RA 4HQOA 2ORWA 4MRMB 4DR4B 4MARA 1M1NB 3UANA 1PS0A 2ISCA 4ALJA 1IWBB 4X84A 4R64A 2G88A 3OHPA 1BROA 4MHVA 1A3CA 1KTQA 1MAAA 2FN8A 1YZHA 2CRXA 4PO3X 4G9BA 3ZJ4A 2J0VA 2YVUA 3PGLA 5K8CA 4DL5A 2RSLA 4Y3UA 4UVGA 2BCUA 4LXGA 2RBKA 1M2FA 2WAQC 1XZDA 2XQGA 2GLTA 2VJNA 2OO7A 4DY4A 4HI0E 2OK8A 2QR2A 3N0RA 3GVXA 3ICQB 1YZUA 3AOEA 1RHMA 4ZHQA 2I66A 3ZWNA 2VNKA 2O2HA 3X1KA 2QN3A 1K1QA 1K68A 1RYBA 5IULC 4IVNA 1C30A 4DUZB 2ZR9A 4LRYA 3I28A 1ADYA 1CUDA 1FFDA 5AXDA 3IGFA 5ESDA 4CG3A 2H4ZA 3FXAA 4JCCA 2QPAA 1NLZA 1O8BA 3K71B 5B12A 5GTHU 3H2BA 4IQGA 4R71A 1QIEA 1Y6RA 2RHDA 3PLNA 2C5AA 4ARAA 3PRKE 4YQYA 1U6IA 3ES9A 1XDUA 3HKDA 4HX5A 2Q3JA 5D84A 1F8XA 4V38A 2HVHA 1ORRA 5KYYB 1NFFA 3HO8A 3ON5A 3GLRA 3EPRA 2JEYA 3WWEA 2G5GX 1I4WA 3KKPA 4J7AA 2KJQA 4RY2A 5I9MA 3E1SA 5FI0B 4M9QA 4UBKA 4FYKA 3TZKA 3TRDA 3C41J 3PF9A 4HS9A 5CG2A 4HYTA 1N2OA 2FPWA 2HQ1A 4HUTA 1F12A 2B1QA 2YHAA 1ZJWA 4C43A 3HW8A 4CN9A 4EKYA 1JEQB 3TBKA 4F3CA 3A14A 4K81B 5EIOA 1JP7A 4UTNA 1FX0B 2ZVPX 3DFZA 3PDJA 5EHIA 2G08A 3S0JA 1FLAA 2CXXA 5LN1A 3CTPA 2EP5A 3WYFA 4JYCA 3L7CA 3JD0A 4GKVA 5U4QA 2FUNB 1B43A 1NBMD 5IT9A 4MVJP 3NBXX 4PO8A 4HZGA 3WA6A 2UU9B 4FMCB 3GHYA 3LUDA 4MRSA 7ICIA 2OZVA 1UMBB 4HH0A 4RX1A 4BL5A 4Z7NB 1JLRA 5AKXA 3K35A 2EKPA 1NW3A 3ENZA 4P5PA 3ABQB 4Z6EA 1MA0A 4CCYA 1LQ2A 1EINA 2O2ZA 4NX2A 2Q0ZX 5JRJA 4K6FA 4HVAA 2JH7A 1UFKA 3KK0A 2JDID 4BFZA 4IR1A 1J09A 4C06A 2PPLA 5JXIA 3GFBA 3IUQA 3EZYA 2CK3D 4E7OA 1TW3A 3MFQA 1H2BA 4FBUA 4FP9A 1PKEA 1JPNA 3HNRA 2BN4A 2HGZA 1ORHA 1FUKA 5KNBA 1J8QA 4AWXA 2AB0A 4A4DA 2ZAIA 2WD7A 1LA2A 1SY7A 1O77A 1TKCA 2IOQA 5JU6A 3U80A 2PX2A 3BVPA 3HI6A 4ZQHA 2VA3A 3L4BA 5EYPA 2XQVA 1J2UA 3QH4A 3DT8A 3BF7A 1W73A 3PW0A 4BVKA 3DOIA 2VBCA 3V33A 1IBSA 2HTFA 3ER8A 7ICMA 3H5WA 4XR9A 4ERNA 1CJKC 2WZCA 2Z8YM 2OBLA 3TK1A 3BS7A 3TTWA 4R1PA 1X19A 3ZHBA 4YPFA 3S70A 3OVMA 4RKEA 4JSRA 2PKYX 1TFUA 1ZYQA 3DMTC 3CBQA 1XLVA 2Y67A 4FLMA 3KQKA 1CS4C 1E4YA 3N7RC 2A3NA 4DKXA 2XZOA 4RL6A 3EDYA 4UAWA 2PAAA 5DX0A 1LJ8A 2VH2A 2BEUB 3HCCA 4ID3A 3C4VA 5DM70 2XUFA 1D2RA 4Q1FA 4CIVA 4JIMA 1A8PA 1IJBA 2DE0X 4KQXA 4WNCA 1E94E 5ALRA 2ANCA 4R2KA 4WJLA 5FD8A 2FFAA 4MAFA 7ICFA 1LC3A 4GC7A 2EW2A 2J3DA 5AKGA 1UT8A 5HSGA 1K3TA 1TMYA 3JYHA 1KNQA 5KT6A 3BQ7A 4YMGA 1QSYA 3C1ZA 3V9PA 2KZZA 3ZU2A 4M8NE 2W90A 3T1TA 2WU3A 5DXFA 4W1QA 1FE8A 4FWTA 2POCA 2ZSHA 3P9ZA 5JCOA 2I29A 1XNSA 1FDRA 2BTOA 3KB8A 4U2FA 3TOZA 2VK8A 3JPSA 1VKOA 1QC5B 4BKUA 3RBAA 4FIZA 2XB4A 1PK3A 4IAOA 4RQ1A 2DSTA 2WJ3A 3K0KA 4NXNB 1OZAA 2PFKA 2C8VA 4Q21A 3CEHA 2YFYA 4R54A 1GAEO 3CLSD 3GWZA 2J59A 4NTZA 1S01A 2VA8A 4PAQA 1LBQA 2RAPA 3M82A 4KAJA 3ORYA 4EY7A 4KHPB 4DKJA 2GRAA 2CXNA 2DRIA 3JQ8A 1MVOA 2WU4A 1UWVA 2QIOA 3IVXA 5C3MA 1RG6A 3P2EA 1KAEA 3IODA 4ZANA 2V5VA 4DMCA 4HPWA 4IR7A 3KJNA 4H18A 4Z4QA 3GJ3A 4US1R 2GEUA 3K9WA 5A0LA 5IWAB 2ZRBA 2IUYA 5FPSA 1XVTA 2FE9A 2ZRGA 2V6BA 3K94A 3JWIA 4JDUA 2IPAB 5H16A 2ENWA 3GL9A 1SC4A 4KYIB 3OM0A 5GOTA 2GCPA 1SXQA 1AZLA 2KJ5A 2Q8PA 2C29D 4XVHA 4DMGA 2YKGA 4RO0A 2KICA 1P2FA 3H1FA 3HABA 2ZI9A 1YBMA 3IQEA 3PI7A 4OLFA 3GOHA 3KKNA 1NQVA 3CVWA 3ORSA 3LKZA 3TZBA 1FSPA 4YUXA 1O58A 1H5NA 4FKMA 3RW9A 4P92A 3BMQB 2F90A 2HWWA 5FUWA 1NYRA 3GDXA 3ANMA 2CHUA 4DYDA 1MX9A 2CXOA 3K0CA 1TLFA 4NV1A 1CP3A 3R0ZA 4I29A 3ZGZA 1EFLA 2MA1A 1V6AA 2P0AA 5B64A 4JJ6A 1ITZA 3GILA 3GMIA 3LRPA 1ABEA 2WE8A 4XEHA 1A8HA 3W5IA 4ECUA 4OQLA 4UVEA 1KQQA 5AW4A 3EBOA 4BNDB 3KUCA 3IBCA 4HDKB 1R6UA 1BXRA 4G3IA 3P27A 4JUAA 1LGYA 3MRXA 2WIJA 2CBGA 1SMKA 3KHUA 2Q21A 3TKAA 1YS1X 2A86A 2WM2A 4MW4A 2WHRA 4ISCA 5K09A 3WDSA 4ETNA 1E2BA 2XKJE 3EW9A 3L4JA 5MN5A 2DECA 1DX9A 5F78A 3ERCA 2FF7A 3FPCA 3EA4A 2ZYGA 1EUQA 3A1UA 4XJVA 2DF8A 3CRQA 4JCOA 4I1VA 4DSIA 3TJMA 4Q4HA 1Z25A 3EPPA 2ZS9A 1N2SA 4BBZA 5C34B 3I64A 2ZIWA 5GP1A 2H48A 3OE4A 3X2SA 1SXJA 4URZR 3WLOA 5L3QB 2JGLA 3KXDA 2BY4A 2D0IA 5CM9C 2A9OA 4KLGA 4LYYA 3DZIA 1R6XA 1T1IA 2QVYX 3SCZA 3WYBA 5E2IA 4JC5A 1JEJA 1QH0A 3QU7A 3A4VA 3SQLA 1FMJA 2GZ3A 3UJAA 5KL1B 4MKHA 5D46A 2A9FA 3LPDA 4NVRA 4TS9A 3MMSA 2NVBA 3O84A 1QZUA 2DFDA 3MBKA 4AMYA 1VLJA 3EIUA 4COKA 1KWKA 3L7LA 5ERYA 3DZ8A 4B9AA 3RB0A 3TYXA 3I9FA 1EFUA 2W2KB 3T3EA 3TCNA 4ZZIA 5I01A 2HCFA 4Z4IA 1COKA 1FXWF 4Q1BA 3AY7A 4OHCA 4REQB 2X9VA 1DBRA 2WB2A 4MIEA 1QMGA 4TRMA 6YASA 1ZKMA 3OMLA 4LMAA 4Z99A 4ZZ2A 5K2MA 4H3SA 2I34A 3NNSA 1HDGO 3BTOA 1FDVA 4AIRA 2C97A 4W6ZA 3Q2KA 2CMDA 3JPYA 3H8MA 2PZLA 5DASA 2OBBA 2Q2WA 2QRQA 2WBLC 3M6ZA 2W93A 2BFWA 3DZBA 3TOXA 2SNIE 3T9FA 4HMQA 4BNWA 5C5IA 4GI1A 1LQTA 4FFPA 1KEWA 2LYHA 1EFVB 1KFBB 3EC2A 2XBMA 4FS3A 1HNWB 3CLTC 3I9MA 4BJQA 4TTSA 4MKZA 2RGYA 1D0VA 1QK5A 2ZT7A 3N87A 2ZWVA 1GFWA 3FSEA 3QVTA 1NXWA 5KFOA 1GN8A 2BJVA 1ZCAA 3L6EA 7ICRA 2RHRA 3Q98A 2NUBA 1ZWKA 3WU2U 2NU8B 5FOTA 3QU5A 1OWNA 3TQCA 3EGDA 1E18A 2XQKA 4FWBA 5CJJA 3TH5A 3RYFB 1MDFA 1W4BA 1DDIA 2LVBA 3G0CA 3D8BA 3AONB 4EY4A 1X7ZA 4OREX 3ZQKA 4IZHA 5DP2A 1Q3KA 3WYAA 3URMA 4C2UA 2YHBA 1NHWA 5B6JA 1M73E 2SKEA 4GU5A 1IPFA 1KHHA 3V5NA 3BN3A 2OH2A 3I2HA 1YKGA 3IXLA 4DBVO 1LX6A 1OH6A 1CEZA 1VPEA 4LQ4A 3LFHA 2OFOA 4FKZA 1T2EA 4UB2A 1XKLA 1RRKA 3SC2B 1GGFA 1PWZA 2O0HA 1CB7A 5B6PA 1FU4A 3NU1A 2ZBUA 1LNQA 3RU3A 3DZFA 5TQ2A 1QWSA 1NDQA 3DCJA 3M8KA 1Z1BA 1HNNA 2C3UA 5AKZA 2QUJA 2E8NA 2CV1A 5DGIA 4KR3A 3I8SA 1HYHA 3LQ4A 9MHTA 1NJWA 1XVAA 4N7BA 4Q6BA 2BTEA 4L50A 1GO2A 4MS3A 4YRQA 4LWOA 1NVGA 4GL2A 2G5IB 3LKVA 1XTUA 1X1SA 4ISBA 4XAQA 2ZAGA 4UMFA 4LZDA 1OZGA 1WXEA 4CMAA 3RKSA 4JLSA 3W1EA 1XV5A 3IJPA 2P3SA 4WUTA 5JBIA 3EYZA 3HNPA 1QIKA 4DSOA 3E18A 4IHKA 3CPEA 1YD7A 3R9XB 4GL4A 3WX0A 4QWBA 4X63A 2DLNA 4M49A 2FG6C 5J2KA 2Y1CA 3QUTA 4QZHA 4ER7A 1EBBA 5JNRA 2GOYA 3W7AA 1Q92A 1RT9A 2PI4A 3S27A 2FPIA 5AWFC 5EJEA 3TQRA 3MFHA 2NVOA 4UHHA 2IY8A 3GQVA 2NQ8A 2OZLA 5I9TA 2RGEA 1NXVA 4F1WA 4KLEA 4GNKA 2OSVA 3KYDA 1EX7A 3R4VA 1XP8A 4BQOA 1RDFA 4Q3AA 2BGIA 1RKQA 2PZEA 4GC6A 2NZYA 1FXWA 1WNTA 1UBJS 3GN1A 1T91A 4G24A 5EMLA 2VNIA 1L8AA 2E5LB 2QRKA 2IYNA 2F4NA 4LGVA 1IRIA 5JNSA 2PXIA 3VSBA 1EX9A 3BKWA 1Q7EA 2PLAA 3A11A 3AVXA 1K9SA 5AIAA 4ENQA 1NVDA 2XDQA 3OICA 1ZMXA 4N5MA 3KQTA 1CIPA 3KJHA 5ABPA 3USCS 2DULA 2Z2YA 1N5KA 3D8RA 4MMYB 3TQQA 4YUZA 3M2PA 4XB1A 2WYVA 2IK8A 1NPTO 2E5SA 3NP7A 4YRFA 5D01A 2VRCA 4I08A 4BJ3A 2G71A 2NU9A 1ZRNA 2FWJA 5KCZA 3RJEA 4TL7A 1I9CA 3RJJA 5HBRA 4O0LA 1YBAA 2OVBA 4AO6A 4RNDB 3E9ZA 3JD2A 3BM5A 2XRMA 4RSRA 2FGKA 3QWBA 4HWKA 4HJRA 1X1RA 4UFNA 2FQWA 4HAZA 2IA6A 3WGJA 3RIXA 2JATA 1RBZA 4X60A 3P9QA 4Q6WA 2W6MA 1K4MA 1Z33A 5J47A 4Q4AB 4GLJA 4H1VA 3FAKA 3L02A 4RD4A 2X2EA 3S2GA 1GSAA 2KWIA 2H3IA 2VNSA 2G7ZA 4AKGA 1ACLA 4GX0A 2BD0A 5JS8A 2LR0A 1X9MA 1ODJA 1S76D 4MYTA 3ZZUA 4D57A 3RCBA 3VKVA 1K8QA 2FG7C 5LSAA 3BWYA 5TGDA 1HH4A 4JZKA 3T3PB 3QXCA 4UEKA 2QGZA 3L6RA 1QFSA 4I5IA 4R3WA 3C7AA 1PNTA 1DAIA 3EIWA 5A2QA 2UVPA 4JITA 5ISMA 1R18A 1T8UA 4MQFB 4U7FA 5LQJA 1KQOA 3E82A 1Y63A 5DO9A 3NVAA 1P33A 1V5FA 3LDGA 5EMNA 3H3XA 3GROA 1YQWA 2FN4A 2YRFA 1Y8QB 4FTWA 3RRBA 5KG6A 3GAMA 2HBMA 1HEYA 2RB5A 5EOVA 5C80A 1XCLA 4PYKA 2R7MA 2VQ3A 5GTIU 3S3TA 2WAYA 4M1WA 5ITZB 5LA6B 3SG0A 4LFCB 2PKQO 4R0NA 3MDCA 3E22B 2YQEA 4U6SA 2BISA 4CXMA 2ECFA 4IGIA 3I1YA 2HWKA 4GOJA 1GKYA 4RQ8A 4MR9A 3VR4D 1GFSA 3CUUA 1QGED 3M4XA 3QELA 3QFTA 6Q21A 3PPWA 3ER9A 3DD5A 1L3BA 1HIWA 2JI6A 3P0EA 5DE3A 2I7VA 5HJEA 2CDNA 2O8NA 5JE8A 3ZD9A 3FDSA 3PUHA 2XUQA 1SN7A 1GPYA 1U04A 1T9KA 2CMHA 2WAQF 2EZ9A 2J3EA 1C3JA 2JHDA 4JKYA 3OQIB 3RUIA 4C0LA 1WMSA 4RF4A 1UPHA 2XNCA 3OHMA 2CN1A 3EB9A 1M1YB 5JO9A 3RD5A 3KSBC 3K0FA 3L4BC 5KFRA 4QULA 1G9XA 1SOWA 4NP6A 3E2MA 2HCJB 5IJXA 1JPJA 1I4DD 4NS1A 3UWOA 3WL4A 1G6HA 1NT2A 2I6XA 1O57A 2QL7A 5TPWB 4OMFG 4CFYA 4FE4A 5ILQA 1D6NA 4HYKA 2ZEJA 3UQZA 2W98A 2VJAA 4R2LA 3DOEA 1ZXXA 4QM7A 3CR3C 4QQFA 3U9TA 2QLNA 2QV7A 1SD5A 2DHDA 5CB6A 4CM8A 1BYUA 3IILA 2WTNA 4L16A 5C5CA 4TV9B 3V7KA 3KHLA 1XJQA 3CUSA 4KLQA 1NP3A 1MNAA 3TIVA 1AC5A 2V0GA 2ZSIA 2FEKA 3MELA 3Q3IA 1NR1A 2LCQA 4AFNA 5E8JA 2QA5A 2HDNB 2V7QD 2QRJA 5C5DA 2WILA 3H9QA 1UKBA 5HR7A 1UJ5A 2AGPA 3WYEA 2X6QA 1WUIS 4PCUA 2ZDQA 3PDWA 1PR4A 5M2QA 4DCPA 1E9RA 4C7OB 4GMKA 2N1BA 4ICAA 8ICZA 1PUXA 2XBUA 2WF5A 5F9MA 3PGVA 2XTZA 1WW3A 1RYNA 4DLLA 3OH8A 1DK2A 1ZQHA 2ORIA 4MYDA 4KN4A 2AFRA 1GTSA 2JFFA 1U94A 3WIVA 1G9SA 2FWRA 1QQ5A 1J1IA 5HGJA 3AR6A 3QPBA 5C46F 3JATA 3NC1C 2HV8A 5CIQA 1RWWA 1VMAA 3C87A 4CIBA 1EU1A 5MFZA 3MVEA 4FS2A 5L3ZA 4UHKA 1ZUNB 1E66A 2G6TA 2PXXA 5BY2A 4MFCA 1QIHA 4N48A 1QE0A 3G79A 3BFXA 3D54D 4I8XA 3FVWA 2JK1A 4RADA 5KTSA 3NVMB 2SCUA 2G76A 1P2GA 4X1YB 4AMBA 4FVTA 1A9ZA 3HYTA 4R63A 5TEWA 5HKKA 1A4RA 3EPJA 4ZDJA 3TNFA 1MAVA 1HT2E 3NR2A 4KRYA 1BH2A 1TGYA 3EFBA 3PUYA 4EA9A 1JN0A 1ADGA 4MK4A 2AD1A 1B3RA 1AUXA 3LP6A 4JJ8A 3IQFA 2EW1A 2OHGA 3FWNA 3ALRA 3CW8X 4EITA 3TIXB 3CZAA 4HGYA 1FFBA 2GX6A 1OBHA 1ZQIA 4RHUA 3MRTA 1GFZA 3ANXA 2DXIA 5HXAA 1T1JA 2D3WA 1JG2A 5J2UF 3C29A 4TOIA 3MHTA 3BDIA 4LA4A 2C5GA 4EYEA 4Z2AA 2M2IA 2HPAA 5M3BA 4X64B 3TNDA 1KYQA 2FUCA 1UCFA 3T7DA 1M0TA 2YMMA 3H1EA 2ILTA 5TVGA 4Z51A 2QN2A 1MAHA 3C1OA 3BHMA 4OYYA 3KQSA 1SC3A 1M2VB 3F46A 1KYXA 2D59A 1OFTA 5K20A 3ZR4B 1B1AA 3V6JA 1T2DA 1XLUA 3GCWA 1F48A 1SO8A 2PZKA 1LK7A 2M0NA 5CB1A 3GR6A 1DEKA 3A58B 4XFKA 2O0JA 2XYRA 2M9NA 2C3MA 4G1EB 1NNLA 4YXFA 4Q1VA 2H3FA 3I34X 5IJ0B 3MWLA 4DLGA 1GDTA 3TBFA 4FGWA 3K0CC 2OEHA 4WKOA 2R8OA 5AVVA 4U2KA 5I5GA 3LCCA 4YAFA 1DRGA 1XA0A 2I6TA 3OIUA 2ZREA 4JT8A 2ZPUA 3S29A 3QLJA 1QQAA 2ZG6A 2AYXA 4FB4A 4CCHA 3HJHA 5TQ0B 2AQIA 3FOAA 1OFGA 2OXIA 2ZULA 3A2MA 2WDZA 4FFDA 1IMJA 3SXPA 2HOQA 2YMPA 1SHUX 2B7BA 2XUZA 2IHBA 3A6HA 3E4DA 1AJEA 5CA1A 5IBCA 4R69A 5FPPA 3ZOKA 4BLOA 1Z0IA 3EXAA 2LP4Y 5F51A 4EW3A 3DEHA 4HQ6A 3UCXA 2YJTD 2PX6A 4JYMA 4WCFB 5JADA 3AEUA 4WE3A 3IAS1 1SXJC 4X1OA 1L4FA 3B3GA 3MGHA 5I9IA 2V4RA 4YASA 4D6PA 3LWNA 3PJGA 1XRMA 3E7XA 2WKPA 4NNOA 1O2DA 3SJ7A 1T0UA 1DELA 1B0PA 2IEYA 4BKOA 3U7QA 1C1HA 4G0VA 1UP7A 4KR6A 1OYVA 1V1JA 4G25A 4Q3NA 1FMFA 4UHFA 1ZQBA 4C7VA 2IE0A 1RHRA 4LF5B 3OTHA 1D6JA 3AVTA 2DHRA 2FPGA 4P82A 3SOZA 1MVLA 4G67A 1YFKA 2NP6A 2RHLA 1T4CA 2JCGA 1Q21A 3LD9A 3ASYA 1YJ8A 4TWRA 4OFXA 2QXYA 3I2FA 3W3AA 5I9BA 1MFPA 1ONSA 5ADVA 1U9CA 1L4NA 1ZAKA 5JSUA 4ZJUA 3DBIA 4LDRA 2WFLA 4X90A 2C77A 4ZAXA 3O26A 1F44A 3CF0A 5F4ZA 4X9XA 1IPEA 1KJIA 3MRSA 1YVPA 5F1OA 4F7DA 2IE8A 3EVEA 1HFKA 4FGJA 1K92A 4QYSA 1JQKA 1R9GA 3B60A 4UBBA 1I3KA 2KB0A 1W19A 1B1CA 3OT1B 1OXXK 1E1CA 3TRIA 3ZLJA 4Y2XA 2R7NA 4PGAA 3MJCA 3HJRA 3EOAI 1HE3A 1YMQA 3FYUB 1AKYA 3AL3A 1O96A 2NT4A 3DF7A 4TWZA 2VOJA 2YV2A 4JLBA 4DQQA 4EB3A 1TLLA 1UADA 4WJKB 4I2AA 3DMTA 3EMKA 4FGUA 4OUDA 1SBQA 5LDDC 3V7FA 1VP9A 3T7AA 3PUWA 1UK9A 3KZCA 2BFBB 3D3WB 4DLRA 2M32A 2BH9A 4NCKA 4X1KB 3E0FA 3EDCA 3FDZA 4YI3A 3EISA 3IEKA 1BVHA 4I9FA 5CYPA 4MLPA 2BFCA 5MGNA 1V9PA 1K3FA 2MMGA 2NT3A 2QVLA 2R8BA 4YEDA 3ML1A 1M5RA 3LXRA 4QEDA 5E95A 4GKKB 5C2JB 5DB8A 2BKXA 2AIRA 5EPEA 4LZPA 4D8YA 3HP1A 3LX8A 1DIOB 4YX9A 4I9GA 2QMEA 3T3OA 3KOYA 3QA9A 3AUJB 4NV3A 2ZYSA 3E23A 2NZVG 4ARZA 4BB5A 4ZCTA 2D2XA 3N2NA 4U7TB 3ANNA 4ZRNA 2CCKA 1K2WA 4Q3CA 5CYOA 3I61A 1TQ8A 4BLPA 3RVNA 3QPCA 4ACBA 1NONA 1ZBDA 1DJMA 4AJ1A 3LZ6A 2JFZA 2E2WA 1YC5A 3QU4A 1ZUWA 4DFJA 1E2LA 4G36A 4ELVA 2ZJBA 4ZVKA 2OCYC 3WLHA 4R8LA 2XCTB 2GKGA 2B25A 4Q3DA 3B5EA 4DZRA 3BIOA 3CRNA 2IELA 1WD7A 4F5QA 1PV1A 4EHJA 3HN6A 5GPBA 3WR5A 1AX9A 5DHRA 4CLRA 4P4PA 3ZHVA 2BBSA 3ZCVA 4HN9A 3HRIA 4Z4HA 2A4MA 3AUOA 2PZAA 4YJ2B 5BQOA 4JLKA 3UJNA 4FYIA 4PRYA 2Z2IA 1XZ8A 3ZPXA 3C4QA 5CA0B 3U61B 4F86A 3NH6A 2QL5A 3KJXA 4QW8A 3PR4A 1LK0A 3UH0A 1WE2A 2GRUA 1GG2A 3E9EA 4BV2A 4ZICA 3Q8RB 3AERB 1JWLA 3R5XA 1ZNXA 5BN5B 2VPZA 3R7SA 3D2BA 4DFMA 5J3JA 1VHTA 3C1UA 2XNHA 1A1VA 3L7DA 3MR6A 1EP1B 5FO1A 4YRCA 5EG5A 3SC6A 2KNJA 4M9JA 4C5CA 5DX8A 5IM5A 1NF2A 2QQGA 3PYXA 4TYPA 3TL6A 3I04A 1XNGA 4RV4A 1MJGA 4NCAA 2CMGA 3FNHA 2FMFA 4NLNA 4R3UC 2QD3A 5IM4F 1VJ1A 2WJPA 2OT3B 3ND9A 5AM1A 2L17A 3GDWA 2WU1A 4Q39A 7ICKA 2HZBA 2QRZA 1E89A 4X8HA 4BFYA 4X8LA 4JJKA 2JFWA 1HKUA 2Z1NA 2WYHA 3T4XA 4AB1A 1EBUA 2X6RA 4KZPA 4RLFA 5JI3E 3AR9A 2C8KA 2WTXA 4I2GA 3QWHA 2ZWMA 1UXJA 3NUZA 4E88A 5COQA 5C4GB 1L5HA 4EK9A 1R4MB 1DB3A 3E53A 8ICWA 1G5TA 3QVXA 5EUQB 2C83A 3EDOA 3TSYA 2A3VA 1SV4A 2FW7A 3ZDDA 2ZRDA 1GNTA 2ZBRA 4CL2A 3LC7O 1W6RA 3W2HA 2AR7A 3F98A 5CXUA 2L18A 1UAYA 1LPBB 3GUVA 5JU5A 1JQLB 1SZDA 2GAAA 1DC5A 1ZQJA 4ZZ0A 4JYBA 1RM6C 5TVKA 4OAQA 5LQSA 1SUDA 4V3BA 1E2PA 3H0EA 3FSGA 3STYA 4GX1A 2IUSA 4NBSA 3R74A 4B3TB 4JV2A 3TJRA 5CNKA 1JIXA 3GEHA 2OAEA 4AMUA 4QGAA 4RA9A 1BCSB 1MO4A 4CM4A 4R2HA 2JVKA 3UG7A 4JIGA 5IUJC 4ZO9A 1N6KA 2OENG 4URUR 4RUCA 4BDTA 2ZAYA 4LF9B 2FOIA 4FSHA 1PCXA 5FPHA 1PKXA 3K1AA 1RHQA 1SRRA 2QU8A 3AEKB 3FIJA 4F5OA 1Q50A 3NYRA 1JA1A 3DMNA 4ZCQA 2JD1A 3NJRA 3WHIA 4MDEA 4LJRA 4RNOA 1QVZA 4XLTA 2VHTA 3OY2A 1OWOA 1PZXA 1ZD8A 5LBIA 3QMMA 4O2LA 4DO9A 2HMAA 4R8UB 2IU6A 3MJTA 2ZTHA 4HVCA 4GS5A 4UAUA 3NHWA 4HV4A 3EEIA 4M9ZA 2P3LA 2PEYA 1ZD9A 4CIWA 4N6NA 1F8UA 2GA9A 4CE6A 3SU8A 1SHLA 4BOYA 2GJ4A 4EMSA 2XBLA 3N2KA 5TGZA 3L0SA 3SS7X 3V97A 2OHXA 1C0EA 2YFKA 1GG9A 3W5CA 2N1RA 4E32A 1LV5A 2WTFA 4IDQA 4XVQA 1UZNA 1K66A 3UEOA 2HMWA 3ICWA 2EGUA 2KEYA 4H7FA 3HJEA 5KNIA 4PPQA 1J70A 4OSPA 2UYGA 3A6PC 3EE6A 3I9V6 3TB6A 2K6GA 5BWNA 1YKFA 3M6FA 4KDCA 3HFGA 1W96A 3MJRA 3EVDA 4I5GA 1ESNA 5KKAA 2QD1A 3LC0A 1YR6A 3F8WA 1V38A 2C7OA 3I01M 4WWHA 3C3PA 1CB0A 2YVQA 3H13A 4KAXA 2MHCA 4GZ6A 4ZYYA 3RUEA 1ZZEA 1L9XA 1G16A 3ZJ5A 1TVCA 1NTOA 5GONB 1X2BA 3T3GA 4DF8A 3CRXA 3ZK8A 3ESZA 5TB5A 2JFXA 4C8LA 3RS2A 4LOLA 4Q47A 3IVAA 8ICEA 4CU2A 3RUDA 3OU7A 2OBYA 3GLGB 2XRZA 5EP3A 5A0TA 1N8SA 1ZAYA 1GVHA 5CVEA 4F06A 4G5OA 4IJ5A 4AUEA 3CKKA 1XMOB 5DT2A 4CV1A 1NVFA 3ZHXA 2VYFA 2PSDA 3TR5A 1T9DA 3RM3A 2P2CA 1F06A 2G25A 4NLLA 4ED7A 1X3SA 4NDAA 3ZKWB 4EPYA 2HJ9A 3C5CA 2JGAA 2X3FA 4FUTA 1X70A 3UO8B 3W7BA 3AHCA 1KI9A 4Q4LA 5IUKC 4BGVA 4RTLA 4E13A 3EF3A 1EVQA 1GL6A 1PNQA 4KOEC 3UGJA 1XC7A 2GLUA 1BA2A 2QL9A 1XZAA 2HPZA 2W6PA 1ABBA 4G0ZA 1TDJA 3MTAA 4NZMA 4RABA 4RK7A 1P9WA 3QPDA 5AKYA 3VU9B 5KTRA 3UW3A 3RVQA 2BKAA 1I80A 4RZ2A 5AM5A 5IC5A 3MG9A 4RCYA 3PP8A 2PUBA 3LUKA 1H4QA 3HB5X 3KSZO 1SK9A 5C9ZA 4GXKA 5E38A 2ADMA 3H1GA 2R751 4CLDA 2I91A 1R0CA 3ZV6A 4EQZA 2V4UA 1GZVA 1E3DA 2X58A 1Y5LA 4CIDA 3NTQA 2G06A 5HWSA 2BGNA 4BN5A 1G4AE 3ANYB 1H6DA 5LOVF 4K6OA 3KB2A 2XCRB 1UM9A 1RQRA 1M1ZA 2DUJA 2ZROA 4KQGA 4Q19A 4P0PA 3NEYA 5FWYA 3O4RA 2H3ZA 4G23A 1YK1A 2HIGA 1KKLA 2P4EA 1DAMA 2UVQA 2C82A 4PSKA 2XCUA 1WQ3A 2GZ1A 4B4UA 5CAEB 1E2MA 5JVDB 2V58A 2F67A 4D26A 3N76A 4IEEA 2GK6A 3VSEA 1NK6A 4KN7A 1MO6A 1HMPA 4EYSA 4JLVA 4BY9E 3MB5A 4FZNA 3ITNA 3O93A 3N28A 3AVVA 3VJRA 5KL8B 1S89A 1NW5A 3TUZC 1JXEA 2PSHA 3UKDA 2GEVA 3IMCA 1YQEA 1V6SA 1Y1RA 1V48A 2V7WA 3E2IA 4QASA 3DZJA 1RKXA 4K9NA 3H40A 5IANA 4YLGA 3EEOA 1OAOA 4V2UA 4QSMA 1NXOA 4QUEA 1LRJA 4Z4CA 4MIKA 4A8EA 1AG9A 3WOVA 1JQ5A 4JI7B 3HK2A 1Z4KA 4TSFD 4B5LA 2AJTA 4AZ3A 5G4LA 1AMUA 4J29A 3MLAA 3HA7A 5I5EA 5DB7A 5A5EA 2QVXX 3UHFA 3R0VA 2OTCA 3VGPA 3FFXA 3AM9A 3WNQA 4DIOA 2E18A 3G2OA 4G8BA 4LJ5A 3O90A 5F1PA 5LYJA 2GR9A 3RFAA 2FHSA 1ECWA 4GGPA 2I62A 5A05A 3CWQA 2VUSA 1LRLA 1JDNA 1MC5A 5K0EA 3A2NA 4G5QA 4EG5A 5CX4A 4RNNA 4OGFA 1S8OA 2O8FA 2IFTA 5EE1A 2XQIA 1M76A 1HWYA 3IUJA 2WHYA 4M0MA 4AJHA 4YMSA 1SVOA 4CG1A 3EPLA 1N5XA 3DAPA 4P38A 2OWEA 2K5UA 4C0HA 1K97A 2N47A 2AJBA 4G2NA 4LF8B 3L43A 3J81A 3H4VA 2OFFA 4DRXB 1KEZA 1O5TA 4JJFA 1D7AA 3M3PA 5ERGB 2HHXA 2ZOSA 1NF8A 3KUUA 4B09A 1JALA 2CXQA 2GBLA 5CYFA 4MUJA 3THRA 1K88A 2JLCA 2VN8A 1TJ5A 4NAUA 3V6KA 4OQXA 2HSZA 3KQWA 2P6RA 1B0UA 3QBEA 2IPMA 4KVAA 4ENVA 4KW7A 4TT3D 3IT0A 3U3KA 3L92A 3FC4A 4IEFB 3O3NB 5IABA 2DPHA 4WCVA 4CIXA 3IDAA 5HHIA 3H9JA 4KAAA 2KP7A 4LHYA 1YZVA 3I30X 3RTEA 3P94A 4Y67A 1UP4A 3N6RA 1CY6A 2B69A 4DV7B 1FC0A 5CDHA 3EZFA 4KPUA 1EUYA 3RC2A 1ZW6A 5D4BA 3F6SA 3FFAA 2OZKA 3UTDA 3ZLUA 5LOVA 5KFJA 1UDBA 1Q0ZA 3IMKA 4Q9NA 2ZTEA 3N3BC 4NMHA 1UJMA 3USES 2GI4A 2I3DA 4RPXA 4QUIA 5IBRA 3OP4A 4XEUA 5EUMA 3GUZA 3PO5A 3THXB 2FMSA 1QSSA 2FJ0A 5AKJA 2Z95A 3IXQA 1PNVA 3GFTA 2RDIA 5H1YA 4QGFA 1EGVB 4W6QA 3LX4A 1JI0A 1ZMBA 4YT5A 2HMVA 1CQXA 1RM4A 3FTCA 1T5HX 5FEUA 4JXKA 3GCXA 3SWWA 3GEGA 3M81A 2OUIA 2O23A 4BO7A 2K7FA 1ISIA 3C5WP 2HU2A 3K4QA 4IJQA 3OLQA 3EF0A 3DL2A 3SR3A 5KTPA 3QUCA 2IY7A 3V48A 3BZCA 4O2AB 3DAFA 4GZLA 3FLMA 3U09A 5DNWA 4WVFA 2V5UA 4Y98A 1W85B 1O4WA 4H59A 4FQ8A 4IXNA 4UAZA 1MJNA 1YBVA 3QW4B 2DWCA 2GMWA 2WD8A 4KK3A 3AVQA 1GGKA 5KG5A 3NV9A 4G0MA 2WG1A 4P6VF 2D1SA 2FTKE 1C3EA 2ACKA 1YB5A 2QAGB 2QARB 1EK1A 4LTNA 1SXIA 1T3QA 3ZXSA 1CIJA 2H57A 1YDGA 2R6CA 3NHZA 4I55A 4NCBA 1IEWA 3GRCA 5EJIA 3ZHTA 3UUWA 3CCFA 1A7JA 4TZ6A 3HPOA 1KZGB 5DBEX 5DP1A 1VIDA 3PS9A 2BDEA 5C7IO 3UQYS 2V96A 4L8YA 4DQXA 4GPZA 3C2LA 1QHYA 3ZV7A 2PKQP 4YCXA 1U4BA 4CMHA 2CB9A 2V7UA 1E32A 2AXTU 1XMXA 2I3ZA 1L5MA 1XD8A 2J08A 1ZQGA 4V1CI 5JJBA 3W2EA 1YZKA 2JFBA 2ONYA 4AX4A 2TSYB 5DV9A 3ZS9A 4D8WA 4J2TA 3FUWA 1PQ4A 2AJ8A 5LBUA 4ZCMA 3QMWA 3IDSA 3H4TA 2NX2A 4TXNA 3VAZA 5F1KA 4QPZA 3UOAB 2B8TA 3N53A 2F2AB 1X7WB 4DANA 3PXAA 1MENA 4L76A 3AHEA 3D4BA 3K9GA 4RNCA 5B7QA 5DN6D 5B1HA 1N61A 3VJMA 5A9SB 5DM2A 5BOMA 1I3LA 2EIHA 1PJ2A 1K6JA 2IPNA 2CYCA 2OA0A 1W9HA 3OTGA 1PJRA 2VUHB 4YHBA 1TM1E 3W2IA 3KBBA 3AF1A 2QTVA 2VTVA 4NECA 4MWEA 4MDHA 2FJ6A 4MV1A 1D03A 2NRZA 1MNQA 5FHQA 1I94B 1QF7A 1CZRA 2FN7A 4KJZA 5JHGB 3S44A 4F5NA 4G0WA 4QYIA 4WXHA 1YHYA 5H82A 5BV8A 1IIBA 2FR1A 3QEBZ 1U7OA 4RWEA 4S1TA 4DMFA 4KLCA 2OQ2A 3TL3A 4MUHA 3MNFA 3G0HA 2NXNA 1UBUS 3M8RA 1ML3A 3O2QB 1GLNA 4YRNA 3A3YA 4ZYWA 2Y9UA 2CLHB 4E5SA 3PI6A 1UFVA 4NQRA 3RTBA 1X38A 3QPUA 4D8VA 3RJIA 3HP7A 2KHQA 3CJTA 2REQB 3RRZA 4OXXA 1T8EA 1P6UA 4PNPA 2SKCA 4K9KA 4RH0A 5C8VA 5T6BA 3EJWA 4N39A 4C6HA 1NK9A 1PK9A 4TM7A 3C97A 4WKPA 3NBFA 2K8CB 4UXJA 3NQ41 1SCUB 3UATA 2GD0A 1T6XA 4G1UC 9ICMA 3QX9A 3ONNA 5LDGA 2J3LA 2I2AA 5IX8A 5IIIA 4Q01A 2O48X 2XXBA 3NCHA 3IAM6 2O0KA 4UOQA 4RESA 3BMXA 2JANA 3AEVA 4B9VA 4EUEA 4WZ6A 4MKGA 4ZCIA 4NBNA 2N9UA 1ZQWA 1HKHA 2A0UA 3L05A 2UVRA 1GQOA 4XWKA 5FUXA 1ZQFA 4FZRA 1KDOA 2XWJI 2ZI7A 1P7PA 3ZG6A 2OP0A 3I5UA 3PSFA 3I6YA 2ZE5A 2CZQA 3F5QA 4RQBA 3H16A 3GVHA 5EP2A 4TUSA 1C7FA 1D8YA 4ZVUA 1T34A 1EM8A 1I4TD 4HN2A 3FZYA 1RQ7A 1UQUA 2ID8A 1JXOA 1DXHA 3OCZA 4NOJA 4UFOA 4I2EA 2Z8YA 2DKXA 3H3JA 1E2GA 1FYXA 4BNTA 1MO3A 3O92A 3A2KA 5EIBC 3BICA 5CT4A 4MWGA 1VE3A 8ICVA 5BWMA 2OQVA 3QLVA 4Y2TA 3B9JA 3UAOA 1F7UA 3H9GA 4CI0B 8LDHA 1J56A 4BNKA 5HS4A 4DV2B 3OWHA 1Y1PA 2V6GA 3PITA 1XN1A 1HQYE 1HETA 3CZCA 2CMKA 5J0TA 1S8NA 2PVPA 2HOFA 3FIUA 1NVVR 2KS6A 3ZWAA 3NBKA 4MZXA 2BI4A 4RLSA 3N0XA 4X20B 3W9SA 2OWOA 3ETCA 4LJSA 2GTIA 4FMPA 1IWPB 5I7AA 1NZDA 2BKLA 3ZIDA 4OATA 1HZZA 2RK6A 3P32A 3SENA 4WFQA 1JHYA 1G2PA 3T3MB 4G65A 2YASA 4AYTA 3GO4A 4IWNA 2R8XA 3CF4A 3GBPA 5DTIA 4ZI2A 4JROA 4C1BA 3UIEA 5BN1A 4G0OA 5AR1A 3IFSA 4IO1A 1Z5ZA 4D3ZA 4M9GA 4NJMB 4ND8A 4QX6A 5JNWA 2FH5B 4E08A 1TB4A 4O4HB 3PR5B 1QX4A 2CCJA 3LS2A 1HM5A 1R9JA 1GCAA 3I5MA 1RKBA 2QJFA 1EWKA 2WY2D 1VBMA 1DQYA 1XK7A 2PMWB 3T5KA 4INOA 3E3OA 3H0CA 5D51S 4NLZA 3KIPA 2ZXUA 4TWAA 1KY5A 1QPBA 2AQHA 1JAYA 2VDPB 1N9GA 1NP6A 3R75A 4Z8YA 3GLTA 2ENUA 5EE0A 2P4SA 2G1KA 5A5VA 4Q3EA 3KKLA 1WYGA 4X0EA 1P1FA 1XL0A 4YMVA 4O25A 5IJWA 2VI5A 4JT4A 5FLKA 4BZZA 3KT0A 4JEUA 4B6OA 4OGKA 3KZXA 5H7XA 1XVLA 1ZK2A 3WQQA 4C7JA 1Z82A 4EDHA 4RHCA 4NEGA 8ICXA 1Z2OX 3ETHA 4V39A 2R9VA 1NV9A 4ATNA 3EGIA 4DHEA 4MFFA 1JDSA 2HHSA 5I48A 2AOVA 3WLTA 3WXBA 1KMHB 4ESOA 4NHEA 4F96A 2JGIA 3KZOA 1T25A 2DR0A 3QMPA 1KPHA 4OJKA 5J0SA 1XMVA 3BBLA 4V1CA 2OO5A 3STXA 4GOOD 1Y0BA 2I8AA 5EWLB 3NIBA 4ML3A 1WY5A 2GZDA 2H11A 2VDMB 3QXJA 2QTRA 3ZVNA 4ZEOA 4YJ3B 2OV8A 4ND1A 2VRNA 1L4HA 1U8CB 3LFUA 3EBPA 1Z16A 1IZ9A 1Q3UA 2G63A 2F1JA 3IIMA 1COZA 4HRXA 3NFRA 3PE4A 2Y1GA 1V9SA 3QBVA 3O8OB 3OF2A 5K3AA 1OWPA 1KI6A 2G9UA 4OHZA 2BCJQ 1WDTA 1XQ9A 1THMA 1CPYA 3ZD7A 5LZ7A 1XFDA 4YAGA 3T34A 1X8KA 3DW3X 3AKCA 4YYEA 2EU8A 3STUA 2G4CA 2QUZA 2HWUA 3P2OA 1G19A 1GNPA 2GHQA 4ZK6A 1CQWA 1OH8A 4EUKA 4Q3OA 3ZLTA 2KE7A 1LPSA 5G41A 4G2TA 5F3XB 4CDNA 1NQXA 5FP0A 4AP9A 2AFVA 4XGQA 3GP3A 2F2TA 4GEGA 2LNDA 3ISJA 5BR4A 5I47A 2C99A 5A4MS 4YI5A 3UJ9A 3L8MA 2W6ZA 4E33A 1OAOC 3L4KA 3DPSA 1VCMA 2CB0A 4XFDA 3A1CA 4ZC1A 5CDSA 3IHQB 4GXJA 5H70A 4OMCA 4EF6A 4PHHA 2QU7A 1IEXA 4DUGA 1PYDA 4KXQA 3SDBA 3CISA 1WQ1R 2XUPA 5LZ2A 3CU5A 2BFFA 1F2TA 4TROA 5ALDA 4DMUB 1RZVA 2NSHA 1XQ1A 3PFNA 5KNDD 2VJQA 1LB2B 1AO0A 1O94A 3ROGA 1FA9A 5D6OA 1J0CA 3PQEA 2JZOA 1NP7A 1A88A 1TRHA 2NUTA 2YNMD 3EWAA 2X1HA 4Y1FA 3CV3A 5CRIA 1E6LA 1T4MA 1EGAA 1WO8A 1U4SA 1II0A 5GJCA 4J16C 1W7AA 4BMPB 1IH8A 2H92A 5IAOA 3ZE6A 3STVA 3BH0A 3KM0A 4D0RA 5CEJA 4JJ7A 1H05A 4ZIRA 1GSHA 1LI7A 4CDMA 1ENOA 3QVGB 2EHJA 2QUAA 2ZVDA 4QWDA 2IHMA 1JSCA 5CM8B 3G59A 4JS0A 5CP8A 3QZUA 3KQHA 2ETVA 4ODIA 3CE9A 4JP8A 1VG8A 4ZVOA 1JQDA 4RGBA 3U4QA 4NMLA 3UHOA 1GTZA 2GBLC 4FKBA 4PCAA 4B4VA 4OHRA 1M6VA 4G5RA 2O5EA 1V7ZA 5DBOA 4EG6A 5LU8A 1XLWA 3Q11A 5JRZA 1RFGE 4H08A 4HDMB 1X15A 4MITA 2O2JA 3GLFB 3D59A 1QFXA 2P5UA 5IDVA 2IV7A 3ZHSA 3SC3A 2KFZA 1Y81A 3PSAA 3FTNA 1RPAA 2AFIB 4PFJA 5EWEA 2VTKA 2VA9A 3K73O 4M0LA 4FYVA 3DOFA 2RKWA 3WBJA 8ICYA 3VYSB 3FPJA 3K0AB 2X41A 4BNFA 4PFKA 4CQNA 5H81A 2Z9BA 1D8AA 4CHTA 3LK7A 3GZNB 3ZWDA 4ZVTA 4P98A 2PV7A 4FHGA 1O9HA 4V0QA 3RS3A 4HSEA 4NJEB 1DWUA 2VDLB 4UNNA 2HB6A 3DDNA 2B5WA 4Q12A 4HWRA 5A5FA 3TNJA 5DRTA 5CA1F 3BIWA 3GFGA 4J9VA 2FZWA 4EY6A 2CLLB 1ZJYA 2VJKA 4F6CA 1RYDA 5U4XA 5H83A 2VJ5A 4GXIA 3NKFA 2WYIA 4ER0A 1TQHA 1XD9A 2FZEA 4DCJA 3U6BA 1Y88A 2VQ6A 1RPZA 1YOBA 3W6OA 5BR1A 3TGPA 3EQ9A 4LJ9A 3F71A 3CZ9A 2WUFA 3Q5DA 3L1KA 2DMRA 2HZ7A 1JKJA 1RAAA 5B3KA 3LQFA 3JSAA 3SZGA 1W0CA 3ZBPA 2XO7A 4EW1A 1QNLA 4HZUA 5CDGA 3CZ4A 4HLDA 5ELLA 2PUHA 5KFUA 2QYHA 1ADJA 1OXJA 1V8PA 1OB5A 1BPZA 2CYAA 2N1MA 5AXBA 4RQ4A 4RQ6A 3NEJA 4H3VA 1NATA 1WHSA 4A36A 2Q4RA 3V1NA 4WOJA 4PPNA 1N25A 2Y0EA 3HX0A 3LUJA 4OJYA 1N2EA 5LQNA 1B4DA 5SZHB 4IINA 3SKVA 2C2RA 4OQMA 3FWPA 3JZDA 4GM1A 3MMPA 4HAIA 1H0RA 4M55A 3DKVA 2LYAA 3QE2A 3SGLA 4FFBA 5K51A 2ZJYA 1E8NA 1WDWB 3LO8A 2GWSA 2TMKA 1C0PA 2MUTB 2AXPA 4D41A 1Y7TA 3HUFA 1ZQQA 1UDAA 3PIDA 6GPBA 3JYLA 1USWA 5JLAA 5ITVA 2CNDA 1KI7A 1A96A 3GWGA 5KX5B 1LKYB 2QE7D 4YACA 1X9WA 1PI3A 4BJ1A 1Z3EB 5I45A 1DTWB 3C6YA 2ONJA 4YXWD 2V3VA 4PC6A 2DF4B 1ZGAA 3WDKA 2IUEA 4P34A 1WCYA 2XTAA 1QAMA 2E49A 2B8EA 3RAPR 4CEIA 5DEIA 2ALZA