1NNLA

Crystal structure of human phosphoserine phosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
205
Chain Sequence
SELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of human phosphoserine phosphatase in open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
total genus 69
structure length 205
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1nnlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1nnlA01
3HLTA 3L8FA 2CFRA 3KDPA 4UM5A 2FPUA 3ED5A 2YMLA 4ZEXA 1FEZA 4OFZA 2HX1A 1EK1A 1Q92A 2I7DA 5AHXA 1SU4A 1U7OA 5AI4A 1J8DA 5AW6A 3MC1A 4Y3UA 1F5SA 2FPXA 5AI6A 4HYTA 3L8EA 1Z4KA 5ALOA 4G9BA 5AKIA 3L1UA 3PDWA 5AVTA 1RLOA 5AKHA 3EPRA 3AR3A 3FPSA 2AMYA 1WZCA 5AVZA 1Z4OA 3L7YA 4GIBA 3ZTWA 2IOFA 3QU7A 3E8MA 5IT4A 3A3YA 4OD0A 3IRUA 2FDRA 3ZWKA 4KN8A 5T41A 4BKMA 3WGUA 3ZTYA 4HGNA 2GHQA 3L0YA 3B9RA 3ZW7A 4UMEA 1XPJA 3SKYA 2YJ4A 4EZEA 1Z4NA 2QYHA 2ZBDA 2JARA 3I76A 1YV9A 4NV0A 5AW3A 2P11A 3OCUA 1Z4JA 4DCCA 1Z4QA 1XVIA 2YN4A 4BNDB 4I9GA 5ALGA 3ZVNA 3U26A 3NUQA 3NAMA 4C4TA 4DWOA 2FPWA 3FM9A 3OCVA 4UAVA 3E81A 1L7PA 1SWWA 1QQ6A 4YH1A 2G06A 4IG4A 4CF3A 4UARA 4YCLA 4RETA 4YIHA 3QXGA 5ALYA 3U7HB 2NO4A 1TJ5A 2IOFK 1WPGA 3NALA 4UU0A 3WK6A 3QUTA 1ZD4A 3A1DA 3W5AA 4FFDA 3P96A 5ALMA 2ODAA 1RC8A 4NWIA 2P69A 4QJBA 1RLTA 4ZEVA 2C8KA 2IA5A 5AM5A 1XP5A 2BDEA 4Y2YA 4C4SA 4EEKA 4UU1A 3U7EB 5AI5A 2PQ0A 3ET5A 4G63A 5ALPA 2JAOA 1YMQA 1N9KA 2RB5A 4BNDA 5AW1A 2B8JA 3OTQA 3N28A 3ONNA 5AVUA 3R09A 4AS3A 5AVVA 1T5TA 5AW7A 2I33A 4DW8A 4QQFA 4MWOA 1YDFA 1Z4MA 2HO4A 2P9JA 2YFYA 3L5KA 2WF7A 3SF0A 3ET4A 1AQ6A 3BA6A 3RFUA 3I1YA 2HSZA 4UM7A 3AR7A 1YNSA 3FGOA 3L1VA 2C9MA 5ALSA 1U02A 5ALJA 2YY6A 3L8HA 3ZU6A 4F71A 2ZXEA 3W5BA 2Q5EA 3EWIA 5AKJA 3AR4A 1NRWA 1NF2A 1Z5GA 5AK5A 5AKZA 3WKCA 3NANA 5ALWA 2ZOSA 5AKEA 4EX6A 1TE2A 3AR6A 1EK2A 4J03A 1RPZA 2GO7A 5A3QA 2FPRA 5ALKA 3ZVLA 1U2TA 4KX5A 3QU9A 2FEAA 5IS2A 1VJ5A 1K1EA 5AW5A 2MU1A 1RDFA 2WF8A 5AIBA 1O03A 3SD7A 3KD3A 3DV9A 2EARA 5A3SA 1QH9A 2HDOA 3AR5A 4HGOA 3M1YA 1Z4IA 2GMWA 2C88A 2O2XA 5AKXA 4BX0A 2I34A 4UAUA 4E88A 2RAVA 2D2VA 2P27A 3A1EA 1RKVA 2B8EA 3QGMA 1QYIA 2FUCA 3R4CA 2BDUA 4CF4A 4FE3A 1RLMA 2YJ6A 3QUCA 5AK3A 3WKDA 2OBBA 3FZQA 1RMYA 4UMFA 2WF9A 1VFPA 1RKQA 3U7FB 2VKQA 2WHEA 2CFSA 3MMZA 5AVQA 3EF1A 1RRCA 2I54A 3DDHA 3ZI4A 1QQ5A 3FPBA 4CF5A 4FYPA 2R8EA 1ZD2P 4HGQA 2DQSA 3PGVA 3AR8A 5AKKA 4Y2VA 3U19A 5ALFA 1TJ3A 1YJ5A 3L8GA 3WK5A 1MH9A 1ZRMA 4B6JA 3I28A 2WF6A 4Y2RA 3QU5A 1WR8A 2CN1A 2G1AA 5AM1A 5FP0A 3QYPA 3CZ4A 4EX7A 3NRJA 1L7MA 3W5DA 3QUQA 3KC2A 4CNQA 2RARA 2ZG6A 1Z4PX 3QLEA 2EATA 4J2TA 2W43A 1RKUA 5AI0A 4XOUA 5AKYA 4OHFA 3WKAA 4KNVA 3WKEA 3M9LA 4O8CA 5AI9A 1Y8AA 5ALLA 2GHTA 2JAWA 3EF0A 1Z88A 5AM3A 3OPXA 2QLTA 2YMMA 3U7GA 1RMQA 1TJ4A 3W5CA 3PCTA 3U13A 1X42A 4MUMA 2B1RA 2Q4RA 3MN1A 3J7TA 5A3RA 2B0CA 2OYCA 4JDPA 5AW9A 4RESA 4KX3A 4Y2PA 4L6CA 2I6XA 1U7PA 2AGVA 4YCNA 5ALIA 4Y2UA 4BEWA 3ZUPA 4KYTA 3GYGA 3KBBA 2HHLA 3WK9A 5JJBA 5AVXA 1ZOLA 5ALDA 2X4DA 4EELA 3ESRA 1S2OA 3A1CA 5ALUA 3N07A 5AESA 2W4MA 5AKLA 4ZEWA 4HAIA 2G08A 3E58A 1J97A 5AIAA 3F9RA 3WK8A 3PGLA 2BY4A 3OCXA 1ZRNA 3B9BA 5ALZA 3WK7A 4Y2TA 3ESQA 1Z5UA 4BX3A 1ZS9A 3SMVA 2NYVA 3WKBA 1LVHA 4UMVA 3SKXA 2AUTA 5AW4A 1U2SA 2PKEA 4XPZA 2YMQA 5ALHA 5ALQA 4BBJA 3VAYA 2HCFA 2O9JA 3CNHA 1SWVA 3DNPA 2OA0A 1ZJJA 1L8OA 5AK4A 3UMGA 2HF2A 2G0AA 3N5KA 1RQLA 2Q4TA 4BX2A 3NASA 4IFTA 3OCWA 2R8XA 4HGPA 1IWOA 3KZXA 4CE6A 3N8GA 3QX7A 2G80A 3QU4A 2C8LA 2JGAA 4UATA 2FPSA 2IOHA 2ZBFA 3L0CA 1CR6A 5AVSA 2WM8A 2I55A 2YJ3A 4H1WA 2YMPA 3ZVMA 5AICA 4YIKA 3SHQA 2R8ZA 1L8LA 3WGVA 4BYGA 2IYEA 1CQZA 1TA0A 4UMDA 2YJ5A 2FUEA 3IJ5A 4AS2A 2CFTA 3AR2A 2JAUA 1KYTA 3HYCA 4NFLA 2WFAA 2PR7A 4EENA 3QU2A 4UW9A 3OCZA 3TLMA 1ZD3A 1ZD5A 3N1UA 1O08A 2MSNA 2ZBGA 5ALVA 1Z4LA 5AM2A 3DAOA 3MPOA 4YCMA 2NO5A 3K1ZA 1Q91A 3QNMA 2B30A 3QUBA 3D6JA 4I9FA 4GXTA 3B8EA 4AP9A 3AR9A 3KOOA 2C4NA 2AH5A 4Y2QA 1YS9A 2ZBEA 1VJRA 1T9ZA 4BEVA 2W11A 3ZX5A 1RMTA 1S8OA 4OCZA 5ALEA 1LTQA 3IB6A 4YGYA 5AW2A 5ALRA 5ALNA 1L7NA 2WF5A 4NABA 1WVIA 3BWVA 5ALTA 2R8YA 4JB3A 2OM6A 5AM0A 1L6RA 2G09A 1PW5A 3OCYA 3NIWA 5AVWA 4XE5A 3WK4A 1RQNA 4DFDA 4HGRA 4L57A 1NNLA 5AVRA 4NAVA 4XQ0A 2B82A 5AM4A 2B1QA 2FI1A 2HI0A 1T5SA 4KNWA 3I6BA 1JUDA 5AVYA 2HOQA 2RBKA 4C4RA 2YBDA 4L6AA 2G07A 3UMBA 3UM9A 3ZWDA 4PNHA 5AKGA 3RF6A 5AK6A 1N8NA 3FVVA 2HF7A 4Y2JA 3ZX4A 5AW0A 2GFHA 1QQ7A 5ALXA 3SLRA 4Y2XA 5AW8A 2HEGA 4Y2SA 3S6JA 4F72A 3L0BA 3UMCA 2EAUA 3R9KA 3E84A 5E0OA 5AI8A 1L7OA 4UASA 5IT0A
chains in the Genus database with same CATH superfamily
1KEWA 2E4WA 3FZNA 1L0BA 1U04A 5IDYA 4IYJA 5L3QB 4J9OA 1YC5A 3LBYA 4O3FA 2OHOA 2JVJA 4ZZ3A 3IPRA 4OFZA 5JVDF 2ATCA 3O84A 3R3YA 3ZH9B 4TKVA 3AM1A 5K3OA 2IHYA 2PQMA 3SQMA 3PNMA 4K8OA 2RB4A 5EJAA 1BX0A 3F67A 5JE8A 2JEJA 4PYKA 1SU4A 1GA1A 3CLHA 3HR8A 3SVZA 3OX4A 2EW1A 1JEDA 1IY8A 2VZ8A 4XI9A 2JG3A 4MEXA 1DADA 2PUGA 3BERA 1OYOA 1YVDA 4ITVA 5DU2A 2WKWA 4UHKA 1YJ8A 3AK4A 2LE0A 3L1UA 5FAXA 4DEXA 1GM5A 4FMCB 4RNNA 4OGWA 5CHYA 4JWTA 9ICGA 4P0PA 1Y3DE 3I9OA 4ZCLA 1GPBA 2HDNB 4I2EA 4NENB 4BO1A 2UYHA 4DMHA 3QK7A 1QFYA 4RCVA 1F8FA 4P98A 2J6IA 3PVXA 1W5SA 2ZFUA 3IUYA 3EN0A 3K5HA 4L3OA 5IT4A 1HGXA 1V1MA 3GC6A 2VNIA 1B3RA 2O2EA 5FA5A 5CNJA 1M2VB 1LLFA 5D3MB 1KEJA 2G9VA 3PUIA 4I50A 3RHZA 4YRZA 2Q4BA 5CFNA 2X8JA 1BN6A 4ND7A 4I0WB 2QUKA 5DE3A 4ZVOA 4DWJA 3H6GA 5IK2D 2P2YA 3N2NA 1HEUA 3UXNA 1B0UA 3MSXA 3P5SA 5EWLB 2XH8A 3TADA 2IYPA 3DONA 5KCZA 1T0UA 1F3LA 2OHVA 3DJYA 3E48A 1WUIS 2XT0A 4GSLA 3D7RA 4MW1A 3PHJA 4BFSA 4JVOA 3WX0A 1WXIA 4LXGA 4G81A 2ZPTX 2XVYA 1JDUA 1FVFA 2FPMA 2ZU0C 3WSVA 4H6WA 4IP0A 4YMLA 4RCZA 4KL8S 4F3RA 3GLGA 2GOYA 3DOIA 1Z4QA 3P0FA 3LAWA 4M38A 3QWHA 1JFSA 2ZRFA 3L84A 4FS8A 2W6OA 3NBQA 2GJAA 1ZSVA 1KYZA 3AI7A 1E2GA 1KJWA 1T9DA 1WV0A 3H8SA 2Q3DA 2QLMA 2V54A 3RAGA 2XUAA 1DPFA 3E81A 2I4IA 2DWCA 4R2LA 5B1YA 3IAS6 4WXEA 5KFQA 2BDTA 4N0MA 3P0JA 3AGPA 1I4LD 2C9ZA 2G5HB 2O5CA 3JTEA 2QXUA 2NO4A 4M76B 2V6MA 4K03A 1P91A 4UB1A 3I0MA 4LHZA 2IPNA 1LDMA 1OFHA 2E4ZA 4MVJF 4C7XA 3SHVA 3ZJTA 1LDBA 3C2QA 1N0UA 3CZAA 1E1KA 3V7YA 3PEYA 3PFCA 2VQ3A 3LYSA 1ODLA 3FR7A 4M1KA 1MA7A 3BMCA 4KXUA 4OQZA 4A0QA 3T5JA 4A3SA 4DHEA 4NWIA 3OBIA 1SELA 2YKGA 1V9SA 2XAAA 3JRNA 4HB0A 2P77A 1KZGB 1MDBA 5AM5A 3FB4A 1NK7A 4IIJA 4WK2B 5BN4B 3TD6A 4A2QA 1L1RA 4UU1A 4LG1A 3PNCA 4U6QA 3U3OA 1M7GA 3AO0B 2D00A 4QIHA 4G4GA 1Z34A 3E9EA 5FPHA 1UWKA 4KXWA 2RB5A 1N5JA 4CV2A 3IERA 1Y8RA 2CUTA 3DZBA 3N3AC 4G23A 3L6EA 2IF0A 2QSJA 4IVNA 4CLOB 2CRXA 2KVCA 4C8KA 1KDRA 3BL8A 2A0FA 4LJ7A 4RHCA 1ECGA 1H6DA 3EGDA 1JJAA 1VHQA 5CR9A 1ECFA 1KDTA 4PC2A 3OX2A 4CIVA 3CZPA 3LF1A 1ZP6A 3OI7A 3KTAA 3R0IA 4K9MA 2IOQA 3RHTA 5C5JA 1PUJA 1DAIA 1WA5A 1J2MA 2GJKA 4MKFA 4OMUA 4OJ5A 5T5QA 1B0PA 3RWBA 3ZHVA 4I2DA 3JALB 4EUEA 2HEIA 3TYXA 3LLSA 1IVNA 1PEDA 3DOCA 3UXHA 4XWKA 4WDQA 2PT9A 4WAUA 1ZQ1A 4XJTA 2KK0A 1T1SA 2I22A 2HSDA 2C83A 1F8YA 2QP4A 4ICAA 4NNPA 4CCAA 4AICA 4YD2A 3NEAA 3IAS1 4GP7A 1E9AA 3H1BA 4TVBA 4RD2A 4MWSA 5T4EA 4R7ZA 3WO1A 2HA3A 1N33B 1UFKA 2R97A 1X38A 3KFVA 1COOA 5KPJA 3HR7A 1QTQA 3ZU6A 2BCUA 1WB9A 2C59A 4IMRA 1IN1A 5KNLA 5AKJA 4HNSA 1FY2A 1E2UA 1Q2XA 3SICE 4BC1A 4ZVSA 3K70B 3H8MA 5D49A 1CERA 4C4PA 3KVYA 4PNEA 5ALWA 4WJ3B 2C99A 2HNKA 4GOXA 2NXEA 4W7SA 5DT9A 4AUMA 1TE2A 2J4DA 5IC5A 1TYBE 3BZBA 4HT3B 2D0DA 3RR2A 5TQ0B 1RPZA 1E3MA 4QA9A 3WGOA 2FPRA 5A5GA 1E6EA 3GRFA 3AUSA 4XGRA 1A98A 4ND5A 5IUNC 1JNXX 3B9QA 3DFFA 4YNBA 5ANRB 2EEPA 4TV8F 5AIBA 5J0PA 2H4YA 2QU8A 3AEQB 2FJ0A 4D43A 4YMUA 3FLEA 5L1IA 3BQ2A 5TV2A 2WC1A 2XUZA 1O97C 3HBMA 3BWDD 3HN6A 4YASA 4YONB 4ZVLA 3RWMB 3V9AA 4Z9BA 3ASZA 4KWIA 2JJMA 3MNFA 2FOLA 2O8EB 2ISQA 1ACMA 4N5MA 5EOZA 1B0ZA 1D5WA 1JAIA 3K6RA 4HGOA 2EZ8A 4QNMA 2VTKA 2F2AB 2NUTB 3DKVA 5F9HA 1FDWA 3IURA 1C81A 2MSEB 4XGNA 5C2JB 2YVKA 1DK2A 3MLAA 4A03A 3VZCA 1DWUA 4PAWA 2Y2UA 4C0QC 1XL1A 3E7DA 1I6MA 2W04A 1UFRA 4NCJA 2A1TS 2R00A 4BKRA 3GJ3A 1AB5A 1I5EA 5DCUA 2HBJA 1JMSA 3VV2A 1QKKA 3KBOA 1JFFB 4NBVA 1N3BA 3DEAA 1AKUA 4V1CB 4JBIA 4PGMA 2ZSEA 1T8UA 2BP7A 4EGAA 4HSGA 5CXSA 1S8FA 5G0TA 4B82A 2GBPA 2ZTUA 4BKQA 4I5FA 3COZA 2FN8A 3BB3A 4XH9B 2DLNA 3PG5A 3NV9A 4L4SA 821PA 3DBVO 1RM4A 5A5EA 3H8JA 2NO6A 3PL1A 1GUZA 3CBQA 2XNHA 3D4IA 2QRLA 8ATCA 3SIXA 3RROA 4TQUS 5DYGA 1TMOA 3QZUA 2Q9CA 4EKYA 1JX6A 4HGQA 4L27A 4B47A 3AR8A 3QA9A 4U6NA 4C4OA 1L5FA 1R0BA 3HCPA 4KIFA 4Y9UA 3EZFA 4U02A 5J4YA 4NCAA 2P67A 3OEHA 4JASB 1M8PA 1ZRMA 3KQPA 3GRKA 4F9TA 4J0HA 1SU8A 2ZYTX 4WUTA 3U7QA 5A4AA 5EJIA 1Q0QA 5FB3A 3F78A 2AJQA 4ERNA 3GLIA 5GADl 1T3ZA 2Z3ZA 3UMJA 2YVAA 3N76A 1PFQA 3M5PA 4TZTA 3LBFA 1JEOA 3GH1A 1BDIA 1KRXA 4EVIA 2W9BB 3TDKA 1XD2A 1UDCA 4PZ9A 4MSUA 5FP0A 4Y1RA 1NI3A 3A1UA 1OUQA 4UNQA 1A8IA 4WEOA 4OYHA 1UEJA 4HMPA 4HRXA 2DPHA 2FV8A 4YEDA 3IKMB 3AEUA 3JVEA 3DXFA 3AETB 4HB3A 4TV9B 4WD3A 1Q7EA 4NONA 4ERXA 1U0TA 4Q7QA 2FZVA 2WPDA 1E1CA 3IEIA 1IMJA 1D8AA 1UDBA 2QJTA 2HK6A 3EDQA 3F6PA 1R6UA 2G5TA 1KU0A 1P5ZB 1UUFA 3QHAA 1SKWA 1PHRA 2AMVA 4I81A 3VQTA 4DMLA 5HRUA 2W43A 3O3MB 2ZTEA 1IJFA 3EULA 3AQIA 4X3CA 5T3UA 4EYHB 5CFRA 2GAFA 4JHLA 3A11A 3FROA 1PK9A 1OTXA 1RXEA 1XZFA 3KOMA 3LD9A 4OYYA 5AI9A 5TRTA 4FNAA 1KTIA 3GW8A 1XA0A 3MGCA 3EZXA 4TRRA 3OPXA 4ALLA 1LC3A 1MHTA 2WG2A 1KYIA 2IODA 2QLTA 3PEFA 4EF4A 1ILEA 1EFKA 3HUFA 2ORIA 2YW2A 1BS2A 1VMKA 2JIZD 4HGYA 1SAYA 3W5JA 4CM5A 3RFVA 1JR2A 2PXAA 1ZVQA 1G18A 1I2BA 2LIVA 4KFTA 3U13A 1E3SA 2GASA 4F97A 2W9CA 1DAHA 2A1IA 4OK6A 4U2EA 5KFEA 2PSDA 5FHRA 1YRWA 2B34A 1U94A 2C5AA 2NV0A 1E1RD 3DD5A 3EZ7A 3PHBE 5A06A 3FJ1A 10MHA 4DR4B 4MA0A 2FWRA 1ML4A 4FKMA 5JRDS 5KHLB 1A7AA 1PYOA 3R4VA 3PIDA 1BTOA 2HFKA 4YMSA 5LLSA 3HKZF 2OFWA 3R5XA 3UXYA 2V9PA 2QM3A 1ZCFA 9ICOA 2CDNA 4YCNA 1LBEA 2E89A 5B55A 5GTHU 4L6IA 4I2AA 1VPVA 4EDFA 2VSXA 3V8RA 2BUBA 3JQCA 5ILOA 1IBRA 4DSZA 3WK9A 1JXEA 4ZO4A 1ZU5A 3D6MA 5E1OA 4Y9TA 1AO0A 2IC5A 4BV9A 4ALMA 1NRJB 3ZY5A 5AVXA 4EB0A 3I5YA 2OZPA 1QF6A 3DVAB 2XITA 2H0RA 3A1CA 1P18A 1IOZA 3GT4A 4GHWA 4TVKA 1N2CA 4MPDA 2PZBA 1O94A 2UZ1A 3AERA 3NJ4A 3T5TA 3VKGA 1GT6A 4XGQA 4L5JA 1UEIA 4FTWA 4DPMA 4UM9B 1V41E 3Q6MA 2CLKB 2FDXA 2NNLD 1CRLA 1W1UA 1XNQB 3AKZA 1TQ6A 1ZI9A 3KX2A 2H11A 1GTZA 2L42A 4O5OA 4PNZA 2ZRCA 3F9RA 4YVFA 1R6VA 4ZU1X 4A6PA 1WF6A 2NX2A 1IN8A 5HKBA 1N6IA 4B8YA 2F59A 4V0ME 2IHNA 4I55B 3KQSA 5EIFA 4ITRC 1WYGA 3UGQA 2DKZA 1EP9A 4C0SA 4ESVA 5CR0A 1LLUA 3VH4A 3VU3A 3NHJA 4IQUA 5KX5A 5KX5B 3IOCA 5B3JC 3SMQA 3R74A 2H51A 1J6UA 1P6XA 2YZKA 2XECA 4U6SA 5AJTA 5JYBA 3FDXA 4TS1A 1M66A 1Y4ZA 1L5LA 3OMXA 4H6PA 5JEEA 3AUYA 3BUSA 1XQXA 3GL9A 4RK4A 3VZBA 2J3MA 2JIMA 3CSDA 4BRSA 1ONBA 3L7LA 2I3BA 3GU3A 4YVZA 1TK0A 5ALQA 2HHXA 1HDOA 2ONKA 1Z7BA 4HLQB 4ZAFA 8ICJA 1TV9A 2ECQA 4C0JA 5BURA 1SWVA 1RD4A 5IUJC 4IH1A 1L8OA 3TOXA 4S05A 2JFVA 1MKYA 2AZXA 3WYNA 1P7WA 3R6GA 4JVMA 2NU8A 3S55A 3TLKA 2ZTHA 2XGQA 5REQA 4QRIA 1PP4A 3FVQA 3NAQA 5DM4A 1GN8A 4RF2A 5EJ5A 3GFKB 4OFXA 3LPCA 2OFXA 2A7XA 1BXRB 1M34A 1SCDA 4JQSA 2XGPA 4NBWA 3R76A 2B5OA 1JFTA 4L74A 2BSQA 1XNRB 2XXJA 3FTQA 4EBFA 5JY6A 2F8TA 4M0KA 4B09A 1TMKA 3GJRA 3MYYA 3O1JC 3H9CA 2R3SA 3QMVA 1TQ2A 3ZCQA 4F3NA 4QICA 4C5CA 1COZA 1G4AE 2OHFA 1KZYC 1ONOA 3BG5A 3FD8A 2ECKA 2VQDA 4LE0A 1Z06A 3UAGA 4G37A 1QP8A 5D87A 2BLNA 1JE0A 1KU6A 2B1GA 2QAJA 3QOFA 3ZHXA 1PNQA 5K0ZA 3GLQA 3IJEB 4WW0A 4BIIA 1U0RA 2MIIA 4HK4A 4RZ2A 5CYPA 3T4XA 1VBMA 5JXWA 2A14A 2XQJA 3O5AA 4BAZA 5DX0A 2IIPA 1XC9A 2NTNA 2P4UA 1G20B 2O05A 3G59A 1K1SA 4Q18A 5EFZA 3BIJA 4D0LB 3QHPA 2WQ6A 2V0CA 2BFPA 3JPWA 1IHDA 2GBLA 1E3JA 2NTEA 1C50A 3Q3IA 1E1QA 4IIFA 4KAFA 4NL9C 2XRYA 3DUFA 2Y76A 3Q3GE 4EENA 2CVZA 4JJIA 1K5DA 1ZD3A 1ARZA 4NG5A 3N9IA 2X5KO 1M8JA 3VI4B 1OJ7A 4JL6A 3UFXB 3EZYA 1W4ZA 1WDWB 4PGYA 1S2DA 1PWEA 3RIHA 1UBKS 4EZ6A 4OFBA 2Q1XA 1F12A 1UKAA 1MC1A 2YJZA 3ASYA 2D0IA 1N5WA 3MPOA 2VSYA 4P08A 1NWCA 4ECQA 4JYCA 4CQNA 2G83A 2OTCA 2WJJA 2WUVA 1KWKA 2PUHA 3F47A 1R27A 4QQNA 1KFJB 1L8QA 5C8YB 1NKCA 3T9CA 2EZUA 1P60A 1IY2A 1E79D 4Q93A 5L4LA 1YS9A 4P83A 2C4HA 1VJRA 1STOA 2PIAA 2YZGA 3G6XA 1NY5A 3Q9UA 1SOMA 4BEVA 1RZRD 4GBGA 2A1UB 1B8VA 1D2NA 2PRJA 4F2RA 2ACVA 5FV4A 5IZCA 3TARA 4X54A 4OSEA 5EGNA 5LIPA 4I46A 1DAKA 2FFQA 4KBFA 2V7QA 4M8NE 3FVWA 1O5OA 4HNVA 2HQSA 3WRYA 5ALTA 3TAHA 2OVBA 3CIOA 4ZT6A 4DWVA 2ZATA 2Z1NA 3SOZA 4P82A 2C9YA 1KOGA 1U80A 4QFDA 1KK0A 4XFJA 3G2LA 3H18A 3HS3A 2RHOA 2XODA 4AZVA 1Z6ZA 2QBYB 4UDYX 2IVZA 4ND4A 1RHUA 8ICAA 4ND8B 4M0UA 4TMVA 1HA3A 1EGVB 4I66A 4QBHA 3LUPA 3L4EA 2JI4A 3RPEA 2BZFA 1AK9A 3MERA 3OOWA 1AK2A 4Q3LA 5IAJA 3TQTA 5BR7A 3ADCA 3B9JA 3KR9A 3MOIA 1NOIA 1VG9B 1KSPA 5CM2Z 3DW3X 3ZD6A 4RIFA 3Q7QA 1GUFA 3PFNA 1TOAA 2BCEA 1W2WB 2DAPA 4W99A 4CG0A 1DIGA 3CTMA 3UMBA 1NTOA 1XF1A 3NTUA 3GZNB 4MR9B 4KOEC 3Q12A 3HDYA 2GNAA 1UPAA 3TD2A 2NM0A 1GARA 1XWLA 3HCBA 3IEXA 4FDVA 4G1CA 3EVNA 2GLEA 1QOQB 1Z3EB 4FN5A 4ZOBA 3E2EA 2Z2XA 3LL7A 1RKBA 3R3WA 3TTSA 3U44A 3KUDA 2QYTA 1OI7A 2FCRA 4X84A 5T64A 4UUQA 1S9FA 1LPNA 2G6BA 1DK3A 2MSLA 4Y2XA 1M2GA 2C07A 2Q3MA 4HWSA 4KO8A 3CEAA 1D1TA 2F3NA 4YHBA 3ZNOA 1OXUA 2HT1A 2H1LA 4UASA 2WPDD 1JLSA 4N6NA 4TTSA 2P1RA 1MOZA 3D0RA 2CLSA 1XZ8A 3IPCA 2C97A 3L4BC 4F4KA 2CFRA 2H3FA 3KHRA 2C29D 2GFQA 1JIHA 3ED5A 3BXGA 3I0ZA 4UM5A 3TAXA 2D5AA 2DXIA 4NMMA 1WCNA 2AE1A 2RFLA 4XA5A 1Y4AE 2PWYA 4MPJA 5LC1A 4WLOA 4ZCRA 2B9EA 2EHDA 1EK1A 3BYZA 1JJFA 2FZLA 4TLEA 3IBYA 4D6PA 2VYVD 4PSVA 1YB5A 3MQ2A 3ZLBA 2AKAB 2DT8A 4Q9DA 2D7JA 1W0JA 4PZYA 2QF7A 5KTKA 1C0PA 5IJ9B 3NB0A 2X41A 3WMFA 3HBNA 4PPFA 4Z6CA 2VDRB 1S02A 3DDZX 3LG2A 3E2MA 5JUWA 3HNPA 1IZ8A 1L2TA 1WZCA 4PIPA 3ROQA 5AVZA 3ROZA 2OLEA 1DX6A 3OM0A 3ZHYA 1YXMA 2BGNA 2J9ZB 2RGGA 1CUFA 3DEFA 5FBKA 4AJHA 1DIRA 1S97A 2G1UA 4Z4EA 3C6MA 3WJ1A 2FDRA 2QUHA 3FTCA 1NI4B 1YZNA 2Q2QA 1BHSA 1NF3A 4TWAA 4I2BA 1ZK3A 3TSCA 5JFOA 2UAGA 4QEDA 3IULA 3TG2A 4DFJA 1E2HA 4UREA 5AHRA 4M0DA 3PF9A 2Z9DA 4DC0A 3OESA 3SYTA 4O4LB 2M6KA 1RBQA 4INZA 4QVGA 5KTSA 4LA4A 3PIRA 4OU5A 1W36D 2QN1A 4W5OA 3HP4A 3AHJA 3L40A 1UM9B 2XMDA 1M5RA 1ENPA 5CNIA 1JQLB 5JR3A 3AJAA 3TGPA 3RYTC 1OH7A 1LPBB 1V8ZA 3M7DA 1YIAA 3JALA 5AW3A 1RLUA 2OV3A 1JKJA 1R5NA 3KQOA 5B1DA 3QX8A 3UT5B 5I4CA 3O26A 1NKEA 2ZSKA 4M99A 1JJVA 3PYMA 2I2CA 4OYRA 1GWNA 1H6AA 4GLBA 3GQVA 4MQEB 1QB8A 3K0FA 4BNDB 2TMDA 4C7ZA 2ENUA 2HMUA 2V9CA 2VJYA 3A3NA 5A4IS 5BNWA 1OWNA 2WPNA 3AUKA 1OC4A 1J8QA 1Z0IA 4RE6A 1FX0A 1ZSYA 3OCVA 3WB1A 1RYUA 2Z8YA 3FWNA 4GECA 5DSXA 4B43A 4GO1A 1L7PA 5LQMA 1ULAA 2GEJA 4HWTA 3LIIA 1Z18A 3QY9A 3THWA 4JP2A 2FG6C 4WERA 2ZIUA 4OGKA 1W9MA 1GNLA 2Q99A 4FBGA 4X65B 1EJ0A 4M60A 2V45A 5KYUA 1CR0A 1O0BA 3TSYA 1ZD4A 3G9QA 1S6YA 3TK1A 4XUDA 5JSZB 1CRXA 4C4ZA 4OMCA 1VP3A 3GEMA 4ZEVA 1RLTA 3LWDA 5IIJA 3I2GA 1KO1A 3N6VA 3BS7A 4I2NA 4AY6A 2BUAA 1LBTA 2DQNB 2P35A 5BP7A 2HJHA 3K2QA 4G0PA 2PGJA 3RB0A 4ZQBA 2A5YB 4IDCA 3SQLA 3RF9A 4AJJA 4DLTA 2CLHB 3EEIA 5L7WA 1UJBA 4C0XA 2C0PA 2HLPA 4X62B 4AJLA 2VHQA 7ICKA 4CMEC 1A2QA 1MOPA 1E7MA 2H2HA 4IDDA 3SU8A 3HXQA 4D4MA 4O2AB 4C8OA 3VYSB 1PRYA 3ZEAA 2W9BA 2JFYA 3OTGA 3TIIA 1X7DA 2E87A 2IX3A 4K86A 2XXAA 1UBGA 3WBJA 5ICSA 4YMWA 3G17A 1Z4MA 4W5JA 3DR5A 2OPBA 1ZDMA 2Y1DA 1I4WA 3F3SA 1C4XA 1PSWA 1NK9A 2A1UA 2REOA 2X7HA 3H5NA 3OLYA 1DEOA 4C5BA 2JLBA 5DLGA 1E6MA 3R9IA 4CCWA 4DREA 3OHPA 4ZHQA 2GCOB 2XTZA 4QW8A 3AI1A 2A86A 4M0LA 2VP0A 3HEBA 3HYLA 4QC2A 4QREA 3WLMA 1NMXA 3LQ1A 1QONA 3BJRA 3NT5A 5FBHA 3UUWA 2IYTA 1SHKA 2XCQA 1IOLA 3HADA 3UXMA 5HSGA 1ENOA 1ZM9A 4D3FA 1GPNA 4KQFA 5KNBA 4KACA 1M1YB 4I6JA 1GVNB 1Z5GA 2VO1A 2VXBA 5H1YA 4PYIA 5F78A 3U3XA 1XCMA 1LDNA 2P9FA 4B84A 4BVLA 1PGJA 2YV2A 4D57A 1Y5MA 1A96A 1Q1QA 1RRGA 1OYYA 1ZH2A 5K0BA 5LP6A 3AR6A 4B1FA 1HNWB 1E4OA 4HFJA 3IA7A 2W9MA 2OESA 3MFHA 4O63O 2IOYA 3DMPA 2IP2A 1JHMA 3ZVLA 5HXAA 1E58A 1SXEA 1G41A 3UUGA 2FEAA 1WULS 1HE4A 1LSOA 2WJ3A 3IXQA 4XW2A 3CEMA 3RFXA 5LWHA 4ZC1A 3TL6A 1ZESA 2MU1A 3CE9A 3OPQA 3VZRA 3SVLA 4L2IA 3D1LA 4P7BA 4PYLA 1MQ9A 3ND5A 3EDOA 1U47A 4MI6A 4ON9A 4XTCS 1Z26A 5B58C 4B3GA 1O96B 1NZFA 1DQRA 3GJYA 2EHJA 4TSFA 4MV9A 1QXSA 2VHUA 4W9NA 3CLTD 4Y7CA 2JEGA 3T54A 4CKEA 4RSGA 1QH9A 2N0SA 5CEEA 3AR5A 4XLZA 1XMQB 1WWUA 3KZVA 2R65A 2V74B 3K32A 3KJFA 4MAMA 1QO9A 4LY9A 5FFMA 2VWPA 4LI0A 1XR3A 1Y5IA 4AULA 4OHYA 2XPCA 3E1GA 3LGSA 4WESA 4YI5A 3IDZA 2ZTSA 4CCSA 1W0KA 2VDOB 4FZ3A 4UBMA 3QG5A 2JCYA 1OV4A 3S0JA 4NLBA 5ESRA 3UW1A 4FE3A 4R0NA 3G2PA 2Z0MA 2BFEB 3G5LA 3QUCA 3IILA 4FEEA 4OHWA 1O4WA 2KJ8A 5B3AA 5AK3A 1T2CA 5D3ZA 4A0FA 2B5VA 5ENDA 5HJEA 4NU5A 1I6KA 5G4KB 5TT1A 2QQEA 4FR5A 5JNUA 2VJ5A 4A4DA 2DL0A 4G3IA 1GZ4A 2MMCA 2P6MA 1K7YA 3MMZA 4YB8A 1NQAO 2GTIA 4FHEA 5L3RA 2F55A 4X20B 1C7RA 5B12A 2UYYA 1CJCA 1PG2A 4PXAA 2MCFA 2R8EA 3CWZA 3DL7A 4BRWA 1GAQA 1QCZA 2J9GA 2DBYA 1YKSA 2GN2A 2RBGA 3I64A 2O8BB 2FEKA 3PGVA 3IUMA 1KBQA 5HTKA 3MF4A 2HL6A 3H1TA 1QGYA 3HKBB 2QPTA 3UAWA 1ULTA 3L0SA 4JZKA 5CPFA 4EUSA 1C14A 5BQPA 4X91A 3LZCA 3KD2A 4MA5A 4N49A 4ZIRA 2F3RA 5CM8B 5DT2A 3ZGLA 3PQ2A 5B6IA 1X7YA 4H7FA 3KETA 1CY4A 4N01A 3WLHA 1HE8B 2E7ZA 3KCNA 1XTJA 3TQRA 3U16A 4YRIA 3WIUA 3PUHA 1W93A 5DGDA 3VPXA 3RS3A 2G1AA 2QJFA 3OZXA 5TPWB 4EABA 5TPWA 1B16A 1C1XB 1CVLA 1XZNA 2IBMA 3CRZA 4RVHA 4PCAA 4IRDA 3R7BA 2IYVA 3B1KA 5F33A 2ZSHA 1X7GA 2YHSA 3QKSA 1G291 1ZQYA 1NBOA 2O0JA 2ZT8A 3WWOA 5BWOA 5F4BA 1OASA 2XR1A 2VT7A 5AK0A 2IPXA 3OZDA 5KFJA 3UICA 2EQBA 3S1AB 3VHRA 1V7QA 1QK4A 5DH9A 4GGMX 4K05A 5DASA 1H4QA 3LYLA 2XTMA 1QMPA 2LW7A 4D3XA 3P0RA 3OEEA 1K8XB 2W7OA 5ECGC 4I9HA 9ICPA 4HNUA 4US1R 4R01A 3T9EA 1ZIDA 4YMMA 3TQQA 4B5LA 2GN9A 1GCAA 2XF8A 4MVJG 5FPKA 1VZ3A 1W4LA 2RHWA 3U31A 3W8DA 2RI1A 4HH0A 4EUHA 3VTAA 1SIWA 4LVSA 4IR1A 2RHLA 5BPHA 2OG2A 2NVWA 2PANA 2WEKA 3CF2A 1YZLA 3R23A 1K5HA 1U90A 3NIFB 3W5CA 2C2MA 3E70C 1BPXA 3I3SR 2C0CA 3PZBA 3W9SA 4PAMA 2ROQA 2C2RA 4TXHA 3Q3JB 1M1YE 1U1IA 2CXRA 5DI3A 5BSGA 1HSOA 2H5JA 1R4MA 3IV7A 1PZEA 4GXQA 4PX3A 1V95A 4AB1A 2O8FB 5KFKA 2BH9A 2Z2ZA 1U98A 4MCAA 4U2CA 3RLIA 4E4YA 5BUSA 5EZYB 3R7DA 1KI9A 4LY3A 4NJOA 2GPTA 3ENQA 3FAHA 1Z7YA 3TH5A 3O95A 3EW7A 4X1KB 4LZOA 2F00A 5TLSA 1XB2A 2R2GA 2FX3A 4FQ7A 4L0DA 1M1NB 3L4PA 2BCRA 1QR2A 4JT9A 2AGVA 2ZRPA 3UY4A 1CUZA 4Y2UA 4DS5A 2H1HA 4RV5A 5HIIA 1E92A 3NBKA 1XTZA 3PX6A 1KJYA 4YPVA 4L8WB 4CL0A 4C7JA 4OAQA 3DG9A 3RUAA 1V8DA 4OSPA 3TKAA 4F9FA 2PKRA 2PMZF 3B53X 1RKXA 3U7QB 5B3KA 4Q44A 4FUQA 3GLIB 1ZOLA 3ZVRA 4ARZB 1RZUA 3OX3A 4D74A 2FLWA 3EBOA 3S70A 1CY6A 4ED8A 3GRAA 2EAMA 2GI4A 5IC4A 3N4MB 2UZAA 3SZ2A 4IDAA 3KPYA 3RS4A 3VC1A 3LQ4A 2HMTA 3LPAA 3FOAA 1NRIA 4EBCA 2G4LA 4N3CA 1XZBA 2IZOA 3ECCA 1VOTA 3PGLA 3UA3A 2W48A 5BRAA 3EX7C 1H0HA 5G3YA 2YWRA 3KUXA 2B1JA 1NBIA 1BPEA 1QBGA 1D3AA 4TM8A 1PE0A 1Z37A 4OG2A 3KJZA 1E9EA 4N3AA 1O9GA 2CCGA 4NJMB 1K2WA 3NHYA 3WADA 3ACCA 2JLRA 4LZNA 4P4UA 3PTZA 4FB5A 2B0JA 2W2XA 4ZVKA 4JYAB 2VJOA 4JITA 3IEUA 2W0SA 4HNHA 3EIWA 5ULLA 3OQOA 1P19A 3CNLA 1ZQXA 1ACLA 3CRQA 1QB7A 8ICGA 3OIDA 4KWHA 5AW4A 1NU8A 5BSMA 3TRIA 1UDAA 4V0MA 2QW0X 4F5RA 2YL2A 5KWVA 2X9VA 1QK3A 2VF7A 4B4KA 3OEYA 4YK7A 3C1ZA 1W94A 2DX7A 3F5FA 3JYOA 3K92A 4KAAA 4WLFA 4KWTA 4LDNA 5EFOA 4TYYA 2BQRA 2XLCA 4PLVA 3K73O 4NXMB 1PR1A 1B93A 1Y8RB 2BKVA 3A26A 3D1VA 4MV0A 2G0AA 3A9UA 1L6IA 1XJ0A 4KRGA 2R8GA 4QOSA 3AEKB 5GOTA 4N6OA 3T94A 2WD7B 1E2DA 3DAGA 4DVGA 1U99A 2HPZA 1XT6A 3ELYA 2E3TA 4DOCA 2R8XA 1DCKA 3BJMA 3KYDA 3ORQA 3RB3A 4M46A 4MGEA 4PLHA 1E9FA 5DP1A 3O0TA 2V7GA 4R2JA 2ACWA 2AC4A 4R2HA 5J0QA 1X8JA 1JZSA 2G80A 2X1HA 4IIJB 1T25A 2GAOA 3FYTA 3N8IA 3PSTA 4EVRA 1FW6A 4CM8A 1CR6A 4OBBA 5HE8A 5JH7B 2WM8A 3UTCA 5JH7A 2D1RA 3VAAA 4Q9NA 4F9EA 4LRWA 1QAMA 4L85A 2G17A 4LSGA 1R0RE 4X00A 3PHGA 1NQTA 1NOKA 1VPLA 5M04A 2PLRA 4DSLA 1U6JA 1EUQA 1HT3A 2AE2A 3D5TA 2O0HA 4FB4A 1SN7A 3TW6A 2QIPA 2IFTA 3S3TA 1XDGA 4ZQHA 2WD7A 3TFSA 2XB8A 2MR5A 3HTXA 3PPYA 3FNRA 1T0IA 2OBXA 1NMSA 5IN4A 1F44A 5EIBD 5JDCA 4EB8A 1E0DA 2J4FA 4NFLA 4DEVA 2ZUFA 4DCSA 5I48A 3BJYA 4RPGA 4EKIA 1C9DB 1XTSA 2ZDQA 2XAUA 5BQOA 1DC5A 4ALJA 5I9IA 1XEFA 4XASA 1VSQA 1K5PA 2VHTA 3LT5A 1LFAA 2RCYA 2ZBGA 1Z4LA 1XQWA 1V37A 4I2JA 4B71A 3GIWA 3U2QA 4K9KA 2BLLA 2QQ5A 4PZNA 1ZNYA 2OZKA 3CF4G 4C2BA 2ALZA 2CLMB 4I1RA 4UEQA 2GXUA 3GVXA 2V4MA 4DRYA 4F60A 2WB2A 4M1EA 2B4QA 2Z2JA 1G8YA 1W85A 3CTPA 2QMOA 1KK2A 4I1UA 4J7CA 4IIEA 2B4KA 4O4IF 5JC1A 3QF4A 3KYCB 1Q16A 1LV7A 4ZALA 2M6LA 2HWUA 3UT5A 3VPHA 3ZX5A 2W37A 2PX0A 5HQJA 3MTBA 1AN0A 2LM1A 2XIJA 1ZBDA 5HDBB 3VU9A 3ALRA 1QDEA 2G8LA 1BW9A 1PD1A 5BY2A 1NI4A 3BD9A 3JPYA 1HMPA 2C94A 3EVTA 3IO3A 3V5NA 4DIUA 2P2DA 4F46A 2ZBQA 2IS1A 1KE2A 4OIFA 1GUBA 3CPJB 2AXPA 3QE0A 2BPOA 2VJLA 3BBLA 3N0XA 3MPUA 2ZRIA 2AN4A 1H9BA 2R6JA 4IV0A 3THRA 1L6RA 5I9BA 1PW5A 4JCOA 2GUWA 1HLFA 3DE3X 1YACA 2WU0A 3B2QA 4CQJA 1RQNA 4RUAA 1G3MA 2EX1A 3X2EA 4HGRA 4DLLA 2KHQA 3OETA 1J25A 2WOJA 4QULA 5I3ZA 1WXEA 5T6MA 4E21A 4WV3A 5JAIA 4C3UA 4GPAA 3AV0B 4MLDA 2Z4TA 3ZZNA 1H5NA 3I58A 4KKVA 5C7OO 1B23P 4UKDA 3DA8A 2KZ3A 4L0CA 5CEFA 1JX4A 1CUCA 4HC4A 3K4GA 1DEKA 3BMNA 3HU2A 5HZMA 2R8RA 4YHHB 3I9KA 4QM6A 2WTFA 3OLQA 1I10A 2J3KA 3OT1A 3G88A 5KFBA 1AQLA 3LE8A 4YY3B 9ICVA 2NGRA 2DFTA 1N2EA 2V7VA 3AXSA 3INTA 3QVSA 4CJXA 1H2HA 1TI7A 2H3EA 2HJVA 4YP7A 1G2IA 4AN0A 3WLIA 4B32A 2Q0HA 1L4YA 1LXCA 3ZX4A 2AUMA 1KMMA 4HDOB 4QGGA 2XGOA 2WSBA 4ARCA 1Z75A 1E5QA 3VMFA 3LOQA 2LWIA 3V8BA 1SQFA 1GP2A 2K4IA 1SUIA 3NO4A 3QI7A 4KQ1A 2PRYA 5KIAA 3FSJX 2D1QA 1NW4A 5E0OA 2FMUA 4J2OA 1GGNA 1E4VA 2QGNA 3BD7A 3VKHA 2YWJA 4A8HA 1C4OA 1L8AA 2G6TA 4LZGA 4X1KA 2WINI 1ND5A 3P97A 4KUEA 2W9XA 3MLEA 1RYEA 4I8IA 5ES4B 5F1KA 2A4MA 1UT8A 2Z7JA 3RB4A 4CUKA 2X7XA 4Z3KA 5J0OA 1JHXA 1YI0A 2Z5VA 3GD5A 4BQIA 1Y6FA 4PZOA 5CA7A 7ICJA 1T3LA 2RAFA 4RSMA 3ZIUA 1QVWA 4CUJA 1F5SA 3QNUA 1ZJWA 1XU4A 3TOCA 4C8LA 1XZGA 4RFSB 2O4UX 4UEKA 4RQ7A 3NHAA 1KH1A 2ADMA 4UD6A 3TLJA 1BVSA 4BUCA 5C9ZA 2GK7A 1KAOA 4I14A 4AJOA 4BVFA 1PBTA 3FPSA 3G0HA 1SCAA 4M4SA 1A1SA 4OKNA 3VNBA 1GNRA 2PX3A 4I2HA 1RPAA 1XZJA 4IJQA 4J2HA 4KSCA 4ZOEA 2NZ8A 3U1BA 3IBCA 4BWMA 2A3RA 5SZKB 1NX6A 4AG6A 1R1DA 2XBLA 4OD0A 1WSDA 2BMWA 1SIJA 3F71A 2VZ9A 5JU5A 1P4AA 3ZWOA 1XSLA 4HAUA 5JFGA 2DECA 2FCAA 1YKGA 2HCTA 3HO8A 5KJ1A 4EH1A 2F6RA 4AI6A 4XM1A 2KW5A 2RH8A 4YTEA 3TZEA 2HHCA 4HN4B 1OWMA 1E3DA 1E9DA 5IG2A 5FJIA 7REQB 5KJCA 4I2GA 1E1YA 3HMKA 4YQEA 3KQNA 2CJFA 3MS2A 4R9SA 3IUPA 4UMEA 5KQGA 5IKPA 4HD8A 1E4EA 1ISGA 1GVHA 1K6JA 2C7OA 4D26A 2HSJA 3V6JA 2ASVA 5ELMA 2H1WA 1WS6A 1XCGB 2OE2A 3IDSA 5IIIA 2IIBA 3CW9A 2JGMA 3AVWA 2Z6UA 4TYWA 4EVSA 3USCS 1Z4JA 4ZYXA 1U9ZA 4TX1A 3LW8A 1NR5A 3WV5A 1R2QA 1YCHA 1BS1A 3UCEA 1LDEA 1MXHA 1RP1A 5ALGA 3ADPA 2X13A 1EBBA 1ZNXA 4WZBE 3BQ7A 4Z8XA 1OIXA 4E2WA 3FFTA 4JA0A 3DEHA 3GWZA 3CEPB 3HJEA 5J2BA 2KLBA 1PUIA 2I6SA 3H1EA 3UV6A 1M33A 2PV7A 5F51A 1CPYA 3E9NA 1MENA 2L18A 4KU4A 3HW8A 4YCLA 3QXGA 3C2MA 4E11A 1SK9A 4G5GA 5LXTF 3UQZA 4W5TA 1I36A 1TJPB 2VQSA 4QJ4A 3I37X 1OA0A 3EH1A 4CTMA 2R8JA 1LK5A 3FPKA 4DXDA 1GIAA 4M8IA 1AF7A 2X4LA 2P41A 1SBZA 1XG5A 1UMBA 1GZSA 4O0LA 1NVUQ 1T2EA 2QE7A 4JMLA 4RK0A 3IPLA 4ECAA 5KC8A 1MGPA 4QECA 3DQZA 4KITB 4C4SA 1IY9A 2BDEA 2WIDA 1BMFA 3CG4A 4OXXA 4QDKA 4J9RA 3WXBA 4Q1VA 3ZJUA 3FFWA 2XRZA 3DV2A 2PQ0A 2KYRA 1U1FA 1U8YA 2RJ3A 2QUIA 3AKCA 3R7WB 3FMFA 3TTUA 1D0SA 2QLBA 4NQRA 2MAXA 3JQFC 4NX2A 2IS6A 1ZQNA 4Z3OA 1N9KA 5HGJA 4BKUA 4YUAA 2HADA 5B3LA 1DBQA 1P1KA 1EFTA 2B8JA 4FHCA 5DIZA 4LYFA 4Z6DA 4IX9A 4ZZIA 1M2WA 4CLXA 1ZC3A 4YMNA 1IZYA 2Q8PA 1AG9A 2EZXA 1X1TA 1XLWA 2IUFA 5F21A 1GV1A 4Z7NB 4P4NA 4QQFA 2I62A 3BM5A 3MJEA 5K1ZA 5LCXA 5DXFA 2OAP1 1SKAA 2H1SA 3JZAA 1QHFA 1DXQA 1ONSA 1QYRA 5F4ZA 3V6KA 3H42B 4BKPA 4DLRA 3F4LA 3SF0A 1PVOA 1J2RA 1Y8QA 4NZPA 4CI0B 3P0IA 4D5EA 3K9FC 1N25A 2GRJA 2ZWPA 4H7JA 2BFMA 4Y18A 1U1CA 1PV2A 4ZOAA 3S5UA 5KG2A 5EWMA 1YTLA 4IGIA 2VDKB 1KDPA 4B3CA 2XBMA 4FJ2A 4TMKA 2IEZA 3SFZA 2HJRA 2ZVQX 2G0NA 2VNJA 3I9FA 5H82A 4KLLA 4L0QA 3PQ6A 4U2GA 1V35A 3RH6A 1ZHHA 3CVWA 4TLDA 3ZBUA 1E99A 1BE8A 4LF9B 13PKA 1XP8A 2X3UA 4BMXA 2PJZA 1CRPA 4WASA 4ED7A 5EE5B 4ZVTA 4JQZA 1P3Y1 3SYKA 3WRXC 4KLNA 4EFLA 4CFYA 5BXYA 5BV8A 3F5QA 5HZKA 4LXUA 5BSEA 4QGBA 2BIFA 2IYYA 1M2VA 1YMVA 2IHKA 1E8DA 2BEVA 1YQ9A 1QRTA 2Q1UA 1U1EA 5F64A 1ZRSA 2QD3A 2ZIEA 3C29A 3A1WA 2C5GA 3ZWVA 4MDYA 2GEVA 1PZHA 2LUOA 3LHKA 1PL8A 2J3QA 4EY6A 1C2YA 2PMCA 1SOWA 1MB0A 2ZB2A 3ZGOA 4AO6A 4BLQA 2WWWA 4E2FA 5BUQA 3V8NA 3AL0C 3KD3A 2ZE7A 3ZDEA 1EBUA 1QH1B 1TZKA 1MO4A 1Q3HA 1P7ZA 1R4NB 3H83A 3NM5A 4LOAA 4CKBA 4JI0B 3C1AA 5C1PA 3IOMA 3MTQA 5FBVB 4Q9JA 1SMKA 1X6VA 4OP1A 1SIUA 1T2FA 3FYUB 1NXOA 2VWGA 3WLTA 2Y9UA 1QCKA 3ZZ1A 3HJBA 4DA0A 4GAEA 2W58A 4C06A 5MF6A 1KSGA 4MJ3A 5G0SA 1H1LA 4TYNA 5HR6A 3F6RA 2JH7A 3MR3A 3KSAC 2BDUA 1FQOA 4UTPA 3OUZA 5J23A 4PJ0U 4G1MB 3HN2A 3STHA 5L3VA 3Q10A 1CUYA 4IIJF 3SS8A 1XK7A 4IQGA 2WJYA 1NXWA 3PC8A 3Q11A 2PRIA 2A59A 5EA2A 1DC4A 1X2EA 2E2WA 1T2UA 3D6FA 2NN3C 3GUCA 1T2NA 2ZB8A 1QVZA 3I5AA 1TZJA 5C5DA 3JCZA 3Q0IA 5CNKA 3FOBA 4BNYA 7REQA 2QIOA 3KKAC 3DDHA 2BFOA 3EAFA 2XC9A 1KO5A 1GSIA 2E4YA 4R2IA 5CLHA 2GM9A 4IHJB 4MVJP 1FVXA 3UOGA 2DR0A 3AF4A 1GPYA 2NZUG 5AKKA 3C97A 3R3HA 3MR2A 1ABEA 2W8BA 3JQ8B 5CP2A 3MCTA 4S1WA 1SOUA 2X6TA 5EXSA 4N48A 4KR6A 3AU9A 3LT1A 5EC8A 1U3GA 2YIMA 4CM6A 4JB0A 5KAPA 5FPSA 1YR8A 1RAGA 2VPXA 3IBGA 1AGRA 1FP7A 4L7VA 4JI7B 2VNHA 1PFKA 2X0KA 4IIGA 4TUPA 4I28A 2E5WA 2IY9A 2Z5GA 1IZ7A 1CY0A 4QODA 3LPLA 5M34A 1IM2A 1Q74A 1YT5A 5IULC 1OU0A 4O4IB 2F1JA 3CB2A 5JROA 1DRWA 4FGWA 5IDWA 1J4AA 1NJZA 3UPDA 3PW7A 1X2BA 2UUPA 1K7FB 1L5UA 5F7JA 4DIEA 5AQEA 1DL5A 3K1AA 3UAXA 3QX9A 4DCTA 2WB1F 1DNPA 3IKLA 4RPJA 2A3NA 4R8UA 3A14A 2WWGA 2QAGC 3B5IA 1KQQA 2OV8A 3JTMA 4AY2A 2EATA 4GXKA 2RI6A 3GDGA 3K8QA 4GPZA 3ZBQA 4HUQB 5GVSA 4MQLA 5L3SA 4E12A 1SUFA 4XOUA 5IVHA 2B92A 1EK6A 4JBXA 4RJKA 1DO8A 3CJQA 3NORA 2MMGA 3FTDA 3ONDA 3R5TA 5T4BA 2BJHA 2VP2A 2AHRA 2AEFA 4LV6A 1HT2E 2FB9A 2JAWA 3BTSA 1TB4A 5HBGA 2JRZA 2R6GA 1NW7A 4ZDWA 3IOBA 2K7FA 3RTBA 1QQBA 1UKZA 3TRFA 3GMSA 4GXIA 5CJ7A 3KZOA 4UQLA 1W8DA 3NAGA 4E94A 3LUFA 2LPEA 1KETA 4HQ6A 5NULA 3GYBA 4EGJA 4Z4CA 3MGIA 3JWPA 2LM4A 4XTRA 2WMYA 3TSWA 1GL6A 4H08A 4NMWA 4PX2A 1GGJA 1HG1A 5FOVA 4B9AA 4BB5A 3LL4A 4AURA 1SQ0A 1VLBA 1X86B 3EEYA 1PWZA 1OYWA 2Q5QA 3BA1A 3FCAA 3ZBPA 5EE0A 1JQ3A 2ZDGA 1U9YA 3E5NA 4BQFA 5CLLA 1XXHA 5CYGA 2PZJA 1WHTA 4EGSA 2EKZA 3LLVA 5AUOB 3CT6A 4JDPA 2WMDA 4P5DA 4YAKA 3ZJYA 1FNBA 1TMYA 5G1NA 3AB3A 4Q7MB 3C3JA 3TN7A 4ZYWA 3RJZA 1RCUA 5C37A 2VDLB 3NRBA 3SV3A 1E7SA 2LBOA 2A3VA 3FGZA 1T1IA 5CTAA 3AF3A 3F3KA 1AKNA 3SAHA 2V5AA 5CK4A 2ZJ7A 1J24A 6ABPA 1LPAB 2Q8NA 3EGOA 4FZRA 3IMEA 1JIUA 2CXNA 1V11A 2ADFA 4KQEA 5HK9A 5A0VA 4EELA 1XWWA 2YV5A 1VLVA 4S04A 1N5IA 1MC4A 4J9QA 3K1RB 4P6VF 1C9KA 3W9YA 3H9UA 3DF9A 3DBOB 5LNK6 4DCJA 1C1XA 2O54A 1AUOA 1YQGA 2QN6A 5G3ZA 1QIHA 4Q5IA 2LHTA 3KHLA 2PQ2A 2HK8A 1GGEA 4HJXA 4A8JC 2OXOA 3M81A 4NYJQ 2EBWA 1KGSA 3KQKA 3INGA 2KBEA 8ICQA 4PL1A 2Y0EA 4LF5B 2C8VA 2HU2A 4OLFA 2ZWOA 1ZLXA 3GCWA 1P9NA 4IIDA 3A9WA 4NV1A 1SBHA 5KAFU 1IY0A 3UH1A 3PMLA 4BLWA 4QXPA 3GFQA 4R71A 2JBWA 4M9JA 1FTGA 3Q3VA 4V2IA 3WBFA 5FA6A 3SKXA 4Q21A 5CB4F 1G2PA 1NQVA 4KLDA 5LB4A 1TUEA 2HU8A 3RT1A 2GZHA 5ECDA 2V5VA 2QN8A 3ID6C 4QDUA 3VR2D 3DCYA 6Q21A 4IQTA 2GO1A 4V1CI 2C2OA 2EWVA 3U09A 4GD3Q 5F9FA 4NBKA 1ABBA 4BX9C 1N0HA 2ISCA 3NATA 3ZQUA 4E5MA 2QBYA 4MQMA 4INPA 5BRNA 1YRQA 4B4VA 3Q8LA 4P58A 2W22A 2PK3A 7ICIA 5AQ1A 1EHIA 4H1VA 2OT3B 1G20A 5AVOA 1P4SA 3EMKA 3IAFA 4G8JA 4OM7A 4N8SA 4JLWA 1VJTA 4XVHA 2BI8A 2WJVA 1S3SA 2PXHA 4HGPA 2VNKA 4RHYA 1GZ3A 2D7CA 3N8GA 3DUFB 2BCSA 1UJNA 5HK8A 5C8YA 5I8WA 2PR2A 1NP6A 2W00A 3H6KA 1Y82A 1CEYA 1SBQA 1GXSB 4EJ2A 2KKVA 4HDCA 2QHXA 2REBA 2W4QA 3EFOA 1S3GA 4BE9A 5JSHA 4IJUA 1C7EA 1H9AA 2W6IA 4DGQA 3GVPA 2PRZA 3CX7A 2ILTA 1M0EA 3SHQA 1EAMA 3VPAA 2HCRA 4EHHA 4UBCA 1RXCA 3OT1B 3CLRC 5A04A 1RYSA 2R1ZA 3WGVA 2C3UA 4DQVA 4KPGA 3IQDB 1X1RA 1NAIA 2YJ5A 4GH5A 4ENWA 3KJNA 4L5IA 1I94B 2OHJA 4ELUA 2ZJBA 2NPIA 5D46A 1SY7A 2GM4A 1JFLA 2PR7A 4MMXB 2OZVA 3VNQA 3KE9A 3LY8A 1DOQA 3N1UA 3Q3EA 3F4KA 4LZWA 1T0BA 4Z9XA 1HEKA 2UKDA 1U0OC 4K9SA 1S76D 3LS2A 1FSFA 4IG9A 2CVOA 5GP1A 4KVZA 2AOVA 2J0UB 3ZHOA 4KTQA 4E6EA 3ELWA 5JC8A 1QLHA 2FPIB 2H1RA 4WCVA 1D1SA 1Q19A 1MAHA 1G8GA 1YUBA 1QHNA 1IG3A 2VATA 3F5SA 2FZWA 1B73A 3H11A 4F6RA 3H0CA 2DHDA 3N39C 3LGXA 2X0DA 4L72A 3RVDA 1VCHA 4RTOA 1CLEA 3FNBA 3X2FA 2IMWP 1E5LA 1SL2A 2RGEA 4D9IA 3EEOA 3E3OA 2J1LA 2ACKA 4DS3A 3EY4A 1VRVA 2UVPB 5FIUA 7ICEA 5HMLA 4W5QA 1IK4A 1S8OA 2JD2A 1S0OA 1IAVA 5L1LA 1GTL1 5L3SB 2LKDA 3M4YA 4KP7A 1ZQJA 1D6NA 1I32A 3QLJA 2YXEA 4CIXA 7ICVA 3L07A 3KB6A 4YREA 5DOVA 3RUCA 4K28A 1KI3A 2WMNB 4R1PA 1BZYA 1OQAA 4KQWA 4TWRA 2UZ1B 4CIYA 3BWVA 4J1QA 1ZWKA 2M9NA 1J7JA 2ASEA 5K99A 4M0AA 2CWDA 4MS3B 3DTTA 4YV7A 1CETA 3CKLA 3L0IB 4O2BB 4D9KA 3F6BX 3EFHA 4H27A 3IIJA 3R5SA 1EVEA 2E4UA 2CZCA 2EDUA 1GA6A 4KFCA 2OCIA 1NW5A 2ZTLA 3NWPA 1G7SA 2OO5C 5AVRA 3VR6H 4Y30A 1SXDA 3OQIB 4JELA 4B79A 3T61A 3O9ZA 3QBVA 1CC1S 3F98A 2KLHA 4ND2A 1GDHA 1C7JA 1RADA 2DKOA 1BXZA 2J08A 3SX2A 4Q4HA 5EMHA 4IQWA 2MYUA 3ZWQA 2CHGA 1GQOA 5L8VA 1N78A 4U39A 5JZ9A 2HBRA 3QWBA 2VYND 3BWXA 5B2EA 4KTVE 1FMCA 1F2VA 1A2KC 2DP4E 4ZCIA 4M9NA 2G5PA 2YR0A 2FSHA 2ORWA 3LQ2A 3GRPA 3NYWA 1Z8DA 4Q4AB 4M37A 1XLVA 1K5OA 4V0RA 3WLRA 1RPNA 4HEHA 1NG1A 1ISSA 3X1YA 4KXLA 1DBIA 1IC6A 3KJHA 4C3VA 3LV8A 1U3FA 4FDTA 3KK0A 2EYUA 4G0XA 4D4GA 4R31A 5DHFA 3LBIA 1V8OA 5MHTA 1RR6A 2YYAA 2MUTB 2UYOA 5JQGA 2MUTA 5JQGB 4OAPA 3DVSX 1ZQZA 1HOXA 2PL3A 1KH2A 2Q9AA 3EXFA 4I1SA 2V4RA 4YUVA 3B36A 1LCIA 2A9OA 4QDOA 4NNOA 4KPYA 3B82A 4RJLA 3ZH2A 1XCOA 3GD7A 2FMHA 3BL6A 4ZOCA 3UJ3X 4GMHA 2FSVC 1CS0A 5AI4A 2SECE 5SZHB 1DBPA 1Q44A 2WP8J 3W2HA 2DERA 1QE5A 1WSAA 1YVUA 2R66A 5FV7A 5FL7D 4MS4B 1JPVA 2FPXA 2HR1A 3VKVA 2JZOA 1DXOA 4QQ8A 3VGPA 1HSZA 4PHTA 1H65A 3EDCA 4LZZA 4B9SA 1T0HB 4R2WA 4BZPA 4L7QA 3HYRA 4YI3A 4BGUA 1NK5A 4D1YA 3BGVA 4BU1A 5FOQA 3LWMA 3CN7A 3I09A 7ABPA 1GKYA 1M6VB 1XDSA 2R7MA 4EA6A 3ZDXB 1E94E 2I6FA 2HA6A 1UZNA 5DMHA 1YGYA 1AMNA 1TRKA 3QLTA 4GVLA 5FJJA 8ICVA 4L8VA 1CX9B 4TTVA 4B6SA 3G2HA 5A9RA 1NHWA 2P6RA 3E5HA 1IHYA 3I5MA 3OZWA 4JCCA 4TLAA 2ZT6A 3K70C 5KT3A 1VXRA 4PPQA 3LVRE 3SZOA 4LRSB 4B9NA 2ZROA 3L9XA 4N4AA 3U4HA 2HIGA 3NFRA 5D2CA 3BMOA 3CH7A 3HUTA 5DM2A 3EYAA 4CT4B 2AOWA 2KHZA 1AROP 2GHQA 3HFJA 2ZM6B 2G82A 1CHNA 1OXVA 2G9UA 3GJTA 1QQAA 2IKQA 3ENWA 1N8TA 1Z7GA 5FNZA 1XFAA 2GD0A 1ZNQO 2HXGA 4FQ8A 4MR7A 1JSRA 4A8JB 4YJFB 1UJ5A 1HQDA 3H5VA 4JFRA 3X1JA 2WG0A 2IU4A 5SYAA 3TAPA 3W4JA 3ZY3A 2ID7A 3AHGA 3CEJA 3KKNA 3R6TA 1FYXA 3ND8A 3DUWA 3TLEA 2BR3A 3HY4A 4U4AA 5KYWA 2BBTA 4JB2A 1U2GC 1Z0SA 1NA5A 3OY7A 4L8GA 4U6PA 4FVTA 4E2YA 5I9SA 3ZVNA 9ICRA 1L5WA 4GLXA 2HDWA 2J6BA 5EJ4A 3OJOA 3ZK8A 2QZSA 3GIMA 3B38A 2CWWA 4UB5A 3EYWA 2QRHA 5DWVA 4KPUB 1U0EA 4JH0A 2AOTB 4OB8A 1Y9JA 1ZBQA 2XQFA 2Y9PB 2DHEA 4JQYA 2V7EA 3UJ7A 5ICMA 1DAPA 2V7WA 2ONYA 1EJBA 2AG1A 3CGWA 4ZK6A 4C7OB 4DQDA 2D8AA 2B3DA 3P19A 3WK6A 5DRTA 4MB2A 5J29A 2FN4A 2Q0SA 3QUTA 1P1FA 2OZLB 4ZT5A 3UF0A 2O6KA 4IX1A 4FFDA 5A1TA 5H80A 1C3XA 3EPGA 1KKXA 4JC4A 1YJQA 4MW5A 4Q9IA 1Y1KE 2QE6A 3OZ7A 3O8QA 5ED0A 5JJCA 1H1TA 1THZA 1Y3AA 2Y3IA 3QUAA 2IA5A 3QVGB 5TNXA 1XP5A 3AVVA 5E7JA 1MVLA 4WBNF 3B7GA 4KQ2A 5LDDC 3U7EB 4UQGA 3VYUB 2PUCA 1ORWA 1GA4A 4QBGB 1KNQA 2DR3A 4H1HA 5EG5A 5LZ5A 1E3EA 3GJ5A 4WY8A 3RTAA 3H4VA 4XSVA 4GDFA 4TROA 3PRJA 1B8NA 2ERCA 4H4EA 1YC2A 4GXRA 3HUEA 4DM3A 2AZMA 5AW1A 5GTDA 4H60A 4BGIA 1TM4E 3K71B 1VG8A 3SAJA 2UYCA 1SCQA 2Q3FA 2VS1A 3KL2A 3ZV6A 1QWOA 4K40A 4C0WA 2FR8A 4OY3A 3UIEA 1OLSB 5KYYA 3EQ6A 1MSWD 3K31A 3ANYB 4YMVA 4NZOA 4MLCA 1P7YA 2P5TB 2P9ZA 4RTJA 2HRRA 4FGUA 1PV4A 1N6RA 2IF2A 2IU6A 3W2EA 4CM8B 2OWEA 4NVRA 1VIVA 3K9GA 1YHNA 2GAAA 4IO1A 1NN1A 5LQAA 3Q2OA 4KLAA 4YAIA 5LR6A 2PJRA 1EJ6A 2EBFX 3EGCA 2OXRA 4D9MA 1FTQA 3UT6A 3MBKA 1HT1E 2QTCA 1NUPA 1BEEA 1G8JA 5EP1A 1U2RA 1PGOA 5KWIA 5LQKA 1UODA 4MVJI 3BC1A 2QNBA 3C43A 1U02A 1UJ2A 4FOLA 4RH1A 5BYJA 3T9AA 1QYXA 3DMTA 4P4LA 1KY3A 2RIRA 4BAUA 3EWIA 3WNDA 2C1XA 3DDCA 4XDZA 3AR4A 1QPGA 3Q8QB 2EJBA 4CQLA 5J58A 3HKEA 3LWNA 4KH1A 4MGHA 4ED6A 1XN4A 3PNBA 1CT9A 3QVMA 3RAEC 2YV1A 5L9AA 2XDAA 2XEXA 4DUZB 3DTVA 4BMZA 2GFIA 1C41A 1M6YA 3OIGA 2ZB4A 1GTRA 3MTGA 3JZDA 1VBKA 3PMNA 2B98A 1MVOA 3M1AA 3G2IA 2PBFA 3L6OO 4IYRA 1XSPA 2UUBB 1MF7A 2V9ZA 4D3ZA 1R0SA 1FQKA 2D5LA 1FX1A 1X87A 2WDPA 3KTAB 3OEHD 1UHUA 1BJTA 2QRKA 3QTBA 4FUTA 1GEEA 1X6IA 4G1EB 4U7GA 4X8HA 1FF9A 4ESHA 2GRAA 4F5EA 5I8PA 4K6OA 3AJ8A 1A4RA 5EHGA 3VSAA 4XIJA 3K94A 3PDCA 3D4NA 4I3GA 4GFJA 2G5IB 4I4TF 3IP4B 2DKXA 2BSXA 4LTNA 2YTZA 4ANFA 4D4IA 2GMWA 3OZRA 3DMFA 1XTIA 4MWTA 1NJ2A 4MRSA 3SEIA 2Y68A 1CEQA 3DOOA 4JBHA 3B1ZA 2EQYA 1I7DA 1BWRA 1OBFO 2W6CX 3QVOA 1E0KA 1PL6A 2B8EA 2IHTA 2AFIA 1SKBA 2VUTA 2CL5A 2J4CA 4D41A 4HGZA 2YH2A 1G4UR 1KNXA 4IDFA 3SOPA 5DHTA 3TR5A 3WRXA 3RAFC 4LQDA 3GLGE 3O47A 2Q3EA 2GZ1A 2W6QA 1QFJA 3F8SA 5K0GA 1PJ4A 1F17A 3EA5A 4TXJA 1N57A 3W4KA 3ZWNA 3T5AA 1RWKA 3Q41A 1KYQA 1XALA 16PKA 1KH3A 2ZJ6A 4BNGA 5JPCA 1GRCA 1SPXA 1YL5A 2EGUA 1J2EA 1QC5A 4W7HA 1RYZA 4GEKA 4OJYA 4H6VA 3ZI4A 5A0LA 2ECFA 2JI6A 4JJFA 4KDCA 4RVDA 1Y7IA 1BDMA 5FBLB 4L02A 5BO5A 4YYEA 4DDMA 3T3NA 2VA3A 4CGZA 2ZB7A 2NU7B 4XIFA 3CNNA 5TF0A 2Z09A 4RFLA 3V2HA 5LP1A 3JV7A 1G8SA 4B4UA 1UBUS 4YCXA 3HMQA 4QT4A 1L4HA 1H38A 2V4UA 4IH9A 1NT4A 2K7ZA 4BQOA 4EATA 3HZRA 5DYIA 1MH9A 1C8LA 1OHHA 2XY4A 3HV0A 1X94A 5K0FA 3UJNA 2QUBA 1KO8A 1ZEJA 3GLGB 1U2ZA 3O4IA 1U2DC 1V2GA 3RRXA 1FFYA 1X1DA 2Y05A 4XM2A 1N1DA 1JI7A 4MO9A 3IMFA 3JWHA 4M1ZA 1PS8A 2ECPA 4N39A 2NVBA 5I7AA 4C03A 4E3ZA 3DE4X 1GV0A 1KEEB 3RLFA 3SLGA 4PSCA 4Q7LA 1KC3A 1YJAA 4HDKB 3R0JA 4UDOA 4ZZ2A 4CNQA 1EDDA 1TO1E 2VNSA 4NZYA 1T4CB 3ZYZA 4BIMA 1G9SA 1P2UA 2DHRA 2PGDA 2JH1A 1E0JA 1OYVA 3G0OA 5DDMA 2AX4A 2GZ2A 3KAKA 4JOSA 1TIKA 4FZJA 4MEJA 2XE6A 2GEDA 4EY8A 1BKSB 2I1VB 3JYHA 4PE5B 1PJRA 4QGFA 4F5WA 3IVAA 4FFNA 2QTZA 1CUKA 4XSGA 5LSAA 4IHJA 3OOHA 4GU5A 5DN9A 3THOA 2HHTA 4ETNA 1IL0A 1HTTA 4HX9A 5IAOA 1IWPB 4ZZ1A 4MW0A 4CKCA 5EJFA 3RIYA 4QASA 1EUDB 5K05A 3RRHA 1OX5A 2JKYA 2G1JA 4ND6A 3PP8A 2YCLA 3V4PB 4MROA 4ZFNA 1UOEA 1RYRA 2QJOA 1D9ZA 1SCBA 1XTQA 3EAQA 5DGBA 4G5HA 5K8CA 4UHFA 2YYSA 4ZCMA 5K09A 4F4XA 2FPOA 5DWQA 3REGA 4EMBA 3HUUA 3O1LA 5AVJA 3BAZA 3FHOA 5C3MA 4MUMA 1ILWA 1QE3A 1XTRA 1WDMA 3O82A 4D9JA 4YDQA 2C7PA 4Z9FA 1RYBA 2HHWA 2EF1A 5EZYA 1RAHA 2CYBA 1GCGA 2DTEA 2V59A 5CCDA 1P29A 1QS0B 1A5SB 3ESAA 1E89A 5J2DA 4M9SA 3AESB 2NAPA 4NCHA 4RPHA 3WNQA 2Z2IA 2IS2A 2Y27A 4LVOA 2H4XA 3K3PA 5KREA 3VAZA 1YB6A 3PS9A 5H3CA 1J22A 4KMUA 4JJAA 3TIFA 4GYKA 1IUNA 4QTXA 2WU8A 1SRRA 1D5CA 4UAJA 3KVNA 4U5XA 1J2TA 2BFBB 2ADOA 1K4KA 3PA8A 1JDBB 3CR7A 2IKSA 4KQJA 1W6UA 3HL0A 4O4JB 1C0KA 1J90A 3KUKA 2KTQA 5JJBA 2Z08A 4JIGA 1QX4A 3QF7A 1ISHA 1S2OA 1Z5OA 3AX6A 3TGLA 1FSSA 3UMSA 2RI0A 1G20E 5GVRA 3GGDA 5FFFA 2YBEA 1C20A 5ELXA 2VP3A 3LY9A 2HVHA 5FORA 4PZ0A 4HWRA 4UB3A 2W8KA 1P7CA 2AXEA 3REOA 3WV4A 2C9BA 2E1EA 3CUUA 3CJRA 1P17A 2QB5A 1J07A 1ZMTA 3NBZC 1O96A 1FSZA 4ND8A 4ZVUA 3P9PA 1X1CA 4QEKA 1PD0A 4O3OA 5K2MA 4N0DA 4OI4A 2AR0A 1NC1A 2D8CA 1VKOA 4ZI7A 2R1TA 3OIVA 2D4HA 3MCAA 2OPHA 2Y1FA 3RC2A 1L3BA 1I4DD 3H3JA 4JUFA 3GFRA 4NOLA 1G3UA 2W42A 1M2OA 1PK8A 1Y6RA 3NHSA 3LX8A 5FBQB 1E77A 3VOTA 2JRLA 3D8NA 4OHOA 3VR1A 4BO5A 4B5KA 2O0KA 4IWYA 3KVRA 4YCCA 2BGTA 3O6VA 3TFWA 1ZUHA 4MITA 3KPUA 4DCPA 1Z29A 2IIVA 1T36A 1ONPA 1W5FA 1ICIA 3HC7A 2H52A 4PBRA 1Z39A 2XBUA 2O7RA 4UNRA 2CLOB 3CNHA 3BL5A 4V3BA 5DLPA 3DNPA 3U3ZA 2PUJA 1A77A 1RYNA 4RT3A 4DJEC 3AVTA 1ZQSA 3QJ5A 1ZW1A 3CSSA 1XNHA 2KPOA 5FEUA 3N5KA 2OGSA 1SUCA 5KFGA 2AR9A 3ICCA 3MAJA 5AT1A 5CFQA 3C8UA 4WESB 4CZ2A 3V4RA 1ZHFA 2E6UX 4IFTA 4N12A 5EUCA 5C5CA 3KZXA 1U7DA 3EXFB 4J75A 4M1WA 2IH5A 3QX7A 3ERCA 1UKCA 3U6KA 1I4TD 2GARA 2ZSAA 3CPSA 1DTWA 1E1RA 3VBEA 3WRVA 3KSMA 4UATA 1C30A 5E6RB 4RHFA 1E98A 2OY0A 1UK6A 3JYPA 3TRDA 2EZYA 1ORHA 3BE4A 1OXKB 3G49A 3HCWA 1A69A 1VJ1A 5JW6A 2DPXA 1A88A 4FHGA 4ZCSA 4X44A 4H1WA 3H04A 2G04A 2HLHA 2KBFA 3EXHC 5KG3A 2I9GA 1VGVA 3PITA 1QVVA 4LHYA 1E8NA 4B83A 1VZ2A 4M6WB 1FP1D 3DE7X 4LOHA 1R6AA 1MW8X 1ECWA 5LQRA 1PKXA 1CVIA 4UMDA 1P0CA 1QRAA 5HUJA 4FMPA 2Y6VA 1GFIA 5IVIA 1YDEA 4TT3A 3BSYA 1N62A 4Z0PA 3PNQA 1LVGA 4XUEA 1L4EA 3GUHA 2II6A 3LDHA 1AVTA 1GQRA 1HURA 2V5UA 4US0R 3KSBC 3SQWA 4DCMA 4RBNA 1ZK1A 1LB1B 1M8GA 2XOXA 4H1UA 1LA2A 2OQIA 1MO5A 4FYIA 1KW4A 3UJAA 4CFSA 5ALVA 4M9GA 5AM2A 1YCFA 4OQMA 2HAEA 4RNCA 3RUHA 5KFZA 5LZ4A 1WPQA 5CIQA 4BGEA 2XMRA 5EXTA 4RSRA 5JVDB 4C05A 5F7XA 1YJCA 4RVSA 4WLEA 3S2GA 3SFVA 4B7UA 1N36B 2UVRA 1YFZA 2FUG6 5D86A 3TLCA 4M1SA 3B8EA 121PA 1L7DA 4AP9A 4HDMA 3T3PB 3VRHA 4E4TA 3KKMA 4MAFA 1FFSA 5T8KA 2NPFA 2PEYA 2KEYA 2AGQA 5KHOC 2VTDA 2WM2A 5DQIA 1FP4B 2W11A 1XTPA 1Z56C 3OC0A 4JLSA 2O8NA 2JIBA 2AG6A 4LWOA 4DSTA 4EEZA 2ZAMA 1A27A 3DVRX 3ANLA 3PD7A 1H6BA 9ICXA 1J33A 1K8RA 3U1TA 2WVHA 3X1XA 3ZHUA 3CX4A 1T10A 2YS7A 5AW2A 2XUHA 3IIIA 1X7HA 1WUJS 2J0EA 2PMFA 4G0MA 3CS3A 1KMHB 1NR1A 3IUEA 1MTOA 7ICTA 3I6QA 3VTZA 1FQJA 3B85A 2HIMA 4QWWA 5DM0A 3W5UA 4AW9A 4JB3A 4C14A 4CR6A 2OM6A 4QZ8A 3G82C 4DXHA 4XQ8A 1JBEA 2IU3A 3OIUA 2HV8A 3ONEA 1XO0A 2C98A 4AMZA 4CTKA 4NSNA 4DGSA 1EXDA 3LY5A 1VE3A 4PONA 3CUWA 4EEYA 1YIOA 2V6IA 4HDQB 4JSYA 4DMGA 4EHIA 2YTUA 3CVXA 1TZCA 1UP4A 2H06A 2QAGA 2VYCA 1U3UA 2HI0A 2RGXA 2WU1A 2BCJQ 5JQWA 5M2QA 1WSWA 3SBOA 1AKTA 4GP6A 4ZV7A 3RSZA 5HKLA 4QUBA 2XQIA 4D3YA 1H8EA 1NFFA 1IM8A 2LD4A 4YT8A 3T7EA 1SG0A 4OX9Y 4U3JA 4MF8A 2RBKA 1M6HA 4Q7JB 3AU8A 3GJSA 1X9WA 2H0QA 4L4UA 2N42A 1G60A 1Z6PA 1HKHA 2OAGA 3LQRA 3VDQA 3IDFA 1XCJA 5D3KA 3SQNA 4NC9A 4EPTA 5JZMA 5E3JA 3AG6A 1ISFA 3PB3A 3HVJA 2FX2A 1D09A 3TCXB 1ODCA 4AT1A 4X0EA 2J9FB 4FGKA 4PLYA 5K0NA 1GOTA 3GV0A 3V4ZA 5TMBA 1HZZA 4G0UA 1C7IA 1TAUA 3VZDA 3WBBA 5CJPA 1KQOA 1FFGA 1F20A 2JBHA 3SP1A 1MPTA 1HPLA 1ZUWA 5NLLA 1ZJZA 4C04A 2FXIA 3I9NA 4FZVA 3K15A 3WLSA 2E5LB 4R1OA 4YJHB 1XZAA 1M7HA 3SBEA 4GUDA 1HLGA 1H2FA 1NWHA 2AYZA 2FLVA 3F2IA 1HTBA 3EC7A 5F3DA 3GAFA 5IK2A 2GYUA 3JR3A 4UBBA 2INGX 1Z15A 1JEJA 1J8DA 3TRJA 5AW6A 2ETVA 3KVOA 3QMMA 1SXJB 3CVVA 1EXMA 3V8MA 5EPEA 5AI6A 2H7VA 5FL3A 221PA 2NW6A 5AKIA 5I3CA 2XWSA 4NR0A 1Q50A 3DZDA 4DQSA 1HYBA 2CEAA 2VRBA 3CLVA 2KE7A 4LHVA 3SM3A 1LI5A 4R54A 1C7ZA 3B3AA 2ZP1A 3DULA 4FD3A 1HFEL 1BGXT 3H4TA 4PVDA 3PUZA 1TKDA 2WFMA 1NAHA 3HWX1 3I6IA 4NHOA 4QYSA 2AN9A 4IIXA 4XDYA 3A3YA 1JBQA 3U7IA 1RLJA 4PGGA 4G9GA 1D4OA 5G41A 5EKTA 4HXYA 1VLQA 1GU0A 3OZTA 3DM9B 2IK8A 3UEOA 4E03A 4BKMA 2YFHA 4XUSA 2EIXA 2OBMA 2CLCX 4E46A 5G40A 3EEBA 1UMDA 4DJAA 1P45A 1QIIA 2NYAA 2I66A 3LVWA 3B9RA 3H2HA 1C9YA 1NL3A 2DHCA 4FR2A 3BMQA 2Z8XA 1XPJA 5B4VA 4C0HA 1LRJA 2A7QA 4EZEA 4RC9A 4OJMX 4B8ZA 1XDDA 2R6HA 3PQEA 3VHQA 2AQ4A 4MVJM 1OW5A 1JDPA 3KHGA 1K5GA 1NQWA 2AI3A 2NYRA 4OBEA 4REMA 1N60A 1RQ7A 2CJWB 3N3BC 2P11A 5D5HA 3GEHA 4NU8X 2IW1A 2BM0A 5L95A 1Y6QA 3GQBA 3RNLA 3K70D 4DSIA 1Z2PX 2CZGA 1VPWA 3I6YA 3BILA 4QZDA 3ZDFA 4JXZA 3MTIA 5LKAA 2E4AA 4KGDA 2ZI4A 4O4JF 4YJ3A 4RH3A 4I9GA 2EJCA 4YLYA 1E60A 4ELTA 1IXYA 1CFJA 3S5JA 4Z5XA 2GKGA 1J42A 4JI5B 4BNVA 3TNJA 2OXFA 1NYQA 3B1WA 4UAGA 5BV2P 2Q5CA 1UC4B 1VI6A 2MSKA 5K0TA 4D4LA 5IHPA 4B3BA 1VC2A 1B26A 1DOZA 4MS1B 2IDJA 2QNRA 1W0CA 4TV9F 5COBA 1MAAA 1V26A 5E6UB 3UAOA 1QQTA 1CWUA 3H19A 5ALYA 4P3OA 3NYIA 4EHNA 1QU2A 2CDCA 5HE9A 2EW8A 3FCUB 1CZHA 3O03A 1GAXA 3K4HA 3VC8A 4YRSA 1JEEA 2VDMB 4B76A 5C1BA 3A1DA 1FFCA 2FP3A 4ZAYA 4F4JA 4FM9A 3KZNA 1W25A 3EC1A 4HB4A 4KV7A 4PX9A 3QVKA 3PLAE 2YRFA 1NMZA 3RTGA 4EKNB 1LSJA 1QIDA 4KR0A 4ONEA 4ZO7A 3SIWA 1FPQA 3VR3A 3AHHA 5TGTA 1GQFA 3WWYA 4DR5B 2FR1A 1NLMA 2GCNA 2N1MA 4NPCA 4P53A 4AJ9A 1Y9EA 1HLDA 3ETJA 4CCYB 2OEHA 2C5BA 2AVDA 2JEIA 1I4OA 2OORC 2BMVA 3BHJA 4FDMA 4G63A 5CA1A 2R68A 4P4PA 4F4ZA 1MDFA 1Y89A 3I2YX 2JFPA 5JMTA 5JHGB 2IZ5A 1PX2A 2L19A 2Z98A 3H5OA 1BQEA 4QL3A 4CNBA 4AQDA 4I29A 1Q7GA 1B00A 2GBFA 2W93A 2LNDA 1QAOA 4PV7A 3WDKA 2MA1A 4M1YA 5AJZA 4FLEA 3ADOA 5DLEA 3GA7A 3RS7A 2HBKA 3U17A 4Q82A 5AVVA 1KEPA 3JPNA 3KLOA 5JAOA 3GN2A 1HE5A 2F2TA 2B2NA 4Y6PA 5J2AA 3SYZA 4LVNA 3FYCA 3W7BA 2Q1SA 3AJRA 2FMPA 1OXBB 2DSNA 2P9JA 3ZE7A 3D81A 2I78A 1Q0LA 3WGNA 5EMLA 3FCYA 1L4GA 3ET4A 4H31A 4ZC8A 1GQYA 1ODJA 2XMZA 2AVNA 1ZH0A 2YWEA 4JYMA 2P2ZA 3UK0A 1SKMA 1XTTA 2XUKA 1LWOA 4HI0E 4JEIA 3FDSA 4LMPA 4ENUA 5KNBD 2HCBA 3KQYA 1MX3A 4G0QA 4AKGA 4HV4A 5EESA 3FGOA 2WAAA 3I01A 5C1OA 3FX2A 2CBXA 4QLBA 3G5UA 3K0BA 2C96A 3P0HA 4MR8A 2F4NA 3L6UA 1XQ6A 2PKWA 2PI5A 4PLFA 4ZOLA 3AVQA 4F2DA 1KRHA 1BGWA 4D9EA 1HDEA 3KU4A 4GPD1 4V24A 1TTQB 3WGIA 2NQ2C 3A1VA 3OX1A 3U60B 4C5AA 3SF8A 1TD1A 1P0QA 4B4OA 1E2FA 2BP7B 3THVA 2C84A 2O50A 1FFWA 1ORVA 2PXIA 3OPVA 4DUGA 1HE1C 1VFNA 5CYOA 4DA4A 1P5HA 4QTZA 1ECPA 5J8YA 2FMQA 2X8JB 5ALKA 3P9NA 5KCMA 4ER5A 5HQTA 3M2TA 4LF4B 3UFBA 4B0PA 1F0NA 3VPFA 1N4DA 3AN1A 5C5IA 2FJPA 4GM0A 4OF4A 5AW5A 5DB9A 2WF8A 3H2IA 5IJZA 1DKUA 1GPLA 4ROSA 3RVNA 4QZ9A 1WVMA 4X93A 1GG8A 5FUWA 3VSDA 1RNLA 2WJHA 4E5YA 1WUKS 1ZK2A 4MWEA 2F67A 4TSRA 2BVNA 5BW4A 1Y3BE 3LVVA 2H9YA 2WFLB 4M54A 2C5FA 1CQJB 4TL6A 2WWHA 2QN3A 1EJ2A 4AKSA 4RLFA 4G36A 3RHFA 1MQSA 5CBPA 5CBPB 4Z49A 3NRCA 4ZTBA 5JNLA 4EI9A 4RU9A 3FYUC 3KOWA 5KT2A 3BWEA 3N5CA 4ARZA 5A6VA 1OH5A 3KXPA