1NNLA

Crystal structure of human phosphoserine phosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
205
Chain Sequence
SELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of human phosphoserine phosphatase in open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
total genus 69
structure length 205
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1nnlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1nnlA01
5AW6A 3I76A 2FPXA 4CNQA 2FI1A 3N28A 3K1ZA 3QU9A 4GIBA 2MSNA 1EK1A 3FVVA 3L1VA 4IFTA 3QUQA 4J03A 4Y2QA 4Y2SA 5AVYA 2HDOA 1RKQA 2YMLA 5AM5A 2HSZA 4DW8A 1NRWA 1T5SA 2FPWA 2HF7A 1ZS9A 4AS3A 3HYCA 4L6AA 4G63A 1J97A 5IT4A 1SWVA 3OCVA 4NABA 2C8LA 4Y2TA 1CQZA 3N07A 1QQ6A 4G9BA 2ZBGA 4HAIA 5E0OA 4Y2YA 5AVXA 2WF6A 3NUQA 3IRUA 5AIBA 1S8OA 4KYTA 3QU4A 5ALVA 3L0CA 2ZOSA 3UMBA 3U7HB 4Y2JA 2IYEA 2P11A 4UARA 3I28A 4FYPA 2IOHA 3SD7A 3W5AA 5AVUA 1L8OA 1YMQA 3U7GA 2R8XA 5AK4A 3QUCA 2ZBDA 3W5DA 2HX1A 4EZEA 3QU5A 2CFTA 3QXGA 5AVVA 2ZG6A 4DWOA 2I55A 3U7FB 4YIHA 5IT0A 3QLEA 1Z4JA 4F72A 3FPBA 3QUBA 5AKJA 2GO7A 2PKEA 3R9KA 3WK7A 2AUTA 3CNHA 1XP5A 2YMQA 2NYVA 2AH5A 2P9JA 1N8NA 4NWIA 3S6JA 4BX0A 5AW3A 2FDRA 3OCWA 4RESA 3HLTA 5AK3A 1Z4QA 1WPGA 5ALJA 1U7OA 4HGNA 2Q5EA 2GFHA 3ZWDA 3NALA 5AW1A 1RLOA 3ZX5A 2GHTA 4I9GA 1U7PA 5ALKA 1EK2A 3TLMA 2QYHA 2EAUA 3WK6A 5AVSA 2IA5A 4EENA 3MC1A 2Q4RA 2GHQA 4OD0A 1O08A 3EF0A 1SU4A 3KD3A 1L7MA 1XVIA 4JB3A 1Z4NA 1ZD4A 3AR6A 5ALNA 3N5KA 5JJBA 2W11A 3MN1A 3QYPA 3FGOA 4BKMA 1Z5GA 1RMQA 3ET5A 5AM4A 4BNDB 5AKZA 1ZRMA 5ALUA 2G06A 4Y2XA 1XPJA 3CZ4A 2JAOA 3ZVLA 1NNLA 5AM2A 1QQ7A 2EATA 3U19A 3GYGA 5ALTA 5A3QA 2YJ3A 1Z4LA 2Q4TA 2ZXEA 3OCUA 2WF9A 4GXTA 1Z4MA 1ZD2P 1Z4IA 3BWVA 3AR7A 3NAMA 4C4TA 5AI4A 3L8EA 3AR2A 2DQSA 1YS9A 3PDWA 2WF7A 4I9FA 4UAUA 3E81A 3D6JA 4EX6A 4KNVA 5AIAA 3ZUPA 3I6BA 3MPOA 1RQLA 3ZW7A 1WZCA 2I33A 5ALPA 2OA0A 3IB6A 2B82A 1RMTA 3L0YA 5AW9A 3SF0A 5AKGA 3A1CA 1QH9A 3FM9A 1J8DA 3OPXA 3SKXA 4XE5A 3QNMA 4BYGA 1Z88A 3WKDA 5AVTA 5AW0A 1WVIA 2C9MA 1RQNA 2G0AA 5AM1A 5AHXA 4BX3A 4H1WA 1YNSA 3DV9A 5ALWA 5ALSA 2R8EA 5AI5A 4MWOA 1X42A 1TJ5A 4ZEWA 2B0CA 3UMGA 3PGLA 1YDFA 4YH1A 3OCXA 5AVWA 5ALGA 3ZX4A 2B30A 1L6RA 3WK4A 2HO4A 5AK5A 4CF5A 5A3RA 1T5TA 2I7DA 3EWIA 3L5KA 1Z4OA 4EELA 3J7TA 4UMDA 2YFYA 2G09A 3ZVNA 4OHFA 3DAOA 5T41A 5AW4A 3DDHA 3AR9A 3KZXA 4BBJA 5ALZA 3B8EA 2B8JA 2W43A 2YBDA 2FUCA 3DNPA 4XQ0A 4IG4A 4HGOA 3OCZA 3SLRA 4UATA 5AKXA 5IS2A 3ESQA 3ZWKA 2OM6A 3L1UA 2GMWA 1RMYA 1RKVA 1ZJJA 3EPRA 2ZBFA 3UM9A 3U26A 2I34A 5ALOA 3PGVA 1FEZA 5ALYA 2HI0A 1TA0A 3ZVMA 1NF2A 1U2TA 3B9RA 4NV0A 2P69A 2G80A 3MMZA 3ONNA 2QLTA 4CF3A 4NFLA 2HHLA 1CR6A 3WK5A 3OCYA 4JDPA 5AK6A 3QU2A 2IOFA 2BY4A 1Z5UA 4XPZA 4RETA 4Y2RA 1RRCA 1L7NA 3F9RA 3QU7A 4O8CA 4QQFA 2P27A 4KNWA 2WHEA 3FZQA 3WGVA 1Q91A 2WM8A 1IWOA 5AW7A 1SWWA 3SKYA 1YV9A 2JAWA 3I1YA 2BDEA 4UMFA 4Y2UA 2HF2A 2D2VA 3L8HA 3ZI4A 2R8YA 2YN4A 5ALIA 4Y2PA 3U7EB 3WKEA 2FPSA 5ALRA 4BEWA 1AQ6A 3WK8A 1WR8A 3U13A 2B1QA 5ALLA 3W5CA 1Z4PX 2WF5A 2YJ5A 4XOUA 1JUDA 2VKQA 4UMVA 2AMYA 5ALQA 3KDPA 5AKLA 5AW2A 2O2XA 3W5BA 3KBBA 2B1RA 5AI9A 2YJ6A 2RB5A 4E88A 1RLMA 4C4SA 5ALHA 1TJ4A 4J2TA 1ZD3A 5AKHA 5AI6A 4KX3A 2HCFA 2CN1A 4L57A 4EX7A 3ZTWA 5ALFA 1O03A 3BA6A 4FFDA 3EF1A 4NAVA 4UM7A 3P96A 2G08A 1PW5A 3NASA 2FEAA 3L8FA 2G07A 4UM5A 4QJBA 4UU1A 1LVHA 3N8GA 3M1YA 1ZD5A 4MUMA 4ZEXA 2FPUA 3WKBA 3OTQA 5AESA 4B6JA 4OFZA 2AGVA 2FPRA 5AICA 3ZU6A 3WKAA 4EEKA 4BX2A 4C4RA 4HGPA 4FE3A 1MH9A 4YCMA 2YY6A 2R8ZA 4YGYA 2RAVA 2B8EA 3ED5A 5AVQA 4UASA 1TE2A 1LTQA 2ODAA 3WGUA 1L7PA 3IJ5A 2C8KA 2G1AA 4DFDA 1RPZA 3PCTA 1YJ5A 4KX5A 3A1EA 3M9LA 4OCZA 2YMMA 2RBKA 1VFPA 2W4MA 5AW8A 4BEVA 5A3SA 3VAYA 5AM0A 4F71A 5AKKA 1Y8AA 3ZTYA 5AVZA 3AR4A 3R4CA 1QQ5A 2MU1A 4HGQA 3FPSA 3R09A 1K1EA 1VJ5A 1Z4KA 2OBBA 2O9JA 4YIKA 5FP0A 2RARA 4UMEA 2EARA 3QGMA 2PQ0A 5AKEA 5ALXA 3L8GA 2I6XA 1RKUA 5AKYA 1U02A 2PR7A 3ET4A 3AR3A 2HOQA 1T9ZA 2NO4A 4UU0A 3A1DA 1VJRA 2JAUA 2FUEA 2JARA 4ZEVA 1KYTA 2WFAA 3WKCA 3AR8A 3E84A 2C4NA 4L6CA 4CE6A 3NIWA 1TJ3A 3AR5A 4YCNA 3QX7A 4UAVA 2CFRA 1L8LA 5AI0A 2BDUA 2IOFK 1S2OA 3SMVA 5AM3A 2JGAA 2NO5A 1RDFA 3A3YA 3WK9A 1Q92A 1QYIA 4HGRA 5AI8A 2YMPA 4UW9A 4CF4A 1N9KA 3E8MA 3ESRA 3L7YA 1RC8A 3L0BA 2C88A 5AKIA 4AP9A 2YJ4A 5AW5A 1F5SA 3SHQA 1ZRNA 3NANA 2I54A 3RF6A 3QUTA 1RLTA 5ALMA 3UMCA 4AS2A 1U2SA 3NRJA 1ZOLA 2ZBEA 2CFSA 2HEGA 5ALEA 4PNHA 2WF8A 4Y2VA 2OYCA 1L7OA 5ALDA 5AVRA 3KC2A 4Y3UA 4YCLA 3B9BA 4BNDA 4DCCA 3KOOA 3E58A 4HYTA 4KN8A 3RFUA 2X4DA 3N1UA
chains in the Genus database with same CATH superfamily
4FYVA 5HTKA 3E3LA 1CP3A 4CNQA 1FDSA 4LXQA 5FBZA 2R60A 4DR2B 3QFFA 4RUCA 4KFUA 2J0QA 3AUKA 3K1ZA 5EE9A 1LSUA 2J3HA 5H59A 1Y3HA 5DBIA 5C34B 3JQ9A 4E14A 5G4KA 1FYDA 5P21A 2CFIA 2MR5A 3LM8A 3L1VA 3L40A 4HN2A 2GS9A 2ZI5A 3H75A 4LZLA 4P92A 4RFSB 1R88A 1OUMA 2NZ2A 5H70A 1NOKA 1T5SA 5CT6A 3RAPR 1JHQA 1YQTA 2HF7A 5LZ2A 1RWXA 2PD4A 3IQFA 2ZBVA 4X8OA 4BX9C 1H8HD 4ZOBA 2J6CA 4Z8YA 4ZALA 4C6RA 1SL2A 1JU9A 1J97A 1OX4A 1R6AA 4ZOCA 1C41A 1GGEA 4GMFA 4GNKA 5CA7A 2YINC 4DMFA 4ZZ0A 1IZ7A 3KWFA 3BQ1A 1D9ZA 2OILA 3F2VA 3L4SO 4OXIA 4WZBE 5G4KB 3QEAZ 1AS2A 1YHYA 1E5TA 2ZVQX 3CH7A 3VTKA 2XR1A 3VH2A 4CEJB 2H5EA 5EGSA 1GYRA 2A88A 3P7MA 1YQUA 2IBKA 1E7SA 4AC9A 5JDIC 1Y1SA 3T3HA 1BDIA 1EAYA 2ZTCA 1KZ7B 5ALVA 1J1ZA 4KYTA 4TT8A 1C0KA 1AKVA 1IIRA 1VIAA 1BAPA 4MB6A 4ZTUB 3NR2A 1GR0A 1JX4A 2B61A 4L15A 1QUEA 1EFVB 4TTIA 1JIJA 3BCUA 3SD7A 2GJKA 3KLPX 1YU9A 5AVUA 4H9GA 4EBEA 3CONA 2IUYA 4F8EA 2C4TA 2MJLA 2R7NA 3QVGA 4L3WA 5KG5A 3P9XA 5D3KA 1ONNA 5F9HA 5A5DA 3NP9A 1H6BA 3IXLA 4PFKA 5EA2A 3U7FB 1H69A 4GT1A 4P86A 5J1TB 2Q7DA 4YRMA 1BMFD 2PZMA 5EINA 1QSSA 1Z2EA 3G0IA 3WS7A 4ED1A 2XCUA 4ZYWA 1G8MA 1G18A 2NG1A 2B9VA 3HWWA 2GYYA 3OTHA 3PI6A 3QEMB 4OFWA 1SXJB 3T5DA 1ZXLA 3RFXA 2VC2B 1ITZA 1PAUA 4DNFA 1RR6A 5CEEA 3AJAA 1TMOA 1XU4A 5KNIA 1NMZA 3HVHA 5FAXA 2NYAA 3B52X 1SCUA 2XPCA 3JV7A 3Q8MA 1JPVA 2GSDA 3HBJA 4RD3A 5KDOA 2BRUA 4V0LA 3DD5A 1EB8A 3FPFA 1Y5IA 4KMOB 1IEXA 3CISA 4ESOA 1VBKA 1T5LA 4WJZA 1WXWA 1YQGA 1JFSA 2QN3A 1HLPA 3WNCA 2NX2A 3TVDA 2C8JA 2UZ1B 3C3JA 3MBYA 1COOA 1PJLA 4TLBA 1IE3A 4G36A 5JUMA 2WAOA 2ZJBA 3GZJA 1U5BA 4LECA 2GEJA 2R68A 5IINA 1EFRA 1ZUHA 3Q3GE 4MQ4A 3VV3A 4AZ0B 4BN0A 4DG9A 3WMWA 1HDZA 1ODIA 2WM3A 5J2UB 2EAUA 4M9JA 1YIOA 5B6JA 2E4WA 1PK3A 5KFMA 2GA8A 1LDNA 3IBYA 4JP1A 1NVUQ 3KUCA 2Q4RA 4UBJA 4V0KA 4XARA 3EFEA 1NBMA 1LJ8A 2ZCUA 4CIXA 4BXOB 1FDUA 2IVFA 2LKYA 3P0RA 4H3VA 1CLUA 5CAEB 5F51A 4U2DA 1Z4NA 4KOEC 3U61B 2BN4A 4GOMD 2JGIA 4N0DA 4QBTA 4ZQFA 1JWAB 5K0NA 3T94A 1XZDA 3AOEA 3DKKA 1UDWA 5JSHA 4PLFA 5JJBA 2ZUFA 4D4KA 1KKXA 1I3MA 3IMKA 4KQJA 2OB2A 5CYGA 4XI9A 4FBUA 4P54A 3D4IA 2A30A 1NZBA 3M82A 3PSHA 2CJFA 4QAJA 4CL8A 1XLUA 3TL6A 1X9GA 3SP1A 5BSHA 4C0XA 3AL0B 1SG9A 2VWGA 4M7OA 1SHUX 4R2KA 5CT9A 3SVTA 3IOEA 2KJ8A 2EBWA 3TARA 2DQZA 5BQ5A 2PH3A 3F7OA 3TR6A 2W6CX 4J0DA 1P5RA 4JITA 4D80A 3G1UA 4F3OA 3LIIA 1V0JA 4UUNA 8ICKA 4KLLA 2GB4A 2KLHA 2N9UA 1ND6A 1L9XA 3PUIA 4PZZA 5AH0A 5A3QA 4WBNB 4IFEA 3KQPA 2ZXEA 2O23A 4LJ6A 2VS1A 3PX6A 3OOWA 2VF2A 3BDIA 5CM9C 3SBEA 3OEHA 4IX1A 1TECE 3WOVA 1C7YA 1QG0A 3WV5A 3SFTA 4K9PA 3Q8SB 4KLJA 3CT6A 3J81k 3S2EA 3EBLA 1NOIA 2IGTA 4IIJF 3AVOA 3LQFA 4TSKA 5D87A 4BAGA 3OH8A 3KLBA 4F96A 3E81A 1HIWA 3VR1A 1DE0A 4RSHA 3H9UA 4MYUA 4IOJA 5ALPA 3I9NA 7AT1A 1E98A 3AFGA 3E0QA 4JNCA 2ISCA 5FNZA 5TGDA 3L0YA 1U0TA 4CIBA 4CT4B 3H5LA 3K9CA 3CF4A 3L2OB 2UVPB 3CGWA 4QEDA 2ZIZA 1FSPA 1BTOA 1DRUA 1A97A 3OE1A 3W79A 2V98A 2FHPA 2X0FA 2VJMB 4BYGA 5BYKA 3KDAA 1WKCA 1SCIA 4PANA 4TKLA 3AWDA 4DMKA 3D8BA 3HCEA 2A19A 1XZLA 4POAA 4TL9A 3RKUA 3NVVA 2G6BA 4DSJA 1RHMA 1V1RA 3ZGZA 2NO6A 5F73A 4YAIA 5KFEA 1CUYA 4JU9A 2A5JA 2EJUA 5JNUA 3OLXA 3CLHA 5AOAA 3PHHA 1IPHA 2C29D 2HIAA 4FDUA 4E30A 4YXWD 2CK3A 2B0CA 1K4KA 1TIPA 3AXTA 3ADPA 4MXDA 2H1CA 4ZYUA 1ORIA 2C5LA 1G8YA 3R5XA 4HZUA 4IO0A 3VXKA 1C14A 1QS0A 4O2LA 4ACAA 4MW1A 1BPEA 2WJGA 3FYUA 1V4NA 3DH0A 4R6XA 1M6VA 1M6VB 2Q9BA 1XEWY 5E7QA 1V9PA 2CZQA 3NIDB 1RJFA 2FR1A 4O5KA 4OK6A 3IOCA 3PEVA 1T2VA 4J2HA 4Z9AA 5DX0A 1S0OA 1FP2A 3VPFA 4KGDA 1Q19A 3BKXA 4DT1B 3BERA 5L4NA 2IHTA 1C30A 4YT2A 1NXQA 1SV0A 4P4OA 3DDHA 4GDMA 3E5NA 3SEAA 4Z8XA 4ZCIA 1IXRA 3H6HA 1NP7A 1KK2A 1XDZA 2VRCA 3EZGA 3HACA 4HL6A 4NMMA 3MUEA 4Q00A 4QXPA 1XLTA 2H4HA 1FTQA 3BWDD 3TE6A 4D79A 1SKAA 4J90A 5CJPA 1TTHA 3PK0A 3HJAA 2I6SA 5LU8A 3N7AA 3H0MB 1E3JA 5M2QA 1UPBA 1LPAB 3QXCA 3I9V6 2C2HA 4OBXA 4TTRA 4X61A 4RK5A 3C8DA 1N1GA 5ETJA 3BS7A 4HYEA 3QOYA 4J7UA 3PHIA 5LA6A 3NHRA 2HHAA 4X5VA 4PY2A 4ED9A 2MCFA 3R5SA 4GX2A 5HK8A 2IH5A 9ICLA 4GLXA 5ER6A 4H27A 4JSYA 4QAQA 2E8PA 2A57A 1ZJJA 4YRFA 1UBKS 3AEQA 3EMBA 9ICRA 4IOKA 4JUFA 5DXJA 5H3HA 2KPOA 3T1NA 4E4TA 3BFKA 1HDRA 3SQMA 3PGVA 3EIXA 1G291 1C1DA 1SEVA 2PXCA 2ZYSA 1VE5A 8ICXA 2AQIA 4PNZA 3EZ5A 1QJ4A 4CF3A 2AL7A 4B6GA 5FWXA 1JDBC 4BQNA 2OCAA 2PS9A 3ETLA 2A1UB 4JDPA 4YR0A 9ICBA 1KAEA 2QU8A 4X7PA 4AMUA 2EQ5A 3MYRA 2NMVA 1UR5A 1DK3A 3O2JA 1LCIA 4H7HA 5G1PA 3SXUB 1TM2A 3ZV3A 7ICSA 2OCKA 3C7TA 3OLQA 2OHHA 4M1KA 2QJWA 4N6GA 4PPGA 4RL4A 1YVDA 4D6YA 5CLFA 2DERA 4XAQA 1FLVA 1UXOA 4GPBA 2GN9A 3FRJA 3R6TA 4LXYA 4OY3A 3UANA 4B74A 5CA1F 3U48A 1JR3D 4KQHA 3CVXA 1NJYA 4Y98A 4OBEA 1PDWA 1MFPA 4Z6CA 3QVTA 1GJRA 2P9TA 5HJ7A 3PA6A 4FFVA 1VE7A 2A1IA 3FDXA 4A8JC 5IIJA 3R3YA 1MIOB 1LUAA 1VPVA 4R3UC 3RS5A 3T4PA 3S81A 2HWWA 1WXEA 3SKYA 2D54A 2NXEA 3OEWA 4O4LA 4GP6A 1DQZA 1K68A 4RTMA 4YC7A 1TQ8A 2W93A 4RHXA 5KT3A 5JPDA 1V6AA 3X1YA 4BASA 1G64A 4B3CA 3B9JA 2BEUB 1P0MA 5HIMA 1U9YA 3L4KA 3FUVA 4QHYA 2RC5A 1UT8A 1E64A 2CXNA 1RBZA 3MWDA 4PGGA 3WLNA 1BOFA 1CIPA 1TC2A 1ZH8A 2GPNA 3Q4GA 5I7RA 3ZE8A 1ZGCA 2DWCA 1NKTA 3UWKA 4DFMA 1QNFA 2NSJA 2VHTA 2YIVX 4EUSA 2KVCA 4QQ8A 4D9CA 1V39A 5CDUA 2WJYA 2VKQA 3SM3A 1ZUNB 5ADUS 1BN7A 1VCNA 3KDPA 4HFJA 1FIUA 5I9BA 1HFWA 5JV5A 4MRRA 2O14A 2E6UX 2AE1A 4HEJA 5LZ7A 4ED3A 2EKQA 3WNBA 5LQJA 4KN5A 1O5TA 1QLNA 4JOBA 4BE9A 4DIBA 2OCGA 3TSWA 5AJVB 5E6RB 2DJ5A 2JI7A 4LVNA 3WIEA 2VDJA 4JK3A 2BZSA 3CRNA 4IVQA 5AHKA 4Y7CA 2HCFA 4R51A 1ZOIA 4UEKA 4A73A 4A8JA 1HLGA 1OB5A 3AY3A 1M6EX 4M1SA 3V7LA 4QOFA 4F9FA 1LK0A 5KC9A 1PFWA 5G3YA 4FFDA 2CT8A 1DAKA 5B7GA 2B1JA 1T2CA 4HK4A 1AHNA 1K3UB 4DLXA 3KYJB 2YZ2A 1J99A 4NOMA 1WCNA 1M2WA 4NLCA 1ENPA 4TRNA 4OAOA 3PG5A 4R1LA 1XKQA 2C9OA 2H9YA 1N2ZA 4WFIA 4B79A 2QTMA 2IIBA 5ED0A 4ZDJA 5JXJA 1OFUA 3HDHA 3DUWA 2YWJA 3THVA 3DE5X 2IY8A 3KHLA 1ESCA 1QOQB 3A1UA 4COOA 1BS2A 1GTMA 3W5IA 3DOUA 1YT5A 1AQJA 3CZQA 2FPRA 3R3XA 1Y88A 5HMMA 2YIMA 3BB1A 4K2HA 3TW8A 3WKAA 3BGSA 1GGVA 3A04A 3WWOA 5CDHA 3SZ3A 4Q12A 4F6LA 2HOIA 3QPDA 2VUSA 5CUQA 4ZANA 3Q15C 5KYTA 3GDXA 2XCTB 3Q0EA 2WB1C 3ZJ5A 5LOVB 2Y9MB 3IE0A 4XJVA 3WO0A 3WP0A 4N12A 3L8YA 3JQ7A 4FMDF 1FRNA 4V3CA 1P1FA 1EQAA 4KR0A 1NVXQ 3J81j 1B00A 1HG1A 2C0CA 2NZUG 3CYFA 3MNFA 5J0YA 4F6RB 1ZJ5A 5DYGA 3P0IA 2RHCA 3HVJA 2IYQA 2H5LA 3RH6A 3H6GA 3OHSX 3K5WA 2INGX 4H7IA 4KI7A 1S3IA 4OHKA 2WFLB 3VHLB 4BMDA 3EZFA 4TS9A 4ASUA 4RHUA 3IQWA 1YE8A 3EXEA 4F12A 1MJGM 3AY0A 2I3GA 4K6GA 5JRJA 1P2DA 3TM5A 3W9YA 1GNPA 1B8OA 4BLPA 4C7BA 2XY4A 8LDHA 2NSYA 3H4IA 5AKKA 1LS6A 2IW3A 2AMLA 4B81A 2YVQA 3DE7X 4F5DA 1PZEA 1KQGA 1SC3A 5ICGA 4WEQA 4AZTA 1ST2A 4G1CA 3DS8A 2ASLA 1A1VA 3K9GA 1B15A 3O8QB 2KHVA 4YRQA 1Y7LA 5EKXA 4AXXA 4YBRA 3ORSA 1AKRA 2Y93A 2OXTA 4HB4A 2O9JA 2DGDA 3RHTA 4MRAA 1TO2E 2GEBA 3TDNA 4MW2A 1B73A 4K9SA 1SD1A 2CMFA 2FX5A 3NHAA 2OCIA 4DR1B 2BFWA 2RFLA 3DFKA 3NI2A 3OZFA 3QF7A 1WWUA 3GIMA 1G16A 4RACA 5A62A 2LM1A 3PL1A 3QZUA 5B12A 2HMUA 1J7JA 4A2CA 1HE8B 2DRIA 3HADA 1ODCA 1VA5A 3EQZA 3FZEA 5GV8A 1G6KA 3GRPA 2I2CA 2C2RA 2JARA 4P32A 4XWYA 3RAGA 1IAQA 4JELA 1EZ4A 3O4IA 1R3DA 3AK4A 2YYAA 4RX1A 1D8LA 3USCS 1XVTA 4CT5A 3GJTA 2YQ4A 5ERGB 4RTNA 1DIGA 1F4PA 1E2EA 2OQRA 2A9KA 3MVEA 4QVKA 4DTIA 5B53A 4U2CA 3VPSA 2LDXA 2OAQ1 5B3JA 4A0HA 2YIDA 2FMPA 2Y1JA 4MCJA 3PDCA 1F14A 4N01A 4E32A 3VPCA 3OEED 3CH5A 1L8LA 3QPWA 2GZAA 1I4EB 1NBHA 5HIIA 1E4YA 2B4YA 4DLPA 3FW1A 3PC4A 4OHMA 4TKUA 2P5YA 3LUKA 1UC8A 4BP3A 2I91A 4IAOA 4DA7A 2X40A 1QCKA 4WZZA 1XDBA 2RCNA 1ZVKA 2G17A 1KPGA 4OGWA 2ZRAA 3RBAA 5AVKA 2E4ZA 1KQ3A 2X1VA 5FLXA 4ZV4A 3PYLA 2C54A 3TRFA 4ESHA 1EXMA 2ORYA 4LDAA 8ICCA 1CS4C 1VBFA 1KDTA 2WIBA 1WP9A 2WJJA 3BZBA 3TLCA 4AO8A 3U4QB 2RHJA 3K70B 4DQLA 2AUNA 4MF2A 2IH4A 1QYXA 4QZIA 1NQVA 2OZLA 5ARDA 4BV2A 3CW8X 1P2SA 5CNIA 5JR3A 1HTBA 3DM9B 4NCNA 2W6PA 4HQRA 4MA4A 3R8FA 3AHFA 2B4AA 4TS4A 4R71A 4U6PA 5DTMA 1S96A 3R76A 2AX3A 4KPYA 4MARA 1W75A 1LD3A 3TAPA 2CVPA 3DE3X 1QQBA 5IIIA 2D6FC 4OI2A 1QHHA 1NU6A 1ISPA 4ARIA 4RQBA 1W4RA 3IALA 4TKVA 5J0WA 1Q8KA 3GMTA 1XJ5A 4FFWA 4EFLA 2JEIA 1W30A 2BP7B 3PFGA 3BWCA 1W25A 3LKBA 4DOMA 1G2PA 4NBWA 4W7SA 2FPXA 2VWPA 4E2YA 5CAEA 1KS9A 2Y2UA 1TA9A 4TZTA 2DPIA 1P9WA 1X70A 2VF4X 3PD7A 4C4XA 4X94A 3UF0A 1WETA 3N3AC 5HCIA 4NCIA 2QI9C 1GN9A 4IGIA 5FEUA 1FFXA 3HRDD 4Y9RA 1KAHA 1PGNA 3HJRA 4MLPA 5E1MA 2GWSA 2VL7A 3TNDA 4DW8A 1FRFS 5DYYA 1GZ7A 2SCUA 3P9SA 4GPZA 1E4EB 3BILA 3N9IA 1GTG1 1IIPA 3ABIA 3WQSB 4AS3A 3H2JA 8ICMA 1FVHA 2UZ1A 3ILSA 2NQTA 3PW7A 4ZTBA 2K89A 3SZGA 1CULC 1XTBA 3G5MA 5ECDA 1UDBA 2E1EA 1W46A 5CFLA 1JQKA 1MTZA 2J5BA 4P3YA 1RBYA 2WP8J 1M2JA 5GVSA 2CBXA 4OA5A 2NVBA 3A6HA 4O02B 4M3NA 4RV9A 2ZIVB 3NDBB 2JJ2D 3LGSA 4Q4HA 3A6GA 1UFQA 3C6BA 3W8NA 2E2WA 5IVHA 3WOHA 3K2QA 4LY0A 2MYPA 3RJ5A 1YVUA 3CNLA 1CUGA 4X7MA 3B6ZA 2X13A 3IURA 3CR8A 5F78A 4O4JB 3HCDA 4A3SA 1D09A 4UARA 1E9VA 2K2WA 4PF1A 2PUBA 5HF8A 1BWRA 2AOXA 4WL0A 5DBHX 4RS4A 1MZVA 1DAIA 4KRFA 3QJ5A 1M0TA 3A7EA 4FDAA 1Z8HA 3VR4A 2C7RA 4HNVA 1ZQHA 4PC3A 4U7JA 1VLMA 3IDSA 2DWQA 1V95A 4BNJA 2V4MA 5HKKD 1X7YA 2R2GA 3RYCA 3MBIA 3LYSA 1SB9A 1CB0A 1E63A 1XQ6A 1ZMRA 4U7CA 1L8QA 2GWRA 3JQDA 2HU8A 3KKZA 4HAOA 4WZBB 5DOVA 1F6WA 5IVDA 1Z4JA 4YTEA 1KSFX 3VKVA 3WGJA 5BT9A 3AM5A 3WSVA 3LK9A 2FJPA 2ATLA 2FZEA 2GO7A 2RHLA 3ONWA 2Z8YM 4HYQA 5I5GA 3UGQA 1EUZA 3QZ7A 1SCNE 3A10A 5E95A 2ZYGA 4QXQA 3F6PA 1YDHA 3KFLA 4FZLA 3AI3A 3JASB 1CUSA 1I9GA 2POQX 3DF7A 4B0PA 2G0NA 2P9JA 1C1YA 2ZT8A 3KCNA 5CW1A 1YQXA 1GXSB 5EKUA 3BTOA 9ABPA 3INYA 1BPDA 4ND1A 1NZFA 3MCVA 4G0XA 2C5EA 2E4UA 1W87A 2JBAB 3AZOA 3BF7A 4TKVB 4NU6A 5A7FA 3DR3A 4M9QA 1XXLA 1Z5NA 3F47A 3HKDA 3PV0A 2FDRA 1SD2A 4FFOA 3RODA 1URJA 4TGLA 4YXFA 3PIIA 3JCZA 4GG1A 1TT5B 1Z4QA 2GD0A 1ZQZA 2X2PA 4TXHA 3E8SA 1U7OA 2XQKA 2VT7A 3C1UA 4OQ4A 2AW3A 1OX4B 4LBWA 3MWGA 4QIWF 1SVKA 3G2JA 2JJ8A 1YS7A 4RVOA 5J5AA 3SAJA 4CKXA 5K5EA 2BGGA 2XXAA 4ZZ3A 1AY0A 3IAXA 4INOA 4FOLA 5J4YA 1YXMA 4R41A 4I2CA 5JS8A 4PQYA 5AW3A 3V34A 1KEJA 4ELUA 1SJ9A 3LUPA 4IIFA 2BEWA 2Q6VA 3H9EO 2FEOA 4MHVA 2NP7A 4EENA 1M3SA 3Q2OA 3QLTA 4V39A 4NU8X 2VOEA 2G7MC 4NAHA 5DIZA 5EXDA 4JR0A 5LXTB 4L5IA 1W29A 4U6NA 1BU8A 2HCTA 2AXEA 3REQA 1KYIA 1H2EA 1KO1A 1QHYA 2EX4A 3W04A 1ISRA 2BKEA 3AHGA 3ACBA 3DTTA 3ND9A 3OUTA 4M6WA 4NCJA 2W11A 2JLAA 4MHSA 5F4BA 4ZU3A 2F3UA 1G59A 1JG6A 1XRPA 3L8ZA 2V0GA 3M4ZA 1C2TA 3ZWNA 2AZ4A 2JI6A 3AFNA 4RU1A 2EFEB 3AHHA 4PCAA 3ROFA 3R9IA 2D2FA 1KTVA 3AERA 3H4VA 1OAKA 2JVKA 1N34B 1QAOA 2IF0A 2F9LA 1U2PA 3REQB 1L3UA 2CD7A 4ZVVA 2RJOA 3CZ4A 2LWIA 3I8XA 3F5FA 2QB1A 2ZIXA 3BMNB 3ABRB 4KB5A 4P83A 4QOJA 5CK5A 2PKRA 2EHDA 5EFZA 13PKA 1ZOOA 3JRNA 1PX2A 1SGGA 2AV6A 2W03A 2E89A 2EJBA 2PFSA 3IBCA 4GMHA 4YRIA 2OC4A 1SOUA 1NTOA 2O3RA 1ADJA 3IYLW 3UB4A 1PBNA 3OZEA 4DWVA 4X7BA 2W8BB 2ZTMA 5D84A 1Z4MA 3U0VA 1K6XA 3CX7A 2HU7A 3ESBA 5DB8A 4FMBB 5L9AA 3NS1A 3VC2A 3ZDDA 4R98A 4RXUA 2XIQA 1WBBA 5SZIA 4LZNA 1Y5MA 2BFFA 2I76A 4YROA 2DQSA 4E5MA 1CDDA 4H1TA 2C78A 1H5UA 2HBQA 2EKLA 1N7HA 2HTFA 3HPQA 3IEUA 3S4YA 4B4WA 5JMWA 1GAXA 4LGMA 2COEA 2H29A 3GGSA 5TQJA 5IYZA 3GFFA 1FA9A 4FZ3A 421PA 1Z6YA 1F51E 5AW9A 4URHA 2VSOA 3KJXA 3HBLA 3PMLA 2CL0X 4Q3KA 3V97A 1NWHA 1SUDA 4UNNA 4EUNA 1BW9B 1M1YE 1PLLA 1T8WA 3DYIA 2CVFA 3OPXA 4KGVA 4MP3A 4MFCA 1V96A 3CIFA 3NRWA 1IV8A 1U8ZA 3IL2A 2WPNA 2PNJA 2XCAA 4WOPA 2SCUB 4FFRA 5F2OA 4E0BA 5AJZA 5KFFA 3JQ7B 2DFNA 3IKVA 4KIWA 1ZQ1A 1QO9A 4HAVA 3MGIA 3CC8A 3M89A 4R84A 1Q7TA 4TQRA 1XZJA 2A5YB 2ZSUA 4RGQA 4C0BA 2CL5A 3EDOA 1M33A 4UD2A 4KLFA 4DSIA 2CYAA 2J4FA 4WZBA 1QQAA 3AP2A 3FCEA 3KWJA 3TOSA 2AZTA 1FMJA 3HFRA 1JH8A 1Z17A 3PDIA 3AXSA 4ZQHA 3FKSD 2HJWA 5IFKA 2VRCD 3FJYA 4BUGA 1XQVA 4GEKA 2QENA 4MS1B 3VZRA 1GA6A 1ZO8A 3JD2A 1Z73A 3D4OA 2L69A 1KYXA 2FZ5A 1UKAA 3EVEA 4Q3EA 4LFCB 4RIHA 3DVAA 4EDFA 2JHPA 1VKHA 1Z29A 1Z4OA 3HKZC 1NAIA 1YZVA 2VAXA 1HL7A 1HE5A 1VJTA 3GDFA 3QEJA 1TTPB 2DFPA 3VISA 5KFQA 3EXHC 5DBBA 2IEIA 3J7TA 3CNNA 4M54A 5D51S 3JAWA 2Q29A 1L7RA 5SICE 1DJLA 2VK2A 4WQMA 4Q4HB 3AKCA 2GCOB 4KN6A 1C7JA 3IA2A 2PA0A 4HMQA 3NFRA 2PRZA 4JWKA 1X38A 3VZCA 5C5EA 4BVLA 4LHEA 5DK4A 3EYAA 1KZ6A 3VU3A 4DIKA 4ZZ1A 3B5EA 4EHAA 1NVBA 4JJIA 1H8ED 3GK3A 1FQJA 5HKBA 1MJ5A 4JLBA 4NR0A 1F48A 3SJZA 3CLRD 4MZDA 3LYUA 5AJTA 4C5BA 2FUNB 1GFZA 5CB0A 4JV2A 3USZA 4DL3A 3FMIA 1IUNA 2A9JA 3Q7IA 3F5QA 2R5WA 2XVAA 3W8DA 3VU1A 2ZUEA 3CYMA 3E2PA 2P9YA 2RHMA 4K6CA 5H0IA 4I2AA 4MUJA 3RQIA 4CMIA 4FJ0A 1X94A 1NZDA 1DAFA 4JJZA 3M34A 3K16A 3VBEA 3WMEA 4D4MA 3ZVMA 5EP2A 1E2FA 1XCLA 1J0BA 1JKMA 3EGXB 1A9OA 1FRVA 3FNQA 3MCAA 3BEOA 4HC4A 2JFFA 3SZLA 3UOAB 3WDKA 5AQ1A 2GHIA 1XQ1A 1QH1A 2GJ4A 2A35A 3WGHA 4YWHA 3U9LA 4F5ZA 2H2AA 1IUPA 1S02A 5K8VA 3FKJA 1T2NA 1ECGA 4FGZA 1XQWA 2QZZA 3N0XA 1KVUA 1FQWA 4GMXA 4OJTA 2NOAA 4QFBA 5HF6A 1FNNA 4M7RA 3SGLA 2ZI4A 4DNQA 3K5HA 1TADA 4JJ8A 5FFFA 4CTNA 4R1PA 1MQSA 2B8WA 4O4HB 3A06A 4F3KA 2YVUA 3TH5A 3LVQE 1Q50A 2R4QA 3B13B 1HNZB 4N5NA 1O96B 3M9OB 3HCCA 3QZ8A 2WVGA 1R4AA 2CF6A 2F1JA 2ZR0A 4Y6LA 1F8UA 2AQKA 1Q91A 2ODWA 3HYNA 5AW7A 2CJWB 3D6AA 2B4QA 3IKLA 4JLVA 2NAPA 3VI4B 3RRXA 1SKMA 4AYWA 3GLFA 3LBHA 1SG0A 4GGPA 4Y6OA 4AROA 2QRMA 2R79A 2XB9A 3ZY6A 1MPXA 4B8YA 3FC4A 2F1RA 4JAVC 4N49A 4IO1A 4DEZA 3SYMA 4D7AA 3BRSA 4V0SA 2ZJ5A 1SCQA 2AU0A 2J5QA 4GLJA 5H7XA 3SEQA 5LYJB 4J8PA 2RK4A 3CKYA 3RC3A 3A14A 3EWNA 3EPHA 4OGKA 1DJNA 4ECYA 2KV2A 3W5CA 2LMRA 3MWYW 1E2IA 5K03A 3AEVA 3HCNA 4UUQA 5HR7A 4QSHA 1E1RD 2JJQA 3E5HA 3K1TA 3H04A 2RH8A 3COJA 1C1DB 2DTXA 1WLSA 2PGOA 3ELDA 4ZRNA 3PEUA 2WWGA 2ZBUA 3KVRA 4FS3A 2A0YA 3GQVA 4I50A 4CIWA 1K75A 4JQOA 3DE6X 1PZGA 1PS0A 3PA8A 2HMYB 4DIDA 4XSVA 5COBA 1B93A 1QWOA 2GILA 4Y9TA 4UTZA 4JUZA 4C4SA 4CM4A 3T7SA 1Y6JA 3JYQA 1VHQA 5ENVA 4CV3A 2V03A 3Q8QB 3AEYA 2AYYA 2BIFA 3ANYB 4RPJA 5EMJA 4BZPA 3QPUA 1FLNA 3EZXA 1L5HA 7REQB 4JBGA 5HFAA 3BSYA 3GUZA 4I50B 2ID9A 4JQZA 4KQFA 1MABB 2DFTA 2Q50A 4Z9BA 4HZGA 2HA3A 1OX5A 2JFXA 2BFEA 3LBNA 3GEIA 2Y1DA 3D3EA 1C3OA 2OB1A 2CC2A 4R05A 2SECE 3TUJC 1JSZA 5DHSA 2BZ0A 3WIUA 2G07A 4AQYB 4JLMA 2BOVA 4GW3A 3BQMB 3FPAA 2KZ3A 2V0NA 1HSOA 2ZSHA 5TF4A 2D1TA 3NYRA 1PR1A 2XB2A 2BEVB 2LPEA 1C3EA 3O95A 5JANA 3NH9A 5EJGA 5IAAA 4EMBA 5AK0A 5AESA 2JASA 4QZEA 1SUSA 2QK4A 2PEZA 3I92A 3PENA 1MGOA 2O2ZA 2ZPTX 4WNYA 4X1IB 2QTCA 2D3TA 2WSLA 3DKVA 3DZCA 1V7ZA 3LUHA 1Z28A 3O03A 1ZQRA 3WV4A 5J2GA 3KFXA 3M6WA 1DBPA 2Z56A 4KLQA 1P1HA 3NWOA 4FLEA 4MJLA 3WLQA 5BNWA 5E3JA 2XUIA 3GCWA 3PL5A 5FX2A 1T3GA 3PHBE 5TRTA 1XZMA 2RKBA 4DL7A 2WR8A 1B4DA 4KXFB 3CX4A 3DL4A 1NOJA 2PXHA 3V5NA 4DEXA 3EA4A 2Y0EA 2B7LA 2QTBA 4KLEA 4DPLA 1TK3A 4EPTA 3JZMA 3W5VA 1XC7A 3L7BA 3PP8A 4DB2A 1V85A 3GQCA 1US8B 3FMVA 1G8GA 2CNWD 3L18A 3UYLA 4CKCA 2ZSIA 4QIHA 2FSIA 3DTVB 3M9LA 3ZLBA 2B2XA 3DB2A 4X95A 4AJHA 5CDTA 3HMQA 4UOZA 2MUTA 3CRQA 1QF9A 2PGXA 2BHTA 1EJ0A 1FY2A 2CCJA 1IAVA 4BJHB 1WDLA 4O3MA 4BMXA 2JDID 3VJMA 4ND6A 2QD1A 1SHJA 3NX4A 1N56A 2JCXA 3RAJA 4WI1A 4ROTA 1SHKA 1G2OA 1NMSA 1KSPA 3TFSA 3KJQA 4JXKA 4NBUA 5FJIA 1CUKA 3ZDFA 2QLMA 3OM0A 3REGA 1QX4A 1KH2A 2WU3A 2H3HA 4XGQA 5HF9A 1SMKA 3E27A 2V9CA 3VAZA 5FP0A 2W7TA 3NVZA 2JIMA 3U2QA 1RZRA 1P9RA 4HPWA 2JFOA 8ICFA 2QR5A 2QSZA 4PZ9A 1QP4A 3U6KA 1L4NA 2E55A 4RQNA 3KAPA 4E5PA 3ISVA 4US9A 2BELA 4LVSA 2DKOA 3CZ9A 4O2AA 3UK0A 1WUDA 3OZBA 1UJMA 1X9HA 4YPOA 4U6QA 5HUQA 3IUSA 1UC4B 3H87A 2ZBQA 4WXPA 4R3NA 4YHHB 2PK3A 1RTKA 3IUPA 2CXYA 2ID4A 2R62A 1R0YA 2AEJA 4IVPA 5I01A 2D7CA 4UBNA 4UTOA 1XMSA 1DKUA 3AR8A 3DZBA 1E3IA 1HDXA 2C4NA 3NVMB 4J3JA 5C1IA 4BP1A 2FWIA 4XWKA 2OCYC 3GA0A 2OR3A 4IYRA 1I13A 5CVEA 3T5BA 4NJEB 4CUJA 2HV9A 2DFVA 4QDTA 2B94A 2V7XA 3KEOA 3OJFA 3BDPA 5A1TA 4YG2A 4UEWA 3KOUA 4UBKA 4EYIB 4H6PA 4CEJA 3EEQA 1UAYA 4BZXA 4ETIA 3PLNA 5F2KA 3KBOA 4Q4LA 1SUEA 5D6NA 1QYIA 5AI8A 4MAAA 4EA7A 1R3UA 3A2MA 4WKCA 4UJ3A 9LDTA 1UA1A 1WCXA 1NJFA 2Q3FA 2ODEA 4O25A 2I03A 2FPPA 1DTWA 3SJAA 1GP2A 2H5IA 1H1TA 2OO5A 1F5SA 4PZOA 3VO8A 4I4LA 1ZRNA 3SHQA 2V7EA 1XE3A 4CFYA 3QVLA 1O8CA 2JLBA 3IELA 3VMFA 3HUDA 1XA4A 3KXLA 1RLTA 5H8WA 2G8LA 3DE2X 2XSZD 2Y0SF 3OJLA 1TM3E 1LRKA 3LCVB 1RIFA 2OFPA 1PJ4A 3ZJ4A 5F9LA 4G4IA 4WE3A 4KMOA 2AJLI 5JWOA 1MUUA 1X74A 4QECA 1DS6A 3EUB2 5GTIU 1TAQA 1EFHA 2B3DA 1MMFB 3ZLUA 1GKLA 3OFND 1KDZA 5DW3A 3V55A 5KC8A 4KQIA 1J2MA 1AE1A 1EQ2A 2CUNA 2EP7A 4ZC1A 4N0QA 3KC2A 1VJ1A 3Q41A 2PZ8A 2Q4EA 4JXJA 3M2TA 4H60A 4UM9B 1XHEA 2VN8A 1T2EA 2QL5A 2OHOA 5EE5B 1G6Q1 3L77A 3U49A 2LRHA 2KSOB 1I7PA 2VLBA 3IAFA 3RVLA 1E9EA 3JVIA 3VSAA 4BV9A 1H8HA 3J7AC 2R11A 3WWZA 4D3SA 3LGXA 1T4BA 5ELXA 1F8GA 3AU2A 3H9GA 4L7QA 2R8KA 4N40A 2W2TA 2DUYA 3QLJA 4R8VA 2X7JA 4PJ0U 2FR8A 3TOCA 4BE7B 2BE7A 1HZJA 2WVAA 1B7GO 2CZCA 2OUKA 3KE8A 1S3FA 2AW5A 5EQDA 5F21A 3UQZA 1SN7A 4MEBA 3ZE2B 2EHJA 5B6IA 5JWRA 2P0AA 4IGEA 1AQUA 2CLIB 4EZ6A 1XZIA 1SB8A 2EP8A 2WI8A 4MPTA 1NN5A 1Q3TA 2DSTA 1GUYA 2R7LA 4MUYA 4Y1GA 1P73A 3N58A 1F0YA 4RL6A 3K4HA 4ZDWA 5K8IA 1T26A 1S8FA 3VVBA 3L4PA 2DKFA 1W6RA 4MV3A 4U2GA 5K6RA 5DBCA 4MITA 3T5TA 1Y6GA 3EXG2 2ZZKA 2ZQ5A 1EX1A 4Z4CA 4E5YA 4U9IS 4JLWA 3TLXA 4QE3A 3TNJA 4DLEA 1YVRA 1DRKA 3O84A 3LOQA 4BIIA 1OU0A 3GZNA 1QZTA 2ZBGA 4HAIA 3KWLA 4K2AA 5E6SB 5CBKA 3TG2A 2WZCA 3TEFA 3AEXA 4YJDA 4NG5A 5F2NA 1R6BX 5IK2D 5LXTA 3M5WA 2NT3A 2PSFA 2H7VA 2Y1CA 3FA2A 5KG3A 3HN6A 1SCAA 1ODTC 4D2IA 4ALIA 4QWBA 4RQMA 1AGXA 1E9AA 4Y30A 4FYPA 2OYYA 3EOAI 2Q5QA 3Q12A 5I8ZA 3TZLA 2HL6A 4DR4B 5JS7A 2W2QA 3U4MA 3VTAA 3GJ0A 1FFSA 4TVOA 1V38A 1MOSA 1YMQA 4P3XA 1NF9A 2BPCA 4S0XA 4KXYA 1UBTS 3MSXA 1RRKA 4WA8A 4HGZA 5EZ6B 3SYNA 1NW9B 3U1TA 3T3DA 4ERXA 4ETMA 1IJKA 3O4FA 4BJ1A 2ASVA 4EUHA 3T5KA 3I2GA 4EZEA 2AEFA 3DAGA 4CLHA 3GZ4A 2OTCA 3EARA 4I4CA 2FLWA 2QX8A 3A6EA 4AG6A 4DV3B 3LRPA 4DR3B 1MKYA 1Q21A 1Z9BA 3RK4A 2XNCA 4UVDA 1YI0A 1WSAA 3FPHA 3B3FA 1W5FA 3QRWA 3CSUA 4N8SA 5GZ1A 1W5TA 5DDIP 1T9GR 1U8EA 3FOAA 3LC7O 4YWJA 3GPCA 5PNTA 2VYQA 3O8BA 4KI0A 1Y3DE 1L8AA 1N3BA 1CLEA 1NBIA 1TW2A 1XS9D 4ENTA 3AF2A 4TTQA 1HFEL 1NVWQ 3EG5A 1R1DA 1TFUA 4PPNA 5KOHA 1IU9A 5E2BA 4NONA 1SU6A 1IZYA 2Y9PB 1QBGA 2GD1O 2KM1A 3ITEA 3W05A 3WA7A 2DWUA 4K7JA 3LT2A 2CPRA 2FMHA 2ODPA 2XAUA 2EF1A 3AF4A 5FNVF 2WJHA 4PO3X 4BEJA 5A0TA 2VBCA 2HDNB 4Z53A 3LW7A 3QG5A 1KF0A 3DBHB 3BWYA 1VE6A 5ESWA 3HA2A 3M7DA 3PUVA 2L5YA 5B1IA 2O5CA 4N9WA 1A6SA 1EK6A 4D8XA 3AM9A 1JJAA 1LI7A 2YJZA 4UFPA 2L2QA 4NEQA 4Q3BA 4LHXA 8ICRA 4O0IA 3B70A 1U5CA 3IP4B 1NVVR 2WSIA 1BNPA 3RH4A 3FRHA 4YI3A 1W9MA 1I6MA 3T0GA 5LWQA 3FCUB 3N70A 3JRWA 3AQFA 3I37X 4LJ8A 2IA5A 4MO9A 2WLSA 4WIAA 4CUKA 5KL1B 4L4ZA 3S70A 1IVYA 4G0PA 4PBTA 3DMGA 1W0CA 2IYSA 3V1YA 6GPBA 1U3FA 4MWBA 2PMEA 2D5IA 5GOZA 2ODNA 4HNUA 1RM6C 2RH9B 2XWJI 2X9NA 2XUZA 4J6EA 2P66A 4JEMA 4DOCA 2A58A 4OQMA 1IUOA 2W9AA 2X6QA 2YWHA 3OQIA 1KJ8A 5IEBA 2FMSA 4Q1FA 3DL2A 3HCAA 3RJTA 1ZRMA 1LJLA 2XTNA 3OE7A 2Z1DA 1V71A 4LTNA 4ZWNA 1KETA 2X0KA 3WGQA 3VPAA 4Y2XA 1U1FA 1VMAA 4MKHA 1U1CA 3VR5A 4G5GA 3RRGA 3L8DA 4JB0A 3SQWA 3JTEA 1XPJA 2AFIE 2QL6A 3E9EA 5JXGA 3C15C 3OWXA 3JS5A 2AF3C 3OIUA 4TVKA 5J0OA 1SVSA 5FULA 1TU3A 4P93A 1L5FA 2KFZA 2ZYAA 5IXSA 3LLMA 4LGVA 4AF8A 3DF9A 3PUWA 2BD0A 2XICA 1ID1A 5AJXA 4EFDA 2G70A 2GEKA 3DLCA 1RBMA 3RD5A 1YS1X 1WPXA 3UENA 1ZQFA 5IAGA 1F0PA 1QTRA 3RVRA 3ZCVA 4GRIA 3EIFA 4X44A 2FFQA 4PYJA 4XVUA 5CHEA 1GQFA 4OXRA 1TB4A 5EZYA 1Z4IA 2RHGB 1XX6A 4GECA 4Q9HA 4LZDA 1AKNA 2HM7A 2WBLC 3NLLA 5EERA 3ICEA 2V4RA 1XAGA 5LLDA 3PSAA 1CYDA 3ICPA 2XTMA 1AHHA 4IVRA 1KKMA 3H7IA 3LK7A 1BGXT 2I22A 2QN9A 3MT7A 3NGMA 3UGTA 1Z39A 3UMVA 1OB2A 3I6BA 3IIJA 1BJRE 4B47A 1K1SA 1BX3A 5JTIA 3C7CB 4UFNA 3WYDA 3IAEA 1KJ9A 2NNWB 3ABSB 2B0JA 2FMKA 3SF0A 4S2EA 4Y7DA 3T6KA 3L6EA 2HCJB 5LNK1 3AP1A 3EVZA 1OXTA 2P2DA 3OJEA 1AUXA 1VLHA 4U2KA 2BZFA 3ZE9A 4X20B 1P5FA 3ND6A 3HC7A 3WKDA 5EWGA 2D8AA 1F9EA 1SVLA 5MF6A 4LG1A 1OOEA 3H0EA 4U7DA 2OV4A 4V0QA 2W2KA 5KIAA 2VJ5A 4RK0A 2GFIA 2MSKA 4V0MA 4F9TA 5AHXA 1X92A 4ALLA 4HRAA 1T4CA 2XYRA 3TDMA 3DV9A 1ADFA 1J5EB 5DNDA 2B4KA 2ZIXB 4QOHA 1D6JA 4CJXA 5I7OA 3V1NA 2B3TA 3H1FA 4A23A 1A2OA 1UZUA 2ZT6A 3NZEA 2L42A 2QE7D 2YFHA 2FOIA 2VDLB 5KVSA 3FBGA 3MCZA 2IVZA 4OXQA 1GU0A 2AJBA 5HM6A 3CLKA 2QARB 1IZ9A 3MJDA 2E8OA 4B9TA 5IAJA 3CO0S 4URYR 4YR3A 3RTGA 4GBMA 3SR0A 2YZKA 3KVNA 2IC5A 3Q8PB 3N2KA 4LPKA 3IT2A 3CVWA 3IUJA 2XECA 3GRRA 5GJBA 2X9GA 2ZIEA 4PXYA 1E2PA 3THWA 2G25A 2PLFA 3SSMA 4UNQA 4CCSA 4EEZA 5JI2E 3SR3A 4L28A 2AFVA 2I2FA 1I4OA 1VB5A 1Q3HA 4PYNA 5KAMA 5LBTA 3B8EA 4LXXA 1V11A 2H9AA 1XCOA 3DNPA 3EFOB 4K6HA 4YCCA 1Q0ZA 4QULA 3F8WA 5DM60 3GELA 4B7ZA 4OFBA 4HB3A 1Z5VA 5JCOA 3PX4A 5JHGB 2JK1A 1K8ZB 2PMZC 3L1UA 1JLLA 1XWIA 3L5OA 7ICFA 5ERYA 3RTCA 3WDMA 3ZWOA 5IKXA 3TZ6A 2AZXA 3ANNA 4FPXA 3ZBQA 4KBYA 1WZUA 2RGXA 3A1VA 4HEQA 4P98A 4FYJA 4PQRA 1PV4A 4DDMA 4GAEA 1M0WA 4WY2A 1DX4A 4R8MA 1U2TA 3B9RA 3R77A 4R9UC 3ZHYA 1ZP6A 4NV0A 1DADA 4OFXA 4PTYA 2CXUA 3AFIA 1ORTA 3IMEA 3KKLA 3S2FA 4IR9A 2P4EA 3DZFA 3UUWA 1MO2A 3BIJA 1Z6GA 4BO2A 3RYFA 1DG9A 4QELA 5F3DA 3UAOA 5D3QA 3JQEA 2QP9X 3UK7A 1E9BA 3DDOA 3TFWA 1E1KA 1GSOA 1GZVA 3LDUA 2G76A 4MQFB 4QTUB 2CHUA 2R97A 2D59A 1AURA 4J0JA 3SE7A 3GJ7A 3WYBA 3ZK8A 4C01A 4DFPA 2K87A 4RHYA 2R1ZA 3I6IA 4ROSA 2G4VA 3TXAA 1WMFA 1LDYA 2ORED 4GZ6A 3PSPA 4YMIA 1PNQA 3HS3A 1CS0B 1JIUA 1KA9H 4M9CA 1DIBA 4KNWA 1QK4A 1XU7A 4HWKA 1M34B 4ZVNA 3FZQA 4IQGA 1YWGO 3B1WA 3G9QA 1XUOA 3ITNA 4OH7A 5KT4A 3WWYA 1K2VN 4J0FA 1YV9A 4Q9NA 5LMZA 4XRGA 1KARA 1V8DA 5K3CA 4Y2UA 3WFJA 2OYRA 5LWHA 4UC0A 5EEHA 5A3JA 3QYAA 4C9BA 5I48A 2WTMA 3NVAA 1Q1GA 3KSRA 5MGNA 2EKPA 3HXQA 1YBVA 1NLMA 4FBLA 4IQVA 5AT1A 5IIKA 1MVOA 3T4XA 3P5SA 2X9LA 3WWDA 4WN3A 5DB4A 4CWAA 1T8TA 2WW8A 1QE5A 4II3A 1L4UA 4PXAA 2G5CA 4MQLA 1RAFA 2ERYA 3IXMA 4B2LA 1IHOA 2C20A 4ECWA 2D8CA 1LPMA 2HXSA 3OPQA 1XTSA 1HURA 3NM5A 4FYIA 1E3DA 4XRRA 1ESMA 2RI6A 3I34X 1KYVA 1A4RA 1T8RA 3TRIA 4D8YA 1KERA 1YKFA 1Z00B 2BI8A 4PONA 1R5JA 4FC7A 4Q47A 1D1PA 2AI3A 3FMOB 3KPVA 3LQQA 3LKVA 5AKLA 1QBKC 1T3HA 2JIOA 2YV2A 3BHIA 4AZVA 5KTTA 1YQQA 1U8UA 1A0PA 3NJRA 3V1UA 4Y8VA 4TRJA 1CR1A 4CLDA 4FZRA 1IVSA 1GPDG 4MCAA 1X39A 1J9ZA 1RLMA 1TZ2A 2WIDA 1R6VA 3ILXA 1GQRA 4MYCA 4X7RA 4UQLA 2QX6A 1PFGA 2XNHA 5K2MA 3QVSA 1Z2OX 2I66A 1T36B 2AWNA 3ZE7A 1EHYA 3H1TA 1H42A 3DVRX 3ZTWA 3Q1KA 721PA 1E5QA 3KKNA 1WNFA 1EWYA 3HGTA 1Y7IA 1KI4A 4HLUA 3QBEA 2PWBA 2HQ1A 1JR4A 2OCBA 3Q3JB 4EUKA 4V0NA 5A4FS 2F8MA 4RF5A 3VR3A 1P7WA 1S0UA 3PQ8A 4IEEA 2HMVA 2AHOA 4QXAA 2C7QA 1O6FA 3AUAA 1ZNWA 3EC2A 3GJSA 3P94A 5CH3A 5HRCA 1P1JA 2W37A 1YR3A 2GAFA 4NF2A 1XLVA 3KYBA 4NS4A 1TYBE 4JB8A 2C94A 4UU1A 4P0QB 2VOJA 2X42A 5KWSA 3HDTA 1YA8A 3DO6A 5ERXA 1JTFA 2YJNA 3K35A 3LA6A 1T5OA 2RIPA 4ZGWA 1J2EA 3P52A 3F1KA 4PO8A 4GKKB 3ZXXA 3OX1A 4NBNA 3D3QA 1BXZA 1YASA 2P6NA 1MVLA 2XRMA 3I9FA 2Q28A 5BNFA 5C0OE 1SCDA 1ZJYA 1IQRA 3BREA 4YGYA 2JEYA 1SD5A 2NACA 1S10A 5FXMA 5KDDA 4CEIA 1UOOA 1TCAA 2J3DA 1ILEA 2C2EA 1GZDA 4HFNA 3P2YA 5A4AA 3AF3A 4KQXA 3A6KA 2PT6A 2F00A 4P3PA 3WTBA 2FPMA 5JXIA 3OQBA 1I24A 1M76A 1Y42X 1K7YA 1NJ2A 1II8A 1S8AA 1YRYE 1Y4DE 2WMOB 3C3EA 3QWHA 4FTWA 4MVJH 4E12A 4UEOA 5TJHA 1VFPA 3UK6A 2HSEA 3KYDA 2W4MA 5B55A 3GZNB 3T1TA 2RCYA 4HH1A 5JH7B 2IX3A 2DUMA 3QVOA 3PY8A 4R7GA 1XB2A 5EPEA 4B44A 5BSVA 4ENVA 1NC3A 4R63A 1RPNA 1W8IA 2V6IA 1XEXA 2XHZA 3AEQB 3IQXA 5IHPA 4WEOA 2EERA 3IEMA 4PG8A 5DNVA 2XUGA 3DL0A 3FIUA 3KKKA 1VIYA 4FCWA 1J2NA 4MVYA 5ES3A 3O94A 3U39A 1BDMA 4B2YA 3MSCA 3PX3A 4XCQA 2G77B 5IVIA 3KJHA 5H68A 3R3HA 2HNBA 5KJCA 1HH4A 2JGKA 2VUUA 2PSJA 4CR7A 1MB3A 1KY2A 3C1AA 4G5QA 4XWWA 1ZQYA 4KLGA 2PR7A 4A1FA 3GZTB 4QNLA 5TJ9A 2F2AB 1IY2A 3EUWA 3HB1A 4OYYA 1G5HA 4BGIA 3R5HA 4F92B 4XQ8A 4JBLA 4Y6QA 4WESA 2IYLD 2X8JA 1X7WA 3D2AA 5KNDH 4MGIR 3TQQA 1KXJA 4LQLA 3LNTA 1NSTA 2GM3A 2QW8A 4LI3X 3JWGA 2OCXA 3LLCA 1SV4A 1LKYA 2V4UA 2W6ZA 4K9QA 2KWIA 2WFAA 4OJ6A 1G2QA 1Y8ZA 1JIIA 2YDYA 4FC6A 2QAIA 5IM4A 1B2RA 2WYWA 1JZQA 1QGOA 4PSUA 5K3SA 4LQ4A 1TVKA 3M81A 2FQQA 2ZRBA 2YC2C 3RREA 1YB4A 1JEEA 1G3MA 1RPJA 3I5AA 4YAWA 1ZWLA 4G41A 5JFTA 1VCIA 3BWEA 1XNGA 4QZAA 2QR2A 3OP4A 1MENA 5C8ZA 5ISMA 4CQJA 2TYSB 5FI5A 1LRJA 3B3JA 3PB3A 2OGTA 2ASJA 1FFDA 4CCWA 5IEJA 4WMLA 1XMIA 1TEXA 2HRCA 4EY6A 4MWZA 3W9SA 2UVRA 4FYMA 4BLTA 4JSTA 1T8EA 2D2IA 1PRYA 2ES6A 2G71A 3AYXB 3C74A 4INPA 4OL9A 1DOHA 3RLFA 3T52A 1CRQA 4FD3A 1YB1A 2PL1A 3P9PA 4GUAA 5T3UA 2EW2A 1PK9A 3OZGA 4J4HA 5LZ8A 5H4GA 1AB6A 5JMTA 3GJRA 3OZDA 4JGBA 1TK5A 2X9VA 3F5DA 4EAQA 2FPPB 4JV5B 3NGLA 1FL9A 3I32A 1YOVA 2HLPA 1CNFA 1E6CA 1I2AA 2B7BA 3DKRA 4WZAB 2PD3A 2TS1A 3VR6A 2J6BA 2W22A 3ZV7A 1BHJA 1Z07A 4LF7B 1D9DA 1BE8A 2A94A 1H3FA 3BIWA 4I1YA 4IM7A 1P0IA 2FUG1 5B64A 1FDTA 3TZBA 3UJ3X 4DL5A 2R8RA 3ROXA 1MB9A 1Z3IX 1T5DX 1ZK3A 1O8BA 4Y2VA 4OK5A 1RAIA 1WABA 3N39C 2X0EA 3ZCSA 4X93A 5ALDA 2HUNA 3QWBA 4EHFA 2QNRA 5CHGA 1TPYA 1JALA 2G5IB 1IH8A 1EXNA 4YQZA 3OE5A 1PKEA 2DKNA 4DCCA 4DSAA 1TF7A 1WKVA 1PSWA 4CMBA 1XA3A 3HI4A 3IVRA 1E6WA 2PI4A 3D2BA 3HV2A 4OM8A 4GLFA 1BYIA 3Q9LA 4PNEA 2C9CA 3OA0A 2RB4A 3EPLA 2EG9A 2D2XA 3L07A 4H0CA 1FQKA 1OTYA 2IOYA 4L9SA 5B58T 1OC4A 2IS1A 2HLDD 3FVQA 3HJNA 1U9IA 1OJ7A 3OCJA 4FJ2A 4IEIA 4PAQA 4W1QA 2VA8A 4TQSA 4YQEA 3T9DA 1GTRA 4P5DA 1DXSA 1L3CA 4LHZA 5GP1A 2PPVA 2Y0BA 2VCEA 3Q85A 1YQ9A 1IBLB 2YMLA 1W0KD 4PW0A 4P4MA 1W4AA 8ICBA 4YMOA 5KCZA 4QICA 4NDNE 4V2UA 3RRNA 1PD1A 1J23A 2FJ0A 2C3YA 4G63A 2WQ6A 1BSVA 3GD7A 3RHZA 4UHCA 2IYWA 1U2EA 4KO8A 2H3IA 1JJVA 1AK9A 4LYFA 5LQNA 4P4NA 3AIIA 2P1ZA 2FPIB 2YVAA 3E7WA 1RP7A 4LDRA 4QZGA 1CHDA 3W6PA 5JU5A 3H19A 3P2JA 2DT8A 1R6UA 1FJXA 2QTVA 1F7VA 2DWPA 2QRLA 5AVXA 3WISA 3VR4D 1TYDE 2WD7B 1F3LA 1S8OA 3TVYA 3NEYA 2F17A 2QF7A 1FVOA 3G5TA 3WNQA 1RTTA 3A1TA 4AY4A 4MW9A 1XTVA 2JGDB 2VP3A 3N8HA 4OSPA 3WNVA 3RRZA 4BU1A 1IXYA 4XUDA 2M6SA 5BOLA 1WUTA 2YUTA 4QTTB 4EGAA 1B1AA 1P1RA 5HUHA 3TUZC 3TCNA 1PP4A 1KZ4A 2PX2A 2NGRA 4S2UA 5A4MS 4AWBA 2CL7X 2GOLA 1QHFA 1TX4B 3RS9A 2QA5A 1S1MA 1ATIA 4FN4A 2XMRA 3QG1A 5G5GA 3K8QA 4H08A 4HZUB 2BLLA 2IP1A 2XMPA 3ITDA 4UNIA 2O7NA 4JCCA 4TXMA 5EMMA 1DV2A 4LNAA 3PEWA 1E1CA 1X8KA 2BF7A 4IF6A 3TLGA 3LOPA 3LHKA 4RLFA 2CHGA 2ZRHA 3EYZA 1U80A 4EB0A 2O8FB 7ICQA 1KAQA 1KNQA 4RZSA 1HORA 4YALA 1FC0A 1XP5A 2Q6OA 3ANSA 5LQMA 1NI3A 2OBNA 4P2GA 2R6DA 1G55A 3PW5A 5KTPA 4MSUA 4WCVA 1XMQB 4QDJA 4ZOAA 3O8CA 4GSKA 3AFOA 3EDCA 1Q1QA 3O1HB 2KTQA 1RI5A 3IAHA 3UHOA 2VQ3A 4EGQA 4OHYA 5TT0A 1DGQA 1PGQA 1MABA 3OCWA 1GKUB 1Y1KE 5T8KA 4CGZA 1UPCA 3ID6C 1JQJC 4Y0NA 1DXHA 1NRIA 9ICOA 1T9AA 4HAXA 5H9VA 5HVNA 3P2EA 4KLDA 2H9IA 2G8NA 2BFCA 1RLOA 5CXXA 1OIWA 3C6MA 2UYCA 3V46A 1S2GA 2WMDA 5C5JA 1X0VA 2HGZA 3FF1A 1VG1A 3DP9A 3HCBA 4NG4A 1BZYA 3KO8A 3RYHA 5J2JA 1EVJA 4DSTA 5DI9A 4XFKA 1NJWA 2I4RA 3W5UA 2HW8A 1RHQA 1S5PA 5K51A 1KDPA 2ZUVA 5I7FA 4TMZA 3QQ5A 3A1WA 1Q15A 3MQFA 1V43A 3NYIA 4R2WA 2AKEA 3EF0A 3KD3A 1S8NA 5DMXA 1RXYA 2AIRA 2G0TA 4G84A 1FYVA 4OQLA 3GQBA 1XO1A 3ME5A 1V5FA 5DVZA 1P62B 3NQ41 3NUZA 4AZ3A 2VDMB 4NDAA 4Z49A 4PWZA 3T3MB 3SX2A 8ICHA 1S76D 2DTDA 1QP7A 2AC7A 3ENKA 2DE0X 2XXJA 5KFLA 4TV8B 1GUFA 4LV8B 1B2LA 4F6CA 3PR4A 3OEHD 5AKZA 1J8QA 3KUXA 5COAA 2R4TA 5C7YA 3WGOA 1KEVA 2YQZA 4ZXPA 3FYUB 1XZFA 2F48A 4GXRA 5LYYA 3VHRA 1HQDA 4FEAA 4MS3B 2ATCA 4MK4A 2CY0A 2OP1A 3C39A 4GMGA 2GCGA 1DWUA 2IL1A 2BCJQ 3KX2A 1QC5B 3BMCB 3TAXA 5EIFA 3CWCA 3JD3A 2BKUA 2JAOA 3IHLA 4FYWA 2A4KA 2A1JB 1F1BA 1GNRA 2RHRA 5AM2A 4J0IA 4OYRA 2SICE 2DBQA 4WN9B 4B35A 4Z1OA 2HHHB 1R0SA 2RDIA 4MRVA 3ZCRA 2O4UX 3GYGA 5JH7F 1CEEA 1UBEA 4GOND 1JMVA 1B8VA 2I6FA 2VFAA 3T3PB 1Y4AE 1OQAA 3A6FA 1ZEJA 1M2HA 1NY6A 1WVMA 2FN9A 3BB4A 4HG2A 1KI6B 4BRWA 3VZPA 2YXPX 5IUJC 2I4OA 1KBOA 4WBNA 2UKDA 1ZJ6A 3DEKA 3PUJA 2FUKA 4WKGA 5J29A 1YKSA 3RUHA 4NVRA 1QJCA 3QENA 4MR9B 2AOTA 5IZ4A 1QIGA 9ICTA 1D6MA 4IS7A 1XSEA 1OZAA 2UVPA 2PUFA 3GMDA 1C7RA 2HHCA 5L4LA 1KSHA 2IUFA 4IIEA 4UAUA 4HQLA 1H22A 1GGNA 4ODIA 5FQOA 4CMEC 5EHNA 3IKTA 4E4RA 1U5AA 3AVPA 4LQCA 1G3UA 4HEA1 4BX8A 2BBWA 1WMBA 4AP5A 1IMOA 1WQ4A 1WHSB 2IWRA 3E35A 4CMIB 1NLUA 3KZNA 2DX7A 2QWXA 4UXJA 1KRXA 4JYBA 2NNLD 1E9FA 1VL8A 2C0PA 3AQ4A 3MJTA 2AG5A 2J3MA 2Q3CA 3CMMA 1QE0A 3EZLA 3G7UA 3K0BA 5A9TA 7ICIA 1N2OA 3ZJVA 1UINA 3ICQB 2R6CA 5BP7A 4YB8A 2HNAA 3AM4A 1JSCA 1RI1A 1RQ7A 1DUVG 2HSDA 4S1OA 2QT0A 4ZMSA 2VTBB 3ETGA 4PG7A 1BCSA 4I28A 5ADWA 4MVJM 4OJLA 1ZLXA 5H4HA 1R50A 1R5BA 4MUXA 3D8HA 3JYLA 4AWXA 1RPLA 3VNRA 2UUPA 5LMNB 1FFBA 1I0ZA 1TRKA 4G1FA 3E3OA 5CMLA 2HFKA 3RANA 3CNBA 5ALWA 4QA9A 1IHYA 4E70A 2OZKA 3RAXA 1DUIA 4MKGA 2IELA 2YVLA 1DX6A 1G7SA 2Q1SA 1QYWA 4TSRA 5GMOA 4E4YA 2YOHA 3PGLA 3S7TA 1QP0A 3QKUA 1T6XA 2M9NA 1AN9A 3H5OA 3QXHA 4DOBA 4IH9A 2IYOA 4ZVRA 3T8YA 4MPPA 3X1JA 4DQXA 4M9HA 4IIHA 4TTTS 1EVZA 5JOQA 4LZZA 5B7NA 4OI0A 1Q17A 2ZWOA 2ZRPA 5TQ0A 2BSQA 1H2HA 3F3YA 4PINA 3VH1A 4B33A 1C2YA 5K4HA 3QFHA 4Y2GA 1W59A 2OSVA 1FK8A 1WUJS 2D74A 3T5LA 2LHTA 2YFYA 3O75A 3HNPA 4I2IA 1J2JA 3FWZA 3M6XA 4KUEA 2QZJA 2XB4A 4X84A 1O0CA 4OHUA 3CWZA 4QYIA 4CIVA 2Y9TA 1PKXA 1J0CA 5JDCA 3TTUA 5ICMA 1Z6TA 3KZXA 1AT1A 2FFBA 2I5PO 2PJDA 3G9XA 3H1EA 2H4WA 5F9MA 4ZIRA 1CY8A 4ZTZB 2BFPA 3G2KA 1VG9B 3HUUA 4MRNA 1MJGA 3OZIA 2FUCA 4Q9DA 2B1IA 2DU8A 1C9DB 4LY3A 5EHGA 2QQ5A 2BDPA 1WUHS 2C03A 2XGJA 1VHJA 3OIGA 4YMVA 3ZU2A 5L3QB 2EX0A 1U47A 1ATZA 3JQPA 2GT1A 2BGUA 1TGYA 3D54D 2XW6A 1B0AA 2XI9A 5J2KA 2LIVA 1L7XA 3E1SA 5DLEA 1R00A 4EHKA 5KMGA 1APBA 1Y37A 4DV2B 1W48A 3V2IA 2NP6A 4AUKA 3T5JA 2WB1F 1WW2A 4TUYA 3N0WA 1G3IA 1L3TA 5KSZA 4JCOA 4URUR 4X6YA 5DHFA 4LISA 2D06A 3ND7A 3M8RA 1LBTA 4HWOA 4EIWA 1ZDMA 3NETA 4HUQB 4UCQA 4NEGA 2P69A 2GM5A 1A9RA 1G20B 1Z0ZA 4KLTA 1JLSA 4JFRA 4NICA 2W6MA 2QVGA 3L7NA 4WZ6A 4K3VA 5AUQA 4GWLA 1LS1A 5J2UF 1VPWA 1CUIA 5F3RA 3QU2A 2G4CA 2REQB 2IOFA 4KPUB 3T1QA 1Z5UA 4QM7A 4MIEA 8ICYA 5FYQA 3MTBA 3PF8A 5JHHB 4R9VA 4JFAA 1L7NA 3K96A 4BS9A 3THXA 1H2XA 2RAFA 3PQ7A 4MW6A 3JW8A 4DA0A 2PMZF 5KINB 1IATA 2Z5FA 3JQFA 4HQKA 4QQFA 4W6ZA 3BBLA 2GCIA 2JGJA 3KR0A 1NJGA 1E0KA 2EP5A 2ZJ4A 4BP9A 3DKPA 1BVYF 1SXHA 2WM8A 5HILA 4Q3LA 4EB6B 4F1JA 1USKA 4GI3A 1V26A 4F8YA 2Q46A 2PMCA 3BK2A 1C8BA 4I55F 1O94A 2QB0A 4DYDA 4I4TF 4OH1A 1T4CB 1FRQA 4OO1J 3M5CA 1JKFA 3HM9A 1L4YA 1WW3A 1Y5LA 1JTEA 5JRZA 4X1KA 4ER7A 4OGLA 3WKEA 2FPSA 3OPMA 1JVNA 3TR5A 1FDVA 2HJGA 1EB9A 5LZ5A 4FGJA 2ZR8A 5LQSA 3TL3A 1I2ZA 2B1QA 3D59A 4CN9A 4XVRA 2GZMA 2JIZD 3MFQA 2ZXFA 3DFUA 1DQNA 3A0HU 2ZIWB 1JSXA 1Y1QA 4JYCA 4NESA 4QWWA 4FSXA 4BNYA 5CA0F 5L95A 1TTQB 1YA6A 1YH3A 4RTKA 2WF5A 2IYPA 3CB2A 3T1VA 4ZZIA 5BNIA 9ICHA 5HW0A 2JFWA 2IWHA 2XBLA 3K09C 5F5XA 1HC7A 2RJ3A 4QJIA 5ALQA 1SKRA 3OLVA 4KVAA 4F4FA 1UPUA 3RS7A 1TI7A 1HBJA 1R6XA 1I2BA 4R66A 2HK7A 1UKBA 1E3TA 2I99A 2YN2A 1U2GA 4NCXA 2XYHA 4MDHA 2WJPA 4ZT5A 5YASA 4DDUA 2FR0A 4E2FA 1GGKA 3VOTA 3BHJA 3AB7A 4PZCA 2Q62A 2JFHA 5TLSA 2WJWA 3P0HA 1A4UA 3PKJA 5LDGA 3WGIA 2UZAA 4XTRA 3D3JA 4JY7A 3LQRA 2ZI9A 4L57A 2QUAA 2F1IA 3KKMA 3RVKA 1E99A 2J0UA 4EY5A 1EM8B 3DV2A 1VHTA 4YJ2F 3PLAE 1HYQA 1YL5A 3C3CA 4EKGA 4LF8B 3AVYA 2ZE6A 1T2FA 4BIMA 4IHAA 2R00A 3HY3A 3QELA 4TSFA 4FW9A 3UXMA 3CJTA 1N0HA 1A69A 4A8PA 1QLJA 4FGUA 5HMLA 2A5DA 1KTQA 4WLUA 3RIEA 4CKWA 5HIKA 2IJGX 3CG0A 2WUWE 3KJGA 4LZPA 4MZXA 5B3KA 5IJ9B 2IUTA 2CUKA 3K71B 4OJNA 2C82A 4I81A 3GLHE 1KJQA 1B76A 1MXHA 1TNDA 3LX8A 4ELTA 1ONSA 3QK7A 4JX8A 1E3QA 5EESA 4A8HA 1N6HA 2KKPA 4UBBA 2OORC 2XV1A 5IZCC 1KWKA 1HT0A 1U0NA 2RGEA 4B4UA 2ZYWX 1QH8A 1SA0B 2A8YA 1PVOA 5EP1A 2E1FA 1RZUA 3UAYA 3OE4A 2I3DA 1UFRA 4KEAA 5BUZA 1YZTA 4CIAA 3OZVA 1MOPA 4OLJA 2D4HA 4B6OA 2A5FA 3VR5D 2YASA 4KQKA 2Z2IA 2EFJA 4E7OA 4UDXX 5KJFA 2DEUA 3GGDA 2PLNA 5E4TA 3UC9A 2IQ5A 4MULA 2DT5A 2Q45A 3MF4A 4O4JA 3SS8A 4C06A 2HCBA 4QFCA 2W04A 1BNCA 1WXQA 3LL7A 3HDQA 5CG1A 3NW9A 4WK2B 1JYSA 3H3FA 4WXHA 2W3SA 1OGYA 1W85A 3I2FA 4XM0A 1E8MA 3DT6A 3PGKA 4IQUA 5FWAA 4QWEA 2O1XA 2QUHA 2X1MA 3TW4A 1A98A 1OFTA 1UIMA 2HREA 2HNKA 1OYYA 2P3SA 2VPYA 3EOZA 3FBWA 2V7QA 3HH8A 3PGA1 1CY1A 4HEHA 4FKBA 2H2HA 2C7GA 1BE6A 2G9RA 1H0KA 3G8YA 2Z8YA 3NDIA 5LR6A 1XLTC 1P44A 2MSWA 2DMRA 1XTPA 4RIGA 4ZREA 4AZWA 4HJXA 4EL0A 4ZIRB 1UP4A 2VUIB 4D96A 3S29A 5CVUA 3AKYA 1ZI9A 3BJZA 3VPHA 1NK7A 4HKTA 4D42A 5KUTA 3H0RB 3N76A 2P6MA 4P2BA 1ZIXA 3SC2B 1E2QA 1DT3A 2DSNA 1SY7A 2X5NA 1T5HX 1UZLA 2HA4A 3DTYA 3IDAA 3UV6A 4DCTA 3CEHA 2KOBA 2Z2ZA 3LQKA 3LXXA 4CRWB 1CI4A 1Z3EB 4L8GA 3HPOA 3UJDA 1SHLA 3EG9B 4DHEA 5JCZA 4W8GA 3WX0A 2FUEA 2MSEB 3PXDA 3TQ1A 1W4CA 5HCUA 1DAOA 1YHZA 2VZLA 1BOOA 4WERA 4BGEA 4XB1A 3M6FA 1T8SA 4TL6A 1VLJA 3UHAA 1E6EA 5C5IA 1KH3A 1GPWB 2BTQA 1RFLA 2IIQA 1S0VA 4KFTA 1B8NA 3NIWA 5AOBA 4Z4EA 5TZVA 2IUEA 1E2GA 5FH9A 4LK2A 2O50A 3R1IA 4KQ2A 4FS2A 1YA4A 1YZFA 3PZBA 3NAZA 5K6TA 5I9IA 3ESYA 4QZ8A 1VKRA 2JL1A 1IYZA 3SMVA 3WIBA 1L8XA 1PWEA 4Q1DA 4JLNA 4QUGA 2EWWA 4IDFA 3C5GA 1NYTA 1M2OA 3OF2A 2YMPA 2IBTA 1BO6A 3GNTA 1X8JA 1ORWA 5AJUA 1KJNA 2NTNA 1GG2A 2Z4SA 1ZXBA 2D3DA 1YBHA 4W82A 4L22A 3TNLA 3SICE 1AM4D 3G6WA 5GJWC 2GLXA 4QQNA 1W36B 3TYXA 5BR8B 1LSSA 1YJBA 2PJUA 2VNJA 2WHQA 4OQFA 4IIYA 1ZITA 5LN1A 4AX4A 3FUTA 2NO1A 5ULLA 3RK0A 4EB6A 1JEDA 5HPYB 1CUFA 4LVOA 3C1TA 4R83A 4U39A 4P5PA 1AIPA 5ALEA 4AXBA 3TSCA 2WPDD 3RR7A 3JQ8A 4PGFA 4RTSA 4AKIA 5EWJB 2OXEA 4ZQBA 2XIJA 4DB4A 5C31A 1HKUA 1NQUA 4AUNA 2KN7A 1N7JA 3FPGA 4G5FA 4UFOA 5TMPA 4HDOB 3RFUA 4YUXA 4IDHA 4C7KA 3N75A 2R7KA 2KSOA 1G8PA 3T35A 4Z1MD 5AW6A 1E0SA 3O3NB 4O08A 4BV8A 1NR7A 3L43A 4LI0A 4ECRA 2C9BA 2GUWA 3FCAA 3PTLA 4P53A 3N28A 2VJDA 3G9TA 4N0MA 2NRXA 3V8QA 4ZAWA 3UOGA 3C6QA 3PR2B 2V74B 3GVPA 1U7XA 3SJUA 1P5JA 4RQ4A 3R0VA 3OZSA 2Q99A 4CMGA 4OKNA 4Y2SA 2WTEA 3RT7A 4KLNA 1Z8FA 1AROP 1X1TA 1T10A 5DYWA 1BHO1 4PSKA 3VSEA 3WHKA 5JZSA 1ZMOA 1FX0B 4N3AA 3TW0A 2PX8A 2PUHA 1C0IA 2GFQA 3PJRA 3BD8A 4YP1A 2P2SA 2QTHA 4WKPA 1WZEA 5ENDA 3WGZA 4G9EA 4S05A 3HV0A 3Q5EA 1CT9A 3PQ4A 4N41A 1NDQA 2RONA 1O9GA 3NKLA 4BNVA 1N3YA 3N59A 3BGWA 1QQ6A 1T3NA 2B5OA 3QF4A 4M0UA 4TV8A 5KVQA 1RXEA 2JLQA 4EHBA 5EIWA 4ZVMA 5DLDA 3RFTA 5C35A 1C3OB 2C1XA 2J87A 5HTOA 1GEEA 4YO7A 3MAGA 3L3BA 2WDPA 3RSFA 1EWKA 3E05A 2GARA 4M36A 1G41A 3U7HB 1AS0A 3IHKA 3KSDO 1NNI1 3TQOA 1ZQKA 4A0GA 5BNZA 5KG4A 2BT4A 2GAJA 3HXMA 5IKEA 2C4UA 3FMFA 4Y6SA 1Q57A 1BX1A 1SVMA 2X41A 5L8VA 1RLUA 2UUBB 2BM9A 2OZPA 3RTAA 4WOJA 5KQSA 2OBYA 4KLOA 4LZJA 1L8OA 2EZTA 2KJQA 4FJ1A 1DAPA 1Z0IA 4MTCA 3HKCA 4PH5A 3PNCA 1DWOA 3IVXA 4WLNA 2REXB 2QE6A 2HX1A 2IU3A 1U2RA 2IYTA 1C4XA 1SIUA 2F3QA 3IMFA 4GICA 5AVVA 5D5PA 1U0FA 5KTQA 3IJRA 4QGHA 4PGAA 1J42A 4FO6A 4QOGA 4RLHA 5F7ZA 3WNZA 1V2GA 2XADA 5HQTA 1I1NA 1Z13A 2BSAA 4QLAA 4Q16A 2X76A 1S1CA 2W6OA 4MAMA 4OHXA 2H2GA 3UT0A 1PGJA 2PKEA 1H9BA 2IE0A 3ES9A 3RS2A 3P19A 1DIOB 2D0DA 2GZ3A 2AUTA 3EW9A 1HFKA 2I2AA 1OHHA 2WQZA 4XGIA 5D6OA 3PE6A 3V6HA 3WP1B 1JHDA 2VTBA 1FDWA 4EFMA 1T0BA 5KYYB 3AY7A 4WH0A 4PHGA 1D7OA 3CX6A 2RIRA 3MGAA 3WC4A 5IJZA 2YB4A 7ICKA 3D0KA 5GGYA 8ICIA 1CNMA 1PW7A 1T91A 2OL4A 4INZA 1X6JA 3CBGA 4Q4DA 1OXMA 3VO2A 3LPNA 3OEEA 4DYVA 5FBWB 4RABA 5AK3A 3DPSA 3C24A 1IN5A 3D5TA 5ALJA 3A0BU 2ZJFA 3ABZA 3GIKA 2QV0A 3JQBA 2HQRA 2DBVO 1JA1A 3FCXA 3GJ6A 4Y67A 3NALA 2AJCA 5HHIA 1X7DA 4R3WA 5FB3A 3ZX5A 4CLOB 5CRXA 3IX7A 3OJCA 4B9VA 2JLYA 1IY0A 5EE1A 1I6KA 2ZP1A 3B6IA 1E1YA 2IP2A 1KI9A 1WF6A 3K94A 3O8LA 4NNOA 4EA6A 1MPTA 2I7VA 1R0KA 4OG2A 4PR0A 1DQPA 2HA7A 4DG5A 3KZMA 2M9MA 3C4JA 3CPHA 4LBZA 3WXMA 1VL6A 3HVIA 3EIUA 4D02A 4X64B 2GHQA 3LYLA 1P3DA 2J7KA 3OHPA 3Q9UA 2HBYA 3GLGE 1NE2A 3MJCA 4H4EA 3IN5A 3R5KA 3BG5A 1CJSA 3ICVA 5CVJA 5EJEA 1HLFA 4CLOA 5ARBA 5IXJA 2JA1A 4KMUA 2AK3A 3D3NA 1FJGB 3B89A 3EGXA 3KHKA 3T3GA 2RKOA 1R15A 3E15A 1TYAE 3MMNA 4O4HA 5DDMA 4WJKB 4B9MA 1RMQA 3ELBA 4BNDB 1Z75A 4R8SA 1CF9A 5DQHA 1A88A 1FTNA 5C3UA 5ALUA 3WSWA 3B2NA 2GN4A 1WUIS 1UC9A 3GOHA 1JAYA 4EEYA 4D44A 1TKAA 2G1JA 2OUIA 5JARA 1SH7A 2G3YA 3WU2U 1GPKA 3PIDA 1A9YA 5IBRA 4JI2B 3LRXA 2O54A 4NOLA 5D00A 4K87A 1U4NA 5REQA 2AR0A 3EQ8A 5BWBA 4OREX 4PLPA 2Y1FA 5MN6A 3VRHA 1LKYB 3EUAA 2J08A 4DJFC 2BJVA 1U6KA 1USVA 2BFOA 2J5XA 1MVNA 3CTMA 2NW6A 2WB4A 3I2HA 3IB3A 4FNAA 3HZZA 4KW7A 3OMWA 2VBFA 3ZGXA 1A5ZA 2FMTA 3DXYA 3IVCA 3KUUA 2Q4TA 3FTCA 3NRBA 1PT8A 4I2EA 3G88A 3HL0A 4PYIA 5JECA 4IUYA 3O83A 2BCVA 3GEHA 1TT7A 2JH3A 2HTEA 4L0QA 2ZTLA 5CBPB 3MR3A 3ZUGA 1Z62A 3REOA 1WPQA 4KP7A 4RTLA 3NFYA 4IVNA 4HNGA 1NPTO 2J0EA 4MMYB 2PVPA 3DMRA 2VPXA 4QU5A 5TIIA 2ZANA 3HNRA 2JV3A 3ZWYA 4S24A 2QLLA 5AJHA 1JI0A 3P2IA 3B9QA 1KU0A 2I65A 1Y8RB 1A9TA 1GPUA 1GDTA 3FHTA 1ISJA 1N2XA 1XEXB 3DEYX 3ZHRA 1DV1A 1ZEMA 3PUYA 4CNBA 3MCTA 5LJIA 3VPXA 3GG9A 5K99A 5LPNA 3DOJA 3K5IA 4I46A 4MB2A 9ICFA 1B6GA 4DQIA 5KYUA 1J8DA 3M6LA 3UV3A 4FT4A 4LKOA 3X43A 4V1CA 3ZU5A 4NK4A 3VR4H 2B34A 4MV4A 5AVTA 2ZSFA 2X2OA