1NNLA

Crystal structure of human phosphoserine phosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
205
Chain Sequence
SELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
publication title High-resolution structure of human phosphoserine phosphatase in open conformation.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 205
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1nnlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1nnlA01
1QQ7A 5AI9A 2G80A 3W5DA 4YCMA 4Y2QA 1ZD4A 3QX7A 2AH5A 5AM0A 3R9KA 4RESA 2C8LA 3QLEA 2ODAA 2O2XA 3QU7A 4Y2SA 4CE6A 5ALGA 4XE5A 1RKUA 3QGMA 4YCNA 2HCFA 1L7PA 2VKQA 4NABA 4AS3A 4DWOA 2WF9A 3J7TA 2R8EA 5AW4A 4OFZA 1RMQA 2C88A 1RKQA 2WHEA 5AW7A 5AVWA 4BBJA 5AI5A 2D2VA 3QYPA 3KBBA 2I54A 5ALRA 2FI1A 2WF7A 5AVUA 4IG4A 2HF7A 4YIHA 2BDEA 1TE2A 5AI0A 2JAUA 2FPSA 2HX1A 1TA0A 5ALMA 1Z4PX 5ALXA 1Z4KA 2YJ5A 5ALWA 2P11A 2OYCA 2B8EA 1L8OA 3L8GA 3OCUA 2BDUA 1Z5UA 1WZCA 2YFYA 5FP0A 3HYCA 4G9BA 3UM9A 2RAVA 5AVTA 3WK5A 3SMVA 1XP5A 5ALNA 2EAUA 2YJ3A 2C8KA 1RMYA 5AKHA 1Z4NA 4Y2XA 3KDPA 3KC2A 1EK1A 1YMQA 3B9BA 2PKEA 3QU2A 5ALZA 2I6XA 3OCXA 5AM3A 2NO4A 3IJ5A 4Y2YA 3ZUPA 5AI4A 1WR8A 4HAIA 3MC1A 4UMFA 5E0OA 2FPUA 4O8CA 3DDHA 1U02A 2G1AA 4Y2RA 5ALHA 5ALLA 2CN1A 1ZRMA 3NALA 4UAVA 1RPZA 1RLMA 1Z4QA 3OTQA 3QU4A 1U2TA 4EZEA 5AK5A 2NO5A 5AI6A 3ET4A 2GMWA 2BY4A 5T41A 1X42A 5AVQA 4Y2PA 4AS2A 3ZU6A 3U7FB 3QUTA 3WKCA 2YMLA 2I7DA 4DFDA 4CF5A 2I55A 5AVYA 3L8EA 1YV9A 2OM6A 2YN4A 2RBKA 5ALOA 2NYVA 2OBBA 3RF6A 3PGVA 1AQ6A 2JARA 3FGOA 1L7OA 4UMEA 1QH9A 4KN8A 1N9KA 3L0BA 4CNQA 1TJ4A 3SLRA 3FZQA 4KNVA 4BNDB 3PDWA 3W5AA 3L7YA 4BNDA 3U7EB 5JJBA 3NAMA 5AW9A 3AR2A 3AR3A 4QJBA 4ZEXA 3EPRA 4EEKA 2ZG6A 1RRCA 3IRUA 3OCYA 3ZVNA 4GXTA 1ZD5A 2YY6A 3A1CA 3QU5A 3SKXA 4BX3A 5AKXA 2YMMA 5IT4A 4YIKA 1Z4LA 3B8EA 2ZBEA 3CNHA 3N8GA 1YNSA 3WKEA 2JAOA 4J2TA 3L0YA 4BKMA 5AW3A 1EK2A 1O03A 3ZTWA 3B9RA 3AR8A 3BWVA 2O9JA 4MWOA 3FPSA 4DCCA 3U7GA 3AR6A 1RDFA 4Y2UA 3P96A 5AW2A 3F9RA 2G0AA 2W11A 2P9JA 2MU1A 3MPOA 3BA6A 3I28A 1WVIA 1Z4MA 1QQ6A 2MSNA 1VJRA 1Q92A 4BX2A 2IOFK 2ZOSA 1Y8AA 3M9LA 3ESRA 5ALVA 1NNLA 1QYIA 2WF6A 3I76A 3AR5A 4NFLA 3WKBA 4CF4A 3OPXA 5AW8A 3TLMA 4YH1A 2CFSA 4UARA 5AHXA 1U7PA 5AKJA 3ZVMA 3NIWA 4BYGA 2FDRA 2RARA 3U26A 1YS9A 5AIBA 1RKVA 2Q5EA 3OCVA 3I6BA 3WK6A 3ZWKA 1U7OA 3W5CA 5AM5A 5AM4A 2GFHA 1XPJA 4Y3UA 3FVVA 3SHQA 4L6AA 4OD0A 3MN1A 3L8FA 3IB6A 5ALUA 2ZXEA 3DV9A 4HGRA 4IFTA 4L6CA 2PQ0A 4MUMA 2G09A 2W43A 3R4CA 2HEGA 5AVSA 3EWIA 3QNMA 2OA0A 1MH9A 4UU0A 5ALTA 2FPWA 4FFDA 4EENA 1J8DA 1SWVA 1T5TA 1IWOA 4NAVA 1NF2A 3OCZA 5AK4A 2HI0A 1RLTA 3PGLA 4NV0A 1L7MA 3K1ZA 3ET5A 1N8NA 2ZBDA 4AP9A 3KD3A 3SD7A 1CR6A 2GHTA 1ZD3A 3QU9A 4RETA 4BEVA 5AVZA 1RLOA 4YCLA 4F71A 3UMCA 5AESA 4UM5A 2B82A 3I1YA 2PR7A 5AM2A 4UW9A 1KYTA 4J03A 4ZEWA 4FYPA 5ALDA 1YDFA 4EELA 3ZI4A 2P69A 3KOOA 1K1EA 3ZTYA 3VAYA 1S2OA 4NWIA 3U13A 1Z88A 1ZRNA 4UASA 3FPBA 3WK7A 5AW5A 4KX3A 2AMYA 2GO7A 3E84A 1TJ3A 1FEZA 3CZ4A 3KZXA 4KNWA 3WGVA 1SU4A 1Z5GA 1TJ5A 3E81A 3NASA 4OHFA 1RQNA 3N1UA 5AKZA 4Y2JA 1XVIA 1YJ5A 2WF8A 5AIAA 4EX6A 2G07A 3WGUA 2FPXA 1O08A 1VFPA 4BEWA 1L8LA 3AR4A 3R09A 4I9FA 3FM9A 2IA5A 4FE3A 2IOFA 3DNPA 2JGAA 3EF1A 5AKIA 2DQSA 5AM1A 5ALIA 2FUCA 5AKYA 2C4NA 2YBDA 2B0CA 2W4MA 4C4SA 3EF0A 1Z4OA 4C4TA 2R8YA 3N07A 5AKEA 3ZVLA 3N28A 2HSZA 2YJ6A 3WK9A 4KYTA 3WK4A 3HLTA 2HOQA 3L5KA 3ZW7A 2GHQA 2I33A 4HGNA 2ZBGA 5AKLA 2B30A 3L8HA 1L6RA 1F5SA 1NRWA 2YMQA 1T5SA 1WPGA 4G63A 3UMBA 4E88A 4UU1A 5AW1A 3ZWDA 3AR7A 2HDOA 1RQLA 5AW0A 2YMPA 3RFUA 3AR9A 5AI8A 3QXGA 3WKAA 3GYGA 3QUBA 2ZBFA 5AVXA 3OCWA 4Y2TA 4HYTA 5ALFA 3A3YA 4I9GA 3S6JA 2CFRA 4HGQA 4UMDA 4OCZA 3DAOA 2RB5A 4YGYA 3ZX4A 2B8JA 1L7NA 1ZD2P 5AVVA 5IT0A 2B1QA 3U7HB 2I34A 3QUCA 2FEAA 1T9ZA 3UMGA 2AGVA 2YJ4A 4PNHA 5AVRA 1PW5A 5AKGA 3NANA 4JDPA 1Q91A 4CF3A 1CQZA 2CFTA 5AW6A 4UATA 4HGPA 3ED5A 1Z4JA 1J97A 3A1EA 4XPZA 2P27A 3ONNA 4F72A 1RC8A 2WM8A 5AK3A 1ZJJA 2Q4TA 2HF2A 4UM7A 2IYEA 4XQ0A 1VJ5A 2EATA 4XOUA 2HO4A 3WKDA 5A3QA 4DW8A 3MMZA 3W5BA 1SWWA 5ALQA 3SKYA 3U19A 1U2SA 1ZS9A 3NUQA 3NRJA 2G06A 4HGOA 3PCTA 4EX7A 1LTQA 2AUTA 2QYHA 3A1DA 1JUDA 5AICA 3ZX5A 4ZEVA 3E8MA 2JAWA 3N5KA 2IOHA 3WK8A 5AK6A 5ALSA 5IS2A 1RMTA 2HHLA 3D6JA 4BX0A 4UMVA 2WF5A 2FUEA 1QQ5A 2C9MA 3QUQA 1ZOLA 3E58A 5ALJA 5ALKA 3L1UA 5ALPA 3M1YA 3L0CA 3ESQA 2B1RA 5A3RA 2QLTA 4Y2VA 2WFAA 4GIBA 3L1VA 5A3SA 4H1WA 2R8ZA 4UAUA 4L57A 1LVHA 1Z4IA 2Q4RA 4C4RA 2EARA 2R8XA 4KX5A 2G08A 1S8OA 4QQFA 2FPRA 4JB3A 5AKKA 4B6JA 2X4DA 3SF0A 5ALEA 5ALYA
chains in the Genus database with same CATH superfamily
1XYVA 4KN9S 4G5SA 4ECTA 3QXCA 1P1IA 3PO4A 1J8VA 2PWPA 4MQLA 4FHDA 1JR4A 1UCVA 1G41A 4CL3A 2GXUA 3U7RA 5C7IO 2IHKA 3TSWA 3B89A 1BXRA 4HJXA 1QQAA 2O7VA 2F9FA 1D2MA 2HWXA 1FYVA 2DG2A 3NVAA 1U3WA 4MFAA 4AP6A 5DQHA 2CBGA 4E3ZA 4QYTA 2WKQA 2P0AA 4KO2S 2Y2VA 3DEZA 4E7PA 5MHTA 4MVJP 2PEZA 1CUVA 3MC1A 2E5FA 2ZWPA 2HHJA 4GFDA 1SN7A 1BTOA 1IEXA 3NHRA 4BJ5A 4M49A 2FVXA 4JUBA 3TQCA 1X9IA 2G9ZA 3HKZC 2JCSA 1VI5A 3ZY6A 1Q6ZA 2NQ2C 1EX7A 3WO0A 2NAPA 2C2YA 2WKWA 3E3NA 1W0JA 2VN8A 2I2WA 5JS1A 4DJAA 1P8AA 2G70A 2OBNA 3S1AB 3K9NA 3F4BA 1GSAA 4BTEA 4TM7A 3B8EA 3AIMA 1DGJA 1E5TA 1G17A 2QE6A 3B3QA 5G5HA 2H1LA 3OMWA 3WL6A 4H1UA 5DRTA 4F97A 3BWVA 2HTFA 1GZ5A 3B6MA 1NJ8A 4JP3A 4ZJPA 5AW2A 4B4KA 1J0CA 2QBYB 1B73A 4U7PB 2CJYA 4M47A 1KA9H 1HE2A 3CRRA 5EWGA 1ZMXA 2FZ5A 2WG1A 5DBIA 1TU0A 4PAWA 1T13A 1NQVA 2VAVA 4IXWA 4OIFA 4JNKA 4ND2A 3UHJA 4CU5A 4R2HA 1JIHA 2O19A 1HMPA 3QKRB 4CIWA 4JL5A 3EGEA 3HSKA 5FPKA 5BSRA 2W93A 3WRXC 4L5JA 5IAOA 1ZH2A 5AK4A 4LY9A 3NR2A 4J9PA 4MVJA 4NEHB 4R1MA 4R1QA 4JXJA 1P2SA 4RETA 3ZHXA 4QD3A 3N0TA 4LJ6A 3PQ8A 3AY6A 1U7HA 3COVA 3OJXA 4MUJA 2IYWA 4MQMA 1ZCZA 3HJEA 3OQBA 2OHGA 5D5QA 4MKRA 2VDNB 4O9MA 4JITA 2DH5A 1WXIA 1RI4A 2KKVA 3CF4A 3UA3A 4F5NA 1ZLXA 2ZSFA 5JARA 3B52X 1ZSVA 1K5PA 3WLAA 1XO0A 4B3TB 3AO0B 3IBGA 3VXKA 4MROA 4RNDB 5DGBA 1CV2A 3LF1A 3WRYA 5AR1A 2FUCA 4MWZA 3U9TA 3AUJB 4IL5A 1HYGA 2C31A 3AH8A 3A3NA 2WLSA 3DQQA 6PFKA 2QUBA 4UD2A 1F5SA 5LYJB 4MV3A 3MRTA 1SRRA 2LKDA 1E3MA 2BFAA 3Q7EA 5FI3A 5TMPA 1P0FA 4QE3A 3H8MA 3URKA 2E4WA 1M1YA 4CMKA 1LRLA 3DM5A 2Y9TA 4LTDA 3DTVD 2CF5A 1N3YA 2IBKA 4E4YA 4S1NA 1SBZA 1SVKA 5JDCC 1ZJJA 4KBGA 2SKDA 3I9KA 4F4FA 3THWB 2CXQA 1RPTA 2CE7A 2UUCB 2FG6C 4LBVA 3ASYA 1U2DA 3I2GA 1ESDA 3A6DA 3LPLA 3T99A 4TKUA 3ADCA 2XNSA 4R8LA 2QLTA 1KEEA 1TIKA 2EDUA 4RZ2A 3TRJA 1TK5A 1I5EA 2BJHA 2JBAB 4U9UA 2QRQA 1GUZA 3GIIA 1E6UA 5GGYA 1KI3A 1YDWA 1MH1A 1MDFA 4TL6A 2G5TA 4DWOA 2QTHA 5T3YA 4DS4A 4WFIA 4YGXB 4IJ5A 4B4DA 4QYMA 5J0YA 5ALMA 3E53A 2NIPA 1E2FA 3SEFA 1S6YA 8ICLA 3TAHA 2O8EB 4EYOA 5CYFA 5FP0A 3TLCA 2NU6A 3UM9A 1BROA 2PKRA 3MFHA 2IP1A 4HLUC 5GIPE 4EG1A 3QLTA 4TX1A 3ZV4A 1EK1A 2CJWB 3GRRA 2G8LA 4M4SA 8ICMA 3F0TA 4EHLA 1RZRA 1XK6A 4II2A 4IFIA 4KJZA 2G40A 3OTOB 4ELTA 1LDYA 2FZWA 3WQRA 3T79A 3SYZA 5BW5A 4M0EA 2UAGA 2WYWA 3P9PA 5LNK6 4AS1A 2CDBA 4FQ5A 4LY0A 5LDDC 1YGPA 3DW3X 4RDXA 2FN9A 2ZJ8A 1AB6A 1SUEA 1X94A 3NWPA 5CEFA 3TNJA 4G85A 2GRAA 3RFVA 3HFGA 2HRRA 1MBZA 1N0VC 3ZWPA 1HQYE 3C2KA 3EZGA 2QK4A 3ZTWA 1FB5A 3G6WA 3S40A 1O94C 2KK0A 4M7OA 4OHOA 1G59A 1MN8A 3UGQA 3SMQA 2JGMA 4PCUA 4K8RB 4RENA 4Q00A 5CIYA 3GCGA 3COSA 4KV7A 2I71A 3HU3A 5K8IA 3HFSA 2QEQA 1XZMA 1DAKA 1CD5A 2CLFB 4DM3A 5BOLA 3RS2A 3MJRA 5HVNA 2ZJBA 3RTDA 2NV0A 3RQIA 3LXUX 1YE5A 3BERA 4IFTA 4G1EB 3LO8A 5LZ8A 5HQ3A 2HBJA 4Q1VA 2FZKA 4QECA 3GJSA 3IRVA 2RFLA 5I8ZA 1SXGA 1PKEA 2Q2VA 1ZKMA 5KREA 3OJ0A 4BNNA 5AVZA 1DIRA 1QB8A 4L4ZA 4R66A 5L7TA 2C5HA 1VLHA 1NQOA 3VKFA 1R0KA 3Q3JB 3OAAD 1S2IA 5CT5A 1DUVG 2MMGA 2DTXA 2PT7A 1E3DA 4ZD6A 2YVLA 3MPUA 3NGDA 1KQOA 4EHKA 1NLMA 5EVCA 2X8BA 4PU0A 3OE4A 1COWD 4PPQA 1L4UA 3TFSA 2XYQA 2O7QA 1KI9A 3N1UA 2LCIA 4IIEA 2XNHA 4B40A 3DD1A 1DL5A 5HJ5A 3U9LA 2PRJA 1L5SA 1YMVA 4YXMA 4REQA 8ICYA 4FHEA 1XMVA 2M6LA 5H02A 1GU1A 2Z56A 5B12A 3UWMA 2EFCB 3MWEB 4W63A 1Q1GA 2ABWA 3IV6A 3VU9A 2GXSA 2GZ1A 4ZHQB 4WACA 5BN5A 2UV8A 2XDQB 3ISCA 1JH8A 5JPDA 4EGCB 3LXRA 1GL7A 4QFBA 2VIXA 1CE8A 5H3HA 4Q0MA 4IGAA 4A8JB 4RKQA 1H2WA 2C7QA 3K31A 3ZY2A 2X40A 4GL4A 2BI8A 4CLRB 2KW5A 4GKJB 1L5QA 2OL4A 1U8YA 5CHGA 3GGJA 3LC7O 1IQUA 2HGSA 1B2RA 5AK3A 3CZMA 3ANLA 4D4LA 3ZGXA 1EM6A 2L5YA 1QRSA 2XAUA 1T3QA 5TQJA 1ULZA 4MIYA 1IHYA 2IDJA 1AMNA 5EHNA 2EW2A 1UANA 4RULA 2FUEA 2ZT7A 3M6WA 4DN6A 1X9XA 5C32A 2ZVDA 2WTXA 5SZKB 3AC0A 3WIBA 4Q44A 3BGIA 5L1MA 1EFDN 2LXNA 2LGJA 2A3NA 2NYRA 4DBLC 1YB5A 5HIIA 4MYHA 3LDFA 1YZTA 3QHQA 2D4HA 5TMDA 2QT0A 1ND6A 1GV0A 1XROA 4HDRB 2JRLA 5KWVA 3M3PA 4PYJA 1SBIA 3ZNPA 2DOKA 2B25A 1ORDA 2IZ5A 2CLHB 1E64A 1FJXA 2CNBA 1J5XA 2OBYA 4MVXA 1UCFA 3OO0A 5LKAA 1VKOA 4PQEA 1X7WB 4LA4A 2ZS7A 5BV1A 1XA4A 2HK9A 1MRNA 1JB9A 3RCBA 4OKNA 4DSNA 2P35A 4XIFA 5EG5A 4HTFB 2PNJA 3E5MA 4MQBA 3DE2X 4IEIA 4Q37A 2P9QA 5A05A 5DCLA 1JXLA 2Z4RA 4L8WB 3KIPA 4A9AA 5IH7A 4DG9A 2IIQA 4YCJA 4B3SB 4OJKA 5E7MA 1H2EA 5B1YA 3L7YA 2R7KA 2UYOA 3HXOA 1PJCA 3KAPA 4TSRA 5B4VA 4QNRA 3O1IC 2CLMB 2VBGA 2ZETA 4WXYB 1NSFA 5LIRA 2FETA 3KQHA 1R64A 2AFIB 1EFTA 1ZUHA 5DB8A 5LP6A 1S5LU 1RM3A 4M38A 1WXXA 3P9RA 1W35A 5DG8A 5JFGA 5A62A 2PPVA 1QE3A 1RWNA 521PA 4BFCA 1XVAA 1VMDA 1Z29A 1B15A 2OQVA 4DEXA 1NUPA 2GBCA 1BVRA 5IM4A 3OM0A 1Q95A 3GEEA 3NTLA 1CQIB 4PYIA 2AKAB 4DG5A 3HKDA 4ZVLA 2OCKA 1FBTA 1GAXA 2J3HA 4PGMA 3JAKB 3ZIDA 4I0WB 2QQFA 1QLWA 3LZ6A 4OP3A 2HHHB 2QF7A 2QRVA 4EATA 1Z5PA 3QEBZ 2QJWA 2W9BA 1GU0A 1VB5A 4H6WA 4WESB 9ICSA 2O5EA 2FCRA 1B1AA 2PR2A 1K5OA 1G1MA 3S2FA 3VR5D 5DGHA 2WSYB 2VH2A 1L7QA 3U60B 3KD3A 3CJTA 4IH4A 1ZD3A 3H3JA 4DR3B 3AIKA 3UMSA 1QH8A 3SPXA 4L75A 2MIIA 4EH1A 2AWOA 3BJZA 3E9ZA 4EJSB 5KT4A 3VOBA 3KJXA 4MPDA 1KVTA 4BTVA 5LU8A 4Z8YA 1QIEA 2ASVA 1VGRA 5BN1A 5HJ2A 1TJ5A 3LX8A 4I2AA 1U2GA 3E48A 5B2EA 3RC7A 3NHMA 2RJNA 1KJZA 4FGWA 1II9A 2W4MA 3K6KA 4QDJA 2QX6A 5JZBA 2GZDA 5ARCA 1YVDA 3WV4A 4E88A 4EUKA 3IT0A 3TGPA 1FBNA 1QDLB 2PRKA 1JFRA 1A8UA 3ENVA 1DGSA 2W6JD 1DCMA 4Y9SA 4JUDX 2WAQC 1KY5A 2H2IA 2R62A 4F2GA 3O94A 4JB2A 2E1FA 1OAOC 1Y42X 1JJVA 2Q9CA 4G8JA 2HWYA 1L4LA 3IXLA 1QVZA 1N5MA 2AYYA 2R1TB 5LXTB 5IN4A 4BZWA 2X5NA 1NFRA 3PXUA 3UUWA 5LQMA 1F1JA 5ESDA 3FETA 3GGSA 4V03A 3VHXB 2JKYA 1IOVA 5LJLA 4E30A 1ZOLA 3IMFA 1YUNA 3UMVA 3NNDA 2PL5A 4IXTA 1TF5A 4DABA 2A8YA 4O5AA 3GNSA 5IJ0A 1KDYA 5JJCA 1SBCA 1JLRA 3MGBA 2RP5A 3DEFA 3EQ9A 3DBLB 3OKCA 5C8VA 4RF4A 4TMXA 1EXWA 3SAHA 1LK5A 1TDJA 3SS7X 2AEJA 2J5BA 1UBUS 4CN9A 2P9BA 3OZUA 5EJMA 2UDPA 2O1WA 3WGTA 4DQSA 4V2IA 2PXIA 4LZGA 4D0LB 2YFYA 4MNTA 4QJ5A 4CKWB 2B6HA 2IBSA 1ZQSA 4I2BA 3TADC 1ZQ1A 1SCNE 4G1FA 2A86A 1U0BB 5AM3A 1T2FA 1XCJA 1ZGHA 2X2PA 8ICBA 3AEXA 3SR6A 2C95A 3A9WA 4BFWA 4I3GA 5CNIA 4GOMD 2W6IA 5I7UA 4WOCA 1MX9A 4D96A 3NALA 4GLOA 4K4GA 1ADYA 1ZAYA 1KH3A 4FYVA 3PQEA 3CNNA 2ZP1A 3O26A 2I7DA 2JLZA 2TS1A 2I55A 1J1ZA 2A1JB 4B2IA 1CT9A 4XIIA 3C41J 5KG5A 1U65A 4NARA 1SU8A 4BO0A 4XYEA 3SI7A 2V7VA 3AR3A 4QJBA 4YRIA 3R3XA 5DW0A 3AM5A 1H5UA 5JATA 1G63A 4RU9A 1UDXA 3MRVA 5DYIA 3ORQA 3OESA 3ZJUA 3HVKA 3NG1A 2CC2A 3AKCA 4EWLA 5JTTA 5HCIA 3I9FA 4N76A 3ZIUA 5GM1A 1L5KA 16PKA 2Y4NA 4D9MA 4I9HA 5ALVA 1I3NA 3TLKA 3E05A 5KFNA 5BRJA 4EUHA 4P7GA 1E1QD 4M9UA 1NLFA 5IAEA 4UM9D 4R71A 3GVXA 4RPCA 4JI3B 2ATEA 2V03A 5KG4A 1UFKA 1SVWA 4BQFA 4QRHA 2WY2D 4O3SA 5LLDA 2FWIA 4L9SA 1NBMA 1LQ2A 3OZDA 3OX2A 2QLJA 2Z3ZA 5F3DA 1G3UA 2G5HB 3HDYA 3O3OB 2PMZF 2PVCA 3PNMA 2PN1A 1KEJA 4K9MA 4KFUA 4DL3A 2VHVA 1SMKA 1Y81A 1C8KA 4RL4A 4I99A 3B1XA 3U62A 3GCXA 2NXWA 1GEEA 3Q7RA 3B1WA 1P81A 5EWLB 4MWCA 4J4HA 3E5NA 1FP4A 1DDGA 4Q7KA 1UDWA 5IARA 1BEUB 1CUIA 2QD1A 1ETHA 3E9RA 2PGOA 2XDWA 2R6HA 4R7ZA 3AKYA 1KO4A 4RM2A 2I3BA 3A6FA 4FNOA 4TTTS 4R05A 3M4NA 4QEDA 4OMFG 4BOYA 2HBLA 4UUAA 3ZV5A 3DWEX 3LUKA 5DT2A 1NHGA 4WT7A 3K05A 1JIUA 5SICE 1YR9A 4IDFA 4ENQA 3LP8A 2DFKB 1RI3A 2XRYA 3TZHA 1NN5A 1WEHA 1XXLA 5LYJA 5FOVA 1AK9A 4LJLA 2MJLA 2VT6A 4R8UB 4R68A 2OD9A 3M2PA 3WZ2A 4CMBA 3R5KA 2A9VA 2G77B 2KFNA 1FTGA 4EF4A 4F5DA 2Q5HA 1CYDA 1E4YA 2ZRBA 3PHIA 3IVCA 1PX2A 3PXDA 5IWAB 2WSLA 2VTDA 5DV9A 3ED5A 3AF6A 2FQ1A 5EXDA 3ETRA 3M1AA 1DG9A 2A1IA 2P2LA 1DAOA 1X80B 4UUOA 3EXHB 1SUSA 2P4EA 3EIUA 1VJ1A 1LFAA 2II6A 3T38A 2HHLA 3A9TA 1U8XX 5DWVA 1GQSA 2JHPA 3JWGA 1E79D 3O0TA 4D26A 3KQSA 2EAOA 2GQ0A 2GRJA 2I6TA 1ZX1A 3B0YA 3QVGB 1JMKC 4TKZA 2G80A 2JBAA 5HFNA 2YXNA 1ULTA 2VF2A 3O8LA 1N56A 5KX5F 2B4AA 1I0LA 3QFFA 1P17A 3ZQUA 2ZYUX 3GDFA 4PHFA 1N6RA 3AK4A 4TXHA 2BKUA 2FEWB 1E77A 4H2DA 1H93A 4LE0A 1QAOA 3OJUA 4YFYA 2O8EA 1AMUA 4JBNA 3GMIA 4O3PA 3QPUA 1ZD1A 3QNWA 2V7TA 3HUFA 5JH7F 4BNGA 1O94D 3DFUA 1GCIA 2HCTA 4KL8S 2XOXA 1ORRA 5DSZA 1BVUA 4RW0A 4BLUA 4W99A 4JD5A 3LG2A 5T41A 4MVCA 2OSVA 2OTCA 4N3GA 4OYLA 2ODGA 1K8YB 2R7LA 5CEHA 5LNK1 1KGSA 3TS1A 1PW7A 2NU8B 1OHHA 4TL9A 1T9GS 4Z86A 4NBRA 5DKWA 4DSLA 3U7EB 3KCQA 4YPFA 4MRPA 3HNPA 1GUBA 3NC0C 4KFRA 5KYGA 1FFDA 3TTWA 1JIQA 3UH1A 4DMKA 1WPXA 4IDOA 2XZTA 4DSTA 3BRSA 2DLNA 4O02B 4MH0R 4BJ3A 4F4JA 3MMNA 5HYVA 3OG9A 1NN3A 2X5OA 3N87A 1TCBA 2IEDA 4MP3A 3JVVA 2D54A 4DVJA 3V7YA 3MHTA 4LGMA 4DC0A 2AZTA 3A3PA 4CMCA 1E5DA 4A3SA 3WLFA 3T61A 3WS7A 4X93A 4M8LA 4K28A 2PSEA 1JQKA 3CNEA 2Q7XA 4JEMA 4B79A 4P58A 3I2KA 1TUEA 1SZJG 4RLFA 4BNZA 4C6RA 1QP0A 2F3QA 1SU6A 2VOEA 1O6BA 3JQ7B 2VYVD 5M7EA 3ZQ4A 1J2RA 2DGDA 4G0XA 4MGYR 1I3OA 4MYCA 2CVZA 1MXFA 3NP7A 1LJUA 2A58A 4XR9A 5DSTA 2IXTA 4M1EA 1OQAA 4GMHA 5FDFA 4KQ2A 2EGGA 3EGVA 5D8DA 3G9XA 1HA3A 2RI0A 4BP9A 1Z82A 5G5GA 1E60A 3CVVA 3TNLA 4B8WA 3AVUA 4PJ0U 1F2VA 5JSKA 3F5SA 3GV8B 8ICCA 3AU8A 4GPAA 2QI9C 3CR3C 4EG0A 3OWOA 1DRVA 3UGJA 3IN5A 3ZU5A 5CDFA 2RBGA 3K6RA 4EQZA 2V7GA 2Y77A 2WFLA 1IULA 5I9NA 4TUYF 4J07A 5BVHB 4INJA 1H4TA 4HFNA 1J8QA 3TOXA 2XB4A 4M0CA 5F33A 1E3WB 1G9XA 3L4EA 4NZPA 4Z9FA 4MSUA 5L9XA 4ARZA 3P9CA 3PC2A 3U56A 3WK9A 2FCAA 2N0SA 4B9LA 4ZHQA 2IHBA 3QHPA 3PXBA 2XDQA 1C9JA 3VJMA 3T3IA 1VBKA 4TSFD 2O2CA 5F4BA 1PEAA 4IJ6A 4PPGA 2PK3A 3ZDAA 4K46A 1CS4C 3PNOA 4QTZA 4GLBA 5AVVA 1CPYA 2VF8A 1ABFA 2WAYA 3SZUA 4D8VA 2F43B 3PEFA 1ZJWA 4H7EA 3V1NA 4D4MA 2VRCD 4JYBA 1GADO 3VCBA 1PL8A 4QAJA 4P7KA 1KFKB 1ECCA 5CB4F 2HPAA 5DKFA 1XNJA 4JLKA 4HNGA 4NLLA 1S8FA 1NMEA 1LTQA 5L6LB 1NXOA 4WAUA 3H1AA 1ODTC 5DN6D 3AF2A 1JU4A 3ZE6A 5IFLA 3EF3A 3NHKA 4RTKA 3GPBA 4ZYWA 1JDVA 1UDRA 4P2HA 2NRWA 5KFGA 1BNOA 4QYSA 3DKIA 1Y1KE 3H0CA 4HLDA 5FT9A 1ZMTA 3BCUA 1ISMA 2OV8A 3GUUA 4V0SA 3VPXA 3BXOA 4GPIB 4LWOA 2GJ8A 2YDXA 4KACA 4O2AB 1UKEA 2CLSA 1R0SA 1JDJA 1BYIA 2EP7A 1TMGE 4YCBA 2QQ0A 1PIWA 4DLNA 4BBJA 1OFUX 2M1ZA 3BZBA 4QASA 3ZHRA 4E2ZA 4HDRA 1XFAA 3W5UA 2RKBA 1HE3A 2YICA 3IT3A 1REQB 4Z6EA 3ES9A 3I4CA 4PONA 2XUIA 2PMEA 5CXUA 5SZHB 3SMVA 4HAUA 3GDWA 1E2BA 5JMPA 4BUCA 1RAAA 1M2OB 2QHXA 2H5JA 4KLQA 5CDSA 1GP2A 5KWSA 3VNVA 1YB7A 1ZMOA 2AJLI 3G6VA 4B45A 5CAEB 2GWSA 5ALLA 3PNYA 1TJYA 4PS1A 4RUAA 3H83A 4TS1A 5TDHA 4HTFA 2PI5A 1SEVA 1NPTO 3TRFA 4R3WA 4F5WA 2X0DA 5C4MA 3UOWA 5C52B 3DPUA 4OK5A 3UATA 4LRSB 3NC4A 8ICFA 4H0FA 1H05A 5CA0B 3ZJ4A 4KWHA 3FZQA 4RE5A 2FRDC 1JEJA 4M36A 4FDMA 3IHKA 3OZBA 3WL5A 2JIBA 1GNQA 2DWOA 4BX3A 2HA7A 5IT4A 1HMYA 3OIVA 4CMAA 4UXJA 3SQDA 3I8SA 2BN4A 1Z7WA 1BA2A 2R751 1VMEA 1L3TA 3AEKB 1TT5B 4L16A 4CNBA 1KQGA 2XMBA 3NOVA 1YA6A 1ECPA 1SU7A 5B7GA 4FFRA 2YHAA 5KBYA 3WLKX 3O2SB 2EKPA 4X65B 1TQHA 5KAIU 1CQIA 4HNAB 2XNJA 3BD9A 3K4GA 4W5JA 4JQYA 5AOVA 1BX3A 3JAKA 2GN6A 1T8EA 4KQCA 1FNMA 5IVIA 3BQNB 3WGGA 1C20A 3G7UA 2G09A 4BJ6A 2WUEA 3ABOB 2WZCA 3AOEC 5H1YA 4KSCA 2VCYA 3ZW9A 3KT0A 4Z2YA 3C1UA 2D1QA 7ICIA 4AZ0B 5CYGA 1SBHA 5BUCA 2IV2X 4PE5B 1NVAA 2BZSA 1P5ZB 3Q5EA 2NP6A 3OLZA 1D2EA 4MICA 2ID8A 4NZMA 2O20A 4PVCA 2GOLA 1ACJA 1T9DA 4EJSA 4DT1B 4MA0A 3F47A 3G1TA 4C03A 1N6OA 1KYWA 4PFSA 4PRKA 1L5MA 1OBVA 2ST1A 4L9WA 4B84A 4ITRC 5A7HA 2HFKA 2D2FA 3O4FA 1BEZA 4PLYA 2D2IA 4A6EA 5ERYA 3PJFA 4ZDKA 4KLSA 3U31A 1J2YA 1TYAE 3JYOA 4DDMA 4AD8A 4G0ZA 2XEDA 5JNUA 5IMSA 4C4TA 2IGTA 5EMKA 3NJ8A 4QNLA 2DCMA 2QR5A 1GZSA 3RSLA 4NJEB 3OTIA 3OT4A 9ICQA 5GADl 1X6IA 4LE1A 1QSYA 2YMPA 4HQOA 4PZAA 4D41A 3COYA 4G84A 2QLFA 4R8KA 4YDSA 4M1MA 5K0EA 1RWPA 4V0ME 3TRIA 3E15A 2J41A 3A6HA 1PNVA 1VG9B 3STVA 3ABRB 1N33B 5LN1A 1NJ5A 2Q2NA 1JHAA 1KPGA 4Q9HA 1TM4E 4AYWA 1IIRA 4HJRA 4XIJA 4D8UA 2BFNA 2C4TA 2HDNB 2FQWA 2R1TA 4TQSA 4MPTA 2GCNA 3EGXA 3QXHA 2W7OA 4WNAB 1P3Y1 3W6OA 3WJ2A 1W73A 4OGFA 3RF7A 4V02A 1VA5A 3EPLA 1VRVA 3IQDB 3DDZX 4CTJA 2Z83A 3HVRA 1K06A 3SYNA 3RIMA 4GPZA 5ISMA 3GFGA 1DCKA 2IBTA 5J2TF 3K92A 3OZWA 2VIIA 4J0GA 3K70B 1B6RA 1JKFA 4C8MA 3FWZA 4MPJA 4KX5A 2ZT6A 2V58A 3BORA 3ZCTA 5KPDA 2JIQA 3ZWYA 3RIXA 1BWRA 4TLBA 1BWSA 3VDNB 2X1MA 4E31A 5KTSA 3H17A 3JPNA 4G36A 3UB2A 4CTNA 3G0HA 2RDIA 2VAWA 2XKKA 2XJ9A 3G9TA 2UZ1B 1UL1X 4K81B 5ESWA 2VJOA 2JAQA 2B34A 3KSZO 1Z68A 3PWZA 1CUXA 3B2QA 5A2GA 3BIJA 3CF2A 1HDOA 2OXEA 3OCUA 1FDOA 1Z33A 4CKWA 4R9RA 3HJCA 2H4XA 5BT8A 3GJ6A 5F9HA 1PFUA 1A1SA 1Z83A 1L8AA 3SR0A 2WUGA 5EQTA 2WTBA 1LDMA 3CUUA 4DM4A 4QXPA 3K8OE 4JR2A 3IEKA 5G0VA 2BOVA 2YR0A 4YDQA 2AL7A 5DB7A 2EF0A 3NAZA 5EJGA 1WP9A 4DQVA 1I2ZA 2K4MA 1TPYA 2H0RA 2A1JA 5BOSA 2QLMA 4HADA 5TARA 1Z07A 8GPBA 3QRWA 3R6DA 4J94A 4MW0A 1LA2A 1QYVA 2O2JA 2X2FA 2DJIA 3GEPA 5EIHA 4B85A 1P77A 3K0HA 3Q8WA 1XRPA 2A9RA 4Q21A 2A94A 4BO3A 1FZQA 1C8LA 5JW6A 1QTQA 4UNRA 4M46A 4ZN6A 1Z62A 2XTMA 2FEXA 1HTBA 5EE9A 1C3OB 3OQHA 2AX4A 4WEQA 5K6TA 3KLOA 4Y1RA 4K6HA 1PEDA 2XUHA 2E7ZA 4HO1X 4Q15A 4A0GA 4YMSA 2ZEJA 3ZGVA 1MF7A 3G2QA 2F1IA 2DPGA 2GLEA 3I04A 1VB3A 3KT3A 1P19A 1ZU4A 4KMSA 2EDCA 1Y9JA 5AHWA 1FZTA 1NQUA 3DMTA 4KFCA 2GBLC 3BMCB 3GPIA 4D9KA 1BMFD 1WWVA 5JROA 5LBUA 3DMNA 1P0MA 2ERCA 4WGFA 2RHWA 3W7AA 4MOWA 2OHHA 4R1LA 3KKMA 4PZ0A 1WBDA 1GDTA 1DBSA 2E3JA 3D54D 4YCLA 4Q01A 3NVKI 2GYVA 5IG2A 4QM7A 1E9DA 4ALKA 3MVEA 3C5HA 5FPYA 3MQ2A 1RNLA 5JZSA 4GYYA 2GERA 5FWYB 3PUZA 2ZTUA 4ECYA 4ZJYA 2WU0A 3DJYA 2D3TA 3E1SA 3GR6A 5EWLA 3H2JA 4HGZA 3EGOA 4M1ZA 2G07A 2QXTA 2FPXA 2H1HA 3CRNA 4D42A 1I2BA 5HSGA 2IA5A 3C45A 1TIPA 1COOA 5CK5A 5CFZA 3MWLA 1U98A 4N9QA 1TFUA 1E1DA 3HYRA 3D8TA 2I1LA 3EZ6A 1XI2A 2YJ6A 4I8XA 4V3CA 4QGGA 1MA0A 1Y4ZA 5CLHA 3V8EA 1CZNA 1OZGA 2D1TA 4HQ0A 3SQNA 1ICEA 4GXIA 7ICKA 1OA1A 1LW7A 4R8UA 2XUZA 1ZP6A 2NO0A 1G16A 3LVVA 2PU5A 3V3KA 4CJXA 5FB3A 3T41A 1T3NA 5THQA 1DJLA 2JFUA 2BCEA 1QQBA 2JMGA 4YMOA 5CT4A 2A14A 3I34X 4KQ1A 3IYLW 1N2IA 1EB9A 4ENTA 3MFYA 5A3QA 1SH7A 4HL6A 1JT9A 1X80A 4MEJA 3UK2A 2XQVA 3EXHA 3L40A 2BKEA 3RFAA 4B3JA 3EA0A 1O95D 1EK6A 1FU4A 3H42B 2QTVB 2QJOA 4NBKA 1RC1A 7ICJA 1RRKA 3SWWA 1XMIA 1PJAA 5DM60 4DS5A 4DLKA 3QVTA 2EX1A 1LZLA 3A7EA 1YQDA 3H5WA 4E6PA 2HREA 3PRHA 3TEJA 1GGVA 1PTJC 3IODA 1VE5A 1DMRA 3QVGA 2D7DA 3LZDA 1EJ6A 3PQCA 5IJZA 3E9YA 1XCPA 4ECQA 2FV8A 2OYRA 4QHSA 3BQ0A 1E89A 4CLEA 3REGA 4C21A 1C0PA 2EBHX 4ICIA 3VJRA 1TTPB 4FVTA 1P1CA 2LIPA 3J7TA 3G7SA 2WHPB 4Q3AA 4BUZA 3ND9A 3Q7SA 1ZN8A 4IG4A 3USZA 3T9CA 2H9AA 3FCSB 1A0OA 4RXTA 1SOAA 3L7JA 1WM1A 1R6BX 3PJEA 2GF2A 4R2IA 5DBFA 4JV2A 2KMLA 2J46A 2RCYA 1YZKA 4BVHA 2C04A 4ND7A 4P53A 3AUFA 5ENVA 2WT9A 4OOFA 2NO4A 4UNNA 1IHDA 3DDHA 3NVYA 4M7WA 4DNFA 1C4XA 3KTQA 5FD8A 4DSAA 5H7XA 4E12A 5DP1A 1XZAA 2ZT5A 3C6BA 1X42A 4QWEA 5KTQA 3X1ZA 3AU2A 5JY1A 3UF0A 2ZDQA 1UJ4A 4EFKA 5IKXA 2XT0A 3THXA 3S99A 1T4MA 4RQBA 1BHO1 3AUAA 1QKJA 3PS9A 2C83A 3KTAB 1N7GA 5K99A 1XC9A 3M82A 1E9SA 1VLQA 1YC5A 5EA2A 2BSXA 3LNCA 1ZD5A 3L1IA 3QVXA 5C18A 3M33A 4RA6A 4ECZA 1Y4DE 3O0DA 4JR0A 2ESRA 3CLHA 5FLYA 5K2OA 4ZC1A 3FMOB 4PXAA 4BX2A 3PGA1 4I1VA 4Y18A 5ITZB 3D7SA 3GIKA 1XPRA 5KTOA 4C89A 1PEKE 4HDKB 2BE7A 1L3VA 1UPHA 3ZD9A 1BXZA 4ZYVA 3MN1A 1WTAA 1FYEA 4GXRA 4GX1A 2FPMA 5JMTA 3LIIA 3ZE1B 5HZGA 3ZVRA 5LD2B 1AUXA 3ZBQA 3DV2A 4P3YA 2F1JA 3IKTA 3ADBA 4DIOA 2CDRA 2XZOA 2CNWA 1B8NA 5HRCA 1GR1A 3H86A 1PTKA 1WY5A 3PNCA 1P9WA 3DD5A 2CZGA 2KSQA 1TC2A 3JYPA 3V8RA 3AESB 3U3DA 3ZK8A 4RQTA 2YWRA 3NBZC 4OUDA 3WK7A 5TRTA 1DRJA 2RH5A 1AUPA 3WAGA 1TNDA 2E4VA 1XXHB 4LNUB 1T9AA 9ICMA 4OK3A 2NZWA 3PW7A 8ICHA 4GBJA 1P5HA 4PL2A 5BVGA 1NZFA 1R3UA 4ROTA 1RJFA 1XSLA 2G9QA 2Q5JA 2OXFA 5FHRA 4HFRA 4XM2A 2Q27A 4C4SA 3DZ8A 4W5RA 3ZJTA 1YS4A 2HF9A 1IC6A 3D3EA 3RVKA 5HM8A 4HGNA 1YL6A 3KWMA 1AKVA 4RS3A 2GSWA 1JQAA 3EVZA 3AHGA 5JYDA 3FZYA 2FZEA 2FPPB 1QRTA 1SOVA 4K9QA 4ZT2A 3GLIB 5ALFA 3A3YA 3DDOA 4UTRA 2GD1O 2G4VA 3N7RC 5DQGA 5EP4A 2C1EA 3E18A 4PNHA 5DEIA 2F43A 5LM3A 2VXBA 3A06A 4B4WA 4FQ7A 2CNKA 5IKMA 4EPTA 1K89A 4UBJA 5J0XA 2VHUA 5EIEA 1T4CB 4O0MA 3HGQA 1PR9A 3Q8PB 4U6NA 4RMJA 2X0FA 3EDCA 3TIGA 3AP3A 4MQUA 4R9NA 1JSCA 4KRGA 1D6JA 4CKBB 3MFQA 3ZWNA 3GD5A 4JLMA 1AS0A 2IW1A 2LYBA 4BMCA 3VHQA 1NBWB 4RZUA 4FDAA 1C0KA 2RGNA 1XA0A 5BSFA 3EEFA 3R3VA 3BHJA 2Y1JA 2KV2A 1R10A 2ZUWA 2VATA 1DAIA 3NT2A 2VT2A 1DKLA 1DOZA 2RGRA 1NJGA 4EVSA 5BW6B 4C7JA 1X7XB 4FIDA 3D4LA 4ZAYA 1AGPA 4BNXA 2Q9AA 2RE8A 3MWFA 4J90A 3E4CA 4N5HX 4AKEA 3TLXA 1CUYA 1VPTA 5KNBA 2G28A 3QPWA 3BXZA 1REQA 1QS0A 5B66U 4RK5A 2EGHA 4LDRA 1SUBA 5KKAA 2GBGA 1JDBB 3QX3A 1NR1A 2EKZA 5CB1A 2PH1A 3RKUA 4Q82A 4MUNA 3A28A 4UB3A 1UHUA 3TI9A 5D84A 1JPUA 2OY0A 3K72B 2DF4B 2JFVA 4RV5A 5CAEA 1KDZA 3IL2A 4GZLA 4RTSA 3MDAA 1CUZA 4LFAB 4MFFA 3TKAA 2QORA 5KVAA 1CUDA 2ZQYA 2OM6A 4Q45A 1JQLB 4YJGA 2VPTA 4M9GA 2HBKA 2IXGA 2PT5A 3C7TA 1Y37A 1HEYA 1G7TA 4Q02A 3MIIA 4UM8B 3RU9A 4BN5A 1GVHA 3KWLA 4GI5A 1PVPA 1SKBA 4GM0A 2JFYA 2JJ1D 1WOMA 3MCZA 3MLEA 4MVJG 1ZAKA 3OTWA 4MW5A 5D1NA 2XR1A 1CR2A 4CZ2A 2H3HA 2VDKB 4F84A 4H0CA 2O8FB 1BH6A 4KMMA 4HB3A 2Q6OA 3AEKA 4BNUA 2PIAA 1TT5A 1OY1A 3RHSA 1WVIA 2ILTA 4EHFA 3OD1A 4XCVA 4JSRA 4REMA 1UZUA 3V6LA 3CF4G 2R7AA 1MJ5A 7GPBA 1EHYA 3H2YA 2FDRA 3OCJA 1N48A 1DXYA 4ER7A 2QW1A 1F8YA 5KNCD 4QZVA 9ICVA 4I1RA 5DYNA 3DV9A 2JLAA 4E70A 2G7ZA 1ESCA 2XE7A 1LBQA 1M6HA 3DVSX 3DBHB 3D7RA 3WLNA 4GF5A 4J9UE 3MNFA 1G9SA 4LSZA 4N9WA 1F14A 3D31A 3V80A 4AZ0A 3OBIA 4CKEA 4EOGA 3GZNB 3LCMA 1RACA 1SZHA 3URMA 3PNBA 3S2IA 2BI7A 4IZOA 3JCZA 8ICNA 4IQGA 1BFKA 3VR0A 4DT1A 3QWIA 4IOJA 4WNIA 4M88A 5IM5A 3R9XB 2QKQA 4YWHA 5FV4A 5TVKA 2H65A 1CRPA 4AJPA 4Y1FA 3MW8A 2A0YA 3ZNOA 3FMPB 4J43A 1ADBA 2CBXA 1F6WA 1JIJA 4IVNA 3W9YA 5EHQA 9ICGA 4ZVTA 1YVUA 4YXJA 4FFPA 4OEHA 2DVMA 2C4NA 4KSBA 4BYMA 4L7QA 1OI7A 3KE9A 3R5SA 3CO0S 4EY7A 4B48A 4B76A 2FXIA 4ROSA 2QD3A 4NJEA 4HQ6A 2IYXA 2GZSA 3N7PD 3LVQE 2YVKA 2JLRA 4JY7A 4IS2A 4DXDA 2FLVA 1QR6A 4CQNA 3AM3A 5BV2P 4PX9A 1YKFA 4PFKA 2YQ4A 2E8MA 1NOJA 2C3UA 3HBFA 3A4VA 1W4CA 2PL1A 5LIPA 2QVCA 4G01B 1X8XA 3U0BA 1EFCA 1PJSA 4G23A 5FPTA 2WD8A 1NASA 3EDOA 4M76B 4WNAA 1SV4A 3ACCA 5EJ8A 3EZYA 3ALRA 4JL6A 1Q2UA 2LMRA 2OFWA 3D5TA 3RROA 1NC1A 3B7WA 4NS4A 2O05A 2ZI5A 2Q2QA 3KSUA 4FCVA 4N6OA 5F2OA 5CFOA 6NULA 3M49A 2VR1A 1HNWB 2ONCA 1QVRA 4W8HA 3CVWA 2XUFA 2NZ8A 2ZSKA 1YF3A 3S5JA 5ER6A 2M98A 3S2EA 1QUEA 4YALA 2W6ZA 4M0DA 1UKYA 2C88A 2DPJA 4DYHA 5B7QA 3GQBB 3DWIA 4IOLA 4AY5A 3ZHCA 2QB5A 3EH2A 3FOZA 2XE4A 1C9MA 5KINB 5DLGA 5KFPA 1K3FA 1YJ8A 4KAFA 4JEHA 2DB3A 4D98A 3EPHA 3KTFA 4JV5B 4ITVA 1WD7A 3NRBA 3WU2U 5BXQC 1IM2A 1ODKA 2OFFA 4XEHA 1DV2A 4INZA 2I5HA 1KF0A 3JYHA 2DP4E 5JXGA 3R6TA 1U0JA 1NVDA 3PSFA 3KJNA 3DTTA 1JI3A 1D2NA 4JBLA 1AO0A 3ZJ5A 2FMPA 2NVWA 4LF5B 3PW2A 3UB3A 4X0EA 1OWNA 2XXAB 5F7XA 3WB9A 2GK4A 4O2BB 4ZOLF 1JFFA 1X77A 1JZQA 3JS5A 4QDTA 5DDMA 4UMEA 1P9RA 4OP1A 4PZYA 1GGKA 5ADWA 2BRUC 1WF3A 3OFNA 4XW2A 3GH1A 1BS2A 4PAQA 3FGNA 5G4KB 1I30A 3ZDZB 4EP1A 3F3KA 3EVDA 2BSAA 4GM4A 5K20A 3AF5A 1NWHA 5CCXA 5G4LA 3ANMA 1YAJA 1C3OA 2AFHE 1X8JA 4P7BA 4O0LA 1WB4A 4QRDA 2J6UA 3H8VA 3B6IA 4MMYB 5EWJB 3WO1A 4ODIA 4ZEMA 1U31A 4XLZA 2IUEA 5KNCH 2H1SA 2B2NA 4HQLA 3CINA 2F4VB 3UTCA 4M9NA 2PX8A 3M3DA 3HTXA 5EXSA 1GQFA 3BMCA 1ENYA 3DC2A 2Y68A 4ZVVA 2VDQB 4FGUA 1E9RA 4CF7A 2V1UA 3UG6A 4KR0A 1YULA 2QUHA 4RSRA 2OP1A 3AWIA 3EISA 1O87A 4OHWA 5L1KA 4KQWA 3FCEA 4DTCA 4KREA 3HA3A 4XGNA 3TJZA 2QVXX 1K1EA 3AJ9A 5THKA 3ME5A 1QOZA 4ER0A 5A71A 3AONB 5FWYA 3INNA 8LDHA 3FSGA 3VVMA 3OZEA 1UMBB 1U3DA 4I55B 4KH0A 5AKZA 3PZRA 1ZQDA 1GGFA 3AEVA 4FFBB 4QTXA 2UU9B 1QHIA 3WP0A 1C1XB 5CR9A 4LC0A 3V42A 1AS2A 2HPZA 1ZM7A 3KV3O 1D1SA 2XDYA 1J9EA 1WIWA 3KKLA 4MDYA 3TEMA 3EVBA 3DNMA 2C61A 4YQZA 2QTBA 1XP8A 2I2AA 2J48A 2A57A 1TYZA 4Q3DA 3OCWA 4LCEA 3H1TA 4RQ3A 4QLBA 3I9V6 3QFRA 1FTNA 4X71A 4KN7A 2WJJA 3BFPA 5DTMA 1EFKA 3WQQA 2VKTA 1PS0A 1QSLA 3ONDA 4XVUA 2O8BB 3GJ3A 2QLLA 4JBIA 1SWWA 5B4UA 5BWBA 3G3EA 1X7HA 5LZ9A 4U7TB 4ZDJA 5AJZA 1QFSA 3MJTA 2NZVG 3STHA 4CGZA 3EJWA 3M4JA 4NEGA 2R6ZA 3TAXA 3E8MA 2QTVA 2JFBA 2YRFA 4X41A 4US8A 3ND7A 4P32A 1OH5A 5J4HA 1WV1A 2VJCA 3UT0A 1ZIDA 4URZR 1YIAA 4KGDA 4EHIA 1AV7A 2GPBA 1VLVA 1FLAA 4RD3A 4Z4IA 3S1AA 2WG2A 4P4UA 3GBSA 1X70A 3UUGA 3FYSA 1UUFA 1KC3A 3CXUA 3M6FA 1CQXA 2GPSA 3MMXA 3Q41A 3L1JA 2WAOA 3RFXA 3KJHA 1NG1A 3RGGA 2YJTD 3ZW8A 5HBRA 2QBYA 1X8LA 4PLWA 4WK6A 4DNXA 5L53A 2FPSA 1XRNA 5B55A 2GZRA 1Z08A 1T91A 2KJQA 3VJLA 2ZRJA 2BDUA 3CMMA 1J7JA 2BMFA 2ORYA 1VXOA 2FFBA 1ZIXA 4L73A 1ULHA 4BEBA 3W7VA 4HB4A 2GEUA 1RS0A 2QARB 1ONOA 5JLJA 3C14C 4JVMA 2LPEA 3HCCA 3QKRA 2C07A 3N39C 5FBWB 5B58C 1GZDA 3SZGA 5EI5A 4H08A 3NXKA 2HW8A 3H40A 3WBKA 1RI2A 3I6QA 5EP1A 4U7HA 2FZLA 1K66A 4PRYA 4XWTA 1IFXA 5DTIA 1PUJA 1WCXA 4L5IA 4EPYA 1Y6ZA 1XGKA 2W55A 1E18A 3UV3A 4GP7A 1YQGA 5DN9A 2HLHA 2GPYA 3OQJA 5LQAA 3RG8A 1ZRHA 2JD1A 2G67A 1N5LA 4MF8A 2IY8A 2YY6A 3PJGA 4IDNA 5A5VA 2QPOA 3QXXA 1NOIA 1NYRA 7ICRA 2NXJA 4ACOA 3B9RA 2KKPA 4YBZA 4DB2A 1NM5C 4MPPA 1A4IA 3VISA 2QN6A 2J3EA 4LXXA 1TMOA 1AGNA 1GNSA 3DTNA 4MGHA 4ARAA 3EUEA 4YQEA 5I9LA 5A06A 1K7YA 5J2HA 1S77D 4ZODA 5JTUA 4HDKA 3B3GA 2PZLA 2Q5EA 5JSHA 1POXA 4KAAA 4ZAFA 1ZQAA 4TSKA 3TXAA 2LPMA 4R6XA 2QRPA 1R6DA 4N49A 1E5XA 4H7HA 4MX8A 1R27A 3RH6A 5AVSA 5BSVA 2HI0A 3KHUA 1N5RA 3MS7A 4FZNA 1N8NA 4ED1A 1GXSB 3ZK9A 4LZPA 4WASA 3EVFA 1C14A 1J8FA 5TF4A 4PSDA 3BJMA 1JRLA 4TLEA 4MS3B 4N7RA 3B13B 3THWA 4NS1A 1YK1A 1KH1A 3TB4A 4L85A 4BUJA 1TCCA 5IF3A 3L7NA 4IF4A 1EJ0A 3VR3A 3GJ4A 4X8OA 1H85A 2H16A 2HU7A 2V59A 2LYHA 4NDZA 3G0BA 1Z7YA 4RHCA 4HMOA 5KTKA 1FEZA 1J2UA 4INPA 5I9MA 5BUZA 2LW7A 3N2LA 3G8DA 1XXHA 1AGXA 3VU0A 4LNUA 2R6AA 3FX2A 5FWXB 4X95A 4DJTA 4RH1A 1IIPA 3X1JA 3RJ9A 3JQAB 2FK7A 3WISA 4DKXA 1XYYA 3O73A 5BW8A 1CHNA 2P9HA 3P45A 2QENA 3ELYA 3PR3A 4ISCA 4ZO8A 1YCFA 2G5PA 2GARA 4JSTA 3RFUA 5ICSA 2WI8A 4LDZA 4WBNB 2FPPA 4N5MA 1P75A 1U90A 5HE8A 3GLIA 4G1CA 5LZ2A 3F5DA 1N5DA 3HRDD 3EVAA 1O95C 1OKKD 2XB8A 4NXNB 1T2VA 3D6NB 5K05A 1CRLA 2X6QA 2NU7B 4XD7D 1Q7EA 4KZPA 4OLHA 2AC4A 3AT1A 2UUPA 4EJMA 1V48A 1R7RA 3EIHA 2CJWA 5GV7A 4YJ2F 1Z6AA 5C8YB 1MGPA 2FW9A 2V3CC 1T4CA 5B2ZA 2QZJA 3ZDBA 5KTTA 4TTSA 1VMIA 1Y1PA 4KKXB 3NRJA 4C0SA 2BGWA 1U6IA 3L3BA 5DJ5A 3T4XA 1PK8A 2HHCA 2WM9B 4ZZ3A 5F21A 4BX0A 4HT3B 4CKBA 3GLHB 3DO8A 1QOPB 3NAQA 2HSEA 2H1IA 3RRBA 2DLCX 3A6EA 2J3KA 2YL2A 3HABA 3AUYA 1ZQTA 4JLDA 4A03A 2IWRA 3EGDB 1UBGA 1JR2A 3L7OA 1MUUA 2Q5CA 1S1MA 4GC5A 1EGQA 5AJYA 1UWVA 1FRVA 4WZ6A 3W9BA 4IDCA 1U5BB 3VGJA 4WV3A 1K27A 3O8BA 3EFBA 1X9HA 3M4YA 1FS6A 4MRAA 4JGIA 2CMKA 4ARBA 5AVUA 1GKYA 2OD7A 2OSBA 5F3XB 1JDZA 1XTUA 3WR5A 2I9KA 1IG3A 3NVZA 5G0SA 2OYCA 3AVYA 1MAWA 2AG6A 1P8JA 2WJ3A 3CJQA 4N12A 3DR3A 1DWUA 3SNKA 4N0EA 3LI2A 5ALNA 4A5OA 4G6ZA 2CJFA 2NXCA 3JQFA 3G02A 2FHSA 1SXQA 5DNEA 4ESVA 3V8BA 2ZTSA 2H0QA 3FR8A 3C23A 3JW8A 1NUTA 2QTNA 1ITZA 4IVPA 3OX1A 1FDSA 1VJGA 4AYXA 3RV4A 3G49A 3RBEA 1JLMA 4U8HA 4B2PA 1XMXA 2KBFA 3A8TA 4OM8A 1CF4A 3CN9A 4A5SA 1V47A 5C35A 3QPAA 2JZCA 3RU7A 3JZDA 4GX0A 2LM1A 1HNXB 3B5EA 3VUEA 1HFWA 1JTEA 3G9ZA 2GNOA 3IALA 4FW9A 1X40A 4OLJA 1RJDA 5BPHA 2O54A 3WKEA 3UJDA 1SY7A 4CU2A 3UJ3X 4IHJF 2VSNA 4B7AA 2CD7A 1FVHA 2O8FA 3BMOB 1KBUA 1KI4A 1P4HA 1WMSA 5JG7A 2P9JA 1YS6A 2HBRA 2ZRCA 5J0WA 3O84A 1H2ZA 4AWBA 2MU2A 1TZJA 2Z8YM 3NIGB 3O1LA 3MWEA 3PPIA 1BHQ1 1GG9A 4JROA 3LRPA 1VE3A 3NOQA 2WYVA 1C8VB 4PAOA 4BQQA 4C4AA 5C46F 4GX5A 1FO4A 1XUOA 1TMYA 2JGJA 3ML1A 3FKSD 2NSYA 3DBOB 2AVDA 3V7LA 4FR5A 4BO4A 3E9EA 4JJFA 1M5RA 3Q7IA 1DIHA 3LT0A 1DEKA 4A8JA 2E4ZA 3HBLA 1SG9A 3F6SA 5DEOA 4N8EA 5JASA 2EEZA 3DJFA 4F3KA 4FFDA 3DBHA 3TNYA 4CLRA 4MHOA 3R6WA 4W5OA 1XMOB 1RLTA 3H5OA 3DVLA 2ZUSA 1C3EA 1H69A 2JC3A 3RVLA 3H2SA 4E0BA 3DZCA 4W5WA 3GZNA 1F7VA 1DKUA 3DUWA 5DTJA 2GA9A 4QWWA 3HRKA 1XK7A 4FI3F 4JOQA 1GPUA 1G21B 1UBEA 2VJPA 4IGIA 4HN2A 4IP0A 1FMJA 1K7CA 3R9XA 3JD1A 4ZRNA 3QOFA 2X7XA 1LPNA 2OT3B 1SAYA 4Q7JB 2IEIA 2YZKA 4JOSA 4CTKA 4Z0HO 5I4IA 1MAVA 2YZNA 2JCVA 1QDEA 5ICFA 1VHTA 2VWQA 3NUGA 3PHGA 1W29A 1SCQA 2HOQA 5HKKA 3ZWBA 1ZZEA 4J9LA 4BFLA 2O2HA 3AHEA 4MWSA 2JDID 5KKCA 2XSZA 2OO5A 3QA3E 2KB0A 2QRLA 4PGQA 4GL2A 2F44A 3QLVC 1JSXA 2CV2A 1LPMA 5JIBA 2P9FA 5T3UA 3DCIA 5CHEA 4Z2AA 3S5UA 2Y1OA 2WJGA 3KHSA 1MW8X 2V8BA 3GIMA 4LDQA 2FSHA 3UYKA 1X7WA 2BEUB 1L5FA 1U3UA 2EEPA 1W8DA 1IN8A 4O3MA 2WTMA 1AV6A 2WU4A 3O1HB 4KGXA 3AI7A 1NJ2A 3HYTA 2HIGA 1GR0A 5GVRA 1H3NA 1DJNA 3BK1A 1XJWA 3BPSA 4Z51A 1TM2A 3IHQB 2JATA 2EJUA 3HZRA 3CLRD 2X8LA 4ZK2A 2FLKA 3ZWCA 2QE7D 4D8XA 2J0QA 1ZJ5A 1ZD4A 3WB0A 4TTVA 2MYUA 4RESA 3UXHA 5IN5A 2AFIA 2O0KA 4QBIA 1ADFA 1WAMA 4TV9B 3E3MA 1IG0A 1OJLA 1PZMA 2RGUA 4C4ZA 4N7JA 1XDSA 4PN7A 5AI5A 3GQBA 1E6MA 4NOMA 1BFUA 3KLNA 1Z4KA 1W46A 1B8PA 1M83A 4PYQA 1FIUA 4LHXA 4KXUA 1HEKA 4ZCMA 1ODFA 7ICTA 3RM3A 1VL8A 4ECSA 2Z4TA 1Q3KA 3M8KA 4P5DA 1YA4A 2QP3A 3UENA 1SKQA 1C4WA 1QSGA 1G6HA 5IC4A 1NP6A 2E82A 1FNCA 2O7RA 4EAQA 3VNUA 1UJMA 4IW3B 2WM2A 3DMRA 5KJEA 3A04A 1U9CA 4OGLA 1H6DA 3CNQS 4WESA 2IP4A 3WWOA 4NPCA 1JFVA 5DBEX 4RY8A 1GN8A 2H18A 1SUCA 1XT6A 3WLLA 4YXWD 2XXAA 3ASVA 5C53B 3KR9A 1GCGA 1YRLA 2B4QA 2BEKA 3SAJA 1FYXA 4LF6B 5GINE 2JIPA 2YW9A 4C0LA 5TPWB 1MB9A 6REQB 4DNPA 3U3KA 4I2DA 2DYKA 2JH8A 3FPGA 3NAMA 2X0NA 4QDZA 3RKRA 3R8CA 3OOWA 3CFYA 2GXQA 4JK1A 2B61A 3EZ2A 3OCYA 5CM2Z 1XC7A 3F73A 4MAAA 5G4KA 1WQ4A 5JAMA 3QJGA 4AI6A 3JYLA 1CB0A 1CP3A 3WDMA 4HKTA 1U0RA 3NMUF 3A2NA 2W4IA 3V1MA 2WP0A 3KR2A 2QX4A 3TCXB 4DIKA 2F4NA 3CYMA 1Q8KA 1X9WA 4MW2A 1WOYA 1GZ7A 4HB2A 3OHSX 3UQ0A 4MKZA 1Z18A 1RYFA 1EGVB 3D8NA 5EWJA 1R37A 1B0PA 1TB4A 1BDIA 3QQPA 3BF7A 1D09A 3D5EA 4GSKA 4WXEA 1WUDA 3FGPA 1P0PA 5JANA 4DLSA 2Z3VA 5IEBA 3LKBA 3DOIA 4XGKA 2GEJA 4GKVA 4A73A 1UC9A 1KYVA 2Y4OA 2BV3A 5F9NA 4NL9A 2QG9A 3Q2KA 3ND5A 1GKIA 5FR2A 4YRZA 1KO1A 5LXTA 2FY8A 1YCDA 4YMHA 1RIFA 1PHRA 1P2FA 3U3XA 4DV1B 2NADA 3MM4A 4ZVRA 4FYPA 3VHXA 1PV4A 4ON9A 4CV3A 3NKFA 2KVSA 4RSGA 2HJRA 2X22A 2MUTB 4TQGA 1H23A 3WLTA 2RB4A 2ZSJA 3FIJA 2ACWA 5ES4B 1UMBA 4I55A 4P81A 1JI7A 5HDBB 3KYJB 1YZLA 3V7UA 4FFBA 2TMYA 1QG6A 2H2AA 3VV3A 4IJWA 5I01A 4XTCS 1UWKA 3DBLA 3HO8A 3U2QA 1C1XA 3RVMA 2FPOA 1ISJA 3W0LB 3TR5A 4ZU3A 1NKEA 4B0OA 3EVTA 4Q48A 1PYOA 3JVDA 2IY7A 3EXG1 5JNTA 2IP2A 1EVIA 1W1WA 4CMEC 1KRXA 2PFOA 4QXOA 1DBVO 4YUAA 1SULA 5KKNB 1CIJA 3GYGA 5KFIA 2Z6AA 4YLEA 3OP1A 5I47A 3H0LB 1CY2A 4D56A 4ILEA 3N2IA 3I9V1 1SGWA 4AU1A 2WVJA 1H0SA 4F45A 1JMVA 2IMWP 3MGVA 1LI4A 3L6BA 2BPFA 3R7BA 2NYAA 3VR6H 4BB9A 2O8BA 1ZQPA 1WUJS 4YPVA 1ETUA 2GCOB 2V7EA 3FNGA 3IDZA 1U9IC 1U3VA 4J2HA 4PFQA 5LQJA 1QTRA 4BZPA 3O82A 1Q74A 4ACBA 2CLEB 4NG5A 2IT1A 3LQRA 2ODEA 3P9QA 1Y5IA 2BCUA 1O96B 2G1JA 1CNMA 3PQ6A 5HIMA 3RTGA 4JJZA 1R9JA 3M2TA 1SD2A 1SXEA 2J59A 3PX2A 3FDIA 2H59A 4K9SA 3FYUC 5L3ZA 1Y1SA 4EB0A 1BVSA 4GMDA 4MKIA 5JNRA 1CUEA 5CIQA 4FZJA 1R9GA 2VHTA 4PEVA 4XA5A 1Q3VA 1Q12A 2W2LD 4LW8A 1GKKA 4HPXB 4NCJA 5DNCA 1WBBA 1VJDA 4G3XA 1XQYA 1GPLA 4CM8B 3MCAA 2WB1F 5DZSA 3TLGB 1C9DB 2J7KA 4J1NA 3FNRA 1JG3A 2C4WA 3RUAA 3S8MA 4MVWA 2IUYA 1SUWA 3LFHA 3LU1A 4G86A 1E3IA 1S4QA 2PKEA 4O4LB 4ZH4A 2QARA 1L4NA 4MP8A 2TSYB 4ZYLA 3KO8A 4FKMA 1QLNA 3I37X 3C24A 5CBKA 1GFZA 1HH4A 3KPYA 1JP7A 3JQ9A 4BFZA 3FB1A 3UJNA 5AUNB 3K9LA 1CU1A 2ASDA 2ZPUA 1BYUA 4L0DA 4IQ0A 3ZNQA 1NI4B 3T7JA 5JSZB 3TOZA 2GETA 3QBDA 1BMQA 2V6JA 3FZNA 3LO5A 4BPBA 3TSOA 1K8ZB 1XVUA 3ONFA 3HM9A 3NH6A 5LUBA 4QFDA 1I4WA 4YLGA 1PJ4A 5FTKA 4IX1A 1IUPA 3QW4B 2G71A 3IMEA 4LZAA 1CJKC 2H5IA 2GCEA 3Q7PA 5TE9A 4MWOA 1UDCA 1XLVA 2ZJOA 4OXIA 4K0KB 3K5HA 3LVWA 2A19A 1Z4MA 1GTL1 1S2MA 2Y1EA 3K96A 4RXUA 3AKEA 2UYYA 4BLVA 1NVFA 3C39A 5DNVA 5CPFA 5A03A 1B0UA 3IP4B 4Q7QA 1AA6A 2O2GA 4F60A 1T1JA 4RCVA 3OSUA 3A14A 2A84A 3PQ7A 1MAHA 3ZGLA 4RGBA 3KQUA 2XUDA 4RQ8A 2YFKA 4DQDA 2XT6A 4M1SA 3WA7A 1V3QE 2IZ7A 2AT1A 3TW4A 5DNDA 3JPRA 2K4EA 2EJWA 1E6WA 1H4QA 3DFIA 4Y6SA 3HEMA 4J0EA 1CR6A 4NCIA 3QVLA 1GVNB 3MEQA 2HZ7A 3D9QX 1MB3A 2AWNA 1GXSA 1S3SA 1QH1B 2CJXA 1F48A 2WU1A 4AUMA 1KO5A 4L2IB 4JVSB 4MS3A 5F2KA 1JEDA 3F9IA 2R79A 5JRDS 3CEHA 4IDGA 2WPDD 2G9NA 1TPZA 4TKLA 5A6VA 4YMGA 1GRCA 4QZHA 3FPBA 1A1VA 3KDSE 3X1XA 1UQUA 3WNDA 1XVIA 5AJUA 5BR8B 2ZBQA 2VT7A 3TFQA 4C3VA 4RWEA 4NMHA 3T1HB 4ER6A 1NATA 5AKIA 4JBXA 1RI1A 2CWDA 3A6GA 4KG7A 3SQIA 2C2BA 5C7OO 4K6MA 1OT3A 4Q7LA 3H87A 4ZAGA 4XWGA 2IEBA 5FTNA 3NT5A 2PMFA 2PBZA 5AKLA 1RAGA 1I4DD 2FH5B 4O3FA 2NO7A 4MCJA 3N58A 4UHKA 5AI8A 2FF7A 2GCGA 4UXIA 4WBNA 2A1TR 4V1CI 4TMTA 4DLLA 2IYUA 3PC6A 5DHTA 1BFDA 1SCIA 3U3ZA 4FCTA 6ABPA 1RCFA 3DQZA 1SZDA 1NPYA 3WQHA 1NURA 5J5AA 2NACA 5JQWA 5C8YA 3R7AA 1UJNA 2XCIA 1JXOA 1SKYB 4RK6A 4XQGA 2J6TA 4J9OA 4MW1A 4KTQA 5SYMA 1UK6A 2AZDA 1MEEA 1E2NA 3UQ2A 5DBHX 5H4GA 2EWVA 2JAWA 1IY0A 2IOHA 3DYVA 1XDBA 3PK0A 3GLHA 4H16A 1NAHA 4D92A 2NU8A 2N1MA 1DC6A 2ZXHA 4OFXA 1JT2A 2W7TA 2LKYA 4NP6A 3QYJA 3EGDA 1VPVA 3WLJA 4UVGA 1NMSA 3I9MA 3FD8A 4PLFA 5EUMA 5IPFA 1L4HA 5I6DA 4Q24A 4DA4A 4R54A 3F67A 1K4MA 1I4OA 4BNVA 3ZXSA 1U5BA 1BGVA 2ORIA 1ESEA 4ID9A 3U40A 2PXCA 3AY3A 5T6MA 2P7HA 3VSEA 4XEUA 2CMGA 4JLVA 1U3GA 3L43A 3LDGA 2I87A 4GBED 4TTJA 4MQ5A 1NJWA 1UH5A 2VA2A 3GK3A 3M3HA 4TQ9A 3CJRA 3ENZA 2PJUA 3S0JA 5C0YA 721PA 1H1LB 3GU3A 3JQ7A 3SOZA 1W6UA 1PK7A 4ED0A 1Y3IA 3EAQA 3ROFA 2HCJB 1RPZA 3RRFA 3SP1A 3DS8A 1PLKA 2JIZA 1NQAO 2IL1A 1SC9A 1KKMA 4HWKA 4RVNA 4ZI5A 3WDLA 3VYVA 4I4TF 4OHPA 3DFZA 3LNTA 2HQOA 5DTQA 4K1XA 3OFJA 3I4FA 3MBKA 3SVLA 1UPBA 3ZCVA 1P1BA 3PSTA 1FQJA 4NV1A 1W36B 1O54A 2DLDA 4I1OA 5JV5A 5KU7A 5GV8A 2ZUEA 4PO3X 3VKVA 3AR8A 1ZH8A 5BVHA 1V6AA 1YDEA 3VC1A 4I8DA 2WUWE 3RFFA 4QBFA 4LYYA 3W8DA 2O23A 2PJZA 4JVOA 3BMOA 1JMYA 2YRWA 1WKVA 1E3WA 4GQAA 2WSMA 4RZSA 1X1AA 4NFLA 3W5IA 4Y9DA 2RK6A 1TZBA 2H92A 5KFCA 2B8NA 4LRXA 2Q9BA 2J9RA 2ZYVX 3K8QA 4H4CA 5CB6A 1A96A 2AEFA 1Z28A 3FOEC 4WFJA 3WK6A 5TT1A 1KQQA 4MHTA 2QTWB 3EAFA 4QTTB 2YCBA 2ZJ1A 4H3KB 4PN3A 1F17A 4ND5A 4QQRA 3KFVA 2HMUA 3ABZA 2YZMA 2GZ3A 4PTYA 1SBQA 1YI8A 5GOZA 1U8UA 3KPWA 3G5TA 4QBTA 3SIXA 1TRKA 2XUJA 1YQ9A 2G7MC 2ARKA 1ESMA 3LYUA 2C4VA 3X2SA 2H7YA 1NVKA 1QOQB 4WCFC 3SX2A 4GD3Q 4UU8A 1I6MA 4DUGA 1VSQA 2FZVA 3M83A 1YDFA 3DOEA 3AG5A 4LZJA 1G21A 2ES6A 2JRZA 2GN8A 2JH7A 1RCUA 3V97A 1XDZA 4U4AA 3P0JA 5L3QB 2IU3A 1AKNA 9ICPA 4B7XA 2F8TA 2FHPA 3NWOA 1CC1S 3V4ZA 1YJ5A 2WSIA 4LIPD 3MELA 5JNLA 4JCCA 2I8CA 2UVRA 1RYEA 1EXMA 3HXLA 2HIHA 4GBMA 4BO8A 1Z8HA 2EQYA 3IPLA 4WXPA 4FYWA 4I2VA 4F4HA 4O2AA 1Z75A 3KU4A 2EZYA 4QSHA 1NVUQ 3C7CB 2DWUA 1PNQA 4G4IA 2H1FA 2YWEA 1MDBA 1TVCA 1FPMA 3CT4A 5A7GA 5FUWA 1UC4B 4K6GA 2VJBA 3E5RA 2VA8A 3IAAA 1WCIB 5IT0A 8ICPA 2J7PA 2VCEA 3FTNA 1G6KA 1YU6A 4RPIA 1M2OA 2X4IA 3OEEA 4JDPA 4KQGA 4JP2A 2JCBA 3M81A 3I42A 1AZWA 2Y93A 1Z37A 1PR3A 5C1PA 3G13A 4J16A 1FP6A 2O5CA 2QM0A 1E7RA 4ND3A 3KKZA 1IOLA 1RWKA 3VDXA 4JUCA 3DO5A 2QYHA 3ASZA 3EVNA 4O3QA 4UMVA 2QIOA 3OHAA 2JGKA 2V0CA 2PX3A 2OG1A 2AXTU 4ZMRA 1UXOA 5CA0A 4WZAB 3C1TA 4CV0A 4BLRA 2NRXA 4DR4B 1AY0A 2EARA 5JTIA 4Q4DA 4I5FA 5BO5A 3LA6A 3CVYA 3FFBA 2ZZKA 1PHPA 5BYBA 3BT7A 1V6SA 3PUYA 4ZT5A 1QZUA 4Y2SA 2H1WA 4TV9A 4AWXA 2GXAA 4JMLA 3R5JA 3A9SA 2CYAA 1NMQA 1M1NB 5K3AA 4Q9LA 1JIXA 3BH0A 3T1YB 4NULA 1QGED 2XD9A 1XSEA 3TTYA 3GUHA 4IQTA 5KYUB 1S2DA 1O8BA 4A2CA 3HFRA 2HNAA 3LUCA 2JIMA 1WZCA 3CUVA 5F7ZA 1HE1C 2I3GA 4HNAA 3WMEA 3BIXA 2ZIWB 3OU6A 4DF3A 2R5WA 2J0UB 4AQDA 4BVKA 4KLMA 5LVAA 1WXEA 4LNHA 1W4AA 1JR3E 1X2IA 5E38A 1Q1EA 5KFWA 3ZK7A 4BNJA 3N7SC 3ZD6A 3HO1A 3G2IA 1PFQA 2Q3BA 3UKDA 4GGMX 5EJ4A 1GAEO 2NXEA 1NBAA 1ZQ9A 4HYKA 3JVIA 5WRFA 3RFCA 2BMJA 1XRRA 1Q7RA 3G8CA 3V8NA 1CRQA 1V26A 5TPWA 4QBHA 6REQA 2RD2A 4RK4A 4EA7A 1USWA 3TINA 1Q21A 4PHTA 1TLLA 2EZXA 4YIKA 3FHLA 5FHQA 3TG2A 1D4FA 1HYHA 4J2TA 4H7IA 4PX3A 4BKMA 5GM2A 3TSAA 2D5BA 3TTSA 4MMZB 1YS1X 4F6CA 3DZHA 2QSYA 3PQ2A 1GZ4A 2EKLA 3L4JA 1L3IA 2PS9A 4BMXA 1R8SA 1NUHA 1QGDA 4ND8B 5F2NA 3HB4X 2I4LA 2QGFA 4DNQA 3FNEA 5EXTA 4DYVA 1HY3A 2OORC 2Q0QA 2VTKA 2LWIA 9ICJA 3OPXA 3T8YA 2AE2A 1P5JA 1R9NA 1E0AA 4L72A 3I58A 3REFA 4TXMA 2OXRA 4BNWA 3C1ZA 2YBEA 3LYLA 3OFKA 2DJ5A 4USAA 1GTZA 1YJQA 1QFJA 4GH5A 1XQ6A 4L6AA 1QP7A 2QRGA 4JT2A 4N6NA 4P3PA 2C7BA 5CRXA 1ZD9A 4QEKA 4PBTA 3K1AB 3ASUA 3VTAA 3W5VA 4I27A 3GUYA 1XHFA 2DQNB 4J0HA 4DPLA 3QMVA 2E8PA 4WUTA 5EJ9A 1R66A 1SCJA 5K3BA 4AB1A 3UV7A 1EP2B 2AW5A 2EU8A 3GJ8A 5H81A 1UAGA 2DZDA 2ZWIA 2R2GA 4L0QA 3VZRA 1XMQB 4F4KA 1D9FA 4AY2A 2EBFX 3PYLA 4AULA 3BXFA 4B35A 4ARVA 2NRZA 4G2TA 4PZNA 2VXYA 2F2TA 2BM1A 1RBYA 2C99A 2CKDA 5AW5A 3T06B 1WMDA 3Q2OA 3A4TA 1N5OX 2R48A 4YMTA 3AJDA 3MWKA 1VE7A 1QQTA 1VPEA 2GWRA 3UA4A 1N2GA 2WJWA 4CLHA 1PJQA 1XTQA 3F2DA 2J9XB 2HN9A 2RHCA 3MGIA 1A2QA 2O6KA 3C74A 3C8ZA 1RVDA 1K8QA 2UZ1A 3FWPA 1OA0A 3L0PA 2H0AA 3RJHA 3W05A 5PNTA 2PO5A 3WSVA 4MMXB 2NUTB 2VPXA 3LTNC 3OE1A 2LE0A 4AJNA 4GOXA 2OVFA 4X7MA 3D8RA 4QZAA 3RBDA 5JO9A 1V4VA 3GQVA 4ZC8A 2O3RA 2HIMA 4IY1A 1O6GA 4CF3A 1M6YA 3A1EA 1SKMA 2XCLA 1UBMS 3CLRC 1ABEA 1W52X 1W19A 1WDLA 2NT4A 4IIUA 3VYSB 1QBKC 2WAMA 2PLRA 4BNHA 2I2CA 5BR1A 2M6KA 3ZVKA 4KDRA 5I5GA 1KAHA 2YINC 4HMQA 2VJDA 2GCOA 2VJQA 1RMTA 4UOZA 4HD8A 3OM8A 4OLAA 3QUQA 4B3XA 4PXYA 2ZCUA 4L9RA 3MS4A 3KQKA 1Y9ZA 2WMOB 3QKWA 5NULA 5JADA 5JJKA 3GVIA 4RTPA 5JAIA 2JIRA 3RAGA 4RVUA 3BXEA 3DM9B 5ELLA 2DSNA 5AM0A 4I2FA 4N0MA 2HRCA 1USUA 4I5EA 2DR2A 1K5DA 4FWBA 1ZQXA 3QG1A 2UUAB 4XE5A 3GLVA 4QVIA 1SXPA 1LLDA 2WIFA 4AF7A 1QX4A 3RVSA 2VJKA 4ZDWA 4FMDF 1U7WA 1B74A 2GYUA 4CHTA 4CM8A 1GYRA 3TLGA 1ZL2A 3JX9A 4DSUA 4XR4A 2YS7A 5LMCA 4M3NA 4RDCA 3BXGA 4KB5A 2HLDD 4S1WA 3NLLA 4XWWA 1KSHA 1UEJA 1W30A 2QW8A 3FG9A 2B2XA 3LD9A 2P90A 5HJ7A 4I66A 4DLZA 1W5AA 1RQ2A 1TAUA 3GARA 2EX4A 3HV0A 1FUYB 3SC2B 1R6TA 3G2JA 1IZ9A 5EIOA 4Q3NA 3GQCA 1GL3A 4OHXA 1F0PA 3PGKA 3RODA 3KZOA 4AJJA 5KIAA 3RTAA 1NI4A 1HT0A 4PYKA 2VPQA 2XMZA 1VDMA 4QPNA 3IM1A 1DBRA 1SC3A 2FWAA 2ACKA 1Y4UA 3E6AA 3H97A 1EWRA 5SY9A 1NVVQ 1ZQWA 1E3TA 1B0XA 4S1TA 3D5QA 4CEIB 3SYKA 2YFQA 2VAXA 2AOUB 2JK1A 1ECJA 4J29A 2Y1KA 3BM5A 3F6BX 4OBBA 5LMZA 4BWGA 1T6ZA 1V0JA 5DHAA 2RJ3A 2WJAA 4Q16A 1XZFA 1NOKA 2V4RA 4KN5A 3HJHA 3R1IA 3C4JA 4DJDC 5CTJA 1T8SA 2CFSA 5DI9A 1SEPA 2JFHA 4FGJA 1F5NA 4V0KA 2YASA 4OJTA 4XWKA 4KIGA 2CT8A 4QGBA 5BWNA 2YB1A 5SYAA 4ZQEA 2F6RA 2SBTA 3FZEA 3SJUA 1P7YA 4EGSA 4X60A 4BKRA 4YMMA 1HDGO 1D8TA 2ILVA 3HO6A 1W47A 5HZMA 3SVZA 3LPDA 1QO9A 2FK8A 1OXMA 3E03A 1DKOA 5TMEA 2HJ9A 1QH1A 2G72A 4HYEA 2K6GA 1P0CA 1SCAA 4L2IA 2AKEA 2KPOA 1PVOA 1KBZA 5LB4A 1QB7A 4PV7A 4EITA 4GYWA 5C7LO 4QPZA 4RDIA 4LDNA 5HF8A 3LMKA 5L3VA 4N3NA 3OPNA 4QW9A 1Y48E 4P35A 3LWZA 3FUXA 4YJDA 2B4TO 4RH3A 4JT8A 4QXMA 4OL0A 1NKSA 3CBQA 1YT3A 5EL0A 3BS4A 3HSYA 4R81A 3CIFA 1RXVA 2D8CA 5FV7A 4MP6A 3PPVA 3GFOA 2GZ2A 4B81A 3I0MA 3SJCA 1CJVC 2O8NA 5BQXA 5C5DA 1OF1A 2VZ8A 2BFBB 2WHPA 1FQWA 3WA6A 4J3NA 2WVAA 1XHEA 2FWRA 3HP7A 5AW1A 3JALB 4A6PA 1GQQA 2O3SA 1QHXA 1V71A 3QEKA 5BPFA 5IDXA 1TC1A 4MWBA 4UVHA 3H6KA 2WSSA 1Z5ZA 2KN7A 1ZJ4A 1NKBA 1SCDA 4NNOA 3TTVA 3BCSA 2VH1A 2X0RA 5JDIA 5A2QA 3FUTA 1Y5RA 1EZ1A 5LQUA 4MS1B 1MO4A 4WNCA 2P68A 4I8IA 4JC0A 2CMDA 3D1VA 3NIDB 1AK1A 1IQ0A 1WMAA 1WU7A 5A0FA 1NW9B 1G4AE 4LCBA 5ALKA 5BP7A 2GGSA 2PUEA 1UFVA 2DUMA 1T3SA 5I7SA 3KTAA 4DG8A 2QRHA 2ANBA 3V7JA 1NVMB 1V9SA 1T3HA 3I2IA 1V4NA 2ZPTX 2Q07A 3SV3A 2D1FA 5B7NA 2O0HA 3OGUA 3CH5A 4LXTA 1NONA 4KU4A 3PWSA 3FOBA 5EERA 1R16A 5KVCA 1UK8A 1XF1A 2CNNA 5EVJA 1SXJD 1M0SA 4DCUA 5K5EA 3UJHA 2OWDA 1BHJA 3WIOA 1S0UA 4C8OA 3KJEA 1AHPA 1UPCA 5JCOA 3K4HA 4UBLA 1OX6A 1EZZA 1SD1A 4XCXA 5ITZA 4BQNA 4J7CA 2C77A 2GZAA 1ICIA 2KMDA 3PV0A 3TUZC 3SS9X 1H1LA 4ZANA 4QO7A 3M9NB 4TURA 3WXBA 4KMRA 1XZHA 1DAFA 3BH7A 5J58A 3CP8A 3CEPB 2I7CA 3PQ5A 3K8YA 3GFKB 2OPHA 4GR9A 1DX4A 4DLPA 4FB4A 2CZCA 3KVRA 4PZZA 1A97A 4RPXA 3C5VA 1VKNA 2IKSA 3WMRA 4YQYA 4LJKA 3ZKAA 2EW1A 2NSJA 1WLYA 1XU9A 3C3CA 3D8SA 4AP5A 2I3ZA 2DH6A 1C3XA 1LPSA 1UMCB 1RP7A 2D0DA 1TJ4A 5CVUA 4JVNA 3MUOA 1HDZA 1XN1A 3DR5A 2ZZNA 1AX9A 2A9JA 2BL4A 2MMCA 3AESA 4TN5A 1N8SA 2P6MA 1XLUA 3F3YA 5B36A 5HR5A 2ZTHA 4BO6A 2YMMA 3IUSA 4HN9A 4KQHA 1I3MA 2XIJA 4ND6A 1U1DA 2HA0A 3R0VA 4KE6A 3L0YA 5A7FA 3E2EA 1F2TB 4AQYB 1B26A 4AURA 3T5DA 3W04A 1XWIA 1DEOA 3TR6A 4HF7A 2FZ4A 2YW2A 4MI9A 1LDBA 3N0VA 4ML3A 3C5FA 2Q62A 1FVOA 4IIJF 2W2OA 3IUPA 4HEA6 5AW8A 1H8ED 1XQVA 1X2EA 3NORA 4FKZA 3B20A 1WW2A 1UBNA 2GPWA 5AM5A 1G2IA 1UOEA 3M6AA 5K0LA 2JLWA 1BKDR 5DGDA 3ZHYA 2ZI4A 4U63A 4KMOB 1G20B 1DUIA 2FMQA 4C04A 4RADA 1C2TA 4YRRA 4G8BA 1G5TA 1OBCA 3V33A 1D4OA 1S9FA 2EIHA 7ICFA 4PG4A 4KVGA 4JC5A 3U4CA 2PUVA 1S0MA 1NMZA 1ODJA 4QSMA 2QDKA 1DB3A 5GWXA 2D00A 2F1OA 5J4LA 1VG0B 5DNYB 2VK1A 1KEPA 2K8AA 3ZN2A 5JSFA 4AAYA 1WZUA 3D81A 4AG6A 1G38A 1U49A 3EUWA 3I6IA 3RAJA 4KRFA 5CT9A 1DG1G 3AYXB 1QCYA 3Q8KA 4G4GA 1X7XA 2J5KA 4C7ZA 1M0TA 4G4JA 4YT4A 4AVYA 3ECCA 4JENA 2C5EA 1RZ3A 3VH4A 2ORWA 1BIFA 5LOVF 1MT3A 2XA1A 4L5YA<