1NNLA

Crystal structure of human phosphoserine phosphatase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
205
Chain Sequence
SELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-phosphoserine phosphatase
publication title High-resolution structure of human phosphoserine phosphatase in open conformation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 205
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1nnlA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1nnlA01
4UMFA 5ALSA 3ZVNA 1L8OA 4Y2UA 3IJ5A 4NABA 1X42A 1RC8A 5AW0A 2FPSA 2OBBA 2G06A 4QJBA 3NASA 5ALPA 3U7FB 1EK1A 2Q5EA 5ALHA 2I55A 2Q4RA 1Z4PX 2MSNA 3U7EB 3DDHA 3KC2A 3KD3A 5FP0A 3DNPA 3E81A 3ZTWA 1F5SA 2YMMA 1K1EA 1U02A 5AM4A 2IYEA 3SKYA 1QQ7A 4UMVA 4HGNA 4GIBA 4YCLA 1YNSA 4NWIA 5AW9A 3F9RA 3N07A 5ALMA 2WHEA 3OTQA 3ZX5A 3OCUA 2BDUA 3QU4A 4Y2TA 1U7PA 2PKEA 2YBDA 3BA6A 3NUQA 2ZBDA 4BEVA 1RKUA 2C8KA 2I6XA 3WKEA 1WVIA 2JAWA 2CFRA 1ZRNA 3NRJA 5IS2A 2CN1A 2WFAA 1T5SA 2OYCA 3HYCA 2YN4A 4Y2QA 4Y2JA 4FE3A 1ZS9A 1L7NA 1Z88A 1LTQA 2R8EA 1ZD4A 1VJ5A 2MU1A 1ZD3A 1NNLA 4BX0A 2EARA 1YV9A 1LVHA 1S2OA 2IOHA 3BWVA 3QUQA 4BEWA 1QQ6A 4YIKA 5ALDA 1RRCA 2B8JA 3AR5A 4UMDA 2G08A 5ALYA 1YS9A 2FPWA 5JJBA 5ALVA 3I6BA 5ALNA 3L0BA 1TA0A 3QU9A 5ALLA 3R09A 1Z5UA 5AW5A 5AICA 2FDRA 2FI1A 5AM1A 5ALEA 3KBBA 4G9BA 1L7PA 1RKVA 4BYGA 4CF5A 2G07A 3PGVA 4EELA 4MWOA 1FEZA 5AM5A 3EF1A 2WF5A 4YIHA 3WKAA 5AVUA 3AR9A 3AR4A 3U19A 2AH5A 1Z4KA 1RLTA 3RFUA 1SWVA 3AR7A 2R8XA 2FPUA 3IRUA 4HGOA 2ZOSA 3U7HB 5AVWA 3WK4A 2EAUA 4BNDA 4C4SA 2HSZA 4UARA 1ZOLA 3WGUA 4CNQA 3SF0A 3FZQA 2GO7A 4OFZA 4UAUA 3WGVA 3NAMA 3R4CA 3W5AA 2FEAA 1U2TA 3RF6A 2I34A 4NV0A 3KOOA 5AI4A 5ALRA 1Y8AA 2HOQA 5AIBA 4XQ0A 2AUTA 3ZWDA 5AVVA 3W5CA 3ZVMA 3D6JA 2PR7A 1RQNA 3UMGA 2O9JA 4C4TA 3PDWA 5ALGA 1PW5A 1Z4MA 3CNHA 4BBJA 1XPJA 3L8GA 4L6CA 1WZCA 2JGAA 4Y2SA 2IOFK 1QQ5A 1RLOA 2P9JA 4Y2XA 5A3QA 3ZVLA 2GFHA 1L8LA 2G1AA 2W43A 2G0AA 2WF8A 5AM2A 5ALZA 3OCXA 3SLRA 1L7MA 4RETA 3VAYA 1L6RA 5A3SA 1JUDA 3QLEA 2JAOA 3ZUPA 4UU1A 1U7OA 1L7OA 3L8EA 5ALOA 4KNWA 2NO4A 3M9LA 4ZEWA 4ZEXA 1AQ6A 4DWOA 1RMQA 2YJ4A 3EWIA 5T41A 2W11A 5AW3A 5AVYA 2YMQA 4Y2PA 3E58A 5AK5A 1KYTA 1Z4OA 2ZBEA 3W5BA 2B82A 1QH9A 3ED5A 3AR2A 5AIAA 1NF2A 4YGYA 5AW1A 1RLMA 2P27A 1VJRA 2D2VA 3P96A 1U2SA 3B9BA 2WF9A 3R9KA 3CZ4A 3L7YA 1ZD5A 1ZRMA 2HO4A 5AHXA 2HI0A 4EENA 3J7TA 1VFPA 3QU7A 3L1UA 1Z4LA 3I1YA 4ZEVA 3WK5A 1RDFA 2HDOA 3WK6A 5AVQA 3MMZA 3U26A 2QYHA 3FPSA 4UW9A 3L5KA 2AGVA 4I9GA 1TE2A 5AI6A 2YJ5A 3MN1A 3FPBA 4XOUA 3QXGA 3N28A 1SU4A 2BDEA 2GHTA 5AI5A 1RKQA 3ET4A 2WF6A 3SHQA 4DW8A 5ALQA 2I54A 1RMYA 1Q91A 4HYTA 1XVIA 4DFDA 3AR3A 5AKGA 1RMTA 1IWOA 3FVVA 4HGRA 5AKEA 3DV9A 4XE5A 4UM5A 4OD0A 1MH9A 4BX2A 1TJ5A 4E88A 4B6JA 2C88A 2P11A 3K1ZA 2RBKA 2ZG6A 3OCYA 1S8OA 2YY6A 1J8DA 2ZBFA 4KX3A 3QUTA 5AKKA 3A1CA 5AKYA 4CF3A 2PQ0A 4JB3A 5AW4A 2JARA 4UASA 4FYPA 4H1WA 2DQSA 3NANA 5AVZA 5AKHA 2O2XA 5AW2A 3NALA 3U7GA 3ONNA 3WKCA 4CE6A 4OCZA 5ALIA 1Z4IA 1XP5A 2C8LA 2HX1A 1TJ4A 1ZJJA 1Q92A 3FM9A 3ZU6A 5AVSA 3ET5A 3OCWA 4J03A 2AMYA 2GHQA 2NYVA 1Z4NA 4HGPA 2P69A 4J2TA 3ZWKA 3I76A 5AK6A 2ODAA 1RQLA 5AM0A 4EZEA 2HF2A 3DAOA 5AESA 5AW8A 2B30A 5AKJA 2G80A 4BX3A 3WK8A 3M1YA 4YCMA 4Y2RA 4HAIA 4I9FA 3N1UA 3L0CA 5AW6A 2FPRA 2Q4TA 3MC1A 3KZXA 2ZBGA 1Z4JA 2VKQA 3AR8A 4FFDA 3OPXA 1WPGA 2EATA 4KYTA 5A3RA 4KN8A 3A1EA 3UM9A 1CQZA 4L6AA 4OHFA 1SWWA 5AKLA 5AVTA 4HGQA 3QNMA 1N9KA 5AVRA 2RARA 4UAVA 3UMCA 3OCVA 1YJ5A 5AI0A 3OCZA 4F71A 2WM8A 4YCNA 4UATA 2HF7A 2W4MA 2YFYA 5AM3A 4YH1A 2ZXEA 2IA5A 3ZW7A 4AS2A 2BY4A 2B1QA 4IFTA 3ZTYA 2OA0A 4GXTA 4C4RA 4QQFA 1O03A 2YJ6A 5AKIA 2NO5A 4BKMA 3NIWA 1Z5GA 3PCTA 3N5KA 3L8HA 2YMPA 5AK4A 4AS3A 1TJ3A 3ESRA 3WKDA 3U13A 3QU2A 5AVXA 2G09A 5AI9A 2B0CA 2X4DA 2I33A 4NFLA 5ALFA 3UMBA 2B1RA 3QX7A 1NRWA 3GYGA 3TLMA 4EX7A 4UM7A 5AK3A 3HLTA 3I28A 2I7DA 5ALJA 3FGOA 2YMLA 2OM6A 1CR6A 3A3YA 3MPOA 5AKXA 3ZI4A 3SMVA 3EPRA 2HCFA 3ESQA 1O08A 2CFSA 1QYIA 4Y3UA 5ALXA 3ZX4A 4AP9A 2HHLA 2B8EA 2RB5A 3B8EA 3E8MA 3QGMA 4RESA 4F72A 5AW7A 3QU5A 3QUCA 2RAVA 4EEKA 4UU0A 1T5TA 4O8CA 3QYPA 2JAUA 1T9ZA 3WK7A 2IOFA 4XPZA 1EK2A 4PNHA 1WR8A 2FUEA 4MUMA 5ALWA 3S6JA 3L8FA 5ALUA 1RPZA 1YMQA 3W5DA 2HEGA 4KNVA 2R8YA 3IB6A 1ZD2P 3N8GA 4L57A 4JDPA 3PGLA 3SKXA 5IT0A 5IT4A 3SD7A 2C4NA 4UMEA 2FUCA 1Z4QA 3EF0A 2FPXA 2WF7A 5ALTA 2C9MA 5E0OA 2QLTA 1N8NA 2GMWA 3KDPA 4G63A 5AKZA 4EX6A 3AR6A 2YJ3A 4KX5A 3B9RA 4Y2VA 1J97A 5ALKA 3QUBA 4DCCA 5AI8A 3L1VA 4NAVA 1YDFA 4CF4A 4IG4A 3L0YA 3E84A 3WKBA 2R8ZA 3WK9A 4Y2YA 2CFTA 3A1DA 4BNDB
chains in the Genus database with same CATH superfamily
5F35A 4US2R 4EBDA 4RJKA 1ZSNA 2YCBA 3TUJC 1DTSA 3L0SA 3NP9A 4DQVA 2UXDB 4YRKA 3TACB 4RSMA 5B6JA 1Q1QA 1DG9A 4FBMA 1GPUA 2VXOA 2JR5A 2AEEA 2V5AA 2QF7A 1M2GA 3PD7A 1IFXA 1XJCA 4WW0A 3HUFA 4LIPD 1QQBA 1YA4A 3PKZA 2P68A 4ZYLA 1KQOA 5IVKA 1C7ZA 1AGYA 4BZZA 2H1LA 2BGMA 3ENNA 3PRYA 4XIFA 3QUQA 4R5MA 3A1UA 3X1MA 4CCYB 2WDPA 2QB0A 1L7XA 4KMRA 1O9BA 1ZBDA 3RG8A 4EA6A 3G8DA 2KG5A 2HY7A 4BO0A 2XI4A 1I7PA 5EFZA 2V97A 1DLJA 2Z6VA 3PNPA 1GT91 1SG9A 4HDKB 2OSBA 3SPXA 1CNFA 2R65A 1KJQA 1WUTA 4BJHB 3HKEA 2KE7A 1DUVG 3O47A 1IQUA 1GQYA 5A4KA 4IJMA 1T8SA 4ZA2A 1ZR4A 5J2CA 1YJXA 2R85A 2W9CA 3QOWA 1UUFA 2O06A 3C87A 4PLHA 4RQ3A 5JJIA 1GPBA 5KG4A 2Z8XA 5B4TA 4A15A 5WRFA 1K8ZB 3OOEA 4IWXA 1B0UA 2GLEA 1XSPA 2AYZA 5GIOE 3ASYA 4OJ6A 4A6EA 2ZPAA 3VR1A 2HEIA 1UIMA 4TROA 3B6JA 3MJVA 4IQWA 4P0QA 1QIMA 1RMQA 3DMFA 2QR3A 4JP1A 2JK1A 4TTPA 1B8OA 2SKEA 4AU1A 3EXEB 1QGED 2VIIA 4NPCA 5CLIA 1L5HA 5HVNA 3K2IA 3K9CA 4D92A 1UM8A 1R2QA 2DPHA 2JH3A 2WOJA 2JI7A 1ECLA 3PNLA 5AXCA 4YJFB 4C7MA 1SOWA 2IP1A 3H86A 3WQRA 1T4CB 1M1NA 2V9ZA 2WIDA 3SLKA 3HZOA 1DBQA 3RFVA 4UTRA 3WGMA 5F7JA 2ZYIA 5KHAA 3RNLA 2I6GA 3P2OA 4V1CB 5DM0A 2Z30A 1ZI6A 3UZUA 4OJQA 3AKCA 3K8QA 3MGKA 3ILXA 5TGZA 5BSHA 5TEVA 4WNYA 4MRMA 3ABQB 2GCOB 1HYEA 4WPGA 3U4QB 8ICXA 1IBCA 3QEMB 3CH7A 2Q4TA 2JLUA 1JDPA 5BPCA 4QVKA 1G20A 4OFBA 2VDMB 4OL0A 3PUZA 1TT7A 4LFBB 4XR9A 4YLEA 1SEPA 1E1QA 3PZRA 3AETB 3GJ8A 2AUNA 2ZJFA 4YRTA 4U3JA 1P6XA 4PG6A 2QMEA 1H0HA 3FDJA 3CLTD 1SHZA 4CKYA 4TQSA 1DKNA 5JRDS 3WWOA 5FA5A 1ZP6A 1N2ZA 1P2SA 3NPMA 5J2GA 3CX7A 4I1IA 4N6GA 5D3KA 3KJZA 2F1HA 5D5PA 4F9TA 1GTVA 1N62A 3MPOA 5F21A 1ESEA 4CLEA 2C0CA 4U2CA 2H1RA 3EUWA 3CE9A 4LZZA 4MI9A 5JHGB 3CIFA 4AMGA 4TSFA 4HWSA 4YAIA 1O58A 1O95C 1U48A 3KTAA 1E6CA 5GJCA 4X94A 3U40A 4UMEA 4LDPA 7YASA 3K2QA 3HZRA 2ACEA 2PMBA 2KHQA 2NZYA 4RJTA 3T9EA 3OQIB 4LOKA 2A3VA 3BDPA 1CJVC 1B42A 4ZVNA 3JV7A 3HU2A 4QJIA 1BOFA 1TECE 4BNDB 4KOEC 2QN9A 4CIBA 2B78A 1G5FA 4HO1X 2JZOA 4B85A 4CQMA 4CPDA 1U0GA 1K1EA 4H31A 3C3CA 3HB7A 5K8IA 2JLAA 5BQPA 2HDHA 5KFCA 3ZDQA 2PGXA 2VH5R 2B1GA 3NHLA 2VJNA 3WKEA 4RF5A 1KJ8A 1MT3A 5KFKA 1NNSA 3VSCA 2WFAA 1HR0B 4C88A 3J80A 3TINA 1F7UA 3ETGA 2IQ5A 3T1HB 2XA9A 2AG5A 2UAGA 3OT1B 3CUYA 4NLCA 4IH4A 3DE2X 1QH8A 2B5WA 3I01M 2Q6LA 3DH0A 4XEHA 3JZMA 1CR0A 4D0RA 3L7OA 3F2IA 1PI3A 1IHPA 1OXXK 2OBLA 4N47A 3EIEA 5I9MA 3PLAE 2XKJE 2AGOA 1YZLA 4GUDA 4HNHA 3OZRA 4W9NA 1D9XA 1BA3A 4UBIA 4E1VA 5MGNA 5FUYA 1E5QA 3FAHA 1Z9BA 3SZRA 3PX7A 2FUKA 3BPSA 1PK3A 5LQNA 3FJ1A 3CR7A 2OQRA 2HOFA 1Y98A 2VJQA 4FO6A 2X4LA 1EVJA 2P91A 3JPSA 1MC8A 5ALGA 3PDWA 5K0TA 2O2EA 2QN1A 1WXXA 1SCUA 3T3MB 2KJ5A 1RACA 2WHQA 4GOJA 4R4JA 2C82A 1KMNA 2ZRAA 1D8BA 1M2HA 5DDIP 2O8NA 1L5VA 1BH6A 1A9TA 4JOSA 5B2FA 4A0GA 3S7TA 4BNGA 2HBRA 1UJNA 2ZUSA 1BPDA 1YFLA 3TMKA 1G21E 4JV0A 5DHQA 1LPBB 3PTZA 4RFVA 1PLLA 1SV0C 2OFOA 4OLHA 3G9XA 5EMKA 2RP5A 4ECEA 2AT1A 4EB3A 3L1JA 1II8B 3WO0A 4MQ5A 2JCYA 3ED1A 5CM8B 2EJBA 1WMFA 1JLLA 1UBHS 4LG1A 1Q91A 3NIBA 5LYJB 4H6WA 4NYJQ 1DWUA 1Q46A 3PW5A 4IZHA 2P9HA 1OLXA 3JATA 3FLEA 1RBZA 4JJFA 3U4GA 4DEYA 1O7JA 3NQ41 3WJ7A 4FUTA 5AKYA 1CB7A 5HDBB 1NBOA 1STOA 3QP9A 3AL2A 1DC6A 2R18A 2ZBPA 1YZNA 1Z4NA 3UGTA 5GTDA 3KTQA 1Q7EA 2NW6A 4CT0A 4D56A 2VG8A 1CY4A 2QQGA 1PN3A 1UKEA 4Q47A 5CXUA 3LO5A 1DT5A 5T57A 5IILA 4KLGA 4BP1A 2G5HB 3TUIC 4TN5A 2Q6VA 3SVZA 1JT2A 2D59A 2XV1A 2ATCA 3L04A 2WU0A 3P19A 2AI1A 5L3RA 3KKKA 4EI9A 6CHYA 4FPXA 1DRVA 3QWFA 3JZAA 3A3NA 1OU4A 2V1UA 3IFSA 2QVYX 3C16C 1V35A 3ELWA 3CVYA 4RT3A 2H3EA 5BQFA 4E3ZA 2FSGA 3KO8A 1DE0A 3ESRA 4JLKA 1BZYA 1I3CA 5JISA 5LP1A 1NJXA 3LPLA 4KR9A 2CXUA 1UODA 4OQEA 4KVAA 3I1IA 1GXSB 1OZAA 3VZSA 4DAEA 4KR2A 1GU7A 4R8MA 2JFFA 1DL5A 1V97A 4DR4B 1XHLA 1SXJC 4RZSA 1KIMA 2DPMA 3GNSA 2RJ3A 2QMOA 3GH3A 1TMGE 3WLHA 1L1QA 3BD9A 4M9LA 1E1MA 4D4HA 3HBAA 5DTRA 1KDOA 4OXRA 5FTNA 1CUCA 4OLBA 4Z4FA 1S0VA 5HKBA 2IODA 2R11A 3TR6A 4AX8A 4IC9A 1A82A 4H2DA 4LMBA 4NSNA 2V65A 4PAGA 3GLUA 4LJ8A 1U8ZA 4HAVA 3EY9A 4DCCA 4LX8A 3NHYA 4D26A 5CP2A 4LTMA 4P4SB 3ZQKA 4EYIB 1E2MA 2J0SA 5JCJA 4EBFA 3HJCA 4RVUA 3D7SA 3HJFA 4O0LA 2DFLA 3UOGA 3K4HA 3F53A 4XWOA 2VOJA 4B7XA 4M46A 4YPFA 2BDUA 4OJ5A 2PUGA 1G60A 1BFKA 4LDAA 4LBZA 1T8RA 4HYQA 5C18A 4DFJA 1MW8X 4KFRA 1RXUA 2HWXA 2SCUB 4RU1A 4XGIA 2D1TA 1E1CA 3KWMA 2RHTA 3ZHXA 3P9KA 3FAZA 3TTVA 4AURA 2ATXA 1D4FA 2Q5JA 4MINA 3EXFA 2GR9A 1TMOA 5J0XA 5DASA 2XICA 4WCVA 3EZYA 3B85A 1Y48E 1USUA 2PFOA 1A9XB 3D5TA 1JU9A 4OHUA 4CKZA 5AM5A 2EWWA 3T54A 4CF6A 4C7BA 2JZBA 3U16A 4OJLA 4B34A 2VH1A 4MROA 1V8FA 4UE3S 3UKDA 1P3JA 4K9OA 3TAPA 4CNQA 1SVUA 4EL5A 2CLIB 4C07A 1JVBA 3O4JA 2OHXA 5AI4A 1FP6A 2GS9A 3AEKB 4CQLB 5LQJA 3VU9B 4P3XA 2PVCA 4Q01A 5K09A 4TTQA 2OCAA 3AZQA 2O20A 1HEUA 4E94A 1QB8A 2A58A 2V6GA 3CBGA 2JIPA 1B6RA 5F73A 2FPPA 3JWEA 5TXGA 1EIZA 5L3QB 4B7CA 3MSXA 3F47A 4O6VA 5T41A 2ZWIA 3HBJA 5AVYA 1CP2A 3ETCA 1DRKA 5KMGB 3OFSA 1OTYA 3Q5GA 2EBUA 5B1HA 3R6DA 1CZUA 1VIMA 2ON6A 5BP7A 5IC6A 4Q0MA 1DX9A 3BE8A 4QPDA 3N2GB 4YLGA 2I9KA 2JEGA 5CTJA 1QAMA 3CT6A 2VT3A 1GVNB 2ZRGA 1IXSB 1KO7A 1L5FA 5DQIA 5B37A 2AEJA 4ZJPA 4G07A 4MKHA 1ZJ6A 1HDZA 5CX4A 4DL3A 3DL0A 2JGEA 3DZGA 4WKCA 4B6JA 2COUA 3CGWA 1P1CA 1RRPA 1ZQJA 2ZUTA 1WB4A 1HA3A 3TZEA 2Y1IA 3EZXA 3NONA 2CFOA 2X0NA 3VGJA 1SUAA 4TL8A 3V55A 4OCZA 2X1HA 4AO7A 3JQGB 4GQAA 3E15A 1GEEA 5FOQA 2OWEA 3KTDA 2H16A 4E5SA 1Y8ZA 4YQYA 1RYZA 4J0DA 1BVUA 4L9AA 3IX7A 2VPXA 2BGGA 3NRWA 3K1TA 1N2JA 1RNLA 2WOOA 1KMHA 2C57A 3HW8A 3EPPA 7ICEA 4PNPA 1LQUA 1GO3F 2P3QA 5JCOA 1R74A 4C6HA 1DO2A 1PFGA 3VH4A 2B1QA 4XB1A 5BT9A 4NZYA 2XCUA 1XZ8A 3IP5A 2NO5A 2H1IA 4J9SA 2ONCA 4BRWA 4CV1A 3Q3HA 2JL1A 4C8OA 1MZVA 1JJVA 2KLHA 1U81A 2HLDA 3JQ8B 3T9DA 1E4VA 3SBEA 2O8BA 2I7DA 1I4DD 2C5BA 3ZWQA 4HQRA 1I3NA 2E5WA 3JVEA 2R84A 4ARAA 1KY4A 1NAHA 5KS2A 1KI6A 4RK1A 3PFKA 3RRJA 2DE0X 3UW1A 1S1MA 1BNCA 4UPEA 2EQ5A 2FW6A 1UXGA 4AMUA 3SKXA 2EX0A 4MPRA 4R1OA 4ND4A 1AXEA 4MPPA 3TJRA 2JBAB 5ALTA 5FBVB 3EVGA 4IXNA 1EU1A 1U04A 3SM3A 2AU0A 3WKBA 4M1TA 1CD5A 1ZBQA 1NXOA 1YRYE 3FUCA 4J9OA 5ICCA 3WMWA 3QYFA 4LHVA 1JYEA 3BCHA 3H6GA 4YCAA 3IODA 4DIKA 1KMMA 1IWPB 4GF5A 1ZNQO 1G2IA 3H75A 4QWDA 5LR6A 2GEVA 2X86A 4D6PA 3CPSA 4HJXA 4Y2JA 1L8AA 1I51A 1QRSA 3ELYA 1ORWA 4FZ3A 5HQ3A 4S04A 3RTEA 1B7GO 3JYNA 3WGLA 3KETA 3CLTC 1RC1A 1NG1A 3KKEA 1Z12A 3NVMB 2YTUA 4LS3A 3RF9A 4M88A 4DEZA 5JV5A 1AS0A 3RR8A 4AP5A 3AP3A 3T4UA 4AXBA 2ZIXA 2YN2A 1NVWQ 2F67A 2P4HX 3EGXA 2CUNA 4WSOA 4JLOA 3K6SA 4A5OA 2DQ4A 3B1XA 1R0RE 1QV6A 3NT5A 1MB2A 4FW9A 2HXGA 1U6KA 1KO4A 2ZVQX 3BTOA 3NFRA 4MVYA 4CXMA 1GN9A 3Q7PA 4MW0A 1NOIA 4BO2A 5GIPE 3T0GA 3DFKA 2CMDA 2I78A 5C2JB 3ESDA 1KYZA 4XQEA 2DPYA 4RZIA 2PH5A 2IKSA 4D46A 1SBNE 1CULC 4O25A 3OCCA 5F3WB 3UBTA 3PJRA 3GT0A 2ISQA 4LOHA 3P7MA 3UPQA 1VMAA 1RBMA 1YQTA 3KRTA 2JCSA 3QVMA 1FCJA 4UAWA 2XCQA 4Z4EA 2HQ1A 1OXTA 5COBA 3LI2A 2AGVA 3UHJA 5DB9A 2RCNA 3P9RA 2PXAA 1ZOOA 4CWAA 3NDJA 3EXAA 5JIBA 1YVDA 3X1ZA 2KZZA 5LA6F 2OZKA 2VIXA 3RUCA 4JXXA 3O3NB 1ZQKA 3L0DA 1V3TA 4M37A 4ONEA 1HDIA 1NJWA 1J20A 1WXFA 1KZYC 2VLBA 5KX5F 4ABTA 3PJDA 4OHKA 3BYZA 1V3QE 4CLOB 3WR5A 4RKYA 2ZR8A 3ETDA 2DL0A 2H3FA 4AN1A 4WACA 1XQXA 2YQ5A 2MSWA 4XGRA 3VSEA 1KSHA 3WK8A 1GZ4A 3W6UA 4CTKA 4JP2A 2FSIA 1TA9A 2P9ZA 4W99A 3O8QA 3L6OO 4UTPA 1JRPA 2HRCA 2QU8A 1H2AS 3MJDA 4KAXA 5AVTA 4HGQA 1C80A 4BU1A 2OE2A 4F21A 1GL6A 3W9UA 4BGIA 3RYHB 3B20A 1E4EB 4OI2A 3KL4A 3TCXB 5DP2A 1CEYA 3BQ7A 4QJFB 2OENG 4UHFA 2FW7A 4EJSC 2HHHB 1JHDA 3FGZA 3DZFA 1SQSA 3KB8A 3R3UA 3NTVA 2EAOA 3BQTA 3WGQA 4JJIA 4RIHA 1ECPA 3TZKA 4UOQA 4MDEA 1ZQTA 1ZQHA 4KIWA 3GA5A 2VP6A 3EIFA 5AKXA 1K8XB 3QW2A 4DLAA 3K4QA 3J81j 4OA8A 3S2UA 4TTIA 5TY0A 2KFNA 3O4HA 3UWKA 2BKVA 2NT4A 1GL3A 3M9NB 1A2BA 1W59A 4ZTUB 3B3GA 4JDPA 4YJ3A 3C6XA 3U1VA 2XUDA 2OHVA 4GOLD 2X6RA 1RI5A 1JIVA 5J0UA 1JDSA 3NGLA 2JJ1D 3RRMA 4D4JA 3D7NA 3GG9A 7ADHA 3A1DA 5G40A 4A03A 3ZVNA 3ZR4B 2AX4A 4NU6A 2PQ6A 3EH2A 3RWBA 5CFOA 3R7WA 4I5DA 4JVOA 4Q34A 2Q5EA 2B6GA 5EPOA 3FLBA 1GL7A 2RHLA 4ZYZA 1ODFA 2I29A 3KWFA 2WR8A 3TXXA 4TLDA 3T5BA 2VK1A 1AUOA 1V96A 3EZ7A 4G8BA 1U8TA 2CE2X 4JHXA 3V7UA 1E18A 1ZMOA 3BH6A 3DHVA 4BNXA 1OWPA 3QZ7A 1IM2A 2C22A 1VLHA 2VS1A 1Z88A 4B7AA 1QGOA 4FKMA 3G1UA 3V6MA 3FW1A 1XYGA 1MF7A 3FKQA 2E1RA 5ELXA 1FX0A 1CJSA 3CF0A 1H1LA 4MCAA 3SY8A 1TA0A 5E6RA 2QUJA 3LVWA 3GUHA 3TAXA 3EZLA 1RKVA 5HUJA 1JHUA 3IRVA 3V8RA 2RK3A 2XUQA 2X2OA 3RFUA 1JFSA 1EAYA 2C4MA 5IJZA 1IK4A 3RC2A 4EF4A 5JAZA 1IUNA 1MO3A 4TMTA 1FQJA 4OUDA 1O1YA 4JXJA 2ABWA 1WNTA 2Y1KA 5LB2A 4CKWA 2NUTB 3VNVA 4P31A 3BFPA 3G8BA 3SZ3A 4J9PA 4D79A 5JI3E 3A05A 4JVSB 4FYMA 1VPTA 4LF4B 3CCBA 1M7HA 2D1YA 4M0FA 1QKJA 2ACWA 1CQPA 1VE5A 4ZOBA 1W73A 3OIUA 3DO5A 5IKMA 4LHYA 5I9SA 2BCGY 1S2MA 1CUXA 621PA 1GTL1 4HPXB 3EHDA 1M6NA 1O3YA 1B43A 3BGWA 3C4QA 3KUXA 4FMCB 5DMXA 2OLKA 1M6WA 2KQUA 3BZUA 4BQRA 4Z8XA 2XW6A 2XAUA 1SHJA 2AR9A 5J0YA 4MHSA 2J3EA 2Y66A 5AHXA 1QIHA 1YC5A 1BO6A 2A1AA 2PI5A 3HA2A 4POAA 1E2HA 4B8YA 2J07A 1SL0A 5LB4A 5DHTA 4NU0A 2RHHA 5CB8A 1SU4A 4Z0PA 3GEDA 1G66A 4S0ZA 2EV9A 2BPGA 2GUGA 3C7TA 3E9QA 4I4LA 3PDUA 5IG2A 5FOWA 2PRZA 3FR8A 2P6OA 3P2EA 3PEFA 4BHTA 5TPWA 1B6SA 4IGKA 4QO8A 2AVDA 1ZNXA 1D8TA 1SCDA 2VNHA 3AVYA 2WU8A 4IVPA 1G98A 3QM1A 4CE6A 4C6TA 2CKDA 1Z6TA 2KSOA 4M1WA 1I7QB 1ZJ4A 2OMKA 4IFIA 1NXSA 2BZ1A 1KZ6A 5ES3A 4HFNA 2GPTA 1V1RA 8ICSA 1UK7A 2VP0A 3ZV6A 4H9GA 4BUGA 1WTCA 1E2DA 4Q3LA 4B17A 1MVNA 1SBIA 3ZY4A 4QYSA 1PD0A 3DC2A 5I01A 3SQMA 1N78A 2HWYA 2BD0A 1E7RA 1Z5ZA 2VZEA 3EH1A 3H4MA 3Q3GE 3FZNA 2XH8A 4KP7A 5FOVA 3SLGA 4W9NC 1S8AA 1Q0SA 1MHPA 4I3HA 2H11A 1PRYA 4N18A 1GLGA 3ZWAA 1QS0B 4XQCA 3WOVA 2RH5A 3NJ8A 3EWAA 2UZIR 1WKCA 3OZSA 4NCJA 2G9UA 2VYVD 3BWXA 4GOXA 5KNBD 1CHDA 5EHIA 2WPNA 1CUWA 4AL4A 1VBMA 5DB6A 4J43A 4NPHA 4CIXA 2W9MA 5IF3A 3PGLA 4BYMA 2YKGA 1KPGA 3B13B 1KORA 2DF4B 2YXNA 3GBSA 3UAYA 3G0HA 3RUEA 1OI3A 3HCCA 1IIBA 2JGMA 1VYVA 3B9RA 3MJEA 4E5UA 1CJBA 2F62A 4C21A 2WI8A 1GGVA 1MVOA 2DFPA 4QTYA 5KWVA 4JMLA 3GOHA 3ZY5A 4GEGA 1SRQA 3CP8A 1EJ0A 2X23A 1G18A 2OBBA 4OXKA 3KXLA 2G36A 1EXNA 4MCIA 3I62A 1ZCFA 1HYHA 2D0DA 2Z2ZA 5CYOA 2BM1A 1R50A 4UU7A 3OZDA 3V1UA 2AFHA 1M5TA 1W36D 3BZKA 4CLDA 5KFTA 4ZK2A 1P0MA 4OXYA 4B44A 3G5TA 4I5GA 2WP8J 3DAYA 2DKOA 3AKEA 1H3EA 3A6KA 2WEKA 4TVBA 3KYCA 3H83A 1DEKA 1LJ8A 3TTTA 1CG6A 1QIGA 1BHQ1 4K2HA 4ZI5A 3EGEA 2C7PA 2IBSA 3MM4A 4HN2A 1LY1A 2XGJA 3DEZA 2VHEA 3H13A 3GIKA 1AMNA 5LVAA 1IEQA 2A86A 1CNEA 1ADBA 2ZLBA 3ETEA 5EKSA 2Q1WA 2FCRA 5CDSA 3HXQA 3R09A 2EOAA 3T94A 4FU0A 1QRUA 4ZJYA 1C7IA 4MUNA 1C4KA 4UHCA 2XX3A 1E9SA 5E8RA 5DLGA 3DYBA 4U2EA 5IIKA 3OHBA 2QL7A 3HWSA 3HKCB 5EOVA 3PBKA 3BXGA 4H0NA 1FFWA 3H1FA 5HP4A 2AYYA 3ALRA 3R40A 5JG7A 2WU1A 5JPDA 1QJ4A 2VPQA 4BU0A 1Q83A 3IDSA 1G7TA 2XHEA 1E4OA 3QY9A 2AG1A 3FMOB 5LQDA 1Y9JA 4NMXB 2JAXA 3KLOA 4TVOA 1T6YA 5BW4A 1O96B 1G3MA 2VJOA 3H1GA 4CEIB 5CB4B 1XVLA 1WZNA 1X2EA 4YV7A 4DMLA 1IZ8A 4E14A 1MLDA 3GYBA 5GZ1A 2XJ9A 4G24A 4M49A 1GO2A 4X1IA 5IC5A 5K0CA 5CA7A 4LPKA 1N60A 2YOHA 5E6UB 4XI9A 1M7BA 2MIIA 2J33A 4RGVA 3OY2A 3LUFA 1XDWA 7ICGA 3N0RA 4INZA 1ODIA 2FR0A 3HVHA 3R9XB 5KG3A 4MVJI 4GPAA 4D57A 4LQ4A 4HNSA 5HKOA 2JLYA 2FWRA 2FLKA 3PFCA 3O1HB 4JSRA 3G0DA 1GLNA 1PR6A 4PX2A 1MEJA 2C7OA 1P4SA 4ANFA 4U00A 2A0XA 5JRJA 1QTMA 3M5DA 3RODA 1MG5A 2E3JA 3TDKA 5H8WA 3PPIA 2PANA 3C1ZA 3KJIA 1SHKA 3FB4A 1CJMA 2AOTA 1IATA 3PEYA 3WBFA 3RJJA 1OIVA 4PL2A 2EKDA 2PLFA 1AKTA 4NLBA 1U7ZA 2XXBA 3PE6A 5L1KA 2A35A 1TD9A 4AG5A 3AI1A 1DKQA 1QF7A 3P52A 2VK2A 2FG7C 5G0WA 4JUIA 5K8VA 4DREA 1J42A 3GRKA 1R8JA 1CXZA 2J9RA 3D54D 3ZKWA 3FTDA 2J5KA 4BVHA 3OFJA 2B7BA 1VPLA 3JVDA 3UPUA 3NHBA 2AK3A 5FWYB 4RSGA 2WFLA 3HDQA 3L7JA 5JJKA 5MN5A 8ICKA 3TLEA 1PR4A 3NS1A 1V7ZA 4QQKA 3TE6A 5T14A 1FFGA 4ZT3A 4F3TA 5A5FA 4M55A 4W9RA 1O8BA 1K6EA 1JF8A 4F11A 1PK9A 1FNSA 1PYOA 2A1TS 2TMYA 2C31A 4ED2A 3P4XA 2YINC 4BWYA 3WL7A 1KFDA 2GI4A 4QPNA 1B1CA 2BHRA 2VTKA 2JGDA 1AC5A 2ID7A 5DWVA 3IUSA 1J1ZA 5KYUB 3U6KA 4X84A 1MGOA 3Q5DA 1YVPA 3EPLA 1LLDA 5I5EA 4IL5A 2QUBA 3NIGB 3R23A 3HYTA 3HCPA 4WESA 3A1SA 3CF6R 3W5UA 1A8IA 2AQIA 4BLVA 2RMKA 1ENYA 3WXMA 2CNWA 3N2LA 2NZXA 2N1RA 3OMXA 1R6VA 5LMCA 1YDFA 2I7VA 4LJLA 2OKGA 1TD1A 3FUUA 4MIKA 2I22A 1OXMA 4I5FA 4M1OA 5G4KA 4U6PA 2WT8A 4GPEA 2QL9A 3WP1B 2GFIA 1ZVMA 5HSGA 3D9QX 4MUBA 3X1XA 2GWRA 1TT5A 1HDXA 1VJGA 2VPTA 5IAAA 1NZJA 1WX1A 2V9PA 3KQVA 3KU1A 4OQLA 4BO4A 1NLUA 1GNTA 5ESWA 4TV8F 4DUGD 3A1FA 4IDDA 2VWQA 4M1SA 3KKAA 4QEDA 4IR7A 5DTIA 3U9TA 1KOGA 4PAQA 1IBLB 3LFTA 5H3HA 4HZUA 4DG8A 1R0YA 4MI3A 3KR9A 3OJCA 4RTKA 5ICMA 4I08A 2B8JA 4HY3A 5IVIA 3KUCA 5J5VA 4I8IA 4BXOB 3I6BA 5E7JA 2KSQA 2NUAA 1DCKA 2EDCA 1LDMA 4HRXA 2WICA 5JNUA 2EDAA 4JDUA 4ENSA 2WWWA 4B9TA 4YAFA 3SQNA 2C2XA 4EKGA 1WD7A 5IFKA 1GVHA 2KKPA 3ORQA 4CKXA 4BMDA 1NJGA 1DQNA 3LVFO 2CVQA 1ZOIA 3QF4B 3CONA 1XXLA 4DILA 4Z9AA 1QV9A 4ZAYA 1NR7A 2Q5CA 2V45A 4AYBC 1O5IA 4QGSA 4N49A 5FJIA 2H92A 2OD2A 3Q7EA 3I32A 3KOOA 5CCDA 2GJKA 1DK2A 3F49S 3R74A 3I9KA 2J1LA 2DR2A 3V1YA 3DKIA 4XPIB 3GFGA 4M1EA 1S10A 5BWNA 1ZFNA 1U31A 4IM7A 5AVJA 4S1NA 4PIPA 2CNDA 5K3SA 1TYDE 5J0RA 2HMAA 4ZEXA 4TZTA 2YJ4A 3W8RA 2D1FA 1KH3A 3H5TA 4PG7A 4BFWA 3HACA 2JA2A 1AZWA 1NF2A 3X3HA 5M2QA 1KU0A 2ZB4A 1EJBA 1ZWKA 2ZRMA 4FR5A 1VFPA 5K8LA 2CVPA 4KIUA 3VHXB 3DPSA 3ER8A 3EQ9A 5HIIA 2IELA 4K1LA 5I4KA 1DB3A 4Q4HA 1E92A 5AUOB 4MO9A 3RS8A 1CX9B 1TEVA 5FV7A 2AKEA 1NU6A 1ORHA 5KT3A 2ZE5A 1PFYA 1XSEA 5IULC 4ITRC 4NK4A 4O4LF 1G9XA 4PZCA 3I73A 4INOA 3W3AH 1WMBA 4UCQA 4G3XA 2C2KA 2QRKA 4IGEA 3P2MA 4D43A 5HKLA 2WHPA 1H4QA 4X93A 2FSHA 1BCSB 4ALKA 3G7UA 3PUYA 3AFHA 4EITA 3L06A 5CLGA 3MNFA 3AVPA 1SR8A 4U4AA 3MJCA 4EO4A 5F78A 3NOVA 1KQNA 4ZGGA 1EVIA 3TXAA 5DJ5A 1D4AA 4C8MA 1T6BY 3D4NA 1GCOA 2R79A 1ZXLA 3RS9A 5IXJA 4MYSA 4D02A 4UEJA 2A9KA 5KFIA 3FDZB 1M67A 5DB4A 3TNFA 3MQ4A 5KL1B 1SXJE 1JR6A 1U1IA 2PMWB 1RCTE 1AHPA 1YTLA 1AKMA 4R5HA 3GPLA 1SCQA 3NHWA 1HDOA 4F1WA 2ZRQA 5AJUA 2C92A 1O03A 1TPZA 1T35A 4B7ZA 1KOLA 2VK4A 4ZREA 1QR6A 2WIAA 4BTEA 2ZBUA 4PO1A 2V7EA 7REQA 5FPPA 1OI2A 5LQMA 1OASA 4DADA 3DKVA 4QDUA 2X4DA 2GF2A 2G7ZA 4RQ4A 3R3WA 3SIWA 2D2FA 3EA5A 4UM7A 3DFUA 3O91A 3NX4A 4RU9A 4KBFA 1NX6A 1F8UA 4KVFA 4YMGA 4AP9A 2IS2A 2WTNA 5E6SA 3E9YA 4CEJA 3OIVA 1YC2A 1U0RA 2DT5A 2XPCA 3EOAI 1XRMA 2VQSA 3CX8A 2HHQA 4ZARA 3WQHA 4I2GA 1SVIA 4Y6QA 4A36A 5L7YA 1MP0A 2UUAB 1H5QA 3QA9A 1Y42X 1DPGA 5KI6A 4Q7MB 3DXZA 1FLNA 3OPMA 3VJKA 4M0PA 1YH3A 1BJKA 1DGJA 4F5OA 5AKZA 2L2QA 3BXFA 5KQSA 4JL8A 5F5XA 4JYMA 3TLBA 3ZE0B 2FN8A 5CMLA 2ZTVA 3IDOA 3TGLA 3QI2A 2DUNA 2COEA 4H3HB 2R7MA 5DHFA 2XUAA 4FEAA 1RWXA 4G5FA 3F1LA 4JS0A 5I9NA 2WQZA 1MA0A 4FD3A 5EA2A 1AV6A 1Y33E 2DCUA 5AXDA 4Q7EA 3VXKA 4EB8A 5KUTA 2BFWA 3AUKA 5IU6A 1WS6A 3BCRA 5A3VA 3ZHBA 1G291 5SYAA 1Y3IA 3PICA 4BNVA 1G19A 1LSUA 5H1YA 4Q5IA 4BE9A 4BDPA 3AUTA 2I8AA 3LSYA 4EG4A 3RSGA 1M66A 3N0XA 1KEWA 5BRNA 1OGYA 4AJOA 4DTCA 3KOWA 4I27A 4RS4A 4KN4A 2F48A 4RWEA 1EYZA 3O9VA 2QT0A 2KJ9A 1K2WA 1B8PA 1SCNE 2VA9A 3I6ZA 5IZCA 4RPYA 1XQWA 4D80A 5TLSA 1B93A 3EULA 3SF0A 3C3DA 4MW6A 2GSWA 2QNIA 2QJOA 2A8YA 3GZNB 3EC2A 1QRDA 2CMFA 4MWCA 1DBRA 1YBAA 2Q2OA 4R84A 5IDWA 4EW3A 2E7ZA 4LECA 4U7HA 2O9JA 3SXPA 2JHPA 3GVIA 1Z25A 3AZOA 3RFCA 1LPAB 3G82C 2LD4A 5AVKA 2XXAB 3UV6A 1HDCA 4K8RB 1JQJC 2ZYGA 3PD0A 5HHTA 4K03A 1NP3A 4I6JA 4ZJZA 4WE3A 1BG6A 1XL1A 1XOIA 2ZT6A 4A2QA 4W5NA 2UVVA 4KNWA 5JE8A 3MRSA 4Y0AA 3URKA 4G89A 1HTBA 2GNOA 1S1CA 1W36C 2HM7A 2QTTA 2RE8A 4KRGA 5GM1A 1MTZA 1UHUA 3C74A 1DAFA 1Y3DE 4MV9A 1SC4A 1YZTA 3X2SA 3BGSA 1F8FA 4Z9FA 3INYA 1YOBA 1BE6A 1VKJA 3MA0A 3B6EA 5KOJB 1BPEA 3A25A 1T1IA 1UQVA 3GVXA 4BIIA 3TQQA 4BFZA 3GELA 4H7JA 4EJSB 5JATA 1P0IA 2EJUA 2W2VA 3AUSA 5FYQA 5IVPA 1WO8A 1W29A 1I3OA 1DC3A 5BXYA 2Y1EA 1FSZA 2NSDA 3CVUA 2HBZA 5JSZB 5DW3A 5KYXB 3B82A 5D85A 4EAQA 3RR7A 5J0TA 3R5FA 5E3JA 5G1OA 1QZXA 4J07A 4IIGA 3R0XA 4J03A 4N3NA 3WGJA 1YZFA 3I3OA 3FNEA 2L42A 8ICIA 1MIHA 3FIUA 1GFZA 4QDKA 3TLCA 1NC1A 2YR0A 4PHGA 1UCFA 5IYZB 1I6WA 1YJ5A 3QWIA 4PC7A 4QPJC 5JBIA 3FPGA 5J1TB 3U2QA 2F1KA 5CAEA 2JH8A 2P2CA 4LZAA 3C5WP 4O2RA 4MWBA 2IYVA 4PAMA 2YY7A 2W54A 5JYDA 3V1MA 1SVOA 4RPGA 2WUEA 3P8ZA 2Q3BA 3I64A 4RMGA 2QLFA 2Z6AA 1GNVA 5GY7A 1Z34A 3C6QA 4XYEA 4GOND 3OQHA 4QELA 2F43A 7ICUA 1UWCA 3OGUA 2CLKB 3H0KA 4M8IA 4HLUA 1KZ9A 4JKIA 1O08A 2PZKA 1KDPA 1UAAA 3KHUA 1YOVB 1E8MA 3LJKA 1L4BA 1G8AA 5EJFA 1QRTA 2QN6A 3H97A 4P4GA 1PBTA 4JYZA 3QXCA 5GV8A 1VCNA 5EP3A 3L43A 4DLEA 2Q7XA 3L05A 2JFBA 4ZWNA 4DSUA 3SAGA 4QXRA 3S3TA 4LGVA 1C3OB 2FOXA 1WDTA 1VGRA 1UINA 4TXMA 2NNLD 1UZMA 1J97A 4EYOA 1LKZA 4MYUA 4QOIA 2HRQA 1KFTA 2I7CA 4GOKA 2PYDA 3B3QA 1FFUA 1EFAA 4IHQA 2X8BA 2RK6A 2VUTA 2OGUA 2H6EA 1ML3A 2LNDA 3OOYA 1H0SA 1ZH6A 3AI3A 9ICRA 1UC4B 2QL5A 4LV6A 2LCFA 3GV0A 1IAQA 2HQRA 1XXHE 1Q1BA 2B9EA 1K4MA 1GARA 2CCKA 3GJRA 4G5SA 3PC8A 1NZDA 4X7PA 4JQYA 3V9PA 4JP8A 4L72A 1NU8A 3T9CA 1AD2A 3H8WA 1MEEA 3PPYA 5KFGA 5J5CA 4AXXA 1D1PA 4Q4JB 4MQBA 2EGUA 4IDQA 4Y0NA 2DPLA 4B6GA 5EJAA 5ECWA 1VJ5A 1JDUA 4DHEA 2FQXA 4N8EA 3ESAA 2FETA 2PA0A 5DCYA 8OHMA 1KJZA 3G6XA 3L7LA 1RXEA 3ND7A 1A97A 3I6IA 3KZMA 3WP0A 5KU7A 3PSTA 2FB9A 4ND2A 5C8YB 4AO6A 2N1MA 3ZXXA 4BEJA 1E9FA 1H8EA 1SBQA 1K27A 3C85A 3UBMA 7ICFA 4BNIA 1IRIA 1U0HC 1ZUNA 1QWOA 4J94A 3RWOA 4V0ME 1QK3A 1OPRA 1E96A 4M0CA 3UC5A 5LMNB 2HSZA 3N70A 2CL0X 4E6PA 4AD8A 2AQ0A 3WRVA 3RF6A 2R5FA 4QTXA 1S96A 3GHHA 4N03A 1JB9A 1DAMA 2FW1A 2FRVA 3A26A 3CO0S 2OLEA 1HFWA 1AKRA 3B1KA 4QZ8A 1C8BA 3M6FA 1E60A 1OTXA 2D2IA 3UXEA 4LJ7A 2PFSA 3QMMA 3TLYA 5DCUA 2I0FA 4BC1A 4ZOLA 3TR0A 3SVLA 1SKRA 2A57A 5EAIA 5LZ9A 1U7OA 2ZKLA 2NO4A 1P19A 3SSAA 1QP4A 4RLFA 4Y2PA 2VF4X 1UP6A 1JX6A 5IARA 3W6ZA 1I01A 4ZT5A 1UKYA 2E4VA 4P92A 2FEOA 1G8JA 1MXHA 3NHJA 4LF8B 4US8A 2W71A 3T3HA 1S5LU 2I62A 1SC6A 3K73O 3U4MA 1RKQA 4PYJA 5JARA 5JWRA 5LYJF 4JWMA 4PLCA 1EJ6A 4RWZA 4QUHA 1I4OA 2QAIA 5CIYA 1V5EA 1O6ZA 3PVZA 4Z8YA 3KNZA 2UZ4A 3WY9A 1UFRA 3KDSE 2H08A 4TMZA 2X5OA 2PQMA 2FDXA 1E1QD 5K7SA 1F5NA 1E3JA 5IAEA 2BMJA 2VR1A 4Q3CA 3P0EA 3AESB 1FU4A 2F9MA 3Q7TA 2BUBA 3B8HA 4FGZA 3VV2A 3V1NA 5B7NA 3IVXA 3AV0B 1GCUA 3ZD6A 2VHXA 4I5IA 3AEQA 4KQJA 2A94A 3L1KA 3HCRA 4LUCA 3RTCA 2O6LA 4D5EA 2ARKA 2QLJA 3ND9A 3R5HA 1JGTA 4M9GA 4K6MA 2XB8A 1M2VA 2PYIA 1RLJA 4IIXA 4NECA 2O7NA 3K9WA 3KK0A 4B9MA 1I1OA 5HZMA 1DRGA 4B9VA 4N65A 4GYKA 4OHZA 4TSFD 3VKHA 5JXHA 1R1DA 4Q1FA 4CKEA 1C4XA 3SR0A 3FPJA 3DHNA 2XMRA 5EP2A 3LGAA 1PFVA 2LDXA 2NRWA 4EB6A 1J21A 3N9IA 2HQBA 3GRUA 5JDIA 3T1QA 1W6UA 4S35A 1EEHA 2BC9A 5LNK1 1HOTA 4TRNA 2W6OA 4Q9HA 2EZ4A 1BD3A 1C2YA 1H2YA 4CQMD 2DXIA 1XEXA 1YT5A 3HBFA 1YO6A 1L4YA 3WDKA 4YRGA 3CG4A 1COKA 3G6WA 3JD4A 3JWIA 1S02A 1ZQCA 1PJLA 3WWYA 2IC5A 4WK6A 5GZ6A 2RONA 2FSVC 1P61B 2CNBA 1OV6A 3E84A 4Y7DA 4YXWA 4Z9XA 4NNPA 4C2AA 4CDGA 2JH1A 4L2IA 3ENWA 3EXIB 3C70A 1W4BA 4EG1A 4HDNA 4GLFA 3H0MB 2KICA 1A0OA 3VYTB 4ZRDA 1SQGA 4J0CA 4NWIA 3GEEA 2X0KA 4REMA 4HWPA 2GBLA 1PJBA 4OQDA 3B6IA 3LL4A 3TQTA 2FP4B 4JYPA 1RI2A 5JNVA 4I2HA 3AVUA 4KLAA 3TDMA 4XJSA 1KSPA 1O4WA 1Y34E 2VWGA 2QKQA 3HJAA 7ABPA 3SV3A 2G04A 1OXKB 1G20E 2OO7A 3GMIA 3F98A 3U80A 5MHTA 3T3DA 4JH0A 4H15A 3IG8A 1WB5A 4Z86A 2IITA 2ZZKA 1B14A 3F5DA 2ZYAA 3JPNA 1J0AA 4G01B 2VJMA 4EARA 2LHTA 3UQZA 2FMPA 3ZHZA 1CRLA 3W78A 3R44A 3O0FA 1PJZA 2YHIA 2AOUB 2IBKA 3IMEA 1MQ9A 3ZGLA 2RHWA 3P9ZA 2JD1A 1R9GA 2H54A 5CNMA 5F77A 5FTMA 4XM1A 3L82B 1MNAA 1YUNA 4DNXA 3L92A 3URMA 1CRQA 4OIFA 1G6OA 1ZJYA 5G1PA 4PR3A 3A11A 1Y8AA 1ZD9A 1XTRA 2PMCA 4MHVA 2QUZA 1ULSA 3KLNA 4R7TA 1GPKA 1D04A 3DLBA 1ZETA 2QJWA 1RXIA 3CPJB 3E1KA 2G1AA 2X41A 1A3CA 1B8UA 3WJ2A 4IIBA 4R0VA 3E70C 4PN3A 2I9GA 4Q4AB 1JVSA 2DKFA 1HY3A 3G88A 4OTZA 4L22A 4G1EB 1BDHA 3K4PA 2IYQA 3R3YA 4MFCA 2E1EA 1MDFA 1NKCA 4ECQA 1AGXA 1YBFA 4ED1A 3L02A 2ZI6A 3GOQA 3RSOA 5DGHA 2WINI 1X13A 4L0CA 1S2LA 2AD5A 3MCAA 3OA0A 2ESEA 4CM8B 4UW9A 6PFKA 4M4SA 3VR6H 1I1HA 1I9GA 2IDKA 4JWKA 4UHDA 2IPXA 4LDRA 1FP7A 4K9SA 2CXTA 4Y9SA 3MFIA 5FUMA 1T10A 4R16A 3TAHA 1LWOA 2P11A 5AD1A 3SKVA 4NDAA 4JLPA 2ZJ5A 3FCYA 3QKSA 4DEVA 3FPEA 1WCIB 3B12A 4DS5A 5FXMA 2L17A 3ZVRA 3WX0A 3INTA 1AMUA 4QXPA 4MRNA 4R68A 5AW6A 2P6UA 4EABA 2HCBA 1RWQA 4RADA 1KDTA 1IC6A 3HEAA 4JQCA 4JV1A 4KO8A 2WSYB 3QLUC 3D0KA 4TLAA 1QFZA 1RYRA 2QW1A 3E8XA 4D0NA 3A1WA 1X9IA 4KFUA 1WETA 4J16C 1F0MA 3OG9A 4EUEA 4PZ0A 4QBIA 1YCDA 1HNNA 3MIIA 4RZ3A 1Z3EB 1NK7A 2Q5LA 2BZ0A 1V41E 3VU3A 3QK7A 3ZU4A 3CMCO 5EMMA 1XA0A 3IG5A 4H3KB 5CFQA 5KREA 2XXJA 3M6UA 5JU5A 3DZIA 1XRQA 1JNYA 3DQZA 5JCJD 3JW8A 3DZDA 1T5LA 1E1KA 2DUJA 1OPXA 4OKNA 3KHTA 2C4NA 3TIIA 2E5SA 2IYPA 3HGMA 1LXCA 2EYQA 4ML3A 5GVSA 3S68A 2O3RA 2FV8A 4OKSA 2VDOB 1Z1BA 3AEYA 4M0EA 2QKYA 1QCYA 3C5HA 2XWBF 1DEOA 5EFOA 1X42A 1RAIA 4RUAA 4MVJP 2VXYA 6REQB 2ZAYA 5DI3B 3IBTA 1RPTA 1ESMA 3PNBA 9GPBA 2Q9UA 2ZDQA 3FUVA 2I6XA 2JAWA 2Z95A 1M6HA 1XTPA 1KLNA 1F4VA 2P6PA 4B3TB 4QW9A 1XJ5A 1U3VA 1GQRA 4HX5A 4C4ZA 1DAEA 1XTJA 4PF1A 1MB3A 3WLFA 1R0WA 2WJZB 2YX8A 3AR5A 2AN5A 3PDJA 1Q50A 2OYYA 2B4YA 1TCBA 1XCOA 3BWMA 2PO7A 4UNPA 3HEBA 4F9EA 3ZGNA 2LYAA 1QHHA 4CV0A 4CTOA 1SXPA 3BHJA 3PK0A 3L01A 2JEIA 1D6JA 4ZYUA 2FMIA 1P1HA 3C1YA 2CXXA 3H2IA 2OAQ1 4FQ5A 2BFOA 1GZ6A 3WE7A 4LK3A 2YQEA 3NGDA 2YXEA 2PAFA 2FF5A 3RIGA 1FFDA 2RGUA 1LF0A 3WBBA 4FT2A 5ITZB 3PCRB 4EG6A 4WGFA 4C0KA 3NUZA 1A5SB 1JKFA 2YQZA 1LK7A 3Q0TA 1XHEA 1T15A 1LNSA 4BO3A 4P4MA 2R5NA 4LBVA 3C24A 2GN2A 2XQVA 5FV4A 3DPIA 4IOKA 4PONA 1AK2A 1N56A 3IBSA 5BSEA 3G9TA 1VIAA 2QD2A 4QFDA 1DVRA 3LX5A 2Y05A 5K20A 3BA1A 2EG9A 3EJ6A 4G0UA 3G2QA 4LJ4A 1OBFO 4JL5A 1KZHA 4DCMA 2IIQA 1NJ8A 3WI7A 2BVNA 3P2YA 2R97A 3UJ3X 3U17A 2FE9A 5LNK6 4F2SA 2AJCA 3D2LA 1COZA 1QWSA 3BS5B 3ZCXA 2E55A 3KVRA 1IHYA 3L5KA 4BGDA 4Q8EA 3K9BA 1KFSA 1O4VA 4ZCPA 4D6XA 1Q2UA 2NXEA 5JS8A 2QVZX 1FW8A 5HR7A 2J09A 2DHDA 4D3FA 3KHHA 1PT7A 4QDZA 2CHFA 1K4YA 5J9FA 4MF2A 4RVSA 4EJFA 1JDJA 5DTQA 4FFBA 3EFBA 1U63A 3WYFA 4NY8A 2GHRA 5I6DA 3U5TA 3HRKA 4GMKA 3QNUA 3SYNA 4KDFA 3Q40A 3IEVA 3CRW1 1EGAA 4QIWC 3BQ2A 2N3ZA 2AG0A 4MS3A 3ROZA 5DPMA 1JI0A 1JXMA 3I2HA 3ZY3A 3O6VA 4E07A 5AESA 2QX8A 4I55B 4PYKA 1CEXA 2CK3A 5KFNA 4CV2A 5HIAA 3MW8A 1GIAA 3AR8A 2GBCA 2HLDD 3MJFA 3H6KA 2GBGA 4UNQA 5AKLA 3QNMA 4IJ5A 5JLAA 1UF9A 1U3CA 3RUDA 2PMZC 1BGXT 2GZDA 2W4MA 2P9YA 2FG6C 4LC9A 3AHJA 2E48A 2C3MA 1PJCA 4NAHA 9ICFA 5AKIA 1U4SA 3F2VA 4NZOA 1QFMA 3EOBI 3WGNA 4AS3A 3ZZ0A 3BMQB 3EPGA 4NL4H 5LZ8A 4NBSA 2G09A 1OREA 2WU4A 3HDYA 1NRWA 4D9FA 4QO7A 4TTTS 1P7PA 4RH0A 2B6NA 4KH1A 4NEQA 5JW6A 4MB0A 5IZCC 4JP5A 4X71A 3K9LA 1FQOA 1U0OC 2E5FA 1JE1A 2MYPA 1Z73A 4AWXA 1WHSB 1J7KA 2B8TA 4O4HA 1P1IA 1YONA 4YDRA 5DO9A 4OQZA 3FTCA 3DBHB 1XNQB 4IKOA 3ZY6A 1BX3A 5JPCA 2V1XA 3OM1A 3NTLA 1ZN2A 3TEJA 2HPZA 2CSUA 4F45A 5J2EA 1NG9A 1J2NA 4CG0A 4G41A 5FI5A 5IMSA 3AKZA 1JG6A 3GXBA 3ANMA 3UAOA 4USAA 4TZ0A 3KPJA 1RWVA 2ASVA 3H05A 1ISMA 3L84A 3ESZA 1G8GA 2DSNA 5H4HA 4TTVA 3BE4A 3JPPA 5EMHA 3A1VA 4H1HA 2XUIA 3IR6A 1WVIA 3WHKA 4DV3B 5T3YA 2HQSA 3WMXA 4XSGA 3IQEA 4HB0A 3LMKA 3WYCA 2OVFA 4BQFA 5JC1A 1XRNA 1U9LA 1SUWA 1D1SA 4KTVE 4ID9A 5EG5A 4PGAA 4KPEC 1XO1A 3VR3A 3M8KA 2NO1A 3ZJ5A 4TS3A 3NT4A 1H9BA 1VE3A 2P6RA 5KFYA 3A70A 5FI1B 1M8FA 1XAGA 5IBPA 3ZOZA 2IMWP 2HYDA 4ICAA 2D3TA 1THZA 5LKRA 4GE0A 4FILA 1BYUA 4JKOA 1L4EA 2PZ8A 3OE1A 1KFBB 3LVRE 3DYVA 4LXHA 4B4VA 1O77A 2ZTUA 3DCYA 4P86A 4NIMA 3KWJA 4EHLA 1J4AA 4KQ6A 2UYGA 1MN6A 3EC1A 1VYUA 2O2YA 2CL7X 3CUWA 5P21A 4J0EA 3BXEA 1NKVA 2AHRA 3THYA 1E2LA 2JH9A 1WCWA 4IIUA 4E4YA 4FHDA 1N4DA 2UUBB 1GYQA 2JEFA 2WF8A 2A0WA 2WKSA 5BOVA 4PZ9A 4FMCF 3BK1A 1JB1A 2YIVX 3LQ4A 4HAYA 1TUEA 1BEUB 4CMCA 3KYJB 2OXIA 4E31A 5JCZA 1NBAA 4HLUC 4X63A 4JVLA 3T4EA 3I12A 3FDXA 1F20A 5B30A 4CL2A 1X2IA 3MGIA 4J49A 3MYRA 1JHMA 2JI8A 2KOBA 1H42A 3WMRA 3QE9Y 4YAUA 3AWDA 1JI7A 2FW9A 1YU9A 2GB4A 5LZ2A 1XPRA 1HSZA 2X15A 4WDQA 4QWAA 2HW3A 1I7DA 1E6WA 2SBTA 3UF0A 2AE1A 4MVJM 3KE8A 2Q2QA 2FXVA 2GPNA 4X62B 1B76A 4YRIA 5A1TA 5K3EA 4XASA 2VP2A 1WEKA 4YQZA 4URVR 1M1YA 1M6VA 1GWNA 2PL5A 3H9EO 4KQWA 3FPAA 4ETWA 5ALIA 2C99A 1X80B 3L8YA 1TJ4A 3W9BA 4YP7A 3N2KA 3C6KA 1NVVR 3UWMA 3RIEA 4JUBA 3BMCA 1Z8NA 4U0KA 4FFMA 9ICBA 1JFFA 1XKXA 3U7QB 2FJPA 4U7WA 4PY2A 4K6FA 3A27A 3RD5A 3WLPA 1HSOA 2RD2A 4RVOA 1LBIA 2GM9A 2GZHA 4EZ6A 3CZPA 1PAUA 4M0UA 1FSSA 1FXWA 4KJXA 2ZQZA 2IE0A 3IR5A 4GAEA 1TQ8A 3GLGA 3ZTYA 1XZCA 1U49A 5ADVA 3A2KA 2JCVA 3JPWA 2HSWA 5KSZA 2RDMA 1WSDA 2WJGA 4E03A 5E7MA 3DMRA 5BSWA 3F96A 1W2GA 2RC6A 4DOMA 3FCUB 2NADA 2IHMA 3TFOA 4YP1A 2AC4A 2IXTA 1CR6A 2O2CA 1C3LA 4YHBA 1E59A 4FWIB 2YWHA 2PS9A 1GUZA 3ABOB 3DLHA 3PF8A 3DMPA 3MB5A 3B38A 5KT6A 4G8CA 3MWEB 1LK5A 4L74A 3DB2A 4DOBA 2X4IA 3NO4A 3HPOA 1MJHA 3V4RA 1XR3A 3KZVA 2G70A 1M8KA 1Q84A 1J2TA 1ZG3A 3KLMX 2R6JA 3FNQA 5KG5A 2GLUA 3PC6A 3ZE6A 1ZO8A 1KI1A 4FIDA 1WSAA 4KPFC 2FPGB 4UUAA 3LBAA 3MXOA 1IIRA 4CN8A 2XZPA 1KPHA 3LTEA 4PYQA 1JQAA 2ZRHA 1HC7A 1VXRA 4M6WB 1PG2A 3MCZA 4KAJA 4LMRA 4QUDA 4XFDA 4KXUA 1FYFA 3LW7A 1PJQA 2RC5A 3M6ZA 3QELA 2DR3A 2YMMA 5KJ6A 2Y93A 3ZEAA 3OQOA 2C20A 1X7WA 5A4MS 3R0ZA 3RJZA 3AV3A 2CLFB 4PV7A 4QBGB 1UZUA 4I28A 3T7TA 2G6BA 4Q12A 2BR3A 5DTJA 1LJLA 1L5MA 3D43A 5LWQA 3WG9A 1DV1A 5TS3A 2P41A 5TX7A 1HGXA 3QZ8A 1NT4A 3H5OA 3ICXA 4U2DA 1EVQA 2GYYA 3VC1A 5HZHA 4DV1B 4NDZA 2Q5IA 1Y6GA 1MX5A 3GCZA 1Z15A 3HI4A 4OLFA 1B3BA 2PD6A 1CUGA 1ZW6A 1CY1A 2DKXA 3PFGA 1AHNA 3WV4A 1JIXA 3T7SA 3KBBA 2F44A 3MFHA 2PUDA 3H11A 4FHCA 4FEGA 4WZBE 1FFCA 1HZZA 2ATEA 2C4VA 4TWBA 1QYVA 1OXJA 1JJIA 4ZOHC 2QM8A 3UT6A 3BB1A 4BGVA 4EG0A 3DAPA 4YMTA 3WIVA 1NHGA 3GFBA 3PFFA 1JTFA 1CQXA 1ZNWA 5G0VA 5AYVA 3TVTA 3BQMB 3WIEA 1M74A 2IV3A 3FZYA 3TTSA 3P9NA 3L8ZA 1P60A 2QARA 1KJ9A 5BSFA 2W98A 3BORA 1GY8A 4LVSA 4D3SA 1Q0TA 2J7KA 1SXJB 1N7JA 1W8IA 4PZYA 1IM8A 5JBNA 1CUSA 3LS2A 9MHTA 3PMLA 4A3SA 3ZTTA 5CB4F 4DIEA 5F9FA 2DJ5A 2V54A 1A9QA 4ZDIA 1BMQA 4J29A 1S0MA 2JFYA 3E53A 4FUQA 4IGAA 4P0TA 4F50A 2IXEA 3BCSA 2N9UA 2UVPB 4N54A 3JWPA 1ZKDA 2PV0A 3FUXA 3C2MA 3AIMA 3K6JA 5BUZA 3UAZA 2MJLA 2YYAA 4JL6A 3O9ZA 3DAFA 1SZDA 1V1JA 3T7AA 4KFTA 1MR3F 3O8CA 3FY4A 4FX2A 5T4EA 1VJ1A 2VHUA 2JZNA 4TV9A 4W4TA 3WOHA 1BJRE 4RQNA 4O2LA 4HS4A 4GG1A 5CPFA 4L5YA 2Q3HA 1L5SA 3SOZA 1I4LD 5LJIA 1OZGA 1J8DA 3U37A 3DJFA 4KX3A 2R0QC 4CUJA 1YA6A 1W2WB 5FADA 3WLQA 1CQWA 3H42B 5GJBA 1U65A 6NULA 5BVGB 3U4HA 1MORA 2C7VA 4RTQA 4FHGA 4RQ2A 2M32A 4LRYA 5HA5A 3A0BU 4KUGA 2GBLC 1ZQLA 2NPOA 4KR0A 4MA0A 3I4LA 4BC0A 1URPA 1X9HA 2QD4A 4A10A 4R1NA 1LDNA 2IP2A 5KFFA 1JU3A 4JJ7A 4QJ3A 2QZJA 3OIYA 3ZHUA 2PJRA 4F6RB 1E9BA 3OPXA 4FGSA 3FCAA 1WAMA 4XYMA 1D8YA 1V16A 3S8YA 2PBFA 3ANYB 2VOEA 3C98A 3OX3A 1P1KA 1ZDMA 3LBHA 3PNCA 3FVWA 4ATNA 1PJAA 1JA1A 2YZ2A 5H4GA 3G7NA 3U13A 2H3HA 2VSOA 3A32A 2VHVA 4YV1A 4X9XA 4HAUA 4MJXA 4WN9A 2W3RA 4JZYA 3NHKA 5DHPA 1AN9A 4LQDA 3F46A 2NU7A 4K0KB 1UZNA 2KV2A 4AJEA 4F72A 2WJIA 2PL3A 3OURA 1ZU4A 5GGYA 1Z35A 1EVKA 3L8FA 5K3FA 1IIPA 1E77A 5U9CA 5JAUA 4W7IA 3H8MA 2QX4A 4ECAA 4DCNA 5F76A 1J8MF 3RWMB 2QD5A 4C7OB 4F96A 1KHTA 4JCCA 4M22A 3BWBA 2MYTA 3ONEA 3OJOA 3GV8B 3RAEC 5JCOC 3IKJA 1PS9A 3K2EA 1UBTS 1EQAA 3NDIA 1ZK2A 4F8RA 2Q4BA 1WZIA 3JASA 5LLTA 4HP8A 3OHMA 4Q1VA 2IBMA 2VDQB 5EIWA 1CVLA 3P2KA 1O87A 2WTXA 1T1JA 5LZ5A 4GR9A 3MINA 4OSOA 3H9CA 1NK4A 2BP7B 1SCAA 4R8KA 3FCCA 5KTMA 1ZYQA 1T2VA 4O3OA 1JEDA 3X2EA 1QSLA 3QWBA 2P5SA 5HUQA 1EA7A 2ZU0C 3CRNA 4AMZA 1YCFA 1CVRA 2R4QA 2SKDA 3ZG6A 2XDAA 1C2TA 2X9NA 5ICGA 3SR6A 3AOEA 3HR4A 1KRWA 1X8XA 3RC7A 4POOA 3WMGA 1PK8A 3EW9A 1D2NA 3MD0A 2C3PA 2VSNA 1MAAA 2ODWA 1OX4A 1VZ2A 3A2NA 2QSZA 5CHYA 2C5SA 2HPHA 1S89A 1FDVA 3WISA 3MXTA 5AJWA 4AZ0A 3KQOA 4WOBA 3MJSA 4CMKA 3LVBA 5EQJB 1PV1A 4M8KA 4GRDA 5E79U 3WRWA 1BXZA 2H8GA 3E5NA 3B0YA 4YPVA 3DTTA 1C7EA 3E7XA 1QP8A 4ME6A 2G88A 3HU1A 3I0MA 4H6XA 1NW4A 2DFNA 1WQ1R 4HXYA 2CMHA 2W2KB 1U3DA 4OK3A 4MAMA 2QV7A 2XMSA 5CCXA 4N0QA 1QUEA 1USWA 3DHYA 3WIDA 3E3LA 2F8SA 4HDSB 1PKEA 4HYYA 3RSQA 4JJEA 3L4SO 3BIXA 1CETA 2E4XA 1PT5A 2AFHE 2B69A 1PK1A 2O50A 3QU7A 8ICYA 3S7ZA 1I6MA 4DQQA 1KP2A 3CZAA 1JEYB 4XDZA 4LYAA 4LC0A 1EXDA 4W5HA 3ZD7A 4QNNA 1GKIA 2XTJA 4X6UA 4Z6DA 3NRBA 3Q1LA 2FZCA 2ZVPX 2IL1A 2XA2A 3IXLA 1F8GA 3H7IA 2I5PO 4MRAA 4MKIA 3ZQUA 2GF0A 1NF3A 4Q3DA 4XWKA 2J59A 1AQIA 1ORVA 1JFVA 3EIQA 1IVNA 2V74B 1NRIA 4RZHA 3TQCA 1V45E 4PTYA 4CN9A 2AV6A 3JYPA 4AJLA 3WJAA 3MWJA 5IWCA 4F2GA 5BNTA 2XI9A 5H82A 1YZ6A 3O21A 4G86A 3QEAZ 2O3UA 4X41A 5SY6A 1FDOA 5KYTA 4AK9A 1XXHB 4L5BA 4YCMA 1WXEA 1EE9A 4YMMA 1YE8A 1T4BA 4WFQA 1VL0A 2X8JA 1PX0A 4Z4IA 1WLYA 1JXLA 3ODGA 3K4GA 3RVKA 3KHLA 3EMVA 4KITB 2GAIA 2QRGA 3DLIA 3EGCA 1MB0A 2EQYA 3NEJA 5C1OA 1YK1A 4ZVRA 1IY8A 2R1VB 1G21B 3UPDA 1KH1A 6LDHA 1U8FO 1FSFA 1XG5A 4Q7JB 3MILA 2O3QA 1IV8A 4P98A 4DFPA 3QU2A 2G9RA 5MDHA 3STVA 1TF2A 2C78A 4PO3X 1NUHA 4DLWA 5KDDA 2WNSA 5IVHA 5J0SA 1XZJA 2BFBB 5HOEA 3HFGA 1W47A 1F2UB 2CNWD 1J5EB 2OM6A 3PKJA 2ZRDA 3V2UA 5FJJA 3NKLA 5I3CA 1PR3A 1U8AA 1Y1TA 3EPKA 1ZJMA 3C6ZA 3KKZA 4HTAA 2NRTA 3OUTA 3QMPA 4B87A 4NFSA 1A2OA 3NXSA 3VBCA 1YI1A 1KRPA 4TLMB 3K0SA 4G0XA 1QZUA 2V3VA 4F2DA 4BPBA 1JPVA 1C14A 3UKOA 1Y3AA 1Y6ZA 2XNSA 3HBMA 4LTNA 3PQ6A 1BPBA 4HVTA 1ATIA 3T5KA 2NXCA 1NUQA 1MABA 1XDDA 1NP6A 1J5PA 3T9AA 2IYTA 2C2OA 1N63A 4PE5B 2IZOA 4Y2UA 1SVWA 2BFFA 5T5QA 4MRPA 3BZCA 1UC8A 4YLYA 2VP3A 1JIUA 5FF9A 4QUGA 2X4GA 3C0KA 1X7YA 2FQ1A 3RRYA 3PIIA 3DM5A 1OJLA 2LYHA 2YS6A 2HJSA 5FUWA 3F8SA 4YCLA 2VUSA 4OQ4A 1ZD8A 4HWRA 3NBYC 5IDVA 5C7OO 4N1AA 4CIYA 1R9NA 4Q00A 1XC7A 3IUQA 3W1VA 1YF3A 3DD1A 1KR2A 2EF0A 1N75A 1NWCA 2ZTEA 5J4LA 1GA6A 1ECWA 5AQ1A 3IB3A 3ROXA 1J9EA 3VUEA 2PXXA 1MC4A 1T34A 2BCVA 2DBQA 1AGRA 3Q3VA 2HOIA 5TQ0A 2ZAOA 1KL7A 3H2YA 4FOTA 2RHBA 4DM4A 3VA7A 2IV7A 2PSFA 3ZU5A 1P4JA 4ND7A 3R7DA 5DQHA 2HYIC 4UHBA 1NDHA 3PT9A 3GFOA 4QLBA 4W7SA 1K8QA 1QIEA 2XQFA 1FEZA 3EGVA 3KP1A 5TSDA 2C7RA 1X1QA 5KTNA 4CT5A 5EERA 2QB0B 4DM3A 3AR7A 2ADFA 1W9HA 4LJKA 3OQVA 1SM4A 4PANA 1DOAA 5L3ZA 3OZ7A 5DDMA 4UBMA 4PQYA 1DKUA 2P2YA 2JHDA 4A4DA 3KQHA 2OV2A 2DY0A 1LVUA 4RDCA 3MFQA 3QIAA 3ZCUA 2ZWMA 4YMVA 4BV8A 3I53A 5CGZA 4FBGA 5ALRA 3ITNA 5HKKA 4TMFA 3FUTA 4YD2A 1PD1A 3HKEB 3W90A 4GWLA 4E0BA 5B1YA 2H0RA 2F1RA 5F12A 3VDRA 3UT0A 4MIEA 3ICQB 2FXIA 3GPBA 2W9CB 3D6HA 3W5VA 2HIHA 3N2YA 4NFYA 5CB6A 3CZCA 1UC9A 2XWSA 2BGKA 3W5HA 4L4YA 1SIJA 1KKLA 3KAKA 1D2AA 4RD4A 4LJ9A 4P3NA 1N2OA 2CCJA 3GLFA 2LRHA 3NM5A 4Q45A 3F4BA 4P0QB 2H1FA 5CT9A 4BUJA 5ADHA 5K8CA 2UXBB 2ZYVX 3EDOA 1DPFA 3Q7RA 2VDNB 5CEHA 1V2GA 4YMNA 1UMBB 5FUVA 1G2QA 2YWGA 9ICKA 3DFZA 3IM1A 3OZBA 1L5HB 2E6KA 4D3YA 4QNRA 1CUYA 1S0OA 1GKLA 1T2CA 4UE6A 4XE5A 5DLDA 4OD0A 2QYTA 3QVGA 1U9JA 2BEWA 3D31A 3KB6A 1NRXA 4ZZ3A 1EWTA 2R6DA 1SXIA 5EIEA 5AW2A 3BHIA 4LKOA 3GFVA 1BW9A 1SA0A 4EY7A 4OP2A 4MYCA 4XM0A 3A1NA 4J2TA 4RORA 1VRWA 3UC9A 3SE7A 3V72A 1L7BA 5DV9A 3D3EA 4A0HA 2PS1A 5H68A 4F4ZA 3M6VA 4Y9UA 2XB9A 1WG8A 4Z7NB 4GOOD 4B0OA 5KQGA 4KBGA 5IYZF 3RPEA 3K96A 2YNMA 1QYRA 4LE0A 3O1JC 4G56A 3O1LA 3R3HA 5UKDA 1Q0RA 1PLJA 4INAA 1G20B 3RW9A 2ZXEA 4BWFB 3VV3A 3KG2A 3TD2A 3G0BA 2C2BA 2BCSA 2VZ8A 1J8VA 4LA4A 5BR7A 1YDHA 4QWWA 1DIGA 1DIAA 2Y2VA 3RRHA 4U3JB 5HJEA 4C5CA 2F3TA 1SHUX 5C46F 5FBWB 4Y9RA 5JNTA 3WMEA 1RI4A 5IUNC 4TXJA 4EQZA 3UJ7A 1Z5NA 2CJPA 1EFVA 4M9XA 4DM7A 3GN2A 2O1XA 2ODEA 4W8OA 2IIBA 4YYZA 2HHLA 4HPWA 1CC1S 1WCNA 3OZFA 5H9WA 3NWPA 4A8PA 1XSNA 2HUPA 4LJSA 1I6KA 3IHTA 1BU8A 4HQ6A 4YUWA 1OT3A 4YRBA 4DOAA 2GVZC 1JQ5A 1TK3A 4GBED 3UKJA 1QHXA 4GXKA 3I1JA 4BNHA 5DYIA 9ICNA 5DP1A 4QBHA 3DOFA 1EMDA 3B7GA 2YRWA 2CNKA 5E2AA 1ACLA 1JRLA 3R8FA 3OQNA 3HYSA 4LXIA 1CF2O 2OAEA 2F1IA 1IBRA 1E2QA 3GEBA 2E85A 5AT1A 3S5JA 3AUFA 3DKKA 3TEMA 3D6UA 1GCAA 2ASDA 1X9XA 2NRZA 3OIFA 4DLSA 3ZX5A 4CQMB 3K5HA 4YUXA 4J7CA 3EJWA 3TQHA 3A6EA 1IG0A 2HU7A 4PG4A 3NHFA 5EJ8A 4RLSA 3E3MA 4NEHB 2FZWA 4UUNA 1J0DA 2B8WA 2BGUA 5IUKC 5F9HA 2QRVA 3JRXA 1LVHA 2VRBA 2DULA 2F4VB 5JD5A 3CNLA 2A1IA 2VBIA 3Q2IA 4X54A 3ZV3A 3ZDRA 3R5XA 2XNJA 3B2EA 5C8YF 3TRJA 4I14A 2P2ZA 1VSQA 1CJKC 1P7DA 5DSTA 4EELA 1G8KA 2XT0A 2IF2A 2Q3FA 2CD9A 2WB4A 3B2NA 4J9QA 2FMUA 2PBRA 5KNLA 1KC1A 4JBHA 4BZWA 4GRAA 4ER0A 4QUKA 1RWOA 2RG1A 4GUAA 1D4ZA 3DQPA 2CCGA 1SOAA 4J4TA 4NESA 5KT4A 3UWOA 3RB0A 5IAGA 2CJYA 3OQBA 1YDWA 1AG9A 2D5IA 4AROA 1LZLA 1HL3A 1P0CA 2FVXA 1DADA 5BWLA 4J2OA 2WVGA 1J56A 2BJHA 2YDXA 4A8HA 3IO3A 1WUDA 1NJ5A 1I3MA 1Z4MA 2IY8A 2O3TA 3PQFA 1LRJA 4UQLA 2GRAA 3HVJA 4JI4B 2V4UA 3S4YA 4JUDX 5A2QA 1YIOA 4DLVA 1S0UA 1FMTA 3DCJA 2ZRBA 1F60A 4LISA 2WDZA 2WUGA 3HZZA 4JN6B 3BZBA 1R3DA 4I2BA 3OZCA 4TMYA 1GKKA 4LZJA 1UQTA 1AZLA 4R8VA 2JAPA 1RC0A 2FK7A 3GVPA 2VO1A 4ECRA 1PEDA 4ZFNA 1CJCA 3O73A 1DXYA 1PQUA 3AERA 1VMKA 3G13A 2HPAA 3MYYA 4EYGA 3BF7A 4Q02A 4DNOA 2C83A 3HY4A 1OYYA 2W6QA 4JFRA 4AJ4A 1BN7A 2J5QA 5C8ZA 3H3JA 4MXDA 2VP9A 1VIDA 4HQ0A 4RQ6A 2A5GA 5HZKA 2WFZA 5KNBH 1NRJB 2JARA 3IESA 2J41A 1IEWA 1OLXB 3JATB 3KQYA 3OQJA 3SBOA 3TB4A 2IVFA 4PHCA 5BQOA 3OBBA 3RT9A 4N12A 3OPQA 3ZOKA 3IIKA 3A9TA 3V2GA 1TC2A 2C2GA 4IICA 3DTNA 3A36A 4ERXA 2FN3A 1ETHA 1ORTA 3T41A 3LTNC 4ZPXA 3A9VA 2C9ZA 5KVVA 4J0FA 5B4VA 3HCBA 3WJ1A 2HJRA 3ZGVA 5EE0A 1BS2A 4NCKA 2CUZA 2EWMA 1VJCA 2NZJA 3MTAA 1B3RA 3BERA 4X7BA 3K0EA 4UHEA 5CFLA 1WF6A 4GNKA 1X1TA 1VE6A 4AZ3B 4IFTA 2PFQA 1U4NA 3VVCA 2EZYA 4M1MA 4IUDS 5AVXA 4GZ6A 4NHOA 3SN6A 5DHSA 2QRZA 5KFRA 3MQFA 4ZXPA 1F2DA 3LC1O 3DZ8A 3H04A 4GI2A 1FJHA 4BQPA 2NZ2A 3RFXA 2PS0A 4D4GA 3VPCA 1TL7C 4XVQA 2HSGA 3UH1A 1EK2A 4MR8A 1W52X 2PZAA 2FFRA 2ZR9A 3MELA 2ISSD 5HIJA 5KFHA 2WJAA 1RFGE 2GRUA 5HR5A 4MA5A 3W4IA 3UT5B 2YV1A 3O83A 2ZYDA 2RK4A 4HKTA 3F78A 4B2IA 5A9SB 4G9GA 5ALPA 1WABA 3IP8A 1QX3A 3AVXA 3WL4A 4HZIA 5SZKB 2ZCUA 1WXQA 3TUZC 2DVMA 2BL4A 4OMDA 2F2TA 2QORA 1H8ED 1MOSA 2CJWA 5KAIU 4B6OA 3V1KA 1ZQZA 4YCCA 2P0YA 4AX4A 2J5BA 1OLSB 3K30A 3CC8A 2AZDA 1USGA 1GSHA 2OOSA 2BEJA 3JZFA 1C0IA 1V6CA 3C1OA 1OA0A 4G36A 1D03A 1Q3UA 1E1CB 4HXFB 3GQBA 2R6ZA 2ZJ1A 1HRKA 1NT2A 3HKZC 5F5NA 4FB5A 5FTLA 2W00A 5F9MA 4IMJB 2Q2WA 2J0QA 4YRLA 1NKBA 4EKDA 1CIVA 2HMYB 3IKMB 4WK2B 2O2ZA 2JZBB 3R4CA 1R00A 5JRTA 2QB5A 3C4JA 5KYWA 3ZGZA 3Q9SA 2W6NA 1TTTA 4LXQA 2BZFA 4KOAA 5J2JA 4RTMA 2BGTA 2WKQA 2QRHA 4BMVA 4TKVB 1OUMA 5CVTA 5HCIA 3MLEA 3DSRA 4C4PA 3RAQA 4FFVA 4ZDWA 5CRIA 3QBEA 4NQZA 1TZCA 2C84A 4RTRA 3KKAC 1HFEL 3WDSA 2VUHB 1ONNA 3B1WA 1NPDA 3SYRA 3KXPA 1LV7A 2HGZA 4LTDA 5A5DA 2FPPB 1MOZA 3Q72A 1MQ8B 4U0JA 3N2EA 3W6NA 5AW1A 1JIQA 4A8JA 4OATA 3UATA 5A1JA 4DBLE 4R3WA 5FULA 1YDGA 4DF3A 5B7PA 4Z4CA 4NH4A 2D0PB 3UN1A 2WF6A 3L6CA 2C3OA 3PHHA 1U9CA 1CE8B 1XZLA 2QVCA 4QG3A 1MH9A 2HBYA 1JAHA 1SKQA 3BIWA 1N0VC 4XVRA 1HL7A 1M1ZA 3HXPA 2QTWB 3O4RA 2VT7A 5A6VA 3CINA 1N3YA 4LY6A 1ZL0A 3ZE9A 3D8NA 2AMYA 4YO7A 4A91A 1QU2A 1U3UA 4LHSA 4KSBA 2IHZA 1N5WA 5J4HA 3ZNPA 3TTYA 5JVDA 4JI0B 3PUWA 3CBQA 1NXWA 4XRHA 2ZTDA 1AOXA 1VSUA 1N6RA 5LL6P 4QXMA 5DGTA 1L4NA 1Q8KA 3NTOA 1EGVB 1H38A 3MTBA 5BMVA 1L8QA 3T7RA 5FLYA 4MULA 4GWGA 5ITWA 4KZPA 3TQOA 4BNWA 3C1UA 3U3KA 3HLTA 4GMHA 2VJPA 1OHHA 1DTWA 3A3YA 4K9LA 4YXWD 4I0WB 4EHBA 3E8MA 2P2LA 2O8BB 1SKBA 4IJUA 3SQWA 4PHDA 3G59A 1OGJA 2W58A 2GYUA 16PKA 3VTKA 1M1UA 4O3QA 4M36A 3QBDA 2YQ4A 1EUCA 2Q1UA 2AE2A 2QLTA 1UR5A 4H7DA 1L5RA 2P2SA 3L79A 2OZVA 1IU9A 3TDNA 2C58A 1LDEA 4OHOA 1L8OA 4XARA 1ZCJA 1K7SN 3EIWA 1B4FA 9ICQA 2IRWA 1GGEA 2BGNA 1GPNA 1GZUA 4TLLB 3W7BA 4OK6A 1LBSA 4UMVA 2GJSA 2AIRA 1DCMA 2FNAA 1DQYA 2HVIA 1YSCA 3LHKA 1RE0A 2I5HA 1KKMA 2G1JA 5DT9A 5TVKA 1ZK1A 4HQLA 4ZQIA 1FFXA 4F86A 2VLIA 1M1XB 3K8ZA 3B3FA 3T1YB 3BEDA 4IIFA 4Z6KA 1XTBA 3BK7A 1RZVA 2H65A 2OMEA 2GBPA 2ZJYA 4P4TA 5IT9A 5KFAA 4QWCA 3TRIA 4E2YA 4JEIA 4F7WA 1NVMB 1P5RA 4EFLA 2NM0A 3I61A 1XS9D 5HQ3B 2LCQA 4URFA 2B9VA 5LDGA 5FO0A 3JVIA 3ZJVA 2ZE8A 2ZCVA 1KC3A 1WDLA 2I80A 2I2AA 4KWIA 3VU8A 3WRYA 3EGXB 3HA3A 3E3OA 3DVSX 1YZGA 1VJ0A 2B36A 2PKQO 1GNSA 2PKCA 3D3JA 2QY9A 1JFRA 2PA3A 4FC6A 3EG5A 4JR2A 4D0GA 4HG2A 1ZPDA 2IOYA 4N3BA 1J49A 1CS0A 3MBOA 3IAS1 1JKXA 4RM3A 1TCUA 1Q14A 4LYFA 1H3NA 3F4KA 1TAMA 4RETA 4DDKA 1QOPB 1HUOA 4FD2A 2W6CX 4DWOA 3I1FA 5I9TA 1V8BA 3H1BA 4BNFA 2D2VA 2R6R1 3A0UA 2CJXA 2P62A 4KNYA 3SQXA 1AZTA 4RA9A 3PW7A 2WAYA 5EZSA 3A9WA 4AYWA 3QXGA 4JBIA 4NVRA 2O48X 8AT1A 6YASA 3KLPX 5ESRA 4BQEA 4UAGA 2O6HA 4E22A 3S2EA 2HB6A 1R9JA 2OWOA 4H7KA 4H18A 4RTSA 1HQKA 3K1ZA 3S99A 3OCYA 2ZG6A 2Y0SC 4WXEA 2YY6A 3AU8A 4WXRA 1X8KA 5ERXA 3L7BA 3RIHA 3LWLA 3THSA 4QWBA 1BVHA 5K5EA 5H02A 5CRXA 5AXBA 1VMDA 2NO7A 3EVCA 4ZVVA 2QBYA 4MEBA 1PVVA 2VZLA 4PGMA 4KACA 2VYNA 3HYLA 3NEYA 2E18A 4I55F 5KYYB 1Z36A 4PPFA 2G4LA 3R5KA 3KQWA 3PV0A 1JIJA 4PZEA 2BKLA 3RAJA 3HGQA 5IFLA 2WWVD 4D8UA 1Z16A