4O0IA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
SKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with 2'-MeSe-arabino-guanosine derivatized DNA
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o0iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4o0iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o0iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0iA01
9ICGA 3V6HA 9ICQA 4MFAA 1ZQSA 4K4HA 3NCIA 4FM2A 2VG6A 4B9LA 1DGSA 3RB4A 5KFAA 1JLFA 2FPLA 2UVWA 7ICPA 4Z6CA 4DL3A 4I2CA 3F9KA 3Q8LA 3KHGA 4B9UA 2IC3A 2BCUA 2XY6A 1XWLA 5KI6A 2OA8A 5J0PA 3IM1A 2ZE2A 3U3GA 3PMLA 1ZQBA 3RH4A 1IM4A 2F1JA 3CG7A 4FJJA 3LP0A 4QWBA 5J0OA 2QK9A 1IKYA 2PFOA 2QXFA 2W9BB 5KRTA 5KFSA 4NCBA 1QSYA 3EPIA 3T1AA 5KG2A 4P4OA 4FCYA 1NK0A 1EKEA 3ZD8A 3CFRA 1HNVA 2O4IA 3RR7A 4IFYA 7ICUA 3THVA 1RXWA 5I3UA 2HHUA 4KMUA 4Q44A 1ZETA 3TAFA 2BCSA 4O5KA 2HHTA 4FLTA 1QS4A 7ICFA 4ZHRA 3LDAA 1MU2A 1LWEA 4CJVA 4XIUA 5HRPA 1BIZA 4ZTJA 1GOBA 4J2EA 3NTUA 1EX4A 4NCGA 3CFPA 3O3HA 4DL2A 1A76A 2DFEA 2X78A 4FS1A 1T4GA 3NH1A 1WCLA 3KLFA 4E7JA 1TK8A 4M3TA 2KZMA 4PUOA 4R64A 4FK4A 4ELTA 5HLFA 1IO2A 1SV5A 3D45A 4DSEA 5J2JA 3E01A 4Z4HA 4I2QA 2JZBA 4BXOA 2RDJA 5KFIA 4JWNA 3PW4A 1J53A 4CGDA 1T3NA 1SL0A 1ZJMA 2P6RA 4F50A 1ZQIA 1J5OA 2JEJA 5DB6A 1B43A 3OS2A 2BDPA 3V1OA 2IMWP 1UT8A 1S0NA 2AQ0A 3TAQA 3PMNA 3AVCA 3G6YA 3MR2A 3ISBA 1T7PA 8ICJA 9ICUA 1JLGA 8ICMA 3NH2A 4CJFA 3G6VA 4KHWA 4F5QA 4DTSA 1ZBFA 3RB6A 2OPRA 9ICJA 4CIEA 4CFDA 5E41A 4DEZA 3ZT0A 3DLHA 1U47A 2W9CA 3AVBA 4CJQA 4O44A 4FLXA 4KITB 3MGHA 4EBCA 1XSPA 2D0AA 4YN4A 4M9NA 4I2AA 3KK2A 4CHOA 3SI8A 4QZ8A 5J2EA 2W8LA 3V81A 4N41A 2HB5A 4L8RB 1G15A 2RKIA 1S97A 1RTJA 1JN3A 2HHSA 2ALZA 1ASWA 5KFUA 8ICIA 1CXQA 3HP9A 4AHCA 4UQGA 1RYSA 5J0WA 5KT5A 4ED1A 1RT3A 4FLYA 4ZH4A 1JX4A 4DSKA 2Z1JA 4FK2A 1T03A 4TUSA 8ICKA 3ZT1A 2NRXA 3QIOA 3ISDA 3RJKA 3C5FA 5KTQA 1TKDA 2XCPA 4GXIA 4LZDA 5J2CA 1NKCA 5KG5A 4DTUA 4FJGA 4CFBA 5T7BA 3OYJA 4EBEA 3GDXA 1AROP 8ICNA 2F96A 4DTMA 1YVUA 3EY1A 3U6FA 5KFJA 4M04A 1R0AA 4M6WB 5KFFA 1VRTA 3AV9A 3RR8A 3C6UA 1ITGA 2ZQBA 1RT4A 5CB1A 2M9NA 4C8OA 1L3UA 1WNSA 1U4BA 4I2EA 9ICFA 4GMJB 5KG1A 3LZJA 1BPEA 3K2PA 4DL7A 1CZBA 4ELUA 1JLCA 2VWJA 1C0MA 4NYNA 4P2HA 4Y1CA 3ZDCA 3OYLA 3QEWA 1NJXA 5L1JA 1S10A 1NK5A 4KLEA 3T5KA 1S6QA 5KFGA 1RILA 1S77D 4RNNA 1QSLA 5DLGA 2HHWA 4M0AA 3H8SA 4MEYA 3DYAA 2OPQA 4C8NA 3V7LA 3QNOA 3S3OA 2BQ3A 5J29A 1S76D 4IQUA 5KFDA 1S0VA 4R8UA 2XO7A 3ZDAA 2UVVA 3VN5A 4KLLA 2C2EA 1UA0A 5FROA 2ZD1A 2BHNA 4RNOA 3ULDA 4RNMA 1SKWA 4KO0A 1RXVA 4O5BA 3HYFA 1BPXA 5SWMA 1HJPA 4K4IA 1LAVA 4IFVA 1A5WA 2V4RA 1VSLA 4F91B 2VANA 4CHPA 2B5JA 4PPXA 8ICSA 8ICOA 1NJYA 1VSKA 1ZQQA 3Q8RB 1XI1A 4X5VA 2E4LA 1KRPA 3DLEA 1ZQUA 3L2WA 5EOZA 5HHHA 4LVSA 1BPYA 4JRPA 3SJJA 2PY5A 4ED0A 1TKTA 2VG7A 3L2UA 3T5JA 3QESA 3RB0A 1GOAA 3ALYA 4QZ9A 3M8QA 3SPYA 5IIKA 2WONA 1S9FA 3NE6A 4MFBA 4CFAA 1TK5A 4IQTA 1JLEA 3VQ4A 4AHSA 4I2FA 4DO9A 7ICLA 4KLFA 3VQBA 2HVIA 4M45A 1COOA 3RRGA 3NF8A 4F2RA 1WAJA 4NLKA 4RW8A 4UB1A 4B9TA 5C24A 2XCAA 3AVJA 2RF2A 1S1XA 9ICBA 4G1QA 2IA6A 4EZ6A 3GIKA 2UVRA 1TKZA 4JS4A 4W5NA 3H08A 9ICSA 4EP4A 3HM9A 4HCCA 3G10A 4ECSA 2VA3A 3ZSXA 4K4GA 4UAYA 4Y1DA 2BANA 2WOMA 3P5JA 2HVHA 2GWSA 2Q0ZX 4KRFA 1RT1A 4KTWA 5JUMA 3KK1A 4FJ9A 3V9XA 4TUPA 5KFEA 4QZDA 4JRQA 4XRHA 4DQPA 5L9XA 3LDSA 4PQUA 3AA4A 1BVSA 3RJGA 3M8PA 3I0RA 4F4KA 3SQ4A 7ICKA 3VQ6A 5EWEA 5KGWA 4I2IA 5DLFA 3F73A 2O4GA 2F8SA 3HWTA 4PHDA 4RW7A 1BISA 3T5HA 4F4ZA 3SYZA 2MUTB 2NUBA 2AGQA 5DBCA 4ED6A 4QZHA 4M3UA 4PGXA 2HNZA 4LSLA 3AVGA 4MEXA 1LW2A 5IIIA 4QOZB 4GXKA 9ICXA 3ASMA 3L8BA 2YHBA 4PGYA 4XUSA 1SZPA 1NK7A 4B8AB 4CF8A 4J9LA 3MXJA 4FZYA 3NFAA 1X9WA 2BGWA 7ICSA 5SZTA 2ZUCA 3NF9A 1CEZA 4E1NA 1TAUA 4FLZA 1WN7A 2ITGA 3LP2A 5TZVA 3DLGA 2W9AA 3SCXA 3BDPA 4M2YA 1EETA 3S3MA 2IGIA 4HUGA 4M3XA 1RBSA 3GQCA 3SUPA 4IKFA 4CEFA 4RW9A 9ICVA 1LB2B 2G8FA 3PR4A 1LV5A 1NKBA 1ZQAA 3DLBA 1ZQWA 4KLGA 4UB4A 3TQ1A 3HPGA 4CECA 3SV3A 7ICGA 4FJNA 5KFPA 4KHUA 4O9MA 3KLIA 4ID5A 4J9NA 4KHYA 3B0XA 3ZDEA 1HRHA 3AUOA 1BPBA 8ICLA 1HYZA 1XO1A 4F4XA 5HMLA 3UQ0A 5KT7A 4G3IA 5DG8A 5J2AA 3OYGA 4YD1A 5KFRA 1S0OA 4CHNA 4CJ3A 4YG2A 3UQ2A 3EPGA 4RT3A 2X6SA 4YR3A 1F21A 4O0IA 2PFQA 4KLHA 1RT6A 1L5UA 4DQQA 3VQ9A 1SL1A 4AHTA 4JV0A 4KHSA 5HNKA 4O5EA 5KFBA 3K58A 3ISCA 5KFLA 5KFMA 5CZ2A 2HW3A 1X9MA 4FW1A 4BE2A 2MAXA 4YQWA 3NH0A 3RJFA 4YNQA 2W9MA 3HSTB 4NLGA 3C95A 3Q8SB 3HJFA 4PA1A 4KI6A 1HUZA 1QLNA 4RQ6A 4YD2A 3K5OA 4FJ7A 3L2QA 3LZIA 5J0QA 2WTFA 3HK2A 3VQPA 3PW5A 3DRPA 2ZTEA 5DQGA 3WNFA 4CESA 4RQ3A 4YFKA 4O3OA 2YHAA 3LWLA 4J9PA 1RTHA 4KPYA 2RDIA 5J2BA 3IAYA 3AA2A 4ED2A 3AO1A 2BQRA 3KKRA 3OYDA 3UXOA 5J2FA 2ETJA 2DTUA 4KHNA 3PV8A 4GW6A 4ED8A 1ZBUA 4I9LA 1N6QA 5L1KA 4DLEA 4CJ5A 8ICXA 4RPZA 1C1BA 4J9QA 3BQ1A 1WSIA 4KTQA 4KLTA 4HUEA 3HXMA 2FBTA 3D0PA 3M9MB 2PFPA 1KFDA 5DB9A 5J0YA 4QWEA 4CJKA 4EZ9A 4EYIB 1LWFA 3JYTA 3S9HA 4FJ5A 4N76A 4DU3A 3PW7A 3SI6A 3KTQA 1KFTA 1DOQA 4CJLA 3GIIA 2YKMA 2AGPA 4BE1A 3E2EA 3TARA 3C6TA 4C8KA 4F8RA 2ISPA 2G8IA 4YMMA 3C1ZA 5C42A 4F93B 3ZD9A 2BPFA 3NF7A 3VQQA 4EYHB 1BPZA 1JKHA 1JXEA 3A2FA 1VSEA 3V9WA 3V9SA 1MSWD 1I39A 3TAEA 4FJKA 2BCQA 4DL4A 3KK3A 4DU1A 1BCOA 5J2IA 1VSMA 1RT2A 4E7LA 4CJRA 3V9ZA 1Z26A 4GXJA 4FLWA 5D49A 2XHBA 1C6VA 2XRIA 3H4BA 1XU4A 1JLQA 2FMPA 4YXJA 3EZ5A 1B9FA 4Z4EA 4ECXA 5DDYA 5J0RA 2P51A 4DS4A 3QERA 3DMJA 1ZQRA 1HQUA 4KLIA 3VQ5A 4JWMA 4P4PA 1D5AA 3ORYA 2OZMA 1Q8IA 4C8MA 1XHZA 3TAPA 3MFIA 4E7KA 3KLGA 3O4QA 3RH5A 3OYEA 3H8WA 2C2DA 4QW9A 3MEEA 4I27A 2DPJA 3OYBA 1EXQA 4UAZA 4CJSA 5C25A 3H8JA 3DM2A 4CJTA 2LSNA 1WSHA 4CHZA 4YVZA 2C28A 1I3AA 3NDKA 4DL6A 3MR3A 3DI6A 4HTUA 7ICEA 3C94A 4RG8A 3C2KA 3SQ1A 1X1PA 3SUOA 4ECRA 2D5RA 3IHQB 1U45A 3OS1A 2DFLA 3LANA 4I2PA 4E3SA 4O3QA 4DTJA 4M6WA 3FYHA 5J2KA 5KT4A 2JGUA 1YT3A 4IQVA 4QWDA 1RBTA 2OZSA 3SZ2A 5J2GA 3I8DA 4H8KA 4FM0A 4FZXC 4O0JA 4QWCA 4IG3A 1XSLA 3ZCMA 2YKNA 4FJHA 1DLOA 3UXPA 3M8RA 2DY4A 1W9HA 4YXMA 4PWDA 3VA3A 1ASUA 3MFHA 3SNNA 4HVJA 3P1GA 8ICPA 1S6PA 3ZSZA 4K8XA 3KD1E 3KJVA 1A77A 3PY8A 1MQ2A 3QZ7A 3TFRA 3ZSRA 3LALA 1ZQOA 4OLBA 4DU4A 4IR1A 3OS0A 3OYCA 5JS2A 3AO4A 3NHGA 4NCAA 2FBXA 1ZQPA 3ZSWA 5HRNA 2BPGA 1ZBLA 5KG3A 3RBDA 5DG7A 1SKRA 3WNEA 2H5XA 3KKSA 4NY8A 1C0UA 4CEZA 2PI5A 3JPSA 1RZTA 7ICJA 5BOLA 4FJLA 1BQMA 4KB0A 4M9JA 4RQ1A 3H4DA 2EHGA 4EBDA 3MXIA 4EP5A 1IKXA 4DSLA 4I28A 3QO9A 2IDOA 1PZNA 3ZDDA 1L3VA 4F5RA 3CM5A 4BDZA 1U48A 4EEYA 3V1RA 1BI4A 4DTOA 7ICRA 4IRCA 4NXZA 3ETLA 7ICVA 2W9BA 2AU0A 3MR5A 4OVLA 4CFCA 4M3YA 2G8VA 2IHNA 3FDSA 1TVRA 4E7IA 1JLBA 1ZYQA 1ZQXA 3AVKA 1S1UA 4RZRA 3MGIA 4DTXA 1D9FA 5HHIA 1HMVA 5HP4A 3RB3A 3MAQA 1ZQEA 1ZQKA 4CEDA 2C22A 5J0TA 3N4MB 9ICPA 9ICNA 5KFNA 3EWAA 4GC6A 3NGDA 4DFPA 5DQHA 2ZTDA 3VQDA 4DG1A 4F3OA 4F5NA 3O3GA 5KG7A 2IAJA 5CZ1A 3Q8PB 2HMIA 4JUZA 3HVRA 1LAWA 3ZSYA 1TGOA 4FW2A 4RPXA 4P4MA 3GFKB 3ITHA 3OYHA 1XS9D 3LPUA 2Y1JA 1C1AA 4JK1A 4CGHA 3TI0A 4CE9A 5DKWA 3ZT4A 3JPNA 1GOCA 4J2DA 4KFBA 3ZSOA 4CF9A 4YR2A 2HHVA 3FFIA 4IDKA 3C23A 4QZEA 5CYQA 1Z00B 2P66A 1JL2A 4OLAA 1ZQLA 2Y1IA 4FYDA 4I2HA 5FDLA 1Y88A 4DQRA 3L2RA 2C2RA 1WSJA 5HROA 1T05A 4QZIA 2BCVA 1S1WA 3VQ7A 4IBNA 4KLJA 5KGXA 2KZ3A 2DPIA 1RNHA 1Q9YA 2GV9A 4CEEA 3KD5E 3PX6A 4QWAA 4ECUA 1RBUA 2F1IA 1B92A 2X74A 2I1QA 3AVMA 4Q43A 3V1QA 3K59A 3RH6A 2YNGA 4TQRA 1FK9A 3OYMA 1HUOA 3K5LA 5FRMA 1ZQHA 1RBVA 5J2QA 2KFZA 1VRUA 2YV0X 3UIQA 5L1IA 4K8ZA 9ICLA 1WSFA 3OYAA 2FBVA 4RW6A 1KTQA 1N48A 3MEGA 3O4NA 1UAXA 2NRVA 2I5JA 3OY9A 1KSPA 4ECTA 1X9SA 1RBRA 3C1YA 4PHAA 1L3SA 9ICTA 4KTZA 2FLLA 4J2BA 3QEPA 5DGAA 4E89A 5KRSA 4DTPA 3ISNC 4HUFA 5FRNA 4J9OA 9ICRA 3EW9A 3MBYA 1TK0A 3ZT3A 1EP4A 4FS2A 5DQIA 3L3UA 1UWBA 3NGIA 2R8HA 4RQ7A 4HCBA 3RBEA 9ICWA 2ASLA 1BHLA 2AJQA 4IR9A 1Z3EB 1S1VA 3OYIA 4OKKA 2ASDA 4XQ8A 4CGIA 8ICZA 3GIMA 4H4MA 3TR8A 3B6PA 5DG9A 1L3TA 4I2DA 4RQ5A 1TKXA 1YTAA 4IQWA 5DB7A 4OJRA 5KFYA 4JS5A 3HW8A 1QTMA 2G8KA 3CYMA 2G8UA 2P6UA 4ECZA 2FLPA 4ID1A 3DOLA 1YTUA 1CXUA 4RQ8A 3Q8KA 3LP3A 1HNIA 2BGGA 4DFJA 3ZSQA 2KZZA 4CEBA 4F5OA 8ICHA 4FJMA 3VQAA 1KVBA 1REVA 3LWMA 5DBAA 3GV8B 1FKPA 5CJ7A 4R66A 4DSFA 4RUCA 2D0BA 1Q9XA 2YNHA 2AQ4A 2F8TA 2XGPA 2NRWA 3NAEA 2OWOA 5J1EA 1N56A 4M3WA 4RU9A 4DF4A 4BACA 5DK5A 3UXNA 3ZDBA 3V4IA 1RDAA 4B3OA 1J9AA 3DLRA 4E1MA 3T5LA 4WE1A 1VSDA 1XC9A 1ZQFA 4CEOA 5DGBA 3PX4A 4IRDA 4R5PA 3I0SA 2J6UA 2PI4A 4NM2A 1C0TA 2HNDA 4E7HA 4KB1A 2KQ2A 2P5GA 1JMSA 3BQ0A 3LK9A 1ASVA 3QETA 3KHRA 4GLXA 4HHTA 1QQCA 3RJIA 5CYMA 3RMBA 4BGDA 5KFVA 4DF8A 4CJEA 5KT6A 3V72A 4FBUA 5KFTA 2W8KA 4GVMA 3HPHA 3QZ8A 1N5YA 2YNFA 4DLGA 8ICGA 1SL2A 4CGJA 5BOMA 4UBBA 3HX0A 5KFZA 1IKVA 2P1JA 4B9NA 4YMOA 4HYKA 4FK0A 4FM1A 5DDMA 4QZGA 4RT2A 4UBCA 2OPSA 2HHQA 5CA7A 1HYVA 3IS9A 4DTRA 4Q8FA 4DSIA 4LH4A 3QEBZ 5KG4A 1S1TA 3H7IA 3SUNA 4IRKA 9ICHA 1BPDA 2JEFA 2EX3A 1MQ3A 3JPTA 2YNIA 3LAMA 1BI4B 3RRHA 3QINA 2J6SA 1TFRA 3CQ8A 3T3FA 5CHGA 4Z6DA 3QE9Y 1JL1A 8ICEA 1FXXA 2FPKA 3PNCA 1NK8A 9ICAA 1KLNA 4F3TA 1U9LA 5KFKA 4B08A 3RJHA 4QZBA 4DOCA 5IILA 2IOCA 2Z1IA 5HBMA 1TAQA 4TUQA 1JXBA 3NGYA 1ZQJA 3PUFA 3MDAA 4AHUA 1RT7A 4C8LA 4DQSA 3AVLA 3QNNA 1V9PA 5CP2A 4JV2A 4TSXA 2PYLA 1K1QA 4FZZA 3AVHA 4KV8A 2ZUDA 4DQIA 3EYZA 4YP3A 3JPOA 8ICBA 8ICAA 3MR6A 1VSIA 3N97B 3GV7B 1UA1A 2RPIA 5J2MA 1CLQA 8ICCA 4I7FA 3RTVA 4KLMA 4KN7A 4F4YA 1H38A 1QE1A 5HMMA 2BPCA 1IH7A 4LD0A 4RUAA 3G6XA 1EXNA 4KAZA 4R8UB 4CK3A 1ZQMA 2FMQA 1XHXA 4DL5A 2R8KA 4M42A 3NBPA 1UT5A 4CGGA 3CM6A 3AA5X 1RDDA 1ZQVA 4LH5A 3OVNA 1RDBA 1DTQA 2GBZA 4RPYA 4Z6EA 4E19A 5HP1A 1ZQYA 4OPKA 1KCFA 3QEXA 2DFFA 4M3RA 4FVMA 5J2NA 4AILC 2Q3SA 3QEVA 5CWRA 4OGCA 1RDCA 1S9GA 3AVIA 1BIUA 4PHPA 3O3FA 4F5PA 4DSJA 4JV1A 1ZBHA 3AVFA 4ECYA 4DFKA 2NRZA 3V6KA 4DMNA 1RYRA 3DRSA 4CERA 3HP6A 2B4JA 5DB8A 1NK6A 4AHVA 3RMCA 1NJWA 5CY4A 4BE0A 2P5OA 3L3VA 1SKSA 3JPRA 4PH5A 3BQ2A 5EU7A 1S0MA 4CJUA 4I9QA 2PXIA 5D4BA 3UPQA 1HJRA 4DOBA 3C5GA 3KHLA 1X2IA 3MDCA 1WAFA 4ECWA 1LW0A 4OGEA 3LAKA 3SQ0A 4I29A 2BR0A 3AU6A 2QKKA 1NOYA 1TV6A 3AVAA 4W5QA 2A1RA 3AO2A 3JSMA 3RJJA 1LWCA 5IIMA 3BGRA 4W5RA 4W5OA 9ICIA 3HL8A 3B6OA 4YMNA 4NLZA 5KT2A 7ICMA 4Z0UA 5F9NA 4MF8A 3Q8MA 1VSJA 2KN7A 4ED3A 4E0DA 4YR0A 4LSNA 3OYFA 1A5VA 5IIOA 2ZTCA 1CUKA 4O3RA 5HRRA 4DFMA 1U49A 3PO4A 4QCLA 4QZAA 5F9LA 3GIJA 1NOMA 4RW4A 4Q0BA 4KLQA 4O55A 2LYHA 3ZT2A 4FJIA 1IG9A 2VG5A 3KHHA 4CCHA 3SV4A 2MUTA 3HT3A 2UVUA 1KVAA 4KLUA 4UAWA 4I2GA 3B0YA 4MFFA 4FJXA 3M9NB 1TVAA 5HRSA 1HPZA 1D8LA 2XGQA 4Z4FA 1XSNA 5J2PA 4R65A 4DS5A 3PW0A 4BWJA 2JEGA 4M41A 3JPPA 1SUQA 4Z4CA 4CHQA 1RTIA 3MABA 3PVXA 4OPJA 3TWHA 2FC0A 4LY7A 4CEQA 1ZQTA 4F92B 2Z1GA 4ZTFA 3MECA 1NK4A 4DWIA 3OHBA 3AU2A 4AH9A 4ICLA 3Q8QB 4PGQA 4H4OA 1A5XA 3WNGA 1W0HA 4O3NA 1TL1A 5J2DA 4J9SA 1KFSA 4MFCA 5DMRA 3NF6A 2IBKA 4RQ0A 3BQTA 3SPZA 3LP1A 2G8WA 1HYSA 4JLHA 1K6YA 3RMDA 1MC8A 4UB2A 1Z00A 4QZFA 4IG0A 2FBYA 3RAQA 4CJWA 3P83D 3VQ8A 1RTDA 3PO5A 1WLJA 5BPCA 5D3GA 9ICCA 5KFXA 3PX0A 3SUQA 4CF1A 4F4WA 4W5TA 5I42A 4PY5A 1ZJNA 1NJZA 3QEIA 3TANA 4KN4A 1B22A 3OJSA 1IXRA 1B9DA 8ICUA 4J9MA 4M9LA 2F1HA 1D9DA 2FMSA 5EWGA 8ICQA 3G0ZA 2BQUA 2FLNA 1ZQNA 7ICOA 2KTQA 1BCMA 2A1SA 4CF2A 3QEAZ 1K1SA 4Q5VA 5DBBA 4ECQA 4QZCA 4ECVA 4ED7A 4NLNA 7ICQA 3ZSVA 4FO6A 2B21A 4O3SA 4KI4A 4CGFA 3RMAA 2ZJ8A 1Y97A 3CFOA 2PZSA 1DTTA 3TFSA 4Z6FA 4N5SA 4YCXA 3K5NA 1RCHA 4OKEA 2R8IA 4Z4IA 5KT3A 2KFNA 3RWUA 4M9GA 3RAXA 3VA0A 2OYQA 4LZGA 3T19A 4KLOA 1IKWA 3C2MA 8ICRA 4B9SA 3DOKA 1U04A 5J0SA 1KEJA 4CK1A 2GUIA 3RJEA 1TL3A 9ICKA 1VK0A 1JIHA 3OJUA 1ZQGA 2V4QA 3DLKA 5J2HA 3K57A 9ICOA 2JLEA 2NRTA 1J54A 4KLSA 1BGXT 3S3NA 5KFQA 4NYFA 4RQ4A 4TQSA 5KFHA 2QKBA 4MQ3A 3AA3A 2VA8A 2I9GA 1WSGA 1D8YA 4J9KA 3OYNA 4J2AA 2IHMA 4UB3A 1BL3A 3M9OB 3OHAA 4FLUA 4BDPA 4B9MA 2DFHA 1QSSA 3NGZA 2KW4A 1NKEA 2D0CA 4PHEA 2RN2A 1FKOA 4KLDA 1CZ9A 4B9VA 4NM1A 4R63A 2PFNA 1VSHA 3AVNA 2X6NA 7ICHA 4Z4GA 3V6JA 3IRXA 5EWFA 5IINA 2HNYA 2ZUBA 2R8GA 4FJ8A 3C2LA 1QHTA 5J0UA 2AGOA 2IS3A 1BQNA 3U3YA 3SQ2A 8ICWA 4CIFA 4RQ2A 2PYJA 4CK2A 3MEDA 5KFOA 4N56A 4CJ4A 4OKJA 4Q45A 3VQCA 3PR5B 4N47A 2VWKA 2JEIA 1C7YA 2FPMA 4F2SA 1KDHA 1VSFA 3L2VA 3LPTA 1TV9A 2ATLA 1T8EA 4O3PA 1ZQZA 3OGUA 4QW8A 5CR0A 9ICEA 3DRRA 1KLMA 3K5MA 1ZQDA 2A1JA 2ZJ5A 3QIPA 4KREA 4DTNA 4FBTA 5KG0A 5K14A 3V6DA 4UB5A 4CEAA 2XY7A 1S9EA 4BDYA 1RT5A 1KVCA 2BE2A 2R7YA 1HQEA 5IIJA 5KG6A 5J0XA 2VA2A 3QLHA 2XC9A 5KFCA 4AHRA 8ICVA 3OYKA 3C21A 2HHXA 7ICNA 1S5JA 3BJYA 5C5JA 2OPPA 1WCNA 3OSPA 2ASJA 4FLVA 4ELVA 1C1CA 2ZJAA 3TABA 3JPQA 2ATQA 2BKEA 3K75D 3H40A 7ICTA 2E6LA 3VQEA 3GV5B 3V7JA 3AO5A 2JZBB 4BXOB 4O5CA 3OSNA 3K4GA 4B8CA 9ICMA 4QAGA 2W42A 2XY8A 1Z25A 1ZQCA 2E6MA 4YFUA 3HVTA 4TURA 1UOCA 2J6TA 3IG1A 2XY5A 4M47A 2B6AA 4I2JA 5L1LA 1WSEA 2ISOA 2Z1HA 2BCRA 2V9WA 4MF2A 3KLEA 4FXDA 3HPOA 4GC7A 4M9HA 4CHYA 3WNHA 2W9CB 3AO3A 3M8SA 4CJPA 4M3ZA 1NK9A 4J9RA 4KKOA 7ICIA 4DOAA 4CF0A 3KLHA 2A1JB 8ICYA 8ICFA 1NOZA 4Q8EA 5KFWA 1JLAA 4KHQA 5D46A 4I2BA 3MXMA 2G8HA 4BWMA 3TAMA 3GILA 4XA5A 3PW2A 3KIOA 3TAGA 1ZBIA 3V7KA 4CIGA 1O1WA 3V9UA 5JS1A 1JXLA 8ICTA 2R8JA 1RPLA 3HO1A 4O4GA
chains in the Genus database with same CATH superfamily
3DFEA 9ICQA 3K1RB 1Y0HA 3TAMB 3OTOJ 3HD1A 3W5XA 1O51A 4LR9A 3VQSA 4Z6CA 4DL3A 3F9KA 3CC2S 3KJFB 1REGX 1KXPA 1D0EA 2BCUA 1DURA 3O8MA 4IO1A 1SKUB 3O80A 3IM1A 1WBDA 4Y00A 4TLRA 5M1KA 3BZCA 3U3GA 4DPOA 1IM4A 1H7WA 1KOHA 4UY8T 2XMWA 5K8OA 1M5SA 2LBOA 2NO4A 1HBUB 1S1TB 5IT9U 4Y2TA 3CCRS 1IKYA 1HUXA 2AX1A 4NCBA 4CM2A 3D2WA 1QSYA 4BVPA 3T1AA 1RXOB 2G2YA 4BG9A 2RILA 4P4OA 4ZP9A 1YJVA 2R3VA 3QRQA 4KE5A 2O4IA 4IFYA 2NZ4A 1HI1A 4CH1A 1WEXA 5I3UA 4CI6A 2CPYA 4NMXA 2JRZA 4ZN1A 4KMUA 1WJ9A 1J6ZA 2YX6A 3E1YA 2HHTA 1BLUA 2M70A 1PVPA 1F0MA 4B3SF 1ZAWA 3UWTA 1VQ7S 3NOCA 3I9V9 1SB6A 1LVHA 1LWEA 3CJ0A 3J80U 4XIUA 1YIJS 5HRPA 2JLFA 4ZTJA 3BBCA 4NCGA 3MCAB 3WQUA 3DGPA 4DV3F 4LVNP 1F9FA 2DFEA 4JK7A 2X78A 4LF9J 1VQ9S 3UNGC 4TU8A 4JI0F 2H5IB 4PG4A 2QGFB 3WK7A 3D45A 4BY9C 5J2JA 3E01A 5JTIA 2D3ZA 1YTYA 4JWNA 4YS2A 2CIMA 2KO1A 2WVDA 3W1YC 1SL0A 3OQ2A 2M0NA 2P6RA 4F50A 5IT9Y 1J5OA 2JEJA 3FFKB 2ITMA 4I6MB 3V1OA 3AXMA 2IMWP 3U7JA 2LQJA 3TAQA 4WXOA 3G6YA 3AVCA 4JKBA 1HNXJ 2HF3A 4H5NA 4DV1F 4KHRA 3G6VA 1SXLA 2OLWA 3FUYA 2Z30B 4KHWA 3A8YA 4DTSA 4USMA 5E41A 2BRLA 3ZT0A 3DLHA 1UEUA 4U7BA 2W9CA 4CJQA 2QARB 2XNQA 4FLXA 4KITB 1IVZA 1I6JA 3L7UA 4OV1A 2D0AA 1NSPA 2ZIXB 4QZVB 4DV2F 4CHOA 3SI8A 1LFWA 2OEMA 2FDRA 4N41A 1Y10A 1F60B 2A0FB 1S97A 1RTJA 2BM1A 4C7QA 2A2DA 2HHSA 1S79A 1X9JA 1ECWA 8ICIA 2IRYA 4F0KA 3GJTB 1MROB 3SFGA 3CDUA 4L3KA 4ZVRB 1VBZA 3HP9A 5KL8B 4RX6A 4CI0B 1RT3A 5HQ8A 4ZH4A 3CO0P 5HJYA 4QIWF 1QQOA 3N9UC 4FK2A 4ANCA 2Z0GA 4TUSA 4OX6A 3MCMA 1IBLJ 3BH6B 3SQOP 2ZH1A 4M63C 2PEBA 5ETKA 3ZT1A 2X1BA 4X66K 3ISDA 2WF9A 3C5FA 2XCPA 2YHXA 3ZNUA 2FZKB 1C2PA 2H65B 3K8WA 4J9VA 2D3DA 4TN2A 4CFBA 2KXNB 4OYXA 4LIWA 3CB4A 4DTMA 4YOXA 3U6FA 1MN7A 3AQFA 3HKWA 4K4ZA 5A8KB 1URRA 2BJ7A 4NYZA 3CD6N 3C6UA 2DKZA 1HEKA 4X4VA 4P72A 2GWKA 2VH7A 1L3UA 1VLYA 1BWFO 9ICFA 3D1OA 1EQ0A 2HNZB 4OMFG 2IM0A 1JUDA 4DL7A 2OTLS 4ELUA 2QG9B 1CZBA 4X4UA 1NDLA 3QRRA 3RSEB 4Y1CA 3MURP 3OYLA 1NJXA 3BGFA 3UMBA 3DOMB 1ED1A 5DLGA 1JLEB 4MEYA 1RWNB 2QM1A 3DYAA 3O9TA 4Y2VA 3QNOA 2BQ3A 2DHGA 3CC7S 1S76D 2HZVA 3NWGA 5KFDA 1BO5O 5EY4A 2XO7A 2ZWHA 4NEZA 3VN5A 4KLLA 3NBPB 2ZJQQ 5IFMA 5AQFA 1X5PA 4RNMA 5ALHA 3AB2B 1WC1A 3R1HA 2B3TB 4ZP7A 5SWMA 2P9UB 4L3NA 1LAVA 4G1PA 3HOTA 4GKKF 1HBNB 5B0DA 4CHPA 2B5JA 3ZFVA 8ICSA 8ICOA 2RSQA 3C6UB 2MZ1A 1AFJA 4ZCLA 1XI1A 4MO5A 2K8GA 2Q36A 1N5WA 3W2WB 2NXCA 1SQEA 3H1QA 4ISGA 3CCWA 5I9EB 1BPYA 4JRPA 5AFUH 2DY1A 4QJFB 3MCSA 3E0FA 2VG7A 3IO1A 4WWSA 4IH7A 2ZH8A 2LXFA 1T9YA 1GOAA 1VC6A 3FGVA 2NO5A 3SPYA 4NX9A 2LQ5A 1WKKA 3NE6A 4TNOA 1TK5A 1JLEA 1APSA 1U1OA 2CH6A 2QIFA 4NA2A 3A0HU 4DV4K 3VQBA 5AK6A 5J1PA 1FJGF 3EM1A 5LT5A 1U8WA 1E6VA 3RW6A 3RU0A 1NB7A 4LVOP 3KNAA 5AK4A 3UKUB 2AYGA 3D9BA 2YH0A 4DR5F 3AVJA 2AP1A 3AEVA 2RF2A 3VEWA 1IKXB 3JSMB 4LQ9A 9ICBA 2I38A 2RQCA 2XMKA 4YB5A 1CJUA 3TADA 9ICSA 4OX7A 4EP4A 2E2QA 2KVQE 3G10A 2LQBA 4K4GA 3TZXA 4Y1DA 1HKGA 3LVVA 2BANA 3P5JA 1L7NA 2Q0ZX 4KRFA 5F8HA 3SCKE 4TUPA 1ATNA 4LR8A 4JRQA 4KX5A 4LFCF 5D0HA 4PQUA 4LSNB 2YMPA 3I56S 1T3VA 3VGKA 4CJ7A 2JFDA 4CQ1A 1KQFB 1BVSA 4B3TK 3VF6A 4C4RA 1FFGB 1FVQA 3Q0AA 2YX1A 5GAEU 1BWEA 4FF3A 3VQ6A 4B3RJ 2JX2A 1UTAA 3BB5A 3S6EA 3F73A 2HBJA 2KT3A 1ZD4A 1Q18A 2F8SA 2RNEA 1BISA 3SYZA 5IQQA 3NLCA 3VETA 3AVGA 1S6PB 3HJVA 1OH8A 1SQGA 4QOZB 2PBDA 4W4MA 3GFZA 2W7PA 2OANA 1MMNA 4NCGB 1N5SA 2ZH2A 3L8BA 3CJ7A 4XUSA 2WFAA 5ALEA 4B8AB 4J9LA 1WHXA 5ELZA 2U1AA 4JN4A 7ICSA 2CNKB 2ZUCA 1YZ6A 1SI9A 5GVQA 3FEXB 3SCXA 3BDPA 4M5HA 1C0UB 3ETRA 3S3MA 2P9PB 2QWNA 1Y11A 4GV3A 4HUGA 2AH5A 2OYYA 4IKFA 3MEKA 4CEFA 3W0LA 3GU0A 3SMPA 1LB2B 4RW4B 2BVZA 1LV5A 3FQKA 2Q31A 5HMXA 1X4EA 3M1YA 3CTRA 4KLGA 4UB4A 2E1PA 3H42A 4IFYB 3HPGA 1X4FA 3SV3A 1PBUA 3CPWM 1ZZNA 2JVOA 2P9PA 4KHUA 4O9MA 1EX8A 4NLCA 1HRHA 3AQEA 2F3JA 5CABA 3AUOA 3ZX2A 3FSIA 3D66A 4WCEQ 4BC7A 1XO1A 2CNLB 4F4XA 2DIVA 3WEEA 4OZ3A 1SUQB 1XNSA 2J7UA 1ELOA 3UQ0A 5A2QY 3OYGA 1IKYB 2KJ8A 2VIXA 3BO2A 1V97A 4M7YA 3HZEA 2MHNA 2X6SA 4X66J 3IRWP 2UXCJ 2ZUAA 5AKYA 4JV0A 3D6FB 2F77X 1H74A 5H2FU 4TU7A 3VPZA 1N62A 3R2DJ 5KFMA 3GLJA 1VJQA 2W4PA 1DTTB 1X9MA 4FVUA 1T11A 1X60A 1XQIA 1YWXA 3QUTA 3FBFA 3WQTA 2UV8G 4ZVGA 2W9MA 2WC9A 5JLHA 3CCMS 2DGTA 3C95A 3Q8SB 1QE1B 5C24B 3CCQS 3IR7B 3HJFA 4MJKA 3L4PA 1KWMA 4F9OA 4KI6A 2VQFJ 1Z6RA 2L9DA 3EE3A 5HSPA 3T1YF 5LM7E 4PRFA 2N4CA 3K5OA 2Q97A 1EWQA 2WTFA 1SJQA 3HK2A 3DRPA 2ZTEA 5E3AA 2ZBCA 2BANB 2V2KA 4CZLA 1M6YA 3C46A 3EX7B 3BBFA 4FWKA 4KHPK 3ID8A 1ZRMA 5M1NA 1HYSB 2PC6A 3JS6A 5J2FA 3ID6A 1FEHA 3AM9A 2CPJA 2DTUA 4ZPBA 2IYIA 1HQEB 4I9LA 3FRZA 1N6QA 3JAMY 4DMZA 1HJOA 2H5JB 4PPZA 8ICXA 3D3BJ 2CQCA 2NS1B 4J9QA 3M4XA 2LEPA 4P2XA 4KTQA 4BRLA 5C2DA 3D0PA 2DBBA 3QJJA 1GXLA 3J7YP 3S9HA 4FJ5A 5EE3A 2ZNYA 3SI6A 4OD0A 4ZLLA 2FJBB 3DM2B 3TJ9A 2LKYA 1DOQA 3GIIA 4LC9B 1VQPS 1LKZA 4C8KA 3TA2A 2ISPA 3UVJA 3A5LC 3O44A 4WF9Q 4CF5A 3ZD9A 1RT2B 4L72B 4EYHB 3N7SC 1GX6A 4XTTA 5AKIA 1HBNA 1VSEA 3TYTA 4F36A 2P9UA 2NYIA 4FJKA 3NGRA 2ZIWA 2JV3A 4CJRA 4ZK7M 2BZFA 3EDRB 4PG5A 5GADP 5D49A 2XHBA 2XB2D 1VQNS 2JXJA 3VC8A 3F56A 5ALFA 1XU4A 1JLQA 1RAIB 2CJ9A 3MMJA 4IEEA 1U2VB 3EZ5A 5ALYA 4EU0A 4Z4EA 4ECXA 2HS4A 4DS4A 1VQ8S 4OI3A 4JI3J 3ORYA 3MPUB 2OZMA 3J80Y 3NXZA 3WC0A 3U1NA 1HKCA 2CG8A 2KICA 4G6VB 2YX8A 2CJKA 3MX2A 1Q46A 2KD1A 1H72C 1I1GA 3OYEA 2R4FA 3MM9B 2WK4A 3H8WA 1N60A 2AHOB 3MEEA 1Q95G 4OJPA 3QJLA 4UAZA 3DGVA 1FJCA 5C25A 2CA9A 3OVBA 1VQON 2DNQA 3HILA 1R8CA 1WSHA 4CHZA 2C28A 1NGFA 4LJMA 3TZWA 5K8MA 5EUHA 2GHVC 3IN5A 2YWFA 1X1PA 3D5MA 3IHQB 1U45A 3MR7A 4E3SA 3AODA 4DV7K 4DTJA 1V6HA 3T1HJ 4W98A 4RNFA 1ZM2A 5BYRA 2OAUA 2J5AA 3SZ2A 3QRPA 2XMTA 2J76E 4H8KA 2P6TA 3AGRA 4QWCA 3PXGa 2ZHAA 3ZCMA 4LF4K 3UXPA 2I9SA 3L3FX 2MKIA 4YXMA 4PWDA 4OI2A 1FWLA 3VA3A 1ASUA 1PJ7A 3FC4A 1K8AT 3R6MA 3KD1E 2M88A 1RYUA 2YXLA 1Z2ZA 1ZQOA 1NZAA 1NNEA 2F9WA 4FZNA 1N32K 2E2OA 3OYCA 3M8QB 5JS2A 2OKQA 4XH5A 3AO4A 1T94A 3NHGA 5LJ3Y 3VV2B 1CG2A 1NLKL 1X0PA 3OFHA 3H20A 3UCUP 1OMSA 2K8CB 1SKRA 3KMSA 3R6GB 1JLFB 4NY8A 2ZM6J 2ZJRQ 1LWCB 2G0CA 4CEZA 4K25A 2EXUA 2XMMA 3VZHA 4FJLA 1S12A 3CCRN 4RQ1A 2PA8D 2EHGA 4I6MA 4KGXB 3R7BB 4HHHA 4F5RA 1L7MA 2L08A 3H46O 4IFVB 1Y3KA 2W2OP 3AOCA 1BI4A 1NGGA 3ZETA 3OXFA 4J91A 3NVWA 3SR6A 4JMUA 1UCVA 3KJQB 4CFCA 2EI5A 1FWPA 4LFAK 3SBGA 2BTFA 1Y7PA 2KV2A 2O8CB 1N33K 1HMVA 4CBWA 1WC4A 4FF2A 3RB3A 1ZQEA 4KY3A 2NRRA 9ICNA 5GADU 5KFNA 3CRXA 3NGDA 4DFPA 4BROA 5DQHA 1QVFR 3VQDA 4DG1A 2CPRA 3O3GA 1A6LA 4JBCA 2IAJA 4UW2A 5D0GA 4JI6K 3MPVA 5A0LA 2HMIA 4ZLPA 5ALIA 3HVRA 1NUEA 1S6UA 3UVJB 1LAWA 1JCFA 5DETA 2MYFA 4P4MA 4ANEA 3HI9A 3LP0B 3LPUA 1UZHA 2Y1JA 4CGHA 1R3NA 2G1HA 4DHYA 3AHPA 3ZT4A 4J2DA 1GOCA 3IV6A 3ZSOA 3MX5A 5D6GA 5B0CA 3ENWA 3GZFA 3FFIA 4JI5F 1VRTB 3D2EA 1JL2A 3L4QA 2Y1IA 1FE0A 4OZLA 2I2YA 3LDNA 4I2HA 1Y88A 2ASYA 4NZ0A 2IVOA 1T05A 4BRPA 2JWKA 2QA1A 2VCPA 2JH1A 2DPIA 4Y3CA 1S22A 2QRRA 1MA7A 2B8PA 1RBUA 3EE8A 2BOAA 1TFWA 3V1QA 3AVMA 3AAWB 3K59A 2ASMA 4C0OC 4QOTA 2W2PP 5H1SV 3D2FA 5EVZA 3AAQA 2KSOA 4B1WB 4ZP6A 2QFIA 4RNHA 3DGPB 3S41A 2M3DA 4JYAK 5K9FA 1WEYA 3VAFA 1P8GA 2DHSA 9ICLA 3KJNB 1WSFA 4FYXB 4LRCA 2YKPA 1KTQA 2AYMA 4WP8A 1N48A 2R7SA 3MN6A 4H5RA 3O4NA 3D7EO 3D2QA 3OTOK 2R2TA 1RBRA 4AP9A 1HNWJ 1FE4A 4CLFA 2ZBPA 2ATCB 4PHAA 3VF4A 1RWVB 2KHDA 1FDBA 4C4WA 1LWXA 2KOBA 3AMZA 2FLLA 2EFGA 4LF2A 4IDKB 4E89A 3CIMA 4CE6A 4HUFA 2AEJA 5U47A 3EW9A 1GNKA 4KGZB 3NGKA 4FXWA 2WBNA 5EN1A 4JI6F 3L3UA 1UWBA 3NGIA 4QQBA 1S5LU 4OX8A 3D1HA 3BPSP 1PG5B 3DV9A 4QJVA 2AJQA 4FWNA 2V52B 5E3CA 2ASDA 2MZTA 2KN4A 3KLIB 2K1RA 4CGIA 1XEZA 1EQMA 4NV0A 3LW5C 3H90A 4USKA 1N63A 1XNQF 1L3TA 2F8LA 3SCIE 1V38A 1RHQB 5HK4A 3R8YA 4JI6J 4B3TF 5F8GA 2KIWA 1CLFA 5DB7A 2RH3A 3R9LA 4JS5A 1HKAA 4ZP8A 1QTMA 3MGJA 4ID1A 1REVB 4I69A 2R7VA 3RZAA 4KX3A 4OZ2A 5AIAA 2MHEA 2WAQC 4WTYA 4CEBA 5F3ZA 4WF9L 3TUJC 3VQAA 2D9OA 1REVA 3LWMA 3W3DA 2QWQA 2FB0A 4GKKK 1GAOA 5CJ7A 2HBMA 1Q9XA 3G6EN 4MKAA 4DR6K 2OWOA 1BU6O 3IXQA 4NOHA 1N56A 4EGLA 1SV5B 3TACB 4DR5J 2IVPA 4ZVUB 3EICA 2P9IA 1VSDA 1XC9A 4K4YA 2ZH4A 4IRDA 4BGBA 2EEYA 4R5PA 1KHWA 3IGVA 4UOCA 1ATSA 3I0SA 4N8OA 2J8AA 1NO8A 2DGWA 1VFJA 3ZLJA 4DR3K 2P5GA 4IG3B 1JMSA 3BQ0A 2LA6A 3OFEA 3LDLA 2BX6A 3KHRA 4WCEL 4F4AA 1FJGK 3MPDA 1UCNA 1JB0C 1XBWA 5AXNA 3PYFA 3NNCA 5CR4A 2IM1A 4WFNQ 4X65F 1H6KX 2KP7A 1VIXA 2BE2B 2DO0A 4CJEA 5B66U 3GWCA 3SEIA 5KFTA 2YNFA 4NEYA 4AXIA 1P6TA 4WIIA 4NMLA 1SL2A 5CH7B 2HURA 1E6YA 1JLCB 4WFZA 3W9IA 5KFZA 2CPFA 5B0BA 1IQZA 4B9NA 1WC6A 4YMOA 4HYKA 1D8ZA 3KWMA 1HARA 4UBCA 2OHDA 3BUZB 4ACOA 1TFYA 3EL2A 5CA7A 4BGAA 4OPAA 2GJ2A 4JI7J 4LH4A 3H5YA 1KD1O 2LDYA 1M5PC 5BREA 3GG1A 1NAQA 9ICHA 2EX3A 4CZIA 5I3PA 3QINA 1M1KO 2B6AB 1AUDA 4IYQA 3SXLA 2G5HB 3F44A 2RUSA 3QE9Y 8ICEA 2F65A 3C6AA 4CNZA 4JD2B 3UR3C 5KFKA 2OP5A 3UNYA 4DOCA 5IILA 4IH6A 5HBMA 1GT8A 1WWUA 1JXBA 1EB0A 5AXMA 4JKAA 1DQ9A 4B1YB 4P2FA 3MDAA 2LKZA 1ZZFA 3MI7X 4C8LA 3AVLA 4X64F 3WDOA 1K0TA 4J90A 4TSXA 2VJ4A 1Q16B 1K1QA 2IBOA 2E1EA 3K0JA 2D0OA 4NXNK 2WAQD 3KHYA 3JPOA 1XTZA 2PE8A 3MF5A 2MKHA 1H3DA 3KLGB 5J2MA 1UA1A 2B56A 3IWLA 1NDCA 2HIQA 5THWA 4DG1B 4M95A 3KOOA 4KN7A 2ZITA 4KHMA 1LQ9A 4WIQA 2ILYA 1UQVA 4B3SK 1UETA 3ZX0A 4USHA 4A2AA 2YQ1A 2FMQA 3RBXA 2R8KA 4M42A 3NBPA 1UT5A 4HT7A 1YSJA 4WJ3B 3CM6A 5AQQA 4C4SA 4UZCA 4IKAA 3AA5X 1RDDA 1ZQVA 3QDKA 4Y2KA 3T9ZA 4LH5A 2ZH7A 3OTQA 4NYOA 1SJ1A 2WVCA 4Z6EA 4ATNA 2W4CA 2ABYA 2DFFA 2O8BA 3B8HA 5AE1A 1KONA 4DPTA 1BIUA 2DXFA 4DSJA 1T3OA 4MIAA 1F1BB 3UO0A 4MYUA 2NRZA 3UDCA 1RYRA 3ZETB 3HP6A 3CC4S 4R25A 4LF5J 4AHVA 2L3MA 5B7WA 3KD3A 2V34A 4MFBB 1S9GB 5GIPA 1W97L 3D1QA 4WFBQ 3P4UB 4H0YB 3U4LA 4PH5A 3BQ2A 5T7LB 2PXIA 2CRLA 1HPZB 2GQ2A 3CCLS 2XULA 3MDCA 2IVYA 4I29A 2BR0A 2RF2B 4K5SA 2QKKA 2J4RA 2I5JB 2VODA 3AVAA 2XM3A 4UATA 1GLLO 2AEMA 3KUEA 1RAOA 5CYQB 5C0YA 3IM9A 3HSDA 3I96A 3QJPA 3MM9A 5IWAK 2ZIVB 4OFZA 3HHNB 4MDAA 4LF8F 3HL8A 7ICMA 3OBYA 4OX9F 2FJ6A 4PUOB 4MF8A 3Q8MA 2X1GA 3LPYA 1NPRA 1GMWA 3D6TB 1VQMS 3LA0A 1T9WA 2HMPA 3CC7N 3CC2N 3HT0A 4KJIA 3A5NC 1UVKA 3BS5B 4NLRA 2YWEA 2QLFB 5GMKa 2YWGA 4NPOA 3LTOA 2VC0A 4XPEA 1NOMA 2A2CA 1SV4A 2AEFA 5BR8J 3T7ZA 4OYPA 2NYHA 4GKJK 2HFZA 2LYHA 1IG9A 2JZ5A 2PMHA 2VG5A 3TZYA 4RW7B 4UT4A 2QJ3A 3CJ1A 3AJDA 1FD2A 2MUTA 2WB1D 4Y34A 3M9NB 1FKOB 2ZWOA 4ICLB 4PR6A 5J2PA 2JEGA 3UDLA 1F9HA 4L6V3 1IJFB 1NMDA 4CHQA 1RTIA 3MABA 3G8QA 4JI2F 4CEQA 3QYPA 1ZQTA 4F92B 3DU5A 4A48A 3CCSS 2G0AA 3AU2A 3IP4B 3CDBA 4AH9A 3SQGA 5AQMA 1XC3A 4C0ZA 5C2CA 3EGVA 3US5A 3MMBB 4MFCA 4OYOA 5ALZA 3UDVA 2QT7A 1RM6C 1WORA 4LF4J 2V8HA 3WXMB 3RMDA 5HROB 1CJTB 2O5DA 1N36F 1X6IA 1HD0A 4ZIVA 1UFLA 3M32B 5A0YA 4MTPA 3E01B 5D3GA 4PKDB 4HACA 3HHLA 4AL7A 5I42A 5FJ4A 7AT1B 2ODGA 1NJZA 3QATA 1SH3A 4H0OA 4J9MA 4L73A 2UUCJ 2W03A 5EWGA 4LBPA 8ICQA 3PJXA 1Q78A 3F2CA 1ZQNA 7ICOA 2YCHA 1MNEA 4HDHA 1Q8LA 1BCMA 2PN6A 2F8KA 2O8FB 4CF2A 2XI2A 4DV4F 3N7RC 1TMJA 4ECQA 2QWRA 1PCAA 5EGYA 5B5EU 2N3LA 1HD1A 2N4DA 3IRXB 4LSLB 5LMNK 5BRFA 3CFOA 3TFSA 1DTTA 3MM7B 4URQU 4ZVSB 3BO3A 3L4BC 1GLAG 1B0TA 2DGVA 3MWPA 3BV8A 1FEZA 4JYAJ 2LYVA 3RWUA 3RAXA 2GMHA 1Q82T 3IRUA 2FF6A 2ZIWB 4I67A 3G87A 4WFAL 3O8WA 2WAQF 5RUBA 1X5TA 3J81U 1IM6A 3DOKA 4TU9A 4YOWA 2CJYB 4DPUA 1KEJA 3RJEA 2CXEA 4GFJA 1DK2A 1RWXB 3OJUA 2V4QA 3K57A 1OY9A 1ITPA 5KFQA 1RAHB 1FXLA 4BQZA 3CD7A 5KFHA 4UUXA 3IAS9 3D6RA 1WSGA 1D8YA 2P35A 3OYNA 3LDPA 4C4TA 3V81B 4B9MA 2IM2A 2DFHA 4H0PA 1NKEA 4PHEA 3VMFB 4CDGA 3TNVA 4KLDA 3H0RB 4RBVA 1URNA 2RS2A 1EKRA 4UARA 1ZOLA 4AFFA 4ILHA 2R42A 5ALVA 2HNYA 2ZUBA 1CS4A 3AOBA 3S6JA 2VFSA 5J0UA 3ETMA 1BNOA 4FL9A 2KKZA 3WHIA 1MWKA 8ICWA 4CIFA 4CK2A 1DY3A 1FRMA 3QO9B 1WEZA 2K8BB 1YJWN 2A5XA 3RUBL 2UXBF 4IS7A 2B6GA 2E5LJ 3MK6A 2HS3A 1VJWA 4WU2A 2YKOA 4F2SA 1QHAA 1KDHA 2HRUA 4OYWA 3FZLA 3LPTA 2ZOFA 3UD3P 3QU7A 2EKNA 3H3OB 3OGUA 3FCHA 4NXNJ 1FK9B 1Q82O 2FD2A 1KLMA 3WIVA 1QZ5A 1F2GA 5D4NA 3H5UA 2E5HA 4KREA 5AM4A 4DTNA 1JLAB 4NLSA 4UB5A 2XY7A 2P6SA 4JKDA 2HBLA 1KVCA 4GVEA 2LU2A 2R7YA 1HQEA 5HMYA 1K0VA 1RLDA 5J0XA 5KG6A 1VC0A 2VA2A 3QLHA 2AJ1A 2Z2ZA 3OYKA 3C21A 1TMMA 3SMZA 4ICAA 3HSGA 1HHTP 5C5JA 5E5NA 3J7AP 1WCNA 4FLVA 1N32J 3K75D 4DL0C 1U2FA 4FWOA 2VGNA 2F44A 3JSRA 2CNNB 1UVNA 3CMEN 1DJ0A 2J9DA 4QAGA 1D4XA 2XY8A 5E3RA 4LIRA 4YFUA 3ITHB 1U6ZA 2UUWA 4LFBF 4BJQA 1UOCA 2GWJA 3IG1A 3FFIB 4OX9J 1U1RA 4MIWA 2QA4N 2EFQA 4MF2A 3JS9A 2DNYA 4GC7A 3WNHA 4ID5B 4BC4A 3QT7A 4DKWA 4MLHA 2QB0B 1NK9A 4CYUB 4CT8A 1T0TV 4O4RA 1QAJA 1ZD3A 8ICFA 3P6YC 2P9KB 4UOHA 3EXYA 2Z4PA 1GQEA 2H5EA 4DV3K 2LM1A 2G8HA 3MMCA 4AYBF 2D41A 3NMRA 4BC3A 1VDHA 2G5IB 2ZBIA 2JC1A 1PYTA 3GONA 5LMUK 8ICTA 2YNHB 3KOAA 3HO1A 2UUBK 2BEFA 9ICGA 2F8HA 3NCIA 2VG6A 4K8RA 4B9LA 4QS8A 1EARA 3CQYA 2FPLA 2CVEA 4KHPF 3T79A 4RTFD 3WK5A 4JI0K 3KHGA 2IC3A 1ZM9A 2XY6A 3HSZA 1KN5A 5KI6A 2OA8A 2HMIB 3N6LA 3M8WA 2FQQB 4DQ8A 3PKMA 1N52B 2ZE2A 1N54B 1IBMF 2ROPA 4X4TA 3CG7A 3LP0A 4QWBA 2YQEA 4FWQA 1R8HA 4CBUA 3O1BA 2F7VA 2PFOA 1YVFA 2W9BB 1HNXF 2DNLA 1T9UA 2P9CA 3EPIA 1R6YA 1NK0A 2Y8WA 3H0LB 3CFRA 1HNVA 3I56N 3RGIA 3UI3A 3U9DA 3QU2A 3JTNA 3ILLA 4CH7A 2HHUA 2CQBA 4EO8A 1C20A 1YBAA 4B3MF 1VI7A 4RUHA 3L6QA 1NNLA 2BCSA 3MEGB 1J97A 2KVIA 1RWMB 5AHXA 1I5OB 3LDAA 2ADCA 3DOLB 4CJVA 4Y2AA 2PAVA 1GOBA 4J2EA 2DGQA 4X62F 4A57A 3O3HA 1BUXA 1A76A 4DU8A 4FS1A 1T4GA 1WCLA 2RU9A 1TK8A 1SQFA 3QX7A 1RLCL 2EAPA 2CRXA 4Y0FA 1SJRA 4ELTA 3ZZ0A 4ZA1A 3P96A 3PZPA 4HACB 1IKWB 4W92B 9ATCB 3IKMA 4MK9A 5ALWA 4B6JA 4CGDA 1T3NA 5CZVA 2FHKA 2VC1A 5ALLA 3UM9A 5HJXA 2DXDA 4JKHA 1B43A 3OS2A 2BDPA 2P9GA 4BX9C 3RJMB 1RABB 4CRJA 2IRUA 3D0IE 2Y9UA 1S0NA 1IG6A 3PMNA 1X66A 3NH2A 2KHCA 5AXLA 5LMNJ 4F5QA 4LSZB 4KGMA 5CHIA 1ZBFA 2OPRA 2CQ3A 2HNDB 4DEZA 2DR9A 2RRNA 5JVHL 3MGHA 2CWKA 4EBCA 1JK9B 1YRXA 2A10A 4I2AA 5AXKA 4ZPVR 2A19A 5AM5A 5J2EA 2W8LA 3TSPA 1OO0B 4DX5A 3VF2A 3GFXA 1NSQA 2BV3A 4L8RB 1G15A 1F2HA 4KPCA 4JKCA 2WHOA 4DUYK 1JN3A 1WC0A 3VQTA 4IOBA 1ASWA 4ES2A 2O1PA 1VHFA 4AHCA 4O8UA 4UQGA 5J0WA 4QIFA 4ED1A 2VF3A 2AJFE 4FLYA 4DSKA 3CJTA 3THWB 3Q22A 3BYRA 1KNZA 3BYPA 2DEJA 4B3MK 1N8RO 4XDCA 3MAAA 5C25B 2NRXA 3IP0A 1XMQJ 3QIOA 1IN0A 2A3VA 3DLJA 1HBMA 3CETA 2W6KA 5J2CA 1HBOA 5KG5A 4IG0B 5EDWA 4Y2UA 4NLOA 2DB1A 4IH5A 2QB0A 1S1VB 4TVAB 3OYJA 4K4WA 3KZXA 2F96A 3B8AX 1J5OB 3DXKA 3N79A 3CJ8A 2FVCA 3IMXA 2NR0A 3HMJG 3MN5A 3NS7B 4M63A 1JCEA 3RR8A 3PEHA 4ZIWA 5CB1A 4V19X 1R31A 5ALUA 1CRXA 3IC1A 3CDEA 4O0NA 1WNSA 3LL3A 4MHVA 3FRYA 3VGVA 2W7OA 4TKTA 3PFOA 4ZLJA 3T1HK 2D9PA 3LZJA 1BPEA 1NH7A 4J37A 2LU1A 4DR2F 2FTRA 3LQVA 3GYGA 2FVRA 2LI6A 2YBVA 2NZCA 2VWJA 3IWNC 1VRQC 4CZCA 1P9QC 3GTYX 3W61A 5L1JA 4AL6A 2KM8B 3T5KA 4RL1A 1S77D 1RILA 2LLZA 2AJ4A 4M0AA 4I6YA 4C23A 3R3LA 2LYAA 1GTHA 1FD8A 2HK2A 2JMGA 2IDLA 4WK3A 3S3OA 2DGUA 4YEAA 1S0VA 4R8UA 3ZDAA 4DV0F 4R0JA 3WBZA 1UA0A 3KKFA 4PG6A 1DHMA 2BHNA 4DR7J 1QAIA 2E8PA 5H9EJ 3G8SA 1RXVA 1KKHA 2MLZA 1HJPA 4K4IA 3CJSA 3SSSA 3EO3A 5F1XA 1VSLA 1IIPA 4F91B 2VANA 2B0CA 3ZC4A 1VSKA 2OEJA 5D0EA 4X2BA 4FNIA 5J8YC 3Q8RB 1KRPA 1WUAA 3U02A 3BP8A 2AXTU 3UB5A 5EOZA 5HHHA 3SJJA 2PY5A 2C3UA 5AZIA 3DNCA 1TKTA 3BZKA 1RWWB 3RB0A 3OBIA 2WONA 2PFFB 2QARA 1VK8A 1DZ5A 2X1FA 2YMMA 3UMGA 2W3SA 2AYEA 3EVMA 1S1XB 3VQ4A 4NLTA 2BOPA 4AHSA 2GIQA 2ZC4A 4FF1A 4DO9A 1MDUB 4YN3B 4KLFA 2KK0A 4AQYK 2PD1A 2V8PA 2F4VJ 2E1RA 4RW8A 4XPCA 4ZPWR 5C24A 4PL2A 2GQCA 4ZITA 4KAIA 3PNIA 4DV4J 2NV3A 3GIKA 2QWLA 4W5NA 2KLAA 3H08A 4KH4A 4E1JA 2VIHA 4HCCA 1S7HA 4ECSA 2VA3A 4ZVTB 2KG0A 2BUNA 3PM9A 3PSPA 1X8DA 3NWRA 2KDOA 2Q43A 2HVHA 3LM9A 3WKAA 2A6AA 1U26A 1W7WA 3NGTA 5JUMA 3WKBA 1EHWA 4DQPA 3AT1B 1OH6A 1RCXB 2CN1A 3UR0A 4B3SJ 4O44B 3AA4A 1B0XA 5CCMA 1U8SA 3PJ9A 1RSCA 4CP5A 3SQ4A 1WOOA 3WKDA 4LFAJ 4NL9A 7ICKA 5GAGU 3CJRA 3GCWP 5EWEA 4U8YA 2WCXA 2HRTA 5KGWA 3MPWA 4H0TB 2MGZB 3HWTA 1HLUA 4F4ZA 2NUBA 2QN6B 2GV1A 4ED6A 4QZHA 2F1FA 3C14A 4JI0J 1CI4A 3O1LA 1CJVA 2UZAA 4PGXA 3BF3A 3DLLL 2WONB 2YTCA 1IUJA 1HIYA 4LSLA 1X4HA 2PSZA 5D4PA 2XO6A 1FESA 3I31A 3QIDA 3FC9A 3M3ZA 5AQPA 1SZPA 2EH9A 5E7OB 4PL7A 3FE1A 1YJ9N 1XNRK 4FZYA 4B3RF 1FFVA 1HLWA 1UPPA 2HFNA 1QVGR 2BGWA 1NHVA 4C3MA 3PIOL 4EWTA 1TAUA 4YDUA 5G0RB 2ITGA 4Y0WA 1E4FT 5TZVA 4CO2A 3QU9A 4DV3J 2IGIA 4Z7CA 1GLCG 4IWVA 4K4XA 4UOFA 3GQCA 2JL9A 3SUPA 1VQLN 2W01A 3H2UB 4A8WA 3PR4A 4KH5A 3BGOP 1OSDA 2BUPA 1WWVA 1FWKA 1R8BA 3D68A 2WF7A 4CECA 1PYSB 1B7FA 1S99A 4CLPA 2QLXA 4Y2SA 3KLIA 4Y2RA 3A12A 5M2UA 2IOHA 2CVIA 2ZH5A 3B0XA 2DNNA 3N5FA 3KLVA 3VZIA 1BPBA 2XYPB 3C8YA 5HMLA 4PG8A 4FVCA 5A8WB 4I1TA 4G3IA 3TVZA 3TUZC 1FRLA 5AKXA 5KFRA 4CHNA 2HAIA 4RR5A 1JNZB 2GEMA 3TADC 1ZQ1C 2ZEJA 4RT3A 2IVMA 3C6HA 3V5RA 4O0IA 4CBXA 4ZLNA 1RT6A 2P9NB 2ADBA 4Y2PA 1U1NA 4GY2B 5D0RA 1TV6B 1RDFA 2G13A 5HNKA 3W65A 4F0MA 1QQMA 1HR0J 5KFBA 3WXKA 2H3IA 5KFLA 1U25A 1B64A 3N28A 4MDBA 5CZ2A 2HW3A 4FW1A 2KYZA 2HYIB 4CO3A 2DNGA 4YQWA 3D6JA 1SAZA 2BA9A 4FYYB 1CJTA 4OLOA 3FGUA 1LKYA 1ACMB 2MZRA 2YNIB 5BRDA 4IEIA 5HAOA 5K5MA 5DDQC 3DEEA 1YGYA 3M2UB 3L2QA 2XZDB 1N33F 1O0PA 1RDUA 1RAJA 5DQGA 3NCRA 3BS5A 3WNFA 2WOMB 1U09A 3Q7CA 4RQ3A 3C28A 2YHAA 4J9PA 1RG6A 1RTHA 2L5YA 3NS1A 3FM9A 1HWUA 1X4GA 4WKRA 3I5CA 4A8KA 4DN9A 4U95A 1JNRB 2AP6A 4PHTX 3U1MA 1HX1A 4BCAA 4CJ5A 1U1LA 3QMLA 1R0CB 4L74A 2E7XA 4RPZA 1C1BA 1BDGA 3BQ1A 2DVIA 3QNMA 3HXMA 1EIYB 3THWA 3M9MB 3OV7A 2PFPA 9RUBA 5KPZA 5DB9A 3DHXA 1LWFA 2RD5C 3JYTA 3MM5A 2OCEA 4X4NA 4N76A 4DU3A 1QQ6A 1CJUB 2GVZA 2K06A 4YY3F 4CJLA 1JQGA 1MWQA 2YKMA 2E5LF 1V3ZA 3EXCX 1YJWS 1LKYB 2G8IA 3KG4A 3BSOA 2J7WA 4HLBA 5GINA 1KAYA 2BPFA 2BJDA 3HVAA 1SQKA 3NF7A 2O8BB 1WSVA 2QWPA 2CAJA 4CZEA 3HLUA 3V9SA 2W2QP 2IHR1 2BCQA 2BE9B 4DL4A 2YHWA 1HMVB 4FOIA 1VSMA 5CYMB 1KAZA 1FRKA 1Z26A 5HANA 1NGJA 2XS7A 1R8PA 1C6VA 3H4BA 5D15A 1NZ8A 2W55A 2FMPA 4QIVA 4YXJA 2HK3A 1B9FA 5AT1B 5C2FA 2PDAA 5DDYA 5J0RA 2P51A 2DHAA 1ZQRA 3TOQA 2QKQA 1IR2A 5LMUF 1R43A 3J81O 4P4PA 4HH1A 1D5AA 2OTJS 2MQMA 4TY8A 4KYZA 3QGPA 1U6BA 2C3YA 3KLGA 3T1HF 4QYRA 1XNRF 1JALA 3GE9A 3L0QA 4RLEA 2C2DA 1KS2A 4QW9A 1Q3VA 2DISA 2HGLA 3H8JA 1HPMA 3H0PA 4J03A 4YVZA 2CWXA 4EENA 2FF3B 5LL6d 3IM8A 4PJ0U 7ICEA 4RG8A 3C2KA 3SQ1A 3ULHA 3SUOA 3AQOA 1BA0A 4USJC 1UHUA 1PBAA 1RT1B 3H5SA 3FYHA 5J2KA 4IOXA 2NZTA 1RDRA 3HRDD 1WDTA 3NVKA 5J2GA 3I8DA 2PA3A 4C80A 2WVBA 2XHCA 4DCOB 4O0JA 1OKJA 4IG3A 3I33A 3M7VA 2VKRA 2D1KA 1XSLA 3DLLQ 4AYBD 4LFCJ 3FSYA 1DT9A 3ULEA 3FAHA 1JLGB 3TTFA 1JLQB 1RGIA 2E8MA 1W9HA 3HKZD 2EQYA 2DGOA 2MXYA 3OLBA 3WU2U 1T9TA 5KAKA 3MFHA 3CMQA 1NGHA 4B17A 3BN7A 5E79U 3FBCA 1H0HB 4PKGA 1XMQK 3BSCA 5DS7A 3JXUA 3TFRA 1M5HA 4ES1A 3H2LA 3ZSRA 2V68A 3D3CJ 4IR1A 3OS0A 4C48A 3L7PA 3CCTA 3P8BB 2H54B 4ILRA 2YB4A 4MYTA 4NXNF 1QH9A 2EZXA 2L48A 5KG3A 5DG7A 3W63A 2VHGA 2MSSA 1DGKN 3JPSA 1RZTA 3L09A 4V1Ak 4EBDA 2ZXIA 4KO0B 3MXIA 4KKOB 3QO9A 3CM5A 1KKXA 4NRTA 4BDZA 1CC7A 2HQFA 1KQGB 2P9EA 3G6ES 3V1RA 3X3UA 1NEEA 2EK6A 7ICRA 4IRCA 4CW7B 4NXZA 3ETLA 7ICVA 1QCKA 2XWXA 3TU5A 2W9BA 2KU7A 3B9JA 4OVLA 1NWKA 5ALPA 1JJ4A 2IHNA 3HBTA 2ZIXA 4RQMA 1S1UA 2E66A 2H51B 4C11B 4U67Q 4KH6A 5A76A 1KEKA 5IXUA 1ZQKA 4JEPA 2L41A 3MUVP 1QVFM 3FEZA 5J0TA 4NXMF 3HRGA 3EWAA 2MQ8A 3O0FA 4JHDB 3N7PD 3THTA 4F3OA 4F5NA 4DXLA 2G06A 5KG7A 4JI2K 3FZKA 2LFVA 3Q8PB 4JUZA 5LXRA 4KFBB 4CNQA 3ZSYA 4U67L 2RRBA 3CP8A 1XMOK 3KKAC 1FFWB 3ITHA 3G8TA 1XS9D 1NM2A 3TI0A 2FHJD 4CE9A 4JB3A 4CZGA 5DKWA 1S59A 5AFUA 3QFHA 5DM6L 4W90B 2HHVA 2XI9A 1Z00B 4FZLA 1UJ6A 3HFVA 5AQLA 1ZQLA 4FYDA 1AFIA 1H1VA 3TA1A 3L2RA 1N5TA 4QZIA 3VQ7A 1S1WA 4IBNA 4KLJA 5KGXA 2KZ3A 1M5KC 1KN6A 1YDLA 4GV9A 1Q9YA 2D3O1 2GV9A 3C16A 3KD5E 5ETVA 5ITHA 1OPIA 1B92A 4HKQA 2A3JA 3NOGA 3IDWA 1MU2B 1JI7A 4Q43A 3GMGA 2E9RX 4A46A 5ALJA 4TQRA 1HKBA 4JHDA 4DX7A 2DPNA 5ETQA 2V2QA 1FK9A 1S57A 3G82B 4IO9Q 2AZ1A 1HUOA 3K5LA 2NPFA 3A4TA 2V7ZA 1ZQHA 4ILGB 1AA1B 1M90T 1CC8A 4G9BA 2CDQA 3UIQA 5L1IA 2B43A 3WUHA 2HGNA 2FBVA 3VGUA 2LPEA 4LRBA 2HMXA 2KSOB 2NRVA 4YORA 3OY9A 1Z1VA 3AH6A 3A3NB 3KBBA 1ZBTA 5A8RA 3CCLN 1BNPA 4B1ZA 2ZDPA 3B82A 9ICTA 1HBMB 4OIXA 4KTZA 2F2AB 5AM1A 5DGAA 4NO7A 4DTPA 3ISNC 2F9DA 3OTOF 4DV6K 5FRNA 4ANDA 4KT0C 1JKHB 1EP4A 3GR0A 1B7YB 4NA3A 1TL7B 2XYGB 1N61A 2R8HA 2P8IA 3RBEA 9ICWA 1OXJA 2J9CA 1Z3EB 2GGPA 3OYIA 1H98A 1QD1A 2Y1LB 4LF8J 3M2VB 3TR8A 2WVFA 1C0GA 1B4FA 4ZJQA 2HWIA 3O3LA 3EUB2 4AL5A 2HZAA 1ESVA 3HHKA 2KNJA 1YTAA 4ZOHC 3CE8A 1WI8A 3GJSB 5KFYA 5E33A 3GU3A 2JLGA 3CYMA 1K8KB 3O6WA 2G8UA 4ECZA 1F3FA 1BOTO 1SXDA 1YTUA 3Q8KA 3TA0A 1NSKL 2B4UA 4F67A 3LP3A 5D78A 1HNZF 4CLWA 4DFJA 2YMLA 4B1VA 3QQCD 4F5OA 8ICHA 2GS8A 4Z37A 2VBYA 3FKBA 3CIPA 1J2VA 2XG8A 4KBIA 8RUCA 3GV8B 1FKPA 1IBKF 4R0EA 4KHPJ 4R66A 4DSFA 3OXGA 5JRTA 3KWIA 4RUCA 2D0BA 2CFXA 3RVCA 2JWNA 2F8TA 4LREA 1AZSA 2NRWA 1BA1A 3NAEA 5J1EA 5AI9A 3AOAA 1OW5A 4DF4A 1FRHA 4BACA 2K4PA 2FJXA 2VBZA 4O23A 4AXJA 1J9AA 4QS9A 2GOLA 2CYYA 4PAAA 3CULA 2Y3YA 4WE1A 3MM6A 1ZQFA 4CEOA 5DGBA 4DR3J 5ALXA 2VONA 5BR8K 1RAAB 2J6UA 3NS6A 1OVQA 3VEYA 1C0TA 2HNDA 5E84A 1WDDA 4LRFA 2HOQA 4CTAB 3ILIA 2IJFA 2X7IA 1DQAA 3QETA 3JQJA 4GLXA 1CJKA 4HHTA 2HQGA 1ZC6A 3QIPB 5LY3A 3MAHA 3RJIA 3R5AA 5AZJA 2RE1A 4ZPDA 4RWXA 2M2BA 2QTWA 5KFVA 4DR3F 4MT1A 5G4DA 1WOSA 4LFAF 5KT6A 1N2XA 5E26A 3K8VA 3VEVA 4BG8A 4GVMA 3HPHA 5F8JA 3QZ8A 1N5YA 5AM0A 1D09B 2PMZF 4F26A 5KPRA 4JOUA 2OPPB 5FP0A 5BOMA 4UBBA 4FPRA 3PSTA 1IKVA 5HVGA 2CG4A 2MQOA 2DCUB 2EC0A 2MJUA 4FM1A 2BJ8A 3PTWA 5DDMA 5C42B 4QZGA 3PJWA 4M8LA 2MB0B 1HYVA 3R5JB 3QT8A 4DTRA 3KUHA 1RHKB 2NNWA 3CJ3A 4XK8C 3OPXA 1YRUA 4X4OA 4DCHA 2PIIA 4IRKA 4OJ6A 4FYVB 1BPDA 2H9ZA 2JEFA 4B1XB 3LAMA 1BI4B 4RWTA 1IXKA 4NJ8A 2OTLN 4BREA 3W62A 1JL1A 3POTA 3BGUA 1KLNA 3LGHA 2KE7A 4B08A 3RJHA 4QZBA 4DV2J 3D54A 4C3LA 2IOCA 4ALZA 2QSWA 2VOOA 3D7SB 4TUQA 5AQOA 3TUPA 1RT7A 3M7DA 2VZ9A 4QNLA 2AW0A 4JAXA 1V9PA 3IG8A 4JV2A 4HR2A 4FZZA 4JI4F 4NXMJ 2ZUDA 4DQIA 4FPBA 2DEIA 1TL5A 2FXUA 5BN9A 8ICAA 1KQSM 3QU5A 5FLXO 3N97B 2WSCC 3P5BP 2F8EX 8ICCA 4I7FA 4QIWD 4KLMA 1QUVA 1Y00A 4FPIA 5CA5A 2AMCB 4KC5A 1DEJA 4WQ4A 4KH0B 3G6XA 1EXNA 2F3NA 4CK3A 3JSBA 3WC2A 2DCLA 5AQNA 4GKJF 4CNYA 1RACB 3MEDB 3I55S 3CD5A 2YVSA 1DTQA 3W64A 1RDBA 1YF5L 2E20A 2R2RA 2IOFK 1RBLA 4RPYA 4F0HA 2HHHJ 5HP1A 1VC5A 1ZQYA 1QAYA 4DPWA 4JI8K 1KCFA 4DUZJ 1BQMB 2Z58B 4H4KC 4OGCA 2JC0A 1S9GA 4K0KJ 3MMVA 2M5YA 4YDUC 3AVIA 5GAEI 1HW8A 3K7RA 4PHPA 1ZBHA 4A8XA 5GAGI 4PZNA 1L8OA 2AKWB 3VAHA 4ECYA 2ZZMA 2VOPA 3V6KA 3NMAA 3N4QA 3GBTA 4WYLA 1RAEB 5JVGQ 4AQYJ 4DR2J 4HVZA 1IWAA 2VL1A 2HVZA 3RMCA 1NJWA 1Z19A 2XZTB 1MMDA 4BE0A 2P5OA 3L3VA 3JPRA 5EU7A 2B4PA 5DJBA 3T6BA 4L75A 1KC8T 1BY9A 2N7CA 3W2VA 5ALOA 5LJVA 2O8DA 3C5GA 2GFFA 4ED5A 4BUGA 4ECWA 3M1VA 4OGEA 4HI2A 3FNNA 3AU6A 1KTVA 2KKPA 1RWOB 4W5QA 1BUPA 3AO2A 1VQLS 2FIUA 3RJJA 4B02A 4W5RA 4K2XA 4NLUA 3KG1A 5A8RB 3FZHA 4NLZA 5KT2A 2HSTA 3IFEA 4Z0UA 2LEAA 3MTKA 3TVYA 3ZZUA 3OL7A 4MKVA 2MPUA 2NXJA 3OYFA 2ZTCA 4CTAA 1RT4B 5F8LA 2QW9A 2EKYA 1SPBP 2Z56B 3A1YG 3BKTA 1FF2A 4QZAA 5HL7L 5F9LA 5DDPC 4KLQA 3NAHA 2CGKA 3CNQP 2VKZG 2BJ1A 1RBAA 5FDLB 4CCHA 3SV4A 1B99A 2LP4A 4QR2A 1YVNA 2UVUA 2DL0A 4KLUA 4UAWA 4FWSA 3B0YA 2E5LK 1NZPA 3CJKA 5HRSA 3EZWA 3M2RA 4Z4FA 4Y2MA 1XSNA 3C29A 4BWJA 4Z4CA 3EKSA 4E98A 2UUAJ 3TWHA 4YHHK 1CS4B 3MECA 1NK4A 4DWIA 1HHSA 4PGQA 3UFCX 1GXUA 2VUGA 1SZ2A 4BRIA 2XVTA 4H5WA 1AUSL 3EVWA 3CMAS 1Q53A 2HBZB 1FFUA 1W0HA 1FA0A 2PO4A 4J9SA 5D4OA 4CLZA 3TPQA 2MZSA 2HFVA 2OM6A 3HJEA 3A0IX 3LP1A 2YN4A 1HYSA 1COKA 4UB2A 5AJ3J 3J81Y 1RTDA 3ED5A 3PO5A 5ADZA 3ZZOA 3P39A 3PX0A 3RG6A 4LF8K 1TZ0A 2OMOA 4YHHJ 2H3FA 2UUTA 1R0AB 4MMOA 2DNOA 4P6QA 1ZJNA 2F4VF 5ETPA 3QEIA 1OH7A 3TANA 3BDEA 3OJSA 1IXRA 1B9DA 8ICUA 4M9LA 2F1HA 1D9DA 5JMNA 1JJ2M 1X7VA 1NNDA 2GAHC 2ZJQL 1RHMB 1MW7A 2FI1A 4C11A 2RRAA 3DC2A 2A1SA 4WU3A 3VGMA 3HKZF 3LPEA 1Y9OA 2HLUA 4Q5VA 2ESEA 3ICXA 3LOUA 3ZEUA 3MGVA 3OTEA 2H3ZA 2H3GX 2ZIUA 3E9OA 3NGSA 4Z6FA 2W6LA 4YCXA 2RKIB 2HIYA 4OI1A 4AT1B 1RCHA 3BF4A 4OKEA 5CHCB 3CXCR 1XNQK 2K4EA 3U27A 4DU7A 2DGSA 5DDOC 5KT3A 2KFNA 2QTDA 1BQNB 2OYQA 4JV5F 2VFTA 3T19A 4N8NA 2R18A 2E3TA 4I2QB 3JAMU 3OTBA 5HR7A 1EO1A 4KRWA 1MN8A 2G0IA 3AA8A 3CF5Q 8ICRA 1D9AA 4B9SA 1EP4B 2ZVIA 3HF5A 3PHTA 5J0SA 2GUIA 2RQ4A 4DR1K 1TL3A 1JIHA 5J2HA 2XS5A 9ICOA 2PFDA 4KLSA 1BGXT 3VGSA 2RIJA 4UY85 4TQSA 3OW2M 4DCJB 1ZAXA 5L38A 4MQ3A 1Y5LB 3W7BA 3AA3A 3AJ1A 3MUMP 1WG8A 1J2NA 4P2MA 2XMJA 4J9KA 4J2AA 5IV4A 1LEOA 4WP9A 1FX4A 1BL3A 3HFZB 2CPIA 3OL8A 4FLUA 3O2IA 3CHWA 2FSNA 5AKHA 4CZMA 3WKEA 2M9KA 3NGZA 5B09A 2D0CA 4BVOA 5CEHA 4B9VA 3LGNA 2PFNA 1VBYA 2GAGC 4HDGA 1VSHA 2N7YA 2X6NA 4Z4GA 3IRXA 3PYGA 5IINA 2KG1A 1OSCA 3C2LA 3FCWA 3UN5A 3BN4A 1ZRNA 4DUTA 1NRKA 5ALNA 4K50A 2ASPA 3D6HB 5KFOA 4F71A 1U2RA 4EFHA 2G07A 2H4WB 4TLQA 4A8YA 4N47A 2OPSB 3CT9A 1C7YA 2FPMA 3EUNA 1VSFA 3AA9A 5DM7L 2LM4A 1I94F 5K14B 2XMAA 4H54A 4QR1A 1HW9A 1ZQZA 4Y65A 1RCOB 3SDEB 2NUHA 5AQRA 5D77A 3QBWA 3I76A 3OVAA 2A1JA 2HQDA 1R27B 1G99A 4ZHRB 3KDOA 2XSJA 5KG0A 4OO1J 4YMEA 3V6DA 4CEAA 2BACA 1S9EA 1NGEA 4BDYA 2DNMA 4DR5K 5IIJA 3M8ZA 2XC9A 3TTDA 2G2ZA 4AHRA 3CXCM 3AAPA 1C1BB 7ICNA 4UZBA 1LW2B 4JV5K 3W2VB 4ELVA 2ZJAA 3TABA 3T1YJ 4YOTA 2BKEA 4PKIA 1CZAN 2E6LA 3AY9A 3W9HA 3VQEA 3GV5B 3V7JA 1HWLA 2JZBB 4BXOB 2BW7A 3TR5A 2W42A 4OI6A 4I7FB 1Z25A 1ZQCA 4K4SA 1UEVA 4TURA 1YITN 3C0BA 2XY5A 4I2JA 1WSEA 1R8AA 1RQLA 2V9WA 2DTJA 2LMIA 1VQPN 2E2PA 2R7QA 1FVSA 4GMKA 1VQ6N 4LF1A 4OHWA 2W9CB 4F3QA 3AO3A 3M8SA 1IBLK 7ICIA 1WSRA 4DOAA 2RQMA 2A6OA 5EHHA 5LOQA 1NPPA 5FPNA 4U9RA 4K0KK 4HH0A 3J81j 1UW4A 4ISEA 4P74A 4KQZA 4YOEA 3DXMB 2YWWA 2E8OA 4BWMA 2KXFA 3PW2A 3KIOA 2VG6B 2FZGB 1XR7A 2KB2A 3F5TA 1KP6A 1ZBIA 2DIUA 4CIGA 2R7OA 3ICLA 3VTIA 2D1CA 3C3LA 5BPMA 3V9UA 4DV5K 1JXLA 3B4DA 4QPXA 2W4DA 2R8JA 5FPMA 1VRUB 3RSEA 1UW9A 3I87A 3V6HA 4MFAA 2DQNB 1ZQSA 4K4HA 4P7TA 5M1OA 4M5DA 3I9ZA 3V4MA 5KFAA 2CPEA 1JLFA 1LXJA 2RE2A 4FNHA 2UVWA 4ERDA 3Q8LA 2LYBA 4B9UA 5AQJA 2I5HA 1G4CA 2YTUA 1XWLA 2FJDB 1FO1A 2LA4A 3B78A 4BRAA 3PMLA 4C98A 1ZQBA 3J7YU 3RH4A 2ZOGA 4YY3K 3GIRA 1HWJA 4NL9C 2QK9A 2LEBA 3M8PB 2V7YA 1T9VA 2COLA 5KFSA 2FHOB 1HWIA 5KG2A 3AL0B 4FCYA 2QLBB 1EKEA 1JLBB 3ZD8A 3RR7A 5AQVA 1BD6A 4YOVA 3SDEA 1N0UA 3C7NB 1KDNA 2F76X 3TAFA 3UD4P 3G4SS 1OS5A 3GP9A 1QS4A 5AQYA 4ZHRA 2UXDF 1RWUA 1BIZA 3ZEUB 3A8EA 5DM7Q 1KW4A 1RTJB 1DBDA 2NQPA 3CFPA 3OFFA 4DL2A 3SAHA 4OZNA 5F0UA 3FR0A 3W5YA 3NH1A 4E7JA 1A7GE 2XMVA 2ERRA 1LOUA 4EHUA 4M3TA 3O9SA 5ALKA 3OR1A 1FXRA 4PUOA 4R64A 1GLFO 1I51B 5AQZA 3CCZA 1IO2A 3DDNA 4H4KA 5ETTA 4DSEA 4GVLA 2VPWB 4I2QA 2JZBA 4BXOA 2RDJA 2RHKA 4HTJA 1TKZB 3PW4A 5GADI 1J53A 2DNRA 1IBMJ 1BHNA 2CH5A 4JKFA 2C2ZB 1ZQIA 4JYAF 1TL4A 4MK8A 1D1UA 2QB1A 1HBUA 4FDFA 1TUGB 4A59A 1UT8A 2AQ0A 8ICJA 3MR2A 8ICMA 1HNVB 4CJFA 3IDHA 2VJUA 4JI5J 1Z1BA 3C16B 3LO3A 1S9EB 4CFDA 5AKGA 1TUWA 2D3OR 2E1ZA 1A0OB 2GH1A 2CADA 4JKEA 2FHJA 4YN4A 3R1LA 4M9NA 1HQUB 2YX7A 1VQNN 5AKEA 3QWUA 3VEXA 1U02A 2E1CA 2HB5A 1SJFA 1CULB 1TQLA 3W5ZA 2KRBA 1PUZA 2GELA 2OXOA 5KFUA 3M6VA 4CZKA 2QI2A 1CXQA 3TQEA 1RYSA 2IOFA 5KT5A 2R9LA 4DV7F 1KQQA 2V0NA 3MWBA 5GMEA 1T03A 2VWBA 8ICKA 5JLFA 3IUCA 2RJZA 1XMOF 4RBTA 5ADXA 3J7ZO 3E3XA 4OI0A 4GXIA 4DHVA 4URGA 3GSIA 3CJCA 2YJEA 1NLVA 4OX9K 1HNWF 5T7BA 1N4LA 4QR0A 4C0BA 4EBEA 1ZD2P 3GDXA 1YVUA 5DZ7A 3EY1A 4RO0A 3QFWA 4M6WB 5KFFA 5KAIU 4K2JA 1YJNS 1BG3A 4BRGA 3K9KA 1SBRA 4EX6A 2ZQBA 3ILJA 4C8OA 2M7SA 2PT0A 1U4BA 1FDDA 1N32F 1NG9A 4GMJB 5GAEP 5KG1A 1CSJA 2FVPA 1YAGA 2V8DA 3CJ2A 4ILLA 2OH2A 3HZ6A 1JLCA 3CCJS 5GAHU 3GG0A 4X4RA 4NYNA 1J27A 2HNYB 2OELA 4HHUA 1M5OC 2E88A 1F5AA 1S10A 4KLEA 4CLUA 1WBBA 4CO0A 3NVYA 1QSLA 2HHWA 4DB3A 3JSYA 3PLAA 2ZXHA 5BRHA 5G5HA 1Q81T 3DMJB 1QM9A 4OYIA 4CWBA 1X4BA 4C8NA 3V7LA 4LUBA 1RP5A 1L7OA 2V69A 2EW9A 1TYQB 3MUTP 5F3XB 2C2EA 5FROA 2ZD1A 2EANA 3ULDA 3AB4B 3EDQB 4MH8A 3HDSA 1OYEA 1T02A 1SKWA 2QZ8A 2V51B 3VGLA 1BPXA 2Q3PA 1NDPA 1U0SA 4TYBA 3OTDA 5DRKA 3NY0A 3NASA 4CD3A 4OZ5A 2O8EB 2I7NA 1N34K 1RU1A 2GMJA 4PPXA 3KUGA 2W40A 2HF4A 1NJYA 4ZVHA 5JJBA 2HGMA 4M1KA 5B8HA 2C1EB 5FLXU 4B3TJ 2DR6A 4X5VA 3CD0A