4O0IA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
SKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with 2'-MeSe-arabino-guanosine derivatized DNA
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o0iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4o0iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o0iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0iA01
4RZRA 3ALYA 2JEJA 4O3SA 4RW6A 4B8CA 1C7YA 3OY9A 3MR2A 3LZIA 4R8UA 1S6QA 1CZBA 4O4GA 3LWMA 3F9KA 1IKYA 4J9MA 1S5JA 1VSKA 9ICXA 4ECUA 3Q8SB 3SI6A 1KFTA 4NM2A 4CEEA 3VA0A 3VA3A 4M3YA 4HYKA 4FLXA 2Z1IA 1QTMA 8ICBA 3KHGA 3KD5E 4ED6A 4KTZA 1UA0A 1ZJNA 5DB6A 3H08A 1JL2A 3M9NB 3BQ1A 4CJVA 1NK8A 3RWUA 8ICLA 3QEBZ 4ECVA 4EP4A 4IQUA 1BIZA 3MDCA 4W5RA 3C21A 5DQIA 5CP2A 1EX4A 1BGXT 1ZQGA 1RBRA 4UB3A 4DSFA 3TQ1A 3TFRA 5KG6A 4I2FA 3M9MB 4Q45A 2PFPA 1ZQXA 3V4IA 2FBYA 1YVUA 1D9DA 4O9MA 3U3GA 4J9PA 2BCQA 2XCPA 4H4MA 2FBVA 3O3GA 2FMSA 4CFAA 2ZJ8A 1JLCA 1HPZA 3V9SA 1IG9A 3QEPA 4KPYA 3KK2A 4CJQA 3EYZA 4Z4FA 2VG6A 1BL3A 4M3XA 4F4ZA 4CGIA 7ICFA 4YR2A 8ICYA 3ZSWA 4KB1A 2AGPA 2BHNA 4I2EA 4CHYA 4RQ1A 2HHWA 4FJ5A 4M2YA 5KFQA 4IG0A 4LD0A 1ZQNA 3UQ2A 1MC8A 1VSLA 3LP3A 3PW5A 4M47A 4F5RA 4LH5A 1WSEA 9ICSA 3HVRA 5CA7A 2AGOA 1RYSA 4BGDA 2JZBB 1EKEA 3MEEA 4RQ8A 1ZBFA 1RYRA 5C5JA 1WSJA 3L2WA 3MFIA 1CZ9A 3ZDAA 1U45A 4FBUA 5SWMA 5EWGA 4G1QA 8ICWA 4DTOA 4YD1A 3PV8A 1LAWA 2IDOA 3PVXA 1C0MA 1JLQA 1ZQAA 5EWFA 4UAZA 3MR5A 5KT5A 3ASMA 4BE2A 1IKXA 3ISCA 2X78A 1D5AA 4CJEA 1PZNA 3V81A 4I2IA 4ID5A 4NLNA 2OPRA 1JMSA 3JPPA 4RQ2A 4TUPA 1J54A 3K5MA 4ECQA 5DQGA 1LW2A 3PO5A 1TFRA 3O3HA 4F2SA 3L2QA 2BCSA 1EP4A 4MFCA 2OYQA 3NGIA 3C5GA 4BDZA 5KGXA 3BQ0A 4DS5A 4FLZA 4XA5A 4QZCA 2UVUA 4I2PA 1HJRA 4CGHA 3C2LA 5T7BA 2VWJA 1RTDA 4EEYA 2PFOA 2C2EA 4M3RA 4UB5A 5J29A 4FLVA 4DU1A 2O4GA 4I28A 4CESA 2BGWA 2ZQBA 4FZZA 5J2FA 1S0VA 2W9BA 4F4WA 4OGCA 5CWRA 4JUZA 4I2QA 8ICAA 1BI4B 3SQ4A 4DTMA 1HYVA 1EXNA 3ZSXA 7ICTA 2D0BA 4UB2A 4MF2A 2HNYA 3QZ8A 3AA5X 5FRMA 1ASVA 4CJ4A 4M41A 4N56A 2XCAA 4G3IA 5CJ7A 4IRKA 8ICJA 1A5WA 3RJIA 4F5QA 3MR3A 5E41A 1QE1A 4CF9A 4ECYA 3HW8A 2FBXA 4DSEA 3WNHA 2J6SA 4B3OA 2HNDA 3OYEA 8ICRA 4YN4A 3B6OA 3ZT1A 4J2BA 1KSPA 3ISNC 2DPIA 4E7IA 4CJPA 3QNNA 3JPSA 3T5HA 1N48A 4LZGA 4MFFA 4FJLA 3OSNA 3VQDA 4CK2A 2YV0X 9ICUA 2OWOA 1TAUA 2OA8A 1IM4A 1KLMA 2ITGA 3AVAA 3KK1A 3S3OA 3GIMA 3LPTA 3EPGA 2GUIA 1QSLA 4CEOA 2VANA 4Z0UA 4FJGA 2A1JA 5KFGA 2RDIA 3LALA 4ELTA 4GXKA 4KLFA 2YNFA 2V4RA 2F1IA 4ECRA 5KFOA 4O3NA 1VSEA 4RU9A 2DFHA 3OYDA 3U3YA 4B8AB 4KLOA 3MXIA 7ICUA 1NOYA 4W5NA 4RQ5A 3RMDA 4KLDA 4CIFA 3SQ1A 4BXOA 4IDKA 4FM0A 2XO7A 8ICFA 3PUFA 2NUBA 1WNSA 1XHXA 1N5YA 2Q3SA 4CF8A 3RR7A 5TZVA 4KLTA 1ZQDA 3B6PA 2BCRA 5KG5A 4OLAA 3SQ2A 1JLEA 4KLSA 1SL0A 3C94A 5KFYA 4Y1CA 5DKWA 3G6YA 2F1HA 4W5OA 3D45A 4E7HA 4O5BA 1DTQA 4RQ6A 3AA3A 5KRSA 7ICLA 2X6NA 5KFDA 1ZQPA 2VA2A 4I2HA 3ZSOA 3KLHA 3MBYA 4IG3A 5D49A 3HPHA 3V7LA 3IS9A 1TK0A 3OYJA 1U4BA 4LVSA 3ORYA 1B22A 3C2KA 4NLKA 3C5FA 5J0YA 1Z26A 3AO3A 1WCNA 2H5XA 2W8KA 2ZD1A 4R66A 7ICGA 4KLGA 1Q9XA 3Q8KA 4JLHA 3QINA 5J2IA 8ICSA 4CHOA 4NYNA 3DYAA 3NDKA 4NCGA 2C2RA 3LPUA 4FO6A 4HUGA 2IA6A 4FK4A 4L8RB 3C23A 4QWEA 3ZDBA 1RXWA 4BWJA 3KKSA 4XIUA 3RH4A 1NJYA 1J53A 5BOMA 3O4QA 2GBZA 4YVZA 3RAQA 4IR9A 2WONA 2Z1HA 4DL3A 1RZTA 3AVGA 3V9UA 4FJIA 3ZSQA 3ZDCA 3K58A 1RT5A 1BPEA 4FW2A 3ZD8A 8ICOA 4ED0A 3MXJA 2W9CA 4O5KA 1A76A 3GV8B 7ICQA 9ICOA 1XSLA 4Q8EA 2C2DA 3QEAZ 2V9WA 5DG9A 2PZSA 3ZD9A 4AHUA 1Z00A 4FZXC 4IFVA 1GOCA 3OYKA 3M9OB 2Z1JA 4I2CA 2FMQA 9ICPA 5KFKA 3AUOA 4H8KA 3WNFA 1S10A 8ICMA 4CGGA 4Z4HA 2FC0A 4UAYA 2RDJA 8ICQA 2ZJAA 5F9LA 2R8IA 2R8HA 4DFJA 4I2AA 4J2DA 1ZQIA 2BCVA 3ZSRA 4ECTA 3CYMA 3V9ZA 2W8LA 2BQ3A 1IKWA 3OS0A 4OKJA 1WAJA 4ECWA 1L3SA 4OKKA 2G8KA 4I2BA 1ZETA 1RBSA 5CB1A 3P5JA 2LYHA 5DGAA 1BPXA 1XC9A 7ICRA 4GC7A 4KTQA 1ZQUA 4HUFA 3PX4A 4QZFA 4C8LA 1ZQQA 1X9WA 1WCLA 5DG8A 2MUTA 3KKRA 3RJKA 3MABA 4FLTA 4PHAA 3TANA 4RPXA 3VN5A 3GIIA 3DMJA 2G8HA 1CEZA 2KN7A 4RT3A 4BDPA 3OHBA 3H8SA 4M42A 4EP5A 2KZ3A 1XI1A 4PUOA 4CEBA 3HT3A 4DF4A 4M45A 5DBBA 1VSDA 2RF2A 4LZDA 2PFNA 3AV9A 4E7JA 1ZQFA 3KLIA 4KLLA 4AH9A 2UVWA 3G6XA 5DB8A 3MEGA 4DTRA 9ICTA 4K8XA 1DLOA 5KFZA 4DFPA 5J2HA 3TARA 1VSMA 5KFJA 1WAFA 7ICHA 3RB6A 3NH0A 4O5CA 3RB4A 4CGFA 5KFXA 2F96A 1U47A 1NJWA 1Y97A 4Q44A 1FKOA 4LH4A 1S77D 4YCXA 9ICIA 1LWCA 3DLRA 4I2JA 5KG4A 4CK1A 5J2PA 1ITGA 5DDYA 1J9AA 3DRSA 4JWMA 2BQUA 2NRTA 4R63A 4MQ3A 4J2EA 3ZT4A 4J9NA 1RCHA 3EPIA 4LSNA 4OPJA 4YR0A 4FBTA 2FPLA 3V6DA 2RKIA 4M3UA 4OJRA 2XY6A 1CLQA 5HP1A 4MFBA 4CHQA 4B08A 4KREA 1RT7A 4BACA 4HVJA 1KDHA 3E01A 5KG1A 9ICFA 3RB3A 2WOMA 4M9HA 1NKCA 1Q8IA 3GILA 3KHLA 3NCIA 3OYAA 4KLMA 5EOZA 3QEIA 4FM2A 4F92B 1J5OA 4DL7A 1RT1A 4QWDA 4PGQA 1KLNA 4B9LA 4CJ3A 1FKPA 1JLGA 3RJEA 3AVBA 2KZMA 1ZQWA 4DLEA 2IHNA 2P51A 4E3SA 1ZQSA 2HB5A 4ID1A 3ZT3A 4F5NA 5DMRA 3DOKA 3V7JA 3AO2A 1CXUA 2X6SA 3ISDA 1S9FA 1W9HA 5I42A 3PMNA 3V7KA 3QIPA 4QOZB 5IIMA 1RT4A 7ICSA 3L8BA 2NRWA 8ICHA 3NAEA 4KRFA 4J9LA 3KHRA 4KHYA 3ZDDA 1Q9YA 2IC3A 2VA3A 3HXMA 4CERA 4ECZA 3GV7B 4KV8A 5CZ2A 2E6MA 2AJQA 3TI0A 4OKEA 4RNMA 7ICMA 1TL1A 4M6WA 4RPYA 1T7PA 4CHZA 4FXDA 3HWTA 2ZJ5A 3IHQB 2P6UA 4ED1A 1TGOA 3BGRA 1YT3A 4DOAA 4KLQA 4I9LA 4M3WA 4FCYA 1X9SA 3MAQA 4DTSA 3C1ZA 4JS5A 4AHVA 1ZQZA 1VK0A 3UIQA 1TKDA 1S1VA 5HROA 2HNZA 5HMLA 1L3VA 3RH5A 3D0PA 1GOAA 3G10A 5EWEA 1NKBA 3V72A 2WTFA 4NCBA 4HCCA 3TFSA 1XS9D 1C0UA 3ZT2A 5IIJA 1LB2B 3NH2A 1S1UA 1UOCA 4PWDA 4FJ9A 5HP4A 1RPLA 5KGWA 9ICKA 3P1GA 3QO9A 2HHXA 4KHSA 2FBTA 4EYIB 4R8UB 4YQWA 5J0PA 7ICPA 4N47A 1LAVA 5KFNA 3JSMA 3AO1A 3BQ2A 1S1WA 3V1QA 3VQQA 4RW8A 1D8YA 2NRZA 4DSKA 5J0XA 5L1KA 8ICTA 4N76A 4QW8A 3RJFA 2G8FA 1KVCA 4FJHA 3UPQA 3I0SA 3SJJA 2O4IA 3PNCA 4J9SA 3TAGA 3TAPA 3ZSYA 1KEJA 1ZQJA 4UAWA 1RT2A 4F8RA 4PA1A 2HMIA 3RH6A 5J0WA 3TABA 5J0OA 3V6KA 1TK8A 4Q43A 5L9XA 3TR8A 3NH1A 3K5OA 1K1QA 4CFBA 1ZQVA 4CF0A 3V1OA 3RR8A 1SL2A 4CEZA 3OJUA 1X1PA 3CFPA 2IBKA 3ZDEA 1U04A 5I3UA 5HRRA 2BGGA 4IQWA 3OYNA 4QWCA 4FJ8A 5FRNA 3SCXA 4CHNA 2ASDA 3L2RA 4BDYA 1S0MA 7ICOA 1EXQA 2ETJA 2JEFA 4CEDA 3SUNA 1MQ3A 4O0IA 2DPJA 1IKVA 8ICUA 4E1MA 4DTXA 1UT8A 3E2EA 1UWBA 5J0SA 3P83D 5KFRA 4FYDA 1ZYQA 5IILA 5BPCA 5J2BA 2JEGA 4C8MA 4P4PA 5KI6A 1NJXA 2I1QA 1C0TA 1Y88A 1HNVA 2ZE2A 3HJFA 2A1JB 3B0YA 5JUMA 4RQ7A 4BWMA 4CGJA 4B9NA 9ICCA 1QS4A 5KG0A 4K4HA 2YNIA 4GVMA 4X5VA 4GXIA 1RDBA 3NGZA 3KIOA 1HNIA 2BPGA 1DTTA 1NK0A 3OS2A 1R0AA 4DU3A 4M6WB 4RW9A 4F2RA 4OGEA 2OPPA 2HHSA 3OS1A 8ICPA 4PGYA 1UAXA 4QZ8A 1RDCA 4ECXA 3L3UA 5DBAA 3MEDA 2XY5A 5J0RA 3PMLA 2PI4A 4FJKA 5J2MA 1SL1A 9ICLA 2NRXA 3K75D 2QK9A 1BQMA 2LSNA 5KFAA 4CFDA 4E1NA 5KRTA 4AHRA 4HCBA 4P4MA 5KFPA 1D9FA 1BPBA 4DO9A 1T8EA 3OYMA 3QEXA 2IHMA 2I5JA 4YMOA 4FW1A 3OYHA 2PXIA 5C25A 3VQ8A 2D0CA 4GMJB 1CUKA 4F91B 1RT3A 4UQGA 4C8OA 1TVRA 3UQ0A 4RT2A 4ZTJA 1NK6A 3NF7A 4DFKA 4AHCA 3AA4A 3O3FA 4FJXA 7ICJA 9ICNA 3RRGA 1BISA 3AVFA 4FJNA 2ZUBA 4CJSA 2KTQA 3OJSA 4ECSA 4O55A 4IQVA 4YMMA 4GW6A 3DI6A 1NK7A 3AVNA 1KCFA 4EZ9A 4QZBA 3IRXA 1NK5A 1L3UA 7ICVA 4LY7A 2DFFA 3HK2A 2E4LA 3RMCA 4KLEA 4Z6DA 3H40A 1KTQA 2QXFA 5KFEA 1ZQYA 2ALZA 4CFCA 3T5JA 5J0QA 1U9LA 2FPKA 4B9SA 4J9KA 4FJJA 3VQAA 2X74A 4GXJA 3GFKB 3CM6A 3S9HA 1RDDA 4TURA 9ICMA 4KLHA 3WNEA 3EZ5A 2KQ2A 4RG8A 2ZUCA 4JWNA 2ISOA 4CK3A 1JXBA 2G8VA 4ED3A 1JXEA 4KLJA 1JXLA 4FLUA 5KG7A 8ICZA 4YFKA 2I9GA 4FJ7A 5F9NA 2GV9A 5DLGA 3GIKA 5KT3A 1ZBIA 4ZTFA 2RPIA 2W9AA 2XY8A 3AO5A 3A2FA 1RT6A 5IIOA 4Q5VA 4O5EA 2P66A 1LWFA 3T3FA 2VA8A 3CFOA 8ICCA 4UB1A 1LV5A 4KN4A 3G0ZA 1ZQKA 3M8SA 5J1EA 3H8JA 5KFCA 4RQ3A 3VQCA 3T5KA 3HPGA 4DWIA 3AA2A 3HYFA 9ICWA 4O3OA 3KK3A 4DSIA 3ZT0A 4CEFA 2HHQA 2BANA 3NE6A 1TVAA 4DSLA 5L1JA 3TAMA 2IS3A 5CZ1A 4IBNA 2AU0A 5KFBA 3NGYA 4KLUA 2OZMA 4DOBA 2YHAA 3VQ7A 2ASLA 1BPZA 3NF9A 1DGSA 2KZZA 3NBPA 3KJVA 1XO1A 4RUAA 4ED2A 5J2KA 4JS4A 3QESA 4CJLA 2PFQA 4CCHA 9ICQA 2GWSA 1BPDA 4PHPA 5HRSA 2Y1JA 1S97A 4PQUA 2D5RA 3QIOA 2AGQA 3FFIA 3EY1A 1T3NA 1ZQLA 1A5VA 3QEWA 2FPMA 4M9LA 3LAMA 2NRVA 4QZHA 4JV0A 1H38A 4O3RA 3K5NA 2XGQA 3KHHA 2EX3A 4RW7A 4ED7A 3PW2A 2J6TA 1ASWA 3HM9A 3GV5B 2IOCA 4FS1A 2VWKA 4M3ZA 4IRDA 4Z4EA 4F50A 1JIHA 4DQRA 2VG7A 4KN7A 5BOLA 1BQNA 3HPOA 1NK4A 4K4IA 8ICVA 1X2IA 4Q0BA 4UB4A 2BE2A 3BQTA 3LZJA 3NF6A 4R5PA 1QLNA 9ICGA 1JN3A 1HUZA 3G6VA 2XY7A 2PI5A 3H4BA 5HHIA 3QNOA 1W0HA 1QHTA 4Z6EA 1TL3A 3OVNA 3OSPA 1SV5A 5IIKA 1ZQCA 5HRNA 4F5OA 3JPOA 3EW9A 4TSXA 2EHGA 5J2GA 4NY8A 3KLFA 4PHDA 2J6UA 4BE1A 3U6FA 1HYSA 3NGDA 3H7IA 2A1RA 3C95A 4DLGA 3HO1A 9ICHA 1BVSA 1S6PA 5KFLA 4AHSA 1BIUA 3JPQA 3EWAA 2HHTA 1RILA 4DTUA 5HHHA 1U49A 5KFTA 2FMPA 5J2NA 4YXJA 4F93B 1ZQTA 4CJWA 3V1RA 2OPSA 2P5GA 1TV6A 2P1JA 2PYJA 2AQ0A 4MEXA 1L5UA 4I2DA 5KFMA 2KFNA 1REVA 7ICNA 4N5SA 4Z4GA 1O1WA 1B9FA 1JL1A 3RTVA 3LDSA 2HVHA 3PY8A 1GOBA 1U48A 3HSTB 2JEIA 2MUTB 1XSNA 5D46A 2C28A 1HQEA 3N97B 3AVMA 3AVLA 2R7YA 1MSWD 3VQ6A 4PY5A 4CJKA 3THVA 1RTIA 5J0TA 2PYLA 1TK5A 1KFDA 2DY4A 4Z4IA 2IGIA 1ZQBA 1C1BA 3VQ4A 3VQ5A 1RBVA 4NLZA 9ICVA 1ZQHA 2P6RA 7ICIA 1MU2A 4GLXA 4JV1A 4DTNA 4KI6A 4DMNA 1ZBHA 4DQQA 1S0OA 4R64A 1BCOA 1C6VA 1TAQA 1ZJMA 1NOZA 2BR0A 1UT5A 4DL6A 1ZQOA 3H4DA 1S1XA 3L3VA 8ICKA 4ELUA 3V6HA 4EBCA 1IH7A 4RQ4A 3AVCA 3TAEA 1VSJA 1F21A 2YNHA 2DFLA 1RXVA 4KAZA 3LP2A 3I8DA 3IG1A 3PW7A 4KITB 4J9OA 2ASJA 4XQ8A 4GC6A 4EBDA 4ZHRA 1JLAA 3DLHA 4DS4A 1RDAA 4J9QA 3UXOA 1Z25A 5EU7A 5HLFA 3TAQA 3AVHA 5JS1A 2B5JA 4KHWA 2BDPA 3SV3A 4Z6CA 1NOMA 3VQBA 2YKNA 4KMUA 2P5OA 1TKZA 4P2HA 5KFSA 3TWHA 5DB9A 3Q8QB 3LANA 4Y1DA 3SV4A 1JLBA 3K2PA 4F5PA 3RBDA 5KFIA 4DL2A 3KD1E 3CQ8A 4P4OA 2B4JA 3M8RA 2W9BB 5J2QA 1BPYA 2IMWP 5L1IA 5KT4A 4TUSA 3VQ9A 4XRHA 3QETA 4EYHB 2ISPA 1TKXA 4LSLA 3GIJA 1KVBA 3SUQA 3QLHA 5HNKA 4UBBA 3C6UA 5FROA 3SNNA 4I9QA 1IXRA 4NM1A 4YXMA 2QKKA 2OZSA 4I27A 1K6YA 3HX0A 2ZTDA 4JV2A 1S76D 4CJTA 3HP6A 5CYQA 3M8QA 1BHLA 4WE1A 3CM5A 1WN7A 5D4BA 4CJRA 1I39A 3LP0A 4FLWA 4M3TA 5DDMA 3K4GA 1QQCA 4FK2A 5KT7A 9ICJA 4F4YA 1RBUA 2E6LA 2RN2A 4TUQA 4IRCA 4QZ9A 5J2CA 4DQPA 4DTPA 2DTUA 4IQTA 3PX0A 4KI4A 3LDAA 3OYBA 3KLGA 4CHPA 2AQ4A 3SUPA 4NYFA 4UBCA 2FLPA 2HHVA 5DK5A 1ASUA 4FS2A 3N4MB 3H8WA 4XUSA 4IR1A 5JS2A 3SZ2A 4RUCA 4DQIA 4EZ6A 3V9XA 4CJUA 1KFSA 2HHUA 4J2AA 4MF8A 3PR4A 1MQ2A 5KFVA 4BE0A 1HUOA 9ICBA 4CGDA 1BCMA 3VQPA 4AHTA 2Y1IA 2XRIA 2F8SA 3NF8A 4CJ5A 4CECA 1ZQEA 4B9TA 4O44A 1ZBLA 3HL8A 1SZPA 5FDLA 2G8WA 1JX4A 1RTHA 5HRPA 4QZDA 5DGBA 2W9CB 4HUEA 1VSFA 1K1SA 3ULDA 4YG2A 4KLIA 5SZTA 1BI4A 3RJHA 4W5TA 3AU6A 2MAXA 3T5LA 3DLKA 1WSFA 8ICEA 1KVAA 4M9JA 2W42A 1UA1A 4I7FA 5CR0A 3SPYA 2A1SA 3FYHA 1Z3EB 3TAFA 5DG7A 2BQRA 2R8JA 1AROP 4CF2A 4DTJA 5KFHA 4E7KA 5KTQA 3PR5B 2XGPA 1WSHA 3OYCA 2UVRA 1ZBUA 4FLYA 3MXMA 4RPZA 4RW4A 1LW0A 3Q8MA 3AVIA 2Z1GA 4KO0A 4FZYA 1JKHA 2YKMA 3MECA 2Q0ZX 4QZEA 4ELVA 4O0JA 4E7LA 1SKWA 2C22A 2YNGA 3AVKA 5D3GA 5DBCA 3QEVA 1S9GA 3AVJA 3QZ7A 4IFYA 3HVTA 3OHAA 1CXQA 3C1YA 5K14A 2DFEA 4CIGA 1HMVA 1VSHA 1RTJA 4NXZA 1TKTA 5L1LA 1V9PA 5KFWA 3LK9A 4M9GA 4O3QA 4YP3A 2YHBA 2ATLA 3MR6A 3BJYA 3WNGA 5HMMA 1RNHA 2V4QA 3MFHA 1B9DA 2JZBA 4R65A 3NTUA 5DLFA 1FK9A 4Q8FA 4NCAA 3T1AA 5J2JA 4Z4CA 2D0AA 4N41A 4DL5A 4QAGA 3PW4A 4RQ0A 2R8KA 3AU2A 4B9UA 1T05A 2W9MA 4YFUA 3RMBA 4QCLA 5DQHA 3PO4A 4F4KA 3ZCMA 4PPXA 2ZTEA 4MFAA 4F4XA 3S3MA 4FM1A 5KFUA 1Z00B 1T03A 1B92A 4DSJA 1LWEA 4DFMA 4KFBA 2M9NA 1WLJA 2XC9A 4DL4A 4F3OA 2BKEA 5KFFA 2F8TA 2KW4A 4DU4A 1SUQA 9ICAA 5HBMA 3L2VA 3M8PA 3F73A 3LP1A 4BXOB 1G15A 3VQEA 3UXPA 2HW3A 3SPZA 3PX6A 4C8KA 4FJMA 3RB0A 2BPCA 4J9RA 4KHNA 4E0DA 3ITHA 4I29A 2ATQA 3OYIA 4FVMA 1VSIA 1S0NA 8ICNA 4QZAA 4M9NA 1EETA 3JYTA 4CF1A 4I2GA 1FXXA 4E19A 1B43A 5J0UA 4DQSA 1QSSA 2KFZA 1QSYA 4JRQA 3DLGA 1X9MA 1DOQA 4C8NA 3OGUA 4CEAA 4KHUA 1JLFA 3PW0A 3JPNA 1S9EA 4CIEA 1NK9A 3L2UA 4TQRA 1NKEA 1A5XA 1HJPA 1HRHA 3C6TA 4PGXA 2G8UA 2OPQA 1C1AA 3CG7A 4NLGA 4E89A 1TV9A 2ZTCA 1KRPA 7ICKA 1ZQRA 4CEQA 1SKSA 3DLEA 1D8LA 3KLEA 4M0AA 4KHQA 4QW9A 4ICLA 3MDAA 5CYMA 3K57A 2BCUA 8ICIA 1RBTA 4YMNA 3V9WA 1N6QA 1NJZA 3IAYA 3FDSA 3BDPA 3DM2A 4QWAA 3RAXA 3UXNA 3OYGA 5C42A 3RMAA 4FK0A 4QZGA 1YTAA 2FLNA 3OYFA 3B0XA 4QZIA 3HP9A 3C2MA 1SKRA 3NHGA 4ZH4A 3RJJA 4AILC 2XHBA 4DEZA 3LWLA 1WSGA 3RBEA 3Q8PB 4MEYA 4K8ZA 4B9VA 4DOCA 2QKBA 5J2DA 8ICXA 3MGIA 3QERA 4HHTA 4F3TA 2JLEA 4KB0A 4RNNA 4O3PA 3V6JA 4M04A 5IINA 1XSPA 4OPKA 2F1JA 4JK1A 1COOA 1XHZA 3RRHA 5KG3A 3Q8RB 1VRUA 2UVVA 3K59A 3SUOA 3MGHA 3DOLA 4W5QA 1YTUA 5J2EA 2R8GA 5DB7A 2B6AA 4HTUA 4K4GA 4CJFA 1XWLA 2PY5A 3ETLA 1WSIA 5KT2A 3DRPA 1T4GA 3S3NA 4IKFA 5CHGA 3SYZA 9ICEA 2VG5A 2B21A 3IM1A 4CE9A 2HVIA 4H4OA 3O4NA 4RNOA 4PH5A 1L3TA 8ICGA 4OVLA 4JRPA 4YR3A 4DF8A 3GDXA 2FLLA 1C1CA 3AO4A 3JPTA 3KTQA 4ED8A 3GQCA 4DG1A 4QWBA 4YD2A 5KT6A 5CY4A 1XU4A 3DLBA 3CFRA 4PHEA 2G8IA 4TQSA 3QE9Y 2BPFA 1VRTA 3ISBA 3SI8A 2ZUDA 3SQ0A 5KG2A 4YNQA 4KKOA 1ZQMA 3LAKA 5C24A 3NFAA 2IAJA 3T19A 3RJGA 1A77A 2JGUA 3DRRA 1N56A 5J2AA 5IIIA 3ZSVA 1IO2A 7ICEA 3OYLA 1HQUA 4EBEA 4Z6FA 3K5LA 9ICRA 1S1TA 4B9MA 1I3AA 4OLBA 3JPRA 3ZSZA 4KTWA 3Q8LA 1HYZA 3I0RA
chains in the Genus database with same CATH superfamily
5AZJB 1H72C 3EKUA 3IAS9 3ALYA 2OPRB 3HDSA 4O3SA 4RW6A 4B8CA 5I9EB 5FP0A 4WJ3B 2KH9A 2X1GA 2HHPA 5DM6Q 4R8UA 5ALFA 2OH2A 3MM7B 5AXNA 3VGTA 2P9GA 2E5IA 1SV4A 4J9MA 4PXBA 1BC6A 4ECUA 3IDWA 4CBWA 4NXMJ 2L9DA 4CEEA 4EELA 2Z1IA 2DD8S 2PAVA 2RHSB 3KHGA 3PYFA 5DM7L 1TKZB 1SQFA 2VH7A 1FKPB 3H08A 3W65A 1FE4A 1MWYA 2P9NB 2DH7A 4ILGB 4FO0A 1UWBB 3BQ1A 3IUCA 2QWQA 2AEFA 3QEBZ 1DFDA 4IQUA 2G0AA 4L72B 3OTOK 3CJKA 2VQEF 4DR7F 2F4VJ 3FCVA 3C21A 1K9MT 1IBLF 5IQQA 4IFVB 1RBRA 4UB3A 3LP2B 3K2YA 2JWNA 3TQ1A 3QYPA 5KG6A 2HURA 2PFPA 4CYUA 3V4IA 2FBYA 2P9LB 4O9MA 1XTZA 4PWUA 3U3GA 2JWKA 4J9PA 5HLFB 1OYDA 5AICA 2F65A 5FIIA 4CFAA 1JLCA 1HPZA 3QIDA 3V9SA 2OD4A 2CZVC 1RA6A 4KPYA 4LF8F 2VG6A 1BL3A 2FVRA 3D2FA 4CO2A 2P9PA 2RRAA 5AQVA 3D2NA 2QTDA 3ZSWA 2DISA 4KB1A 4XAKA 2NO4A 4FJ5A 4NLOA 1V97A 5KFQA 1WG8A 3IWXA 3LDLA 1ZQNA 1IG6A 2ZH4A 2OHDA 4Y3CA 3Q24A 3WQUA 4F5RA 1L6NA 3NS6A 2HSEB 4UUWA 1EKEA 4RQ8A 1RYRA 1WSJA 4DPXA 4BHQA 4C80A 1CS4A 4FBUA 5EWGA 4QU6A 2DRDA 4YD1A 3PV8A 4F4AA 2WMMA 3CXCR 2AXTU 1JLQA 1ZQAA 5LSRA 3WXJA 2D69A 3MR5A 1P1LA 4KMOB 2FJXA 4CZLA 2X78A 3RSEB 4CJEA 5U47A 1PZNA 3NGTA 2AJ0A 4CNQA 4NLNA 1FJGF 2I7PA 1XNQF 3KJVB 2QB0A 4TY8B 3PKMA 4TUPA 1J54A 3P38A 3T1HK 4ECQA 3LM9A 1NDKA 2CQ3A 2OANA 1TFRA 2BCSA 3KOAA 3C5GA 3NGIA 4BDZA 2LM4A 3I1YA 1IWGA 2DTJA 4DV7F 4XA5A 1WC3A 2R2SA 2LI6A 1M90T 4TN2A 2P9KA 4I2PA 3C2LA 1NGBA 4EEYA 2Q4TA 2C2EA 1NHVA 3RZAA 3LF0A 3M6ZA 5IM0B 2HBJA 1TYQB 3CCUS 4NX9A 2P9PB 1UQVA 5CZVA 1V38A 8ICAA 1BI4B 2ZF5O 3SQ4A 4QPXA 4NZ6A 4YUDA 1HYVA 1N8RO 1R6VA 2V6AA 2D0BA 4UB2A 1NJIT 2MSNA 1SJFA 3SLCA 2F7TA 4R79A 2PIIA 4RL1A 3K9JA 2QV6A 2CKWA 1ASVA 3H5UA 4M41A 2N4CA 2V94A 2XCAA 2DCLA 5CJ7A 3WKAA 4NLXA 1X4CA 1SBRA 3RJIA 2LQBA 3EDRB 1YIJS 4IEEA 3NVVA 4ECYA 3WNHA 4BR9A 1QQ7A 8ICRA 4DB3A 4YN4A 3R27A 1OKJA 1KSPA 3NVZA 4E7IA 4CJPA 3JPSA 1N48A 2AWZA 2FHJA 4FZNA 3OSNA 9ICUA 3DI6B 2FJVA 5IWAJ 2Q79A 1HBUB 1PVPA 2CNLB 1KLMA 2GHVC 3KK1A 3VEWA 4H4KC 3S3OA 3GIMA 4N8NA 4OLOA 2GEMA 3EPGA 5F8MA 5AZIA 3H0RB 1RDFA 4FJGA 1PCAA 2A1JA 3LALA 4ELTA 4OL8A 3CC4S 1FRLA 2F1IA 4O3NA 3AT1B 4RU9A 1WOSA 3PYEA 5G0RA 2KHQA 2DFHA 3VF6A 3U3YA 2ZUGA 1VQMS 4KLOA 3MXIA 3U9ZA 2CVIA 4KLDA 4CIFA 4IDKA 2J5AA 2QL7B 4LRBA 2XO7A 8ICFA 5AM3A 2NUBA 1XHXA 1N5YA 3KUGA 5TZVA 4XH5A 1Y5LB 5E26A 2XSJA 4OLAA 3SQ2A 1DXSA 5IV4A 2ZNYA 4JI0F 1J2VA 3I28A 2E5JA 4ZVTB 3D0IE 1V85A 5GIOA 4O5BA 3H59A 3ED5A 2XNQA 1T03B 1MMDA 3AA3A 2BH1A 5KRSA 2BE9B 2LYBA 3CJ9A 3NWRA 4I2HA 2H4WB 2YTCA 4X66J 3KLHA 4H5RA 3PNIA 4IG3A 1ZAXA 1B64A 2MMYA 2VGNA 1FEHA 3MCPA 1NZAA 1TK0A 3OYJA 3VAFA 3O9QA 3HHNB 1R6YA 3C5FA 2F8MA 2VKZG 1CS4B 2OJ3A 1GFWB 1Z26A 3EMTA 1YSJA 2DQNB 2H5XA 2ZD1A 4ENOA 3PDNA 1IKXB 3IFEA 1EO1A 3HD1A 2A41A 3QINA 3DXKA 3D1OA 1HNXF 4CHOA 1ZM3A 3IBFB 3VPZA 2C2RA 3MMCB 2Z2YB 1AUSL 3AQEA 3O9TA 3K1RB 1OVYA 3VGMA 4M1KA 5AKXA 2CNKB 1Q18A 2WSCC 2YN4A 3HBTA 2HOEA 1UPPA 3RH4A 2FVCA 4CF3A 4HL9A 2QA4S 3GDQA 3BKFA 4ZIVA 2WONA 2Z1HA 4L3QA 3V9UA 2CUYA 3ZDCA 2XEXA 1BPEA 3W64A 3O0FA 1UCNA 2GVZA 2H3ZA 1N32F 2RRBA 2W9CA 4O5KA 1A76A 1LFPA 7ICQA 1U2CA 3R1LA 9ICOA 4LJXA 4Q8EA 2C2DA 2XS5A 4I2QB 4EEKA 2BE2B 3FCHA 5AI9A 4U7BA 4IFVA 2Z1JA 2LM1A 3AUOA 3WNFA 1H6KX 4OYWA 1N52B 4AQYK 4X66F 2C3PA 4WZQA 5F9LA 5AHXA 2R8HA 2WF6A 1VK3A 4ZPDA 3FZMA 4AQYJ 1J5OB 3TUZC 4J2DA 2DH9A 3CNQP 1VIXA 5M2UA 3CYMA 1NGEA 3V9ZA 2W8LA 2O8BB 7FD1A 2MKJA 1KBRA 4KGZB 4OKJA 2ZH3A 4WBFA 4LIRA 2QYGA 3N7PD 1F9FA 2QWRA 1QDUB 1RBSA 5CB1A 3P5JA 4L3KA 2P2CB 2LYHA 1BPXA 1XC9A 1PVQA 2AP1A 4O5FA 4UOFA 4MKYA 2CPHA 3NVKA 4C8LA 1PC4A 4AM6A 4CVNE 3BKTA 1VLOA 3IR5B 3UDVA 1X9WA 1WCLA 5MLCQ 2MUTA 3EVOA 3IFRA 1GH8A 1RTZA 2PE8A 4RPXA 2MPUA 3EUNA 3MTJA 4OYBA 4W98A 2A6MA 2BUPA 2YMQA 1S4EA 3Q8UA 4NI2A 4EP5A 1P90A 4EK2A 2G08A 2MY8A 1XI1A 1NGHA 3TZZA 1VK8A 1FDNA 4DF4A 3J7A1 5DBBA 3N5BA 2C3UA 4E7JA 2HBLA 5J8YA 1ZQFA 4KLLA 1BWFO 1TAMA 5LMNK 1KW4A 4C7ZA 3J7AN 1O8BA 2XZWA 3MEGA 5E3AA 9ICTA 2GFFA 4BR2A 4BC2A 1YQHA 4HTIA 4DFPA 4AYBF 1WAFA 2BOAA 3AOBA 4PXDA 4NRTA 4FNIA 1TKTB 1R0CB 1NJWA 4Q44A 4LH4A 4YCXA 1LWCA 2WOMB 2DGVA 2CXEA 4BRHA 3VGKA 3A8EA 2GIRA 4FF1A 4LF5F 3ZTOA 1KKXA 1J9AA 1JCEA 5E3CA 2E1AA 2B5JB 2FLOA 2OPQB 2NRTA 3FRYA 1JJ2R 2FVSA 1WOQA 2XMJA 3HHLD 4DV6F 2JJ4D 4BUGA 2WB1D 2DH8A 2RKIA 3UCUP 3CCQS 3QU7A 1Z2ZA 3A8KA 1F1BB 4CZEA 2K89A 2NLWA 1J6ZA 4UATA 5BREA 1V5VA 2RP5A 3T1HF 4B08A 1S1UB 4CLTA 4MFBB 2Z7JA 2KO1A 3CIZA 1X42A 3PSTA 1NMNA 1M90O 1L7MA 1HQEB 2WOMA 5HMWA 1NKCA 4ZVFA 2CQIA 1Q8IA 5LY3A 5CEHA 5EE9A 4C3KA 3KHLA 2YMMA 3OTDA 3NCIA 4MLEA 1VQ7N 2EQYA 3QEIA 5ALIA 4F92B 3D54A 3BUZB 4QWDA 4PGQA 5ALOA 3K5PA 2F7VA 4J90A 1IBCB 1JLGA 2KHCA 1ZQWA 1KQGB 4BRFA 3NGRA 2EG2A 4URGA 4QQBA 3S01A 1RZMA 2R7QA 1CXUA 2MKSA 1S57A 2HKEA 2W3SA 3TNVA 2CDRB 3W5XA 3PMNA 2AEMA 4QOZB 1RT4B 3M2VA 3MTKA 5IIMA 1RT7B 4LSLB 1RT4A 3QAEA 4FWQA 3NAEA 1RWOB 1DQ8A 3KHRA 1Q9YA 1BWEA 1LW2B 1OY9A 4ZJQA 5AKGA 2VA3A 3HXMA 4JI2J 4ECZA 5CZ2A 4XDDA 3C6TB 2OUGA 3NS5A 4CHZA 3HWTA 3E58A 4QOTA 4XH4A 1V3SA 2P6UA 4ED1A 1EARA 3TA1A 4Y2VA 3KKFA 1M1KO 4DOAA 4HI2A 5HN0A 3HF5A 2CRXA 2HS0A 4JYAK 2ZD1B 3FC9A 3UIQA 3R5DA 1TKDA 1S1VA 4Q2MA 1RT2B 3GYNA 1JLEB 1NGJA 4TU8A 2WC9A 5AXKA 1YK9A 2EAMA 2ZIVB 3CJ1A 1G2EA 2AJ4A 3ZT2A 4DR2J 3FZHA 2PEBA 1S1UA 1WEXA 3VETA 5JICA 3BF3A 9ICKA 3QO9A 1YVNA 4NO7A 3WU2U 2IYIA 5EY4A 1HNZF 3DXMB 3HTVA 5J0PA 3JSMB 3GOIA 4PL7A 3I4PA 4KGVB 3AO1A 4HTLA 1D8YA 4FXWA 3GBTA 2Q2RA 1FO4A 4QW8A 1M5VC 3P49B 5DS7A 2IDLA 2G8FA 3I0SA 1HBOB 3SENA 4OD0A 2DGOA 1HWJA 3ENOA 3SJJA 4J9SA 5HI7A 4K42A 3V6DB 4HHHA 4OI2A 2N82B 3M1FA 2M9KA 2P9UB 3RH6A 3RSEA 3KWIA 4JD2B 4Q43A 5L9XA 3VZHA 3DCAA 1MWMA 1KD1O 2NXCA 3M32A 4WF9Q 2XMUA 3EWGA 3E9OA 3NKYA 4ACOA 2KG0A 4USMA 1GLCG 1HR0K 4FJ8A 3PFOA 4DR1J 3L2RA 1S0MA 4C9DA 2ZIWB 1MWKA 4BRAA 4MH8A 1MQ3A 4C0HA 3MCNA 1IKVA 1VQ5S 3E2EA 2VFTA 5J0SA 5KFRA 5BPCA 4FXVA 3CGIA 2GA7A 1WG4A 2JLFA 2CG4A 2PN6A 4X62J 3R1HA 2ZE2A 5KL1B 2QMXA 3GJRB 5JUMA 4AQYF 4CGJA 4W92B 3ELHA 2DPNA 5ETVA 4FWKA 3CDUA 2NQPA 5KG0A 1HWKA 4GVMA 1XMOK 1RDBA 1HNIA 2BPGA 1VQYA 4EGLA 1NK0A 5E7OB 3P5TL 4D3HA 5A8KA 2HVDA 8ICPA 4UOCA 3U1LA 1YZ6A 4C0BA 4QZ8A 9ATCB 2XY5A 3ID6A 5LXYA 1SL1A 2NRXA 2XSJB 5IWAK 3CCQN 3MAHA 4ZIWA 1VQ5N 3EZWA 3QBWA 4HCBA 4AHRA 4P4MA 5KFPA 2UXDF 3OR1B 4FZVA 2IHMA 2V69A 3OR1A 1MN8A 4HH1A 4DV3K 4FW1A 5AQXA 3GG0A 3VQ8A 1YUWA 2I2YA 4C8YA 4MIBA 3TPQA 5GADU 4ES3A 3PRDA 4RT2A 1YJNN 4FJXA 1IVZA 1UKUA 3MMBA 2AYEA 4EAHD 2F76X 2F4VF 2JFKA 3G82A 5HQLA 1GX6A 2HWIA 2OTJN 1WC5A 1IKWB 2KTQA 1JLQB 3JAMY 4C11A 4IQVA 4MMOA 3DI6A 4MHVA 2LDIA 2K60A 1XBWA 2QXLA 1L3UA 5EN1A 3HK2A 3RMCA 1E4GT 2HZVA 4Z6DA 2ALZA 5IT9O 2KKHA 3O9RA 3JSYA 3QGPA 4O8KA 2FPKA 4K2XA 4U8VA 2EFOA 3GR1A 2G5HB 3S9HA 1NAQA 3WNEA 2KQ2A 2QT7A 1MROA 2ZUCA 4JWNA 5JVGL 1YJTA 4CK3A 4IQXA 2ROGA 4FLUA 1T9VA 3BS5A 5CHCB 4F04B 1FI4A 4U67L 2CPYA 1R8BA 1YJNS 3DU5A 3UW1A 4QPTA 4X64K 4KRWA 3RW6A 4DXLA 4X2BA 2RPIA 2C2ZB 4IWVA 4DHVA 2MKIA 1U6FA 3BS7A 4A2BA 1RT6A 2HVEA 1N33F 1NLKL 4GO7X 2FD2A 5IIOA 5AJ3J 3M7DA 2CGKA 4CLLA 3T3FA 3JSBA 2K06A 2VA8A 1HLUA 5BYQA 4I6MA 4DV1K 8ICCA 1IQZA 1ZQKA 3M8SA 4BVPA 4RQ3A 1LK5A 1ESVA 3T5KA 2Q1NA 2DR9A 4DSIA 5J2PB 5C12A 1M1GA 1JRPA 3NE6A 1CI4A 4PZVA 4RW7B 3TX0A 3TKAA 1K73O 1R0BG 2WBRA 2ZH2A 1VQSA 2P9IA 1D3WA 5IC4B 4P9SA 2YHAA 5IT0A 1BPZA 3HHLA 1F9EB 4G6VB 3A5MC 1KXPA 4H0TB 1Z4NA 1DGSA 3NBPA 4DV5J 2GWKA 1NU4A 5AM5A 1ZC6A 1TFWA 3FAHA 3BSAA 4ED2A 2KIVA 5DDPC 2PFQA 4CCHA 4USIA 3CJSA 3R5CA 2VC1A 1T3NA 1A5VA 1CQNA 3CD5A 4QZHA 1H38A 3MPYA 5GTIU 3GPAA 2XO6A 3CI5A 2KG1A 1U2VB 2XGQA 2EX3A 3PW2A 3HM9A 1ASWA 4IEIA 2YKNB 4M3ZA 4KN7A 3W60A 1NK4A 2D9PA 4UB4A 1QLNA 2E5LJ 4Z37A 9ICGA 1MWQA 2KKZA 3CB4A 1CJKB 1NBWA 3GFYA 3QNOA 4Z6EA 1R43A 4WYBA 5G4DA 3OSPA 1IKYB 3E0FA 2ZJQL 1R0AB 4MKAA 1W7AA 3JPOA 2Z57B 2W40A 3MGJA 3OBYA 1B0PA 4DN0A 1O5JA 3VF4A 4DX6A 4TYAA 4A48A 3NGDA 1WBDA 4XPCA 2E5SA 3HO1A 3B6BA 4AHSA 4CO5A 4DTUA 3EXCX 5HROB 5JLHA 3NASA 3GJQB 2JVOA 2QFJA 2CPRA 2DY1A 1XMOF 2CQPA 1FRHA 3C7NB 3QRQA 1YITS 2W7OA 5DM6L 3MEGB 1L5UA 4IFEA 1REVA 4JKGB 4DQ8A 1UL3A 1O1WA 1JL1A 4C4WA 1DARA 3RTVA 2HVHA 3PY8A 1IBKK 3FZ2A 3GG1A 2F9WA 3B54A 2C28A 2DNKA 4PG5A 1SV5B 5BPLA 4I4BA 3C14A 2PMZF 2XHCA 3R6LB 1VQMN 3MHYA 4KH6A 2PYLA 1KFDA 3CTRA 2VPXB 3D6TB 1XQIA 3BDEA 3VQ4A 3VQ5A 1MU2A 2AHOB 4JV1A 1N5YB 2KM8B 4QJFB 3J7ZT 2J0QD 4DQQA 2M4MA 1HUXA 1TAQA 4P0QB 1NOZA 1TUUA 2ZEJA 4DPYA 3V6HA 4EBCA 1OQ3A 3V4MA 3RU0A 2D1KA 4WFBQ 2YHYA 2MU2A 1VSJA 4CF4A 5LT5A 2M3DA 2YNHA 2NREA 1RXVA 2NXJA 2DXEA 3IG1A 4MJKA 4KITB 4GC6A 4IG3B 1QQNA 2PGCA 2WF9A 2ASMA 4YY3J 3OXFA 1RDAA 2D3DA 4UOGA 3CCTA 5HLFA 3CJ0A 2ILZA 2B5JA 3CMQA 5A8WB 3OPKA 3SV3A 4Z6CA 1NOMA 2U2FA 1DK2A 3A5LC 2AJFE 2HRUA 4P2HA 3MUTP 5KFSA 5DB9A 1IM6A 4Y1DA 3SV4A 2O6KA 1JLBA 1RLDA 5KFIA 3KD1E 1I5OB 3LUYA 1LQ9A 4JBCA 1BPYA 5L1IA 3A8JA 3QETA 3DLGB 4O8UA 1I3OB 5L1MA 2EPIA 2CPJA 3UD5A 3AAQA 3GIJA 4ZPAA 1X60A 3D2EB 3SUQA 4LRDA 4UBBA 4U8YA 3QFUA 2NYHA 5FROA 5B5EU 3SNNA 3FE1A 2DO4A 4GKKF 4UAUA 3HX0A 2ZTDA 3HP6A 2FY1A 1E6VB 3WXMB 4OYIA 1BHLA 5A8WA 3W2VA 4ZVEA 3G86A 1WACA 2XZTB 3NRBA 4CJRA 5ETTA 1NNDA 4FK2A 3BS5B 5KT7A 4OHZA 4UW2A 2HK3A 1FESA 4GVEA 2DTUA 5ETQA 4KI4A 3MECB 2Z56B 3UN2A 3AAPA 3VF2A 4QR1A 2XVTA 4JI7K 2RDDA 4KT0C 3SUPA 4YB5A 2FJ6A 2KJ8A 1HNXJ 4YS2A 4UBCA 2K8GA 3ICXA 3A0BU 3WK4A 2GMLA 4K5SA 2R7WA 2VF3A 4LFAK 4IR1A 3SCIE 3ZZ0A 4IFYB 1T95A 3NS7B 2WVBA 3TUPA 1PSDA 3RFAA 4P71A 4QIWC 2G9OA 4RUCA 1FNOA 1WOPA 4DQIA 4LF9F 3V9XA 1RAAB 3JQMA 4PKHA 3KOOA 2EC2A 2B9XA 5ALVA 2YWKA 3PR4A 3KK3B 1HUOA 1KDNA 1NGAA 1VLYA 9ICBA 3VQPA 2XRIA 1FFSB 5F3ZA 1H74A 4KGMA 2DVIA 3D0HE 4CJ5A 4CECA 1ZQEA 4B9TA 1DT9A 4Y2PA 1JX4A 1N4LA 4X62K 1RWMB 5AQNA 1RTHA 5HRPA 4QZDA 1C2PA 2J0XA 4HUEA 2RKIB 3E8OA 2ZH7A 4UZBA 3ULDA 2HHHJ 4KLIA 2E20A 5SZTA 1BI4A 3RJHA 2ZJPQ 2WHOA 2YHXA 3MZIA 5AE3A 3T5LA 3DLKA 3ENAA 4F25A 4M9JA 2E1EA 1NGDA 1WC6A 2UUWA 5CR0A 3DOLB 2Y1RI 3SPYA 3TVKA 1FJGJ 4WFNL 4B1WB 5DG7A 1AROP 4CT9A 2RHKA 3CCMN 2CPFA 3US5A 2NUUG 4XO0A 1GMWA 5KAKA 4K4VA 3ZTQA 2WW4A 2YBVA 4A8YA 1K0TA 3UVJB 5FLXY 3MXMA 4RPZA 5BPMA 2O3DA 3NS1A 3PIOQ 3VWSA 4JI5F 3EN9A 2QTWA 3ZC4A 1UJ6A 1JNZB 4ZJLA 3UR3C 2XS2A 4K43A 3O1BA 4BRKA 5B0EA 2K1RB 4O0JA 4E7LA 1V3ZA 3H45C 2MHNA 3LYSA 3IGVA 4RLEA 7AT1B 3K89A 2Y0SD 5LL6d 1U2FA 4CIGA 1QTNB 5B7WA 2KT3A 1WF2A 4NXZA 1TKTA 1V9PA 2YX4A 5GMKa 1RE1B 1B4SA 3I6PA 5EE1A 1RNHA 3MFHA 2CVEA 1YVFA 2ZZMA 3TWZA 3VZIA 3MM6A 5AQMA 2ASYA 1V3RA 2J9EA 3O3LA 4JMUA 2K4HA 2LBOA 2ZH8A 5CAAA 4DR5J 4C97A 3DDIA 1D1UA 3BSCA 4RQ0A 3HKZC 1WDTA 2W9MA 4LIWA 4KHMA 4YEAA 1U1PA 3ZCMA 3PO4A 4F4KA 2O8FA 1WD6A 4KX5A 3S3MA 2L9NA 1T03A 3QO9B 5AJ3K 4ILMA 1QVFR 4XDCA 2CXYA 1SWWA 2YWFA 4RW6B 3KWGA 1IBLJ 1XNQK 4DFMA 1Y10A 4KFBA 1J5EF 1X4GA 4JI2K 3NVMA 3IP0A 1RISA 2CJ9A 5E3QA 2KW4A 3ZO7A 1UPHA 4CWBA 1SJ3P 2RILA 3F73A 2Q0RA 4IDKB 4X4TA 4C8KA 1ZRNA 1HHTP 4B3SJ 2G5IB 1WEZA 2HHHF 1S6UA 3LH2S 4DFDA 3GZFA 4LF4F 1IXKA 5AKHA 1VJQA 2HAIA 4NOHA 3OYIA 1DY3A 5EOYA 4M9NA 4CF1A 1NRKA 2DGQA 3KZXA 3DNCA 3CP8A 4F36A 4NEYA 3ILLA 3CF5L 1Q1KA 2CFXA 1ZQ1C 3F2BA 4CH7A 4C8NA 3OGUA 1PJ6A 4KHUA 2JNJA 2QJ3A 3JPNA 3NY0A 5LMUK 3MPUB 2KVSA 2QEXS 2CRLA 3L2UA 4C98A 2ZZNA 2KHVA 1AYEA 1DTTB 1X4AA 3C8YA 1HJPA 1HRHA 3G82B 4Y2RA 4M5NA 2WFBA 4PGXA 2KVIA 1DAXA 2OPQA 3CG7A 1ECWA 4NLGA 3CJ7A 4A8KA 4E8UA 1TV9A 1ZAVA 4UB6U 1KRPA 1SKSA 4YORA 4MIAA 2O01C 3DLEA 4PPZA 1U25A 2IY5B 3F44A 3K57A 2E5LK 2R9LA 3V9WA 2XQCA 3IAYA 1SB3C 3U8XA 3PM9A 2LQJA 3DLKB 3NNCA 5C42A 3RMAA 3VEVA 1FD2A 3GLJA 4BRPA 5AXLA 2EC0A 2GAGC 2RUSA 1HARA 4ZHRB 1WUUA 3H25A 1V9OA 3EEQA 4WQ4A 4ZH4A 3LPYA 3F2KA 4OYXA 3UWTA 2XHBA 2WTUA 3LWLA 3ALRA 2DGUA 1OH5A 2QLFB 3BP8A 1GXUA 4Y2YA 3X1LB 2JDJA 2H48B 2BJDA 3A8IA 3BQ7A 2E5GA 2F2AB 1RHQB 1HBMA 8ICXA 2UZAA 2EFGA 4F3TA 1UFWA 5F0WA 3UCGA 5K8PA 1HNWJ 2POKA 2MGZA 3V6JA 4WIIA 3MM5A 1WOOA 4LUBA 1OY6A 5KG3A 1JWWA 2A6AA 3CC7N 2L48A 2ERRA 4JI5K 4W5QA 2R8GA 1R59O 4HTUA 3BF4A 3CC2S 2GMJA 4K4GA 1XWLA 4U95A 2EI5A 3H1VX 5KT2A 4JKDA 2NRHA 4ZCMA 5HO4A 1HI8A 1HYSB 4BR5A 4LF6K 9ICEA 4RR5A 3W66A 1X5SA 4CE9A 1C1BB 4Y2TA 2J9CA 5KOWA 4NLQA 4PH5A 3AD8C 1L3TA 3AN1A 3MM8A 3I55N 4JRPA 1HNZJ 4DF8A 2JH1A 4OZLA 3GWCA 1C1CA 3JPTA 3P31A 5I3PA 2QN6B 4UARA 4YD2A 3M8ZA 3MM9B 5AZJA 2F8KA 4LRFA 4CO1A 3DLBA 4IXCA 3CFRA 4PHEA 2G8IA 3QE9Y 5HOOA 2XI9A 1U8WA 3QDKA 1WKJA 4M5GA 3IR6B 4DCJB 6FDRA 4HH0A 5BR9A 3SQ0A 3DAWA 4A8SA 5I4MA 1ZQMA 4JI2F 3NFAA 1RLCL 4HACB 4DV2J 1VQ6N 2IAJA 3OFGA 2MKHA 1RKJA 2B3TB 2F4VK 5K8NA 1SJRA 4CZIA 1QAYA 2JGUA 3DRRA 4K4ZA 1YF5L 5J2AA 5IIIA 2XYHB 3DRRB 2ZVIA 3ZSVA 1C4AA 4CT8A 3L6QA 2HQ3A 1FVQA 2E1ZA 4B17A 1AZSB 3PSIA 4DX5A 3F2DA 9ICRA 2HQIA 4JKCA 4WCEQ 2R7SA 5HSPA 1WF0A 4OI0A 1HYZA 2CAJA 4I6YA 4DR3F 2EVZA 3UD4P 1NMDA 4RZRA 3QFPA 4MK8A 5ETRA 3C29A 3ZI4A 2COLA 1C7YA 3FEZA 2DKXA 3MR2A 2CPDA 2IM2A 2YNIB 1CZBA 4O4GA 3LWMA 3F9KA 4DV6K 1IKYA 2LPEA 3PJ9A 1KFTA 4NM2A 2X51A 4Y2JA 3VA0A 4M3YA 4HYKA 3QJLA 3H46O 4C23A 2HDOA 3QNMA 1QTMA 3KD5E 4ZP8A 1NB7A 3KUHA 6FD1A 1N63A 1KOOA 5AKZA 4BY9C 3M9NB 3QJPA 1J5EJ 2QFIA 2OHFA 4CJVA 1ZZFA 2RQ4A 3RWUA 2UXDK 3TR5A 4YDUC 2O8FB 4ZLNA 2O67A 4FPBA 3ILIA 4H0PA 3X3UA 1WORA 4J91A 2I0XA 3N28A 4DSFA 4B3RJ 3TFRA 2YI1A 1ZQXA 4EHUA 3M6KA 3SMZA 1S4FA 2ASPA 2IIRA 3R97A 2FBVA 3CCWA 2FMSA 3CJ8A 4TVAB 3R6MA 3ZYYX 3FSIA 2HS4A 2MYFA 4P75A 1IG9A 3QEPA 3MN7A 1NHUA 3KK2A 1OH6A 3CCRS 1D8ZA 2AX0A 3DJCA 2GMHA 1BQXA 2MZRA 2P9NA 2HZAA 2G06A 2QE5A 5AQZA 5ALRA 3O44A 2LYAA 5J2NB 4CGIA 2IA0A 4YR2A 8ICYA 1N0VC 3GIRA 3CDEA 2MQNA 2AGPA 1ZAWA 2YY3A 1RHUB 5AM2A 4CHYA 2HHWA 2FIUA 1BNOA 4GIBA 4IUFA 4M2YA 2W24A 2UP1A 4IG0A 3VAHA 5C42B 3ENBA 1VSLA 3OL9A 3LP3A 3Q7CA 2HRTA 3W62A 2V8HA 3CCRN 4Y2CA 3HVRA 5CA7A 4C4TA 1RYSA 1RAHB 3PIPL 1MNEA 1ZBFA 2MXYA 5HR7A 2M52A 4G1PA 2M70A 3FRZA 2VPZB 2XYPB 3ZDAA 2GVDA 8ICWA 3FZKA 4QR0A 4GV6A 4ZPCA 3Q8YA 3NP5A 1B7YB 3PVXA 3ASMA 2LQ5A 2NZ4A 2MQ8A 5A6PA 5AJ3F 5B0BA 4I2IA 3CD0A 1ELOA 1JMSA 4RQ2A 2ESEA 2FGCA 2Y8YA 3K5MA 1CJKA 5DQGA 1GLAG 3PO5A 3V5RA 1YLXA 3NCRA 3QSYB 1QE1B 2OYQA 1ZTTA 1XNRF 3BQ0A 5AQKA 4FLZA 2O1PA 1C0GA 4RU2A 1RTDB 3C6HA 1GLEG 5T7BA 3P3DA 1RTDA 1J27A 4DUYF 4A46A 2D3O1 3PIPQ 4DU1A 2O4GA 4I28A 4CESA 3WIVA 2GVZB 2ZQBA 3KLEB 3I4HX 5J2MB 4F4WA 1XJWB 5CWRA 3CRXA 3D67A 2DHGA 3EE3A 2H3GX 4DTMA 1P8GA 4MF2A 4LF9K 1V4SA 2ROEA 1ZD2P 3AA5X 1WUAA 3BO3A 4CZFA 2E1MC 3WKEA 1UZHA 4CF9A 3FMBA 5DM7Q 3LGMA 4PQUB 3W2VB 2D0PA 2HNDA 3OYEA 3QFHA 3PYDA 1TZ0A 3D4JA 3JSRA 1L7NA 4NA3A 2JHEA 3ISNC 2DPIA 3MI7X 3T5HA 1JKHB 4R25A 3J80Y 4FWMA 4CK2A 1X6IA 3ICLA 3ULHA 4AL7A 3CEDA 1TAUA 5LSOA 2MA1A 2Q6BA 1FWPA 2MEWA 3SMPA 3UQSA 1T3OA 4RWXA 1VJWA 3D2SA 2VANA 3QYYA 2QKQA 1BDGA 2D7SA 3MN5A 2YNFA 4FE3A 4QNLA 4ECRA 2YH0A 2BJ8A 4GVBA 4CLUA 2QW9A 1NOYA 4RQ5A 3RMDA 4UAVA 4BXOA 2XTJP 4OJPA 3PUFA 4JB8B 4LFBF 2K8AA 5BR8J 2DWQA 1WNSA 3O6QA 1K9MO 3JS6A 2ZIUB 2B8QA 3THWB 1VQ8S 1BHNA 4DUYJ 3L4IA 3IGNA 3FZFA 3N6LA 1JLEA 4KLSA 2CJXB 3Q8VA 2MGZB 4WYWA 1VQON 4DDFA 3VEZA 3TUIC 3G6YA 2F1HA 3UPFA 2YTUA 3D45A 4E7HA 3SAHA 3C65A 3DM2B 3IRUA 4TY8A 1CC7A 4KSEB 1T9YA 3C66A 2X6NA 1ZQPA 3OL8A 3UNYA 3ZSOA 2CQ4A 4MKVA 3MBYA 1EHWA 5BN8A 5F8NA 3D6MB 2GAHC 3UDEA 5CCMA 1VQKS 1JK9B 1UVKA 3L09A 1LCUA 3V7LA 1MMLA 2VC0A 3IS9A 4JI1J 4ZK7M 4WTYA 1U4BA 5HVFA 3PHEA 1XR7A 4CM0A 2UV8A 3C2KA 4NLKA 3FQKA 1SCJB 4NWIA 1RTHB 4V19X 4CW7B 2W8KA 3HSJA 4R66A 7ICGA 1VQ8N 1Q9XA 3Q8KA 1UAWA 4JLHA 4RO0A 3NMUA 3H2UB 3M4XA 4IH5A 5J2IA 1VQPN 3D2QA 1TL7A 8ICSA 4MKBA 3O8WA 3QRPA 4XPEA 1EWQA 3E9LA 2HIYA 4FN5A 5KNIA 5HP1B 4JK7A 3F5EA 3MPDA 2QG9B 2MKYA 1T9XA 2FJWA 4QWEA 3ZDBA 1RXWA 4I7FB 3KKSA 4C6AA 5B0DA 2HK2A 5A76A 2WK4A 2A3ZA 5IFMA 1WHWA 4K25A 5D15A 2GBZA 3WZ0A 3RAQA 1LEOA 2CH5A 4H03B 4DL3A 3LQVA 4IOAL 3K58A 3CXCM 1FXLA 1GT8A 4FWSA 2VKRA 3HULA 2KM8C 1TYQA 5H9FJ 2E29A 4KC5A 2YY6A 4PZNA 2AYBA 1XSLA 3EE9A 2P9IB 3GONA 2NPFA 4WFZA 4BJQA 2PZSA 3ZD9A 5I42B 3P6YC 3OYKA 2I5JB 5F41A 3M9OB 4ZVOB 2FMQA 2ACYA 2QI2A 1EQMA 3HFZB 4Z4HA 1KAXA 4UAYA 3DC2A 3N4WA 8ICQA 3RUBL 2DNHA 4OO1J 1MDUB 3VQTA 5ETOA 1S5ZA 1IKWA 2G1DA 4DPOA 4ECWA 4GMKA 1R7IA 3PEJA 4ILRA 2G8KA 5ALTA 4EWTA 3CDWA 3SDEB 4X4SA 4I2BA 2FC8A 2B43A 3TJ9A 2F3NA 4GC7A 3CO0P 3FKBA 3J7ZO 3MC1A 3J7Z5 2QSFA 1G3OA 5AIAA 1Y5IB 2ZJPL 2ZWHA 4HUFA 3MR7A 2OYYA 1F5AA 2K7JA 2VV5A 3WHIA 3TUJC 3MGVA 3R5AA 5GAEU 1A0OB 2FPHX 3MABA 5GAGP 3GIIA 3DMJA 1Q16B 2OLWA 1VQ4S 2LMRA 4B1UB 3H8SA 4M42A 4BR7A 2DEIA 4JI7F 5A0LA 2UUAF 3IBWA 3UFCX 1CJUA 5ETNA 4CEBA 5JMNA 2C42A 1VSDA 4LZDA 4NLYA 1YJWS 2HZCA 4R0JA 2K1RA 4AH9A 4O23A 2UVWA 4OJOA 2G2YA 2B0CA 2VBYA 5DB8A 1JMTA 4DTRA 2PSZA 2CQBA 4K8XA 5B08A 4H0YB 4KH4A 3HT0A 2WZ1A 1VSMA 7ICHA 2W4DA 3FBEA 2RD5C 4OLPA 1U47A 2F96A 1KC8O 2KKVA 3FJ2A 1S77D 3W2WB 1T9TA 2UXCF 4X62F 2XWXA 5J2PA 4XTTA 3H20A 2CNOB 2QA1A 3D6FB 4JWMA 4EENA 3ITHB 3FZBA 3HMJG 1LKYB 1FFWB 1GO3F 1URJA 4MQ3A 3ZT4A 1RCHA 2C3OA 1EB0A 3KLGB 4LSNA 3TEHB 1Y3JA 1MA9B 5B0CA 4OJRA 1L7OA 2XY6A 3THXA 3TOQA 1XEZA 1W26A 1O03A 3WUHA 4LBPA 1ICEB 1B7FA 2R7TA 1G4CA 4JI3K 4JYAF 5BJRA 4A8MP 3E01A 5KG1A 3SIPB 1RHMB 2VFUA 1VMBA 4UOHA 4M9HA 3I9ZA 2R7VA 3M1VB 1F2HA 4KJIA 4PCQA 3GILA 2IJRA 2GO9A 2UUBJ 3JTPA 1JLCB 1T3QA 1HPZB 2IJFA 3R7BB 4Z7CA 4XEIA 5AQHA 2KT5A 2EFNA 1KLNA 2ADCA 4YHHF 2H5EA 2ZJRQ 2BTFA 4WFNQ 1ZQSA 2KHDA 3M2RB 3D6HB 3R3LA 1XMBA 2N4DA 3A0IX 5JJBA 3MPVA 3H3OB 1S9FA 1FNMA 5FD1A 5LJWA 2WBNA 4LQ3A 3L8BA 4IOBA 4KRFA 3ZDDA 1RT3B 3BS9A 2IC3A 4HWIA 3RAMA 4CERA 1Z1BA 4M5IA 2E6MA 3TI0A 3SSQA 4OKEA 3KJFB 4RPYA 4FXDA 2QEXN 3VMFB 4HT7A 2ZJ5A 2AIRB 1N2XA 3BSNA 3IXQA 4HI1A 3BGRA 3HZ6A 4RQNA 4BROA 1YT3A 1W7WA 2W7PA 2A6OA 4I9LA 4M3WA 4FCYA 1CSJA 4DTSA 3C1ZA 1N33J 4ZOSA 4JS5A 1PKUA 1VK0A 5HROA 5HMLA 1L3VA 3BO4A 1C4CA 3G10A 2RHFA 4LREA 1WWVA 3KLIB 4B1XB 4NLTA 2WTFA 2W3RA 5D77A 4U6PA 3QJJA 1Z4OA 1N5QA 3L9ZA 4BRCA 2K8CB 5IIJA 4PWDA 4FJ9A 5KGWA 1P27B 4KHSA 1NI3A 5M1PA 4CH1A 3CCVN 4OZ5A 7ICPA 4PPDA 1JI7A 3U9DA 3UKUB 2F8EX 4CD3A 3FZLA 1RCXB 3ILJA 1S1WA 3FBBA 4DV4F 3MMBB 3VQQA 5M1QA 4RW8A 3ID8A 4DSKA 1KWMA 1RWUA 5J0XA 8ICTA 3VR1A 2V2KA 3RJFA 4QU7A 4FJHA 3UPQA 3BYRA 3SR6A 1HI0P 3KK1B 3TAGA 2BM0A 3ZSYA 5IT9Y 1RT2A 2EW9A 2P9EA 3P4UB 2ADBA 3HSDA 4PA1A 3V81B 3AODA 2B6GA 1PJ5A 3TABA 3QAUA 5J0OA 5EE0A 5AXMA 3D66A 3NNHA 1JJCB 5AK5A 4CFBA 3I56N 1ZQVA 2MQOA 1QVFM 4CEZA 3CC2N 1VC0A 2H5IB 3CFPA 4QIWD 2NUHA 2UUTA 1DGJA 5HRRA 2BGGA 1Y00A 1FFGB 2YX6A 2HVZA 4DV5F 1N36K 3SCXA 1SB6A 3OVSA 4DPUA 1SV0A 3SUNA 4O0IA 4PG6A 8ICUA 2XLJA 4E1MA 3P83D 1YJWN 2JEGA 3BN7A 4CZHA 2UXCK 4P4PA 4JI3J 1NJXA 2I1QA 1C0TA 2FJDB 3VCDA 3CMES 1HNVA 3I96A 2RAQA 3HJFA 4JKAA 2B4OA 3JTNA 3KJNB 3PTWA 1K8KB 4RQ7A 4OHVA 1HIWA 3R3TA 2HFZA 1M0SA 2KXNB 1NNEA 9ICCA 2FJAB 2OTLN 1F9HA 1HR0J 2QA4N 4GXIA 2B6AB 3NGZA 3KIOA 1N36J 1DTTA 1R0AA 3CHWA 3H2VE 1ZPVA 4DU3A 4FKYA 1RWNB 2B7BB 5C24B 2DIVA 2OPPA 2HHSA 1S7IA 3TJ8A 4PGYA 4A62A 1RDCA 3R9PA 1GTHA 3MEDA 4BC9A 5CABA 1YGYA 5J0RA 2PI4A 9ICLA 2WF8A 4AL6A 3K75D 2QK9A 1S1XB 1BQMA 1SIWB 5HQMA 5KFAA 4CJ7A 3WK5A 2KE7A 2DR6A 3JXUA 4DO9A 1T8EA 2E9TA 5AFUA 1CULB 4NWBA 3SAFA 4G65A 4Z7YA 2YHWA 5K9FA 5K14B 1BA1A 3OYHA 4RUBA 2IBOA 1QQ5A 4WK3A 2DCUB 2F63A 3TZWA 2Y9TA 5KAIU 2EBGA 1Q86T 1FIQA 2RE2A 4Q7AA 2UUBF 2PBDA 1QJHA 2Z2LA 2JSXA 3UQ0A 1NK6A 5M1OA 4DFKA 3AA4A 3RW7A 3B8AX 7ICJA 1T6CA 1ZXOA 1K44A 4RW9B 1NBEB 3RRGA 1VQ9S 5BRDA 1ZZNA 2ZUBA 1TFYA 1WHVA 2VCPA 2AJ2A 3EVMA 3FGUA 3UM9A 1T44A 3BH6B 1NK7A 3L7OA 2OEKA 4LY7A 2DFFA 1KR4A 3MX5A 2LQ8A 3IM9A 2HEKA 1K5OA 2X7IA 2AV5A 4KLEA 3H40A 5KFEA 4IDHA 2QLTA 3T5JA 5J0QA 2V8PA 4J9KA 4FJJA 3GFKB 3DHXA 3PKYA 2YXLA 1I6JA 4M5HA 1UHUA 3M8PB 2KK0A 2ISOA 4ZN3A 4JN4A 1N5TA 3AJ1A 2OTLS 3GSIA 2LFVA 4GKKK 1JXBA 2G8VA 5T7LA 4DV5K 5KG7A 5AM0A 4FL9A 2QM1A 8ICZA 4YFKA 2ZIUA 1R8PA 5F9NA 3RVCA 2ZH5A 3HJEA 1IKVB 2GV9A 4J8FA 1ZBIA 3NAIA 2JWLA 5ALQA 2W9AA 3VQSA 3AO5A 4W90B 3CJQA 1QHAA 3WXKA 1REVB 4JKGA 4WFYA 3H42A 1FE0A 2DL0A 2FTRA 5ITHA 5IC6B 3GB0A 1LWFA 3HILA 2NYIA 2B4PA 1NGIA 1VYAA 2HIQA 4O0NA 3CFOA 4KN4A 1FCAA 2ZXHA 1RHJB 2H3EB 1HNIB 3H8JA 3ZZTA 3VQCA 2CJQA 5AK4A 3AA2A 3HYFA 1DJ0A 2Y0BB 3ZT0A 2UU9J 4CEFA 1TVAA 5AQYA 1Y0HA 3OA9A 1RI7A 4DSLA 3CQYA 3TAMA 1NSPA 2C2NA 4USJC 5CZ1A 2GVDB 1NM2A 1HBOA 5A0YB 4U7UK 5E84A 4KLUA 2IDEA 1AZSA 3WDOA 4B1VA 3WKBA 2OZMA 4DOBA 1ZD4A 4EHTA 2EAOA 4UB8U 2ASLA 3I5AA 1M5SA 1ED1A 1M1HA 2KZZA 3KJVA 1XO1A 3QLHB 1ZBSA 2MZTA 1BPDA 4PHPA 1QM9A 4DR5K 1JUDA 4RPFA 1WF1A 3MM7A 5HRSA 3M30B 2D5RA 3QIOA 3KVGA 2AGQA 3FFIA 1TE2A 1FERA 3QEWA 2FPMA 4M9LA 1U02A 1M6YA 1Q3VA 4O3RA 2LU2A 1LXNA 4JEPA 2VBZA 3K5NA 4E98A 3KHHA 2KJ5A 1MMNA 2C2OB 3D9BA 4RW7A 2MLXA 5D0RA 3VHQA 3W5YA 4DCOB 3CVKA 4LFBJ 2IOCA 2VWKA 2XHWA 1NDLA 2R7UA 4IRDA 1JIHA 1Z4UA 1BQNA 4OX8A 4B3TF 5BPNA 2P9CA 3EXYA 3BREA 3NF6A 4QS9A 3JAMO 4JHDB 2VQEJ 4DR7J 1JN3A 1HUZA 4OX6A 2PI5A 4CZKA 3H4BA 5HHIA 4CZMA 2IC3B 2MZJA 4OI3A 1U1NA 3BBCA 3OVNA 5DJBA 2Y8WA 1SV5A 1K0VA 3WIUA 4DV7K 1K8AT 1P6TA 1Y4ZB 1X9JA 4TSXA 2DNZA 3KLFA 2KLAA 2E2NA 4DR2F 1WC1A 1HYSA 2ZWOA 1YRTA 3QRRA 2ZGZA 1RBLA 1T9UA 4NLRA 3G4SN 1BIUA 1HD1A 3EWAA 1YBUA 1RILA 4NLWA 2I38A 1U49A 2FB0A 4X64F 3OVBA 1WB9A 1G7CB 4F67A 3SQIA 3DXKB 4KR0B 1TV6A 2GQCA 3ZX0A 4LQ9A 4MEXA 3AOCA 2UUCJ 4GKKJ 5KFMA 2KFNA 1YX2A 7ICNA 3L3CA 1IBMF 4OMFG 1YRUA 4B3RF 1IJJA 2DNOA 1N8RT 4NL9C 2YQ1A 1HEKA 5ALWA 2JEIA 4OZ2A 5JVGQ 2P9SB 2NZTA 3AVMA 3N97B 3PRBA 3OFEA 1L8OA 2ZUAA 2BRKA 3HI0A 2G0IA 3VOVA 2YVSA 1F0XA 2R7YA 3THVA 4GVBB 5IT4A 1EKSA 1DGKN 2KXHA 3IS9B 2DY4A 2HNDB 4MYUA 4Y2SA 3FCWA 1C1BA 4OI6A 5AK3A 2QZ8A 3GMGA 1RBVA 4CLFA 2MDAA 1ZQHA 2G1HA 2P6RA 7ICIA 1RT1B 4K41A 5E33A 4EUVA 2LP4A 8ATCB 4KY3A 5GINA 3FR0A 3QFWA 3L5KA 4F7VA 4LF4J 1ZJMA 3GCXP 4DL6A 4FF2A 2HBMA 4B1ZA 2M7SA 1IH7A 1FXDA 4YB7A 1A7GE 3ET6B 3TAEA 2A2DA 4FVCA 3RBXA 4MT1A 3ZZUA 2KJVA 4ILJA 2WB1C 3PW7A 2BJ1A 4J9OA 3KKAA 4JAXA 3ULEA 2D74B 1JLAA 4KGXB 3BO2A 4DS4A 2W2OP 4J9QA 1VOMA 2RIJA 1UVJA 3DU6A 4JV5J 3C14B 4K59A 3TAQA 1UVNA 1ZD3A 3VGVA 4YY3K 3GJTB 3DWLA 3WKCA 1IG8A 4A5BA 3DDKA 2HSZA 3IC1A 3CC7S 1FEZA 5LJ3Y 3TWHA 5AI0A 2JC0A 3K2PA 2ZDOA 1D0EA 4P4OA 2IVNA 5KT4A 3VQ9A 4H54A 5D3GB 2ISPA 1TKXA 2VJVA 1ULRA 1M5OC 4JD2A 1AW0A 2AA4A 4CZJA 2Q3PA 1X0PA 2LXUA 1Z1VA 1UW4A 2QKKA 2H1YA 4QS7A 1K6YA 1S76D 3OXGA 3WQTA 3CM5A 2XSFA 4FLWA 4M3TA 2V7YA 4LF8J 4F4YA 1RBUA 3H0LB 5J2CA 4DQPA 4DTPA 2GUPA 5AI5A 4IQTA 4M5DB 3OYBA 4KO0B 2LDYA 2YQ0A 2ZG6A 2V51B 4AD6A 3M32B 4DZDA 1OSDA 1T6DA 1RB0A 3D3BJ 4EZ6A 2PD1A 4CJUA 2CQHA 1I94F 1TL4A 4J2AA 1CLFA 1FTCA 2AP6A 1UEKA 4TU9A 1BCMA 1N5WA 2Y1IA 4K5RA 1QAXA 3AXMA 5EE3A 1SZPA 2AX1A 5FDLA 2GJFA 1YDLA 1P1TA 5DGBA 2EK1A 3CUNA 3SDEA 2MQPA 1VSFA 1EETB 2W1BA 2GW8A 4IC9A 1I1GA 1RWWB 4C2MA 4OPAA 4URQU 2BX6A 4DR4J 3L0QA 2QC3A 2M8DB 1F3VA 1WSFA 8ICEA 1S12A 1TMJA 3BYPA 2VQFF 1FJCA 2ZKUA 2YKPA 3SCKE 4I7FA 3BF1A 3L7PA 4RJVA 2A1SA 2YMPA 2YX1A 2BQRA 1QVGR 4E7KA 3AB4B 3T9ZA 4MN4C 1YHQS 2XGPA 5FPDA 5KPRA 2UVRA 3J81U 1PG5B 1ZBUA 4FLYA 4PUOB 4PHTX 3AEVA 3QUBA 4OJHA 3H3NO 3Q8MA 3AVIA 2YKMB 4YDUA 1JKHA 3MECA 1F44A 3HSZA 1IQTA 4BRQA 1SKWA 3BH7B 3IM8A 3AVKA 2ZNZA 3WK6A 1UMJA 1FJ7A 1VFJA 4KYZA 4Q0BB 3QZ7A 4CLZA 1VRUB 3HVTA 4P2SA 3CPEA 4IH6A 3OHAA 3C1YA 4F02A 2XNRA 2DFEA 2Z2MA 1CJVB 1FKOB 2XULA 3EUB2 1RADB 4O3QA 4YP3A 2V7ZA 3BJYA 2VL1A 3MEEB 1HKCA 2MZ1A 2V4QA 2QARA 2ZGYA 1NGGA 1YAGA 2WUSA 2B0GA 3QGHA 1S7HA 3JQKA 1SH2A 4OJ5A 1JLGB 4ZPTR 2QWOA 5M1KA 4AXJA 2D0AA 4FOIA 4N41A 2RF2B 3CCVS 3MDFA 3AU2A 1T05A 1KTVA 4GKJK 1S22A 1HNVB 4PPXA 2W2PP 4FWLA 4C1NK 2O66A 2NXEA 4FM1A 4IJAA 3UMGA 1Z00B 1Q5VA 5E3RA 2D3OR 1XC3A 1VBKA 4ZVQB 3ENWA 5B0GA 3CERA 4DSJA 1LWEA 2CG8A 2ZOMA 2MRLA 3ZZYA 2OEHA 4PG7A 4AE5A 1WLJA 2WVEA 2XC9A 4F3OA 2BKEA 1AA1B 3RG6A 3GJSB 4DU4A 3CCJS 4CO0A 2GQ2A 2DXFA 3MMVA 4P2MA 3B4MA 1XQSC 3LP1A 1CJUB 1G15A 2HW3A 3PX6A 2GWJA 5DRKA 5GAHP 4JI4J 3ITHA 5LM7E 3HHEA 2P5VA 4Z2XA 2Z4PA 1RQ0A 4I29A 1VSIA 8ICNA 2DNYA 1VDHA 3G8TA 1XK8A 2W01A 3CIMA 4I2GA 1FXXA 4CE6A 5HJXA 2Z30B 5J0UA 1RT6B 4CZGA 1QSYA 4JRQA 2V67A 3K0SA 1TKXB 5J1NA 3QUCA 1YJ9S 1DOQA 3G87A 1DEJA 4NXNK 4Y2KA 4CEAA 1JLFA 3FC4A 3PW0A 4W4MA 4CIEA 2IJNA 1JCGA 2RE1A 2PMWA 3IRWP 5G5HA 4Z94A 2H3QA 2LHTA 2JV3A 4FF4A 4CEQA 3CETA 3ZLJA 1Q7YO 1D8LA 3WEEB 3KLEA 2HBKA 3VENA 3R8EA 4QW9A 2YB1A 1VJ5A 1KQFB 3MDAA 2EAPA 2FHJD 4NJ8A 2EK6A 1NLVA 4LFCF 5CYMA 2BCUA 1IR2A 8ICIA 1RBTA 2VZ9A 1N6QA 1NJZA 4P2XA 2EDUA 4NMLA 1YRXA 1FNXH 3NGUA 3BDPA 1KS2A 3DM2A 4EMDA 3OYGA 2VGMA 4FYYB 2I6WA 3FSXA 3SEIA 5BRFA 5KOXA 4UY85 4IG0B 1YTAA 1X3MA 2W43A 4AFFA 2KOBA 4HLBA 1ATRA 3PIOL 1R31A 3C2MA 3GG4A 3VTHA 1SKRA 5D0GA 1X8DA 5AQSA 1N62A 5HATA 1F6TA 2I1RA 2BMBA 1OJ4A 5J1PA 1F3FA 3RBEA 2GJ2A 4LR9A 1APSA 3Q8PB 4BRLA 4WQ5A 4K8ZA 1ZRMA 3I5CA 2LEPA 4OZJA 5G5GA 1SQEA 3J81Y 2CQ1A 1NSAA 2E5HA 4LFAF 5J2DA 1PYTA 4HHTA 4GNIA 5HMYA 2QMWA 2GCFA 3JB9k 1UEVA 3THXB 1CQMA 1RU2A 3KJQB 1JCFA 1XSPA 4RTFD 1WKLA 2F1JA 3W3SA 4JK1A 1S99A 4Q2LA 1XHZA 1NPPA 2VOOA 3Q8RB 2F8HA 6AT1B 2CADA 3SUOA 3K59A 3TACB 1FRXA 3DOLA 1URRA 1YTUA 1IJFB 5IXUA 1IJEB 4CJFA 2PY5A 1BLUA 4DHYA 3DRXA 2RS2A 3L4QA 4YOWA 1QH9A 3N5FA 2HVIA 3IAM9 1YI2N 2DT9A 1WG1A 1U0SA 2HOQA 3O4NA 2FUG9 4CQ1A 2A1BA 5JLFA 3B8HA 4OVLA 2IRUA 4I67A 4QJVA 3AO4A 3KTQA 1EKRA 3BR9A 1CZAN 2PMZC 4ED8A 3PG9A 5IOLA 4F0HA 2ZM6K 4J9VA 4A57A 5KT6A 3P96A 1QUPA 5C7PA 1SXLA 3K17A 2DYAA 4JI4K 2FDRA 1VRTA 2XMMA 3ISBA 5GAGU 5J1EB 2HG4A 5GAEP 2VHGA 1RWVB 3W2WA 2EANA 1TL1B 1BE4A 1DQ9A 2HWHA 4KKOA 1CBKA 3T1YK 3LAKA 2XMKA 3R5JB 1FX2A 3C6AA 3VALA 2VUGA 2NXNA 3VAJA 3RJGA 1A77A 2C2MB 4GO5X 3PZPA 2RT3A 1LW0B 1N56A 3KUEA 4IOXA 7ICEA 2VG7B 4KGKA 2QLWA 5THWA 3SMVA 4OLBA 4B9MA 2R18A 5L9NA 3FGVA 3JPRA 1Y64A 4KTWA 3ZSZA 3Q8LA 4BC5A 3I0RA 3NRWA 2ZIVA 2FSJA 2P9UA 4BREA 1M1KT 3M6WA 4WP9A 3VC8A 4A5AA 3KG4A 3IG5A 1Q53A 4Y34A 2OSRA 2OELA 3MXHP 1QY7A 1VSKA 1EP4B 4WXWA 3Q8SB 3O08A 3NOCA 1SUQB 3VA3A 5AM1A 4O3MA 4YOUA 2B9YA 3LW5C 2Q6CA 4ED6A 5ETLA 2W7AA 1ZJNA 5AQTA 1D4XA 2VBWA 4I6WA 1JL2A 1JJHA 2HNZB 4F3QA 4OI1A 2FSKA 2M8HA 5GMDA 1NK8A 1O51A 1VC5A 4FWPA 1LKZA 8ICLA 1V5IB 1TR0A 4KB7A 4EP4A 3SBMA 4BC7A 4WIQA 1BIZA 4ZITA 3MDCA 4W5RA 5DQIA 5CP2A 1EX4A 3CT9A 1BGXT 5GAEI 2LU1A 3LDOA 2QA4G 1HKAA 4I2FA 3M9MB 1XMQK 4BRIA 1FF2A 1LWEB 3T79A 4DV1F 1VBXA 2BCQA 1FDAA 4MLHA 2UXBK 2XCPA 1P7DA 2PEHA 2GLEA 3J80O 3O3GA 1FK9B 2A5XA 5IWAF 1F5CA 4A59A 1HIYA 1H7WA 1VBYA 4CNZA 2SXLA 3TJAA 3QATA 4DR3K 4BQZA 3CCLS 1RAEB 1PK3A 4RW4B 1HBMB 3MM8B 4CJQA 3EYZA 4K4YA 4Z4FA 1HQUB 3MN6A 4M3XA 4F4ZA 1JJ4A 2MKKA 7ICFA 1IUJA 3DOMB 2KVQE 2HOFA 2FHMA 4MO5A 5F8LA 2BHNA 2YKQA 3FBFA 4PAAA 1ZD5A 3KZIU 3KG0A 2EWHA 5A2QY 2ZHAA 1VQOS 3DXMA 1JLFB 2C1EB 2F40A 1S6QB 1DRZA 4LH5A 1WSEA 1HNWK 9ICSA 1LXJA 2D0OA 5KQ8A 2V9KA 1X4EA 5C5JA 4L76A 3L2WA 1CZ9A 4P10A 3R7NB 3H5YA 2E2OA 3GFXA 5SWMA 4G1QA 3J7YP 5TISU 3CCJN 4NV0A 4QIWF 1C0MA 1S1VB 1N36F 2Q1LA 4WKRA 3MEKA 2GGPA 2VFRA 3TA0A 1HWIA 2AYMA 1D5AA 5JRTA 2YNGB 3V81A 2J76E 2XG8A 4A8WA 1SXEA 1Z2LA 2LXFA 4TLRA 8AT1B 1Q8KA 3DFEA 1S5LU 5GAGI 3S7RA 2QL5B 3VESA 1E3MA 5EX0A 4C3LA 4C0ZA 4BQLA 3O3HA 4F2SA 2E9RX 3L2QA 2RRNA 4DS5A 3W9IA 4I1TA 3M6UA 4QZCA 4YOEA 1FTRA 2VWJA 2PFOA 4DR2K 3CJ5A 4JK9A 4M3RA 4UY8O 5J29A 2HLTA 3PSFA 3LL3A 4ICLB 3EX7B 5FPMA 4FZZA 2KIWA 3T6JA 2W9BA 1S1TB 4OGCA 4JUZA 4I2QA 4A8FA 1OH7A 1ZH5A 1EXNA 3ZSXA 7ICTA 3ISND 5K5MA 2HNYA 1ZM2A 4F0MA 1CRXA 3QZ8A 5FRMA 4CJ4A 5M2PA 1TUWA 4N56A 1YI2S 3DLLL 3QT7A 5ALXA 4F5QA 4WPAA 4H4MB 4AF1A 1TVRB 3HW8A 2LQ9A 2FBXA 3DEEA 2ZBIA 5JMVA 1OW5A 1YIJN 4OZ1A 4DR1K 2N7CA 3B6OA 1B4FA 4J2BA 2OPPB 2ZBPA 1EZZB 4OI4A 5FDLB 2OO4A 3CCLN 3QNNA 1JNRB 4MFFA 2Y3YA 3BR8A 3HZEA 1WTBA 2YV0X 5CE3A 2HFOA 2B7CB 1KLMB 2JZ5A 4P52A 2KEYA 3LPTA 5A6WA 2GUIA 3C7NA 1PK1A 2VWBA 4CEOA 4X84A 2V8VA 1URNA 1V6HA 5KFGA 2RDIA 3LA0A 1O08A 2BJ3A 4GXKA 1KP6A 4KLFA 2OFHX 3ZTRA 2WBMA 2MJNA 2RQ5A 2QIFA 4B8AB 2F8LA 4YDDB 4WE1B 3KD3A 5H1SQ 4CLSA 1HNWF 4OPHA 3SQ1A 4OYAA 3C19A 4FM0A 2D9OA 3OTEA 2PFFB 1GLJO 4D3GA 4NA2A 2Q3SA 4DV3F 3RR7A 4KLTA 3DGVA 1ZQDA 3B6PA 1EIYB 4N8OA 1N61A 4AYBD