4O0IA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
SKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with 2'-MeSe-arabino-guanosine derivatized DNA
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o0iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4o0iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o0iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0iA01
3TAMA 1S76D 3SNNA 4PHDA 4Z4IA 2R7YA 2PXIA 5HP4A 2AGQA 3KTQA 4FJNA 8ICVA 3HO1A 4CHYA 3PV8A 3T5LA 4FZZA 4K4IA 2AU0A 5J2IA 1NOMA 4F5RA 3CM5A 1L5UA 5KFEA 5J2DA 2XY5A 1LWCA 4YR0A 5KG5A 3GIMA 9ICRA 1YTAA 1GOCA 3OYGA 4J2EA 3M9OB 5J2KA 5E41A 5KFWA 3ISDA 2IBKA 4Y1DA 4M47A 3LALA 4F3TA 4FJ8A 4M9NA 3QEXA 4CJTA 1ZQHA 4FK0A 4CFBA 4QZCA 5EU7A 4FS2A 2QXFA 4I2FA 1BPXA 2FPLA 1VSIA 5DGBA 3H8JA 3MR6A 1HQUA 3SCXA 2X74A 3VQ8A 1A76A 3T5HA 4Q5VA 3G6XA 3LDAA 1IKYA 4DTJA 3SV3A 5DLFA 1HYVA 4M6WB 4B3OA 5DBAA 1BISA 4RW6A 1N6QA 5IIIA 2VG5A 2BR0A 4OKKA 4TUSA 3P83D 1KSPA 1JLEA 4FJKA 1KVCA 3V9SA 1LW0A 5F9LA 3PMNA 1Q9XA 3SYZA 3V9WA 4M3UA 2P51A 2G8WA 2F1HA 2JGUA 3TABA 2F1IA 7ICQA 1VRUA 4KLLA 2OPPA 3LWLA 3P1GA 2G8IA 8ICEA 1RNHA 4BXOB 4GC7A 4R64A 4O5KA 1ZQFA 1UA0A 4W5QA 5J2GA 3S3NA 4PY5A 3RRGA 1EKEA 4TUQA 4F4XA 3A2FA 4LY7A 5HMMA 3L2WA 4QZIA 5L1KA 4F5PA 1A5WA 4IRDA 4ID1A 2BGWA 8ICLA 3RTVA 3T19A 4GXKA 3MECA 4O9MA 4B08A 4KLOA 3BDPA 4CFDA 4I2JA 3L2RA 1HJRA 3QERA 4OLBA 1RTHA 4FJXA 3OYHA 2BQUA 1ZQPA 2W9MA 3QEBZ 3LPUA 3QO9A 2YNIA 4W5RA 2DFFA 1C7YA 5CP2A 2P5GA 3N4MB 4AHUA 3JYTA 2A1JB 4CE9A 4M2YA 3OYJA 3NCIA 3V6KA 4IQVA 1S1TA 3TAPA 1S10A 1ASVA 5FDLA 2E6LA 3AO3A 5KT4A 3RH4A 4DTSA 4BE2A 9ICUA 1JLQA 2FBVA 3M8PA 5HROA 2VANA 1NK5A 4RW7A 4O5BA 1EETA 4RUCA 4Z4HA 3RJKA 3TI0A 5D46A 4BDZA 5J2EA 8ICNA 1XHZA 2YNHA 4CGDA 4MEYA 1I39A 5DQGA 1SV5A 3IM1A 4DFJA 3HT3A 3VQAA 4CGJA 4CHQA 3UQ0A 4DU4A 9ICTA 5KGXA 4FBTA 1L3VA 3C1ZA 4PH5A 4M41A 1TKZA 2X6NA 5KTQA 4LH5A 3ZSXA 3MABA 4RT2A 4JWMA 4F2RA 4O3SA 1U45A 2ZE2A 4N56A 3I0SA 3KKRA 1D9DA 4KMUA 3NGIA 1HUZA 1WSJA 2BCVA 3NAEA 4YR3A 4M0AA 4YXJA 3PUFA 1KFTA 4JS4A 2FLLA 3NHGA 4IBNA 1KEJA 3MR5A 4MFAA 3K75D 3ULDA 3GIKA 4DQQA 4M9HA 2NRXA 5CWRA 4G3IA 4B9TA 5KFZA 2HHQA 1QHTA 4IFYA 1RT4A 4EP4A 4RQ8A 4KV8A 4AHCA 4MFFA 2IDOA 1FXXA 4ECYA 2BANA 3RBDA 2GWSA 4JS5A 3V72A 4NCBA 1RZTA 4RW4A 3VA3A 4DL3A 3TAGA 7ICJA 3SQ4A 3RMCA 4K8XA 3U6FA 3IS9A 4KLGA 5JUMA 4P4PA 1KCFA 3ZSYA 4M04A 2YV0X 4AHTA 4MFBA 1SKSA 2DTUA 1ZQOA 1ZQGA 5KFAA 2QK9A 1NJWA 3SQ0A 2WOMA 1QS4A 2PFOA 4E1NA 3RB0A 2KFNA 1S1XA 3ZSQA 2QKBA 3MEDA 4ED1A 4CGGA 2BPFA 4FCYA 4GC6A 2PI5A 4XUSA 1RBRA 2V9WA 2IC3A 1TK5A 2FMPA 5I42A 5J29A 5IINA 3OYDA 3V9UA 1KRPA 1KVAA 1JMSA 4CEAA 3KHLA 1RBTA 4DU1A 4YN4A 3Q8PB 9ICMA 2HNYA 4JV0A 4KLDA 4CHPA 5CJ7A 2H5XA 1BL3A 1HNVA 5CHGA 4RNMA 3PO5A 3GDXA 4Z6EA 4AHSA 3SPZA 3QNNA 1NOYA 3LAMA 3OYLA 4CJSA 1S0VA 1SZPA 1S1WA 2A1SA 1NK4A 2ZUCA 5HHHA 1C0UA 1RT3A 4I2EA 4H8KA 5HBMA 3VQPA 2XGPA 3AVJA 9ICKA 3G10A 1SL0A 3QZ7A 4DG1A 4PGYA 4CHZA 2FBTA 4PA1A 3ZT0A 4DLEA 4QZHA 3CG7A 2J6TA 4CFCA 2C2DA 3QETA 1IG9A 4NM2A 3Q8LA 2KFZA 5BOMA 4OPJA 2IAJA 9ICSA 4E1MA 4O3RA 3AVHA 2G8FA 3LDSA 3GQCA 4CF8A 1T05A 3TAFA 4CEEA 4C8OA 4J9RA 4AH9A 1NOZA 1B9DA 9ICOA 2KZMA 5L9XA 4B9NA 4KAZA 2FBXA 3AV9A 4AHRA 4M3WA 4KLEA 4LSNA 1QQCA 4IDKA 2RDJA 3L2QA 5HMLA 5HP1A 1TFRA 2ZUDA 2C22A 3EPIA 4DSLA 3QEVA 4ZH4A 3PNCA 9ICGA 1D8LA 2EX3A 5DMRA 1XS9D 1RBVA 3O3GA 3AVCA 4CJQA 4OGEA 3L2UA 3SQ1A 2Z1GA 4BDPA 2MUTA 2AQ4A 2KN7A 3K2PA 1RYRA 4FK2A 3FYHA 5J2FA 3CFOA 4I2PA 4CEBA 4FJLA 4E89A 3C94A 2P5OA 4QZBA 3ASMA 4Q44A 4RQ4A 2GUIA 1TL1A 1JLCA 4R8UA 1J53A 3NBPA 3OVNA 2HW3A 3KLIA 5CB1A 7ICRA 1C6VA 2FLNA 4NY8A 4UAWA 2BPGA 1T03A 2ZUBA 3RJJA 3OSPA 1TKTA 4YFKA 3TQ1A 4RPZA 2OZSA 3UQ2A 4CK3A 2I5JA 1W9HA 1UT8A 5HLFA 3ZDBA 4CEOA 2M9NA 3GIJA 1S1UA 3QLHA 1RTDA 3LP0A 4KB1A 1T8EA 2XCPA 4HUEA 1RT6A 4TSXA 4R65A 7ICSA 3VQBA 2RKIA 4RZRA 5J0RA 3EZ5A 4M3ZA 5J2AA 4TQRA 4P2HA 3L8BA 4MFCA 4KLMA 9ICEA 1B43A 4DSJA 5J0TA 2HHUA 1RPLA 1RBUA 4DQPA 3HM9A 5C5JA 3ZT4A 4KHQA 4M9JA 3KJVA 4F5QA 5KFOA 3ZSRA 1RXVA 4XA5A 4M3RA 4J2DA 4UAZA 4CECA 4EBCA 1HMVA 4FLXA 3JPTA 4M3YA 1QE1A 4ID5A 5C25A 2B5JA 1RYSA 5J0XA 1D9FA 4LD0A 3MXMA 4I29A 4ED7A 4DSFA 3NE6A 4YD1A 3CFPA 2IA6A 3PW5A 3AVLA 2F96A 4DQIA 4DTNA 3RRHA 1WSEA 5DKWA 1EX4A 8ICJA 5KFDA 4OJRA 2VA3A 4K4GA 4DOCA 3M8SA 4I28A 1VSEA 4YP3A 3UXOA 1SKWA 1N48A 5DLGA 4QWEA 1Z00A 1XU4A 5DG8A 5KFJA 2JEGA 5F9NA 4DS5A 4IQUA 3K59A 4GXIA 1A5XA 1U47A 4BGDA 1VK0A 5CY4A 3HYFA 4HVJA 4IQWA 3IG1A 4CJFA 3DRPA 3M8RA 3V9XA 4Z4EA 4QWDA 2G8KA 3MXJA 5KG3A 4FLTA 3QIOA 1XI1A 4MEXA 1ZQYA 3KLGA 3DRSA 8ICKA 2D0CA 4PHEA 3KLEA 3U3GA 1TV6A 4OKJA 2D0AA 3HW8A 5HRNA 8ICIA 1R0AA 4NLKA 4B8AB 5L1IA 3WNFA 4HUGA 2ZTDA 3V9ZA 4CERA 4ECRA 3TAEA 4ECQA 2YHBA 4O5EA 1HPZA 3VN5A 4JK1A 1PZNA 4I9LA 4O3QA 1MQ3A 4NLNA 9ICLA 4W5TA 1VSJA 4JUZA 3MXIA 3AVAA 2VG6A 1XSNA 4CJVA 1WAJA 4RT3A 3OSNA 4FYDA 4CJLA 1AROP 5DBCA 3L2VA 4I2DA 3ISBA 2IOCA 4RQ2A 1C1BA 3VQEA 4J9KA 5D3GA 4W5OA 3ZT3A 5EOZA 2WONA 4CJEA 4KHUA 4GMJB 1HNIA 5DBBA 3ZSWA 3MFHA 2KTQA 1MQ2A 1KFSA 4M9GA 4DLGA 4QZFA 3LK9A 1IKVA 5CZ1A 3TFRA 1EXQA 3PX4A 2ALZA 4UBBA 5IIKA 2BQRA 4QWCA 5HNKA 3GV8B 4DF4A 4CJ4A 5IIJA 1ZBFA 4J9SA 2W9BA 1S9EA 4O0JA 1LAVA 4B9LA 1T3NA 5KFRA 4CHOA 4GLXA 3VQCA 2W9AA 1X9MA 3PR4A 9ICHA 3KHRA 3ZDDA 4CFAA 3VQ4A 2XCAA 2HVHA 3PY8A 2R8IA 2YKMA 2OYQA 7ICNA 2P6UA 2HNZA 4UB4A 3AUOA 4RUAA 1TAQA 1LAWA 3HP9A 4N47A 4DO9A 3B0YA 1S6PA 4YVZA 2Z1JA 5KFFA 4RQ3A 3ZSZA 8ICQA 1C1AA 2C28A 4IKFA 4OPKA 3RBEA 3C23A 8ICPA 4ECUA 3BQTA 8ICAA 1JLGA 4KTZA 4EBEA 2RF2A 4YMOA 1BI4A 1J54A 5CZ2A 1VSFA 4F92B 4RNNA 5KFBA 2UVVA 1KLMA 9ICVA 4B9UA 1IKXA 3KK1A 4OLAA 8ICCA 3PO4A 3UXPA 5KG2A 2ASJA 3HX0A 4ECTA 4CEZA 8ICGA 2NUBA 3H8WA 2JZBB 3O3HA 3QEPA 3EYZA 3KLFA 1WSFA 2BCUA 3VQ5A 1U4BA 3SUPA 5DK5A 2FPMA 8ICZA 4UB5A 4O3PA 2AGPA 5JS2A 4AILC 5DDMA 4DS4A 1NK9A 1ZQCA 4I2HA 4KLFA 3KK3A 4YCXA 1WSHA 4F3OA 4JRPA 1W0HA 9ICXA 5J2NA 3ZD9A 4YQWA 2OPQA 4G1QA 1S0MA 2UVWA 3SUQA 4KHYA 1WAFA 4RPXA 1S1VA 5L1JA 3OY9A 4UQGA 3QZ8A 4J9LA 5DQHA 3OHBA 1CXQA 4IRKA 4FZYA 3QEAZ 1ZQDA 1A77A 5J2QA 5J2BA 1D8YA 1CZ9A 2C2RA 1TVRA 3DI6A 3BQ0A 3QEIA 4QW9A 4EYHB 1IH7A 3GV5B 4MF2A 1HYZA 3K5OA 4HUFA 3NF6A 4IRCA 1K6YA 4FLVA 3SI6A 1ZBHA 3QE9Y 2XC9A 2PZSA 3DLKA 1BPZA 4HTUA 2HHVA 3N97B 1ZQWA 3BJYA 3ORYA 9ICJA 2Y1IA 2E4LA 3VQDA 1IXRA 5KRSA 1S77D 1RDCA 4KHWA 7ICGA 2IS3A 3AVGA 3K5NA 4LH4A 3MFIA 4YFUA 1WN7A 5T7BA 5J2PA 4B9VA 3EW9A 4H4OA 3IHQB 2FPKA 2ISPA 1VSHA 4BWMA 1JLAA 1KLNA 1LV5A 3NFAA 4ZTFA 5KGWA 3ZDAA 3PW2A 3K4GA 1X1PA 3AVFA 2G8UA 3AO4A 4YMMA 2DFLA 4DQRA 2VWJA 1U04A 9ICPA 1JKHA 1EXNA 2J6SA 3M9NB 5KT5A 4GXJA 1TL3A 4FJ9A 3H4DA 1UWBA 2I1QA 1HYSA 3T3FA 4F91B 2JEJA 3C95A 3Q8QB 4DSEA 3OYBA 1MC8A 1ZJMA 3EY1A 5EWEA 2LYHA 3NGDA 1A5VA 2AGOA 3OYNA 3DLBA 2AQ0A 1BQNA 3M8QA 1F21A 3H08A 2R8HA 3AO1A 3IRXA 4QWAA 1ZQUA 5KT6A 3S9HA 1KDHA 3F9KA 3V6JA 4NXZA 2Y1JA 1RT5A 3MEEA 4FXDA 3KLHA 5EWFA 2HMIA 4PHPA 3V81A 3TFSA 3D0PA 3SPYA 1NJZA 2FMQA 1QSLA 3EWAA 3GFKB 4R63A 2ASDA 3OYMA 3VQ7A 4FJMA 3UPQA 1N56A 1RXWA 4I2BA 4QZ9A 7ICLA 2ATQA 5IIOA 4ECSA 5J0QA 3HP6A 3ZSVA 5DB8A 4CF1A 2I9GA 1TVAA 1ZQJA 4I7FA 4K4HA 3ZD8A 1CEZA 3NF9A 2UVRA 1BPDA 4CK2A 1NK0A 5EWGA 2BGGA 3RB3A 3RH5A 1DGSA 1BPBA 4ED0A 1JL1A 1WSGA 4CEQA 3F73A 3NTUA 3RJFA 3B6OA 4QZEA 3AA3A 5DG9A 4I2QA 1ZBLA 3HWTA 2XGQA 3DLEA 3JPRA 1JLFA 4ZHRA 3KHHA 8ICMA 3ZDCA 5J2JA 5D49A 4IR9A 1VSDA 3I0RA 4HHTA 4QCLA 2GBZA 3EPGA 1NK8A 4KLTA 4EEYA 4Y1CA 4FLYA 1ITGA 3O4QA 1MSWD 1Z25A 5J0SA 3TARA 4PPXA 4FJ5A 4C8KA 1WLJA 2R8GA 3MBYA 5IILA 1SL1A 5KFHA 2IMWP 5HHIA 2PFPA 1FKOA 4BACA 3T5JA 4IG3A 4ELTA 2J6UA 1RTIA 1X9WA 4ED8A 2HHWA 1GOAA 5I3UA 3RB6A 4O4GA 1ZQBA 4QAGA 5DG7A 1B92A 1X2IA 2DPIA 2VWKA 3FDSA 3RMBA 1WNSA 3Q8RB 1S97A 3NDKA 5KG4A 4F5OA 5KFMA 2DY4A 5KFYA 2YHAA 4FZXC 3RJGA 2BDPA 4RQ5A 3V7LA 4J9MA 1G15A 3V6HA 3AA4A 1JXBA 5KFUA 3SZ2A 5K14A 3KD1E 4MF8A 3K5LA 5DQIA 2Q3SA 3ISCA 4F5NA 2Z1IA 4KO0A 5CYMA 4CF0A 4DFKA 1TV9A 3MGHA 4JV1A 3RWUA 4M42A 1Z3EB 2PYLA 5BOLA 4M6WA 4BE0A 1NK7A 3E2EA 5IIMA 4DEZA 4M9LA 4KITB 4FVMA 4ECVA 4ECZA 4EBDA 4FK4A 4DTPA 4OGCA 5SWMA 4DL4A 4CHNA 3ZSOA 3KK2A 3AA5X 4PGQA 3NF8A 1YTUA 2BCRA 3OS1A 5CA7A 5DDYA 2YNFA 1U49A 3LZIA 5HRSA 3JPOA 4GW6A 1ZQZA 1C1CA 1JIHA 4FJ7A 3I8DA 8ICRA 4I2GA 5KG0A 1K1QA 1EP4A 9ICIA 1XHXA 2C2EA 3BGRA 3AU6A 4CJPA 4BXOA 4F4ZA 4X5VA 4M45A 2V4RA 4ECXA 1JL2A 4CEFA 4RG8A 3JPPA 4KPYA 2OPRA 2ETJA 1D5AA 3PX6A 3ZT1A 1TKXA 1ZQVA 3RJIA 3C5GA 2PYJA 2KZZA 4DL7A 4QWBA 7ICKA 2W8KA 1VSLA 4CF9A 2DPJA 4MQ3A 1BIZA 4FLWA 5J0PA 1HQEA 3WNHA 3G6VA 4CEDA 3KHGA 8ICOA 2Q0ZX 4F93B 3KD5E 2X78A 1ZQXA 4FLUA 4DSIA 3HPGA 4RPYA 4Z0UA 5J2MA 1VRTA 2FMSA 3DRRA 8ICXA 4KLIA 3PR5B 7ICEA 4CJKA 4DTXA 4UB3A 2A1JA 4B8CA 2OZMA 4KI4A 3HPHA 4ED3A 2V4QA 3OYCA 4RU9A 3L3UA 4EZ6A 3TANA 1UA1A 3SUNA 4Z4CA 3D45A 4DTMA 1J5OA 4I2CA 5KG6A 8ICWA 1HJPA 3T5KA 4DL6A 1JN3A 2BKEA 2MUTB 2IHMA 4O0IA 2R8KA 2P1JA 3RR7A 3AVIA 5FRNA 4M3XA 4NM1A 4GVMA 4O5CA 4JLHA 2O4GA 1Y88A 3ZT2A 2D0BA 1H38A 4FM1A 4FJGA 4C8LA 4R8UB 2WTFA 4DFMA 1YVUA 1CUKA 1FKPA 1V9PA 5DB6A 5KFKA 5KT3A 3TAQA 5KFCA 2BHNA 1ZQSA 4LZGA 5KFPA 1L3UA 5J0OA 4DTOA 4E0DA 3AU2A 4ZTJA 2JEFA 2YKNA 4QZ8A 4XIUA 3KIOA 4Z6FA 7ICPA 3L3VA 5KRTA 1REVA 5KFLA 3RMAA 5CR0A 1TGOA 4DOAA 2BQ3A 3MR2A 4DOBA 3E01A 3ZDEA 1XWLA 1BIUA 1RILA 1I3AA 3HVTA 2F8TA 4YG2A 4IR1A 5KG7A 1K1SA 4I27A 2D5RA 4Z4FA 1ZYQA 2RDIA 1JXLA 5KT2A 3OYFA 3B0XA 1DTTA 4KLUA 2W42A 5CYQA 3V7KA 3BQ1A 4F2SA 5DGAA 4LZDA 7ICIA 3DOKA 4W5NA 4J9QA 3M9MB 1DOQA 8ICSA 1HUOA 4RNOA 4J2BA 2HHSA 3O3FA 4KFBA 3OYIA 4F4KA 8ICTA 1GOBA 1QLNA 4YMNA 3RH6A 9ICQA 2NRZA 1S0OA 3NH0A 1TAUA 3S3MA 4JV2A 4N5SA 3VQ9A 3C21A 3KKSA 4KN4A 1IM4A 1C0TA 1NJXA 3MEGA 4QW8A 4PGXA 4Z6DA 4EP5A 3VA0A 4KTWA 4FO6A 4NLGA 2ZJAA 4N76A 2Z1HA 4DWIA 2X6SA 1WCLA 1BGXT 4RQ0A 1Y97A 3RAQA 4Q0BA 4FM0A 7ICHA 3T1AA 1B9FA 4FBUA 2OA8A 4HYKA 3LWMA 2HNDA 5KT7A 2RN2A 3PW4A 5L1LA 4CIFA 3GV7B 3RMDA 4P4OA 3LP2A 1ASUA 3RJEA 4CF2A 1Z00B 4PQUA 4Q45A 4QZGA 4DMNA 3NF7A 3UIQA 4KREA 4I2IA 8ICYA 2W9CB 4NCAA 2XO7A 1BPYA 3OJUA 4I2AA 3JSMA 1JXEA 3DLGA 4DFPA 9ICBA 2VG7A 4DQSA 8ICFA 1ZQEA 3HSTB 5TZVA 3H40A 3OS2A 4E7LA 3LPTA 1KFDA 1Q8IA 5C24A 4EYIB 2HHTA 4KHNA 2DFEA 1IKWA 4CJWA 8ICBA 4R5PA 5KI6A 4E7KA 1NKEA 1T7PA 2XY8A 4OVLA 3V1OA 2R8JA 4DTUA 4RW8A 3SQ2A 1DLOA 3AVBA 3PW7A 4DL2A 1JLBA 5KFVA 4KTQA 3C6UA 4NLZA 4PWDA 2PY5A 1C0MA 4C8MA 4HCBA 1KTQA 4J9NA 2KZ3A 3HK2A 3PX0A 3DOLA 5KFTA 3S3OA 1L3SA 1RDDA 3DLHA 1VSMA 3C2KA 9ICAA 4F50A 1XSPA 3P5JA 2HB5A 4IG0A 3V1RA 1RDAA 3LANA 1Q9YA 4QOZB 9ICFA 3V7JA 3PMLA 2JLEA 3K5MA 5HRPA 1RTJA 3AVKA 3H8SA 1TK8A 4KLSA 1O1WA 5KFSA 4E7JA 1BPEA 4DF8A 1RT7A 4O44A 3AVNA 3CYMA 3NH2A 4RQ1A 2G8VA 1ZQLA 1S9FA 4ELVA 2B6AA 2W8LA 4PUOA 4J2AA 3WNEA 2NRTA 1S5JA 4FJHA 1XSLA 3VQ6A 4XQ8A 3C1YA 1NKCA 4XRHA 3G0ZA 2XHBA 4KB0A 2W9BB 1IO2A 4N41A 4DSKA 4KLHA 4P4MA 4FLZA 1ZBIA 3G6YA 9ICCA 4FW2A 3Q8MA 4J9PA 2AJQA 5C42A 4BWJA 3MDAA 5KFQA 5D4BA 7ICVA 3C2LA 5KFGA 4M3TA 2HHXA 2ZTCA 2QKKA 1RT2A 5DB9A 4CJUA 5J0WA 7ICUA 4F4YA 3OGUA 5KFIA 3CM6A 4Q43A 3LP3A 3MGIA 1BI4B 4CJRA 2FBYA 1UAXA 5J0UA 3K58A 1LW2A 3OYKA 4KRFA 2LSNA 2P6RA 2UVUA 1ZQRA 4NYFA 1XC9A 4NCGA 5SZTA 2ZTEA 4E19A 3RJHA 3U3YA 4O3OA 1UT5A 3NGYA 3MAQA 2E6MA 4DU3A 1WSIA 4FM2A 1ZQAA 3PW0A 4CCHA 1S6QA 1FK9A 1BVSA 3IAYA 4Q8EA 3DLRA 2ZJ5A 4CJ5A 4TURA 2F8SA 4FJIA 3SJJA 4ED6A 3HJFA 3AO5A 3ETLA 1B22A 3ISNC 2PFQA 4PHAA 8ICHA 1ASWA 3OYAA 2A1RA 2ZQBA 4YR2A 3C6TA 4UBCA 4LVSA 2O4IA 3FFIA 3SV4A 1SL2A 2NRWA 2MAXA 1BQMA 1ZETA 5JS1A 4YD2A 4Q8FA 4Z6CA 4DL5A 1RBSA 1T4GA 1CXUA 5KFXA 4OKEA 2IHNA 2BPCA 3GIIA 1TKDA 2PI4A 4E3SA 3HVRA 1CZBA 1QTMA 3TR8A 3RAXA 1HRHA 4UB2A 4FS1A 2JEIA 4UAYA 3THVA 3MR3A 2YNGA 3RB4A 1RDBA 1L3TA 1ZQMA 4E7HA 4H4MA 2KW4A 3PVXA 3GILA 5FRMA 1MU2A 2ASLA 3SI8A 3HL8A 4ECWA 9ICNA 2B4JA 4CGFA 1QSSA 2NRVA 1BHLA 1S9GA 2ISOA 4CESA 2BE2A 1U9LA 4BDYA 1KVBA 4CGHA 2FC0A 4ELUA 4YXMA 1COOA 4KKOA 3SUOA 2RPIA 2P66A 3DM2A 2OPSA 3OHAA 3AA2A 1S0NA 2OWOA 4F4WA 3K57A 4NYNA 3MDCA 5J2HA 3RR8A 4CIGA 4FW1A 4RW9A 1ZQIA 1ZJNA 1TK0A 1N5YA 3ALYA 4KLQA 1ZQKA 1YT3A 3CFRA 3V4IA 5HRRA 8ICUA 5KG1A 4BE1A 3H7IA 5DB7A 3JPNA 5J0YA 3HPOA 4B9MA 1SKRA 2EHGA 2ITGA 3ZCMA 4F8RA 3NH1A 5J1EA 4O3NA 4DTRA 3QESA 2XY6A 4KI6A 2ZJ8A 4RQ7A 2GV9A 1ZQQA 3V1QA 1U48A 3OS0A 2VA2A 1SUQA 3AVMA 1UOCA 2G8HA 4L8RB 3TWHA 7ICMA 3LP1A 1LB2B 4JRQA 4LSLA 3OYEA 4AHVA 4KLJA 3VQQA 3NGZA 3JPQA 4J9OA 4CGIA 3DMJA 3QINA 2PFNA 4CIEA 4JWNA 2IGIA 4R66A 2BCQA 1ZBUA 4UB1A 1WCNA 1J9AA 4IFVA 4E7IA 4C8NA 2XY7A 5J2CA 3V6DA 1ZQTA 3HXMA 1DTQA 3DYAA 2ZD1A 1BCOA 3Q8SB 2F1JA 3C2MA 4HCCA 3O4NA 9ICWA 3UXNA 2HVIA 4I9QA 4QZAA 1QSYA 2B21A 1VSKA 5BPCA 7ICOA 7ICFA 3CQ8A 3QEWA 3WNGA 1NK6A 1CLQA 4QZDA 3B6PA 3AO2A 4EZ9A 4IQTA 1BCMA 4FJJA 3BQ2A 3ITHA 1NKBA 3QIPA 4CJ3A 1LWEA 4YNQA 1ZQNA 1NJYA 2DFHA 4B9SA 3OJSA 3H4BA 4CK1A 1RCHA 1Z26A 1LWFA 4WE1A 5KFNA 4K8ZA 4Z4GA 2FLPA 4ICLA 3QNOA 2XRIA 3Q8KA 1RT1A 2JZBA 4RQ6A 2ATLA 1X9SA 7ICTA 3JPSA 2BCSA 1JX4A 1XO1A 4KHSA 4TQSA 2VA8A 4TUPA 3LZJA 2KQ2A 3C5FA 2W9CA 4KN7A 4O55A 4ED2A 3LAKA 5FROA
chains in the Genus database with same CATH superfamily
4Z4IA 1NBWA 4K50A 8ICVA 3HO1A 3G71S 3IRUA 3KFWX 3KLIB 1RQNA 1G4CA 2CAJA 3FBFA 5J2IA 1FKOB 3CM5A 4OZ1A 5J2DA 3WIUA 1M90T 4IG3B 3JQKA 2VF3A 1RTIB 1GOCA 4O4GB 1U6FA 2XI2A 3M9OB 4WU2A 2IBKA 4M47A 3VHQA 4I6WA 3E9PA 5GAGI 4CJTA 4NLUA 3ZETB 1SH0A 5EU7A 3F2DA 1B0TA 5AR0A 2QXFA 4YB5A 4PG8A 2CWXA 2ZG6A 1BPXA 1VSIA 1JALA 2DGOA 4F0KA 4GIBA 1VQPN 1ACMB 3MR6A 1L8LA 2W3SA 2QRRA 3OFHA 5CYMB 3T5HA 3TRGA 1NNDA 2RAQA 3BH6B 2RKIB 1VQ6S 1SC6A 2J0QD 4NL9C 1HYVA 5DETA 3UM9A 1BISA 5IIIA 5DDRC 3P83D 4WIQA 4DV0J 1KSPA 1JLEA 2XG8A 2IVMA 3W60A 1SZ2A 4CBXA 2R7QA 4FXWA 3PMNA 2YNFB 3V9WA 2W7PA 1X4FA 4DV4K 1C1CB 1TR0A 3UCUP 1EP4B 2G8IA 2W2OP 4K43A 4DZDA 5AQFA 3T6BA 1N33F 2HWTA 1YTYA 2QYGA 4F4XA 1UFWA 1MWKA 2VL1A 1H98A 5HMMA 5L1KA 1A5WA 5IQ6A 3SCKE 4L72B 2J9CA 1UVLA 4ILRA 3C65A 3T19A 2C42A 4OZNA 4KLOA 3BDPA 1OQ3A 2X7IA 5B0DA 3MGVA 1V6HA 5EUHA 1HJRA 4B3TK 3ED5A 1Q3VA 1D9AA 3R1HA 3NNAA 3ATUA 1GMVA 4W5RA 3BR9A 3ZEUB 5ALSA 4OI0A 2L48A 4L3KA 3N4MB 1HNWK 4DUYK 3VETA 1W7AA 2A1JB 4CE9A 3OYJA 3VTHA 1VHIA 6FDRA 1N8RT 2J0XA 1LKYB 4DR6F 4ZDNA 1H2TZ 1S1TA 5B7WA 3AO3A 1RLDA 4BE2A 4OCZA 2UUCJ 2FBVA 3MUMP 2O8EA 3M8PA 4XTTA 2N4CA 3QXGA 3IG1B 3WXKA 4BC2A 1C0FA 1HL6A 4BDZA 3OHRA 3ONQA 5I4MA 2YNHA 4CGDA 4MEYA 5E79U 1Q3UA 1LOUA 1F5SA 4I67A 3VQAA 4CHQA 1AA1B 3DDIA 1GMUA 4A8SA 4KR0B 2JRZA 4AYBD 9ICTA 7AT1B 3I56S 3CETA 1VLOA 3NS7B 2X6NA 5LL6d 3MABA 2W7OA 4RPFA 4F2RA 4O3SA 2RHQB 3A3OB 4OX6A 5IV3A 3D67A 3SEOA 2O3DA 1R7IA 3E01B 3F41A 4LRCA 5AQUA 4RBUA 3HVTB 5J1NA 4M0AA 4H0PA 3PUFA 4JS4A 1KEJA 3QT7A 1GLEG 5JVGL 3K75D 4DQQA 4M9HA 2QL7B 2XTJP 5KFZA 3M6VA 4AHCA 2HCFA 4YN3B 2Z2MA 2XWXA 4C11B 1KAYA 1NB2A 4ZS6A 4MH8A 3DGPB 4ECYA 1S6OA 2DO4A 4GNIA 4ERDA 1ECWA 5EE1A 4JS5A 1ZM2A 2BJEA 3WQPA 3TAGA 3GSDA 7ICJA 2WW4A 1HR0K 3U6FA 4KFBB 1X5OA 4YEAA 4HH0A 2JL9A 4F4AA 3ZFVA 4ILHA 3FE1A 4MFBA 5F3ZA 2B7CB 1ZQOA 1VHFA 2QK9A 2YMQA 1NDKA 2KEYA 4IH5A 2BJ8A 1QAXA 2PFOA 2WAQF 2R2RA 3RB0A 3ENQA 5A76A 3CERA 3ZSQA 4FCYA 4ACOA 4GC6A 1HNZK 4IXCA 5E33A 3QT6A 1QUVA 2DISA 2HQIA 5HJXA 4FNIA 1F44A 5IINA 2G09A 1KVAA 1VQ4S 1RBTA 2HI0A 4DU1A 9ICMA 1B0VA 2HNYA 4YOEA 2LU2A 3VZIA 1HNVA 1WBBA 4RNMA 3GDXA 3HT0A 4Q0BB 2KHDA 3N7SC 5FP0A 4YB1P 4J8FA 4CJSA 4DV1K 5ADXA 4TY8A 4GFJA 2HNDB 1SZPA 4WQ4A 3QAUA 1C0UA 3NGSA 1RT3A 1ATSA 3HD2A 1S4FA 5J1PA 4JI8J 2GCFA 3G10A 3MM9B 2VDHA 3OFEA 4PQUB 1SL0A 2C2MB 3VENA 3W2VB 4CHZA 3D2SA 1FTRA 2FBTA 2IOFK 3M8YA 4DLEA 3CULA 2J6TA 4LQ9A 3QETA 3JSMB 2VH7A 2ADBA 2OTLS 1MWMA 3Q8LA 3BO3A 2IAJA 3P3DA 3ULHA 4X4VA 3VAKA 2ZKTA 4CEEA 2IIHA 1FCAA 3DDKA 1VHXA 2R9LA 1WUAA 4Y28C 4R5PB 2JH7A 1E6YA 4ZP7A 4DV2K 2E1EA 3CCMS 1J5EK 3HRDD 1SBRA 4DBQA 4BBYA 2FHOB 2JV3A 2IVOA 4M3WA 4C9DA 3PACA 4NWIA 1YG0A 2V2QA 4KLEA 2LP4A 5FD1A 5CAAA 1TUYA 3A5NC 2X1AA 4BRPA 4IDKA 3FKBA 5CRXA 5HP1A 1YWXA 1PK1B 3GIRA 1TL4A 4ZH4A 5KPZA 5H9EJ 3QX7A 4V19S 1NLKL 1VLYA 3H5YA 3VEWA 2BYCA 3C8YA 2VUGA 3DDHA 5CXTA 1S57A 2Z1GA 4JBCA 1IG6A 2MUTA 2CJBA 3AJ1A 3R8YA 4ZCKA 1L7NA 3SSSA 4CIOA 1JJ2R 2NREA 4USKA 2MHEA 1SH3A 1XR6A 4OV1A 4BREA 3KJFB 1RAIB 2LI6A 3DXKA 1RAOA 3QYYA 4XH1A 3VAMA 1RT7B 1IQTA 3W2WB 1PJ7A 1J53A 3NBPA 3GYGA 3WK7A 3LGMA 4J91A 2YKQA 4AL5A 7ICRA 2OH2A 2QT7A 1C6VA 2FLNA 4PCQA 3GOIA 3AXKA 1XJWB 4F71A 5FPEA 5AM2A 4G1IA 4KBOA 3RJJA 3SMZA 4WU3A 3HOSA 1FEZA 2DNPA 1W9HA 5AKEA 4P0PA 2Z7JA 2YI1A 2F4VF 1PBAA 3J7AN 3QLHA 1RTDA 2DH7A 3J7YU 2I5HA 2FSKA 4HUEA 1N33K 3WK6A 1RT6A 4NZ7A 3WKBA 2JJ4D 4R79A 2Q31A 4RZRA 2J8AA 3J7A1 4LRFA 5J0RA 3QPIA 3UWTA 4M3ZA 4FWNA 2HMIB 2E2QA 5J2AA 4TQRA 5CYJA 3CC4N 4DSJA 3R3TA 3BEGB 3M2RB 3ILLA 4KGKA 5J0TA 2GVDA 2IRXA 2J76E 2ASMA 3QFUA 5AQSA 4UT4A 3RYLA 3IC1A 3LDLA 4MK7A 3PNIA 4UAZA 4AD6A 1FK9B 3M05A 3QBCA 2YBVA 1Q81T 1VC0A 3D3BJ 5C25A 3QMLA 1KTVA 3ATVA 2B5JA 1RYSA 3BS7A 3NVKA 4LD0A 4PXCA 4EI2A 2UUAF 1SJRA 2DNZA 2M0NA 2RHSB 3NE6A 4YD1A 3C6TB 6FD1A 2D41A 4O0NA 1GFWB 3RRHA 5DKWA 1EX4A 1HQ2A 4H5WA 4JN4A 2CGLA 2MY7A 1FT8A 3M8SA 1NCLA 2EAOA 4WP9A 4ZK7M 4MKVA 3DCAA 4X64J 5GINA 2BKOA 1U26A 2HVEA 2JEGA 2XSJA 2E5HA 5DJBA 1ZOTA 1LFWA 4TYAA 3G4SS 3QFPA 4PR6A 4CLWA 1VQLN 4CLFA 5LMUF 4K2XA 2AD9A 3PM9A 2ZXHA 4IQWA 3M7DA 3DRPA 2GJFA 1WC4A 3ZZUA 5L8RC 4X4QA 1RDUA 2EDUA 3MXJA 5KG3A 1XI1A 1NHUA 2BE2B 4I6YA 3WHIA 2QEXS 2H9ZA 2ZIVB 3OL9A 2XLKA 2R7RA 5ALOA 3RG6A 5A0YA 3H5XA 3HFZB 2HDOA 3F53A 5L1IA 3WNFA 4NLSA 4YHHK 4A57A 5K14B 2JSXA 1IBLJ 4ECRA 1Q82T 4JAXA 3V9ZA 3TAEA 1YJTA 4O5EA 3EICA 1HPZA 3VN5A 4JK1A 2F5GA 4I9LA 5BN8A 1R6VA 2N3OA 2N7YA 4RW9B 3W66A 3VVUA 1Q7YO 4CJVA 3DXSX 2CXYA 3CRXA 3KDOA 3ZNUA 3FZHA 3I6PA 1XNQJ 4FYDA 4PPZA 4CJLA 3RGIA 3HHLC 2OCEA 1X4BA 1OO0B 1C1BA 3K7RA 4LRAA 2OJ3A 4NB4A 2QFIA 3KDNA 2XYPB 2WONA 4IOBA 1HNIA 3ZSWA 3UE2A 1VQ8S 3A5LC 1JMTA 4UUWA 4P10A 3PX4A 2ALZA 3RU0A 3CSKA 2K89A 2PAVA 3SDEB 4QWCA 3GV8B 2BQRA 2HKEA 4JI5F 4WJBA 3TOQA 1VQ5S 4A2AA 5AIAA 1S9EA 4B9LA 4Y2VA 1XERA 4CHOA 5MAOA 2W01A 4JB8B 3KHRA 1DTQB 3H1QA 4KX5A 3VQ4A 2K4EA 2R8IA 4OYMA 1T9WA 3Q89A 3C14B 3PYDA 4NRTA 3AUOA 1TAQA 4N47A 2EW9A 4IS7A 2RU3A 2VQFJ 5KFFA 2HGNA 2V69A 2C28A 4OPKA 2W4CA 2YKAA 2K7JA 4JK7A 3VEXA 4CD3A 4ECUA 3BQTA 2WHEA 3ADAC 4FKXA 4KTZA 3QIPB 4EBEA 2RF2A 4TY9A 2EQYA 1ZXIA 1LWEB 3W8PA 1KLMA 3EVMA 4IH7A 1W2BR 3KK1A 4OLAA 2PA3A 1REGX 1LWFB 3OTOF 5KG2A 2Q43A 3U27A 4ECTA 2CGJA 1RAAB 3QT5A 8ICGA 1QHAA 1KHWA 3BSNA 1LCUA 4EAHD 4OZ3A 2BCUA 1U2FA 4I56A 2FJBB 2FJWA 4LF4J 2PMHA 1HBUA 2Q6BA 3V2UC 2WF9A 1TU0B 4O3PA 2AGPA 4LF8J 1UMJA 4AILC 4I2HA 1WWUA 4YCXA 1U1MA 1WSHA 2DGWA 1XMBA 1W0HA 9ICXA 4YQWA 4RBVA 3PG9A 1S0MA 4NA1A 4C2MA 1S1VA 4KBIA 4J9LA 2ALYB 2NXCA 2W03A 1A77A 4GMKA 3BZCA 3DI6A 2KIVA 3BQ0A 4H0VB 3QEIA 4WF9L 1IH7A 2V51B 1HBNA 2D3O1 4QYZJ 3K5OA 3QWPA 3CCJN 3CJCA 4I6MA 1XNRF 1U6BA 2O5DA 1HW8A 3QU2A 1OIAA 3QE9Y 2HS3A 4NI2A 2E88A 3QMQA 4B1WB 2EG1A 4HTUA 1KONA 3BJYA 3VQDA 1IXRA 3G2XA 1IBKF 1RDCA 4KHWA 2IS3A 3K5NA 2F4VK 4HR2A 4YFUA 2R7XA 5T7BA 3HD1A 5J2PA 2Y0SF 3OBIA 2WVEA 3MMVA 1YSJA 3IHQB 3E9OA 1VSHA 4BR4A 3JTPA 2M0GB 1KLNA 1LV5A 2YJFA 5KGWA 3OVAA 5IT9Y 3K4GA 2E8MA 2FSJA 4EFAC 3UNGC 4UY8O 1DGKN 5ETVA 1VS3A 1WUDA 2EAPA 9ICPA 2AP1A 3H0PA 1I6JA 1J97A 2J6SA 2ZUGA 1RA7A 1UPHA 1YZ6A 5K20B 1VQYA 1IJEB 3MGJA 2V8DA 2DO0A 4OYZA 2ZEJA 5D6GA 2CNNB 3OL7A 1OMSA 4DSEA 3G87A 2WFBA 5GAHU 4BUGA 1A5VA 1O6XA 3I5CA 3OYNA 2FVRA 1VJWA 3M8QA 3F44A 2AF6A 3AO1A 1MWYA 1IV8A 1ZQUA 2UUAK 3V6JA 1RT5A 3BN7A 4YDUC 3HKZC 3LP2B 2O1PA 4OYAA 1HA1A 1NJZA 2QWNA 5M1QA 1QSLA 3EWAA 2KL8A 4I6AA 1S1TB 3CPWR 1KVKA 3B4MA 1Q53A 2EFNA 3UPQA 1N56A 4I2BA 1FJGF 4QZ9A 2ATQA 4YDXA 2AJ0A 2O8EB 4JKGA 4ECSA 5J0QA 2OXOA 3KUEA 1NZPA 3IGVA 4RWTA 3OPKA 5AK4A 3ZD8A 4RX6A 3DJCA 2YNHB 2BGGA 4NLQA 2YQ0A 2QZ8A 1F1BB 2A3ZA 1PC5A 3LO3A 3RH5A 4L6V3 1DGSA 1Z2LA 3TR5A 4ED0A 2YMPA 4H5TA 4CEQA 4DV3F 4WXOA 3RJFA 3JB9k 4X66K 4AUKA 3AA3A 5DG9A 3DLEA 3JPRA 2NXJA 4KGVB 3KHHA 3F0NA 8ICMA 5AQTA 1VSDA 3I0RA 1P27B 4YS2A 4QCLA 2GBZA 2QA4N 3CIPA 3H20A 4F72A 1XMOJ 4W90B 4Y1CA 5ALIA 1BNOA 3O4QA 1Z25A 3IUCA 3TARA 2ASOA 5DS7A 4JI1K 3N01A 1VGYA 1SL1A 4Y2JA 3W9JA 2QL9B 3O0FA 2B6AB 4WFNQ 2RRNA 3QU5A 1SJFA 2CADA 4ITSA 2C2KB 1X9WA 3CXCM 3L95X 3H42A 5I3UA 3CCWA 1G3OA 3FDSA 4MFBB 2QW9A 3P31A 4FSVA 5KG4A 4F5OA 3SR6A 1XK8A 1BUXA 2D9PA 5ALMA 1R8BA 1G15A 1M1KT 4K4UA 5HMYA 2MZ1A 1IIPA 1VC6A 4M1KA 2E8PA 4M42A 2CZVC 2F8KA 4M6WA 1NK7A 1UEKA 5IIMA 4M9LA 4KITB 4ECVA 3ZX2A 2ESEA 4OGCA 5SWMA 2A1AA 1HNVB 4OJHA 5FPMA 4PZVA 3HVWA 2KT5A 5EHHA 5F8HA 1GLBG 1YRTA 3AA5X 4PGQA 4W98A 4JI0J 2FI1A 4GV9A 1U2VA 2QWOA 1CVJA 2W2NP 4TY8B 5AT1B 3CCEN 1JIHA 4BX9C 1C0UB 2P9SA 1F3FA 9ICIA 2G4BA 1NLVA 1XHXA 5JMVA 2PFFB 1RM6C 2C2EA 4BXOA 3VZHA 3AOBA 5U47A 3CCVN 2JH3A 3CJSA 5LJWA 1NPPA 3AGKA 2SXLA 2V4RA 4ECXA 2HS0A 1JL2A 3OTOK 4CEFA 2OPRA 3JXOA 1AW0A 2ETJA 1PUZA 4WF9Q 2W2MP 4L73A 2EK6A 4JI6F 1VQMN 4WPAA 2IAJB 2PYJA 3AD9C 2W8KA 1KL9A 3N79A 3SMPA 1WG8A 1NU0A 2H4YB 2LDIA 4BRMA 5EY4A 4B3SF 1HQEA 5AXLA 3WC0A 4OI3A 1E6YB 2DCLA 4BC4A 2W1BA 3CF5L 2Q0ZX 3M6KA 3KD5E 3UDVA 4LFCF 3F9MA 3OL8A 3QSYB 1WF2A 3EXCX 2IM3A 1T9UA 3VOVA 3CVKA 4IDKB 4DTXA 4CJKA 2QFJA 1WC5A 1ATNA 4WYBA 5HP1B 1O0PA 3BS9A 4ED3A 2V4QA 3L3UA 4EZ6A 1XQIA 3ISZA 3TADA 2VQEF 4YOVA 2VJVA 4X4UA 4DTMA 4C4RA 4KH1B 4I2CA 5ALQA 4BCAA 2MUTB 2BKEA 4PJ0U 1FD8A 4BGBA 2R8KA 2P1JA 3GLJA 5IT9U 2GAHC 3AVIA 5FRNA 1XNRK 3F2KA 1U02A 5M2UA 4M3XA 4NM1A 3MC1A 2KMDA 3O08A 3DXKB 3NOGA 2D0BA 1H38A 4XH5A 4FJGA 3UVJA 3VGLA 4CF3A 3BBFA 1IBKK 3NBPB 2EFQA 1FKPA 2CN1A 4LZGA 5KFPA 3IRWP 1L3UA 3CC4S 2YCHA 1DHMA 4OFZA 4DTOA 2JMGA 3QGPA 4NOHA 4RQNA 4K4XA 1J2VA 2VC0A 4XIUA 2DR9A 3KIOA 4D3HA 2E8OA 3HHEA 5KFLA 4HTIA 3V4IB 3MR2A 2H3FA 3EO3A 3CCLS 3CCRS 3FZBA 4P0PB 4Y2KA 1RILA 3KUGA 5T41A 5J1EB 4PYAA 4IR1A 2QGFB 3QLHB 1RTDB 3QB0A 1RWOB 2WZ1A 3OTDA 4U67Q 3QATA 1RT6B 1FFGB 2CQ3A 1ZRMA 1YKWA 1P9QC 2GELA 4LR8A 4TKTA 3LM2A 1FIQA 4IOCQ 1HNXF 5CYQA 3N4QA 2R2UA 3CCZA 4F2SA 1S12A 5DGAA 2HRYA 2IBOA 4HT5A 3DOKA 4PL8A 8ICSA 3QU4A 3ZZTA 4J2BA 4PEOA 4BRAA 3HJEA 2G1HA 4OZ0A 4BJQA 1HLUA 4WXWA 3RJMB 3ALRA 2HOFA 8ICTA 5CR4A 3RH6A 3IG8A 5ALVA 5GAGU 3O8WA 3DYAB 3BS5A 3U02A 3C21A 4Y2PA 1WOSA 4JD2B 2APOA 3W62A 1IM4A 3DV9A 4A48A 2XLIA 3TZYA 1NJXA 1EAYC 3MEGA 1P8ZA 4U6PA 4PGXA 5C25B 3C15A 2LA4A 1FJGK 3CJKA 4GKKJ 4IOAL 4ZP8A 2B5JB 8RUCA 4FO6A 4ZP9A 1YAGA 3VGUA 4JKFA 3H8MA 1LK5A 1S22A 2JDJA 3FZ2A 1OPZA 4FYXB 1IUJA 7ICHA 3E9LA 5ALDA 5HVFA 3KUHA 3LL3A 4FBUA 2OA8A 1VK3A 4HYKA 3LWMA 3BH7B 2RN2A 3PW4A 2BEFA 3R7NB 4ZJLA 2DNNA 1VJ5A 5DM7Q 1TQLA 1ASUA 4PAAA 3RJEA 2K60A 2UV8G 1HHTP 3UCGA 4H0OA 4JI4J 5IWAF 1SC4B 3EUB2 4K2JA 4Q45A 3CCUN 4QZGA 2IYGA 1WBDA 3NF7A 2XSJB 1XC3A 1UJ5A 4K5SA 1BPYA 1FFWB 5ETPA 1U2CA 3US5A 1U7LA 1ZQEA 3H40A 1UZHA 2N82B 4JKEA 3L4PA 3OS2A 4X4TA 2L9WA 3DRPB 1Q8IA 1PC4A 2F8MA 2DFEA 3VERA 1UPPA 4WP8A 4KJIA 1NGCA 2XY8A 4OVLA 4USWA 4CLUA 3W65A 4DTUA 4RW8A 3SQ2A 1DLOA 3T79A 2Z0GA 3PW7A 2ZH3A 4KYZA 5KFVA 4KTQA 2NLWA 3UQSA 2ZGZA 5A0YB 3K1ZA 1NRKA 2P9PB 4XDCA 3HHLD 2DGQA 1X4HA 4HCBA 1HPZB 1XBWA 2E9TA 2RIJA 2KZ3A 1QJHA 1WG5A 3DOLA 4MIWA 3D28A 5EX5A 3QUBA 3F56A 3S3OA 1FEHA 2QJ3A 1L3SA 3CD6S 1VSMA 3SFGA 1KVIA 3BB5A 3LANA 1C1BB 3T1YJ 3SD7A 3V7JA 3B82A 2JLEA 3K5MA 1RTJA 3MI7X 2WONB 5KFSA 2KHVA 3KKFA 4E7JA 1HNIB 4Z94A 4O44A 3R6MA 3LVWA 4IJAA 2VPYB 3NH2A 2A1BA 1DQ9A 2G8VA 2WAQD 4OYBA 3HSZA 1S9FA 1XMQJ 2EVZA 3AXMA 3CB4A 2W8LA 1W97L 2OUGA 3WNEA 2NRTA 3GFZA 3MTJA 4ZVUB 3KKAC 3CF5Q 2KVSA 4FJHA 4XQ8A 1NKCA 4XRHA 3G0ZA 5A0LA 2J4RA 1A6SA 4LF1A 2CJQA 3O2IA 1Q5VA 2NPIA 3ZTSA 2E8NA 3LVVA 3G6YA 3WQUA 4FW2A 1GLLO 5C42A 3PXGa 3W9IA 4C0BA 4KH0B 4KH4A 4BQZA 2W54A 4MDAA 7ICVA 4KY3A 3U9DA 2M8DB 2VONA 2HHXA 2O8CA 2G06A 2MKIA 1RT2A 2V68A 1CC7A 1BQXA 2MQPA 4F4YA 3OGUA 2YWFA 2J9EA 2RF2B 2MHNA 2LKYA 2M3DA 4KAIA 4B3SK 3I9V9 1SJ3P 1U1NA 3KK1B 4LFCK 1WKLA 2A3JA 4NYFA 1XIQA 2D3ZA 3U3YA 3X3UA 1Z6RA 4O3OA 1U6ZA 2VWBA 3BYPA 4DU3A 1BY9A 4JI7J 1N36J 4CCHA 1S6QA 1TAMA 5AQNA 4DHYA 2ZJ5A 4ZPTR 1K9MT 2F8SA 1WC1A 3BYRA 2Y1RI 2DEIA 2RILA 3HSJA 2RSQA 3BY5A 4CDIA 3HJFA 4X65F 3ETLA 2WCXA 2ZJQL 3ISNC 2ES6A 2YTUA 1J2MA 8ICHA 1N5WA 4P52A 1TELA 2A1RA 4KHRA 1N60A 2PMZF 5CHCB 4UBCA 1S1VB 4EMDA 2O4IA 2W43A 1BD6A 1WJ9A 2Q36A 4EO8A 4PWWA 2C3MA 1ZETA 3IMQJ 3CW2C 4YD2A 1DT9A 3ICXA 1CJTA 4Z6CA 2JFDA 3DI6B 3L6QA 1RBSA 1HBNB 3T1HF 4HHJA 2DGUA 1IBMJ 3D2EA 2JRSA 3U7JA 1TKDA 4I6MB 2FY8A 3LTOA 1WTBA 1CZBA 4FOIA 1FW6A 5AM1A 1UZDA 4ZN3A 2F65A 2JWNA 4NI2B 2F76X 2YNGA 3RB4A 2YMLA 2GGPA 3HJVA 2KW4A 2YQEA 4CNZA 4OJ3A 1LNQA 3QBWA 3JAMO 3GILA 2H3IA 1GXUA 5FRMA 1S7HA 3HL8A 1HI8A 2CPZA 1DEJA 1YK9A 3HMJG 1VQ9S 1BHLA 5B08A 1FF2A 1WNEA 4BC9A 4NZ0A 2P35A 4CGHA 4NYZA 2EFOA 4ZVOB 4JI8K 2HFUA 3OV7A 3AA2A 2DEJA 2CQHA 1S0NA 3N9UC 1NMDA 4ZVTB 4JKBA 3P5BP 2QMUB 2DF4B 1FERA 3K57A 1KD1O 1VBKA 2MSSA 3CJBA 3MEDB 2CPYA 4UOCA 4HVZA 1QUPA 4OI6A 3CDEA 1N5VA 4C97A 3NL0A 1N5YA 1BO5O 3Q7BA 4BE1A 5DB7A 5J0YA 4OZ2A 4ZA1A 5AFUH 4FZMA 4PWUA 3N4PA 5CA5A 4DTRA 4KI6A 3UDEA 1GLAG 5JMNA 4LBPA 3K5PA 1L6NA 4K42A 3M8QB 2XWYA 1CBKA 3AB2B 3BSCA 1HKCA 4ZPAA 2CRXA 2PEHA 4LIWA 1LB2B 1RT5B 4JRQA 4LSLA 4ATNA 4OV6A 4WZQA 1DJ0A 2CPEA 2OFGX 2Z57B 2XYHB 1G7CB 1HFEL 3UNYA 2YX7A 4WQ5C 1TP7A 4QU6A 1UVKA 3BEXA 1U1KA 3CHWA 4H0TB 2XY7A 3V6DA 2OSRA 1SC1B 5CEHA 2QSWA 2V8VA 4BR7A 1BCOA 1DFDA 4JKGB 3Q7CA 4OX9J 2F1JA 3O4NA 3HULA 4BRKA 1XO0A 4ZMMA 1VBZA 1E3MA 4RUBA 3CDUA 2B21A 3AGRA 4K7QA 4LJMA 7ICFA 1Y64A 4K8RA 5IT0A 3VEYA 3WNGA 4DPYA 2XZTB 4RCHA 2CKWA 1APSA 3B8AX 3H90A 3AO2A 4EZ9A 3SMSA 4C1NI 2XSFA 3NMUA 2CPJA 3O1BA 4BG8A 5K5MA 1V4SA 3NNCA 3H4BA 2D0OA 4CK1A 5EX3A 3DLEB 4NZ6A 3EJMA 3OTBA 4K8ZA 5GMEA 4RJVA 3O6QA 2FLPA 3QNOA 2XRIA 3I0RB 4RQ6A 4BG9A 2CIMA 3G8SA 2W4DA 4PG4A 3C6HA 2CQBA 3P4UB 4KHSA 3CIZA 3JQMA 4LF6F 3LZJA 4LVNP 4K4ZA 3OW2M 2BJ7A 3LAKA 3TAMA 3SNNA 1COKA 2PXIA 3VESA 4B3MF 3KTQA 4FJNA 4Q2LA 2FLOA 4CHYA 4DPUA 3T5LA 1KN6A 4K4IA 3EGNA 1T3OA 1NOMA 5HSPA 1SZHA 3I28A 4N8OA 4BC5A 5KG5A 3GIMA 2BKNA 2XQCA 5EOYA 5I3UB 3JTOA 3HSGA 5JRTA 2B9YA 2R4FA 3ISDA 4YDDB 4YUDA 3BF1A 3A5OC 2LQ8A 4LRBA 2V5HG 4CW7B 4CFBA 3J81O 2X1FA 2LXIA 4B3TJ 5DGBA 2OMLA 2QX0A 3TJ9A 2CPXA 4NO7A 4Q5VA 1X4AA 5KAKA 3N28A 2E29A 1PJ5A 2HVDA 3SV3A 4M6WB 2EBEA 3CT9A 2AA4A 1L7MA 1ZAXA 4EUVA 3PFEA 5F2RA 3DXMA 2VG5A 4OKKA 2ZJQQ 4FJKA 3V9SA 4OYPA 5F9LA 1U2VB 5DZ7A 1J27A 1NGDA 3LM9A 5HAOA 4X64K 3VCBA 4M3UA 4E2FB 2G8WA 2F1HA 1RWWB 1UJ4A 2HBQB 2F1IA 3C46A 2RS2A 1LOTB 2R42A 1VRUA 2P9SB 2K8CB 4KLLA 5HI7A 2JHEA 3VALA 1G99A 3PLAA 4BXOB 2EFGA 4R64A 3RZAA 4CZCA 1ZQFA 1UA0A 2LQBA 2VD3A 2PKEA 4B6JA 4KH5A 2MKYA 4UOGA 3IP4B 4QZIA 3FSYA 1WUUA 4F5PA 1FRMA 4IRDA 3WK4A 3QQCD 5H1SV 4H03B 3RTVA 4GXKA 1HQEB 2E2NA 4B08A 3OTCA 3MWTA 4NYOA 3E58A 1VJQA 1IBLK 3QERA 1RTHA 4LREA 3D1OA 3OYHA 1ZQPA 3QEBZ 3QO9A 3LPUA 3IR7B 2XYGB 4CZGA 2YNIA 5HQMA 1YJ7A 5DDPC 4DR5J 4M2YA 2EK1A 4CLKA 3M6GA 3V6KA 2KOBA 2NV3A 4IKAA 1WOQA 4IQVA 3TAPA 5A8WA 3SCJE 1XUPO 1YI2S 3M6ZA 5BR8F 4RUCA 2GUPA 2GWJA 1Q95G 4M5LA 3TI0A 5D46A 2WF7A 4MN4C 1T44A 5J2EA 4USMA 1OSCA 4PABA 4OL8A 1I39A 3UVJB 5DQGA 1SV5A 3IM1A 4DFJA 3L3FX 4WTYA 1HNZJ 1YIJS 3UQ0A 2DQNB 2HF3A 1FKPB 2IFXA 4IYQA 5KGXA 4F3QA 2LEPA 1XN9A 1PBUA 3C1ZA 1MA7A 2IM2A 4M41A 2D69A 4CT8A 2AJFE 4RT2A 3F5EA 4JWMA 1W26A 2ZE2A 4N56A 1YJNN 1NGBA 3AEVA 1Q16B 1EKRA 3UDCA 2UUBJ 1D9DA 1N5TA 3GR0A 4E8UA 2VQFK 4M63C 1HUZA 3C3LA 2MMYA 4DV1J 2BCVA 2Y0SD 3KJQB 4YR3A 4NYPA 4NA2A 1KFTA 2FLLA 3BZKA 4IBNA 3VGKA 4P0QA 3GIKA 2NRXA 4G3IA 2KH9A 5AK6A 2KKHA 4IFYA 2HS4A 1X6IA 2VB6A 5HMWA 5CYQB 1CJKB 2DGVA 3G8QA 2CDQA 4LF9F 2GWSA 2DNQA 3DOKB 1RZTA 3SMVA 1JNZB 4DL3A 1KKXA 4DQ8A 1VDVA 1T9YA 1UAWA 1KCFA 2VKRA 3NCPA 4DKWA 1SKSA 2DTUA 4M5DA 2DNGA 1YJ9N 3MMJA 2KKVA 1MDUB 2PA8D 2WOMA 1FVSA 2FSNA 1F2HA 4OIXA 4E1NA 3BS5B 6AT1B 4DV2J 4LF8K 4H0XB 3CCUS 4ED1A 1J5EJ 5D0HA 4U96A 5ALUA 3N6NA 3P96A 3MEGB 3I9ZA 2XS2A 4CO4A 4XUSA 2V9WA 1UPMB 2YWWA 1MROA 2B0CA 2GHVC 2GMLA 3C15B 5I42A 2DNYA 3CJKB 1JJ4A 3KHLA 3GYXB 3Q8PB 4JV0A 1JLGB 2FZGB 1BL3A 4ZLNA 2WF6A 3N5FA 3H98A 3SPZA 3TADC 3CJ1A 3QNNA 1NOYA 3R7SB 3OYLA 4CLPA 3BKUA 3D66A 3MUTP 2D6FC 2WF5A 2ZUCA 2MZJA 4I2EA 1SVDA 5AKYA 3KG1A 4H8KA 1SIWB 5T7LB 1WYGA 3VQPA 4MKAA 4QR1A 1UP1A 3B78A 1LQ9A 1GLJO 4DG1A 3B9JA 3NVWA 4PGYA 1K73T 4IFEA 3LPEA 4CFCA 2C2DA 2GO8A 2QL5B 1H6KX 1IG9A 1QQ5A 3D7EO 4OPJA 2VHGA 3CMQA 9ICSA 2CFXA 1NHKL 3AVHA 3D6TB 2KICA 3PYFA 1T05A 4LF6K 4WFAQ 4RLEA 3TAFA 4K4WA 1WEYA 2EWHA 1WG4A 1NDCA 4DX5A 1FA0A 4AH9A 1NOZA 3UKRA 1YITN 1RHUB 1QCKA 2VCPA 4B3MK 2A19A 4RW8B 1DLOB 2KZMA 1K44A 3V4MA 5C7PA 3AV9A 1FXRA 1N33J 1N34F 2D9OA 1EO1A 2CPFA 2IMOA 2KG5A 5TKYA 1TFRA 3QEVA 3PNCA 9ICGA 2NXNA 3SBMA 1D8LA 2BW7A 2KG0A 2EX3A 3DOLB 1RBVA 1WHXA 3AVCA 2DTJA 3SQ1A 4L74A 1GLCG 4BDPA 2F1FA 3DOMA 4M5JA 2KN7A 2EI5A 4CEBA 4I2PA 2GC8A 3TTFA 1RTJB 4OLPA 1HBMA 2GUIA 4RQ4A 4EFHA 4O44B 1JLCA 4R8UA 2V7ZA 2DH8A 4KX3A 3KLIA 4DR6J 4BGAA 1VYAA 1N32F 2Y8YA 1L7OA 4EO6A 1VI7A 4AL7A 4UAWA 2VC1A 2IM1A 4DI6A 2ASPA 1MLAA 3THYA 1IM6A 1JKHB 1YX2A 4YFKA 1LVHA 3AAPA 4RPZA 2DL0A 3UQ2A 2GLEA 2V94A 3FC9A 2MZQA 2O8BB 3ZDBA 4J5OA 4CEOA 2K3KA 5C42B 2GFFA 4NEYA 2QMXA 3DNCA 2RKIA 5F0UA 2E44A 1PILA 1S4EA 1KN5A 1EX8A 1SIJA 3KJNB 1K8AO 1BLUA 1WI8A 3TTCA 4DV6F 3RRKA 2HHPA 4GO5X 2HPUA 2MKHA 3WXMB 2MZSA 9ICEA 1B43A 2QLFB 3R6LB 2UP1A 2ZC3A 2HHUA 3NS5A 1RPLA 3HM9A 5C5JA 3TSUA 2MU2A 2MJUA 3IM8A 3KJVA 3ISND 3ZSRA 5AQGA 4J2DA 3R9PA 3SQOP 2G9OA 3JPTA 1LK7A 2FJEB 3K0SA 4M3YA 3P38A 5M1NA 3AHPA 4RWWA 2UXDF 1A0PA 2RS8A 5BR8K 2AJ1A 3CJ3A 1NNLA 4EU0A 2CQDA 2QLJB 3ENAA 3TNVA 2ZOFA 2MEWA 2XB2D 5LL6Z 4M7XA 2W25A 4TU8A 2CDRB 2OD4A 3MDFA 1RHRB 3N4WA 3PW5A 3H2UB 5GAEP 4DTNA 1UVNA 2C3OA 3M6XA 3JXUA 4BR5A 4OJRA 4TYBA 1CJTB 4NMLA 2C1EB 2HIYA 5B0FA 1JQGA 2GO9A 4I28A 4NXNF 2W2PP 5D78A 4BRDA 3UXOA 1Q4RA 3D2EB 5DLGA 3WU2U 1Z00A 4QIEA 2YWEA 2OM6A 5F9NA 4DS5A 2K8AA 1RDRA 1FNMA 1FHTA 2YHWA 4GXIA 2YNGB 3P4IA 2IJNA 4BGDA 4JI0K 2GGPB 1HUXA 3IG1A 3DWLA 2OAUA 2RQ4A 3U1LA 4ENOA 9ATCB 1WF0A 3QIOA 1ZQYA 1N61A 1RHJB 5HMXA 2D0AA 3HW8A 1PYOB 5HRNA 4NLKA 2NZCA 2KXNB 2C3YA 2O66A 3LDPA 2MQMA 3UW1A 3CCSN 4GKJF 4BRCA 2LFVA 4O3QA 4AQYF 4W5TA 4YB7A 3D6RA 1N5YB 1XTZA 3MXIA 2VG6A 3KOOA 2ZBRA 4CLYA 3T9ZA 2ZNYA 1WAJA 2WBRA 1XR5A 5DM6L 3WDOA 2ZHOA 4PXEA 4RQ2A 4J9KA 2QI2A 2KVIA 5EOZA 4CJEA 4GMJB 5E0OA 4MLHA 4CH0S 2KTQA 1KFSA 4C11A 2MSNA 3DGPA 3LW5C 1MNEA 4F67A 1EXQA 1YVFA 4LSLB 4DJBA 5ETMA 5HNKA 4JV5F 1FRJA 4DF4A 1RWXB 1C0GA 1FO1A 4CM2A 4QIVA 4Y65A 5ADXH 4BRIA 1U8WA 1CS4A 3ZTPA 4OD0A 5KFRA 3RBZA 4GLXA 3VQCA 4MJKA 4KHPF 2YX8A 1X9MA 3PR4A 3B8HA 1Y10A 4FPBA 1NNEA 2HVHA 2YKMA 1KOOA 4UB4A 2M52A 3J7ZO 1BWVA 1VQNS 5AFUA 3HP9A 4DO9A 2K3IA 5AQYA 3THTA 3HILA 4HEA9 1TUVA 4RQ3A 2H3GX 1JJ2M 2VV5A 4IKFA 3RBEA 1S72N 4NV0A 4WYLA 8ICAA 2DHSA 4ES2A 1VSFA 4F92B 2XICA 3CWJA 4HI2A 4J9UE 4RNNA 3BKTA 1KXPA 3UI3A 1IKXA 4RUHA 1X9JA 1KQGB 3PO4A 2F4VJ 3UXPA 2ASJA 5JU5A 2O8DB 3HX0A 1GMWA 2NUBA 2AX1A 4M8LA 4QQBA 5AXMA 3MMAA 5SUHA 3QEPA 2XIDA 2OEHA 1BE4A 3JS6A 2VGNA 1D1UA 4CRXA 1U4BA 1O51A 2AEFA 4GVLA 4ZVHA 1YJWN 3TAMB 4UB5A 1B0XA 2VKZG 2Q6CA 4AT1B 3P6YC 1KOHA 4F3OA 4JRPA 2NPFA 2FJXA 1H73A 3TEHB 3SUQA 4ZCMA 4FYVB 2QTWA 4GY2B 2YKPA 1WAFA 1VQKN 1FDNA 3OY9A 5BR9A 4UQGA 4P75A 5DQHA 4NLDA 3TUIC 4FZYA 3OVSA 3KMSA 5J2QA 1CZ9A 2AW0A 2C2RA 1EB0A 1ZAVA 3LYSA 4QW9A 2XNRA 2WFAA 1N32K 1HYZA 1YQHA 2QLWA 4FLVA 1Z19A 2RQCA 5ALGA 2UUAJ 4U7UD 4ZIVA 4HACB 3DLKA 3CUNA 1ED1A 3JSBA 1BPZA 2K06A 3KBBA 2ZBCA 3J8AA 1ZQWA 9ICJA 4CLTA 4C7ZA 3CJ7A 1OY9A 2A5XA 3L7PA 3FZMA 4LH4A 2PT0A 1WN7A 3FSXA 2IVFB 3DXMB 1M90O 2VG5B 2JC0A 2HYIB 3HFVA 1LXJA 4B9VA 2Z56B 3FNNA 5D8HB 5H1SQ 2DY9A 4JI4K 2LQ5A 2DK2A 2OFHX 1MWQA 1X1PA 3AVFA 2EXUA 2G8UA 1VRUB 4DV6K 3QIDA 2CJXB 1WB9A 2DFLA 2KJWA 5LMUJ 5AQPA 3V5RA 1C0TB 1SAZA 2GS8A 2V2KA 1X66A 5H9FK 2E9RX 2QTDA 2P9UA 2EPIA 2O01C 1UWBA 3T3FA 3N0VA 2RMLA 3AJ2A 2FVCA 3Q8QB 3IXQA 4BC7A 3S8SA 1FRKA 3GSIA 1MC8A 2Z2LA 4QBUA 3EY1A 2AGOA 4F02A 3MMBA 1VLBA 2UXDK 3CMES 2V8PA 1RTHB 2HURA 2R8HA 3QO9B 4J90A 3IRXA 3KG0A 2YNIB 3ENHA 3UB5A 1KDHA 5KOWA 3F9KA 4NXZA 1Z05A 5EWFA 2HMIA 4PHPA 3V81A 2HFNA 3ZZYA 1OVYA 5AQWA 4R63A 3IFRA 5A8WB 4WTOB 1RXWA 4C0HA 4NXNK 5IIOA 4NXMF 5IOLA 4IJNA 3A8JA 5AM3A 4WFZA 4CF1A 2PMZD 4K4HA 3Q83A 1XMQK 2EKYA 2EZXA 3NF9A 5KPTA 1MMDA 4CK2A 1U1OA 4FE3A 5KQ8A 1NK0A 5EWGA 3L9ZA 3KWGA 1WWHA 4JI5J 1QQOA 1SV5B 3LGHA 3DLLL 2ZIWA 2IRYA 4K0KF 5EE0A 2FHJA 1SH2A 1YXQA 1JJCB 4PKIA 3NTUA 1VQON 3AD7C 4QZEA 2F9TA 1ZBLA 4I2QA 4RR5A 1RAFB 2YTCA 3M4XA 1Q0NA 2ZE2B 2AMCB 5K8MA 1CPZA 3ZDCA 5D49A 2OP5A 4DX6A 3EE9A 3EPGA 1ZBSA 5AJ3F 2F3NA 1NK8A 2ABYA 3CQYA 3M2UA 4LF5K 4FLYA 4GKJK 2MJNA 1MSWD 4AQYK 3OD2A 2OANA 2MKCA 4P0QB 3HBTA 5F1XA 4G9ZA 2Y3YA 5D0EA 2YH1A 4USJC 4PPXA 1RI7A 4FJ5A 4IFYB 2R8GA 1X6JA 2RB7A 2CQ0A 3QGHA 4P2FA 5KFHA 3SK3A 3OTOJ 2QARB 4PUOB 2ZOMA 3K17A 4DV7F 4ELTA 1F6TA 4H4KA 2RLTA 4ED8A 2HHWA 1GOAA 4IEEA 2PD1A 1BWEA 5DG7A 1B92A 4C23A 4JI7K 1N36K 2K4PA 2VWKA 3HVAA 4OMFG 4M5DB 3Q8RB 1S97A 3QJJA 4A8WA 2DY4A 4DPWA 4Y2YA 5T14A 1W2BM 1VR6A 2WOMB 2DHAA 2KHOA 3WXLA 2BDPA 4JV5K 2NRRA 3V7LA 1JXBA 3BSOA 5K14A 1FDDA 4MF8A 5DQIA 5ALPA 3C7NA 1IJJA 2Z1IA 3A8KA 3SJHA 2LYAA 1XNSA 2F8LA 1MROB 1F3VA 2VZ9A 3F5TA 4KHPK 4JV1A 5I42B 2PYLA 5E5NA 2BA9A 4BE0A 3E2EA 1OH5A 2E1PA 2R18A 1VOMA 4ES3A 1K5OA 4FK4A 4DTPA 2B4OA 2ZZTA 1JXVA 2XM3A 3KK2A 3AOCA 3ZSOA 4KE5A 4BRGA 5DDYA 2CNOB 2HFOA 1IBMK 1Y4ZB 1XNRJ 5LM7E 1ZQZA 4AFFA 4FJ7A 2D3DA 3I8DA 2ODGA 8AT1B 2B9XA 4DHVA 3O9RA 4G1PA 1T02A 3BGRA 3AU6A 2IVYA 3AOAA 1RHQB 1IBKJ 4DG1B 1KQQA 1S49A 4KPYA 3ZLJA 4M7YA 1R31A 1D5AA 3JSRA 3H2VE 1VQ7S 4N77A 4DL7A 4QWBA 7ICKA 1VQSA 1OSDA 2JC1A 3BZQA 2I2YA 2OI2A 4MQ3A 2F8HA 1HBOA 5CZXA 5J0PA 4FFDA 5JICA 3M6WA 3G6VA 4NLWA 5KL8B 3KHGA 3SQIA 3UKRB 4DR3F 2FYXA 4F93B 4FLUA 1U09A 1BQMB 2DXDA 4Y2XA 4RPYA 1DBDA 5BN9A 4JP8A 4Z0UA 3GMGA 3T9NA 1VRTA 2HFVA 3DRRA 2YVSA 2KHQA 2RDDA 3PR5B 3BR8A 3K9KA 1GEHA 4UB3A 3IBCB 4DCPB 2G2YA 3SFUA 2ADCA 4RU9A 1M1GA 3SUNA 1TFYA 3D45A 3FBEA 1J5OA 5M1PA 1A0OB 3AL0B 3D2FA 4TXSA 4FOEA 5KG6A 4FPIA 3DOMB 3TSPA 4G9BA 1PAEX 2IHMA 3RR7A 3CCQN 1VBXA 4I2PB 5AI0A 1WG1A 3AH6A 2B8PA 4GVMA 3M7VA 1PK3A 2O4GA 1Y88A 4WK3A 3ZT2A 1HBMB 3VF0B 1ZTWA 1JCEA 4JKDA 4KKOB 1JLCB 4R8UB 2RQKA 4FWRA 2A10A 4DFMA 2HK3A 4MHVA 5DB6A 5KFCA 1ZQSA 1NO8A 1FJGJ 4E0DA 3AU2A 3NLCA 2YKNA 3THYB 4Z6FA 4OX9K 1OWXA 3SIPB 1NI3A 2PFDA 5KRTA 2DNRA 5CR0A 3PJ9A 1TGOA 4DOAA 3CPWM 2IOHA 1I3AA 3O9UA 3D6FB 2GW8A 4I27A 2HQDA 2D5RA 3ET6A 3KVGA 1ZYQA 1JXLA 1QVGR 4DV3J 1QQ7A 3OYFA 3BQ7A 3KD3A 3D6MB 3V7KA 3BQ1A 7ICIA 2RH3A 5FLXY 3K9JA 3PSFA 2DGSA 3Q8UA 1DOQA 4FP9A 4KGZB 4DR2F 4KQZA 5HL7Q 2OSQA 1F2GA 2KM8B 3CJQA 5A6WA 3DLLQ 3JS9A 2NRZA 3M1YA 3MXHP 2RU9A 4YOYA 5LSRA 3OT9A 1HHQA 3KJVB 1WSVA 4KN4A 1ULRA 3PYGA 2E1RA 3DC2A 2DNOA 3BDEA 4DV5F 4EP5A 4ZOSA 3VAHA 5B0BA 3VA0A 2AEJA 3MDQA 1IR0A 1X60A 2NYIA 3L4IA 1RQ0A 4CO0A 4IDHA 2X6SA 1WCLA 1BGXT 2KJ9A 1PCAA 1Y97A 5IXUA 4FM0A 1RDFA 1R8PA 3T1AA 5FJ4A 4LFBF 4AE5A 1B9FA 4OO1J 4LBIA 3UFCX 1M5VC 1X4DA 2W7AA 5KT7A 4AP9A 1RK8A 1KVJA 4CD1A 1PYTA 3D4JA 4CIFA 3RMDA 1N5QA 3LP2A 1FWPA 3K8WA 2WBNA 4LSZB 1N62A 2KD1A 1Z00B 1Q81O 2HGMA 4GO7X 3MWPA 2HWHA 1QQMA 1S5LU 3NCRA 4I2IA 2EAMA 2W9CB 2CG4A 2FC8A 2MSTA 5F8MA 3DLGA 3ILOA 1U1QA 2HHHF 2RJZA 9ICBA 5AJ3K 2OIHA 4DQSA 8ICFA 2HGLA 1WDDA 1HKAA 3E0FA 1H72C 3PEJA 2YH0A 5C24A 1FX4A 4OYIA 2P5VA 4CJWA 3W5XA 4H5RA 2V34A 3V1OA 2R8JA 1ZTTA 1YBTA 1DK3A 2DNMA 5GMKa 3LA0A 1JLBA 3CC2N 5AQQA 3TZWA 1CQMA 3C6UA 4DV7K 5KOXA 2YQ3A 4PWDA 5IS2A 2PY5A 1C0MA 4FF2A 2KVCA 2KJVA 3P45B 2H65B 4LR9A 4JI6J 3CC7S 2B4PA 3HK2A 3CJ8A 2H3QA 5KFTA 2OD6A 3OPXA 3MEKA 2VG6B 3D54A 1ZM4A 1KQSR 4B3SJ 1RDDA 3C2KA 9ICAA 4F50A 2I1RA 3CPEA 3PRVA 3P5JA 2QA2A 2HB5A 2GJIA 4O5FA 1DQ8A 1DARA 4LFCJ 3VR1A 5TKWA 3AODA 1T6CA 2KM8C 3I31A 2OTJN 3SEIA 1TMJA 3D0IE 1O1WA 1LW0B 5AQZA 1PO6A 4FF3A 4DR5K 2YY3A 4CO2A 2VQEJ 3R5GA 2B6AA 3MPDA 4IH6A 4J2AA 2IVPA 2KK0A 5F0WA 4C8YA 2HAFA 1Q82O 2E7VA 1S5JA 4B3RF 3VQ6A 3TW0A 5CQGA 1CS4B 5AI8A 2AH5A 1S8OA 1IO2A 2MQOA 3MTKA 4KLHA 2GVZA 2DGZA 4FLZA 3UPFA 4ES1A 1M5SA 3D3CJ 5BYQA 1ZBIA 2YKMB 4CO5A 9ICCA 3MZIA 2QWLA 4J9PA 4BWJA 2COLA 5KFQA 5D4BA 4DOZA 1I94F 5KFGA 4M3TA 4TLRA 2ZTCA 5EGYA 2N3LA 3OQ2A 4NL9A 4ISGA 2MZRA 1R3NA 5K8OA 2H54B 5KFIA 4Q43A 4BRHA 2FBYA 1UAXA 4UQTA 1K8KA 3K58A 2UUBK 1LW2A 3OYKA 4KHMA 1IKXB 4KRFA 3NP5A 2P6RA 3GZ7A 2B9WA 3EN9A 3RJHA 2DKOB 4USIA 2F2AB 1UT5A 4RWXA 3MMAB 2ZXIA 1K47A 2K8GA 4ZVEA 1FEEA 1RU2A 2KP7A 2YKOA 4U95A 4P7TA 4CJ5A 4WFBQ 3PIOL 3I55N 3H3NO 3SJJA 2WB1F 4ED6A 2V63A 1FJ7A 4FZLA 4P2XA 5IC4B 3KZXA 3BGOP 5AKXA 1G6BA 3RBXA 2OEKA 1ASWA 3OYAA 2ZHBA 2P9LA 4YR2A 4JI2F 1H3DA 2I8EA 1FWKA 3KWIA 3FFIA 3S41A 4Y0WA 2KT3A 3SV4A 5E3AA 5J2QB 3ILJA 2DNKA 4DL5A 3WBZA 3M3ZA 2QE5A 4OHXA 2G2ZA 1U0HA 4OKEA 2IHNA 2WRMA 5FLXU 3SAFA 2PI4A 2R7WA 2R7UA 3HVRA 1ZM3A 2QG9B 3HHKA 3RAXA 3SXLA 2IM0A 1Y0HA 4BLGA 2A40A 3DLKB 4FS1A 1BA1A 2VBWA 1OYDA 3OTEA 2AYGA 1ZPVA 2KU7A 2VBYA 4IO1A 4FWOA 2E1AA 4UF4A 2HBZB 4UB8U 9ICNA 2VFVA 2B4JA 2I7PA 3K0JA 3EGVA 4B17A 1S9GA 2ISOA 4JNEA 4CESA 3CJ0A 2X1BA 4BDYA 3CMAS 1KVBA 4ELUA 4YXMA 1COOA 2J7WA 2RPIA 5IWAJ 5AKGA 3DM2A 3HSDA 3I96A 1SI9A 2OWOA 4PQAA 3GCWP 4XH4A 1Q79A 4DR2K 3TP2A 3L0QA 5IT9O 3QRRA 3MDCA 3ID6A 2FF3B 1ZQIA 1ZJNA 2P9UB 1YT3A 4F9OA 2PGCA 3V4IA 8ICUA 3QT8A 4YY3F 4K4YA 1VBYA 2UU9F 3JPNA 3HPOA 1UWBB 1NSAA 5BRHA 2UZAA 2KXHA 4F8RA 3I82A 3NH1A 1QQ6A 5J1EA 3H6EA 3QESA 3G71N 2XY6A 1FO4A 2XS7A 4Z37A 2B8QA 2CQGA 4DV5K 3MMBB 5E26A 3P8BB 3ZTOA 4CI0B 2EEYA 1SUQA 3H5SA 2G8HA 3WEEA 4L8RB 3IRXB 1N88A 3TWHA 3LP1A 3MN9A 1FE0A 3OYEA 4AHVA 4TVAB 3MCAB 3V81B 4KLJA 4CM0A 2P8IA 3NGZA 4J9OA 4CGIA 1X42A 2ZF5O 3NOCA 3QINA 4CIEA 1E6VA 3A8YA 1RKIA 4R66A 3C66A 2BCQA 4UB1A 1WCNA 4CLSA 2U1AA 2J5AA 4IFVA 4E7IA 1C4CA 3LUYA 3U4LA 5J2CA 1ZQTA 1VQ6N 3DYAA 4EWTA 2ZD1A 4CZJA 5GAEI 1A6LA 4JD2A 5AICA 1IWAA 3IDWA 3C2MA 9ICWA 2HVIA 4M5MA 3EE8A 4QZAA 4DR6K 5BPCA 3CQ8A 4QIWF 1NEEA 3FMBA 2HHHK 1CLQA 3MMCA 2ZIWB 2KRRA 2QLXA 4BS2A 3QRQA 1BCMA 3MCOA 5CABA 1N4LA 1NKBA 4CJ3A 1DK2A 4YNQA 1ZQNA 1NJYA 3OJSA 3MURP 1BG3A 2V7YA 4I2QB 1KDNA 1Z26A 4C6AA 2GX8A 1MN8A 4UB6U 5E3CA 2JZBA 5HVGA 2E9ZA 4OI2A 7ICTA 3JPSA 2BCSA 1BDGA 1XO1A 3DU6A 3M2UB 3R5JB 5ETKA 4USTA 2VA8A 5F8LA 2KQ2A 3C5FA 3OVBA 3ZNJ1 3ZX0A 4O55A 4ED2A 1S5ZA 1S76D 1FFSB 1WHYA 4PHDA 2R7YA 1FVQA 1C2PA 1HKBA 4YMEA 2AGQA 3TEGA 3MM8A 4JI3F 4NPOA 4IEIA 4FZZA 2AU0A 2E5GA 3S6JA 1JK9B 1N54B 4F5RA 5KFEA 3SSRA 2XY5A 1WWVA 4EELA 3QU7A 4JB3A 3THXA 3VAGA 1T03B 4J2EA 4W4MA 5J2KA 2B9EA 5E41A 4Y1DA 2KV2A 1GQEA 2YB1A 4RBTA 3R2DJ 4M9NA 5C2GA 1YF5L 4YORA 4ZIWA 1ZQHA 1QY7A 4UAVA 4QZCA 2E5JA 2YPYA 2EH9A 4P74A 4FS2A 4X65J 2P9PA 4I2FA 2BV3A 2G1DA 3C7NB 2IOFA 4DL0C 2X74A 4A8XA 1A76A 3VQ8A 3G6XA 4BRQA 4HH1A 4DTJA 2B56A 4FL9A 5DBAA 1N6QA 3D2WA 3EKUA 4O3MA 3PIOQ 2BR0A 5K8NA 2D4WA 4TUSA 1Y5NB 3KK2B 1SXLA 3I56N 2V50A 1R0CB 3T1HJ 1FRHA 1Q9XA 3SYZA 2PFUA 3GFXA 1NDLA 1YGYA 2E5LF 2EBGA 2P51A 3R1LA 5I3QA 1NBEB 3TABA 1B7FA 7ICQA 1Q8BA 2CGKA 1HEKA 4HL9A 2OPPA 5CD4H 3LWLA 1M1KO 3ENWA 3BGRB 3K1RB 3QFWA 1RNHA 3G9CA 5GTHU 2I6XA 1WSRA 2D8CA 2DR8A 3CNHA 3B4DA 2WAQC 3ONNA 2QWPA 4C48A 1FXLA 2HSEB 3L2WA 4Y2RA 1FRLA 2BGWA 8ICLA 4PYDA 4CLZA 4ZPVR 1HBOB 2XMVA 1MN7A 2CA9A 4WFNL 4IQMA 4O9MA 4DMZA 2XHCA 3FVYA 1G1XA 4CFDA 2VKQA 4I2JA 1EQYA 2XMTA 3L2RA 2H3ZA 4CZFA 4FJXA 2BQUA 2P9IA 4IWVA 1SQKA 2L5YA 4H5NA 1VRTB 1BOTO 3DRRB 2UXCF 3D7SB 5CP2A 2P5GA 2LU1A 4AHUA 3RAMA 3UCZP 1B7YB 3NCIA 1SXDA 1DRGA 1S10A 1F9HA 5FDLA 2ASYA 1YHQN 2E6LA 1J5OB 5KQDA 5KT4A 3D2FB 3RH4A 4DTSA 9ICUA 1JLQA 1NK5A 4RW7A 4O5BA 2DRAA 1SV0C 1EETA 3MPYA 3ZZOA 1VQPS 1VQ4N 3RJKA 4H4KC 4X62F 1HW9A 8ICNA 1WOOA 3H8YA 2VOPA 1X5TA 4NMXA 4A8KA 2FJDB 2AT1B 5KAFU 2LBOA 4ZLLA 2AZ1A 2G0JA 2XMKA 5LMNF 4CGJA 2OYYA 1QAYA 1RABB 4FN5A 2ROEA 1Y00A 1RFQA 4FBTA 3KWMA 1OYEA 4KSEB 4PH5A 2ROPA 1X7VA 2YKNB 3PEHA 3NRBA 2XBPA 1UVIA 2XHWA 3GE9A 1VFJA 3KKRA 2XZWA 4OJ5A 4KMUA 5AQIA 3TQEA 3NGIA 1WOPA 2PE8A 2OTLN 4TLQA 2ACYA 5D4LA 2DVIA 3NAEA 1F0XA 5AZJA 3ET6B 3UD5A 3W8GA 2ZFHA 4MFAA 3R9KA 3ULDA 4CNQA 2UU9K 2HHQA 4YY3K 1QHTA 1RT4A 4EP4A 4RQ8A 4KV8A 4MFFA 2IDOA 2KI2A 3CCMN 1FXXA 1M5KC 3C2PA 3NMRA 1ZD2P 3RBDA 2BANA 5EVZA 3SLCA 4RW4A 3A0IX 3VA3A 3KHYA 3H25A 1SV4A 3CIMA 3SQ4A 1U0SA 3J80O 1Y3KA 1OY8A 1KKHA 3ZSYA 4FO0A 3EL2A 4LF6J 1ZQGA 1KBRA 3IBFB 1NJWA 4U7BA 2DHXA 2DXEA 2CJ9A 5AQHA 2G08A 3ICLA 4URQU 3ZX3A 5G5GA 3GDQA 1YBAA 3IO1A 4PRFA 4XK8C 2ZWPA 2QLTA 3WK8A 1S1XA 3MEDA 4B3MJ 4EX6A 3IGNA 4CGGA 4PHTX 2MY8A 2PI5A 2YX4A 1RBRA 1UW4A 3QNWB 2IC3A 3W5YA 4JKCA 1TK5A 1NGGA 2GMHA 4NLCA 1RAHB 5J29A 4OZJA 1PVQA 3QJLA 1JMSA 4DCHA 3I4PA 4DV4F 5HANA 2ZVIA 3AQFA 4CT9A 4C80A 1RYUA 3NUQA 5CJ7A 4IO9Q 2D1KA 2H5XA 1ZRNA 2AJ2A 5CHGA 1R8AA 3R5BA 2BTFA 2KYZA 3EVOA 3LAMA 1FJEB 2VPWB 2JWKA 1IQZA 2ZKUA 1S0VA 3FC4A 2A1SA 1S6UA 3M2VB 2RUSA 4TN2A 1MMLA 5HHHA 3QYPA 1ESVA 1F60B 3O3LA 2XGPA 3EE3A 3W5ZA 3AVJA 3HHNB 3LH2S 3QZ7A 4FZVA 2JR5A 2QN6B 2VFRA 2FUG9 2KT2A 2A6AA 3CG7A 2QWQA 4U67L 2B4VA