4O0IA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
SKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with 2'-MeSe-arabino-guanosine derivatized DNA
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o0iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4o0iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o0iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0iA01
4E7IA 1J5OA 5JS1A 3LP1A 4BWMA 1U4BA 3HJFA 4YG2A 1TK0A 1ZBHA 3BDPA 3EYZA 4RW7A 3G6XA 5CHGA 2DTUA 3DLHA 5F9NA 4B8CA 1S9FA 1MSWD 4LSLA 8ICKA 1UA1A 1KRPA 4I2DA 1ITGA 3ZDDA 2VA2A 2E4LA 1UT5A 1KVAA 4JLHA 2BCRA 3DMJA 1CEZA 3RB3A 4K4IA 4J9MA 1EKEA 4DTMA 1L3UA 1EX4A 2BPCA 5J2FA 2ASJA 5KFLA 4B08A 4AHCA 2X74A 5DG7A 3TFRA 2BR0A 1ZQRA 3MECA 4DSFA 3CM6A 1ZETA 3ZDAA 5HMMA 3OYDA 4FJ9A 1IM4A 4YVZA 3C94A 5K14A 3VQ8A 9ICJA 7ICUA 4F92B 1HUZA 3O3GA 4Q43A 2ISOA 4QZHA 4H4MA 5FRMA 1COOA 1S5JA 1RT2A 3V7KA 3N4MB 4CJRA 2D0CA 2PZSA 1SUQA 9ICFA 1RYSA 5KFGA 3KLHA 2R7YA 4WE1A 3VQDA 4R66A 2QXFA 4O55A 4CHYA 3TAFA 3RBDA 4KLSA 4O0JA 1KDHA 1JLFA 4O3PA 3E2EA 3O4NA 3ISDA 5FROA 4YXJA 1BCMA 1XSPA 3QEIA 3KD5E 1VSFA 1VSIA 1A77A 9ICKA 2UVUA 3OS0A 2BQUA 1BIZA 1VSHA 4RQ7A 3SZ2A 1WAFA 1ZJNA 4Z6CA 3C95A 7ICOA 4YFKA 3T3FA 4DTXA 3S3OA 4DSJA 2BCQA 4M45A 2PFQA 4ECYA 2AQ0A 1HRHA 4CJLA 4AILC 3GIKA 1ZQHA 1B22A 3DLKA 3HYFA 8ICIA 1JL1A 4KLOA 1NK0A 4QZDA 2ZTDA 3VQCA 4KRFA 5IIIA 1ZQLA 3QIPA 4FK4A 1L3VA 3TAMA 4PQUA 4NLNA 1D8YA 2DFHA 4YR3A 3KLIA 3OGUA 2FMQA 5DB8A 2I5JA 5JS2A 1C0MA 1TKTA 5KFVA 2XCAA 3RH6A 4OKEA 4CEAA 1RCHA 4NY8A 3AO3A 4QZCA 3B0XA 4YR2A 5I3UA 3H8SA 5JUMA 5DDMA 1S0MA 1UT8A 4GW6A 7ICIA 3QEBZ 3RR8A 3Q8MA 4UB2A 3D0PA 3TAGA 3AVIA 3SQ4A 3MABA 3ZSWA 4HHTA 1BPDA 8ICUA 8ICFA 1VSDA 3QESA 5KFOA 1RDDA 3MEGA 3CM5A 3DYAA 3LDSA 4J9RA 3A2FA 3NF8A 2VANA 3P5JA 4F50A 3HP9A 2AGOA 3V81A 3OS2A 1HQEA 4YMOA 1TGOA 2OZSA 1RT1A 1S0OA 1U9LA 4CECA 1HPZA 3L3VA 4RQ3A 4C8OA 4TUQA 1KCFA 3ORYA 4CERA 5EWGA 5L1JA 9ICRA 2HVHA 1BIUA 4CEFA 2FC0A 3JPRA 4N41A 4QW8A 2OPPA 4HCBA 1HYSA 3AVHA 3ZSOA 2VA8A 2FPLA 3ZT1A 1C1AA 5TZVA 1NKCA 3T5LA 2F8SA 1S1VA 4DQRA 3O3FA 4CGJA 4OVLA 1WSIA 1RTJA 3SI8A 4O3OA 4I27A 3ZDEA 3KK3A 4E7LA 3RJGA 2M9NA 8ICGA 4ECWA 3HVTA 4PGYA 3NGYA 3KHLA 3ULDA 3RB0A 2IBKA 1Z25A 4N47A 2ZE2A 7ICJA 4Q8EA 4UQGA 5D3GA 4HVJA 1RDAA 3KLEA 4ZHRA 1DLOA 4F2RA 3EWAA 4FLXA 1CLQA 2GWSA 4DTNA 3OSNA 1LAVA 4FJNA 4QZ9A 4EP4A 4RG8A 2HHUA 1IKWA 4KITB 2GUIA 4LSNA 4F4WA 4DL2A 2KZ3A 2VWJA 2BQ3A 1LWEA 1SKRA 4NLKA 3PW4A 2OZMA 4RZRA 5KFUA 1H38A 5DKWA 4M42A 1C6VA 1U04A 2I9GA 3PY8A 3C1ZA 4I2QA 1NK7A 4CCHA 2ITGA 4O4GA 1WSJA 3KK2A 4Q0BA 1R0AA 2W9BB 4O5EA 2B4JA 3KIOA 3HXMA 5KFQA 3O4QA 4DL5A 9ICAA 1W9HA 2WONA 2RKIA 4J9OA 2JZBA 3CFPA 2RF2A 5KRTA 8ICSA 4I2IA 1IH7A 1NK9A 3L2UA 4PUOA 3ALYA 2W9AA 2GV9A 1SL1A 2YKNA 2RDIA 3I8DA 4O5KA 1VRUA 4J2BA 4QWEA 1KFTA 2D5RA 4TURA 3PUFA 2KZMA 4DTJA 1ASWA 2PYJA 4M0AA 1BCOA 7ICQA 2YV0X 4RNNA 1RT4A 5J0WA 3ISBA 3OHAA 3PW7A 4RT3A 1TAQA 5CJ7A 1KLNA 4M3RA 3ZT4A 1ZQVA 4FJIA 3EPGA 3NGIA 1VK0A 2NRVA 3HT3A 1QE1A 4KLFA 5J29A 5HRRA 1NK4A 1JN3A 1J9AA 2F8TA 1K6YA 4EYHB 3V9ZA 4K8ZA 2V4QA 4EEYA 3ZD8A 3KKRA 5KT3A 4NCAA 3CG7A 4FLZA 3HW8A 1U49A 3JPPA 3KKSA 2FPMA 1ZJMA 4QZFA 1T7PA 2ASDA 3P83D 3BQ1A 4YMNA 4CFAA 2XY8A 1JL2A 2OWOA 4IQWA 2Z1GA 4JV1A 8ICWA 2A1RA 2AQ4A 4O3RA 1XI1A 2PXIA 5J1EA 4F4XA 2V9WA 3RR7A 1B9FA 5D46A 1TFRA 4CIGA 1Q9XA 4TSXA 1WSGA 3AVNA 3BJYA 1IO2A 3NH1A 1CXUA 1C0UA 5DB9A 2J6UA 2V4RA 2B21A 2XY5A 3WNFA 4RQ8A 1UA0A 1XC9A 3V6HA 2R8HA 3ZSVA 4W5NA 4CEBA 5J2MA 4KMUA 4N56A 1B92A 1T4GA 5F9LA 4M9NA 4B9UA 2RPIA 5EU7A 2XGPA 3OYEA 1WN7A 3RRHA 2HNYA 4RNOA 1RT5A 3H08A 1TV9A 2W9CA 4QZ8A 2W9MA 3LAMA 4PA1A 4CJKA 4DG1A 2G8KA 3AU2A 2F96A 4CJ4A 3LDAA 3M9MB 4J9SA 4IR1A 1K1QA 5J0RA 4YQWA 3RH5A 4CGFA 3OYJA 4AH9A 4KLGA 3C5GA 2W9BA 2XO7A 3C6UA 3Q8KA 3M8RA 1LB2B 4M3TA 1IKVA 1XSLA 1HQUA 4RNMA 2W9CB 4DWIA 1Q9YA 2ZTEA 3LAKA 5C25A 3IM1A 1JLAA 2VG6A 4E89A 2ZUCA 5L1LA 4ECXA 2LSNA 3EPIA 1JLCA 4KLEA 8ICMA 3DI6A 4HUEA 3GIMA 5C5JA 1KEJA 5D49A 4B9LA 3KLGA 1TKDA 9ICPA 4F3TA 4KLMA 4GXJA 4Y1DA 1VSLA 4I2CA 1ASVA 4RW9A 1X2IA 3HO1A 3OYAA 4R5PA 5IIKA 9ICVA 4I2PA 1TK8A 3N97B 5J0XA 1EXQA 1YT3A 1LW2A 3IG1A 2YKMA 3LP3A 4DL3A 1ZQOA 4P2HA 4O3NA 1EP4A 3C2LA 3QEAZ 4JK1A 2YNIA 5IIOA 5DK5A 1T03A 1UWBA 1NK5A 4YD2A 5J2IA 4GXIA 1RPLA 3KHHA 4W5RA 5J2KA 1X9WA 3PV8A 7ICKA 1FKOA 2HHXA 4M9LA 2D0AA 2XRIA 1HJPA 3VQ7A 1Z00A 4FJJA 2R8JA 5I42A 3RJHA 5CA7A 2IMWP 4JS5A 3C21A 4I2EA 2QKKA 2KTQA 4I9LA 1JMSA 5CYQA 3QE9Y 4JV0A 4ECRA 4O9MA 2FPKA 2MAXA 4AHUA 1S77D 1D8LA 4CGHA 3OYCA 4AHTA 2F1IA 2IHNA 5DLFA 3OYKA 5FRNA 3L2VA 1WSEA 3AO1A 4W5TA 5J2CA 4LH5A 3VQ5A 1S1UA 4P4MA 3T5JA 1JLEA 2ZQBA 7ICSA 4MFAA 2P6UA 2AGQA 1RZTA 2HHWA 2C22A 2LYHA 4Z4HA 2DFLA 8ICZA 3JPTA 2HW3A 4ELVA 3LZJA 4DU1A 4O3QA 5IIJA 1RBRA 8ICHA 3RH4A 3SJJA 4FJ7A 2Z1JA 3B6PA 3GV5B 3V1QA 5KG4A 3CFRA 5J2BA 3MDAA 4UB3A 5T7BA 1LW0A 4CJ5A 4CGDA 1BL3A 4I2FA 3K5MA 3AA2A 4BACA 5KFCA 1GOAA 1FKPA 3PX0A 1NK6A 3UXNA 1QSSA 4FLUA 3TAEA 1Z3EB 4RW4A 5KFAA 4DOAA 4LD0A 1TKZA 3QEWA 4UAZA 1XHZA 4FZXC 1RILA 1RDBA 4CHZA 5CZ1A 3P1GA 3HSTB 5HRPA 4CGIA 4JV2A 4KO0A 4Q5VA 5KG3A 4I28A 4IFVA 1CUKA 4ELTA 3Q8RB 3PX4A 5DBBA 4MEYA 4FO6A 4RUCA 3VQ9A 2BGWA 4IRKA 3K57A 3DLEA 4FM2A 2E6LA 3MEEA 1NJZA 4C8LA 5KFHA 5KRSA 5IINA 3AO4A 3HVRA 1WLJA 4NLGA 4KLUA 4XQ8A 3PR5B 4E1NA 3PVXA 2ZUBA 4CJ3A 2PI4A 4C8MA 1BPBA 2NRXA 1JXEA 2DPJA 2KFNA 4ED1A 5KG0A 2C2DA 1LWCA 4F4ZA 2UVWA 3T1AA 8ICAA 3T19A 3I0SA 1AROP 1ZQYA 3S3NA 1S76D 3Q8LA 4CFDA 1B9DA 4F5PA 3SQ2A 1S1WA 4CJPA 4ECVA 4QWAA 3AVKA 1MU2A 2FBXA 5IIMA 1YTAA 4F8RA 4FYDA 4DQIA 1C1BA 4QZIA 3JPSA 4I9QA 2ZUDA 3LWMA 3IHQB 3AVFA 4M9JA 1BQMA 3VQPA 3RJJA 3K58A 4F3OA 4KN7A 3H8JA 2FLLA 3F73A 5J0QA 3VQ4A 4BGDA 1CZBA 1EETA 2J6SA 4B9TA 1ASUA 4BDPA 9ICQA 4QOZB 4FM1A 4DTRA 4CE9A 2PFOA 4NYNA 3ZT3A 3NCIA 1J54A 4E7HA 1TVRA 3V6KA 4IRCA 3SQ1A 1HYVA 1G15A 4JUZA 3MFIA 3JPQA 1ZQWA 5DG9A 2BQRA 3K75D 4QZEA 1Q8IA 4R8UB 4RU9A 4QWBA 4NLZA 5KFYA 4IBNA 3K4GA 4ED0A 4ED8A 4TQRA 1XU4A 4RQ0A 5KTQA 4TQSA 1W0HA 3G6YA 1S10A 3KHRA 4M47A 3Q8QB 2BE2A 4CJWA 2G8UA 4CK1A 3GILA 4LVSA 2BCVA 3AUOA 4GVMA 2ALZA 1SKWA 4ICLA 4ZTFA 2FBVA 4KTQA 2HNDA 1VRTA 4PHPA 2BCSA 1TL1A 1U45A 4BWJA 1WCLA 2C2RA 4CEOA 2JGUA 1ZQBA 4BXOA 5KFBA 1NKEA 3GV8B 2IHMA 5CY4A 5KG5A 1QTMA 4AHVA 4M3ZA 8ICTA 1D5AA 3UXPA 1RT3A 4KTZA 3V4IA 3KTQA 1JLBA 4EP5A 4DTSA 4MF2A 2KW4A 5KG6A 1SL0A 2VWKA 4UBCA 4OPJA 5DG8A 4Z4FA 1RNHA 4RUAA 4CHQA 2P6RA 1VSEA 1T05A 3M9OB 4H4OA 4KI6A 4KREA 1HMVA 5CB1A 1C1CA 1Y88A 4W5QA 3MAQA 2VA3A 3SUQA 1TKXA 2P5GA 2RN2A 2G8WA 5D4BA 1XSNA 1ZQPA 2BCUA 4FS2A 2WOMA 2R8KA 1S9EA 1ZQSA 1S9GA 3V1OA 4N76A 3MGIA 3QNOA 4DSEA 1ZQQA 4PPXA 3OJSA 7ICRA 1WNSA 4Y1CA 8ICCA 1JKHA 2GBZA 5J2QA 1WSHA 5J2GA 1KSPA 4E1MA 1PZNA 4PWDA 1V9PA 9ICGA 4CESA 4DQQA 3C6TA 3NTUA 4Z4EA 4XUSA 4O44A 4MF8A 2G8IA 4PH5A 4RW8A 9ICMA 2JEJA 3C1YA 3ZCMA 1K1SA 4O0IA 4CF0A 4H8KA 4IQTA 3PO4A 1L3SA 4RPZA 3V9SA 4R8UA 1BPYA 2HHSA 9ICTA 4YCXA 4TUSA 2IA6A 2C28A 4UAWA 1BQNA 3JYTA 4YFUA 3HP6A 5CYMA 2R8GA 9ICBA 4OLAA 3V1RA 1UAXA 7ICGA 4Q8FA 1NKBA 3K5OA 4R65A 2NRTA 1JXBA 4KV8A 4KKOA 1TVAA 3OYNA 1KFDA 4RW6A 4OJRA 4FJKA 3D45A 3FDSA 4NXZA 4DS5A 3OYFA 3V7LA 4B9VA 5KFFA 1XO1A 1NOZA 3HPGA 2IOCA 4UB1A 5DB6A 4FBTA 3QINA 3V6JA 4FK0A 1ZQGA 9ICNA 3LP0A 4YD1A 2DFFA 3PX6A 1S6PA 4XRHA 4LH4A 4YR0A 3CQ8A 1I3AA 5BPCA 3LANA 4DSKA 3MGHA 1ZQAA 2YHBA 3GQCA 5J0PA 2P5OA 2XHBA 2HHVA 4FJ8A 3M8PA 1BPXA 4W5OA 1NJXA 5J2PA 4IQVA 3KK1A 5KFXA 4IG0A 2PFPA 4OLBA 2KFZA 5J0OA 3SV4A 3AVBA 4MQ3A 3GIIA 4DQSA 3AVCA 1VSKA 2HHTA 4DL7A 1JLGA 4KAZA 1Z00B 4C8KA 3B0YA 4HYKA 2IS3A 4F5RA 1XS9D 3VA0A 5J0UA 1HNIA 4EZ9A 2QKBA 4DS4A 9ICCA 4KN4A 4KB0A 4I29A 5J2JA 1REVA 3AVLA 4FJMA 2BPFA 4DFKA 5J2NA 4J9NA 1TV6A 2Y1JA 3C2MA 2EX3A 3QZ8A 4M04A 5EWEA 2FLPA 4CF1A 1S97A 4M9HA 3ZT0A 4FLTA 2X6SA 2NRZA 3BGRA 4CFBA 4DF8A 4ED6A 4RT2A 1LAWA 4I2JA 4L8RB 4PHDA 3QEPA 3OJUA 1O1WA 4J2DA 2OPSA 2P51A 4E19A 4F4KA 3NGDA 2OPRA 2ZJ5A 4CHPA 3RB4A 3LPUA 2H5XA 7ICTA 5CWRA 3I0RA 4Z4IA 4EBCA 3ETLA 3TQ1A 3NH2A 4DTUA 3Q8SB 5KFDA 3PNCA 3EW9A 1L3TA 3QO9A 4RQ6A 1VSMA 1NK8A 1ZQCA 1T8EA 5J2AA 3V9WA 1N48A 3T5KA 4X5VA 1BISA 4DMNA 4FK2A 3NF9A 4HCCA 1HUOA 4FM0A 1JIHA 4CHNA 1ZBUA 4GLXA 3TFSA 3ZSXA 4KPYA 4M3WA 3GDXA 4KTWA 4GC7A 2BDPA 4JWMA 3V7JA 2Z1HA 4DEZA 8ICRA 1ZBFA 4DO9A 9ICSA 7ICFA 4F93B 4KLHA 9ICUA 1N6QA 4QCLA 5DQGA 4PGXA 4MEXA 4FJXA 3QIOA 4AHRA 4FS1A 5FDLA 4UB4A 3ZT2A 5HRNA 1ZBIA 5J2HA 3NHGA 3GIJA 4RQ5A 3NH0A 4KLTA 4DFPA 1NOYA 5DB7A 5DQHA 1C7YA 3DM2A 4DOBA 3H4DA 9ICOA 3MXMA 2F1HA 3NFAA 1IXRA 1X9MA 2PI5A 4O5BA 3JSMA 1Y97A 1D9FA 4LZDA 4I7FA 3PMLA 2XGQA 4CJEA 1RTDA 3V6DA 3ITHA 3OYGA 3C23A 1ZQEA 2B6AA 4M41A 2B5JA 7ICHA 4HUGA 3MR6A 3OY9A 1WAJA 3H4BA 2AU0A 3EY1A 4P4OA 2WTFA 1L5UA 5C24A 1ZQJA 3NBPA 2Z1IA 1BGXT 4ELUA 1QS4A 3KLFA 5KT5A 3F9KA 5KFSA 3SPZA 5KT6A 3V72A 1A5XA 3V9UA 3IAYA 5SZTA 2FLNA 1UOCA 2A1JB 4ECTA 4NYFA 4DTOA 4KB1A 4F2SA 3GFKB 3AA3A 5KFNA 1BHLA 3OYLA 1QLNA 4M2YA 8ICXA 9ICIA 2W8LA 4HUFA 2AJQA 4KLLA 4KLQA 4GMJB 4QZAA 3ZDBA 3Q8PB 5L1IA 3L2QA 3OVNA 1RT7A 3MEDA 1S0NA 1BI4A 4OGEA 3NF6A 4CJUA 4ED3A 4PHEA 4CF9A 2JEIA 1ZQUA 2KQ2A 3MR5A 2FMPA 5HROA 3RTVA 1RDCA 4ZH4A 5HP4A 2A1JA 4ED7A 1NOMA 2Y1IA 1IG9A 2DPIA 3M9NB 5L1KA 1RXWA 1QSYA 4FW1A 2BGGA 2UVRA 5DMRA 3AA4A 4CFCA 3IRXA 5BOMA 4GXKA 1SZPA 4B9MA 4PHAA 3PR4A 9ICXA 3LZIA 4BDZA 3RMBA 4O3SA 4NCBA 5HP1A 3QZ7A 4NM2A 3E01A 4Z6DA 5KG7A 5HHHA 1SKSA 4Q44A 2OPQA 3AVMA 3HM9A 1BVSA 4DL4A 5KFIA 1EXNA 1RBSA 3MXIA 3HWTA 4EBEA 4M3YA 4CEQA 1J53A 1F21A 3DRSA 4M9GA 7ICLA 4CJVA 5KFZA 4DFJA 1KFSA 4QZGA 5J2EA 1ZQXA 1MC8A 3TI0A 2O4GA 1DTQA 3O3HA 4PGQA 4CIFA 5J2DA 3S9HA 3DRPA 5KFRA 4BE1A 4JS4A 4J2AA 5DGBA 1N56A 1RT6A 3PW5A 1LV5A 3RAQA 3MXJA 3BQTA 5KFEA 3ISCA 4J9KA 2JEGA 2HMIA 4KI4A 4F5OA 3QERA 4FVMA 4QW9A 4MFBA 4FJHA 2ZJ8A 1MQ3A 4DLGA 2RDJA 2W42A 4FW2A 3SYZA 8ICPA 3SNNA 4QWCA 4M3UA 3U6FA 4R63A 4YMMA 2W8KA 4K4HA 2BANA 4M6WB 2MUTA 3WNGA 8ICBA 3ZDCA 4QWDA 1IKXA 1ZBLA 1U48A 1S6QA 1ZQMA 3CYMA 3RRGA 1MQ2A 8ICNA 3NF7A 5C42A 1RTHA 4AHSA 1GOBA 1ZQIA 3G0ZA 1S1TA 5KFJA 1RXVA 4GC6A 4IFYA 4Z4CA 4PY5A 4K8XA 4Z6FA 4XA5A 2ISPA 4FLYA 4Z6EA 2ZTCA 2NRWA 2ATQA 2G8HA 8ICYA 4JWNA 3JPNA 2ETJA 4F5QA 2HHQA 5KG1A 4BE2A 3HPOA 5HNKA 2YNFA 1T3NA 4I2GA 3ISNC 2IAJA 3QLHA 2UVVA 2PFNA 2P66A 2IDOA 3K59A 2VG7A 4R64A 2QK9A 2E6MA 5CZ2A 4CK2A 5DBCA 3HX0A 3C5FA 5HHIA 1SL2A 1NJWA 1C0TA 4E7KA 1A5WA 4CJFA 1ZQKA 1YVUA 3NDKA 1U47A 1I39A 2X78A 4CEZA 3LWLA 5KFPA 5HMLA 2XC9A 4C8NA 1SV5A 3ZSYA 3SUPA 3RMAA 3U3YA 4YNQA 4KHUA 5KI6A 1RTIA 4I2HA 3VQAA 4JRPA 1ZQTA 3UQ0A 1RBVA 2G8FA 3TAPA 9ICLA 2ZJAA 4RQ1A 4I2BA 4RPXA 4FZYA 3NGZA 5DBAA 4DQPA 3HPHA 3L2WA 1BI4B 2ATLA 2Q0ZX 2KN7A 3HL8A 3RJIA 4RQ4A 1XHXA 2NUBA 4CEEA 3MBYA 2KZZA 3MR2A 3OYIA 3AVJA 3CFOA 3RMCA 5BOLA 3AVAA 4IDKA 4DU3A 4ZTJA 3ZSZA 2DY4A 4KHYA 5EOZA 7ICPA 1ZQNA 3SV3A 4EYIB 8ICVA 3TARA 1HJRA 4E3SA 5L9XA 5DQIA 3MFHA 3AVGA 2A1SA 2VG5A 4FLWA 1YTUA 2AGPA 3KJVA 4O5CA 4FLVA 2G8VA 4K4GA 3OHBA 3ZSQA 3SUOA 3QETA 3NAEA 3H7IA 4KHSA 3OYMA 4G1QA 2R8IA 9ICWA 2YNGA 4CHOA 2PY5A 8ICLA 4KHWA 3KHGA 2YNHA 5KT2A 4RPYA 4DLEA 2BKEA 4UBBA 3RJFA 4OKJA 3VQEA 4FJLA 3RWUA 5KGXA 1N5YA 4CK3A 3U3GA 2FBTA 4ECQA 3RBEA 3L3UA 3OYHA 1NJYA 3AV9A 2C2EA 3KD1E 4XIUA 3G10A 3LPTA 5CR0A 3TR8A 8ICQA 4FJGA 4J9PA 3VQBA 3SCXA 4QZBA 1HNVA 3M8SA 1JLQA 4E7JA 8ICOA 2FBYA 2O4IA 1TK5A 4FXDA 1RBTA 4IR9A 4ID1A 4Q45A 4UB5A 1QHTA 3L2RA 1A76A 4FZZA 2JLEA 7ICEA 1RYRA 3K5LA 4QAGA 3WNHA 4CJTA 3VQ6A 4B8AB 3AA5X 1TAUA 4B9SA 3MDCA 4IKFA 4KFBA 4ECSA 2MUTB 5E41A 4CF2A 2YHAA 4CGGA 1X9SA 1DOQA 3AU6A 2Q3SA 3B6OA 7ICNA 5CP2A 4NM1A 4ECUA 1BPZA 8ICEA 3L8BA 3RJKA 5J0YA 4ID5A 5SWMA 3C2KA 5DDYA 4DU4A 2HVIA 3PO5A 4MFCA 3AO2A 3RAXA 3EZ5A 4IQUA 1BPEA 2JEFA 2P1JA 4CF8A 9ICHA 3PMNA 1QSLA 2HNZA 4J9LA 1RBUA 2XY7A 3UPQA 1GOCA 4CEDA 5HBMA 3ZD9A 4M3XA 3QEXA 4G3IA 5KFWA 2X6NA 1XWLA 4P4PA 3OYBA 2OYQA 7ICMA 1DTTA 4FJ5A 3VN5A 4J2EA 4TUPA 5KGWA 4ED2A 4IRDA 4OGCA 3V9XA 4I2AA 4DF4A 4DOCA 4DFMA 1S0VA 2I1QA 3SUNA 3TABA 3WNEA 4KLDA 3DLBA 3PW2A 3H8WA 4F4YA 2DFEA 4DSLA 4NCGA 3DRRA 3SQ0A 4OKKA 3AO5A 3HK2A 5EWFA 4DSIA 3T5HA 3DLRA 2ZD1A 3QEVA 3TWHA 4IG3A 4UAYA 3NE6A 7ICVA 3LK9A 1B43A 4KHNA 3SPYA 3UQ2A 4FCYA 5DLGA 2J6TA 3IS9A 3FFIA 3K2PA 5HLFA 4B3OA 4OPKA 3S3MA 5KG2A 4EZ6A 5KFTA 5KT7A 1D9DA 4KLIA 2OA8A 4EBDA 1FK9A 2F1JA 1VSJA 5HRSA 3OSPA 3VA3A 2XCPA 1KVCA 1CZ9A 2IC3A 5DGAA 4LZGA 3UIQA 3THVA 4J9QA 3QNNA 3TAQA 4MFFA 1QQCA 1DGSA 3G6VA 8ICJA 1TL3A 5KFMA 5KT4A 3RMDA 4YXMA 4F5NA 3GV7B 9ICEA 1IKYA 4DTPA 2XY6A 4N5SA 3RJEA 2ASLA 1A5VA 4JRQA 3FYHA 1KLMA 2D0BA 4BXOB 4E0DA 3SI6A 3H40A 4BDYA 4YN4A 1KVBA 4Z4GA 4FBUA 4ECZA 2EHGA 3BQ2A 4HTUA 1ZQFA 4M6WA 3MR3A 2JZBB 1JX4A 3M8QA 2BPGA 4LY7A 2IGIA 3DOLA 4CIEA 4RQ2A 5IILA 3RB6A 3OS1A 4BE0A 3PW0A 1S1XA 1HYZA 1JXLA 2FMSA 4F91B 3UXOA 5J0TA 1ZQDA 3VQQA 3K5NA 3BQ0A 1Z26A 3TANA 1ZYQA 3DOKA 4Z0UA 5J0SA 1WCNA 5KFKA 4B9NA 1KTQA 3JPOA 4YP3A 1CXQA 1LWFA 3LALA 4CJQA 1X1PA 1FXXA 2PYLA 3ZSRA 4KLJA 2HB5A 4DL6A 1WSFA 4KHQA 3DLGA 1ZQZA 3ASMA 4CJSA 3LP2A 2BHNA
chains in the Genus database with same CATH superfamily
2WSFC 4WKRA 3CCUN 4UY85 4BWMA 3A5OC 4MT1A 5TKWA 1K0TA 3POTA 3UKUB 1YI2S 3KKAC 1QVFR 5F9NA 1MSWD 2B9YA 4LSLA 8ICKA 3MXHP 5KQ8A 1RFQA 1NCLA 4YDUA 2ALYB 4WU2A 1MLAA 3ZDDA 1ILYA 2VA2A 4Y0WA 2E4LA 5AI9A 1UT5A 5CR4A 3DMJA 2E5HA 2JLFA 4YUDA 1SWVA 3UN3A 4DTMA 1EX4A 2BPCA 3MEKA 1H2TZ 4P7VA 4B08A 4A48A 1FJ7A 1JXVA 1GTHA 2OD4A 4YMEA 1FD8A 5EGYA 2BR0A 1ZQRA 4DJBA 4NMLA 3EE8A 2PGCA 4FJ9A 2I6XA 2IDEA 1X4CA 4F92B 2AYGA 1HUZA 2Q97A 1COOA 4I4BA 3H98A 3JTPA 5M1QA 2LQ8A 3N4MB 3B4MA 2D0CA 5AQRA 1SWWA 2PZSA 9ICFA 1RYSA 5C10A 2I0XA 3KLHA 3VQDA 4OZNA 2I2YA 2QYCA 3BKTA 3DM2B 3IRWP 1Q7YT 2QXFA 1Q86O 2HBJA 3RBDA 4WXOA 3E2EA 4M5GA 2HQCA 1V4SA 3UR3C 5HMZA 2E5SA 3J7A1 2BOAA 1CVJA 3QEIA 2DRBA 1G1XA 3CD0A 4A46A 2KN4A 5BYSA 3LDOA 2UVUA 1Y00A 3NY0A 4G1IA 1BIZA 1IKXB 1VSHA 4RQ7A 3ULHA 1WAFA 3O9QA 4Z6CA 3T3FA 3DKDA 4J03A 2YKNB 3MAAA 4K59A 2BCQA 2ZUAA 3CMES 3M6GA 1Q3UA 4M45A 1B0VA 4CJLA 1OH6A 8ICIA 1RDUA 2JNJA 3NS1A 3FAHA 1HWUA 1ZQLA 3QIPA 1YBUA 5D77A 1ZA1B 4R25A 4PQUA 1RAAB 1D8YA 4MK7A 2W01A 4F3MA 3OGUA 1S6UA 3JAMY 5DB8A 4NLYA 2I5JA 2GQCA 2ZFHA 1TKXB 3NRBA 4X66F 1RISA 3Q83A 3N7PD 1H74A 4OZ2A 5IT9Y 1X4FA 4QZCA 3PSFA 3DRYA 4BRGA 2YWKA 5I3UA 3T1YK 1HBOA 3VAMA 3D6TB 1NGFA 2QWLA 2YB4A 1UT8A 2L9NA 4F67A 3H2UB 1ESVA 4HACB 5HJYA 2YQ1A 3CD7A 4NRUA 4Q2LA 3QRQA 3W2WB 3CJBA 2CIMA 1ZAWA 2FLOA 3KUHA 2Y8WA 3AVIA 3SQ4A 4CLSA 1QAYA 4K0KJ 8ICUA 5KFOA 1RDDA 3MEGA 4URGA 2C1EB 3MWTA 1NHVA 4F3QA 3AGKA 3LDSA 1WBBA 5DM7L 3DRXA 4RJVA 5AQQA 1RWUA 1HNZJ 4YMOA 4AD6A 3DN9A 4KBIA 3KUGA 2Q6BA 4V19J 2H51B 4A8KA 3AOBA 5L1JA 2YHYA 2FE9A 4LF8J 3CJCA 3H5XA 1BIUA 1RZMA 2YWWA 2MZJA 3R8EA 2JWKA 1X4AA 2VA8A 2FPLA 3C14B 3ZT1A 3ZXWA 2LQBA 5TZVA 3NGUA 3ZZPA 4TLRA 3OVAA 1KQKA 2QLWA 2EH9A 3KG1A 3CMQA 1WHWA 1VQSA 2HG4A 4PZVA 4C9DA 2KJVA 3B6BA 4E7LA 4JK8A 4C4SA 3RJGA 4A47A 5AZJB 2APOA 2RRDA 4X66K 3L4PA 5F8IA 2A18A 4N47A 6FD1A 4AYBD 2ZE2A 4LRBA 2IYGA 3WKEA 3GONA 4HVJA 3KLEA 4ZHRA 4IFVB 3LGNA 4FLXA 2W1BA 1WOQA 3VAKA 4KJIA 4DTNA 4M5IA 1D8ZA 3MMVA 4FJNA 4RG8A 4KITB 2GUIA 3G96A 1URRA 3SSQA 2B5JB 2VPZB 4LSNA 4F4WA 4DL2A 2KZ3A 1LWEA 3ITHB 4NA3A 3BSCA 2I9SA 3WK5A 5DKWA 4OYPA 5DZ6A 4JB3A 4Y2MA 1MWKA 1KVJA 3Q8YA 2V67A 4I2QA 2DNMA 2DL0A 2CN1A 4OD0A 4ER8A 4JI2K 1SC4B 3OL7A 1VQ9S 9ICAA 2WONA 4KFBB 2JZBA 3CFPA 1KONA 2RF2A 8ICSA 2AEJA 1NK9A 3R9PA 4USHA 4PUOA 4A61A 2E8AA 1YXQA 3DXKA 1M5PC 4ZVPB 3L9ZA 2RDIA 3NS7B 2KG0A 4J2BA 1F0XA 2P9KA 2PYJA 1BCOA 2B51A 7ICQA 4RNNA 3HJEA 5J0WA 2OHDA 5FPMA 1Y4ZB 5AQNA 4PWUA 3G71N 3F0NA 1FIQA 1KLNA 1GTEA 4ANDA 2WMMA 3ZTOA 2IDLA 3HOTA 2EVZA 4U67L 3Q86A 3NGIA 4BRPA 5ADZA 5ALZA 1WG5A 3KJFB 1QE1A 4KLFA 4NA2A 3AXMA 1B0PA 2F65A 2UXDF 2EAPA 2GVZA 4EYHB 1KW4A 2V4QA 1HNZF 5B08A 3ZD8A 1IBKF 4FLZA 4NEYA 3HSZA 2OTLS 3R7SB 1F5AA 3KKSA 4NLCA 4OJGA 3CIZA 5B7WA 4OJOA 1T7PA 1N36F 3U8XA 4YMNA 4CFAA 8ICWA 2PXIA 1IJJA 3FRZA 5J1EA 4U7BA 3DU5A 4US8A 4O3MA 5D46A 3UVJB 1GMUA 2QB1A 2E7WA 3C65A 1N60A 5F3TA 2J8SA 2LXIA 2A19A 2HVZA 2UP1A 2V4RA 3NWRA 1NB2A 2R8HA 3ZSVA 2HQFA 5J2MA 4KMUA 3M2RA 3TUIC 2I7NA 1DY3A 1B92A 1RSCA 1IKWB 4ALZA 1NI3A 2QEXS 1HHTP 2XGPA 1WN7A 4IS7A 4BRHA 4OHVA 2KVSA 3BEXA 3Q2SC 2W9MA 1RDFA 4CJKA 3J7YI 4DG1A 1X42A 3D67A 2F96A 3LDAA 3RRKA 5BR8F 3WX4A 1HYSB 1K1QA 4LFCJ 2BKNA 3C6UA 2ZIVB 1LB2B 2OGUA 3A4TA 4M3TA 2LI6A 5CYJA 1APSA 3OXGA 4RNMA 2XMKA 2W9CB 4DWIA 4MMOA 1Q9YA 5C25A 3KK3B 1KNZA 1PK1B 2D3DA 3IGNA 3CC2S 2EXUA 4WFBQ 5L1LA 1OW5A 4ECXA 1H2VZ 4KLEA 4YN3B 3M3ZA 1T03B 3A8IA 3HILA 2J7WA 3IG1B 1DLOB 3R8YA 2WRMA 4H0OA 1N33K 3PZPA 3M8ZA 4NXMK 5D49A 4B9LA 3VZHA 1TKDA 4ZPVR 1W7WA 4CIOA 1V3SA 1T9VA 5HI7A 3QJJA 1ASVA 4RW9A 1X2IA 3VALA 1I94J 4UY8O 1X6JA 5B09A 5B0EA 3IG1A 2DY9A 1AUSL 1V38A 1T03A 3SEIA 5AI5A 1R6VA 4CT9A 4EHUA 1NK5A 1HBUB 3ZETB 2W2MP 4C1NK 3L4BC 5I9EB 1NNLA 3EXCX 4YD2A 5J2IA 4TNOA 1UFKA 4K25A 4GXIA 3TA1A 2YX4A 2DGTA 5CD4H 2BUNA 1XMQF 1SXEA 1VBZA 4DR5K 3HOSA 3LM2A 3SEOA 1WG4A 4H5VA 4Z2XA 1RWKB 3EKSA 3HLUA 1HJPA 4FJJA 2IM1A 1PUZA 1Y5NB 2FJ6A 2HK2A 4HHUA 3C21A 4I2EA 2QG9B 1VQLN 3F5AA 5CYQA 3QE9Y 5HR7A 4JV0A 4L3QA 2BH1A 2NPFA 3AD8C 3LP1B 2BA9A 4CGHA 2MSSA 1NDKA 2FJDB 2ADCA 5D15A 3CTRA 2EFNA 1TUUA 4ERDA 1F9FA 1WSEA 3A0IX 3AO1A 4K4XA 3HCXA 3CQXA 3VQ5A 4P4MA 4CF5A 2KRBA 1UKUA 2ZQBA 2CPHA 7ICSA 1UL3A 2P6UA 1RM6C 1RZTA 3AN1A 2HCFA 1S79A 4ELVA 3LZJA 4O3QA 3CDUA 1YJRA 1U1PA 3DRPB 1S3XA 1RT6B 3EVMA 3SJJA 3G2XA 3PEJA 4FJ7A 5AQPA 5J2BA 3MDAA 3DOMA 1IBMK 1LW0A 3OFGA 4IH7A 4I7FB 3AA2A 1S1VB 1OUQA 1SUQB 1YJ7A 2NLWA 2DNKA 1S4EA 1RBLA 5KFCA 3PYFA 4X4VA 3UXNA 4FLUA 1TYQB 5D4LA 1R7IA 2D8CA 2Q79A 1TKZA 4JI8F 1XHZA 1SQFA 2CZVC 2UZAA 1WELA 5K9FA 3O3LA 2HHPA 2G1DA 4LRAA 2PFDA 2VJUA 4JKHA 2E1YA 3DHWC 3TEGA 4TXSA 1SIZA 4RUCA 3CC7N 4FF1A 2BGWA 3K57A 2G1HA 5KOWA 3MEEA 1XMOF 1N34K 5KRSA 4CWBA 1NSQA 5JMVA 2DNRA 3G8TA 1WLJA 3BSAA 4NLGA 4Y2YA 5DS7A 1R0AB 3MGVA 2HGLA 3PVXA 4CJ3A 2BX6A 3NWGA 4TU7A 4YORA 1OY9A 4LFCF 3WQUA 1F6TA 3BM7A 4ED1A 5KG0A 2DGSA 4YHHF 9ATCB 2U1AA 1AFJA 4IQMA 3GOIA 8ICAA 3ZZZA 3I0SA 5AQYA 5J8YC 4CFDA 2Y8YA 3CMAS 4UZCA 4QIFA 4F5PA 3QRPA 3KWMA 2GX9A 3IFRA 1Q53A 3JAMO 1S1WA 2QTWA 4KT0C 4CJPA 1PAUB 2GW8A 3BGLA 3GPAA 1VHIA 2RQ5A 2HZCA 2ZIWA 1PO6A 3RVCA 4CP5A 4DUZJ 1GO3F 2WTUA 5IOLA 2MQQA 5A8KA 1VI7A 4YHHJ 2J7KA 2QYGA 3K58A 2BJ7A 4KN7A 1HKGA 2XSFA 3F73A 3AL0B 2W2OP 4BGDA 1Q81O 1CZBA 4JI7K 2YI1A 2J9DA 2QRRA 2ROGA 4B9TA 4CE6A 4FM1A 1KQSM 2A3JA 2LQ5A 4CE9A 2PFOA 4G6VB 3NCIA 3QUQA 2R7SA 4E7HA 2KB2A 2X1FA 3V6KA 3SQ1A 2F5GA 3CJRA 3W5ZA 1G15A 2CJQA 3QYYA 3EGVA 4I1TA 4EO6A 1XMOJ 3OPKA 1ZQWA 1NMNA 3K75D 4QZEA 4R8UB 1GXTA 4LQ9A 5K20B 3R5GA 4I6MA 4IBNA 2CQ2A 3UMGA 4TQRA 1HLUA 3QRRA 4LF6F 2A6AA 2DKZA 5I4MA 4URQU 2HOIA 4DV5K 3GILA 4L76A 4BREA 1OH7A 4WYLA 4C6AA 2ZIXA 1FT8A 2ALZA 4ZTFA 3AXKA 2BJDA 1UW9A 2HNDA 1VRTA 2LMIA 2YXLA 2WSCC 1RGIA 1ZPVA 2CGLA 2C2RA 4CEOA 5A0LA 3CJ9A 1NKEA 3GV8B 3TZXA 2O8FA 5EE9A 4QIWC 5KG5A 1A0OB 4OYBA 4DR2F 3UXPA 2Y1LB 1AXQA 3KTQA 4UATA 4DTSA 2GELA 3FCHA 4ZVTB 4DV6F 5ALTA 3EMTA 4QR2A 2FF6A 2VWKA 1TAMA 2I5HA 3QUBA 5DG8A 4LF6K 2P6RA 2KT3A 3R5JB 2KYZA 2CJYB 3AY0A 4DV4K 5CB1A 3C7NA 3VGVA 5LOQA 2Z56B 4ZPBA 3MAQA 1RE1B 2ZZMA 3ZNJ1 3T69A 3SUQA 2EWSA 4PHTX 2BACA 3D6RA 4CZLA 1UQVA 4JKCA 4FS2A 4S0MA 2MU2A 2KM8B 1WYGA 3QNOA 2DPNA 1UZDA 1RT4B 7ICRA 5E3PA 4BRAA 4EAHD 3HSDA 5J2QA 1WSHA 3ONNA 4E98A 1V9PA 1AT1B 4N7TA 4XUSA 3X1LB 3EGNA 4H0XB 1NPRA 4NLRA 2XYPB 2G0CA 3QFPA 4V19S 3BB5A 4LBIA 1L3SA 3RJMB 4YCXA 4X4OA 2P9PB 3M2UB 1VJ5A 3U1LA 2E3TA 5CYMA 2O3DA 2JMGA 4OLAA 1SIWB 2HVDA 3BYRA 2X1AA 3I55N 5D0HA 1SPBP 1SH3A 5F0WA 3A5LC 3TVKA 3OYNA 1VDVA 4BC9A 4YHHK 3FDSA 4CDIA 1BDGA 4NXZA 4JI4K 3TOQA 2XS7A 4LFCK 4OQJA 3BS7A 3MOJB 3UKRB 1ELOA 1XO1A 4A8FA 1RQ0A 2HZVA 3OV7A 2W4DA 1ZRNA 3R3TA 3RFAA 1N32F 3NCQA 2AJ2A 2MZSA 2ZXIA 3KLFB 1XMOK 1FFWB 5THWA 3PACA 3C16A 5BPCA 1FDBA 1UPMB 2HPUA 4G9ZA 1S1TB 3W5YA 2P5OA 3IKMA 2XHBA 2D0PA 1EWQA 5ALNA 4BR4A 5AI6A 3CJ2A 3BF3A 1NJXA 5J2PA 4DX5A 5KFXA 4OLBA 4L72B 1PAEX 2CPXA 5A2QO 3AVCA 4P74A 2P9IB 4A59A 2HHTA 2MLZA 4DL7A 4WPAA 4C8KA 2FC8A 4BRKA 1M1KO 4YOXA 4K4WA 2EI5A 9ICCA 3R7BB 3NVKA 4KN4A 4OHZA 4ZN1A 4KB0A 4I29A 2UYTA 1REVA 5EXWA 2LM1A 4J9NA 1GLEG 2NZTA 3M8WA 3CC4S 5J1PA 3Q7CA 1MW7A 3R3LA 3HD2A 3J81j 2HSTA 4M9HA 3QXGA 4DV3J 4P2SA 4LT6A 3BGRA 1CJUB 3HF5A 3LO3A 4DF8A 4ZVUB 3O2IA 5ETQA 3B54A 4RT2A 4L8RB 3UN5A 2A3VA 1O1WA 4ZVSB 3D68A 1OPIA 2KVCA 1N88A 4CHPA 4JI1F 3LPUA 2GZOA 1BY9A 3LP2B 4HL9A 3I0RA 2POKA 3SCIE 3QUTA 4GVLA 1H73A 4NLBA 3TQ1A 3O6WA 2U2FA 1HFEL 1P9YA 1CBKA 3KMSA 4LC9B 2WF9A 3UE5A 3QO9A 3KZXA 1NK8A 1ZQCA 3OUYB 3CCMS 5AIBA 4BC2A 2ZWOA 2IVOA 4KH5A 1NU0A 3R2CJ 2QC3A 4DMNA 1TFWA 1SJ4P 3NF9A 2HOFA 5HSPA 2JX2A 2VJVA 2QB0A 3DGVA 2PN6A 4P2FA 4KQZA 4H03B 3SENA 5J1EB 4IJNA 3GDXA 3V7JA 2KIVA 3U27A 3ZX3A 3VGTA 3M1VA 2LP4A 2ZH2A 4DR3J 4OHXA 4M5DB 4FS1A 3OUYA 5H9FK 5FDLA 5HRNA 2AP1A 1ZBIA 5J2HA 2QLTA 4PKIA 1RTJB 3FZMA 3GIJA 4RQ5A 2DK2A 2XNRA 5AZIB 5B0GA 4MH8A 4DFPA 1UJ6A 4DR1J 1D0EA 1IR0A 3MXMA 3H4DA 4OI2A 3W63A 3FSYA 1ZAXA 3I55S 4DR5J 1KBUA 2J5AA 3LF0A 1D9FA 3PMLA 2XGQA 4M5DA 4CJEA 4FKYA 4FXVA 3V6DA 3B8HA 4DXLA 2J7UA 2DR5A 3G9CA 1QD1A 5GADI 2DVIA 3OYGA 3C23A 1ZQEA 4M41A 1PK1A 4X4RA 7ICHA 2WFBA 3R9KA 4DOZA 2GGPA 2R2RA 1L5UA 5C24A 1ZQJA 2LM4A 1DJ0A 2FJBB 4X4SA 1RLCL 2M0GB 5CH7B 5AE2A 2LU1A 4TY8A 2Z1IA 1I94K 4Q2MA 5KT5A 5KFSA 4PG6A 2W11A 4LF9K 3TVYA 1A5XA 1NNDA 4FYYB 2FLNA 1UOCA 3ENBA 4KGZB 1CPZA 2AF6A 4DTOA 5KFNA 2UU9K 2ZOMA 2CQ3A 1I6JA 1O13A 1PGZA 2PMWA 2CQCA 2V69A 4OFZA 4Q7AA 3N4WA 4IKAA 3UMBA 3ZDBA 4C2MA 2YNIB 2FB0A 4DV4J 2HQGA 3OVNA 2DYAA 3MMBA 1RT7A 4J7CA 2F4VF 3JS6A 3MM6B 1F0MA 4BRCA 1BI4A 4A57A 1K5OA 3O4WA 5BN9A 2JEIA 3C15B 3ICLA 1ZQUA 5ETLA 1J5OB 1XMQJ 2B9EA 3BUZB 4HACA 4GKKK 2A1JA 3OFHA 4MLHA 1BWVA 3RW7A 5AI0A 4ED4A 1SBRA 3IRXA 4BROA 2KSOB 1QVFM 1OWXA 3BBCA 5BYQA 4OJ6A 3MMBB 1RTZA 3UNGC 4RU2A 3PR4A 3EE3A 3RMBA 1IBKK 4HDHA 4NCBA 2H65B 5HP1A 2BE2B 2VKZG 3OQ2A 1GMVA 2AEMA 5KG7A 5HHHA 1VQON 5T14A 4GKKF 4HAIA 3HM9A 2IJFA 2H5JB 4CH7A 2ZZTA 1GT8A 4DV0F 3ZO7A 2QA4G 5AQFA 1N8RT 1CLFA 1DQ8A 4TYAA 3R2DJ 7ICLA 4CJVA 1JLEB 1ZQXA 3GCXP 1MC8A 2NXEA 2CQHA 4CLWA 4CIFA 3S9HA 1LKYA 5M2UA 1H6KX 3D2FA 2HSZA 3PW5A 2RRBA 2CXEA 2Q6CA 4J9KA 2RMLA 1WEXA 4H0TB 4KI4A 4EFAC 5LMUF 3QERA 4FVMA 2WF5A 1RCOB 2XYHB 2W42A 3D6JA 2MGZA 4QWCA 1TE2A 1T9XA 1RWXB 2JH3A 5EE0A 2W40A 3IBFB 4LBPA 3F2DA 5M1OA 3S1TA 2RSQA 3JSRA 4QWDA 2Q66A 1ZQMA 4QBUA 2W3RA 2OKQA 8ICNA 1RTHA 4YDUC 3J80O 5KFJA 1RXVA 4GC6A 2D9PA 2FY1A 2I38A 4K8XA 3BBBA 4Z6FA 2ISPA 2WONB 2HNDB 3VEYA 1N0UA 3LPYA 3TSPA 3BH6B 2CPYA 4M5HA 4YB6A 3L7OA 3EXYA 4DPXA 2ETJA 2HI0A 5KG1A 1WKLA 2YNFA 1T3NA 3CMAN 4L3NA 4OZLA 3NRZA 3HT0A 4CQ1A 5D6GA 4QS7A 2ZKTA 3HX0A 3C5FA 2CQ4A 1SL2A 1S7HA 1NJWA 3M2UA 4X64J 1S5ZA 3QDKA 2W43A 3PFEA 5U47A 1VYAA 4QIGA 4LREA 3T1HF 3TYTA 2MA1A 1SV5A 4ILMA 2ZM6J 3U3YA 2DNGA 4M63C 4CZFA 4YNQA 2W7OA 2FVRA 4I2HA 5IZHA 4JBCA 2C2ZB 4WF9Q 4IO1A 4C7YA 1HIYA 1VIOA 4KGVB 5HMYA 4I2BA 3E66A 4FZYA 3PJ9A 3R5CA 2NR0A 2R2TA 5D4NA 1EAYC 2ATLA 2Q0ZX 3RJIA 4OCZA 3RAMA 4B9QA 2ZIWB 1MROA 1AFIA 3IBWA 5AQXA 3MBYA 2YNGB 3OYIA 4CNYA 2AX0A 2QWRA 4RW8B 4ZTJA 3UPFA 3MURP 2XBPA 2UUCF 3ZSZA 2DY4A 4KHYA 5EOZA 7ICPA 1ZQNA 3F9MA 2AZ1A 2CH5A 4MFBB 2E2NA 4E3SA 4P71A 3BV8A 4CO2A 4IOAQ 3MFHA 2ZH3A 3T1YF 4FLWA 4NJ8A 5FPEA 3DXMA 3IM8A 3IDHA 3ZSQA 1MROB 3NAEA 3H7IA 2KT5A 1LKZA 2P6SA 2OEJA 2ESEA 2R8IA 2YNGA 2Z58B 2D69A 3UE2A 8ICLA 1Q78A 2H3VA 2YNHA 3CVKA 1N32J 4RPYA 4GVBA 1YF5L 1WUUA 4OKJA 4FJLA 2ZH4A 2FGCA 1Q82T 4FOEA 3DNCA 4CK3A 3F44A 2FBTA 4ECQA 4ZIWA 1P27B 3FK4A 2XSJB 1VJQA 3G10A 4BQLA 3CJ7A 3LDQA 1PSDA 5CR0A 1FKPB 3TR8A 2LECA 3DGPB 3UDLA 3VQBA 3SCXA 1Q18A 1HNVA 1G99A 1FDNA 2F9WA 4JKDA 2O4IA 1TK5A 4FXDA 1RBAA 3ZX0A 1HNXJ 3PCOB 2XNQA 3MF5A 4IR9A 3BBFA 4UB5A 3L2RA 1TL4A 1P90A 4JI5F 2OANA 7ICEA 2LFVA 1BUXA 1H0HB 2D9OA 3AARA 3VQ6A 4K8RA 3AA5X 4B9SA 3MDCA 1EB0A 4TU9A 2YKMB 2RKIB 5LY3A 5KPZA 2BV3A 3R1XA 4Y2AA 3L4IA 3PJXA 1UVLA 1BPZA 1YJ9S 3Q24A 1DFDA 5J0YA 3C2KA 5DDYA 4P0QB 5LSRA 1UWBB 1Y0HA 1HWKA 5ETKA 1VISA 5SUHA 1U8SA 4EU0A 3T1YJ 1BPEA 1X9XA 2QX0A 4HH0A 2JEFA 4E1JA 9ICHA 4PKDB 1TP7A 3AMZA 2RS2A 2F8EX 4J9LA 4XDCA 4CO0A 4QJVA 3UPQA 4FF3A 2RILA 5AK6A 4CEDA 3MD1A 3ZD9A 2XMAA 2ZD1B 4FWQA 2NO4A 1NGGA 3VN5A 4J2EA 2N82B 2H3FA 4IG3B 3TWZA 2WOMB 5IWAK 4OGCA 2MSNA 4HDGA 3E9OA 1L7OA 2HFSA 1ACMB 4FVCA 1VR6A 4Y2XA 3KK7A 3MI7X 2VIXA 4CD1A 4DOCA 3SBMA 4DFMA 1S0VA 4O44B 1HPMA 1VBKA 2G0AA 3BSNA 1O03A 1S12A 3BP8A 2B0CA 1RAOA 1MWQA 2DFEA 3MM8B 4DSLA 2XICA 4NCGA 3SQ0A 3HK2A 1R6YA 4UAVA 2G07A 3ZZYA 4OI3A 3QATA 3PG9A 3KLHB 3NL0A 4KHNA 3SPYA 3THYB 3TADC 3FCVA 2YJEA 3AEVA 5AM3A 5IM0A 4AP9A 3HVWA 5HLFA 2A10A 4B3OA 3QBWA 1Y11A 5KG2A 1FF2A 1D9DA 5KT7A 3CCES 2DHHA 3CCQN 2VF3A 4FXWA 3IC1A 1VSJA 3L6QA 3J81Y 1FDAA 3VA3A 5GAHP 2XCPA 2P5VA 2PA3A 4FKXA 4U9RA 2ZH1A 5DGAA 4LZGA 3WK8A 4C7ZA 2W4CA 4DV6K 2M3DA 4L74A 1S6PB 3QNMA 2K4PA 1QQCA 3G6VA 1XQSC 3D1HA 4JI3J 5AJ3F 4ZK7M 4LRFA 5KT4A 3RMDA 1RYUA 9ICEA 3GV7B 1RT7B 1VQ7N 4WFBL 3FBEA 1RAFB 1A5VA 2WB1F 5M2PA 4A8EA 1JLCB 3F2BA 4NL9C 3TNVA 3FYHA 4CI0B 3SI6A 3H40A 4BDYA 5BPMA 2HFZA 4NZ6A 1M5KC 2EFPA 4M6WA 4CI6A 4A2AA 4CDGA 4DHYA 4YY3F 2KRRA 3RSEA 3PTWA 4CIEA 5JVHQ 1QQ6A 5IILA 4Y3CA 3G86A 1WKJA 4FOIA 3PW0A 3TTDA 3OS1A 4BE0A 1HD0A 4IO9L 1VCTA 1JQGA 1Q82O 4F91B 5G0RB 1YJVA 1Z26A 3E51A 4FF2A 1KHVA 3SQGA 3MM6A 1TMJA 1KTQA 3JPOA 3OL8A 1LWFA 2ATCB 3LALA 4B3TF 2RIJA 4ANEA 3ZSRA 2HB5A 1LVHA 2NZCA 2RQCA 1E4FT 3ASMA 2DUYA 3LP2A 3ED5A 2OSRA 1J5OA 5JS1A 3LP1A 4X65F 2M0NA 4FNHA 3I9ZA 4BR2A 5ETRA 1FFVA 1L6NA 1RQLA 1RTIB 4MKVA 3VEXA 3G6XA 3TZZA 2BRKA 2EK6A 3CCRS 3HHKA 1JCEA 3IV6A 2ZJPQ 2WAQF 1S9FA 3QT5A 1UA1A 3WXIA 3FQKA 5JLFA 2P35A 3PJWA 3MM7B 4ZMMA 1ITGA 4J90A 5C7PA 2VFVA 1KVAA 4H5WA 4JLHA 1F9HA 1CEZA 2MSTA 2C42A 1UCNA 2IBOA 4OZ0A 1L3UA 4MKBA 4B1UB 5J2FA 4ID8A 4AL7A 3H0RB 4JHDA 2UUCJ 4AHCA 2X74A 3DOMB 2WVFA 3TFRA 3BQ7A 4DSFA 3CM6A 5FJ4A 3ETRA 1G3OA 3OYDA 2JL9A 3S6JA 3MCPA 1IM4A 1SC1B 2ZGYA 1F44A 4L6V3 4Y2JA 1V9OA 3AJ1A 3D2FB 1IKVB 5LXRA 5FRMA 1S5JA 1RT2A 3V7KA 2OUGA 4JHDB 1U6BA 2DISA 4WE1A 2ZF5O 4C11A 3MN6A 2WB1C 3M1YA 2PBDA 4CHYA 4NWBA 3OXFA 1SQGA 2XZWA 1I1GA 4RNFA 4O0JA 3HKZC 2QA4N 2KYXA 3O4NA 4HLBA 2C2MB 2MMYA 4IFEA 1BCMA 1FK9B 4CZMA 3O44A 1VSIA 1A77A 3OS0A 2H5EA 2A6MA 4XEIA 1BWFO 3KBBA 2XMJA 2GWJA 4UW2A 5FD1A 1ZJNA 2A0FB 7ICOA 5AM1A 4PL8A 1RTDB 2DF4B 1P6TA 2KG5A 4WP8A 1FNOA 3J8AA 2F63A 1HLWA 4CLFA 2E7XA 1Q86T 4WP9A 4AILC 3GIKA 4ZP8A 3HYFA 3NGSA 4KLOA 2ZTDA 4M7YA 2R7UA 3VQCA 4KRFA 3TTCA 4RLEA 2FHMA 3DFEA 3TAMA 1X4EA 3BN4A 4NLNA 3KLIA 2DFHA 5ETNA 1XQIA 3S7RA 4XO0A 2WCXA 2HQ3A 1UP1A 2GHWA 2FMQA 2MJUA 3F56A 1JLAB 5B0AA 1F60B 3MEGB 4U8VA 2XCAA 4O4RA 3SIPB 2YCHA 4CEAA 1DARA 2ZJPL 4NY8A 1VIXA 4CH1A 3F2KA 3FM9A 4HI2A 3M30B 2W25A 4C0ZA 4PQUB 1JI7A 5J2QB 1CRXA 3RGIA 1YZ7A 3DDKA 5IT0A 2QA1A 1BUPA 1DK3A 3FLCO 4GW6A 3QEBZ 2NYHA 3Q8MA 2PT0A 2WBMA 2FDRA 2ROEA 5KNIA 2UUCK 3MABA 5GMEA 4GVBB 3U26A 2B9XA 2E5LJ 4HHHA 1P8ZA 1NGBA 3QESA 2RU3A 4MLEA 2HS0A 8RUCA 3NF8A 5J2MB 3K2YA 3V81A 2AGOA 1JJ2R 2QA4S 1HQEA 4EI2A 2L5YA 1RT1A 2MQPA 3L3VA 4C8OA 4TUQA 2G9OA 5EWGA 3U1NA 3DLJA 3W8GA 3PFOA 4CEFA 4CO1A 4NLQA 1BOTO 3JPRA 2K89A 1TVRB 3H25A 1K8KB 1XMQK 4OYIA 3CCUS 3UMCA 1X40A 4BY9C 2DCUB 2VPWB 3BO3A 3CDBA 2F8SA 3VEWA 4WIQA 1U2RA 2QWOA 1EIYB 3MOZA 1FTCA 1KLMB 2HFUA 4OVLA 2NLXA 3R7NB 3SI8A 4O3OA 3CJ8A 3ZDEA 3KK3A 2E5IA 4USAA 4NYPA 3HVTA 3NGYA 1WG1A 3C14A 5JU5A 4C3LA 2J0WA 2J0QD 4CZCA 1V5VA 2JVOA 2P2CB 1RDAA 3TTFA 3N7SC 5E84A 3OVSA 4KR0B 4O23A 2GWSA 3CC7S 4PPZA 3EDQB 1LAVA 4EP4A 5H9EK 1IKWA 3WC2A 1TL1B 2E1EA 4IC9A 1T9YA 2VWJA 2BQ3A 2LBOA 1SKRA 2BJ3A 3WZ0A 2OZMA 1CULA 5AJ3J 1H38A 4C0HA 2UV8G 1DEJA 3BGUA 1C6VA 1U04A 1R8BA 1IIPA 5ALGA 2AJ4A 4K43A 4CCHA 1C4AA 4DV0J 1Q5YA 4O4GA 4Q0BA 2K8GA 5BR8K 3H20A 2W9BB 3LQVA 4O5EA 3KIOA 2UUAJ 3O4QA 4DL5A 2YMPA 2RKIA 5FP0A 2IVMA 2WAQD 5KRTA 2GAGC 3PIOQ 3ALYA 2ZITA 3K8VA 1E4GT 1K8AT 3I8DA 3ZYYX 1VRUA 3J80Y 4QWEA 1KFTA 3VOVA 1YKWA 3V5RA 1DK2A 2KZMA 1C0TB 1ASWA 2E2OA 1RT4A 1S1XB 3NNHA 2FVCA 3VQTA 4C4WA 5CJ7A 1KD1T 3M6XA 1HEKA 4Y6IA 1NDPA 2ILYA 1OVYA 2QA2A 1F2GA 4DV0K 4ZA1A 1N36K 3Q0AA 4BS2A 3CCRN 4F7VA 2XQCA 2CWKA 2KXHA 2QWMA 4I0WA 4CLPA 3HT3A 1URNA 5J29A 2CJ9A 1JN3A 3GFYA 1J9AA 2F8TA 1VQ8S 4K8ZA 1E6YB 1VC6A 3OD2A 3JB9k 3CG7A 4IO9Q 2NRRA 4ENOA 1OSDA 5KPRA 2FPMA 1ZJMA 4QZFA 4LF8F 3BQ1A 4IQWA 4B1WB 4KV8B 1JMTA 3MM5B 2FJAB 1HJOA 2EDUA 1Y64A 3O8WA 1B9FA 2QV6A 1Q9XA 4JI8J 4TSXA 3ADAC 1LW0B 1WSGA 2ZH8A 4JV5F 2I6WA 1UA0A 2V2KA 3A5NC 5AM4A 2EFQA 5AKJA 1OKJA 1T4GA 5F9LA 1T44A 3MC1A 4B9UA 1LCUA 2F4VK 1ZZNA 1SJ3P 4RCHA 2G0IA 3RRHA 3M8YA 4I67A 1TV9A 2CG4A 5ETSA 4B3SJ 2DHAA 4JB8B 2G8KA 1B70B 4ICLB 3M9MB 3D0GE 3PM9A 2CQPA 4PPDA 5F8NA 4IR1A 3LVVA 4CGFA 2XVTA 1QHAA 2LEAA 1RUSA 1N5YB 2YHWA 1IBMJ 3GJQB 2G0JA 2AH5A 3LAKA 4ITSA 2YKOA 5ALOA 2IM3A 2VG6A 2YWHA 2BRLA 2ZUCA 2PC6A 3LDNA 4P75A 4JD2B 2LU2A 5ALQA 8ICMA 2K3KA 4RWWA 5C5JA 3WQPA 1KEJA 2O5DA 4DR4K 4KX5A 4F3TA 2D3ZA 4DHVA 4KLMA 4DI6A 2DT9A 3THWB 2VDIA 3VAFA 1M5SA 4YB7A 4I2CA 1RHQB 4LFAJ 4E2FB 1Q3VA 9ICVA 4OI1A 4BC5A 1AZSA 4DPTA 1EXQA 2VYPA 1YT3A 1LW2A 2MTLA 3I0SB 3N5BA 4DL3A 1R0CB 4IOCL 4LSLB 4P2HA 5GAGU 1R3NA 5K8PA 2YNIA 2V8DA 3TR5A 4JKGB 4BGAA 3MPDA 5HATA 2QEXN 4X65J 3JQKA 3DWLA 4CF4A 4B02A 2O8EB 5J2KA 3PV8A 3GZ7A 3K5PA 1ZD4A 3D9BA 1HKBA 2H9ZA 4IZ9A 5M1FA 1MMDA 3G4SS 4LF7J 1GK8A 2OPPB 2D0AA 4GV9A 4BC7A 2XRIA 3HHLD 3IMQJ 1RHJB 1Z00A 1LWXA 1Z05A 1NJIO 4M7XA 3RJHA 5CA7A 2KXFA 4ZP9A 2HGNA 2LMRA 3KD3A 1ZS6A 5K5MA 1JMSA 3GFHA 3THPA 1T3VA 5ALVA 2DBYA 3CD5A 4ECRA 1RWNB 3RUBL 2MAXA 4AHUA 1RG6A 4LF6J 1SQKA 4AHTA 2WF6A 2IHNA 5AKEA 2FJWA 5DLFA 2OAUA 4DX8H 3OYKA 4W5TA 1NM2A 2MHNA 1UMJA 3T5JA 1JLEA 4DCPB 4MFAA 1TMMA 2XI9A 1YVFA 2HHWA 2BKOA 8ICZA 1X0PA 2CRLA 3JPTA 2HW3A 3EVWA 2CYYA 1CG2A 3T6JA 1RBRA 4LIRA 1URJA 4FO0A 4CD3A 2UV8A 1SGGA 8ICHA 2OFHX 1I3OB 3B6PA 1TELA 4G1QB 3GBTA 3CFRA 4UB3A 4X2BA 4WFXA 1BL3A 2EAOA 4IWVA 4TN2A 5F0UA 2YY3A 1FNMA 1HNXK 2ZIUB 5A8WB 1T6CA 1QSSA 2PMZC 3TAEA 4WE1B 5KFAA 4DOAA 4OMFG 1NZBA 2BE9B 2P9UB 1EO1A 2AEFA 4JYAJ 2VBYA 3D4JA 2R7WA 5HVHA 3GYGA 5HRPA 2MKYA 2KG1A 4Q5VA 5KG3A 3TSUA 3NRWA 2MDAA 3Q8RB 1QZ5A 2VQEJ 4WZQA 1X4HA 3H59A 5DBBA 2YKAA 1HD1A 3LGMA 3ET6A 4DUYJ 4IRKA 2AD9A 4CZHA 1J5EK 2KI2A 5KFHA 2RS8A 3J7ZO 4K7QA 1JK9B 2VICA 5D8HB 4G65A 1VQNS 4KLUA 3PR5B 3DU6A 1Q7LB 4C8MA 1E3MA 2D4WA 4DCJB 2X3GA 3C6TB 5C15A 2V8GA 5AM0A 2KFNA 2D1KA 1CI4A 4C4TA 2A41A 3M4XA 4QIVA 3KJNB 1UVJA 4F4ZA 2A6OA 2DGXA 2ZH5A 2UVWA 3KKFA 3T1AA 5GAGI 3T19A 3VF6A 3VTIA 2PFFB 1AROP 1ZQYA 3S3NA 1L7MA 2V8VA 1MWMA 2FJVA 2P9SB 1B9DA 1KOHA 3J81U 4ECVA 1WC5A 1XTZA 2P9LB 4USKA 1MU2A 3KFUF 5IIMA 1N8RO 4OX6A 1C1BA 4FWKA 4DUZK 4FWNA 1Q7YO 4I9QA 2ZUDA 3LWMA 1M5OC 2FD2A 3DDNA 1BQMA 3IDWA 3RJJA 4MYTA 1M5HA 2YHXA 2G06A 5J0QA 1EKRA 1Q95G 3O1BA 3CCTA 5T41A 3VQ4A 4BVOA 2GJ2A 2A5XA 4XK8C 3EEQA 1S22A 5T7LB 2DNPA 1LOTB 4IRCA 2VKQA 1HYVA 3SDEA 1FRHA 1VC0A 3N4PA 3HULA 1RI7A 1KBRA 5CRXA 3OTOK 2BQRA 2CPDA 4P73A 2OEKA 3UVJA 2Y1RI 4JV5J 4ZDNA 3UDCA 2B4VA 4ED0A 4ED8A 1ZOLA 4K0KK 2K8CB 4X4PA 1KAYA 2ZZNA 4N77A 1VQOS 4TQSA 1W0HA 5EX0A 4KE5A 3KHRA 3SCJE 3H2LA 1KS2A 1JLGB 1UPHA 3FE1A 4MO5A 3V4IB 2GO7A 3ZLJA 3HRDD 2G8UA 4CK1A 2NNWA 2G2ZA 3E01B 2HIQA 3KLEB 3HVTB 4HHJA 2BCVA 3JTNA 1GMWD 5IT4A 4GVMA 1SKWA 3L4QA 1SC3B 1B3TA 2FBVA 4KTQA 2H3ZA 3ILIA 3OR1A 5ITHA 1TL1A 3U02A 1U45A 1N2XA 3H8YA 1WCLA 2JGUA 2DO0A 2IRUA 1P7DA 1VS3A 1EZZB 4AHVA 1QTMA 5FIIA 8ICTA 1VQKS 1VGYA 3E3XA 1RT3A 3GZFA 4PL7A 3V4IA 5FPDA 4EP5A 4NOHA 3D28A 3BGOP 2HBQB 5KG6A 3FUYA 4LR7A 2V52B 3CHWA 1SL0A 4UBCA 4OPJA 2ZGZA 2HQIA 2UUBF 4Z4FA 4RUAA 4NXMJ 4DPUA 2KJWA 3FBBA 2K1RB 2BDUA 3PYGA 4KI6A 5JRTA 2XIDA 4KREA 2VBWA 2H5IB 5AK3A 4BC4A 1Y88A 2VA3A 3KOOA 1PJ5A 3CCWA 4DPYA 2P5GA 5D0GA 3FR0A 1XSNA 4B3RK 1KOOA 1NZPA 2Q1NA 3HI9A 2P9NB 2QM1A 3U7JA 2WOMA 2R8KA 1S9EA 1ZA2B 5IV3A 3SK3A 3MGIA 5F8LA 3PRVA 3T1HJ 1ZQQA 4ISGA 3QU7A 3KNGA 2VOPA 1SB6A 1GX6A 3JSYA 1N63A 4Y1CA 8ICCA 1JKHA 2GBZA 1U7LA 3SLCA 5J2GA 4E1MA 3OBYA 2M52A 4DQQA 3NTUA 4O44A 4PH5A 1FEHA 4WQ5C 4OX9F 2Z30B 2JEJA 2DBBA 3MN5A 3HKZF 4IQTA 1MMNA 3PO4A 2BW7A 3ZTSA 4OJPA 3V9SA 2KVIA 2R7TA 9ICTA 1HQ2A 4WBFA 2R7XA 1N33J 5CZVA 3SSSA 3C6UB 2B4OA 4UAWA 1BQNA 1RWOB 2ZJQL 3DXMB 3R6MA 1F5BA 4YFUA 2R8GA 3ULEA 3CERA 3K5OA 2IVNA 4ZOSA 4KKOA 1CQMA 1YRUA 3FBCA 4RW6A 3UCGA 2ASPA 5DDPC 4DS5A 1T3QA 2ZJQQ 3TJ8A 2V63A 1NEEA 1NOZA 3HPGA 2IOCA 4FBTA 3S01A 1RA6A 1XNQF 4B3SK 2ZBQA 3WEEB 4FK0A 9ICNA 1S6PA 4UY8T 2IOFA 1O0PA 2WVEA 1U6ZA 4XRHA 4ISFA 3PRDA 3MUMP 2XI3A 1SJQA 1I3AA 3QFUA 3LANA 1U26A 1ZQAA 3NASA 4KHPK 3GQCA 2XLIA 2MZRA 4FJ8A 2RE2A 3D0IE 5KL1B 2D7SA 3AY9A 1DTQB 2O8EA 3M8PA 3FVYA 2ITMA 1LEOA 5HR6A 4X62F 4CZGA 4H4OB 2DH9A 2PFPA 4WZMA 2KFZA 3SV4A 2GAHC 3AVBA 4RW4B 1VSKA 2Y9UA 4KAZA 1FCAA 1QUPA 1Z00B 4UW9A 3IA0A 1XNQK 2IS3A 4HYKA 3WKCA 4F5RA 5F8GA 2RUSA 5J0UA 2CPFA 2NYVA 2HBMA 1N5VA 4FJMA 3ID8A 2RU9A 5AKZA 3FGVA 1WKKA 1ZD3A 4F71A 1H72C 1Y5IB 1CQNA 1VJWA 3GG1A 2EX3A 4K41A 3QZ8A 2YX1A 4CF1A 2IIRA 2DITA 5D0EA 4U67Q 1AW0A 4FLTA 1PVQA 2HVEA 2DKXA 3PDNA 3IXQA 4ED6A 1LAWA 1BWEA 3CWJA 2J9CA 4KX3A 4LJXA 1CC8A 2P51A 2OPRA 1NGJA 2ZJ5A 1T05B 4DCCA 1NO8A 2Z2LA 2JJ4D 3WK9A 3TEHB 1V97A 7ICTA 1IN0A 3ICXA 4CW7B 2H3QA 1TUYA 1JJ2M 4KPCA 3Q8SB 5KFDA 4OL8A 4EK2A 3EW9A 4RQ6A 1IR2A 2ERRA 3ZZTA 1T8EA 4ZP7A 1L3KA 1F3VA 1N48A 3AOAA 3KJVB 1V5IB 3T5KA 4BHQA 4X5VA 1N54B 5EUHA 3QGIA 3K9JA 4MJKA 2NYIA 2N7YA 5IM0B 4FM0A 1JIHA 4OIXA 1ROFA 1ZBUA 5C2DA 3QU4A 3ATVA 3ZSXA 4M3WA 4GC7A 2J0SD 4OX7A 2Z1HA 8ICRA 9ICSA 2MQLA 4KLHA 1N6QA 1MNEA 4FYWB 5DQGA 4FJXA 1J2MA 4C1NI 2I8EA 4BUGA 3FSIA 4ETXA 4NV0A 4UB4A 3A13A 4WFZA 3L3CA 2RJZA 4KHMA 1Z2LA 3ZZRA 4J91A 5AE1A 1ZM4A 1C7YA 1NGAA 2IFXA 2JWNA 4K4SA 3S8SA 1T9WA 3NFAA 1NPKA 2D41A 1IXRA 3N9UC 2KJ8A 1HW8A 1X9MA 4AE5A 3JSMA 2ZUGA 5DJBA 5BPNA 1FKAF 2VGNA 1RTDA 3R1HA 2V34A 3EL2A 1YX2A 4IH6A 5A6PA 4HUGA 3MR6A 3OY9A 2AW0A 1WAJA 3H4BA 1R31A 4LF5J 4P4OA 3JSMB 3SQIA 4ILRA 4DV2F 5AK4A 1QS4A 2XMTA 1ZZFA 4GKJF 5E3AA 1WACA 4X62K 3V6DB 3F9KA 1PCAA 3EGWB 5G4DA 1XN9A 1FHTA 3V9UA 2A1JB 4NYFA 5IC6B 3GG4A 4F2SA 3D0HE 3SCKE 8ICXA 4M8LA 5HBMB 4HUFA 2AJQA 3NOCA 4KLQA 4GMJB 2BJ9A 3Q8PB 3AH6A 5L1IA 1NPPA 4JYAF 3G87A 2GX8A 4D3HA 2KLAA 3MEDA 2ODGA 1DQAA 1K0VA 4OGEA 4B3SF 2FHKA 4PHEA 2C3OA 4JI0K 4F0HA 5AQGA 2KQ2A 3P6YC 5HROA 2VASA 1RDCA 5HP4A 1RAHB 2Y1IA 1NOMA 1IG9A 2DPIA 3M9NB 4FF4A 5L1KA 1RXWA 1QSYA 4CLZA 4Y00A 1LWCB 5DMRA 2DHSA 2FPHX 4DUZF 3AA4A 1HR0F 4CFCA 3SBGA 2XO6A 1PBUA 4NL9A 3F5EA 5BOMA 4NLOA 1M90O 2O66A 1SZPA 4B9MA 5LMNF 3VEZA 3V81B 1YJUA 3LZIA 3I5CA 3CJ4A 4M5NA 1HQEB 1FW6A 3OHRA 1SS6A 5DM6Q 1NU4A 1K9MT 1Q8LA 2BXJA 1SKSA 4JAXA 2F44A 1PILA 4CT8A 4A8QA 2RQ4A 4OX9K 1EXNA 1VHXA 3MXIA 5GTHU 4WJ3B 1GNKA 4M3YA 4IOCQ 1J53A 2QLXA 1QTNB 1F21A 2K2PA 1HI8A 3CIMA 4U8YA 4M9GA 1KFSA 2KK0A 3N7RC 4NX9A 3O3HA 4PGQA 4A5BA 5JMNA 3ONQA 2G13A 4JS4A 1N56A 1SCJB 2FF3B 4B3RF 1FESA 1WF2A 2B6GA 4NE9C 3ISCA 3CCQS 3BZCA 2QL7B 4QW9A 2OXOA 4FJHA 4DLGA 2RDJA 3I33A 4NXNF 2WW8A 4YOTA 3SCLE 3G8QA 3SNNA 1C20A 4JI2F 3IWNC 2MKSA 2E1AA 1HKCA 1BNPA 1R8PA 3ZDCA 3TPQA 2AKWB 3DXSX 1NMDA 1Y7PA 3NNAA 5ETTA 1S6QA 1NGDA 3H2VE 4BVPA 3RRGA 2HLTA 5C42A 4AHSA 1GOBA 3OR1B 2KHVA 3G0ZA 3P5TL 1VQ6S 1WORA 2FIUA 4IFYA 4Z4CA 4PY5A 4DU7A 2DNNA 1MN7A 4XA5A 5E33A 2QXLA 4Y0FA 4O0NA 3QJLA 4U7CA 4OV1A 3BN7A 4FLYA 4Z6EA 2RF2B 2HHHF 2ATQA 2XS5A 1CJTA 1GH8A 8ICYA 1NH7A 4CYUB 4F5QA 3NKYA 3GU0A 4ES1A 3KZIU 5HNKA 4Y2VA 1CC7A 1ZAVA 2E5LF 3QLHA 2PFNA 4V1Ak 2VG7A 1NGHA 3TU5A 4CK2A 5DBCA 4B3MK 2PA8D 5HHIA 3QMQA 1HBUA 3T9NA 1A5WA 2L9WA 1ZQKA 1DURA 3QMLA 3NDKA 2X78A 4YOWA 3DCAA 4UTGA 4DV1K 4U95A 1S8OA 5KFPA 3AODA 2DR8A 5HMLA 4I6WA 4DMZA 3ZSYA 4CRJA 2CQBA 4IJAA 3CCJN 2QARA 5AI4A 5AKKA 3SAFA 5F41A 3OVBA 2M7SA 5AXNA 2P9SA 1ZQTA 1HX1A 3UQ0A 2D3O1 1RBVA 1HWJA 4M1KA 2ZJAA 3MPVA 4ZPAA 1GLBG 4AXIA 1KL9A 1WOPA 3NGZA 5DBAA 4ES3A 3HPHA 1OXJA 1J97A 3H0LB 4OO1J 2KN7A 3HL8A 3DXBA 4RQ4A 4PKHA 1VMBA 4WWSA 2NUBA 3NMUA 4JNEA 2H1YA 3Q22A 3MR2A 3CFOA 3RMCA 2JH7A 3T7ZA 3EUB2 2MKHA 4X4UA 2E2QA 4KB7A 3MMAB 4DU3A 4DR7F 3OL6A 4JI1K 3SV3A 4KGMA 8ICVA 5JVGQ 2D0OA 3MCAB 4UOHA 4H0VB 1HNWF 2VG5A 1YTUA 2AGPA 2IPOB 2VB6A 4FLVA 1YJNS 2G5HB 1U02A 4OYXA 3OHBA 3SUOA 3CULA 3QETA 4BG9A 4AQYJ 1XMBA 4FSVA 5F8HA 4JEPA 3OYMA 3HJVA 4LF7K 9ICWA 2NCKL 3DJCA 5J8YA 2KMDA 4ATNA 3CO0P 4QQBA 1RWWB 3VQEA 3UI3A 3KWGA 2D3OR 1FO1A 3KD1E 4XIUA 3TX8A 1RU1A 2XMUA 4FJGA 3OFEA 2QGFB 1YJWS 1ATSA 2YMLA 4OI6A 2LQJA 4MYUA 4WFNQ 1PBAA 3R9LA 1J5EF 8ICOA 2AP6A 2DIVA 2FBYA 1VQLS 2MKIA 3I31A 4GRSA 5HN0A 2NZ4A 2VHGA 3MUTP 3B78A 5A0YA 4RNHA 3CP8A 4FZZA 2Q31A 1QAIA 1Q4RA 2EC0A 4QAGA 3ZC4A 4JMUA 4ID5B 5B8HA 1VQ6N 3MUVP 3VWSA 4HVZA 3I0RB 2BANB 2MUTB 3J7AP 1XO0A 3CW2C 2ZC3A 1ZBTA 2V2QA 3GIRA 1X9SA 4U96A 2L41A 2CZ9A 3FZKA 2YB1A 3WT0A 1N5TA 4DZDA 4DPOA 3QUCA 2B8PA 1OYDA 4ID5A 3VENA 1ECWA 3W66A 4NLPA 2HVIA 5SWMA 3H6EA 1MMLA 4ES2A 4JI4F 1V85A 3O9SA 3GFXA 3TVZA 2ZH7A 4JI1J 1BQXA 5E0OA 1QSLA 3Q8VA 2NPIA 1RBUA 4HH1A 4WTOB 3VGSA 3EKUA 4NASA 2WC9A 1K73T 4CJ7A 2WB1D 2EEYA 5KFWA 1XWLA 2OH2A 4FDFA 1FD2A 1XR6A 1N5SA 7ICMA 2OCEA 2E5GA 2OO4A 3I5AA 2K4EA 3S6EA 2XWXA 2Q2RA 1VHFA 1ZH5A 3VAIA 4FZMA 1TL7B 2HYIB 2AIRB 1S5LU 3WNEA 4EGLA 2WK4A 1SB3C 4H5RA 3JXOA 3OLAA 1RAGB 3D54A 4F4YA 3MHYA 5CQGA 4H0PA 3DRRA 3AO5A 1A0PA 5EWFA 1HKAA 3SD7A 3T5HA 2JFKA 3L7PA 2A3ZA 3UFCX 3T9ZA 1EETB 3UD5A 3CJSA 4UAYA 5EN1A 4FP9A 7ICVA 3LK9A 1YVNA 3UQ2A 4CGZA 2E66A 1Z1VA 1HI0P 4FCYA 3VCDA 2J6TA 3IS9A 1UEVA 5IFMA 5AQIA 2O01C 4AUKA 3MDQA 3K2PA 1GLFO 5C12A 4N8NA 1WC3A 3S3MA 4A2BA 1JLQB 4DV4F 2XHWA 3EX7B 2V8HA 2OA8A 4RL1A 1FK9A 2CA9A 5HRSA 3OSPA 5ETMA 5AE3A 1KVCA 2OD6A 3THYA 1XR7A 3QFWA 1Q8KA 2QFIA 2VOOA 3IG8A 4CLKA 4ZLPA 3QNNA 4BQZA 4KGXB 3TAQA 3LP0B 8ICJA 2YNFB 5RUBA 2X1BA 1WWVA 2QFJA 5AQSA 4YXMA 5AXLA 2YN4A 4F5NA 3OR2B 2YQEA 3M8QB 4DV1J 1SH0A 2CNNB 4CF3A 4N5SA 1ZQ1C 3ILOA 1A9NB 2KL8A 4JRQA 5C0YA 4GY2B 4E0DA 2GQQA 1IBLF 1YUWA 4DR4F 3G6ES 1KVBA 4Z4GA 4Y28C 4MKYA 1YSJA 1A6LA 4F26A 1RQNA 4F0MA 2JZBB 2DGOA 5AXMA 4LF5K 4WFAQ 2BPGA 1LFWA 4NZ0A 3LW5C 3FMBA 3H3OB 5AKLA 1VK8A 5LJ5Y 2IGIA 4K42A 4UZBA 4A8WA 3PHEA 4RQ2A 4HT7A 2DNZA 1Q46A 3VAGA 1OYEA 1QQNA 3UXOA 1ZQDA 3VQQA 2PSZA 1R8AA 2GIRA 1UW4A 2J9DE 3DOKA 4Z0UA 5KFKA 4BR5A 1C0FA 1T95A 5AK5A 3QT8A 4I69A 4KRWA 4YP3A 2VCPA 3Q2TC 4KLJA 1WSFA 1F1BB 3MM7A 3L3FX 4KHQA 4CRXA 5BR8J 4LR9A 4DBQA 3BS5B 3OTCA 3KHYA 2BHNA 3P39A 2W41A 2EPIA 4RKUC 2IVFB 4YG2A 1TK0A 4RW7A 2I5JB 2M8DB 2B3TB 3C6HA 5A8KB 4DR6J 1CS4B 3MECB 3DLHA 3WU2U 3NVVA 3BY5A 2KIWA 4B8CA 4LF8K 3G6EN 1IQTA 4CVNE 2OLWA 5C2GA 3HHLC 1B4SA 4NLSA 1FRIA 3DAWA 2J0XA 3WXJA 3RB3A 4K4IA 4J9MA 1EKEA 1XK8A 2HAFA 3R5DA 2ASJA 5KFLA 4F02A 1HBMB 3CJ0A 2J76E 3O80A 1RT5B 4B3RJ 2AT1B 3MECA 3RW6A 1ZETA 3HZ6A 1W7AA 2M2BA 4QYRA 5K14A 4YVZA 3VQ8A 9ICJA 7ICUA 3BKUA 3O3GA 4Q43A 2ISOA 4QZHA 2EFVA 4FWMA 1N34F 4KY3A 4CJRA 2ZNZA 2R2SA 4JI3F 5H1SQ 4DDFA 2DKOB 3O9UA 4O55A 4YDDB 3JTOA 4H5TA 3PYEA 4KLSA 1ZRMA 1JLFA 3DI6B 3IG5A 2MKKA 2HLUA 5FROA 3KD5E 1XSPA 4A62A 3W9JA 1B7YB 1VSFA 9ICKA 4C0OC 2BQUA 4P0PA 3SZ2A 5AICA 2F7VA 2CPZA 4X4NA 3C95A 1ZM3A 1TUGB 4DTXA 3S3OA 3HX9A 2CVEA 3CT9A 1ZD5A 3CIPA 4R5PB 2ZH9A 2PFQA 1BA1A 4GMKA 2PKEA 1HRHA 2F8KA 3DLKA 4BRIA 2QMXA 3UCZP 1NK0A 2YKQA 1VFJA 5ALFA 4OI0A 3U9ZA 2CJBA 5IIIA 2G4BA 4FK4A 3I1YA 4ZVRB 1S6OA 2WVDA 3GE9A 4YR3A 3CDEA 4CZJA 1RU2A 1WSVA 3HHLB 1IV8A 5JS2A 2DXEA 2KHCA 3POTB 3UKUA 2GA7A 1LOUA 4ACOA 1TKTA 1U2VA 5HL7Q 1VBXA 4FYVB 4OKEA 5L8RC 2Y0SF 1RDWX 5AKGA 3AO3A 3KDOA 3M2VB 4YR2A 1JJHA 3TAMB 4J5OA 4NEZA 4H0YB 3VEVA 3H8SA 5DDMA 2D1CA 3A0BU 1GFWB 1S0MA 2QLJB 3RR8A 3D0PA 5AM2A 5E7OB 4DV7J 3IMXA 3TAGA 3MMCA 2VL1A 4HHTA 1PYSB 2R7OA 2ZDOA 3DYAA 4J9RA 3PSIA 2Z2MA 3P5JA 3HP9A 3KYLA 3PKYA 3OS2A 2O8BA 3H8MA 4CLLA 3FZBA 2PIIA 4M95A 4NB4A 4B3TK 1S0OA 3DGPA 1U9LA 4R0EA 4RQ3A 3HKWA 4MIAA 1KCFA 4RO0A 2O8DB 4LVOP 1ZM2A 2HVHA 3WBZA 1UAWA 5JJBA 4HCBA 3TSQA 4MK9A 1HYSA 3R6GB 3MTJA 1IM6A 1C1AA 2O8BB 4YEAA 3I82A 2PMHA 1NKCA 1S1VA 2LDYA 3O3FA 1RT1B 4WU3A 3CETA 3FEXB 4Y2KA 5EX5A 1WNEA 4BC3A 1MDUB 2VDHA 1K8KA 5I3PA 4ZLNA 6AT1B 4ECWA 5HVGA 2DO4A 2GIQA 3ULDA 1M6YA 3CRXA 3RB0A 2IJNA 2IBKA 1Z25A 4WCEL 3IWLA 3EUNA 4Q8EA 4UQGA 5D3GA 1J2NA 3A12A 1DLOA 5ETOA 1IBLK 3OPXA 4F2RA 3EWAA 7FDRA 1L8LA 2BBEA 4F25A 4DUYK 2XTJP 2IC3B 2OEMA 3OSNA 3OTEA 3LDPA 2DNOA 4JKBA 3QNWB 2FHJD 4PCQA 4YB5A 1Y3KA 4NLKA 3PW4A 4H4MB 4JI6F 1FRJA 4RZRA 5DDRC 1NSAA 5KFUA 3HSCA 2FVPA 1IKYB 1OY6A 5A0YB 3CI5A 4P72A 4XPEA 5FLXU 5HQLA 3C1ZA 1BU6O 3AHPA 3VCBA 1JLBB 1NK7A 4RBTA 1KQQA 3KK2A 1WSJA 4QYZK 2B4JA 4FWOA 5KFQA 2CQIA 3HBTA 2W04A 4MDAA 5IC4B 1O5JA 3FBFA 2HKEA 2Z8QA 2VBZA 2R18A 2ZM6K 3SMZA 5ALRA 3K0SA 1HMVB 3N01A 2XB2D 4B1YB 2W9AA 3TUJC 1RBOB 3MDFA 1YIJS 3X3UA 2HS4A 4O5KA 2KXNB 3WXLA 2E9RX 3VAJA 2DTJA 3I4HX 4DTJA 2EG1A 1WI8A 2RRAA 1YAGA 4M0AA 2YV0X