4O0IA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
SKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with 2'-MeSe-arabino-guanosine derivatized DNA
rcsb
source organism Geobacillus stearothermophilus
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o0iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4o0iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o0iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0iA01
3AA5X 3HK2A 3PUFA 7ICGA 1LWEA 1JN3A 5BOLA 4Z4IA 4YD2A 1QQCA 1C1BA 1RTDA 4CEOA 3ZSVA 2FBVA 4IQUA 5J1EA 1D9FA 4FJIA 3GFKB 2R7YA 4BXOB 4CF0A 4J9QA 3MXJA 2G8IA 2QKBA 4DTXA 4JV1A 4PUOA 1JKHA 3C6TA 2JEIA 2PFNA 4QZ8A 2F8SA 2ASJA 2IOCA 4Z4EA 4FJHA 2ZQBA 4JWMA 1BQNA 3HXMA 3RB3A 2IAJA 4LZGA 5KFBA 4QZDA 2PY5A 8ICOA 8ICUA 4H4MA 5KFIA 2Z1GA 4P4MA 4M04A 3UXNA 4QWDA 3O4NA 3LWMA 1C0UA 4QOZB 3L2UA 2W9BA 1HMVA 3ZDBA 2OPQA 5D3GA 9ICBA 4J9LA 5KRTA 1BI4A 2X6SA 1BVSA 3IHQB 1BCMA 3DLBA 3ZSWA 1WSIA 1D8YA 2DPIA 2B6AA 5KFNA 4QW9A 1CEZA 4P4PA 5KFQA 3ZSYA 4XA5A 4ED3A 3K58A 1NOZA 1QSLA 4CEZA 1ZQSA 5HRSA 3OYDA 1BCOA 7ICEA 4PA1A 1TKDA 4YMNA 2KZ3A 3SV4A 4ED2A 3QEVA 3T5HA 4FK0A 3N4MB 4YMOA 3V1OA 4K4IA 2Z1IA 1EP4A 4C8LA 5J0OA 3DLHA 3HP9A 2PFQA 4BDZA 5KT2A 4ZTFA 2ISPA 5KG1A 3PO4A 4DEZA 5JS1A 5KFWA 3G0ZA 3PX0A 4F2RA 1MSWD 4R65A 3VQ7A 1HNVA 3M8QA 4F5OA 9ICKA 2G8UA 3HSTB 3K5LA 4DL3A 2MAXA 4CF1A 2RDJA 2OZSA 2BQRA 4DOCA 1BISA 3V1QA 1RT2A 3NF7A 4I2QA 4O0JA 3GV8B 3PR5B 3C2LA 4KN4A 5DQIA 3OYNA 3ZT3A 4QW8A 1KFTA 2I5JA 3L2WA 4DSIA 2XY7A 1JLGA 5L1JA 3C1YA 2KZZA 4MFCA 4M3RA 3NBPA 4CHPA 1CXUA 3K59A 2NRXA 4YQWA 3M9MB 4HUEA 8ICFA 3HWTA 1ZQIA 3DLGA 3L2VA 3LK9A 4F3TA 8ICZA 4RQ2A 3RJEA 3KK1A 3MDCA 1D5AA 4RPYA 4OVLA 1S0NA 4DU1A 4KLDA 4CEBA 3SI8A 3RTVA 3V72A 3LDAA 1HJRA 5IIKA 4Z0UA 2UVUA 1CXQA 3Q8RB 1RBTA 2H5XA 5SZTA 2AGQA 5TZVA 1RBVA 1CZ9A 3ZT1A 4DSKA 4YN4A 2VG5A 3LZJA 4ID5A 3L3UA 2IS3A 4CFAA 1K6YA 2HHWA 1S1VA 2FC0A 3UPQA 4OKEA 3OYLA 2HW3A 8ICKA 4IG0A 4UBCA 1A5XA 1RT5A 3VQ6A 4CF9A 4MEYA 4RQ6A 4CFCA 7ICKA 3KLIA 2IHNA 4O44A 3KHGA 1B92A 4Q5VA 4M9NA 2C22A 3NCIA 2PXIA 1JLFA 3OS0A 3LPUA 2ZJAA 5EOZA 4RW8A 3RJJA 4PPXA 3KLGA 4I2AA 1ZQEA 1VSMA 5C42A 4PWDA 3V6DA 2JGUA 4CGGA 3ASMA 3K57A 3EYZA 4PH5A 3VQ5A 1RNHA 1SUQA 4CJ3A 1HYSA 5I3UA 4RW6A 1CLQA 3OJUA 3FFIA 1NKCA 1UOCA 5DG7A 2J6TA 5DGAA 3UXOA 5T7BA 4F8RA 3CFPA 1TVRA 3P1GA 1B22A 4I2DA 2FMPA 1S0OA 4FLTA 3JPOA 4YFKA 4RT3A 1ZQPA 1NJWA 3NE6A 1JXLA 3KD1E 7ICRA 2KFZA 4B9UA 1TGOA 3UXPA 2NRVA 4RQ7A 2E4LA 2JEFA 3SV3A 5IINA 1YT3A 1REVA 3H40A 3JPNA 3VQ9A 4FJLA 1RBRA 2DFFA 1VRUA 2KN7A 2XHBA 3M8SA 4N76A 4RNMA 3ZD8A 5HP1A 2P6UA 4CFBA 3F9KA 3NDKA 2D0BA 3ISDA 2UVWA 3SNNA 1T3NA 3MR5A 3S3NA 1NJYA 4FJNA 2XO7A 4ECUA 3Q8PB 5J0XA 4CEDA 5KFXA 4MFAA 3SJJA 5DB6A 9ICEA 4B9TA 4Z6FA 5DQHA 2D0CA 3AVHA 4DOAA 4XQ8A 4AHRA 1L5UA 3GIMA 1NK8A 1JLQA 1TK0A 4M6WB 4YP3A 4YR0A 5J2HA 1C1AA 3OSPA 4O3SA 1C7YA 3ZCMA 4MFFA 1NJZA 3PW5A 4YVZA 3TAMA 3Q8MA 4ECWA 1ASUA 3QINA 4FJ5A 8ICIA 3B0YA 4NY8A 1RZTA 4FJJA 3ZDAA 1A77A 2I9GA 3I0RA 3ZT2A 1ZQHA 4I28A 2JZBB 4BACA 4BDYA 3OYMA 2FBYA 4YCXA 4CJLA 4O5EA 4C8MA 3PW2A 4FJ7A 3K75D 3HW8A 1JX4A 4E1NA 1JLCA 3ZT0A 1MQ2A 4I2GA 4M3ZA 3MR6A 8ICEA 7ICJA 3RMAA 3RH6A 4ED7A 2IBKA 4KAZA 4HTUA 2DFEA 3VQEA 4NYFA 2MUTB 3PMLA 3A2FA 3MR2A 2G8FA 1RXWA 8ICXA 4UAZA 3PY8A 1K1SA 2V9WA 3SQ0A 4J9NA 2FMSA 1Z3EB 4FLXA 4KMUA 2Z1HA 4I7FA 1HQUA 3ETLA 4TUSA 1HYZA 4TURA 3EW9A 3MGHA 4O3OA 4KB1A 3TARA 3AO2A 4FLWA 3WNHA 4EBCA 1B9DA 8ICJA 1JLBA 3LPTA 4G1QA 8ICHA 3VQ8A 3RMCA 2W9CA 7ICPA 4F5PA 2WOMA 2HHTA 4J2AA 1S77D 1SKRA 3JPQA 5HMLA 4IQWA 1IKVA 2NRTA 4FK4A 2GWSA 2ISOA 4AHCA 4O3NA 1RDBA 2AGOA 4JWNA 2RKIA 1W0HA 3VQDA 1FXXA 1VSHA 4M3UA 1D8LA 3HVTA 1VK0A 1KLNA 3RJFA 9ICFA 3HT3A 3MAQA 4JRQA 4OKJA 4CFDA 1BGXT 5KFCA 4FLZA 2AQ0A 4DU4A 4AH9A 4Z4GA 4E7HA 4FXDA 4GMJB 7ICMA 5D4BA 1F21A 4FZXC 3GDXA 4FBTA 3RMBA 1S1WA 1L3UA 3V7LA 4ECXA 3BDPA 8ICRA 2Z1JA 4QZIA 1HUOA 2XCAA 9ICTA 4TQSA 3NFAA 4IQVA 1DTTA 4FJGA 4TSXA 4O3QA 2A1JB 4DOBA 1ZQJA 3PW0A 5J0SA 3MFIA 4R66A 1C6VA 5CY4A 3AA4A 3C6UA 3T5LA 4DTMA 2ASDA 3MEDA 3MEEA 3IS9A 1KEJA 2HNZA 4EYHB 4R5PA 3QIPA 5KFYA 2XY5A 3G6YA 3NH1A 4HYKA 3JPRA 4QAGA 4I2JA 2F1JA 1ZQWA 1WN7A 4DF4A 2Y1IA 1EETA 4CEAA 4FM1A 3AVGA 4FCYA 1YTAA 3B6PA 3NF9A 2DTUA 3RAQA 4YMMA 5C24A 5FRNA 1ITGA 1J53A 3WNFA 3GV7B 2HHVA 1NKBA 3NTUA 4CIEA 4QWBA 3TI0A 3RWUA 4DO9A 4XUSA 4M9JA 1QS4A 1QHTA 5KG2A 3AVKA 1TKXA 2P51A 4LSNA 3ISNC 1Q9XA 3HO1A 2P5OA 4NYNA 1HPZA 2IHMA 5D49A 1A5WA 3L3VA 3KTQA 3QEWA 5DMRA 1CZBA 3GIIA 4QZEA 4CCHA 5CWRA 1RT1A 2D5RA 2F96A 3O4QA 1FKOA 4M42A 3DI6A 2DFHA 3ITHA 4MF8A 2W42A 4B9VA 1TAQA 1IH7A 1VRTA 3V4IA 3D45A 4DTSA 3OYJA 3AVAA 4C8KA 2HVIA 5KFUA 2BANA 4I9QA 4OKKA 3E01A 3ORYA 3AO4A 1LB2B 4B9MA 4NLGA 4CHNA 4KFBA 3TR8A 5IIJA 4I2BA 4QZAA 9ICVA 3AVCA 2YV0X 4F5QA 1QTMA 3AVFA 3RB6A 3I0SA 5J0QA 1S10A 3NF6A 1RDAA 1S9GA 5CYMA 1SL2A 2W9BB 3ZSOA 3T1AA 2BKEA 1I3AA 3HJFA 1UA1A 4OLAA 1BI4B 3UIQA 4UQGA 4DTUA 3K5NA 4F5NA 2C2RA 1RTIA 1ZETA 4FW2A 3AVLA 3C2MA 3C2KA 4F93B 4CIGA 3MGIA 1S0MA 3CM6A 3G10A 1JIHA 3M8RA 1KFSA 5KI6A 3CG7A 4Q8FA 4WE1A 4Q0BA 4J2EA 5J2AA 8ICTA 1S1XA 2BCVA 1DLOA 3TFRA 4FJKA 1I39A 2P6RA 5J29A 4RW7A 3OYFA 3IAYA 2BPCA 5DB7A 4KHQA 1T8EA 9ICSA 4CGIA 3RH5A 3K4GA 4W5OA 5KFGA 4XRHA 4FVMA 3MR3A 1PZNA 4KLIA 4QZFA 3QESA 2FPKA 1X9SA 3OYAA 1LAWA 2NUBA 4PHPA 2E6LA 4BXOA 4CJKA 3AO5A 3OHAA 4IRKA 3KK3A 2ASLA 5KRSA 5KG3A 1UA0A 1YTUA 3H4BA 4CESA 3IM1A 4PQUA 4M2YA 5KFPA 4BWMA 1KVBA 4F4XA 1ZYQA 1U48A 9ICHA 4E0DA 1ZQNA 4GC7A 4CJQA 1RXVA 1IKYA 5C5JA 5HP4A 5CR0A 4RQ1A 4EP5A 5J2EA 2PZSA 1JL2A 4FZYA 2DFLA 4DQIA 2VWKA 1ASWA 1EX4A 4YXJA 3ALYA 5JUMA 4QZ9A 5K14A 5I42A 3PV8A 5DLFA 1WSFA 3HL8A 3LANA 4RNNA 2XGQA 2ATQA 3K5MA 4Q45A 5L1KA 1XSNA 2AGPA 3AV9A 3U6FA 1J54A 5EU7A 1WAJA 9ICNA 4RG8A 3SUQA 4ELUA 2C2EA 1KVAA 3DMJA 2YKMA 4E7IA 4YFUA 4NCBA 4Q8EA 2YNFA 4YR3A 1J5OA 8ICSA 4DFKA 4GXJA 4UB2A 3SCXA 4F91B 4GXIA 1RDDA 2W9AA 8ICMA 3VQAA 3C23A 4NLKA 8ICPA 4IBNA 4CEEA 4B9SA 5L9XA 4KRFA 3HYFA 3HPGA 4GW6A 1TFRA 5BOMA 4DFJA 4J9SA 3DM2A 4QCLA 2G8WA 4M9HA 3QEPA 1X9MA 1SKSA 4O55A 1VSJA 2PI5A 1KDHA 5J0PA 2DPJA 2VA8A 1TK5A 4E3SA 4DTOA 2RN2A 4DMNA 4CEQA 4O4GA 5DB8A 3TAFA 3ZDCA 3LP1A 3DLKA 3B0XA 2HHUA 1JXBA 4KTZA 3EPGA 4G3IA 5EWFA 2JLEA 4KO0A 3HP6A 3SUPA 1RYRA 1KLMA 3F73A 4IFYA 4AHTA 4K4HA 4HVJA 3SPZA 4GLXA 4QZCA 3VQQA 4Q44A 3O3FA 2BGGA 2ITGA 2X6NA 1L3VA 5KFEA 4F5RA 3NGIA 1WSJA 4DQQA 3OVNA 4KI6A 4YD1A 3L2RA 2OYQA 2KQ2A 2V4RA 5KFHA 2OPSA 3BQ1A 2AQ4A 1BPYA 8ICAA 2OPPA 1UT8A 5CYQA 3KK2A 1DOQA 1RTJA 5KT5A 4M3YA 2X74A 4KHWA 3LP3A 5J2KA 4JS4A 2XY8A 4I29A 1QSYA 4LVSA 1NK5A 1WSGA 4J9RA 2BQUA 2BCUA 4I2FA 4PGXA 8ICNA 4FLUA 1B9FA 9ICUA 4BWJA 5KFMA 4HHTA 2BPGA 1NK6A 3VQPA 4IG3A 2WONA 1Q9YA 1WNSA 5BPCA 4CJRA 1Z00A 1LV5A 3LDSA 1XWLA 4FO6A 3M9OB 1DGSA 4KLMA 2OA8A 1BPEA 1ZQGA 1WSHA 2HHSA 4F4YA 2J6UA 4Z4HA 3Q8LA 1KFDA 2ZD1A 4W5QA 7ICLA 2PFPA 4CF8A 2WTFA 1IM4A 1C0MA 3JPSA 4W5RA 1LAVA 3EWAA 3PX6A 2HHXA 4KHNA 4M0AA 3C95A 3G6XA 4CHOA 2ALZA 1TK8A 1BIZA 4J9PA 2FLLA 3ULDA 4NM1A 5DG8A 4YNQA 4FJXA 5KG0A 4M3XA 1ZBFA 1DTQA 3L2QA 9ICGA 4FS2A 3TAPA 4I9LA 2UVVA 1ZQLA 5E41A 4JLHA 4RU9A 4QWCA 1KRPA 4PHEA 3MECA 3LP0A 8ICQA 2X78A 1J9AA 4LH5A 5KFDA 1RCHA 4ECQA 4RQ3A 4KLFA 3HM9A 4DS4A 3TAGA 2BQ3A 2R8KA 4J9MA 4J2DA 3ZSQA 3GQCA 2BPFA 2EHGA 3QEAZ 5DBBA 4IDKA 1R0AA 3DOKA 3RJGA 4CJ5A 5J2IA 8ICCA 1VSKA 1S97A 3OGUA 5EWGA 4KLLA 2GV9A 4LY7A 3OYHA 3KIOA 5HMMA 4ECYA 3NF8A 3RRGA 4J9KA 3CQ8A 1S6PA 4F2SA 4DTRA 1HQEA 3RR8A 3GIJA 5DB9A 4ED8A 3HX0A 4CECA 1UT5A 2FPMA 4IQTA 3U3YA 1JXEA 1T7PA 2HVHA 4UBBA 3K5OA 4P4OA 3H8SA 1ZQOA 2FMQA 3TWHA 3ISCA 4KLOA 1COOA 4KREA 4E19A 1GOAA 4AHVA 7ICQA 3BQ2A 2BR0A 2VA2A 4KLSA 5J2DA 3EPIA 4FJMA 1KTQA 4IRCA 2W8KA 9ICMA 3JYTA 5KT6A 1L3TA 4Q43A 4KLTA 5DK5A 4RPZA 5J2QA 4RPXA 3QZ8A 3RB4A 1D9DA 2A1SA 3CYMA 3VA3A 2B21A 4KTWA 1JLAA 2MUTA 3KLHA 1MC8A 3AA3A 4CHZA 1X1PA 4B8CA 1N5YA 5KFSA 1L3SA 5FDLA 4KPYA 4R8UA 3KKRA 1ZQRA 4EBDA 4RNOA 3ZDEA 1S1UA 1S6QA 3N97B 4M41A 4CERA 3KLEA 2P1JA 3AU2A 4CEFA 3THVA 4EYIB 4OJRA 5KG6A 4DSJA 1TV6A 2M9NA 2PI4A 5DG9A 5L1IA 4MFBA 4DQRA 1ZQCA 4NLNA 3IG1A 2NRZA 1QLNA 3MXMA 1XC9A 4M47A 4K8ZA 2YNHA 2YHBA 5DBCA 3MDAA 1C0TA 4QZGA 4I2HA 1ZQVA 4DS5A 5KT3A 2XGPA 1W9HA 4ED1A 1UAXA 5KT4A 5F9LA 3QZ7A 2EX3A 3T5JA 1TKTA 2RDIA 4CGJA 2GBZA 3WNEA 1GOCA 2OWOA 3K2PA 4ZH4A 1X2IA 4RQ8A 1ZQYA 4GC6A 4KI4A 3DLEA 3KD5E 4CE9A 1VSLA 2OZMA 2C28A 4CGHA 4H8KA 4NXZA 3PW4A 2D0AA 5CA7A 4UB4A 7ICHA 3O3GA 4DSEA 4NLZA 4M3WA 4RUAA 4JS5A 3AVJA 4KN7A 2ZTEA 1IXRA 4F92B 4IR9A 2A1JA 4Z6CA 4Y1DA 3RBEA 3RB0A 1A5VA 1BPXA 3T3FA 3OYGA 2AJQA 4CJUA 5J0TA 3NHGA 1BL3A 5KG7A 2Y1JA 4O3PA 5KFLA 3V9SA 2BHNA 2G8VA 3IRXA 5HROA 4XIUA 4AILC 3UQ2A 1K1QA 3JPPA 1CUKA 4E7LA 2IA6A 5KFRA 4ECTA 4ICLA 4FBUA 3H08A 1G15A 2YNIA 4E7KA 2R8HA 4RUCA 1Q8IA 9ICOA 4PHAA 3ZD9A 1S5JA 8ICBA 3OS2A 3AU6A 2R8JA 5FROA 5J2NA 1XI1A 3C21A 5KG4A 3EZ5A 3DLRA 3Q8SB 3CFRA 3KJVA 4ZHRA 3V6KA 4JUZA 2YNGA 3RH4A 3QE9Y 4RQ0A 1HYVA 4RZRA 1ZQDA 4BE1A 5DDYA 4GXKA 3OJSA 3AVNA 4QWAA 2W8LA 4Z4CA 3MFHA 1SKWA 2LSNA 3OYBA 1BPBA 4I2EA 5HRNA 2RF2A 2BCQA 4O0IA 4Z6EA 4CJ4A 2BCSA 4DFPA 7ICVA 3GV5B 4TUPA 4DQPA 4FS1A 3KLFA 3V7JA 1X9WA 4RW9A 1ZQBA 4DLEA 4F4KA 1HNIA 5KFTA 5KG5A 2O4GA 4JV0A 1ZJMA 3LZIA 5HRPA 3SUNA 1NKEA 4GVMA 1TL3A 5HHIA 3MABA 2F1HA 3CM5A 1T03A 3RR7A 2A1RA 2YHAA 4EBEA 4ECSA 3E2EA 1FK9A 4KHSA 4W5NA 1U47A 5C25A 1ASVA 5HBMA 4M9LA 3SUOA 4DF8A 4UAWA 4IKFA 1Y88A 3PMNA 4OLBA 3TFSA 3ZT4A 4N56A 3PX4A 1WLJA 4TQRA 3BJYA 3OSNA 4CJTA 5HLFA 5IILA 1TV9A 4CK3A 1ZQUA 1RT4A 2LYHA 2HNYA 4RT2A 3UQ0A 4KLUA 3RAXA 2V4QA 5KFVA 3AVIA 3M8PA 4CJEA 4I2PA 4F4WA 9ICPA 5J2CA 1ZQAA 3OS1A 4N5SA 3AA2A 4FLVA 4E7JA 4FK2A 2VANA 5SWMA 4FW1A 4BDPA 2FBTA 2G8KA 9ICXA 4KLGA 2ATLA 4ID1A 3V9ZA 4F50A 1BPZA 4JRPA 2ZJ8A 4DL4A 4AHSA 4YG2A 1QE1A 1ZQZA 1S1TA 2IC3A 1TL1A 1NK7A 5DLGA 4M9GA 1Z25A 2F8TA 5J2MA 1KVCA 4BE0A 3QO9A 3M9NB 2BE2A 1Z26A 3T19A 2W9MA 4O5BA 1QSSA 4C8OA 3DRRA 5DGBA 2BCRA 1BQMA 4IFVA 4RW4A 5IIIA 4FJ9A 5J2GA 3GIKA 4HCBA 4BGDA 3QNNA 4BE2A 3AVMA 3AVBA 5J0UA 3C5FA 3KHRA 3V7KA 1C1CA 5J2JA 9ICIA 2Q3SA 1NK9A 5KFKA 9ICWA 2IDOA 3RBDA 7ICSA 2FLNA 2KTQA 3NGYA 3QEXA 3RJKA 1XHZA 3RJHA 5KGXA 3QEIA 4K4GA 4QZHA 3EY1A 1XSLA 9ICLA 4CIFA 2O4IA 3SQ2A 7ICNA 4UAYA 2BGWA 3RRHA 4HCCA 4QWEA 3V6JA 9ICQA 4FYDA 4B3OA 1WSEA 3VN5A 3U3GA 3VQ4A 1ZBIA 1BPDA 1ZQFA 3AO1A 4CK1A 5L1LA 1RDCA 3P5JA 1N48A 1XO1A 1Z00B 3G6VA 4ECVA 1ZJNA 2C2DA 4Y1CA 3DYAA 9ICRA 1O1WA 4NCAA 5KFFA 4ZTJA 2B4JA 1Y97A 3TQ1A 2PYLA 2P5GA 2J6SA 1ZBHA 3NH2A 1S76D 2QK9A 4ECRA 3ZSZA 4I2IA 4KITB 4KB0A 4FM0A 4P2HA 1A76A 1SV5A 4RQ4A 8ICVA 1S9EA 4DTPA 7ICFA 4I27A 4R63A 4UB1A 4N47A 4EZ9A 4Z4FA 1RT7A 4DTNA 3QERA 1N6QA 2XY6A 2RPIA 4R64A 3H8WA 1U9LA 1HRHA 4K8XA 5EWEA 2HNDA 1S9FA 4KLJA 3V9WA 1JMSA 3AO3A 4KV8A 7ICOA 4LH4A 3TAQA 4CGFA 1HUZA 2YKNA 4B9LA 1WCLA 3SYZA 5F9NA 4KKOA 2VWJA 1H38A 1FKPA 4JV2A 5KGWA 5CZ2A 2VG6A 4B9NA 4DSLA 5JS2A 4OPKA 4MQ3A 3KHLA 4KHUA 5IIMA 4CJWA 4N41A 3NAEA 3VQBA 4M45A 5J2PA 1SZPA 1VSFA 4AHUA 4J2BA 2IGIA 3BGRA 3RMDA 3V9XA 1T05A 4CJVA 1EKEA 1BIUA 3LAKA 3VQCA 2QXFA 2XRIA 4CHYA 1TAUA 3DRPA 4YXMA 5KFAA 1MU2A 1IG9A 3QEBZ 4KLQA 1LWFA 4IRDA 4CK2A 1VSIA 2HHQA 2VG7A 4EP4A 4ELTA 4O3RA 2KW4A 3O3HA 4L8RB 1JL1A 2AU0A 3OY9A 3JSMA 5J0WA 3VA0A 1T4GA 2FPLA 4DSFA 1ZQTA 4E1MA 4PGYA 7ICTA 2DY4A 1NOYA 4X5VA 1LWCA 1HJPA 9ICJA 3QNOA 3C5GA 3HPHA 2E6MA 2ZTCA 3S3OA 4CJFA 4C8NA 3T5KA 3TAEA 5J2BA 1JLEA 2ZE2A 2ZTDA 2HB5A 2W9CB 4LD0A 4PY5A 2KFNA 3TABA 2KZMA 4DQSA 4OGCA 2ZUDA 4M6WA 3P83D 4KHYA 1SL1A 4O5KA 8ICYA 5DBAA 2R8GA 3NGZA 3V6HA 4B08A 3C94A 3SI6A 3CFOA 3PNCA 4B8AB 4CHQA 1RBSA 2HMIA 4EZ6A 1RBUA 2IMWP 4IR1A 1RT6A 4LZDA 1SL0A 9ICAA 1NK0A 3DRSA 3KHHA 1ZQXA 2FLPA 5KTQA 2JZBA 3MXIA 2XC9A 2R8IA 5DQGA 4R8UB 4QZBA 3JPTA 4DG1A 4HUFA 5DDMA 5FRMA 4PHDA 1IKWA 3DOLA 3BQTA 4Z6DA 4KTQA 4EEYA 1GOBA 2B5JA 4PGQA 3Q8KA 3SQ1A 5CB1A 2VA3A 4KLEA 2FBXA 3QIOA 3B6OA 4OGEA 5HNKA 3AUOA 4RQ5A 1RILA 2XCPA 5DKWA 5CZ1A 2QKKA 4H4OA 3ZSRA 4ED6A 1XSPA 1MQ3A 3WNGA 3FDSA 1RTHA 5IIOA 5J0RA 3ISBA 3PVXA 4KLHA 5KT7A 3V9UA 1WAFA 3I8DA 4NCGA 5J0YA 4CF2A 1U04A 2PFOA 3S3MA 4ECZA 3OYKA 5KFJA 4CJSA 1EXQA 5D46A 3S9HA 3LP2A 4F4ZA 1IO2A 3PO5A 4ED0A 1U49A 3ZDDA 2F1IA 2Q0ZX 1WCNA 4O5CA 2ZUCA 1KCFA 4NM2A 2G8HA 4FLYA 1VSEA 1UWBA 8ICWA 4OPJA 3H8JA 1KSPA 3C1ZA 4CGDA 4DFMA 1XHXA 1U4BA 1ZQQA 2ZUBA 4ELVA 3H4DA 3LALA 2P66A 3HVRA 4E89A 4JK1A 4YR2A 5HHHA 7ICUA 8ICLA 1VSDA 3L8BA 2BDPA 2ETJA 3HPOA 3Q8QB 3H7IA 5CHGA 1U45A 3LWLA 1RPLA 2JEJA 5HRRA 3QLHA 2I1QA 4LSLA 5CJ7A 4M3TA 2OPRA 3LAMA 3MEGA 4F3OA 4DL6A 4MEXA 4DLGA 1RYSA 1TVAA 3PR4A 4W5TA 3BQ0A 3SPYA 2JEGA 5CP2A 3PW7A 1LW0A 4CJPA 2PYJA 1EXNA 3OHBA 1XU4A 4DL7A 3KKSA 3MBYA 1NK4A 1BHLA 3V81A 9ICCA 2NRWA 3OYCA 1S0VA 2ZJ5A 3QETA 3SQ4A 4J9OA 4DU3A 5KFZA 3ZSXA 4FJ8A 1YVUA 1NOMA 8ICGA 3RJIA 1V9PA 3NGDA 5KFOA 3TANA 1AROP 1IKXA 4HUGA 1ZBUA 1LW2A 1N56A 3V1RA 1XS9D 3D0PA 4DWIA 4UB5A 3FYHA 4DL5A 4DTJA 2GUIA 2UVRA 1RT3A 4I2CA 4TUQA 4FZZA 1B43A 3GILA 7ICIA 3OYEA 1NJXA 4FM2A 1ZQMA 3NH0A 1ZQKA 5J2FA 1ZBLA 4DL2A 4UB3A 1TKZA 3OYIA 4O9MA 4MF2A 3SZ2A
chains in the Genus database with same CATH superfamily
4JEPA 2IIHA 3ZTOA 3PUFA 3R1XA 3W8PA 5BOLA 3FC4A 1QQCA 4Z4IA 1T03B 1RTDA 3F2KA 4JHDA 1XO0A 2CZVC 4GRSA 3M2UB 2J4RA 1NZBA 4BXOB 3U02A 2ZBCA 3MXJA 2G8IA 4DUYK 3G9CA 4LIWA 1QAYA 1YWXA 1X9JA 3IGVA 3ZTSA 2B9YA 4QZ8A 2VDIA 4ZVOB 4Z4EA 2ZQBA 4PXBA 1IUJA 2CGJA 1D4XA 3VQTA 1U1MA 2VGMA 1SV4A 3CC2N 1XQIA 3BP8A 4Y2KA 4QZDA 1TQLA 1U0HB 2PY5A 8ICOA 5KFIA 1AXQA 3UXNA 2XNQA 3EMTA 4IOBA 2Z0GA 9ICBA 3GP9A 4J9LA 3JXUA 3O5BA 3IR5B 1D8ZA 1BVSA 3IHQB 2DTJA 3DLBA 4UOHA 3TR5A 1CC8A 5I42B 3ULEB 3U1LA 1R8HA 4HEA9 5KFNA 3JS6A 1WJ9A 2XWXA 3GYXB 3GJSB 1TUUA 3QDKA 1NG9A 3A3NB 4XA5A 3K58A 1BOTO 1OYEA 5HRSA 3MHYA 2OTLN 4PA1A 1N88A 5A2QY 4YMNA 5HMZA 2W7AA 2KZ3A 3I32A 1WUDA 3QEVA 2B3TB 4FK0A 3V1OA 1TL1B 3LDOA 3CCEN 2FD2A 4C8LA 2O8BB 5J0OA 3QO9B 1VGYA 4LR9A 2BE2B 3LGHA 2XYGB 3VALA 4BDZA 3P49B 1DQ9A 2IY5B 4LFBK 2VC1A 2NUUG 3PX0A 4PXCA 1ZZFA 2IM1A 2CNLB 4DR2K 2ZBQA 4DUZF 1VQNS 3RFAA 4Q2LA 4F5OA 3TWZA 3A13A 3QFWA 4LQ9A 2ZJPQ 3QWUA 2YX1A 2P9IB 1ZRMA 1C1CB 5A8RB 4RPFA 4CF1A 3R97A 1BISA 4QOTA 3VAKA 1SH3A 2MPUA 3C2LA 5DQIA 3OYNA 3CCLN 5M1OA 4QW8A 2I5JA 3G87A 4IEEA 4C8ZA 4KMOB 1UEKA 2YI1A 1U6BA 2VFTA 1SQKA 4JI3F 3C0BA 5AM2A 2YY6A 1FJCA 1X4BA 1XERA 2OM6A 1HHQA 3R5AA 8ICFA 3UMCA 3DLGA 4OJGA 2WAQF 1NDCA 3L0QA 1HR0F 4F3TA 1J2NA 4KGZB 2C3OA 5K5MA 4CM0A 4DU7A 3DAWA 3ZYYX 3DYAB 2DGZA 1X42A 4CEBA 3SI8A 2WF5A 2VQFK 2DPNA 2OTLS 1UKUA 5IIKA 1T6CA 4Z0UA 2EC0A 1CXQA 3Q8RB 5BR8F 1RBTA 2H5XA 4LF9J 3BBFA 5TZVA 5MLCQ 4AP9A 2VJ5A 1ZTTA 3CCES 3AQFA 2UXBK 2G0IA 3AD7C 2IS3A 4CFAA 3L3FX 4ZVHA 1S9EB 3SMZA 1OWXA 2FSJA 3UPQA 3DCAA 2F9WA 4OKEA 2E8NA 2KRBA 4UBCA 1CJUA 4X66J 5LMNJ 3TO8A 3JAMO 4MEYA 2P9PB 1BG3A 4RQ6A 4CFCA 2BV3A 3L7OA 2HNDB 1V5IB 3KHGA 3SCLE 3WDOA 2E8PA 1GEHA 5JMVA 3W9IA 4M9NA 2Q79A 1QVFM 2YKNB 2KV2A 1JLFA 4LF6F 4LF2A 2ZJAA 2E1EA 4RW8A 3RJJA 4PPXA 2MEWA 2ZJRQ 3CJBA 5KPRA 2JGUA 4BC4A 3K57A 1ZC6A 2DO4A 5HN0A 1CLQA 1HBNA 5ALYA 3PEHA 3OJUA 3UCUP 5JXSA 1Y0HA 4YEAA 2J6TA 1U6FA 2H51B 3HLUA 2QL7B 3UXOA 4F8RA 3MCMA 4WXOA 4PPDA 4UASA 3UDEA 1S0OA 3HFKA 3JPOA 1ED1A 3M1YA 3J80U 2RQCA 1NJWA 1I3OB 3W5ZA 5AKLA 1WEXA 1CZAN 2KFZA 1S12A 2GHVC 1AZSA 3B82A 3GSIA 3MECB 2NRVA 2ITMA 4RQ7A 2YQ0A 1FO4A 1UPHA 4P7VA 2I0XA 1VC6A 3D2NA 2E8OA 3H40A 4B3TF 3QYPA 2HIQA 3OR1A 4CI0B 4PWUA 4FJLA 3SDEB 1VRUA 2HHHF 1SJ3P 4RNMA 3ZD8A 1G99A 3NOCA 1KL9A 8RUCA 1NAQA 3HOSA 3F9KA 2VH7A 3NDKA 1FF2A 2WF9A 4DV4J 1HKCA 1XNRJ 1W25A 2V50A 1WTFA 5JVHL 4ECUA 4CEDA 3SQGA 3HF5A 4Z6FA 3GG1A 1RAOA 1KVIA 5DQHA 3FLCO 3H20A 4UQTA 1GTHA 3NXZA 2XBPA 4BRKA 1BUPA 1JLQA 2J7UA 5AFUA 1C1AA 4Y2IA 5KAKA 3NVKA 3ZCMA 3I33A 1NJZA 1ASUA 1Q46A 3QINA 2G9OA 3B0YA 1RT6B 3KZIU 1T3QA 5ADZA 2PIIA 4U96A 3CJKA 5G5HA 2GV1A 3C6AA 3WUHA 3VWSA 5DZ7A 3BEGB 4YUDA 3K75D 5ADXA 1IKWB 3HW8A 2QA2A 4E1NA 3J7A1 1JLCA 1MQ2A 3RMAA 3GFXA 3RH6A 2XVTA 2HWTA 4FP9A 4HTUA 1JJ2R 3VC8A 2DR7A 4NYFA 4U67Q 1NLVA 3TQEA 2MJUA 5IT9Y 2Y8YA 3W0LA 4BRFA 1H7WA 2YN4A 4XK8C 1QTNB 1WUUA 3MR2A 2XSJA 2ZBRA 1RXWA 3PYEA 1VLYA 2YY3A 2R7OA 4ZN3A 3PY8A 4YDDB 4M5NA 1U26A 1P6TA 2KVCA 2L41A 1YZ6A 2A0FB 4NCGB 4I7FA 4TURA 3EW9A 5ALGA 3OFFA 5AQHA 2HZAA 3UKRB 3IG1B 3KHYA 3BS5B 3KXDA 2YWEA 4ZCLA 1JLBA 3LPTA 3UD4P 3VQ8A 3RMCA 7ICPA 4I6WA 3GTYX 4F5PA 3H0LB 5GIOA 1OVQA 1SXDA 3VPZA 2A19A 4E98A 4IQWA 1IKVA 2VDHA 4PL1A 3IWLA 2V8HA 2AD9A 4Y65A 1ZM2A 2ISOA 1C0FA 4H5WA 2ZH5A 4DR7J 5ETOA 2KMDA 3R3LA 4M3UA 1D8LA 1VK0A 1RM6C 3G71N 4DI6A 9ICFA 2E5SA 1FJ7A 3HT3A 3MAQA 3I28A 2NXCA 3S41A 4AH9A 4ZVPB 5H9EK 2PA3A 4FZXC 3RMBA 1Y5IB 1L3UA 3V7LA 4ECXA 2IRXA 4QZIA 4TQSA 4FJGA 1AFIA 1HEKA 2XB2D 3UFCX 1HR0K 2JXJA 2OI2A 1H74A 4XDCA 1FXLA 2C2OB 2Z2MA 3MFIA 3BSNA 4R66A 5M2UA 3PHTA 4FPIA 3T5LA 2ASDA 2J0WA 3GIRA 3D7EO 1KAZA 3CDBA 1KEJA 2HNZA 1KVKA 5BR8K 1FT8A 1PYTA 4CO5A 3NGRA 1FDNA 4W90B 1R8PA 3PYDA 3G6YA 4HYKA 4WYBA 3CQYA 3JPRA 4B1ZA 2F1JA 3J7YP 4IOCL 2PSZA 4NLTA 2O1PA 1FE4A 3AAWB 4CEAA 4JD2A 4FM1A 2GEMA 4FCYA 1YTAA 3NF9A 4FKYA 2CQHA 3M8YA 1WOPA 5C24A 3GV7B 2H3EB 1TL7A 3MM5A 1RWKB 1NKBA 2Q6CA 1KQSM 4DO9A 4XUSA 3DDIA 1DZ5A 5CD4H 1TKXA 4JI2J 1TMJA 4LSNA 2HRTA 3G71S 3ISNC 4RWTA 2VPYB 1MN7A 4DV0K 3TOQA 3L3VA 3QEWA 3D0HE 1RWXB 5H9FJ 5DDQC 3GIIA 4OJ3A 3TNVA 5AM3A 5CWRA 1RT1A 4M42A 1OH7A 1LWEB 2HVEA 3ITHA 1ZBTA 4NZ7A 4B9VA 2GELA 1WF1A 3V4IA 2RU3A 2KRRA 3H7HB 2GIRA 2WTUA 2FZKB 1GLFO 4J9VA 4CH1A 2P8IA 1TELA 3D2SA 2I1RA 2H3IA 5K8OA 4B9MA 4X66K 5LMNK 3E1YA 4M1KA 4DPXA 1IBKF 3QGHA 4H4MB 1N8RT 2CG4A 2D3UA 3P5BP 1S10A 2NV3A 1C0UB 4CZKA 2RMLA 3IRUA 4OJPA 3PLAA 2BKEA 4K5SA 5IC4B 2QT7A 4QS8A 1I3AA 4DR1J 2P35A 5AQVA 3UKUA 2N7YA 2ZH8A 2J8AA 2KVQE 5I3PA 3C2KA 3WZ0A 3M3ZA 3EDQB 3CM6A 1S0MA 4FE3A 1R7IA 4GVBB 3D6HB 1EJ7L 3DV9A 2RP5A 2RNEA 2GJFA 3D4JA 4Q8FA 3K0SA 1MDUB 4Q0BA 3GYGA 5J2AA 2W03A 8ICTA 4LF5J 1NB7A 1DKGD 4G6VB 3TFRA 1FDDA 4HT7A 1FW6A 4TYBA 4OJ6A 2ZWPA 1M90T 5DB7A 2IFXA 2QMWA 4DCPB 3K4GA 3Q7BA 3UE5A 2YWFA 4XRHA 2KSOA 1UHUA 2VU5A 3MWTA 1HNVB 2XMAA 4ZLLA 8AT1B 3AO5A 2F76X 4PG7A 1NGBA 3KK3A 4OYOA 4JKHA 3GB0A 3SSRA 4IH6A 4DV4K 1YTUA 1A0PA 1S5ZA 2MA1A 2DNLA 5FLXU 4CRXA 1RT2B 4MAKA 4CO3A 1IBCB 3IG5A 3OW2R 2AHOB 4F4XA 1ZYQA 3VCBA 2DNOA 4E0DA 2VJVA 1RXVA 1TUWA 1IKYA 3EXYA 4NXMJ 4Y3CA 4RQ1A 5J2EA 4WKRA 2K1RB 1ZD2P 1SC4B 2RILA 5ALIA 4GO7X 2K8GA 3MWBA 4YXJA 1RAJA 4MO4A 1JI7A 3LVVA 5AKJA 3HSGA 1WSFA 4K4TA 2LQJA 5L1KA 5AIAA 3QGGA 1XSNA 3VZIA 4MLEA 5EU7A 2LQBA 4H0TB 9ICNA 4RG8A 3GR0A 3TADC 4ZP8A 2C2EA 3WC0A 5EOYA 4TYAA 3DMJA 3EJMA 1I5OB 4YR3A 3CD5A 4UB2A 1H98A 4QYZJ 2CG8A 2XHWA 5DDOC 5D77A 8ICMA 4IBNA 4B9SA 5L9XA 4CT8A 3HYFA 4HKQA 3THTA 4J9SA 1RZMA 3DM2A 4RL1A 1LFPA 4JI6J 3GWCA 2UUCF 3CC7S 2G8WA 1N5SA 3QU4A 2FHJD 2RUSA 4E3SA 4DTOA 3FGUA 4DV6J 3L4PA 5DB8A 1R0CB 4CLUA 1GXUA 4JKFA 3R7BB 3TAFA 3LP1A 3HKZD 2HHUA 5HMWA 1JXBA 3EPGA 2JLEA 5T7LA 4PWDB 2DGSA 4KO0A 3AOCA 2R7XA 4ZPDA 1U2VB 3KD3A 3F73A 4AHTA 2VPWB 1CG2A 4Y2SA 2Z30B 3HKWA 1YSJA 2QM1A 1YJVA 4DR7K 2CWKA 1TVRB 2IDLA 3M6XA 1IN0A 3O3FA 2BGGA 4HACA 2JRZA 1L3VA 1KBUA 3D0GE 4DQQA 4EX6A 1NGAA 3H25A 2V4RA 4L3KA 3BQ1A 5E3QA 2OPPA 5CYQA 2HSEB 4OX9F 1FRMA 5KT5A 4M3YA 4KHWA 2MQNA 3LP3A 4JS4A 2DB1A 4I29A 2ZM6J 2BQUA 3BGRB 4MIAA 2VFRA 4H4KC 4CYUA 4LR8A 4EAHD 3FAHA 4BWJA 1FXDA 3DRPB 2QLFB 4B1YB 3VETA 4IOAL 3R7SB 2WK4A 4FO6A 3OTQA 1DGSA 2YPYA 2Q1LA 5A6WA 2WMMA 2WUSA 2BEFA 4Z4HA 4CD3A 3AOBA 2BH1A 1GMWD 3RW7A 7ICLA 4CLLA 4CLWA 2IJNA 3W62A 1IM4A 2CQIA 5F3ZA 2R9LA 3JS9A 4W5RA 3OFEA 1LAVA 3EWAA 5EN1A 5IT4A 3ID8A 4KHNA 2ALZA 1V85A 3BPSP 3PG9A 3HHEA 3NGSA 3MR7A 3UI3A 4J9PA 1ZA1B 3R5DA 5DG8A 2DRAA 1N0VC 5IXUA 2ZF5O 4JAXA 4ZP6A 3TAPA 4OZ2A 2K8AA 4FWKA 3ZZUA 3VERA 1JQGA 2QN6B 1ZQLA 4JLHA 4N8OA 2MLXA 1KRPA 1N4LA 3AFGA 3PIOQ 5CAAA 5D0HA 3LP0A 5ETNA 1QVGR 4PL8A 5ETPA 3MTJA 2NRHA 5GAGU 3TAGA 3A5MC 2UYTA 2BPFA 2EHGA 3TZYA 1R0AA 1YITN 4BHQA 3R6LB 3ONNA 2VD3A 3MEKA 3RJGA 2C3PA 1B0PA 4CJ5A 2D9OA 1VSKA 1HQUB 5EWGA 1CJTB 2LHTA 2ZH1A 2NCKL 5MAOA 4Z7YA 4K7QA 4I6MA 1DAXA 2AJ2A 3KIOA 3NF8A 5B0FA 4J9KA 1S6PA 4LFCF 2RD5C 1RBLA 1HI1A 4DTRA 1Z2LA 4K2XA 4DV5F 4A8MP 1MMLA 5CH7B 1P8GA 1GAOA 5DB9A 3WXJA 2HAIA 2E20A 4DR1K 4CECA 3QRQA 1W2BR 3OUYA 2UUAJ 4TU9A 2HVHA 2IVMA 1IG6A 3HVTB 3H8SA 1U1NA 5KQDA 4BQLA 2LQ9A 2C2NA 3ZZYA 3C14A 3S7RA 1COOA 4A8EA 4BRDA 4E19A 3M1FA 2LYAA 5AQKA 3FVYA 1MW7A 4LF5K 3O1BA 3VENA 2DT9A 4LF8J 2AYBA 3VGUA 3B4MA 4ALZA 3JYTA 5KT6A 2AA4A 1L3TA 4Q43A 2GX8A 2XWYA 1SKUB 2KP7A 2DGOA 2PMZD 3ALRA 3MTKA 3BSCA 1JLAA 2MUTA 3NVVA 2EH9A 5AKKA 3AAQA 3ONQA 1FJGJ 5FDLA 3NS5A 5M1QA 2PFFB 2RB7A 3KKRA 2ZUAA 3MEDB 1YITS 4EBDA 5HQMA 2V5HG 4DBQA 3KLEA 3N97B 1M1HA 1AA1B 3T1HF 5LY3A 3THVA 1RISA 5AJ3J 5KG6A 3T79A 2HIYA 3VGVA 1EARA 2K60A 2DXEA 2XMJA 4LSLB 5BPMA 3I56N 2NRZA 4K8ZA 3UE2A 3CF5Q 2YHBA 3MDAA 3WX4A 1C0TA 4AF1A 4I2HA 1ZQVA 4DS5A 5KT3A 4URGA 1VQ9N 4NXMK 4JI5F 5F9LA 3CB4A 1Q7YO 2RDIA 3KJQB 2OWOA 2EEYA 2A10A 4HR2A 3BN4A 1PG5B 4YDUA 4LBIA 2LMRA 5AI9A 2GIFA 1OVYA 4ES3A 4OO1J 3R7NB 2CH6A 4H8KA 2D0AA 4PRFA 3EDRB 2L3MA 2HBJA 4JS5A 1ACMB 4HT5A 4KY3A 2IIRA 4QYZK 1VRTB 1HBMB 1IXRA 3IP0A 4IR9A 1FFUA 3GG4A 2CZ9A 4Z6CA 2XMUA 2KL8A 3O2IA 4P0PB 1U0SA 2KYXA 4OI6A 1BU6O 3T3FA 2AJQA 4TLRA 4JI6K 5C2CA 2AYEA 2V8GA 2IPOB 2QSWA 1X0FA 1P8ZA 3NHGA 2XNRA 2L9DA 3M6KA 3D28A 4O3PA 3V9SA 4AXJA 3HSCA 4LJMA 4DV6K 4NXNF 5HROA 1LKYA 2FVSA 3N4QA 2AYMA 1S9GB 3K8VA 5CYMB 4E7LA 5KFRA 2GVZB 2M2BA 3I56S 1URRA 5JLFA 2LXUA 1A7GE 4WP3A 4FBUA 3TJAA 3WQUA 2YNIA 2GJIA 2R8HA 4PHAA 3GDQA 3OXLA 2KG5A 1VQ9S 3AU6A 4HTJA 1KEKA 1XI1A 5EE9A 1FCAA 2JGAA 4R25A 1N8RO 2I38A 1R89A 1FNXH 4P2SA 4RZRA 2YCHA 1WWHA 2CQ4A 1Z4OA 1ZQDA 3W3SA 4USUA 1X4FA 2WW4A 2IA0A 3OJSA 2QWMA 3K0JA 4Z4CA 2XI9A 2FVRA 1GNKA 2FGOA 5BPNA 3OYBA 1BPBA 4RJVA 2CPJA 1WORA 3GJRB 5D4OA 5I9EB 4DV3F 2ZM6K 4WU3A 3QUTA 2Q1NA 4L72B 5IQ6A 3NNCA 3L7PA 2HLTA 3FRZA 4GKJF 3WK9A 4OZLA 2K3KA 1JXVA 1FNMA 3M7VA 1N5QA 3MPYA 1M90O 1HNIA 2LA4A 2B6GA 3KBBA 1Q3UA 1RI7A 1DGKN 2JRSA 2X1FA 3E9PA 5KNIA 2YTCA 3ISZA 2R42A 1W97L 1T03A 2E2OA 3RR7A 2FDNA 2GMJA 2YHAA 2IBOA 2A1RA 4BC9A 2JZ5A 5F8JA 3CJCA 5AQLA 1LWXA 5RUBA 4KHSA 2J0SD 3U9ZA 2W4PA 4A62A 4C48A 1XQSC 9ATCB 1WG1A 2E7XA 4JI3J 4CE6A 2GQ2A 2ZJQL 2PAVA 1EWRA 4UAWA 3M6VA 4XAKA 2ZHOA 5BXIA 3ZT4A 3AXKA 2EZYA 4CLZA 3QB0A 3BJYA 4CJTA 5IILA 1TV9A 1U0HA 1SQEA 4KH6A 4EUVA 4FYXB 2YKMB 2LYHA 2KKHA 1XC3A 4YS2A 1J5OB 5KFVA 5H1SQ 4CW7B 3ZZTA 2RJZA 2ZWOA 1B4SA 1L8LA 2JX2A 3ULEA 2BXJA 2N3OA 2BMBA 3AA2A 2XYPB 1IR1A 4XH1A 5SWMA 4BDPA 3CNQP 2HMXA 2AP6A 3CETA 2KH9A 4DPYA 4O5FA 1EAYC 4C8YA 4YOEA 2EAPA 4DL4A 4AHSA 3Q86A 5C12A 1RAAB 2IC3A 2QTDA 1TL1A 1MROA 4MTPA 5AQIA 3DU5A 2O8BA 3QO9A 3PFOA 2RSQA 2LMIA 3IFRA 3HKZC 2BE2A 3ZC4A 3T19A 4LF6J 2W9MA 4C98A 1RWWB 1YBUA 3M2VA 4QZVB 2OEKA 2XYHB 4XH5A 5A2QU 2K8BB 1WACA 2QWOA 4PL7A 4OX8A 4BE2A 1Z4NA 3RW6A 3AVMA 1PVPA 2P9IA 3C5FA 1C1CA 5J2JA 4HI2A 1A6SA 5A8RA 2LEPA 3I6PA 2DNZA 3Q2TC 1NK9A 5KFKA 2HQ3A 9ICWA 4US8A 2IDOA 3RBDA 2FLNA 3P38A 5ALRA 1Q5YA 2OPSB 4LF8K 4QZHA 3AT1B 1HNZJ 4X4SA 2EZZA 1RWMB 1XSLA 5I3UB 5M1FA 4UB6U 2O4IA 2HBLA 3H3OB 3W5YA 2DHHA 2A1AA 9ICQA 5ALMA 4OD0A 3VQ4A 2JH3A 2I6XA 2HGLA 5JICA 2ZDOA 2HHHJ 3TZWA 1FJGK 1RHKB 3P4UB 1Z00B 4FZNA 4ECVA 2CN1A 4O8UA 3DYAA 1ZTWA 1K47A 4K2JA 2RLTA 1KQQA 2DGWA 4ZTJA 2O5DA 3LF0A 3MCPA 4ZITA 5AJ3K 1RQLA 4IO1A 1IBLF 2QK9A 4I2IA 2IOHA 2OAUA 1SQFA 4FM0A 1VQMN 4AM7A 3FM9A 4P2HA 1A76A 3TA2A 8ICVA 4IWVA 4JKGB 1S9EA 4MIBA 4I27A 3QUCA 4N47A 2B56A 3W7BA 4N77A 3EWGA 3U1NA 4DTNA 3G8TA 2QXLA 2P9PA 1P7DA 2DQNB 5EWEA 2HNDA 4FWRA 1MWYA 2C2ZB 4BGBA 3V9WA 4KV8A 4PABA 5A8KB 3TAQA 1HUZA 2YKNA 5F9NA 4KKOA 2VWJA 4UZCA 4JV2A 5GTHU 2RRDA 4WFAQ 4EWTA 3KHLA 4KHUA 1UTAA 3JB9k 1H2TZ 2KHQA 3MCOA 3Q8YA 1KS2A 1SZPA 4J90A 2CNNB 3MD3A 4J2BA 3DOKB 3RMDA 5FD1A 3L6QA 1S59A 1F9FA 5BYQA 1O0PA 4CHYA 4CO0A 1RWOB 4DKWA 2JWLA 3GYNA 3NVYA 2PA8D 2HHQA 1NCLA 2CJQA 4ELTA 2ZH2A 4Q7AA 4LF7F 4O3RA 2KW4A 3AJ2A 3O3HA 2P9EA 2KVSA 3D3CJ 4ICAA 4ILHA 2DD8S 3CIMA 4DSFA 3SDEA 4KGKA 4PGYA 4JI7F 2EFOA 4CZIA 1VQMS 4B3MF 1R8CA 2IOFK 1UW4A 4GKKF 3QNOA 4OI2A 3KKAC 3S3OA 3A12A 3MMJA 4CJFA 4C8NA 2W40A 3T5KA 3TAEA 2JFKA 3TA0A 4JV5J 3TEHB 3D6JA 4PAAA 3FBFA 4G1QB 3A8YA 2W9CB 2KFNA 3W61A 1UZHA 3PIPQ 4BR4A 2F65A 2B8QA 2KZMA 1BE4A 2C3MA 1ZM3A 5C15A 2ZUDA 4QQBA 4DV7J 2R8GA 5E3PA 3V6HA 3CJ0A 4B08A 3D67A 3PNCA 1Q8BA 2PMZC 3CO0P 4EZ6A 1RBUA 2G5IB 4BC2A 1RT6A 1SL0A 1HLUA 3AQPA 2BACA 3UMBA 2H3FA 2XC9A 1OJ4A 2R8IA 4R8UB 4HUFA 2HOFA 4ZVQB 4UY85 1H2UX 1S1WB 1IKWA 4K25A 4JI8K 3DOLA 3BQTA 4ZOSA 4KGMA 1X4CA 4PGQA 4OZ3A 4AL6A 3MUTP 3NNHA 2KXNB 1FD2A 4ED6A 4DV2F 5LMUJ 1Z1ZA 4XH4A 1UFWA 5KT7A 3D3BJ 2A2CA 1QM9A 4NCGA 5EE3A 2PFOA 1OPZA 2A42A 2FY1A 3QBWA 2ZUGA 4ECZA 2V51B 2F4VJ 3VAMA 5KFJA 4WWSA 2UUBF 3UKRA 4J7CA 1RKIA 5CCMA 1AB8A 3BS5A 5B0CA 4BS2A 2HSZA 1ATSA 3JAMY 5IT9U 2GAHC 4H0XB 3OTDA 4NL9C 2FJBB 2E7WA 3J7AN 4PJ0U 4LF4K 4CTAB 1OH6A 1U49A 2WF7A 4CF3A 4O5CA 5FIIA 3IBWA 3SAGA 1YJNS 4JK7A 2AV5A 2PMWA 3CTRA 2FVQA 1VSEA 4OPJA 4DZDA 2F9DA 2XLKA 7FD1A 3UM9A 3N6MA 1U4BA 4G1IA 1S3XA 2MLZA 1HPZB 4E89A 4JK1A 2FIUA 4UY8T 4TXSA 1MWMA 2BDPA 4M5HA 2ETJA 5CHCB 3OXGA 4NZ0A 3HZ6A 2MZSA 2BRLA 3G25A 1FKOB 3IRXB 5HRRA 4C0BA 4X62F 2E2PA 1JNRB 2MTLA 4F3OA 4DL6A 3OV7A 3RSEA 2B0GA 2KT2A 3N7SC 3SPYA 1G1XA 2JEGA 2UXCF 3CT9A 2GQCA 4CJPA 1VQ7N 3OHBA 4USVA 3A3PB 3K9KA 4CH7A 1N33F 4ZHRB 9ICCA 2NRWA 3OYCA 2EFQA 4FPAA 1S0VA 1WELA 1R8BA 1T6DA 1K9MT 3R9PA 3VF2A 5KFZA 4LR7A 1V9PA 2E9TA 2NRRA 1HNZK 2MKHA 3V1RA 2GOLA 1UW9A 1YQHA 2YMMA 2VQEJ 4UB5A 5LSRA 2GUIA 5D4NA 2UVRA 2CIMA 2G2YA 2LU1A 4ZLJA 4WIIA 4KR0B 1KOOA 4FZZA 4E8UA 2BX6A 2Z7JA 1PCAA 5F41A 1RADB 3A8KA 1ZQMA 1ZBLA 3JQMA 3PTWA 4DL2A 4C97A 1TKZA 4RW9B 1NMNA 4O9MA 5GAHU 1K8KB 4B6JA 2OEMA 4AXIA 4MDAA 2CDRB 3POTB 1ZD3A 1U09A 1J2VA 3WK7A 1HBOB 3WXIA 2FJVA 4G9BA 4FYYB 3LW5C 1LWEA 2A40A 2DUYA 4YD2A 1IV0A 2A3JA 1RHMB 4CEOA 3ZSVA 3WX8A 3C29A 3WKBA 1ILYA 5ALWA 3GFKB 4J9QA 4K4SA 4C3MA 5C25B 2QKBA 2XMKA 1WNEA 5HBMB 3M30B 3SSQA 4LF7K 2ASJA 2ZIUB 2CYYA 4ANDA 2AH5A 1VQ7S 3HXMA 3RB3A 3TZXA 5E7OB 3AXMA 4LZGA 4NLOA 8ICUA 2V94A 1N32F 4H4MA 1UPMB 3DGPB 2Z1GA 3HJEA 4P0QB 4P4MA 1RT4B 4H0PA 2HNYB 4QWDA 3SLCA 5A8WB 3O4NA 1JB0C 1RHQB 1C0UA 2BOAA 3L2UA 3ZDBA 3FNNA 2CNOB 2X6SA 1X6JA 3M8PB 4I2PB 1EQYA 3ZSWA 3W2WB 2MZJA 5IOLA 2M8HA 2FHKA 2L5YA 4GVBA 1MG7A 2A3ZA 3IRWP 1QSLA 5AKEA 4QS7A 1GFWB 7ICEA 4CBXA 1KVJA 3H45C 4QJFB 3DGVA 3SV4A 4ED2A 3N5FA 2UUCJ 2WF8A 3PXGa 2KVIA 1NLKL 1QE1B 1S1TB 4K4IA 2ILYA 4LREA 1SVDA 4DN9A 4MKBA 3CDEA 2FJDB 5J2MB 2DY9A 1HUXA 3IDHA 5IQQA 4DEZA 4DQ8A 1P1LA 3A3OB 3VF4A 2J9CA 1R6VA 2PO4A 4E2FB 3F56A 1MSWD 3TJ8A 1HNVA 2HKEA 1B4FA 4U95A 2BJ7A 3HSTB 3MURP 5AFUH 2MAXA 2K4PA 3NCPA 2Z2ZA 3HDSA 2MQOA 2RDJA 4GFJA 4JV5K 2BQRA 3V1QA 1PJ6A 1RT2A 1S57A 3Q8UA 4U9RA 3GV8B 1JROA 3PR5B 4M95A 1UJ5A 5T41A 3ZT3A 3C46A 2VYPA 4RUBA 3OVAA 2ZKUA 1PILA 5ETMA 4MFCA 4IO9Q 4DV7K 4M3RA 3PEJA 4OX9J 2B51A 2PEBA 1KOHA 4HUEA 5AQSA 1REGX 1V6HA 1N60A 8ICZA 1RG6A 3JQKA 3RJEA 3BO3A 4J5OA 3MDCA 4CH0S 4RPYA 4OVLA 1J5EF 4NRUA 4ILMA 4X65J 1NGIA 3CMAN 1QY7A 2E5LJ 3L4IA 3V72A 3LDAA 1HJRA 2F9TA 2E1PA 3OTCA 2ZNZA 2UVUA 1D09B 5SZTA 1RBVA 3HJVA 1CZ9A 3D2FB 3RJMB 1CJVA 4YN4A 1VCTA 2HHWA 1S1VA 2ASYA 3OTOJ 3TADA 2HZCA 1WC0A 5LMUK 2HW3A 8ICKA 2YX4A 1A5XA 2RU9A 3VQ6A 4UOFA 2COLA 5HAOA 3PJ9A 3QJPA 4C0HA 2LLZA 7ICKA 1RFQA 3DJCA 1IXKA 2QLJB 3D54A 3KLIA 3IAM9 5SUHA 2F4VK 4F4AA 2JHEA 3P5TL 5EOZA 4LFAF 2KKVA 5D6GA 1HD0A 4I2AA 4M5GA 1ZQEA 3J7YU 2VG6B 4PWDA 4QU6A 1PYOB 1XNQF 1RB0A 1VLOA 4BR5A 4PH5A 3VQ5A 1U2VA 1B0VA 2ASPA 2LPEA 4B3RJ 4JP8A 2VWBA 4KX5A 1VQSA 1TVRA 3P1GA 1B22A 1FFSB 2ZC3A 3W66A 1N34J 5AI4A 1ZQPA 2YX8A 1QDUB 1J2MA 3T7ZA 3NE6A 3KD1E 2N3LA 3AD9C 2Z58B 2ABYA 1NMDA 4B9UA 1FWLA 4WQ5C 4Q2MA 1T02A 3CMAS 6AT1B 5AQQA 2HWHA 1PK1B 2UUWA 2JEFA 1YT3A 2LYVA 1REVA 4YY3F 1RK8A 3JSMB 1HX1A 5FPNA 5TISU 2BUPA 2BE7D 1Y3JA 1RBRA 3NMAA 3CJ2A 4JI0F 4LFCJ 2ADCA 4N76A 1C4AA 3TYTA 5BN8A 1LWCB 3PNIA 3JSBA 3EM1A 1XMQJ 4O8KA 6FDRA 2D0BA 1IBMJ 2AMCB 3MR5A 2M70A 2CPZA 5J0XA 3F5AA 5KFXA 5DB6A 9ICEA 2V69A 4CDGA 3AVHA 4DOAA 2DEJA 3A0IX 1CS4B 4H4KA 4A48A 4AHRA 5ALDA 4YP3A 4YR0A 4DN0A 1RDWX 1HNXK 2KJ5A 1C7YA 2ZOFA 2HMPA 2GMHA 4FJ5A 2P5VA 3QYYA 2VQEK 3CDWA 2E1YA 2RHQB 4GVLA 4QR2A 1N32K 3I0RA 1ZQHA 2HBMA 3PYGA 4BACA 4BDYA 4DG1B 1D3WA 2FBYA 4OQJA 1SPBP 3CMEN 4C8MA 4PXDA 3RGIA 4YOVA 2A6MA 3ENBA 1WTBA 1BA0A 3B4DA 2NPIA 1FDBA 1O03A 2EZXA 3FEZA 4OYBA 3QGPA 1DARA 3VEZA 5EY4A 5AZJB 2AXTU 2J8SA 2AZ3A 1RKJA 2DFEA 4OI0A 3VQEA 2EKYA 2K3IA 5L39A 4JI1F 5LL6Z 8ICXA 1VISA 5B0DA 4CLKA 2V9WA 3SQ0A 5AM5A 1TTHB 2FMSA 2BE9B 4AM6A 1Z3EB 4FLXA 4KMUA 2JL9A 2MSSA 2DYAA 2MKSA 1HQUA 4UW2A 1CJTA 1WKLA 2D1CA 1WDDA 3J81j 1TV6B 3M1VB 5TKYA 3D6TB 4O3OA 1CRXA 3ZNUA 4Y2VA 3T69A 4MLHA 3WNHA 4EBCA 4TU8A 3D0IE 1RAEB 2W4DA 8ICHA 4BRGA 3LP2B 4LRCA 2HHTA 2VKQA 1M5VC 1PYSB 1SKRA 5HMLA 1KWMA 1N36F 5F8NA 5DM7L 4NWBA 1C4CA 4AHCA 4O3NA 4BR2A 5B8HA 2AGOA 4JWNA 2RKIA 3KNGA 1FXXA 1VSHA 1ZOTA 3HVTA 2R18A 1KLNA 3J7Z5 4J91A 1ZAXA 3A1YG 4A8FA 1JCEA 4OJLA 1F5CA 4DX7A 1BGXT 3CJAA 4FLZA 2KI2A 2RUGA 3TVZA 2HZVA 3BN7A 2QA1A 1RDFA 5D4BA 1F21A 3GDXA 4PYAA 1TYQB 2A2DA 1GLCG 1VQ6N 2XI2A 3BDPA 2Z1JA 2UXDF 2XCAA 9ICTA 2DITA 3TTFA 3B78A 5GINA 4DXLA 3MUMP 4AYBD 4CJ7A 4U7BA 4BRLA 3MCSA 2DJWA 1RWVB 3MEGB 1FERA 2ZVIA 3M5RA 1ICEB 4FZVA 1TUYA 5HVHA 2QA4G 1KONA 2CRLA 4LRDA 2CPIA 4UY8O 5BRHA 3MEDA 4Y2QA 4EYHB 4R5PA 3V81B 3O08A 1VYAA 4OV6A 1IWGA 2HQDA 3AARA 1ZQWA 1RAGB 3PYFA 4GV6A 3FSIA 4OPHA 5LJWA 2KXHA 1Q16B 1IKXB 2XZTB 4B9QA 3MM9B 5F3XB 4GY2B 4EU0A 3K89A 2CH5A 1Q7LB 3KOOA 2CQCA 1ELOA 3NTUA 4QIWD 4QWBA 5CZXA 3J7ZT 2L9WA 5D15A 1LEOA 3KJVB 1OY9A 4BRCA 4M9JA 1QS4A 4FXVA 1QHTA 5KG2A 4DV3J 5LJ5Y 2ADBA 1JNZB 4ISGA 1ZOLA 3R2DJ 1K9MO 3HO1A 1Z6RA 3QT7A 4X65K 1HBUB 5D49A 2IVYA 2E5LK 1FIQA 4QZEA 1FJEB 5BJRA 2W25A 1AFJA 2CPDA 2F96A 1SH2A 2NREA 2XS2A 4A57A 2KO1A 2YTUA 3FKBA 4P71A 4DR4F 1TAQA 1VRTA 2QG9B 1HBMA 4DTSA 3DRYA 4C8KA 1C0GA 1CBKA 2BJ3A 4P0PA 3N79A 3OTOK 3T1YJ 1JKHB 3C6TB 1LB2B 3I87A 4HH0A 2O8EA 2QE5A 1RSCA 5IIJA 2UU9J 2O8CB 1YZ7A 1BQNB 2IAJB 3VEWA 2WCXA 5EDWA 3NF6A 2AKWB 3J81O 1S9GA 5CYMA 3ID6A 1JJ2M 2W9BB 1COKA 2OPQB 2E8MA 4Y2RA 1OSCA 2RHFA 1KP6A 2HWIA 1BI4B 2YX7A 3MK6A 3V4MA 1WEYA 2K06A 5ALUA 4FW2A 3BYPA 4RBTA 2B6AB 4B3RK 4NA2A 3NCQA 4C4TA 3G10A 3EUB2 2MZQA 4M8LA 3M8RA 1EO1A 3C2PA 3CG7A 1N34K 2RS2A 1S4EA 4FWMA 1M5PC 2YB4A 4H0YB 2IYGA 1FE0A 3OYFA 2D69A 3AEVA 3IAYA 3AAPA 1L6NA 4KHQA 1D8BA 3CD0A 2KICA 4ETXA 9ICSA 2QWRA 5GAGI 2HF3A 3LA0A 4W5OA 1IQZA 1URJA 1U2CA 1S79A 5AK6A 5JU5A 2MKYA 1N2XA 3OYAA 2OFGX 1LAWA 2NUBA 4PHPA 3H5UA 2I5HA 1XMQK 1F3VA 2F7TA 5L46A 2V52B 3OHAA 1ZXIA 1NBWA 2GO9A 2GS8A 5KG3A 1UA0A 1IBMK 3BF1A 1M6YA 2HAFA 2LCWA 4CESA 4WJ3B 1QH9A 4I2QB 2HFSA 1YLXA 5KPZA 3CCQN 4IJNA 5DM6L 4BWMA 2VBYA 1YVNA 1U48A 2XICA 1DXSA 3ZZOA 4ISEA 2N1RA 1NUEA 1JLGB 4IFVB 2ZZTA 5HI7A 2XMWA 4L76A 4EP5A 2PZSA 1YBTA 1NM1A 1JL2A 1AYEA 4CP5A 2R2TA 2QFJA 2RHKA 3BEXA 4KH1B 2VWKA 1ASWA 1DQ8A 4FF4A 3ALYA 5JUMA 4QZ9A 2X51A 4L75A 5DLFA 4LJXA 1NDLA 3LANA 2GZOA 3KK1B 2ATQA 2D74B 2D4WA 1WAJA 1KVAA 5AQOA 2YKMA 3VGMA 4YFUA 2YNFA 3UWTA 3CCMN 1J5OA 4GXJA 4BG9A 4GXIA 2W9AA 3VQAA 4NLKA 8ICPA 2Q0RA 3B8HA 4ATNA 1TFRA 4EX7A 3MDQA 4BC7A 2FY8A 4DFJA 2FZGB 3KZBA 4NA3A 4CIOA 4CD1A 1R43A 1BQXA 1X9MA 1FDAA 1SKSA 2PGCA 2HEKA 1TE2A 1S6UA 4A8QA 3WK5A 1DQAA 5HL7Q 2NO5A 2GJ2A 4G3IA 5EWFA 3CCQS 3DRXA 3WU2U 1F5BA 3THWB 1BWFO 1SUQB 3N4PA 4C7YA 4RW6B 3HILA 2RT3A 2FHJA 2BM1A 3QXGA 4IFYA 1WDTA 4HVJA 4BQZA 2W2QP 3CJSA 4X4OA 3NASA 2QGFB 4JBCA 5T14A 3UDVA 4Q44A 3W2VB 2X6NA 4ZVEA 4JI4K 1XR7A 2PBDA 4F5RA 3CCRN 2W7PA 2ZJPL 4KI6A 3NVWA 2OELA 4DR6F 2JVOA 2OPSA 3E9LA 1YIJN 2JFDA 3HSZA 4NLBA 2ZBIA 2X74A 2ROPA 3CCMS 2ZVSA 4IH5A 4LVSA 4J9RA 5HP1B 4I2FA 4PGXA 5HVGA 2C3UA 1TL4A 3BGLA 4HHTA 3KYLA 3VQPA 1Q9YA 4OJ1A 3AA8A 4DDFA 5BPCA 3A5NC 5ITHA 1Z00A 5L38A 5G0RA 2V8PA 4DR5J 2ASOA 1HIYA 2ZZMA 1OH8A 4NL5A 1BPEA 2FB0A 2FF3B 3AGRA 3R9LA 5AQTA 2J6UA 2XSFA 3Q8LA 2GA7A 5AZIB 3CJ4A 3CUNA 2FDRA 1YHQS 2VKZG 5DDRC 4RQNA 2PFPA 2GHWA 2F63A 4JKGA 3WIUA 3G96A 2DNKA 2GCFA 1X5OA 4Y2YA 2HYIB 3SCIE 4M0AA 4NV0A 4YNQA 1R6YA 3JSYA 4FJXA 5KG0A 3UB5A 1SXEA 4M3XA 5LL6d 4FS2A 3K7RA 1UVLA 2WHOA 5A8KA 3CCRS 1WKKA 4DUYF 3OW2M 4NLVA 4GIBA 4F0HA 2YBVA 4PHEA 4OFZA 2QWQA 5CXTA 2MRLA 2X78A 2ZJRL 1YIJS 4RQ3A 3HM9A 4R0JA 1BXNA 4J9MA 2AEFA 2FPHX 1X31C 3N5BA 5DBBA 3DOKA 4DV2J 1WSRA 8ICCA 1S97A 3T1YK 3OGUA 4FWNA 2B7CB 2BW7A 2WVEA 1EKRA 3BPDA 4KLLA 4RQMA 1T9YA 1TL5A 3JTOA 3C19A 3NNAA 3OYHA 2UU9K 2QYCA 4RKUC 2WBRA 3M32B 3CMQA 3UVJA 2WOMB 2P9UB 2CPYA 4L74A 4Z37A 4YDXA 4B3SJ 1JALA 3M6UA 3HX0A 2NZTA 3ILOA 2XS7A 1SZHA 4DHYA 3U3YA 1NSQA 1ZXOA 1OS5A 3DC2A 2WRMA 3ISCA 4KLOA 3RYLA 4LFBF 1L7NA 3LQVA 5BRFA 3EVMA 2BR0A 4KLSA 3QT5A 2VV5A 1KTQA 4DR2F 3JSRA 4IRCA 1O51A 2W8KA 4U8YA 2J76E 2LA6A 3KKAA 4F25A 2AIRB 4NYPA 3T9NA 4MK7A 3QZ8A 2X3GA 1QUVA 3CYMA 2JDJA 4AYBC 3VV2B 4KTWA 3ICXA 2KG0A 1WBDA 5AQJA 1MC8A 3IC1A 4CHZA 1FVQA 4B8CA 2QX0A 5KFSA 4KPYA 2MGZB 3SMPA 2H3QA 4R8UA 1NDPA 1ZQRA 4RNOA 3MEEB 3MM6B 3QNMA 2UXCJ 1KD1T 2P1JA 5FPMA 2DH7A 3AU2A 3SENA 4C7QA 4UOCA 3QIPB 4JK9A 1VI7A 2KHDA 4CEFA 2BBEA 2M9NA 1XR6A 4DQRA 5B7WA 4NLNA 2OIHA 2LBOA 5A76A 3MXMA 3OPKA 1EETB 1NHKL 1I6JA 3QSYB 5F2RA 1VHFA 4NB4A 2X1GA 2XGPA 3FZMA 4WXWA 4UAUA 5LJVA 1S7HA 4ED1A 4DCOB 1N63A 1UAXA 5KT4A 4U67L 3QZ7A 3T5JA 1TKTA 4CGJA 2ZITA 3GMGA 2GTDA 2ACYA 4QIWC 4ZH4A 3EXCX 4GC6A 3DLEA 3U4LA 2UXBF 2AW0A 1DGJA 3PRVA 3LM9A 4CE9A 5GTIU 1SQGA 3R27A 4NE9C 5HR7A 2OZMA 2C28A 4CGHA 4X64J 3BUZB 4NXZA 3PW4A 5CA7A 4UB4A 4WFXA 7ICHA 1QQ5A 4CTAA 3VTIA 4K4ZA 1NWKA 2NNWA 1V5VA 3ZTPA 4Y2XA 4KN7A 2ROEA 4QPTA 2XLJA 2NYHA 1VQPN 3J7ZO 3EE9A 2A1JA 3EO3A 2K4EA 1KQFB 4G1PA 1KHVA 4Y1DA 3E01B 1A5VA 1BPXA 2EK1A 2PEHA 4L3QA 2IRUA 3OYGA 4NL9A 4BRHA 5J0TA 3JAMU 4FO0A 4KFBB 2D3ZA 4F36A 4A2AA 2CJ9A 2BHNA 3R1LA 2IJFA 4DJBA 3IRXA 5JRTA 3CD6N 1HKGA 2HBQB 4JHDB 4Y2CA 4JK8A 3TJ9A 4BREA 2LKZA 3THYB 1SV0C 4RUCA 1Q8IA 1Y64A 1RWPB 4EO8A 4EMDA 4BUGA 1S5JA 2DISA 4J8FA 2R8JA 1FEZA 3CCSS 3C21A 5KG4A 1SBRA 2AT1B 3EZ5A 3CFRA 3Q8SB 4ZHRA 4QIGA 5KOXA 5H1SV 4YB1P 4HAIA 1S1XB 3KG0A 3QE9Y 1IIPA 4RQ0A 1HYVA 3HULA 1S7IA 2HF4A 4GXKA 3MUVP 4RW7B 2V0NA 1FO1A 1BHNA 3K5PA 1NI3A 3AHPA 3EUNA 3BR8A 3SR6A 2MQMA 3VAJA 3CULA 2Q97A 2XM3A 4U7CA 1SKWA 4KHPK 4KH0B 1W2BM 2BCQA 3NUQA 4ANCA 3RBXA 4DQPA 3ZTQA 4BC3A 4RNHA 3KK7A 4CRJA 3CCVN 4X84A 1ZQBA 1UWAA 4RW9A 1D9AA 1KNZA 5A0YA 3C66A 4F4KA 4DR5K 4NLDA 5KFTA 2A3VA 1XBWA 5KG5A 2XI3A 4ETZA 4PQUB 4FOIA 1HBOA 3LZIA 2VASA 3QT8A 1LCUA 2F1HA 4PZVA 4UW9A 5LSOA 3SMSA 3DXMA 1F0MA 2LXFA 1HWJA 1GK8A 3IM9A 1XMOK 5C25A 1MWZA 5K14B 5HBMA 3M30A 4M9LA 2DBBA 2M0NA 3TFSA 2ZIUA 3TUZC 2RRNA 4J9UE 4TQRA 2F5GA 3OSNA 3DGPA 4P0QA 1RT4A 1UVIA 2HNYA 1PJ5A 2V4QA 3WK6A 3M8PA 4I2PA 3QJLA 4I56A 2FSNA 1HI0P 4CLPA 4UUXA 4M5LA 1YUWA 2OEJA 5F3TA 5ALPA 3W2WA 2YMPA 4CBUA 1N5VA 3SBMA 4FLVA 1E6VA 3JTNA 3TP2A 3QICA 4USAA 4IZ9A 2G8KA 1T11A 2FE9A 4FYWB 4ES1A 1W7WA 2F77X 2SXLA 2ATLA 2J7WA 1F0XA 4F50A 4RBUA 1BPZA 2LEAA 2CJBA 2DWQA 5ALNA 2R2RA 4YG2A 1QE1A 1VQLN 3MPVA 1S1TA 3LL3A 2EANA 4O4GB 5B0AA 3CCVS 1F2GA 3SEIA 5JTIA 5J2MA 2H9ZA 3DFEA 4BE0A 2YHXA 4QYRA 2HRYA 3CC2S 4K41A 5AE2A 4O5BA 3CCJN 2A6AA 2QB0B 2YWWA 2BCRA 1KLMB 1KAXA 1KKHA 3F2BA 4LF1A 1G4CA 2E2NA 2M3DA 5IIIA 4B3SK 2I7NA 2LYBA 1WC6A 3GIKA 1NO8A 4M5MA 3TPQA 3QNNA 5F8GA 1L7PA 4WZMA 4BBYA 5GMKa 4NLYA 3VAFA 1JLFB 5KAFU 1JRPA 1IR2A 1JCFA 2KIVA 7ICSA 2DGVA 1GMVA 3NGYA 1T3VA 3HKZF 2C42A 4Z94A 2W2PP 3RJHA 4KRWA 4OI4A 1FD8A 4ID8A 2R7RA 1RTJB 7ICNA 2FSKA 4UAYA 4HCCA 1Y00A 3V6JA 3M7DA 2ZXHA 3MWPA 1WSEA 1HNWJ 2E5HA 3KFWX 1BPDA 4USJC 2VHGA 3HX9A 2N7CA 3H0PA 4MIWA 2P9GA 2WONB 3P5JA 1S99A 1ZPVA 1XO1A 3MI7X 2C2DA 5ALKA 9ICRA 3VOVA 2ILZA 1O1WA 2B4JA 2E1FA 3TQ1A 2GUPA 2J6SA 1YJ9N 3DU6A 4YHHJ 1S76D 5F1XA 1RU2A 1VQLS 2HBRB 3ZSZA 2YPZA 2HOQA 3D2FA 1YRXA 3ZNJ1 1HW8A 2MY8A 3MMAB 1R59O 4USKA 7ICFA 4DV0F 3CCLS 4R63A 2JLFA 4K50A 5D0GA 4AFFA 4EZ9A 3AN1A 3AGKA 5EE1A 1NDKA 5HATA 2HS4A 1WI8A 2B43A 1Y9OA 2C1EB 3SQGB 3H98A 4K8XA 2LM1A 1S9FA 1DTQB 5IWAJ 3KWGA 4O3MA 5AQMA 4A4JA 4CGFA 1WCLA 1VMBA 3ENVA 1H38A 3F53A 3MCNA 4JKBA 4IUFA 5KGWA 4X64K 5CZ2A 2VG6A 1RXOB 4OPKA 4EO6A 2OYYA 1S4FA 4X66F 5LMNF 1M5HA 3AB2B 5J2PA 2HQCA 2PE8A 4IDKB 2QV6A 4MMOA 2CQGA 2GWKA 4JYAJ 2IGIA 1MN9A 2CQDA 3V9XA 1L7MA 3E3XA 2E66A 1T05A 3FCVA 2N4CA 3Q83A 2KHCA 3BF4A 4H0VB 4ZP7A 3O9QA 1IG9A 4KLQA 4IRDA 4CNYA 3ZX2A 4CK2A 5GAHI 4K0KK 3H1VX 4RTFD 4EP4A 2APOA 3BY5A 1PK1A 3CCUN 1KBRA 1JL1A 2AU0A 3OY9A 3JSMA 1YJ9S 1T4GA 2FPLA 1F9HA 3CSKA 4C3LA 3I9V9 3M8WA 2W43A 2DGTA 3EE8A 1LWCA 5LSLA 4WQ5A 1HJPA 3C15B 1FTRA 4I4BA 3VVTA 2ZTCA 3BH6B 2PN6A 4BRNA 4C1NK 3QX7A 5FJ4A 3SAHA 2JV3A 2GGPA 2DHXA 2RS8A 1U1LA 2Q36A 5J2BA 2CXEA 2G0JA 2GMLA 1QZ5A 5HJXA 2CNKB 3P31A 4LD0A 4PY5A 4UB8U 2V4JB 3TABA 1CS4A 2LKYA 4DU8A 4DQSA 2NYIA 4M7XA 1GLEG 1T94A 1SL1A 1DRGA 4O5KA 5J2QB 3BQ7A 8ICYA 3NGZA 3SI6A 2RRBA 4DV4F 3S01A 1VC5A 3GE9A 4CHQA 2D3DA 1RBSA 3HBTA 4PPZA 2RAQA 1S48A 2E5JA 3KLHB 1NK0A 4CVNE 3DRSA 1N5YB 3WKAA 5A0LA 3PSTA 3ETRA 5KTQA 3VZHA 3JPTA 4DG1A 2E7VA 4CF4A 1JCGA 4C9DA 5DDMA 1S6QB 4MKVA 4NI2B 4M7YA 1ZBSA 1FKAF 3K17A 1GOBA 1L3KA 4OGEA 2VA3A 4KLEA 2W24A 3IR7B 1XTZA 1WUAA 5AZJA 4CI6A 1I1GA 3SJHA 4RQ5A 2PMZF 2CJAA 3CCUS 5DKWA 5CZ1A 3PIOL 3V2UC 2JJ4D 4MYTA 4ZVFA 2HGMA 5LXYA 4O4RA 4HWIA 2HFZA 3WNGA 3FDSA 3AOAA 1SWWA 5IIOA 2UV8G 4KHRA 2ZKTA 5AQRA 3H2UB 3V9UA 5J0YA 4CF2A 1YJUA 1P9QC 1KD1O 1UVMA 2VUGA 4ILGB 5C2GA 1AQ6A 3UR3C 4F0KA 3M1VA 2D41A 2FLOA 4CJSA 1PBAA 1IJFB 2LFVA 3RAMA 3OT9A 4C3KA 3LP2A 4HHJA 4OYXA 4F4ZA 5C24B 3RBZA 4Y2MA 1QZ6A 4PKGA 3MM5B 2Z57B 2F8EX 4UAVA 1O8BA 2G8HA 3ZX0A 4PHTX 5G4DA 3U7JA 4DR4J 8ICWA 4FF3A 3H8JA 4FWPA 3C1ZA 4CGDA 2P9NB 2DNPA 2Y1LB 1XHXA 4BJQA 2ZUBA 1FWPA 4DCJB 2RDDA 5AE1A 8ICLA 3HPOA 1LOUA 3Q8QB 3D1QA 1TYQA 1RPLA 1RQ0A 3W65A 3QLHA 4DR7F 3ITHB 3VF0B 5CJ7A 4M3TA 4X4VA 4IC9A 3MEGA 2KDOA 4HVZA 4K4XA 4I6YA 4ICLB 2XMVA 2QEXN 4IYQA 3IWNC 2DIUA 4DLGA 2WC9A 3OL8A 3BKFA 4ILJA 3PR4A 5CP2A 4TKTA 3ED5A 5E0OA 5J2NB 4QBUA 5ALZA 1XU4A 4DL7A 3KKSA 3MBYA 2M9KA 3V81A 1CULA 2BJDA 3O5TB 4R79A 2BZ2A 3NLCA 3ZEUB 1X4EA 1YVUA 8ICGA 3RJIA 3MOZA 3T41A 3TANA 2JMGA 3WK8A 1IKXA 4HUGA 3O1LA 4DV1J 3MC1A 1MMDA 3CF5L 4DWIA 4LF9K 2RF2B 2Q2RA 4TY9A 1YRTA 4IOXA 1UVJA 1OO0B 1HNWK 2GW8A 4LBPA 4TUQA 5AQXA 2V63A 3GILA 4NA1A 3LGNA 1SB3C 5GADI 3KLFB 9RUBA 4MDBA 2Z2LA 4RU2A 1M0SA 5J2FA 1SGGA 3OYIA 2IVFB 5F8LA 3DLLQ 3AA5X 5ALHA 2GWJA 4ZPAA 3ZZZA 4OYAA 3OFGA 7ICGA 4YHHK 1JN3A 1DHMA 3MN6A 3L09A 4WF9Q 3D6MB 2MZ1A 1UEVA 4Y28C 4QIVA 2GVDA 3NVZA 4E1JA 1FK9B 4IQUA 2DGXA 1QAXA 4I67A 2ZGYA 1WHVA 1W2IA 4DTXA 4JV1A 2FVPA 2QEXS 4PUOA 1JKHA 3C6TA 2JEIA 2BKOA 2PFNA 2ACMA 4KGXB 2XEXA 2F8SA 2IOCA 4FJHA 4ZVTB 2G09A 1BQNA 1HHTP 2IAJA 1HLWA 1TZ0A 2E1RA 3UN3A 4LRBA 5IWAK 3P96A 3NGUA 2FGCA 3IMXA 3Q89A 3QQCD 4P52A 1IKYB 3LWMA 1UVKA 1BUXA 2BJ8A 1SAZA 2W9BA 1HMVA 2OPQA 3GJQB 1X5SA 3HFVA 4P7TA 5KRTA 2XTJP 1BI4A 1OH5A 3ETMA 3TZZA 4J37A 1WSIA 4PR6A 1JMTA 4A8KA 2B6AA 4QW9A 1U25A 1CEZA 1M1KT 4P4PA 5KFQA 2IOFA 5AICA 1ZQSA 2QTWA 3VEVA 3OYDA 1TKDA 4UATA 3K1RB 5B5EU 4DR1F 5L1MA 3T5HA 1VDVA 1XNRK 1EP4A 1ROFA 3LTOA 3HP9A 1NNEA 2EG2A 4ZTFA 2ISPA 5KG1A 1VRQC 4MN4C 3DRRB 1ATRA 2QYGA 2E9ZA 4Y00A 2G08A 3G0ZA 4H5NA 4F2RA 1VHIA 4LF5F 2NYVA 1ZZNA 2X7IA 3K5LA 4DL3A 2CVEA 4GV3A 1YKWA 4DOCA 1SJQA 2PC6A 4XEIA 1FA0A 2ZIWB 4I2QA 4O0JA 3GR1A 3FZFA 4WQ4C 1X4DA 1LFWA 4OIXA 5ALQA 3ENAA 4KN4A 2FHOB 1EQMA 1H73A 1UCVA 1KFTA 3L2WA 3MX5A 1JLGA 3AM9A 2W7OA 2EBEA 1IVZA 2NXJA 3C1YA 1GLBG 1XR5A 4CDIA 4CHPA 2MQ8A 3KUEA 2QWNA 1CXUA 4RLEA 3K59A 4DR3J 3FSXA 1KN5A 1KXPA 1VQKN 5TKWA 4OHVA 3HWTA 5F0XA 2F8MA 3L2VA 5AR0A 3LK9A 3CRXA 4F71A 4RQ2A 3KK1A 1D5AA 2HQFA 5B66U 1S0NA 4KYZA 4NXMF 2W1BA 4KLDA 3RTVA 1S8OA 2MY7A 5JJBA 1FNOA 2D8CA 2XZWA 2W01A 1UFKA 1N54B 4ILRA 2AZ1A 3E66A 1T0TV 5M1KA 4XPCA 2ALYB 3RZAA 1K6YA 2YMQA 2KN4A 2E1CA 2A5XA 1RHRB 2FC0A 3C8YA 3BBBA 3OYLA 3DEEA 3E8OA 1O08A 4IG0A 1RT7B 3CP8A 4IFEA 3N7PD 5IT0A 2MB0B 4CF9A 3RUBL 4NLUA 1VFJA 3QATA 1MA9B 4ED5A 3RG6A 2IHNA 1Q53A 2NXUA 4WKYA 1F44A 2V2VA 3U27A 3SFUA 1UJ6A 2LECA 3HZGA 5CRXA 5C42A 1VSMA 2BYCA 5AQNA 4JI6F 3AY0A 3CIPA 5JVGQ 3V6DA 3TUPA 4LVNP 4FNHA 3ASMA 4W98A 4CBWA 1K5OA 1SUQA 2FJWA 1X4AA 4WP9A 2ZH3A 4CJ3A 4RW6A 2IHR1 4MHVA 4CNZA 1FRKA 2IVOA 3TX0A 5DG7A 2H5JB 3BBCA 3J81Y 3IBPA 4DV6F 4P9SA 2H65B 2EFPA 4I2DA 2FMPA 4FLTA 1H3DA 4RT3A 4RWXA 1MU2B 7ICRA 3THXB 4ZKAA 2RVJA 3M2RB 1TGOA 4Y2PA 1LWFB 2E1MC 2VIHA 2F44A 3PACA 2VG7B 4AQYJ 5IINA 1NSKL 4ER8A 3K1ZA 4ERDA 4LC9B 3VQ9A 1R0AB 2XHBA 5HP1A 1PAUB 3QFUA 3BGUA 5L9NA 3T6JA 3W5XA 3CJQA 2P9SB 4J03A 3S3NA 2R2UA 1NJYA 4I6MB 3PCOB 3ET6B 4UUWA 1JLEB 3Q8PB 2ZE2B 4MFAA 4RNFA 4X4TA 2KHOA 4B9TA 1WF2A 1IR0A 1S6PB 4LFBJ 1DFDA 2D0CA 3KKFA 2ZM6F 1F1BB 3EZOA 1W26A 4JI2K 1L5UA 1U1QA 3GIMA 1NK8A 5AZIA 4M6WB 1KKXA 3EE3A 4DR2J 2W6KA 4F72A 3OSPA 1ZD5A 5H9FK 3I76A 2D1KA 2KJVA 4WTYA 4YVZA