4O0IA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
b'SKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with 2'-MeSe-arabino-guanosine derivatized DNA
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o0iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4o0iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o0iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0iA01
3L2RA 4DTOA 1U47A 5CP2A 5KT6A 1CEZA 3RWUA 1VK0A 2KFNA 3C2MA 1RT2A 4QWCA 3V9XA 5KFEA 1IXRA 9ICRA 5L1KA 1NKBA 1C7YA 1J53A 4C8NA 4EP4A 4ZTFA 2OPSA 4KMUA 5KFYA 4FBTA 5DMRA 5DLFA 3TANA 3LPTA 3HX0A 4KN7A 1RPLA 4Q8EA 1HYZA 4FYDA 3GIMA 2VA3A 4CHPA 4Z4GA 4OLAA 2F1HA 4GXIA 8ICXA 4QZEA 2HW3A 2YNIA 1ASWA 2C2DA 3PR4A 3RJHA 4W5OA 1ZQWA 2FBTA 1QE1A 2HHWA 2UVWA 4L8RB 1HQUA 2VG5A 2IS3A 4J9LA 2XHBA 3RB0A 2KN7A 3C95A 2P1JA 2BPGA 1XHXA 4RT2A 2KW4A 4Z4IA 2LSNA 4O9MA 3Q8PB 2NRXA 4RQ3A 4J9RA 2PFQA 1KTQA 4DTSA 2BQRA 4I9LA 4UB2A 2HHUA 2FLPA 5J2HA 4HUEA 3ZDAA 4OKEA 3ZSOA 5CZ1A 4E19A 3TABA 4UB3A 1Z25A 1VSFA 4ED1A 5J0RA 3QEIA 1NKCA 4E7IA 1TVRA 5J0XA 2W9CA 5KG0A 5FDLA 1NJXA 3GV7B 3QINA 4J9NA 4MFBA 4E7JA 3OJSA 1JLBA 3RMAA 4ED0A 5HHHA 3ZSYA 4BXOB 3VQ5A 5D49A 5J1EA 3AO1A 3O3GA 4DFMA 2PFPA 4CHNA 3RB6A 4CGGA 1D8LA 4QCLA 2JEIA 2HNZA 3K5LA 3MGHA 7ICLA 4RQ7A 2BE2A 1C1AA 4H8KA 5HRNA 2JEGA 3PVXA 1NOZA 3NGZA 4FJ5A 1BQNA 2NRZA 1BPXA 1RXWA 4EYHB 3LZIA 4XRHA 1GOCA 4CF9A 4CFCA 3MR6A 2YNFA 3MEGA 4KRFA 1JLFA 2X6SA 4BACA 8ICLA 1ZQVA 4CEBA 2ZTDA 5J2MA 1Q9YA 4M9JA 3H4BA 1HRHA 1ZQQA 4KLTA 4OJRA 2ZTEA 3SNNA 5KG7A 3TI0A 3D0PA 2BKEA 5KRSA 1UAXA 2PYJA 1N56A 4KI6A 4JUZA 1L3TA 3G0ZA 3AVLA 1PZNA 1L3SA 5KFXA 4DSLA 3AA5X 2XY8A 3O4QA 4DOCA 3V9ZA 3UIQA 2ASDA 9ICGA 1WCLA 3LZJA 4YVZA 4ZHRA 3AUOA 1S76D 5DGBA 4PHAA 4J9QA 3L3UA 4YFKA 1BCMA 4DTXA 1HMVA 2P51A 2X6NA 1ZQIA 3IAYA 3NFAA 2IBKA 1ZQMA 3H8WA 1FKPA 1HQEA 4Y1DA 4CJKA 2P5OA 1S1VA 3U3GA 1ZQLA 2NRWA 1U48A 2HMIA 3JPRA 4M3WA 1VSIA 3OVNA 3LWLA 3SZ2A 4CHYA 4CIGA 4PGYA 4DQQA 8ICSA 1MQ3A 4FLTA 3CM6A 2D0BA 5KFKA 3NF7A 5C24A 4M3YA 4MEYA 4F5NA 4TUSA 1U49A 2A1JA 3C94A 4NCAA 1LWFA 1Q8IA 4CECA 1KLNA 3T1AA 4JRQA 4DLEA 5KGWA 5I42A 4RPZA 4I27A 2UVVA 3LAMA 1QSSA 3DOKA 4GXKA 5FROA 1YTAA 3GIKA 3EPIA 3V7KA 4JLHA 1BPYA 1KCFA 7ICEA 5CWRA 4I28A 5HNKA 3WNGA 1HUZA 1KVCA 1RT7A 4CF2A 5CY4A 1QSLA 1KVAA 4CJVA 1RDCA 3AO2A 4DQPA 3KKSA 8ICWA 4FLZA 4YQWA 1U04A 4RPXA 2B6AA 1LWCA 3RBEA 3KK3A 1HJRA 2FPKA 1YVUA 1RT6A 4DFJA 4C8LA 3VQBA 1DTTA 1IG9A 4M0AA 3K5OA 2BCUA 3UXNA 3DLRA 3HP9A 4O5CA 4CIFA 4UB5A 2P66A 4Q0BA 4KLHA 4F4KA 1TL1A 5KT5A 3RAXA 4JS4A 3QEPA 4DS4A 3OSNA 5KT3A 7ICFA 2F96A 3QZ8A 1WSFA 4F5OA 1N48A 5J0PA 3NE6A 4KFBA 3KLHA 3QIPA 2B21A 2FBYA 1ASVA 5J2AA 1D8YA 1TV6A 1K1SA 4ECVA 2ASJA 1NK9A 4JWMA 1XHZA 4FJXA 2FMSA 5CZ2A 3LDAA 5JS2A 3NGIA 1SKSA 2DPIA 4DWIA 4QZCA 1CXUA 3K5NA 4DOBA 2BANA 2DFLA 1VSKA 3HXMA 3SCXA 1NOYA 4PHEA 3V6HA 5C42A 4ED6A 8ICQA 1QTMA 2PFNA 3IHQB 3UXOA 7ICKA 3SV3A 4NXZA 4DQIA 2JEFA 3E01A 1A76A 5HP1A 2PYLA 5J0QA 4I9QA 4CGJA 3ITHA 1SZPA 1WSHA 3MDCA 3TAMA 2XO7A 4RW9A 3PR5B 4DFPA 1XI1A 2W8LA 3S3NA 4I2FA 8ICHA 3V1OA 3EZ5A 1LWEA 3QEAZ 2YHAA 4J9KA 5CJ7A 5KFQA 4M3RA 3OY9A 3B0XA 4FM2A 7ICRA 1ZJMA 1VSMA 4FCYA 1ZQCA 3OYJA 3MFIA 4IRCA 4YR2A 4EYIB 2ISPA 3T3FA 3VQCA 2J6SA 5KG4A 4DF4A 1JLAA 4X5VA 3JPTA 3FDSA 3WNHA 4CJUA 1LAWA 2KZMA 2H5XA 4AHSA 3QEWA 1TVAA 4RW7A 3ZDEA 1K1QA 3CYMA 4RG8A 4FK2A 2VANA 5BPCA 1WSGA 3KLIA 9ICTA 4F91B 3OSPA 3F73A 5DG9A 3AVIA 4DTMA 3BQTA 3PO4A 4FLVA 1LW2A 1NJYA 1HPZA 4IQUA 5EWGA 3BQ2A 3C6TA 5J2CA 5TZVA 3S9HA 3OYBA 3U3YA 5KFVA 4R8UB 4FW2A 3RMDA 2RDIA 4M42A 1BVSA 4W5QA 2IHMA 1KFSA 1U4BA 3UQ2A 1IKWA 1ZYQA 3C2LA 1S9EA 2FPMA 3NF9A 3M9MB 3V81A 1EXQA 3NF6A 1NK8A 3SQ4A 1ZBIA 3GDXA 4C8MA 3PMLA 3V7LA 3ZSRA 5KFZA 1X2IA 3SI6A 4R65A 1A5VA 3AVAA 1LV5A 1S6PA 9ICAA 4FM1A 1WNSA 3TWHA 2ZE2A 4ECQA 1ZQGA 2YV0X 1HJPA 3RRGA 1ZBHA 4Z4FA 1W9HA 1TK8A 4J9PA 1JN3A 2BCVA 1WSIA 1LW0A 5IIJA 1ZETA 4CFAA 5BOLA 3N97B 1ZQHA 2NRVA 4O0JA 3IS9A 5IIMA 9ICLA 4DQSA 3CQ8A 1S9GA 4BWJA 2AGQA 2JEJA 2GV9A 1ZBUA 3RH5A 4QW8A 4NY8A 3AA4A 3ZSWA 3KIOA 3TAQA 5DQGA 3OYAA 1HYVA 1REVA 3T5LA 3FFIA 3UXPA 9ICXA 1FXXA 2AGOA 4O3RA 3NH0A 4F92B 7ICUA 4KHQA 5EWFA 5CYMA 2AQ0A 3KK2A 5J2DA 1X9MA 1L3UA 3OYGA 3Q8SB 3OYNA 7ICNA 2BCSA 5L1LA 4AHCA 1BPDA 3QERA 4BE1A 1ZQSA 3DM2A 1JIHA 3PX0A 1DOQA 3SPZA 3CFRA 3EY1A 5DB9A 3U6FA 4MFFA 1NKEA 3NF8A 3L8BA 3QETA 2R7YA 3V4IA 2JLEA 4QWAA 1C0TA 9ICMA 2V9WA 1BIZA 3LP1A 4QZDA 1ZQDA 1NJZA 4DSFA 3HVRA 4M45A 4KTWA 5J2KA 4O3OA 1TAUA 4YP3A 5J2QA 2BGWA 3GILA 4KLOA 3T5JA 5DQHA 1RDDA 3RB3A 1T05A 1C0MA 4G3IA 1BISA 3B0YA 3THVA 2XGQA 3V9UA 3KHGA 1VSEA 4EBEA 5HRPA 4PGQA 5L1IA 3BQ1A 3BGRA 3Q8RB 3KHRA 3VQPA 2VG7A 4RW6A 2O4IA 3SUPA 2GWSA 1RBTA 1IKYA 2YHBA 9ICUA 4RPYA 3DMJA 4Z6FA 4N47A 3GQCA 4R8UA 2OPPA 3TAGA 3M9OB 3VQ7A 3AVCA 1SV5A 8ICZA 3AVKA 2QKBA 3WNEA 9ICNA 1VRUA 5J2NA 3KD1E 3OYDA 4KLDA 1T8EA 2OZMA 4LSNA 7ICQA 4CCHA 4NM1A 3NGYA 3ETLA 5HHIA 4IG3A 5F9LA 5KFPA 1LAVA 4LD0A 3QNNA 4M3TA 1BPEA 5CR0A 4Z0UA 4M9HA 5IILA 4LZDA 3DRPA 1KSPA 4B8AB 4O0IA 1HNIA 5DB7A 4W5TA 2A1JB 3MR2A 3C23A 3FYHA 3M8QA 3TARA 4YG2A 3RMBA 3SQ1A 3DLBA 3K57A 3CFPA 5KFSA 3F9KA 4TURA 3ISNC 3RMCA 2W9BB 4N41A 5IIKA 3MR5A 3JSMA 2IOCA 4UBCA 4MFCA 1JLCA 2ZJ5A 3NAEA 3ZD8A 3HWTA 3C5FA 1RTIA 5J2EA 4B9VA 3CG7A 3L2WA 3KKRA 4H4MA 4HTUA 5DLGA 3PV8A 4ECWA 2IAJA 4FJ8A 5KFOA 5J2GA 4AH9A 2BPCA 4CEDA 3M8SA 2KQ2A 5DG8A 2Z1HA 4HCBA 5HRSA 4CE9A 4FS2A 3PY8A 5J2BA 4FVMA 2JGUA 1N5YA 2HB5A 1CZBA 4E7KA 3QEVA 4J2EA 3RTVA 3AVHA 3G6XA 2ISOA 5D4BA 4E3SA 2PI4A 8ICTA 3AV9A 2IHNA 4OVLA 5E41A 2D0AA 1IKXA 4PUOA 1IKVA 4DTJA 4F5PA 3DI6A 3HT3A 1ZQNA 1RDBA 3OHAA 4ED2A 3PW7A 2Q0ZX 8ICBA 1JX4A 2J6UA 2P6RA 1WSEA 4NYNA 1EETA 1S6QA 5EOZA 5HBMA 4GLXA 3LP0A 3VQDA 1JXEA 5CYQA 4UB1A 4F93B 1RTHA 2HHSA 8ICJA 3UQ0A 3RB4A 3GIIA 1W0HA 4R64A 3OS1A 3H40A 2W8KA 4YN4A 1NK0A 4FJ7A 4NM2A 1QS4A 8ICFA 4LSLA 1Z00B 3ORYA 2FPLA 3AA2A 1B92A 2ALZA 2B5JA 1B9FA 3JPNA 3QEXA 9ICSA 3T5KA 2BR0A 4JK1A 4B9LA 2ATLA 1UOCA 4UBBA 1BPZA 4CK2A 4W5NA 1J54A 4QZAA 4O3PA 5FRNA 4RQ5A 3HYFA 1S97A 3ZT1A 3BJYA 4DS5A 4B9SA 3LALA 4PY5A 4CGIA 3DRRA 4I29A 2C28A 5SZTA 4GMJB 4O3NA 4BE2A 4KLUA 4M9GA 3PMNA 1S0VA 3EPGA 4KV8A 4KHYA 4CF1A 3NTUA 5J2JA 4AHTA 2Y1JA 3N4MB 3RJJA 5L1JA 4Z4CA 4DU1A 1S9FA 1BGXT 5DBBA 3AVJA 2RN2A 1S0OA 4CFBA 2NRTA 4YXJA 3L2QA 4AHUA 4QZIA 4B3OA 9ICFA 5FRMA 4CEFA 3M8RA 2W9BA 3RJIA 3LP3A 3KLFA 4P4PA 2DFHA 2GUIA 4EP5A 4O4GA 4O3SA 9ICEA 2KZ3A 3ZD9A 1ZQOA 4KN4A 4IKFA 4XQ8A 4CJ3A 4F4ZA 4KB1A 2O4GA 8ICNA 1S0MA 3NHGA 2ASLA 4EZ9A 4TSXA 4I2GA 3ZDDA 4M9LA 2RPIA 4R5PA 3QZ7A 3V9SA 2RKIA 4J2BA 4FXDA 3HW8A 4QOZB 4O5KA 2A1SA 4CJQA 4F4XA 1TK0A 4IQVA 4HHTA 3S3OA 3I8DA 3HL8A 4JWNA 1SKRA 3OJUA 4O5BA 3DLEA 3ZSZA 4RNNA 4XA5A 2C22A 1ZBLA 2BQUA 4K4GA 3S3MA 3LDSA 4HUGA 5KT2A 4CJSA 1C1BA 3AVGA 4BDPA 1TAQA 4EZ6A 3HO1A 3ALYA 4UAYA 5DG7A 3HPHA 3MXMA 2G8FA 5DGAA 1FK9A 4FLYA 3AO4A 3AA3A 1O1WA 3AVMA 1T4GA 4NLZA 2HVHA 4DLGA 2HVIA 2IGIA 5IIIA 1EP4A 1ZQPA 4FJIA 4CJEA 5J2FA 3C1YA 2KTQA 8ICRA 4B9NA 4QWEA 4I2JA 3LPUA 1ZQRA 3V1QA 1S1UA 1Z00A 2R8KA 4I2AA 1S1TA 1TK5A 2G8VA 1S5JA 1ZQYA 1KRPA 3DLKA 4Z4EA 4YNQA 3E2EA 1COOA 4N5SA 4E1MA 4CEOA 3LP2A 3RAQA 5J0YA 2I9GA 3VQQA 4QZHA 3QIOA 3TAFA 8ICMA 1XS9D 3KK1A 4I7FA 2DY4A 4ICLA 5HLFA 3QEBZ 4B9TA 2YKMA 3P83D 2LYHA 4UAZA 3VQEA 1CUKA 3KLEA 2JZBB 9ICQA 4KLJA 3VN5A 5J2IA 4Z6CA 1XWLA 4HCCA 4B8CA 3AVFA 1Y97A 3ZSXA 3SI8A 4DU4A 4PGXA 8ICKA 3AU2A 4UQGA 2G8KA 2Y1IA 9ICKA 3LK9A 3LWMA 8ICAA 4O55A 2DFFA 2EHGA 4CF8A 9ICVA 4CJPA 4M41A 1KFTA 3MAQA 4F5QA 1RILA 2P6UA 1ZQTA 1BL3A 3VQAA 3ISDA 3RJKA 7ICPA 4CJRA 4ID5A 4FJMA 2HHTA 4Q44A 1TKZA 4Q45A 2G8IA 5KFCA 1IH7A 1ZQXA 3AO3A 3NDKA 4CEEA 1MSWD 4DQRA 4CJ4A 5J0TA 3P1GA 1HNVA 2EX3A 3V9WA 4BDYA 3KD5E 3H7IA 2VG6A 4GXJA 1G15A 4AHVA 3HVTA 3OYKA 1Y88A 5KG2A 1JXLA 3DLHA 3SPYA 3V7JA 4FLUA 9ICBA 3LAKA 4WE1A 4N76A 3RJEA 4ID1A 5C25A 1B9DA 4R66A 1H38A 4JV0A 4TUPA 1L3VA 1ZQAA 1VRTA 4ECZA 4RU9A 2V4QA 1WSJA 4NLKA 4P2HA 3K2PA 5J0UA 2ZTCA 4I2BA 5KT4A 4DL2A 1XC9A 2OA8A 4ECUA 2XY7A 4E7LA 1RTJA 2OPQA 2FC0A 1ZQZA 4DSKA 4M3XA 4FBUA 3HM9A 3K75D 1KEJA 3PX4A 4KREA 5HMMA 5JUMA 3PNCA 4HYKA 1UT5A 3H8JA 2D5RA 3Q8LA 1RTDA 4PHPA 1YT3A 1ZJNA 5DB6A 1ASUA 3H4DA 1KVBA 4J2AA 4GC6A 4K8ZA 3HP6A 5KGXA 3AVNA 1RBUA 4BGDA 4DL4A 4M3UA 3QLHA 4CGHA 3DRSA 4H4OA 5EU7A 1MU2A 1UA0A 2HHVA 4MEXA 1UWBA 1A5XA 2E4LA 5KI6A 5DDYA 3HPOA 3AO5A 3QO9A 3OGUA 4LZGA 4RQ6A 2RDJA 4M47A 3OYIA 3I0SA 4Z6EA 3MGIA 3ZDBA 7ICHA 1S77D 2VWJA 3ISCA 2JZBA 4DL6A 2VWKA 4EBCA 9ICHA 8ICYA 4ELUA 2XCPA 2OWOA 3RH4A 3KTQA 1TV9A 2WOMA 1TKDA 3MR3A 4RNMA 7ICVA 4DF8A 4NLGA 4CK3A 3SUNA 4RQ2A 3TFSA 5KFFA 4DL3A 4OGCA 4KLMA 3B6OA 1Z26A 3K5MA 4FS1A 4XIUA 3L2VA 1S1WA 4N56A 2G8WA 1CLQA 4KTQA 3H8SA 2ZUBA 3ZT3A 1XO1A 4W5RA 3GV5B 7ICOA 2F8TA 2W9AA 3V72A 1NJWA 1RT1A 2UVUA 3QE9Y 2ZUDA 5BOMA 2DFEA 3OS0A 1QSYA 2XCAA 4ECXA 3RBDA 4DTUA 2BHNA 3PUFA 1SL2A 1C0UA 3NGDA 2ETJA 5DB8A 4B9MA 3H08A 2WTFA 3KHLA 4FO6A 8ICVA 1QQCA 4CJ5A 4YCXA 3G10A 1GOAA 4M6WB 4QZ8A 5F9NA 1N6QA 3OYEA 4KI4A 5DDMA 4Q43A 4FZZA 5KG6A 4KLIA 1JKHA 1QHTA 3RR7A 4GC7A 2J6TA 4CEQA 5KT7A 1C1CA 2FLLA 1JLEA 2X78A 8ICPA 4RUAA 4OKKA 5KFGA 3C6UA 3ULDA 1CZ9A 3OYLA 3MXJA 3K58A 4AHRA 5J29A 3O4NA 5KFJA 3CFOA 5T7BA 4F2RA 5J2PA 4YMMA 1TKTA 2FLNA 4IQWA 3O3FA 1T03A 3C21A 2BCQA 4K4HA 2XC9A 3Q8QB 4CHOA 3BQ0A 4MFAA 1UT8A 4BWMA 4P4MA 4RQ4A 4CESA 1HUOA 9ICOA 4XUSA 4CGFA 4PA1A 3VQ8A 2C2RA 3GFKB 4J9MA 1DGSA 4YFUA 2FBXA 2R8IA 5DBCA 3M8PA 1WN7A 3TQ1A 5IIOA 3ZT2A 4UAWA 4I2CA 4QWBA 2AJQA 4GW6A 3MXIA 4F3OA 3T19A 1I3AA 4CHZA 4C8KA 5HP4A 5KFTA 3SQ2A 3PW0A 1JLQA 4FJ9A 2I5JA 3HK2A 1FKOA 5J0SA 1SL0A 1GOBA 1J5OA 5KG3A 1HYSA 3JPPA 2HNDA 3HPGA 4E89A 2MUTB 4DSIA 2YNHA 1RZTA 2WONA 1SL1A 2BCRA 1NK6A 3O3HA 2F1IA 1R0AA 4CIEA 4FJJA 1SKWA 5DKWA 5DBAA 1DTQA 9ICPA 4ELVA 2IDOA 2W9MA 1RDAA 4R63A 4DTRA 4RUCA 3PW5A 2FMQA 4RQ1A 5DK5A 1RXVA 3QESA 2E6MA 4CJWA 4TUQA 1RNHA 4QZ9A 4KKOA 3ZDCA 4M2YA 1NK5A 3JYTA 5HROA 8ICUA 2Z1GA 2HHQA 5HMLA 4ED8A 1BIUA 1T3NA 4J9OA 3V1RA 1C6VA 4YXMA 4IBNA 4CJFA 4KLSA 3UPQA 3ZCMA 4FZXC 3SJJA 1BPBA 2I1QA 7ICMA 4GVMA 5D3GA 4CJLA 2AQ4A 4KLQA 2A1RA 3Q8MA 3OYMA 4B9UA 2XY5A 5KFNA 1NOMA 1IO2A 2D0CA 4M6WA 4J9SA 1KDHA 1U45A 3V6DA 3OYCA 4YR3A 3C5GA 1ZQUA 4C8OA 4LVSA 4BDZA 5KG5A 5KFHA 5KRTA 3SUQA 1VSJA 4RQ8A 3K59A 2PI5A 4Q5VA 4M04A 1JL1A 1KFDA 2HNYA 1D9DA 4JS5A 3NH1A 4I2IA 2W42A 1RBRA 3PO5A 4QZBA 3RRHA 2GBZA 3VQ9A 4MF2A 1JMSA 1LB2B 4CF0A 4QW9A 3SQ0A 4JV1A 3A2FA 9ICIA 2ZUCA 9ICWA 1VSDA 4YMOA 4RQ0A 4IDKA 4MF8A 4Z6DA 1EXNA 7ICGA 4FW1A 1J9AA 4LY7A 4EBDA 2UVRA 2Q3SA 4O3QA 4KLGA 3PX6A 4FZYA 1XSPA 4FJNA 4FJLA 3K4GA 4TQRA 3V6JA 1TL3A 4FJHA 5L9XA 4K8XA 4FK4A 4RNOA 4CEZA 4ZTJA 1TFRA 4DMNA 3KLGA 2OYQA 4DTPA 1MC8A 2R8GA 4BXOA 3RJGA 4F3TA 1S1XA 2MUTA 1QLNA 4QZGA 3SV4A 4DL7A 3NBPA 1VSLA 4FJGA 3WNFA 4M9NA 4M3ZA 4JV2A 3MFHA 4I2PA 2BQ3A 5D46A 3TR8A 3SUOA 1X9SA 7ICJA 5KFUA 1B43A 1X9WA 2ZQBA 3V6KA 1ZQFA 3AVBA 2DTUA 4FK0A 2VA2A 2Z1JA 1XU4A 3OHBA 2XRIA 1S0NA 1K6YA 5KFRA 4MQ3A 2XY6A 3RR8A 4FM0A 5KTQA 3T5HA 2PXIA 1NK4A 4LH5A 4E7HA 1ZQKA 1I39A 3KHHA 4F4YA 4J2DA 4F2SA 4KHUA 4NCGA 1NK7A 1BCOA 4JRPA 4FJKA 4PQUA 2KZZA 4O5EA 1UA1A 2PFOA 4I2QA 4E0DA 3MECA 1BI4B 1D5AA 2F1JA 4ZH4A 5KFWA 4ED3A 4KTZA 5KFAA 3RH6A 5SWMA 3NCIA 3Q8KA 4P4OA 7ICIA 3OYHA 4KPYA 9ICJA 4CHQA 4I2EA 5DQIA 2XGPA 4DL5A 1WAFA 4IFYA 3TAEA 1BQMA 4CGDA 2BPFA 5KFMA 3IG1A 1U9LA 4G1QA 2V4RA 4CERA 5J0OA 2NUBA 4ECYA 3CM5A 4DEZA 4ELTA 4Y1CA 2BGGA 3EYZA 4AILC 4DOAA 4PH5A 3M9NB 2P5GA 3ISBA 2B4JA 3HSTB 4RT3A 2M9NA 4YMNA 1CXQA 4F8RA 2QXFA 2PY5A 3NH2A 4DSEA 8ICCA 3ASMA 4IRKA 5KG1A 1WCNA 2R8HA 1JLGA 7ICTA 4QWDA 2YNGA 4NCBA 3PW2A 4O44A 2IC3A 1RT3A 1MQ2A 1A5WA 4KLLA 1YTUA 1T7PA 1WLJA 1RBVA 4IFVA 8ICEA 4Z4HA 1F21A 1ZBFA 4ECTA 4F4WA 1V9PA 1KLMA 4RW8A 4OPJA 5C5JA 1A77A 4ECSA 5IINA 4DTNA 3MABA 3VQ6A 4HVJA 8ICGA 2QKKA 4RW4A 4YR0A 3JPSA 5JS1A 5KFBA 4IQTA 5CB1A 4DO9A 3DYAA 3L3VA 4EEYA 2MAXA 4IR1A 4DFKA 1RYRA 1TKXA 3JPQA 2KFZA 1L5UA 4NYFA 4TQSA 1RYSA 4KAZA 4YD2A 3TFRA 2FBVA 4ECRA 4F50A 2YKNA 1AROP 3MEDA 4QAGA 4OLBA 4NLNA 3EW9A 1VSHA 4RZRA 4BE0A 1SUQA 3ZT0A 1RBSA 2ATQA 2OPRA 3KJVA 2OZSA 9ICCA 4HUFA 1ITGA 4DG1A 4LH4A 3LANA 4IG0A 3L2UA 4KB0A 3EWAA 4PWDA 3C2KA 3VA0A 4KITB 3I0RA 4I2HA 2Z1IA 3IM1A 1JL2A 4QZFA 3DLGA 3IRXA 5HRRA 3GIJA 2QK9A 4FLWA 2G8UA 4OKJA 4KHNA 3DOLA 4PPXA 3PW4A 1ZQJA 4CK1A 1BHLA 4OPKA 4KHSA 2IMWP 7ICSA 2ZJAA 2G8HA 1X1PA 4CJTA 3ZSVA 2E6LA 3SYZA 1ZQBA 5CA7A 2ZD1A 4CEAA 5K14A 1RT5A 3VA3A 2ZJ8A 5KFLA 3QNOA 1XSLA 1BI4A 4FLXA 2X74A 5J0WA 2AGPA 4KLFA 4DU3A 2W9CB 5CHGA 3MDAA 4OGEA 3GV8B 1EX4A 2FMPA 2AU0A 4ED7A 3C1ZA 5KFDA 1XSNA 2DPJA 8ICOA 1RT4A 4CFDA 3RJFA 4E1NA 4B08A 1S10A 1DLOA 1EKEA 3MBYA 4Q8FA 4F5RA 3ZT4A 2RF2A 3G6YA 4KHWA 1B22A 4KO0A 3BDPA 3VQ4A 5I3UA 1Z3EB 2VA8A 8ICIA 2PZSA 3G6VA 4KLEA 1D9FA 4YD1A 2F8SA 4PHDA 2IA6A 4I2DA 1Q9XA 3MEEA 3AU6A 1JXBA 1RCHA 5EWEA 3ZSQA 3JPOA 4K4IA 4DSJA 3OYFA 3TAPA 2HHXA 2C2EA 3OS2A 5KFIA 1IM4A 1TGOA 1WAJA 4IRDA 3P5JA 3HJFA 2R8JA 1ZQEA 4IR9A 2BDPA 3B6PA 4UB4A 3D45A 2ITGA
chains in the Genus database with same CATH superfamily
3LVVA 5KT6A 2RHSB 4OQJA 2CGJA 3FC9A 1N63A 9ICRA 1IXRA 5L1KA 3O2IA 4ZTFA 2KVQE 2P9KB 1ZM2A 3AJ2A 3HX0A 2C2OB 2G9OA 4FYDA 1HQEB 2SXLA 3BYRA 1RXOB 2F1HA 4RWWA 4Z4GA 3IWNC 2W2MP 4K8RA 3Q22A 2D6FC 4F72A 2HKEA 1HBOA 1P8ZA 2HBQB 4M5IA 3F41A 3SEIA 5AKZA 4W5OA 2PMZC 2DBYA 2FDRA 2IS3A 1ZPVA 1NBWA 5CD4H 2ZIUB 3MC1A 2RHFA 2HFOA 4N8OA 4DR1J 5LMNK 2P1JA 2BPGA 1HNWJ 3SSRA 2KW4A 5HO4A 4FSVA 4O9MA 4AT1B 5G5GA 1SJQA 2BTFA 4QR0A 5B08A 4IDKB 5AXNA 2G08A 2LXIA 3EVWA 2HHUA 4KGKA 5H9EJ 1Q86T 2IVPA 4QS8A 4BC4A 4Z7YA 3HDSA 4OX9K 1BWEA 3TABA 1WJ9A 4X62K 3VAGA 1PJ6A 3KFUF 2L48A 2EC2A 3D1QA 2GAGC 1NBEB 4F71A 3OLBA 4DV4J 5F8HA 1VSFA 1EQMA 2QTWA 2KXFA 3A0IX 4CO2A 4MKBA 2Q0UA 4DFDA 3NGSA 5ALMA 3T9ZA 3TEHB 2FJ6A 4TU9A 1JLBA 4MKVA 4B1XB 4DR1F 4O3MA 1HNWF 2RE1A 1VQNS 1CQNA 3C15B 2ZIXA 1JRPA 2JC0A 4USAA 1S4EA 3CCMN 1DXSA 3GP9A 4X4UA 2ZUAA 4KFBB 4PJ0U 4ZCKA 1C1AA 1JJCB 4H8KA 3DXKA 4P10A 3I32A 5LSRA 4FJ5A 5BYQA 2HBRB 2AEFA 5L1MA 4LRDA 1BPXA 3H3OB 3W2VA 3KDOA 2W25A 2LEAA 4DV4F 2KT5A 6FD1A 3QU2A 1T9VA 4CFCA 3MR6A 2RS8A 1JLFA 2MGZB 4IXCA 3I4HX 1Q9YA 3H4BA 2QA1A 2WUSA 2KG1A 1G99A 3L7OA 2B4VA 3NY0A 4C8ZA 3CO9A 3C19A 4DUYJ 3D0PA 1G3OA 5FPEA 1WHVA 2A2DA 5E0OA 2A18A 3LGHA 3G0ZA 4MO5A 1PZNA 3MMBB 3CHWA 2V8DA 1V5VA 3TKAA 2YWWA 9ICGA 3LZJA 3L3UA 4YFKA 4DTXA 1HMVA 4LFBJ 3EX7B 2P51A 1YSJA 4NYZA 3NP5A 3H8WA 2R7RA 4CJKA 4HHHA 4U67Q 2NRWA 2E8AA 3OL9A 3J7YI 5AQQA 1RDUA 3JPRA 4JI0J 1VSIA 1YZ6A 4QPTA 4DUYF 3R5BA 1NEEA 2L08A 4CT9A 1I3OB 1RI7A 2BMBA 5KFKA 1JLAB 1UCVA 2B4UA 4NLQA 2VFRA 5C24A 4MK8A 4EO8A 4F5NA 2QA2A 3IDHA 1MWZA 4RW7B 5E33A 3R97A 3TADC 3UE2A 1X4HA 1DAXA 3W9IA 1JWWA 2A1JA 4LFBF 4NCAA 1Q8IA 2LEPA 4CECA 1Z2ZA 2LVWA 2LXFA 2KG0A 1Y5IB 5I42A 4RPZA 2VIHA 2VB6A 5KQ8A 1HWLA 2K3IA 1BPYA 3IC1A 5B0BA 2JDJA 2ZJPL 1RT7A 2EFOA 4JI0F 4NE9C 1QSLA 4Y2MA 1RDCA 4KGMA 8ICWA 3MEDB 1U04A 4RPXA 3MGJA 3MWTA 4H0PA 1LWCA 5IT4A 4HTLA 5H9FJ 2FPKA 1YVUA 1Q79A 4C8LA 1OVYA 3HI0A 1NB7A 3K5OA 3FZMA 1N32J 4RCHA 4CIFA 2EAPA 2XMTA 4PPZA 5CZXA 3TA1A 3MPWA 5JU5A 3SD7A 3ID8A 1FDBA 4AQYJ 4Q0BA 3PM9A 4JS4A 3RAXA 3KYLA 3QZ8A 3SBMA 5IV4A 1N48A 4CZHA 3KLHA 2P9EA 1FRMA 3UMBA 2FZKB 1Q4RA 3IS9B 4HT7A 5D8HB 1B0PA 4Q2MA 4NASA 4ER8A 3GMGA 4HT5A 2FMSA 3TTCA 4M8LA 2CXYA 3NGIA 3J7Z5 2DPIA 4PZVA 1P8GA 1G1XA 1VLOA 4DKWA 1VSKA 1NOYA 3F2BA 1PC4A 1N32F 1C20A 2WW4A 5C42A 2LKYA 4BR4A 4U8YA 5CYMB 4AQYF 1R27B 2JEFA 1NGHA 3E01A 3B6BA 1LOTB 3PKYA 4K41A 2IRUA 5HVGA 1Q95G 4P0QA 1WSHA 3G82A 3UN3A 1F60B 2RF2B 1AZSA 3TAMA 3LPYA 3TUJC 3EDQB 3FM9A 3V4IB 2GAHC 3S3NA 3N7PD 3LVWA 8ICHA 3K5PA 3EZ5A 1UPMB 3A4TA 3LP1B 2VONA 1HR0J 2HDOA 2H5JB 4Y65A 4DR5J 3CMAS 5AE1A 1PAUB 4NRTA 1SQGA 3CI5A 2QARA 2VBYA 1LWXA 3NLCA 1C0FA 3KZXA 4H5VA 7ICRA 4QIFA 5BR8F 4FCYA 2P9PB 3VEOA 3OYJA 4IRCA 4TU8A 2AJ2A 3VQCA 2B7CB 3D2QA 2KN4A 1OPIA 5AQWA 1SZ2A 4CLPA 1LAWA 4AHSA 4KX3A 3HOTA 2FVQA 2ZH4A 1YTYA 2VANA 2MQOA 5F3ZA 3IAM9 1QUVA 2DIUA 1SJ1A 1NDLA 2WF8A 1V4TA 2ZXIA 3AVIA 4B1VA 3ICXA 3BQTA 2ZH5A 1IJEB 4G1PA 3H5XA 3VAIA 5IQQA 1IKYB 3R5DA 1HR0F 4DR5F 3L4IA 5EWGA 1XNQK 5IM0B 3DMJB 3S9HA 1U2RA 5KFVA 1X4GA 4HTIA 1ZOTA 4W5QA 4LF9K 1KFSA 3UQ2A 1IKWA 2E20A 1ZYQA 1VRUB 1FNMA 2H3ZA 3M9MB 3V81A 1EXQA 4C8MA 3BGFA 1OH6A 5JJBA 3IFEA 2V8GA 2J8SA 5C15A 2KHCA 4JI3J 2H3IA 1S6PA 9ICAA 4PKDB 4XH5A 1WNSA 3UDEA 3TWHA 2H48B 1DRZA 2NV3A 2YV0X 3LA0A 1GLEG 2WZ1A 1F5AA 3ZFVA 2GIRA 3NGUA 3KVGA 1NI3A 3GOIA 3N97B 4ILJA 1ZQHA 4LF7J 3T41A 5IIMA 5LSOA 3CD7A 9ICLA 4HDHA 2M0GB 2MU2A 5E3PA 2AGQA 3LL3A 3AA4A 2K3KA 2HHHK 3G71N 2HIQA 3OYAA 1EARA 3NCPA 3KMQA 4H4MB 3UN2A 3FFIA 2IAJB 4B9QA 3N7SC 2AGOA 2QYCA 1RAEB 2G13A 3W5XA 7ICUA 4KHQA 4IOBA 3QYYA 2GVDA 3KK2A 5J2DA 4C4RA 4M7YA 3HKZF 3D2WA 1JJ2M 3Q8SB 3OYNA 1LNQA 5L1LA 3MM6B 4GY2B 1N5YB 1U2VB 4CTAA 4B1UB 1ZQSA 1YI2N 1RWVB 2Z2ZA 4NLTA 2GGPB 4OFZA 5DB9A 2GA7A 4LF7F 3BB5A 2BE2B 2K60A 3DI6B 1RAOA 2QJ3A 3UDLA 4QZDA 1ZQDA 3N4QA 5CHIA 3KKAC 1OH8A 3HVRA 1HWJA 3D1OA 4EK2A 1WWUA 4O3OA 1J2MA 3ZZZA 3M5RA 5J2QA 5HQLA 4Y2TA 1S6QB 3MEGB 1G2EA 4KLOA 1L7NA 3E58A 3RB3A 2Z58B 1T05A 1GXTA 2XYHB 1C0MA 2A42A 3S01A 5MLCV 1BISA 1NWKA 5AT1B 1NGCA 4BROA 5B0AA 2YKOA 4ETZA 5HQ8A 3IM9A 2VD3A 3M05A 4LRCA 1I94K 2W03A 5IFMA 1ZBTA 5A0LA 2O8FA 5AIAA 2DF4B 1XNRK 3K7RA 2VG7A 4RW6A 2O4IA 5F1XA 1B4FA 2GWSA 2V5HG 1FXLA 4CLSA 2FY8A 3AAWB 1ATNA 4J9VA 4Z6FA 3E3XA 3U1MA 2FB0A 3L4PA 1JJHA 4N47A 3GQCA 2CGKA 4R8UA 4RKUC 1VQ9N 1DGKN 4YEAA 2QKBA 4GIBA 3WNEA 1HHSA 2VPYB 2X3DA 3KD1E 2KIWA 4M5DA 4K42A 5AXLA 5G4DA 1H0HB 1SC4B 2RNEA 5F9LA 2Q1LA 1LAVA 4OJ6A 1BPEA 5CR0A 4ZPCA 4ED4A 4Z0UA 3ZEUA 4M9HA 2E7XA 3DRPA 4C11A 3P6YC 3E0FA 5GAGI 3SJHA 4FYXB 2K2PA 3CJKB 1SQEA 3M2UA 2A41A 1YZ7A 2F8EX 1FW6A 1TUYA 5DM6L 3K57A 1T9WA 5KFSA 2IIHA 3RMCA 5IIKA 3MR5A 4UW9A 4U7CA 1GMWD 2ASYA 2IOCA 5GAEU 2HFUA 4O5FA 3NAEA 3D0IE 1KVJA 1NGDA 4ID8A 3ENQA 1PK1A 3L2WA 4PHTX 1XMQJ 3LO3A 3DOMA 2IRXA 4HTUA 4FJ8A 2ZIWA 5C2GA 4FN5A 2G5IB 3KK3B 1H1VA 2BPCA 4ZVHA 3M8SA 4R5PB 1IG6A 2EK1A 2Z1HA 2VPXB 1UFLA 2OTJN 2YHYA 3PY8A 4CZIA 2I1RA 2V8VA 3FZHA 2HB5A 4E7KA 1T3VA 4J2EA 1OW5A 1CJVB 1NHKL 2AX1A 5D4BA 4BR7A 1T95A 3AV9A 4H0XB 2HLUA 1URNA 2ODGA 2B3TB 3CJ3A 1IG8A 1KAXA 5ALJA 2Y8YA 4YORA 2KHDA 3VAMA 4LFCK 2NSCA 2W4CA 3ZZPA 4ED2A 3K8WA 4LRAA 1VQ7S 8ICBA 1EHWA 3O9TA 1JX4A 2Y9TA 3H5YA 2MLXA 2EI5A 2VJVA 2KJVA 3PNIA 2C2ZB 1XMQF 2LMIA 2E2PA 4GLXA 3W3DA 4UB1A 2Y0SF 3MURP 1GXLA 4IJAA 3R1HA 8ICJA 3JSYA 2X51A 1EP4B 1WWVA 4R64A 2A0FB 3CD6S 1R43A 1NGAA 5TKYA 1H2VZ 4K4SA 1FXRA 2PIIA 3CWJA 3I31A 1VI7A 1VQYA 4Y2CA 2VL1A 1S1UB 1Z00B 3HKZC 2X1BA 4PABA 3DDIA 3AA2A 2J4RA 5EUHA 2B5JA 1PJ7A 3CCSN 3KNGA 2O8BB 2OP5A 2LLZA 4F3MA 4B9LA 4GKJJ 4MLHA 1PVPA 3CJ5A 4W5NA 1HI0P 3KK1B 4I7FB 3AODA 2R7WA 5HLFB 5L9NA 3OFFA 3CVKA 2YKMB 3IRUA 4O3PA 4Y2VA 3HYFA 3D6MB 1YGYA 1ZA2B 5AI0A 2WB1D 1XERA 3BJYA 2G06A 1KQKA 3LALA 1X4BA 1TL7A 3DRRA 4DHYA 5A8WB 2CQBA 3POTA 5A0YA 2W01A 2IRYA 2X1GA 1EKRA 4CNZA 2OD4A 1J2VA 2QWQA 3RG6A 4F36A 1Q8LA 4KYZA 2Y1JA 3N4MB 3G6EN 3RJJA 4DUTA 5L1JA 3QMQA 2GZOA 2LBOA 3OXFA 3QNMA 3HF5A 5GMKa 2NRTA 4YXJA 4WFAL 4QZIA 1R31A 2B9EA 2W4DA 2VCPA 1TKZB 5FRMA 2ZH3A 1Z1ZA 2D74B 3SCIE 4RR5A 3UMGA 2DFHA 1TU0B 4Q7AA 3ONQA 4O4GA 2WB1C 4BG9A 1HNVB 1B64A 4DI6A 4CLZA 4EZ9A 2VG6B 3ET6A 3FKBA 4BLGA 2BH1A 3ZDDA 3HMJG 1NM1A 2D1KA 3UD3P 3CERA 4CZJA 3A5MC 4ETXA 1FRHA 2RKIA 5J1PA 2QA4G 4FXDA 3HW8A 1HBUA 2XWXA 4P2MA 1TYQA 3N4PA 4MMOA 4QU7A 2M5YA 4PL2A 2NXEA 3VGTA 5C25B 3CCVS 3DLEA 3UDCA 4RNNA 3QRRA 2PSZA 1UZHA 3ADAC 5M1PA 1JUDA 1R7IA 4RO0A 5D78A 5CRXA 1Q16B 3HTVA 2ROGA 1ZBLA 2MKKA 2BQUA 3GZFA 3S3MA 4USKA 1MMLA 2W7AA 5IXUA 4LVNP 3AA9A 1QQ5A 1TFYA 2CNKB 3HO1A 3ALYA 3HPHA 3I82A 4WTOB 1FK9A 4FLYA 5EX3A 2E7WA 2YWKA 1T4GA 4NLZA 2B9WA 4DLGA 2Y0SD 3H5SA 2IGIA 1ZQPA 1WDTA 4CJEA 1T02A 8ICRA 4B9NA 2IVFB 3UD5A 2XTJP 3Q83A 1E6VA 4WPAA 1S1TA 1TK5A 2G8VA 5AFUH 4NXNK 3DM2B 3M6WA 1JJ2R 1COOA 1YIJS 1AUSL 3DU5A 3VQQA 1VC5A 3QIOA 3TAFA 8ICMA 2DISA 1HBMB 4ICLA 5F3TA 3QEBZ 4B9TA 3M6UA 4L73A 3TX0A 4UAVA 2CUYA 4M5KA 2E1EA 2OEMA 4UAZA 2YB4A 9ICQA 2HURA 4OYBA 3VN5A 3VGUA 1YHQS 2O8CB 4M5GA 4Z6CA 4MKAA 3ZZOA 1WBBA 1SS6A 2W7OA 4B8CA 2ZGYA 2Z8QA 3ZSXA 5LMUJ 4DU4A 3MN9A 3HSZA 2OJ3A 8ICKA 2Y0SC 2A10A 2Y1IA 1DQ9A 3CPEA 2LI6A 3SSSA 8ICAA 1CC8A 3NS5A 2W43A 2RHKA 4C23A 2UXCK 1KFTA 2OLWA 1TUGB 1YG0A 3MAQA 4F5QA 1RHMB 1ZQTA 4Y00A 1BL3A 4DPYA 1YF5L 3RJKA 4NLYA 3RUBL 3UR0A 4FJMA 2RRAA 4DR6K 3EO3A 1IH7A 3GBTA 4WQ4C 4CJ4A 5AKGA 1SJRA 1QY7A 1Q3UA 1CVJA 4NZ0A 2VIXA 5EX0A 2JOQA 2QFJA 1BHNA 4JI8K 5IT0A 2EX3A 5LMUF 5E84A 2YX8A 2CJAA 4B3SJ 4JK9A 5AM3A 2E9RX 1G15A 4AHVA 3TYTA 3HVTA 1Y88A 4FE3A 3EMTA 1JXLA 4U67L 1VHIA 1SV0A 4RQMA 3ETOA 2HVDA 1BMQB 4WE1A 1SBRA 3UN5A 3QJPA 3CC7N 4JV0A 4UB8U 2VUGA 1ZQAA 3CDAA 3MAAB 1WG5A 3PCOB 4RBVA 2V4QA 2RQCA 3DEEA 4UF4A 4P2HA 5J0UA 1ULRA 4B3TK 4I2BA 2F4VK 2LM1A 2B43A 2OA8A 4ECUA 2OYYA 5C2FA 2OPQA 4IH6A 4LF8J 2WVCA 2FC0A 4DSKA 2XVTA 3P45B 1WC3A 3PX4A 5HMMA 4JI7K 3SEOA 4HYKA 3H8JA 1RTDA 2P9UA 3G4SS 3H4DA 1RWOB 4FNHA 5KGXA 4BGDA 4DL4A 4NZ6A 3IXQA 1J6ZA 2WHOA 3VALA 4AF1A 1MU2A 1A5XA 4FL9A 2H4WB 2E4LA 1QD1A 1CPZA 1J2NA 2HWIA 3THPA 3HPOA 1FKOB 1Q7YO 4C48A 2W1BA 5EE1A 2P9LB 1VQ8N 3I0SA 2JR5A 4Z6EA 4OYXA 4IOCL 1LFWA 3ZDBA 1WB9A 4B3MJ 1S77D 2VWJA 1IWAA 2WB4A 4DL6A 1R0AB 2VWKA 3Q7CA 3ALRA 1ILYA 2XCPA 4DCJB 2AT1B 3QATA 3KTQA 4RBUA 1FX2A 3IBCB 2DKXA 3MR3A 2V2QA 4DPTA 2MSTA 2C3YA 4CK3A 2QWPA 1ZXIA 3TJ8A 3SUNA 2ZM6J 2O3DA 5KFFA 3UM9A 1UFWA 5GADP 1Z26A 2UUCJ 1KAZA 5HROB 2CNNB 3H8SA 1S7HA 4UAUA 4DN0A 5T41A 3E66A 1XO1A 3IRWP 4DX7A 1X7VA 2UUBJ 4KH4A 1NJWA 1RT1A 3QE9Y 5BOMA 4B3MF 5F8MA 1TZ0A 3OS0A 1Q78A 3RBDA 3ZNJ1 1DKGD 4DTUA 2CQ3A 4B3RJ 3F5AA 1X6JA 1UVIA 4B9MA 2BX6A 1MDUB 4EFHA 5KAFU 1RHQB 1K73O 1FJGK 4CJ5A 1R89A 4A47A 3WC0A 1OYEA 2NUHA 2MQQA 3R9KA 4A8SA 1TAMA 5IWAJ 1RHRB 1SPBP 1NDPA 3ZZTA 4CO5A 1KP6A 4CWBA 4KI4A 2ZM6F 2WF5A 5DDMA 3D54A 2UUAK 1KKXA 1JKHA 2YX7A 3RR7A 2UUCF 3R6GB 4GC7A 4CEQA 1C1CA 1JLEA 1XEZA 3TTFA 2OXOA 5L39A 3VQTA 3HRGA 4OKKA 4BRGA 4DV3J 2E2OA 1NM2A 4G6VB 4A61A 2UUBF 4C98A 2LYAA 2WSEC 5T7BA 5J2PA 4YMMA 1T03A 3FEZA 3O3FA 4B3RF 4HL9A 1VQ4S 2EKYA 3C21A 5B8HA 3BQ0A 3AT1B 5E7OB 3VEWA 2MY8A 4P4MA 5IWAF 3U9DA 1SXDA 4MK9A 9ICOA 3PTWA 3G8SA 4CGFA 2XMWA 3VQ8A 1MROA 2LA6A 4BHQA 3GFKB 2V2ZA 4QPXA 1U1QA 2R8IA 1QVGR 5DBCA 3M8PA 3TQ1A 5IIOA 5HMYA 2P9NA 3QFHA 4NL5A 3MM9A 4UAWA 4EX6A 4K0KJ 4QWBA 5T14A 1QUPA 3QGPA 1PUZA 3MXIA 4F3OA 3T19A 4FKXA 3PW0A 2B4OA 8AT1B 3HK2A 3CXCM 2OELA 4FZNA 4O8KA 4NLXA 3HPGA 1SB6A 2MUTB 5D6GA 1F6TA 2WONA 4A5BA 2CPEA 2M3DA 3O3HA 2D7SA 2F1IA 3MMAA 3G2XA 4CIEA 2DY9A 2CZVC 3QYPA 3TNVA 1DTQA 4ELVA 3JQMA 2W9MA 4LBPA 4CZCA 2W41A 1YRUA 1CULA 5AQVA 4KHPK 3PW5A 2WFAA 2VQEJ 4RQ1A 4K0KF 1WF1A 3NVWA 2F44A 3BF1A 1NU4A 3MECB 1SCJB 4DR2J 4RTFD 2Z1GA 3R2DJ 4QIVA 2VZ9A 4ED8A 2EG2A 3V1RA 3L9ZA 4NYOA 1EKSA 4YXMA 2MZTA 3ATVA 4IBNA 2WF6A 3WIUA 4F0KA 3ZCMA 4FZXC 1KONA 2Y1RI 2PEHA 2CPFA 2I1QA 3S8SA 3MPUB 3Q8MA 1ZA1B 2K8CB 4OI2A 1GLFO 5FPMA 4YY3K 2LU1A 1GTHA 2P6TA 4CF5A 4B9UA 2EH9A 1N88A 1NOMA 3DDHA 2VQEF 2D0CA 3H1QA 2DEJA 5ETMA 2E1MC 4YR3A 1X4EA 3C5GA 3RVCA 1ZQUA 4C8OA 4OD0A 4LVSA 4BDZA 1NHUA 4RQ8A 4Q5VA 1NAQA 1K8KA 5BRHA 1LKYB 1JL1A 1KFDA 2WBRA 2MA1A 1D9DA 2KL8A 5GIPA 4JS5A 1OIAA 4A8YA 3HSDA 1OWXA 2HVEA 3H3NO 3ZTQA 5AKHA 2WVBA 3CD0A 2BJ8A 4MF2A 2F5GA 2G5HB 1LB2B 4IFVB 3WK7A 2DXEA 1KLMB 4JV1A 1U6FA 3BDEA 4FWNA 9ICWA 4BX9C 3M6VA 2E5IA 4MF8A 4FW1A 5DDPC 3X1LB 4WWSA 5A2QU 3MCOA 2UVRA 3EE8A 2Q3SA 4FVCA 4CF3A 1X5SA 4KLGA 1RGVA 2Q1NA 4NLDA 4BC3A 1IQZA 4H5RA 2J0WA 2ZBCA 1RU1A 3DAWA 3V6JA 2CPIA 3PFOA 4JYAJ 3L6QA 4RNOA 4ZTJA 7FDRA 1YJRA 4LFAK 3PACA 4DTPA 4OJ3A 1PYSB 3AN1A 3KJVB 2R8GA 1BUXA 2XMUA 4BXOA 2DJWA 2UV8A 3S1TA 2AX0A 3EM1A 3GU3A 4F3TA 1RAIB 1VSLA 2HK3A 3G87A 4FJGA 3WNFA 2M4MA 2YWHA 1VQNN 3MFHA 4U9RA 1Y10A 2HGMA 3TR8A 1U2CA 1OUQA 1S79A 5EXWA 4YB5A 5KFUA 1RABB 2XZDB 2ZQBA 1XIQA 5AM5A 1XU4A 2DR9A 5JLHA 1K6YA 4TY8B 3RR8A 2YH0A 5KTQA 4LT6A 5FPNA 2HOQA 3F9MA 5LMNF 1ZQKA 4X4QA 2QLTA 4F4YA 2D3OR 2CPYA 4GNIA 4DR7K 1BCOA 4JYAF 3CO0P 5K14B 5AQLA 4O5EA 4I2QA 3QLHB 3C7NA 3SQIA 1BI4B 1KC8O 3DRYA 4ZH4A 3ENHA 3I33A 5KFAA 5SWMA 4BRKA 7ICIA 1ZOLA 3OYHA 2W6KA 9ICJA 1VGYA 3LOUA 1YJWS 1DARA 2DGSA 4DL5A 3OR2B 4IFYA 1RT4B 3FBBA 4L3KA 1QZ6A 1KDNA 5KFMA 3OV7A 3IG1A 4XDDA 4CERA 5J0OA 2NUBA 1XC3A 5BYSA 3CM5A 4MDBA 2BGGA 3DV9A 2BJ7A 5B7WA 4DOAA 4QR2A 3N9UC 4B17A 2ALYB 4P71A 3HSTB 3BGLA 1BU6O 4YMNA 4FXWA 4F8RA 1U1KA 4Y2YA 2QXFA 4RNHA 2VU5A 2R42A 4DSEA 4X64J 4CYUA 1UL3A 5AM1A 2ZBQA 1U1PA 5CEHA 5AKLA 3ILOA 4NA3A 4IRKA 5KG1A 4DV2K 2YNGA 3P96A 3PW2A 1RP5A 2QI2A 3RW6A 1L7MA 1RT3A 1B0TA 4KLLA 5AQKA 3TVKA 3J81O 1VYAA 4M95A 3N7RC 4PG4A 4I6AA 4RW8A 2KI2A 3MOZA 4NZ7A 1SVDA 5IINA 2ZHBA 2PDAA 3MABA 3VQ6A 2QKKA 4IO8A 1V5IB 3TEGA 1AT1B 2GC8A 4IQTA 3J7AN 5AQHA 3DYAA 3MCAB 4IR1A 4Q2LA 2XNQA 2OHDA 1TKXA 4X64F 2B8PA 1N33K 1HNXK 3F44A 2FBVA 3TFRA 3E8OA 1A7GE 1FNOA 3NAHA 4FF1A 4EGLA 2YKNA 2WFBA 3MN6A 3MX2A 3R3LA 3WKDA 2PE8A 4AM7A 2PEBA 4NLNA 1TMMA 2AD9A 1VSHA 3OA9A 2D41A 4BE0A 1SUQA 3C6UB 2OPRA 2YWEA 1SJ3P 2D4WA 9ICCA 4DG1A 5DDQC 2N4CA 1H3DA 1Q8KA 2AZ3A 3IGVA 4PWDA 3C2KA 3VA0A 3W8PA 2ZJQQ 5CQGA 3SR6A 3IM1A 3GIJA 1WC0A 1R59O 1EB0A 3DOLA 1F3FA 4OYWA 2GO8A 1WKKA 4E8UA 4UASA 1IUJA 3HFVA 1WKLA 4OPKA 2J0QD 3A3NB 4KHSA 2XSJA 7ICSA 2C1EB 2ZJAA 2G8HA 4CJTA 3TADA 3VR1A 2V51B 3CETA 3CJ4A 2A2CA 4CEAA 2QGFB 5GIOA 2RB7A 1F5BA 2WAQF 2DGVA 3A3PB 2I5HA 3CJ8A 4Y2AA 2X74A 2OAUA 3D6FB 5J0WA 2W9CB 5AZIA 1SJFA 3DC2A 2A3ZA 2P9IB 4MFBB 3MDAA 1Q5VA 4DPUA 1RZMA 4H4KC 1J5OB 2IOFA 5KFDA 8ICOA 3P39A 2ZHAA 2H3GX 2R7XA 2LYVA 3D6RA 3TSPA 4C80A 4HAIA 1ZD4A 1YJUA 3ATUA 3C8YA 1DEJA 2KM8B 2NO4A 2CFXA 1WC1A 3CJ2A 3UNGC 1ZM9A 5GADU 3G6YA 2CH5A 5TISU 1R8AA 2E88A 5BPLA 3I9V9 2YXLA 1BQNB 2BW2A 4FOEA 4FWLA 2DL0A 4YD1A 2I8EA 1EWRA 2JHDA 1GNKA 2QYGA 3DXMB 1E4FT 2E7VA 3CMAN 3N79A 1ZPWX 3FSXA 2YQ0A 1FDAA 3HHNB 5AM2A 5EWEA 3FCWA 1N5SA 3EZOA 3C66A 2GNKA 3VEZA 1IBMJ 2HHXA 2RRNA 2U2FA 2C2EA 3A5LC 2X1AA 1WAJA 4ES1A 3SQGB 2HRTA 1FNXH 3W2WA 4QYRA 4IR9A 5AICA 3KUHA 1CEZA 4GO7X 3RWUA 1VK0A 1RT2A 3PIPL 4XK8C 2PMHA 2F8KA 1UJ4A 2HCFA 1J53A 2H3FA 2V8HA 3AD7C 4JI1K 4FBTA 5DMRA 3UKRA 3ULEA 4JI4J 2DHSA 3M32A 4OLAA 3OR1A 2J9DE 5G0RB 1S1VB 4GXIA 9RUBA 2O8DB 4NLUA 1VJ5A 4JI5K 1GLCG 1CJTA 8ICXA 2HW3A 3GSIA 1IBMF 2HNYB 2C2DA 4F0HA 2RIJA 4UY8O 1QE1A 4RJVA 4X4OA 1IBLJ 4L8RB 3GG0A 2VG5A 1UVJA 2YPZA 3RB0A 1KQQA 4TU7A 1VQKS 1HD1A 2KN7A 3C95A 3BSAA 2MZQA 3FGUA 3GIRA 4PWWA 1HHTP 3BN7A 4Z4IA 2PC6A 3OT9A 2LDIA 2LSNA 4JBCA 1M5VC 3Q8PB 4DL0C 4J9RA 1SXEA 1F5CA 2A1BA 5I3PA 3M3ZA 4FF2A 1KTQA 3T1YK 3HOSA 4WP8A 4JI4F 2A19A 5IC6B 4OKEA 3TPQA 1PAEX 2K4HA 4HH0A 4WU2A 5F8IA 1K0TA 2M2BA 2E2QA 2WAQD 1TVRA 4NI2B 1PO6A 5FDLA 4X65K 1WF0A 3KLGB 1NJXA 2MZRA 3GV7B 4J9NA 4E7JA 1BLUA 4C7YA 4ED0A 4USUA 3IV6A 3GFYA 4CLTA 1DTTB 5HHHA 3ZSYA 4F7VA 2EG1A 1UW4A 3OFEA 5J1EA 2D0PA 1DQ8A 2DR5A 3AO1A 2CPHA 4FWSA 2PFPA 2HQGA 4WP3A 4CGGA 1D8LA 3L7UA 3NKYA 3MGHA 3CCES 4LJMA 2VWBA 4WYBA 1KEKA 1UWAA 3BQ7A 1IBKJ 2JEGA 4O23A 1BXNA 4JP8A 2O66A 3NGZA 1J27A 5M2RA 1JCEA 5CHCB 3SXLA 2JSXA 1Q7YT 4XRHA 4CF9A 1FD2A 2HFZA 2KVCA 2X6SA 1CJUA 5LY3A 1ZQVA 3FSYA 2WAQC 4M9JA 2IM0A 4Y2UA 1HRHA 3UWTA 2W40A 2BANB 3RU0A 5ALTA 4BCAA 4KLTA 3V2UC 4YB7A 3FEYB 2NLXA 4OJRA 2ZTEA 3AQEA 2RE2A 4JD2B 3SNNA 2BKEA 3MMJA 1VK3A 3IMXA 4M94A 1HJOA 1N56A 4RWXA 4KI6A 4H0TB 1L3SA 1FT8A 5KFXA 3AA5X 4C1NK 3R27A 3O4QA 4DOCA 4DV7J 5HP1B 3O6QA 2ASDA 1WCLA 3ITHB 3SQOP 1S76D 5DGBA 4J9QA 1BCMA 1IBKF 4P2XA 1BY9A 3L5KA 4RW9B 3HILA 3DKDA 2P9KA 3IAYA 3RGIA 1ZQMA 3C46A 1FKPA 2NQPA 1HQEA 3CJ1A 2P5OA 2UXBJ 2CG4A 4M3WA 1S6OA 3OVNA 2EBEA 4CIGA 8ICSA 5ETOA 5D0RA 3AQPA 4LF4K 1GLDG 3NF7A 1K73T 4BRQA 3KKAA 1WC5A 2DBBA 5AXKA 3SAHA 2ZIUA 4K2XA 2P9SB 4DV7F 2O67A 2MZSA 3O1BA 4DV5J 3LW5C 1NMEB 4JKHA 1V9OA 2IOHA 4RL1A 1O08A 3C94A 2M8DB 1FCAA 4OZ1A 2PN6A 1F3VA 3H2LA 4DMZA 4JRQA 4I27A 1HWIA 3LAMA 3AOCA 5EGYA 1KTVA 3IBWA 3EPIA 2BM0A 3V7KA 2J7UA 4JLHA 3MX5A 2DR8A 2AJ1A 3ED5A 2UXBF 4JKGB 3WNGA 1NGGA 1QVFM 4KQZA 3CF5L 3QUTA 4JKFA 4DQPA 3C16B 5ETVA 2VOPA 1XNRF 4QOTA 1S9EB 3CCJS 4DFJA 1IG9A 1RSCA 2DNMA 1SV4A 3QBXA 4O5CA 3HHLB 4DV5F 1J97A 4ILLA 4B1WB 3C15A 5A2QY 1FE4A 4UB5A 2P66A 2R4FA 3N6NA 2ZE2B 4OIXA 3OBYA 2E8MA 4DS4A 2V7ZA 2F96A 4F5OA 3C3LA 5J0PA 4KX5A 3SIPB 2VJ4A 3S41A 4KFBA 4PXDA 2B21A 1WEXA 2HBZB 1ASVA 1TV6A 1T11A 2DNRA 2J7WA 5LXRA 5LJ3Y 2JVOA 4CP5A 2KRRA 2ASJA 3QU5A 4NMXA 3SMSA 4JWMA 1VQ7N 4CH0S 3LDAA 1X40A 3E9PA 1TP7A 5AK3A 2MGZA 5E2QA 1OY9A 4DWIA 1QDUB 2KJ9A 1CXUA 4MN4C 3K5NA 4DOBA 1V3RA 5TKWA 3RBZA 1REVB 3M1FA 1VIXA 3HXMA 3SCXA 1WEZA 3LTOA 3AMZA 2O6KA 3AY9A 2ATCB 1RAGB 3IHQB 7ICKA 3P3DA 3MMBA 5JVHQ 2W2PP 3W65A 4CZFA 1RDWX 3CD6N 3DXBA 1OYDA 1F9EB 2PYLA 2LFVA 2DNNA 4YHHJ 3ZLJA 3EE3A 3LQVA 3MDCA 3MK6A 4TNOA 1VBYA 3KWMA 3HFKA 1FEEA 4ZCLA 3ZX2A 3N28A 1XI1A 3PZPA 4OYOA 1C0TB 4I2FA 1HBNB 5AE2A 3BGOP 2E5JA 4J9KA 1H7WA 3KG4A 4NYPA 4DR3J 5KFQA 3PJ9A 4DN9A 4FM2A 1N0VC 1ZQCA 3LDNA 6FDRA 2AA4A 4EYIB 3FFKB 1W7AA 1M1KO 4WIIA 3O5TB 1JLAA 4X5VA 3FDSA 2FE9A 1FE0A 1UPHA 2H5XA 1FEHA 3QEWA 2DCUB 2CPZA 4RW7A 4YHHF 4KHRA 1K1QA 3H20A 2KJ5A 3O0FA 4RG8A 4ZITA 2ZXHA 3CDWA 2OEJA 3KLIA 3ZXWA 9ICTA 1VBKA 3C28A 3BF4A 5ALGA 3DU6A 3OSPA 5DG9A 3GL1A 4DTMA 2EFNA 1O0PA 3K2YA 2XZTB 2E1YA 2JV3A 2OD6A 3MM8B 3BQ2A 3C6TA 1DHMA 5TZVA 4DR3F 4Y2PA 3U3YA 4FW2A 2OPPB 4MIAA 2XHCA 1BVSA 4H0OA 1QHAA 2DNPA 3TUZC 1HBOB 2IDLA 4I69A 1X0PA 1K0VA 3C2LA 2KM8C 2ZH7A 3NF9A 2E9TA 1NK8A 3SQ4A 4LSNB 4GKKK 1FXDA 3ZSRA 1N34K 2RP5A 3SI6A 4LJXA 4IG3B 2EFPA 4R65A 3PHEA 1A5VA 2VDHA 4FM1A 3TQEA 2IVNA 1HNIB 3G25A 3F0NA 2GMJA 3RRGA 4AXIA 3BZCA 5AE3A 1ZBHA 4HHUA 3CB4A 1W9HA 3CCVN 1TK8A 4J9PA 1OMSA 1ZRNA 5K8NA 4A62A 3CJQA 5IIJA 1ZETA 2DVIA 1Q82O 2NRVA 3VZIA 3IS9A 4B6JA 3GFHA 1MG7A 3SAFA 3NNAA 3ZZRA 1JLCB 4OI3A 4CGZA 1QQ6A 4BWJA 3NS6A 2N3LA 3A8JA 2F40A 1ZBUA 3RH5A 1NSKL 3ZSWA 4PYAA 3KIOA 4GRSA 1IM6A 5DQGA 1YDLA 1YJNS 5B5EU 2E5LJ 2M8HA 1FXXA 5F2RA 2A6AA 2AYGA 1NNDA 5CYMA 1X9MA 3FGVA 3OYGA 2VJUA 3ENAA 5AZJB 3TJ9A 2ZIXB 1A6LA 3QERA 1GEHA 4BE1A 3GYXB 4KAIA 1JIHA 3CFRA 3VESA 2W7PA 3PHTA 3EY1A 2AP1A 3U6FA 3VF6A 3V4IA 1HKCA 1W26A 2Z2LA 1IKXB 3GCXP 4PUOB 1B0XA 2QG9B 4ENOA 1KC8T 1YIJN 2QL7B 3LP1A 2W4PA 4DSFA 2DGQA 4M45A 4KTWA 3SMVA 5LL6d 2RQMA 4YP3A 1EETB 2P9PA 2BGWA 3GILA 1BNPA 3M6GA 3HZEA 2JXJA 5DQHA 1YHQN 2KG5A 1E4GT 2BOAA 4CBWA 2K4EA 2ZF5O 3D2FB 4G3IA 2XLJA 3B0YA 3A8YA 3N6LA 5HJYA 3KHGA 3C2PA 1NLKL 1NNLA 4LF2A 4EBEA 2NRRA 3BO3A 1XR7A 3E1YA 3BSOA 3BPDA 1MN9A 4U96A 5L1IA 3BQ1A 1NSAA 4BREA 3Q8RB 2XICA 3D1HA 1X5OA 1HMVB 2QSWA 1IR1A 2ZH1A 2EDUA 3TZZA 1IKYA 1NGEA 1RBTA 2YHBA 5IM0A 9ICUA 4RPYA 3DMJA 1XR6A 3FC4A 2HOFA 4FYWB 4KIAA 4G9BA 2HG4A 1J5EJ 3M9OB 3D5MA 2FGOA 4A8EA 4IZ9A 1SV5A 3TUIC 4IDHA 2P2CB 3H2VE 4OHZA 5GAHI 1VRUA 5J2NA 3NS7B 3OYDA 4KLDA 3QRPA 3MM7B 3Q2SC 2IJNA 2OZMA 4J90A 4NM1A 3PYEA 3NGYA 4I6WA 5IQ6A 5E26A 2Z4PA 3C6AA 2BKOA 4KV8B 2GX9A 5IILA 2HQCA 4HLBA 4CZMA 4HHJA 1XMOK 2A1JB 4K2JA 1RUSA 4NLWA 1KHWA 5BXIA 4YG2A 3RMBA 5I42B 4B3OB 3DLBA 1M5HA 1FEZA 4TURA 3ISNC 2BXJA 1J5EF 4LIWA 4WK1A 1K9MO 3C5FA 4GMKA 4C9DA 4WF9Q 1RT7B 2K8GA 2FI1A 4BRIA 1E6YB 3Q23A 3C29A 3FCHA 2NPFA 2AJ4A 4OLOA 4H4MA 3KKRA 3NASA 5DLGA 2IAJA 5KFOA 4AH9A 2ASMA 3FZBA 4WQ4A 5DG8A 2YB1A 2ZH6A 2D0OA 5HRSA 5DRKA 3G4SN 4M5JA 3BUZB 2RSQA 2F4VJ 3RSEB 3MM6A 4JI8F 4ZVQB 3GWCA 2UXDK 4FVMA 2DEIA 4JB8B 1N5YA 1WSVA 1U2VA 3RTVA 5M2PA 1MWKA 1AXQA 2GGPA 4MIWA 2F2AB 5HR6A 2MXYA 3D28A 4PPDA 4DV0J 3B4DA 4WQ5C 5ITHA 5JVGQ 1HPMA 2ZJQL 3AY0A 3DI6A 5HQMA 3PRBA 3SLCA 3PRDA 2QN6B 3L3FX 2J6UA 3HHLD 2DCLA 5A8KB 1S6QA 3NMRA 2ZIVB 5EOZA 2QO3A 3VQDA 2H3VA 4F93B 3D6HB 3R1XA 3OVBA 1NGFA 3AD8C 3UQ0A 1U8SA 3H7HB 3GIIA 4B3TF 4TLQA 5ETTA 1W0HA 3AJ1A 5C42B 2F4VF 4P75A 4YN4A 4FJ7A 4NM2A 8ICFA 1DK3A 2FPLA 2V2KA 4H54A 1B92A 3NCRA 2ALZA 4JI2K 3IP0A 1B9FA 3DLKB 4DV0F 2GQQA 5ETPA 2V6AA 3KJNB 9ICSA 1WUUA 4OHVA 2ZITA 4JK1A 3TAMB 1VC0A 1HW8A 3MTJA 3R5AA 1U25A 1FHTA 4DDFA 4C1NI 2R7VA 2YJFA 5FRNA 3HHLC 1M5PC 1S97A 2H5EA 4PKHA 3ZT1A 1VQLS 4IOAL 3TVYA 4OPAA 2NO5A 3JQJA 2GO7A 3PRVA 3GJSB 5J8YC 3NVMA 2YQ3A 4M63C 3LGMA 5AQOA 2C28A 1LFPA 5K4LA 4QIEA 3ZX3A 4OV6A 3O4WA 1S0VA 2QKQA 1VAZA 4OJ1A 3H25A 3NTUA 5J2JA 1YJVA 5GTHU 5CD4A 1W2BR 2K7KA 5LT5A 5B0CA 4USIA 3AVJA 4LF6J 2RN2A 3QU9A 4JI6J 3J7YU 2IMOA 3M8RA 3NG8A 1P9QC 5EN1A 2KD1A 2V67A 4UY8T 2MZJA 1VQ4N 5IZHA 4O3SA 4D3HA 4KN4A 2VBZA 3SMZA 1FWLA 4F4ZA 3TA0A 4H5WA 4R79A 4KB1A 8ICNA 2A1AA 4I2GA 4ZLNA 2DYAA 3V81B 2HRUA 5U47A 1OKJA 2RPIA 3O9UA 4R5PA 3QZ7A 3QB0A 5D77A 4J2BA 2KO1A 4OV1A 1Q7LB 4CJQA 1KN5A 1TK0A 2E1AA 1S6PB 3S3OA 2XS7A 1O5JA 2KHOA 2EBGA 1CJVA 1FRXA 4J37A 3OJUA 4MDAA 2HS0A 3ZSZA 4JI6F 1HNZK 1SKUB 4IL6U 2C22A 2FC8A 2K8BB 2UUAF 3LUYA 2WW8A 1K8AO 1I5OB 5KT2A 1UQVA 1C1BA 4DR4J 1X4DA 2RHQB 3F56A 2LA4A 3NMAA 1TAQA 3QGHA 4QIGA 5ALOA 2EFVA 1UJ5A 4CVNE 3DHWC 1D0EA 3AA3A 3BH6B 3AVMA 4Z94A 5D0GA 1EP4A 5E5NA 5HAOA 5J2FA 3C1YA 5ADXH 4I2JA 3LPUA 1S1UA 1Z00A 2IOFK 4KBIA 3NWGA 3LPEA 2F77X 4CTAB 2O8BA 3A8KA 4YNQA 2V4JA 3EUB2 1EQ0A 2CJBA 1X60A 2I9GA 4QZHA 4QJVA 3D2EB 4NO7A 3KK1A 4I7FA 2DY4A 5GMDA 4KHPJ 4DR4F 3IR5B 5HLFA 2YKMA 4PG6A 5IC4B 3RF9A 3W7BA 1CUKA 2F3JA 2JZBB 2P9CA 2EW9A 2MYFA 3M7VA 4ZOHC 5J2IA 2UUTA 1Y0HA 1JCFA 3CIPA 3SI8A 4TN2A 5A8WA 2G8KA 9ICKA 3UD4P 1T0TV 1T05B 4LUBA 4O55A 1NG9A 5AQMA 2QXLA 2DFFA 2B51A 2E44A 1GFWB 2CWXA 3LM2A 2V9KA 9ICVA 4QZVB 4M41A 3NAIA 1X4FA 1S1WB 3ISDA 1V6HA 7ICPA 2GJFA 2KYXA 4ID5A 2HHTA 4KHPF 2MHEA 1TKZA 1URJA 4RW6B 2G8IA 5KFCA 2ZH8A 1ZQXA 4OL8A 4LR9A 2BYCA 3HHDA 1DT9A 4CJ7A 1HNWK 2ZBIA 4DQRA 4QIWD 4ZJLA 1C0UB 1SXLA 1HNVA 5ALVA 3V9WA 4C0BA 4BDYA 3KD5E 3ILIA 2KYZA 3MPYA 3C65A 4ZP6A 1IIPA 2VG6A 4KGXB 1Q46A 4GXJA 4RQNA 3MM5A 5H9EK 2MQLA 1VFJA 1N6QB 2DGWA 1P6TA 3SPYA 3KUGA 2JX2A 2QW9A 4FLUA 3CP8A 3B82A 4A2BA 3KBBA 3RJEA 1EJ7L 3THYA 1SC1B 3BV8A 5C25A 1B9DA 4DV4K 2UU9J 3GJRB 4Y34A 3VPZA 3H0RB 1MN7A 4XO0A 3T9NA 3DLLQ 4RU9A 5ADZA 4NLKA 1U6BA 1GMVA 4MLEA 3R7NB 1ZXOA 2ZTCA 1VR6A 1M1HA 1XC9A 4HI1A 3TZXA 3T1HJ 5ALPA 4QIWC 1RTJA 3CJ7A 4M3XA 1IXKA 4WFBQ 3HM9A 3K75D 5JUMA 2AXTU 1PK1B 3PNCA 3BO2A 4PHPA 1ZJNA 5DB6A 3QSIA 4GC6A 4K8ZA 1PILA 1FJEB 3HP6A 4XPCA 3TW0A 1U0HB 3GZ7A 4M3UA 2UU9F 2Z30B 3DRSA 2KDOA 1NGJA 1P9YA 1UA0A 2HHVA 4MEXA 3CUNA 3W3SA 2BACA 4DPOA 1JLQB 1JB0C 3K9JA 3VAHA 3WXMB 4CZEA 3OGUA 4LZGA 3AAQA 4DUYK 4CLUA 1HBMA 4CD3A 2RDJA 1QTNB 3OYIA 1VQPS 2YNHB 3T1HF 1YJWN 3I76A 4OZ3A 3MDQA 3WU2U 4EBCA 9ICHA 1WHXA 2O8CA 1RWPB 4ISEA 2KMDA 2OWOA 3RH4A 4LFBK 2R9LA 4M5HA 5F0XA 3P4UB 4CZKA 1Q1KA 4DF8A 4NLGA 2JC1A 2F9JA 5AR0A 3KKFA 1JJ4A 4CBXA 1PYTA 3CE8A 3L2VA 4JI0K 1U6ZA 2IPOB 2ZOMA 2G8WA 2B5JB 3AA8A 4JV5J 1Q18A 5ETQA 4DV6J 2RQ5A 3HKWA 4DHVA 2APOA 4A2AA 5JVHL 1YBTA 2W9AA 3V72A 4J5OA 4OJHA 2DFEA 1EX8A 1M1KT 2BHNA 3CJBA 2ETJA 4ZS6A 4FO6A 1KQFB 8ICVA 2MKHA 1QQCA 4YCXA 2UV8G 2AW0A 4ZJQA 4C3LA 4CDGA 4EAHD 4PEOA 1WORA 4QZ8A 3OYEA 1BD6A 2FHJA 3V6DB 2KNJA 1ZH5A 1A0OB 1RAAB 4JV5F 4PZNA 5KFGA 2AWZA 4DV6F 3VAKA 3W9JA 3OYLA 5H9FK 3MAAA 3ICLA 5K8MA 5KFJA 1HA1A 2QB0A 1N32K 2NNWA 2GH1A 5ALUA 2QWMA 1NH7A 2CJXB 2CGLA 2XC9A 2WRMA 4AQYK 4UOGA 3KHYA 4BQZA 4DV2F 4MFAA 4LC9B 2CADA 4CIOA 1UT8A 3ILLA 4BWMA 4Y2XA 4RQ4A 1HUOA 3BEXA 2MKCA 3AEVA 4PA1A 1UAWA 5GAGU 4J9MA 2FBXA 4KE5A 4H0YB 2BUPA 3AQFA 4OI1A 1F1BB 3CCWA 1QAXA 1Q82T 3TTDA 4GW6A 2HYIB 3CDBA 4A8MP 5HP4A 4FJ9A 2I5JA 1FKOA 5GAEP 1KOHA 2H5IB 2POKA 1YJTA 1GMUA 3N5BA 3L0QA 4URSA 2P9LA 1Z1BA 1S1XB 4LF5J 5AKKA 3NBPB 2AHOB 2I7NA 1RWWB 1R0AA 2F8LA 1WG8A 2ZEJA 2JZ5A 4JKCA 5DKWA 2FJBB 3OPXA 4BR0A 2KVIA 3HCXA 2O1PA 3KZBA 3NCQA 4IYQA 3GDQA 2FMQA 3PYFA 1RFQA 5AXMA 3PIOL 4DR5K 1HR0K 2E8NA 4NCGB 1RNHA 2R3VA 1ZM3A 1E6VB 3CIMA 4AUKA 3O9SA 1NK5A 2IIRA 5HROA 1FRJA 2HHQA 1VOMA 3PEJA 4K4XA 1PBAA 1T3NA 3HVAA 3FE1A 4LF5F 5K5MA 4ZCMA 3KG0A 4NWIA 5AQPA 3BSNA 4ICLB 2YJEA 5HMZA 4WFNQ 2W54A 2XI9A 5D3GA 3SMPA 2AQ4A 4KLQA 2ZG6A 4C0ZA 3NMUA 4QS9A 2IM2A 2OKQA 4H4KA 2XY5A 5KFNA 1IO2A 2N7CA 2PFUA 4V19S 2XMKA 4V19J 4IKAA 4BQLA 5KRTA 2W3SA 2GIFA 6AT1B 1KW4A 3K59A 2NR0A 1TUUA 1T9UA 4GVBB 2H4YB 4W4MA 5ALHA 4I2IA 2W42A 1RBRA 3UE5A 3DGPA 3RRHA 4M1KA 2JVRA 5HR7A 4JI1J 4UATA 2J9EA 1JMSA 1MMDA 3IR7B 1N2XA 3VTHA 4CF0A 1RYUA 4JI3K 3HSJA 1VQKN 2ZNZA 2KICA 3LYSA 5ETNA 2ZFHA 1VSDA 3FZKA 4YMOA 2FF3B 1EXNA 1V38A 1R6VA 2H51B 5AQIA 3EGZA 3PX6A 4LF7K 3AAPA 3A0HU 2A5XA 8ATCB 4NXMJ 4FJLA 3R8EA 3H98A 1FIQA 3F53A 1X5TA 3WQTA 2BKPA 2ILYA 4FJHA 5L9XA 1X4CA 1VK8A 1TFRA 2BRLA 3T1YJ 1K9MT 5T7LB 4JI1F 1MC8A 4XEIA 4A5AA 2OFGX 5B0DA 1PKUA 2MUTA 5HMWA 2DR7A 3VVTA 4IG0B 2YMLA 4QZGA 3M6XA 1SQFA 2YHXA 3IGNA 1Y9OA 2CPDA 4M9NA 4V1Ak 3DLGB 4HTJA 2HF3A 2OPQB 3SUOA 1X9SA 7ICJA 3EE9A 1ZQFA 1VBZA 2VA2A 2XRIA 3CCEN 4F0MA 4NXMF 1NK4A 2DKOB 1Y64A 4LH5A 2P9UB 3QT7A 1I39A 4WF9L 3KHHA 3IUCA 4J2DA 4WYWA 3SAGA 3BKFA 2BBEA 1RT5B 1UA1A 2MLYA 2AYEA 3MECA 3T1YF 1D5AA 2PA8D 3G9CA 4KTZA 1MU2B 3D7EO 5BR8J 1FVQA 3GYGA 4CHQA 4A57A 3PLAA 1KQSR 1WAFA 2UUWA 2WF9A 3O9QA 3I0SB 3ZX0A 3IBFB 4CGDA 3CSKA 2YQEA 2CJYB 1PJ5A 2E1PA 4ECYA 5DO2A 4DEZA 2VJ5A 4ELTA 3I55S 5JVGL 1XMBA 3MMVA 2CJQA 2CZ9A 2MQPA 4PH5A 3QWUA 3WEEA 2M9NA 5E79U 3QRQA 5I3UB 3VVUA 1CXQA 1F44A 2IVOA 3WBZA 2PY5A 3NH2A 2XM3A 3R7BB 1SIJA 4I64A 2GHVC 5AQRA 1LKYA 1LK7A 1S59A 2R8HA 4EELA 3SBGA 4QWDA 4O44A 4CDIA 4RU2A 1M5SA 1NZ8A 1MQ2A 2OEHA 2E5HA 1A5WA 4BRHA 1T7PA 3EXYA 3FQKA 2XO6A 3VGMA 4IFVA 1SQKA 4ZCIA 1KLMA 1V9PA 3D2NA 3ZETB 2KHQA 1H73A 1A77A 2KT3A 8ICGA 4YR0A 2F1FA 2CAJA 3OTCA 2FVCA 4DO9A 1H74A 4OZJA 3TWZA 3L3VA 3H59A 2DHHA 2OMOA 2KFZA 4CLLA 1FX4A 4NYFA 5CABA 4EUVA 1VLYA 1S99A 1RYSA 4Y2KA 2D69A 5I3QA 2JNJA 4ATNA 4ES2A 3IM8A 3H1VX 3NVVA 2R7QA 2RU3A 4QAGA 4OLBA 3EW9A 4RZRA 5AI8A 2GO9A 4F26A 1AYEA 1XMQK 3KJVA 4X66J 5ETRA 4OX7A 5EE3A 2CNLB 1HQUB 3CCJN 4PG8A 2PT0A 3IA0A 5SUHA 3EWAA 2G1HA 1JL2A 4QZFA 2AIRB 4R0JA 2QK9A 4FLWA 4OKJA 4KHNA 4FPBA 3M6KA 3UI3A 2HZCA 2G2ZA 4TY9A 4ZN3A 5AIBA 2M0NA 1WHWA 4LF4F 4NLCA 1ZAWA 4TY8A 1GX6A 2J9CA 4KSEB 2Q66A 1X1PA 2WHEA 1S7IA 2MB0B 5CA7A 3R3TA 2P9NB 5K14A 5GADI 3VA3A 5KFLA 5FJ4A 4FLXA 1BI4A 3UB5A 1K8AT 4X66F 4DU3A 4QQBA 5CHGA 3JS9A 3D68A 3GV8B 1EX4A 1Z19A 2L9WA 2YWFA 2AU0A 2CQDA 5GINA 3OR2A 3TSUA 1RT4A 5C2CA 4CFDA 4BUGA 4MJKA 1X42A 4WU3A 2PKEA 1LXJA 4XH4A 1RWXB 2K06A 3TVZA 4ACOA 2HNZB 1FFWB 4I56A 4GKJK 4TXSA 1RAFB 4CZGA 5AI6A 1X66A 1OO0B 2XYGB 4AYBF 4KO0A 3BDPA 2I38A 4Z2XA 1RJJA 4MK7A 4EX7A 5AQNA 4C2MA 1QZ5A 1RAHB 5LM7E 3OHRA 2IA6A 4I2DA 2DNKA 1X31C 1CS4A 4MIBA 1PVRA 2YNFB 4EFAC 5J2MB 2HSTA 4DSJA 2YMMA 3OS2A 1IM4A 3P5JA 3EUNA 1D09B 3HJFA 3HI9A 2CJKA 2YI1A 3MUMP 3B6PA 1RLCL 3FMWA 3D45A 3SENA 4BC5A 3P5TL 3VTIA 3L2RA 4DTOA 5CP2A 3LDQA 3J81j 4KT0C 2XZWA 4ZHRB 2KFNA 3C2MA 4QWCA 3EKSA 3NVKA 1NJIO 2YMPA 5AM0A 1RCOB 5KAKA 4ZJOA 4C8NA 2EFQA 2XBPA 5EHHA 2OPSA 1RKJA 2WBNA 1IWGA 5DLFA 3TANA 3LPTA 1UEUA 4KN7A 1HYZA 3GIMA 3H8MA 2QWLA 2E1ZA 1UTAA 3QDKA 3G8TA 5D15A 4QZEA 3GE9A 2YNIA 1EAYC 2ZBRA 3M2RB 3RJHA 1DRGA 2FBTA 2HHWA 3DXSX 2ZC3A 3GFZA 1L7PA 2XHBA 1ZAVA 5EVZA 2CDRB 4E1JA 1XHXA 1GTEA 1WF2A 5M1FA 1U1OA 2KVSA 2Z2YB 4YB1P 2GWKA 3FZLA 3VC8A 2NRXA 1Z4NA 5C10A 1LWFB 1SAZA 2KEYA 4PAAA 4I9LA 3MEKA 2IDEA 3SDEA 3UW1A 3QWPA 1S3XA 5BRFA 4LF1A 1IVZA 3DGVA 3DOKB 3ZDAA 4WCEQ 3TRGA 1NDKA 4UB3A 1R6YA 1Z25A 2IBOA 5A6PA 3UNYA 3QEIA 2B6AB 2ZZTA 1PVQA 2W9CA 1RK8A 5DJBA 3CC2S 1QAJA 1KNZA 4MFBA 1OY6A 1YJNN 1PSDA 1RT6B 1TTHB 5E3RA 4BXOB 1LKZA 3W5ZA 5B09A 1N36J 3VQ5A 1D9AA 2V34A 4OZLA 3HKZD 2ZDOA 4DFMA 1TL1B 3RB6A 3DLLL 4P6QA 3WIVA 3CCZA 4MT1A 3MMCB 4QCLA 2JEIA 3CRXA 1JK9B 1EQYA 5ALRA 2LQ8A 4FYVB 5HRNA 5M1NA 4DZ6A 3CCTA 4ZPTR 3PVXA 4W92B 3CQXA 1BQNA 3FBFA 3VERA 2IFXA 1RXWA 1N0UA 3LZIA 4P9SA 1GOCA 2XSFA 1RWMB 4BACA 2RVJA 8ICLA 3GJQB 1SWVA 2J9DA 4CH1A 1YRTA 1ZQQA 2XIDA 4PXBA 2H9ZA 3GG4A 2W2NP 3GSDA 1Y7PA 3TI0A 1N36F 4NLRA 5KRSA 1TE2A 4L75A 2HBJA 2NS1B 4WZQA 3MN7A 4JEPA 1L3TA 3VF2A 3AVLA 1O6XA 4DSLA 3TSQA 2LQ9A 2H3QA 2FTRA 2XY8A 4P52A 1B0VA 3UIQA 3V9ZA 1LCUA 4YOWA 2W2QP 1WELA 3AUOA 3OVAA 1L3KA 3JAMO 4H03B 1YJ7A 4KBOA 1ZQIA 3IG5A 4AYBC 3AARA 5B66U 4C3KA 3MD1A 1WG1A 1LWEB 2FVRA 5G0RA 1S1VA 4IUFA 3U3GA 3BS7A 1ZQLA 3OUYB 2KK0A 2HMIA 3QT6A 2DY1A 3Q89A 3LWLA 3SZ2A 2NXUA 1B7YB 2YNGB 5GTIU 4NLOA 4B3SK 3QSYB 4PGYA 4DQQA 2MHNA 1GLJO 3A3OB 2GS8A 3CM6A 2D0BA 1RQNA 2AJ0A 3A12A 4BRNA 1NGBA 4TUSA 3HFZB 3A5NC 1U49A 1B4SA 4A48A 2I6XA 4US8A 2Y1LB 1XBWA 5MAOA 1RWKB 3T1AA 5KGWA 5K8PA 3QU7A 1RGIA 3FZFA 1LW2B 1QSSA 3AH6A 4GXKA 1HPZB 5FROA 2IM3A 4ZVPB 3KG1A 4KH6A 4JKBA 1C2PA 4USHA 7ICEA 4I28A 5HNKA 2HQFA 1U1LA 1HUZA 1KVCA 2BJ9A 3TA2A 5CY4A 2OEKA 2JWKA 4CJVA 4FZMA 4LF8K 2YX6A 3AO2A 3KKSA 4FLZA 4YQWA 3RBEA 2Q43A 2I9SA 5ALIA 1ICEB 1HJRA 2XI2A 2DHXA 2C2MB 3VQBA 1DTTA 2PO4A 4ZVTB 4JK8A 4ED5A 3EVMA 1UVMA 4N77A 3FJ2A 2GMLA 3EDRB 4KLHA 2AF6A 5KT5A 1ZRMA 7ICFA 3DOLB 1KQGB 3NGTA 1WSFA 2UYTA 2HEKA 4OZ0A 1U2FA 3HSCA 1RG6A 2CYYA 1X6IA 3EKUA 3CIZA