4O0IA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
SKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Crystal structure of fragment DNA polymerase I from Bacillus stearothermophilus with 2'-MeSe-arabino-guanosine derivatized DNA
rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4o0iA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4o0iA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o0iA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o0iA01
1KCFA 1T8EA 4MQ3A 3M8RA 2X6SA 4DTMA 5HP4A 1L3VA 9ICQA 2XY7A 3LWLA 3OYFA 3ISBA 3AVNA 2AGOA 4E0DA 4YQWA 4DSLA 3ZSQA 1BI4B 3ZDAA 3B0YA 4EP4A 4KLSA 4RUCA 4NM2A 4DF8A 2BE2A 3DLHA 1ZQFA 4AHRA 1C7YA 4NCAA 3ZSRA 2ALZA 3TAFA 2Z1HA 5J29A 1JLAA 3AVAA 1XI1A 1B9DA 4CK2A 4FLTA 4C8OA 4DOAA 1RXVA 4KLLA 5HRRA 5KFMA 1YTAA 2UVVA 5DB9A 3RJEA 1IKXA 5KT7A 3DI6A 4KLFA 3D0PA 3SJJA 3ZSWA 4XRHA 5DLFA 4FS2A 4KLGA 7ICSA 1RDCA 2OPSA 4KMUA 1B9FA 2ZTEA 3VA0A 5I42A 2VANA 3VQ4A 8ICIA 5KI6A 4RU9A 4NCBA 3AO5A 2IOCA 4MF8A 3SCXA 4W5NA 4BXOB 4DTOA 2B4JA 3RAQA 1SZPA 4I29A 3SNNA 5DMRA 3DMJA 5KFUA 1L3SA 4CHZA 3IG1A 4ED8A 2ETJA 3SQ0A 3S3OA 3QEIA 1HNIA 3ORYA 3SQ4A 4FS1A 4LY7A 4FLUA 7ICJA 1Z3EB 1QHTA 1ZQLA 4UBBA 1VSEA 4CEFA 5KFOA 2W9AA 5HRSA 4YMMA 4KN4A 2HHUA 2XRIA 4MFAA 4QZGA 1D8LA 4DTRA 4H8KA 3V4IA 4W5QA 1NOMA 2DFEA 1BQNA 1EXQA 4Y1DA 1ZQKA 3BQTA 5JUMA 3ALYA 1ZJNA 3VQBA 3T3FA 4CCHA 1VSDA 2HNDA 4OKKA 9ICEA 4DTUA 3V1OA 3L8BA 7ICUA 1U4BA 3AA3A 4YXJA 2FC0A 3V9SA 1S0NA 7ICQA 1ZQWA 3T5KA 5T7BA 4F91B 3PVXA 5JS2A 3QERA 4IBNA 3LALA 1JXLA 4IRCA 3CFPA 2VA3A 3ZSVA 2F8TA 3S3NA 4O5BA 5L1IA 1ZQEA 7ICHA 2KQ2A 3KK2A 5DB8A 1S9GA 1QSYA 3NF6A 2XHBA 4M47A 4DU4A 1UT8A 4R65A 2UVUA 3AV9A 4ZH4A 1U04A 4O44A 4DLEA 3ZDDA 4DL4A 8ICOA 5J2AA 4G3IA 3TFRA 3RB3A 1ZQCA 4CJ4A 4J9QA 4EBCA 5KFIA 2W9CA 2NUBA 2BQUA 9ICLA 8ICCA 1CUKA 1EXNA 1SL0A 1L3TA 5C42A 4RNMA 2C22A 4IR1A 2HHTA 5TZVA 4DMNA 4YP3A 3OJSA 4FM0A 4I2FA 4R8UA 3PY8A 1RILA 3M8QA 2FBTA 1UT5A 5KT4A 4QZIA 4KLEA 2O4IA 3M9OB 5J0QA 5BPCA 4CEOA 4M41A 4OGEA 3HO1A 1DGSA 4B9LA 2JZBA 3KHRA 5J0UA 4AHUA 4ECTA 3NH1A 3I0RA 2D5RA 2XGQA 3Q8PB 1A5VA 4NLGA 9ICIA 2ZQBA 4CJ5A 1HYVA 1QE1A 4QZFA 5DB6A 2ASJA 3ZT1A 5DDMA 8ICJA 3ULDA 1KLNA 5KFHA 2P5OA 5DGAA 3V9UA 4M6WB 4KLOA 3JPTA 4J9OA 4TURA 5EWEA 2Q3SA 1A76A 4RPYA 4YR2A 3RRHA 3MGHA 1KTQA 4DS5A 4Y1CA 1S77D 3VQEA 4FCYA 1DOQA 4B9TA 2VG6A 1N48A 5D49A 4IG0A 3RB4A 2NRWA 4KLJA 4FK2A 5KFSA 5KTQA 4I27A 3LPUA 4Z0UA 3DM2A 3QEBZ 3DOLA 4KITB 4O5KA 4JLHA 4J2AA 4QCLA 4RNNA 1ZQMA 2F8SA 3Q8MA 1RBRA 1JXBA 4O55A 1WNSA 4E7JA 5KFWA 4DOCA 1SV5A 2UVRA 4TUSA 4IKFA 1YVUA 2DFLA 3HJFA 5KFCA 4KLHA 3GFKB 5J0PA 2F1HA 2ZJ5A 2RDIA 4ED0A 4CGIA 4CJSA 4UQGA 3B0XA 1XSLA 5KFFA 1JKHA 7ICRA 2ZTDA 4I28A 1D9FA 3KHGA 2G8IA 3EYZA 1L5UA 2PFQA 4UBCA 3GIKA 1VRUA 2ASDA 2PYLA 2BQRA 2BCQA 1WSFA 4FJ5A 5D46A 5DG9A 4YN4A 1GOCA 3OHBA 2VA8A 5DDYA 3V6KA 1QQCA 1Q9XA 1X2IA 3Q8RB 2KN7A 4DG1A 4OPJA 3KJVA 4FBUA 3G0ZA 5FDLA 1UWBA 8ICKA 2C2EA 3ISNC 1VSJA 1ZBUA 4CGFA 1TAUA 1SKRA 2Y1IA 4Z4GA 5KG2A 5EWFA 1VSFA 3IRXA 4KFBA 4PGXA 2P51A 2KFZA 3AVHA 3ZDBA 4JV0A 4E1NA 3Q8QB 1YTUA 3JPPA 1RT3A 4DTJA 3O4NA 5KG7A 4O5EA 1TL1A 3PW5A 4YMOA 4PH5A 4EYHB 1S1UA 4R63A 5HMLA 3EPGA 3DLEA 5CY4A 1RT6A 2YNIA 3AA4A 2HVHA 4DFJA 4EZ9A 4G1QA 3NF8A 4DL7A 1KVCA 3O3HA 5HP1A 5HMMA 4GXJA 2KZ3A 1S1TA 3M9MB 2R8IA 1SUQA 1BPBA 1RNHA 3ZSZA 1X9WA 4ELUA 5C5JA 3EPIA 3L2RA 1ZQSA 4CFDA 5J2FA 1KSPA 4ID5A 4DF4A 4J2DA 2D0AA 4NXZA 9ICOA 3Q8LA 4E19A 1ZQVA 1BVSA 3DRSA 1WCNA 3S9HA 3UPQA 4CHPA 2FPMA 1NK6A 1RT4A 3AVJA 1CXQA 2ASLA 1ZQJA 2G8FA 3ZSXA 2AQ0A 4JRQA 5J1EA 3U6FA 4P4OA 3LP2A 3T1AA 5J0XA 3MXMA 3JPOA 3NGZA 4KHNA 3DLGA 5J2NA 4F5OA 1C1CA 5CA7A 9ICKA 3ISDA 4KN7A 2W9CB 4RNOA 8ICNA 4IRKA 2QKBA 1HMVA 3PV8A 1NOYA 1KLMA 5DQIA 1TV9A 3SUPA 4QZCA 4CFBA 2E6MA 3KTQA 4R8UB 4DQRA 1LB2B 2VWJA 4KHYA 3VQ6A 1TFRA 2W8KA 3BDPA 4IQWA 4KI4A 1QLNA 1DTQA 3UQ0A 3GILA 4BDYA 3VQDA 4BDPA 5E41A 4QWAA 1A77A 3V72A 4M2YA 2JZBB 4IFYA 2C2RA 4QWDA 4CK1A 3V6DA 2YKMA 4ELVA 1HNVA 4F3TA 4CJUA 1S1WA 4BACA 3ZSYA 3E2EA 3I8DA 4YCXA 3OYGA 4M9HA 3JPRA 4YFUA 2FMSA 3ZDCA 3ASMA 1GOAA 2V9WA 3PUFA 4PGYA 3ZD8A 4N5SA 4K4IA 1XS9D 3OYKA 4KHUA 4PWDA 4XA5A 1HJPA 4DS4A 4CEQA 3VQ9A 4YR3A 4DFKA 2F96A 1GOBA 4DSKA 2OPRA 2FPLA 4FZZA 4FXDA 4B8AB 3RMBA 5J0YA 4FM2A 4QWCA 2AGQA 2E6LA 2G8WA 2YNHA 3L2VA 3UXOA 1QS4A 3H4BA 1C0TA 5KFJA 2BGWA 4CJVA 5J2QA 4CJWA 1ZBHA 1KFDA 1BGXT 1KVAA 4I2EA 5KRSA 3SQ2A 5KGXA 1TKDA 1IO2A 4DO9A 5L9XA 2UVWA 1RTJA 1J53A 3K2PA 4KTQA 4YVZA 4F2RA 3HYFA 2KW4A 3NBPA 1V9PA 4CHYA 3JYTA 5F9NA 4FYDA 1XC9A 1I3AA 3K5MA 4FLVA 5KT2A 1RT1A 1ASUA 2P6RA 1RT5A 3QLHA 3C95A 3OY9A 4KPYA 2PY5A 1IKWA 1ZBIA 5DG7A 4R5PA 3PW2A 3IS9A 3SPZA 4KHQA 1ZQAA 3Q8SB 5C25A 4KAZA 5J2BA 2HHVA 5FRMA 2RDJA 3QE9Y 2WTFA 1FKOA 4L8RB 2QK9A 3RAXA 4CJEA 5DQGA 2YV0X 4CHQA 9ICAA 3HXMA 1S10A 8ICXA 2A1SA 3TAEA 3K4GA 5CWRA 2PFPA 1JIHA 4ZHRA 2KZZA 2BR0A 1NKEA 4KLDA 5KG5A 1LWFA 3AVMA 3TANA 4KLIA 1Z26A 3V7KA 1ZQUA 4WE1A 4J9KA 1RT7A 3GV5B 3OYDA 7ICMA 4QZEA 4Q8FA 5IIIA 3HPOA 2HVIA 3RR7A 3V7JA 1KFSA 4F93B 2J6SA 1RTHA 4I2JA 1JLCA 4IQTA 1FK9A 1NK5A 1F21A 3VQ5A 3K75D 1ZQOA 5J2CA 4FJ9A 4OKJA 4CEAA 4EBDA 4QOZB 5IIJA 2IA6A 1QSSA 4Q0BA 3NGDA 4B9UA 4HUEA 4KB0A 3MXJA 4K4GA 4IQUA 3VQQA 4QZDA 5KFNA 3HVTA 3RJKA 5KT3A 1QSLA 4M0AA 4KREA 1EP4A 1XO1A 1TK0A 1HRHA 3RJGA 4HHTA 4AHSA 3T19A 4F50A 2VWKA 5HHIA 2RPIA 3OHAA 2BPGA 2FMQA 3WNEA 3WNFA 3VQCA 3C5FA 3M8PA 3PO5A 8ICEA 1B92A 4NM1A 1CEZA 2XO7A 2G8KA 2O4GA 1H38A 1BPXA 3LP3A 2LSNA 3QEWA 4GW6A 4RQ1A 3SV3A 2KZMA 4IDKA 2KTQA 2HNZA 3LK9A 1COOA 1MSWD 1TKZA 3NTUA 3ITHA 3MEDA 4FO6A 1NJZA 3MDCA 5J2EA 3AA2A 4ECRA 4Z4HA 4RT3A 3RH5A 3CYMA 4FJJA 1C0UA 3VQAA 3OVNA 1MC8A 1SKSA 3RMAA 1BISA 1D9DA 3V9XA 2YNGA 3WNHA 2OPQA 5HLFA 2A1JA 3OS2A 3NAEA 4RQ2A 3AVFA 3DRRA 3RJHA 4KO0A 3NFAA 4MFCA 1DTTA 4OLBA 4CFCA 3O3FA 3QZ8A 2YNFA 4O3PA 2IDOA 4XUSA 4KKOA 3OSNA 5KGWA 3OYHA 5J2IA 1NK8A 3G6XA 2J6TA 4CF2A 4O0JA 5CJ7A 4J2BA 3BQ2A 1UA0A 3MR2A 1TL3A 3QEAZ 2ZUDA 3LZIA 1ITGA 3AVBA 3IHQB 4CHOA 3MEEA 8ICUA 2PYJA 4CJLA 1TVAA 2X6NA 4UB5A 1MQ3A 1ZQBA 2V4RA 3NGIA 5KT6A 4I9LA 5BOLA 3ZDEA 3IAYA 3OGUA 3TI0A 4NLZA 3AVCA 1X9SA 3AU6A 4CK3A 2G8UA 4RW4A 4PGQA 3KD5E 1D5AA 3MDAA 3LAMA 1S76D 5J0WA 3JPNA 1ZETA 3LDAA 4DOBA 1S0VA 3PMNA 2HMIA 1BCOA 1U45A 4J9RA 4CIFA 2P66A 5D3GA 3PW4A 2NRZA 4FJMA 4JS5A 5DBBA 4DSJA 3I0SA 2EX3A 2AJQA 2YHAA 3NDKA 3BGRA 4P4PA 3L2QA 2PFOA 2HHQA 2BKEA 1T03A 3RRGA 1XWLA 4LZDA 4W5OA 1JL2A 4RQ4A 3TAGA 3F73A 3V81A 1DLOA 4F5RA 4FVMA 4K8ZA 4O3OA 3GQCA 3KLEA 2ISPA 3NE6A 4OGCA 2BCVA 2FBXA 3H7IA 3HT3A 4RQ8A 4FJLA 4Q43A 1J54A 4F92B 4TQRA 4KLTA 3KK3A 2FPKA 4CF0A 3TR8A 7ICKA 4GXKA 1PZNA 2XY8A 3P83D 3HP6A 5KG1A 8ICYA 4M9JA 1HQUA 4CJTA 3MECA 4RQ6A 3IM1A 3HM9A 4K4HA 4Z4EA 3QETA 5J2GA 3PW0A 2JEJA 1AROP 3AO3A 1JLQA 4P4MA 3A2FA 4RPZA 4XIUA 4M3ZA 9ICRA 3SYZA 1Z00A 4OKEA 8ICPA 4IQVA 1ZQGA 4QW9A 4KLUA 4Q5VA 2GV9A 4PUOA 1TK5A 3AU2A 2Z1JA 1N5YA 3HPGA 2RN2A 4OPKA 2W42A 1LAWA 3HPHA 1SKWA 4F4KA 4CGDA 2D0CA 3KKSA 2ZJ8A 3OS1A 2Z1GA 8ICFA 9ICWA 1SL2A 5IINA 1NK0A 1W9HA 2ZUCA 4M9GA 3HVRA 3DLKA 2FMPA 1Q9YA 5DBCA 4O9MA 5CZ2A 5KG6A 4X5VA 1U47A 3MGIA 4R66A 1RBSA 5HRPA 1RDDA 4LH5A 4FJKA 4DLGA 4DSIA 4FLZA 5EOZA 7ICLA 5KFBA 1ZQIA 3K58A 4N41A 4B9NA 5KRTA 5KFRA 3TABA 4IG3A 2BQ3A 2HW3A 4AILC 4Q8EA 3RMDA 4ZTJA 2W8LA 5K14A 3RH6A 4YD1A 4UAWA 4M3XA 3C6TA 5DKWA 4O3RA 4CF8A 1ZQYA 4JWNA 1VSHA 1VK0A 3OYNA 4DSFA 1LAVA 3H40A 3RB6A 2M9NA 4I7FA 4CJFA 5CYQA 1S6PA 3T5JA 4AH9A 4DWIA 3LAKA 4FLYA 4LVSA 4AHTA 2IBKA 1D8YA 2BDPA 1BHLA 4PHAA 1ASVA 4NY8A 1VSLA 2R8JA 1S1XA 3L2UA 4UAZA 4FJIA 1KVBA 3MFIA 1ZQDA 4B9MA 1BIZA 3L2WA 3KHLA 4JRPA 2G8HA 4ED2A 4CHNA 4FJ8A 2XCAA 2A1RA 4DQSA 2DY4A 4ZTFA 1HPZA 1NOZA 3PR4A 4DU3A 1RBTA 4RW8A 5SWMA 3KLFA 9ICMA 2A1JB 4W5TA 1Q8IA 4FBTA 4CEZA 1TV6A 3RMCA 3FYHA 4CEEA 4M45A 4IFVA 4YXMA 1HYSA 4CERA 3QINA 1ZJMA 2PZSA 2P5GA 1WLJA 4M3RA 4C8NA 3QEPA 2PXIA 4R64A 2BPCA 1Z25A 2P1JA 2AGPA 1HYZA 3ISCA 4MF2A 1WAFA 3HWTA 4EYIB 3V6JA 2OYQA 2BPFA 1CLQA 1XSPA 1VSMA 3MBYA 2FLNA 2IHNA 4CEDA 2R8HA 3CM5A 5KFQA 1K1QA 2C28A 3C94A 1CXUA 1EETA 3B6OA 5L1JA 1CZBA 1Y88A 2C2DA 3THVA 4C8MA 4OVLA 2JGUA 2ZUBA 9ICBA 4HVJA 4DTXA 4I2IA 2R8KA 4DQPA 2YKNA 5DB7A 1T4GA 5CYMA 3GIMA 3UIQA 3T5HA 1WSJA 4C8LA 4MFFA 4Z4CA 3AO1A 4KHWA 4ECSA 4CGHA 5BOMA 2AU0A 1KDHA 2IC3A 5J0TA 3QIPA 3P1GA 3ZSOA 2GWSA 3G10A 3AVIA 4Z4FA 1BPEA 4RPXA 4I2AA 2BCSA 4FK0A 1YT3A 4ECZA 4CEBA 5KFLA 5L1LA 1WN7A 4BE0A 1W0HA 4PQUA 4F5NA 4GC6A 3CG7A 3CFRA 9ICJA 5J2MA 4I2HA 4CFAA 2ATLA 3TQ1A 3H4DA 4M3WA 2I1QA 4RUAA 2VG7A 3TFSA 4E7LA 3OYJA 4PHEA 3DOKA 4ECWA 3SQ1A 1TVRA 4PHDA 8ICMA 3NGYA 4NLKA 2MUTA 2D0BA 4KV8A 2BGGA 1VSKA 1K1SA 3D45A 1T3NA 3TAQA 3LDSA 4I2CA 1NJXA 4N76A 4JUZA 3QO9A 5IIOA 1ASWA 3ZT2A 5DK5A 2X78A 2EHGA 4DU1A 1VRTA 2XY6A 3FDSA 1Z00B 4QWBA 4YD2A 4MEYA 4HUGA 3HP9A 5J0RA 4CJKA 3MR6A 2GBZA 4HYKA 7ICGA 4QZ8A 4ECQA 4F4XA 3DRPA 3EZ5A 3UQ2A 4B08A 2OWOA 2OZSA 1HUOA 4ED3A 4CIEA 5J2PA 2HHXA 3RBDA 5DG8A 3HK2A 3V6HA 1S97A 1X9MA 3OYIA 3U3YA 5KFTA 4MEXA 3N4MB 1HUZA 4PY5A 3L3UA 4EP5A 4CE9A 4ICLA 4FJ7A 1ZYQA 8ICHA 1L3UA 2P6UA 3AVLA 1U9LA 3QNOA 1NK4A 5KFVA 4BGDA 5F9LA 4FJNA 2V4QA 4J9MA 1X1PA 4F5PA 5KG4A 1A5XA 3AO4A 1XSNA 1WSGA 4FW2A 3MR3A 4LH4A 4ED6A 1B22A 4BDZA 1NK7A 4O3NA 8ICGA 1ZQTA 2IS3A 4I2QA 5HROA 4EZ6A 4JV2A 5KG3A 1LV5A 4DTPA 1IH7A 1IXRA 4QAGA 2LYHA 4EEYA 4KLQA 1B43A 3CQ8A 4CF9A 3SPYA 4M3YA 1BQMA 4ED7A 4CF1A 3B6PA 5KG0A 7ICEA 3LPTA 5C24A 4JK1A 4CJ3A 9ICFA 2NRXA 4M3UA 4ELTA 3ZT4A 3UXPA 4GLXA 5J0SA 2ZD1A 2NRTA 1TK8A 1G15A 4QZHA 3C23A 1RYSA 1FKPA 4MFBA 3RWUA 4LD0A 1JX4A 3M8SA 2MAXA 4DEZA 3QNNA 1MQ2A 2BCUA 1ZQHA 3DYAA 2HHWA 3VQ7A 3H8JA 1R0AA 1ZQQA 3V9WA 3NF9A 4E7KA 5KFKA 3LP0A 5DBAA 4FJGA 5J2KA 3M9NB 1TAQA 4JV1A 4E3SA 4Z6EA 1BPDA 4Q44A 2XCPA 3QZ7A 4ECVA 3ZD9A 5SZTA 3L3VA 3LANA 2HNYA 4RZRA 5J2HA 4GVMA 4F8RA 4N47A 2DPIA 2VA2A 9ICTA 4B8CA 1S6QA 3VQPA 3SUNA 4Z6DA 3SI6A 2I9GA 4YG2A 3LP1A 2JEFA 3LZJA 2B5JA 5DLGA 5CB1A 7ICFA 4DQIA 3MR5A 3RBEA 1LWEA 4NLNA 1BCMA 2W9BA 2B21A 3SUOA 2ZJAA 4GC7A 3U3GA 3OYEA 2W9MA 1T7PA 5FRNA 4W5RA 1HQEA 9ICSA 3MAQA 4QWEA 4QZAA 4BE2A 3GIIA 9ICUA 2GUIA 4KHSA 4ECYA 5EU7A 3VQ8A 1RCHA 1JXEA 2DFFA 3BQ0A 1BPZA 3C21A 1UAXA 4FZYA 4UB2A 3JPSA 4J9SA 1C1AA 4OJRA 3NF7A 1XU4A 2ISOA 1O1WA 3OYMA 2ITGA 2X74A 3UXNA 1Y97A 3C2KA 1TKTA 1XHXA 2B6AA 1K6YA 5KFAA 9ICGA 4DFPA 5KFDA 5HNKA 4RT2A 4F4YA 3Q8KA 4I2BA 3O4QA 1NJYA 4J9PA 3OYCA 2J6UA 4YMNA 3TWHA 5CP2A 3PMLA 3ZCMA 2PI4A 4CJPA 1KEJA 4BWMA 3HX0A 3MFHA 1C1BA 4RQ5A 3MXIA 4M9NA 5KFYA 4C8KA 1RXWA 3OS0A 1RBUA 4O3QA 1WCLA 4JWMA 4DFMA 1LWCA 4FK4A 3P5JA 3VN5A 5J2JA 1J9AA 1XHZA 3H8WA 1U48A 1KRPA 4TQSA 1ZBLA 4CECA 4I2PA 1IG9A 4PPXA 5KFZA 4BE1A 3PX6A 3TARA 9ICVA 2QKKA 4KI6A 1C6VA 3GV7B 2MUTB 8ICBA 3OYAA 4M04A 2ATQA 1ZQXA 3EW9A 2BCRA 4HUFA 4B9SA 4GXIA 2XC9A 4ED1A 4TSXA 5D4BA 4B9VA 1RTIA 2WONA 3LWMA 9ICCA 2Y1JA 2JEGA 4J9LA 3KHHA 4IR9A 2I5JA 3KKRA 3PX0A 1T05A 9ICNA 3V1RA 4J9NA 4K8XA 5IILA 8ICLA 4E89A 3SUQA 4O4GA 1NKBA 1NK9A 4FLXA 1SL1A 3RTVA 3OSPA 4I9QA 1WSHA 4UAYA 4HCCA 2IMWP 8ICZA 1RZTA 3BQ1A 4QZ9A 3CM6A 1IM4A 2IAJA 7ICOA 3PNCA 2FLPA 4CESA 2PI5A 2JEIA 4JS4A 4DL2A 4NCGA 3JSMA 1HJRA 2R7YA 2BHNA 3AVGA 2OZMA 2DTUA 3HSTB 3ZT0A 1ZQRA 1C0MA 1ZBFA 3V1QA 1NJWA 7ICNA 1IKYA 1QTMA 4M42A 1BI4A 5KT5A 3DLBA 7ICPA 3T5LA 4ECXA 4HTUA 4KB1A 1S1VA 4AHCA 1MU2A 1A5WA 3K5LA 3SV4A 2R8GA 3OYLA 4N56A 8ICAA 3NH0A 4CJQA 3RR8A 3VA3A 5HBMA 1JMSA 4RG8A 7ICTA 5IIKA 3WNGA 1WSEA 2IGIA 5KFGA 4LZGA 4CJRA 4YR0A 4Z6CA 4DL6A 4RW9A 7ICIA 1JLGA 2DPJA 3MEGA 4FJXA 3G6YA 4UB3A 4RW6A 4TUPA 3V7LA 4UB4A 4FJHA 2PFNA 1ZQPA 2HHSA 3BJYA 1EX4A 4QZBA 2ZTCA 2VG5A 2G8VA 4BXOA 2KFNA 3MABA 2YHBA 4O0IA 8ICWA 3KLHA 1EKEA 4ECUA 4H4OA 4PHPA 3RJFA 3NH2A 5CHGA 1RDBA 2QXFA 1UA1A 1JLBA 1RT2A 3KIOA 3PO4A 3OJUA 3SZ2A 3TAPA 2RKIA 3FFIA 9ICHA 3H08A 4M3TA 3RJIA 4E7HA 2OA8A 3AO2A 4H4MA 5CR0A 5HRNA 1REVA 4NYFA 4DQQA 2RF2A 3O3GA 4YFKA 4KTZA 2Z1IA 3NHGA 5I3UA 3RH4A 4IRDA 1S5JA 4RQ7A 4F4ZA 1VSIA 2OPPA 3JPQA 4Q45A 9ICPA 2W9BB 5J0OA 1U49A 4FW1A 3CFOA 1WAJA 1S0MA 4FZXC 1BIUA 4O3SA 2HB5A 4FLWA 3K5OA 3GIJA 4HCBA 3AA5X 3TAMA 2H5XA 2FLLA 4E1MA 4PA1A 2FBVA 3QEVA 4ID1A 4I2DA 1WSIA 5J2DA 3C2LA 5L1KA 4BWJA 3RB0A 5CZ1A 4CGGA 4NYNA 4J2EA 4DSEA 2BANA 8ICSA 5KFEA 3KLGA 5JS1A 1UOCA 3C1YA 4B3OA 4DTNA 3PR5B 1CZ9A 3HL8A 3V9ZA 3QEXA 3DLRA 1ZQZA 4OLAA 4FM1A 3SI8A 4LSLA 3C6UA 4F4WA 3E01A 4GMJB 3GV8B 1RPLA 3GDXA 4RQ0A 3EY1A 4QW8A 3AVKA 1N56A 4AHVA 5KFPA 1J5OA 2Q0ZX 4F5QA 4F3OA 2F1JA 3N97B 2DFHA 2XY5A 1JL1A 2XGPA 4Z4IA 7ICVA 1BL3A 1KFTA 4LSNA 4M9LA 8ICVA 3HW8A 5EWGA 1RDAA 3KK1A 3RJJA 8ICQA 5KFXA 2E4LA 3QIOA 1RYRA 4DL5A 2F1IA 3PW7A 1RTDA 5FROA 3KD1E 1TKXA 5DQHA 8ICTA 4UB1A 4YNQA 4CGJA 4EBEA 1BPYA 3C2MA 4XQ8A 3AUOA 4Z6FA 5DGBA 3OYBA 4P2HA 1S0OA 1S9FA 4O5CA 1I39A 5IIMA 1S9EA 2WOMA 3H8SA 3QESA 1LW2A 4E7IA 3K59A 3K5NA 2JLEA 3ETLA 1JLEA 3G6VA 1JLFA 4DL3A 8ICRA 3S3MA 4I2GA 3C1ZA 2IHMA 4RW7A 3EWAA 3K57A 1ZQNA 4RQ3A 4TUQA 4CIGA 4M6WA 2NRVA 1FXXA 2FBYA 1JN3A 1IKVA 4F2SA 1TGOA 3ZT3A 3F9KA 1N6QA 4KRFA 4KTWA 3NCIA 1RBVA 2AQ4A 9ICXA 1LW0A 5HHHA 3PX4A 3KLIA 3C5GA 4DTSA 4KLMA 2ZE2A 1NKCA
chains in the Genus database with same CATH superfamily
4UY85 2ZH9A 2D3ZA 2X6SA 5GAHP 4NCGB 1IUJA 4CO3A 5HANA 2XIDA 3LWLA 3FZMA 1RQLA 1YF5L 4E0DA 4DSLA 3ZDAA 4EP4A 3DLKB 5HI7A 2BE2A 3BO2A 1WELA 3DLHA 3CIPA 2Z1HA 3ENHA 2I5HA 1JLAA 1M5VC 1B9DA 2P9PB 3CQXA 3FZLA 4WU2A 3SMSA 4KLLA 1H7WA 4DR4J 2G0AA 3O5BA 1YTAA 4V19S 1JALA 1HHSA 3RJEA 4WJ3B 3MM6A 3IGNA 5A0YB 2MQMA 3QQCD 3ADAC 3W2WB 4XRHA 3ZO7A 4KLGA 7ICSA 2OPSA 1YVNA 1B9FA 2O8DB 2G13A 5I42A 4NCBA 2MQLA 5B0EA 4W5NA 4BXOB 3QMLA 5HR7A 1NI3A 1TL7B 1N88A 1TQLA 3O6WA 2P6SA 4WWSA 2RLTA 5DMRA 2RP5A 1CC7A 4CHZA 4JHDB 3IG1A 1FDBA 1FRXA 3SQ0A 3S3OA 4MHVA 3QEIA 3AOBA 3BF3A 3FFIB 2DNHA 3FSXA 4GRSA 3S01A 1NGGA 2YHYA 3C8YA 5HRSA 2LP4A 2VPXB 4H4MB 1EARA 1G4CA 2CJBA 4OYXA 1Q18A 4MFAA 4Z37A 1GLJO 3NXZA 3ETRA 3L09A 4MN4C 5C10A 1X4EA 2QIFA 3ZZTA 1SH3A 1FA0A 2OPPB 4AQYF 4ID8A 1TUVA 1NOMA 3IP4B 1BQNA 1FO4A 4WF9Q 3VF0B 1ZXOA 2OAUA 1X6IA 2KKZA 3VQBA 4EHUA 1VSDA 1W97L 3V1OA 3DFEA 3L8BA 7ICUA 2M2BA 4I4BA 2HEKA 2FC0A 2WHEA 7ICQA 1IR2A 1ZQWA 2YWHA 3GR1A 1U1LA 3QERA 4IBNA 5AXMA 1NU0A 4I0WA 4NLVA 4ETXA 2ZH8A 1OJ4A 4YHHJ 5HJYA 2MRLA 2D9OA 4ZPAA 3UR0A 3ILLA 3KLGB 1EQMA 5DB8A 3UDEA 2UUAJ 2H51B 5HATA 2XLKA 3NF6A 1UT8A 2KG5A 5KAFU 4M5DB 1AW0A 1WC5A 3A0BU 2HZVA 1U04A 4O44A 1J2VA 1DEJA 4CE6A 1WDTA 3TFRA 1R89A 1ZQCA 2GTDA 4U9RA 4FVCA 2FJVA 3I5CA 3NS7B 3BGLA 1YLXA 1FNXH 3D3BJ 1RCOB 1O6XA 1XMBA 4Z2XA 4RNMA 3KNAA 1VK8A 5TZVA 1HBMB 5GADP 4CF4A 1FX4A 3PY8A 1UT5A 4C23A 5KT4A 3KK1B 2O4IA 4YOYA 5J0QA 5BPCA 2AX0A 4M41A 2ASOA 4OGEA 4B9LA 2UUAK 3BS5B 2IM3A 4JYAJ 1TKXB 1CPZA 1YDLA 2ASPA 4WXOA 3CJ0A 4I68A 2P9UB 3FZFA 1UPMB 4D3GA 3Q8PB 9ICIA 4FO0A 2EDUA 1GLEG 4BG8A 3FJ2A 1IQTA 5AM1A 4QZFA 2ASJA 2DYAA 2O8EB 3EICA 4DN9A 4KC5A 5C2GA 4EEKA 2CNKB 2VQEJ 4DJBA 3MMAB 2X1FA 4M6WB 2PEHA 4IEEA 2HK2A 3JPTA 2ZM6K 2HKEA 4J9OA 2DY1A 4W90B 1X6JA 4PYAA 2Q3SA 4JYAK 4EMDA 4RPYA 4ES3A 3M1YA 4QQBA 3MGHA 1KTQA 1NSKL 2ZE2B 3DRPB 4I6AA 2LKZA 1ZAWA 1KHVA 2EZYA 4CD3A 5AQGA 1BXNA 2VIXA 4KLJA 5FPDA 2QLWA 4Z0UA 3TPQA 3OXFA 3DM2A 3QEBZ 2PAVA 3C6AA 4QCLA 4J2AA 4NXNF 5EVZA 3R97A 1Q5YA 4K42A 1PJ5A 5KFWA 2MSNA 2XMJA 1W2BM 2VQEK 1FO1A 1PK1A 4RQNA 3CPEA 1IBKJ 2ZJ5A 3DNCA 3VAFA 3HHNB 2QG9B 3HVAA 3MAAA 4CJSA 2JFDA 2VWBA 2DH7A 4UQGA 1VQ5N 1VRQC 3WZ0A 4Y2JA 4X62K 1UVNA 7ICRA 2JXJA 2WB4A 4CRJA 5A0LA 4K50A 4I28A 2GEMA 4TY8B 4NA3A 1FRHA 4M95A 2QLFB 2XHWA 3O6QA 3GIKA 2ASDA 2ITMA 2BQRA 2BCQA 3IA0A 5E3CA 4FJ5A 5D46A 4A8SA 4YN4A 4YDDB 3OHBA 4FF2A 4UY8O 3ZNUA 2AYGA 2VA8A 2Z0GA 3NL0A 1Q9XA 1X2IA 4DG1A 1X5TA 4OPJA 4FBUA 2HI0A 4L74A 8ICKA 4P73A 2KL8A 3UCUP 2YX4A 1PAUB 2IY5B 1WG1A 5ALIA 1VSJA 4CGFA 3FAHA 3DMJB 2W25A 2Y1IA 1VQ7N 4Z4GA 1E6VA 2ZBPA 2FVSA 1VSFA 4KFBA 2X3DA 3VTHA 1QUVA 1HNIB 5KG7A 1J97A 3PW5A 4YMOA 1QVGM 4CDIA 2IOFA 3WC0A 2G2OA 4EYHB 2KOBA 5HQMA 5HMLA 3MPVA 2LPEA 1PG5B 3OTDA 1IVZA 4YY3J 1K9MT 2VD3A 5ALDA 3UFCX 3G9CA 3AAPA 1IJFB 3NF8A 2HRTA 3O3HA 2QFIA 1X9XA 5HP1A 2KZ3A 5GTIU 2B5JB 3M9MB 2R8IA 1SUQA 1BPBA 3AH6A 5ETOA 1RNHA 2F63A 2OSQA 3KJNB 4ELUA 3L2RA 1V3SA 1ZQSA 3ENWA 3ZNJ1 1FJ7A 4ZS6A 5LT5A 4J2DA 1R6VA 5JVHL 2NYHA 4C7ZA 5GAGI 4ZVGA 3W8PA 1WCNA 3GCWP 3UPQA 3OTOK 4LF8J 4PL7A 1YXQA 2QYGA 1NK6A 5AI5A 2AT1B 3PYEA 3LM2A 2WVEA 2NZTA 3ZSXA 3KK2B 5AI8A 4KHPK 5J1EA 1X9JA 1SXEA 5AQXA 3U6FA 2A19A 4C11A 3MXMA 5BRDA 3J81O 1K73T 4KHNA 4JKCA 4F5OA 3DWLA 1YUWA 2D9PA 3CPWR 9ICKA 2AA4A 4HWIA 3ISDA 4CO1A 3ETOA 4ISFA 2QKBA 3PV8A 1PUZA 4CZIA 1Z4NA 1A6LA 1XR6A 2YX6A 2L5YA 4CFBA 3CEDA 1TFRA 3BDPA 4IQWA 4KI4A 1QLNA 2GAHC 3OXLA 3GILA 1XN9A 4DV1K 4BDYA 3FRZA 2DR9A 4Y0WA 1KAXA 5B09A 2ZJPL 4C0ZA 3HHDA 3FFKB 2JHDA 2JZBB 3PNIA 2F8MA 3GIRA 2F8EX 2YKMA 2XNQA 4U7CA 4F3TA 1MROB 4OPHA 4DKWA 2O8FA 3ZSYA 2VC1A 1QQNA 4C1NI 5LMNJ 4YCXA 4JP8A 3VQTA 1QAJA 3CF5L 1QE1B 1Q81O 3CD7A 3PUFA 4N5SA 4DR2K 3H1QA 1XS9D 3W1YC 1AZSB 5AK5A 2APOA 1HJPA 4DS4A 2Q3PA 4PCQA 4CEQA 2KFYA 4XAKA 3C14A 4YR3A 4TYBA 3U8XA 1OW5A 4DSKA 3I96A 1GMUA 4XPCA 1WJ9A 3VEYA 5J0YA 4Y2UA 2E1FA 2UUAF 1KP6A 4WZQA 2P9SA 3UXOA 3H4BA 4HDHA 3WXLA 2K8CB 3HILA 3MPYA 1K44A 4PG4A 4CJWA 1ZBHA 2RUSA 5AM3A 2CQ1A 3MUVP 1GMWD 4I56A 4LF6J 2OM6A 2ZIUB 2ZIWB 2FY8A 3LTOA 5L9XA 2I1RA 5KOXA 1R8BA 3IRUA 4TN2A 1DQ9A 1SV5B 4FXVA 3J80Y 5IV3A 2WFAA 4CHYA 5F9NA 2JWKA 1UJ6A 1IKYB 3M2RA 3T79A 2Q6BA 3T1YK 2B9EA 3U4LA 2KM8C 2CQ2A 4KPYA 4AE5A 3IFRA 3LVVA 4JYAF 3CCVN 3PW2A 3IS9A 1N34K 2LBOA 1RK8A 3N4PA 2WB1C 2NYVA 4X64J 3QJLA 3D1HA 2IM2A 5FRMA 2WTFA 1FKOA 1RABB 1APSA 3UMGA 3C3LA 3ENAA 4HDGA 2YV0X 1PILA 2WC9A 2GAGC 3T69A 4C4RA 1OH8A 3UI3A 2A1SA 4Y2AA 3TKAA 3MEGB 2BUPA 3KJVB 1WDDA 3AD9C 4CLZA 2ZWOA 2BR0A 2DR7A 2VQEF 2Z30B 1K8KB 1KVKA 3AVMA 4KLIA 4HTIA 1ZQUA 4JAXA 1UFWA 1N62A 2YKAA 4TU7A 4QZEA 4Q8FA 3HPOA 3CIZA 2W2OP 3NRWA 1KFSA 4OYPA 4X62F 2QLTA 2Q79A 3JS6A 5AM5A 3UCGA 2EWSA 4OJHA 3U26A 1RTHA 2CPHA 4AYBD 2YNIB 1NZAA 4IFEA 4IQTA 2OTLS 2IRUA 2IOFK 1YBTA 3VQ5A 4G1QB 2G2YA 4ES2A 4L72B 1ZQOA 1U6FA 1VR6A 4OKJA 4QOZB 2HIYA 2IA6A 4B9UA 4JI3K 2P9KB 4HAIA 1FW6A 1RAEB 5HK4A 3HVTA 3RJKA 4MIBA 1QSLA 4KREA 2NPIA 2EAMA 3QAUA 3TAMB 2FMQA 3IWNC 4U67L 4ICAA 3PO5A 2B3TB 2VOOA 4NM1A 1ROFA 2MKJA 5IT9Y 3OBYA 2BYCA 3NCQA 2DH9A 3LP2B 2O4GA 2DKZA 3BR8A 1VC6A 2QA2A 2R7RA 4GW6A 3SV3A 3O3LA 2K1RA 2U2FA 3R6MA 4GO5X 3R3TA 1VQ8N 1ZPWX 4ERDA 5J2NB 3M6XA 1C1CB 5JLFA 3WIUA 2DHGA 4ECRA 3H20A 4LRBA 3CYMA 3RH5A 3VF2A 5GADU 2P9LB 1RWMB 1G7CB 4BUGA 1D9DA 1HMVB 4DUZJ 3CC2S 3WNHA 2OPQA 5HLFA 1EO1A 3FCHA 4J9VA 4UY8T 1UEVA 3D2FB 3K7RA 3H5YA 2O66A 3E01B 3DRRA 1DTTA 4CFCA 2BUNA 3QZ8A 2I8EA 2ZGZA 2YNFA 2HBQB 4XUSA 4KKOA 3OSNA 5KGWA 3OTOF 1RWNB 2IRXA 3MC1A 1DTQB 3IG8A 4O0JA 4QR0A 4IH5A 4KHPF 3GYGA 3LDOA 4YY3F 2YVSA 3BH7B 1RA7A 1WOQA 4CHOA 3HZEA 3VVUA 2H3ZA 3C15B 4BRNA 3F2DA 2W41A 2X6NA 2RDDA 1SV0C 1XK8A 1FE0A 2E8AA 3MM8A 3MX5A 2V4RA 1U25A 1S4FA 3ZDEA 3OGUA 2AV5A 2G8UA 4FWRA 4B3TK 4DPTA 5L9NA 3MDAA 1S76D 3TSUA 5E0OA 1FRIA 1ZETA 3FC4A 3DJCA 5A2QO 1S0VA 5HMWA 2QB0B 4LF8F 2GWKA 1WBBA 3W2VB 2P9NA 4JI6K 3PW4A 3IGVA 4IWVA 4DSJA 1WYGA 2F7VA 4P4PA 3G71S 5ALPA 2DCLA 3CULA 4LZDA 4B02A 3MPDA 2RT3A 4O3OA 4DI6A 3VOVA 1PK3A 4DPWA 4IOCL 5AICA 4RQ8A 4RNHA 4FJLA 4Q43A 2W4CA 2W6LA 4A59A 4KLTA 2PGCA 4BLGA 3KK3A 2MKIA 2RVJA 2O8CB 4L73A 4DN0A 1L8OA 3D1QA 5KG1A 4DB3A 1JROA 1SKUB 5B66U 3C16A 3D2WA 3JYTB 5J2GA 3PW0A 2JEJA 4OZ1A 4NMXA 1AROP 3CWJA 1JLQA 3D6MB 2E5GA 4RPZA 3A2FA 4UTGA 3M2UA 1FTRA 5KPRA 4UW2A 3QLHB 1Z00A 3P4IA 1IR1A 3WEEB 4IQVA 4R5PB 4K4YA 5E3AA 2DXDA 1EZZB 4C7QA 5C25B 3EEQA 4U8VA 3AU2A 3S6EA 1MN8A 3HPGA 1UHUA 4LBIA 5LMNF 4KH6A 1U6ZA 3RBZA 1D9AA 2PEBA 4F4KA 5ALNA 3HHKA 1VDHA 4IO1A 4DV7K 2GUPA 1TAMA 5C2DA 1SL2A 1W9HA 2OD4A 2D6FC 4A8EA 2A1BA 3DLKA 1S72S 5HVFA 4NLYA 5KG6A 1X4AA 2XSFA 3A3OB 3NASA 3AAWB 2MTLA 2CXEA 3CMEN 1RDDA 1VQPN 1UTAA 4CRXA 5CE3A 2FYXA 3AD8C 5ETMA 7ICLA 4QYRA 1ZQIA 1SPBP 4N41A 5KRTA 3Q23A 3SEIA 2F65A 3RYLA 4IG3A 2XMKA 1HLUA 5K14A 4YD1A 4UOHA 2D3OR 4BGAA 5DKWA 7FDRA 3JS9A 2DHHA 1WF1A 2LM1A 1KQKA 4CF8A 2IVNA 2C3MA 1VSHA 5FPNA 1JJ4A 2UUBJ 5C12A 3RB6A 1CJVB 2M9NA 4FNHA 3R3LA 2R2UA 3BSAA 3T5JA 1EP4B 3D2NA 4JHDA 4RBUA 3MM9B 4WP3A 2IBKA 4DCOB 3N5FA 4FJIA 2MSSA 1KVBA 2HSTA 2EBGA 3MFIA 3M8PB 1GNKA 3N4QA 4P2XA 3O9RA 1UAWA 4DR6J 4B9MA 3TACB 3L2WA 3KHLA 4IDKB 2GNKA 1TKZB 3ITHB 1X5SA 5JVHQ 4ZTFA 2J0WA 1HPMA 1XNRJ 1D8ZA 4PQAA 5E5NA 1ZD5A 4B3SK 2WBMA 3KLFA 9ICMA 2MZSA 2RQKA 1SXLA 1GH8A 2QWNA 4OD0A 4CEZA 3K89A 1C0FA 1WUDA 1ILYA 3H5SA 3FYHA 5GAEP 4OYZA 1DT9A 2XZDB 1WLJA 4JKBA 5AM0A 3BZCA 5D0EA 2PXIA 3X3UA 4A48A 2NRHA 3GOIA 3CI5A 2NLXA 1QJHA 3AOCA 3CCJS 1Z25A 3MD3A 1WAFA 3UE5A 1ZRMA 5ALHA 1U7LA 4GNIA 1V4TA 1SWWA 1Y5LB 1CLQA 3GG1A 1XSPA 4YUDA 2PFDA 2DNGA 1X5PA 1K1QA 2C28A 3C94A 1OO0B 5LMUK 5L1JA 1Y88A 2K2PA 3GP9A 4OZ5A 3THVA 2UXBK 2UV8G 2HFUA 3W65A 1M0SA 3FGVA 4CQ1A 5D0HA 3I0RB 2R8KA 2DQNB 2MJUA 1ZXIA 4DFDA 1HBMA 1WHWA 4NLQA 3AO1A 2HFNA 1XERA 1M90O 1KDHA 2AU0A 3QIPA 4K7QA 1FX2A 1DXSA 3ZSOA 1LXJA 3WK4A 1XMQK 1DBDA 3BS5A 3CF5Q 2BH1A 4BJQA 3NAIA 2BCSA 1HW8A 3BREA 4BRLA 1W26A 3H25A 5KFLA 1DLOB 1W0HA 4PQUA 4GC6A 3CJ3A 4WP8A 2KKHA 3UO0A 5HQ8A 2ATLA 3VV2B 3H4DA 5LSLA 5F8HA 4IOXA 4DUZF 5AQRA 3OYJA 3DOKA 4ECWA 4BRGA 1CJUB 1U09A 3NGYA 4NLKA 5CD4H 1CJTB 4KV8A 3MECB 5ALFA 2IIHA 4CLSA 2F4VK 3C29A 2R3VA 3LDSA 1D0EA 4JUZA 1ASWA 2AJ4A 2EHGA 2BJ1A 4CLLA 1C4CA 1GLFO 3EN9A 1RACB 4YD2A 3CCLS 3R5CA 2YH1A 4MEYA 2IRYA 2QC3A 3J81j 3HP9A 2RB7A 2Q66A 3MR6A 1Z2LA 2M7SA 2GBZA 4DXLA 2BX6A 3S7RA 2Z7JA 2W4PA 3DRPA 4B08A 4XH1A 4KY3A 2H65B 2OZSA 2GZOA 5DG8A 3HK2A 3V6HA 1S97A 1Q3UA 5EE0A 3QX7A 4ALZA 3N4MB 1VRUB 2BV3A 2EG1A 2QMUB 1ZYQA 2E1ZA 3QNWB 1N36J 2ZF5O 1DK3A 1U9LA 2KVSA 2KHVA 4NLUA 3HHLA 3C7NB 3ALRA 4KGMA 5F8MA 3WXIA 4J9MA 4URGA 1A5XA 3VAJA 3KOAA 4HT5A 3AQFA 3AN1A 3QXGA 1JWWA 3SAFA 3B78A 2BJ9A 3CCEN 1M5OC 5L38A 2C3UA 2FY1A 1EWQA 5A8KB 3JXOA 2X1GA 4EEYA 3CJBA 3O9QA 2HRYA 1Y4ZB 5F8IA 3IR7B 4CF9A 3IBFB 4MLEA 1VQLN 1BQMA 1R7IA 4CF1A 7ICEA 3W9HA 4FWLA 4DV4K 2OMLA 4C4SA 5AXLA 3SD7A 3UD3P 3H0RB 4PG6A 4ETZA 1ZM4A 2BA9A 4MFBA 3RWUA 3O1BA 5IC4B 1NPRA 2QSWA 2E1MC 1JX4A 1S1TB 2FVPA 1KKXA 5L39A 4QR1A 2K7KA 3L5KA 2F4FA 2HHWA 3UB5A 3VQ7A 3T9NA 3IO1A 4PXBA 1NDPA 3V9WA 5MAOA 3PRVA 5GMKa 2MLYA 2BJEA 3M9NB 2EW9A 4E3SA 4EELA 3DRSB 1P1TA 2ZJQQ 2KLAA 3FQKA 4JKEA 4A8QA 5EXWA 5AKEA 3W9IA 4F8RA 5KPZA 3K0SA 3U02A 1RAGB 3VQPA 3SUNA 4Z6DA 4NJ8A 4YG2A 3LP1A 2V6AA 4ER8A 2B5JA 4IL6U 2IVPA 2D74B 4FOIA 4HH0A 3VAGA 4U67Q 3EGZA 3AB2B 1WI8A 1ITPA 2UP1A 2CJQA 1HNZK 2HFVA 1GTEA 4FYVB 1U24A 1HWKA 5CH7B 4CJ7A 3J7YP 4GC7A 5IV4A 3U3GA 2PMZD 1HW9A 4L3KA 1UVJA 1BQXA 5AK6A 5JMNA 4QZAA 3GJSB 4Y00A 3UE2A 3GIIA 4KHSA 1NAQA 2VJ4A 1W2BR 1WHVA 1U02A 4BC5A 2JRSA 2ERRA 1N32J 2Y8YA 4LFBJ 4K5SA 2RRDA 1BPZA 3QUQA 1UAXA 3NVVA 1QQ5A 5DRKA 1XU4A 1H72C 4DZ6A 4CO5A 2D1CA 1O1WA 4UF4A 1ZPVA 2UUBF 4LRFA 2ITGA 2X74A 4WFYA 3MCOA 1Y97A 3C2KA 2DB1A 1K6YA 5AQYA 5LXRA 9ICGA 5LJ5Y 5KFDA 4LF5J 4F4YA 3Q8KA 2CPYA 3OFFA 1D1UA 4I2BA 5H9EK 4DUYK 2EBEA 3BDEA 2E1PA 4C98A 4RUBA 4YMNA 4H4KA 5CP2A 3H59A 2I0XA 2QWRA 2PI4A 2G5HB 1KEJA 2HHPA 4ZVTB 3MFHA 4ZPDA 1C1BA 4RQ5A 3POTA 4UOGA 2AZ1A 2CQPA 3P5TL 5KFYA 2FXUA 3RFAA 4C8KA 3WQTA 5AHXA 1RBUA 5T7LA 3MR7A 3GYXB 2JC0A 3GZFA 4JI1K 1MROA 3P5JA 2ZFHA 5K4LA 2QT7A 3H8WA 1RSCA 4CECA 3BR9A 3M1FA 4LF9J 4BE1A 4KYZA 3TARA 5HR6A 4IQMA 2QKKA 4B1UB 1TVRB 1HI1A 3OFHA 1WC3A 5L1MA 2MUTB 3OYAA 3D6HB 3EW9A 3OL6A 4GXIA 2XC9A 4ED1A 2IDLA 1YJUA 4B9VA 3EJMA 3GFZA 2HQDA 3H45C 2Y1JA 1OY9A 4M1KA 5BR9A 2I5JA 3FBBA 3O0FA 2BZFA 2G07A 4K8XA 2JNJA 5IILA 4CVNE 2YXLA 1NRKA 4BR2A 4RTFD 4DV3K 1H6KX 2WF8A 2JVOA 1WC4A 2HWIA 1N5SA 3SUQA 2BZ2A 3MN5A 1SL1A 3LDLA 2QLXA 4AL5A 3GE1A 3R5GA 4USMA 4LIRA 1GXTA 4LF9K 3I4PA 4K2XA 1WSHA 1N54B 2IMWP 1AUDA 2HCFA 5D15A 4CYUB 4KGKA 2NS1B 4MK8A 3TJ9A 2HBKA 2KRRA 3R1LA 2FLPA 3VPZA 2JEIA 3O44A 4DL2A 2E7XA 2I6XA 2DKOB 1ZQRA 1ZBFA 1W25A 1IKYA 4ZLLA 4M7XA 3HHEA 5AJ3K 2M88A 1ZA2B 2I7PA 4ILJA 2ROGA 2ZDPA 2VKQA 3L7UA 2F44A 4USIA 1CS4B 5AQMA 1A5WA 3DDNA 2ZH3A 4I2QB 4WE1B 3TADA 1M90T 5GTHU 3NH0A 3RR8A 3HT0A 1OXJA 2OTJS 4JI8K 4P9SA 2R7WA 4EGLA 1JMSA 3CJ1A 4NZ6A 1WSEA 4BRHA 1QUPA 3IM8A 4NO7A 1JLCB 1OPZA 4RW9A 4Z6CA 2LYBA 3TEGA 3MEGA 1GTHA 4UB3A 3FQLA 2OYYA 4TUPA 1FKPB 5GIOA 2YMQA 2X51A 2PFNA 1ZQPA 2HHSA 2ZBCA 3CCSS 1QH9A 2VG5A 4Q0BB 5FLXY 2KFNA 2EK1A 1RGVA 4HACA 1IBMJ 2DEIA 3RJFA 2HQFA 2QXFA 3FBEA 2AWZA 4OYMA 1XNQK 2DNKA 3MHYA 6FDRA 1HARA 1Y3KA 2C3OA 2EVZA 3K8VA 1LVHA 4NA2A 2HQCA 2PFFB 3TAPA 3SQIA 2RKIA 4MLHA 2MZQA 4CBWA 4WYWA 2HNYB 2ZVIA 4JNEA 3CC4S 1R6YA 1SBRA 3GFHA 5FP0A 5C7PA 1WC0A 2RF2A 1T95A 4KTZA 3NHGA 5I3UA 1S5JA 1LWEB 4Q45A 1Y5NB 5U47A 2OFGX 5J0OA 1U49A 3L9ZA 1WAJA 2WTUA 1S0MA 1CJKB 2HB5A 2XS5A 3CP8A 4ZPWR 4JKFA 2IDEA 4UB8U 4HCBA 3DC2A 3TAMA 3HZGA 1YI2N 1HQEB 2H5XA 1KONA 1LKYB 4KO0B 1BLUA 4PA1A 2FBVA 2FHOB 4E2FB 4C4TA 1Z2ZA 3R7BB 3VQSA 1KN5A 2NV3A 1IWGA 1KBRA 3C2LA 1WOSA 4PL8A 2CH5A 4Y28C 4YOXA 5L1KA 3OV7A 1BC6A 3DGPB 3LVWA 8ICSA 5KFEA 1D8BA 3EGVA 4NLOA 4DPYA 5ADXH 4ZN1A 1M6YA 1REGX 5CCLA 1X60A 4C3MA 3M8WA 5F0WA 4JKGA 1WWVA 4QNLA 3QEXA 2OUGA 2E5SA 3I9ZA 4FM1A 1HNZF 1NSAA 8AT1B 3D2FA 3N6MA 3VF6A 3C6UA 3E01A 2JOQA 1GX5A 4C0OC 4RQ0A 3JSRA 4Z7YA 3EY1A 1TZ0A 1U1KA 4BQZA 1YBAA 1J5OA 2Q0ZX 3K0JA 3GB0A 2F1JA 3ZTOA 4ANDA 2HFSA 2DFHA 4DR7J 2CVEA 4LF7J 3K5PA 3UD5A 1KVIA 4CF5A 1K47A 1LWCB 2FJEB 1RDAA 2VODA 3RJJA 8ICQA 3C15A 2VJ5A 4FSVA 3QIOA 1RTDA 2D3DA 3CDEA 3RJMB 3PACA 1JK9B 4BRMA 3IP0A 4YNQA 4IDHA 3I56S 3C2MA 4DUYF 4XQ8A 4Z6FA 5DGBA 2MDAA 1U1MA 4DV0J 1CQNA 1S9FA 4O5CA 1XJWB 1FHTA 4WK3A 2QB0A 3D6JA 4JI2K 1Q82O 3BPSP 2A3VA 3K5NA 1JLEA 1ZZFA 3THWB 3OQ2A 1SGGA 1IR0A 5AT1B 3BGOP 2C3YA 3BZQA 4IUFA 3FM9A 4RW7A 5AM2A 4LFBF 1N32F 1ATNA 2LVWA 3KDOA 3CCMS 1PO6A 5DDQC 2NRVA 2YCHA 1TGOA 2W1BA 2K4HA 1Y64A 1KL9A 9ICXA 2ZBRA 5AKKA 5HHHA 3PX4A 1ICEB 1SJ1A 4KLMA 2O8CA 1NKCA 4LF5F 1Y10A 3HFZB 2L3MA 3BPDA 4DTMA 5HP4A 1L3VA 9ICQA 2MQOA 4DV0K 2EZXA 1RKIA 1YVFA 2XY7A 3I55S 1ZD2P 3UNYA 5MLCQ 1NB7A 1BI4B 1WOOA 2IVMA 1VQKS 3B0YA 3IV6A 4RU2A 4NM2A 4DF8A 2GWJA 4AHRA 3SENA 1B7YB 3ZSRA 4OJ6A 3TZWA 1I94J 1V5VA 5HBMB 4PRFA 4C8OA 3AGRA 3AXKA 4ZP6A 3QGHA 4DOAA 3MM5A 2VICA 4LF9F 3PM9A 3HOSA 2UVVA 5DB9A 2RMLA 5KT7A 2DGQA 1TE2A 3DI6A 1JLGB 1FXLA 1KAZA 4NLCA 5DLFA 2VBZA 4FS2A 1EHWA 2AEJA 4HL9A 4KMUA 3TSPA 5K5MA 5AFUA 1CSJA 2WVFA 3NGKA 5KI6A 4RU9A 3TEHB 3KLVA 2EH9A 3TWZA 4AYBC 2VU5A 3KLHB 4I67A 5ETRA 4DTOA 5AQOA 4I7FB 5AJ3F 3VAKA 4BCAA 3RAQA 1G1XA 1SZPA 4I29A 1TYQA 1JLBB 1NM1A 1L3SA 1YRTA 2KYZA 3M32B 1RT2B 3D7SB 1A9NB 1KC8O 4M8LA 2XI2A 2H1YA 2DHAA 4LY7A 1FJCA 1S1XB 3GPAA 3LOUA 3PJ9A 1QHTA 1ZQLA 4UBBA 1WD6A 5F2RA 4CEFA 1HBUA 1VJWA 4A5AA 1JUDA 4KN4A 4M7YA 2I9SA 4KHRA 4QZGA 1D8LA 2HYIB 2YMMA 3CERA 2GQQA 1Q8LA 2W01A 4H8KA 1U2FA 2CNLB 4DCJB 5JJBA 3BQTA 3GYNA 2V68A 1ZJNA 3KOOA 3M05A 3J7Z5 5KL1B 4CCHA 3J81Y 4H0YB 4ZCIA 2G1HA 5CHIA 4OKKA 4CLKA 3BN7A 2I38A 5ALXA 1LFWA 3AA3A 3P45B 2DWQA 2LQBA 3WU2U 3T5KA 1M5SA 4LFCJ 1JXLA 3RSEB 2RU3A 3CFPA 2BANB 3MM7B 2BOAA 5AXKA 3S3NA 3BZKA 4H54A 2GMJA 4WJBA 1EQ0A 1MWMA 4B3OB 4R65A 3ATUA 1GO3F 2UVUA 4NI2A 4WCEL 3N28A 4DL4A 4BC7A 4HLBA 3RB3A 1SJRA 4UQTA 4CJ4A 1B99A 5E3PA 2W9CA 4K4XA 2NUBA 1LQ9A 2ZIXB 1BUXA 1IBMF 2KT3A 4ZPTR 2BQUA 9ICLA 4QU6A 4LQ3A 2QXLA 3NVYA 1RWVB 4A8FA 4WKYA 1L3TA 1WB9A 4IR1A 3EE8A 4XH5A 5EX5A 3HSZA 1UCVA 4DMNA 4UOFA 5HMZA 4D3HA 3GFXA 2MQ8A 3M8QA 3GG4A 2FBTA 2NZCA 4QZIA 4KLEA 4GVBB 3M9OB 4LF4K 4CEOA 2GGPA 3HO1A 3M5RA 5IZHA 3AGKA 3O08A 5GAHI 4UZBA 4OV6A 5JXSA 4ZA1A 2DH8A 2AX1A 2BABA 3I0RA 2D5RA 2J5AA 2XGQA 2NPFA 1YJ9N 3AODA 1HYVA 5FD1A 3KJQB 4LREA 1LW2B 4AXJA 3H0PA 4XO0A 3ZT1A 1DZ5A 2Z58B 2AEMA 1KLNA 4DV6J 5KFHA 4LVOP 3BH6B 3R27A 3UDCA 2P5OA 4O8UA 3V9UA 3BF4A 2V0NA 4TU8A 1WTBA 1SJ3P 4URQU 3SIPB 3O9SA 1Q7YO 4YR2A 1FDDA 4DS5A 2KNJA 1S77D 2VG6A 2VBYA 3VALA 1CLFA 2K8GA 4IG0A 2NRWA 4FK2A 3LPUA 2R9LA 4KITB 4JLHA 4JI2F 2WAQF 2F8SA 1VQYA 2G5IB 1RBRA 1J5EJ 1DKGD 4DR7F 4O55A 4LF7F 1N52B 4E7JA 1UJ4A 2UVRA 4TUSA 4DV6K 1OH6A 3FMBA 2DFLA 3HJFA 2GC8A 5KFCA 3GFKB 4OFZA 1XR7A 4K4ZA 2JHEA 2F1HA 3QYYA 3NMUA 4Y0FA 2RRNA 4KH0B 3O1LA 5AI6A 1VS3A 5KFFA 1JKHA 2F7TA 1D9FA 1UETA 3MM6B 4QS7A 1EWRA 5HN0A 5F0XA 3EYZA 4TLRA 1L5UA 1S12A 1VRUA 4FNIA 3TUZC 1S5ZA 3OR2A 2OPSB 4K5RA 2OKQA 2A3ZA 3CO0P 4DV0F 5DDYA 2OEJA 3FZ2A 1QQCA 2KN7A 2A6AA 3G0ZA 2XYGB 5IQ6A 2ZHAA 2K3KA 3WUHA 1ZBUA 3IG1B 1FEEA 3E9OA 4PXDA 5KG2A 4R0JA 1Q82T 2ZH7A 3IRXA 4CIOA 2P51A 3AVHA 4CBUA 3DYAB 3ZDBA 4RWXA 4E1NA 1RCXB 5A8KA 1R0AB 1P1LA 4TVAB 1TL1A 4PABA 5FIIA 2QJ3A 3MMCA 1S1UA 4RBTA 2RSQA 3DLEA 5CY4A 4C48A 1NDLA 2RS2A 4USHA 2CPZA 3B4MA 3AA4A 4AD6A 2HVHA 1NGHA 3PHTA 3W61A 5I4MA 1F5SA 4EZ9A 3UN2A 2J76E 2MMYA 1KVCA 4CNZA 3EL2A 2FJAB 5HMMA 2J9DE 1JNRB 3HVWA 3G2XA 1S1TA 2RQMA 1RBOB 1TUYA 1N33K 1GXUA 3WK5A 3CJ8A 4ID5A 2LFVA 2AJFE 2W2PP 9ICOA 1I94F 1S6UA 3ZEUA 1BVSA 3DRSA 3WXMB 4AM7A 3TR5A 3NGTA 4X4QA 3J7AN 1Z1VA 3AVJA 2ASLA 1ZQJA 3M7VA 2XLJA 4LC9B 4ZOHC 4KSEB 1MWYA 4P4OA 3T1AA 3JTNA 2CPIA 3R5DA 2IMOA 4O44B 5IQQA 2DTJA 4DMZA 4I6MB 4GKJJ 5LOQA 4KN7A 3KNGA 3H2VE 4RNOA 4IRKA 3OBIA 2WUSA 3J7ZO 2KIWA 5B8HA 3SUPA 3I1YA 2E6MA 1RHQB 4DQRA 2BMBA 1FRMA 2H5IB 3HLUA 4X2BA 3P3DA 1RHKB 4CZKA 3VQDA 4IC9A 2R7VA 4RBVA 2V8DA 1A77A 4CI6A 5A2QY 4IFYA 2C2RA 4NL9C 4QWDA 4ELVA 5IM0A 1WF2A 3I8DA 2ZIVA 4DR1J 2AXTU 3OYGA 3A13A 3JPRA 3ZDCA 2YB1A 4HR2A 2DISA 4B6JA 4DX5A 1FFSB 2CJ9A 3ASMA 2QX0A 4EAHD 1DARA 4CTAB 5FPEA 2FHJD 4PWDA 2FGCA 3CDUA 4GV3A 4LFCF 4PKIA 2AJ0A 3W5ZA 4NRUA 3TNVA 2G09A 5DZ7A 4OZJA 4FXDA 2OPRA 1Q7LB 1GOBA 2NR0A 4FKYA 4OPAA 1KQQA 4QWCA 2AGQA 2KSOB 4IS7A 4A61A 5KAKA 2WRMA 4JI4J 2N7YA 1C0TA 1RU2A 1MMLA 4F0KA 3SCKE 3G71N 1KFDA 3O5TB 1BGXT 1KVAA 1VQ4S 1MDUB 1UW4A 5KRSA 5AQHA 3PKMA 1WKJA 2GQCA 3DM2B 4P0QB 2DGOA 4WFZA 1RTJA 3OA9A 1J53A 4YVZA 4F2RA 1ZM3A 1SC6A 3NBPA 1PK1B 1V9PA 2KKVA 5DO2A 2GJIA 4QIFA 2F40A 2NSBA 3SLCA 3K5MA 1M1KT 3MAAB 1AB8A 1RT1A 3I31A 3C95A 4GKKJ 3WX8A 4UUXA 2PY5A 1IKWA 1ZBIA 4KBIA 3VHQA 4EUVA 5F3ZA 3SAHA 3OVSA 3K9JA 1RWKB 4KHQA 4BY9C 3TJ8A 5J2BA 4H5TA 1OWXA 4CYUA 4F4AA 6FD1A 3QE9Y 2ZDOA 4L8RB 2ALYB 4C80A 2JL9A 3HXMA 1X4HA 4DG1B 4K4SA 4FOEA 1NH8A 4CZFA 3NLCA 2DRAA 2ZITA 4RW6B 1JIHA 1YJVA 4DV6F 1NKEA 2IM1A 4KLDA 4CO0A 5KG5A 3G6ES 3TANA 1Z26A 1E6VB 1ZD3A 4WE1A 4KFBB 3GV5B 1M1GA 3K2YA 7ICMA 1X42A 2ESEA 2CZ9A 5IIIA 2CZVC 1SV0A 3V7JA 1HR0J 2UU9J 4A62A 4F93B 1JI7A 2R7OA 4ENOA 4N7TA 4OJ3A 4I2JA 3GG0A 4AM6A 2F9JA 4BX9C 1JLCA 1N8RO 2UYTA 1F21A 2DGXA 1Q7YT 5J2CA 3SMVA 1VIOA 5HP1B 1GLLO 2WSFC 3MF5A 1AQ6A 4CEAA 5IIJA 1J5EF 4Q0BA 1SUQB 4HUEA 1HI8A 4QZDA 1HA1A 3UDLA 5AQZA 2OMOA 4WZMA 4LSZB 4OI1A 4ZVPB 2MPUA 2D0OA 2DHXA 2M3DA 4BC4A 4AHSA 4ZVFA 5HHIA 5AQWA 3OHAA 2BPGA 4IZ9A 3KYLA 3EZWA 3V4MA 3DGVA 4BBYA 2KJ9A 8ICEA 2CYYA 2G8KA 4DX8H 3QSIA 1BPXA 3LP3A 5HAOA 2PMZC 3MK6A 2KTQA 2E8PA 2O67A 1TUGB 3GDQA 3LK9A 3CDBA 2YQ1A 4EFHA 2HF3A 1HI0P 4FO6A 1NJZA 2W04A 5J2EA 4Z4HA 2OD6A 4RT3A 2A3JA 2LDIA 1CJKA 1MC8A 1ZTTA 4JMUA 3RMAA 4OZ0A 4NE9C 1EAYC 4RQ2A 3AVFA 4WQ5A 3FBCA 4KO0A 4QIWF 5IT4A 4O3PA 2R18A 1MMNA 4FF3A 1BO5O 1WBDA 4W98A 2V8GA 4B3RJ 1ZA1B 4JD2A 4WCEQ 3G6XA 4I64A 5AQVA 2J6TA 4CF2A 4QS9A 4NLBA 2PO4A 3ILIA 2HBJA 4GO7X 3CCJN 3LZIA 3KUGA 2YKMB 3T7ZA 5EN1A 4QS8A 3KWIA 2HOIA 8ICUA 2GO8A 4X4VA 1KNZA 2EQYA 2O8FB 1WG5A 4CJLA 1WI6A 2H5JB 3UKRA 2QV6A 2ES6A 2UUCJ 2EFPA 3TZYA 4DR5J 5BOLA 1XQIA 3IAYA 4NLZA 3AU6A 4CK3A 1V38A 5D0GA 1D5AA 1X8DA 4KBOA 3FCWA 2D1KA 4C3KA 2ABYA 4O8KA 3CD0A 1XUPO 2LA6A 4K0KK 3OR1A 3AL0B 3C14B 1BCOA 2G0JA 4LFAJ 4FJMA 1U0SA 5BYRA 5AK3A 4JS5A 5DBBA 1DRGA 3I0SA 1NHKL 3L2QA 2PFOA 1T03A 2C2NA 3MPUB 4R25A 1RADB 4B1ZA 4W5OA 4K2JA 1JL2A 3TAGA 4Y2KA 1JJHA 4K8ZA 3QFWA 3KLEA 2ISPA 2OANA 3PYDA 2G0IA 1VQMN 2UUCK 1RM6C 1VQON 2CKWA 4GKJF 4DR5K 1J54A 1LW0B 5M1KA 1VAZA 1U26A 2W6KA 1OH7A 2DNYA 2FPKA 5CQGA 3TR8A 2KN4A 4ES1A 3CTRA 4OI4A 1Z4OA 2XY8A 3P83D 3HP6A 4OLPA 5G4DA 4M9JA 2E5LK 1SI9A 4K4HA 3DXKA 4Z4EA 2YHXA 4LFAK 3AO3A 3M2RB 5A8WB 2Q6CA 2OLWA 2K06A 3SSQA 3MWTA 3J7ZT 3I33A 3MGVA 3ONQA 4QW9A 1IXKA 1RDRA 4KB7A 2XMTA 4FZNA 1PYSB 3CCLN 3OUYB 1N5YA 2RN2A 4OPKA 3TA1A 2Y0SD 4DR1F 3H3NO 2W42A 1LAWA 3WHIA 3QSYB 3J7AP 2SXLA 1IKXB 2D0CA 3DV9A 2ZJ8A 3TU5A 1L7MA 2PA3A 5IINA 2HQ3A 3QGPA 1NK0A 4FYXB 5H1SV 3HVRA 4RKUC 1Q9YA 3MCPA 4O9MA 1OQ6A 2ZC3A 4ZVRB 1XNSA 2N3OA 3MGIA 3QATA 5HRPA 3QRPA 5IWAK 1T6CA 2XEXA 3WBZA 3BSOA 2Z8QA 4DSIA 4FLZA 5EOZA 2FQQB 2VF3A 4A8XA 2EK6A 1UVIA 3TABA 4ZTJA 5E2QA 2W8LA 3M30A 3MOJB 5AZJA 4UAWA 4ILMA 4IO8A 2XNRA 3C6TA 3C46A 2KVQE 1YJNN 1FT8A 4ISGA 3FZBA 3M1VB 4JI0J 1U8SA 1J27A 3LPYA 1VK0A 3OYNA 3P4UB 4DSFA 2P5VA 1LAVA 3H40A 1QQMA 4BHQA 5AKYA 4I7FA 3JAMU 4CJFA 2WAQD 3HVTB 3R8YA 1RAHB 4F36A 2JH1A 3M32A 3TA0A 5AQTA 3FLCO 1IV8A 2KKPA 4MH8A 3MMVA 4AHTA 4A8OA 4P0PB 2E1RA 2BDPA 4GKKF 1RDFA 5E84A 3LA0A 4PHAA 1S1XA 1UP1A 2DNPA 1UPPA 5RUBA 1HKBA 2HS0A 2UZAA 4MYTA 2O5DA 2XZTB 3I87A 3IXQA 1KTVA 2K1RB 3ULHA 4ED2A 1AYEA 4USKA 4FJ8A 3FUYA 4GFJA 2PDAA 3P96A 1NZPA 2GJ2A 3BB5A 1HPZA 1G2EA 1T9WA 2RHSB 5JU5A 2MLZA 4RO0A 2DD8S 2MKYA 4F25A 2DNZA 2YQEA 2OPQB 2RU9A 5HLFB 1WORA 3EUNA 2KXNB 3DLLL 2XMAA 2NUHA 2K89A 4DV2K 3DRRB 2RNEA 4CEEA 4M45A 1DTTB 2DITA 4YXMA 1HYSA 2P5GA 4KKOB 3DXSX 4C8NA 1NGIA 5AQFA 4P2SA 2DNQA 5C42B 4R64A 3RSEA 2D41A 2ADBA 2AGPA 3R8EA 2OYQA 3D6RA 4NLSA 2JV3A 2V5HG 3HRDD 4CGZA 4ZLNA 4XPEA 3MBYA 2O3DA 4LVNP 2ZNZA 4IJNA 1HHQA 4ZJOA 1CXUA 3BM7A 1EETA 2M70A 2QL5B 1CZBA 1M1HA 5A6PA 4PAAA 1N8RT 2WW4A 2ZIXA 2JGUA 2ZUBA 2MHEA 4EHTA 1OY6A 3E9PA 3M6ZA 4NXNJ 3WK7A 2XHCA 4DQPA 5DB7A 1T4GA 1C2PA 3E9LA 3Q86A 4WYLA 2C42A 5AR0A 1WSJA 4MFFA 4Z4CA 4QBUA 2P9GA 4OHVA 4ECSA 1QAIA 4KH5A 4JBCA 4GVBA 2IC3A 1QQ7A 4PHTX 2UV8A 2MXYA 3B8AX 4YDUC 3G10A 2QI2A 3HFVA 1B0VA 1RKJA 2EFQA 4ZK7M 4RPXA 4I2AA 1YT3A 2UUTA 3R1XA 4ECZA 2FHMA 4CEBA 5AKHA 1WN7A 3NNCA 1V97A 3CG7A 1SIWB 3DCAA 5J2MA 1L8LA 3H2LA 4I2HA 4CFAA 1CBKA 2GHWA 5ITHA 4AFFA 4M3WA 1L7PA 5CCMA 4UASA 3KK3B 4E7LA 1RWWB 1F2HA 1WSRA 3JSBA 3O9TA 5ETKA 2GH1A 2D0BA 1N60A 2UXCJ 4F0HA 3TAQA 4I2CA 4B3RF 3RU0A 2PE8A 4H0VB 1S6OA 2DR6A 5IIOA 1Q16B 3M2UB 4DU1A 3MI7X 1VRTA 4G1PA 1Z00B 3MCNA 2HMXA 5M2RA 3Q2SC 3L4BC 2ZWPA 5J0RA 4CZJA 1FD2A 5J1NA 1CI4A 7ICGA 4QZ8A 4ECQA 2A18A 4FZMA 2UUCF 3QBWA 3PEJA 4DR5F 3QU2A 1PYTA 4Y2XA 4ED3A 2BBEA 4DUTA 2HHXA 3RBDA 3OYIA 4TLQA 4DU8A 5KFTA 1ZZNA 3U3YA 1HUZA 2X7IA 3HSGA 2UXCK 2QTWA 4EP5A 4WFNL 4JI7K 3KXDA 3M7DA 8ICHA 3HULA 1L3UA 2P6UA 3HI0A 2HF4A 3MWBA 3ATVA 4RQMA 3QNOA 2K8AA 1ZOTA 4LFAF 5KFVA 4DU7A 1X1PA 5KG4A 1OY8A 3CJ5A 2QA4S 2ROEA 3T6JA 1HWJA 4LH4A 4ED6A 1NU4A 4O3NA 3MGJA 1DURA 5HROA 4JEPA 2R7QA 3VEOA 2DNOA 2Z56B 3UKUA 4F0MA 5KG3A 1LV5A 3LW5C 4IG3B 8RUCA 1RT3B 2DO0A 1IXRA 2O1PA 5K14B 4QAGA 2HLTA 2R7UA 4H5RA 2R4FA 1PC5A 2MB0B 1ZBSA 3R9KA 3R6GB 5KG0A 2BJ8A 2OTJN 3LPTA 2C2KB 4OYWA 5C24A 5CABA 2NRXA 2EAOA 5J0SA 5GAEI 3CETA 2ZD1A 4QZHA 4O4RA 1S59A 1GQEA 2H9ZA 5FJ4A 2N4CA 5KQ8A 3HMJG 4OHZA 1ZQHA 4KGVB 3DYAA 3QU4A 1R0AA 1SJFA 1ZQQA 3NF9A 3PCOB 4E7KA 4ITSA 2Q36A 4FJGA 5J2KA 1Z1BA 3WK8A 2EWHA 3TA2A 4CLWA 4Z6EA 3FSYA 4F71A 2XCPA 3OTBA 3FEXB 2DGUA 4FPBA 1WUUA 3TOQA 3ZD9A 5SZTA 4CD1A 2XWXA 1HKAA 1W7AA 1GMVA 5J2HA 4GVMA 1TELA 3A5OC 2H4WB 2VJVA 2DPIA 2VA2A 4ZCMA 9ICTA 2COLA 2XMVA 3N4WA 4OHYA 3SI6A 2I9GA 2JEFA 4PWWA 3KLFB 3IBCB 2J0XA 3I82A 2N4DA 1AT1B 7ICFA 1X4CA 5B0DA 1HBNA 2VBWA 1BCMA 3O9UA 1NGEA 2CQGA 2B21A 2RAQA 4Y34A 4C97A 4ZMMA 2RIJA 3OYEA 2W9MA 1RAAB 2HOEA 1HWIA 4F7VA 5GAGU 4UAVA 3HF5A 4W5RA 4QWEA 4ZP8A 2JJ4D 2AP1A 1MN7A 9ICUA 1J6ZA 3UVJA 1IG8A 1WF0A 3VQ8A 1RCHA 2DFFA 1HD1A 1ATSA 1FWLA 4UB2A 4J9SA 1C1AA 4WFXA 4JI0F 4IH7A 3EMTA 2IIRA 4I6MA 3LF0A 4EX6A 3RZAA 3UXNA 2QARB 1TKTA 2B6AA 3H5UA 2RILA 3AFGA 1KOHA 4DFPA 3ZX2A 4RT2A 3M6KA 3NVZA 3DRXA 1VQNS 2CJAA 2BJ3A 1VK3A 2QEXN 3TWHA 1UJ5A 2X3GA 5ALWA 1SJ4P 3QIPB 2ZXIA 4DPOA 3CVKA 3DLJA 1OS5A 1G6BA 3NRZA 1RXWA 2ZM6J 1ZAVA 1JJ2M 3HDSA 5FPMA 4GMKA 1WCLA 4PQUB 4JWMA 4AT1B 2FJ6A 4DFMA 1U1OA 1GLBG 1YHQN 4FK4A 3VN5A 1HL6A 3UNGC 1IBLK 1XHZA 1F5AA 1KRPA 1ZBLA 1PSDA 4I2PA 2CH6A 1IG9A 4PPXA 3KBBA 5KFZA 3C65A 3DOKB 2LEAA 5F0UA 5BREA 5I9EB 2E2PA 1ZAXA 3W7BA 3GSDA 4CTAA 4HTLA 4KV8B 2L48A 3UM9A 4HUFA 2B9YA 2AYMA 1NO8A 2C2ZB 4TSXA 5D4BA 1S57A 1RTIA 3I56N 4QIWD 9ICCA 3HD2A 4ZJQA 3D0HE 3LDNA 4ZVOB 4TNOA 4E1JA 4J9NA 8ATCB 2KSOA 3AMZA 4X62J 4M5JA 1Z19A 2GMHA 4Q7AA 1P8GA 1YX2A 5ELZA 4L75A 4HI2A 1H2UX 3RTVA 4O0NA 2B9XA 2MZRA 5ALJA 2CG4A 1YITN 1YRUA 4P0QA 4QZ9A 2ZKTA 3CM6A 3NVKA 2D0PA 5G5HA 3WKAA 3JSMA 1PGZA 5ALRA 2DTUA 3IM9A 5SUHA 3HHLB 3V1QA 1NJWA 4KRWA 7ICNA 2A2DA 2F3JA 5M1FA 4BC2A 3IBPA 2VPZB 5KT5A 3DLBA 7ICPA 3T5LA 4Y2RA 3I55N 3Q8YA 2NXUA 2P2CB 1MG7A 1FDAA 4DOZA 3K1RB 1MN9A 4IQXA 5AI9A 2KVIA 8ICAA 3HKWA 4M5LA 1GLAG 3VA3A 1OKJA 4WIQA 4ZJLA 4RG8A 2IHR1 5IIKA 1BQMB 2BKPA 4OZNA 2IGIA 2K8BB 4CJRA 4YR0A 3O80A 5M1PA 2BXJA 1X31C 2UXCF 4RW6A 3J7YI 3VCBA 4J03A 3VESA 4UB4A 4MFBB 9ATCB 4NLPA 2CZ4A 5BPNA 3BJYA 3QNMA 4BS2A 3CMQA 4QZBA 2A10A 2D3O1 3CXCM 5AQPA 4ZVSB 2LLZA 2MA1A 1Q86T 5CHGA 3OTOJ 1DRZA 2F8KA 1UA1A 2ACMA 1ZM9A 2VJUA 5L8RC 3PKYA 4Y2SA 4FKXA 4KHPJ 2E1AA 4KPCA 3QRRA 1OSCA 2GW8A 4BR4A 3VGUA 4JK9A 1HNXJ 2BKOA 3UW1A 1FWKA 2XICA 3N6NA 3E66A 3B8HA 1UEUA 3F44A 5HRNA 3LP1B 2VHGA 2D8CA 4YFKA 2E2QA 5D4PA 3KFWX 1GMWA 1LWXA 3VAHA 4F4ZA 1VSIA 4CLFA 3MTJA 4CZEA 1F3VA 4FW1A 1C0UB 5G5GA 3BGFA 2IBOA 3OVAA 4Y2VA 4FLWA 3Q83A 1Q5VA 2NXEA 2YNGB 2F9TA 3G4SS 3VEZA 1WEYA 3SR6A 4WBFA 4DV1J 2NQPA 1F5CA 3AARA 2CQ4A 4OYOA 1YKWA 3DLLQ 2B0GA 4LR7A 5CZ1A 3DOMA 4IOBA 1HNXK 4J2EA 4P10A 4RPFA 4DSEA 1FRJA 1YBUA 1UVMA 3R6LB 4V19J 2M8DB 1UOCA 1S48A 3A8EA 3PLAA 1S7HA 3VZIA 4Y3CA 1RU1A 2KXFA 2V4JA 3V9ZA 4C7YA 2XYPB 1ZQZA 3SI8A 3UN5A 4DR2J 3VGLA 4LSLA 2N7CA 1H2VZ 2W2MP 4GMJB 4Y2YA 1KQSR 5KFPA 4RW4B 1G99A 4F5QA 4G9ZA 2I2YA 1C1BB 3N97B 3POTB 1RA6A 4IXCA 2XGPA 5CR4A 4NXMK 4X4SA 3THXA 2L9NA 1NB2A 1VISA 1KFTA 5D3GB 1YJ7A 5T7LB 3VERA 4LSNA 2BW7A 8ICVA 5K20B 4I69A 3M2VA 3V5RA 2KVCA 3QUCA 2QRRA 3BEGB 4WXWA 3H46O 5B0BA 5ALLA 1RYRA 1SQGA 1Y0HA 3FC9A 2AEFA 2J8AA 1N61A 1FFUA 3HRGA 1VHFA 4M94A 5FROA 1H98A 2MKSA 1FCAA 4NEYA 3RG6A 3QBXA 4HEA9 3D2SA 3ZXWA 1TL4A 5HJXA 3VAMA 3G96A 1S0OA 4FYWB 1I39A 3M4XA 2D3UA 4DX6A 4E7IA 2JLEA 2I5JB 4K4VA 1HQUB 4DL3A 3S3MA 4I2GA 3T1YJ 5HVGA 2IHMA 3IR6B 2LU2A 2JX2A 5KL8B 2GIFA 2FDNA 1LKZA 4TUQA 4WKRA 4RL1A 1N34J 1GXLA 2NXNA 4ZITA 3L6QA 3SFGA 5ALKA 2HSEB 1IKVA 2CNNB 1N6QA 1R31A 4KTWA 3NCIA 4M5MA 1LW0A 2XBPA 3KLIA 4L3QA 4ZKAA 2UXDK 3IBWA 4CP5A 5E26A 1L6NA 3F2CA 2MQPA 3CJTA 4LJMA 1T8EA 4MQ3A 1AA1B 3M8RA 3AQPA 1HNWJ 4WFBL 1RDUA 3C28A 4O5FA 2VQFK 3ICXA 4U6PA 2A42A 1WWHA 3OYFA 3ISBA 1UFKA 3AVNA 1IM6A 5DS7A 5A8WA 4BRCA 3ICLA 2ZM6F 2NRRA 4RUCA 4NCAA 1C7YA 4W92B 1VQPS 3E51A 3T1HK 3O8WA 5J29A 2ROPA 3AVAA 4WFNQ 3OUYA 4CK2A 4FLTA 2EKNA 3WQUA 3Q0AA 2OCEA 1GT8A 4HH1A 4B1WB 1RXVA 5HRRA 5KFMA 2JWLA 1YK9A 2LQ8A 3U7JA 3OHRA 4OLOA 1HUXA 1IKXA 1U1NA 2CNOB 4RW9B 1NPPA 2MJNA 2WVCA 1HNWK 4WQ4C 1C0GA 4JI3J 1RDCA 3IDWA 2VPYB 2F1FA 3LGNA 4UT4A 3VA0A 4X65K 2VANA 3Q8UA 4U7UK 2PMZF 2VG5B 3AO5A 4MF8A 3SCXA 4OCZA 2KDOA 2HHHK 3GJQB 4HACB 2VZ9A 4FWQA 4DHVA 3BKTA 4N77A 3DN9A 4PZVA 2E66A 5H2FU 1PVQA 3VCDA 2ETJA 3JSYA 2CGLA 2RKIB 3ORYA 3SQ4A 1Z6RA 4KH1B 1YG0A 3NS6A 5KFOA 2W9AA 3L7PA 4YMMA 2AHOB 3M1VA 2HHUA 3P5BP 3PIPL 2VDHA 2RF2B 2VOPA 4N8NA 2ZJQL 3V4IA 5I3UB 3CCQS 1Q3VA 4W5QA 1RHJB 2DT9A 2DFEA 2ASMA 3H98A 4Y1DA 2XM3A 2V69A 5JUMA 5BR8K 4FYYB 3ALYA 3UWTA 3AM9A 3T3FA 4P0PA 2HNDA 2IM0A 1NDKA 2LMIA 1NGBA 1OMSA 1U4BA 4YXJA 1TMMA 1VOMA 4IFVB 4NEZA 4CH0S 2CQCA 5T7BA 3PVXA 4FPIA 4CZCA 4XEIA 1N4LA 1BU6O 4WYBA 3ZSVA 2IFXA 5BN9A 3THYA 5L1IA 1ZQEA 3BYRA 4UOCA 2KQ2A 3CJAA 1S9GA 4M47A 4DU4A 4BGBA 3ZZRA 4G1IA 4JKGB 5CD4A 1FESA 1VJQA 8ICOA 2QWQA 3TJAA 4S0MA 5B0CA 4DV5K 4B3TJ 2LXIA 3C6UB 2YB4A 4PPDA 4IEIA 4EBCA 3MUTP 2BE7D 4BRDA 2DGVA 1QAXA 4U7BA 8ICCA 1J5OB 5HVHA 1CUKA 1EXNA 2YKNB 1SL0A 5C42A 4JI6J 3US5A 2C22A 3SAGA 2CUYA 2HHTA 4KQZA 3PJXA 3F9MA 3SEOA 3RVCA 4YP3A 3OJSA 1F9EB 1OYDA 2NSCA 2P9EA 4FM0A 4R8UA 1RILA 1OIAA 2PMWA 3SSRA 1MLAA 4QIGA 1DQ8A 1HNXF 3BN4A 1TL5A 2DRBA 2KHOA 4YORA 3SBGA 5EY4A 2GCFA 4MAKA 4HI1A 4P2MA 4L6V3 1NNDA 1RTDB 3KHRA 4B3MJ 2B7CB 3DU5A 3EDRB 4K4UA 2LCWA 5J0UA 4AHUA 4ECTA 4Q2LA 3H5XA 2J0QD 1Z1ZA 3DXBA 1A5VA 2VG7B 4NLGA 2ZQBA 4CJ5A 3B4DA 3KWMA 2GA7A 2ILZA 4BC3A 1K0TA 3CC7S 3ENQA 1JLEB 2R7XA 5DDMA 8ICJA 2YY6A 4DV1F 2IVFB 3F2KA 4RW7B 4KGZB 2QA1A 5B7WA 3NWGA 2H3EB 3G82A 5AE2A 1S22A 4NLWA 3ID8A 1LOUA 4TURA 1D3WA 5IC6B 1H1VA 3KG0A 2F9DA 4B3MK 2XZWA 3I6PA 4TKTA 4MTPA 3RRHA 4E8UA 3T6BA 5GIPA 4DV7J 2DO4A 4DR2F 3VQEA 4FCYA 1N48A 5LL6d 3EO3A 5J2PB 4I27A 5KTQA 3N7SC 3LDQA 1KVJA 1VCTA 1ZQMA 5HO4A 2KG0A 2OSRA 4LIWA 1JXBA 1WNSA 1R3NA 1KD1O 3GJRB 3IMQJ 4KX3A 2Y0SC 1YVUA 4KLHA 1X4BA 5J0PA 2HGNA 2QWOA 2RDIA 1HEKA 4ED0A 4JK7A 3NVWA 4CGIA 3CJKA 2Y1RI 3B6BA 3QRQA 1XSLA 4OI0A 3MM5B 4NLDA 2EXUA 3HI9A 3I9V9 2ZTDA 4H0XB 1VQLS 2UXDF 3DI6B 1U0HB 5ETPA 4UBCA 2N3LA 3CJQA 2AJ2A 2BACA 4EFAC 4P52A 1Q81T 2CDQA 2FD2A 5AI0A 5FDLA