1X6IA

Crystal structure of ygfy from escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ygfY
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6iA00
1PUZA 1X6JA 2LM4A 1X6IA 2JR5A
chains in the Genus database with same CATH superfamily
3WK4A 3UMCA 1KW4A 4UB2A 2WAQC 3PY8A 1SWWA 5J2CA 3ZDEA 1ZD5A 2IHNA 2DGZA 1UT8A 3C2KA 1JRPA 2GH1A 5F9LA 2HMXA 1T3NA 3JPOA 1S10A 4RUAA 3M9NB 1RYUA 4PZOA 4IRKA 1KRPA 1QQ6A 5ALGA 3H4DA 5HHHA 4ED3A 4DL3A 2VJ4A 4QJFB 4RNOA 5DLGA 3TACB 4F91B 4QWAA 7ICIA 2FLNA 4YVZA 1ZQGA 5DDYA 4OD0A 1ZQIA 1PUZA 1SGGA 5KFFA 2QARA 5CHGA 4P4MA 1L3TA 1NK7A 2DQNB 1S9FA 2KKVA 4DLEA 4F71A 3ETRA 1L8OA 3TANA 4PL1A 3M7DA 3AU2A 4Y2XA 1ZD4A 3HX0A 4DFMA 2ZIUA 3MDCA 5BOLA 2KHVA 1D8BA 2FLPA 1BPBA 1WCNA 2B6GA 5KG6A 2DF4B 4Z6DA 4PHEA 5KFHA 2K4IA 2AGPA 1C20A 3NGDA 3V72A 1D9DA 4QNLA 2PMZF 2NRVA 1L8LA 2JHDA 2WF8A 4EYHB 2KZZA 3K75D 1KFSA 4I28A 5EE3A 1RPLA 1Q8KA 3RJJA 4Z6CA 2JH7A 2W7OA 1TKDA 4P0PB 1F44A 5KG0A 2FMQA 3BZCA 5ALVA 2KEYA 4DSEA 4QWEA 3KHGA 9ICAA 2ZIWA 4NLNA 4BDPA 4TURA 2W8LA 4QWDA 4JV2A 1L3VA 4QZFA 3LWLA 3C2LA 4I2HA 4J9PA 2PKEA 4NV0A 4ED8A 2KVCA 2KG5A 2OH2A 2C2EA 3N97B 5L1JA 5ALQA 4EZ6A 8ICYA 3PW2A 2MA1A 4YG2A 2LI6A 4F4KA 3KBBA 1FIQA 4DQRA 8ICSA 2BQ3A 5DBBA 2JEFA 4DS4A 1OUQA 4KMOB 4EBDA 2XGQA 3UM9A 4Q8FA 3MFHA 1ZRMA 3J81j 2HOQA 4UAZA 1DRGA 4Y2VA 5AM0A 2HW3A 1A0PA 3HJEA 2R8KA 4KLTA 5EE1A 3E2EA 3AUOA 3QYPA 3PSPA 3D2QA 1YZ7A 4YP3A 2CRXA 1T94A 3PX4A 5AK6A 1BGXT 4QZAA 2OYYA 2EAPA 2KJ8A 2KNJA 4CRXA 2QARB 4J9NA 2E3TA 1ZQMA 3HP6A 3CRXA 2DPJA 2FE9A 3G6XA 4DEZA 1UA1A 4BJQA 4OJ5A 2J6SA 3RFAA 3AL0B 2Y9UA 5EE0A 2E8OA 3RTVA 8ICKA 3QUTA 5CJ7A 3GV5B 4M47A 4I2JA 3ZDBA 3BZKA 3PW0A 3N4MB 1RQLA 1Z4OA 4RQ6A 5BOMA 4IQVA 2XY7A 3N7SC 5K4LA 3ONNA 5G5GA 1ZQNA 1A76A 2V9WA 1X9XA 1F5SA 2QKQA 2FMPA 2C22A 4MFAA 3Q8PB 1IG6A 2Q4TA 1NK0A 1ZXIA 2XVTA 4ED6A 1X40A 4DFPA 4FBTA 3IV6A 3GZFA 5HP4A 2NRXA 2LM1A 3NVZA 3BQ0A 1U47A 2BQUA 2HBLA 4F5QA 5KG4A 3Q8RB 3UXNA 1RZTA 4IQUA 5HR7A 3T5JA 1URJA 3MGHA 4YQWA 2FPKA 3RJGA 4YMMA 1JROA 2J6UA 4IR9A 5DG7A 4CF5A 4KLUA 4UB4A 1ZQXA 9ICJA 2KIWA 1TE2A 1KDHA 2HHSA 4BXOB 9ICCA 2DPIA 2KZ3A 4QZGA 2KE7A 2LKYA 5KFOA 3QU5A 1SZHA 1UA0A 1U9LA 3KKAA 5J0YA 4ELVA 1ECWA 1UQVA 3ISBA 2YTUA 2FJ6A 2WB1F 3M6KA 2VA2A 9ICTA 1ZD2P 4FO6A 2RDIA 3C21A 2KFZA 4HYKA 2DWQA 2EAMA 2G0AA 4O5EA 5HMMA 4F5OA 1Z1BA 4DF8A 1QSYA 1N62A 1AROP 2JV3A 4Z6FA 2E8MA 1X42A 5JRTA 5KG1A 5J0WA 2W9MA 3PX6A 3WK8A 3M9OB 4KLGA 3NVYA 4WJ3B 8ICXA 2H3IA 2E8NA 4DFJA 4R63A 3D6JA 2E1EA 5EOZA 3JPSA 1B4FA 3QUBA 1DK2A 3A0BU 5J2JA 4J9RA 4RNNA 4TUQA 3TFRA 5J0XA 3TADC 2ZIXB 1S0NA 1KL9A 3RH6A 2EZXA 1H38A 3H8SA 1MQ3A 4M9GA 1V85A 2YMQA 3L3FX 5KG3A 2HHXA 3GFKB 3BQ7A 4MFCA 4NM2A 1RYSA 3V6HA 5ALNA 3QU7A 4M9NA 2AHOB 3RRGA 8ICRA 3H8MA 4Y2YA 3TARA 3BS7A 5KFXA 5A0LA 9ICKA 3S6JA 4FS2A 4JB3A 3HILA 4JK1A 5AI6A 4RQ7A 1V9PA 1K1QA 3C5GA 1KN5A 1ZOLA 4ECZA 3RH5A 1ZQFA 2W43A 1T4GA 1RG6A 3QZ8A 4DO9A 2Y1JA 4M9LA 4F2RA 2JZBB 2ZTCA 4C8MA 2F8KA 3OTQA 2NO5A 2ZG6A 2AQ0A 1IIPA 4OCZA 4R66A 1KBUA 1ZD3A 5J0TA 1FFUA 5GTHU 1NKBA 3V7KA 4I29A 5CP2A 1ED1A 3Q8LA 3H40A 4NLBA 2JEIA 3IN5A 4F4XA 1X6IA 3PR5B 4RU9A 4F5RA 3GIIA 4O3MA 2HSZA 2EQYA 9ICXA 1XO0A 4UB1A 4DL7A 1MA7A 2W04A 4BGDA 1S76D 4ACOA 1D8LA 4AP9A 7ICOA 7ICNA 4OJ6A 2HDOA 2GO7A 1NK6A 3AQFA 2ES6A 1KQQA 4IL6U 3IRUA 1N56A 2P6UA 3QEAZ 1N5XA 2E1FA 1S0MA 1QCKA 2OCEA 2DBYA 4RQ1A 4FZMA 5HMLA 4Y2PA 3SMVA 1NKCA 1FEZA 3RF9A 5AK5A 1VDVA 2QB1A 1NK8A 5T14A 3HW8A 1D8YA 4I2DA 1KEJA 4K4HA 2DKXA 4ED2A 4UQGA 1N60A 1L5UA 3ZD8A 5JU5A 5KG2A 4KLEA 1PK1B 5AM1A 2BPGA 3BS5A 4MF8A 2ZJAA 2G5HB 2ZUBA 1UPHA 2YN4A 3R9KA 1SV0A 7ICLA 1KFTA 2XGPA 1SL0A 1BPZA 1XNSA 4R65A 4ED7A 3EYZA 4CF3A 4F8RA 4UW9A 2G08A 1MN8A 1X2IA 5ALTA 4RT2A 3WK5A 4KLLA 3UMGA 3M9MB 3BQ2A 3Q8MA 5KFMA 2UVVA 4RZRA 1PVRA 5DQIA 3EPGA 2ZTDA 5EWGA 4J9SA 5DQHA 9ICFA 5J2DA 4YXJA 3OJUA 4PZNA 1ZYQA 8ICTA 2XCAA 4Z6EA 2UVUA 8ICPA 4TUPA 3PX0A 1B0XA 1X66A 1X6JA 3HT3A 1L7OA 5J8YA 3IDWA 3GIMA 4B9SA 1KTQA 3LWMA 3RJHA 9ICQA 2OHFA 4YMNA 2LYBA 3PW7A 5ALMA 1SKWA 3TAQA 1ZQBA 5J2HA 5ALRA 3H0MB 2W55A 4DSKA 1U48A 4EBEA 4NLKA 3HPOA 4XRHA 4DWIA 1DGSA 4C4TA 1ZQCA 1N61A 7ICMA 4C4SA 4IC9A 1ZQSA 3K4GA 1NJWA 4AYBF 1ZQYA 4UBCA 1KKXA 3BQ1A 3PNCA 1NZBA 5E79U 1XWLA 1BPEA 1N63A 5KFRA 3KHHA 2IMWP 9ICNA 1YT3A 3JPPA 2F77X 3RJFA 1BVSA 3GQCA 4KLSA 5AKGA 3QZ7A 1TK5A 1ZQ1C 1FO4A 9ICWA 4P0QB 4G9BA 2IA6A 3MABA 4R8UB 3FYHA 3MGVA 4DL6A 2KD1A 2W3RA 5D4BA 5KT5A 3F5AA 4Y2RA 5H2FU 2FMSA 4A8EA 2YY6A 4NXZA 3V6KA 1J2MA 1QLNA 3BS5B 2IHMA 3GV8B 1JXLA 4NLZA 1ZQVA 5J2GA 4I2GA 4YR3A 3IG5A 5KFSA 2JR5A 1NOMA 4K4IA 4I2AA 4KN7A 2WAQF 3CP8A 3PW5A 4DSJA 3M1YA 3GDXA 2BHNA 4J9KA 4M2YA 2HHWA 4GFJA 3L5KA 3V7LA 2I9GA 1S8OA 1QQ7A 3ISDA 4ECRA 1SIJA 3T79A 1O03A 4ECUA 1DK3A 4PL2A 4I2EA 5ALKA 3PSTA 3MR6A 2ZXIA 2BKEA 2ISPA 4UB3A 1V38A 2H3FA 4JWNA 4KTQA 2WFAA 1XSNA 4JV1A 2WF5A 2A1JB 3C2MA 2KSOA 3E0FA 4RPXA 1HUOA 4RQ3A 4F3OA 2RRDA 3SYZA 2V4QA 1NJZA 2VIXA 3ZDAA 8ICVA 9ICGA 1M6YA 1WWVA 1JALA 4IR1A 4BXOA 5AKZA 9ICMA 4RQ8A 2HBMA 1TFRA 5CB1A 2PFPA 4I2BA 2KZMA 4R64A 1JN3A 4ECTA 5KFTA 4O5CA 4Q8EA 3O0FA 2H3QA 3ETLA 4QZ9A 1TVAA 2Y1IA 3RB0A 3KZXA 1SKSA 8ICCA 5KFGA 5D49A 4UASA 5IIJA 4ZOHC 4QWBA 2MAXA 1ZQQA 3RAQA 3H0RB 4DQIA 4BX9C 5AKLA 3OGUA 4BWMA 2IOHA 3UXPA 3RB4A 1Z4NA 3ZDDA 4BWJA 4F5NA 1HIWA 4C8NA 3EW9A 1L7PA 3NTUA 2HHTA 3RAXA 8ICLA 4UB6U 3T5LA 3NASA 3SR6A 1O08A 3D2NA 5AKIA 1F0MA 2K8AA 5TZVA 3HKZC 5KFUA 1SL1A 2C2RA 1XU4A 3PZPA 2NRTA 1NI3A 4Y2JA 1P7DA 2FDRA 3ED5A 3VC8A 4FZNA 1D9FA 2IOFK 4YR2A 2ZIXA 2K4HA 2NRWA 5L9XA 3BJYA 1ZQAA 2I5HA 5L1LA 5KFJA 3QUQA 3H8WA 2K4EA 2WB1C 5EWEA 4MEXA 3TQ1A 2KIVA 2OXOA 4JUZA 5DKWA 5AI5A 3ALRA 4EELA 1XO1A 3Q8KA 2I1QA 3SZ2A 4Q43A 1BPDA 1HJPA 2YMLA 1CRXA 1LV5A 2ASJA 3WU2U 4DOBA 4F4WA 2HOIA 4YD1A 5KFZA 2LMRA 3B9JA 2F1JA 2EAOA 4M0AA 4ELTA 4RT3A 3RB6A 5KAIU 4B9NA 2KJ9A 2E8PA 2JZBA 4YD2A 5DDMA 4NWIA 2KSOB 3PMNA 1B43A 1X9SA 2PFQA 7ICSA 3EUB2 3CW2C 2ZIVB 2BCSA 5ALZA 1RXWA 2K8BB 4C8OA 3T5HA 3CNHA 5AM3A 4XQ8A 3EZ5A 2RDJA 1NK5A 8ICMA 1UHUA 2M9NA 5IIOA 4PHAA 1RDFA 4UB5A 2V4RA 2K60A 5CR0A 1MQ2A 3RBEA 2Y0SC 3QU4A 1QTMA 2F44A 3C1YA 2LBOA 3WKEA 2JGAA 3F2CA 3IP4B 5KFQA 1S77D 3LYSA 2CN1A 5ALOA 1KLNA 2KN7A 2MUTB 8ICUA 2RLTA 4M6WA 4F93B 5KFYA 1SL2A 3OPXA 3GU3A 5DG8A 3N7PD 2ASDA 3WKDA 5F9NA 2I6XA 4J9MA 2VKQA 1LVHA 2H5XA 5AM4A 5CA7A 3BDPA 1HUZA 2A3VA 5KTQA 4C0ZA 4TQSA 2FI1A 5ALDA 4GC7A 4FBUA 3V6JA 4RUCA 5ALEA 2LHTA 2C28A 3IHQB 4GIBA 4OJOA 9ICVA 3IM1A 4OJPA 4DOCA 1PK1A 1X9MA 2AH5A 4UBBA 2A1AA 1OXJA 4OO1J 5EE9A 1DXSA 5DB9A 7ICVA 1JI7A 1WCLA 3SENA 7ICQA 4J9LA 4UAWA 5AKKA 3OHAA 2FPLA 1S0VA 9ICRA 2AU0A 5KFWA 4M9HA 3I1YA 3UQ2A 1MSWD 1EXNA 2KP7A 5AKXA 3KZIU 1XS9D 1Q3VA 2D3DA 2BR0A 2HBKA 3LVWA 3UMBA 5J2BA 2YB1A 3MFIA 1HEKA 3JPQA 2W3SA 4B9UA 1ZQHA 3PMLA 4KX5A 5L1IA 2UVRA 3AEVA 1SXDA 4RQNA 3RH4A 3ISCA 2BQRA 2Q0ZX 1A6SA 2YX8A 2YMMA 5AM2A 2F76X 4J03A 5CEHA 2BGWA 5KFIA 3LDAA 8ICIA 9ICSA 5HNKA 1NZPA 1RYRA 1SZPA 3B0XA 5AKHA 1S0OA 4NL9A 3NRWA 3AMZA 3ICXA 1J2NA 1NNLA 3B0YA 1WG8A 2N1RA 3WKAA 1U45A 1N2XA 4ZH4A 2R8JA 3AQEA 2EDUA 1SKRA 5IIIA 1NKEA 4I2IA 8ICAA 2RHFA 3MR3A 1Q46A 4BUGA 2BDPA 2AGOA 1COKA 3KOOA 4M6WB 2W9BB 2P35A 5AI4A 2ZJ8A 1LKYA 3EWAA 2KK0A 4NM1A 2W54A 4FS1A 2UVWA 2J6TA 5DQGA 4RNMA 2XICA 4PJ0U 4GXJA 1BNPA 1S5LU 4MHVA 4YXMA 5J0QA 1VLBA 2BCRA 1ZQLA 2QB0A 5DLFA 4CF4A 4E0DA 1K5OA 4P0QA 3SAFA 2WTFA 2LYHA 4FZLA 4US9A 5JTIA 5ALHA 9ICOA 5J0OA 4R8UA 4EENA 4DOAA 4KLDA 3U26A 1L3UA 2H3VA 3F2DA 5B66U 5AI9A 1Y88A 4KX3A 2OM6A 1Z1VA 8ICBA 3UPQA 4NLGA 5IIMA 2AQ4A 3TFSA 5J2KA 4UAYA 2DFLA 1Z19A 2BDUA 4M9JA 3SAGA 2BCQA 5KL8B 9ICEA 5AK3A 4JMUA 4IRCA 3PV8A 1ZRNA 3PVXA 3SD7A 2ZJ5A 3Q8SB 3RJEA 4HAIA 2AJQA 3OHBA 4C7YA 3ZD9A 4B9VA 1BPYA 4AYBC 4QIWF 5ALSA 5GTIU 4RQ0A 1JX4A 4RPYA 3L4PA 2NV3A 5KT4A 4O3NA 3WKBA 4KLFA 5B5EU 3KTQA 4JV0A 1QSSA 4F92B 3SAHA 3NVVA 4F72A 4DL4A 4O3RA 3C1ZA 2FLLA 4XA5A 4PHDA 5DG9A 4Q44A 2A1JA 2D8CA 1ZQJA 2DKZA 2IOFA 3WK7A 3CYMA 5KT2A 4KLOA 4C7ZA 1TAQA 3AN1A 4OJLA 3OSNA 5ALJA 1L7MA 5C5JA 5ALUA 5ALLA 4C80A 2E5SA 1SV4A 1U49A 2PMZC 4DFKA 4ECSA 2ZTEA 1LKYB 3TAPA 4B9MA 5ALIA 1CEZA 7ICRA 2W9CB 2PXIA 2KFNA 8ICGA 1SV0C 1FFVA 4EX7A 8ICFA 2QB0B 4QZDA 4O3QA 9ICIA 2WF7A 2JH1A 5AIAA 2R8HA 1TAMA 5IINA 5ALXA 5G5HA 7ICTA 3EPIA 5J0SA 1BPXA 4EZ9A 5AKYA 1JMSA 1Z00B 3C28A 2YQEA 3K1RB 4X5VA 2ESEA 2LM4A 4J9OA 4B6JA 3H7IA 3H4BA 2W7PA 2B0CA 4O5KA 4DQSA 5KFAA 4XUSA 7ICGA 1IV8A 4B9LA 2F1HA 4FE3A 3QXGA 4RQ4A 2XI9A 1QSLA 4Y2TA 1QQ5A 2PI4A 2D6FC 1K1SA 5ALPA 5J8YC 2BZFA 5DB7A 2W8KA 4CE6A 1RXVA 1PVQA 9ICHA 3KFUF 4ECQA 3MGIA 3N7RC 2FPMA 5KFDA 5AM5A 2R8GA 2NO4A 4QW9A 1IM4A 4EEYA 1KFDA 2ATLA 2PFOA 3K1ZA 2WHEA 1L3SA 1TK0A 1ZQPA 4YCXA 3RR7A 5AK4A 4KLHA 1PVPA 4F4YA 5F3XB 3C23A 1TV9A 2Y9TA 3PSIA 5KFEA 3SEIA 2O6KA 2KICA 4O3PA 2BPCA 1NK4A 2A19A 3TI0A 4CDGA 4CNQA 3PW4A 2DL0A 2OEHA 1LB2B 2BCUA 1DGJA 4GLXA 4CCHA 8ICQA 5KFNA 3RJIA 4DQQA 4KLQA 4RPZA 4UAVA 2ZIVA 5J29A 2RP5A 4KLIA 2HHVA 2GWSA 4ECYA 5DBCA 1J97A 2ISOA 2ALZA 2EH9A 4PPXA 2K4PA 1AQ6A 4O0IA 8ICWA 3FDSA 2EZYA 5AKEA 1XSLA 7ICUA 1B22A 2K8CB 2KV2A 4I27A 4O3SA 2XC9A 1BNOA 2F1IA 5CRXA 4ED0A 2R8IA 1JUDA 4Y2UA 4RQ5A 2MUTA 3QU2A 4GXKA 1XC9A 1T7PA 1JXEA 3FC4A 7ICHA 2VJ5A 4KN4A 5HR6A 5JUMA 5KL1B 2BCVA 4KMUA 1Z3EB 2R18A 4EX6A 1UCVA 4YMOA 3OJSA 4DS5A 2HVIA 1RQNA 5KT3A 8ICOA 3DV9A 1WUDA 4NJ8A 2PFNA 3QUCA 2B21A 2XY5A 2CPRA 2F3NA 4Y2QA 2H3ZA 3PO4A 5FP0A 1YZ6A 4YN4A 2G5IB 3AU6A 4J9QA 4KLMA 1ZJMA 4DL2A 2ZIUB 3A0HU 2HVHA 4ECVA 2CXYA 5IILA 4EBCA 5DB6A 7ICKA 2F2AB 4F4ZA 1TAUA 1CI4A 2W11A 8ICJA 4PH5A 5J0UA 1N5WA 2NRZA 5J2AA 3ZI4A 3M8RA 2W9AA 2GLEA 2VA8A 4I2FA 2WF6A 4NY8A 2XO7A 2KTQA 4ECWA 1ZQDA 4G3IA 3ORYA 3AM9A 1CUKA 4YFKA 3JPNA 2ZIWB 3GIKA 1V97A 3G6VA 4LVSA 2ZUDA 1T8EA 4CGZA 2HCFA 1ZQOA 2HOFA 4P4PA 3WKCA 3C29A 2RQ5A 4YR0A 3TADA 4IQTA 5KAFU 5IIKA 3RJKA 2Z7JA 3KHLA 2WF9A 4DCCA 3HKZF 4MFFA 4O3OA 1SB3C 4NLCA 1N48A 2IBKA 4ELUA 2KHQA 4DSFA 2K89A 3QU9A 9ICPA 2JMGA 4QZHA 2VANA 4F50A 2W9BA 3Q8QB 5KG7A 4QZBA 4MF2A 3GILA 2P6RA 2G06A 1T3QA 2XCPA 3FM9A 3C5FA 2P66A 4IQWA 3RRHA 2ASLA 3F2BA 4C4RA 3SQIA 3MC1A 4F2SA 3T5KA 5KFLA 1A77A 1SXEA 4RQ2A 2AGQA 3DEEA 3WK9A 3HRDD 4LJXA 5KT7A 1ZQUA 9ICUA 1U4BA 2HBJA 2HHUA 5DBAA 4GXIA 3SV3A 3QE9Y 4Q45A 5J2IA 2ZUCA 2QLTA 5BPCA 3QNMA 1SWVA 3V7JA 3G6YA 3FAHA 4UB8U 1PZNA 3SV4A 4C8KA 1COOA 1Q3UA 3RBDA 3RB3A 1ZQRA 1XSPA 7ICPA 8ICHA 4K4GA 3NVWA 1NJYA 2JXJA 2KMDA 2G07A 4M04A 2Y0SF 1WWUA 1JIHA 3KKAC 5AI8A 4QZ8A 5J0PA 1ZQEA 3LK9A 3NUQA 3HWTA 1ZQKA 9ICBA 2LPEA 3E58A 1S97A 8ICEA 4QWCA 1VJ5A 5KT6A 1DOQA 2W03A 7ICJA 3M8SA 4DL5A 3RR8A 2C2DA 1IXRA 4DLGA 5AHXA 4I2CA 4EYIB 1MC8A 4TUSA 7ICEA 8ICNA 3F5EA 4UARA 3PR4A 5KNIA 3KHRA 5J0RA 4Y2SA 4KLJA 2DUYA 1KSPA 2KVSA 4QZIA 3JPTA 2EZZA 5AKJA 4LZDA 3QEBZ 4C8LA 2L5YA 5D46A 3H8JA 1UT5A 5KG5A 1QH9A 2KKPA 2ZXHA 3GV7B 4QZCA 4PGQA 4US8A 3M6ZA 4QZEA 3T3FA 4DSIA 2GOLA 2MU2A 2JRZA 4GC6A 4QIWC 4PGXA 2XY6A 4LZGA 5KFBA 2XIDA 2W9CA 3GIJA 4USAA 3KD3A 2OWOA 5KFVA 2NYVA 2MRLA 2F8LA 3NS1A 3TKAA 5KFCA 3F53A 1ZQTA 3MDAA 5KFPA 2JEGA 5CWRA 1GO3F 1PK3A 3H0LB 4PGYA 4P2HA 3I28A 2MSNA 5TISU 1RM6C 1Z00A 2HHQA 1X9WA 5KFKA 1OW5A 2YB4A 4F5PA 5AI0A 3SI8A 7ICFA 5C0YA 4UATA 4ED1A 3UQ0A 4IRDA 5EWFA 2M0NA 2VA3A 3MR2A 3JPRA 2BPFA 1WYGA 2LYAA 4FFDA 4JWMA 2YMPA 4P4OA 4ICAA 4MEYA 4B9TA 8ICZA 3WK6A 5ALWA 3DDHA 2JEJA 3MR5A 4IS7A 4UAUA 1NK9A 1L7NA 3PSFA 5J2FA 2ODGA 3MBYA 3NRZA 1NJXA 3N28A 5ALYA 2HI0A 5AIBA 3PO5A 5ALFA 4NL9C 3IG8A 2AXTU 4DQPA 4O9MA 3I76A 4ECXA 4EEKA 3LVVA 4DSLA 3UXOA 2KJ5A 3ZDCA 1C7YA 2KOBA 3BQTA 3VCBA 5L1MA 4U7CA 1ZQZA 2EANA 4P0PA 1TK8A 2G09A 1ZETA 5HHIA 4TQRA 4RQMA 4QW8A 4U6PA 3OSPA 4DFDA 5DGAA 1ZJNA 5AICA 1ZQWA 1L6NA 5DB8A 3QX7A 9ICLA 4DF4A 5DGBA 2PI5A 3D2SA 4KITB 5J2EA 4PHPA 3THVA 5L1KA
chains in the Genus database with same CATH topology
1PUZA 1X6JA 2LM4A 1X6IA 2JR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUZ A;  1X6J A;  2LM4 A;  1X6I A;  2JR5 A; 
#chains in the Genus database with same CATH topology
 3WK4 A;  3UMC A;  1KW4 A;  4UB2 A;  2WAQ C;  3PY8 A;  1SWW A;  5J2C A;  3ZDE A;  1ZD5 A;  2IHN A;  2DGZ A;  1UT8 A;  3C2K A;  1JRP A;  2GH1 A;  5F9L A;  2HMX A;  1T3N A;  3JPO A;  1S10 A;  4RUA A;  3M9N B;  1RYU A;  4PZO A;  4IRK A;  1KRP A;  1QQ6 A;  5ALG A;  3H4D A;  5HHH A;  4ED3 A;  4DL3 A;  2VJ4 A;  4QJF B;  4RNO A;  5DLG A;  3TAC B;  4F91 B;  4QWA A;  7ICI A;  2FLN A;  4YVZ A;  1ZQG A;  5DDY A;  4OD0 A;  1ZQI A;  1PUZ A;  1SGG A;  5KFF A;  2QAR A;  5CHG A;  4P4M A;  1L3T A;  1NK7 A;  2DQN B;  1S9F A;  2KKV A;  4DLE A;  4F71 A;  3ETR A;  1L8O A;  3TAN A;  4PL1 A;  3M7D A;  3AU2 A;  4Y2X A;  1ZD4 A;  3HX0 A;  4DFM A;  2ZIU A;  3MDC A;  5BOL A;  2KHV A;  1D8B A;  2FLP A;  1BPB A;  1WCN A;  2B6G A;  5KG6 A;  2DF4 B;  4Z6D A;  4PHE A;  5KFH A;  2K4I A;  2AGP A;  1C20 A;  3NGD A;  3V72 A;  1D9D A;  4QNL A;  2PMZ F;  2NRV A;  1L8L A;  2JHD A;  2WF8 A;  4EYH B;  2KZZ A;  3K75 D;  1KFS A;  4I28 A;  5EE3 A;  1RPL A;  1Q8K A;  3RJJ A;  4Z6C A;  2JH7 A;  2W7O A;  1TKD A;  4P0P B;  1F44 A;  5KG0 A;  2FMQ A;  3BZC A;  5ALV A;  2KEY A;  4DSE A;  4QWE A;  3KHG A;  9ICA A;  2ZIW A;  4NLN A;  4BDP A;  4TUR A;  2W8L A;  4QWD A;  4JV2 A;  1L3V A;  4QZF A;  3LWL A;  3C2L A;  4I2H A;  4J9P A;  2PKE A;  4NV0 A;  4ED8 A;  2KVC A;  2KG5 A;  2OH2 A;  2C2E A;  3N97 B;  5L1J A;  5ALQ A;  4EZ6 A;  8ICY A;  3PW2 A;  2MA1 A;  4YG2 A;  2LI6 A;  4F4K A;  3KBB A;  1FIQ A;  4DQR A;  8ICS A;  2BQ3 A;  5DBB A;  2JEF A;  4DS4 A;  1OUQ A;  4KMO B;  4EBD A;  2XGQ A;  3UM9 A;  4Q8F A;  3MFH A;  1ZRM A;  3J81 j;  2HOQ A;  4UAZ A;  1DRG A;  4Y2V A;  5AM0 A;  2HW3 A;  1A0P A;  3HJE A;  2R8K A;  4KLT A;  5EE1 A;  3E2E A;  3AUO A;  3QYP A;  3PSP A;  3D2Q A;  1YZ7 A;  4YP3 A;  2CRX A;  1T94 A;  3PX4 A;  5AK6 A;  1BGX T;  4QZA A;  2OYY A;  2EAP A;  2KJ8 A;  2KNJ A;  4CRX A;  2QAR B;  4J9N A;  2E3T A;  1ZQM A;  3HP6 A;  3CRX A;  2DPJ A;  2FE9 A;  3G6X A;  4DEZ A;  1UA1 A;  4BJQ A;  4OJ5 A;  2J6S A;  3RFA A;  3AL0 B;  2Y9U A;  5EE0 A;  2E8O A;  3RTV A;  8ICK A;  3QUT A;  5CJ7 A;  3GV5 B;  4M47 A;  4I2J A;  3ZDB A;  3BZK A;  3PW0 A;  3N4M B;  1RQL A;  1Z4O A;  4RQ6 A;  5BOM A;  4IQV A;  2XY7 A;  3N7S C;  5K4L A;  3ONN A;  5G5G A;  1ZQN A;  1A76 A;  2V9W A;  1X9X A;  1F5S A;  2QKQ A;  2FMP A;  2C22 A;  4MFA A;  3Q8P B;  1IG6 A;  2Q4T A;  1NK0 A;  1ZXI A;  2XVT A;  4ED6 A;  1X40 A;  4DFP A;  4FBT A;  3IV6 A;  3GZF A;  5HP4 A;  2NRX A;  2LM1 A;  3NVZ A;  3BQ0 A;  1U47 A;  2BQU A;  2HBL A;  4F5Q A;  5KG4 A;  3Q8R B;  3UXN A;  1RZT A;  4IQU A;  5HR7 A;  3T5J A;  1URJ A;  3MGH A;  4YQW A;  2FPK A;  3RJG A;  4YMM A;  1JRO A;  2J6U A;  4IR9 A;  5DG7 A;  4CF5 A;  4KLU A;  4UB4 A;  1ZQX A;  9ICJ A;  2KIW A;  1TE2 A;  1KDH A;  2HHS A;  4BXO B;  9ICC A;  2DPI A;  2KZ3 A;  4QZG A;  2KE7 A;  2LKY A;  5KFO A;  3QU5 A;  1SZH A;  1UA0 A;  1U9L A;  3KKA A;  5J0Y A;  4ELV A;  1ECW A;  1UQV A;  3ISB A;  2YTU A;  2FJ6 A;  2WB1 F;  3M6K A;  2VA2 A;  9ICT A;  1ZD2 P;  4FO6 A;  2RDI A;  3C21 A;  2KFZ A;  4HYK A;  2DWQ A;  2EAM A;  2G0A A;  4O5E A;  5HMM A;  4F5O A;  1Z1B A;  4DF8 A;  1QSY A;  1N62 A;  1ARO P;  2JV3 A;  4Z6F A;  2E8M A;  1X42 A;  5JRT A;  5KG1 A;  5J0W A;  2W9M A;  3PX6 A;  3WK8 A;  3M9O B;  4KLG A;  3NVY A;  4WJ3 B;  8ICX A;  2H3I A;  2E8N A;  4DFJ A;  4R63 A;  3D6J A;  2E1E A;  5EOZ A;  3JPS A;  1B4F A;  3QUB A;  1DK2 A;  3A0B U;  5J2J A;  4J9R A;  4RNN A;  4TUQ A;  3TFR A;  5J0X A;  3TAD C;  2ZIX B;  1S0N A;  1KL9 A;  3RH6 A;  2EZX A;  1H38 A;  3H8S A;  1MQ3 A;  4M9G A;  1V85 A;  2YMQ A;  3L3F X;  5KG3 A;  2HHX A;  3GFK B;  3BQ7 A;  4MFC A;  4NM2 A;  1RYS A;  3V6H A;  5ALN A;  3QU7 A;  4M9N A;  2AHO B;  3RRG A;  8ICR A;  3H8M A;  4Y2Y A;  3TAR A;  3BS7 A;  5KFX A;  5A0L A;  9ICK A;  3S6J A;  4FS2 A;  4JB3 A;  3HIL A;  4JK1 A;  5AI6 A;  4RQ7 A;  1V9P A;  1K1Q A;  3C5G A;  1KN5 A;  1ZOL A;  4ECZ A;  3RH5 A;  1ZQF A;  2W43 A;  1T4G A;  1RG6 A;  3QZ8 A;  4DO9 A;  2Y1J A;  4M9L A;  4F2R A;  2JZB B;  2ZTC A;  4C8M A;  2F8K A;  3OTQ A;  2NO5 A;  2ZG6 A;  2AQ0 A;  1IIP A;  4OCZ A;  4R66 A;  1KBU A;  1ZD3 A;  5J0T A;  1FFU A;  5GTH U;  1NKB A;  3V7K A;  4I29 A;  5CP2 A;  1ED1 A;  3Q8L A;  3H40 A;  4NLB A;  2JEI A;  3IN5 A;  4F4X A;  1X6I A;  3PR5 B;  4RU9 A;  4F5R A;  3GII A;  4O3M A;  2HSZ A;  2EQY A;  9ICX A;  1XO0 A;  4UB1 A;  4DL7 A;  1MA7 A;  2W04 A;  4BGD A;  1S76 D;  4ACO A;  1D8L A;  4AP9 A;  7ICO A;  7ICN A;  4OJ6 A;  2HDO A;  2GO7 A;  1NK6 A;  3AQF A;  2ES6 A;  1KQQ A;  4IL6 U;  3IRU A;  1N56 A;  2P6U A;  3QEA Z;  1N5X A;  2E1F A;  1S0M A;  1QCK A;  2OCE A;  2DBY A;  4RQ1 A;  4FZM A;  5HML A;  4Y2P A;  3SMV A;  1NKC A;  1FEZ A;  3RF9 A;  5AK5 A;  1VDV A;  2QB1 A;  1NK8 A;  5T14 A;  3HW8 A;  1D8Y A;  4I2D A;  1KEJ A;  4K4H A;  2DKX A;  4ED2 A;  4UQG A;  1N60 A;  1L5U A;  3ZD8 A;  5JU5 A;  5KG2 A;  4KLE A;  1PK1 B;  5AM1 A;  2BPG A;  3BS5 A;  4MF8 A;  2ZJA A;  2G5H B;  2ZUB A;  1UPH A;  2YN4 A;  3R9K A;  1SV0 A;  7ICL A;  1KFT A;  2XGP A;  1SL0 A;  1BPZ A;  1XNS A;  4R65 A;  4ED7 A;  3EYZ A;  4CF3 A;  4F8R A;  4UW9 A;  2G08 A;  1MN8 A;  1X2I A;  5ALT A;  4RT2 A;  3WK5 A;  4KLL A;  3UMG A;  3M9M B;  3BQ2 A;  3Q8M A;  5KFM A;  2UVV A;  4RZR A;  1PVR A;  5DQI A;  3EPG A;  2ZTD A;  5EWG A;  4J9S A;  5DQH A;  9ICF A;  5J2D A;  4YXJ A;  3OJU A;  4PZN A;  1ZYQ A;  8ICT A;  2XCA A;  4Z6E A;  2UVU A;  8ICP A;  4TUP A;  3PX0 A;  1B0X A;  1X66 A;  1X6J A;  3HT3 A;  1L7O A;  5J8Y A;  3IDW A;  3GIM A;  4B9S A;  1KTQ A;  3LWM A;  3RJH A;  9ICQ A;  2OHF A;  4YMN A;  2LYB A;  3PW7 A;  5ALM A;  1SKW A;  3TAQ A;  1ZQB A;  5J2H A;  5ALR A;  3H0M B;  2W55 A;  4DSK A;  1U48 A;  4EBE A;  4NLK A;  3HPO A;  4XRH A;  4DWI A;  1DGS A;  4C4T A;  1ZQC A;  1N61 A;  7ICM A;  4C4S A;  4IC9 A;  1ZQS A;  3K4G A;  1NJW A;  4AYB F;  1ZQY A;  4UBC A;  1KKX A;  3BQ1 A;  3PNC A;  1NZB A;  5E79 U;  1XWL A;  1BPE A;  1N63 A;  5KFR A;  3KHH A;  2IMW P;  9ICN A;  1YT3 A;  3JPP A;  2F77 X;  3RJF A;  1BVS A;  3GQC A;  4KLS A;  5AKG A;  3QZ7 A;  1TK5 A;  1ZQ1 C;  1FO4 A;  9ICW A;  4P0Q B;  4G9B A;  2IA6 A;  3MAB A;  4R8U B;  3FYH A;  3MGV A;  4DL6 A;  2KD1 A;  2W3R A;  5D4B A;  5KT5 A;  3F5A A;  4Y2R A;  5H2F U;  2FMS A;  4A8E A;  2YY6 A;  4NXZ A;  3V6K A;  1J2M A;  1QLN A;  3BS5 B;  2IHM A;  3GV8 B;  1JXL A;  4NLZ A;  1ZQV A;  5J2G A;  4I2G A;  4YR3 A;  3IG5 A;  5KFS A;  2JR5 A;  1NOM A;  4K4I A;  4I2A A;  4KN7 A;  2WAQ F;  3CP8 A;  3PW5 A;  4DSJ A;  3M1Y A;  3GDX A;  2BHN A;  4J9K A;  4M2Y A;  2HHW A;  4GFJ A;  3L5K A;  3V7L A;  2I9G A;  1S8O A;  1QQ7 A;  3ISD A;  4ECR A;  1SIJ A;  3T79 A;  1O03 A;  4ECU A;  1DK3 A;  4PL2 A;  4I2E A;  5ALK A;  3PST A;  3MR6 A;  2ZXI A;  2BKE A;  2ISP A;  4UB3 A;  1V38 A;  2H3F A;  4JWN A;  4KTQ A;  2WFA A;  1XSN A;  4JV1 A;  2WF5 A;  2A1J B;  3C2M A;  2KSO A;  3E0F A;  4RPX A;  1HUO A;  4RQ3 A;  4F3O A;  2RRD A;  3SYZ A;  2V4Q A;  1NJZ A;  2VIX A;  3ZDA A;  8ICV A;  9ICG A;  1M6Y A;  1WWV A;  1JAL A;  4IR1 A;  4BXO A;  5AKZ A;  9ICM A;  4RQ8 A;  2HBM A;  1TFR A;  5CB1 A;  2PFP A;  4I2B A;  2KZM A;  4R64 A;  1JN3 A;  4ECT A;  5KFT A;  4O5C A;  4Q8E A;  3O0F A;  2H3Q A;  3ETL A;  4QZ9 A;  1TVA A;  2Y1I A;  3RB0 A;  3KZX A;  1SKS A;  8ICC A;  5KFG A;  5D49 A;  4UAS A;  5IIJ A;  4ZOH C;  4QWB A;  2MAX A;  1ZQQ A;  3RAQ A;  3H0R B;  4DQI A;  4BX9 C;  5AKL A;  3OGU A;  4BWM A;  2IOH A;  3UXP A;  3RB4 A;  1Z4N A;  3ZDD A;  4BWJ A;  4F5N A;  1HIW A;  4C8N A;  3EW9 A;  1L7P A;  3NTU A;  2HHT A;  3RAX A;  8ICL A;  4UB6 U;  3T5L A;  3NAS A;  3SR6 A;  1O08 A;  3D2N A;  5AKI A;  1F0M A;  2K8A A;  5TZV A;  3HKZ C;  5KFU A;  1SL1 A;  2C2R A;  1XU4 A;  3PZP A;  2NRT A;  1NI3 A;  4Y2J A;  1P7D A;  2FDR A;  3ED5 A;  3VC8 A;  4FZN A;  1D9F A;  2IOF K;  4YR2 A;  2ZIX A;  2K4H A;  2NRW A;  5L9X A;  3BJY A;  1ZQA A;  2I5H A;  5L1L A;  5KFJ A;  3QUQ A;  3H8W A;  2K4E A;  2WB1 C;  5EWE A;  4MEX A;  3TQ1 A;  2KIV A;  2OXO A;  4JUZ A;  5DKW A;  5AI5 A;  3ALR A;  4EEL A;  1XO1 A;  3Q8K A;  2I1Q A;  3SZ2 A;  4Q43 A;  1BPD A;  1HJP A;  2YML A;  1CRX A;  1LV5 A;  2ASJ A;  3WU2 U;  4DOB A;  4F4W A;  2HOI A;  4YD1 A;  5KFZ A;  2LMR A;  3B9J A;  2F1J A;  2EAO A;  4M0A A;  4ELT A;  4RT3 A;  3RB6 A;  5KAI U;  4B9N A;  2KJ9 A;  2E8P A;  2JZB A;  4YD2 A;  5DDM A;  4NWI A;  2KSO B;  3PMN A;  1B43 A;  1X9S A;  2PFQ A;  7ICS A;  3EUB 2;  3CW2 C;  2ZIV B;  2BCS A;  5ALZ A;  1RXW A;  2K8B B;  4C8O A;  3T5H A;  3CNH A;  5AM3 A;  4XQ8 A;  3EZ5 A;  2RDJ A;  1NK5 A;  8ICM A;  1UHU A;  2M9N A;  5IIO A;  4PHA A;  1RDF A;  4UB5 A;  2V4R A;  2K60 A;  5CR0 A;  1MQ2 A;  3RBE A;  2Y0S C;  3QU4 A;  1QTM A;  2F44 A;  3C1Y A;  2LBO A;  3WKE A;  2JGA A;  3F2C A;  3IP4 B;  5KFQ A;  1S77 D;  3LYS A;  2CN1 A;  5ALO A;  1KLN A;  2KN7 A;  2MUT B;  8ICU A;  2RLT A;  4M6W A;  4F93 B;  5KFY A;  1SL2 A;  3OPX A;  3GU3 A;  5DG8 A;  3N7P D;  2ASD A;  3WKD A;  5F9N A;  2I6X A;  4J9M A;  2VKQ A;  1LVH A;  2H5X A;  5AM4 A;  5CA7 A;  3BDP A;  1HUZ A;  2A3V A;  5KTQ A;  4C0Z A;  4TQS A;  2FI1 A;  5ALD A;  4GC7 A;  4FBU A;  3V6J A;  4RUC A;  5ALE A;  2LHT A;  2C28 A;  3IHQ B;  4GIB A;  4OJO A;  9ICV A;  3IM1 A;  4OJP A;  4DOC A;  1PK1 A;  1X9M A;  2AH5 A;  4UBB A;  2A1A A;  1OXJ A;  4OO1 J;  5EE9 A;  1DXS A;  5DB9 A;  7ICV A;  1JI7 A;  1WCL A;  3SEN A;  7ICQ A;  4J9L A;  4UAW A;  5AKK A;  3OHA A;  2FPL A;  1S0V A;  9ICR A;  2AU0 A;  5KFW A;  4M9H A;  3I1Y A;  3UQ2 A;  1MSW D;  1EXN A;  2KP7 A;  5AKX A;  3KZI U;  1XS9 D;  1Q3V A;  2D3D A;  2BR0 A;  2HBK A;  3LVW A;  3UMB A;  5J2B A;  2YB1 A;  3MFI A;  1HEK A;  3JPQ A;  2W3S A;  4B9U A;  1ZQH A;  3PML A;  4KX5 A;  5L1I A;  2UVR A;  3AEV A;  1SXD A;  4RQN A;  3RH4 A;  3ISC A;  2BQR A;  2Q0Z X;  1A6S A;  2YX8 A;  2YMM A;  5AM2 A;  2F76 X;  4J03 A;  5CEH A;  2BGW A;  5KFI A;  3LDA A;  8ICI A;  9ICS A;  5HNK A;  1NZP A;  1RYR A;  1SZP A;  3B0X A;  5AKH A;  1S0O A;  4NL9 A;  3NRW A;  3AMZ A;  3ICX A;  1J2N A;  1NNL A;  3B0Y A;  1WG8 A;  2N1R A;  3WKA A;  1U45 A;  1N2X A;  4ZH4 A;  2R8J A;  3AQE A;  2EDU A;  1SKR A;  5III A;  1NKE A;  4I2I A;  8ICA A;  2RHF A;  3MR3 A;  1Q46 A;  4BUG A;  2BDP A;  2AGO A;  1COK A;  3KOO A;  4M6W B;  2W9B B;  2P35 A;  5AI4 A;  2ZJ8 A;  1LKY A;  3EWA A;  2KK0 A;  4NM1 A;  2W54 A;  4FS1 A;  2UVW A;  2J6T A;  5DQG A;  4RNM A;  2XIC A;  4PJ0 U;  4GXJ A;  1BNP A;  1S5L U;  4MHV A;  4YXM A;  5J0Q A;  1VLB A;  2BCR A;  1ZQL A;  2QB0 A;  5DLF A;  4CF4 A;  4E0D A;  1K5O A;  4P0Q A;  3SAF A;  2WTF A;  2LYH A;  4FZL A;  4US9 A;  5JTI A;  5ALH A;  9ICO A;  5J0O A;  4R8U A;  4EEN A;  4DOA A;  4KLD A;  3U26 A;  1L3U A;  2H3V A;  3F2D A;  5B66 U;  5AI9 A;  1Y88 A;  4KX3 A;  2OM6 A;  1Z1V A;  8ICB A;  3UPQ A;  4NLG A;  5IIM A;  2AQ4 A;  3TFS A;  5J2K A;  4UAY A;  2DFL A;  1Z19 A;  2BDU A;  4M9J A;  3SAG A;  2BCQ A;  5KL8 B;  9ICE A;  5AK3 A;  4JMU A;  4IRC A;  3PV8 A;  1ZRN A;  3PVX A;  3SD7 A;  2ZJ5 A;  3Q8S B;  3RJE A;  4HAI A;  2AJQ A;  3OHB A;  4C7Y A;  3ZD9 A;  4B9V A;  1BPY A;  4AYB C;  4QIW F;  5ALS A;  5GTI U;  4RQ0 A;  1JX4 A;  4RPY A;  3L4P A;  2NV3 A;  5KT4 A;  4O3N A;  3WKB A;  4KLF A;  5B5E U;  3KTQ A;  4JV0 A;  1QSS A;  4F92 B;  3SAH A;  3NVV A;  4F72 A;  4DL4 A;  4O3R A;  3C1Z A;  2FLL A;  4XA5 A;  4PHD A;  5DG9 A;  4Q44 A;  2A1J A;  2D8C A;  1ZQJ A;  2DKZ A;  2IOF A;  3WK7 A;  3CYM A;  5KT2 A;  4KLO A;  4C7Z A;  1TAQ A;  3AN1 A;  4OJL A;  3OSN A;  5ALJ A;  1L7M A;  5C5J A;  5ALU A;  5ALL A;  4C80 A;  2E5S A;  1SV4 A;  1U49 A;  2PMZ C;  4DFK A;  4ECS A;  2ZTE A;  1LKY B;  3TAP A;  4B9M A;  5ALI A;  1CEZ A;  7ICR A;  2W9C B;  2PXI A;  2KFN A;  8ICG A;  1SV0 C;  1FFV A;  4EX7 A;  8ICF A;  2QB0 B;  4QZD A;  4O3Q A;  9ICI A;  2WF7 A;  2JH1 A;  5AIA A;  2R8H A;  1TAM A;  5IIN A;  5ALX A;  5G5H A;  7ICT A;  3EPI A;  5J0S A;  1BPX A;  4EZ9 A;  5AKY A;  1JMS A;  1Z00 B;  3C28 A;  2YQE A;  3K1R B;  4X5V A;  2ESE A;  2LM4 A;  4J9O A;  4B6J A;  3H7I A;  3H4B A;  2W7P A;  2B0C A;  4O5K A;  4DQS A;  5KFA A;  4XUS A;  7ICG A;  1IV8 A;  4B9L A;  2F1H A;  4FE3 A;  3QXG A;  4RQ4 A;  2XI9 A;  1QSL A;  4Y2T A;  1QQ5 A;  2PI4 A;  2D6F C;  1K1S A;  5ALP A;  5J8Y C;  2BZF A;  5DB7 A;  2W8K A;  4CE6 A;  1RXV A;  1PVQ A;  9ICH A;  3KFU F;  4ECQ A;  3MGI A;  3N7R C;  2FPM A;  5KFD A;  5AM5 A;  2R8G A;  2NO4 A;  4QW9 A;  1IM4 A;  4EEY A;  1KFD A;  2ATL A;  2PFO A;  3K1Z A;  2WHE A;  1L3S A;  1TK0 A;  1ZQP A;  4YCX A;  3RR7 A;  5AK4 A;  4KLH A;  1PVP A;  4F4Y A;  5F3X B;  3C23 A;  1TV9 A;  2Y9T A;  3PSI A;  5KFE A;  3SEI A;  2O6K A;  2KIC A;  4O3P A;  2BPC A;  1NK4 A;  2A19 A;  3TI0 A;  4CDG A;  4CNQ A;  3PW4 A;  2DL0 A;  2OEH A;  1LB2 B;  2BCU A;  1DGJ A;  4GLX A;  4CCH A;  8ICQ A;  5KFN A;  3RJI A;  4DQQ A;  4KLQ A;  4RPZ A;  4UAV A;  2ZIV A;  5J29 A;  2RP5 A;  4KLI A;  2HHV A;  2GWS A;  4ECY A;  5DBC A;  1J97 A;  2ISO A;  2ALZ A;  2EH9 A;  4PPX A;  2K4P A;  1AQ6 A;  4O0I A;  8ICW A;  3FDS A;  2EZY A;  5AKE A;  1XSL A;  7ICU A;  1B22 A;  2K8C B;  2KV2 A;  4I27 A;  4O3S A;  2XC9 A;  1BNO A;  2F1I A;  5CRX A;  4ED0 A;  2R8I A;  1JUD A;  4Y2U A;  4RQ5 A;  2MUT A;  3QU2 A;  4GXK A;  1XC9 A;  1T7P A;  1JXE A;  3FC4 A;  7ICH A;  2VJ5 A;  4KN4 A;  5HR6 A;  5JUM A;  5KL1 B;  2BCV A;  4KMU A;  1Z3E B;  2R18 A;  4EX6 A;  1UCV A;  4YMO A;  3OJS A;  4DS5 A;  2HVI A;  1RQN A;  5KT3 A;  8ICO A;  3DV9 A;  1WUD A;  4NJ8 A;  2PFN A;  3QUC A;  2B21 A;  2XY5 A;  2CPR A;  2F3N A;  4Y2Q A;  2H3Z A;  3PO4 A;  5FP0 A;  1YZ6 A;  4YN4 A;  2G5I B;  3AU6 A;  4J9Q A;  4KLM A;  1ZJM A;  4DL2 A;  2ZIU B;  3A0H U;  2HVH A;  4ECV A;  2CXY A;  5IIL A;  4EBC A;  5DB6 A;  7ICK A;  2F2A B;  4F4Z A;  1TAU A;  1CI4 A;  2W11 A;  8ICJ A;  4PH5 A;  5J0U A;  1N5W A;  2NRZ A;  5J2A A;  3ZI4 A;  3M8R A;  2W9A A;  2GLE A;  2VA8 A;  4I2F A;  2WF6 A;  4NY8 A;  2XO7 A;  2KTQ A;  4ECW A;  1ZQD A;  4G3I A;  3ORY A;  3AM9 A;  1CUK A;  4YFK A;  3JPN A;  2ZIW B;  3GIK A;  1V97 A;  3G6V A;  4LVS A;  2ZUD A;  1T8E A;  4CGZ A;  2HCF A;  1ZQO A;  2HOF A;  4P4P A;  3WKC A;  3C29 A;  2RQ5 A;  4YR0 A;  3TAD A;  4IQT A;  5KAF U;  5IIK A;  3RJK A;  2Z7J A;  3KHL A;  2WF9 A;  4DCC A;  3HKZ F;  4MFF A;  4O3O A;  1SB3 C;  4NLC A;  1N48 A;  2IBK A;  4ELU A;  2KHQ A;  4DSF A;  2K89 A;  3QU9 A;  9ICP A;  2JMG A;  4QZH A;  2VAN A;  4F50 A;  2W9B A;  3Q8Q B;  5KG7 A;  4QZB A;  4MF2 A;  3GIL A;  2P6R A;  2G06 A;  1T3Q A;  2XCP A;  3FM9 A;  3C5F A;  2P66 A;  4IQW A;  3RRH A;  2ASL A;  3F2B A;  4C4R A;  3SQI A;  3MC1 A;  4F2S A;  3T5K A;  5KFL A;  1A77 A;  1SXE A;  4RQ2 A;  2AGQ A;  3DEE A;  3WK9 A;  3HRD D;  4LJX A;  5KT7 A;  1ZQU A;  9ICU A;  1U4B A;  2HBJ A;  2HHU A;  5DBA A;  4GXI A;  3SV3 A;  3QE9 Y;  4Q45 A;  5J2I A;  2ZUC A;  2QLT A;  5BPC A;  3QNM A;  1SWV A;  3V7J A;  3G6Y A;  3FAH A;  4UB8 U;  1PZN A;  3SV4 A;  4C8K A;  1COO A;  1Q3U A;  3RBD A;  3RB3 A;  1ZQR A;  1XSP A;  7ICP A;  8ICH A;  4K4G A;  3NVW A;  1NJY A;  2JXJ A;  2KMD A;  2G07 A;  4M04 A;  2Y0S F;  1WWU A;  1JIH A;  3KKA C;  5AI8 A;  4QZ8 A;  5J0P A;  1ZQE A;  3LK9 A;  3NUQ A;  3HWT A;  1ZQK A;  9ICB A;  2LPE A;  3E58 A;  1S97 A;  8ICE A;  4QWC A;  1VJ5 A;  5KT6 A;  1DOQ A;  2W03 A;  7ICJ A;  3M8S A;  4DL5 A;  3RR8 A;  2C2D A;  1IXR A;  4DLG A;  5AHX A;  4I2C A;  4EYI B;  1MC8 A;  4TUS A;  7ICE A;  8ICN A;  3F5E A;  4UAR A;  3PR4 A;  5KNI A;  3KHR A;  5J0R A;  4Y2S A;  4KLJ A;  2DUY A;  1KSP A;  2KVS A;  4QZI A;  3JPT A;  2EZZ A;  5AKJ A;  4LZD A;  3QEB Z;  4C8L A;  2L5Y A;  5D46 A;  3H8J A;  1UT5 A;  5KG5 A;  1QH9 A;  2KKP A;  2ZXH A;  3GV7 B;  4QZC A;  4PGQ A;  4US8 A;  3M6Z A;  4QZE A;  3T3F A;  4DSI A;  2GOL A;  2MU2 A;  2JRZ A;  4GC6 A;  4QIW C;  4PGX A;  2XY6 A;  4LZG A;  5KFB A;  2XID A;  2W9C A;  3GIJ A;  4USA A;  3KD3 A;  2OWO A;  5KFV A;  2NYV A;  2MRL A;  2F8L A;  3NS1 A;  3TKA A;  5KFC A;  3F53 A;  1ZQT A;  3MDA A;  5KFP A;  2JEG A;  5CWR A;  1GO3 F;  1PK3 A;  3H0L B;  4PGY A;  4P2H A;  3I28 A;  2MSN A;  5TIS U;  1RM6 C;  1Z00 A;  2HHQ A;  1X9W A;  5KFK A;  1OW5 A;  2YB4 A;  4F5P A;  5AI0 A;  3SI8 A;  7ICF A;  5C0Y A;  4UAT A;  4ED1 A;  3UQ0 A;  4IRD A;  5EWF A;  2M0N A;  2VA3 A;  3MR2 A;  3JPR A;  2BPF A;  1WYG A;  2LYA A;  4FFD A;  4JWM A;  2YMP A;  4P4O A;  4ICA A;  4MEY A;  4B9T A;  8ICZ A;  3WK6 A;  5ALW A;  3DDH A;  2JEJ A;  3MR5 A;  4IS7 A;  4UAU A;  1NK9 A;  1L7N A;  3PSF A;  5J2F A;  2ODG A;  3MBY A;  3NRZ A;  1NJX A;  3N28 A;  5ALY A;  2HI0 A;  5AIB A;  3PO5 A;  5ALF A;  4NL9 C;  3IG8 A;  2AXT U;  4DQP A;  4O9M A;  3I76 A;  4ECX A;  4EEK A;  3LVV A;  4DSL A;  3UXO A;  2KJ5 A;  3ZDC A;  1C7Y A;  2KOB A;  3BQT A;  3VCB A;  5L1M A;  4U7C A;  1ZQZ A;  2EAN A;  4P0P A;  1TK8 A;  2G09 A;  1ZET A;  5HHI A;  4TQR A;  4RQM A;  4QW8 A;  4U6P A;  3OSP A;  4DFD A;  5DGA A;  1ZJN A;  5AIC A;  1ZQW A;  1L6N A;  5DB8 A;  3QX7 A;  9ICL A;  4DF4 A;  5DGB A;  2PI5 A;  3D2S A;  4KIT B;  5J2E A;  4PHP A;  3THV A;  5L1K A; 
#chains in the Genus database with same CATH homology
 1PUZ A;  1X6J A;  2LM4 A;  1X6I A;  2JR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...