1X6IA

Crystal structure of ygfy from escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
b'HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ygfY
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6iA00
1PUZA 1X6JA 2LM4A 1X6IA 2JR5A
chains in the Genus database with same CATH superfamily
4UAYA 3PX0A 8ICAA 2NRWA 3RB6A 1X9WA 3CRXA 1KW4A 2KZMA 4KX3A 2HHXA 4QW8A 2F1IA 3QYPA 4O3SA 1YZ7A 2MU2A 4BDPA 2ESEA 2VKQA 5L1MA 4UBBA 4ECQA 5KFZA 2HOIA 3RB4A 2EAPA 4R8UB 4JMUA 3HKZC 1NK0A 3RH5A 3H8WA 3KKAC 2XCAA 4E0DA 4O3OA 1XU4A 4PZOA 1L7NA 5BPCA 5JTIA 4EBCA 3JPOA 2HHTA 3N28A 2NYVA 2K4HA 2V9WA 1V9PA 2DL0A 5AICA 3LWLA 4F3OA 1L8LA 2YX8A 3IP4B 1TVAA 8ICHA 4UBCA 4UB5A 1TE2A 2LMRA 4GFJA 4FBUA 9ICPA 3E58A 1XO1A 1X2IA 2W9BA 5KFDA 2W55A 5EE0A 1WCLA 4UW9A 2UVRA 2HDOA 2HOFA 5D4BA 2ZG6A 2IOFA 1TFRA 3MR2A 1YZ6A 4I2GA 2F44A 4O3NA 1Y88A 4QIWF 5EWFA 4MEXA 2ZIWB 3QU2A 2ZTDA 3KKAA 2ATLA 3GZFA 3KZXA 5A0LA 1ED1A 3H7IA 3LYSA 4B9NA 4DF4A 1ZQOA 5IINA 4UB8U 4FE3A 3MC1A 5KG5A 1X9MA 3TARA 4I28A 9ICHA 3F5AA 2EH9A 4PHPA 4KLGA 1PVQA 5F3XB 3F2DA 1UA1A 2OCEA 3AMZA 2RP5A 2K89A 1OW5A 2XO7A 4KLIA 3H0MB 2KHVA 1BPYA 1TAUA 1X42A 3WK6A 2XY5A 4M9LA 1FFVA 5J0QA 9ICWA 1SV0C 5DBBA 4M9HA 4HYKA 2LI6A 1SKRA 1X9XA 2R8HA 4JWMA 3HKZF 2KP7A 3S6JA 4AYBC 4I27A 1QQ7A 4TUQA 4KLTA 3OSNA 5AK6A 4ED7A 2C2DA 3RJIA 1RG6A 5HMMA 4IQUA 4C7ZA 2OWOA 4P4PA 4RQNA 8ICYA 3V7LA 3D2SA 5KFLA 3UQ2A 3OHBA 5KNIA 3PMLA 4J9RA 3GILA 2KTQA 4C4SA 2NO5A 1JX4A 2E1EA 1SKWA 4OO1J 8ICUA 3SV3A 1T8EA 1Z4OA 5KFUA 1Z00B 1UCVA 2BCUA 1U49A 5EOZA 4I2HA 2E1FA 4F4KA 1SV0A 4B9LA 2XY7A 4ECWA 2KOBA 3Q8PB 4DQQA 1S97A 4PGQA 4Z6CA 3V7JA 1V38A 3MBYA 3BZKA 3N7RC 5CHGA 1UA0A 5J2GA 1XWLA 1YT3A 1XS9D 5AM5A 4R63A 4YFKA 2DWQA 1IIPA 4YP3A 3C2LA 4TQRA 5IIMA 2YY6A 3RRGA 1A6SA 4DFMA 4LZDA 5KG4A 2P66A 4DQRA 1U45A 3JPRA 2KJ5A 2MRLA 3Q8QB 5CRXA 4CE6A 3PW5A 1QSSA 2ZIUA 3VC8A 2VA3A 4KLFA 2ZJAA 4B6JA 4LZGA 5AKZA 5D49A 2UVUA 3QU9A 1SWWA 3H40A 4J9QA 3M8RA 1S0NA 2W8LA 7ICRA 3NVZA 4Z6FA 5KG3A 2XC9A 3HT3A 4J9NA 3PSFA 4OJ5A 2D3DA 3C1YA 5TISU 1TKDA 9ICGA 2K4PA 3HPOA 2DBYA 2EDUA 2AHOB 1N5WA 4US9A 4DSLA 1FEZA 3MDCA 5DB7A 3CW2C 9ICOA 3KTQA 3TFRA 1F5SA 2VA2A 1UPHA 3JPTA 1N63A 1DRGA 3V6KA 3SEIA 4NLKA 2I9GA 1BVSA 2ZJ5A 4PGYA 4F93B 5KT6A 1JROA 3ORYA 4Q8EA 4Q44A 4F5RA 5GTHU 2KSOB 5AI4A 1KTQA 2V4RA 2OHFA 1KFTA 1KN5A 5CB1A 1S10A 3N7SC 3QEAZ 1ZD4A 2E8MA 2JGAA 1N48A 2R8GA 3WU2U 3KFUF 5J0OA 5C0YA 3SAFA 3HP6A 1N60A 5AI6A 4ECUA 5DBAA 3GU3A 3RR8A 2A1JA 5L1JA 2DF4B 3F5EA 3QZ8A 5IIJA 1L3SA 2W11A 1L7OA 2DPJA 1U48A 1S77D 5DQIA 9ICKA 3PY8A 2HBMA 4XA5A 3BS7A 5J29A 4JK1A 1SXEA 3VCBA 5KT7A 5CP2A 5KFKA 3QZ7A 3ZDCA 5TZVA 1SL0A 4DLEA 3EPGA 5J0SA 3F2BA 4PGXA 3BS5B 5KL1B 2LKYA 5JU5A 2ZJ8A 2W9CB 1S8OA 3PSIA 2QARB 2IOHA 4QWDA 5ALJA 4DOBA 2XCPA 2VJ5A 2L5YA 1TAMA 1TK5A 3TI0A 5J2FA 3L3FX 2P6RA 4EYIB 2ZIVA 4UB4A 2CPRA 5AK3A 1NK6A 5AKIA 4EBDA 4GC7A 3NRZA 5AKEA 1RYUA 5KFQA 1XSNA 1N62A 5KFCA 2HCFA 4DSKA 5T14A 2ZIXB 4J9LA 2IHNA 4NM2A 5DGAA 2J6UA 4PL1A 3TADC 1XO0A 2FDRA 4R64A 2H5XA 4P4OA 4Z6EA 1ZETA 2ASDA 1DK3A 1BPDA 2E8PA 3H4BA 3NVWA 2XGPA 3H0RB 3C28A 1JMSA 1NK8A 2G5IB 3F2CA 4P4MA 4F5NA 7ICHA 4C8MA 2EAOA 5KFJA 5J0PA 4ECXA 1ZQUA 4RQ4A 4FZNA 4MFFA 4Z6DA 2YB4A 4RZRA 3EWAA 2XGQA 1S0VA 1AROP 2HHSA 5J0RA 3PVXA 4RQ6A 3RH6A 2C2EA 5J0WA 5J0XA 3PSTA 4KLJA 5AI8A 5ALWA 2OXOA 1LB2B 5KT5A 3TADA 1DGSA 4P2HA 3BJYA 1PK1B 4BJQA 4MFCA 4KLLA 7ICJA 1RYRA 4KLMA 4F92B 9ICIA 4DS4A 3LVWA 4MEYA 4YN4A 1L3UA 5AK4A 2ALZA 3G6XA 3WK4A 4YXMA 1Z3EB 3M9NB 1FFUA 8ICGA 3JPSA 2KG5A 4GC6A 4M9NA 9ICQA 2HVHA 3JPNA 4MHVA 4KX5A 1K5OA 1SKSA 2P6UA 5ALQA 9ICXA 5KFYA 3AN1A 2XI9A 2W7PA 4IL6U 3KD3A 3QEBZ 2MUTA 2MAXA 4DF8A 2VJ4A 4KMOB 2PI5A 2GOLA 2BHNA 3V7KA 2G08A 2K8BB 2RDJA 3PX4A 2WTFA 4OCZA 1V97A 7ICMA 3QNMA 1NKCA 4ECTA 3HRDD 5ALIA 1DOQA 2QB1A 3H8MA 4NXZA 4USAA 3MFIA 3C2MA 4FBTA 1ZQTA 9ICVA 2Q0ZX 2B21A 5ALTA 4UAWA 2BKEA 4XRHA 4F71A 5IIKA 2R8JA 5DG7A 1SGGA 1KEJA 4QZAA 3QUCA 4YCXA 5L1IA 5AI5A 4ELTA 3ONNA 1L8OA 4F72A 2KJ9A 3UMBA 3C29A 3WK9A 1Q3VA 2AGOA 4DOCA 1ZD3A 4TURA 2H3FA 3H8SA 5DGBA 4F4YA 1NI3A 2ZTEA 3D2NA 3ZD9A 2F1HA 5BOLA 5AM2A 5KFGA 1NNLA 1RXVA 1SV4A 1T4GA 5J2AA 4K4HA 4PJ0U 2WF5A 3OHAA 3LVVA 2BQ3A 4DQPA 2JR5A 4C8NA 3CP8A 3Q8KA 4GIBA 3L4PA 3TANA 2JEGA 4DQSA 4M47A 5J2JA 1X9SA 3NGDA 2KHQA 3QUTA 3U26A 3UQ0A 1OUQA 2KNJA 3MABA 1OXJA 1MC8A 1C7YA 4O3QA 1N5XA 3PMNA 2LM1A 4BWMA 5KFAA 3SAHA 4PZNA 7ICQA 2AQ0A 2W43A 4KLHA 2CXYA 4YQWA 5DG9A 4I2JA 3SMVA 4FS2A 4PL2A 1URJA 4P0QA 2WB1C 3GIIA 4DL6A 2HW3A 1NJXA 5IILA 5ALFA 4QNLA 3IHQB 3E2EA 1UQVA 5AM4A 4YR2A 1ZQEA 1C20A 2BDPA 2KIVA 5J0UA 2ODGA 3N97B 4C8KA 4QZDA 8ICVA 3K75D 1JN3A 1WG8A 8ICJA 4R8UA 4KLDA 3NVVA 4EENA 2YMMA 4IQWA 2LM4A 5EE3A 4RPZA 4DO9A 1HJPA 9ICAA 5KFPA 1NJZA 4Y2VA 1NK7A 2LYAA 4F5PA 1O03A 1IXRA 5F9LA 4I2DA 5D46A 4O5KA 5EE9A 1A77A 1UT8A 4IRKA 4RQ7A 2P35A 5KAFU 2EZXA 5AIBA 2G0AA 1ZQMA 2WFAA 4O3RA 5KT3A 3EYZA 3D2QA 4AP9A 8ICSA 4ACOA 5ALXA 3WK7A 1ZD5A 4ED8A 4I2CA 4DFKA 2JHDA 3KBBA 2HMXA 4DSFA 4K4IA 4QJFB 1ZQAA 3SAGA 5ALYA 1SZHA 4DFDA 1QTMA 2ZIWA 2FMQA 4TUSA 5HR7A 1M6YA 4IR9A 1D8YA 2HBKA 2HHQA 1IV8A 3C2KA 4X5VA 2M0NA 4YXJA 2R18A 2PFNA 2A1AA 1Z1VA 1T94A 4YD2A 4DOAA 2AJQA 3TFSA 4EYHB 5ALVA 1NKBA 4I2AA 2BQUA 5DDMA 1U4BA 1K1SA 2BDUA 2WB1F 1BNPA 1IM4A 2D8CA 4DCCA 3PW7A 9ICJA 3I76A 3WKBA 2ISPA 2F3NA 4QZ9A 5ALEA 2ASJA 2ZUCA 5AKKA 4OJPA 3RAXA 3L5KA 5G5HA 3RTVA 4BXOB 4NLBA 2RRDA 7ICEA 4Y2XA 9ICLA 3ZDEA 3RBDA 2JMGA 1PZNA 2N1RA 2ISOA 2FPKA 3TACB 2IHMA 3RH4A 1ZQSA 4U7CA 1J2NA 4CNQA 3T5LA 1LKYA 2JZBB 1MQ3A 1NZPA 1DK2A 5KTQA 4FZMA 1JXLA 5KFBA 2W7OA 4EBEA 5AM0A 3IG8A 1MQ2A 4GXKA 2PKEA 1J2MA 2KN7A 4M04A 2ES6A 2RHFA 4QW9A 3UPQA 2ZUBA 3RB3A 4Y2YA 2M9NA 1ZQZA 1DXSA 2H3ZA 3NVYA 3I28A 5AKHA 4DL3A 1U47A 4DSJA 5GTIU 4RNMA 2NO4A 2LYHA 3IV6A 1L3TA 4UARA 2Q4TA 7ICSA 4US8A 1BPEA 4JV1A 3EPIA 4AYBF 2B6GA 1Z1BA 5J0YA 8ICPA 5ALZA 5KG6A 5J2BA 5HHIA 1ZJNA 4M0AA 1NK4A 2FJ6A 3ZI4A 5F9NA 4RPYA 3HWTA 3UMCA 3IM1A 3PO5A 3THVA 3M1YA 5BOMA 3MGIA 2QKQA 2WAQC 4KTQA 2E8NA 5KT2A 1PVRA 2NRVA 1WWUA 1QCKA 2CN1A 5ALDA 1WWVA 1WYGA 4DSIA 2CRXA 4KITB 5KFRA 3QUBA 4ED6A 2OH2A 1ZQDA 2YQEA 1KLNA 2KKVA 5J0TA 3PV8A 3H0LB 3TAPA 5KL8B 3EZ5A 2AQ4A 1NZBA 3T79A 3M6KA 2EQYA 4QWEA 1SIJA 3RBEA 1MN8A 4OD0A 4B9MA 5KG1A 1VDVA 1S0MA 2R8IA 1BPBA 2A3VA 2UVWA 1KQQA 1D8BA 3M6ZA 3PZPA 1RPLA 3N4MB 2ZIVB 9ICEA 5J2IA 5KG2A 4J9PA 3K1RB 1AQ6A 5CEHA 4QWCA 3JPPA 4CGZA 2PXIA 1D8LA 3B0XA 7ICVA 1RYSA 2H3IA 3K1ZA 5AKGA 4B9VA 8ICWA 5DQGA 1ZQJA 2QB0A 5ALNA 4I2FA 4MFAA 5AI0A 1K1QA 1B43A 2PFQA 8ICIA 1ZQYA 2XY6A 8ICLA 2BPFA 4RUCA 7ICGA 2I6XA 2KSOA 5J8YC 2KVCA 4IC9A 5KG7A 1KL9A 3IN5A 3MR3A 3OJSA 2Y9TA 3AM9A 4NJ8A 2BR0A 1L7MA 3SD7A 4R65A 2Z7JA 3BQ7A 4O5CA 2ZXIA 3C5FA 4NL9C 4YMOA 5DB6A 1XSLA 1HEKA 4YVZA 1JIHA 4ECYA 4O5EA 9ICNA 2BQRA 1SZPA 4Y2RA 2KMDA 7ICPA 4YMNA 3KHGA 4P0PA 2WAQF 3RRHA 5JRTA 1DGJA 7ICNA 3GV8B 3PSPA 2AXTU 1T7PA 1B4FA 1L3VA 1JRPA 4J9OA 5J8YA 5DB9A 1L5UA 2YN4A 2KVSA 2DGZA 2W9CA 5EWGA 5J2EA 3G6YA 4B9SA 2BZFA 2QARA 4R66A 4DL5A 4DS5A 3RJKA 9ICTA 2FLNA 3AU6A 1SB3C 5HP4A 4F91B 4NL9A 1CRXA 1CEZA 4F5OA 2K60A 5AHXA 1QLNA 1WUDA 5J2DA 1KKXA 2W9MA 1T3NA 1RQNA 3EUB2 2MUTB 4Y2JA 3JPQA 2WF9A 7ICIA 1Q3UA 2KZZA 4GXJA 4RT3A 4M6WB 5L1KA 3AL0B 3M9OB 1CI4A 4J9SA 2F8KA 3RJJA 2IMWP 3LDAA 3NRWA 1N61A 1TV9A 4ICAA 2J6SA 5HMLA 3SZ2A 3GV5B 5B5EU 3AQEA 5ALGA 2RLTA 4Q43A 3GQCA 5DLFA 5FP0A 3FAHA 1ZQFA 3DV9A 1PUZA 2FLPA 4KLQA 3Q8MA 3UMGA 1A76A 3OTQA 1BPXA 4TUPA 4F4XA 2DPIA 7ICUA 1JI7A 2KKPA 3ETRA 9ICBA 3PO4A 4IR1A 1ZQXA 1ZRNA 5CJ7A 2EZZA 3WK5A 4RQ5A 2RQ5A 2JEJA 3K4GA 4UAUA 5ALRA 3FC4A 4IRCA 4J03A 2MSNA 5KFEA 2Y9UA 5B66U 4XUSA 1COOA 2XICA 1WCNA 3OSPA 1PK1A 4BUGA 3J81j 5L9XA 1RXWA 2WHEA 5HNKA 5HR6A 2F77X 2GH1A 2KZ3A 3UXOA 2IOFK 2H3QA 1FO4A 2AU0A 3BQ2A 4I29A 9ICRA 8ICRA 2DFLA 5KFTA 4EEYA 4C80A 2FMSA 4GLXA 4NY8A 2F2AB 3FM9A 1H38A 3ETLA 1LVHA 3ZDDA 4NLGA 4CF5A 5KFXA 4TQSA 2QLTA 2PMZC 3R9KA 5AIAA 2FI1A 1VJ5A 4YD1A 5KAIU 5ALUA 2RDIA 4QZGA 1HIWA 3KHLA 1RQLA 1A0PA 9ICUA 5IIIA 2W9BB 2VANA 2W54A 4UB6U 2E5SA 2W04A 3UXPA 2KICA 4QZIA 3M8SA 4RQ3A 4F5QA 1XSPA 2K4EA 2UVVA 4EEKA 2O6KA 1T3QA 4KLEA 5KFVA 1NK5A 2I5HA 2DKXA 2HBJA 3QUQA 4UAVA 2JH7A 4YR0A 1ZJMA 4RQ2A 4NLNA 5ALMA 1PK3A 3DEEA 3NS1A 3ZDBA 4YMMA 3O0FA 5ALSA 3SYZA 4DQIA 1V85A 1FIQA 3AU2A 3ISDA 5C5JA 4UB2A 3V6JA 4EX6A 3AUOA 1QQ6A 1UT5A 3MFHA 4C4RA 2KD1A 1RZTA 1ZQNA 4FS1A 2WF8A 3B9JA 4KLOA 3V72A 2GWSA 4LJXA 1ZQHA 2G09A 2HOQA 3A0BU 4EZ9A 1S76D 2Y1JA 2K8AA 3C5GA 5DLGA 8ICMA 4BX9C 4RQ8A 2HHWA 3SENA 2W3SA 3WKEA 4B9TA 1BGXT 2KJ8A 1N2XA 3GFKB 5E79U 5AKXA 2GO7A 4A8EA 4CF4A 2PMZF 2BCVA 1KSPA 5DKWA 4MF8A 4F8RA 4F4WA 4O9MA 4OJ6A 3HILA 2ASLA 4RQ0A 4YR3A 4RUAA 4PPXA 4RU9A 3BZCA 2JEIA 2HBLA 4M2YA 4RQMA 3GIMA 3QXGA 2PFOA 3QU4A 3QE9Y 2DQNB 2EZYA 3C23A 1UHUA 2ZTCA 1XNSA 1D9DA 3RFAA 1ZQBA 5DBCA 5AK5A 3BDPA 9ICCA 1GO3F 3ZD8A 4JB3A 2PI4A 1SWVA 3F53A 4OJLA 1LKYB 3KOOA 1P7DA 1X6IA 1ZQCA 4QZHA 3N7PD 8ICXA 4QWBA 1O08A 5KT4A 2FE9A 4QZ8A 4PHDA 8ICNA 1B0XA 4ED1A 2ZXHA 2KE7A 2ZIUB 5DB8A 3QX7A 2OEHA 3QU7A 5H2FU 1J97A 3AQFA 4Y2QA 2KV2A 3RJEA 4KLUA 2W03A 8ICCA 2HSZA 2LPEA 3HJEA 3PNCA 4QZCA 1JALA 4Y2PA 4DSEA 3BQ0A 4O0IA 1HUZA 1SL2A 4KN4A 4K4GA 2YMQA 2FMPA 4RQ1A 4Q8FA 4DFPA 3ED5A 3IDWA 5K4LA 2HHUA 3RJGA 4JWNA 4QZBA 3T3FA 3WKDA 1KDHA 1NJWA 1Z4NA 1NK9A 2MA1A 1B22A 3SQIA 4G9BA 2G07A 1Z00A 4C8OA 5AKJA 5ALKA 3WK8A 4UQGA 2D6FC 8ICQA 8ICKA 3GDXA 4NM1A 4BXOA 9ICSA 4EX7A 8ICZA 2H3VA 5CA7A 3IG5A 4ED3A 5AM1A 4FZLA 2XIDA 3WKAA 1ZQPA 4UB1A 1MSWD 1KRPA 2OYYA 4DL7A 1KFSA 2A1JB 1VLBA 2VA8A 5KG0A 1RDFA 5J2KA 3NUQA 2JZBA 2KIWA 3Q8SB 3UXNA 1S9FA 2BCQA 4Y2UA 3ISCA 5KFMA 4Y2SA 1QSYA 4DEZA 4C8LA 3PW2A 1ZQQA 3OGUA 2LHTA 2IA6A 4DWIA 2V4QA 4CCHA 2W3RA 2AGPA 3MGHA 1QH9A 3IRUA 4O3MA 1F44A 5EE1A 4BGDA 2DUYA 5DG8A 5G5GA 3PR5B 3MGVA 4Q45A 2KEYA 3OPXA 4WJ3B 3DDHA 5CWRA 1TK8A 2QB0B 1IG6A 5AM3A 1ZRMA 3FDSA 4F2RA 3UM9A 3ICXA 1TK0A 4PH5A 5EWEA 2F76X 2C2RA 7ICKA 4ECRA 8ICTA 7ICLA 2G5HB 4JV2A 3KHRA 2Y0SC 3AEVA 2NRZA 4FFDA 3KHHA 4QZFA 2B0CA 1ZQGA 9ICMA 5AKLA 2FPLA 5ALPA 7ICOA 3Q8RB 4O3PA 3LWMA 1S0OA 2BGWA 1X40A 2BPCA 1NKEA 3EW9A 3OJUA 2GLEA 2LYBA 2A19A 4I2BA 4KN7A 3TQ1A 4DL4A 3SR6A 3RF9A 5AKYA 2EANA 2W9AA 3BQTA 2K8CB 4RNNA 2F1JA 1ZXIA 4I2EA 4P0PB 5IIOA 4IS7A 4IQVA 4ECSA 5J2HA 2HVIA 4RNOA 4F4ZA 2Y1IA 4EELA 3RB0A 3ISBA 4ELVA 5J2CA 5KFSA 2WF7A 1JXEA 1JUDA 1KFDA 3MDAA 3T5JA 1COKA 4JV0A 2R8KA 2JRZA 2EAMA 1U9LA 5CR0A 1F0MA 3SI8A 5KFOA 3NASA 3H8JA 2WF6A 2J6TA 1D9FA 9ICFA 2DKZA 4Y2TA 2JXJA 3H4DA 1NJYA 2NRXA 3I1YA 2W8KA 2F8LA 1HUOA 3RJFA 4ELUA 1L7PA 2E8OA 1SXDA 2BCSA 3GV7B 1ZD2P 4NLCA 2KK0A 4DFJA 1N56A 4MF2A 3RAQA 5KFIA 4LVSA 5ALHA 4ZOHC 3TKAA 1Q8KA 5AI9A 1KBUA 1SL1A 3SV4A 5ALLA 3G6VA 2YMLA 4ED2A 3BS5A 2YB1A 2YTUA 4C0ZA 3HW8A 3B0YA 4OJOA 1S5LU 1L6NA 4M9JA 1Z19A 1ZQVA 2JV3A 4RT2A 4YG2A 4PHEA 1QQ5A 4CRXA 4EZ6A 4KLSA 3C21A 8ICEA 4B9UA 4QZEA 1CUKA 4J9MA 2Y0SF 1MA7A 3RJHA 4DLGA 3TAQA 4GXIA 4NLZA 7ICTA 7ICFA 4IQTA 4KMUA 3BQ1A 3HX0A 1X6JA 3GIJA 2BPGA 3QU5A 2ZIXA 1BPZA 3D6JA 1ZYQA 3ZDAA 3Q8LA 3E0FA 2HHVA 3FYHA 4UAZA 3PW0A 2XVTA 3MR5A 2AGQA 2HI0A 1ZQ1C 5HHHA 2OM6A 4I2IA 4UATA 3A0HU 2NRTA 4RPXA 5KFWA 4F2SA 2JH1A 1ZQRA 2NV3A 2JEFA 4G3IA 4QWAA 3T5HA 3M7DA 4BWJA 4UB3A 4ZH4A 2FPMA 2G06A 2C28A 4CF3A 3MR6A 3C1ZA 5DQHA 4M9GA 1QSLA 2AH5A 1XC9A 4C4TA 1PVPA 5KFHA 3PX6A 4NV0A 3NTUA 2KFNA 1RM6C 3M9MB 4J9KA 4U6PA 3V6HA 1ZQLA 4JUZA 4NWIA 1ZQWA 2PFPA 1ZQIA 3CYMA 3KZIU 2I1QA 4CDGA 2IBKA 1X66A 5JUMA 5KFFA 3PR4A 3T5KA 4M6WA 4UASA 4XQ8A 1ZQKA 4F50A 5KFNA 2YMPA 1EXNA 3RR7A 3PW4A 2VIXA 2BCRA 3LK9A 2ZUDA 1TAQA 3ALRA 1LV5A 1BNOA 2LBOA 4QIWC 2KFZA 4IRDA 1ECWA 5DDYA 1Q46A 5L1LA 4PHAA 3WKCA 1NOMA 4ECVA 5ALOA 8ICFA 3GIKA 3CNHA 4DL2A 8ICOA 1ZOLA 2E3TA 2FLLA 4C7YA 4FO6A 4HAIA 2K4IA 4ED0A 8ICBA 2C22A 4P0QB 4ECZA
chains in the Genus database with same CATH topology
1PUZA 1X6JA 2LM4A 1X6IA 2JR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUZ A;  1X6J A;  2LM4 A;  1X6I A;  2JR5 A; 
#chains in the Genus database with same CATH topology
 4UAY A;  3PX0 A;  8ICA A;  2NRW A;  3RB6 A;  1X9W A;  3CRX A;  1KW4 A;  2KZM A;  4KX3 A;  2HHX A;  4QW8 A;  2F1I A;  3QYP A;  4O3S A;  1YZ7 A;  2MU2 A;  4BDP A;  2ESE A;  2VKQ A;  5L1M A;  4UBB A;  4ECQ A;  5KFZ A;  2HOI A;  3RB4 A;  2EAP A;  4R8U B;  4JMU A;  3HKZ C;  1NK0 A;  3RH5 A;  3H8W A;  3KKA C;  2XCA A;  4E0D A;  4O3O A;  1XU4 A;  4PZO A;  1L7N A;  5BPC A;  5JTI A;  4EBC A;  3JPO A;  2HHT A;  3N28 A;  2NYV A;  2K4H A;  2V9W A;  1V9P A;  2DL0 A;  5AIC A;  3LWL A;  4F3O A;  1L8L A;  2YX8 A;  3IP4 B;  1TVA A;  8ICH A;  4UBC A;  4UB5 A;  1TE2 A;  2LMR A;  4GFJ A;  4FBU A;  9ICP A;  3E58 A;  1XO1 A;  1X2I A;  2W9B A;  5KFD A;  2W55 A;  5EE0 A;  1WCL A;  4UW9 A;  2UVR A;  2HDO A;  2HOF A;  5D4B A;  2ZG6 A;  2IOF A;  1TFR A;  3MR2 A;  1YZ6 A;  4I2G A;  2F44 A;  4O3N A;  1Y88 A;  4QIW F;  5EWF A;  4MEX A;  2ZIW B;  3QU2 A;  2ZTD A;  3KKA A;  2ATL A;  3GZF A;  3KZX A;  5A0L A;  1ED1 A;  3H7I A;  3LYS A;  4B9N A;  4DF4 A;  1ZQO A;  5IIN A;  4UB8 U;  4FE3 A;  3MC1 A;  5KG5 A;  1X9M A;  3TAR A;  4I28 A;  9ICH A;  3F5A A;  2EH9 A;  4PHP A;  4KLG A;  1PVQ A;  5F3X B;  3F2D A;  1UA1 A;  2OCE A;  3AMZ A;  2RP5 A;  2K89 A;  1OW5 A;  2XO7 A;  4KLI A;  3H0M B;  2KHV A;  1BPY A;  1TAU A;  1X42 A;  3WK6 A;  2XY5 A;  4M9L A;  1FFV A;  5J0Q A;  9ICW A;  1SV0 C;  5DBB A;  4M9H A;  4HYK A;  2LI6 A;  1SKR A;  1X9X A;  2R8H A;  4JWM A;  3HKZ F;  2KP7 A;  3S6J A;  4AYB C;  4I27 A;  1QQ7 A;  4TUQ A;  4KLT A;  3OSN A;  5AK6 A;  4ED7 A;  2C2D A;  3RJI A;  1RG6 A;  5HMM A;  4IQU A;  4C7Z A;  2OWO A;  4P4P A;  4RQN A;  8ICY A;  3V7L A;  3D2S A;  5KFL A;  3UQ2 A;  3OHB A;  5KNI A;  3PML A;  4J9R A;  3GIL A;  2KTQ A;  4C4S A;  2NO5 A;  1JX4 A;  2E1E A;  1SKW A;  4OO1 J;  8ICU A;  3SV3 A;  1T8E A;  1Z4O A;  5KFU A;  1Z00 B;  1UCV A;  2BCU A;  1U49 A;  5EOZ A;  4I2H A;  2E1F A;  4F4K A;  1SV0 A;  4B9L A;  2XY7 A;  4ECW A;  2KOB A;  3Q8P B;  4DQQ A;  1S97 A;  4PGQ A;  4Z6C A;  3V7J A;  1V38 A;  3MBY A;  3BZK A;  3N7R C;  5CHG A;  1UA0 A;  5J2G A;  1XWL A;  1YT3 A;  1XS9 D;  5AM5 A;  4R63 A;  4YFK A;  2DWQ A;  1IIP A;  4YP3 A;  3C2L A;  4TQR A;  5IIM A;  2YY6 A;  3RRG A;  1A6S A;  4DFM A;  4LZD A;  5KG4 A;  2P66 A;  4DQR A;  1U45 A;  3JPR A;  2KJ5 A;  2MRL A;  3Q8Q B;  5CRX A;  4CE6 A;  3PW5 A;  1QSS A;  2ZIU A;  3VC8 A;  2VA3 A;  4KLF A;  2ZJA A;  4B6J A;  4LZG A;  5AKZ A;  5D49 A;  2UVU A;  3QU9 A;  1SWW A;  3H40 A;  4J9Q A;  3M8R A;  1S0N A;  2W8L A;  7ICR A;  3NVZ A;  4Z6F A;  5KG3 A;  2XC9 A;  3HT3 A;  4J9N A;  3PSF A;  4OJ5 A;  2D3D A;  3C1Y A;  5TIS U;  1TKD A;  9ICG A;  2K4P A;  3HPO A;  2DBY A;  2EDU A;  2AHO B;  1N5W A;  4US9 A;  4DSL A;  1FEZ A;  3MDC A;  5DB7 A;  3CW2 C;  9ICO A;  3KTQ A;  3TFR A;  1F5S A;  2VA2 A;  1UPH A;  3JPT A;  1N63 A;  1DRG A;  3V6K A;  3SEI A;  4NLK A;  2I9G A;  1BVS A;  2ZJ5 A;  4PGY A;  4F93 B;  5KT6 A;  1JRO A;  3ORY A;  4Q8E A;  4Q44 A;  4F5R A;  5GTH U;  2KSO B;  5AI4 A;  1KTQ A;  2V4R A;  2OHF A;  1KFT A;  1KN5 A;  5CB1 A;  1S10 A;  3N7S C;  3QEA Z;  1ZD4 A;  2E8M A;  2JGA A;  1N48 A;  2R8G A;  3WU2 U;  3KFU F;  5J0O A;  5C0Y A;  3SAF A;  3HP6 A;  1N60 A;  5AI6 A;  4ECU A;  5DBA A;  3GU3 A;  3RR8 A;  2A1J A;  5L1J A;  2DF4 B;  3F5E A;  3QZ8 A;  5IIJ A;  1L3S A;  2W11 A;  1L7O A;  2DPJ A;  1U48 A;  1S77 D;  5DQI A;  9ICK A;  3PY8 A;  2HBM A;  4XA5 A;  3BS7 A;  5J29 A;  4JK1 A;  1SXE A;  3VCB A;  5KT7 A;  5CP2 A;  5KFK A;  3QZ7 A;  3ZDC A;  5TZV A;  1SL0 A;  4DLE A;  3EPG A;  5J0S A;  3F2B A;  4PGX A;  3BS5 B;  5KL1 B;  2LKY A;  5JU5 A;  2ZJ8 A;  2W9C B;  1S8O A;  3PSI A;  2QAR B;  2IOH A;  4QWD A;  5ALJ A;  4DOB A;  2XCP A;  2VJ5 A;  2L5Y A;  1TAM A;  1TK5 A;  3TI0 A;  5J2F A;  3L3F X;  2P6R A;  4EYI B;  2ZIV A;  4UB4 A;  2CPR A;  5AK3 A;  1NK6 A;  5AKI A;  4EBD A;  4GC7 A;  3NRZ A;  5AKE A;  1RYU A;  5KFQ A;  1XSN A;  1N62 A;  5KFC A;  2HCF A;  4DSK A;  5T14 A;  2ZIX B;  4J9L A;  2IHN A;  4NM2 A;  5DGA A;  2J6U A;  4PL1 A;  3TAD C;  1XO0 A;  2FDR A;  4R64 A;  2H5X A;  4P4O A;  4Z6E A;  1ZET A;  2ASD A;  1DK3 A;  1BPD A;  2E8P A;  3H4B A;  3NVW A;  2XGP A;  3H0R B;  3C28 A;  1JMS A;  1NK8 A;  2G5I B;  3F2C A;  4P4M A;  4F5N A;  7ICH A;  4C8M A;  2EAO A;  5KFJ A;  5J0P A;  4ECX A;  1ZQU A;  4RQ4 A;  4FZN A;  4MFF A;  4Z6D A;  2YB4 A;  4RZR A;  3EWA A;  2XGQ A;  1S0V A;  1ARO P;  2HHS A;  5J0R A;  3PVX A;  4RQ6 A;  3RH6 A;  2C2E A;  5J0W A;  5J0X A;  3PST A;  4KLJ A;  5AI8 A;  5ALW A;  2OXO A;  1LB2 B;  5KT5 A;  3TAD A;  1DGS A;  4P2H A;  3BJY A;  1PK1 B;  4BJQ A;  4MFC A;  4KLL A;  7ICJ A;  1RYR A;  4KLM A;  4F92 B;  9ICI A;  4DS4 A;  3LVW A;  4MEY A;  4YN4 A;  1L3U A;  5AK4 A;  2ALZ A;  3G6X A;  3WK4 A;  4YXM A;  1Z3E B;  3M9N B;  1FFU A;  8ICG A;  3JPS A;  2KG5 A;  4GC6 A;  4M9N A;  9ICQ A;  2HVH A;  3JPN A;  4MHV A;  4KX5 A;  1K5O A;  1SKS A;  2P6U A;  5ALQ A;  9ICX A;  5KFY A;  3AN1 A;  2XI9 A;  2W7P A;  4IL6 U;  3KD3 A;  3QEB Z;  2MUT A;  2MAX A;  4DF8 A;  2VJ4 A;  4KMO B;  2PI5 A;  2GOL A;  2BHN A;  3V7K A;  2G08 A;  2K8B B;  2RDJ A;  3PX4 A;  2WTF A;  4OCZ A;  1V97 A;  7ICM A;  3QNM A;  1NKC A;  4ECT A;  3HRD D;  5ALI A;  1DOQ A;  2QB1 A;  3H8M A;  4NXZ A;  4USA A;  3MFI A;  3C2M A;  4FBT A;  1ZQT A;  9ICV A;  2Q0Z X;  2B21 A;  5ALT A;  4UAW A;  2BKE A;  4XRH A;  4F71 A;  5IIK A;  2R8J A;  5DG7 A;  1SGG A;  1KEJ A;  4QZA A;  3QUC A;  4YCX A;  5L1I A;  5AI5 A;  4ELT A;  3ONN A;  1L8O A;  4F72 A;  2KJ9 A;  3UMB A;  3C29 A;  3WK9 A;  1Q3V A;  2AGO A;  4DOC A;  1ZD3 A;  4TUR A;  2H3F A;  3H8S A;  5DGB A;  4F4Y A;  1NI3 A;  2ZTE A;  3D2N A;  3ZD9 A;  2F1H A;  5BOL A;  5AM2 A;  5KFG A;  1NNL A;  1RXV A;  1SV4 A;  1T4G A;  5J2A A;  4K4H A;  4PJ0 U;  2WF5 A;  3OHA A;  3LVV A;  2BQ3 A;  4DQP A;  2JR5 A;  4C8N A;  3CP8 A;  3Q8K A;  4GIB A;  3L4P A;  3TAN A;  2JEG A;  4DQS A;  4M47 A;  5J2J A;  1X9S A;  3NGD A;  2KHQ A;  3QUT A;  3U26 A;  3UQ0 A;  1OUQ A;  2KNJ A;  3MAB A;  1OXJ A;  1MC8 A;  1C7Y A;  4O3Q A;  1N5X A;  3PMN A;  2LM1 A;  4BWM A;  5KFA A;  3SAH A;  4PZN A;  7ICQ A;  2AQ0 A;  2W43 A;  4KLH A;  2CXY A;  4YQW A;  5DG9 A;  4I2J A;  3SMV A;  4FS2 A;  4PL2 A;  1URJ A;  4P0Q A;  2WB1 C;  3GII A;  4DL6 A;  2HW3 A;  1NJX A;  5IIL A;  5ALF A;  4QNL A;  3IHQ B;  3E2E A;  1UQV A;  5AM4 A;  4YR2 A;  1ZQE A;  1C20 A;  2BDP A;  2KIV A;  5J0U A;  2ODG A;  3N97 B;  4C8K A;  4QZD A;  8ICV A;  3K75 D;  1JN3 A;  1WG8 A;  8ICJ A;  4R8U A;  4KLD A;  3NVV A;  4EEN A;  2YMM A;  4IQW A;  2LM4 A;  5EE3 A;  4RPZ A;  4DO9 A;  1HJP A;  9ICA A;  5KFP A;  1NJZ A;  4Y2V A;  1NK7 A;  2LYA A;  4F5P A;  1O03 A;  1IXR A;  5F9L A;  4I2D A;  5D46 A;  4O5K A;  5EE9 A;  1A77 A;  1UT8 A;  4IRK A;  4RQ7 A;  2P35 A;  5KAF U;  2EZX A;  5AIB A;  2G0A A;  1ZQM A;  2WFA A;  4O3R A;  5KT3 A;  3EYZ A;  3D2Q A;  4AP9 A;  8ICS A;  4ACO A;  5ALX A;  3WK7 A;  1ZD5 A;  4ED8 A;  4I2C A;  4DFK A;  2JHD A;  3KBB A;  2HMX A;  4DSF A;  4K4I A;  4QJF B;  1ZQA A;  3SAG A;  5ALY A;  1SZH A;  4DFD A;  1QTM A;  2ZIW A;  2FMQ A;  4TUS A;  5HR7 A;  1M6Y A;  4IR9 A;  1D8Y A;  2HBK A;  2HHQ A;  1IV8 A;  3C2K A;  4X5V A;  2M0N A;  4YXJ A;  2R18 A;  2PFN A;  2A1A A;  1Z1V A;  1T94 A;  4YD2 A;  4DOA A;  2AJQ A;  3TFS A;  4EYH B;  5ALV A;  1NKB A;  4I2A A;  2BQU A;  5DDM A;  1U4B A;  1K1S A;  2BDU A;  2WB1 F;  1BNP A;  1IM4 A;  2D8C A;  4DCC A;  3PW7 A;  9ICJ A;  3I76 A;  3WKB A;  2ISP A;  2F3N A;  4QZ9 A;  5ALE A;  2ASJ A;  2ZUC A;  5AKK A;  4OJP A;  3RAX A;  3L5K A;  5G5H A;  3RTV A;  4BXO B;  4NLB A;  2RRD A;  7ICE A;  4Y2X A;  9ICL A;  3ZDE A;  3RBD A;  2JMG A;  1PZN A;  2N1R A;  2ISO A;  2FPK A;  3TAC B;  2IHM A;  3RH4 A;  1ZQS A;  4U7C A;  1J2N A;  4CNQ A;  3T5L A;  1LKY A;  2JZB B;  1MQ3 A;  1NZP A;  1DK2 A;  5KTQ A;  4FZM A;  1JXL A;  5KFB A;  2W7O A;  4EBE A;  5AM0 A;  3IG8 A;  1MQ2 A;  4GXK A;  2PKE A;  1J2M A;  2KN7 A;  4M04 A;  2ES6 A;  2RHF A;  4QW9 A;  3UPQ A;  2ZUB A;  3RB3 A;  4Y2Y A;  2M9N A;  1ZQZ A;  1DXS A;  2H3Z A;  3NVY A;  3I28 A;  5AKH A;  4DL3 A;  1U47 A;  4DSJ A;  5GTI U;  4RNM A;  2NO4 A;  2LYH A;  3IV6 A;  1L3T A;  4UAR A;  2Q4T A;  7ICS A;  4US8 A;  1BPE A;  4JV1 A;  3EPI A;  4AYB F;  2B6G A;  1Z1B A;  5J0Y A;  8ICP A;  5ALZ A;  5KG6 A;  5J2B A;  5HHI A;  1ZJN A;  4M0A A;  1NK4 A;  2FJ6 A;  3ZI4 A;  5F9N A;  4RPY A;  3HWT A;  3UMC A;  3IM1 A;  3PO5 A;  3THV A;  3M1Y A;  5BOM A;  3MGI A;  2QKQ A;  2WAQ C;  4KTQ A;  2E8N A;  5KT2 A;  1PVR A;  2NRV A;  1WWU A;  1QCK A;  2CN1 A;  5ALD A;  1WWV A;  1WYG A;  4DSI A;  2CRX A;  4KIT B;  5KFR A;  3QUB A;  4ED6 A;  2OH2 A;  1ZQD A;  2YQE A;  1KLN A;  2KKV A;  5J0T A;  3PV8 A;  3H0L B;  3TAP A;  5KL8 B;  3EZ5 A;  2AQ4 A;  1NZB A;  3T79 A;  3M6K A;  2EQY A;  4QWE A;  1SIJ A;  3RBE A;  1MN8 A;  4OD0 A;  4B9M A;  5KG1 A;  1VDV A;  1S0M A;  2R8I A;  1BPB A;  2A3V A;  2UVW A;  1KQQ A;  1D8B A;  3M6Z A;  3PZP A;  1RPL A;  3N4M B;  2ZIV B;  9ICE A;  5J2I A;  5KG2 A;  4J9P A;  3K1R B;  1AQ6 A;  5CEH A;  4QWC A;  3JPP A;  4CGZ A;  2PXI A;  1D8L A;  3B0X A;  7ICV A;  1RYS A;  2H3I A;  3K1Z A;  5AKG A;  4B9V A;  8ICW A;  5DQG A;  1ZQJ A;  2QB0 A;  5ALN A;  4I2F A;  4MFA A;  5AI0 A;  1K1Q A;  1B43 A;  2PFQ A;  8ICI A;  1ZQY A;  2XY6 A;  8ICL A;  2BPF A;  4RUC A;  7ICG A;  2I6X A;  2KSO A;  5J8Y C;  2KVC A;  4IC9 A;  5KG7 A;  1KL9 A;  3IN5 A;  3MR3 A;  3OJS A;  2Y9T A;  3AM9 A;  4NJ8 A;  2BR0 A;  1L7M A;  3SD7 A;  4R65 A;  2Z7J A;  3BQ7 A;  4O5C A;  2ZXI A;  3C5F A;  4NL9 C;  4YMO A;  5DB6 A;  1XSL A;  1HEK A;  4YVZ A;  1JIH A;  4ECY A;  4O5E A;  9ICN A;  2BQR A;  1SZP A;  4Y2R A;  2KMD A;  7ICP A;  4YMN A;  3KHG A;  4P0P A;  2WAQ F;  3RRH A;  5JRT A;  1DGJ A;  7ICN A;  3GV8 B;  3PSP A;  2AXT U;  1T7P A;  1B4F A;  1L3V A;  1JRP A;  4J9O A;  5J8Y A;  5DB9 A;  1L5U A;  2YN4 A;  2KVS A;  2DGZ A;  2W9C A;  5EWG A;  5J2E A;  3G6Y A;  4B9S A;  2BZF A;  2QAR A;  4R66 A;  4DL5 A;  4DS5 A;  3RJK A;  9ICT A;  2FLN A;  3AU6 A;  1SB3 C;  5HP4 A;  4F91 B;  4NL9 A;  1CRX A;  1CEZ A;  4F5O A;  2K60 A;  5AHX A;  1QLN A;  1WUD A;  5J2D A;  1KKX A;  2W9M A;  1T3N A;  1RQN A;  3EUB 2;  2MUT B;  4Y2J A;  3JPQ A;  2WF9 A;  7ICI A;  1Q3U A;  2KZZ A;  4GXJ A;  4RT3 A;  4M6W B;  5L1K A;  3AL0 B;  3M9O B;  1CI4 A;  4J9S A;  2F8K A;  3RJJ A;  2IMW P;  3LDA A;  3NRW A;  1N61 A;  1TV9 A;  4ICA A;  2J6S A;  5HML A;  3SZ2 A;  3GV5 B;  5B5E U;  3AQE A;  5ALG A;  2RLT A;  4Q43 A;  3GQC A;  5DLF A;  5FP0 A;  3FAH A;  1ZQF A;  3DV9 A;  1PUZ A;  2FLP A;  4KLQ A;  3Q8M A;  3UMG A;  1A76 A;  3OTQ A;  1BPX A;  4TUP A;  4F4X A;  2DPI A;  7ICU A;  1JI7 A;  2KKP A;  3ETR A;  9ICB A;  3PO4 A;  4IR1 A;  1ZQX A;  1ZRN A;  5CJ7 A;  2EZZ A;  3WK5 A;  4RQ5 A;  2RQ5 A;  2JEJ A;  3K4G A;  4UAU A;  5ALR A;  3FC4 A;  4IRC A;  4J03 A;  2MSN A;  5KFE A;  2Y9U A;  5B66 U;  4XUS A;  1COO A;  2XIC A;  1WCN A;  3OSP A;  1PK1 A;  4BUG A;  3J81 j;  5L9X A;  1RXW A;  2WHE A;  5HNK A;  5HR6 A;  2F77 X;  2GH1 A;  2KZ3 A;  3UXO A;  2IOF K;  2H3Q A;  1FO4 A;  2AU0 A;  3BQ2 A;  4I29 A;  9ICR A;  8ICR A;  2DFL A;  5KFT A;  4EEY A;  4C80 A;  2FMS A;  4GLX A;  4NY8 A;  2F2A B;  3FM9 A;  1H38 A;  3ETL A;  1LVH A;  3ZDD A;  4NLG A;  4CF5 A;  5KFX A;  4TQS A;  2QLT A;  2PMZ C;  3R9K A;  5AIA A;  2FI1 A;  1VJ5 A;  4YD1 A;  5KAI U;  5ALU A;  2RDI A;  4QZG A;  1HIW A;  3KHL A;  1RQL A;  1A0P A;  9ICU A;  5III A;  2W9B B;  2VAN A;  2W54 A;  4UB6 U;  2E5S A;  2W04 A;  3UXP A;  2KIC A;  4QZI A;  3M8S A;  4RQ3 A;  4F5Q A;  1XSP A;  2K4E A;  2UVV A;  4EEK A;  2O6K A;  1T3Q A;  4KLE A;  5KFV A;  1NK5 A;  2I5H A;  2DKX A;  2HBJ A;  3QUQ A;  4UAV A;  2JH7 A;  4YR0 A;  1ZJM A;  4RQ2 A;  4NLN A;  5ALM A;  1PK3 A;  3DEE A;  3NS1 A;  3ZDB A;  4YMM A;  3O0F A;  5ALS A;  3SYZ A;  4DQI A;  1V85 A;  1FIQ A;  3AU2 A;  3ISD A;  5C5J A;  4UB2 A;  3V6J A;  4EX6 A;  3AUO A;  1QQ6 A;  1UT5 A;  3MFH A;  4C4R A;  2KD1 A;  1RZT A;  1ZQN A;  4FS1 A;  2WF8 A;  3B9J A;  4KLO A;  3V72 A;  2GWS A;  4LJX A;  1ZQH A;  2G09 A;  2HOQ A;  3A0B U;  4EZ9 A;  1S76 D;  2Y1J A;  2K8A A;  3C5G A;  5DLG A;  8ICM A;  4BX9 C;  4RQ8 A;  2HHW A;  3SEN A;  2W3S A;  3WKE A;  4B9T A;  1BGX T;  2KJ8 A;  1N2X A;  3GFK B;  5E79 U;  5AKX A;  2GO7 A;  4A8E A;  4CF4 A;  2PMZ F;  2BCV A;  1KSP A;  5DKW A;  4MF8 A;  4F8R A;  4F4W A;  4O9M A;  4OJ6 A;  3HIL A;  2ASL A;  4RQ0 A;  4YR3 A;  4RUA A;  4PPX A;  4RU9 A;  3BZC A;  2JEI A;  2HBL A;  4M2Y A;  4RQM A;  3GIM A;  3QXG A;  2PFO A;  3QU4 A;  3QE9 Y;  2DQN B;  2EZY A;  3C23 A;  1UHU A;  2ZTC A;  1XNS A;  1D9D A;  3RFA A;  1ZQB A;  5DBC A;  5AK5 A;  3BDP A;  9ICC A;  1GO3 F;  3ZD8 A;  4JB3 A;  2PI4 A;  1SWV A;  3F53 A;  4OJL A;  1LKY B;  3KOO A;  1P7D A;  1X6I A;  1ZQC A;  4QZH A;  3N7P D;  8ICX A;  4QWB A;  1O08 A;  5KT4 A;  2FE9 A;  4QZ8 A;  4PHD A;  8ICN A;  1B0X A;  4ED1 A;  2ZXH A;  2KE7 A;  2ZIU B;  5DB8 A;  3QX7 A;  2OEH A;  3QU7 A;  5H2F U;  1J97 A;  3AQF A;  4Y2Q A;  2KV2 A;  3RJE A;  4KLU A;  2W03 A;  8ICC A;  2HSZ A;  2LPE A;  3HJE A;  3PNC A;  4QZC A;  1JAL A;  4Y2P A;  4DSE A;  3BQ0 A;  4O0I A;  1HUZ A;  1SL2 A;  4KN4 A;  4K4G A;  2YMQ A;  2FMP A;  4RQ1 A;  4Q8F A;  4DFP A;  3ED5 A;  3IDW A;  5K4L A;  2HHU A;  3RJG A;  4JWN A;  4QZB A;  3T3F A;  3WKD A;  1KDH A;  1NJW A;  1Z4N A;  1NK9 A;  2MA1 A;  1B22 A;  3SQI A;  4G9B A;  2G07 A;  1Z00 A;  4C8O A;  5AKJ A;  5ALK A;  3WK8 A;  4UQG A;  2D6F C;  8ICQ A;  8ICK A;  3GDX A;  4NM1 A;  4BXO A;  9ICS A;  4EX7 A;  8ICZ A;  2H3V A;  5CA7 A;  3IG5 A;  4ED3 A;  5AM1 A;  4FZL A;  2XID A;  3WKA A;  1ZQP A;  4UB1 A;  1MSW D;  1KRP A;  2OYY A;  4DL7 A;  1KFS A;  2A1J B;  1VLB A;  2VA8 A;  5KG0 A;  1RDF A;  5J2K A;  3NUQ A;  2JZB A;  2KIW A;  3Q8S B;  3UXN A;  1S9F A;  2BCQ A;  4Y2U A;  3ISC A;  5KFM A;  4Y2S A;  1QSY A;  4DEZ A;  4C8L A;  3PW2 A;  1ZQQ A;  3OGU A;  2LHT A;  2IA6 A;  4DWI A;  2V4Q A;  4CCH A;  2W3R A;  2AGP A;  3MGH A;  1QH9 A;  3IRU A;  4O3M A;  1F44 A;  5EE1 A;  4BGD A;  2DUY A;  5DG8 A;  5G5G A;  3PR5 B;  3MGV A;  4Q45 A;  2KEY A;  3OPX A;  4WJ3 B;  3DDH A;  5CWR A;  1TK8 A;  2QB0 B;  1IG6 A;  5AM3 A;  1ZRM A;  3FDS A;  4F2R A;  3UM9 A;  3ICX A;  1TK0 A;  4PH5 A;  5EWE A;  2F76 X;  2C2R A;  7ICK A;  4ECR A;  8ICT A;  7ICL A;  2G5H B;  4JV2 A;  3KHR A;  2Y0S C;  3AEV A;  2NRZ A;  4FFD A;  3KHH A;  4QZF A;  2B0C A;  1ZQG A;  9ICM A;  5AKL A;  2FPL A;  5ALP A;  7ICO A;  3Q8R B;  4O3P A;  3LWM A;  1S0O A;  2BGW A;  1X40 A;  2BPC A;  1NKE A;  3EW9 A;  3OJU A;  2GLE A;  2LYB A;  2A19 A;  4I2B A;  4KN7 A;  3TQ1 A;  4DL4 A;  3SR6 A;  3RF9 A;  5AKY A;  2EAN A;  2W9A A;  3BQT A;  2K8C B;  4RNN A;  2F1J A;  1ZXI A;  4I2E A;  4P0P B;  5IIO A;  4IS7 A;  4IQV A;  4ECS A;  5J2H A;  2HVI A;  4RNO A;  4F4Z A;  2Y1I A;  4EEL A;  3RB0 A;  3ISB A;  4ELV A;  5J2C A;  5KFS A;  2WF7 A;  1JXE A;  1JUD A;  1KFD A;  3MDA A;  3T5J A;  1COK A;  4JV0 A;  2R8K A;  2JRZ A;  2EAM A;  1U9L A;  5CR0 A;  1F0M A;  3SI8 A;  5KFO A;  3NAS A;  3H8J A;  2WF6 A;  2J6T A;  1D9F A;  9ICF A;  2DKZ A;  4Y2T A;  2JXJ A;  3H4D A;  1NJY A;  2NRX A;  3I1Y A;  2W8K A;  2F8L A;  1HUO A;  3RJF A;  4ELU A;  1L7P A;  2E8O A;  1SXD A;  2BCS A;  3GV7 B;  1ZD2 P;  4NLC A;  2KK0 A;  4DFJ A;  1N56 A;  4MF2 A;  3RAQ A;  5KFI A;  4LVS A;  5ALH A;  4ZOH C;  3TKA A;  1Q8K A;  5AI9 A;  1KBU A;  1SL1 A;  3SV4 A;  5ALL A;  3G6V A;  2YML A;  4ED2 A;  3BS5 A;  2YB1 A;  2YTU A;  4C0Z A;  3HW8 A;  3B0Y A;  4OJO A;  1S5L U;  1L6N A;  4M9J A;  1Z19 A;  1ZQV A;  2JV3 A;  4RT2 A;  4YG2 A;  4PHE A;  1QQ5 A;  4CRX A;  4EZ6 A;  4KLS A;  3C21 A;  8ICE A;  4B9U A;  4QZE A;  1CUK A;  4J9M A;  2Y0S F;  1MA7 A;  3RJH A;  4DLG A;  3TAQ A;  4GXI A;  4NLZ A;  7ICT A;  7ICF A;  4IQT A;  4KMU A;  3BQ1 A;  3HX0 A;  1X6J A;  3GIJ A;  2BPG A;  3QU5 A;  2ZIX A;  1BPZ A;  3D6J A;  1ZYQ A;  3ZDA A;  3Q8L A;  3E0F A;  2HHV A;  3FYH A;  4UAZ A;  3PW0 A;  2XVT A;  3MR5 A;  2AGQ A;  2HI0 A;  1ZQ1 C;  5HHH A;  2OM6 A;  4I2I A;  4UAT A;  3A0H U;  2NRT A;  4RPX A;  5KFW A;  4F2S A;  2JH1 A;  1ZQR A;  2NV3 A;  2JEF A;  4G3I A;  4QWA A;  3T5H A;  3M7D A;  4BWJ A;  4UB3 A;  4ZH4 A;  2FPM A;  2G06 A;  2C28 A;  4CF3 A;  3MR6 A;  3C1Z A;  5DQH A;  4M9G A;  1QSL A;  2AH5 A;  1XC9 A;  4C4T A;  1PVP A;  5KFH A;  3PX6 A;  4NV0 A;  3NTU A;  2KFN A;  1RM6 C;  3M9M B;  4J9K A;  4U6P A;  3V6H A;  1ZQL A;  4JUZ A;  4NWI A;  1ZQW A;  2PFP A;  1ZQI A;  3CYM A;  3KZI U;  2I1Q A;  4CDG A;  2IBK A;  1X66 A;  5JUM A;  5KFF A;  3PR4 A;  3T5K A;  4M6W A;  4UAS A;  4XQ8 A;  1ZQK A;  4F50 A;  5KFN A;  2YMP A;  1EXN A;  3RR7 A;  3PW4 A;  2VIX A;  2BCR A;  3LK9 A;  2ZUD A;  1TAQ A;  3ALR A;  1LV5 A;  1BNO A;  2LBO A;  4QIW C;  2KFZ A;  4IRD A;  1ECW A;  5DDY A;  1Q46 A;  5L1L A;  4PHA A;  3WKC A;  1NOM A;  4ECV A;  5ALO A;  8ICF A;  3GIK A;  3CNH A;  4DL2 A;  8ICO A;  1ZOL A;  2E3T A;  2FLL A;  4C7Y A;  4FO6 A;  4HAI A;  2K4I A;  4ED0 A;  8ICB A;  2C22 A;  4P0Q B;  4ECZ A; 
#chains in the Genus database with same CATH homology
 1PUZ A;  1X6J A;  2LM4 A;  1X6I A;  2JR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...