1X6IA

Crystal structure of ygfy from escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ygfY
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6iA00
1X6JA 1PUZA 2LM4A 2JR5A 1X6IA
chains in the Genus database with same CATH superfamily
4ED7A 3NRZA 8ICYA 1RM6C 5KFDA 1T94A 1X9WA 4DSJA 4DL3A 4BXOB 1T8EA 4KLQA 2RP5A 1S97A 3QE9Y 3C2KA 3QXGA 5KAFU 3JPOA 3RH6A 4NLGA 2W11A 3L3FX 1XC9A 5KAIU 3TADC 1NKBA 3UXOA 1ZQKA 4JWMA 4QZHA 3JPQA 2WF7A 2GLEA 1PVRA 4NM1A 2MAXA 2BQUA 3NUQA 3WKBA 4O5CA 1BNPA 2AXTU 3C1ZA 2HVIA 3UMGA 2KE7A 3ONNA 4NV0A 9ICPA 3EYZA 3PW0A 3AQFA 2R8KA 4KLOA 8ICMA 5C5JA 3QU5A 5KFEA 5KFWA 3QYPA 4MF8A 4DSIA 4US8A 1UT5A 5JTIA 3QNMA 3QU7A 3PMLA 5ALKA 3B9JA 2VIXA 3DDHA 3T79A 5CRXA 5ALFA 5EE1A 1MA7A 4QZCA 5F3XB 5DLGA 3RB3A 1X9SA 3AN1A 2XGPA 5KFXA 1D8YA 4ECQA 2E5SA 1WUDA 5T14A 1X2IA 2MRLA 8ICPA 4RQ2A 1HIWA 4DFMA 1M6YA 3CRXA 2KHQA 4UB3A 4P0PB 3V7LA 2D8CA 4YQWA 4TUPA 2BZFA 8ICGA 2ES6A 3HILA 2ESEA 2ZIWA 2G5IB 4RQ8A 2H3QA 4KLEA 3RAXA 2W9CB 3EUB2 2IOFA 2HHXA 2W9AA 3ED5A 3GQCA 5KG0A 1A0PA 5KFKA 2IOFK 3QUCA 1J2NA 8ICOA 5AK3A 1FO4A 1VLBA 5B66U 1U45A 1JMSA 2NYVA 3NASA 1UQVA 3F2BA 1ZQZA 4OJ5A 5KG4A 5GTHU 1QH9A 4M9HA 4DF8A 1ZD3A 4ED8A 2F44A 2L5YA 2MUTA 3C23A 5IIKA 3TKAA 2KEYA 3ZD9A 3WK6A 1XSLA 4KTQA 1NKEA 2LKYA 1UCVA 5AIAA 2C2RA 4IQVA 8ICUA 3B0XA 7ICGA 2I5HA 2E1EA 2MA1A 1L8OA 4M9LA 1SKSA 3ISDA 5AI8A 5ALPA 1SWVA 2PKEA 1PZNA 5KFFA 3C1YA 1ZQSA 4KLIA 4DL7A 2FJ6A 5KFRA 3QEAZ 5EWGA 2BCQA 4RUCA 1ZQCA 4KN7A 3V72A 4PGYA 3QEBZ 2QKQA 4KLFA 1ED1A 2ZIVB 2KSOB 1MQ2A 1DK2A 3TACB 2YY6A 3GIMA 1H38A 8ICSA 5L1MA 4Z6DA 1IM4A 2HBLA 5FP0A 3SAFA 1ZQFA 2JEFA 5KFJA 4TUQA 1BPZA 2NRZA 1RDFA 3KHHA 5KG2A 3THVA 5DB8A 2G06A 1OW5A 1ZRNA 1SL0A 4M04A 4ZH4A 1WWVA 5CWRA 4F5QA 3T3FA 1TV9A 4FS1A 3ZDAA 3L5KA 4F92B 4DFDA 4GXKA 1SXDA 1FIQA 4CNQA 3SAGA 2YB1A 1B4FA 3PR4A 1ZQXA 2F1JA 2LM1A 3K1RB 4ECZA 4ECRA 1D9FA 1ZJNA 5AI9A 4I2JA 5F9LA 4DLEA 4PPXA 3J81j 2PFNA 1Y88A 4M9NA 1Q3VA 9ICCA 4I29A 3WK4A 4ECUA 2JHDA 3RF9A 3AUOA 4UAYA 1S5LU 4FE3A 3WKAA 4UB1A 3H8JA 4Q43A 2OYYA 3IM1A 1ZQLA 4QJFB 4LVSA 4EEYA 4O5KA 4K4IA 1EXNA 2E8NA 5HP4A 2PXIA 4GLXA 3M8RA 2PMZF 2F76X 3KKAA 3PX6A 1NJXA 2AQ4A 2BR0A 2VA3A 4LJXA 1L7OA 2EAOA 3ISBA 2KIWA 2XIDA 4IQTA 4TQSA 1U47A 2NO4A 2FDRA 3HKZC 5DB7A 2BCRA 4F4WA 1TK0A 2OWOA 2ZIXA 4DEZA 3RAQA 3JPNA 3T5LA 4QWDA 2DPJA 2AGOA 3G6VA 2YMLA 1TVAA 9ICRA 2FLNA 1Z1VA 4YR2A 2HMXA 2XVTA 4PL2A 1NK8A 3BQTA 3MFIA 4ICAA 1K1SA 1KKXA 2P35A 5DQHA 1ZOLA 2RLTA 3MBYA 4J9QA 9ICOA 9ICMA 5J0TA 9ICXA 3RBEA 2FPMA 5AM4A 5KFAA 3WK8A 4EYHB 4M9GA 1ZQEA 1KSPA 9ICBA 2W3SA 3Q8PB 2XY7A 2EQYA 3T5KA 1SV0A 3MGIA 4O3PA 7ICPA 1ZQDA 4UAWA 4DOBA 3PMNA 2XCPA 4ELVA 2HOIA 3MFHA 3N7SC 4CF3A 3CYMA 5JRTA 3LK9A 5HMLA 4QZDA 4C8KA 1Z00A 2GWSA 2FI1A 3SR6A 1SZHA 1NJZA 1PVQA 4KMOB 4DQIA 3NGDA 5EE0A 4M47A 4F4ZA 4QZIA 5C0YA 3H8MA 4M0AA 4DSKA 2R8IA 4PJ0U 5J2BA 4Y2YA 1KL9A 1TE2A 3PO5A 1L5UA 1ZRMA 4NL9A 5AKLA 5KFZA 2FE9A 5KFNA 3MR6A 3V7KA 3PSIA 2IBKA 4Q45A 2H3VA 1KFTA 1JN3A 5AM0A 2KJ9A 2C2EA 2ISPA 5KNIA 1V38A 2JV3A 4DQQA 1JUDA 4C7ZA 5HR7A 5BOMA 4UAUA 1NK5A 5CR0A 3BZKA 2EZXA 1CEZA 1HEKA 5ALLA 1S0MA 5IIOA 4YVZA 2W8LA 3M9NB 1YT3A 2WTFA 5J2FA 3SAHA 1ZQRA 4I2EA 4OJOA 2EZYA 4PZOA 5KG1A 4RQ1A 2W04A 4FBTA 2ZXHA 1A6SA 2R18A 4NLCA 4Y2RA 3H7IA 4YMMA 7ICMA 1QLNA 5KFIA 5IIIA 3QUTA 3AMZA 2KNJA 4RQNA 2E1FA 4DOAA 1WWUA 5L1KA 4FS2A 1RPLA 2W9CA 3OHBA 9ICEA 5F9NA 4FBUA 3RR7A 2WB1F 2HBMA 3PVXA 4PZNA 4NM2A 4P2HA 5ALIA 3V6KA 4QIWC 1ZXIA 2BQRA 4UATA 5J2KA 3HP6A 3C5GA 3L4PA 4UARA 3H0MB 1XSPA 3NVYA 5ALDA 5KFSA 2VA2A 4B9NA 7ICHA 3JPRA 2F8LA 3JPPA 3BJYA 3TANA 4QZ8A 2BKEA 4MFAA 4FO6A 4KLSA 9ICUA 1XU4A 4DQSA 4PHAA 1T3NA 5AI6A 1CRXA 8ICKA 8ICNA 4F4XA 1ZQTA 2PI5A 4ECTA 4OD0A 5EWEA 2W9BB 1QCKA 3V6HA 1DOQA 2KZZA 4R64A 3H0LB 3RB6A 5E79U 4PHDA 4O3MA 2K4PA 1SGGA 1A77A 1F44A 4YXMA 4UBBA 5CB1A 2WF5A 3MABA 4J9PA 4ELUA 1SXEA 4QW9A 4DL6A 2H3IA 1HUOA 3CNHA 4CF5A 4DS4A 4FZMA 4Y2JA 1FFVA 4O3NA 3IP4B 4F71A 3UXNA 3TAQA 3FC4A 3NVVA 1IG6A 8ICRA 4MEXA 4QZ9A 2NRXA 1SV0C 1L6NA 1U9LA 4YG2A 1B0XA 3Q8SB 3OSPA 2XY6A 2ZUCA 1NK7A 2BCUA 3FAHA 2HHSA 2DL0A 4YD1A 3H0RB 5AIBA 4NLBA 4DFKA 2AJQA 1RQLA 2ZTCA 4RQ6A 4OO1J 4Y2SA 2ZJ8A 4F5OA 5EOZA 2FLLA 3SI8A 3SMVA 3OGUA 2J6UA 2YMPA 4QIWF 1KLNA 7ICTA 2JZBA 4BDPA 3SV3A 3PW7A 4C8OA 5J2AA 2HW3A 5J0QA 2Z7JA 4DL2A 2K8AA 4IQWA 4UB6U 5DG9A 3DV9A 2KICA 1V85A 2ASDA 1LKYA 4DOCA 2KHVA 5TISU 4HYKA 2V9WA 4DFPA 1ZQWA 3SEIA 5CA7A 3AQEA 2AGQA 3LYSA 3RRGA 2IHNA 8ICFA 2V4RA 4Q8FA 5DG8A 1ZD2P 2GH1A 4WJ3B 4I2IA 2LM4A 2DBYA 4B9TA 3IRUA 3SD7A 3UQ0A 1QTMA 2Y9UA 1XS9D 4DSLA 2MUTB 3ZI4A 1COOA 3RRHA 2HDOA 5AKHA 1Z19A 2KP7A 4AP9A 4NY8A 5J2GA 1AQ6A 1ZQIA 5AKEA 3H8SA 4YR0A 2KTQA 4JV1A 2ZG6A 2P6UA 4US9A 2K8BB 4QZEA 1ZETA 1QQ7A 4UB4A 2DUYA 2KZ3A 4QZFA 3PSPA 1QQ6A 2BQ3A 1Z00B 4OJPA 5ALYA 3PSFA 2BHNA 2EANA 9ICVA 4DL5A 1Q3UA 2UVWA 3V7JA 2C22A 2ZJAA 4ECSA 1DRGA 1O03A 4QWBA 4M6WB 3PV8A 2Y9TA 5KT7A 2DWQA 4IC9A 1A76A 5BOLA 8ICJA 2HI0A 2ZTEA 1YZ7A 4Z6FA 2D3DA 1HJPA 2LBOA 3PZPA 5DLFA 2EDUA 3RH5A 4ELTA 5J8YA 3GV8B 1DXSA 4JV0A 4UB2A 3U26A 2ZUDA 2RQ5A 3C2MA 5HNKA 2ISOA 8ICTA 2E8PA 3FDSA 5KFCA 1ZQJA 5J0SA 5J8YC 5A0LA 3GV7B 3T5JA 3VC8A 4EZ6A 2A3VA 9ICIA 1BVSA 1X66A 5TZVA 1ZQYA 4PH5A 1MN8A 4QWEA 3SV4A 2KD1A 7ICUA 3GILA 1L7PA 4K4HA 2DPIA 1L7NA 1AROP 2OM6A 4R63A 3GV5B 2VANA 4ECVA 4BXOA 3PW4A 2JGAA 3MC1A 4ED2A 5IINA 2QB1A 4TUSA 1RYUA 5CEHA 4DCCA 3BQ0A 1N5XA 4RQ7A 4BJQA 1BPBA 5EE3A 5ALOA 5CP2A 2JH7A 5J2JA 4F2SA 1F0MA 4KLMA 1XO0A 1X9MA 4IR1A 9ICTA 5H2FU 2JXJA 2AH5A 3FYHA 3QUBA 5J2EA 1N60A 2NRVA 4EYIB 1N61A 4NXZA 8ICWA 4KITB 1ZQUA 4YXJA 2HBJA 3HJEA 2FPKA 1WCLA 4MEYA 2D6FC 2G0AA 4I27A 1U49A 1ZQ1C 3RJEA 4RNNA 1IXRA 8ICXA 3RR8A 1BPDA 2R8JA 3NTUA 3LDAA 5AK5A 4CE6A 3QU2A 5DBAA 3WKCA 1B22A 1NK0A 2KVSA 3DEEA 5AI0A 2XC9A 3ICXA 2H3FA 2JMGA 4K4GA 2KIVA 2KMDA 4I2BA 5DDYA 2GO7A 2DGZA 5AM2A 4O3QA 1RXVA 2CXYA 4FZLA 4JB3A 1P7DA 4R8UB 2ATLA 1BPEA 4UAVA 5KFYA 1MQ3A 5G5HA 3F2DA 1N63A 3BDPA 2LYBA 1ZQBA 1XO1A 4KLTA 3QUQA 3K1ZA 3N97B 4RNOA 2F1IA 4A8EA 4DFJA 3BQ2A 5KFVA 5AK6A 1KBUA 4PHEA 2BDPA 4FFDA 8ICIA 4MHVA 4J03A 4UB5A 1LB2B 3AU2A 4PL1A 4JV2A 1ZQMA 3TADA 5BPCA 1JALA 2LI6A 2W03A 1LV5A 4KLGA 5KG5A 2W43A 2YB4A 4R8UA 4USAA 2YX8A 1KFSA 7ICIA 8ICBA 3UM9A 4UAZA 2ZIUA 4C80A 4P4PA 1NOMA 3RJGA 3OJUA 5DB9A 2W55A 3O0FA 1X9XA 1ZD4A 4F2RA 2WAQC 5ALUA 1U48A 4B9VA 2YMMA 3QZ8A 3HW8A 4Y2QA 2OCEA 4IQUA 4Y2TA 3BZCA 4B6JA 1JRPA 2A1JA 3AU6A 5L1IA 2VA8A 3F5EA 4F50A 1C7YA 5KT3A 4M2YA 2F2AB 5J29A 8ICCA 1Z4OA 1DGSA 1VJ5A 1WCNA 1JX4A 4ZOHC 3NS1A 4I2DA 7ICFA 2G09A 2G07A 4OJ6A 4J9NA 1K5OA 2ZUBA 4RNMA 2XO7A 5ALSA 3Q8KA 1ZQAA 2W8KA 1IIPA 2HSZA 4YN4A 2BDUA 2VJ5A 1TK5A 1J2MA 2P66A 3ETLA 3GDXA 3PY8A 2QB0A 2IHMA 4Z6EA 1NK4A 1F5SA 3N7RC 1ZYQA 2CN1A 1L8LA 5KFUA 2OH2A 2KV2A 5DBBA 2C28A 2M9NA 1KN5A 2Y1JA 4Y2VA 4Y2UA 3HX0A 4UW9A 3K4GA 4C8LA 4FZNA 4EZ9A 5KFGA 4P0QB 4XA5A 4ECWA 1KW4A 1TFRA 1NKCA 1QSLA 2F77X 2QARB 4YR3A 3C28A 2HHVA 1SWWA 4M9JA 3GFKB 1KRPA 3AL0B 1RYRA 4JMUA 4KN4A 1U4BA 4DSFA 3RH4A 3QU4A 4EEKA 5CJ7A 4M6WA 4I2GA 4IS7A 1TKDA 2KKPA 5DGBA 2BCSA 3D2QA 1TAQA 4RT2A 1SKWA 3AEVA 3SQIA 4J9KA 2AQ0A 1ZQVA 3ZD8A 5AKJA 3C21A 1ZQHA 1NJWA 3MGVA 4BWMA 1NK6A 5J0UA 2KN7A 2IOHA 3IG8A 2W9MA 5DKWA 3RJKA 2EH9A 5J2IA 4KLJA 5DBCA 3ORYA 1SIJA 3RBDA 2W54A 3M8SA 4UB8U 4QNLA 2IMWP 2AU0A 4CGZA 3KD3A 5ALGA 5AK4A 4TQRA 4F91B 4YMOA 2H5XA 5KFQA 3I76A 2UVUA 3QX7A 2C2DA 4F4YA 3EW9A 2J6TA 5L1JA 1DK3A 3N28A 4CF4A 4UBCA 2K4EA 3RJJA 2KFNA 4IL6U 4J9LA 4ED3A 2F1HA 4EBEA 4F5PA 1TK8A 2NO5A 3Q8QB 5ALMA 2PFQA 8ICHA 5KT2A 1SKRA 4CCHA 3OJSA 2LHTA 4XRHA 5JUMA 3N7PD 5D46A 5AI5A 2ZIUB 3KBBA 4DWIA 2ZTDA 1FFUA 1HUZA 2G08A 1J97A 4I2FA 4I28A 4KX3A 3HWTA 4I2CA 2N1RA 3AM9A 4J9SA 7ICLA 1S0OA 2DQNB 2YTUA 4NJ8A 4O3SA 1N48A 3KKAC 4G9BA 3WK7A 2JEIA 4DF4A 4YCXA 3ALRA 1N62A 4EX6A 4DSEA 3G6YA 2I6XA 2K60A 1UHUA 5ALTA 2VJ4A 2HBKA 3QU9A 4C4TA 4RPZA 3BS5A 3H4BA 5G5GA 8ICVA 3CW2C 2DKZA 4XQ8A 4ED6A 2J6SA 4GXIA 1ZJMA 3KHRA 2QARA 4C0ZA 2PMZC 4BWJA 4UQGA 3V6JA 7ICQA 4C7YA 4R66A 3KHLA 1T4GA 4Y2PA 3JPSA 3EPGA 5J0XA 1OUQA 1JXEA 3HKZF 2AHOB 1ZD5A 2OHFA 3LVWA 5IILA 5D4BA 2Q4TA 3KZIU 4ACOA 2JZBB 2ZIVA 3F53A 4B9MA 5KG3A 1LVHA 1X6JA 1UT8A 2FPLA 1CUKA 3GZFA 4F4KA 2HHQA 4KLDA 4RQ0A 1O08A 2XY5A 2BPGA 1LKYB 5J0WA 5AKKA 2JRZA 5IIJA 4JK1A 3R9KA 2YN4A 2BGWA 2Y0SF 4IRKA 2KVCA 3E0FA 1FEZA 2ALZA 1OXJA 3E2EA 3JPTA 9ICWA 5J2HA 3C29A 3HRDD 4GC6A 5AKZA 3OSNA 4O3RA 5KTQA 4RT3A 4PHPA 3PW2A 4DS5A 4F72A 5ALRA 1PK1B 1UPHA 3Q8RB 2UVRA 7ICOA 2HHWA 2PFOA 2XGQA 3LWLA 4RQ5A 4NL9C 2UVVA 1BPXA 4RUAA 4QWAA 3D2SA 9ICGA 4AYBF 1MC8A 3VCBA 4ED1A 8ICLA 5ALZA 2ZIXB 3MDAA 4Q44A 2PI4A 4GIBA 3BQ1A 1BPYA 2WF9A 2LPEA 4AYBC 1MSWD 4F5NA 5DB6A 5KFTA 3RB0A 1ZQGA 4Q8EA 2NV3A 1COKA 1ZQPA 2HOFA 2ASJA 5KL8B 3RB4A 5EE9A 2KSOA 2E8OA 2JEJA 1QSSA 2XCAA 2M0NA 1RQNA 3N4MB 3KZXA 3PX4A 5ALEA 4B9UA 4MFCA 3RJHA 4MF2A 1KFDA 2FMQA 2JR5A 3BS7A 3LWMA 5KFBA 4F5RA 1NJYA 2KJ8A 2DKXA 3ZDEA 4IR9A 4RZRA 1QQ5A 2EAPA 4UASA 3TI0A 1B43A 3M9OB 5AKGA 5DQIA 1XNSA 1L3SA 1KDHA 3PW5A 2I9GA 3RJIA 4NLNA 1SV4A 3D2NA 4X5VA 3IN5A 1K1QA 4YP3A 3T5HA 5AICA 4QZGA 2XI9A 1NZBA 1SB3C 4EELA 3PO4A 1PVPA 3K75D 2PFPA 4U7CA 3I1YA 4DO9A 4DL4A 3OPXA 1L3UA 5ALWA 1JI7A 5KFPA 3WU2U 2HHUA 3D6JA 3Q8MA 5AM3A 4KLHA 5AM5A 2A1AA 4RPYA 4CRXA 5KT5A 4R65A 2F8KA 1WG8A 9ICHA 2DF4B 4DLGA 5ALJA 3BQ7A 5AKYA 5HHIA 5ALHA 5L1LA 4DQRA 2K89A 4C8MA 1WYGA 3IDWA 1URJA 4TURA 3QZ7A 3UPQA 1JXLA 3RTVA 5ALNA 2LYHA 2IA6A 2EAMA 2QB0B 2O6KA 3GU3A 4QZBA 9ICSA 4DQPA 8ICZA 3A0HU 4YFKA 3S6JA 2CRXA 2AGPA 4IRDA 1SL2A 2YMQA 1BGXT 3MR2A 3B0YA 4U6PA 1NZPA 2A19A 3I28A 7ICNA 3IG5A 3EWAA 2W7PA 4F8RA 1JROA 2LYAA 5KT4A 4NWIA 5JU5A 3HT3A 5CHGA 4O3OA 5GTIU 3M6KA 3G6XA 5EWFA 2KJ5A 1S0VA 1RZTA 4GC7A 2E3TA 2KG5A 7ICRA 4I2HA 5HR6A 3MR3A 2HCFA 4RQ3A 1V97A 4O0IA 2CPRA 2W7OA 3C2LA 9ICFA 3TARA 1QSYA 4B9SA 4BUGA 2JEGA 1SZPA 1S8OA 9ICJA 4F93B 1S10A 1TAMA 3ZDBA 2ASLA 3WK9A 3TFSA 2H3ZA 4NLZA 3TQ1A 4MFFA 2WAQF 2YQEA 5DGAA 3UQ2A 4G3IA 3EZ5A 4LZDA 2P6RA 1X40A 3ZDCA 7ICSA 1C20A 1NNLA 3GIKA 3KFUF 2HHTA 2JH1A 5KG7A 4KMUA 7ICJA 1N2XA 1CI4A 2WF8A 4QZAA 7ICVA 5ALXA 2WB1C 2W9BA 4NLKA 5KFLA 4J9RA 2RRDA 4Y2XA 9ICLA 1PUZA 5B5EU 4JUZA 2V4QA 1N56A 4KLLA 2FMSA 7ICEA 2EZZA 3OHAA 1D8LA 1Q8KA 5DQGA 3PNCA 4YD2A 3TFRA 2KKVA 3NRWA 1Z4NA 4IRCA 1VDVA 3SYZA 5HMMA 2Q0ZX 1S0NA 2NRWA 3KHGA 2OEHA 3MR5A 5ALVA 3EPIA 1ZQNA 2K8CB 1ZQQA 3Q8LA 4C4SA 2KZMA 1ZQOA 3GIJA 1Z1BA 2MSNA 2KOBA 4BX9C 2ZJ5A 2BPCA 3UMCA 2FMPA 4EBDA 9ICQA 5HHHA 5AHXA 3NVZA 2W3RA 4GXJA 2F3NA 2LMRA 2B0CA 1YZ6A 2B6GA 4YMNA 2HOQA 3WKEA 4GFJA 3UXPA 5ALQA 3RJFA 1JIHA 1XWLA 1V9PA 3SENA 5J2DA 4I2AA 3RFAA 4C4RA 5KFOA 4PGQA 3MGHA 5K4LA 2RHFA 3MDCA 4EENA 1X6IA 4P0PA 3NVWA 4HAIA 3C5FA 5AI4A 2ZXIA 2K4HA 3HPOA 2GOLA 3M6ZA 1UA0A 4XUSA 2MU2A 3E58A 5AM1A 3CP8A 4PGXA 2E8MA 3PR5B 2ZIWB 5AKIA 4Z6CA 4C8NA 1XSNA 3ISCA 1DGJA 4B9LA 1ECWA 3OTQA 1RYSA 2QLTA 2BPFA 8ICAA 2WF6A 8ICQA 1KTQA 1D8BA 5J0PA 4RU9A 4LZGA 3TAPA 2K4IA 1L7MA 4ECYA 3ZDDA 1RG6A 5AKXA 2R8HA 5IIMA 1BNOA 3M7DA 4KX5A 3GIIA 9ICKA 1NK9A 4ECXA 3F5AA 3LVVA 4QW8A 1KQQA 3M9MB 5J2CA 2A1JB 3H8WA 4J9MA 3BS5B 1RXWA 1S76D 2ODGA 4QWCA 4RPXA 5KFHA 4O5EA 4J9OA 4KLUA 3A0BU 2NRTA 4CDGA 2WFAA 4RQ4A 4EBCA 9ICAA 1TAUA 3WK5A 5DG7A 2RDIA 3ETRA 4ED0A 5KT6A 4BGDA 5J0RA 1Z3EB 3SZ2A 1NI3A 2VKQA 5L9XA 3H40A 5KL1B 5D49A 2Y1IA 4P4OA 2DFLA 1D9DA 7ICKA 3FM9A 4OCZA 3WKDA 4P4MA 4JWNA 9ICNA 1IV8A 4OJLA 4EX7A 1L3TA 1S77D 1N5WA 2RDJA 2BCVA 3KOOA 3F2CA 1X42A 5KG6A 1GO3F 4F3OA 4O9MA 2FLPA 1S9FA 1Q46A 4E0DA 3PSTA 2XICA 2Y0SC 1UA1A 2I1QA 3IHQB 1PK1A 2G5HB 1T7PA 2KK0A 1L3VA 1KEJA 1T3QA 1PK3A 4RQMA 3IV6A 3H4DA 5DDMA 2R8GA 3PX0A 2B21A 3KTQA 2KFZA 1SL1A 8ICEA 4P0QA 5J0YA 5KFMA 3UMBA 2HVHA 5J0OA 2OXOA 2WHEA 3M1YA
chains in the Genus database with same CATH topology
1X6JA 1PUZA 2LM4A 2JR5A 1X6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6J A;  1PUZ A;  2LM4 A;  2JR5 A;  1X6I A; 
#chains in the Genus database with same CATH topology
 4ED7 A;  3NRZ A;  8ICY A;  1RM6 C;  5KFD A;  1T94 A;  1X9W A;  4DSJ A;  4DL3 A;  4BXO B;  1T8E A;  4KLQ A;  2RP5 A;  1S97 A;  3QE9 Y;  3C2K A;  3QXG A;  5KAF U;  3JPO A;  3RH6 A;  4NLG A;  2W11 A;  3L3F X;  1XC9 A;  5KAI U;  3TAD C;  1NKB A;  3UXO A;  1ZQK A;  4JWM A;  4QZH A;  3JPQ A;  2WF7 A;  2GLE A;  1PVR A;  4NM1 A;  2MAX A;  2BQU A;  3NUQ A;  3WKB A;  4O5C A;  1BNP A;  2AXT U;  3C1Z A;  2HVI A;  3UMG A;  2KE7 A;  3ONN A;  4NV0 A;  9ICP A;  3EYZ A;  3PW0 A;  3AQF A;  2R8K A;  4KLO A;  8ICM A;  5C5J A;  3QU5 A;  5KFE A;  5KFW A;  3QYP A;  4MF8 A;  4DSI A;  4US8 A;  1UT5 A;  5JTI A;  3QNM A;  3QU7 A;  3PML A;  5ALK A;  3B9J A;  2VIX A;  3DDH A;  3T79 A;  5CRX A;  5ALF A;  5EE1 A;  1MA7 A;  4QZC A;  5F3X B;  5DLG A;  3RB3 A;  1X9S A;  3AN1 A;  2XGP A;  5KFX A;  1D8Y A;  4ECQ A;  2E5S A;  1WUD A;  5T14 A;  1X2I A;  2MRL A;  8ICP A;  4RQ2 A;  1HIW A;  4DFM A;  1M6Y A;  3CRX A;  2KHQ A;  4UB3 A;  4P0P B;  3V7L A;  2D8C A;  4YQW A;  4TUP A;  2BZF A;  8ICG A;  2ES6 A;  3HIL A;  2ESE A;  2ZIW A;  2G5I B;  4RQ8 A;  2H3Q A;  4KLE A;  3RAX A;  2W9C B;  3EUB 2;  2IOF A;  2HHX A;  2W9A A;  3ED5 A;  3GQC A;  5KG0 A;  1A0P A;  5KFK A;  2IOF K;  3QUC A;  1J2N A;  8ICO A;  5AK3 A;  1FO4 A;  1VLB A;  5B66 U;  1U45 A;  1JMS A;  2NYV A;  3NAS A;  1UQV A;  3F2B A;  1ZQZ A;  4OJ5 A;  5KG4 A;  5GTH U;  1QH9 A;  4M9H A;  4DF8 A;  1ZD3 A;  4ED8 A;  2F44 A;  2L5Y A;  2MUT A;  3C23 A;  5IIK A;  3TKA A;  2KEY A;  3ZD9 A;  3WK6 A;  1XSL A;  4KTQ A;  1NKE A;  2LKY A;  1UCV A;  5AIA A;  2C2R A;  4IQV A;  8ICU A;  3B0X A;  7ICG A;  2I5H A;  2E1E A;  2MA1 A;  1L8O A;  4M9L A;  1SKS A;  3ISD A;  5AI8 A;  5ALP A;  1SWV A;  2PKE A;  1PZN A;  5KFF A;  3C1Y A;  1ZQS A;  4KLI A;  4DL7 A;  2FJ6 A;  5KFR A;  3QEA Z;  5EWG A;  2BCQ A;  4RUC A;  1ZQC A;  4KN7 A;  3V72 A;  4PGY A;  3QEB Z;  2QKQ A;  4KLF A;  1ED1 A;  2ZIV B;  2KSO B;  1MQ2 A;  1DK2 A;  3TAC B;  2YY6 A;  3GIM A;  1H38 A;  8ICS A;  5L1M A;  4Z6D A;  1IM4 A;  2HBL A;  5FP0 A;  3SAF A;  1ZQF A;  2JEF A;  5KFJ A;  4TUQ A;  1BPZ A;  2NRZ A;  1RDF A;  3KHH A;  5KG2 A;  3THV A;  5DB8 A;  2G06 A;  1OW5 A;  1ZRN A;  1SL0 A;  4M04 A;  4ZH4 A;  1WWV A;  5CWR A;  4F5Q A;  3T3F A;  1TV9 A;  4FS1 A;  3ZDA A;  3L5K A;  4F92 B;  4DFD A;  4GXK A;  1SXD A;  1FIQ A;  4CNQ A;  3SAG A;  2YB1 A;  1B4F A;  3PR4 A;  1ZQX A;  2F1J A;  2LM1 A;  3K1R B;  4ECZ A;  4ECR A;  1D9F A;  1ZJN A;  5AI9 A;  4I2J A;  5F9L A;  4DLE A;  4PPX A;  3J81 j;  2PFN A;  1Y88 A;  4M9N A;  1Q3V A;  9ICC A;  4I29 A;  3WK4 A;  4ECU A;  2JHD A;  3RF9 A;  3AUO A;  4UAY A;  1S5L U;  4FE3 A;  3WKA A;  4UB1 A;  3H8J A;  4Q43 A;  2OYY A;  3IM1 A;  1ZQL A;  4QJF B;  4LVS A;  4EEY A;  4O5K A;  4K4I A;  1EXN A;  2E8N A;  5HP4 A;  2PXI A;  4GLX A;  3M8R A;  2PMZ F;  2F76 X;  3KKA A;  3PX6 A;  1NJX A;  2AQ4 A;  2BR0 A;  2VA3 A;  4LJX A;  1L7O A;  2EAO A;  3ISB A;  2KIW A;  2XID A;  4IQT A;  4TQS A;  1U47 A;  2NO4 A;  2FDR A;  3HKZ C;  5DB7 A;  2BCR A;  4F4W A;  1TK0 A;  2OWO A;  2ZIX A;  4DEZ A;  3RAQ A;  3JPN A;  3T5L A;  4QWD A;  2DPJ A;  2AGO A;  3G6V A;  2YML A;  1TVA A;  9ICR A;  2FLN A;  1Z1V A;  4YR2 A;  2HMX A;  2XVT A;  4PL2 A;  1NK8 A;  3BQT A;  3MFI A;  4ICA A;  1K1S A;  1KKX A;  2P35 A;  5DQH A;  1ZOL A;  2RLT A;  3MBY A;  4J9Q A;  9ICO A;  9ICM A;  5J0T A;  9ICX A;  3RBE A;  2FPM A;  5AM4 A;  5KFA A;  3WK8 A;  4EYH B;  4M9G A;  1ZQE A;  1KSP A;  9ICB A;  2W3S A;  3Q8P B;  2XY7 A;  2EQY A;  3T5K A;  1SV0 A;  3MGI A;  4O3P A;  7ICP A;  1ZQD A;  4UAW A;  4DOB A;  3PMN A;  2XCP A;  4ELV A;  2HOI A;  3MFH A;  3N7S C;  4CF3 A;  3CYM A;  5JRT A;  3LK9 A;  5HML A;  4QZD A;  4C8K A;  1Z00 A;  2GWS A;  2FI1 A;  3SR6 A;  1SZH A;  1NJZ A;  1PVQ A;  4KMO B;  4DQI A;  3NGD A;  5EE0 A;  4M47 A;  4F4Z A;  4QZI A;  5C0Y A;  3H8M A;  4M0A A;  4DSK A;  2R8I A;  4PJ0 U;  5J2B A;  4Y2Y A;  1KL9 A;  1TE2 A;  3PO5 A;  1L5U A;  1ZRM A;  4NL9 A;  5AKL A;  5KFZ A;  2FE9 A;  5KFN A;  3MR6 A;  3V7K A;  3PSI A;  2IBK A;  4Q45 A;  2H3V A;  1KFT A;  1JN3 A;  5AM0 A;  2KJ9 A;  2C2E A;  2ISP A;  5KNI A;  1V38 A;  2JV3 A;  4DQQ A;  1JUD A;  4C7Z A;  5HR7 A;  5BOM A;  4UAU A;  1NK5 A;  5CR0 A;  3BZK A;  2EZX A;  1CEZ A;  1HEK A;  5ALL A;  1S0M A;  5IIO A;  4YVZ A;  2W8L A;  3M9N B;  1YT3 A;  2WTF A;  5J2F A;  3SAH A;  1ZQR A;  4I2E A;  4OJO A;  2EZY A;  4PZO A;  5KG1 A;  4RQ1 A;  2W04 A;  4FBT A;  2ZXH A;  1A6S A;  2R18 A;  4NLC A;  4Y2R A;  3H7I A;  4YMM A;  7ICM A;  1QLN A;  5KFI A;  5III A;  3QUT A;  3AMZ A;  2KNJ A;  4RQN A;  2E1F A;  4DOA A;  1WWU A;  5L1K A;  4FS2 A;  1RPL A;  2W9C A;  3OHB A;  9ICE A;  5F9N A;  4FBU A;  3RR7 A;  2WB1 F;  2HBM A;  3PVX A;  4PZN A;  4NM2 A;  4P2H A;  5ALI A;  3V6K A;  4QIW C;  1ZXI A;  2BQR A;  4UAT A;  5J2K A;  3HP6 A;  3C5G A;  3L4P A;  4UAR A;  3H0M B;  1XSP A;  3NVY A;  5ALD A;  5KFS A;  2VA2 A;  4B9N A;  7ICH A;  3JPR A;  2F8L A;  3JPP A;  3BJY A;  3TAN A;  4QZ8 A;  2BKE A;  4MFA A;  4FO6 A;  4KLS A;  9ICU A;  1XU4 A;  4DQS A;  4PHA A;  1T3N A;  5AI6 A;  1CRX A;  8ICK A;  8ICN A;  4F4X A;  1ZQT A;  2PI5 A;  4ECT A;  4OD0 A;  5EWE A;  2W9B B;  1QCK A;  3V6H A;  1DOQ A;  2KZZ A;  4R64 A;  3H0L B;  3RB6 A;  5E79 U;  4PHD A;  4O3M A;  2K4P A;  1SGG A;  1A77 A;  1F44 A;  4YXM A;  4UBB A;  5CB1 A;  2WF5 A;  3MAB A;  4J9P A;  4ELU A;  1SXE A;  4QW9 A;  4DL6 A;  2H3I A;  1HUO A;  3CNH A;  4CF5 A;  4DS4 A;  4FZM A;  4Y2J A;  1FFV A;  4O3N A;  3IP4 B;  4F71 A;  3UXN A;  3TAQ A;  3FC4 A;  3NVV A;  1IG6 A;  8ICR A;  4MEX A;  4QZ9 A;  2NRX A;  1SV0 C;  1L6N A;  1U9L A;  4YG2 A;  1B0X A;  3Q8S B;  3OSP A;  2XY6 A;  2ZUC A;  1NK7 A;  2BCU A;  3FAH A;  2HHS A;  2DL0 A;  4YD1 A;  3H0R B;  5AIB A;  4NLB A;  4DFK A;  2AJQ A;  1RQL A;  2ZTC A;  4RQ6 A;  4OO1 J;  4Y2S A;  2ZJ8 A;  4F5O A;  5EOZ A;  2FLL A;  3SI8 A;  3SMV A;  3OGU A;  2J6U A;  2YMP A;  4QIW F;  1KLN A;  7ICT A;  2JZB A;  4BDP A;  3SV3 A;  3PW7 A;  4C8O A;  5J2A A;  2HW3 A;  5J0Q A;  2Z7J A;  4DL2 A;  2K8A A;  4IQW A;  4UB6 U;  5DG9 A;  3DV9 A;  2KIC A;  1V85 A;  2ASD A;  1LKY A;  4DOC A;  2KHV A;  5TIS U;  4HYK A;  2V9W A;  4DFP A;  1ZQW A;  3SEI A;  5CA7 A;  3AQE A;  2AGQ A;  3LYS A;  3RRG A;  2IHN A;  8ICF A;  2V4R A;  4Q8F A;  5DG8 A;  1ZD2 P;  2GH1 A;  4WJ3 B;  4I2I A;  2LM4 A;  2DBY A;  4B9T A;  3IRU A;  3SD7 A;  3UQ0 A;  1QTM A;  2Y9U A;  1XS9 D;  4DSL A;  2MUT B;  3ZI4 A;  1COO A;  3RRH A;  2HDO A;  5AKH A;  1Z19 A;  2KP7 A;  4AP9 A;  4NY8 A;  5J2G A;  1AQ6 A;  1ZQI A;  5AKE A;  3H8S A;  4YR0 A;  2KTQ A;  4JV1 A;  2ZG6 A;  2P6U A;  4US9 A;  2K8B B;  4QZE A;  1ZET A;  1QQ7 A;  4UB4 A;  2DUY A;  2KZ3 A;  4QZF A;  3PSP A;  1QQ6 A;  2BQ3 A;  1Z00 B;  4OJP A;  5ALY A;  3PSF A;  2BHN A;  2EAN A;  9ICV A;  4DL5 A;  1Q3U A;  2UVW A;  3V7J A;  2C22 A;  2ZJA A;  4ECS A;  1DRG A;  1O03 A;  4QWB A;  4M6W B;  3PV8 A;  2Y9T A;  5KT7 A;  2DWQ A;  4IC9 A;  1A76 A;  5BOL A;  8ICJ A;  2HI0 A;  2ZTE A;  1YZ7 A;  4Z6F A;  2D3D A;  1HJP A;  2LBO A;  3PZP A;  5DLF A;  2EDU A;  3RH5 A;  4ELT A;  5J8Y A;  3GV8 B;  1DXS A;  4JV0 A;  4UB2 A;  3U26 A;  2ZUD A;  2RQ5 A;  3C2M A;  5HNK A;  2ISO A;  8ICT A;  2E8P A;  3FDS A;  5KFC A;  1ZQJ A;  5J0S A;  5J8Y C;  5A0L A;  3GV7 B;  3T5J A;  3VC8 A;  4EZ6 A;  2A3V A;  9ICI A;  1BVS A;  1X66 A;  5TZV A;  1ZQY A;  4PH5 A;  1MN8 A;  4QWE A;  3SV4 A;  2KD1 A;  7ICU A;  3GIL A;  1L7P A;  4K4H A;  2DPI A;  1L7N A;  1ARO P;  2OM6 A;  4R63 A;  3GV5 B;  2VAN A;  4ECV A;  4BXO A;  3PW4 A;  2JGA A;  3MC1 A;  4ED2 A;  5IIN A;  2QB1 A;  4TUS A;  1RYU A;  5CEH A;  4DCC A;  3BQ0 A;  1N5X A;  4RQ7 A;  4BJQ A;  1BPB A;  5EE3 A;  5ALO A;  5CP2 A;  2JH7 A;  5J2J A;  4F2S A;  1F0M A;  4KLM A;  1XO0 A;  1X9M A;  4IR1 A;  9ICT A;  5H2F U;  2JXJ A;  2AH5 A;  3FYH A;  3QUB A;  5J2E A;  1N60 A;  2NRV A;  4EYI B;  1N61 A;  4NXZ A;  8ICW A;  4KIT B;  1ZQU A;  4YXJ A;  2HBJ A;  3HJE A;  2FPK A;  1WCL A;  4MEY A;  2D6F C;  2G0A A;  4I27 A;  1U49 A;  1ZQ1 C;  3RJE A;  4RNN A;  1IXR A;  8ICX A;  3RR8 A;  1BPD A;  2R8J A;  3NTU A;  3LDA A;  5AK5 A;  4CE6 A;  3QU2 A;  5DBA A;  3WKC A;  1B22 A;  1NK0 A;  2KVS A;  3DEE A;  5AI0 A;  2XC9 A;  3ICX A;  2H3F A;  2JMG A;  4K4G A;  2KIV A;  2KMD A;  4I2B A;  5DDY A;  2GO7 A;  2DGZ A;  5AM2 A;  4O3Q A;  1RXV A;  2CXY A;  4FZL A;  4JB3 A;  1P7D A;  4R8U B;  2ATL A;  1BPE A;  4UAV A;  5KFY A;  1MQ3 A;  5G5H A;  3F2D A;  1N63 A;  3BDP A;  2LYB A;  1ZQB A;  1XO1 A;  4KLT A;  3QUQ A;  3K1Z A;  3N97 B;  4RNO A;  2F1I A;  4A8E A;  4DFJ A;  3BQ2 A;  5KFV A;  5AK6 A;  1KBU A;  4PHE A;  2BDP A;  4FFD A;  8ICI A;  4MHV A;  4J03 A;  4UB5 A;  1LB2 B;  3AU2 A;  4PL1 A;  4JV2 A;  1ZQM A;  3TAD A;  5BPC A;  1JAL A;  2LI6 A;  2W03 A;  1LV5 A;  4KLG A;  5KG5 A;  2W43 A;  2YB4 A;  4R8U A;  4USA A;  2YX8 A;  1KFS A;  7ICI A;  8ICB A;  3UM9 A;  4UAZ A;  2ZIU A;  4C80 A;  4P4P A;  1NOM A;  3RJG A;  3OJU A;  5DB9 A;  2W55 A;  3O0F A;  1X9X A;  1ZD4 A;  4F2R A;  2WAQ C;  5ALU A;  1U48 A;  4B9V A;  2YMM A;  3QZ8 A;  3HW8 A;  4Y2Q A;  2OCE A;  4IQU A;  4Y2T A;  3BZC A;  4B6J A;  1JRP A;  2A1J A;  3AU6 A;  5L1I A;  2VA8 A;  3F5E A;  4F50 A;  1C7Y A;  5KT3 A;  4M2Y A;  2F2A B;  5J29 A;  8ICC A;  1Z4O A;  1DGS A;  1VJ5 A;  1WCN A;  1JX4 A;  4ZOH C;  3NS1 A;  4I2D A;  7ICF A;  2G09 A;  2G07 A;  4OJ6 A;  4J9N A;  1K5O A;  2ZUB A;  4RNM A;  2XO7 A;  5ALS A;  3Q8K A;  1ZQA A;  2W8K A;  1IIP A;  2HSZ A;  4YN4 A;  2BDU A;  2VJ5 A;  1TK5 A;  1J2M A;  2P66 A;  3ETL A;  3GDX A;  3PY8 A;  2QB0 A;  2IHM A;  4Z6E A;  1NK4 A;  1F5S A;  3N7R C;  1ZYQ A;  2CN1 A;  1L8L A;  5KFU A;  2OH2 A;  2KV2 A;  5DBB A;  2C28 A;  2M9N A;  1KN5 A;  2Y1J A;  4Y2V A;  4Y2U A;  3HX0 A;  4UW9 A;  3K4G A;  4C8L A;  4FZN A;  4EZ9 A;  5KFG A;  4P0Q B;  4XA5 A;  4ECW A;  1KW4 A;  1TFR A;  1NKC A;  1QSL A;  2F77 X;  2QAR B;  4YR3 A;  3C28 A;  2HHV A;  1SWW A;  4M9J A;  3GFK B;  1KRP A;  3AL0 B;  1RYR A;  4JMU A;  4KN4 A;  1U4B A;  4DSF A;  3RH4 A;  3QU4 A;  4EEK A;  5CJ7 A;  4M6W A;  4I2G A;  4IS7 A;  1TKD A;  2KKP A;  5DGB A;  2BCS A;  3D2Q A;  1TAQ A;  4RT2 A;  1SKW A;  3AEV A;  3SQI A;  4J9K A;  2AQ0 A;  1ZQV A;  3ZD8 A;  5AKJ A;  3C21 A;  1ZQH A;  1NJW A;  3MGV A;  4BWM A;  1NK6 A;  5J0U A;  2KN7 A;  2IOH A;  3IG8 A;  2W9M A;  5DKW A;  3RJK A;  2EH9 A;  5J2I A;  4KLJ A;  5DBC A;  3ORY A;  1SIJ A;  3RBD A;  2W54 A;  3M8S A;  4UB8 U;  4QNL A;  2IMW P;  2AU0 A;  4CGZ A;  3KD3 A;  5ALG A;  5AK4 A;  4TQR A;  4F91 B;  4YMO A;  2H5X A;  5KFQ A;  3I76 A;  2UVU A;  3QX7 A;  2C2D A;  4F4Y A;  3EW9 A;  2J6T A;  5L1J A;  1DK3 A;  3N28 A;  4CF4 A;  4UBC A;  2K4E A;  3RJJ A;  2KFN A;  4IL6 U;  4J9L A;  4ED3 A;  2F1H A;  4EBE A;  4F5P A;  1TK8 A;  2NO5 A;  3Q8Q B;  5ALM A;  2PFQ A;  8ICH A;  5KT2 A;  1SKR A;  4CCH A;  3OJS A;  2LHT A;  4XRH A;  5JUM A;  3N7P D;  5D46 A;  5AI5 A;  2ZIU B;  3KBB A;  4DWI A;  2ZTD A;  1FFU A;  1HUZ A;  2G08 A;  1J97 A;  4I2F A;  4I28 A;  4KX3 A;  3HWT A;  4I2C A;  2N1R A;  3AM9 A;  4J9S A;  7ICL A;  1S0O A;  2DQN B;  2YTU A;  4NJ8 A;  4O3S A;  1N48 A;  3KKA C;  4G9B A;  3WK7 A;  2JEI A;  4DF4 A;  4YCX A;  3ALR A;  1N62 A;  4EX6 A;  4DSE A;  3G6Y A;  2I6X A;  2K60 A;  1UHU A;  5ALT A;  2VJ4 A;  2HBK A;  3QU9 A;  4C4T A;  4RPZ A;  3BS5 A;  3H4B A;  5G5G A;  8ICV A;  3CW2 C;  2DKZ A;  4XQ8 A;  4ED6 A;  2J6S A;  4GXI A;  1ZJM A;  3KHR A;  2QAR A;  4C0Z A;  2PMZ C;  4BWJ A;  4UQG A;  3V6J A;  7ICQ A;  4C7Y A;  4R66 A;  3KHL A;  1T4G A;  4Y2P A;  3JPS A;  3EPG A;  5J0X A;  1OUQ A;  1JXE A;  3HKZ F;  2AHO B;  1ZD5 A;  2OHF A;  3LVW A;  5IIL A;  5D4B A;  2Q4T A;  3KZI U;  4ACO A;  2JZB B;  2ZIV A;  3F53 A;  4B9M A;  5KG3 A;  1LVH A;  1X6J A;  1UT8 A;  2FPL A;  1CUK A;  3GZF A;  4F4K A;  2HHQ A;  4KLD A;  4RQ0 A;  1O08 A;  2XY5 A;  2BPG A;  1LKY B;  5J0W A;  5AKK A;  2JRZ A;  5IIJ A;  4JK1 A;  3R9K A;  2YN4 A;  2BGW A;  2Y0S F;  4IRK A;  2KVC A;  3E0F A;  1FEZ A;  2ALZ A;  1OXJ A;  3E2E A;  3JPT A;  9ICW A;  5J2H A;  3C29 A;  3HRD D;  4GC6 A;  5AKZ A;  3OSN A;  4O3R A;  5KTQ A;  4RT3 A;  4PHP A;  3PW2 A;  4DS5 A;  4F72 A;  5ALR A;  1PK1 B;  1UPH A;  3Q8R B;  2UVR A;  7ICO A;  2HHW A;  2PFO A;  2XGQ A;  3LWL A;  4RQ5 A;  4NL9 C;  2UVV A;  1BPX A;  4RUA A;  4QWA A;  3D2S A;  9ICG A;  4AYB F;  1MC8 A;  3VCB A;  4ED1 A;  8ICL A;  5ALZ A;  2ZIX B;  3MDA A;  4Q44 A;  2PI4 A;  4GIB A;  3BQ1 A;  1BPY A;  2WF9 A;  2LPE A;  4AYB C;  1MSW D;  4F5N A;  5DB6 A;  5KFT A;  3RB0 A;  1ZQG A;  4Q8E A;  2NV3 A;  1COK A;  1ZQP A;  2HOF A;  2ASJ A;  5KL8 B;  3RB4 A;  5EE9 A;  2KSO A;  2E8O A;  2JEJ A;  1QSS A;  2XCA A;  2M0N A;  1RQN A;  3N4M B;  3KZX A;  3PX4 A;  5ALE A;  4B9U A;  4MFC A;  3RJH A;  4MF2 A;  1KFD A;  2FMQ A;  2JR5 A;  3BS7 A;  3LWM A;  5KFB A;  4F5R A;  1NJY A;  2KJ8 A;  2DKX A;  3ZDE A;  4IR9 A;  4RZR A;  1QQ5 A;  2EAP A;  4UAS A;  3TI0 A;  1B43 A;  3M9O B;  5AKG A;  5DQI A;  1XNS A;  1L3S A;  1KDH A;  3PW5 A;  2I9G A;  3RJI A;  4NLN A;  1SV4 A;  3D2N A;  4X5V A;  3IN5 A;  1K1Q A;  4YP3 A;  3T5H A;  5AIC A;  4QZG A;  2XI9 A;  1NZB A;  1SB3 C;  4EEL A;  3PO4 A;  1PVP A;  3K75 D;  2PFP A;  4U7C A;  3I1Y A;  4DO9 A;  4DL4 A;  3OPX A;  1L3U A;  5ALW A;  1JI7 A;  5KFP A;  3WU2 U;  2HHU A;  3D6J A;  3Q8M A;  5AM3 A;  4KLH A;  5AM5 A;  2A1A A;  4RPY A;  4CRX A;  5KT5 A;  4R65 A;  2F8K A;  1WG8 A;  9ICH A;  2DF4 B;  4DLG A;  5ALJ A;  3BQ7 A;  5AKY A;  5HHI A;  5ALH A;  5L1L A;  4DQR A;  2K89 A;  4C8M A;  1WYG A;  3IDW A;  1URJ A;  4TUR A;  3QZ7 A;  3UPQ A;  1JXL A;  3RTV A;  5ALN A;  2LYH A;  2IA6 A;  2EAM A;  2QB0 B;  2O6K A;  3GU3 A;  4QZB A;  9ICS A;  4DQP A;  8ICZ A;  3A0H U;  4YFK A;  3S6J A;  2CRX A;  2AGP A;  4IRD A;  1SL2 A;  2YMQ A;  1BGX T;  3MR2 A;  3B0Y A;  4U6P A;  1NZP A;  2A19 A;  3I28 A;  7ICN A;  3IG5 A;  3EWA A;  2W7P A;  4F8R A;  1JRO A;  2LYA A;  5KT4 A;  4NWI A;  5JU5 A;  3HT3 A;  5CHG A;  4O3O A;  5GTI U;  3M6K A;  3G6X A;  5EWF A;  2KJ5 A;  1S0V A;  1RZT A;  4GC7 A;  2E3T A;  2KG5 A;  7ICR A;  4I2H A;  5HR6 A;  3MR3 A;  2HCF A;  4RQ3 A;  1V97 A;  4O0I A;  2CPR A;  2W7O A;  3C2L A;  9ICF A;  3TAR A;  1QSY A;  4B9S A;  4BUG A;  2JEG A;  1SZP A;  1S8O A;  9ICJ A;  4F93 B;  1S10 A;  1TAM A;  3ZDB A;  2ASL A;  3WK9 A;  3TFS A;  2H3Z A;  4NLZ A;  3TQ1 A;  4MFF A;  2WAQ F;  2YQE A;  5DGA A;  3UQ2 A;  4G3I A;  3EZ5 A;  4LZD A;  2P6R A;  1X40 A;  3ZDC A;  7ICS A;  1C20 A;  1NNL A;  3GIK A;  3KFU F;  2HHT A;  2JH1 A;  5KG7 A;  4KMU A;  7ICJ A;  1N2X A;  1CI4 A;  2WF8 A;  4QZA A;  7ICV A;  5ALX A;  2WB1 C;  2W9B A;  4NLK A;  5KFL A;  4J9R A;  2RRD A;  4Y2X A;  9ICL A;  1PUZ A;  5B5E U;  4JUZ A;  2V4Q A;  1N56 A;  4KLL A;  2FMS A;  7ICE A;  2EZZ A;  3OHA A;  1D8L A;  1Q8K A;  5DQG A;  3PNC A;  4YD2 A;  3TFR A;  2KKV A;  3NRW A;  1Z4N A;  4IRC A;  1VDV A;  3SYZ A;  5HMM A;  2Q0Z X;  1S0N A;  2NRW A;  3KHG A;  2OEH A;  3MR5 A;  5ALV A;  3EPI A;  1ZQN A;  2K8C B;  1ZQQ A;  3Q8L A;  4C4S A;  2KZM A;  1ZQO A;  3GIJ A;  1Z1B A;  2MSN A;  2KOB A;  4BX9 C;  2ZJ5 A;  2BPC A;  3UMC A;  2FMP A;  4EBD A;  9ICQ A;  5HHH A;  5AHX A;  3NVZ A;  2W3R A;  4GXJ A;  2F3N A;  2LMR A;  2B0C A;  1YZ6 A;  2B6G A;  4YMN A;  2HOQ A;  3WKE A;  4GFJ A;  3UXP A;  5ALQ A;  3RJF A;  1JIH A;  1XWL A;  1V9P A;  3SEN A;  5J2D A;  4I2A A;  3RFA A;  4C4R A;  5KFO A;  4PGQ A;  3MGH A;  5K4L A;  2RHF A;  3MDC A;  4EEN A;  1X6I A;  4P0P A;  3NVW A;  4HAI A;  3C5F A;  5AI4 A;  2ZXI A;  2K4H A;  3HPO A;  2GOL A;  3M6Z A;  1UA0 A;  4XUS A;  2MU2 A;  3E58 A;  5AM1 A;  3CP8 A;  4PGX A;  2E8M A;  3PR5 B;  2ZIW B;  5AKI A;  4Z6C A;  4C8N A;  1XSN A;  3ISC A;  1DGJ A;  4B9L A;  1ECW A;  3OTQ A;  1RYS A;  2QLT A;  2BPF A;  8ICA A;  2WF6 A;  8ICQ A;  1KTQ A;  1D8B A;  5J0P A;  4RU9 A;  4LZG A;  3TAP A;  2K4I A;  1L7M A;  4ECY A;  3ZDD A;  1RG6 A;  5AKX A;  2R8H A;  5IIM A;  1BNO A;  3M7D A;  4KX5 A;  3GII A;  9ICK A;  1NK9 A;  4ECX A;  3F5A A;  3LVV A;  4QW8 A;  1KQQ A;  3M9M B;  5J2C A;  2A1J B;  3H8W A;  4J9M A;  3BS5 B;  1RXW A;  1S76 D;  2ODG A;  4QWC A;  4RPX A;  5KFH A;  4O5E A;  4J9O A;  4KLU A;  3A0B U;  2NRT A;  4CDG A;  2WFA A;  4RQ4 A;  4EBC A;  9ICA A;  1TAU A;  3WK5 A;  5DG7 A;  2RDI A;  3ETR A;  4ED0 A;  5KT6 A;  4BGD A;  5J0R A;  1Z3E B;  3SZ2 A;  1NI3 A;  2VKQ A;  5L9X A;  3H40 A;  5KL1 B;  5D49 A;  2Y1I A;  4P4O A;  2DFL A;  1D9D A;  7ICK A;  3FM9 A;  4OCZ A;  3WKD A;  4P4M A;  4JWN A;  9ICN A;  1IV8 A;  4OJL A;  4EX7 A;  1L3T A;  1S77 D;  1N5W A;  2RDJ A;  2BCV A;  3KOO A;  3F2C A;  1X42 A;  5KG6 A;  1GO3 F;  4F3O A;  4O9M A;  2FLP A;  1S9F A;  1Q46 A;  4E0D A;  3PST A;  2XIC A;  2Y0S C;  1UA1 A;  2I1Q A;  3IHQ B;  1PK1 A;  2G5H B;  1T7P A;  2KK0 A;  1L3V A;  1KEJ A;  1T3Q A;  1PK3 A;  4RQM A;  3IV6 A;  3H4D A;  5DDM A;  2R8G A;  3PX0 A;  2B21 A;  3KTQ A;  2KFZ A;  1SL1 A;  8ICE A;  4P0Q A;  5J0Y A;  5KFM A;  3UMB A;  2HVH A;  5J0O A;  2OXO A;  2WHE A;  3M1Y A; 
#chains in the Genus database with same CATH homology
 1X6J A;  1PUZ A;  2LM4 A;  2JR5 A;  1X6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...