1X6IA

Crystal structure of ygfy from escherichia coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
HMDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRIFIRLLECDDPDLFNWLMNHGKPADAELEMMVRLIQTRNRERGPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ygfY
publication title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 1x6iA00
1X6IA 2LM4A 1PUZA 2JR5A 1X6JA
chains in the Genus database with same CATH superfamily
4O3RA 1DOQA 4QZBA 5KFAA 2JH7A 2XVTA 4BX9C 4LJXA 3TADA 4RT3A 4F71A 4UB8U 1K1QA 3MR2A 4WJ3B 1OW5A 2KG5A 1CI4A 3EUB2 5EE9A 2WTFA 5AIAA 4OCZA 2BGWA 1BPXA 5J2BA 2LYHA 2MAXA 2VJ4A 1IXRA 2A1JA 4IRCA 2FI1A 3PW7A 4JWMA 4UASA 4CF3A 4DCCA 3OJSA 4J9RA 2OM6A 4KLHA 4I27A 3D2QA 5EE0A 1T7PA 2DF4B 5CA7A 5J2GA 1ZQRA 3LVWA 1ZQTA 1BPZA 2K89A 2JMGA 5DLGA 1L3UA 3A0HU 4F2SA 2C2EA 4ECQA 5ALGA 3WKBA 2AGOA 3RAQA 4FE3A 2LM1A 4NY8A 7ICQA 2JZBB 2GLEA 2YQEA 4F5RA 4OO1J 3GV5B 2WF8A 3C5GA 4MFCA 2JR5A 4DWIA 2N1RA 1J97A 4RZRA 4NL9A 8ICRA 1SXDA 1KN5A 4EZ9A 4F8RA 5L1LA 3V7KA 8ICPA 2E3TA 4TURA 4KMUA 4DQQA 3QEBZ 2J6UA 2WB1F 3PX4A 2BZFA 2K4PA 5KT5A 4I2HA 2HOIA 8ICCA 2BCUA 2CPRA 2ZIUB 3MC1A 4ED8A 5DG7A 1UT5A 4MFAA 4DSKA 2Q0ZX 2WF6A 4DO9A 5AI4A 2W55A 4HYKA 2EAOA 8ICMA 3AU2A 2JHDA 3OPXA 3PSPA 1VDVA 1T3NA 3SENA 3QE9Y 4UAZA 3WK5A 1RG6A 2Q4TA 1KSPA 2E8OA 3Q8MA 4UW9A 1SGGA 1U49A 3AM9A 4ACOA 5KFNA 1IIPA 2W9BA 3C2MA 8ICKA 1S77D 5AKZA 2HBLA 4PPXA 2RDJA 5D46A 4RQ5A 5KG4A 1PK1B 2KJ8A 3JPSA 1TV9A 1BGXT 4US8A 4Q43A 2AHOB 4O9MA 4QWEA 5KG2A 4DOCA 7ICGA 4F5PA 3VC8A 5DQGA 1QQ6A 2AJQA 5IIIA 1O08A 5A0LA 3GU3A 3PNCA 4Z6FA 1N60A 3F2BA 4PHDA 3RJJA 1U47A 3BS7A 3QUBA 3B0YA 1SL2A 1TE2A 1IV8A 1SKWA 5ALTA 1KLNA 2EAPA 3FDSA 1RYUA 4NLCA 3C28A 3TFSA 4Y2PA 3RRGA 1F0MA 1FEZA 4O3MA 2HSZA 5ALZA 3GILA 4F50A 3CRXA 2OCEA 9ICQA 3ED5A 3CW2C 4F5QA 1KFTA 3M7DA 3WKDA 2C22A 1Z1BA 1ZQHA 1MC8A 5DBCA 1S0NA 2ZIVB 5J8YA 2EDUA 4PGQA 5CHGA 1Z1VA 3RRHA 1C7YA 3ORYA 4UARA 2FJ6A 4ECYA 2ASDA 2FLNA 4BDPA 2BCSA 2D8CA 2JEFA 4P0QB 1WG8A 4C4SA 2Y0SC 3M8RA 2FLLA 1N63A 3ALRA 1JN3A 3K4GA 2YB1A 5CWRA 4R66A 1SWVA 5J2AA 2KZ3A 3QX7A 1F5SA 4YN4A 3T5HA 9ICHA 2AQ4A 3ISBA 3WK8A 2JV3A 2BDUA 1UQVA 4JUZA 3KZXA 5KAFU 5ALOA 3ZI4A 4P2HA 1N2XA 4DL3A 2BHNA 3ZDCA 3BQ7A 3UQ0A 2IHMA 3EYZA 2H3FA 1FIQA 5KFVA 3CYMA 1Q3VA 2KSOB 1O03A 2MUTB 3MDCA 4KN7A 2JXJA 4R8UA 4JV2A 5HHHA 4NLNA 2ZXHA 4BXOA 5EWEA 1NZBA 1XO1A 1ZJNA 2BCVA 1DGJA 2KP7A 3ZD8A 2R8HA 3H0MB 3UMCA 4PHEA 2XCPA 4QIWC 1JXLA 4F3OA 4F5NA 4OJOA 2F3NA 4GC6A 3RTVA 3D2NA 3RBEA 1NKCA 4ECRA 4DSJA 4UB6U 4IRKA 4JV0A 1PVPA 4U7CA 1X9SA 4DQIA 4GC7A 1XNSA 8ICZA 2FE9A 2RLTA 2FPKA 1L3VA 2QB0B 2HHVA 5KFWA 3LDAA 5EWGA 4YD1A 3UXNA 1L8OA 3WK6A 3F2DA 1TK0A 2W7PA 4GXJA 2F8KA 4RNMA 2B0CA 2KD1A 3PO5A 1YT3A 2F2AB 2W9CA 5KFGA 1KKXA 4J03A 2DKXA 2UVVA 4QNLA 4RU9A 4UATA 3J81j 2LPEA 2ATLA 3OHBA 2OHFA 5E79U 4O5CA 3CNHA 3C29A 1ZQCA 1S9FA 2V4QA 4PHAA 4Q44A 4EELA 1OXJA 2DL0A 3EZ5A 4UBBA 4DOBA 5ALPA 2YX8A 4GLXA 1L7PA 4F91B 1B22A 5B5EU 1Q8KA 1ZRMA 2E1EA 2AU0A 3IRUA 4USAA 2R8JA 2GOLA 5J2IA 4YD2A 3KZIU 3MABA 2C28A 3Q8QB 4ZOHC 1ED1A 2W9MA 3SYZA 1WWVA 3AQFA 4RQ2A 4RQMA 1U45A 4CF4A 2DQNB 3BZCA 3PVXA 3KHGA 2RDIA 4O0IA 5ALKA 5FP0A 8ICBA 1ZQOA 2V4RA 7ICLA 4Y2YA 2ZUCA 2HVIA 3LK9A 8ICJA 1DXSA 5ALEA 2AH5A 4C80A 4QZ8A 2MSNA 4KLDA 2WAQF 3NVYA 5DGBA 4IR9A 2K8CB 2I5HA 4EX6A 1RQNA 2ZTCA 2QB1A 2ZJ5A 5AKJA 4KLGA 3PO4A 3OTQA 3PMLA 4M0AA 4RQ7A 4P0PA 4QZHA 2C2DA 5J0UA 1KBUA 5KFQA 3THVA 4CCHA 2F1HA 3QU4A 3UMBA 1N5WA 4UBCA 1RZTA 1TAUA 4KLLA 3KTQA 5KG6A 3I76A 3Q8SB 5ALIA 1D8BA 3GFKB 4DF8A 5J0PA 1JXEA 4DFPA 2K4IA 1XWLA 4ECVA 5DGAA 1ZQGA 5AK4A 2K8BB 5KFZA 1RXVA 1S76D 2KIVA 1ZQNA 2H3IA 2P6UA 4J9OA 5AHXA 3ZDDA 2RRDA 2DFLA 2OH2A 3H0RB 3UXPA 2EANA 5L1JA 1N56A 4AYBC 3RB4A 2E8MA 5AI0A 4M9NA 3OJUA 4DSLA 4UB4A 3QEAZ 1RQLA 3NVWA 4Y2UA 3OSPA 3PZPA 2KK0A 1X40A 4KN4A 4LZDA 9ICUA 5CJ7A 5J2KA 5ALSA 1Z19A 5J0WA 1S8OA 2Y0SF 2KICA 4KLEA 1F44A 3JPOA 3JPQA 2WF7A 1RM6C 5AKEA 2I9GA 1TK5A 3FM9A 2ZIXA 5JUMA 4M04A 4EEKA 4QWDA 3Q8LA 4FFDA 4YXJA 1N5XA 3KKAC 1QTMA 2CRXA 2GO7A 2VANA 4KTQA 3SAGA 5ALMA 4MFFA 4UB1A 4F5OA 2ZIWA 1UA0A 2Z7JA 3I28A 3RJFA 1NK6A 5KFLA 2KJ5A 3GDXA 2GH1A 1RYRA 5EE1A 3E2EA 2YY6A 1L7MA 1QCKA 1SIJA 3SZ2A 3TARA 4OJ6A 4B9LA 2KIWA 3G6XA 1AQ6A 4YP3A 3NASA 2KZMA 4BUGA 2RHFA 3L4PA 3HJEA 3AL0B 4YVZA 3IDWA 4F4KA 5JTIA 5TISU 1JALA 1COOA 1TKDA 8ICNA 3WK7A 2PI5A 4M9HA 2R8IA 5J2CA 5KFXA 2NRVA 1T8EA 2JEJA 4QZCA 5AI8A 3RJGA 3PW5A 8ICYA 3PSFA 4FBTA 2G5HB 3LVVA 3N7RC 3K1RB 1KL9A 2CN1A 1PVQA 3WKEA 5ALWA 4CF5A 3RJEA 8ICVA 3JPNA 5IIJA 1NK5A 4ED0A 2ZUBA 1L7NA 3NRWA 9ICOA 4B9UA 1L8LA 3RAXA 4QW8A 1ZYQA 7ICVA 3CP8A 3IG8A 4CRXA 1SZPA 1ZQJA 1NKBA 2LHTA 3PY8A 4UAYA 1D8YA 3H40A 1ZETA 3BQ1A 1B43A 3QU5A 4I2BA 3FYHA 1VLBA 2QLTA 1URJA 3T3FA 2ZTEA 3F5AA 3IM1A 3SD7A 2AGPA 3BQTA 1JX4A 5CB1A 2C2RA 4YXMA 1SL1A 1SB3C 4U6PA 8ICXA 2DWQA 4FZLA 4PL1A 2FPLA 1DRGA 2GWSA 1V9PA 4RT2A 2W8KA 2XY5A 4GXIA 4J9KA 9ICPA 3SV3A 3ZDEA 1Q3UA 1S10A 4MHVA 2Y1JA 5IILA 2W43A 1NK8A 5L9XA 4DLEA 4F2RA 8ICQA 2JZBA 8ICGA 1WWUA 5J0OA 1ZQEA 5DBAA 4C8KA 2ALZA 2HW3A 4C4TA 2EQYA 2XIDA 3RFAA 1NK4A 1XSLA 2AGQA 4C0ZA 4C4RA 2ISPA 4FO6A 4J9NA 1KFDA 4DS5A 2HHTA 1WCLA 2W9BB 1ZQSA 2WHEA 4RQ0A 5AI9A 3ZD9A 5J2DA 3PX6A 2UVWA 3SR6A 3UMGA 3RH4A 3PW4A 4RQ6A 3I1YA 2RQ5A 1CUKA 5DQIA 2ZIUA 3RF9A 1J2NA 2HHUA 4B9NA 2J6SA 3AU6A 4EEYA 1NOMA 2XY7A 3DEEA 4UAVA 1RYSA 5BPCA 2NO4A 2VA3A 5DQHA 4PL2A 4AYBF 2WAQC 3B9JA 1XSNA 3BS5A 1ZJMA 1ZQAA 2AXTU 3N97B 8ICTA 4YR0A 2LKYA 3OSNA 3SAFA 4QZAA 8ICSA 3SEIA 4KLTA 2LYAA 2FMQA 1BPDA 3QU2A 5HHIA 9ICVA 3SQIA 4ED3A 9ICBA 1OUQA 1BPEA 1PK1A 2JGAA 5IIMA 5ALRA 7ICUA 4F92B 8ICFA 9ICLA 1SV4A 2I6XA 2MU2A 4EZ6A 2KFNA 1MA7A 4M2YA 3TQ1A 1BPBA 2EH9A 1ZXIA 4YFKA 1T3QA 2W3RA 4FS1A 5AKLA 2XGQA 3F53A 3Q8RB 1ZQPA 2PFPA 2KVSA 1L5UA 4ELUA 4J9SA 4JK1A 4PHPA 1KFSA 4IQUA 2XGPA 4C7ZA 7ICKA 2QARB 1T4GA 5KT2A 3OHAA 3LWMA 4P4PA 1FFVA 4M9GA 3ZDAA 2W04A 2A3VA 5DB7A 1PUZA 4P4OA 1NZPA 2KKVA 3Q8PB 3NGDA 2MRLA 4Z6CA 3PSIA 1SV0C 4J9LA 1HEKA 3QXGA 4YR2A 3AMZA 1Z00B 2ZIVA 2G09A 5AM5A 4RUCA 5HNKA 2ZJAA 5ALLA 3TAPA 2LBOA 4DFJA 4I2GA 4DL5A 1QLNA 3TI0A 2IOFA 3AEVA 1ZRNA 4B9TA 3G6VA 2ESEA 9ICNA 2VKQA 2Y1IA 3TKAA 3GV7B 2D6FC 1S97A 3QZ8A 2PFNA 5KNIA 2JEGA 4P0QA 3HW8A 4JV1A 3KHHA 1ZQWA 2VA2A 2YMPA 5DBBA 3IV6A 9ICGA 4EBCA 2PMZC 4J9MA 4EBDA 4ECZA 2HHWA 4TQRA 9ICRA 4DQSA 4XUSA 2LMRA 5KAIU 1L3TA 2B6GA 5KFHA 2HOQA 4DL6A 1JUDA 3M8SA 2DPJA 3H8SA 3AN1A 5AM0A 1SXEA 2KE7A 7ICTA 2KHQA 2NO5A 5ALJA 2W7OA 3M9NB 2DKZA 5D4BA 3JPTA 4JWNA 3QU9A 1NJXA 4BWJA 2ASLA 4XQ8A 2KSOA 2MUTA 3H8MA 1ZD3A 4GXKA 3TAQA 5JU5A 2BCQA 1JI7A 4P4MA 4EYHB 2BKEA 2EZYA 4QWBA 1ZQDA 4RQNA 3F5EA 5HMMA 4RPZA 2F1IA 2KN7A 4QWCA 3C1YA 5KFPA 4BWMA 4I2EA 4C8LA 1JROA 4QZEA 5ALQA 4G9BA 2KJ9A 4NLGA 4X5VA 1SKRA 3BQ0A 3RJIA 3JPRA 4ELVA 3MGHA 3N28A 2F76X 3HP6A 5KT6A 2ISOA 1CEZA 1ZQVA 5J2JA 4KLMA 4M9JA 3V7LA 5BOMA 4QZGA 4I2FA 8ICHA 4O3OA 1ZD4A 4LZGA 2HVHA 3JPPA 2BPCA 4NLKA 2XY6A 5KFKA 3ONNA 4CDGA 4NLZA 4KX5A 5GTHU 1ECWA 5L1KA 8ICWA 1ZQKA 4ECSA 2KEYA 1S0MA 2YMMA 2H3VA 5AK5A 1ZD2P 4IQVA 4ED2A 3PV8A 4RQ8A 4FZNA 4IR1A 1V38A 4IS7A 3BQ2A 7ICFA 3NTUA 4UB2A 3H7IA 5B66U 2H5XA 2XC9A 2NRXA 4KX3A 2EAMA 3WKCA 5J0QA 3PX0A 4Y2QA 3PMNA 1TAQA 5IIOA 2M0NA 4I2DA 3V6KA 3ETLA 3M6ZA 4JB3A 1ZQZA 4I2CA 3IG5A 5ALUA 4ELTA 5F9NA 3ISDA 1J2MA 1JRPA 2YN4A 5AI5A 3KKAA 2IOFK 2BPFA 1L3SA 2F1JA 4YR3A 2XO7A 3HWTA 1QQ7A 3LYSA 3T5JA 1BNOA 3IHQB 3SI8A 2H3ZA 2E5SA 4BJQA 2ODGA 1KTQA 2EZZA 5DKWA 4K4IA 2B21A 2ZXIA 8ICEA 1TK8A 5AKHA 4ECTA 4EX7A 2NV3A 3M9OB 2ASJA 3V7JA 4M6WB 4GFJA 3E58A 4J9QA 3L3FX 3WKAA 1ZQIA 4UB5A 3F2CA 4DS4A 3EW9A 5GTIU 3O0FA 1RDFA 5DLFA 2FDRA 5KG5A 3NRZA 3D2SA 3PW2A 3GIJA 1SZHA 4Y2XA 3UPQA 1XC9A 3GQCA 2F8LA 2W3SA 1CRXA 3L5KA 2KKPA 4I2IA 4DFDA 3GIMA 3C1ZA 3K75D 4PJ0U 4UQGA 3TANA 4Y2VA 1XO0A 1Z3EB 3OGUA 3NVVA 5AK3A 2IA6A 4GIBA 1K5OA 5EOZA 5KG0A 3RJHA 2E8NA 1IM4A 2ZIWB 4B9SA 3LWLA 4YG2A 2ZTDA 4A8EA 5EE3A 2NRWA 3FAHA 1LVHA 1NJWA 3QU7A 1T94A 2V9WA 2HCFA 4BGDA 4O3SA 5CP2A 1EXNA 3N7PD 4EBEA 2HOFA 1X9MA 4C7YA 3U26A 3QUCA 4IQTA 1N48A 1LKYB 2L5YA 5KFYA 9ICKA 2HMXA 1JMSA 4O3PA 3RJKA 4O5KA 4R64A 1PK3A 4RPYA 4PGXA 1RPLA 3KHRA 1XU4A 1ZD5A 1N61A 2PMZF 1X2IA 4ED7A 1KW4A 3WU2U 4O3QA 1U9LA 5T14A 1QSLA 2F44A 3TFRA 4RUAA 2Y9UA 2YB4A 2NRTA 1U4BA 3MDAA 2LM4A 2NRZA 5H2FU 1M6YA 3ETRA 3H8WA 3RH5A 2FMSA 4KLJA 4UAWA 4KLUA 4E0DA 3RH6A 5AK6A 3AQEA 2KHVA 5KFCA 4DFKA 3HKZC 2JH1A 2A1JB 4YMOA 5AM3A 4PGYA 3C2KA 4Y2TA 4RNOA 5K4LA 5IIKA 4C8NA 3T5KA 1Q46A 5BOLA 3PR4A 2XI9A 1NI3A 1X66A 4Z6EA 3R9KA 2O6KA 5J2HA 2HHSA 1UA1A 5F3XB 2WFAA 3SMVA 5ALDA 2DGZA 3S6JA 3BJYA 5KT7A 3VCBA 4OJ5A 9ICWA 2KNJA 1ZQFA 4F4WA 5TZVA 4DL7A 5C0YA 7ICSA 5AI6A 5ALNA 3TACB 5DG8A 3RB3A 4Y2SA 1AROP 1B0XA 3HX0A 4QJFB 5KFFA 2WF9A 4ED1A 5ALXA 1S0VA 1WCNA 4OD0A 4IQWA 3ISCA 2KZZA 2G06A 4DL2A 5KFIA 1X9WA 1RXWA 4QZDA 1QSYA 9ICFA 8ICAA 1BPYA 4XA5A 1JIHA 1D9DA 4ZH4A 8ICIA 4KMOB 4O3NA 2VA8A 3MR6A 1DK2A 3QYPA 4MF2A 2D3DA 7ICHA 4NXZA 2E1FA 3MFHA 3M6KA 5AM1A 5CR0A 1NJYA 1LB2B 2EZXA 4PZNA 4G3IA 3HT3A 1ZQLA 2W54A 3QUTA 1V85A 4DQRA 2YMLA 4ECUA 3C2LA 4OJLA 3GIKA 2DPIA 2IMWP 1FFUA 2W03A 3TADC 2RP5A 5AKXA 3GV8B 3RR8A 3IP4B 4IC9A 1HIWA 1QQ5A 1ZQUA 3H4DA 2IBKA 2DBYA 4ECXA 1K1SA 1H38A 4YQWA 2W11A 4QW9A 4JMUA 4M47A 4TQSA 1HJPA 4YCXA 5ALVA 5KFMA 9ICXA 2W9AA 2BDPA 2FLPA 2FMPA 5KG3A 1YZ7A 3BS5B 5AKGA 3QZ7A 4Y2RA 3A0BU 2BPGA 1SV0A 5AIBA 2PKEA 4DL4A 1ZQMA 3HRDD 1S5LU 7ICJA 1ZOLA 5J0SA 3IN5A 3RB6A 2HHXA 4KLFA 4NL9C 4DSIA 4R63A 2BCRA 2OYYA 5CRXA 5KT4A 5ALFA 1VJ5A 4KLOA 3QNMA 3MGIA 1D8LA 2A19A 3N4MB 3M9MB 7ICRA 7ICOA 2YTUA 3B0XA 4CGZA 1LV5A 3WK4A 5KL8B 5C5JA 4RQ4A 2LYBA 1DGSA 1MQ3A 2HBJA 1S0OA 1PVRA 2KV2A 4K4HA 4QWAA 4R65A 2K4EA 2VJ5A 5HP4A 9ICJA 1UCVA 1Z4NA 3T5LA 9ICSA 5KFSA 1A77A 4I2JA 3KD3A 3QUQA 5HMLA 5AKIA 5F9LA 1NKEA 2PFOA 1KDHA 1X42A 7ICMA 3V6JA 5J0YA 4TUSA 4PZOA 1WUDA 2PI4A 2KVCA 1Z4OA 4Q8FA 9ICTA 2R18A 5KG7A 1FO4A 3C23A 5AICA 1NK7A 4TUPA 5DB8A 2QARA 3V72A 3HKZF 2JEIA 3HILA 5D49A 4R8UB 4MEXA 3H8JA 4BXOB 4MF8A 2CXYA 4ED6A 1WYGA 4IRDA 1NJZA 3Q8KA 3EWAA 4HAIA 5AKYA 3HPOA 2BQUA 5AM2A 1Z00A 2LI6A 2G08A 4B6JA 4RNNA 1X6IA 3EPGA 4F93B 5DDYA 4KLQA 5KG1A 1UPHA 4NM1A 4QZIA 4I28A 1ZQYA 8ICLA 4DQPA 4C8MA 1QH9A 1NK9A 2K60A 4ECWA 2BR0A 4QZFA 4Q45A 2XICA 2F77X 4NV0A 3M1YA 1C20A 5ALYA 3H0LB 3ICXA 5J8YC 5KTQA 3MBYA 5KFOA 2W9CB 1SKSA 2MA1A 4DFMA 3FC4A 3H4BA 5KFEA 1X9XA 2M9NA 2UVRA 4UB3A 1BNPA 3ZDBA 3SAHA 3MR5A 5KFJA 2OWOA 1GO3F 2E8PA 2G5IB 1BVSA 2Y9TA 9ICCA 3AUOA 1Y88A 4F4YA 3MGVA 3MR3A 2W8LA 1KRPA 2QKQA 2QB0A 4YMNA 2P35A 1IG6A 4AP9A 4B9VA 4O5EA 2KTQA 4F72A 3EPIA 2ZJ8A 1QSSA 1N62A 4FZMA 1A6SA 3RBDA 1TFRA 7ICPA 2HBKA 5ALHA 5L1MA 2ES6A 5L1IA 3G6YA 1ZQQA 2YMQA 5J0XA 7ICEA 1P7DA 2WF5A 4NJ8A 1X6JA 2UVUA 1TVAA 5J0TA 2K8AA 3KFUF 5J0RA 4MEYA 2R8KA 4KLIA 2G07A 4NWIA 1DK3A 4DEZA 1TAMA 3PR5B 1ZQBA 3RB0A 2VIXA 1D9FA 5KFDA 4KITB 3E0FA 2NYVA 1ZQXA 4NM2A 4US9A 4ICAA 5G5GA 1SL0A 4P0PB 4B9MA 1L6NA 3T79A 5AKKA 4Y2JA 2G0AA 3KBBA 1NNLA 1MN8A 1L7OA 2WB1C 1XSPA 1U48A 1A76A 1XS9D 4DLGA 1NK0A 4Z6DA 7ICIA 2BQRA 4C8OA 7ICNA 3NVZA 2HHQA 2P66A 9ICMA 4RQ3A 5J2EA 2IOHA 3NUQA 3V6HA 4DF4A 5J2FA 4TUQA 2H3QA 1HUOA 2IHNA 2DUYA 4M9LA 5DG9A 2HDOA 5KT3A 3C21A 3PSTA 3GZFA 9ICIA 2PXIA 5KFBA 2KOBA 3N7SC 2K4HA 5CEHA 2ZIXB 3BDPA 1YZ6A 5HR7A 3UQ2A 5EWFA 5KFUA 2P6RA 4M6WA 1A0PA 5KFTA 5J29A 3GIIA 1SWWA 4CNQA 1KEJA 1ZQ1C 2XCAA 4YMMA 4NLBA 1KQQA 3K1ZA 4RQ1A 4K4GA 1PZNA 2ZG6A 9ICEA 2HI0A 5JRTA 2J6TA 1UHUA 2FPMA 1V97A 4J9PA 3KHLA 3BZKA 4UAUA 2KMDA 5KL1B 5DB6A 1B4FA 1UT8A 2AQ0A 4F4ZA 3SV4A 3KOOA 4DSEA 3DV9A 3MFIA 4I29A 4XRHA 4FS2A 4DSFA 3RR7A 4DOAA 4IL6U 2I1QA 2KFZA 2A1AA 3UXOA 4LVSA 5DB9A 4KLSA 2PFQA 4Q8EA 4PH5A 2JRZA 5HR6A 3D6JA 4FBUA 1LKYA 3NS1A 5AM4A 1HUZA 2OEHA 2ZUDA 5G5HA 4QZ9A 1COKA 3DDHA 8ICOA 5KFRA 9ICAA 4RPXA 2OXOA 4QIWF 4F4XA 1MQ2A 2BQ3A 4EYIB 2HBMA 4OJPA 1MSWD 4CE6A 4EENA 5IINA 5DDMA 3C5FA 3PW0A 2R8GA 3WK9A 4I2AA 8ICUA 3UM9A
chains in the Genus database with same CATH topology
1X6IA 2LM4A 1PUZA 2JR5A 1X6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6I A;  2LM4 A;  1PUZ A;  2JR5 A;  1X6J A; 
#chains in the Genus database with same CATH topology
 4O3R A;  1DOQ A;  4QZB A;  5KFA A;  2JH7 A;  2XVT A;  4BX9 C;  4LJX A;  3TAD A;  4RT3 A;  4F71 A;  4UB8 U;  1K1Q A;  3MR2 A;  4WJ3 B;  1OW5 A;  2KG5 A;  1CI4 A;  3EUB 2;  5EE9 A;  2WTF A;  5AIA A;  4OCZ A;  2BGW A;  1BPX A;  5J2B A;  2LYH A;  2MAX A;  2VJ4 A;  1IXR A;  2A1J A;  4IRC A;  2FI1 A;  3PW7 A;  4JWM A;  4UAS A;  4CF3 A;  4DCC A;  3OJS A;  4J9R A;  2OM6 A;  4KLH A;  4I27 A;  3D2Q A;  5EE0 A;  1T7P A;  2DF4 B;  5CA7 A;  5J2G A;  1ZQR A;  3LVW A;  1ZQT A;  1BPZ A;  2K89 A;  2JMG A;  5DLG A;  1L3U A;  3A0H U;  4F2S A;  2C2E A;  4ECQ A;  5ALG A;  3WKB A;  2AGO A;  3RAQ A;  4FE3 A;  2LM1 A;  4NY8 A;  7ICQ A;  2JZB B;  2GLE A;  2YQE A;  4F5R A;  4OO1 J;  3GV5 B;  2WF8 A;  3C5G A;  4MFC A;  2JR5 A;  4DWI A;  2N1R A;  1J97 A;  4RZR A;  4NL9 A;  8ICR A;  1SXD A;  1KN5 A;  4EZ9 A;  4F8R A;  5L1L A;  3V7K A;  8ICP A;  2E3T A;  4TUR A;  4KMU A;  4DQQ A;  3QEB Z;  2J6U A;  2WB1 F;  3PX4 A;  2BZF A;  2K4P A;  5KT5 A;  4I2H A;  2HOI A;  8ICC A;  2BCU A;  2CPR A;  2ZIU B;  3MC1 A;  4ED8 A;  5DG7 A;  1UT5 A;  4MFA A;  4DSK A;  2Q0Z X;  2WF6 A;  4DO9 A;  5AI4 A;  2W55 A;  4HYK A;  2EAO A;  8ICM A;  3AU2 A;  2JHD A;  3OPX A;  3PSP A;  1VDV A;  1T3N A;  3SEN A;  3QE9 Y;  4UAZ A;  3WK5 A;  1RG6 A;  2Q4T A;  1KSP A;  2E8O A;  3Q8M A;  4UW9 A;  1SGG A;  1U49 A;  3AM9 A;  4ACO A;  5KFN A;  1IIP A;  2W9B A;  3C2M A;  8ICK A;  1S77 D;  5AKZ A;  2HBL A;  4PPX A;  2RDJ A;  5D46 A;  4RQ5 A;  5KG4 A;  1PK1 B;  2KJ8 A;  3JPS A;  1TV9 A;  1BGX T;  4US8 A;  4Q43 A;  2AHO B;  4O9M A;  4QWE A;  5KG2 A;  4DOC A;  7ICG A;  4F5P A;  3VC8 A;  5DQG A;  1QQ6 A;  2AJQ A;  5III A;  1O08 A;  5A0L A;  3GU3 A;  3PNC A;  4Z6F A;  1N60 A;  3F2B A;  4PHD A;  3RJJ A;  1U47 A;  3BS7 A;  3QUB A;  3B0Y A;  1SL2 A;  1TE2 A;  1IV8 A;  1SKW A;  5ALT A;  1KLN A;  2EAP A;  3FDS A;  1RYU A;  4NLC A;  3C28 A;  3TFS A;  4Y2P A;  3RRG A;  1F0M A;  1FEZ A;  4O3M A;  2HSZ A;  5ALZ A;  3GIL A;  4F50 A;  3CRX A;  2OCE A;  9ICQ A;  3ED5 A;  3CW2 C;  4F5Q A;  1KFT A;  3M7D A;  3WKD A;  2C22 A;  1Z1B A;  1ZQH A;  1MC8 A;  5DBC A;  1S0N A;  2ZIV B;  5J8Y A;  2EDU A;  4PGQ A;  5CHG A;  1Z1V A;  3RRH A;  1C7Y A;  3ORY A;  4UAR A;  2FJ6 A;  4ECY A;  2ASD A;  2FLN A;  4BDP A;  2BCS A;  2D8C A;  2JEF A;  4P0Q B;  1WG8 A;  4C4S A;  2Y0S C;  3M8R A;  2FLL A;  1N63 A;  3ALR A;  1JN3 A;  3K4G A;  2YB1 A;  5CWR A;  4R66 A;  1SWV A;  5J2A A;  2KZ3 A;  3QX7 A;  1F5S A;  4YN4 A;  3T5H A;  9ICH A;  2AQ4 A;  3ISB A;  3WK8 A;  2JV3 A;  2BDU A;  1UQV A;  4JUZ A;  3KZX A;  5KAF U;  5ALO A;  3ZI4 A;  4P2H A;  1N2X A;  4DL3 A;  2BHN A;  3ZDC A;  3BQ7 A;  3UQ0 A;  2IHM A;  3EYZ A;  2H3F A;  1FIQ A;  5KFV A;  3CYM A;  1Q3V A;  2KSO B;  1O03 A;  2MUT B;  3MDC A;  4KN7 A;  2JXJ A;  4R8U A;  4JV2 A;  5HHH A;  4NLN A;  2ZXH A;  4BXO A;  5EWE A;  1NZB A;  1XO1 A;  1ZJN A;  2BCV A;  1DGJ A;  2KP7 A;  3ZD8 A;  2R8H A;  3H0M B;  3UMC A;  4PHE A;  2XCP A;  4QIW C;  1JXL A;  4F3O A;  4F5N A;  4OJO A;  2F3N A;  4GC6 A;  3RTV A;  3D2N A;  3RBE A;  1NKC A;  4ECR A;  4DSJ A;  4UB6 U;  4IRK A;  4JV0 A;  1PVP A;  4U7C A;  1X9S A;  4DQI A;  4GC7 A;  1XNS A;  8ICZ A;  2FE9 A;  2RLT A;  2FPK A;  1L3V A;  2QB0 B;  2HHV A;  5KFW A;  3LDA A;  5EWG A;  4YD1 A;  3UXN A;  1L8O A;  3WK6 A;  3F2D A;  1TK0 A;  2W7P A;  4GXJ A;  2F8K A;  4RNM A;  2B0C A;  2KD1 A;  3PO5 A;  1YT3 A;  2F2A B;  2W9C A;  5KFG A;  1KKX A;  4J03 A;  2DKX A;  2UVV A;  4QNL A;  4RU9 A;  4UAT A;  3J81 j;  2LPE A;  2ATL A;  3OHB A;  2OHF A;  5E79 U;  4O5C A;  3CNH A;  3C29 A;  1ZQC A;  1S9F A;  2V4Q A;  4PHA A;  4Q44 A;  4EEL A;  1OXJ A;  2DL0 A;  3EZ5 A;  4UBB A;  4DOB A;  5ALP A;  2YX8 A;  4GLX A;  1L7P A;  4F91 B;  1B22 A;  5B5E U;  1Q8K A;  1ZRM A;  2E1E A;  2AU0 A;  3IRU A;  4USA A;  2R8J A;  2GOL A;  5J2I A;  4YD2 A;  3KZI U;  3MAB A;  2C28 A;  3Q8Q B;  4ZOH C;  1ED1 A;  2W9M A;  3SYZ A;  1WWV A;  3AQF A;  4RQ2 A;  4RQM A;  1U45 A;  4CF4 A;  2DQN B;  3BZC A;  3PVX A;  3KHG A;  2RDI A;  4O0I A;  5ALK A;  5FP0 A;  8ICB A;  1ZQO A;  2V4R A;  7ICL A;  4Y2Y A;  2ZUC A;  2HVI A;  3LK9 A;  8ICJ A;  1DXS A;  5ALE A;  2AH5 A;  4C80 A;  4QZ8 A;  2MSN A;  4KLD A;  2WAQ F;  3NVY A;  5DGB A;  4IR9 A;  2K8C B;  2I5H A;  4EX6 A;  1RQN A;  2ZTC A;  2QB1 A;  2ZJ5 A;  5AKJ A;  4KLG A;  3PO4 A;  3OTQ A;  3PML A;  4M0A A;  4RQ7 A;  4P0P A;  4QZH A;  2C2D A;  5J0U A;  1KBU A;  5KFQ A;  3THV A;  4CCH A;  2F1H A;  3QU4 A;  3UMB A;  1N5W A;  4UBC A;  1RZT A;  1TAU A;  4KLL A;  3KTQ A;  5KG6 A;  3I76 A;  3Q8S B;  5ALI A;  1D8B A;  3GFK B;  4DF8 A;  5J0P A;  1JXE A;  4DFP A;  2K4I A;  1XWL A;  4ECV A;  5DGA A;  1ZQG A;  5AK4 A;  2K8B B;  5KFZ A;  1RXV A;  1S76 D;  2KIV A;  1ZQN A;  2H3I A;  2P6U A;  4J9O A;  5AHX A;  3ZDD A;  2RRD A;  2DFL A;  2OH2 A;  3H0R B;  3UXP A;  2EAN A;  5L1J A;  1N56 A;  4AYB C;  3RB4 A;  2E8M A;  5AI0 A;  4M9N A;  3OJU A;  4DSL A;  4UB4 A;  3QEA Z;  1RQL A;  3NVW A;  4Y2U A;  3OSP A;  3PZP A;  2KK0 A;  1X40 A;  4KN4 A;  4LZD A;  9ICU A;  5CJ7 A;  5J2K A;  5ALS A;  1Z19 A;  5J0W A;  1S8O A;  2Y0S F;  2KIC A;  4KLE A;  1F44 A;  3JPO A;  3JPQ A;  2WF7 A;  1RM6 C;  5AKE A;  2I9G A;  1TK5 A;  3FM9 A;  2ZIX A;  5JUM A;  4M04 A;  4EEK A;  4QWD A;  3Q8L A;  4FFD A;  4YXJ A;  1N5X A;  3KKA C;  1QTM A;  2CRX A;  2GO7 A;  2VAN A;  4KTQ A;  3SAG A;  5ALM A;  4MFF A;  4UB1 A;  4F5O A;  2ZIW A;  1UA0 A;  2Z7J A;  3I28 A;  3RJF A;  1NK6 A;  5KFL A;  2KJ5 A;  3GDX A;  2GH1 A;  1RYR A;  5EE1 A;  3E2E A;  2YY6 A;  1L7M A;  1QCK A;  1SIJ A;  3SZ2 A;  3TAR A;  4OJ6 A;  4B9L A;  2KIW A;  3G6X A;  1AQ6 A;  4YP3 A;  3NAS A;  2KZM A;  4BUG A;  2RHF A;  3L4P A;  3HJE A;  3AL0 B;  4YVZ A;  3IDW A;  4F4K A;  5JTI A;  5TIS U;  1JAL A;  1COO A;  1TKD A;  8ICN A;  3WK7 A;  2PI5 A;  4M9H A;  2R8I A;  5J2C A;  5KFX A;  2NRV A;  1T8E A;  2JEJ A;  4QZC A;  5AI8 A;  3RJG A;  3PW5 A;  8ICY A;  3PSF A;  4FBT A;  2G5H B;  3LVV A;  3N7R C;  3K1R B;  1KL9 A;  2CN1 A;  1PVQ A;  3WKE A;  5ALW A;  4CF5 A;  3RJE A;  8ICV A;  3JPN A;  5IIJ A;  1NK5 A;  4ED0 A;  2ZUB A;  1L7N A;  3NRW A;  9ICO A;  4B9U A;  1L8L A;  3RAX A;  4QW8 A;  1ZYQ A;  7ICV A;  3CP8 A;  3IG8 A;  4CRX A;  1SZP A;  1ZQJ A;  1NKB A;  2LHT A;  3PY8 A;  4UAY A;  1D8Y A;  3H40 A;  1ZET A;  3BQ1 A;  1B43 A;  3QU5 A;  4I2B A;  3FYH A;  1VLB A;  2QLT A;  1URJ A;  3T3F A;  2ZTE A;  3F5A A;  3IM1 A;  3SD7 A;  2AGP A;  3BQT A;  1JX4 A;  5CB1 A;  2C2R A;  4YXM A;  1SL1 A;  1SB3 C;  4U6P A;  8ICX A;  2DWQ A;  4FZL A;  4PL1 A;  2FPL A;  1DRG A;  2GWS A;  1V9P A;  4RT2 A;  2W8K A;  2XY5 A;  4GXI A;  4J9K A;  9ICP A;  3SV3 A;  3ZDE A;  1Q3U A;  1S10 A;  4MHV A;  2Y1J A;  5IIL A;  2W43 A;  1NK8 A;  5L9X A;  4DLE A;  4F2R A;  8ICQ A;  2JZB A;  8ICG A;  1WWU A;  5J0O A;  1ZQE A;  5DBA A;  4C8K A;  2ALZ A;  2HW3 A;  4C4T A;  2EQY A;  2XID A;  3RFA A;  1NK4 A;  1XSL A;  2AGQ A;  4C0Z A;  4C4R A;  2ISP A;  4FO6 A;  4J9N A;  1KFD A;  4DS5 A;  2HHT A;  1WCL A;  2W9B B;  1ZQS A;  2WHE A;  4RQ0 A;  5AI9 A;  3ZD9 A;  5J2D A;  3PX6 A;  2UVW A;  3SR6 A;  3UMG A;  3RH4 A;  3PW4 A;  4RQ6 A;  3I1Y A;  2RQ5 A;  1CUK A;  5DQI A;  2ZIU A;  3RF9 A;  1J2N A;  2HHU A;  4B9N A;  2J6S A;  3AU6 A;  4EEY A;  1NOM A;  2XY7 A;  3DEE A;  4UAV A;  1RYS A;  5BPC A;  2NO4 A;  2VA3 A;  5DQH A;  4PL2 A;  4AYB F;  2WAQ C;  3B9J A;  1XSN A;  3BS5 A;  1ZJM A;  1ZQA A;  2AXT U;  3N97 B;  8ICT A;  4YR0 A;  2LKY A;  3OSN A;  3SAF A;  4QZA A;  8ICS A;  3SEI A;  4KLT A;  2LYA A;  2FMQ A;  1BPD A;  3QU2 A;  5HHI A;  9ICV A;  3SQI A;  4ED3 A;  9ICB A;  1OUQ A;  1BPE A;  1PK1 A;  2JGA A;  5IIM A;  5ALR A;  7ICU A;  4F92 B;  8ICF A;  9ICL A;  1SV4 A;  2I6X A;  2MU2 A;  4EZ6 A;  2KFN A;  1MA7 A;  4M2Y A;  3TQ1 A;  1BPB A;  2EH9 A;  1ZXI A;  4YFK A;  1T3Q A;  2W3R A;  4FS1 A;  5AKL A;  2XGQ A;  3F53 A;  3Q8R B;  1ZQP A;  2PFP A;  2KVS A;  1L5U A;  4ELU A;  4J9S A;  4JK1 A;  4PHP A;  1KFS A;  4IQU A;  2XGP A;  4C7Z A;  7ICK A;  2QAR B;  1T4G A;  5KT2 A;  3OHA A;  3LWM A;  4P4P A;  1FFV A;  4M9G A;  3ZDA A;  2W04 A;  2A3V A;  5DB7 A;  1PUZ A;  4P4O A;  1NZP A;  2KKV A;  3Q8P B;  3NGD A;  2MRL A;  4Z6C A;  3PSI A;  1SV0 C;  4J9L A;  1HEK A;  3QXG A;  4YR2 A;  3AMZ A;  1Z00 B;  2ZIV A;  2G09 A;  5AM5 A;  4RUC A;  5HNK A;  2ZJA A;  5ALL A;  3TAP A;  2LBO A;  4DFJ A;  4I2G A;  4DL5 A;  1QLN A;  3TI0 A;  2IOF A;  3AEV A;  1ZRN A;  4B9T A;  3G6V A;  2ESE A;  9ICN A;  2VKQ A;  2Y1I A;  3TKA A;  3GV7 B;  2D6F C;  1S97 A;  3QZ8 A;  2PFN A;  5KNI A;  2JEG A;  4P0Q A;  3HW8 A;  4JV1 A;  3KHH A;  1ZQW A;  2VA2 A;  2YMP A;  5DBB A;  3IV6 A;  9ICG A;  4EBC A;  2PMZ C;  4J9M A;  4EBD A;  4ECZ A;  2HHW A;  4TQR A;  9ICR A;  4DQS A;  4XUS A;  2LMR A;  5KAI U;  1L3T A;  2B6G A;  5KFH A;  2HOQ A;  4DL6 A;  1JUD A;  3M8S A;  2DPJ A;  3H8S A;  3AN1 A;  5AM0 A;  1SXE A;  2KE7 A;  7ICT A;  2KHQ A;  2NO5 A;  5ALJ A;  2W7O A;  3M9N B;  2DKZ A;  5D4B A;  3JPT A;  4JWN A;  3QU9 A;  1NJX A;  4BWJ A;  2ASL A;  4XQ8 A;  2KSO A;  2MUT A;  3H8M A;  1ZD3 A;  4GXK A;  3TAQ A;  5JU5 A;  2BCQ A;  1JI7 A;  4P4M A;  4EYH B;  2BKE A;  2EZY A;  4QWB A;  1ZQD A;  4RQN A;  3F5E A;  5HMM A;  4RPZ A;  2F1I A;  2KN7 A;  4QWC A;  3C1Y A;  5KFP A;  4BWM A;  4I2E A;  4C8L A;  1JRO A;  4QZE A;  5ALQ A;  4G9B A;  2KJ9 A;  4NLG A;  4X5V A;  1SKR A;  3BQ0 A;  3RJI A;  3JPR A;  4ELV A;  3MGH A;  3N28 A;  2F76 X;  3HP6 A;  5KT6 A;  2ISO A;  1CEZ A;  1ZQV A;  5J2J A;  4KLM A;  4M9J A;  3V7L A;  5BOM A;  4QZG A;  4I2F A;  8ICH A;  4O3O A;  1ZD4 A;  4LZG A;  2HVH A;  3JPP A;  2BPC A;  4NLK A;  2XY6 A;  5KFK A;  3ONN A;  4CDG A;  4NLZ A;  4KX5 A;  5GTH U;  1ECW A;  5L1K A;  8ICW A;  1ZQK A;  4ECS A;  2KEY A;  1S0M A;  2YMM A;  2H3V A;  5AK5 A;  1ZD2 P;  4IQV A;  4ED2 A;  3PV8 A;  4RQ8 A;  4FZN A;  4IR1 A;  1V38 A;  4IS7 A;  3BQ2 A;  7ICF A;  3NTU A;  4UB2 A;  3H7I A;  5B66 U;  2H5X A;  2XC9 A;  2NRX A;  4KX3 A;  2EAM A;  3WKC A;  5J0Q A;  3PX0 A;  4Y2Q A;  3PMN A;  1TAQ A;  5IIO A;  2M0N A;  4I2D A;  3V6K A;  3ETL A;  3M6Z A;  4JB3 A;  1ZQZ A;  4I2C A;  3IG5 A;  5ALU A;  4ELT A;  5F9N A;  3ISD A;  1J2M A;  1JRP A;  2YN4 A;  5AI5 A;  3KKA A;  2IOF K;  2BPF A;  1L3S A;  2F1J A;  4YR3 A;  2XO7 A;  3HWT A;  1QQ7 A;  3LYS A;  3T5J A;  1BNO A;  3IHQ B;  3SI8 A;  2H3Z A;  2E5S A;  4BJQ A;  2ODG A;  1KTQ A;  2EZZ A;  5DKW A;  4K4I A;  2B21 A;  2ZXI A;  8ICE A;  1TK8 A;  5AKH A;  4ECT A;  4EX7 A;  2NV3 A;  3M9O B;  2ASJ A;  3V7J A;  4M6W B;  4GFJ A;  3E58 A;  4J9Q A;  3L3F X;  3WKA A;  1ZQI A;  4UB5 A;  3F2C A;  4DS4 A;  3EW9 A;  5GTI U;  3O0F A;  1RDF A;  5DLF A;  2FDR A;  5KG5 A;  3NRZ A;  3D2S A;  3PW2 A;  3GIJ A;  1SZH A;  4Y2X A;  3UPQ A;  1XC9 A;  3GQC A;  2F8L A;  2W3S A;  1CRX A;  3L5K A;  2KKP A;  4I2I A;  4DFD A;  3GIM A;  3C1Z A;  3K75 D;  4PJ0 U;  4UQG A;  3TAN A;  4Y2V A;  1XO0 A;  1Z3E B;  3OGU A;  3NVV A;  5AK3 A;  2IA6 A;  4GIB A;  1K5O A;  5EOZ A;  5KG0 A;  3RJH A;  2E8N A;  1IM4 A;  2ZIW B;  4B9S A;  3LWL A;  4YG2 A;  2ZTD A;  4A8E A;  5EE3 A;  2NRW A;  3FAH A;  1LVH A;  1NJW A;  3QU7 A;  1T94 A;  2V9W A;  2HCF A;  4BGD A;  4O3S A;  5CP2 A;  1EXN A;  3N7P D;  4EBE A;  2HOF A;  1X9M A;  4C7Y A;  3U26 A;  3QUC A;  4IQT A;  1N48 A;  1LKY B;  2L5Y A;  5KFY A;  9ICK A;  2HMX A;  1JMS A;  4O3P A;  3RJK A;  4O5K A;  4R64 A;  1PK3 A;  4RPY A;  4PGX A;  1RPL A;  3KHR A;  1XU4 A;  1ZD5 A;  1N61 A;  2PMZ F;  1X2I A;  4ED7 A;  1KW4 A;  3WU2 U;  4O3Q A;  1U9L A;  5T14 A;  1QSL A;  2F44 A;  3TFR A;  4RUA A;  2Y9U A;  2YB4 A;  2NRT A;  1U4B A;  3MDA A;  2LM4 A;  2NRZ A;  5H2F U;  1M6Y A;  3ETR A;  3H8W A;  3RH5 A;  2FMS A;  4KLJ A;  4UAW A;  4KLU A;  4E0D A;  3RH6 A;  5AK6 A;  3AQE A;  2KHV A;  5KFC A;  4DFK A;  3HKZ C;  2JH1 A;  2A1J B;  4YMO A;  5AM3 A;  4PGY A;  3C2K A;  4Y2T A;  4RNO A;  5K4L A;  5IIK A;  4C8N A;  3T5K A;  1Q46 A;  5BOL A;  3PR4 A;  2XI9 A;  1NI3 A;  1X66 A;  4Z6E A;  3R9K A;  2O6K A;  5J2H A;  2HHS A;  1UA1 A;  5F3X B;  2WFA A;  3SMV A;  5ALD A;  2DGZ A;  3S6J A;  3BJY A;  5KT7 A;  3VCB A;  4OJ5 A;  9ICW A;  2KNJ A;  1ZQF A;  4F4W A;  5TZV A;  4DL7 A;  5C0Y A;  7ICS A;  5AI6 A;  5ALN A;  3TAC B;  5DG8 A;  3RB3 A;  4Y2S A;  1ARO P;  1B0X A;  3HX0 A;  4QJF B;  5KFF A;  2WF9 A;  4ED1 A;  5ALX A;  1S0V A;  1WCN A;  4OD0 A;  4IQW A;  3ISC A;  2KZZ A;  2G06 A;  4DL2 A;  5KFI A;  1X9W A;  1RXW A;  4QZD A;  1QSY A;  9ICF A;  8ICA A;  1BPY A;  4XA5 A;  1JIH A;  1D9D A;  4ZH4 A;  8ICI A;  4KMO B;  4O3N A;  2VA8 A;  3MR6 A;  1DK2 A;  3QYP A;  4MF2 A;  2D3D A;  7ICH A;  4NXZ A;  2E1F A;  3MFH A;  3M6K A;  5AM1 A;  5CR0 A;  1NJY A;  1LB2 B;  2EZX A;  4PZN A;  4G3I A;  3HT3 A;  1ZQL A;  2W54 A;  3QUT A;  1V85 A;  4DQR A;  2YML A;  4ECU A;  3C2L A;  4OJL A;  3GIK A;  2DPI A;  2IMW P;  1FFU A;  2W03 A;  3TAD C;  2RP5 A;  5AKX A;  3GV8 B;  3RR8 A;  3IP4 B;  4IC9 A;  1HIW A;  1QQ5 A;  1ZQU A;  3H4D A;  2IBK A;  2DBY A;  4ECX A;  1K1S A;  1H38 A;  4YQW A;  2W11 A;  4QW9 A;  4JMU A;  4M47 A;  4TQS A;  1HJP A;  4YCX A;  5ALV A;  5KFM A;  9ICX A;  2W9A A;  2BDP A;  2FLP A;  2FMP A;  5KG3 A;  1YZ7 A;  3BS5 B;  5AKG A;  3QZ7 A;  4Y2R A;  3A0B U;  2BPG A;  1SV0 A;  5AIB A;  2PKE A;  4DL4 A;  1ZQM A;  3HRD D;  1S5L U;  7ICJ A;  1ZOL A;  5J0S A;  3IN5 A;  3RB6 A;  2HHX A;  4KLF A;  4NL9 C;  4DSI A;  4R63 A;  2BCR A;  2OYY A;  5CRX A;  5KT4 A;  5ALF A;  1VJ5 A;  4KLO A;  3QNM A;  3MGI A;  1D8L A;  2A19 A;  3N4M B;  3M9M B;  7ICR A;  7ICO A;  2YTU A;  3B0X A;  4CGZ A;  1LV5 A;  3WK4 A;  5KL8 B;  5C5J A;  4RQ4 A;  2LYB A;  1DGS A;  1MQ3 A;  2HBJ A;  1S0O A;  1PVR A;  2KV2 A;  4K4H A;  4QWA A;  4R65 A;  2K4E A;  2VJ5 A;  5HP4 A;  9ICJ A;  1UCV A;  1Z4N A;  3T5L A;  9ICS A;  5KFS A;  1A77 A;  4I2J A;  3KD3 A;  3QUQ A;  5HML A;  5AKI A;  5F9L A;  1NKE A;  2PFO A;  1KDH A;  1X42 A;  7ICM A;  3V6J A;  5J0Y A;  4TUS A;  4PZO A;  1WUD A;  2PI4 A;  2KVC A;  1Z4O A;  4Q8F A;  9ICT A;  2R18 A;  5KG7 A;  1FO4 A;  3C23 A;  5AIC A;  1NK7 A;  4TUP A;  5DB8 A;  2QAR A;  3V72 A;  3HKZ F;  2JEI A;  3HIL A;  5D49 A;  4R8U B;  4MEX A;  3H8J A;  4BXO B;  4MF8 A;  2CXY A;  4ED6 A;  1WYG A;  4IRD A;  1NJZ A;  3Q8K A;  3EWA A;  4HAI A;  5AKY A;  3HPO A;  2BQU A;  5AM2 A;  1Z00 A;  2LI6 A;  2G08 A;  4B6J A;  4RNN A;  1X6I A;  3EPG A;  4F93 B;  5DDY A;  4KLQ A;  5KG1 A;  1UPH A;  4NM1 A;  4QZI A;  4I28 A;  1ZQY A;  8ICL A;  4DQP A;  4C8M A;  1QH9 A;  1NK9 A;  2K60 A;  4ECW A;  2BR0 A;  4QZF A;  4Q45 A;  2XIC A;  2F77 X;  4NV0 A;  3M1Y A;  1C20 A;  5ALY A;  3H0L B;  3ICX A;  5J8Y C;  5KTQ A;  3MBY A;  5KFO A;  2W9C B;  1SKS A;  2MA1 A;  4DFM A;  3FC4 A;  3H4B A;  5KFE A;  1X9X A;  2M9N A;  2UVR A;  4UB3 A;  1BNP A;  3ZDB A;  3SAH A;  3MR5 A;  5KFJ A;  2OWO A;  1GO3 F;  2E8P A;  2G5I B;  1BVS A;  2Y9T A;  9ICC A;  3AUO A;  1Y88 A;  4F4Y A;  3MGV A;  3MR3 A;  2W8L A;  1KRP A;  2QKQ A;  2QB0 A;  4YMN A;  2P35 A;  1IG6 A;  4AP9 A;  4B9V A;  4O5E A;  2KTQ A;  4F72 A;  3EPI A;  2ZJ8 A;  1QSS A;  1N62 A;  4FZM A;  1A6S A;  3RBD A;  1TFR A;  7ICP A;  2HBK A;  5ALH A;  5L1M A;  2ES6 A;  5L1I A;  3G6Y A;  1ZQQ A;  2YMQ A;  5J0X A;  7ICE A;  1P7D A;  2WF5 A;  4NJ8 A;  1X6J A;  2UVU A;  1TVA A;  5J0T A;  2K8A A;  3KFU F;  5J0R A;  4MEY A;  2R8K A;  4KLI A;  2G07 A;  4NWI A;  1DK3 A;  4DEZ A;  1TAM A;  3PR5 B;  1ZQB A;  3RB0 A;  2VIX A;  1D9F A;  5KFD A;  4KIT B;  3E0F A;  2NYV A;  1ZQX A;  4NM2 A;  4US9 A;  4ICA A;  5G5G A;  1SL0 A;  4P0P B;  4B9M A;  1L6N A;  3T79 A;  5AKK A;  4Y2J A;  2G0A A;  3KBB A;  1NNL A;  1MN8 A;  1L7O A;  2WB1 C;  1XSP A;  1U48 A;  1A76 A;  1XS9 D;  4DLG A;  1NK0 A;  4Z6D A;  7ICI A;  2BQR A;  4C8O A;  7ICN A;  3NVZ A;  2HHQ A;  2P66 A;  9ICM A;  4RQ3 A;  5J2E A;  2IOH A;  3NUQ A;  3V6H A;  4DF4 A;  5J2F A;  4TUQ A;  2H3Q A;  1HUO A;  2IHN A;  2DUY A;  4M9L A;  5DG9 A;  2HDO A;  5KT3 A;  3C21 A;  3PST A;  3GZF A;  9ICI A;  2PXI A;  5KFB A;  2KOB A;  3N7S C;  2K4H A;  5CEH A;  2ZIX B;  3BDP A;  1YZ6 A;  5HR7 A;  3UQ2 A;  5EWF A;  5KFU A;  2P6R A;  4M6W A;  1A0P A;  5KFT A;  5J29 A;  3GII A;  1SWW A;  4CNQ A;  1KEJ A;  1ZQ1 C;  2XCA A;  4YMM A;  4NLB A;  1KQQ A;  3K1Z A;  4RQ1 A;  4K4G A;  1PZN A;  2ZG6 A;  9ICE A;  2HI0 A;  5JRT A;  2J6T A;  1UHU A;  2FPM A;  1V97 A;  4J9P A;  3KHL A;  3BZK A;  4UAU A;  2KMD A;  5KL1 B;  5DB6 A;  1B4F A;  1UT8 A;  2AQ0 A;  4F4Z A;  3SV4 A;  3KOO A;  4DSE A;  3DV9 A;  3MFI A;  4I29 A;  4XRH A;  4FS2 A;  4DSF A;  3RR7 A;  4DOA A;  4IL6 U;  2I1Q A;  2KFZ A;  2A1A A;  3UXO A;  4LVS A;  5DB9 A;  4KLS A;  2PFQ A;  4Q8E A;  4PH5 A;  2JRZ A;  5HR6 A;  3D6J A;  4FBU A;  1LKY A;  3NS1 A;  5AM4 A;  1HUZ A;  2OEH A;  2ZUD A;  5G5H A;  4QZ9 A;  1COK A;  3DDH A;  8ICO A;  5KFR A;  9ICA A;  4RPX A;  2OXO A;  4QIW F;  4F4X A;  1MQ2 A;  2BQ3 A;  4EYI B;  2HBM A;  4OJP A;  1MSW D;  4CE6 A;  4EEN A;  5IIN A;  5DDM A;  3C5F A;  3PW0 A;  2R8G A;  3WK9 A;  4I2A A;  8ICU A;  3UM9 A; 
#chains in the Genus database with same CATH homology
 1X6I A;  2LM4 A;  1PUZ A;  2JR5 A;  1X6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...