2LKYA

Solution structure of msmeg_1053, the second duf3349 annotated protein in the genome of mycobacterium smegmatis, seattle structural genomics center for infectious disease target mysma.17112.b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
b'GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRDGEEPDGESGGPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Mycobacterium smegmatis str. mc2 155
publication title Different structures for two DUF3349 annotated proteins in the genome of Mycobacterium smegmatis suggest a structural diversity within the DUF3349 superfamily.
rcsb
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.430 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lkyA00
2M0NA 2KVCA 2LKYA
chains in the Genus database with same CATH superfamily
1F5SA 4F4YA 1N61A 5AKXA 1S0OA 5AK3A 1Z4NA 1T7PA 3PW2A 4EELA 4EYHB 3NASA 1FIQA 5J2DA 3V6HA 1S0MA 1TAQA 2JH1A 4F5PA 2DPJA 1DOQA 3EPIA 2NV3A 2G5HB 1NK5A 4R65A 2KVSA 4O5EA 4DQPA 4OJLA 3PW4A 2AJQA 2FMPA 1Y88A 1COOA 4FS1A 2PFPA 2HBJA 4J9SA 2ZIVA 4BWMA 4ECSA 4EZ6A 3E2EA 1MC8A 1PK1A 5DQIA 5EOZA 4DL4A 1N60A 2E8NA 4QNLA 2HHQA 2HDOA 3T5JA 4ED0A 3PW7A 1ZD3A 1ZQ1C 2G06A 1ED1A 2ZG6A 1X6JA 3L4PA 5ALOA 3GDXA 4JV1A 1FFUA 4FE3A 4YQWA 3A0BU 1QCKA 4MFFA 1ZQTA 3UPQA 4CGZA 1ZD5A 3ZI4A 3KZXA 4QIWF 2I9GA 5G5HA 4DL7A 1SV0C 5KFIA 1ZD4A 5DDMA 5ALFA 3PMLA 2J6TA 2YMMA 1ZQDA 2V4RA 5J2FA 4M9HA 2QB1A 1TK0A 2ZIUA 4KLGA 2ZTDA 4B9TA 1RM6C 4I2EA 2JGAA 5CHGA 4PHAA 4NL9A 2J6SA 3BS5B 1X42A 3EZ5A 3MFHA 2E8MA 5KFFA 4DS5A 3CNHA 2PFOA 5AIAA 3BQ0A 1ZQLA 3IG8A 1FO4A 3TARA 3HWTA 2YB1A 3NRZA 4C8OA 3V6JA 1FFVA 4FBTA 1UPHA 2HI0A 2KOBA 4F4XA 3WK7A 5KAIU 1ZQWA 8ICNA 4IR9A 4UB8U 4ED8A 3NRWA 3IRUA 2BPFA 2W54A 2PKEA 2KN7A 1PK3A 4UAZA 5JRTA 3MR5A 5IILA 2CN1A 1B22A 1C20A 3JPQA 3CYMA 4DFMA 7ICVA 2JH7A 4Y2UA 3SZ2A 5IIJA 7ICJA 5AM2A 1SXDA 3GIKA 5KFOA 5GTHU 2AH5A 4KLMA 4RQ8A 7ICIA 1B4FA 3WKEA 2VKQA 4YCXA 1GO3F 3RJEA 2HHTA 5HNKA 2YQEA 1NK0A 4PGQA 2KVCA 4Z6FA 4X5VA 3G6VA 3RBEA 8ICOA 5KL8B 4I2DA 3BQ1A 5KG1A 2H5XA 1A6SA 5KG5A 4YG2A 1PVPA 4JWNA 7ICPA 4O3QA 2WB1F 4BDPA 3JPRA 5T14A 9ICVA 3H0LB 1NZPA 5ALJA 9ICWA 1PVQA 4RQ2A 4KMUA 4RNMA 5AK5A 2B21A 1X6IA 4KN4A 8ICBA 1CRXA 3L5KA 1L6NA 4FZMA 4UARA 2HMXA 5KFUA 2O6KA 9ICAA 4UAYA 1V38A 2R8HA 5ALQA 4MF2A 3SV3A 4UB4A 8ICAA 3H0RB 2C28A 4UQGA 1KN5A 3AQEA 1NK6A 3GZFA 2FDRA 2VA8A 1ZXIA 1ZRMA 5BPCA 2EQYA 3EUB2 3PO4A 1ZYQA 4QZGA 1JXLA 5DB6A 4I2HA 5F3XB 2N1RA 5AKHA 4I2CA 3GV7B 5HHHA 2ASDA 2GWSA 4C4RA 4ZH4A 1SV4A 1SWWA 3G6YA 3H40A 2FPMA 1QSLA 3RF9A 1NKEA 4QZ8A 4DL3A 1PVRA 2QARB 1XS9D 1RYUA 3EYZA 4PZOA 2H3IA 3UXNA 7ICMA 4M2YA 3U26A 5KFKA 4DSKA 1SZPA 2LI6A 2A1AA 2W9MA 2W55A 4Z6DA 1P7DA 1PUZA 1T94A 3NVZA 1O03A 3H8WA 1SKSA 3C5GA 2AXTU 3KHLA 1SL2A 3KTQA 1BNPA 3TANA 4FO6A 2CXYA 3H4DA 1NK7A 1L8LA 2F1HA 4PJ0U 2R8KA 4CF4A 5BOLA 2WF6A 3ICXA 2LMRA 1LKYA 1RXWA 5DGAA 1N62A 2F8LA 3FC4A 5DBAA 7ICRA 1BPXA 1N48A 2E5SA 2BCVA 1F0MA 3DV9A 2R8GA 3H7IA 4NV0A 2HOIA 1L3SA 4RUCA 5KT6A 2W9BB 1MQ3A 3RJHA 2ZIVB 4BWJA 5J8YA 4K4HA 1U47A 3LK9A 3FDSA 2HSZA 4EEKA 2KV2A 2LM1A 1ZQOA 1DGJA 1L3VA 3SV4A 3CRXA 3SYZA 3GIMA 5AI6A 4KLHA 3S6JA 1OUQA 2NRVA 4RQMA 4YMMA 9ICIA 1BPDA 1XU4A 2W7PA 3F5EA 5KFZA 4UB2A 1ZQBA 2M0NA 3ONNA 5CP2A 5C0YA 4F5OA 4QZBA 4C7YA 5DG7A 2NRXA 4PHPA 2I1QA 5DQHA 4PL1A 4PHDA 4OJ6A 1B0XA 1YZ6A 5KFSA 5KG0A 4RT3A 4DFPA 4IR1A 4QWEA 2FLNA 4FZLA 5AM3A 4C4SA 4P4OA 4GXJA 1XSPA 2G07A 4DF8A 1NJXA 3DEEA 5KFLA 3G6XA 2RHFA 5L9XA 4P0QB 2QKQA 3HJEA 4ICAA 4IS7A 2HHSA 3PVXA 3ZDCA 3VC8A 3I76A 2EAPA 1WCLA 2F1JA 3MR6A 2LHTA 8ICRA 1BVSA 3C2LA 4I2IA 3F53A 7ICTA 5CEHA 8ICKA 2Q4TA 2BDUA 4C4TA 8ICFA 1S5LU 4YFKA 1FEZA 1L7NA 1J2NA 1ZETA 2ZUCA 4ED1A 4Y2RA 1NK8A 5KFVA 4QZHA 2KJ5A 1L7PA 2IHNA 4P0PB 4QWAA 1WWVA 3RH5A 5KFWA 8ICHA 5ALRA 4BX9C 2R18A 2DKZA 4ED3A 2AHOB 1MQ2A 4UB1A 4UAVA 2PI4A 4OD0A 5ALZA 4DSFA 1QQ5A 1SKRA 2R8JA 4B9UA 2CPRA 4MHVA 4UW9A 4BUGA 1LV5A 1UA1A 3TACB 4QJFB 1L3TA 4XA5A 2YTUA 3QUTA 3C5FA 2HBLA 4ZOHC 3C28A 4IL6U 9ICNA 4AP9A 4IRKA 4UBCA 3SQIA 4PHEA 3M9OB 5J0QA 2FJ6A 4O9MA 3H4BA 5J2AA 1S0VA 4KLOA 4OO1J 1QLNA 5AI4A 4PGXA 4DQRA 2NO5A 3OSNA 3K4GA 3T5LA 5AICA 4DWIA 2JZBA 3C2KA 1IXRA 4J9KA 2XY7A 3WKDA 1LB2B 3MDCA 1L7OA 2WAQC 3QU9A 4CE6A 2K4PA 4CDGA 1BPYA 5KFTA 5DB9A 3PSTA 3RJKA 1KRPA 4QZEA 5AM1A 5AI0A 2Y0SC 3ORYA 1N5WA 5AKEA 2WF8A 3QZ7A 5AI5A 2IOFK 3M9MB 3QU5A 4ECTA 2PFNA 5KG7A 3V7JA 2KD1A 1BPZA 4I27A 2JEIA 4JWMA 2GLEA 1S76D 3IDWA 5L1MA 2DBYA 2OEHA 3ZD9A 1Q46A 1ZQQA 5B66U 3PW5A 1WYGA 3TI0A 3M7DA 1ZQIA 2V4QA 1VLBA 4GC6A 4ED2A 4Y2TA 3PSIA 5FP0A 1A77A 3NVVA 5DB8A 2K60A 1N2XA 2EH9A 2OHFA 4ACOA 3RB4A 1JN3A 2EZXA 1SKWA 1S10A 4DSIA 2AGQA 5KFPA 2ZIUB 4RQ4A 1V97A 2GO7A 2ZUBA 1TK8A 2W8KA 5J2IA 2Y1JA 3SAHA 3MGHA 3RAQA 3RB6A 3QUQA 4YXMA 2D8CA 5IIKA 4F8RA 4Q45A 2MUTA 3PV8A 4DSLA 4F93B 3QUBA 1ZQHA 5KG3A 5CA7A 4O3RA 1SL0A 4QZFA 3HILA 5KFCA 2NRTA 3WK6A 4DQSA 4JB3A 3D2QA 5ALVA 2YMPA 2IOHA 4F5QA 1V9PA 1UA0A 2BCQA 1ZQCA 5KFHA 4ECUA 4O5CA 2FLPA 1Z3EB 3PX0A 3OTQA 3J81j 4CF3A 3V7LA 3A0HU 2FLLA 2IMWP 3HKZC 4GLXA 2BQ3A 2KZMA 5AKIA 3TFSA 4RPZA 3NVYA 3AUOA 1NZBA 3N7RC 5KT5A 2EAMA 3C23A 3RJGA 3UQ0A 3SD7A 1IM4A 2KNJA 1KFTA 5AHXA 3N7PD 4KN7A 3F2CA 1RYSA 3QX7A 3NVWA 1RG6A 4YVZA 5KG6A 3AEVA 3OGUA 1ZD2P 2Y9TA 2XGPA 2ZJ5A 4YMOA 3C1ZA 3T79A 2F3NA 4EX7A 2WFAA 4KLDA 1JUDA 4GFJA 4FZNA 1CI4A 4DL5A 3N97B 7ICNA 3PR4A 5AKJA 5J2GA 4QIWC 5EE0A 8ICTA 2W3RA 3V72A 5KFNA 5J0WA 4HAIA 2HCFA 5AKGA 5AM0A 4CCHA 2C2EA 4B6JA 2KMDA 1KQQA 2D6FC 2G5IB 4R8UB 4EEYA 4Q43A 1ZOLA 4O3PA 3TQ1A 2A1JB 4F4ZA 4PGYA 3IG5A 1U4BA 1MA7A 4JV0A 1TV9A 2W8LA 4G3IA 1U9LA 2H3FA 8ICEA 2ZIWB 1ZQNA 5ALLA 3I28A 4RT2A 1RPLA 2W04A 2WAQF 2B6GA 5L1JA 2DWQA 4CNQA 4NL9C 3M6KA 2NO4A 8ICIA 9ICOA 1ZQAA 4MFAA 2PXIA 4YR3A 3RJFA 1LVHA 3JPOA 3QXGA 3JPSA 1ZQEA 3IV6A 4BXOA 1UQVA 3LWLA 4Y2JA 4KLIA 1BNOA 2LYAA 3WKCA 4B9VA 2YX8A 1XC9A 1H38A 5CB1A 4ECXA 1ZQKA 3WKBA 2W9BA 3OJUA 1SV0A 4RPXA 2A3VA 5J0PA 2JXJA 1KW4A 2JEGA 2PFQA 5AM5A 5D46A 5ALUA 4FFDA 4Q44A 2QB0B 7ICLA 4Y2PA 3WU2U 2KZZA 5KAFU 1D9DA 4F50A 4E0DA 3PNCA 2RDJA 1DK3A 3ISCA 5DBBA 4O3MA 5DG9A 1HUZA 3CP8A 3L3FX 2B0CA 1KFSA 4O3NA 2ES6A 3Q8SB 4XQ8A 1X9MA 5ALDA 8ICJA 1WCNA 4I2AA 5G5GA 5J0UA 5JTIA 2UVUA 2WF9A 4TUQA 2QARA 3IN5A 1VDVA 2JMGA 5ALXA 5ALWA 1T4GA 2LYHA 2NRWA 3RRHA 3RB3A 2KG5A 2YN4A 1TVAA 3H8MA 1O08A 5KG2A 9ICCA 3N7SC 1DRGA 3SI8A 3T5KA 4C7ZA 5HMMA 5EWEA 4M47A 2EZZA 1XSNA 5HR6A 5AI9A 4ELTA 4K4IA 5KT3A 2HOQA 2WHEA 4M9GA 9ICEA 4RQNA 4P0QA 3AU2A 4RUAA 4F2SA 3RH6A 2KJ9A 2PMZC 2VA2A 2DFLA 4J9NA 5AIBA 3BS7A 2LM4A 2MU2A 5J0TA 1WG8A 2DKXA 1YT3A 4ELVA 2BPCA 1KFDA 2ZIWA 4GXKA 3PO5A 2P6RA 3IM1A 3IP4B 1ZRNA 2QB0A 4B9MA 3Q8RB 4PZNA 4F4KA 2ZIXA 2ESEA 5KFGA 4OCZA 2HVIA 1AQ6A 2XC9A 3BQ2A 5D4BA 5J0YA 5CRXA 2HVHA 4F92B 3C21A 4K4GA 3AN1A 2K4IA 3MR2A 5CJ7A 2AGPA 8ICYA 4RQ7A 1IIPA 1RQLA 2ALZA 1RQNA 4ECYA 1F44A 4C8LA 2KEYA 2BDPA 3TADA 4NLNA 4HYKA 1ZQYA 4F72A 1TAUA 2UVVA 2F77X 4I2JA 5J0OA 9ICRA 2BGWA 3MGIA 4NY8A 3MDAA 2XICA 1YZ7A 1RZTA 3OJSA 3GU3A 3JPNA 4ECVA 1RXVA 1LKYB 5KTQA 3GIIA 3CW2C 4KLTA 1OXJA 9ICBA 2EANA 1NJZA 2JZBB 2OM6A 3KOOA 2KP7A 4DQQA 2DPIA 4P2HA 2ATLA 4O3OA 3RRGA 1KSPA 4KX3A 3RJIA 4QWCA 1D8BA 1L7MA 4RQ6A 1L3UA 5AKYA 4F71A 1X2IA 2ISOA 5DB7A 4IRDA 2Y9UA 3ISDA 1V85A 9ICGA 3UMCA 7ICFA 4MEXA 8ICZA 4F4WA 1U48A 8ICCA 1XO0A 5J2HA 2C2RA 5L1LA 4NXZA 5JUMA 1WWUA 1L8OA 3EWAA 3JPPA 4M04A 3QEAZ 1JX4A 2K8BB 7ICGA 4YXJA 4UB5A 3NUQA 1TFRA 2DQNB 1XSLA 1QQ7A 3M6ZA 5AKZA 3RR7A 4FBUA 4M6WB 1UT5A 4IC9A 3N4MB 5ALTA 2E3TA 5K4LA 2VJ4A 4JK1A 4UASA 4DFDA 2HOFA 1SIJA 4P0PA 1ZQUA 3RFAA 3ED5A 5DBCA 3GIJA 2MA1A 3TADC 4J9RA 5F9LA 4RQ0A 1Z00B 2DL0A 2KJ8A 3LVWA 1BPBA 4F5NA 3DDHA 1BGXT 1S8OA 3Q8PB 2XGQA 3UMBA 1IV8A 3SENA 2XIDA 5HMLA 9ICLA 3O0FA 4ECWA 1ZJMA 3H8JA 1HJPA 4P4MA 5KT4A 1JRPA 5KG4A 2W9CB 1X9XA 2XCAA 3KFUF 2G0AA 4Y2QA 1WUDA 3SAFA 5KFXA 4TUSA 3RB0A 4KLQA 2KIWA 5F9NA 2F76X 1PK1B 1NJWA 1CEZA 3H8SA 4LZGA 3QU2A 5H2FU 2A19A 2LPEA 4Q8FA 2HHUA 3ZDEA 3MBYA 5IIOA 4ECQA 5TZVA 3BZKA 4C8MA 5JU5A 5J0SA 1QSSA 2MSNA 4J03A 4XRHA 2V9WA 7ICSA 2KTQA 5ALEA 4EYIB 5EWGA 4NLZA 3RBDA 2EAOA 2P35A 3NGDA 1NJYA 3BDPA 9ICKA 1ZQSA 5B5EU 5J8YC 3JPTA 2DUYA 4C8NA 4DOBA 4M9LA 5KFJA 2FMQA 4YD2A 7ICQA 5ALMA 1Z4OA 5D49A 3EW9A 4RQ5A 4KLLA 2ASLA 2IOFA 3LVVA 3AQFA 2HHVA 2VIXA 2NYVA 3KBBA 3LDAA 5A0LA 5HHIA 2W9CA 2IHMA 2ZTCA 4F2RA 8ICXA 2UVWA 2J6UA 4DL2A 5ALGA 4Z6EA 4QWDA 1PZNA 4UAWA 9ICJA 3HP6A 2KKPA 1HEKA 2E1FA 4BGDA 2HHXA 2FPLA 1AROP 3QEBZ 4NLBA 4TUPA 2LKYA 4PPXA 3QU4A 5EE3A 5L1KA 1UT8A 2CRXA 5KT7A 2E8OA 2DF4B 5DGBA 4RU9A 4ELUA 2W7OA 2RLTA 4NM1A 2M9NA 1XO1A 2ZXHA 4WJ3B 8ICQA 1QTMA 5KT2A 1S77D 5AK6A 2E8PA 2YB4A 4LJXA 2OCEA 4M6WA 4J9QA 1K1SA 2VANA 2E1EA 3RAXA 1NOMA 2G09A 3MABA 4NJ8A 3OHBA 5J2CA 4J9OA 3ISBA 2I5HA 4GIBA 4DSEA 3IHQB 1T8EA 4C8KA 2EDUA 3THVA 3PMNA 8ICWA 5KFAA 9ICFA 4F91B 2Z7JA 3GFKB 2F2AB 4YP3A 1COKA 4QZIA 1QSYA 2G08A 4EBDA 5AK4A 4QZ9A 3QYPA 4M0AA 2I6XA 2BCSA 4O3SA 1JROA 3AM9A 2IBKA 1NK9A 2BQUA 5EE9A 5DLFA 2Q0ZX 1RYRA 1K5OA 2VA3A 3ZD8A 4QWBA 4RQ1A 3PSFA 2ZJ8A 2W43A 3GV8B 4AYBF 9ICHA 4Y2XA 3Q8QB 3RH4A 5KFBA 2Y1IA 8ICSA 4EBEA 5AM4A 1ZQGA 9ICPA 3OHAA 2QLTA 3Q8KA 3UXOA 3TAQA 2KIVA 3MFIA 2AGOA 2ZJAA 5AKLA 2OXOA 3PZPA 3K1ZA 5E79U 4DCCA 4DLEA 5J2KA 2KHQA 4IQTA 9ICUA 3LYSA 2BQRA 3WKAA 3HKZF 7ICUA 4NM2A 1EXNA 1J97A 4R63A 1KBUA 4RNNA 1JMSA 2Y0SF 4DO9A 1K1QA 4XUSA 2YMQA 3KHRA 2K4HA 1NNLA 2KKVA 3ALRA 1X9WA 4U6PA 2KK0A 4MFCA 4UB6U 4JUZA 3T3FA 5IINA 4QZCA 1Z1BA 3UMGA 4US8A 1Z00A 2BHNA 3PY8A 1TE2A 3ETRA 2P66A 5KFDA 2EZYA 2ASJA 2YY6A 1U49A 1CUKA 5ALKA 5HR7A 3RTVA 1TAMA 4PH5A 1KDHA 1ZQXA 2WTFA 4KITB 4ED6A 1T3QA 4GXIA 2ISPA 2OWOA 3F2DA 2HBMA 5DDYA 4DS4A 3UM9A 3SAGA 4R66A 3C2MA 2W03A 4MF8A 3B0YA 9ICQA 3QE9Y 2XI9A 4O0IA 4US9A 3RR8A 2K4EA 1MN8A 3WK9A 3HT3A 4AYBC 2OH2A 4BXOB 4IQWA 4EENA 5KFMA 2C2DA 2BR0A 3PX6A 3BJYA 2JRZA 3HW8A 8ICUA 3FAHA 2XCPA 1NKBA 4I2FA 3I1YA 5TISU 4KLJA 5ALIA 4BJQA 5BOMA 5IIMA 2R8IA 4TURA 2C22A 2BPGA 3ZDBA 4KLFA 3F5AA 4F5RA 4J9PA 1JI7A 4CF5A 1KEJA 3OPXA 4EX6A 2UVRA 3RJJA 2K8CB 2KFNA 1TKDA 3QZ8A 5DQGA 3T5HA 5ALYA 2F1IA 1Q3UA 1KL9A 2XY5A 1ZQPA 9ICMA 1D8YA 3PW0A 4O5KA 9ICTA 1KLNA 4ED7A 2AQ0A 1XWLA 4FS2A 1RDFA 1VJ5A 2KICA 2PI5A 8ICPA 1JXEA 4LVSA 1NI3A 2ODGA 1Z1VA 3B9JA 4YR0A 2ZUDA 4LZDA 1A76A 4UBBA 1SWVA 4CRXA 1IG6A 8ICLA 3D2SA 3GV5B 1N63A 4IQUA 4KLSA 8ICMA 1KTQA 3WK4A 1JALA 1TK5A 2HBKA 2JHDA 7ICHA 4GC7A 2RP5A 5KNIA 3Q8MA 4R64A 4M9JA 4NLCA 5J0RA 4NLGA 4YR2A 3AMZA 1A0PA 2GH1A 3KHHA 4OJOA 4KLUA 2KSOA 4A8EA 1MSWD 4DEZA 2HW3A 3LWMA 2ZIXB 4G9BA 3HX0A 4DOCA 2JV3A 3TFRA 4F3OA 9ICSA 1QH9A 4RNOA 4JMUA 1DK2A 2DGZA 1NK4A 2W9AA 2KSOB 3HRDD 3ZDDA 4NWIA 1X66A 3NTUA 2A1JA 3GILA 3PR5B 2OYYA 1D9FA 4R8UA 1J2MA 3K75D 5CWRA 1URJA 3KD3A 2LBOA 1HUOA 4DQIA 1XNSA 5HP4A 4QW9A 4UB3A 3AU6A 1N56A 4P4PA 2KFZA 4U7CA 5KFYA 4RPYA 3KZIU 1UHUA 5KFEA 2L5YA 4KMOB 2H3ZA 3V6KA 3TKAA 2BKEA 3GQCA 2WB1C 4Z6CA 1UCVA 2KE7A 3V7KA 7ICEA 2MAXA 2NRZA 4ECRA 5KFQA 2F44A 2RQ5A 5CR0A 2HHWA 4RZRA 2IA6A 3E58A 1DGSA 1OW5A 4Y2SA 5C5JA 4ECZA 4B9SA 3BS5A 3VCBA 5DG8A 1ZQJA 2XVTA 3KHGA 4J9LA 3PX4A 8ICVA 4PL2A 2K89A 4QW8A 4KTQA 4DL6A 2P6UA 2WF7A 1B43A 5L1IA 3Q8LA 4I2GA 2KHVA 2ZTEA 4J9MA 4QZDA 3M9NB 5AI8A 3R9KA 5GTIU 3D6JA 5J2EA 4NLKA 3M8RA 2FI1A 3QUCA 3D2NA 3QU7A 2WF5A 1ZQVA 3ETLA 3C1YA 3C29A 2F8KA 2FPKA 5J2JA 4Q8EA 1QQ6A 4YD1A 3MR3A 2FMSA 3M1YA 4JV2A 2AU0A 2FE9A 3H0MB 3KKAC 4DF4A 3MGVA 3UQ2A 4RQ3A 3B0XA 5J2BA 2W11A 1Q3VA 3F2BA 3K1RB 3QNMA 4Y2VA 1DXSA 2MUTB 4QZAA 4TQRA 2JEJA 2RRDA 1JIHA 5IIIA 5ALHA 4Y2YA 4C0ZA 1T3NA 3SR6A 4MEYA 4YMNA 3SMVA 4DLGA 1M6YA 4DFJA 1S9FA 4I29A 5ALPA 5ALNA 2BZFA 1ZQZA 2KZ3A 2BCUA 7ICKA 2RDIA 3BQ7A 1SB3C 1HIWA 2JEFA 1ZJNA 1N5XA 4B9NA 1ZQRA 1L5UA 4DFKA 3FYHA 2W3SA 3BQTA 4OJPA 4USAA 3BZCA 4YN4A 3PSPA 2PMZF 5DKWA 3WK5A 4M9NA 3HPOA 2JR5A 2VJ5A 5AKKA 3UXPA 5ALSA 4KLEA 3AL0B 3OSPA 1NKCA 1KKXA 3M8SA 1D8LA 5J0XA 4C80A 5EWFA 3N28A 4TQSA 2H3QA 3E0FA 2D3DA 3SEIA 1Z19A 2AQ4A 1SXEA 8ICGA 3KKAA 3EPGA 3NS1A 3MC1A 1X40A 4IQVA 4IRCA 4DOAA 1ECWA 2MRLA 1S97A 2GOLA 2ZXIA 4UATA 1X9SA 2H3VA 4UAUA 1ZQMA 4B9LA 4I2BA 1Q8KA 3FM9A 2BCRA 9ICXA 4EZ9A 5KL1B 5EE1A 3ZDAA 4EBCA 2XO7A 3TAPA 1S0NA 2XY6A 1C7YA 5J29A 1BPEA 4I28A 2K8AA 4OJ5A 2LYBA 5DLGA 1SGGA 1U45A 1SL1A 3WK8A 7ICOA 2YMLA 1SZHA 1ZQFA 5KFRA 4KX5A 4DSJA
chains in the Genus database with same CATH topology
2Y0SF 4P0QA 2KJ5A 1XO0A 3ICXA 2KD1A 2E1EA 2KJ9A 3IG8A 2PMZC 4OJPA 2K4HA 2KKVA 4P0PB 2G09A 2LYAA 2KICA 2F8LA 1NZBA 2YB1A 3ALRA 4U6PA 2YX8A 3N7RC 3PSPA 3VCBA 2PMZF 2E5SA 1CRXA 1UPHA 2XVTA 4NV0A 2HOIA 1L6NA 2KNJA 2KOBA 4FZMA 1Z1BA 4PL2A 1YT3A 4BX9C 2JH1A 2HMXA 2K89A 2R18A 3N7PD 2A3VA 3F2CA 2K8BB 2ZIVB 2VJ5A 4CRXA 2NV3A 2G5HB 3AL0B 2ZIWA 3M7DA 3D2SA 3NUQA 2Z7JA 2KHVA 4OJLA 3IP4B 2DQNB 3M6ZA 4O3MA 3H0RB 2F2AB 2CPRA 3PSIA 4BUGA 3NRWA 3T79A 3AQEA 2HBKA 2KV2A 5HR7A 3GZFA 1TAMA 2JHDA 2ZIXA 2HBJA 2G08A 2ZIVA 4GFJA 3CRXA 2RP5A 4FZNA 4IC9A 5CRXA 3D2NA 4QJFB 4ACOA 1OUQA 4NLCA 2H3QA 2CN1A 2HBMA 3E0FA 3F2DA 3CP8A 3F5EA 2K4IA 1A0PA 4QNLA 2GH1A 2VJ4A 3SAGA 4OJOA 2W7PA 3C29A 1Z19A 3CYMA 3L3FX 2W03A 4A8EA 3LVVA 3AQFA 4QIWC 2HBLA 2JH7A 2VIXA 2XI9A 2ZIUB 2HOFA 3C28A 4P0PA 2ZIXB 3RFAA 2K4EA 2N1RA 1IIPA 1ECWA 2MRLA 3H0MB 5A0LA 1F44A 2GOLA 2M0NA 3ONNA 1ZQ1C 2G06A 2MA1A 4AYBC 3SAHA 1ED1A 2KEYA 2ZG6A 2ZXIA 3PSFA 3MGVA 5C0YA 3SQIA 2H3VA 4FE3A 4AYBF 4JMUA 4PL1A 2DGZA 1Q3VA 4OJ6A 2D6FC 2G5IB 3F2BA 4CGZA 4OO1J 2F77X 2KJ8A 4NWIA 3LVWA 3IN5A 3RF9A 3KZXA 4QIWF 2OYYA 2JMGA 2VKQA 1PVRA 1GO3F 4BJQA 2XIDA 3IG5A 2KKPA 2RRDA 1HEKA 2KVCA 2E1FA 4FZLA 1MA7A 5KL1B 2XICA 3O0FA 2H3IA 4NLBA 1URJA 4C0ZA 2LBOA 3GU3A 2G07A 2LKYA 5KL8B 1XNSA 3F5AA 3DEEA 2OXOA 2RHFA 3PZPA 3SMVA 4P0QB 3D2QA 2CRXA 2H3FA 3KFUF 2G0AA 2WAQC 2ZIWB 3K1ZA 3N7SC 4U7CA 1A6SA 1DRGA 2DF4B 2OM6A 3OPXA 4ICAA 1WUDA 1PVPA 2ZIUA 1P7DA 1T94A 3VC8A 3SAFA 2W04A 2WAQF 2W7OA 2K8AA 2K8CB 2WB1F 2KIWA 2LHTA 2KHQA 4KMOB 2H3ZA 4KX3A 4OJ5A 4CDGA 5HR6A 1D8BA 2LYBA 2F76X 2ZXHA 4WJ3B 2JGAA 2WB1C 3F53A 1HIWA 3PSTA 3LYSA 5T14A 3HKZF 3M6KA 2Q4TA 2BDUA 2HOQA 1SZHA 3H0LB 1Q3UA 2Y0SC 2YB4A 4KX5A 1PVQA 2OH2A 1KBUA 3HKZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0N A;  2KVC A;  2LKY A; 
#chains in the Genus database with same CATH topology
 1F5S A;  4F4Y A;  1N61 A;  5AKX A;  1S0O A;  5AK3 A;  1Z4N A;  1T7P A;  3PW2 A;  4EEL A;  4EYH B;  3NAS A;  1FIQ A;  5J2D A;  3V6H A;  1S0M A;  1TAQ A;  2JH1 A;  4F5P A;  2DPJ A;  1DOQ A;  3EPI A;  2NV3 A;  2G5H B;  1NK5 A;  4R65 A;  2KVS A;  4O5E A;  4DQP A;  4OJL A;  3PW4 A;  2AJQ A;  2FMP A;  1Y88 A;  1COO A;  4FS1 A;  2PFP A;  2HBJ A;  4J9S A;  2ZIV A;  4BWM A;  4ECS A;  4EZ6 A;  3E2E A;  1MC8 A;  1PK1 A;  5DQI A;  5EOZ A;  4DL4 A;  1N60 A;  2E8N A;  4QNL A;  2HHQ A;  2HDO A;  3T5J A;  4ED0 A;  3PW7 A;  1ZD3 A;  1ZQ1 C;  2G06 A;  1ED1 A;  2ZG6 A;  1X6J A;  3L4P A;  5ALO A;  3GDX A;  4JV1 A;  1FFU A;  4FE3 A;  4YQW A;  3A0B U;  1QCK A;  4MFF A;  1ZQT A;  3UPQ A;  4CGZ A;  1ZD5 A;  3ZI4 A;  3KZX A;  4QIW F;  2I9G A;  5G5H A;  4DL7 A;  1SV0 C;  5KFI A;  1ZD4 A;  5DDM A;  5ALF A;  3PML A;  2J6T A;  2YMM A;  1ZQD A;  2V4R A;  5J2F A;  4M9H A;  2QB1 A;  1TK0 A;  2ZIU A;  4KLG A;  2ZTD A;  4B9T A;  1RM6 C;  4I2E A;  2JGA A;  5CHG A;  4PHA A;  4NL9 A;  2J6S A;  3BS5 B;  1X42 A;  3EZ5 A;  3MFH A;  2E8M A;  5KFF A;  4DS5 A;  3CNH A;  2PFO A;  5AIA A;  3BQ0 A;  1ZQL A;  3IG8 A;  1FO4 A;  3TAR A;  3HWT A;  2YB1 A;  3NRZ A;  4C8O A;  3V6J A;  1FFV A;  4FBT A;  1UPH A;  2HI0 A;  2KOB A;  4F4X A;  3WK7 A;  5KAI U;  1ZQW A;  8ICN A;  4IR9 A;  4UB8 U;  4ED8 A;  3NRW A;  3IRU A;  2BPF A;  2W54 A;  2PKE A;  2KN7 A;  1PK3 A;  4UAZ A;  5JRT A;  3MR5 A;  5IIL A;  2CN1 A;  1B22 A;  1C20 A;  3JPQ A;  3CYM A;  4DFM A;  7ICV A;  2JH7 A;  4Y2U A;  3SZ2 A;  5IIJ A;  7ICJ A;  5AM2 A;  1SXD A;  3GIK A;  5KFO A;  5GTH U;  2AH5 A;  4KLM A;  4RQ8 A;  7ICI A;  1B4F A;  3WKE A;  2VKQ A;  4YCX A;  1GO3 F;  3RJE A;  2HHT A;  5HNK A;  2YQE A;  1NK0 A;  4PGQ A;  2KVC A;  4Z6F A;  4X5V A;  3G6V A;  3RBE A;  8ICO A;  5KL8 B;  4I2D A;  3BQ1 A;  5KG1 A;  2H5X A;  1A6S A;  5KG5 A;  4YG2 A;  1PVP A;  4JWN A;  7ICP A;  4O3Q A;  2WB1 F;  4BDP A;  3JPR A;  5T14 A;  9ICV A;  3H0L B;  1NZP A;  5ALJ A;  9ICW A;  1PVQ A;  4RQ2 A;  4KMU A;  4RNM A;  5AK5 A;  2B21 A;  1X6I A;  4KN4 A;  8ICB A;  1CRX A;  3L5K A;  1L6N A;  4FZM A;  4UAR A;  2HMX A;  5KFU A;  2O6K A;  9ICA A;  4UAY A;  1V38 A;  2R8H A;  5ALQ A;  4MF2 A;  3SV3 A;  4UB4 A;  8ICA A;  3H0R B;  2C28 A;  4UQG A;  1KN5 A;  3AQE A;  1NK6 A;  3GZF A;  2FDR A;  2VA8 A;  1ZXI A;  1ZRM A;  5BPC A;  2EQY A;  3EUB 2;  3PO4 A;  1ZYQ A;  4QZG A;  1JXL A;  5DB6 A;  4I2H A;  5F3X B;  2N1R A;  5AKH A;  4I2C A;  3GV7 B;  5HHH A;  2ASD A;  2GWS A;  4C4R A;  4ZH4 A;  1SV4 A;  1SWW A;  3G6Y A;  3H40 A;  2FPM A;  1QSL A;  3RF9 A;  1NKE A;  4QZ8 A;  4DL3 A;  1PVR A;  2QAR B;  1XS9 D;  1RYU A;  3EYZ A;  4PZO A;  2H3I A;  3UXN A;  7ICM A;  4M2Y A;  3U26 A;  5KFK A;  4DSK A;  1SZP A;  2LI6 A;  2A1A A;  2W9M A;  2W55 A;  4Z6D A;  1P7D A;  1PUZ A;  1T94 A;  3NVZ A;  1O03 A;  3H8W A;  1SKS A;  3C5G A;  2AXT U;  3KHL A;  1SL2 A;  3KTQ A;  1BNP A;  3TAN A;  4FO6 A;  2CXY A;  3H4D A;  1NK7 A;  1L8L A;  2F1H A;  4PJ0 U;  2R8K A;  4CF4 A;  5BOL A;  2WF6 A;  3ICX A;  2LMR A;  1LKY A;  1RXW A;  5DGA A;  1N62 A;  2F8L A;  3FC4 A;  5DBA A;  7ICR A;  1BPX A;  1N48 A;  2E5S A;  2BCV A;  1F0M A;  3DV9 A;  2R8G A;  3H7I A;  4NV0 A;  2HOI A;  1L3S A;  4RUC A;  5KT6 A;  2W9B B;  1MQ3 A;  3RJH A;  2ZIV B;  4BWJ A;  5J8Y A;  4K4H A;  1U47 A;  3LK9 A;  3FDS A;  2HSZ A;  4EEK A;  2KV2 A;  2LM1 A;  1ZQO A;  1DGJ A;  1L3V A;  3SV4 A;  3CRX A;  3SYZ A;  3GIM A;  5AI6 A;  4KLH A;  3S6J A;  1OUQ A;  2NRV A;  4RQM A;  4YMM A;  9ICI A;  1BPD A;  1XU4 A;  2W7P A;  3F5E A;  5KFZ A;  4UB2 A;  1ZQB A;  2M0N A;  3ONN A;  5CP2 A;  5C0Y A;  4F5O A;  4QZB A;  4C7Y A;  5DG7 A;  2NRX A;  4PHP A;  2I1Q A;  5DQH A;  4PL1 A;  4PHD A;  4OJ6 A;  1B0X A;  1YZ6 A;  5KFS A;  5KG0 A;  4RT3 A;  4DFP A;  4IR1 A;  4QWE A;  2FLN A;  4FZL A;  5AM3 A;  4C4S A;  4P4O A;  4GXJ A;  1XSP A;  2G07 A;  4DF8 A;  1NJX A;  3DEE A;  5KFL A;  3G6X A;  2RHF A;  5L9X A;  4P0Q B;  2QKQ A;  3HJE A;  4ICA A;  4IS7 A;  2HHS A;  3PVX A;  3ZDC A;  3VC8 A;  3I76 A;  2EAP A;  1WCL A;  2F1J A;  3MR6 A;  2LHT A;  8ICR A;  1BVS A;  3C2L A;  4I2I A;  3F53 A;  7ICT A;  5CEH A;  8ICK A;  2Q4T A;  2BDU A;  4C4T A;  8ICF A;  1S5L U;  4YFK A;  1FEZ A;  1L7N A;  1J2N A;  1ZET A;  2ZUC A;  4ED1 A;  4Y2R A;  1NK8 A;  5KFV A;  4QZH A;  2KJ5 A;  1L7P A;  2IHN A;  4P0P B;  4QWA A;  1WWV A;  3RH5 A;  5KFW A;  8ICH A;  5ALR A;  4BX9 C;  2R18 A;  2DKZ A;  4ED3 A;  2AHO B;  1MQ2 A;  4UB1 A;  4UAV A;  2PI4 A;  4OD0 A;  5ALZ A;  4DSF A;  1QQ5 A;  1SKR A;  2R8J A;  4B9U A;  2CPR A;  4MHV A;  4UW9 A;  4BUG A;  1LV5 A;  1UA1 A;  3TAC B;  4QJF B;  1L3T A;  4XA5 A;  2YTU A;  3QUT A;  3C5F A;  2HBL A;  4ZOH C;  3C28 A;  4IL6 U;  9ICN A;  4AP9 A;  4IRK A;  4UBC A;  3SQI A;  4PHE A;  3M9O B;  5J0Q A;  2FJ6 A;  4O9M A;  3H4B A;  5J2A A;  1S0V A;  4KLO A;  4OO1 J;  1QLN A;  5AI4 A;  4PGX A;  4DQR A;  2NO5 A;  3OSN A;  3K4G A;  3T5L A;  5AIC A;  4DWI A;  2JZB A;  3C2K A;  1IXR A;  4J9K A;  2XY7 A;  3WKD A;  1LB2 B;  3MDC A;  1L7O A;  2WAQ C;  3QU9 A;  4CE6 A;  2K4P A;  4CDG A;  1BPY A;  5KFT A;  5DB9 A;  3PST A;  3RJK A;  1KRP A;  4QZE A;  5AM1 A;  5AI0 A;  2Y0S C;  3ORY A;  1N5W A;  5AKE A;  2WF8 A;  3QZ7 A;  5AI5 A;  2IOF K;  3M9M B;  3QU5 A;  4ECT A;  2PFN A;  5KG7 A;  3V7J A;  2KD1 A;  1BPZ A;  4I27 A;  2JEI A;  4JWM A;  2GLE A;  1S76 D;  3IDW A;  5L1M A;  2DBY A;  2OEH A;  3ZD9 A;  1Q46 A;  1ZQQ A;  5B66 U;  3PW5 A;  1WYG A;  3TI0 A;  3M7D A;  1ZQI A;  2V4Q A;  1VLB A;  4GC6 A;  4ED2 A;  4Y2T A;  3PSI A;  5FP0 A;  1A77 A;  3NVV A;  5DB8 A;  2K60 A;  1N2X A;  2EH9 A;  2OHF A;  4ACO A;  3RB4 A;  1JN3 A;  2EZX A;  1SKW A;  1S10 A;  4DSI A;  2AGQ A;  5KFP A;  2ZIU B;  4RQ4 A;  1V97 A;  2GO7 A;  2ZUB A;  1TK8 A;  2W8K A;  5J2I A;  2Y1J A;  3SAH A;  3MGH A;  3RAQ A;  3RB6 A;  3QUQ A;  4YXM A;  2D8C A;  5IIK A;  4F8R A;  4Q45 A;  2MUT A;  3PV8 A;  4DSL A;  4F93 B;  3QUB A;  1ZQH A;  5KG3 A;  5CA7 A;  4O3R A;  1SL0 A;  4QZF A;  3HIL A;  5KFC A;  2NRT A;  3WK6 A;  4DQS A;  4JB3 A;  3D2Q A;  5ALV A;  2YMP A;  2IOH A;  4F5Q A;  1V9P A;  1UA0 A;  2BCQ A;  1ZQC A;  5KFH A;  4ECU A;  4O5C A;  2FLP A;  1Z3E B;  3PX0 A;  3OTQ A;  3J81 j;  4CF3 A;  3V7L A;  3A0H U;  2FLL A;  2IMW P;  3HKZ C;  4GLX A;  2BQ3 A;  2KZM A;  5AKI A;  3TFS A;  4RPZ A;  3NVY A;  3AUO A;  1NZB A;  3N7R C;  5KT5 A;  2EAM A;  3C23 A;  3RJG A;  3UQ0 A;  3SD7 A;  1IM4 A;  2KNJ A;  1KFT A;  5AHX A;  3N7P D;  4KN7 A;  3F2C A;  1RYS A;  3QX7 A;  3NVW A;  1RG6 A;  4YVZ A;  5KG6 A;  3AEV A;  3OGU A;  1ZD2 P;  2Y9T A;  2XGP A;  2ZJ5 A;  4YMO A;  3C1Z A;  3T79 A;  2F3N A;  4EX7 A;  2WFA A;  4KLD A;  1JUD A;  4GFJ A;  4FZN A;  1CI4 A;  4DL5 A;  3N97 B;  7ICN A;  3PR4 A;  5AKJ A;  5J2G A;  4QIW C;  5EE0 A;  8ICT A;  2W3R A;  3V72 A;  5KFN A;  5J0W A;  4HAI A;  2HCF A;  5AKG A;  5AM0 A;  4CCH A;  2C2E A;  4B6J A;  2KMD A;  1KQQ A;  2D6F C;  2G5I B;  4R8U B;  4EEY A;  4Q43 A;  1ZOL A;  4O3P A;  3TQ1 A;  2A1J B;  4F4Z A;  4PGY A;  3IG5 A;  1U4B A;  1MA7 A;  4JV0 A;  1TV9 A;  2W8L A;  4G3I A;  1U9L A;  2H3F A;  8ICE A;  2ZIW B;  1ZQN A;  5ALL A;  3I28 A;  4RT2 A;  1RPL A;  2W04 A;  2WAQ F;  2B6G A;  5L1J A;  2DWQ A;  4CNQ A;  4NL9 C;  3M6K A;  2NO4 A;  8ICI A;  9ICO A;  1ZQA A;  4MFA A;  2PXI A;  4YR3 A;  3RJF A;  1LVH A;  3JPO A;  3QXG A;  3JPS A;  1ZQE A;  3IV6 A;  4BXO A;  1UQV A;  3LWL A;  4Y2J A;  4KLI A;  1BNO A;  2LYA A;  3WKC A;  4B9V A;  2YX8 A;  1XC9 A;  1H38 A;  5CB1 A;  4ECX A;  1ZQK A;  3WKB A;  2W9B A;  3OJU A;  1SV0 A;  4RPX A;  2A3V A;  5J0P A;  2JXJ A;  1KW4 A;  2JEG A;  2PFQ A;  5AM5 A;  5D46 A;  5ALU A;  4FFD A;  4Q44 A;  2QB0 B;  7ICL A;  4Y2P A;  3WU2 U;  2KZZ A;  5KAF U;  1D9D A;  4F50 A;  4E0D A;  3PNC A;  2RDJ A;  1DK3 A;  3ISC A;  5DBB A;  4O3M A;  5DG9 A;  1HUZ A;  3CP8 A;  3L3F X;  2B0C A;  1KFS A;  4O3N A;  2ES6 A;  3Q8S B;  4XQ8 A;  1X9M A;  5ALD A;  8ICJ A;  1WCN A;  4I2A A;  5G5G A;  5J0U A;  5JTI A;  2UVU A;  2WF9 A;  4TUQ A;  2QAR A;  3IN5 A;  1VDV A;  2JMG A;  5ALX A;  5ALW A;  1T4G A;  2LYH A;  2NRW A;  3RRH A;  3RB3 A;  2KG5 A;  2YN4 A;  1TVA A;  3H8M A;  1O08 A;  5KG2 A;  9ICC A;  3N7S C;  1DRG A;  3SI8 A;  3T5K A;  4C7Z A;  5HMM A;  5EWE A;  4M47 A;  2EZZ A;  1XSN A;  5HR6 A;  5AI9 A;  4ELT A;  4K4I A;  5KT3 A;  2HOQ A;  2WHE A;  4M9G A;  9ICE A;  4RQN A;  4P0Q A;  3AU2 A;  4RUA A;  4F2S A;  3RH6 A;  2KJ9 A;  2PMZ C;  2VA2 A;  2DFL A;  4J9N A;  5AIB A;  3BS7 A;  2LM4 A;  2MU2 A;  5J0T A;  1WG8 A;  2DKX A;  1YT3 A;  4ELV A;  2BPC A;  1KFD A;  2ZIW A;  4GXK A;  3PO5 A;  2P6R A;  3IM1 A;  3IP4 B;  1ZRN A;  2QB0 A;  4B9M A;  3Q8R B;  4PZN A;  4F4K A;  2ZIX A;  2ESE A;  5KFG A;  4OCZ A;  2HVI A;  1AQ6 A;  2XC9 A;  3BQ2 A;  5D4B A;  5J0Y A;  5CRX A;  2HVH A;  4F92 B;  3C21 A;  4K4G A;  3AN1 A;  2K4I A;  3MR2 A;  5CJ7 A;  2AGP A;  8ICY A;  4RQ7 A;  1IIP A;  1RQL A;  2ALZ A;  1RQN A;  4ECY A;  1F44 A;  4C8L A;  2KEY A;  2BDP A;  3TAD A;  4NLN A;  4HYK A;  1ZQY A;  4F72 A;  1TAU A;  2UVV A;  2F77 X;  4I2J A;  5J0O A;  9ICR A;  2BGW A;  3MGI A;  4NY8 A;  3MDA A;  2XIC A;  1YZ7 A;  1RZT A;  3OJS A;  3GU3 A;  3JPN A;  4ECV A;  1RXV A;  1LKY B;  5KTQ A;  3GII A;  3CW2 C;  4KLT A;  1OXJ A;  9ICB A;  2EAN A;  1NJZ A;  2JZB B;  2OM6 A;  3KOO A;  2KP7 A;  4DQQ A;  2DPI A;  4P2H A;  2ATL A;  4O3O A;  3RRG A;  1KSP A;  4KX3 A;  3RJI A;  4QWC A;  1D8B A;  1L7M A;  4RQ6 A;  1L3U A;  5AKY A;  4F71 A;  1X2I A;  2ISO A;  5DB7 A;  4IRD A;  2Y9U A;  3ISD A;  1V85 A;  9ICG A;  3UMC A;  7ICF A;  4MEX A;  8ICZ A;  4F4W A;  1U48 A;  8ICC A;  1XO0 A;  5J2H A;  2C2R A;  5L1L A;  4NXZ A;  5JUM A;  1WWU A;  1L8O A;  3EWA A;  3JPP A;  4M04 A;  3QEA Z;  1JX4 A;  2K8B B;  7ICG A;  4YXJ A;  4UB5 A;  3NUQ A;  1TFR A;  2DQN B;  1XSL A;  1QQ7 A;  3M6Z A;  5AKZ A;  3RR7 A;  4FBU A;  4M6W B;  1UT5 A;  4IC9 A;  3N4M B;  5ALT A;  2E3T A;  5K4L A;  2VJ4 A;  4JK1 A;  4UAS A;  4DFD A;  2HOF A;  1SIJ A;  4P0P A;  1ZQU A;  3RFA A;  3ED5 A;  5DBC A;  3GIJ A;  2MA1 A;  3TAD C;  4J9R A;  5F9L A;  4RQ0 A;  1Z00 B;  2DL0 A;  2KJ8 A;  3LVW A;  1BPB A;  4F5N A;  3DDH A;  1BGX T;  1S8O A;  3Q8P B;  2XGQ A;  3UMB A;  1IV8 A;  3SEN A;  2XID A;  5HML A;  9ICL A;  3O0F A;  4ECW A;  1ZJM A;  3H8J A;  1HJP A;  4P4M A;  5KT4 A;  1JRP A;  5KG4 A;  2W9C B;  1X9X A;  2XCA A;  3KFU F;  2G0A A;  4Y2Q A;  1WUD A;  3SAF A;  5KFX A;  4TUS A;  3RB0 A;  4KLQ A;  2KIW A;  5F9N A;  2F76 X;  1PK1 B;  1NJW A;  1CEZ A;  3H8S A;  4LZG A;  3QU2 A;  5H2F U;  2A19 A;  2LPE A;  4Q8F A;  2HHU A;  3ZDE A;  3MBY A;  5IIO A;  4ECQ A;  5TZV A;  3BZK A;  4C8M A;  5JU5 A;  5J0S A;  1QSS A;  2MSN A;  4J03 A;  4XRH A;  2V9W A;  7ICS A;  2KTQ A;  5ALE A;  4EYI B;  5EWG A;  4NLZ A;  3RBD A;  2EAO A;  2P35 A;  3NGD A;  1NJY A;  3BDP A;  9ICK A;  1ZQS A;  5B5E U;  5J8Y C;  3JPT A;  2DUY A;  4C8N A;  4DOB A;  4M9L A;  5KFJ A;  2FMQ A;  4YD2 A;  7ICQ A;  5ALM A;  1Z4O A;  5D49 A;  3EW9 A;  4RQ5 A;  4KLL A;  2ASL A;  2IOF A;  3LVV A;  3AQF A;  2HHV A;  2VIX A;  2NYV A;  3KBB A;  3LDA A;  5A0L A;  5HHI A;  2W9C A;  2IHM A;  2ZTC A;  4F2R A;  8ICX A;  2UVW A;  2J6U A;  4DL2 A;  5ALG A;  4Z6E A;  4QWD A;  1PZN A;  4UAW A;  9ICJ A;  3HP6 A;  2KKP A;  1HEK A;  2E1F A;  4BGD A;  2HHX A;  2FPL A;  1ARO P;  3QEB Z;  4NLB A;  4TUP A;  2LKY A;  4PPX A;  3QU4 A;  5EE3 A;  5L1K A;  1UT8 A;  2CRX A;  5KT7 A;  2E8O A;  2DF4 B;  5DGB A;  4RU9 A;  4ELU A;  2W7O A;  2RLT A;  4NM1 A;  2M9N A;  1XO1 A;  2ZXH A;  4WJ3 B;  8ICQ A;  1QTM A;  5KT2 A;  1S77 D;  5AK6 A;  2E8P A;  2YB4 A;  4LJX A;  2OCE A;  4M6W A;  4J9Q A;  1K1S A;  2VAN A;  2E1E A;  3RAX A;  1NOM A;  2G09 A;  3MAB A;  4NJ8 A;  3OHB A;  5J2C A;  4J9O A;  3ISB A;  2I5H A;  4GIB A;  4DSE A;  3IHQ B;  1T8E A;  4C8K A;  2EDU A;  3THV A;  3PMN A;  8ICW A;  5KFA A;  9ICF A;  4F91 B;  2Z7J A;  3GFK B;  2F2A B;  4YP3 A;  1COK A;  4QZI A;  1QSY A;  2G08 A;  4EBD A;  5AK4 A;  4QZ9 A;  3QYP A;  4M0A A;  2I6X A;  2BCS A;  4O3S A;  1JRO A;  3AM9 A;  2IBK A;  1NK9 A;  2BQU A;  5EE9 A;  5DLF A;  2Q0Z X;  1RYR A;  1K5O A;  2VA3 A;  3ZD8 A;  4QWB A;  4RQ1 A;  3PSF A;  2ZJ8 A;  2W43 A;  3GV8 B;  4AYB F;  9ICH A;  4Y2X A;  3Q8Q B;  3RH4 A;  5KFB A;  2Y1I A;  8ICS A;  4EBE A;  5AM4 A;  1ZQG A;  9ICP A;  3OHA A;  2QLT A;  3Q8K A;  3UXO A;  3TAQ A;  2KIV A;  3MFI A;  2AGO A;  2ZJA A;  5AKL A;  2OXO A;  3PZP A;  3K1Z A;  5E79 U;  4DCC A;  4DLE A;  5J2K A;  2KHQ A;  4IQT A;  9ICU A;  3LYS A;  2BQR A;  3WKA A;  3HKZ F;  7ICU A;  4NM2 A;  1EXN A;  1J97 A;  4R63 A;  1KBU A;  4RNN A;  1JMS A;  2Y0S F;  4DO9 A;  1K1Q A;  4XUS A;  2YMQ A;  3KHR A;  2K4H A;  1NNL A;  2KKV A;  3ALR A;  1X9W A;  4U6P A;  2KK0 A;  4MFC A;  4UB6 U;  4JUZ A;  3T3F A;  5IIN A;  4QZC A;  1Z1B A;  3UMG A;  4US8 A;  1Z00 A;  2BHN A;  3PY8 A;  1TE2 A;  3ETR A;  2P66 A;  5KFD A;  2EZY A;  2ASJ A;  2YY6 A;  1U49 A;  1CUK A;  5ALK A;  5HR7 A;  3RTV A;  1TAM A;  4PH5 A;  1KDH A;  1ZQX A;  2WTF A;  4KIT B;  4ED6 A;  1T3Q A;  4GXI A;  2ISP A;  2OWO A;  3F2D A;  2HBM A;  5DDY A;  4DS4 A;  3UM9 A;  3SAG A;  4R66 A;  3C2M A;  2W03 A;  4MF8 A;  3B0Y A;  9ICQ A;  3QE9 Y;  2XI9 A;  4O0I A;  4US9 A;  3RR8 A;  2K4E A;  1MN8 A;  3WK9 A;  3HT3 A;  4AYB C;  2OH2 A;  4BXO B;  4IQW A;  4EEN A;  5KFM A;  2C2D A;  2BR0 A;  3PX6 A;  3BJY A;  2JRZ A;  3HW8 A;  8ICU A;  3FAH A;  2XCP A;  1NKB A;  4I2F A;  3I1Y A;  5TIS U;  4KLJ A;  5ALI A;  4BJQ A;  5BOM A;  5IIM A;  2R8I A;  4TUR A;  2C22 A;  2BPG A;  3ZDB A;  4KLF A;  3F5A A;  4F5R A;  4J9P A;  1JI7 A;  4CF5 A;  1KEJ A;  3OPX A;  4EX6 A;  2UVR A;  3RJJ A;  2K8C B;  2KFN A;  1TKD A;  3QZ8 A;  5DQG A;  3T5H A;  5ALY A;  2F1I A;  1Q3U A;  1KL9 A;  2XY5 A;  1ZQP A;  9ICM A;  1D8Y A;  3PW0 A;  4O5K A;  9ICT A;  1KLN A;  4ED7 A;  2AQ0 A;  1XWL A;  4FS2 A;  1RDF A;  1VJ5 A;  2KIC A;  2PI5 A;  8ICP A;  1JXE A;  4LVS A;  1NI3 A;  2ODG A;  1Z1V A;  3B9J A;  4YR0 A;  2ZUD A;  4LZD A;  1A76 A;  4UBB A;  1SWV A;  4CRX A;  1IG6 A;  8ICL A;  3D2S A;  3GV5 B;  1N63 A;  4IQU A;  4KLS A;  8ICM A;  1KTQ A;  3WK4 A;  1JAL A;  1TK5 A;  2HBK A;  2JHD A;  7ICH A;  4GC7 A;  2RP5 A;  5KNI A;  3Q8M A;  4R64 A;  4M9J A;  4NLC A;  5J0R A;  4NLG A;  4YR2 A;  3AMZ A;  1A0P A;  2GH1 A;  3KHH A;  4OJO A;  4KLU A;  2KSO A;  4A8E A;  1MSW D;  4DEZ A;  2HW3 A;  3LWM A;  2ZIX B;  4G9B A;  3HX0 A;  4DOC A;  2JV3 A;  3TFR A;  4F3O A;  9ICS A;  1QH9 A;  4RNO A;  4JMU A;  1DK2 A;  2DGZ A;  1NK4 A;  2W9A A;  2KSO B;  3HRD D;  3ZDD A;  4NWI A;  1X66 A;  3NTU A;  2A1J A;  3GIL A;  3PR5 B;  2OYY A;  1D9F A;  4R8U A;  1J2M A;  3K75 D;  5CWR A;  1URJ A;  3KD3 A;  2LBO A;  1HUO A;  4DQI A;  1XNS A;  5HP4 A;  4QW9 A;  4UB3 A;  3AU6 A;  1N56 A;  4P4P A;  2KFZ A;  4U7C A;  5KFY A;  4RPY A;  3KZI U;  1UHU A;  5KFE A;  2L5Y A;  4KMO B;  2H3Z A;  3V6K A;  3TKA A;  2BKE A;  3GQC A;  2WB1 C;  4Z6C A;  1UCV A;  2KE7 A;  3V7K A;  7ICE A;  2MAX A;  2NRZ A;  4ECR A;  5KFQ A;  2F44 A;  2RQ5 A;  5CR0 A;  2HHW A;  4RZR A;  2IA6 A;  3E58 A;  1DGS A;  1OW5 A;  4Y2S A;  5C5J A;  4ECZ A;  4B9S A;  3BS5 A;  3VCB A;  5DG8 A;  1ZQJ A;  2XVT A;  3KHG A;  4J9L A;  3PX4 A;  8ICV A;  4PL2 A;  2K89 A;  4QW8 A;  4KTQ A;  4DL6 A;  2P6U A;  2WF7 A;  1B43 A;  5L1I A;  3Q8L A;  4I2G A;  2KHV A;  2ZTE A;  4J9M A;  4QZD A;  3M9N B;  5AI8 A;  3R9K A;  5GTI U;  3D6J A;  5J2E A;  4NLK A;  3M8R A;  2FI1 A;  3QUC A;  3D2N A;  3QU7 A;  2WF5 A;  1ZQV A;  3ETL A;  3C1Y A;  3C29 A;  2F8K A;  2FPK A;  5J2J A;  4Q8E A;  1QQ6 A;  4YD1 A;  3MR3 A;  2FMS A;  3M1Y A;  4JV2 A;  2AU0 A;  2FE9 A;  3H0M B;  3KKA C;  4DF4 A;  3MGV A;  3UQ2 A;  4RQ3 A;  3B0X A;  5J2B A;  2W11 A;  1Q3V A;  3F2B A;  3K1R B;  3QNM A;  4Y2V A;  1DXS A;  2MUT B;  4QZA A;  4TQR A;  2JEJ A;  2RRD A;  1JIH A;  5III A;  5ALH A;  4Y2Y A;  4C0Z A;  1T3N A;  3SR6 A;  4MEY A;  4YMN A;  3SMV A;  4DLG A;  1M6Y A;  4DFJ A;  1S9F A;  4I29 A;  5ALP A;  5ALN A;  2BZF A;  1ZQZ A;  2KZ3 A;  2BCU A;  7ICK A;  2RDI A;  3BQ7 A;  1SB3 C;  1HIW A;  2JEF A;  1ZJN A;  1N5X A;  4B9N A;  1ZQR A;  1L5U A;  4DFK A;  3FYH A;  2W3S A;  3BQT A;  4OJP A;  4USA A;  3BZC A;  4YN4 A;  3PSP A;  2PMZ F;  5DKW A;  3WK5 A;  4M9N A;  3HPO A;  2JR5 A;  2VJ5 A;  5AKK A;  3UXP A;  5ALS A;  4KLE A;  3AL0 B;  3OSP A;  1NKC A;  1KKX A;  3M8S A;  1D8L A;  5J0X A;  4C80 A;  5EWF A;  3N28 A;  4TQS A;  2H3Q A;  3E0F A;  2D3D A;  3SEI A;  1Z19 A;  2AQ4 A;  1SXE A;  8ICG A;  3KKA A;  3EPG A;  3NS1 A;  3MC1 A;  1X40 A;  4IQV A;  4IRC A;  4DOA A;  1ECW A;  2MRL A;  1S97 A;  2GOL A;  2ZXI A;  4UAT A;  1X9S A;  2H3V A;  4UAU A;  1ZQM A;  4B9L A;  4I2B A;  1Q8K A;  3FM9 A;  2BCR A;  9ICX A;  4EZ9 A;  5KL1 B;  5EE1 A;  3ZDA A;  4EBC A;  2XO7 A;  3TAP A;  1S0N A;  2XY6 A;  1C7Y A;  5J29 A;  1BPE A;  4I28 A;  2K8A A;  4OJ5 A;  2LYB A;  5DLG A;  1SGG A;  1U45 A;  1SL1 A;  3WK8 A;  7ICO A;  2YML A;  1SZH A;  1ZQF A;  5KFR A;  4KX5 A;  4DSJ A; 
#chains in the Genus database with same CATH homology
 2Y0S F;  4P0Q A;  2KJ5 A;  1XO0 A;  3ICX A;  2KD1 A;  2E1E A;  2KJ9 A;  3IG8 A;  2PMZ C;  4OJP A;  2K4H A;  2KKV A;  4P0P B;  2G09 A;  2LYA A;  2KIC A;  2F8L A;  1NZB A;  2YB1 A;  3ALR A;  4U6P A;  2YX8 A;  3N7R C;  3PSP A;  3VCB A;  2PMZ F;  2E5S A;  1CRX A;  1UPH A;  2XVT A;  4NV0 A;  2HOI A;  1L6N A;  2KNJ A;  2KOB A;  4FZM A;  1Z1B A;  4PL2 A;  1YT3 A;  4BX9 C;  2JH1 A;  2HMX A;  2K89 A;  2R18 A;  3N7P D;  2A3V A;  3F2C A;  2K8B B;  2ZIV B;  2VJ5 A;  4CRX A;  2NV3 A;  2G5H B;  3AL0 B;  2ZIW A;  3M7D A;  3D2S A;  3NUQ A;  2Z7J A;  2KHV A;  4OJL A;  3IP4 B;  2DQN B;  3M6Z A;  4O3M A;  3H0R B;  2F2A B;  2CPR A;  3PSI A;  4BUG A;  3NRW A;  3T79 A;  3AQE A;  2HBK A;  2KV2 A;  5HR7 A;  3GZF A;  1TAM A;  2JHD A;  2ZIX A;  2HBJ A;  2G08 A;  2ZIV A;  4GFJ A;  3CRX A;  2RP5 A;  4FZN A;  4IC9 A;  5CRX A;  3D2N A;  4QJF B;  4ACO A;  1OUQ A;  4NLC A;  2H3Q A;  2CN1 A;  2HBM A;  3E0F A;  3F2D A;  3CP8 A;  3F5E A;  2K4I A;  1A0P A;  4QNL A;  2GH1 A;  2VJ4 A;  3SAG A;  4OJO A;  2W7P A;  3C29 A;  1Z19 A;  3CYM A;  3L3F X;  2W03 A;  4A8E A;  3LVV A;  3AQF A;  4QIW C;  2HBL A;  2JH7 A;  2VIX A;  2XI9 A;  2ZIU B;  2HOF A;  3C28 A;  4P0P A;  2ZIX B;  3RFA A;  2K4E A;  2N1R A;  1IIP A;  1ECW A;  2MRL A;  3H0M B;  5A0L A;  1F44 A;  2GOL A;  2M0N A;  3ONN A;  1ZQ1 C;  2G06 A;  2MA1 A;  4AYB C;  3SAH A;  1ED1 A;  2KEY A;  2ZG6 A;  2ZXI A;  3PSF A;  3MGV A;  5C0Y A;  3SQI A;  2H3V A;  4FE3 A;  4AYB F;  4JMU A;  4PL1 A;  2DGZ A;  1Q3V A;  4OJ6 A;  2D6F C;  2G5I B;  3F2B A;  4CGZ A;  4OO1 J;  2F77 X;  2KJ8 A;  4NWI A;  3LVW A;  3IN5 A;  3RF9 A;  3KZX A;  4QIW F;  2OYY A;  2JMG A;  2VKQ A;  1PVR A;  1GO3 F;  4BJQ A;  2XID A;  3IG5 A;  2KKP A;  2RRD A;  1HEK A;  2KVC A;  2E1F A;  4FZL A;  1MA7 A;  5KL1 B;  2XIC A;  3O0F A;  2H3I A;  4NLB A;  1URJ A;  4C0Z A;  2LBO A;  3GU3 A;  2G07 A;  2LKY A;  5KL8 B;  1XNS A;  3F5A A;  3DEE A;  2OXO A;  2RHF A;  3PZP A;  3SMV A;  4P0Q B;  3D2Q A;  2CRX A;  2H3F A;  3KFU F;  2G0A A;  2WAQ C;  2ZIW B;  3K1Z A;  3N7S C;  4U7C A;  1A6S A;  1DRG A;  2DF4 B;  2OM6 A;  3OPX A;  4ICA A;  1WUD A;  1PVP A;  2ZIU A;  1P7D A;  1T94 A;  3VC8 A;  3SAF A;  2W04 A;  2WAQ F;  2W7O A;  2K8A A;  2K8C B;  2WB1 F;  2KIW A;  2LHT A;  2KHQ A;  4KMO B;  2H3Z A;  4KX3 A;  4OJ5 A;  4CDG A;  5HR6 A;  1D8B A;  2LYB A;  2F76 X;  2ZXH A;  4WJ3 B;  2JGA A;  2WB1 C;  3F53 A;  1HIW A;  3PST A;  3LYS A;  5T14 A;  3HKZ F;  3M6K A;  2Q4T A;  2BDU A;  2HOQ A;  1SZH A;  3H0L B;  1Q3U A;  2Y0S C;  2YB4 A;  4KX5 A;  1PVQ A;  2OH2 A;  1KBU A;  3HKZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...