2LKYA

Solution structure of msmeg_1053, the second duf3349 annotated protein in the genome of mycobacterium smegmatis, seattle structural genomics center for infectious disease target mysma.17112.b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRDGEEPDGESGGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Different structures for two DUF3349 annotated proteins in the genome of Mycobacterium smegmatis suggest a structural diversity within the DUF3349 superfamily.
rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.430 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lkyA00
2LKYA 2KVCA 2M0NA
chains in the Genus database with same CATH superfamily
3PSIA 5DDYA 4YMMA 5TISU 3M9MB 4PHAA 2QB0A 3UQ2A 1LB2B 3C21A 4ICAA 4YXJA 3DEEA 4AP9A 3ZDEA 4JUZA 4NLNA 2BCQA 4O3OA 1ZD5A 1B0XA 4NWIA 2KV2A 2F8LA 2XCPA 1KN5A 3WU2U 3PW7A 3RJHA 1DRGA 2AQ0A 3RAXA 2V4RA 3PX6A 4IQVA 2HVIA 2I9GA 4KLIA 1T4GA 4F4XA 4M9LA 2CXYA 3N28A 5HNKA 4CDGA 5J0XA 2RRDA 4RQ0A 4EYIB 4FE3A 2NO5A 4RQNA 2HHXA 5A0LA 4TUQA 2Y9UA 4KLGA 2LKYA 2HBMA 2C2EA 1D8YA 1ZQBA 4DFMA 1FO4A 1QSLA 3RFAA 3DV9A 3IG8A 3NVWA 3QU5A 3BQ7A 5DB8A 5AKLA 7ICGA 5HR7A 2NRZA 7ICRA 4UAYA 4PL1A 7ICSA 3JPOA 3JPQA 4RU9A 5KFQA 2R8GA 1TAMA 5KFTA 3K75D 4G9BA 1JI7A 4IRCA 4F2SA 5KFNA 2EAOA 3M8RA 3RRHA 3AM9A 5KFEA 2JV3A 5ALMA 3ALRA 4M2YA 2XCAA 4RQ2A 4U7CA 1Q3UA 5KT7A 4I2DA 2D6FC 3HKZF 4RUCA 5F9NA 3V7JA 2YX8A 2OM6A 4UB4A 3HT3A 2F77X 4UQGA 4KMUA 3WKCA 2HI0A 1BPXA 1DGJA 2W55A 4I2AA 1NJWA 2I1QA 2JRZA 3A0HU 4RQ3A 2MAXA 3IN5A 3CP8A 5KT2A 4DQPA 5AI9A 3L4PA 5L9XA 4ED2A 4J9QA 3UMCA 9ICGA 5KL8B 3ZD8A 4IQTA 4Y2YA 4OJLA 4RQ8A 3R9KA 3SENA 1BNPA 2IOHA 4Q45A 3SAFA 3IM1A 5DG7A 3MGVA 4ECRA 1ZQFA 2JEJA 4WJ3B 2HVHA 3SR6A 9ICPA 4E0DA 2XVTA 4KLJA 5DGAA 1X6JA 2AGOA 7ICMA 1JX4A 3MABA 4YVZA 5D49A 3V6KA 4UB2A 8ICWA 5E79U 3T5JA 2V4QA 3I76A 1KFTA 3IG5A 5ALGA 3RJIA 4UAUA 2BQRA 3RH5A 5EE1A 2FE9A 5AI6A 3HRDD 1NK0A 3D2SA 3AUOA 3UMBA 4KLMA 2IOFA 1X66A 1RM6C 3I28A 2Q0ZX 4NV0A 4F91B 5AKKA 1XO0A 4ELVA 3RB0A 3OTQA 4KN7A 3QUTA 1ZQIA 3B0YA 4UATA 3SMVA 4KMOB 3N4MB 5CA7A 5B5EU 1S5LU 2E3TA 2F1IA 4ECQA 2N1RA 4Z6CA 4ECYA 8ICBA 2KP7A 3RB6A 2PKEA 2KJ5A 5KFFA 3JPSA 1PZNA 2MUTB 2ALZA 5L1MA 1ZYQA 4JK1A 4ZOHC 5TZVA 1ZQMA 4DL6A 1L8LA 4FS2A 2B0CA 4DL4A 1YZ6A 3T5KA 9ICHA 3M9OB 2K60A 3NRZA 3H0LB 3TFSA 4QIWC 1OUQA 4OD0A 9ICIA 5DB6A 2W3SA 2R8JA 1S9FA 2MUTA 4US8A 1Q46A 4RQMA 4P4MA 1SV0A 4KLDA 2KSOA 4JV1A 2HBKA 5KT3A 5J0RA 1VJ5A 2LYBA 3WKBA 2O6KA 4Y2SA 3JPPA 1MC8A 7ICLA 4QWEA 3RF9A 1UT8A 3AL0B 1K5OA 3KHHA 4EBEA 2YB4A 1ZJNA 5AKJA 4QZFA 3ZDBA 1TAQA 1U47A 3SV3A 2LBOA 5J0WA 4LZDA 2FLPA 1D9FA 5CR0A 2A3VA 4QZIA 4F8RA 3AU6A 1JUDA 1ZQAA 4NL9A 3ED5A 3WK5A 1XSNA 2I6XA 3TANA 2BDUA 3M6KA 5AKZA 1ZQ1C 3AU2A 3Q8SB 5DLGA 2ZTEA 5C5JA 3F5AA 1L3UA 5CJ7A 3C1ZA 3PR4A 1EXNA 1LKYB 1UHUA 3EUB2 1KW4A 4M9HA 2CN1A 1BPEA 3T3FA 1SZHA 2LI6A 5HMMA 2ATLA 4HAIA 3V7LA 2W9BA 1RDFA 3NS1A 2ES6A 1QLNA 3QU4A 4C8NA 2EAPA 4QZEA 1LKYA 3UM9A 1NNLA 3RR8A 3D6JA 5ALQA 2JZBB 2EZYA 2WHEA 5DLFA 5AM0A 3BQ1A 3SD7A 4C4RA 4PH5A 4DL2A 4DQSA 3KFUF 3OPXA 1WG8A 2XY6A 4TURA 5ALDA 4QZGA 2FMPA 2XC9A 3H8SA 5KFAA 1RQLA 2HHTA 2FDRA 2JZBA 2ISPA 1U49A 3H4DA 9ICVA 4RNMA 4Y2XA 3MR3A 3WKDA 2KE7A 3THVA 5IINA 4QZ8A 4NLBA 1CI4A 9ICUA 2KICA 1PVPA 1S0MA 4Q8FA 2OYYA 1COOA 3QZ8A 9ICJA 1WYGA 2XGQA 2Y0SC 5F9LA 4DSJA 1X40A 3TADA 9ICKA 9ICLA 1SKSA 1IM4A 3GV8B 2W8KA 4PL2A 2E8OA 4RQ1A 1SWWA 3H0RB 2HHWA 2F8KA 1Z19A 5T14A 1JMSA 4RQ6A 4UAWA 5D4BA 7ICQA 2LYHA 2RP5A 2NRXA 1KRPA 2YN4A 1XSPA 1ZQCA 5KTQA 2W9CB 1AROP 2DQNB 2VA2A 1RYUA 2MA1A 4O5KA 3RH6A 1UCVA 4MFCA 2KZMA 5EE0A 1RXWA 1BNOA 3GDXA 2AU0A 3N7SC 4I2FA 1OXJA 4YG2A 2KIWA 3RRGA 2PMZC 4DWIA 7ICKA 4F4YA 1N62A 3WK6A 5C0YA 1TK5A 2W7OA 4I2EA 2G08A 2HHUA 5ALRA 2G0AA 2K4IA 3SV4A 4UARA 2UVUA 3AMZA 1T94A 5DB7A 4RUAA 5AKHA 1QSYA 2KOBA 5CEHA 1L7NA 5KAIU 2ASLA 4UBCA 3PR5B 1UT5A 7ICTA 4PZOA 5J2AA 1ZQEA 3GIJA 2B21A 1PK3A 2RDIA 4RT3A 3UXPA 3BQ2A 4B9LA 1WCLA 3FC4A 4BWMA 1L5UA 3C2LA 5EWGA 1TAUA 4QZBA 1SKWA 5JU5A 4Y2QA 2WF6A 4C4SA 3PX4A 2YB1A 2AQ4A 4F4KA 3FM9A 2R8IA 4IRKA 4DF4A 4EX6A 5IIOA 1ZJMA 3Q8PB 5BOLA 3PV8A 3LDAA 3SEIA 1KTQA 4KLTA 5AK6A 3F2BA 3TADC 3V72A 3OJUA 3SQIA 1Z3EB 5G5HA 4EENA 1CRXA 3IRUA 3FYHA 3PW2A 3KHRA 7ICUA 1KDHA 5EWFA 1NK5A 2BQUA 4DSKA 3C1YA 4CCHA 2ZUCA 1JIHA 3GU3A 5GTHU 1X9XA 1SXEA 2F44A 2BCUA 2ASDA 8ICLA 3G6VA 4ZH4A 4EEKA 2BR0A 1FFVA 4CE6A 4RPXA 4F5QA 2LMRA 1AQ6A 5AICA 3RBEA 4LZGA 1B4FA 5ALIA 4C7YA 2JMGA 5ALNA 1JN3A 3BJYA 3TQ1A 2E8PA 1NZPA 4O3MA 2WB1C 1ZQQA 1S76D 4FBUA 3CRXA 3M7DA 3MGHA 3MDCA 1ZQTA 4I29A 2ZIWB 5ALHA 4Y2PA 1FFUA 8ICVA 4TUPA 5HR6A 1N5XA 3NGDA 1WWVA 1B43A 1N5WA 3GQCA 1QSSA 1X9SA 4RQ5A 2V9WA 4QZAA 2G5HB 2XGPA 2UVVA 2XIDA 5BOMA 4O3QA 2Y0SF 5EE3A 5J0SA 3JPTA 1FEZA 5K4LA 3UXOA 2KTQA 8ICAA 4DFKA 2ZIWA 4YN4A 1J97A 5J2EA 1YT3A 2P35A 4AYBC 3WK8A 2K4EA 3I1YA 1K1SA 3WK7A 5HP4A 2EAMA 2E8MA 4OCZA 5D46A 4KLQA 1DK3A 4QZHA 1L3VA 2EANA 1NOMA 3QUBA 1CUKA 2LHTA 2BKEA 2LPEA 2WFAA 4ED3A 1N48A 1HEKA 1NZBA 1QQ5A 4DO9A 4QW9A 4XUSA 1TFRA 4JMUA 2G09A 4B9TA 4PGYA 2R8HA 4O3RA 2KZZA 1NK9A 4F5PA 1ZQGA 3C23A 5KFKA 4KTQA 4J9SA 3QE9Y 4Y2UA 1BPBA 1SL1A 2JEIA 3CNHA 8ICEA 1L7OA 2PMZF 3L3FX 1UA1A 1URJA 2GLEA 9ICFA 1VDVA 1V85A 8ICZA 4IQWA 3ICXA 4ECWA 4QZCA 1S8OA 3Q8KA 5ALTA 5AKEA 4I2HA 5KG2A 1P7DA 2ZUDA 2VKQA 2FMSA 2W04A 2BPFA 2PFPA 1A0PA 5J2BA 1IXRA 1F0MA 3TKAA 1N60A 3WKEA 3A0BU 4RQ4A 4ECZA 4PHPA 3IP4B 7ICVA 5J8YA 1N56A 1XSLA 1J2NA 3T79A 1MQ2A 1MQ3A 3MFIA 1ZRMA 2QLTA 4BWJA 1ZQYA 5J2HA 2RHFA 3SAGA 2OXOA 3NRWA 5DBAA 4F71A 4JWMA 3GILA 3V6JA 3EPIA 2F3NA 2FI1A 5KFBA 4MFAA 3ZD9A 4F5NA 1QTMA 3DDHA 1L7PA 5EE9A 2ZXHA 2P6UA 4DL3A 5ALOA 4QWBA 5KFWA 2W11A 4Z6DA 1RZTA 2MSNA 1HUZA 7ICHA 3KD3A 4J9LA 3PO4A 3VC8A 5AIBA 2GOLA 2BCSA 2HHSA 8ICTA 1S10A 5AK5A 1T8EA 2C2RA 3EPGA 2R18A 1NKEA 3Q8LA 3QNMA 3U26A 4DSIA 4M9GA 2HSZA 1ZQWA 2VA3A 4B9NA 4R8UB 3RTVA 3PSPA 1ZQOA 5KT5A 2PFQA 4FZNA 5AKYA 4O3PA 3QYPA 2DL0A 1BPYA 3BQTA 4NXZA 2ZG6A 3PMLA 3EZ5A 1TK0A 4GIBA 4J9PA 3KHLA 1O03A 4R8UA 1X6IA 2EDUA 5J0TA 1S0VA 5AM5A 2DUYA 4DOAA 1JALA 4DL7A 9ICMA 2YTUA 5FP0A 5J0YA 2OHFA 1KL9A 4I2CA 4NY8A 4CRXA 4DFJA 4YD2A 4IL6U 2ESEA 3BS5B 3QX7A 3Q8RB 2RQ5A 3UPQA 4UB6U 2KK0A 1SL0A 5HHHA 4PGXA 2DGZA 4UAVA 8ICOA 1DK2A 3BS7A 4F92B 3M1YA 1Y88A 4P0PB 4IS7A 3BS5A 2I5HA 5IIIA 8ICHA 1RG6A 4C0ZA 3PMNA 8ICQA 1J2MA 3RJFA 5J8YC 3EW9A 4AYBF 5AKIA 5ALLA 4F72A 5ALZA 2HBJA 1A77A 4O9MA 3PW4A 1Z00B 4GC6A 3FAHA 3QEBZ 4US9A 4HYKA 4C8OA 4Z6FA 4QZ9A 3SAHA 2HHVA 5DBBA 3QUCA 3TAPA 3QUQA 4I28A 3C28A 4FZLA 5GTIU 4GXJA 1ZD3A 4I2BA 3PVXA 5ALXA 9ICBA 1BPDA 3KKAC 4RNNA 4QWAA 1KBUA 2NV3A 3WKAA 1Z00A 2JXJA 1Q8KA 3F5EA 8ICJA 4QNLA 4EYHB 4I2JA 2ZTCA 9ICSA 4O5EA 5L1IA 3V7KA 9ICXA 2GH1A 3HP6A 2EZZA 5AI5A 5DQIA 1XC9A 4KLHA 3OHAA 3GV5B 4YQWA 2D8CA 3ZI4A 4DEZA 2FPMA 2YMLA 4JV2A 1TE2A 5KAFU 4P2HA 2NO4A 2HMXA 1SXDA 4LJXA 4GC7A 3F53A 3O0FA 1X9MA 2PI5A 8ICYA 2K8AA 1PVQA 2H3FA 4PJ0U 4YR0A 2IA6A 2IHNA 5ALFA 4QWCA 9ICEA 4IRDA 5ALEA 2W3RA 1GO3F 1IG6A 1S77D 3TACB 3SYZA 5KFJA 5JUMA 5DBCA 4LVSA 4K4HA 3RJGA 1LV5A 2Y1JA 2IBKA 4ED7A 1ZXIA 3TARA 5KFYA 5ALWA 2A1AA 4DSFA 2BHNA 2A1JB 2IHMA 3H40A 4YXMA 3QEAZ 8ICXA 3T5LA 3IHQB 5KFUA 1BVSA 5KG4A 1FIQA 2HHQA 4J9KA 1QCKA 2KN7A 2K4PA 1SL2A 1ZQZA 5KFSA 2R8KA 4ED1A 2A1JA 2VJ4A 1KEJA 2J6UA 5IILA 2HBLA 1NKCA 2GWSA 2H3QA 2OCEA 4DQIA 2KNJA 3PSFA 3T5HA 2OWOA 2EQYA 3NVVA 4J9MA 3PW0A 4ECUA 3RB4A 2KKVA 5KG3A 1ZQKA 8ICIA 4NJ8A 5ALVA 1SKRA 5DG9A 4K4GA 3NUQA 4QW8A 4BUGA 1KQQA 2QB1A 1MA7A 2IMWP 4C7ZA 2WF9A 2ZTDA 2Y9TA 2W9CA 9ICOA 4DFPA 1U9LA 1UQVA 2ISOA 3MDAA 4EZ6A 1XO1A 3ZDDA 3ETLA 4QIWF 5HHIA 3F2DA 5J2JA 1NJXA 2CPRA 5HMLA 5G5GA 4GXKA 2Q4TA 4PZNA 4PHEA 1ZQJA 9ICNA 4GXIA 1L8OA 2E8NA 2HDOA 4C80A 1M6YA 4O0IA 2HOQA 2L5YA 4RPZA 2GO7A 2HW3A 2K89A 2ZJ5A 3LVVA 1WCNA 2KG5A 1SWVA 2KMDA 2DBYA 2NRVA 1Z1BA 1WUDA 2YMPA 2DKZA 5AK4A 2VA8A 2PFOA 4IR9A 4DLGA 2C28A 5KFCA 2YMMA 4OJPA 2FPKA 3M9NB 1ZQLA 3RR7A 2W43A 4KLFA 4F93B 8ICNA 5DQGA 3TFRA 3IDWA 4XRHA 1A6SA 2BPGA 1ED1A 2ZXIA 3BZCA 2H3IA 5DKWA 4M9NA 1ECWA 1RXVA 2XICA 2BPCA 2WF8A 1N2XA 5ALSA 1ZETA 1HUOA 1IV8A 2YMQA 4IQUA 3KZXA 1V97A 4CGZA 2W8LA 3H8MA 8ICMA 4F4ZA 5KG6A 1XNSA 4KN4A 2KHQA 4DS4A 4B9MA 5JRTA 5KT6A 1D8LA 3LYSA 3B9JA 4YMNA 7ICNA 1S0OA 1X2IA 5CP2A 8ICSA 4F3OA 4ACOA 5B66U 3MR5A 3EYZA 1C7YA 2NRWA 2EH9A 4KITB 4YR2A 3ISBA 4UW9A 4PHDA 1NK6A 1K1QA 4KLSA 1B22A 2YQEA 4XQ8A 4UB3A 2JEGA 4ED8A 1Z1VA 5EOZA 3C29A 5AKXA 2G5IB 4GFJA 1TV9A 2E1EA 3H8JA 2F2AB 2IOFK 3NVZA 4B9SA 2BCVA 4DSEA 4R64A 4RQ7A 3M6ZA 3K4GA 4EX7A 1D9DA 2ZJ8A 1A76A 1YZ7A 3HWTA 5AI8A 3QU7A 3BDPA 4FO6A 3EWAA 1SIJA 3G6YA 2FLLA 3BQ0A 4ECXA 4JB3A 1ZQSA 5EWEA 4DOBA 3SZ2A 2ZIXB 5CWRA 1O08A 1KSPA 2WF7A 3GV7B 4C8KA 2H3ZA 4J9RA 1T3QA 2JH1A 4BJQA 4P4PA 2HCFA 3RH4A 4NM2A 3QZ7A 1RPLA 5H2FU 5AM4A 2W7PA 5KFDA 4KX3A 2ZUBA 4Y2TA 2ZIXA 1ZQDA 4NLGA 4Y2RA 4C8LA 1SGGA 2ZJAA 3AQEA 3AQFA 1N61A 5J2KA 2UVWA 3LWMA 4F2RA 5J2FA 4FS1A 3WK4A 1ZRNA 1XWLA 2RLTA 7ICIA 4YMOA 2OEHA 5KFIA 3Q8QB 3MBYA 2MRLA 5KG7A 3MGIA 2XO7A 1L3SA 1NJZA 2J6TA 3NASA 4USAA 1V38A 2H5XA 4MF8A 5KFVA 5ALJA 4Q44A 4UB8U 3RBDA 1L7MA 1KKXA 2VANA 3KTQA 1T7PA 3NTUA 2HOIA 4OO1J 5DDMA 1SV4A 1ZQHA 4KLLA 1NK4A 4CF5A 4RNOA 5KG5A 1QQ7A 4R66A 3C2KA 1RYSA 4I27A 2WTFA 4K4IA 4KLOA 2P6RA 2G07A 4DQRA 1TKDA 3QXGA 4JV0A 3PSTA 3OSPA 4M9JA 3MC1A 2W9MA 4MF2A 5JTIA 2KVSA 5DQHA 4MEYA 2WF5A 2FPLA 4FFDA 4Q8EA 2KFZA 5KFRA 2KFNA 3KKAA 4C4TA 5KG1A 5ALPA 1BPZA 2K8CB 4O3SA 1ZQVA 5KFXA 2A19A 9ICRA 3ZDAA 5AI4A 2AH5A 2AGQA 4QZDA 3PNCA 4NLCA 4DF8A 3JPNA 2G06A 2ZIVB 1UPHA 5BPCA 1RQNA 5KFZA 4P0QB 4IC9A 4B6JA 4J9NA 2FLNA 4DFDA 4F4WA 4F5RA 3NVYA 4CNQA 4NLZA 3RAQA 2JEFA 3G6XA 1XS9D 4YFKA 4FBTA 4DLEA 1V9PA 3H7IA 2ZIVA 2XI9A 4J03A 4P0QA 2E1FA 2H3VA 3GFKB 3QU9A 4RPYA 2WB1F 4C8MA 3TI0A 1ZQRA 4J9OA 5L1JA 5DB9A 1ZD2P 3MR2A 1F5SA 4M04A 7ICFA 1XU4A 2QKQA 5KL1B 4EZ9A 3HPOA 2EZXA 1NJYA 4EELA 4NM1A 3N97B 3UMGA 3HILA 4UASA 3FDSA 3ISDA 4NLKA 3Q8MA 2PFNA 2KSOB 3RJJA 5AIAA 2JGAA 1CEZA 3KOOA 2KKPA 1BGXT 7ICEA 5J2IA 1U45A 4CF4A 2KVCA 1ZQNA 3E0FA 8ICUA 4P0PA 2VIXA 3PY8A 5CRXA 4UB5A 4X5VA 3K1ZA 4A8EA 3V6HA 4EBDA 4I2GA 1HIWA 4Z6EA 4B9VA 5ALYA 1T3NA 3K1RB 2NYVA 2LM1A 4BX9C 2JHDA 3KZIU 3HJEA 4U6PA 4KLEA 3OGUA 5KG0A 4ECSA 4TUSA 4KX5A 4YD1A 1U4BA 5ALKA 4Q43A 3BZKA 3OHBA 4Y2JA 1ZD4A 2KIVA 4M6WB 1SZPA 4R65A 3OSNA 1ZOLA 3H0MB 2ZIUB 9ICAA 3D2QA 2PI4A 1X9WA 1JXEA 2KHVA 2PXIA 3ETRA 4Y2VA 3LWLA 3TAQA 1WWUA 4YP3A 2AHOB 5CB1A 2W9BB 4BDPA 2MU2A 1N63A 2JH7A 5AI0A 4M6WA 3S6JA 2ZIUA 3KHGA 4UAZA 4B9UA 3ONNA 4RT2A 1KLNA 4F50A 1NI3A 1VLBA 1JROA 2BCRA 4KLUA 5DGBA 2AGPA 3SI8A 2DFLA 8ICRA 4MEXA 5KFPA 1UA0A 2W54A 2WAQC 5KFOA 2RDJA 2F76X 2DKXA 2DPIA 2OH2A 4O5CA 5KFMA 5F3XB 5KFGA 2KJ8A 2AXTU 1TVAA 5AK3A 4PPXA 3C5FA 5AM2A 5L1KA 4TQRA 4JWNA 3C5GA 2Z7JA 3C2MA 3OJSA 2P66A 3WK9A 1KFDA 2DWQA 8ICCA 1TK8A 3HX0A 5AM1A 5KNIA 3VCBA 4BXOB 3B0XA 2FJ6A 2BDPA 4ELTA 4ED6A 8ICPA 1QQ6A 2KZ3A 2W9AA 7ICJA 1Z4NA 2NRTA 2AJQA 4FZMA 3N7PD 4M0AA 3AEVA 4MHVA 4QWDA 2F1HA 1COKA 3GZFA 3LVWA 2C22A 5KFLA 1SV0C 4BXOA 2K8BB 2XY5A 4G3IA 5J0OA 1RYRA 5AHXA 2E5SA 3IV6A 5IIMA 5J2DA 3PZPA 2BQ3A 1F44A 3ORYA 2M0NA 1D8BA 3AN1A 4XA5A 3UXNA 1U48A 2DPJA 4ELUA 1PUZA 4DSLA 3E58A 3N7RC 2XY7A 4UB1A 4GLXA 2YY6A 2QARB 3H4BA 4NL9C 1ZQUA 1L6NA 4YR3A 3E2EA 9ICWA 4DL5A 2W03A 5KFHA 2C2DA 4IR1A 1MN8A 3HKZC 1L3TA 1ZQPA 3PX0A 5IIJA 3UQ0A 4DQQA 3CW2C 4DCCA 4R63A 3ISCA 1JRPA 4O3NA 1KFSA 2QARA 5J29A 3F2CA 3LK9A 2BZFA 2HOFA 4I2IA 2K4HA 2FMQA 2DF4B 3RJKA 2JR5A 2M9NA 2KEYA 5J2CA 2KJ9A 3PW5A 2VJ5A 2ODGA 5L1LA 4CF3A 4QJFB 1NKBA 1LVHA 4M47A 2J6SA 3MFHA 5J0PA 5AM3A 3L5KA 1MSWD 5AKGA 3J81j 2CRXA 5J0UA 3GIMA 2ASJA 3GIKA 4TQSA 2KD1A 4MFFA 8ICGA 1PK1B 1C20A 2F1JA 1DXSA 5DG8A 4OJOA 3KBBA 3MR6A 1JXLA 8ICFA 1NK7A 4EBCA 1H38A 1IIPA 4OJ5A 3RB3A 5CHGA 5J0QA 1HJPA 7ICOA 3QU2A 9ICTA 1PK1A 3M8SA 1NK8A 3HW8A 2UVRA 3JPRA 2D3DA 1DGSA 4PGQA 3H8WA 4BGDA 4EEYA 1OW5A 3PO5A 7ICPA 3D2NA 3GIIA 1X42A 5ALUA 9ICQA 1Q3VA 4ECVA 4P4OA 2LM4A 5KT4A 1QH9A 1S97A 4OJ6A 3RJEA 4ED0A 2LYAA 3ZDCA 4YCXA 1ZQXA 9ICCA 3CYMA 5J2GA 1PVRA 1S0NA 2BGWA 4ECTA 4UBBA 4DS5A 1Z4OA 2Y1IA 4DOCA 8ICKA 2QB0B 2B6GA 1DOQA 1SB3C 4F5OA 4RZRA 5IIKA 2WAQF
chains in the Genus database with same CATH topology
2YX8A 2RP5A 3PSIA 2OH2A 2OM6A 3F5AA 3SMVA 4KMOB 2LHTA 4OJPA 2KJ8A 2F77X 2DQNB 2JGAA 1HEKA 3F2BA 2KKPA 3F2CA 2CN1A 1NZBA 2HOFA 4O3MA 2MA1A 3SAHA 2R18A 4JMUA 1SZHA 2K4HA 2G09A 2N1RA 3SQIA 3C28A 2DF4B 4FZLA 1CRXA 4ICAA 3DEEA 1A6SA 2KEYA 1ED1A 2Z7JA 3IN5A 2KVCA 3PSPA 2ZXIA 2KJ5A 2H3IA 2KJ9A 3CP8A 1KBUA 3E0FA 1ECWA 2VJ4A 2VJ5A 2NV3A 3N7SC 2ZIXB 4FZNA 2XICA 2HBLA 2KV2A 2F8LA 4NWIA 2H3QA 4QJFB 2VIXA 4P0PA 5CRXA 2KNJA 1DRGA 2K8CB 3K1ZA 3PSFA 4A8EA 2KIWA 3GU3A 3F5EA 2PMZC 2ZG6A 3VCBA 2PMZF 3L3FX 4QNLA 1URJA 2H3ZA 5KL8B 5C0YA 4P0QB 4BJQA 2JH1A 2W7OA 1HIWA 4OJLA 2G08A 3KZXA 2CRXA 2G0AA 2K4IA 4CGZA 2W7PA 2KKVA 2GH1A 4CDGA 3ICXA 2RRDA 4BX9C 2JHDA 4FZMA 3KFUF 2KD1A 3H0LB 3OPXA 4KX3A 4QIWC 4FE3A 3SAFA 4NLCA 4U6PA 1OUQA 1T94A 2ZIXA 3N7PD 3NUQA 3MGVA 5A0LA 4BUGA 2G06A 2KOBA 1P7DA 4WJ3B 2ZIVB 1UPHA 4KX5A 2JMGA 2VKQA 4OJOA 2W04A 3GZFA 3LVWA 1XNSA 3AQEA 2KHQA 2LKYA 2WB1C 2XVTA 3AQFA 2HBMA 1A0PA 2K8BB 4IC9A 1MA7A 4CRXA 1IIPA 3CRXA 4OJ5A 2HBKA 3H0MB 2ZIUB 3RFAA 2E5SA 2HMXA 3LYSA 2LYBA 3IG8A 3IP4B 3M7DA 3D2QA 3PZPA 3RF9A 5HR7A 2KHVA 2ZIWB 2MRLA 3F53A 3O0FA 3T79A 1F44A 2K8AA 2DGZA 4NLBA 2M0NA 1PVQA 4PL1A 2H3FA 2YB4A 2ZIVA 3AL0B 5HR6A 1D8BA 4QIWF 2KICA 2XI9A 4ACOA 3IG5A 1PVPA 4P0QA 2E1FA 3F2DA 3D2NA 2H3VA 1GO3F 2JH7A 2RHFA 3SAGA 2OYYA 2CPRA 2LBOA 1Q3VA 2G5HB 1TAMA 2OXOA 2HOIA 4P0PB 4OO1J 3N7RC 2WB1F 3NRWA 2ZIUA 2XIDA 2Y0SC 2Y0SF 2A3VA 4OJ6A 4C0ZA 2Q4TA 2LYAA 3ONNA 3D2SA 3CYMA 2ZIWA 1PVRA 3ALRA 5KL1B 1YT3A 1L6NA 4AYBC 4AYBF 2HOQA 2K4EA 2YB1A 3C29A 2G5IB 4PL2A 4GFJA 4U7CA 2W03A 1Q3UA 2K89A 2E1EA 4NV0A 2ZXHA 2HBJA 3H0RB 2F2AB 3LVVA 1Z19A 5T14A 2D6FC 2BDUA 1XO0A 3HKZC 3M6KA 3HKZF 1Z1BA 2G07A 1ZQ1C 2WAQC 2WAQF 1WUDA 3M6ZA 2F76X 3PSTA 3VC8A 2GOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKY A;  2KVC A;  2M0N A; 
#chains in the Genus database with same CATH topology
 3PSI A;  5DDY A;  4YMM A;  5TIS U;  3M9M B;  4PHA A;  2QB0 A;  3UQ2 A;  1LB2 B;  3C21 A;  4ICA A;  4YXJ A;  3DEE A;  4AP9 A;  3ZDE A;  4JUZ A;  4NLN A;  2BCQ A;  4O3O A;  1ZD5 A;  1B0X A;  4NWI A;  2KV2 A;  2F8L A;  2XCP A;  1KN5 A;  3WU2 U;  3PW7 A;  3RJH A;  1DRG A;  2AQ0 A;  3RAX A;  2V4R A;  3PX6 A;  4IQV A;  2HVI A;  2I9G A;  4KLI A;  1T4G A;  4F4X A;  4M9L A;  2CXY A;  3N28 A;  5HNK A;  4CDG A;  5J0X A;  2RRD A;  4RQ0 A;  4EYI B;  4FE3 A;  2NO5 A;  4RQN A;  2HHX A;  5A0L A;  4TUQ A;  2Y9U A;  4KLG A;  2LKY A;  2HBM A;  2C2E A;  1D8Y A;  1ZQB A;  4DFM A;  1FO4 A;  1QSL A;  3RFA A;  3DV9 A;  3IG8 A;  3NVW A;  3QU5 A;  3BQ7 A;  5DB8 A;  5AKL A;  7ICG A;  5HR7 A;  2NRZ A;  7ICR A;  4UAY A;  4PL1 A;  7ICS A;  3JPO A;  3JPQ A;  4RU9 A;  5KFQ A;  2R8G A;  1TAM A;  5KFT A;  3K75 D;  4G9B A;  1JI7 A;  4IRC A;  4F2S A;  5KFN A;  2EAO A;  3M8R A;  3RRH A;  3AM9 A;  5KFE A;  2JV3 A;  5ALM A;  3ALR A;  4M2Y A;  2XCA A;  4RQ2 A;  4U7C A;  1Q3U A;  5KT7 A;  4I2D A;  2D6F C;  3HKZ F;  4RUC A;  5F9N A;  3V7J A;  2YX8 A;  2OM6 A;  4UB4 A;  3HT3 A;  2F77 X;  4UQG A;  4KMU A;  3WKC A;  2HI0 A;  1BPX A;  1DGJ A;  2W55 A;  4I2A A;  1NJW A;  2I1Q A;  2JRZ A;  3A0H U;  4RQ3 A;  2MAX A;  3IN5 A;  3CP8 A;  5KT2 A;  4DQP A;  5AI9 A;  3L4P A;  5L9X A;  4ED2 A;  4J9Q A;  3UMC A;  9ICG A;  5KL8 B;  3ZD8 A;  4IQT A;  4Y2Y A;  4OJL A;  4RQ8 A;  3R9K A;  3SEN A;  1BNP A;  2IOH A;  4Q45 A;  3SAF A;  3IM1 A;  5DG7 A;  3MGV A;  4ECR A;  1ZQF A;  2JEJ A;  4WJ3 B;  2HVH A;  3SR6 A;  9ICP A;  4E0D A;  2XVT A;  4KLJ A;  5DGA A;  1X6J A;  2AGO A;  7ICM A;  1JX4 A;  3MAB A;  4YVZ A;  5D49 A;  3V6K A;  4UB2 A;  8ICW A;  5E79 U;  3T5J A;  2V4Q A;  3I76 A;  1KFT A;  3IG5 A;  5ALG A;  3RJI A;  4UAU A;  2BQR A;  3RH5 A;  5EE1 A;  2FE9 A;  5AI6 A;  3HRD D;  1NK0 A;  3D2S A;  3AUO A;  3UMB A;  4KLM A;  2IOF A;  1X66 A;  1RM6 C;  3I28 A;  2Q0Z X;  4NV0 A;  4F91 B;  5AKK A;  1XO0 A;  4ELV A;  3RB0 A;  3OTQ A;  4KN7 A;  3QUT A;  1ZQI A;  3B0Y A;  4UAT A;  3SMV A;  4KMO B;  3N4M B;  5CA7 A;  5B5E U;  1S5L U;  2E3T A;  2F1I A;  4ECQ A;  2N1R A;  4Z6C A;  4ECY A;  8ICB A;  2KP7 A;  3RB6 A;  2PKE A;  2KJ5 A;  5KFF A;  3JPS A;  1PZN A;  2MUT B;  2ALZ A;  5L1M A;  1ZYQ A;  4JK1 A;  4ZOH C;  5TZV A;  1ZQM A;  4DL6 A;  1L8L A;  4FS2 A;  2B0C A;  4DL4 A;  1YZ6 A;  3T5K A;  9ICH A;  3M9O B;  2K60 A;  3NRZ A;  3H0L B;  3TFS A;  4QIW C;  1OUQ A;  4OD0 A;  9ICI A;  5DB6 A;  2W3S A;  2R8J A;  1S9F A;  2MUT A;  4US8 A;  1Q46 A;  4RQM A;  4P4M A;  1SV0 A;  4KLD A;  2KSO A;  4JV1 A;  2HBK A;  5KT3 A;  5J0R A;  1VJ5 A;  2LYB A;  3WKB A;  2O6K A;  4Y2S A;  3JPP A;  1MC8 A;  7ICL A;  4QWE A;  3RF9 A;  1UT8 A;  3AL0 B;  1K5O A;  3KHH A;  4EBE A;  2YB4 A;  1ZJN A;  5AKJ A;  4QZF A;  3ZDB A;  1TAQ A;  1U47 A;  3SV3 A;  2LBO A;  5J0W A;  4LZD A;  2FLP A;  1D9F A;  5CR0 A;  2A3V A;  4QZI A;  4F8R A;  3AU6 A;  1JUD A;  1ZQA A;  4NL9 A;  3ED5 A;  3WK5 A;  1XSN A;  2I6X A;  3TAN A;  2BDU A;  3M6K A;  5AKZ A;  1ZQ1 C;  3AU2 A;  3Q8S B;  5DLG A;  2ZTE A;  5C5J A;  3F5A A;  1L3U A;  5CJ7 A;  3C1Z A;  3PR4 A;  1EXN A;  1LKY B;  1UHU A;  3EUB 2;  1KW4 A;  4M9H A;  2CN1 A;  1BPE A;  3T3F A;  1SZH A;  2LI6 A;  5HMM A;  2ATL A;  4HAI A;  3V7L A;  2W9B A;  1RDF A;  3NS1 A;  2ES6 A;  1QLN A;  3QU4 A;  4C8N A;  2EAP A;  4QZE A;  1LKY A;  3UM9 A;  1NNL A;  3RR8 A;  3D6J A;  5ALQ A;  2JZB B;  2EZY A;  2WHE A;  5DLF A;  5AM0 A;  3BQ1 A;  3SD7 A;  4C4R A;  4PH5 A;  4DL2 A;  4DQS A;  3KFU F;  3OPX A;  1WG8 A;  2XY6 A;  4TUR A;  5ALD A;  4QZG A;  2FMP A;  2XC9 A;  3H8S A;  5KFA A;  1RQL A;  2HHT A;  2FDR A;  2JZB A;  2ISP A;  1U49 A;  3H4D A;  9ICV A;  4RNM A;  4Y2X A;  3MR3 A;  3WKD A;  2KE7 A;  3THV A;  5IIN A;  4QZ8 A;  4NLB A;  1CI4 A;  9ICU A;  2KIC A;  1PVP A;  1S0M A;  4Q8F A;  2OYY A;  1COO A;  3QZ8 A;  9ICJ A;  1WYG A;  2XGQ A;  2Y0S C;  5F9L A;  4DSJ A;  1X40 A;  3TAD A;  9ICK A;  9ICL A;  1SKS A;  1IM4 A;  3GV8 B;  2W8K A;  4PL2 A;  2E8O A;  4RQ1 A;  1SWW A;  3H0R B;  2HHW A;  2F8K A;  1Z19 A;  5T14 A;  1JMS A;  4RQ6 A;  4UAW A;  5D4B A;  7ICQ A;  2LYH A;  2RP5 A;  2NRX A;  1KRP A;  2YN4 A;  1XSP A;  1ZQC A;  5KTQ A;  2W9C B;  1ARO P;  2DQN B;  2VA2 A;  1RYU A;  2MA1 A;  4O5K A;  3RH6 A;  1UCV A;  4MFC A;  2KZM A;  5EE0 A;  1RXW A;  1BNO A;  3GDX A;  2AU0 A;  3N7S C;  4I2F A;  1OXJ A;  4YG2 A;  2KIW A;  3RRG A;  2PMZ C;  4DWI A;  7ICK A;  4F4Y A;  1N62 A;  3WK6 A;  5C0Y A;  1TK5 A;  2W7O A;  4I2E A;  2G08 A;  2HHU A;  5ALR A;  2G0A A;  2K4I A;  3SV4 A;  4UAR A;  2UVU A;  3AMZ A;  1T94 A;  5DB7 A;  4RUA A;  5AKH A;  1QSY A;  2KOB A;  5CEH A;  1L7N A;  5KAI U;  2ASL A;  4UBC A;  3PR5 B;  1UT5 A;  7ICT A;  4PZO A;  5J2A A;  1ZQE A;  3GIJ A;  2B21 A;  1PK3 A;  2RDI A;  4RT3 A;  3UXP A;  3BQ2 A;  4B9L A;  1WCL A;  3FC4 A;  4BWM A;  1L5U A;  3C2L A;  5EWG A;  1TAU A;  4QZB A;  1SKW A;  5JU5 A;  4Y2Q A;  2WF6 A;  4C4S A;  3PX4 A;  2YB1 A;  2AQ4 A;  4F4K A;  3FM9 A;  2R8I A;  4IRK A;  4DF4 A;  4EX6 A;  5IIO A;  1ZJM A;  3Q8P B;  5BOL A;  3PV8 A;  3LDA A;  3SEI A;  1KTQ A;  4KLT A;  5AK6 A;  3F2B A;  3TAD C;  3V72 A;  3OJU A;  3SQI A;  1Z3E B;  5G5H A;  4EEN A;  1CRX A;  3IRU A;  3FYH A;  3PW2 A;  3KHR A;  7ICU A;  1KDH A;  5EWF A;  1NK5 A;  2BQU A;  4DSK A;  3C1Y A;  4CCH A;  2ZUC A;  1JIH A;  3GU3 A;  5GTH U;  1X9X A;  1SXE A;  2F44 A;  2BCU A;  2ASD A;  8ICL A;  3G6V A;  4ZH4 A;  4EEK A;  2BR0 A;  1FFV A;  4CE6 A;  4RPX A;  4F5Q A;  2LMR A;  1AQ6 A;  5AIC A;  3RBE A;  4LZG A;  1B4F A;  5ALI A;  4C7Y A;  2JMG A;  5ALN A;  1JN3 A;  3BJY A;  3TQ1 A;  2E8P A;  1NZP A;  4O3M A;  2WB1 C;  1ZQQ A;  1S76 D;  4FBU A;  3CRX A;  3M7D A;  3MGH A;  3MDC A;  1ZQT A;  4I29 A;  2ZIW B;  5ALH A;  4Y2P A;  1FFU A;  8ICV A;  4TUP A;  5HR6 A;  1N5X A;  3NGD A;  1WWV A;  1B43 A;  1N5W A;  3GQC A;  1QSS A;  1X9S A;  4RQ5 A;  2V9W A;  4QZA A;  2G5H B;  2XGP A;  2UVV A;  2XID A;  5BOM A;  4O3Q A;  2Y0S F;  5EE3 A;  5J0S A;  3JPT A;  1FEZ A;  5K4L A;  3UXO A;  2KTQ A;  8ICA A;  4DFK A;  2ZIW A;  4YN4 A;  1J97 A;  5J2E A;  1YT3 A;  2P35 A;  4AYB C;  3WK8 A;  2K4E A;  3I1Y A;  1K1S A;  3WK7 A;  5HP4 A;  2EAM A;  2E8M A;  4OCZ A;  5D46 A;  4KLQ A;  1DK3 A;  4QZH A;  1L3V A;  2EAN A;  1NOM A;  3QUB A;  1CUK A;  2LHT A;  2BKE A;  2LPE A;  2WFA A;  4ED3 A;  1N48 A;  1HEK A;  1NZB A;  1QQ5 A;  4DO9 A;  4QW9 A;  4XUS A;  1TFR A;  4JMU A;  2G09 A;  4B9T A;  4PGY A;  2R8H A;  4O3R A;  2KZZ A;  1NK9 A;  4F5P A;  1ZQG A;  3C23 A;  5KFK A;  4KTQ A;  4J9S A;  3QE9 Y;  4Y2U A;  1BPB A;  1SL1 A;  2JEI A;  3CNH A;  8ICE A;  1L7O A;  2PMZ F;  3L3F X;  1UA1 A;  1URJ A;  2GLE A;  9ICF A;  1VDV A;  1V85 A;  8ICZ A;  4IQW A;  3ICX A;  4ECW A;  4QZC A;  1S8O A;  3Q8K A;  5ALT A;  5AKE A;  4I2H A;  5KG2 A;  1P7D A;  2ZUD A;  2VKQ A;  2FMS A;  2W04 A;  2BPF A;  2PFP A;  1A0P A;  5J2B A;  1IXR A;  1F0M A;  3TKA A;  1N60 A;  3WKE A;  3A0B U;  4RQ4 A;  4ECZ A;  4PHP A;  3IP4 B;  7ICV A;  5J8Y A;  1N56 A;  1XSL A;  1J2N A;  3T79 A;  1MQ2 A;  1MQ3 A;  3MFI A;  1ZRM A;  2QLT A;  4BWJ A;  1ZQY A;  5J2H A;  2RHF A;  3SAG A;  2OXO A;  3NRW A;  5DBA A;  4F71 A;  4JWM A;  3GIL A;  3V6J A;  3EPI A;  2F3N A;  2FI1 A;  5KFB A;  4MFA A;  3ZD9 A;  4F5N A;  1QTM A;  3DDH A;  1L7P A;  5EE9 A;  2ZXH A;  2P6U A;  4DL3 A;  5ALO A;  4QWB A;  5KFW A;  2W11 A;  4Z6D A;  1RZT A;  2MSN A;  1HUZ A;  7ICH A;  3KD3 A;  4J9L A;  3PO4 A;  3VC8 A;  5AIB A;  2GOL A;  2BCS A;  2HHS A;  8ICT A;  1S10 A;  5AK5 A;  1T8E A;  2C2R A;  3EPG A;  2R18 A;  1NKE A;  3Q8L A;  3QNM A;  3U26 A;  4DSI A;  4M9G A;  2HSZ A;  1ZQW A;  2VA3 A;  4B9N A;  4R8U B;  3RTV A;  3PSP A;  1ZQO A;  5KT5 A;  2PFQ A;  4FZN A;  5AKY A;  4O3P A;  3QYP A;  2DL0 A;  1BPY A;  3BQT A;  4NXZ A;  2ZG6 A;  3PML A;  3EZ5 A;  1TK0 A;  4GIB A;  4J9P A;  3KHL A;  1O03 A;  4R8U A;  1X6I A;  2EDU A;  5J0T A;  1S0V A;  5AM5 A;  2DUY A;  4DOA A;  1JAL A;  4DL7 A;  9ICM A;  2YTU A;  5FP0 A;  5J0Y A;  2OHF A;  1KL9 A;  4I2C A;  4NY8 A;  4CRX A;  4DFJ A;  4YD2 A;  4IL6 U;  2ESE A;  3BS5 B;  3QX7 A;  3Q8R B;  2RQ5 A;  3UPQ A;  4UB6 U;  2KK0 A;  1SL0 A;  5HHH A;  4PGX A;  2DGZ A;  4UAV A;  8ICO A;  1DK2 A;  3BS7 A;  4F92 B;  3M1Y A;  1Y88 A;  4P0P B;  4IS7 A;  3BS5 A;  2I5H A;  5III A;  8ICH A;  1RG6 A;  4C0Z A;  3PMN A;  8ICQ A;  1J2M A;  3RJF A;  5J8Y C;  3EW9 A;  4AYB F;  5AKI A;  5ALL A;  4F72 A;  5ALZ A;  2HBJ A;  1A77 A;  4O9M A;  3PW4 A;  1Z00 B;  4GC6 A;  3FAH A;  3QEB Z;  4US9 A;  4HYK A;  4C8O A;  4Z6F A;  4QZ9 A;  3SAH A;  2HHV A;  5DBB A;  3QUC A;  3TAP A;  3QUQ A;  4I28 A;  3C28 A;  4FZL A;  5GTI U;  4GXJ A;  1ZD3 A;  4I2B A;  3PVX A;  5ALX A;  9ICB A;  1BPD A;  3KKA C;  4RNN A;  4QWA A;  1KBU A;  2NV3 A;  3WKA A;  1Z00 A;  2JXJ A;  1Q8K A;  3F5E A;  8ICJ A;  4QNL A;  4EYH B;  4I2J A;  2ZTC A;  9ICS A;  4O5E A;  5L1I A;  3V7K A;  9ICX A;  2GH1 A;  3HP6 A;  2EZZ A;  5AI5 A;  5DQI A;  1XC9 A;  4KLH A;  3OHA A;  3GV5 B;  4YQW A;  2D8C A;  3ZI4 A;  4DEZ A;  2FPM A;  2YML A;  4JV2 A;  1TE2 A;  5KAF U;  4P2H A;  2NO4 A;  2HMX A;  1SXD A;  4LJX A;  4GC7 A;  3F53 A;  3O0F A;  1X9M A;  2PI5 A;  8ICY A;  2K8A A;  1PVQ A;  2H3F A;  4PJ0 U;  4YR0 A;  2IA6 A;  2IHN A;  5ALF A;  4QWC A;  9ICE A;  4IRD A;  5ALE A;  2W3R A;  1GO3 F;  1IG6 A;  1S77 D;  3TAC B;  3SYZ A;  5KFJ A;  5JUM A;  5DBC A;  4LVS A;  4K4H A;  3RJG A;  1LV5 A;  2Y1J A;  2IBK A;  4ED7 A;  1ZXI A;  3TAR A;  5KFY A;  5ALW A;  2A1A A;  4DSF A;  2BHN A;  2A1J B;  2IHM A;  3H40 A;  4YXM A;  3QEA Z;  8ICX A;  3T5L A;  3IHQ B;  5KFU A;  1BVS A;  5KG4 A;  1FIQ A;  2HHQ A;  4J9K A;  1QCK A;  2KN7 A;  2K4P A;  1SL2 A;  1ZQZ A;  5KFS A;  2R8K A;  4ED1 A;  2A1J A;  2VJ4 A;  1KEJ A;  2J6U A;  5IIL A;  2HBL A;  1NKC A;  2GWS A;  2H3Q A;  2OCE A;  4DQI A;  2KNJ A;  3PSF A;  3T5H A;  2OWO A;  2EQY A;  3NVV A;  4J9M A;  3PW0 A;  4ECU A;  3RB4 A;  2KKV A;  5KG3 A;  1ZQK A;  8ICI A;  4NJ8 A;  5ALV A;  1SKR A;  5DG9 A;  4K4G A;  3NUQ A;  4QW8 A;  4BUG A;  1KQQ A;  2QB1 A;  1MA7 A;  2IMW P;  4C7Z A;  2WF9 A;  2ZTD A;  2Y9T A;  2W9C A;  9ICO A;  4DFP A;  1U9L A;  1UQV A;  2ISO A;  3MDA A;  4EZ6 A;  1XO1 A;  3ZDD A;  3ETL A;  4QIW F;  5HHI A;  3F2D A;  5J2J A;  1NJX A;  2CPR A;  5HML A;  5G5G A;  4GXK A;  2Q4T A;  4PZN A;  4PHE A;  1ZQJ A;  9ICN A;  4GXI A;  1L8O A;  2E8N A;  2HDO A;  4C80 A;  1M6Y A;  4O0I A;  2HOQ A;  2L5Y A;  4RPZ A;  2GO7 A;  2HW3 A;  2K89 A;  2ZJ5 A;  3LVV A;  1WCN A;  2KG5 A;  1SWV A;  2KMD A;  2DBY A;  2NRV A;  1Z1B A;  1WUD A;  2YMP A;  2DKZ A;  5AK4 A;  2VA8 A;  2PFO A;  4IR9 A;  4DLG A;  2C28 A;  5KFC A;  2YMM A;  4OJP A;  2FPK A;  3M9N B;  1ZQL A;  3RR7 A;  2W43 A;  4KLF A;  4F93 B;  8ICN A;  5DQG A;  3TFR A;  3IDW A;  4XRH A;  1A6S A;  2BPG A;  1ED1 A;  2ZXI A;  3BZC A;  2H3I A;  5DKW A;  4M9N A;  1ECW A;  1RXV A;  2XIC A;  2BPC A;  2WF8 A;  1N2X A;  5ALS A;  1ZET A;  1HUO A;  1IV8 A;  2YMQ A;  4IQU A;  3KZX A;  1V97 A;  4CGZ A;  2W8L A;  3H8M A;  8ICM A;  4F4Z A;  5KG6 A;  1XNS A;  4KN4 A;  2KHQ A;  4DS4 A;  4B9M A;  5JRT A;  5KT6 A;  1D8L A;  3LYS A;  3B9J A;  4YMN A;  7ICN A;  1S0O A;  1X2I A;  5CP2 A;  8ICS A;  4F3O A;  4ACO A;  5B66 U;  3MR5 A;  3EYZ A;  1C7Y A;  2NRW A;  2EH9 A;  4KIT B;  4YR2 A;  3ISB A;  4UW9 A;  4PHD A;  1NK6 A;  1K1Q A;  4KLS A;  1B22 A;  2YQE A;  4XQ8 A;  4UB3 A;  2JEG A;  4ED8 A;  1Z1V A;  5EOZ A;  3C29 A;  5AKX A;  2G5I B;  4GFJ A;  1TV9 A;  2E1E A;  3H8J A;  2F2A B;  2IOF K;  3NVZ A;  4B9S A;  2BCV A;  4DSE A;  4R64 A;  4RQ7 A;  3M6Z A;  3K4G A;  4EX7 A;  1D9D A;  2ZJ8 A;  1A76 A;  1YZ7 A;  3HWT A;  5AI8 A;  3QU7 A;  3BDP A;  4FO6 A;  3EWA A;  1SIJ A;  3G6Y A;  2FLL A;  3BQ0 A;  4ECX A;  4JB3 A;  1ZQS A;  5EWE A;  4DOB A;  3SZ2 A;  2ZIX B;  5CWR A;  1O08 A;  1KSP A;  2WF7 A;  3GV7 B;  4C8K A;  2H3Z A;  4J9R A;  1T3Q A;  2JH1 A;  4BJQ A;  4P4P A;  2HCF A;  3RH4 A;  4NM2 A;  3QZ7 A;  1RPL A;  5H2F U;  5AM4 A;  2W7P A;  5KFD A;  4KX3 A;  2ZUB A;  4Y2T A;  2ZIX A;  1ZQD A;  4NLG A;  4Y2R A;  4C8L A;  1SGG A;  2ZJA A;  3AQE A;  3AQF A;  1N61 A;  5J2K A;  2UVW A;  3LWM A;  4F2R A;  5J2F A;  4FS1 A;  3WK4 A;  1ZRN A;  1XWL A;  2RLT A;  7ICI A;  4YMO A;  2OEH A;  5KFI A;  3Q8Q B;  3MBY A;  2MRL A;  5KG7 A;  3MGI A;  2XO7 A;  1L3S A;  1NJZ A;  2J6T A;  3NAS A;  4USA A;  1V38 A;  2H5X A;  4MF8 A;  5KFV A;  5ALJ A;  4Q44 A;  4UB8 U;  3RBD A;  1L7M A;  1KKX A;  2VAN A;  3KTQ A;  1T7P A;  3NTU A;  2HOI A;  4OO1 J;  5DDM A;  1SV4 A;  1ZQH A;  4KLL A;  1NK4 A;  4CF5 A;  4RNO A;  5KG5 A;  1QQ7 A;  4R66 A;  3C2K A;  1RYS A;  4I27 A;  2WTF A;  4K4I A;  4KLO A;  2P6R A;  2G07 A;  4DQR A;  1TKD A;  3QXG A;  4JV0 A;  3PST A;  3OSP A;  4M9J A;  3MC1 A;  2W9M A;  4MF2 A;  5JTI A;  2KVS A;  5DQH A;  4MEY A;  2WF5 A;  2FPL A;  4FFD A;  4Q8E A;  2KFZ A;  5KFR A;  2KFN A;  3KKA A;  4C4T A;  5KG1 A;  5ALP A;  1BPZ A;  2K8C B;  4O3S A;  1ZQV A;  5KFX A;  2A19 A;  9ICR A;  3ZDA A;  5AI4 A;  2AH5 A;  2AGQ A;  4QZD A;  3PNC A;  4NLC A;  4DF8 A;  3JPN A;  2G06 A;  2ZIV B;  1UPH A;  5BPC A;  1RQN A;  5KFZ A;  4P0Q B;  4IC9 A;  4B6J A;  4J9N A;  2FLN A;  4DFD A;  4F4W A;  4F5R A;  3NVY A;  4CNQ A;  4NLZ A;  3RAQ A;  2JEF A;  3G6X A;  1XS9 D;  4YFK A;  4FBT A;  4DLE A;  1V9P A;  3H7I A;  2ZIV A;  2XI9 A;  4J03 A;  4P0Q A;  2E1F A;  2H3V A;  3GFK B;  3QU9 A;  4RPY A;  2WB1 F;  4C8M A;  3TI0 A;  1ZQR A;  4J9O A;  5L1J A;  5DB9 A;  1ZD2 P;  3MR2 A;  1F5S A;  4M04 A;  7ICF A;  1XU4 A;  2QKQ A;  5KL1 B;  4EZ9 A;  3HPO A;  2EZX A;  1NJY A;  4EEL A;  4NM1 A;  3N97 B;  3UMG A;  3HIL A;  4UAS A;  3FDS A;  3ISD A;  4NLK A;  3Q8M A;  2PFN A;  2KSO B;  3RJJ A;  5AIA A;  2JGA A;  1CEZ A;  3KOO A;  2KKP A;  1BGX T;  7ICE A;  5J2I A;  1U45 A;  4CF4 A;  2KVC A;  1ZQN A;  3E0F A;  8ICU A;  4P0P A;  2VIX A;  3PY8 A;  5CRX A;  4UB5 A;  4X5V A;  3K1Z A;  4A8E A;  3V6H A;  4EBD A;  4I2G A;  1HIW A;  4Z6E A;  4B9V A;  5ALY A;  1T3N A;  3K1R B;  2NYV A;  2LM1 A;  4BX9 C;  2JHD A;  3KZI U;  3HJE A;  4U6P A;  4KLE A;  3OGU A;  5KG0 A;  4ECS A;  4TUS A;  4KX5 A;  4YD1 A;  1U4B A;  5ALK A;  4Q43 A;  3BZK A;  3OHB A;  4Y2J A;  1ZD4 A;  2KIV A;  4M6W B;  1SZP A;  4R65 A;  3OSN A;  1ZOL A;  3H0M B;  2ZIU B;  9ICA A;  3D2Q A;  2PI4 A;  1X9W A;  1JXE A;  2KHV A;  2PXI A;  3ETR A;  4Y2V A;  3LWL A;  3TAQ A;  1WWU A;  4YP3 A;  2AHO B;  5CB1 A;  2W9B B;  4BDP A;  2MU2 A;  1N63 A;  2JH7 A;  5AI0 A;  4M6W A;  3S6J A;  2ZIU A;  3KHG A;  4UAZ A;  4B9U A;  3ONN A;  4RT2 A;  1KLN A;  4F50 A;  1NI3 A;  1VLB A;  1JRO A;  2BCR A;  4KLU A;  5DGB A;  2AGP A;  3SI8 A;  2DFL A;  8ICR A;  4MEX A;  5KFP A;  1UA0 A;  2W54 A;  2WAQ C;  5KFO A;  2RDJ A;  2F76 X;  2DKX A;  2DPI A;  2OH2 A;  4O5C A;  5KFM A;  5F3X B;  5KFG A;  2KJ8 A;  2AXT U;  1TVA A;  5AK3 A;  4PPX A;  3C5F A;  5AM2 A;  5L1K A;  4TQR A;  4JWN A;  3C5G A;  2Z7J A;  3C2M A;  3OJS A;  2P66 A;  3WK9 A;  1KFD A;  2DWQ A;  8ICC A;  1TK8 A;  3HX0 A;  5AM1 A;  5KNI A;  3VCB A;  4BXO B;  3B0X A;  2FJ6 A;  2BDP A;  4ELT A;  4ED6 A;  8ICP A;  1QQ6 A;  2KZ3 A;  2W9A A;  7ICJ A;  1Z4N A;  2NRT A;  2AJQ A;  4FZM A;  3N7P D;  4M0A A;  3AEV A;  4MHV A;  4QWD A;  2F1H A;  1COK A;  3GZF A;  3LVW A;  2C22 A;  5KFL A;  1SV0 C;  4BXO A;  2K8B B;  2XY5 A;  4G3I A;  5J0O A;  1RYR A;  5AHX A;  2E5S A;  3IV6 A;  5IIM A;  5J2D A;  3PZP A;  2BQ3 A;  1F44 A;  3ORY A;  2M0N A;  1D8B A;  3AN1 A;  4XA5 A;  3UXN A;  1U48 A;  2DPJ A;  4ELU A;  1PUZ A;  4DSL A;  3E58 A;  3N7R C;  2XY7 A;  4UB1 A;  4GLX A;  2YY6 A;  2QAR B;  3H4B A;  4NL9 C;  1ZQU A;  1L6N A;  4YR3 A;  3E2E A;  9ICW A;  4DL5 A;  2W03 A;  5KFH A;  2C2D A;  4IR1 A;  1MN8 A;  3HKZ C;  1L3T A;  1ZQP A;  3PX0 A;  5IIJ A;  3UQ0 A;  4DQQ A;  3CW2 C;  4DCC A;  4R63 A;  3ISC A;  1JRP A;  4O3N A;  1KFS A;  2QAR A;  5J29 A;  3F2C A;  3LK9 A;  2BZF A;  2HOF A;  4I2I A;  2K4H A;  2FMQ A;  2DF4 B;  3RJK A;  2JR5 A;  2M9N A;  2KEY A;  5J2C A;  2KJ9 A;  3PW5 A;  2VJ5 A;  2ODG A;  5L1L A;  4CF3 A;  4QJF B;  1NKB A;  1LVH A;  4M47 A;  2J6S A;  3MFH A;  5J0P A;  5AM3 A;  3L5K A;  1MSW D;  5AKG A;  3J81 j;  2CRX A;  5J0U A;  3GIM A;  2ASJ A;  3GIK A;  4TQS A;  2KD1 A;  4MFF A;  8ICG A;  1PK1 B;  1C20 A;  2F1J A;  1DXS A;  5DG8 A;  4OJO A;  3KBB A;  3MR6 A;  1JXL A;  8ICF A;  1NK7 A;  4EBC A;  1H38 A;  1IIP A;  4OJ5 A;  3RB3 A;  5CHG A;  5J0Q A;  1HJP A;  7ICO A;  3QU2 A;  9ICT A;  1PK1 A;  3M8S A;  1NK8 A;  3HW8 A;  2UVR A;  3JPR A;  2D3D A;  1DGS A;  4PGQ A;  3H8W A;  4BGD A;  4EEY A;  1OW5 A;  3PO5 A;  7ICP A;  3D2N A;  3GII A;  1X42 A;  5ALU A;  9ICQ A;  1Q3V A;  4ECV A;  4P4O A;  2LM4 A;  5KT4 A;  1QH9 A;  1S97 A;  4OJ6 A;  3RJE A;  4ED0 A;  2LYA A;  3ZDC A;  4YCX A;  1ZQX A;  9ICC A;  3CYM A;  5J2G A;  1PVR A;  1S0N A;  2BGW A;  4ECT A;  4UBB A;  4DS5 A;  1Z4O A;  2Y1I A;  4DOC A;  8ICK A;  2QB0 B;  2B6G A;  1DOQ A;  1SB3 C;  4F5O A;  4RZR A;  5IIK A;  2WAQ F; 
#chains in the Genus database with same CATH homology
 2YX8 A;  2RP5 A;  3PSI A;  2OH2 A;  2OM6 A;  3F5A A;  3SMV A;  4KMO B;  2LHT A;  4OJP A;  2KJ8 A;  2F77 X;  2DQN B;  2JGA A;  1HEK A;  3F2B A;  2KKP A;  3F2C A;  2CN1 A;  1NZB A;  2HOF A;  4O3M A;  2MA1 A;  3SAH A;  2R18 A;  4JMU A;  1SZH A;  2K4H A;  2G09 A;  2N1R A;  3SQI A;  3C28 A;  2DF4 B;  4FZL A;  1CRX A;  4ICA A;  3DEE A;  1A6S A;  2KEY A;  1ED1 A;  2Z7J A;  3IN5 A;  2KVC A;  3PSP A;  2ZXI A;  2KJ5 A;  2H3I A;  2KJ9 A;  3CP8 A;  1KBU A;  3E0F A;  1ECW A;  2VJ4 A;  2VJ5 A;  2NV3 A;  3N7S C;  2ZIX B;  4FZN A;  2XIC A;  2HBL A;  2KV2 A;  2F8L A;  4NWI A;  2H3Q A;  4QJF B;  2VIX A;  4P0P A;  5CRX A;  2KNJ A;  1DRG A;  2K8C B;  3K1Z A;  3PSF A;  4A8E A;  2KIW A;  3GU3 A;  3F5E A;  2PMZ C;  2ZG6 A;  3VCB A;  2PMZ F;  3L3F X;  4QNL A;  1URJ A;  2H3Z A;  5KL8 B;  5C0Y A;  4P0Q B;  4BJQ A;  2JH1 A;  2W7O A;  1HIW A;  4OJL A;  2G08 A;  3KZX A;  2CRX A;  2G0A A;  2K4I A;  4CGZ A;  2W7P A;  2KKV A;  2GH1 A;  4CDG A;  3ICX A;  2RRD A;  4BX9 C;  2JHD A;  4FZM A;  3KFU F;  2KD1 A;  3H0L B;  3OPX A;  4KX3 A;  4QIW C;  4FE3 A;  3SAF A;  4NLC A;  4U6P A;  1OUQ A;  1T94 A;  2ZIX A;  3N7P D;  3NUQ A;  3MGV A;  5A0L A;  4BUG A;  2G06 A;  2KOB A;  1P7D A;  4WJ3 B;  2ZIV B;  1UPH A;  4KX5 A;  2JMG A;  2VKQ A;  4OJO A;  2W04 A;  3GZF A;  3LVW A;  1XNS A;  3AQE A;  2KHQ A;  2LKY A;  2WB1 C;  2XVT A;  3AQF A;  2HBM A;  1A0P A;  2K8B B;  4IC9 A;  1MA7 A;  4CRX A;  1IIP A;  3CRX A;  4OJ5 A;  2HBK A;  3H0M B;  2ZIU B;  3RFA A;  2E5S A;  2HMX A;  3LYS A;  2LYB A;  3IG8 A;  3IP4 B;  3M7D A;  3D2Q A;  3PZP A;  3RF9 A;  5HR7 A;  2KHV A;  2ZIW B;  2MRL A;  3F53 A;  3O0F A;  3T79 A;  1F44 A;  2K8A A;  2DGZ A;  4NLB A;  2M0N A;  1PVQ A;  4PL1 A;  2H3F A;  2YB4 A;  2ZIV A;  3AL0 B;  5HR6 A;  1D8B A;  4QIW F;  2KIC A;  2XI9 A;  4ACO A;  3IG5 A;  1PVP A;  4P0Q A;  2E1F A;  3F2D A;  3D2N A;  2H3V A;  1GO3 F;  2JH7 A;  2RHF A;  3SAG A;  2OYY A;  2CPR A;  2LBO A;  1Q3V A;  2G5H B;  1TAM A;  2OXO A;  2HOI A;  4P0P B;  4OO1 J;  3N7R C;  2WB1 F;  3NRW A;  2ZIU A;  2XID A;  2Y0S C;  2Y0S F;  2A3V A;  4OJ6 A;  4C0Z A;  2Q4T A;  2LYA A;  3ONN A;  3D2S A;  3CYM A;  2ZIW A;  1PVR A;  3ALR A;  5KL1 B;  1YT3 A;  1L6N A;  4AYB C;  4AYB F;  2HOQ A;  2K4E A;  2YB1 A;  3C29 A;  2G5I B;  4PL2 A;  4GFJ A;  4U7C A;  2W03 A;  1Q3U A;  2K89 A;  2E1E A;  4NV0 A;  2ZXH A;  2HBJ A;  3H0R B;  2F2A B;  3LVV A;  1Z19 A;  5T14 A;  2D6F C;  2BDU A;  1XO0 A;  3HKZ C;  3M6K A;  3HKZ F;  1Z1B A;  2G07 A;  1ZQ1 C;  2WAQ C;  2WAQ F;  1WUD A;  3M6Z A;  2F76 X;  3PST A;  3VC8 A;  2GOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...