2LKYA

Solution structure of msmeg_1053, the second duf3349 annotated protein in the genome of mycobacterium smegmatis, seattle structural genomics center for infectious disease target mysma.17112.b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRDGEEPDGESGGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Different structures for two DUF3349 annotated proteins in the genome of Mycobacterium smegmatis suggest a structural diversity within the DUF3349 superfamily.
rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Structural genomics, unknown function
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.430 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lkyA00
2LKYA 2M0NA 2KVCA
chains in the Genus database with same CATH superfamily
1ZQZA 4O3NA 3PSIA 3GIMA 3D2SA 3V7KA 3RJIA 2FLPA 3WK7A 2RLTA 5AM2A 1ZJNA 7ICKA 4UBBA 2FI1A 9ICTA 2R8GA 5GTIU 3BS5A 4R63A 2C22A 3RBDA 1BNPA 3LWMA 4Q8EA 3F2DA 2H3QA 2BPFA 4UB5A 4EX6A 4I2JA 4C7ZA 2HHUA 4PPXA 7ICNA 1CI4A 2PFPA 2DQNB 5E79U 3G6YA 2N1RA 2MRLA 4WJ3B 3AQEA 4I2IA 2DWQA 1NOMA 1HIWA 4PL1A 2H3ZA 4GXKA 5AKXA 4R65A 1NZBA 2ZXIA 1WCNA 4NM1A 3H4DA 2W7PA 4FZMA 5F9NA 1KBUA 2CXYA 1ZQUA 2LKYA 5KFDA 3MDAA 1NK6A 3N97B 4IS7A 3SR6A 2I1QA 3KHRA 2G5HB 4NL9A 2W11A 4YMMA 4OD0A 1AROP 3DV9A 2EANA 9ICSA 4RPXA 1NJYA 5H2FU 1SGGA 5J2HA 3PVXA 5KFEA 3QNMA 2IMWP 3ETRA 3HP6A 1NK4A 2GO7A 5AKIA 5KFIA 2F1JA 2JZBA 5KFLA 2KHVA 4OCZA 4F4WA 4USAA 2M9NA 3UMBA 3WKEA 2W9AA 5DLGA 4CF5A 4KLHA 2KSOA 3ZI4A 4YR0A 3HT3A 2K4PA 5ALVA 1QSYA 3ORYA 3C1ZA 3QUQA 2Z7JA 5J2BA 4DOAA 5HP4A 5IIMA 2EAOA 1MQ2A 4MFCA 4QW9A 1ZYQA 1ZOLA 3HW8A 5DB8A 4B9VA 5AI6A 7ICLA 3M6ZA 2HBJA 4QW8A 2A1JA 4Z6CA 5CJ7A 4DF4A 5J0TA 4YN4A 2EH9A 1ZQLA 3VCBA 2YX8A 2WF7A 5KFXA 1A77A 4F2SA 5KG3A 5CHGA 8ICTA 4BUGA 1RQNA 2ES6A 3JPOA 2XY5A 3EWAA 4KLUA 2WB1F 3ZDEA 4C4SA 7ICJA 3TAQA 2WHEA 8ICNA 2BHNA 2JR5A 4RQ6A 2MUTB 4DQQA 1HEKA 5EE9A 5ALTA 1RZTA 2HBLA 3H8WA 1ZQSA 3SMVA 1ED1A 1U45A 5IIOA 2ISOA 4IRCA 2EZXA 4I28A 1ZQWA 2KOBA 1Q3UA 2R18A 4DFKA 2J6SA 1JUDA 2XI9A 3EW9A 3SQIA 3TARA 2Y0SC 4B9TA 4GC7A 2RQ5A 1ZRMA 2AQ4A 4QWDA 4RQ1A 5CP2A 4GC6A 2AGOA 5J0YA 4NLCA 1ZQIA 8ICPA 4RQ8A 4DL5A 3CNHA 2XO7A 1KTQA 3SI8A 3NASA 4OJ5A 3F2BA 3GIIA 3RRGA 2FLLA 4F93B 3V7LA 4F4YA 3AM9A 5AKZA 4DL2A 1WWVA 4DWIA 4K4IA 1ZQCA 4EZ6A 1MA7A 1X9WA 3JPPA 5JTIA 4KLOA 4EENA 4ED1A 1X9MA 2VANA 4QNLA 5AKGA 2WF6A 2E1EA 3H8JA 4FBUA 2W9BA 1T94A 4DFDA 3N7SC 3OGUA 2W9CA 4J9PA 4P0PB 4Q44A 3N28A 5DKWA 3HKZF 3MFIA 3UMGA 1ZRNA 4QZAA 2AJQA 5DB9A 2NV3A 2I9GA 2ZIVB 5AI8A 3RH4A 2CPRA 2ZJ8A 3QU9A 4KN4A 3SEIA 3AU2A 4ELUA 2KZMA 9ICUA 5DBCA 2HDOA 1NKBA 5J0XA 4KLQA 2E8PA 2LPEA 4KMUA 1NI3A 1PZNA 3T5LA 2LMRA 3JPNA 4C8NA 9ICMA 3BQ1A 3CP8A 2YMLA 4DQRA 2WTFA 3Q8KA 3NS1A 7ICHA 2W3SA 4F50A 2A3VA 1V85A 4M0AA 4JV0A 4RUCA 4YMOA 2KIVA 4F5OA 1X9SA 8ICMA 4UB4A 2AU0A 5AKEA 4KX5A 2F8KA 2KP7A 1WYGA 5KFGA 4RQMA 2UVVA 1L6NA 4FZLA 1QSLA 2LYBA 5IIKA 5KAFU 1SKWA 2R8KA 2WF8A 4DSEA 5KL8B 2YN4A 4ECXA 1X66A 4K4HA 2LYAA 1ZQNA 3NVZA 3PW0A 3BZCA 3RJFA 5F9LA 3RR8A 1ZQQA 1CEZA 2Q0ZX 9ICRA 4NWIA 5KAIU 2PFQA 3WKDA 4RNOA 3U26A 5KFYA 1KKXA 3FDSA 1NJWA 2FMQA 4DSIA 3SZ2A 3OTQA 1LKYA 2YMPA 2GH1A 4ED6A 2EDUA 1DK2A 1BPXA 4DSLA 4YR2A 3C2MA 3WU2U 2KJ5A 4YG2A 4QZ9A 3M9NB 2G08A 4RQ5A 2KVSA 5ALLA 4KLFA 5KNIA 2PXIA 3BZKA 4EELA 4PH5A 3UQ2A 3OPXA 5KFWA 4IQWA 9ICVA 3C21A 1F44A 3SAFA 4DS4A 4UB8U 7ICTA 1TK8A 5K4LA 2C28A 2YMQA 3RH5A 5AI0A 2G07A 3DDHA 2QLTA 2PKEA 2F8LA 4J9RA 5J0PA 2G06A 4J9QA 3WK9A 1Q46A 3PO4A 2KIWA 2ZIWA 4O3SA 4ACOA 2VJ5A 1P7DA 4M6WB 3A0HU 5EWEA 3AQFA 5KT6A 3NVWA 3MDCA 1S0NA 1ZQTA 1UQVA 4B9NA 5G5GA 3RFAA 2HHQA 5J2AA 1Z4NA 4ZOHC 2FPMA 1DRGA 2FPKA 4P0QA 5KTQA 2EZYA 5KFKA 5J2DA 5EE0A 1ZQYA 1ZD2P 5ALDA 1WCLA 2JH7A 3CW2C 5J0UA 4LZGA 4KLEA 2UVUA 3KHHA 2WAQF 5HR7A 2WF9A 3A0BU 5KFJA 4Z6EA 8ICGA 5AKYA 2Y1JA 1PVPA 2Y9UA 9ICKA 4JK1A 1S76D 3ALRA 3PX4A 1U47A 1PK1B 4F4ZA 5JRTA 4M9NA 4IRKA 2F76X 4YXJA 7ICMA 4QJFB 3D2QA 2ZIXB 9ICOA 4LVSA 2W8KA 2PFNA 4JMUA 2YTUA 5ALNA 3PNCA 5DGAA 1V9PA 2HMXA 3V6HA 2KMDA 4DLGA 5IINA 4R8UA 4O3MA 1T7PA 5TZVA 3OHBA 2O6KA 2PMZC 1KEJA 4YXMA 3M6KA 1KDHA 4OJOA 4BXOB 1T8EA 2XVTA 1RYUA 2AHOB 3JPRA 1Z1VA 1ZQVA 3NVYA 4DQIA 3ONNA 2MAXA 1ZQAA 1O08A 5CB1A 4ELVA 5DG9A 3H8MA 7ICGA 1IV8A 4UAWA 1QQ7A 3PW2A 2DF4B 1XSPA 5JUMA 1QQ6A 4KLDA 3C1YA 5KFQA 1TVAA 3RJKA 3KKAC 4QWCA 1L3SA 5L1MA 3G6XA 4O3PA 2FMPA 3QUCA 1N61A 5G5HA 1KQQA 1BPYA 4UAYA 4J9NA 4Y2VA 4PHAA 2XGQA 1V38A 4RQNA 2Y1IA 5DG8A 4EX7A 1K1SA 4A8EA 2BQ3A 2B0CA 3QUTA 4QZ8A 3BDPA 1NK0A 3F5AA 3MR3A 2ATLA 3RR7A 2XIDA 4DQSA 4JWMA 3M1YA 1Z00B 3IG5A 2W43A 2BCRA 2ZIUA 2P6UA 1Z3EB 1IG6A 4MF2A 2Y9TA 1S97A 1JI7A 5AM0A 5DDMA 4I2BA 4Y2SA 3UXPA 4PGXA 4F71A 3MGHA 4QZHA 3PX0A 1B22A 5KFTA 4DFJA 3IDWA 3PR4A 3KFUF 3HWTA 9ICEA 3VC8A 2EAPA 3HX0A 2AGQA 3WK8A 4KLSA 8ICXA 4O9MA 3GQCA 4RPYA 3OSPA 4QZIA 1B4FA 4JB3A 4DSFA 2BQUA 1F0MA 4QWBA 5KT2A 3RJEA 4MHVA 3BS5B 4ED3A 3RJJA 1BPDA 4EBEA 4ELTA 2LM1A 2ODGA 2FJ6A 3GIJA 2JMGA 4YD1A 1MSWD 2KHQA 4KTQA 2QARA 3C5FA 1N48A 5DBAA 1UT5A 3PR5B 2NRXA 4KLGA 3E0FA 4BDPA 1RQLA 2YY6A 1ZQJA 3K4GA 5ALOA 4TURA 2I6XA 1NK7A 1N60A 5KT7A 2I5HA 4F3OA 4J9OA 1ZQPA 3MR2A 3HRDD 5HR6A 5EOZA 3PW7A 8ICOA 2VKQA 5KG0A 2BCVA 1KW4A 3NGDA 3PW5A 4OJPA 2F77X 2KJ8A 3TAPA 4PZOA 3PV8A 3TKAA 3UM9A 1F5SA 4IQUA 4Y2UA 3MBYA 5ALUA 1TAMA 3RTVA 2H3VA 5KG7A 3Q8MA 2JEJA 4NLBA 4B9SA 4Z6FA 3B0XA 5KT4A 4IQVA 4RQ2A 3C29A 2K8BB 2W55A 5J2EA 4PJ0U 4KLLA 8ICHA 2KFZA 1U48A 2J6UA 3T5KA 2HHXA 4NV0A 1RXWA 5AM1A 3ICXA 3GV7B 4EEKA 8ICCA 2JZBB 2WFAA 4C4RA 5ALRA 2MSNA 3MR6A 4O5KA 1FFVA 4I2GA 2KSOB 2ZG6A 3H40A 2H3IA 1NZPA 5KFSA 1RPLA 3FC4A 3RB6A 2VA3A 2G09A 3SV4A 1SIJA 2V4RA 1Q3VA 4PHDA 4O0IA 3N7PD 5J2GA 1PK3A 4DFMA 2G5IB 3GILA 3RF9A 3AL0B 2OM6A 1K5OA 3JPTA 4DOCA 4PGYA 5D46A 5L1LA 2A1JB 4I2DA 4UBCA 2ASLA 3TADA 1X6JA 1KRPA 9ICHA 3M8RA 2DGZA 1M6YA 2ZJ5A 1TAQA 3PW4A 1JXEA 3I28A 2PMZF 1D8BA 4BX9C 4O5CA 3PMLA 4M9HA 1YZ7A 2HBKA 3ZDDA 3SAGA 5KFHA 3ED5A 4RU9A 4HYKA 4FFDA 2F2AB 4KMOB 4EBCA 2DKZA 5CWRA 2KFNA 9ICXA 1S8OA 3IM1A 3NTUA 1PVQA 5EE3A 3GV5B 3RRHA 3L5KA 9ICFA 4XUSA 4KLTA 3CRXA 2AGPA 4F72A 4I29A 5HHIA 2K60A 4OJ6A 3I76A 1T3QA 4ED2A 1X40A 3RBEA 3QZ7A 1ZQGA 5AKLA 2HI0A 5KFZA 2HOIA 4UASA 1ZD5A 4QIWF 5KG4A 5J0RA 1RYRA 1L8OA 2ASJA 4ECRA 2ZXHA 4FZNA 3QUBA 5EWFA 8ICWA 1UA1A 3QXGA 4F91B 1KLNA 4NLZA 4CF3A 2HHSA 4DL4A 1LVHA 5ALFA 3AN1A 2RDJA 3Q8SB 4Q43A 2HBMA 1HJPA 4YMNA 1J97A 1FIQA 1S10A 5J8YC 2JHDA 5IILA 4M9JA 1KL9A 3EUB2 4ECTA 2W3RA 5KL1B 5DQIA 2ZTEA 5KG2A 3MR5A 2OCEA 5ALMA 5AKKA 3EPGA 1EXNA 1ZQDA 5ALXA 3IP4B 2EZZA 2W9BB 3JPSA 1RM6C 2AQ0A 2W9CB 1XO1A 2E3TA 4C7YA 2ALZA 3WK5A 4TUPA 3RJGA 1GO3F 2FDRA 3HJEA 7ICRA 2E1FA 4Y2PA 3IG8A 1V97A 2AH5A 1FFUA 5EE1A 2KG5A 3EPIA 5ALKA 2D8CA 2F1HA 1DK3A 3B9JA 1QTMA 2IBKA 5DB6A 1L3TA 4F8RA 1TK5A 3PSFA 5BOMA 4GXIA 4MEXA 4I2EA 2OWOA 4IRDA 1SXEA 2PI4A 3M9MB 4DL6A 4O3QA 1C20A 5KG1A 4Q45A 3C23A 1Y88A 2ASDA 3WK4A 3KD3A 1XNSA 3SYZA 4UAVA 1DXSA 5ALQA 3CYMA 1H38A 2QB1A 4XA5A 2KEYA 1XWLA 4NXZA 3K1RB 4G3IA 1DGJA 4EYIB 2XY7A 5KFFA 4ECSA 2RHFA 4NJ8A 3S6JA 4JV1A 4M47A 9ICNA 3IRUA 1MQ3A 5AICA 5CA7A 4M2YA 2QKQA 3NVVA 4KLMA 2QB0A 5EWGA 1JMSA 5J0OA 1NK8A 5KFUA 4ED7A 2GOLA 1NJXA 1S0OA 1QLNA 2VIXA 1JALA 1N2XA 4UB1A 3PZPA 1LKYB 2D6FC 4P4OA 1N56A 4BGDA 1N63A 2DPIA 4EYHB 2HW3A 3LVVA 3OHAA 3DEEA 4FE3A 3ISBA 2BR0A 4RNNA 3L4PA 1L3VA 4F4XA 8ICRA 2V9WA 1NKEA 1UCVA 4EZ9A 3D2NA 1S77D 4RZRA 1RDFA 4NLNA 1TFRA 5J29A 3AEVA 4F5RA 1QH9A 2W04A 2JEFA 2K4EA 3UQ0A 1MN8A 2KICA 8ICVA 2DFLA 2JEIA 9ICGA 2HHWA 2JRZA 3H0LB 2BCSA 1HUOA 5KT5A 1N62A 3RAXA 5AKHA 4ZH4A 2ZIWB 2Y0SF 3QYPA 2Q4TA 4C4TA 1ZQMA 1YT3A 4F5NA 7ICFA 3KKAA 1B43A 3QX7A 2B21A 3LDAA 2KKPA 4GIBA 4YFKA 1COKA 3QU5A 4UB2A 3QU7A 1A6SA 1RXVA 4YP3A 2BGWA 1SXDA 4P0QB 1LB2B 5C0YA 1SV0A 2IOFK 1L8LA 2C2RA 5KFNA 1ZD4A 2VA2A 2XICA 4UAUA 4UB3A 4ED0A 8ICEA 3C5GA 3ISDA 3BS7A 5BPCA 2LHTA 4KITB 2LI6A 3BQ2A 3WKAA 2WB1C 4DL7A 4BJQA 3ZD9A 4RT3A 4RT2A 5FP0A 4O5EA 2H3FA 2NRWA 1U4BA 4NY8A 4B6JA 7ICUA 3AUOA 2YB4A 1UT8A 3MABA 4ECVA 4QWAA 2GWSA 4X5VA 1UPHA 1C7YA 4I2CA 5KFCA 7ICSA 4RQ4A 3KHGA 4DS5A 4FS1A 1BPBA 2K89A 3MGIA 2KK0A 9ICQA 2JXJA 4DEZA 4ECZA 2BCQA 3NRWA 3BJYA 5ALJA 4C0ZA 2J6TA 1J2NA 4RNMA 4I27A 3M8SA 2KN7A 1SL0A 1TKDA 7ICIA 3RJHA 4Y2TA 4CCHA 2WF5A 4TUQA 4UQGA 4TQSA 2JEGA 8ICKA 2ZUDA 3LWLA 2EQYA 2BKEA 2K8CB 1BVSA 4QWEA 2VJ4A 3QZ8A 3Q8PB 3MGVA 4CRXA 2RP5A 4J9KA 1UHUA 1DGSA 1T3NA 3QEAZ 3RB4A 4FBTA 5L9XA 4RQ7A 3OSNA 1SWVA 3ZD8A 5KFOA 1CRXA 4J9LA 2A1AA 5KFBA 1Z1BA 2F3NA 4J9MA 3OJSA 4U6PA 3AMZA 1SWWA 2W9MA 8ICIA 1MC8A 1UA0A 2KJ9A 3Q8LA 1KFDA 3O0FA 9ICCA 4FS2A 3HKZC 1N5XA 2XCPA 4E0DA 4GXJA 1FO4A 1X2IA 4US9A 2F44A 4C8OA 1D9FA 3BQTA 4XQ8A 4CE6A 1IXRA 3BQ7A 3TANA 5BOLA 4B9UA 1Z19A 2E8MA 2ZTDA 2R8JA 2BCUA 1FEZA 3H0MB 4IL6U 4PHEA 4P4PA 2ZIUB 3NUQA 1SB3C 2HCFA 1HUZA 5AI9A 3H7IA 4ECYA 1Q8KA 4MFAA 1D8LA 4AP9A 4ED8A 8ICZA 1N5WA 5J0QA 2KD1A 5AIBA 5KFMA 4OJLA 5AI5A 3ZDAA 9ICWA 4BWJA 3WKBA 5D4BA 4QZGA 3FM9A 3IV6A 5CR0A 1BPEA 3HILA 5F3XB 4EBDA 4Q8FA 1WWUA 4RPZA 7ICEA 3OJUA 1WUDA 5J2JA 2XCAA 2LBOA 4NLKA 5HNKA 2FMSA 3T5HA 1OUQA 1VDVA 4EEYA 4KN7A 5IIIA 3RB0A 4FO6A 2L5YA 3PSTA 4YR3A 5B5EU 2P66A 4TUSA 1NK5A 4O3OA 3WKCA 3ZDCA 5A0LA 5DG7A 3K75D 2QARB 3JPQA 1XU4A 4YQWA 2NRVA 4CDGA 4M9GA 4LJXA 5HMLA 3T5JA 4DO9A 3H0RB 5CRXA 3R9KA 4AYBC 4C8KA 1JRPA 3GV8B 2DBYA 4IC9A 1S0VA 2HOFA 3BQ0A 4GLXA 5DB7A 3GU3A 2BPGA 7ICPA 2CN1A 3E2EA 5L1IA 2MUTA 4KX3A 2G0AA 3EYZA 2OH2A 2C2DA 3MFHA 1X6IA 3H4BA 5KFPA 8ICAA 4G9BA 1D9DA 5ALGA 5J2IA 4UB6U 1S9FA 5J8YA 1L7PA 4C8MA 2YMMA 1Z4OA 4PGQA 3RB3A 1L3UA 8ICLA 3KHLA 2FE9A 1WG8A 4CNQA 3Q8QB 3E58A 3J81j 8ICYA 3PY8A 3TFSA 2OHFA 5C5JA 1SKSA 4UATA 4XRHA 5D49A 1ZQHA 2IHMA 5ALSA 2HHTA 2P6RA 2PFOA 4NM2A 4NL9C 1AQ6A 2HSZA 1BPZA 9ICJA 2AXTU 4CF4A 1KN5A 3EZ5A 4YD2A 5ALHA 2KKVA 4CGZA 2CRXA 1IM4A 3TQ1A 4O3RA 4R66A 7ICOA 1NNLA 3PX6A 7ICVA 2WAQC 5DQHA 4IR9A 2KV2A 3KTQA 3RH6A 3FAHA 4JWNA 2NRZA 1PUZA 1T4GA 2R8HA 5AM4A 5KFVA 3LK9A 1JX4A 1S0MA 1X9XA 4P0PA 5DQGA 3T3FA 4B9LA 4MEYA 4QZEA 1ZETA 1ZQ1C 5ALPA 1LV5A 4PZNA 4UARA 3QE9Y 3RAQA 2IHNA 3UXNA 2ZIVA 1ZQBA 2JGAA 5KG6A 2UVWA 2W03A 3KZXA 3L3FX 4C8LA 5CEHA 2IOHA 2JH1A 2RRDA 2HVIA 5KFRA 4NLGA 1TK0A 3PSPA 3QU2A 4F2RA 3V6KA 3SENA 3C28A 3LVWA 3M7DA 1SKRA 2DPJA 1TE2A 2K4HA 3UXOA 4K4GA 4QZDA 2C2EA 9ICPA 5L1KA 1TAUA 3NRZA 2A19A 3C2LA 1U49A 1PVRA 1RG6A 2P35A 3AU6A 2GLEA 1ZQRA 3IN5A 4DSJA 1JIHA 3TADC 2YB1A 5AK5A 4P2HA 3T79A 5AK6A 2KZZA 4I2FA 1URJA 5HHHA 1JROA 3WK6A 1B0XA 2ISPA 2LYHA 1D8YA 3N4MB 2OYYA 8ICJA 5ALZA 4JV2A 5GTHU 2EAMA 2OXOA 5J0SA 1L7NA 2DUYA 2KE7A 4TQRA 3GDXA 4DL3A 2NO5A 2VA8A 1TV9A 9ICAA 4F4KA 1L7OA 2HHVA 1NKCA 2F1IA 4F92B 5ALEA 2ESEA 4MFFA 5J2FA 2XGPA 4DCCA 8ICBA 8ICUA 2W7OA 4PHPA 3PO5A 4I2AA 3V72A 5TISU 2W8LA 4F5QA 1A76A 1YZ6A 3GIKA 1SV4A 5DDYA 2KVCA 3MC1A 2XY6A 1QCKA 4DFPA 4I2HA 3TI0A 2BDUA 2M0NA 3QU4A 5J2CA 1ZQXA 3GFKB 1O03A 4Y2QA 4M04A 3C2KA 1ZXIA 2PI5A 4AYBF 2W54A 4ECUA 1L5UA 2V4QA 3V7JA 9ICBA 5AM3A 1KFTA 2BDPA 2D3DA 5ALIA 1JXLA 4M6WA 2FPLA 1S5LU 3V6JA 8ICSA 4U7CA 1VJ5A 2B6GA 2FLNA 4OO1J 2QB0B 1X42A 1SL2A 9ICLA 2RDIA 4YVZA 2K4IA 2ZTCA 3ZDBA 4M9LA 1QSSA 3UMCA 5JU5A 5L1JA 3SV3A 1KFSA 2R8IA 4KLJA 8ICFA 2H5XA 5B66U 4Y2RA 2OEHA 5IIJA 4QZFA 3K1ZA 5DBBA 4HAIA 2IA6A 1COOA 1ZJMA 5J2KA 5KG5A 1SZHA 4F5PA 4DQPA 1ZD3A 2ZJAA 3M9OB 1PK1A 1L7MA 1XO0A 1VLBA 2XC9A 4J9SA 1ZQKA 2YQEA 1ZQFA 2E5SA 4UAZA 1IIPA 1ZQOA 5T14A 3KZIU 4PL2A 5AK3A 2BQRA 4BWMA 2IOFA 1J2MA 5AIAA 3PMNA 5AHXA 4DOBA 1BNOA 3F53A 2K8AA 1KSPA 2ZIXA 2ZUBA 4KLIA 4IR1A 2DL0A 4MF8A 4IQTA 8ICQA 1DOQA 5AI4A 3Q8RB 4Z6DA 4YCXA 4J03A 2KTQA 5ALWA 2HOQA 1NK9A 5HMMA 3D6JA 3B0YA 1QQ5A 2NO4A 3F2CA 5AKJA 3HPOA 4BXOA 2NYVA 3TACB 1XSLA 3UPQA 4JUZA 2UVRA 2BPCA 1BGXT 1U9LA 3F5EA 2ZUCA 1SZPA 1ZQEA 3LYSA 3IHQB 3ISCA 1NJZA 2HVHA 1XSNA 1ECWA 5ALYA 1XC9A 7ICQA 4ICAA 4B9MA 5AK4A 3I1YA 2KZ3A 4DLEA 4LZDA 5J0WA 1OW5A 2JV3A 2BZFA 4GFJA 1SL1A 2KNJA 4R8UB 4RUAA 3FYHA 4Y2JA 4QZBA 1CUKA 5KFAA 5AM5A 3ETLA 1K1QA 2MA1A 1A0PA 3GZFA 5DGBA 3G6VA 4R64A 3H8SA 4ECWA 2NRTA 2DKXA 2MU2A 3QEBZ 3THVA 3KOOA 1Z00A 5DLFA 3KBBA 4C80A 4UW9A 4ECQA 3SD7A 4DF8A 1XS9D 4QIWC 5KT3A 4RQ0A 3TFRA 1JN3A 4RQ3A 4Y2YA 1RYSA 1OXJA 3N7RC 2E8NA 4Y2XA 3SAHA 4QZCA 9ICIA 4P4MA 2E8OA 1SV0C 2LM4A 4DSKA 4US8A
chains in the Genus database with same CATH topology
1UPHA 3D2NA 4AYBF 2F2AB 2HOQA 2WAQF 2ZIUB 3PSIA 3D2SA 3NUQA 2Z7JA 4KMOB 4NWIA 3F2CA 5HR7A 2K89A 5HR6A 2W04A 2K4EA 1MA7A 1PVRA 2KICA 1PVPA 2VKQA 1PVQA 3NRWA 4OJPA 4C0ZA 3ALRA 3PSFA 3M6ZA 2KD1A 4U7CA 2F77X 3H0LB 2KJ8A 2HBJA 4OJLA 4OO1J 4QNLA 3IN5A 2E1EA 3F5EA 3F2DA 2H3QA 1T94A 2GH1A 3CRXA 2YB1A 4A8EA 3N7SC 3T79A 3LYSA 1TAMA 2K4IA 4P0PB 1URJA 4OJ6A 2H3VA 3VCBA 2YX8A 2DQNB 3H0MB 1ECWA 1XNSA 4NLBA 3F5AA 2KJ5A 2ZIWB 4ICAA 2N1RA 2Y0SF 2MRLA 2XIDA 2G08A 2Q4TA 2K8BB 3CYMA 3HKZF 3C29A 4WJ3B 3AQEA 2F76X 1WUDA 4BUGA 1YT3A 2LBOA 2K8CB 2NV3A 2KKVA 2OYYA 2VJ4A 2WB1F 3OPXA 2KEYA 2ZIVB 4QJFB 1HIWA 3D2QA 3MGVA 1OUQA 2CPRA 3IG5A 2CRXA 2HOIA 4CRXA 4CGZA 2RP5A 2ZIXB 4PL1A 2ZIUA 4QIWF 2H3ZA 4NV0A 3K1ZA 4GFJA 3PSTA 1F44A 3SAFA 2KNJA 4JMUA 1NZBA 2WAQC 2ZXHA 2KKPA 3ICXA 4FZNA 1HEKA 5A0LA 2KV2A 2OXOA 2RHFA 2ZXIA 1A6SA 2HMXA 1CRXA 2W7PA 3CP8A 4P0QB 2HBLA 2ZG6A 4FZMA 1SZHA 2G07A 1KBUA 3SMVA 3KFUF 5C0YA 4CDGA 2H3IA 1Z1BA 1ED1A 2LKYA 3VC8A 2F8LA 2G09A 2MA1A 1XO0A 4O3MA 4U6PA 2A3VA 2HBMA 1A0PA 2G06A 2PMZC 4P0PA 1Q3VA 2E5SA 2XICA 3GZFA 1IIPA 2G5HB 2JHDA 3N7PD 3H0RB 3M6KA 5T14A 2KOBA 2KJ9A 2KIWA 2G5IB 2R18A 4OJOA 2W7OA 2GOLA 2ZIWA 4PL2A 5CRXA 4AYBC 5KL1B 3RF9A 3AL0B 3O0FA 2XVTA 2OM6A 2XI9A 4ACOA 2LHTA 2VJ5A 3SQIA 1ZQ1C 2Y0SC 4IC9A 2VIXA 3HKZC 4KX5A 1P7DA 2HOFA 2ZIVA 2JGAA 3F53A 3GU3A 2K8AA 2W03A 3AQFA 2ZIXA 3IP4B 3ONNA 1L6NA 2WB1C 3KZXA 3L3FX 4FZLA 2CN1A 3PZPA 4BJQA 2D6FC 2LYBA 2KVCA 4KX3A 4QIWC 2JH1A 2G0AA 2RRDA 4NLCA 3RFAA 2H3FA 2JMGA 2OH2A 3LVVA 2KHVA 2KHQA 2BDUA 3DEEA 2M0NA 3PSPA 4FE3A 1DRGA 3N7RC 5KL8B 2DGZA 4P0QA 2DF4B 2YB4A 3SAHA 1Z19A 1Q3UA 3E0FA 1GO3F 2LYAA 3C28A 4OJ5A 3LVWA 2PMZF 3F2BA 1D8BA 3M7DA 4BX9C 2E1FA 2K4HA 3IG8A 2HBKA 2JH7A 3SAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKY A;  2M0N A;  2KVC A; 
#chains in the Genus database with same CATH topology
 1ZQZ A;  4O3N A;  3PSI A;  3GIM A;  3D2S A;  3V7K A;  3RJI A;  2FLP A;  3WK7 A;  2RLT A;  5AM2 A;  1ZJN A;  7ICK A;  4UBB A;  2FI1 A;  9ICT A;  2R8G A;  5GTI U;  3BS5 A;  4R63 A;  2C22 A;  3RBD A;  1BNP A;  3LWM A;  4Q8E A;  3F2D A;  2H3Q A;  2BPF A;  4UB5 A;  4EX6 A;  4I2J A;  4C7Z A;  2HHU A;  4PPX A;  7ICN A;  1CI4 A;  2PFP A;  2DQN B;  5E79 U;  3G6Y A;  2N1R A;  2MRL A;  4WJ3 B;  3AQE A;  4I2I A;  2DWQ A;  1NOM A;  1HIW A;  4PL1 A;  2H3Z A;  4GXK A;  5AKX A;  4R65 A;  1NZB A;  2ZXI A;  1WCN A;  4NM1 A;  3H4D A;  2W7P A;  4FZM A;  5F9N A;  1KBU A;  2CXY A;  1ZQU A;  2LKY A;  5KFD A;  3MDA A;  1NK6 A;  3N97 B;  4IS7 A;  3SR6 A;  2I1Q A;  3KHR A;  2G5H B;  4NL9 A;  2W11 A;  4YMM A;  4OD0 A;  1ARO P;  3DV9 A;  2EAN A;  9ICS A;  4RPX A;  1NJY A;  5H2F U;  1SGG A;  5J2H A;  3PVX A;  5KFE A;  3QNM A;  2IMW P;  3ETR A;  3HP6 A;  1NK4 A;  2GO7 A;  5AKI A;  5KFI A;  2F1J A;  2JZB A;  5KFL A;  2KHV A;  4OCZ A;  4F4W A;  4USA A;  2M9N A;  3UMB A;  3WKE A;  2W9A A;  5DLG A;  4CF5 A;  4KLH A;  2KSO A;  3ZI4 A;  4YR0 A;  3HT3 A;  2K4P A;  5ALV A;  1QSY A;  3ORY A;  3C1Z A;  3QUQ A;  2Z7J A;  5J2B A;  4DOA A;  5HP4 A;  5IIM A;  2EAO A;  1MQ2 A;  4MFC A;  4QW9 A;  1ZYQ A;  1ZOL A;  3HW8 A;  5DB8 A;  4B9V A;  5AI6 A;  7ICL A;  3M6Z A;  2HBJ A;  4QW8 A;  2A1J A;  4Z6C A;  5CJ7 A;  4DF4 A;  5J0T A;  4YN4 A;  2EH9 A;  1ZQL A;  3VCB A;  2YX8 A;  2WF7 A;  5KFX A;  1A77 A;  4F2S A;  5KG3 A;  5CHG A;  8ICT A;  4BUG A;  1RQN A;  2ES6 A;  3JPO A;  2XY5 A;  3EWA A;  4KLU A;  2WB1 F;  3ZDE A;  4C4S A;  7ICJ A;  3TAQ A;  2WHE A;  8ICN A;  2BHN A;  2JR5 A;  4RQ6 A;  2MUT B;  4DQQ A;  1HEK A;  5EE9 A;  5ALT A;  1RZT A;  2HBL A;  3H8W A;  1ZQS A;  3SMV A;  1ED1 A;  1U45 A;  5IIO A;  2ISO A;  4IRC A;  2EZX A;  4I28 A;  1ZQW A;  2KOB A;  1Q3U A;  2R18 A;  4DFK A;  2J6S A;  1JUD A;  2XI9 A;  3EW9 A;  3SQI A;  3TAR A;  2Y0S C;  4B9T A;  4GC7 A;  2RQ5 A;  1ZRM A;  2AQ4 A;  4QWD A;  4RQ1 A;  5CP2 A;  4GC6 A;  2AGO A;  5J0Y A;  4NLC A;  1ZQI A;  8ICP A;  4RQ8 A;  4DL5 A;  3CNH A;  2XO7 A;  1KTQ A;  3SI8 A;  3NAS A;  4OJ5 A;  3F2B A;  3GII A;  3RRG A;  2FLL A;  4F93 B;  3V7L A;  4F4Y A;  3AM9 A;  5AKZ A;  4DL2 A;  1WWV A;  4DWI A;  4K4I A;  1ZQC A;  4EZ6 A;  1MA7 A;  1X9W A;  3JPP A;  5JTI A;  4KLO A;  4EEN A;  4ED1 A;  1X9M A;  2VAN A;  4QNL A;  5AKG A;  2WF6 A;  2E1E A;  3H8J A;  4FBU A;  2W9B A;  1T94 A;  4DFD A;  3N7S C;  3OGU A;  2W9C A;  4J9P A;  4P0P B;  4Q44 A;  3N28 A;  5DKW A;  3HKZ F;  3MFI A;  3UMG A;  1ZRN A;  4QZA A;  2AJQ A;  5DB9 A;  2NV3 A;  2I9G A;  2ZIV B;  5AI8 A;  3RH4 A;  2CPR A;  2ZJ8 A;  3QU9 A;  4KN4 A;  3SEI A;  3AU2 A;  4ELU A;  2KZM A;  9ICU A;  5DBC A;  2HDO A;  1NKB A;  5J0X A;  4KLQ A;  2E8P A;  2LPE A;  4KMU A;  1NI3 A;  1PZN A;  3T5L A;  2LMR A;  3JPN A;  4C8N A;  9ICM A;  3BQ1 A;  3CP8 A;  2YML A;  4DQR A;  2WTF A;  3Q8K A;  3NS1 A;  7ICH A;  2W3S A;  4F50 A;  2A3V A;  1V85 A;  4M0A A;  4JV0 A;  4RUC A;  4YMO A;  2KIV A;  4F5O A;  1X9S A;  8ICM A;  4UB4 A;  2AU0 A;  5AKE A;  4KX5 A;  2F8K A;  2KP7 A;  1WYG A;  5KFG A;  4RQM A;  2UVV A;  1L6N A;  4FZL A;  1QSL A;  2LYB A;  5IIK A;  5KAF U;  1SKW A;  2R8K A;  2WF8 A;  4DSE A;  5KL8 B;  2YN4 A;  4ECX A;  1X66 A;  4K4H A;  2LYA A;  1ZQN A;  3NVZ A;  3PW0 A;  3BZC A;  3RJF A;  5F9L A;  3RR8 A;  1ZQQ A;  1CEZ A;  2Q0Z X;  9ICR A;  4NWI A;  5KAI U;  2PFQ A;  3WKD A;  4RNO A;  3U26 A;  5KFY A;  1KKX A;  3FDS A;  1NJW A;  2FMQ A;  4DSI A;  3SZ2 A;  3OTQ A;  1LKY A;  2YMP A;  2GH1 A;  4ED6 A;  2EDU A;  1DK2 A;  1BPX A;  4DSL A;  4YR2 A;  3C2M A;  3WU2 U;  2KJ5 A;  4YG2 A;  4QZ9 A;  3M9N B;  2G08 A;  4RQ5 A;  2KVS A;  5ALL A;  4KLF A;  5KNI A;  2PXI A;  3BZK A;  4EEL A;  4PH5 A;  3UQ2 A;  3OPX A;  5KFW A;  4IQW A;  9ICV A;  3C21 A;  1F44 A;  3SAF A;  4DS4 A;  4UB8 U;  7ICT A;  1TK8 A;  5K4L A;  2C28 A;  2YMQ A;  3RH5 A;  5AI0 A;  2G07 A;  3DDH A;  2QLT A;  2PKE A;  2F8L A;  4J9R A;  5J0P A;  2G06 A;  4J9Q A;  3WK9 A;  1Q46 A;  3PO4 A;  2KIW A;  2ZIW A;  4O3S A;  4ACO A;  2VJ5 A;  1P7D A;  4M6W B;  3A0H U;  5EWE A;  3AQF A;  5KT6 A;  3NVW A;  3MDC A;  1S0N A;  1ZQT A;  1UQV A;  4B9N A;  5G5G A;  3RFA A;  2HHQ A;  5J2A A;  1Z4N A;  4ZOH C;  2FPM A;  1DRG A;  2FPK A;  4P0Q A;  5KTQ A;  2EZY A;  5KFK A;  5J2D A;  5EE0 A;  1ZQY A;  1ZD2 P;  5ALD A;  1WCL A;  2JH7 A;  3CW2 C;  5J0U A;  4LZG A;  4KLE A;  2UVU A;  3KHH A;  2WAQ F;  5HR7 A;  2WF9 A;  3A0B U;  5KFJ A;  4Z6E A;  8ICG A;  5AKY A;  2Y1J A;  1PVP A;  2Y9U A;  9ICK A;  4JK1 A;  1S76 D;  3ALR A;  3PX4 A;  1U47 A;  1PK1 B;  4F4Z A;  5JRT A;  4M9N A;  4IRK A;  2F76 X;  4YXJ A;  7ICM A;  4QJF B;  3D2Q A;  2ZIX B;  9ICO A;  4LVS A;  2W8K A;  2PFN A;  4JMU A;  2YTU A;  5ALN A;  3PNC A;  5DGA A;  1V9P A;  2HMX A;  3V6H A;  2KMD A;  4DLG A;  5IIN A;  4R8U A;  4O3M A;  1T7P A;  5TZV A;  3OHB A;  2O6K A;  2PMZ C;  1KEJ A;  4YXM A;  3M6K A;  1KDH A;  4OJO A;  4BXO B;  1T8E A;  2XVT A;  1RYU A;  2AHO B;  3JPR A;  1Z1V A;  1ZQV A;  3NVY A;  4DQI A;  3ONN A;  2MAX A;  1ZQA A;  1O08 A;  5CB1 A;  4ELV A;  5DG9 A;  3H8M A;  7ICG A;  1IV8 A;  4UAW A;  1QQ7 A;  3PW2 A;  2DF4 B;  1XSP A;  5JUM A;  1QQ6 A;  4KLD A;  3C1Y A;  5KFQ A;  1TVA A;  3RJK A;  3KKA C;  4QWC A;  1L3S A;  5L1M A;  3G6X A;  4O3P A;  2FMP A;  3QUC A;  1N61 A;  5G5H A;  1KQQ A;  1BPY A;  4UAY A;  4J9N A;  4Y2V A;  4PHA A;  2XGQ A;  1V38 A;  4RQN A;  2Y1I A;  5DG8 A;  4EX7 A;  1K1S A;  4A8E A;  2BQ3 A;  2B0C A;  3QUT A;  4QZ8 A;  3BDP A;  1NK0 A;  3F5A A;  3MR3 A;  2ATL A;  3RR7 A;  2XID A;  4DQS A;  4JWM A;  3M1Y A;  1Z00 B;  3IG5 A;  2W43 A;  2BCR A;  2ZIU A;  2P6U A;  1Z3E B;  1IG6 A;  4MF2 A;  2Y9T A;  1S97 A;  1JI7 A;  5AM0 A;  5DDM A;  4I2B A;  4Y2S A;  3UXP A;  4PGX A;  4F71 A;  3MGH A;  4QZH A;  3PX0 A;  1B22 A;  5KFT A;  4DFJ A;  3IDW A;  3PR4 A;  3KFU F;  3HWT A;  9ICE A;  3VC8 A;  2EAP A;  3HX0 A;  2AGQ A;  3WK8 A;  4KLS A;  8ICX A;  4O9M A;  3GQC A;  4RPY A;  3OSP A;  4QZI A;  1B4F A;  4JB3 A;  4DSF A;  2BQU A;  1F0M A;  4QWB A;  5KT2 A;  3RJE A;  4MHV A;  3BS5 B;  4ED3 A;  3RJJ A;  1BPD A;  4EBE A;  4ELT A;  2LM1 A;  2ODG A;  2FJ6 A;  3GIJ A;  2JMG A;  4YD1 A;  1MSW D;  2KHQ A;  4KTQ A;  2QAR A;  3C5F A;  1N48 A;  5DBA A;  1UT5 A;  3PR5 B;  2NRX A;  4KLG A;  3E0F A;  4BDP A;  1RQL A;  2YY6 A;  1ZQJ A;  3K4G A;  5ALO A;  4TUR A;  2I6X A;  1NK7 A;  1N60 A;  5KT7 A;  2I5H A;  4F3O A;  4J9O A;  1ZQP A;  3MR2 A;  3HRD D;  5HR6 A;  5EOZ A;  3PW7 A;  8ICO A;  2VKQ A;  5KG0 A;  2BCV A;  1KW4 A;  3NGD A;  3PW5 A;  4OJP A;  2F77 X;  2KJ8 A;  3TAP A;  4PZO A;  3PV8 A;  3TKA A;  3UM9 A;  1F5S A;  4IQU A;  4Y2U A;  3MBY A;  5ALU A;  1TAM A;  3RTV A;  2H3V A;  5KG7 A;  3Q8M A;  2JEJ A;  4NLB A;  4B9S A;  4Z6F A;  3B0X A;  5KT4 A;  4IQV A;  4RQ2 A;  3C29 A;  2K8B B;  2W55 A;  5J2E A;  4PJ0 U;  4KLL A;  8ICH A;  2KFZ A;  1U48 A;  2J6U A;  3T5K A;  2HHX A;  4NV0 A;  1RXW A;  5AM1 A;  3ICX A;  3GV7 B;  4EEK A;  8ICC A;  2JZB B;  2WFA A;  4C4R A;  5ALR A;  2MSN A;  3MR6 A;  4O5K A;  1FFV A;  4I2G A;  2KSO B;  2ZG6 A;  3H40 A;  2H3I A;  1NZP A;  5KFS A;  1RPL A;  3FC4 A;  3RB6 A;  2VA3 A;  2G09 A;  3SV4 A;  1SIJ A;  2V4R A;  1Q3V A;  4PHD A;  4O0I A;  3N7P D;  5J2G A;  1PK3 A;  4DFM A;  2G5I B;  3GIL A;  3RF9 A;  3AL0 B;  2OM6 A;  1K5O A;  3JPT A;  4DOC A;  4PGY A;  5D46 A;  5L1L A;  2A1J B;  4I2D A;  4UBC A;  2ASL A;  3TAD A;  1X6J A;  1KRP A;  9ICH A;  3M8R A;  2DGZ A;  1M6Y A;  2ZJ5 A;  1TAQ A;  3PW4 A;  1JXE A;  3I28 A;  2PMZ F;  1D8B A;  4BX9 C;  4O5C A;  3PML A;  4M9H A;  1YZ7 A;  2HBK A;  3ZDD A;  3SAG A;  5KFH A;  3ED5 A;  4RU9 A;  4HYK A;  4FFD A;  2F2A B;  4KMO B;  4EBC A;  2DKZ A;  5CWR A;  2KFN A;  9ICX A;  1S8O A;  3IM1 A;  3NTU A;  1PVQ A;  5EE3 A;  3GV5 B;  3RRH A;  3L5K A;  9ICF A;  4XUS A;  4KLT A;  3CRX A;  2AGP A;  4F72 A;  4I29 A;  5HHI A;  2K60 A;  4OJ6 A;  3I76 A;  1T3Q A;  4ED2 A;  1X40 A;  3RBE A;  3QZ7 A;  1ZQG A;  5AKL A;  2HI0 A;  5KFZ A;  2HOI A;  4UAS A;  1ZD5 A;  4QIW F;  5KG4 A;  5J0R A;  1RYR A;  1L8O A;  2ASJ A;  4ECR A;  2ZXH A;  4FZN A;  3QUB A;  5EWF A;  8ICW A;  1UA1 A;  3QXG A;  4F91 B;  1KLN A;  4NLZ A;  4CF3 A;  2HHS A;  4DL4 A;  1LVH A;  5ALF A;  3AN1 A;  2RDJ A;  3Q8S B;  4Q43 A;  2HBM A;  1HJP A;  4YMN A;  1J97 A;  1FIQ A;  1S10 A;  5J8Y C;  2JHD A;  5IIL A;  4M9J A;  1KL9 A;  3EUB 2;  4ECT A;  2W3R A;  5KL1 B;  5DQI A;  2ZTE A;  5KG2 A;  3MR5 A;  2OCE A;  5ALM A;  5AKK A;  3EPG A;  1EXN A;  1ZQD A;  5ALX A;  3IP4 B;  2EZZ A;  2W9B B;  3JPS A;  1RM6 C;  2AQ0 A;  2W9C B;  1XO1 A;  2E3T A;  4C7Y A;  2ALZ A;  3WK5 A;  4TUP A;  3RJG A;  1GO3 F;  2FDR A;  3HJE A;  7ICR A;  2E1F A;  4Y2P A;  3IG8 A;  1V97 A;  2AH5 A;  1FFU A;  5EE1 A;  2KG5 A;  3EPI A;  5ALK A;  2D8C A;  2F1H A;  1DK3 A;  3B9J A;  1QTM A;  2IBK A;  5DB6 A;  1L3T A;  4F8R A;  1TK5 A;  3PSF A;  5BOM A;  4GXI A;  4MEX A;  4I2E A;  2OWO A;  4IRD A;  1SXE A;  2PI4 A;  3M9M B;  4DL6 A;  4O3Q A;  1C20 A;  5KG1 A;  4Q45 A;  3C23 A;  1Y88 A;  2ASD A;  3WK4 A;  3KD3 A;  1XNS A;  3SYZ A;  4UAV A;  1DXS A;  5ALQ A;  3CYM A;  1H38 A;  2QB1 A;  4XA5 A;  2KEY A;  1XWL A;  4NXZ A;  3K1R B;  4G3I A;  1DGJ A;  4EYI B;  2XY7 A;  5KFF A;  4ECS A;  2RHF A;  4NJ8 A;  3S6J A;  4JV1 A;  4M47 A;  9ICN A;  3IRU A;  1MQ3 A;  5AIC A;  5CA7 A;  4M2Y A;  2QKQ A;  3NVV A;  4KLM A;  2QB0 A;  5EWG A;  1JMS A;  5J0O A;  1NK8 A;  5KFU A;  4ED7 A;  2GOL A;  1NJX A;  1S0O A;  1QLN A;  2VIX A;  1JAL A;  1N2X A;  4UB1 A;  3PZP A;  1LKY B;  2D6F C;  4P4O A;  1N56 A;  4BGD A;  1N63 A;  2DPI A;  4EYH B;  2HW3 A;  3LVV A;  3OHA A;  3DEE A;  4FE3 A;  3ISB A;  2BR0 A;  4RNN A;  3L4P A;  1L3V A;  4F4X A;  8ICR A;  2V9W A;  1NKE A;  1UCV A;  4EZ9 A;  3D2N A;  1S77 D;  4RZR A;  1RDF A;  4NLN A;  1TFR A;  5J29 A;  3AEV A;  4F5R A;  1QH9 A;  2W04 A;  2JEF A;  2K4E A;  3UQ0 A;  1MN8 A;  2KIC A;  8ICV A;  2DFL A;  2JEI A;  9ICG A;  2HHW A;  2JRZ A;  3H0L B;  2BCS A;  1HUO A;  5KT5 A;  1N62 A;  3RAX A;  5AKH A;  4ZH4 A;  2ZIW B;  2Y0S F;  3QYP A;  2Q4T A;  4C4T A;  1ZQM A;  1YT3 A;  4F5N A;  7ICF A;  3KKA A;  1B43 A;  3QX7 A;  2B21 A;  3LDA A;  2KKP A;  4GIB A;  4YFK A;  1COK A;  3QU5 A;  4UB2 A;  3QU7 A;  1A6S A;  1RXV A;  4YP3 A;  2BGW A;  1SXD A;  4P0Q B;  1LB2 B;  5C0Y A;  1SV0 A;  2IOF K;  1L8L A;  2C2R A;  5KFN A;  1ZD4 A;  2VA2 A;  2XIC A;  4UAU A;  4UB3 A;  4ED0 A;  8ICE A;  3C5G A;  3ISD A;  3BS7 A;  5BPC A;  2LHT A;  4KIT B;  2LI6 A;  3BQ2 A;  3WKA A;  2WB1 C;  4DL7 A;  4BJQ A;  3ZD9 A;  4RT3 A;  4RT2 A;  5FP0 A;  4O5E A;  2H3F A;  2NRW A;  1U4B A;  4NY8 A;  4B6J A;  7ICU A;  3AUO A;  2YB4 A;  1UT8 A;  3MAB A;  4ECV A;  4QWA A;  2GWS A;  4X5V A;  1UPH A;  1C7Y A;  4I2C A;  5KFC A;  7ICS A;  4RQ4 A;  3KHG A;  4DS5 A;  4FS1 A;  1BPB A;  2K89 A;  3MGI A;  2KK0 A;  9ICQ A;  2JXJ A;  4DEZ A;  4ECZ A;  2BCQ A;  3NRW A;  3BJY A;  5ALJ A;  4C0Z A;  2J6T A;  1J2N A;  4RNM A;  4I27 A;  3M8S A;  2KN7 A;  1SL0 A;  1TKD A;  7ICI A;  3RJH A;  4Y2T A;  4CCH A;  2WF5 A;  4TUQ A;  4UQG A;  4TQS A;  2JEG A;  8ICK A;  2ZUD A;  3LWL A;  2EQY A;  2BKE A;  2K8C B;  1BVS A;  4QWE A;  2VJ4 A;  3QZ8 A;  3Q8P B;  3MGV A;  4CRX A;  2RP5 A;  4J9K A;  1UHU A;  1DGS A;  1T3N A;  3QEA Z;  3RB4 A;  4FBT A;  5L9X A;  4RQ7 A;  3OSN A;  1SWV A;  3ZD8 A;  5KFO A;  1CRX A;  4J9L A;  2A1A A;  5KFB A;  1Z1B A;  2F3N A;  4J9M A;  3OJS A;  4U6P A;  3AMZ A;  1SWW A;  2W9M A;  8ICI A;  1MC8 A;  1UA0 A;  2KJ9 A;  3Q8L A;  1KFD A;  3O0F A;  9ICC A;  4FS2 A;  3HKZ C;  1N5X A;  2XCP A;  4E0D A;  4GXJ A;  1FO4 A;  1X2I A;  4US9 A;  2F44 A;  4C8O A;  1D9F A;  3BQT A;  4XQ8 A;  4CE6 A;  1IXR A;  3BQ7 A;  3TAN A;  5BOL A;  4B9U A;  1Z19 A;  2E8M A;  2ZTD A;  2R8J A;  2BCU A;  1FEZ A;  3H0M B;  4IL6 U;  4PHE A;  4P4P A;  2ZIU B;  3NUQ A;  1SB3 C;  2HCF A;  1HUZ A;  5AI9 A;  3H7I A;  4ECY A;  1Q8K A;  4MFA A;  1D8L A;  4AP9 A;  4ED8 A;  8ICZ A;  1N5W A;  5J0Q A;  2KD1 A;  5AIB A;  5KFM A;  4OJL A;  5AI5 A;  3ZDA A;  9ICW A;  4BWJ A;  3WKB A;  5D4B A;  4QZG A;  3FM9 A;  3IV6 A;  5CR0 A;  1BPE A;  3HIL A;  5F3X B;  4EBD A;  4Q8F A;  1WWU A;  4RPZ A;  7ICE A;  3OJU A;  1WUD A;  5J2J A;  2XCA A;  2LBO A;  4NLK A;  5HNK A;  2FMS A;  3T5H A;  1OUQ A;  1VDV A;  4EEY A;  4KN7 A;  5III A;  3RB0 A;  4FO6 A;  2L5Y A;  3PST A;  4YR3 A;  5B5E U;  2P66 A;  4TUS A;  1NK5 A;  4O3O A;  3WKC A;  3ZDC A;  5A0L A;  5DG7 A;  3K75 D;  2QAR B;  3JPQ A;  1XU4 A;  4YQW A;  2NRV A;  4CDG A;  4M9G A;  4LJX A;  5HML A;  3T5J A;  4DO9 A;  3H0R B;  5CRX A;  3R9K A;  4AYB C;  4C8K A;  1JRP A;  3GV8 B;  2DBY A;  4IC9 A;  1S0V A;  2HOF A;  3BQ0 A;  4GLX A;  5DB7 A;  3GU3 A;  2BPG A;  7ICP A;  2CN1 A;  3E2E A;  5L1I A;  2MUT A;  4KX3 A;  2G0A A;  3EYZ A;  2OH2 A;  2C2D A;  3MFH A;  1X6I A;  3H4B A;  5KFP A;  8ICA A;  4G9B A;  1D9D A;  5ALG A;  5J2I A;  4UB6 U;  1S9F A;  5J8Y A;  1L7P A;  4C8M A;  2YMM A;  1Z4O A;  4PGQ A;  3RB3 A;  1L3U A;  8ICL A;  3KHL A;  2FE9 A;  1WG8 A;  4CNQ A;  3Q8Q B;  3E58 A;  3J81 j;  8ICY A;  3PY8 A;  3TFS A;  2OHF A;  5C5J A;  1SKS A;  4UAT A;  4XRH A;  5D49 A;  1ZQH A;  2IHM A;  5ALS A;  2HHT A;  2P6R A;  2PFO A;  4NM2 A;  4NL9 C;  1AQ6 A;  2HSZ A;  1BPZ A;  9ICJ A;  2AXT U;  4CF4 A;  1KN5 A;  3EZ5 A;  4YD2 A;  5ALH A;  2KKV A;  4CGZ A;  2CRX A;  1IM4 A;  3TQ1 A;  4O3R A;  4R66 A;  7ICO A;  1NNL A;  3PX6 A;  7ICV A;  2WAQ C;  5DQH A;  4IR9 A;  2KV2 A;  3KTQ A;  3RH6 A;  3FAH A;  4JWN A;  2NRZ A;  1PUZ A;  1T4G A;  2R8H A;  5AM4 A;  5KFV A;  3LK9 A;  1JX4 A;  1S0M A;  1X9X A;  4P0P A;  5DQG A;  3T3F A;  4B9L A;  4MEY A;  4QZE A;  1ZET A;  1ZQ1 C;  5ALP A;  1LV5 A;  4PZN A;  4UAR A;  3QE9 Y;  3RAQ A;  2IHN A;  3UXN A;  2ZIV A;  1ZQB A;  2JGA A;  5KG6 A;  2UVW A;  2W03 A;  3KZX A;  3L3F X;  4C8L A;  5CEH A;  2IOH A;  2JH1 A;  2RRD A;  2HVI A;  5KFR A;  4NLG A;  1TK0 A;  3PSP A;  3QU2 A;  4F2R A;  3V6K A;  3SEN A;  3C28 A;  3LVW A;  3M7D A;  1SKR A;  2DPJ A;  1TE2 A;  2K4H A;  3UXO A;  4K4G A;  4QZD A;  2C2E A;  9ICP A;  5L1K A;  1TAU A;  3NRZ A;  2A19 A;  3C2L A;  1U49 A;  1PVR A;  1RG6 A;  2P35 A;  3AU6 A;  2GLE A;  1ZQR A;  3IN5 A;  4DSJ A;  1JIH A;  3TAD C;  2YB1 A;  5AK5 A;  4P2H A;  3T79 A;  5AK6 A;  2KZZ A;  4I2F A;  1URJ A;  5HHH A;  1JRO A;  3WK6 A;  1B0X A;  2ISP A;  2LYH A;  1D8Y A;  3N4M B;  2OYY A;  8ICJ A;  5ALZ A;  4JV2 A;  5GTH U;  2EAM A;  2OXO A;  5J0S A;  1L7N A;  2DUY A;  2KE7 A;  4TQR A;  3GDX A;  4DL3 A;  2NO5 A;  2VA8 A;  1TV9 A;  9ICA A;  4F4K A;  1L7O A;  2HHV A;  1NKC A;  2F1I A;  4F92 B;  5ALE A;  2ESE A;  4MFF A;  5J2F A;  2XGP A;  4DCC A;  8ICB A;  8ICU A;  2W7O A;  4PHP A;  3PO5 A;  4I2A A;  3V72 A;  5TIS U;  2W8L A;  4F5Q A;  1A76 A;  1YZ6 A;  3GIK A;  1SV4 A;  5DDY A;  2KVC A;  3MC1 A;  2XY6 A;  1QCK A;  4DFP A;  4I2H A;  3TI0 A;  2BDU A;  2M0N A;  3QU4 A;  5J2C A;  1ZQX A;  3GFK B;  1O03 A;  4Y2Q A;  4M04 A;  3C2K A;  1ZXI A;  2PI5 A;  4AYB F;  2W54 A;  4ECU A;  1L5U A;  2V4Q A;  3V7J A;  9ICB A;  5AM3 A;  1KFT A;  2BDP A;  2D3D A;  5ALI A;  1JXL A;  4M6W A;  2FPL A;  1S5L U;  3V6J A;  8ICS A;  4U7C A;  1VJ5 A;  2B6G A;  2FLN A;  4OO1 J;  2QB0 B;  1X42 A;  1SL2 A;  9ICL A;  2RDI A;  4YVZ A;  2K4I A;  2ZTC A;  3ZDB A;  4M9L A;  1QSS A;  3UMC A;  5JU5 A;  5L1J A;  3SV3 A;  1KFS A;  2R8I A;  4KLJ A;  8ICF A;  2H5X A;  5B66 U;  4Y2R A;  2OEH A;  5IIJ A;  4QZF A;  3K1Z A;  5DBB A;  4HAI A;  2IA6 A;  1COO A;  1ZJM A;  5J2K A;  5KG5 A;  1SZH A;  4F5P A;  4DQP A;  1ZD3 A;  2ZJA A;  3M9O B;  1PK1 A;  1L7M A;  1XO0 A;  1VLB A;  2XC9 A;  4J9S A;  1ZQK A;  2YQE A;  1ZQF A;  2E5S A;  4UAZ A;  1IIP A;  1ZQO A;  5T14 A;  3KZI U;  4PL2 A;  5AK3 A;  2BQR A;  4BWM A;  2IOF A;  1J2M A;  5AIA A;  3PMN A;  5AHX A;  4DOB A;  1BNO A;  3F53 A;  2K8A A;  1KSP A;  2ZIX A;  2ZUB A;  4KLI A;  4IR1 A;  2DL0 A;  4MF8 A;  4IQT A;  8ICQ A;  1DOQ A;  5AI4 A;  3Q8R B;  4Z6D A;  4YCX A;  4J03 A;  2KTQ A;  5ALW A;  2HOQ A;  1NK9 A;  5HMM A;  3D6J A;  3B0Y A;  1QQ5 A;  2NO4 A;  3F2C A;  5AKJ A;  3HPO A;  4BXO A;  2NYV A;  3TAC B;  1XSL A;  3UPQ A;  4JUZ A;  2UVR A;  2BPC A;  1BGX T;  1U9L A;  3F5E A;  2ZUC A;  1SZP A;  1ZQE A;  3LYS A;  3IHQ B;  3ISC A;  1NJZ A;  2HVH A;  1XSN A;  1ECW A;  5ALY A;  1XC9 A;  7ICQ A;  4ICA A;  4B9M A;  5AK4 A;  3I1Y A;  2KZ3 A;  4DLE A;  4LZD A;  5J0W A;  1OW5 A;  2JV3 A;  2BZF A;  4GFJ A;  1SL1 A;  2KNJ A;  4R8U B;  4RUA A;  3FYH A;  4Y2J A;  4QZB A;  1CUK A;  5KFA A;  5AM5 A;  3ETL A;  1K1Q A;  2MA1 A;  1A0P A;  3GZF A;  5DGB A;  3G6V A;  4R64 A;  3H8S A;  4ECW A;  2NRT A;  2DKX A;  2MU2 A;  3QEB Z;  3THV A;  3KOO A;  1Z00 A;  5DLF A;  3KBB A;  4C80 A;  4UW9 A;  4ECQ A;  3SD7 A;  4DF8 A;  1XS9 D;  4QIW C;  5KT3 A;  4RQ0 A;  3TFR A;  1JN3 A;  4RQ3 A;  4Y2Y A;  1RYS A;  1OXJ A;  3N7R C;  2E8N A;  4Y2X A;  3SAH A;  4QZC A;  9ICI A;  4P4M A;  2E8O A;  1SV0 C;  2LM4 A;  4DSK A;  4US8 A; 
#chains in the Genus database with same CATH homology
 1UPH A;  3D2N A;  4AYB F;  2F2A B;  2HOQ A;  2WAQ F;  2ZIU B;  3PSI A;  3D2S A;  3NUQ A;  2Z7J A;  4KMO B;  4NWI A;  3F2C A;  5HR7 A;  2K89 A;  5HR6 A;  2W04 A;  2K4E A;  1MA7 A;  1PVR A;  2KIC A;  1PVP A;  2VKQ A;  1PVQ A;  3NRW A;  4OJP A;  4C0Z A;  3ALR A;  3PSF A;  3M6Z A;  2KD1 A;  4U7C A;  2F77 X;  3H0L B;  2KJ8 A;  2HBJ A;  4OJL A;  4OO1 J;  4QNL A;  3IN5 A;  2E1E A;  3F5E A;  3F2D A;  2H3Q A;  1T94 A;  2GH1 A;  3CRX A;  2YB1 A;  4A8E A;  3N7S C;  3T79 A;  3LYS A;  1TAM A;  2K4I A;  4P0P B;  1URJ A;  4OJ6 A;  2H3V A;  3VCB A;  2YX8 A;  2DQN B;  3H0M B;  1ECW A;  1XNS A;  4NLB A;  3F5A A;  2KJ5 A;  2ZIW B;  4ICA A;  2N1R A;  2Y0S F;  2MRL A;  2XID A;  2G08 A;  2Q4T A;  2K8B B;  3CYM A;  3HKZ F;  3C29 A;  4WJ3 B;  3AQE A;  2F76 X;  1WUD A;  4BUG A;  1YT3 A;  2LBO A;  2K8C B;  2NV3 A;  2KKV A;  2OYY A;  2VJ4 A;  2WB1 F;  3OPX A;  2KEY A;  2ZIV B;  4QJF B;  1HIW A;  3D2Q A;  3MGV A;  1OUQ A;  2CPR A;  3IG5 A;  2CRX A;  2HOI A;  4CRX A;  4CGZ A;  2RP5 A;  2ZIX B;  4PL1 A;  2ZIU A;  4QIW F;  2H3Z A;  4NV0 A;  3K1Z A;  4GFJ A;  3PST A;  1F44 A;  3SAF A;  2KNJ A;  4JMU A;  1NZB A;  2WAQ C;  2ZXH A;  2KKP A;  3ICX A;  4FZN A;  1HEK A;  5A0L A;  2KV2 A;  2OXO A;  2RHF A;  2ZXI A;  1A6S A;  2HMX A;  1CRX A;  2W7P A;  3CP8 A;  4P0Q B;  2HBL A;  2ZG6 A;  4FZM A;  1SZH A;  2G07 A;  1KBU A;  3SMV A;  3KFU F;  5C0Y A;  4CDG A;  2H3I A;  1Z1B A;  1ED1 A;  2LKY A;  3VC8 A;  2F8L A;  2G09 A;  2MA1 A;  1XO0 A;  4O3M A;  4U6P A;  2A3V A;  2HBM A;  1A0P A;  2G06 A;  2PMZ C;  4P0P A;  1Q3V A;  2E5S A;  2XIC A;  3GZF A;  1IIP A;  2G5H B;  2JHD A;  3N7P D;  3H0R B;  3M6K A;  5T14 A;  2KOB A;  2KJ9 A;  2KIW A;  2G5I B;  2R18 A;  4OJO A;  2W7O A;  2GOL A;  2ZIW A;  4PL2 A;  5CRX A;  4AYB C;  5KL1 B;  3RF9 A;  3AL0 B;  3O0F A;  2XVT A;  2OM6 A;  2XI9 A;  4ACO A;  2LHT A;  2VJ5 A;  3SQI A;  1ZQ1 C;  2Y0S C;  4IC9 A;  2VIX A;  3HKZ C;  4KX5 A;  1P7D A;  2HOF A;  2ZIV A;  2JGA A;  3F53 A;  3GU3 A;  2K8A A;  2W03 A;  3AQF A;  2ZIX A;  3IP4 B;  3ONN A;  1L6N A;  2WB1 C;  3KZX A;  3L3F X;  4FZL A;  2CN1 A;  3PZP A;  4BJQ A;  2D6F C;  2LYB A;  2KVC A;  4KX3 A;  4QIW C;  2JH1 A;  2G0A A;  2RRD A;  4NLC A;  3RFA A;  2H3F A;  2JMG A;  2OH2 A;  3LVV A;  2KHV A;  2KHQ A;  2BDU A;  3DEE A;  2M0N A;  3PSP A;  4FE3 A;  1DRG A;  3N7R C;  5KL8 B;  2DGZ A;  4P0Q A;  2DF4 B;  2YB4 A;  3SAH A;  1Z19 A;  1Q3U A;  3E0F A;  1GO3 F;  2LYA A;  3C28 A;  4OJ5 A;  3LVW A;  2PMZ F;  3F2B A;  1D8B A;  3M7D A;  4BX9 C;  2E1F A;  2K4H A;  3IG8 A;  2HBK A;  2JH7 A;  3SAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...