2LKYA

Solution structure of msmeg_1053, the second duf3349 annotated protein in the genome of mycobacterium smegmatis, seattle structural genomics center for infectious disease target mysma.17112.b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
GPGSMVNAFLAKIAAWLNAGYPEGVPGPDRVPLLALLTRRLTNDEIKAIAEDLEKRAHFDHIDIGVLITQMTDEMPREEDIERVRRHLALQGWPLDDPRDGEEPDGESGGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Different structures for two DUF3349 annotated proteins in the genome of Mycobacterium smegmatis suggest a structural diversity within the DUF3349 superfamily.
rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Structural genomics, unknown function
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2011-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.430 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lkyA00
2M0NA 2KVCA 2LKYA
chains in the Genus database with same CATH superfamily
1OXJA 5AICA 5ALHA 3QU2A 1A76A 2RRDA 2JGAA 4P0QB 4YR0A 4M9HA 8ICCA 4DSLA 2AJQA 9ICWA 2IOFK 2J6SA 5J0TA 3UQ0A 1MC8A 4KLJA 1IIPA 3QXGA 5HHHA 4GXKA 2BCUA 1KKXA 2NYVA 3H7IA 2NO5A 3RAXA 1TAQA 5AM4A 3QUCA 1TVAA 1RM6C 2ZIWA 4RZRA 1ZQCA 4YMNA 4P4PA 4Q8FA 3M8RA 2N1RA 1SV4A 4J9PA 4KLUA 3ALRA 1ZQAA 3GV8B 1BNOA 5ALUA 2KSOB 4ED2A 5KNIA 4C4TA 9ICKA 4O9MA 5KT3A 1S0NA 3K1RB 3QZ7A 2EAPA 4DFJA 1SB3C 2E1FA 1RYUA 5CA7A 2F1IA 2ISPA 2PFPA 3D2QA 5KFXA 3AL0B 5KT4A 4O5CA 2L5YA 5ALZA 5KFGA 5EE0A 3KHGA 4I2FA 2BZFA 2LM4A 1NNLA 4ELVA 4UAWA 3BQTA 3J81j 1XSNA 4OJLA 2WAQF 1XO1A 5CHGA 4JV0A 2GOLA 2D8CA 1X9SA 1SKSA 4UAZA 3SI8A 2R8HA 2DBYA 4NLCA 1PUZA 4Y2UA 4P2HA 4P4OA 3PY8A 3WK8A 4EYIB 3AU6A 2RQ5A 3TAPA 3AEVA 3IG5A 2OWOA 1N48A 2NRZA 3GILA 5EWGA 2PI5A 4JMUA 3ED5A 4UAVA 4UB5A 3BDPA 5KT2A 4KX3A 1ZQDA 2EQYA 2KZMA 2H5XA 5CWRA 1O08A 1NOMA 5AKYA 2HHWA 2KN7A 2BHNA 2EZZA 2BCVA 4TQRA 3C2LA 5DB8A 2WTFA 5DBCA 2HI0A 3M6KA 1K1QA 1ZJMA 1Z1VA 4LZDA 3B9JA 3LVVA 4G9BA 4UB2A 1ZRNA 8ICHA 3TQ1A 3KZIU 3WK9A 4Y2XA 4B9SA 2MU2A 2YB4A 3PSPA 3PX6A 2OM6A 3UQ2A 3PW7A 3SAGA 1K5OA 4JV1A 1LVHA 2W9CB 5JRTA 4UARA 7ICKA 1QTMA 2NRVA 1QQ6A 2HHTA 2B21A 3C29A 2ZTEA 5KFFA 3BQ7A 3GQCA 3UM9A 3WK7A 4O3PA 1PK1B 2HHQA 5L1IA 4OD0A 2KEYA 3GIJA 1ZJNA 1VJ5A 3SENA 7ICSA 2HHUA 3SEIA 3WKEA 2G5HB 4IC9A 5DLGA 1ED1A 3IDWA 1KSPA 5DG9A 5ALXA 3AU2A 1S97A 2QB0B 3MBYA 2I9GA 2K8CB 4DSJA 4DFDA 1EXNA 5KFLA 1ZQQA 4UBBA 4J9MA 1ZQOA 3KKAA 2BCSA 1Z3EB 3Q8PB 4FS2A 2FPLA 1YZ7A 2HBJA 3QU7A 1RZTA 2LPEA 3RAQA 5AI0A 1C7YA 2VJ5A 3IV6A 4DF8A 7ICEA 4NLBA 3F53A 4EZ6A 1TAUA 1B43A 2CRXA 1Q3VA 1SWVA 1S77D 2HHXA 2XO7A 4OO1J 2OH2A 4PGQA 1XWLA 3QUQA 1RXVA 4G3IA 3DV9A 3K4GA 5J2KA 2G5IB 2JH1A 4M2YA 1F5SA 4QZ9A 2HW3A 2W3RA 3E58A 1DGJA 3KHLA 1X9MA 5HMMA 2W8LA 5ALYA 4R63A 2F8LA 3L4PA 2HOFA 4F3OA 4UB4A 8ICAA 4CGZA 3N28A 1T7PA 3GU3A 1QCKA 5ALSA 1ZQMA 1IG6A 1ZRMA 2H3VA 1ZQNA 3C1YA 4RQ2A 1RDFA 1JROA 8ICMA 3AQEA 4KMUA 4J9QA 1JIHA 4QZEA 4J9KA 2IOHA 3CRXA 4GIBA 2UVVA 1WG8A 1V38A 1Y88A 4ZH4A 2CXYA 4QW8A 3PX0A 3NVYA 1SZPA 3JPTA 3NVWA 4CDGA 3WK5A 2FPMA 1D8LA 1BPYA 1TK0A 2YN4A 4DF4A 4OCZA 4RQ1A 3H40A 2Z7JA 1KN5A 4M6WB 1SXEA 2EANA 5AKHA 1N62A 2DPIA 2XY5A 2HDOA 4QIWC 1CI4A 5ALVA 4RUCA 4CRXA 2RHFA 5DDYA 3BQ2A 4IR1A 3TADA 4ECXA 1D8YA 3GV7B 4I2EA 2W8KA 5J8YC 3AQFA 4F5OA 2W9BB 1FIQA 5TISU 3QUTA 1SL2A 2NV3A 1ZQXA 9ICLA 2O6KA 5CEHA 1UQVA 1MQ2A 2Y1JA 3SYZA 2PKEA 4RNMA 1ZD4A 4BXOA 4C80A 1RYRA 2AGPA 4C4SA 3KD3A 4NLKA 4OJ5A 3RRGA 2QKQA 4F72A 3PZPA 4BJQA 2BPCA 2ZTCA 2DPJA 2J6TA 4EENA 4PZOA 1PVPA 3ZD8A 4QWAA 4QZBA 4CCHA 1KFTA 4KLSA 5DBAA 2ZXIA 5KTQA 3MFHA 2F76X 3UXOA 4XQ8A 4EEKA 3MABA 9ICCA 1BPBA 2Y9UA 1T4GA 2NRXA 3IM1A 2EH9A 5AKXA 4ED0A 3JPRA 3N7PD 2P66A 5EOZA 1M6YA 1Q8KA 4QZHA 4IRCA 4CF5A 5D46A 1Z1BA 1BGXT 4O3NA 3V6KA 5E79U 3V72A 4J9OA 3PNCA 3ZDAA 2KFNA 3THVA 2LHTA 5HMLA 5F9NA 4DSEA 1D8BA 1ZD2P 3KKAC 5DKWA 4RQ0A 7ICLA 4A8EA 1L3VA 5KFSA 4BX9C 2FJ6A 1KFSA 5G5HA 4DS5A 2RP5A 1NJZA 5AKZA 2JEGA 5TZVA 5AK5A 2PI4A 1ZQGA 2UVRA 1JXLA 3NVZA 4RQ3A 2V9WA 5K4LA 3Q8SB 1D9DA 3FC4A 4RQ6A 3BS5A 2W7OA 3HILA 4M9LA 2K8BB 4R65A 1TFRA 5AK4A 2BCQA 3HT3A 4M0AA 4YMMA 2Q0ZX 3PO5A 2RDJA 4MF8A 2FMSA 2KMDA 3C23A 2OHFA 1UPHA 5J2AA 1RQLA 9ICQA 1JUDA 2Y0SF 2HBKA 4FZMA 5ALFA 4O3QA 3SD7A 5KL1B 1HEKA 1Z00A 5J0UA 4R8UA 5DB7A 1LKYB 4QW9A 2W43A 2FMQA 2KZZA 4ECQA 5J2FA 3OJUA 5KL8B 4FFDA 1FEZA 5HR6A 4DLEA 3GFKB 4UAUA 2YMLA 4TUQA 2HOQA 4RQNA 1NK9A 1XU4A 2KJ8A 5DB6A 4B9UA 3Q8LA 2MUTA 3OPXA 1AQ6A 4RQ4A 3M9OB 2B6GA 3QYPA 1SWWA 2YMMA 1OW5A 2ZIVB 3CYMA 3F2BA 3N4MB 3SQIA 3H8SA 8ICOA 2QARB 2K89A 1FFVA 5KFAA 1ZETA 4RPYA 2ASLA 4NWIA 2K8AA 1ZQIA 3NUQA 3BS7A 4M47A 4UB3A 4Q45A 8ICPA 2C2EA 1NK8A 2Y0SC 2DKZA 4RNOA 2W55A 1S76D 5KFVA 2ZUDA 1X9XA 3G6VA 3MR5A 3H4DA 1SV0C 2ASJA 4RQ5A 3C2KA 4FBTA 4F91B 8ICRA 2XCPA 8ICSA 3TARA 3JPNA 2EZXA 1L7NA 4KX5A 5KFMA 4Y2JA 8ICWA 2BPFA 2EDUA 2IHNA 2IA6A 1F44A 3MR3A 2QB0A 2XGPA 1ZQVA 3L3FX 4RPZA 5HP4A 5L1LA 2E8MA 5AKGA 1X6IA 1H38A 5DBBA 1N60A 5A0LA 3H8MA 4DOCA 5KG1A 9ICBA 5AI9A 3ISBA 1BPDA 9ICIA 1U47A 3PW0A 1ZQTA 4ED3A 2XGQA 2HBLA 5KFIA 5KFBA 4JV2A 2VA8A 4I2IA 4MFAA 5HNKA 4KLOA 2ZIXB 2PFNA 2F1JA 1N5XA 3IP4B 4J9LA 2ZG6A 1FO4A 4ED1A 3ZDBA 1OUQA 3ICXA 2BQUA 2PMZF 4Q8EA 2FE9A 4DQSA 1S5LU 2E8OA 1ZQKA 2QLTA 4F4WA 2H3FA 2JRZA 1O03A 3NRZA 5L9XA 5L1JA 2LYHA 5J2JA 2ZUBA 4DQIA 2HSZA 2F2AB 3GIIA 9ICOA 1TV9A 2KHQA 2C2DA 1MN8A 5DG7A 4GFJA 1N61A 1BPEA 5KT7A 2IOFA 4US9A 2YMPA 3RJIA 2MRLA 3SAFA 2IBKA 3TFSA 4USAA 2ZIUA 3OJSA 4QWBA 2WF9A 4JWNA 4M04A 4B9MA 1ZXIA 4ECYA 4PGXA 3A0BU 3H0MB 3Q8RB 2QB1A 2AQ4A 3QU9A 2I1QA 1U4BA 2KTQA 1ZD5A 4J9NA 4Y2RA 3PV8A 3UMGA 4Z6FA 3EZ5A 4B9NA 4EBCA 2PMZC 3BZKA 2KKVA 1S10A 2AHOB 3D2NA 2VJ4A 4PHAA 3UXPA 1TE2A 1WWUA 3DDHA 5J29A 1WCLA 1UHUA 4P0PB 4M6WA 8ICIA 2I5HA 4KLFA 3C21A 5KFPA 4Z6CA 2MA1A 2WFAA 2EZYA 1ZQJA 2C22A 2WAQC 2UVUA 4BWJA 4UB1A 3MGVA 4DEZA 4Q44A 2DFLA 3MC1A 2R8GA 4ZOHC 3NRWA 3IN5A 1NK4A 3N7SC 4O5EA 2JZBA 4F2SA 4Z6EA 2OEHA 1ZQUA 8ICQA 2GO7A 4XA5A 4Y2PA 1JRPA 5KFKA 4IQTA 4NL9C 1SKRA 3HP6A 2KHVA 3V6HA 4EBDA 5KFQA 3GIKA 9ICAA 2KNJA 4DSIA 4F2RA 3H8WA 4ECVA 8ICUA 1QQ5A 1DRGA 2YY6A 2AGOA 5J2GA 5KFWA 5J2IA 1ZQHA 5J2CA 3H0LB 4DWIA 5KFTA 2HVIA 4YG2A 4KMOB 3ZDEA 2ALZA 3JPQA 2JH7A 3PX4A 4Y2SA 4PHDA 1JALA 3SV4A 3RB0A 4O3MA 5DG8A 4EELA 5ALIA 4B6JA 1Z4OA 4BWMA 3SR6A 1KBUA 4FS1A 3L5KA 1KLNA 1S0MA 2RDIA 5AHXA 1K1SA 3F5AA 4KLHA 1A6SA 4J9RA 2NO4A 1VDVA 1RQNA 3D6JA 3H8JA 5J2EA 2LMRA 4O3OA 1FFUA 5J0WA 2V4RA 7ICJA 4KLMA 1SGGA 4AP9A 4UASA 2UVWA 4DCCA 3JPPA 1J2NA 4FZLA 4C8NA 1V85A 3GIMA 2EAMA 2EAOA 5KG2A 2OCEA 4I2BA 5ALGA 3RBEA 4O3SA 3PR4A 3V6JA 2LKYA 1J97A 5KFHA 4AYBF 9ICPA 5J2DA 5EE1A 4I2CA 3RB4A 3VCBA 4BGDA 8ICKA 4MFCA 1NKEA 3GZFA 2WF6A 3QZ8A 4GXJA 4KTQA 1TKDA 2XVTA 4K4IA 4QZGA 4RT3A 2FMPA 1HIWA 4YQWA 8ICNA 4UB6U 3MDAA 4JUZA 4ED7A 5DQIA 2H3IA 3RTVA 4I2JA 3HX0A 3WK6A 4HAIA 4NJ8A 4O0IA 3SZ2A 4ECSA 2E1EA 5KG0A 3AN1A 4P4MA 4IR9A 1B0XA 1NKBA 4NM1A 1MSWD 4F4KA 3RJJA 4ELUA 5AM3A 4WJ3B 2M9NA 3VC8A 1URJA 5JUMA 4PPXA 4GXIA 4IQUA 3KZXA 3S6JA 7ICHA 1NJWA 3NVVA 1AROP 4JB3A 5ALKA 2GLEA 1B4FA 3HJEA 2R18A 2A1JB 2H3ZA 1ZQWA 4ELTA 5T14A 4AYBC 3ZI4A 5ALOA 3N7RC 3K1ZA 4YFKA 4QZDA 3PSFA 5ALWA 3T5LA 4KLQA 2VANA 4U7CA 5KFJA 3E0FA 4PH5A 1QLNA 4PGYA 1TK8A 5AI8A 4DSKA 4C8OA 5AIAA 4KLIA 3RRHA 8ICVA 5AM0A 5J0OA 1QH9A 2ZUCA 5KFUA 5KFZA 5KFOA 9ICSA 4GC7A 4XUSA 1U48A 4RU9A 4ECTA 3C5GA 8ICZA 4ECUA 4KN7A 1KTQA 4P0QA 4BUGA 3QUBA 5J0RA 5J0YA 2E8PA 3PMLA 2XY7A 1HJPA 4IQWA 5CRXA 2PXIA 5L1KA 2IMWP 3HKZF 5BOMA 2G08A 4ACOA 8ICLA 7ICMA 4LJXA 4DL6A 1U49A 5DGBA 3ZDCA 1ZD3A 1S8OA 2DUYA 1V97A 3D2SA 2W03A 2WF8A 1SL1A 1ZQZA 4ED6A 4FE3A 4Y2YA 4UQGA 4DSFA 3RFAA 1WWVA 4LVSA 2HOIA 2JXJA 2DQNB 5AKLA 4DL2A 2E8NA 2NRWA 4GLXA 3EW9A 4YD2A 2R8KA 1YZ6A 5ALDA 2A3VA 2ZIXA 3NASA 4KLLA 3B0XA 1WYGA 2E3TA 5ALEA 5AKIA 4F8RA 2K4HA 1KDHA 3M9MB 1SL0A 2KSOA 4M9JA 1BVSA 1RG6A 4NM2A 3OSNA 3LDAA 5J0SA 4TURA 2KD1A 2M0NA 5AK3A 1BNPA 4DFKA 1N5WA 3F5EA 7ICOA 3PW4A 4EX6A 2P6RA 2W9AA 4RPXA 3HKZC 9ICJA 1A0PA 4RNNA 5J2HA 3MGHA 1U9LA 2KVSA 3OTQA 4I2HA 5KG4A 4B9LA 2ODGA 2K4PA 2B0CA 4GC6A 2OYYA 5CJ7A 1NK6A 2AXTU 4DL4A 4U6PA 4ECZA 5AI6A 1ZYQA 1KRPA 1NZPA 4JWMA 4F5RA 2GH1A 1UT8A 1L5UA 4M9GA 1SZHA 2AH5A 4HYKA 4FZNA 4DQPA 4YVZA 2FI1A 4ECWA 1LB2B 2HMXA 2KK0A 3G6YA 2Y9TA 4KITB 1F0MA 4DOAA 3T5JA 3BZCA 4NLZA 1CUKA 5KG7A 1N56A 1HUZA 2K4IA 5BPCA 3F2CA 3OHAA 1X40A 1YT3A 2G09A 5EE3A 2H3QA 4X5VA 2DGZA 3RBDA 3AM9A 1UT5A 4Y2QA 3NS1A 3FDSA 4DQQA 4QZIA 1NJYA 2F8KA 4P0PA 2ES6A 2JEIA 4F5PA 1JMSA 3UPQA 1PVRA 1L3SA 2YB1A 3QEAZ 5KT5A 4EZ9A 1UA1A 2F1HA 3I76A 2W9CA 4DLGA 2JV3A 5FP0A 5GTIU 3UXNA 2A19A 2FLLA 3BJYA 9ICXA 5KFYA 5KFCA 4Z6DA 4C7YA 3NGDA 3K75D 4US8A 1SKWA 4F92B 4YD1A 2DF4B 1QSLA 2KJ5A 1KQQA 4PHEA 2LBOA 2ZJAA 3M1YA 3TADC 2AQ0A 1PK1A 3IRUA 2G07A 3OHBA 1VLBA 2KE7A 3MFIA 3IHQB 1BPXA 3WKBA 1ZQLA 1CEZA 7ICUA 2CPRA 4BXOB 4KLTA 4I28A 3EWAA 1L7PA 2HBMA 3KFUF 5AM5A 1T3NA 2BPGA 1JX4A 3ORYA 9ICRA 2ISOA 4QJFB 2MAXA 2BDUA 2AU0A 5DB9A 1T3QA 2DL0A 2JMGA 1IV8A 3V7JA 3RF9A 1KL9A 5D49A 1LV5A 1L3UA 5JU5A 1QSSA 1NK7A 4I29A 3TI0A 4OJOA 3LVWA 4YXMA 2HHSA 3MDCA 1ZQ1C 1N63A 2VA2A 5GTHU 3WKDA 4C0ZA 2ESEA 1NK0A 2YMQA 2FLNA 3NTUA 3TAQA 4NLGA 3ISDA 5DQHA 5KAIU 4C8LA 1TK5A 9ICMA 3PSTA 1KEJA 4NV0A 4QWEA 2BGWA 8ICEA 3F2DA 2IHMA 1P7DA 4KLEA 3R9KA 7ICNA 1BPZA 5ALLA 4J9SA 2DWQA 4MF2A 4C8MA 3TKAA 4LZGA 3DEEA 3UMBA 1SIJA 8ICGA 4PL2A 3PW2A 4MEYA 2C2RA 3BQ0A 5HR7A 2YTUA 4UATA 5IIJA 3ZDDA 4C8KA 3MR6A 4EX7A 2OXOA 4JK1A 4KLDA 3BS5B 3QNMA 5EE9A 3Q8MA 3FAHA 1ZQRA 1KW4A 2YX8A 3JPSA 3H0RB 1C20A 2HVHA 4ECRA 1NZBA 2J6UA 1SXDA 4F50A 3ETLA 2P35A 4UBCA 2XICA 2R8IA 2VKQA 1PK3A 1Z00B 5EWEA 7ICFA 4R8UB 3HWTA 4RQMA 5B66U 3C5FA 4RUAA 2FDRA 1N2XA 2BR0A 4DS4A 3EPGA 3HPOA 1ZQPA 2KICA 3TACB 2MUTB 4YMOA 2YQEA 5J8YA 3C2MA 2A1JA 5AKJA 3SV3A 5AKKA 5ALRA 2HCFA 2W9MA 5KFRA 3N97B 5J0XA 1A77A 2W9BA 4O5KA 1XNSA 7ICPA 1MA7A 3LK9A 1UCVA 3TFRA 4YN4A 7ICIA 4EEYA 3LWLA 1X42A 2JEFA 4QNLA 4B9TA 4CF3A 3V7KA 5KFNA 3ONNA 5KG6A 1X9WA 5IIOA 1L3TA 4FBUA 3C28A 9ICVA 4DQRA 1PZNA 1ZQFA 4J03A 4ICAA 2W3SA 2AGQA 4Q43A 5CB1A 5KT6A 3RJKA 5ALTA 1DK3A 2XY6A 2KG5A 5ALNA 5C0YA 4IL6U 2K4EA 2W11A 2KFZA 3QU5A 3HW8A 5F9LA 3RB3A 4OJ6A 1XSPA 2KP7A 5ALJA 3FYHA 4UAYA 1IXRA 2ASDA 4C4RA 5ALMA 4B9VA 2WF5A 3RB6A 8ICBA 3PR5B 1IM4A 2G0AA 5KAFU 3A0HU 3EYZA 4IRKA 5D4BA 2P6UA 7ICRA 2Y1IA 3EPIA 2LM1A 3T5HA 2WHEA 2VA3A 3LWMA 2F3NA 2ZIWB 9ICNA 1T8EA 4DFPA 3H4BA 3RJEA 4F4YA 1NJXA 2E5SA 3CP8A 1S9FA 1J2MA 5KFEA 8ICFA 2XIDA 5AM1A 3QE9Y 5J0PA 2FLPA 4I27A 4DL3A 5IIMA 3RH5A 4F5NA 2D3DA 3CW2C 2JR5A 2ZJ5A 3T3FA 3C1ZA 2GWSA 4M9NA 5F3XB 1ECWA 3RH4A 3PMNA 5JTIA 2RLTA 2Q4TA 2W04A 1DOQA 3OSPA 2I6XA 2WF7A 1S0VA 4QZ8A 2NRTA 4ED8A 4K4HA 4K4GA 3M7DA 2ZIUB 4QIWF 1S0OA 3RH6A 4DO9A 3OGUA 8ICTA 3KHHA 3Q8QB 4I2GA 4CNQA 1XO0A 3FM9A 2LYBA 1LKYA 3MGIA 1WUDA 3HRDD 2WB1F 3LYSA 1L8OA 2VIXA 2KOBA 3WU2U 5BOLA 4IQVA 3AUOA 1L6NA 4EBEA 9ICHA 4OJPA 3WKCA 4QWDA 4KLGA 3WKAA 5B5EU 1NKCA 1DXSA 2ZIVA 3KBBA 4NLNA 1XS9D 3O0FA 2ZTDA 2PFOA 2FPKA 3I1YA 3M8SA 5IIIA 2QARA 1QQ7A 3I28A 4DL7A 3GDXA 1DGSA 2C28A 4F4XA 5L1MA 4Y2TA 2PFQA 2XI9A 4NY8A 1Z4NA 1XSLA 3MR2A 4RQ8A 4F93B 4KN4A 1SV0A 2KV2A 3G6XA 2BCRA 4RQ7A 1KFDA 4TQSA 1Q46A 3RJGA 2JZBB 7ICTA 1WCNA 2WB1C 1X6JA 2ATLA 3M6ZA 1JI7A 2LI6A 3ZD9A 4DL5A 4Y2VA 1Z19A 2CN1A 4CE6A 4MFFA 3IG8A 3M9NB 2F44A 9ICGA 4R64A 1D9FA 3ETRA 7ICQA 4YCXA 2MSNA 3QX7A 1CRXA 2V4QA 4QWCA 5ALPA 2A1AA 5DDMA 5CR0A 3PW5A 5DQGA 5ALQA 4QZFA 4QZCA 2JHDA 7ICVA 1NI3A 2ZJ8A 4PJ0U 2KJ9A 9ICUA 4R66A 4DFMA 5IILA 4RT2A 8ICYA 3QEBZ 4PZNA 5J2BA 5CP2A 1X2IA 5AKEA 2JEJA 2XCAA 3KOOA 3PO4A 3GV5B 9ICFA 4IRDA 2K60A 4XRHA 5AK6A 4E0DA 2KIVA 1ZQBA 1UA0A 1L7OA 4PL1A 4UB8U 1Q3UA 1RPLA 2F77X 2BDPA 1NK5A 1T94A 1ZQYA 4I2AA 4MHVA 5HHIA 5KG5A 5IIKA 2XC9A 3T79A 3PVXA 3TANA 5IINA 1ZQSA 4TUSA 3RR8A 3WK4A 3SAHA 4MEXA 8ICXA 4F4ZA 1RXWA 4FO6A 3QU4A 5DGAA 1TAMA 4UW9A 3CNHA 5AIBA 4F5QA 4TUPA 4CF4A 4O3RA 2KIWA 1MQ3A 3RR7A 3UMCA 1QSYA 3V7LA 3EUB2 1ZQEA 2W7PA 1DK2A 5AM2A 1HUOA 4F71A 1B22A 3AMZA 5H2FU 4C7ZA 2BQ3A 4NXZA 1COKA 3JPOA 3ISCA 3PSIA 9ICTA 3SMVA 2BKEA 5C5JA 3RJHA 2KZ3A 4PHPA 4YP3A 2ZXHA 1PVQA 4QZAA 4YXJA 1XC9A 2KKPA 1RYSA 3B0YA 2LYAA 2D6FC 3KTQA 1U45A 5KG3A 2BQRA 5J0QA 5AI4A 2HHVA 1JN3A 5G5GA 3BQ1A 4DOBA 1ZOLA 4EYHB 2KVCA 3RJFA 2G06A 3Q8KA 5EWFA 1X66A 4YR3A 1L7MA 4NL9A 8ICJA 3U26A 2W54A 5DLFA 1GO3F 1L8LA 2R8JA 4BDPA 5KFDA 3KHRA 7ICGA 5AI5A 1COOA 3E2EA 4IS7A 3T5KA 2DKXA 9ICEA 4I2DA 4YR2A 1V9PA 1JXEA
chains in the Genus database with same CATH topology
2K8AA 3GZFA 3F2CA 4GFJA 2G08A 4C0ZA 4ACOA 2WB1C 3NUQA 1YT3A 2G09A 2KNJA 2LHTA 2XVTA 2Z7JA 2H3QA 1D8BA 3M6ZA 2DGZA 3IG5A 2RRDA 3D2SA 2JGAA 1TAMA 2MRLA 2W03A 1HIWA 4P0QB 1XNSA 1ECWA 1Z19A 2CN1A 1DRGA 4NWIA 1MA7A 3SAFA 2Y0SC 4FE3A 3IG8A 2ZIUA 2HBJA 4P0PA 3PSTA 4JMUA 4A8EA 4QIWC 2KIWA 2H3IA 4NV0A 3RFAA 4BX9C 4CRXA 2RHFA 2VJ5A 2Q4TA 2W04A 1PVRA 2HOIA 4NLBA 2YB1A 2W7PA 2DQNB 3F53A 4KX3A 2RP5A 3F2DA 1CRXA 1P7DA 3H0LB 2E1EA 5C0YA 4QNLA 1IIPA 3H0MB 2CRXA 3AQFA 1Q3VA 3ONNA 4OO1J 4KX5A 4WJ3B 2A3VA 2JHDA 2NV3A 2ZIXA 3M6KA 2ZIUB 3M7DA 4QIWF 3VC8A 3C28A 2OH2A 2W7OA 1URJA 3DEEA 3LVVA 3PSIA 2K8BB 2KJ9A 2K4HA 4KMOB 4PL2A 3KZXA 2ZIWA 3SMVA 2JH7A 2YB4A 3PSPA 1XO0A 4ICAA 5HR7A 2OM6A 2LYBA 2ZXHA 2G5IB 1F44A 2JH1A 2PMZC 2DF4B 2R18A 2KKVA 2KJ5A 2H3ZA 3SAGA 1WUDA 2N1RA 3D2NA 1PVQA 2LBOA 2OXOA 2WB1F 3ALRA 3LYSA 4OJ5A 5T14A 4O3MA 2KKPA 2KD1A 2M0NA 2VIXA 2KOBA 4AYBC 2VJ4A 2G07A 3F5EA 2LYAA 3L3FX 2D6FC 1UPHA 1KBUA 2K4EA 1L6NA 2F8LA 2HOFA 3N7RC 3HKZC 3PZPA 2Y0SF 2HBKA 3K1ZA 4FZMA 4BJQA 4CGZA 1A0PA 2YX8A 5KL1B 1HEKA 3F5AA 4OJ6A 4OJPA 1A6SA 3GU3A 2CPRA 4P0PB 3H0RB 2KVCA 5A0LA 3C29A 3PSFA 1PVPA 2G06A 2MA1A 2H3VA 2E1FA 1NZBA 4PL1A 2ZIVA 2G0AA 4U7CA 1Q3UA 2OYYA 2HBMA 3KFUF 2WAQC 5KL8B 5HR6A 3D2QA 2F77X 3E0FA 3O0FA 3MGVA 3AQEA 3AL0B 1T94A 2ZXIA 2XICA 2HBLA 4U6PA 2F76X 2HOQA 2KEYA 2VKQA 2GH1A 2KJ8A 1GO3F 2ZIXB 3NRWA 3IN5A 3CRXA 1SZHA 3OPXA 4QJFB 3N7SC 2BDUA 3IP4B 2G5HB 4IC9A 1ED1A 4FZLA 2ZG6A 2JMGA 3T79A 2ZIWB 4FZNA 2ZIVB 2XI9A 3ICXA 3RF9A 1OUQA 4OJLA 2WAQF 2PMZF 3CYMA 3N7PD 2HMXA 3F2BA 4P0QA 2GOLA 2LKYA 4BUGA 2E5SA 3SQIA 3CP8A 4CDGA 2H3FA 3SAHA 2KV2A 4OJOA 3LVWA 4AYBF 2K89A 2XIDA 1Z1BA 2K8CB 1ZQ1C 5CRXA 2KICA 2KHVA 3VCBA 4NLCA 2F2AB 3HKZF 2KHQA 2K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0N A;  2KVC A;  2LKY A; 
#chains in the Genus database with same CATH topology
 1OXJ A;  5AIC A;  5ALH A;  3QU2 A;  1A76 A;  2RRD A;  2JGA A;  4P0Q B;  4YR0 A;  4M9H A;  8ICC A;  4DSL A;  2AJQ A;  9ICW A;  2IOF K;  2J6S A;  5J0T A;  3UQ0 A;  1MC8 A;  4KLJ A;  1IIP A;  3QXG A;  5HHH A;  4GXK A;  2BCU A;  1KKX A;  2NYV A;  3H7I A;  2NO5 A;  3RAX A;  1TAQ A;  5AM4 A;  3QUC A;  1TVA A;  1RM6 C;  2ZIW A;  4RZR A;  1ZQC A;  4YMN A;  4P4P A;  4Q8F A;  3M8R A;  2N1R A;  1SV4 A;  4J9P A;  4KLU A;  3ALR A;  1ZQA A;  3GV8 B;  1BNO A;  5ALU A;  2KSO B;  4ED2 A;  5KNI A;  4C4T A;  9ICK A;  4O9M A;  5KT3 A;  1S0N A;  3K1R B;  3QZ7 A;  2EAP A;  4DFJ A;  1SB3 C;  2E1F A;  1RYU A;  5CA7 A;  2F1I A;  2ISP A;  2PFP A;  3D2Q A;  5KFX A;  3AL0 B;  5KT4 A;  4O5C A;  2L5Y A;  5ALZ A;  5KFG A;  5EE0 A;  3KHG A;  4I2F A;  2BZF A;  2LM4 A;  1NNL A;  4ELV A;  4UAW A;  3BQT A;  3J81 j;  1XSN A;  4OJL A;  2WAQ F;  1XO1 A;  5CHG A;  4JV0 A;  2GOL A;  2D8C A;  1X9S A;  1SKS A;  4UAZ A;  3SI8 A;  2R8H A;  2DBY A;  4NLC A;  1PUZ A;  4Y2U A;  4P2H A;  4P4O A;  3PY8 A;  3WK8 A;  4EYI B;  3AU6 A;  2RQ5 A;  3TAP A;  3AEV A;  3IG5 A;  2OWO A;  1N48 A;  2NRZ A;  3GIL A;  5EWG A;  2PI5 A;  4JMU A;  3ED5 A;  4UAV A;  4UB5 A;  3BDP A;  5KT2 A;  4KX3 A;  1ZQD A;  2EQY A;  2KZM A;  2H5X A;  5CWR A;  1O08 A;  1NOM A;  5AKY A;  2HHW A;  2KN7 A;  2BHN A;  2EZZ A;  2BCV A;  4TQR A;  3C2L A;  5DB8 A;  2WTF A;  5DBC A;  2HI0 A;  3M6K A;  1K1Q A;  1ZJM A;  1Z1V A;  4LZD A;  3B9J A;  3LVV A;  4G9B A;  4UB2 A;  1ZRN A;  8ICH A;  3TQ1 A;  3KZI U;  3WK9 A;  4Y2X A;  4B9S A;  2MU2 A;  2YB4 A;  3PSP A;  3PX6 A;  2OM6 A;  3UQ2 A;  3PW7 A;  3SAG A;  1K5O A;  4JV1 A;  1LVH A;  2W9C B;  5JRT A;  4UAR A;  7ICK A;  1QTM A;  2NRV A;  1QQ6 A;  2HHT A;  2B21 A;  3C29 A;  2ZTE A;  5KFF A;  3BQ7 A;  3GQC A;  3UM9 A;  3WK7 A;  4O3P A;  1PK1 B;  2HHQ A;  5L1I A;  4OD0 A;  2KEY A;  3GIJ A;  1ZJN A;  1VJ5 A;  3SEN A;  7ICS A;  2HHU A;  3SEI A;  3WKE A;  2G5H B;  4IC9 A;  5DLG A;  1ED1 A;  3IDW A;  1KSP A;  5DG9 A;  5ALX A;  3AU2 A;  1S97 A;  2QB0 B;  3MBY A;  2I9G A;  2K8C B;  4DSJ A;  4DFD A;  1EXN A;  5KFL A;  1ZQQ A;  4UBB A;  4J9M A;  1ZQO A;  3KKA A;  2BCS A;  1Z3E B;  3Q8P B;  4FS2 A;  2FPL A;  1YZ7 A;  2HBJ A;  3QU7 A;  1RZT A;  2LPE A;  3RAQ A;  5AI0 A;  1C7Y A;  2VJ5 A;  3IV6 A;  4DF8 A;  7ICE A;  4NLB A;  3F53 A;  4EZ6 A;  1TAU A;  1B43 A;  2CRX A;  1Q3V A;  1SWV A;  1S77 D;  2HHX A;  2XO7 A;  4OO1 J;  2OH2 A;  4PGQ A;  1XWL A;  3QUQ A;  1RXV A;  4G3I A;  3DV9 A;  3K4G A;  5J2K A;  2G5I B;  2JH1 A;  4M2Y A;  1F5S A;  4QZ9 A;  2HW3 A;  2W3R A;  3E58 A;  1DGJ A;  3KHL A;  1X9M A;  5HMM A;  2W8L A;  5ALY A;  4R63 A;  2F8L A;  3L4P A;  2HOF A;  4F3O A;  4UB4 A;  8ICA A;  4CGZ A;  3N28 A;  1T7P A;  3GU3 A;  1QCK A;  5ALS A;  1ZQM A;  1IG6 A;  1ZRM A;  2H3V A;  1ZQN A;  3C1Y A;  4RQ2 A;  1RDF A;  1JRO A;  8ICM A;  3AQE A;  4KMU A;  4J9Q A;  1JIH A;  4QZE A;  4J9K A;  2IOH A;  3CRX A;  4GIB A;  2UVV A;  1WG8 A;  1V38 A;  1Y88 A;  4ZH4 A;  2CXY A;  4QW8 A;  3PX0 A;  3NVY A;  1SZP A;  3JPT A;  3NVW A;  4CDG A;  3WK5 A;  2FPM A;  1D8L A;  1BPY A;  1TK0 A;  2YN4 A;  4DF4 A;  4OCZ A;  4RQ1 A;  3H40 A;  2Z7J A;  1KN5 A;  4M6W B;  1SXE A;  2EAN A;  5AKH A;  1N62 A;  2DPI A;  2XY5 A;  2HDO A;  4QIW C;  1CI4 A;  5ALV A;  4RUC A;  4CRX A;  2RHF A;  5DDY A;  3BQ2 A;  4IR1 A;  3TAD A;  4ECX A;  1D8Y A;  3GV7 B;  4I2E A;  2W8K A;  5J8Y C;  3AQF A;  4F5O A;  2W9B B;  1FIQ A;  5TIS U;  3QUT A;  1SL2 A;  2NV3 A;  1ZQX A;  9ICL A;  2O6K A;  5CEH A;  1UQV A;  1MQ2 A;  2Y1J A;  3SYZ A;  2PKE A;  4RNM A;  1ZD4 A;  4BXO A;  4C80 A;  1RYR A;  2AGP A;  4C4S A;  3KD3 A;  4NLK A;  4OJ5 A;  3RRG A;  2QKQ A;  4F72 A;  3PZP A;  4BJQ A;  2BPC A;  2ZTC A;  2DPJ A;  2J6T A;  4EEN A;  4PZO A;  1PVP A;  3ZD8 A;  4QWA A;  4QZB A;  4CCH A;  1KFT A;  4KLS A;  5DBA A;  2ZXI A;  5KTQ A;  3MFH A;  2F76 X;  3UXO A;  4XQ8 A;  4EEK A;  3MAB A;  9ICC A;  1BPB A;  2Y9U A;  1T4G A;  2NRX A;  3IM1 A;  2EH9 A;  5AKX A;  4ED0 A;  3JPR A;  3N7P D;  2P66 A;  5EOZ A;  1M6Y A;  1Q8K A;  4QZH A;  4IRC A;  4CF5 A;  5D46 A;  1Z1B A;  1BGX T;  4O3N A;  3V6K A;  5E79 U;  3V72 A;  4J9O A;  3PNC A;  3ZDA A;  2KFN A;  3THV A;  2LHT A;  5HML A;  5F9N A;  4DSE A;  1D8B A;  1ZD2 P;  3KKA C;  5DKW A;  4RQ0 A;  7ICL A;  4A8E A;  1L3V A;  5KFS A;  4BX9 C;  2FJ6 A;  1KFS A;  5G5H A;  4DS5 A;  2RP5 A;  1NJZ A;  5AKZ A;  2JEG A;  5TZV A;  5AK5 A;  2PI4 A;  1ZQG A;  2UVR A;  1JXL A;  3NVZ A;  4RQ3 A;  2V9W A;  5K4L A;  3Q8S B;  1D9D A;  3FC4 A;  4RQ6 A;  3BS5 A;  2W7O A;  3HIL A;  4M9L A;  2K8B B;  4R65 A;  1TFR A;  5AK4 A;  2BCQ A;  3HT3 A;  4M0A A;  4YMM A;  2Q0Z X;  3PO5 A;  2RDJ A;  4MF8 A;  2FMS A;  2KMD A;  3C23 A;  2OHF A;  1UPH A;  5J2A A;  1RQL A;  9ICQ A;  1JUD A;  2Y0S F;  2HBK A;  4FZM A;  5ALF A;  4O3Q A;  3SD7 A;  5KL1 B;  1HEK A;  1Z00 A;  5J0U A;  4R8U A;  5DB7 A;  1LKY B;  4QW9 A;  2W43 A;  2FMQ A;  2KZZ A;  4ECQ A;  5J2F A;  3OJU A;  5KL8 B;  4FFD A;  1FEZ A;  5HR6 A;  4DLE A;  3GFK B;  4UAU A;  2YML A;  4TUQ A;  2HOQ A;  4RQN A;  1NK9 A;  1XU4 A;  2KJ8 A;  5DB6 A;  4B9U A;  3Q8L A;  2MUT A;  3OPX A;  1AQ6 A;  4RQ4 A;  3M9O B;  2B6G A;  3QYP A;  1SWW A;  2YMM A;  1OW5 A;  2ZIV B;  3CYM A;  3F2B A;  3N4M B;  3SQI A;  3H8S A;  8ICO A;  2QAR B;  2K89 A;  1FFV A;  5KFA A;  1ZET A;  4RPY A;  2ASL A;  4NWI A;  2K8A A;  1ZQI A;  3NUQ A;  3BS7 A;  4M47 A;  4UB3 A;  4Q45 A;  8ICP A;  2C2E A;  1NK8 A;  2Y0S C;  2DKZ A;  4RNO A;  2W55 A;  1S76 D;  5KFV A;  2ZUD A;  1X9X A;  3G6V A;  3MR5 A;  3H4D A;  1SV0 C;  2ASJ A;  4RQ5 A;  3C2K A;  4FBT A;  4F91 B;  8ICR A;  2XCP A;  8ICS A;  3TAR A;  3JPN A;  2EZX A;  1L7N A;  4KX5 A;  5KFM A;  4Y2J A;  8ICW A;  2BPF A;  2EDU A;  2IHN A;  2IA6 A;  1F44 A;  3MR3 A;  2QB0 A;  2XGP A;  1ZQV A;  3L3F X;  4RPZ A;  5HP4 A;  5L1L A;  2E8M A;  5AKG A;  1X6I A;  1H38 A;  5DBB A;  1N60 A;  5A0L A;  3H8M A;  4DOC A;  5KG1 A;  9ICB A;  5AI9 A;  3ISB A;  1BPD A;  9ICI A;  1U47 A;  3PW0 A;  1ZQT A;  4ED3 A;  2XGQ A;  2HBL A;  5KFI A;  5KFB A;  4JV2 A;  2VA8 A;  4I2I A;  4MFA A;  5HNK A;  4KLO A;  2ZIX B;  2PFN A;  2F1J A;  1N5X A;  3IP4 B;  4J9L A;  2ZG6 A;  1FO4 A;  4ED1 A;  3ZDB A;  1OUQ A;  3ICX A;  2BQU A;  2PMZ F;  4Q8E A;  2FE9 A;  4DQS A;  1S5L U;  2E8O A;  1ZQK A;  2QLT A;  4F4W A;  2H3F A;  2JRZ A;  1O03 A;  3NRZ A;  5L9X A;  5L1J A;  2LYH A;  5J2J A;  2ZUB A;  4DQI A;  2HSZ A;  2F2A B;  3GII A;  9ICO A;  1TV9 A;  2KHQ A;  2C2D A;  1MN8 A;  5DG7 A;  4GFJ A;  1N61 A;  1BPE A;  5KT7 A;  2IOF A;  4US9 A;  2YMP A;  3RJI A;  2MRL A;  3SAF A;  2IBK A;  3TFS A;  4USA A;  2ZIU A;  3OJS A;  4QWB A;  2WF9 A;  4JWN A;  4M04 A;  4B9M A;  1ZXI A;  4ECY A;  4PGX A;  3A0B U;  3H0M B;  3Q8R B;  2QB1 A;  2AQ4 A;  3QU9 A;  2I1Q A;  1U4B A;  2KTQ A;  1ZD5 A;  4J9N A;  4Y2R A;  3PV8 A;  3UMG A;  4Z6F A;  3EZ5 A;  4B9N A;  4EBC A;  2PMZ C;  3BZK A;  2KKV A;  1S10 A;  2AHO B;  3D2N A;  2VJ4 A;  4PHA A;  3UXP A;  1TE2 A;  1WWU A;  3DDH A;  5J29 A;  1WCL A;  1UHU A;  4P0P B;  4M6W A;  8ICI A;  2I5H A;  4KLF A;  3C21 A;  5KFP A;  4Z6C A;  2MA1 A;  2WFA A;  2EZY A;  1ZQJ A;  2C22 A;  2WAQ C;  2UVU A;  4BWJ A;  4UB1 A;  3MGV A;  4DEZ A;  4Q44 A;  2DFL A;  3MC1 A;  2R8G A;  4ZOH C;  3NRW A;  3IN5 A;  1NK4 A;  3N7S C;  4O5E A;  2JZB A;  4F2S A;  4Z6E A;  2OEH A;  1ZQU A;  8ICQ A;  2GO7 A;  4XA5 A;  4Y2P A;  1JRP A;  5KFK A;  4IQT A;  4NL9 C;  1SKR A;  3HP6 A;  2KHV A;  3V6H A;  4EBD A;  5KFQ A;  3GIK A;  9ICA A;  2KNJ A;  4DSI A;  4F2R A;  3H8W A;  4ECV A;  8ICU A;  1QQ5 A;  1DRG A;  2YY6 A;  2AGO A;  5J2G A;  5KFW A;  5J2I A;  1ZQH A;  5J2C A;  3H0L B;  4DWI A;  5KFT A;  2HVI A;  4YG2 A;  4KMO B;  3ZDE A;  2ALZ A;  3JPQ A;  2JH7 A;  3PX4 A;  4Y2S A;  4PHD A;  1JAL A;  3SV4 A;  3RB0 A;  4O3M A;  5DG8 A;  4EEL A;  5ALI A;  4B6J A;  1Z4O A;  4BWM A;  3SR6 A;  1KBU A;  4FS1 A;  3L5K A;  1KLN A;  1S0M A;  2RDI A;  5AHX A;  1K1S A;  3F5A A;  4KLH A;  1A6S A;  4J9R A;  2NO4 A;  1VDV A;  1RQN A;  3D6J A;  3H8J A;  5J2E A;  2LMR A;  4O3O A;  1FFU A;  5J0W A;  2V4R A;  7ICJ A;  4KLM A;  1SGG A;  4AP9 A;  4UAS A;  2UVW A;  4DCC A;  3JPP A;  1J2N A;  4FZL A;  4C8N A;  1V85 A;  3GIM A;  2EAM A;  2EAO A;  5KG2 A;  2OCE A;  4I2B A;  5ALG A;  3RBE A;  4O3S A;  3PR4 A;  3V6J A;  2LKY A;  1J97 A;  5KFH A;  4AYB F;  9ICP A;  5J2D A;  5EE1 A;  4I2C A;  3RB4 A;  3VCB A;  4BGD A;  8ICK A;  4MFC A;  1NKE A;  3GZF A;  2WF6 A;  3QZ8 A;  4GXJ A;  4KTQ A;  1TKD A;  2XVT A;  4K4I A;  4QZG A;  4RT3 A;  2FMP A;  1HIW A;  4YQW A;  8ICN A;  4UB6 U;  3MDA A;  4JUZ A;  4ED7 A;  5DQI A;  2H3I A;  3RTV A;  4I2J A;  3HX0 A;  3WK6 A;  4HAI A;  4NJ8 A;  4O0I A;  3SZ2 A;  4ECS A;  2E1E A;  5KG0 A;  3AN1 A;  4P4M A;  4IR9 A;  1B0X A;  1NKB A;  4NM1 A;  1MSW D;  4F4K A;  3RJJ A;  4ELU A;  5AM3 A;  4WJ3 B;  2M9N A;  3VC8 A;  1URJ A;  5JUM A;  4PPX A;  4GXI A;  4IQU A;  3KZX A;  3S6J A;  7ICH A;  1NJW A;  3NVV A;  1ARO P;  4JB3 A;  5ALK A;  2GLE A;  1B4F A;  3HJE A;  2R18 A;  2A1J B;  2H3Z A;  1ZQW A;  4ELT A;  5T14 A;  4AYB C;  3ZI4 A;  5ALO A;  3N7R C;  3K1Z A;  4YFK A;  4QZD A;  3PSF A;  5ALW A;  3T5L A;  4KLQ A;  2VAN A;  4U7C A;  5KFJ A;  3E0F A;  4PH5 A;  1QLN A;  4PGY A;  1TK8 A;  5AI8 A;  4DSK A;  4C8O A;  5AIA A;  4KLI A;  3RRH A;  8ICV A;  5AM0 A;  5J0O A;  1QH9 A;  2ZUC A;  5KFU A;  5KFZ A;  5KFO A;  9ICS A;  4GC7 A;  4XUS A;  1U48 A;  4RU9 A;  4ECT A;  3C5G A;  8ICZ A;  4ECU A;  4KN7 A;  1KTQ A;  4P0Q A;  4BUG A;  3QUB A;  5J0R A;  5J0Y A;  2E8P A;  3PML A;  2XY7 A;  1HJP A;  4IQW A;  5CRX A;  2PXI A;  5L1K A;  2IMW P;  3HKZ F;  5BOM A;  2G08 A;  4ACO A;  8ICL A;  7ICM A;  4LJX A;  4DL6 A;  1U49 A;  5DGB A;  3ZDC A;  1ZD3 A;  1S8O A;  2DUY A;  1V97 A;  3D2S A;  2W03 A;  2WF8 A;  1SL1 A;  1ZQZ A;  4ED6 A;  4FE3 A;  4Y2Y A;  4UQG A;  4DSF A;  3RFA A;  1WWV A;  4LVS A;  2HOI A;  2JXJ A;  2DQN B;  5AKL A;  4DL2 A;  2E8N A;  2NRW A;  4GLX A;  3EW9 A;  4YD2 A;  2R8K A;  1YZ6 A;  5ALD A;  2A3V A;  2ZIX A;  3NAS A;  4KLL A;  3B0X A;  1WYG A;  2E3T A;  5ALE A;  5AKI A;  4F8R A;  2K4H A;  1KDH A;  3M9M B;  1SL0 A;  2KSO A;  4M9J A;  1BVS A;  1RG6 A;  4NM2 A;  3OSN A;  3LDA A;  5J0S A;  4TUR A;  2KD1 A;  2M0N A;  5AK3 A;  1BNP A;  4DFK A;  1N5W A;  3F5E A;  7ICO A;  3PW4 A;  4EX6 A;  2P6R A;  2W9A A;  4RPX A;  3HKZ C;  9ICJ A;  1A0P A;  4RNN A;  5J2H A;  3MGH A;  1U9L A;  2KVS A;  3OTQ A;  4I2H A;  5KG4 A;  4B9L A;  2ODG A;  2K4P A;  2B0C A;  4GC6 A;  2OYY A;  5CJ7 A;  1NK6 A;  2AXT U;  4DL4 A;  4U6P A;  4ECZ A;  5AI6 A;  1ZYQ A;  1KRP A;  1NZP A;  4JWM A;  4F5R A;  2GH1 A;  1UT8 A;  1L5U A;  4M9G A;  1SZH A;  2AH5 A;  4HYK A;  4FZN A;  4DQP A;  4YVZ A;  2FI1 A;  4ECW A;  1LB2 B;  2HMX A;  2KK0 A;  3G6Y A;  2Y9T A;  4KIT B;  1F0M A;  4DOA A;  3T5J A;  3BZC A;  4NLZ A;  1CUK A;  5KG7 A;  1N56 A;  1HUZ A;  2K4I A;  5BPC A;  3F2C A;  3OHA A;  1X40 A;  1YT3 A;  2G09 A;  5EE3 A;  2H3Q A;  4X5V A;  2DGZ A;  3RBD A;  3AM9 A;  1UT5 A;  4Y2Q A;  3NS1 A;  3FDS A;  4DQQ A;  4QZI A;  1NJY A;  2F8K A;  4P0P A;  2ES6 A;  2JEI A;  4F5P A;  1JMS A;  3UPQ A;  1PVR A;  1L3S A;  2YB1 A;  3QEA Z;  5KT5 A;  4EZ9 A;  1UA1 A;  2F1H A;  3I76 A;  2W9C A;  4DLG A;  2JV3 A;  5FP0 A;  5GTI U;  3UXN A;  2A19 A;  2FLL A;  3BJY A;  9ICX A;  5KFY A;  5KFC A;  4Z6D A;  4C7Y A;  3NGD A;  3K75 D;  4US8 A;  1SKW A;  4F92 B;  4YD1 A;  2DF4 B;  1QSL A;  2KJ5 A;  1KQQ A;  4PHE A;  2LBO A;  2ZJA A;  3M1Y A;  3TAD C;  2AQ0 A;  1PK1 A;  3IRU A;  2G07 A;  3OHB A;  1VLB A;  2KE7 A;  3MFI A;  3IHQ B;  1BPX A;  3WKB A;  1ZQL A;  1CEZ A;  7ICU A;  2CPR A;  4BXO B;  4KLT A;  4I28 A;  3EWA A;  1L7P A;  2HBM A;  3KFU F;  5AM5 A;  1T3N A;  2BPG A;  1JX4 A;  3ORY A;  9ICR A;  2ISO A;  4QJF B;  2MAX A;  2BDU A;  2AU0 A;  5DB9 A;  1T3Q A;  2DL0 A;  2JMG A;  1IV8 A;  3V7J A;  3RF9 A;  1KL9 A;  5D49 A;  1LV5 A;  1L3U A;  5JU5 A;  1QSS A;  1NK7 A;  4I29 A;  3TI0 A;  4OJO A;  3LVW A;  4YXM A;  2HHS A;  3MDC A;  1ZQ1 C;  1N63 A;  2VA2 A;  5GTH U;  3WKD A;  4C0Z A;  2ESE A;  1NK0 A;  2YMQ A;  2FLN A;  3NTU A;  3TAQ A;  4NLG A;  3ISD A;  5DQH A;  5KAI U;  4C8L A;  1TK5 A;  9ICM A;  3PST A;  1KEJ A;  4NV0 A;  4QWE A;  2BGW A;  8ICE A;  3F2D A;  2IHM A;  1P7D A;  4KLE A;  3R9K A;  7ICN A;  1BPZ A;  5ALL A;  4J9S A;  2DWQ A;  4MF2 A;  4C8M A;  3TKA A;  4LZG A;  3DEE A;  3UMB A;  1SIJ A;  8ICG A;  4PL2 A;  3PW2 A;  4MEY A;  2C2R A;  3BQ0 A;  5HR7 A;  2YTU A;  4UAT A;  5IIJ A;  3ZDD A;  4C8K A;  3MR6 A;  4EX7 A;  2OXO A;  4JK1 A;  4KLD A;  3BS5 B;  3QNM A;  5EE9 A;  3Q8M A;  3FAH A;  1ZQR A;  1KW4 A;  2YX8 A;  3JPS A;  3H0R B;  1C20 A;  2HVH A;  4ECR A;  1NZB A;  2J6U A;  1SXD A;  4F50 A;  3ETL A;  2P35 A;  4UBC A;  2XIC A;  2R8I A;  2VKQ A;  1PK3 A;  1Z00 B;  5EWE A;  7ICF A;  4R8U B;  3HWT A;  4RQM A;  5B66 U;  3C5F A;  4RUA A;  2FDR A;  1N2X A;  2BR0 A;  4DS4 A;  3EPG A;  3HPO A;  1ZQP A;  2KIC A;  3TAC B;  2MUT B;  4YMO A;  2YQE A;  5J8Y A;  3C2M A;  2A1J A;  5AKJ A;  3SV3 A;  5AKK A;  5ALR A;  2HCF A;  2W9M A;  5KFR A;  3N97 B;  5J0X A;  1A77 A;  2W9B A;  4O5K A;  1XNS A;  7ICP A;  1MA7 A;  3LK9 A;  1UCV A;  3TFR A;  4YN4 A;  7ICI A;  4EEY A;  3LWL A;  1X42 A;  2JEF A;  4QNL A;  4B9T A;  4CF3 A;  3V7K A;  5KFN A;  3ONN A;  5KG6 A;  1X9W A;  5IIO A;  1L3T A;  4FBU A;  3C28 A;  9ICV A;  4DQR A;  1PZN A;  1ZQF A;  4J03 A;  4ICA A;  2W3S A;  2AGQ A;  4Q43 A;  5CB1 A;  5KT6 A;  3RJK A;  5ALT A;  1DK3 A;  2XY6 A;  2KG5 A;  5ALN A;  5C0Y A;  4IL6 U;  2K4E A;  2W11 A;  2KFZ A;  3QU5 A;  3HW8 A;  5F9L A;  3RB3 A;  4OJ6 A;  1XSP A;  2KP7 A;  5ALJ A;  3FYH A;  4UAY A;  1IXR A;  2ASD A;  4C4R A;  5ALM A;  4B9V A;  2WF5 A;  3RB6 A;  8ICB A;  3PR5 B;  1IM4 A;  2G0A A;  5KAF U;  3A0H U;  3EYZ A;  4IRK A;  5D4B A;  2P6U A;  7ICR A;  2Y1I A;  3EPI A;  2LM1 A;  3T5H A;  2WHE A;  2VA3 A;  3LWM A;  2F3N A;  2ZIW B;  9ICN A;  1T8E A;  4DFP A;  3H4B A;  3RJE A;  4F4Y A;  1NJX A;  2E5S A;  3CP8 A;  1S9F A;  1J2M A;  5KFE A;  8ICF A;  2XID A;  5AM1 A;  3QE9 Y;  5J0P A;  2FLP A;  4I27 A;  4DL3 A;  5IIM A;  3RH5 A;  4F5N A;  2D3D A;  3CW2 C;  2JR5 A;  2ZJ5 A;  3T3F A;  3C1Z A;  2GWS A;  4M9N A;  5F3X B;  1ECW A;  3RH4 A;  3PMN A;  5JTI A;  2RLT A;  2Q4T A;  2W04 A;  1DOQ A;  3OSP A;  2I6X A;  2WF7 A;  1S0V A;  4QZ8 A;  2NRT A;  4ED8 A;  4K4H A;  4K4G A;  3M7D A;  2ZIU B;  4QIW F;  1S0O A;  3RH6 A;  4DO9 A;  3OGU A;  8ICT A;  3KHH A;  3Q8Q B;  4I2G A;  4CNQ A;  1XO0 A;  3FM9 A;  2LYB A;  1LKY A;  3MGI A;  1WUD A;  3HRD D;  2WB1 F;  3LYS A;  1L8O A;  2VIX A;  2KOB A;  3WU2 U;  5BOL A;  4IQV A;  3AUO A;  1L6N A;  4EBE A;  9ICH A;  4OJP A;  3WKC A;  4QWD A;  4KLG A;  3WKA A;  5B5E U;  1NKC A;  1DXS A;  2ZIV A;  3KBB A;  4NLN A;  1XS9 D;  3O0F A;  2ZTD A;  2PFO A;  2FPK A;  3I1Y A;  3M8S A;  5III A;  2QAR A;  1QQ7 A;  3I28 A;  4DL7 A;  3GDX A;  1DGS A;  2C28 A;  4F4X A;  5L1M A;  4Y2T A;  2PFQ A;  2XI9 A;  4NY8 A;  1Z4N A;  1XSL A;  3MR2 A;  4RQ8 A;  4F93 B;  4KN4 A;  1SV0 A;  2KV2 A;  3G6X A;  2BCR A;  4RQ7 A;  1KFD A;  4TQS A;  1Q46 A;  3RJG A;  2JZB B;  7ICT A;  1WCN A;  2WB1 C;  1X6J A;  2ATL A;  3M6Z A;  1JI7 A;  2LI6 A;  3ZD9 A;  4DL5 A;  4Y2V A;  1Z19 A;  2CN1 A;  4CE6 A;  4MFF A;  3IG8 A;  3M9N B;  2F44 A;  9ICG A;  4R64 A;  1D9F A;  3ETR A;  7ICQ A;  4YCX A;  2MSN A;  3QX7 A;  1CRX A;  2V4Q A;  4QWC A;  5ALP A;  2A1A A;  5DDM A;  5CR0 A;  3PW5 A;  5DQG A;  5ALQ A;  4QZF A;  4QZC A;  2JHD A;  7ICV A;  1NI3 A;  2ZJ8 A;  4PJ0 U;  2KJ9 A;  9ICU A;  4R66 A;  4DFM A;  5IIL A;  4RT2 A;  8ICY A;  3QEB Z;  4PZN A;  5J2B A;  5CP2 A;  1X2I A;  5AKE A;  2JEJ A;  2XCA A;  3KOO A;  3PO4 A;  3GV5 B;  9ICF A;  4IRD A;  2K60 A;  4XRH A;  5AK6 A;  4E0D A;  2KIV A;  1ZQB A;  1UA0 A;  1L7O A;  4PL1 A;  4UB8 U;  1Q3U A;  1RPL A;  2F77 X;  2BDP A;  1NK5 A;  1T94 A;  1ZQY A;  4I2A A;  4MHV A;  5HHI A;  5KG5 A;  5IIK A;  2XC9 A;  3T79 A;  3PVX A;  3TAN A;  5IIN A;  1ZQS A;  4TUS A;  3RR8 A;  3WK4 A;  3SAH A;  4MEX A;  8ICX A;  4F4Z A;  1RXW A;  4FO6 A;  3QU4 A;  5DGA A;  1TAM A;  4UW9 A;  3CNH A;  5AIB A;  4F5Q A;  4TUP A;  4CF4 A;  4O3R A;  2KIW A;  1MQ3 A;  3RR7 A;  3UMC A;  1QSY A;  3V7L A;  3EUB 2;  1ZQE A;  2W7P A;  1DK2 A;  5AM2 A;  1HUO A;  4F71 A;  1B22 A;  3AMZ A;  5H2F U;  4C7Z A;  2BQ3 A;  4NXZ A;  1COK A;  3JPO A;  3ISC A;  3PSI A;  9ICT A;  3SMV A;  2BKE A;  5C5J A;  3RJH A;  2KZ3 A;  4PHP A;  4YP3 A;  2ZXH A;  1PVQ A;  4QZA A;  4YXJ A;  1XC9 A;  2KKP A;  1RYS A;  3B0Y A;  2LYA A;  2D6F C;  3KTQ A;  1U45 A;  5KG3 A;  2BQR A;  5J0Q A;  5AI4 A;  2HHV A;  1JN3 A;  5G5G A;  3BQ1 A;  4DOB A;  1ZOL A;  4EYH B;  2KVC A;  3RJF A;  2G06 A;  3Q8K A;  5EWF A;  1X66 A;  4YR3 A;  1L7M A;  4NL9 A;  8ICJ A;  3U26 A;  2W54 A;  5DLF A;  1GO3 F;  1L8L A;  2R8J A;  4BDP A;  5KFD A;  3KHR A;  7ICG A;  5AI5 A;  1COO A;  3E2E A;  4IS7 A;  3T5K A;  2DKX A;  9ICE A;  4I2D A;  4YR2 A;  1V9P A;  1JXE A; 
#chains in the Genus database with same CATH homology
 2K8A A;  3GZF A;  3F2C A;  4GFJ A;  2G08 A;  4C0Z A;  4ACO A;  2WB1 C;  3NUQ A;  1YT3 A;  2G09 A;  2KNJ A;  2LHT A;  2XVT A;  2Z7J A;  2H3Q A;  1D8B A;  3M6Z A;  2DGZ A;  3IG5 A;  2RRD A;  3D2S A;  2JGA A;  1TAM A;  2MRL A;  2W03 A;  1HIW A;  4P0Q B;  1XNS A;  1ECW A;  1Z19 A;  2CN1 A;  1DRG A;  4NWI A;  1MA7 A;  3SAF A;  2Y0S C;  4FE3 A;  3IG8 A;  2ZIU A;  2HBJ A;  4P0P A;  3PST A;  4JMU A;  4A8E A;  4QIW C;  2KIW A;  2H3I A;  4NV0 A;  3RFA A;  4BX9 C;  4CRX A;  2RHF A;  2VJ5 A;  2Q4T A;  2W04 A;  1PVR A;  2HOI A;  4NLB A;  2YB1 A;  2W7P A;  2DQN B;  3F53 A;  4KX3 A;  2RP5 A;  3F2D A;  1CRX A;  1P7D A;  3H0L B;  2E1E A;  5C0Y A;  4QNL A;  1IIP A;  3H0M B;  2CRX A;  3AQF A;  1Q3V A;  3ONN A;  4OO1 J;  4KX5 A;  4WJ3 B;  2A3V A;  2JHD A;  2NV3 A;  2ZIX A;  3M6K A;  2ZIU B;  3M7D A;  4QIW F;  3VC8 A;  3C28 A;  2OH2 A;  2W7O A;  1URJ A;  3DEE A;  3LVV A;  3PSI A;  2K8B B;  2KJ9 A;  2K4H A;  4KMO B;  4PL2 A;  3KZX A;  2ZIW A;  3SMV A;  2JH7 A;  2YB4 A;  3PSP A;  1XO0 A;  4ICA A;  5HR7 A;  2OM6 A;  2LYB A;  2ZXH A;  2G5I B;  1F44 A;  2JH1 A;  2PMZ C;  2DF4 B;  2R18 A;  2KKV A;  2KJ5 A;  2H3Z A;  3SAG A;  1WUD A;  2N1R A;  3D2N A;  1PVQ A;  2LBO A;  2OXO A;  2WB1 F;  3ALR A;  3LYS A;  4OJ5 A;  5T14 A;  4O3M A;  2KKP A;  2KD1 A;  2M0N A;  2VIX A;  2KOB A;  4AYB C;  2VJ4 A;  2G07 A;  3F5E A;  2LYA A;  3L3F X;  2D6F C;  1UPH A;  1KBU A;  2K4E A;  1L6N A;  2F8L A;  2HOF A;  3N7R C;  3HKZ C;  3PZP A;  2Y0S F;  2HBK A;  3K1Z A;  4FZM A;  4BJQ A;  4CGZ A;  1A0P A;  2YX8 A;  5KL1 B;  1HEK A;  3F5A A;  4OJ6 A;  4OJP A;  1A6S A;  3GU3 A;  2CPR A;  4P0P B;  3H0R B;  2KVC A;  5A0L A;  3C29 A;  3PSF A;  1PVP A;  2G06 A;  2MA1 A;  2H3V A;  2E1F A;  1NZB A;  4PL1 A;  2ZIV A;  2G0A A;  4U7C A;  1Q3U A;  2OYY A;  2HBM A;  3KFU F;  2WAQ C;  5KL8 B;  5HR6 A;  3D2Q A;  2F77 X;  3E0F A;  3O0F A;  3MGV A;  3AQE A;  3AL0 B;  1T94 A;  2ZXI A;  2XIC A;  2HBL A;  4U6P A;  2F76 X;  2HOQ A;  2KEY A;  2VKQ A;  2GH1 A;  2KJ8 A;  1GO3 F;  2ZIX B;  3NRW A;  3IN5 A;  3CRX A;  1SZH A;  3OPX A;  4QJF B;  3N7S C;  2BDU A;  3IP4 B;  2G5H B;  4IC9 A;  1ED1 A;  4FZL A;  2ZG6 A;  2JMG A;  3T79 A;  2ZIW B;  4FZN A;  2ZIV B;  2XI9 A;  3ICX A;  3RF9 A;  1OUQ A;  4OJL A;  2WAQ F;  2PMZ F;  3CYM A;  3N7P D;  2HMX A;  3F2B A;  4P0Q A;  2GOL A;  2LKY A;  4BUG A;  2E5S A;  3SQI A;  3CP8 A;  4CDG A;  2H3F A;  3SAH A;  2KV2 A;  4OJO A;  3LVW A;  4AYB F;  2K89 A;  2XID A;  1Z1B A;  2K8C B;  1ZQ1 C;  5CRX A;  2KIC A;  2KHV A;  3VCB A;  4NLC A;  2F2A B;  3HKZ F;  2KHQ A;  2K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...