3HILA

Sam domain of human ephrin type-a receptor 1 (epha1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
b'GIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 1
publication title SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1).
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3hilA00
1DXSA 2GLEA 3TACB 2ESEA 2K4PA 1OW5A 1RG6A 1Z1VA 2ES6A 2DL0A 3K1RB 1WWUA 1COKA 2DKXA 2EANA 5F3XB 1X40A 3KKAC 4NJ8A 2Y9TA 1KW4A 2E8MA 2LPEA 2LMRA 2FE9A 1LKYA 1SXDA 2QARB 2KMDA 2KG5A 1PK1A 1JI7A 2YTUA 4RQNA 4PZNA 1X66A 1V85A 3BS7A 2D8CA 3TADA 3H8MA 4NL9A 2EAOA 3BS5B 2E8PA 1PK3A 1OXJA 2B6GA 2QKQA 1WWVA 2F3NA 1SXEA 2QB0B 2E8OA 5L1MA 5JTIA 2F44A 1SV0A 1B4FA 1F0MA 5JU5A 1SV0C 2K60A 2QB0A 1SV4A 2D3DA 2QARA 1X9XA 2DKZA 3TADC 4RQMA 2Y9UA 5KNIA 4IS7A 1SGGA 4NL9C 2KE7A 2JV3A 2EAPA 2KSOB 1UCVA 3BQ7A 3BS5A 5J8YA 1V38A 3SEIA 5JRTA 2KIVA 1UQVA 2EAMA 2QB1A 5J8YC 1B0XA 4PZOA 3KKAA 3HILA 4MHVA 3SENA 2L5YA 1LKYB 2KSOA 3IDWA 2F8KA 2E8NA 1PK1B
chains in the Genus database with same CATH superfamily
4Z6EA 3Q8SB 4NLCA 4UB5A 2AGOA 2ESEA 9ICWA 2HHXA 9ICCA 1J2MA 3Q8KA 5AM4A 5C0YA 4CDGA 2ES6A 1TFRA 1L5UA 5ALYA 4UBBA 4O5EA 4JWNA 3AU2A 2G08A 2HSZA 2YB4A 3B9JA 4RNNA 2W9AA 1NZBA 2NRZA 1PUZA 5DB8A 2JZBA 1FFUA 3BQ2A 5HR6A 4I2BA 3KKAC 1UT5A 2KMDA 1BPDA 1AQ6A 4GXIA 3M1YA 4F4WA 1XSNA 4C0ZA 5ALTA 5AM1A 2E1FA 3C2KA 4C7YA 4OJOA 2IHMA 4UB3A 3JPOA 2ZUBA 5EE3A 4GLXA 4FO6A 1U47A 1WWVA 4P4PA 4KLGA 5KFYA 4C4TA 4IQTA 4I2CA 1RYUA 2JR5A 8ICMA 5KT6A 2V4QA 2AH5A 9ICUA 5KFBA 3FDSA 2LYBA 1LB2B 4DQPA 4IQWA 4RQ7A 3GU3A 3E0FA 5IIKA 3WKDA 5CP2A 3CRXA 5ALEA 2WTFA 4ICAA 1RM6C 4QZIA 2BCUA 3RAQA 4FZMA 9ICJA 4UBCA 4DCCA 2R8HA 1Q3UA 3F53A 4MEYA 4EYHB 8ICNA 3EZ5A 1JROA 4O5CA 5IIOA 2KFZA 1FIQA 4ACOA 4YCXA 1NJXA 4M9GA 3DDHA 3QXGA 5BPCA 4GC6A 8ICJA 1ZRMA 2HBLA 4QZBA 4F4ZA 3PW2A 2KTQA 2HI0A 4XQ8A 4NM1A 3F2CA 4DF8A 1M6YA 2WB1C 3FAHA 3PZPA 2BZFA 1WG8A 1ZD2P 3EPGA 4ED1A 3PSTA 2A3VA 4OCZA 1ECWA 3PR5B 1ZQFA 4AP9A 1QSSA 1NK4A 5AI0A 5DDMA 1KLNA 4ED2A 1NK0A 3MABA 4P4OA 1ZYQA 1ZQEA 2MU2A 2KD1A 4YVZA 5KFQA 4QNLA 5DKWA 2XIDA 4KMUA 3G6XA 5AI5A 4KITB 2VIXA 1UHUA 3TAPA 2HOQA 3A0HU 4F5QA 2EAOA 3AQFA 2B6GA 1SL2A 2AJQA 2A19A 2KZZA 2F3NA 4XUSA 4FS2A 1Q3VA 5ALMA 2K89A 5ALKA 4MFFA 5JTIA 5ALRA 3SYZA 4KLIA 1RYSA 2G0AA 5KFXA 3HPOA 4RU9A 7ICPA 2VA3A 2J6SA 2HBMA 2FMSA 4I2GA 5KAFU 3N7SC 3PSPA 1QSYA 7ICVA 3RTVA 2P6RA 2HHWA 1NJWA 5KNIA 4IS7A 1ZQKA 4NL9C 4LVSA 9ICIA 2EAPA 2ZIVB 1X9WA 3J81j 1T3NA 5J8YA 5AI9A 1RDFA 2W3RA 4KLMA 5J8YC 4PZOA 4CE6A 5KFPA 5KL8B 2L5YA 2RLTA 4OJ6A 4C4RA 1IM4A 3BDPA 1N5XA 3KHLA 4P0PB 1YT3A 4ED0A 4M9LA 5EWEA 7ICLA 1YZ6A 2Q4TA 2KFNA 2J6TA 3Q8MA 1V97A 2A1JB 5KFSA 1BPZA 4YXMA 1COOA 1WWUA 2ZTDA 4ECRA 2R8IA 4K4GA 4EBCA 2ZIVA 5DBBA 2G5IB 4I2IA 1ZQAA 1RQLA 8ICWA 3C1ZA 5TZVA 1SKRA 4EZ6A 1U9LA 2E8MA 1KL9A 2LMRA 3MFIA 2N1RA 3QU5A 4IQUA 4C8LA 4UAYA 1L8OA 2IOFK 3KBBA 8ICOA 4RPZA 4UATA 2AQ0A 5KFAA 4Q44A 3NVVA 3ISDA 4DFKA 3BS5B 3C5FA 4ED6A 2FLPA 4TUQA 5HMLA 1N2XA 1WUDA 3LYSA 3QX7A 1LVHA 2F44A 4Y2XA 1X2IA 2QLTA 5J2AA 4Y2QA 4Y2TA 5IIJA 2LM4A 4RPXA 3Q8LA 3T3FA 4OJLA 1N62A 3PR4A 1S10A 4FE3A 1X6IA 3CW2C 3WKAA 1X9XA 2A1AA 2DFLA 3CYMA 5CA7A 4ECQA 4YD2A 4IQVA 9ICLA 2PI5A 3QEAZ 2EDUA 2K8CB 1UA1A 5ALJA 4KLOA 1TKDA 3BS5A 1ZQLA 4QJFB 2RDIA 3QU2A 4DSJA 4YR2A 2W8KA 4U7CA 5ALVA 4KLFA 4MHVA 1LKYB 3GIMA 1T8EA 1TAMA 2P35A 1PK1B 2NO4A 1U4BA 3T5KA 1AROP 4I2AA 7ICSA 3N28A 1Z1VA 2VKQA 2F2AB 4BWJA 1MQ2A 4J9LA 1ZETA 5J0WA 1N48A 1SWVA 2W9BB 2JH7A 3F2BA 2NV3A 1BNOA 2JEJA 4KLHA 3AU6A 2FLLA 2UVRA 2HMXA 2BCSA 2W9CB 2F1JA 9ICKA 1RXVA 1JRPA 4BXOB 4R64A 5KT4A 3O0FA 4ED7A 2JGAA 1LKYA 1BPXA 1UT8A 2KJ9A 5DB9A 1PK1A 1ZQWA 1TK8A 5GTIU 3QU9A 2KP7A 3G6YA 2HHTA 3PSIA 5J0UA 3RJIA 4JV0A 5HP4A 2AGPA 2BCVA 3MR3A 1TK0A 3HKZF 4USAA 4DQQA 3UPQA 4Q45A 4RQ5A 4Q8EA 1UA0A 4JK1A 9ICHA 4UARA 3MC1A 1S0NA 4QWCA 1SZHA 3GIIA 5KFHA 2W9CA 3MGVA 1F0MA 5KT7A 5KFEA 3UMCA 5K4LA 3ISCA 4DOAA 1L3SA 2KN7A 4GXJA 4R8UA 4I2EA 4F50A 3RJJA 1KBUA 3I1YA 3K4GA 5EE1A 2W03A 4ECXA 4PHPA 4Z6CA 5C5JA 2J6UA 2H3VA 2ALZA 3BZCA 3PX0A 2V4RA 4BWMA 1B0XA 1NJZA 3JPTA 5J2DA 2WF7A 4DFPA 3SD7A 3M7DA 8ICSA 2K8BB 3RB0A 3HJEA 3RB3A 1X9SA 2KVCA 4KLSA 1X9MA 2PMZF 2I9GA 3L3FX 4G9BA 2K4PA 3C2MA 2MAXA 5KG2A 1KQQA 2ZUCA 2ZTCA 4ED8A 5DQIA 2IBKA 4O3SA 2VA2A 4YQWA 3RH4A 2LYHA 2W54A 2KZ3A 5KT2A 2FI1A 1XC9A 1WCLA 4X5VA 4CF4A 2XGPA 3AUOA 3BQTA 3M8SA 2EANA 1BPEA 3CP8A 4KLDA 3IV6A 1T4GA 4DEZA 2Q0ZX 3HP6A 1JALA 5AK4A 3C29A 1L3VA 2PI4A 2Z7JA 4F91B 2MRLA 1ZD4A 3UM9A 5ALWA 4Y2UA 4TUPA 4PZNA 1X66A 4ECUA 1D9FA 4YR0A 1S9FA 4NLKA 2PFQA 3WK5A 3KHGA 1NK6A 1ZQTA 5DQGA 4QZAA 2QB0B 3N7RC 1SV0A 4EEKA 3RF9A 3PV8A 1L7NA 2KKPA 1SV0C 4Z6FA 2EZYA 5DG8A 4UB8U 4F5NA 1KDHA 1NJYA 5KFIA 3VC8A 2VJ5A 9ICAA 2NO5A 1ZD5A 4PHEA 1TV9A 4YR3A 2ASJA 4DFMA 3K1ZA 2YB1A 3T5LA 5ALQA 2QB1A 3H8WA 4ECZA 2I1QA 2RRDA 5J29A 4KLQA 1ZJNA 1N5WA 5DDYA 3N97B 2IMWP 3E58A 5B5EU 4EX6A 1J2NA 1JUDA 4QW9A 5ALIA 2MSNA 3JPRA 2OHFA 2HVIA 2B0CA 5KG7A 5L1KA 2VA8A 4I2JA 2BPFA 2GOLA 2BQUA 1SB3C 1COKA 3WK7A 3KD3A 5CEHA 3NRZA 2FLNA 4ECYA 3QNMA 4OD0A 4C8NA 4B9SA 5F9LA 4IRCA 4BGDA 3OHBA 3WU2U 2UVVA 2FE9A 5EE9A 5IINA 1TAQA 2M9NA 1CRXA 2FDRA 4YMOA 4YN4A 3N4MB 4RQNA 1KKXA 1T7PA 1WYGA 2AGQA 3BS7A 4I29A 3TADA 3ZDCA 2UVUA 3PVXA 1U45A 2R18A 3D2NA 3GV8B 7ICRA 4DS4A 5KG1A 2GWSA 2ZJ5A 3EW9A 4ECSA 5D4BA 4DL4A 5KG6A 4C8KA 1S8OA 1VLBA 4C8OA 1ZQUA 3THVA 4YMNA 1NOMA 2Y0SF 3ZDBA 1B4FA 1KRPA 1ZRNA 2EQYA 3ETLA 1BPYA 1Z4OA 1L7MA 5J0YA 3OJSA 4DWIA 2IHNA 3M8RA 2G5HB 2IOHA 4YD1A 4MF8A 3ED5A 5ALDA 5AI8A 2HCFA 2XCAA 2WF6A 2R8KA 2KIVA 4DLEA 2EAMA 2W7OA 1QQ7A 2KJ5A 2BQRA 2ZJAA 3H0MB 4I2DA 3OSPA 3QE9Y 2AXTU 3RJEA 5HHIA 7ICKA 4JV2A 4KLTA 8ICQA 4CGZA 5AI6A 2NRXA 1O08A 5CB1A 7ICIA 4KN7A 1ZQZA 3C23A 2MUTB 1T94A 5AICA 3QZ7A 1Z4NA 4QWDA 2W3SA 3L4PA 5FP0A 3ICXA 4DO9A 3HKZC 4J9RA 4DSFA 4CCHA 3QU4A 9ICSA 4NLNA 3H8JA 4EELA 4CF5A 1L3TA 5ALZA 4EBEA 3IM1A 3C21A 4RUCA 2OM6A 4LZDA 4F72A 1SL1A 3PW7A 4F2SA 2MUTA 4F3OA 1VJ5A 3V7JA 4YMMA 4DL3A 1S0VA 4DL2A 1SKWA 2DF4B 5DLGA 9ICTA 4NM2A 5J0QA 5AIAA 4DQIA 1OUQA 4Y2SA 2PMZC 2KOBA 2WAQF 2AU0A 7ICMA 4R65A 9ICEA 4M47A 3HILA 2BQ3A 4UQGA 1S97A 2KIWA 3E2EA 4O3MA 3LDAA 2DPIA 4F92B 2GH1A 3ETRA 1TE2A 2LBOA 3RJGA 4LZGA 3IRUA 3RBEA 2G06A 3L5KA 2FPKA 4AYBF 1F44A 2BPCA 5L9XA 3AEVA 2H5XA 5KG0A 7ICHA 2EH9A 1JIHA 2F8LA 1ZQQA 4KX5A 2NYVA 2PKEA 4NJ8A 3FC4A 5AKLA 3TFRA 4Y2VA 3EYZA 3PMNA 4ELUA 4KX3A 4MFAA 3C28A 3TQ1A 3T5JA 5B66U 1ZD3A 4NXZA 2EZXA 2FPLA 3GILA 1MQ3A 1RQNA 9ICXA 3NGDA 1ZQOA 2XI9A 1ZQPA 3FYHA 3PW4A 2BDPA 1RZTA 2AHOB 1KEJA 1CI4A 1FO4A 1ZOLA 7ICUA 3SI8A 4PGYA 1S0MA 4UAZA 2RP5A 5ALXA 1Q46A 5KFRA 4E0DA 1ZQCA 1JMSA 4HYKA 4GXKA 8ICUA 5JU5A 3WKCA 1Z1BA 1Z00B 1CUKA 4EBDA 3G6VA 3S6JA 4KTQA 4RQ4A 3SAGA 8ICFA 2WF5A 3UMBA 3M9OB 1ZQSA 2H3FA 4IR9A 3MR5A 3SR6A 1SGGA 5KFKA 4QIWF 5CJ7A 4IRKA 1NNLA 4B9LA 7ICGA 3SEIA 2RQ5A 4QZGA 5J0PA 5DG7A 4G3IA 2OYYA 2HDOA 2V9WA 1ZQDA 4A8EA 4J9KA 1Z00A 3RAXA 2FMPA 3OGUA 2XICA 5KFMA 2W9MA 1MA7A 2OH2A 8ICLA 4P0QA 5G5HA 7ICNA 4CF3A 3SAFA 3PX4A 8ICAA 2VJ4A 1ED1A 5DBCA 2LPEA 2ISOA 9ICGA 2KICA 5ALHA 3AN1A 3HT3A 2F1HA 2YMLA 2KG5A 1JI7A 1KFDA 2KNJA 1K1SA 4F93B 2Y0SC 7ICTA 3ISBA 4BX9C 2PFOA 5BOLA 4J9QA 5AM0A 3NRWA 3V72A 2QKQA 3TAQA 2E5SA 3GFKB 5CHGA 1ZQNA 3H0RB 4JV1A 4O3OA 3TI0A 4O3RA 3H8SA 3AL0B 3RJHA 4R8UB 3PMLA 1DGSA 3BQ0A 2KK0A 2ZJ8A 4J03A 3K75D 3OSNA 1Z19A 2HOIA 2NRVA 3EUB2 4F2RA 1JX4A 3V7KA 3M6ZA 1N63A 5AK5A 5HR7A 1ZQMA 2BKEA 4O9MA 2FJ6A 2C22A 4QZFA 2IOFA 4GIBA 4B9NA 4ECTA 3WK8A 3ZI4A 3OJUA 3MBYA 2KSOA 2E8NA 2HHVA 4F5RA 5AHXA 3B0YA 1XO0A 4FS1A 5ALFA 3C2LA 4ED3A 2D6FC 2XCPA 5KAIU 3D2SA 3IG8A 3UXPA 3IG5A 8ICKA 3AQEA 3N7PD 1X40A 5DLFA 8ICBA 2W55A 4B9UA 2IA6A 2DUYA 3AMZA 2H3ZA 2JXJA 1SXDA 2YMMA 4KLLA 2YTUA 5AM2A 4UAVA 3IP4B 3T5HA 4PGQA 1BNPA 2D8CA 4DLGA 2DBYA 5GTHU 1PK3A 3RB4A 1NK9A 4QZCA 4JB3A 5KG5A 4KMOB 3QZ8A 3RRGA 3H40A 4RQ6A 3KOOA 4JWMA 1O03A 3PW0A 4TUSA 1DGJA 5G5GA 3H4DA 2GO7A 3H4BA 2K60A 2C2DA 3GV5B 2W04A 2WAQC 3T79A 4MEXA 5TISU 3LWLA 4DL6A 4C8MA 4P2HA 2DKZA 3LVWA 2XGQA 1IIPA 4O3NA 4BDPA 2MA1A 2K8AA 2I6XA 3UXOA 3LVVA 2ASDA 3MFHA 5ALLA 2C2EA 1TVAA 1N56A 5CR0A 5KFLA 4EEYA 1QSLA 3HRDD 2PFNA 1HUZA 5AKGA 4F8RA 3SENA 3IDWA 4AYBC 5L1IA 5AKEA 4M9NA 4RNMA 2WHEA 5AK3A 1HEKA 5KFOA 4FZLA 2OWOA 4NLGA 2KZMA 1OW5A 2BR0A 1DRGA 1RG6A 4UAWA 5J0SA 4TQSA 3KZIU 4F5PA 1NKBA 2DL0A 5ALGA 1XSLA 2K4IA 5AKYA 5AKXA 1QCKA 8ICTA 3KZXA 1PVRA 2NRWA 3NASA 4QZEA 2Y9TA 2F76X 4US9A 1GO3F 1C20A 4PL1A 1QTMA 3NVYA 1LV5A 1PVQA 4RT2A 4JUZA 3GV7B 2HBKA 4ZOHC 5J2EA 3ZD9A 3NS1A 1RPLA 3H8MA 3H0LB 2PXIA 1L3UA 3MR6A 5AKKA 1IV8A 1NKEA 2OEHA 1NZPA 4GC7A 3V6HA 4QIWC 2ZIXA 1L8LA 4QW8A 4DSIA 5KT5A 5J2HA 1XO1A 5KFDA 1SIJA 2DGZA 4F4KA 3TADC 1KSPA 4RQ0A 2FMQA 4CRXA 4Y2JA 5J2BA 2UVWA 2ZTEA 2YQEA 2R8GA 9ICPA 1A76A 2BGWA 4I28A 3KKAA 1BGXT 5KFCA 5DQHA 3D2QA 2EZZA 5IIIA 4UB1A 4R66A 2HVHA 5KFVA 2KV2A 9ICMA 5J2FA 1K5OA 4F4XA 1EXNA 3TFSA 1ZQBA 3NUQA 2R8JA 4ECVA 1WCNA 1Z3EB 5ALOA 2HBJA 4NY8A 2DKXA 3WK4A 2P6UA 1IXRA 2Y1IA 2ZUDA 4I2FA 3TKAA 5L1LA 3WK6A 2JMGA 5J2CA 3DEEA 1S0OA 2KHVA 3EPIA 4DSEA 3RR8A 4ELVA 1A0PA 2I5HA 5KTQA 5AKIA 3MGHA 1S76D 4EENA 2XC9A 5KFUA 1V85A 4O3PA 3F5AA 3IHQB 5J0XA 2DPJA 5BOMA 4KLJA 1L7PA 2E1EA 1C7YA 3SQIA 5ALSA 3EWAA 4DL5A 1K1QA 1D9DA 5DGAA 4DSLA 1SL0A 2YMPA 3UQ0A 2E8OA 1L6NA 2K4HA 4KLUA 5J2IA 3GIJA 5T14A 4UB4A 3ZDEA 2ZIUB 4Q8FA 1ZQYA 1P7DA 2CXYA 4EZ9A 4GFJA 2ATLA 4TQRA 4F4YA 1URJA 4PJ0U 5DB6A 4Z6DA 5HHHA 1D8YA 7ICFA 3BQ1A 1CEZA 1HUOA 4J9PA 1ZQXA 3KHHA 1V9PA 1V38A 1YZ7A 4FZNA 3VCBA 2JHDA 5KG4A 1Y88A 5EE0A 5EWGA 3U26A 2ZIUA 4DSKA 3FM9A 1B43A 3WK9A 1ZQHA 2K4EA 2RHFA 9ICVA 3PSFA 1X42A 1A77A 4R63A 1QH9A 3K1RB 2ZXHA 1N60A 3WKBA 4J9MA 4IRDA 5ALPA 5KFTA 2H3IA 5KG3A 5AKJA 5J0RA 4UB6U 7ICQA 2XY7A 4QZDA 4EYIB 2CPRA 5DGBA 4DQSA 2RDJA 1L7OA 4IL6U 4UAUA 1J97A 3QEBZ 2OCEA 4RQ3A 8ICHA 4J9OA 3I28A 5KFGA 4QZHA 1KTQA 3NVZA 4NL9A 1SKSA 1XNSA 4DS5A 2XY5A 4DF4A 4KLEA 2WF9A 4FBUA 3RH6A 1JXLA 2ISPA 3ALRA 4P4MA 2LM1A 1PVPA 5IIMA 3RB6A 1DK3A 2JRZA 1KFTA 2KJ8A 3V7LA 1JXEA 2Y1JA 4K4HA 4DL7A 1S77D 1XWLA 8ICRA 5DG9A 4M9HA 1PZNA 3DV9A 3Q8RB 4RQ2A 2JV3A 4DFDA 2P66A 4US8A 3ZDAA 3R9KA 2G07A 2LI6A 8ICCA 2LHTA 5ALUA 4YFKA 3GZFA 4NWIA 5KL1B 3ZDDA 1ZQGA 5KFJA 3PY8A 2W8LA 2AQ4A 1NK7A 3TACB 9ICQA 3HWTA 5L1JA 4NLBA 4P0QB 4O5KA 2HW3A 4BUGA 4P0PA 1QQ5A 3QYPA 5KFNA 1DK2A 5AI4A 3QU7A 5HMMA 3F2DA 3GDXA 2A1JA 1FEZA 1VDVA 4B9TA 1KW4A 3BZKA 2XY6A 1KFSA 1A6SA 2F1IA 2QARB 4UASA 3RR7A 4MF2A 2JH1A 1TAUA 3SMVA 3JPPA 3PO5A 4Q43A 1D8LA 1SWWA 4BJQA 2JEFA 4OO1J 9ICBA 2YY6A 1D8BA 4RNOA 4CNQA 1OXJA 3QUCA 1NI3A 8ICZA 3F5EA 2C28A 4PH5A 1ZJMA 3GQCA 4YG2A 2M0NA 4B9VA 2ODGA 3KTQA 2BPGA 7ICJA 1NK5A 4F71A 4TURA 2BHNA 1T3QA 4QZ9A 1SV4A 3UXNA 5AM3A 5J2GA 4RPYA 2D3DA 2QARA 3WKEA 4RQ8A 2CRXA 2LYAA 4RQMA 3OPXA 1ZXIA 1XS9D 3UMGA 3NTUA 7ICEA 2KHQA 2KSOB 4M04A 2O6KA 3MDCA 3KHRA 4WJ3B 2DQNB 4C80A 5A0LA 3NVWA 9ICRA 2WF8A 2YN4A 1BVSA 5J2JA 3SV3A 1H38A 4QWAA 3M9MB 5KFZA 1ZQIA 5KFFA 1ZQJA 4IC9A 9ICFA 5F9NA 2JEIA 2BDUA 5JUMA 2HHQA 1RYRA 4I2HA 4YXJA 4IR1A 3M6KA 4O3QA 2VANA 5KFWA 4DFJA 4PHDA 4FBTA 4QZ8A 4Y2YA 4RZRA 3ONNA 1U48A 4F5OA 4Y2PA 1XSPA 5ALNA 3A0BU 3AM9A 5AM5A 3Q8QB 3C5GA 2ASLA 3PNCA 8ICVA 3QUBA 3RRHA 5DB7A 2W9BA 4PGXA 2WB1F 7ICOA 4FFDA 4U6PA 2PFPA 1FFVA 3JPSA 4M9JA 3LK9A 4QWEA 4C7ZA 4M6WB 4UB2A 3LWMA 4BXOA 4LJXA 4NLZA 3ZD8A 1JN3A 4QWBA 3B0XA 2FPMA 3C1YA 3BJYA 2E8PA 5D49A 2HHUA 2BCRA 2YMQA 8ICIA 1SXEA 5HNKA 4OJPA 5D46A 8ICXA 5CRXA 1NKCA 4M2YA 3KFUF 2G09A 4ZH4A 2JEGA 2OXOA 2ZIWB 3ORYA 1QQ6A 1U49A 3OHAA 4DOBA 4KN4A 2W43A 2HOFA 2ZXIA 5IILA 4PL2A 3V6KA 4M6WA 2DWQA 2W11A 3IN5A 3OTQA 5J2KA 1MN8A 1UCVA 3BQ7A 3RBDA 4O0IA 5JRTA 1UQVA 1X6JA 3UQ2A 1ZQ1C 8ICGA 4RT3A 1KN5A 1UPHA 3TANA 3V6JA 1XU4A 1Q8KA 2F8KA 1QLNA 2YX8A 1IG6A 3QUQA 3SAHA 4PPXA 1DXSA 2GLEA 5J0OA 3RJFA 4MFCA 5H2FU 4JMUA 2ZIWA 1N61A 3CNHA 4Y2RA 2NRTA 2XVTA 5KT3A 2KEYA 3MDAA 1HIWA 5J0TA 3RJKA 2KKVA 2LKYA 4XA5A 5F3XB 3RFAA 3SZ2A 4NV0A 5DBAA 2C2RA 5E79U 3RH5A 1HJPA 8ICEA 4YP3A 2CN1A 1SZPA 3TARA 4J9NA 8ICPA 4B9MA 3PW5A 2ZG6A 1BPBA 3D6JA 5AKHA 1RXWA 4I27A 2HHSA 1ZQRA 4C4SA 2F77X 1ZQVA 3H7IA 5EOZA 2BCQA 4J9SA 1NK8A 3MR2A 1B22A 3SV4A 2ZIXB 4UW9A 3I76A 3HW8A 2KVSA 4XRHA 4DQRA 4PHAA 5L1MA 4ECWA 4RUAA 4RQ1A 2H3QA 3Q8PB 4DOCA 2QB0A 4B6JA 2W7PA 5CWRA 8ICYA 3PX6A 5AKZA 1MC8A 4OJ5A 3JPNA 4HAIA 2WFAA 3M9NB 3GIKA 2Y9UA 9ICOA 5AIBA 3QUTA 4M0AA 2KE7A 3PO4A 1F5SA 3HX0A 2B21A 1DOQA 2JZBB 3JPQA 4K4IA 4ELTA 2E3TA 4EX7A 5AK6A 1MSWD 1S5LU 5EWFA 9ICNA 1TK5A 3MGIA 2XO7A
chains in the Genus database with same CATH topology
1DXSA 2GLEA 3TACB 2ESEA 2K4PA 1OW5A 1RG6A 1Z1VA 2ES6A 2DL0A 3K1RB 1WWUA 1COKA 2DKXA 2EANA 5F3XB 1X40A 3KKAC 4NJ8A 2Y9TA 1KW4A 2E8MA 2LPEA 2LMRA 2FE9A 1LKYA 1SXDA 2QARB 2KMDA 2KG5A 1PK1A 1JI7A 2YTUA 4RQNA 4PZNA 1X66A 1V85A 3BS7A 2D8CA 3TADA 3H8MA 4NL9A 2EAOA 3BS5B 2E8PA 1PK3A 1OXJA 2B6GA 2QKQA 1WWVA 2F3NA 1SXEA 2QB0B 2E8OA 5L1MA 5JTIA 2F44A 1SV0A 1B4FA 1F0MA 5JU5A 1SV0C 2K60A 2QB0A 1SV4A 2D3DA 2QARA 1X9XA 2DKZA 3TADC 4RQMA 2Y9UA 5KNIA 4IS7A 1SGGA 4NL9C 2KE7A 2JV3A 2EAPA 2KSOB 1UCVA 3BQ7A 3BS5A 5J8YA 1V38A 3SEIA 5JRTA 2KIVA 1UQVA 2EAMA 2QB1A 5J8YC 1B0XA 4PZOA 3KKAA 3HILA 4MHVA 3SENA 2L5YA 1LKYB 2KSOA 3IDWA 2F8KA 2E8NA 1PK1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DXS A;  2GLE A;  3TAC B;  2ESE A;  2K4P A;  1OW5 A;  1RG6 A;  1Z1V A;  2ES6 A;  2DL0 A;  3K1R B;  1WWU A;  1COK A;  2DKX A;  2EAN A;  5F3X B;  1X40 A;  3KKA C;  4NJ8 A;  2Y9T A;  1KW4 A;  2E8M A;  2LPE A;  2LMR A;  2FE9 A;  1LKY A;  1SXD A;  2QAR B;  2KMD A;  2KG5 A;  1PK1 A;  1JI7 A;  2YTU A;  4RQN A;  4PZN A;  1X66 A;  1V85 A;  3BS7 A;  2D8C A;  3TAD A;  3H8M A;  4NL9 A;  2EAO A;  3BS5 B;  2E8P A;  1PK3 A;  1OXJ A;  2B6G A;  2QKQ A;  1WWV A;  2F3N A;  1SXE A;  2QB0 B;  2E8O A;  5L1M A;  5JTI A;  2F44 A;  1SV0 A;  1B4F A;  1F0M A;  5JU5 A;  1SV0 C;  2K60 A;  2QB0 A;  1SV4 A;  2D3D A;  2QAR A;  1X9X A;  2DKZ A;  3TAD C;  4RQM A;  2Y9U A;  5KNI A;  4IS7 A;  1SGG A;  4NL9 C;  2KE7 A;  2JV3 A;  2EAP A;  2KSO B;  1UCV A;  3BQ7 A;  3BS5 A;  5J8Y A;  1V38 A;  3SEI A;  5JRT A;  2KIV A;  1UQV A;  2EAM A;  2QB1 A;  5J8Y C;  1B0X A;  4PZO A;  3KKA A;  3HIL A;  4MHV A;  3SEN A;  2L5Y A;  1LKY B;  2KSO A;  3IDW A;  2F8K A;  2E8N A;  1PK1 B; 
#chains in the Genus database with same CATH topology
 4Z6E A;  3Q8S B;  4NLC A;  4UB5 A;  2AGO A;  2ESE A;  9ICW A;  2HHX A;  9ICC A;  1J2M A;  3Q8K A;  5AM4 A;  5C0Y A;  4CDG A;  2ES6 A;  1TFR A;  1L5U A;  5ALY A;  4UBB A;  4O5E A;  4JWN A;  3AU2 A;  2G08 A;  2HSZ A;  2YB4 A;  3B9J A;  4RNN A;  2W9A A;  1NZB A;  2NRZ A;  1PUZ A;  5DB8 A;  2JZB A;  1FFU A;  3BQ2 A;  5HR6 A;  4I2B A;  3KKA C;  1UT5 A;  2KMD A;  1BPD A;  1AQ6 A;  4GXI A;  3M1Y A;  4F4W A;  1XSN A;  4C0Z A;  5ALT A;  5AM1 A;  2E1F A;  3C2K A;  4C7Y A;  4OJO A;  2IHM A;  4UB3 A;  3JPO A;  2ZUB A;  5EE3 A;  4GLX A;  4FO6 A;  1U47 A;  1WWV A;  4P4P A;  4KLG A;  5KFY A;  4C4T A;  4IQT A;  4I2C A;  1RYU A;  2JR5 A;  8ICM A;  5KT6 A;  2V4Q A;  2AH5 A;  9ICU A;  5KFB A;  3FDS A;  2LYB A;  1LB2 B;  4DQP A;  4IQW A;  4RQ7 A;  3GU3 A;  3E0F A;  5IIK A;  3WKD A;  5CP2 A;  3CRX A;  5ALE A;  2WTF A;  4ICA A;  1RM6 C;  4QZI A;  2BCU A;  3RAQ A;  4FZM A;  9ICJ A;  4UBC A;  4DCC A;  2R8H A;  1Q3U A;  3F53 A;  4MEY A;  4EYH B;  8ICN A;  3EZ5 A;  1JRO A;  4O5C A;  5IIO A;  2KFZ A;  1FIQ A;  4ACO A;  4YCX A;  1NJX A;  4M9G A;  3DDH A;  3QXG A;  5BPC A;  4GC6 A;  8ICJ A;  1ZRM A;  2HBL A;  4QZB A;  4F4Z A;  3PW2 A;  2KTQ A;  2HI0 A;  4XQ8 A;  4NM1 A;  3F2C A;  4DF8 A;  1M6Y A;  2WB1 C;  3FAH A;  3PZP A;  2BZF A;  1WG8 A;  1ZD2 P;  3EPG A;  4ED1 A;  3PST A;  2A3V A;  4OCZ A;  1ECW A;  3PR5 B;  1ZQF A;  4AP9 A;  1QSS A;  1NK4 A;  5AI0 A;  5DDM A;  1KLN A;  4ED2 A;  1NK0 A;  3MAB A;  4P4O A;  1ZYQ A;  1ZQE A;  2MU2 A;  2KD1 A;  4YVZ A;  5KFQ A;  4QNL A;  5DKW A;  2XID A;  4KMU A;  3G6X A;  5AI5 A;  4KIT B;  2VIX A;  1UHU A;  3TAP A;  2HOQ A;  3A0H U;  4F5Q A;  2EAO A;  3AQF A;  2B6G A;  1SL2 A;  2AJQ A;  2A19 A;  2KZZ A;  2F3N A;  4XUS A;  4FS2 A;  1Q3V A;  5ALM A;  2K89 A;  5ALK A;  4MFF A;  5JTI A;  5ALR A;  3SYZ A;  4KLI A;  1RYS A;  2G0A A;  5KFX A;  3HPO A;  4RU9 A;  7ICP A;  2VA3 A;  2J6S A;  2HBM A;  2FMS A;  4I2G A;  5KAF U;  3N7S C;  3PSP A;  1QSY A;  7ICV A;  3RTV A;  2P6R A;  2HHW A;  1NJW A;  5KNI A;  4IS7 A;  1ZQK A;  4NL9 C;  4LVS A;  9ICI A;  2EAP A;  2ZIV B;  1X9W A;  3J81 j;  1T3N A;  5J8Y A;  5AI9 A;  1RDF A;  2W3R A;  4KLM A;  5J8Y C;  4PZO A;  4CE6 A;  5KFP A;  5KL8 B;  2L5Y A;  2RLT A;  4OJ6 A;  4C4R A;  1IM4 A;  3BDP A;  1N5X A;  3KHL A;  4P0P B;  1YT3 A;  4ED0 A;  4M9L A;  5EWE A;  7ICL A;  1YZ6 A;  2Q4T A;  2KFN A;  2J6T A;  3Q8M A;  1V97 A;  2A1J B;  5KFS A;  1BPZ A;  4YXM A;  1COO A;  1WWU A;  2ZTD A;  4ECR A;  2R8I A;  4K4G A;  4EBC A;  2ZIV A;  5DBB A;  2G5I B;  4I2I A;  1ZQA A;  1RQL A;  8ICW A;  3C1Z A;  5TZV A;  1SKR A;  4EZ6 A;  1U9L A;  2E8M A;  1KL9 A;  2LMR A;  3MFI A;  2N1R A;  3QU5 A;  4IQU A;  4C8L A;  4UAY A;  1L8O A;  2IOF K;  3KBB A;  8ICO A;  4RPZ A;  4UAT A;  2AQ0 A;  5KFA A;  4Q44 A;  3NVV A;  3ISD A;  4DFK A;  3BS5 B;  3C5F A;  4ED6 A;  2FLP A;  4TUQ A;  5HML A;  1N2X A;  1WUD A;  3LYS A;  3QX7 A;  1LVH A;  2F44 A;  4Y2X A;  1X2I A;  2QLT A;  5J2A A;  4Y2Q A;  4Y2T A;  5IIJ A;  2LM4 A;  4RPX A;  3Q8L A;  3T3F A;  4OJL A;  1N62 A;  3PR4 A;  1S10 A;  4FE3 A;  1X6I A;  3CW2 C;  3WKA A;  1X9X A;  2A1A A;  2DFL A;  3CYM A;  5CA7 A;  4ECQ A;  4YD2 A;  4IQV A;  9ICL A;  2PI5 A;  3QEA Z;  2EDU A;  2K8C B;  1UA1 A;  5ALJ A;  4KLO A;  1TKD A;  3BS5 A;  1ZQL A;  4QJF B;  2RDI A;  3QU2 A;  4DSJ A;  4YR2 A;  2W8K A;  4U7C A;  5ALV A;  4KLF A;  4MHV A;  1LKY B;  3GIM A;  1T8E A;  1TAM A;  2P35 A;  1PK1 B;  2NO4 A;  1U4B A;  3T5K A;  1ARO P;  4I2A A;  7ICS A;  3N28 A;  1Z1V A;  2VKQ A;  2F2A B;  4BWJ A;  1MQ2 A;  4J9L A;  1ZET A;  5J0W A;  1N48 A;  1SWV A;  2W9B B;  2JH7 A;  3F2B A;  2NV3 A;  1BNO A;  2JEJ A;  4KLH A;  3AU6 A;  2FLL A;  2UVR A;  2HMX A;  2BCS A;  2W9C B;  2F1J A;  9ICK A;  1RXV A;  1JRP A;  4BXO B;  4R64 A;  5KT4 A;  3O0F A;  4ED7 A;  2JGA A;  1LKY A;  1BPX A;  1UT8 A;  2KJ9 A;  5DB9 A;  1PK1 A;  1ZQW A;  1TK8 A;  5GTI U;  3QU9 A;  2KP7 A;  3G6Y A;  2HHT A;  3PSI A;  5J0U A;  3RJI A;  4JV0 A;  5HP4 A;  2AGP A;  2BCV A;  3MR3 A;  1TK0 A;  3HKZ F;  4USA A;  4DQQ A;  3UPQ A;  4Q45 A;  4RQ5 A;  4Q8E A;  1UA0 A;  4JK1 A;  9ICH A;  4UAR A;  3MC1 A;  1S0N A;  4QWC A;  1SZH A;  3GII A;  5KFH A;  2W9C A;  3MGV A;  1F0M A;  5KT7 A;  5KFE A;  3UMC A;  5K4L A;  3ISC A;  4DOA A;  1L3S A;  2KN7 A;  4GXJ A;  4R8U A;  4I2E A;  4F50 A;  3RJJ A;  1KBU A;  3I1Y A;  3K4G A;  5EE1 A;  2W03 A;  4ECX A;  4PHP A;  4Z6C A;  5C5J A;  2J6U A;  2H3V A;  2ALZ A;  3BZC A;  3PX0 A;  2V4R A;  4BWM A;  1B0X A;  1NJZ A;  3JPT A;  5J2D A;  2WF7 A;  4DFP A;  3SD7 A;  3M7D A;  8ICS A;  2K8B B;  3RB0 A;  3HJE A;  3RB3 A;  1X9S A;  2KVC A;  4KLS A;  1X9M A;  2PMZ F;  2I9G A;  3L3F X;  4G9B A;  2K4P A;  3C2M A;  2MAX A;  5KG2 A;  1KQQ A;  2ZUC A;  2ZTC A;  4ED8 A;  5DQI A;  2IBK A;  4O3S A;  2VA2 A;  4YQW A;  3RH4 A;  2LYH A;  2W54 A;  2KZ3 A;  5KT2 A;  2FI1 A;  1XC9 A;  1WCL A;  4X5V A;  4CF4 A;  2XGP A;  3AUO A;  3BQT A;  3M8S A;  2EAN A;  1BPE A;  3CP8 A;  4KLD A;  3IV6 A;  1T4G A;  4DEZ A;  2Q0Z X;  3HP6 A;  1JAL A;  5AK4 A;  3C29 A;  1L3V A;  2PI4 A;  2Z7J A;  4F91 B;  2MRL A;  1ZD4 A;  3UM9 A;  5ALW A;  4Y2U A;  4TUP A;  4PZN A;  1X66 A;  4ECU A;  1D9F A;  4YR0 A;  1S9F A;  4NLK A;  2PFQ A;  3WK5 A;  3KHG A;  1NK6 A;  1ZQT A;  5DQG A;  4QZA A;  2QB0 B;  3N7R C;  1SV0 A;  4EEK A;  3RF9 A;  3PV8 A;  1L7N A;  2KKP A;  1SV0 C;  4Z6F A;  2EZY A;  5DG8 A;  4UB8 U;  4F5N A;  1KDH A;  1NJY A;  5KFI A;  3VC8 A;  2VJ5 A;  9ICA A;  2NO5 A;  1ZD5 A;  4PHE A;  1TV9 A;  4YR3 A;  2ASJ A;  4DFM A;  3K1Z A;  2YB1 A;  3T5L A;  5ALQ A;  2QB1 A;  3H8W A;  4ECZ A;  2I1Q A;  2RRD A;  5J29 A;  4KLQ A;  1ZJN A;  1N5W A;  5DDY A;  3N97 B;  2IMW P;  3E58 A;  5B5E U;  4EX6 A;  1J2N A;  1JUD A;  4QW9 A;  5ALI A;  2MSN A;  3JPR A;  2OHF A;  2HVI A;  2B0C A;  5KG7 A;  5L1K A;  2VA8 A;  4I2J A;  2BPF A;  2GOL A;  2BQU A;  1SB3 C;  1COK A;  3WK7 A;  3KD3 A;  5CEH A;  3NRZ A;  2FLN A;  4ECY A;  3QNM A;  4OD0 A;  4C8N A;  4B9S A;  5F9L A;  4IRC A;  4BGD A;  3OHB A;  3WU2 U;  2UVV A;  2FE9 A;  5EE9 A;  5IIN A;  1TAQ A;  2M9N A;  1CRX A;  2FDR A;  4YMO A;  4YN4 A;  3N4M B;  4RQN A;  1KKX A;  1T7P A;  1WYG A;  2AGQ A;  3BS7 A;  4I29 A;  3TAD A;  3ZDC A;  2UVU A;  3PVX A;  1U45 A;  2R18 A;  3D2N A;  3GV8 B;  7ICR A;  4DS4 A;  5KG1 A;  2GWS A;  2ZJ5 A;  3EW9 A;  4ECS A;  5D4B A;  4DL4 A;  5KG6 A;  4C8K A;  1S8O A;  1VLB A;  4C8O A;  1ZQU A;  3THV A;  4YMN A;  1NOM A;  2Y0S F;  3ZDB A;  1B4F A;  1KRP A;  1ZRN A;  2EQY A;  3ETL A;  1BPY A;  1Z4O A;  1L7M A;  5J0Y A;  3OJS A;  4DWI A;  2IHN A;  3M8R A;  2G5H B;  2IOH A;  4YD1 A;  4MF8 A;  3ED5 A;  5ALD A;  5AI8 A;  2HCF A;  2XCA A;  2WF6 A;  2R8K A;  2KIV A;  4DLE A;  2EAM A;  2W7O A;  1QQ7 A;  2KJ5 A;  2BQR A;  2ZJA A;  3H0M B;  4I2D A;  3OSP A;  3QE9 Y;  2AXT U;  3RJE A;  5HHI A;  7ICK A;  4JV2 A;  4KLT A;  8ICQ A;  4CGZ A;  5AI6 A;  2NRX A;  1O08 A;  5CB1 A;  7ICI A;  4KN7 A;  1ZQZ A;  3C23 A;  2MUT B;  1T94 A;  5AIC A;  3QZ7 A;  1Z4N A;  4QWD A;  2W3S A;  3L4P A;  5FP0 A;  3ICX A;  4DO9 A;  3HKZ C;  4J9R A;  4DSF A;  4CCH A;  3QU4 A;  9ICS A;  4NLN A;  3H8J A;  4EEL A;  4CF5 A;  1L3T A;  5ALZ A;  4EBE A;  3IM1 A;  3C21 A;  4RUC A;  2OM6 A;  4LZD A;  4F72 A;  1SL1 A;  3PW7 A;  4F2S A;  2MUT A;  4F3O A;  1VJ5 A;  3V7J A;  4YMM A;  4DL3 A;  1S0V A;  4DL2 A;  1SKW A;  2DF4 B;  5DLG A;  9ICT A;  4NM2 A;  5J0Q A;  5AIA A;  4DQI A;  1OUQ A;  4Y2S A;  2PMZ C;  2KOB A;  2WAQ F;  2AU0 A;  7ICM A;  4R65 A;  9ICE A;  4M47 A;  3HIL A;  2BQ3 A;  4UQG A;  1S97 A;  2KIW A;  3E2E A;  4O3M A;  3LDA A;  2DPI A;  4F92 B;  2GH1 A;  3ETR A;  1TE2 A;  2LBO A;  3RJG A;  4LZG A;  3IRU A;  3RBE A;  2G06 A;  3L5K A;  2FPK A;  4AYB F;  1F44 A;  2BPC A;  5L9X A;  3AEV A;  2H5X A;  5KG0 A;  7ICH A;  2EH9 A;  1JIH A;  2F8L A;  1ZQQ A;  4KX5 A;  2NYV A;  2PKE A;  4NJ8 A;  3FC4 A;  5AKL A;  3TFR A;  4Y2V A;  3EYZ A;  3PMN A;  4ELU A;  4KX3 A;  4MFA A;  3C28 A;  3TQ1 A;  3T5J A;  5B66 U;  1ZD3 A;  4NXZ A;  2EZX A;  2FPL A;  3GIL A;  1MQ3 A;  1RQN A;  9ICX A;  3NGD A;  1ZQO A;  2XI9 A;  1ZQP A;  3FYH A;  3PW4 A;  2BDP A;  1RZT A;  2AHO B;  1KEJ A;  1CI4 A;  1FO4 A;  1ZOL A;  7ICU A;  3SI8 A;  4PGY A;  1S0M A;  4UAZ A;  2RP5 A;  5ALX A;  1Q46 A;  5KFR A;  4E0D A;  1ZQC A;  1JMS A;  4HYK A;  4GXK A;  8ICU A;  5JU5 A;  3WKC A;  1Z1B A;  1Z00 B;  1CUK A;  4EBD A;  3G6V A;  3S6J A;  4KTQ A;  4RQ4 A;  3SAG A;  8ICF A;  2WF5 A;  3UMB A;  3M9O B;  1ZQS A;  2H3F A;  4IR9 A;  3MR5 A;  3SR6 A;  1SGG A;  5KFK A;  4QIW F;  5CJ7 A;  4IRK A;  1NNL A;  4B9L A;  7ICG A;  3SEI A;  2RQ5 A;  4QZG A;  5J0P A;  5DG7 A;  4G3I A;  2OYY A;  2HDO A;  2V9W A;  1ZQD A;  4A8E A;  4J9K A;  1Z00 A;  3RAX A;  2FMP A;  3OGU A;  2XIC A;  5KFM A;  2W9M A;  1MA7 A;  2OH2 A;  8ICL A;  4P0Q A;  5G5H A;  7ICN A;  4CF3 A;  3SAF A;  3PX4 A;  8ICA A;  2VJ4 A;  1ED1 A;  5DBC A;  2LPE A;  2ISO A;  9ICG A;  2KIC A;  5ALH A;  3AN1 A;  3HT3 A;  2F1H A;  2YML A;  2KG5 A;  1JI7 A;  1KFD A;  2KNJ A;  1K1S A;  4F93 B;  2Y0S C;  7ICT A;  3ISB A;  4BX9 C;  2PFO A;  5BOL A;  4J9Q A;  5AM0 A;  3NRW A;  3V72 A;  2QKQ A;  3TAQ A;  2E5S A;  3GFK B;  5CHG A;  1ZQN A;  3H0R B;  4JV1 A;  4O3O A;  3TI0 A;  4O3R A;  3H8S A;  3AL0 B;  3RJH A;  4R8U B;  3PML A;  1DGS A;  3BQ0 A;  2KK0 A;  2ZJ8 A;  4J03 A;  3K75 D;  3OSN A;  1Z19 A;  2HOI A;  2NRV A;  3EUB 2;  4F2R A;  1JX4 A;  3V7K A;  3M6Z A;  1N63 A;  5AK5 A;  5HR7 A;  1ZQM A;  2BKE A;  4O9M A;  2FJ6 A;  2C22 A;  4QZF A;  2IOF A;  4GIB A;  4B9N A;  4ECT A;  3WK8 A;  3ZI4 A;  3OJU A;  3MBY A;  2KSO A;  2E8N A;  2HHV A;  4F5R A;  5AHX A;  3B0Y A;  1XO0 A;  4FS1 A;  5ALF A;  3C2L A;  4ED3 A;  2D6F C;  2XCP A;  5KAI U;  3D2S A;  3IG8 A;  3UXP A;  3IG5 A;  8ICK A;  3AQE A;  3N7P D;  1X40 A;  5DLF A;  8ICB A;  2W55 A;  4B9U A;  2IA6 A;  2DUY A;  3AMZ A;  2H3Z A;  2JXJ A;  1SXD A;  2YMM A;  4KLL A;  2YTU A;  5AM2 A;  4UAV A;  3IP4 B;  3T5H A;  4PGQ A;  1BNP A;  2D8C A;  4DLG A;  2DBY A;  5GTH U;  1PK3 A;  3RB4 A;  1NK9 A;  4QZC A;  4JB3 A;  5KG5 A;  4KMO B;  3QZ8 A;  3RRG A;  3H40 A;  4RQ6 A;  3KOO A;  4JWM A;  1O03 A;  3PW0 A;  4TUS A;  1DGJ A;  5G5G A;  3H4D A;  2GO7 A;  3H4B A;  2K60 A;  2C2D A;  3GV5 B;  2W04 A;  2WAQ C;  3T79 A;  4MEX A;  5TIS U;  3LWL A;  4DL6 A;  4C8M A;  4P2H A;  2DKZ A;  3LVW A;  2XGQ A;  1IIP A;  4O3N A;  4BDP A;  2MA1 A;  2K8A A;  2I6X A;  3UXO A;  3LVV A;  2ASD A;  3MFH A;  5ALL A;  2C2E A;  1TVA A;  1N56 A;  5CR0 A;  5KFL A;  4EEY A;  1QSL A;  3HRD D;  2PFN A;  1HUZ A;  5AKG A;  4F8R A;  3SEN A;  3IDW A;  4AYB C;  5L1I A;  5AKE A;  4M9N A;  4RNM A;  2WHE A;  5AK3 A;  1HEK A;  5KFO A;  4FZL A;  2OWO A;  4NLG A;  2KZM A;  1OW5 A;  2BR0 A;  1DRG A;  1RG6 A;  4UAW A;  5J0S A;  4TQS A;  3KZI U;  4F5P A;  1NKB A;  2DL0 A;  5ALG A;  1XSL A;  2K4I A;  5AKY A;  5AKX A;  1QCK A;  8ICT A;  3KZX A;  1PVR A;  2NRW A;  3NAS A;  4QZE A;  2Y9T A;  2F76 X;  4US9 A;  1GO3 F;  1C20 A;  4PL1 A;  1QTM A;  3NVY A;  1LV5 A;  1PVQ A;  4RT2 A;  4JUZ A;  3GV7 B;  2HBK A;  4ZOH C;  5J2E A;  3ZD9 A;  3NS1 A;  1RPL A;  3H8M A;  3H0L B;  2PXI A;  1L3U A;  3MR6 A;  5AKK A;  1IV8 A;  1NKE A;  2OEH A;  1NZP A;  4GC7 A;  3V6H A;  4QIW C;  2ZIX A;  1L8L A;  4QW8 A;  4DSI A;  5KT5 A;  5J2H A;  1XO1 A;  5KFD A;  1SIJ A;  2DGZ A;  4F4K A;  3TAD C;  1KSP A;  4RQ0 A;  2FMQ A;  4CRX A;  4Y2J A;  5J2B A;  2UVW A;  2ZTE A;  2YQE A;  2R8G A;  9ICP A;  1A76 A;  2BGW A;  4I28 A;  3KKA A;  1BGX T;  5KFC A;  5DQH A;  3D2Q A;  2EZZ A;  5III A;  4UB1 A;  4R66 A;  2HVH A;  5KFV A;  2KV2 A;  9ICM A;  5J2F A;  1K5O A;  4F4X A;  1EXN A;  3TFS A;  1ZQB A;  3NUQ A;  2R8J A;  4ECV A;  1WCN A;  1Z3E B;  5ALO A;  2HBJ A;  4NY8 A;  2DKX A;  3WK4 A;  2P6U A;  1IXR A;  2Y1I A;  2ZUD A;  4I2F A;  3TKA A;  5L1L A;  3WK6 A;  2JMG A;  5J2C A;  3DEE A;  1S0O A;  2KHV A;  3EPI A;  4DSE A;  3RR8 A;  4ELV A;  1A0P A;  2I5H A;  5KTQ A;  5AKI A;  3MGH A;  1S76 D;  4EEN A;  2XC9 A;  5KFU A;  1V85 A;  4O3P A;  3F5A A;  3IHQ B;  5J0X A;  2DPJ A;  5BOM A;  4KLJ A;  1L7P A;  2E1E A;  1C7Y A;  3SQI A;  5ALS A;  3EWA A;  4DL5 A;  1K1Q A;  1D9D A;  5DGA A;  4DSL A;  1SL0 A;  2YMP A;  3UQ0 A;  2E8O A;  1L6N A;  2K4H A;  4KLU A;  5J2I A;  3GIJ A;  5T14 A;  4UB4 A;  3ZDE A;  2ZIU B;  4Q8F A;  1ZQY A;  1P7D A;  2CXY A;  4EZ9 A;  4GFJ A;  2ATL A;  4TQR A;  4F4Y A;  1URJ A;  4PJ0 U;  5DB6 A;  4Z6D A;  5HHH A;  1D8Y A;  7ICF A;  3BQ1 A;  1CEZ A;  1HUO A;  4J9P A;  1ZQX A;  3KHH A;  1V9P A;  1V38 A;  1YZ7 A;  4FZN A;  3VCB A;  2JHD A;  5KG4 A;  1Y88 A;  5EE0 A;  5EWG A;  3U26 A;  2ZIU A;  4DSK A;  3FM9 A;  1B43 A;  3WK9 A;  1ZQH A;  2K4E A;  2RHF A;  9ICV A;  3PSF A;  1X42 A;  1A77 A;  4R63 A;  1QH9 A;  3K1R B;  2ZXH A;  1N60 A;  3WKB A;  4J9M A;  4IRD A;  5ALP A;  5KFT A;  2H3I A;  5KG3 A;  5AKJ A;  5J0R A;  4UB6 U;  7ICQ A;  2XY7 A;  4QZD A;  4EYI B;  2CPR A;  5DGB A;  4DQS A;  2RDJ A;  1L7O A;  4IL6 U;  4UAU A;  1J97 A;  3QEB Z;  2OCE A;  4RQ3 A;  8ICH A;  4J9O A;  3I28 A;  5KFG A;  4QZH A;  1KTQ A;  3NVZ A;  4NL9 A;  1SKS A;  1XNS A;  4DS5 A;  2XY5 A;  4DF4 A;  4KLE A;  2WF9 A;  4FBU A;  3RH6 A;  1JXL A;  2ISP A;  3ALR A;  4P4M A;  2LM1 A;  1PVP A;  5IIM A;  3RB6 A;  1DK3 A;  2JRZ A;  1KFT A;  2KJ8 A;  3V7L A;  1JXE A;  2Y1J A;  4K4H A;  4DL7 A;  1S77 D;  1XWL A;  8ICR A;  5DG9 A;  4M9H A;  1PZN A;  3DV9 A;  3Q8R B;  4RQ2 A;  2JV3 A;  4DFD A;  2P66 A;  4US8 A;  3ZDA A;  3R9K A;  2G07 A;  2LI6 A;  8ICC A;  2LHT A;  5ALU A;  4YFK A;  3GZF A;  4NWI A;  5KL1 B;  3ZDD A;  1ZQG A;  5KFJ A;  3PY8 A;  2W8L A;  2AQ4 A;  1NK7 A;  3TAC B;  9ICQ A;  3HWT A;  5L1J A;  4NLB A;  4P0Q B;  4O5K A;  2HW3 A;  4BUG A;  4P0P A;  1QQ5 A;  3QYP A;  5KFN A;  1DK2 A;  5AI4 A;  3QU7 A;  5HMM A;  3F2D A;  3GDX A;  2A1J A;  1FEZ A;  1VDV A;  4B9T A;  1KW4 A;  3BZK A;  2XY6 A;  1KFS A;  1A6S A;  2F1I A;  2QAR B;  4UAS A;  3RR7 A;  4MF2 A;  2JH1 A;  1TAU A;  3SMV A;  3JPP A;  3PO5 A;  4Q43 A;  1D8L A;  1SWW A;  4BJQ A;  2JEF A;  4OO1 J;  9ICB A;  2YY6 A;  1D8B A;  4RNO A;  4CNQ A;  1OXJ A;  3QUC A;  1NI3 A;  8ICZ A;  3F5E A;  2C28 A;  4PH5 A;  1ZJM A;  3GQC A;  4YG2 A;  2M0N A;  4B9V A;  2ODG A;  3KTQ A;  2BPG A;  7ICJ A;  1NK5 A;  4F71 A;  4TUR A;  2BHN A;  1T3Q A;  4QZ9 A;  1SV4 A;  3UXN A;  5AM3 A;  5J2G A;  4RPY A;  2D3D A;  2QAR A;  3WKE A;  4RQ8 A;  2CRX A;  2LYA A;  4RQM A;  3OPX A;  1ZXI A;  1XS9 D;  3UMG A;  3NTU A;  7ICE A;  2KHQ A;  2KSO B;  4M04 A;  2O6K A;  3MDC A;  3KHR A;  4WJ3 B;  2DQN B;  4C80 A;  5A0L A;  3NVW A;  9ICR A;  2WF8 A;  2YN4 A;  1BVS A;  5J2J A;  3SV3 A;  1H38 A;  4QWA A;  3M9M B;  5KFZ A;  1ZQI A;  5KFF A;  1ZQJ A;  4IC9 A;  9ICF A;  5F9N A;  2JEI A;  2BDU A;  5JUM A;  2HHQ A;  1RYR A;  4I2H A;  4YXJ A;  4IR1 A;  3M6K A;  4O3Q A;  2VAN A;  5KFW A;  4DFJ A;  4PHD A;  4FBT A;  4QZ8 A;  4Y2Y A;  4RZR A;  3ONN A;  1U48 A;  4F5O A;  4Y2P A;  1XSP A;  5ALN A;  3A0B U;  3AM9 A;  5AM5 A;  3Q8Q B;  3C5G A;  2ASL A;  3PNC A;  8ICV A;  3QUB A;  3RRH A;  5DB7 A;  2W9B A;  4PGX A;  2WB1 F;  7ICO A;  4FFD A;  4U6P A;  2PFP A;  1FFV A;  3JPS A;  4M9J A;  3LK9 A;  4QWE A;  4C7Z A;  4M6W B;  4UB2 A;  3LWM A;  4BXO A;  4LJX A;  4NLZ A;  3ZD8 A;  1JN3 A;  4QWB A;  3B0X A;  2FPM A;  3C1Y A;  3BJY A;  2E8P A;  5D49 A;  2HHU A;  2BCR A;  2YMQ A;  8ICI A;  1SXE A;  5HNK A;  4OJP A;  5D46 A;  8ICX A;  5CRX A;  1NKC A;  4M2Y A;  3KFU F;  2G09 A;  4ZH4 A;  2JEG A;  2OXO A;  2ZIW B;  3ORY A;  1QQ6 A;  1U49 A;  3OHA A;  4DOB A;  4KN4 A;  2W43 A;  2HOF A;  2ZXI A;  5IIL A;  4PL2 A;  3V6K A;  4M6W A;  2DWQ A;  2W11 A;  3IN5 A;  3OTQ A;  5J2K A;  1MN8 A;  1UCV A;  3BQ7 A;  3RBD A;  4O0I A;  5JRT A;  1UQV A;  1X6J A;  3UQ2 A;  1ZQ1 C;  8ICG A;  4RT3 A;  1KN5 A;  1UPH A;  3TAN A;  3V6J A;  1XU4 A;  1Q8K A;  2F8K A;  1QLN A;  2YX8 A;  1IG6 A;  3QUQ A;  3SAH A;  4PPX A;  1DXS A;  2GLE A;  5J0O A;  3RJF A;  4MFC A;  5H2F U;  4JMU A;  2ZIW A;  1N61 A;  3CNH A;  4Y2R A;  2NRT A;  2XVT A;  5KT3 A;  2KEY A;  3MDA A;  1HIW A;  5J0T A;  3RJK A;  2KKV A;  2LKY A;  4XA5 A;  5F3X B;  3RFA A;  3SZ2 A;  4NV0 A;  5DBA A;  2C2R A;  5E79 U;  3RH5 A;  1HJP A;  8ICE A;  4YP3 A;  2CN1 A;  1SZP A;  3TAR A;  4J9N A;  8ICP A;  4B9M A;  3PW5 A;  2ZG6 A;  1BPB A;  3D6J A;  5AKH A;  1RXW A;  4I27 A;  2HHS A;  1ZQR A;  4C4S A;  2F77 X;  1ZQV A;  3H7I A;  5EOZ A;  2BCQ A;  4J9S A;  1NK8 A;  3MR2 A;  1B22 A;  3SV4 A;  2ZIX B;  4UW9 A;  3I76 A;  3HW8 A;  2KVS A;  4XRH A;  4DQR A;  4PHA A;  5L1M A;  4ECW A;  4RUA A;  4RQ1 A;  2H3Q A;  3Q8P B;  4DOC A;  2QB0 A;  4B6J A;  2W7P A;  5CWR A;  8ICY A;  3PX6 A;  5AKZ A;  1MC8 A;  4OJ5 A;  3JPN A;  4HAI A;  2WFA A;  3M9N B;  3GIK A;  2Y9U A;  9ICO A;  5AIB A;  3QUT A;  4M0A A;  2KE7 A;  3PO4 A;  1F5S A;  3HX0 A;  2B21 A;  1DOQ A;  2JZB B;  3JPQ A;  4K4I A;  4ELT A;  2E3T A;  4EX7 A;  5AK6 A;  1MSW D;  1S5L U;  5EWF A;  9ICN A;  1TK5 A;  3MGI A;  2XO7 A; 
#chains in the Genus database with same CATH homology
 1DXS A;  2GLE A;  3TAC B;  2ESE A;  2K4P A;  1OW5 A;  1RG6 A;  1Z1V A;  2ES6 A;  2DL0 A;  3K1R B;  1WWU A;  1COK A;  2DKX A;  2EAN A;  5F3X B;  1X40 A;  3KKA C;  4NJ8 A;  2Y9T A;  1KW4 A;  2E8M A;  2LPE A;  2LMR A;  2FE9 A;  1LKY A;  1SXD A;  2QAR B;  2KMD A;  2KG5 A;  1PK1 A;  1JI7 A;  2YTU A;  4RQN A;  4PZN A;  1X66 A;  1V85 A;  3BS7 A;  2D8C A;  3TAD A;  3H8M A;  4NL9 A;  2EAO A;  3BS5 B;  2E8P A;  1PK3 A;  1OXJ A;  2B6G A;  2QKQ A;  1WWV A;  2F3N A;  1SXE A;  2QB0 B;  2E8O A;  5L1M A;  5JTI A;  2F44 A;  1SV0 A;  1B4F A;  1F0M A;  5JU5 A;  1SV0 C;  2K60 A;  2QB0 A;  1SV4 A;  2D3D A;  2QAR A;  1X9X A;  2DKZ A;  3TAD C;  4RQM A;  2Y9U A;  5KNI A;  4IS7 A;  1SGG A;  4NL9 C;  2KE7 A;  2JV3 A;  2EAP A;  2KSO B;  1UCV A;  3BQ7 A;  3BS5 A;  5J8Y A;  1V38 A;  3SEI A;  5JRT A;  2KIV A;  1UQV A;  2EAM A;  2QB1 A;  5J8Y C;  1B0X A;  4PZO A;  3KKA A;  3HIL A;  4MHV A;  3SEN A;  2L5Y A;  1LKY B;  2KSO A;  3IDW A;  2F8K A;  2E8N A;  1PK1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...