3HILA

Sam domain of human ephrin type-a receptor 1 (epha1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
GIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 1
publication title SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1).
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3hilA00
1V85A 1RG6A 2KE7A 4IS7A 1SV0C 4RQNA 1WWUA 1SXEA 5L1MA 2F3NA 2K60A 2EANA 4RQMA 1PK1A 5F3XB 2QARA 5JTIA 1SXDA 3H8MA 1PK3A 4NL9C 5J8YC 2Y9TA 2YTUA 1DXSA 4NJ8A 2FE9A 2D8CA 2F44A 1X9XA 3HILA 3TADA 3BQ7A 2EAMA 2KMDA 3BS5A 1SV4A 1JI7A 2B6GA 1PK1B 4PZNA 2GLEA 1Z1VA 4PZOA 2KSOA 1B4FA 1OW5A 2E8NA 2DKXA 3BS7A 2QKQA 2F8KA 1SV0A 2L5YA 3SEIA 2KG5A 2Y9UA 2E8PA 2DKZA 2JV3A 3KKAA 1SGGA 1WWVA 5KNIA 3BS5B 1OXJA 3TACB 1V38A 2LPEA 2DL0A 5JRTA 1LKYA 2KSOB 1X66A 3SENA 2QARB 5J8YA 2EAPA 3K1RB 2KIVA 1X40A 4MHVA 1B0XA 2QB0A 2E8OA 2QB1A 2ES6A 2ESEA 2EAOA 5JU5A 3KKAC 2E8MA 1LKYB 3TADC 1COKA 1UCVA 1KW4A 4NL9A 2D3DA 3IDWA 2LMRA 2QB0B 2K4PA 1F0MA 1UQVA
chains in the Genus database with same CATH superfamily
1FFVA 3OGUA 3T5LA 5KG2A 1S76D 3KBBA 1EXNA 3FC4A 3H0RB 4UAZA 4DL7A 2OH2A 3I28A 1S0OA 3UQ0A 2ZTCA 2GOLA 4FFDA 4YD2A 5ALVA 4UB3A 2HBMA 3WK7A 5HP4A 1WCNA 3PW5A 4QZAA 4NJ8A 1ZRMA 2D8CA 4R65A 5ALTA 2G0AA 4FS1A 3M6ZA 4F4KA 4J03A 3PSIA 2VJ5A 4RQ7A 2GLEA 1K1QA 4ED3A 2NRXA 3PX4A 4KLTA 3IG8A 2UVRA 4I2EA 2MUTB 2CN1A 2QKQA 3I1YA 3I76A 4I2IA 1ZQRA 4E0DA 1SKRA 4RQ0A 5KNIA 5KFZA 1Z00A 4O5KA 3LDAA 4DL6A 3ISDA 2DL0A 1ZETA 5ALSA 4HYKA 5EE9A 5ALNA 4M04A 4UB2A 3WK9A 3RBDA 4F2SA 4C8KA 3UXPA 3RJEA 2K4HA 3PX0A 5ALPA 4X5VA 1L3SA 4RPZA 1SKSA 4PH5A 2AH5A 4NLCA 2OYYA 5KFBA 5T14A 1JUDA 5AIBA 1RYUA 5AK4A 5DQHA 3RJJA 4UB4A 2BPCA 5IIJA 2HHTA 5DBBA 4CF5A 4DS5A 7ICIA 4RQ5A 4QW8A 3OPXA 3L3FX 3BQ0A 1IIPA 2WHEA 2XI9A 7ICMA 3E2EA 4Z6CA 2H3ZA 3F5EA 2MSNA 8ICNA 4OJ6A 5E79U 1ZQDA 4J9KA 4GIBA 2ASJA 4ECWA 3UM9A 2GO7A 4IQTA 5AK5A 7ICFA 4UAVA 9ICWA 3RH4A 4I2JA 3WKBA 1U49A 2Y1IA 3RF9A 5ALIA 2HOIA 2YB1A 4UQGA 2C2DA 5AKJA 3WKCA 5TZVA 4RQ2A 2VA8A 1TV9A 8ICLA 4O3PA 2XY7A 1FO4A 3QE9Y 4F5QA 5ALDA 8ICUA 2L5YA 3EUB2 4WJ3B 3Q8PB 3RJIA 2JRZA 3KFUF 1A76A 5DB9A 2KVCA 3UQ2A 4ECRA 1PUZA 2V9WA 4EELA 4M0AA 4YMMA 1LKYA 5ALZA 2W11A 5ALFA 1CEZA 2UVUA 4PJ0U 2ASDA 4RPYA 1T3NA 4DWIA 3D2NA 3HT3A 3RB3A 2C28A 1S0MA 1AROP 1SZHA 2N1RA 4YR0A 2IMWP 4Q8FA 2FMQA 2BCUA 4JWMA 8ICGA 5AHXA 2WF5A 1JRPA 3LVWA 1RYSA 3WK8A 2KZ3A 4RT2A 4GC7A 5KFNA 3RTVA 4B9TA 2I1QA 1Z4NA 1VLBA 9ICCA 1JMSA 4DFPA 2LHTA 1N61A 2D6FC 4DL5A 5AM5A 4RQ4A 2K8AA 2XC9A 9ICXA 2K8CB 1LVHA 4QZBA 5AK6A 4AYBC 1ZQOA 1S97A 1PK1A 2BCSA 4ICAA 4QZEA 1KFDA 1DGSA 2J6TA 1NK4A 2DWQA 4A8EA 4R8UB 2W8KA 8ICWA 3FYHA 3TADA 2EAMA 2KJ9A 4O3SA 3PW7A 3NUQA 4MEXA 2KVSA 1ZQIA 5KT4A 1B22A 4ECZA 1WCLA 4RQ8A 1T8EA 1KN5A 9ICFA 4ECXA 4GXIA 4C8MA 1X9MA 4Q8EA 5L1KA 3PVXA 4OJ5A 4RQ1A 2F77X 1V38A 4YMOA 5KFJA 3MC1A 3HW8A 2A1JB 3QYPA 4ACOA 3JPTA 1BVSA 2XO7A 5AKYA 2FMSA 2OM6A 4B9VA 3ZD9A 3OSPA 2JEGA 3SZ2A 4DQIA 2JGAA 4B9SA 2KV2A 1D9FA 2EAOA 4EX6A 5AI5A 5GTIU 1S5LU 3SR6A 5ALMA 4DCCA 3OTQA 4YCXA 1ZQNA 3JPRA 2IA6A 2NRTA 3RJKA 3SAHA 1HEKA 2W9AA 1L3UA 4Q43A 3TAQA 5A0LA 1NJXA 1P7DA 4J9LA 1ZYQA 2JEFA 5EWGA 3F2DA 2Q0ZX 3HP6A 1ZQFA 1ZQJA 3DEEA 1HUZA 4EYHB 4JB3A 4QWBA 3KZIU 4NM2A 1MSWD 4EZ9A 3RH6A 4FO6A 2KZZA 2RRDA 4HAIA 4BXOB 2H3QA 1SXDA 2FLPA 2HHXA 4O3QA 5J8YC 1ZXIA 1DXSA 2MRLA 4ECUA 3BQ7A 2KMDA 5G5HA 1KFTA 5AI8A 1TK5A 4MFCA 1IXRA 2ZTDA 1QQ6A 5C0YA 3ZDEA 7ICOA 1OW5A 4M6WA 2E8NA 4I2GA 2ODGA 1QSLA 1TAQA 1OUQA 3WKEA 1ZD2P 5IIOA 3ZD8A 5KAIU 5J2KA 1XWLA 2NV3A 7ICJA 5KFRA 3D2QA 1DRGA 3AEVA 1QQ7A 1NKEA 2AGPA 2WAQF 1BPEA 2LYBA 3CP8A 4PHAA 8ICSA 4UAUA 4MF8A 1NK5A 5J2IA 9ICEA 3PR5B 3LWMA 3BZKA 4QW9A 1V9PA 4J9QA 4Y2VA 4QZFA 4LZDA 2I6XA 2VKQA 4CF3A 3OJUA 2D3DA 3NVWA 1Q46A 4KLLA 4F8RA 4ED7A 2FDRA 1IG6A 4YXMA 1NK8A 2MAXA 5ALOA 1ZD5A 2BHNA 4F71A 2KIWA 2F1IA 3T5KA 4DOAA 3NGDA 1DGJA 2AXTU 1D9DA 4B9MA 5D46A 3QU2A 3T5JA 9ICPA 4CNQA 2QARA 2KOBA 4KX3A 3QZ8A 2YX8A 2HHQA 5KG3A 2LYAA 3HJEA 4QWDA 4F50A 2PI5A 4KLHA 1X42A 9ICKA 2W3RA 5J2CA 1SV4A 2G07A 4US9A 2KICA 1N48A 4C8LA 2RLTA 5KG5A 3G6YA 2YN4A 4ECYA 1O03A 4PGXA 3Q8QB 5BOMA 5HMLA 3H7IA 3KKAA 8ICAA 7ICQA 2W8LA 2YMQA 3ISBA 3U26A 5KT5A 4EBEA 2ZJAA 4KLFA 3LK9A 4Q44A 4B9UA 2ZTEA 4I2BA 2A3VA 5ALUA 1MQ3A 2AQ4A 2QLTA 8ICMA 5KFLA 4NLKA 4F4WA 5KFCA 3MR6A 5B66U 1CUKA 4CE6A 4P4OA 5J2DA 4JWNA 3D6JA 7ICHA 2GWSA 5HNKA 2VA3A 3FDSA 4M9JA 1TVAA 1NKBA 1X9SA 5AM4A 2RQ5A 1ZQQA 5DQIA 4RT3A 4EEKA 2NRZA 3Q8KA 3ETRA 2EQYA 4R8UA 4RUAA 5JUMA 5J2HA 4J9MA 2BPFA 1JXEA 3TI0A 4EZ6A 4TQRA 4TURA 4U6PA 4XA5A 5IILA 3KHLA 5HMMA 1NJZA 2HHSA 1S0VA 3CW2C 5KT6A 4EBCA 2P66A 3H8JA 4JV2A 5AKLA 5AKZA 3IV6A 1ZQVA 9ICSA 1SL0A 1BPDA 4BDPA 4G9BA 4Q45A 4XRHA 1KEJA 4UBCA 9ICVA 4I2HA 3MFHA 2E5SA 4CDGA 3E0FA 2A1JA 4G3IA 3C1YA 5AK3A 4C80A 1SV0A 5B5EU 2E8PA 4Y2JA 2ZIXA 3GIKA 3FM9A 1QH9A 4RNOA 1ZQGA 2BPGA 4NXZA 4F2RA 4F4YA 1HJPA 4Z6EA 5KG7A 4JV0A 7ICSA 1GO3F 4KTQA 7ICNA 4DSLA 1S77D 3QU5A 1S9FA 1TFRA 2JR5A 1L3TA 1ECWA 1RZTA 2G08A 3FAHA 5J0WA 2KJ8A 3B9JA 4NLZA 1BPXA 2PFQA 2AGOA 2JXJA 2BCQA 3C1ZA 3MGIA 1F44A 2BGWA 1A0PA 4M6WB 5AM0A 5J2FA 3WKDA 3JPQA 2ASLA 4BXOA 3EYZA 5KL1B 4PHPA 2MU2A 2E1EA 5AKHA 4K4HA 3NVYA 2BQRA 4FBUA 1D8BA 4YQWA 3B0XA 2NYVA 2F3NA 1SL2A 3VCBA 1M6YA 4DQSA 4NLGA 4GFJA 1PVQA 3SV4A 1L8OA 4ECTA 3M9MB 5ALGA 4DS4A 2ZG6A 3GV5B 4M9GA 2KHQA 3RB6A 2LM4A 1KLNA 3PNCA 2VIXA 1ZQAA 4TUPA 4PGYA 3LWLA 4RZRA 2IHMA 3AU2A 3ZDDA 1RM6C 1ZJMA 2W55A 5G5GA 3WK4A 1NK6A 8ICCA 3RB4A 2YB4A 4UARA 2FPMA 4NLNA 5CWRA 3ETLA 4Y2YA 3GV7B 3F53A 1V97A 2KJ5A 2WF9A 4I2CA 1KKXA 3R9KA 3GV8B 3F2BA 3TACB 8ICIA 5EWEA 4P0QB 5AI6A 2M0NA 2QARB 1ZQMA 1T94A 1MC8A 3MBYA 1X40A 3EPGA 4EYIB 2DUYA 3DDHA 3GQCA 3SAFA 3HWTA 9ICTA 4U7CA 2XVTA 1X9WA 1KSPA 8ICJA 5KFXA 2O6KA 5DLGA 3PO4A 4MF2A 3N7SC 2DBYA 3OHBA 2JHDA 5KFHA 3KOOA 5DQGA 3PX6A 2LMRA 4Y2PA 2RDJA 1UQVA 3Q8RB 4O5CA 1SZPA 4YR2A 1U4BA 4CGZA 4AYBF 1D8LA 2AU0A 4CF4A 4ELUA 4F5NA 1N5XA 1WYGA 4O9MA 2NRWA 7ICVA 2BQ3A 1X6JA 1L8LA 4RPXA 3B0YA 1T4GA 2KZMA 4NV0A 2Y9TA 4DSFA 1TKDA 4DSIA 1NKCA 2W3SA 2ZXIA 3RBEA 3PSFA 2YMLA 1KDHA 1RDFA 2FJ6A 1N63A 5ALWA 3PZPA 3A0HU 2WB1C 3JPOA 5J29A 8ICTA 4FS2A 4DEZA 3QUCA 5L1JA 4UAYA 3MR3A 3MGHA 2CPRA 3AN1A 1RQNA 5DB7A 5KT3A 4QZ8A 4O3OA 3AM9A 4ELVA 8ICBA 2PMZF 2R8KA 2HSZA 2GH1A 2JH7A 2HCFA 2V4QA 4UB6U 4DSEA 4ECQA 3M7DA 4QIWC 2EAPA 2ZJ8A 8ICFA 5DB8A 3GDXA 3SQIA 1HIWA 3THVA 4EENA 2KP7A 5J0PA 3OHAA 2BCVA 4BGDA 4QWCA 2CXYA 4IRKA 5JU5A 2FI1A 3V7LA 2KTQA 3M9NB 3KD3A 3KHHA 4NLBA 5F9LA 9ICQA 4NL9A 1UA0A 4MFAA 3RJFA 5CA7A 2K4PA 2AHOB 4B9NA 3LVVA 3QEBZ 1FFUA 3AMZA 2DF4B 1V85A 2ZIXB 5KL8B 1XNSA 1BNOA 5DBCA 4DLGA 3RAQA 4RQ3A 1KL9A 1SXEA 4BWJA 2EANA 3SYZA 3PO5A 3C21A 2W54A 3MFIA 2EZZA 5ALKA 3HKZC 5ALLA 3IHQB 2H3FA 1L7MA 2IOHA 3EZ5A 4KMUA 4F4ZA 3RRGA 4ECVA 3SD7A 4KLUA 4RUCA 4M2YA 1U9LA 5J2BA 2I5HA 3ZDBA 3QEAZ 4PZNA 8ICKA 4IR1A 3TAPA 4Y2UA 5KG1A 2Y1JA 2R18A 5KFQA 3IG5A 3WKAA 4UBBA 4KN7A 1BPZA 3QUBA 1F5SA 4Y2XA 1L7PA 8ICQA 2ZIWA 2KD1A 2WF8A 2LYHA 3GIIA 1ZQPA 5IIMA 1QSSA 4LVSA 4F5RA 3QU9A 8ICZA 2KSOB 3IRUA 5AKXA 3K1RB 1TE2A 2P35A 2XICA 4KLGA 2V4RA 5L1LA 3NTUA 3AUOA 4B9LA 4M9HA 2KNJA 1FEZA 2G09A 1ZQEA 2XCAA 2Y0SC 3KKAC 3EPIA 4DQQA 5EOZA 4GXJA 3F5AA 4ED0A 4YFKA 1U48A 3QZ7A 5HHIA 3IDWA 1BPBA 4JUZA 1KQQA 3KHGA 5EE0A 2I9GA 2A1AA 1SKWA 1F0MA 1YZ7A 5J0OA 1N5WA 3IP4B 4R66A 1ZQKA 1S10A 1WUDA 5L1MA 9ICIA 4M47A 1ZQCA 3UMCA 3C2KA 1DK3A 4UB5A 4USAA 1SWVA 4KITB 3PV8A 3MDCA 3C5FA 2FE9A 2K8BB 2F44A 3HILA 4US8A 1ZQSA 1Q3VA 5EWFA 1ZQZA 4KLDA 1Z1VA 3NRZA 1UHUA 3H0MB 4UATA 4P0QA 2DFLA 1K5OA 3TFSA 3G6XA 2F8KA 3PW0A 4IL6U 5D49A 5KFIA 1JROA 4PHDA 1RPLA 3HPOA 2JV3A 4DL4A 9ICLA 4BX9C 2F76X 4NM1A 4Z6FA 2KKVA 3TQ1A 9ICBA 2YQEA 3GIJA 4IRCA 3C2MA 5ALEA 5J8YA 7ICPA 1A6SA 2W43A 4QJFB 2KIVA 3Q8MA 2EH9A 5DBAA 4MHVA 1XS9D 4F72A 4Y2RA 3ED5A 1T7PA 3K75D 2QB1A 3AQEA 2ES6A 8ICOA 4MEYA 4Z6DA 1MN8A 2DGZA 2FPLA 2K4IA 4F91B 9ICOA 1CRXA 1MA7A 4I28A 1COKA 1UCVA 5IIKA 2XY6A 4ZOHC 4QZ9A 4KLMA 2BCRA 1RXVA 5KFEA 5J0SA 2BKEA 1YZ6A 1RG6A 3BDPA 3JPPA 1QSYA 2Z7JA 3H0LB 2W04A 8ICYA 5FP0A 5ALYA 3K1ZA 2W9MA 2XGPA 1RYRA 5F3XB 2PI4A 4YMNA 4IQWA 1RQLA 1B43A 1QLNA 4RU9A 1JALA 2OEHA 2YTUA 2HOQA 8ICRA 2FLNA 4UAWA 4PL1A 3H4DA 4PPXA 3Q8SB 2B6GA 9ICNA 4ECSA 4PZOA 4DQRA 2DPIA 2HBLA 2EZYA 4YR3A 3ALRA 3KZXA 4TQSA 3M8SA 1IM4A 4QZCA 4P4PA 3Q8LA 3GILA 2KG5A 4OD0A 2KN7A 4OJLA 3C5GA 4UB8U 2ZUDA 2ZIVA 5KFPA 1O08A 1NNLA 3C2LA 2JZBB 4EEYA 5JRTA 1H38A 4C8NA 3H8WA 4J9OA 2B0CA 4OJPA 3PMLA 2EDUA 4JV1A 5CRXA 2RHFA 2LKYA 4BJQA 1NK7A 1B0XA 3SV3A 2E8OA 5AM1A 5DG7A 1QQ5A 3L5KA 1J2MA 3EWAA 1DOQA 4J9RA 2ESEA 1ED1A 3C29A 4CRXA 5KAFU 4MFFA 5J2AA 3RFAA 3EW9A 3V7KA 1ZRNA 2NRVA 3PW4A 3V72A 4ELTA 7ICTA 1BGXT 3BJYA 2LM1A 2P6UA 4P4MA 1L3VA 1CI4A 1XU4A 2ZIWB 3M1YA 1JXLA 3WK5A 4IS7A 3MDAA 5CHGA 3QX7A 1X2IA 4FZNA 4J9PA 1L5UA 2C2RA 4RQMA 9ICGA 3OJSA 4IR9A 2K89A 5KFFA 4O5EA 2BDUA 2VA2A 2CRXA 2W9BB 3RH5A 3PMNA 2VANA 5ALHA 3M8RA 1D8YA 3KTQA 1UA1A 3K4GA 2W9CA 4QWAA 2HHVA 1PZNA 5KFGA 4DFJA 2KSOA 4YVZA 3RB0A 1N2XA 4PGQA 1XSNA 1BNPA 3DV9A 3MGVA 1Y88A 4F4XA 3H40A 4PL2A 5DG9A 4M9LA 2R8HA 4KLOA 3NASA 2HVHA 3ZDCA 1Q8KA 3RJHA 3C28A 1Z3EB 1FIQA 1KTQA 5DLFA 1MQ2A 1NZPA 3SMVA 4DOCA 3WU2U 2C2EA 2A19A 9ICJA 5CR0A 1URJA 5AIAA 5KFSA 2BR0A 2AQ0A 4O3MA 2B21A 2HW3A 1YT3A 4KN4A 2W7PA 4IQVA 4DLEA 2BDPA 2PKEA 1ZJNA 4PHEA 2PFNA 2EZXA 2WF7A 5TISU 2M9NA 2OCEA 3TADC 2ZUCA 1KBUA 3CRXA 2WFAA 2ZXHA 2F8LA 3PR4A 2K4EA 5F9NA 1NOMA 4R64A 2DQNB 2H5XA 2IOFK 4GC6A 2JMGA 2F1JA 5CEHA 4ED8A 2KE7A 5DB6A 2JEJA 5DG8A 4KLIA 5AI4A 2W7OA 4RQNA 3T3FA 3RRHA 4TUSA 4JMUA 2NO4A 1TAMA 2HHUA 3UXOA 2KEYA 4I2DA 4C8OA 3GIMA 2PFOA 3N7RC 5JTIA 2UVVA 3RR7A 4NL9C 3UMBA 4YXJA 4NY8A 3BZCA 1ZQWA 2RDIA 2HDOA 4DFKA 2AJQA 3NRWA 1S8OA 1LV5A 7ICGA 1Z1BA 2E3TA 1Z4OA 2WB1F 4F5OA 2NO5A 2G06A 2YMMA 1ZD4A 1ZD3A 3JPNA 1ZQYA 1B4FA 2DKXA 4O3NA 1TAUA 5KFMA 4DFMA 1K1SA 4B6JA 2H3IA 4DFDA 4LZGA 1AQ6A 3BS5B 3TARA 3IM1A 1U45A 2LPEA 3N7PD 3LYSA 3IN5A 4LJXA 4QIWF 3V6JA 2PXIA 1L7NA 1Q3UA 4P0PB 4ZH4A 5IIIA 5AI9A 1TK0A 1NK0A 2BQUA 2YMPA 4F5PA 1JIHA 4C4RA 2ZIUA 1T3QA 4ED1A 5DGBA 4UASA 2KK0A 2W03A 3CYMA 5L9XA 2XGQA 2RP5A 9ICRA 1L6NA 4YD1A 4ED2A 1SB3C 3V6KA 4O3RA 1C20A 5ALJA 4C4SA 3ISCA 5J0TA 2MA1A 4RNNA 5GTHU 2QB0B 1XO1A 4J9SA 3ICXA 1PVPA 4CCHA 5H2FU 3VC8A 2ISPA 3RJGA 3TKAA 4BUGA 1NI3A 2ZIVB 2K60A 3HKZF 2IHNA 4OJOA 5J0QA 2BZFA 2ZUBA 5KFAA 4C7ZA 4DSKA 4Y2SA 3H8MA 3BQ1A 4XQ8A 5AKGA 5ALXA 5HR6A 3SI8A 5KFYA 5EE3A 5BPCA 3MABA 2WF6A 7ICUA 2FPKA 1X9XA 4IRDA 3MR5A 8ICVA 5KTQA 2HI0A 1ZQ1C 2PMZC 4QWEA 3QU4A 5AKKA 5J0YA 4RQ6A 2JZBA 5AI0A 1XSPA 1NJWA 2R8IA 5J2JA 1U47A 5J0XA 1NZBA 3BS7A 1NK9A 4KMOB 3AL0B 5HR7A 2H3VA 2Y9UA 4AP9A 1KFSA 2ALZA 3C23A 1SIJA 3M6KA 2FLLA 4C0ZA 4RNMA 3O0FA 3QUQA 3GZFA 1QCKA 3NVVA 3UXNA 3AU6A 1UT5A 2KKPA 2E1FA 4UW9A 2F1HA 7ICEA 3T79A 4GXKA 4TUQA 1Z00B 2Y0SF 3RR8A 1N60A 5C5JA 3D2SA 1A77A 2W9CB 5ALQA 1PVRA 5AM3A 4KX5A 3M9OB 4QZDA 4I2FA 2HVIA 1KW4A 3ZI4A 4I29A 2HHWA 5KFKA 4F3OA 2W9BA 4UB1A 4BWMA 2MUTA 3G6VA 1BPYA 1C7YA 7ICRA 1COOA 1ZQLA 4KLSA 4IC9A 3PY8A 5J2EA 2XY5A 3PSPA 8ICPA 4FZLA 2LI6A 1XSLA 1PK3A 5BOLA 2ISOA 4IQUA 2KFZA 1XO0A 4YN4A 4OCZA 1N56A 1UT8A 1JI7A 1ZQUA 2FMPA 3JPSA 3V6HA 5EE1A 4ED6A 4DQPA 4FE3A 4C4TA 5DDYA 3BQTA 3GU3A 5DDMA 4EX7A 3CNHA 5CJ7A 4FZMA 3SEIA 2DKZA 4J9NA 3N97B 3ONNA 4KLJA 1ZOLA 3BQ2A 3H8SA 2ZJ5A 1NJYA 4YP3A 5KFWA 2J6SA 1JX4A 2G5HB 3J81j 4DSJA 5AKEA 5KG6A 3H4BA 4K4IA 3TANA 2HBKA 2WAQC 4I27A 2OXOA 5DKWA 3PSTA 2KHVA 3PW2A 2IBKA 4R63A 1TK8A 5KFOA 4DOBA 4NWIA 1KRPA 2OWOA 2LBOA 3AQFA 3QNMA 7ICLA 5J0UA 3S6JA 2E8MA 1LKYB 2HMXA 4O0IA 2ATLA 4Y2TA 5J2GA 3A0BU 4C7YA 2F2AB 4XUSA 1LB2B 2J6UA 2PFPA 5K4LA 1J2NA 3WK6A 2P6RA 3UPQA 5KG0A 5HHHA 4KLEA 5KFTA 1IV8A 1L7OA 3N4MB 3QXGA 2AGQA 1XC9A 2VJ4A 1SV0C 4K4GA 1WWUA 5J0RA 1S0NA 3KHRA 3E58A 1Z19A 4F92B 2G5IB 5KT2A 1SWWA 9ICAA 5AM2A 2ZIUB 1HUOA 5KFDA 1VDVA 2HBJA 4F93B 4DL2A 8ICXA 3ORYA 2JEIA 1ZQBA 8ICEA 1DK2A 3T5HA 9ICUA 1J97A 3F2CA 4QNLA 5AICA 3HX0A 3BS5A 3GFKB 3UMGA 2R8JA 1PK1B 5KFVA 4I2AA 1RXWA 3NVZA 4KLQA 3NS1A 3HRDD 3OSNA 2OHFA 4P0PA 5KFUA 2XIDA 3N28A 4QZHA 5DGAA 2XCPA 3TFRA 1SGGA 2YY6A 1WWVA 1WG8A 1OXJA 1VJ5A 2Q4TA 5CB1A 2IOFA 1ZQXA 4GLXA 5D4BA 3QUTA 2WTFA 2R8GA 4M9NA 1X66A 3SENA 4YG2A 3QU7A 4FBTA 3RAXA 1ZQTA 2KFNA 2HOFA 4DO9A 2JH1A 3V7JA 3ZDAA 7ICKA 1UPHA 2QB0A 4EBDA 5AKIA 4QZGA 3MR2A 1X6IA 9ICMA 1N62A 2UVWA 3L4PA 4JK1A 5KT7A 8ICHA 4Y2QA 4DL3A 5ALRA 5IINA 4QZIA 1SL1A 4DF4A 5L1IA 1ZQHA 2C22A 5CP2A 3SAGA 4DF8A 4OO1J 2DPJA 9ICHA 4P2HA 1JN3A 1QTMA 5KG4A
chains in the Genus database with same CATH topology
1V85A 1RG6A 2KE7A 4IS7A 1SV0C 4RQNA 1WWUA 1SXEA 5L1MA 2F3NA 2K60A 2EANA 4RQMA 1PK1A 5F3XB 2QARA 5JTIA 1SXDA 3H8MA 1PK3A 4NL9C 5J8YC 2Y9TA 2YTUA 1DXSA 4NJ8A 2FE9A 2D8CA 2F44A 1X9XA 3HILA 3TADA 3BQ7A 2EAMA 2KMDA 3BS5A 1SV4A 1JI7A 2B6GA 1PK1B 4PZNA 2GLEA 1Z1VA 4PZOA 2KSOA 1B4FA 1OW5A 2E8NA 2DKXA 3BS7A 2QKQA 2F8KA 1SV0A 2L5YA 3SEIA 2KG5A 2Y9UA 2E8PA 2DKZA 2JV3A 3KKAA 1SGGA 1WWVA 5KNIA 3BS5B 1OXJA 3TACB 1V38A 2LPEA 2DL0A 5JRTA 1LKYA 2KSOB 1X66A 3SENA 2QARB 5J8YA 2EAPA 3K1RB 2KIVA 1X40A 4MHVA 1B0XA 2QB0A 2E8OA 2QB1A 2ES6A 2ESEA 2EAOA 5JU5A 3KKAC 2E8MA 1LKYB 3TADC 1COKA 1UCVA 1KW4A 4NL9A 2D3DA 3IDWA 2LMRA 2QB0B 2K4PA 1F0MA 1UQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V85 A;  1RG6 A;  2KE7 A;  4IS7 A;  1SV0 C;  4RQN A;  1WWU A;  1SXE A;  5L1M A;  2F3N A;  2K60 A;  2EAN A;  4RQM A;  1PK1 A;  5F3X B;  2QAR A;  5JTI A;  1SXD A;  3H8M A;  1PK3 A;  4NL9 C;  5J8Y C;  2Y9T A;  2YTU A;  1DXS A;  4NJ8 A;  2FE9 A;  2D8C A;  2F44 A;  1X9X A;  3HIL A;  3TAD A;  3BQ7 A;  2EAM A;  2KMD A;  3BS5 A;  1SV4 A;  1JI7 A;  2B6G A;  1PK1 B;  4PZN A;  2GLE A;  1Z1V A;  4PZO A;  2KSO A;  1B4F A;  1OW5 A;  2E8N A;  2DKX A;  3BS7 A;  2QKQ A;  2F8K A;  1SV0 A;  2L5Y A;  3SEI A;  2KG5 A;  2Y9U A;  2E8P A;  2DKZ A;  2JV3 A;  3KKA A;  1SGG A;  1WWV A;  5KNI A;  3BS5 B;  1OXJ A;  3TAC B;  1V38 A;  2LPE A;  2DL0 A;  5JRT A;  1LKY A;  2KSO B;  1X66 A;  3SEN A;  2QAR B;  5J8Y A;  2EAP A;  3K1R B;  2KIV A;  1X40 A;  4MHV A;  1B0X A;  2QB0 A;  2E8O A;  2QB1 A;  2ES6 A;  2ESE A;  2EAO A;  5JU5 A;  3KKA C;  2E8M A;  1LKY B;  3TAD C;  1COK A;  1UCV A;  1KW4 A;  4NL9 A;  2D3D A;  3IDW A;  2LMR A;  2QB0 B;  2K4P A;  1F0M A;  1UQV A; 
#chains in the Genus database with same CATH topology
 1FFV A;  3OGU A;  3T5L A;  5KG2 A;  1S76 D;  3KBB A;  1EXN A;  3FC4 A;  3H0R B;  4UAZ A;  4DL7 A;  2OH2 A;  3I28 A;  1S0O A;  3UQ0 A;  2ZTC A;  2GOL A;  4FFD A;  4YD2 A;  5ALV A;  4UB3 A;  2HBM A;  3WK7 A;  5HP4 A;  1WCN A;  3PW5 A;  4QZA A;  4NJ8 A;  1ZRM A;  2D8C A;  4R65 A;  5ALT A;  2G0A A;  4FS1 A;  3M6Z A;  4F4K A;  4J03 A;  3PSI A;  2VJ5 A;  4RQ7 A;  2GLE A;  1K1Q A;  4ED3 A;  2NRX A;  3PX4 A;  4KLT A;  3IG8 A;  2UVR A;  4I2E A;  2MUT B;  2CN1 A;  2QKQ A;  3I1Y A;  3I76 A;  4I2I A;  1ZQR A;  4E0D A;  1SKR A;  4RQ0 A;  5KNI A;  5KFZ A;  1Z00 A;  4O5K A;  3LDA A;  4DL6 A;  3ISD A;  2DL0 A;  1ZET A;  5ALS A;  4HYK A;  5EE9 A;  5ALN A;  4M04 A;  4UB2 A;  3WK9 A;  3RBD A;  4F2S A;  4C8K A;  3UXP A;  3RJE A;  2K4H A;  3PX0 A;  5ALP A;  4X5V A;  1L3S A;  4RPZ A;  1SKS A;  4PH5 A;  2AH5 A;  4NLC A;  2OYY A;  5KFB A;  5T14 A;  1JUD A;  5AIB A;  1RYU A;  5AK4 A;  5DQH A;  3RJJ A;  4UB4 A;  2BPC A;  5IIJ A;  2HHT A;  5DBB A;  4CF5 A;  4DS5 A;  7ICI A;  4RQ5 A;  4QW8 A;  3OPX A;  3L3F X;  3BQ0 A;  1IIP A;  2WHE A;  2XI9 A;  7ICM A;  3E2E A;  4Z6C A;  2H3Z A;  3F5E A;  2MSN A;  8ICN A;  4OJ6 A;  5E79 U;  1ZQD A;  4J9K A;  4GIB A;  2ASJ A;  4ECW A;  3UM9 A;  2GO7 A;  4IQT A;  5AK5 A;  7ICF A;  4UAV A;  9ICW A;  3RH4 A;  4I2J A;  3WKB A;  1U49 A;  2Y1I A;  3RF9 A;  5ALI A;  2HOI A;  2YB1 A;  4UQG A;  2C2D A;  5AKJ A;  3WKC A;  5TZV A;  4RQ2 A;  2VA8 A;  1TV9 A;  8ICL A;  4O3P A;  2XY7 A;  1FO4 A;  3QE9 Y;  4F5Q A;  5ALD A;  8ICU A;  2L5Y A;  3EUB 2;  4WJ3 B;  3Q8P B;  3RJI A;  2JRZ A;  3KFU F;  1A76 A;  5DB9 A;  2KVC A;  3UQ2 A;  4ECR A;  1PUZ A;  2V9W A;  4EEL A;  4M0A A;  4YMM A;  1LKY A;  5ALZ A;  2W11 A;  5ALF A;  1CEZ A;  2UVU A;  4PJ0 U;  2ASD A;  4RPY A;  1T3N A;  4DWI A;  3D2N A;  3HT3 A;  3RB3 A;  2C28 A;  1S0M A;  1ARO P;  1SZH A;  2N1R A;  4YR0 A;  2IMW P;  4Q8F A;  2FMQ A;  2BCU A;  4JWM A;  8ICG A;  5AHX A;  2WF5 A;  1JRP A;  3LVW A;  1RYS A;  3WK8 A;  2KZ3 A;  4RT2 A;  4GC7 A;  5KFN A;  3RTV A;  4B9T A;  2I1Q A;  1Z4N A;  1VLB A;  9ICC A;  1JMS A;  4DFP A;  2LHT A;  1N61 A;  2D6F C;  4DL5 A;  5AM5 A;  4RQ4 A;  2K8A A;  2XC9 A;  9ICX A;  2K8C B;  1LVH A;  4QZB A;  5AK6 A;  4AYB C;  1ZQO A;  1S97 A;  1PK1 A;  2BCS A;  4ICA A;  4QZE A;  1KFD A;  1DGS A;  2J6T A;  1NK4 A;  2DWQ A;  4A8E A;  4R8U B;  2W8K A;  8ICW A;  3FYH A;  3TAD A;  2EAM A;  2KJ9 A;  4O3S A;  3PW7 A;  3NUQ A;  4MEX A;  2KVS A;  1ZQI A;  5KT4 A;  1B22 A;  4ECZ A;  1WCL A;  4RQ8 A;  1T8E A;  1KN5 A;  9ICF A;  4ECX A;  4GXI A;  4C8M A;  1X9M A;  4Q8E A;  5L1K A;  3PVX A;  4OJ5 A;  4RQ1 A;  2F77 X;  1V38 A;  4YMO A;  5KFJ A;  3MC1 A;  3HW8 A;  2A1J B;  3QYP A;  4ACO A;  3JPT A;  1BVS A;  2XO7 A;  5AKY A;  2FMS A;  2OM6 A;  4B9V A;  3ZD9 A;  3OSP A;  2JEG A;  3SZ2 A;  4DQI A;  2JGA A;  4B9S A;  2KV2 A;  1D9F A;  2EAO A;  4EX6 A;  5AI5 A;  5GTI U;  1S5L U;  3SR6 A;  5ALM A;  4DCC A;  3OTQ A;  4YCX A;  1ZQN A;  3JPR A;  2IA6 A;  2NRT A;  3RJK A;  3SAH A;  1HEK A;  2W9A A;  1L3U A;  4Q43 A;  3TAQ A;  5A0L A;  1NJX A;  1P7D A;  4J9L A;  1ZYQ A;  2JEF A;  5EWG A;  3F2D A;  2Q0Z X;  3HP6 A;  1ZQF A;  1ZQJ A;  3DEE A;  1HUZ A;  4EYH B;  4JB3 A;  4QWB A;  3KZI U;  4NM2 A;  1MSW D;  4EZ9 A;  3RH6 A;  4FO6 A;  2KZZ A;  2RRD A;  4HAI A;  4BXO B;  2H3Q A;  1SXD A;  2FLP A;  2HHX A;  4O3Q A;  5J8Y C;  1ZXI A;  1DXS A;  2MRL A;  4ECU A;  3BQ7 A;  2KMD A;  5G5H A;  1KFT A;  5AI8 A;  1TK5 A;  4MFC A;  1IXR A;  2ZTD A;  1QQ6 A;  5C0Y A;  3ZDE A;  7ICO A;  1OW5 A;  4M6W A;  2E8N A;  4I2G A;  2ODG A;  1QSL A;  1TAQ A;  1OUQ A;  3WKE A;  1ZD2 P;  5IIO A;  3ZD8 A;  5KAI U;  5J2K A;  1XWL A;  2NV3 A;  7ICJ A;  5KFR A;  3D2Q A;  1DRG A;  3AEV A;  1QQ7 A;  1NKE A;  2AGP A;  2WAQ F;  1BPE A;  2LYB A;  3CP8 A;  4PHA A;  8ICS A;  4UAU A;  4MF8 A;  1NK5 A;  5J2I A;  9ICE A;  3PR5 B;  3LWM A;  3BZK A;  4QW9 A;  1V9P A;  4J9Q A;  4Y2V A;  4QZF A;  4LZD A;  2I6X A;  2VKQ A;  4CF3 A;  3OJU A;  2D3D A;  3NVW A;  1Q46 A;  4KLL A;  4F8R A;  4ED7 A;  2FDR A;  1IG6 A;  4YXM A;  1NK8 A;  2MAX A;  5ALO A;  1ZD5 A;  2BHN A;  4F71 A;  2KIW A;  2F1I A;  3T5K A;  4DOA A;  3NGD A;  1DGJ A;  2AXT U;  1D9D A;  4B9M A;  5D46 A;  3QU2 A;  3T5J A;  9ICP A;  4CNQ A;  2QAR A;  2KOB A;  4KX3 A;  3QZ8 A;  2YX8 A;  2HHQ A;  5KG3 A;  2LYA A;  3HJE A;  4QWD A;  4F50 A;  2PI5 A;  4KLH A;  1X42 A;  9ICK A;  2W3R A;  5J2C A;  1SV4 A;  2G07 A;  4US9 A;  2KIC A;  1N48 A;  4C8L A;  2RLT A;  5KG5 A;  3G6Y A;  2YN4 A;  4ECY A;  1O03 A;  4PGX A;  3Q8Q B;  5BOM A;  5HML A;  3H7I A;  3KKA A;  8ICA A;  7ICQ A;  2W8L A;  2YMQ A;  3ISB A;  3U26 A;  5KT5 A;  4EBE A;  2ZJA A;  4KLF A;  3LK9 A;  4Q44 A;  4B9U A;  2ZTE A;  4I2B A;  2A3V A;  5ALU A;  1MQ3 A;  2AQ4 A;  2QLT A;  8ICM A;  5KFL A;  4NLK A;  4F4W A;  5KFC A;  3MR6 A;  5B66 U;  1CUK A;  4CE6 A;  4P4O A;  5J2D A;  4JWN A;  3D6J A;  7ICH A;  2GWS A;  5HNK A;  2VA3 A;  3FDS A;  4M9J A;  1TVA A;  1NKB A;  1X9S A;  5AM4 A;  2RQ5 A;  1ZQQ A;  5DQI A;  4RT3 A;  4EEK A;  2NRZ A;  3Q8K A;  3ETR A;  2EQY A;  4R8U A;  4RUA A;  5JUM A;  5J2H A;  4J9M A;  2BPF A;  1JXE A;  3TI0 A;  4EZ6 A;  4TQR A;  4TUR A;  4U6P A;  4XA5 A;  5IIL A;  3KHL A;  5HMM A;  1NJZ A;  2HHS A;  1S0V A;  3CW2 C;  5KT6 A;  4EBC A;  2P66 A;  3H8J A;  4JV2 A;  5AKL A;  5AKZ A;  3IV6 A;  1ZQV A;  9ICS A;  1SL0 A;  1BPD A;  4BDP A;  4G9B A;  4Q45 A;  4XRH A;  1KEJ A;  4UBC A;  9ICV A;  4I2H A;  3MFH A;  2E5S A;  4CDG A;  3E0F A;  2A1J A;  4G3I A;  3C1Y A;  5AK3 A;  4C80 A;  1SV0 A;  5B5E U;  2E8P A;  4Y2J A;  2ZIX A;  3GIK A;  3FM9 A;  1QH9 A;  4RNO A;  1ZQG A;  2BPG A;  4NXZ A;  4F2R A;  4F4Y A;  1HJP A;  4Z6E A;  5KG7 A;  4JV0 A;  7ICS A;  1GO3 F;  4KTQ A;  7ICN A;  4DSL A;  1S77 D;  3QU5 A;  1S9F A;  1TFR A;  2JR5 A;  1L3T A;  1ECW A;  1RZT A;  2G08 A;  3FAH A;  5J0W A;  2KJ8 A;  3B9J A;  4NLZ A;  1BPX A;  2PFQ A;  2AGO A;  2JXJ A;  2BCQ A;  3C1Z A;  3MGI A;  1F44 A;  2BGW A;  1A0P A;  4M6W B;  5AM0 A;  5J2F A;  3WKD A;  3JPQ A;  2ASL A;  4BXO A;  3EYZ A;  5KL1 B;  4PHP A;  2MU2 A;  2E1E A;  5AKH A;  4K4H A;  3NVY A;  2BQR A;  4FBU A;  1D8B A;  4YQW A;  3B0X A;  2NYV A;  2F3N A;  1SL2 A;  3VCB A;  1M6Y A;  4DQS A;  4NLG A;  4GFJ A;  1PVQ A;  3SV4 A;  1L8O A;  4ECT A;  3M9M B;  5ALG A;  4DS4 A;  2ZG6 A;  3GV5 B;  4M9G A;  2KHQ A;  3RB6 A;  2LM4 A;  1KLN A;  3PNC A;  2VIX A;  1ZQA A;  4TUP A;  4PGY A;  3LWL A;  4RZR A;  2IHM A;  3AU2 A;  3ZDD A;  1RM6 C;  1ZJM A;  2W55 A;  5G5G A;  3WK4 A;  1NK6 A;  8ICC A;  3RB4 A;  2YB4 A;  4UAR A;  2FPM A;  4NLN A;  5CWR A;  3ETL A;  4Y2Y A;  3GV7 B;  3F53 A;  1V97 A;  2KJ5 A;  2WF9 A;  4I2C A;  1KKX A;  3R9K A;  3GV8 B;  3F2B A;  3TAC B;  8ICI A;  5EWE A;  4P0Q B;  5AI6 A;  2M0N A;  2QAR B;  1ZQM A;  1T94 A;  1MC8 A;  3MBY A;  1X40 A;  3EPG A;  4EYI B;  2DUY A;  3DDH A;  3GQC A;  3SAF A;  3HWT A;  9ICT A;  4U7C A;  2XVT A;  1X9W A;  1KSP A;  8ICJ A;  5KFX A;  2O6K A;  5DLG A;  3PO4 A;  4MF2 A;  3N7S C;  2DBY A;  3OHB A;  2JHD A;  5KFH A;  3KOO A;  5DQG A;  3PX6 A;  2LMR A;  4Y2P A;  2RDJ A;  1UQV A;  3Q8R B;  4O5C A;  1SZP A;  4YR2 A;  1U4B A;  4CGZ A;  4AYB F;  1D8L A;  2AU0 A;  4CF4 A;  4ELU A;  4F5N A;  1N5X A;  1WYG A;  4O9M A;  2NRW A;  7ICV A;  2BQ3 A;  1X6J A;  1L8L A;  4RPX A;  3B0Y A;  1T4G A;  2KZM A;  4NV0 A;  2Y9T A;  4DSF A;  1TKD A;  4DSI A;  1NKC A;  2W3S A;  2ZXI A;  3RBE A;  3PSF A;  2YML A;  1KDH A;  1RDF A;  2FJ6 A;  1N63 A;  5ALW A;  3PZP A;  3A0H U;  2WB1 C;  3JPO A;  5J29 A;  8ICT A;  4FS2 A;  4DEZ A;  3QUC A;  5L1J A;  4UAY A;  3MR3 A;  3MGH A;  2CPR A;  3AN1 A;  1RQN A;  5DB7 A;  5KT3 A;  4QZ8 A;  4O3O A;  3AM9 A;  4ELV A;  8ICB A;  2PMZ F;  2R8K A;  2HSZ A;  2GH1 A;  2JH7 A;  2HCF A;  2V4Q A;  4UB6 U;  4DSE A;  4ECQ A;  3M7D A;  4QIW C;  2EAP A;  2ZJ8 A;  8ICF A;  5DB8 A;  3GDX A;  3SQI A;  1HIW A;  3THV A;  4EEN A;  2KP7 A;  5J0P A;  3OHA A;  2BCV A;  4BGD A;  4QWC A;  2CXY A;  4IRK A;  5JU5 A;  2FI1 A;  3V7L A;  2KTQ A;  3M9N B;  3KD3 A;  3KHH A;  4NLB A;  5F9L A;  9ICQ A;  4NL9 A;  1UA0 A;  4MFA A;  3RJF A;  5CA7 A;  2K4P A;  2AHO B;  4B9N A;  3LVV A;  3QEB Z;  1FFU A;  3AMZ A;  2DF4 B;  1V85 A;  2ZIX B;  5KL8 B;  1XNS A;  1BNO A;  5DBC A;  4DLG A;  3RAQ A;  4RQ3 A;  1KL9 A;  1SXE A;  4BWJ A;  2EAN A;  3SYZ A;  3PO5 A;  3C21 A;  2W54 A;  3MFI A;  2EZZ A;  5ALK A;  3HKZ C;  5ALL A;  3IHQ B;  2H3F A;  1L7M A;  2IOH A;  3EZ5 A;  4KMU A;  4F4Z A;  3RRG A;  4ECV A;  3SD7 A;  4KLU A;  4RUC A;  4M2Y A;  1U9L A;  5J2B A;  2I5H A;  3ZDB A;  3QEA Z;  4PZN A;  8ICK A;  4IR1 A;  3TAP A;  4Y2U A;  5KG1 A;  2Y1J A;  2R18 A;  5KFQ A;  3IG5 A;  3WKA A;  4UBB A;  4KN7 A;  1BPZ A;  3QUB A;  1F5S A;  4Y2X A;  1L7P A;  8ICQ A;  2ZIW A;  2KD1 A;  2WF8 A;  2LYH A;  3GII A;  1ZQP A;  5IIM A;  1QSS A;  4LVS A;  4F5R A;  3QU9 A;  8ICZ A;  2KSO B;  3IRU A;  5AKX A;  3K1R B;  1TE2 A;  2P35 A;  2XIC A;  4KLG A;  2V4R A;  5L1L A;  3NTU A;  3AUO A;  4B9L A;  4M9H A;  2KNJ A;  1FEZ A;  2G09 A;  1ZQE A;  2XCA A;  2Y0S C;  3KKA C;  3EPI A;  4DQQ A;  5EOZ A;  4GXJ A;  3F5A A;  4ED0 A;  4YFK A;  1U48 A;  3QZ7 A;  5HHI A;  3IDW A;  1BPB A;  4JUZ A;  1KQQ A;  3KHG A;  5EE0 A;  2I9G A;  2A1A A;  1SKW A;  1F0M A;  1YZ7 A;  5J0O A;  1N5W A;  3IP4 B;  4R66 A;  1ZQK A;  1S10 A;  1WUD A;  5L1M A;  9ICI A;  4M47 A;  1ZQC A;  3UMC A;  3C2K A;  1DK3 A;  4UB5 A;  4USA A;  1SWV A;  4KIT B;  3PV8 A;  3MDC A;  3C5F A;  2FE9 A;  2K8B B;  2F44 A;  3HIL A;  4US8 A;  1ZQS A;  1Q3V A;  5EWF A;  1ZQZ A;  4KLD A;  1Z1V A;  3NRZ A;  1UHU A;  3H0M B;  4UAT A;  4P0Q A;  2DFL A;  1K5O A;  3TFS A;  3G6X A;  2F8K A;  3PW0 A;  4IL6 U;  5D49 A;  5KFI A;  1JRO A;  4PHD A;  1RPL A;  3HPO A;  2JV3 A;  4DL4 A;  9ICL A;  4BX9 C;  2F76 X;  4NM1 A;  4Z6F A;  2KKV A;  3TQ1 A;  9ICB A;  2YQE A;  3GIJ A;  4IRC A;  3C2M A;  5ALE A;  5J8Y A;  7ICP A;  1A6S A;  2W43 A;  4QJF B;  2KIV A;  3Q8M A;  2EH9 A;  5DBA A;  4MHV A;  1XS9 D;  4F72 A;  4Y2R A;  3ED5 A;  1T7P A;  3K75 D;  2QB1 A;  3AQE A;  2ES6 A;  8ICO A;  4MEY A;  4Z6D A;  1MN8 A;  2DGZ A;  2FPL A;  2K4I A;  4F91 B;  9ICO A;  1CRX A;  1MA7 A;  4I28 A;  1COK A;  1UCV A;  5IIK A;  2XY6 A;  4ZOH C;  4QZ9 A;  4KLM A;  2BCR A;  1RXV A;  5KFE A;  5J0S A;  2BKE A;  1YZ6 A;  1RG6 A;  3BDP A;  3JPP A;  1QSY A;  2Z7J A;  3H0L B;  2W04 A;  8ICY A;  5FP0 A;  5ALY A;  3K1Z A;  2W9M A;  2XGP A;  1RYR A;  5F3X B;  2PI4 A;  4YMN A;  4IQW A;  1RQL A;  1B43 A;  1QLN A;  4RU9 A;  1JAL A;  2OEH A;  2YTU A;  2HOQ A;  8ICR A;  2FLN A;  4UAW A;  4PL1 A;  3H4D A;  4PPX A;  3Q8S B;  2B6G A;  9ICN A;  4ECS A;  4PZO A;  4DQR A;  2DPI A;  2HBL A;  2EZY A;  4YR3 A;  3ALR A;  3KZX A;  4TQS A;  3M8S A;  1IM4 A;  4QZC A;  4P4P A;  3Q8L A;  3GIL A;  2KG5 A;  4OD0 A;  2KN7 A;  4OJL A;  3C5G A;  4UB8 U;  2ZUD A;  2ZIV A;  5KFP A;  1O08 A;  1NNL A;  3C2L A;  2JZB B;  4EEY A;  5JRT A;  1H38 A;  4C8N A;  3H8W A;  4J9O A;  2B0C A;  4OJP A;  3PML A;  2EDU A;  4JV1 A;  5CRX A;  2RHF A;  2LKY A;  4BJQ A;  1NK7 A;  1B0X A;  3SV3 A;  2E8O A;  5AM1 A;  5DG7 A;  1QQ5 A;  3L5K A;  1J2M A;  3EWA A;  1DOQ A;  4J9R A;  2ESE A;  1ED1 A;  3C29 A;  4CRX A;  5KAF U;  4MFF A;  5J2A A;  3RFA A;  3EW9 A;  3V7K A;  1ZRN A;  2NRV A;  3PW4 A;  3V72 A;  4ELT A;  7ICT A;  1BGX T;  3BJY A;  2LM1 A;  2P6U A;  4P4M A;  1L3V A;  1CI4 A;  1XU4 A;  2ZIW B;  3M1Y A;  1JXL A;  3WK5 A;  4IS7 A;  3MDA A;  5CHG A;  3QX7 A;  1X2I A;  4FZN A;  4J9P A;  1L5U A;  2C2R A;  4RQM A;  9ICG A;  3OJS A;  4IR9 A;  2K89 A;  5KFF A;  4O5E A;  2BDU A;  2VA2 A;  2CRX A;  2W9B B;  3RH5 A;  3PMN A;  2VAN A;  5ALH A;  3M8R A;  1D8Y A;  3KTQ A;  1UA1 A;  3K4G A;  2W9C A;  4QWA A;  2HHV A;  1PZN A;  5KFG A;  4DFJ A;  2KSO A;  4YVZ A;  3RB0 A;  1N2X A;  4PGQ A;  1XSN A;  1BNP A;  3DV9 A;  3MGV A;  1Y88 A;  4F4X A;  3H40 A;  4PL2 A;  5DG9 A;  4M9L A;  2R8H A;  4KLO A;  3NAS A;  2HVH A;  3ZDC A;  1Q8K A;  3RJH A;  3C28 A;  1Z3E B;  1FIQ A;  1KTQ A;  5DLF A;  1MQ2 A;  1NZP A;  3SMV A;  4DOC A;  3WU2 U;  2C2E A;  2A19 A;  9ICJ A;  5CR0 A;  1URJ A;  5AIA A;  5KFS A;  2BR0 A;  2AQ0 A;  4O3M A;  2B21 A;  2HW3 A;  1YT3 A;  4KN4 A;  2W7P A;  4IQV A;  4DLE A;  2BDP A;  2PKE A;  1ZJN A;  4PHE A;  2PFN A;  2EZX A;  2WF7 A;  5TIS U;  2M9N A;  2OCE A;  3TAD C;  2ZUC A;  1KBU A;  3CRX A;  2WFA A;  2ZXH A;  2F8L A;  3PR4 A;  2K4E A;  5F9N A;  1NOM A;  4R64 A;  2DQN B;  2H5X A;  2IOF K;  4GC6 A;  2JMG A;  2F1J A;  5CEH A;  4ED8 A;  2KE7 A;  5DB6 A;  2JEJ A;  5DG8 A;  4KLI A;  5AI4 A;  2W7O A;  4RQN A;  3T3F A;  3RRH A;  4TUS A;  4JMU A;  2NO4 A;  1TAM A;  2HHU A;  3UXO A;  2KEY A;  4I2D A;  4C8O A;  3GIM A;  2PFO A;  3N7R C;  5JTI A;  2UVV A;  3RR7 A;  4NL9 C;  3UMB A;  4YXJ A;  4NY8 A;  3BZC A;  1ZQW A;  2RDI A;  2HDO A;  4DFK A;  2AJQ A;  3NRW A;  1S8O A;  1LV5 A;  7ICG A;  1Z1B A;  2E3T A;  1Z4O A;  2WB1 F;  4F5O A;  2NO5 A;  2G06 A;  2YMM A;  1ZD4 A;  1ZD3 A;  3JPN A;  1ZQY A;  1B4F A;  2DKX A;  4O3N A;  1TAU A;  5KFM A;  4DFM A;  1K1S A;  4B6J A;  2H3I A;  4DFD A;  4LZG A;  1AQ6 A;  3BS5 B;  3TAR A;  3IM1 A;  1U45 A;  2LPE A;  3N7P D;  3LYS A;  3IN5 A;  4LJX A;  4QIW F;  3V6J A;  2PXI A;  1L7N A;  1Q3U A;  4P0P B;  4ZH4 A;  5III A;  5AI9 A;  1TK0 A;  1NK0 A;  2BQU A;  2YMP A;  4F5P A;  1JIH A;  4C4R A;  2ZIU A;  1T3Q A;  4ED1 A;  5DGB A;  4UAS A;  2KK0 A;  2W03 A;  3CYM A;  5L9X A;  2XGQ A;  2RP5 A;  9ICR A;  1L6N A;  4YD1 A;  4ED2 A;  1SB3 C;  3V6K A;  4O3R A;  1C20 A;  5ALJ A;  4C4S A;  3ISC A;  5J0T A;  2MA1 A;  4RNN A;  5GTH U;  2QB0 B;  1XO1 A;  4J9S A;  3ICX A;  1PVP A;  4CCH A;  5H2F U;  3VC8 A;  2ISP A;  3RJG A;  3TKA A;  4BUG A;  1NI3 A;  2ZIV B;  2K60 A;  3HKZ F;  2IHN A;  4OJO A;  5J0Q A;  2BZF A;  2ZUB A;  5KFA A;  4C7Z A;  4DSK A;  4Y2S A;  3H8M A;  3BQ1 A;  4XQ8 A;  5AKG A;  5ALX A;  5HR6 A;  3SI8 A;  5KFY A;  5EE3 A;  5BPC A;  3MAB A;  2WF6 A;  7ICU A;  2FPK A;  1X9X A;  4IRD A;  3MR5 A;  8ICV A;  5KTQ A;  2HI0 A;  1ZQ1 C;  2PMZ C;  4QWE A;  3QU4 A;  5AKK A;  5J0Y A;  4RQ6 A;  2JZB A;  5AI0 A;  1XSP A;  1NJW A;  2R8I A;  5J2J A;  1U47 A;  5J0X A;  1NZB A;  3BS7 A;  1NK9 A;  4KMO B;  3AL0 B;  5HR7 A;  2H3V A;  2Y9U A;  4AP9 A;  1KFS A;  2ALZ A;  3C23 A;  1SIJ A;  3M6K A;  2FLL A;  4C0Z A;  4RNM A;  3O0F A;  3QUQ A;  3GZF A;  1QCK A;  3NVV A;  3UXN A;  3AU6 A;  1UT5 A;  2KKP A;  2E1F A;  4UW9 A;  2F1H A;  7ICE A;  3T79 A;  4GXK A;  4TUQ A;  1Z00 B;  2Y0S F;  3RR8 A;  1N60 A;  5C5J A;  3D2S A;  1A77 A;  2W9C B;  5ALQ A;  1PVR A;  5AM3 A;  4KX5 A;  3M9O B;  4QZD A;  4I2F A;  2HVI A;  1KW4 A;  3ZI4 A;  4I29 A;  2HHW A;  5KFK A;  4F3O A;  2W9B A;  4UB1 A;  4BWM A;  2MUT A;  3G6V A;  1BPY A;  1C7Y A;  7ICR A;  1COO A;  1ZQL A;  4KLS A;  4IC9 A;  3PY8 A;  5J2E A;  2XY5 A;  3PSP A;  8ICP A;  4FZL A;  2LI6 A;  1XSL A;  1PK3 A;  5BOL A;  2ISO A;  4IQU A;  2KFZ A;  1XO0 A;  4YN4 A;  4OCZ A;  1N56 A;  1UT8 A;  1JI7 A;  1ZQU A;  2FMP A;  3JPS A;  3V6H A;  5EE1 A;  4ED6 A;  4DQP A;  4FE3 A;  4C4T A;  5DDY A;  3BQT A;  3GU3 A;  5DDM A;  4EX7 A;  3CNH A;  5CJ7 A;  4FZM A;  3SEI A;  2DKZ A;  4J9N A;  3N97 B;  3ONN A;  4KLJ A;  1ZOL A;  3BQ2 A;  3H8S A;  2ZJ5 A;  1NJY A;  4YP3 A;  5KFW A;  2J6S A;  1JX4 A;  2G5H B;  3J81 j;  4DSJ A;  5AKE A;  5KG6 A;  3H4B A;  4K4I A;  3TAN A;  2HBK A;  2WAQ C;  4I27 A;  2OXO A;  5DKW A;  3PST A;  2KHV A;  3PW2 A;  2IBK A;  4R63 A;  1TK8 A;  5KFO A;  4DOB A;  4NWI A;  1KRP A;  2OWO A;  2LBO A;  3AQF A;  3QNM A;  7ICL A;  5J0U A;  3S6J A;  2E8M A;  1LKY B;  2HMX A;  4O0I A;  2ATL A;  4Y2T A;  5J2G A;  3A0B U;  4C7Y A;  2F2A B;  4XUS A;  1LB2 B;  2J6U A;  2PFP A;  5K4L A;  1J2N A;  3WK6 A;  2P6R A;  3UPQ A;  5KG0 A;  5HHH A;  4KLE A;  5KFT A;  1IV8 A;  1L7O A;  3N4M B;  3QXG A;  2AGQ A;  1XC9 A;  2VJ4 A;  1SV0 C;  4K4G A;  1WWU A;  5J0R A;  1S0N A;  3KHR A;  3E58 A;  1Z19 A;  4F92 B;  2G5I B;  5KT2 A;  1SWW A;  9ICA A;  5AM2 A;  2ZIU B;  1HUO A;  5KFD A;  1VDV A;  2HBJ A;  4F93 B;  4DL2 A;  8ICX A;  3ORY A;  2JEI A;  1ZQB A;  8ICE A;  1DK2 A;  3T5H A;  9ICU A;  1J97 A;  3F2C A;  4QNL A;  5AIC A;  3HX0 A;  3BS5 A;  3GFK B;  3UMG A;  2R8J A;  1PK1 B;  5KFV A;  4I2A A;  1RXW A;  3NVZ A;  4KLQ A;  3NS1 A;  3HRD D;  3OSN A;  2OHF A;  4P0P A;  5KFU A;  2XID A;  3N28 A;  4QZH A;  5DGA A;  2XCP A;  3TFR A;  1SGG A;  2YY6 A;  1WWV A;  1WG8 A;  1OXJ A;  1VJ5 A;  2Q4T A;  5CB1 A;  2IOF A;  1ZQX A;  4GLX A;  5D4B A;  3QUT A;  2WTF A;  2R8G A;  4M9N A;  1X66 A;  3SEN A;  4YG2 A;  3QU7 A;  4FBT A;  3RAX A;  1ZQT A;  2KFN A;  2HOF A;  4DO9 A;  2JH1 A;  3V7J A;  3ZDA A;  7ICK A;  1UPH A;  2QB0 A;  4EBD A;  5AKI A;  4QZG A;  3MR2 A;  1X6I A;  9ICM A;  1N62 A;  2UVW A;  3L4P A;  4JK1 A;  5KT7 A;  8ICH A;  4Y2Q A;  4DL3 A;  5ALR A;  5IIN A;  4QZI A;  1SL1 A;  4DF4 A;  5L1I A;  1ZQH A;  2C22 A;  5CP2 A;  3SAG A;  4DF8 A;  4OO1 J;  2DPJ A;  9ICH A;  4P2H A;  1JN3 A;  1QTM A;  5KG4 A; 
#chains in the Genus database with same CATH homology
 1V85 A;  1RG6 A;  2KE7 A;  4IS7 A;  1SV0 C;  4RQN A;  1WWU A;  1SXE A;  5L1M A;  2F3N A;  2K60 A;  2EAN A;  4RQM A;  1PK1 A;  5F3X B;  2QAR A;  5JTI A;  1SXD A;  3H8M A;  1PK3 A;  4NL9 C;  5J8Y C;  2Y9T A;  2YTU A;  1DXS A;  4NJ8 A;  2FE9 A;  2D8C A;  2F44 A;  1X9X A;  3HIL A;  3TAD A;  3BQ7 A;  2EAM A;  2KMD A;  3BS5 A;  1SV4 A;  1JI7 A;  2B6G A;  1PK1 B;  4PZN A;  2GLE A;  1Z1V A;  4PZO A;  2KSO A;  1B4F A;  1OW5 A;  2E8N A;  2DKX A;  3BS7 A;  2QKQ A;  2F8K A;  1SV0 A;  2L5Y A;  3SEI A;  2KG5 A;  2Y9U A;  2E8P A;  2DKZ A;  2JV3 A;  3KKA A;  1SGG A;  1WWV A;  5KNI A;  3BS5 B;  1OXJ A;  3TAC B;  1V38 A;  2LPE A;  2DL0 A;  5JRT A;  1LKY A;  2KSO B;  1X66 A;  3SEN A;  2QAR B;  5J8Y A;  2EAP A;  3K1R B;  2KIV A;  1X40 A;  4MHV A;  1B0X A;  2QB0 A;  2E8O A;  2QB1 A;  2ES6 A;  2ESE A;  2EAO A;  5JU5 A;  3KKA C;  2E8M A;  1LKY B;  3TAD C;  1COK A;  1UCV A;  1KW4 A;  4NL9 A;  2D3D A;  3IDW A;  2LMR A;  2QB0 B;  2K4P A;  1F0M A;  1UQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...