3HILA

Sam domain of human ephrin type-a receptor 1 (epha1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
GIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1).
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 1
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3hilA00
1PK3A 1LKYA 1LKYB 1X66A 2QB0A 2EAMA 2LPEA 1SV0C 2Y9TA 2ES6A 4NL9C 2E8NA 2ESEA 3BS5A 3KKAA 4RQMA 4NJ8A 3HILA 2EANA 5J8YA 1KW4A 1OW5A 5JTIA 2KIVA 1SV0A 1V85A 5F3XB 3IDWA 1COKA 2KMDA 2E8PA 4IS7A 3TACB 2KSOB 1B4FA 1SV4A 5JRTA 2KSOA 3TADA 2K4PA 2JV3A 3SEIA 5JU5A 4RQNA 2F3NA 1JI7A 2QB0B 2EAPA 4PZNA 2Y9UA 1B0XA 1OXJA 2D3DA 3BS5B 4MHVA 2FE9A 2DL0A 3K1RB 5L1MA 2GLEA 2QARB 2QARA 1UCVA 2KG5A 1WWUA 1UQVA 2QB1A 5J8YC 2YTUA 1SXDA 2F44A 1SXEA 2D8CA 1F0MA 2E8OA 1SGGA 2DKXA 1X9XA 4NL9A 3BQ7A 2QKQA 3H8MA 2B6GA 1V38A 2L5YA 2KE7A 2F8KA 3SENA 3TADC 5KNIA 1RG6A 1PK1B 2LMRA 3BS7A 1X40A 1DXSA 2DKZA 4PZOA 1PK1A 2K60A 1WWVA 3KKAC 2E8MA 1Z1VA 2EAOA
chains in the Genus database with same CATH superfamily
3NVVA 2ZXIA 5KFHA 2F2AB 1N63A 4US8A 2EAMA 2LPEA 4BWJA 8ICLA 4US9A 1NI3A 5AI8A 2H3IA 2NV3A 4K4IA 1ZQRA 3SD7A 5AI5A 4YR2A 2NO5A 2RHFA 2C28A 4IQVA 2BQRA 3OSPA 4O3OA 4DSKA 2GH1A 4HAIA 2ZUBA 4ECZA 4NLGA 7ICIA 1ZD5A 5ALRA 4EBDA 1B43A 4PL2A 3WK9A 1L3SA 4JB3A 9ICAA 3NVWA 1U47A 2UVVA 4YD1A 4UB2A 4PHPA 3RB6A 3E58A 4PHAA 3V7KA 3RH6A 2NRTA 1SB3C 4ED2A 3TFRA 2QB0B 1XU4A 2D3DA 1P7DA 2BR0A 5ALUA 1ZOLA 2BKEA 3ZD8A 3UXPA 2FE9A 1C7YA 2XO7A 3AQEA 5C5JA 1XSPA 3QXGA 4P2HA 5CWRA 4DF8A 1ZQZA 3MC1A 4UB5A 7ICSA 4YD2A 4IQWA 1WYGA 4DFMA 3UMBA 7ICPA 5DG7A 2RRDA 1NKEA 4C8LA 4GIBA 4DSEA 3IM1A 2CPRA 1RG6A 1ZQHA 4EBCA 3PVXA 1K1QA 5ALXA 1NK9A 3QUBA 3PW2A 2K4EA 2K8AA 1TV9A 3SYZA 3CYMA 4LVSA 3H0MB 3OTQA 3H7IA 4FS2A 4ECQA 3PX6A 2GO7A 3EWAA 3KKAA 1CI4A 4EZ6A 2BPCA 3IN5A 3BZCA 3F5EA 4KMOB 4RUAA 1ZRMA 1JUDA 4PHDA 4DFKA 3AU2A 2B0CA 4O5KA 2LBOA 7ICQA 3ORYA 2WF8A 3TACB 3PSPA 2KVCA 4DS5A 5DB7A 1S0MA 2A1AA 3GILA 5CA7A 4UASA 4B9UA 5EWFA 1SL1A 4KLIA 3ICXA 4ELVA 3WK7A 4J9LA 4QZCA 4KLGA 1BPDA 5KG6A 3MR6A 5G5HA 8ICFA 1H38A 4EBEA 5AK3A 1TK5A 9ICSA 4MEXA 4NXZA 4F5QA 5IIKA 2KG5A 4I2BA 4C80A 2DWQA 2KHQA 1YT3A 4RNOA 4O9MA 5B5EU 4Z6EA 1IM4A 1SXDA 2F44A 4NLBA 5ALLA 3S6JA 4M9GA 5AM0A 5J2GA 9ICTA 5AKGA 5TISU 5IIOA 3MDCA 2FPMA 4PH5A 5KT6A 1AROP 4KLTA 3H4BA 1ZRNA 4KLLA 1QQ7A 2MAXA 3N7PD 4OJOA 2ALZA 4P0PB 1L5UA 1X40A 1T3QA 4YQWA 2R8HA 3D2NA 1ZQVA 1TE2A 2JEJA 3C5GA 4QZAA 5DBBA 1B0XA 3ZDBA 2J6SA 2RQ5A 4DOAA 2Y9TA 5BPCA 1U49A 2W7PA 5KFCA 1NK6A 2KJ9A 3RBEA 3NGDA 1ZXIA 8ICEA 3WKDA 1IV8A 1DRGA 1ZJNA 2KZMA 3NVZA 4WJ3B 5KFYA 4R8UA 5D49A 2HOFA 4R65A 2BZFA 2LM1A 3QNMA 2MRLA 4X5VA 4F5NA 4A8EA 4GXKA 1F44A 2JR5A 2WHEA 3TARA 1WG8A 5DDYA 3V6JA 3F5AA 4F2SA 2C22A 4UW9A 5KFEA 3N28A 4XRHA 5AM4A 5JU5A 3JPPA 1L6NA 1N2XA 2YB1A 1BPEA 3SAFA 3IP4B 1YZ6A 3F2DA 4QZBA 4PHEA 2DUYA 3GU3A 4FFDA 1WWUA 4ECSA 1CRXA 4ELUA 2BDPA 2ASLA 2PMZF 3E0FA 4QW9A 5DBCA 5DGAA 5BOMA 2MU2A 2KV2A 2E8OA 5HMLA 2DKXA 3BQ1A 8ICCA 1M6YA 5AK6A 2L5YA 2HVIA 2BPGA 1ZD2P 1Q3VA 2E5SA 7ICHA 5AI0A 1ZD3A 4M2YA 3GZFA 2VIXA 3SAHA 3MGVA 4MFCA 2JH1A 4BWMA 2EQYA 2OCEA 4DL6A 2K60A 1WWVA 1XWLA 3SZ2A 4QNLA 5ALSA 4QWAA 4DFPA 3SI8A 3EW9A 3H4DA 1ZQIA 4DL7A 4B9LA 3WK6A 9ICBA 3T3FA 2E3TA 4R63A 3LVVA 1OUQA 1PVRA 8ICRA 4RQ1A 3WKBA 1UT5A 5AICA 1D8YA 1K1SA 4J9QA 2W03A 3T5JA 4TUPA 2HBKA 1NZPA 5IIJA 4UAWA 1ZQTA 3VC8A 3HKZC 3NRWA 2KIVA 4KLUA 3C1YA 4KLEA 4R64A 5IINA 1U48A 2IOFK 1Z4OA 4M9HA 2HOIA 1RYSA 4J9OA 3BQ2A 2W8LA 3RB3A 2JV3A 5HNKA 2C2EA 3EYZA 5KFUA 4U7CA 1JI7A 2OH2A 5D4BA 4B6JA 4P4MA 4O3SA 4C0ZA 2XGQA 5AKKA 3BZKA 5KFLA 5L1MA 5KFJA 4EYHB 5KFAA 2R8KA 4YVZA 1A6SA 4EELA 4YXJA 5AKYA 2IHNA 3HP6A 5J0TA 8ICGA 2LYHA 2QLTA 3C1ZA 4IL6U 1ZQ1C 3ISDA 3M9OB 5J0WA 3H0LB 5AKIA 2H3QA 4CF4A 3LK9A 2B6GA 2YMPA 2OEHA 2EZYA 3ZDAA 1X6JA 3C29A 2PKEA 1ZQWA 3KZIU 3PSFA 2B21A 2ZUDA 2XCPA 3KHLA 2H3VA 2G07A 4Q8FA 3V7LA 2Y1JA 4EEKA 1NOMA 1SL2A 3PX4A 2DKZA 3OPXA 5J2KA 3M6ZA 2EDUA 3C5FA 5L1IA 2FDRA 1LKYA 3ETRA 2W9MA 1A76A 2WF5A 1S77D 5J2FA 2KICA 5DB6A 2XIDA 5F9NA 4ECWA 2EANA 4KLJA 9ICGA 1XO1A 2AU0A 2KIWA 4BXOA 9ICWA 4J9MA 3Q8MA 5JTIA 1MN8A 2ASDA 1MA7A 5KFTA 7ICGA 3IDWA 2FJ6A 2BQUA 7ICFA 2V9WA 1FFVA 4O5CA 5KAIU 3GIKA 2KMDA 3D2SA 2WB1F 5JRTA 2K4IA 4RQ0A 3PMNA 4P0PA 4UAVA 5KL8B 2AGQA 4TQRA 1XSLA 3K75D 1RM6C 1NJZA 3TANA 2AQ4A 2RDJA 3VCBA 5KFDA 5EWEA 7ICVA 3D6JA 3PZPA 3ZDCA 2UVWA 4YP3A 3UXNA 4FZLA 5DLGA 9ICQA 3SR6A 2QARA 4FBTA 2YTUA 2A3VA 3N4MB 3LWLA 1TVAA 2JRZA 4RU9A 2BGWA 3HW8A 4IQTA 1B22A 2EH9A 2BCUA 1KFDA 3TKAA 1SWVA 5EWGA 2NRVA 1L3TA 2M9NA 5KL1B 3H40A 2BCQA 2YMLA 3SENA 1ZETA 2OHFA 2AGOA 8ICIA 3H8SA 2HDOA 3EPGA 2OXOA 3C2LA 4O0IA 7ICLA 5ALYA 4I2JA 4NM1A 1JMSA 4ED1A 3M6KA 1S0NA 3QEAZ 5DDMA 3KTQA 3MGHA 2YN4A 4KLHA 1CEZA 2ES6A 1L3VA 1WUDA 2OYYA 2V4RA 3BJYA 1ZQAA 4ZOHC 4EZ9A 3L4PA 9ICXA 2R8JA 5KFXA 2O6KA 4F5PA 3GV8B 4GXJA 5L1KA 2BPFA 4NY8A 1BVSA 2XC9A 1C20A 5KT3A 3ETLA 5F3XB 3AMZA 4BUGA 4M9JA 3MBYA 9ICHA 2JGAA 4Y2QA 1ZQDA 1J2NA 2FPLA 4ED7A 3KD3A 1JROA 3PX0A 3CNHA 4TUQA 7ICTA 2I5HA 1UA0A 2ZTDA 5J2EA 1O03A 2OM6A 2P6UA 5AK5A 1S8OA 3F2CA 5KAFU 2Q0ZX 3CRXA 2MUTA 4BGDA 3BS5B 5J2DA 1RXWA 3EZ5A 3A0HU 5KG7A 3NUQA 3K1RB 2MSNA 4O3MA 3O0FA 5DLFA 2ZTEA 2KJ5A 4Q43A 1SWWA 4CDGA 5EE9A 4ED8A 4LZGA 3J81j 2ZJ5A 5KG2A 8ICOA 1X9XA 3B9JA 3D2QA 7ICNA 5ALPA 3DEEA 2DPJA 1V38A 5AKXA 4QZGA 2ZIUA 1L7OA 4YXMA 2F8KA 5DB8A 2HOQA 2Z7JA 3WK8A 3RJJA 1KN5A 3RJIA 1K5OA 5AM2A 5CB1A 1TKDA 1URJA 1HJPA 2ASJA 4B9SA 2ZIVA 4P4PA 2FLNA 5J2AA 1Z1VA 2KKPA 2KKVA 1KSPA 3QU5A 2EZZA 2DF4B 4DS4A 1NK7A 1X66A 2ISOA 1ZYQA 3HT3A 2ZIWA 3RTVA 2BQ3A 3PW0A 4PJ0U 1X9WA 4OCZA 1RXVA 4F4ZA 3OHAA 8ICZA 4NM2A 2NYVA 4CF3A 2AGPA 2HMXA 5J8YA 2XY7A 1Y88A 4I2AA 4BX9C 2HHTA 2YQEA 4Y2SA 1SIJA 3T5LA 2A19A 4CGZA 4Z6CA 2UVUA 3MABA 2JZBB 1EXNA 3NVYA 3M9NB 2XY6A 3I76A 4ICAA 1UPHA 1MSWD 4O5EA 4XUSA 4UAYA 5J0QA 4UARA 1ZQUA 3HWTA 3PW5A 4IRKA 3CP8A 3B0XA 1FIQA 3KOOA 4YMOA 4MFAA 4QJFB 3T5HA 2P6RA 5E79U 4J9PA 1KBUA 3QU9A 1XO0A 3WKAA 3QEBZ 1QQ6A 1BPZA 4CF5A 3RH5A 2AXTU 4CE6A 1T7PA 1SKSA 9ICFA 4DFJA 4ED3A 2W9BA 3BQTA 3AN1A 5J2HA 1PUZA 3C21A 4KLQA 4RQ2A 1D8BA 2W9BB 4KN4A 3QU7A 1NK4A 9ICJA 4DSFA 4KLSA 3N7SC 1PK1A 4C4SA 5A0LA 1T3NA 2XICA 3KHRA 4I2CA 8ICAA 1PK3A 2YMQA 4P4OA 1S5LU 3K4GA 2IHMA 2E8NA 3RR8A 7ICJA 2PMZC 1Z19A 2CRXA 4M47A 2DFLA 2IA6A 4Y2PA 4XA5A 3NS1A 4OJ5A 2IBKA 2AHOB 1BPBA 4F92B 2HBJA 3PW4A 5AKZA 1ZQPA 2PFQA 4YCXA 4USAA 1NKCA 2E1FA 4IC9A 8ICJA 1QTMA 1NJWA 2K89A 2W9CB 4JV0A 1L8LA 4FZNA 2KFNA 2Y1IA 3I28A 1IIPA 2I1QA 4C4TA 3JPRA 3WKEA 1UHUA 2FI1A 2KN7A 1KFSA 3M8RA 4FO6A 4DO9A 4F4KA 2DGZA 4DOCA 4ECTA 3Q8KA 2KVSA 1YZ7A 3MGIA 1ZQCA 5IIMA 3ZI4A 4DFDA 5T14A 4Y2JA 2RLTA 1Z1BA 1Q46A 4DL4A 1UQVA 1MQ3A 1X42A 4DCCA 4C7ZA 5ALWA 4I2IA 1L7NA 5AM5A 1N61A 2W9CA 3UMGA 3RB4A 4Y2YA 2JEIA 4I2GA 3AM9A 3AEVA 3V6HA 5KT2A 1S9FA 1FO4A 3SV3A 3Q8PB 4I29A 4IRCA 3MR3A 1Q8KA 4Q8EA 1CUKA 4O3RA 4YR0A 3QZ8A 4K4GA 4QWEA 2MUTB 3C23A 5J0RA 2HBLA 3U26A 1KQQA 3SMVA 2VA3A 1Z4NA 2A1JB 1XS9D 2HHVA 4Z6FA 3RR7A 3QUQA 1HEKA 2H3ZA 4B9NA 2JXJA 5KFZA 1S76D 1RZTA 4OJPA 4EEYA 1N5WA 3MDAA 3TAQA 1KFTA 1KW4A 3ZDEA 3QUTA 2KOBA 3GFKB 8ICBA 3GV7B 1COKA 4UATA 1QSLA 2JEFA 1WCLA 1VLBA 3GIMA 4Z6DA 2ZJAA 3QE9Y 2DPIA 1DGJA 1B4FA 3Q8SB 1SV4A 5ALEA 3RFAA 4J03A 3FYHA 5FP0A 3PSTA 2BHNA 1S10A 1KLNA 4DL5A 2WB1C 4EX7A 5DBAA 3GDXA 4RPXA 4J9RA 2ZIXA 2KD1A 1T94A 3LYSA 3RJHA 4KN7A 4C8KA 2XVTA 3K1ZA 2HI0A 2ZTCA 4GFJA 4NLNA 2JMGA 2D6FC 4U6PA 5IIIA 4F8RA 1LV5A 2KTQA 2HCFA 1ZD4A 2G08A 5ALKA 5KT5A 4ECVA 4O3NA 3UPQA 4YFKA 5J0PA 1TAUA 8ICMA 1ZQNA 3BS7A 1X9SA 4C4RA 2Y0SF 4EYIB 4F3OA 4UAZA 3OJUA 1PZNA 2EAOA 3IG8A 2ATLA 8ICQA 4EENA 2G0AA 4CCHA 4NV0A 5CEHA 2VA8A 1S0VA 4M9LA 2HBMA 3TQ1A 3CW2C 5J2IA 1T8EA 2F77X 5DKWA 4ECRA 2IOHA 1N60A 4MF8A 1QLNA 2Q4TA 2FLLA 4QIWC 5DG8A 1UT8A 3RF9A 5HP4A 1V9PA 1L7MA 1ZQJA 2VANA 4I2DA 5GTIU 4DF4A 1ECWA 3KZXA 4QWDA 2IOFA 3RH4A 2G09A 2VKQA 4FE3A 4QWCA 2W54A 2ZG6A 2ZIWB 2F8LA 3FAHA 1IG6A 2W11A 4MHVA 2DL0A 3UQ2A 5DB9A 3QZ7A 2G5HB 5KFPA 5J29A 3ONNA 5HR6A 4IR9A 2W3RA 3PR5B 5KFSA 1Z00B 1N48A 3OSNA 4PGXA 2NRZA 5DQGA 2J6TA 1A77A 3ISCA 3H0RB 4AYBC 2KP7A 5KFMA 4KX3A 3G6XA 2W8KA 5CP2A 3TADC 5KNIA 2LMRA 2OWOA 3HX0A 4LZDA 3IV6A 3GIJA 5ALNA 2CN1A 4JMUA 4PZOA 9ICUA 5C0YA 3JPNA 7ICKA 4DL2A 4I28A 2I9GA 1BNOA 2K8CB 1TAMA 3G6YA 4QWBA 4RQ5A 3QUCA 4Y2VA 3BS5A 2JHDA 3RBDA 2LM4A 2PI4A 2PXIA 1XNSA 1QQ5A 3KBBA 3MR2A 1LVHA 3TI0A 4FBUA 3QX7A 4O3PA 2BCSA 4DL3A 1RQNA 4I2HA 4RPYA 5KT4A 4JV2A 5KFKA 1QSSA 3C2MA 2E8PA 1J2MA 4RT3A 7ICUA 2KSOB 2AJQA 1ZQOA 3E2EA 1HUZA 4RPZA 1QSYA 1RDFA 3KFUF 1JXLA 2KSOA 1TK8A 8ICYA 3MR5A 4J9SA 1DOQA 4RQNA 2F3NA 2ZIVB 4Y2UA 1ZQMA 3JPSA 1VJ5A 2YB4A 2A1JA 4OJLA 2Y0SC 5ALVA 5L1JA 2HHQA 1TAQA 2QB1A 3Q8LA 3QU4A 3GV5B 4ED6A 3WKCA 2KEYA 3DV9A 3JPOA 2D8CA 4EX6A 1F0MA 3FDSA 4JV1A 4ECUA 3OHBA 4C7YA 4NL9A 2QKQA 4QZHA 2WTFA 2E1EA 2JZBA 4RQ3A 5EOZA 1J97A 1ZQEA 1V97A 5B66U 1ZQLA 4AP9A 4CNQA 2M0NA 8ICXA 4E0DA 2K8BB 3N97B 2BCRA 4DSLA 2AH5A 2QB0A 4NL9C 2F1JA 3M8SA 3PW7A 4RQ6A 4Y2TA 5L1LA 4NJ8A 1PVPA 3EUB2 3IHQB 3RRGA 4XQ8A 7ICEA 1N5XA 4M04A 2HW3A 2W43A 4M6WA 1SV0A 4QZIA 1KRPA 5AI4A 5KFIA 4F5RA 2HHXA 5J0UA 5J0XA 3JPQA 1NK5A 1LB2B 2ZIUB 8ICKA 2HSZA 5DG9A 4IS7A 1SKRA 2P35A 3V72A 5DGBA 2WF6A 1X6IA 4F5OA 3LVWA 4G3IA 1ZJMA 4GLXA 2KZZA 4GC7A 3C28A 4UBBA 2RDIA 2KZ3A 2YY6A 2MA1A 3IG5A 4QZDA 2EAPA 4F4YA 9ICLA 3HKZF 5G5GA 2ZIXB 4DSJA 5AI6A 2NRWA 3ED5A 5EE1A 2QARB 3WU2U 1FEZA 1AQ6A 2H5XA 3ZD9A 4M9NA 4Y2XA 4YN4A 2V4QA 1SXEA 5AIBA 4MEYA 5J0OA 1JIHA 5KFRA 2HHSA 1HUOA 2IMWP 5AKLA 3M1YA 1TK0A 2ZUCA 4C8OA 2RP5A 1NKBA 1A0PA 3R9KA 2XY5A 3V7JA 4UQGA 1MQ2A 4KITB 4R66A 4DSIA 4NLCA 1GO3F 1ZQXA 3BDPA 3HRDD 2ISPA 4DWIA 3T79A 2N1RA 4KLOA 1NK8A 3KKAC 2ZJ8A 5AK4A 2E8MA 8ICTA 4NWIA 5ALTA 2F1HA 3HPOA 2ESEA 2FLPA 1F5SA 3FM9A 1D9DA 2R18A 1VDVA 2VJ4A 3H8WA 4KLFA 1RPLA 1L7PA 1D9FA 4YMMA 4I2EA 5ALGA 1QH9A 3Q8QB 1JALA 1V85A 2FMQA 5CJ7A 2DQNB 5J0SA 3L5KA 5AM1A 1N62A 2W9AA 2BDUA 5AHXA 4F4WA 4NLZA 4FZMA 4R8UB 2XCAA 3RJGA 1NJYA 1KEJA 2HHUA 3JPTA 3RAXA 2HVHA 3HJEA 1L3UA 1KL9A 3SEIA 3QYPA 4I2FA 1SKWA 5KG3A 2EZXA 3PSIA 1KTQA 3BQ0A 3RJKA 2WAQC 4DQSA 2C2RA 3I1YA 2PFOA 4BDPA 2KHVA 3AL0B 3MFIA 4YG2A 4UB1A 2LHTA 4M0AA 4KLMA 4UB6U 4HYKA 1U4BA 4F2RA 3F53A 4JWMA 3RB0A 4RNNA 4MF2A 4J9NA 4G9BA 4TQSA 4QZ9A 1DGSA 1QCKA 1SGGA 4IR1A 1NZBA 3MFHA 3BQ7A 1D8LA 9ICKA 4F72A 1U9LA 4B9TA 3M7DA 4DQPA 1MC8A 4B9VA 3M9MB 1DXSA 2I6XA 3ALRA 3KHHA 3RJFA 4QZFA 4OD0A 4P0QB 1L8OA 4IQUA 5KFNA 1LKYB 4OO1J 1SV0C 8ICNA 5KG1A 2W3SA 4JK1A 2K4HA 1FFUA 4Q44A 3HILA 1HIWA 4KMUA 2JH7A 2UVRA 3PMLA 1ZQQA 5KFBA 3GIIA 3GQCA 4UB3A 2WF7A 4M6WB 2WAQF 2FPKA 2NO4A 4QZ8A 1PVQA 5EE0A 3N7RC 4Y2RA 5AIAA 8ICUA 1NK0A 5KFFA 2CXYA 7ICMA 4F93B 4UBCA 5ALJA 5BOLA 3T5KA 3PV8A 3SV4A 4YMNA 3LWMA 5HHIA 4PZNA 1OXJA 1ZQSA 8ICWA 2KK0A 4KTQA 3AU6A 2R8GA 2GLEA 9ICCA 1ZQGA 1X2IA 5KFQA 4DLEA 1SZPA 1S0OA 3NTUA 3B0YA 1RYUA 3G6VA 5K4LA 4ACOA 4DQQA 5ALFA 1BPXA 3ZDDA 9ICOA 3H8MA 4DEZA 4J9KA 3NRZA 5GTHU 5AKEA 4OJ6A 1ZQYA 1KKXA 2FMPA 4PGQA 4RQ4A 4ED0A 1X9MA 5J0YA 5ALMA 2PI5A 2YX8A 4TURA 4DQIA 5HHHA 4I27A 4P0QA 2W55A 1O08A 4IRDA 7ICRA 3L3FX 2HHWA 2KJ8A 1BGXT 1BNPA 5ALIA 4F91B 1DK2A 4RUCA 1Q3UA 1BPYA 4LJXA 3PO4A 4RQMA 4AYBF 1OW5A 4UB4A 4K4HA 1S97A 2BCVA 3H8JA 9ICPA 5KTQA 4PL1A 5HMMA 3THVA 1JX4A 2LI6A 3EPIA 2VJ5A 4GC6A 5J2BA 3UXOA 2LKYA 2KNJA 5HR7A 1IXRA 3ISBA 1SL0A 1N56A 4ZH4A 3TFSA 5KG5A 5AKHA 2LYAA 2KFZA 2J6UA 9ICIA 3TADA 9ICMA 5J2CA 1Z3EB 5H2FU 4F4XA 3WK5A 1TFRA 4QZEA 3PY8A 2Y9UA 5F9LA 1JRPA 5EE3A 1KDHA 1ZQKA 4PPXA 3QU2A 2W04A 2GOLA 3C2KA 5CHGA 4YR3A 3NASA 5JUMA 2F76X 4F71A 5J2JA 5DQIA 4KX5A 3PO5A 5ALOA 9ICEA 3TAPA 1COOA 2XGPA 2AQ0A 2KE7A 3AUOA 8ICSA 4DOBA 2PFPA 1PK1B 3Q8RB 4GXIA 4MFFA 4RT2A 4QIWF 4DLGA 4C8NA 4UAUA 5AI9A 5TZVA 7ICOA 5AKJA 4RZRA 4ECXA 9ICRA 4FS1A 3OJSA 4O3QA 3FC4A 8ICPA 3KHGA 1NNLA 5KG4A 4CRXA 5CRXA 5DQHA 2ODGA 3PNCA 2H3FA 5L9XA 2G5IB 9ICNA 3OGUA 2W7OA 2LYBA 4DQRA 4NLKA 2GWSA 1SZHA 5D46A 5IILA 5CR0A 3RRHA 3V6KA 4PGYA 3A0BU 1JXEA 4C8MA 1NJXA 4RQ8A 4TUSA 3LDAA 4JUZA 3DDHA 2VA2A 5KFOA 3SAGA 2K4PA 5KG0A 3WK4A 4F50A 4Q45A 4KLDA 1U45A 2WFAA 3PR4A 5KFWA 4QW8A 2PFNA 2WF9A 3AQFA 4ELTA 5ALZA 1UCVA 1XC9A 2ZXHA 1Z00A 2DBYA 1T4GA 3RJEA 4ECYA 1ZQBA 4BXOB 5J8YC 4BJQA 2P66A 4RNMA 2XI9A 2F1IA 1WCNA 2JEGA 2NRXA 3IRUA 3SQIA 5KFVA 1ZQFA 2C2DA 8ICHA 4JWNA 1ED1A 2R8IA 4RQ7A 9ICVA 1UA1A 3UQ0A 4B9MA 2G06A 1RYRA 3RAQA 4UB8U 8ICVA 5ALHA 1JN3A 5ALDA 1XSNA 1DK3A 2FMSA 3F2BA 5KT7A 3UM9A 5KFGA 5AM3A 5ALQA 3UMCA 1RQLA 2YMMA
chains in the Genus database with same CATH topology
1PK3A 1LKYA 1LKYB 1X66A 2QB0A 2EAMA 2LPEA 1SV0C 2Y9TA 2ES6A 4NL9C 2E8NA 2ESEA 3BS5A 3KKAA 4RQMA 4NJ8A 3HILA 2EANA 5J8YA 1KW4A 1OW5A 5JTIA 2KIVA 1SV0A 1V85A 5F3XB 3IDWA 1COKA 2KMDA 2E8PA 4IS7A 3TACB 2KSOB 1B4FA 1SV4A 5JRTA 2KSOA 3TADA 2K4PA 2JV3A 3SEIA 5JU5A 4RQNA 2F3NA 1JI7A 2QB0B 2EAPA 4PZNA 2Y9UA 1B0XA 1OXJA 2D3DA 3BS5B 4MHVA 2FE9A 2DL0A 3K1RB 5L1MA 2GLEA 2QARB 2QARA 1UCVA 2KG5A 1WWUA 1UQVA 2QB1A 5J8YC 2YTUA 1SXDA 2F44A 1SXEA 2D8CA 1F0MA 2E8OA 1SGGA 2DKXA 1X9XA 4NL9A 3BQ7A 2QKQA 3H8MA 2B6GA 1V38A 2L5YA 2KE7A 2F8KA 3SENA 3TADC 5KNIA 1RG6A 1PK1B 2LMRA 3BS7A 1X40A 1DXSA 2DKZA 4PZOA 1PK1A 2K60A 1WWVA 3KKAC 2E8MA 1Z1VA 2EAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK3 A;  1LKY A;  1LKY B;  1X66 A;  2QB0 A;  2EAM A;  2LPE A;  1SV0 C;  2Y9T A;  2ES6 A;  4NL9 C;  2E8N A;  2ESE A;  3BS5 A;  3KKA A;  4RQM A;  4NJ8 A;  3HIL A;  2EAN A;  5J8Y A;  1KW4 A;  1OW5 A;  5JTI A;  2KIV A;  1SV0 A;  1V85 A;  5F3X B;  3IDW A;  1COK A;  2KMD A;  2E8P A;  4IS7 A;  3TAC B;  2KSO B;  1B4F A;  1SV4 A;  5JRT A;  2KSO A;  3TAD A;  2K4P A;  2JV3 A;  3SEI A;  5JU5 A;  4RQN A;  2F3N A;  1JI7 A;  2QB0 B;  2EAP A;  4PZN A;  2Y9U A;  1B0X A;  1OXJ A;  2D3D A;  3BS5 B;  4MHV A;  2FE9 A;  2DL0 A;  3K1R B;  5L1M A;  2GLE A;  2QAR B;  2QAR A;  1UCV A;  2KG5 A;  1WWU A;  1UQV A;  2QB1 A;  5J8Y C;  2YTU A;  1SXD A;  2F44 A;  1SXE A;  2D8C A;  1F0M A;  2E8O A;  1SGG A;  2DKX A;  1X9X A;  4NL9 A;  3BQ7 A;  2QKQ A;  3H8M A;  2B6G A;  1V38 A;  2L5Y A;  2KE7 A;  2F8K A;  3SEN A;  3TAD C;  5KNI A;  1RG6 A;  1PK1 B;  2LMR A;  3BS7 A;  1X40 A;  1DXS A;  2DKZ A;  4PZO A;  1PK1 A;  2K60 A;  1WWV A;  3KKA C;  2E8M A;  1Z1V A;  2EAO A; 
#chains in the Genus database with same CATH topology
 3NVV A;  2ZXI A;  5KFH A;  2F2A B;  1N63 A;  4US8 A;  2EAM A;  2LPE A;  4BWJ A;  8ICL A;  4US9 A;  1NI3 A;  5AI8 A;  2H3I A;  2NV3 A;  4K4I A;  1ZQR A;  3SD7 A;  5AI5 A;  4YR2 A;  2NO5 A;  2RHF A;  2C28 A;  4IQV A;  2BQR A;  3OSP A;  4O3O A;  4DSK A;  2GH1 A;  4HAI A;  2ZUB A;  4ECZ A;  4NLG A;  7ICI A;  1ZD5 A;  5ALR A;  4EBD A;  1B43 A;  4PL2 A;  3WK9 A;  1L3S A;  4JB3 A;  9ICA A;  3NVW A;  1U47 A;  2UVV A;  4YD1 A;  4UB2 A;  4PHP A;  3RB6 A;  3E58 A;  4PHA A;  3V7K A;  3RH6 A;  2NRT A;  1SB3 C;  4ED2 A;  3TFR A;  2QB0 B;  1XU4 A;  2D3D A;  1P7D A;  2BR0 A;  5ALU A;  1ZOL A;  2BKE A;  3ZD8 A;  3UXP A;  2FE9 A;  1C7Y A;  2XO7 A;  3AQE A;  5C5J A;  1XSP A;  3QXG A;  4P2H A;  5CWR A;  4DF8 A;  1ZQZ A;  3MC1 A;  4UB5 A;  7ICS A;  4YD2 A;  4IQW A;  1WYG A;  4DFM A;  3UMB A;  7ICP A;  5DG7 A;  2RRD A;  1NKE A;  4C8L A;  4GIB A;  4DSE A;  3IM1 A;  2CPR A;  1RG6 A;  1ZQH A;  4EBC A;  3PVX A;  1K1Q A;  5ALX A;  1NK9 A;  3QUB A;  3PW2 A;  2K4E A;  2K8A A;  1TV9 A;  3SYZ A;  3CYM A;  4LVS A;  3H0M B;  3OTQ A;  3H7I A;  4FS2 A;  4ECQ A;  3PX6 A;  2GO7 A;  3EWA A;  3KKA A;  1CI4 A;  4EZ6 A;  2BPC A;  3IN5 A;  3BZC A;  3F5E A;  4KMO B;  4RUA A;  1ZRM A;  1JUD A;  4PHD A;  4DFK A;  3AU2 A;  2B0C A;  4O5K A;  2LBO A;  7ICQ A;  3ORY A;  2WF8 A;  3TAC B;  3PSP A;  2KVC A;  4DS5 A;  5DB7 A;  1S0M A;  2A1A A;  3GIL A;  5CA7 A;  4UAS A;  4B9U A;  5EWF A;  1SL1 A;  4KLI A;  3ICX A;  4ELV A;  3WK7 A;  4J9L A;  4QZC A;  4KLG A;  1BPD A;  5KG6 A;  3MR6 A;  5G5H A;  8ICF A;  1H38 A;  4EBE A;  5AK3 A;  1TK5 A;  9ICS A;  4MEX A;  4NXZ A;  4F5Q A;  5IIK A;  2KG5 A;  4I2B A;  4C80 A;  2DWQ A;  2KHQ A;  1YT3 A;  4RNO A;  4O9M A;  5B5E U;  4Z6E A;  1IM4 A;  1SXD A;  2F44 A;  4NLB A;  5ALL A;  3S6J A;  4M9G A;  5AM0 A;  5J2G A;  9ICT A;  5AKG A;  5TIS U;  5IIO A;  3MDC A;  2FPM A;  4PH5 A;  5KT6 A;  1ARO P;  4KLT A;  3H4B A;  1ZRN A;  4KLL A;  1QQ7 A;  2MAX A;  3N7P D;  4OJO A;  2ALZ A;  4P0P B;  1L5U A;  1X40 A;  1T3Q A;  4YQW A;  2R8H A;  3D2N A;  1ZQV A;  1TE2 A;  2JEJ A;  3C5G A;  4QZA A;  5DBB A;  1B0X A;  3ZDB A;  2J6S A;  2RQ5 A;  4DOA A;  2Y9T A;  5BPC A;  1U49 A;  2W7P A;  5KFC A;  1NK6 A;  2KJ9 A;  3RBE A;  3NGD A;  1ZXI A;  8ICE A;  3WKD A;  1IV8 A;  1DRG A;  1ZJN A;  2KZM A;  3NVZ A;  4WJ3 B;  5KFY A;  4R8U A;  5D49 A;  2HOF A;  4R65 A;  2BZF A;  2LM1 A;  3QNM A;  2MRL A;  4X5V A;  4F5N A;  4A8E A;  4GXK A;  1F44 A;  2JR5 A;  2WHE A;  3TAR A;  1WG8 A;  5DDY A;  3V6J A;  3F5A A;  4F2S A;  2C22 A;  4UW9 A;  5KFE A;  3N28 A;  4XRH A;  5AM4 A;  5JU5 A;  3JPP A;  1L6N A;  1N2X A;  2YB1 A;  1BPE A;  3SAF A;  3IP4 B;  1YZ6 A;  3F2D A;  4QZB A;  4PHE A;  2DUY A;  3GU3 A;  4FFD A;  1WWU A;  4ECS A;  1CRX A;  4ELU A;  2BDP A;  2ASL A;  2PMZ F;  3E0F A;  4QW9 A;  5DBC A;  5DGA A;  5BOM A;  2MU2 A;  2KV2 A;  2E8O A;  5HML A;  2DKX A;  3BQ1 A;  8ICC A;  1M6Y A;  5AK6 A;  2L5Y A;  2HVI A;  2BPG A;  1ZD2 P;  1Q3V A;  2E5S A;  7ICH A;  5AI0 A;  1ZD3 A;  4M2Y A;  3GZF A;  2VIX A;  3SAH A;  3MGV A;  4MFC A;  2JH1 A;  4BWM A;  2EQY A;  2OCE A;  4DL6 A;  2K60 A;  1WWV A;  1XWL A;  3SZ2 A;  4QNL A;  5ALS A;  4QWA A;  4DFP A;  3SI8 A;  3EW9 A;  3H4D A;  1ZQI A;  4DL7 A;  4B9L A;  3WK6 A;  9ICB A;  3T3F A;  2E3T A;  4R63 A;  3LVV A;  1OUQ A;  1PVR A;  8ICR A;  4RQ1 A;  3WKB A;  1UT5 A;  5AIC A;  1D8Y A;  1K1S A;  4J9Q A;  2W03 A;  3T5J A;  4TUP A;  2HBK A;  1NZP A;  5IIJ A;  4UAW A;  1ZQT A;  3VC8 A;  3HKZ C;  3NRW A;  2KIV A;  4KLU A;  3C1Y A;  4KLE A;  4R64 A;  5IIN A;  1U48 A;  2IOF K;  1Z4O A;  4M9H A;  2HOI A;  1RYS A;  4J9O A;  3BQ2 A;  2W8L A;  3RB3 A;  2JV3 A;  5HNK A;  2C2E A;  3EYZ A;  5KFU A;  4U7C A;  1JI7 A;  2OH2 A;  5D4B A;  4B6J A;  4P4M A;  4O3S A;  4C0Z A;  2XGQ A;  5AKK A;  3BZK A;  5KFL A;  5L1M A;  5KFJ A;  4EYH B;  5KFA A;  2R8K A;  4YVZ A;  1A6S A;  4EEL A;  4YXJ A;  5AKY A;  2IHN A;  3HP6 A;  5J0T A;  8ICG A;  2LYH A;  2QLT A;  3C1Z A;  4IL6 U;  1ZQ1 C;  3ISD A;  3M9O B;  5J0W A;  3H0L B;  5AKI A;  2H3Q A;  4CF4 A;  3LK9 A;  2B6G A;  2YMP A;  2OEH A;  2EZY A;  3ZDA A;  1X6J A;  3C29 A;  2PKE A;  1ZQW A;  3KZI U;  3PSF A;  2B21 A;  2ZUD A;  2XCP A;  3KHL A;  2H3V A;  2G07 A;  4Q8F A;  3V7L A;  2Y1J A;  4EEK A;  1NOM A;  1SL2 A;  3PX4 A;  2DKZ A;  3OPX A;  5J2K A;  3M6Z A;  2EDU A;  3C5F A;  5L1I A;  2FDR A;  1LKY A;  3ETR A;  2W9M A;  1A76 A;  2WF5 A;  1S77 D;  5J2F A;  2KIC A;  5DB6 A;  2XID A;  5F9N A;  4ECW A;  2EAN A;  4KLJ A;  9ICG A;  1XO1 A;  2AU0 A;  2KIW A;  4BXO A;  9ICW A;  4J9M A;  3Q8M A;  5JTI A;  1MN8 A;  2ASD A;  1MA7 A;  5KFT A;  7ICG A;  3IDW A;  2FJ6 A;  2BQU A;  7ICF A;  2V9W A;  1FFV A;  4O5C A;  5KAI U;  3GIK A;  2KMD A;  3D2S A;  2WB1 F;  5JRT A;  2K4I A;  4RQ0 A;  3PMN A;  4P0P A;  4UAV A;  5KL8 B;  2AGQ A;  4TQR A;  1XSL A;  3K75 D;  1RM6 C;  1NJZ A;  3TAN A;  2AQ4 A;  2RDJ A;  3VCB A;  5KFD A;  5EWE A;  7ICV A;  3D6J A;  3PZP A;  3ZDC A;  2UVW A;  4YP3 A;  3UXN A;  4FZL A;  5DLG A;  9ICQ A;  3SR6 A;  2QAR A;  4FBT A;  2YTU A;  2A3V A;  3N4M B;  3LWL A;  1TVA A;  2JRZ A;  4RU9 A;  2BGW A;  3HW8 A;  4IQT A;  1B22 A;  2EH9 A;  2BCU A;  1KFD A;  3TKA A;  1SWV A;  5EWG A;  2NRV A;  1L3T A;  2M9N A;  5KL1 B;  3H40 A;  2BCQ A;  2YML A;  3SEN A;  1ZET A;  2OHF A;  2AGO A;  8ICI A;  3H8S A;  2HDO A;  3EPG A;  2OXO A;  3C2L A;  4O0I A;  7ICL A;  5ALY A;  4I2J A;  4NM1 A;  1JMS A;  4ED1 A;  3M6K A;  1S0N A;  3QEA Z;  5DDM A;  3KTQ A;  3MGH A;  2YN4 A;  4KLH A;  1CEZ A;  2ES6 A;  1L3V A;  1WUD A;  2OYY A;  2V4R A;  3BJY A;  1ZQA A;  4ZOH C;  4EZ9 A;  3L4P A;  9ICX A;  2R8J A;  5KFX A;  2O6K A;  4F5P A;  3GV8 B;  4GXJ A;  5L1K A;  2BPF A;  4NY8 A;  1BVS A;  2XC9 A;  1C20 A;  5KT3 A;  3ETL A;  5F3X B;  3AMZ A;  4BUG A;  4M9J A;  3MBY A;  9ICH A;  2JGA A;  4Y2Q A;  1ZQD A;  1J2N A;  2FPL A;  4ED7 A;  3KD3 A;  1JRO A;  3PX0 A;  3CNH A;  4TUQ A;  7ICT A;  2I5H A;  1UA0 A;  2ZTD A;  5J2E A;  1O03 A;  2OM6 A;  2P6U A;  5AK5 A;  1S8O A;  3F2C A;  5KAF U;  2Q0Z X;  3CRX A;  2MUT A;  4BGD A;  3BS5 B;  5J2D A;  1RXW A;  3EZ5 A;  3A0H U;  5KG7 A;  3NUQ A;  3K1R B;  2MSN A;  4O3M A;  3O0F A;  5DLF A;  2ZTE A;  2KJ5 A;  4Q43 A;  1SWW A;  4CDG A;  5EE9 A;  4ED8 A;  4LZG A;  3J81 j;  2ZJ5 A;  5KG2 A;  8ICO A;  1X9X A;  3B9J A;  3D2Q A;  7ICN A;  5ALP A;  3DEE A;  2DPJ A;  1V38 A;  5AKX A;  4QZG A;  2ZIU A;  1L7O A;  4YXM A;  2F8K A;  5DB8 A;  2HOQ A;  2Z7J A;  3WK8 A;  3RJJ A;  1KN5 A;  3RJI A;  1K5O A;  5AM2 A;  5CB1 A;  1TKD A;  1URJ A;  1HJP A;  2ASJ A;  4B9S A;  2ZIV A;  4P4P A;  2FLN A;  5J2A A;  1Z1V A;  2KKP A;  2KKV A;  1KSP A;  3QU5 A;  2EZZ A;  2DF4 B;  4DS4 A;  1NK7 A;  1X66 A;  2ISO A;  1ZYQ A;  3HT3 A;  2ZIW A;  3RTV A;  2BQ3 A;  3PW0 A;  4PJ0 U;  1X9W A;  4OCZ A;  1RXV A;  4F4Z A;  3OHA A;  8ICZ A;  4NM2 A;  2NYV A;  4CF3 A;  2AGP A;  2HMX A;  5J8Y A;  2XY7 A;  1Y88 A;  4I2A A;  4BX9 C;  2HHT A;  2YQE A;  4Y2S A;  1SIJ A;  3T5L A;  2A19 A;  4CGZ A;  4Z6C A;  2UVU A;  3MAB A;  2JZB B;  1EXN A;  3NVY A;  3M9N B;  2XY6 A;  3I76 A;  4ICA A;  1UPH A;  1MSW D;  4O5E A;  4XUS A;  4UAY A;  5J0Q A;  4UAR A;  1ZQU A;  3HWT A;  3PW5 A;  4IRK A;  3CP8 A;  3B0X A;  1FIQ A;  3KOO A;  4YMO A;  4MFA A;  4QJF B;  3T5H A;  2P6R A;  5E79 U;  4J9P A;  1KBU A;  3QU9 A;  1XO0 A;  3WKA A;  3QEB Z;  1QQ6 A;  1BPZ A;  4CF5 A;  3RH5 A;  2AXT U;  4CE6 A;  1T7P A;  1SKS A;  9ICF A;  4DFJ A;  4ED3 A;  2W9B A;  3BQT A;  3AN1 A;  5J2H A;  1PUZ A;  3C21 A;  4KLQ A;  4RQ2 A;  1D8B A;  2W9B B;  4KN4 A;  3QU7 A;  1NK4 A;  9ICJ A;  4DSF A;  4KLS A;  3N7S C;  1PK1 A;  4C4S A;  5A0L A;  1T3N A;  2XIC A;  3KHR A;  4I2C A;  8ICA A;  1PK3 A;  2YMQ A;  4P4O A;  1S5L U;  3K4G A;  2IHM A;  2E8N A;  3RR8 A;  7ICJ A;  2PMZ C;  1Z19 A;  2CRX A;  4M47 A;  2DFL A;  2IA6 A;  4Y2P A;  4XA5 A;  3NS1 A;  4OJ5 A;  2IBK A;  2AHO B;  1BPB A;  4F92 B;  2HBJ A;  3PW4 A;  5AKZ A;  1ZQP A;  2PFQ A;  4YCX A;  4USA A;  1NKC A;  2E1F A;  4IC9 A;  8ICJ A;  1QTM A;  1NJW A;  2K89 A;  2W9C B;  4JV0 A;  1L8L A;  4FZN A;  2KFN A;  2Y1I A;  3I28 A;  1IIP A;  2I1Q A;  4C4T A;  3JPR A;  3WKE A;  1UHU A;  2FI1 A;  2KN7 A;  1KFS A;  3M8R A;  4FO6 A;  4DO9 A;  4F4K A;  2DGZ A;  4DOC A;  4ECT A;  3Q8K A;  2KVS A;  1YZ7 A;  3MGI A;  1ZQC A;  5IIM A;  3ZI4 A;  4DFD A;  5T14 A;  4Y2J A;  2RLT A;  1Z1B A;  1Q46 A;  4DL4 A;  1UQV A;  1MQ3 A;  1X42 A;  4DCC A;  4C7Z A;  5ALW A;  4I2I A;  1L7N A;  5AM5 A;  1N61 A;  2W9C A;  3UMG A;  3RB4 A;  4Y2Y A;  2JEI A;  4I2G A;  3AM9 A;  3AEV A;  3V6H A;  5KT2 A;  1S9F A;  1FO4 A;  3SV3 A;  3Q8P B;  4I29 A;  4IRC A;  3MR3 A;  1Q8K A;  4Q8E A;  1CUK A;  4O3R A;  4YR0 A;  3QZ8 A;  4K4G A;  4QWE A;  2MUT B;  3C23 A;  5J0R A;  2HBL A;  3U26 A;  1KQQ A;  3SMV A;  2VA3 A;  1Z4N A;  2A1J B;  1XS9 D;  2HHV A;  4Z6F A;  3RR7 A;  3QUQ A;  1HEK A;  2H3Z A;  4B9N A;  2JXJ A;  5KFZ A;  1S76 D;  1RZT A;  4OJP A;  4EEY A;  1N5W A;  3MDA A;  3TAQ A;  1KFT A;  1KW4 A;  3ZDE A;  3QUT A;  2KOB A;  3GFK B;  8ICB A;  3GV7 B;  1COK A;  4UAT A;  1QSL A;  2JEF A;  1WCL A;  1VLB A;  3GIM A;  4Z6D A;  2ZJA A;  3QE9 Y;  2DPI A;  1DGJ A;  1B4F A;  3Q8S B;  1SV4 A;  5ALE A;  3RFA A;  4J03 A;  3FYH A;  5FP0 A;  3PST A;  2BHN A;  1S10 A;  1KLN A;  4DL5 A;  2WB1 C;  4EX7 A;  5DBA A;  3GDX A;  4RPX A;  4J9R A;  2ZIX A;  2KD1 A;  1T94 A;  3LYS A;  3RJH A;  4KN7 A;  4C8K A;  2XVT A;  3K1Z A;  2HI0 A;  2ZTC A;  4GFJ A;  4NLN A;  2JMG A;  2D6F C;  4U6P A;  5III A;  4F8R A;  1LV5 A;  2KTQ A;  2HCF A;  1ZD4 A;  2G08 A;  5ALK A;  5KT5 A;  4ECV A;  4O3N A;  3UPQ A;  4YFK A;  5J0P A;  1TAU A;  8ICM A;  1ZQN A;  3BS7 A;  1X9S A;  4C4R A;  2Y0S F;  4EYI B;  4F3O A;  4UAZ A;  3OJU A;  1PZN A;  2EAO A;  3IG8 A;  2ATL A;  8ICQ A;  4EEN A;  2G0A A;  4CCH A;  4NV0 A;  5CEH A;  2VA8 A;  1S0V A;  4M9L A;  2HBM A;  3TQ1 A;  3CW2 C;  5J2I A;  1T8E A;  2F77 X;  5DKW A;  4ECR A;  2IOH A;  1N60 A;  4MF8 A;  1QLN A;  2Q4T A;  2FLL A;  4QIW C;  5DG8 A;  1UT8 A;  3RF9 A;  5HP4 A;  1V9P A;  1L7M A;  1ZQJ A;  2VAN A;  4I2D A;  5GTI U;  4DF4 A;  1ECW A;  3KZX A;  4QWD A;  2IOF A;  3RH4 A;  2G09 A;  2VKQ A;  4FE3 A;  4QWC A;  2W54 A;  2ZG6 A;  2ZIW B;  2F8L A;  3FAH A;  1IG6 A;  2W11 A;  4MHV A;  2DL0 A;  3UQ2 A;  5DB9 A;  3QZ7 A;  2G5H B;  5KFP A;  5J29 A;  3ONN A;  5HR6 A;  4IR9 A;  2W3R A;  3PR5 B;  5KFS A;  1Z00 B;  1N48 A;  3OSN A;  4PGX A;  2NRZ A;  5DQG A;  2J6T A;  1A77 A;  3ISC A;  3H0R B;  4AYB C;  2KP7 A;  5KFM A;  4KX3 A;  3G6X A;  2W8K A;  5CP2 A;  3TAD C;  5KNI A;  2LMR A;  2OWO A;  3HX0 A;  4LZD A;  3IV6 A;  3GIJ A;  5ALN A;  2CN1 A;  4JMU A;  4PZO A;  9ICU A;  5C0Y A;  3JPN A;  7ICK A;  4DL2 A;  4I28 A;  2I9G A;  1BNO A;  2K8C B;  1TAM A;  3G6Y A;  4QWB A;  4RQ5 A;  3QUC A;  4Y2V A;  3BS5 A;  2JHD A;  3RBD A;  2LM4 A;  2PI4 A;  2PXI A;  1XNS A;  1QQ5 A;  3KBB A;  3MR2 A;  1LVH A;  3TI0 A;  4FBU A;  3QX7 A;  4O3P A;  2BCS A;  4DL3 A;  1RQN A;  4I2H A;  4RPY A;  5KT4 A;  4JV2 A;  5KFK A;  1QSS A;  3C2M A;  2E8P A;  1J2M A;  4RT3 A;  7ICU A;  2KSO B;  2AJQ A;  1ZQO A;  3E2E A;  1HUZ A;  4RPZ A;  1QSY A;  1RDF A;  3KFU F;  1JXL A;  2KSO A;  1TK8 A;  8ICY A;  3MR5 A;  4J9S A;  1DOQ A;  4RQN A;  2F3N A;  2ZIV B;  4Y2U A;  1ZQM A;  3JPS A;  1VJ5 A;  2YB4 A;  2A1J A;  4OJL A;  2Y0S C;  5ALV A;  5L1J A;  2HHQ A;  1TAQ A;  2QB1 A;  3Q8L A;  3QU4 A;  3GV5 B;  4ED6 A;  3WKC A;  2KEY A;  3DV9 A;  3JPO A;  2D8C A;  4EX6 A;  1F0M A;  3FDS A;  4JV1 A;  4ECU A;  3OHB A;  4C7Y A;  4NL9 A;  2QKQ A;  4QZH A;  2WTF A;  2E1E A;  2JZB A;  4RQ3 A;  5EOZ A;  1J97 A;  1ZQE A;  1V97 A;  5B66 U;  1ZQL A;  4AP9 A;  4CNQ A;  2M0N A;  8ICX A;  4E0D A;  2K8B B;  3N97 B;  2BCR A;  4DSL A;  2AH5 A;  2QB0 A;  4NL9 C;  2F1J A;  3M8S A;  3PW7 A;  4RQ6 A;  4Y2T A;  5L1L A;  4NJ8 A;  1PVP A;  3EUB 2;  3IHQ B;  3RRG A;  4XQ8 A;  7ICE A;  1N5X A;  4M04 A;  2HW3 A;  2W43 A;  4M6W A;  1SV0 A;  4QZI A;  1KRP A;  5AI4 A;  5KFI A;  4F5R A;  2HHX A;  5J0U A;  5J0X A;  3JPQ A;  1NK5 A;  1LB2 B;  2ZIU B;  8ICK A;  2HSZ A;  5DG9 A;  4IS7 A;  1SKR A;  2P35 A;  3V72 A;  5DGB A;  2WF6 A;  1X6I A;  4F5O A;  3LVW A;  4G3I A;  1ZJM A;  4GLX A;  2KZZ A;  4GC7 A;  3C28 A;  4UBB A;  2RDI A;  2KZ3 A;  2YY6 A;  2MA1 A;  3IG5 A;  4QZD A;  2EAP A;  4F4Y A;  9ICL A;  3HKZ F;  5G5G A;  2ZIX B;  4DSJ A;  5AI6 A;  2NRW A;  3ED5 A;  5EE1 A;  2QAR B;  3WU2 U;  1FEZ A;  1AQ6 A;  2H5X A;  3ZD9 A;  4M9N A;  4Y2X A;  4YN4 A;  2V4Q A;  1SXE A;  5AIB A;  4MEY A;  5J0O A;  1JIH A;  5KFR A;  2HHS A;  1HUO A;  2IMW P;  5AKL A;  3M1Y A;  1TK0 A;  2ZUC A;  4C8O A;  2RP5 A;  1NKB A;  1A0P A;  3R9K A;  2XY5 A;  3V7J A;  4UQG A;  1MQ2 A;  4KIT B;  4R66 A;  4DSI A;  4NLC A;  1GO3 F;  1ZQX A;  3BDP A;  3HRD D;  2ISP A;  4DWI A;  3T79 A;  2N1R A;  4KLO A;  1NK8 A;  3KKA C;  2ZJ8 A;  5AK4 A;  2E8M A;  8ICT A;  4NWI A;  5ALT A;  2F1H A;  3HPO A;  2ESE A;  2FLP A;  1F5S A;  3FM9 A;  1D9D A;  2R18 A;  1VDV A;  2VJ4 A;  3H8W A;  4KLF A;  1RPL A;  1L7P A;  1D9F A;  4YMM A;  4I2E A;  5ALG A;  1QH9 A;  3Q8Q B;  1JAL A;  1V85 A;  2FMQ A;  5CJ7 A;  2DQN B;  5J0S A;  3L5K A;  5AM1 A;  1N62 A;  2W9A A;  2BDU A;  5AHX A;  4F4W A;  4NLZ A;  4FZM A;  4R8U B;  2XCA A;  3RJG A;  1NJY A;  1KEJ A;  2HHU A;  3JPT A;  3RAX A;  2HVH A;  3HJE A;  1L3U A;  1KL9 A;  3SEI A;  3QYP A;  4I2F A;  1SKW A;  5KG3 A;  2EZX A;  3PSI A;  1KTQ A;  3BQ0 A;  3RJK A;  2WAQ C;  4DQS A;  2C2R A;  3I1Y A;  2PFO A;  4BDP A;  2KHV A;  3AL0 B;  3MFI A;  4YG2 A;  4UB1 A;  2LHT A;  4M0A A;  4KLM A;  4UB6 U;  4HYK A;  1U4B A;  4F2R A;  3F53 A;  4JWM A;  3RB0 A;  4RNN A;  4MF2 A;  4J9N A;  4G9B A;  4TQS A;  4QZ9 A;  1DGS A;  1QCK A;  1SGG A;  4IR1 A;  1NZB A;  3MFH A;  3BQ7 A;  1D8L A;  9ICK A;  4F72 A;  1U9L A;  4B9T A;  3M7D A;  4DQP A;  1MC8 A;  4B9V A;  3M9M B;  1DXS A;  2I6X A;  3ALR A;  3KHH A;  3RJF A;  4QZF A;  4OD0 A;  4P0Q B;  1L8O A;  4IQU A;  5KFN A;  1LKY B;  4OO1 J;  1SV0 C;  8ICN A;  5KG1 A;  2W3S A;  4JK1 A;  2K4H A;  1FFU A;  4Q44 A;  3HIL A;  1HIW A;  4KMU A;  2JH7 A;  2UVR A;  3PML A;  1ZQQ A;  5KFB A;  3GII A;  3GQC A;  4UB3 A;  2WF7 A;  4M6W B;  2WAQ F;  2FPK A;  2NO4 A;  4QZ8 A;  1PVQ A;  5EE0 A;  3N7R C;  4Y2R A;  5AIA A;  8ICU A;  1NK0 A;  5KFF A;  2CXY A;  7ICM A;  4F93 B;  4UBC A;  5ALJ A;  5BOL A;  3T5K A;  3PV8 A;  3SV4 A;  4YMN A;  3LWM A;  5HHI A;  4PZN A;  1OXJ A;  1ZQS A;  8ICW A;  2KK0 A;  4KTQ A;  3AU6 A;  2R8G A;  2GLE A;  9ICC A;  1ZQG A;  1X2I A;  5KFQ A;  4DLE A;  1SZP A;  1S0O A;  3NTU A;  3B0Y A;  1RYU A;  3G6V A;  5K4L A;  4ACO A;  4DQQ A;  5ALF A;  1BPX A;  3ZDD A;  9ICO A;  3H8M A;  4DEZ A;  4J9K A;  3NRZ A;  5GTH U;  5AKE A;  4OJ6 A;  1ZQY A;  1KKX A;  2FMP A;  4PGQ A;  4RQ4 A;  4ED0 A;  1X9M A;  5J0Y A;  5ALM A;  2PI5 A;  2YX8 A;  4TUR A;  4DQI A;  5HHH A;  4I27 A;  4P0Q A;  2W55 A;  1O08 A;  4IRD A;  7ICR A;  3L3F X;  2HHW A;  2KJ8 A;  1BGX T;  1BNP A;  5ALI A;  4F91 B;  1DK2 A;  4RUC A;  1Q3U A;  1BPY A;  4LJX A;  3PO4 A;  4RQM A;  4AYB F;  1OW5 A;  4UB4 A;  4K4H A;  1S97 A;  2BCV A;  3H8J A;  9ICP A;  5KTQ A;  4PL1 A;  5HMM A;  3THV A;  1JX4 A;  2LI6 A;  3EPI A;  2VJ5 A;  4GC6 A;  5J2B A;  3UXO A;  2LKY A;  2KNJ A;  5HR7 A;  1IXR A;  3ISB A;  1SL0 A;  1N56 A;  4ZH4 A;  3TFS A;  5KG5 A;  5AKH A;  2LYA A;  2KFZ A;  2J6U A;  9ICI A;  3TAD A;  9ICM A;  5J2C A;  1Z3E B;  5H2F U;  4F4X A;  3WK5 A;  1TFR A;  4QZE A;  3PY8 A;  2Y9U A;  5F9L A;  1JRP A;  5EE3 A;  1KDH A;  1ZQK A;  4PPX A;  3QU2 A;  2W04 A;  2GOL A;  3C2K A;  5CHG A;  4YR3 A;  3NAS A;  5JUM A;  2F76 X;  4F71 A;  5J2J A;  5DQI A;  4KX5 A;  3PO5 A;  5ALO A;  9ICE A;  3TAP A;  1COO A;  2XGP A;  2AQ0 A;  2KE7 A;  3AUO A;  8ICS A;  4DOB A;  2PFP A;  1PK1 B;  3Q8R B;  4GXI A;  4MFF A;  4RT2 A;  4QIW F;  4DLG A;  4C8N A;  4UAU A;  5AI9 A;  5TZV A;  7ICO A;  5AKJ A;  4RZR A;  4ECX A;  9ICR A;  4FS1 A;  3OJS A;  4O3Q A;  3FC4 A;  8ICP A;  3KHG A;  1NNL A;  5KG4 A;  4CRX A;  5CRX A;  5DQH A;  2ODG A;  3PNC A;  2H3F A;  5L9X A;  2G5I B;  9ICN A;  3OGU A;  2W7O A;  2LYB A;  4DQR A;  4NLK A;  2GWS A;  1SZH A;  5D46 A;  5IIL A;  5CR0 A;  3RRH A;  3V6K A;  4PGY A;  3A0B U;  1JXE A;  4C8M A;  1NJX A;  4RQ8 A;  4TUS A;  3LDA A;  4JUZ A;  3DDH A;  2VA2 A;  5KFO A;  3SAG A;  2K4P A;  5KG0 A;  3WK4 A;  4F50 A;  4Q45 A;  4KLD A;  1U45 A;  2WFA A;  3PR4 A;  5KFW A;  4QW8 A;  2PFN A;  2WF9 A;  3AQF A;  4ELT A;  5ALZ A;  1UCV A;  1XC9 A;  2ZXH A;  1Z00 A;  2DBY A;  1T4G A;  3RJE A;  4ECY A;  1ZQB A;  4BXO B;  5J8Y C;  4BJQ A;  2P66 A;  4RNM A;  2XI9 A;  2F1I A;  1WCN A;  2JEG A;  2NRX A;  3IRU A;  3SQI A;  5KFV A;  1ZQF A;  2C2D A;  8ICH A;  4JWN A;  1ED1 A;  2R8I A;  4RQ7 A;  9ICV A;  1UA1 A;  3UQ0 A;  4B9M A;  2G06 A;  1RYR A;  3RAQ A;  4UB8 U;  8ICV A;  5ALH A;  1JN3 A;  5ALD A;  1XSN A;  1DK3 A;  2FMS A;  3F2B A;  5KT7 A;  3UM9 A;  5KFG A;  5AM3 A;  5ALQ A;  3UMC A;  1RQL A;  2YMM A; 
#chains in the Genus database with same CATH homology
 1PK3 A;  1LKY A;  1LKY B;  1X66 A;  2QB0 A;  2EAM A;  2LPE A;  1SV0 C;  2Y9T A;  2ES6 A;  4NL9 C;  2E8N A;  2ESE A;  3BS5 A;  3KKA A;  4RQM A;  4NJ8 A;  3HIL A;  2EAN A;  5J8Y A;  1KW4 A;  1OW5 A;  5JTI A;  2KIV A;  1SV0 A;  1V85 A;  5F3X B;  3IDW A;  1COK A;  2KMD A;  2E8P A;  4IS7 A;  3TAC B;  2KSO B;  1B4F A;  1SV4 A;  5JRT A;  2KSO A;  3TAD A;  2K4P A;  2JV3 A;  3SEI A;  5JU5 A;  4RQN A;  2F3N A;  1JI7 A;  2QB0 B;  2EAP A;  4PZN A;  2Y9U A;  1B0X A;  1OXJ A;  2D3D A;  3BS5 B;  4MHV A;  2FE9 A;  2DL0 A;  3K1R B;  5L1M A;  2GLE A;  2QAR B;  2QAR A;  1UCV A;  2KG5 A;  1WWU A;  1UQV A;  2QB1 A;  5J8Y C;  2YTU A;  1SXD A;  2F44 A;  1SXE A;  2D8C A;  1F0M A;  2E8O A;  1SGG A;  2DKX A;  1X9X A;  4NL9 A;  3BQ7 A;  2QKQ A;  3H8M A;  2B6G A;  1V38 A;  2L5Y A;  2KE7 A;  2F8K A;  3SEN A;  3TAD C;  5KNI A;  1RG6 A;  1PK1 B;  2LMR A;  3BS7 A;  1X40 A;  1DXS A;  2DKZ A;  4PZO A;  1PK1 A;  2K60 A;  1WWV A;  3KKA C;  2E8M A;  1Z1V A;  2EAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...