3HILA

Sam domain of human ephrin type-a receptor 1 (epha1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
GIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 1
publication title SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1).
rcsb
source organism Homo sapiens
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3hilA00
3KKAA 2KG5A 3BS7A 3SEIA 3HILA 2KSOA 2DKXA 1DXSA 5KNIA 2DKZA 2LPEA 1OW5A 2QARB 2E8OA 3IDWA 4MHVA 3BS5A 3KKAC 2Y9UA 2F3NA 3BQ7A 2E8NA 1KW4A 5L1MA 2JV3A 2QARA 1PK1A 2QB1A 1JI7A 2KE7A 1SXEA 5J8YC 1X40A 1SXDA 1UCVA 1V38A 2LMRA 4IS7A 1B0XA 2KMDA 4NL9C 1COKA 2E8PA 1WWVA 2EAPA 5JRTA 1SV0A 2F8KA 4PZOA 2QB0B 2KIVA 5JU5A 1Z1VA 3TADA 2F44A 5F3XB 1UQVA 2Y9TA 2YTUA 1WWUA 3TACB 1SV0C 2FE9A 1B4FA 1PK3A 2EANA 2K60A 2QKQA 2L5YA 3TADC 2ES6A 1LKYB 2EAOA 1X66A 3K1RB 1X9XA 2DL0A 2E8MA 1RG6A 1SGGA 2D8CA 4PZNA 1LKYA 3BS5B 2B6GA 1SV4A 1V85A 4NJ8A 2EAMA 2QB0A 3H8MA 4RQNA 2D3DA 5JTIA 2ESEA 5J8YA 1PK1B 2GLEA 4RQMA 1OXJA 2K4PA 3SENA 1F0MA 4NL9A 2KSOB
chains in the Genus database with same CATH superfamily
4J9PA 2GO7A 3OPXA 3GIJA 1IIPA 2FPMA 3VCBA 5KT4A 2HBKA 4IC9A 1VJ5A 2A1AA 2WB1C 3GDXA 4B9TA 4UAZA 2ZUDA 2E8OA 1ZQRA 4JV1A 5T14A 4ZOHC 2F3NA 5IIJA 5KT5A 3F53A 4ED1A 3ONNA 4ED8A 2BQ3A 1SWWA 4RQ0A 1M6YA 4I29A 2XY5A 2M9NA 2G5IB 3GFKB 3PO5A 2PI5A 2BCRA 1KKXA 3AQFA 2ZIXB 5J2GA 4UB1A 2BPFA 1T4GA 4G3IA 7ICGA 1TK8A 3GU3A 4BUGA 8ICHA 4JB3A 3E0FA 5G5GA 1ZQGA 1MN8A 3CP8A 4FS2A 4CRXA 1WCLA 4WJ3B 1ZQPA 4ZH4A 5DQIA 9ICSA 3DEEA 4UB6U 2KD1A 5B66U 2W9BB 4M0AA 4M9LA 2MA1A 5ALZA 5HMLA 3UMGA 3WKCA 4QIWF 3EPIA 3EPGA 4ECTA 4YMNA 5L1LA 1DK2A 3C21A 1J2MA 2XGPA 5J2CA 2R8GA 2FI1A 3QXGA 4RQ4A 3JPNA 5J0XA 2W9CA 4PGXA 2FLNA 3ALRA 3CW2C 2XY6A 1TV9A 4JWNA 3HPOA 4DL2A 2O6KA 4IRDA 3OGUA 4NL9A 4RT3A 2JEJA 5DLGA 4KLSA 2R8IA 3QZ8A 5ALHA 2XO7A 1WCNA 2B21A 4DSFA 2HVIA 3F5AA 5CEHA 1QQ7A 4DS5A 1Z4OA 1X42A 4NLNA 2BCQA 5AICA 3PMNA 3OHBA 4MF2A 5IILA 3BQ0A 7ICHA 2AGOA 2XI9A 1X40A 2EH9A 4C80A 4K4IA 2LMRA 3SMVA 1CRXA 4DWIA 2V4RA 3RB3A 4OJ6A 4XUSA 2JMGA 1MQ2A 1SV0A 4QWAA 4RQ3A 1S0MA 2VANA 3M6KA 2H3VA 3C2LA 2KVCA 4MEXA 4DQSA 5DB8A 1SKRA 1UA1A 4FZMA 4DQRA 3RRHA 1SV0C 5AIBA 4P2HA 1BPZA 5ALMA 1N62A 2FE9A 2ZIUB 2LYHA 3LDAA 2JZBB 4M47A 1WG8A 2WAQF 1L8LA 5J2EA 5KFDA 2BCVA 2OWOA 8ICUA 1WYGA 1L3TA 5J0UA 4O3PA 2NO5A 3N7SC 4RQNA 4F5PA 5ALWA 2C28A 3D2QA 1BVSA 3LWMA 2PMZC 4KLOA 1DRGA 5DQHA 3PW7A 3RJFA 2K8BB 2K4PA 9ICEA 4DSEA 4FBUA 5KG0A 3BS7A 2W11A 2CN1A 3WK5A 3JPQA 4PGQA 2XICA 4UB3A 2AXTU 1BPDA 4EYHB 4UB2A 1NK4A 3Q8RB 1FEZA 5BOLA 3PMLA 1X9MA 1ZQIA 1NKBA 1L6NA 4ED6A 5ALPA 4ECUA 4KLUA 2MAXA 1ZETA 2C22A 1TAUA 1PK1A 3THVA 4YR3A 1JI7A 4FZNA 3KOOA 4PHEA 4EEKA 1S5LU 1OUQA 4NLKA 2DQNB 7ICEA 1ZQWA 1NK7A 1RDFA 2JH1A 4USAA 5AI9A 3OJSA 3WK9A 5ALJA 2FMSA 2DF4B 2KFZA 3MGVA 4OJOA 3PW4A 3O0FA 2AGPA 2NRWA 2RQ5A 4YD2A 5AKJA 4DL7A 1UHUA 5C0YA 4UB5A 3GQCA 1Z1VA 5KT6A 2IBKA 3S6JA 2DWQA 4BGDA 4GIBA 4RNOA 5KFVA 1KL9A 5KG7A 2UVVA 1HJPA 2PKEA 3NVYA 2K4EA 2G09A 1Z1BA 2QKQA 5HHHA 1ZQCA 4YVZA 2OH2A 3KD3A 3FAHA 3LWLA 3IG8A 3SZ2A 4I2CA 4F5OA 4O9MA 4CE6A 1KFTA 2W3RA 2K4IA 5ALUA 2ZUCA 2DBYA 5JTIA 1RQLA 4KLDA 3Q8LA 5KFYA 4FE3A 3SV4A 7ICMA 8ICJA 2HCFA 1N5XA 4J03A 2MU2A 2JHDA 2EDUA 4DFDA 4O0IA 2CRXA 3AM9A 8ICRA 1XC9A 4KLQA 2JEIA 3SEIA 2C2DA 4DQPA 2RDJA 3C1YA 4I2DA 4EZ6A 4IQVA 1ZQNA 3RAQA 3V6HA 1TAQA 1NKCA 1UT5A 2DKZA 3MGHA 1JIHA 2QARB 3DV9A 5DB6A 3UXNA 2BDUA 4EENA 3RJEA 2G0AA 3QUCA 3QYPA 2LBOA 4UAWA 1L5UA 3NRWA 4EX7A 1U48A 2YMPA 4QZEA 4RNMA 4CDGA 1NK8A 4BXOA 5EE0A 3PV8A 1T7PA 1UCVA 2AQ4A 3AEVA 5TISU 4YG2A 3GV5B 4OD0A 4M9GA 2XC9A 2D6FC 4YP3A 2KHQA 2LKYA 4PPXA 9ICWA 2LM4A 3HKZC 5B5EU 1AROP 1BNOA 5DG9A 2ZIVB 2V9WA 3TFSA 1ZRNA 3M6ZA 1XS9D 4DCCA 5KG4A 2RRDA 2MRLA 3TARA 2F1IA 7ICKA 5KFGA 2YB4A 3HRDD 4US9A 1JALA 1ED1A 1VLBA 4TQRA 1N56A 4F91B 2LYAA 5A0LA 1KEJA 3RAXA 4EZ9A 4K4HA 1TFRA 4P0PB 5D46A 4IR9A 4F4XA 1Q3UA 4R8UA 2YQEA 1IV8A 4P4OA 2KSOB 4QZ9A 3PSPA 2BKEA 4EYIB 2ATLA 1RZTA 2F2AB 3SD7A 5KG3A 4RPYA 1DXSA 7ICVA 8ICMA 4QZ8A 1PVRA 1ZQYA 3IDWA 4UASA 1RXWA 3BS5A 3ICXA 4O5EA 2HHWA 3K4GA 4NV0A 5L1MA 3T5JA 1QLNA 2YN4A 2NO4A 3ETRA 2QB1A 2OEHA 2LYBA 3QZ7A 2V4QA 3C5FA 3IM1A 1SXEA 2H5XA 5J8YC 2KP7A 4TURA 3QU5A 3FDSA 1QCKA 4PL2A 2ASLA 3D2NA 2KMDA 3HX0A 1L3VA 1QSYA 5DBBA 5H2FU 4O3SA 2ODGA 2YMQA 3AMZA 5DB9A 1B22A 2QB0B 3E58A 3KHGA 5CJ7A 3N28A 4Y2PA 5ALRA 4OJPA 3C28A 3ORYA 1ZQAA 1CUKA 2DGZA 3L3FX 4PGYA 4KLHA 2YB1A 3RFAA 2Y0SF 2ZJAA 9ICLA 1V9PA 2K60A 5F9LA 3QEBZ 1RYSA 4ICAA 2BCSA 4QIWC 3ZDDA 4JV0A 4ECXA 1ZD4A 2IMWP 1QSLA 2HHUA 1Q46A 2Y1IA 4KLJA 1ZQTA 4NJ8A 4M6WB 1D8LA 4QWCA 3IV6A 5AK5A 2B0CA 5KG1A 3MR3A 1KFSA 4QZAA 1QSSA 5J0TA 4I2JA 4QWEA 2FPLA 5KFRA 4PHDA 3KZXA 2UVWA 1L7NA 4YR0A 5JUMA 4RQ6A 3RJIA 3RJKA 4AYBF 3KHRA 9ICUA 3Q8SB 3OSNA 2C2RA 4B9SA 4Z6EA 3BZKA 2KKVA 1K5OA 1S77D 1XSPA 1TVAA 3GIKA 3UPQA 4CCHA 1MC8A 4LZDA 4Y2JA 2H3FA 4Y2UA 3BJYA 2KEYA 1O03A 1X9SA 2KZZA 1KLNA 3M7DA 1GO3F 4QZBA 4F8RA 5DG7A 4IL6U 5EE1A 3JPRA 2F76X 2HHVA 3TADA 9ICIA 3WU2U 1NK5A 3E2EA 1ZD2P 3N7PD 1F44A 5KFSA 1DGSA 4KLLA 1L8OA 2KICA 1PK3A 3BDPA 2BQRA 4O3NA 4RQ5A 4F4YA 3TADC 3PSTA 1A76A 3SYZA 4E0DA 4F4KA 5DBAA 2BQUA 1X9XA 2W03A 4Y2QA 3NTUA 1NJZA 3QE9Y 7ICSA 3M1YA 1D8YA 2ASJA 2WAQC 1SWVA 4QW9A 2HHSA 9ICKA 2G08A 4Y2RA 1ZQDA 4QNLA 3CRXA 3B0XA 3D6JA 1RPLA 4A8EA 5ALXA 4TUQA 3KTQA 4DSIA 5ALGA 1VDVA 2ZIWA 4ECVA 3HILA 2DKXA 9ICPA 4J9KA 4XA5A 2KJ9A 4UAYA 7ICUA 4C7YA 4NM2A 2QLTA 3C2MA 2JGAA 3F2DA 1KRPA 3PX0A 5DDYA 9ICVA 4UAUA 2H3QA 4M9NA 4YD1A 4F2SA 5ALDA 1A77A 1NK6A 5KFXA 3UXPA 5DG8A 2W8LA 2EQYA 2ZIXA 4NL9C 5D4BA 4IQTA 5AK4A 5JRTA 2BGWA 2RP5A 4M9HA 2YY6A 3GILA 4DOAA 3UMBA 5DKWA 3T79A 3PW0A 4KN4A 4UAVA 5ALQA 5CRXA 1UQVA 3NUQA 2Y9TA 4UBCA 2PI4A 1XSNA 4EBDA 4CF5A 2XVTA 3HWTA 5ALFA 2W9BA 2W43A 2EANA 4HYKA 1N2XA 4PH5A 2KVSA 5DQGA 3I76A 5AK6A 5KAIU 3ZDEA 3H40A 4Q8EA 2ZTEA 5AI6A 4YMMA 4Y2YA 3RR8A 1S0OA 1XSLA 1HUOA 7ICJA 4NLGA 2IOFA 8ICQA 9ICBA 4F2RA 1PK1B 8ICOA 1ZQQA 3V72A 1N63A 3C29A 2PFOA 1JN3A 1DGJA 3NVZA 1LB2B 3Q8PB 2ZTCA 5C5JA 1QQ6A 4US8A 1XNSA 5AM4A 5L9XA 3FC4A 2W3SA 4DFJA 3MABA 3ED5A 1U49A 1L3SA 4DSLA 4CNQA 3K75D 3SV3A 4MF8A 5GTHU 1T3QA 5IIIA 5J0WA 4O3RA 4U7CA 4DL4A 4LZGA 3RJJA 4YR2A 4C4TA 3HT3A 3SI8A 3BQTA 4C8MA 1V38A 4DF4A 7ICTA 5AI4A 2Y1JA 5EWEA 5G5HA 5AM5A 4DQIA 1KFDA 5AKXA 4C4SA 4YFKA 5E79U 4DOBA 1UA0A 1ZQXA 5KFAA 1NZPA 4PZOA 5KFEA 4J9NA 2BDPA 2WF5A 3WK6A 9ICXA 5AK3A 4GXJA 1ZQMA 1SKSA 4C8LA 1ZXIA 5KFLA 1X6JA 3A0BU 1ZQOA 1C20A 4RQ2A 3AQEA 5EOZA 9ICGA 2NRTA 4KMUA 3RB4A 3PR5B 1D8BA 2ZIUA 2ZXIA 2E1FA 4EBCA 4P4PA 2WF6A 2P66A 1RG6A 1L7MA 3LYSA 5J2DA 1RQNA 2KV2A 4U6PA 4TUPA 1BGXT 4RU9A 3G6YA 4PJ0U 1NZBA 4I2EA 2ESEA 3H7IA 3M9NB 1SL1A 3C5GA 3RR7A 2GLEA 5DBCA 4BXOB 5J2BA 2BZFA 4FZLA 2G06A 3SENA 3AL0B 4X5VA 1V97A 2CXYA 1ZQ1C 3LVWA 5KFJA 2HHXA 5HP4A 2C2EA 2KNJA 2R8KA 1KN5A 5AKZA 5KNIA 2VJ4A 4ECZA 8ICBA 4GFJA 2DUYA 5DDMA 1F5SA 3RF9A 1OW5A 1SB3C 2OHFA 1T94A 3A0HU 4DLEA 2PFQA 4R63A 3EUB2 4MEYA 3EZ5A 2E8NA 1J97A 4MFFA 2E3TA 4Y2VA 4LJXA 1X6IA 3JPOA 2OYYA 5TZVA 1Q8KA 2KN7A 4DL5A 3RJHA 3Q8QB 3MR6A 4DFMA 3PNCA 3TAQA 4FBTA 1WWVA 4FFDA 3F2BA 3UQ0A 2EAPA 2UVRA 1RM6C 4OO1J 2KOBA 3Q8KA 1KQQA 4KMOB 4NY8A 4Y2TA 4B9NA 4R8UB 1NI3A 1PVPA 4Z6DA 2KTQA 2J6SA 1URJA 4F93B 1J2NA 4J9RA 3WKAA 2Y0SC 1LKYB 2EAOA 3ZD9A 4C7ZA 3B0YA 1AQ6A 2MUTA 3SAHA 8ICCA 2ZXHA 3BS5B 1Z19A 4B9MA 2A19A 5K4LA 2HBMA 4Z6CA 3TQ1A 1K1QA 3JPTA 2JH7A 1QH9A 3OHAA 4BWMA 8ICVA 4O3MA 2A1JA 4I2IA 5IIMA 3H0RB 1ZD5A 1XO0A 1Q3VA 3D2SA 1SL2A 4P0QB 2VA2A 2YMMA 1ZQEA 2M0NA 3MDAA 3ETLA 2ZJ8A 5EWGA 4TQSA 1U9LA 1UT8A 5ALTA 1KW4A 2AHOB 1U47A 1ZQZA 3LVVA 2QARA 3KBBA 4DL6A 1B43A 4AYBC 3H0LB 1ZQHA 4F72A 5KFOA 4P4MA 1H38A 1BNPA 4YXJA 1CEZA 5KT7A 8ICSA 5J0SA 4Y2SA 1LVHA 3IN5A 1B0XA 5KAFU 8ICZA 2Z7JA 4NXZA 5J0QA 5AM2A 4Q43A 2N1RA 4IRKA 3TAPA 5HHIA 5L1JA 2F44A 1ZOLA 5KFHA 2VKQA 1WWUA 1A6SA 1Z00B 4B9LA 5L1IA 2RLTA 4IRCA 5AIAA 1Z4NA 1UPHA 1NK0A 1B4FA 2FLPA 1BPYA 3H8WA 2XCPA 4KLMA 3IHQB 2W54A 1YZ7A 2JEGA 3NVVA 4ED7A 2VJ5A 1PZNA 8ICIA 4MFCA 5ALOA 4EEYA 4O5CA 2DPIA 3U26A 5KFTA 3C23A 3OJUA 4KTQA 2WF9A 5AKHA 4RNNA 9ICCA 1HIWA 9ICQA 2OCEA 4Q8FA 3IRUA 4UARA 1LV5A 2BHNA 3QU2A 1TK0A 2KSOA 4YN4A 2FMQA 2BR0A 3H4BA 1ZQFA 2LPEA 8ICLA 3EW9A 1S97A 3RH5A 2AQ0A 4MHVA 5KFMA 3NASA 4CF4A 2VA8A 4OJ5A 3MR5A 2ALZA 3Q8MA 4EELA 4UB4A 8ICNA 2AGQA 5BPCA 4ELVA 5FP0A 3WKEA 1NJYA 1SZPA 2LHTA 2XIDA 4DSKA 4M9JA 2XGQA 4NLCA 5KFKA 8ICTA 2MSNA 1JUDA 3RB6A 2XCAA 5KG2A 4R64A 4GC6A 4GLXA 3TI0A 3PW5A 3BQ1A 4UATA 4Q44A 1NK9A 3TANA 3NGDA 5KFNA 2I9GA 4IQWA 4NM1A 5KG6A 2F8KA 2R8JA 3ZDAA 4Y2XA 1NJXA 4C4RA 2KIVA 5J0RA 4NLBA 3V6KA 2ISOA 2F77X 5F3XB 2NRXA 5KTQA 4XRHA 4F3OA 4KLEA 2BCUA 3TACB 4DLGA 5DLFA 2AJQA 3MC1A 1BPBA 2KJ5A 4QWDA 4I2HA 2ES6A 3VC8A 3B9JA 4MFAA 3K1RB 2W9CB 2HDOA 1ZQVA 1PUZA 2D8CA 5KL8B 2B6GA 3PX6A 3MFIA 4QZFA 2EAMA 2J6TA 3CYMA 5AKKA 5KT2A 4UB8U 1JROA 2I1QA 5IINA 5HR7A 1FFVA 1QTMA 3M8SA 4PHPA 4RQ8A 4M6WA 2Q4TA 4KITB 4ED2A 3MR2A 5J2KA 3UMCA 1JMSA 2W04A 3KKAA 4DO9A 3RB0A 2KZMA 1K1SA 3R9KA 3QX7A 2ASDA 4F4ZA 5EE3A 3N4MB 3ZDBA 3KKAC 4Q45A 5KFPA 4ELTA 5F9NA 1COOA 2JV3A 4Z6FA 4DFKA 4BWJA 3ISCA 3PO4A 4OCZA 3EWAA 3WK4A 2KKPA 4DF8A 1U4BA 4C8KA 2CPRA 5ALKA 1TKDA 4RPXA 3T3FA 3F2CA 5AKEA 4PHAA 5AKGA 4F71A 4O3QA 4I2BA 3WKBA 1DOQA 4RT2A 2BPCA 1PVQA 5CA7A 5CB1A 2FDRA 1KSPA 2VA3A 1CI4A 3SAGA 4KX5A 4DS4A 2KK0A 3F5EA 2NV3A 3MFHA 7ICFA 3V7KA 2LI6A 3I1YA 2FPKA 4BDPA 1ZJNA 3UQ2A 2EZZA 2JEFA 5EE9A 3N7RC 3PW2A 4PL1A 7ICLA 3PX4A 5HR6A 3HW8A 5KFQA 4DSJA 4DQQA 4GXIA 1JX4A 2LM1A 2HOIA 3AUOA 2DL0A 2E8MA 3RBDA 5J2AA 1SGGA 3OTQA 4J9LA 2A3VA 1FO4A 4F92B 2R8HA 4HAIA 1KBUA 4ECQA 2G07A 3H4DA 1P7DA 1BPXA 1JXLA 8ICXA 2WF8A 2P35A 4DOCA 3PSFA 2HVHA 2NRZA 2WB1F 1D9DA 4JK1A 4DFPA 2F1JA 3V7LA 3WKDA 3RRGA 1ZQLA 4O3OA 4KN7A 8ICFA 4M04A 3RH4A 3GZFA 3KFUF 3BQ7A 4C0ZA 5KT3A 5J2JA 4CGZA 2PXIA 2F1HA 2NRVA 5ALEA 1Z3EB 4LVSA 1BPEA 3FM9A 3PZPA 1ZQSA 2HHTA 3QUBA 5HNKA 2OXOA 1U45A 5J2FA 2I5HA 1ZJMA 2HSZA 3GIMA 1DK3A 5J0PA 5CHGA 3H8SA 4YMOA 2OM6A 1N61A 2FJ6A 1S0NA 3IG5A 2KHVA 4I27A 1IXRA 3RH6A 5KG5A 7ICPA 4B9VA 3GV8B 8ICYA 4NLZA 2WFAA 5DB7A 7ICRA 4JMUA 2HMXA 2HBLA 3KZIU 3I28A 1FFUA 2EZXA 4KX3A 7ICQA 5KFZA 3V7JA 1T8EA 5AKLA 2YX8A 3AU2A 4RQ7A 1N48A 4F5NA 4ECRA 3L5KA 5AM3A 4F5RA 2WHEA 8ICGA 8ICWA 4FS1A 1L7OA 2VIXA 5J2IA 4IR1A 1X2IA 2W9MA 4K4GA 2K8AA 2BPGA 2GWSA 4QZHA 1S9FA 2JZBA 4J9MA 1S10A 1YT3A 3T5HA 2GOLA 8ICPA 4RUAA 2IHNA 5CP2A 3ZD8A 2W55A 4IQUA 4C8OA 1A0PA 4YCXA 3OSPA 3HJEA 4QWBA 5KL1B 4C8NA 2Y9UA 1RXVA 2XY7A 1KTQA 1ZD3A 1SKWA 5ALNA 2IA6A 2HI0A 5AI0A 3QUQA 1Y88A 2UVUA 1MSWD 5AI5A 2KE7A 1SL0A 4B6JA 2PFNA 1L3UA 1XU4A 1RYUA 5ALIA 2KFNA 3RTVA 4RUCA 4GXKA 3WK7A 3SQIA 2GH1A 2E5SA 4IS7A 1ZQKA 3BQ2A 5CWRA 2MUTB 5ALLA 3N97B 4RPZA 3QU9A 4R66A 3TKAA 1YZ6A 5DGAA 5JU5A 1RYRA 8ICEA 1MQ3A 2E1EA 2AU0A 2A1JB 5J0OA 2W7OA 3ISDA 2YTUA 3HP6A 3NS1A 4I2GA 4YXMA 4I2AA 3IP4B 3H8JA 4OJLA 3KHLA 2R18A 2ZG6A 4ED3A 2K8CB 3EYZA 2IOHA 4KLGA 3NVWA 1HEKA 1TE2A 2ZUBA 3FYHA 5AKYA 4ECSA 2IHMA 4KLIA 4QW8A 9ICAA 1IM4A 2JR5A 1JXEA 5J29A 4BX9C 3G6XA 2PMZF 1SV4A 3AN1A 1N60A 3H8MA 5J2HA 8ICAA 2D3DA 4R65A 1ZYQA 2HOQA 4G9BA 3WK8A 2H3ZA 5AM0A 1NOMA 4KLTA 8ICKA 4FO6A 1TK5A 3KHHA 1NJWA 2AH5A 1F0MA 2E8PA 2YMLA 3C2KA 5IIOA 5AHXA 2HOFA 7ICIA 4ELUA 4I28A 2EZYA 3AU6A 2IOFK 2KZ3A 3JPSA 4KLFA 4QJFB 4BJQA 1ECWA 4JV2A 4GC7A 4B9UA 2DPJA 4F5QA 3GV7B 2K4HA 3QU7A 2G5HB 3H0MB 5ALVA 4QZIA 4AP9A 5KFFA 3PSIA 2H3IA 3JPPA 2J6UA 5CR0A 5AM1A 4DL3A 5KFCA 4TUSA 1MA7A 9ICHA 2F8LA 1IG6A 2WTFA 5KFIA 9ICOA 3M8RA 3MBYA 2ZJ5A 5EWFA 2HW3A 4F4WA 5KFBA 1SIJA 3DDHA 1JRPA 2FLLA 5ALYA 4RQ1A 1XWLA 7ICNA 4ED0A 4XQ8A 4JUZA 4UQGA 2W7PA 9ICNA 2W9AA 3LK9A 2Q0ZX 1C7YA 5AKIA 4O5KA 3MDCA 3RJGA 2I6XA 1SZHA 1S8OA 4YQWA 2NYVA 3SR6A 1LKYA 3T5KA 1FIQA 4J9SA 1V85A 3NRZA 4M2YA 5DGBA 4UBBA 5J0YA 5J8YA 3L4PA 2ZIVA 3ISBA 2HBJA 4I2FA 3UXOA 3ZDCA 4RQMA 3QUTA 3TFRA 9ICRA 2ISPA 5KFUA 7ICOA 2JRZA 2KG5A 4CF3A 2WF7A 1NKEA 4ECWA 3G6VA 3QU4A 5IIKA 1TAMA 1WUDA 1ZRMA 4P0QA 5BOMA 3GIIA 1D9FA 1O08A 1S76D 2K89A 4P0PA 2HHQA 3RBEA 3MGIA 1HUZA 1N5WA 4JWMA 2RHFA 9ICFA 4ACOA 3ZI4A 1SXDA 4QZCA 4J9QA 1EXNA 5AI8A 1KDHA 5D49A 2FMPA 5HMMA 2JXJA 2KJ8A 1COKA 1ZQUA 4J9OA 3M9MB 3T5LA 3HKZF 4ECYA 3PVXA 2P6RA 1S0VA 3M9OB 3PY8A 4DEZA 1ZQBA 2RDIA 1ZQJA 5GTIU 2ZTDA 1T3NA 2PFPA 9ICTA 4UW9A 3QNMA 5L1KA 9ICMA 2DFLA 3QEAZ 1Z00A 2L5YA 9ICJA 4NWIA 3K1ZA 4RZRA 1X66A 2P6UA 4QZDA 3SAFA 4EX6A 3UM9A 1L7PA 5KFWA 1XO1A 3V6JA 4PZNA 3PR4A 2W8KA 3BZCA 1QQ5A 3C1ZA 4QZGA 2QB0A 3J81j 1X9WA 1NNLA 4EBEA 5ALSA 2ZIWB 3CNHA 1OXJA 4F50A 2KIWA
chains in the Genus database with same CATH topology
3KKAA 2KG5A 3BS7A 3SEIA 3HILA 2KSOA 2DKXA 1DXSA 5KNIA 2DKZA 2LPEA 1OW5A 2QARB 2E8OA 3IDWA 4MHVA 3BS5A 3KKAC 2Y9UA 2F3NA 3BQ7A 2E8NA 1KW4A 5L1MA 2JV3A 2QARA 1PK1A 2QB1A 1JI7A 2KE7A 1SXEA 5J8YC 1X40A 1SXDA 1UCVA 1V38A 2LMRA 4IS7A 1B0XA 2KMDA 4NL9C 1COKA 2E8PA 1WWVA 2EAPA 5JRTA 1SV0A 2F8KA 4PZOA 2QB0B 2KIVA 5JU5A 1Z1VA 3TADA 2F44A 5F3XB 1UQVA 2Y9TA 2YTUA 1WWUA 3TACB 1SV0C 2FE9A 1B4FA 1PK3A 2EANA 2K60A 2QKQA 2L5YA 3TADC 2ES6A 1LKYB 2EAOA 1X66A 3K1RB 1X9XA 2DL0A 2E8MA 1RG6A 1SGGA 2D8CA 4PZNA 1LKYA 3BS5B 2B6GA 1SV4A 1V85A 4NJ8A 2EAMA 2QB0A 3H8MA 4RQNA 2D3DA 5JTIA 2ESEA 5J8YA 1PK1B 2GLEA 4RQMA 1OXJA 2K4PA 3SENA 1F0MA 4NL9A 2KSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKA A;  2KG5 A;  3BS7 A;  3SEI A;  3HIL A;  2KSO A;  2DKX A;  1DXS A;  5KNI A;  2DKZ A;  2LPE A;  1OW5 A;  2QAR B;  2E8O A;  3IDW A;  4MHV A;  3BS5 A;  3KKA C;  2Y9U A;  2F3N A;  3BQ7 A;  2E8N A;  1KW4 A;  5L1M A;  2JV3 A;  2QAR A;  1PK1 A;  2QB1 A;  1JI7 A;  2KE7 A;  1SXE A;  5J8Y C;  1X40 A;  1SXD A;  1UCV A;  1V38 A;  2LMR A;  4IS7 A;  1B0X A;  2KMD A;  4NL9 C;  1COK A;  2E8P A;  1WWV A;  2EAP A;  5JRT A;  1SV0 A;  2F8K A;  4PZO A;  2QB0 B;  2KIV A;  5JU5 A;  1Z1V A;  3TAD A;  2F44 A;  5F3X B;  1UQV A;  2Y9T A;  2YTU A;  1WWU A;  3TAC B;  1SV0 C;  2FE9 A;  1B4F A;  1PK3 A;  2EAN A;  2K60 A;  2QKQ A;  2L5Y A;  3TAD C;  2ES6 A;  1LKY B;  2EAO A;  1X66 A;  3K1R B;  1X9X A;  2DL0 A;  2E8M A;  1RG6 A;  1SGG A;  2D8C A;  4PZN A;  1LKY A;  3BS5 B;  2B6G A;  1SV4 A;  1V85 A;  4NJ8 A;  2EAM A;  2QB0 A;  3H8M A;  4RQN A;  2D3D A;  5JTI A;  2ESE A;  5J8Y A;  1PK1 B;  2GLE A;  4RQM A;  1OXJ A;  2K4P A;  3SEN A;  1F0M A;  4NL9 A;  2KSO B; 
#chains in the Genus database with same CATH topology
 4J9P A;  2GO7 A;  3OPX A;  3GIJ A;  1IIP A;  2FPM A;  3VCB A;  5KT4 A;  2HBK A;  4IC9 A;  1VJ5 A;  2A1A A;  2WB1 C;  3GDX A;  4B9T A;  4UAZ A;  2ZUD A;  2E8O A;  1ZQR A;  4JV1 A;  5T14 A;  4ZOH C;  2F3N A;  5IIJ A;  5KT5 A;  3F53 A;  4ED1 A;  3ONN A;  4ED8 A;  2BQ3 A;  1SWW A;  4RQ0 A;  1M6Y A;  4I29 A;  2XY5 A;  2M9N A;  2G5I B;  3GFK B;  3PO5 A;  2PI5 A;  2BCR A;  1KKX A;  3AQF A;  2ZIX B;  5J2G A;  4UB1 A;  2BPF A;  1T4G A;  4G3I A;  7ICG A;  1TK8 A;  3GU3 A;  4BUG A;  8ICH A;  4JB3 A;  3E0F A;  5G5G A;  1ZQG A;  1MN8 A;  3CP8 A;  4FS2 A;  4CRX A;  1WCL A;  4WJ3 B;  1ZQP A;  4ZH4 A;  5DQI A;  9ICS A;  3DEE A;  4UB6 U;  2KD1 A;  5B66 U;  2W9B B;  4M0A A;  4M9L A;  2MA1 A;  5ALZ A;  5HML A;  3UMG A;  3WKC A;  4QIW F;  3EPI A;  3EPG A;  4ECT A;  4YMN A;  5L1L A;  1DK2 A;  3C21 A;  1J2M A;  2XGP A;  5J2C A;  2R8G A;  2FI1 A;  3QXG A;  4RQ4 A;  3JPN A;  5J0X A;  2W9C A;  4PGX A;  2FLN A;  3ALR A;  3CW2 C;  2XY6 A;  1TV9 A;  4JWN A;  3HPO A;  4DL2 A;  2O6K A;  4IRD A;  3OGU A;  4NL9 A;  4RT3 A;  2JEJ A;  5DLG A;  4KLS A;  2R8I A;  3QZ8 A;  5ALH A;  2XO7 A;  1WCN A;  2B21 A;  4DSF A;  2HVI A;  3F5A A;  5CEH A;  1QQ7 A;  4DS5 A;  1Z4O A;  1X42 A;  4NLN A;  2BCQ A;  5AIC A;  3PMN A;  3OHB A;  4MF2 A;  5IIL A;  3BQ0 A;  7ICH A;  2AGO A;  2XI9 A;  1X40 A;  2EH9 A;  4C80 A;  4K4I A;  2LMR A;  3SMV A;  1CRX A;  4DWI A;  2V4R A;  3RB3 A;  4OJ6 A;  4XUS A;  2JMG A;  1MQ2 A;  1SV0 A;  4QWA A;  4RQ3 A;  1S0M A;  2VAN A;  3M6K A;  2H3V A;  3C2L A;  2KVC A;  4MEX A;  4DQS A;  5DB8 A;  1SKR A;  1UA1 A;  4FZM A;  4DQR A;  3RRH A;  1SV0 C;  5AIB A;  4P2H A;  1BPZ A;  5ALM A;  1N62 A;  2FE9 A;  2ZIU B;  2LYH A;  3LDA A;  2JZB B;  4M47 A;  1WG8 A;  2WAQ F;  1L8L A;  5J2E A;  5KFD A;  2BCV A;  2OWO A;  8ICU A;  1WYG A;  1L3T A;  5J0U A;  4O3P A;  2NO5 A;  3N7S C;  4RQN A;  4F5P A;  5ALW A;  2C28 A;  3D2Q A;  1BVS A;  3LWM A;  2PMZ C;  4KLO A;  1DRG A;  5DQH A;  3PW7 A;  3RJF A;  2K8B B;  2K4P A;  9ICE A;  4DSE A;  4FBU A;  5KG0 A;  3BS7 A;  2W11 A;  2CN1 A;  3WK5 A;  3JPQ A;  4PGQ A;  2XIC A;  4UB3 A;  2AXT U;  1BPD A;  4EYH B;  4UB2 A;  1NK4 A;  3Q8R B;  1FEZ A;  5BOL A;  3PML A;  1X9M A;  1ZQI A;  1NKB A;  1L6N A;  4ED6 A;  5ALP A;  4ECU A;  4KLU A;  2MAX A;  1ZET A;  2C22 A;  1TAU A;  1PK1 A;  3THV A;  4YR3 A;  1JI7 A;  4FZN A;  3KOO A;  4PHE A;  4EEK A;  1S5L U;  1OUQ A;  4NLK A;  2DQN B;  7ICE A;  1ZQW A;  1NK7 A;  1RDF A;  2JH1 A;  4USA A;  5AI9 A;  3OJS A;  3WK9 A;  5ALJ A;  2FMS A;  2DF4 B;  2KFZ A;  3MGV A;  4OJO A;  3PW4 A;  3O0F A;  2AGP A;  2NRW A;  2RQ5 A;  4YD2 A;  5AKJ A;  4DL7 A;  1UHU A;  5C0Y A;  4UB5 A;  3GQC A;  1Z1V A;  5KT6 A;  2IBK A;  3S6J A;  2DWQ A;  4BGD A;  4GIB A;  4RNO A;  5KFV A;  1KL9 A;  5KG7 A;  2UVV A;  1HJP A;  2PKE A;  3NVY A;  2K4E A;  2G09 A;  1Z1B A;  2QKQ A;  5HHH A;  1ZQC A;  4YVZ A;  2OH2 A;  3KD3 A;  3FAH A;  3LWL A;  3IG8 A;  3SZ2 A;  4I2C A;  4F5O A;  4O9M A;  4CE6 A;  1KFT A;  2W3R A;  2K4I A;  5ALU A;  2ZUC A;  2DBY A;  5JTI A;  1RQL A;  4KLD A;  3Q8L A;  5KFY A;  4FE3 A;  3SV4 A;  7ICM A;  8ICJ A;  2HCF A;  1N5X A;  4J03 A;  2MU2 A;  2JHD A;  2EDU A;  4DFD A;  4O0I A;  2CRX A;  3AM9 A;  8ICR A;  1XC9 A;  4KLQ A;  2JEI A;  3SEI A;  2C2D A;  4DQP A;  2RDJ A;  3C1Y A;  4I2D A;  4EZ6 A;  4IQV A;  1ZQN A;  3RAQ A;  3V6H A;  1TAQ A;  1NKC A;  1UT5 A;  2DKZ A;  3MGH A;  1JIH A;  2QAR B;  3DV9 A;  5DB6 A;  3UXN A;  2BDU A;  4EEN A;  3RJE A;  2G0A A;  3QUC A;  3QYP A;  2LBO A;  4UAW A;  1L5U A;  3NRW A;  4EX7 A;  1U48 A;  2YMP A;  4QZE A;  4RNM A;  4CDG A;  1NK8 A;  4BXO A;  5EE0 A;  3PV8 A;  1T7P A;  1UCV A;  2AQ4 A;  3AEV A;  5TIS U;  4YG2 A;  3GV5 B;  4OD0 A;  4M9G A;  2XC9 A;  2D6F C;  4YP3 A;  2KHQ A;  2LKY A;  4PPX A;  9ICW A;  2LM4 A;  3HKZ C;  5B5E U;  1ARO P;  1BNO A;  5DG9 A;  2ZIV B;  2V9W A;  3TFS A;  1ZRN A;  3M6Z A;  1XS9 D;  4DCC A;  5KG4 A;  2RRD A;  2MRL A;  3TAR A;  2F1I A;  7ICK A;  5KFG A;  2YB4 A;  3HRD D;  4US9 A;  1JAL A;  1ED1 A;  1VLB A;  4TQR A;  1N56 A;  4F91 B;  2LYA A;  5A0L A;  1KEJ A;  3RAX A;  4EZ9 A;  4K4H A;  1TFR A;  4P0P B;  5D46 A;  4IR9 A;  4F4X A;  1Q3U A;  4R8U A;  2YQE A;  1IV8 A;  4P4O A;  2KSO B;  4QZ9 A;  3PSP A;  2BKE A;  4EYI B;  2ATL A;  1RZT A;  2F2A B;  3SD7 A;  5KG3 A;  4RPY A;  1DXS A;  7ICV A;  8ICM A;  4QZ8 A;  1PVR A;  1ZQY A;  3IDW A;  4UAS A;  1RXW A;  3BS5 A;  3ICX A;  4O5E A;  2HHW A;  3K4G A;  4NV0 A;  5L1M A;  3T5J A;  1QLN A;  2YN4 A;  2NO4 A;  3ETR A;  2QB1 A;  2OEH A;  2LYB A;  3QZ7 A;  2V4Q A;  3C5F A;  3IM1 A;  1SXE A;  2H5X A;  5J8Y C;  2KP7 A;  4TUR A;  3QU5 A;  3FDS A;  1QCK A;  4PL2 A;  2ASL A;  3D2N A;  2KMD A;  3HX0 A;  1L3V A;  1QSY A;  5DBB A;  5H2F U;  4O3S A;  2ODG A;  2YMQ A;  3AMZ A;  5DB9 A;  1B22 A;  2QB0 B;  3E58 A;  3KHG A;  5CJ7 A;  3N28 A;  4Y2P A;  5ALR A;  4OJP A;  3C28 A;  3ORY A;  1ZQA A;  1CUK A;  2DGZ A;  3L3F X;  4PGY A;  4KLH A;  2YB1 A;  3RFA A;  2Y0S F;  2ZJA A;  9ICL A;  1V9P A;  2K60 A;  5F9L A;  3QEB Z;  1RYS A;  4ICA A;  2BCS A;  4QIW C;  3ZDD A;  4JV0 A;  4ECX A;  1ZD4 A;  2IMW P;  1QSL A;  2HHU A;  1Q46 A;  2Y1I A;  4KLJ A;  1ZQT A;  4NJ8 A;  4M6W B;  1D8L A;  4QWC A;  3IV6 A;  5AK5 A;  2B0C A;  5KG1 A;  3MR3 A;  1KFS A;  4QZA A;  1QSS A;  5J0T A;  4I2J A;  4QWE A;  2FPL A;  5KFR A;  4PHD A;  3KZX A;  2UVW A;  1L7N A;  4YR0 A;  5JUM A;  4RQ6 A;  3RJI A;  3RJK A;  4AYB F;  3KHR A;  9ICU A;  3Q8S B;  3OSN A;  2C2R A;  4B9S A;  4Z6E A;  3BZK A;  2KKV A;  1K5O A;  1S77 D;  1XSP A;  1TVA A;  3GIK A;  3UPQ A;  4CCH A;  1MC8 A;  4LZD A;  4Y2J A;  2H3F A;  4Y2U A;  3BJY A;  2KEY A;  1O03 A;  1X9S A;  2KZZ A;  1KLN A;  3M7D A;  1GO3 F;  4QZB A;  4F8R A;  5DG7 A;  4IL6 U;  5EE1 A;  3JPR A;  2F76 X;  2HHV A;  3TAD A;  9ICI A;  3WU2 U;  1NK5 A;  3E2E A;  1ZD2 P;  3N7P D;  1F44 A;  5KFS A;  1DGS A;  4KLL A;  1L8O A;  2KIC A;  1PK3 A;  3BDP A;  2BQR A;  4O3N A;  4RQ5 A;  4F4Y A;  3TAD C;  3PST A;  1A76 A;  3SYZ A;  4E0D A;  4F4K A;  5DBA A;  2BQU A;  1X9X A;  2W03 A;  4Y2Q A;  3NTU A;  1NJZ A;  3QE9 Y;  7ICS A;  3M1Y A;  1D8Y A;  2ASJ A;  2WAQ C;  1SWV A;  4QW9 A;  2HHS A;  9ICK A;  2G08 A;  4Y2R A;  1ZQD A;  4QNL A;  3CRX A;  3B0X A;  3D6J A;  1RPL A;  4A8E A;  5ALX A;  4TUQ A;  3KTQ A;  4DSI A;  5ALG A;  1VDV A;  2ZIW A;  4ECV A;  3HIL A;  2DKX A;  9ICP A;  4J9K A;  4XA5 A;  2KJ9 A;  4UAY A;  7ICU A;  4C7Y A;  4NM2 A;  2QLT A;  3C2M A;  2JGA A;  3F2D A;  1KRP A;  3PX0 A;  5DDY A;  9ICV A;  4UAU A;  2H3Q A;  4M9N A;  4YD1 A;  4F2S A;  5ALD A;  1A77 A;  1NK6 A;  5KFX A;  3UXP A;  5DG8 A;  2W8L A;  2EQY A;  2ZIX A;  4NL9 C;  5D4B A;  4IQT A;  5AK4 A;  5JRT A;  2BGW A;  2RP5 A;  4M9H A;  2YY6 A;  3GIL A;  4DOA A;  3UMB A;  5DKW A;  3T79 A;  3PW0 A;  4KN4 A;  4UAV A;  5ALQ A;  5CRX A;  1UQV A;  3NUQ A;  2Y9T A;  4UBC A;  2PI4 A;  1XSN A;  4EBD A;  4CF5 A;  2XVT A;  3HWT A;  5ALF A;  2W9B A;  2W43 A;  2EAN A;  4HYK A;  1N2X A;  4PH5 A;  2KVS A;  5DQG A;  3I76 A;  5AK6 A;  5KAI U;  3ZDE A;  3H40 A;  4Q8E A;  2ZTE A;  5AI6 A;  4YMM A;  4Y2Y A;  3RR8 A;  1S0O A;  1XSL A;  1HUO A;  7ICJ A;  4NLG A;  2IOF A;  8ICQ A;  9ICB A;  4F2R A;  1PK1 B;  8ICO A;  1ZQQ A;  3V72 A;  1N63 A;  3C29 A;  2PFO A;  1JN3 A;  1DGJ A;  3NVZ A;  1LB2 B;  3Q8P B;  2ZTC A;  5C5J A;  1QQ6 A;  4US8 A;  1XNS A;  5AM4 A;  5L9X A;  3FC4 A;  2W3S A;  4DFJ A;  3MAB A;  3ED5 A;  1U49 A;  1L3S A;  4DSL A;  4CNQ A;  3K75 D;  3SV3 A;  4MF8 A;  5GTH U;  1T3Q A;  5III A;  5J0W A;  4O3R A;  4U7C A;  4DL4 A;  4LZG A;  3RJJ A;  4YR2 A;  4C4T A;  3HT3 A;  3SI8 A;  3BQT A;  4C8M A;  1V38 A;  4DF4 A;  7ICT A;  5AI4 A;  2Y1J A;  5EWE A;  5G5H A;  5AM5 A;  4DQI A;  1KFD A;  5AKX A;  4C4S A;  4YFK A;  5E79 U;  4DOB A;  1UA0 A;  1ZQX A;  5KFA A;  1NZP A;  4PZO A;  5KFE A;  4J9N A;  2BDP A;  2WF5 A;  3WK6 A;  9ICX A;  5AK3 A;  4GXJ A;  1ZQM A;  1SKS A;  4C8L A;  1ZXI A;  5KFL A;  1X6J A;  3A0B U;  1ZQO A;  1C20 A;  4RQ2 A;  3AQE A;  5EOZ A;  9ICG A;  2NRT A;  4KMU A;  3RB4 A;  3PR5 B;  1D8B A;  2ZIU A;  2ZXI A;  2E1F A;  4EBC A;  4P4P A;  2WF6 A;  2P66 A;  1RG6 A;  1L7M A;  3LYS A;  5J2D A;  1RQN A;  2KV2 A;  4U6P A;  4TUP A;  1BGX T;  4RU9 A;  3G6Y A;  4PJ0 U;  1NZB A;  4I2E A;  2ESE A;  3H7I A;  3M9N B;  1SL1 A;  3C5G A;  3RR7 A;  2GLE A;  5DBC A;  4BXO B;  5J2B A;  2BZF A;  4FZL A;  2G06 A;  3SEN A;  3AL0 B;  4X5V A;  1V97 A;  2CXY A;  1ZQ1 C;  3LVW A;  5KFJ A;  2HHX A;  5HP4 A;  2C2E A;  2KNJ A;  2R8K A;  1KN5 A;  5AKZ A;  5KNI A;  2VJ4 A;  4ECZ A;  8ICB A;  4GFJ A;  2DUY A;  5DDM A;  1F5S A;  3RF9 A;  1OW5 A;  1SB3 C;  2OHF A;  1T94 A;  3A0H U;  4DLE A;  2PFQ A;  4R63 A;  3EUB 2;  4MEY A;  3EZ5 A;  2E8N A;  1J97 A;  4MFF A;  2E3T A;  4Y2V A;  4LJX A;  1X6I A;  3JPO A;  2OYY A;  5TZV A;  1Q8K A;  2KN7 A;  4DL5 A;  3RJH A;  3Q8Q B;  3MR6 A;  4DFM A;  3PNC A;  3TAQ A;  4FBT A;  1WWV A;  4FFD A;  3F2B A;  3UQ0 A;  2EAP A;  2UVR A;  1RM6 C;  4OO1 J;  2KOB A;  3Q8K A;  1KQQ A;  4KMO B;  4NY8 A;  4Y2T A;  4B9N A;  4R8U B;  1NI3 A;  1PVP A;  4Z6D A;  2KTQ A;  2J6S A;  1URJ A;  4F93 B;  1J2N A;  4J9R A;  3WKA A;  2Y0S C;  1LKY B;  2EAO A;  3ZD9 A;  4C7Z A;  3B0Y A;  1AQ6 A;  2MUT A;  3SAH A;  8ICC A;  2ZXH A;  3BS5 B;  1Z19 A;  4B9M A;  2A19 A;  5K4L A;  2HBM A;  4Z6C A;  3TQ1 A;  1K1Q A;  3JPT A;  2JH7 A;  1QH9 A;  3OHA A;  4BWM A;  8ICV A;  4O3M A;  2A1J A;  4I2I A;  5IIM A;  3H0R B;  1ZD5 A;  1XO0 A;  1Q3V A;  3D2S A;  1SL2 A;  4P0Q B;  2VA2 A;  2YMM A;  1ZQE A;  2M0N A;  3MDA A;  3ETL A;  2ZJ8 A;  5EWG A;  4TQS A;  1U9L A;  1UT8 A;  5ALT A;  1KW4 A;  2AHO B;  1U47 A;  1ZQZ A;  3LVV A;  2QAR A;  3KBB A;  4DL6 A;  1B43 A;  4AYB C;  3H0L B;  1ZQH A;  4F72 A;  5KFO A;  4P4M A;  1H38 A;  1BNP A;  4YXJ A;  1CEZ A;  5KT7 A;  8ICS A;  5J0S A;  4Y2S A;  1LVH A;  3IN5 A;  1B0X A;  5KAF U;  8ICZ A;  2Z7J A;  4NXZ A;  5J0Q A;  5AM2 A;  4Q43 A;  2N1R A;  4IRK A;  3TAP A;  5HHI A;  5L1J A;  2F44 A;  1ZOL A;  5KFH A;  2VKQ A;  1WWU A;  1A6S A;  1Z00 B;  4B9L A;  5L1I A;  2RLT A;  4IRC A;  5AIA A;  1Z4N A;  1UPH A;  1NK0 A;  1B4F A;  2FLP A;  1BPY A;  3H8W A;  2XCP A;  4KLM A;  3IHQ B;  2W54 A;  1YZ7 A;  2JEG A;  3NVV A;  4ED7 A;  2VJ5 A;  1PZN A;  8ICI A;  4MFC A;  5ALO A;  4EEY A;  4O5C A;  2DPI A;  3U26 A;  5KFT A;  3C23 A;  3OJU A;  4KTQ A;  2WF9 A;  5AKH A;  4RNN A;  9ICC A;  1HIW A;  9ICQ A;  2OCE A;  4Q8F A;  3IRU A;  4UAR A;  1LV5 A;  2BHN A;  3QU2 A;  1TK0 A;  2KSO A;  4YN4 A;  2FMQ A;  2BR0 A;  3H4B A;  1ZQF A;  2LPE A;  8ICL A;  3EW9 A;  1S97 A;  3RH5 A;  2AQ0 A;  4MHV A;  5KFM A;  3NAS A;  4CF4 A;  2VA8 A;  4OJ5 A;  3MR5 A;  2ALZ A;  3Q8M A;  4EEL A;  4UB4 A;  8ICN A;  2AGQ A;  5BPC A;  4ELV A;  5FP0 A;  3WKE A;  1NJY A;  1SZP A;  2LHT A;  2XID A;  4DSK A;  4M9J A;  2XGQ A;  4NLC A;  5KFK A;  8ICT A;  2MSN A;  1JUD A;  3RB6 A;  2XCA A;  5KG2 A;  4R64 A;  4GC6 A;  4GLX A;  3TI0 A;  3PW5 A;  3BQ1 A;  4UAT A;  4Q44 A;  1NK9 A;  3TAN A;  3NGD A;  5KFN A;  2I9G A;  4IQW A;  4NM1 A;  5KG6 A;  2F8K A;  2R8J A;  3ZDA A;  4Y2X A;  1NJX A;  4C4R A;  2KIV A;  5J0R A;  4NLB A;  3V6K A;  2ISO A;  2F77 X;  5F3X B;  2NRX A;  5KTQ A;  4XRH A;  4F3O A;  4KLE A;  2BCU A;  3TAC B;  4DLG A;  5DLF A;  2AJQ A;  3MC1 A;  1BPB A;  2KJ5 A;  4QWD A;  4I2H A;  2ES6 A;  3VC8 A;  3B9J A;  4MFA A;  3K1R B;  2W9C B;  2HDO A;  1ZQV A;  1PUZ A;  2D8C A;  5KL8 B;  2B6G A;  3PX6 A;  3MFI A;  4QZF A;  2EAM A;  2J6T A;  3CYM A;  5AKK A;  5KT2 A;  4UB8 U;  1JRO A;  2I1Q A;  5IIN A;  5HR7 A;  1FFV A;  1QTM A;  3M8S A;  4PHP A;  4RQ8 A;  4M6W A;  2Q4T A;  4KIT B;  4ED2 A;  3MR2 A;  5J2K A;  3UMC A;  1JMS A;  2W04 A;  3KKA A;  4DO9 A;  3RB0 A;  2KZM A;  1K1S A;  3R9K A;  3QX7 A;  2ASD A;  4F4Z A;  5EE3 A;  3N4M B;  3ZDB A;  3KKA C;  4Q45 A;  5KFP A;  4ELT A;  5F9N A;  1COO A;  2JV3 A;  4Z6F A;  4DFK A;  4BWJ A;  3ISC A;  3PO4 A;  4OCZ A;  3EWA A;  3WK4 A;  2KKP A;  4DF8 A;  1U4B A;  4C8K A;  2CPR A;  5ALK A;  1TKD A;  4RPX A;  3T3F A;  3F2C A;  5AKE A;  4PHA A;  5AKG A;  4F71 A;  4O3Q A;  4I2B A;  3WKB A;  1DOQ A;  4RT2 A;  2BPC A;  1PVQ A;  5CA7 A;  5CB1 A;  2FDR A;  1KSP A;  2VA3 A;  1CI4 A;  3SAG A;  4KX5 A;  4DS4 A;  2KK0 A;  3F5E A;  2NV3 A;  3MFH A;  7ICF A;  3V7K A;  2LI6 A;  3I1Y A;  2FPK A;  4BDP A;  1ZJN A;  3UQ2 A;  2EZZ A;  2JEF A;  5EE9 A;  3N7R C;  3PW2 A;  4PL1 A;  7ICL A;  3PX4 A;  5HR6 A;  3HW8 A;  5KFQ A;  4DSJ A;  4DQQ A;  4GXI A;  1JX4 A;  2LM1 A;  2HOI A;  3AUO A;  2DL0 A;  2E8M A;  3RBD A;  5J2A A;  1SGG A;  3OTQ A;  4J9L A;  2A3V A;  1FO4 A;  4F92 B;  2R8H A;  4HAI A;  1KBU A;  4ECQ A;  2G07 A;  3H4D A;  1P7D A;  1BPX A;  1JXL A;  8ICX A;  2WF8 A;  2P35 A;  4DOC A;  3PSF A;  2HVH A;  2NRZ A;  2WB1 F;  1D9D A;  4JK1 A;  4DFP A;  2F1J A;  3V7L A;  3WKD A;  3RRG A;  1ZQL A;  4O3O A;  4KN7 A;  8ICF A;  4M04 A;  3RH4 A;  3GZF A;  3KFU F;  3BQ7 A;  4C0Z A;  5KT3 A;  5J2J A;  4CGZ A;  2PXI A;  2F1H A;  2NRV A;  5ALE A;  1Z3E B;  4LVS A;  1BPE A;  3FM9 A;  3PZP A;  1ZQS A;  2HHT A;  3QUB A;  5HNK A;  2OXO A;  1U45 A;  5J2F A;  2I5H A;  1ZJM A;  2HSZ A;  3GIM A;  1DK3 A;  5J0P A;  5CHG A;  3H8S A;  4YMO A;  2OM6 A;  1N61 A;  2FJ6 A;  1S0N A;  3IG5 A;  2KHV A;  4I27 A;  1IXR A;  3RH6 A;  5KG5 A;  7ICP A;  4B9V A;  3GV8 B;  8ICY A;  4NLZ A;  2WFA A;  5DB7 A;  7ICR A;  4JMU A;  2HMX A;  2HBL A;  3KZI U;  3I28 A;  1FFU A;  2EZX A;  4KX3 A;  7ICQ A;  5KFZ A;  3V7J A;  1T8E A;  5AKL A;  2YX8 A;  3AU2 A;  4RQ7 A;  1N48 A;  4F5N A;  4ECR A;  3L5K A;  5AM3 A;  4F5R A;  2WHE A;  8ICG A;  8ICW A;  4FS1 A;  1L7O A;  2VIX A;  5J2I A;  4IR1 A;  1X2I A;  2W9M A;  4K4G A;  2K8A A;  2BPG A;  2GWS A;  4QZH A;  1S9F A;  2JZB A;  4J9M A;  1S10 A;  1YT3 A;  3T5H A;  2GOL A;  8ICP A;  4RUA A;  2IHN A;  5CP2 A;  3ZD8 A;  2W55 A;  4IQU A;  4C8O A;  1A0P A;  4YCX A;  3OSP A;  3HJE A;  4QWB A;  5KL1 B;  4C8N A;  2Y9U A;  1RXV A;  2XY7 A;  1KTQ A;  1ZD3 A;  1SKW A;  5ALN A;  2IA6 A;  2HI0 A;  5AI0 A;  3QUQ A;  1Y88 A;  2UVU A;  1MSW D;  5AI5 A;  2KE7 A;  1SL0 A;  4B6J A;  2PFN A;  1L3U A;  1XU4 A;  1RYU A;  5ALI A;  2KFN A;  3RTV A;  4RUC A;  4GXK A;  3WK7 A;  3SQI A;  2GH1 A;  2E5S A;  4IS7 A;  1ZQK A;  3BQ2 A;  5CWR A;  2MUT B;  5ALL A;  3N97 B;  4RPZ A;  3QU9 A;  4R66 A;  3TKA A;  1YZ6 A;  5DGA A;  5JU5 A;  1RYR A;  8ICE A;  1MQ3 A;  2E1E A;  2AU0 A;  2A1J B;  5J0O A;  2W7O A;  3ISD A;  2YTU A;  3HP6 A;  3NS1 A;  4I2G A;  4YXM A;  4I2A A;  3IP4 B;  3H8J A;  4OJL A;  3KHL A;  2R18 A;  2ZG6 A;  4ED3 A;  2K8C B;  3EYZ A;  2IOH A;  4KLG A;  3NVW A;  1HEK A;  1TE2 A;  2ZUB A;  3FYH A;  5AKY A;  4ECS A;  2IHM A;  4KLI A;  4QW8 A;  9ICA A;  1IM4 A;  2JR5 A;  1JXE A;  5J29 A;  4BX9 C;  3G6X A;  2PMZ F;  1SV4 A;  3AN1 A;  1N60 A;  3H8M A;  5J2H A;  8ICA A;  2D3D A;  4R65 A;  1ZYQ A;  2HOQ A;  4G9B A;  3WK8 A;  2H3Z A;  5AM0 A;  1NOM A;  4KLT A;  8ICK A;  4FO6 A;  1TK5 A;  3KHH A;  1NJW A;  2AH5 A;  1F0M A;  2E8P A;  2YML A;  3C2K A;  5IIO A;  5AHX A;  2HOF A;  7ICI A;  4ELU A;  4I28 A;  2EZY A;  3AU6 A;  2IOF K;  2KZ3 A;  3JPS A;  4KLF A;  4QJF B;  4BJQ A;  1ECW A;  4JV2 A;  4GC7 A;  4B9U A;  2DPJ A;  4F5Q A;  3GV7 B;  2K4H A;  3QU7 A;  2G5H B;  3H0M B;  5ALV A;  4QZI A;  4AP9 A;  5KFF A;  3PSI A;  2H3I A;  3JPP A;  2J6U A;  5CR0 A;  5AM1 A;  4DL3 A;  5KFC A;  4TUS A;  1MA7 A;  9ICH A;  2F8L A;  1IG6 A;  2WTF A;  5KFI A;  9ICO A;  3M8R A;  3MBY A;  2ZJ5 A;  5EWF A;  2HW3 A;  4F4W A;  5KFB A;  1SIJ A;  3DDH A;  1JRP A;  2FLL A;  5ALY A;  4RQ1 A;  1XWL A;  7ICN A;  4ED0 A;  4XQ8 A;  4JUZ A;  4UQG A;  2W7P A;  9ICN A;  2W9A A;  3LK9 A;  2Q0Z X;  1C7Y A;  5AKI A;  4O5K A;  3MDC A;  3RJG A;  2I6X A;  1SZH A;  1S8O A;  4YQW A;  2NYV A;  3SR6 A;  1LKY A;  3T5K A;  1FIQ A;  4J9S A;  1V85 A;  3NRZ A;  4M2Y A;  5DGB A;  4UBB A;  5J0Y A;  5J8Y A;  3L4P A;  2ZIV A;  3ISB A;  2HBJ A;  4I2F A;  3UXO A;  3ZDC A;  4RQM A;  3QUT A;  3TFR A;  9ICR A;  2ISP A;  5KFU A;  7ICO A;  2JRZ A;  2KG5 A;  4CF3 A;  2WF7 A;  1NKE A;  4ECW A;  3G6V A;  3QU4 A;  5IIK A;  1TAM A;  1WUD A;  1ZRM A;  4P0Q A;  5BOM A;  3GII A;  1D9F A;  1O08 A;  1S76 D;  2K89 A;  4P0P A;  2HHQ A;  3RBE A;  3MGI A;  1HUZ A;  1N5W A;  4JWM A;  2RHF A;  9ICF A;  4ACO A;  3ZI4 A;  1SXD A;  4QZC A;  4J9Q A;  1EXN A;  5AI8 A;  1KDH A;  5D49 A;  2FMP A;  5HMM A;  2JXJ A;  2KJ8 A;  1COK A;  1ZQU A;  4J9O A;  3M9M B;  3T5L A;  3HKZ F;  4ECY A;  3PVX A;  2P6R A;  1S0V A;  3M9O B;  3PY8 A;  4DEZ A;  1ZQB A;  2RDI A;  1ZQJ A;  5GTI U;  2ZTD A;  1T3N A;  2PFP A;  9ICT A;  4UW9 A;  3QNM A;  5L1K A;  9ICM A;  2DFL A;  3QEA Z;  1Z00 A;  2L5Y A;  9ICJ A;  4NWI A;  3K1Z A;  4RZR A;  1X66 A;  2P6U A;  4QZD A;  3SAF A;  4EX6 A;  3UM9 A;  1L7P A;  5KFW A;  1XO1 A;  3V6J A;  4PZN A;  3PR4 A;  2W8K A;  3BZC A;  1QQ5 A;  3C1Z A;  4QZG A;  2QB0 A;  3J81 j;  1X9W A;  1NNL A;  4EBE A;  5ALS A;  2ZIW B;  3CNH A;  1OXJ A;  4F50 A;  2KIW A; 
#chains in the Genus database with same CATH homology
 3KKA A;  2KG5 A;  3BS7 A;  3SEI A;  3HIL A;  2KSO A;  2DKX A;  1DXS A;  5KNI A;  2DKZ A;  2LPE A;  1OW5 A;  2QAR B;  2E8O A;  3IDW A;  4MHV A;  3BS5 A;  3KKA C;  2Y9U A;  2F3N A;  3BQ7 A;  2E8N A;  1KW4 A;  5L1M A;  2JV3 A;  2QAR A;  1PK1 A;  2QB1 A;  1JI7 A;  2KE7 A;  1SXE A;  5J8Y C;  1X40 A;  1SXD A;  1UCV A;  1V38 A;  2LMR A;  4IS7 A;  1B0X A;  2KMD A;  4NL9 C;  1COK A;  2E8P A;  1WWV A;  2EAP A;  5JRT A;  1SV0 A;  2F8K A;  4PZO A;  2QB0 B;  2KIV A;  5JU5 A;  1Z1V A;  3TAD A;  2F44 A;  5F3X B;  1UQV A;  2Y9T A;  2YTU A;  1WWU A;  3TAC B;  1SV0 C;  2FE9 A;  1B4F A;  1PK3 A;  2EAN A;  2K60 A;  2QKQ A;  2L5Y A;  3TAD C;  2ES6 A;  1LKY B;  2EAO A;  1X66 A;  3K1R B;  1X9X A;  2DL0 A;  2E8M A;  1RG6 A;  1SGG A;  2D8C A;  4PZN A;  1LKY A;  3BS5 B;  2B6G A;  1SV4 A;  1V85 A;  4NJ8 A;  2EAM A;  2QB0 A;  3H8M A;  4RQN A;  2D3D A;  5JTI A;  2ESE A;  5J8Y A;  1PK1 B;  2GLE A;  4RQM A;  1OXJ A;  2K4P A;  3SEN A;  1F0M A;  4NL9 A;  2KSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...