3HILA

Sam domain of human ephrin type-a receptor 1 (epha1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
GIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SAM Domain of Human Ephrin Type-A Receptor 1 (EphA1).
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 1
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3hilA00
3IDWA 1B4FA 2DKZA 1RG6A 4PZOA 2ESEA 1KW4A 5J8YC 2K60A 1F0MA 1OW5A 2YTUA 1WWVA 2KMDA 5JRTA 4NL9A 2E8PA 2LPEA 1UCVA 1PK1A 2QB1A 3HILA 1Z1VA 2ES6A 2QKQA 1PK1B 5L1MA 2EANA 1SXEA 4IS7A 3BS7A 3KKAA 5JTIA 1JI7A 2KE7A 3SEIA 2D3DA 1X40A 2KIVA 1WWUA 1V38A 1X9XA 3TADC 2EAMA 1UQVA 5J8YA 2JV3A 4MHVA 2QARB 2KG5A 3TADA 1SV4A 2F8KA 2QB0B 2KSOA 2K4PA 2FE9A 2E8OA 3BS5A 3TACB 1SV0C 3KKAC 3H8MA 1SGGA 2Y9TA 4RQMA 2KSOB 2GLEA 3BS5B 1COKA 1LKYA 2EAOA 1V85A 1SXDA 2QB0A 2F3NA 2Y9UA 4PZNA 1OXJA 3SENA 4NL9C 1B0XA 5JU5A 2E8MA 2E8NA 3K1RB 3BQ7A 1PK3A 4NJ8A 4RQNA 2F44A 1LKYB 2D8CA 2DL0A 2L5YA 5KNIA 1DXSA 1SV0A 2QARA 2EAPA 2B6GA 1X66A 2DKXA 2LMRA 5F3XB
chains in the Genus database with same CATH superfamily
4AP9A 5F9LA 2MA1A 2BPCA 1JUDA 1SKSA 2D6FC 3IHQB 4J9NA 3EW9A 2ZXIA 3HKZF 2HHWA 4DS5A 5J0PA 1NK9A 1F44A 5KFHA 4KLTA 4M9JA 1Q3UA 2HHUA 3D2SA 3E58A 3T5JA 4NXZA 8ICWA 2EANA 4P0PA 3BS7A 5ALVA 3T5LA 3UMCA 4G3IA 5DBCA 2G06A 4EX7A 2RP5A 2VJ4A 5EE3A 4TUQA 1U45A 5ALSA 1IXRA 2W8KA 1XC9A 4YMMA 4C4TA 4RT2A 5ALKA 5AM1A 2XGQA 4F91B 1N2XA 3NVYA 4KLEA 4J9OA 2Y1JA 4BWMA 2HVIA 2IBKA 3TFSA 2FPKA 9ICKA 2NRVA 1J2NA 1CUKA 9ICMA 1ZQ1C 1BPXA 4Y2QA 2R8KA 2ASDA 2F3NA 4ELVA 2KTQA 3UXPA 2CPRA 1SWVA 3GZFA 3N28A 5DG8A 2R8JA 4O0IA 2IMWP 5ALUA 1SV0A 4F4KA 8ICYA 5EWGA 2ZIVB 2MUTA 2KEYA 3RJGA 1ED1A 4QZIA 1NKBA 3ISBA 4B9NA 3PX4A 3DDHA 1N5WA 5IINA 3H40A 2FLPA 2EDUA 2FDRA 4I2GA 4DQQA 2MAXA 2IA6A 4ED6A 1FFVA 2Y0SF 5T14A 2AHOB 3N97B 2MSNA 1KBUA 5DQHA 4DOCA 1XSLA 3MR6A 1UHUA 3BQTA 9ICRA 3JPTA 5AM3A 2ZJ8A 3RB4A 2IOHA 3UQ2A 4KLIA 3EYZA 7ICPA 4Z6EA 3ETRA 5AIAA 9ICGA 8ICKA 4FZNA 3TADC 1NK5A 5KT2A 3S6JA 4AYBF 4IQWA 4C4SA 2V4QA 3AMZA 3V7KA 4I28A 5GTHU 5JUMA 3RF9A 4DWIA 3THVA 5KAIU 8ICZA 3PW7A 2FI1A 3DEEA 1K1SA 1QTMA 2OEHA 4TQSA 4LVSA 2ODGA 1SB3C 2NRWA 5CRXA 3EPIA 2HHTA 3UM9A 2YMPA 1DGJA 3C5FA 3V72A 1HUZA 3OSPA 3CRXA 4MF2A 3TANA 4YCXA 5CR0A 1T3NA 4DL2A 2JEFA 1L8OA 4JV1A 4JWNA 1ZQWA 2L5YA 3I1YA 3GV8B 1BPZA 1S76D 3I28A 3LVWA 3C2MA 3RRGA 2QARA 1C7YA 4RNMA 4Y2SA 3V7JA 4CF4A 4PHDA 2DKXA 2JH7A 3N7PD 2R18A 2HHXA 5AI9A 1B4FA 3WKAA 1OW5A 2HOIA 2A1AA 5KFVA 3UMGA 3WK8A 2I9GA 3K4GA 3HW8A 4J9MA 3KHHA 9ICXA 2W3SA 5AKJA 1DK2A 3UPQA 7ICFA 3PVXA 8ICFA 1ZQOA 4JUZA 1SZPA 5KFAA 1S5LU 4F5QA 1UQVA 4J9RA 8ICNA 2LYHA 3M7DA 3SMVA 2NO4A 3QYPA 1SV4A 4YMOA 2ZG6A 2JHDA 4Q43A 4ECTA 9ICQA 2FE9A 2JZBA 2KOBA 3QUQA 4ECWA 1WCNA 8ICAA 4EZ9A 1NJWA 1A6SA 1RYRA 1KTQA 4A8EA 4NLNA 4PZNA 5ALZA 2HSZA 1HEKA 5DG9A 5IIKA 2WB1C 4NLBA 1RPLA 1PZNA 2YMMA 1S0NA 3JPOA 4LZGA 2Y1IA 1WYGA 1ZD2P 2KHVA 4RQ4A 2KZMA 2F1IA 2A1JB 4UARA 4GC6A 4OCZA 4UW9A 5KAFU 1L8LA 4Y2PA 2ZJ5A 3Q8KA 1LB2B 5D46A 4DQSA 2KJ9A 2E5SA 3E2EA 7ICVA 3ZDBA 9ICNA 4C7YA 5IIMA 3SQIA 1JALA 4Y2TA 5KFGA 4QWCA 4UQGA 5ALHA 4TURA 4P4PA 4F5NA 3GU3A 3B0XA 5HMLA 4ELTA 2BCSA 4TUSA 3OJSA 4QZCA 3M6KA 2J6TA 7ICNA 3HP6A 4YQWA 3RH5A 4F4WA 3B0YA 3PNCA 3L3FX 2ZIUA 9ICIA 4FZMA 1VDVA 4UB6U 3FDSA 3OSNA 2DF4B 5AM0A 2WFAA 4EELA 4BDPA 1Z19A 1SV0C 2LYBA 2ZUCA 4UATA 2KJ8A 2VKQA 1XSNA 3EPGA 2UVUA 1A77A 4I2FA 3SD7A 4C8OA 2BQUA 3NGDA 1L6NA 3BQ7A 4F4ZA 1KDHA 3IRUA 4ZOHC 4B9UA 5IIOA 2OCEA 5KFQA 8ICCA 4EBEA 9ICOA 4BXOA 3JPSA 1S9FA 1COOA 5HR7A 1ZQEA 1TAUA 7ICEA 3F5EA 8ICXA 2J6SA 1NNLA 2A1JA 9ICHA 4DL6A 3QZ8A 1NK7A 3T79A 3OHBA 1TE2A 5AKKA 1QQ5A 3QE9Y 4B9MA 5AKXA 4QWEA 2DPJA 2ZIWB 9ICEA 2XGPA 4DQRA 5EOZA 2PXIA 5EWFA 2VJ5A 2CRXA 2KICA 3IN5A 1JI7A 3SEIA 5BPCA 3F2BA 2NRXA 1JXLA 4Q44A 5IIJA 3NVZA 5ALNA 1XO0A 1Z00B 2RDJA 5AKZA 2F1JA 2KIVA 5KG1A 4I2CA 2ZTCA 3SZ2A 3F5AA 5ALOA 5CB1A 2JV3A 4FS2A 2OYYA 2A3VA 2BPFA 4ECSA 3A0BU 5IIIA 1XWLA 2W9MA 5J2AA 1ZQBA 4EZ6A 3LK9A 1TFRA 5KFKA 8ICTA 2AJQA 4RZRA 3C1YA 1NZBA 2KZZA 3WKEA 3LYSA 2J6UA 4RQMA 3IP4B 2C2DA 7ICGA 2DUYA 5AIBA 4CRXA 8ICLA 5ALXA 1V85A 3PO5A 2IOFK 1TK0A 2B0CA 4UAVA 4J9SA 4KX5A 4RQ7A 3QUCA 4IL6U 2ZJAA 3ALRA 2W8LA 3WK7A 1Z3EB 2KHQA 5HHIA 5KFDA 1S0OA 4M2YA 3AUOA 3RJHA 4UB4A 2JH1A 4PPXA 4JV0A 4O9MA 4FBTA 1TKDA 2VIXA 3IDWA 4B6JA 3M1YA 1TV9A 5KT7A 1RG6A 8ICRA 5HP4A 4K4IA 3G6VA 4DQIA 4O5CA 2KZ3A 7ICQA 1UCVA 4YR0A 4QJFB 3MGHA 3ZD9A 1Q46A 1NKCA 1IG6A 5DQIA 4Y2YA 2O6KA 4PL1A 3G6YA 1ZQFA 4KLQA 3CW2C 2NYVA 3KOOA 3WK6A 1ZQQA 3LWMA 8ICGA 1Q8KA 1X40A 1ZQMA 4Z6DA 5ALMA 3GQCA 2EAMA 3H4BA 2KK0A 2KJ5A 1SZHA 3HWTA 2F76X 2W3RA 2KG5A 1NJZA 1N48A 3BDPA 1NZPA 2LHTA 3TAPA 3IV6A 2YB1A 3UXOA 3WKBA 1YZ7A 5AM2A 3H8MA 2AGQA 2HOFA 1J97A 1X6IA 2B21A 1ZQKA 2HBJA 3M8RA 4R8UB 5G5GA 3FC4A 5J0XA 3C23A 2ZIUB 1B0XA 5JU5A 3H0RB 2ZIWA 3VC8A 5C5JA 2WAQC 4C80A 2F44A 4QWAA 1UA0A 4F50A 2G0AA 1DXSA 2EZXA 5KFMA 2PMZC 1URJA 1X66A 3GIMA 2GO7A 5DB8A 4P0QB 3PSFA 4ED3A 5KL8B 2ALZA 5DQGA 2G5HB 5J8YC 5HR6A 4UAWA 4O5EA 1QQ7A 5ALJA 5E79U 1ZQAA 3KHRA 4DL3A 3R9KA 1RDFA 4NL9A 2BKEA 4ECQA 1NOMA 3ORYA 2UVRA 2XO7A 8ICOA 4RQ2A 5HMMA 3WK9A 5AI0A 3V7LA 1PVQA 1FFUA 1B43A 4ELUA 9ICTA 4DF8A 2KFZA 3M8SA 5DBBA 2VANA 3RJIA 4ED1A 1NK6A 3QEBZ 2WAQF 1N62A 2XI9A 4DS4A 1L5UA 3NRZA 5J2HA 5AK6A 4QZEA 5C0YA 7ICMA 2KD1A 3VCBA 2LM4A 2QB0B 3SAGA 4U7CA 5J29A 4UB5A 4RNOA 3QUTA 1NI3A 1TK5A 5KFNA 3KKAC 3T3FA 3T5HA 1WG8A 3K1ZA 4DSFA 4JB3A 1SXDA 2GWSA 2VA3A 4O3NA 4M6WB 2JXJA 2YMLA 1JIHA 3RH4A 3E0FA 2W9BA 3SV3A 2YMQA 2AQ0A 1SL1A 4KLLA 1SL0A 2CXYA 2YX8A 3PR5B 1ZQRA 4NM1A 3SYZA 4KX3A 1ZQLA 3PSIA 2NRTA 1P7DA 3KFUF 3QU2A 1X42A 4PH5A 4F2RA 2HVHA 2HBMA 4DEZA 2I1QA 3BZCA 3QU9A 3QUBA 5AM5A 2K60A 2XY6A 2H3IA 3MR5A 3C2KA 1X6JA 1X9SA 2ZUDA 3NS1A 3SAHA 3WU2U 4JK1A 1XS9D 2XIDA 5KFPA 4RUAA 4JV2A 5ALPA 5KFLA 4O3OA 1KKXA 2JRZA 2M0NA 2HW3A 3ED5A 1RQLA 1YZ6A 3KBBA 1BNPA 5CJ7A 4QNLA 4QZ9A 1ZD4A 1KQQA 4O3PA 2JEIA 2Y0SC 3EWAA 4ECYA 3SV4A 1X9XA 3BQ0A 3RJKA 4F5PA 1XSPA 2MUTB 2QARB 3H7IA 2EQYA 3Q8SB 1KN5A 2KSOA 4ED8A 4DSKA 3TACB 1UPHA 2HOQA 3UQ0A 2NV3A 3BS5B 3QXGA 4CF3A 5EE1A 2K4IA 3H0MB 3TAQA 5L1IA 1T4GA 1QLNA 1MSWD 4US8A 3NVWA 2HHQA 3IG8A 1WCLA 4KLUA 3K1RB 3IM1A 3JPNA 3AL0B 2A19A 3V6KA 4RQ8A 4KITB 3OGUA 8ICPA 9ICUA 3F53A 4P0QA 3Q8PB 2P6RA 4DSIA 1ZRNA 4RU9A 3MFIA 5ALLA 4OO1J 3NVVA 4DL5A 1NJXA 2DFLA 1K1QA 2BDPA 5ALFA 5KG3A 4Y2XA 4XRHA 4PZOA 5ALQA 3PMLA 3AM9A 1N56A 3ZDAA 2HBLA 3L4PA 1X9MA 4HAIA 5JRTA 1A76A 4PL2A 3AQFA 4EEKA 3GV7B 1ZYQA 1RQNA 4IRDA 2PFOA 4R8UA 5KFIA 4UASA 5L1MA 4Q8FA 3RJFA 3Q8LA 2FJ6A 3PW2A 4RPYA 3ISCA 4MFFA 3AU6A 4DLEA 1KFDA 5CHGA 2W9CA 4B9TA 5KFJA 4JWMA 4UB2A 2I6XA 1V38A 1ZD3A 3RAXA 5IILA 7ICLA 2FMPA 3OTQA 2KFNA 4RT3A 2GH1A 2BCQA 3BZKA 1SL2A 4MEXA 1XNSA 8ICBA 3MR2A 5KFYA 2AGOA 4TUPA 4M6WA 5AKEA 4YR2A 2WF9A 9ICVA 4IQUA 1ZQCA 3PSTA 4QZGA 3D6JA 3PZPA 1JROA 1A0PA 1BPEA 2W7OA 1SWWA 2KSOB 4NM2A 5DKWA 1OUQA 3RJJA 1MQ2A 2C2RA 2KNJA 4RQ0A 1Z4OA 2ATLA 1NKEA 4QZAA 7ICTA 3H8JA 1L7PA 5F9NA 4I2JA 3AQEA 5KFOA 4DFDA 1OXJA 4PGYA 5AKLA 2LKYA 3RR7A 1L7MA 2K8AA 5DDYA 1FO4A 3MFHA 1CEZA 4F4YA 5D49A 1AROP 2UVVA 1S10A 3RFAA 3M9OB 2P66A 4US9A 2H3FA 2PI5A 1V9PA 2K8BB 2PKEA 2HMXA 4RNNA 3C1ZA 3V6JA 2HHVA 4P4OA 4FBUA 1LVHA 4I2EA 5J2BA 4FZLA 3OPXA 2BHNA 2KKVA 4Y2JA 1ZQHA 3BJYA 2BPGA 7ICRA 3RAQA 2ZTDA 3KHLA 3MDAA 4PJ0U 5DGAA 1ZQJA 1S0VA 5AKHA 1D9DA 5HNKA 2OWOA 2W9BB 2LPEA 3ZI4A 5G5HA 4J9KA 2WF5A 5ALTA 3M6ZA 5ALEA 1QSYA 2ISPA 3KHGA 4BWJA 5J2EA 5ALIA 1NK4A 3MR3A 4OJPA 5CA7A 2PI4A 1JX4A 2HCFA 3V6HA 2EH9A 3D2NA 1PUZA 1AQ6A 1ZQDA 2Q4TA 2RQ5A 1WWUA 8ICQA 9ICFA 4EYHB 3PX0A 7ICOA 2FPLA 5L1KA 4MEYA 1ZQZA 3SR6A 4OJ5A 5K4LA 4PHAA 4E0DA 2WF6A 2F77X 2AQ4A 1TK8A 2ZUBA 5KFZA 4CF5A 1Z00A 3ZD8A 2E8OA 1D8LA 4C8MA 8ICHA 5J2CA 3HPOA 2BDUA 2Y9TA 2GLEA 4I29A 1L7OA 2JZBB 3AN1A 2RHFA 1LKYA 4ACOA 1VLBA 3PO4A 3PY8A 4R66A 1TVAA 4QWDA 4YG2A 4RQ3A 1D9FA 2RLTA 4RQ5A 3M9NB 4AYBC 1L3SA 2E8MA 3PW0A 4TQRA 1U49A 2P35A 2ZIXA 3NASA 1N63A 4UB1A 5KFUA 2Q0ZX 5KNIA 3JPQA 4O3QA 4B9VA 3KTQA 1BVSA 5ALWA 4DFPA 3WK5A 5KT3A 2YB4A 4QW9A 5F3XB 8ICEA 4ECVA 2XVTA 3RB0A 9ICSA 5BOMA 1IM4A 2HI0A 4ED2A 2YTUA 4GXJA 4J9PA 3ETLA 2JGAA 2KMDA 1UA1A 2R8HA 2P6UA 1DK3A 2QKQA 5KFSA 2ISOA 4IS7A 3RB6A 5AHXA 2KN7A 3KKAA 3PMNA 2XC9A 4KLGA 4F72A 3GFKB 4CDGA 1QCKA 5J0YA 2GOLA 4F8RA 2I5HA 5KG7A 3H8SA 3FAHA 1TAQA 1U4BA 2MRLA 5KG0A 4ECXA 4UBBA 1KFSA 9ICCA 1RZTA 1FIQA 3GIIA 4BX9C 3WKCA 4FS1A 4DOBA 5FP0A 3ISDA 3BS5A 8ICJA 4YVZA 4DSEA 1Z4NA 3MDCA 1ZQXA 1CI4A 5KFBA 4EYIB 1COKA 8ICIA 3HRDD 5J0TA 4C0ZA 4KN4A 5DG7A 4RQ6A 2H3QA 3GIKA 4BXOB 4NL9C 3QEAZ 3KZIU 3H4DA 4I27A 3HT3A 5AK5A 1CRXA 4FO6A 1ZQTA 3D2QA 1RXWA 2D8CA 5DB7A 2V9WA 4GXIA 1ZQIA 1YT3A 1QSSA 1KL9A 1MN8A 3RR8A 9ICJA 2IOFA 1ZRMA 2W11A 3CP8A 1U48A 2XY7A 2WF7A 4ZH4A 2E1FA 5KT6A 3RH6A 3T5KA 5ALRA 5D4BA 2W04A 4HYKA 3MABA 3JPPA 4Q8EA 4OD0A 2DKZA 2ZIVA 5EWEA 4DOAA 2G09A 4CE6A 3UXNA 4C4RA 3EUB2 4QZDA 1RXVA 4CGZA 2JEJA 3F2CA 2E8PA 1BPDA 2DGZA 2FPMA 2DPIA 5DB6A 5A0LA 2ZTEA 4DL4A 5AKGA 3PW4A 1ZQPA 3I76A 4RUCA 4O3RA 4QIWC 4KLOA 3GIJA 4F92B 2KKPA 4IQVA 3RRHA 4DFJA 3RB3A 2RRDA 2K8CB 3RBDA 1SIJA 1TAMA 4DLGA 4ECRA 5DLFA 4ECZA 4ECUA 1S77D 4MHVA 2YY6A 4DF4A 4O5KA 8ICVA 2F8KA 4QWBA 3NRWA 1MA7A 5HHHA 3O0FA 5L1LA 4IR9A 4NV0A 3C21A 1X2IA 4QZ8A 2C28A 5AKIA 3TARA 1ZQUA 2Y9UA 8ICMA 2WTFA 9ICPA 3HJEA 1ZJMA 4R63A 1T7PA 4I2DA 1Q3VA 3C2LA 4DL7A 3IG5A 1ZQNA 3Q8MA 4P2HA 2PFPA 4CNQA 1HUOA 2R8IA 4ED0A 5AK4A 2MU2A 4GLXA 3J81j 1T8EA 3LVVA 4PGQA 4YXJA 1UT5A 2QLTA 2B6GA 2HBKA 1BPYA 4PHPA 2LI6A 2E3TA 4O3SA 2WF8A 2KVCA 4BGDA 4M47A 4F3OA 3HKZC 3LWLA 2KIWA 1PK1A 3H0LB 4BJQA 1ZJNA 3TKAA 2W9AA 4Y2RA 5J0SA 9ICWA 4M9HA 5J2DA 4KN7A 8ICUA 5KFWA 5CWRA 3C28A 4XUSA 1Y88A 2KE7A 1DGSA 2AXTU 3WK4A 1ZQGA 2LYAA 1ZD5A 2D3DA 2BGWA 5KFRA 4DCCA 5DLGA 1K5OA 1T3QA 2NRZA 4OJ6A 1SKWA 1L3TA 4KLJA 5BOLA 3RBEA 4DQPA 3NUQA 3QU5A 4EENA 3GILA 5AICA 4EBCA 4OJOA 4B9SA 4PGXA 4M9LA 3FM9A 5AI4A 2IHMA 5KFTA 2KP7A 3TQ1A 1UT8A 1LV5A 4IR1A 3MBYA 3G6XA 3CNHA 4ED7A 2W43A 2QB0A 4YP3A 1NK0A 1B22A 5J2GA 4OJLA 3AEVA 5B66U 2HHSA 3M9MB 2WHEA 4QZHA 1ZETA 1N5XA 7ICUA 4NJ8A 2H3ZA 4RQNA 2ASLA 2LM1A 4C8NA 5CP2A 2G07A 5KG4A 1DRGA 4DSLA 2LBOA 4EEYA 3RTVA 4KLDA 7ICKA 2VA8A 2W54A 1F5SA 3QZ7A 1N61A 4DO9A 1SKRA 3ONNA 1RYUA 4KMOB 5J0UA 4KLSA 7ICSA 4J03A 2BR0A 4F5RA 4Z6CA 1KW4A 1O08A 3N7RC 2N1RA 4I2BA 2OHFA 5KT4A 4EX6A 1WWVA 1XU4A 4FE3A 2XY5A 2W55A 1HIWA 4MF8A 4NLKA 4IRCA 1JRPA 1HJPA 2F1HA 1BPBA 1S97A 2BCVA 4IC9A 4Q45A 1Z1VA 5L1JA 4UBCA 1D8BA 2W7PA 1PK1B 1KEJA 3ZDEA 4M0AA 4X5VA 2AU0A 1SXEA 2FMQA 3LDAA 2JR5A 4GC7A 1KLNA 1KFTA 3N7SC 4GIBA 1ECWA 4XA5A 3NTUA 3SI8A 1RYSA 2F8LA 4GFJA 9ICAA 2H5XA 5AI8A 4RQ1A 1ZQYA 5EE9A 4YD2A 4USAA 3TFRA 4J9LA 4KTQA 4NLGA 1RM6C 4NWIA 4K4HA 4F93B 5AI6A 4F71A 2BZFA 4LJXA 4F4XA 3DV9A 2M9NA 2UVWA 4LZDA 4F2SA 1L3UA 9ICBA 4RPXA 5AM4A 5TZVA 4IRKA 2PFQA 3C5GA 1J2MA 1X9WA 4Y2VA 1ZOLA 5H2FU 1QSLA 2DBYA 4Z6FA 5DDMA 1Z1BA 2R8GA 3QX7A 2BQRA 9ICLA 1XO1A 3N4MB 2RDIA 2VA2A 1V97A 2E8NA 3L5KA 4YXMA 4JMUA 1IV8A 2WB1F 5KG2A 4DFKA 2C2EA 4WJ3B 1JMSA 5AK3A 1ZQSA 1PVRA 3PR4A 2BCRA 2EAPA 4UAZA 4DFMA 4MFAA 5ALDA 4UB8U 4C7ZA 4M9GA 4KLHA 2G08A 1DOQA 4YR3A 4EBDA 1KSPA 4F5OA 4G9BA 3GV5B 2ESEA 4O3MA 1F0MA 4DSJA 5J2KA 5KFFA 3EZ5A 4I2IA 5DGBA 4GXKA 4NLZA 1GO3F 7ICHA 3HILA 1EXNA 5J0QA 1KRPA 4I2HA 4P0PB 1U9LA 3GDXA 2ES6A 3MGVA 7ICJA 5KG6A 1QH9A 2DWQA 1T94A 1S0MA 3UMBA 5JTIA 3QNMA 3CYMA 3U26A 4XQ8A 5KFEA 2XCAA 1C20A 4K4GA 1JXEA 1WUDA 3TI0A 5J8YA 4YMNA 4YFKA 2H3VA 1NJYA 2G5IB 4I2AA 5TISU 2AH5A 1D8YA 1M6YA 3PSPA 3F2DA 5AI5A 2W03A 1ZXIA 1SGGA 2EZZA 2YQEA 4J9QA 1ZQVA 3ZDCA 2Z7JA 2OM6A 2KV2A 5KFCA 4FFDA 4R65A 1L3VA 5KT5A 1H38A 1PK3A 1LKYB 3PX6A 2K4EA 1MC8A 4IQTA 4MFCA 3BQ2A 1PVPA 2PFNA 3Q8QB 1NK8A 4P4MA 1O03A 5DB9A 5J0OA 3JPRA 2KVSA 1L7NA 2PMZF 1BNOA 2FLLA 1IIPA 3MC1A 4Y2UA 5J0RA 4NY8A 4PHEA 2LMRA 5GTIU 4YN4A 3Q8RB 4QZBA 4R64A 4C8LA 2FLNA 3ZDDA 2K4HA 3PV8A 4YD1A 5EE0A 2QB1A 3A0HU 1S8OA 3PW5A 4UAUA 2FMSA 5L9XA 4C8KA 2OXOA 2OH2A 2JMGA 3SAFA 1BGXT 5J2JA 3RJEA 3QU7A 2C22A 2JEGA 5CEHA 4QZFA 3B9JA 4BUGA 7ICIA 5KG5A 1N60A 3MGIA 2ZIXB 2K89A 5KFXA 2V4RA 3HX0A 3AU2A 5DBAA 2F2AB 3QU4A 5KTQA 4M9NA 4U6PA 3TADA 5ALGA 5AKYA 1FEZA 2CN1A 4M04A 3K75D 1QQ6A 2XICA 4ICAA 3H8WA 2W9CB 2K4PA 2BCUA 2NO5A 3WKDA 8ICSA 3FYHA 3KZXA 2EAOA 2HDOA 4KLFA 3KD3A 3C29A 3OHAA 3SENA 2DQNB 2IHNA 4CCHA 3BQ1A 3OJUA 2AGPA 4KLMA 2ASJA 5J0WA 1VJ5A 1MQ3A 2DL0A 5ALYA 1U47A 4NLCA 2E1EA 5B5EU 4UAYA 4B9LA 2YN4A 4KMUA 2EZYA 4QIWF 4QW8A 2ZXHA 4RPZA 3ICXA 5KL1B 5J2FA 4UB3A 2XCPA 5J2IA 2BQ3A 1JN3A
chains in the Genus database with same CATH topology
3IDWA 1B4FA 2DKZA 1RG6A 4PZOA 2ESEA 1KW4A 5J8YC 2K60A 1F0MA 1OW5A 2YTUA 1WWVA 2KMDA 5JRTA 4NL9A 2E8PA 2LPEA 1UCVA 1PK1A 2QB1A 3HILA 1Z1VA 2ES6A 2QKQA 1PK1B 5L1MA 2EANA 1SXEA 4IS7A 3BS7A 3KKAA 5JTIA 1JI7A 2KE7A 3SEIA 2D3DA 1X40A 2KIVA 1WWUA 1V38A 1X9XA 3TADC 2EAMA 1UQVA 5J8YA 2JV3A 4MHVA 2QARB 2KG5A 3TADA 1SV4A 2F8KA 2QB0B 2KSOA 2K4PA 2FE9A 2E8OA 3BS5A 3TACB 1SV0C 3KKAC 3H8MA 1SGGA 2Y9TA 4RQMA 2KSOB 2GLEA 3BS5B 1COKA 1LKYA 2EAOA 1V85A 1SXDA 2QB0A 2F3NA 2Y9UA 4PZNA 1OXJA 3SENA 4NL9C 1B0XA 5JU5A 2E8MA 2E8NA 3K1RB 3BQ7A 1PK3A 4NJ8A 4RQNA 2F44A 1LKYB 2D8CA 2DL0A 2L5YA 5KNIA 1DXSA 1SV0A 2QARA 2EAPA 2B6GA 1X66A 2DKXA 2LMRA 5F3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDW A;  1B4F A;  2DKZ A;  1RG6 A;  4PZO A;  2ESE A;  1KW4 A;  5J8Y C;  2K60 A;  1F0M A;  1OW5 A;  2YTU A;  1WWV A;  2KMD A;  5JRT A;  4NL9 A;  2E8P A;  2LPE A;  1UCV A;  1PK1 A;  2QB1 A;  3HIL A;  1Z1V A;  2ES6 A;  2QKQ A;  1PK1 B;  5L1M A;  2EAN A;  1SXE A;  4IS7 A;  3BS7 A;  3KKA A;  5JTI A;  1JI7 A;  2KE7 A;  3SEI A;  2D3D A;  1X40 A;  2KIV A;  1WWU A;  1V38 A;  1X9X A;  3TAD C;  2EAM A;  1UQV A;  5J8Y A;  2JV3 A;  4MHV A;  2QAR B;  2KG5 A;  3TAD A;  1SV4 A;  2F8K A;  2QB0 B;  2KSO A;  2K4P A;  2FE9 A;  2E8O A;  3BS5 A;  3TAC B;  1SV0 C;  3KKA C;  3H8M A;  1SGG A;  2Y9T A;  4RQM A;  2KSO B;  2GLE A;  3BS5 B;  1COK A;  1LKY A;  2EAO A;  1V85 A;  1SXD A;  2QB0 A;  2F3N A;  2Y9U A;  4PZN A;  1OXJ A;  3SEN A;  4NL9 C;  1B0X A;  5JU5 A;  2E8M A;  2E8N A;  3K1R B;  3BQ7 A;  1PK3 A;  4NJ8 A;  4RQN A;  2F44 A;  1LKY B;  2D8C A;  2DL0 A;  2L5Y A;  5KNI A;  1DXS A;  1SV0 A;  2QAR A;  2EAP A;  2B6G A;  1X66 A;  2DKX A;  2LMR A;  5F3X B; 
#chains in the Genus database with same CATH topology
 4AP9 A;  5F9L A;  2MA1 A;  2BPC A;  1JUD A;  1SKS A;  2D6F C;  3IHQ B;  4J9N A;  3EW9 A;  2ZXI A;  3HKZ F;  2HHW A;  4DS5 A;  5J0P A;  1NK9 A;  1F44 A;  5KFH A;  4KLT A;  4M9J A;  1Q3U A;  2HHU A;  3D2S A;  3E58 A;  3T5J A;  4NXZ A;  8ICW A;  2EAN A;  4P0P A;  3BS7 A;  5ALV A;  3T5L A;  3UMC A;  4G3I A;  5DBC A;  2G06 A;  4EX7 A;  2RP5 A;  2VJ4 A;  5EE3 A;  4TUQ A;  1U45 A;  5ALS A;  1IXR A;  2W8K A;  1XC9 A;  4YMM A;  4C4T A;  4RT2 A;  5ALK A;  5AM1 A;  2XGQ A;  4F91 B;  1N2X A;  3NVY A;  4KLE A;  4J9O A;  2Y1J A;  4BWM A;  2HVI A;  2IBK A;  3TFS A;  2FPK A;  9ICK A;  2NRV A;  1J2N A;  1CUK A;  9ICM A;  1ZQ1 C;  1BPX A;  4Y2Q A;  2R8K A;  2ASD A;  2F3N A;  4ELV A;  2KTQ A;  3UXP A;  2CPR A;  1SWV A;  3GZF A;  3N28 A;  5DG8 A;  2R8J A;  4O0I A;  2IMW P;  5ALU A;  1SV0 A;  4F4K A;  8ICY A;  5EWG A;  2ZIV B;  2MUT A;  2KEY A;  3RJG A;  1ED1 A;  4QZI A;  1NKB A;  3ISB A;  4B9N A;  3PX4 A;  3DDH A;  1N5W A;  5IIN A;  3H40 A;  2FLP A;  2EDU A;  2FDR A;  4I2G A;  4DQQ A;  2MAX A;  2IA6 A;  4ED6 A;  1FFV A;  2Y0S F;  5T14 A;  2AHO B;  3N97 B;  2MSN A;  1KBU A;  5DQH A;  4DOC A;  1XSL A;  3MR6 A;  1UHU A;  3BQT A;  9ICR A;  3JPT A;  5AM3 A;  2ZJ8 A;  3RB4 A;  2IOH A;  3UQ2 A;  4KLI A;  3EYZ A;  7ICP A;  4Z6E A;  3ETR A;  5AIA A;  9ICG A;  8ICK A;  4FZN A;  3TAD C;  1NK5 A;  5KT2 A;  3S6J A;  4AYB F;  4IQW A;  4C4S A;  2V4Q A;  3AMZ A;  3V7K A;  4I28 A;  5GTH U;  5JUM A;  3RF9 A;  4DWI A;  3THV A;  5KAI U;  8ICZ A;  3PW7 A;  2FI1 A;  3DEE A;  1K1S A;  1QTM A;  2OEH A;  4TQS A;  4LVS A;  2ODG A;  1SB3 C;  2NRW A;  5CRX A;  3EPI A;  2HHT A;  3UM9 A;  2YMP A;  1DGJ A;  3C5F A;  3V72 A;  1HUZ A;  3OSP A;  3CRX A;  4MF2 A;  3TAN A;  4YCX A;  5CR0 A;  1T3N A;  4DL2 A;  2JEF A;  1L8O A;  4JV1 A;  4JWN A;  1ZQW A;  2L5Y A;  3I1Y A;  3GV8 B;  1BPZ A;  1S76 D;  3I28 A;  3LVW A;  3C2M A;  3RRG A;  2QAR A;  1C7Y A;  4RNM A;  4Y2S A;  3V7J A;  4CF4 A;  4PHD A;  2DKX A;  2JH7 A;  3N7P D;  2R18 A;  2HHX A;  5AI9 A;  1B4F A;  3WKA A;  1OW5 A;  2HOI A;  2A1A A;  5KFV A;  3UMG A;  3WK8 A;  2I9G A;  3K4G A;  3HW8 A;  4J9M A;  3KHH A;  9ICX A;  2W3S A;  5AKJ A;  1DK2 A;  3UPQ A;  7ICF A;  3PVX A;  8ICF A;  1ZQO A;  4JUZ A;  1SZP A;  5KFA A;  1S5L U;  4F5Q A;  1UQV A;  4J9R A;  8ICN A;  2LYH A;  3M7D A;  3SMV A;  2NO4 A;  3QYP A;  1SV4 A;  4YMO A;  2ZG6 A;  2JHD A;  4Q43 A;  4ECT A;  9ICQ A;  2FE9 A;  2JZB A;  2KOB A;  3QUQ A;  4ECW A;  1WCN A;  8ICA A;  4EZ9 A;  1NJW A;  1A6S A;  1RYR A;  1KTQ A;  4A8E A;  4NLN A;  4PZN A;  5ALZ A;  2HSZ A;  1HEK A;  5DG9 A;  5IIK A;  2WB1 C;  4NLB A;  1RPL A;  1PZN A;  2YMM A;  1S0N A;  3JPO A;  4LZG A;  2Y1I A;  1WYG A;  1ZD2 P;  2KHV A;  4RQ4 A;  2KZM A;  2F1I A;  2A1J B;  4UAR A;  4GC6 A;  4OCZ A;  4UW9 A;  5KAF U;  1L8L A;  4Y2P A;  2ZJ5 A;  3Q8K A;  1LB2 B;  5D46 A;  4DQS A;  2KJ9 A;  2E5S A;  3E2E A;  7ICV A;  3ZDB A;  9ICN A;  4C7Y A;  5IIM A;  3SQI A;  1JAL A;  4Y2T A;  5KFG A;  4QWC A;  4UQG A;  5ALH A;  4TUR A;  4P4P A;  4F5N A;  3GU3 A;  3B0X A;  5HML A;  4ELT A;  2BCS A;  4TUS A;  3OJS A;  4QZC A;  3M6K A;  2J6T A;  7ICN A;  3HP6 A;  4YQW A;  3RH5 A;  4F4W A;  3B0Y A;  3PNC A;  3L3F X;  2ZIU A;  9ICI A;  4FZM A;  1VDV A;  4UB6 U;  3FDS A;  3OSN A;  2DF4 B;  5AM0 A;  2WFA A;  4EEL A;  4BDP A;  1Z19 A;  1SV0 C;  2LYB A;  2ZUC A;  4UAT A;  2KJ8 A;  2VKQ A;  1XSN A;  3EPG A;  2UVU A;  1A77 A;  4I2F A;  3SD7 A;  4C8O A;  2BQU A;  3NGD A;  1L6N A;  3BQ7 A;  4F4Z A;  1KDH A;  3IRU A;  4ZOH C;  4B9U A;  5IIO A;  2OCE A;  5KFQ A;  8ICC A;  4EBE A;  9ICO A;  4BXO A;  3JPS A;  1S9F A;  1COO A;  5HR7 A;  1ZQE A;  1TAU A;  7ICE A;  3F5E A;  8ICX A;  2J6S A;  1NNL A;  2A1J A;  9ICH A;  4DL6 A;  3QZ8 A;  1NK7 A;  3T79 A;  3OHB A;  1TE2 A;  5AKK A;  1QQ5 A;  3QE9 Y;  4B9M A;  5AKX A;  4QWE A;  2DPJ A;  2ZIW B;  9ICE A;  2XGP A;  4DQR A;  5EOZ A;  2PXI A;  5EWF A;  2VJ5 A;  2CRX A;  2KIC A;  3IN5 A;  1JI7 A;  3SEI A;  5BPC A;  3F2B A;  2NRX A;  1JXL A;  4Q44 A;  5IIJ A;  3NVZ A;  5ALN A;  1XO0 A;  1Z00 B;  2RDJ A;  5AKZ A;  2F1J A;  2KIV A;  5KG1 A;  4I2C A;  2ZTC A;  3SZ2 A;  3F5A A;  5ALO A;  5CB1 A;  2JV3 A;  4FS2 A;  2OYY A;  2A3V A;  2BPF A;  4ECS A;  3A0B U;  5III A;  1XWL A;  2W9M A;  5J2A A;  1ZQB A;  4EZ6 A;  3LK9 A;  1TFR A;  5KFK A;  8ICT A;  2AJQ A;  4RZR A;  3C1Y A;  1NZB A;  2KZZ A;  3WKE A;  3LYS A;  2J6U A;  4RQM A;  3IP4 B;  2C2D A;  7ICG A;  2DUY A;  5AIB A;  4CRX A;  8ICL A;  5ALX A;  1V85 A;  3PO5 A;  2IOF K;  1TK0 A;  2B0C A;  4UAV A;  4J9S A;  4KX5 A;  4RQ7 A;  3QUC A;  4IL6 U;  2ZJA A;  3ALR A;  2W8L A;  3WK7 A;  1Z3E B;  2KHQ A;  5HHI A;  5KFD A;  1S0O A;  4M2Y A;  3AUO A;  3RJH A;  4UB4 A;  2JH1 A;  4PPX A;  4JV0 A;  4O9M A;  4FBT A;  1TKD A;  2VIX A;  3IDW A;  4B6J A;  3M1Y A;  1TV9 A;  5KT7 A;  1RG6 A;  8ICR A;  5HP4 A;  4K4I A;  3G6V A;  4DQI A;  4O5C A;  2KZ3 A;  7ICQ A;  1UCV A;  4YR0 A;  4QJF B;  3MGH A;  3ZD9 A;  1Q46 A;  1NKC A;  1IG6 A;  5DQI A;  4Y2Y A;  2O6K A;  4PL1 A;  3G6Y A;  1ZQF A;  4KLQ A;  3CW2 C;  2NYV A;  3KOO A;  3WK6 A;  1ZQQ A;  3LWM A;  8ICG A;  1Q8K A;  1X40 A;  1ZQM A;  4Z6D A;  5ALM A;  3GQC A;  2EAM A;  3H4B A;  2KK0 A;  2KJ5 A;  1SZH A;  3HWT A;  2F76 X;  2W3R A;  2KG5 A;  1NJZ A;  1N48 A;  3BDP A;  1NZP A;  2LHT A;  3TAP A;  3IV6 A;  2YB1 A;  3UXO A;  3WKB A;  1YZ7 A;  5AM2 A;  3H8M A;  2AGQ A;  2HOF A;  1J97 A;  1X6I A;  2B21 A;  1ZQK A;  2HBJ A;  3M8R A;  4R8U B;  5G5G A;  3FC4 A;  5J0X A;  3C23 A;  2ZIU B;  1B0X A;  5JU5 A;  3H0R B;  2ZIW A;  3VC8 A;  5C5J A;  2WAQ C;  4C80 A;  2F44 A;  4QWA A;  1UA0 A;  4F50 A;  2G0A A;  1DXS A;  2EZX A;  5KFM A;  2PMZ C;  1URJ A;  1X66 A;  3GIM A;  2GO7 A;  5DB8 A;  4P0Q B;  3PSF A;  4ED3 A;  5KL8 B;  2ALZ A;  5DQG A;  2G5H B;  5J8Y C;  5HR6 A;  4UAW A;  4O5E A;  1QQ7 A;  5ALJ A;  5E79 U;  1ZQA A;  3KHR A;  4DL3 A;  3R9K A;  1RDF A;  4NL9 A;  2BKE A;  4ECQ A;  1NOM A;  3ORY A;  2UVR A;  2XO7 A;  8ICO A;  4RQ2 A;  5HMM A;  3WK9 A;  5AI0 A;  3V7L A;  1PVQ A;  1FFU A;  1B43 A;  4ELU A;  9ICT A;  4DF8 A;  2KFZ A;  3M8S A;  5DBB A;  2VAN A;  3RJI A;  4ED1 A;  1NK6 A;  3QEB Z;  2WAQ F;  1N62 A;  2XI9 A;  4DS4 A;  1L5U A;  3NRZ A;  5J2H A;  5AK6 A;  4QZE A;  5C0Y A;  7ICM A;  2KD1 A;  3VCB A;  2LM4 A;  2QB0 B;  3SAG A;  4U7C A;  5J29 A;  4UB5 A;  4RNO A;  3QUT A;  1NI3 A;  1TK5 A;  5KFN A;  3KKA C;  3T3F A;  3T5H A;  1WG8 A;  3K1Z A;  4DSF A;  4JB3 A;  1SXD A;  2GWS A;  2VA3 A;  4O3N A;  4M6W B;  2JXJ A;  2YML A;  1JIH A;  3RH4 A;  3E0F A;  2W9B A;  3SV3 A;  2YMQ A;  2AQ0 A;  1SL1 A;  4KLL A;  1SL0 A;  2CXY A;  2YX8 A;  3PR5 B;  1ZQR A;  4NM1 A;  3SYZ A;  4KX3 A;  1ZQL A;  3PSI A;  2NRT A;  1P7D A;  3KFU F;  3QU2 A;  1X42 A;  4PH5 A;  4F2R A;  2HVH A;  2HBM A;  4DEZ A;  2I1Q A;  3BZC A;  3QU9 A;  3QUB A;  5AM5 A;  2K60 A;  2XY6 A;  2H3I A;  3MR5 A;  3C2K A;  1X6J A;  1X9S A;  2ZUD A;  3NS1 A;  3SAH A;  3WU2 U;  4JK1 A;  1XS9 D;  2XID A;  5KFP A;  4RUA A;  4JV2 A;  5ALP A;  5KFL A;  4O3O A;  1KKX A;  2JRZ A;  2M0N A;  2HW3 A;  3ED5 A;  1RQL A;  1YZ6 A;  3KBB A;  1BNP A;  5CJ7 A;  4QNL A;  4QZ9 A;  1ZD4 A;  1KQQ A;  4O3P A;  2JEI A;  2Y0S C;  3EWA A;  4ECY A;  3SV4 A;  1X9X A;  3BQ0 A;  3RJK A;  4F5P A;  1XSP A;  2MUT B;  2QAR B;  3H7I A;  2EQY A;  3Q8S B;  1KN5 A;  2KSO A;  4ED8 A;  4DSK A;  3TAC B;  1UPH A;  2HOQ A;  3UQ0 A;  2NV3 A;  3BS5 B;  3QXG A;  4CF3 A;  5EE1 A;  2K4I A;  3H0M B;  3TAQ A;  5L1I A;  1T4G A;  1QLN A;  1MSW D;  4US8 A;  3NVW A;  2HHQ A;  3IG8 A;  1WCL A;  4KLU A;  3K1R B;  3IM1 A;  3JPN A;  3AL0 B;  2A19 A;  3V6K A;  4RQ8 A;  4KIT B;  3OGU A;  8ICP A;  9ICU A;  3F53 A;  4P0Q A;  3Q8P B;  2P6R A;  4DSI A;  1ZRN A;  4RU9 A;  3MFI A;  5ALL A;  4OO1 J;  3NVV A;  4DL5 A;  1NJX A;  2DFL A;  1K1Q A;  2BDP A;  5ALF A;  5KG3 A;  4Y2X A;  4XRH A;  4PZO A;  5ALQ A;  3PML A;  3AM9 A;  1N56 A;  3ZDA A;  2HBL A;  3L4P A;  1X9M A;  4HAI A;  5JRT A;  1A76 A;  4PL2 A;  3AQF A;  4EEK A;  3GV7 B;  1ZYQ A;  1RQN A;  4IRD A;  2PFO A;  4R8U A;  5KFI A;  4UAS A;  5L1M A;  4Q8F A;  3RJF A;  3Q8L A;  2FJ6 A;  3PW2 A;  4RPY A;  3ISC A;  4MFF A;  3AU6 A;  4DLE A;  1KFD A;  5CHG A;  2W9C A;  4B9T A;  5KFJ A;  4JWM A;  4UB2 A;  2I6X A;  1V38 A;  1ZD3 A;  3RAX A;  5IIL A;  7ICL A;  2FMP A;  3OTQ A;  2KFN A;  4RT3 A;  2GH1 A;  2BCQ A;  3BZK A;  1SL2 A;  4MEX A;  1XNS A;  8ICB A;  3MR2 A;  5KFY A;  2AGO A;  4TUP A;  4M6W A;  5AKE A;  4YR2 A;  2WF9 A;  9ICV A;  4IQU A;  1ZQC A;  3PST A;  4QZG A;  3D6J A;  3PZP A;  1JRO A;  1A0P A;  1BPE A;  2W7O A;  1SWW A;  2KSO B;  4NM2 A;  5DKW A;  1OUQ A;  3RJJ A;  1MQ2 A;  2C2R A;  2KNJ A;  4RQ0 A;  1Z4O A;  2ATL A;  1NKE A;  4QZA A;  7ICT A;  3H8J A;  1L7P A;  5F9N A;  4I2J A;  3AQE A;  5KFO A;  4DFD A;  1OXJ A;  4PGY A;  5AKL A;  2LKY A;  3RR7 A;  1L7M A;  2K8A A;  5DDY A;  1FO4 A;  3MFH A;  1CEZ A;  4F4Y A;  5D49 A;  1ARO P;  2UVV A;  1S10 A;  3RFA A;  3M9O B;  2P66 A;  4US9 A;  2H3F A;  2PI5 A;  1V9P A;  2K8B B;  2PKE A;  2HMX A;  4RNN A;  3C1Z A;  3V6J A;  2HHV A;  4P4O A;  4FBU A;  1LVH A;  4I2E A;  5J2B A;  4FZL A;  3OPX A;  2BHN A;  2KKV A;  4Y2J A;  1ZQH A;  3BJY A;  2BPG A;  7ICR A;  3RAQ A;  2ZTD A;  3KHL A;  3MDA A;  4PJ0 U;  5DGA A;  1ZQJ A;  1S0V A;  5AKH A;  1D9D A;  5HNK A;  2OWO A;  2W9B B;  2LPE A;  3ZI4 A;  5G5H A;  4J9K A;  2WF5 A;  5ALT A;  3M6Z A;  5ALE A;  1QSY A;  2ISP A;  3KHG A;  4BWJ A;  5J2E A;  5ALI A;  1NK4 A;  3MR3 A;  4OJP A;  5CA7 A;  2PI4 A;  1JX4 A;  2HCF A;  3V6H A;  2EH9 A;  3D2N A;  1PUZ A;  1AQ6 A;  1ZQD A;  2Q4T A;  2RQ5 A;  1WWU A;  8ICQ A;  9ICF A;  4EYH B;  3PX0 A;  7ICO A;  2FPL A;  5L1K A;  4MEY A;  1ZQZ A;  3SR6 A;  4OJ5 A;  5K4L A;  4PHA A;  4E0D A;  2WF6 A;  2F77 X;  2AQ4 A;  1TK8 A;  2ZUB A;  5KFZ A;  4CF5 A;  1Z00 A;  3ZD8 A;  2E8O A;  1D8L A;  4C8M A;  8ICH A;  5J2C A;  3HPO A;  2BDU A;  2Y9T A;  2GLE A;  4I29 A;  1L7O A;  2JZB B;  3AN1 A;  2RHF A;  1LKY A;  4ACO A;  1VLB A;  3PO4 A;  3PY8 A;  4R66 A;  1TVA A;  4QWD A;  4YG2 A;  4RQ3 A;  1D9F A;  2RLT A;  4RQ5 A;  3M9N B;  4AYB C;  1L3S A;  2E8M A;  3PW0 A;  4TQR A;  1U49 A;  2P35 A;  2ZIX A;  3NAS A;  1N63 A;  4UB1 A;  5KFU A;  2Q0Z X;  5KNI A;  3JPQ A;  4O3Q A;  4B9V A;  3KTQ A;  1BVS A;  5ALW A;  4DFP A;  3WK5 A;  5KT3 A;  2YB4 A;  4QW9 A;  5F3X B;  8ICE A;  4ECV A;  2XVT A;  3RB0 A;  9ICS A;  5BOM A;  1IM4 A;  2HI0 A;  4ED2 A;  2YTU A;  4GXJ A;  4J9P A;  3ETL A;  2JGA A;  2KMD A;  1UA1 A;  2R8H A;  2P6U A;  1DK3 A;  2QKQ A;  5KFS A;  2ISO A;  4IS7 A;  3RB6 A;  5AHX A;  2KN7 A;  3KKA A;  3PMN A;  2XC9 A;  4KLG A;  4F72 A;  3GFK B;  4CDG A;  1QCK A;  5J0Y A;  2GOL A;  4F8R A;  2I5H A;  5KG7 A;  3H8S A;  3FAH A;  1TAQ A;  1U4B A;  2MRL A;  5KG0 A;  4ECX A;  4UBB A;  1KFS A;  9ICC A;  1RZT A;  1FIQ A;  3GII A;  4BX9 C;  3WKC A;  4FS1 A;  4DOB A;  5FP0 A;  3ISD A;  3BS5 A;  8ICJ A;  4YVZ A;  4DSE A;  1Z4N A;  3MDC A;  1ZQX A;  1CI4 A;  5KFB A;  4EYI B;  1COK A;  8ICI A;  3HRD D;  5J0T A;  4C0Z A;  4KN4 A;  5DG7 A;  4RQ6 A;  2H3Q A;  3GIK A;  4BXO B;  4NL9 C;  3QEA Z;  3KZI U;  3H4D A;  4I27 A;  3HT3 A;  5AK5 A;  1CRX A;  4FO6 A;  1ZQT A;  3D2Q A;  1RXW A;  2D8C A;  5DB7 A;  2V9W A;  4GXI A;  1ZQI A;  1YT3 A;  1QSS A;  1KL9 A;  1MN8 A;  3RR8 A;  9ICJ A;  2IOF A;  1ZRM A;  2W11 A;  3CP8 A;  1U48 A;  2XY7 A;  2WF7 A;  4ZH4 A;  2E1F A;  5KT6 A;  3RH6 A;  3T5K A;  5ALR A;  5D4B A;  2W04 A;  4HYK A;  3MAB A;  3JPP A;  4Q8E A;  4OD0 A;  2DKZ A;  2ZIV A;  5EWE A;  4DOA A;  2G09 A;  4CE6 A;  3UXN A;  4C4R A;  3EUB 2;  4QZD A;  1RXV A;  4CGZ A;  2JEJ A;  3F2C A;  2E8P A;  1BPD A;  2DGZ A;  2FPM A;  2DPI A;  5DB6 A;  5A0L A;  2ZTE A;  4DL4 A;  5AKG A;  3PW4 A;  1ZQP A;  3I76 A;  4RUC A;  4O3R A;  4QIW C;  4KLO A;  3GIJ A;  4F92 B;  2KKP A;  4IQV A;  3RRH A;  4DFJ A;  3RB3 A;  2RRD A;  2K8C B;  3RBD A;  1SIJ A;  1TAM A;  4DLG A;  4ECR A;  5DLF A;  4ECZ A;  4ECU A;  1S77 D;  4MHV A;  2YY6 A;  4DF4 A;  4O5K A;  8ICV A;  2F8K A;  4QWB A;  3NRW A;  1MA7 A;  5HHH A;  3O0F A;  5L1L A;  4IR9 A;  4NV0 A;  3C21 A;  1X2I A;  4QZ8 A;  2C28 A;  5AKI A;  3TAR A;  1ZQU A;  2Y9U A;  8ICM A;  2WTF A;  9ICP A;  3HJE A;  1ZJM A;  4R63 A;  1T7P A;  4I2D A;  1Q3V A;  3C2L A;  4DL7 A;  3IG5 A;  1ZQN A;  3Q8M A;  4P2H A;  2PFP A;  4CNQ A;  1HUO A;  2R8I A;  4ED0 A;  5AK4 A;  2MU2 A;  4GLX A;  3J81 j;  1T8E A;  3LVV A;  4PGQ A;  4YXJ A;  1UT5 A;  2QLT A;  2B6G A;  2HBK A;  1BPY A;  4PHP A;  2LI6 A;  2E3T A;  4O3S A;  2WF8 A;  2KVC A;  4BGD A;  4M47 A;  4F3O A;  3HKZ C;  3LWL A;  2KIW A;  1PK1 A;  3H0L B;  4BJQ A;  1ZJN A;  3TKA A;  2W9A A;  4Y2R A;  5J0S A;  9ICW A;  4M9H A;  5J2D A;  4KN7 A;  8ICU A;  5KFW A;  5CWR A;  3C28 A;  4XUS A;  1Y88 A;  2KE7 A;  1DGS A;  2AXT U;  3WK4 A;  1ZQG A;  2LYA A;  1ZD5 A;  2D3D A;  2BGW A;  5KFR A;  4DCC A;  5DLG A;  1K5O A;  1T3Q A;  2NRZ A;  4OJ6 A;  1SKW A;  1L3T A;  4KLJ A;  5BOL A;  3RBE A;  4DQP A;  3NUQ A;  3QU5 A;  4EEN A;  3GIL A;  5AIC A;  4EBC A;  4OJO A;  4B9S A;  4PGX A;  4M9L A;  3FM9 A;  5AI4 A;  2IHM A;  5KFT A;  2KP7 A;  3TQ1 A;  1UT8 A;  1LV5 A;  4IR1 A;  3MBY A;  3G6X A;  3CNH A;  4ED7 A;  2W43 A;  2QB0 A;  4YP3 A;  1NK0 A;  1B22 A;  5J2G A;  4OJL A;  3AEV A;  5B66 U;  2HHS A;  3M9M B;  2WHE A;  4QZH A;  1ZET A;  1N5X A;  7ICU A;  4NJ8 A;  2H3Z A;  4RQN A;  2ASL A;  2LM1 A;  4C8N A;  5CP2 A;  2G07 A;  5KG4 A;  1DRG A;  4DSL A;  2LBO A;  4EEY A;  3RTV A;  4KLD A;  7ICK A;  2VA8 A;  2W54 A;  1F5S A;  3QZ7 A;  1N61 A;  4DO9 A;  1SKR A;  3ONN A;  1RYU A;  4KMO B;  5J0U A;  4KLS A;  7ICS A;  4J03 A;  2BR0 A;  4F5R A;  4Z6C A;  1KW4 A;  1O08 A;  3N7R C;  2N1R A;  4I2B A;  2OHF A;  5KT4 A;  4EX6 A;  1WWV A;  1XU4 A;  4FE3 A;  2XY5 A;  2W55 A;  1HIW A;  4MF8 A;  4NLK A;  4IRC A;  1JRP A;  1HJP A;  2F1H A;  1BPB A;  1S97 A;  2BCV A;  4IC9 A;  4Q45 A;  1Z1V A;  5L1J A;  4UBC A;  1D8B A;  2W7P A;  1PK1 B;  1KEJ A;  3ZDE A;  4M0A A;  4X5V A;  2AU0 A;  1SXE A;  2FMQ A;  3LDA A;  2JR5 A;  4GC7 A;  1KLN A;  1KFT A;  3N7S C;  4GIB A;  1ECW A;  4XA5 A;  3NTU A;  3SI8 A;  1RYS A;  2F8L A;  4GFJ A;  9ICA A;  2H5X A;  5AI8 A;  4RQ1 A;  1ZQY A;  5EE9 A;  4YD2 A;  4USA A;  3TFR A;  4J9L A;  4KTQ A;  4NLG A;  1RM6 C;  4NWI A;  4K4H A;  4F93 B;  5AI6 A;  4F71 A;  2BZF A;  4LJX A;  4F4X A;  3DV9 A;  2M9N A;  2UVW A;  4LZD A;  4F2S A;  1L3U A;  9ICB A;  4RPX A;  5AM4 A;  5TZV A;  4IRK A;  2PFQ A;  3C5G A;  1J2M A;  1X9W A;  4Y2V A;  1ZOL A;  5H2F U;  1QSL A;  2DBY A;  4Z6F A;  5DDM A;  1Z1B A;  2R8G A;  3QX7 A;  2BQR A;  9ICL A;  1XO1 A;  3N4M B;  2RDI A;  2VA2 A;  1V97 A;  2E8N A;  3L5K A;  4YXM A;  4JMU A;  1IV8 A;  2WB1 F;  5KG2 A;  4DFK A;  2C2E A;  4WJ3 B;  1JMS A;  5AK3 A;  1ZQS A;  1PVR A;  3PR4 A;  2BCR A;  2EAP A;  4UAZ A;  4DFM A;  4MFA A;  5ALD A;  4UB8 U;  4C7Z A;  4M9G A;  4KLH A;  2G08 A;  1DOQ A;  4YR3 A;  4EBD A;  1KSP A;  4F5O A;  4G9B A;  3GV5 B;  2ESE A;  4O3M A;  1F0M A;  4DSJ A;  5J2K A;  5KFF A;  3EZ5 A;  4I2I A;  5DGB A;  4GXK A;  4NLZ A;  1GO3 F;  7ICH A;  3HIL A;  1EXN A;  5J0Q A;  1KRP A;  4I2H A;  4P0P B;  1U9L A;  3GDX A;  2ES6 A;  3MGV A;  7ICJ A;  5KG6 A;  1QH9 A;  2DWQ A;  1T94 A;  1S0M A;  3UMB A;  5JTI A;  3QNM A;  3CYM A;  3U26 A;  4XQ8 A;  5KFE A;  2XCA A;  1C20 A;  4K4G A;  1JXE A;  1WUD A;  3TI0 A;  5J8Y A;  4YMN A;  4YFK A;  2H3V A;  1NJY A;  2G5I B;  4I2A A;  5TIS U;  2AH5 A;  1D8Y A;  1M6Y A;  3PSP A;  3F2D A;  5AI5 A;  2W03 A;  1ZXI A;  1SGG A;  2EZZ A;  2YQE A;  4J9Q A;  1ZQV A;  3ZDC A;  2Z7J A;  2OM6 A;  2KV2 A;  5KFC A;  4FFD A;  4R65 A;  1L3V A;  5KT5 A;  1H38 A;  1PK3 A;  1LKY B;  3PX6 A;  2K4E A;  1MC8 A;  4IQT A;  4MFC A;  3BQ2 A;  1PVP A;  2PFN A;  3Q8Q B;  1NK8 A;  4P4M A;  1O03 A;  5DB9 A;  5J0O A;  3JPR A;  2KVS A;  1L7N A;  2PMZ F;  1BNO A;  2FLL A;  1IIP A;  3MC1 A;  4Y2U A;  5J0R A;  4NY8 A;  4PHE A;  2LMR A;  5GTI U;  4YN4 A;  3Q8R B;  4QZB A;  4R64 A;  4C8L A;  2FLN A;  3ZDD A;  2K4H A;  3PV8 A;  4YD1 A;  5EE0 A;  2QB1 A;  3A0H U;  1S8O A;  3PW5 A;  4UAU A;  2FMS A;  5L9X A;  4C8K A;  2OXO A;  2OH2 A;  2JMG A;  3SAF A;  1BGX T;  5J2J A;  3RJE A;  3QU7 A;  2C22 A;  2JEG A;  5CEH A;  4QZF A;  3B9J A;  4BUG A;  7ICI A;  5KG5 A;  1N60 A;  3MGI A;  2ZIX B;  2K89 A;  5KFX A;  2V4R A;  3HX0 A;  3AU2 A;  5DBA A;  2F2A B;  3QU4 A;  5KTQ A;  4M9N A;  4U6P A;  3TAD A;  5ALG A;  5AKY A;  1FEZ A;  2CN1 A;  4M04 A;  3K75 D;  1QQ6 A;  2XIC A;  4ICA A;  3H8W A;  2W9C B;  2K4P A;  2BCU A;  2NO5 A;  3WKD A;  8ICS A;  3FYH A;  3KZX A;  2EAO A;  2HDO A;  4KLF A;  3KD3 A;  3C29 A;  3OHA A;  3SEN A;  2DQN B;  2IHN A;  4CCH A;  3BQ1 A;  3OJU A;  2AGP A;  4KLM A;  2ASJ A;  5J0W A;  1VJ5 A;  1MQ3 A;  2DL0 A;  5ALY A;  1U47 A;  4NLC A;  2E1E A;  5B5E U;  4UAY A;  4B9L A;  2YN4 A;  4KMU A;  2EZY A;  4QIW F;  4QW8 A;  2ZXH A;  4RPZ A;  3ICX A;  5KL1 B;  5J2F A;  4UB3 A;  2XCP A;  5J2I A;  2BQ3 A;  1JN3 A; 
#chains in the Genus database with same CATH homology
 3IDW A;  1B4F A;  2DKZ A;  1RG6 A;  4PZO A;  2ESE A;  1KW4 A;  5J8Y C;  2K60 A;  1F0M A;  1OW5 A;  2YTU A;  1WWV A;  2KMD A;  5JRT A;  4NL9 A;  2E8P A;  2LPE A;  1UCV A;  1PK1 A;  2QB1 A;  3HIL A;  1Z1V A;  2ES6 A;  2QKQ A;  1PK1 B;  5L1M A;  2EAN A;  1SXE A;  4IS7 A;  3BS7 A;  3KKA A;  5JTI A;  1JI7 A;  2KE7 A;  3SEI A;  2D3D A;  1X40 A;  2KIV A;  1WWU A;  1V38 A;  1X9X A;  3TAD C;  2EAM A;  1UQV A;  5J8Y A;  2JV3 A;  4MHV A;  2QAR B;  2KG5 A;  3TAD A;  1SV4 A;  2F8K A;  2QB0 B;  2KSO A;  2K4P A;  2FE9 A;  2E8O A;  3BS5 A;  3TAC B;  1SV0 C;  3KKA C;  3H8M A;  1SGG A;  2Y9T A;  4RQM A;  2KSO B;  2GLE A;  3BS5 B;  1COK A;  1LKY A;  2EAO A;  1V85 A;  1SXD A;  2QB0 A;  2F3N A;  2Y9U A;  4PZN A;  1OXJ A;  3SEN A;  4NL9 C;  1B0X A;  5JU5 A;  2E8M A;  2E8N A;  3K1R B;  3BQ7 A;  1PK3 A;  4NJ8 A;  4RQN A;  2F44 A;  1LKY B;  2D8C A;  2DL0 A;  2L5Y A;  5KNI A;  1DXS A;  1SV0 A;  2QAR A;  2EAP A;  2B6G A;  1X66 A;  2DKX A;  2LMR A;  5F3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...