3IP4B

The high resolution structure of gatcab
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
482
structure length
482
Chain Sequence
b'MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
molecule tags Ligase
source organism Staphylococcus aureus subsp. aureus
publication title Two distinct regions in Staphylococcus aureus GatCAB guarantee accurate tRNA recognition
pubmed doi rcsb
total genus 168
structure length 482
sequence length 482
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ip4B03
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3ip4B02
2G5HB 1NG6A 3H0LB 2DF4B 4WJ3B 2F2AB 3H0RB 3IP4B 3AL0B 3KFUF 3H0MB 2DQNB 1ZQ1C 2G5IB 2D6FC
chains in the Genus database with same CATH superfamily
1N62A 1FT9A 2EWNA 4CXFA 3VYUB 1RUOA 2F2AB 3D0SA 1D9DA 4YCXA 4ABZA 4UAWA 5CA7A 3T5XA 3EPGA 5FRNA 3SQNA 4Y2QA 3G6YA 1V4RA 1ZQHA 2E2JJ 5AK5A 4ENJA 1BJAA 1UB9A 4FISA 3TO6A 4C4RA 7ICNA 3JPRA 3RBEA 3TFRA 2CUZA 1K61A 3J7YJ 5AK4A 3FMRA 2YX8A 1N75A 1U8RA 4PFPA 9ICPA 2KIWA 1XSNA 7ICHA 2HQ5A 3WK4A 4RNNA 1ETKA 2IJLA 3VDXA 2W7NA 1PP8F 2NOJB 4Z6EA 2JRTA 3RTRA 3ZMSA 1L3TA 4XMYA 3F72A 3HUGB 4IL6U 3GXOA 5DDMA 3EDPA 2O3FA 4JOMA 2ZJ2A 1FYKA 2HPMA 3TQNA 2DMTA 1G8XA 2DLLA 1P4XA 4CHUA 3LQQA 4GXOA 4YMMA 4B9UA 5CJ9A 1A31A 3WTSC 4NLCA 5DM7F 2BQUA 2IOFK 4YFNF 5HLHA 2LHTA 4FQGA 3SAFA 8ICVA 3G1OA 4KT6A 1U2WA 3CCSI 4QPOA 1MBGA 3DTEA 4XSXF 1Q8KA 1D0YA 4O3MA 3JSOA 1LFBA 5DG9A 5AKYA 2QSFX 4LG3A 1D0XA 2FOKA 2UXNA 2PEXA 2MH2A 1KGSA 1DPRA 4IQTA 4NQWA 1RYSA 2JUCA 2YR2A 2R8IA 1MZBA 4DIQA 1JIHA 2PMZN 3WGIA 4J19A 4J9KA 4ZH4F 1Q3UA 1KQ8A 2Z33A 3V6JA 1ETYA 3QODA 1QO0D 1S29A 2NOGA 4F52A 3KZYA 5JFRA 1ETOA 3OV8A 4NXZA 2I1QA 2OU2A 2XO7A 3JPQA 1IJWC 2CWEA 2L5YA 4QZAA 2HHSA 4L5JA 4HYEA 3KP2A 3Q8LA 2K40A 3IH2A 2A3SA 3ZN0A 2F3NA 4DYRA 1COOA 2HMXA 3NVVA 3KKAC 3FK7A 5IY5H 3SD7A 3JPTA 2E5NA 4UUVA 2QM3A 1Y1VJ 3DEWA 5EGOA 1SL2A 3BG9A 4PGHA 4RAYA 4XN0A 1OXJA 1V3FA 1A0PA 2JGAA 5FB2A 5D46A 4OJLA 2ZJAA 3UMCA 3DWLE 5J1YA 4A3CJ 9ICJA 4AIKA 3RRGA 3JAMZ 4B47A 4EELA 3E6DA 3E58A 2W9CA 2FQ3A 2KIUA 2M4KA 5EE9A 2ASLA 4DSFA 2C28A 4BJ5C 1Z1BA 4YEJA 3WTUC 1NK9A 3H4BA 4M74A 3G4SI 3ABTA 3TACB 2JEIA 1FOYA 3CESA 2R7TA 4MFDA 3K7AJ 4M3EA 2GA2A 5KAFU 4ECRA 4O6JA 3PNCA 5D49A 4BS9A 1HC8A 3IHQB 4R63A 4A0YA 2AU0A 2A5YB 3ONQA 4U7CA 2CYYA 2NVQJ 2R8GA 3M9OB 1W5CC 1DQUA 3BR2A 5KFRA 4ZYAA 9ICLA 2G5IB 4Y2VA 1T56A 1K6YA 5DM6F 3ZMVA 3GTKJ 2Y9ZA 3CCMI 2HDCA 3J7AO 3JRCA 3HGYA 1XS9A 4ZTFA 3DP7A 1Y8QB 3RCOA 4PJ0C 2XRNA 4NM2A 3CDIA 4PH5A 4E7LA 5CR0A 2QQ8A 3SZ2A 1LVHA 3BQTA 3RSNA 4IRIA 3QU3A 4DOBA 1F36A 5DB7A 2XUBA 4EV0A 1Z00A 4PGQA 2LKPA 1E17A 3WTTC 2HDDA 4DZJA 1ZQCA 4F55A 3TAPA 4DOZA 3IDWA 3SMVA 8ICHA 3GX4X 3WTYC 2OZUA 4RGSA 3QRFF 3GZFA 3A01B 3LA7A 3LSPA 5E3LA 4C3JJ 2UVRA 5D5WB 1SZHA 4LB6B 2DA4A 4UUSA 4D1QA 3KZXA 5D4BA 4A3JJ 4B8XA 2MC4A 2P4WA 1ZRMA 2ESEA 4CH7A 4NLNA 3OOUA 3OS0A 3AEVA 1WCLA 4RS8A 1OR7C 4LIVA 5FLVA 1XCBA 1GXQA 1XG1A 3QYBA 4ED7A 2JEGA 4LZGA 2XGQA 4KLEA 3E6BA 4FX4A 4ECTA 2UVVA 1YS6A 3O6BB 4M6XA 3I1YA 2AXLA 4QZIA 3PMNA 1ZOLA 4DQRA 2JRMA 3CO6C 3LWLA 3IV6A 1S8OA 3WKDA 4YG2A 2PI5A 4RGUA 3K10A 2OCCH 2JZBB 1ZQRA 2PJPA 1JRPA 3HWTA 1M1EB 1OJLA 2Q0OA 2YU3A 3CLQA 3AL0C 2JZBA 2BEOA 2RRDA 3A0BU 1DGJA 4QWAA 4R64A 1ZQ1C 4DJAA 1LUJB 4XBFA 2PQ8A 3V6HA 1T3QA 5H20A 4X0GA 1UA1A 2VA8A 2DAOA 4HAMA 4E6KG 4R8HA 1KDHA 1VFCA 1MMAA 4DBRA 4UUTA 4PL2A 3DBHB 3GFLA 1EF4A 1W5SA 2H6BA 4O5VA 1MBEA 4Y2PA 3VOEA 2DPUA 3I4MJ 3FKJA 4C30A 4I2CA 2VJIA 3F22A 2HHUA 1U5TC 2BR0A 1EH8A 1YJNI 2D8CA 3N7SC 4FFDA 3IRQA 1ZQ3P 4HAIA 3MGVA 5J2IA 4J9RA 2L3DA 4LGWA 1QHHD 3RJPA 2WAQF 3HSRA 5B5EC 3OTQA 3CUQC 4M0AA 5E17F 2CRGA 4G9YA 4PGYA 3M1YA 4J9LA 3SEQA 4FASD 2FA5A 1IUYA 3WE3A 3HRTA 4FX0A 3F8MA 2D1HA 4OJ6A 2DOAA 5KNIA 5E3OA 1JMSA 3N97A 1H38A 4ED8A 4BUGA 2G09A 4KLQA 5G5HA 1DDNA 1L7MA 1G59A 5AI0A 5J4VA 1MNEA 3ERMA 4LLLA 3TOAA 3K4GA 4E7HA 4MQVA 5E3MA 5ALXA 1JN3A 1T08B 3BR6A 3DU5A 4BQQA 4XRMA 1LQ1A 1TZLA 2AXTU 2QLTA 3PUFA 1OW5A 2E8NA 2W9MA 4M73A 2R7QA 3M6ZA 2PFBA 1K6OA 2YMMA 3PSPA 2GLOA 1YIJI 3DPUA 3VEPA 1N60A 3NAUA 2VJ5A 1L3SA 3CUQA 4MFFA 1PK1A 3ABLH 4BE2A 5LBQA 2BCQA 2L9SA 4OMYA 2Y2ZA 2R18A 1R22A 2RLTA 5TISU 4PPXA 2FMQA 3EPIA 1NKBA 3DDHA 5AM5A 1Y0NA 3Q8PB 1IG7A 8ICMA 1ZQEA 1ULYA 4UAYA 2E8PA 3PVXA 3ZXSA 4PHPA 3HIFA 2KFNA 2D3DA 1DP3A 3DU6A 3S32A 3IV5A 1I50J 2KRFA 3BR0A 3KCCA 3RPUA 5AI8A 1T38A 2FJ6A 3GV5B 1BPXA 5J8CA 4F5RA 5DLGA 2BY1A 3BOQA 3LA2A 3GDXA 4DFPA 2KD1A 3H36A 3A0HC 4OIRF 3Q9SA 4O3QA 4UAZA 3LAPA 1CRXA 3OJUA 1S77D 4F50A 4EZ6A 4KT5C 2RNJA 4U7BA 4BDYA 2VODA 4V2GA 4OJ5A 1CQTA 5H2FC 1WJFA 1KQ9A 2KDOA 2NYXA 4H4KC 1MSFC 1SAXA 4L18B 3Q0VA 5J3LA 1MNDA 4I2AA 3ZQFA 5AKHA 3QU5A 4CCOA 1X2NA 2ISPA 2O8XA 4UV9A 3J7ZI 1V85A 5EEGA 2EDUA 1K78B 4MEXA 1QSSA 5CHGA 3PW0A 2XY5A 1RYRA 3IL2A 1WFXA 1S5LU 4YRVA 2LYBA 5L1LA 2DMUA 2JA5J 3OYNA 2R0QC 4J9QA 5B1BH 1OCPA 2GWRA 2XKPA 1X3ZB 2K8BB 2FMYA 3GFIA 9ANTA 2EA2A 1XGNA 3ZPLA 2R7WA 4ACOA 3MR2A 2HHQA 1SVLA 4WF2A 1B4AA 3IKVA 1KRPA 1R6RA 4C2TA 1BNPA 3DPTA 3EWAA 2K9QA 5HHIA 4QWCA 5KFLA 3EUKL 1I1GA 1TP4A 3O3KA 2B0CA 2VE8A 3S17J 2DW4A 2R3SA 5K7FA 5CP2A 2Q2EB 3S93A 3TADC 4Q43A 4O3SA 1SD5A 3RR8A 3G6VA 4GGGA 2K9MA 5ALPA 3T79A 1FOWA 7ICEA 2M9HA 3HTSB 5LRRA 3T8RA 3Q0WA 1V5FA 5KFTA 3GLXA 5CVUA 2KHVA 2O0YA 3ICXA 4PHAA 2FF4A 3FM9A 2EFNA 1WCNA 1MDMB 3ZMZA 4EEFG 3BLYA 4BX9C 1FTTA 1Y88A 1FMWA 3H3ZA 1S0OA 2NVYJ 1JGSA 3SDBA 1FOXA 4FE7A 1U45A 5E8IA 2M30A 3HUGA 1QVUA 3I54A 2QLZA 3F21A 2BXZA 1HBXG 4C7ZA 4EYIB 4UB8U 3AG3H 1MSWD 8ICRA 1YS7A 4I98B 1NZBA 3HKZC 5KFKA 3DXJF 1BR4A 1BN5A 2LY1A 2L5QA 2MGQA 4BJTA 3OYIA 1SV0C 4RNMA 3LK9A 1ZLJA 4HNTA 2DU9A 2HKXA 1XN7A 3MWMA 5DD8A 2JPBA 2LFBA 2EZXA 3TP3A 1JROA 4RAZA 1W7PB 3FAHA 3OSNA 1QQ5A 3LWMA 3PO4A 2PKEA 9ICEA 3K0LA 4Y2SA 2ZMEA 5GTIC 1C0WA 5KG6A 1JHHA 4F8RA 1OYYA 1CF7B 1TVAA 1HOMA 3WHCA 3S14J 2HEOA 2IOFA 4J03A 2Y1IA 1ZQQA 4DL2A 4I29A 4PUSA 1S0VA 1OCRH 3QOEA 2R5YB 1MJBA 3FIWA 4I0AA 3MCZA 4XKWA 1XB4A 1H9GA 5CVJA 3U2RA 5J47A 5A2QK 1EJ9A 1YHQI 1ZJNA 2IS2A 3KFUF 3RQ4A 3THVA 4CE6A 3L3FX 4KIFA 2OTLI 1SMTA 1X1CA 3RKQA 4Q8EA 5EF6A 1Z0XA 5GAEJ 2F5EA 4QTRA 4KLDA 2Z9OA 1ZQNA 5E18F 4E7IA 5HODA 5AM0A 2X6OA 3FX3A 3H0DA 2W9BA 2RGVA 1A36A 2WF7A 3WK7A 5J29A 2ZKZA 2XDVA 2W7OA 1HUOA 3QQAA 4XLHA 4LG0B 5FLXK 4CCJA 1VQLI 5KFEA 4F5OA 3DPLC 4BHCA 1QCKA 5KFVA 1XGOA 4BE1A 4ZOHC 1MMGA 2A61A 3RRHA 2ZNZA 3BZKA 2Q1ZB 2DQRA 3UR3C 1O57A 4XLPF 1WJDA 2W54A 3MR6A 4J00A 4A93J 2HHXA 2QB0A 3BTJA 3CP8A 2YB1A 1OPCA 5ALYA 5ICFA 3JRDA 3KYDB 1XX5A 3OIPA 2QQAA 1K78A 2JPCA 3M07A 1D5VA 5AM4A 1L3UA 2IXSA 3PNTA 1UZCA 2F4OB 1N56A 4XIDA 1YE9A 4RQ3A 1MA7A 2COMA 1Z7LA 4OOIA 1XTAA 2E35A 2L9RA 3VWBA 2UZKA 3WK9A 1NH3A 4IF4A 1R58A 1B43A 1V9PA 2BVMA 4I0BA 1O7LA 1S7OA 1K1SA 2KEYA 3V7JA 1I5ZA 3SQIA 3OSPA 2HXIA 2HXOA 2W00A 2X48A 1VDVA 5KFDA 4D7NA 3K1PA 4Y3OA 2PX9A 4MEYA 5ERIA 5KT5A 4J9MA 2NS8A 4R79A 5J6XA 1HCRA 2LPEA 1A5JA 2MA1A 2Q4TA 3SFZA 2EH9A 4KN4A 4GDFA 2HKOA 4LZDA 2H3ZA 3C28A 4NNJA 3TAQA 1F0MA 4QZGA 4IR9A 1ZRFA 4OIOF 4QZCA 2F5DA 3LSRA 2TCTA 1ONVA 2ATLA 1FBSA 3E7LA 1TWAJ 2KMUA 4JYKA 3FXOA 4YIIA 1VQ4I 4RPYA 2ESHA 3RYPA 3N28A 4J9SA 2VT3A 2MFZA 2RQQA 5F0HA 2D2WA 2BZFA 4PHEA 3S1NJ 2G5HB 2LYHA 4C4SA 1LE8B 2JT1A 4Q48A 5FO5A 2E1CA 3N05A 1GXPA 3OS2A 4ECYA 1IXRC 3E97A 3F2CA 4AYBN 3GTQJ 1WWUA 2VJJA 4TV7A 4C3IJ 1FPQA 2OCEA 1YO5C 3DV8A 2R7OA 1B9NA 4I7HA 4MHGA 2HWVA 1URJA 4TQSA 1BA5A 8ICPA 2ZJPF 5CYVA 2CQ7A 1X9WA 2X1DA 4KIGA 2DT7B 3FXMA 5F0FA 3CTAA 2EFPA 2V4JC 5EZHA 2RHFA 3N97B 1TWCJ 3HHGA 1AOYA 1H9TA 4Z6CA 2DDAA 4F3QA 1MC8A 3H0MB 2WF5A 3HTUA 2LTPA 3GILA 5EDNA 2MH9A 3PUBA 1RETA 1TW3A 1JI7A 8ICYA 1TW2A 2EZYA 5DCFA 4JUZA 5KFPA 5IPAA 3FXUA 2X1CA 1PZNA 3ONNA 4GIBA 2WAFA 3PIOF 4EGYA 4ESBA 4ED6A 2EAOA 2M0MA 3W6KB 8ICWA 2BPGA 3H5AA 1ETQA 1JT6A 1VI0A 2FE3A 1ZQFA 2NYVA 2BCSA 5E3NA 1WGXA 3M8FA 3DFGA 1TAUA 4M72A 2LBFB 1CGPA 5KFZA 1MIJA 4BBSJ 3M9MB 2M87A 3CF2A 3GTJJ 4O3PA 4XSZF 5AI4A 1G3TA 5KFOA 4GCVA 3OOPA 1OKRA 2K27A 2QKLB 3L7WA 5FFXA 4V2FA 2HOTA 4HDVA 5ALIA 4M6YA 3ISPA 8ICCA 2E3TA 4E7KA 3LSMA 1WYGA 4L0ZB 2W25A 2WAQC 1RKTA 4KX5A 3JRIA 2BPFA 2JEJA 3NRZA 2KJ9A 3IWZA 3FMSA 1TWHJ 4TUPA 2QF7A 4NC8A 3ZQQA 1R9TJ 1GT0C 3EUHA 1ACIA 1S97A 1IRGA 1STZA 3DBRB 4IHYA 1L8OA 2P5LC 1T0FC 3W2AA 2B21A 3MC1A 4QZ9A 3RJKA 2GAUA 2R8KA 3GW2A 3LSTA 1NG6A 1VQ8I 4G9BA 4S0HB 2O9LA 3WKEA 2QBYA 1VJ5A 4XLEA 4YXJA 4GYIA 1FSHA 4FS2A 1WG8A 5ALLA 4KLSA 3D5LA 2MBFA 1WI3A 2Y69H 5AONA 1VF9A 3OWTA 1FNNA 4XNFA 1J59A 5KFHA 2H5XA 2M9NA 1DOQA 4BXUA 3MQ0A 2Y1JA 3E6CC 3C2KA 4LFUA 4P9FA 4R65A 1LKXA 2VBZA 2JK3A 5KHDA 2V1NA 5AICA 4D5CA 4DYCA 1Z00B 3RR7A 5D8KB 5IIKA 5J2BA 1E3HA 2L01A 5ILUA 1HQCA 5J4YA 2NVXJ 2BKEA 2F6CA 3C1DA 3LL7A 4M3DA 5GTHC 3GV8B 4II3A 1BGXT 3CLOA 3GVAA 5C4XJ 4CF4A 1S6LA 2QSGX 4RQ6A 1VTNC 2H94A 3F8FA 1ETWA 3M9AA 1MGTA 1Y8RB 3L1PA 2L2OA 1XMAA 2JUGA 2LG4A 4XN3A 5TRDA 1ZGWA 2KG5A 3O8HA 1W36C 2NRTA 4NB5A 1PUFA 2ZIXB 5DD4A 4ED3A 2HOIA 7ICQA 2HOFA 2OWOA 1U5TB 2VC1A 1ETXA 5G5GA 2UVUA 2HS5A 3UXPA 4IZZA 1Z21A 1S9HA 1XD7A 4BHBA 4W1UA 1TQMA 3UNGC 4ECUA 4ON0A 2HOEA 1IRZA 4I6ZA 5JRTA 1WJBA 2EK5A 2ISZA 1W1WE 2V9KA 3BJOA 3HYIA 1HKQA 3UQ0A 3DEUA 3B6AA 2K4JA 2E7WA 1YIOA 3MVPA 2K3PA 4I02A 3RF9A 9ICOA 2KMDA 1ZQTA 3RKWA 2QEXI 5KFCA 1TNTA 3I4PA 4HLXA 3HXLA 3TADA 4XQFA 2L9VA 2W9BB 9ICVA 1X1DA 2DPIA 2NO5A 1JX4A 4UVBA 4Z6YA 3GIIA 1JKOC 2Y9TA 3FYHA 1B1BA 4KX3A 4M6WA 5J0OA 2DOEA 4QIWN 5FFZA 5EGOB 1RC9A 2EJRA 1BI3A 2ZMEC 3GBGA 3H5NA 1JKPC 4Y2UA 4F5PA 4YVZA 1TT5B 4FT8A 2DN0A 4YD2A 3RJGA 4BL0B 2NXNB 2KE7A 2ZNYA 3HOWJ 4ZH4A 5E1WA 1S10A 1QZEA 2K4BA 3TO9A 3VYRB 4A3KJ 1X19A 3EYIA 1PYVA 4UATA 3H8MA 2YTUA 5J0RA 1NK4A 2J6TA 5D5UB 4CRXA 4KMOB 1WZ2A 1RPLA 5BS6A 3KP4A 4G12A 3ROUA 3CCQI 4KN7X 5F9LA 3OYFA 5JVGF 4JV0A 4ECXA 1MD0A 2AO9A 2F4IA 3LSHA 3WU0A 4BAYA 2ZJ5A 4XRSA 5FRMA 1Z6TA 1BR1A 2LREA 2KKOA 2XB0X 2WFAA 2J6UA 2HU9A 1WH5A 2YB4A 3NUQA 5ALDA 4X1EA 1QQ6A 1T39A 3ED5A 3LSKA 2HYFA 4QZFA 5EJCA 2IHMA 3HOXJ 2O03A 3LOCA 5CB1A 1JTXA 2WA0A 4IRDA 3QEBZ 2MUTB 4Q4ZF 3D2NA 3RJJA 2A6HF 3UPQA 3HSEA 1BL0A 1BI2A 1MDMA 4MF2A 5J1RA 4AM3A 2DMNA 1LNWA 5ALUA 1YRNA 3GO5A 5KFIA 1NK6A 3MR5A 3L09A 1BOBA 4Q44A 1BJZA 3M8JA 1SWVA 3IP4B 4DFDA 1TKDA 3D2SA 4DLGA 1SXDA 2MUTA 1Z9CA 5H2FU 2UVWA 4L9VA 3V8LA 1ZKGA 2Q2EA 2UXXA 5LHHA 5LEJA 3ZCOA 2UV1A 4QPQA 2MLKA 2I5UA 2IGNA 9ICBA 4XRSG 1B0XA 5JHFA 3TO7A 3OYAA 2HBLA 2YMLA 4BWMA 1N61A 4Z6DA 3S2WA 2O61A 1TL8A 1R49A 1SV4A 2BBYA 2VLAA 3QU2A 3ZRGA 1IAWA 5JI6A 2VANA 3CMMA 2DKXA 5J2FA 1K4TA 1TTYA 5KG4A 4F4ZA 4YMOA 2BQRA 2R4GA 5EZGA 4ZYEA 3H9GA 3K4NA 3KEQA 4C8KA 2B7EA 4KLIA 7ICJA 4EJUA 4C9YA 3IKTA 3JPPA 5HDGA 3L2VA 3D6JA 3K4CA 1PVEA 3QU7A 2E1NA 2R7DA 5LEKA 4UHTA 1HA8A 1DGRM 1ZQBA 4PJ0U 1O4XA 3JRFA 3BP8A 2DA3A 4EBDA 3QU4A 4B4CA 9ICKA 1WKMA 4B9VA 4R66A 2K4EA 2X1EA 4HW0A 3GLLA 5FGMA 2K8AA 4L9JA 1QPIA 2Z16A 2FNPA 1IXSB 3P9IA 5IP9J 4P1WA 1FEXA 2R7XA 3DQVC 2Y0MA 2XHKA 3QXGA 3CCJI 1XU4A 3PO2J 3CCYA 1QH9A 3P5JA 1D5YA 4AYBC 2ELHA 4EGZA 2WV1A 5TZVA 1X6IA 5KAFC 1C7YA 5KG2A 4GYGA 1MBFA 4IXAA 5J0TA 2CFXA 8ICZA 2IVMA 4PSWA 2V7FA 5KT3A 2XKOA 2H1LA 9ICCA 5K1YA 5HP4A 2PFOA 5DUKA 5EWGA 2G06A 5K5OA 1EKEA 3LAJA 5IIMA 5CQGA 3SV3A 2FDRA 1PK1B 2VA3A 4RMNA 4FO6A 3TBIA 1PUFB 1IG6A 1OR7A 3O0FA 1SFKA 1J75A 3U1DA 4MNUA 3KYLA 2E5ZA 3LWFA 4M3FA 2NNYA 4U87A 3ZQGA 3HOZJ 5DBCA 4IHXA 4QZDA 4JWNA 2COBA 2GXAA 2DQNB 1NJZA 2EIJH 3L00A 5ALMA 4LLNA 4HSRA 1SKWA 3ETLA 1WUDA 1B9MA 4UBCA 4S05A 3AG1H 2IS1A 4QZEA 3CJTB 3OL4A 1XMKA 1B72B 2P6RA 4G6TB 5FKOA 5IP7J 1FZPB 2FRHA 2IGMA 1X1PA 3Q8SB 1OFCX 5BOXA 3T5JA 3G2BA 3GU3A 1XSXA 2JR5A 1ZQJA 3WK6A 3KD3A 4IVNA 1D8LA 1WSUA 3FWEA 1MBKA 3H3VK 4Y7NJ 1RRJA 2IRFG 2ZFUA 2E8OA 4HEA2 3G1MA 3C5GA 1UA0A 3SZGA 2DPJA 3KTQA 4CUGA 2ZJRF 4KMFA 4DLEA 1G4DA 4ZYHA 3BG6A 1UT5A 3P7NA 1X66A 4DQIA 4LIUA 5KT2A 1X42A 1IV8A 5HDNA 4IOCF 3MFIA 2GZWA 5HNFA 1W36D 5DLFA 3QOPA 4XICA 5FLXZ 3JTHA 4A8EA 2BCUA 5GAGJ 1V97A 1NJXA 4BXOB 5B3SH 5J8YA 1KA8A 1HDDC 2VOOA 1FTZA 2LMRA 3LSJA 1IZ1A 2TRTA 2BHYA 2KJCA 3QP5A 5L1MA 2CS3A 3LSGA 1N5WA 3H8WA 3GCMA 5IYCJ 3HPGA 5AKEA 1GVDA 2K60A 8ICTA 5L1KA 2XF6A 5LHGA 2E60A 4EYHB 3F6VA 2XF7A 3OIOA 1ZHFA 4KDPA 3C21A 3K1ZA 2AJQA 5BQTA 3H7IA 2K4PA 2OUMA 3K69A 2LH9A 1KFDA 2P81A 2HTSA 2XF5A 1ERDA 1J7KA 1IV6A 3A02A 4RQ0A 3NWTA 3BG7A 2DODA 2A1JA 4HA8A 2JA6J 2VB6A 3JRBA 2Y0SF 2WB1N 4A0ZA 3FXQA 3IRUA 4XQ8A 3TFSA 2ASJA 4XKVA 2DXIA 3HHHA 3AG2H 2NRAC 2IW5A 4RT2A 1NKEA 4YR3A 1YJ9I 1I3AA 4Z2YA 3F8BA 3OMYA 4DL3A 3BQ2A 4I27A 4USAA 3MZ8A 5L3FA 3TP0A 4CNQA 5J0SA 2XIGA 2X0LA 2B63J 4DS5A 2GOXB 3FMQA 1P7IA 4PHDA 2HVQA 3PNVA 3AU6A 3GIMA 2BGWA 2ZG6A 3S2HJ 1SZPA 1V38A 5CJ7A 4ELVA 5C0YA 1S0NA 1UAAA 3KHGA 3FKIJ 2OHFA 2KLOA 1FC3A 4GC6A 2ZC2A 2H6CA 2LY9A 2EZZA 5KFGA 4OINF 2ZSIB 2KISA 4ZC3A 3B0XA 5AKXA 2F5CA 2KNJA 4ECVA 3AMZA 4OO1J 2QGUA 4XL9A 3KPHA 5IIIA 2B6GA 3KP3A 4XORA 2JA2A 2VOPA 1Z4NA 1SFXA 3WGHA 4UVCA 2JXJA 5HR7A 5J8FA 3I64A 2KICA 4Y2TA 1DRGA 4OD0A 2M8EA 2IBDA 5AIPA 1MN8A 4KLGA 1S9FA 2HFHA 3F8CA 3KZIC 2CV2A 1KN5A 4P0QB 3KP5A 5HHHA 3QYPA 1OLTA 2VKHA 2FI1A 3WG9A 2R8JA 3KE2A 1RQNA 3WKAA 2YX4A 4YIRX 1BPBA 1X4PA 2IEKA 1SVOA 3FXKA 4EJWA 4A12A 4GFBA 2F8KA 3ML6A 5F64A 5J40A 4G3IA 4EQQA 4C8LA 5AKZA 4GXIA 1SKRA 2CV1A 1YITI 3A0HU 4DOAA 3SI8A 3F2DA 1JI8A 3L5KA 2A07F 4UB6C 1KEJA 2FQ4A 1U0JA 1PK3A 1LJ9A 3VYTB 1BBYA 2DFLA 2RDIA 3ASOH 4YIFA 2E34A 4O5EA 4B3AA 2Z1DA 2H3FA 2BHZA 5HOOA 3AU2A 2OQRA 2XICA 2KKPA 2ZB9A 2Y0SA 3CUOA 3W6VA 1BPZA 1DK2A 2KTQA 2C22A 5TISC 3C1YA 3RDIA 1ZN2A 3FZVA 2JH7A 5KFJA 1BW6A 2CU7A 1Q46A 3EZ5A 1ZH5A 1KONA 4NY8A 5CPRB 2PFNA 3FK6A 2PLYA 5IT9K 3K70C 1O7FA 2KZMA 1QRYA 3WK8A 2F4MB 5ALQA 1W5TA 4IQUA 1JXLA 2ZIVB 4K4GA 2EFWA 3A2KA 4A5MA 3QZ7A 2Z99A 2XC9A 3RAXA 4JV2A 4LVSA 2F76X 4DFKA 3F5EA 4QNLA 2HI3A 3HP6A 4QIWF 4IQWA 1YW7A 3KYCB 2KDZA 1NK2P 3ABUA 3ZQLA 2XCPA 2OTJI 2WAQN 5EG0A 2Y9UA 1YTYA 2GM4A 4G6QA 1ECWA 1DUXC 4RUAA 4RPZA 4LG0A 3F9KA 4YR0A 1OUQA 3NARA 3RKYA 3TEDA 4BJQA 3R0AA 1ORKA 2A1AA 3BTLA 2QQBA 1VQOI 4DF4A 2WB1A 4NQWB 5J2KA 1IDYA 2WTFA 2NS0A 2FUG2 2LSOA 2FX0A 2VKQA 3W2VA 3DTKA 3L2QA 4Y4RA 3SHFA 2DFEA 1S8NA 2X6WA 3BCBA 3X2QH 1PDNC 1UT8A 3TARA 1ZARA 2L7MP 3BTIA 1S76D 4F4YA 4RGXA 5D6EA 4C3HJ 2XAUA 2R92J 1XDUA 3ZMTA 2VXDA 5DV5A 3VSLA 5J2CA 3H0RB 2FMPA 1LDKB 1ZQXA 2Z2SB 5C5JA 2NV3A 5E79C 3BC8A 4YR2A 3REOA 2IS4A 1Y0UA 2M7AA 4IRHA 3H8JA 4P55A 2ME6A 1HJPA 3HEFA 4MIMA 3MD2A 4NJ8A 3DKWA 2NRVA 4M2YA 5AKGA 2HQAA 2KP6A 2EZIA 1U5TA 3LA3A 1LKYB 3I4NJ 1J2MA 4KLUA 2CQKA 2O5RA 2QYOA 2E2IJ 2W8LA 3VB2A 1L7PA 5ALKA 1FIQA 1D1BA 1GLNA 2R5ZB 1HW1A 3BR3A 4BY1J 3I9V2 1SEUA 5L9XA 4O3NA 4JX4A 1KU3A 3DEEA 5HS7A 1X2MA 3S3NA 4A6EA 2VQLA 5ILSA 2BV6A 2R7ZJ 2PMZC 5J2AA 7ICUA 3HJEA 5BOLA 4MFEA 4F5NA 3V7CA 8ICJA 4RB2C 1SD4A 2HQNA 3M8SA 4GXJA 4IHWA 1TK8A 4M9HA 3HOYJ 1KL9A 1SGGA 5K7ZA 5BOMA 1RG6A 1OISA 2KL4A 4UNOA 2OXOA 5FKMA 2WF8A 1P4AA 4US8A 4JK1A 7ICVA 3ABKH 2QARA 1RXWA 1YZ7A 4E4HA 5C3EJ 4A3EJ 2XAJA 3NVWA 1BM9A 2DMQA 1QVTA 4M04A 2ALZA 1DGWY 2A6EF 4HX4A 4PJJA 1H8AC 5DB9A 4FBTA 1YX5A 2JA7J 1UCVA 3S6JA 2R7RA 5L3EA 2K02A 5AIAA 1G3WA 1OQYA 5EWFA 4EENA 3C18A 4RUCA 1U47A 4I01A 1XSLA 1G2HA 2ICWG 4QIWC 1F43A 1IN7A 4C7YA 3VYSB 2XPUA 2O6GE 2HYGD 2PI0A 3JPNA 3IH4A 3QUCA 3K1RB 5GPCA 1RPWA 2HQRA 5DQGA 4A3GJ 3GUDA 3HRDD 4I2BA 2DF4B 3KEOA 1G3SA 3MKWB 2HBJA 5GAHJ 2IGKA 1REPC 2HYJA 3QWLA 2V9VA 4I2GA 1NK0A 3C2LA 4CZZA 4DSLA 3RB6A 2EH3A 1D1AA 3S15J 1TWGJ 2K85A 2QKMB 2IHNA 2K5CA 4AVPA 3JPOA 2STTA 3JTGA 3I5UA 3TOBA 4L0YB 1O03A 2ZJQF 4NL9C 1QLNA 2EQRA 1NNLA 5J8YC 1R4NB 3PW2A 1QQ7A 4B6JA 4IO9F 2WB1F 4RNOA 3T3FA 4Y52J 2MSNA 3GMEA 3RQIA 2FPMA 3SEIA 3CCRI 2BY2A 1DXSA 3OS1A 2W24A 2ZTCA 1IDZA 2JMGA 1T8IA 3CD6I 1KBUA 1ZQMA 5F9NA 2CW0F 1Z1DA 3CCEI 3HOSA 4HG2A 4OIQF 4MTEA 2YSRA 3C1ZA 3RAQA 3L2UA 3QUQA 2K89A 2YPRA 2QUFA 2VL8A 2A1JB 2DA7A 1ED1A 8ICOA 1VZ0A 5KVRA 1JKRC 2ZTDA 3ZDAA 1QGPA 3NRVA 2XSJC 1PJRA 3EYYA 3ZQ7A 1NKCA 2HR3A 2KJBA 4F71A 4KA4A 4U0WA 3IG8A 4ESFA 1L5UA 3FM5A 3BQYA 4PFOA 1FP1D 3BTCA 3K70D 3BR1A 2JTVA 3HB9A 3PO3J 1UHWA 4EM1A 1P4WA 2O8KA 2FMLA 2Z7JA 2GXBA 4DYQA 2H1KA 2KV2A 3GZ6A 2MD0A 3NGDA 3JAMK 1T8EA 2W43A 1JTYA 2VPLA 8ICLA 2AGOA 1DU6A 3FBNB 3SAGA 3CZ6A 2F44A 3B0YA 1TAQA 2XCAA 2PN6A 4H0EA 3R9KA 3KOOA 5IILA 3RB4A 2VC0A 2XAFA 3F0CA 3PX6A 1TK5A 1EV7A 3MR3A 4DSJA 7ICMA 9ICGA 1VQNI 1QZZA 3LYSA 4XRFA 1T4GA 3OL3A 1W7PD 2H8WA 2G0AA 1B4FA 4DSEA 2LYCA 4NC6A 4RQNA 3ZI4A 2ECBA 5K4LA 2FOWA 5ALGA 4CCHA 4E7JA 2JHDA 2C2RA 2OF7A 5KK1A 2IP2A 4UBBA 2FXAA 2LLKA 1UJ8A 4JWMA 2FLPA 1IXCA 1X40A 2HSZA 1SFUA 3GFJA 2O6KA 2VI6A 1ZGJA 2P6TA 2V1XA 4C2MJ 3ZR8X 4ENMA 1FEZA 3BS5A 5AKLA 5KFBA 5J2DA 5ICEA 2Y0SC 3V4GA 1GHCA 3KETA 5L3BA 4A3LJ 3M6KA 2DDBA 1RR7A 4A3BJ 3RI4A 5HLGA 2RC4A 1E3PA 2V1UA 1O08A 2NAZA 4IR1A 2CW7A 3MGHA 4IL6C 2VN2A 5H6RA 4HQMA 2BW3A 3ECOA 4M9JA 1K5OA 9ICRA 1ZQYA 2L7ZA 1XSDA 1MH4A 5KG0A 2GO7A 3UXOA 4L5IA 2CXYA 4ZYGA 1FFUA 2W55A 5CVIA 4DEZA 2KN7A 7ICTA 1COKA 2N8GA 4KMUA 3HKZA 1O3TA 3HOVJ 1KQQA 3MKLA 3ABMH 5C4JJ 3H0LB 3CQZJ 2GOMA 2KQRA 5ALNA 3WKCA 2GWSA 9ICSA 7ICRA 3BS7A 2LP0A 2H3IA 3RH5A 1X58A 4ELTA 1ZTRA 3U26A 3V7LA 2A05A 4WCGA 2OAZA 3N7RC 4B9SA 1PVQA 3GFMA 2KHQA 9ICUA 1D8KA 1P92A 9ICXA 3EETA 5IINA 1MQ2A 1IN6A 3OYLA 3S1RJ 5JUMA 5HDKA 4FETA 2Y75A 1YI2I 2PG4A 2WC2A 3UKGA 2CUFA 2RV8A 1XGSA 4B48A 4RB1A 3ZDEA 1ZREA 4XUSA 1YLFA 1L6NA 1ZQLA 3PZPA 2CUEA 1H88C 1TE2A 2XVCA 2HVSA 2LY2A 1FFVA 2QARB 4Y2RA 2E8MA 2BXYA 2ID6A 3ZQIA 5EYRA 2DO7A 2XROA 3G71I 2WHEA 3SV4A 1U48A 5LHIA 2R5YA 5F3XB 1SFOJ 3M1CA 2MLGA 2LD5A 2GLEA 3CDHA 1U9OA 3A1YA 5L3CA 4P0PB 1UELB 3BQ0A 1OCTC 1LEBA 3NEUA 2FNAA 2CMPA 5DEQA 2DJIA 1GDTA 4MLOA 3HDDA 5J1UA 3RZOJ 1WJCA 3J81j 1R00A 1U3EM 3HZJA 1I1SA 1LEAA 5DGAA 4HF1A 3PFYA 4EMSA 3ELKA 3L2CA 2KIVA 2KZGA 4B44A 4BWJA 3PR4A 3Q8RB 5KG3A 3N4MA 2CRXA 4F2SA 4ECQA 5LGNA 3I56I 3MBYA 5F08A 1S7EA 2OBPA 1YOVB 2HOAA 5EEHA 3OSGA 1SC7A 1F4KA 1ZR4A 1R1UA 1ZD4A 3F53A 4O3RA 4V19K 2EZKA 2AS5F 5AK6A 4F5QA 1R36A 2R7VA 5IIJA 1ZYRF 3H0GJ 2RQPA 2OYYA 5J2JA 4RLFA 2WB1C 2L4MA 3H92A 4CYDA 5D5XB 3C5FA 2KZVA 2OQGA 9ICNA 3LDAA 2W9CB 5BPDA 4GC7A 3ZN1A 2XY7A 1R5GA 3BPVA 3D5RC 4XLAA 4XR6A 3J80K 1WHUA 4BU2A 3ALRA 1ZQAA 3EQLF 4IJAA 2L02A 5FKLA 1QQIA 3H1CA 2E1FA 2JRZA 5AI5A 2IBKA 3PQKA 2K7LA 3PX0A 1ZD5A 2FE9A 3OGUA 2DKZA 2ECCA 2LMDA 2P0WA 1NK5A 4JBAA 2K9LA 2W1OA 3UMGA 3WU2U 1WJ5A 4DZPA 4ESJA 3OHAA 3ZDCA 2XSDC 4HZFA 3R60A 4D5FA 2OD5A 5DDYA 1J2XA 2ISYA 2ZBKA 3T8TA 4ZJZA 1IRXA 4DQSA 3PW5A 3PM1A 2GOLA 3WU1B 3I55I 2ZIVA 3KP6A 4U6PA 2KKVA 2VKDA 4KUMA 4ENNA 4QW9A 3VPRA 1NI3A 4UB4A 1BI1A 2EIMH 5ICCA 4QZHA 1XGMA 1FBUA 4A3IJ 3E5UA 2D5VA 1ZQOA 1R7JA 1UMQA 1N78A 1KLNA 4KLLA 5KG5A 4CA0A 4M9LA 2Q0ZX 3QPSA 4RAFA 2E2HJ 1EA3A 1NK7A 1QBJA 1N25A 1OCZH 2X6XA 1XO0A 4UB5A 2M45A 1E2XA 3W2WA 9ICFA 4LK0F 2VUMJ 4I2EA 4KN4X 4D0PA 2ZJ8A 5DDGA 2DI3A 1L8LA 8ICIA 2ZSHB 4QSHA 2VA2A 1UHSA 1Q1HA 4WXDA 3L2WA 4FHTA 4EEKA 3HPOA 4RU9A 5FD5A 4GXKA 3T5LA 1A04A 4JMUA 1SWWA 2ZXJA 4QLCU 2FJ1A 3HBLA 2BZTA 4HV5A 3C2HA 2QB1A 2XGPA 1BIAA 2JJ7A 4YN4A 4HSTA 4F2RA 3COAC 1XS9D 3RJFA 4ELUA 2LNBA 3DLLF 4Q5SF 2IOHA 3N4MB 1R1TA 4NUBA 1KU2A 3N7PD 5AK3A 2K9NA 1A6IA 4PJMA 3HW8A 2OC6A 3LFUA 4PJNA 1AKHA 2H3VA 2FLNA 1HUZA 1NG7A 3CJRB 1K7AA 1V5GA 2PBIA 3OHBA 3E5QA 3WTWC 1PVPA 2VPRA 2FMSA 4EX7A 3ZGKA 1Z67A 1XWLA 3PSIA 3V7RA 4KICA 4XOPA 2DK8A 4DNCA 5DTDA 3NWSA 4ECZA 2EA4A 4UARA 4MFAA 3K75D 1ON2A 4B9TA 5A2QZ 4U88A 1LB2B 3DKXA 2NRZA 3EYZA 1TLHB 4Y15A 3PR5B 1MQ3A 3WODF 2FBKA 3PL8A 2ELJA 1O3QA 3OPXA 2LKSA 3W6JB 2FD5A 1A76A 4F72A 2H3QA 2KT0A 1YJWI 1SD7A 4KLHA 4A3MJ 4YD1A 2AH5A 4KLJA 4BDZA 5KFSA 2YX7A 3PV8A 8ICSA 2M7BA 3MFHA 2P35A 4ZZDA 3IG5A 1R5ID 4YP3A 2M0NA 1Z1VA 4P0PA 3F6OA 8ICNA 7ICSA 1YW9A 4K4IA 2DFHA 4QZ8A 4K2EA 2LM4A 2KFDA 1JXEA 2QSHX 2E19A 3B6CA 3MN2A 3H9QA 4PZJA 4FZNA 2NS7A 4IS7A 4NM1A 4RT3A 2L9NA 4AC0A 2F1HA 2ZO4A 2VQHA 2QCOA 2FBIA 3Q0UA 4NC7A 1IGNA 4XLNF 2IA1A 4AU7A 4I09A 1YT3A 4IQVA 4XONA 3AG4H 3GEZA 4OCZA 9ICTA 4TQRA 1Z19A 4M9GA 2JWTA 1PUZA 2DA6A 2ELKA 3D1NI 3HOUJ 2MC3A 9ICIA 2DUYA 2ISOA 2JVGA 3TGNA 2BW3B 3HOTA 1N63A 5IOZA 2VKEA 4CF3A 1ZETA 5KNLA 2XGDA 2LKYA 4Z6FA 1YQAA 4HX8A 5E79U 4ZTJA 1N2XA 1ZG1A 1L3LA 1HEKA 3QU9A 5DCMB 4G7OF 4RM3A 2DGZA 2KRHA 1NK3P 3S1QJ 2HHTA 2E1MB 2ES6A 1SFEA 2DL0A 4J01A 3S8PA 4OU0A 5GP9A 1VQKI 5AM3A 3MDCA 3KHLA 4R8UB 4BKXA 1K4SA 1IN5A 1OYIA 2V26A 4LOCA 4EATA 3ISCA 3WE2A 4O0IA 1F5SA 4AP9A 1N48A 2DA5A 3CCUI 4Y2XA 4YFKF 1P2FA 1SIJA 4M3GA 3KZZA 3G3ZA 2ZUBA 1ZQPA 5B66C 5J2HA 4P2HA 1X9SA 1UFMA 4RZRA 5DQHA 2HNHA 2W84A 3JRGA 1APLC 2CG4A 3GTPJ 1SVMA 3C2BA 2KSOA 4BQOA 3OR1C 3PW7A 5ICGA 1IO2A 4ED0A 3GWZA 1B8IA 3JW4A 3BS5B 4LLGF 1NK8A 4AYBF 2L7FP 1VQMI 3Q8MA 2JQ7A 3AQFA 1A6QA 1S5LC 5KFWA 1HW5A 4I28A 1V55H 5AI9A 5AKKA 4P4PA 3QX7A 4HNUA 5KG7A 4F4XA 3JSPA 2EIKH 2XVTA 4I2IA 4HNVA 1LE8A 2PMZA 4IPAA 5L3DA 2CQNA 3D5SC 2OV7A 4NLZA 1N5XA 3LVVA 2YUSA 5EEAA 4F7ZA 3OYHA 4L5EA 1DGSA 2P5KA 4GO1A 1AQ6A 4LD5A 3GQCA 2VBXA 1U9NA 3C2GA 3P9CA 2IA2A 3MMYB 2I10A 4I2JA 3M8RA 4RQ5A 5CLSA 2BYVE 2A6TA 1OMIA 3C7JA 4HBLA 4PK4A 4S04A 1T95A 3L2RA 2EBIA 3J80Z 3WTVC 4AUXA 2LOOA 1QU3A 1IM4A 2W11A 3TDUC 3R6SA 2KK0A 1XC9A 2PI4A 2P8TA 2AHQA 4US9A 3H4DA 2KSOB 1TFRA 5F6FA 4IQ4A 5LGUA 3SENA 5DBAA 4O9MA 2VQCA 1UPHA 3K9TA 4DL7A 4RB0A 1QSYA 1FSEA 1RIOH 2HW3A 4BYYA 1HSJA 4C2UA 5K5RA 1GUUA 3H40A 3C2MA 4X6AJ 1ZD2P 8ICBA 2ZUCA 4BH9A 2D45A 5GTHU 2VE9A 4A5NA 5LRSA 1EH7A 2F1IA 3KZIU 5DB8A 1ZQKA 2DFFA 1X4OA 4OWRB 3LNQA 5ALZA 1FO4A 4G94A 4UB8C 1ZK8A 1D8JA 2FPLA 4RQ4A 5D5VB 1KQ0A 1J97A 3SFIA 4XA5A 2EZHA 1H0MA 2QB0B 5LD2C 2DQLA 4N4NB 3G6XA 3ZQHA 1T2KA 3R61A 1FYMA 2XV4S 2NVTJ 4DF8A 3CYMA 1KW4A 2PMHA 3H3UA 3WK5A 5K7HA 1RZ4A 4HF2A 1TK0A 3VSKA 4U0YA 8ICKA 1FWZA 3PW4A 3GTLJ 1I27A 2KFZA 3FXRA 4RPXA 3SAHA 2ESNA 2MU2A 1YG2A 4ITVA 5D4SA 3E6MA 2GIZA 3AM9A 3ISDA 4BXFA 9ICHA 4M9SA 4JK1X 5DG8A 4CCMA 9ICMA 1T6SA 1NTCA 3CRXA 2IT0A 3ZD9A 2DT5A 3K2AA 4DL5A 2HGCA 4FTHA 2W8KA 1USTA 2AQEA 4P4OA 4UQGA 3ISBA 1U9LA 3S3MA 4DFJA 5LFAA 1ZR2A 5JVTA 4DBQA 3GTGJ 7ICKA 4NLGA 3E1SA 1NJYA 2WY8Q 1P6RA 2HZDA 5ALOA 2L4AA 2CW8A 1B6AA 4HDUA 4I2OA 4QWBA 1RNLA 2DCEA 3ZOBA 4WWCA 1CF7A 4BJ6C 5CKTA 4OIPF 3QUTA 3AKZA 5D8LB 1TC3C 2ZMEB 3GFKB 1WI9A 5KFNA 3UMBA 1WJAA 2J5PA 1HSTA 1W7PA 3F3XA 5KL1B 3HG9A 4J9NA 4KLTA 2ASDA 2DBBA 8ICXA 4F4KA 4G7HF 3IN5A 3FXLA 2ZXHA 3DBLB 2MG4A 3GIJA 1CUKA 2M0CA 3G1LA 4EEYA 4A6DA 4YG2F 3TDZC 1J0RA 1MH3A 3CC2I 2KJ5A 1J5YA 3UM9A 4DOCA 2XRLA 2YS9A 4KN7A 1XSVA 3IAS2 1A6SA 1BI0A 2DMPA 1JGGA 2PJRB 3BQ7A 3M7DA 4Q45A 4M9NA 3I59B 2Z3YA 1U6GA 3MEXA 2I6XA 2OPTA 3BQ1A 1RR8C 1TBXA 4EBEA 1XPXA 2CN1A 3CW2C 3EPZA 3OY9A 1V5EA 3WG7H 2F5VA 1L0OC 2CQQA 2EFOA 4DO9A 1UHUA 4MO7A 4YELA 1U78A 4ZYDA 1UG2A 1IXRA 3MABA 4K4HA 4WX9A 3BT9A 2AGQA 3HX0A 1LKYA 2W7PA 2E1MC 4A3FJ 5GTIU 1FIAA 3TMOA 5ALFA 2M3AA 2ADUA 2WWYA 3K1MA 3FHNA 1VQ5I 1YW8A 3SXYA 3SZPA 3QUBA 5TGTA 1W0UA 5M5XJ 3OYKA 4NL9A 4WXHA 2KVSA 3TQ1A 8ICEA 2IMWP 1QHGA 2V9WA 3K2ZA 1RUNA 1MMNA 3PQJA 1JUMA 4A2UA 2IA6A 1KFTA 3RTVA 2XGXA 1TAMA 5ALRA 1NZPA 4P5OA 2WF9A 5J2EA 3WKBA 3H5RA 5J0QA 3PY8A 7ICIA 4DQPA 3M8EA 2K8CB 5JTIA 8ICQA 3BZ6A 3FHZA 4KLFA 1B22A 2HTJA 4RB3C 1K1QA 5ALSA 4DQ2A 3JPSA 3F2BA 4N9IA 2H8RA 3LSIA 2RP5A 4HYKA 1LDDA 1V54H 4F91B 5KFQA 4J9PA 3E2EA 5E1ZB 4BHPA 4RQMA 2MAXA 5AHXA 2K9SA 2BDPA 4M71A 1RXVA 5EG0B 4ICAA 4UAUA 1SV0A 1LVAA 3QZ8A 2QZ8A 3HILA 4BQNA 2EB7A 5AI6A 5AIBA 5JU5A 5FROA 4E7SA 3I59A 4AWXB 1ZLKA 2W03A 5KAIU 2BOLA 2PJRA 1Y6IA 2HPIA 1D1CA 2Y30A 4XK4A 1KFSA 5AM1A 5A0LA 3V8JA 1QSLA 4IQJA 4RGRA 2EINH 1RKWA 4OJOA 2J6SA 2MD5A 2RKHA 4M47A 1D8YA 2LK2A 3AQEA 2LRDA 1Z6RA 2ZIWB 1DU0A 1SB3C 2W04A 4IRCA 5DQIA 1Z91A 2DK5A 3PSFA 4L9TA 3O2PE 3AUOA 3M3YJ 2XY6A 5ALJA 2Y31A 2QENA 4B43A 3K4MA 1YFHA 1R71A 1X6JA 2LF8A 2G9WA 4DW6A 3AL0B 2E5SA 2G0EA 1TWFJ 4AYBA 1TT0A 3JRAA 3VCBA 3SJMA 1O3RA 3OYEA 2QBYB 1ZQUA 3FISA 5M3MJ 8ICFA 2VQGA 1TQPA 4ZZLA 2RDPA 1MMDA 2V9PA 3BJ6A 2AQ4A 2XGCA 2RREA 4P0QA 1IUFA 9ICQA 2BPCA 1WQ2A 1XC5A 4PCQA 1PP7U 2AQFA 4A3DJ 5ALEA 3RYRA 3HRSA 1IIPA 2YN4A 4C8OA 3V42A 2FLLA 1E0EA 5DB6A 2B0LA 3NVYA 2CSOA 4RQ8A 2KIQA 4EM0B 3QYFA 5ALHA 2C2EA 2GIVA 2O7OA 1C20A 2HBKA 4N0BA 5LGTA 4P96A 4UW9A 2DWQA 4NWIA 4JV1A 3G73A 4UASA 1DP7P 1Z4OA 1ZQDA 3D2QA 2QA4I 5BPIA 1WJEA 4ASNA 2M4GA 1X3UA 4Y33A 2IS6A 2MW8A 1HW2A 1MKMA 2HOSA 4CICA 3PJRA 3F5AA 3V8KA 2HHWA 4N9HA 2VKVA 4OAYA 3VODA 4OAZA 4FE3A 5JLXA 1HIWA 4IHVA 1I6XA 3SDGA 3O8GA 5DYMA 2G08A 1GVJA 1ITYA 1RQLA 3I0TA 3Q3SA 1IF1A 5CRXA 2CUJA 3GTOJ 4F93B 1ZD3A 2HZTA 3SZTA 2HOQA 2DFIA 4C4TA 2FU4A 4RAGA 5IIOA 2H09A 3UQ2A 3HSFA 4CSWA 2AXTC 1SKSA 4F92B 5D4RA 4KLMA 4AIDA 1IRFA 5J0WA 3DLAA 5JR3A 3KLNA 2F2EA 5F27A 2EFQA 5F0CA 4MEXF 4PZOA 2X51A 3DKYA 1HF0A 2CV0A 5J0PA 4LK1F 3GV7B 3NS1A 5GPAA 3Q8KA 2FSWA 3NVZA 3LMMA 2V79A 1XCVA 5DUIA 4HRIA 1FIPA 2XC7A 5ALVA 4JX6A 3JCUC 2VT2A 4XLCA 5B5EU 3OYDA 3M4OJ 5KAIC 3CO7C 2GH1A 2XI9A 1P7DA 3QEAZ 2ME0A 5B66U 1EH6A 1R4MB 1Z05A 4A69C 3FDYA 3CC4I 1P9QC 4XKBA 1MW7A 5HLTA 4Y2YA 3V7SA 4WXCA 1WRJA 2K3FA 1LFPA 3ZMUA 4IHTA 3BZCA 2X4HA 2OJED 2CO5A 4UV8A 4B09A 2NVUB 3TI0A 2LBOA 3IUOA 3TL4X 3QP6A 4UUSB 1L7OA 4JB3A 4YXMA 3NTUA 3HT3A 2C6YA 1S72I 4CCLA 2HI0A 1OCOH 3A01A 2NO4A 4QW8A 5EE3A 4DSIA 4E0DA 3A0BC 5E8GA 3MKZA 3T0YA 1YX3A 2XAQA 3WGGA 1T94A 2A19A 2EAPA 2WBMA 5CQEA 2GA1A 5HLIA 2KZ3A 1RESA 3B73A 1AWCA 1JKQC 5CVVA 1B8IB 3IM1A 1WCMJ 2P7CB 1TV9A 2W48A 1JT0A 2YMQA 2V4RA 4QJFB 8ICAA 3RPQA 1B72A 1NHAA 4BXOA 7ICFA 2L7KA 2ACJA 3FC4A 4EVIA 2JMWA 3BQZA 3I28A 3AAFA 1M6YA 4M9XA 4QWEA 2VIXA 5IT3A 1AHDP 5KFUA 4MFCA 3S3OA 1CEZA 3PNYA 3K4BA 2R7UA 1GV5A 2Y48A 3A4CA 1CI4A 1X1BA 1U49A 3I53A 2ZXWH 4E70A 1MNMC 4NLKA 4LJZF 2N1RA 3U21A 4R8UA 3QPLA 1TQIA 2WY7Q 3V72A 3HRUA 4MQ9F 2XAGA 4FS1A 3NASA 3PX4A 2QVOA 5H6QA 4I76A 3E3VA 2R8HA 1SAUA 1BIBA 2A5WA 2BY3A 2DBYA 4RBOA 1BC8C 4BACA 1ZXIA 1S7AA 4CCKA 1AROP 5IT9Z 3OYBA 2OM6A 2RQ5A 4FCYA 3AN1A 4UB1A 3KEYA 3RB0A 1S0MA 1HDPA 3S16J 2Y0SN 3ECHA 2KIMA 3QAHA 5FKKA 2E1OA 2IPQX 4XOTA 2F77X 2UWMA 4C0ZA 4ECSA 4I2HA 5CVRA 3F8NA 2XIDA 2DTRA 2CPRA 2GQQA 1WWVA 4IC9A 3QNMA 4KJZA 2X6YA 4G7ZF 4KITB 4MHVA 4F3OA 4P9UA 1DK3A 2H27A 3BCAA 1RM6C 4TUSA 4BE0A 2JV3A 4R1HA 2AGPA 3CMAI 4UB2A 1A77A 1XO1A 3CF5F 4QWQA 2HCFA 1MBJA 2BQ3A 5K5QA 4XM3A 9ICWA 2DYRH 2QQ9A 3J7AY 3S1MJ 5L1JA 2KJ8A 5DBBA 2FEZA 2XB5A 3CJQB 1LPQA 1PUEE 3UXNA 3GTMJ 4UY8I 5EE1A 4WK8F 3CMYA 4PGGA 7ICGA 3H9JA 3K4JA 3VFZA 1FJLA 1VQ6I 5KL8B 2F5FA 1MSEC 5KFYA 1ZG5A 2ZIUA 4MEYF 4BXXJ 1IN4A 4UB6U 4DL6A 4ED1A 3MKYB 1B59A 1X1AA 3KIOA 3WHBA 3T5KA 8ICUA 3J81K 1UQVA 3MAJA 4OJPA 2VONA 1SL0A 3WTXC 2KHMA 5FP0A 1ZQGA 1USSA 1SMYF 1XNSA 4FZMA 4BBRJ 2FPKA 2P6UA 5KT7A 3KLOA 4M3BA 4O3OA 2P7VB 3T1BA 4C8MA 3OJSA 1UCRA 2JH1A 1LB2A 1FP2A 5L1IA 1ZYQA 4BY7J 1X3WB 1MBHA 3EUHC 3B02A 1SD6A 3NRWA 2CH0A 2QWWA 3BG3A 5BMZA 1QZYA 2W4SA 1BPDA 2NNNA 2MRLA 4NHJA 3HGGA 4AVZA 4MTDA 4KISA 1NOMA 4YMNA 4EX6A 1Z3XA 3QPHA 3C23A 5JHUA 3K4LA 4FE4A 2W9AA 1GV2A 4DSKA 1K83J 2M34A 5BNGA 3MZHA 1AKHB 3EW9A 3TKAA 4KYWA 2XGEA 5J2GA 1F1ZA 2ID3A 4KLOA 3KX2A 4KTQA 3HM5A 2F8LA 3RJIA 4D9JA 1ZJMA 4FZLA 3RFAA 2MSYA 1WH7A 3CDLA 5TJJA 2BCRA 4DFMA 1XMXA 2I8DA 3RH4A 2M2EA 3LFKA 2AHOB 1KYWA 2CJJA 4G8XA 4EM2A 4P4MA 4BDPA 3OSFA 1ZQWA 2OA4A 1OYWA 4ED2A 3HC7A 2GXGA 3ZP5A 1GO3F 4RQ7A 3BG5A 3F23A 1YRNB 1FX7A 4KFCA 1SL1A 4DL4A 2LDUA 3BJAA 3Q5FA 5KFMA 3SYTA 2HVIA 4EJOA 2DPDA 5HS8A 3MZYA 4EJTA 2V6CA 3U1KA 4C80A 1QPMA 2K4HA 4DWIA 4L9NA 3TW7A 4ETSA 3H35A 3I3LA 5J0UA 3JRHA 3ZDBA 3RH6A 3C3WA 2R5ZA 2MABA 3BR5A 4F4WA 4PDKA 4NLBA 4PGXA 1G3YA 2FBHA 3SEZA 1JUPA 3BJYA 2Y9YA 2C2DA 3A03A 3E0JB 1FLIA 4M6WB 3FBIB 1HLVA 1ZQIA 5F1JA 4UVAA 5J0YA 2JSPA 4KIBA 5E1XA 7ICPA 2LR8A 2R7FA 5F04A 1I6HJ 4CO8A 3ZDDA 2KVCA 2LKXA 3ZD8A 4Y13A 1BPEA 2ZIUB 3PIPF 3RB3A 2G7UA 4HOBA 5DG7A 1WVRA 1J09A 2W3SA 1R23A 2A69F 2M5WA 4IX7A 1POGA 3CCLI 2PMZF 9ICAA 3ZMDA 1VQPI 2RVCA 5KT4A 5ALWA 1W4MA 1UG0A 3B9JA 2NRXA 1XDSA 3K4KA 5BPCA 4MF8A 2EPFA 2MYSA 1X9XA 3I71A 1HXDA 2EILH 2DOFA 4ZDPA 4AIHA 2YY6A 5M5YJ 5AKIA 4YFKA 3L9FA 3HRMA 5HMLA 5FKNA 3HKZF 1YYVA 2CFOA 2PMUA 3CUQB 2EAMA 3T5HA 2M1BA 4XKCA 6PAXA 2BDUA 5KFFA 1VNDA 2ZIXA 3ERED 1ZQVA 3MGIA 3ULQB 2L0KA 2X9DA 2E36A 1F9NA 3ZQCA 2DA1A 4HV6A 4IHSA 2BE5F 2LYAA 3BPXA 2K4IA 2IA0A 5ED4A 4CGZA 4IEJA 1WWXA 5D6FA 3BDPA 2JVHA 2OH2A 2GBYA 4EJVA 3HL2A 1ZRDA 4N4OB 4BGDA 4NBQA 3MDAA 3IRRA 3FDSA 2CGPA 5HMMA 3C29A 3AFHA 1RYUA 3TANA 4ZDLA 1MMSA 5KFAA 1RZTA 2EZLA 4PSXA 1LFUP 4HLYA 2PXIA 2OEHA 1J9IA 4TUQA 4RA2A 5HVQC 1ZQZA 2BGCA 3CCVI 5JLWA 1JHFA 4BEHA 4LITA 4XRHA 2EV6A 1HKSA 4E7ZA 2XAHA 3FF5A 3CC7I 1FMVA 4LB5A 2G7HA 4MGRA 4LMYA 3OYJA 3KBBA 3RKXA 3KKAA 2DA2A 3G6EI 5KT6A 4JX5A 2Z5UA 1KSPA 4IRKA 1JUDA 3KHRA 4EBCA 2QKQA 2YMPA 1PVRA 2MA3A 1G6NA 1ZAOA 2KRCA 4RLQA 5L3GA 1W0TA 3FM3A 2V1DA 2EV0A 2F1JA 2RDJA 3FXJA 1IN8A 3L4PA 3SR6A 4O5CA 3RJEA 4GRIA 1BW5A 2HBMA 2V6EA 3M7GA 4M9ZA 1Z3EB 5M3FJ 2R93J 1BR2A 1Z3YA 1I39A 2W57A 1KKXA 1KYZA 2Q8KA 1Y39A 4BNCA 1JE8A 5HNHA 5FLMJ 1KU9A 2HDWA 4TURA 2I9GA 3QU6A 4B1RA 1J2NA 2RAEA 1FY7A 4A0XA 2ZTEA 1TNSA 4HX7A 4CYCA 1Z7UA 1L7NA 1ZRNA 2R7SA 2ETHA 2XPVA 1R1VA 2LI6A 2LVSA 5HS9A 3Q9VA 5IYBJ 1Y1WJ 3SYZA 1N77A 4X5VA 1O3SA 4QZBA 2KZZA 3K1NA 5GADJ 2HDOA 4I2DA 4RQ2A 5ILVA 1I3QJ 2XPWA 2G07A 4C8NA 1ENHA 1AA7A 2LBFA 4XLFA 2I5HA 4I2FA 1IC8A 1Q1VA 2VXZA 1KTQA 3E5XA 1X9MA 1RI7A 2K86A 3RPUD 4UXNA 2DTZA 1DPUA 4U0VA 1D9FA 5C44J 2YU9J 2A68F 3KHHA 4DGWB 2IGOA 4JP0A 1BNOA 3PSTA 4G6DA 5J0XA 4J9OA 2HHVA 3QE9Y 1KZHA 3I76A 2D6FC 3LQRA 3ETRA 3ASNH 4ANJA 1JXSA 2AQ0A 1F5TA 3JREA 5AM2A 3IC7A 5KG1A 4U7DA 4RQ1A 1NJWA 1ZELA 5FJ8J 3VC8A 1LDJA 4NDLA 4PZNA 1RDFA 1T7PA 4O5KA 2L54A 2DJNA 1SANA 2STWA 1SXEA 3DV9A 1ZG3A 3K6GA 1FBQA 4KNYA 3S2DJ 2JN6A 5CWRA 3RJHA 4CZCA 4QWDA 2WTEA 1IW7F 5F1RA 2LF7A 3ORYA 3IWFA 1BC7C 3GIKA 1UHMA 2BVLA 3BWGA 1YZ6A 3H8SA 3J81Z 2YQEA 1A35A 3OIQA 5AIQA 3IH3A 2E1EA 4HPQA 3OYMA 2JZYA 2WAQA 1JALA 2EANA 2JEFA 3U9GA 4YFXF 1OCCH 1JJ8C 5KFXA 5DGBA 3KFWX 5HR6A 5IP6A 2CQXA 2WADA 4RM2A 3HPHA 1LV5A 3W3CA 3GYHX 1QNTA 1BVSA 3DF8A 4BUPA 1EXNA 1ON1A 2JA8J 1LVKA 2WV0A 2KOBA 4CYCB 1FYLA 1BPYA 4EZ9A 3CJNA 1BOAA 3KP7A 4WJ3B 4IRGA 3LVWA 3EUAA 5FD6A 2ODGA 4CCNA 4JQFA 2P66A 7ICOA 1MJ9A 4PL1A 1JUSA 1D8BA 2EQYA 4ECWA 3OYCA 3GZNB 1T33A 3TKYA 1ETVA 1D0ZA 2RN7A 2P6SA 3NQOA 4KMUX 4DQQA 2IAIA 3WU2C 2X85A 4ENKA 1FOKA 1VLBA 4DS4A 3PO5A 3CNHA 2BCVA 2ZFWA 5B1AH 2BHNA 3BY6A 3CMEI 5IYDJ 2VASA 2ZUDA 3RIRA 3OYGA 4CDGA 3V6KA 4Y17A 2W3RA 5AKJA 4CF5A 5T14A 1H89C 3BROA 1HKTA 8ICGA 4BQAA 3BDDA 4YQWA 2V4QA 2PFPA 2PFQA 5E20A 3PFIA 1D3YA 4BEHB 7ICLA 1WPKA 4FBUA 1ZGAA 1U4BA 4GLXA 2ZIWA 1T98A 3GF2A 3V7KA 3ESWB 3I58A 1MJAA 3P9KA 3TW6A 3QPTA 1F44A 1R5HA 5HNKA 1AU7A 4AIJA 3RBDA 1P7JA 2TDXA 3Q8QB 3HKZN 3IHUA 5DCMA 4RDUA 2HVHA 2DYSH 4Y2JA 1JJ6C 3RZDJ 4B9LA 2UUZA 4UB3A 1K79A 2J5OA 3QYEA 5KCMA 4AD9A 1Z77A 2F48A 3R4KA 5DKWA 4IKFA 4II2A 2LC2A 4GFJA 2ZXIA 2VJ4A 4HQEA 1ZQSA 3IAM2 2ZCWA 4Q47A 2HVRA 4B9NA 1Q3VA 2VBWA 4D7MA 4I99C 2VBYA 4LJXA 2M8GX 4HF0A 2LM1A 3DCFA 1ODDA 3E0FA 2E71A 4UAVA 2RNGA 4PJLA 2KPMA 5DS9A 2W82A 4M6VA 2NRWA 2D1VA 4W97A 1L3VA 4B9MA 5M5WJ 3GZ5A 1KU7A 4OMZA 2BY0A 3EUB2 5EWEA 1ZRCA 5CEHA 4Q8FA 2XASA 2WF6A 1XSPA 2JSCA 2KIFA 5EE0A 1QA6A 1T3NA 3CP2A 2DT6A 4IOAF 4NV0A 1QTMA 5EOZA 1T0FA 3M9NB 1Y56A 4B3XA 2E7XA 3OR2C 5LLQA 3PMLA 3WTZA 2P5VA 2WAEA 3JR9A 3M1EA 3R0JA 1S3JA 2EV5A 3MFKA 1U8BA 2OZ6A 5KTQA 2W85A 5ALTA 1VQ7I 5IOYA 1X2IA 3DTIA 2A3VA 2KP7A 4DCCA 4ZDOA 2B9SA 1E3OC 1VQ9I
chains in the Genus database with same CATH topology
3AQEA 1NG6A 2LRDA 2Z7JA 2ZIWB 2F2AB 4XLEA 3VYUB 2KV2A 2W04A 2MD0A 3D5LA 3PSFA 5FRNA 3OWTA 4XNFA 2VPLA 3FBNB 4B43A 3CZ6A 3K4MA 3SAGA 2LHTA 3AL0B 2E5SA 3VCBA 4AYBA 1TT0A 2CUZA 1LKXA 3OYEA 5KHDA 2V1NA 2VQGA 3LYSA 2YX8A 1MMDA 1N75A 4PFPA 4P0QA 2RREA 3OL3A 2KIWA 2AQFA 2G0AA 3VDXA 1IIPA 2F6CA 2LYCA 2NOJB 3LL7A 2W7NA 3V42A 3RTRA 1E0EA 4II3A 4XMYA 4E7JA 2JHDA 3QYFA 3HUGB 4JOMA 2HBKA 2HPMA 1G8XA 3ZR8X 2L2OA 2JUGA 2LG4A 4XN3A 4NLCA 2ZIXB 4NWIA 1W36C 2HOIA 2Y0SC 3SAFA 2HOFA 3D2QA 4KT6A 4IZZA 1Z21A 4QPOA 1WJEA 1S9HA 2CW7A 2M4GA 3DTEA 4Y33A 2IS6A 3UNGC 1D0YA 3F5AA 4O3MA 3PJRA 2BW3A 4OAYA 4LG3A 1D0XA 4OAZA 4FE3A 1WJBA 1HIWA 2V9KA 2G08A 3RF9A 2K3PA 4DIQA 5CRXA 2CUJA 4F93B 2HOQA 1Q3UA 3HKZA 3HXLA 4CSWA 4XQFA 3QODA 4F52A 4F92B 3H0LB 1X1DA 2GOMA 2KQRA 3DLAA 2H3IA 4KX3A 2X51A 3DKYA 3GBGA 3H5NA 2CV0A 2KHQA 3N7RC 1PVQA 3OYLA 3LMMA 2HMXA 4BL0B 4FETA 4HRIA 2E5NA 2XC7A 3VYRB 1X19A 1PYVA 4XLCA 3OYDA 4XN0A 4B48A 4CRXA 2GH1A 2XI9A 4KMOB 1P7DA 1L6NA 3PZPA 1A0PA 2JGAA 4OJLA 3FDYA 3DWLE 3OYFA 1P9QC 2F4IA 3LSHA 4XKBA 2LY2A 1MW7A 5HLTA 2HVSA 4B47A 5FRMA 1BR1A 2LREA 1LFPA 2M4KA 2HU9A 2YB4A 3NUQA 3M1CA 4BJ5C 2LBOA 3IUOA 3TL4X 3LSKA 3A1YA 1Z1BA 4P0PB 4YEJA 1UELB 4CCLA 2CMPA 2WA0A 2DJIA 3CESA 4MLOA 2R7TA 1WJCA 3D2NA 3MKZA 1YX3A 1T94A 4BS9A 2WBMA 5CQEA 3ONQA 3PFYA 4B44A 1DQUA 4ZYAA 4QJFB 2G5IB 2CRXA 2L7KA 1K6YA 1BOBA 3M8JA 3IP4B 2VIXA 4ZTFA 3F53A 3RCOA 3S3OA 3PNYA 3K4BA 3ZCOA 2UV1A 4E7LA 3A4CA 4QPQA 1X1BA 2R7UA 3RSNA 2IGNA 2R7VA 2N1RA 3U21A 5JHFA 3OYAA 2HBLA 2WY7Q 2OYYA 4RLFA 2WB1C 1SAUA 2KZVA 2A5WA 4F55A 2VLAA 2OM6A 3ZRGA 4DOZA 4BACA 4CCKA 3SMVA 3CMMA 3OYBA 3D2SA 3D5RC 4XLAA 3GZFA 3KEYA 4XR6A 2R4GA 3ALRA 3H9GA 3K4NA 4BU2A 4XOTA 2F77X 2UWMA 4C0ZA 4C9YA 1SZHA 3KZXA 2XIDA 1KBUA 4D1QA 2CPRA 2E1FA 4IC9A 4KJZA 2X6YA 3L2VA 4KITB 3K4CA 2MC4A 3BCAA 4CH7A 4BE0A 3OOUA 3OS0A 1DGRM 1HA8A 2P0WA 1OR7C 2K9LA 2W1OA 4LIVA 3QYBA 1WJ5A 4XM3A 2K4EA 2X1EA 3J7AY 2K8AA 2KJ8A 2Z16A 3CJQB 4ZJZA 1IRXA 4P1WA 2GOLA 2R7XA 3DQVC 3K10A 2ZIVA 4U6PA 2KKVA 2VKDA 3H9JA 3K4JA 4AYBC 3AL0C 5KL8B 2RRDA 1N78A 2ZIUA 1ZQ1C 4DJAA 4CA0A 4PSWA 2V7FA 1EA3A 4X0GA 1X1AA 3MKYB 4E6KG 2X6XA 4OJPA 1XO0A 1MMAA 4DBRA 3W2WA 2G06A 4PL2A 2KHMA 5CQGA 4RMNA 4FZMA 1XNSA 3FKJA 2ZSHB 4C30A 2VJIA 3TBIA 1SFKA 3O0FA 3KYLA 3L2WA 2JH1A 2E5ZA 3N7SC 3MGVA 4JMUA 4U87A 1QHHD 2WAQF 3EUHC 3NRWA 2DQNB 2CH0A 3C2HA 3SEQA 4FASD 4HSRA 4HSTA 1WUDA 2W4SA 4OJ6A 2MRLA 2IS1A 2DOAA 3OL4A 4AVZA 4KISA 4NUBA 3N7PD 4G6TB 1Z3XA 3K4LA 4PJMA 2OC6A 3LFUA 2IGMA 4PJNA 2H3VA 4BUGA 2G09A 3G2BA 3GU3A 3CJRB 1NG7A 3KX2A 1V5GA 1G59A 2F8LA 4D9JA 1MNEA 1PVPA 4FZLA 4E7HA 3ZGKA 3RFAA 2ZFUA 3M6KA 3DU5A 3PSIA 4HEA2 4XOPA 2I8DA 3SZGA 1TZLA 4BQQA 4CUGA 4U7CA 2R7QA 3NWSA 3M6ZA 3BG6A 4LIUA 3HC7A 3PSPA 1GO3F 3DPUA 3DKXA 5HNFA 1W36D 4A8EA 3PL8A 2ELJA 3OPXA 2VJ5A 3SYTA 4BE2A 2H3QA 2L9SA 2R18A 2CS3A 4BDZA 3LSGA 2K4HA 2M7BA 3HPGA 3H35A 3I3LA 3IG5A 2XF6A 2M0NA 2E60A 2MABA 4P0PA 3ZXSA 2XF7A 4NLBA 1DP3A 3K1ZA 3DU6A 3S32A 3SEZA 2OUMA 2LH9A 2XF5A 1ERDA 3E0JB 3FBIB 4FZNA 3H9QA 2KD1A 3NWTA 2JSPA 2L9NA 1CRXA 3BG7A 2Y0SF 2VB6A 2VQHA 2KVCA 4OJ5A 4NC7A 4U7BA 4BDYA 2ZIUB 4AU7A 1YT3A 4XKVA 1WJFA 2KDOA 4H4KC 2DXIA 4XONA 1J09A 1MNDA 4IX7A 1Z19A 4CCOA 3OMYA 2PMZF 1UG0A 2JVGA 2BW3B 3HOTA 3K4KA 2GOXB 1WFXA 2MYSA 4YRVA 5KNLA 2LKYA 4ZDPA 2LYBA 2HVQA 2W7PA 3OYNA 3PNVA 4ZTJA 2ZG6A 3HKZF 1HEKA 2CFOA 5C0YA 4RM3A 2DGZA 2KRHA 1UAAA 2K8BB 2BDUA 2KLOA 4XKCA 4ACOA 2E1MB 2R7WA 2ZIXA 4J01A 3S8PA 2ZSIB 1R6RA 4ZC3A 4C2TA 2LYAA 2K4IA 2KNJA 3DPTA 4OO1J 4XL9A 4CGZA 2V26A 3EUKL 4EATA 2JVHA 2OH2A 4XORA 2JA2A 2Q2EB 3S93A 3HL2A 5HR7A 4N4OB 4BGDA 2KICA 1DRGA 2K9MA 3C29A 3T79A 3AFHA 4ZDLA 4P0QB 2HNHA 2CV2A 1V5FA 4PSXA 2KHVA 1OLTA 2VKHA 3ICXA 4BQOA 3OR1C 5HVQC 4BEHA 4LITA 3BLYA 1X4PA 4E7ZA 4BX9C 1FMWA 1FMVA 4AYBF 3SDBA 3OYJA 3AQFA 2CV1A 3F2DA 1JI8A 4HNUA 1PVRA 2XVTA 4RLQA 2KRCA 2PMZA 1U0JA 1NZBA 3HKZC 1BR4A 2LY1A 2OV7A 3D5SC 2L5QA 3VYTB 4BJTA 3OYIA 4GRIA 3LVVA 4HNTA 3OYHA 2V6EA 2HBMA 2Z1DA 2H3FA 5HOOA 2XICA 2KKPA 2Y0SA 1BR2A 1Z3YA 3C2GA 3MMYB 5HNHA 2A6TA 2HDWA 3L2RA 4PK4A 2JH7A 1T95A 1KONA 5CPRB 1QU3A 2LOOA 4PUSA 3K70C 3QOEA 2R7SA 4XKWA 1N77A 2ZIVB 4IQ4A 3KFUF 3A2KA 2IS2A 2VQCA 3RQ4A 1UPHA 3L3FX 2G07A 2LBFA 1AA7A 4XLFA 1X1CA 2VXZA 2F76X 3RPUD 4C2UA 3F5EA 4QNLA 4QIWF 4E7IA 3H0DA 4DGWB 2IGOA 2XDVA 1ECWA 4XLHA 3PSTA 2W7OA 1OUQA 3F9KA 4CCJA 1X4OA 4OWRB 3DPLC 4BJQA 2D6FC 4ANJA 4BE1A 1MMGA 2WB1A 2Q1ZB 4NQWB 3UR3C 1WJDA 5LD2C 2FUG2 4N4NB 4J00A 2VKQA 1ZELA 3W2VA 3VC8A 3DTKA 3CYMA 3CP8A 3L2QA 4Y4RA 2YB1A 2X6WA 3BCBA 3VSKA 3K6GA 3OIPA 2XAUA 2IXSA 3PNTA 4CZCA 2VXDA 3SAHA 3VSLA 3H0RB 1LDKB 4ITVA 2Z2SB 2BVLA 1YE9A 4BXFA 3BC8A 2NV3A 1MA7A 1Z7LA 2IS4A 2M7AA 4CCMA 3VWBA 3OIQA 2E1EA 3CRXA 4HPQA 2BVMA 3OYMA 2WAQA 2KEYA 3MD2A 3SQIA 5HR6A 2AQEA 2W00A 2HQAA 2KP6A 2WADA 3S3MA 4Y3OA 4RM2A 5LFAA 3HPHA 4R79A 3W3CA 4DBQA 2MA1A 2Q4TA 2O5RA 4BUPA 2KOBA 1LVKA 3E1SA 2WY8Q 2HZDA 2H3ZA 1GLNA 1D1BA 3C28A 4NNJA 3I9V2 2CW8A 3LVWA 3EUAA 4WJ3B 2DCEA 3DEEA 4CCNA 4JQFA 5CKTA 4BJ6C 4PL1A 3AKZA 3S3NA 2VQLA 1D8BA 3OYCA 2PMZC 1WJAA 1D0ZA 2KMUA 5KL1B 2X85A 3HG9A 2MFZA 2RQQA 3IN5A 2ZXHA 2VASA 2G5HB 2KL4A 2OXOA 3OYGA 4CDGA 2KJ5A 3N05A 3OS2A 5T14A 4E4HA 3IAS2 1A6SA 3M7DA 2PJRB 3F2CA 1DGWY 4PJJA 2VJJA 1YX5A 2R7RA 2R7OA 4BEHB 1URJA 2CN1A 3EPZA 3OY9A 1V5EA 2F5VA 2ZIWA 2X1DA 4QIWC 1F44A 2DT7B 4YELA 2V4JC 2RHFA 3VYSB 2E1MC 3TMOA 2UUZA 2M3AA 3H0MB 4F3QA 3FHNA 3QYEA 5KCMA 5TGTA 2DF4B 3PUBA 3OYKA 4IKFA 3MKWB 4II2A 1QHGA 2LC2A 2IGKA 2HBJA 2ZXIA 4GFJA 1MMNA 2VJ4A 3IAM2 2X1CA 3ONNA 2HVRA 1Q3VA 2WAFA 1D1AA 2M0MA 3E0FA 2QKMB 1TAMA 2K5CA 4P5OA 3H5AA 2RNGA 4PJLA 3H5RA 2KPMA 2W82A 2K8CB 2LBFB 2WB1F 3CF2A 3F2BA 2QKLB 3LSIA 2RP5A 3OS1A 4F91B 2JMGA 3CP2A 2DT6A 4NV0A 3HOSA 3LSMA 4HG2A 4E7KA 1Y56A 4B3XA 3OR2C 2WAQC 4ICAA 3L2UA 4KX5A 2K89A 2VL8A 2WAEA 1ED1A 4BQNA 2KJ9A 1VZ0A 4NC8A 3ZQQA 5FROA 2XSJC 1PJRA 4E7SA 2W03A 2BOLA 2PJRA 1Y6IA 2HPIA 1D1CA 3DTIA 3IG8A 5A0LA 4IQJA 3W2AA 1T0FC 2A3VA 4PFOA 4ZDOA 3K70D 4OJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5H B;  1NG6 A;  3H0L B;  2DF4 B;  4WJ3 B;  2F2A B;  3H0R B;  3IP4 B;  3AL0 B;  3KFU F;  3H0M B;  2DQN B;  1ZQ1 C;  2G5I B;  2D6F C; 
#chains in the Genus database with same CATH topology
 1N62 A;  1FT9 A;  2EWN A;  4CXF A;  3VYU B;  1RUO A;  2F2A B;  3D0S A;  1D9D A;  4YCX A;  4ABZ A;  4UAW A;  5CA7 A;  3T5X A;  3EPG A;  5FRN A;  3SQN A;  4Y2Q A;  3G6Y A;  1V4R A;  1ZQH A;  2E2J J;  5AK5 A;  4ENJ A;  1BJA A;  1UB9 A;  4FIS A;  3TO6 A;  4C4R A;  7ICN A;  3JPR A;  3RBE A;  3TFR A;  2CUZ A;  1K61 A;  3J7Y J;  5AK4 A;  3FMR A;  2YX8 A;  1N75 A;  1U8R A;  4PFP A;  9ICP A;  2KIW A;  1XSN A;  7ICH A;  2HQ5 A;  3WK4 A;  4RNN A;  1ETK A;  2IJL A;  3VDX A;  2W7N A;  1PP8 F;  2NOJ B;  4Z6E A;  2JRT A;  3RTR A;  3ZMS A;  1L3T A;  4XMY A;  3F72 A;  3HUG B;  4IL6 U;  3GXO A;  5DDM A;  3EDP A;  2O3F A;  4JOM A;  2ZJ2 A;  1FYK A;  2HPM A;  3TQN A;  2DMT A;  1G8X A;  2DLL A;  1P4X A;  4CHU A;  3LQQ A;  4GXO A;  4YMM A;  4B9U A;  5CJ9 A;  1A31 A;  3WTS C;  4NLC A;  5DM7 F;  2BQU A;  2IOF K;  4YFN F;  5HLH A;  2LHT A;  4FQG A;  3SAF A;  8ICV A;  3G1O A;  4KT6 A;  1U2W A;  3CCS I;  4QPO A;  1MBG A;  3DTE A;  4XSX F;  1Q8K A;  1D0Y A;  4O3M A;  3JSO A;  1LFB A;  5DG9 A;  5AKY A;  2QSF X;  4LG3 A;  1D0X A;  2FOK A;  2UXN A;  2PEX A;  2MH2 A;  1KGS A;  1DPR A;  4IQT A;  4NQW A;  1RYS A;  2JUC A;  2YR2 A;  2R8I A;  1MZB A;  4DIQ A;  1JIH A;  2PMZ N;  3WGI A;  4J19 A;  4J9K A;  4ZH4 F;  1Q3U A;  1KQ8 A;  2Z33 A;  3V6J A;  1ETY A;  3QOD A;  1QO0 D;  1S29 A;  2NOG A;  4F52 A;  3KZY A;  5JFR A;  1ETO A;  3OV8 A;  4NXZ A;  2I1Q A;  2OU2 A;  2XO7 A;  3JPQ A;  1IJW C;  2CWE A;  2L5Y A;  4QZA A;  2HHS A;  4L5J A;  4HYE A;  3KP2 A;  3Q8L A;  2K40 A;  3IH2 A;  2A3S A;  3ZN0 A;  2F3N A;  4DYR A;  1COO A;  2HMX A;  3NVV A;  3KKA C;  3FK7 A;  5IY5 H;  3SD7 A;  3JPT A;  2E5N A;  4UUV A;  2QM3 A;  1Y1V J;  3DEW A;  5EGO A;  1SL2 A;  3BG9 A;  4PGH A;  4RAY A;  4XN0 A;  1OXJ A;  1V3F A;  1A0P A;  2JGA A;  5FB2 A;  5D46 A;  4OJL A;  2ZJA A;  3UMC A;  3DWL E;  5J1Y A;  4A3C J;  9ICJ A;  4AIK A;  3RRG A;  3JAM Z;  4B47 A;  4EEL A;  3E6D A;  3E58 A;  2W9C A;  2FQ3 A;  2KIU A;  2M4K A;  5EE9 A;  2ASL A;  4DSF A;  2C28 A;  4BJ5 C;  1Z1B A;  4YEJ A;  3WTU C;  1NK9 A;  3H4B A;  4M74 A;  3G4S I;  3ABT A;  3TAC B;  2JEI A;  1FOY A;  3CES A;  2R7T A;  4MFD A;  3K7A J;  4M3E A;  2GA2 A;  5KAF U;  4ECR A;  4O6J A;  3PNC A;  5D49 A;  4BS9 A;  1HC8 A;  3IHQ B;  4R63 A;  4A0Y A;  2AU0 A;  2A5Y B;  3ONQ A;  4U7C A;  2CYY A;  2NVQ J;  2R8G A;  3M9O B;  1W5C C;  1DQU A;  3BR2 A;  5KFR A;  4ZYA A;  9ICL A;  2G5I B;  4Y2V A;  1T56 A;  1K6Y A;  5DM6 F;  3ZMV A;  3GTK J;  2Y9Z A;  3CCM I;  2HDC A;  3J7A O;  3JRC A;  3HGY A;  1XS9 A;  4ZTF A;  3DP7 A;  1Y8Q B;  3RCO A;  4PJ0 C;  2XRN A;  4NM2 A;  3CDI A;  4PH5 A;  4E7L A;  5CR0 A;  2QQ8 A;  3SZ2 A;  1LVH A;  3BQT A;  3RSN A;  4IRI A;  3QU3 A;  4DOB A;  1F36 A;  5DB7 A;  2XUB A;  4EV0 A;  1Z00 A;  4PGQ A;  2LKP A;  1E17 A;  3WTT C;  2HDD A;  4DZJ A;  1ZQC A;  4F55 A;  3TAP A;  4DOZ A;  3IDW A;  3SMV A;  8ICH A;  3GX4 X;  3WTY C;  2OZU A;  4RGS A;  3QRF F;  3GZF A;  3A01 B;  3LA7 A;  3LSP A;  5E3L A;  4C3J J;  2UVR A;  5D5W B;  1SZH A;  4LB6 B;  2DA4 A;  4UUS A;  4D1Q A;  3KZX A;  5D4B A;  4A3J J;  4B8X A;  2MC4 A;  2P4W A;  1ZRM A;  2ESE A;  4CH7 A;  4NLN A;  3OOU A;  3OS0 A;  3AEV A;  1WCL A;  4RS8 A;  1OR7 C;  4LIV A;  5FLV A;  1XCB A;  1GXQ A;  1XG1 A;  3QYB A;  4ED7 A;  2JEG A;  4LZG A;  2XGQ A;  4KLE A;  3E6B A;  4FX4 A;  4ECT A;  2UVV A;  1YS6 A;  3O6B B;  4M6X A;  3I1Y A;  2AXL A;  4QZI A;  3PMN A;  1ZOL A;  4DQR A;  2JRM A;  3CO6 C;  3LWL A;  3IV6 A;  1S8O A;  3WKD A;  4YG2 A;  2PI5 A;  4RGU A;  3K10 A;  2OCC H;  2JZB B;  1ZQR A;  2PJP A;  1JRP A;  3HWT A;  1M1E B;  1OJL A;  2Q0O A;  2YU3 A;  3CLQ A;  3AL0 C;  2JZB A;  2BEO A;  2RRD A;  3A0B U;  1DGJ A;  4QWA A;  4R64 A;  1ZQ1 C;  4DJA A;  1LUJ B;  4XBF A;  2PQ8 A;  3V6H A;  1T3Q A;  5H20 A;  4X0G A;  1UA1 A;  2VA8 A;  2DAO A;  4HAM A;  4E6K G;  4R8H A;  1KDH A;  1VFC A;  1MMA A;  4DBR A;  4UUT A;  4PL2 A;  3DBH B;  3GFL A;  1EF4 A;  1W5S A;  2H6B A;  4O5V A;  1MBE A;  4Y2P A;  3VOE A;  2DPU A;  3I4M J;  3FKJ A;  4C30 A;  4I2C A;  2VJI A;  3F22 A;  2HHU A;  1U5T C;  2BR0 A;  1EH8 A;  1YJN I;  2D8C A;  3N7S C;  4FFD A;  3IRQ A;  1ZQ3 P;  4HAI A;  3MGV A;  5J2I A;  4J9R A;  2L3D A;  4LGW A;  1QHH D;  3RJP A;  2WAQ F;  3HSR A;  5B5E C;  3OTQ A;  3CUQ C;  4M0A A;  5E17 F;  2CRG A;  4G9Y A;  4PGY A;  3M1Y A;  4J9L A;  3SEQ A;  4FAS D;  2FA5 A;  1IUY A;  3WE3 A;  3HRT A;  4FX0 A;  3F8M A;  2D1H A;  4OJ6 A;  2DOA A;  5KNI A;  5E3O A;  1JMS A;  3N97 A;  1H38 A;  4ED8 A;  4BUG A;  2G09 A;  4KLQ A;  5G5H A;  1DDN A;  1L7M A;  1G59 A;  5AI0 A;  5J4V A;  1MNE A;  3ERM A;  4LLL A;  3TOA A;  3K4G A;  4E7H A;  4MQV A;  5E3M A;  5ALX A;  1JN3 A;  1T08 B;  3BR6 A;  3DU5 A;  4BQQ A;  4XRM A;  1LQ1 A;  1TZL A;  2AXT U;  2QLT A;  3PUF A;  1OW5 A;  2E8N A;  2W9M A;  4M73 A;  2R7Q A;  3M6Z A;  2PFB A;  1K6O A;  2YMM A;  3PSP A;  2GLO A;  1YIJ I;  3DPU A;  3VEP A;  1N60 A;  3NAU A;  2VJ5 A;  1L3S A;  3CUQ A;  4MFF A;  1PK1 A;  3ABL H;  4BE2 A;  5LBQ A;  2BCQ A;  2L9S A;  4OMY A;  2Y2Z A;  2R18 A;  1R22 A;  2RLT A;  5TIS U;  4PPX A;  2FMQ A;  3EPI A;  1NKB A;  3DDH A;  5AM5 A;  1Y0N A;  3Q8P B;  1IG7 A;  8ICM A;  1ZQE A;  1ULY A;  4UAY A;  2E8P A;  3PVX A;  3ZXS A;  4PHP A;  3HIF A;  2KFN A;  2D3D A;  1DP3 A;  3DU6 A;  3S32 A;  3IV5 A;  1I50 J;  2KRF A;  3BR0 A;  3KCC A;  3RPU A;  5AI8 A;  1T38 A;  2FJ6 A;  3GV5 B;  1BPX A;  5J8C A;  4F5R A;  5DLG A;  2BY1 A;  3BOQ A;  3LA2 A;  3GDX A;  4DFP A;  2KD1 A;  3H36 A;  3A0H C;  4OIR F;  3Q9S A;  4O3Q A;  4UAZ A;  3LAP A;  1CRX A;  3OJU A;  1S77 D;  4F50 A;  4EZ6 A;  4KT5 C;  2RNJ A;  4U7B A;  4BDY A;  2VOD A;  4V2G A;  4OJ5 A;  1CQT A;  5H2F C;  1WJF A;  1KQ9 A;  2KDO A;  2NYX A;  4H4K C;  1MSF C;  1SAX A;  4L18 B;  3Q0V A;  5J3L A;  1MND A;  4I2A A;  3ZQF A;  5AKH A;  3QU5 A;  4CCO A;  1X2N A;  2ISP A;  2O8X A;  4UV9 A;  3J7Z I;  1V85 A;  5EEG A;  2EDU A;  1K78 B;  4MEX A;  1QSS A;  5CHG A;  3PW0 A;  2XY5 A;  1RYR A;  3IL2 A;  1WFX A;  1S5L U;  4YRV A;  2LYB A;  5L1L A;  2DMU A;  2JA5 J;  3OYN A;  2R0Q C;  4J9Q A;  5B1B H;  1OCP A;  2GWR A;  2XKP A;  1X3Z B;  2K8B B;  2FMY A;  3GFI A;  9ANT A;  2EA2 A;  1XGN A;  3ZPL A;  2R7W A;  4ACO A;  3MR2 A;  2HHQ A;  1SVL A;  4WF2 A;  1B4A A;  3IKV A;  1KRP A;  1R6R A;  4C2T A;  1BNP A;  3DPT A;  3EWA A;  2K9Q A;  5HHI A;  4QWC A;  5KFL A;  3EUK L;  1I1G A;  1TP4 A;  3O3K A;  2B0C A;  2VE8 A;  3S17 J;  2DW4 A;  2R3S A;  5K7F A;  5CP2 A;  2Q2E B;  3S93 A;  3TAD C;  4Q43 A;  4O3S A;  1SD5 A;  3RR8 A;  3G6V A;  4GGG A;  2K9M A;  5ALP A;  3T79 A;  1FOW A;  7ICE A;  2M9H A;  3HTS B;  5LRR A;  3T8R A;  3Q0W A;  1V5F A;  5KFT A;  3GLX A;  5CVU A;  2KHV A;  2O0Y A;  3ICX A;  4PHA A;  2FF4 A;  3FM9 A;  2EFN A;  1WCN A;  1MDM B;  3ZMZ A;  4EEF G;  3BLY A;  4BX9 C;  1FTT A;  1Y88 A;  1FMW A;  3H3Z A;  1S0O A;  2NVY J;  1JGS A;  3SDB A;  1FOX A;  4FE7 A;  1U45 A;  5E8I A;  2M30 A;  3HUG A;  1QVU A;  3I54 A;  2QLZ A;  3F21 A;  2BXZ A;  1HBX G;  4C7Z A;  4EYI B;  4UB8 U;  3AG3 H;  1MSW D;  8ICR A;  1YS7 A;  4I98 B;  1NZB A;  3HKZ C;  5KFK A;  3DXJ F;  1BR4 A;  1BN5 A;  2LY1 A;  2L5Q A;  2MGQ A;  4BJT A;  3OYI A;  1SV0 C;  4RNM A;  3LK9 A;  1ZLJ A;  4HNT A;  2DU9 A;  2HKX A;  1XN7 A;  3MWM A;  5DD8 A;  2JPB A;  2LFB A;  2EZX A;  3TP3 A;  1JRO A;  4RAZ A;  1W7P B;  3FAH A;  3OSN A;  1QQ5 A;  3LWM A;  3PO4 A;  2PKE A;  9ICE A;  3K0L A;  4Y2S A;  2ZME A;  5GTI C;  1C0W A;  5KG6 A;  1JHH A;  4F8R A;  1OYY A;  1CF7 B;  1TVA A;  1HOM A;  3WHC A;  3S14 J;  2HEO A;  2IOF A;  4J03 A;  2Y1I A;  1ZQQ A;  4DL2 A;  4I29 A;  4PUS A;  1S0V A;  1OCR H;  3QOE A;  2R5Y B;  1MJB A;  3FIW A;  4I0A A;  3MCZ A;  4XKW A;  1XB4 A;  1H9G A;  5CVJ A;  3U2R A;  5J47 A;  5A2Q K;  1EJ9 A;  1YHQ I;  1ZJN A;  2IS2 A;  3KFU F;  3RQ4 A;  3THV A;  4CE6 A;  3L3F X;  4KIF A;  2OTL I;  1SMT A;  1X1C A;  3RKQ A;  4Q8E A;  5EF6 A;  1Z0X A;  5GAE J;  2F5E A;  4QTR A;  4KLD A;  2Z9O A;  1ZQN A;  5E18 F;  4E7I A;  5HOD A;  5AM0 A;  2X6O A;  3FX3 A;  3H0D A;  2W9B A;  2RGV A;  1A36 A;  2WF7 A;  3WK7 A;  5J29 A;  2ZKZ A;  2XDV A;  2W7O A;  1HUO A;  3QQA A;  4XLH A;  4LG0 B;  5FLX K;  4CCJ A;  1VQL I;  5KFE A;  4F5O A;  3DPL C;  4BHC A;  1QCK A;  5KFV A;  1XGO A;  4BE1 A;  4ZOH C;  1MMG A;  2A61 A;  3RRH A;  2ZNZ A;  3BZK A;  2Q1Z B;  2DQR A;  3UR3 C;  1O57 A;  4XLP F;  1WJD A;  2W54 A;  3MR6 A;  4J00 A;  4A93 J;  2HHX A;  2QB0 A;  3BTJ A;  3CP8 A;  2YB1 A;  1OPC A;  5ALY A;  5ICF A;  3JRD A;  3KYD B;  1XX5 A;  3OIP A;  2QQA A;  1K78 A;  2JPC A;  3M07 A;  1D5V A;  5AM4 A;  1L3U A;  2IXS A;  3PNT A;  1UZC A;  2F4O B;  1N56 A;  4XID A;  1YE9 A;  4RQ3 A;  1MA7 A;  2COM A;  1Z7L A;  4OOI A;  1XTA A;  2E35 A;  2L9R A;  3VWB A;  2UZK A;  3WK9 A;  1NH3 A;  4IF4 A;  1R58 A;  1B43 A;  1V9P A;  2BVM A;  4I0B A;  1O7L A;  1S7O A;  1K1S A;  2KEY A;  3V7J A;  1I5Z A;  3SQI A;  3OSP A;  2HXI A;  2HXO A;  2W00 A;  2X48 A;  1VDV A;  5KFD A;  4D7N A;  3K1P A;  4Y3O A;  2PX9 A;  4MEY A;  5ERI A;  5KT5 A;  4J9M A;  2NS8 A;  4R79 A;  5J6X A;  1HCR A;  2LPE A;  1A5J A;  2MA1 A;  2Q4T A;  3SFZ A;  2EH9 A;  4KN4 A;  4GDF A;  2HKO A;  4LZD A;  2H3Z A;  3C28 A;  4NNJ A;  3TAQ A;  1F0M A;  4QZG A;  4IR9 A;  1ZRF A;  4OIO F;  4QZC A;  2F5D A;  3LSR A;  2TCT A;  1ONV A;  2ATL A;  1FBS A;  3E7L A;  1TWA J;  2KMU A;  4JYK A;  3FXO A;  4YII A;  1VQ4 I;  4RPY A;  2ESH A;  3RYP A;  3N28 A;  4J9S A;  2VT3 A;  2MFZ A;  2RQQ A;  5F0H A;  2D2W A;  2BZF A;  4PHE A;  3S1N J;  2G5H B;  2LYH A;  4C4S A;  1LE8 B;  2JT1 A;  4Q48 A;  5FO5 A;  2E1C A;  3N05 A;  1GXP A;  3OS2 A;  4ECY A;  1IXR C;  3E97 A;  3F2C A;  4AYB N;  3GTQ J;  1WWU A;  2VJJ A;  4TV7 A;  4C3I J;  1FPQ A;  2OCE A;  1YO5 C;  3DV8 A;  2R7O A;  1B9N A;  4I7H A;  4MHG A;  2HWV A;  1URJ A;  4TQS A;  1BA5 A;  8ICP A;  2ZJP F;  5CYV A;  2CQ7 A;  1X9W A;  2X1D A;  4KIG A;  2DT7 B;  3FXM A;  5F0F A;  3CTA A;  2EFP A;  2V4J C;  5EZH A;  2RHF A;  3N97 B;  1TWC J;  3HHG A;  1AOY A;  1H9T A;  4Z6C A;  2DDA A;  4F3Q A;  1MC8 A;  3H0M B;  2WF5 A;  3HTU A;  2LTP A;  3GIL A;  5EDN A;  2MH9 A;  3PUB A;  1RET A;  1TW3 A;  1JI7 A;  8ICY A;  1TW2 A;  2EZY A;  5DCF A;  4JUZ A;  5KFP A;  5IPA A;  3FXU A;  2X1C A;  1PZN A;  3ONN A;  4GIB A;  2WAF A;  3PIO F;  4EGY A;  4ESB A;  4ED6 A;  2EAO A;  2M0M A;  3W6K B;  8ICW A;  2BPG A;  3H5A A;  1ETQ A;  1JT6 A;  1VI0 A;  2FE3 A;  1ZQF A;  2NYV A;  2BCS A;  5E3N A;  1WGX A;  3M8F A;  3DFG A;  1TAU A;  4M72 A;  2LBF B;  1CGP A;  5KFZ A;  1MIJ A;  4BBS J;  3M9M B;  2M87 A;  3CF2 A;  3GTJ J;  4O3P A;  4XSZ F;  5AI4 A;  1G3T A;  5KFO A;  4GCV A;  3OOP A;  1OKR A;  2K27 A;  2QKL B;  3L7W A;  5FFX A;  4V2F A;  2HOT A;  4HDV A;  5ALI A;  4M6Y A;  3ISP A;  8ICC A;  2E3T A;  4E7K A;  3LSM A;  1WYG A;  4L0Z B;  2W25 A;  2WAQ C;  1RKT A;  4KX5 A;  3JRI A;  2BPF A;  2JEJ A;  3NRZ A;  2KJ9 A;  3IWZ A;  3FMS A;  1TWH J;  4TUP A;  2QF7 A;  4NC8 A;  3ZQQ A;  1R9T J;  1GT0 C;  3EUH A;  1ACI A;  1S97 A;  1IRG A;  1STZ A;  3DBR B;  4IHY A;  1L8O A;  2P5L C;  1T0F C;  3W2A A;  2B21 A;  3MC1 A;  4QZ9 A;  3RJK A;  2GAU A;  2R8K A;  3GW2 A;  3LST A;  1NG6 A;  1VQ8 I;  4G9B A;  4S0H B;  2O9L A;  3WKE A;  2QBY A;  1VJ5 A;  4XLE A;  4YXJ A;  4GYI A;  1FSH A;  4FS2 A;  1WG8 A;  5ALL A;  4KLS A;  3D5L A;  2MBF A;  1WI3 A;  2Y69 H;  5AON A;  1VF9 A;  3OWT A;  1FNN A;  4XNF A;  1J59 A;  5KFH A;  2H5X A;  2M9N A;  1DOQ A;  4BXU A;  3MQ0 A;  2Y1J A;  3E6C C;  3C2K A;  4LFU A;  4P9F A;  4R65 A;  1LKX A;  2VBZ A;  2JK3 A;  5KHD A;  2V1N A;  5AIC A;  4D5C A;  4DYC A;  1Z00 B;  3RR7 A;  5D8K B;  5IIK A;  5J2B A;  1E3H A;  2L01 A;  5ILU A;  1HQC A;  5J4Y A;  2NVX J;  2BKE A;  2F6C A;  3C1D A;  3LL7 A;  4M3D A;  5GTH C;  3GV8 B;  4II3 A;  1BGX T;  3CLO A;  3GVA A;  5C4X J;  4CF4 A;  1S6L A;  2QSG X;  4RQ6 A;  1VTN C;  2H94 A;  3F8F A;  1ETW A;  3M9A A;  1MGT A;  1Y8R B;  3L1P A;  2L2O A;  1XMA A;  2JUG A;  2LG4 A;  4XN3 A;  5TRD A;  1ZGW A;  2KG5 A;  3O8H A;  1W36 C;  2NRT A;  4NB5 A;  1PUF A;  2ZIX B;  5DD4 A;  4ED3 A;  2HOI A;  7ICQ A;  2HOF A;  2OWO A;  1U5T B;  2VC1 A;  1ETX A;  5G5G A;  2UVU A;  2HS5 A;  3UXP A;  4IZZ A;  1Z21 A;  1S9H A;  1XD7 A;  4BHB A;  4W1U A;  1TQM A;  3UNG C;  4ECU A;  4ON0 A;  2HOE A;  1IRZ A;  4I6Z A;  5JRT A;  1WJB A;  2EK5 A;  2ISZ A;  1W1W E;  2V9K A;  3BJO A;  3HYI A;  1HKQ A;  3UQ0 A;  3DEU A;  3B6A A;  2K4J A;  2E7W A;  1YIO A;  3MVP A;  2K3P A;  4I02 A;  3RF9 A;  9ICO A;  2KMD A;  1ZQT A;  3RKW A;  2QEX I;  5KFC A;  1TNT A;  3I4P A;  4HLX A;  3HXL A;  3TAD A;  4XQF A;  2L9V A;  2W9B B;  9ICV A;  1X1D A;  2DPI A;  2NO5 A;  1JX4 A;  4UVB A;  4Z6Y A;  3GII A;  1JKO C;  2Y9T A;  3FYH A;  1B1B A;  4KX3 A;  4M6W A;  5J0O A;  2DOE A;  4QIW N;  5FFZ A;  5EGO B;  1RC9 A;  2EJR A;  1BI3 A;  2ZME C;  3GBG A;  3H5N A;  1JKP C;  4Y2U A;  4F5P A;  4YVZ A;  1TT5 B;  4FT8 A;  2DN0 A;  4YD2 A;  3RJG A;  4BL0 B;  2NXN B;  2KE7 A;  2ZNY A;  3HOW J;  4ZH4 A;  5E1W A;  1S10 A;  1QZE A;  2K4B A;  3TO9 A;  3VYR B;  4A3K J;  1X19 A;  3EYI A;  1PYV A;  4UAT A;  3H8M A;  2YTU A;  5J0R A;  1NK4 A;  2J6T A;  5D5U B;  4CRX A;  4KMO B;  1WZ2 A;  1RPL A;  5BS6 A;  3KP4 A;  4G12 A;  3ROU A;  3CCQ I;  4KN7 X;  5F9L A;  3OYF A;  5JVG F;  4JV0 A;  4ECX A;  1MD0 A;  2AO9 A;  2F4I A;  3LSH A;  3WU0 A;  4BAY A;  2ZJ5 A;  4XRS A;  5FRM A;  1Z6T A;  1BR1 A;  2LRE A;  2KKO A;  2XB0 X;  2WFA A;  2J6U A;  2HU9 A;  1WH5 A;  2YB4 A;  3NUQ A;  5ALD A;  4X1E A;  1QQ6 A;  1T39 A;  3ED5 A;  3LSK A;  2HYF A;  4QZF A;  5EJC A;  2IHM A;  3HOX J;  2O03 A;  3LOC A;  5CB1 A;  1JTX A;  2WA0 A;  4IRD A;  3QEB Z;  2MUT B;  4Q4Z F;  3D2N A;  3RJJ A;  2A6H F;  3UPQ A;  3HSE A;  1BL0 A;  1BI2 A;  1MDM A;  4MF2 A;  5J1R A;  4AM3 A;  2DMN A;  1LNW A;  5ALU A;  1YRN A;  3GO5 A;  5KFI A;  1NK6 A;  3MR5 A;  3L09 A;  1BOB A;  4Q44 A;  1BJZ A;  3M8J A;  1SWV A;  3IP4 B;  4DFD A;  1TKD A;  3D2S A;  4DLG A;  1SXD A;  2MUT A;  1Z9C A;  5H2F U;  2UVW A;  4L9V A;  3V8L A;  1ZKG A;  2Q2E A;  2UXX A;  5LHH A;  5LEJ A;  3ZCO A;  2UV1 A;  4QPQ A;  2MLK A;  2I5U A;  2IGN A;  9ICB A;  4XRS G;  1B0X A;  5JHF A;  3TO7 A;  3OYA A;  2HBL A;  2YML A;  4BWM A;  1N61 A;  4Z6D A;  3S2W A;  2O61 A;  1TL8 A;  1R49 A;  1SV4 A;  2BBY A;  2VLA A;  3QU2 A;  3ZRG A;  1IAW A;  5JI6 A;  2VAN A;  3CMM A;  2DKX A;  5J2F A;  1K4T A;  1TTY A;  5KG4 A;  4F4Z A;  4YMO A;  2BQR A;  2R4G A;  5EZG A;  4ZYE A;  3H9G A;  3K4N A;  3KEQ A;  4C8K A;  2B7E A;  4KLI A;  7ICJ A;  4EJU A;  4C9Y A;  3IKT A;  3JPP A;  5HDG A;  3L2V A;  3D6J A;  3K4C A;  1PVE A;  3QU7 A;  2E1N A;  2R7D A;  5LEK A;  4UHT A;  1HA8 A;  1DGR M;  1ZQB A;  4PJ0 U;  1O4X A;  3JRF A;  3BP8 A;  2DA3 A;  4EBD A;  3QU4 A;  4B4C A;  9ICK A;  1WKM A;  4B9V A;  4R66 A;  2K4E A;  2X1E A;  4HW0 A;  3GLL A;  5FGM A;  2K8A A;  4L9J A;  1QPI A;  2Z16 A;  2FNP A;  1IXS B;  3P9I A;  5IP9 J;  4P1W A;  1FEX A;  2R7X A;  3DQV C;  2Y0M A;  2XHK A;  3QXG A;  3CCJ I;  1XU4 A;  3PO2 J;  3CCY A;  1QH9 A;  3P5J A;  1D5Y A;  4AYB C;  2ELH A;  4EGZ A;  2WV1 A;  5TZV A;  1X6I A;  5KAF C;  1C7Y A;  5KG2 A;  4GYG A;  1MBF A;  4IXA A;  5J0T A;  2CFX A;  8ICZ A;  2IVM A;  4PSW A;  2V7F A;  5KT3 A;  2XKO A;  2H1L A;  9ICC A;  5K1Y A;  5HP4 A;  2PFO A;  5DUK A;  5EWG A;  2G06 A;  5K5O A;  1EKE A;  3LAJ A;  5IIM A;  5CQG A;  3SV3 A;  2FDR A;  1PK1 B;  2VA3 A;  4RMN A;  4FO6 A;  3TBI A;  1PUF B;  1IG6 A;  1OR7 A;  3O0F A;  1SFK A;  1J75 A;  3U1D A;  4MNU A;  3KYL A;  2E5Z A;  3LWF A;  4M3F A;  2NNY A;  4U87 A;  3ZQG A;  3HOZ J;  5DBC A;  4IHX A;  4QZD A;  4JWN A;  2COB A;  2GXA A;  2DQN B;  1NJZ A;  2EIJ H;  3L00 A;  5ALM A;  4LLN A;  4HSR A;  1SKW A;  3ETL A;  1WUD A;  1B9M A;  4UBC A;  4S05 A;  3AG1 H;  2IS1 A;  4QZE A;  3CJT B;  3OL4 A;  1XMK A;  1B72 B;  2P6R A;  4G6T B;  5FKO A;  5IP7 J;  1FZP B;  2FRH A;  2IGM A;  1X1P A;  3Q8S B;  1OFC X;  5BOX A;  3T5J A;  3G2B A;  3GU3 A;  1XSX A;  2JR5 A;  1ZQJ A;  3WK6 A;  3KD3 A;  4IVN A;  1D8L A;  1WSU A;  3FWE A;  1MBK A;  3H3V K;  4Y7N J;  1RRJ A;  2IRF G;  2ZFU A;  2E8O A;  4HEA 2;  3G1M A;  3C5G A;  1UA0 A;  3SZG A;  2DPJ A;  3KTQ A;  4CUG A;  2ZJR F;  4KMF A;  4DLE A;  1G4D A;  4ZYH A;  3BG6 A;  1UT5 A;  3P7N A;  1X66 A;  4DQI A;  4LIU A;  5KT2 A;  1X42 A;  1IV8 A;  5HDN A;  4IOC F;  3MFI A;  2GZW A;  5HNF A;  1W36 D;  5DLF A;  3QOP A;  4XIC A;  5FLX Z;  3JTH A;  4A8E A;  2BCU A;  5GAG J;  1V97 A;  1NJX A;  4BXO B;  5B3S H;  5J8Y A;  1KA8 A;  1HDD C;  2VOO A;  1FTZ A;  2LMR A;  3LSJ A;  1IZ1 A;  2TRT A;  2BHY A;  2KJC A;  3QP5 A;  5L1M A;  2CS3 A;  3LSG A;  1N5W A;  3H8W A;  3GCM A;  5IYC J;  3HPG A;  5AKE A;  1GVD A;  2K60 A;  8ICT A;  5L1K A;  2XF6 A;  5LHG A;  2E60 A;  4EYH B;  3F6V A;  2XF7 A;  3OIO A;  1ZHF A;  4KDP A;  3C21 A;  3K1Z A;  2AJQ A;  5BQT A;  3H7I A;  2K4P A;  2OUM A;  3K69 A;  2LH9 A;  1KFD A;  2P81 A;  2HTS A;  2XF5 A;  1ERD A;  1J7K A;  1IV6 A;  3A02 A;  4RQ0 A;  3NWT A;  3BG7 A;  2DOD A;  2A1J A;  4HA8 A;  2JA6 J;  2VB6 A;  3JRB A;  2Y0S F;  2WB1 N;  4A0Z A;  3FXQ A;  3IRU A;  4XQ8 A;  3TFS A;  2ASJ A;  4XKV A;  2DXI A;  3HHH A;  3AG2 H;  2NRA C;  2IW5 A;  4RT2 A;  1NKE A;  4YR3 A;  1YJ9 I;  1I3A A;  4Z2Y A;  3F8B A;  3OMY A;  4DL3 A;  3BQ2 A;  4I27 A;  4USA A;  3MZ8 A;  5L3F A;  3TP0 A;  4CNQ A;  5J0S A;  2XIG A;  2X0L A;  2B63 J;  4DS5 A;  2GOX B;  3FMQ A;  1P7I A;  4PHD A;  2HVQ A;  3PNV A;  3AU6 A;  3GIM A;  2BGW A;  2ZG6 A;  3S2H J;  1SZP A;  1V38 A;  5CJ7 A;  4ELV A;  5C0Y A;  1S0N A;  1UAA A;  3KHG A;  3FKI J;  2OHF A;  2KLO A;  1FC3 A;  4GC6 A;  2ZC2 A;  2H6C A;  2LY9 A;  2EZZ A;  5KFG A;  4OIN F;  2ZSI B;  2KIS A;  4ZC3 A;  3B0X A;  5AKX A;  2F5C A;  2KNJ A;  4ECV A;  3AMZ A;  4OO1 J;  2QGU A;  4XL9 A;  3KPH A;  5III A;  2B6G A;  3KP3 A;  4XOR A;  2JA2 A;  2VOP A;  1Z4N A;  1SFX A;  3WGH A;  4UVC A;  2JXJ A;  5HR7 A;  5J8F A;  3I64 A;  2KIC A;  4Y2T A;  1DRG A;  4OD0 A;  2M8E A;  2IBD A;  5AIP A;  1MN8 A;  4KLG A;  1S9F A;  2HFH A;  3F8C A;  3KZI C;  2CV2 A;  1KN5 A;  4P0Q B;  3KP5 A;  5HHH A;  3QYP A;  1OLT A;  2VKH A;  2FI1 A;  3WG9 A;  2R8J A;  3KE2 A;  1RQN A;  3WKA A;  2YX4 A;  4YIR X;  1BPB A;  1X4P A;  2IEK A;  1SVO A;  3FXK A;  4EJW A;  4A12 A;  4GFB A;  2F8K A;  3ML6 A;  5F64 A;  5J40 A;  4G3I A;  4EQQ A;  4C8L A;  5AKZ A;  4GXI A;  1SKR A;  2CV1 A;  1YIT I;  3A0H U;  4DOA A;  3SI8 A;  3F2D A;  1JI8 A;  3L5K A;  2A07 F;  4UB6 C;  1KEJ A;  2FQ4 A;  1U0J A;  1PK3 A;  1LJ9 A;  3VYT B;  1BBY A;  2DFL A;  2RDI A;  3ASO H;  4YIF A;  2E34 A;  4O5E A;  4B3A A;  2Z1D A;  2H3F A;  2BHZ A;  5HOO A;  3AU2 A;  2OQR A;  2XIC A;  2KKP A;  2ZB9 A;  2Y0S A;  3CUO A;  3W6V A;  1BPZ A;  1DK2 A;  2KTQ A;  2C22 A;  5TIS C;  3C1Y A;  3RDI A;  1ZN2 A;  3FZV A;  2JH7 A;  5KFJ A;  1BW6 A;  2CU7 A;  1Q46 A;  3EZ5 A;  1ZH5 A;  1KON A;  4NY8 A;  5CPR B;  2PFN A;  3FK6 A;  2PLY A;  5IT9 K;  3K70 C;  1O7F A;  2KZM A;  1QRY A;  3WK8 A;  2F4M B;  5ALQ A;  1W5T A;  4IQU A;  1JXL A;  2ZIV B;  4K4G A;  2EFW A;  3A2K A;  4A5M A;  3QZ7 A;  2Z99 A;  2XC9 A;  3RAX A;  4JV2 A;  4LVS A;  2F76 X;  4DFK A;  3F5E A;  4QNL A;  2HI3 A;  3HP6 A;  4QIW F;  4IQW A;  1YW7 A;  3KYC B;  2KDZ A;  1NK2 P;  3ABU A;  3ZQL A;  2XCP A;  2OTJ I;  2WAQ N;  5EG0 A;  2Y9U A;  1YTY A;  2GM4 A;  4G6Q A;  1ECW A;  1DUX C;  4RUA A;  4RPZ A;  4LG0 A;  3F9K A;  4YR0 A;  1OUQ A;  3NAR A;  3RKY A;  3TED A;  4BJQ A;  3R0A A;  1ORK A;  2A1A A;  3BTL A;  2QQB A;  1VQO I;  4DF4 A;  2WB1 A;  4NQW B;  5J2K A;  1IDY A;  2WTF A;  2NS0 A;  2FUG 2;  2LSO A;  2FX0 A;  2VKQ A;  3W2V A;  3DTK A;  3L2Q A;  4Y4R A;  3SHF A;  2DFE A;  1S8N A;  2X6W A;  3BCB A;  3X2Q H;  1PDN C;  1UT8 A;  3TAR A;  1ZAR A;  2L7M P;  3BTI A;  1S76 D;  4F4Y A;  4RGX A;  5D6E A;  4C3H J;  2XAU A;  2R92 J;  1XDU A;  3ZMT A;  2VXD A;  5DV5 A;  3VSL A;  5J2C A;  3H0R B;  2FMP A;  1LDK B;  1ZQX A;  2Z2S B;  5C5J A;  2NV3 A;  5E79 C;  3BC8 A;  4YR2 A;  3REO A;  2IS4 A;  1Y0U A;  2M7A A;  4IRH A;  3H8J A;  4P55 A;  2ME6 A;  1HJP A;  3HEF A;  4MIM A;  3MD2 A;  4NJ8 A;  3DKW A;  2NRV A;  4M2Y A;  5AKG A;  2HQA A;  2KP6 A;  2EZI A;  1U5T A;  3LA3 A;  1LKY B;  3I4N J;  1J2M A;  4KLU A;  2CQK A;  2O5R A;  2QYO A;  2E2I J;  2W8L A;  3VB2 A;  1L7P A;  5ALK A;  1FIQ A;  1D1B A;  1GLN A;  2R5Z B;  1HW1 A;  3BR3 A;  4BY1 J;  3I9V 2;  1SEU A;  5L9X A;  4O3N A;  4JX4 A;  1KU3 A;  3DEE A;  5HS7 A;  1X2M A;  3S3N A;  4A6E A;  2VQL A;  5ILS A;  2BV6 A;  2R7Z J;  2PMZ C;  5J2A A;  7ICU A;  3HJE A;  5BOL A;  4MFE A;  4F5N A;  3V7C A;  8ICJ A;  4RB2 C;  1SD4 A;  2HQN A;  3M8S A;  4GXJ A;  4IHW A;  1TK8 A;  4M9H A;  3HOY J;  1KL9 A;  1SGG A;  5K7Z A;  5BOM A;  1RG6 A;  1OIS A;  2KL4 A;  4UNO A;  2OXO A;  5FKM A;  2WF8 A;  1P4A A;  4US8 A;  4JK1 A;  7ICV A;  3ABK H;  2QAR A;  1RXW A;  1YZ7 A;  4E4H A;  5C3E J;  4A3E J;  2XAJ A;  3NVW A;  1BM9 A;  2DMQ A;  1QVT A;  4M04 A;  2ALZ A;  1DGW Y;  2A6E F;  4HX4 A;  4PJJ A;  1H8A C;  5DB9 A;  4FBT A;  1YX5 A;  2JA7 J;  1UCV A;  3S6J A;  2R7R A;  5L3E A;  2K02 A;  5AIA A;  1G3W A;  1OQY A;  5EWF A;  4EEN A;  3C18 A;  4RUC A;  1U47 A;  4I01 A;  1XSL A;  1G2H A;  2ICW G;  4QIW C;  1F43 A;  1IN7 A;  4C7Y A;  3VYS B;  2XPU A;  2O6G E;  2HYG D;  2PI0 A;  3JPN A;  3IH4 A;  3QUC A;  3K1R B;  5GPC A;  1RPW A;  2HQR A;  5DQG A;  4A3G J;  3GUD A;  3HRD D;  4I2B A;  2DF4 B;  3KEO A;  1G3S A;  3MKW B;  2HBJ A;  5GAH J;  2IGK A;  1REP C;  2HYJ A;  3QWL A;  2V9V A;  4I2G A;  1NK0 A;  3C2L A;  4CZZ A;  4DSL A;  3RB6 A;  2EH3 A;  1D1A A;  3S15 J;  1TWG J;  2K85 A;  2QKM B;  2IHN A;  2K5C A;  4AVP A;  3JPO A;  2STT A;  3JTG A;  3I5U A;  3TOB A;  4L0Y B;  1O03 A;  2ZJQ F;  4NL9 C;  1QLN A;  2EQR A;  1NNL A;  5J8Y C;  1R4N B;  3PW2 A;  1QQ7 A;  4B6J A;  4IO9 F;  2WB1 F;  4RNO A;  3T3F A;  4Y52 J;  2MSN A;  3GME A;  3RQI A;  2FPM A;  3SEI A;  3CCR I;  2BY2 A;  1DXS A;  3OS1 A;  2W24 A;  2ZTC A;  1IDZ A;  2JMG A;  1T8I A;  3CD6 I;  1KBU A;  1ZQM A;  5F9N A;  2CW0 F;  1Z1D A;  3CCE I;  3HOS A;  4HG2 A;  4OIQ F;  4MTE A;  2YSR A;  3C1Z A;  3RAQ A;  3L2U A;  3QUQ A;  2K89 A;  2YPR A;  2QUF A;  2VL8 A;  2A1J B;  2DA7 A;  1ED1 A;  8ICO A;  1VZ0 A;  5KVR A;  1JKR C;  2ZTD A;  3ZDA A;  1QGP A;  3NRV A;  2XSJ C;  1PJR A;  3EYY A;  3ZQ7 A;  1NKC A;  2HR3 A;  2KJB A;  4F71 A;  4KA4 A;  4U0W A;  3IG8 A;  4ESF A;  1L5U A;  3FM5 A;  3BQY A;  4PFO A;  1FP1 D;  3BTC A;  3K70 D;  3BR1 A;  2JTV A;  3HB9 A;  3PO3 J;  1UHW A;  4EM1 A;  1P4W A;  2O8K A;  2FML A;  2Z7J A;  2GXB A;  4DYQ A;  2H1K A;  2KV2 A;  3GZ6 A;  2MD0 A;  3NGD A;  3JAM K;  1T8E A;  2W43 A;  1JTY A;  2VPL A;  8ICL A;  2AGO A;  1DU6 A;  3FBN B;  3SAG A;  3CZ6 A;  2F44 A;  3B0Y A;  1TAQ A;  2XCA A;  2PN6 A;  4H0E A;  3R9K A;  3KOO A;  5IIL A;  3RB4 A;  2VC0 A;  2XAF A;  3F0C A;  3PX6 A;  1TK5 A;  1EV7 A;  3MR3 A;  4DSJ A;  7ICM A;  9ICG A;  1VQN I;  1QZZ A;  3LYS A;  4XRF A;  1T4G A;  3OL3 A;  1W7P D;  2H8W A;  2G0A A;  1B4F A;  4DSE A;  2LYC A;  4NC6 A;  4RQN A;  3ZI4 A;  2ECB A;  5K4L A;  2FOW A;  5ALG A;  4CCH A;  4E7J A;  2JHD A;  2C2R A;  2OF7 A;  5KK1 A;  2IP2 A;  4UBB A;  2FXA A;  2LLK A;  1UJ8 A;  4JWM A;  2FLP A;  1IXC A;  1X40 A;  2HSZ A;  1SFU A;  3GFJ A;  2O6K A;  2VI6 A;  1ZGJ A;  2P6T A;  2V1X A;  4C2M J;  3ZR8 X;  4ENM A;  1FEZ A;  3BS5 A;  5AKL A;  5KFB A;  5J2D A;  5ICE A;  2Y0S C;  3V4G A;  1GHC A;  3KET A;  5L3B A;  4A3L J;  3M6K A;  2DDB A;  1RR7 A;  4A3B J;  3RI4 A;  5HLG A;  2RC4 A;  1E3P A;  2V1U A;  1O08 A;  2NAZ A;  4IR1 A;  2CW7 A;  3MGH A;  4IL6 C;  2VN2 A;  5H6R A;  4HQM A;  2BW3 A;  3ECO A;  4M9J A;  1K5O A;  9ICR A;  1ZQY A;  2L7Z A;  1XSD A;  1MH4 A;  5KG0 A;  2GO7 A;  3UXO A;  4L5I A;  2CXY A;  4ZYG A;  1FFU A;  2W55 A;  5CVI A;  4DEZ A;  2KN7 A;  7ICT A;  1COK A;  2N8G A;  4KMU A;  3HKZ A;  1O3T A;  3HOV J;  1KQQ A;  3MKL A;  3ABM H;  5C4J J;  3H0L B;  3CQZ J;  2GOM A;  2KQR A;  5ALN A;  3WKC A;  2GWS A;  9ICS A;  7ICR A;  3BS7 A;  2LP0 A;  2H3I A;  3RH5 A;  1X58 A;  4ELT A;  1ZTR A;  3U26 A;  3V7L A;  2A05 A;  4WCG A;  2OAZ A;  3N7R C;  4B9S A;  1PVQ A;  3GFM A;  2KHQ A;  9ICU A;  1D8K A;  1P92 A;  9ICX A;  3EET A;  5IIN A;  1MQ2 A;  1IN6 A;  3OYL A;  3S1R J;  5JUM A;  5HDK A;  4FET A;  2Y75 A;  1YI2 I;  2PG4 A;  2WC2 A;  3UKG A;  2CUF A;  2RV8 A;  1XGS A;  4B48 A;  4RB1 A;  3ZDE A;  1ZRE A;  4XUS A;  1YLF A;  1L6N A;  1ZQL A;  3PZP A;  2CUE A;  1H88 C;  1TE2 A;  2XVC A;  2HVS A;  2LY2 A;  1FFV A;  2QAR B;  4Y2R A;  2E8M A;  2BXY A;  2ID6 A;  3ZQI A;  5EYR A;  2DO7 A;  2XRO A;  3G71 I;  2WHE A;  3SV4 A;  1U48 A;  5LHI A;  2R5Y A;  5F3X B;  1SFO J;  3M1C A;  2MLG A;  2LD5 A;  2GLE A;  3CDH A;  1U9O A;  3A1Y A;  5L3C A;  4P0P B;  1UEL B;  3BQ0 A;  1OCT C;  1LEB A;  3NEU A;  2FNA A;  2CMP A;  5DEQ A;  2DJI A;  1GDT A;  4MLO A;  3HDD A;  5J1U A;  3RZO J;  1WJC A;  3J81 j;  1R00 A;  1U3E M;  3HZJ A;  1I1S A;  1LEA A;  5DGA A;  4HF1 A;  3PFY A;  4EMS A;  3ELK A;  3L2C A;  2KIV A;  2KZG A;  4B44 A;  4BWJ A;  3PR4 A;  3Q8R B;  5KG3 A;  3N4M A;  2CRX A;  4F2S A;  4ECQ A;  5LGN A;  3I56 I;  3MBY A;  5F08 A;  1S7E A;  2OBP A;  1YOV B;  2HOA A;  5EEH A;  3OSG A;  1SC7 A;  1F4K A;  1ZR4 A;  1R1U A;  1ZD4 A;  3F53 A;  4O3R A;  4V19 K;  2EZK A;  2AS5 F;  5AK6 A;  4F5Q A;  1R36 A;  2R7V A;  5IIJ A;  1ZYR F;  3H0G J;  2RQP A;  2OYY A;  5J2J A;  4RLF A;  2WB1 C;  2L4M A;  3H92 A;  4CYD A;  5D5X B;  3C5F A;  2KZV A;  2OQG A;  9ICN A;  3LDA A;  2W9C B;  5BPD A;  4GC7 A;  3ZN1 A;  2XY7 A;  1R5G A;  3BPV A;  3D5R C;  4XLA A;  4XR6 A;  3J80 K;  1WHU A;  4BU2 A;  3ALR A;  1ZQA A;  3EQL F;  4IJA A;  2L02 A;  5FKL A;  1QQI A;  3H1C A;  2E1F A;  2JRZ A;  5AI5 A;  2IBK A;  3PQK A;  2K7L A;  3PX0 A;  1ZD5 A;  2FE9 A;  3OGU A;  2DKZ A;  2ECC A;  2LMD A;  2P0W A;  1NK5 A;  4JBA A;  2K9L A;  2W1O A;  3UMG A;  3WU2 U;  1WJ5 A;  4DZP A;  4ESJ A;  3OHA A;  3ZDC A;  2XSD C;  4HZF A;  3R60 A;  4D5F A;  2OD5 A;  5DDY A;  1J2X A;  2ISY A;  2ZBK A;  3T8T A;  4ZJZ A;  1IRX A;  4DQS A;  3PW5 A;  3PM1 A;  2GOL A;  3WU1 B;  3I55 I;  2ZIV A;  3KP6 A;  4U6P A;  2KKV A;  2VKD A;  4KUM A;  4ENN A;  4QW9 A;  3VPR A;  1NI3 A;  4UB4 A;  1BI1 A;  2EIM H;  5ICC A;  4QZH A;  1XGM A;  1FBU A;  4A3I J;  3E5U A;  2D5V A;  1ZQO A;  1R7J A;  1UMQ A;  1N78 A;  1KLN A;  4KLL A;  5KG5 A;  4CA0 A;  4M9L A;  2Q0Z X;  3QPS A;  4RAF A;  2E2H J;  1EA3 A;  1NK7 A;  1QBJ A;  1N25 A;  1OCZ H;  2X6X A;  1XO0 A;  4UB5 A;  2M45 A;  1E2X A;  3W2W A;  9ICF A;  4LK0 F;  2VUM J;  4I2E A;  4KN4 X;  4D0P A;  2ZJ8 A;  5DDG A;  2DI3 A;  1L8L A;  8ICI A;  2ZSH B;  4QSH A;  2VA2 A;  1UHS A;  1Q1H A;  4WXD A;  3L2W A;  4FHT A;  4EEK A;  3HPO A;  4RU9 A;  5FD5 A;  4GXK A;  3T5L A;  1A04 A;  4JMU A;  1SWW A;  2ZXJ A;  4QLC U;  2FJ1 A;  3HBL A;  2BZT A;  4HV5 A;  3C2H A;  2QB1 A;  2XGP A;  1BIA A;  2JJ7 A;  4YN4 A;  4HST A;  4F2R A;  3COA C;  1XS9 D;  3RJF A;  4ELU A;  2LNB A;  3DLL F;  4Q5S F;  2IOH A;  3N4M B;  1R1T A;  4NUB A;  1KU2 A;  3N7P D;  5AK3 A;  2K9N A;  1A6I A;  4PJM A;  3HW8 A;  2OC6 A;  3LFU A;  4PJN A;  1AKH A;  2H3V A;  2FLN A;  1HUZ A;  1NG7 A;  3CJR B;  1K7A A;  1V5G A;  2PBI A;  3OHB A;  3E5Q A;  3WTW C;  1PVP A;  2VPR A;  2FMS A;  4EX7 A;  3ZGK A;  1Z67 A;  1XWL A;  3PSI A;  3V7R A;  4KIC A;  4XOP A;  2DK8 A;  4DNC A;  5DTD A;  3NWS A;  4ECZ A;  2EA4 A;  4UAR A;  4MFA A;  3K75 D;  1ON2 A;  4B9T A;  5A2Q Z;  4U88 A;  1LB2 B;  3DKX A;  2NRZ A;  3EYZ A;  1TLH B;  4Y15 A;  3PR5 B;  1MQ3 A;  3WOD F;  2FBK A;  3PL8 A;  2ELJ A;  1O3Q A;  3OPX A;  2LKS A;  3W6J B;  2FD5 A;  1A76 A;  4F72 A;  2H3Q A;  2KT0 A;  1YJW I;  1SD7 A;  4KLH A;  4A3M J;  4YD1 A;  2AH5 A;  4KLJ A;  4BDZ A;  5KFS A;  2YX7 A;  3PV8 A;  8ICS A;  2M7B A;  3MFH A;  2P35 A;  4ZZD A;  3IG5 A;  1R5I D;  4YP3 A;  2M0N A;  1Z1V A;  4P0P A;  3F6O A;  8ICN A;  7ICS A;  1YW9 A;  4K4I A;  2DFH A;  4QZ8 A;  4K2E A;  2LM4 A;  2KFD A;  1JXE A;  2QSH X;  2E19 A;  3B6C A;  3MN2 A;  3H9Q A;  4PZJ A;  4FZN A;  2NS7 A;  4IS7 A;  4NM1 A;  4RT3 A;  2L9N A;  4AC0 A;  2F1H A;  2ZO4 A;  2VQH A;  2QCO A;  2FBI A;  3Q0U A;  4NC7 A;  1IGN A;  4XLN F;  2IA1 A;  4AU7 A;  4I09 A;  1YT3 A;  4IQV A;  4XON A;  3AG4 H;  3GEZ A;  4OCZ A;  9ICT A;  4TQR A;  1Z19 A;  4M9G A;  2JWT A;  1PUZ A;  2DA6 A;  2ELK A;  3D1N I;  3HOU J;  2MC3 A;  9ICI A;  2DUY A;  2ISO A;  2JVG A;  3TGN A;  2BW3 B;  3HOT A;  1N63 A;  5IOZ A;  2VKE A;  4CF3 A;  1ZET A;  5KNL A;  2XGD A;  2LKY A;  4Z6F A;  1YQA A;  4HX8 A;  5E79 U;  4ZTJ A;  1N2X A;  1ZG1 A;  1L3L A;  1HEK A;  3QU9 A;  5DCM B;  4G7O F;  4RM3 A;  2DGZ A;  2KRH A;  1NK3 P;  3S1Q J;  2HHT A;  2E1M B;  2ES6 A;  1SFE A;  2DL0 A;  4J01 A;  3S8P A;  4OU0 A;  5GP9 A;  1VQK I;  5AM3 A;  3MDC A;  3KHL A;  4R8U B;  4BKX A;  1K4S A;  1IN5 A;  1OYI A;  2V26 A;  4LOC A;  4EAT A;  3ISC A;  3WE2 A;  4O0I A;  1F5S A;  4AP9 A;  1N48 A;  2DA5 A;  3CCU I;  4Y2X A;  4YFK F;  1P2F A;  1SIJ A;  4M3G A;  3KZZ A;  3G3Z A;  2ZUB A;  1ZQP A;  5B66 C;  5J2H A;  4P2H A;  1X9S A;  1UFM A;  4RZR A;  5DQH A;  2HNH A;  2W84 A;  3JRG A;  1APL C;  2CG4 A;  3GTP J;  1SVM A;  3C2B A;  2KSO A;  4BQO A;  3OR1 C;  3PW7 A;  5ICG A;  1IO2 A;  4ED0 A;  3GWZ A;  1B8I A;  3JW4 A;  3BS5 B;  4LLG F;  1NK8 A;  4AYB F;  2L7F P;  1VQM I;  3Q8M A;  2JQ7 A;  3AQF A;  1A6Q A;  1S5L C;  5KFW A;  1HW5 A;  4I28 A;  1V55 H;  5AI9 A;  5AKK A;  4P4P A;  3QX7 A;  4HNU A;  5KG7 A;  4F4X A;  3JSP A;  2EIK H;  2XVT A;  4I2I A;  4HNV A;  1LE8 A;  2PMZ A;  4IPA A;  5L3D A;  2CQN A;  3D5S C;  2OV7 A;  4NLZ A;  1N5X A;  3LVV A;  2YUS A;  5EEA A;  4F7Z A;  3OYH A;  4L5E A;  1DGS A;  2P5K A;  4GO1 A;  1AQ6 A;  4LD5 A;  3GQC A;  2VBX A;  1U9N A;  3C2G A;  3P9C A;  2IA2 A;  3MMY B;  2I10 A;  4I2J A;  3M8R A;  4RQ5 A;  5CLS A;  2BYV E;  2A6T A;  1OMI A;  3C7J A;  4HBL A;  4PK4 A;  4S04 A;  1T95 A;  3L2R A;  2EBI A;  3J80 Z;  3WTV C;  4AUX A;  2LOO A;  1QU3 A;  1IM4 A;  2W11 A;  3TDU C;  3R6S A;  2KK0 A;  1XC9 A;  2PI4 A;  2P8T A;  2AHQ A;  4US9 A;  3H4D A;  2KSO B;  1TFR A;  5F6F A;  4IQ4 A;  5LGU A;  3SEN A;  5DBA A;  4O9M A;  2VQC A;  1UPH A;  3K9T A;  4DL7 A;  4RB0 A;  1QSY A;  1FSE A;  1RIO H;  2HW3 A;  4BYY A;  1HSJ A;  4C2U A;  5K5R A;  1GUU A;  3H40 A;  3C2M A;  4X6A J;  1ZD2 P;  8ICB A;  2ZUC A;  4BH9 A;  2D45 A;  5GTH U;  2VE9 A;  4A5N A;  5LRS A;  1EH7 A;  2F1I A;  3KZI U;  5DB8 A;  1ZQK A;  2DFF A;  1X4O A;  4OWR B;  3LNQ A;  5ALZ A;  1FO4 A;  4G94 A;  4UB8 C;  1ZK8 A;  1D8J A;  2FPL A;  4RQ4 A;  5D5V B;  1KQ0 A;  1J97 A;  3SFI A;  4XA5 A;  2EZH A;  1H0M A;  2QB0 B;  5LD2 C;  2DQL A;  4N4N B;  3G6X A;  3ZQH A;  1T2K A;  3R61 A;  1FYM A;  2XV4 S;  2NVT J;  4DF8 A;  3CYM A;  1KW4 A;  2PMH A;  3H3U A;  3WK5 A;  5K7H A;  1RZ4 A;  4HF2 A;  1TK0 A;  3VSK A;  4U0Y A;  8ICK A;  1FWZ A;  3PW4 A;  3GTL J;  1I27 A;  2KFZ A;  3FXR A;  4RPX A;  3SAH A;  2ESN A;  2MU2 A;  1YG2 A;  4ITV A;  5D4S A;  3E6M A;  2GIZ A;  3AM9 A;  3ISD A;  4BXF A;  9ICH A;  4M9S A;  4JK1 X;  5DG8 A;  4CCM A;  9ICM A;  1T6S A;  1NTC A;  3CRX A;  2IT0 A;  3ZD9 A;  2DT5 A;  3K2A A;  4DL5 A;  2HGC A;  4FTH A;  2W8K A;  1UST A;  2AQE A;  4P4O A;  4UQG A;  3ISB A;  1U9L A;  3S3M A;  4DFJ A;  5LFA A;  1ZR2 A;  5JVT A;  4DBQ A;  3GTG J;  7ICK A;  4NLG A;  3E1S A;  1NJY A;  2WY8 Q;  1P6R A;  2HZD A;  5ALO A;  2L4A A;  2CW8 A;  1B6A A;  4HDU A;  4I2O A;  4QWB A;  1RNL A;  2DCE A;  3ZOB A;  4WWC A;  1CF7 A;  4BJ6 C;  5CKT A;  4OIP F;  3QUT A;  3AKZ A;  5D8L B;  1TC3 C;  2ZME B;  3GFK B;  1WI9 A;  5KFN A;  3UMB A;  1WJA A;  2J5P A;  1HST A;  1W7P A;  3F3X A;  5KL1 B;  3HG9 A;  4J9N A;  4KLT A;  2ASD A;  2DBB A;  8ICX A;  4F4K A;  4G7H F;  3IN5 A;  3FXL A;  2ZXH A;  3DBL B;  2MG4 A;  3GIJ A;  1CUK A;  2M0C A;  3G1L A;  4EEY A;  4A6D A;  4YG2 F;  3TDZ C;  1J0R A;  1MH3 A;  3CC2 I;  2KJ5 A;  1J5Y A;  3UM9 A;  4DOC A;  2XRL A;  2YS9 A;  4KN7 A;  1XSV A;  3IAS 2;  1A6S A;  1BI0 A;  2DMP A;  1JGG A;  2PJR B;  3BQ7 A;  3M7D A;  4Q45 A;  4M9N A;  3I59 B;  2Z3Y A;  1U6G A;  3MEX A;  2I6X A;  2OPT A;  3BQ1 A;  1RR8 C;  1TBX A;  4EBE A;  1XPX A;  2CN1 A;  3CW2 C;  3EPZ A;  3OY9 A;  1V5E A;  3WG7 H;  2F5V A;  1L0O C;  2CQQ A;  2EFO A;  4DO9 A;  1UHU A;  4MO7 A;  4YEL A;  1U78 A;  4ZYD A;  1UG2 A;  1IXR A;  3MAB A;  4K4H A;  4WX9 A;  3BT9 A;  2AGQ A;  3HX0 A;  1LKY A;  2W7P A;  2E1M C;  4A3F J;  5GTI U;  1FIA A;  3TMO A;  5ALF A;  2M3A A;  2ADU A;  2WWY A;  3K1M A;  3FHN A;  1VQ5 I;  1YW8 A;  3SXY A;  3SZP A;  3QUB A;  5TGT A;  1W0U A;  5M5X J;  3OYK A;  4NL9 A;  4WXH A;  2KVS A;  3TQ1 A;  8ICE A;  2IMW P;  1QHG A;  2V9W A;  3K2Z A;  1RUN A;  1MMN A;  3PQJ A;  1JUM A;  4A2U A;  2IA6 A;  1KFT A;  3RTV A;  2XGX A;  1TAM A;  5ALR A;  1NZP A;  4P5O A;  2WF9 A;  5J2E A;  3WKB A;  3H5R A;  5J0Q A;  3PY8 A;  7ICI A;  4DQP A;  3M8E A;  2K8C B;  5JTI A;  8ICQ A;  3BZ6 A;  3FHZ A;  4KLF A;  1B22 A;  2HTJ A;  4RB3 C;  1K1Q A;  5ALS A;  4DQ2 A;  3JPS A;  3F2B A;  4N9I A;  2H8R A;  3LSI A;  2RP5 A;  4HYK A;  1LDD A;  1V54 H;  4F91 B;  5KFQ A;  4J9P A;  3E2E A;  5E1Z B;  4BHP A;  4RQM A;  2MAX A;  5AHX A;  2K9S A;  2BDP A;  4M71 A;  1RXV A;  5EG0 B;  4ICA A;  4UAU A;  1SV0 A;  1LVA A;  3QZ8 A;  2QZ8 A;  3HIL A;  4BQN A;  2EB7 A;  5AI6 A;  5AIB A;  5JU5 A;  5FRO A;  4E7S A;  3I59 A;  4AWX B;  1ZLK A;  2W03 A;  5KAI U;  2BOL A;  2PJR A;  1Y6I A;  2HPI A;  1D1C A;  2Y30 A;  4XK4 A;  1KFS A;  5AM1 A;  5A0L A;  3V8J A;  1QSL A;  4IQJ A;  4RGR A;  2EIN H;  1RKW A;  4OJO A;  2J6S A;  2MD5 A;  2RKH A;  4M47 A;  1D8Y A;  2LK2 A;  3AQE A;  2LRD A;  1Z6R A;  2ZIW B;  1DU0 A;  1SB3 C;  2W04 A;  4IRC A;  5DQI A;  1Z91 A;  2DK5 A;  3PSF A;  4L9T A;  3O2P E;  3AUO A;  3M3Y J;  2XY6 A;  5ALJ A;  2Y31 A;  2QEN A;  4B43 A;  3K4M A;  1YFH A;  1R71 A;  1X6J A;  2LF8 A;  2G9W A;  4DW6 A;  3AL0 B;  2E5S A;  2G0E A;  1TWF J;  4AYB A;  1TT0 A;  3JRA A;  3VCB A;  3SJM A;  1O3R A;  3OYE A;  2QBY B;  1ZQU A;  3FIS A;  5M3M J;  8ICF A;  2VQG A;  1TQP A;  4ZZL A;  2RDP A;  1MMD A;  2V9P A;  3BJ6 A;  2AQ4 A;  2XGC A;  2RRE A;  4P0Q A;  1IUF A;  9ICQ A;  2BPC A;  1WQ2 A;  1XC5 A;  4PCQ A;  1PP7 U;  2AQF A;  4A3D J;  5ALE A;  3RYR A;  3HRS A;  1IIP A;  2YN4 A;  4C8O A;  3V42 A;  2FLL A;  1E0E A;  5DB6 A;  2B0L A;  3NVY A;  2CSO A;  4RQ8 A;  2KIQ A;  4EM0 B;  3QYF A;  5ALH A;  2C2E A;  2GIV A;  2O7O A;  1C20 A;  2HBK A;  4N0B A;  5LGT A;  4P96 A;  4UW9 A;  2DWQ A;  4NWI A;  4JV1 A;  3G73 A;  4UAS A;  1DP7 P;  1Z4O A;  1ZQD A;  3D2Q A;  2QA4 I;  5BPI A;  1WJE A;  4ASN A;  2M4G A;  1X3U A;  4Y33 A;  2IS6 A;  2MW8 A;  1HW2 A;  1MKM A;  2HOS A;  4CIC A;  3PJR A;  3F5A A;  3V8K A;  2HHW A;  4N9H A;  2VKV A;  4OAY A;  3VOD A;  4OAZ A;  4FE3 A;  5JLX A;  1HIW A;  4IHV A;  1I6X A;  3SDG A;  3O8G A;  5DYM A;  2G08 A;  1GVJ A;  1ITY A;  1RQL A;  3I0T A;  3Q3S A;  1IF1 A;  5CRX A;  2CUJ A;  3GTO J;  4F93 B;  1ZD3 A;  2HZT A;  3SZT A;  2HOQ A;  2DFI A;  4C4T A;  2FU4 A;  4RAG A;  5IIO A;  2H09 A;  3UQ2 A;  3HSF A;  4CSW A;  2AXT C;  1SKS A;  4F92 B;  5D4R A;  4KLM A;  4AID A;  1IRF A;  5J0W A;  3DLA A;  5JR3 A;  3KLN A;  2F2E A;  5F27 A;  2EFQ A;  5F0C A;  4MEX F;  4PZO A;  2X51 A;  3DKY A;  1HF0 A;  2CV0 A;  5J0P A;  4LK1 F;  3GV7 B;  3NS1 A;  5GPA A;  3Q8K A;  2FSW A;  3NVZ A;  3LMM A;  2V79 A;  1XCV A;  5DUI A;  4HRI A;  1FIP A;  2XC7 A;  5ALV A;  4JX6 A;  3JCU C;  2VT2 A;  4XLC A;  5B5E U;  3OYD A;  3M4O J;  5KAI C;  3CO7 C;  2GH1 A;  2XI9 A;  1P7D A;  3QEA Z;  2ME0 A;  5B66 U;  1EH6 A;  1R4M B;  1Z05 A;  4A69 C;  3FDY A;  3CC4 I;  1P9Q C;  4XKB A;  1MW7 A;  5HLT A;  4Y2Y A;  3V7S A;  4WXC A;  1WRJ A;  2K3F A;  1LFP A;  3ZMU A;  4IHT A;  3BZC A;  2X4H A;  2OJE D;  2CO5 A;  4UV8 A;  4B09 A;  2NVU B;  3TI0 A;  2LBO A;  3IUO A;  3TL4 X;  3QP6 A;  4UUS B;  1L7O A;  4JB3 A;  4YXM A;  3NTU A;  3HT3 A;  2C6Y A;  1S72 I;  4CCL A;  2HI0 A;  1OCO H;  3A01 A;  2NO4 A;  4QW8 A;  5EE3 A;  4DSI A;  4E0D A;  3A0B C;  5E8G A;  3MKZ A;  3T0Y A;  1YX3 A;  2XAQ A;  3WGG A;  1T94 A;  2A19 A;  2EAP A;  2WBM A;  5CQE A;  2GA1 A;  5HLI A;  2KZ3 A;  1RES A;  3B73 A;  1AWC A;  1JKQ C;  5CVV A;  1B8I B;  3IM1 A;  1WCM J;  2P7C B;  1TV9 A;  2W48 A;  1JT0 A;  2YMQ A;  2V4R A;  4QJF B;  8ICA A;  3RPQ A;  1B72 A;  1NHA A;  4BXO A;  7ICF A;  2L7K A;  2ACJ A;  3FC4 A;  4EVI A;  2JMW A;  3BQZ A;  3I28 A;  3AAF A;  1M6Y A;  4M9X A;  4QWE A;  2VIX A;  5IT3 A;  1AHD P;  5KFU A;  4MFC A;  3S3O A;  1CEZ A;  3PNY A;  3K4B A;  2R7U A;  1GV5 A;  2Y48 A;  3A4C A;  1CI4 A;  1X1B A;  1U49 A;  3I53 A;  2ZXW H;  4E70 A;  1MNM C;  4NLK A;  4LJZ F;  2N1R A;  3U21 A;  4R8U A;  3QPL A;  1TQI A;  2WY7 Q;  3V72 A;  3HRU A;  4MQ9 F;  2XAG A;  4FS1 A;  3NAS A;  3PX4 A;  2QVO A;  5H6Q A;  4I76 A;  3E3V A;  2R8H A;  1SAU A;  1BIB A;  2A5W A;  2BY3 A;  2DBY A;  4RBO A;  1BC8 C;  4BAC A;  1ZXI A;  1S7A A;  4CCK A;  1ARO P;  5IT9 Z;  3OYB A;  2OM6 A;  2RQ5 A;  4FCY A;  3AN1 A;  4UB1 A;  3KEY A;  3RB0 A;  1S0M A;  1HDP A;  3S16 J;  2Y0S N;  3ECH A;  2KIM A;  3QAH A;  5FKK A;  2E1O A;  2IPQ X;  4XOT A;  2F77 X;  2UWM A;  4C0Z A;  4ECS A;  4I2H A;  5CVR A;  3F8N A;  2XID A;  2DTR A;  2CPR A;  2GQQ A;  1WWV A;  4IC9 A;  3QNM A;  4KJZ A;  2X6Y A;  4G7Z F;  4KIT B;  4MHV A;  4F3O A;  4P9U A;  1DK3 A;  2H27 A;  3BCA A;  1RM6 C;  4TUS A;  4BE0 A;  2JV3 A;  4R1H A;  2AGP A;  3CMA I;  4UB2 A;  1A77 A;  1XO1 A;  3CF5 F;  4QWQ A;  2HCF A;  1MBJ A;  2BQ3 A;  5K5Q A;  4XM3 A;  9ICW A;  2DYR H;  2QQ9 A;  3J7A Y;  3S1M J;  5L1J A;  2KJ8 A;  5DBB A;  2FEZ A;  2XB5 A;  3CJQ B;  1LPQ A;  1PUE E;  3UXN A;  3GTM J;  4UY8 I;  5EE1 A;  4WK8 F;  3CMY A;  4PGG A;  7ICG A;  3H9J A;  3K4J A;  3VFZ A;  1FJL A;  1VQ6 I;  5KL8 B;  2F5F A;  1MSE C;  5KFY A;  1ZG5 A;  2ZIU A;  4MEY F;  4BXX J;  1IN4 A;  4UB6 U;  4DL6 A;  4ED1 A;  3MKY B;  1B59 A;  1X1A A;  3KIO A;  3WHB A;  3T5K A;  8ICU A;  3J81 K;  1UQV A;  3MAJ A;  4OJP A;  2VON A;  1SL0 A;  3WTX C;  2KHM A;  5FP0 A;  1ZQG A;  1USS A;  1SMY F;  1XNS A;  4FZM A;  4BBR J;  2FPK A;  2P6U A;  5KT7 A;  3KLO A;  4M3B A;  4O3O A;  2P7V B;  3T1B A;  4C8M A;  3OJS A;  1UCR A;  2JH1 A;  1LB2 A;  1FP2 A;  5L1I A;  1ZYQ A;  4BY7 J;  1X3W B;  1MBH A;  3EUH C;  3B02 A;  1SD6 A;  3NRW A;  2CH0 A;  2QWW A;  3BG3 A;  5BMZ A;  1QZY A;  2W4S A;  1BPD A;  2NNN A;  2MRL A;  4NHJ A;  3HGG A;  4AVZ A;  4MTD A;  4KIS A;  1NOM A;  4YMN A;  4EX6 A;  1Z3X A;  3QPH A;  3C23 A;  5JHU A;  3K4L A;  4FE4 A;  2W9A A;  1GV2 A;  4DSK A;  1K83 J;  2M34 A;  5BNG A;  3MZH A;  1AKH B;  3EW9 A;  3TKA A;  4KYW A;  2XGE A;  5J2G A;  1F1Z A;  2ID3 A;  4KLO A;  3KX2 A;  4KTQ A;  3HM5 A;  2F8L A;  3RJI A;  4D9J A;  1ZJM A;  4FZL A;  3RFA A;  2MSY A;  1WH7 A;  3CDL A;  5TJJ A;  2BCR A;  4DFM A;  1XMX A;  2I8D A;  3RH4 A;  2M2E A;  3LFK A;  2AHO B;  1KYW A;  2CJJ A;  4G8X A;  4EM2 A;  4P4M A;  4BDP A;  3OSF A;  1ZQW A;  2OA4 A;  1OYW A;  4ED2 A;  3HC7 A;  2GXG A;  3ZP5 A;  1GO3 F;  4RQ7 A;  3BG5 A;  3F23 A;  1YRN B;  1FX7 A;  4KFC A;  1SL1 A;  4DL4 A;  2LDU A;  3BJA A;  3Q5F A;  5KFM A;  3SYT A;  2HVI A;  4EJO A;  2DPD A;  5HS8 A;  3MZY A;  4EJT A;  2V6C A;  3U1K A;  4C80 A;  1QPM A;  2K4H A;  4DWI A;  4L9N A;  3TW7 A;  4ETS A;  3H35 A;  3I3L A;  5J0U A;  3JRH A;  3ZDB A;  3RH6 A;  3C3W A;  2R5Z A;  2MAB A;  3BR5 A;  4F4W A;  4PDK A;  4NLB A;  4PGX A;  1G3Y A;  2FBH A;  3SEZ A;  1JUP A;  3BJY A;  2Y9Y A;  2C2D A;  3A03 A;  3E0J B;  1FLI A;  4M6W B;  3FBI B;  1HLV A;  1ZQI A;  5F1J A;  4UVA A;  5J0Y A;  2JSP A;  4KIB A;  5E1X A;  7ICP A;  2LR8 A;  2R7F A;  5F04 A;  1I6H J;  4CO8 A;  3ZDD A;  2KVC A;  2LKX A;  3ZD8 A;  4Y13 A;  1BPE A;  2ZIU B;  3PIP F;  3RB3 A;  2G7U A;  4HOB A;  5DG7 A;  1WVR A;  1J09 A;  2W3S A;  1R23 A;  2A69 F;  2M5W A;  4IX7 A;  1POG A;  3CCL I;  2PMZ F;  9ICA A;  3ZMD A;  1VQP I;  2RVC A;  5KT4 A;  5ALW A;  1W4M A;  1UG0 A;  3B9J A;  2NRX A;  1XDS A;  3K4K A;  5BPC A;  4MF8 A;  2EPF A;  2MYS A;  1X9X A;  3I71 A;  1HXD A;  2EIL H;  2DOF A;  4ZDP A;  4AIH A;  2YY6 A;  5M5Y J;  5AKI A;  4YFK A;  3L9F A;  3HRM A;  5HML A;  5FKN A;  3HKZ F;  1YYV A;  2CFO A;  2PMU A;  3CUQ B;  2EAM A;  3T5H A;  2M1B A;  4XKC A;  6PAX A;  2BDU A;  5KFF A;  1VND A;  2ZIX A;  3ERE D;  1ZQV A;  3MGI A;  3ULQ B;  2L0K A;  2X9D A;  2E36 A;  1F9N A;  3ZQC A;  2DA1 A;  4HV6 A;  4IHS A;  2BE5 F;  2LYA A;  3BPX A;  2K4I A;  2IA0 A;  5ED4 A;  4CGZ A;  4IEJ A;  1WWX A;  5D6F A;  3BDP A;  2JVH A;  2OH2 A;  2GBY A;  4EJV A;  3HL2 A;  1ZRD A;  4N4O B;  4BGD A;  4NBQ A;  3MDA A;  3IRR A;  3FDS A;  2CGP A;  5HMM A;  3C29 A;  3AFH A;  1RYU A;  3TAN A;  4ZDL A;  1MMS A;  5KFA A;  1RZT A;  2EZL A;  4PSX A;  1LFU P;  4HLY A;  2PXI A;  2OEH A;  1J9I A;  4TUQ A;  4RA2 A;  5HVQ C;  1ZQZ A;  2BGC A;  3CCV I;  5JLW A;  1JHF A;  4BEH A;  4LIT A;  4XRH A;  2EV6 A;  1HKS A;  4E7Z A;  2XAH A;  3FF5 A;  3CC7 I;  1FMV A;  4LB5 A;  2G7H A;  4MGR A;  4LMY A;  3OYJ A;  3KBB A;  3RKX A;  3KKA A;  2DA2 A;  3G6E I;  5KT6 A;  4JX5 A;  2Z5U A;  1KSP A;  4IRK A;  1JUD A;  3KHR A;  4EBC A;  2QKQ A;  2YMP A;  1PVR A;  2MA3 A;  1G6N A;  1ZAO A;  2KRC A;  4RLQ A;  5L3G A;  1W0T A;  3FM3 A;  2V1D A;  2EV0 A;  2F1J A;  2RDJ A;  3FXJ A;  1IN8 A;  3L4P A;  3SR6 A;  4O5C A;  3RJE A;  4GRI A;  1BW5 A;  2HBM A;  2V6E A;  3M7G A;  4M9Z A;  1Z3E B;  5M3F J;  2R93 J;  1BR2 A;  1Z3Y A;  1I39 A;  2W57 A;  1KKX A;  1KYZ A;  2Q8K A;  1Y39 A;  4BNC A;  1JE8 A;  5HNH A;  5FLM J;  1KU9 A;  2HDW A;  4TUR A;  2I9G A;  3QU6 A;  4B1R A;  1J2N A;  2RAE A;  1FY7 A;  4A0X A;  2ZTE A;  1TNS A;  4HX7 A;  4CYC A;  1Z7U A;  1L7N A;  1ZRN A;  2R7S A;  2ETH A;  2XPV A;  1R1V A;  2LI6 A;  2LVS A;  5HS9 A;  3Q9V A;  5IYB J;  1Y1W J;  3SYZ A;  1N77 A;  4X5V A;  1O3S A;  4QZB A;  2KZZ A;  3K1N A;  5GAD J;  2HDO A;  4I2D A;  4RQ2 A;  5ILV A;  1I3Q J;  2XPW A;  2G07 A;  4C8N A;  1ENH A;  1AA7 A;  2LBF A;  4XLF A;  2I5H A;  4I2F A;  1IC8 A;  1Q1V A;  2VXZ A;  1KTQ A;  3E5X A;  1X9M A;  1RI7 A;  2K86 A;  3RPU D;  4UXN A;  2DTZ A;  1DPU A;  4U0V A;  1D9F A;  5C44 J;  2YU9 J;  2A68 F;  3KHH A;  4DGW B;  2IGO A;  4JP0 A;  1BNO A;  3PST A;  4G6D A;  5J0X A;  4J9O A;  2HHV A;  3QE9 Y;  1KZH A;  3I76 A;  2D6F C;  3LQR A;  3ETR A;  3ASN H;  4ANJ A;  1JXS A;  2AQ0 A;  1F5T A;  3JRE A;  5AM2 A;  3IC7 A;  5KG1 A;  4U7D A;  4RQ1 A;  1NJW A;  1ZEL A;  5FJ8 J;  3VC8 A;  1LDJ A;  4NDL A;  4PZN A;  1RDF A;  1T7P A;  4O5K A;  2L54 A;  2DJN A;  1SAN A;  2STW A;  1SXE A;  3DV9 A;  1ZG3 A;  3K6G A;  1FBQ A;  4KNY A;  3S2D J;  2JN6 A;  5CWR A;  3RJH A;  4CZC A;  4QWD A;  2WTE A;  1IW7 F;  5F1R A;  2LF7 A;  3ORY A;  3IWF A;  1BC7 C;  3GIK A;  1UHM A;  2BVL A;  3BWG A;  1YZ6 A;  3H8S A;  3J81 Z;  2YQE A;  1A35 A;  3OIQ A;  5AIQ A;  3IH3 A;  2E1E A;  4HPQ A;  3OYM A;  2JZY A;  2WAQ A;  1JAL A;  2EAN A;  2JEF A;  3U9G A;  4YFX F;  1OCC H;  1JJ8 C;  5KFX A;  5DGB A;  3KFW X;  5HR6 A;  5IP6 A;  2CQX A;  2WAD A;  4RM2 A;  3HPH A;  1LV5 A;  3W3C A;  3GYH X;  1QNT A;  1BVS A;  3DF8 A;  4BUP A;  1EXN A;  1ON1 A;  2JA8 J;  1LVK A;  2WV0 A;  2KOB A;  4CYC B;  1FYL A;  1BPY A;  4EZ9 A;  3CJN A;  1BOA A;  3KP7 A;  4WJ3 B;  4IRG A;  3LVW A;  3EUA A;  5FD6 A;  2ODG A;  4CCN A;  4JQF A;  2P66 A;  7ICO A;  1MJ9 A;  4PL1 A;  1JUS A;  1D8B A;  2EQY A;  4ECW A;  3OYC A;  3GZN B;  1T33 A;  3TKY A;  1ETV A;  1D0Z A;  2RN7 A;  2P6S A;  3NQO A;  4KMU X;  4DQQ A;  2IAI A;  3WU2 C;  2X85 A;  4ENK A;  1FOK A;  1VLB A;  4DS4 A;  3PO5 A;  3CNH A;  2BCV A;  2ZFW A;  5B1A H;  2BHN A;  3BY6 A;  3CME I;  5IYD J;  2VAS A;  2ZUD A;  3RIR A;  3OYG A;  4CDG A;  3V6K A;  4Y17 A;  2W3R A;  5AKJ A;  4CF5 A;  5T14 A;  1H89 C;  3BRO A;  1HKT A;  8ICG A;  4BQA A;  3BDD A;  4YQW A;  2V4Q A;  2PFP A;  2PFQ A;  5E20 A;  3PFI A;  1D3Y A;  4BEH B;  7ICL A;  1WPK A;  4FBU A;  1ZGA A;  1U4B A;  4GLX A;  2ZIW A;  1T98 A;  3GF2 A;  3V7K A;  3ESW B;  3I58 A;  1MJA A;  3P9K A;  3TW6 A;  3QPT A;  1F44 A;  1R5H A;  5HNK A;  1AU7 A;  4AIJ A;  3RBD A;  1P7J A;  2TDX A;  3Q8Q B;  3HKZ N;  3IHU A;  5DCM A;  4RDU A;  2HVH A;  2DYS H;  4Y2J A;  1JJ6 C;  3RZD J;  4B9L A;  2UUZ A;  4UB3 A;  1K79 A;  2J5O A;  3QYE A;  5KCM A;  4AD9 A;  1Z77 A;  2F48 A;  3R4K A;  5DKW A;  4IKF A;  4II2 A;  2LC2 A;  4GFJ A;  2ZXI A;  2VJ4 A;  4HQE A;  1ZQS A;  3IAM 2;  2ZCW A;  4Q47 A;  2HVR A;  4B9N A;  1Q3V A;  2VBW A;  4D7M A;  4I99 C;  2VBY A;  4LJX A;  2M8G X;  4HF0 A;  2LM1 A;  3DCF A;  1ODD A;  3E0F A;  2E71 A;  4UAV A;  2RNG A;  4PJL A;  2KPM A;  5DS9 A;  2W82 A;  4M6V A;  2NRW A;  2D1V A;  4W97 A;  1L3V A;  4B9M A;  5M5W J;  3GZ5 A;  1KU7 A;  4OMZ A;  2BY0 A;  3EUB 2;  5EWE A;  1ZRC A;  5CEH A;  4Q8F A;  2XAS A;  2WF6 A;  1XSP A;  2JSC A;  2KIF A;  5EE0 A;  1QA6 A;  1T3N A;  3CP2 A;  2DT6 A;  4IOA F;  4NV0 A;  1QTM A;  5EOZ A;  1T0F A;  3M9N B;  1Y56 A;  4B3X A;  2E7X A;  3OR2 C;  5LLQ A;  3PML A;  3WTZ A;  2P5V A;  2WAE A;  3JR9 A;  3M1E A;  3R0J A;  1S3J A;  2EV5 A;  3MFK A;  1U8B A;  2OZ6 A;  5KTQ A;  2W85 A;  5ALT A;  1VQ7 I;  5IOY A;  1X2I A;  3DTI A;  2A3V A;  2KP7 A;  4DCC A;  4ZDO A;  2B9S A;  1E3O C;  1VQ9 I; 
#chains in the Genus database with same CATH homology
 3AQE A;  1NG6 A;  2LRD A;  2Z7J A;  2ZIW B;  2F2A B;  4XLE A;  3VYU B;  2KV2 A;  2W04 A;  2MD0 A;  3D5L A;  3PSF A;  5FRN A;  3OWT A;  4XNF A;  2VPL A;  3FBN B;  4B43 A;  3CZ6 A;  3K4M A;  3SAG A;  2LHT A;  3AL0 B;  2E5S A;  3VCB A;  4AYB A;  1TT0 A;  2CUZ A;  1LKX A;  3OYE A;  5KHD A;  2V1N A;  2VQG A;  3LYS A;  2YX8 A;  1MMD A;  1N75 A;  4PFP A;  4P0Q A;  2RRE A;  3OL3 A;  2KIW A;  2AQF A;  2G0A A;  3VDX A;  1IIP A;  2F6C A;  2LYC A;  2NOJ B;  3LL7 A;  2W7N A;  3V42 A;  3RTR A;  1E0E A;  4II3 A;  4XMY A;  4E7J A;  2JHD A;  3QYF A;  3HUG B;  4JOM A;  2HBK A;  2HPM A;  1G8X A;  3ZR8 X;  2L2O A;  2JUG A;  2LG4 A;  4XN3 A;  4NLC A;  2ZIX B;  4NWI A;  1W36 C;  2HOI A;  2Y0S C;  3SAF A;  2HOF A;  3D2Q A;  4KT6 A;  4IZZ A;  1Z21 A;  4QPO A;  1WJE A;  1S9H A;  2CW7 A;  2M4G A;  3DTE A;  4Y33 A;  2IS6 A;  3UNG C;  1D0Y A;  3F5A A;  4O3M A;  3PJR A;  2BW3 A;  4OAY A;  4LG3 A;  1D0X A;  4OAZ A;  4FE3 A;  1WJB A;  1HIW A;  2V9K A;  2G08 A;  3RF9 A;  2K3P A;  4DIQ A;  5CRX A;  2CUJ A;  4F93 B;  2HOQ A;  1Q3U A;  3HKZ A;  3HXL A;  4CSW A;  4XQF A;  3QOD A;  4F52 A;  4F92 B;  3H0L B;  1X1D A;  2GOM A;  2KQR A;  3DLA A;  2H3I A;  4KX3 A;  2X51 A;  3DKY A;  3GBG A;  3H5N A;  2CV0 A;  2KHQ A;  3N7R C;  1PVQ A;  3OYL A;  3LMM A;  2HMX A;  4BL0 B;  4FET A;  4HRI A;  2E5N A;  2XC7 A;  3VYR B;  1X19 A;  1PYV A;  4XLC A;  3OYD A;  4XN0 A;  4B48 A;  4CRX A;  2GH1 A;  2XI9 A;  4KMO B;  1P7D A;  1L6N A;  3PZP A;  1A0P A;  2JGA A;  4OJL A;  3FDY A;  3DWL E;  3OYF A;  1P9Q C;  2F4I A;  3LSH A;  4XKB A;  2LY2 A;  1MW7 A;  5HLT A;  2HVS A;  4B47 A;  5FRM A;  1BR1 A;  2LRE A;  1LFP A;  2M4K A;  2HU9 A;  2YB4 A;  3NUQ A;  3M1C A;  4BJ5 C;  2LBO A;  3IUO A;  3TL4 X;  3LSK A;  3A1Y A;  1Z1B A;  4P0P B;  4YEJ A;  1UEL B;  4CCL A;  2CMP A;  2WA0 A;  2DJI A;  3CES A;  4MLO A;  2R7T A;  1WJC A;  3D2N A;  3MKZ A;  1YX3 A;  1T94 A;  4BS9 A;  2WBM A;  5CQE A;  3ONQ A;  3PFY A;  4B44 A;  1DQU A;  4ZYA A;  4QJF B;  2G5I B;  2CRX A;  2L7K A;  1K6Y A;  1BOB A;  3M8J A;  3IP4 B;  2VIX A;  4ZTF A;  3F53 A;  3RCO A;  3S3O A;  3PNY A;  3K4B A;  3ZCO A;  2UV1 A;  4E7L A;  3A4C A;  4QPQ A;  1X1B A;  2R7U A;  3RSN A;  2IGN A;  2R7V A;  2N1R A;  3U21 A;  5JHF A;  3OYA A;  2HBL A;  2WY7 Q;  2OYY A;  4RLF A;  2WB1 C;  1SAU A;  2KZV A;  2A5W A;  4F55 A;  2VLA A;  2OM6 A;  3ZRG A;  4DOZ A;  4BAC A;  4CCK A;  3SMV A;  3CMM A;  3OYB A;  3D2S A;  3D5R C;  4XLA A;  3GZF A;  3KEY A;  4XR6 A;  2R4G A;  3ALR A;  3H9G A;  3K4N A;  4BU2 A;  4XOT A;  2F77 X;  2UWM A;  4C0Z A;  4C9Y A;  1SZH A;  3KZX A;  2XID A;  1KBU A;  4D1Q A;  2CPR A;  2E1F A;  4IC9 A;  4KJZ A;  2X6Y A;  3L2V A;  4KIT B;  3K4C A;  2MC4 A;  3BCA A;  4CH7 A;  4BE0 A;  3OOU A;  3OS0 A;  1DGR M;  1HA8 A;  2P0W A;  1OR7 C;  2K9L A;  2W1O A;  4LIV A;  3QYB A;  1WJ5 A;  4XM3 A;  2K4E A;  2X1E A;  3J7A Y;  2K8A A;  2KJ8 A;  2Z16 A;  3CJQ B;  4ZJZ A;  1IRX A;  4P1W A;  2GOL A;  2R7X A;  3DQV C;  3K10 A;  2ZIV A;  4U6P A;  2KKV A;  2VKD A;  3H9J A;  3K4J A;  4AYB C;  3AL0 C;  5KL8 B;  2RRD A;  1N78 A;  2ZIU A;  1ZQ1 C;  4DJA A;  4CA0 A;  4PSW A;  2V7F A;  1EA3 A;  4X0G A;  1X1A A;  3MKY B;  4E6K G;  2X6X A;  4OJP A;  1XO0 A;  1MMA A;  4DBR A;  3W2W A;  2G06 A;  4PL2 A;  2KHM A;  5CQG A;  4RMN A;  4FZM A;  1XNS A;  3FKJ A;  2ZSH B;  4C30 A;  2VJI A;  3TBI A;  1SFK A;  3O0F A;  3KYL A;  3L2W A;  2JH1 A;  2E5Z A;  3N7S C;  3MGV A;  4JMU A;  4U87 A;  1QHH D;  2WAQ F;  3EUH C;  3NRW A;  2DQN B;  2CH0 A;  3C2H A;  3SEQ A;  4FAS D;  4HSR A;  4HST A;  1WUD A;  2W4S A;  4OJ6 A;  2MRL A;  2IS1 A;  2DOA A;  3OL4 A;  4AVZ A;  4KIS A;  4NUB A;  3N7P D;  4G6T B;  1Z3X A;  3K4L A;  4PJM A;  2OC6 A;  3LFU A;  2IGM A;  4PJN A;  2H3V A;  4BUG A;  2G09 A;  3G2B A;  3GU3 A;  3CJR B;  1NG7 A;  3KX2 A;  1V5G A;  1G59 A;  2F8L A;  4D9J A;  1MNE A;  1PVP A;  4FZL A;  4E7H A;  3ZGK A;  3RFA A;  2ZFU A;  3M6K A;  3DU5 A;  3PSI A;  4HEA 2;  4XOP A;  2I8D A;  3SZG A;  1TZL A;  4BQQ A;  4CUG A;  4U7C A;  2R7Q A;  3NWS A;  3M6Z A;  3BG6 A;  4LIU A;  3HC7 A;  3PSP A;  1GO3 F;  3DPU A;  3DKX A;  5HNF A;  1W36 D;  4A8E A;  3PL8 A;  2ELJ A;  3OPX A;  2VJ5 A;  3SYT A;  4BE2 A;  2H3Q A;  2L9S A;  2R18 A;  2CS3 A;  4BDZ A;  3LSG A;  2K4H A;  2M7B A;  3HPG A;  3H35 A;  3I3L A;  3IG5 A;  2XF6 A;  2M0N A;  2E60 A;  2MAB A;  4P0P A;  3ZXS A;  2XF7 A;  4NLB A;  1DP3 A;  3K1Z A;  3DU6 A;  3S32 A;  3SEZ A;  2OUM A;  2LH9 A;  2XF5 A;  1ERD A;  3E0J B;  3FBI B;  4FZN A;  3H9Q A;  2KD1 A;  3NWT A;  2JSP A;  2L9N A;  1CRX A;  3BG7 A;  2Y0S F;  2VB6 A;  2VQH A;  2KVC A;  4OJ5 A;  4NC7 A;  4U7B A;  4BDY A;  2ZIU B;  4AU7 A;  1YT3 A;  4XKV A;  1WJF A;  2KDO A;  4H4K C;  2DXI A;  4XON A;  1J09 A;  1MND A;  4IX7 A;  1Z19 A;  4CCO A;  3OMY A;  2PMZ F;  1UG0 A;  2JVG A;  2BW3 B;  3HOT A;  3K4K A;  2GOX B;  1WFX A;  2MYS A;  4YRV A;  5KNL A;  2LKY A;  4ZDP A;  2LYB A;  2HVQ A;  2W7P A;  3OYN A;  3PNV A;  4ZTJ A;  2ZG6 A;  3HKZ F;  1HEK A;  2CFO A;  5C0Y A;  4RM3 A;  2DGZ A;  2KRH A;  1UAA A;  2K8B B;  2BDU A;  2KLO A;  4XKC A;  4ACO A;  2E1M B;  2R7W A;  2ZIX A;  4J01 A;  3S8P A;  2ZSI B;  1R6R A;  4ZC3 A;  4C2T A;  2LYA A;  2K4I A;  2KNJ A;  3DPT A;  4OO1 J;  4XL9 A;  4CGZ A;  2V26 A;  3EUK L;  4EAT A;  2JVH A;  2OH2 A;  4XOR A;  2JA2 A;  2Q2E B;  3S93 A;  3HL2 A;  5HR7 A;  4N4O B;  4BGD A;  2KIC A;  1DRG A;  2K9M A;  3C29 A;  3T79 A;  3AFH A;  4ZDL A;  4P0Q B;  2HNH A;  2CV2 A;  1V5F A;  4PSX A;  2KHV A;  1OLT A;  2VKH A;  3ICX A;  4BQO A;  3OR1 C;  5HVQ C;  4BEH A;  4LIT A;  3BLY A;  1X4P A;  4E7Z A;  4BX9 C;  1FMW A;  1FMV A;  4AYB F;  3SDB A;  3OYJ A;  3AQF A;  2CV1 A;  3F2D A;  1JI8 A;  4HNU A;  1PVR A;  2XVT A;  4RLQ A;  2KRC A;  2PMZ A;  1U0J A;  1NZB A;  3HKZ C;  1BR4 A;  2LY1 A;  2OV7 A;  3D5S C;  2L5Q A;  3VYT B;  4BJT A;  3OYI A;  4GRI A;  3LVV A;  4HNT A;  3OYH A;  2V6E A;  2HBM A;  2Z1D A;  2H3F A;  5HOO A;  2XIC A;  2KKP A;  2Y0S A;  1BR2 A;  1Z3Y A;  3C2G A;  3MMY B;  5HNH A;  2A6T A;  2HDW A;  3L2R A;  4PK4 A;  2JH7 A;  1T95 A;  1KON A;  5CPR B;  1QU3 A;  2LOO A;  4PUS A;  3K70 C;  3QOE A;  2R7S A;  4XKW A;  1N77 A;  2ZIV B;  4IQ4 A;  3KFU F;  3A2K A;  2IS2 A;  2VQC A;  3RQ4 A;  1UPH A;  3L3F X;  2G07 A;  2LBF A;  1AA7 A;  4XLF A;  1X1C A;  2VXZ A;  2F76 X;  3RPU D;  4C2U A;  3F5E A;  4QNL A;  4QIW F;  4E7I A;  3H0D A;  4DGW B;  2IGO A;  2XDV A;  1ECW A;  4XLH A;  3PST A;  2W7O A;  1OUQ A;  3F9K A;  4CCJ A;  1X4O A;  4OWR B;  3DPL C;  4BJQ A;  2D6F C;  4ANJ A;  4BE1 A;  1MMG A;  2WB1 A;  2Q1Z B;  4NQW B;  3UR3 C;  1WJD A;  5LD2 C;  2FUG 2;  4N4N B;  4J00 A;  2VKQ A;  1ZEL A;  3W2V A;  3VC8 A;  3DTK A;  3CYM A;  3CP8 A;  3L2Q A;  4Y4R A;  2YB1 A;  2X6W A;  3BCB A;  3VSK A;  3K6G A;  3OIP A;  2XAU A;  2IXS A;  3PNT A;  4CZC A;  2VXD A;  3SAH A;  3VSL A;  3H0R B;  1LDK B;  4ITV A;  2Z2S B;  2BVL A;  1YE9 A;  4BXF A;  3BC8 A;  2NV3 A;  1MA7 A;  1Z7L A;  2IS4 A;  2M7A A;  4CCM A;  3VWB A;  3OIQ A;  2E1E A;  3CRX A;  4HPQ A;  2BVM A;  3OYM A;  2WAQ A;  2KEY A;  3MD2 A;  3SQI A;  5HR6 A;  2AQE A;  2W00 A;  2HQA A;  2KP6 A;  2WAD A;  3S3M A;  4Y3O A;  4RM2 A;  5LFA A;  3HPH A;  4R79 A;  3W3C A;  4DBQ A;  2MA1 A;  2Q4T A;  2O5R A;  4BUP A;  2KOB A;  1LVK A;  3E1S A;  2WY8 Q;  2HZD A;  2H3Z A;  1GLN A;  1D1B A;  3C28 A;  4NNJ A;  3I9V 2;  2CW8 A;  3LVW A;  3EUA A;  4WJ3 B;  2DCE A;  3DEE A;  4CCN A;  4JQF A;  5CKT A;  4BJ6 C;  4PL1 A;  3AKZ A;  3S3N A;  2VQL A;  1D8B A;  3OYC A;  2PMZ C;  1WJA A;  1D0Z A;  2KMU A;  5KL1 B;  2X85 A;  3HG9 A;  2MFZ A;  2RQQ A;  3IN5 A;  2ZXH A;  2VAS A;  2G5H B;  2KL4 A;  2OXO A;  3OYG A;  4CDG A;  2KJ5 A;  3N05 A;  3OS2 A;  5T14 A;  4E4H A;  3IAS 2;  1A6S A;  3M7D A;  2PJR B;  3F2C A;  1DGW Y;  4PJJ A;  2VJJ A;  1YX5 A;  2R7R A;  2R7O A;  4BEH B;  1URJ A;  2CN1 A;  3EPZ A;  3OY9 A;  1V5E A;  2F5V A;  2ZIW A;  2X1D A;  4QIW C;  1F44 A;  2DT7 B;  4YEL A;  2V4J C;  2RHF A;  3VYS B;  2E1M C;  3TMO A;  2UUZ A;  2M3A A;  3H0M B;  4F3Q A;  3FHN A;  3QYE A;  5KCM A;  5TGT A;  2DF4 B;  3PUB A;  3OYK A;  4IKF A;  3MKW B;  4II2 A;  1QHG A;  2LC2 A;  2IGK A;  2HBJ A;  2ZXI A;  4GFJ A;  1MMN A;  2VJ4 A;  3IAM 2;  2X1C A;  3ONN A;  2HVR A;  1Q3V A;  2WAF A;  1D1A A;  2M0M A;  3E0F A;  2QKM B;  1TAM A;  2K5C A;  4P5O A;  3H5A A;  2RNG A;  4PJL A;  3H5R A;  2KPM A;  2W82 A;  2K8C B;  2LBF B;  2WB1 F;  3CF2 A;  3F2B A;  2QKL B;  3LSI A;  2RP5 A;  3OS1 A;  4F91 B;  2JMG A;  3CP2 A;  2DT6 A;  4NV0 A;  3HOS A;  3LSM A;  4HG2 A;  4E7K A;  1Y56 A;  4B3X A;  3OR2 C;  2WAQ C;  4ICA A;  3L2U A;  4KX5 A;  2K89 A;  2VL8 A;  2WAE A;  1ED1 A;  4BQN A;  2KJ9 A;  1VZ0 A;  4NC8 A;  3ZQQ A;  5FRO A;  2XSJ C;  1PJR A;  4E7S A;  2W03 A;  2BOL A;  2PJR A;  1Y6I A;  2HPI A;  1D1C A;  3DTI A;  3IG8 A;  5A0L A;  4IQJ A;  3W2A A;  1T0F C;  2A3V A;  4PFO A;  4ZDO A;  3K70 D;  4OJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...