3IP4B

The high resolution structure of gatcab
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
482
structure length
482
Chain Sequence
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct regions in Staphylococcus aureus GatCAB guarantee accurate tRNA recognition
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 168
structure length 482
sequence length 482
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ip4B03
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3ip4B02
2DQNB 3IP4B 3H0LB 2DF4B 3AL0B 2G5IB 3KFUF 4WJ3B 1ZQ1C 1NG6A 2D6FC 2F2AB 3H0RB 3H0MB 2G5HB
chains in the Genus database with same CATH superfamily
1Y1WJ 3C2GA 2KRFA 4UAZA 3WKBA 3HTSB 2ZJRF 4E7JA 5KG6A 1XWLA 2LPEA 5FKOA 2Y69H 5AKLA 3T8RA 4NB5A 4PGGA 1RPLA 4DZPA 2WTFA 2G5IB 1IXSB 4PJNA 3HOUJ 1MNEA 3ML6A 5ALWA 1ZHFA 3SENA 2HVIA 3ELKA 4FQGA 5AKEA 5J29A 1Z0XA 1USSA 3BZKA 3S17J 3OS2A 2RP5A 2FA5A 4B9MA 3PNVA 2HR3A 1JT0A 2NVTJ 1PVRA 4IRKA 1MBGA 2BCSA 3BR5A 1Z3EB 1U0JA 1OCTC 4HNTA 3GIKA 4GXKA 1T56A 1XGNA 2P7VB 1Z1BA 1HW1A 2MABA 2ZTDA 4EJVA 5DLGA 1BJAA 2W55A 5ALVA 3PL8A 3C2MA 3ZDBA 4BJTA 3C5GA 2XSJC 3CCLI 4KNYA 1B59A 5AKXA 3JPNA 1TK8A 2Z9OA 3IG5A 3CF2A 3DDHA 2W8LA 4Y2JA 1YTYA 4M6VA 3RQ4A 2R7XA 1JMSA 1W1WE 1IZ1A 2NOJB 3ZN0A 1R36A 4ZJZA 5HVQC 3NARA 1KYWA 3KEOA 3RRGA 5K5RA 4NLKA 3CTAA 2D1VA 4J9LA 1ETVA 4LG3A 2RQQA 4LD5A 1QCKA 4FBTA 2ZNYA 2ZC2A 4BQOA 5BPCA 2L2OA 1YQAA 5H6RA 1ACIA 1V55H 2JUGA 2YMLA 2Y31A 3DU6A 2XGPA 3ZQCA 9ICWA 2HTSA 1TE2A 2ZUBA 4FE3A 4PK4A 3I71A 8ICQA 1E17A 3FC4A 4E7IA 4KISA 2VKEA 1OQYA 2RNJA 3J81Z 4KUMA 2YTUA 3EYZA 1Q3VA 3S1RJ 2UVWA 3RJFA 3CDIA 2BQUA 3RF9A 5DCFA 4A5NA 5LHIA 3GIJA 4I29A 4CDGA 2OEHA 1USTA 2OQGA 3GCMA 2JH7A 2L7KA 4UNOA 4PHEA 1S0OA 4RT3A 3EYIA 2H3IA 3LSHA 4BEHB 3FWEA 3A0BU 4IQJA 4FBUA 3I4PA 4DFMA 3BG3A 3RDIA 1BPXA 3KYLA 4KT6A 2IAIA 5AONA 8ICBA 2CRGA 3VSLA 5DB9A 4TUQA 3QXGA 2ZJAA 4YP3A 1K6YA 4AYBC 2NV3A 3WKEA 1BPZA 1IN6A 3QODA 2DPDA 4C4RA 1LFPA 3PNCA 2X1DA 3S1QJ 5LGTA 2BPFA 4CCOA 4PFOA 2KZZA 5FLXZ 2DUYA 1RKWA 4A6EA 4GO1A 4BXFA 3GX4X 3A01B 1V38A 3BTJA 4F5QA 3HZJA 2K4BA 1WUDA 3I9V2 3ZN1A 3H0MB 4D7NA 4EZ6A 3DP7A 7ICHA 4IRGA 1IUYA 2E1CA 4RAGA 4AWXB 2K27A 3T5XA 1OR7A 4PGHA 4LG0B 2R7TA 1LV5A 3WTXC 7ICGA 2LLKA 3BJ6A 3H8SA 4DBRA 3TFRA 5JTIA 4Y52J 4XICA 2EPFA 1R5GA 2JEJA 4OMZA 4BWMA 1Z3XA 3GFJA 4I2OA 1DGSA 2EQRA 5KFBA 3I59A 1QU3A 1W7PB 1LFUP 2X4HA 2R0QC 2VB6A 3LL7A 5D5WB 5AIBA 5KFWA 3ZMUA 3DFGA 2W85A 1APLC 2BEOA 2DFFA 2VONA 1XMKA 2H3QA 2X51A 1RRJA 4NM2A 5DCMB 4P0PB 4B44A 4NDLA 1ZG1A 1BR2A 1XC5A 1R23A 1X3ZB 2A68F 2AXTC 4PJLA 4LB5A 2CFOA 2KMUA 1RC9A 4NHJA 5C0YA 2WFAA 1R1VA 2MLGA 4EELA 1RESA 3CZ6A 1G3SA 2M45A 4A12A 2HDDA 2YU3A 4C8KA 8ICKA 4MFCA 2WC2A 2J6TA 1YW9A 2O3FA 3U21A 2BCRA 3BR6A 2ID6A 2IA2A 5E79U 3V7KA 2K4IA 1GLNA 3GXOA 3SZPA 4E7HA 5KFXA 3C28A 3BQ1A 2E8OA 2DT6A 4OOIA 3D2QA 2GWRA 3BCBA 2NVXJ 3F2BA 5E3NA 4X1EA 3EETA 1P9QC 1IW7F 9ICTA 1WJ5A 3KZIU 4MLOA 1DDNA 4CO8A 1IRZA 2VQGA 2M0NA 4AIHA 4KLUA 2MUTA 2FMSA 2QWWA 5DUKA 4RQ2A 1JTYA 1WKMA 2NNNA 1B4FA 3H9JA 1HBXG 3HT3A 3HIFA 2NVUB 4ABZA 2R7QA 5KG1A 3HRMA 3ZR8X 3CMYA 1BC8C 5DBCA 2R8KA 1FBQA 5F3XB 5IINA 1Y0UA 4WF2A 2NNYA 4NY8A 1EV7A 1D0ZA 5EE3A 3D2NA 1QSLA 2ZXHA 2X6XA 3C7JA 2JZYA 4I6ZA 4EEKA 2EFQA 3ORYA 1PK1A 4ENJA 4ZTFA 3T1BA 4ZDOA 3AFHA 5AIAA 1RETA 1FZPB 2ETHA 3J80Z 4LZDA 3UXNA 3PUBA 3WODF 1BNOA 2IW5A 2KVCA 8ICGA 1KLNA 3HOVJ 5E20A 4Y15A 3O2PE 4M9LA 3MR3A 2MLKA 3HRTA 4Y2YA 4DL6A 4RGRA 1B8IB 5FFXA 4F4KA 1JN3A 3QYPA 2K9MA 2YQEA 1SFOJ 5KAIC 2WAQF 1JRPA 1R1TA 1ZXIA 1TNTA 3UXPA 2H6BA 5ILVA 5C3EJ 2ELHA 2DA1A 4OAYA 4A3LJ 1XDUA 5ILSA 2BVMA 3WE3A 5ALIA 5FKKA 5CVVA 1EJ9A 4M9SA 4GFJA 3I28A 4L9VA 2GA1A 4GYIA 2E2JJ 2ZO4A 1IRGA 3U1KA 3TMOA 1U8RA 4O5KA 1WWUA 2WV0A 5D5VB 2CH0A 4XQFA 2ZXIA 5AKJA 2KISA 1CF7A 4XKVA 1XO1A 3ZRGA 5H2FU 2EV0A 2UXXA 4U88A 4EENA 3KETA 3H40A 3RBDA 1ZQGA 3JRHA 3J7ZI 4Y3OA 1JUPA 4BAYA 3V7RA 5AHXA 4TUPA 1YI2I 1V54H 2UV1A 3KFWX 2LKSA 3QP5A 4AU7A 5JVGF 4E7KA 2WF5A 2MYSA 3WK9A 4IHVA 3ISCA 1UA0A 1RXWA 1T0FA 4L5EA 4BL0B 2DFLA 2RHFA 4PFPA 4QZEA 2VE8A 1X19A 3O8GA 3G6XA 2CO5A 1NI3A 3K4MA 2KKOA 2MG4A 5ICGA 2BKEA 3SMVA 1F43A 3SXYA 3FDSA 5L3GA 2HZTA 5AI9A 2FQ3A 3Q8KA 2I8DA 4ITVA 1HKSA 1S29A 3WK6A 2IMWP 3ZQHA 1J2MA 1LB2A 4KIGA 2AS5F 2XY6A 2A1AA 3O6BB 5BS6A 4A93J 5L1LA 2R93J 3L9FA 1N25A 3PX0A 4F8RA 5J40A 9ICCA 4I28A 1W0UA 4PGXA 2L02A 1J9IA 3C2HA 3HSRA 1R49A 4NC8A 5K4LA 5FKMA 2M9HA 3E5QA 1Z6TA 2XB0X 5DKWA 2JUCA 3QYEA 3REOA 3QWLA 2AQFA 3R0AA 4N9HA 4XKWA 3V4GA 1JKPC 1X9MA 1RYSA 3VFZA 2XPUA 4L0YB 3DLAA 4HX8A 4EM0B 3OS1A 2PXIA 1SB3C 1YX5A 4RAZA 1F44A 1KKXA 2JJ7A 5D4RA 2MD0A 1VLBA 5KT7A 4GYGA 1ZD4A 3NVVA 2HVHA 4DOZA 1XTAA 3CCSI 4GRIA 3AAFA 1BC7C 1Z7UA 2JHDA 3Q0UA 3RSNA 5AKYA 5ALZA 4R8UB 1XS9D 2LOOA 8ICRA 5L1MA 2HOQA 5EEAA 2PJRA 1BGXT 3JRCA 2K9NA 1LE8B 2RVCA 4G6QA 2PN6A 3FAHA 3IC7A 2P6RA 1RQLA 3CW2C 1A35A 4Y7NJ 1LNWA 9ICAA 2V7FA 4ETSA 4ELVA 1UT8A 1MBEA 4XRSG 3KPHA 3ZQ7A 4EJUA 4XM3A 2E8MA 3HSFA 4QZBA 4YR3A 1DGRM 4IJAA 5J0UA 2WAQA 2EFOA 4KMUA 2OBPA 4A3CJ 2QLTA 1AHDP 2LKXA 4DIQA 4YFKA 2PQ8A 3TBIA 1L3SA 1D8YA 1QO0D 1B6AA 1FC3A 3HBLA 1MA7A 1Y8QB 2BY1A 1FMWA 1WSUA 3LOCA 4KX5A 4I98B 3SZ2A 3UNGC 4AP9A 4RGUA 2B6GA 2R7WA 1TK0A 3JPSA 5M5YJ 1RIOH 2R8HA 5KFEA 5BOXA 4GGGA 1B4AA 1O7LA 4II2A 3QOEA 4HSTA 1YS6A 4JB3A 4LK1F 2GLOA 4LMYA 1JTXA 1KU9A 4JOMA 3AG3H 1JUDA 3TW6A 4HYKA 1OW5A 2HNHA 4XUSA 4CCJA 1VNDA 3E6CC 2M8GX 4EMSA 1T6SA 3BS7A 2RNGA 3DCFA 4GXOA 4EJWA 1JXLA 2I9GA 2M0CA 2X6OA 4EJTA 1K79A 3QU9A 4RT2A 1FBUA 3NS1A 2PBIA 3WU2U 5E1WA 1Z05A 2F5DA 2CV0A 5GAGJ 3PW7A 2ZJ5A 1VQ6I 2XF7A 1NJXA 1UJ8A 4PUSA 3TO6A 1P6RA 4YFKF 1BPYA 3WGIA 2PI4A 9ICEA 3OR1C 2MW8A 1XD7A 4C7ZA 3GV7B 4O3SA 4XIDA 4BJ5C 4BY1J 3S1MJ 4A3KJ 1UT5A 1K4SA 3ESWB 3SV3A 1TWHJ 2PMZF 4Y17A 4A3BJ 2X0LA 2L9SA 4A0XA 4RBOA 1PUZA 3ZOBA 3TDUC 2F3NA 2MC3A 2VKQA 2E7XA 3HB9A 4J9OA 1LKXA 4HEA2 4J9MA 1QZYA 2C2DA 3VOEA 1R4NB 3DKWA 3N4MA 3SFZA 4PL2A 4RQ8A 2CUJA 4V2GA 4F55A 4U7DA 1ZQBA 5M3FJ 1MIJA 1JUMA 4UB6U 9ICBA 1B22A 2KFNA 1ZD5A 3BDPA 8ICXA 3N97B 4CYCB 3B0YA 2QYOA 3RB0A 1Z91A 2KIMA 1S5LU 4P9FA 4FE7A 3JPTA 2HQNA 3V7JA 7ICLA 4DLEA 1H9TA 4Y2UA 5J0YA 4BH9A 4F3QA 4DQ2A 5AKGA 4RM2A 3GTKJ 2W43A 1RPWA 2IGMA 2V4JC 3OS0A 2E3TA 5ICCA 3DPLC 1FP1D 4AIKA 3RRHA 2KNJA 5EGOB 4J00A 2XB5A 3G1MA 1NK3P 3JPQA 1LDKB 3MZYA 7ICMA 4RAYA 1N77A 1VQNI 2M7BA 1V4RA 4FX0A 2FQ4A 3QU7A 3MGVA 4Q47A 1SMTA 9ICRA 2XI9A 2LH9A 3C3WA 3Q0WA 4DW6A 3KZYA 4C2UA 1UHSA 4B09A 1K7AA 2M5WA 3D0SA 3DU5A 4RM3A 3GILA 4ESBA 1P92A 4C8NA 4C4TA 3TAPA 1XDSA 4ESFA 2MSNA 5DDGA 3ABUA 3RZDJ 1TW2A 1H9GA 3PQKA 3QEAZ 1T98A 4IC9A 2V1UA 1E3PA 3WK5A 2OAZA 4JX5A 2H8RA 1L0OC 1YOVB 5IOYA 1IXRA 5HDKA 1K78A 1E0EA 1L3LA 1O3SA 2KVSA 1KQ9A 2OA4A 1EXNA 4ICAA 3AG1H 1SC7A 1I1SA 4PCQA 4P4OA 2E1OA 1XGSA 1WHUA 3TQ1A 1FIAA 1J7KA 1QHGA 1KZHA 1GO3F 3I4NJ 2ZIUA 4I2DA 4UB2A 4UB6C 4PHDA 4XLFA 4CCLA 4M3FA 4FT8A 1TQIA 4MTDA 2PI5A 3WKDA 4D0PA 5CVUA 4Z6CA 5AI4A 4IRHA 4E6KG 2KV2A 3M4OJ 4AVPA 2WY7Q 1UCRA 3HKZN 5B3SH 2OM6A 1R71A 1ZQEA 2ELJA 1IN5A 2A6HF 5ALRA 3EZ5A 3EPGA 2DMNA 1SZPA 4J9NA 1SFXA 4DBQA 3ZQLA 3H4DA 2KFZA 2FMQA 4MNUA 4DQSA 2WAQN 2M1BA 5F64A 1OCCH 4L5IA 3MDCA 1RZ4A 5D4BA 4DSKA 3HJEA 5E18F 4RB1A 1MJBA 3QU5A 2XVCA 2ESHA 2QQAA 4I09A 4I02A 2DA6A 3OYFA 2W7NA 2FRHA 3K2AA 5FJ8J 3W2AA 2CS3A 3UMGA 2HOIA 2EH3A 4JBAA 4HDVA 1TC3C 3H5RA 1TV9A 3R61A 5KT6A 5AM2A 1L7MA 9ICKA 3G6EI 5KFAA 4FISA 2ZJ2A 1TBXA 9ICGA 2HOTA 1RUNA 3RIRA 1HF0A 2ES6A 1G8XA 1KRPA 1Y0NA 3FXLA 5J8YC 5DQGA 3JR9A 1Z67A 1D1BA 3QPSA 3J81K 3BDDA 4ENMA 2QF7A 2KJ8A 3TKAA 3VB2A 1JE8A 4RPZA 5LGNA 4ZH4F 1S3JA 2JVGA 4LLNA 2R7UA 1COOA 5DV5A 4O3MA 2EH9A 3N28A 3THVA 2FJ6A 4JWNA 4K4GA 3CJTB 3M07A 2IGNA 5AI6A 4IR9A 1YZ6A 3RJEA 4XOTA 3IUOA 4R1HA 1TLHB 1D5YA 1I5ZA 3CC4I 1WG8A 4XRSA 2XIDA 1DUXC 4RQNA 1LEAA 1GV2A 1QVUA 2RREA 2JRZA 3QYFA 4NLNA 2VXDA 3FXJA 4ACOA 4QWBA 1ETQA 5FO5A 3EDPA 1ETYA 2XAJA 1DP7P 3AG2H 2TDXA 3GTPJ 3JCUC 2CUFA 3IRUA 3U26A 2RN7A 5HNFA 4P96A 3PUFA 3CCUI 1KSPA 5DLFA 3JRDA 1OPCA 2HBJA 3GBGA 3F21A 5FKLA 5F04A 4CCMA 2G06A 1GXPA 2EA2A 4M71A 1BPBA 2BW3A 3ISBA 4OJ5A 3OSGA 4QWEA 5D6FA 1SV0A 2CRXA 2EB7A 2HOEA 3BPVA 4YEJA 4X6AJ 1L7NA 5G5HA 2A6TA 1VQMI 4CF4A 1QNTA 4OU0A 1PVPA 4N0BA 1WH5A 4G7ZF 2EZYA 3MC1A 2OU2A 3AQFA 1D8BA 1FJLA 2RC4A 3MKYB 3S16J 4ECQA 2XGCA 2C28A 2Y0MA 1KW4A 1XNSA 4R8HA 2IS6A 1TVAA 2K4JA 1WCMJ 2IP2A 3HOZJ 1JXSA 1VQ8I 1DGWY 3VODA 2BV6A 4LVSA 3H5NA 4OJOA 1Z7LA 3RH4A 2FMYA 3SAFA 9ICXA 1TWGJ 1RM6C 2W82A 1W4MA 5C4JJ 2CSOA 1TWFJ 1ZQIA 2HBLA 1W7PA 2LMDA 2PMUA 1YS7A 3P9KA 3K4CA 1ZETA 2DI3A 1TAQA 2CN1A 4RUAA 1TAMA 2VUMJ 4FZMA 3CDHA 5J2AA 3WKCA 4BACA 2H3VA 2W7PA 1JALA 3RB3A 4U7BA 4DSIA 4E0DA 5KFDA 3PIOF 3MAJA 3PSIA 1KONA 1ITYA 4DJAA 4PGQA 2IS2A 3W3CA 2RGVA 1WCNA 2C22A 1D9DA 2ZIUB 3LAPA 2LKYA 1O7FA 2C6YA 4XRFA 2VA8A 5AK5A 2M2EA 2P5VA 1FIQA 3S1NJ 4UAYA 4DLGA 4EVIA 5IY5H 2V9PA 2VOPA 4B3XA 1OCRH 5KFGA 5L1IA 2P6TA 2LDUA 5ALKA 2HVRA 2IS4A 2H3ZA 2Q1ZB 5CJ7A 3LMMA 4BEHA 2FPLA 3BC8A 2XIGA 2EFNA 3E5XA 4NC7A 4PHAA 1NK4A 3PW4A 2Z7JA 1UG2A 4QJFB 3TDZC 4C3HJ 2QA4I 2WF7A 4YG2A 9ICJA 2LG4A 2NS0A 1G6NA 4CHUA 3V7CA 1IN7A 4BHCA 3F5EA 3DTIA 2XRNA 4Y33A 5K7HA 2MUTB 1I27A 3B6CA 3WKAA 1YHQI 2ZIXA 1V5FA 4AD9A 2QENA 5DM6F 3JTHA 3RI4A 2QCOA 1PUFB 3HPHA 3P7NA 2QB1A 5J2DA 2KTQA 2ECCA 1DQUA 5BNGA 3J80K 1BN5A 4A3IJ 2FI1A 1YFHA 4BXUA 1TTYA 3I58A 3KEYA 4FFDA 2DGZA 3AU6A 3CRXA 1IV8A 3LSRA 3OR2C 3CC2I 2MH2A 3L2VA 2RQPA 4QNLA 5ILUA 1Z4OA 1I6XA 1IO2A 2DK5A 5HP4A 2VQLA 2KSOA 2BPCA 2NXNB 3LFUA 1YRNA 3KHGA 2Y2ZA 1WJDA 3KE2A 2B9SA 2RRDA 3Q9SA 3RTVA 5T14A 8ICMA 4UV8A 3PQJA 3S3OA 1A6QA 4NNJA 2DBYA 4WK8F 2BPGA 1UCVA 1P2FA 1Z00A 1MDMB 4RU9A 3PVXA 3GW2A 2KJBA 2HHVA 5KT2A 2E2IJ 4UUVA 3BG7A 1F5SA 2E5SA 2TCTA 4XRHA 2DMPA 4EBEA 2K9LA 3RJIA 1AROP 2L9RA 4FETA 2CW7A 1U5TA 2P35A 3H0RB 1YYVA 3CP2A 4BNCA 1DU6A 5KAFC 2NAZA 1D0YA 4F4XA 4NM1A 4Y2PA 2XY7A 3OSPA 4I2FA 1V85A 2VBZA 1GXQA 3FYHA 1U49A 2V1NA 4IOAF 3ED5A 5KNIA 2N1RA 4XONA 3F2CA 5DCMA 2G0AA 4I2HA 4P0PA 3GVAA 3M8RA 1LVKA 2HDWA 3L4PA 2ZUDA 1RR7A 3OV8A 5IIOA 4M6WB 3B6AA 3DTEA 1FT9A 2HHSA 4CCHA 2RLTA 2DN0A 1QVTA 1BOBA 5DGAA 3G71I 3HOWJ 3RCOA 2KG5A 3MFIA 4JK1A 5J1YA 3UR3C 1SWVA 2CQNA 1WZ2A 1IRXA 2JZBA 4F91B 1YJNI 3TADC 1NK8A 4DWIA 9ICHA 3ABMH 2A1JA 4ED0A 1U5TC 2UVRA 4N4NB 5L3BA 2NS7A 4QLCU 2O6KA 1S7AA 1A0PA 2KKVA 2W9CA 5HODA 3MFKA 1XSNA 5KFZA 1N48A 2HQRA 1CGPA 2NS8A 4BJQA 2P8TA 2YU9J 2R7FA 4F2RA 3IRRA 3HL2A 2KZ3A 4IHYA 2PFQA 4RAFA 2IA1A 3QZ8A 8ICNA 1KQ8A 1UQVA 4YFXF 2LBFA 2L9NA 2M87A 2NRWA 1ZQFA 3SEIA 1RG6A 2KIVA 4HV5A 4MQ9F 1S72I 2JA6J 4C7YA 2W24A 1MMAA 3FXOA 1BI2A 2W57A 3GWZA 4XBFA 4O3PA 3OSFA 1N62A 1MQ2A 4MEXA 5HS7A 4OO1J 1FBSA 1J75A 4ED3A 2K7LA 1DPUA 1X1PA 1PK1B 5BQTA 3K4GA 1BBYA 5EE9A 1WI9A 2A5WA 4UATA 2KP6A 1S9FA 2GXBA 2DFIA 3C2LA 2DQLA 8ICAA 3E1SA 4RGSA 5LHGA 1VQLI 2JGAA 2W9CB 1FSEA 4IVNA 4A6DA 1G3YA 1BPEA 9ICQA 3B0XA 3PX6A 4QSHA 3L2QA 5TJJA 1MZBA 3CCJI 4DOAA 2HEOA 2F8KA 2L7MP 4IL6U 3PV8A 1KA8A 4D7MA 1ZQWA 2HHUA 5J0QA 3S32A 3I76A 2HFHA 2AGQA 4CE6A 3RAXA 3L5KA 4RNMA 4BHBA 1HEKA 1PUFA 3OJSA 2RDIA 2F5EA 3FMQA 3TOBA 3BZCA 2KMDA 3ZQGA 3I0TA 4KLLA 2TRTA 1S0VA 2AXLA 4I01A 3A0BC 5CYVA 5EWEA 4MGRA 4QIWN 5AIQA 5J2EA 4KLJA 4ECZA 3KOOA 4QWCA 1BNPA 4YMOA 2JSPA 3H3ZA 3K4BA 5E79C 4WX9A 2BXZA 3EUAA 1X66A 4HNVA 2W3SA 2DT5A 1SFKA 4KT5C 4DFJA 4HX7A 1ONVA 2L4MA 4XR6A 3GLXA 4JYKA 2VC0A 2VQHA 4DYCA 2R92J 2KSOB 2Y0SC 2E60A 1ZELA 1T38A 3M9OB 1SXEA 4MEYF 2CUZA 3R0JA 7ICRA 5ALUA 2LVSA 2LYHA 1L7PA 1FTZA 2STWA 4QZAA 4DSJA 3ZQFA 2YX8A 2FSWA 1G4DA 1R5HA 3TKYA 3IV5A 3AG4H 2JEIA 3I54A 2E71A 5FP0A 3MKZA 4UASA 2HXOA 4JQFA 5H20A 4B9SA 5CPRB 1U48A 1WQ2A 2M34A 4BXXJ 1H8AC 1XB4A 5ALDA 3MGHA 2XPVA 4IKFA 2WAFA 3KHHA 4XSZF 3UMBA 1SL0A 2DWQA 2BR0A 8ICUA 1QA6A 5E3OA 3GZ5A 1X6IA 5HOOA 3M6KA 2Q2EB 2KRHA 2BDPA 1UELB 3TFSA 4Q8EA 2W04A 2Z5UA 1ED1A 4P1WA 1NTCA 4RLFA 1L3VA 3LQRA 1Z4NA 3OYBA 2CQQA 2KJ9A 2H6CA 1KGSA 1EKEA 1I6HJ 1S0MA 3NVZA 1HLVA 4I2BA 5IPAA 1MQ3A 1ZYQA 1LKYB 1X9SA 1HC8A 1BL0A 4UBCA 2OCEA 1J09A 3EW9A 3TP0A 4QZCA 3FM5A 3LDAA 3H0DA 3HOYJ 1FYMA 3PO3J 4B9VA 1REPC 5EZHA 1WWXA 3C5FA 1NH3A 2O0YA 2LRDA 3JAMZ 3S2WA 5KVRA 5M5WJ 4TUSA 2VKVA 1JGSA 3FXMA 1SV0C 4A69C 2XVTA 3FX3A 4H4KC 3N7SC 4TQRA 2WBMA 2YY6A 4IRCA 1JJ6C 3NRVA 2K8BB 5EEGA 3T8TA 1TT0A 3BP8A 2CGPA 1VQOI 4P0QB 1W36D 4BBSJ 3NASA 3VSKA 1RI7A 4K4HA 4PSXA 5AK3A 3ISPA 2VPRA 4I0AA 3PIPF 4ECSA 1L3TA 5D6EA 3QU3A 1OJLA 1KU2A 1DOQA 4R8UA 3WK4A 3ZD9A 3G6YA 3QE9Y 2A61A 4KLFA 4ZYHA 3BS5B 2ZBKA 4UVAA 3ERMA 4UB8U 1NK7A 3O8HA 4Q43A 5A2QZ 5L1KA 1MSEC 2F77X 3ECOA 1W5TA 2OZUA 3BQZA 2JR5A 2Q4TA 2DA5A 4QIWF 3ZMSA 1ETOA 1C20A 3GDXA 4S05A 1B72B 5AM1A 5KT4A 4DL7A 3IRQA 3UMCA 2AHQA 5KG5A 4FO6A 5J2HA 4ED2A 3H92A 3OYNA 3K1RB 3CMAI 5HHHA 1R9TJ 3GIMA 2MH9A 5FFZA 5FRNA 3SDGA 1JXEA 2BHNA 1KQQA 4P0QA 3FKJA 3DQVC 1P7JA 1SVOA 1ZAOA 2YMPA 1ZN2A 3A0HC 3SYTA 2CV1A 1KFTA 3GFKB 2V6CA 2LHTA 2PMHA 2XAUA 1AA7A 2IGKA 5JRTA 3HPOA 1PK3A 4JMUA 1SD4A 2F4MB 3OYCA 4Z6YA 1JHFA 2CU7A 4RNOA 4FZNA 2K9QA 2K4HA 3NGDA 4RQ3A 2D6FC 4A0YA 2ZJ8A 2CMPA 2COMA 3EUKL 3QQAA 3F23A 3L09A 5J8CA 4DQQA 5ICEA 2K4EA 1D9FA 4XLEA 1RR8C 5HMMA 3V8LA 3AL0C 1ENHA 2A07F 3CF5F 3T79A 3K4NA 4HX4A 2G08A 1ZQAA 5JLXA 1MSFC 4ECUA 3CDLA 4U87A 2NRXA 3BJOA 4OMYA 4XOPA 5DB8A 1VF9A 4I2JA 3HKZC 2LF8A 3W6JB 2NO4A 1ZKGA 2DKZA 4RB2C 3IWZA 2DQRA 3CC7I 3LFKA 2ZXWH 3BTIA 4PJJA 3DTKA 5LGUA 2O61A 1DPRA 1D8JA 3S3NA 4XKCA 5F08A 5GADJ 3VDXA 4RA2A 1A31A 2DODA 2F5FA 4UVCA 1YJ9I 2VE9A 1U78A 4C8LA 5DTDA 3GTGJ 3SYZA 3F8CA 1N61A 2Y9ZA 3VWBA 5EG0A 3RKYA 3E7LA 3WG7H 2EDUA 2FE9A 2HVSA 3OYDA 2XV4S 3GUDA 3FIWA 4WCGA 3TW7A 3E6MA 3OL3A 3T5JA 1FFVA 3WGGA 4PZNA 4YD2A 2Y9UA 4TQSA 5ALNA 5KFVA 1X2MA 3MGIA 5KTQA 2EZKA 2Y1IA 1IUFA 3K4KA 3WTSC 3JTGA 1J97A 1LDDA 5J6XA 1WJFA 2HOFA 3M8JA 4ANJA 5LEKA 2Y0SN 4EM1A 2ME6A 5M5XJ 4NWIA 1PVEA 4RGXA 2VJJA 2A5YB 4QPOA 2JMGA 1FEZA 1HKQA 2QQ9A 3FHNA 3HKZA 5FD6A 3HGGA 4FTHA 2RQ5A 1JI8A 2WF8A 2W9BA 4F92B 5AI0A 2DXIA 4LLGF 4R79A 2EWNA 2E8PA 2M4KA 2N8GA 4ON0A 2BZTA 2HCFA 2DOAA 3CJRB 3RKQA 3P9IA 2Z3YA 4BY7J 5ALXA 3S2HJ 5J8YA 3GYHX 2DTRA 1ZQRA 3RBEA 4AYBN 4G94A 2KZMA 3ICXA 5ALSA 1X40A 1BOAA 5F27A 5KT5A 3CQZJ 5D49A 3V6JA 3OYKA 5KAIU 1BJZA 2DMTA 4D9JA 3MABA 1TQMA 2DKXA 5K5OA 2LBOA 1YX3A 4US8A 3SI8A 3ZP5A 4KLDA 8ICOA 3PW0A 3LAJA 2AU0A 1C7YA 2E5ZA 4KMFA 5DG7A 2ECBA 3K0LA 2OYYA 1QPMA 2JRMA 2VA2A 2HS5A 3K70D 2YB1A 4ECXA 5DGBA 4D5CA 4A3DJ 1ZGWA 1WJAA 4OIQF 2KRCA 3GFIA 2LP0A 1T95A 1ZG5A 4Z6DA 2F1IA 5KFNA 3KP5A 3F8NA 2HKOA 2O8KA 3BG6A 3G4SI 1UFMA 3I4MJ 1T7PA 5F0CA 2OV7A 4HW0A 1SIJA 4I27A 9ICOA 3B02A 2L3DA 2G5HB 1JUSA 4BUPA 5AICA 2V9KA 3CP8A 1F9NA 4DL2A 4MF2A 4ZDPA 1A5JA 3HW8A 5EF6A 5ALFA 1UG0A 4RQ5A 1RNLA 5CQEA 4Q8FA 4DL3A 2ZB9A 2EV5A 5AM0A 2VJ5A 3GTOJ 3M1YA 3RPUA 1HW5A 4NLBA 1N5WA 3HUGA 2X1CA 5C4XJ 3DF8A 2YX4A 3IG8A 2W4SA 2GWSA 1IXRC 4M6YA 5IOZA 3KZZA 4KX3A 2VBWA 2XKPA 5D5XB 1HW2A 1ZTRA 1ZQMA 7ICNA 3GV8B 5A2QK 2KD1A 1HSJA 3QUCA 3U9GA 5DG9A 2IOHA 2YX7A 5IT9Z 4IRIA 5AK6A 2DA4A 2XAGA 2EZZA 2K5CA 2RAEA 4XLAA 3RYRA 3OYLA 5HMLA 5KFTA 1NZBA 2HTJA 1HUOA 1PDNC 2WHEA 1L8OA 2HDCA 5ALYA 3KZXA 3DKYA 3HM5A 2R8IA 3WU0A 5EGOA 1ZR2A 1SAUA 4DNCA 1W36C 2XGQA 1ZQZA 3ASNH 2W9AA 2QZ8A 3BTCA 3H0GJ 3F8FA 2K60A 3HRSA 1QTMA 1N63A 4JV1A 4ZYGA 1MBJA 1XMXA 3Q9VA 1U4BA 4KLGA 5ALHA 2K40A 2JEFA 3ERED 1KFDA 1BPDA 2MA1A 4TURA 4RB3C 1XSXA 2NYXA 5LRSA 1HSTA 1FOKA 3E0FA 2DJNA 4IX7A 1JROA 4DCCA 1S10A 4X5VA 3NWTA 5GTHC 1WWVA 1TT5B 4FE4A 4UB8C 4IHSA 3SQNA 5KFJA 2VANA 4Z6EA 5J0RA 1O08A 4M74A 3M3YJ 3OYJA 3ECHA 2A69F 3D5RC 3M9AA 2B0CA 1LVAA 4I7HA 4D1QA 1GHCA 2ODGA 3FHZA 2P81A 3J7AY 4OD0A 4MTEA 1B1BA 1WYGA 1P7DA 1LQ1A 4F52A 1ZQPA 4J9KA 1QGPA 2RV8A 5HLTA 4CICA 2IT0A 4IQVA 5KFCA 3ZMVA 1Z6RA 3G2BA 4U7CA 4AVZA 4GC6A 3DPUA 1XCBA 2JPCA 1DU0A 4Z2YA 4YRVA 1RXVA 2M30A 1QH9A 4HRIA 2BGWA 3WHCA 4BE2A 4I2IA 2Y0SA 1JIHA 1MH4A 4X0GA 1KL9A 2QBYB 4O3OA 3SD7A 2FLNA 3VCBA 3FBIB 4EX7A 1STZA 3ZQQA 3PO2J 2NRZA 4R66A 3ZD8A 2VJIA 1O4XA 2W3RA 3BTLA 2V26A 3HYIA 2YB4A 5KFUA 3PSTA 1U45A 3LSTA 3QPLA 3AEVA 5IT3A 3PSPA 5KL8B 2CFXA 3K9TA 3K1ZA 2CW0F 3RR8A 4XLCA 2D3DA 2BDUA 2ZIVB 3KZIC 3W6KB 4C4SA 2ZJQF 4IF4A 2XGDA 3VYTB 2KHVA 1GV5A 1AU7A 4UW9A 4J9SA 2A05A 2FLPA 1M1EB 2HU9A 3DV9A 1MMNA 3L00A 2VL8A 2MAXA 3SFIA 4YXMA 3V8KA 5J1RA 1F1ZA 2HHWA 1ZLJA 2FNPA 1TNSA 2ISYA 1OCOH 4XLPF 4IZZA 1K61A 4KIFA 4DQIA 1ZJNA 2WAEA 4NUBA 2XUBA 3KYDB 3E0JB 2B7EA 2EV6A 2L5YA 2A19A 2ASLA 3HC7A 1ZH5A 2GQQA 2OF7A 2ZTCA 4G9YA 4ZYDA 2AQEA 3D1NI 3W6VA 3WTYC 4U0VA 5FRMA 2JWTA 4S0HB 1SV4A 4K4IA 3MCZA 1S77D 2HMXA 2KP7A 2BGCA 4E7LA 1SZHA 2BY3A 4ECTA 4BBRJ 1JT6A 2MC4A 3RJKA 1T0FC 3F72A 5D8KB 3IL2A 3KBBA 3PY8A 1ZQCA 1TAUA 3N05A 3P9CA 2QM3A 1VQ4I 4XORA 3FKIJ 3K6GA 4G12A 1XS9A 5EYRA 5J2FA 5L3CA 2VODA 2X6WA 2AO9A 5TISC 3JSPA 5ALLA 1UHUA 3B73A 4BYYA 3TL4X 1NOMA 1I1GA 2NO5A 1R00A 4G8XA 4L18B 2LYBA 3E3VA 3OHAA 3V72A 4BE0A 3BQ0A 2NRTA 2E1EA 3GO5A 2W8KA 3WE2A 4WXCA 3Q8QB 1X1AA 1Y88A 2P5KA 3RJPA 5L1JA 3QPHA 2ZUCA 2DMUA 1BI1A 4BGDA 1GVDA 4KN4A 3TADA 4OAZA 4CCKA 2ASDA 9ICUA 2IGOA 2MGQA 3PSFA 3OYIA 2ISZA 5J1UA 7ICSA 3RKXA 2XSDC 3AKZA 1SGGA 4IHXA 4BHPA 2EZXA 4F5RA 3T5LA 2D45A 4IL6C 3HRUA 2QEXI 1A6SA 3HKZF 2QVOA 5M3MJ 5LFAA 2ASJA 1ZQDA 2GIVA 1BI3A 2XROA 2EAPA 4KIBA 1S76D 1L6NA 1S5LC 2F48A 1Y1VJ 1ECWA 1X9XA 2DOFA 2NRVA 4OCZA 5ERIA 1IM4A 1DK2A 2QGUA 1BW6A 1IN8A 3JAMK 2LR8A 8ICPA 2MFZA 4YG2F 3KIOA 2ESNA 3MKLA 4E4HA 1VI0A 2LF7A 3M1CA 1FYLA 1L7OA 2KZVA 5DDMA 4EEFG 2RDJA 1T3NA 4DS5A 2MRLA 2DLLA 4IXAA 3M8FA 2KJ5A 3BROA 4ASNA 3COAC 3S15J 5DDYA 5KG2A 4F7ZA 1O3TA 4KYWA 2AJQA 3C21A 3VPRA 1QQ5A 3UPQA 1YRNB 3C1ZA 2ZSIB 3QUBA 5ALEA 9ICFA 1M6YA 1QSYA 2I6XA 3L2WA 1P7IA 1RUOA 3OWTA 2XHKA 1YJWI 3V7SA 4G7OF 4QWAA 5GAEJ 2QLZA 1FO4A 2DDAA 2VT3A 4UUTA 4CH7A 1T2KA 3A02A 3SHFA 2ATLA 3SV4A 3Q8SB 5J4YA 5JVTA 1IDZA 3R6SA 2AGPA 2JRTA 1WGXA 1FFUA 2E1FA 4V19K 1ZOLA 3VEPA 1D1CA 1FWZA 3BQYA 1SMYF 2I5UA 4RQ7A 2BY2A 4UUSB 2IA6A 4LG0A 4ECRA 3CUOA 3NUQA 4B47A 5J0TA 1FNNA 2DPJA 3J7YJ 2EZLA 5E8GA 3RPUD 3A4CA 3WTWC 4UAUA 2JZBB 1NK9A 2I5HA 2BYVE 3SAHA 2A1JB 3TACB 1ZQXA 2CJJA 3IWFA 4M9NA 1E2XA 5J4VA 4YR0A 1UHMA 2KHMA 1XO0A 4YMMA 8ICZA 1DP3A 2PJRB 1X58A 4WXDA 4QPQA 2DW4A 1O3QA 2V4RA 8ICWA 4F71A 9ICMA 4UY8I 2DA7A 4B9LA 3TARA 1CUKA 3QYBA 5IILA 1OFCX 3AUOA 1MC8A 4A8EA 2PMZN 3TAQA 3MR2A 1XSPA 3MKWB 2NVYJ 3FM3A 3U1DA 1EF4A 1EH6A 4M9XA 4HBLA 1ZRFA 1IXCA 4EGZA 3JPRA 3M7GA 4A3MJ 2KN7A 1X4OA 3TOAA 1X3WB 1S6LA 3BR3A 5BPIA 5GP9A 1IV6A 3H4BA 4F4YA 2JEGA 3MQ0A 5J47A 1UB9A 1ZREA 5DB6A 3N7RC 1O3RA 3PO4A 1TWAJ 3CESA 2CV2A 1NK2P 3DEEA 4P5OA 3HGYA 3NEUA 4RPYA 3G3ZA 1MBKA 4Y2TA 4PJ0C 5FROA 1GDTA 4CNQA 2IVMA 1Z3YA 3PM1A 3I55I 1Z00B 4B9UA 4KLHA 5J0SA 4LB6B 1MNMC 2LFBA 3SAGA 1U9OA 2ZNZA 4QZFA 2O6GE 1HKTA 4C8MA 1LVHA 3L7WA 1A6IA 2DOEA 4HA8A 1VQPI 4KJZA 2AGOA 2HBKA 3V6KA 4ZZLA 1LEBA 1NNLA 1TP4A 2W00A 4LITA 1MNDA 5DD4A 1NJYA 1FEXA 3IHQB 4I0BA 3WTZA 1ZQKA 3V42A 5DM7F 3QRFF 4I2EA 2G9WA 5F0HA 4GIBA 5KFMA 3ZQIA 1SXDA 5JI6A 3GTQJ 3J81j 4DL4A 3UQ0A 3Q8RB 4J01A 3BQ2A 5KT3A 4HPQA 4UB5A 2FMLA 3FF5A 3TO7A 2BQ3A 3BQTA 4IHWA 1Q1HA 2EAOA 1YIOA 4CSWA 2IXSA 3H8WA 2ZG6A 2VKHA 3HPGA 4CYDA 1F5TA 1MGTA 1SWWA 4C2TA 3WTVC 2WTEA 4B9NA 3UKGA 1HXDA 4UAWA 4LGWA 4BS9A 1KTQA 5K7ZA 2GOLA 8ICTA 4IOCF 3H9GA 1FYKA 3CCYA 4AYBF 5HHIA 3N4MB 4M0AA 5K1YA 2F1JA 2H1LA 2HHXA 2GOXB 1BR1A 1KYZA 2JMWA 3CCMI 2W11A 3BJAA 1FTTA 8ICEA 4BU2A 1VQ9I 4Q5SF 4P2HA 4M2YA 3TP3A 2KHQA 2DT7B 2W03A 3IKVA 2VIXA 3ASOH 1E3HA 3GEZA 2CWEA 1HDDC 1HA8A 1BI0A 1LE8A 1HIWA 3VC8A 5GPCA 3MDAA 5L3EA 2FBHA 3GQCA 1H38A 2KOBA 1NG7A 4M73A 2R7OA 2LBFB 3SEQA 4QW9A 3X2QH 1T3QA 1ZRMA 3BQ7A 2M9NA 4EBCA 3OSNA 3TQNA 1NKBA 4BJ6C 4M47A 3DBHB 1OR7C 3QOPA 3Q5FA 5DQHA 2G0EA 1Z1VA 3H35A 2K4PA 3GTMJ 5KFRA 4DSLA 2KK0A 4XN0A 3RFAA 1CQTA 3ZI4A 2DAOA 1BW5A 2BCUA 1FOXA 2H5XA 3S6JA 2DTZA 4HAIA 4N4OB 5IYDJ 4F2SA 4PPXA 2VLAA 3ETLA 4DSEA 1XC9A 2JVHA 1Z77A 4PDKA 2H1KA 3JPPA 2PFPA 2PI0A 3QU4A 5CWRA 1SEUA 5E17F 2W54A 1VQ5I 5KG7A 4P4MA 2DU9A 2KDOA 4AYBA 2MA3A 4XRMA 2YMQA 1UHWA 2D2WA 3DLLF 3FK6A 3GTLJ 4XLNF 3B9JA 4F72A 1TK5A 2R4GA 2RKHA 1RKTA 3K1PA 1TFRA 1B43A 5LD2C 4HOBA 5CA7A 3UQ2A 4LIVA 3Q8PB 2HPIA 4AIJA 4F50A 4O9MA 1H88C 2DFHA 2W84A 1R7JA 4YD1A 1UMQA 3OIOA 5HS9A 1JKQC 3OTQA 2XCPA 5EE0A 4U0WA 2P0WA 2JXJA 3JRAA 2OTJI 3VYUB 2EFPA 2C2EA 1OYYA 4YIIA 5KFFA 3MEXA 1SD5A 3HOTA 1DK3A 3V7LA 1IAWA 4CF5A 3JPOA 2F5CA 1IGNA 2LKPA 1QQIA 3G1OA 1NG6A 2DMQA 3FXKA 2NVQJ 2E7WA 1NK6A 4HAMA 7ICTA 2Q8KA 1X42A 1WJCA 2ZTEA 1MW7A 1OYWA 3BS5A 2XCAA 1T94A 1ZRNA 1W5CC 4USAA 4DO9A 4M9HA 1WJEA 3RYPA 1Z19A 1XMAA 1B8IA 2R7DA 5CVRA 3OYHA 1VTNC 4LJXA 4NC6A 5AI8A 2UXNA 7ICEA 1T8IA 2PG4A 2F4OB 4AM3A 2HGCA 1DXSA 4ECVA 1NJWA 3DEWA 5LBQA 4A3FJ 4DSFA 2QUFA 4DQPA 1JKOC 3QUQA 1RZTA 4XL9A 1WJBA 3ZGKA 3TANA 1AKHA 2C2RA 2CW8A 3RKWA 1ZQVA 2LYAA 2AQ4A 4QWDA 1SKSA 3DBLB 4B48A 5HLIA 2KPMA 4RMNA 2XC7A 2H27A 2AHOB 4PL1A 4F4WA 1FOYA 1UA1A 1NKEA 3K4LA 3P5JA 4CUGA 2LMRA 2K86A 2W7OA 1EH7A 2RDPA 2OUMA 1KBUA 4R63A 3HOSA 3E5UA 5AK4A 3WHBA 2GXAA 7ICPA 3QP6A 3K70C 2QSFX 2JA5J 1LKYA 2OH2A 3FDYA 2BQRA 2GBYA 4G7HF 4RQ6A 3JRIA 3BPXA 4QZ8A 4XN3A 2Y30A 2XGEA 4YXJA 4RNNA 2O8XA 4RQ1A 3MD2A 2W48A 5J8FA 5FLVA 3ABKH 2LC2A 1LPQA 2FX0A 2M3AA 3LSJA 5E8IA 2YSRA 2AXTU 1WRJA 5CJ9A 5EOZA 2Y1JA 3Q8MA 1G3WA 3CCVI 2IOFK 2IBDA 4Z6FA 4MF8A 2HHTA 1HDPA 1WFXA 2L7FP 2QQ8A 3F8MA 1BA5A 4DFDA 4GDFA 3PZPA 2F4IA 3GIIA 4OJ6A 4CRXA 1X1DA 3S8PA 4RB0A 5DD8A 4YQWA 1C0WA 2LY1A 1B9MA 8ICLA 9ANTA 1LB2B 4MO7A 2FXAA 2PFOA 4JV2A 4K2EA 1D5VA 4DF4A 1RDFA 3ABLH 2R5YB 2PFNA 2HW3A 2M0MA 8ICJA 2HQ5A 2OZ6A 1QPIA 1K1QA 2K8CB 4YELA 4UB4A 4EYHB 1X1BA 4W1UA 1IC8A 2BXYA 4A0ZA 3FMRA 1K78B 5KFOA 2W9MA 1XSVA 1J59A 2DFEA 1ETXA 2IJLA 3T0YA 4HQMA 2HWVA 4KFCA 2KQRA 4C9YA 4FS1A 2CQXA 5B1BH 3L2CA 5BMZA 2FOKA 4OJPA 4DGWB 3R9KA 4PHPA 2Y75A 4QZDA 9ICSA 5JUMA 3RJGA 3PX4A 3S14J 7ICQA 2FLLA 3JSOA 1UAAA 1S9HA 3CLQA 2K9SA 2R8JA 2VC1A 3OYMA 2DPIA 5CLSA 1ZGAA 3ABTA 5EZGA 5HNHA 1GVJA 1ODDA 2XASA 1P4XA 2Z16A 3E6DA 3GMEA 4UXNA 2XO7A 4N9IA 4TV7A 3LNQA 3OIQA 4DS4A 1VQKI 1I50J 3JREA 1N60A 5KFHA 1MD0A 3BY6A 3SZTA 2FDRA 3R60A 3EUHC 3HG9A 1OKRA 4Q4ZF 5FLXK 2WB1C 2MD5A 2R18A 2JA7J 2NRAC 2Y9TA 4H0EA 1POGA 2JT1A 4KN7A 4JV0A 2R7RA 4R64A 2ZJPF 3E6BA 4ED1A 2FD5A 2E2HJ 5CR0A 4ZC3A 2CUEA 4NBQA 9ICNA 5KFQA 4NL9A 3HHHA 3LQQA 4KMUX 3ONNA 3VYSB 2VI6A 3SEZA 1COKA 1WH7A 2H09A 2L7ZA 4CCNA 4BDYA 5KCMA 1T4GA 4BDZA 3D6JA 3O3KA 5ALQA 3I53A 2DCEA 3M9NB 5JHUA 1A76A 3E2EA 2HZDA 2LY2A 2WAQC 2Y48A 4ECWA 2X6YA 3HTUA 3IN5A 2ALZA 9ICLA 1HQCA 3BT9A 3OYAA 1ZJMA 3H8JA 2G7HA 3M8EA 2L0KA 4P55A 4G9BA 3OIPA 5KL1B 4OIRF 2ZIVA 3CJNA 5DBAA 3CNHA 3LSIA 3CYMA 2E5NA 1Q1VA 1BM9A 2ZIWB 3H1CA 3CUQA 3KP4A 4O5EA 2ZXJA 1R4MB 3BR2A 7ICKA 1NK0A 4M3BA 3ULQB 3LYSA 2HXIA 2XF5A 3LA3A 4ED8A 5JR3A 1D8LA 2ME0A 4M3GA 2IRFG 5F6FA 2JA8J 3FM9A 3BWGA 3V8JA 3AMZA 2JN6A 4WWCA 2FJ1A 5CP2A 3I64A 2W1OA 3QUTA 2J6SA 2E35A 4MHGA 4MQVA 3IH4A 2QSHX 4MEXF 5KAFU 1N5XA 2XY5A 1MKMA 2R3SA 1QZZA 5FKNA 3CCEI 2E34A 1SVLA 2WF9A 4GC7A 5JLWA 1W5SA 3PO5A 2HOSA 1QLNA 3HXLA 3MR5A 1T33A 3KLOA 3HHGA 2VT2A 5KG0A 4PGYA 3BZ6A 3DKXA 3OPXA 3HEFA 1YW8A 4DZJA 1PP7U 3F2DA 3WK8A 4G3IA 2FOWA 2GA2A 1PZNA 2IS1A 4PZJA 2DYRH 4NL9C 5CB1A 2X9DA 5FD5A 4BQQA 3H8MA 1QSSA 1F0MA 2GLEA 5TISU 2Z33A 1R58A 5ALTA 7ICUA 1D8KA 2MSYA 3QZ7A 8ICCA 2XKOA 5BOMA 2FNAA 2HI0A 4MEYA 5C5JA 2Q0OA 4FASD 3NRZA 2V79A 2YPRA 1U5TB 4B6JA 2R5ZA 2QBYA 5D4SA 4BQNA 3OYEA 4KTQA 4KN7X 2WY8Q 4IPAA 2W25A 1S7OA 2GH1A 2EIMH 3IDWA 1F4KA 5A0LA 3EPIA 1S0NA 2ISPA 1FP2A 2P7CB 4XLHA 3EYYA 3CMEI 5E1ZB 3NWSA 2ID3A 1T08B 4ENKA 3UXOA 4EBDA 3HSEA 3LA2A 2IHNA 1PJRA 5JHFA 3IM1A 5CHGA 2OQRA 3C23A 1NKCA 4RQMA 4Y2VA 3I5UA 1ZLKA 3NRWA 3TI0A 3ZDDA 3C1DA 3LSGA 3IHUA 4EM2A 3A1YA 4ZYAA 2JSCA 3GFLA 1WCLA 1X2IA 3BLYA 3VYRB 4XA5A 5L3FA 1IJWC 1MMSA 3A03A 1HJPA 5EWGA 4QZHA 2NOGA 5IIMA 2BCVA 7ICIA 2PFBA 4YIRX 3KP3A 1S97A 2ZFUA 2FPKA 3H36A 4F5OA 4M9GA 5HLHA 1QQ6A 4U6PA 1WVRA 3ROUA 2IA0A 3QX7A 4U0YA 2P5LC 4M6XA 3RR7A 4LK0F 2COBA 2HI3A 5F0FA 3H3VK 5BOLA 5EE1A 4F5NA 1R5ID 3ZDEA 2KJCA 2LSOA 4A5MA 4LLLA 1JGGA 3T5KA 3KP2A 2E1NA 2JH1A 2ZIXB 2JQ7A 4XKBA 2CPRA 2E8NA 1S7EA 5E3LA 2D1HA 3QPTA 4HNUA 4O0IA 5IYBJ 3F8BA 3D5SC 1X9WA 2V1XA 1DRGA 1BR4A 1Y8RB 3A2KA 4I2AA 2HVQA 3F22A 3OL4A 4EX6A 2FF4A 1ZQHA 2X1EA 1L8LA 1QBJA 3LSPA 2VASA 3F9KA 1EH8A 1ZQJA 2VXZA 1FMVA 1BIBA 1EA3A 5GTHU 2E1MB 4L0ZB 3G1LA 4KLMA 9ICPA 2XAHA 1SKWA 4EZ9A 4L9JA 5AKHA 1TQPA 3PNTA 5FGMA 1ZR4A 3ZDAA 2EIKH 4GCVA 1ON1A 2WB1N 3OOPA 4B4CA 1SL1A 1KDHA 5J2CA 3FXRA 3RPQA 4E7ZA 5FLMJ 1CI4A 4UB1A 3RJHA 4JK1X 2Z2SB 2BHZA 5AIPA 3QU2A 3ZDCA 1XN7A 3T5HA 1RQNA 3C2KA 2MU2A 1O57A 3CUQB 2PJPA 4CZCA 5GTIU 2MBFA 5DS9A 4UAVA 4Y2XA 5B66U 1IRFA 1J0RA 1KEJA 1ZQSA 2UWMA 2IBKA 4C8OA 3K69A 4OWRB 5CVJA 3AU2A 3F53A 3KTQA 2H8WA 2M4GA 4O5VA 3F0CA 5L9XA 4YN4A 1ZQLA 2FU4A 2A3SA 4C80A 2DPUA 1YG2A 3KLNA 5CKTA 2K89A 1XGMA 5FB2A 2NYVA 1V5EA 4NLCA 1FIPA 2FBKA 4NQWB 4RZRA 5J0XA 2ZSHB 2AH5A 4DOCA 2ZMEB 1UZCA 5ALMA 9ICIA 3RJJA 3Q0VA 4PJ0U 1SANA 2M8EA 2QKLB 3NTUA 5ALGA 2O03A 3LSKA 4EEYA 1ETKA 1V3FA 2VOOA 3D5LA 1VDVA 3BOQA 2WB1F 3ALRA 4M04A 1ZQTA 2ZCWA 3LSMA 2QARB 4IQTA 4QWQA 4NV0A 1IF1A 4JUZA 5KG3A 3M9MB 2IHMA 2LYCA 5D8LB 3PFYA 4HSRA 3RB6A 2OTLI 2F76X 3ZXSA 5D5UB 1K6OA 2HDOA 4RQ0A 2EZIA 1W0TA 4GLXA 1KN5A 4KLTA 3SJMA 2HKXA 2FPMA 3KFUF 1TZLA 1IG7A 2PEXA 3IV6A 1CRXA 4I2CA 4QZIA 2R7VA 3FXQA 4PH5A 2R7ZJ 4NQWA 2EZHA 5J0OA 1SD7A 2ZMEA 2M7AA 1WPKA 4HLXA 4FHTA 1X2NA 5H6QA 4C2MJ 4OIOF 1U6GA 2HQAA 5TGTA 4B1RA 1URJA 1Y56A 2LI6A 1D1AA 4HZFA 3ZMZA 1V97A 3KP6A 5DEQA 3S93A 5EJCA 5KHDA 3L2UA 7ICJA 1Y6IA 1A36A 2GAUA 4HV6A 2VQCA 4DOBA 2LREA 5HNKA 1LFBA 3TO9A 1U47A 2L5QA 1PVQA 4MFFA 2R8GA 1SL2A 1XSLA 4R65A 1L5UA 2K3FA 1CEZA 1YIJI 3KP7A 2CYYA 1K4TA 1MJ9A 4BQAA 2GOMA 2J5PA 8ICIA 2ZMEC 2LM4A 1ZYRF 2EQYA 3K2ZA 4LJZF 5J2KA 3V6HA 2A6EF 5K5QA 1OMIA 3JW4A 3TGNA 4B3AA 4J19A 2BCQA 4RLQA 1A77A 4I99C 1P4WA 3F5AA 1KFSA 4CA0A 5DB7A 4YFNF 3J7AO 2PX9A 4YR2A 3G6VA 4IHTA 3PW5A 2F5VA 3TEDA 2K02A 5LEJA 2XDVA 1ON2A 3MZHA 3GV5B 4F3OA 4HLYA 2DYSH 2WA0A 3CCRI 1FX7A 2X85A 2K3PA 3A01A 3CO6C 3OHBA 3OGUA 3NVWA 4DYQA 2HYGD 2GO7A 1NK5A 3S2DJ 5B5EU 4RUCA 5IP9J 3F3XA 4M6WA 1ZGJA 2KKPA 4XQ8A 4Q45A 4ECYA 3H9QA 4Q48A 5GPAA 4WXHA 4V2FA 2JV3A 2XRLA 1OCZH 1U3EM 2DA3A 1LDJA 2KIQA 4M3DA 4Y13A 1ZQOA 4M9JA 8ICVA 2QKMB 1SFUA 4NXZA 4ELUA 2E1MC 2HYJA 5DG8A 3R4KA 5AKZA 5DBBA 4UBBA 2K85A 4RDUA 3HX0A 4NLGA 1V5GA 3PMLA 3I59B 3FK7A 4BWJA 4JX6A 3GZ6A 5KFPA 4YIFA 1WI3A 4I76A 2Q0ZX 3HILA 2LY9A 2KE7A 5F9LA 4W97A 1BIAA 1ERDA 2F6CA 2YN4A 3JRBA 2KDZA 4AIDA 3PW2A 4DYRA 5KFIA 5F9NA 2VN2A 1JJ8C 1Y39A 3EWAA 4YMNA 4B43A 7ICFA 1ORKA 2BOLA 2V9VA 3I1YA 2BHYA 1MN8A 2J5OA 5BPDA 2KIUA 3RZOJ 1YZ7A 4EGYA 1YLFA 4M9ZA 1AOYA 3RTRA 2H94A 1G3TA 1YT3A 4UUSA 1IG6A 2L9VA 1XPXA 3CO7C 2PLYA 3HP6A 2Q2EA 5HR6A 3QEBZ 3CMMA 2I10A 2B21A 4PZOA 8ICYA 5ED4A 2KLOA 5L3DA 2DK8A 3BG5A 4QW8A 2OJED 1ZD2P 4DEZA 3K10A 1IIPA 1R22A 4ED7A 3MFHA 4I2GA 2QB0A 3GZNB 2FMPA 5J2BA 4C3IJ 3JRGA 1ZQUA 5HDNA 5J0WA 3KHRA 2QARA 3S3MA 1J5YA 4UB3A 1ETWA 1RYUA 1KQ0A 3FZVA 5EEHA 2GM4A 4ZTJA 3LWLA 1MDMA 2VBYA 4NJ8A 3C29A 4L5JA 3E97A 3ETRA 3M7DA 3Q3SA 5C44J 1ULYA 1G59A 3H5AA 2J6UA 5IP7J 4XMYA 2EIJH 5KFSA 2HYFA 2L01A 3SQIA 2F2AB 5IIJA 4J03A 4ZH4A 3HWTA 1E3OC 3FISA 4BE1A 1XG1A 2DO7A 2LD5A 4J9RA 4FX4A 5AI5A 3EQLF 5ICFA 4WJ3B 2KZGA 1R6RA 3NVYA 2E19A 2EJRA 2KL4A 3WU2C 5IP6A 2DL0A 2VKDA 4GXIA 5HR7A 1FOWA 1OLTA 4KICA 4C0ZA 3IP4B 4UQGA 4MFEA 4PJMA 3PJRA 5ALPA 1ZD3A 3IKTA 1ZQ1C 2W9BB 2H3FA 4XNFA 4GXJA 1A04A 2FEZA 1YE9A 3OMYA 3H0LB 4KLQA 5AKKA 4HG2A 3BJYA 1IN4A 2FBIA 2GZWA 2PMZC 4F93B 3M1EA 2KIWA 1N75A 2XAFA 5J0PA 3EPZA 1B72A 3AM9A 1D3YA 2L54A 5IYCJ 1OUQA 1FSHA 2DF4B 2STTA 3T3FA 4HYEA 1QRYA 1Q46A 1TKDA 4AC0A 3CJQB 2KICA 4IQUA 2O5RA 3LK9A 4MHVA 3ISDA 2QSGX 8ICFA 3KKAC 2ELKA 2F8LA 1QHHD 4ENNA 4UHTA 3OOUA 3C1YA 1NHAA 1MBFA 5CVIA 4E70A 2A3VA 3ZPLA 1Z1DA 2JA2A 1D0XA 2VJ4A 4PSWA 5LLQA 3KCCA 2D5VA 5G5GA 4DFKA 4CYCA 4HQEA 1XSDA 1CF7B 2Y0SF 1JHHA 3QNMA 1S8NA 2DBBA 3GZFA 4EQQA 3RH6A 1IDYA 1OISA 2OC6A 3NAUA 5K7FA 2AQ0A 5AM5A 1ZQYA 2ADUA 4XK4A 4IQWA 3WTUC 3HDDA 2ACJA 4A3GJ 3W2VA 1B0XA 2DDBA 1YITI 5E1XA 2D8CA 4EV0A 5IT9K 5B5EC 1X6JA 1MMDA 1U9LA 2LK2A 2JPBA 4O3QA 2XC9A 1KU3A 4BUGA 2HPMA 1TWCJ 1J2NA 3WG9A 3KX2A 3QAHA 3KD3A 5ALOA 4UV9A 5AKIA 2CQKA 4MFAA 3FBNB 3H3UA 4IRDA 3O0FA 1BVSA 5CEHA 2F2EA 3K1MA 2KEYA 5DUIA 4QTRA 2G07A 3CD6I 1NZPA 2V9WA 8ICSA 1R1UA 3PNYA 2VA3A 1NJZA 2IPQX 4A2UA 4ED6A 5IIIA 5LRRA 1KU7A 5KK1A 3L2RA 4MIMA 1YW7A 1AQ6A 3ZMTA 2XPWA 3MWMA 2V4QA 1SFEA 3IH2A 4O6JA 4HDUA 2XF6A 4HF1A 1DGJA 1JI7A 2LM1A 3KHLA 4JP0A 3LWFA 4O3NA 1X3UA 5EG0B 2KT0A 3ZCOA 5J2GA 3GU3A 4QZ9A 2UVUA 3I56I 4G6TB 3KEQA 1G2HA 4DF8A 1MJAA 3SR6A 4IS7A 1OXJA 4Q44A 4BXOB 3GLLA 4MFDA 3QU6A 2YUSA 4CZZA 3G73A 2DJIA 4KN4X 3E58A 3DPTA 1X1CA 1B9NA 4DFPA 1ZARA 4LZGA 2EBIA 3C18A 3RQIA 4A3JJ 1O03A 3OYGA 1U8BA 6PAXA 4KLEA 3IAM2 3D2SA 4L9NA 3LVVA 1SD6A 2Z99A 2P4WA 3RH5A 4ELTA 2F1HA 4HF2A 4B8XA 5AM4A 7ICVA 1XU4A 3GF2A 3WU1B 1SKRA 3ZMDA 4KITB 1FLIA 2HSZA 3UM9A 1QQ7A 2WV1A 5DYMA 4E7SA 4CGZA 4KMOB 1L3UA 2EANA 1K1SA 1V9PA 2QB0B 4OJLA 5CRXA 1RYRA 3GFMA 1OYIA 4ZOHC 7ICOA 4ZDLA 5EWFA 2ICWG 2ISOA 2BBYA 3BR1A 3MR6A 4XSXF 4Y4RA 1MH3A 1JX4A 4O5CA 2DA2A 4OINF 1HOMA 1HCRA 2OCCH 3WTTC 3DV8A 4RPXA 3RAQA 2ESEA 4M72A 1SVMA 1H0MA 2OXOA 4BXOA 5J2JA 2ZFWA 2QKQA 2VPLA 1N56A 2P66A 3DXJF 2XAQA 3SZGA 4YCXA 9ICVA 3MN2A 2YS9A 1GT0C 3Q8LA 4EATA 4G6DA 2QQBA 4J9PA 4IQ4A 5CQGA 1FY7A 2GIZA 5H2FC 2HBMA 4B9TA 1N78A 1I3AA 5GAHJ 3L1PA 2EK5A 2V1DA 4NLZA 3IH3A 4US9A 2R5YA 4P4PA 3DBRB 2UUZA 2XICA 3I3LA 4FCYA 4Y2SA 4ZZDA 5J2IA 5B66C 1XX5A 5GTIC 1I39A 2BVLA 4JX4A 4KA4A 3OY9A 3L3FX 3LVWA 2OPTA 1T8EA 5LHHA 3DWLE 3SDBA 3AN1A 5TZVA 1LJ9A 2JTVA 4II3A 4ESJA 4YVZA 1LUJB 2VBXA 3OJUA 4L9TA 3CCQI 2UVVA 2WWYA 1YO5C 3FXUA 2FE3A 2FUG2 2OD5A 3MZ8A 4ZYEA 1ZRDA 4GFBA 4Y2QA 5AM3A 1K5OA 4QIWC 1ZQNA 4RS8A 3PMNA 2EA4A 2CXYA 4FS2A 4Y2RA 2I1QA 2L4AA 2V6EA 2EAMA 4IR1A 2CG4A 4LOCA 3MMYB 2EINH 1AKHB 1UPHA 1Z21A 3PR4A 2BZFA 3CUQC 2OHFA 1S8OA 1MMGA 2B0LA 4LFUA 2F44A 5JU5A 3MVPA 1QZEA 1Z9CA 1TL8A 4KDPA 1OCPA 1K83J 3DEUA 2EFWA 2EILH 2P6SA 2Y9YA 2R7SA 1MBHA 1SAXA 5KFYA 2Z1DA 1F36A 3W2WA 2X48A 3WGHA 2R5ZB 4DL5A 1HUZA 2LTPA 3M8SA 3RB4A 3H7IA 3ONQA 1X4PA 4HF0A 3GTJJ 1N2XA 3AQEA 2K8AA 1U2WA 4P9UA 1J2XA 3K75D 4BX9C 1XGOA 2GXGA 4IO9F 1ZQQA 5JFRA 4RQ4A 5KFLA 5TRDA 4A3EJ 2O7OA 1VQ7I 4S04A 3M6ZA 5HDGA 1GUUA 2UZKA 3N7PD 5KG4A 4BKXA 4QZGA 2HOAA 4F5PA 1VFCA 2KFDA 1ZRCA 2IOFA 2CQ7A 3WK7A 3U2RA 3AL0B 3F6OA 1PYVA 4JWMA 1FPQA 2ZKZA 1W7PD 4KLIA 2JK3A 2WB1A 1I3QJ 1XCVA 5KNLA 2G7UA 3BR0A 3C2BA 3EUHA 2WADA 1VJ5A 3N97A 3KKAA 4UARA 1P4AA 2O9LA 4F4ZA 3LWMA 4KLSA 1Q8KA 4AUXA 2KIFA 4OIPF 2E36A 3EUB2 2YMMA 3IAS2 4M3EA 4C30A 5J3LA 1U9NA 1MSWD 2ZIWA 2PMZA 5B1AH 4CXFA 1TW3A 1AWCA 3K4JA 5D46A 3A0HU 3MBYA 4DQRA 5F1RA 3F6VA 2HHQA 5HLGA 5IIKA 1ZQ3P 1ZK8A 3JRFA 1VZ0A 3PR5B 1PP8F 4KLOA 1H89C 4EYIB 2LNBA 4C3JJ 3BG9A 4UVBA 2XGXA 2B63J 3HUGB 2BE5F 2BY0A 3FMSA 5E3MA 1T39A 5ALJA 5DQIA 5HS8A 3HOXJ 4CF3A 8ICHA 3PFIA 4EJOA 3CLOA 4IEJA 3BCAA 1JKRC 2G09A 2WF6A 4FZLA 4BDPA 4O3RA 3K7AJ 2PKEA 2P6UA 3K1NA 1PUEE 2DQNB 4D5FA 4J9QA 2IEKA 1ZG3A 5F1JA 3HRDD 2YR2A 5EDNA 2BW3B 5KFKA 2OWOA 3LA7A 1Q3UA 3KYCB 3NQOA 4LIUA
chains in the Genus database with same CATH topology
3C2GA 3D5RC 4FASD 4D1QA 3J7AY 4E7JA 2HBJA 1P7DA 4BQNA 3GBGA 4F52A 4CCMA 3OYEA 5HLTA 2G06A 2WY8Q 2GH1A 3G2BA 4U7CA 2G5IB 4AVZA 2BW3A 3DPUA 5A0LA 4OJ5A 4YRVA 4PJNA 4XLHA 1MNEA 4HRIA 2CRXA 4YEJA 3NWSA 4BE2A 2A6TA 1PJRA 2Y0SA 5JHFA 4X0GA 1PVPA 3OS2A 2RP5A 3FBIB 3VCBA 3ZQQA 3AQFA 1D8BA 3PNVA 3MKYB 2VJIA 1PVRA 2V26A 2YB4A 3PSTA 3NRWA 1XNSA 1U0JA 2IS6A 3LSGA 4HNTA 3PSPA 5KL8B 3A1YA 4ZYAA 1Z1BA 1DGWY 3K1ZA 2MABA 3BLYA 3VYRB 4XLCA 2BDUA 2ZIVB 3H5NA 3PL8A 4OJOA 1Z7LA 3SAFA 3VYTB 4BJTA 2KHVA 2W82A 2XSJC 2ZFUA 2HU9A 1MMNA 2VL8A 2HBLA 3IG5A 4U6PA 3CF2A 3K4CA 2R7XA 3RQ4A 2CN1A 4IZZA 1TAMA 4FZMA 2NOJB 2WAEA 4NUBA 4ZJZA 5HVQC 4BACA 3E0JB 2H3VA 2W7PA 4U7BA 3HC7A 3PSIA 1KONA 2JH1A 2ZIXB 4DJAA 2CPRA 4XKBA 2AQEA 3W3CA 2IS2A 4LG3A 2RQQA 4HNUA 2ZIUB 5FRMA 2LKYA 3D5SC 4BQOA 2L2OA 2HMXA 1DRGA 4E7LA 1SZHA 1BR4A 2JUGA 3A2KA 2HVQA 3DU6A 3OL4A 4B3XA 2MC4A 1T0FC 2X1EA 2HVRA 4FE3A 2IS4A 4PK4A 3N05A 2H3ZA 2VASA 3F9KA 2VXZA 2Q1ZB 1FMVA 4XORA 3K6GA 3LMMA 1EA3A 4BEHA 3BC8A 2E1MB 4E7IA 4KISA 2X6WA 1Q3VA 4NC7A 2Z7JA 3TL4X 3RF9A 4QJFB 2LYBA 3PNTA 2LG4A 4CDGA 4BE0A 2JH7A 2L7KA 2E1EA 4E7ZA 3F5EA 3DTIA 2Z2SB 4Y33A 2H3IA 1X1AA 3LSHA 4BEHB 4IQJA 2ZIXA 1V5FA 4BGDA 4KT6A 4CZCA 3KYLA 4OAZA 4CCKA 3VSLA 2IGOA 3PSFA 3OYIA 3HPHA 1K6YA 4AYBC 2UWMA 2NV3A 1DQUA 3AKZA 3QODA 1LFPA 4OWRB 2X1DA 3F53A 2M4GA 4CCOA 3KEYA 4PFOA 1A6SA 3HKZF 2DGZA 4BXFA 5LFAA 3CRXA 3OR2C 5CKTA 1WUDA 2K89A 3I9V2 4NLCA 1V5EA 3L2VA 3H0MB 4NQWB 4QNLA 1L6NA 2ZSHB 1ECWA 2VQLA 2QKLB 3LFUA 3LSKA 2R7TA 1WJDA 2MFZA 4DBRA 3D5LA 4E4HA 2RRDA 2WB1F 3ALRA 3M1CA 5T14A 2KZVA 3LSMA 3S3OA 4NV0A 4NNJA 1Z3XA 2MRLA 2LYCA 3PFYA 2KJ5A 4HSRA 1QU3A 2F76X 3ZXSA 2VB6A 3LL7A 3BG7A 2ZSIB 2E5SA 3L2WA 2K9LA 3OWTA 2H3QA 2X51A 4P0PB 4B44A 1TZLA 3KFUF 1CRXA 1BR2A 4FETA 2CW7A 2R7VA 3H0RB 4CH7A 3CP2A 4PJLA 5C0YA 2CFOA 2KMUA 1D0YA 3CZ6A 2M7AA 2E1FA 1D1CA 2HQAA 2V1NA 5TGTA 1URJA 1Y56A 3U21A 1D1AA 4XONA 2G0AA 2N1RA 3F2CA 4P0PA 3NUQA 3S93A 4B47A 5KHDA 1LVKA 2K4IA 1GLNA 2HDWA 4E7HA 3L2UA 3C28A 1Y6IA 3RPUD 2DT6A 3A4CA 2VQCA 3D2QA 2LREA 3BCBA 1PVQA 3F2BA 2L5QA 3SAHA 3DTEA 1P9QC 1WJ5A 1BOBA 4MLOA 3RCOA 2GOMA 2VQGA 2M0NA 3UR3C 2KHMA 1XO0A 1DP3A 2PJRB 1IRXA 4F91B 4QPQA 3H9JA 3QYBA 2R7QA 4RLQA 4N4NB 2KKVA 1A0PA 3ZR8X 4CA0A 3F5AA 4A8EA 3MKWB 2F5VA 2XDVA 4BJQA 1D0ZA 2WA0A 3D2NA 2ZXHA 2X85A 2X6XA 2K3PA 3HL2A 1X4OA 4ZTFA 2LBFA 2L9NA 3AFHA 4ZDOA 2KKPA 3H9QA 3PUBA 3N7RC 2KVCA 1MMAA 4OO1J 3CESA 2CV2A 3DEEA 4P5OA 2QKMB 2E1MC 2A5WA 2KP6A 5FROA 1V5GA 1Z3YA 2K9MA 3E1SA 2JGAA 2WAQF 3SAGA 1ERDA 2F6CA 3L2QA 4OAYA 4KJZA 2HBKA 2BVMA 3S32A 4GFJA 2W00A 4LITA 1MNDA 4B43A 2BOLA 1HEKA 3TMOA 3V42A 2CH0A 4XQFA 3RTRA 2ZXIA 3OYJA 4XKVA 1YT3A 3ZRGA 4J01A 4HPQA 5HR6A 2JSPA 3K4BA 3CMMA 3EUAA 4Y3OA 1SFKA 2KLOA 2UV1A 4AU7A 4XR6A 4CSWA 2IXSA 2VQHA 4E7KA 2Y0SC 2MYSA 2ZG6A 2VKHA 2E60A 1ZELA 3K10A 2CUZA 3HPGA 4BL0B 1IIPA 4PFPA 2RHFA 1X19A 4C2TA 2YX8A 3K4MA 3S3MA 4BS9A 3SMVA 3MKZA 2GOLA 3H9GA 4AYBF 4JQFA 4ZTJA 5CPRB 2I8DA 4ITVA 3C29A 2GOXB 1BR1A 3M7DA 4IKFA 1G59A 4BU2A 3H5AA 2WAFA 4XMYA 2DT7B 2KHQA 2W03A 3SQIA 2VIXA 1HIWA 2F2AB 1HA8A 3VC8A 4BE1A 5HOOA 3M6KA 2Q2EB 2KRHA 1UELB 2KOBA 1NG7A 3C2HA 4WJ3B 1R6RA 2W04A 2R7OA 4NC8A 4P1WA 2LBFB 3SEQA 2KL4A 4RLFA 1ED1A 2VKDA 3OYBA 5HR7A 3QYEA 1OLTA 4BJ6C 2KJ9A 2AQFA 1OR7C 3IP4B 4XKWA 3L3FX 4C0ZA 3PJRA 3H35A 4PJMA 1ZQ1C 3RFAA 4XN0A 2H3FA 3DLAA 4XNFA 3OS1A 1J09A 1YE9A 1YX5A 3OMYA 3H0LB 1F44A 4HG2A 4N4OB 3H0DA 2VLAA 2PMZC 2MD0A 2JVHA 4F93B 2KIWA 1N75A 3EPZA 4DOZA 2LRDA 2JHDA 2DF4B 4GRIA 1OUQA 2XVTA 4H4KC 3RSNA 4AYBA 2KDOA 2WBMA 3N7SC 2LOOA 3CJQB 2KICA 2O5RA 2HOQA 2PJRA 2R4GA 2K8BB 1TT0A 4P0QB 5LD2C 2F8LA 1W36D 1QHHD 4LIVA 3VSKA 2HPIA 3OOUA 2A3VA 4PSXA 2JA2A 1D0XA 2VJ4A 4PSWA 2V7FA 2P0WA 2Y0SF 4XM3A 3GZFA 3VYUB 2OC6A 1DGRM 3HOTA 2WAQA 4DIQA 1NG6A 2F77X 3W2VA 2Q4TA 3TBIA 4QIWF 1MMDA 1WJCA 1MW7A 4BUGA 1MA7A 2HPMA 1T94A 3KX2A 1FMWA 1WJEA 3FBNB 1Z19A 4KX5A 3O0FA 3OYNA 3OYHA 3UNGC 2KEYA 2R7WA 5FRNA 2G07A 4P0QA 3FKJA 3PNYA 3DQVC 3SYTA 2CV1A 4II2A 3L2RA 3QOEA 4HSTA 2LHTA 2XAUA 1AA7A 2IGKA 4JOMA 1WJBA 4XL9A 3ZGKA 4JMUA 2HNHA 2XF6A 3OYCA 4CCJA 2CW8A 2LYAA 3ZCOA 4FZNA 2RNGA 2K4HA 3GU3A 4B48A 4PL1A 2KPMA 4G6TB 4RMNA 2XC7A 2D6FC 2CMPA 3EUKL 3K4LA 4CUGA 2K4EA 2CV0A 4XLEA 2W7OA 2DJIA 3AL0C 2OUMA 1X1CA 3DPTA 1KBUA 2XF7A 3HOSA 3T79A 3K4NA 2G08A 4PUSA 3OYGA 3D2SA 3K70C 3IAM2 2OH2A 4U87A 3FDYA 3OR1C 3LVVA 4XOPA 4XN3A 3HKZC 4BJ5C 3MD2A 2LC2A 4KITB 2M3AA 2PMZF 4PJJA 3DTKA 2L9SA 4E7SA 4KMOB 4CGZA 3S3NA 4XKCA 4OJLA 3VDXA 5CRXA 1WFXA 2VKQA 1LKXA 4HEA2 4ZDLA 3PZPA 2F4IA 4OJ6A 3VWBA 4CRXA 1X1DA 3S8PA 4PL2A 2CUJA 4Y4RA 4F55A 2HVSA 3OYDA 2LY1A 3OL3A 2OXOA 2M0MA 2VPLA 2K8CB 4YELA 3SZGA 1X1BA 4EATA 3K4KA 2HOFA 4F3QA 1WJFA 3M8JA 4IQ4A 4RM2A 5CQGA 4ANJA 2HBMA 4NWIA 2IGMA 1N78A 2V4JC 3OS0A 2VJJA 3DPLC 4QPOA 2JMGA 2KNJA 3FHNA 3HKZA 2KQRA 2UUZA 4C9YA 3I3LA 4J00A 1JI8A 2XICA 4F92B 2DXIA 2BVLA 1LDKB 4OJPA 4R79A 3OY9A 3LVWA 2M4KA 4DGWB 1N77A 2M7BA 3DWLE 3SDBA 2DOAA 3CJRB 4II3A 2XI9A 2LH9A 1UAAA 1S9HA 3ICXA 2FUG2 4C2UA 3OYMA 3OYKA 3DU5A 4RM3A 4QIWC 4D9JA 5HNHA 2LBOA 1YX3A 2V6EA 2Z16A 2E5ZA 4IC9A 3OIQA 3MMYB 1UPHA 1Z21A 4ICAA 1E0EA 1MMGA 3EUHC 3HG9A 2OYYA 3MGVA 2R7SA 2WB1C 2R18A 3K70D 2YB1A 1WJAA 2Z1DA 3W2WA 2KRCA 1T95A 1GO3F 1QHGA 2R7RA 2ZIUA 4XLFA 4CCLA 3ONQA 1X4PA 4ZC3A 3BG6A 3AQEA 2K8AA 4E6KG 2KV2A 2OV7A 2WY7Q 3ONNA 3VYSB 4BX9C 3SEZA 2OM6A 2G5HB 4BUPA 2ELJA 2V9KA 3CP8A 4CCNA 5KCMA 4BDYA 4BDZA 4ZDPA 2DCEA 3M6ZA 3N7PD 2HZDA 1UG0A 4DBQA 2LY2A 2WAQC 5CQEA 2X6YA 3IN5A 3OYAA 3AL0B 1PYVA 2VJ5A 3OIPA 4NLBA 5KL1B 2ZIVA 2X1CA 2WB1A 3LSIA 5KNLA 3CYMA 2E5NA 2W4SA 3IG8A 2WADA 2ZIWB 3OYFA 2W7NA 4KX3A 3W2AA 2HOIA 2CS3A 3LYSA 3H5RA 2XF5A 2KD1A 2K5CA 3IAS2 4XLAA 4C30A 3OYLA 1NZBA 2W1OA 2ZIWA 1G8XA 2PMZA 3KZXA 3K4JA 3DKYA 1D1BA 2KJ8A 1SAUA 1W36C 1VZ0A 2R7UA 2JVGA 3HXLA 4O3MA 2IGNA 3DKXA 3HUGB 3OPXA 4XOTA 3IUOA 2XIDA 2MA1A 3F2DA 3BCAA 2RREA 3E0FA 2IS1A 3QYFA 2G09A 4FZLA 2VXDA 4IX7A 4ACOA 4BQQA 2DQNB 3NWTA 2BW3B 1Q3UA 5HNFA 4LIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DQN B;  3IP4 B;  3H0L B;  2DF4 B;  3AL0 B;  2G5I B;  3KFU F;  4WJ3 B;  1ZQ1 C;  1NG6 A;  2D6F C;  2F2A B;  3H0R B;  3H0M B;  2G5H B; 
#chains in the Genus database with same CATH topology
 1Y1W J;  3C2G A;  2KRF A;  4UAZ A;  3WKB A;  3HTS B;  2ZJR F;  4E7J A;  5KG6 A;  1XWL A;  2LPE A;  5FKO A;  2Y69 H;  5AKL A;  3T8R A;  4NB5 A;  4PGG A;  1RPL A;  4DZP A;  2WTF A;  2G5I B;  1IXS B;  4PJN A;  3HOU J;  1MNE A;  3ML6 A;  5ALW A;  1ZHF A;  3SEN A;  2HVI A;  3ELK A;  4FQG A;  5AKE A;  5J29 A;  1Z0X A;  1USS A;  3BZK A;  3S17 J;  3OS2 A;  2RP5 A;  2FA5 A;  4B9M A;  3PNV A;  2HR3 A;  1JT0 A;  2NVT J;  1PVR A;  4IRK A;  1MBG A;  2BCS A;  3BR5 A;  1Z3E B;  1U0J A;  1OCT C;  4HNT A;  3GIK A;  4GXK A;  1T56 A;  1XGN A;  2P7V B;  1Z1B A;  1HW1 A;  2MAB A;  2ZTD A;  4EJV A;  5DLG A;  1BJA A;  2W55 A;  5ALV A;  3PL8 A;  3C2M A;  3ZDB A;  4BJT A;  3C5G A;  2XSJ C;  3CCL I;  4KNY A;  1B59 A;  5AKX A;  3JPN A;  1TK8 A;  2Z9O A;  3IG5 A;  3CF2 A;  3DDH A;  2W8L A;  4Y2J A;  1YTY A;  4M6V A;  3RQ4 A;  2R7X A;  1JMS A;  1W1W E;  1IZ1 A;  2NOJ B;  3ZN0 A;  1R36 A;  4ZJZ A;  5HVQ C;  3NAR A;  1KYW A;  3KEO A;  3RRG A;  5K5R A;  4NLK A;  3CTA A;  2D1V A;  4J9L A;  1ETV A;  4LG3 A;  2RQQ A;  4LD5 A;  1QCK A;  4FBT A;  2ZNY A;  2ZC2 A;  4BQO A;  5BPC A;  2L2O A;  1YQA A;  5H6R A;  1ACI A;  1V55 H;  2JUG A;  2YML A;  2Y31 A;  3DU6 A;  2XGP A;  3ZQC A;  9ICW A;  2HTS A;  1TE2 A;  2ZUB A;  4FE3 A;  4PK4 A;  3I71 A;  8ICQ A;  1E17 A;  3FC4 A;  4E7I A;  4KIS A;  2VKE A;  1OQY A;  2RNJ A;  3J81 Z;  4KUM A;  2YTU A;  3EYZ A;  1Q3V A;  3S1R J;  2UVW A;  3RJF A;  3CDI A;  2BQU A;  3RF9 A;  5DCF A;  4A5N A;  5LHI A;  3GIJ A;  4I29 A;  4CDG A;  2OEH A;  1UST A;  2OQG A;  3GCM A;  2JH7 A;  2L7K A;  4UNO A;  4PHE A;  1S0O A;  4RT3 A;  3EYI A;  2H3I A;  3LSH A;  4BEH B;  3FWE A;  3A0B U;  4IQJ A;  4FBU A;  3I4P A;  4DFM A;  3BG3 A;  3RDI A;  1BPX A;  3KYL A;  4KT6 A;  2IAI A;  5AON A;  8ICB A;  2CRG A;  3VSL A;  5DB9 A;  4TUQ A;  3QXG A;  2ZJA A;  4YP3 A;  1K6Y A;  4AYB C;  2NV3 A;  3WKE A;  1BPZ A;  1IN6 A;  3QOD A;  2DPD A;  4C4R A;  1LFP A;  3PNC A;  2X1D A;  3S1Q J;  5LGT A;  2BPF A;  4CCO A;  4PFO A;  2KZZ A;  5FLX Z;  2DUY A;  1RKW A;  4A6E A;  4GO1 A;  4BXF A;  3GX4 X;  3A01 B;  1V38 A;  3BTJ A;  4F5Q A;  3HZJ A;  2K4B A;  1WUD A;  3I9V 2;  3ZN1 A;  3H0M B;  4D7N A;  4EZ6 A;  3DP7 A;  7ICH A;  4IRG A;  1IUY A;  2E1C A;  4RAG A;  4AWX B;  2K27 A;  3T5X A;  1OR7 A;  4PGH A;  4LG0 B;  2R7T A;  1LV5 A;  3WTX C;  7ICG A;  2LLK A;  3BJ6 A;  3H8S A;  4DBR A;  3TFR A;  5JTI A;  4Y52 J;  4XIC A;  2EPF A;  1R5G A;  2JEJ A;  4OMZ A;  4BWM A;  1Z3X A;  3GFJ A;  4I2O A;  1DGS A;  2EQR A;  5KFB A;  3I59 A;  1QU3 A;  1W7P B;  1LFU P;  2X4H A;  2R0Q C;  2VB6 A;  3LL7 A;  5D5W B;  5AIB A;  5KFW A;  3ZMU A;  3DFG A;  2W85 A;  1APL C;  2BEO A;  2DFF A;  2VON A;  1XMK A;  2H3Q A;  2X51 A;  1RRJ A;  4NM2 A;  5DCM B;  4P0P B;  4B44 A;  4NDL A;  1ZG1 A;  1BR2 A;  1XC5 A;  1R23 A;  1X3Z B;  2A68 F;  2AXT C;  4PJL A;  4LB5 A;  2CFO A;  2KMU A;  1RC9 A;  4NHJ A;  5C0Y A;  2WFA A;  1R1V A;  2MLG A;  4EEL A;  1RES A;  3CZ6 A;  1G3S A;  2M45 A;  4A12 A;  2HDD A;  2YU3 A;  4C8K A;  8ICK A;  4MFC A;  2WC2 A;  2J6T A;  1YW9 A;  2O3F A;  3U21 A;  2BCR A;  3BR6 A;  2ID6 A;  2IA2 A;  5E79 U;  3V7K A;  2K4I A;  1GLN A;  3GXO A;  3SZP A;  4E7H A;  5KFX A;  3C28 A;  3BQ1 A;  2E8O A;  2DT6 A;  4OOI A;  3D2Q A;  2GWR A;  3BCB A;  2NVX J;  3F2B A;  5E3N A;  4X1E A;  3EET A;  1P9Q C;  1IW7 F;  9ICT A;  1WJ5 A;  3KZI U;  4MLO A;  1DDN A;  4CO8 A;  1IRZ A;  2VQG A;  2M0N A;  4AIH A;  4KLU A;  2MUT A;  2FMS A;  2QWW A;  5DUK A;  4RQ2 A;  1JTY A;  1WKM A;  2NNN A;  1B4F A;  3H9J A;  1HBX G;  3HT3 A;  3HIF A;  2NVU B;  4ABZ A;  2R7Q A;  5KG1 A;  3HRM A;  3ZR8 X;  3CMY A;  1BC8 C;  5DBC A;  2R8K A;  1FBQ A;  5F3X B;  5IIN A;  1Y0U A;  4WF2 A;  2NNY A;  4NY8 A;  1EV7 A;  1D0Z A;  5EE3 A;  3D2N A;  1QSL A;  2ZXH A;  2X6X A;  3C7J A;  2JZY A;  4I6Z A;  4EEK A;  2EFQ A;  3ORY A;  1PK1 A;  4ENJ A;  4ZTF A;  3T1B A;  4ZDO A;  3AFH A;  5AIA A;  1RET A;  1FZP B;  2ETH A;  3J80 Z;  4LZD A;  3UXN A;  3PUB A;  3WOD F;  1BNO A;  2IW5 A;  2KVC A;  8ICG A;  1KLN A;  3HOV J;  5E20 A;  4Y15 A;  3O2P E;  4M9L A;  3MR3 A;  2MLK A;  3HRT A;  4Y2Y A;  4DL6 A;  4RGR A;  1B8I B;  5FFX A;  4F4K A;  1JN3 A;  3QYP A;  2K9M A;  2YQE A;  1SFO J;  5KAI C;  2WAQ F;  1JRP A;  1R1T A;  1ZXI A;  1TNT A;  3UXP A;  2H6B A;  5ILV A;  5C3E J;  2ELH A;  2DA1 A;  4OAY A;  4A3L J;  1XDU A;  5ILS A;  2BVM A;  3WE3 A;  5ALI A;  5FKK A;  5CVV A;  1EJ9 A;  4M9S A;  4GFJ A;  3I28 A;  4L9V A;  2GA1 A;  4GYI A;  2E2J J;  2ZO4 A;  1IRG A;  3U1K A;  3TMO A;  1U8R A;  4O5K A;  1WWU A;  2WV0 A;  5D5V B;  2CH0 A;  4XQF A;  2ZXI A;  5AKJ A;  2KIS A;  1CF7 A;  4XKV A;  1XO1 A;  3ZRG A;  5H2F U;  2EV0 A;  2UXX A;  4U88 A;  4EEN A;  3KET A;  3H40 A;  3RBD A;  1ZQG A;  3JRH A;  3J7Z I;  4Y3O A;  1JUP A;  4BAY A;  3V7R A;  5AHX A;  4TUP A;  1YI2 I;  1V54 H;  2UV1 A;  3KFW X;  2LKS A;  3QP5 A;  4AU7 A;  5JVG F;  4E7K A;  2WF5 A;  2MYS A;  3WK9 A;  4IHV A;  3ISC A;  1UA0 A;  1RXW A;  1T0F A;  4L5E A;  4BL0 B;  2DFL A;  2RHF A;  4PFP A;  4QZE A;  2VE8 A;  1X19 A;  3O8G A;  3G6X A;  2CO5 A;  1NI3 A;  3K4M A;  2KKO A;  2MG4 A;  5ICG A;  2BKE A;  3SMV A;  1F43 A;  3SXY A;  3FDS A;  5L3G A;  2HZT A;  5AI9 A;  2FQ3 A;  3Q8K A;  2I8D A;  4ITV A;  1HKS A;  1S29 A;  3WK6 A;  2IMW P;  3ZQH A;  1J2M A;  1LB2 A;  4KIG A;  2AS5 F;  2XY6 A;  2A1A A;  3O6B B;  5BS6 A;  4A93 J;  5L1L A;  2R93 J;  3L9F A;  1N25 A;  3PX0 A;  4F8R A;  5J40 A;  9ICC A;  4I28 A;  1W0U A;  4PGX A;  2L02 A;  1J9I A;  3C2H A;  3HSR A;  1R49 A;  4NC8 A;  5K4L A;  5FKM A;  2M9H A;  3E5Q A;  1Z6T A;  2XB0 X;  5DKW A;  2JUC A;  3QYE A;  3REO A;  3QWL A;  2AQF A;  3R0A A;  4N9H A;  4XKW A;  3V4G A;  1JKP C;  1X9M A;  1RYS A;  3VFZ A;  2XPU A;  4L0Y B;  3DLA A;  4HX8 A;  4EM0 B;  3OS1 A;  2PXI A;  1SB3 C;  1YX5 A;  4RAZ A;  1F44 A;  1KKX A;  2JJ7 A;  5D4R A;  2MD0 A;  1VLB A;  5KT7 A;  4GYG A;  1ZD4 A;  3NVV A;  2HVH A;  4DOZ A;  1XTA A;  3CCS I;  4GRI A;  3AAF A;  1BC7 C;  1Z7U A;  2JHD A;  3Q0U A;  3RSN A;  5AKY A;  5ALZ A;  4R8U B;  1XS9 D;  2LOO A;  8ICR A;  5L1M A;  2HOQ A;  5EEA A;  2PJR A;  1BGX T;  3JRC A;  2K9N A;  1LE8 B;  2RVC A;  4G6Q A;  2PN6 A;  3FAH A;  3IC7 A;  2P6R A;  1RQL A;  3CW2 C;  1A35 A;  4Y7N J;  1LNW A;  9ICA A;  2V7F A;  4ETS A;  4ELV A;  1UT8 A;  1MBE A;  4XRS G;  3KPH A;  3ZQ7 A;  4EJU A;  4XM3 A;  2E8M A;  3HSF A;  4QZB A;  4YR3 A;  1DGR M;  4IJA A;  5J0U A;  2WAQ A;  2EFO A;  4KMU A;  2OBP A;  4A3C J;  2QLT A;  1AHD P;  2LKX A;  4DIQ A;  4YFK A;  2PQ8 A;  3TBI A;  1L3S A;  1D8Y A;  1QO0 D;  1B6A A;  1FC3 A;  3HBL A;  1MA7 A;  1Y8Q B;  2BY1 A;  1FMW A;  1WSU A;  3LOC A;  4KX5 A;  4I98 B;  3SZ2 A;  3UNG C;  4AP9 A;  4RGU A;  2B6G A;  2R7W A;  1TK0 A;  3JPS A;  5M5Y J;  1RIO H;  2R8H A;  5KFE A;  5BOX A;  4GGG A;  1B4A A;  1O7L A;  4II2 A;  3QOE A;  4HST A;  1YS6 A;  4JB3 A;  4LK1 F;  2GLO A;  4LMY A;  1JTX A;  1KU9 A;  4JOM A;  3AG3 H;  1JUD A;  3TW6 A;  4HYK A;  1OW5 A;  2HNH A;  4XUS A;  4CCJ A;  1VND A;  3E6C C;  2M8G X;  4EMS A;  1T6S A;  3BS7 A;  2RNG A;  3DCF A;  4GXO A;  4EJW A;  1JXL A;  2I9G A;  2M0C A;  2X6O A;  4EJT A;  1K79 A;  3QU9 A;  4RT2 A;  1FBU A;  3NS1 A;  2PBI A;  3WU2 U;  5E1W A;  1Z05 A;  2F5D A;  2CV0 A;  5GAG J;  3PW7 A;  2ZJ5 A;  1VQ6 I;  2XF7 A;  1NJX A;  1UJ8 A;  4PUS A;  3TO6 A;  1P6R A;  4YFK F;  1BPY A;  3WGI A;  2PI4 A;  9ICE A;  3OR1 C;  2MW8 A;  1XD7 A;  4C7Z A;  3GV7 B;  4O3S A;  4XID A;  4BJ5 C;  4BY1 J;  3S1M J;  4A3K J;  1UT5 A;  1K4S A;  3ESW B;  3SV3 A;  1TWH J;  2PMZ F;  4Y17 A;  4A3B J;  2X0L A;  2L9S A;  4A0X A;  4RBO A;  1PUZ A;  3ZOB A;  3TDU C;  2F3N A;  2MC3 A;  2VKQ A;  2E7X A;  3HB9 A;  4J9O A;  1LKX A;  4HEA 2;  4J9M A;  1QZY A;  2C2D A;  3VOE A;  1R4N B;  3DKW A;  3N4M A;  3SFZ A;  4PL2 A;  4RQ8 A;  2CUJ A;  4V2G A;  4F55 A;  4U7D A;  1ZQB A;  5M3F J;  1MIJ A;  1JUM A;  4UB6 U;  9ICB A;  1B22 A;  2KFN A;  1ZD5 A;  3BDP A;  8ICX A;  3N97 B;  4CYC B;  3B0Y A;  2QYO A;  3RB0 A;  1Z91 A;  2KIM A;  1S5L U;  4P9F A;  4FE7 A;  3JPT A;  2HQN A;  3V7J A;  7ICL A;  4DLE A;  1H9T A;  4Y2U A;  5J0Y A;  4BH9 A;  4F3Q A;  4DQ2 A;  5AKG A;  4RM2 A;  3GTK J;  2W43 A;  1RPW A;  2IGM A;  2V4J C;  3OS0 A;  2E3T A;  5ICC A;  3DPL C;  1FP1 D;  4AIK A;  3RRH A;  2KNJ A;  5EGO B;  4J00 A;  2XB5 A;  3G1M A;  1NK3 P;  3JPQ A;  1LDK B;  3MZY A;  7ICM A;  4RAY A;  1N77 A;  1VQN I;  2M7B A;  1V4R A;  4FX0 A;  2FQ4 A;  3QU7 A;  3MGV A;  4Q47 A;  1SMT A;  9ICR A;  2XI9 A;  2LH9 A;  3C3W A;  3Q0W A;  4DW6 A;  3KZY A;  4C2U A;  1UHS A;  4B09 A;  1K7A A;  2M5W A;  3D0S A;  3DU5 A;  4RM3 A;  3GIL A;  4ESB A;  1P92 A;  4C8N A;  4C4T A;  3TAP A;  1XDS A;  4ESF A;  2MSN A;  5DDG A;  3ABU A;  3RZD J;  1TW2 A;  1H9G A;  3PQK A;  3QEA Z;  1T98 A;  4IC9 A;  2V1U A;  1E3P A;  3WK5 A;  2OAZ A;  4JX5 A;  2H8R A;  1L0O C;  1YOV B;  5IOY A;  1IXR A;  5HDK A;  1K78 A;  1E0E A;  1L3L A;  1O3S A;  2KVS A;  1KQ9 A;  2OA4 A;  1EXN A;  4ICA A;  3AG1 H;  1SC7 A;  1I1S A;  4PCQ A;  4P4O A;  2E1O A;  1XGS A;  1WHU A;  3TQ1 A;  1FIA A;  1J7K A;  1QHG A;  1KZH A;  1GO3 F;  3I4N J;  2ZIU A;  4I2D A;  4UB2 A;  4UB6 C;  4PHD A;  4XLF A;  4CCL A;  4M3F A;  4FT8 A;  1TQI A;  4MTD A;  2PI5 A;  3WKD A;  4D0P A;  5CVU A;  4Z6C A;  5AI4 A;  4IRH A;  4E6K G;  2KV2 A;  3M4O J;  4AVP A;  2WY7 Q;  1UCR A;  3HKZ N;  5B3S H;  2OM6 A;  1R71 A;  1ZQE A;  2ELJ A;  1IN5 A;  2A6H F;  5ALR A;  3EZ5 A;  3EPG A;  2DMN A;  1SZP A;  4J9N A;  1SFX A;  4DBQ A;  3ZQL A;  3H4D A;  2KFZ A;  2FMQ A;  4MNU A;  4DQS A;  2WAQ N;  2M1B A;  5F64 A;  1OCC H;  4L5I A;  3MDC A;  1RZ4 A;  5D4B A;  4DSK A;  3HJE A;  5E18 F;  4RB1 A;  1MJB A;  3QU5 A;  2XVC A;  2ESH A;  2QQA A;  4I09 A;  4I02 A;  2DA6 A;  3OYF A;  2W7N A;  2FRH A;  3K2A A;  5FJ8 J;  3W2A A;  2CS3 A;  3UMG A;  2HOI A;  2EH3 A;  4JBA A;  4HDV A;  1TC3 C;  3H5R A;  1TV9 A;  3R61 A;  5KT6 A;  5AM2 A;  1L7M A;  9ICK A;  3G6E I;  5KFA A;  4FIS A;  2ZJ2 A;  1TBX A;  9ICG A;  2HOT A;  1RUN A;  3RIR A;  1HF0 A;  2ES6 A;  1G8X A;  1KRP A;  1Y0N A;  3FXL A;  5J8Y C;  5DQG A;  3JR9 A;  1Z67 A;  1D1B A;  3QPS A;  3J81 K;  3BDD A;  4ENM A;  2QF7 A;  2KJ8 A;  3TKA A;  3VB2 A;  1JE8 A;  4RPZ A;  5LGN A;  4ZH4 F;  1S3J A;  2JVG A;  4LLN A;  2R7U A;  1COO A;  5DV5 A;  4O3M A;  2EH9 A;  3N28 A;  3THV A;  2FJ6 A;  4JWN A;  4K4G A;  3CJT B;  3M07 A;  2IGN A;  5AI6 A;  4IR9 A;  1YZ6 A;  3RJE A;  4XOT A;  3IUO A;  4R1H A;  1TLH B;  1D5Y A;  1I5Z A;  3CC4 I;  1WG8 A;  4XRS A;  2XID A;  1DUX C;  4RQN A;  1LEA A;  1GV2 A;  1QVU A;  2RRE A;  2JRZ A;  3QYF A;  4NLN A;  2VXD A;  3FXJ A;  4ACO A;  4QWB A;  1ETQ A;  5FO5 A;  3EDP A;  1ETY A;  2XAJ A;  1DP7 P;  3AG2 H;  2TDX A;  3GTP J;  3JCU C;  2CUF A;  3IRU A;  3U26 A;  2RN7 A;  5HNF A;  4P96 A;  3PUF A;  3CCU I;  1KSP A;  5DLF A;  3JRD A;  1OPC A;  2HBJ A;  3GBG A;  3F21 A;  5FKL A;  5F04 A;  4CCM A;  2G06 A;  1GXP A;  2EA2 A;  4M71 A;  1BPB A;  2BW3 A;  3ISB A;  4OJ5 A;  3OSG A;  4QWE A;  5D6F A;  1SV0 A;  2CRX A;  2EB7 A;  2HOE A;  3BPV A;  4YEJ A;  4X6A J;  1L7N A;  5G5H A;  2A6T A;  1VQM I;  4CF4 A;  1QNT A;  4OU0 A;  1PVP A;  4N0B A;  1WH5 A;  4G7Z F;  2EZY A;  3MC1 A;  2OU2 A;  3AQF A;  1D8B A;  1FJL A;  2RC4 A;  3MKY B;  3S16 J;  4ECQ A;  2XGC A;  2C28 A;  2Y0M A;  1KW4 A;  1XNS A;  4R8H A;  2IS6 A;  1TVA A;  2K4J A;  1WCM J;  2IP2 A;  3HOZ J;  1JXS A;  1VQ8 I;  1DGW Y;  3VOD A;  2BV6 A;  4LVS A;  3H5N A;  4OJO A;  1Z7L A;  3RH4 A;  2FMY A;  3SAF A;  9ICX A;  1TWG J;  1RM6 C;  2W82 A;  1W4M A;  5C4J J;  2CSO A;  1TWF J;  1ZQI A;  2HBL A;  1W7P A;  2LMD A;  2PMU A;  1YS7 A;  3P9K A;  3K4C A;  1ZET A;  2DI3 A;  1TAQ A;  2CN1 A;  4RUA A;  1TAM A;  2VUM J;  4FZM A;  3CDH A;  5J2A A;  3WKC A;  4BAC A;  2H3V A;  2W7P A;  1JAL A;  3RB3 A;  4U7B A;  4DSI A;  4E0D A;  5KFD A;  3PIO F;  3MAJ A;  3PSI A;  1KON A;  1ITY A;  4DJA A;  4PGQ A;  2IS2 A;  3W3C A;  2RGV A;  1WCN A;  2C22 A;  1D9D A;  2ZIU B;  3LAP A;  2LKY A;  1O7F A;  2C6Y A;  4XRF A;  2VA8 A;  5AK5 A;  2M2E A;  2P5V A;  1FIQ A;  3S1N J;  4UAY A;  4DLG A;  4EVI A;  5IY5 H;  2V9P A;  2VOP A;  4B3X A;  1OCR H;  5KFG A;  5L1I A;  2P6T A;  2LDU A;  5ALK A;  2HVR A;  2IS4 A;  2H3Z A;  2Q1Z B;  5CJ7 A;  3LMM A;  4BEH A;  2FPL A;  3BC8 A;  2XIG A;  2EFN A;  3E5X A;  4NC7 A;  4PHA A;  1NK4 A;  3PW4 A;  2Z7J A;  1UG2 A;  4QJF B;  3TDZ C;  4C3H J;  2QA4 I;  2WF7 A;  4YG2 A;  9ICJ A;  2LG4 A;  2NS0 A;  1G6N A;  4CHU A;  3V7C A;  1IN7 A;  4BHC A;  3F5E A;  3DTI A;  2XRN A;  4Y33 A;  5K7H A;  2MUT B;  1I27 A;  3B6C A;  3WKA A;  1YHQ I;  2ZIX A;  1V5F A;  4AD9 A;  2QEN A;  5DM6 F;  3JTH A;  3RI4 A;  2QCO A;  1PUF B;  3HPH A;  3P7N A;  2QB1 A;  5J2D A;  2KTQ A;  2ECC A;  1DQU A;  5BNG A;  3J80 K;  1BN5 A;  4A3I J;  2FI1 A;  1YFH A;  4BXU A;  1TTY A;  3I58 A;  3KEY A;  4FFD A;  2DGZ A;  3AU6 A;  3CRX A;  1IV8 A;  3LSR A;  3OR2 C;  3CC2 I;  2MH2 A;  3L2V A;  2RQP A;  4QNL A;  5ILU A;  1Z4O A;  1I6X A;  1IO2 A;  2DK5 A;  5HP4 A;  2VQL A;  2KSO A;  2BPC A;  2NXN B;  3LFU A;  1YRN A;  3KHG A;  2Y2Z A;  1WJD A;  3KE2 A;  2B9S A;  2RRD A;  3Q9S A;  3RTV A;  5T14 A;  8ICM A;  4UV8 A;  3PQJ A;  3S3O A;  1A6Q A;  4NNJ A;  2DBY A;  4WK8 F;  2BPG A;  1UCV A;  1P2F A;  1Z00 A;  1MDM B;  4RU9 A;  3PVX A;  3GW2 A;  2KJB A;  2HHV A;  5KT2 A;  2E2I J;  4UUV A;  3BG7 A;  1F5S A;  2E5S A;  2TCT A;  4XRH A;  2DMP A;  4EBE A;  2K9L A;  3RJI A;  1ARO P;  2L9R A;  4FET A;  2CW7 A;  1U5T A;  2P35 A;  3H0R B;  1YYV A;  3CP2 A;  4BNC A;  1DU6 A;  5KAF C;  2NAZ A;  1D0Y A;  4F4X A;  4NM1 A;  4Y2P A;  2XY7 A;  3OSP A;  4I2F A;  1V85 A;  2VBZ A;  1GXQ A;  3FYH A;  1U49 A;  2V1N A;  4IOA F;  3ED5 A;  5KNI A;  2N1R A;  4XON A;  3F2C A;  5DCM A;  2G0A A;  4I2H A;  4P0P A;  3GVA A;  3M8R A;  1LVK A;  2HDW A;  3L4P A;  2ZUD A;  1RR7 A;  3OV8 A;  5IIO A;  4M6W B;  3B6A A;  3DTE A;  1FT9 A;  2HHS A;  4CCH A;  2RLT A;  2DN0 A;  1QVT A;  1BOB A;  5DGA A;  3G71 I;  3HOW J;  3RCO A;  2KG5 A;  3MFI A;  4JK1 A;  5J1Y A;  3UR3 C;  1SWV A;  2CQN A;  1WZ2 A;  1IRX A;  2JZB A;  4F91 B;  1YJN I;  3TAD C;  1NK8 A;  4DWI A;  9ICH A;  3ABM H;  2A1J A;  4ED0 A;  1U5T C;  2UVR A;  4N4N B;  5L3B A;  2NS7 A;  4QLC U;  2O6K A;  1S7A A;  1A0P A;  2KKV A;  2W9C A;  5HOD A;  3MFK A;  1XSN A;  5KFZ A;  1N48 A;  2HQR A;  1CGP A;  2NS8 A;  4BJQ A;  2P8T A;  2YU9 J;  2R7F A;  4F2R A;  3IRR A;  3HL2 A;  2KZ3 A;  4IHY A;  2PFQ A;  4RAF A;  2IA1 A;  3QZ8 A;  8ICN A;  1KQ8 A;  1UQV A;  4YFX F;  2LBF A;  2L9N A;  2M87 A;  2NRW A;  1ZQF A;  3SEI A;  1RG6 A;  2KIV A;  4HV5 A;  4MQ9 F;  1S72 I;  2JA6 J;  4C7Y A;  2W24 A;  1MMA A;  3FXO A;  1BI2 A;  2W57 A;  3GWZ A;  4XBF A;  4O3P A;  3OSF A;  1N62 A;  1MQ2 A;  4MEX A;  5HS7 A;  4OO1 J;  1FBS A;  1J75 A;  4ED3 A;  2K7L A;  1DPU A;  1X1P A;  1PK1 B;  5BQT A;  3K4G A;  1BBY A;  5EE9 A;  1WI9 A;  2A5W A;  4UAT A;  2KP6 A;  1S9F A;  2GXB A;  2DFI A;  3C2L A;  2DQL A;  8ICA A;  3E1S A;  4RGS A;  5LHG A;  1VQL I;  2JGA A;  2W9C B;  1FSE A;  4IVN A;  4A6D A;  1G3Y A;  1BPE A;  9ICQ A;  3B0X A;  3PX6 A;  4QSH A;  3L2Q A;  5TJJ A;  1MZB A;  3CCJ I;  4DOA A;  2HEO A;  2F8K A;  2L7M P;  4IL6 U;  3PV8 A;  1KA8 A;  4D7M A;  1ZQW A;  2HHU A;  5J0Q A;  3S32 A;  3I76 A;  2HFH A;  2AGQ A;  4CE6 A;  3RAX A;  3L5K A;  4RNM A;  4BHB A;  1HEK A;  1PUF A;  3OJS A;  2RDI A;  2F5E A;  3FMQ A;  3TOB A;  3BZC A;  2KMD A;  3ZQG A;  3I0T A;  4KLL A;  2TRT A;  1S0V A;  2AXL A;  4I01 A;  3A0B C;  5CYV A;  5EWE A;  4MGR A;  4QIW N;  5AIQ A;  5J2E A;  4KLJ A;  4ECZ A;  3KOO A;  4QWC A;  1BNP A;  4YMO A;  2JSP A;  3H3Z A;  3K4B A;  5E79 C;  4WX9 A;  2BXZ A;  3EUA A;  1X66 A;  4HNV A;  2W3S A;  2DT5 A;  1SFK A;  4KT5 C;  4DFJ A;  4HX7 A;  1ONV A;  2L4M A;  4XR6 A;  3GLX A;  4JYK A;  2VC0 A;  2VQH A;  4DYC A;  2R92 J;  2KSO B;  2Y0S C;  2E60 A;  1ZEL A;  1T38 A;  3M9O B;  1SXE A;  4MEY F;  2CUZ A;  3R0J A;  7ICR A;  5ALU A;  2LVS A;  2LYH A;  1L7P A;  1FTZ A;  2STW A;  4QZA A;  4DSJ A;  3ZQF A;  2YX8 A;  2FSW A;  1G4D A;  1R5H A;  3TKY A;  3IV5 A;  3AG4 H;  2JEI A;  3I54 A;  2E71 A;  5FP0 A;  3MKZ A;  4UAS A;  2HXO A;  4JQF A;  5H20 A;  4B9S A;  5CPR B;  1U48 A;  1WQ2 A;  2M34 A;  4BXX J;  1H8A C;  1XB4 A;  5ALD A;  3MGH A;  2XPV A;  4IKF A;  2WAF A;  3KHH A;  4XSZ F;  3UMB A;  1SL0 A;  2DWQ A;  2BR0 A;  8ICU A;  1QA6 A;  5E3O A;  3GZ5 A;  1X6I A;  5HOO A;  3M6K A;  2Q2E B;  2KRH A;  2BDP A;  1UEL B;  3TFS A;  4Q8E A;  2W04 A;  2Z5U A;  1ED1 A;  4P1W A;  1NTC A;  4RLF A;  1L3V A;  3LQR A;  1Z4N A;  3OYB A;  2CQQ A;  2KJ9 A;  2H6C A;  1KGS A;  1EKE A;  1I6H J;  1S0M A;  3NVZ A;  1HLV A;  4I2B A;  5IPA A;  1MQ3 A;  1ZYQ A;  1LKY B;  1X9S A;  1HC8 A;  1BL0 A;  4UBC A;  2OCE A;  1J09 A;  3EW9 A;  3TP0 A;  4QZC A;  3FM5 A;  3LDA A;  3H0D A;  3HOY J;  1FYM A;  3PO3 J;  4B9V A;  1REP C;  5EZH A;  1WWX A;  3C5F A;  1NH3 A;  2O0Y A;  2LRD A;  3JAM Z;  3S2W A;  5KVR A;  5M5W J;  4TUS A;  2VKV A;  1JGS A;  3FXM A;  1SV0 C;  4A69 C;  2XVT A;  3FX3 A;  4H4K C;  3N7S C;  4TQR A;  2WBM A;  2YY6 A;  4IRC A;  1JJ6 C;  3NRV A;  2K8B B;  5EEG A;  3T8T A;  1TT0 A;  3BP8 A;  2CGP A;  1VQO I;  4P0Q B;  1W36 D;  4BBS J;  3NAS A;  3VSK A;  1RI7 A;  4K4H A;  4PSX A;  5AK3 A;  3ISP A;  2VPR A;  4I0A A;  3PIP F;  4ECS A;  1L3T A;  5D6E A;  3QU3 A;  1OJL A;  1KU2 A;  1DOQ A;  4R8U A;  3WK4 A;  3ZD9 A;  3G6Y A;  3QE9 Y;  2A61 A;  4KLF A;  4ZYH A;  3BS5 B;  2ZBK A;  4UVA A;  3ERM A;  4UB8 U;  1NK7 A;  3O8H A;  4Q43 A;  5A2Q Z;  5L1K A;  1MSE C;  2F77 X;  3ECO A;  1W5T A;  2OZU A;  3BQZ A;  2JR5 A;  2Q4T A;  2DA5 A;  4QIW F;  3ZMS A;  1ETO A;  1C20 A;  3GDX A;  4S05 A;  1B72 B;  5AM1 A;  5KT4 A;  4DL7 A;  3IRQ A;  3UMC A;  2AHQ A;  5KG5 A;  4FO6 A;  5J2H A;  4ED2 A;  3H92 A;  3OYN A;  3K1R B;  3CMA I;  5HHH A;  1R9T J;  3GIM A;  2MH9 A;  5FFZ A;  5FRN A;  3SDG A;  1JXE A;  2BHN A;  1KQQ A;  4P0Q A;  3FKJ A;  3DQV C;  1P7J A;  1SVO A;  1ZAO A;  2YMP A;  1ZN2 A;  3A0H C;  3SYT A;  2CV1 A;  1KFT A;  3GFK B;  2V6C A;  2LHT A;  2PMH A;  2XAU A;  1AA7 A;  2IGK A;  5JRT A;  3HPO A;  1PK3 A;  4JMU A;  1SD4 A;  2F4M B;  3OYC A;  4Z6Y A;  1JHF A;  2CU7 A;  4RNO A;  4FZN A;  2K9Q A;  2K4H A;  3NGD A;  4RQ3 A;  2D6F C;  4A0Y A;  2ZJ8 A;  2CMP A;  2COM A;  3EUK L;  3QQA A;  3F23 A;  3L09 A;  5J8C A;  4DQQ A;  5ICE A;  2K4E A;  1D9F A;  4XLE A;  1RR8 C;  5HMM A;  3V8L A;  3AL0 C;  1ENH A;  2A07 F;  3CF5 F;  3T79 A;  3K4N A;  4HX4 A;  2G08 A;  1ZQA A;  5JLX A;  1MSF C;  4ECU A;  3CDL A;  4U87 A;  2NRX A;  3BJO A;  4OMY A;  4XOP A;  5DB8 A;  1VF9 A;  4I2J A;  3HKZ C;  2LF8 A;  3W6J B;  2NO4 A;  1ZKG A;  2DKZ A;  4RB2 C;  3IWZ A;  2DQR A;  3CC7 I;  3LFK A;  2ZXW H;  3BTI A;  4PJJ A;  3DTK A;  5LGU A;  2O61 A;  1DPR A;  1D8J A;  3S3N A;  4XKC A;  5F08 A;  5GAD J;  3VDX A;  4RA2 A;  1A31 A;  2DOD A;  2F5F A;  4UVC A;  1YJ9 I;  2VE9 A;  1U78 A;  4C8L A;  5DTD A;  3GTG J;  3SYZ A;  3F8C A;  1N61 A;  2Y9Z A;  3VWB A;  5EG0 A;  3RKY A;  3E7L A;  3WG7 H;  2EDU A;  2FE9 A;  2HVS A;  3OYD A;  2XV4 S;  3GUD A;  3FIW A;  4WCG A;  3TW7 A;  3E6M A;  3OL3 A;  3T5J A;  1FFV A;  3WGG A;  4PZN A;  4YD2 A;  2Y9U A;  4TQS A;  5ALN A;  5KFV A;  1X2M A;  3MGI A;  5KTQ A;  2EZK A;  2Y1I A;  1IUF A;  3K4K A;  3WTS C;  3JTG A;  1J97 A;  1LDD A;  5J6X A;  1WJF A;  2HOF A;  3M8J A;  4ANJ A;  5LEK A;  2Y0S N;  4EM1 A;  2ME6 A;  5M5X J;  4NWI A;  1PVE A;  4RGX A;  2VJJ A;  2A5Y B;  4QPO A;  2JMG A;  1FEZ A;  1HKQ A;  2QQ9 A;  3FHN A;  3HKZ A;  5FD6 A;  3HGG A;  4FTH A;  2RQ5 A;  1JI8 A;  2WF8 A;  2W9B A;  4F92 B;  5AI0 A;  2DXI A;  4LLG F;  4R79 A;  2EWN A;  2E8P A;  2M4K A;  2N8G A;  4ON0 A;  2BZT A;  2HCF A;  2DOA A;  3CJR B;  3RKQ A;  3P9I A;  2Z3Y A;  4BY7 J;  5ALX A;  3S2H J;  5J8Y A;  3GYH X;  2DTR A;  1ZQR A;  3RBE A;  4AYB N;  4G94 A;  2KZM A;  3ICX A;  5ALS A;  1X40 A;  1BOA A;  5F27 A;  5KT5 A;  3CQZ J;  5D49 A;  3V6J A;  3OYK A;  5KAI U;  1BJZ A;  2DMT A;  4D9J A;  3MAB A;  1TQM A;  2DKX A;  5K5O A;  2LBO A;  1YX3 A;  4US8 A;  3SI8 A;  3ZP5 A;  4KLD A;  8ICO A;  3PW0 A;  3LAJ A;  2AU0 A;  1C7Y A;  2E5Z A;  4KMF A;  5DG7 A;  2ECB A;  3K0L A;  2OYY A;  1QPM A;  2JRM A;  2VA2 A;  2HS5 A;  3K70 D;  2YB1 A;  4ECX A;  5DGB A;  4D5C A;  4A3D J;  1ZGW A;  1WJA A;  4OIQ F;  2KRC A;  3GFI A;  2LP0 A;  1T95 A;  1ZG5 A;  4Z6D A;  2F1I A;  5KFN A;  3KP5 A;  3F8N A;  2HKO A;  2O8K A;  3BG6 A;  3G4S I;  1UFM A;  3I4M J;  1T7P A;  5F0C A;  2OV7 A;  4HW0 A;  1SIJ A;  4I27 A;  9ICO A;  3B02 A;  2L3D A;  2G5H B;  1JUS A;  4BUP A;  5AIC A;  2V9K A;  3CP8 A;  1F9N A;  4DL2 A;  4MF2 A;  4ZDP A;  1A5J A;  3HW8 A;  5EF6 A;  5ALF A;  1UG0 A;  4RQ5 A;  1RNL A;  5CQE A;  4Q8F A;  4DL3 A;  2ZB9 A;  2EV5 A;  5AM0 A;  2VJ5 A;  3GTO J;  3M1Y A;  3RPU A;  1HW5 A;  4NLB A;  1N5W A;  3HUG A;  2X1C A;  5C4X J;  3DF8 A;  2YX4 A;  3IG8 A;  2W4S A;  2GWS A;  1IXR C;  4M6Y A;  5IOZ A;  3KZZ A;  4KX3 A;  2VBW A;  2XKP A;  5D5X B;  1HW2 A;  1ZTR A;  1ZQM A;  7ICN A;  3GV8 B;  5A2Q K;  2KD1 A;  1HSJ A;  3QUC A;  3U9G A;  5DG9 A;  2IOH A;  2YX7 A;  5IT9 Z;  4IRI A;  5AK6 A;  2DA4 A;  2XAG A;  2EZZ A;  2K5C A;  2RAE A;  4XLA A;  3RYR A;  3OYL A;  5HML A;  5KFT A;  1NZB A;  2HTJ A;  1HUO A;  1PDN C;  2WHE A;  1L8O A;  2HDC A;  5ALY A;  3KZX A;  3DKY A;  3HM5 A;  2R8I A;  3WU0 A;  5EGO A;  1ZR2 A;  1SAU A;  4DNC A;  1W36 C;  2XGQ A;  1ZQZ A;  3ASN H;  2W9A A;  2QZ8 A;  3BTC A;  3H0G J;  3F8F A;  2K60 A;  3HRS A;  1QTM A;  1N63 A;  4JV1 A;  4ZYG A;  1MBJ A;  1XMX A;  3Q9V A;  1U4B A;  4KLG A;  5ALH A;  2K40 A;  2JEF A;  3ERE D;  1KFD A;  1BPD A;  2MA1 A;  4TUR A;  4RB3 C;  1XSX A;  2NYX A;  5LRS A;  1HST A;  1FOK A;  3E0F A;  2DJN A;  4IX7 A;  1JRO A;  4DCC A;  1S10 A;  4X5V A;  3NWT A;  5GTH C;  1WWV A;  1TT5 B;  4FE4 A;  4UB8 C;  4IHS A;  3SQN A;  5KFJ A;  2VAN A;  4Z6E A;  5J0R A;  1O08 A;  4M74 A;  3M3Y J;  3OYJ A;  3ECH A;  2A69 F;  3D5R C;  3M9A A;  2B0C A;  1LVA A;  4I7H A;  4D1Q A;  1GHC A;  2ODG A;  3FHZ A;  2P81 A;  3J7A Y;  4OD0 A;  4MTE A;  1B1B A;  1WYG A;  1P7D A;  1LQ1 A;  4F52 A;  1ZQP A;  4J9K A;  1QGP A;  2RV8 A;  5HLT A;  4CIC A;  2IT0 A;  4IQV A;  5KFC A;  3ZMV A;  1Z6R A;  3G2B A;  4U7C A;  4AVZ A;  4GC6 A;  3DPU A;  1XCB A;  2JPC A;  1DU0 A;  4Z2Y A;  4YRV A;  1RXV A;  2M30 A;  1QH9 A;  4HRI A;  2BGW A;  3WHC A;  4BE2 A;  4I2I A;  2Y0S A;  1JIH A;  1MH4 A;  4X0G A;  1KL9 A;  2QBY B;  4O3O A;  3SD7 A;  2FLN A;  3VCB A;  3FBI B;  4EX7 A;  1STZ A;  3ZQQ A;  3PO2 J;  2NRZ A;  4R66 A;  3ZD8 A;  2VJI A;  1O4X A;  2W3R A;  3BTL A;  2V26 A;  3HYI A;  2YB4 A;  5KFU A;  3PST A;  1U45 A;  3LST A;  3QPL A;  3AEV A;  5IT3 A;  3PSP A;  5KL8 B;  2CFX A;  3K9T A;  3K1Z A;  2CW0 F;  3RR8 A;  4XLC A;  2D3D A;  2BDU A;  2ZIV B;  3KZI C;  3W6K B;  4C4S A;  2ZJQ F;  4IF4 A;  2XGD A;  3VYT B;  2KHV A;  1GV5 A;  1AU7 A;  4UW9 A;  4J9S A;  2A05 A;  2FLP A;  1M1E B;  2HU9 A;  3DV9 A;  1MMN A;  3L00 A;  2VL8 A;  2MAX A;  3SFI A;  4YXM A;  3V8K A;  5J1R A;  1F1Z A;  2HHW A;  1ZLJ A;  2FNP A;  1TNS A;  2ISY A;  1OCO H;  4XLP F;  4IZZ A;  1K61 A;  4KIF A;  4DQI A;  1ZJN A;  2WAE A;  4NUB A;  2XUB A;  3KYD B;  3E0J B;  2B7E A;  2EV6 A;  2L5Y A;  2A19 A;  2ASL A;  3HC7 A;  1ZH5 A;  2GQQ A;  2OF7 A;  2ZTC A;  4G9Y A;  4ZYD A;  2AQE A;  3D1N I;  3W6V A;  3WTY C;  4U0V A;  5FRM A;  2JWT A;  4S0H B;  1SV4 A;  4K4I A;  3MCZ A;  1S77 D;  2HMX A;  2KP7 A;  2BGC A;  4E7L A;  1SZH A;  2BY3 A;  4ECT A;  4BBR J;  1JT6 A;  2MC4 A;  3RJK A;  1T0F C;  3F72 A;  5D8K B;  3IL2 A;  3KBB A;  3PY8 A;  1ZQC A;  1TAU A;  3N05 A;  3P9C A;  2QM3 A;  1VQ4 I;  4XOR A;  3FKI J;  3K6G A;  4G12 A;  1XS9 A;  5EYR A;  5J2F A;  5L3C A;  2VOD A;  2X6W A;  2AO9 A;  5TIS C;  3JSP A;  5ALL A;  1UHU A;  3B73 A;  4BYY A;  3TL4 X;  1NOM A;  1I1G A;  2NO5 A;  1R00 A;  4G8X A;  4L18 B;  2LYB A;  3E3V A;  3OHA A;  3V72 A;  4BE0 A;  3BQ0 A;  2NRT A;  2E1E A;  3GO5 A;  2W8K A;  3WE2 A;  4WXC A;  3Q8Q B;  1X1A A;  1Y88 A;  2P5K A;  3RJP A;  5L1J A;  3QPH A;  2ZUC A;  2DMU A;  1BI1 A;  4BGD A;  1GVD A;  4KN4 A;  3TAD A;  4OAZ A;  4CCK A;  2ASD A;  9ICU A;  2IGO A;  2MGQ A;  3PSF A;  3OYI A;  2ISZ A;  5J1U A;  7ICS A;  3RKX A;  2XSD C;  3AKZ A;  1SGG A;  4IHX A;  4BHP A;  2EZX A;  4F5R A;  3T5L A;  2D45 A;  4IL6 C;  3HRU A;  2QEX I;  1A6S A;  3HKZ F;  2QVO A;  5M3M J;  5LFA A;  2ASJ A;  1ZQD A;  2GIV A;  1BI3 A;  2XRO A;  2EAP A;  4KIB A;  1S76 D;  1L6N A;  1S5L C;  2F48 A;  1Y1V J;  1ECW A;  1X9X A;  2DOF A;  2NRV A;  4OCZ A;  5ERI A;  1IM4 A;  1DK2 A;  2QGU A;  1BW6 A;  1IN8 A;  3JAM K;  2LR8 A;  8ICP A;  2MFZ A;  4YG2 F;  3KIO A;  2ESN A;  3MKL A;  4E4H A;  1VI0 A;  2LF7 A;  3M1C A;  1FYL A;  1L7O A;  2KZV A;  5DDM A;  4EEF G;  2RDJ A;  1T3N A;  4DS5 A;  2MRL A;  2DLL A;  4IXA A;  3M8F A;  2KJ5 A;  3BRO A;  4ASN A;  3COA C;  3S15 J;  5DDY A;  5KG2 A;  4F7Z A;  1O3T A;  4KYW A;  2AJQ A;  3C21 A;  3VPR A;  1QQ5 A;  3UPQ A;  1YRN B;  3C1Z A;  2ZSI B;  3QUB A;  5ALE A;  9ICF A;  1M6Y A;  1QSY A;  2I6X A;  3L2W A;  1P7I A;  1RUO A;  3OWT A;  2XHK A;  1YJW I;  3V7S A;  4G7O F;  4QWA A;  5GAE J;  2QLZ A;  1FO4 A;  2DDA A;  2VT3 A;  4UUT A;  4CH7 A;  1T2K A;  3A02 A;  3SHF A;  2ATL A;  3SV4 A;  3Q8S B;  5J4Y A;  5JVT A;  1IDZ A;  3R6S A;  2AGP A;  2JRT A;  1WGX A;  1FFU A;  2E1F A;  4V19 K;  1ZOL A;  3VEP A;  1D1C A;  1FWZ A;  3BQY A;  1SMY F;  2I5U A;  4RQ7 A;  2BY2 A;  4UUS B;  2IA6 A;  4LG0 A;  4ECR A;  3CUO A;  3NUQ A;  4B47 A;  5J0T A;  1FNN A;  2DPJ A;  3J7Y J;  2EZL A;  5E8G A;  3RPU D;  3A4C A;  3WTW C;  4UAU A;  2JZB B;  1NK9 A;  2I5H A;  2BYV E;  3SAH A;  2A1J B;  3TAC B;  1ZQX A;  2CJJ A;  3IWF A;  4M9N A;  1E2X A;  5J4V A;  4YR0 A;  1UHM A;  2KHM A;  1XO0 A;  4YMM A;  8ICZ A;  1DP3 A;  2PJR B;  1X58 A;  4WXD A;  4QPQ A;  2DW4 A;  1O3Q A;  2V4R A;  8ICW A;  4F71 A;  9ICM A;  4UY8 I;  2DA7 A;  4B9L A;  3TAR A;  1CUK A;  3QYB A;  5IIL A;  1OFC X;  3AUO A;  1MC8 A;  4A8E A;  2PMZ N;  3TAQ A;  3MR2 A;  1XSP A;  3MKW B;  2NVY J;  3FM3 A;  3U1D A;  1EF4 A;  1EH6 A;  4M9X A;  4HBL A;  1ZRF A;  1IXC A;  4EGZ A;  3JPR A;  3M7G A;  4A3M J;  2KN7 A;  1X4O A;  3TOA A;  1X3W B;  1S6L A;  3BR3 A;  5BPI A;  5GP9 A;  1IV6 A;  3H4B A;  4F4Y A;  2JEG A;  3MQ0 A;  5J47 A;  1UB9 A;  1ZRE A;  5DB6 A;  3N7R C;  1O3R A;  3PO4 A;  1TWA J;  3CES A;  2CV2 A;  1NK2 P;  3DEE A;  4P5O A;  3HGY A;  3NEU A;  4RPY A;  3G3Z A;  1MBK A;  4Y2T A;  4PJ0 C;  5FRO A;  1GDT A;  4CNQ A;  2IVM A;  1Z3Y A;  3PM1 A;  3I55 I;  1Z00 B;  4B9U A;  4KLH A;  5J0S A;  4LB6 B;  1MNM C;  2LFB A;  3SAG A;  1U9O A;  2ZNZ A;  4QZF A;  2O6G E;  1HKT A;  4C8M A;  1LVH A;  3L7W A;  1A6I A;  2DOE A;  4HA8 A;  1VQP I;  4KJZ A;  2AGO A;  2HBK A;  3V6K A;  4ZZL A;  1LEB A;  1NNL A;  1TP4 A;  2W00 A;  4LIT A;  1MND A;  5DD4 A;  1NJY A;  1FEX A;  3IHQ B;  4I0B A;  3WTZ A;  1ZQK A;  3V42 A;  5DM7 F;  3QRF F;  4I2E A;  2G9W A;  5F0H A;  4GIB A;  5KFM A;  3ZQI A;  1SXD A;  5JI6 A;  3GTQ J;  3J81 j;  4DL4 A;  3UQ0 A;  3Q8R B;  4J01 A;  3BQ2 A;  5KT3 A;  4HPQ A;  4UB5 A;  2FML A;  3FF5 A;  3TO7 A;  2BQ3 A;  3BQT A;  4IHW A;  1Q1H A;  2EAO A;  1YIO A;  4CSW A;  2IXS A;  3H8W A;  2ZG6 A;  2VKH A;  3HPG A;  4CYD A;  1F5T A;  1MGT A;  1SWW A;  4C2T A;  3WTV C;  2WTE A;  4B9N A;  3UKG A;  1HXD A;  4UAW A;  4LGW A;  4BS9 A;  1KTQ A;  5K7Z A;  2GOL A;  8ICT A;  4IOC F;  3H9G A;  1FYK A;  3CCY A;  4AYB F;  5HHI A;  3N4M B;  4M0A A;  5K1Y A;  2F1J A;  2H1L A;  2HHX A;  2GOX B;  1BR1 A;  1KYZ A;  2JMW A;  3CCM I;  2W11 A;  3BJA A;  1FTT A;  8ICE A;  4BU2 A;  1VQ9 I;  4Q5S F;  4P2H A;  4M2Y A;  3TP3 A;  2KHQ A;  2DT7 B;  2W03 A;  3IKV A;  2VIX A;  3ASO H;  1E3H A;  3GEZ A;  2CWE A;  1HDD C;  1HA8 A;  1BI0 A;  1LE8 A;  1HIW A;  3VC8 A;  5GPC A;  3MDA A;  5L3E A;  2FBH A;  3GQC A;  1H38 A;  2KOB A;  1NG7 A;  4M73 A;  2R7O A;  2LBF B;  3SEQ A;  4QW9 A;  3X2Q H;  1T3Q A;  1ZRM A;  3BQ7 A;  2M9N A;  4EBC A;  3OSN A;  3TQN A;  1NKB A;  4BJ6 C;  4M47 A;  3DBH B;  1OR7 C;  3QOP A;  3Q5F A;  5DQH A;  2G0E A;  1Z1V A;  3H35 A;  2K4P A;  3GTM J;  5KFR A;  4DSL A;  2KK0 A;  4XN0 A;  3RFA A;  1CQT A;  3ZI4 A;  2DAO A;  1BW5 A;  2BCU A;  1FOX A;  2H5X A;  3S6J A;  2DTZ A;  4HAI A;  4N4O B;  5IYD J;  4F2S A;  4PPX A;  2VLA A;  3ETL A;  4DSE A;  1XC9 A;  2JVH A;  1Z77 A;  4PDK A;  2H1K A;  3JPP A;  2PFP A;  2PI0 A;  3QU4 A;  5CWR A;  1SEU A;  5E17 F;  2W54 A;  1VQ5 I;  5KG7 A;  4P4M A;  2DU9 A;  2KDO A;  4AYB A;  2MA3 A;  4XRM A;  2YMQ A;  1UHW A;  2D2W A;  3DLL F;  3FK6 A;  3GTL J;  4XLN F;  3B9J A;  4F72 A;  1TK5 A;  2R4G A;  2RKH A;  1RKT A;  3K1P A;  1TFR A;  1B43 A;  5LD2 C;  4HOB A;  5CA7 A;  3UQ2 A;  4LIV A;  3Q8P B;  2HPI A;  4AIJ A;  4F50 A;  4O9M A;  1H88 C;  2DFH A;  2W84 A;  1R7J A;  4YD1 A;  1UMQ A;  3OIO A;  5HS9 A;  1JKQ C;  3OTQ A;  2XCP A;  5EE0 A;  4U0W A;  2P0W A;  2JXJ A;  3JRA A;  2OTJ I;  3VYU B;  2EFP A;  2C2E A;  1OYY A;  4YII A;  5KFF A;  3MEX A;  1SD5 A;  3HOT A;  1DK3 A;  3V7L A;  1IAW A;  4CF5 A;  3JPO A;  2F5C A;  1IGN A;  2LKP A;  1QQI A;  3G1O A;  1NG6 A;  2DMQ A;  3FXK A;  2NVQ J;  2E7W A;  1NK6 A;  4HAM A;  7ICT A;  2Q8K A;  1X42 A;  1WJC A;  2ZTE A;  1MW7 A;  1OYW A;  3BS5 A;  2XCA A;  1T94 A;  1ZRN A;  1W5C C;  4USA A;  4DO9 A;  4M9H A;  1WJE A;  3RYP A;  1Z19 A;  1XMA A;  1B8I A;  2R7D A;  5CVR A;  3OYH A;  1VTN C;  4LJX A;  4NC6 A;  5AI8 A;  2UXN A;  7ICE A;  1T8I A;  2PG4 A;  2F4O B;  4AM3 A;  2HGC A;  1DXS A;  4ECV A;  1NJW A;  3DEW A;  5LBQ A;  4A3F J;  4DSF A;  2QUF A;  4DQP A;  1JKO C;  3QUQ A;  1RZT A;  4XL9 A;  1WJB A;  3ZGK A;  3TAN A;  1AKH A;  2C2R A;  2CW8 A;  3RKW A;  1ZQV A;  2LYA A;  2AQ4 A;  4QWD A;  1SKS A;  3DBL B;  4B48 A;  5HLI A;  2KPM A;  4RMN A;  2XC7 A;  2H27 A;  2AHO B;  4PL1 A;  4F4W A;  1FOY A;  1UA1 A;  1NKE A;  3K4L A;  3P5J A;  4CUG A;  2LMR A;  2K86 A;  2W7O A;  1EH7 A;  2RDP A;  2OUM A;  1KBU A;  4R63 A;  3HOS A;  3E5U A;  5AK4 A;  3WHB A;  2GXA A;  7ICP A;  3QP6 A;  3K70 C;  2QSF X;  2JA5 J;  1LKY A;  2OH2 A;  3FDY A;  2BQR A;  2GBY A;  4G7H F;  4RQ6 A;  3JRI A;  3BPX A;  4QZ8 A;  4XN3 A;  2Y30 A;  2XGE A;  4YXJ A;  4RNN A;  2O8X A;  4RQ1 A;  3MD2 A;  2W48 A;  5J8F A;  5FLV A;  3ABK H;  2LC2 A;  1LPQ A;  2FX0 A;  2M3A A;  3LSJ A;  5E8I A;  2YSR A;  2AXT U;  1WRJ A;  5CJ9 A;  5EOZ A;  2Y1J A;  3Q8M A;  1G3W A;  3CCV I;  2IOF K;  2IBD A;  4Z6F A;  4MF8 A;  2HHT A;  1HDP A;  1WFX A;  2L7F P;  2QQ8 A;  3F8M A;  1BA5 A;  4DFD A;  4GDF A;  3PZP A;  2F4I A;  3GII A;  4OJ6 A;  4CRX A;  1X1D A;  3S8P A;  4RB0 A;  5DD8 A;  4YQW A;  1C0W A;  2LY1 A;  1B9M A;  8ICL A;  9ANT A;  1LB2 B;  4MO7 A;  2FXA A;  2PFO A;  4JV2 A;  4K2E A;  1D5V A;  4DF4 A;  1RDF A;  3ABL H;  2R5Y B;  2PFN A;  2HW3 A;  2M0M A;  8ICJ A;  2HQ5 A;  2OZ6 A;  1QPI A;  1K1Q A;  2K8C B;  4YEL A;  4UB4 A;  4EYH B;  1X1B A;  4W1U A;  1IC8 A;  2BXY A;  4A0Z A;  3FMR A;  1K78 B;  5KFO A;  2W9M A;  1XSV A;  1J59 A;  2DFE A;  1ETX A;  2IJL A;  3T0Y A;  4HQM A;  2HWV A;  4KFC A;  2KQR A;  4C9Y A;  4FS1 A;  2CQX A;  5B1B H;  3L2C A;  5BMZ A;  2FOK A;  4OJP A;  4DGW B;  3R9K A;  4PHP A;  2Y75 A;  4QZD A;  9ICS A;  5JUM A;  3RJG A;  3PX4 A;  3S14 J;  7ICQ A;  2FLL A;  3JSO A;  1UAA A;  1S9H A;  3CLQ A;  2K9S A;  2R8J A;  2VC1 A;  3OYM A;  2DPI A;  5CLS A;  1ZGA A;  3ABT A;  5EZG A;  5HNH A;  1GVJ A;  1ODD A;  2XAS A;  1P4X A;  2Z16 A;  3E6D A;  3GME A;  4UXN A;  2XO7 A;  4N9I A;  4TV7 A;  3LNQ A;  3OIQ A;  4DS4 A;  1VQK I;  1I50 J;  3JRE A;  1N60 A;  5KFH A;  1MD0 A;  3BY6 A;  3SZT A;  2FDR A;  3R60 A;  3EUH C;  3HG9 A;  1OKR A;  4Q4Z F;  5FLX K;  2WB1 C;  2MD5 A;  2R18 A;  2JA7 J;  2NRA C;  2Y9T A;  4H0E A;  1POG A;  2JT1 A;  4KN7 A;  4JV0 A;  2R7R A;  4R64 A;  2ZJP F;  3E6B A;  4ED1 A;  2FD5 A;  2E2H J;  5CR0 A;  4ZC3 A;  2CUE A;  4NBQ A;  9ICN A;  5KFQ A;  4NL9 A;  3HHH A;  3LQQ A;  4KMU X;  3ONN A;  3VYS B;  2VI6 A;  3SEZ A;  1COK A;  1WH7 A;  2H09 A;  2L7Z A;  4CCN A;  4BDY A;  5KCM A;  1T4G A;  4BDZ A;  3D6J A;  3O3K A;  5ALQ A;  3I53 A;  2DCE A;  3M9N B;  5JHU A;  1A76 A;  3E2E A;  2HZD A;  2LY2 A;  2WAQ C;  2Y48 A;  4ECW A;  2X6Y A;  3HTU A;  3IN5 A;  2ALZ A;  9ICL A;  1HQC A;  3BT9 A;  3OYA A;  1ZJM A;  3H8J A;  2G7H A;  3M8E A;  2L0K A;  4P55 A;  4G9B A;  3OIP A;  5KL1 B;  4OIR F;  2ZIV A;  3CJN A;  5DBA A;  3CNH A;  3LSI A;  3CYM A;  2E5N A;  1Q1V A;  1BM9 A;  2ZIW B;  3H1C A;  3CUQ A;  3KP4 A;  4O5E A;  2ZXJ A;  1R4M B;  3BR2 A;  7ICK A;  1NK0 A;  4M3B A;  3ULQ B;  3LYS A;  2HXI A;  2XF5 A;  3LA3 A;  4ED8 A;  5JR3 A;  1D8L A;  2ME0 A;  4M3G A;  2IRF G;  5F6F A;  2JA8 J;  3FM9 A;  3BWG A;  3V8J A;  3AMZ A;  2JN6 A;  4WWC A;  2FJ1 A;  5CP2 A;  3I64 A;  2W1O A;  3QUT A;  2J6S A;  2E35 A;  4MHG A;  4MQV A;  3IH4 A;  2QSH X;  4MEX F;  5KAF U;  1N5X A;  2XY5 A;  1MKM A;  2R3S A;  1QZZ A;  5FKN A;  3CCE I;  2E34 A;  1SVL A;  2WF9 A;  4GC7 A;  5JLW A;  1W5S A;  3PO5 A;  2HOS A;  1QLN A;  3HXL A;  3MR5 A;  1T33 A;  3KLO A;  3HHG A;  2VT2 A;  5KG0 A;  4PGY A;  3BZ6 A;  3DKX A;  3OPX A;  3HEF A;  1YW8 A;  4DZJ A;  1PP7 U;  3F2D A;  3WK8 A;  4G3I A;  2FOW A;  2GA2 A;  1PZN A;  2IS1 A;  4PZJ A;  2DYR H;  4NL9 C;  5CB1 A;  2X9D A;  5FD5 A;  4BQQ A;  3H8M A;  1QSS A;  1F0M A;  2GLE A;  5TIS U;  2Z33 A;  1R58 A;  5ALT A;  7ICU A;  1D8K A;  2MSY A;  3QZ7 A;  8ICC A;  2XKO A;  5BOM A;  2FNA A;  2HI0 A;  4MEY A;  5C5J A;  2Q0O A;  4FAS D;  3NRZ A;  2V79 A;  2YPR A;  1U5T B;  4B6J A;  2R5Z A;  2QBY A;  5D4S A;  4BQN A;  3OYE A;  4KTQ A;  4KN7 X;  2WY8 Q;  4IPA A;  2W25 A;  1S7O A;  2GH1 A;  2EIM H;  3IDW A;  1F4K A;  5A0L A;  3EPI A;  1S0N A;  2ISP A;  1FP2 A;  2P7C B;  4XLH A;  3EYY A;  3CME I;  5E1Z B;  3NWS A;  2ID3 A;  1T08 B;  4ENK A;  3UXO A;  4EBD A;  3HSE A;  3LA2 A;  2IHN A;  1PJR A;  5JHF A;  3IM1 A;  5CHG A;  2OQR A;  3C23 A;  1NKC A;  4RQM A;  4Y2V A;  3I5U A;  1ZLK A;  3NRW A;  3TI0 A;  3ZDD A;  3C1D A;  3LSG A;  3IHU A;  4EM2 A;  3A1Y A;  4ZYA A;  2JSC A;  3GFL A;  1WCL A;  1X2I A;  3BLY A;  3VYR B;  4XA5 A;  5L3F A;  1IJW C;  1MMS A;  3A03 A;  1HJP A;  5EWG A;  4QZH A;  2NOG A;  5IIM A;  2BCV A;  7ICI A;  2PFB A;  4YIR X;  3KP3 A;  1S97 A;  2ZFU A;  2FPK A;  3H36 A;  4F5O A;  4M9G A;  5HLH A;  1QQ6 A;  4U6P A;  1WVR A;  3ROU A;  2IA0 A;  3QX7 A;  4U0Y A;  2P5L C;  4M6X A;  3RR7 A;  4LK0 F;  2COB A;  2HI3 A;  5F0F A;  3H3V K;  5BOL A;  5EE1 A;  4F5N A;  1R5I D;  3ZDE A;  2KJC A;  2LSO A;  4A5M A;  4LLL A;  1JGG A;  3T5K A;  3KP2 A;  2E1N A;  2JH1 A;  2ZIX B;  2JQ7 A;  4XKB A;  2CPR A;  2E8N A;  1S7E A;  5E3L A;  2D1H A;  3QPT A;  4HNU A;  4O0I A;  5IYB J;  3F8B A;  3D5S C;  1X9W A;  2V1X A;  1DRG A;  1BR4 A;  1Y8R B;  3A2K A;  4I2A A;  2HVQ A;  3F22 A;  3OL4 A;  4EX6 A;  2FF4 A;  1ZQH A;  2X1E A;  1L8L A;  1QBJ A;  3LSP A;  2VAS A;  3F9K A;  1EH8 A;  1ZQJ A;  2VXZ A;  1FMV A;  1BIB A;  1EA3 A;  5GTH U;  2E1M B;  4L0Z B;  3G1L A;  4KLM A;  9ICP A;  2XAH A;  1SKW A;  4EZ9 A;  4L9J A;  5AKH A;  1TQP A;  3PNT A;  5FGM A;  1ZR4 A;  3ZDA A;  2EIK H;  4GCV A;  1ON1 A;  2WB1 N;  3OOP A;  4B4C A;  1SL1 A;  1KDH A;  5J2C A;  3FXR A;  3RPQ A;  4E7Z A;  5FLM J;  1CI4 A;  4UB1 A;  3RJH A;  4JK1 X;  2Z2S B;  2BHZ A;  5AIP A;  3QU2 A;  3ZDC A;  1XN7 A;  3T5H A;  1RQN A;  3C2K A;  2MU2 A;  1O57 A;  3CUQ B;  2PJP A;  4CZC A;  5GTI U;  2MBF A;  5DS9 A;  4UAV A;  4Y2X A;  5B66 U;  1IRF A;  1J0R A;  1KEJ A;  1ZQS A;  2UWM A;  2IBK A;  4C8O A;  3K69 A;  4OWR B;  5CVJ A;  3AU2 A;  3F53 A;  3KTQ A;  2H8W A;  2M4G A;  4O5V A;  3F0C A;  5L9X A;  4YN4 A;  1ZQL A;  2FU4 A;  2A3S A;  4C80 A;  2DPU A;  1YG2 A;  3KLN A;  5CKT A;  2K89 A;  1XGM A;  5FB2 A;  2NYV A;  1V5E A;  4NLC A;  1FIP A;  2FBK A;  4NQW B;  4RZR A;  5J0X A;  2ZSH B;  2AH5 A;  4DOC A;  2ZME B;  1UZC A;  5ALM A;  9ICI A;  3RJJ A;  3Q0V A;  4PJ0 U;  1SAN A;  2M8E A;  2QKL B;  3NTU A;  5ALG A;  2O03 A;  3LSK A;  4EEY A;  1ETK A;  1V3F A;  2VOO A;  3D5L A;  1VDV A;  3BOQ A;  2WB1 F;  3ALR A;  4M04 A;  1ZQT A;  2ZCW A;  3LSM A;  2QAR B;  4IQT A;  4QWQ A;  4NV0 A;  1IF1 A;  4JUZ A;  5KG3 A;  3M9M B;  2IHM A;  2LYC A;  5D8L B;  3PFY A;  4HSR A;  3RB6 A;  2OTL I;  2F76 X;  3ZXS A;  5D5U B;  1K6O A;  2HDO A;  4RQ0 A;  2EZI A;  1W0T A;  4GLX A;  1KN5 A;  4KLT A;  3SJM A;  2HKX A;  2FPM A;  3KFU F;  1TZL A;  1IG7 A;  2PEX A;  3IV6 A;  1CRX A;  4I2C A;  4QZI A;  2R7V A;  3FXQ A;  4PH5 A;  2R7Z J;  4NQW A;  2EZH A;  5J0O A;  1SD7 A;  2ZME A;  2M7A A;  1WPK A;  4HLX A;  4FHT A;  1X2N A;  5H6Q A;  4C2M J;  4OIO F;  1U6G A;  2HQA A;  5TGT A;  4B1R A;  1URJ A;  1Y56 A;  2LI6 A;  1D1A A;  4HZF A;  3ZMZ A;  1V97 A;  3KP6 A;  5DEQ A;  3S93 A;  5EJC A;  5KHD A;  3L2U A;  7ICJ A;  1Y6I A;  1A36 A;  2GAU A;  4HV6 A;  2VQC A;  4DOB A;  2LRE A;  5HNK A;  1LFB A;  3TO9 A;  1U47 A;  2L5Q A;  1PVQ A;  4MFF A;  2R8G A;  1SL2 A;  1XSL A;  4R65 A;  1L5U A;  2K3F A;  1CEZ A;  1YIJ I;  3KP7 A;  2CYY A;  1K4T A;  1MJ9 A;  4BQA A;  2GOM A;  2J5P A;  8ICI A;  2ZME C;  2LM4 A;  1ZYR F;  2EQY A;  3K2Z A;  4LJZ F;  5J2K A;  3V6H A;  2A6E F;  5K5Q A;  1OMI A;  3JW4 A;  3TGN A;  4B3A A;  4J19 A;  2BCQ A;  4RLQ A;  1A77 A;  4I99 C;  1P4W A;  3F5A A;  1KFS A;  4CA0 A;  5DB7 A;  4YFN F;  3J7A O;  2PX9 A;  4YR2 A;  3G6V A;  4IHT A;  3PW5 A;  2F5V A;  3TED A;  2K02 A;  5LEJ A;  2XDV A;  1ON2 A;  3MZH A;  3GV5 B;  4F3O A;  4HLY A;  2DYS H;  2WA0 A;  3CCR I;  1FX7 A;  2X85 A;  2K3P A;  3A01 A;  3CO6 C;  3OHB A;  3OGU A;  3NVW A;  4DYQ A;  2HYG D;  2GO7 A;  1NK5 A;  3S2D J;  5B5E U;  4RUC A;  5IP9 J;  3F3X A;  4M6W A;  1ZGJ A;  2KKP A;  4XQ8 A;  4Q45 A;  4ECY A;  3H9Q A;  4Q48 A;  5GPA A;  4WXH A;  4V2F A;  2JV3 A;  2XRL A;  1OCZ H;  1U3E M;  2DA3 A;  1LDJ A;  2KIQ A;  4M3D A;  4Y13 A;  1ZQO A;  4M9J A;  8ICV A;  2QKM B;  1SFU A;  4NXZ A;  4ELU A;  2E1M C;  2HYJ A;  5DG8 A;  3R4K A;  5AKZ A;  5DBB A;  4UBB A;  2K85 A;  4RDU A;  3HX0 A;  4NLG A;  1V5G A;  3PML A;  3I59 B;  3FK7 A;  4BWJ A;  4JX6 A;  3GZ6 A;  5KFP A;  4YIF A;  1WI3 A;  4I76 A;  2Q0Z X;  3HIL A;  2LY9 A;  2KE7 A;  5F9L A;  4W97 A;  1BIA A;  1ERD A;  2F6C A;  2YN4 A;  3JRB A;  2KDZ A;  4AID A;  3PW2 A;  4DYR A;  5KFI A;  5F9N A;  2VN2 A;  1JJ8 C;  1Y39 A;  3EWA A;  4YMN A;  4B43 A;  7ICF A;  1ORK A;  2BOL A;  2V9V A;  3I1Y A;  2BHY A;  1MN8 A;  2J5O A;  5BPD A;  2KIU A;  3RZO J;  1YZ7 A;  4EGY A;  1YLF A;  4M9Z A;  1AOY A;  3RTR A;  2H94 A;  1G3T A;  1YT3 A;  4UUS A;  1IG6 A;  2L9V A;  1XPX A;  3CO7 C;  2PLY A;  3HP6 A;  2Q2E A;  5HR6 A;  3QEB Z;  3CMM A;  2I10 A;  2B21 A;  4PZO A;  8ICY A;  5ED4 A;  2KLO A;  5L3D A;  2DK8 A;  3BG5 A;  4QW8 A;  2OJE D;  1ZD2 P;  4DEZ A;  3K10 A;  1IIP A;  1R22 A;  4ED7 A;  3MFH A;  4I2G A;  2QB0 A;  3GZN B;  2FMP A;  5J2B A;  4C3I J;  3JRG A;  1ZQU A;  5HDN A;  5J0W A;  3KHR A;  2QAR A;  3S3M A;  1J5Y A;  4UB3 A;  1ETW A;  1RYU A;  1KQ0 A;  3FZV A;  5EEH A;  2GM4 A;  4ZTJ A;  3LWL A;  1MDM A;  2VBY A;  4NJ8 A;  3C29 A;  4L5J A;  3E97 A;  3ETR A;  3M7D A;  3Q3S A;  5C44 J;  1ULY A;  1G59 A;  3H5A A;  2J6U A;  5IP7 J;  4XMY A;  2EIJ H;  5KFS A;  2HYF A;  2L01 A;  3SQI A;  2F2A B;  5IIJ A;  4J03 A;  4ZH4 A;  3HWT A;  1E3O C;  3FIS A;  4BE1 A;  1XG1 A;  2DO7 A;  2LD5 A;  4J9R A;  4FX4 A;  5AI5 A;  3EQL F;  5ICF A;  4WJ3 B;  2KZG A;  1R6R A;  3NVY A;  2E19 A;  2EJR A;  2KL4 A;  3WU2 C;  5IP6 A;  2DL0 A;  2VKD A;  4GXI A;  5HR7 A;  1FOW A;  1OLT A;  4KIC A;  4C0Z A;  3IP4 B;  4UQG A;  4MFE A;  4PJM A;  3PJR A;  5ALP A;  1ZD3 A;  3IKT A;  1ZQ1 C;  2W9B B;  2H3F A;  4XNF A;  4GXJ A;  1A04 A;  2FEZ A;  1YE9 A;  3OMY A;  3H0L B;  4KLQ A;  5AKK A;  4HG2 A;  3BJY A;  1IN4 A;  2FBI A;  2GZW A;  2PMZ C;  4F93 B;  3M1E A;  2KIW A;  1N75 A;  2XAF A;  5J0P A;  3EPZ A;  1B72 A;  3AM9 A;  1D3Y A;  2L54 A;  5IYC J;  1OUQ A;  1FSH A;  2DF4 B;  2STT A;  3T3F A;  4HYE A;  1QRY A;  1Q46 A;  1TKD A;  4AC0 A;  3CJQ B;  2KIC A;  4IQU A;  2O5R A;  3LK9 A;  4MHV A;  3ISD A;  2QSG X;  8ICF A;  3KKA C;  2ELK A;  2F8L A;  1QHH D;  4ENN A;  4UHT A;  3OOU A;  3C1Y A;  1NHA A;  1MBF A;  5CVI A;  4E70 A;  2A3V A;  3ZPL A;  1Z1D A;  2JA2 A;  1D0X A;  2VJ4 A;  4PSW A;  5LLQ A;  3KCC A;  2D5V A;  5G5G A;  4DFK A;  4CYC A;  4HQE A;  1XSD A;  1CF7 B;  2Y0S F;  1JHH A;  3QNM A;  1S8N A;  2DBB A;  3GZF A;  4EQQ A;  3RH6 A;  1IDY A;  1OIS A;  2OC6 A;  3NAU A;  5K7F A;  2AQ0 A;  5AM5 A;  1ZQY A;  2ADU A;  4XK4 A;  4IQW A;  3WTU C;  3HDD A;  2ACJ A;  4A3G J;  3W2V A;  1B0X A;  2DDB A;  1YIT I;  5E1X A;  2D8C A;  4EV0 A;  5IT9 K;  5B5E C;  1X6J A;  1MMD A;  1U9L A;  2LK2 A;  2JPB A;  4O3Q A;  2XC9 A;  1KU3 A;  4BUG A;  2HPM A;  1TWC J;  1J2N A;  3WG9 A;  3KX2 A;  3QAH A;  3KD3 A;  5ALO A;  4UV9 A;  5AKI A;  2CQK A;  4MFA A;  3FBN B;  3H3U A;  4IRD A;  3O0F A;  1BVS A;  5CEH A;  2F2E A;  3K1M A;  2KEY A;  5DUI A;  4QTR A;  2G07 A;  3CD6 I;  1NZP A;  2V9W A;  8ICS A;  1R1U A;  3PNY A;  2VA3 A;  1NJZ A;  2IPQ X;  4A2U A;  4ED6 A;  5III A;  5LRR A;  1KU7 A;  5KK1 A;  3L2R A;  4MIM A;  1YW7 A;  1AQ6 A;  3ZMT A;  2XPW A;  3MWM A;  2V4Q A;  1SFE A;  3IH2 A;  4O6J A;  4HDU A;  2XF6 A;  4HF1 A;  1DGJ A;  1JI7 A;  2LM1 A;  3KHL A;  4JP0 A;  3LWF A;  4O3N A;  1X3U A;  5EG0 B;  2KT0 A;  3ZCO A;  5J2G A;  3GU3 A;  4QZ9 A;  2UVU A;  3I56 I;  4G6T B;  3KEQ A;  1G2H A;  4DF8 A;  1MJA A;  3SR6 A;  4IS7 A;  1OXJ A;  4Q44 A;  4BXO B;  3GLL A;  4MFD A;  3QU6 A;  2YUS A;  4CZZ A;  3G73 A;  2DJI A;  4KN4 X;  3E58 A;  3DPT A;  1X1C A;  1B9N A;  4DFP A;  1ZAR A;  4LZG A;  2EBI A;  3C18 A;  3RQI A;  4A3J J;  1O03 A;  3OYG A;  1U8B A;  6PAX A;  4KLE A;  3IAM 2;  3D2S A;  4L9N A;  3LVV A;  1SD6 A;  2Z99 A;  2P4W A;  3RH5 A;  4ELT A;  2F1H A;  4HF2 A;  4B8X A;  5AM4 A;  7ICV A;  1XU4 A;  3GF2 A;  3WU1 B;  1SKR A;  3ZMD A;  4KIT B;  1FLI A;  2HSZ A;  3UM9 A;  1QQ7 A;  2WV1 A;  5DYM A;  4E7S A;  4CGZ A;  4KMO B;  1L3U A;  2EAN A;  1K1S A;  1V9P A;  2QB0 B;  4OJL A;  5CRX A;  1RYR A;  3GFM A;  1OYI A;  4ZOH C;  7ICO A;  4ZDL A;  5EWF A;  2ICW G;  2ISO A;  2BBY A;  3BR1 A;  3MR6 A;  4XSX F;  4Y4R A;  1MH3 A;  1JX4 A;  4O5C A;  2DA2 A;  4OIN F;  1HOM A;  1HCR A;  2OCC H;  3WTT C;  3DV8 A;  4RPX A;  3RAQ A;  2ESE A;  4M72 A;  1SVM A;  1H0M A;  2OXO A;  4BXO A;  5J2J A;  2ZFW A;  2QKQ A;  2VPL A;  1N56 A;  2P66 A;  3DXJ F;  2XAQ A;  3SZG A;  4YCX A;  9ICV A;  3MN2 A;  2YS9 A;  1GT0 C;  3Q8L A;  4EAT A;  4G6D A;  2QQB A;  4J9P A;  4IQ4 A;  5CQG A;  1FY7 A;  2GIZ A;  5H2F C;  2HBM A;  4B9T A;  1N78 A;  1I3A A;  5GAH J;  3L1P A;  2EK5 A;  2V1D A;  4NLZ A;  3IH3 A;  4US9 A;  2R5Y A;  4P4P A;  3DBR B;  2UUZ A;  2XIC A;  3I3L A;  4FCY A;  4Y2S A;  4ZZD A;  5J2I A;  5B66 C;  1XX5 A;  5GTI C;  1I39 A;  2BVL A;  4JX4 A;  4KA4 A;  3OY9 A;  3L3F X;  3LVW A;  2OPT A;  1T8E A;  5LHH A;  3DWL E;  3SDB A;  3AN1 A;  5TZV A;  1LJ9 A;  2JTV A;  4II3 A;  4ESJ A;  4YVZ A;  1LUJ B;  2VBX A;  3OJU A;  4L9T A;  3CCQ I;  2UVV A;  2WWY A;  1YO5 C;  3FXU A;  2FE3 A;  2FUG 2;  2OD5 A;  3MZ8 A;  4ZYE A;  1ZRD A;  4GFB A;  4Y2Q A;  5AM3 A;  1K5O A;  4QIW C;  1ZQN A;  4RS8 A;  3PMN A;  2EA4 A;  2CXY A;  4FS2 A;  4Y2R A;  2I1Q A;  2L4A A;  2V6E A;  2EAM A;  4IR1 A;  2CG4 A;  4LOC A;  3MMY B;  2EIN H;  1AKH B;  1UPH A;  1Z21 A;  3PR4 A;  2BZF A;  3CUQ C;  2OHF A;  1S8O A;  1MMG A;  2B0L A;  4LFU A;  2F44 A;  5JU5 A;  3MVP A;  1QZE A;  1Z9C A;  1TL8 A;  4KDP A;  1OCP A;  1K83 J;  3DEU A;  2EFW A;  2EIL H;  2P6S A;  2Y9Y A;  2R7S A;  1MBH A;  1SAX A;  5KFY A;  2Z1D A;  1F36 A;  3W2W A;  2X48 A;  3WGH A;  2R5Z B;  4DL5 A;  1HUZ A;  2LTP A;  3M8S A;  3RB4 A;  3H7I A;  3ONQ A;  1X4P A;  4HF0 A;  3GTJ J;  1N2X A;  3AQE A;  2K8A A;  1U2W A;  4P9U A;  1J2X A;  3K75 D;  4BX9 C;  1XGO A;  2GXG A;  4IO9 F;  1ZQQ A;  5JFR A;  4RQ4 A;  5KFL A;  5TRD A;  4A3E J;  2O7O A;  1VQ7 I;  4S04 A;  3M6Z A;  5HDG A;  1GUU A;  2UZK A;  3N7P D;  5KG4 A;  4BKX A;  4QZG A;  2HOA A;  4F5P A;  1VFC A;  2KFD A;  1ZRC A;  2IOF A;  2CQ7 A;  3WK7 A;  3U2R A;  3AL0 B;  3F6O A;  1PYV A;  4JWM A;  1FPQ A;  2ZKZ A;  1W7P D;  4KLI A;  2JK3 A;  2WB1 A;  1I3Q J;  1XCV A;  5KNL A;  2G7U A;  3BR0 A;  3C2B A;  3EUH A;  2WAD A;  1VJ5 A;  3N97 A;  3KKA A;  4UAR A;  1P4A A;  2O9L A;  4F4Z A;  3LWM A;  4KLS A;  1Q8K A;  4AUX A;  2KIF A;  4OIP F;  2E36 A;  3EUB 2;  2YMM A;  3IAS 2;  4M3E A;  4C30 A;  5J3L A;  1U9N A;  1MSW D;  2ZIW A;  2PMZ A;  5B1A H;  4CXF A;  1TW3 A;  1AWC A;  3K4J A;  5D46 A;  3A0H U;  3MBY A;  4DQR A;  5F1R A;  3F6V A;  2HHQ A;  5HLG A;  5IIK A;  1ZQ3 P;  1ZK8 A;  3JRF A;  1VZ0 A;  3PR5 B;  1PP8 F;  4KLO A;  1H89 C;  4EYI B;  2LNB A;  4C3J J;  3BG9 A;  4UVB A;  2XGX A;  2B63 J;  3HUG B;  2BE5 F;  2BY0 A;  3FMS A;  5E3M A;  1T39 A;  5ALJ A;  5DQI A;  5HS8 A;  3HOX J;  4CF3 A;  8ICH A;  3PFI A;  4EJO A;  3CLO A;  4IEJ A;  3BCA A;  1JKR C;  2G09 A;  2WF6 A;  4FZL A;  4BDP A;  4O3R A;  3K7A J;  2PKE A;  2P6U A;  3K1N A;  1PUE E;  2DQN B;  4D5F A;  4J9Q A;  2IEK A;  1ZG3 A;  5F1J A;  3HRD D;  2YR2 A;  5EDN A;  2BW3 B;  5KFK A;  2OWO A;  3LA7 A;  1Q3U A;  3KYC B;  3NQO A;  4LIU A; 
#chains in the Genus database with same CATH homology
 3C2G A;  3D5R C;  4FAS D;  4D1Q A;  3J7A Y;  4E7J A;  2HBJ A;  1P7D A;  4BQN A;  3GBG A;  4F52 A;  4CCM A;  3OYE A;  5HLT A;  2G06 A;  2WY8 Q;  2GH1 A;  3G2B A;  4U7C A;  2G5I B;  4AVZ A;  2BW3 A;  3DPU A;  5A0L A;  4OJ5 A;  4YRV A;  4PJN A;  4XLH A;  1MNE A;  4HRI A;  2CRX A;  4YEJ A;  3NWS A;  4BE2 A;  2A6T A;  1PJR A;  2Y0S A;  5JHF A;  4X0G A;  1PVP A;  3OS2 A;  2RP5 A;  3FBI B;  3VCB A;  3ZQQ A;  3AQF A;  1D8B A;  3PNV A;  3MKY B;  2VJI A;  1PVR A;  2V26 A;  2YB4 A;  3PST A;  3NRW A;  1XNS A;  1U0J A;  2IS6 A;  3LSG A;  4HNT A;  3PSP A;  5KL8 B;  3A1Y A;  4ZYA A;  1Z1B A;  1DGW Y;  3K1Z A;  2MAB A;  3BLY A;  3VYR B;  4XLC A;  2BDU A;  2ZIV B;  3H5N A;  3PL8 A;  4OJO A;  1Z7L A;  3SAF A;  3VYT B;  4BJT A;  2KHV A;  2W82 A;  2XSJ C;  2ZFU A;  2HU9 A;  1MMN A;  2VL8 A;  2HBL A;  3IG5 A;  4U6P A;  3CF2 A;  3K4C A;  2R7X A;  3RQ4 A;  2CN1 A;  4IZZ A;  1TAM A;  4FZM A;  2NOJ B;  2WAE A;  4NUB A;  4ZJZ A;  5HVQ C;  4BAC A;  3E0J B;  2H3V A;  2W7P A;  4U7B A;  3HC7 A;  3PSI A;  1KON A;  2JH1 A;  2ZIX B;  4DJA A;  2CPR A;  4XKB A;  2AQE A;  3W3C A;  2IS2 A;  4LG3 A;  2RQQ A;  4HNU A;  2ZIU B;  5FRM A;  2LKY A;  3D5S C;  4BQO A;  2L2O A;  2HMX A;  1DRG A;  4E7L A;  1SZH A;  1BR4 A;  2JUG A;  3A2K A;  2HVQ A;  3DU6 A;  3OL4 A;  4B3X A;  2MC4 A;  1T0F C;  2X1E A;  2HVR A;  4FE3 A;  2IS4 A;  4PK4 A;  3N05 A;  2H3Z A;  2VAS A;  3F9K A;  2VXZ A;  2Q1Z B;  1FMV A;  4XOR A;  3K6G A;  3LMM A;  1EA3 A;  4BEH A;  3BC8 A;  2E1M B;  4E7I A;  4KIS A;  2X6W A;  1Q3V A;  4NC7 A;  2Z7J A;  3TL4 X;  3RF9 A;  4QJF B;  2LYB A;  3PNT A;  2LG4 A;  4CDG A;  4BE0 A;  2JH7 A;  2L7K A;  2E1E A;  4E7Z A;  3F5E A;  3DTI A;  2Z2S B;  4Y33 A;  2H3I A;  1X1A A;  3LSH A;  4BEH B;  4IQJ A;  2ZIX A;  1V5F A;  4BGD A;  4KT6 A;  4CZC A;  3KYL A;  4OAZ A;  4CCK A;  3VSL A;  2IGO A;  3PSF A;  3OYI A;  3HPH A;  1K6Y A;  4AYB C;  2UWM A;  2NV3 A;  1DQU A;  3AKZ A;  3QOD A;  1LFP A;  4OWR B;  2X1D A;  3F53 A;  2M4G A;  4CCO A;  3KEY A;  4PFO A;  1A6S A;  3HKZ F;  2DGZ A;  4BXF A;  5LFA A;  3CRX A;  3OR2 C;  5CKT A;  1WUD A;  2K89 A;  3I9V 2;  4NLC A;  1V5E A;  3L2V A;  3H0M B;  4NQW B;  4QNL A;  1L6N A;  2ZSH B;  1ECW A;  2VQL A;  2QKL B;  3LFU A;  3LSK A;  2R7T A;  1WJD A;  2MFZ A;  4DBR A;  3D5L A;  4E4H A;  2RRD A;  2WB1 F;  3ALR A;  3M1C A;  5T14 A;  2KZV A;  3LSM A;  3S3O A;  4NV0 A;  4NNJ A;  1Z3X A;  2MRL A;  2LYC A;  3PFY A;  2KJ5 A;  4HSR A;  1QU3 A;  2F76 X;  3ZXS A;  2VB6 A;  3LL7 A;  3BG7 A;  2ZSI B;  2E5S A;  3L2W A;  2K9L A;  3OWT A;  2H3Q A;  2X51 A;  4P0P B;  4B44 A;  1TZL A;  3KFU F;  1CRX A;  1BR2 A;  4FET A;  2CW7 A;  2R7V A;  3H0R B;  4CH7 A;  3CP2 A;  4PJL A;  5C0Y A;  2CFO A;  2KMU A;  1D0Y A;  3CZ6 A;  2M7A A;  2E1F A;  1D1C A;  2HQA A;  2V1N A;  5TGT A;  1URJ A;  1Y56 A;  3U21 A;  1D1A A;  4XON A;  2G0A A;  2N1R A;  3F2C A;  4P0P A;  3NUQ A;  3S93 A;  4B47 A;  5KHD A;  1LVK A;  2K4I A;  1GLN A;  2HDW A;  4E7H A;  3L2U A;  3C28 A;  1Y6I A;  3RPU D;  2DT6 A;  3A4C A;  2VQC A;  3D2Q A;  2LRE A;  3BCB A;  1PVQ A;  3F2B A;  2L5Q A;  3SAH A;  3DTE A;  1P9Q C;  1WJ5 A;  1BOB A;  4MLO A;  3RCO A;  2GOM A;  2VQG A;  2M0N A;  3UR3 C;  2KHM A;  1XO0 A;  1DP3 A;  2PJR B;  1IRX A;  4F91 B;  4QPQ A;  3H9J A;  3QYB A;  2R7Q A;  4RLQ A;  4N4N B;  2KKV A;  1A0P A;  3ZR8 X;  4CA0 A;  3F5A A;  4A8E A;  3MKW B;  2F5V A;  2XDV A;  4BJQ A;  1D0Z A;  2WA0 A;  3D2N A;  2ZXH A;  2X85 A;  2X6X A;  2K3P A;  3HL2 A;  1X4O A;  4ZTF A;  2LBF A;  2L9N A;  3AFH A;  4ZDO A;  2KKP A;  3H9Q A;  3PUB A;  3N7R C;  2KVC A;  1MMA A;  4OO1 J;  3CES A;  2CV2 A;  3DEE A;  4P5O A;  2QKM B;  2E1M C;  2A5W A;  2KP6 A;  5FRO A;  1V5G A;  1Z3Y A;  2K9M A;  3E1S A;  2JGA A;  2WAQ F;  3SAG A;  1ERD A;  2F6C A;  3L2Q A;  4OAY A;  4KJZ A;  2HBK A;  2BVM A;  3S32 A;  4GFJ A;  2W00 A;  4LIT A;  1MND A;  4B43 A;  2BOL A;  1HEK A;  3TMO A;  3V42 A;  2CH0 A;  4XQF A;  3RTR A;  2ZXI A;  3OYJ A;  4XKV A;  1YT3 A;  3ZRG A;  4J01 A;  4HPQ A;  5HR6 A;  2JSP A;  3K4B A;  3CMM A;  3EUA A;  4Y3O A;  1SFK A;  2KLO A;  2UV1 A;  4AU7 A;  4XR6 A;  4CSW A;  2IXS A;  2VQH A;  4E7K A;  2Y0S C;  2MYS A;  2ZG6 A;  2VKH A;  2E60 A;  1ZEL A;  3K10 A;  2CUZ A;  3HPG A;  4BL0 B;  1IIP A;  4PFP A;  2RHF A;  1X19 A;  4C2T A;  2YX8 A;  3K4M A;  3S3M A;  4BS9 A;  3SMV A;  3MKZ A;  2GOL A;  3H9G A;  4AYB F;  4JQF A;  4ZTJ A;  5CPR B;  2I8D A;  4ITV A;  3C29 A;  2GOX B;  1BR1 A;  3M7D A;  4IKF A;  1G59 A;  4BU2 A;  3H5A A;  2WAF A;  4XMY A;  2DT7 B;  2KHQ A;  2W03 A;  3SQI A;  2VIX A;  1HIW A;  2F2A B;  1HA8 A;  3VC8 A;  4BE1 A;  5HOO A;  3M6K A;  2Q2E B;  2KRH A;  1UEL B;  2KOB A;  1NG7 A;  3C2H A;  4WJ3 B;  1R6R A;  2W04 A;  2R7O A;  4NC8 A;  4P1W A;  2LBF B;  3SEQ A;  2KL4 A;  4RLF A;  1ED1 A;  2VKD A;  3OYB A;  5HR7 A;  3QYE A;  1OLT A;  4BJ6 C;  2KJ9 A;  2AQF A;  1OR7 C;  3IP4 B;  4XKW A;  3L3F X;  4C0Z A;  3PJR A;  3H35 A;  4PJM A;  1ZQ1 C;  3RFA A;  4XN0 A;  2H3F A;  3DLA A;  4XNF A;  3OS1 A;  1J09 A;  1YE9 A;  1YX5 A;  3OMY A;  3H0L B;  1F44 A;  4HG2 A;  4N4O B;  3H0D A;  2VLA A;  2PMZ C;  2MD0 A;  2JVH A;  4F93 B;  2KIW A;  1N75 A;  3EPZ A;  4DOZ A;  2LRD A;  2JHD A;  2DF4 B;  4GRI A;  1OUQ A;  2XVT A;  4H4K C;  3RSN A;  4AYB A;  2KDO A;  2WBM A;  3N7S C;  2LOO A;  3CJQ B;  2KIC A;  2O5R A;  2HOQ A;  2PJR A;  2R4G A;  2K8B B;  1TT0 A;  4P0Q B;  5LD2 C;  2F8L A;  1W36 D;  1QHH D;  4LIV A;  3VSK A;  2HPI A;  3OOU A;  2A3V A;  4PSX A;  2JA2 A;  1D0X A;  2VJ4 A;  4PSW A;  2V7F A;  2P0W A;  2Y0S F;  4XM3 A;  3GZF A;  3VYU B;  2OC6 A;  1DGR M;  3HOT A;  2WAQ A;  4DIQ A;  1NG6 A;  2F77 X;  3W2V A;  2Q4T A;  3TBI A;  4QIW F;  1MMD A;  1WJC A;  1MW7 A;  4BUG A;  1MA7 A;  2HPM A;  1T94 A;  3KX2 A;  1FMW A;  1WJE A;  3FBN B;  1Z19 A;  4KX5 A;  3O0F A;  3OYN A;  3OYH A;  3UNG C;  2KEY A;  2R7W A;  5FRN A;  2G07 A;  4P0Q A;  3FKJ A;  3PNY A;  3DQV C;  3SYT A;  2CV1 A;  4II2 A;  3L2R A;  3QOE A;  4HST A;  2LHT A;  2XAU A;  1AA7 A;  2IGK A;  4JOM A;  1WJB A;  4XL9 A;  3ZGK A;  4JMU A;  2HNH A;  2XF6 A;  3OYC A;  4CCJ A;  2CW8 A;  2LYA A;  3ZCO A;  4FZN A;  2RNG A;  2K4H A;  3GU3 A;  4B48 A;  4PL1 A;  2KPM A;  4G6T B;  4RMN A;  2XC7 A;  2D6F C;  2CMP A;  3EUK L;  3K4L A;  4CUG A;  2K4E A;  2CV0 A;  4XLE A;  2W7O A;  2DJI A;  3AL0 C;  2OUM A;  1X1C A;  3DPT A;  1KBU A;  2XF7 A;  3HOS A;  3T79 A;  3K4N A;  2G08 A;  4PUS A;  3OYG A;  3D2S A;  3K70 C;  3IAM 2;  2OH2 A;  4U87 A;  3FDY A;  3OR1 C;  3LVV A;  4XOP A;  4XN3 A;  3HKZ C;  4BJ5 C;  3MD2 A;  2LC2 A;  4KIT B;  2M3A A;  2PMZ F;  4PJJ A;  3DTK A;  2L9S A;  4E7S A;  4KMO B;  4CGZ A;  3S3N A;  4XKC A;  4OJL A;  3VDX A;  5CRX A;  1WFX A;  2VKQ A;  1LKX A;  4HEA 2;  4ZDL A;  3PZP A;  2F4I A;  4OJ6 A;  3VWB A;  4CRX A;  1X1D A;  3S8P A;  4PL2 A;  2CUJ A;  4Y4R A;  4F55 A;  2HVS A;  3OYD A;  2LY1 A;  3OL3 A;  2OXO A;  2M0M A;  2VPL A;  2K8C B;  4YEL A;  3SZG A;  1X1B A;  4EAT A;  3K4K A;  2HOF A;  4F3Q A;  1WJF A;  3M8J A;  4IQ4 A;  4RM2 A;  5CQG A;  4ANJ A;  2HBM A;  4NWI A;  2IGM A;  1N78 A;  2V4J C;  3OS0 A;  2VJJ A;  3DPL C;  4QPO A;  2JMG A;  2KNJ A;  3FHN A;  3HKZ A;  2KQR A;  2UUZ A;  4C9Y A;  3I3L A;  4J00 A;  1JI8 A;  2XIC A;  4F92 B;  2DXI A;  2BVL A;  1LDK B;  4OJP A;  4R79 A;  3OY9 A;  3LVW A;  2M4K A;  4DGW B;  1N77 A;  2M7B A;  3DWL E;  3SDB A;  2DOA A;  3CJR B;  4II3 A;  2XI9 A;  2LH9 A;  1UAA A;  1S9H A;  3ICX A;  2FUG 2;  4C2U A;  3OYM A;  3OYK A;  3DU5 A;  4RM3 A;  4QIW C;  4D9J A;  5HNH A;  2LBO A;  1YX3 A;  2V6E A;  2Z16 A;  2E5Z A;  4IC9 A;  3OIQ A;  3MMY B;  1UPH A;  1Z21 A;  4ICA A;  1E0E A;  1MMG A;  3EUH C;  3HG9 A;  2OYY A;  3MGV A;  2R7S A;  2WB1 C;  2R18 A;  3K70 D;  2YB1 A;  1WJA A;  2Z1D A;  3W2W A;  2KRC A;  1T95 A;  1GO3 F;  1QHG A;  2R7R A;  2ZIU A;  4XLF A;  4CCL A;  3ONQ A;  1X4P A;  4ZC3 A;  3BG6 A;  3AQE A;  2K8A A;  4E6K G;  2KV2 A;  2OV7 A;  2WY7 Q;  3ONN A;  3VYS B;  4BX9 C;  3SEZ A;  2OM6 A;  2G5H B;  4BUP A;  2ELJ A;  2V9K A;  3CP8 A;  4CCN A;  5KCM A;  4BDY A;  4BDZ A;  4ZDP A;  2DCE A;  3M6Z A;  3N7P D;  2HZD A;  1UG0 A;  4DBQ A;  2LY2 A;  2WAQ C;  5CQE A;  2X6Y A;  3IN5 A;  3OYA A;  3AL0 B;  1PYV A;  2VJ5 A;  3OIP A;  4NLB A;  5KL1 B;  2ZIV A;  2X1C A;  2WB1 A;  3LSI A;  5KNL A;  3CYM A;  2E5N A;  2W4S A;  3IG8 A;  2WAD A;  2ZIW B;  3OYF A;  2W7N A;  4KX3 A;  3W2A A;  2HOI A;  2CS3 A;  3LYS A;  3H5R A;  2XF5 A;  2KD1 A;  2K5C A;  3IAS 2;  4XLA A;  4C30 A;  3OYL A;  1NZB A;  2W1O A;  2ZIW A;  1G8X A;  2PMZ A;  3KZX A;  3K4J A;  3DKY A;  1D1B A;  2KJ8 A;  1SAU A;  1W36 C;  1VZ0 A;  2R7U A;  2JVG A;  3HXL A;  4O3M A;  2IGN A;  3DKX A;  3HUG B;  3OPX A;  4XOT A;  3IUO A;  2XID A;  2MA1 A;  3F2D A;  3BCA A;  2RRE A;  3E0F A;  2IS1 A;  3QYF A;  2G09 A;  4FZL A;  2VXD A;  4IX7 A;  4ACO A;  4BQQ A;  2DQN B;  3NWT A;  2BW3 B;  1Q3U A;  5HNF A;  4LIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...