3IP4B

The high resolution structure of gatcab
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
482
structure length
482
Chain Sequence
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Two distinct regions in Staphylococcus aureus GatCAB guarantee accurate tRNA recognition
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Ligase
total genus 168
structure length 482
sequence length 482
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ip4B03
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3ip4B02
2D6FC 1NG6A 4WJ3B 3H0LB 2F2AB 2G5IB 3H0MB 2DF4B 3H0RB 2DQNB 3IP4B 2G5HB 3AL0B 3KFUF 1ZQ1C
chains in the Genus database with same CATH superfamily
4JWMA 2GQQA 4GFJA 2G7UA 1S5LC 4ECTA 1R58A 3OYKA 1CF7A 1BPDA 3D2SA 2I8DA 3SAGA 3EUHC 5CQEA 5D5WB 5HHHA 2YS9A 3DBHB 3H0GJ 2L01A 3AQEA 3HSRA 4UB5A 9ICHA 3RZDJ 5AKGA 5TGTA 4IKFA 4RUCA 5FFXA 7ICJA 4IRIA 2AO9A 2LKXA 5E20A 4EM0B 5BMZA 1XWLA 3TKAA 3ZN1A 3F23A 3J81K 2DGZA 4RQNA 3I0TA 2HHSA 5JLWA 1A5JA 1IAWA 2HOFA 2EZXA 1YZ6A 3FHNA 4A3EJ 1AU7A 4DFMA 2YUSA 1Z6TA 3G1MA 1Q3VA 4PHEA 1SL2A 3THVA 4OIRF 5H2FC 2VBYA 4ECUA 4UB3A 2FUG2 4FZLA 2P5KA 5DG7A 2NOGA 1FBUA 2HXIA 2A6EF 3MKWB 4IL6C 3EYZA 3EUKL 3JSPA 1YS7A 2KZGA 4A6DA 2OAZA 3PSPA 4KMUA 2PMZF 2V9WA 1T3QA 1PJRA 2F5CA 3B9JA 4N4NB 2YX4A 1DPRA 3WGIA 2EZHA 4Z6EA 4RLQA 4ENNA 3T3FA 1BNOA 3LDAA 2EZIA 2D6FC 1MA7A 2FLPA 1LNWA 1S7OA 3DBLB 2MYSA 3GFJA 2G5IB 5D4BA 1B59A 4CDGA 3H35A 4RB1A 1W5SA 3RJKA 2R8KA 4ECSA 5CKTA 1ZYQA 2ZTEA 2HOIA 2XGEA 1GO3F 2E2IJ 5HLHA 1TAQA 2F8LA 3WHBA 2JRZA 3GTMJ 3QOPA 2M87A 4H4KC 1JUSA 4XIDA 3ISDA 1K1SA 2K86A 2ZUDA 3AQFA 3CO7C 2IT0A 4J9KA 2VQGA 2DBYA 3KD3A 1K5OA 3WU1B 2P4WA 4P0QA 4J00A 2IA1A 2IGNA 2FPLA 2K9QA 3LFUA 1HC8A 1VI0A 1WJDA 4I2IA 4WF2A 5HS7A 4MFCA 4BXOB 5AM5A 1FIQA 4HA8A 3PW0A 2AGOA 4MFEA 3SEZA 3D2NA 1S7EA 2IS1A 1S5LU 3AU6A 2B6GA 1VDVA 3MQ0A 3K6GA 3AFHA 2VT3A 3ZQQA 4ESJA 4OIPF 1UQVA 2RAEA 4M2YA 1J7KA 1JHFA 2LG4A 1U78A 3OSPA 1L5UA 3IH2A 1S6LA 5M5XJ 5BQTA 2DODA 3CZ6A 8ICTA 1P7IA 2CV1A 2F4IA 3B6AA 4FE7A 5LFAA 3RAQA 2R5YA 2KD1A 1XB4A 2VKVA 5KK1A 4CCOA 1ITYA 1SMTA 3KHRA 2COBA 3LWFA 3QAHA 2CGPA 4EX7A 1XGNA 4DO9A 2M3AA 4TURA 3RYPA 2W25A 2ZIUA 2W85A 5D5VB 1DOQA 2XGQA 4G8XA 1SKRA 3F0CA 3OYDA 3ZP5A 2PMUA 3IWFA 4P96A 2DQLA 5D8KB 3JRHA 1MSEC 2F6CA 2JZBA 3T5HA 2A05A 2M0MA 5DGAA 5H2FU 3FX3A 5D4RA 3HPHA 4I99C 3H0DA 1X9XA 5E8GA 4O0IA 4RBOA 5IIKA 5K7HA 3FBIB 4U87A 1KQ9A 4IRGA 5AM3A 2CWEA 1FJLA 3TP0A 1LE8B 4XLFA 2CJJA 4RUAA 4YVZA 2O9LA 1QTMA 1UELB 3UXOA 3I4MJ 5ICGA 1FBQA 1G3SA 2E36A 2F5EA 3OSGA 1JI7A 2I5HA 1UPHA 4RT3A 4BEHB 2L7MP 2DJIA 2CV0A 2EIMH 3KPHA 4S05A 3RPQA 3I5UA 3BTJA 1MDMB 2UVRA 3J80Z 1LFUP 4BY1J 1D5YA 3HDDA 1S97A 2DO7A 3CCEI 3C1YA 5C3EJ 1FOWA 3SMVA 2A61A 2RNJA 4IHYA 2RN7A 3ETLA 2X1DA 1MBEA 2HZDA 2DTZA 1B9NA 5CPRB 3C21A 2Y1JA 3PV8A 2HPMA 4CGZA 4QZFA 4KUMA 4ED0A 4DYRA 3IN5A 3K4GA 4BUGA 4DL5A 2MAXA 1TKDA 1IRXA 2IP2A 1HA8A 5H20A 2RV8A 3K10A 4XRHA 4W97A 4JWNA 3QU5A 4C7ZA 4E0DA 1ZJMA 2WF6A 4OJLA 2WAFA 5E1XA 1BC8C 3T79A 1J75A 5HDNA 2GH1A 2FE3A 5DM7F 5J2FA 2OYYA 3L2QA 3SDBA 3Q8MA 3LVWA 3ASOH 2AQEA 1LV5A 4JV1A 3MR2A 3GV7B 5DEQA 5EE1A 3HKZF 4RQ8A 2XCAA 3OYAA 2CRXA 5IYCJ 2DQRA 3G3ZA 1MMGA 1ZQRA 4XLCA 1V55H 3W6VA 3MKZA 1J2NA 2E3TA 5L3DA 1MBFA 1WWUA 4UAZA 1KLNA 1KU3A 3PM1A 1ZQ3P 2NVXJ 2BHNA 4EX6A 4F5PA 2ZSIB 3GEZA 3VB2A 3HL2A 1XDUA 5BOLA 2ELJA 2Z33A 2F8KA 2CH0A 5DUIA 3S3OA 2YMMA 2TCTA 1ZQAA 1E3PA 2XY6A 4XKBA 4CCNA 3RR8A 1I50J 2HWVA 1EH8A 2RC4A 5FKOA 4E7KA 1IC8A 1U2WA 2FPMA 2G7HA 1RKWA 3CYMA 3QUTA 5KT2A 3MDCA 5J29A 7ICFA 1YW8A 2VBWA 2QB0A 2EA2A 5AM2A 1QO0D 3RBEA 3HWTA 3NRVA 1GDTA 9ICOA 3PIOF 3TGNA 1D0YA 2KSOA 1NZBA 1S0NA 3RB6A 5AI9A 3F8CA 3PQKA 4L18B 4RAZA 4QIWF 1ZQ1C 3K1MA 4DL2A 4EEYA 2XY5A 1ED1A 4NUBA 2W7NA 3IG5A 1GXQA 3QNMA 1ZTRA 2XO7A 4YRVA 3IUOA 3ZR8X 3W2WA 3OY9A 1UHMA 3C23A 2YR2A 4Q48A 3QP6A 3WK6A 3SFIA 1OCOH 2K8CB 2BDUA 3ZQ7A 2HBLA 2HBKA 1XDSA 4LGWA 1FYKA 3EW9A 3C2KA 1IN4A 1IN6A 1R1UA 2OM6A 3DTKA 2LMDA 1SV0C 1IM4A 2JR5A 2GXAA 3F8MA 1SVOA 2ZSHB 4KX3A 7ICRA 4LFUA 2XSJC 4GCVA 3PQJA 4E70A 2K9LA 1YZ7A 3NGDA 2R7TA 3FM5A 1ZD5A 4KLTA 1NOMA 1S0VA 2GO7A 3WTTC 3V8LA 1YHQI 1ZG3A 1QQ5A 2W9BA 2DQNB 2E7XA 1MBJA 4O3SA 2ASJA 2PJRB 4XQ8A 1MBGA 1NH3A 4M0AA 8ICRA 1KA8A 1LJ9A 4XQFA 5F0HA 1SFXA 4YEJA 2VE9A 4HDUA 5ALZA 5ALFA 2LNBA 1G6NA 1BI2A 1JUMA 5GTHC 3ISCA 1ZH5A 1E17A 3MEXA 2DOAA 4I98B 1DGWY 1BW6A 4Y17A 3TEDA 1X6IA 2DPUA 3F2DA 1TW3A 2GIVA 1GXPA 1I27A 3HRSA 3BPXA 4IXAA 5GADJ 4J9SA 1IIPA 3W3CA 4R1HA 4DQRA 2ZJ8A 3JW4A 4Y7NJ 1FO4A 4WK8F 2XC9A 4BNCA 2PMZC 5GP9A 3M1CA 4EMSA 4ED7A 1I3QJ 2W84A 2PFNA 1D1BA 4DQIA 2M8EA 3JTHA 2YU3A 1IRFA 5KFXA 2E1CA 1YT3A 5AHXA 3QYEA 4LD5A 2KIVA 5JHFA 2XGCA 2BHZA 2MFZA 4RM3A 2KHVA 4RQ1A 1U3EM 4XICA 1W7PD 2DOEA 4LMYA 3PMLA 2Z3YA 3I3LA 4C8NA 5A2QZ 1YG2A 1SXDA 4RNMA 2H3ZA 4BXOA 1XS9A 3PJRA 4USAA 3HIFA 3BR5A 4QJFB 4XSZF 1OR7C 4DSLA 2UVVA 4Q4ZF 2VJ5A 1YRNB 2HDOA 2M7BA 2A5YB 4ECQA 2ES6A 1VQNI 5KFRA 2KPMA 4UAVA 2W8LA 2CRGA 2I5UA 3S1MJ 4LITA 1TV9A 5IOZA 3CCQI 1YFHA 1V97A 3NASA 3E58A 5E1ZB 1SFUA 5F0FA 3CCVI 5EE9A 3C2HA 4QSHA 2JRTA 2P7CB 1GV2A 2NRXA 3H3ZA 5LRSA 1APLC 3HKZN 2R3SA 1ON1A 1IXRA 1MC8A 3LQQA 1BIBA 3C2GA 1MKMA 4DGWB 2JXJA 4DIQA 1D1CA 2MW8A 3QUQA 5BOMA 3OR1C 5LHGA 5HS8A 4NM1A 3L1PA 2D1HA 3C1DA 3G2BA 1U5TC 9ICQA 2JWTA 2R8IA 2P5LC 5DV5A 4G9BA 2OTLI 3A4CA 3OIOA 1SD7A 2WAQN 3WODF 1IXCA 1XS9D 2DFHA 5ALMA 2OZ6A 1ECWA 3H36A 3QX7A 1LE8A 2QARB 2BEOA 4LZDA 1HSTA 3PR5B 4D0PA 2UUZA 4C4RA 2V1NA 5EJCA 2E1OA 3J80K 2TRTA 5BS6A 4M9SA 4BEHA 3PO2J 2VB6A 2JEFA 3SFZA 3HPGA 1KBUA 3QOEA 3LAJA 3ABMH 1MDMA 3ZMZA 4EELA 9ICFA 5IIMA 3H1CA 3FXUA 2ASLA 3LOCA 3EZ5A 4DSEA 1KFTA 7ICQA 2HQAA 4ZTJA 2MU2A 5EWGA 5BPCA 2MLKA 2H09A 2G07A 5J47A 4L9VA 1GV5A 4XL9A 3CF5F 2JEGA 3HOSA 3MC1A 2LTPA 3BQYA 1Y88A 3HT3A 1X2MA 4U7DA 1QU3A 1JRPA 2I6XA 3NVYA 2W82A 2Y9ZA 3FMRA 1RZ4A 3H7IA 4F4ZA 4PGHA 4J9LA 2L7ZA 5AM1A 2NYXA 3CJQB 2TDXA 4A6EA 1O4XA 1NJWA 2MD0A 5DG9A 1DRGA 1IRZA 2FBKA 2DPDA 4C8KA 3CC2I 3ZPLA 4BXXJ 1T98A 4NBQA 3S14J 3Q8LA 4F2RA 4HW0A 4Y2VA 3ZDBA 1ETXA 4HDVA 1G3YA 2LR8A 5AK4A 2VT2A 4BACA 3K4BA 5KAFC 1ZRMA 1L3SA 4FQGA 3BLYA 4FS2A 1JTYA 2ME0A 4JYKA 4DS5A 2PX9A 4KLEA 1JGGA 3HKZC 4QWAA 1ZQSA 2CQ7A 3TDZC 2F76X 5BPDA 4GXIA 1HCRA 2L54A 2W43A 4G94A 4IRCA 4GRIA 1FC3A 4II3A 1TTYA 1T7PA 2J6TA 2QSFX 4KTQA 2DOFA 1OUQA 2KTQA 2E7WA 3H9JA 3M8FA 1R9TJ 2YB4A 2JTVA 4Z6CA 5AICA 4ZC3A 1O7FA 3J81j 1EV7A 2OV7A 2HBMA 4B9MA 4GYIA 4HYEA 3HP6A 2ETHA 1CRXA 2FOWA 4P55A 2J5OA 4E7IA 2VI6A 8ICMA 2L9RA 1DP3A 1I39A 2CUFA 2JUCA 3I56I 3L3FX 2Y2ZA 2QF7A 4L9TA 2Y31A 2E1FA 5ALGA 2V79A 2Y0SN 5DQHA 2EH9A 1R5HA 5J2AA 2OD5A 1HBXG 7ICIA 5J4YA 1PUZA 4IHXA 2M0NA 3ZN0A 1RNLA 3VCBA 4JX6A 3KFUF 9ICCA 4AIDA 1KL9A 2YMPA 4I2OA 3FK6A 3CUOA 1UHUA 3IDWA 1X4PA 4QWEA 5BOXA 5KFVA 1TZLA 3CJNA 4QIWC 4UASA 3OYFA 3EUHA 2EIJH 4F5RA 4DZPA 4UW9A 2IMWP 9ICUA 7ICVA 4Y2QA 3R0AA 4FBUA 2M4KA 4NV0A 4DL6A 1UCRA 5GTIC 2RRDA 2RQPA 4HNUA 3IL2A 4JBAA 4US8A 1KFSA 2CG4A 2CW0F 2NOJB 2XAHA 3L7WA 3M8JA 5J0YA 5DS9A 1X2IA 2BQUA 2AHQA 2KFZA 1SGGA 1RC9A 5ALRA 5FJ8J 4XKVA 1CQTA 1EH7A 5LD2C 4OJPA 3RJJA 1ETOA 2PJRA 3HRMA 4P1WA 3MMYB 2NRVA 4DEZA 3BP8A 3QU3A 4A0XA 3B6CA 1ZQYA 1N5XA 4JK1X 2FX0A 2HOAA 4RMNA 1AQ6A 1SEUA 3T5LA 3BZCA 5ALDA 3F6VA 3GYHX 4KISA 4MFDA 5EEGA 5DYMA 1QSYA 3PR4A 2LVSA 4BJ6C 3DV8A 2LLKA 3PNVA 2KZMA 3LL7A 3CQZJ 3R60A 2GOMA 1QHHD 4L0YB 4OIOF 3KEOA 3BQ0A 2P6TA 3DLAA 2HVSA 2PLYA 2X6WA 2W9MA 1P4AA 2W57A 1RUNA 1SZPA 1SWWA 4O3OA 3UPQA 2VKHA 3MVPA 1X3ZB 4BQNA 2N1RA 2JA2A 2FU4A 3E2EA 4M3GA 1L8OA 3HTUA 4BDYA 3DXJF 1NK3P 2FI1A 1X1BA 1F9NA 1LEAA 3VFZA 5L3BA 3CCRI 4Z6DA 3V6HA 4B9SA 2EH3A 2HXOA 3CO6C 2HFHA 5KT7A 5A2QK 4O5KA 4XMYA 4XLNF 3H3VK 1YX5A 3AL0C 5CYVA 3D6JA 2DWQA 4I2FA 2CUEA 1ZN2A 2IEKA 4ZZDA 7ICSA 4XSXF 3FF5A 5E3NA 2VODA 5F9LA 2GWRA 4UY8I 8ICVA 4QW8A 2Y30A 2R7UA 3C2BA 1DGJA 2ZUCA 2FMSA 9ICWA 3CDHA 4EZ6A 2F5DA 3QXGA 1FOKA 1Z19A 2XV4S 3I71A 4U0WA 4W1UA 4IEJA 4F93B 3WKDA 3EPIA 3TO6A 3K4NA 3WTXC 4DBQA 1HIWA 3NUQA 3V8KA 2R5ZB 1X66A 3RFAA 4FTHA 2BCRA 4EJUA 3FC4A 4PZOA 1HQCA 1X1DA 2QGUA 4IQWA 3GZ6A 3Q8RB 4XOPA 2HHVA 7ICKA 3HW8A 5CHGA 5ED4A 1TWGJ 3GTJJ 1O3QA 3VYTB 5AIAA 3PW4A 1ZQUA 2B63J 2FLLA 3PX6A 2JH7A 2KJ5A 1SXEA 5JTIA 2O3FA 1KQ0A 1X1PA 3CUQB 4RB3C 2E8OA 3KZIC 4A93J 1ZG1A 4B9NA 3K7AJ 4EJOA 4AIHA 1QCKA 2M34A 3AAFA 5GTIU 1WWXA 8ICCA 3CC4I 3GFMA 4X1EA 3QODA 3VDXA 4YN4A 5EEHA 3FXOA 1V5EA 1COOA 2ID3A 4M3FA 2BY0A 4JV2A 2W7OA 2LYCA 2XF6A 2XKOA 4ZJZA 5T14A 3JPOA 3RJIA 1OKRA 2K9NA 2DPIA 4DSKA 2XPUA 4XRFA 2K7LA 3RB4A 2QARA 2IHNA 2W9CB 4GXJA 2M9HA 1IGNA 3G6YA 1U5TB 5EEAA 3K70C 3CD6I 4I27A 2F5FA 4XA5A 2HI0A 2Z5UA 3MR3A 1QHGA 4F55A 1TL8A 4Y2SA 9ICJA 1H9GA 2ID6A 1PZNA 3LSMA 2G0AA 4IZZA 4KMFA 2FF4A 1LVHA 4IHSA 4UV8A 2MSNA 1KRPA 1ZQQA 1RQLA 1I5ZA 1FT9A 2LBFB 1Z3EB 3DPTA 1W5TA 4PPXA 4JK1A 3ELKA 5FD5A 2DMPA 5KG4A 2V4QA 4BX9C 3ZDDA 1WCMJ 1A76A 3ZD9A 2F2EA 4YCXA 2EANA 2J6UA 2LBOA 2X4HA 1FBSA 4AVPA 1MSWD 4HF1A 3Q0WA 5J2IA 2DT6A 2R5YB 1YO5C 1HF0A 2G08A 3RKQA 5KAIC 3OSFA 3A2KA 4MNUA 1G2HA 1WPKA 1ZQOA 2IHMA 1L7MA 4ZH4A 2ZXIA 1U4BA 2XVTA 2W1OA 3HJEA 5CB1A 1D8JA 3TQ1A 1Y6IA 5KNLA 2OF7A 3R9KA 5FRMA 1SD5A 1IN5A 2VKEA 3GLXA 4LIUA 5GAGJ 4M6YA 4G3IA 9ICMA 2QENA 2DUYA 2DMNA 2LI6A 4PJJA 1HLVA 4HLYA 1JXSA 3BR2A 3OGUA 3HRDD 2ZB9A 1NK2P 2K4HA 4R63A 3V7RA 1D5VA 2GBYA 3QZ8A 5HMMA 3GFIA 2UVUA 4JQFA 1BVSA 1MNDA 2V4RA 4HOBA 2R8HA 3GZNB 4DYQA 2MC4A 4OOIA 1X9SA 2XI9A 4L9JA 1FP1D 3UMBA 2HDWA 1IZ1A 2M4GA 3ECHA 2DBBA 2F44A 4C8LA 2KRCA 2HI3A 4OO1J 1FSEA 4RS8A 2DFIA 2XAUA 4PSXA 2KIWA 1HKSA 3F8BA 4IQVA 3OJSA 1QRYA 3C1ZA 3C5FA 3PW2A 4YR3A 3I54A 4YR2A 2Z99A 3CCLI 1UB9A 2HOEA 4XR6A 2K9SA 3EUAA 5E3OA 3H0RB 3IV6A 4FE3A 5AK6A 3QPLA 1NKBA 5DB7A 2HVIA 2STTA 3BJAA 1ERDA 5J2JA 1UJ8A 4F8RA 2L9SA 4XORA 3WK9A 4KMUX 3OHAA 1N56A 5CRXA 1YITI 3ZGKA 8ICJA 5EWEA 8ICQA 1A0PA 1DU0A 2H3IA 4NB5A 4CYCB 4I6ZA 4UB6U 4RNOA 4GC6A 4L0ZB 3J7ZI 4EVIA 4QZBA 4RLFA 4AM3A 2VIXA 3RQ4A 1QPIA 3N7PD 3L00A 2QLZA 4WX9A 5J0WA 5KFIA 2DAOA 1Y1WJ 2JK3A 1HKQA 4V2GA 4WXCA 1BIAA 3JRDA 1EJ9A 1M1EB 3JPNA 3NVZA 5KHDA 2BCUA 3L2UA 3WGHA 5CVIA 5CJ7A 3K1PA 3P7NA 8ICAA 5IIIA 3TI0A 2BZTA 3ONQA 2FEZA 5KG0A 5ALEA 3UXNA 3C5GA 1ULYA 3WTSC 5L1KA 4ECRA 2OH2A 5E1WA 5IP9J 3M7DA 5DQIA 1S10A 2DYRH 1F43A 3GILA 3NEUA 3COAC 2DA2A 2ZIXB 3O2PE 2C22A 3E5QA 5AI6A 1SV0A 2ZMEC 3S8PA 1Y39A 3UXPA 4J9QA 5C0YA 5DBCA 2ASDA 3HPOA 1QZZA 9ICSA 1H88C 2NRZA 2ZTCA 1UHSA 3BDPA 4XLEA 2W4SA 3W2AA 3LQRA 1VQMI 2NVTJ 1UA1A 1JKPC 2BGCA 5J0UA 3NS1A 3Q9VA 3OTQA 4KDPA 4EM2A 3M8RA 4ZZLA 4D7MA 2FMPA 1IDYA 3QWLA 2IS4A 3BG7A 1ZQVA 3GZ5A 5KFSA 1YX3A 4A0YA 4YG2F 1ZRDA 4NL9C 1K61A 4FHTA 1QLNA 2F1JA 3MD2A 4ECWA 2QWWA 3C29A 2HYFA 2BCSA 1FEXA 3HRTA 2YMLA 4HQMA 2VOOA 1LFPA 3H8MA 3PZPA 2FQ3A 4XNFA 4FS1A 2OWOA 2E8PA 3CTAA 1W36C 1WJ5A 4I29A 5IP7J 1WVRA 2KQRA 5ALKA 2R7ZJ 1UG2A 1R4MB 5HDKA 2MA1A 3TANA 1ZQPA 4M9LA 3HOZJ 2EIKH 1Z7UA 4KJZA 2PMZA 2RDPA 2QVOA 1SC7A 4IR9A 3OIQA 3MDAA 1K6OA 3KIOA 3ED5A 1XC9A 1ZGAA 5L3CA 1A31A 3I4PA 3CJTB 4XN0A 4RQ6A 2KISA 3I1YA 4PCQA 4UBCA 3VEPA 4I2JA 1ZK8A 1H9TA 5DBBA 1XD7A 3AL0B 4BE2A 2C6YA 4FZMA 2R7DA 1PK1A 2RHFA 4CCMA 1WCNA 3BZKA 2HKOA 4IF4A 2R5ZA 4PFPA 1T6SA 5CWRA 4MEXF 4GXKA 3J7YJ 3BR3A 3GTGJ 4I2DA 1MQ3A 3SYTA 1FP2A 2KT0A 1D0ZA 3TKYA 4BU2A 3JTGA 2UVWA 3WKEA 2A07F 3K1RB 8ICGA 1XC5A 3BPVA 3I4NJ 1OR7A 4PSWA 3WTWC 3LSJA 4HAIA 3EETA 1QNTA 2QM3A 1U48A 3KP5A 2J5PA 3UNGC 3DEUA 3CUQA 2V7FA 4Z2YA 3ROUA 3ZMTA 4D7NA 1ZQMA 2FPKA 4C8OA 1F1ZA 5EE0A 1V5GA 2JJ7A 1DQUA 2W00A 1T0FC 2QSHX 1ONVA 4HG2A 5HODA 3EPGA 2VOPA 3A02A 4GC7A 2GLOA 2QKLB 4F92B 2MABA 5DB6A 5D4SA 2DJNA 2KEYA 2KHMA 1OISA 1MBHA 1IDZA 3ISPA 2Z9OA 3DWLE 3RR7A 4ELUA 2HVHA 5E8IA 1T56A 2XIGA 1QVUA 3OYJA 1P4XA 1ZAOA 3L2WA 2ZIVB 3T1BA 3RKYA 5E3MA 2A6HF 3AG3H 3H5AA 3ZI4A 2W9CA 5HVQC 3SR6A 1JKQC 2XHKA 4DFKA 1BBYA 3ESWB 2ESNA 1U5TA 2DLLA 3O8HA 1D3YA 3Q3SA 2JMWA 4MTDA 4CE6A 3RRGA 4YMMA 2CQNA 2BY1A 3QYPA 2EWNA 1HEKA 2KV2A 3RRHA 3IWZA 1J97A 1PVQA 4O6JA 1T39A 3N05A 3U1DA 1ZQWA 3H8WA 3CCSI 2KL4A 2WY7Q 2D8CA 1ETWA 2LBFA 1EF4A 3PSIA 3WK8A 5IP6A 3U1KA 1L0OC 3DDHA 5KFLA 2JA5J 3WK5A 1ZQGA 1OQYA 1ZR4A 2B21A 1E0EA 4UB8C 4YQWA 3JREA 4CHUA 5IT9Z 1TK8A 2E1EA 2HGCA 4HF2A 3E1SA 1A6QA 2KDOA 1SAUA 3S15J 4G6TB 1FIAA 3WTZA 2QBYB 2KNJA 1R5ID 3LA3A 1KFDA 3TP3A 4C3JJ 5DBAA 3OYCA 3UMCA 2XRLA 3MGVA 3H4BA 5JI6A 4IQUA 4UVCA 2C2RA 4F2SA 3PNYA 4ZYAA 5J4VA 3D5RC 3OL4A 4HV6A 1NTCA 2X6OA 4J19A 2P35A 2DA6A 3ZCOA 2IS6A 3OSNA 2HR3A 2Y9TA 3HG9A 2M45A 2HBJA 3MFKA 1LUJB 3CMYA 2XPVA 5CP2A 5KFKA 9ICGA 2CS3A 1XMXA 2FOKA 4EGZA 1HDDC 4ICAA 4I2GA 5L3EA 4P9FA 4BYYA 3PFIA 4BHPA 3PNCA 4MTEA 3B0YA 1R7JA 3ZMUA 1ZRNA 5F04A 5GAHJ 2RP5A 4BJTA 5J2EA 2W8KA 3TO7A 1NZPA 3B73A 1N61A 4M9JA 2HHTA 3F3XA 4F4XA 3HYIA 3LSKA 1X1AA 1DXSA 2HVRA 5J1RA 4Y2UA 1W0TA 2NRAC 1BC7C 1ORKA 2UV1A 2P6SA 4TV7A 1KU9A 2Y48A 4U7BA 1JKRC 4ANJA 1FEZA 5AM0A 2DA1A 4CYCA 1BPEA 1G3WA 4GXOA 8ICBA 3QU9A 2X6YA 1W4MA 4U7CA 1VQ4I 4B09A 4YFKF 1IO2A 1L3TA 1SANA 1USTA 4MFAA 2EJRA 2VN2A 1DU6A 1RR7A 3SHFA 4ABZA 3JAMZ 4A3JJ 3B0XA 1TK5A 1RYRA 4DQPA 2IPQX 1OFCX 2BVMA 1H89C 3Q0VA 3CESA 2ZJRF 4YFXF 4J9RA 1SL1A 3A0BC 1W0UA 1LDDA 4WXDA 2BKEA 2NO5A 3RF9A 1OCTC 3K2ZA 1QZYA 1R36A 2OUMA 5C44J 4DNCA 4R79A 3G6EI 4ZTFA 3KKAC 5J0PA 4G6QA 1BR2A 2FLNA 4UVBA 4UB8U 1JJ8C 3RH6A 2VBZA 1G8XA 4B43A 3BT9A 1U8RA 4CF4A 5KT3A 4UB4A 4R65A 2JV3A 2VQHA 1SMYF 2WAQF 4E6KG 4K4HA 5IYBJ 2KVCA 2ZIXA 3CF2A 2FDRA 3PX4A 4UV9A 2PFPA 4YIRX 3QEBZ 2R92J 1HXDA 1YJ9I 2AU0A 4DW6A 1T3NA 2FJ1A 3DEWA 1YYVA 1LDJA 3CLOA 4Y2RA 5KFUA 2H3FA 3T8RA 2M2EA 4B44A 1RUOA 2G5HB 4UUVA 2H94A 5DG8A 2ZMEB 2LC2A 4US9A 5IINA 3TARA 3K4KA 5IYDJ 4RAYA 3T0YA 1WJEA 1LVKA 1RYSA 3QPHA 1RDFA 3QEAZ 2WAEA 3BR1A 4ED8A 2EFWA 4X6AJ 1SIJA 5HP4A 1NK6A 3BG9A 1A35A 2GZWA 3DF8A 1SWVA 4E7JA 5BPIA 1ZRCA 2YU9J 1NNLA 1T4GA 4M6WB 3CMAI 5AKEA 3CW2C 1TWCJ 4Z6FA 1X9WA 3SI8A 5HR6A 1AWCA 1CUKA 2ZCWA 3R6SA 3RYRA 1MJBA 4AYBA 1TP4A 1OJLA 4OJ6A 3PMNA 1XMAA 5ALHA 5J2GA 2O8KA 2VC0A 2KFDA 3H9QA 4BGDA 1XSLA 3NTUA 3C2MA 3GW2A 2YSRA 2W9BB 1PVPA 4F52A 1SV4A 1D1AA 3OWTA 5DKWA 1ZQNA 4A3KJ 3SZTA 3V7SA 3AU2A 1BPBA 2XVCA 2K5CA 4M72A 1NG7A 2ECBA 2DMQA 4CRXA 5CVUA 4RQ2A 1JT6A 2AXLA 1S0MA 4IS7A 3LA2A 3E6MA 3M3YJ 1F5SA 3DFGA 3BS5B 5HMLA 5KFYA 3NRZA 1IF1A 2G9WA 1SL0A 3FM9A 1BPXA 3E7LA 3OYMA 2PMHA 1JXLA 1XCBA 1ZGJA 4BUPA 4CSWA 3A0BU 2X1CA 3F21A 3CMEI 2MSYA 3KP6A 2GXBA 5KCMA 2BY3A 3F6OA 5D5UB 5L1IA 3NVVA 1QSLA 1SD6A 2YX7A 2H1LA 2MUTB 5KFCA 1S9HA 3PUFA 3LYSA 3L4PA 1T8EA 1A77A 4F50A 4YIIA 1QH9A 2K8AA 4IOCF 2C28A 2FMQA 3OHBA 4K4IA 2IOFA 1WWVA 1R1VA 2QQAA 1KW4A 4M73A 2VLAA 2RLTA 5LEJA 4KYWA 2A5WA 3MBYA 3H3UA 2IBKA 5F08A 2LYAA 2XICA 4UARA 4B1RA 2AGPA 3O3KA 3VYUB 2ZIVA 1P92A 2CN1A 2Y0SF 2E5SA 5K1YA 2KHQA 3KFWX 4RAGA 4YD1A 5B1BH 2O61A 4PDKA 2JRMA 3GMEA 3KETA 2KZZA 2BV6A 4JUZA 7ICUA 3BTIA 2R8GA 2VA3A 4L5EA 3RQIA 1P9QC 4RPZA 3IC7A 3SZ2A 1NK8A 3OPXA 5ALYA 5ALIA 2WTFA 2L5QA 3OR2C 4RNNA 4IRDA 5ALQA 2LOOA 3WTUC 5CA7A 1ZHFA 1TWAJ 1TWFJ 4R66A 3ABTA 4ED3A 3LNQA 4HZFA 2GA2A 2CSOA 5IT9K 3LWLA 2HSZA 1X9MA 3TW7A 3O0FA 3RTVA 3IHUA 3SZGA 3F53A 5KFPA 3ZOBA 3F8NA 3WU0A 1RPLA 5L9XA 4UAYA 3ULQB 4RGSA 3ERED 2Z7JA 3DCFA 2NNNA 2K89A 3Q0UA 3S1QJ 4LB6B 3MZ8A 1DK3A 2QBYA 4FCYA 4IQTA 5CQGA 4RPXA 3GV8B 4NHJA 3A01B 2AH5A 3S16J 2FNPA 2O7OA 2G0EA 2BPGA 9ICAA 4O3QA 5GPCA 1WKMA 2LREA 3DBRB 4QTRA 4BE1A 2OEHA 3QPSA 4DFJA 1Z6RA 5AI0A 5ALPA 1YJNI 1ZYRF 1Z67A 2D2WA 5C5JA 1O3SA 1JROA 2IOHA 4ZYEA 3CJRB 5CLSA 3G73A 4P4OA 3ZDEA 5IOYA 3MR6A 4HPQA 1D8YA 4LZGA 3KZYA 2R18A 2VL8A 3TMOA 3JSOA 2HU9A 2ZO4A 2NS8A 5LGTA 3KZXA 3GTKJ 3QUBA 2BCVA 1Z4OA 4CYDA 4KLLA 4A3MJ 1WRJA 2MG4A 4PHDA 5L1LA 1SKWA 4KLHA 3BG5A 1I3AA 4HQEA 5FP0A 1P2FA 2WA0A 4DQ2A 2IRFG 2NVQJ 3WG9A 4A3GJ 3IHQB 3TOBA 3QU2A 4NLGA 4M9XA 5KTQA 3ZQHA 2EFPA 4NQWB 5DLGA 3HOXJ 4OCZA 1XCVA 5KG5A 2COMA 3JPPA 4MFFA 1X3UA 3P9CA 4L5JA 1FMVA 2LY1A 3GF2A 3N4MB 1PYVA 2LF7A 5JUMA 4DFPA 2OQGA 3OYLA 1J2XA 1N62A 1ZQFA 2ZXHA 3HBLA 3WU2U 3FYHA 5B3SH 5KG7A 1WH5A 4BH9A 5M5WJ 2NO4A 1POGA 8ICHA 3W6JB 3WE2A 4F3QA 1ZQHA 3ZQGA 2RKHA 5IIOA 3SV3A 1CI4A 3S3MA 3Q8QB 4DL4A 1VQPI 4A3DJ 2ZJPF 1OCZH 4OJ5A 1ZQJA 4ZDPA 4GGGA 1E3OC 1WZ2A 2ZTDA 4JX5A 4OD0A 3BZ6A 4XLPF 2GOXB 1ON2A 1DGSA 3KHGA 3RPUA 3RB0A 3R61A 4GLXA 1NKEA 1J09A 5TISU 3HXLA 1UT8A 2KKVA 3IKVA 2P6UA 4L9NA 1YI2I 3K1ZA 1KYWA 5J0RA 2JEJA 1EXNA 4FBTA 1EA3A 2VPLA 1SAXA 4PJLA 3AUOA 9ICNA 4NWIA 3X2QH 2KJBA 2ELHA 4CXFA 3WG7H 1HOMA 1PDNC 2BR0A 2W3RA 2I9GA 5HNFA 2CQXA 1D8BA 3H8JA 2JVHA 2CPRA 2H5XA 2WF9A 1YW7A 4CZZA 3ICXA 4C4TA 3PW5A 1ZQLA 2DPJA 4I28A 3PW7A 3DQVC 1O3TA 4LG3A 2V1XA 4HV5A 5HLTA 3EYIA 4NC8A 2MC3A 2AHOB 4Q43A 3GIKA 4F5OA 3ZQLA 1SFKA 5M3FJ 2FBIA 1DGRM 2ZMEA 3BTLA 1MMSA 2WAQC 3M6ZA 5F6FA 1KEJA 1B72B 1XSXA 5LBQA 2IVMA 8ICWA 1OMIA 2XGXA 1WFXA 1OXJA 1URJA 2LH9A 1BPZA 1K4TA 1MNMC 3ZDCA 3BOQA 3DEEA 4U0VA 5KFWA 4M6WA 4BDZA 2KP6A 1HJPA 1PUFB 4OWRB 3GFKB 2WB1A 5L1JA 2AQ0A 2WY8Q 5CJ9A 5LLQA 3HILA 4NL9A 4ITVA 2GA1A 1S77D 5IILA 3U9GA 1YTYA 3HSEA 2FE9A 3NQOA 2ZXJA 4G6DA 5KFEA 2JZYA 2WF8A 2XGPA 2D1VA 2ZKZA 2ICWG 4RQ0A 1Z3YA 3NWSA 5IT3A 1VFCA 1ETKA 2QUFA 2IS2A 2LP0A 3M6KA 4KX5A 4NM2A 2PN6A 3KYDB 2EFOA 1QQIA 3TBIA 4TQSA 1FTZA 4E7LA 2DU9A 2X51A 2VXDA 3SDGA 3IG8A 1ZQIA 3BJ6A 2XB0X 1DPUA 4R64A 4DOBA 3TQNA 3BS5A 3REOA 1MNEA 5FD6A 1SFOJ 1S0OA 2BQ3A 3PSFA 2XAQA 1KONA 3K4JA 2XC7A 8ICFA 3K0LA 5LHHA 2F1IA 2ZJAA 2YN4A 4CCLA 3FISA 2XDVA 2X85A 1V54H 4D5FA 3SD7A 2BXZA 3E6DA 4IX7A 5KFZA 2GLEA 3JPQA 1FFUA 2XASA 2MUTA 1WJBA 1B43A 1NK9A 3O8GA 2N8GA 1VQOI 1XO1A 3QZ7A 3ML6A 1RI7A 3EQLF 2E71A 3AG4H 5K5RA 3VYSB 1MMAA 5BNGA 1JUPA 2DDAA 3Q9SA 4XKWA 1ENHA 5M5YJ 4QZ8A 1P7JA 4A69C 1Y8QB 4A2UA 1LQ1A 2DF4B 3KBBA 1FMWA 1BM9A 1WJAA 1X19A 2GAUA 3M07A 5EOZA 3FWEA 5HDGA 2E2HJ 4M9GA 3M8SA 3ZQFA 3LSHA 1W36D 4J9NA 2P5VA 3E5UA 3GQCA 4BKXA 1ZARA 1TNSA 1WH7A 1HKTA 1J9IA 5L3GA 3DTEA 5CEHA 4J9MA 3E3VA 1T0FA 2BXYA 4R8HA 4KLMA 3N97B 2LHTA 3V4GA 4DL7A 2HHUA 2Z1DA 5K7FA 4PK4A 1PK3A 5EE3A 4HLXA 4DLGA 2UZKA 1FTTA 2DFEA 2BW3B 4NXZA 2PXIA 9ICVA 1UZCA 4CCKA 1S7AA 3KLOA 1U9NA 2BQRA 3C28A 2HQRA 2EK5A 2CMPA 2IXSA 4QNLA 2O5RA 4DOAA 4EM1A 2KZ3A 4DQSA 2Y0SC 4F7ZA 1STZA 4AU7A 2OU2A 1PK1B 5KVRA 2ZJ5A 1I6HJ 1P4WA 2DT5A 2YTUA 1BN5A 1UG0A 3IAS2 3I76A 2YY6A 2ZNZA 5CR0A 1X42A 2K4IA 1MH4A 1W1WE 4HNVA 2PFQA 4IHVA 4UNOA 3PO4A 5J8FA 3V72A 5L3FA 1WQ2A 3S6JA 3MFIA 3A01A 4ED6A 4MF2A 5LEKA 4Q8FA 1VQKI 8ICEA 4GIBA 4AC0A 2PEXA 3K69A 2VJJA 4FX0A 2V1DA 4XRSG 3WK4A 3KP4A 3GTOJ 2BHYA 3I9V2 3KEQA 4IPAA 1TAMA 4F4WA 2DK8A 3J81Z 2R7RA 1BPYA 3KCCA 5KFOA 5JHUA 2W04A 1P7DA 3PO3J 4DSFA 4PJ0U 4I2CA 1U9OA 5AKKA 2XF5A 4LLGF 1PP8F 1F5TA 1HSJA 3JRGA 5M3MJ 3BQTA 4P0PA 1X40A 5A0LA 3GU3A 4RZRA 4XLAA 3LK9A 1P6RA 2OZUA 1BR4A 4PZJA 4UB6C 3SJMA 4RQMA 4QZAA 4HX8A 5TZVA 2B7EA 4RA2A 2DYSH 8ICXA 4UXNA 4II2A 2NVYJ 4OAYA 1BL0A 3WKAA 4MEYF 5D6FA 1QQ6A 1RXVA 1WUDA 2L3DA 2H1KA 2PQ8A 3WHCA 4S04A 4UUSB 1GVDA 1Z0XA 5FFZA 3OS2A 3BG3A 1ODDA 4NQWA 3GTLJ 2X0LA 3GZFA 4P4MA 1T2KA 4MQ9F 3MN2A 3CDLA 2LDUA 1AHDP 3JR9A 4I76A 1I6XA 3EUB2 5EZHA 3FAHA 7ICEA 4OU0A 5J2DA 1JIHA 3BQ2A 5B1AH 7ICHA 3KX2A 2QQBA 2RDIA 5JU5A 4AUXA 3KEYA 7ICPA 1TQMA 3N4MA 1IUFA 2WV1A 3E6BA 2GM4A 2STWA 4G7OF 3GBGA 1R22A 1K4SA 2P81A 3D5SC 4C2TA 1N78A 5J8YC 4Y15A 2F77X 5J1YA 1XN7A 2YMQA 2R7FA 4HSTA 1MMDA 2HDDA 5LGUA 1N25A 2QKQA 2GWSA 3GCMA 4E4HA 2EV5A 1IRGA 2BE5F 2CFOA 2HYGD 3I58A 1KN5A 1C20A 2DT7B 3OOPA 2PFBA 4N9HA 2NVUB 2QA4I 3WKCA 1L3UA 1CEZA 3IM1A 4FASD 4Y3OA 1D0XA 1UHWA 2ZJQF 2E60A 2KKOA 1TT0A 2EFNA 3LMMA 4P4PA 4WJ3B 2LY9A 1IXRC 1IJWC 4ECZA 4QZGA 2W7PA 4C3IJ 2LM4A 4HYKA 2HCFA 1YE9A 1HW2A 4B9LA 4F72A 4I2EA 3KYCB 3GTPJ 3GX4X 3KKAA 4X5VA 1ACIA 9ICBA 3IP4B 4IO9F 1ZXIA 5ALUA 3SEIA 5ICFA 2XKPA 1IN8A 4K2EA 1RIOH 4YR0A 2VA2A 3TACB 3IKTA 4QZ9A 3BROA 3F8FA 1QBJA 5J0XA 1JX4A 2ZXWH 2W3SA 2DA5A 1O7LA 5DLFA 1ZQTA 1AROP 2P66A 3S1NJ 3J7AO 3ZMSA 4BXFA 3ABUA 1J2MA 4C4SA 2X1EA 4ESBA 3K9TA 1B72A 2EAMA 5DM6F 4BE0A 3HB9A 1X2NA 5KL8B 1U45A 4EENA 2JPBA 1UAAA 2VA8A 1XPXA 2MRLA 2YB1A 4QWBA 3ZD8A 1ZQCA 1PUFA 4FETA 4Q45A 5EZGA 4Y2YA 4YIFA 4EGYA 2IA6A 1YQAA 3TAPA 3W6KB 3IRUA 4DBRA 2L7KA 2Y75A 2JSPA 2XRNA 2JA6J 4KN7A 5AI8A 4O3NA 1KU7A 4IC9A 5F9NA 4I2HA 1XG1A 4CF3A 2D5VA 2MH2A 4M3EA 1ETQA 3GIJA 1KSPA 1VTNC 1U9LA 3M9AA 4K4GA 2NXNB 3U26A 1UFMA 5ERIA 4KMOB 3DKXA 4KIGA 1G3TA 3S1RJ 2H3VA 2W9AA 2RDJA 4GO1A 3FXMA 4BS9A 4YG2A 3JRFA 2XY7A 2IGMA 3VODA 4KFCA 1Z1DA 1DP7P 1OPCA 3CNHA 2HTSA 2IBDA 3E97A 3ERMA 2D3DA 2VANA 1NG6A 2OCEA 1B8IB 1TNTA 2FD5A 2XAFA 4JB3A 5H6RA 5E18F 1MJAA 1FFVA 5KT6A 4A3FJ 8ICYA 4LJXA 4TQRA 4QZEA 4BHCA 3ZRGA 4RGRA 2HQNA 3L2CA 2FBHA 4M3BA 2EQRA 2H6CA 1VF9A 2LY2A 3RIRA 2L0KA 2RREA 1VZ0A 3H92A 3S32A 1NJXA 4PH5A 2A69F 3OYIA 2VPRA 3PNTA 4B8XA 4KA4A 3WK7A 3D0SA 3CP8A 4B3XA 1Z91A 3SAFA 1MBKA 3RJPA 2KVSA 5KFJA 5AIPA 1L3VA 2ZFUA 4TUQA 2F48A 5ICCA 2QB1A 3N7SC 3RH5A 4IOAF 3WKBA 4QWCA 2JSCA 3N97A 2ACJA 4MEXA 2ISPA 3HM5A 4MHVA 1G59A 3GV5B 1V9PA 3L5KA 4Y2XA 3G6VA 2Y0MA 3OYGA 2LM1A 4I0AA 2BW3A 2BY2A 1LEBA 4RDUA 3LFKA 2LYHA 4DLEA 3F5EA 2KIFA 5FGMA 4Y52J 5JLXA 2R4GA 3SYZA 3ZQIA 4RB0A 5DCMB 2K4PA 2LD5A 2V4JC 4JMUA 4EBCA 3F2CA 4ZYHA 2EZKA 4ELVA 2K60A 3MR5A 4U0YA 2E1MC 1TLHB 5KG1A 4O3RA 2OHFA 4U6PA 8ICOA 1A6IA 2OJED 4AP9A 4RQ5A 2EB7A 4A5MA 1O57A 3M8EA 4LB5A 4PGYA 2EPFA 1K6YA 2DA4A 3JCUC 2LKSA 1GUUA 4PGGA 5LRRA 4CZCA 3TADC 3UMGA 2UXXA 5KFAA 4F4YA 1R49A 4ZDLA 3AM9A 4OAZA 3K75D 4KT5C 2JEIA 2A1JB 1BOBA 1WCLA 5D46A 4EEFG 4HNTA 1JALA 2LPEA 4ZOHC 1K79A 1C7YA 1FX7A 2JT1A 2V9PA 2FQ4A 3DLLF 5EF6A 4J01A 4DWIA 3DKYA 3AKZA 2L9NA 1L7NA 3PVXA 5J0OA 5AKLA 1S8NA 8ICZA 3FZVA 1W7PB 1R5GA 3H4DA 5AKXA 4TUPA 2DK5A 3D1NI 2V9VA 1YIOA 1YOVB 4UQGA 1MIJA 3KOOA 1JXEA 2F3NA 2PBIA 4PL2A 3FM3A 2AQFA 3M1YA 2MD5A 4A3LJ 3H9GA 1SVLA 3DTIA 3K4CA 2DMUA 5DUKA 3MGIA 2Z2SB 5AKIA 2D45A 9ICIA 2E5NA 1TFRA 4YMOA 1ZLJA 4XONA 1RZTA 2XPWA 3IAM2 3OYEA 3QRFF 4UUSA 4D1QA 2PFOA 3B02A 5ICEA 2JMGA 5KFGA 4M6XA 1MN8A 2X9DA 2MH9A 3KHHA 2KIMA 1FYLA 1JT0A 2HZTA 4C2MJ 1ZRFA 3J7AY 2QKMB 3RZOJ 2VKQA 4S0HB 4UAUA 4MLOA 4M9HA 3OOUA 3ZDAA 2W11A 1U49A 2R7XA 5J2KA 1BI3A 1B4FA 1RESA 5HHIA 3H0MB 1KYZA 1RRJA 2XGDA 5J6XA 2B0CA 4UB2A 5KG2A 3RJEA 5EYRA 4PFOA 2L7FP 2ZFWA 2YX8A 3I28A 1OYIA 5KFFA 1WI3A 1Z21A 1RQNA 2KE7A 4Q8EA 2CO5A 3R4KA 1I1SA 9ICPA 9ICXA 2AXTC 1XNSA 1YS6A 1BW5A 5K4LA 3CMMA 3AMZA 4DSJA 4DZJA 4EYIB 5DD4A 5JVTA 5DB8A 7ICOA 4ELTA 2EAOA 1LFBA 4CA0A 3RB3A 2HOTA 3P5JA 1RETA 2M8GX 2P8TA 2FSWA 2BVLA 2JN6A 5KFMA 9ICRA 4LK1F 1BA5A 3NWTA 1LKYB 2PG4A 5KL1B 2R7SA 4DQQA 4JP0A 1IN7A 2E2JJ 3AN1A 2K4EA 5AI4A 1H38A 4EZ9A 1V85A 3QU7A 3I55I 4BAYA 3TO9A 4YFKA 2K3PA 4M9ZA 4PJMA 4FFDA 3FIWA 3L9FA 1ETVA 3FDYA 4F3OA 5HOOA 5FLXZ 4DS4A 2OA4A 2KICA 4OIQF 4M04A 4QZCA 5DGBA 3HKZA 2BCQA 3L2RA 4I2BA 3V7KA 1RR8C 4BJ5C 3SENA 5F0CA 2NAZA 4M74A 4UVAA 1F4KA 2H27A 4NC7A 4IL6U 4RQ3A 2ESEA 2IJLA 5KFDA 5HLIA 4DL3A 2KP7A 1R4NB 2O6KA 2JGAA 1XMKA 3A0HC 2HPIA 5K7ZA 5ALSA 3VSLA 2WAQA 2R93J 4XN3A 3PUBA 4HSRA 4KLFA 2XIDA 1MMNA 1V5FA 2QQ9A 5HNHA 4N0BA 3FXJA 4I0BA 4P9UA 1VNDA 1NHAA 2VJIA 4MQVA 2K27A 5ALVA 1ZQDA 2DDBA 1Z00B 4C9YA 2WF7A 3FXLA 2QLTA 2VKDA 5AM4A 3KP7A 1I1GA 5KNIA 1S9FA 1MQ2A 1JI8A 4O5EA 2KRHA 1KDHA 2KIQA 4KT6A 2L9VA 4ED1A 4B47A 3AEVA 1U0JA 3GO5A 2KJ9A 1Y0UA 5C4XJ 2LYBA 4LLLA 5CVRA 3JRIA 4AD9A 4CCHA 4E7HA 1S3JA 1VQ9I 5ALJA 5FLVA 4IJAA 2KLOA 2E8MA 1PVEA 1U6GA 2O8XA 1R6RA 1B8IA 4AWXB 4EJTA 2HHWA 2HS5A 2K8BB 2AXTU 2QQ8A 4ENJA 2ZG6A 1QPMA 1XSVA 8ICUA 2EBIA 4Z6YA 2KZVA 4JV0A 5DB9A 4I02A 4A3BJ 3RAXA 1WG8A 2Y9YA 3DU5A 3FXRA 1E2XA 5DD8A 1BOAA 1DK2A 3QP5A 4XBFA 2EV0A 2FXAA 1PVRA 2XCPA 4I2AA 3AG2H 4XRMA 1A36A 4FX4A 5HNKA 5DTDA 3OS0A 2AJQA 3EPZA 1S8OA 3LWMA 8ICKA 4XUSA 1IG7A 1HDPA 2PMZN 2R7OA 3G71I 2NRTA 4BXUA 1BI0A 2DFLA 1XX5A 2A3SA 2Q2EB 1Y1VJ 2JQ7A 2M9NA 1JTXA 1OCPA 2VC1A 3S3NA 4GYGA 4IVNA 3U21A 4QWQA 4L5IA 1VQ8I 1H8AC 3CC7I 1HUOA 1OLTA 2EQYA 4HX4A 2ADUA 3PL8A 4KN4X 2WBMA 5ILSA 1N60A 4KICA 2C2EA 1ZJNA 2CUZA 2X6XA 4FT8A 1ZD2P 2KOBA 2Q0ZX 3E0FA 4BBSJ 1DDNA 5F3XB 3TFRA 1X6JA 2VXZA 3DP7A 1ETYA 5J2HA 2LRDA 5DCMA 1NJYA 3TOAA 1ZQXA 2DTRA 2M7AA 4EJVA 4J9PA 2HHXA 1XO0A 2EZLA 3BQZA 3A0HU 4ZYDA 1VJ5A 5KFTA 1BGXT 5DCFA 2LFBA 4Q5SF 3AG1H 1Z1BA 1WI9A 4D5CA 2QCOA 1Z7LA 3V6KA 2X48A 5AONA 5AIQA 4C3HJ 3F9KA 3DV9A 3SV4A 3JPSA 2Y0SA 1WJCA 2E1MB 4FE4A 3DPLC 2WWYA 1RG6A 5KT5A 3G6XA 2FNAA 3BWGA 3DU6A 5J1UA 2ME6A 4KLIA 1XGSA 2F4OB 4LLNA 1J0RA 1R23A 3T5XA 3OS1A 4ENMA 2JVGA 1XSDA 2A1JA 5J2CA 2GIZA 3C18A 4ESFA 5B5EC 4FO6A 3SAHA 3I64A 1Q8KA 1S76D 3PO5A 1ZKGA 2V6EA 4KLUA 3CCUI 5G5GA 3TFSA 2ELKA 3ISBA 1XGMA 2VASA 2Q0OA 2IGKA 3I59B 4BL0B 2F1HA 2H8RA 4M9NA 3KP2A 1NI3A 2QZ8A 1W7PA 2WHEA 4OJOA 2E19A 4AYBF 4FISA 2HVQA 4Y4RA 2LMRA 5AK3A 4R8UB 4DF8A 2A68F 2ZIWB 4B9UA 3BG6A 4HF0A 2E1NA 3NAUA 4RGUA 3IRRA 2I1QA 3CRXA 2E8NA 3TL4X 4A3IJ 4M6VA 2FJ6A 3ZQCA 3HX0A 4UUTA 5KFBA 2VQCA 2DN0A 3WU2C 2AQ4A 4NLKA 8ICIA 4ON0A 4P2HA 4C0ZA 1AA7A 4PHAA 2CFXA 5J0SA 1SD4A 4Y33A 1KQQA 2H6BA 4XM3A 2OBPA 1VQ5I 3FMQA 1USSA 2KKPA 4Y2PA 3TAQA 4HRIA 2W54A 2ZUBA 4RU9A 3MABA 1NJZA 3JRAA 2CUJA 4M71A 1C0WA 2DA3A 4XKCA 1BJAA 3FKIJ 4ETSA 2XAGA 2KMUA 3MFHA 2E5ZA 1MJ9A 4MIMA 3NRWA 4YP3A 3BY6A 4QW9A 4DYCA 5TISC 4EQQA 4F5NA 5G5HA 2OXOA 5C4JJ 3BR0A 1T8IA 4EEKA 2DXIA 1Z4NA 4A5NA 2ZBKA 3OMYA 8ICSA 2ISYA 1Z3XA 3BCBA 3ZMVA 3BC8A 4NC6A 1ZQZA 2DL0A 5ALOA 4UB1A 2FMLA 2MA3A 3P9IA 3GFLA 4I09A 1PP7U 3OV8A 5J8YA 2NS0A 3WTVC 4RM2A 3BTCA 4BQQA 2EINH 1U47A 2P0WA 1TC3C 2CXYA 4NLCA 5AKJA 3CP2A 1MD0A 3ZXSA 1AKHB 2ZJ2A 3CUQC 3KZZA 5B66C 5KFHA 4IR1A 1RPWA 4YXMA 4KN4A 1K1QA 5HS9A 4Y13A 4P0PB 3UM9A 1NK0A 3K70D 2F5VA 3EDPA 4HAMA 4U88A 1JHHA 3M9OB 1Y56A 3ASNH 1LKYA 1AOYA 5F64A 3H0LB 2B9SA 5JR3A 2KRFA 3HEFA 2PKEA 1B6AA 1Q1VA 5E79C 5J40A 4B4CA 5F1RA 5FLXK 4KLDA 5B5EU 2LSOA 2EFQA 4NY8A 3S2HJ 3Q5FA 5KG6A 1HUZA 2V6CA 3OYHA 4UATA 3HHHA 4RT2A 1NK7A 3G1OA 1K78B 4UAWA 1U8BA 1F36A 2FMYA 2QYOA 1JGSA 3RSNA 4IRHA 4BJQA 5GTHU 3JAMK 3RJFA 1IV6A 2FA5A 4DOCA 1YLFA 2CQQA 1CGPA 3MGHA 2Z16A 4RB2C 5L1MA 7ICLA 1X3WB 1UMQA 3HOWJ 1D9FA 4B48A 4IHTA 2OC6A 4RAFA 2OQRA 3MCZA 5H6QA 4A12A 4EJWA 1O08A 4IRKA 3HGGA 2O03A 1FWZA 2BOLA 2BGWA 1Y8RB 2HYJA 1Z00A 1LDKB 1LB2B 5AKYA 1VLBA 4C8MA 1BI1A 1S29A 3RTRA 5F27A 3W2VA 4PJNA 1E3HA 1ZGWA 1FNNA 4QIWN 2PJPA 2NYVA 4J03A 4BWMA 1OYYA 2VONA 1VQ6I 3FDSA 1SKSA 2HTJA 1SZHA 2ALZA 3VYRB 4AIKA 4O5VA 3ONNA 1COKA 1IUYA 1B0XA 4YFNF 1T94A 4C7YA 1RYUA 3HZJA 2V9KA 4P5OA 3IH4A 2C2DA 2V1UA 9ICEA 5J8CA 3ORYA 2XUBA 4Q47A 3FBNB 4Q44A 5DDGA 4OMYA 2W03A 2F2AB 1Q3UA 2ZNYA 3LSIA 3RBDA 7ICGA 4F5QA 3S2DJ 2L5YA 1J59A 4BQAA 1V3FA 5FROA 3RKXA 5B66U 2K40A 3SEQA 4KITB 3C7JA 5FO5A 3D5LA 2NNYA 4ZDOA 3UR3C 3QQAA 4QPQA 3WGGA 4E7SA 4CF5A 1LPQA 3L2VA 2JPCA 1WYGA 4PHPA 3Q8KA 1NK4A 3OL3A 2IAIA 1FIPA 4C30A 1O3RA 1D8LA 4ENKA 4AYBN 2OCCH 4RPYA 2HQ5A 2O6GE 4RQ7A 1L7OA 4FZNA 3GLLA 1XSNA 5EGOB 2F4MB 2XF7A 4ACOA 2VJ4A 1OYWA 4KNYA 1GVJA 3PSTA 1XU4A 5E79U 3MZYA 1MH3A 4LG0B 2Q2EA 5D8LB 2JA8J 3RPUD 3H8SA 3GWZA 3CDIA 1FPQA 2XB5A 3JRBA 2R0QC 9ICKA 5AKZA 5HR7A 1QSSA 2DMTA 4G12A 1NKCA 2LF8A 2A1AA 1LKXA 2EA4A 2V26A 3FK7A 4G7HF 2CV2A 2HOSA 2G09A 4C80A 2KMDA 3BQ7A 5ALTA 2AGQA 1WJFA 1A6SA 3BDDA 3FXKA 3M7GA 3N7RC 5ALWA 4BDPA 1IXSB 1N75A 3UQ2A 3OYNA 5JVGF 4KLOA 2K3FA 1ZREA 2R8JA 3KLNA 2DI3A 1X4OA 2L2OA 3FHZA 4KIBA 3SQIA 4PJ0C 8ICPA 4O3PA 3T8TA 1V4RA 2WTEA 1BNPA 1MGTA 5FLMJ 5CVVA 1V38A 3M1EA 2G06A 4CH7A 2VE8A 1UA0A 4M47A 2UXNA 2KFNA 3Q8PB 3K4LA 1JN3A 3SXYA 4NLZA 4LIVA 3RH4A 1L8LA 1KKXA 3E5XA 4UHTA 4PUSA 2ISZA 2GXGA 4A8EA 3M9NB 4WWCA 1GT0C 3S2WA 2HKXA 2KK0A 3FXQA 1TQPA 1OW5A 3QE9Y 2XROA 2FRHA 3HHGA 1T38A 3TADA 4IHWA 2XSDC 2VUMJ 4XRSA 4KLGA 3I59A 5EG0B 3DPUA 3IH3A 1FYMA 2WB1F 3HUGB 5IY5H 1K7AA 3LSTA 2ISOA 3RJHA 2XAJA 4R8UA 4G7ZF 2AS5F 1KZHA 2BPCA 9ICTA 2W24A 1TW2A 3V7CA 2RQ5A 2ZIWA 4F91B 1FY7A 3K2AA 5ILVA 1T33A 4C2UA 1QA6A 2R7WA 2YQEA 1LVAA 3V7LA 1XSPA 4YXJA 1TK0A 4CNQA 3DKWA 1OCRH 4M3DA 5J3LA 1JKOC 3MAJA 5GPAA 1M6YA 4F71A 3BCAA 1B4AA 4QZDA 1ZQEA 3MKYB 3C2LA 4EYHB 5D6EA 3A03A 3UQ0A 4AYBC 3NARA 5KAFU 3S93A 1O03A 1OCCH 1SFEA 1Z05A 2H8WA 5FKMA 1JMSA 4NJ8A 3RI4A 3HTSB 2M5WA 4LJZF 5ALXA 4MF8A 2L4AA 1CF7B 3LSGA 3RDIA 3HOVJ 4BWJA 2IA2A 5FKKA 4AIJA 5J0QA 4MHGA 3TDUC 7ICTA 4DCCA 3GXOA 4ZYGA 2JHDA 4N9IA 9ICLA 2A6TA 5DQGA 1IG6A 1GHCA 1GLNA 1N5WA 2NRWA 1WSUA 4CCJA 2EV6A 1ZR2A 4OINF 4E7ZA 4ECYA 4QZHA 2K4JA 4BQOA 2ECCA 1VQ7I 3G1LA 3KYLA 1ZD3A 2HMXA 3FKJA 4Y2JA 3QUCA 3GIIA 3BR6A 3ABKH 4B9TA 3GIMA 2KN7A 2O0YA 3QYBA 4MEYA 4HBLA 4CO8A 2BPFA 1IW7F 1TQIA 2IW5A 3QU6A 1Z1VA 5FKNA 1YRNA 3F22A 3UKGA 5K5QA 1AKHA 2HNHA 1G4DA 3BJYA 4D9JA 1YW9A 4KN7X 1QGPA 5FKLA 4PGXA 2DKZA 3JPTA 4RGXA 3F2BA 2KDZA 2J6SA 2JH1A 1YJWI 3OJUA 1DUXC 5DDYA 2GOLA 5HLGA 2H3QA 1Q46A 4BY7J 1F44A 2JA7J 3OIPA 2M30A 2NV3A 5GAEJ 5J2BA 2EAPA 2PI4A 1D9DA 3V42A 1ZELA 4V19K 1BJZA 1R00A 4QWDA 2P7VB 4IQJA 5E3LA 1SVMA 4EBEA 3HSFA 2IA0A 3P9KA 4QLCU 1L3LA 1K78A 2CW7A 3BS7A 5D5XB 1JE8A 5J0TA 3PY8A 1EKEA 2WC2A 4JX4A 7ICNA 1TT5B 2DW4A 2Y9UA 5ALLA 5JRTA 2ATLA 5EDNA 2BYVE 3ZMDA 3QYFA 1VQLI 2Y1IA 2K02A 4XK4A 2Q8KA 1S72I 1L7PA 2A19A 1W5CC 4O5CA 1QVTA 3SQNA 4NLNA 1TBXA 4P0QB 5KG3A 2HEOA 1RM6C 5EWFA 5TJJA 1J5YA 2DCEA 2LKYA 5AIBA 3QPTA 1R1TA 3KP3A 3KE2A 4DOZA 5LHIA 3LAPA 1WGXA 2OPTA 2WADA 4HEA2 4OMZA 1MSFC 1SB3C 3VC8A 3HC7A 5DDMA 1FZPB 4ECVA 4LVSA 2CW8A 2Q1ZB 3ECOA 1N2XA 1ZETA 1B9MA 1LB2A 1FLIA 3FMSA 3K1NA 5ILUA 1MZBA 3M4OJ 4F4KA 5IPAA 2W55A 2P6RA 8ICNA 3RJGA 1ZLKA 3ABLH 1UT5A 2A3VA 3CCJI 2K85A 4YMNA 1HW1A 1QZEA 4LOCA 2IOFK 4B6JA 1TE2A 1RXWA 3EYYA 3CLQA 3G4SI 2B0LA 3PIPF 4GFBA 1IV8A 2R7QA 2HHQA 2MBFA 1FOXA 3F5AA 1BR1A 2DFFA 4BHBA 5LGNA 1Q1HA 3WTYC 2LK2A 2ZIUB 3H5NA 4NNJA 1KQ8A 5E17F 4DF4A 2M0CA 4QPOA 3JPRA 2E34A 3T5JA 3EWAA 4B3AA 3K4MA 3Q8SB 4UBBA 2DKXA 2JZBB 3PFYA 5KT4A 5K5OA 2NS7A 1TWHJ 2WV0A 1QQ7A 1T08B 3I53A 3LSPA 4KIFA 1XTAA 3HOTA 9ANTA 1B22A 1KGSA 1Y0NA 1UCVA 4PL1A 2WB1N 4ASNA 4ED2A 3C3WA 1ZD4A 2EZYA 1N77A 3HOUJ 3GDXA 1ZQBA 2JUGA 1Z9CA 3MZHA 4PGQA 1FOYA 3H5RA 4LK0F 4ZH4F 3RKWA 1TAUA 1B1BA 2DA7A 2KJCA 2LKPA 3VPRA 3MWMA 3WE3A 5EGOA 4A3CJ 4XLHA 3V8JA 4O3MA 1FSHA 3HRUA 2IGOA 2Q4TA 3KZIU 4J9OA 4LG0A 4TUSA 3T5KA 5TRDA 2MLGA 2L02A 2EZZA 1ZQKA 2RGVA 3VSKA 3HGYA 3U2RA 3ALRA 1KU2A 3KHLA 6PAXA 2M1BA 3S17J 3QU4A 2QSGX 4MGRA 3LVVA 4B9VA 2UWMA 2KG5A 2Y69H 2OTJI 3CCMI 4WCGA 3BQ1A 2I10A 2BBYA 5ALNA 2KIUA 1KTQA 5AK5A 4EBDA 3CCYA 1JUDA 1REPC 3GVAA 2CQKA 5FRNA 4Y2TA 2RQQA 1H0MA 4NDLA 5KFQA 2BZFA 2RVCA 2KJ8A 2RNGA 4I7HA 3E6CC 3VWBA 4I01A 2BDPA 3A1YA 4DSIA 3IV5A 1EH6A 2VQLA 4IQ4A 2EILH 2L4MA 3LA7A 5AKHA 1R71A 2ZC2A 3GUDA 2WFAA 3JRCA 1A04A 2W48A 3LSRA 1K83J 4H0EA 3OYBA 4QZIA 4HX7A 2YPRA 4V2FA 3N28A 2R7VA 3R0JA 4EV0A 4KLQA 4ECXA 4WXHA 2MGQA 5AI5A 1N48A 1Z77A 3V7JA 1JJ6C 4G9YA 2PI5A 1X1CA 1T95A 1XGOA 2ESHA 4EATA 4KLSA 3V6JA 5F1JA 3IRQA 3D2QA 1WHUA 2EDUA 4CUGA 4DJAA 2CYYA 2E35A 5KAIU 1TVAA 1D8KA 2CU7A 3VOEA 1ZG5A 5EG0A 5JFRA 2PI0A 1NK5A 3HOYJ 3HUGA 1N63A 1HW5A 8ICLA 5IIJA 2K4BA 4NLBA 3GTQJ 2WF5A 3O6BB 3TW6A 2K9MA 1MW7A 4AVZA 4BBRJ 4CICA 5FB2A 1PUEE 4KLJA 3KTQA 2ODGA 3MKLA 4N4OB 2QEXI 3NVWA 3RCOA 1RKTA 1X58A 4X0GA 5D49A 3L09A 4MO7A 3BJOA 1ZOLA 4A0ZA 4JOMA 4YELA 4YD2A 5CVJA 4RQ4A 3H40A 4O9MA 2QB0B 2HW3A 7ICMA 4DFDA 3M9MB 1YIJI 4PZNA 2HOQA 3E0JB 2VBXA 4XOTA 2WB1C 5KFNA 3PX0A 2KSOB 1L6NA 3ETRA 4GDFA 1F0MA 2HDCA 3SZPA 3F72A
chains in the Genus database with same CATH topology
1FMVA 2K8BB 4GFJA 2LY1A 1PYVA 2ZG6A 3OYKA 3D2SA 2I8DA 2KZVA 3SAGA 3OYLA 3EUHC 3DU5A 5CQEA 3QODA 3VDXA 2ZXHA 3AQEA 1V5EA 5TGTA 4IKFA 2W7OA 4F3QA 2LYCA 2XF6A 4ZJZA 5T14A 3OS0A 3EPZA 3S3MA 2DGZA 2R7OA 2HOFA 4OJ5A 2Q2EB 3K70C 4ZDPA 3FHNA 3S3NA 1Q3VA 3U21A 1QHGA 2GOXB 4F55A 1OLTA 2FUG2 2G0AA 3LSMA 3PL8A 4IZZA 2WBMA 1J09A 4FZLA 3HXLA 2KKVA 3K1ZA 2CUZA 2X6XA 3MKWB 2KOBA 3E0FA 3EUKL 1EA3A 2LBFB 2VPLA 3PSPA 2VXZA 3DPTA 4PJLA 2PMZF 2LRDA 1PJRA 4NWIA 2M7AA 4N4NB 1D8BA 5HNFA 4BX9C 2JVHA 2CPRA 1XO0A 4RLQA 3ICXA 2LBOA 3DQVC 2D6FC 4LG3A 5HLTA 1MA7A 4NC8A 1Z1BA 2G5IB 2DT6A 2MYSA 1SFKA 3M6ZA 2WAQC 1DGRM 1Z7LA 2G08A 4CDGA 3H35A 3A2KA 5CKTA 2ZXIA 3F9KA 2XVTA 2W1OA 1WJCA 2E1MB 2Y0SA 3DPLC 1GO3F 2HOIA 1URJA 1WFXA 2F8LA 2LH9A 1Y6IA 3DU6A 4H4KC 5KNLA 3DEEA 5FRMA 4LIUA 3OS1A 3AQFA 2JVGA 4BDZA 2KP6A 4OWRB 2VQGA 4PJJA 2WB1A 3SAHA 2WY8Q 4P0QA 4J00A 2V6EA 2IGNA 4ITVA 2K4HA 2VASA 3LFUA 2IGKA 4JQFA 4BL0B 1MNDA 1WJDA 4OJOA 2MC4A 4AYBF 4Y4RA 2HVQA 2XI9A 1Z3YA 3NWSA 3M6KA 2HDWA 2IS2A 1Z19A 2M4GA 2ZIWB 4KX5A 3BG6A 3SEZA 2KRCA 3D2NA 2IS1A 4OO1J 3CRXA 3TBIA 2XAUA 4PSXA 3K6GA 3AFHA 3TL4X 3ZQQA 2KIWA 4E7LA 2LG4A 2X51A 2VXDA 2VQCA 3IG8A 4XR6A 3CZ6A 3EUAA 4FE3A 3H0RB 1MNEA 2CV1A 2F4IA 5LFAA 3PSFA 3K4JA 1KONA 1AA7A 2XC7A 1ERDA 4CCOA 4Y33A 2KD1A 4C0ZA 2L9SA 4XORA 4CCLA 4XM3A 3IG5A 3ZGKA 2KKPA 5CRXA 2XDVA 2M3AA 2X85A 4HRIA 1A0PA 2H3IA 2ZIUA 4IX7A 2CUJA 1WJBA 3OYDA 4XKCA 4RLFA 2F6CA 2VIXA 2KMUA 2E5ZA 2M0MA 3RQ4A 3N7PD 3VYSB 1MMAA 3NRWA 4XKWA 3HPHA 3H0DA 2OXOA 2DF4B 1FMWA 1WJAA 3FBIB 1X19A 4U87A 2DXIA 3OMYA 3LSHA 1Z3XA 3BCBA 1W36D 3BC8A 4XLFA 1UELB 3DTEA 5KHDA 3L2UA 4RM2A 2LHTA 4BQQA 1UPHA 2Z1DA 2P0WA 3ONQA 4BEHB 4NLCA 4PK4A 2DJIA 3CP2A 2CV0A 2OH2A 3ZXSA 3M7DA 2BW3B 2ZIXB 4CCKA 3SMVA 4P0PB 3C28A 3K70D 2F5VA 2X1DA 3S8PA 2CMPA 2IXSA 2HZDA 1Y56A 5CPRB 4QNLA 5C0YA 2O5RA 2HPMA 3H0LB 4CGZA 4XLEA 3IN5A 2Y0SC 2W4SA 4BUGA 3W2AA 1IRXA 1HA8A 4AU7A 3K10A 1UG0A 3IAS2 3OYHA 4OJLA 2WAFA 2K4IA 3T79A 2IS4A 2GH1A 3BG7A 1YX3A 2OYYA 3L2QA 3SDBA 3LVWA 2AQEA 3MD2A 3C29A 3RSNA 3HKZF 4BJQA 3OYAA 2CRXA 1LFPA 2VJJA 3PZPA 1MMGA 4XNFA 4XLCA 3MKZA 1W36C 1WJ5A 3I9V2 1TAMA 2Z16A 2R7RA 2KQRA 2W04A 1P7DA 2MA1A 4B48A 2OC6A 4KJZA 2XF5A 2PMZA 2ZSIB 3HL2A 2ELJA 3OIQA 2CH0A 2BOLA 3S3OA 3GU3A 5A0LA 4XLAA 4P0PA 1BR4A 1LDKB 4XN0A 3W2VA 3RTRA 4XKBA 4PJNA 4CCNA 4E7KA 4II2A 3AL0B 4BE2A 4OAYA 1SZHA 4FZMA 3VYRB 4CCMA 3CYMA 1WUDA 3ONNA 4PFPA 1T94A 3OS2A 2V9KA 3SYTA 4BU2A 1D0ZA 4P5OA 3GZFA 3FBNB 4PSWA 2W03A 1D0YA 2F2AB 1NZBA 3LSIA 1Q3UA 3KX2A 4QIWF 3KEYA 3UNGC 1ZQ1C 2V7FA 1ED1A 4NUBA 1V5GA 3GBGA 1DQUA 2W00A 3D5SC 1T0FC 5FROA 2W7NA 4C2TA 4HG2A 1N78A 4YRVA 3IUOA 3ZR8X 3W2WA 3OY9A 3SEQA 4KITB 2QKLB 4ZDOA 3D5LA 2F77X 4F92B 2MABA 4QPQA 3UR3C 4HSTA 4E7SA 1MMDA 2KEYA 2KHMA 3L2VA 3DWLE 3OL3A 4E4HA 4C30A 2K8CB 2BDUA 2CFOA 3L2WA 3OYJA 2HBLA 2HBKA 1PVRA 4FZNA 2DT7B 2OM6A 2ZIVB 3DTKA 2XF7A 4ACOA 3H5AA 2VJ4A 5HVQC 2ZSHB 3PSTA 4KX3A 4FASD 2XSJC 4Y3OA 1D0XA 2K9LA 2E60A 2R7TA 3RPUD 3LMMA 1TT0A 4WJ3B 5HR7A 1HEKA 2KV2A 2W7PA 1PVQA 1LKXA 2CV2A 2V26A 2DQNB 3N05A 2G09A 1YE9A 2PJRB 1WJFA 1A6SA 2KL4A 2WY7Q 3N7RC 4XQFA 2LBFA 1N75A 4YEJA 3IP4B 3PSIA 3OYNA 2DOAA 1DGWY 1X4OA 1E0EA 2L2OA 3F2DA 3SQIA 2E1EA 3E1SA 1IIPA 3W3CA 2KDOA 1SAUA 4G6TB 2G06A 4BXFA 2KNJA 4CH7A 2X1EA 3K4LA 3OYCA 4BE0A 3M1CA 4LIVA 2PMZC 3MGVA 1D1BA 5KL8B 3PNYA 4PUSA 4ZYAA 1UAAA 3D5RC 3OL4A 3QYEA 1YT3A 2MRLA 2YB1A 4A8EA 5JHFA 4FETA 2MFZA 4RM3A 3ZCOA 2KHVA 2IS6A 3HG9A 2HBJA 4DBRA 2L7KA 2CS3A 2JSPA 3I3LA 2WB1F 3DPUA 4ICAA 4IC9A 3HUGB 2H3ZA 3PJRA 2ZIWA 4F91B 4QJFB 1OR7C 2VJ5A 4C2UA 2RP5A 2M7BA 4BJTA 2R7WA 4KMOB 3DKXA 2KPMA 2H3VA 4BS9A 4LITA 3LSKA 1X1AA 2IGMA 2HVRA 3BCAA 3MKYB 2UV1A 3C2HA 4AYBC 4U7BA 1NG6A 3S93A 4ANJA 3C2GA 3LSGA 2X6YA 3ZRGA 4DGWB 4DIQA 1D1CA 4U7CA 3OR1C 2LY2A 3G2BA 2RREA 2JHDA 1VZ0A 2A6TA 3S32A 1GLNA 3A4CA 2BVMA 4CCJA 3OYIA 3PNTA 3CESA 4E7ZA 4BQOA 3KYLA 3CP8A 4B3XA 1ECWA 3FKJA 2HMXA 3RF9A 3SAFA 2ZFUA 2UUZA 2OUMA 3N7SC 3QYBA 4R79A 4ZTFA 2V1NA 1BR2A 4BEHA 2VB6A 1G59A 1G8XA 4B43A 3HPGA 2HNHA 3OYGA 2VQHA 2BW3A 3QOEA 4D9JA 2WAQF 4E6KG 1KBUA 3F5EA 3F2BA 2KVCA 2ZIXA 3CF2A 2R4GA 2JH1A 2HQAA 4ZTJA 2V4JC 4JMUA 2GOLA 3F2CA 2G07A 2H3QA 2E1MC 1F44A 4XL9A 2H3FA 4U6PA 3OIPA 2NV3A 3HOSA 4B44A 2G5HB 3V42A 1ZELA 1QU3A 2W82A 2LC2A 3K4KA 4IQJA 1K6YA 4CZCA 2CW7A 3CJQB 1WJEA 1LVKA 2WAEA 2MD0A 1DRGA 3QYFA 4ZDLA 4OAZA 4E7JA 1BOBA 4HNTA 5HR6A 4J01A 4P0QB 3DKYA 4AYBA 2L9NA 3AKZA 4OJ6A 2DCEA 2LKYA 3H9QA 4BGDA 4DOZA 4HEA2 2WADA 3K4BA 4BACA 3VC8A 3BLYA 3HC7A 1PVPA 4F52A 1D1AA 2CW8A 2Q1ZB 3OWTA 3HKZC 2F76X 4PL2A 2AQFA 2K5CA 1NG7A 4CRXA 4GRIA 3H9GA 3K4CA 3DTIA 4II3A 2Z2SB 2A3VA 2E5NA 1OUQA 3H9JA 4XONA 3OYMA 3IAM2 3OYEA 2YB4A 4D1QA 2R7QA 4ZC3A 2JMGA 4BUPA 1BR1A 4CSWA 3F5AA 2OV7A 2HBMA 1CRXA 4E7IA 2X1CA 2ZIUB 1DP3A 3H5NA 4NNJA 5KCMA 2VKQA 3J7AY 3L3FX 2QKMB 4QPOA 2E1FA 1S9HA 4MLOA 3LYSA 3OOUA 3K4MA 2K8AA 3PFYA 2R7XA 3H0MB 2M0NA 3VCBA 2VLAA 3KFUF 3HOTA 4PFOA 4PL1A 2A5WA 2YX8A 1N77A 2LYAA 2XICA 2JUGA 1X4PA 1Z21A 3H5RA 1TZLA 3VYUB 2ZIVA 4QIWC 2CN1A 2Y0SF 3OYFA 4NLBA 2E5SA 1XNSA 2KHQA 4XLHA 4O3MA 2Q4TA 2IGOA 3CMMA 2M4KA 4NV0A 2RRDA 4HNUA 3VSKA 2NOJB 3ALRA 3M8JA 1P9QC 4CA0A 3LVVA 4XKVA 2UWMA 3OPXA 5LD2C 2L5QA 2BVLA 3OR2C 4OJPA 2LOOA 2PJRA 3NWTA 4P1WA 3MMYB 5KL1B 2R7SA 5FRNA 2K4EA 2RQQA 4RMNA 2K3PA 2RNGA 2KJ8A 4PJMA 3SZGA 4KISA 3VWBA 3F53A 3O0FA 3A1YA 3FDYA 4BJ6C 3PNVA 2VQLA 4IQ4A 5HOOA 3LL7A 2Z7JA 2GOMA 1QHHD 2K89A 2KICA 3DLAA 2HVSA 3HKZA 2X6WA 3L2RA 4BJ5C 5CQGA 4NC7A 3OYBA 2VKHA 4BQNA 2N1RA 2R7VA 2JA2A 2LREA 4BE1A 4BDYA 2JGAA 1X1BA 2HPIA 3VSLA 2WAQA 1X1CA 1T95A 4XN3A 4EATA 3PUBA 4HSRA 3CJRB 4XMYA 2XIDA 1MMNA 1YX5A 4HPQA 3AL0C 3D2QA 1V5FA 4CUGA 4DJAA 2R18A 5HNHA 2VL8A 3TMOA 2VJIA 2HU9A 4C9YA 3KZXA 2VKDA 2R7UA 2K9MA 1MW7A 4AVZA 1JI8A 2KRHA 4N4OB 3RCOA 4F93B 4X0GA 3K4NA 4KT6A 4DBQA 1HIWA 3NUQA 2WA0A 4B47A 3RFAA 4JOMA 4YELA 1U0JA 2KJ9A 2LYBA 1X1DA 4NQWB 4XOPA 4E7HA 3E0JB 4XOTA 2HOQA 2WB1C 3VYTB 2KLOA 1L6NA 2JH7A 2KJ5A 1R6RA 2RHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D6F C;  1NG6 A;  4WJ3 B;  3H0L B;  2F2A B;  2G5I B;  3H0M B;  2DF4 B;  3H0R B;  2DQN B;  3IP4 B;  2G5H B;  3AL0 B;  3KFU F;  1ZQ1 C; 
#chains in the Genus database with same CATH topology
 4JWM A;  2GQQ A;  4GFJ A;  2G7U A;  1S5L C;  4ECT A;  1R58 A;  3OYK A;  1CF7 A;  1BPD A;  3D2S A;  2I8D A;  3SAG A;  3EUH C;  5CQE A;  5D5W B;  5HHH A;  2YS9 A;  3DBH B;  3H0G J;  2L01 A;  3AQE A;  3HSR A;  4UB5 A;  9ICH A;  3RZD J;  5AKG A;  5TGT A;  4IKF A;  4RUC A;  5FFX A;  7ICJ A;  4IRI A;  2AO9 A;  2LKX A;  5E20 A;  4EM0 B;  5BMZ A;  1XWL A;  3TKA A;  3ZN1 A;  3F23 A;  3J81 K;  2DGZ A;  4RQN A;  3I0T A;  2HHS A;  5JLW A;  1A5J A;  1IAW A;  2HOF A;  2EZX A;  1YZ6 A;  3FHN A;  4A3E J;  1AU7 A;  4DFM A;  2YUS A;  1Z6T A;  3G1M A;  1Q3V A;  4PHE A;  1SL2 A;  3THV A;  4OIR F;  5H2F C;  2VBY A;  4ECU A;  4UB3 A;  2FUG 2;  4FZL A;  2P5K A;  5DG7 A;  2NOG A;  1FBU A;  2HXI A;  2A6E F;  3MKW B;  4IL6 C;  3EYZ A;  3EUK L;  3JSP A;  1YS7 A;  2KZG A;  4A6D A;  2OAZ A;  3PSP A;  4KMU A;  2PMZ F;  2V9W A;  1T3Q A;  1PJR A;  2F5C A;  3B9J A;  4N4N B;  2YX4 A;  1DPR A;  3WGI A;  2EZH A;  4Z6E A;  4RLQ A;  4ENN A;  3T3F A;  1BNO A;  3LDA A;  2EZI A;  2D6F C;  1MA7 A;  2FLP A;  1LNW A;  1S7O A;  3DBL B;  2MYS A;  3GFJ A;  2G5I B;  5D4B A;  1B59 A;  4CDG A;  3H35 A;  4RB1 A;  1W5S A;  3RJK A;  2R8K A;  4ECS A;  5CKT A;  1ZYQ A;  2ZTE A;  2HOI A;  2XGE A;  1GO3 F;  2E2I J;  5HLH A;  1TAQ A;  2F8L A;  3WHB A;  2JRZ A;  3GTM J;  3QOP A;  2M87 A;  4H4K C;  1JUS A;  4XID A;  3ISD A;  1K1S A;  2K86 A;  2ZUD A;  3AQF A;  3CO7 C;  2IT0 A;  4J9K A;  2VQG A;  2DBY A;  3KD3 A;  1K5O A;  3WU1 B;  2P4W A;  4P0Q A;  4J00 A;  2IA1 A;  2IGN A;  2FPL A;  2K9Q A;  3LFU A;  1HC8 A;  1VI0 A;  1WJD A;  4I2I A;  4WF2 A;  5HS7 A;  4MFC A;  4BXO B;  5AM5 A;  1FIQ A;  4HA8 A;  3PW0 A;  2AGO A;  4MFE A;  3SEZ A;  3D2N A;  1S7E A;  2IS1 A;  1S5L U;  3AU6 A;  2B6G A;  1VDV A;  3MQ0 A;  3K6G A;  3AFH A;  2VT3 A;  3ZQQ A;  4ESJ A;  4OIP F;  1UQV A;  2RAE A;  4M2Y A;  1J7K A;  1JHF A;  2LG4 A;  1U78 A;  3OSP A;  1L5U A;  3IH2 A;  1S6L A;  5M5X J;  5BQT A;  2DOD A;  3CZ6 A;  8ICT A;  1P7I A;  2CV1 A;  2F4I A;  3B6A A;  4FE7 A;  5LFA A;  3RAQ A;  2R5Y A;  2KD1 A;  1XB4 A;  2VKV A;  5KK1 A;  4CCO A;  1ITY A;  1SMT A;  3KHR A;  2COB A;  3LWF A;  3QAH A;  2CGP A;  4EX7 A;  1XGN A;  4DO9 A;  2M3A A;  4TUR A;  3RYP A;  2W25 A;  2ZIU A;  2W85 A;  5D5V B;  1DOQ A;  2XGQ A;  4G8X A;  1SKR A;  3F0C A;  3OYD A;  3ZP5 A;  2PMU A;  3IWF A;  4P96 A;  2DQL A;  5D8K B;  3JRH A;  1MSE C;  2F6C A;  2JZB A;  3T5H A;  2A05 A;  2M0M A;  5DGA A;  5H2F U;  3FX3 A;  5D4R A;  3HPH A;  4I99 C;  3H0D A;  1X9X A;  5E8G A;  4O0I A;  4RBO A;  5IIK A;  5K7H A;  3FBI B;  4U87 A;  1KQ9 A;  4IRG A;  5AM3 A;  2CWE A;  1FJL A;  3TP0 A;  1LE8 B;  4XLF A;  2CJJ A;  4RUA A;  4YVZ A;  2O9L A;  1QTM A;  1UEL B;  3UXO A;  3I4M J;  5ICG A;  1FBQ A;  1G3S A;  2E36 A;  2F5E A;  3OSG A;  1JI7 A;  2I5H A;  1UPH A;  4RT3 A;  4BEH B;  2L7M P;  2DJI A;  2CV0 A;  2EIM H;  3KPH A;  4S05 A;  3RPQ A;  3I5U A;  3BTJ A;  1MDM B;  2UVR A;  3J80 Z;  1LFU P;  4BY1 J;  1D5Y A;  3HDD A;  1S97 A;  2DO7 A;  3CCE I;  3C1Y A;  5C3E J;  1FOW A;  3SMV A;  2A61 A;  2RNJ A;  4IHY A;  2RN7 A;  3ETL A;  2X1D A;  1MBE A;  2HZD A;  2DTZ A;  1B9N A;  5CPR B;  3C21 A;  2Y1J A;  3PV8 A;  2HPM A;  4CGZ A;  4QZF A;  4KUM A;  4ED0 A;  4DYR A;  3IN5 A;  3K4G A;  4BUG A;  4DL5 A;  2MAX A;  1TKD A;  1IRX A;  2IP2 A;  1HA8 A;  5H20 A;  2RV8 A;  3K10 A;  4XRH A;  4W97 A;  4JWN A;  3QU5 A;  4C7Z A;  4E0D A;  1ZJM A;  2WF6 A;  4OJL A;  2WAF A;  5E1X A;  1BC8 C;  3T79 A;  1J75 A;  5HDN A;  2GH1 A;  2FE3 A;  5DM7 F;  5J2F A;  2OYY A;  3L2Q A;  3SDB A;  3Q8M A;  3LVW A;  3ASO H;  2AQE A;  1LV5 A;  4JV1 A;  3MR2 A;  3GV7 B;  5DEQ A;  5EE1 A;  3HKZ F;  4RQ8 A;  2XCA A;  3OYA A;  2CRX A;  5IYC J;  2DQR A;  3G3Z A;  1MMG A;  1ZQR A;  4XLC A;  1V55 H;  3W6V A;  3MKZ A;  1J2N A;  2E3T A;  5L3D A;  1MBF A;  1WWU A;  4UAZ A;  1KLN A;  1KU3 A;  3PM1 A;  1ZQ3 P;  2NVX J;  2BHN A;  4EX6 A;  4F5P A;  2ZSI B;  3GEZ A;  3VB2 A;  3HL2 A;  1XDU A;  5BOL A;  2ELJ A;  2Z33 A;  2F8K A;  2CH0 A;  5DUI A;  3S3O A;  2YMM A;  2TCT A;  1ZQA A;  1E3P A;  2XY6 A;  4XKB A;  4CCN A;  3RR8 A;  1I50 J;  2HWV A;  1EH8 A;  2RC4 A;  5FKO A;  4E7K A;  1IC8 A;  1U2W A;  2FPM A;  2G7H A;  1RKW A;  3CYM A;  3QUT A;  5KT2 A;  3MDC A;  5J29 A;  7ICF A;  1YW8 A;  2VBW A;  2QB0 A;  2EA2 A;  5AM2 A;  1QO0 D;  3RBE A;  3HWT A;  3NRV A;  1GDT A;  9ICO A;  3PIO F;  3TGN A;  1D0Y A;  2KSO A;  1NZB A;  1S0N A;  3RB6 A;  5AI9 A;  3F8C A;  3PQK A;  4L18 B;  4RAZ A;  4QIW F;  1ZQ1 C;  3K1M A;  4DL2 A;  4EEY A;  2XY5 A;  1ED1 A;  4NUB A;  2W7N A;  3IG5 A;  1GXQ A;  3QNM A;  1ZTR A;  2XO7 A;  4YRV A;  3IUO A;  3ZR8 X;  3W2W A;  3OY9 A;  1UHM A;  3C23 A;  2YR2 A;  4Q48 A;  3QP6 A;  3WK6 A;  3SFI A;  1OCO H;  2K8C B;  2BDU A;  3ZQ7 A;  2HBL A;  2HBK A;  1XDS A;  4LGW A;  1FYK A;  3EW9 A;  3C2K A;  1IN4 A;  1IN6 A;  1R1U A;  2OM6 A;  3DTK A;  2LMD A;  1SV0 C;  1IM4 A;  2JR5 A;  2GXA A;  3F8M A;  1SVO A;  2ZSH B;  4KX3 A;  7ICR A;  4LFU A;  2XSJ C;  4GCV A;  3PQJ A;  4E70 A;  2K9L A;  1YZ7 A;  3NGD A;  2R7T A;  3FM5 A;  1ZD5 A;  4KLT A;  1NOM A;  1S0V A;  2GO7 A;  3WTT C;  3V8L A;  1YHQ I;  1ZG3 A;  1QQ5 A;  2W9B A;  2DQN B;  2E7X A;  1MBJ A;  4O3S A;  2ASJ A;  2PJR B;  4XQ8 A;  1MBG A;  1NH3 A;  4M0A A;  8ICR A;  1KA8 A;  1LJ9 A;  4XQF A;  5F0H A;  1SFX A;  4YEJ A;  2VE9 A;  4HDU A;  5ALZ A;  5ALF A;  2LNB A;  1G6N A;  1BI2 A;  1JUM A;  5GTH C;  3ISC A;  1ZH5 A;  1E17 A;  3MEX A;  2DOA A;  4I98 B;  1DGW Y;  1BW6 A;  4Y17 A;  3TED A;  1X6I A;  2DPU A;  3F2D A;  1TW3 A;  2GIV A;  1GXP A;  1I27 A;  3HRS A;  3BPX A;  4IXA A;  5GAD J;  4J9S A;  1IIP A;  3W3C A;  4R1H A;  4DQR A;  2ZJ8 A;  3JW4 A;  4Y7N J;  1FO4 A;  4WK8 F;  2XC9 A;  4BNC A;  2PMZ C;  5GP9 A;  3M1C A;  4EMS A;  4ED7 A;  1I3Q J;  2W84 A;  2PFN A;  1D1B A;  4DQI A;  2M8E A;  3JTH A;  2YU3 A;  1IRF A;  5KFX A;  2E1C A;  1YT3 A;  5AHX A;  3QYE A;  4LD5 A;  2KIV A;  5JHF A;  2XGC A;  2BHZ A;  2MFZ A;  4RM3 A;  2KHV A;  4RQ1 A;  1U3E M;  4XIC A;  1W7P D;  2DOE A;  4LMY A;  3PML A;  2Z3Y A;  3I3L A;  4C8N A;  5A2Q Z;  1YG2 A;  1SXD A;  4RNM A;  2H3Z A;  4BXO A;  1XS9 A;  3PJR A;  4USA A;  3HIF A;  3BR5 A;  4QJF B;  4XSZ F;  1OR7 C;  4DSL A;  2UVV A;  4Q4Z F;  2VJ5 A;  1YRN B;  2HDO A;  2M7B A;  2A5Y B;  4ECQ A;  2ES6 A;  1VQN I;  5KFR A;  2KPM A;  4UAV A;  2W8L A;  2CRG A;  2I5U A;  3S1M J;  4LIT A;  1TV9 A;  5IOZ A;  3CCQ I;  1YFH A;  1V97 A;  3NAS A;  3E58 A;  5E1Z B;  1SFU A;  5F0F A;  3CCV I;  5EE9 A;  3C2H A;  4QSH A;  2JRT A;  2P7C B;  1GV2 A;  2NRX A;  3H3Z A;  5LRS A;  1APL C;  3HKZ N;  2R3S A;  1ON1 A;  1IXR A;  1MC8 A;  3LQQ A;  1BIB A;  3C2G A;  1MKM A;  4DGW B;  2JXJ A;  4DIQ A;  1D1C A;  2MW8 A;  3QUQ A;  5BOM A;  3OR1 C;  5LHG A;  5HS8 A;  4NM1 A;  3L1P A;  2D1H A;  3C1D A;  3G2B A;  1U5T C;  9ICQ A;  2JWT A;  2R8I A;  2P5L C;  5DV5 A;  4G9B A;  2OTL I;  3A4C A;  3OIO A;  1SD7 A;  2WAQ N;  3WOD F;  1IXC A;  1XS9 D;  2DFH A;  5ALM A;  2OZ6 A;  1ECW A;  3H36 A;  3QX7 A;  1LE8 A;  2QAR B;  2BEO A;  4LZD A;  1HST A;  3PR5 B;  4D0P A;  2UUZ A;  4C4R A;  2V1N A;  5EJC A;  2E1O A;  3J80 K;  2TRT A;  5BS6 A;  4M9S A;  4BEH A;  3PO2 J;  2VB6 A;  2JEF A;  3SFZ A;  3HPG A;  1KBU A;  3QOE A;  3LAJ A;  3ABM H;  1MDM A;  3ZMZ A;  4EEL A;  9ICF A;  5IIM A;  3H1C A;  3FXU A;  2ASL A;  3LOC A;  3EZ5 A;  4DSE A;  1KFT A;  7ICQ A;  2HQA A;  4ZTJ A;  2MU2 A;  5EWG A;  5BPC A;  2MLK A;  2H09 A;  2G07 A;  5J47 A;  4L9V A;  1GV5 A;  4XL9 A;  3CF5 F;  2JEG A;  3HOS A;  3MC1 A;  2LTP A;  3BQY A;  1Y88 A;  3HT3 A;  1X2M A;  4U7D A;  1QU3 A;  1JRP A;  2I6X A;  3NVY A;  2W82 A;  2Y9Z A;  3FMR A;  1RZ4 A;  3H7I A;  4F4Z A;  4PGH A;  4J9L A;  2L7Z A;  5AM1 A;  2NYX A;  3CJQ B;  2TDX A;  4A6E A;  1O4X A;  1NJW A;  2MD0 A;  5DG9 A;  1DRG A;  1IRZ A;  2FBK A;  2DPD A;  4C8K A;  3CC2 I;  3ZPL A;  4BXX J;  1T98 A;  4NBQ A;  3S14 J;  3Q8L A;  4F2R A;  4HW0 A;  4Y2V A;  3ZDB A;  1ETX A;  4HDV A;  1G3Y A;  2LR8 A;  5AK4 A;  2VT2 A;  4BAC A;  3K4B A;  5KAF C;  1ZRM A;  1L3S A;  4FQG A;  3BLY A;  4FS2 A;  1JTY A;  2ME0 A;  4JYK A;  4DS5 A;  2PX9 A;  4KLE A;  1JGG A;  3HKZ C;  4QWA A;  1ZQS A;  2CQ7 A;  3TDZ C;  2F76 X;  5BPD A;  4GXI A;  1HCR A;  2L54 A;  2W43 A;  4G94 A;  4IRC A;  4GRI A;  1FC3 A;  4II3 A;  1TTY A;  1T7P A;  2J6T A;  2QSF X;  4KTQ A;  2DOF A;  1OUQ A;  2KTQ A;  2E7W A;  3H9J A;  3M8F A;  1R9T J;  2YB4 A;  2JTV A;  4Z6C A;  5AIC A;  4ZC3 A;  1O7F A;  3J81 j;  1EV7 A;  2OV7 A;  2HBM A;  4B9M A;  4GYI A;  4HYE A;  3HP6 A;  2ETH A;  1CRX A;  2FOW A;  4P55 A;  2J5O A;  4E7I A;  2VI6 A;  8ICM A;  2L9R A;  1DP3 A;  1I39 A;  2CUF A;  2JUC A;  3I56 I;  3L3F X;  2Y2Z A;  2QF7 A;  4L9T A;  2Y31 A;  2E1F A;  5ALG A;  2V79 A;  2Y0S N;  5DQH A;  2EH9 A;  1R5H A;  5J2A A;  2OD5 A;  1HBX G;  7ICI A;  5J4Y A;  1PUZ A;  4IHX A;  2M0N A;  3ZN0 A;  1RNL A;  3VCB A;  4JX6 A;  3KFU F;  9ICC A;  4AID A;  1KL9 A;  2YMP A;  4I2O A;  3FK6 A;  3CUO A;  1UHU A;  3IDW A;  1X4P A;  4QWE A;  5BOX A;  5KFV A;  1TZL A;  3CJN A;  4QIW C;  4UAS A;  3OYF A;  3EUH A;  2EIJ H;  4F5R A;  4DZP A;  4UW9 A;  2IMW P;  9ICU A;  7ICV A;  4Y2Q A;  3R0A A;  4FBU A;  2M4K A;  4NV0 A;  4DL6 A;  1UCR A;  5GTI C;  2RRD A;  2RQP A;  4HNU A;  3IL2 A;  4JBA A;  4US8 A;  1KFS A;  2CG4 A;  2CW0 F;  2NOJ B;  2XAH A;  3L7W A;  3M8J A;  5J0Y A;  5DS9 A;  1X2I A;  2BQU A;  2AHQ A;  2KFZ A;  1SGG A;  1RC9 A;  5ALR A;  5FJ8 J;  4XKV A;  1CQT A;  1EH7 A;  5LD2 C;  4OJP A;  3RJJ A;  1ETO A;  2PJR A;  3HRM A;  4P1W A;  3MMY B;  2NRV A;  4DEZ A;  3BP8 A;  3QU3 A;  4A0X A;  3B6C A;  1ZQY A;  1N5X A;  4JK1 X;  2FX0 A;  2HOA A;  4RMN A;  1AQ6 A;  1SEU A;  3T5L A;  3BZC A;  5ALD A;  3F6V A;  3GYH X;  4KIS A;  4MFD A;  5EEG A;  5DYM A;  1QSY A;  3PR4 A;  2LVS A;  4BJ6 C;  3DV8 A;  2LLK A;  3PNV A;  2KZM A;  3LL7 A;  3CQZ J;  3R60 A;  2GOM A;  1QHH D;  4L0Y B;  4OIO F;  3KEO A;  3BQ0 A;  2P6T A;  3DLA A;  2HVS A;  2PLY A;  2X6W A;  2W9M A;  1P4A A;  2W57 A;  1RUN A;  1SZP A;  1SWW A;  4O3O A;  3UPQ A;  2VKH A;  3MVP A;  1X3Z B;  4BQN A;  2N1R A;  2JA2 A;  2FU4 A;  3E2E A;  4M3G A;  1L8O A;  3HTU A;  4BDY A;  3DXJ F;  1NK3 P;  2FI1 A;  1X1B A;  1F9N A;  1LEA A;  3VFZ A;  5L3B A;  3CCR I;  4Z6D A;  3V6H A;  4B9S A;  2EH3 A;  2HXO A;  3CO6 C;  2HFH A;  5KT7 A;  5A2Q K;  4O5K A;  4XMY A;  4XLN F;  3H3V K;  1YX5 A;  3AL0 C;  5CYV A;  3D6J A;  2DWQ A;  4I2F A;  2CUE A;  1ZN2 A;  2IEK A;  4ZZD A;  7ICS A;  4XSX F;  3FF5 A;  5E3N A;  2VOD A;  5F9L A;  2GWR A;  4UY8 I;  8ICV A;  4QW8 A;  2Y30 A;  2R7U A;  3C2B A;  1DGJ A;  2ZUC A;  2FMS A;  9ICW A;  3CDH A;  4EZ6 A;  2F5D A;  3QXG A;  1FOK A;  1Z19 A;  2XV4 S;  3I71 A;  4U0W A;  4W1U A;  4IEJ A;  4F93 B;  3WKD A;  3EPI A;  3TO6 A;  3K4N A;  3WTX C;  4DBQ A;  1HIW A;  3NUQ A;  3V8K A;  2R5Z B;  1X66 A;  3RFA A;  4FTH A;  2BCR A;  4EJU A;  3FC4 A;  4PZO A;  1HQC A;  1X1D A;  2QGU A;  4IQW A;  3GZ6 A;  3Q8R B;  4XOP A;  2HHV A;  7ICK A;  3HW8 A;  5CHG A;  5ED4 A;  1TWG J;  3GTJ J;  1O3Q A;  3VYT B;  5AIA A;  3PW4 A;  1ZQU A;  2B63 J;  2FLL A;  3PX6 A;  2JH7 A;  2KJ5 A;  1SXE A;  5JTI A;  2O3F A;  1KQ0 A;  1X1P A;  3CUQ B;  4RB3 C;  2E8O A;  3KZI C;  4A93 J;  1ZG1 A;  4B9N A;  3K7A J;  4EJO A;  4AIH A;  1QCK A;  2M34 A;  3AAF A;  5GTI U;  1WWX A;  8ICC A;  3CC4 I;  3GFM A;  4X1E A;  3QOD A;  3VDX A;  4YN4 A;  5EEH A;  3FXO A;  1V5E A;  1COO A;  2ID3 A;  4M3F A;  2BY0 A;  4JV2 A;  2W7O A;  2LYC A;  2XF6 A;  2XKO A;  4ZJZ A;  5T14 A;  3JPO A;  3RJI A;  1OKR A;  2K9N A;  2DPI A;  4DSK A;  2XPU A;  4XRF A;  2K7L A;  3RB4 A;  2QAR A;  2IHN A;  2W9C B;  4GXJ A;  2M9H A;  1IGN A;  3G6Y A;  1U5T B;  5EEA A;  3K70 C;  3CD6 I;  4I27 A;  2F5F A;  4XA5 A;  2HI0 A;  2Z5U A;  3MR3 A;  1QHG A;  4F55 A;  1TL8 A;  4Y2S A;  9ICJ A;  1H9G A;  2ID6 A;  1PZN A;  3LSM A;  2G0A A;  4IZZ A;  4KMF A;  2FF4 A;  1LVH A;  4IHS A;  4UV8 A;  2MSN A;  1KRP A;  1ZQQ A;  1RQL A;  1I5Z A;  1FT9 A;  2LBF B;  1Z3E B;  3DPT A;  1W5T A;  4PPX A;  4JK1 A;  3ELK A;  5FD5 A;  2DMP A;  5KG4 A;  2V4Q A;  4BX9 C;  3ZDD A;  1WCM J;  1A76 A;  3ZD9 A;  2F2E A;  4YCX A;  2EAN A;  2J6U A;  2LBO A;  2X4H A;  1FBS A;  4AVP A;  1MSW D;  4HF1 A;  3Q0W A;  5J2I A;  2DT6 A;  2R5Y B;  1YO5 C;  1HF0 A;  2G08 A;  3RKQ A;  5KAI C;  3OSF A;  3A2K A;  4MNU A;  1G2H A;  1WPK A;  1ZQO A;  2IHM A;  1L7M A;  4ZH4 A;  2ZXI A;  1U4B A;  2XVT A;  2W1O A;  3HJE A;  5CB1 A;  1D8J A;  3TQ1 A;  1Y6I A;  5KNL A;  2OF7 A;  3R9K A;  5FRM A;  1SD5 A;  1IN5 A;  2VKE A;  3GLX A;  4LIU A;  5GAG J;  4M6Y A;  4G3I A;  9ICM A;  2QEN A;  2DUY A;  2DMN A;  2LI6 A;  4PJJ A;  1HLV A;  4HLY A;  1JXS A;  3BR2 A;  3OGU A;  3HRD D;  2ZB9 A;  1NK2 P;  2K4H A;  4R63 A;  3V7R A;  1D5V A;  2GBY A;  3QZ8 A;  5HMM A;  3GFI A;  2UVU A;  4JQF A;  1BVS A;  1MND A;  2V4R A;  4HOB A;  2R8H A;  3GZN B;  4DYQ A;  2MC4 A;  4OOI A;  1X9S A;  2XI9 A;  4L9J A;  1FP1 D;  3UMB A;  2HDW A;  1IZ1 A;  2M4G A;  3ECH A;  2DBB A;  2F44 A;  4C8L A;  2KRC A;  2HI3 A;  4OO1 J;  1FSE A;  4RS8 A;  2DFI A;  2XAU A;  4PSX A;  2KIW A;  1HKS A;  3F8B A;  4IQV A;  3OJS A;  1QRY A;  3C1Z A;  3C5F A;  3PW2 A;  4YR3 A;  3I54 A;  4YR2 A;  2Z99 A;  3CCL I;  1UB9 A;  2HOE A;  4XR6 A;  2K9S A;  3EUA A;  5E3O A;  3H0R B;  3IV6 A;  4FE3 A;  5AK6 A;  3QPL A;  1NKB A;  5DB7 A;  2HVI A;  2STT A;  3BJA A;  1ERD A;  5J2J A;  1UJ8 A;  4F8R A;  2L9S A;  4XOR A;  3WK9 A;  4KMU X;  3OHA A;  1N56 A;  5CRX A;  1YIT I;  3ZGK A;  8ICJ A;  5EWE A;  8ICQ A;  1A0P A;  1DU0 A;  2H3I A;  4NB5 A;  4CYC B;  4I6Z A;  4UB6 U;  4RNO A;  4GC6 A;  4L0Z B;  3J7Z I;  4EVI A;  4QZB A;  4RLF A;  4AM3 A;  2VIX A;  3RQ4 A;  1QPI A;  3N7P D;  3L00 A;  2QLZ A;  4WX9 A;  5J0W A;  5KFI A;  2DAO A;  1Y1W J;  2JK3 A;  1HKQ A;  4V2G A;  4WXC A;  1BIA A;  3JRD A;  1EJ9 A;  1M1E B;  3JPN A;  3NVZ A;  5KHD A;  2BCU A;  3L2U A;  3WGH A;  5CVI A;  5CJ7 A;  3K1P A;  3P7N A;  8ICA A;  5III A;  3TI0 A;  2BZT A;  3ONQ A;  2FEZ A;  5KG0 A;  5ALE A;  3UXN A;  3C5G A;  1ULY A;  3WTS C;  5L1K A;  4ECR A;  2OH2 A;  5E1W A;  5IP9 J;  3M7D A;  5DQI A;  1S10 A;  2DYR H;  1F43 A;  3GIL A;  3NEU A;  3COA C;  2DA2 A;  2ZIX B;  3O2P E;  2C22 A;  3E5Q A;  5AI6 A;  1SV0 A;  2ZME C;  3S8P A;  1Y39 A;  3UXP A;  4J9Q A;  5C0Y A;  5DBC A;  2ASD A;  3HPO A;  1QZZ A;  9ICS A;  1H88 C;  2NRZ A;  2ZTC A;  1UHS A;  3BDP A;  4XLE A;  2W4S A;  3W2A A;  3LQR A;  1VQM I;  2NVT J;  1UA1 A;  1JKP C;  2BGC A;  5J0U A;  3NS1 A;  3Q9V A;  3OTQ A;  4KDP A;  4EM2 A;  3M8R A;  4ZZL A;  4D7M A;  2FMP A;  1IDY A;  3QWL A;  2IS4 A;  3BG7 A;  1ZQV A;  3GZ5 A;  5KFS A;  1YX3 A;  4A0Y A;  4YG2 F;  1ZRD A;  4NL9 C;  1K61 A;  4FHT A;  1QLN A;  2F1J A;  3MD2 A;  4ECW A;  2QWW A;  3C29 A;  2HYF A;  2BCS A;  1FEX A;  3HRT A;  2YML A;  4HQM A;  2VOO A;  1LFP A;  3H8M A;  3PZP A;  2FQ3 A;  4XNF A;  4FS1 A;  2OWO A;  2E8P A;  3CTA A;  1W36 C;  1WJ5 A;  4I29 A;  5IP7 J;  1WVR A;  2KQR A;  5ALK A;  2R7Z J;  1UG2 A;  1R4M B;  5HDK A;  2MA1 A;  3TAN A;  1ZQP A;  4M9L A;  3HOZ J;  2EIK H;  1Z7U A;  4KJZ A;  2PMZ A;  2RDP A;  2QVO A;  1SC7 A;  4IR9 A;  3OIQ A;  3MDA A;  1K6O A;  3KIO A;  3ED5 A;  1XC9 A;  1ZGA A;  5L3C A;  1A31 A;  3I4P A;  3CJT B;  4XN0 A;  4RQ6 A;  2KIS A;  3I1Y A;  4PCQ A;  4UBC A;  3VEP A;  4I2J A;  1ZK8 A;  1H9T A;  5DBB A;  1XD7 A;  3AL0 B;  4BE2 A;  2C6Y A;  4FZM A;  2R7D A;  1PK1 A;  2RHF A;  4CCM A;  1WCN A;  3BZK A;  2HKO A;  4IF4 A;  2R5Z A;  4PFP A;  1T6S A;  5CWR A;  4MEX F;  4GXK A;  3J7Y J;  3BR3 A;  3GTG J;  4I2D A;  1MQ3 A;  3SYT A;  1FP2 A;  2KT0 A;  1D0Z A;  3TKY A;  4BU2 A;  3JTG A;  2UVW A;  3WKE A;  2A07 F;  3K1R B;  8ICG A;  1XC5 A;  3BPV A;  3I4N J;  1OR7 A;  4PSW A;  3WTW C;  3LSJ A;  4HAI A;  3EET A;  1QNT A;  2QM3 A;  1U48 A;  3KP5 A;  2J5P A;  3UNG C;  3DEU A;  3CUQ A;  2V7F A;  4Z2Y A;  3ROU A;  3ZMT A;  4D7N A;  1ZQM A;  2FPK A;  4C8O A;  1F1Z A;  5EE0 A;  1V5G A;  2JJ7 A;  1DQU A;  2W00 A;  1T0F C;  2QSH X;  1ONV A;  4HG2 A;  5HOD A;  3EPG A;  2VOP A;  3A02 A;  4GC7 A;  2GLO A;  2QKL B;  4F92 B;  2MAB A;  5DB6 A;  5D4S A;  2DJN A;  2KEY A;  2KHM A;  1OIS A;  1MBH A;  1IDZ A;  3ISP A;  2Z9O A;  3DWL E;  3RR7 A;  4ELU A;  2HVH A;  5E8I A;  1T56 A;  2XIG A;  1QVU A;  3OYJ A;  1P4X A;  1ZAO A;  3L2W A;  2ZIV B;  3T1B A;  3RKY A;  5E3M A;  2A6H F;  3AG3 H;  3H5A A;  3ZI4 A;  2W9C A;  5HVQ C;  3SR6 A;  1JKQ C;  2XHK A;  4DFK A;  1BBY A;  3ESW B;  2ESN A;  1U5T A;  2DLL A;  3O8H A;  1D3Y A;  3Q3S A;  2JMW A;  4MTD A;  4CE6 A;  3RRG A;  4YMM A;  2CQN A;  2BY1 A;  3QYP A;  2EWN A;  1HEK A;  2KV2 A;  3RRH A;  3IWZ A;  1J97 A;  1PVQ A;  4O6J A;  1T39 A;  3N05 A;  3U1D A;  1ZQW A;  3H8W A;  3CCS I;  2KL4 A;  2WY7 Q;  2D8C A;  1ETW A;  2LBF A;  1EF4 A;  3PSI A;  3WK8 A;  5IP6 A;  3U1K A;  1L0O C;  3DDH A;  5KFL A;  2JA5 J;  3WK5 A;  1ZQG A;  1OQY A;  1ZR4 A;  2B21 A;  1E0E A;  4UB8 C;  4YQW A;  3JRE A;  4CHU A;  5IT9 Z;  1TK8 A;  2E1E A;  2HGC A;  4HF2 A;  3E1S A;  1A6Q A;  2KDO A;  1SAU A;  3S15 J;  4G6T B;  1FIA A;  3WTZ A;  2QBY B;  2KNJ A;  1R5I D;  3LA3 A;  1KFD A;  3TP3 A;  4C3J J;  5DBA A;  3OYC A;  3UMC A;  2XRL A;  3MGV A;  3H4B A;  5JI6 A;  4IQU A;  4UVC A;  2C2R A;  4F2S A;  3PNY A;  4ZYA A;  5J4V A;  3D5R C;  3OL4 A;  4HV6 A;  1NTC A;  2X6O A;  4J19 A;  2P35 A;  2DA6 A;  3ZCO A;  2IS6 A;  3OSN A;  2HR3 A;  2Y9T A;  3HG9 A;  2M45 A;  2HBJ A;  3MFK A;  1LUJ B;  3CMY A;  2XPV A;  5CP2 A;  5KFK A;  9ICG A;  2CS3 A;  1XMX A;  2FOK A;  4EGZ A;  1HDD C;  4ICA A;  4I2G A;  5L3E A;  4P9F A;  4BYY A;  3PFI A;  4BHP A;  3PNC A;  4MTE A;  3B0Y A;  1R7J A;  3ZMU A;  1ZRN A;  5F04 A;  5GAH J;  2RP5 A;  4BJT A;  5J2E A;  2W8K A;  3TO7 A;  1NZP A;  3B73 A;  1N61 A;  4M9J A;  2HHT A;  3F3X A;  4F4X A;  3HYI A;  3LSK A;  1X1A A;  1DXS A;  2HVR A;  5J1R A;  4Y2U A;  1W0T A;  2NRA C;  1BC7 C;  1ORK A;  2UV1 A;  2P6S A;  4TV7 A;  1KU9 A;  2Y48 A;  4U7B A;  1JKR C;  4ANJ A;  1FEZ A;  5AM0 A;  2DA1 A;  4CYC A;  1BPE A;  1G3W A;  4GXO A;  8ICB A;  3QU9 A;  2X6Y A;  1W4M A;  4U7C A;  1VQ4 I;  4B09 A;  4YFK F;  1IO2 A;  1L3T A;  1SAN A;  1UST A;  4MFA A;  2EJR A;  2VN2 A;  1DU6 A;  1RR7 A;  3SHF A;  4ABZ A;  3JAM Z;  4A3J J;  3B0X A;  1TK5 A;  1RYR A;  4DQP A;  2IPQ X;  1OFC X;  2BVM A;  1H89 C;  3Q0V A;  3CES A;  2ZJR F;  4YFX F;  4J9R A;  1SL1 A;  3A0B C;  1W0U A;  1LDD A;  4WXD A;  2BKE A;  2NO5 A;  3RF9 A;  1OCT C;  3K2Z A;  1QZY A;  1R36 A;  2OUM A;  5C44 J;  4DNC A;  4R79 A;  3G6E I;  4ZTF A;  3KKA C;  5J0P A;  4G6Q A;  1BR2 A;  2FLN A;  4UVB A;  4UB8 U;  1JJ8 C;  3RH6 A;  2VBZ A;  1G8X A;  4B43 A;  3BT9 A;  1U8R A;  4CF4 A;  5KT3 A;  4UB4 A;  4R65 A;  2JV3 A;  2VQH A;  1SMY F;  2WAQ F;  4E6K G;  4K4H A;  5IYB J;  2KVC A;  2ZIX A;  3CF2 A;  2FDR A;  3PX4 A;  4UV9 A;  2PFP A;  4YIR X;  3QEB Z;  2R92 J;  1HXD A;  1YJ9 I;  2AU0 A;  4DW6 A;  1T3N A;  2FJ1 A;  3DEW A;  1YYV A;  1LDJ A;  3CLO A;  4Y2R A;  5KFU A;  2H3F A;  3T8R A;  2M2E A;  4B44 A;  1RUO A;  2G5H B;  4UUV A;  2H94 A;  5DG8 A;  2ZME B;  2LC2 A;  4US9 A;  5IIN A;  3TAR A;  3K4K A;  5IYD J;  4RAY A;  3T0Y A;  1WJE A;  1LVK A;  1RYS A;  3QPH A;  1RDF A;  3QEA Z;  2WAE A;  3BR1 A;  4ED8 A;  2EFW A;  4X6A J;  1SIJ A;  5HP4 A;  1NK6 A;  3BG9 A;  1A35 A;  2GZW A;  3DF8 A;  1SWV A;  4E7J A;  5BPI A;  1ZRC A;  2YU9 J;  1NNL A;  1T4G A;  4M6W B;  3CMA I;  5AKE A;  3CW2 C;  1TWC J;  4Z6F A;  1X9W A;  3SI8 A;  5HR6 A;  1AWC A;  1CUK A;  2ZCW A;  3R6S A;  3RYR A;  1MJB A;  4AYB A;  1TP4 A;  1OJL A;  4OJ6 A;  3PMN A;  1XMA A;  5ALH A;  5J2G A;  2O8K A;  2VC0 A;  2KFD A;  3H9Q A;  4BGD A;  1XSL A;  3NTU A;  3C2M A;  3GW2 A;  2YSR A;  2W9B B;  1PVP A;  4F52 A;  1SV4 A;  1D1A A;  3OWT A;  5DKW A;  1ZQN A;  4A3K J;  3SZT A;  3V7S A;  3AU2 A;  1BPB A;  2XVC A;  2K5C A;  4M72 A;  1NG7 A;  2ECB A;  2DMQ A;  4CRX A;  5CVU A;  4RQ2 A;  1JT6 A;  2AXL A;  1S0M A;  4IS7 A;  3LA2 A;  3E6M A;  3M3Y J;  1F5S A;  3DFG A;  3BS5 B;  5HML A;  5KFY A;  3NRZ A;  1IF1 A;  2G9W A;  1SL0 A;  3FM9 A;  1BPX A;  3E7L A;  3OYM A;  2PMH A;  1JXL A;  1XCB A;  1ZGJ A;  4BUP A;  4CSW A;  3A0B U;  2X1C A;  3F21 A;  3CME I;  2MSY A;  3KP6 A;  2GXB A;  5KCM A;  2BY3 A;  3F6O A;  5D5U B;  5L1I A;  3NVV A;  1QSL A;  1SD6 A;  2YX7 A;  2H1L A;  2MUT B;  5KFC A;  1S9H A;  3PUF A;  3LYS A;  3L4P A;  1T8E A;  1A77 A;  4F50 A;  4YII A;  1QH9 A;  2K8A A;  4IOC F;  2C28 A;  2FMQ A;  3OHB A;  4K4I A;  2IOF A;  1WWV A;  1R1V A;  2QQA A;  1KW4 A;  4M73 A;  2VLA A;  2RLT A;  5LEJ A;  4KYW A;  2A5W A;  3MBY A;  3H3U A;  2IBK A;  5F08 A;  2LYA A;  2XIC A;  4UAR A;  4B1R A;  2AGP A;  3O3K A;  3VYU B;  2ZIV A;  1P92 A;  2CN1 A;  2Y0S F;  2E5S A;  5K1Y A;  2KHQ A;  3KFW X;  4RAG A;  4YD1 A;  5B1B H;  2O61 A;  4PDK A;  2JRM A;  3GME A;  3KET A;  2KZZ A;  2BV6 A;  4JUZ A;  7ICU A;  3BTI A;  2R8G A;  2VA3 A;  4L5E A;  3RQI A;  1P9Q C;  4RPZ A;  3IC7 A;  3SZ2 A;  1NK8 A;  3OPX A;  5ALY A;  5ALI A;  2WTF A;  2L5Q A;  3OR2 C;  4RNN A;  4IRD A;  5ALQ A;  2LOO A;  3WTU C;  5CA7 A;  1ZHF A;  1TWA J;  1TWF J;  4R66 A;  3ABT A;  4ED3 A;  3LNQ A;  4HZF A;  2GA2 A;  2CSO A;  5IT9 K;  3LWL A;  2HSZ A;  1X9M A;  3TW7 A;  3O0F A;  3RTV A;  3IHU A;  3SZG A;  3F53 A;  5KFP A;  3ZOB A;  3F8N A;  3WU0 A;  1RPL A;  5L9X A;  4UAY A;  3ULQ B;  4RGS A;  3ERE D;  2Z7J A;  3DCF A;  2NNN A;  2K89 A;  3Q0U A;  3S1Q J;  4LB6 B;  3MZ8 A;  1DK3 A;  2QBY A;  4FCY A;  4IQT A;  5CQG A;  4RPX A;  3GV8 B;  4NHJ A;  3A01 B;  2AH5 A;  3S16 J;  2FNP A;  2O7O A;  2G0E A;  2BPG A;  9ICA A;  4O3Q A;  5GPC A;  1WKM A;  2LRE A;  3DBR B;  4QTR A;  4BE1 A;  2OEH A;  3QPS A;  4DFJ A;  1Z6R A;  5AI0 A;  5ALP A;  1YJN I;  1ZYR F;  1Z67 A;  2D2W A;  5C5J A;  1O3S A;  1JRO A;  2IOH A;  4ZYE A;  3CJR B;  5CLS A;  3G73 A;  4P4O A;  3ZDE A;  5IOY A;  3MR6 A;  4HPQ A;  1D8Y A;  4LZG A;  3KZY A;  2R18 A;  2VL8 A;  3TMO A;  3JSO A;  2HU9 A;  2ZO4 A;  2NS8 A;  5LGT A;  3KZX A;  3GTK J;  3QUB A;  2BCV A;  1Z4O A;  4CYD A;  4KLL A;  4A3M J;  1WRJ A;  2MG4 A;  4PHD A;  5L1L A;  1SKW A;  4KLH A;  3BG5 A;  1I3A A;  4HQE A;  5FP0 A;  1P2F A;  2WA0 A;  4DQ2 A;  2IRF G;  2NVQ J;  3WG9 A;  4A3G J;  3IHQ B;  3TOB A;  3QU2 A;  4NLG A;  4M9X A;  5KTQ A;  3ZQH A;  2EFP A;  4NQW B;  5DLG A;  3HOX J;  4OCZ A;  1XCV A;  5KG5 A;  2COM A;  3JPP A;  4MFF A;  1X3U A;  3P9C A;  4L5J A;  1FMV A;  2LY1 A;  3GF2 A;  3N4M B;  1PYV A;  2LF7 A;  5JUM A;  4DFP A;  2OQG A;  3OYL A;  1J2X A;  1N62 A;  1ZQF A;  2ZXH A;  3HBL A;  3WU2 U;  3FYH A;  5B3S H;  5KG7 A;  1WH5 A;  4BH9 A;  5M5W J;  2NO4 A;  1POG A;  8ICH A;  3W6J B;  3WE2 A;  4F3Q A;  1ZQH A;  3ZQG A;  2RKH A;  5IIO A;  3SV3 A;  1CI4 A;  3S3M A;  3Q8Q B;  4DL4 A;  1VQP I;  4A3D J;  2ZJP F;  1OCZ H;  4OJ5 A;  1ZQJ A;  4ZDP A;  4GGG A;  1E3O C;  1WZ2 A;  2ZTD A;  4JX5 A;  4OD0 A;  3BZ6 A;  4XLP F;  2GOX B;  1ON2 A;  1DGS A;  3KHG A;  3RPU A;  3RB0 A;  3R61 A;  4GLX A;  1NKE A;  1J09 A;  5TIS U;  3HXL A;  1UT8 A;  2KKV A;  3IKV A;  2P6U A;  4L9N A;  1YI2 I;  3K1Z A;  1KYW A;  5J0R A;  2JEJ A;  1EXN A;  4FBT A;  1EA3 A;  2VPL A;  1SAX A;  4PJL A;  3AUO A;  9ICN A;  4NWI A;  3X2Q H;  2KJB A;  2ELH A;  4CXF A;  3WG7 H;  1HOM A;  1PDN C;  2BR0 A;  2W3R A;  2I9G A;  5HNF A;  2CQX A;  1D8B A;  3H8J A;  2JVH A;  2CPR A;  2H5X A;  2WF9 A;  1YW7 A;  4CZZ A;  3ICX A;  4C4T A;  3PW5 A;  1ZQL A;  2DPJ A;  4I28 A;  3PW7 A;  3DQV C;  1O3T A;  4LG3 A;  2V1X A;  4HV5 A;  5HLT A;  3EYI A;  4NC8 A;  2MC3 A;  2AHO B;  4Q43 A;  3GIK A;  4F5O A;  3ZQL A;  1SFK A;  5M3F J;  2FBI A;  1DGR M;  2ZME A;  3BTL A;  1MMS A;  2WAQ C;  3M6Z A;  5F6F A;  1KEJ A;  1B72 B;  1XSX A;  5LBQ A;  2IVM A;  8ICW A;  1OMI A;  2XGX A;  1WFX A;  1OXJ A;  1URJ A;  2LH9 A;  1BPZ A;  1K4T A;  1MNM C;  3ZDC A;  3BOQ A;  3DEE A;  4U0V A;  5KFW A;  4M6W A;  4BDZ A;  2KP6 A;  1HJP A;  1PUF B;  4OWR B;  3GFK B;  2WB1 A;  5L1J A;  2AQ0 A;  2WY8 Q;  5CJ9 A;  5LLQ A;  3HIL A;  4NL9 A;  4ITV A;  2GA1 A;  1S77 D;  5IIL A;  3U9G A;  1YTY A;  3HSE A;  2FE9 A;  3NQO A;  2ZXJ A;  4G6D A;  5KFE A;  2JZY A;  2WF8 A;  2XGP A;  2D1V A;  2ZKZ A;  2ICW G;  4RQ0 A;  1Z3Y A;  3NWS A;  5IT3 A;  1VFC A;  1ETK A;  2QUF A;  2IS2 A;  2LP0 A;  3M6K A;  4KX5 A;  4NM2 A;  2PN6 A;  3KYD B;  2EFO A;  1QQI A;  3TBI A;  4TQS A;  1FTZ A;  4E7L A;  2DU9 A;  2X51 A;  2VXD A;  3SDG A;  3IG8 A;  1ZQI A;  3BJ6 A;  2XB0 X;  1DPU A;  4R64 A;  4DOB A;  3TQN A;  3BS5 A;  3REO A;  1MNE A;  5FD6 A;  1SFO J;  1S0O A;  2BQ3 A;  3PSF A;  2XAQ A;  1KON A;  3K4J A;  2XC7 A;  8ICF A;  3K0L A;  5LHH A;  2F1I A;  2ZJA A;  2YN4 A;  4CCL A;  3FIS A;  2XDV A;  2X85 A;  1V54 H;  4D5F A;  3SD7 A;  2BXZ A;  3E6D A;  4IX7 A;  5KFZ A;  2GLE A;  3JPQ A;  1FFU A;  2XAS A;  2MUT A;  1WJB A;  1B43 A;  1NK9 A;  3O8G A;  2N8G A;  1VQO I;  1XO1 A;  3QZ7 A;  3ML6 A;  1RI7 A;  3EQL F;  2E71 A;  3AG4 H;  5K5R A;  3VYS B;  1MMA A;  5BNG A;  1JUP A;  2DDA A;  3Q9S A;  4XKW A;  1ENH A;  5M5Y J;  4QZ8 A;  1P7J A;  4A69 C;  1Y8Q B;  4A2U A;  1LQ1 A;  2DF4 B;  3KBB A;  1FMW A;  1BM9 A;  1WJA A;  1X19 A;  2GAU A;  3M07 A;  5EOZ A;  3FWE A;  5HDG A;  2E2H J;  4M9G A;  3M8S A;  3ZQF A;  3LSH A;  1W36 D;  4J9N A;  2P5V A;  3E5U A;  3GQC A;  4BKX A;  1ZAR A;  1TNS A;  1WH7 A;  1HKT A;  1J9I A;  5L3G A;  3DTE A;  5CEH A;  4J9M A;  3E3V A;  1T0F A;  2BXY A;  4R8H A;  4KLM A;  3N97 B;  2LHT A;  3V4G A;  4DL7 A;  2HHU A;  2Z1D A;  5K7F A;  4PK4 A;  1PK3 A;  5EE3 A;  4HLX A;  4DLG A;  2UZK A;  1FTT A;  2DFE A;  2BW3 B;  4NXZ A;  2PXI A;  9ICV A;  1UZC A;  4CCK A;  1S7A A;  3KLO A;  1U9N A;  2BQR A;  3C28 A;  2HQR A;  2EK5 A;  2CMP A;  2IXS A;  4QNL A;  2O5R A;  4DOA A;  4EM1 A;  2KZ3 A;  4DQS A;  2Y0S C;  4F7Z A;  1STZ A;  4AU7 A;  2OU2 A;  1PK1 B;  5KVR A;  2ZJ5 A;  1I6H J;  1P4W A;  2DT5 A;  2YTU A;  1BN5 A;  1UG0 A;  3IAS 2;  3I76 A;  2YY6 A;  2ZNZ A;  5CR0 A;  1X42 A;  2K4I A;  1MH4 A;  1W1W E;  4HNV A;  2PFQ A;  4IHV A;  4UNO A;  3PO4 A;  5J8F A;  3V72 A;  5L3F A;  1WQ2 A;  3S6J A;  3MFI A;  3A01 A;  4ED6 A;  4MF2 A;  5LEK A;  4Q8F A;  1VQK I;  8ICE A;  4GIB A;  4AC0 A;  2PEX A;  3K69 A;  2VJJ A;  4FX0 A;  2V1D A;  4XRS G;  3WK4 A;  3KP4 A;  3GTO J;  2BHY A;  3I9V 2;  3KEQ A;  4IPA A;  1TAM A;  4F4W A;  2DK8 A;  3J81 Z;  2R7R A;  1BPY A;  3KCC A;  5KFO A;  5JHU A;  2W04 A;  1P7D A;  3PO3 J;  4DSF A;  4PJ0 U;  4I2C A;  1U9O A;  5AKK A;  2XF5 A;  4LLG F;  1PP8 F;  1F5T A;  1HSJ A;  3JRG A;  5M3M J;  3BQT A;  4P0P A;  1X40 A;  5A0L A;  3GU3 A;  4RZR A;  4XLA A;  3LK9 A;  1P6R A;  2OZU A;  1BR4 A;  4PZJ A;  4UB6 C;  3SJM A;  4RQM A;  4QZA A;  4HX8 A;  5TZV A;  2B7E A;  4RA2 A;  2DYS H;  8ICX A;  4UXN A;  4II2 A;  2NVY J;  4OAY A;  1BL0 A;  3WKA A;  4MEY F;  5D6F A;  1QQ6 A;  1RXV A;  1WUD A;  2L3D A;  2H1K A;  2PQ8 A;  3WHC A;  4S04 A;  4UUS B;  1GVD A;  1Z0X A;  5FFZ A;  3OS2 A;  3BG3 A;  1ODD A;  4NQW A;  3GTL J;  2X0L A;  3GZF A;  4P4M A;  1T2K A;  4MQ9 F;  3MN2 A;  3CDL A;  2LDU A;  1AHD P;  3JR9 A;  4I76 A;  1I6X A;  3EUB 2;  5EZH A;  3FAH A;  7ICE A;  4OU0 A;  5J2D A;  1JIH A;  3BQ2 A;  5B1A H;  7ICH A;  3KX2 A;  2QQB A;  2RDI A;  5JU5 A;  4AUX A;  3KEY A;  7ICP A;  1TQM A;  3N4M A;  1IUF A;  2WV1 A;  3E6B A;  2GM4 A;  2STW A;  4G7O F;  3GBG A;  1R22 A;  1K4S A;  2P81 A;  3D5S C;  4C2T A;  1N78 A;  5J8Y C;  4Y15 A;  2F77 X;  5J1Y A;  1XN7 A;  2YMQ A;  2R7F A;  4HST A;  1MMD A;  2HDD A;  5LGU A;  1N25 A;  2QKQ A;  2GWS A;  3GCM A;  4E4H A;  2EV5 A;  1IRG A;  2BE5 F;  2CFO A;  2HYG D;  3I58 A;  1KN5 A;  1C20 A;  2DT7 B;  3OOP A;  2PFB A;  4N9H A;  2NVU B;  2QA4 I;  3WKC A;  1L3U A;  1CEZ A;  3IM1 A;  4FAS D;  4Y3O A;  1D0X A;  1UHW A;  2ZJQ F;  2E60 A;  2KKO A;  1TT0 A;  2EFN A;  3LMM A;  4P4P A;  4WJ3 B;  2LY9 A;  1IXR C;  1IJW C;  4ECZ A;  4QZG A;  2W7P A;  4C3I J;  2LM4 A;  4HYK A;  2HCF A;  1YE9 A;  1HW2 A;  4B9L A;  4F72 A;  4I2E A;  3KYC B;  3GTP J;  3GX4 X;  3KKA A;  4X5V A;  1ACI A;  9ICB A;  3IP4 B;  4IO9 F;  1ZXI A;  5ALU A;  3SEI A;  5ICF A;  2XKP A;  1IN8 A;  4K2E A;  1RIO H;  4YR0 A;  2VA2 A;  3TAC B;  3IKT A;  4QZ9 A;  3BRO A;  3F8F A;  1QBJ A;  5J0X A;  1JX4 A;  2ZXW H;  2W3S A;  2DA5 A;  1O7L A;  5DLF A;  1ZQT A;  1ARO P;  2P66 A;  3S1N J;  3J7A O;  3ZMS A;  4BXF A;  3ABU A;  1J2M A;  4C4S A;  2X1E A;  4ESB A;  3K9T A;  1B72 A;  2EAM A;  5DM6 F;  4BE0 A;  3HB9 A;  1X2N A;  5KL8 B;  1U45 A;  4EEN A;  2JPB A;  1UAA A;  2VA8 A;  1XPX A;  2MRL A;  2YB1 A;  4QWB A;  3ZD8 A;  1ZQC A;  1PUF A;  4FET A;  4Q45 A;  5EZG A;  4Y2Y A;  4YIF A;  4EGY A;  2IA6 A;  1YQA A;  3TAP A;  3W6K B;  3IRU A;  4DBR A;  2L7K A;  2Y75 A;  2JSP A;  2XRN A;  2JA6 J;  4KN7 A;  5AI8 A;  4O3N A;  1KU7 A;  4IC9 A;  5F9N A;  4I2H A;  1XG1 A;  4CF3 A;  2D5V A;  2MH2 A;  4M3E A;  1ETQ A;  3GIJ A;  1KSP A;  1VTN C;  1U9L A;  3M9A A;  4K4G A;  2NXN B;  3U26 A;  1UFM A;  5ERI A;  4KMO B;  3DKX A;  4KIG A;  1G3T A;  3S1R J;  2H3V A;  2W9A A;  2RDJ A;  4GO1 A;  3FXM A;  4BS9 A;  4YG2 A;  3JRF A;  2XY7 A;  2IGM A;  3VOD A;  4KFC A;  1Z1D A;  1DP7 P;  1OPC A;  3CNH A;  2HTS A;  2IBD A;  3E97 A;  3ERM A;  2D3D A;  2VAN A;  1NG6 A;  2OCE A;  1B8I B;  1TNT A;  2FD5 A;  2XAF A;  4JB3 A;  5H6R A;  5E18 F;  1MJA A;  1FFV A;  5KT6 A;  4A3F J;  8ICY A;  4LJX A;  4TQR A;  4QZE A;  4BHC A;  3ZRG A;  4RGR A;  2HQN A;  3L2C A;  2FBH A;  4M3B A;  2EQR A;  2H6C A;  1VF9 A;  2LY2 A;  3RIR A;  2L0K A;  2RRE A;  1VZ0 A;  3H92 A;  3S32 A;  1NJX A;  4PH5 A;  2A69 F;  3OYI A;  2VPR A;  3PNT A;  4B8X A;  4KA4 A;  3WK7 A;  3D0S A;  3CP8 A;  4B3X A;  1Z91 A;  3SAF A;  1MBK A;  3RJP A;  2KVS A;  5KFJ A;  5AIP A;  1L3V A;  2ZFU A;  4TUQ A;  2F48 A;  5ICC A;  2QB1 A;  3N7S C;  3RH5 A;  4IOA F;  3WKB A;  4QWC A;  2JSC A;  3N97 A;  2ACJ A;  4MEX A;  2ISP A;  3HM5 A;  4MHV A;  1G59 A;  3GV5 B;  1V9P A;  3L5K A;  4Y2X A;  3G6V A;  2Y0M A;  3OYG A;  2LM1 A;  4I0A A;  2BW3 A;  2BY2 A;  1LEB A;  4RDU A;  3LFK A;  2LYH A;  4DLE A;  3F5E A;  2KIF A;  5FGM A;  4Y52 J;  5JLX A;  2R4G A;  3SYZ A;  3ZQI A;  4RB0 A;  5DCM B;  2K4P A;  2LD5 A;  2V4J C;  4JMU A;  4EBC A;  3F2C A;  4ZYH A;  2EZK A;  4ELV A;  2K60 A;  3MR5 A;  4U0Y A;  2E1M C;  1TLH B;  5KG1 A;  4O3R A;  2OHF A;  4U6P A;  8ICO A;  1A6I A;  2OJE D;  4AP9 A;  4RQ5 A;  2EB7 A;  4A5M A;  1O57 A;  3M8E A;  4LB5 A;  4PGY A;  2EPF A;  1K6Y A;  2DA4 A;  3JCU C;  2LKS A;  1GUU A;  4PGG A;  5LRR A;  4CZC A;  3TAD C;  3UMG A;  2UXX A;  5KFA A;  4F4Y A;  1R49 A;  4ZDL A;  3AM9 A;  4OAZ A;  3K75 D;  4KT5 C;  2JEI A;  2A1J B;  1BOB A;  1WCL A;  5D46 A;  4EEF G;  4HNT A;  1JAL A;  2LPE A;  4ZOH C;  1K79 A;  1C7Y A;  1FX7 A;  2JT1 A;  2V9P A;  2FQ4 A;  3DLL F;  5EF6 A;  4J01 A;  4DWI A;  3DKY A;  3AKZ A;  2L9N A;  1L7N A;  3PVX A;  5J0O A;  5AKL A;  1S8N A;  8ICZ A;  3FZV A;  1W7P B;  1R5G A;  3H4D A;  5AKX A;  4TUP A;  2DK5 A;  3D1N I;  2V9V A;  1YIO A;  1YOV B;  4UQG A;  1MIJ A;  3KOO A;  1JXE A;  2F3N A;  2PBI A;  4PL2 A;  3FM3 A;  2AQF A;  3M1Y A;  2MD5 A;  4A3L J;  3H9G A;  1SVL A;  3DTI A;  3K4C A;  2DMU A;  5DUK A;  3MGI A;  2Z2S B;  5AKI A;  2D45 A;  9ICI A;  2E5N A;  1TFR A;  4YMO A;  1ZLJ A;  4XON A;  1RZT A;  2XPW A;  3IAM 2;  3OYE A;  3QRF F;  4UUS A;  4D1Q A;  2PFO A;  3B02 A;  5ICE A;  2JMG A;  5KFG A;  4M6X A;  1MN8 A;  2X9D A;  2MH9 A;  3KHH A;  2KIM A;  1FYL A;  1JT0 A;  2HZT A;  4C2M J;  1ZRF A;  3J7A Y;  2QKM B;  3RZO J;  2VKQ A;  4S0H B;  4UAU A;  4MLO A;  4M9H A;  3OOU A;  3ZDA A;  2W11 A;  1U49 A;  2R7X A;  5J2K A;  1BI3 A;  1B4F A;  1RES A;  5HHI A;  3H0M B;  1KYZ A;  1RRJ A;  2XGD A;  5J6X A;  2B0C A;  4UB2 A;  5KG2 A;  3RJE A;  5EYR A;  4PFO A;  2L7F P;  2ZFW A;  2YX8 A;  3I28 A;  1OYI A;  5KFF A;  1WI3 A;  1Z21 A;  1RQN A;  2KE7 A;  4Q8E A;  2CO5 A;  3R4K A;  1I1S A;  9ICP A;  9ICX A;  2AXT C;  1XNS A;  1YS6 A;  1BW5 A;  5K4L A;  3CMM A;  3AMZ A;  4DSJ A;  4DZJ A;  4EYI B;  5DD4 A;  5JVT A;  5DB8 A;  7ICO A;  4ELT A;  2EAO A;  1LFB A;  4CA0 A;  3RB3 A;  2HOT A;  3P5J A;  1RET A;  2M8G X;  2P8T A;  2FSW A;  2BVL A;  2JN6 A;  5KFM A;  9ICR A;  4LK1 F;  1BA5 A;  3NWT A;  1LKY B;  2PG4 A;  5KL1 B;  2R7S A;  4DQQ A;  4JP0 A;  1IN7 A;  2E2J J;  3AN1 A;  2K4E A;  5AI4 A;  1H38 A;  4EZ9 A;  1V85 A;  3QU7 A;  3I55 I;  4BAY A;  3TO9 A;  4YFK A;  2K3P A;  4M9Z A;  4PJM A;  4FFD A;  3FIW A;  3L9F A;  1ETV A;  3FDY A;  4F3O A;  5HOO A;  5FLX Z;  4DS4 A;  2OA4 A;  2KIC A;  4OIQ F;  4M04 A;  4QZC A;  5DGB A;  3HKZ A;  2BCQ A;  3L2R A;  4I2B A;  3V7K A;  1RR8 C;  4BJ5 C;  3SEN A;  5F0C A;  2NAZ A;  4M74 A;  4UVA A;  1F4K A;  2H27 A;  4NC7 A;  4IL6 U;  4RQ3 A;  2ESE A;  2IJL A;  5KFD A;  5HLI A;  4DL3 A;  2KP7 A;  1R4N B;  2O6K A;  2JGA A;  1XMK A;  3A0H C;  2HPI A;  5K7Z A;  5ALS A;  3VSL A;  2WAQ A;  2R93 J;  4XN3 A;  3PUB A;  4HSR A;  4KLF A;  2XID A;  1MMN A;  1V5F A;  2QQ9 A;  5HNH A;  4N0B A;  3FXJ A;  4I0B A;  4P9U A;  1VND A;  1NHA A;  2VJI A;  4MQV A;  2K27 A;  5ALV A;  1ZQD A;  2DDB A;  1Z00 B;  4C9Y A;  2WF7 A;  3FXL A;  2QLT A;  2VKD A;  5AM4 A;  3KP7 A;  1I1G A;  5KNI A;  1S9F A;  1MQ2 A;  1JI8 A;  4O5E A;  2KRH A;  1KDH A;  2KIQ A;  4KT6 A;  2L9V A;  4ED1 A;  4B47 A;  3AEV A;  1U0J A;  3GO5 A;  2KJ9 A;  1Y0U A;  5C4X J;  2LYB A;  4LLL A;  5CVR A;  3JRI A;  4AD9 A;  4CCH A;  4E7H A;  1S3J A;  1VQ9 I;  5ALJ A;  5FLV A;  4IJA A;  2KLO A;  2E8M A;  1PVE A;  1U6G A;  2O8X A;  1R6R A;  1B8I A;  4AWX B;  4EJT A;  2HHW A;  2HS5 A;  2K8B B;  2AXT U;  2QQ8 A;  4ENJ A;  2ZG6 A;  1QPM A;  1XSV A;  8ICU A;  2EBI A;  4Z6Y A;  2KZV A;  4JV0 A;  5DB9 A;  4I02 A;  4A3B J;  3RAX A;  1WG8 A;  2Y9Y A;  3DU5 A;  3FXR A;  1E2X A;  5DD8 A;  1BOA A;  1DK2 A;  3QP5 A;  4XBF A;  2EV0 A;  2FXA A;  1PVR A;  2XCP A;  4I2A A;  3AG2 H;  4XRM A;  1A36 A;  4FX4 A;  5HNK A;  5DTD A;  3OS0 A;  2AJQ A;  3EPZ A;  1S8O A;  3LWM A;  8ICK A;  4XUS A;  1IG7 A;  1HDP A;  2PMZ N;  2R7O A;  3G71 I;  2NRT A;  4BXU A;  1BI0 A;  2DFL A;  1XX5 A;  2A3S A;  2Q2E B;  1Y1V J;  2JQ7 A;  2M9N A;  1JTX A;  1OCP A;  2VC1 A;  3S3N A;  4GYG A;  4IVN A;  3U21 A;  4QWQ A;  4L5I A;  1VQ8 I;  1H8A C;  3CC7 I;  1HUO A;  1OLT A;  2EQY A;  4HX4 A;  2ADU A;  3PL8 A;  4KN4 X;  2WBM A;  5ILS A;  1N60 A;  4KIC A;  2C2E A;  1ZJN A;  2CUZ A;  2X6X A;  4FT8 A;  1ZD2 P;  2KOB A;  2Q0Z X;  3E0F A;  4BBS J;  1DDN A;  5F3X B;  3TFR A;  1X6J A;  2VXZ A;  3DP7 A;  1ETY A;  5J2H A;  2LRD A;  5DCM A;  1NJY A;  3TOA A;  1ZQX A;  2DTR A;  2M7A A;  4EJV A;  4J9P A;  2HHX A;  1XO0 A;  2EZL A;  3BQZ A;  3A0H U;  4ZYD A;  1VJ5 A;  5KFT A;  1BGX T;  5DCF A;  2LFB A;  4Q5S F;  3AG1 H;  1Z1B A;  1WI9 A;  4D5C A;  2QCO A;  1Z7L A;  3V6K A;  2X48 A;  5AON A;  5AIQ A;  4C3H J;  3F9K A;  3DV9 A;  3SV4 A;  3JPS A;  2Y0S A;  1WJC A;  2E1M B;  4FE4 A;  3DPL C;  2WWY A;  1RG6 A;  5KT5 A;  3G6X A;  2FNA A;  3BWG A;  3DU6 A;  5J1U A;  2ME6 A;  4KLI A;  1XGS A;  2F4O B;  4LLN A;  1J0R A;  1R23 A;  3T5X A;  3OS1 A;  4ENM A;  2JVG A;  1XSD A;  2A1J A;  5J2C A;  2GIZ A;  3C18 A;  4ESF A;  5B5E C;  4FO6 A;  3SAH A;  3I64 A;  1Q8K A;  1S76 D;  3PO5 A;  1ZKG A;  2V6E A;  4KLU A;  3CCU I;  5G5G A;  3TFS A;  2ELK A;  3ISB A;  1XGM A;  2VAS A;  2Q0O A;  2IGK A;  3I59 B;  4BL0 B;  2F1H A;  2H8R A;  4M9N A;  3KP2 A;  1NI3 A;  2QZ8 A;  1W7P A;  2WHE A;  4OJO A;  2E19 A;  4AYB F;  4FIS A;  2HVQ A;  4Y4R A;  2LMR A;  5AK3 A;  4R8U B;  4DF8 A;  2A68 F;  2ZIW B;  4B9U A;  3BG6 A;  4HF0 A;  2E1N A;  3NAU A;  4RGU A;  3IRR A;  2I1Q A;  3CRX A;  2E8N A;  3TL4 X;  4A3I J;  4M6V A;  2FJ6 A;  3ZQC A;  3HX0 A;  4UUT A;  5KFB A;  2VQC A;  2DN0 A;  3WU2 C;  2AQ4 A;  4NLK A;  8ICI A;  4ON0 A;  4P2H A;  4C0Z A;  1AA7 A;  4PHA A;  2CFX A;  5J0S A;  1SD4 A;  4Y33 A;  1KQQ A;  2H6B A;  4XM3 A;  2OBP A;  1VQ5 I;  3FMQ A;  1USS A;  2KKP A;  4Y2P A;  3TAQ A;  4HRI A;  2W54 A;  2ZUB A;  4RU9 A;  3MAB A;  1NJZ A;  3JRA A;  2CUJ A;  4M71 A;  1C0W A;  2DA3 A;  4XKC A;  1BJA A;  3FKI J;  4ETS A;  2XAG A;  2KMU A;  3MFH A;  2E5Z A;  1MJ9 A;  4MIM A;  3NRW A;  4YP3 A;  3BY6 A;  4QW9 A;  4DYC A;  5TIS C;  4EQQ A;  4F5N A;  5G5H A;  2OXO A;  5C4J J;  3BR0 A;  1T8I A;  4EEK A;  2DXI A;  1Z4N A;  4A5N A;  2ZBK A;  3OMY A;  8ICS A;  2ISY A;  1Z3X A;  3BCB A;  3ZMV A;  3BC8 A;  4NC6 A;  1ZQZ A;  2DL0 A;  5ALO A;  4UB1 A;  2FML A;  2MA3 A;  3P9I A;  3GFL A;  4I09 A;  1PP7 U;  3OV8 A;  5J8Y A;  2NS0 A;  3WTV C;  4RM2 A;  3BTC A;  4BQQ A;  2EIN H;  1U47 A;  2P0W A;  1TC3 C;  2CXY A;  4NLC A;  5AKJ A;  3CP2 A;  1MD0 A;  3ZXS A;  1AKH B;  2ZJ2 A;  3CUQ C;  3KZZ A;  5B66 C;  5KFH A;  4IR1 A;  1RPW A;  4YXM A;  4KN4 A;  1K1Q A;  5HS9 A;  4Y13 A;  4P0P B;  3UM9 A;  1NK0 A;  3K70 D;  2F5V A;  3EDP A;  4HAM A;  4U88 A;  1JHH A;  3M9O B;  1Y56 A;  3ASN H;  1LKY A;  1AOY A;  5F64 A;  3H0L B;  2B9S A;  5JR3 A;  2KRF A;  3HEF A;  2PKE A;  1B6A A;  1Q1V A;  5E79 C;  5J40 A;  4B4C A;  5F1R A;  5FLX K;  4KLD A;  5B5E U;  2LSO A;  2EFQ A;  4NY8 A;  3S2H J;  3Q5F A;  5KG6 A;  1HUZ A;  2V6C A;  3OYH A;  4UAT A;  3HHH A;  4RT2 A;  1NK7 A;  3G1O A;  1K78 B;  4UAW A;  1U8B A;  1F36 A;  2FMY A;  2QYO A;  1JGS A;  3RSN A;  4IRH A;  4BJQ A;  5GTH U;  3JAM K;  3RJF A;  1IV6 A;  2FA5 A;  4DOC A;  1YLF A;  2CQQ A;  1CGP A;  3MGH A;  2Z16 A;  4RB2 C;  5L1M A;  7ICL A;  1X3W B;  1UMQ A;  3HOW J;  1D9F A;  4B48 A;  4IHT A;  2OC6 A;  4RAF A;  2OQR A;  3MCZ A;  5H6Q A;  4A12 A;  4EJW A;  1O08 A;  4IRK A;  3HGG A;  2O03 A;  1FWZ A;  2BOL A;  2BGW A;  1Y8R B;  2HYJ A;  1Z00 A;  1LDK B;  1LB2 B;  5AKY A;  1VLB A;  4C8M A;  1BI1 A;  1S29 A;  3RTR A;  5F27 A;  3W2V A;  4PJN A;  1E3H A;  1ZGW A;  1FNN A;  4QIW N;  2PJP A;  2NYV A;  4J03 A;  4BWM A;  1OYY A;  2VON A;  1VQ6 I;  3FDS A;  1SKS A;  2HTJ A;  1SZH A;  2ALZ A;  3VYR B;  4AIK A;  4O5V A;  3ONN A;  1COK A;  1IUY A;  1B0X A;  4YFN F;  1T94 A;  4C7Y A;  1RYU A;  3HZJ A;  2V9K A;  4P5O A;  3IH4 A;  2C2D A;  2V1U A;  9ICE A;  5J8C A;  3ORY A;  2XUB A;  4Q47 A;  3FBN B;  4Q44 A;  5DDG A;  4OMY A;  2W03 A;  2F2A B;  1Q3U A;  2ZNY A;  3LSI A;  3RBD A;  7ICG A;  4F5Q A;  3S2D J;  2L5Y A;  1J59 A;  4BQA A;  1V3F A;  5FRO A;  3RKX A;  5B66 U;  2K40 A;  3SEQ A;  4KIT B;  3C7J A;  5FO5 A;  3D5L A;  2NNY A;  4ZDO A;  3UR3 C;  3QQA A;  4QPQ A;  3WGG A;  4E7S A;  4CF5 A;  1LPQ A;  3L2V A;  2JPC A;  1WYG A;  4PHP A;  3Q8K A;  1NK4 A;  3OL3 A;  2IAI A;  1FIP A;  4C30 A;  1O3R A;  1D8L A;  4ENK A;  4AYB N;  2OCC H;  4RPY A;  2HQ5 A;  2O6G E;  4RQ7 A;  1L7O A;  4FZN A;  3GLL A;  1XSN A;  5EGO B;  2F4M B;  2XF7 A;  4ACO A;  2VJ4 A;  1OYW A;  4KNY A;  1GVJ A;  3PST A;  1XU4 A;  5E79 U;  3MZY A;  1MH3 A;  4LG0 B;  2Q2E A;  5D8L B;  2JA8 J;  3RPU D;  3H8S A;  3GWZ A;  3CDI A;  1FPQ A;  2XB5 A;  3JRB A;  2R0Q C;  9ICK A;  5AKZ A;  5HR7 A;  1QSS A;  2DMT A;  4G12 A;  1NKC A;  2LF8 A;  2A1A A;  1LKX A;  2EA4 A;  2V26 A;  3FK7 A;  4G7H F;  2CV2 A;  2HOS A;  2G09 A;  4C80 A;  2KMD A;  3BQ7 A;  5ALT A;  2AGQ A;  1WJF A;  1A6S A;  3BDD A;  3FXK A;  3M7G A;  3N7R C;  5ALW A;  4BDP A;  1IXS B;  1N75 A;  3UQ2 A;  3OYN A;  5JVG F;  4KLO A;  2K3F A;  1ZRE A;  2R8J A;  3KLN A;  2DI3 A;  1X4O A;  2L2O A;  3FHZ A;  4KIB A;  3SQI A;  4PJ0 C;  8ICP A;  4O3P A;  3T8T A;  1V4R A;  2WTE A;  1BNP A;  1MGT A;  5FLM J;  5CVV A;  1V38 A;  3M1E A;  2G06 A;  4CH7 A;  2VE8 A;  1UA0 A;  4M47 A;  2UXN A;  2KFN A;  3Q8P B;  3K4L A;  1JN3 A;  3SXY A;  4NLZ A;  4LIV A;  3RH4 A;  1L8L A;  1KKX A;  3E5X A;  4UHT A;  4PUS A;  2ISZ A;  2GXG A;  4A8E A;  3M9N B;  4WWC A;  1GT0 C;  3S2W A;  2HKX A;  2KK0 A;  3FXQ A;  1TQP A;  1OW5 A;  3QE9 Y;  2XRO A;  2FRH A;  3HHG A;  1T38 A;  3TAD A;  4IHW A;  2XSD C;  2VUM J;  4XRS A;  4KLG A;  3I59 A;  5EG0 B;  3DPU A;  3IH3 A;  1FYM A;  2WB1 F;  3HUG B;  5IY5 H;  1K7A A;  3LST A;  2ISO A;  3RJH A;  2XAJ A;  4R8U A;  4G7Z F;  2AS5 F;  1KZH A;  2BPC A;  9ICT A;  2W24 A;  1TW2 A;  3V7C A;  2RQ5 A;  2ZIW A;  4F91 B;  1FY7 A;  3K2A A;  5ILV A;  1T33 A;  4C2U A;  1QA6 A;  2R7W A;  2YQE A;  1LVA A;  3V7L A;  1XSP A;  4YXJ A;  1TK0 A;  4CNQ A;  3DKW A;  1OCR H;  4M3D A;  5J3L A;  1JKO C;  3MAJ A;  5GPA A;  1M6Y A;  4F71 A;  3BCA A;  1B4A A;  4QZD A;  1ZQE A;  3MKY B;  3C2L A;  4EYH B;  5D6E A;  3A03 A;  3UQ0 A;  4AYB C;  3NAR A;  5KAF U;  3S93 A;  1O03 A;  1OCC H;  1SFE A;  1Z05 A;  2H8W A;  5FKM A;  1JMS A;  4NJ8 A;  3RI4 A;  3HTS B;  2M5W A;  4LJZ F;  5ALX A;  4MF8 A;  2L4A A;  1CF7 B;  3LSG A;  3RDI A;  3HOV J;  4BWJ A;  2IA2 A;  5FKK A;  4AIJ A;  5J0Q A;  4MHG A;  3TDU C;  7ICT A;  4DCC A;  3GXO A;  4ZYG A;  2JHD A;  4N9I A;  9ICL A;  2A6T A;  5DQG A;  1IG6 A;  1GHC A;  1GLN A;  1N5W A;  2NRW A;  1WSU A;  4CCJ A;  2EV6 A;  1ZR2 A;  4OIN F;  4E7Z A;  4ECY A;  4QZH A;  2K4J A;  4BQO A;  2ECC A;  1VQ7 I;  3G1L A;  3KYL A;  1ZD3 A;  2HMX A;  3FKJ A;  4Y2J A;  3QUC A;  3GII A;  3BR6 A;  3ABK H;  4B9T A;  3GIM A;  2KN7 A;  2O0Y A;  3QYB A;  4MEY A;  4HBL A;  4CO8 A;  2BPF A;  1IW7 F;  1TQI A;  2IW5 A;  3QU6 A;  1Z1V A;  5FKN A;  1YRN A;  3F22 A;  3UKG A;  5K5Q A;  1AKH A;  2HNH A;  1G4D A;  3BJY A;  4D9J A;  1YW9 A;  4KN7 X;  1QGP A;  5FKL A;  4PGX A;  2DKZ A;  3JPT A;  4RGX A;  3F2B A;  2KDZ A;  2J6S A;  2JH1 A;  1YJW I;  3OJU A;  1DUX C;  5DDY A;  2GOL A;  5HLG A;  2H3Q A;  1Q46 A;  4BY7 J;  1F44 A;  2JA7 J;  3OIP A;  2M30 A;  2NV3 A;  5GAE J;  5J2B A;  2EAP A;  2PI4 A;  1D9D A;  3V42 A;  1ZEL A;  4V19 K;  1BJZ A;  1R00 A;  4QWD A;  2P7V B;  4IQJ A;  5E3L A;  1SVM A;  4EBE A;  3HSF A;  2IA0 A;  3P9K A;  4QLC U;  1L3L A;  1K78 A;  2CW7 A;  3BS7 A;  5D5X B;  1JE8 A;  5J0T A;  3PY8 A;  1EKE A;  2WC2 A;  4JX4 A;  7ICN A;  1TT5 B;  2DW4 A;  2Y9U A;  5ALL A;  5JRT A;  2ATL A;  5EDN A;  2BYV E;  3ZMD A;  3QYF A;  1VQL I;  2Y1I A;  2K02 A;  4XK4 A;  2Q8K A;  1S72 I;  1L7P A;  2A19 A;  1W5C C;  4O5C A;  1QVT A;  3SQN A;  4NLN A;  1TBX A;  4P0Q B;  5KG3 A;  2HEO A;  1RM6 C;  5EWF A;  5TJJ A;  1J5Y A;  2DCE A;  2LKY A;  5AIB A;  3QPT A;  1R1T A;  3KP3 A;  3KE2 A;  4DOZ A;  5LHI A;  3LAP A;  1WGX A;  2OPT A;  2WAD A;  4HEA 2;  4OMZ A;  1MSF C;  1SB3 C;  3VC8 A;  3HC7 A;  5DDM A;  1FZP B;  4ECV A;  4LVS A;  2CW8 A;  2Q1Z B;  3ECO A;  1N2X A;  1ZET A;  1B9M A;  1LB2 A;  1FLI A;  3FMS A;  3K1N A;  5ILU A;  1MZB A;  3M4O J;  4F4K A;  5IPA A;  2W55 A;  2P6R A;  8ICN A;  3RJG A;  1ZLK A;  3ABL H;  1UT5 A;  2A3V A;  3CCJ I;  2K85 A;  4YMN A;  1HW1 A;  1QZE A;  4LOC A;  2IOF K;  4B6J A;  1TE2 A;  1RXW A;  3EYY A;  3CLQ A;  3G4S I;  2B0L A;  3PIP F;  4GFB A;  1IV8 A;  2R7Q A;  2HHQ A;  2MBF A;  1FOX A;  3F5A A;  1BR1 A;  2DFF A;  4BHB A;  5LGN A;  1Q1H A;  3WTY C;  2LK2 A;  2ZIU B;  3H5N A;  4NNJ A;  1KQ8 A;  5E17 F;  4DF4 A;  2M0C A;  4QPO A;  3JPR A;  2E34 A;  3T5J A;  3EWA A;  4B3A A;  3K4M A;  3Q8S B;  4UBB A;  2DKX A;  2JZB B;  3PFY A;  5KT4 A;  5K5O A;  2NS7 A;  1TWH J;  2WV0 A;  1QQ7 A;  1T08 B;  3I53 A;  3LSP A;  4KIF A;  1XTA A;  3HOT A;  9ANT A;  1B22 A;  1KGS A;  1Y0N A;  1UCV A;  4PL1 A;  2WB1 N;  4ASN A;  4ED2 A;  3C3W A;  1ZD4 A;  2EZY A;  1N77 A;  3HOU J;  3GDX A;  1ZQB A;  2JUG A;  1Z9C A;  3MZH A;  4PGQ A;  1FOY A;  3H5R A;  4LK0 F;  4ZH4 F;  3RKW A;  1TAU A;  1B1B A;  2DA7 A;  2KJC A;  2LKP A;  3VPR A;  3MWM A;  3WE3 A;  5EGO A;  4A3C J;  4XLH A;  3V8J A;  4O3M A;  1FSH A;  3HRU A;  2IGO A;  2Q4T A;  3KZI U;  4J9O A;  4LG0 A;  4TUS A;  3T5K A;  5TRD A;  2MLG A;  2L02 A;  2EZZ A;  1ZQK A;  2RGV A;  3VSK A;  3HGY A;  3U2R A;  3ALR A;  1KU2 A;  3KHL A;  6PAX A;  2M1B A;  3S17 J;  3QU4 A;  2QSG X;  4MGR A;  3LVV A;  4B9V A;  2UWM A;  2KG5 A;  2Y69 H;  2OTJ I;  3CCM I;  4WCG A;  3BQ1 A;  2I10 A;  2BBY A;  5ALN A;  2KIU A;  1KTQ A;  5AK5 A;  4EBD A;  3CCY A;  1JUD A;  1REP C;  3GVA A;  2CQK A;  5FRN A;  4Y2T A;  2RQQ A;  1H0M A;  4NDL A;  5KFQ A;  2BZF A;  2RVC A;  2KJ8 A;  2RNG A;  4I7H A;  3E6C C;  3VWB A;  4I01 A;  2BDP A;  3A1Y A;  4DSI A;  3IV5 A;  1EH6 A;  2VQL A;  4IQ4 A;  2EIL H;  2L4M A;  3LA7 A;  5AKH A;  1R71 A;  2ZC2 A;  3GUD A;  2WFA A;  3JRC A;  1A04 A;  2W48 A;  3LSR A;  1K83 J;  4H0E A;  3OYB A;  4QZI A;  4HX7 A;  2YPR A;  4V2F A;  3N28 A;  2R7V A;  3R0J A;  4EV0 A;  4KLQ A;  4ECX A;  4WXH A;  2MGQ A;  5AI5 A;  1N48 A;  1Z77 A;  3V7J A;  1JJ6 C;  4G9Y A;  2PI5 A;  1X1C A;  1T95 A;  1XGO A;  2ESH A;  4EAT A;  4KLS A;  3V6J A;  5F1J A;  3IRQ A;  3D2Q A;  1WHU A;  2EDU A;  4CUG A;  4DJA A;  2CYY A;  2E35 A;  5KAI U;  1TVA A;  1D8K A;  2CU7 A;  3VOE A;  1ZG5 A;  5EG0 A;  5JFR A;  2PI0 A;  1NK5 A;  3HOY J;  3HUG A;  1N63 A;  1HW5 A;  8ICL A;  5IIJ A;  2K4B A;  4NLB A;  3GTQ J;  2WF5 A;  3O6B B;  3TW6 A;  2K9M A;  1MW7 A;  4AVZ A;  4BBR J;  4CIC A;  5FB2 A;  1PUE E;  4KLJ A;  3KTQ A;  2ODG A;  3MKL A;  4N4O B;  2QEX I;  3NVW A;  3RCO A;  1RKT A;  1X58 A;  4X0G A;  5D49 A;  3L09 A;  4MO7 A;  3BJO A;  1ZOL A;  4A0Z A;  4JOM A;  4YEL A;  4YD2 A;  5CVJ A;  4RQ4 A;  3H40 A;  4O9M A;  2QB0 B;  2HW3 A;  7ICM A;  4DFD A;  3M9M B;  1YIJ I;  4PZN A;  2HOQ A;  3E0J B;  2VBX A;  4XOT A;  2WB1 C;  5KFN A;  3PX0 A;  2KSO B;  1L6N A;  3ETR A;  4GDF A;  1F0M A;  2HDC A;  3SZP A;  3F72 A; 
#chains in the Genus database with same CATH homology
 1FMV A;  2K8B B;  4GFJ A;  2LY1 A;  1PYV A;  2ZG6 A;  3OYK A;  3D2S A;  2I8D A;  2KZV A;  3SAG A;  3OYL A;  3EUH C;  3DU5 A;  5CQE A;  3QOD A;  3VDX A;  2ZXH A;  3AQE A;  1V5E A;  5TGT A;  4IKF A;  2W7O A;  4F3Q A;  2LYC A;  2XF6 A;  4ZJZ A;  5T14 A;  3OS0 A;  3EPZ A;  3S3M A;  2DGZ A;  2R7O A;  2HOF A;  4OJ5 A;  2Q2E B;  3K70 C;  4ZDP A;  3FHN A;  3S3N A;  1Q3V A;  3U21 A;  1QHG A;  2GOX B;  4F55 A;  1OLT A;  2FUG 2;  2G0A A;  3LSM A;  3PL8 A;  4IZZ A;  2WBM A;  1J09 A;  4FZL A;  3HXL A;  2KKV A;  3K1Z A;  2CUZ A;  2X6X A;  3MKW B;  2KOB A;  3E0F A;  3EUK L;  1EA3 A;  2LBF B;  2VPL A;  3PSP A;  2VXZ A;  3DPT A;  4PJL A;  2PMZ F;  2LRD A;  1PJR A;  4NWI A;  2M7A A;  4N4N B;  1D8B A;  5HNF A;  4BX9 C;  2JVH A;  2CPR A;  1XO0 A;  4RLQ A;  3ICX A;  2LBO A;  3DQV C;  2D6F C;  4LG3 A;  5HLT A;  1MA7 A;  4NC8 A;  1Z1B A;  2G5I B;  2DT6 A;  2MYS A;  1SFK A;  3M6Z A;  2WAQ C;  1DGR M;  1Z7L A;  2G08 A;  4CDG A;  3H35 A;  3A2K A;  5CKT A;  2ZXI A;  3F9K A;  2XVT A;  2W1O A;  1WJC A;  2E1M B;  2Y0S A;  3DPL C;  1GO3 F;  2HOI A;  1URJ A;  1WFX A;  2F8L A;  2LH9 A;  1Y6I A;  3DU6 A;  4H4K C;  5KNL A;  3DEE A;  5FRM A;  4LIU A;  3OS1 A;  3AQF A;  2JVG A;  4BDZ A;  2KP6 A;  4OWR B;  2VQG A;  4PJJ A;  2WB1 A;  3SAH A;  2WY8 Q;  4P0Q A;  4J00 A;  2V6E A;  2IGN A;  4ITV A;  2K4H A;  2VAS A;  3LFU A;  2IGK A;  4JQF A;  4BL0 B;  1MND A;  1WJD A;  4OJO A;  2MC4 A;  4AYB F;  4Y4R A;  2HVQ A;  2XI9 A;  1Z3Y A;  3NWS A;  3M6K A;  2HDW A;  2IS2 A;  1Z19 A;  2M4G A;  2ZIW B;  4KX5 A;  3BG6 A;  3SEZ A;  2KRC A;  3D2N A;  2IS1 A;  4OO1 J;  3CRX A;  3TBI A;  2XAU A;  4PSX A;  3K6G A;  3AFH A;  3TL4 X;  3ZQQ A;  2KIW A;  4E7L A;  2LG4 A;  2X51 A;  2VXD A;  2VQC A;  3IG8 A;  4XR6 A;  3CZ6 A;  3EUA A;  4FE3 A;  3H0R B;  1MNE A;  2CV1 A;  2F4I A;  5LFA A;  3PSF A;  3K4J A;  1KON A;  1AA7 A;  2XC7 A;  1ERD A;  4CCO A;  4Y33 A;  2KD1 A;  4C0Z A;  2L9S A;  4XOR A;  4CCL A;  4XM3 A;  3IG5 A;  3ZGK A;  2KKP A;  5CRX A;  2XDV A;  2M3A A;  2X85 A;  4HRI A;  1A0P A;  2H3I A;  2ZIU A;  4IX7 A;  2CUJ A;  1WJB A;  3OYD A;  4XKC A;  4RLF A;  2F6C A;  2VIX A;  2KMU A;  2E5Z A;  2M0M A;  3RQ4 A;  3N7P D;  3VYS B;  1MMA A;  3NRW A;  4XKW A;  3HPH A;  3H0D A;  2OXO A;  2DF4 B;  1FMW A;  1WJA A;  3FBI B;  1X19 A;  4U87 A;  2DXI A;  3OMY A;  3LSH A;  1Z3X A;  3BCB A;  1W36 D;  3BC8 A;  4XLF A;  1UEL B;  3DTE A;  5KHD A;  3L2U A;  4RM2 A;  2LHT A;  4BQQ A;  1UPH A;  2Z1D A;  2P0W A;  3ONQ A;  4BEH B;  4NLC A;  4PK4 A;  2DJI A;  3CP2 A;  2CV0 A;  2OH2 A;  3ZXS A;  3M7D A;  2BW3 B;  2ZIX B;  4CCK A;  3SMV A;  4P0P B;  3C28 A;  3K70 D;  2F5V A;  2X1D A;  3S8P A;  2CMP A;  2IXS A;  2HZD A;  1Y56 A;  5CPR B;  4QNL A;  5C0Y A;  2O5R A;  2HPM A;  3H0L B;  4CGZ A;  4XLE A;  3IN5 A;  2Y0S C;  2W4S A;  4BUG A;  3W2A A;  1IRX A;  1HA8 A;  4AU7 A;  3K10 A;  1UG0 A;  3IAS 2;  3OYH A;  4OJL A;  2WAF A;  2K4I A;  3T79 A;  2IS4 A;  2GH1 A;  3BG7 A;  1YX3 A;  2OYY A;  3L2Q A;  3SDB A;  3LVW A;  2AQE A;  3MD2 A;  3C29 A;  3RSN A;  3HKZ F;  4BJQ A;  3OYA A;  2CRX A;  1LFP A;  2VJJ A;  3PZP A;  1MMG A;  4XNF A;  4XLC A;  3MKZ A;  1W36 C;  1WJ5 A;  3I9V 2;  1TAM A;  2Z16 A;  2R7R A;  2KQR A;  2W04 A;  1P7D A;  2MA1 A;  4B48 A;  2OC6 A;  4KJZ A;  2XF5 A;  2PMZ A;  2ZSI B;  3HL2 A;  2ELJ A;  3OIQ A;  2CH0 A;  2BOL A;  3S3O A;  3GU3 A;  5A0L A;  4XLA A;  4P0P A;  1BR4 A;  1LDK B;  4XN0 A;  3W2V A;  3RTR A;  4XKB A;  4PJN A;  4CCN A;  4E7K A;  4II2 A;  3AL0 B;  4BE2 A;  4OAY A;  1SZH A;  4FZM A;  3VYR B;  4CCM A;  3CYM A;  1WUD A;  3ONN A;  4PFP A;  1T94 A;  3OS2 A;  2V9K A;  3SYT A;  4BU2 A;  1D0Z A;  4P5O A;  3GZF A;  3FBN B;  4PSW A;  2W03 A;  1D0Y A;  2F2A B;  1NZB A;  3LSI A;  1Q3U A;  3KX2 A;  4QIW F;  3KEY A;  3UNG C;  1ZQ1 C;  2V7F A;  1ED1 A;  4NUB A;  1V5G A;  3GBG A;  1DQU A;  2W00 A;  3D5S C;  1T0F C;  5FRO A;  2W7N A;  4C2T A;  4HG2 A;  1N78 A;  4YRV A;  3IUO A;  3ZR8 X;  3W2W A;  3OY9 A;  3SEQ A;  4KIT B;  2QKL B;  4ZDO A;  3D5L A;  2F77 X;  4F92 B;  2MAB A;  4QPQ A;  3UR3 C;  4HST A;  4E7S A;  1MMD A;  2KEY A;  2KHM A;  3L2V A;  3DWL E;  3OL3 A;  4E4H A;  4C30 A;  2K8C B;  2BDU A;  2CFO A;  3L2W A;  3OYJ A;  2HBL A;  2HBK A;  1PVR A;  4FZN A;  2DT7 B;  2OM6 A;  2ZIV B;  3DTK A;  2XF7 A;  4ACO A;  3H5A A;  2VJ4 A;  5HVQ C;  2ZSH B;  3PST A;  4KX3 A;  4FAS D;  2XSJ C;  4Y3O A;  1D0X A;  2K9L A;  2E60 A;  2R7T A;  3RPU D;  3LMM A;  1TT0 A;  4WJ3 B;  5HR7 A;  1HEK A;  2KV2 A;  2W7P A;  1PVQ A;  1LKX A;  2CV2 A;  2V26 A;  2DQN B;  3N05 A;  2G09 A;  1YE9 A;  2PJR B;  1WJF A;  1A6S A;  2KL4 A;  2WY7 Q;  3N7R C;  4XQF A;  2LBF A;  1N75 A;  4YEJ A;  3IP4 B;  3PSI A;  3OYN A;  2DOA A;  1DGW Y;  1X4O A;  1E0E A;  2L2O A;  3F2D A;  3SQI A;  2E1E A;  3E1S A;  1IIP A;  3W3C A;  2KDO A;  1SAU A;  4G6T B;  2G06 A;  4BXF A;  2KNJ A;  4CH7 A;  2X1E A;  3K4L A;  3OYC A;  4BE0 A;  3M1C A;  4LIV A;  2PMZ C;  3MGV A;  1D1B A;  5KL8 B;  3PNY A;  4PUS A;  4ZYA A;  1UAA A;  3D5R C;  3OL4 A;  3QYE A;  1YT3 A;  2MRL A;  2YB1 A;  4A8E A;  5JHF A;  4FET A;  2MFZ A;  4RM3 A;  3ZCO A;  2KHV A;  2IS6 A;  3HG9 A;  2HBJ A;  4DBR A;  2L7K A;  2CS3 A;  2JSP A;  3I3L A;  2WB1 F;  3DPU A;  4ICA A;  4IC9 A;  3HUG B;  2H3Z A;  3PJR A;  2ZIW A;  4F91 B;  4QJF B;  1OR7 C;  2VJ5 A;  4C2U A;  2RP5 A;  2M7B A;  4BJT A;  2R7W A;  4KMO B;  3DKX A;  2KPM A;  2H3V A;  4BS9 A;  4LIT A;  3LSK A;  1X1A A;  2IGM A;  2HVR A;  3BCA A;  3MKY B;  2UV1 A;  3C2H A;  4AYB C;  4U7B A;  1NG6 A;  3S93 A;  4ANJ A;  3C2G A;  3LSG A;  2X6Y A;  3ZRG A;  4DGW B;  4DIQ A;  1D1C A;  4U7C A;  3OR1 C;  2LY2 A;  3G2B A;  2RRE A;  2JHD A;  1VZ0 A;  2A6T A;  3S32 A;  1GLN A;  3A4C A;  2BVM A;  4CCJ A;  3OYI A;  3PNT A;  3CES A;  4E7Z A;  4BQO A;  3KYL A;  3CP8 A;  4B3X A;  1ECW A;  3FKJ A;  2HMX A;  3RF9 A;  3SAF A;  2ZFU A;  2UUZ A;  2OUM A;  3N7S C;  3QYB A;  4R79 A;  4ZTF A;  2V1N A;  1BR2 A;  4BEH A;  2VB6 A;  1G59 A;  1G8X A;  4B43 A;  3HPG A;  2HNH A;  3OYG A;  2VQH A;  2BW3 A;  3QOE A;  4D9J A;  2WAQ F;  4E6K G;  1KBU A;  3F5E A;  3F2B A;  2KVC A;  2ZIX A;  3CF2 A;  2R4G A;  2JH1 A;  2HQA A;  4ZTJ A;  2V4J C;  4JMU A;  2GOL A;  3F2C A;  2G07 A;  2H3Q A;  2E1M C;  1F44 A;  4XL9 A;  2H3F A;  4U6P A;  3OIP A;  2NV3 A;  3HOS A;  4B44 A;  2G5H B;  3V42 A;  1ZEL A;  1QU3 A;  2W82 A;  2LC2 A;  3K4K A;  4IQJ A;  1K6Y A;  4CZC A;  2CW7 A;  3CJQ B;  1WJE A;  1LVK A;  2WAE A;  2MD0 A;  1DRG A;  3QYF A;  4ZDL A;  4OAZ A;  4E7J A;  1BOB A;  4HNT A;  5HR6 A;  4J01 A;  4P0Q B;  3DKY A;  4AYB A;  2L9N A;  3AKZ A;  4OJ6 A;  2DCE A;  2LKY A;  3H9Q A;  4BGD A;  4DOZ A;  4HEA 2;  2WAD A;  3K4B A;  4BAC A;  3VC8 A;  3BLY A;  3HC7 A;  1PVP A;  4F52 A;  1D1A A;  2CW8 A;  2Q1Z B;  3OWT A;  3HKZ C;  2F76 X;  4PL2 A;  2AQF A;  2K5C A;  1NG7 A;  4CRX A;  4GRI A;  3H9G A;  3K4C A;  3DTI A;  4II3 A;  2Z2S B;  2A3V A;  2E5N A;  1OUQ A;  3H9J A;  4XON A;  3OYM A;  3IAM 2;  3OYE A;  2YB4 A;  4D1Q A;  2R7Q A;  4ZC3 A;  2JMG A;  4BUP A;  1BR1 A;  4CSW A;  3F5A A;  2OV7 A;  2HBM A;  1CRX A;  4E7I A;  2X1C A;  2ZIU B;  1DP3 A;  3H5N A;  4NNJ A;  5KCM A;  2VKQ A;  3J7A Y;  3L3F X;  2QKM B;  4QPO A;  2E1F A;  1S9H A;  4MLO A;  3LYS A;  3OOU A;  3K4M A;  2K8A A;  3PFY A;  2R7X A;  3H0M B;  2M0N A;  3VCB A;  2VLA A;  3KFU F;  3HOT A;  4PFO A;  4PL1 A;  2A5W A;  2YX8 A;  1N77 A;  2LYA A;  2XIC A;  2JUG A;  1X4P A;  1Z21 A;  3H5R A;  1TZL A;  3VYU B;  2ZIV A;  4QIW C;  2CN1 A;  2Y0S F;  3OYF A;  4NLB A;  2E5S A;  1XNS A;  2KHQ A;  4XLH A;  4O3M A;  2Q4T A;  2IGO A;  3CMM A;  2M4K A;  4NV0 A;  2RRD A;  4HNU A;  3VSK A;  2NOJ B;  3ALR A;  3M8J A;  1P9Q C;  4CA0 A;  3LVV A;  4XKV A;  2UWM A;  3OPX A;  5LD2 C;  2L5Q A;  2BVL A;  3OR2 C;  4OJP A;  2LOO A;  2PJR A;  3NWT A;  4P1W A;  3MMY B;  5KL1 B;  2R7S A;  5FRN A;  2K4E A;  2RQQ A;  4RMN A;  2K3P A;  2RNG A;  2KJ8 A;  4PJM A;  3SZG A;  4KIS A;  3VWB A;  3F53 A;  3O0F A;  3A1Y A;  3FDY A;  4BJ6 C;  3PNV A;  2VQL A;  4IQ4 A;  5HOO A;  3LL7 A;  2Z7J A;  2GOM A;  1QHH D;  2K89 A;  2KIC A;  3DLA A;  2HVS A;  3HKZ A;  2X6W A;  3L2R A;  4BJ5 C;  5CQG A;  4NC7 A;  3OYB A;  2VKH A;  4BQN A;  2N1R A;  2R7V A;  2JA2 A;  2LRE A;  4BE1 A;  4BDY A;  2JGA A;  1X1B A;  2HPI A;  3VSL A;  2WAQ A;  1X1C A;  1T95 A;  4XN3 A;  4EAT A;  3PUB A;  4HSR A;  3CJR B;  4XMY A;  2XID A;  1MMN A;  1YX5 A;  4HPQ A;  3AL0 C;  3D2Q A;  1V5F A;  4CUG A;  4DJA A;  2R18 A;  5HNH A;  2VL8 A;  3TMO A;  2VJI A;  2HU9 A;  4C9Y A;  3KZX A;  2VKD A;  2R7U A;  2K9M A;  1MW7 A;  4AVZ A;  1JI8 A;  2KRH A;  4N4O B;  3RCO A;  4F93 B;  4X0G A;  3K4N A;  4KT6 A;  4DBQ A;  1HIW A;  3NUQ A;  2WA0 A;  4B47 A;  3RFA A;  4JOM A;  4YEL A;  1U0J A;  2KJ9 A;  2LYB A;  1X1D A;  4NQW B;  4XOP A;  4E7H A;  3E0J B;  4XOT A;  2HOQ A;  2WB1 C;  3VYT B;  2KLO A;  1L6N A;  2JH7 A;  2KJ5 A;  1R6R A;  2RHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...