3IP4B

The high resolution structure of gatcab
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
482
structure length
482
Chain Sequence
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct regions in Staphylococcus aureus GatCAB guarantee accurate tRNA recognition
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
total genus 168
structure length 482
sequence length 482
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ip4B03
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3ip4B02
3KFUF 2D6FC 2DQNB 4WJ3B 3H0RB 3AL0B 1ZQ1C 2G5HB 3H0MB 3H0LB 2F2AB 3IP4B 2G5IB 2DF4B 1NG6A
chains in the Genus database with same CATH superfamily
1OCOH 9ICIA 5E8IA 5CYVA 2K4EA 1GLNA 4UB6C 4RQ0A 4M3FA 1W7PB 1OCZH 2XF5A 4Q48A 4ZZDA 5LRSA 2QKQA 4EELA 4DIQA 4YD2A 2ZJ2A 4XLAA 2HHVA 5KT7A 4E7KA 2STTA 4JK1X 2OZ6A 4IRKA 3RH6A 2D45A 4A0XA 2BY0A 2HXIA 3LQRA 1FBQA 3JR9A 4UBCA 1DXSA 5DG8A 1B6AA 5KFUA 2GA2A 4BE1A 1ETOA 1XS9A 4YXMA 1JKRC 1KFTA 1ZREA 2JMGA 1BC8C 1TW3A 3TL4X 4QTRA 4F55A 4WWCA 4CH7A 5BPDA 3RZOJ 2L9NA 5BOXA 4CDGA 1ZQSA 5FROA 1UHWA 2FNAA 1MDMA 3QWLA 3WTYC 3VODA 1FSHA 2A1JB 8ICBA 3KYDB 2BOLA 3JRGA 2K4JA 5EOZA 4BHBA 2VIXA 4CZCA 3C1DA 4MHVA 1PVEA 2CUJA 5K5RA 3SMVA 3WK6A 1IM4A 1U9LA 3F6VA 1MH3A 5AKKA 2RHFA 4O5EA 1MJAA 4FASD 1D8JA 3F2CA 2A68F 2BY3A 3CCJI 2KFZA 2DA2A 2FLPA 3ZOBA 3PV8A 4A93J 3O0FA 2LBFB 1I27A 2W4SA 3AU2A 4QZBA 4K4IA 2E1MC 2V4QA 3SYZA 2LLKA 3CCYA 1ZGWA 1WCNA 2LC2A 3RPUA 4ED8A 1TWHJ 1IAWA 1T08B 5ALOA 4R66A 3FK6A 4OJ5A 2DW4A 1P9QC 3TOBA 4OJLA 4OJOA 2MGQA 3S1NJ 3PO5A 1W5TA 4Y2PA 3D0SA 4M3EA 4BWMA 1WCLA 3KP6A 3MGIA 4NLZA 1ERDA 1ZQXA 2AQFA 4QZAA 2HZDA 1CF7A 2CQXA 3BR1A 3I4MJ 1SAUA 1L7PA 4RUCA 3X2QH 5KG5A 3QQAA 4RZRA 3M7GA 2HU9A 3NRWA 7ICPA 1BBYA 1Q1VA 1VQKI 3TO6A 3FYHA 1R5HA 1L7MA 4GXIA 4F4ZA 1P4XA 1JI8A 2XAFA 2ZMEC 1BPZA 4OMZA 4UB5A 4H0EA 1KYWA 4MO7A 3RJGA 2CV0A 1ZD3A 2Q8KA 3HRUA 5ALQA 1OQYA 1IV8A 3ML6A 5IYCJ 3CLOA 4MQ9F 2FBHA 4HEA2 1J0RA 4EBCA 2F5FA 2QB0B 2PXIA 2A69F 3OSFA 1ZH5A 5AI0A 3OSPA 2A3SA 4A8EA 4QZ9A 1ZQPA 2VQCA 4A3EJ 1G4DA 8ICQA 2NS0A 2MC4A 3ERED 3OYBA 3N7SC 4Y2VA 2JUCA 2K60A 3K70D 2PKEA 2CXYA 2NV3A 4BQNA 3QU5A 4PFOA 4C30A 3FK7A 3SXYA 2DT6A 5KFXA 5J0UA 2QBYA 5HR7A 1VTNC 5TZVA 4E7LA 1YHQI 2IRFG 5BPCA 3BJYA 9ICVA 3ABTA 4HRIA 3ZMZA 4C7ZA 2DMNA 1K1SA 4F5PA 2W57A 5EWEA 3GUDA 3OYEA 1X3UA 3KFWX 1N77A 3Q8PB 3L2QA 2DN0A 2DOAA 4B9VA 3JRFA 2Z7JA 3DQVC 5BS6A 3OS2A 2ISZA 2ZIXA 5E79U 3OL4A 4MIMA 1YITI 4XNFA 2KG5A 3GTGJ 2OQGA 1KU3A 4FZLA 1VI0A 3WODF 2R5ZA 4NQWB 3OYKA 3ZQFA 1LB2A 2HBKA 4C2TA 4ZYGA 1TQPA 2RQ5A 2ZO4A 1AQ6A 3G3ZA 1DGJA 1DK3A 4XLNF 2CN1A 4DLEA 4AC0A 1YJNI 3I1YA 3H35A 4ELTA 4P0PA 4P5OA 2MUTB 2R7SA 3V6HA 1F9NA 1Z1DA 2E1OA 3CCQI 1SXDA 1H8AC 2W3RA 2LKPA 1QZYA 1RI7A 1UG0A 2JPBA 1X40A 5ALDA 5CR0A 2HVQA 1J9IA 4FS2A 3HPGA 2DFHA 5LHGA 2PG4A 2IBKA 4O9MA 3KHRA 1A6SA 2N8GA 2P5KA 2QWWA 2M9HA 3V8KA 3F23A 3WTWC 2VPLA 5DG9A 1U47A 4N9HA 3LSPA 4O3NA 7ICHA 1RKWA 1UZCA 4UNOA 3KP3A 5HS9A 3E6BA 1AU7A 4FE4A 5KAIC 3ZD8A 2DK5A 3N7PD 1UB9A 4RNNA 3HEFA 1MMGA 2K4IA 5E79C 1GXQA 1WWVA 4BE2A 4GXOA 5ALRA 4OOIA 3PR5B 3TDUC 3BP8A 1V85A 4I2BA 2ZSHB 4ECQA 4R65A 4G3IA 1LFPA 1P7IA 4Y15A 2HOIA 2LH9A 5ICEA 2WV1A 1MIJA 2ZXJA 1WHUA 2PX9A 5HNHA 5K1YA 1BN5A 2EIKH 1FWZA 2XKOA 1RKTA 1FJLA 2DGZA 1AA7A 1L3VA 2EZHA 4RGXA 5K7FA 1ZQTA 2ISPA 3HKZA 3LQQA 3HP6A 3ETLA 2K7LA 3GV5B 3T3FA 3OY9A 5ED4A 3TARA 1X58A 2ISYA 2IBDA 3FXMA 3VFZA 1F44A 1TC3C 3H8JA 1H9GA 5M5XJ 3B0YA 2MA3A 3NWTA 4F4WA 2VJ5A 4Y2QA 3LVWA 3ECHA 3KLOA 1FIQA 1QSLA 5LGTA 2X1CA 3QU6A 2FPKA 4L9TA 5CVIA 5FKOA 2BKEA 4UAYA 3T5JA 1D9DA 2VBXA 5AK4A 2WBMA 3E58A 4CSWA 1R4NB 4B43A 2HDCA 1NI3A 2EZXA 5DGBA 1S9FA 2BCRA 1EH8A 4UXNA 2X1DA 2FJ6A 5GTHU 4DSJA 2W7NA 1X6IA 1SL1A 3BC8A 1Z77A 2EV0A 5KG0A 2XY6A 2PJRA 1T95A 3WTSC 3EQLF 1LFBA 2W54A 3I59A 1ZAOA 3WG7H 3QU3A 3AEVA 3WTVC 4YD1A 4I6ZA 7ICLA 1IG6A 4LG0A 2H3IA 5DB6A 5JU5A 4F2RA 2OQRA 2IA0A 4QIWF 1L8LA 4PZOA 2QSGX 2DMQA 5AI8A 3E6DA 2DQRA 2E1EA 1T3NA 3H5NA 5HS7A 3F8FA 4OAYA 2M3AA 5JVGF 2XGQA 2V9PA 3HOYJ 2KJ8A 3ULQB 9ICHA 1KYZA 5KFKA 3MMYB 2M2EA 3C1YA 5CA7A 2OU2A 8ICNA 1Y8QB 1YG2A 2Z1DA 1W7PA 4NQWA 2Z16A 3RH4A 4UV9A 5ALXA 3PR4A 4I2GA 3W6VA 2K8BB 3WKDA 1IJWC 1DDNA 4C3HJ 3J7YJ 2A1AA 5AM4A 2EFQA 3M9OB 5H6QA 2L4AA 3K4CA 5EE9A 3FXRA 3CP2A 2XASA 3F5AA 1QPIA 4LOCA 3PQJA 3C7JA 2V6EA 4X6AJ 3WHBA 1LFUP 2K4PA 2ZJ5A 2KFNA 2VE9A 1HW5A 2HYFA 3D5SC 5KFCA 2K85A 3BDDA 4GLXA 4UVCA 3N97A 3H4DA 4CICA 4QSHA 5DDYA 4CO8A 2M0CA 2EIMH 2JTVA 4YIIA 4JX4A 1VNDA 3S1RJ 3GWZA 3QXGA 3ZQIA 3J81K 5J8CA 3O3KA 1VLBA 4RQ5A 3EPIA 3BQ0A 4GO1A 8ICXA 4BY7J 1YIOA 1RPWA 2WB1N 2XSJC 3GX4X 1NH3A 4Z2YA 2VXDA 2V6CA 3U21A 1ECWA 1KEJA 2L5YA 1FLIA 2NRVA 2VANA 4X0GA 2F4MB 2RAEA 1T39A 4DYQA 2WF8A 4M72A 4ECUA 5KNIA 4B9TA 3WGGA 4RB1A 3MFIA 3VPRA 1R7JA 4YIFA 4HDUA 2R7ZJ 2KJ9A 4PGXA 1G3TA 3K4LA 2KD1A 1PK3A 2G5HB 3M7DA 4QZFA 3GVAA 5F0HA 1APLC 1U3EM 2R18A 2H5XA 1VQ9I 2BQRA 3I58A 3V7RA 1DU0A 2Y9UA 2F5VA 1RXWA 3B73A 5ERIA 2VXZA 1S7OA 4XK4A 3OYMA 3AL0B 4KMFA 1SFOJ 2VUMJ 1TWFJ 4L9VA 1PYVA 2DBBA 2L54A 4GDFA 4DF8A 2JEGA 1V55H 1AWCA 4MFAA 5DS9A 1ZRDA 1FYMA 2QLTA 1SVMA 1SL2A 1RETA 4HSTA 4I2IA 5GAEJ 4NC6A 4M04A 1TV9A 2LDUA 2ZXIA 2LHTA 4CF3A 4WCGA 3IL2A 3FDYA 4F52A 2Q1ZB 3T79A 5KFPA 2QQ9A 3H8SA 3VYRB 1IUFA 3RTRA 3BZ6A 3TQ1A 1DP7P 3N05A 1YX5A 2LF8A 2BCVA 2O0YA 1J59A 4OJ6A 2DPJA 2DA7A 1YOVB 4UB3A 3UXNA 2HI0A 4XUSA 9ICAA 4IXAA 3BZCA 1D0YA 3ZRGA 4KX3A 1HF0A 4EBEA 2AXLA 5LGNA 3HKZN 2EFWA 3GFJA 2DL0A 1RYUA 3V42A 3L3FX 1MC8A 2H94A 2EZKA 3MQ0A 1SVLA 2JA5J 1T94A 2K89A 3W2WA 2ALZA 1T0FC 3ASNH 3N7RC 1X9WA 1AROP 1FZPB 2XY5A 1OCCH 4ESFA 2VT2A 5J29A 1SKRA 4CXFA 3G1OA 1ZG1A 2KTQA 3I56I 2W55A 3HOWJ 4AYBA 4YELA 5JI6A 4L5JA 4EZ9A 2I8DA 1RG6A 7ICEA 2R7FA 2VKHA 1IF1A 1WI3A 4LLNA 4XLEA 1VDVA 2ZUDA 2YS9A 3I55I 1EH7A 5AKHA 4BWJA 5IIOA 4RNOA 4DWIA 3BT9A 1IZ1A 1DOQA 1FO4A 2HBLA 4HG2A 1YO5C 1IUYA 2EPFA 4JV2A 2L01A 4YEJA 4I09A 1OR7A 2VLAA 3QRFF 3GU3A 1WJDA 5ALHA 2QEXI 1G8XA 5C4JJ 2DI3A 2QZ8A 2CS3A 1ZD2P 4EYIB 4D7MA 2H3QA 1NTCA 2EA2A 1JKOC 2B63J 2V4JC 1YRNB 3IRUA 3CW2C 2Y0SF 5K4LA 2PMUA 1G59A 4M9HA 4A12A 4KLQA 2YX4A 5GTIU 1Z0XA 4O3RA 3UR3C 5KFMA 3M9MB 1JTYA 2BYVE 1UA1A 1JXLA 2VONA 1USTA 3M07A 1YW7A 3WHCA 1DPRA 1J5YA 3WK9A 2AS5F 2NXNB 2XVTA 3KP2A 4IRGA 2ZNZA 3BG9A 5FJ8J 4TQRA 1S6LA 3ZMDA 3ZQLA 1PVRA 4AP9A 3CUQA 3H3ZA 2K27A 1W1WE 5DQHA 4RAFA 5ALVA 1ZQRA 2KKVA 2KT0A 2L7ZA 8ICAA 2F6CA 2NAZA 2LKYA 5HDKA 3TW7A 2EV5A 2JZYA 4EJWA 4IX7A 2HVRA 1K7AA 2MSYA 2Q2EA 2HOQA 2VN2A 1JUPA 1TAMA 1COOA 3BJOA 5M5YJ 4DSLA 4RLQA 1TNTA 2YTUA 2WF6A 4FZNA 1J09A 2BXYA 4FX0A 1ZK8A 2HR3A 2HTJA 4A0ZA 3C5FA 5J1YA 5IP6A 2CMPA 2MH2A 4M9NA 5DD4A 2Y75A 5GADJ 1VQ6I 3Q8LA 1Z4OA 3CJQB 5EE3A 2COMA 3HSEA 1ZQBA 3K4BA 2KE7A 2NOGA 3BS5A 2XIGA 2F8KA 4MFCA 4Y17A 2ZUBA 1JE8A 2H8WA 2NYVA 3S3OA 1FOYA 3CESA 2D1VA 3PQKA 1W36C 4K2EA 1ZXIA 5TRDA 4TUSA 2M8EA 1ORKA 3RJPA 1H0MA 2AH5A 4HX8A 3K4JA 1BPBA 9ICKA 2Z33A 2XPUA 5EF6A 3UMBA 3K70C 5HOOA 2V9KA 5DQGA 1RNLA 4BXFA 4P0PB 3L5KA 2DCEA 4DNCA 1SZPA 2F1HA 1P2FA 3A0BC 3BG5A 1FEXA 3TP3A 2RLTA 2LMRA 3A1YA 2XUBA 5LD2C 3QYFA 2JV3A 1ZOLA 2OZUA 3MCZA 4KIBA 2HPMA 1L8OA 4Y2SA 3JPOA 4DFJA 1HUOA 2MFZA 1P6RA 3DLLF 3V7CA 3QPSA 4DYCA 4CCLA 2E8NA 1EV7A 3OOUA 3IG5A 3WK7A 2CFXA 2CRGA 1Z6TA 2IVMA 2LY1A 4LK1F 5E3OA 5JFRA 1JN3A 3MN2A 4C3JJ 2LFBA 4BE0A 4O3OA 4DL4A 3MC1A 1ZETA 3PW5A 4DQ2A 4PJ0C 3I9V2 1MBKA 1ZRFA 4RBOA 5KTQA 2Z5UA 3A02A 3CO6C 1CEZA 5KHDA 1HCRA 2OBPA 3H9JA 3RB4A 4YR3A 2JMWA 3F8BA 5DM7F 1TE2A 3K1ZA 3HHHA 4J9PA 2KZ3A 4B9MA 3J81j 2VOPA 3QYPA 4F50A 2XAGA 2EA4A 1WJFA 1UJ8A 3SEQA 4A3FJ 3D5LA 1OXJA 3I28A 5KG4A 1NKCA 4JWMA 3AU6A 1SV0C 3G71I 5F1JA 3L7WA 2Y31A 2WADA 2UVWA 2K8CB 1CRXA 3JCUC 5CVUA 2V1DA 1RRJA 3ABKH 1MNEA 1S8NA 1FNNA 3KP4A 1KZHA 5AKEA 1ZQIA 1IRXA 2RDPA 4M0AA 1LKXA 3E2EA 4NLBA 5ILVA 3ONNA 3GYHX 3BR2A 2MU2A 1OCPA 3FC4A 1Y0UA 4BEHA 2KHQA 1Z19A 2TDXA 1BGXT 3GFKB 2QB1A 2GIZA 3KKAA 5F9NA 3Q5FA 2CQ7A 2I9GA 1BI3A 2YU9J 4MTEA 1LEBA 3CCVI 1ZQNA 5B66U 2WTEA 5ALJA 3TAQA 2AGQA 3OYGA 4RNMA 3E5QA 4PHEA 3EZ5A 2VA8A 2OH2A 3C3WA 2JEFA 4RUAA 2M1BA 5CVRA 3AAFA 2DBYA 3IV5A 3WK5A 3HSFA 1TWGJ 4A0YA 2WAFA 4LB6B 4LJZF 3BWGA 2ZB9A 4XRSG 3KYLA 3OV8A 3FF5A 5EE0A 4IOCF 4JUZA 4KX5A 5KFZA 5AIBA 3VWBA 3C1ZA 2HW3A 4HYEA 2PLYA 2DA1A 3RPUD 4YMMA 5L1JA 1Z6RA 2CU7A 1A35A 4XR6A 5ALYA 4C8KA 1J97A 5J40A 2G5IB 5KL1B 1W5CC 3ZDAA 3I3LA 2HQAA 2JK3A 3R0AA 4C2MJ 3L2CA 2BEOA 4BJ5C 2I10A 2W9CB 1JXEA 1ZQWA 2F4IA 3SHFA 3V6JA 4KMUA 1X3WB 4YN4A 4RMNA 4R64A 3LSRA 4ANJA 4B3XA 4LITA 1QO0D 1ETKA 3HRSA 5CRXA 2R92J 2EV6A 5JUMA 1S72I 2HHSA 2G7UA 3KCCA 4LK0F 4P96A 1EXNA 4IQTA 4F72A 3FMRA 3BR5A 1KFSA 1K79A 3C2BA 2X6OA 2E5ZA 3RTVA 1MSFC 1BC7C 2QSHX 3RKQA 3C18A 2L9VA 5HMMA 3GILA 2W1OA 4NLNA 4LMYA 4KN4X 2O7OA 1T4GA 3BCBA 1K1QA 9ICTA 1L0OC 3OGUA 1XMAA 1OYWA 1R71A 1S97A 4RGUA 3NWSA 2DXIA 4EGZA 1DGSA 1FEZA 4F91B 4XKWA 1YJWI 2EANA 3K4KA 5HDNA 5J6XA 4IJAA 1BJAA 1A76A 2E71A 3ETRA 1ZQLA 2WAQA 2BV6A 3H8MA 3DU5A 1LEAA 4EQQA 1ZRCA 4F5QA 2X85A 3GXOA 1RPLA 2GLOA 5J2AA 4RGRA 1B9MA 4DS5A 2MH9A 3CUQB 4Y7NJ 2BE5F 3C21A 2E34A 1FYLA 5EG0B 4XN3A 5KG3A 4HYKA 1BOBA 2CUFA 5HDGA 2EAPA 2NRTA 1IW7F 3MFKA 2MLKA 2ZTDA 4ZH4A 1R6RA 4ESBA 3H4BA 5FKMA 2QKMB 3F21A 3MZ8A 5KFNA 4QWCA 1JKQC 3RKWA 3RR7A 4PPXA 4UAUA 3RSNA 2A07F 5F0FA 2ASJA 3FM3A 3QPLA 1ZQKA 2JVHA 3SEIA 3WE2A 3IV6A 4ETSA 1RC9A 3ESWB 3U9GA 3ORYA 2ZIWA 2ZIXB 5FD5A 4ENJA 2DUYA 5J8YA 1D8KA 8ICLA 2KZGA 3S3NA 2O03A 1M6YA 4RQ1A 4ECYA 8ICVA 2Y0MA 2KFDA 1WQ2A 2VQGA 1JT6A 1SMYF 3BTCA 4UUSA 4IRCA 3JAMZ 4Z6EA 1MBEA 3J80K 1R49A 2XO7A 5L3FA 1CQTA 1IXSB 5K7ZA 2O3FA 4PK4A 4GCVA 2QBYB 3PVXA 1H38A 1HBXG 3AFHA 3Q9VA 4JOMA 1XB4A 2HS5A 2HZTA 1SFUA 4RQ4A 4FBTA 3M3YJ 1S0MA 4TUQA 4EJUA 2CW8A 4FX4A 4DOCA 1QNTA 1XC9A 2UXNA 2X4HA 2DPDA 1SB3C 4F3OA 2PQ8A 1C7YA 9ICLA 4LD5A 3RBEA 3VYSB 3TQNA 1IN8A 3HB9A 3K7AJ 4DBQA 2L2OA 5E3LA 2Y0SC 5CEHA 2HYJA 4UUSB 2XV4S 1T0FA 2K5CA 3JTGA 1X66A 5JR3A 1TKDA 3HT3A 4NLKA 4CF4A 1N60A 3LSJA 4F5NA 3CP8A 2J5PA 2KIQA 1ZGAA 3ZP5A 2EAMA 3M9NB 3GLLA 1E2XA 1WJ5A 2RNJA 3D5RC 4QWQA 3K10A 4U88A 2G09A 2R8HA 1T33A 2VKDA 1PVPA 2HOSA 2DLLA 4JWNA 4DQSA 4IKFA 3OJSA 3AUOA 5FKLA 2DPUA 2CYYA 3SQNA 1B0XA 1EA3A 5FFZA 4CGZA 4HLXA 5J0OA 1UA0A 4N0BA 6PAXA 4XM3A 4M2YA 3MZYA 2VBZA 7ICQA 1D8BA 2MSNA 4C4TA 2Q4TA 3BQTA 3HTSB 2XI9A 1ZQQA 3QUQA 2WF5A 4ABZA 2WF7A 2K4HA 1ZR2A 2KNJA 1D1BA 2Y48A 5D4SA 1D1CA 3OJUA 1F5TA 2ZIUA 4IHSA 1XMKA 4J9LA 1LVKA 4X5VA 1WJBA 4UB2A 2QYOA 4PGHA 1N63A 3JPQA 3HUGA 3MDAA 4GYGA 2JN6A 3BY6A 2LBOA 3V7LA 2D5VA 2IXSA 2YU3A 3M8SA 2X9DA 1LVAA 3ISPA 2UVVA 4NB5A 2IPQX 3OYAA 3U1KA 5JVTA 3DLAA 5KCMA 4AYBC 1HA8A 1SFEA 2F5DA 5M3FJ 1NKEA 4DQRA 2A6HF 1BW5A 1TNSA 3OWTA 3J80Z 4KLEA 5GPCA 1Z05A 1DUXC 1JKPC 2ZG6A 1LKYB 1TQIA 1ZKGA 4L9JA 5IY5H 1N78A 1L6NA 3QYBA 5D8KB 3GBGA 4YCXA 5HLIA 5AKLA 2BHZA 4RQ7A 2H3FA 1JUSA 3RQ4A 4M6WB 2PEXA 3PSPA 2JSPA 3A4CA 3PNYA 3SENA 4TUPA 4FBUA 2ZSIB 2D6FC 7ICJA 2EB7A 2DT7B 3ABLH 3BTIA 2FI1A 3G2BA 4UAVA 1T3QA 3A0HC 1M1EB 3P5JA 1TVAA 4M6XA 4PHAA 2GQQA 2BZFA 2WAQN 2K40A 1RYRA 4IOAF 2YB1A 4I2CA 4BNCA 2QKLB 3RJFA 1J75A 4AYBF 1B8IB 4RB3C 4A3JJ 2P6SA 3RJKA 4IL6C 4M9JA 3FKIJ 1V3FA 1U2WA 2LM1A 7ICTA 4DFKA 2AQ4A 1OCRH 3PSIA 5ALMA 1G3SA 2R7UA 1XSPA 2RDIA 1MKMA 2EWNA 3Q9SA 4KLDA 2BPCA 1N48A 1SZHA 2EBIA 2G07A 1PK1A 2LYBA 2H1LA 1QHGA 1U6GA 3M9AA 3H8WA 4CCJA 1FSEA 4J19A 1Z7UA 4BHCA 2XICA 2VA2A 3DPUA 4N4NB 1OLTA 1IN7A 4BAYA 4CCOA 1VQNI 3EYYA 5DCMB 3WTXC 2UV1A 2RDJA 7ICSA 3TW6A 3FM9A 4YMOA 4KLSA 2QQ8A 4JYKA 3KTQA 4XLHA 1Y1VJ 4KN7X 2OD5A 1UCVA 2IA6A 1U4BA 4QZEA 4E6KG 4BH9A 3K1MA 4M6WA 3CDHA 1PJRA 1QVUA 5CB1A 1WPKA 4DQPA 4KMUX 2AJQA 1B59A 5CJ9A 3GZ6A 4UARA 4KLJA 3VC8A 2GA1A 1XU4A 1IG7A 4ITVA 2JWTA 1L5UA 2KKOA 3MGHA 2DFEA 1IV6A 2CW0F 4Q45A 5D4BA 5E3MA 4E7JA 3CC2I 2W00A 4HBLA 3AG2H 3L2WA 4G12A 4JP0A 4D5CA 3F6OA 1RR8C 4Q43A 1LV5A 5L3DA 2WA0A 4IO9F 4H4KC 5AONA 1SXEA 1Q1HA 2JRMA 4B3AA 1JMSA 4NHJA 4DL7A 2PI4A 4PFPA 2OYYA 4IRHA 1ZQAA 3PUFA 1MMNA 4ICAA 1NJYA 2ELKA 2LVSA 3RI4A 2M8GX 1RXVA 1QBJA 4HOBA 4PUSA 3Q0VA 4E4HA 1MQ3A 2M30A 3E5UA 3ROUA 5LGUA 4EBDA 2BCQA 1N5XA 1WCMJ 1OMIA 1SMTA 1ZQZA 4NLCA 1NK6A 3FWEA 3HOZJ 4CYCB 2KSOA 5D6EA 5J8YC 2KL4A 4EYHB 4DL2A 4ZH4F 1ZQVA 2QENA 2NOJB 2ZNYA 4KA4A 1QA6A 4Y2UA 3ZD9A 4BBSJ 4Y3OA 4NLGA 1ETQA 5L3CA 3GIKA 1WSUA 3N4MA 5E17F 1X2IA 4C8OA 9ICWA 2XVCA 4F7ZA 1ZLJA 2YMQA 4OU0A 4O3QA 2HPIA 4Q5SF 1P92A 1IRGA 4UASA 4EGYA 2GXBA 1PVQA 1ZELA 1A77A 4USAA 1ETYA 2RGVA 2FA5A 3G1LA 2V1UA 3GEZA 5ALEA 1ZD4A 3WU1B 4A6DA 4O5CA 3G73A 2OV7A 1N25A 2DDAA 4OIPF 3GIMA 3CUOA 4HF0A 3IHUA 3OYNA 4IHWA 3E0JB 4II2A 1B72B 2JQ7A 5J0XA 5L1LA 2OEHA 4RA2A 4J03A 2KZVA 5DB9A 4UUTA 3CCLI 2H3VA 2R7QA 3LMMA 5J4YA 1VQ5I 5ICCA 4M71A 2F77X 3MZHA 1MBGA 1V54H 3LOCA 2L4MA 1WWUA 3H7IA 4KLFA 5LEKA 4CA0A 3MWMA 1S29A 2F1IA 3GTQJ 2NO4A 1NG6A 3CCSI 3LSHA 3WTZA 2C6YA 2QA4I 3K6GA 3K9TA 4FT8A 3T5XA 5EWFA 4RPYA 1IO2A 1MBJA 1MD0A 5F04A 1FTZA 2MRLA 4IQVA 1S9HA 4DOAA 5K7HA 3RIRA 2H09A 3OL3A 1LDJA 1NJXA 3O8GA 4XIDA 3FMQA 1SVOA 1VZ0A 1HDPA 2ZXWH 1B4AA 4RPZA 5JTIA 3GLXA 3HRMA 1YS6A 2MA1A 3Q0WA 1LJ9A 2XKPA 1H9TA 3COAC 1BPEA 8ICSA 4L0YB 3BCAA 2ZFWA 4AUXA 2WV0A 1FY7A 2Z9OA 5FLXZ 1AKHB 2A61A 1ZQ1C 4JQFA 2RP5A 1U5TA 4DS4A 3D2SA 1GV5A 4JBAA 4PH5A 3H92A 2VODA 4ED1A 2BW3B 3ZQHA 2XAJA 3KP7A 1NG7A 3HXLA 3JRIA 2JA6J 3HW8A 2C2RA 2BY2A 1E3OC 4OIOF 2BQUA 3RCOA 3IAM2 4J9KA 2HDDA 1X3ZB 2IOFK 1Z3EB 2HI3A 3T5LA 2FMLA 5IIJA 1UELB 1WYGA 3Q8SB 3V72A 1YJ9I 4BXOB 2O8KA 5DLFA 1G2HA 2BCUA 3LSMA 3PX6A 4I29A 5EJCA 2W24A 2DT5A 3TKAA 1WVRA 4Y2JA 5DB8A 1XS9D 4KLIA 1FOKA 3MAJA 2YN4A 1G3WA 3SAGA 3F53A 1MDMB 4NM1A 1X4OA 5DV5A 2LPEA 2MBFA 5FP0A 4TURA 3DV9A 1JT0A 1TWCJ 4B4CA 3IAS2 5DB7A 3H0DA 1XPXA 3FXLA 2R8GA 2LREA 4IQUA 2KK0A 4Z6FA 5DBAA 2YR2A 4Y2XA 3L09A 1MNMC 3WGHA 4NUBA 2JZBB 3TO9A 3UXOA 3M4OJ 4P2HA 4AIHA 1VQMI 1SD6A 3GMEA 5KAFU 2LKSA 2VI6A 3QPHA 4GRIA 4QLCU 1JROA 5AM0A 3THVA 1NJZA 3CCUI 4MFEA 5KFGA 3KEOA 4L9NA 4YFKF 3SDBA 3CCEI 2M0NA 4RT3A 3NS1A 1ED1A 3V7KA 4L18B 3PIPF 1O3TA 2AO9A 4EV0A 2GO7A 2X6WA 1SV0A 4R8UA 2KDOA 1QCKA 3Q0UA 5CJ7A 4QW9A 5F27A 4UB1A 2BVLA 4HPQA 3FHZA 3AL0C 3HZJA 5IOYA 3RR8A 1NZBA 2VJ4A 4I76A 1KU9A 3SZTA 2BZTA 3R61A 4KIFA 4Y2RA 5KG2A 1FYKA 3M1YA 3H0GJ 1EKEA 2OF7A 2WB1A 4F4KA 2VKEA 2VBYA 1HEKA 4XRHA 3FXKA 4RAGA 4ZTJA 2EAOA 4BDYA 2VB6A 1WZ2A 1NK2P 5ALGA 3DEWA 1B72A 1BR4A 1WGXA 2ZJRF 3VDXA 2F5EA 4DCCA 1ETWA 3KZYA 1XDUA 3BPVA 1MN8A 4U0VA 4Y33A 2OCEA 3D2QA 1J2MA 5D5XB 4C9YA 3E3VA 2E19A 3NTUA 4AIDA 4Q8EA 1V5EA 3PNCA 3KE2A 4HLYA 4EEYA 3QUBA 5BOMA 3B6CA 2VL8A 2R7WA 5CVVA 5KT5A 1ZG3A 3LA2A 4V2GA 2BDUA 4I2HA 4KLMA 4GFJA 3E0FA 2P6TA 2WAQF 3IKTA 2M7BA 3NVYA 1FIPA 1YT3A 4J9QA 3BG3A 3F22A 3RRHA 1WFXA 1XCBA 2R7RA 2X51A 2FBKA 3H0LB 5KFTA 1X4PA 2F2AB 3ZI4A 3ISDA 5B5EC 2B7EA 4KFCA 2FXAA 3GZFA 1XSLA 3DTKA 1VFCA 1K6OA 2JJ7A 1RUOA 2DYRH 1U5TC 2KKPA 2KSOB 3QE9Y 3V7SA 4LG3A 3ZQCA 3DV8A 9ICCA 3IM1A 2Y0SA 4ZYHA 2KRFA 4P9FA 4QWAA 3QOEA 1ITYA 2XF6A 1O7LA 1GO3F 3BQ1A 4ECWA 2IS6A 3RJEA 1UCRA 1HSJA 2L3DA 3KZIC 5DDGA 3KHHA 8ICPA 3KETA 2E1FA 2LBFA 2R4GA 7ICRA 3U26A 4U7BA 2P6UA 4OMYA 1RM6C 3KP5A 3SI8A 4WK8F 1YI2I 1EF4A 3W6KB 4YR0A 2W9CA 1NK9A 4KICA 2ACJA 3RPQA 2E5SA 4DOBA 3WK8A 2NRWA 5FLMJ 3F3XA 2XSDC 1I50J 3REOA 3PW7A 3LWFA 3BTJA 2KZMA 1A6QA 2LF7A 2VJIA 3R4KA 3WU0A 3SR6A 1HLVA 1UAAA 1I1GA 7ICIA 4HQMA 4IEJA 1QZEA 5JHUA 4BXUA 1H89C 3A01A 4NWIA 5IIMA 4ELVA 9ANTA 1XN7A 9ICQA 2VQLA 2V26A 3RDIA 4ZOHC 3MABA 3FXOA 1QZZA 2JSCA 4DGWB 4BJ6C 2PMHA 5KFJA 4A2UA 5J0YA 1X9SA 4BBRJ 2W9MA 2FX0A 5AKGA 5C44J 4CUGA 2LY9A 1A0PA 2A19A 4FE7A 4LJXA 4MLOA 2I5UA 1ETXA 1R36A 5T14A 4UW9A 5J0PA 2RVCA 3G1MA 1ZQGA 4O5KA 3JTHA 4A3MJ 3E6MA 1YTYA 1IN6A 4E7SA 3UKGA 4KDPA 1UPHA 3JAMK 4NV0A 3LWMA 4M9GA 2TCTA 3CQZJ 4B44A 2ZIVB 1NK4A 2ECBA 4RB0A 2O6KA 9ICRA 2Z99A 4D1QA 4LFUA 2LMDA 2PFOA 5FLXK 5AK6A 1Y0NA 3ZMTA 4II3A 4R79A 3I64A 3RB3A 4EM2A 3P9IA 1YFHA 3IRQA 9ICOA 3HGYA 1B8IA 2FMQA 3ZR8X 4D7NA 1X1DA 4G6TB 4F5RA 1ONVA 5LFAA 4ECZA 2ZMEB 4US9A 1HKQA 4ESJA 3PMNA 3A03A 4WJ3B 5AK3A 4DFMA 3G6XA 2KIVA 4MF2A 3SD7A 4DQQA 3ZQGA 4HF1A 1UT8A 3BJ6A 5DLGA 2ASDA 3NVWA 1V9PA 3RF9A 5DEQA 1ETVA 3K1PA 4LGWA 5LLQA 2Y9TA 4PGQA 1R58A 4MTDA 3F5EA 2HBMA 3IDWA 3EUHA 2QCOA 4F2SA 3DFGA 1GXPA 1MMSA 1QHHD 1MJ9A 1D8LA 2QUFA 4CNQA 2V1XA 2GBYA 4F5OA 3UPQA 2EQRA 2XY7A 5EZHA 1JGSA 1K4SA 4ED7A 2H6BA 1D5VA 1TW2A 1QLNA 1J2NA 2K4BA 2CH0A 2ZTEA 2K3FA 3PL8A 4QWDA 1MGTA 1NK3P 1KW4A 5ILUA 2PFQA 3NARA 2HHWA 1IIPA 1WRJA 3R6SA 1VQ4I 3OR2C 2E5NA 3IH4A 3U2RA 4HNTA 1VJ5A 2UVUA 4B9NA 2FF4A 4OAZA 1QVTA 3K0LA 4J00A 3HOVJ 3NRZA 4I2EA 2HNHA 1PUFB 2OPTA 3SZ2A 4B9SA 5E1ZB 2YY6A 2O5RA 3ED5A 2QQAA 3F8CA 4FQGA 5E8GA 4YFXF 3ZN1A 5J47A 3WGIA 4ZDOA 2F3NA 2XGPA 4FETA 2EFOA 4RAZA 2ZMEA 1C20A 2XGDA 3QUCA 2K3PA 2XB5A 4G8XA 2CRXA 3KX2A 4G7ZF 1BR2A 4HDVA 4ZTFA 3P9KA 2F4OB 4ENNA 3NUQA 4UATA 2QARB 4RGSA 5D46A 5DTDA 1KL9A 2XDVA 3N28A 1Z4NA 3VSLA 4HV6A 1ZQJA 3VOEA 4F4XA 1Y8RB 2M4KA 1YZ6A 1ZARA 5GTIC 2FMSA 3M1EA 5D5WB 4PL1A 4B9UA 2K9MA 4DQIA 2OTLI 5IIIA 5KFIA 3PJRA 1HKSA 3RYRA 2GOXB 2XAUA 4HQEA 1VQLI 4CHUA 1BPXA 1T2KA 3KKAC 1LUJB 3DDHA 4BX9C 2NVUB 4Y2TA 2EFNA 2JEJA 1WI9A 1LQ1A 4Z6DA 1G3YA 5D8LB 3I5UA 2D2WA 5J1RA 1LDDA 5D4RA 1YLFA 5IP9J 2IS2A 3CMYA 2MUTA 2FOKA 4UV8A 3ECOA 4LG0B 2FBIA 2XRLA 4P55A 1SWVA 1O4XA 1XWLA 3HWTA 1U5TB 5KFYA 5DYMA 5CVJA 3ALRA 3EPZA 3HILA 4A3BJ 3G6EI 5AI5A 4B09A 1VQ8I 3HGGA 5DM6F 3I71A 2EZLA 3E97A 3VYTB 2RKHA 7ICNA 5J2DA 5TISC 3IUOA 3KEQA 2ESNA 5DBCA 5IT9K 3CTAA 4AVZA 2PI0A 3LWLA 2W9BB 3H3VK 1SFXA 4I0AA 2AXTC 4B47A 1KTQA 2F1JA 2G08A 4ZDPA 3IH2A 3ONQA 3L4PA 5KFWA 1Z91A 2G0EA 4HNVA 3BS7A 2JT1A 3FIWA 3C2HA 2YPRA 1TZLA 2GIVA 3ZMUA 1U8RA 4QZ8A 4BDPA 4KLTA 2EK5A 3OYLA 2NRAC 2HSZA 1SGGA 1X2NA 3CD6I 2KMUA 3S16J 5IYDJ 5DG7A 1D8YA 3F0CA 2CQNA 4I7HA 3ZN0A 1ZR4A 4YFNF 2JUGA 3QX7A 3BQ7A 3A0BU 4BJTA 1KLNA 1MSEC 4JB3A 4XQ8A 4QIWC 9ICGA 1K83J 1W0TA 3GFLA 5FD6A 2AU0A 5J2EA 3K4NA 2R5YA 5KVRA 5J2JA 3TO7A 8ICCA 2K9LA 3J7AY 5KK1A 4RQ2A 5DCFA 5D5VB 2R7OA 4YMNA 4U6PA 5FFXA 3EYZA 3DEUA 3FM5A 5KG1A 2KRCA 4IHVA 3R9KA 1U9OA 1NK5A 4NL9C 4LZDA 2W48A 1KSPA 1Y39A 4WXDA 8ICJA 2E8OA 5J2KA 4GFBA 3FBNB 4GGGA 4UAWA 4XONA 3OS1A 1X19A 3B9JA 5KFLA 1ZYQA 1ZQMA 3ISCA 2P66A 1U9NA 2OWOA 3S93A 2RC4A 4N4OB 5HLGA 3RKXA 3ELKA 1P4WA 4FE3A 1Z00B 3A01B 2KOBA 2DMUA 1CGPA 5AI4A 1R22A 2L9RA 4XQFA 9ICMA 3MR3A 1JGGA 1I3AA 4ECRA 1ZQDA 2EZYA 3F72A 3I59B 1O3QA 1J7KA 2JA2A 4NXZA 2RQQA 3C29A 2R8IA 3EUB2 1BI0A 1FOXA 5HHIA 5KFQA 4KLGA 1JJ6C 2C2DA 2KLOA 4XMYA 3DTEA 2KP7A 5AKJA 3E1SA 2C28A 2VKQA 4LZGA 3MR6A 1XGSA 2IA2A 4QWEA 1WJCA 4KNYA 3S6JA 2KIMA 2EZIA 5CWRA 2K8AA 3C2MA 2CWEA 1B22A 2NRXA 4EJVA 5L9XA 1ZG5A 1KQ8A 5DUIA 3HPOA 2G9WA 2UXXA 1DRGA 2MD0A 4QW8A 2A5WA 3EETA 1TLHB 4RPXA 4P4MA 4BQAA 1AOYA 5KFAA 2ESEA 5IINA 4K4HA 5KAIU 3AMZA 5J1UA 5J2IA 1P7JA 1C0WA 3PFYA 2IGNA 1NKBA 3OSGA 3QZ8A 5HLTA 1X1BA 5DUKA 2FQ4A 2A5YB 2FDRA 1GV2A 2P81A 2R93J 2YX8A 4O3MA 5HR6A 3UM9A 3M6ZA 2W8LA 3M6KA 2D8CA 5EZGA 4M9SA 4P4PA 1DGRM 1SANA 4EM0B 4XLFA 1PUEE 4KT6A 2LY2A 1OW5A 5F3XB 3HKZF 5IILA 3ERMA 4IQWA 1K5OA 1SD7A 4O6JA 2FPMA 2KVSA 3QODA 4B6JA 2LSOA 5EYRA 1GDTA 5ALUA 5DBBA 2V9WA 2KJBA 1S0VA 2E7WA 3NAUA 2G06A 2P8TA 1ZQHA 4A6EA 3RZDJ 2RNGA 2WY8Q 5JLXA 3OS0A 5DD8A 1TFRA 5AI9A 5JRTA 5J2GA 2NS8A 1N5WA 2M9NA 4Z6CA 3GTPJ 5ALFA 2ETHA 3NRVA 4I27A 2W03A 4JV0A 4E0DA 1ENHA 5D6FA 3D1NI 4EENA 7ICGA 1S5LC 2ZKZA 4G9YA 4W1UA 1Z21A 1QSSA 5GTHC 1R1UA 4MFFA 1VQ7I 3KZXA 1JI7A 5IP7J 4TQSA 4J01A 2HHTA 7ICVA 1TAUA 2EINH 4ED3A 3TAPA 2L02A 3C2LA 5A2QK 4ECVA 1UQVA 5BPIA 3JPPA 3BQ2A 5ILSA 5J2HA 3S15J 4Y52J 4PHPA 2OJED 4FISA 1Z7LA 3T5HA 3PO2J 1V38A 2WFAA 2WY7Q 2KRHA 1S10A 1D9FA 1MSWD 2LM4A 2HQ5A 3CO7C 5E3NA 2VBWA 4BXXJ 3EW9A 3V7JA 1KN5A 5DQIA 3IC7A 5GAHJ 2V9VA 4HF2A 4PJNA 3AN1A 1YE9A 3S32A 3TOAA 2FMPA 3L9FA 4M47A 3CDIA 5G5GA 5J0SA 5CPRB 3B02A 5EEAA 2AHQA 4ENMA 2G7HA 2FUG2 1URJA 3UMCA 3AG1H 2DOFA 4IHYA 2J6UA 2YQEA 1FOWA 2QB0A 1O3RA 2HWVA 5E18F 1IXCA 2BW3A 4DF4A 2GXGA 4UVAA 4BDZA 5HVQC 3D6JA 4DSEA 2EQYA 2IGOA 2F8LA 5GP9A 4IC9A 4HZFA 2Z3YA 3PW0A 1DU6A 4I98B 4QWBA 2KP6A 1KBUA 3OMYA 2JXJA 3JPRA 3TKYA 1IDYA 2XGEA 5DDMA 2LNBA 4UB6U 3EUAA 1OFCX 2BVMA 3S1MJ 4BXOA 5J2BA 1PK1B 2HVSA 3VB2A 2ID6A 4YFKA 1U45A 2HOTA 3JRAA 4UY8I 1S77D 3S1QJ 4O3PA 3FMSA 3LL7A 1CF7B 4RQ3A 4HA8A 4P4OA 2E8PA 4E7HA 2X6XA 2C2EA 4XKBA 4ZZLA 3K69A 3CDLA 1LE8A 2Q0ZX 1PZNA 3QU4A 2BXZA 4PHDA 1KKXA 4DZPA 4I0BA 2E2IJ 2VE8A 3GV7B 1ZD5A 3CLQA 3GTKJ 2R7XA 4C2UA 4PSXA 2ZJPF 3DBRB 4A3DJ 5L3BA 9ICEA 3LYSA 3BLYA 2VASA 1RESA 5ICGA 3C2GA 2XF7A 2CFOA 4QPOA 1BL0A 2STWA 2EILH 2ADUA 5L3GA 5E1XA 5FRMA 3H0RB 2UVRA 1ON2A 3BR3A 3PX0A 2QF7A 1F1ZA 1XGNA 2DTRA 2V7FA 3LAJA 3HL2A 2DAOA 3I4NJ 1NHAA 4PJLA 4RDUA 1SV4A 1R23A 3K4MA 2JHDA 1OCTC 1MZBA 4DFDA 5J2FA 1S8OA 4HNUA 9ICFA 2WC2A 3H36A 4KUMA 5BQTA 3PFIA 3CF5F 2KICA 5A0LA 1BW6A 3L2VA 1B43A 1S0OA 3OIPA 4A5MA 4ENKA 1OJLA 1F36A 2LR8A 1QGPA 4ZYAA 2X0LA 3KIOA 3LSGA 4F3QA 2GLEA 3HUGB 1K6YA 2VKVA 2XC7A 2VJJA 1R1VA 1UHUA 1K78B 3DTIA 1V5FA 4OJPA 4PZJA 1T8EA 2W7PA 3OHAA 3BS5B 4ELUA 5D49A 4C8LA 3G4SI 2BGWA 5E1WA 2QQBA 3CJRB 4XKCA 1QQ7A 2Y2ZA 3V8LA 2V79A 2ID3A 3AKZA 1QU3A 2LYCA 1IGNA 2GXAA 5E20A 2KISA 3UQ2A 5EGOB 3WTTC 1W5SA 1W36D 2W9AA 4ECXA 3G6VA 3SQIA 3KEYA 3Q3SA 3S14J 3G6YA 3N4MB 3LVVA 1NK8A 2JPCA 4NM2A 1MMDA 1L7NA 3OPXA 2R8KA 4EJOA 9ICXA 3T8RA 1PDNC 1A36A 1NJWA 5DGAA 5F08A 1Y88A 3WKBA 2DDBA 5TISU 4XRSA 8ICZA 3RBDA 4LVSA 3TGNA 2ICWG 2ISOA 2HCFA 4ACOA 2ME6A 2NVXJ 2L7FP 4CZZA 1TTYA 3EWAA 1XGMA 1JUMA 2M4GA 4DSKA 4EX7A 4A5NA 1TK8A 2OXOA 3HG9A 3W3CA 1N2XA 2R7VA 2HHQA 2GAUA 4JX6A 3BR0A 1D0ZA 1E3HA 4O3SA 1LVHA 1QPMA 3QNMA 3OOPA 3S8PA 3A0HU 1VF9A 4RAYA 4EX6A 3KHLA 1HSTA 4OIQF 2CW7A 5J3LA 5M3MJ 3CJNA 2BQ3A 4E7ZA 4UHTA 1ZHFA 3LDAA 1T6SA 8ICTA 1R5GA 1COKA 1D3YA 1NZPA 1ZJNA 5J4VA 4S0HB 4EJTA 2OTJI 3WKAA 4YG2F 8ICFA 2ASLA 1XGOA 2M5WA 4BY1J 3SJMA 1XC5A 2NO5A 3QU7A 3BQZA 5KFRA 2F2EA 1YX3A 4YIRX 4Q44A 4DO9A 1GUUA 3BDPA 1RZ4A 1XD7A 4IHTA 2WB1F 5L1KA 4I99C 4G7OF 1BNOA 2HTSA 2L9SA 4YXJA 2M87A 3PO4A 3PW4A 4E70A 4NJ8A 2EZZA 4NL9A 5HNKA 1N56A 4IR9A 8ICIA 2P7CB 1TAQA 2DQNB 2EFPA 2HFHA 4QIWN 3RJJA 2Q2EB 3IG8A 4ZJZA 3PW2A 5AIAA 5J0TA 2BHNA 4OINF 3JREA 2BCSA 2ELHA 4JK1A 3AG4H 3P9CA 1RZTA 2P5VA 3L2UA 2GWSA 1EH6A 1JHHA 3WTUC 3MD2A 5BMZA 3AQFA 4IL6U 1OPCA 5HP4A 2W43A 2XPVA 1SC7A 1AKHA 4FTHA 2BHYA 4OCZA 2YMMA 3BROA 3RB6A 3FKJA 4G6DA 1OISA 4XBFA 4XA5A 3QPTA 5ALSA 3V6KA 5LBQA 3LFKA 3MR5A 2H1KA 3N97B 3NQOA 4HW0A 3MGVA 3QU9A 3ASOH 4ZYDA 1LB2B 2V1NA 3W2VA 3ISBA 3TFSA 2FEZA 1B9NA 1KQ0A 4M9XA 2E7XA 1YIJI 3CYMA 3WG9A 2Y0SN 1XX5A 4QPQA 1WJAA 4EEFG 5FGMA 2XCAA 1DP3A 4CCHA 2VT3A 1UMQA 3ZMSA 1Y1WJ 2JRTA 1TBXA 2K86A 2FJ1A 4LLGF 2K9NA 2IW5A 4F71A 1ON1A 4P0QA 3MDCA 4V2FA 2ZJQF 3BQYA 1W0UA 1I6XA 1QQIA 4KTQA 4C3IJ 2CQKA 4M9LA 5KFVA 1Q8KA 3T0YA 2P35A 1KU7A 2GH1A 4IR1A 4D0PA 4KLUA 1SWWA 2R7TA 3VSKA 2EDUA 1MQ2A 4Q47A 3TP0A 2G0AA 3PMLA 3HPHA 1IN5A 5K5OA 4ZDLA 4J9NA 4QJFB 1Q3VA 4Y4RA 2R0QC 1GT0C 3CC7I 2QVOA 3OR1C 4BKXA 3HOXJ 3QZ7A 4ED6A 2O8XA 4XLPF 3BZKA 3MBYA 3W2AA 4XOPA 3BG6A 2X1EA 3DKWA 3FXJA 1R1TA 1SD5A 5BNGA 2COBA 3FXQA 1T38A 1POGA 1LPQA 1X9XA 3PSTA 4DOZA 5AICA 2JGAA 5ALKA 3FZVA 2WB1C 3UMGA 2OC6A 3JRDA 2LG4A 4P0QB 1N62A 1PP8F 2F44A 4HX4A 3I53A 4BUPA 1UHSA 2Y9YA 5CQGA 1SL0A 4YR2A 1O08A 2MC3A 4UUVA 1XNSA 2QM3A 5KFOA 4AYBN 4M73A 2PFNA 1OYIA 3K75D 2JA7J 1MJBA 1O57A 2ZCWA 3RB0A 1Z3XA 2PMZC 4M3DA 3GTOJ 4RLFA 4B9LA 1HW1A 2DF4B 4I2JA 3LSIA 4DBRA 3HDDA 3MKZA 4IHXA 2XAHA 3HSRA 4HAMA 5B66C 3OYHA 4AIJA 2HBJA 3TANA 5CKTA 9ICUA 2XIDA 4R8UB 3W6JB 5GPAA 1LDKB 4C8MA 1AHDP 1HDDC 2FD5A 2WWYA 3KOOA 2W8KA 4CF5A 4LB5A 3DCFA 3F9KA 2RV8A 4AM3A 2XAQA 3I0TA 2Y1JA 3SV3A 1Z9CA 1MH4A 4Z6YA 2E8MA 3H1CA 3GFMA 1KQ9A 1BI2A 2M45A 4MEYA 1S3JA 2FLLA 3HHGA 1U0JA 3HOSA 4IRIA 5HMLA 2ZJAA 2VC0A 1TT0A 2X6YA 1K4TA 1X1CA 2XGXA 4IVNA 1NNLA 4MF8A 4OD0A 3OYCA 3HYIA 1SFKA 9ICBA 3SDGA 2R5YB 2LYHA 4ON0A 2KVCA 4LLLA 5G5HA 2HGCA 4D9JA 4KMOB 3EUHC 1HJPA 2AQ0A 3JSPA 4MGRA 1STZA 1WKMA 5FLVA 4C80A 2XGCA 5B3SH 1A04A 3BTLA 4ED2A 3T8TA 5KT2A 3OYDA 3HJEA 2B21A 2DWQA 2ZJ8A 1BIAA 4PZNA 1JTXA 3TADC 4UAZA 2IEKA 1RDFA 1Q3UA 8ICGA 9ICSA 1D1AA 1G6NA 4PJJA 4A3CJ 7ICMA 4I02A 3C23A 3PZPA 2GOMA 3UXPA 1O03A 3JRCA 5LRRA 2LP0A 3FISA 2E60A 4XKVA 4AU7A 2LRDA 1JIHA 1X6JA 2FE9A 4F8RA 3PY8A 3SZPA 1A5JA 2JR5A 2W85A 5KG6A 1RQLA 4NNJA 1ACIA 2RN7A 5C4XJ 2CSOA 5KFEA 1T98A 5IOZA 3JSOA 3SFIA 5IIKA 5KT3A 2H8RA 3LSTA 4XRFA 1FC3A 3WU2U 2JZBA 3ZDEA 1L3SA 2JVGA 8ICUA 2GOLA 1B4FA 2NVQJ 2YB4A 2DYSH 3OIQA 4RB2C 4CYCA 3PNTA 4O5VA 4IZZA 5AIQA 3CMAI 3OTQA 3QU2A 4JMUA 4RQ6A 4CRXA 1PUFA 3L1PA 3LA7A 4XL9A 5F9LA 1DGWY 3F2BA 1F5SA 1U48A 1O7FA 1TK5A 1JXSA 4DYRA 2TRTA 2KJ5A 1BPDA 1ZQYA 2R7DA 2W82A 1LE8B 1ZYRF 1YW9A 2YMPA 5AM3A 3I4PA 4X1EA 2UWMA 5KAFC 1OYYA 3FHNA 4KJZA 4A3LJ 2WAQC 2OM6A 5ALWA 2NYXA 8ICRA 4A3KJ 1Q46A 1KGSA 4HV5A 2LYAA 2ZTCA 3IWFA 4CCMA 2ZIVA 1MW7A 3JPSA 5EDNA 3ZQQA 2IT0A 2ZFUA 1KDHA 2IS1A 4BGDA 3WKEA 2I1QA 5AKXA 4OWRB 3EYIA 3SAFA 1QQ6A 2HOFA 4EEKA 5ICFA 2DMPA 2LD5A 4F4YA 3QEAZ 3DPTA 3DBHB 4M6VA 4AVPA 2AXTU 2HVHA 1MBFA 3O6BB 2L5QA 1FX7A 2EJRA 3K4GA 4GYIA 1V97A 5ALPA 4QZGA 1NK0A 2P5LC 4RQNA 2HXOA 3CZ6A 2KEYA 2KHVA 2XROA 5FRNA 1IDZA 5J0RA 4TV7A 3QP6A 4RM3A 3JPNA 1I6HJ 3HOUJ 1T7PA 5LHHA 3Q8MA 8ICKA 3H3UA 5HLHA 2HEOA 2KIUA 5JHFA 2OUMA 2NVTJ 3DPLC 3IN5A 1I5ZA 1U49A 4I28A 1FMVA 2FNPA 4EVIA 4ZC3A 2HVIA 5M5WJ 3TADA 2EIJH 2BY1A 2MG4A 1S7EA 2ECCA 3ZXSA 1EJ9A 4V19K 2M34A 4WX9A 2BR0A 2OA4A 1GVDA 4XORA 2KV2A 5ALNA 2EH9A 1RUNA 4JV1A 4GC7A 2DKXA 2A05A 3FAHA 3DBLB 2H6CA 1SD4A 4Y13A 2L7KA 4F92B 3EPGA 2C22A 2R8JA 5CQEA 4YQWA 3M8EA 3GV8B 1FMWA 3E5XA 4NC8A 3S2WA 5B1AH 3B6AA 3MEXA 5EGOA 3OSNA 4DSFA 4I2FA 8ICOA 3Q8QB 1XCVA 2HOAA 3EDPA 3ABUA 4BQOA 5IYBJ 2J6SA 2MW8A 3HBLA 4PSWA 3MKWB 3CCMI 1B1BA 2KPMA 1O3SA 3R0JA 5J0QA 3PM1A 1FFVA 2PMZA 3EUKL 4WXHA 5FO5A 2IAIA 2M0MA 1BOAA 1TT5B 3R60A 1VQPI 1BJZA 4IF4A 4EZ6A 2DQLA 4W97A 3TEDA 3M8JA 2OHFA 2PN6A 5L1MA 3FX3A 4ASNA 2ZUCA 3KZIU 1D0XA 2EH3A 5CHGA 1JX4A 4GXKA 4M6YA 2VQHA 5L3EA 2FRHA 4UB8C 3HM5A 5B5EU 5C5JA 5CP2A 8ICWA 2XRNA 4U7DA 4U7CA 3HTUA 1BIBA 2E35A 4NDLA 2BDPA 4BACA 4DSIA 8ICYA 3QP5A 1JHFA 1FIAA 2DTZA 3K1RB 4G94A 5DCMA 5ALIA 1W7PD 2R5ZB 2KJCA 3WK4A 5AKYA 4BL0B 7ICOA 2GM4A 1UFMA 2DA5A 2J5OA 4UVBA 5KFDA 3K1NA 1FBUA 2MYSA 4LIVA 4XN0A 3PO3J 4BQQA 3KHGA 2DKZA 1L3TA 4Q8FA 3SV4A 1HXDA 3GQCA 1KRPA 3QOPA 5F64A 4RU9A 3C28A 3ICXA 1LNWA 1UG2A 1N61A 1L7OA 2HDWA 2FE3A 1X1AA 2VPRA 3DWLE 4XLCA 2M7AA 2UUZA 4U0YA 3QUTA 1R4MB 1P7DA 4DJAA 3LK9A 4KISA 4UB4A 1BM9A 2Q0OA 3HRTA 4IS7A 4CE6A 1T56A 1NK7A 4G7HF 2D1HA 1BA5A 3KD3A 5AM1A 5ALTA 3RJHA 7ICFA 4C8NA 4G6QA 2IGKA 1KFDA 2FQ3A 5CLSA 4KITB 3DU6A 2FPLA 2HMXA 1LKYA 2PFPA 2HQRA 5FKKA 1IRFA 3L00A 3K2AA 5J8FA 4G9BA 3ZDCA 2AGPA 4YP3A 4YRVA 2E1CA 2A6TA 3PIOF 1DK2A 3AG3H 2CUZA 3CF2A 3S2DJ 3KYCB 3IRRA 4M3GA 1HKTA 4B1RA 1MNDA 1I3QJ 1ZGJA 2P7VB 2QGUA 4PCQA 4ZYEA 5IPAA 2Y9ZA 4DFPA 2KZZA 4R1HA 4I2AA 2GWRA 4I2DA 2RREA 2ESHA 1QRYA 3I54A 4HAIA 4KN7A 2Y1IA 4IQ4A 1ODDA 7ICUA 4B8XA 2MABA 1K78A 4RQ8A 3GFIA 3IWZA 3QYEA 1IC8A 3S2HJ 4C0ZA 4QZIA 1P4AA 3DKYA 2DA3A 2NVYJ 4RT2A 2OAZA 1BPYA 2IMWP 3HOTA 1JRPA 3O2PE 4MNUA 4OO1J 1IN4A 3FXUA 1USSA 2BBYA 2PJRB 3KFUF 2KDZA 2E36A 2FSWA 5EEGA 2LI6A 2YSRA 1T8IA 4KLLA 2D3DA 2DJIA 3PNVA 1DQUA 3GCMA 2B9SA 3QEBZ 3V4GA 3C5GA 1VQOI 2W25A 3TACB 1HUZA 5ALZA 1XSXA 4NBQA 1S5LU 5AKIA 4GIBA 4FCYA 8ICHA 4IQJA 1WUDA 1D5YA 4QZCA 1MBHA 1IXRA 1QH9A 3UNGC 2WTFA 1JJ8C 4JX5A 1FTTA 1XO1A 4KIGA 2R3SA 2B6GA 9ICJA 4FHTA 2KMDA 2JRZA 2HOEA 1R00A 3K2ZA 3HKZC 1DPUA 3DEEA 3WE3A 2WF9A 3AM9A 3NGDA 2IHNA 2IOHA 4DZJA 5HS8A 1Z00A 3H9QA 5AKZA 2BGCA 2CGPA 4MEXF 2HHXA 2XCPA 4R63A 3S3MA 5J2CA 1Z67A 5C3EJ 5ALLA 1TWAJ 5HNFA 3OYJA 4A3IJ 2DA6A 4KLHA 1XDSA 4NY8A 3MKLA 2HKOA 4PJMA 3IHQB 4YG2A 2PBIA 2B0LA 2K9SA 2MLGA 4MFDA 1HOMA 3ZGKA 4QZHA 4WF2A 1SKSA 1RYSA 3O8HA 3QAHA 4BUGA 5HODA 9ICNA 3LFUA 2L7MP 4IPAA 3ZQ7A 3BJAA 1YZ7A 2JH7A 5H2FU 3F2DA 1IXRC 4OIRF 2J6TA 2XC9A 1Y56A 1ZQUA 3C2KA 1FPQA 2H27A 3GZ5A 1V5GA 5JLWA 1A6IA 3GTMJ 3BOQA 2NNYA 2ZIWB 5AHXA 3IP4B 3OYIA 3CMMA 4BU2A 5AI6A 3TFRA 3KLNA 4L5IA 4FO6A 2CV1A 4L5EA 3FBIB 3PX4A 3LSKA 3Q8KA 1RR7A 3DXJF 1F0MA 1BR1A 2ME0A 4J9SA 2ES6A 4XICA 4XSXF 4EM1A 1SEUA 3GIIA 1KQQA 2LTPA 1XMXA 2IHMA 3CRXA 4RS8A 2CPRA 2DA4A 3RAQA 2KN7A 4EATA 4P1WA 1SAXA 1WH7A 3V8JA 1OKRA 8ICEA 5TJJA 2NNNA 4XSZF 5F0CA 2CO5A 4E7IA 3ZDDA 4FS1A 5H2FC 1YYVA 4U87A 3NVVA 2HKXA 1YRNA 1K61A 2DK8A 4MHGA 3WU2C 3MR2A 2ZC2A 2DFFA 5A2QZ 4C7YA 4PGYA 4UQGA 3FDSA 2L0KA 1WJEA 3U1DA 1XTAA 2V4RA 1H88C 2YUSA 4BYYA 3IKVA 3VEPA 5K5QA 3S17J 1ZRNA 5KFHA 1HW2A 4UBBA 3UQ0A 2GZWA 2Z2SB 3D2NA 1NOMA 2P0WA 1R5ID 2IGMA 1F4KA 3CNHA 4C4RA 4EMSA 1S76D 2JH1A 3TMOA 2QSFX 2RQPA 4BHPA 1IRZA 1WH5A 2P4WA 2WAEA 2CJJA 4A69C 3CMEI 1R9TJ 1F43A 2KHMA 1FFUA 1FP1D 5FKNA 3ZPLA 2AGOA 3GO5A 3J7AO 5C0YA 1BNPA 1MMAA 2AQEA 3JW4A 4DW6A 3E6CC 3OYFA 4FZMA 4QNLA 1TP4A 3J81Z 3LNQA 4K4GA 2W84A 3SZGA 4CCNA 3KBBA 3JRHA 1U8BA 4RM2A 4Y2YA 3RAXA 1REPC 4S04A 1XSVA 4KYWA 1QSYA 1CI4A 1ZQ3P 1MA7A 3BG7A 2HYGD 4S05A 1JALA 3GDXA 2DODA 2Y30A 3ABMH 5KL8B 1WWXA 1TQMA 2YX7A 2N1RA 2W04A 3Q8RB 3BPXA 2IS4A 3OIOA 2CV2A 4MQVA 1FP2A 3RH5A 2DMTA 1S0NA 3NASA 4LIUA 2PI5A 2BPGA 2KIWA 5AK5A 4ECSA 2XPWA 4GC6A 5H6RA 4ECTA 4GXJA 3RKYA 3DKXA 3J7ZI 1UT5A 1PP7U 3M1CA 4J9MA 1U78A 4QZDA 2PFBA 1ZTRA 5EG0A 2P6RA 5AIPA 5AM2A 1ZLKA 4PDKA 1YS7A 2H3ZA 3MKYB 5GAGJ 4ED0A 4KLOA 3HC7A 1J2XA 1X42A 4YVZA 4CYDA 2K9QA 4KT5C 2VA3A 1YQAA 4PL2A 3DF8A 2E2HJ 4N9IA 5KFSA 2DU9A 2W9BA 3TI0A 5KG7A 2XHKA 2K02A 1CUKA 2HQNA 1E3PA 1RIOH 2O61A 3T5KA 3RRGA 1GVJA 2RRDA 3HIFA 3VCBA 2PMZN 4HSRA 5TGTA 5H20A 4KN4A 5D5UB 1QQ5A 2DFLA 5KT4A 3JPTA 4C4SA 4AD9A 2OCCH 3ZCOA 4U0WA 2DPIA 1WG8A 1E17A 3RJIA 1PUZA 3F8MA 5J0WA 5EE1A 3HX0A 4WXCA 4PGGA 3I76A 1JUDA 1HIWA 1TK0A 3SYTA 3GTJJ 1KONA 4CCKA 2LK2A 1HC8A 2A1JA 5KT6A 2E1MB 1KU2A 2I5HA 5F1RA 1ZQOA 1YW8A 3TDZC 2NRZA 1QTMA 2B0CA 2JEIA 1W4MA 3JRBA 4US8A 2ODGA 3GF2A 4DL5A 5EEHA 2NS7A 4PJ0U 2A6EF 1ZQEA 3GW2A 3M8RA 3T1BA 1XSDA 8ICMA 2UZKA 4BJQA 1FT9A 3RYPA 5LHIA 1X2MA 5KNLA 2O6GE 3GTLJ 2E1NA 1GHCA 1ZRMA 2E3TA 1Z1BA 2F48A 1OUQA 4R8HA 3KZZA 4XOTA 4XRMA 4BEHB 3VYUB 3H9GA 4DEZA 2LKXA 2DO7A 4M74A 5F6FA 2ZXHA 5IT9Z 2X48A 3ZMVA 4DL6A 4D5FA 4DLGA 3MVPA 2PMZF 5L1IA 2FU4A 2QARA 2ZIUB 1S7AA 1I39A 2MD5A 1TL8A 2LOOA 2IJLA 1UHMA 4NC7A 2FOWA 2KIFA 2E2JJ 1X1PA 2ATLA 1RQNA 5EWGA 1N75A 4AWXB 1Z3YA 3CUQC 2AHOB 3H0MB 2IA1A 3RQIA 3RFAA 4UB8U 5BOLA 2ZBKA 1SIJA 1Z1VA 1Y6IA 4P9UA 2FLNA 3IH3A 3NEUA 4B48A 3DP7A 5LEJA 4Q4ZF 3SEZA 2IOFA 2DJNA 5DKWA 4MEXA 3BR6A 3GIJA 3CCRI 4AIKA 2O9LA 2ELJA 3GZNB 4M9ZA 3SFZA 4M3BA 2W11A 4A3GJ 3H5RA 3OHBA 2XB0X 3HRDD 2CUEA 2PJPA 3B0XA 1A31A 9ICPA 1XO0A 1BVSA 5FB2A 2Y69H 2VC1A 4MEYF 3TBIA 2QLZA 3H5AA 4I01A 1ZJMA 1I1SA 1ZN2A 1OR7C 4I2OA 2HDOA 1FBSA 1BI1A 2FMYA 3AQEA 2W7OA 2KQRA 2DOEA 3M8FA 5B1BH 3CC4I 1ZQFA 1XG1A 4BS9A 1X9MA 4L0ZB 2BPFA 4F93B 4J9OA 2JA8J 2MAXA 3NVZA 1V4RA 2DFIA 2A3VA 2VOOA 3F8NA 5KFFA 3MFHA 1HQCA 2HHUA 5HHHA 2WHEA 2YMLA 1ULYA 3A2KA 3PSFA 1ZQCA 3ZDBA 3E7LA 3WKCA 5KFBA 3H40A 1E0EA 4O0IA 1SKWA 2CG4A 4J9RA 2IP2A 1L3UA 3PUBA 7ICKA 3LAPA 2CQQA 3P7NA 3L2RA 3SAHA 2F5CA 1KA8A 5IT3A 1L3LA 5AM5A 2W3SA 4HX7A 1XSNA 4IRDA 3LA3A 4RQMA 3CJTB 3KPHA 2F76X 2I6XA 4DL3A 4FFDA
chains in the Genus database with same CATH topology
4RMNA 2XIDA 2K4EA 4ANJA 4WJ3B 1GLNA 1LDKB 4B3XA 4LITA 5CRXA 2XF5A 4DIQA 4XLAA 3F9KA 4E7KA 3RF9A 3F5EA 2HBMA 2E5ZA 1QHHD 4BE1A 1U0JA 3HOSA 2JMGA 2W1OA 3TL4X 1TT0A 2X6YA 1X1CA 4F55A 4CH7A 2CH0A 2L9NA 3BCBA 3PL8A 3OYCA 1SFKA 5FROA 4CDGA 2KVCA 4KMOB 4D9JA 1IIPA 3EUHC 2BOLA 3NWSA 2DXIA 3OR2C 2E5NA 2VIXA 4CZCA 4HNTA 4XKWA 4F91B 3K4KA 2CUJA 4OAZA 3SMVA 3OYDA 4J00A 2WAQA 1Q3UA 3DU5A 2RHFA 2HNHA 1D1AA 4PJJA 2O5RA 2X85A 4FASD 3F2CA 3PZPA 4ZDOA 2GOMA 4FETA 3O0FA 4AU7A 4XKVA 2E60A 2LBFB 2LRDA 2W4SA 2E1MC 2K3PA 2CRXA 3KX2A 4ZTFA 1BR2A 4NNJA 4XN3A 1BOBA 3NUQA 2LC2A 1R6RA 2QKMB 4OJ5A 2XDVA 1P9QC 2JVGA 4OJLA 2GOLA 3VSLA 4OJOA 3RSNA 2YB4A 3OIQA 2JVHA 2M4KA 3PNTA 4IZZA 4JMUA 4CRXA 2ZIWA 4XL9A 1ERDA 1DGWY 2AQFA 2K9MA 2ZIXB 4PL1A 3F2BA 2HZDA 2KJ5A 3S3NA 1SAUA 3PJRA 2VQGA 2GOXB 2W82A 2XAUA 2HU9A 3NRWA 2UWMA 4BX9C 4PK4A 3FHNA 4KJZA 2WAQC 2OM6A 3AFHA 4JOMA 1JI8A 2LYAA 2IS2A 4CCMA 2ZIVA 2CV0A 1MW7A 3ZQQA 2CW8A 4HEA2 2ZFUA 2IS1A 4BGDA 3ALRA 2HOFA 3EPZA 4OWRB 3SAFA 3VYSB 4A8EA 2VQCA 3DPTA 2MC4A 4DBQA 2L2OA 3OYBA 2Y0SC 3N7SC 3K70D 2L5QA 3VYTB 4BQNA 2NV3A 4PFOA 4C30A 2K5CA 3IUOA 2KHVA 3CZ6A 2KEYA 4AVZA 2DT6A 3CP8A 5FRNA 5HR7A 4E7LA 4RM3A 4B47A 1WJ5A 3D5RC 4ZDPA 4HRIA 3ONQA 3K10A 2G08A 2G09A 3OYEA 1N77A 2VKDA 3C2HA 2DOAA 3L2QA 1TZLA 3IN5A 5JHFA 2OUMA 1PVPA 3DPLC 2Z7JA 3DQVC 1FMVA 3OS2A 3OYLA 4ZC3A 4IKFA 3OL4A 2ZIXA 4XNFA 1EA3A 2KMUA 4FZLA 3ZXSA 4CGZA 1D8BA 4XM3A 4XORA 4NQWB 3OYKA 2JUGA 2KV2A 2Q4TA 2HBKA 4BJTA 4C2TA 2XI9A 4QIWC 4F92B 2L7KA 5CQEA 2K4HA 2CN1A 2KNJA 1D1BA 1D1CA 1FMWA 3K4NA 3H35A 4NC8A 2ZIUA 4P0PA 4P5OA 2R7SA 2K9LA 3J7AY 2R7OA 4BQOA 1LVKA 1UG0A 4U6PA 1WJBA 2HVQA 3HPGA 2KRCA 4PSWA 3MKWB 2KPMA 2LBOA 1A6SA 2IXSA 2PMZA 3EUKL 3FBNB 2VPLA 2M0MA 4XONA 3OS1A 1X19A 3DLAA 5KCMA 3OYAA 4AYBC 1HA8A 3S93A 3M8JA 3OWTA 3N7PD 4N4OB 1MMGA 2K4IA 2ZG6A 1D0XA 4FE3A 1N78A 1L6NA 3QYBA 2VQHA 3GBGA 4BE2A 2KOBA 2H3FA 4XQFA 3RQ4A 2ZSHB 3PSPA 2JSPA 4U7CA 1LFPA 3A4CA 2JA2A 3C29A 2RQQA 4BACA 3PNYA 2D6FC 2ZSIB 2LH9A 2HOIA 2DT7B 2KLOA 4XMYA 3DTEA 3G2BA 3E1SA 5HNHA 2VKQA 4BL0B 1WJCA 2DGZA 1AA7A 2MYSA 4XN0A 3HKZA 4LIVA 2QKLB 4BQQA 2K8AA 2YB1A 4AYBF 3OY9A 1DRGA 2MD0A 1F44A 2A5WA 3PSIA 3C28A 2R7UA 3ICXA 3NWTA 2HDWA 4XLCA 1X1AA 3DWLE 1SZHA 2M7AA 2UUZA 2VJ5A 2G07A 2LYBA 3LVWA 4DJAA 3PFYA 1P7DA 2IGNA 1QHGA 4KISA 2X1CA 4CCJA 5HLTA 1X1BA 2XICA 3DPUA 4N4NB 1OLTA 4CCOA 2YX8A 2WBMA 4CSWA 4B43A 2UV1A 2IGKA 4O3MA 5HR6A 4KITB 3DU6A 2HMXA 4XLHA 3M6ZA 2X1DA 3M6KA 2W7NA 3BC8A 3L3FX 4E6KG 1DGRM 1T95A 4YRVA 2PJRA 1PJRA 4XLFA 2A6TA 4KT6A 2LY2A 2CUZA 3HKZF 3CF2A 3VC8A 2H3IA 1MNDA 4ITVA 3QODA 4QIWF 2E1EA 2RREA 2G06A 3H5NA 4IQ4A 4OAYA 2M3AA 2W00A 2MABA 4E7JA 3L2WA 2RNGA 2WY8Q 3QYEA 3OS0A 2KJ8A 4C0ZA 2WA0A 3DKYA 4H4KC 3MMYB 4PFPA 2Z1DA 3HOTA 2OYYA 2W03A 4OO1J 2Z16A 1MMNA 2PJRB 2K8BB 4ICAA 1Z21A 3KFUF 2DJIA 3K4CA 1DQUA 3CP2A 3PNVA 4PUSA 4E4HA 4J01A 3F5AA 3KZXA 2V6EA 4NLCA 3D5SC 4IQJA 1WUDA 2KL4A 2NOJB 3UNGC 4Y3OA 1Z7LA 2XSJC 2WY7Q 2KRHA 2VXDA 3U21A 1ECWA 3HKZC 3DEEA 4X0GA 2HPIA 3H9QA 4PJNA 1YE9A 3S32A 1ZELA 1PVQA 3S3MA 2KJ9A 5HNFA 3OYJA 3K4LA 5CPRB 2KD1A 2G5HB 3M7DA 2FUG2 4PJMA 2OV7A 1URJA 2R18A 3OYNA 2F5VA 2BW3A 3E0JB 4II2A 2VXZA 3ZGKA 3OYMA 3AL0B 4BDZA 5HVQC 2KZVA 4BUGA 2IGOA 2F8LA 2H3VA 3LFUA 2R7QA 3LMMA 1PYVA 4IC9A 2JH7A 2F77X 1KBUA 2KP6A 3F2DA 3OMYA 4HSTA 1Y56A 2ZXIA 3EUAA 2LHTA 1V5GA 2BVMA 3FDYA 4F52A 4CA0A 2Q1ZB 2HVSA 3T79A 2ZIWB 3IP4B 3VYRB 3CMMA 3RTRA 4BU2A 1NG6A 3OYIA 3LL7A 3N05A 3LSHA 1YX5A 3K6GA 4E7HA 2X6XA 2CV1A 4XKBA 3FBIB 2MRLA 4OJ6A 1S9HA 3LSKA 3OL3A 1BR1A 3ZRGA 1D0YA 4KX3A 1VZ0A 2R7XA 4C2UA 4PSXA 2MA1A 3CRXA 3LYSA 2CPRA 3BLYA 2VASA 4EATA 3C2GA 2CFOA 2XF7A 3BCAA 4P1WA 4QPOA 3V42A 2K89A 5FRMA 3H0RB 1ZQ1C 4E7IA 1T94A 3W2WA 4JQFA 1T0FC 2RP5A 3N7RC 2V7FA 4U87A 3D2SA 3HL2A 4PJLA 3K4MA 2JHDA 2BW3B 3HXLA 1NG7A 1WJEA 4YELA 4AYBA 4HNUA 2I8DA 5A0LA 2KICA 3RCOA 3IAM2 2VKHA 3L2VA 4XLEA 2Z2SB 3D2NA 3OIPA 2P0WA 2IGMA 1UELB 2HBLA 4HG2A 2JH1A 3TMOA 4YEJA 4ZYAA 3LSGA 4F3QA 2WAEA 3HUGB 1K6YA 3LSMA 2XC7A 2VLAA 1WJDA 3GU3A 2KHMA 2VJJA 5C0YA 1G8XA 2CS3A 3DTIA 1MMAA 1V5FA 2AQEA 4OJPA 2H3QA 2W7PA 3OYFA 3SAGA 4FZMA 3F53A 4QNLA 2V4JC 1X4OA 2Y0SF 3CJRB 4XKCA 3SZGA 4CCNA 1G59A 4RM2A 3AKZA 3UR3C 2LYCA 1QU3A 3IAS2 3H0DA 1MA7A 3BG7A 2LREA 5KL8B 1W36D 2N1RA 2W04A 3SQIA 3KEYA 2IS4A 3LVVA 2CV2A 4NUBA 1MMDA 2XVTA 3OPXA 4LIUA 2KIWA 4GRIA 1PVRA 3DKXA 3M1CA 2KKVA 4ACOA 2H3ZA 3SDBA 2M0NA 2M4GA 3MKYB 3HC7A 2F6CA 1ED1A 2LKYA 2OXOA 3HG9A 3W3CA 2R7VA 4IX7A 2X6WA 2HVRA 4PL2A 2KDOA 1D0ZA 2HOQA 1TAMA 2BVLA 4HPQA 4RLQA 3AL0C 3S8PA 1NZBA 2VJ4A 2CW7A 1J09A 4FZNA 4E7ZA 2WB1A 2CMPA 2RRDA 3VCBA 3CJQB 4HSRA 5TGTA 1HEKA 3K4BA 4ZTJA 4BDYA 2VB6A 1BR4A 3ZCOA 3VDXA 3S3OA 1YX3A 3CESA 1W36C 2WB1F 3D2QA 2L9SA 4Y33A 3K4JA 1HIWA 4C9YA 3SYTA 3K70C 1KONA 2V9KA 4CCKA 5HOOA 1V5EA 4BXFA 2E1MB 2DQNB 4P0PB 2DCEA 2Q2EB 3IG8A 2VL8A 4ZJZA 2R7WA 2BDUA 4GFJA 3E0FA 3A1YA 2WAQF 5LD2C 2M7BA 3QYFA 3L2UA 1YT3A 2HPMA 3MD2A 1WFXA 3AQFA 2R7RA 2X51A 3H0LB 2MFZA 4BJQA 1X4PA 2F2AB 4CCLA 3IG5A 3OOUA 5KNLA 1Z1BA 2LY1A 3FKJA 3GZFA 1OUQA 4BE0A 3DTKA 4XOTA 4BEHB 3I9V2 3H9GA 3VYUB 2KKPA 3MGVA 2V1NA 3W2VA 2ZXHA 4LG3A 5KHDA 3H9JA 3K1ZA 2PMZF 2Y0SA 3CYMA 2ZIUB 3QOEA 4QPQA 1WJAA 2LOOA 1WJFA 2XF6A 4NC7A 3SEQA 3D5LA 1DP3A 1GO3F 2IS6A 1N75A 1Z3YA 3H0MB 3RFAA 2E1FA 2LBFA 2R4GA 2WADA 2K8CB 1CRXA 4P0QA 4U7BA 1Y6IA 1MNEA 4B48A 1IRXA 2E5SA 3SEZA 1LKXA 2GH1A 4NLBA 3ONNA 2VJIA 3VSKA 2R7TA 4BEHA 2G0AA 2KHQA 1Z19A 3HPHA 1UAAA 2ELJA 4ZDLA 4QJFB 1Q3VA 4Y4RA 4NWIA 3H5RA 3OR1C 2VQLA 2V26A 3W2AA 4XOPA 3BG6A 2X1EA 3OYGA 4DGWB 4BJ6C 1XO0A 2OH2A 3TBIA 3H5AA 3PSTA 4DOZA 2JGAA 1OR7C 2W7OA 2WB1C 1A0PA 4CUGA 3AQEA 2OC6A 2KQRA 4MLOA 2LG4A 4P0QB 4BS9A 2WAFA 3KYLA 4F93B 5T14A 4BUPA 4KX5A 5CQGA 2A3VA 3VWBA 1UPHA 4E7SA 2HBJA 4NV0A 1XNSA 3RPUD 4B44A 2ZIVB 3A2KA 3PSFA 4XR6A 4D1QA 1E0EA 1Z3XA 3PUBA 2PMZC 4II3A 4RLFA 4R79A 3L2RA 3SAHA 2G5IB 2DF4B 5KL1B 3I3LA 2HQAA 3LSIA 4DBRA 3MKZA 4BJ5C 3ZR8X 2F4IA 1X1DA 4G6TB 2F76X 3OYHA 5LFAA 5CKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFU F;  2D6F C;  2DQN B;  4WJ3 B;  3H0R B;  3AL0 B;  1ZQ1 C;  2G5H B;  3H0M B;  3H0L B;  2F2A B;  3IP4 B;  2G5I B;  2DF4 B;  1NG6 A; 
#chains in the Genus database with same CATH topology
 1OCO H;  9ICI A;  5E8I A;  5CYV A;  2K4E A;  1GLN A;  4UB6 C;  4RQ0 A;  4M3F A;  1W7P B;  1OCZ H;  2XF5 A;  4Q48 A;  4ZZD A;  5LRS A;  2QKQ A;  4EEL A;  4DIQ A;  4YD2 A;  2ZJ2 A;  4XLA A;  2HHV A;  5KT7 A;  4E7K A;  2STT A;  4JK1 X;  2OZ6 A;  4IRK A;  3RH6 A;  2D45 A;  4A0X A;  2BY0 A;  2HXI A;  3LQR A;  1FBQ A;  3JR9 A;  4UBC A;  1DXS A;  5DG8 A;  1B6A A;  5KFU A;  2GA2 A;  4BE1 A;  1ETO A;  1XS9 A;  4YXM A;  1JKR C;  1KFT A;  1ZRE A;  2JMG A;  1BC8 C;  1TW3 A;  3TL4 X;  4QTR A;  4F55 A;  4WWC A;  4CH7 A;  5BPD A;  3RZO J;  2L9N A;  5BOX A;  4CDG A;  1ZQS A;  5FRO A;  1UHW A;  2FNA A;  1MDM A;  3QWL A;  3WTY C;  3VOD A;  1FSH A;  2A1J B;  8ICB A;  3KYD B;  2BOL A;  3JRG A;  2K4J A;  5EOZ A;  4BHB A;  2VIX A;  4CZC A;  3C1D A;  4MHV A;  1PVE A;  2CUJ A;  5K5R A;  3SMV A;  3WK6 A;  1IM4 A;  1U9L A;  3F6V A;  1MH3 A;  5AKK A;  2RHF A;  4O5E A;  1MJA A;  4FAS D;  1D8J A;  3F2C A;  2A68 F;  2BY3 A;  3CCJ I;  2KFZ A;  2DA2 A;  2FLP A;  3ZOB A;  3PV8 A;  4A93 J;  3O0F A;  2LBF B;  1I27 A;  2W4S A;  3AU2 A;  4QZB A;  4K4I A;  2E1M C;  2V4Q A;  3SYZ A;  2LLK A;  3CCY A;  1ZGW A;  1WCN A;  2LC2 A;  3RPU A;  4ED8 A;  1TWH J;  1IAW A;  1T08 B;  5ALO A;  4R66 A;  3FK6 A;  4OJ5 A;  2DW4 A;  1P9Q C;  3TOB A;  4OJL A;  4OJO A;  2MGQ A;  3S1N J;  3PO5 A;  1W5T A;  4Y2P A;  3D0S A;  4M3E A;  4BWM A;  1WCL A;  3KP6 A;  3MGI A;  4NLZ A;  1ERD A;  1ZQX A;  2AQF A;  4QZA A;  2HZD A;  1CF7 A;  2CQX A;  3BR1 A;  3I4M J;  1SAU A;  1L7P A;  4RUC A;  3X2Q H;  5KG5 A;  3QQA A;  4RZR A;  3M7G A;  2HU9 A;  3NRW A;  7ICP A;  1BBY A;  1Q1V A;  1VQK I;  3TO6 A;  3FYH A;  1R5H A;  1L7M A;  4GXI A;  4F4Z A;  1P4X A;  1JI8 A;  2XAF A;  2ZME C;  1BPZ A;  4OMZ A;  4UB5 A;  4H0E A;  1KYW A;  4MO7 A;  3RJG A;  2CV0 A;  1ZD3 A;  2Q8K A;  3HRU A;  5ALQ A;  1OQY A;  1IV8 A;  3ML6 A;  5IYC J;  3CLO A;  4MQ9 F;  2FBH A;  4HEA 2;  1J0R A;  4EBC A;  2F5F A;  2QB0 B;  2PXI A;  2A69 F;  3OSF A;  1ZH5 A;  5AI0 A;  3OSP A;  2A3S A;  4A8E A;  4QZ9 A;  1ZQP A;  2VQC A;  4A3E J;  1G4D A;  8ICQ A;  2NS0 A;  2MC4 A;  3ERE D;  3OYB A;  3N7S C;  4Y2V A;  2JUC A;  2K60 A;  3K70 D;  2PKE A;  2CXY A;  2NV3 A;  4BQN A;  3QU5 A;  4PFO A;  4C30 A;  3FK7 A;  3SXY A;  2DT6 A;  5KFX A;  5J0U A;  2QBY A;  5HR7 A;  1VTN C;  5TZV A;  4E7L A;  1YHQ I;  2IRF G;  5BPC A;  3BJY A;  9ICV A;  3ABT A;  4HRI A;  3ZMZ A;  4C7Z A;  2DMN A;  1K1S A;  4F5P A;  2W57 A;  5EWE A;  3GUD A;  3OYE A;  1X3U A;  3KFW X;  1N77 A;  3Q8P B;  3L2Q A;  2DN0 A;  2DOA A;  4B9V A;  3JRF A;  2Z7J A;  3DQV C;  5BS6 A;  3OS2 A;  2ISZ A;  2ZIX A;  5E79 U;  3OL4 A;  4MIM A;  1YIT I;  4XNF A;  2KG5 A;  3GTG J;  2OQG A;  1KU3 A;  4FZL A;  1VI0 A;  3WOD F;  2R5Z A;  4NQW B;  3OYK A;  3ZQF A;  1LB2 A;  2HBK A;  4C2T A;  4ZYG A;  1TQP A;  2RQ5 A;  2ZO4 A;  1AQ6 A;  3G3Z A;  1DGJ A;  1DK3 A;  4XLN F;  2CN1 A;  4DLE A;  4AC0 A;  1YJN I;  3I1Y A;  3H35 A;  4ELT A;  4P0P A;  4P5O A;  2MUT B;  2R7S A;  3V6H A;  1F9N A;  1Z1D A;  2E1O A;  3CCQ I;  1SXD A;  1H8A C;  2W3R A;  2LKP A;  1QZY A;  1RI7 A;  1UG0 A;  2JPB A;  1X40 A;  5ALD A;  5CR0 A;  2HVQ A;  1J9I A;  4FS2 A;  3HPG A;  2DFH A;  5LHG A;  2PG4 A;  2IBK A;  4O9M A;  3KHR A;  1A6S A;  2N8G A;  2P5K A;  2QWW A;  2M9H A;  3V8K A;  3F23 A;  3WTW C;  2VPL A;  5DG9 A;  1U47 A;  4N9H A;  3LSP A;  4O3N A;  7ICH A;  1RKW A;  1UZC A;  4UNO A;  3KP3 A;  5HS9 A;  3E6B A;  1AU7 A;  4FE4 A;  5KAI C;  3ZD8 A;  2DK5 A;  3N7P D;  1UB9 A;  4RNN A;  3HEF A;  1MMG A;  2K4I A;  5E79 C;  1GXQ A;  1WWV A;  4BE2 A;  4GXO A;  5ALR A;  4OOI A;  3PR5 B;  3TDU C;  3BP8 A;  1V85 A;  4I2B A;  2ZSH B;  4ECQ A;  4R65 A;  4G3I A;  1LFP A;  1P7I A;  4Y15 A;  2HOI A;  2LH9 A;  5ICE A;  2WV1 A;  1MIJ A;  2ZXJ A;  1WHU A;  2PX9 A;  5HNH A;  5K1Y A;  1BN5 A;  2EIK H;  1FWZ A;  2XKO A;  1RKT A;  1FJL A;  2DGZ A;  1AA7 A;  1L3V A;  2EZH A;  4RGX A;  5K7F A;  1ZQT A;  2ISP A;  3HKZ A;  3LQQ A;  3HP6 A;  3ETL A;  2K7L A;  3GV5 B;  3T3F A;  3OY9 A;  5ED4 A;  3TAR A;  1X58 A;  2ISY A;  2IBD A;  3FXM A;  3VFZ A;  1F44 A;  1TC3 C;  3H8J A;  1H9G A;  5M5X J;  3B0Y A;  2MA3 A;  3NWT A;  4F4W A;  2VJ5 A;  4Y2Q A;  3LVW A;  3ECH A;  3KLO A;  1FIQ A;  1QSL A;  5LGT A;  2X1C A;  3QU6 A;  2FPK A;  4L9T A;  5CVI A;  5FKO A;  2BKE A;  4UAY A;  3T5J A;  1D9D A;  2VBX A;  5AK4 A;  2WBM A;  3E58 A;  4CSW A;  1R4N B;  4B43 A;  2HDC A;  1NI3 A;  2EZX A;  5DGB A;  1S9F A;  2BCR A;  1EH8 A;  4UXN A;  2X1D A;  2FJ6 A;  5GTH U;  4DSJ A;  2W7N A;  1X6I A;  1SL1 A;  3BC8 A;  1Z77 A;  2EV0 A;  5KG0 A;  2XY6 A;  2PJR A;  1T95 A;  3WTS C;  3EQL F;  1LFB A;  2W54 A;  3I59 A;  1ZAO A;  3WG7 H;  3QU3 A;  3AEV A;  3WTV C;  4YD1 A;  4I6Z A;  7ICL A;  1IG6 A;  4LG0 A;  2H3I A;  5DB6 A;  5JU5 A;  4F2R A;  2OQR A;  2IA0 A;  4QIW F;  1L8L A;  4PZO A;  2QSG X;  2DMQ A;  5AI8 A;  3E6D A;  2DQR A;  2E1E A;  1T3N A;  3H5N A;  5HS7 A;  3F8F A;  4OAY A;  2M3A A;  5JVG F;  2XGQ A;  2V9P A;  3HOY J;  2KJ8 A;  3ULQ B;  9ICH A;  1KYZ A;  5KFK A;  3MMY B;  2M2E A;  3C1Y A;  5CA7 A;  2OU2 A;  8ICN A;  1Y8Q B;  1YG2 A;  2Z1D A;  1W7P A;  4NQW A;  2Z16 A;  3RH4 A;  4UV9 A;  5ALX A;  3PR4 A;  4I2G A;  3W6V A;  2K8B B;  3WKD A;  1IJW C;  1DDN A;  4C3H J;  3J7Y J;  2A1A A;  5AM4 A;  2EFQ A;  3M9O B;  5H6Q A;  2L4A A;  3K4C A;  5EE9 A;  3FXR A;  3CP2 A;  2XAS A;  3F5A A;  1QPI A;  4LOC A;  3PQJ A;  3C7J A;  2V6E A;  4X6A J;  3WHB A;  1LFU P;  2K4P A;  2ZJ5 A;  2KFN A;  2VE9 A;  1HW5 A;  2HYF A;  3D5S C;  5KFC A;  2K85 A;  3BDD A;  4GLX A;  4UVC A;  3N97 A;  3H4D A;  4CIC A;  4QSH A;  5DDY A;  4CO8 A;  2M0C A;  2EIM H;  2JTV A;  4YII A;  4JX4 A;  1VND A;  3S1R J;  3GWZ A;  3QXG A;  3ZQI A;  3J81 K;  5J8C A;  3O3K A;  1VLB A;  4RQ5 A;  3EPI A;  3BQ0 A;  4GO1 A;  8ICX A;  4BY7 J;  1YIO A;  1RPW A;  2WB1 N;  2XSJ C;  3GX4 X;  1NH3 A;  4Z2Y A;  2VXD A;  2V6C A;  3U21 A;  1ECW A;  1KEJ A;  2L5Y A;  1FLI A;  2NRV A;  2VAN A;  4X0G A;  2F4M B;  2RAE A;  1T39 A;  4DYQ A;  2WF8 A;  4M72 A;  4ECU A;  5KNI A;  4B9T A;  3WGG A;  4RB1 A;  3MFI A;  3VPR A;  1R7J A;  4YIF A;  4HDU A;  2R7Z J;  2KJ9 A;  4PGX A;  1G3T A;  3K4L A;  2KD1 A;  1PK3 A;  2G5H B;  3M7D A;  4QZF A;  3GVA A;  5F0H A;  1APL C;  1U3E M;  2R18 A;  2H5X A;  1VQ9 I;  2BQR A;  3I58 A;  3V7R A;  1DU0 A;  2Y9U A;  2F5V A;  1RXW A;  3B73 A;  5ERI A;  2VXZ A;  1S7O A;  4XK4 A;  3OYM A;  3AL0 B;  4KMF A;  1SFO J;  2VUM J;  1TWF J;  4L9V A;  1PYV A;  2DBB A;  2L54 A;  4GDF A;  4DF8 A;  2JEG A;  1V55 H;  1AWC A;  4MFA A;  5DS9 A;  1ZRD A;  1FYM A;  2QLT A;  1SVM A;  1SL2 A;  1RET A;  4HST A;  4I2I A;  5GAE J;  4NC6 A;  4M04 A;  1TV9 A;  2LDU A;  2ZXI A;  2LHT A;  4CF3 A;  4WCG A;  3IL2 A;  3FDY A;  4F52 A;  2Q1Z B;  3T79 A;  5KFP A;  2QQ9 A;  3H8S A;  3VYR B;  1IUF A;  3RTR A;  3BZ6 A;  3TQ1 A;  1DP7 P;  3N05 A;  1YX5 A;  2LF8 A;  2BCV A;  2O0Y A;  1J59 A;  4OJ6 A;  2DPJ A;  2DA7 A;  1YOV B;  4UB3 A;  3UXN A;  2HI0 A;  4XUS A;  9ICA A;  4IXA A;  3BZC A;  1D0Y A;  3ZRG A;  4KX3 A;  1HF0 A;  4EBE A;  2AXL A;  5LGN A;  3HKZ N;  2EFW A;  3GFJ A;  2DL0 A;  1RYU A;  3V42 A;  3L3F X;  1MC8 A;  2H94 A;  2EZK A;  3MQ0 A;  1SVL A;  2JA5 J;  1T94 A;  2K89 A;  3W2W A;  2ALZ A;  1T0F C;  3ASN H;  3N7R C;  1X9W A;  1ARO P;  1FZP B;  2XY5 A;  1OCC H;  4ESF A;  2VT2 A;  5J29 A;  1SKR A;  4CXF A;  3G1O A;  1ZG1 A;  2KTQ A;  3I56 I;  2W55 A;  3HOW J;  4AYB A;  4YEL A;  5JI6 A;  4L5J A;  4EZ9 A;  2I8D A;  1RG6 A;  7ICE A;  2R7F A;  2VKH A;  1IF1 A;  1WI3 A;  4LLN A;  4XLE A;  1VDV A;  2ZUD A;  2YS9 A;  3I55 I;  1EH7 A;  5AKH A;  4BWJ A;  5IIO A;  4RNO A;  4DWI A;  3BT9 A;  1IZ1 A;  1DOQ A;  1FO4 A;  2HBL A;  4HG2 A;  1YO5 C;  1IUY A;  2EPF A;  4JV2 A;  2L01 A;  4YEJ A;  4I09 A;  1OR7 A;  2VLA A;  3QRF F;  3GU3 A;  1WJD A;  5ALH A;  2QEX I;  1G8X A;  5C4J J;  2DI3 A;  2QZ8 A;  2CS3 A;  1ZD2 P;  4EYI B;  4D7M A;  2H3Q A;  1NTC A;  2EA2 A;  1JKO C;  2B63 J;  2V4J C;  1YRN B;  3IRU A;  3CW2 C;  2Y0S F;  5K4L A;  2PMU A;  1G59 A;  4M9H A;  4A12 A;  4KLQ A;  2YX4 A;  5GTI U;  1Z0X A;  4O3R A;  3UR3 C;  5KFM A;  3M9M B;  1JTY A;  2BYV E;  1UA1 A;  1JXL A;  2VON A;  1UST A;  3M07 A;  1YW7 A;  3WHC A;  1DPR A;  1J5Y A;  3WK9 A;  2AS5 F;  2NXN B;  2XVT A;  3KP2 A;  4IRG A;  2ZNZ A;  3BG9 A;  5FJ8 J;  4TQR A;  1S6L A;  3ZMD A;  3ZQL A;  1PVR A;  4AP9 A;  3CUQ A;  3H3Z A;  2K27 A;  1W1W E;  5DQH A;  4RAF A;  5ALV A;  1ZQR A;  2KKV A;  2KT0 A;  2L7Z A;  8ICA A;  2F6C A;  2NAZ A;  2LKY A;  5HDK A;  3TW7 A;  2EV5 A;  2JZY A;  4EJW A;  4IX7 A;  2HVR A;  1K7A A;  2MSY A;  2Q2E A;  2HOQ A;  2VN2 A;  1JUP A;  1TAM A;  1COO A;  3BJO A;  5M5Y J;  4DSL A;  4RLQ A;  1TNT A;  2YTU A;  2WF6 A;  4FZN A;  1J09 A;  2BXY A;  4FX0 A;  1ZK8 A;  2HR3 A;  2HTJ A;  4A0Z A;  3C5F A;  5J1Y A;  5IP6 A;  2CMP A;  2MH2 A;  4M9N A;  5DD4 A;  2Y75 A;  5GAD J;  1VQ6 I;  3Q8L A;  1Z4O A;  3CJQ B;  5EE3 A;  2COM A;  3HSE A;  1ZQB A;  3K4B A;  2KE7 A;  2NOG A;  3BS5 A;  2XIG A;  2F8K A;  4MFC A;  4Y17 A;  2ZUB A;  1JE8 A;  2H8W A;  2NYV A;  3S3O A;  1FOY A;  3CES A;  2D1V A;  3PQK A;  1W36 C;  4K2E A;  1ZXI A;  5TRD A;  4TUS A;  2M8E A;  1ORK A;  3RJP A;  1H0M A;  2AH5 A;  4HX8 A;  3K4J A;  1BPB A;  9ICK A;  2Z33 A;  2XPU A;  5EF6 A;  3UMB A;  3K70 C;  5HOO A;  2V9K A;  5DQG A;  1RNL A;  4BXF A;  4P0P B;  3L5K A;  2DCE A;  4DNC A;  1SZP A;  2F1H A;  1P2F A;  3A0B C;  3BG5 A;  1FEX A;  3TP3 A;  2RLT A;  2LMR A;  3A1Y A;  2XUB A;  5LD2 C;  3QYF A;  2JV3 A;  1ZOL A;  2OZU A;  3MCZ A;  4KIB A;  2HPM A;  1L8O A;  4Y2S A;  3JPO A;  4DFJ A;  1HUO A;  2MFZ A;  1P6R A;  3DLL F;  3V7C A;  3QPS A;  4DYC A;  4CCL A;  2E8N A;  1EV7 A;  3OOU A;  3IG5 A;  3WK7 A;  2CFX A;  2CRG A;  1Z6T A;  2IVM A;  2LY1 A;  4LK1 F;  5E3O A;  5JFR A;  1JN3 A;  3MN2 A;  4C3J J;  2LFB A;  4BE0 A;  4O3O A;  4DL4 A;  3MC1 A;  1ZET A;  3PW5 A;  4DQ2 A;  4PJ0 C;  3I9V 2;  1MBK A;  1ZRF A;  4RBO A;  5KTQ A;  2Z5U A;  3A02 A;  3CO6 C;  1CEZ A;  5KHD A;  1HCR A;  2OBP A;  3H9J A;  3RB4 A;  4YR3 A;  2JMW A;  3F8B A;  5DM7 F;  1TE2 A;  3K1Z A;  3HHH A;  4J9P A;  2KZ3 A;  4B9M A;  3J81 j;  2VOP A;  3QYP A;  4F50 A;  2XAG A;  2EA4 A;  1WJF A;  1UJ8 A;  3SEQ A;  4A3F J;  3D5L A;  1OXJ A;  3I28 A;  5KG4 A;  1NKC A;  4JWM A;  3AU6 A;  1SV0 C;  3G71 I;  5F1J A;  3L7W A;  2Y31 A;  2WAD A;  2UVW A;  2K8C B;  1CRX A;  3JCU C;  5CVU A;  2V1D A;  1RRJ A;  3ABK H;  1MNE A;  1S8N A;  1FNN A;  3KP4 A;  1KZH A;  5AKE A;  1ZQI A;  1IRX A;  2RDP A;  4M0A A;  1LKX A;  3E2E A;  4NLB A;  5ILV A;  3ONN A;  3GYH X;  3BR2 A;  2MU2 A;  1OCP A;  3FC4 A;  1Y0U A;  4BEH A;  2KHQ A;  1Z19 A;  2TDX A;  1BGX T;  3GFK B;  2QB1 A;  2GIZ A;  3KKA A;  5F9N A;  3Q5F A;  2CQ7 A;  2I9G A;  1BI3 A;  2YU9 J;  4MTE A;  1LEB A;  3CCV I;  1ZQN A;  5B66 U;  2WTE A;  5ALJ A;  3TAQ A;  2AGQ A;  3OYG A;  4RNM A;  3E5Q A;  4PHE A;  3EZ5 A;  2VA8 A;  2OH2 A;  3C3W A;  2JEF A;  4RUA A;  2M1B A;  5CVR A;  3AAF A;  2DBY A;  3IV5 A;  3WK5 A;  3HSF A;  1TWG J;  4A0Y A;  2WAF A;  4LB6 B;  4LJZ F;  3BWG A;  2ZB9 A;  4XRS G;  3KYL A;  3OV8 A;  3FF5 A;  5EE0 A;  4IOC F;  4JUZ A;  4KX5 A;  5KFZ A;  5AIB A;  3VWB A;  3C1Z A;  2HW3 A;  4HYE A;  2PLY A;  2DA1 A;  3RPU D;  4YMM A;  5L1J A;  1Z6R A;  2CU7 A;  1A35 A;  4XR6 A;  5ALY A;  4C8K A;  1J97 A;  5J40 A;  2G5I B;  5KL1 B;  1W5C C;  3ZDA A;  3I3L A;  2HQA A;  2JK3 A;  3R0A A;  4C2M J;  3L2C A;  2BEO A;  4BJ5 C;  2I10 A;  2W9C B;  1JXE A;  1ZQW A;  2F4I A;  3SHF A;  3V6J A;  4KMU A;  1X3W B;  4YN4 A;  4RMN A;  4R64 A;  3LSR A;  4ANJ A;  4B3X A;  4LIT A;  1QO0 D;  1ETK A;  3HRS A;  5CRX A;  2R92 J;  2EV6 A;  5JUM A;  1S72 I;  2HHS A;  2G7U A;  3KCC A;  4LK0 F;  4P96 A;  1EXN A;  4IQT A;  4F72 A;  3FMR A;  3BR5 A;  1KFS A;  1K79 A;  3C2B A;  2X6O A;  2E5Z A;  3RTV A;  1MSF C;  1BC7 C;  2QSH X;  3RKQ A;  3C18 A;  2L9V A;  5HMM A;  3GIL A;  2W1O A;  4NLN A;  4LMY A;  4KN4 X;  2O7O A;  1T4G A;  3BCB A;  1K1Q A;  9ICT A;  1L0O C;  3OGU A;  1XMA A;  1OYW A;  1R71 A;  1S97 A;  4RGU A;  3NWS A;  2DXI A;  4EGZ A;  1DGS A;  1FEZ A;  4F91 B;  4XKW A;  1YJW I;  2EAN A;  3K4K A;  5HDN A;  5J6X A;  4IJA A;  1BJA A;  1A76 A;  2E71 A;  3ETR A;  1ZQL A;  2WAQ A;  2BV6 A;  3H8M A;  3DU5 A;  1LEA A;  4EQQ A;  1ZRC A;  4F5Q A;  2X85 A;  3GXO A;  1RPL A;  2GLO A;  5J2A A;  4RGR A;  1B9M A;  4DS5 A;  2MH9 A;  3CUQ B;  4Y7N J;  2BE5 F;  3C21 A;  2E34 A;  1FYL A;  5EG0 B;  4XN3 A;  5KG3 A;  4HYK A;  1BOB A;  2CUF A;  5HDG A;  2EAP A;  2NRT A;  1IW7 F;  3MFK A;  2MLK A;  2ZTD A;  4ZH4 A;  1R6R A;  4ESB A;  3H4B A;  5FKM A;  2QKM B;  3F21 A;  3MZ8 A;  5KFN A;  4QWC A;  1JKQ C;  3RKW A;  3RR7 A;  4PPX A;  4UAU A;  3RSN A;  2A07 F;  5F0F A;  2ASJ A;  3FM3 A;  3QPL A;  1ZQK A;  2JVH A;  3SEI A;  3WE2 A;  3IV6 A;  4ETS A;  1RC9 A;  3ESW B;  3U9G A;  3ORY A;  2ZIW A;  2ZIX B;  5FD5 A;  4ENJ A;  2DUY A;  5J8Y A;  1D8K A;  8ICL A;  2KZG A;  3S3N A;  2O03 A;  1M6Y A;  4RQ1 A;  4ECY A;  8ICV A;  2Y0M A;  2KFD A;  1WQ2 A;  2VQG A;  1JT6 A;  1SMY F;  3BTC A;  4UUS A;  4IRC A;  3JAM Z;  4Z6E A;  1MBE A;  3J80 K;  1R49 A;  2XO7 A;  5L3F A;  1CQT A;  1IXS B;  5K7Z A;  2O3F A;  4PK4 A;  4GCV A;  2QBY B;  3PVX A;  1H38 A;  1HBX G;  3AFH A;  3Q9V A;  4JOM A;  1XB4 A;  2HS5 A;  2HZT A;  1SFU A;  4RQ4 A;  4FBT A;  3M3Y J;  1S0M A;  4TUQ A;  4EJU A;  2CW8 A;  4FX4 A;  4DOC A;  1QNT A;  1XC9 A;  2UXN A;  2X4H A;  2DPD A;  1SB3 C;  4F3O A;  2PQ8 A;  1C7Y A;  9ICL A;  4LD5 A;  3RBE A;  3VYS B;  3TQN A;  1IN8 A;  3HB9 A;  3K7A J;  4DBQ A;  2L2O A;  5E3L A;  2Y0S C;  5CEH A;  2HYJ A;  4UUS B;  2XV4 S;  1T0F A;  2K5C A;  3JTG A;  1X66 A;  5JR3 A;  1TKD A;  3HT3 A;  4NLK A;  4CF4 A;  1N60 A;  3LSJ A;  4F5N A;  3CP8 A;  2J5P A;  2KIQ A;  1ZGA A;  3ZP5 A;  2EAM A;  3M9N B;  3GLL A;  1E2X A;  1WJ5 A;  2RNJ A;  3D5R C;  4QWQ A;  3K10 A;  4U88 A;  2G09 A;  2R8H A;  1T33 A;  2VKD A;  1PVP A;  2HOS A;  2DLL A;  4JWN A;  4DQS A;  4IKF A;  3OJS A;  3AUO A;  5FKL A;  2DPU A;  2CYY A;  3SQN A;  1B0X A;  1EA3 A;  5FFZ A;  4CGZ A;  4HLX A;  5J0O A;  1UA0 A;  4N0B A;  6PAX A;  4XM3 A;  4M2Y A;  3MZY A;  2VBZ A;  7ICQ A;  1D8B A;  2MSN A;  4C4T A;  2Q4T A;  3BQT A;  3HTS B;  2XI9 A;  1ZQQ A;  3QUQ A;  2WF5 A;  4ABZ A;  2WF7 A;  2K4H A;  1ZR2 A;  2KNJ A;  1D1B A;  2Y48 A;  5D4S A;  1D1C A;  3OJU A;  1F5T A;  2ZIU A;  4IHS A;  1XMK A;  4J9L A;  1LVK A;  4X5V A;  1WJB A;  4UB2 A;  2QYO A;  4PGH A;  1N63 A;  3JPQ A;  3HUG A;  3MDA A;  4GYG A;  2JN6 A;  3BY6 A;  2LBO A;  3V7L A;  2D5V A;  2IXS A;  2YU3 A;  3M8S A;  2X9D A;  1LVA A;  3ISP A;  2UVV A;  4NB5 A;  2IPQ X;  3OYA A;  3U1K A;  5JVT A;  3DLA A;  5KCM A;  4AYB C;  1HA8 A;  1SFE A;  2F5D A;  5M3F J;  1NKE A;  4DQR A;  2A6H F;  1BW5 A;  1TNS A;  3OWT A;  3J80 Z;  4KLE A;  5GPC A;  1Z05 A;  1DUX C;  1JKP C;  2ZG6 A;  1LKY B;  1TQI A;  1ZKG A;  4L9J A;  5IY5 H;  1N78 A;  1L6N A;  3QYB A;  5D8K B;  3GBG A;  4YCX A;  5HLI A;  5AKL A;  2BHZ A;  4RQ7 A;  2H3F A;  1JUS A;  3RQ4 A;  4M6W B;  2PEX A;  3PSP A;  2JSP A;  3A4C A;  3PNY A;  3SEN A;  4TUP A;  4FBU A;  2ZSI B;  2D6F C;  7ICJ A;  2EB7 A;  2DT7 B;  3ABL H;  3BTI A;  2FI1 A;  3G2B A;  4UAV A;  1T3Q A;  3A0H C;  1M1E B;  3P5J A;  1TVA A;  4M6X A;  4PHA A;  2GQQ A;  2BZF A;  2WAQ N;  2K40 A;  1RYR A;  4IOA F;  2YB1 A;  4I2C A;  4BNC A;  2QKL B;  3RJF A;  1J75 A;  4AYB F;  1B8I B;  4RB3 C;  4A3J J;  2P6S A;  3RJK A;  4IL6 C;  4M9J A;  3FKI J;  1V3F A;  1U2W A;  2LM1 A;  7ICT A;  4DFK A;  2AQ4 A;  1OCR H;  3PSI A;  5ALM A;  1G3S A;  2R7U A;  1XSP A;  2RDI A;  1MKM A;  2EWN A;  3Q9S A;  4KLD A;  2BPC A;  1N48 A;  1SZH A;  2EBI A;  2G07 A;  1PK1 A;  2LYB A;  2H1L A;  1QHG A;  1U6G A;  3M9A A;  3H8W A;  4CCJ A;  1FSE A;  4J19 A;  1Z7U A;  4BHC A;  2XIC A;  2VA2 A;  3DPU A;  4N4N B;  1OLT A;  1IN7 A;  4BAY A;  4CCO A;  1VQN I;  3EYY A;  5DCM B;  3WTX C;  2UV1 A;  2RDJ A;  7ICS A;  3TW6 A;  3FM9 A;  4YMO A;  4KLS A;  2QQ8 A;  4JYK A;  3KTQ A;  4XLH A;  1Y1V J;  4KN7 X;  2OD5 A;  1UCV A;  2IA6 A;  1U4B A;  4QZE A;  4E6K G;  4BH9 A;  3K1M A;  4M6W A;  3CDH A;  1PJR A;  1QVU A;  5CB1 A;  1WPK A;  4DQP A;  4KMU X;  2AJQ A;  1B59 A;  5CJ9 A;  3GZ6 A;  4UAR A;  4KLJ A;  3VC8 A;  2GA1 A;  1XU4 A;  1IG7 A;  4ITV A;  2JWT A;  1L5U A;  2KKO A;  3MGH A;  2DFE A;  1IV6 A;  2CW0 F;  4Q45 A;  5D4B A;  5E3M A;  4E7J A;  3CC2 I;  2W00 A;  4HBL A;  3AG2 H;  3L2W A;  4G12 A;  4JP0 A;  4D5C A;  3F6O A;  1RR8 C;  4Q43 A;  1LV5 A;  5L3D A;  2WA0 A;  4IO9 F;  4H4K C;  5AON A;  1SXE A;  1Q1H A;  2JRM A;  4B3A A;  1JMS A;  4NHJ A;  4DL7 A;  2PI4 A;  4PFP A;  2OYY A;  4IRH A;  1ZQA A;  3PUF A;  1MMN A;  4ICA A;  1NJY A;  2ELK A;  2LVS A;  3RI4 A;  2M8G X;  1RXV A;  1QBJ A;  4HOB A;  4PUS A;  3Q0V A;  4E4H A;  1MQ3 A;  2M30 A;  3E5U A;  3ROU A;  5LGU A;  4EBD A;  2BCQ A;  1N5X A;  1WCM J;  1OMI A;  1SMT A;  1ZQZ A;  4NLC A;  1NK6 A;  3FWE A;  3HOZ J;  4CYC B;  2KSO A;  5D6E A;  5J8Y C;  2KL4 A;  4EYH B;  4DL2 A;  4ZH4 F;  1ZQV A;  2QEN A;  2NOJ B;  2ZNY A;  4KA4 A;  1QA6 A;  4Y2U A;  3ZD9 A;  4BBS J;  4Y3O A;  4NLG A;  1ETQ A;  5L3C A;  3GIK A;  1WSU A;  3N4M A;  5E17 F;  1X2I A;  4C8O A;  9ICW A;  2XVC A;  4F7Z A;  1ZLJ A;  2YMQ A;  4OU0 A;  4O3Q A;  2HPI A;  4Q5S F;  1P92 A;  1IRG A;  4UAS A;  4EGY A;  2GXB A;  1PVQ A;  1ZEL A;  1A77 A;  4USA A;  1ETY A;  2RGV A;  2FA5 A;  3G1L A;  2V1U A;  3GEZ A;  5ALE A;  1ZD4 A;  3WU1 B;  4A6D A;  4O5C A;  3G73 A;  2OV7 A;  1N25 A;  2DDA A;  4OIP F;  3GIM A;  3CUO A;  4HF0 A;  3IHU A;  3OYN A;  4IHW A;  3E0J B;  4II2 A;  1B72 B;  2JQ7 A;  5J0X A;  5L1L A;  2OEH A;  4RA2 A;  4J03 A;  2KZV A;  5DB9 A;  4UUT A;  3CCL I;  2H3V A;  2R7Q A;  3LMM A;  5J4Y A;  1VQ5 I;  5ICC A;  4M71 A;  2F77 X;  3MZH A;  1MBG A;  1V54 H;  3LOC A;  2L4M A;  1WWU A;  3H7I A;  4KLF A;  5LEK A;  4CA0 A;  3MWM A;  1S29 A;  2F1I A;  3GTQ J;  2NO4 A;  1NG6 A;  3CCS I;  3LSH A;  3WTZ A;  2C6Y A;  2QA4 I;  3K6G A;  3K9T A;  4FT8 A;  3T5X A;  5EWF A;  4RPY A;  1IO2 A;  1MBJ A;  1MD0 A;  5F04 A;  1FTZ A;  2MRL A;  4IQV A;  1S9H A;  4DOA A;  5K7H A;  3RIR A;  2H09 A;  3OL3 A;  1LDJ A;  1NJX A;  3O8G A;  4XID A;  3FMQ A;  1SVO A;  1VZ0 A;  1HDP A;  2ZXW H;  1B4A A;  4RPZ A;  5JTI A;  3GLX A;  3HRM A;  1YS6 A;  2MA1 A;  3Q0W A;  1LJ9 A;  2XKP A;  1H9T A;  3COA C;  1BPE A;  8ICS A;  4L0Y B;  3BCA A;  2ZFW A;  4AUX A;  2WV0 A;  1FY7 A;  2Z9O A;  5FLX Z;  1AKH B;  2A61 A;  1ZQ1 C;  4JQF A;  2RP5 A;  1U5T A;  4DS4 A;  3D2S A;  1GV5 A;  4JBA A;  4PH5 A;  3H92 A;  2VOD A;  4ED1 A;  2BW3 B;  3ZQH A;  2XAJ A;  3KP7 A;  1NG7 A;  3HXL A;  3JRI A;  2JA6 J;  3HW8 A;  2C2R A;  2BY2 A;  1E3O C;  4OIO F;  2BQU A;  3RCO A;  3IAM 2;  4J9K A;  2HDD A;  1X3Z B;  2IOF K;  1Z3E B;  2HI3 A;  3T5L A;  2FML A;  5IIJ A;  1UEL B;  1WYG A;  3Q8S B;  3V72 A;  1YJ9 I;  4BXO B;  2O8K A;  5DLF A;  1G2H A;  2BCU A;  3LSM A;  3PX6 A;  4I29 A;  5EJC A;  2W24 A;  2DT5 A;  3TKA A;  1WVR A;  4Y2J A;  5DB8 A;  1XS9 D;  4KLI A;  1FOK A;  3MAJ A;  2YN4 A;  1G3W A;  3SAG A;  3F53 A;  1MDM B;  4NM1 A;  1X4O A;  5DV5 A;  2LPE A;  2MBF A;  5FP0 A;  4TUR A;  3DV9 A;  1JT0 A;  1TWC J;  4B4C A;  3IAS 2;  5DB7 A;  3H0D A;  1XPX A;  3FXL A;  2R8G A;  2LRE A;  4IQU A;  2KK0 A;  4Z6F A;  5DBA A;  2YR2 A;  4Y2X A;  3L09 A;  1MNM C;  3WGH A;  4NUB A;  2JZB B;  3TO9 A;  3UXO A;  3M4O J;  4P2H A;  4AIH A;  1VQM I;  1SD6 A;  3GME A;  5KAF U;  2LKS A;  2VI6 A;  3QPH A;  4GRI A;  4QLC U;  1JRO A;  5AM0 A;  3THV A;  1NJZ A;  3CCU I;  4MFE A;  5KFG A;  3KEO A;  4L9N A;  4YFK F;  3SDB A;  3CCE I;  2M0N A;  4RT3 A;  3NS1 A;  1ED1 A;  3V7K A;  4L18 B;  3PIP F;  1O3T A;  2AO9 A;  4EV0 A;  2GO7 A;  2X6W A;  1SV0 A;  4R8U A;  2KDO A;  1QCK A;  3Q0U A;  5CJ7 A;  4QW9 A;  5F27 A;  4UB1 A;  2BVL A;  4HPQ A;  3FHZ A;  3AL0 C;  3HZJ A;  5IOY A;  3RR8 A;  1NZB A;  2VJ4 A;  4I76 A;  1KU9 A;  3SZT A;  2BZT A;  3R61 A;  4KIF A;  4Y2R A;  5KG2 A;  1FYK A;  3M1Y A;  3H0G J;  1EKE A;  2OF7 A;  2WB1 A;  4F4K A;  2VKE A;  2VBY A;  1HEK A;  4XRH A;  3FXK A;  4RAG A;  4ZTJ A;  2EAO A;  4BDY A;  2VB6 A;  1WZ2 A;  1NK2 P;  5ALG A;  3DEW A;  1B72 A;  1BR4 A;  1WGX A;  2ZJR F;  3VDX A;  2F5E A;  4DCC A;  1ETW A;  3KZY A;  1XDU A;  3BPV A;  1MN8 A;  4U0V A;  4Y33 A;  2OCE A;  3D2Q A;  1J2M A;  5D5X B;  4C9Y A;  3E3V A;  2E19 A;  3NTU A;  4AID A;  4Q8E A;  1V5E A;  3PNC A;  3KE2 A;  4HLY A;  4EEY A;  3QUB A;  5BOM A;  3B6C A;  2VL8 A;  2R7W A;  5CVV A;  5KT5 A;  1ZG3 A;  3LA2 A;  4V2G A;  2BDU A;  4I2H A;  4KLM A;  4GFJ A;  3E0F A;  2P6T A;  2WAQ F;  3IKT A;  2M7B A;  3NVY A;  1FIP A;  1YT3 A;  4J9Q A;  3BG3 A;  3F22 A;  3RRH A;  1WFX A;  1XCB A;  2R7R A;  2X51 A;  2FBK A;  3H0L B;  5KFT A;  1X4P A;  2F2A B;  3ZI4 A;  3ISD A;  5B5E C;  2B7E A;  4KFC A;  2FXA A;  3GZF A;  1XSL A;  3DTK A;  1VFC A;  1K6O A;  2JJ7 A;  1RUO A;  2DYR H;  1U5T C;  2KKP A;  2KSO B;  3QE9 Y;  3V7S A;  4LG3 A;  3ZQC A;  3DV8 A;  9ICC A;  3IM1 A;  2Y0S A;  4ZYH A;  2KRF A;  4P9F A;  4QWA A;  3QOE A;  1ITY A;  2XF6 A;  1O7L A;  1GO3 F;  3BQ1 A;  4ECW A;  2IS6 A;  3RJE A;  1UCR A;  1HSJ A;  2L3D A;  3KZI C;  5DDG A;  3KHH A;  8ICP A;  3KET A;  2E1F A;  2LBF A;  2R4G A;  7ICR A;  3U26 A;  4U7B A;  2P6U A;  4OMY A;  1RM6 C;  3KP5 A;  3SI8 A;  4WK8 F;  1YI2 I;  1EF4 A;  3W6K B;  4YR0 A;  2W9C A;  1NK9 A;  4KIC A;  2ACJ A;  3RPQ A;  2E5S A;  4DOB A;  3WK8 A;  2NRW A;  5FLM J;  3F3X A;  2XSD C;  1I50 J;  3REO A;  3PW7 A;  3LWF A;  3BTJ A;  2KZM A;  1A6Q A;  2LF7 A;  2VJI A;  3R4K A;  3WU0 A;  3SR6 A;  1HLV A;  1UAA A;  1I1G A;  7ICI A;  4HQM A;  4IEJ A;  1QZE A;  5JHU A;  4BXU A;  1H89 C;  3A01 A;  4NWI A;  5IIM A;  4ELV A;  9ANT A;  1XN7 A;  9ICQ A;  2VQL A;  2V26 A;  3RDI A;  4ZOH C;  3MAB A;  3FXO A;  1QZZ A;  2JSC A;  4DGW B;  4BJ6 C;  2PMH A;  5KFJ A;  4A2U A;  5J0Y A;  1X9S A;  4BBR J;  2W9M A;  2FX0 A;  5AKG A;  5C44 J;  4CUG A;  2LY9 A;  1A0P A;  2A19 A;  4FE7 A;  4LJX A;  4MLO A;  2I5U A;  1ETX A;  1R36 A;  5T14 A;  4UW9 A;  5J0P A;  2RVC A;  3G1M A;  1ZQG A;  4O5K A;  3JTH A;  4A3M J;  3E6M A;  1YTY A;  1IN6 A;  4E7S A;  3UKG A;  4KDP A;  1UPH A;  3JAM K;  4NV0 A;  3LWM A;  4M9G A;  2TCT A;  3CQZ J;  4B44 A;  2ZIV B;  1NK4 A;  2ECB A;  4RB0 A;  2O6K A;  9ICR A;  2Z99 A;  4D1Q A;  4LFU A;  2LMD A;  2PFO A;  5FLX K;  5AK6 A;  1Y0N A;  3ZMT A;  4II3 A;  4R79 A;  3I64 A;  3RB3 A;  4EM2 A;  3P9I A;  1YFH A;  3IRQ A;  9ICO A;  3HGY A;  1B8I A;  2FMQ A;  3ZR8 X;  4D7N A;  1X1D A;  4G6T B;  4F5R A;  1ONV A;  5LFA A;  4ECZ A;  2ZME B;  4US9 A;  1HKQ A;  4ESJ A;  3PMN A;  3A03 A;  4WJ3 B;  5AK3 A;  4DFM A;  3G6X A;  2KIV A;  4MF2 A;  3SD7 A;  4DQQ A;  3ZQG A;  4HF1 A;  1UT8 A;  3BJ6 A;  5DLG A;  2ASD A;  3NVW A;  1V9P A;  3RF9 A;  5DEQ A;  1ETV A;  3K1P A;  4LGW A;  5LLQ A;  2Y9T A;  4PGQ A;  1R58 A;  4MTD A;  3F5E A;  2HBM A;  3IDW A;  3EUH A;  2QCO A;  4F2S A;  3DFG A;  1GXP A;  1MMS A;  1QHH D;  1MJ9 A;  1D8L A;  2QUF A;  4CNQ A;  2V1X A;  2GBY A;  4F5O A;  3UPQ A;  2EQR A;  2XY7 A;  5EZH A;  1JGS A;  1K4S A;  4ED7 A;  2H6B A;  1D5V A;  1TW2 A;  1QLN A;  1J2N A;  2K4B A;  2CH0 A;  2ZTE A;  2K3F A;  3PL8 A;  4QWD A;  1MGT A;  1NK3 P;  1KW4 A;  5ILU A;  2PFQ A;  3NAR A;  2HHW A;  1IIP A;  1WRJ A;  3R6S A;  1VQ4 I;  3OR2 C;  2E5N A;  3IH4 A;  3U2R A;  4HNT A;  1VJ5 A;  2UVU A;  4B9N A;  2FF4 A;  4OAZ A;  1QVT A;  3K0L A;  4J00 A;  3HOV J;  3NRZ A;  4I2E A;  2HNH A;  1PUF B;  2OPT A;  3SZ2 A;  4B9S A;  5E1Z B;  2YY6 A;  2O5R A;  3ED5 A;  2QQA A;  3F8C A;  4FQG A;  5E8G A;  4YFX F;  3ZN1 A;  5J47 A;  3WGI A;  4ZDO A;  2F3N A;  2XGP A;  4FET A;  2EFO A;  4RAZ A;  2ZME A;  1C20 A;  2XGD A;  3QUC A;  2K3P A;  2XB5 A;  4G8X A;  2CRX A;  3KX2 A;  4G7Z F;  1BR2 A;  4HDV A;  4ZTF A;  3P9K A;  2F4O B;  4ENN A;  3NUQ A;  4UAT A;  2QAR B;  4RGS A;  5D46 A;  5DTD A;  1KL9 A;  2XDV A;  3N28 A;  1Z4N A;  3VSL A;  4HV6 A;  1ZQJ A;  3VOE A;  4F4X A;  1Y8R B;  2M4K A;  1YZ6 A;  1ZAR A;  5GTI C;  2FMS A;  3M1E A;  5D5W B;  4PL1 A;  4B9U A;  2K9M A;  4DQI A;  2OTL I;  5III A;  5KFI A;  3PJR A;  1HKS A;  3RYR A;  2GOX B;  2XAU A;  4HQE A;  1VQL I;  4CHU A;  1BPX A;  1T2K A;  3KKA C;  1LUJ B;  3DDH A;  4BX9 C;  2NVU B;  4Y2T A;  2EFN A;  2JEJ A;  1WI9 A;  1LQ1 A;  4Z6D A;  1G3Y A;  5D8L B;  3I5U A;  2D2W A;  5J1R A;  1LDD A;  5D4R A;  1YLF A;  5IP9 J;  2IS2 A;  3CMY A;  2MUT A;  2FOK A;  4UV8 A;  3ECO A;  4LG0 B;  2FBI A;  2XRL A;  4P55 A;  1SWV A;  1O4X A;  1XWL A;  3HWT A;  1U5T B;  5KFY A;  5DYM A;  5CVJ A;  3ALR A;  3EPZ A;  3HIL A;  4A3B J;  3G6E I;  5AI5 A;  4B09 A;  1VQ8 I;  3HGG A;  5DM6 F;  3I71 A;  2EZL A;  3E97 A;  3VYT B;  2RKH A;  7ICN A;  5J2D A;  5TIS C;  3IUO A;  3KEQ A;  2ESN A;  5DBC A;  5IT9 K;  3CTA A;  4AVZ A;  2PI0 A;  3LWL A;  2W9B B;  3H3V K;  1SFX A;  4I0A A;  2AXT C;  4B47 A;  1KTQ A;  2F1J A;  2G08 A;  4ZDP A;  3IH2 A;  3ONQ A;  3L4P A;  5KFW A;  1Z91 A;  2G0E A;  4HNV A;  3BS7 A;  2JT1 A;  3FIW A;  3C2H A;  2YPR A;  1TZL A;  2GIV A;  3ZMU A;  1U8R A;  4QZ8 A;  4BDP A;  4KLT A;  2EK5 A;  3OYL A;  2NRA C;  2HSZ A;  1SGG A;  1X2N A;  3CD6 I;  2KMU A;  3S16 J;  5IYD J;  5DG7 A;  1D8Y A;  3F0C A;  2CQN A;  4I7H A;  3ZN0 A;  1ZR4 A;  4YFN F;  2JUG A;  3QX7 A;  3BQ7 A;  3A0B U;  4BJT A;  1KLN A;  1MSE C;  4JB3 A;  4XQ8 A;  4QIW C;  9ICG A;  1K83 J;  1W0T A;  3GFL A;  5FD6 A;  2AU0 A;  5J2E A;  3K4N A;  2R5Y A;  5KVR A;  5J2J A;  3TO7 A;  8ICC A;  2K9L A;  3J7A Y;  5KK1 A;  4RQ2 A;  5DCF A;  5D5V B;  2R7O A;  4YMN A;  4U6P A;  5FFX A;  3EYZ A;  3DEU A;  3FM5 A;  5KG1 A;  2KRC A;  4IHV A;  3R9K A;  1U9O A;  1NK5 A;  4NL9 C;  4LZD A;  2W48 A;  1KSP A;  1Y39 A;  4WXD A;  8ICJ A;  2E8O A;  5J2K A;  4GFB A;  3FBN B;  4GGG A;  4UAW A;  4XON A;  3OS1 A;  1X19 A;  3B9J A;  5KFL A;  1ZYQ A;  1ZQM A;  3ISC A;  2P66 A;  1U9N A;  2OWO A;  3S93 A;  2RC4 A;  4N4O B;  5HLG A;  3RKX A;  3ELK A;  1P4W A;  4FE3 A;  1Z00 B;  3A01 B;  2KOB A;  2DMU A;  1CGP A;  5AI4 A;  1R22 A;  2L9R A;  4XQF A;  9ICM A;  3MR3 A;  1JGG A;  1I3A A;  4ECR A;  1ZQD A;  2EZY A;  3F72 A;  3I59 B;  1O3Q A;  1J7K A;  2JA2 A;  4NXZ A;  2RQQ A;  3C29 A;  2R8I A;  3EUB 2;  1BI0 A;  1FOX A;  5HHI A;  5KFQ A;  4KLG A;  1JJ6 C;  2C2D A;  2KLO A;  4XMY A;  3DTE A;  2KP7 A;  5AKJ A;  3E1S A;  2C28 A;  2VKQ A;  4LZG A;  3MR6 A;  1XGS A;  2IA2 A;  4QWE A;  1WJC A;  4KNY A;  3S6J A;  2KIM A;  2EZI A;  5CWR A;  2K8A A;  3C2M A;  2CWE A;  1B22 A;  2NRX A;  4EJV A;  5L9X A;  1ZG5 A;  1KQ8 A;  5DUI A;  3HPO A;  2G9W A;  2UXX A;  1DRG A;  2MD0 A;  4QW8 A;  2A5W A;  3EET A;  1TLH B;  4RPX A;  4P4M A;  4BQA A;  1AOY A;  5KFA A;  2ESE A;  5IIN A;  4K4H A;  5KAI U;  3AMZ A;  5J1U A;  5J2I A;  1P7J A;  1C0W A;  3PFY A;  2IGN A;  1NKB A;  3OSG A;  3QZ8 A;  5HLT A;  1X1B A;  5DUK A;  2FQ4 A;  2A5Y B;  2FDR A;  1GV2 A;  2P81 A;  2R93 J;  2YX8 A;  4O3M A;  5HR6 A;  3UM9 A;  3M6Z A;  2W8L A;  3M6K A;  2D8C A;  5EZG A;  4M9S A;  4P4P A;  1DGR M;  1SAN A;  4EM0 B;  4XLF A;  1PUE E;  4KT6 A;  2LY2 A;  1OW5 A;  5F3X B;  3HKZ F;  5IIL A;  3ERM A;  4IQW A;  1K5O A;  1SD7 A;  4O6J A;  2FPM A;  2KVS A;  3QOD A;  4B6J A;  2LSO A;  5EYR A;  1GDT A;  5ALU A;  5DBB A;  2V9W A;  2KJB A;  1S0V A;  2E7W A;  3NAU A;  2G06 A;  2P8T A;  1ZQH A;  4A6E A;  3RZD J;  2RNG A;  2WY8 Q;  5JLX A;  3OS0 A;  5DD8 A;  1TFR A;  5AI9 A;  5JRT A;  5J2G A;  2NS8 A;  1N5W A;  2M9N A;  4Z6C A;  3GTP J;  5ALF A;  2ETH A;  3NRV A;  4I27 A;  2W03 A;  4JV0 A;  4E0D A;  1ENH A;  5D6F A;  3D1N I;  4EEN A;  7ICG A;  1S5L C;  2ZKZ A;  4G9Y A;  4W1U A;  1Z21 A;  1QSS A;  5GTH C;  1R1U A;  4MFF A;  1VQ7 I;  3KZX A;  1JI7 A;  5IP7 J;  4TQS A;  4J01 A;  2HHT A;  7ICV A;  1TAU A;  2EIN H;  4ED3 A;  3TAP A;  2L02 A;  3C2L A;  5A2Q K;  4ECV A;  1UQV A;  5BPI A;  3JPP A;  3BQ2 A;  5ILS A;  5J2H A;  3S15 J;  4Y52 J;  4PHP A;  2OJE D;  4FIS A;  1Z7L A;  3T5H A;  3PO2 J;  1V38 A;  2WFA A;  2WY7 Q;  2KRH A;  1S10 A;  1D9F A;  1MSW D;  2LM4 A;  2HQ5 A;  3CO7 C;  5E3N A;  2VBW A;  4BXX J;  3EW9 A;  3V7J A;  1KN5 A;  5DQI A;  3IC7 A;  5GAH J;  2V9V A;  4HF2 A;  4PJN A;  3AN1 A;  1YE9 A;  3S32 A;  3TOA A;  2FMP A;  3L9F A;  4M47 A;  3CDI A;  5G5G A;  5J0S A;  5CPR B;  3B02 A;  5EEA A;  2AHQ A;  4ENM A;  2G7H A;  2FUG 2;  1URJ A;  3UMC A;  3AG1 H;  2DOF A;  4IHY A;  2J6U A;  2YQE A;  1FOW A;  2QB0 A;  1O3R A;  2HWV A;  5E18 F;  1IXC A;  2BW3 A;  4DF4 A;  2GXG A;  4UVA A;  4BDZ A;  5HVQ C;  3D6J A;  4DSE A;  2EQY A;  2IGO A;  2F8L A;  5GP9 A;  4IC9 A;  4HZF A;  2Z3Y A;  3PW0 A;  1DU6 A;  4I98 B;  4QWB A;  2KP6 A;  1KBU A;  3OMY A;  2JXJ A;  3JPR A;  3TKY A;  1IDY A;  2XGE A;  5DDM A;  2LNB A;  4UB6 U;  3EUA A;  1OFC X;  2BVM A;  3S1M J;  4BXO A;  5J2B A;  1PK1 B;  2HVS A;  3VB2 A;  2ID6 A;  4YFK A;  1U45 A;  2HOT A;  3JRA A;  4UY8 I;  1S77 D;  3S1Q J;  4O3P A;  3FMS A;  3LL7 A;  1CF7 B;  4RQ3 A;  4HA8 A;  4P4O A;  2E8P A;  4E7H A;  2X6X A;  2C2E A;  4XKB A;  4ZZL A;  3K69 A;  3CDL A;  1LE8 A;  2Q0Z X;  1PZN A;  3QU4 A;  2BXZ A;  4PHD A;  1KKX A;  4DZP A;  4I0B A;  2E2I J;  2VE8 A;  3GV7 B;  1ZD5 A;  3CLQ A;  3GTK J;  2R7X A;  4C2U A;  4PSX A;  2ZJP F;  3DBR B;  4A3D J;  5L3B A;  9ICE A;  3LYS A;  3BLY A;  2VAS A;  1RES A;  5ICG A;  3C2G A;  2XF7 A;  2CFO A;  4QPO A;  1BL0 A;  2STW A;  2EIL H;  2ADU A;  5L3G A;  5E1X A;  5FRM A;  3H0R B;  2UVR A;  1ON2 A;  3BR3 A;  3PX0 A;  2QF7 A;  1F1Z A;  1XGN A;  2DTR A;  2V7F A;  3LAJ A;  3HL2 A;  2DAO A;  3I4N J;  1NHA A;  4PJL A;  4RDU A;  1SV4 A;  1R23 A;  3K4M A;  2JHD A;  1OCT C;  1MZB A;  4DFD A;  5J2F A;  1S8O A;  4HNU A;  9ICF A;  2WC2 A;  3H36 A;  4KUM A;  5BQT A;  3PFI A;  3CF5 F;  2KIC A;  5A0L A;  1BW6 A;  3L2V A;  1B43 A;  1S0O A;  3OIP A;  4A5M A;  4ENK A;  1OJL A;  1F36 A;  2LR8 A;  1QGP A;  4ZYA A;  2X0L A;  3KIO A;  3LSG A;  4F3Q A;  2GLE A;  3HUG B;  1K6Y A;  2VKV A;  2XC7 A;  2VJJ A;  1R1V A;  1UHU A;  1K78 B;  3DTI A;  1V5F A;  4OJP A;  4PZJ A;  1T8E A;  2W7P A;  3OHA A;  3BS5 B;  4ELU A;  5D49 A;  4C8L A;  3G4S I;  2BGW A;  5E1W A;  2QQB A;  3CJR B;  4XKC A;  1QQ7 A;  2Y2Z A;  3V8L A;  2V79 A;  2ID3 A;  3AKZ A;  1QU3 A;  2LYC A;  1IGN A;  2GXA A;  5E20 A;  2KIS A;  3UQ2 A;  5EGO B;  3WTT C;  1W5S A;  1W36 D;  2W9A A;  4ECX A;  3G6V A;  3SQI A;  3KEY A;  3Q3S A;  3S14 J;  3G6Y A;  3N4M B;  3LVV A;  1NK8 A;  2JPC A;  4NM2 A;  1MMD A;  1L7N A;  3OPX A;  2R8K A;  4EJO A;  9ICX A;  3T8R A;  1PDN C;  1A36 A;  1NJW A;  5DGA A;  5F08 A;  1Y88 A;  3WKB A;  2DDB A;  5TIS U;  4XRS A;  8ICZ A;  3RBD A;  4LVS A;  3TGN A;  2ICW G;  2ISO A;  2HCF A;  4ACO A;  2ME6 A;  2NVX J;  2L7F P;  4CZZ A;  1TTY A;  3EWA A;  1XGM A;  1JUM A;  2M4G A;  4DSK A;  4EX7 A;  4A5N A;  1TK8 A;  2OXO A;  3HG9 A;  3W3C A;  1N2X A;  2R7V A;  2HHQ A;  2GAU A;  4JX6 A;  3BR0 A;  1D0Z A;  1E3H A;  4O3S A;  1LVH A;  1QPM A;  3QNM A;  3OOP A;  3S8P A;  3A0H U;  1VF9 A;  4RAY A;  4EX6 A;  3KHL A;  1HST A;  4OIQ F;  2CW7 A;  5J3L A;  5M3M J;  3CJN A;  2BQ3 A;  4E7Z A;  4UHT A;  1ZHF A;  3LDA A;  1T6S A;  8ICT A;  1R5G A;  1COK A;  1D3Y A;  1NZP A;  1ZJN A;  5J4V A;  4S0H B;  4EJT A;  2OTJ I;  3WKA A;  4YG2 F;  8ICF A;  2ASL A;  1XGO A;  2M5W A;  4BY1 J;  3SJM A;  1XC5 A;  2NO5 A;  3QU7 A;  3BQZ A;  5KFR A;  2F2E A;  1YX3 A;  4YIR X;  4Q44 A;  4DO9 A;  1GUU A;  3BDP A;  1RZ4 A;  1XD7 A;  4IHT A;  2WB1 F;  5L1K A;  4I99 C;  4G7O F;  1BNO A;  2HTS A;  2L9S A;  4YXJ A;  2M87 A;  3PO4 A;  3PW4 A;  4E70 A;  4NJ8 A;  2EZZ A;  4NL9 A;  5HNK A;  1N56 A;  4IR9 A;  8ICI A;  2P7C B;  1TAQ A;  2DQN B;  2EFP A;  2HFH A;  4QIW N;  3RJJ A;  2Q2E B;  3IG8 A;  4ZJZ A;  3PW2 A;  5AIA A;  5J0T A;  2BHN A;  4OIN F;  3JRE A;  2BCS A;  2ELH A;  4JK1 A;  3AG4 H;  3P9C A;  1RZT A;  2P5V A;  3L2U A;  2GWS A;  1EH6 A;  1JHH A;  3WTU C;  3MD2 A;  5BMZ A;  3AQF A;  4IL6 U;  1OPC A;  5HP4 A;  2W43 A;  2XPV A;  1SC7 A;  1AKH A;  4FTH A;  2BHY A;  4OCZ A;  2YMM A;  3BRO A;  3RB6 A;  3FKJ A;  4G6D A;  1OIS A;  4XBF A;  4XA5 A;  3QPT A;  5ALS A;  3V6K A;  5LBQ A;  3LFK A;  3MR5 A;  2H1K A;  3N97 B;  3NQO A;  4HW0 A;  3MGV A;  3QU9 A;  3ASO H;  4ZYD A;  1LB2 B;  2V1N A;  3W2V A;  3ISB A;  3TFS A;  2FEZ A;  1B9N A;  1KQ0 A;  4M9X A;  2E7X A;  1YIJ I;  3CYM A;  3WG9 A;  2Y0S N;  1XX5 A;  4QPQ A;  1WJA A;  4EEF G;  5FGM A;  2XCA A;  1DP3 A;  4CCH A;  2VT3 A;  1UMQ A;  3ZMS A;  1Y1W J;  2JRT A;  1TBX A;  2K86 A;  2FJ1 A;  4LLG F;  2K9N A;  2IW5 A;  4F71 A;  1ON1 A;  4P0Q A;  3MDC A;  4V2F A;  2ZJQ F;  3BQY A;  1W0U A;  1I6X A;  1QQI A;  4KTQ A;  4C3I J;  2CQK A;  4M9L A;  5KFV A;  1Q8K A;  3T0Y A;  2P35 A;  1KU7 A;  2GH1 A;  4IR1 A;  4D0P A;  4KLU A;  1SWW A;  2R7T A;  3VSK A;  2EDU A;  1MQ2 A;  4Q47 A;  3TP0 A;  2G0A A;  3PML A;  3HPH A;  1IN5 A;  5K5O A;  4ZDL A;  4J9N A;  4QJF B;  1Q3V A;  4Y4R A;  2R0Q C;  1GT0 C;  3CC7 I;  2QVO A;  3OR1 C;  4BKX A;  3HOX J;  3QZ7 A;  4ED6 A;  2O8X A;  4XLP F;  3BZK A;  3MBY A;  3W2A A;  4XOP A;  3BG6 A;  2X1E A;  3DKW A;  3FXJ A;  1R1T A;  1SD5 A;  5BNG A;  2COB A;  3FXQ A;  1T38 A;  1POG A;  1LPQ A;  1X9X A;  3PST A;  4DOZ A;  5AIC A;  2JGA A;  5ALK A;  3FZV A;  2WB1 C;  3UMG A;  2OC6 A;  3JRD A;  2LG4 A;  4P0Q B;  1N62 A;  1PP8 F;  2F44 A;  4HX4 A;  3I53 A;  4BUP A;  1UHS A;  2Y9Y A;  5CQG A;  1SL0 A;  4YR2 A;  1O08 A;  2MC3 A;  4UUV A;  1XNS A;  2QM3 A;  5KFO A;  4AYB N;  4M73 A;  2PFN A;  1OYI A;  3K75 D;  2JA7 J;  1MJB A;  1O57 A;  2ZCW A;  3RB0 A;  1Z3X A;  2PMZ C;  4M3D A;  3GTO J;  4RLF A;  4B9L A;  1HW1 A;  2DF4 B;  4I2J A;  3LSI A;  4DBR A;  3HDD A;  3MKZ A;  4IHX A;  2XAH A;  3HSR A;  4HAM A;  5B66 C;  3OYH A;  4AIJ A;  2HBJ A;  3TAN A;  5CKT A;  9ICU A;  2XID A;  4R8U B;  3W6J B;  5GPA A;  1LDK B;  4C8M A;  1AHD P;  1HDD C;  2FD5 A;  2WWY A;  3KOO A;  2W8K A;  4CF5 A;  4LB5 A;  3DCF A;  3F9K A;  2RV8 A;  4AM3 A;  2XAQ A;  3I0T A;  2Y1J A;  3SV3 A;  1Z9C A;  1MH4 A;  4Z6Y A;  2E8M A;  3H1C A;  3GFM A;  1KQ9 A;  1BI2 A;  2M45 A;  4MEY A;  1S3J A;  2FLL A;  3HHG A;  1U0J A;  3HOS A;  4IRI A;  5HML A;  2ZJA A;  2VC0 A;  1TT0 A;  2X6Y A;  1K4T A;  1X1C A;  2XGX A;  4IVN A;  1NNL A;  4MF8 A;  4OD0 A;  3OYC A;  3HYI A;  1SFK A;  9ICB A;  3SDG A;  2R5Y B;  2LYH A;  4ON0 A;  2KVC A;  4LLL A;  5G5H A;  2HGC A;  4D9J A;  4KMO B;  3EUH C;  1HJP A;  2AQ0 A;  3JSP A;  4MGR A;  1STZ A;  1WKM A;  5FLV A;  4C80 A;  2XGC A;  5B3S H;  1A04 A;  3BTL A;  4ED2 A;  3T8T A;  5KT2 A;  3OYD A;  3HJE A;  2B21 A;  2DWQ A;  2ZJ8 A;  1BIA A;  4PZN A;  1JTX A;  3TAD C;  4UAZ A;  2IEK A;  1RDF A;  1Q3U A;  8ICG A;  9ICS A;  1D1A A;  1G6N A;  4PJJ A;  4A3C J;  7ICM A;  4I02 A;  3C23 A;  3PZP A;  2GOM A;  3UXP A;  1O03 A;  3JRC A;  5LRR A;  2LP0 A;  3FIS A;  2E60 A;  4XKV A;  4AU7 A;  2LRD A;  1JIH A;  1X6J A;  2FE9 A;  4F8R A;  3PY8 A;  3SZP A;  1A5J A;  2JR5 A;  2W85 A;  5KG6 A;  1RQL A;  4NNJ A;  1ACI A;  2RN7 A;  5C4X J;  2CSO A;  5KFE A;  1T98 A;  5IOZ A;  3JSO A;  3SFI A;  5IIK A;  5KT3 A;  2H8R A;  3LST A;  4XRF A;  1FC3 A;  3WU2 U;  2JZB A;  3ZDE A;  1L3S A;  2JVG A;  8ICU A;  2GOL A;  1B4F A;  2NVQ J;  2YB4 A;  2DYS H;  3OIQ A;  4RB2 C;  4CYC A;  3PNT A;  4O5V A;  4IZZ A;  5AIQ A;  3CMA I;  3OTQ A;  3QU2 A;  4JMU A;  4RQ6 A;  4CRX A;  1PUF A;  3L1P A;  3LA7 A;  4XL9 A;  5F9L A;  1DGW Y;  3F2B A;  1F5S A;  1U48 A;  1O7F A;  1TK5 A;  1JXS A;  4DYR A;  2TRT A;  2KJ5 A;  1BPD A;  1ZQY A;  2R7D A;  2W82 A;  1LE8 B;  1ZYR F;  1YW9 A;  2YMP A;  5AM3 A;  3I4P A;  4X1E A;  2UWM A;  5KAF C;  1OYY A;  3FHN A;  4KJZ A;  4A3L J;  2WAQ C;  2OM6 A;  5ALW A;  2NYX A;  8ICR A;  4A3K J;  1Q46 A;  1KGS A;  4HV5 A;  2LYA A;  2ZTC A;  3IWF A;  4CCM A;  2ZIV A;  1MW7 A;  3JPS A;  5EDN A;  3ZQQ A;  2IT0 A;  2ZFU A;  1KDH A;  2IS1 A;  4BGD A;  3WKE A;  2I1Q A;  5AKX A;  4OWR B;  3EYI A;  3SAF A;  1QQ6 A;  2HOF A;  4EEK A;  5ICF A;  2DMP A;  2LD5 A;  4F4Y A;  3QEA Z;  3DPT A;  3DBH B;  4M6V A;  4AVP A;  2AXT U;  2HVH A;  1MBF A;  3O6B B;  2L5Q A;  1FX7 A;  2EJR A;  3K4G A;  4GYI A;  1V97 A;  5ALP A;  4QZG A;  1NK0 A;  2P5L C;  4RQN A;  2HXO A;  3CZ6 A;  2KEY A;  2KHV A;  2XRO A;  5FRN A;  1IDZ A;  5J0R A;  4TV7 A;  3QP6 A;  4RM3 A;  3JPN A;  1I6H J;  3HOU J;  1T7P A;  5LHH A;  3Q8M A;  8ICK A;  3H3U A;  5HLH A;  2HEO A;  2KIU A;  5JHF A;  2OUM A;  2NVT J;  3DPL C;  3IN5 A;  1I5Z A;  1U49 A;  4I28 A;  1FMV A;  2FNP A;  4EVI A;  4ZC3 A;  2HVI A;  5M5W J;  3TAD A;  2EIJ H;  2BY1 A;  2MG4 A;  1S7E A;  2ECC A;  3ZXS A;  1EJ9 A;  4V19 K;  2M34 A;  4WX9 A;  2BR0 A;  2OA4 A;  1GVD A;  4XOR A;  2KV2 A;  5ALN A;  2EH9 A;  1RUN A;  4JV1 A;  4GC7 A;  2DKX A;  2A05 A;  3FAH A;  3DBL B;  2H6C A;  1SD4 A;  4Y13 A;  2L7K A;  4F92 B;  3EPG A;  2C22 A;  2R8J A;  5CQE A;  4YQW A;  3M8E A;  3GV8 B;  1FMW A;  3E5X A;  4NC8 A;  3S2W A;  5B1A H;  3B6A A;  3MEX A;  5EGO A;  3OSN A;  4DSF A;  4I2F A;  8ICO A;  3Q8Q B;  1XCV A;  2HOA A;  3EDP A;  3ABU A;  4BQO A;  5IYB J;  2J6S A;  2MW8 A;  3HBL A;  4PSW A;  3MKW B;  3CCM I;  1B1B A;  2KPM A;  1O3S A;  3R0J A;  5J0Q A;  3PM1 A;  1FFV A;  2PMZ A;  3EUK L;  4WXH A;  5FO5 A;  2IAI A;  2M0M A;  1BOA A;  1TT5 B;  3R60 A;  1VQP I;  1BJZ A;  4IF4 A;  4EZ6 A;  2DQL A;  4W97 A;  3TED A;  3M8J A;  2OHF A;  2PN6 A;  5L1M A;  3FX3 A;  4ASN A;  2ZUC A;  3KZI U;  1D0X A;  2EH3 A;  5CHG A;  1JX4 A;  4GXK A;  4M6Y A;  2VQH A;  5L3E A;  2FRH A;  4UB8 C;  3HM5 A;  5B5E U;  5C5J A;  5CP2 A;  8ICW A;  2XRN A;  4U7D A;  4U7C A;  3HTU A;  1BIB A;  2E35 A;  4NDL A;  2BDP A;  4BAC A;  4DSI A;  8ICY A;  3QP5 A;  1JHF A;  1FIA A;  2DTZ A;  3K1R B;  4G94 A;  5DCM A;  5ALI A;  1W7P D;  2R5Z B;  2KJC A;  3WK4 A;  5AKY A;  4BL0 B;  7ICO A;  2GM4 A;  1UFM A;  2DA5 A;  2J5O A;  4UVB A;  5KFD A;  3K1N A;  1FBU A;  2MYS A;  4LIV A;  4XN0 A;  3PO3 J;  4BQQ A;  3KHG A;  2DKZ A;  1L3T A;  4Q8F A;  3SV4 A;  1HXD A;  3GQC A;  1KRP A;  3QOP A;  5F64 A;  4RU9 A;  3C28 A;  3ICX A;  1LNW A;  1UG2 A;  1N61 A;  1L7O A;  2HDW A;  2FE3 A;  1X1A A;  2VPR A;  3DWL E;  4XLC A;  2M7A A;  2UUZ A;  4U0Y A;  3QUT A;  1R4M B;  1P7D A;  4DJA A;  3LK9 A;  4KIS A;  4UB4 A;  1BM9 A;  2Q0O A;  3HRT A;  4IS7 A;  4CE6 A;  1T56 A;  1NK7 A;  4G7H F;  2D1H A;  1BA5 A;  3KD3 A;  5AM1 A;  5ALT A;  3RJH A;  7ICF A;  4C8N A;  4G6Q A;  2IGK A;  1KFD A;  2FQ3 A;  5CLS A;  4KIT B;  3DU6 A;  2FPL A;  2HMX A;  1LKY A;  2PFP A;  2HQR A;  5FKK A;  1IRF A;  3L00 A;  3K2A A;  5J8F A;  4G9B A;  3ZDC A;  2AGP A;  4YP3 A;  4YRV A;  2E1C A;  2A6T A;  3PIO F;  1DK2 A;  3AG3 H;  2CUZ A;  3CF2 A;  3S2D J;  3KYC B;  3IRR A;  4M3G A;  1HKT A;  4B1R A;  1MND A;  1I3Q J;  1ZGJ A;  2P7V B;  2QGU A;  4PCQ A;  4ZYE A;  5IPA A;  2Y9Z A;  4DFP A;  2KZZ A;  4R1H A;  4I2A A;  2GWR A;  4I2D A;  2RRE A;  2ESH A;  1QRY A;  3I54 A;  4HAI A;  4KN7 A;  2Y1I A;  4IQ4 A;  1ODD A;  7ICU A;  4B8X A;  2MAB A;  1K78 A;  4RQ8 A;  3GFI A;  3IWZ A;  3QYE A;  1IC8 A;  3S2H J;  4C0Z A;  4QZI A;  1P4A A;  3DKY A;  2DA3 A;  2NVY J;  4RT2 A;  2OAZ A;  1BPY A;  2IMW P;  3HOT A;  1JRP A;  3O2P E;  4MNU A;  4OO1 J;  1IN4 A;  3FXU A;  1USS A;  2BBY A;  2PJR B;  3KFU F;  2KDZ A;  2E36 A;  2FSW A;  5EEG A;  2LI6 A;  2YSR A;  1T8I A;  4KLL A;  2D3D A;  2DJI A;  3PNV A;  1DQU A;  3GCM A;  2B9S A;  3QEB Z;  3V4G A;  3C5G A;  1VQO I;  2W25 A;  3TAC B;  1HUZ A;  5ALZ A;  1XSX A;  4NBQ A;  1S5L U;  5AKI A;  4GIB A;  4FCY A;  8ICH A;  4IQJ A;  1WUD A;  1D5Y A;  4QZC A;  1MBH A;  1IXR A;  1QH9 A;  3UNG C;  2WTF A;  1JJ8 C;  4JX5 A;  1FTT A;  1XO1 A;  4KIG A;  2R3S A;  2B6G A;  9ICJ A;  4FHT A;  2KMD A;  2JRZ A;  2HOE A;  1R00 A;  3K2Z A;  3HKZ C;  1DPU A;  3DEE A;  3WE3 A;  2WF9 A;  3AM9 A;  3NGD A;  2IHN A;  2IOH A;  4DZJ A;  5HS8 A;  1Z00 A;  3H9Q A;  5AKZ A;  2BGC A;  2CGP A;  4MEX F;  2HHX A;  2XCP A;  4R63 A;  3S3M A;  5J2C A;  1Z67 A;  5C3E J;  5ALL A;  1TWA J;  5HNF A;  3OYJ A;  4A3I J;  2DA6 A;  4KLH A;  1XDS A;  4NY8 A;  3MKL A;  2HKO A;  4PJM A;  3IHQ B;  4YG2 A;  2PBI A;  2B0L A;  2K9S A;  2MLG A;  4MFD A;  1HOM A;  3ZGK A;  4QZH A;  4WF2 A;  1SKS A;  1RYS A;  3O8H A;  3QAH A;  4BUG A;  5HOD A;  9ICN A;  3LFU A;  2L7M P;  4IPA A;  3ZQ7 A;  3BJA A;  1YZ7 A;  2JH7 A;  5H2F U;  3F2D A;  1IXR C;  4OIR F;  2J6T A;  2XC9 A;  1Y56 A;  1ZQU A;  3C2K A;  1FPQ A;  2H27 A;  3GZ5 A;  1V5G A;  5JLW A;  1A6I A;  3GTM J;  3BOQ A;  2NNY A;  2ZIW B;  5AHX A;  3IP4 B;  3OYI A;  3CMM A;  4BU2 A;  5AI6 A;  3TFR A;  3KLN A;  4L5I A;  4FO6 A;  2CV1 A;  4L5E A;  3FBI B;  3PX4 A;  3LSK A;  3Q8K A;  1RR7 A;  3DXJ F;  1F0M A;  1BR1 A;  2ME0 A;  4J9S A;  2ES6 A;  4XIC A;  4XSX F;  4EM1 A;  1SEU A;  3GII A;  1KQQ A;  2LTP A;  1XMX A;  2IHM A;  3CRX A;  4RS8 A;  2CPR A;  2DA4 A;  3RAQ A;  2KN7 A;  4EAT A;  4P1W A;  1SAX A;  1WH7 A;  3V8J A;  1OKR A;  8ICE A;  5TJJ A;  2NNN A;  4XSZ F;  5F0C A;  2CO5 A;  4E7I A;  3ZDD A;  4FS1 A;  5H2F C;  1YYV A;  4U87 A;  3NVV A;  2HKX A;  1YRN A;  1K61 A;  2DK8 A;  4MHG A;  3WU2 C;  3MR2 A;  2ZC2 A;  2DFF A;  5A2Q Z;  4C7Y A;  4PGY A;  4UQG A;  3FDS A;  2L0K A;  1WJE A;  3U1D A;  1XTA A;  2V4R A;  1H88 C;  2YUS A;  4BYY A;  3IKV A;  3VEP A;  5K5Q A;  3S17 J;  1ZRN A;  5KFH A;  1HW2 A;  4UBB A;  3UQ0 A;  2GZW A;  2Z2S B;  3D2N A;  1NOM A;  2P0W A;  1R5I D;  2IGM A;  1F4K A;  3CNH A;  4C4R A;  4EMS A;  1S76 D;  2JH1 A;  3TMO A;  2QSF X;  2RQP A;  4BHP A;  1IRZ A;  1WH5 A;  2P4W A;  2WAE A;  2CJJ A;  4A69 C;  3CME I;  1R9T J;  1F43 A;  2KHM A;  1FFU A;  1FP1 D;  5FKN A;  3ZPL A;  2AGO A;  3GO5 A;  3J7A O;  5C0Y A;  1BNP A;  1MMA A;  2AQE A;  3JW4 A;  4DW6 A;  3E6C C;  3OYF A;  4FZM A;  4QNL A;  1TP4 A;  3J81 Z;  3LNQ A;  4K4G A;  2W84 A;  3SZG A;  4CCN A;  3KBB A;  3JRH A;  1U8B A;  4RM2 A;  4Y2Y A;  3RAX A;  1REP C;  4S04 A;  1XSV A;  4KYW A;  1QSY A;  1CI4 A;  1ZQ3 P;  1MA7 A;  3BG7 A;  2HYG D;  4S05 A;  1JAL A;  3GDX A;  2DOD A;  2Y30 A;  3ABM H;  5KL8 B;  1WWX A;  1TQM A;  2YX7 A;  2N1R A;  2W04 A;  3Q8R B;  3BPX A;  2IS4 A;  3OIO A;  2CV2 A;  4MQV A;  1FP2 A;  3RH5 A;  2DMT A;  1S0N A;  3NAS A;  4LIU A;  2PI5 A;  2BPG A;  2KIW A;  5AK5 A;  4ECS A;  2XPW A;  4GC6 A;  5H6R A;  4ECT A;  4GXJ A;  3RKY A;  3DKX A;  3J7Z I;  1UT5 A;  1PP7 U;  3M1C A;  4J9M A;  1U78 A;  4QZD A;  2PFB A;  1ZTR A;  5EG0 A;  2P6R A;  5AIP A;  5AM2 A;  1ZLK A;  4PDK A;  1YS7 A;  2H3Z A;  3MKY B;  5GAG J;  4ED0 A;  4KLO A;  3HC7 A;  1J2X A;  1X42 A;  4YVZ A;  4CYD A;  2K9Q A;  4KT5 C;  2VA3 A;  1YQA A;  4PL2 A;  3DF8 A;  2E2H J;  4N9I A;  5KFS A;  2DU9 A;  2W9B A;  3TI0 A;  5KG7 A;  2XHK A;  2K02 A;  1CUK A;  2HQN A;  1E3P A;  1RIO H;  2O61 A;  3T5K A;  3RRG A;  1GVJ A;  2RRD A;  3HIF A;  3VCB A;  2PMZ N;  4HSR A;  5TGT A;  5H20 A;  4KN4 A;  5D5U B;  1QQ5 A;  2DFL A;  5KT4 A;  3JPT A;  4C4S A;  4AD9 A;  2OCC H;  3ZCO A;  4U0W A;  2DPI A;  1WG8 A;  1E17 A;  3RJI A;  1PUZ A;  3F8M A;  5J0W A;  5EE1 A;  3HX0 A;  4WXC A;  4PGG A;  3I76 A;  1JUD A;  1HIW A;  1TK0 A;  3SYT A;  3GTJ J;  1KON A;  4CCK A;  2LK2 A;  1HC8 A;  2A1J A;  5KT6 A;  2E1M B;  1KU2 A;  2I5H A;  5F1R A;  1ZQO A;  1YW8 A;  3TDZ C;  2NRZ A;  1QTM A;  2B0C A;  2JEI A;  1W4M A;  3JRB A;  4US8 A;  2ODG A;  3GF2 A;  4DL5 A;  5EEH A;  2NS7 A;  4PJ0 U;  2A6E F;  1ZQE A;  3GW2 A;  3M8R A;  3T1B A;  1XSD A;  8ICM A;  2UZK A;  4BJQ A;  1FT9 A;  3RYP A;  5LHI A;  1X2M A;  5KNL A;  2O6G E;  3GTL J;  2E1N A;  1GHC A;  1ZRM A;  2E3T A;  1Z1B A;  2F48 A;  1OUQ A;  4R8H A;  3KZZ A;  4XOT A;  4XRM A;  4BEH B;  3VYU B;  3H9G A;  4DEZ A;  2LKX A;  2DO7 A;  4M74 A;  5F6F A;  2ZXH A;  5IT9 Z;  2X48 A;  3ZMV A;  4DL6 A;  4D5F A;  4DLG A;  3MVP A;  2PMZ F;  5L1I A;  2FU4 A;  2QAR A;  2ZIU B;  1S7A A;  1I39 A;  2MD5 A;  1TL8 A;  2LOO A;  2IJL A;  1UHM A;  4NC7 A;  2FOW A;  2KIF A;  2E2J J;  1X1P A;  2ATL A;  1RQN A;  5EWG A;  1N75 A;  4AWX B;  1Z3Y A;  3CUQ C;  2AHO B;  3H0M B;  2IA1 A;  3RQI A;  3RFA A;  4UB8 U;  5BOL A;  2ZBK A;  1SIJ A;  1Z1V A;  1Y6I A;  4P9U A;  2FLN A;  3IH3 A;  3NEU A;  4B48 A;  3DP7 A;  5LEJ A;  4Q4Z F;  3SEZ A;  2IOF A;  2DJN A;  5DKW A;  4MEX A;  3BR6 A;  3GIJ A;  3CCR I;  4AIK A;  2O9L A;  2ELJ A;  3GZN B;  4M9Z A;  3SFZ A;  4M3B A;  2W11 A;  4A3G J;  3H5R A;  3OHB A;  2XB0 X;  3HRD D;  2CUE A;  2PJP A;  3B0X A;  1A31 A;  9ICP A;  1XO0 A;  1BVS A;  5FB2 A;  2Y69 H;  2VC1 A;  4MEY F;  3TBI A;  2QLZ A;  3H5A A;  4I01 A;  1ZJM A;  1I1S A;  1ZN2 A;  1OR7 C;  4I2O A;  2HDO A;  1FBS A;  1BI1 A;  2FMY A;  3AQE A;  2W7O A;  2KQR A;  2DOE A;  3M8F A;  5B1B H;  3CC4 I;  1ZQF A;  1XG1 A;  4BS9 A;  1X9M A;  4L0Z B;  2BPF A;  4F93 B;  4J9O A;  2JA8 J;  2MAX A;  3NVZ A;  1V4R A;  2DFI A;  2A3V A;  2VOO A;  3F8N A;  5KFF A;  3MFH A;  1HQC A;  2HHU A;  5HHH A;  2WHE A;  2YML A;  1ULY A;  3A2K A;  3PSF A;  1ZQC A;  3ZDB A;  3E7L A;  3WKC A;  5KFB A;  3H40 A;  1E0E A;  4O0I A;  1SKW A;  2CG4 A;  4J9R A;  2IP2 A;  1L3U A;  3PUB A;  7ICK A;  3LAP A;  2CQQ A;  3P7N A;  3L2R A;  3SAH A;  2F5C A;  1KA8 A;  5IT3 A;  1L3L A;  5AM5 A;  2W3S A;  4HX7 A;  1XSN A;  4IRD A;  3LA3 A;  4RQM A;  3CJT B;  3KPH A;  2F76 X;  2I6X A;  4DL3 A;  4FFD A; 
#chains in the Genus database with same CATH homology
 4RMN A;  2XID A;  2K4E A;  4ANJ A;  4WJ3 B;  1GLN A;  1LDK B;  4B3X A;  4LIT A;  5CRX A;  2XF5 A;  4DIQ A;  4XLA A;  3F9K A;  4E7K A;  3RF9 A;  3F5E A;  2HBM A;  2E5Z A;  1QHH D;  4BE1 A;  1U0J A;  3HOS A;  2JMG A;  2W1O A;  3TL4 X;  1TT0 A;  2X6Y A;  1X1C A;  4F55 A;  4CH7 A;  2CH0 A;  2L9N A;  3BCB A;  3PL8 A;  3OYC A;  1SFK A;  5FRO A;  4CDG A;  2KVC A;  4KMO B;  4D9J A;  1IIP A;  3EUH C;  2BOL A;  3NWS A;  2DXI A;  3OR2 C;  2E5N A;  2VIX A;  4CZC A;  4HNT A;  4XKW A;  4F91 B;  3K4K A;  2CUJ A;  4OAZ A;  3SMV A;  3OYD A;  4J00 A;  2WAQ A;  1Q3U A;  3DU5 A;  2RHF A;  2HNH A;  1D1A A;  4PJJ A;  2O5R A;  2X85 A;  4FAS D;  3F2C A;  3PZP A;  4ZDO A;  2GOM A;  4FET A;  3O0F A;  4AU7 A;  4XKV A;  2E60 A;  2LBF B;  2LRD A;  2W4S A;  2E1M C;  2K3P A;  2CRX A;  3KX2 A;  4ZTF A;  1BR2 A;  4NNJ A;  4XN3 A;  1BOB A;  3NUQ A;  2LC2 A;  1R6R A;  2QKM B;  4OJ5 A;  2XDV A;  1P9Q C;  2JVG A;  4OJL A;  2GOL A;  3VSL A;  4OJO A;  3RSN A;  2YB4 A;  3OIQ A;  2JVH A;  2M4K A;  3PNT A;  4IZZ A;  4JMU A;  4CRX A;  2ZIW A;  4XL9 A;  1ERD A;  1DGW Y;  2AQF A;  2K9M A;  2ZIX B;  4PL1 A;  3F2B A;  2HZD A;  2KJ5 A;  3S3N A;  1SAU A;  3PJR A;  2VQG A;  2GOX B;  2W82 A;  2XAU A;  2HU9 A;  3NRW A;  2UWM A;  4BX9 C;  4PK4 A;  3FHN A;  4KJZ A;  2WAQ C;  2OM6 A;  3AFH A;  4JOM A;  1JI8 A;  2LYA A;  2IS2 A;  4CCM A;  2ZIV A;  2CV0 A;  1MW7 A;  3ZQQ A;  2CW8 A;  4HEA 2;  2ZFU A;  2IS1 A;  4BGD A;  3ALR A;  2HOF A;  3EPZ A;  4OWR B;  3SAF A;  3VYS B;  4A8E A;  2VQC A;  3DPT A;  2MC4 A;  4DBQ A;  2L2O A;  3OYB A;  2Y0S C;  3N7S C;  3K70 D;  2L5Q A;  3VYT B;  4BQN A;  2NV3 A;  4PFO A;  4C30 A;  2K5C A;  3IUO A;  2KHV A;  3CZ6 A;  2KEY A;  4AVZ A;  2DT6 A;  3CP8 A;  5FRN A;  5HR7 A;  4E7L A;  4RM3 A;  4B47 A;  1WJ5 A;  3D5R C;  4ZDP A;  4HRI A;  3ONQ A;  3K10 A;  2G08 A;  2G09 A;  3OYE A;  1N77 A;  2VKD A;  3C2H A;  2DOA A;  3L2Q A;  1TZL A;  3IN5 A;  5JHF A;  2OUM A;  1PVP A;  3DPL C;  2Z7J A;  3DQV C;  1FMV A;  3OS2 A;  3OYL A;  4ZC3 A;  4IKF A;  3OL4 A;  2ZIX A;  4XNF A;  1EA3 A;  2KMU A;  4FZL A;  3ZXS A;  4CGZ A;  1D8B A;  4XM3 A;  4XOR A;  4NQW B;  3OYK A;  2JUG A;  2KV2 A;  2Q4T A;  2HBK A;  4BJT A;  4C2T A;  2XI9 A;  4QIW C;  4F92 B;  2L7K A;  5CQE A;  2K4H A;  2CN1 A;  2KNJ A;  1D1B A;  1D1C A;  1FMW A;  3K4N A;  3H35 A;  4NC8 A;  2ZIU A;  4P0P A;  4P5O A;  2R7S A;  2K9L A;  3J7A Y;  2R7O A;  4BQO A;  1LVK A;  1UG0 A;  4U6P A;  1WJB A;  2HVQ A;  3HPG A;  2KRC A;  4PSW A;  3MKW B;  2KPM A;  2LBO A;  1A6S A;  2IXS A;  2PMZ A;  3EUK L;  3FBN B;  2VPL A;  2M0M A;  4XON A;  3OS1 A;  1X19 A;  3DLA A;  5KCM A;  3OYA A;  4AYB C;  1HA8 A;  3S93 A;  3M8J A;  3OWT A;  3N7P D;  4N4O B;  1MMG A;  2K4I A;  2ZG6 A;  1D0X A;  4FE3 A;  1N78 A;  1L6N A;  3QYB A;  2VQH A;  3GBG A;  4BE2 A;  2KOB A;  2H3F A;  4XQF A;  3RQ4 A;  2ZSH B;  3PSP A;  2JSP A;  4U7C A;  1LFP A;  3A4C A;  2JA2 A;  3C29 A;  2RQQ A;  4BAC A;  3PNY A;  2D6F C;  2ZSI B;  2LH9 A;  2HOI A;  2DT7 B;  2KLO A;  4XMY A;  3DTE A;  3G2B A;  3E1S A;  5HNH A;  2VKQ A;  4BL0 B;  1WJC A;  2DGZ A;  1AA7 A;  2MYS A;  4XN0 A;  3HKZ A;  4LIV A;  2QKL B;  4BQQ A;  2K8A A;  2YB1 A;  4AYB F;  3OY9 A;  1DRG A;  2MD0 A;  1F44 A;  2A5W A;  3PSI A;  3C28 A;  2R7U A;  3ICX A;  3NWT A;  2HDW A;  4XLC A;  1X1A A;  3DWL E;  1SZH A;  2M7A A;  2UUZ A;  2VJ5 A;  2G07 A;  2LYB A;  3LVW A;  4DJA A;  3PFY A;  1P7D A;  2IGN A;  1QHG A;  4KIS A;  2X1C A;  4CCJ A;  5HLT A;  1X1B A;  2XIC A;  3DPU A;  4N4N B;  1OLT A;  4CCO A;  2YX8 A;  2WBM A;  4CSW A;  4B43 A;  2UV1 A;  2IGK A;  4O3M A;  5HR6 A;  4KIT B;  3DU6 A;  2HMX A;  4XLH A;  3M6Z A;  2X1D A;  3M6K A;  2W7N A;  3BC8 A;  3L3F X;  4E6K G;  1DGR M;  1T95 A;  4YRV A;  2PJR A;  1PJR A;  4XLF A;  2A6T A;  4KT6 A;  2LY2 A;  2CUZ A;  3HKZ F;  3CF2 A;  3VC8 A;  2H3I A;  1MND A;  4ITV A;  3QOD A;  4QIW F;  2E1E A;  2RRE A;  2G06 A;  3H5N A;  4IQ4 A;  4OAY A;  2M3A A;  2W00 A;  2MAB A;  4E7J A;  3L2W A;  2RNG A;  2WY8 Q;  3QYE A;  3OS0 A;  2KJ8 A;  4C0Z A;  2WA0 A;  3DKY A;  4H4K C;  3MMY B;  4PFP A;  2Z1D A;  3HOT A;  2OYY A;  2W03 A;  4OO1 J;  2Z16 A;  1MMN A;  2PJR B;  2K8B B;  4ICA A;  1Z21 A;  3KFU F;  2DJI A;  3K4C A;  1DQU A;  3CP2 A;  3PNV A;  4PUS A;  4E4H A;  4J01 A;  3F5A A;  3KZX A;  2V6E A;  4NLC A;  3D5S C;  4IQJ A;  1WUD A;  2KL4 A;  2NOJ B;  3UNG C;  4Y3O A;  1Z7L A;  2XSJ C;  2WY7 Q;  2KRH A;  2VXD A;  3U21 A;  1ECW A;  3HKZ C;  3DEE A;  4X0G A;  2HPI A;  3H9Q A;  4PJN A;  1YE9 A;  3S32 A;  1ZEL A;  1PVQ A;  3S3M A;  2KJ9 A;  5HNF A;  3OYJ A;  3K4L A;  5CPR B;  2KD1 A;  2G5H B;  3M7D A;  2FUG 2;  4PJM A;  2OV7 A;  1URJ A;  2R18 A;  3OYN A;  2F5V A;  2BW3 A;  3E0J B;  4II2 A;  2VXZ A;  3ZGK A;  3OYM A;  3AL0 B;  4BDZ A;  5HVQ C;  2KZV A;  4BUG A;  2IGO A;  2F8L A;  2H3V A;  3LFU A;  2R7Q A;  3LMM A;  1PYV A;  4IC9 A;  2JH7 A;  2F77 X;  1KBU A;  2KP6 A;  3F2D A;  3OMY A;  4HST A;  1Y56 A;  2ZXI A;  3EUA A;  2LHT A;  1V5G A;  2BVM A;  3FDY A;  4F52 A;  4CA0 A;  2Q1Z B;  2HVS A;  3T79 A;  2ZIW B;  3IP4 B;  3VYR B;  3CMM A;  3RTR A;  4BU2 A;  1NG6 A;  3OYI A;  3LL7 A;  3N05 A;  3LSH A;  1YX5 A;  3K6G A;  4E7H A;  2X6X A;  2CV1 A;  4XKB A;  3FBI B;  2MRL A;  4OJ6 A;  1S9H A;  3LSK A;  3OL3 A;  1BR1 A;  3ZRG A;  1D0Y A;  4KX3 A;  1VZ0 A;  2R7X A;  4C2U A;  4PSX A;  2MA1 A;  3CRX A;  3LYS A;  2CPR A;  3BLY A;  2VAS A;  4EAT A;  3C2G A;  2CFO A;  2XF7 A;  3BCA A;  4P1W A;  4QPO A;  3V42 A;  2K89 A;  5FRM A;  3H0R B;  1ZQ1 C;  4E7I A;  1T94 A;  3W2W A;  4JQF A;  1T0F C;  2RP5 A;  3N7R C;  2V7F A;  4U87 A;  3D2S A;  3HL2 A;  4PJL A;  3K4M A;  2JHD A;  2BW3 B;  3HXL A;  1NG7 A;  1WJE A;  4YEL A;  4AYB A;  4HNU A;  2I8D A;  5A0L A;  2KIC A;  3RCO A;  3IAM 2;  2VKH A;  3L2V A;  4XLE A;  2Z2S B;  3D2N A;  3OIP A;  2P0W A;  2IGM A;  1UEL B;  2HBL A;  4HG2 A;  2JH1 A;  3TMO A;  4YEJ A;  4ZYA A;  3LSG A;  4F3Q A;  2WAE A;  3HUG B;  1K6Y A;  3LSM A;  2XC7 A;  2VLA A;  1WJD A;  3GU3 A;  2KHM A;  2VJJ A;  5C0Y A;  1G8X A;  2CS3 A;  3DTI A;  1MMA A;  1V5F A;  2AQE A;  4OJP A;  2H3Q A;  2W7P A;  3OYF A;  3SAG A;  4FZM A;  3F53 A;  4QNL A;  2V4J C;  1X4O A;  2Y0S F;  3CJR B;  4XKC A;  3SZG A;  4CCN A;  1G59 A;  4RM2 A;  3AKZ A;  3UR3 C;  2LYC A;  1QU3 A;  3IAS 2;  3H0D A;  1MA7 A;  3BG7 A;  2LRE A;  5KL8 B;  1W36 D;  2N1R A;  2W04 A;  3SQI A;  3KEY A;  2IS4 A;  3LVV A;  2CV2 A;  4NUB A;  1MMD A;  2XVT A;  3OPX A;  4LIU A;  2KIW A;  4GRI A;  1PVR A;  3DKX A;  3M1C A;  2KKV A;  4ACO A;  2H3Z A;  3SDB A;  2M0N A;  2M4G A;  3MKY B;  3HC7 A;  2F6C A;  1ED1 A;  2LKY A;  2OXO A;  3HG9 A;  3W3C A;  2R7V A;  4IX7 A;  2X6W A;  2HVR A;  4PL2 A;  2KDO A;  1D0Z A;  2HOQ A;  1TAM A;  2BVL A;  4HPQ A;  4RLQ A;  3AL0 C;  3S8P A;  1NZB A;  2VJ4 A;  2CW7 A;  1J09 A;  4FZN A;  4E7Z A;  2WB1 A;  2CMP A;  2RRD A;  3VCB A;  3CJQ B;  4HSR A;  5TGT A;  1HEK A;  3K4B A;  4ZTJ A;  4BDY A;  2VB6 A;  1BR4 A;  3ZCO A;  3VDX A;  3S3O A;  1YX3 A;  3CES A;  1W36 C;  2WB1 F;  3D2Q A;  2L9S A;  4Y33 A;  3K4J A;  1HIW A;  4C9Y A;  3SYT A;  3K70 C;  1KON A;  2V9K A;  4CCK A;  5HOO A;  1V5E A;  4BXF A;  2E1M B;  2DQN B;  4P0P B;  2DCE A;  2Q2E B;  3IG8 A;  2VL8 A;  4ZJZ A;  2R7W A;  2BDU A;  4GFJ A;  3E0F A;  3A1Y A;  2WAQ F;  5LD2 C;  2M7B A;  3QYF A;  3L2U A;  1YT3 A;  2HPM A;  3MD2 A;  1WFX A;  3AQF A;  2R7R A;  2X51 A;  3H0L B;  2MFZ A;  4BJQ A;  1X4P A;  2F2A B;  4CCL A;  3IG5 A;  3OOU A;  5KNL A;  1Z1B A;  2LY1 A;  3FKJ A;  3GZF A;  1OUQ A;  4BE0 A;  3DTK A;  4XOT A;  4BEH B;  3I9V 2;  3H9G A;  3VYU B;  2KKP A;  3MGV A;  2V1N A;  3W2V A;  2ZXH A;  4LG3 A;  5KHD A;  3H9J A;  3K1Z A;  2PMZ F;  2Y0S A;  3CYM A;  2ZIU B;  3QOE A;  4QPQ A;  1WJA A;  2LOO A;  1WJF A;  2XF6 A;  4NC7 A;  3SEQ A;  3D5L A;  1DP3 A;  1GO3 F;  2IS6 A;  1N75 A;  1Z3Y A;  3H0M B;  3RFA A;  2E1F A;  2LBF A;  2R4G A;  2WAD A;  2K8C B;  1CRX A;  4P0Q A;  4U7B A;  1Y6I A;  1MNE A;  4B48 A;  1IRX A;  2E5S A;  3SEZ A;  1LKX A;  2GH1 A;  4NLB A;  3ONN A;  2VJI A;  3VSK A;  2R7T A;  4BEH A;  2G0A A;  2KHQ A;  1Z19 A;  3HPH A;  1UAA A;  2ELJ A;  4ZDL A;  4QJF B;  1Q3V A;  4Y4R A;  4NWI A;  3H5R A;  3OR1 C;  2VQL A;  2V26 A;  3W2A A;  4XOP A;  3BG6 A;  2X1E A;  3OYG A;  4DGW B;  4BJ6 C;  1XO0 A;  2OH2 A;  3TBI A;  3H5A A;  3PST A;  4DOZ A;  2JGA A;  1OR7 C;  2W7O A;  2WB1 C;  1A0P A;  4CUG A;  3AQE A;  2OC6 A;  2KQR A;  4MLO A;  2LG4 A;  4P0Q B;  4BS9 A;  2WAF A;  3KYL A;  4F93 B;  5T14 A;  4BUP A;  4KX5 A;  5CQG A;  2A3V A;  3VWB A;  1UPH A;  4E7S A;  2HBJ A;  4NV0 A;  1XNS A;  3RPU D;  4B44 A;  2ZIV B;  3A2K A;  3PSF A;  4XR6 A;  4D1Q A;  1E0E A;  1Z3X A;  3PUB A;  2PMZ C;  4II3 A;  4RLF A;  4R79 A;  3L2R A;  3SAH A;  2G5I B;  2DF4 B;  5KL1 B;  3I3L A;  2HQA A;  3LSI A;  4DBR A;  3MKZ A;  4BJ5 C;  3ZR8 X;  2F4I A;  1X1D A;  4G6T B;  2F76 X;  3OYH A;  5LFA A;  5CKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...