3IP4B

The high resolution structure of gatcab
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
482
structure length
482
Chain Sequence
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Two distinct regions in Staphylococcus aureus GatCAB guarantee accurate tRNA recognition
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Ligase
total genus 168
structure length 482
sequence length 482
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ip4B03
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3ip4B02
3H0LB 1NG6A 3AL0B 3H0RB 2D6FC 2DF4B 3IP4B 2G5IB 4WJ3B 2F2AB 2G5HB 1ZQ1C 3H0MB 3KFUF 2DQNB
chains in the Genus database with same CATH superfamily
4FETA 1DP7P 4FTHA 2JGAA 3H5AA 2AXTC 2E60A 2Y1JA 3HSRA 5ALHA 2ICWG 5KFMA 1Y6IA 2AXLA 2PLYA 3JSPA 3KHLA 2P6RA 1CGPA 2BW3B 3BTLA 3AG4H 2L4MA 3OSFA 2IBDA 2O3FA 4BY1J 2FJ1A 3TBIA 4JMUA 1D8YA 1I1SA 4UUTA 2HVIA 9ICPA 4LG3A 2FI1A 1VQ7I 5AHXA 4G6DA 2Y69H 1WHUA 1X6IA 1EA3A 3OSPA 3KTQA 1GXQA 2PX9A 1X1BA 4NC8A 3RJJA 2VBXA 4DQQA 3EYZA 2LI6A 2JK3A 4UB8C 3PO2J 3LSTA 2BDPA 4F2RA 4Q44A 3DDHA 1TW3A 4M3DA 8ICPA 4P4PA 1Z67A 4Y15A 1WJFA 2FE9A 2OHFA 2ID3A 4C3JJ 3K4CA 3MVPA 3L2WA 3M8SA 2DPIA 3CQZJ 4EELA 4WJ3B 1MDMB 1HDPA 3NARA 1OCRH 2M7BA 5FFXA 1VNDA 2PFPA 8ICRA 5AI6A 2DA1A 3F2DA 2HVRA 3PNVA 5DB6A 2H3QA 3GUDA 4FASD 4DZPA 3CESA 4DZJA 1D1BA 1OJLA 2BHYA 3BG7A 1K61A 2KV2A 2WAEA 4KUMA 4RQ3A 2EH3A 3CDIA 3FK7A 1KYWA 2ACJA 3CJNA 4HX7A 7ICFA 2F1JA 2L54A 2L7MP 4J9SA 5LGTA 1P2FA 1BI3A 1Y8RB 1XNSA 2K9MA 3GLLA 3KEYA 1S5LC 2FXAA 3IAM2 4A3BJ 3LNQA 2HHUA 5J0PA 5K7HA 4UB6U 4BY7J 4ED6A 2QQBA 1VQ5I 1FOXA 4HX4A 3OIOA 2OEHA 3RKXA 2DDBA 3QP5A 3HDDA 1XCVA 2R7RA 2Z1DA 4HF0A 2HBKA 1H89C 1S10A 2XAGA 3JPNA 1LEAA 2VKEA 3MZHA 3CCUI 1IUYA 4IHXA 5DM6F 3PSTA 4QIWC 1AHDP 4UAWA 4S04A 4XLAA 4IRIA 2XVCA 5D4SA 4YFKF 3EYIA 5KFHA 1DP3A 2VLAA 5KFEA 2PFQA 3FDYA 2M8GX 4KISA 3E97A 3WTTC 1JMSA 2LOOA 1JJ8C 4KMOB 4KLGA 2X1DA 1PDNC 1CRXA 3OGUA 3PMNA 1QQ5A 3HG9A 5DTDA 2ISZA 3PZPA 4FX4A 4GCVA 4Q8EA 3BJYA 1YYVA 4BJ5C 4BH9A 1C20A 4AIDA 1MH3A 4CUGA 3LSKA 1ZG5A 1K7AA 2O5RA 1J0RA 4II2A 3MN2A 2BYVE 4R65A 3BCAA 4F4KA 3GFLA 4QIWF 3PW4A 3ML6A 1R23A 1KRPA 2QF7A 5KFYA 5JLWA 1Y0UA 1VQ6I 4TQRA 3ZD9A 2AGOA 2O6KA 2FQ3A 5KFXA 1SV0C 3HOUJ 5J3LA 4LB5A 4A3GJ 2ADUA 4U0WA 2ZO4A 2BQRA 2OAZA 2OTJI 4D7MA 1YIOA 4XRSA 4UUSA 1I3QJ 3QPHA 3MR6A 1W7PB 4PUSA 3T5JA 2F5FA 3U2RA 5J2EA 2DL0A 4RPXA 5LBQA 2P5LC 2WB1N 2R5YB 1XPXA 3FISA 4U0VA 3P9KA 3C1DA 2ALZA 3M8FA 4C7ZA 4PHAA 1ZQ1C 5ALJA 2W82A 1KFDA 4DOBA 1IN6A 2F48A 3MDAA 1C7YA 5E3OA 2OM6A 4CYCA 3SYTA 5KFVA 3PUFA 1AKHA 2KFDA 2MC3A 1RETA 3EUAA 1GXPA 1QA6A 4LVSA 1VJ5A 4YD2A 1LKYA 4CCLA 1QPIA 3B6AA 3K9TA 1X1CA 5KT7A 1IZ1A 3KKAC 4C8KA 5KAFC 2AJQA 5EYRA 3AL0C 1K6OA 1NKEA 3ZDEA 1HBXG 1P4WA 1T38A 4UUVA 2BDUA 3NAUA 2O6GE 2ODGA 2NVTJ 5LLQA 3O8HA 1ITYA 2W11A 3H0MB 2ISYA 5JVGF 3OYGA 3HXLA 3HHGA 3HZJA 2HQNA 4A3FJ 3WTUC 1JIHA 5IYBJ 3AU2A 1NK6A 3V4GA 2EV0A 4B09A 3H9QA 3D6JA 1FY7A 2W4SA 4F2SA 2LY1A 1PP7U 2VKVA 4E7SA 5K5QA 1NH3A 5D5VB 5EEAA 5EJCA 2NNNA 3CJRB 3OYNA 5F64A 2WAQC 5FP0A 4NM2A 1IRXA 4YFKA 2JEGA 4GXJA 3SEQA 9ICJA 2V26A 5DB9A 2MGQA 4CHUA 1IDZA 2LYHA 5GAEJ 1TAQA 3HKZA 2Q0ZX 2XIGA 3JPPA 1TVAA 3RRHA 5EOZA 2VJ5A 3ASNH 5HDKA 2W9CB 1RR7A 3F6OA 1MGTA 5BNGA 4B48A 3ERMA 2KZZA 4EMSA 3CLQA 4XONA 4F8RA 4YIFA 4DO9A 5HS8A 3RDIA 5FFZA 5TRDA 2XPWA 3GTOJ 1IN4A 1YS6A 1HLVA 3BTJA 2DYRH 2CV2A 2LKYA 1WJDA 3BJAA 4NY8A 1HJPA 2WAQF 2KP6A 2P35A 3HIFA 5J0XA 4A0YA 1SFUA 2C2DA 4ZDOA 3FMRA 1NK3P 4K4GA 5FB2A 1SKRA 2PFOA 4RB0A 2VKQA 1WWVA 4ZYDA 3HX0A 4BUPA 2BVLA 4BE1A 1S29A 3T79A 1YJWI 1GT0C 4PZNA 2W84A 1WWXA 3RZOJ 5KG6A 4GC7A 2I10A 3GZ5A 4ANJA 3TACB 3TAQA 4LG0A 2A61A 1XGSA 4QZEA 2R5ZB 1XSNA 2XGPA 2UVVA 2BOLA 1P7DA 3V7SA 5E1ZB 3DLLF 4R1HA 3RYRA 2KICA 2XHKA 5E18F 4B4CA 2MC4A 3OS0A 1RG6A 3V7KA 3TEDA 3FM9A 2GO7A 3RTRA 3KZXA 3A0HU 5C0YA 4CICA 2C6YA 7ICOA 3W2VA 2P81A 4Y2VA 2EIJH 7ICIA 1KLNA 1V85A 1U0JA 3JRGA 2R7OA 1A6QA 5E8GA 4A3EJ 2ETHA 4EYIB 4S05A 1K79A 1F5SA 2JEJA 1FOWA 1BM9A 4F91B 1IGNA 4A8EA 5KT3A 3V7JA 1DQUA 2BY1A 3HPHA 5DCMB 5FLMJ 4ED0A 2DMTA 1VQMI 4F3OA 3F9KA 2NVYJ 3L9FA 4XICA 3JRFA 2W8LA 3BQ2A 2ZSHB 4L5EA 5E1XA 2STTA 2YQEA 1I39A 5KFTA 5LEKA 1HKQA 3KKAA 1NJXA 2VOOA 2DK8A 4PGGA 4RQ7A 5AIAA 1X2NA 1ZQRA 4DGWB 4OD0A 3L7WA 2VJ4A 3FXMA 3K69A 4I7HA 2AS5F 2JPCA 4IQUA 2BXYA 3VB2A 1WJCA 3DWLE 5LD2C 5FD5A 2XF6A 5EE3A 2V4RA 4HPQA 5DEQA 2ASJA 1ZGAA 2YX4A 2W1OA 2WC2A 1QCKA 2XF5A 2FDRA 1MBFA 3V72A 3F8BA 2LMRA 2HYGD 4M47A 2BY3A 2JA2A 1Z3YA 1WJBA 4QPQA 3TKYA 2DFFA 5J0YA 4NDLA 2XVTA 3PR4A 4IS7A 3SDBA 2WAQA 3KZIC 4EBDA 2EILH 4OJ6A 1XO1A 3RJIA 4ELUA 5ALUA 2PJRB 1DDNA 3H5RA 2W43A 4HAIA 2ZG6A 4KN7A 2HTSA 4YMOA 3KEOA 1LQ1A 2DA5A 3GFMA 3FM5A 4KN4X 2L9VA 2VBYA 1L7NA 3EQLF 2ZIXA 4BBRJ 3WHBA 4RZRA 2HBJA 5DB7A 3BDPA 2QARB 1RYRA 3D5SC 2GBYA 4UASA 2IXSA 5M5XJ 3A0BC 4C80A 5DQGA 2RDJA 3ZR8X 2Q0OA 2YMLA 1MNMC 5KT6A 2V79A 3G1OA 5K7FA 1LUJB 3FKIJ 2FA5A 4BHCA 3N7SC 4YN4A 1DOQA 4BE2A 1MQ3A 5DD4A 4A6DA 4Z6YA 2HDWA 5CJ7A 1BJAA 4IO9F 3CCJI 1X1DA 3QZ8A 4KLEA 4CCKA 3L1PA 2KJ8A 4US9A 2XGQA 5AKHA 1I6XA 1FMWA 1KQ0A 2DA4A 3KX2A 3LQRA 3S1MJ 1RM6C 1PUZA 4PHPA 1RQNA 4EQQA 4IRGA 4NLZA 2Q2EB 4BQQA 4DJAA 5K1YA 4J01A 2A07F 4KX3A 5CVRA 3CUQC 1AOYA 2F8LA 2FPMA 3BR3A 4I2EA 5KHDA 4LK0F 1R1UA 1FYLA 3QUCA 4QZGA 1L6NA 4NNJA 3ICXA 3I3LA 2E5ZA 4IOCF 1MKMA 1SB3C 4RUCA 2DMPA 2HVQA 3QP6A 2RREA 1SFKA 1SEUA 3BZKA 4KICA 1KKXA 1U48A 2W48A 3EUB2 4I2GA 4YR0A 1KONA 2LMDA 5J8YA 2X85A 4P55A 4UNOA 1LEBA 1TQIA 2QVOA 4O5CA 1F4KA 2XPVA 3H0RB 3I59B 4DL4A 1RKWA 2K3PA 3K1PA 2FEZA 7ICTA 2JA8J 1WH5A 5DB8A 4QWEA 4DL5A 1ZQPA 4ELVA 3CTAA 2ASDA 2OBPA 1I27A 2XO7A 4EBCA 2KLOA 2IBKA 1FP2A 2H3IA 2DI3A 4R63A 1O7LA 4HYEA 1IIPA 1ZQCA 3UXOA 1SWVA 4DL6A 3HRUA 4M72A 1S7OA 3GFJA 1YRNA 5ALEA 2AXTU 1XB4A 4QNLA 2GA1A 3GBGA 4CNQA 2K5CA 3GTLJ 1ZD3A 4B9VA 2ZJRF 3C7JA 2I9GA 2ZCWA 4ZJZA 3AN1A 4XR6A 1YG2A 1DXSA 2JRMA 2DFLA 4Y2JA 5LHIA 1JI8A 4XQ8A 1TWHJ 1FNNA 2R8JA 1YFHA 5J0TA 2CW8A 2AHQA 2OUMA 1YOVB 5GTIC 2XKPA 2DFHA 2H94A 2KRHA 5B66C 2WTEA 3BLYA 1A04A 2N8GA 2HNHA 2KISA 3E5XA 4HQMA 3V7CA 5JFRA 5KFAA 3IM1A 3G6XA 2EH9A 4GC6A 4B9LA 4F71A 4L9NA 4ZTFA 3K1RB 1N78A 4F50A 4DQRA 1Z1VA 1L8LA 4ZOHC 2HSZA 4LITA 3O8GA 3A01A 3REOA 4UB8U 1RYSA 4IRKA 4I28A 1MMDA 3FXLA 2H6CA 4LLGF 2O9LA 3N4MB 3BDDA 4XORA 5DLGA 4U88A 4NLBA 1R22A 3DCFA 3OYAA 2I8DA 1ZXIA 2JV3A 4OIQF 3J7AY 4KLOA 2M5WA 2W03A 4AUXA 4I76A 2K7LA 5IT9K 4IC9A 4J9RA 2WF5A 4BUGA 1WYGA 1MJBA 4XOTA 2A6TA 3M7GA 3F2CA 2FSWA 2WAFA 4IOAF 3BS7A 3JW4A 3LSIA 3O6BB 4S0HB 2Z33A 3CC7I 1RYUA 4QW8A 5ALKA 3KHGA 2QM3A 2MBFA 5KG3A 3JTGA 1RUNA 2Y0SC 1WJAA 1YX3A 4YFNF 2VUMJ 2FD5A 5J40A 4HNTA 5J2AA 4HV5A 4F7ZA 1NI3A 2COBA 5ICFA 4YP3A 2IGMA 2O0YA 2FF4A 1COOA 1FYMA 1P4AA 1S5LU 2H09A 4ZYHA 5EGOA 1B0XA 3C1ZA 1R9TJ 3OYIA 1X1PA 3DU5A 2X9DA 3ZOBA 5FO5A 3CUQA 1YS7A 4KMFA 3Q8KA 2EV6A 4C2TA 1ZD2P 2M34A 2LHTA 4BWJA 4KIGA 5A2QK 2IGOA 2EZXA 4QJFB 2LVSA 2BHZA 4XRFA 2KVSA 3WKDA 2ATLA 2G0AA 2Y0SF 4GDFA 4TV7A 2PEXA 5FLXK 3E6CC 1DGJA 9ICRA 1ETOA 1XGOA 3ZP5A 4R66A 5DS9A 4HDVA 3GDXA 2IHNA 3I5UA 1D8LA 4Z6CA 4H0EA 1GHCA 5F9NA 3UXPA 3RKQA 9ICGA 4F5QA 2JT1A 4NUBA 1TL8A 3RRGA 1O3RA 4B9SA 5LFAA 3RR8A 3KETA 4XK4A 4G9YA 3GLXA 2K60A 4J19A 4QWDA 1ZQMA 2QKQA 3OY9A 4LIVA 3JR9A 1LVAA 1U9OA 3E1SA 5GAGJ 1TQPA 1HW5A 1FYKA 1Q8KA 3FDSA 3R9KA 3VCBA 4YMMA 1MW7A 3TADC 3OSNA 2BPGA 5GPAA 4B47A 8ICKA 1BPXA 1SWWA 4C2UA 1N25A 1MBEA 2OJED 3I64A 3U1KA 3LFUA 1ECWA 1YJ9I 2YMQA 3PSPA 2LP0A 4JX6A 2HBMA 4KLMA 4F5RA 2D2WA 3OYEA 4HSTA 5L3GA 4RNMA 1U5TC 1VQKI 4JK1A 4PL2A 1OFCX 2DU9A 2W57A 4QSHA 3WE3A 2Y9ZA 3VFZA 5J2CA 3HBLA 3W2AA 1PK3A 2Y9UA 2NO4A 4PHEA 2YSRA 5K4LA 3W6JB 4MEXA 2E34A 4F52A 2OWOA 2DOFA 5F1JA 2R7WA 2D3DA 2VPRA 2M3AA 3ZPLA 3J81j 1MBKA 2A5YB 4P9UA 2PFBA 4QWAA 3QX7A 5IT9Z 2H3VA 3W6VA 3W2WA 4WXCA 2X1EA 2IW5A 4BDYA 1ZR2A 5FRMA 2W55A 1G3SA 3RKYA 1Z9CA 4QZHA 2FUG2 2PI0A 1K4TA 3WGIA 5EGOB 2FX0A 2DMQA 3IH4A 2ZIVA 1B8IB 2F8KA 4KDPA 5B5EC 4A3LJ 3OYMA 1NJZA 4YR2A 1P7JA 8ICBA 3S1NJ 2Y31A 2VQHA 3EUKL 1XSLA 4N4NB 1M6YA 2EDUA 1ZQYA 1NKCA 2BGWA 1S7AA 2P5KA 3PQKA 5JR3A 5A0LA 5HHIA 4M9HA 3GZ6A 1MZBA 2F5CA 5E79C 3MQ0A 5KFWA 1GVDA 1J9IA 2F3NA 5DLFA 1K6YA 1M1EB 3LK9A 1U4BA 4ECYA 4BX9C 5KK1A 1HC8A 1SV4A 1W7PD 4DS4A 5AONA 1V3FA 3IH3A 2Z9OA 3NVZA 4L9JA 1L3VA 2BXZA 2PMHA 4F3QA 5DBCA 5A2QZ 2JJ7A 4UY8I 1DU6A 2XGDA 5J0UA 4PHDA 4NLKA 4RQ6A 5HHHA 2LD5A 2WF6A 2XAQA 4UAZA 5TGTA 1ZQFA 2OD5A 4X0GA 4BL0B 2QB0B 4QW9A 5FLXZ 2CW0F 4NB5A 1V55H 2Y75A 3KFWX 4EBEA 3T1BA 1VQNI 3C18A 5CQGA 1YT3A 1N5WA 1DPUA 2K4HA 1W0UA 4O3SA 1A5JA 2DOAA 2EFWA 3SAHA 1LDJA 5CA7A 4KLSA 1XC5A 3ZQ7A 3PO4A 4XNFA 5JLXA 5ED4A 3JRIA 5J2JA 3DEWA 4O9MA 5F04A 3OIQA 3CCEI 4ED8A 4KLLA 4AM3A 2DQLA 4IEJA 2KDOA 1UCVA 2LRDA 1KBUA 4KIFA 2HHWA 2DA3A 1FEZA 3F5EA 3RF9A 1B4FA 3ISCA 2BCQA 4QZAA 1SD6A 2KZ3A 1ZQBA 3BR0A 1JT0A 3HWTA 1EH6A 2DODA 1Z19A 3EZ5A 8ICGA 5AKZA 4Q43A 1I3AA 4U7BA 2R93J 3TADA 5LEJA 1AWCA 1GUUA 2OTLI 3DPTA 1YW7A 2QBYB 2YMMA 3R0AA 4PDKA 4B6JA 4A93J 2FLPA 2RP5A 2GWSA 4B9TA 4LGWA 1QGPA 2GXAA 2GM4A 5FLVA 1Z3XA 1R1TA 4YELA 1JT6A 1QSSA 1OYIA 5HP4A 2L0KA 2PJPA 2RQQA 2AQ0A 1A35A 2GIVA 2P6SA 2IOFK 2J5PA 1UHUA 5CB1A 2KJ5A 5BPCA 2KTQA 1KZHA 1O3SA 2H3ZA 3DPUA 5KT5A 2R8HA 2PFNA 4O3RA 1TBXA 1MIJA 4U87A 4IRHA 4EJVA 2O61A 3JPSA 4IHWA 3RR7A 2ZNYA 3PO5A 3SV3A 1XSPA 5F08A 2E3TA 4DF8A 4MGRA 1RDFA 9ICVA 4A5MA 5KFJA 5H20A 2KSOA 3ESWB 2FLNA 3F8MA 1K78A 2KHVA 3HRDD 3TW6A 1SZPA 1Q3VA 2ELHA 2F2AB 2RRDA 5DGBA 3IHUA 3IRUA 3RAQA 9ICHA 2V9VA 3L3FX 4YMNA 3EPZA 2G08A 3RYPA 4L9VA 1FFVA 3H8JA 3PX6A 4YQWA 1Z4OA 3HOSA 1TAMA 3H7IA 4O6JA 5KTQA 3LSRA 1S76D 3AG3H 2V1NA 4MFEA 9ICSA 3HP6A 3LSGA 5EG0B 1DK3A 4BXOB 3K1ZA 4MF8A 4EGZA 2E1CA 1XTAA 2LY2A 2AU0A 4QWQA 3ETLA 1SVLA 3ZQFA 4BKXA 2QZ8A 3F23A 4R8UB 3KZIU 4ECVA 2A6EF 4NLNA 1XG1A 1NZPA 2IEKA 3ZD8A 4RUAA 1ZQGA 3BJ6A 3M07A 2YY6A 1PVEA 3VYSB 1A77A 3KD3A 4D7NA 4LD5A 2ZJ2A 3SQIA 3H0DA 3MR3A 1T0FC 2HZTA 1BVSA 1ZQEA 1F36A 1XDUA 4LJZF 1X3WB 1SAXA 1C0WA 2F4OB 4ZH4A 1KU7A 3PVXA 1QSYA 4IX7A 2JWTA 5JI6A 4QZ9A 3ZGKA 3GFIA 2G09A 4F5OA 1ZQJA 3A0BU 3UMGA 4I29A 8ICQA 1T8IA 1PUFA 1B6AA 3TOBA 1SIJA 1O03A 4XSZF 5EEHA 1S3JA 1XN7A 1KQ8A 2E1OA 3DKWA 2HQ5A 4XLFA 2M2EA 4DFKA 5E3NA 3PW2A 4BDPA 4DYCA 5KFZA 4MFFA 1K5OA 2JZBA 3ISBA 2JUGA 3BJOA 1OXJA 1KDHA 2A3SA 2MSYA 1MQ2A 1WRJA 1WCLA 5DQIA 5J29A 5JHUA 3BTCA 1Z00B 1ON1A 1Z6TA 5EEGA 5D49A 2JMWA 3TDZC 3BG9A 4UAVA 2VQGA 5L3BA 1UJ8A 1HF0A 3ROUA 5JHFA 1XGMA 5ALPA 2HR3A 1VQ4I 3EUHC 4BEHA 2ZIUA 1S0MA 3ABUA 5CPRB 3OYDA 4G8XA 1X4PA 1OKRA 5ALZA 2EA4A 2RQPA 3CCYA 2W9BB 2E1EA 3MDCA 1ZAOA 5ILVA 2PMUA 3SV4A 5GTHU 1A6SA 2JR5A 3UR3C 2RKHA 2MW8A 2HYFA 5CQEA 4YRVA 3WK6A 1V5FA 1FZPB 2NYVA 2KP7A 5AICA 5J2KA 2XGEA 3I0TA 1QVTA 1WQ2A 3IP4B 1T3QA 2HVSA 1X58A 3S3OA 1QZYA 2AQEA 1PK1B 4IL6C 3PFIA 3AU6A 3SZ2A 1MJ9A 2VODA 1USSA 3LFKA 4RAZA 4GFJA 5LGUA 3WG7H 4CZCA 3BS5B 4YIRX 2Q8KA 2XB0X 4EEFG 1DGWY 3M1CA 1ZK8A 3S3NA 2WBMA 2OXOA 5KG2A 3TQNA 3S17J 2CV0A 2M4GA 2KHMA 4RQNA 5K5OA 2AHOB 3FKJA 3LVVA 3WKCA 2CO5A 1ZQTA 4GRIA 1XMXA 3TP0A 3AAFA 2L7KA 5GTIU 2XCAA 1H88C 5AI4A 2DFIA 1GV2A 5B66U 1PJRA 1JX4A 3SAGA 1FSHA 3F8CA 3LA7A 2EPFA 3ZCOA 2M0MA 3S93A 3CMAI 1G3WA 3BTIA 1ETWA 1I50J 3HRSA 4XRMA 2FMPA 2UXNA 3SEIA 4XLCA 4F55A 3GTKJ 2HBLA 1J5YA 5CHGA 3BT9A 5BQTA 3NRWA 2VJIA 1MBHA 3RCOA 1CI4A 2HDOA 1TTYA 3UMBA 5B3SH 1BI1A 3MC1A 2YR2A 3AQEA 5G5HA 4IF4A 3QOEA 2Y30A 2VOPA 2EA2A 1UHWA 5DUKA 1NK9A 1FIPA 2HYJA 2VXDA 4F93B 4CF5A 2ZTDA 3RAXA 4I02A 7ICGA 5HR7A 2ECBA 1COKA 4B44A 2ZUCA 4E7IA 4BQNA 3H8SA 3DKXA 4O3NA 2MFZA 3PL8A 4XN3A 1OCZH 1VQLI 2A1JB 4EENA 2IS1A 2YB1A 3FMQA 1IN5A 5CKTA 5J2FA 3QU6A 4V19K 2M0NA 1ZJNA 2ZIUB 9ICAA 4Y2QA 2IS4A 4UXNA 2XUBA 1YO5C 1AU7A 2TRTA 5KAIC 3OOUA 4DS5A 1SFEA 3B73A 4I0AA 1S9HA 4C3HJ 3HOZJ 9ANTA 1BR4A 1EJ9A 1MH4A 4IQWA 5C4XJ 2CQQA 3HKZN 2JPBA 3GU3A 4KMUA 1XMAA 5TZVA 1LDDA 2R7TA 2QENA 1K4SA 5KG0A 4IHVA 2V6CA 4OWRB 2DOEA 3S14J 2DLLA 4FISA 4BQOA 3KP4A 3RJPA 2Z3YA 4ESFA 4NLCA 1QQ6A 1X9WA 4US8A 1IO2A 2W00A 2DKXA 2FJ6A 1JHHA 1KGSA 4AVPA 4MQVA 2KD1A 3GV5B 3T5KA 5IILA 2V6EA 4MIMA 2HVHA 4Y17A 2HWVA 3K1NA 7ICQA 5EE1A 1SXEA 4Y2RA 5J0RA 4BHBA 1TWCJ 2VKDA 4A3KJ 2AGPA 3BG5A 5AKEA 2ASLA 3WG9A 2XICA 4FZNA 3TOAA 2ZIWA 1Y8QB 1Z3EB 1ZKGA 2ESHA 4CA0A 3NS1A 4ON0A 5AK3A 2ME0A 1F0MA 3ZN1A 1MNEA 4JX5A 2K9NA 1R71A 1GO3F 3Q3SA 2F6CA 5FJ8J 2WB1C 2JH7A 4LZGA 2CV1A 2COMA 4M73A 3GXOA 1UAAA 3VYUB 3QAHA 3S2HJ 2HZDA 1OR7C 2XRNA 4UVBA 5F0HA 2MLGA 3NASA 2H3FA 5IIJA 9ICXA 4C4RA 3WK8A 3HRTA 2H8RA 2KHQA 4DOZA 3LA3A 3WK5A 5L1JA 1LE8A 2IGNA 1W0TA 3TP3A 3JPTA 4M6WA 5J6XA 1PYVA 4DQPA 4ZC3A 4EM1A 1Z91A 2KMUA 3ZMZA 1ZRNA 3JPRA 2MG4A 3VYRB 3CO6C 3KHHA 2ISPA 3WK9A 3LWLA 2IHMA 4A2UA 4UB4A 4JV1A 5BPDA 3QUQA 4Q8FA 3HSEA 2R7UA 5J8CA 3ED5A 3G4SI 1KFTA 3ZQGA 3RH5A 1R5ID 2PQ8A 5IP9J 2WB1F 4J9KA 2I6XA 2XY6A 1SKSA 2ZMEC 2F4MB 3GW2A 3I9V2 4LFUA 2R18A 3HOWJ 4PSWA 1VTNC 1Z1DA 1UHSA 4UVAA 3H4BA 4P0QA 3J80K 3I4MJ 3PFYA 2CUEA 2E2HJ 4J9MA 3A03A 3HTUA 3F72A 3K6GA 4P1WA 4WXDA 4OINF 3TW7A 4B3XA 4BJTA 3S32A 3MFKA 2MH9A 1LFUP 1BC7C 3I1YA 3L00A 5D4BA 1QNTA 2KIMA 5AKLA 2K9QA 2KK0A 2JRZA 2P6TA 4I0BA 2V1XA 4XOPA 2ZFWA 2RN7A 2G7UA 4O3QA 5B5EU 2JSPA 4G9BA 5KFOA 5ALNA 4I2OA 5DBBA 3HYIA 2EZKA 2QQAA 3K2AA 2X1CA 1HW1A 3J7ZI 4Q5SF 1LVHA 2W3SA 3DBLB 3FIWA 2O8KA 5J1RA 2HOQA 1XX5A 5AI8A 4KLQA 3FC4A 8ICOA 3RJGA 4UQGA 4XQFA 2KIWA 2ZJPF 1XSVA 3C2MA 4XA5A 4M3BA 1RPWA 1Y88A 3S1RJ 3OYCA 3HOYJ 5E17F 3HOVJ 3SJMA 4BYYA 3TDUC 2EQRA 1IRGA 2LY9A 4BJ6C 3KFUF 2RHFA 3THVA 3FXOA 1W5TA 3RPUA 4EEKA 4BJQA 1QQIA 2JH1A 1RI7A 2ZIWB 1URJA 2CSOA 4USAA 4ED1A 1X4OA 4UUSB 2BV6A 2XIDA 3S16J 3M9OB 5KG5A 2CMPA 4KT5C 4PJNA 2M87A 2X6XA 5DYMA 1HXDA 1RIOH 2RGVA 1MSEC 5TISC 4DLEA 4JWMA 1I1GA 3MFIA 1SD7A 1LDKB 5E3MA 4ICAA 3T0YA 3PV8A 3U26A 1HKTA 2XRLA 4RAGA 5CVIA 4B8XA 3D2SA 3LA2A 4CYCB 2L5YA 3ISPA 4BHPA 4LJXA 1AKHB 4L5IA 9ICMA 2V1DA 4H4KC 9ICUA 4P96A 3K75D 2UV1A 2DA2A 9ICTA 5KFKA 1G8XA 1LKYB 1WI9A 1SV0A 4BXFA 2K8AA 2ISOA 4DF4A 3R60A 3HUGA 1ZG1A 2GXBA 2P7CB 3AFHA 3E0JB 5H2FC 2KNJA 5AKIA 4M9JA 5BMZA 5DM7F 1MN8A 4E7ZA 4B9NA 4PGQA 4HX8A 2A1AA 1I6HJ 4PZOA 2G06A 2GZWA 2ELKA 3PM1A 1FTTA 2DBBA 5AM4A 4CDGA 3C5GA 2QLTA 2K4BA 4MQ9F 2L2OA 1HEKA 4C9YA 1OR7A 1FOKA 5HS9A 4F5PA 1SC7A 1BIAA 3LWFA 4DSKA 3VC8A 4EZ9A 1V4RA 4NHJA 3UXNA 4DFMA 2VKHA 4P0QB 2Z5UA 1QSLA 3HC7A 3F8NA 3HJEA 2CUZA 2KZGA 1HQCA 1G59A 4GLXA 2R7ZJ 2HHSA 2R8KA 3HM5A 1FWZA 1J2XA 3BPXA 3O3KA 4BBSJ 1EF4A 2P4WA 3KE2A 1MBJA 5BPIA 3C2BA 1RPLA 1RR8C 3NWTA 3M7DA 3TGNA 3EETA 5FKMA 2FMYA 2X51A 2MLKA 1R58A 4CGZA 4B9MA 3VYTB 3J80Z 5ALVA 3HPOA 3B0XA 1V5GA 5J1UA 3QODA 4RS8A 1TT0A 1I5ZA 4R79A 3GTMJ 1KEJA 2X6WA 3RB0A 7ICSA 2O03A 3PW5A 2RQ5A 1BW6A 3I55I 2LNBA 2K8BB 2EIKH 7ICVA 4EM2A 1H0MA 3U9GA 2R7QA 2EIMH 1ZREA 3HW8A 4I2DA 1R5GA 1IAWA 5KG1A 5ALQA 2EAMA 1W1WE 2CRGA 1Y1WJ 3DP7A 2MA3A 4Y3OA 3OYBA 2G5HB 2IOHA 3S6JA 1SL1A 2BPFA 3CCVI 1S0NA 8ICYA 2FLLA 1S6LA 2BZTA 3Q9VA 4XKVA 2MRLA 5ALXA 1SGGA 3WK7A 5KFNA 3ZQCA 3KLNA 4JBAA 2NRWA 2PXIA 4JUZA 1A6IA 2H1KA 3H3UA 3DEEA 4PFOA 3JRHA 3JRCA 5D8KB 3DV9A 3I53A 2M9HA 2GAUA 4IXAA 4EM0B 1J2MA 1CUKA 2W04A 1U3EM 5IOZA 2E1MC 3QYFA 4QZDA 2YTUA 5EWEA 4KLIA 3KP6A 4MNUA 5EZGA 4LG0B 3BQTA 5ALTA 2JEIA 4FO6A 3DBRB 3HTSB 4KLUA 4HF2A 3GF2A 1D3YA 4AYBN 2F1IA 1FLIA 1G3TA 1X9MA 1R6RA 2OF7A 2V4JC 2VA8A 5L1IA 2CQKA 4TUPA 2NS8A 2HDCA 1MJAA 4C4SA 3C5FA 1BPEA 4ZDLA 2W54A 4ED7A 5CVVA 3MCZA 4RAFA 3D2QA 4EJUA 1ZQVA 3MKYB 4CF4A 1L7PA 2KQRA 3GVAA 1WUDA 2WF8A 3RB4A 4ACOA 1T3NA 3ZRGA 4RBOA 5ALYA 3QE9Y 3LSMA 2I5HA 1R1VA 2FPLA 3SR6A 3EYYA 1VFCA 3TO6A 1R4NB 5HS7A 4KYWA 1A0PA 1R00A 3BROA 3NTUA 3Q0WA 3G73A 4OMYA 5AKKA 4M9GA 4UATA 4RQ4A 3TKAA 2G5IB 2IS6A 2G07A 4I2FA 3AUOA 1XCBA 5D6FA 3GX4X 4PJ0C 2UVUA 3GIMA 1SL0A 1ZGWA 2LSOA 3I28A 1MMAA 1Y1VJ 4BNCA 3IN5A 5IP6A 3GQCA 1ZD4A 4BQAA 3MR2A 2HPMA 3K10A 4PCQA 3L09A 1DU0A 4E7HA 2PMZN 3T8RA 4DOAA 8ICTA 2LG4A 2XAJA 4CXFA 3AL0B 2PMZC 1N48A 1CF7A 2MA1A 3AKZA 2DDAA 5AK5A 1HUZA 4KLDA 1RZTA 1WH7A 4OAZA 1PVPA 4PJJA 5AM5A 3GMEA 5AIBA 2J6UA 4E6KG 4FE4A 2DT6A 4C2MJ 9ICEA 8ICJA 4KFCA 3L2RA 5E20A 2AGQA 3WTSC 2ZJ8A 4I2JA 3C28A 2IVMA 3VSKA 5ALWA 2NOJB 2XC9A 3E6MA 2IMWP 2YX7A 2JQ7A 2E36A 4NC6A 4M3GA 2WV1A 1IN7A 2HKOA 4FX0A 2KOBA 3N28A 1FIQA 3RJEA 2VL8A 5ERIA 2VT2A 4ECRA 1KTQA 3K4JA 2ZIXB 2HCFA 2GOLA 5D8LB 2ZFUA 2AQ4A 1U9NA 4UV8A 4P4MA 4ZZLA 1ZELA 3N7PD 4XLHA 5AKGA 4RT2A 3KPHA 4ED2A 4DFPA 8ICSA 3OPXA 1ON2A 4O5KA 1MMNA 3V7RA 1XC9A 5L1MA 3UNGC 3K4NA 1NK8A 2EAPA 2LF7A 2F2EA 4A12A 1TAUA 4RT3A 2BQUA 1OCCH 2BQ3A 2EB7A 4DQSA 2ELJA 3PNYA 1LFBA 1BPDA 1YTYA 2CU7A 2F77X 2K4EA 3SFIA 4O3OA 1OPCA 3WTXC 3FXRA 2F1HA 5KNLA 2LPEA 5AM2A 1KL9A 3MKWB 1IJWC 5HNKA 2C22A 3RSNA 3AEVA 3OOPA 4EATA 3CF5F 4Z6FA 5K5RA 2XROA 5F0CA 1B22A 1FEXA 1FPQA 3G1MA 2OQRA 2E2IJ 2JMGA 4IZZA 3QNMA 3M8EA 2XCPA 2BY0A 2MU2A 1E17A 2NVUB 1ZR4A 3W3CA 3CJTB 3ERED 5TJJA 1WKMA 2IA6A 2J6SA 2C28A 3H35A 1R7JA 3V6KA 8ICWA 2WFAA 2LK2A 8ICCA 7ICRA 4JV2A 3HSFA 1TWFJ 1ZN2A 3QU9A 5HVQC 1P92A 2DCEA 4D5CA 3C23A 2KIQA 2YX8A 3C2KA 4M0AA 3N97A 3GV7B 4E7LA 2ZUBA 5E1WA 4UB6C 5F1RA 5AI5A 2Z99A 3PW7A 2MUTA 1UZCA 2XI9A 1Z21A 2PI4A 4L18B 3WTYC 1R4MB 8ICLA 2UXXA 1GLNA 4AIHA 4EJWA 4DBRA 1JUDA 5AIPA 4JV0A 3G6VA 2IS2A 4ZZDA 1L0OC 1NK2P 3FHZA 1ZRMA 2X48A 5IIOA 4JYKA 5KAIU 2LREA 3SZTA 5FROA 1YI2I 5C3EJ 1BNOA 2M30A 1YRNB 3FAHA 2KIUA 2OZUA 2VT3A 2QSFX 1VQ9I 1J7KA 2CH0A 1LB2A 4MFDA 1BIBA 1QTMA 3CCMI 2P0WA 4GXKA 1XS9D 3QUTA 4MHVA 1K1QA 2V4QA 1QQ7A 4RGXA 2GWRA 5DKWA 1U8RA 1WFXA 4M3EA 2DUYA 3DEUA 2GXGA 3MWMA 5ILSA 3PMLA 4ECWA 4E4HA 3BPVA 4DL2A 3QU4A 2KJCA 3QYEA 5L3FA 4AP9A 1RXWA 1TZLA 2OCCH 3S2WA 4A3IJ 3E6BA 4LOCA 3A01B 1FFUA 3A4CA 4F72A 4C8OA 5BOLA 1JKOC 2V9PA 7ICEA 3Q0VA 2WY8Q 3SI8A 4UV9A 3VDXA 2K3FA 3H36A 4NQWA 2KIVA 2XY7A 1NZBA 1S7EA 1YJNI 4I2HA 1F9NA 1ZQWA 3DPLC 3GWZA 4JX4A 2E1FA 4GYIA 4BE0A 2ES6A 7ICUA 2DW4A 2A6HF 4NC7A 3WU2C 1ZQSA 2CN1A 9ICWA 2EK5A 4RQ5A 2XAFA 1B72A 2OYYA 1JGSA 4ITVA 3TQ1A 5B1BH 4QLCU 4G7HF 2W9MA 1W5SA 2EZIA 1L7MA 5HNFA 4P5OA 1G6NA 4A5NA 1FSEA 4ELTA 3E6DA 3R61A 2QA4I 1A31A 2BZFA 5KAFU 4QZCA 3TI0A 4I2IA 4JQFA 5ALOA 4DSFA 1KYZA 2ZSIB 1ZQHA 4KN7X 7ICNA 4YD1A 7ICJA 1D5YA 4YXJA 4UBBA 1N56A 1W4MA 2DA7A 2L9RA 2D8CA 3N97B 4CYDA 3IRQA 4ECZA 1HOMA 4JWNA 3LAPA 3ISDA 3CUQB 3TFSA 1KFSA 1KU3A 2GOMA 1TWAJ 1HKSA 1SFXA 4XKWA 1HCRA 3E58A 3HOXJ 1NOMA 5IIIA 3I71A 2Z16A 1SZHA 2XSJC 2Y0SA 5CVJA 1X1AA 5KFFA 3WODF 2RC4A 2VI6A 2BCUA 3U21A 1V54H 5AKXA 5KCMA 3S8PA 3DLAA 3QU3A 1VQ8I 2JA6J 5AM3A 3CMMA 2KRFA 4BXUA 8ICVA 2EFPA 3BY6A 3BC8A 2KT0A 4XLEA 4QTRA 4ZYAA 2K02A 4UB5A 2QYOA 2HOSA 1ETYA 4KTQA 1IG6A 2JVHA 1UT8A 5IY5H 1T98A 3V42A 1G4DA 3GTGJ 2LM1A 3ABTA 3QPLA 1JKRC 2DBYA 4GFBA 2CQ7A 2K9LA 4XUSA 4P0PA 1CEZA 3T5XA 1YX5A 4N9IA 3QYPA 4KLHA 4KJZA 3ONQA 5ICCA 3EDPA 3KP7A 4WF2A 2Z7JA 1IF1A 5DG8A 4DSLA 5L3DA 9ICIA 2HOAA 5G5GA 3GIJA 2R8IA 1DRGA 1W36D 2KG5A 4PJLA 4GIBA 3ZI4A 2VQCA 3JPQA 3C29A 4Q45A 1QVUA 2GLEA 4HLYA 1QPMA 2ECCA 3E5UA 2EWNA 1B9MA 4CRXA 3GTPJ 2BCSA 5J2GA 3ECHA 4DQ2A 4HNVA 1P7IA 8ICHA 3GEZA 4HW0A 1B43A 1NK4A 5TISU 4CZZA 4DCCA 3LSHA 5K7ZA 4OAYA 2HFHA 2EZHA 3UKGA 3P5JA 3FX3A 3QYBA 2V9WA 1GDTA 3WKBA 1T7PA 2QLZA 3OYKA 1YE9A 1JUPA 4F4YA 4K4HA 3K4KA 1UELB 1ZQUA 2BHNA 4JB3A 1AROP 3V7LA 4M74A 5KFUA 2NYXA 2V1UA 2UZKA 2DPDA 2E8OA 1TP4A 4XRHA 5J0OA 2DMUA 3LOCA 3OS1A 4Z6EA 4RNNA 1UCRA 3M9AA 3KP5A 1X40A 4DWIA 5HLHA 5DGAA 1IRZA 5HMMA 1XU4A 3OMYA 4Y33A 4EYHB 3EW9A 3B6CA 1U5TA 1OLTA 1S8NA 4M6VA 4RLQA 4DBQA 5ALIA 9ICBA 3QOPA 1PP8F 2ZIVB 2R7SA 4A6EA 2P5VA 4AVZA 3GTQJ 3PR5B 5GADJ 2EV5A 1DPRA 3G6YA 3H9GA 1FBQA 1JROA 3LQQA 1IW7F 1HSTA 1MD0A 3NEUA 2DK5A 4FHTA 2XPUA 4KIBA 3X2QH 1MNDA 5AIQA 2W7PA 4F5NA 1TK8A 5FKLA 3U1DA 1SD4A 2XC7A 1ZLKA 3VODA 4PGYA 3DV8A 3BCBA 3K4BA 2E8PA 1JHFA 1WZ2A 3OSGA 5KT4A 4A3DJ 1R5HA 4TURA 4L0ZB 2LH9A 4F92B 1ONVA 3GCMA 4J9PA 1FBSA 4C4TA 1D8JA 2HHTA 2TDXA 1ZYRF 2VC0A 3ZMSA 4E7JA 4XIDA 4KITB 1IRFA 4EGYA 2J6TA 2F5EA 2QGUA 4OIPF 2MYSA 2A68F 2NRZA 3Q8MA 2RV8A 4FS2A 1ZQIA 1USTA 4IPAA 1NK7A 1BN5A 4HOBA 3JAMK 2IA2A 3BR1A 1WSUA 4KT6A 2YU9J 3ZXSA 3CRXA 4FBTA 5D5WB 1ZOLA 2IGKA 2M9NA 4MEYF 1FTZA 5J1YA 2O7OA 3ZMUA 4HAMA 3IWFA 1IN8A 1OCOH 2OPTA 3V8LA 5KT2A 4AWXB 1NK0A 4HYKA 1HUOA 1OYYA 2BW3A 3JRAA 1E0EA 5J47A 5ALFA 2LM4A 1ZRFA 1OQYA 3GO5A 4EJTA 1YZ6A 4CCNA 4PGHA 4R64A 4A69C 1LV5A 2QQ8A 3IKVA 3PIOF 4P2HA 3LYSA 2DTRA 1D0XA 2L7ZA 2VN2A 1W5CC 3MKZA 1T94A 3NVVA 1O57A 1S97A 1O3TA 4KLFA 2HHVA 2V7FA 4YCXA 2R7VA 2DO7A 2IP2A 2M45A 4XLPF 2N1RA 3TARA 3ALRA 3RB6A 5HR6A 3CMEI 2HMXA 1ZD5A 2CFXA 5DDGA 5EE0A 2GOXB 4C7YA 5EWGA 2XY5A 1S77D 4L0YB 7ICPA 4RQ8A 2CWEA 3FBIB 1FT9A 1W36C 1UG0A 8ICIA 5GAHJ 2X6YA 4RDUA 2XSDC 1J59A 4O5EA 5IOYA 3SEZA 3CJQB 4PSXA 1MDMA 3FXKA 1BL0A 5AI9A 3E0FA 1X42A 2MD0A 1A36A 8ICFA 3Q8SB 3ZDCA 4NV0A 3CC2I 4LZDA 1U5TB 3BOQA 5FKOA 8ICNA 1VDVA 4A3CJ 4WWCA 2I5UA 1GV5A 1IG7A 3UQ2A 5CVUA 4B9UA 3MKLA 3IV5A 4RB2C 2ESNA 2RNGA 2VBZA 4M9ZA 4OMZA 5BOMA 1IC8A 4RAYA 3M9NB 4M6YA 1ZH5A 1QZEA 5KL8B 1RKTA 1N62A 1IV6A 1UG2A 2KSOB 5F3XB 3PX0A 5LRRA 1K78B 4FZLA 4OOIA 3OV8A 2KIFA 3MGVA 3UQ0A 1L3SA 4CF3A 3NVWA 2ESEA 4AC0A 4IR9A 5LHHA 4ENJA 2BBYA 3FXUA 2B63J 3J7AO 5DD8A 4KLTA 2R0QC 2IA1A 2F5VA 3NRZA 4C3IJ 1MC8A 3L2UA 1UMQA 3ABKH 3ZMTA 2WY7Q 2MAXA 5C4JJ 3F21A 2Y9YA 2MSNA 2BPCA 5H6QA 1FJLA 3PNCA 4F4WA 1D8KA 5J2HA 2DFEA 1IUFA 2IA0A 2OA4A 1FOYA 3A1YA 3NRVA 4ESJA 2NRTA 4MEYA 4X5VA 3M9MB 3KLOA 2KEYA 1KA8A 3PX4A 2F5DA 2BEOA 1F43A 4GGGA 4Y13A 1T95A 5HNHA 3PJRA 5KG4A 1TK5A 2DWQA 4NM1A 2HW3A 3OYFA 5EZHA 4OIOF 2G9WA 3JAMZ 1GVJA 2L9SA 1SMTA 1Y39A 2KMDA 1TQMA 4MF2A 2KZMA 3CYMA 1B1BA 3NQOA 1XO0A 4PPXA 2C2RA 1BPYA 3QU5A 4MO7A 3FM3A 3JCUC 2ZJQF 5KFLA 3S2DJ 1PUFB 3DXJF 3G1LA 4BAYA 2LYCA 5IYDJ 2K4PA 2KN7A 2L9NA 1RNLA 1ZRDA 1B4AA 3FHNA 3JSOA 4HF1A 2DAOA 3V6JA 2CS3A 4X6AJ 4I27A 1YZ7A 1TNSA 4HLXA 3ORYA 3QU7A 3T3FA 1W7PA 2JZBB 2K8CB 2LBOA 1X3ZB 7ICKA 3CP8A 3KCCA 2R5YA 3AM9A 5FD6A 4MTEA 1T0FA 1TE2A 7ICLA 2W25A 4U7DA 1YW9A 2QCOA 2XGCA 3E2EA 4HDUA 4DLGA 4G6QA 4EX6A 2E35A 2XF7A 4IQJA 2E1NA 1EH7A 4DOCA 3F8FA 4DYRA 4BEHB 5T14A 3BQZA 3CD6I 3D5LA 1LPQA 5IIMA 4XKBA 1QHHD 2KZVA 4FQGA 3JREA 3QU2A 5HLIA 4BS9A 1CQTA 2DA6A 4HA8A 5M5WJ 1ULYA 1NK5A 4PK4A 5KFSA 2JA7J 1X9XA 3BZ6A 4J9LA 5KVRA 4XLNF 3HKZC 4W1UA 2NO5A 4ZYEA 4XM3A 4KN4A 3B02A 3TL4X 5ALLA 5J2DA 4IHTA 3K0LA 4RPYA 1D8BA 1KW4A 1VI0A 3LMMA 2AQFA 4G12A 1ODDA 2BGCA 1TT5B 1ETVA 3BG3A 3FF5A 3OJUA 3TAPA 2EJRA 3EUHA 4MHGA 3RPQA 5HLGA 3KEQA 4QIWN 2YUSA 4RGSA 4FFDA 4LLNA 3QUBA 4QWBA 4CE6A 1SAUA 4K2EA 1L7OA 4TQSA 3IDWA 3ZDDA 5AI0A 1SVOA 1Z77A 1S0VA 1UA0A 2JVGA 2QKMB 3K4GA 3M8JA 1ACIA 2D45A 3F2BA 5ILUA 3H40A 1X9SA 4EX7A 1XD7A 3T5HA 4ESBA 4F4XA 1WI3A 3HKZF 4C0ZA 1U47A 2EANA 3L2VA 4UB1A 8ICMA 2W9CA 2EINH 2A3VA 4WX9A 4AU7A 5EF6A 4LB6B 3TO7A 4GXIA 2M8EA 3SZGA 1ENHA 9ICOA 2FNPA 2EFOA 2KKOA 4O0IA 1R49A 4A0ZA 5J2IA 4IQVA 2M0CA 3FXJA 4AIKA 2A69F 3RI4A 4BXXJ 2B0CA 2E8NA 2D1HA 2P8TA 4CCJA 5C5JA 4M04A 4KLJA 2W24A 4XN0A 2Q4TA 3MBYA 1U78A 4M71A 3S15J 2DQNB 3R6SA 1WJ5A 1WCMJ 1UFMA 3RQIA 2ZTEA 1PUEE 3O0FA 3Q8LA 2BCRA 3MFHA 4RB3C 3V8JA 2YPRA 1YLFA 4EZ6A 1T33A 3WKAA 1RRJA 3MZ8A 4OIRF 2HHQA 3AMZA 4RMNA 3WU2U 4ZYGA 1WVRA 3M1EA 2K4JA 2R7DA 3QWLA 1J2NA 4EEYA 1V5EA 6PAXA 3KYLA 1V97A 4FZMA 4DL7A 3SAFA 2R5ZA 1EKEA 3SYZA 4RU9A 2YB4A 3P9CA 5HDGA 2B0LA 4ENNA 1J97A 1WJEA 1SXDA 1MMGA 4I99C 1SVMA 4XRSG 2ZC2A 3IWZA 3DTEA 2ZTCA 4RGUA 1Z7UA 3WU1B 5F27A 5J4VA 4ENMA 3A2KA 2FQ4A 5JVTA 1TKDA 4AIJA 2H6BA 3H8WA 3H9JA 3T5LA 3C2LA 1P6RA 2NAZA 4BU2A 7ICHA 2CUJA 4NL9C 3GIIA 3JRBA 2HOFA 2XAHA 3H1CA 2CPRA 2LLKA 5DCMA 4OU0A 3H92A 3Q8RB 1ZQQA 2VPLA 5KFBA 2HDDA 4J9OA 1QLNA 1E2XA 5IP7J 5E79U 2X0LA 3HEFA 2WTFA 2WAQN 3RJKA 2DT7B 3SFZA 4G6TB 2HGCA 5BOXA 2HOTA 2D1VA 3HGGA 1D1CA 1QHGA 4Y4RA 2ZXJA 4WXHA 4AD9A 3RBDA 3DTKA 1ZQNA 2A05A 2DQRA 3FWEA 3I4PA 3P9IA 4IJAA 3KHRA 1ZQKA 3CUOA 2HI3A 2JZYA 4CCOA 1NKBA 1U6GA 1TNTA 2FBIA 1WCNA 4YXMA 4QZ8A 3ABLH 2OZ6A 3F0CA 1JI7A 5KFQA 2E71A 4FT8A 3ZMVA 1S0OA 4PJMA 3C1YA 2FE3A 4P4OA 1A76A 4L5JA 3L2CA 3SXYA 4RQ2A 1QRYA 1FIAA 1BPBA 3CDLA 3Q5FA 1EXNA 3ZQLA 2WF7A 2FU4A 3KIOA 3VOEA 5LGNA 1E3OC 2P66A 5LRSA 2PJRA 1EH8A 1BPZA 2KFZA 5JTIA 2L5QA 1LE8B 4OCZA 3JPOA 5HODA 4M6WB 1ERDA 5JU5A 2MD5A 2NS0A 1D5VA 4QZBA 5DCFA 1IXRC 1ZLJA 2G0EA 4EVIA 2LKXA 2E8MA 2P6UA 1DGRM 3F22A 2QARA 1ED1A 2P7VB 2QEXI 2WB1A 2ZB9A 1XSXA 1LJ9A 4PZJA 4RQMA 5CP2A 1SL2A 2L3DA 3H3ZA 1L3LA 4IRDA 3KZZA 2CFOA 4EV0A 3D2NA 4B3AA 3Q9SA 2E7WA 5HOOA 5M3MJ 4CCMA 5FRNA 1S8OA 2L01A 2VJJA 2PKEA 5AK6A 5D5UB 3G2BA 4A3JJ 2MABA 5HMLA 5EWFA 4II3A 2OV7A 4A3MJ 1MMSA 3GV8B 2D6FC 9ICNA 2RNJA 3NWSA 2NXNB 3FYHA 5J8YC 4HG2A 2K27A 1IV8A 4IHSA 5D4RA 4KNYA 5KFIA 4OO1J 3ULQB 2ZKZA 4O5VA 2Q2EA 3S3MA 2H8WA 3G71I 1Q1HA 3ECOA 8ICAA 3O2PE 5CYVA 5HDNA 2Q1ZB 3PSFA 4YFXF 1WGXA 5LHGA 5HLTA 5KFDA 2HEOA 4YR3A 5F6FA 5IIKA 3QZ7A 1B59A 2ZMEA 1REPC 1HA8A 2W7OA 3DU6A 1NTCA 9ICCA 3OHAA 3MGHA 2FMSA 2DKZA 3W6KB 2KL4A 4FE3A 4Q48A 2WWYA 5M3FJ 3KYCB 5L9XA 4LLLA 2UWMA 2LKPA 1KU9A 2OQGA 3KP3A 2UUZA 3BZCA 4DNCA 2MH2A 1UQVA 3HL2A 3I59A 2JUCA 4Q47A 4OJ5A 4PH5A 3QEBZ 1IM4A 5DV5A 4CO8A 2BKEA 3OWTA 2YU3A 5E8IA 4NJ8A 2KKPA 1ZRCA 1BA5A 1SANA 4U7CA 4UAYA 4I2CA 2DMNA 2A19A 2JXJA 3UPQA 1ETXA 2KKVA 9ICLA 5KFCA 3FMSA 3CCQI 4NL9A 4RPZA 2W9AA 4V2FA 5D6EA 1JXLA 3PUBA 2UVWA 3RH6A 4C30A 4NLGA 3BG6A 5F9LA 4N9HA 1X3UA 2XKOA 1XMKA 2HU9A 4PFPA 1VQOI 2VONA 5BS6A 1XSDA 2CQNA 1MA7A 4IVNA 3VWBA 1U9LA 4HNUA 1RUOA 1Y0NA 3DQVC 5EDNA 4G7OF 1QZZA 5KFGA 4DL3A 2K86A 1Z0XA 3KP2A 2W8KA 4M9NA 4RM3A 4IKFA 4Z6DA 3L5KA 1LNWA 4AYBC 2KPMA 4KMUX 2CQXA 4I98B 2LFBA 2R4GA 5DG9A 4FBUA 3HUGB 1ZHFA 1FO4A 3FBNB 2CG4A 1RC9A 3PNTA 2K89A 3D0SA 3H0GJ 1VQPI 2B9SA 5CWRA 1Z05A 2VIXA 2M7AA 4CH7A 3WK4A 2EAOA 3HILA 4I2AA 1T2KA 2VBWA 2A5WA 4MTDA 1Z4NA 3C21A 3DF8A 4Y2PA 2L4AA 3MD2A 3CMYA 4RB1A 4YIIA 5IYCJ 2EQYA 1SKWA 3N4MA 1YHQI 3ASOH 2NVQJ 1QO0D 5CRXA 2VANA 3H0LB 2H27A 3CF2A 2XASA 1KSPA 1IXSB 1VLBA 1ZQAA 3CNHA 4AYBF 2FBKA 8ICZA 3C2HA 3AG2H 2VXZA 4ABZA 1IXRA 5ALRA 1BR1A 3PW0A 3H5NA 5KFPA 4DSEA 2GA2A 1TFRA 4BGDA 3RFAA 4IHYA 2FBHA 3MEXA 2AO9A 5FKNA 3WHCA 1N63A 5ALGA 5B1AH 2BCVA 2ZMEB 2STWA 2R7FA 1STZA 1N60A 3ONNA 2OC6A 2NRAC 2QB1A 4DFJA 3BWGA 2OU2A 1YITI 2G7HA 3H8MA 2ZJAA 5GTHC 4ENKA 4QWCA 3K4MA 1D9FA 1D9DA 4B43A 3RKWA 3T8TA 3TO9A 3F53A 1BOBA 2HTJA 4D9JA 3CCLI 1AA7A 2ZNZA 2H1LA 4U0YA 2VASA 2M4KA 3HRMA 2PMZF 1BJZA 4IL6U 4P9FA 4W97A 1DGSA 3WGHA 3RQ4A 5CEHA 1L3TA 3G3ZA 1YW8A 4ECTA 3K7AJ 4DSJA 5ICGA 2AH5A 5DG7A 1KQ9A 4HEA2 2ZUDA 1UT5A 3F3XA 3NGDA 1L5UA 2BVMA 3RZDJ 8ICXA 4J9QA 1JE8A 4TUSA 4FE7A 4YEJA 2LKSA 3ABMH 5DDMA 1FX7A 2NNYA 4TUQA 2HHXA 1MSWD 1J09A 2VE8A 4YG2F 4ECUA 3IUOA 2HOEA 4UB2A 4RM2A 2QSGX 4G94A 3DBHB 3WKEA 2JSCA 2K85A 1S72I 4JP0A 2VB6A 3OR1C 3CO7C 1SD5A 1T39A 1MSFC 3VPRA 3WE2A 2HI0A 4Y2XA 5D46A 3COAC 3BP8A 2DPJA 2JEFA 3HPGA 2GLOA 2O8XA 3KYDB 3M6KA 2V9KA 1LFPA 1BI2A 1T8EA 1IDYA 2NOGA 3BQYA 5ALMA 2RDPA 2ME6A 9ICFA 3BQ1A 2FNAA 3HT3A 2E5NA 3QXGA 3M4OJ 4HV6A 2PG4A 4I2BA 3L4PA 4E70A 4A0XA 2GQQA 3ZN0A 3RTVA 4NBQA 4DQIA 2FMLA 4DSIA 5IPAA 5DUIA 3LSPA 4RQ0A 4AYBA 1JXEA 3WU0A 1WWUA 2FRHA 2R3SA 2Y48A 3OL4A 3CCSI 1NG6A 2QWWA 3EPGA 5J2BA 2B7EA 1X66A 3PSIA 3QPTA 2YN4A 3RH4A 2NRXA 2JHDA 2PBIA 1RESA 4MFAA 4Y2UA 3RIRA 1CF7B 2R92J 4MEXF 1NHAA 3GFKB 2HS5A 3V8KA 2Y0SN 1OCTC 4G3IA 1TWGJ 4KX5A 2HOIA 2JTVA 2LC2A 1OYWA 4HQEA 2DGZA 5AK4A 1WG8A 2DJNA 2NVXJ 2NS7A 3TMOA 4M3FA 2RDIA 4HBLA 4LIUA 3QRFF 4BDZA 2HPIA 4N0BA 2X6OA 4WCGA 1L8OA 1H9TA 3AQFA 1B8IA 3IHQB 4I09A 4ECQA 3UM9A 4C8NA 3K2ZA 3R0JA 2FOWA 1J75A 4Y52J 1PZNA 4ETSA 2J5OA 1ZGJA 2JRTA 2PMZA 5M5YJ 4XBFA 5ALDA 4M6XA 4ECXA 2NV3A 1RZ4A 4DFDA 1TV9A 4UAUA 2UVRA 1T08B 4EJOA 3BR5A 1H38A 3LWMA 1X19A 4DW6A 2TCTA 3EWAA 3E3VA 3SHFA 1JN3A 1BI0A 3I54A 2DN0A 1VZ0A 5L3CA 2IOFA 1T56A 4M2YA 2X4HA 1BR2A 1T6SA 1SFOJ 2NRVA 3ELKA 4XKCA 2HXIA 3Q8QB 1BGXT 4YG2A 1L3UA 4HRIA 4GO1A 3B9JA 1ZQ3P 1G3YA 1D0YA 5GP9A 4O3MA 4RNOA 2OCEA 1BNPA 3L2QA 1XDSA 3HGYA 3ETRA 2E2JJ 2QB0A 3GZFA 2ID6A 4NWIA 1Z6RA 4MFCA 2R8GA 5KFRA 1ZQZA 1NJWA 3I4NJ 1ETQA 4RLFA 2GIZA 5KL1B 2LF8A 2Y9TA 3CZ6A 2YMPA 1KU2A 2RLTA 1X6JA 3DFGA 1X2MA 1EV7A 3GYHX 4KA4A 2DJIA 2E1MB 3MMYB 1Y56A 3C3WA 1U2WA 2M1BA 1ETKA 1POGA 1E3HA 5F0FA 4ASNA 1JGGA 1ZQLA 2Y0MA 1OCPA 2F4IA 5ICEA 3FK6A 1HSJA 1PVRA 2KJ9A 5KG7A 1O7FA 1UHMA 4E7KA 1XWLA 2CYYA 5J0SA 4ECSA 1RXVA 2FMQA 2WF9A 1FP1D 2EBIA 4UVCA 1U8BA 1K83J 3CCRI 3SD7A 1D0ZA 2PN6A 3Q0UA 2OH2A 2MUTB 1TW2A 1Z1BA 1DK2A 2D5VA 2RAEA 2CXYA 4O3PA 4XMYA 2W3RA 4FS1A 3VEPA 1PVQA 3LSJA 2CW7A 1K1SA 1N2XA 2BE5F 1QU3A 5GPCA 2QBYA 3E5QA 3PQJA 1ZARA 3N05A 3BR6A 5H6RA 1SMYF 1OMIA 5CJ9A 4HZFA 4V2GA 3VSLA 3JRDA 4L9TA 1P4XA 2R7XA 4CCHA 1HW2A 4R8HA 4Z2YA 5ALSA 2H5XA 3TANA 3G6EI 4QZFA 1LB2B 4FCYA 2KJBA 4UARA 4UHTA 2FPKA 3BQ0A 3IRRA 1NNLA 4U6PA 2KRCA 3LAJA 4Y2SA 5AKYA 2IPQX 2LYBA 3SQNA 1F1ZA 4OJLA 1BW5A 4NXZA 3J81K 4RGRA 3MR5A 3GILA 2B21A 3DKYA 3BQ7A 4DEZA 1TK0A 2E5SA 2LYAA 1UPHA 3I76A 3IG5A 1VF9A 4GXOA 3KBBA 1F44A 4D0PA 4UW9A 3IKTA 1KQQA 2XAUA 1T4GA 2CRXA 4BACA 4JOMA 1BOAA 3HHHA 1NJYA 1JTYA 4UBCA 2BR0A 3SMVA 4ED3A 4C8LA 1Q1VA 2JN6A 1U49A 1RQLA 1D1AA 3AG1H 1YQAA 3QQAA 4E0DA 4CSWA 3OYJA 3F5AA 3M8RA 4NQWB 5AM0A 2W85A 4BWMA 1ZTRA 3DTIA 2IT0A 2KFNA 5EG0A 3IL2A 5L1LA 3CLOA 5J8FA 1KN5A 3ZDAA 3PO3J 2K4IA 2K40A 4BXOA 3K70D 3GZNB 4RQ1A 3UMCA 1X2IA 1B72B 1AQ6A 3CP2A 2B6GA 2E7XA 3GTJJ 2L02A 4R8UA 2KDZA 4M9LA 3OIPA 2BY2A 2LBFA 2WA0A 3R4KA 3LL7A 3B0YA 2QSHX 2WHEA 2ZXIA 4MLOA 3ZQIA 1N77A 2EZZA 2LTPA 1O08A 5IINA 5H2FU 4IR1A 1FC3A 4XL9A 9ICKA 5D5XB 3A0HC 1U45A 5DDYA 1YIJI 4PL1A 1ZQDA 4ZH4F 1OUQA 3MAJA 3SDGA 3D1NI 3MGIA 2KVCA 3K1MA 4QZIA 2C2EA 2PI5A 1BC8C 3M3YJ 2DTZA 4ZTJA 3I56I 4D1QA 3F6VA 5IT3A 1ZETA 4LK1F 4IQ4A 2ZXWH 5FGMA 1LVKA 3M6ZA 2VC1A 4X1EA 2E19A 1ZQXA 3IH2A 2FOKA 5JRTA 2F76X 3RBEA 2DYSH 1H8AC 2WADA 3WTVC 5DBAA 3M1YA 2HQRA 3Q8PB 1R36A 5CLSA 4J00A 1V38A 3KZYA 4UB3A 1OISA 3GIKA 1Z00A 9ICQA 4M9XA 1HIWA 3RJFA 4QPOA 3CW2C 3OR2C 3OYLA 1JXSA 2VQLA 2Y2ZA 1P9QC 1F5TA 2DXIA 5CR0A 3OS2A 2DPUA 2VE9A 8ICUA 3V6HA 3OTQA 1FBUA 3ZDBA 5EE9A 4K4IA 3N7RC 3H3VK 3QEAZ 4P0PB 1E3PA 2ZXHA 4OJPA 3MABA 5AM1A 2W9BA 4HSRA 3C2GA 4DIQA 3H4DA 3IAS2 3BR2A 1G2HA 2RVCA 4G7ZF 4B1RA 1APLC 3I58A 3OL3A 2F44A 4LMYA 3E7LA 2W7NA 1BBYA 1JUMA 2EZYA 3RJHA 1JJ6C 2HXOA 4I01A 1N61A 3NVYA 3WGGA 3PIPF 1JKQC 1PK1A 1JTXA 4J03A 5J0WA 1ZQOA 3J81Z 3MZYA 2DT5A 2YS9A 3QPSA 1UB9A 1JRPA 3LDAA 1TC3C 3IC7A 3K4LA 3BS5A 2KE7A 1FMVA 4PGXA 3OJSA 2IRFG 2VA2A 1ZYQA 2DF4B 3LVWA 4Y2YA 1DUXC 4Q4ZF 1HDDC 1OW5A 2Y1IA 1B9NA 3D5RC 2XGXA 5JUMA 2IAIA 4IRCA 2LBFB 2QQ9A 2GH1A 2I1QA 2LDUA 2XDVA 3ZQHA 4M9SA 4DYQA 1V9PA 3PY8A 1N5XA 3ZQQA 2L7FP 2ZBKA 4OJOA 3J7YJ 3TFRA 2EZLA 3OYHA 2ZJ5A 7ICMA 2CJJA 1XS9A 3SENA 2IJLA 3EPIA 3WTZA 5L3EA 4GYGA 1MBGA 3KOOA 1H9GA 1WPKA 2QKLB 3HOTA 3K70C 3S1QJ 4C8MA 1S9FA 1Q3UA 1JALA 5L1KA 2JA5J 1O4XA 3SZPA 1QH9A 5AKJA 3HB9A 2HKXA 3CDHA 8ICEA 4ZDPA 1QBJA 2EFQA 1ZJMA 4PJ0U 5FKKA 3OHBA 1JUSA 1XGNA 1UA1A 3RB3A 4N4OB 1ZG3A 2EFNA 1TLHB 3IV6A 2WV0A 3RPUD 4XSXF 5J0QA 4WK8F 5DQHA 5J4YA 2XV4S 2CUFA 4RA2A 4D5FA 4Y7NJ 3CC4I 2XB5A 3IG8A 1O3QA 4JK1X 2A1JA 4YVZA 4I6ZA 3P7NA 2K9SA 4Y2TA 3FXQA 3WTWC 4F4ZA 1IXCA 2VA3A 3JTHA 3NUQA 1NG7A 2LR8A 2Z2SB 5KNIA 1Q46A 5E3LA 1ORKA 3A02A 3FZVA 2QUFA 4J9NA 1JKPC 1LKXA 2CGPA 4IQTA 1N75A 3ZMDA 5C44J 1Z7LA 2HQAA
chains in the Genus database with same CATH topology
3L2RA 2DT7B 4FETA 4G6TB 3H5AA 1K6YA 2JGAA 2E60A 3C28A 3VSKA 1D1CA 1QHGA 4BX9C 1Y6IA 2NOJB 4Y4RA 2KOBA 3DTKA 2BW3B 2VL8A 4F3QA 4JMUA 3K4JA 3TBIA 4CCOA 2ZIXB 4LG3A 2GOLA 2ZFUA 5TGTA 1EA3A 4X0GA 4BL0B 1ZELA 3N7PD 4XLHA 4PJMA 1X1BA 4NC8A 3OPXA 1MMNA 3UNGC 3K4NA 5CQGA 1YT3A 2K4HA 2PJRA 2DOAA 3SAHA 2ELJA 3PNYA 2K4EA 2F77X 2L5QA 1WJFA 1ERDA 3K4CA 4XNFA 3L2WA 4WJ3B 5KNLA 2M7BA 3OIQA 3MKWB 1DGRM 3RSNA 2KDOA 4EATA 1ED1A 2LRDA 2WB1A 3F2DA 1KBUA 2HVRA 3F5EA 3RF9A 3PNVA 2H3QA 2CFOA 4FASD 3D2NA 5HOOA 3CESA 5FRNA 1D1BA 3BG7A 4CCMA 4IZZA 2JMGA 1Z19A 2VJJA 2WAEA 2KV2A 3G2BA 2MABA 2D6FC 4II3A 2OV7A 3W3CA 4U7BA 3NWSA 3DPTA 3H35A 4HG2A 2RP5A 1XNSA 5HVQC 2K9MA 3KEYA 1Z3XA 2DCEA 3IAM2 4YELA 3S3MA 2YX8A 4E7LA 2RQQA 5HLTA 2Q1ZB 3PSFA 2KJ5A 2H3ZA 2XI9A 1Z21A 2R7RA 3DPUA 2Z1DA 2HBKA 1HA8A 2W7OA 1GLNA 4DBRA 4U87A 3DU6A 2IS2A 4QIWC 3PSTA 2KL4A 4FE3A 2LREA 2UWMA 4XLAA 5FROA 2KHVA 2UUZA 1DP3A 2VLAA 3FDYA 3HL2A 4KISA 2F2AB 2CH0A 2RRDA 4OJ5A 2LOOA 4KMOB 3L3FX 3OWTA 3EPZA 2X1DA 2G08A 2P0WA 2KKPA 1CRXA 4U7CA 3HG9A 3HOSA 1TAMA 3PZPA 4BJ5C 1WFXA 2KKVA 2V1NA 4CUGA 3LSKA 3LSGA 2O5RA 4II2A 3K1ZA 2LY2A 3PUBA 3BCAA 4C30A 4E4HA 3BG6A 4QIWF 4PFPA 2HU9A 3QYEA 1MA7A 1TZLA 3VWBA 4HNUA 3A4CA 3DQVC 4RM3A 4IKFA 2WY8Q 4AYBC 2KPMA 3VYSB 3VDXA 2R4GA 4PUSA 3HUGB 3SQIA 1NZBA 3FBNB 3H0DA 1T0FC 3DPLC 3PNTA 2K89A 2E1FA 2VIXA 4BE0A 4NC7A 4IX7A 2M7AA 4CH7A 2CN1A 3ZGKA 1ZQ1C 2G09A 2OYYA 2W82A 2A5WA 4ITVA 2OM6A 3SYTA 3MD2A 5HNFA 4P5OA 3EUAA 4XLFA 5CRXA 3H0LB 4CCLA 3CF2A 1X1CA 2JUGA 4JQFA 4AYBF 2ZSIB 3C2HA 2VXZA 3AL0C 1BR1A 2BDUA 3H5NA 4BGDA 3RFAA 3H0MB 2VQGA 3OYGA 3HXLA 2GOMA 5JHFA 3EUHC 4BEHA 4XKWA 2ZIUA 5CPRB 3OYDA 2Z16A 1X4PA 2XSJC 2Y0SA 3H9QA 2OC6A 1X1AA 2W4SA 1SZHA 3ONNA 2LY1A 2E1EA 4E7SA 1A6SA 3U21A 3UR3C 3OYNA 3CJRB 3K4MA 5KCMA 3S8PA 5CQEA 2WAQC 1IRXA 3DLAA 4YRVA 4B43A 3SEQA 2V26A 1V5FA 3CMMA 3BC8A 1BOBA 4XLEA 4D9JA 3F53A 1AA7A 4ZYAA 3HKZA 3IP4B 2VASA 2JVHA 2M4KA 2HVSA 3S3OA 3V42A 2PMZF 2AQEA 2VJ5A 2K9LA 4P0PA 4GFJA 3RQ4A 1YX5A 4B48A 4CZCA 4KJZA 3ONQA 4XONA 2Z7JA 4HEA2 1DGWY 3M1CA 2BVMA 3S3NA 2WBMA 2CV2A 2LKYA 1WJDA 2OXOA 1DRGA 4YEJA 1W36D 2CV0A 2KP6A 2KHMA 2M4GA 2VQCA 4PJLA 2WAQF 3C29A 4ZDOA 1J09A 3FKJA 3IUOA 3LVVA 4RM2A 4CRXA 4GRIA 2VB6A 2L7KA 3OR1C 2VKQA 1PJRA 4BUPA 2BVLA 3HPGA 4BE1A 3M6KA 3SAGA 3T79A 2V9KA 3ZCOA 1LFPA 2M0MA 3LSHA 3S93A 4OAYA 3QYBA 4XLCA 4F55A 3OYKA 1YE9A 2HBLA 3K4KA 2VJIA 3RCOA 4ANJA 1UELB 3NRWA 2E5NA 3AQEA 2BOLA 3QOEA 3OS1A 2KICA 2MC4A 3OS0A 2VXDA 4AYBA 4F93B 3RTRA 3OMYA 4Y33A 3OL4A 3KZXA 5C0YA 5HR7A 1NG6A 4B44A 4E7IA 1OLTA 4BQNA 4DBQA 4RLQA 3DKXA 3W2VA 2MFZA 2ZIVB 3PL8A 3PSIA 4XN3A 2R7SA 1U0JA 4AVZA 2JHDA 2R7OA 2IS1A 2YB1A 3H9GA 5CKTA 2M0NA 4A8EA 4F91B 2ZIUB 4KX5A 1DQUA 2IS4A 2HOIA 2LC2A 1MNDA 3HPHA 2W7PA 2DGZA 3F9KA 3OOUA 2XC7A 3TMOA 1S9HA 2ZSHB 3K4BA 3BCBA 1BR4A 4LIUA 4BDZA 2HPIA 3AQFA 1Q3VA 3GU3A 1P7DA 2LH9A 4F92B 4DGWB 2R7TA 2VJ4A 4OWRB 3DWLE 1WJCA 5LD2C 2PMZA 4BQOA 4E7JA 4KITB 2XF6A 2NV3A 4NLCA 2MYSA 4HPQA 2W00A 2W1OA 1X19A 2XF5A 2KD1A 4KT6A 3CRXA 3ZXSA 2JA2A 1Z3YA 2IGKA 1WJBA 4QPQA 2V6EA 1VZ0A 2XVTA 3SDBA 2VKDA 2WAQA 1BR2A 4OJ6A 4XKCA 2PJRB 2XICA 3H5RA 2ZIWA 4FZNA 2ZG6A 2BW3A 4HRIA 1E0EA 4CA0A 1D0YA 4O3MA 2ZIXA 4CCNA 1MNEA 1GO3F 3L2QA 2F6CA 2WB1C 3GZFA 1T94A 1D0XA 2CV1A 2HBJA 3MKZA 2JH7A 3LYSA 4NWIA 1UAAA 3VYUB 3D5SC 4OO1J 2HZDA 1OR7C 2V7FA 2R7VA 2IXSA 4RLFA 2N1RA 2H3FA 5KL1B 3ALRA 3ZR8X 3CZ6A 5HR6A 2HMXA 3N7SC 2GOXB 4BE2A 2DJIA 2E1MB 3FBIB 3MMYB 1Y56A 2HDWA 4DOZA 2KHQA 1W36C 1X1DA 2IGNA 1UG0A 4CCKA 2KJ8A 2F4IA 2X6YA 1FMWA 1PYVA 3KX2A 4ZC3A 2KMUA 3SEZA 3CJQB 4PSXA 3VYRB 1PVRA 2KJ9A 3E0FA 2MD0A 4E7KA 2Q2EB 4BQQA 4DJAA 4J01A 4KX3A 2R7UA 4NV0A 2F8LA 5KHDA 2WB1F 1D0ZA 2OH2A 1Z1BA 4NNJA 3ICXA 1L6NA 3I3LA 3I9V2 2R18A 2E5ZA 4PSWA 4XMYA 4P0QA 2HVQA 1PVQA 2CW7A 2RNGA 1SFKA 2RREA 3PFYA 1QU3A 4B3XA 3K6GA 4P1WA 4BJTA 1KONA 3N05A 3S32A 5KL8B 2X85A 3VSLA 4FZLA 3MGVA 2R7XA 3H0RB 4XOPA 2K3PA 2JSPA 4U6PA 2KRCA 2F5VA 2X1CA 3L2UA 2KLOA 2LYBA 4OJLA 2WY7Q 2H3IA 3KFUF 1IIPA 2HOQA 3DKYA 2E5SA 2LYAA 1UPHA 3IG5A 1F44A 4XQFA 2KIWA 3A1YA 2XAUA 2CRXA 3OYCA 4BACA 4JOMA 4QNLA 3GBGA 2K5CA 3SMVA 2KEYA 4BJ6C 4ZJZA 2RHFA 1D1AA 4XR6A 4BJQA 3PJRA 1T95A 5HNHA 2JH1A 2ZIWB 1URJA 4CSWA 3OYJA 2CW8A 1X4OA 2OUMA 4NQWB 3OYFA 2XIDA 3F5AA 2KRHA 1JI8A 2CMPA 3BLYA 3DTIA 4PJNA 2HNHA 2X6XA 2L9SA 2K4IA 3K70D 1LDKB 3CYMA 1XO0A 4ICAA 4ZTFA 1N78A 3CP2A 4LITA 3D2SA 2LYCA 1MMDA 2LBFA 2WA0A 2L9NA 3OIPA 4H4KC 3FHNA 3LL7A 4XORA 2CS3A 2UV1A 4NLBA 3OYAA 1G8XA 2I8DA 2K8AA 2ZXIA 4MLOA 4BXFA 1N77A 3J7AY 2W03A 2KNJA 2K8CB 2LBOA 3AFHA 3E0JB 3CP8A 4XL9A 4IC9A 4E7ZA 4BUGA 4XOTA 3F2CA 2A6TA 4PL1A 2WAFA 1OUQA 2G06A 3LSIA 2KVCA 4CDGA 1HEKA 2L2OA 2XF7A 4IQJA 4C9YA 4ZTJA 4D1QA 4IQ4A 4BEHB 2Y0SC 1LVKA 1WJAA 1YX3A 3M6ZA 3VC8A 5T14A 3D5LA 4P0QB 2VKHA 4XKBA 1QHHD 2KZVA 4HNTA 2F76X 2WADA 3HC7A 4BS9A 2CUZA 1G59A 4J00A 2IGMA 4PK4A 1HIWA 4QPOA 3OYIA 3OR2C 3HKZC 3OYLA 3DU5A 2VQLA 4XM3A 1P9QC 3TL4X 3NWTA 2DXIA 3OS2A 3M7DA 1D8BA 3LMMA 2AQFA 2X51A 4C2TA 4CGZA 3VYTB 2LHTA 2IGOA 1V5GA 3N7RC 3QODA 1TT0A 4R79A 4P0PB 2ZXHA 2X6WA 4OJPA 2G0AA 2Y0SF 4HSRA 3C2GA 1SAUA 4DIQA 2K8BB 3IAS2 2JVGA 2QKMB 3M8JA 2R7QA 3F2BA 3OL3A 2W7NA 2G5HB 4Y3OA 3OYBA 3HKZF 4C0ZA 3L2VA 4XKVA 2MRLA 4NUBA 3K4LA 2A3VA 5LFAA 4AU7A 1FMVA 3DEEA 4PFOA 3SZGA 3OY9A 4LIVA 2DF4B 3LVWA 3E1SA 4QJFB 2W04A 3VCBA 2E1MC 3QYFA 1MW7A 3D5RC 4B47A 4CCJA 4C2UA 4XN0A 2LBFB 2Q4TA 2GH1A 1ECWA 2DQNB 3LFUA 1R6RA 1WJ5A 2V4JC 2XDVA 3O0FA 3PSPA 2HBMA 3ZQQA 4OJOA 3OYEA 4HSTA 3OYHA 4PL2A 4ZDLA 3D2QA 4RMNA 3W2AA 3MKYB 2KQRA 1WUDA 4ACOA 2QKLB 3HOTA 3ZRGA 3K70C 1V5EA 3LSMA 3KYLA 4FZMA 1Q3UA 4F52A 1A0PA 3SAFA 2R7WA 2M3AA 4ZDPA 2G5IB 2YB4A 2IS6A 2G07A 1WJEA 4N4OB 1MMAA 1MMGA 3IN5A 2H3VA 3DTEA 3W2WA 2X1EA 3RPUD 4BDYA 5FRMA 2HPMA 2FUG2 3IG8A 3K10A 2ZIVA 4E7HA 3A2KA 3OYMA 2LG4A 3AL0B 2PMZC 3H9JA 2VQHA 3EUKL 2MA1A 4N4NB 3AKZA 4BU2A 3NUQA 2CUJA 1NG7A 2HOFA 4OAZA 2Z2SB 1PVPA 4PJJA 2CPRA 2VPLA 1LKXA 5A0LA 4E6KG 1N75A 2DT6A 1Z7LA 2HQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0L B;  1NG6 A;  3AL0 B;  3H0R B;  2D6F C;  2DF4 B;  3IP4 B;  2G5I B;  4WJ3 B;  2F2A B;  2G5H B;  1ZQ1 C;  3H0M B;  3KFU F;  2DQN B; 
#chains in the Genus database with same CATH topology
 4FET A;  1DP7 P;  4FTH A;  2JGA A;  3H5A A;  2AXT C;  2E60 A;  2Y1J A;  3HSR A;  5ALH A;  2ICW G;  5KFM A;  1Y6I A;  2AXL A;  2PLY A;  3JSP A;  3KHL A;  2P6R A;  1CGP A;  2BW3 B;  3BTL A;  3AG4 H;  2L4M A;  3OSF A;  2IBD A;  2O3F A;  4BY1 J;  2FJ1 A;  3TBI A;  4JMU A;  1D8Y A;  1I1S A;  4UUT A;  2HVI A;  9ICP A;  4LG3 A;  2FI1 A;  1VQ7 I;  5AHX A;  4G6D A;  2Y69 H;  1WHU A;  1X6I A;  1EA3 A;  3OSP A;  3KTQ A;  1GXQ A;  2PX9 A;  1X1B A;  4NC8 A;  3RJJ A;  2VBX A;  4DQQ A;  3EYZ A;  2LI6 A;  2JK3 A;  4UB8 C;  3PO2 J;  3LST A;  2BDP A;  4F2R A;  4Q44 A;  3DDH A;  1TW3 A;  4M3D A;  8ICP A;  4P4P A;  1Z67 A;  4Y15 A;  1WJF A;  2FE9 A;  2OHF A;  2ID3 A;  4C3J J;  3K4C A;  3MVP A;  3L2W A;  3M8S A;  2DPI A;  3CQZ J;  4EEL A;  4WJ3 B;  1MDM B;  1HDP A;  3NAR A;  1OCR H;  2M7B A;  5FFX A;  1VND A;  2PFP A;  8ICR A;  5AI6 A;  2DA1 A;  3F2D A;  2HVR A;  3PNV A;  5DB6 A;  2H3Q A;  3GUD A;  4FAS D;  4DZP A;  3CES A;  4DZJ A;  1D1B A;  1OJL A;  2BHY A;  3BG7 A;  1K61 A;  2KV2 A;  2WAE A;  4KUM A;  4RQ3 A;  2EH3 A;  3CDI A;  3FK7 A;  1KYW A;  2ACJ A;  3CJN A;  4HX7 A;  7ICF A;  2F1J A;  2L54 A;  2L7M P;  4J9S A;  5LGT A;  1P2F A;  1BI3 A;  1Y8R B;  1XNS A;  2K9M A;  3GLL A;  3KEY A;  1S5L C;  2FXA A;  3IAM 2;  4A3B J;  3LNQ A;  2HHU A;  5J0P A;  5K7H A;  4UB6 U;  4BY7 J;  4ED6 A;  2QQB A;  1VQ5 I;  1FOX A;  4HX4 A;  3OIO A;  2OEH A;  3RKX A;  2DDB A;  3QP5 A;  3HDD A;  1XCV A;  2R7R A;  2Z1D A;  4HF0 A;  2HBK A;  1H89 C;  1S10 A;  2XAG A;  3JPN A;  1LEA A;  2VKE A;  3MZH A;  3CCU I;  1IUY A;  4IHX A;  5DM6 F;  3PST A;  4QIW C;  1AHD P;  4UAW A;  4S04 A;  4XLA A;  4IRI A;  2XVC A;  5D4S A;  4YFK F;  3EYI A;  5KFH A;  1DP3 A;  2VLA A;  5KFE A;  2PFQ A;  3FDY A;  2M8G X;  4KIS A;  3E97 A;  3WTT C;  1JMS A;  2LOO A;  1JJ8 C;  4KMO B;  4KLG A;  2X1D A;  1PDN C;  1CRX A;  3OGU A;  3PMN A;  1QQ5 A;  3HG9 A;  5DTD A;  2ISZ A;  3PZP A;  4FX4 A;  4GCV A;  4Q8E A;  3BJY A;  1YYV A;  4BJ5 C;  4BH9 A;  1C20 A;  4AID A;  1MH3 A;  4CUG A;  3LSK A;  1ZG5 A;  1K7A A;  2O5R A;  1J0R A;  4II2 A;  3MN2 A;  2BYV E;  4R65 A;  3BCA A;  4F4K A;  3GFL A;  4QIW F;  3PW4 A;  3ML6 A;  1R23 A;  1KRP A;  2QF7 A;  5KFY A;  5JLW A;  1Y0U A;  1VQ6 I;  4TQR A;  3ZD9 A;  2AGO A;  2O6K A;  2FQ3 A;  5KFX A;  1SV0 C;  3HOU J;  5J3L A;  4LB5 A;  4A3G J;  2ADU A;  4U0W A;  2ZO4 A;  2BQR A;  2OAZ A;  2OTJ I;  4D7M A;  1YIO A;  4XRS A;  4UUS A;  1I3Q J;  3QPH A;  3MR6 A;  1W7P B;  4PUS A;  3T5J A;  2F5F A;  3U2R A;  5J2E A;  2DL0 A;  4RPX A;  5LBQ A;  2P5L C;  2WB1 N;  2R5Y B;  1XPX A;  3FIS A;  4U0V A;  3P9K A;  3C1D A;  2ALZ A;  3M8F A;  4C7Z A;  4PHA A;  1ZQ1 C;  5ALJ A;  2W82 A;  1KFD A;  4DOB A;  1IN6 A;  2F48 A;  3MDA A;  1C7Y A;  5E3O A;  2OM6 A;  4CYC A;  3SYT A;  5KFV A;  3PUF A;  1AKH A;  2KFD A;  2MC3 A;  1RET A;  3EUA A;  1GXP A;  1QA6 A;  4LVS A;  1VJ5 A;  4YD2 A;  1LKY A;  4CCL A;  1QPI A;  3B6A A;  3K9T A;  1X1C A;  5KT7 A;  1IZ1 A;  3KKA C;  4C8K A;  5KAF C;  2AJQ A;  5EYR A;  3AL0 C;  1K6O A;  1NKE A;  3ZDE A;  1HBX G;  1P4W A;  1T38 A;  4UUV A;  2BDU A;  3NAU A;  2O6G E;  2ODG A;  2NVT J;  5LLQ A;  3O8H A;  1ITY A;  2W11 A;  3H0M B;  2ISY A;  5JVG F;  3OYG A;  3HXL A;  3HHG A;  3HZJ A;  2HQN A;  4A3F J;  3WTU C;  1JIH A;  5IYB J;  3AU2 A;  1NK6 A;  3V4G A;  2EV0 A;  4B09 A;  3H9Q A;  3D6J A;  1FY7 A;  2W4S A;  4F2S A;  2LY1 A;  1PP7 U;  2VKV A;  4E7S A;  5K5Q A;  1NH3 A;  5D5V B;  5EEA A;  5EJC A;  2NNN A;  3CJR B;  3OYN A;  5F64 A;  2WAQ C;  5FP0 A;  4NM2 A;  1IRX A;  4YFK A;  2JEG A;  4GXJ A;  3SEQ A;  9ICJ A;  2V26 A;  5DB9 A;  2MGQ A;  4CHU A;  1IDZ A;  2LYH A;  5GAE J;  1TAQ A;  3HKZ A;  2Q0Z X;  2XIG A;  3JPP A;  1TVA A;  3RRH A;  5EOZ A;  2VJ5 A;  3ASN H;  5HDK A;  2W9C B;  1RR7 A;  3F6O A;  1MGT A;  5BNG A;  4B48 A;  3ERM A;  2KZZ A;  4EMS A;  3CLQ A;  4XON A;  4F8R A;  4YIF A;  4DO9 A;  5HS8 A;  3RDI A;  5FFZ A;  5TRD A;  2XPW A;  3GTO J;  1IN4 A;  1YS6 A;  1HLV A;  3BTJ A;  2DYR H;  2CV2 A;  2LKY A;  1WJD A;  3BJA A;  4NY8 A;  1HJP A;  2WAQ F;  2KP6 A;  2P35 A;  3HIF A;  5J0X A;  4A0Y A;  1SFU A;  2C2D A;  4ZDO A;  3FMR A;  1NK3 P;  4K4G A;  5FB2 A;  1SKR A;  2PFO A;  4RB0 A;  2VKQ A;  1WWV A;  4ZYD A;  3HX0 A;  4BUP A;  2BVL A;  4BE1 A;  1S29 A;  3T79 A;  1YJW I;  1GT0 C;  4PZN A;  2W84 A;  1WWX A;  3RZO J;  5KG6 A;  4GC7 A;  2I10 A;  3GZ5 A;  4ANJ A;  3TAC B;  3TAQ A;  4LG0 A;  2A61 A;  1XGS A;  4QZE A;  2R5Z B;  1XSN A;  2XGP A;  2UVV A;  2BOL A;  1P7D A;  3V7S A;  5E1Z B;  3DLL F;  4R1H A;  3RYR A;  2KIC A;  2XHK A;  5E18 F;  4B4C A;  2MC4 A;  3OS0 A;  1RG6 A;  3V7K A;  3TED A;  3FM9 A;  2GO7 A;  3RTR A;  3KZX A;  3A0H U;  5C0Y A;  4CIC A;  2C6Y A;  7ICO A;  3W2V A;  2P81 A;  4Y2V A;  2EIJ H;  7ICI A;  1KLN A;  1V85 A;  1U0J A;  3JRG A;  2R7O A;  1A6Q A;  5E8G A;  4A3E J;  2ETH A;  4EYI B;  4S05 A;  1K79 A;  1F5S A;  2JEJ A;  1FOW A;  1BM9 A;  4F91 B;  1IGN A;  4A8E A;  5KT3 A;  3V7J A;  1DQU A;  2BY1 A;  3HPH A;  5DCM B;  5FLM J;  4ED0 A;  2DMT A;  1VQM I;  4F3O A;  3F9K A;  2NVY J;  3L9F A;  4XIC A;  3JRF A;  2W8L A;  3BQ2 A;  2ZSH B;  4L5E A;  5E1X A;  2STT A;  2YQE A;  1I39 A;  5KFT A;  5LEK A;  1HKQ A;  3KKA A;  1NJX A;  2VOO A;  2DK8 A;  4PGG A;  4RQ7 A;  5AIA A;  1X2N A;  1ZQR A;  4DGW B;  4OD0 A;  3L7W A;  2VJ4 A;  3FXM A;  3K69 A;  4I7H A;  2AS5 F;  2JPC A;  4IQU A;  2BXY A;  3VB2 A;  1WJC A;  3DWL E;  5LD2 C;  5FD5 A;  2XF6 A;  5EE3 A;  2V4R A;  4HPQ A;  5DEQ A;  2ASJ A;  1ZGA A;  2YX4 A;  2W1O A;  2WC2 A;  1QCK A;  2XF5 A;  2FDR A;  1MBF A;  3V72 A;  3F8B A;  2LMR A;  2HYG D;  4M47 A;  2BY3 A;  2JA2 A;  1Z3Y A;  1WJB A;  4QPQ A;  3TKY A;  2DFF A;  5J0Y A;  4NDL A;  2XVT A;  3PR4 A;  4IS7 A;  3SDB A;  2WAQ A;  3KZI C;  4EBD A;  2EIL H;  4OJ6 A;  1XO1 A;  3RJI A;  4ELU A;  5ALU A;  2PJR B;  1DDN A;  3H5R A;  2W43 A;  4HAI A;  2ZG6 A;  4KN7 A;  2HTS A;  4YMO A;  3KEO A;  1LQ1 A;  2DA5 A;  3GFM A;  3FM5 A;  4KN4 X;  2L9V A;  2VBY A;  1L7N A;  3EQL F;  2ZIX A;  4BBR J;  3WHB A;  4RZR A;  2HBJ A;  5DB7 A;  3BDP A;  2QAR B;  1RYR A;  3D5S C;  2GBY A;  4UAS A;  2IXS A;  5M5X J;  3A0B C;  4C80 A;  5DQG A;  2RDJ A;  3ZR8 X;  2Q0O A;  2YML A;  1MNM C;  5KT6 A;  2V79 A;  3G1O A;  5K7F A;  1LUJ B;  3FKI J;  2FA5 A;  4BHC A;  3N7S C;  4YN4 A;  1DOQ A;  4BE2 A;  1MQ3 A;  5DD4 A;  4A6D A;  4Z6Y A;  2HDW A;  5CJ7 A;  1BJA A;  4IO9 F;  3CCJ I;  1X1D A;  3QZ8 A;  4KLE A;  4CCK A;  3L1P A;  2KJ8 A;  4US9 A;  2XGQ A;  5AKH A;  1I6X A;  1FMW A;  1KQ0 A;  2DA4 A;  3KX2 A;  3LQR A;  3S1M J;  1RM6 C;  1PUZ A;  4PHP A;  1RQN A;  4EQQ A;  4IRG A;  4NLZ A;  2Q2E B;  4BQQ A;  4DJA A;  5K1Y A;  4J01 A;  2A07 F;  4KX3 A;  5CVR A;  3CUQ C;  1AOY A;  2F8L A;  2FPM A;  3BR3 A;  4I2E A;  5KHD A;  4LK0 F;  1R1U A;  1FYL A;  3QUC A;  4QZG A;  1L6N A;  4NNJ A;  3ICX A;  3I3L A;  2E5Z A;  4IOC F;  1MKM A;  1SB3 C;  4RUC A;  2DMP A;  2HVQ A;  3QP6 A;  2RRE A;  1SFK A;  1SEU A;  3BZK A;  4KIC A;  1KKX A;  1U48 A;  2W48 A;  3EUB 2;  4I2G A;  4YR0 A;  1KON A;  2LMD A;  5J8Y A;  2X85 A;  4P55 A;  4UNO A;  1LEB A;  1TQI A;  2QVO A;  4O5C A;  1F4K A;  2XPV A;  3H0R B;  3I59 B;  4DL4 A;  1RKW A;  2K3P A;  3K1P A;  2FEZ A;  7ICT A;  2JA8 J;  1WH5 A;  5DB8 A;  4QWE A;  4DL5 A;  1ZQP A;  4ELV A;  3CTA A;  2ASD A;  2OBP A;  1I27 A;  2XO7 A;  4EBC A;  2KLO A;  2IBK A;  1FP2 A;  2H3I A;  2DI3 A;  4R63 A;  1O7L A;  4HYE A;  1IIP A;  1ZQC A;  3UXO A;  1SWV A;  4DL6 A;  3HRU A;  4M72 A;  1S7O A;  3GFJ A;  1YRN A;  5ALE A;  2AXT U;  1XB4 A;  4QNL A;  2GA1 A;  3GBG A;  4CNQ A;  2K5C A;  3GTL J;  1ZD3 A;  4B9V A;  2ZJR F;  3C7J A;  2I9G A;  2ZCW A;  4ZJZ A;  3AN1 A;  4XR6 A;  1YG2 A;  1DXS A;  2JRM A;  2DFL A;  4Y2J A;  5LHI A;  1JI8 A;  4XQ8 A;  1TWH J;  1FNN A;  2R8J A;  1YFH A;  5J0T A;  2CW8 A;  2AHQ A;  2OUM A;  1YOV B;  5GTI C;  2XKP A;  2DFH A;  2H94 A;  2KRH A;  5B66 C;  2WTE A;  3BLY A;  1A04 A;  2N8G A;  2HNH A;  2KIS A;  3E5X A;  4HQM A;  3V7C A;  5JFR A;  5KFA A;  3IM1 A;  3G6X A;  2EH9 A;  4GC6 A;  4B9L A;  4F71 A;  4L9N A;  4ZTF A;  3K1R B;  1N78 A;  4F50 A;  4DQR A;  1Z1V A;  1L8L A;  4ZOH C;  2HSZ A;  4LIT A;  3O8G A;  3A01 A;  3REO A;  4UB8 U;  1RYS A;  4IRK A;  4I28 A;  1MMD A;  3FXL A;  2H6C A;  4LLG F;  2O9L A;  3N4M B;  3BDD A;  4XOR A;  5DLG A;  4U88 A;  4NLB A;  1R22 A;  3DCF A;  3OYA A;  2I8D A;  1ZXI A;  2JV3 A;  4OIQ F;  3J7A Y;  4KLO A;  2M5W A;  2W03 A;  4AUX A;  4I76 A;  2K7L A;  5IT9 K;  4IC9 A;  4J9R A;  2WF5 A;  4BUG A;  1WYG A;  1MJB A;  4XOT A;  2A6T A;  3M7G A;  3F2C A;  2FSW A;  2WAF A;  4IOA F;  3BS7 A;  3JW4 A;  3LSI A;  3O6B B;  4S0H B;  2Z33 A;  3CC7 I;  1RYU A;  4QW8 A;  5ALK A;  3KHG A;  2QM3 A;  2MBF A;  5KG3 A;  3JTG A;  1RUN A;  2Y0S C;  1WJA A;  1YX3 A;  4YFN F;  2VUM J;  2FD5 A;  5J40 A;  4HNT A;  5J2A A;  4HV5 A;  4F7Z A;  1NI3 A;  2COB A;  5ICF A;  4YP3 A;  2IGM A;  2O0Y A;  2FF4 A;  1COO A;  1FYM A;  1P4A A;  1S5L U;  2H09 A;  4ZYH A;  5EGO A;  1B0X A;  3C1Z A;  1R9T J;  3OYI A;  1X1P A;  3DU5 A;  2X9D A;  3ZOB A;  5FO5 A;  3CUQ A;  1YS7 A;  4KMF A;  3Q8K A;  2EV6 A;  4C2T A;  1ZD2 P;  2M34 A;  2LHT A;  4BWJ A;  4KIG A;  5A2Q K;  2IGO A;  2EZX A;  4QJF B;  2LVS A;  2BHZ A;  4XRF A;  2KVS A;  3WKD A;  2ATL A;  2G0A A;  2Y0S F;  4GDF A;  4TV7 A;  2PEX A;  5FLX K;  3E6C C;  1DGJ A;  9ICR A;  1ETO A;  1XGO A;  3ZP5 A;  4R66 A;  5DS9 A;  4HDV A;  3GDX A;  2IHN A;  3I5U A;  1D8L A;  4Z6C A;  4H0E A;  1GHC A;  5F9N A;  3UXP A;  3RKQ A;  9ICG A;  4F5Q A;  2JT1 A;  4NUB A;  1TL8 A;  3RRG A;  1O3R A;  4B9S A;  5LFA A;  3RR8 A;  3KET A;  4XK4 A;  4G9Y A;  3GLX A;  2K60 A;  4J19 A;  4QWD A;  1ZQM A;  2QKQ A;  3OY9 A;  4LIV A;  3JR9 A;  1LVA A;  1U9O A;  3E1S A;  5GAG J;  1TQP A;  1HW5 A;  1FYK A;  1Q8K A;  3FDS A;  3R9K A;  3VCB A;  4YMM A;  1MW7 A;  3TAD C;  3OSN A;  2BPG A;  5GPA A;  4B47 A;  8ICK A;  1BPX A;  1SWW A;  4C2U A;  1N25 A;  1MBE A;  2OJE D;  3I64 A;  3U1K A;  3LFU A;  1ECW A;  1YJ9 I;  2YMQ A;  3PSP A;  2LP0 A;  4JX6 A;  2HBM A;  4KLM A;  4F5R A;  2D2W A;  3OYE A;  4HST A;  5L3G A;  4RNM A;  1U5T C;  1VQK I;  4JK1 A;  4PL2 A;  1OFC X;  2DU9 A;  2W57 A;  4QSH A;  3WE3 A;  2Y9Z A;  3VFZ A;  5J2C A;  3HBL A;  3W2A A;  1PK3 A;  2Y9U A;  2NO4 A;  4PHE A;  2YSR A;  5K4L A;  3W6J B;  4MEX A;  2E34 A;  4F52 A;  2OWO A;  2DOF A;  5F1J A;  2R7W A;  2D3D A;  2VPR A;  2M3A A;  3ZPL A;  3J81 j;  1MBK A;  2A5Y B;  4P9U A;  2PFB A;  4QWA A;  3QX7 A;  5IT9 Z;  2H3V A;  3W6V A;  3W2W A;  4WXC A;  2X1E A;  2IW5 A;  4BDY A;  1ZR2 A;  5FRM A;  2W55 A;  1G3S A;  3RKY A;  1Z9C A;  4QZH A;  2FUG 2;  2PI0 A;  1K4T A;  3WGI A;  5EGO B;  2FX0 A;  2DMQ A;  3IH4 A;  2ZIV A;  1B8I B;  2F8K A;  4KDP A;  5B5E C;  4A3L J;  3OYM A;  1NJZ A;  4YR2 A;  1P7J A;  8ICB A;  3S1N J;  2Y31 A;  2VQH A;  3EUK L;  1XSL A;  4N4N B;  1M6Y A;  2EDU A;  1ZQY A;  1NKC A;  2BGW A;  1S7A A;  2P5K A;  3PQK A;  5JR3 A;  5A0L A;  5HHI A;  4M9H A;  3GZ6 A;  1MZB A;  2F5C A;  5E79 C;  3MQ0 A;  5KFW A;  1GVD A;  1J9I A;  2F3N A;  5DLF A;  1K6Y A;  1M1E B;  3LK9 A;  1U4B A;  4ECY A;  4BX9 C;  5KK1 A;  1HC8 A;  1SV4 A;  1W7P D;  4DS4 A;  5AON A;  1V3F A;  3IH3 A;  2Z9O A;  3NVZ A;  4L9J A;  1L3V A;  2BXZ A;  2PMH A;  4F3Q A;  5DBC A;  5A2Q Z;  2JJ7 A;  4UY8 I;  1DU6 A;  2XGD A;  5J0U A;  4PHD A;  4NLK A;  4RQ6 A;  5HHH A;  2LD5 A;  2WF6 A;  2XAQ A;  4UAZ A;  5TGT A;  1ZQF A;  2OD5 A;  4X0G A;  4BL0 B;  2QB0 B;  4QW9 A;  5FLX Z;  2CW0 F;  4NB5 A;  1V55 H;  2Y75 A;  3KFW X;  4EBE A;  3T1B A;  1VQN I;  3C18 A;  5CQG A;  1YT3 A;  1N5W A;  1DPU A;  2K4H A;  1W0U A;  4O3S A;  1A5J A;  2DOA A;  2EFW A;  3SAH A;  1LDJ A;  5CA7 A;  4KLS A;  1XC5 A;  3ZQ7 A;  3PO4 A;  4XNF A;  5JLX A;  5ED4 A;  3JRI A;  5J2J A;  3DEW A;  4O9M A;  5F04 A;  3OIQ A;  3CCE I;  4ED8 A;  4KLL A;  4AM3 A;  2DQL A;  4IEJ A;  2KDO A;  1UCV A;  2LRD A;  1KBU A;  4KIF A;  2HHW A;  2DA3 A;  1FEZ A;  3F5E A;  3RF9 A;  1B4F A;  3ISC A;  2BCQ A;  4QZA A;  1SD6 A;  2KZ3 A;  1ZQB A;  3BR0 A;  1JT0 A;  3HWT A;  1EH6 A;  2DOD A;  1Z19 A;  3EZ5 A;  8ICG A;  5AKZ A;  4Q43 A;  1I3A A;  4U7B A;  2R93 J;  3TAD A;  5LEJ A;  1AWC A;  1GUU A;  2OTL I;  3DPT A;  1YW7 A;  2QBY B;  2YMM A;  3R0A A;  4PDK A;  4B6J A;  4A93 J;  2FLP A;  2RP5 A;  2GWS A;  4B9T A;  4LGW A;  1QGP A;  2GXA A;  2GM4 A;  5FLV A;  1Z3X A;  1R1T A;  4YEL A;  1JT6 A;  1QSS A;  1OYI A;  5HP4 A;  2L0K A;  2PJP A;  2RQQ A;  2AQ0 A;  1A35 A;  2GIV A;  2P6S A;  2IOF K;  2J5P A;  1UHU A;  5CB1 A;  2KJ5 A;  5BPC A;  2KTQ A;  1KZH A;  1O3S A;  2H3Z A;  3DPU A;  5KT5 A;  2R8H A;  2PFN A;  4O3R A;  1TBX A;  1MIJ A;  4U87 A;  4IRH A;  4EJV A;  2O61 A;  3JPS A;  4IHW A;  3RR7 A;  2ZNY A;  3PO5 A;  3SV3 A;  1XSP A;  5F08 A;  2E3T A;  4DF8 A;  4MGR A;  1RDF A;  9ICV A;  4A5M A;  5KFJ A;  5H20 A;  2KSO A;  3ESW B;  2FLN A;  3F8M A;  1K78 A;  2KHV A;  3HRD D;  3TW6 A;  1SZP A;  1Q3V A;  2ELH A;  2F2A B;  2RRD A;  5DGB A;  3IHU A;  3IRU A;  3RAQ A;  9ICH A;  2V9V A;  3L3F X;  4YMN A;  3EPZ A;  2G08 A;  3RYP A;  4L9V A;  1FFV A;  3H8J A;  3PX6 A;  4YQW A;  1Z4O A;  3HOS A;  1TAM A;  3H7I A;  4O6J A;  5KTQ A;  3LSR A;  1S76 D;  3AG3 H;  2V1N A;  4MFE A;  9ICS A;  3HP6 A;  3LSG A;  5EG0 B;  1DK3 A;  4BXO B;  3K1Z A;  4MF8 A;  4EGZ A;  2E1C A;  1XTA A;  2LY2 A;  2AU0 A;  4QWQ A;  3ETL A;  1SVL A;  3ZQF A;  4BKX A;  2QZ8 A;  3F23 A;  4R8U B;  3KZI U;  4ECV A;  2A6E F;  4NLN A;  1XG1 A;  1NZP A;  2IEK A;  3ZD8 A;  4RUA A;  1ZQG A;  3BJ6 A;  3M07 A;  2YY6 A;  1PVE A;  3VYS B;  1A77 A;  3KD3 A;  4D7N A;  4LD5 A;  2ZJ2 A;  3SQI A;  3H0D A;  3MR3 A;  1T0F C;  2HZT A;  1BVS A;  1ZQE A;  1F36 A;  1XDU A;  4LJZ F;  1X3W B;  1SAX A;  1C0W A;  2F4O B;  4ZH4 A;  1KU7 A;  3PVX A;  1QSY A;  4IX7 A;  2JWT A;  5JI6 A;  4QZ9 A;  3ZGK A;  3GFI A;  2G09 A;  4F5O A;  1ZQJ A;  3A0B U;  3UMG A;  4I29 A;  8ICQ A;  1T8I A;  1PUF A;  1B6A A;  3TOB A;  1SIJ A;  1O03 A;  4XSZ F;  5EEH A;  1S3J A;  1XN7 A;  1KQ8 A;  2E1O A;  3DKW A;  2HQ5 A;  4XLF A;  2M2E A;  4DFK A;  5E3N A;  3PW2 A;  4BDP A;  4DYC A;  5KFZ A;  4MFF A;  1K5O A;  2JZB A;  3ISB A;  2JUG A;  3BJO A;  1OXJ A;  1KDH A;  2A3S A;  2MSY A;  1MQ2 A;  1WRJ A;  1WCL A;  5DQI A;  5J29 A;  5JHU A;  3BTC A;  1Z00 B;  1ON1 A;  1Z6T A;  5EEG A;  5D49 A;  2JMW A;  3TDZ C;  3BG9 A;  4UAV A;  2VQG A;  5L3B A;  1UJ8 A;  1HF0 A;  3ROU A;  5JHF A;  1XGM A;  5ALP A;  2HR3 A;  1VQ4 I;  3EUH C;  4BEH A;  2ZIU A;  1S0M A;  3ABU A;  5CPR B;  3OYD A;  4G8X A;  1X4P A;  1OKR A;  5ALZ A;  2EA4 A;  2RQP A;  3CCY A;  2W9B B;  2E1E A;  3MDC A;  1ZAO A;  5ILV A;  2PMU A;  3SV4 A;  5GTH U;  1A6S A;  2JR5 A;  3UR3 C;  2RKH A;  2MW8 A;  2HYF A;  5CQE A;  4YRV A;  3WK6 A;  1V5F A;  1FZP B;  2NYV A;  2KP7 A;  5AIC A;  5J2K A;  2XGE A;  3I0T A;  1QVT A;  1WQ2 A;  3IP4 B;  1T3Q A;  2HVS A;  1X58 A;  3S3O A;  1QZY A;  2AQE A;  1PK1 B;  4IL6 C;  3PFI A;  3AU6 A;  3SZ2 A;  1MJ9 A;  2VOD A;  1USS A;  3LFK A;  4RAZ A;  4GFJ A;  5LGU A;  3WG7 H;  4CZC A;  3BS5 B;  4YIR X;  2Q8K A;  2XB0 X;  4EEF G;  1DGW Y;  3M1C A;  1ZK8 A;  3S3N A;  2WBM A;  2OXO A;  5KG2 A;  3TQN A;  3S17 J;  2CV0 A;  2M4G A;  2KHM A;  4RQN A;  5K5O A;  2AHO B;  3FKJ A;  3LVV A;  3WKC A;  2CO5 A;  1ZQT A;  4GRI A;  1XMX A;  3TP0 A;  3AAF A;  2L7K A;  5GTI U;  2XCA A;  1H88 C;  5AI4 A;  2DFI A;  1GV2 A;  5B66 U;  1PJR A;  1JX4 A;  3SAG A;  1FSH A;  3F8C A;  3LA7 A;  2EPF A;  3ZCO A;  2M0M A;  3S93 A;  3CMA I;  1G3W A;  3BTI A;  1ETW A;  1I50 J;  3HRS A;  4XRM A;  2FMP A;  2UXN A;  3SEI A;  4XLC A;  4F55 A;  3GTK J;  2HBL A;  1J5Y A;  5CHG A;  3BT9 A;  5BQT A;  3NRW A;  2VJI A;  1MBH A;  3RCO A;  1CI4 A;  2HDO A;  1TTY A;  3UMB A;  5B3S H;  1BI1 A;  3MC1 A;  2YR2 A;  3AQE A;  5G5H A;  4IF4 A;  3QOE A;  2Y30 A;  2VOP A;  2EA2 A;  1UHW A;  5DUK A;  1NK9 A;  1FIP A;  2HYJ A;  2VXD A;  4F93 B;  4CF5 A;  2ZTD A;  3RAX A;  4I02 A;  7ICG A;  5HR7 A;  2ECB A;  1COK A;  4B44 A;  2ZUC A;  4E7I A;  4BQN A;  3H8S A;  3DKX A;  4O3N A;  2MFZ A;  3PL8 A;  4XN3 A;  1OCZ H;  1VQL I;  2A1J B;  4EEN A;  2IS1 A;  2YB1 A;  3FMQ A;  1IN5 A;  5CKT A;  5J2F A;  3QU6 A;  4V19 K;  2M0N A;  1ZJN A;  2ZIU B;  9ICA A;  4Y2Q A;  2IS4 A;  4UXN A;  2XUB A;  1YO5 C;  1AU7 A;  2TRT A;  5KAI C;  3OOU A;  4DS5 A;  1SFE A;  3B73 A;  4I0A A;  1S9H A;  4C3H J;  3HOZ J;  9ANT A;  1BR4 A;  1EJ9 A;  1MH4 A;  4IQW A;  5C4X J;  2CQQ A;  3HKZ N;  2JPB A;  3GU3 A;  4KMU A;  1XMA A;  5TZV A;  1LDD A;  2R7T A;  2QEN A;  1K4S A;  5KG0 A;  4IHV A;  2V6C A;  4OWR B;  2DOE A;  3S14 J;  2DLL A;  4FIS A;  4BQO A;  3KP4 A;  3RJP A;  2Z3Y A;  4ESF A;  4NLC A;  1QQ6 A;  1X9W A;  4US8 A;  1IO2 A;  2W00 A;  2DKX A;  2FJ6 A;  1JHH A;  1KGS A;  4AVP A;  4MQV A;  2KD1 A;  3GV5 B;  3T5K A;  5IIL A;  2V6E A;  4MIM A;  2HVH A;  4Y17 A;  2HWV A;  3K1N A;  7ICQ A;  5EE1 A;  1SXE A;  4Y2R A;  5J0R A;  4BHB A;  1TWC J;  2VKD A;  4A3K J;  2AGP A;  3BG5 A;  5AKE A;  2ASL A;  3WG9 A;  2XIC A;  4FZN A;  3TOA A;  2ZIW A;  1Y8Q B;  1Z3E B;  1ZKG A;  2ESH A;  4CA0 A;  3NS1 A;  4ON0 A;  5AK3 A;  2ME0 A;  1F0M A;  3ZN1 A;  1MNE A;  4JX5 A;  2K9N A;  1R71 A;  1GO3 F;  3Q3S A;  2F6C A;  5FJ8 J;  2WB1 C;  2JH7 A;  4LZG A;  2CV1 A;  2COM A;  4M73 A;  3GXO A;  1UAA A;  3VYU B;  3QAH A;  3S2H J;  2HZD A;  1OR7 C;  2XRN A;  4UVB A;  5F0H A;  2MLG A;  3NAS A;  2H3F A;  5IIJ A;  9ICX A;  4C4R A;  3WK8 A;  3HRT A;  2H8R A;  2KHQ A;  4DOZ A;  3LA3 A;  3WK5 A;  5L1J A;  1LE8 A;  2IGN A;  1W0T A;  3TP3 A;  3JPT A;  4M6W A;  5J6X A;  1PYV A;  4DQP A;  4ZC3 A;  4EM1 A;  1Z91 A;  2KMU A;  3ZMZ A;  1ZRN A;  3JPR A;  2MG4 A;  3VYR B;  3CO6 C;  3KHH A;  2ISP A;  3WK9 A;  3LWL A;  2IHM A;  4A2U A;  4UB4 A;  4JV1 A;  5BPD A;  3QUQ A;  4Q8F A;  3HSE A;  2R7U A;  5J8C A;  3ED5 A;  3G4S I;  1KFT A;  3ZQG A;  3RH5 A;  1R5I D;  2PQ8 A;  5IP9 J;  2WB1 F;  4J9K A;  2I6X A;  2XY6 A;  1SKS A;  2ZME C;  2F4M B;  3GW2 A;  3I9V 2;  4LFU A;  2R18 A;  3HOW J;  4PSW A;  1VTN C;  1Z1D A;  1UHS A;  4UVA A;  3H4B A;  4P0Q A;  3J80 K;  3I4M J;  3PFY A;  2CUE A;  2E2H J;  4J9M A;  3A03 A;  3HTU A;  3F72 A;  3K6G A;  4P1W A;  4WXD A;  4OIN F;  3TW7 A;  4B3X A;  4BJT A;  3S32 A;  3MFK A;  2MH9 A;  1LFU P;  1BC7 C;  3I1Y A;  3L00 A;  5D4B A;  1QNT A;  2KIM A;  5AKL A;  2K9Q A;  2KK0 A;  2JRZ A;  2P6T A;  4I0B A;  2V1X A;  4XOP A;  2ZFW A;  2RN7 A;  2G7U A;  4O3Q A;  5B5E U;  2JSP A;  4G9B A;  5KFO A;  5ALN A;  4I2O A;  5DBB A;  3HYI A;  2EZK A;  2QQA A;  3K2A A;  2X1C A;  1HW1 A;  3J7Z I;  4Q5S F;  1LVH A;  2W3S A;  3DBL B;  3FIW A;  2O8K A;  5J1R A;  2HOQ A;  1XX5 A;  5AI8 A;  4KLQ A;  3FC4 A;  8ICO A;  3RJG A;  4UQG A;  4XQF A;  2KIW A;  2ZJP F;  1XSV A;  3C2M A;  4XA5 A;  4M3B A;  1RPW A;  1Y88 A;  3S1R J;  3OYC A;  3HOY J;  5E17 F;  3HOV J;  3SJM A;  4BYY A;  3TDU C;  2EQR A;  1IRG A;  2LY9 A;  4BJ6 C;  3KFU F;  2RHF A;  3THV A;  3FXO A;  1W5T A;  3RPU A;  4EEK A;  4BJQ A;  1QQI A;  2JH1 A;  1RI7 A;  2ZIW B;  1URJ A;  2CSO A;  4USA A;  4ED1 A;  1X4O A;  4UUS B;  2BV6 A;  2XID A;  3S16 J;  3M9O B;  5KG5 A;  2CMP A;  4KT5 C;  4PJN A;  2M87 A;  2X6X A;  5DYM A;  1HXD A;  1RIO H;  2RGV A;  1MSE C;  5TIS C;  4DLE A;  4JWM A;  1I1G A;  3MFI A;  1SD7 A;  1LDK B;  5E3M A;  4ICA A;  3T0Y A;  3PV8 A;  3U26 A;  1HKT A;  2XRL A;  4RAG A;  5CVI A;  4B8X A;  3D2S A;  3LA2 A;  4CYC B;  2L5Y A;  3ISP A;  4BHP A;  4LJX A;  1AKH B;  4L5I A;  9ICM A;  2V1D A;  4H4K C;  9ICU A;  4P96 A;  3K75 D;  2UV1 A;  2DA2 A;  9ICT A;  5KFK A;  1G8X A;  1LKY B;  1WI9 A;  1SV0 A;  4BXF A;  2K8A A;  2ISO A;  4DF4 A;  3R60 A;  3HUG A;  1ZG1 A;  2GXB A;  2P7C B;  3AFH A;  3E0J B;  5H2F C;  2KNJ A;  5AKI A;  4M9J A;  5BMZ A;  5DM7 F;  1MN8 A;  4E7Z A;  4B9N A;  4PGQ A;  4HX8 A;  2A1A A;  1I6H J;  4PZO A;  2G06 A;  2GZW A;  2ELK A;  3PM1 A;  1FTT A;  2DBB A;  5AM4 A;  4CDG A;  3C5G A;  2QLT A;  2K4B A;  4MQ9 F;  2L2O A;  1HEK A;  4C9Y A;  1OR7 A;  1FOK A;  5HS9 A;  4F5P A;  1SC7 A;  1BIA A;  3LWF A;  4DSK A;  3VC8 A;  4EZ9 A;  1V4R A;  4NHJ A;  3UXN A;  4DFM A;  2VKH A;  4P0Q B;  2Z5U A;  1QSL A;  3HC7 A;  3F8N A;  3HJE A;  2CUZ A;  2KZG A;  1HQC A;  1G59 A;  4GLX A;  2R7Z J;  2HHS A;  2R8K A;  3HM5 A;  1FWZ A;  1J2X A;  3BPX A;  3O3K A;  4BBS J;  1EF4 A;  2P4W A;  3KE2 A;  1MBJ A;  5BPI A;  3C2B A;  1RPL A;  1RR8 C;  3NWT A;  3M7D A;  3TGN A;  3EET A;  5FKM A;  2FMY A;  2X51 A;  2MLK A;  1R58 A;  4CGZ A;  4B9M A;  3VYT B;  3J80 Z;  5ALV A;  3HPO A;  3B0X A;  1V5G A;  5J1U A;  3QOD A;  4RS8 A;  1TT0 A;  1I5Z A;  4R79 A;  3GTM J;  1KEJ A;  2X6W A;  3RB0 A;  7ICS A;  2O03 A;  3PW5 A;  2RQ5 A;  1BW6 A;  3I55 I;  2LNB A;  2K8B B;  2EIK H;  7ICV A;  4EM2 A;  1H0M A;  3U9G A;  2R7Q A;  2EIM H;  1ZRE A;  3HW8 A;  4I2D A;  1R5G A;  1IAW A;  5KG1 A;  5ALQ A;  2EAM A;  1W1W E;  2CRG A;  1Y1W J;  3DP7 A;  2MA3 A;  4Y3O A;  3OYB A;  2G5H B;  2IOH A;  3S6J A;  1SL1 A;  2BPF A;  3CCV I;  1S0N A;  8ICY A;  2FLL A;  1S6L A;  2BZT A;  3Q9V A;  4XKV A;  2MRL A;  5ALX A;  1SGG A;  3WK7 A;  5KFN A;  3ZQC A;  3KLN A;  4JBA A;  2NRW A;  2PXI A;  4JUZ A;  1A6I A;  2H1K A;  3H3U A;  3DEE A;  4PFO A;  3JRH A;  3JRC A;  5D8K B;  3DV9 A;  3I53 A;  2M9H A;  2GAU A;  4IXA A;  4EM0 B;  1J2M A;  1CUK A;  2W04 A;  1U3E M;  5IOZ A;  2E1M C;  3QYF A;  4QZD A;  2YTU A;  5EWE A;  4KLI A;  3KP6 A;  4MNU A;  5EZG A;  4LG0 B;  3BQT A;  5ALT A;  2JEI A;  4FO6 A;  3DBR B;  3HTS B;  4KLU A;  4HF2 A;  3GF2 A;  1D3Y A;  4AYB N;  2F1I A;  1FLI A;  1G3T A;  1X9M A;  1R6R A;  2OF7 A;  2V4J C;  2VA8 A;  5L1I A;  2CQK A;  4TUP A;  2NS8 A;  2HDC A;  1MJA A;  4C4S A;  3C5F A;  1BPE A;  4ZDL A;  2W54 A;  4ED7 A;  5CVV A;  3MCZ A;  4RAF A;  3D2Q A;  4EJU A;  1ZQV A;  3MKY B;  4CF4 A;  1L7P A;  2KQR A;  3GVA A;  1WUD A;  2WF8 A;  3RB4 A;  4ACO A;  1T3N A;  3ZRG A;  4RBO A;  5ALY A;  3QE9 Y;  3LSM A;  2I5H A;  1R1V A;  2FPL A;  3SR6 A;  3EYY A;  1VFC A;  3TO6 A;  1R4N B;  5HS7 A;  4KYW A;  1A0P A;  1R00 A;  3BRO A;  3NTU A;  3Q0W A;  3G73 A;  4OMY A;  5AKK A;  4M9G A;  4UAT A;  4RQ4 A;  3TKA A;  2G5I B;  2IS6 A;  2G07 A;  4I2F A;  3AUO A;  1XCB A;  5D6F A;  3GX4 X;  4PJ0 C;  2UVU A;  3GIM A;  1SL0 A;  1ZGW A;  2LSO A;  3I28 A;  1MMA A;  1Y1V J;  4BNC A;  3IN5 A;  5IP6 A;  3GQC A;  1ZD4 A;  4BQA A;  3MR2 A;  2HPM A;  3K10 A;  4PCQ A;  3L09 A;  1DU0 A;  4E7H A;  2PMZ N;  3T8R A;  4DOA A;  8ICT A;  2LG4 A;  2XAJ A;  4CXF A;  3AL0 B;  2PMZ C;  1N48 A;  1CF7 A;  2MA1 A;  3AKZ A;  2DDA A;  5AK5 A;  1HUZ A;  4KLD A;  1RZT A;  1WH7 A;  4OAZ A;  1PVP A;  4PJJ A;  5AM5 A;  3GME A;  5AIB A;  2J6U A;  4E6K G;  4FE4 A;  2DT6 A;  4C2M J;  9ICE A;  8ICJ A;  4KFC A;  3L2R A;  5E20 A;  2AGQ A;  3WTS C;  2ZJ8 A;  4I2J A;  3C28 A;  2IVM A;  3VSK A;  5ALW A;  2NOJ B;  2XC9 A;  3E6M A;  2IMW P;  2YX7 A;  2JQ7 A;  2E36 A;  4NC6 A;  4M3G A;  2WV1 A;  1IN7 A;  2HKO A;  4FX0 A;  2KOB A;  3N28 A;  1FIQ A;  3RJE A;  2VL8 A;  5ERI A;  2VT2 A;  4ECR A;  1KTQ A;  3K4J A;  2ZIX B;  2HCF A;  2GOL A;  5D8L B;  2ZFU A;  2AQ4 A;  1U9N A;  4UV8 A;  4P4M A;  4ZZL A;  1ZEL A;  3N7P D;  4XLH A;  5AKG A;  4RT2 A;  3KPH A;  4ED2 A;  4DFP A;  8ICS A;  3OPX A;  1ON2 A;  4O5K A;  1MMN A;  3V7R A;  1XC9 A;  5L1M A;  3UNG C;  3K4N A;  1NK8 A;  2EAP A;  2LF7 A;  2F2E A;  4A12 A;  1TAU A;  4RT3 A;  2BQU A;  1OCC H;  2BQ3 A;  2EB7 A;  4DQS A;  2ELJ A;  3PNY A;  1LFB A;  1BPD A;  1YTY A;  2CU7 A;  2F77 X;  2K4E A;  3SFI A;  4O3O A;  1OPC A;  3WTX C;  3FXR A;  2F1H A;  5KNL A;  2LPE A;  5AM2 A;  1KL9 A;  3MKW B;  1IJW C;  5HNK A;  2C22 A;  3RSN A;  3AEV A;  3OOP A;  4EAT A;  3CF5 F;  4Z6F A;  5K5R A;  2XRO A;  5F0C A;  1B22 A;  1FEX A;  1FPQ A;  3G1M A;  2OQR A;  2E2I J;  2JMG A;  4IZZ A;  3QNM A;  3M8E A;  2XCP A;  2BY0 A;  2MU2 A;  1E17 A;  2NVU B;  1ZR4 A;  3W3C A;  3CJT B;  3ERE D;  5TJJ A;  1WKM A;  2IA6 A;  2J6S A;  2C28 A;  3H35 A;  1R7J A;  3V6K A;  8ICW A;  2WFA A;  2LK2 A;  8ICC A;  7ICR A;  4JV2 A;  3HSF A;  1TWF J;  1ZN2 A;  3QU9 A;  5HVQ C;  1P92 A;  2DCE A;  4D5C A;  3C23 A;  2KIQ A;  2YX8 A;  3C2K A;  4M0A A;  3N97 A;  3GV7 B;  4E7L A;  2ZUB A;  5E1W A;  4UB6 C;  5F1R A;  5AI5 A;  2Z99 A;  3PW7 A;  2MUT A;  1UZC A;  2XI9 A;  1Z21 A;  2PI4 A;  4L18 B;  3WTY C;  1R4M B;  8ICL A;  2UXX A;  1GLN A;  4AIH A;  4EJW A;  4DBR A;  1JUD A;  5AIP A;  4JV0 A;  3G6V A;  2IS2 A;  4ZZD A;  1L0O C;  1NK2 P;  3FHZ A;  1ZRM A;  2X48 A;  5IIO A;  4JYK A;  5KAI U;  2LRE A;  3SZT A;  5FRO A;  1YI2 I;  5C3E J;  1BNO A;  2M30 A;  1YRN B;  3FAH A;  2KIU A;  2OZU A;  2VT3 A;  2QSF X;  1VQ9 I;  1J7K A;  2CH0 A;  1LB2 A;  4MFD A;  1BIB A;  1QTM A;  3CCM I;  2P0W A;  4GXK A;  1XS9 D;  3QUT A;  4MHV A;  1K1Q A;  2V4Q A;  1QQ7 A;  4RGX A;  2GWR A;  5DKW A;  1U8R A;  1WFX A;  4M3E A;  2DUY A;  3DEU A;  2GXG A;  3MWM A;  5ILS A;  3PML A;  4ECW A;  4E4H A;  3BPV A;  4DL2 A;  3QU4 A;  2KJC A;  3QYE A;  5L3F A;  4AP9 A;  1RXW A;  1TZL A;  2OCC H;  3S2W A;  4A3I J;  3E6B A;  4LOC A;  3A01 B;  1FFU A;  3A4C A;  4F72 A;  4C8O A;  5BOL A;  1JKO C;  2V9P A;  7ICE A;  3Q0V A;  2WY8 Q;  3SI8 A;  4UV9 A;  3VDX A;  2K3F A;  3H36 A;  4NQW A;  2KIV A;  2XY7 A;  1NZB A;  1S7E A;  1YJN I;  4I2H A;  1F9N A;  1ZQW A;  3DPL C;  3GWZ A;  4JX4 A;  2E1F A;  4GYI A;  4BE0 A;  2ES6 A;  7ICU A;  2DW4 A;  2A6H F;  4NC7 A;  3WU2 C;  1ZQS A;  2CN1 A;  9ICW A;  2EK5 A;  4RQ5 A;  2XAF A;  1B72 A;  2OYY A;  1JGS A;  4ITV A;  3TQ1 A;  5B1B H;  4QLC U;  4G7H F;  2W9M A;  1W5S A;  2EZI A;  1L7M A;  5HNF A;  4P5O A;  1G6N A;  4A5N A;  1FSE A;  4ELT A;  3E6D A;  3R61 A;  2QA4 I;  1A31 A;  2BZF A;  5KAF U;  4QZC A;  3TI0 A;  4I2I A;  4JQF A;  5ALO A;  4DSF A;  1KYZ A;  2ZSI B;  1ZQH A;  4KN7 X;  7ICN A;  4YD1 A;  7ICJ A;  1D5Y A;  4YXJ A;  4UBB A;  1N56 A;  1W4M A;  2DA7 A;  2L9R A;  2D8C A;  3N97 B;  4CYD A;  3IRQ A;  4ECZ A;  1HOM A;  4JWN A;  3LAP A;  3ISD A;  3CUQ B;  3TFS A;  1KFS A;  1KU3 A;  2GOM A;  1TWA J;  1HKS A;  1SFX A;  4XKW A;  1HCR A;  3E58 A;  3HOX J;  1NOM A;  5III A;  3I71 A;  2Z16 A;  1SZH A;  2XSJ C;  2Y0S A;  5CVJ A;  1X1A A;  5KFF A;  3WOD F;  2RC4 A;  2VI6 A;  2BCU A;  3U21 A;  1V54 H;  5AKX A;  5KCM A;  3S8P A;  3DLA A;  3QU3 A;  1VQ8 I;  2JA6 J;  5AM3 A;  3CMM A;  2KRF A;  4BXU A;  8ICV A;  2EFP A;  3BY6 A;  3BC8 A;  2KT0 A;  4XLE A;  4QTR A;  4ZYA A;  2K02 A;  4UB5 A;  2QYO A;  2HOS A;  1ETY A;  4KTQ A;  1IG6 A;  2JVH A;  1UT8 A;  5IY5 H;  1T98 A;  3V42 A;  1G4D A;  3GTG J;  2LM1 A;  3ABT A;  3QPL A;  1JKR C;  2DBY A;  4GFB A;  2CQ7 A;  2K9L A;  4XUS A;  4P0P A;  1CEZ A;  3T5X A;  1YX5 A;  4N9I A;  3QYP A;  4KLH A;  4KJZ A;  3ONQ A;  5ICC A;  3EDP A;  3KP7 A;  4WF2 A;  2Z7J A;  1IF1 A;  5DG8 A;  4DSL A;  5L3D A;  9ICI A;  2HOA A;  5G5G A;  3GIJ A;  2R8I A;  1DRG A;  1W36 D;  2KG5 A;  4PJL A;  4GIB A;  3ZI4 A;  2VQC A;  3JPQ A;  3C29 A;  4Q45 A;  1QVU A;  2GLE A;  4HLY A;  1QPM A;  2ECC A;  3E5U A;  2EWN A;  1B9M A;  4CRX A;  3GTP J;  2BCS A;  5J2G A;  3ECH A;  4DQ2 A;  4HNV A;  1P7I A;  8ICH A;  3GEZ A;  4HW0 A;  1B43 A;  1NK4 A;  5TIS U;  4CZZ A;  4DCC A;  3LSH A;  5K7Z A;  4OAY A;  2HFH A;  2EZH A;  3UKG A;  3P5J A;  3FX3 A;  3QYB A;  2V9W A;  1GDT A;  3WKB A;  1T7P A;  2QLZ A;  3OYK A;  1YE9 A;  1JUP A;  4F4Y A;  4K4H A;  3K4K A;  1UEL B;  1ZQU A;  2BHN A;  4JB3 A;  1ARO P;  3V7L A;  4M74 A;  5KFU A;  2NYX A;  2V1U A;  2UZK A;  2DPD A;  2E8O A;  1TP4 A;  4XRH A;  5J0O A;  2DMU A;  3LOC A;  3OS1 A;  4Z6E A;  4RNN A;  1UCR A;  3M9A A;  3KP5 A;  1X40 A;  4DWI A;  5HLH A;  5DGA A;  1IRZ A;  5HMM A;  1XU4 A;  3OMY A;  4Y33 A;  4EYH B;  3EW9 A;  3B6C A;  1U5T A;  1OLT A;  1S8N A;  4M6V A;  4RLQ A;  4DBQ A;  5ALI A;  9ICB A;  3QOP A;  1PP8 F;  2ZIV B;  2R7S A;  4A6E A;  2P5V A;  4AVZ A;  3GTQ J;  3PR5 B;  5GAD J;  2EV5 A;  1DPR A;  3G6Y A;  3H9G A;  1FBQ A;  1JRO A;  3LQQ A;  1IW7 F;  1HST A;  1MD0 A;  3NEU A;  2DK5 A;  4FHT A;  2XPU A;  4KIB A;  3X2Q H;  1MND A;  5AIQ A;  2W7P A;  4F5N A;  1TK8 A;  5FKL A;  3U1D A;  1SD4 A;  2XC7 A;  1ZLK A;  3VOD A;  4PGY A;  3DV8 A;  3BCB A;  3K4B A;  2E8P A;  1JHF A;  1WZ2 A;  3OSG A;  5KT4 A;  4A3D J;  1R5H A;  4TUR A;  4L0Z B;  2LH9 A;  4F92 B;  1ONV A;  3GCM A;  4J9P A;  1FBS A;  4C4T A;  1D8J A;  2HHT A;  2TDX A;  1ZYR F;  2VC0 A;  3ZMS A;  4E7J A;  4XID A;  4KIT B;  1IRF A;  4EGY A;  2J6T A;  2F5E A;  2QGU A;  4OIP F;  2MYS A;  2A68 F;  2NRZ A;  3Q8M A;  2RV8 A;  4FS2 A;  1ZQI A;  1UST A;  4IPA A;  1NK7 A;  1BN5 A;  4HOB A;  3JAM K;  2IA2 A;  3BR1 A;  1WSU A;  4KT6 A;  2YU9 J;  3ZXS A;  3CRX A;  4FBT A;  5D5W B;  1ZOL A;  2IGK A;  2M9N A;  4MEY F;  1FTZ A;  5J1Y A;  2O7O A;  3ZMU A;  4HAM A;  3IWF A;  1IN8 A;  1OCO H;  2OPT A;  3V8L A;  5KT2 A;  4AWX B;  1NK0 A;  4HYK A;  1HUO A;  1OYY A;  2BW3 A;  3JRA A;  1E0E A;  5J47 A;  5ALF A;  2LM4 A;  1ZRF A;  1OQY A;  3GO5 A;  4EJT A;  1YZ6 A;  4CCN A;  4PGH A;  4R64 A;  4A69 C;  1LV5 A;  2QQ8 A;  3IKV A;  3PIO F;  4P2H A;  3LYS A;  2DTR A;  1D0X A;  2L7Z A;  2VN2 A;  1W5C C;  3MKZ A;  1T94 A;  3NVV A;  1O57 A;  1S97 A;  1O3T A;  4KLF A;  2HHV A;  2V7F A;  4YCX A;  2R7V A;  2DO7 A;  2IP2 A;  2M45 A;  4XLP F;  2N1R A;  3TAR A;  3ALR A;  3RB6 A;  5HR6 A;  3CME I;  2HMX A;  1ZD5 A;  2CFX A;  5DDG A;  5EE0 A;  2GOX B;  4C7Y A;  5EWG A;  2XY5 A;  1S77 D;  4L0Y B;  7ICP A;  4RQ8 A;  2CWE A;  3FBI B;  1FT9 A;  1W36 C;  1UG0 A;  8ICI A;  5GAH J;  2X6Y A;  4RDU A;  2XSD C;  1J59 A;  4O5E A;  5IOY A;  3SEZ A;  3CJQ B;  4PSX A;  1MDM A;  3FXK A;  1BL0 A;  5AI9 A;  3E0F A;  1X42 A;  2MD0 A;  1A36 A;  8ICF A;  3Q8S B;  3ZDC A;  4NV0 A;  3CC2 I;  4LZD A;  1U5T B;  3BOQ A;  5FKO A;  8ICN A;  1VDV A;  4A3C J;  4WWC A;  2I5U A;  1GV5 A;  1IG7 A;  3UQ2 A;  5CVU A;  4B9U A;  3MKL A;  3IV5 A;  4RB2 C;  2ESN A;  2RNG A;  2VBZ A;  4M9Z A;  4OMZ A;  5BOM A;  1IC8 A;  4RAY A;  3M9N B;  4M6Y A;  1ZH5 A;  1QZE A;  5KL8 B;  1RKT A;  1N62 A;  1IV6 A;  1UG2 A;  2KSO B;  5F3X B;  3PX0 A;  5LRR A;  1K78 B;  4FZL A;  4OOI A;  3OV8 A;  2KIF A;  3MGV A;  3UQ0 A;  1L3S A;  4CF3 A;  3NVW A;  2ESE A;  4AC0 A;  4IR9 A;  5LHH A;  4ENJ A;  2BBY A;  3FXU A;  2B63 J;  3J7A O;  5DD8 A;  4KLT A;  2R0Q C;  2IA1 A;  2F5V A;  3NRZ A;  4C3I J;  1MC8 A;  3L2U A;  1UMQ A;  3ABK H;  3ZMT A;  2WY7 Q;  2MAX A;  5C4J J;  3F21 A;  2Y9Y A;  2MSN A;  2BPC A;  5H6Q A;  1FJL A;  3PNC A;  4F4W A;  1D8K A;  5J2H A;  2DFE A;  1IUF A;  2IA0 A;  2OA4 A;  1FOY A;  3A1Y A;  3NRV A;  4ESJ A;  2NRT A;  4MEY A;  4X5V A;  3M9M B;  3KLO A;  2KEY A;  1KA8 A;  3PX4 A;  2F5D A;  2BEO A;  1F43 A;  4GGG A;  4Y13 A;  1T95 A;  5HNH A;  3PJR A;  5KG4 A;  1TK5 A;  2DWQ A;  4NM1 A;  2HW3 A;  3OYF A;  5EZH A;  4OIO F;  2G9W A;  3JAM Z;  1GVJ A;  2L9S A;  1SMT A;  1Y39 A;  2KMD A;  1TQM A;  4MF2 A;  2KZM A;  3CYM A;  1B1B A;  3NQO A;  1XO0 A;  4PPX A;  2C2R A;  1BPY A;  3QU5 A;  4MO7 A;  3FM3 A;  3JCU C;  2ZJQ F;  5KFL A;  3S2D J;  1PUF B;  3DXJ F;  3G1L A;  4BAY A;  2LYC A;  5IYD J;  2K4P A;  2KN7 A;  2L9N A;  1RNL A;  1ZRD A;  1B4A A;  3FHN A;  3JSO A;  4HF1 A;  2DAO A;  3V6J A;  2CS3 A;  4X6A J;  4I27 A;  1YZ7 A;  1TNS A;  4HLX A;  3ORY A;  3QU7 A;  3T3F A;  1W7P A;  2JZB B;  2K8C B;  2LBO A;  1X3Z B;  7ICK A;  3CP8 A;  3KCC A;  2R5Y A;  3AM9 A;  5FD6 A;  4MTE A;  1T0F A;  1TE2 A;  7ICL A;  2W25 A;  4U7D A;  1YW9 A;  2QCO A;  2XGC A;  3E2E A;  4HDU A;  4DLG A;  4G6Q A;  4EX6 A;  2E35 A;  2XF7 A;  4IQJ A;  2E1N A;  1EH7 A;  4DOC A;  3F8F A;  4DYR A;  4BEH B;  5T14 A;  3BQZ A;  3CD6 I;  3D5L A;  1LPQ A;  5IIM A;  4XKB A;  1QHH D;  2KZV A;  4FQG A;  3JRE A;  3QU2 A;  5HLI A;  4BS9 A;  1CQT A;  2DA6 A;  4HA8 A;  5M5W J;  1ULY A;  1NK5 A;  4PK4 A;  5KFS A;  2JA7 J;  1X9X A;  3BZ6 A;  4J9L A;  5KVR A;  4XLN F;  3HKZ C;  4W1U A;  2NO5 A;  4ZYE A;  4XM3 A;  4KN4 A;  3B02 A;  3TL4 X;  5ALL A;  5J2D A;  4IHT A;  3K0L A;  4RPY A;  1D8B A;  1KW4 A;  1VI0 A;  3LMM A;  2AQF A;  4G12 A;  1ODD A;  2BGC A;  1TT5 B;  1ETV A;  3BG3 A;  3FF5 A;  3OJU A;  3TAP A;  2EJR A;  3EUH A;  4MHG A;  3RPQ A;  5HLG A;  3KEQ A;  4QIW N;  2YUS A;  4RGS A;  4FFD A;  4LLN A;  3QUB A;  4QWB A;  4CE6 A;  1SAU A;  4K2E A;  1L7O A;  4TQS A;  3IDW A;  3ZDD A;  5AI0 A;  1SVO A;  1Z77 A;  1S0V A;  1UA0 A;  2JVG A;  2QKM B;  3K4G A;  3M8J A;  1ACI A;  2D45 A;  3F2B A;  5ILU A;  3H40 A;  1X9S A;  4EX7 A;  1XD7 A;  3T5H A;  4ESB A;  4F4X A;  1WI3 A;  3HKZ F;  4C0Z A;  1U47 A;  2EAN A;  3L2V A;  4UB1 A;  8ICM A;  2W9C A;  2EIN H;  2A3V A;  4WX9 A;  4AU7 A;  5EF6 A;  4LB6 B;  3TO7 A;  4GXI A;  2M8E A;  3SZG A;  1ENH A;  9ICO A;  2FNP A;  2EFO A;  2KKO A;  4O0I A;  1R49 A;  4A0Z A;  5J2I A;  4IQV A;  2M0C A;  3FXJ A;  4AIK A;  2A69 F;  3RI4 A;  4BXX J;  2B0C A;  2E8N A;  2D1H A;  2P8T A;  4CCJ A;  5C5J A;  4M04 A;  4KLJ A;  2W24 A;  4XN0 A;  2Q4T A;  3MBY A;  1U78 A;  4M71 A;  3S15 J;  2DQN B;  3R6S A;  1WJ5 A;  1WCM J;  1UFM A;  3RQI A;  2ZTE A;  1PUE E;  3O0F A;  3Q8L A;  2BCR A;  3MFH A;  4RB3 C;  3V8J A;  2YPR A;  1YLF A;  4EZ6 A;  1T33 A;  3WKA A;  1RRJ A;  3MZ8 A;  4OIR F;  2HHQ A;  3AMZ A;  4RMN A;  3WU2 U;  4ZYG A;  1WVR A;  3M1E A;  2K4J A;  2R7D A;  3QWL A;  1J2N A;  4EEY A;  1V5E A;  6PAX A;  3KYL A;  1V97 A;  4FZM A;  4DL7 A;  3SAF A;  2R5Z A;  1EKE A;  3SYZ A;  4RU9 A;  2YB4 A;  3P9C A;  5HDG A;  2B0L A;  4ENN A;  1J97 A;  1WJE A;  1SXD A;  1MMG A;  4I99 C;  1SVM A;  4XRS G;  2ZC2 A;  3IWZ A;  3DTE A;  2ZTC A;  4RGU A;  1Z7U A;  3WU1 B;  5F27 A;  5J4V A;  4ENM A;  3A2K A;  2FQ4 A;  5JVT A;  1TKD A;  4AIJ A;  2H6B A;  3H8W A;  3H9J A;  3T5L A;  3C2L A;  1P6R A;  2NAZ A;  4BU2 A;  7ICH A;  2CUJ A;  4NL9 C;  3GII A;  3JRB A;  2HOF A;  2XAH A;  3H1C A;  2CPR A;  2LLK A;  5DCM A;  4OU0 A;  3H92 A;  3Q8R B;  1ZQQ A;  2VPL A;  5KFB A;  2HDD A;  4J9O A;  1QLN A;  1E2X A;  5IP7 J;  5E79 U;  2X0L A;  3HEF A;  2WTF A;  2WAQ N;  3RJK A;  2DT7 B;  3SFZ A;  4G6T B;  2HGC A;  5BOX A;  2HOT A;  2D1V A;  3HGG A;  1D1C A;  1QHG A;  4Y4R A;  2ZXJ A;  4WXH A;  4AD9 A;  3RBD A;  3DTK A;  1ZQN A;  2A05 A;  2DQR A;  3FWE A;  3I4P A;  3P9I A;  4IJA A;  3KHR A;  1ZQK A;  3CUO A;  2HI3 A;  2JZY A;  4CCO A;  1NKB A;  1U6G A;  1TNT A;  2FBI A;  1WCN A;  4YXM A;  4QZ8 A;  3ABL H;  2OZ6 A;  3F0C A;  1JI7 A;  5KFQ A;  2E71 A;  4FT8 A;  3ZMV A;  1S0O A;  4PJM A;  3C1Y A;  2FE3 A;  4P4O A;  1A76 A;  4L5J A;  3L2C A;  3SXY A;  4RQ2 A;  1QRY A;  1FIA A;  1BPB A;  3CDL A;  3Q5F A;  1EXN A;  3ZQL A;  2WF7 A;  2FU4 A;  3KIO A;  3VOE A;  5LGN A;  1E3O C;  2P66 A;  5LRS A;  2PJR A;  1EH8 A;  1BPZ A;  2KFZ A;  5JTI A;  2L5Q A;  1LE8 B;  4OCZ A;  3JPO A;  5HOD A;  4M6W B;  1ERD A;  5JU5 A;  2MD5 A;  2NS0 A;  1D5V A;  4QZB A;  5DCF A;  1IXR C;  1ZLJ A;  2G0E A;  4EVI A;  2LKX A;  2E8M A;  2P6U A;  1DGR M;  3F22 A;  2QAR A;  1ED1 A;  2P7V B;  2QEX I;  2WB1 A;  2ZB9 A;  1XSX A;  1LJ9 A;  4PZJ A;  4RQM A;  5CP2 A;  1SL2 A;  2L3D A;  3H3Z A;  1L3L A;  4IRD A;  3KZZ A;  2CFO A;  4EV0 A;  3D2N A;  4B3A A;  3Q9S A;  2E7W A;  5HOO A;  5M3M J;  4CCM A;  5FRN A;  1S8O A;  2L01 A;  2VJJ A;  2PKE A;  5AK6 A;  5D5U B;  3G2B A;  4A3J J;  2MAB A;  5HML A;  5EWF A;  4II3 A;  2OV7 A;  4A3M J;  1MMS A;  3GV8 B;  2D6F C;  9ICN A;  2RNJ A;  3NWS A;  2NXN B;  3FYH A;  5J8Y C;  4HG2 A;  2K27 A;  1IV8 A;  4IHS A;  5D4R A;  4KNY A;  5KFI A;  4OO1 J;  3ULQ B;  2ZKZ A;  4O5V A;  2Q2E A;  3S3M A;  2H8W A;  3G71 I;  1Q1H A;  3ECO A;  8ICA A;  3O2P E;  5CYV A;  5HDN A;  2Q1Z B;  3PSF A;  4YFX F;  1WGX A;  5LHG A;  5HLT A;  5KFD A;  2HEO A;  4YR3 A;  5F6F A;  5IIK A;  3QZ7 A;  1B59 A;  2ZME A;  1REP C;  1HA8 A;  2W7O A;  3DU6 A;  1NTC A;  9ICC A;  3OHA A;  3MGH A;  2FMS A;  2DKZ A;  3W6K B;  2KL4 A;  4FE3 A;  4Q48 A;  2WWY A;  5M3F J;  3KYC B;  5L9X A;  4LLL A;  2UWM A;  2LKP A;  1KU9 A;  2OQG A;  3KP3 A;  2UUZ A;  3BZC A;  4DNC A;  2MH2 A;  1UQV A;  3HL2 A;  3I59 A;  2JUC A;  4Q47 A;  4OJ5 A;  4PH5 A;  3QEB Z;  1IM4 A;  5DV5 A;  4CO8 A;  2BKE A;  3OWT A;  2YU3 A;  5E8I A;  4NJ8 A;  2KKP A;  1ZRC A;  1BA5 A;  1SAN A;  4U7C A;  4UAY A;  4I2C A;  2DMN A;  2A19 A;  2JXJ A;  3UPQ A;  1ETX A;  2KKV A;  9ICL A;  5KFC A;  3FMS A;  3CCQ I;  4NL9 A;  4RPZ A;  2W9A A;  4V2F A;  5D6E A;  1JXL A;  3PUB A;  2UVW A;  3RH6 A;  4C30 A;  4NLG A;  3BG6 A;  5F9L A;  4N9H A;  1X3U A;  2XKO A;  1XMK A;  2HU9 A;  4PFP A;  1VQO I;  2VON A;  5BS6 A;  1XSD A;  2CQN A;  1MA7 A;  4IVN A;  3VWB A;  1U9L A;  4HNU A;  1RUO A;  1Y0N A;  3DQV C;  5EDN A;  4G7O F;  1QZZ A;  5KFG A;  4DL3 A;  2K86 A;  1Z0X A;  3KP2 A;  2W8K A;  4M9N A;  4RM3 A;  4IKF A;  4Z6D A;  3L5K A;  1LNW A;  4AYB C;  2KPM A;  4KMU X;  2CQX A;  4I98 B;  2LFB A;  2R4G A;  5DG9 A;  4FBU A;  3HUG B;  1ZHF A;  1FO4 A;  3FBN B;  2CG4 A;  1RC9 A;  3PNT A;  2K89 A;  3D0S A;  3H0G J;  1VQP I;  2B9S A;  5CWR A;  1Z05 A;  2VIX A;  2M7A A;  4CH7 A;  3WK4 A;  2EAO A;  3HIL A;  4I2A A;  1T2K A;  2VBW A;  2A5W A;  4MTD A;  1Z4N A;  3C21 A;  3DF8 A;  4Y2P A;  2L4A A;  3MD2 A;  3CMY A;  4RB1 A;  4YII A;  5IYC J;  2EQY A;  1SKW A;  3N4M A;  1YHQ I;  3ASO H;  2NVQ J;  1QO0 D;  5CRX A;  2VAN A;  3H0L B;  2H27 A;  3CF2 A;  2XAS A;  1KSP A;  1IXS B;  1VLB A;  1ZQA A;  3CNH A;  4AYB F;  2FBK A;  8ICZ A;  3C2H A;  3AG2 H;  2VXZ A;  4ABZ A;  1IXR A;  5ALR A;  1BR1 A;  3PW0 A;  3H5N A;  5KFP A;  4DSE A;  2GA2 A;  1TFR A;  4BGD A;  3RFA A;  4IHY A;  2FBH A;  3MEX A;  2AO9 A;  5FKN A;  3WHC A;  1N63 A;  5ALG A;  5B1A H;  2BCV A;  2ZME B;  2STW A;  2R7F A;  1STZ A;  1N60 A;  3ONN A;  2OC6 A;  2NRA C;  2QB1 A;  4DFJ A;  3BWG A;  2OU2 A;  1YIT I;  2G7H A;  3H8M A;  2ZJA A;  5GTH C;  4ENK A;  4QWC A;  3K4M A;  1D9F A;  1D9D A;  4B43 A;  3RKW A;  3T8T A;  3TO9 A;  3F53 A;  1BOB A;  2HTJ A;  4D9J A;  3CCL I;  1AA7 A;  2ZNZ A;  2H1L A;  4U0Y A;  2VAS A;  2M4K A;  3HRM A;  2PMZ F;  1BJZ A;  4IL6 U;  4P9F A;  4W97 A;  1DGS A;  3WGH A;  3RQ4 A;  5CEH A;  1L3T A;  3G3Z A;  1YW8 A;  4ECT A;  3K7A J;  4DSJ A;  5ICG A;  2AH5 A;  5DG7 A;  1KQ9 A;  4HEA 2;  2ZUD A;  1UT5 A;  3F3X A;  3NGD A;  1L5U A;  2BVM A;  3RZD J;  8ICX A;  4J9Q A;  1JE8 A;  4TUS A;  4FE7 A;  4YEJ A;  2LKS A;  3ABM H;  5DDM A;  1FX7 A;  2NNY A;  4TUQ A;  2HHX A;  1MSW D;  1J09 A;  2VE8 A;  4YG2 F;  4ECU A;  3IUO A;  2HOE A;  4UB2 A;  4RM2 A;  2QSG X;  4G94 A;  3DBH B;  3WKE A;  2JSC A;  2K85 A;  1S72 I;  4JP0 A;  2VB6 A;  3OR1 C;  3CO7 C;  1SD5 A;  1T39 A;  1MSF C;  3VPR A;  3WE2 A;  2HI0 A;  4Y2X A;  5D46 A;  3COA C;  3BP8 A;  2DPJ A;  2JEF A;  3HPG A;  2GLO A;  2O8X A;  3KYD B;  3M6K A;  2V9K A;  1LFP A;  1BI2 A;  1T8E A;  1IDY A;  2NOG A;  3BQY A;  5ALM A;  2RDP A;  2ME6 A;  9ICF A;  3BQ1 A;  2FNA A;  3HT3 A;  2E5N A;  3QXG A;  3M4O J;  4HV6 A;  2PG4 A;  4I2B A;  3L4P A;  4E70 A;  4A0X A;  2GQQ A;  3ZN0 A;  3RTV A;  4NBQ A;  4DQI A;  2FML A;  4DSI A;  5IPA A;  5DUI A;  3LSP A;  4RQ0 A;  4AYB A;  1JXE A;  3WU0 A;  1WWU A;  2FRH A;  2R3S A;  2Y48 A;  3OL4 A;  3CCS I;  1NG6 A;  2QWW A;  3EPG A;  5J2B A;  2B7E A;  1X66 A;  3PSI A;  3QPT A;  2YN4 A;  3RH4 A;  2NRX A;  2JHD A;  2PBI A;  1RES A;  4MFA A;  4Y2U A;  3RIR A;  1CF7 B;  2R92 J;  4MEX F;  1NHA A;  3GFK B;  2HS5 A;  3V8K A;  2Y0S N;  1OCT C;  4G3I A;  1TWG J;  4KX5 A;  2HOI A;  2JTV A;  2LC2 A;  1OYW A;  4HQE A;  2DGZ A;  5AK4 A;  1WG8 A;  2DJN A;  2NVX J;  2NS7 A;  3TMO A;  4M3F A;  2RDI A;  4HBL A;  4LIU A;  3QRF F;  4BDZ A;  2HPI A;  4N0B A;  2X6O A;  4WCG A;  1L8O A;  1H9T A;  3AQF A;  1B8I A;  3IHQ B;  4I09 A;  4ECQ A;  3UM9 A;  4C8N A;  3K2Z A;  3R0J A;  2FOW A;  1J75 A;  4Y52 J;  1PZN A;  4ETS A;  2J5O A;  1ZGJ A;  2JRT A;  2PMZ A;  5M5Y J;  4XBF A;  5ALD A;  4M6X A;  4ECX A;  2NV3 A;  1RZ4 A;  4DFD A;  1TV9 A;  4UAU A;  2UVR A;  1T08 B;  4EJO A;  3BR5 A;  1H38 A;  3LWM A;  1X19 A;  4DW6 A;  2TCT A;  3EWA A;  3E3V A;  3SHF A;  1JN3 A;  1BI0 A;  3I54 A;  2DN0 A;  1VZ0 A;  5L3C A;  2IOF A;  1T56 A;  4M2Y A;  2X4H A;  1BR2 A;  1T6S A;  1SFO J;  2NRV A;  3ELK A;  4XKC A;  2HXI A;  3Q8Q B;  1BGX T;  4YG2 A;  1L3U A;  4HRI A;  4GO1 A;  3B9J A;  1ZQ3 P;  1G3Y A;  1D0Y A;  5GP9 A;  4O3M A;  4RNO A;  2OCE A;  1BNP A;  3L2Q A;  1XDS A;  3HGY A;  3ETR A;  2E2J J;  2QB0 A;  3GZF A;  2ID6 A;  4NWI A;  1Z6R A;  4MFC A;  2R8G A;  5KFR A;  1ZQZ A;  1NJW A;  3I4N J;  1ETQ A;  4RLF A;  2GIZ A;  5KL1 B;  2LF8 A;  2Y9T A;  3CZ6 A;  2YMP A;  1KU2 A;  2RLT A;  1X6J A;  3DFG A;  1X2M A;  1EV7 A;  3GYH X;  4KA4 A;  2DJI A;  2E1M B;  3MMY B;  1Y56 A;  3C3W A;  1U2W A;  2M1B A;  1ETK A;  1POG A;  1E3H A;  5F0F A;  4ASN A;  1JGG A;  1ZQL A;  2Y0M A;  1OCP A;  2F4I A;  5ICE A;  3FK6 A;  1HSJ A;  1PVR A;  2KJ9 A;  5KG7 A;  1O7F A;  1UHM A;  4E7K A;  1XWL A;  2CYY A;  5J0S A;  4ECS A;  1RXV A;  2FMQ A;  2WF9 A;  1FP1 D;  2EBI A;  4UVC A;  1U8B A;  1K83 J;  3CCR I;  3SD7 A;  1D0Z A;  2PN6 A;  3Q0U A;  2OH2 A;  2MUT B;  1TW2 A;  1Z1B A;  1DK2 A;  2D5V A;  2RAE A;  2CXY A;  4O3P A;  4XMY A;  2W3R A;  4FS1 A;  3VEP A;  1PVQ A;  3LSJ A;  2CW7 A;  1K1S A;  1N2X A;  2BE5 F;  1QU3 A;  5GPC A;  2QBY A;  3E5Q A;  3PQJ A;  1ZAR A;  3N05 A;  3BR6 A;  5H6R A;  1SMY F;  1OMI A;  5CJ9 A;  4HZF A;  4V2G A;  3VSL A;  3JRD A;  4L9T A;  1P4X A;  2R7X A;  4CCH A;  1HW2 A;  4R8H A;  4Z2Y A;  5ALS A;  2H5X A;  3TAN A;  3G6E I;  4QZF A;  1LB2 B;  4FCY A;  2KJB A;  4UAR A;  4UHT A;  2FPK A;  3BQ0 A;  3IRR A;  1NNL A;  4U6P A;  2KRC A;  3LAJ A;  4Y2S A;  5AKY A;  2IPQ X;  2LYB A;  3SQN A;  1F1Z A;  4OJL A;  1BW5 A;  4NXZ A;  3J81 K;  4RGR A;  3MR5 A;  3GIL A;  2B21 A;  3DKY A;  3BQ7 A;  4DEZ A;  1TK0 A;  2E5S A;  2LYA A;  1UPH A;  3I76 A;  3IG5 A;  1VF9 A;  4GXO A;  3KBB A;  1F44 A;  4D0P A;  4UW9 A;  3IKT A;  1KQQ A;  2XAU A;  1T4G A;  2CRX A;  4BAC A;  4JOM A;  1BOA A;  3HHH A;  1NJY A;  1JTY A;  4UBC A;  2BR0 A;  3SMV A;  4ED3 A;  4C8L A;  1Q1V A;  2JN6 A;  1U49 A;  1RQL A;  1D1A A;  3AG1 H;  1YQA A;  3QQA A;  4E0D A;  4CSW A;  3OYJ A;  3F5A A;  3M8R A;  4NQW B;  5AM0 A;  2W85 A;  4BWM A;  1ZTR A;  3DTI A;  2IT0 A;  2KFN A;  5EG0 A;  3IL2 A;  5L1L A;  3CLO A;  5J8F A;  1KN5 A;  3ZDA A;  3PO3 J;  2K4I A;  2K40 A;  4BXO A;  3K70 D;  3GZN B;  4RQ1 A;  3UMC A;  1X2I A;  1B72 B;  1AQ6 A;  3CP2 A;  2B6G A;  2E7X A;  3GTJ J;  2L02 A;  4R8U A;  2KDZ A;  4M9L A;  3OIP A;  2BY2 A;  2LBF A;  2WA0 A;  3R4K A;  3LL7 A;  3B0Y A;  2QSH X;  2WHE A;  2ZXI A;  4MLO A;  3ZQI A;  1N77 A;  2EZZ A;  2LTP A;  1O08 A;  5IIN A;  5H2F U;  4IR1 A;  1FC3 A;  4XL9 A;  9ICK A;  5D5X B;  3A0H C;  1U45 A;  5DDY A;  1YIJ I;  4PL1 A;  1ZQD A;  4ZH4 F;  1OUQ A;  3MAJ A;  3SDG A;  3D1N I;  3MGI A;  2KVC A;  3K1M A;  4QZI A;  2C2E A;  2PI5 A;  1BC8 C;  3M3Y J;  2DTZ A;  4ZTJ A;  3I56 I;  4D1Q A;  3F6V A;  5IT3 A;  1ZET A;  4LK1 F;  4IQ4 A;  2ZXW H;  5FGM A;  1LVK A;  3M6Z A;  2VC1 A;  4X1E A;  2E19 A;  1ZQX A;  3IH2 A;  2FOK A;  5JRT A;  2F76 X;  3RBE A;  2DYS H;  1H8A C;  2WAD A;  3WTV C;  5DBA A;  3M1Y A;  2HQR A;  3Q8P B;  1R36 A;  5CLS A;  4J00 A;  1V38 A;  3KZY A;  4UB3 A;  1OIS A;  3GIK A;  1Z00 A;  9ICQ A;  4M9X A;  1HIW A;  3RJF A;  4QPO A;  3CW2 C;  3OR2 C;  3OYL A;  1JXS A;  2VQL A;  2Y2Z A;  1P9Q C;  1F5T A;  2DXI A;  5CR0 A;  3OS2 A;  2DPU A;  2VE9 A;  8ICU A;  3V6H A;  3OTQ A;  1FBU A;  3ZDB A;  5EE9 A;  4K4I A;  3N7R C;  3H3V K;  3QEA Z;  4P0P B;  1E3P A;  2ZXH A;  4OJP A;  3MAB A;  5AM1 A;  2W9B A;  4HSR A;  3C2G A;  4DIQ A;  3H4D A;  3IAS 2;  3BR2 A;  1G2H A;  2RVC A;  4G7Z F;  4B1R A;  1APL C;  3I58 A;  3OL3 A;  2F44 A;  4LMY A;  3E7L A;  2W7N A;  1BBY A;  1JUM A;  2EZY A;  3RJH A;  1JJ6 C;  2HXO A;  4I01 A;  1N61 A;  3NVY A;  3WGG A;  3PIP F;  1JKQ C;  1PK1 A;  1JTX A;  4J03 A;  5J0W A;  1ZQO A;  3J81 Z;  3MZY A;  2DT5 A;  2YS9 A;  3QPS A;  1UB9 A;  1JRP A;  3LDA A;  1TC3 C;  3IC7 A;  3K4L A;  3BS5 A;  2KE7 A;  1FMV A;  4PGX A;  3OJS A;  2IRF G;  2VA2 A;  1ZYQ A;  2DF4 B;  3LVW A;  4Y2Y A;  1DUX C;  4Q4Z F;  1HDD C;  1OW5 A;  2Y1I A;  1B9N A;  3D5R C;  2XGX A;  5JUM A;  2IAI A;  4IRC A;  2LBF B;  2QQ9 A;  2GH1 A;  2I1Q A;  2LDU A;  2XDV A;  3ZQH A;  4M9S A;  4DYQ A;  1V9P A;  3PY8 A;  1N5X A;  3ZQQ A;  2L7F P;  2ZBK A;  4OJO A;  3J7Y J;  3TFR A;  2EZL A;  3OYH A;  2ZJ5 A;  7ICM A;  2CJJ A;  1XS9 A;  3SEN A;  2IJL A;  3EPI A;  3WTZ A;  5L3E A;  4GYG A;  1MBG A;  3KOO A;  1H9G A;  1WPK A;  2QKL B;  3HOT A;  3K70 C;  3S1Q J;  4C8M A;  1S9F A;  1Q3U A;  1JAL A;  5L1K A;  2JA5 J;  1O4X A;  3SZP A;  1QH9 A;  5AKJ A;  3HB9 A;  2HKX A;  3CDH A;  8ICE A;  4ZDP A;  1QBJ A;  2EFQ A;  1ZJM A;  4PJ0 U;  5FKK A;  3OHB A;  1JUS A;  1XGN A;  1UA1 A;  3RB3 A;  4N4O B;  1ZG3 A;  2EFN A;  1TLH B;  3IV6 A;  2WV0 A;  3RPU D;  4XSX F;  5J0Q A;  4WK8 F;  5DQH A;  5J4Y A;  2XV4 S;  2CUF A;  4RA2 A;  4D5F A;  4Y7N J;  3CC4 I;  2XB5 A;  3IG8 A;  1O3Q A;  4JK1 X;  2A1J A;  4YVZ A;  4I6Z A;  3P7N A;  2K9S A;  4Y2T A;  3FXQ A;  3WTW C;  4F4Z A;  1IXC A;  2VA3 A;  3JTH A;  3NUQ A;  1NG7 A;  2LR8 A;  2Z2S B;  5KNI A;  1Q46 A;  5E3L A;  1ORK A;  3A02 A;  3FZV A;  2QUF A;  4J9N A;  1JKP C;  1LKX A;  2CGP A;  4IQT A;  1N75 A;  3ZMD A;  5C44 J;  1Z7L A;  2HQA A; 
#chains in the Genus database with same CATH homology
 3L2R A;  2DT7 B;  4FET A;  4G6T B;  3H5A A;  1K6Y A;  2JGA A;  2E60 A;  3C28 A;  3VSK A;  1D1C A;  1QHG A;  4BX9 C;  1Y6I A;  2NOJ B;  4Y4R A;  2KOB A;  3DTK A;  2BW3 B;  2VL8 A;  4F3Q A;  4JMU A;  3K4J A;  3TBI A;  4CCO A;  2ZIX B;  4LG3 A;  2GOL A;  2ZFU A;  5TGT A;  1EA3 A;  4X0G A;  4BL0 B;  1ZEL A;  3N7P D;  4XLH A;  4PJM A;  1X1B A;  4NC8 A;  3OPX A;  1MMN A;  3UNG C;  3K4N A;  5CQG A;  1YT3 A;  2K4H A;  2PJR A;  2DOA A;  3SAH A;  2ELJ A;  3PNY A;  2K4E A;  2F77 X;  2L5Q A;  1WJF A;  1ERD A;  3K4C A;  4XNF A;  3L2W A;  4WJ3 B;  5KNL A;  2M7B A;  3OIQ A;  3MKW B;  1DGR M;  3RSN A;  2KDO A;  4EAT A;  1ED1 A;  2LRD A;  2WB1 A;  3F2D A;  1KBU A;  2HVR A;  3F5E A;  3RF9 A;  3PNV A;  2H3Q A;  2CFO A;  4FAS D;  3D2N A;  5HOO A;  3CES A;  5FRN A;  1D1B A;  3BG7 A;  4CCM A;  4IZZ A;  2JMG A;  1Z19 A;  2VJJ A;  2WAE A;  2KV2 A;  3G2B A;  2MAB A;  2D6F C;  4II3 A;  2OV7 A;  3W3C A;  4U7B A;  3NWS A;  3DPT A;  3H35 A;  4HG2 A;  2RP5 A;  1XNS A;  5HVQ C;  2K9M A;  3KEY A;  1Z3X A;  2DCE A;  3IAM 2;  4YEL A;  3S3M A;  2YX8 A;  4E7L A;  2RQQ A;  5HLT A;  2Q1Z B;  3PSF A;  2KJ5 A;  2H3Z A;  2XI9 A;  1Z21 A;  2R7R A;  3DPU A;  2Z1D A;  2HBK A;  1HA8 A;  2W7O A;  1GLN A;  4DBR A;  4U87 A;  3DU6 A;  2IS2 A;  4QIW C;  3PST A;  2KL4 A;  4FE3 A;  2LRE A;  2UWM A;  4XLA A;  5FRO A;  2KHV A;  2UUZ A;  1DP3 A;  2VLA A;  3FDY A;  3HL2 A;  4KIS A;  2F2A B;  2CH0 A;  2RRD A;  4OJ5 A;  2LOO A;  4KMO B;  3L3F X;  3OWT A;  3EPZ A;  2X1D A;  2G08 A;  2P0W A;  2KKP A;  1CRX A;  4U7C A;  3HG9 A;  3HOS A;  1TAM A;  3PZP A;  4BJ5 C;  1WFX A;  2KKV A;  2V1N A;  4CUG A;  3LSK A;  3LSG A;  2O5R A;  4II2 A;  3K1Z A;  2LY2 A;  3PUB A;  3BCA A;  4C30 A;  4E4H A;  3BG6 A;  4QIW F;  4PFP A;  2HU9 A;  3QYE A;  1MA7 A;  1TZL A;  3VWB A;  4HNU A;  3A4C A;  3DQV C;  4RM3 A;  4IKF A;  2WY8 Q;  4AYB C;  2KPM A;  3VYS B;  3VDX A;  2R4G A;  4PUS A;  3HUG B;  3SQI A;  1NZB A;  3FBN B;  3H0D A;  1T0F C;  3DPL C;  3PNT A;  2K89 A;  2E1F A;  2VIX A;  4BE0 A;  4NC7 A;  4IX7 A;  2M7A A;  4CH7 A;  2CN1 A;  3ZGK A;  1ZQ1 C;  2G09 A;  2OYY A;  2W82 A;  2A5W A;  4ITV A;  2OM6 A;  3SYT A;  3MD2 A;  5HNF A;  4P5O A;  3EUA A;  4XLF A;  5CRX A;  3H0L B;  4CCL A;  3CF2 A;  1X1C A;  2JUG A;  4JQF A;  4AYB F;  2ZSI B;  3C2H A;  2VXZ A;  3AL0 C;  1BR1 A;  2BDU A;  3H5N A;  4BGD A;  3RFA A;  3H0M B;  2VQG A;  3OYG A;  3HXL A;  2GOM A;  5JHF A;  3EUH C;  4BEH A;  4XKW A;  2ZIU A;  5CPR B;  3OYD A;  2Z16 A;  1X4P A;  2XSJ C;  2Y0S A;  3H9Q A;  2OC6 A;  1X1A A;  2W4S A;  1SZH A;  3ONN A;  2LY1 A;  2E1E A;  4E7S A;  1A6S A;  3U21 A;  3UR3 C;  3OYN A;  3CJR B;  3K4M A;  5KCM A;  3S8P A;  5CQE A;  2WAQ C;  1IRX A;  3DLA A;  4YRV A;  4B43 A;  3SEQ A;  2V26 A;  1V5F A;  3CMM A;  3BC8 A;  1BOB A;  4XLE A;  4D9J A;  3F53 A;  1AA7 A;  4ZYA A;  3HKZ A;  3IP4 B;  2VAS A;  2JVH A;  2M4K A;  2HVS A;  3S3O A;  3V42 A;  2PMZ F;  2AQE A;  2VJ5 A;  2K9L A;  4P0P A;  4GFJ A;  3RQ4 A;  1YX5 A;  4B48 A;  4CZC A;  4KJZ A;  3ONQ A;  4XON A;  2Z7J A;  4HEA 2;  1DGW Y;  3M1C A;  2BVM A;  3S3N A;  2WBM A;  2CV2 A;  2LKY A;  1WJD A;  2OXO A;  1DRG A;  4YEJ A;  1W36 D;  2CV0 A;  2KP6 A;  2KHM A;  2M4G A;  2VQC A;  4PJL A;  2WAQ F;  3C29 A;  4ZDO A;  1J09 A;  3FKJ A;  3IUO A;  3LVV A;  4RM2 A;  4CRX A;  4GRI A;  2VB6 A;  2L7K A;  3OR1 C;  2VKQ A;  1PJR A;  4BUP A;  2BVL A;  3HPG A;  4BE1 A;  3M6K A;  3SAG A;  3T79 A;  2V9K A;  3ZCO A;  1LFP A;  2M0M A;  3LSH A;  3S93 A;  4OAY A;  3QYB A;  4XLC A;  4F55 A;  3OYK A;  1YE9 A;  2HBL A;  3K4K A;  2VJI A;  3RCO A;  4ANJ A;  1UEL B;  3NRW A;  2E5N A;  3AQE A;  2BOL A;  3QOE A;  3OS1 A;  2KIC A;  2MC4 A;  3OS0 A;  2VXD A;  4AYB A;  4F93 B;  3RTR A;  3OMY A;  4Y33 A;  3OL4 A;  3KZX A;  5C0Y A;  5HR7 A;  1NG6 A;  4B44 A;  4E7I A;  1OLT A;  4BQN A;  4DBQ A;  4RLQ A;  3DKX A;  3W2V A;  2MFZ A;  2ZIV B;  3PL8 A;  3PSI A;  4XN3 A;  2R7S A;  1U0J A;  4AVZ A;  2JHD A;  2R7O A;  2IS1 A;  2YB1 A;  3H9G A;  5CKT A;  2M0N A;  4A8E A;  4F91 B;  2ZIU B;  4KX5 A;  1DQU A;  2IS4 A;  2HOI A;  2LC2 A;  1MND A;  3HPH A;  2W7P A;  2DGZ A;  3F9K A;  3OOU A;  2XC7 A;  3TMO A;  1S9H A;  2ZSH B;  3K4B A;  3BCB A;  1BR4 A;  4LIU A;  4BDZ A;  2HPI A;  3AQF A;  1Q3V A;  3GU3 A;  1P7D A;  2LH9 A;  4F92 B;  4DGW B;  2R7T A;  2VJ4 A;  4OWR B;  3DWL E;  1WJC A;  5LD2 C;  2PMZ A;  4BQO A;  4E7J A;  4KIT B;  2XF6 A;  2NV3 A;  4NLC A;  2MYS A;  4HPQ A;  2W00 A;  2W1O A;  1X19 A;  2XF5 A;  2KD1 A;  4KT6 A;  3CRX A;  3ZXS A;  2JA2 A;  1Z3Y A;  2IGK A;  1WJB A;  4QPQ A;  2V6E A;  1VZ0 A;  2XVT A;  3SDB A;  2VKD A;  2WAQ A;  1BR2 A;  4OJ6 A;  4XKC A;  2PJR B;  2XIC A;  3H5R A;  2ZIW A;  4FZN A;  2ZG6 A;  2BW3 A;  4HRI A;  1E0E A;  4CA0 A;  1D0Y A;  4O3M A;  2ZIX A;  4CCN A;  1MNE A;  1GO3 F;  3L2Q A;  2F6C A;  2WB1 C;  3GZF A;  1T94 A;  1D0X A;  2CV1 A;  2HBJ A;  3MKZ A;  2JH7 A;  3LYS A;  4NWI A;  1UAA A;  3VYU B;  3D5S C;  4OO1 J;  2HZD A;  1OR7 C;  2V7F A;  2R7V A;  2IXS A;  4RLF A;  2N1R A;  2H3F A;  5KL1 B;  3ALR A;  3ZR8 X;  3CZ6 A;  5HR6 A;  2HMX A;  3N7S C;  2GOX B;  4BE2 A;  2DJI A;  2E1M B;  3FBI B;  3MMY B;  1Y56 A;  2HDW A;  4DOZ A;  2KHQ A;  1W36 C;  1X1D A;  2IGN A;  1UG0 A;  4CCK A;  2KJ8 A;  2F4I A;  2X6Y A;  1FMW A;  1PYV A;  3KX2 A;  4ZC3 A;  2KMU A;  3SEZ A;  3CJQ B;  4PSX A;  3VYR B;  1PVR A;  2KJ9 A;  3E0F A;  2MD0 A;  4E7K A;  2Q2E B;  4BQQ A;  4DJA A;  4J01 A;  4KX3 A;  2R7U A;  4NV0 A;  2F8L A;  5KHD A;  2WB1 F;  1D0Z A;  2OH2 A;  1Z1B A;  4NNJ A;  3ICX A;  1L6N A;  3I3L A;  3I9V 2;  2R18 A;  2E5Z A;  4PSW A;  4XMY A;  4P0Q A;  2HVQ A;  1PVQ A;  2CW7 A;  2RNG A;  1SFK A;  2RRE A;  3PFY A;  1QU3 A;  4B3X A;  3K6G A;  4P1W A;  4BJT A;  1KON A;  3N05 A;  3S32 A;  5KL8 B;  2X85 A;  3VSL A;  4FZL A;  3MGV A;  2R7X A;  3H0R B;  4XOP A;  2K3P A;  2JSP A;  4U6P A;  2KRC A;  2F5V A;  2X1C A;  3L2U A;  2KLO A;  2LYB A;  4OJL A;  2WY7 Q;  2H3I A;  3KFU F;  1IIP A;  2HOQ A;  3DKY A;  2E5S A;  2LYA A;  1UPH A;  3IG5 A;  1F44 A;  4XQF A;  2KIW A;  3A1Y A;  2XAU A;  2CRX A;  3OYC A;  4BAC A;  4JOM A;  4QNL A;  3GBG A;  2K5C A;  3SMV A;  2KEY A;  4BJ6 C;  4ZJZ A;  2RHF A;  1D1A A;  4XR6 A;  4BJQ A;  3PJR A;  1T95 A;  5HNH A;  2JH1 A;  2ZIW B;  1URJ A;  4CSW A;  3OYJ A;  2CW8 A;  1X4O A;  2OUM A;  4NQW B;  3OYF A;  2XID A;  3F5A A;  2KRH A;  1JI8 A;  2CMP A;  3BLY A;  3DTI A;  4PJN A;  2HNH A;  2X6X A;  2L9S A;  2K4I A;  3K70 D;  1LDK B;  3CYM A;  1XO0 A;  4ICA A;  4ZTF A;  1N78 A;  3CP2 A;  4LIT A;  3D2S A;  2LYC A;  1MMD A;  2LBF A;  2WA0 A;  2L9N A;  3OIP A;  4H4K C;  3FHN A;  3LL7 A;  4XOR A;  2CS3 A;  2UV1 A;  4NLB A;  3OYA A;  1G8X A;  2I8D A;  2K8A A;  2ZXI A;  4MLO A;  4BXF A;  1N77 A;  3J7A Y;  2W03 A;  2KNJ A;  2K8C B;  2LBO A;  3AFH A;  3E0J B;  3CP8 A;  4XL9 A;  4IC9 A;  4E7Z A;  4BUG A;  4XOT A;  3F2C A;  2A6T A;  4PL1 A;  2WAF A;  1OUQ A;  2G06 A;  3LSI A;  2KVC A;  4CDG A;  1HEK A;  2L2O A;  2XF7 A;  4IQJ A;  4C9Y A;  4ZTJ A;  4D1Q A;  4IQ4 A;  4BEH B;  2Y0S C;  1LVK A;  1WJA A;  1YX3 A;  3M6Z A;  3VC8 A;  5T14 A;  3D5L A;  4P0Q B;  2VKH A;  4XKB A;  1QHH D;  2KZV A;  4HNT A;  2F76 X;  2WAD A;  3HC7 A;  4BS9 A;  2CUZ A;  1G59 A;  4J00 A;  2IGM A;  4PK4 A;  1HIW A;  4QPO A;  3OYI A;  3OR2 C;  3HKZ C;  3OYL A;  3DU5 A;  2VQL A;  4XM3 A;  1P9Q C;  3TL4 X;  3NWT A;  2DXI A;  3OS2 A;  3M7D A;  1D8B A;  3LMM A;  2AQF A;  2X51 A;  4C2T A;  4CGZ A;  3VYT B;  2LHT A;  2IGO A;  1V5G A;  3N7R C;  3QOD A;  1TT0 A;  4R79 A;  4P0P B;  2ZXH A;  2X6W A;  4OJP A;  2G0A A;  2Y0S F;  4HSR A;  3C2G A;  1SAU A;  4DIQ A;  2K8B B;  3IAS 2;  2JVG A;  2QKM B;  3M8J A;  2R7Q A;  3F2B A;  3OL3 A;  2W7N A;  2G5H B;  4Y3O A;  3OYB A;  3HKZ F;  4C0Z A;  3L2V A;  4XKV A;  2MRL A;  4NUB A;  3K4L A;  2A3V A;  5LFA A;  4AU7 A;  1FMV A;  3DEE A;  4PFO A;  3SZG A;  3OY9 A;  4LIV A;  2DF4 B;  3LVW A;  3E1S A;  4QJF B;  2W04 A;  3VCB A;  2E1M C;  3QYF A;  1MW7 A;  3D5R C;  4B47 A;  4CCJ A;  4C2U A;  4XN0 A;  2LBF B;  2Q4T A;  2GH1 A;  1ECW A;  2DQN B;  3LFU A;  1R6R A;  1WJ5 A;  2V4J C;  2XDV A;  3O0F A;  3PSP A;  2HBM A;  3ZQQ A;  4OJO A;  3OYE A;  4HST A;  3OYH A;  4PL2 A;  4ZDL A;  3D2Q A;  4RMN A;  3W2A A;  3MKY B;  2KQR A;  1WUD A;  4ACO A;  2QKL B;  3HOT A;  3ZRG A;  3K70 C;  1V5E A;  3LSM A;  3KYL A;  4FZM A;  1Q3U A;  4F52 A;  1A0P A;  3SAF A;  2R7W A;  2M3A A;  4ZDP A;  2G5I B;  2YB4 A;  2IS6 A;  2G07 A;  1WJE A;  4N4O B;  1MMA A;  1MMG A;  3IN5 A;  2H3V A;  3DTE A;  3W2W A;  2X1E A;  3RPU D;  4BDY A;  5FRM A;  2HPM A;  2FUG 2;  3IG8 A;  3K10 A;  2ZIV A;  4E7H A;  3A2K A;  3OYM A;  2LG4 A;  3AL0 B;  2PMZ C;  3H9J A;  2VQH A;  3EUK L;  2MA1 A;  4N4N B;  3AKZ A;  4BU2 A;  3NUQ A;  2CUJ A;  1NG7 A;  2HOF A;  4OAZ A;  2Z2S B;  1PVP A;  4PJJ A;  2CPR A;  2VPL A;  1LKX A;  5A0L A;  4E6K G;  1N75 A;  2DT6 A;  1Z7L A;  2HQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...