3IP4B

The high resolution structure of gatcab
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
482
structure length
482
Chain Sequence
MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Two distinct regions in Staphylococcus aureus GatCAB guarantee accurate tRNA recognition
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 168
structure length 482
sequence length 482
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.410 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ip4B03
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3ip4B02
3KFUF 3H0RB 3IP4B 3H0LB 2DF4B 2G5HB 1NG6A 2F2AB 2D6FC 4WJ3B 2DQNB 3H0MB 1ZQ1C 3AL0B 2G5IB
chains in the Genus database with same CATH superfamily
1Z6TA 2DQRA 1TC3C 3RB4A 5DB7A 4NQWB 5F04A 1YW9A 3MKLA 4IEJA 5BMZA 1DRGA 3KCCA 1IN6A 2DU9A 3IAS2 3KP3A 4BEHA 1WKMA 5ALJA 3PX0A 1KQ8A 2H3ZA 2NVYJ 4L9JA 3ISCA 4IHVA 2EAOA 1ZQZA 5JU5A 2W1OA 3QWLA 1ZQBA 4ICAA 5DUIA 4CA0A 1ZQKA 4KLOA 1I50J 2K9LA 1R5GA 1A36A 8ICIA 3COAC 2Z9OA 2IS1A 2R7VA 2EZHA 5ALNA 3LSMA 3ZXSA 2L2OA 5IYBJ 2JXJA 2IA1A 4DBQA 2DFIA 1XMXA 3A02A 3HJEA 2YMLA 1D1AA 2EZXA 3VPRA 4LG0A 1UB9A 2ELKA 3HUGB 4F7ZA 1X9XA 5J40A 4BE1A 2HU9A 2IA0A 2ZXHA 2LSOA 2LPEA 5F6FA 2DMPA 2K02A 3GLLA 4MHGA 2JH1A 1ZQFA 4QPOA 5F27A 4D7NA 1LKYA 2H09A 2K3FA 3DBHB 1XCVA 2WY7Q 4XKBA 5HHHA 2EJRA 4B3AA 3HTUA 4C4RA 4BS9A 4DOAA 1U2WA 1X1DA 1R1VA 4UVCA 4A3JJ 2VJJA 4DFJA 2CQ7A 2W9CA 4HLYA 2K8CB 4Y13A 2M2EA 3ED5A 2BOLA 3K4GA 5HNFA 4G6DA 1WFXA 3E0JB 1U78A 3LSGA 5EG0B 3BTIA 2I5HA 1VQ8I 3F8NA 1HKQA 4UB8U 1I3AA 1G6NA 5G5GA 5B1BH 3ZPLA 2X85A 3J7AY 1OYWA 4A6EA 3H9QA 2YR2A 3QOEA 4Y4RA 1X58A 2R93J 2KSOB 3ABKH 2QLZA 4QZFA 3UKGA 3GV7B 3NVZA 4BDZA 1X42A 5AI9A 4TUPA 2B7EA 4DZPA 2MYSA 4QZDA 2BCSA 3K4LA 3GFKB 3DPLC 5ALXA 1SV0A 5AK4A 4MFAA 1K83J 2P5VA 3KEOA 4M3GA 2LR8A 3N97A 4PH5A 1FLIA 2STTA 8ICEA 4NDLA 4KLUA 2K9SA 4A0ZA 3TOBA 1D5VA 3S6JA 4Q43A 3M9OB 3WG7H 3J81j 3PW0A 2BPFA 3KE2A 1TT0A 2LP0A 1WWXA 1ZYRF 5BPCA 4JYKA 4LJXA 5KAIC 3QEBZ 2ZUDA 4DQPA 2D1HA 3KP7A 4Y3OA 1HF0A 1LE8A 7ICGA 1ODDA 4PCQA 1M6YA 3HOSA 1D8LA 3PIOF 2LKSA 5IT9K 1L7PA 2V79A 2GQQA 5D5VB 5M3FJ 3OYCA 4NBQA 3PY8A 4U0YA 2E2HJ 5GPCA 3WTXC 3CTAA 3KYDB 2MUTB 3REOA 2AHQA 3WKBA 4P0PB 1JUPA 4XRMA 2DPJA 3WK7A 1SMYF 3ZMZA 4BGDA 3KKAA 1WUDA 2GH1A 3FWEA 1XS9A 4Y2XA 5M5YJ 4A5MA 3LSPA 4IHSA 3MR3A 1L3SA 3A03A 1R5HA 3SDGA 4ESFA 2DPUA 2EV5A 4HF0A 4NUBA 4BE2A 5KFJA 4M2YA 3W2VA 4D0PA 1AHDP 4II2A 1ZK8A 2EINH 2XY7A 1U5TA 1ZARA 1DDNA 3RH5A 3Q0VA 2M0CA 5TZVA 2BE5F 2HDOA 4QTRA 3KFWX 3E7LA 1Q8KA 3AL0B 3C23A 4XN0A 1PZNA 4DO9A 4UV9A 1ETYA 4FQGA 4HNVA 4F4XA 8ICPA 3JRHA 2PJRA 4I29A 2XRNA 3AQEA 4RUCA 4ZYDA 2KDZA 2LY2A 2HHSA 4M9GA 1RKTA 3HC7A 4DFPA 3OHBA 5DGAA 1ZRCA 5AI5A 3RR7A 2DT5A 3WTUC 2RQ5A 2YU3A 4I09A 2R18A 3QQAA 1R7JA 5E20A 3BJAA 1E0EA 3GZFA 4KX5A 1ACIA 2YQEA 2HXOA 4RB2C 1NK0A 3F5EA 1BR1A 3QRFF 2RDIA 1R1UA 5K7HA 4LGWA 3OYDA 4NM1A 4OO1J 2JR5A 1CUKA 1UMQA 2ZJQF 3CCQI 3GIKA 1QQ6A 3L2CA 3SEQA 9ICCA 1X9SA 5KFUA 5JLWA 4ZTJA 3V8KA 3ZQIA 2PI5A 1RDFA 4E7JA 2V6CA 4RQ1A 2RN7A 1G59A 3G73A 4R8HA 4EEKA 2ZJ2A 2K4JA 5J8CA 4I27A 2OTLI 2XCAA 1ON2A 5LEKA 4NY8A 3WTVC 1SKWA 4AIJA 4HQEA 1H0MA 3SI8A 2QSHX 4TQSA 9ICSA 2BEOA 4O6JA 2HFHA 7ICRA 1HKSA 2NVQJ 8ICVA 2KRHA 5D4SA 4HW0A 1MC8A 1UAAA 4PSWA 4O0IA 4ESBA 2ZIUA 5KG6A 4TQRA 5LEJA 1G3WA 2MD5A 3IH3A 3FKJA 3FKIJ 1PUEE 3E97A 3ZQGA 5ICEA 4X6AJ 9ANTA 1LEBA 4Y17A 1YT3A 3LSTA 3DPUA 4RMNA 1SANA 3DBRB 4J03A 5J0PA 3JPOA 7ICEA 4PGYA 2HHUA 3ZQLA 2CFXA 4KLMA 8ICAA 3SQIA 1TNSA 3DTIA 2DO7A 4UB8C 3J81K 1SL2A 3I54A 1CRXA 5K7FA 1K6YA 4US9A 5KFVA 1MKMA 1BI0A 1QCKA 1BPEA 2GXBA 3MDAA 1H9TA 3GFJA 5KFDA 5LFAA 5IT9Z 2IEKA 3VC8A 1FBUA 3C1YA 2XF5A 4Y2UA 2R8KA 3AL0C 5ALOA 3NEUA 3SD7A 5KFXA 1OYIA 4HX8A 1B72B 4HF1A 2LOOA 2HOAA 1QU3A 2KEYA 3HGGA 1ZQYA 2H94A 3JPNA 3IN5A 3IG8A 2L0KA 3VYRB 4KN4X 3EPZA 3F2DA 1P4XA 1DGRM 1SKSA 1IXRC 1REPC 2ZTCA 1XC9A 1XPXA 2KIMA 4GXJA 1GXQA 1N61A 4OJLA 4UBCA 4ED7A 2G9WA 4XUSA 1DU0A 2W24A 3IC7A 3RYPA 4CDGA 4HNUA 1F4KA 3BCBA 2BPCA 5ALTA 3PNTA 2M0MA 3GZ5A 5DTDA 2GOXB 1EJ9A 1KFTA 5LLQA 2NYVA 4NJ8A 2DA4A 3D0SA 1BR4A 4UATA 5F0HA 3RB3A 4F5RA 3KP2A 3EDPA 1LQ1A 2CYYA 1KBUA 2IP2A 2VE9A 2VIXA 2E60A 4IOCF 5AIAA 2FLPA 5GTHU 2EH3A 5HHIA 2OF7A 2LBFA 1B8IA 1WWVA 2H8RA 2G0EA 8ICYA 1ETXA 5AM1A 4NWIA 2AQEA 2L5QA 4G3IA 1ETVA 1L7MA 2ZIXB 5C0YA 3MCZA 5K1YA 3OYGA 2EA2A 2X9DA 5AKIA 3F6OA 3THVA 2FOWA 1BM9A 2TDXA 3PQJA 4Z6CA 5KFFA 4EATA 2K60A 8ICHA 2DA3A 5AICA 2MSNA 3CZ6A 3MZYA 4I7HA 5DB6A 2XY5A 3V42A 4MO7A 2MH9A 1YJNI 2K4EA 3H7IA 3NRWA 4J9OA 1GUUA 2HSZA 2V4JC 1LVAA 2XAQA 3DTKA 4XK4A 4M6WA 1YJWI 4RB3C 2Z3YA 3CF2A 2QKQA 2P6SA 3SV4A 3FHZA 2VPRA 1UHWA 2L4AA 1XS9D 2OXOA 1QHGA 1BR2A 4C3JJ 4EM0B 1MJBA 3CO7C 4EVIA 1APLC 3M6KA 1QRYA 3IG5A 1U8BA 1EF4A 4PHEA 4UBBA 3K7AJ 3BG7A 4RA2A 1U8RA 1G8XA 3ROUA 3TW6A 4G9BA 2R0QC 1U9OA 2P4WA 1RNLA 3CP8A 2FUG2 3U21A 2AS5F 2F8KA 2CPRA 3ZMDA 3ALRA 4I2DA 3IH2A 4LIUA 1A04A 5J3LA 3FBIB 2FSWA 3ERED 4V2GA 4EGZA 5GAEJ 1J9IA 4ECRA 2XROA 3FDSA 4C8OA 4B9VA 1IDZA 3IM1A 5DB9A 2UUZA 4FS1A 1RIOH 2VONA 1XCBA 1HW2A 5J0UA 4YXJA 1TAQA 1OW5A 2A1JB 2P6TA 4XM3A 4BY1J 2LF7A 3CJQB 2K8AA 1D0ZA 2X6XA 2BGCA 4RNMA 4ASNA 2K7LA 4PL2A 4PGQA 2DPIA 1U47A 1X1AA 1U49A 2BVLA 3I59B 4RQ2A 4I2HA 4DBRA 1XD7A 4ECWA 3AU2A 3J81Z 5J2KA 5L1JA 3G4SI 1UT5A 2E8NA 4J9QA 2BY2A 4AP9A 1MQ3A 3UNGC 4GC6A 3CESA 5LD2C 1RXVA 2WAQC 3HKZA 3C2BA 4GXOA 2DDAA 1ZQNA 3ERMA 3BR2A 5JVTA 3KEYA 4DS5A 3VDXA 4P4PA 4RNOA 3M8RA 1NKEA 4KLGA 4ENMA 2Y30A 1IRXA 2R7DA 1SVLA 1HDPA 1S29A 4Q47A 3N4MA 3OWTA 2DXIA 1A5JA 1TL8A 5ALLA 4X5VA 5C44J 4BAYA 3HWTA 1XO0A 3IKTA 4LITA 5D8LB 4ECUA 4PJJA 3U26A 4KLIA 4RT3A 1W0UA 2XASA 4UB5A 4BXOA 4Q44A 1JUSA 8ICJA 1NZBA 4ENKA 3E6BA 4RQ8A 4F93B 2OH2A 3CF5F 1VNDA 1FBSA 4RB1A 3H8SA 2OAZA 2X48A 3CCJI 4DJAA 1YS7A 1NZPA 1OUQA 2ELHA 3E6MA 4I02A 2NVUB 2RRDA 1IG7A 5DBBA 3Q8PB 3N7PD 1WRJA 1YRNA 1RQNA 1SGGA 4F4ZA 3AEVA 5GP9A 1X1PA 5KHDA 1D8YA 5L3EA 4C7YA 1J2XA 3ECOA 7ICUA 2FLNA 2DMTA 2CH0A 4YRVA 4DQRA 3VEPA 3EUB2 4QWDA 4CE6A 2W25A 4XKWA 2HW3A 1SAUA 3T1BA 1JKRC 1N63A 3H0GJ 3AQFA 3H0DA 5AKHA 2M3AA 4UUSA 4YFKF 1TAUA 2KIFA 4EMSA 3MQ0A 1IRGA 1S0MA 1WCMJ 4GYIA 1USTA 1JUMA 3OY9A 4DL7A 5GTHC 4R8UA 3KEQA 2FI1A 3HSRA 1XDSA 4IC9A 1BW6A 3JPRA 1OR7C 4A3DJ 4NC6A 2KTQA 5HS9A 3S2WA 4O5VA 2IOFK 2BCQA 4I6ZA 1WJEA 1TKDA 3F8FA 4R63A 1MH3A 4DYCA 2LNBA 2QQAA 5E17F 3V8LA 5DCMA 3PO3J 2F44A 5AM3A 4DOCA 2QARA 4F4KA 9ICMA 3QYFA 2MD0A 4EJUA 2PFNA 1QBJA 5KFYA 4UB2A 1ZQHA 3GXOA 3JTHA 4BNCA 3SZGA 3MKZA 3IRRA 4B9MA 3PNVA 8ICGA 4Q4ZF 2JA6J 4ECTA 7ICIA 3JW4A 1X4PA 3V4GA 2J5PA 2KJ9A 4KJZA 2FF4A 3SENA 4FETA 3K4NA 5IINA 4F72A 1P2FA 4ED2A 1IIPA 3ETLA 3LVVA 1XGNA 2K9NA 4F5OA 3LA7A 4RDUA 2I1QA 1DPRA 1ZKGA 2W9MA 5KG4A 1FP1D 2Z5UA 2G5IB 1X6IA 1WJ5A 1MD0A 4TUQA 3PFIA 3MC1A 1LDKB 2BY1A 2I9GA 1Z6RA 2CRXA 7ICFA 2GIZA 2K5CA 2F3NA 2E2IJ 5GTIU 5KG3A 2O0YA 2R92J 2TCTA 5D6EA 3CLOA 4BHCA 2ZB9A 3I5UA 3OOUA 1TFRA 1UG2A 5JHFA 1MDMB 2QB0B 4A6DA 1B4AA 1DXSA 5IIKA 4KT6A 3J7ZI 2HOTA 5C4XJ 1X66A 4JMUA 5CVJA 1Y8RB 1MSEC 7ICNA 2JN6A 1WQ2A 3JTGA 4LMYA 4E6KG 2BZTA 1ZGJA 4A0YA 2ZSIB 2WHEA 5E3MA 3K9TA 3IV5A 4LB5A 1V3FA 4ZYAA 2GXAA 2HVRA 3TANA 1NOMA 1MSWD 3LVWA 4UAYA 3SZTA 2NS7A 4RGSA 2HOSA 3H0LB 2DW4A 4WXDA 2F2AB 5KFTA 2QSFX 1LB2B 5CYVA 2ZJAA 2YB1A 1N60A 2ZXIA 3BR3A 4XRSG 2JMWA 3HHHA 2HVQA 3ABLH 5IIOA 5ALDA 1IRZA 2A19A 5EWEA 3MFKA 2CWEA 4ZYGA 1QVUA 1L5UA 2ZFWA 2CW0F 2IGNA 1ORKA 4BHPA 2MA1A 3JSPA 5A2QZ 2OWOA 1HC8A 4IQVA 4F4YA 4JV0A 3B02A 2L7KA 4XQFA 2WWYA 1NHAA 3ABTA 2HR3A 2ZXJA 3OS2A 1S6LA 4ON0A 3TQNA 2DOEA 2GLOA 1S7AA 5HLGA 3EPGA 2PMHA 2XHKA 1XTAA 1R71A 4R64A 2M34A 3SMVA 2V26A 2AXTU 1RZTA 2F1IA 5BOLA 2KMDA 3OJUA 3M1EA 1VQMI 1PP8F 4CCJA 1L3VA 2EZKA 3FX3A 2R5YA 2V1XA 3DLLF 1IF1A 3HOVJ 2DJNA 4YN4A 4Q45A 3H92A 3FM9A 5KCMA 2FOKA 2HVIA 5DDGA 2W43A 1ZQLA 3ESWB 4B48A 4IO9F 2JZBA 4XLFA 2HPIA 5BS6A 1IO2A 3KHRA 1ZLKA 4UVBA 2FE3A 3A4CA 5H6RA 3X2QH 4UUTA 4K4HA 4FO6A 3DEUA 3HKZN 3P5JA 2OQRA 2VBZA 5EGOA 3ISBA 3NQOA 2F5DA 1LFUP 2XKOA 1K7AA 2IW5A 1CEZA 3G1MA 1WJCA 1GV5A 3F72A 3CMAI 1ULYA 2DFHA 3V7RA 3CO6C 1VQOI 2F6CA 3DTEA 1YIJI 1G3SA 1FYKA 2NO4A 3BQ7A 4C4TA 1IG6A 4B43A 3L9FA 5DLGA 3F9KA 1A6SA 2HHQA 3FMSA 5AIPA 1D8JA 1L3TA 2Y0SC 3K10A 4WF2A 3KTQA 4P2HA 2YMMA 2CJJA 1I6HJ 3OR1C 5FLVA 2F77X 4RLFA 4Y2PA 3TARA 3F8MA 5AKXA 2JA8J 4EJVA 4M72A 5L3GA 2HZDA 1K1QA 3BC8A 2VE8A 2KLOA 3MN2A 3OR2C 4X1EA 4ENJA 3ZQQA 1VQ7I 4OMYA 3WGHA 3S1NJ 2NV3A 4EBCA 3TO9A 2ZCWA 5H20A 5FROA 3B6CA 1HJPA 2VUMJ 1YYVA 2DCEA 2H6BA 3L2QA 3HILA 2G06A 3S1QJ 4XRSA 1GLNA 2HBMA 4FFDA 5E1ZB 3OL3A 3BJYA 4IRDA 3LA2A 1QSLA 2HGCA 1MMGA 4IQ4A 2DPDA 2EILH 3H5NA 4XLHA 2ZFUA 3FXOA 3BZKA 2W8KA 1BJZA 4FBUA 1Y56A 2FNPA 3WG9A 2Y9UA 1MJAA 1J2MA 3H0RB 3C28A 2F76X 3KLOA 3FM3A 1JMSA 2IA6A 1P4WA 3WKCA 5CB1A 5J0QA 5DDYA 4E7SA 2JZYA 2QM3A 3ZP5A 1PVQA 2KQRA 1CF7A 1R00A 4B9TA 4KLJA 1J75A 1M1EB 3DKXA 5GTIC 1ETOA 2Y0MA 3VYSB 5IOZA 2EFWA 1ZRDA 3C2HA 2ZTEA 1NKCA 1O3QA 3N7RC 3FIWA 1YITI 4QNLA 4OJPA 2OUMA 5C3EJ 3WU2U 5L3CA 2JUGA 5J0XA 3U2RA 1T95A 4IKFA 5JLXA 3DV9A 3NGDA 1Y1VJ 3H0MB 4MQVA 3OYKA 3CC4I 5ED4A 2YPRA 2CQNA 3J7AO 1DK3A 1SV4A 5J0WA 2I5UA 2UVRA 2KISA 5HR7A 4C2MJ 1JXLA 3OIQA 1FSHA 3F0CA 3TP3A 3DWLE 1XG1A 4DYQA 1T08B 2YB4A 5AKEA 3AG2H 2W9CB 1XNSA 1TP4A 4EEYA 2RHFA 3CMYA 2X4HA 2D2WA 1HA8A 4O3MA 2EQRA 5KT4A 4BWMA 4L9NA 4OIPF 3HGYA 3K1RB 1L7NA 3I55I 5CJ7A 4CCLA 2PXIA 2Q2EB 2WTEA 1FOKA 4UVAA 4OAZA 5KTQA 1R1TA 3OYHA 4J9MA 1BA5A 2F5VA 1ZLJA 1DPUA 2FXAA 2CV2A 1N5WA 5IILA 3R61A 2DI3A 4XLCA 1MGTA 4JP0A 3GTMJ 2GA1A 1FMWA 1E3HA 2VKHA 2KNJA 4ACOA 3I3LA 1D3YA 1TK8A 1UCRA 5JUMA 3V7KA 2QF7A 2O61A 2QCOA 3NVYA 4UARA 4F5QA 4PHAA 2KRCA 3O8GA 1XX5A 4J01A 2ZIWA 5CQGA 2XY6A 3V8JA 3G6VA 4DF8A 1KLNA 3RYRA 2AXTC 2GO7A 1KZHA 2FE9A 2HDDA 2EPFA 2OD5A 3IUOA 3RJPA 2XO7A 2DLLA 4ELTA 1SMTA 5LBQA 2OZUA 5HDKA 3E3VA 2MGQA 2FU4A 3HOUJ 3GF2A 4CCMA 2XV4S 2P7VB 1D8KA 3OIOA 1R4MB 2KZ3A 3JAMK 5DQGA 1KW4A 3ETRA 1TWHJ 2OEHA 4I28A 1X3WB 4EX6A 5HODA 1Q1HA 4PK4A 3TQ1A 2OQGA 1Z0XA 4L9VA 2GM4A 4OIQF 2E7XA 1ZRNA 4XKCA 3BQ2A 1T8EA 1DGJA 2JWTA 1PDNC 3D5SC 2EQYA 1ZGWA 2ASLA 2VL8A 5FJ8J 1U4BA 1ZGAA 3TBIA 1MZBA 2O6KA 4GIBA 3BROA 3QP5A 2CFOA 4IXAA 2E1OA 1R49A 5FKOA 4CGZA 2BQ3A 2P81A 1JROA 1HDDC 4ZDPA 4QZHA 4IHYA 3T5JA 1TT5B 4LLGF 5FFZA 4DW6A 4Y2RA 2LHTA 1S7EA 1NJZA 2HBKA 4FBTA 1U5TB 4KIGA 4RZRA 2BDUA 1UFMA 5IT3A 2Y1IA 3K1NA 2MSYA 2P5KA 1W36C 4ZYHA 4XRHA 4NLZA 1X1CA 3K69A 4QZ9A 4KTQA 3WU0A 1UA1A 1LDDA 1POGA 2DOAA 3IAM2 4H0EA 4RUAA 4KMUX 2PQ8A 1D1CA 1Q3VA 2KKVA 3RJIA 4A0XA 5HOOA 4K2EA 2FLLA 2W54A 1XO1A 4QZCA 2WV0A 4NNJA 1PVRA 2EZIA 2X6WA 3MEXA 3SFIA 1TQPA 1UJ8A 5EEAA 2ZG6A 2M5WA 1OFCX 5L1MA 3RBEA 2AGPA 1YOVB 4ECQA 1C0WA 2W00A 1Z19A 3ZOBA 4J19A 2F5EA 4CHUA 2OHFA 2R5ZB 1NKBA 3RJGA 1WYGA 9ICFA 4V2FA 2ASDA 1S9HA 3F22A 2YSRA 1JX4A 2CV1A 1L8OA 3UQ0A 2XSJC 4DSJA 4HV6A 2DA2A 1FSEA 3CC2I 4PPXA 4NXZA 2QQBA 1RYRA 4FT8A 5ALWA 4A12A 5IIIA 4S04A 4DF4A 2LKXA 3C2GA 2BR0A 3U1KA 1BPXA 5AIBA 3KZZA 5DM6F 3PSFA 1UZCA 1YG2A 2F5CA 2W8LA 2ALZA 4KLEA 3LYSA 2CMPA 1Z7LA 8ICMA 1RR7A 1MMSA 2CRGA 4ETSA 5CEHA 3WU2C 5E3NA 2HHWA 3DPTA 1QO0D 3MZ8A 4ZC3A 2DQLA 5JR3A 4ENNA 3RB6A 3QXGA 3QUQA 2MRLA 3R0JA 3DKYA 3FBNB 2BCUA 1NTCA 2AH5A 3WKAA 1HBXG 4O5KA 2Y0SF 4KLLA 2M1BA 3OYNA 1K78A 1ZAOA 2Y1JA 2YX8A 3DU6A 2G08A 1YTYA 3IP4B 3K2ZA 3F2CA 3QPSA 4BKXA 3ZDCA 4EZ6A 4Q48A 1BNPA 3OYAA 2X1DA 4A3LJ 1KGSA 1FIQA 1HQCA 5ALMA 1RXWA 5CA7A 5KT3A 7ICSA 2XAJA 2VOOA 2ZNYA 1JJ6C 2HOFA 2MU2A 1BPBA 4PUSA 5CR0A 1XB4A 3TGNA 2PX9A 4AWXB 4E4HA 2KJCA 3CLQA 4A3KJ 1SXDA 4CYCB 5ALEA 5GAGJ 1PK1B 5G5HA 1SWWA 1XC5A 2EBIA 4LLLA 4UAVA 3JAMZ 1KN5A 4ZYEA 2KRFA 1T98A 1QA6A 1K79A 4P4MA 1WCLA 2KVCA 2LREA 4XBFA 1F5SA 1P9QC 4CXFA 2KIUA 2B0CA 2FPKA 1MNMC 3E5XA 3PW7A 3RH6A 1OKRA 5ALVA 2GWRA 8ICQA 3RPUD 5ILSA 5AI4A 5KNIA 5KG7A 5TGTA 2P0WA 5AM5A 5CJ9A 4UHTA 3FXJA 1V5GA 3QNMA 3KFUF 3R60A 4OAYA 8ICFA 3TDZC 2MAXA 5D8KB 2NRWA 4C8MA 4HV5A 1JJ8C 5FLMJ 4QWCA 5L1IA 3ASNH 3GW2A 3ABUA 3OYJA 3K4MA 1BOAA 4OD0A 5D5UB 1W1WE 4BQOA 2VT2A 3JRAA 3QPLA 2KD1A 1VQLI 1JXSA 2ZC2A 2MABA 5J0RA 2VBWA 2WA0A 3I56I 4JUZA 2QBYA 3Q8SB 2FJ6A 4M9HA 2A5YB 3S1MJ 3QYPA 2NO5A 3RB0A 8ICRA 3OIPA 4BDYA 1RKWA 8ICSA 1TBXA 1NJXA 5J47A 2NXNB 9ICXA 1MMNA 3NRVA 5CLSA 3H9JA 2E5SA 2VLAA 2A3SA 4U0VA 4ZDLA 2HTJA 1VFCA 2W3SA 3H8MA 2P6RA 1PUFB 4Y15A 1KYZA 3SQNA 2WFAA 3K1MA 1JT6A 1R22A 5BQTA 3LSJA 5J2CA 1MJ9A 4CYDA 2BW3B 4WXHA 3Q5FA 5ALIA 1MA7A 4RQ7A 5K5RA 4KMOB 2FMPA 1ZREA 5EZGA 2E35A 3PSIA 2VXZA 1YW7A 1EXNA 4A3BJ 4UAUA 4RPXA 4IF4A 2Z33A 1PVEA 2NS8A 4AVZA 3R0AA 4Y33A 1FJLA 2F4IA 2ZIVA 2ZUBA 4JWNA 2XAHA 3JPPA 4P55A 3ISDA 5J2GA 2BHZA 1R23A 2VT3A 2K4BA 1XGOA 1O4XA 2GLEA 5EEGA 2YY6A 4NL9C 2XICA 1OPCA 1ENHA 2QVOA 2H1LA 2W48A 3DFGA 3M8JA 4LFUA 2RP5A 3PX4A 5KFBA 3DCFA 4S0HB 2MH2A 1SFXA 2G7HA 2ZXWH 2VQCA 4NQWA 1Z00A 3DEWA 2OCCH 2P7CB 3DEEA 5FD6A 2XKPA 3HIFA 4KFCA 2P6UA 4OJOA 3OSNA 3ZR8X 3S8PA 3KYCB 4IPAA 3TW7A 3AMZA 3HSEA 3NTUA 3RQIA 2A6EF 5DD8A 2IRFG 4ZJZA 2CN1A 2IT0A 1XU4A 5J8FA 2VODA 4AUXA 1KFSA 2IHNA 4F52A 3FXRA 3OS1A 1TZLA 3BQTA 3M7DA 4GCVA 3LSRA 2L02A 1FZPB 2ISZA 4E7IA 2HI0A 5HNKA 4I01A 2IOHA 9ICJA 2DAOA 3LK9A 3SV3A 4ELUA 4USAA 4BHBA 3HUGA 4AIDA 1L3LA 5KFLA 3G1OA 3E5UA 3WK4A 5J2IA 2CV0A 1KFDA 5DM7F 5DS9A 5KG0A 3IRUA 3BDPA 3N4MB 1VTNC 2QSGX 2VBYA 4EEFG 4YCXA 4M9JA 5J0TA 2RDPA 1P92A 3T79A 1NK4A 1BNOA 5AKGA 4QWQA 3WU1B 1F1ZA 2R7SA 3FHNA 4PZNA 4J9PA 2VJ5A 3RQ4A 4QIWC 5D6FA 1F43A 2AGOA 3I58A 3PL8A 1E17A 4Z6DA 1T0FC 5AKYA 2BCRA 3D5RC 4D9JA 2F8LA 4C2TA 4CCOA 5EG0A 4MIMA 5ICFA 1TNTA 1OXJA 3H8JA 1Z1BA 3FK6A 3E6CC 1STZA 5FGMA 1ZQCA 4TV7A 4F3OA 1DOQA 5K5QA 5FRMA 2AU0A 4OJ6A 3RJFA 4W97A 1XN7A 4D7MA 3S2HJ 3I71A 1RM6C 2KSOA 2N8GA 3F21A 5J2AA 5DG7A 1MMAA 2L9VA 3E0FA 3PO2J 2GZWA 1RYSA 2I8DA 4JQFA 1OCCH 2Y31A 5ALQA 2DBBA 2OM6A 3AFHA 2A6HF 4C3HJ 3M8EA 1J0RA 3I53A 1P7IA 5LGNA 2JEGA 2VANA 2JV3A 1QQ5A 3H5RA 1HW5A 4Q5SF 3FXKA 5JRTA 4KDPA 1PYVA 4PZJA 2EK5A 1VF9A 1W36D 3G6EI 4ED6A 1OJLA 2NYXA 4XL9A 1MIJA 3BZCA 3P7NA 1GDTA 2LM1A 3L00A 2XCPA 4KLFA 4P1WA 4RGXA 3BTLA 2W55A 3KZYA 4YFKA 2ISPA 3QODA 1NK2P 2WB1C 4YP3A 3DLAA 4MFCA 4WX9A 3S32A 2R7FA 3OMYA 4BQNA 1U6GA 1N5XA 2LYCA 1Z4OA 2VASA 2KV2A 2JHDA 3L4PA 5AM4A 3KYLA 2R7QA 3BR6A 3IWFA 1Z1VA 2MUTA 5EJCA 4P0PA 5F64A 2DMNA 4M9SA 1ECWA 3EYZA 1ZRFA 2BPGA 2I10A 2HQRA 5E79C 1OCOH 4M6XA 2NVTJ 3ZI4A 2VA2A 1MSFC 2D3DA 2F5FA 3A0BU 4DL5A 2E1CA 1A6IA 2E7WA 2QEXI 2C28A 1FIAA 3F3XA 2HXIA 3LQRA 1YX5A 2GXGA 2V1DA 5J2BA 1ZRMA 1Y39A 5AKKA 5GPAA 4BJ6C 1R9TJ 3TACB 1G3YA 4XRFA 3L7WA 1ZETA 2AXLA 3C18A 5E1XA 2G0AA 2VC0A 3FDYA 5TISC 1MH4A 1NH3A 4DL3A 2DQNB 2OJED 1BVSA 3A01B 2V4QA 4KUMA 2E36A 3PV8A 1QHHD 3GX4X 5KFMA 2FBHA 2FJ1A 4E70A 3FZVA 5KK1A 4EX7A 3GVAA 1F0MA 4ECYA 2M30A 4P0QB 4A3GJ 9ICHA 2ME6A 5DG8A 2LRDA 2ZJRF 4J9RA 5KT5A 4J9KA 4I2CA 4OINF 4KT5C 1O7LA 4C9YA 1AKHB 4JK1A 2LK2A 4CCNA 4LZDA 2W9AA 5E18F 5FLXK 2O9LA 1IJWC 5HDNA 2ELJA 4V19K 1FEZA 5F3XB 4B6JA 1VQPI 3ONQA 2DTRA 3K4JA 5FKMA 1IXRA 5CP2A 4GO1A 5ILUA 4O3NA 3O6BB 4ITVA 4HSRA 3A2KA 1QZEA 2XIDA 3PJRA 2VA3A 1RG6A 2KICA 5J4YA 1J97A 3HRTA 3S1RJ 2H8WA 2M8GX 2BXZA 3PZPA 2BY0A 3LWMA 3JRCA 5DYMA 3RF9A 4F2SA 2HQ5A 1K5OA 9ICRA 3UQ2A 3G2BA 1TVAA 3MD2A 4B44A 4CF5A 3Q0WA 1CGPA 4XLAA 5JFRA 1MNDA 2KG5A 2X1CA 2UWMA 4Y52J 4FZNA 5KFOA 2PFQA 3UMCA 1N48A 1COOA 4LIVA 4YXMA 3UXNA 4F71A 5AM2A 1ETKA 1ZQWA 1F36A 2IGMA 2XAGA 3AG4H 5AI8A 4PL1A 3RDIA 3UMGA 4M71A 4ABZA 2HBLA 3LSIA 3GYHX 4YFXF 3MZHA 2Z99A 1R4NB 2WB1A 2CSOA 2VN2A 3M9MB 5C5JA 4F50A 1UA0A 5LRRA 2PMZC 3UM9A 2YU9J 3M1CA 4WXCA 3QPHA 3M6ZA 3HG9A 4L5EA 2M4GA 3VCBA 1J09A 4I98B 3TL4X 3N28A 4XIDA 2HTSA 4N9IA 4A2UA 3QU9A 4DFKA 4IL6U 2HOIA 4RAGA 3GDXA 2RNJA 2OBPA 2B0LA 3RH4A 1BC8C 1ERDA 4O3PA 1ZQDA 5AI6A 2MLKA 2MA3A 3VODA 1UHMA 2FD5A 2ZO4A 3O8HA 1T8IA 3H40A 3OSPA 3BCAA 1VDVA 4Y2JA 2AJQA 2JMGA 2DA7A 1X6JA 4NC8A 2I6XA 1LPQA 3TAPA 1XSVA 5EEHA 4R65A 1DGSA 5E8GA 3S15J 3CCYA 2A07F 2EFNA 4LOCA 3H3VK 2FQ3A 4YIIA 2LYBA 5AK3A 4CO8A 3GV8B 5FKKA 3WHBA 1B72A 2BZFA 1R6RA 1IW7F 3DBLB 4B8XA 4RNNA 4HSTA 2IAIA 2KZMA 2EH9A 3K1PA 1XSNA 5EE9A 1EV7A 3VSLA 2GA2A 4B9LA 4ELVA 2IPQX 1OISA 4AM3A 1SWVA 3EPIA 2ZMEB 2DFFA 2IGOA 4DSEA 3MGVA 4G8XA 3BS5B 2Y9YA 1A77A 4BQAA 2HDCA 1YJ9I 3P9IA 1ZQEA 4HX7A 4HRIA 5KVRA 2OA4A 4DYRA 1KQ9A 4DGWB 2CU7A 2E1NA 1QZZA 3ELKA 3GTJJ 2BDPA 2R7WA 3FXMA 4PJNA 3WK5A 4U6PA 2WAQA 1XSPA 4Y7NJ 2WF8A 3KX2A 3CCVI 1QSSA 2WF7A 2IJLA 5LGUA 2K3PA 1G4DA 3JPSA 3ZCOA 3NWSA 2WTFA 3HPGA 3ZRGA 3A0BC 2E8MA 3WE2A 3FXQA 3L2WA 2K4HA 2FMSA 1AA7A 2DA5A 3CQZJ 2FDRA 4IS7A 9ICNA 3GMEA 1ZOLA 2CUEA 4X0GA 1IN4A 4N4NB 2KIQA 2NVXJ 2ZIXA 4RQ4A 4QIWF 3ZQCA 3AG3H 4BQQA 4OJ5A 4YMMA 3Q8RB 2LLKA 3C5FA 2JEFA 4Q8EA 2VPLA 1YE9A 3CUQB 4AYBC 3OYIA 4DQIA 1VI0A 2RREA 1SD7A 1FY7A 2KHQA 2QYOA 3PMLA 4I2AA 1U9NA 3ZMUA 3CC7I 1QTMA 4L0YB 5ERIA 4DSFA 1SL1A 2OC6A 4UV8A 5ALGA 9ICAA 3C7JA 2DJIA 5DV5A 4A93J 1D8BA 1HOMA 3QU5A 2F4OB 4B09A 1N25A 1TTYA 3SZ2A 3E2EA 5J8YC 1XGMA 4E7LA 4E7KA 4XICA 1G3TA 3WE3A 3T5HA 3GFLA 3K75D 3QZ8A 3C3WA 5F0FA 5EDNA 1IM4A 4CCKA 4BH9A 4ZZDA 2DF4B 2A05A 1UHSA 5ICCA 9ICOA 5E8IA 3LAPA 3C2LA 4LVSA 3OOPA 1HIWA 4JV1A 4QSHA 2L9RA 3KP5A 2A6TA 1U48A 1KU2A 4CZZA 3TKAA 1ZQMA 4NLCA 1H89C 5KG1A 1SFUA 1PUZA 4QWEA 1T7PA 3EYIA 2WB1F 2A1JA 2W82A 2V9WA 3NARA 2UXXA 2ZMEC 3SR6A 2GIVA 5J29A 4NLGA 2M9HA 4GRIA 4B47A 3VB2A 1Y88A 3I59A 3JRGA 1OR7A 4HZFA 3K0LA 3MFHA 2RDJA 1L6NA 2W9BB 3ZN0A 2FMQA 1OYYA 3GV5B 3K4KA 5CKTA 3IRQA 5JVGF 1MBKA 2LMDA 2ID3A 2QKLB 5LHHA 3CCUI 2KHMA 4M3EA 1SEUA 1YZ7A 3MVPA 4BYYA 9ICIA 9ICGA 3VWBA 3TADC 4XMYA 2E8OA 4QIWN 3KZXA 5FKLA 2KP6A 4MEXA 3HRUA 2BXYA 2XVCA 1LVHA 1QPMA 1JKQC 3AM9A 1LDJA 4IL6C 1J5YA 5L1KA 5IP6A 4QLCU 2RVCA 4GXKA 4EM1A 2O03A 4JOMA 1WSUA 1QSYA 4A69C 2VJ4A 1H9GA 3B73A 3CDLA 3DP7A 2HYFA 1UG0A 4PFPA 3G1LA 5IOYA 4IQJA 2XAFA 4YR3A 3MKYB 2LBOA 2ME0A 2QENA 1YX3A 1FYLA 3VOEA 4R79A 3W2AA 2FEZA 7ICKA 3OSGA 2EB7A 2K8BB 1NNLA 2GAUA 2KJ8A 2M0NA 3OL4A 4BE0A 1KKXA 1YS6A 4RAYA 2XSDC 4P4OA 3BJ6A 3H36A 3BG6A 3EQLF 1SD5A 1VZ0A 3RKQA 4P5OA 4YG2A 4R1HA 1Y0UA 4CZCA 1T2KA 4H4KC 1S72I 2RNGA 2V7FA 3OYEA 5AK6A 1SAXA 2NOGA 2CG4A 3C29A 1SD6A 2BY3A 1W7PB 5HR6A 2K27A 5F9NA 5CQEA 4A8EA 4QZ8A 1HUOA 2XPVA 1B0XA 2CQXA 3KZIU 1MBEA 1LVKA 3I4NJ 1BI3A 2QQ8A 4MFDA 1GO3F 2WB1N 1U9LA 4IX7A 3H3UA 2WAQF 3H4DA 1B59A 3GFIA 2EV0A 3WKEA 1R58A 4FZMA 4EYIB 2C2EA 3FC4A 4O3SA 1LJ9A 3A0HU 4UUVA 4RQNA 4M47A 2H27A 3AAFA 3B6AA 5K5OA 2D1VA 1BC7C 1U3EM 2EZYA 1QQIA 3VSKA 2R3SA 2HKXA 1WI9A 3M07A 1FTZA 1IN8A 1H88C 4Y2QA 4L5JA 7ICPA 3PX6A 3EZ5A 2BV6A 4N4OB 4XLEA 1Z91A 2XGEA 2JA5J 5AI0A 5A0LA 3PQKA 2XPUA 5DBAA 1ZR4A 1XSXA 1YW8A 2V9VA 4BEHB 4O3OA 3I64A 3ZN1A 2AQ4A 3LSKA 1JT0A 2P5LC 3P9CA 4Z6YA 2PI0A 2EFOA 3MBYA 4GYGA 1CQTA 3SAHA 4QW9A 1YI2I 1RYUA 2PBIA 2XC9A 2DBYA 1Z3EB 3F8BA 2X0LA 3QZ7A 4U0WA 1ZQUA 1IDYA 4O3RA 1UELB 3GO5A 4XLPF 5K4LA 5BPIA 2NRZA 2HYJA 4LG0B 5AK5A 2B9SA 3IH4A 2VBXA 2VKVA 4U7DA 4HYKA 5E1WA 4HAIA 3HOZJ 2K89A 5BPDA 1VQ4I 1KEJA 4EM2A 3IHQB 2IS4A 1XMAA 1IAWA 5J1RA 1S97A 2GBYA 2V9KA 1LKYB 4IOAF 4KN7A 4JX6A 5B1AH 3SJMA 3OTQA 2XB0X 3FM5A 3HYIA 4EBDA 3NS1A 3EUHC 1Y6IA 5DD4A 4KISA 2E1FA 3TFRA 1GVJA 2HPMA 4F5PA 4YR0A 3W2WA 2LG4A 2WAQN 1BW5A 4U88A 3QX7A 1TWGJ 4RBOA 3JRIA 2ID6A 1FT9A 2MBFA 2AQ0A 4MF8A 4TUSA 1BPDA 2E3TA 1IN5A 2CW7A 2VKQA 4C0ZA 1KQQA 3PNCA 2ODGA 2QB0A 3BQYA 1MDMA 5LRSA 3GIIA 3TFSA 2MLGA 1RESA 3L09A 3RPUA 4MFFA 1DQUA 5M3MJ 3GCMA 1XGSA 1J59A 5ALFA 5DGBA 6PAXA 4XQ8A 3TO6A 1PVPA 4FX0A 5J2FA 2Y0SA 3M8FA 1I1SA 4MEXF 4JX5A 1C7YA 2E1MB 5KL1B 1JALA 2W11A 1X3UA 2M87A 5LHIA 3GTLJ 1CI4A 3CCLI 1VQ5I 1HXDA 4FASD 1NI3A 4O3QA 4B9NA 1Y1WJ 2C2RA 2VKDA 3CCMI 4ECZA 2A69F 2E2JJ 1LB2A 2E8PA 2FPLA 1F5TA 4NLBA 3N97B 4E7ZA 4J00A 1FTTA 1JHFA 2ETHA 3AN1A 4F5NA 5L3DA 1FOXA 3BPVA 3SFZA 2RQQA 3HSFA 4U87A 4EYHB 4AYBF 2E1EA 5J4VA 5E3OA 1W0TA 5J2JA 3IL2A 1E3OC 8ICWA 1LE8B 4YVZA 4C4SA 4OWRB 3RZDJ 3I76A 3HHGA 4YG2F 1B43A 2OPTA 1T33A 2X51A 4HA8A 4J9NA 4DSIA 4PJLA 5HDGA 9ICLA 8ICTA 2DODA 3BZ6A 2Y69H 2EV6A 2KOBA 2NNNA 1J2NA 3T8RA 4EV0A 1XSLA 3WTZA 2YMPA 2DOFA 2Z7JA 2F4MB 2FRHA 5IYDJ 5ALZA 1S76D 3HBLA 3W6JB 3ZQHA 1IGNA 4HEA2 2M7AA 2KE7A 3PSPA 1USSA 5ICGA 3SYZA 2K40A 2V1NA 3EETA 4OU0A 3N05A 3OJSA 3RPQA 2DK8A 4AIHA 4DL2A 3KZIC 2PEXA 2LM4A 2CUFA 1SFEA 1X4OA 3GEZA 2HQNA 2M4KA 3EUHA 3JR9A 4GXIA 2EZLA 4F2RA 1S77D 4IQTA 4C30A 1SZHA 2Q1ZB 3E6DA 3NAUA 5C4JJ 1YFHA 2EDUA 3A0HC 3DKWA 4PFOA 2ADUA 4AU7A 3R9KA 4MHVA 5ALRA 3S2DJ 4B3XA 1X2MA 2LYHA 4YMOA 1Z3XA 1S0NA 5CVUA 2PJRB 1JI8A 3HB9A 4S05A 1TW3A 2LY9A 3DDHA 3WK8A 4YD1A 1IXSB 2FNAA 5JHUA 4BUGA 4F4WA 2LTPA 1Q1VA 4JX4A 1VQKI 3HP6A 1BGXT 2CQQA 3PW4A 4HDUA 2VQGA 4AIKA 3T3FA 1FO4A 2WF6A 3M3YJ 4D5CA 1ZQIA 2LFBA 2O8XA 4XNFA 4AYBN 4BACA 4HDVA 3PFYA 1IUYA 5AM0A 1TK5A 2HWVA 1SV0C 3BR1A 2C2DA 1I3QJ 1WH5A 2LF8A 1S8OA 3G6XA 3CMEI 4UB6U 2QWWA 3I0TA 2Z2SB 4GC7A 3BPXA 3M9AA 4FISA 5DEQA 1T38A 2IS2A 3L5KA 3HOXJ 1TW2A 1Z9CA 2KPMA 4I2JA 2JRMA 4XA5A 3JPTA 2K85A 3I9V2 1ZD3A 2H1KA 4Y2VA 5HLTA 3RJKA 5M5XJ 5J6XA 1GXPA 4DQ2A 4UAWA 1Z00B 2AGQA 4KLTA 2RV8A 5DUKA 4JWMA 3CDHA 1Z77A 4KIBA 4XORA 4D5FA 3QAHA 3ZGKA 2B63J 2R7OA 4KMFA 3ORYA 2Q0OA 1BJAA 5F0CA 4II3A 2WAFA 4HPQA 1QQ7A 1SB3C 2BGWA 1NK8A 4CF4A 2AO9A 2JPBA 3BT9A 4ED3A 4XSXF 5ALYA 3TP0A 4CSWA 1V55H 3LNQA 1FFUA 1SC7A 5ALUA 3WK6A 4MTEA 4U7CA 2LKYA 2PI4A 1FWZA 1KA8A 1T56A 2KIVA 2ZIUB 4MQ9F 1WZ2A 3KKAC 3H3ZA 3H4BA 2V9PA 2XF6A 1NJYA 8ICOA 2UVUA 3HM5A 2NRAC 3ZDEA 1RPWA 2E5ZA 1I6XA 3HRMA 1TWCJ 3DQVC 2W7OA 1TQIA 4M9ZA 4U7BA 4LJZF 3TEDA 2O6GE 3ZD9A 3JRBA 3KP6A 1D0YA 2KDOA 5ALSA 3RAQA 3HZJA 4EELA 4ED1A 1U5TC 2VA8A 4YELA 1JI7A 8ICNA 2DT6A 1ZD4A 4XOPA 1W4MA 1LUJB 3ZDDA 2WBMA 4FHTA 3MFIA 1SFOJ 1AQ6A 3T5XA 3FAHA 4IQWA 4A5NA 2RGVA 5KAFU 1RI7A 3K1ZA 3U1DA 3R4KA 4XR6A 4GDFA 1V54H 2CW8A 4Z2YA 4BUPA 1JRPA 3H1CA 3OYMA 3HRDD 3CYMA 2YUSA 1LEAA 3GTGJ 1JTYA 1A6QA 1PJRA 1FC3A 2Q2EA 2JA2A 4F91B 1FNNA 1U0JA 4F55A 4L9TA 4ED8A 4O9MA 3BS7A 2ZBKA 1T3NA 4D1QA 5KL8B 5KFKA 3C2KA 4QZGA 1X9MA 2KKOA 4RAZA 4FTHA 4M9NA 1MNEA 4G6QA 4G94A 1RRJA 4CF3A 3F2BA 3L1PA 1V9PA 3C2MA 3TOAA 3QUCA 5DDMA 1IXCA 3GILA 3RJJA 4G12A 1BBYA 4YD2A 2RAEA 4YQWA 1ZQ3P 3SEZA 2VQHA 3GTPJ 2JSPA 1DUXC 2ZJPF 2LI6A 2JJ7A 2PFBA 2JQ7A 3D1NI 2ECCA 4HOBA 3WTYC 2CGPA 4M6VA 3W6KB 3ZMTA 5J0YA 1B8IB 2LBFB 3SAGA 4DSKA 2COMA 2DYSH 4NB5A 3CDIA 2OYYA 2ESEA 1L3UA 2N1RA 2EAMA 3IKVA 3Q9VA 4G7ZF 1S9FA 2WV1A 2DKZA 5FP0A 9ICWA 3LSHA 2CUZA 2Y0SN 5D46A 1HW1A 3GUDA 2HEOA 2W3RA 5E79U 4B9UA 1FX7A 3RJHA 5KG5A 3NVVA 4ZH4A 4F3QA 2PKEA 3GZNB 3O3KA 2E34A 4BXUA 2W04A 2NRVA 4OMZA 2OU2A 3QUBA 4BXXJ 2PFPA 1HSTA 2HOEA 4QZEA 4UB1A 1VQ9I 5K7ZA 2FMLA 1N77A 4DWIA 9ICTA 4M0AA 2QKMB 4DOZA 3IV6A 1MMDA 5DCFA 3GTKJ 1MN8A 5CVIA 3U9GA 4M6WB 5TISU 5KFNA 3HX0A 3AU6A 4BU2A 2LKPA 2OZ6A 1A31A 2DFLA 2LMRA 1I27A 3N7SC 4CNQA 1ITYA 4YFNF 2ISYA 1K1SA 5EOZA 3V72A 5IP7J 4FE7A 3Q8MA 3QP6A 2R8HA 3HRSA 5DG9A 1WI3A 2H6CA 1T6SA 2YS9A 4RQMA 2EIKH 1JGSA 2MC4A 2H5XA 1NK7A 1IN7A 4UNOA 2Q0ZX 2O5RA 3TAQA 3PO5A 3CRXA 3ZD8A 2CXYA 3BR0A 1ZQGA 5FD5A 2MC3A 3PUBA 3VYTB 1O08A 4PJ0U 4M6YA 3GBGA 3FK7A 4QW8A 4DOBA 5D49A 4RLQA 2XGPA 4RPZA 5KFCA 1QNTA 2KK0A 5DQHA 4UB6C 3J80K 2YTUA 1TWFJ 3PSTA 5HMMA 1IV8A 5KFHA 5B66U 3M8SA 1NK5A 4B1RA 5BOXA 2D6FC 4GGGA 2A1AA 1U45A 1QLNA 2DL0A 2W03A 2A68F 4ANJA 2WC2A 5L3BA 3S3OA 3GWZA 2R7TA 1W7PD 1Q46A 5ALKA 1KDHA 4M9LA 9ICKA 2JT1A 1A0PA 2FQ4A 5DB8A 2R7UA 2R5ZA 3QOPA 2UVVA 1O3RA 4NLKA 3HOWJ 2YMQA 3IDWA 1HKTA 5CHGA 2HVHA 2J6TA 3NRZA 4QPQA 4US8A 3KPHA 5CRXA 2D45A 2P8TA 3ULQB 1JE8A 4LK1F 3UXOA 1K61A 1Z4NA 1MBJA 2XGXA 2K4PA 2PLYA 3PMNA 3QU7A 3Q0UA 5L1LA 3ASOH 4BBRJ 3CCRI 4AD9A 4BJTA 3PO4A 1AWCA 3MGIA 1T94A 1S0VA 3SXYA 2WF5A 2ISOA 3OSFA 1JIHA 8ICBA 1N75A 4BXOB 1S7OA 1S3JA 3BLYA 1DP7P 5F1JA 2DK5A 3HXLA 1VQ6I 4YMNA 2DYRH 3HEFA 3ZQ7A 4IZZA 2L7MP 4IHTA 4KN4A 4QWBA 3EYYA 2V6EA 1N2XA 1X40A 4OIOF 3M4OJ 3ONNA 1Z21A 1ZG3A 2XB5A 3OGUA 3S14J 4P9UA 3NASA 3LMMA 1ZR2A 4FE3A 5KAFC 1WCNA 9ICEA 1H8AC 1X2NA 2KIWA 5EWGA 1YZ6A 1UT8A 1KYWA 3HL2A 1V5EA 1YRNB 3RIRA 4DLEA 3KP4A 1SD4A 5KT2A 1B1BA 1BOBA 2HBJA 2JVHA 1K4TA 1ZN2A 3E5QA 1EH6A 3G71I 2KFDA 4ESJA 5KFIA 5CVVA 3RZOJ 3GU3A 4DZJA 1W5CC 4PZOA 2BQRA 4CYCA 3IHUA 1PK1A 2NRTA 4ED0A 1SKRA 1X3ZB 3LWLA 5FRNA 4CRXA 2NAZA 3MKWB 5D4RA 3SAFA 7ICOA 2Y75A 1LFBA 2JRZA 3LQQA 4DIQA 4NL9A 4NV0A 1WH7A 1LV5A 3HPHA 1DK2A 4UUSB 2UV1A 4QZAA 2X1EA 1KL9A 4ZZLA 2EFQA 5IP9J 3VFZA 2ZJ8A 1XSDA 3ICXA 3OPXA 4ZH4F 1J7KA 9ICQA 3EUAA 4R8UB 2L4MA 1ZYQA 5KFAA 3QE9Y 1Z3YA 2JEIA 3PNYA 2IA2A 3V6HA 2BHYA 3RKWA 2VB6A 3K6GA 4YEJA 3HPOA 3GTQJ 4YR2A 2ACJA 1FOYA 7ICMA 3E58A 1YIOA 3UR3C 3EWAA 2EANA 4K4IA 2F1HA 3GLXA 5FKNA 4XN3A 3T8TA 1S10A 1P7DA 5DCMB 1B9NA 3LAJA 3HKZC 3SZPA 2QARB 3RR8A 2KFZA 1L0OC 2HVSA 5DKWA 4KLSA 2R8GA 4FCYA 4ZDOA 1COKA 2A3VA 3ZDBA 3WODF 5KFGA 2JA7J 3J80Z 3PR5B 3J7YJ 5J1UA 7ICJA 4IRKA 1O57A 1X2IA 3K70C 1WVRA 2MG4A 3LFKA 3Q9SA 1OCPA 2CUJA 2XRLA 4RQ0A 5HP4A 2ZNZA 5AIQA 1GV2A 4I2GA 3H35A 2V1UA 2JSCA 2L5YA 4PJMA 1ONVA 5CVRA 1YO5C 1PUFA 1WJFA 1DU6A 1T0FA 3H5AA 4HYEA 1GVDA 3WGGA 2XC7A 2QB1A 1T39A 2DDBA 3MAJA 4TURA 3BQ1A 2DA6A 5D4BA 4PJ0C 3P9KA 3R6SA 1YQAA 5IY5H 1RQLA 1XMKA 2BW3A 5J2DA 1MBHA 4WWCA 3AUOA 4MEYA 3RKYA 5B3SH 3I1YA 1B22A 1EKEA 3DF8A 2ECBA 4P9FA 5B66C 3FXUA 4N0BA 2M9NA 4I0BA 2M8EA 4LG3A 4C8NA 2VC1A 5JTIA 4O5EA 2P66A 2XF7A 2DGZA 2P35A 3BDDA 2ZUCA 4PHDA 1ZELA 3KBBA 1X19A 8ICZA 7ICQA 1Z05A 1I1GA 1SFKA 4C7ZA 5HLIA 3PW5A 1F9NA 1BL0A 2G09A 2XI9A 3ZDAA 1WJBA 1ZQ1C 4C2UA 5HS8A 3G6YA 2CQKA 3HT3A 4NC7A 1DP3A 3T5LA 2CO5A 3B0YA 4GFBA 5TRDA 5DQIA 4O5CA 5EE3A 1QVTA 2FBKA 3F53A 5IPAA 4RQ6A 2VI6A 2LY1A 3QUTA 3Q8KA 1BPYA 1IRFA 4BDPA 2ZKZA 2O3FA 2DUYA 3BG3A 4JBAA 4XKVA 2KZGA 1S5LU 3O0FA 3K4BA 4JK1X 4J9SA 5ALHA 1D1BA 2IMWP 4I2BA 1JTXA 1UQVA 1I39A 1G2HA 4RT2A 3I4MJ 1WHUA 1KSPA 2NRXA 2V4RA 1KRPA 5HVQC 5GADJ 5LHGA 5KG2A 2EZZA 2RKHA 1ZTRA 3EUKL 1HLVA 1ZQSA 2L54A 1I5ZA 5TJJA 1FEXA 1ZG1A 2Y9TA 1RZ4A 1RETA 2DFEA 2W84A 3Q3SA 4M3DA 2ES6A 1Q3UA 5HLHA 4EBEA 4BJQA 1JHHA 3QU3A 5KFRA 4KITB 2C6YA 3WHCA 5AKLA 1Y8QB 5DBCA 3MGHA 3RJEA 3BTJA 1EH8A 2KKPA 1XDUA 2R5YB 4MF2A 2XGCA 2MW8A 2JTVA 3M7GA 2EIJH 4PGGA 2F1JA 4PHPA 4CICA 3DV8A 2FBIA 2L3DA 4XONA 2EA4A 4IR1A 3WTTC 3JREA 1X9WA 1KU3A 3G3ZA 7ICHA 1FYMA 2XIGA 4UY8I 2JZBB 4K4GA 1KQ0A 1WJDA 3RCOA 1ZH5A 4BBSJ 2NNYA 3LL7A 1OQYA 3F8CA 4C8KA 4MNUA 3I4PA 3OV8A 4IRGA 3LA3A 2FMYA 2JUCA 5EGOB 3WK9A 3WKDA 1N56A 2KMUA 1IUFA 1C20A 3W6VA 2F48A 4AVPA 5IIMA 4M73A 4DL4A 2JPCA 3T0YA 2W7NA 3MR5A 4DLGA 3NVWA 4KLDA 1OLTA 2G7UA 2LC2A 1ZG5A 1T4GA 5A2QK 5T14A 3C5GA 4CUGA 2L9NA 4HG2A 4UB3A 1JUDA 1UPHA 4A3IJ 4E0DA 1V4RA 4WJ3B 3CCSI 4DEZA 4A3CJ 9ICBA 4RPYA 4AC0A 1O3SA 5LGTA 4G7HF 1FFVA 3JPQA 5GAHJ 1K4SA 2R4GA 2VOPA 3LDAA 4DSLA 2EIMH 5F9LA 3EW9A 2YX4A 1ZQOA 2UVWA 3ML6A 4FS2A 8ICKA 4KICA 4KA4A 2VQLA 1H38A 4BX9C 1KTQA 2VXDA 1NK9A 1WWUA 3S3MA 3UPQA 3H9GA 2UZKA 2W7PA 1JXEA 1ZQAA 2O8KA 5FLXZ 1RR8C 2Q8KA 4UQGA 2A5WA 3CD6I 4OCZA 3A1YA 2BYVE 2DMQA 1EA3A 8ICCA 2ICWG 2W4SA 4BXFA 3L3FX 5KFWA 7ICLA 1ZJNA 1F44A 4RB0A 2HHXA 2W57A 3CJTB 8ICXA 4EENA 3SHFA 5DLFA 1BI2A 2PMZA 3V7SA 2R7XA 4Y2TA 5F08A 2B6GA 5H2FU 2IGKA 2KZZA 1HCRA 2F2EA 4LD5A 2DA1A 4MEYF 3MR2A 4C80A 4G9YA 3V6KA 1TQMA 2H3QA 4HQMA 4L18B 3JSOA 2D8CA 2IXSA 2Y2ZA 1N78A 1CF7B 3RAXA 3HDDA 1HEKA 5IIJA 5D5XB 4UXNA 5EF6A 2KHVA 4F92B 3LFUA 2WF9A 3KETA 3GQCA 4IJAA 1BN5A 2WAEA 4I99C 3DXJF 4KYWA 2BHNA 3SEIA 4IHXA 2LD5A 2QGUA 1P4AA 4B4CA 1PP7U 4FZLA 1EH7A 3A01A 2OCEA 4EQQA 2PN6A 4LZGA 2FX0A 4A3EJ 1S8NA 3K2AA 4HLXA 4RGUA 4ZTFA 2JH7A 3RRGA 8ICLA 2KP7A 1V85A 4DQSA 4P0QA 1VLBA 3OYLA 3ZMSA 3C1ZA 2DKXA 4JB3A 1BIAA 1AKHA 3MWMA 4G7OF 2R8IA 2VJIA 2STWA 1SXEA 3W3CA 2K4IA 4DQQA 2J6SA 2HHVA 4IRIA 3ECHA 3RFAA 3WTWC 3GIJA 7ICVA 2KL4A 5D5WB 1SIJA 1ZQPA 3HKZF 2XGDA 3E1SA 3I28A 4C3IJ 4IQUA 5J0OA 2HS5A 4YIFA 5J2HA 1QZYA 5FO5A 3GZ6A 4DFMA 3JCUC 3T5KA 1S5LC 4MFEA 1WG8A 2HKOA 3TO7A 4EJWA 3UXPA 4J9LA 7ICTA 1RPLA 2IOFA 2XVTA 1HSJA 3QYBA 1W5TA 3F23A 4I2IA 3PR4A 2R7RA 4MTDA 4EZ9A 2O7OA 4L0ZB 4KLHA 2RQPA 3GIMA 2X6OA 5AHXA 1AROP 1ETQA 2ZIWB 4P96A 4KX3A 2BQUA 2COBA 3KHLA 4ECSA 1ZJMA 9ICUA 3C1DA 3V6JA 4KNYA 1MBGA 5BNGA 3OYFA 2H3FA 4B9SA 1Z67A 3BP8A 2IVMA 4KIFA 1VJ5A 5EWFA 4GLXA 1YLFA 1X1BA 4UW9A 2RC4A 3CUQC 2L7ZA 3CJNA 3ISPA 4E7HA 1O7FA 2QQ9A 3CP2A 1URJA 2G5HB 4AYBA 4Y2YA 9ICVA 3KIOA 2YN4A 2BVMA 3QPTA 4IVNA 2ESHA 1VQNI 2BCVA 1ETWA 2M45A 4WK8F 1ZQJA 4UB4A 3OYBA 2LYAA 5BOMA 4GFJA 3OS0A 3QU4A 5CPRB 5EE0A 3FXLA 2BKEA 4BL0B 1FBQA 1YHQI 4ECXA 2H3VA 1ZQXA 1ZD2P 4IRHA 2FPMA 1AOYA 5HMLA 3BOQA 1Y0NA 4EGYA 2FA5A 2ESNA 2JRTA 4HF2A 2KVSA 3NWTA 1OMIA 3JRFA 2ZJ5A 1ZQVA 5J8YA 2KN7A 1MQ2A 2DTZA 3PIPF 3KHGA 3D6JA 1D9FA 3C21A 4XLNF 1SVMA 1HUZA 3FF5A 2AHOB 2HZTA 1E2XA 5L9XA 2LVSA 3K70D 1LNWA 2X6YA 3CJRB 2IBDA 3AG1H 4IHWA 4LLNA 1TV9A 3S17J 5KFSA 2QA4I 1RUNA 3QU2A 2BBYA 5M5WJ 4XSZF 5HS7A 5KNLA 4IR9A 2PG4A 2Z16A 5HNHA 1KU7A 3KHHA 2JGAA 2IBKA 4M9XA 2XGQA 4M04A 2ZMEA 1WJAA 5KFPA 4M3BA 2PMZF 3RBDA 3BS5A 5J0SA 3AKZA 2LDUA 2ZTDA 1S0OA 1E3PA 3H8WA 2KZVA 1O03A 1OCTC 1NK6A 1B4FA 2HCFA 5B5EU 5KFQA 4QZBA 1QGPA 1IV6A 4PDKA 3F5AA 1NG6A 3F6VA 1JKPC 2GOMA 1D5YA 3M1YA 3TADA 2M7BA 1IC8A 1R36A 4MLOA 3BWGA 4M74A 3HOTA 3PVXA 3HOYJ 5H2FC 3V7LA 4RAFA 2UXNA 2HQAA 3V7CA 3TKYA 5JI6A 2J5OA 3PM1A 2Y9ZA 1JN3A 2OTJI 2KJ5A 1ZD5A 2ZSHB 5ILVA 2Q4TA 4I2EA 4RQ5A 2H3IA 5J1YA 2IHMA 4HAMA 1QH9A 4Z6FA 4RS8A 1R5ID 1KU9A 4QZIA 2ATLA 1NJWA 1T3QA 3D2QA 4JV2A 2R7ZJ 3O2PE 5ALPA 2QZ8A 1UCVA 3CUQA 1JGGA 1ZHFA 2OV7A 3Q8QB 3B9JA 2JVGA 4NM2A 3ZMVA 1AU7A 2NOJB 3SYTA 2VKEA 3BR5A 4LK0F 1L8LA 1L7OA 3ABMH 2HHTA 3BQ0A 1SL0A 4BWJA 4BJ5C 3WTSC 1KONA 3TMOA 2PJPA 2RLTA 1Z7UA 2KJBA 4HBLA 4PGHA 1OCZH 4RM2A 2KT0A 4RM3A 5KT7A 4RGRA 4DNCA 2XAUA 1K78B 1RC9A 1TLHB 5EE1A 4QJFB 5KFZA 1GHCA 4DFDA 2XPWA 5EZHA 3S3NA 5KT6A 2AQFA 2GOLA 4R66A 1FMVA 4KLQA 1ON1A 1FIPA 4FE4A 1XWLA 3RI4A 1FP2A 1FPQA 2KFNA 2TRTA 5FFXA 5J2EA 1B9MA 1PK3A 4HNTA 3CNHA 4C8LA 3RRHA 4A3MJ 2PMZN 3MABA 3HW8A 5FB2A 2DN0A 4WCGA 2K86A 5AKJA 1TAMA 1B6AA 4BY7J 2W85A 3ZQFA 2XDVA 4KN7X 2HDWA 1K6OA 2L7FP 5AONA 4ZOHC 1TK0A 1LFPA 1WGXA 2IS6A 5CWRA 5IYCJ 1W5SA 1WPKA 3BG5A 1SZPA 1MW7A 3NUQA 2YX7A 2E5NA 2Z1DA 3LOCA 4G6TB 4I0AA 4ECVA 2ASJA 2PFOA 1NK3P 4UASA 1D9DA 4I2OA 3M9NB 2W9BA 2D5VA 1QPIA 3B0XA 9ICPA 2NS0A 2A61A 4UAZA 3QEAZ 3MMYB 1FOWA 8ICUA 1IZ1A 3WGIA 3L2UA 4Z6EA 4RU9A 3KLNA 3BQZA 3D2NA 3KOOA 1D0XA 4N9HA 2JK3A 2E71A 2R8JA 1P6RA 3UMBA 4PGXA 1RUOA 4Y2SA 1ZQRA 3GFMA 4LB6B 2DT7B 2PMUA 3PW2A 2WY8Q 2K9MA 5L3FA 2HI3A 2HMXA 2DMUA 4RQ3A 3BTCA 4L5IA 5KAIU 1A76A 2C22A 2LH9A 4CCHA 2K9QA 4NHJA 3MR6A 3CMMA 3TDUC 1P7JA 4PSXA 4I76A 5AKZA 3CCEI 2HOQA 4DL6A 3RSNA 1BI1A 1A35A 2EWNA 4QWAA 2GWSA 1DGWY 4XOTA 4IRCA 4F8RA 4FX4A 3S16J 2L01A 2QBYB 3K4CA 3CW2C 4CH7A 1TWAJ 1V5FA 4EJOA 1Z1DA 3TI0A 2Y48A 3D2SA 4KMUA 4Q8FA 5EYRA 3RTRA 2XUBA 3HTSB 1LKXA 3LWFA 4A3FJ 4OIRF 1N62A 1UHUA 1V97A 4DS4A 3MDCA 3QYEA 2EFPA 4MGRA 4W1UA 3IWZA 2WADA 2DWQA 3RKXA 2HNHA 2L9SA 3SDBA 4YIRX 1TE2A 2JEJA 1ZQQA 3RTVA 4OOIA 1ED1A 4HX4A 1ZQTA 1W7PA 2MFZA 3FYHA 3VYUB 3JRDA 2J6UA 1GT0C 2QUFA 3PUFA 4EJTA 2EAPA 1JKOC 2E19A 1BIBA 1NG7A 3V7JA 1BPZA 3L2VA 4M3FA 3CUOA 2E1MC 4I2FA 1MBFA 3FMQA 3QU6A 5F1RA 3DU5A 1O3TA 2QLTA 2ZIVB 3BG9A 3L2RA 2HYGD 5E3LA 1V38A 4DCCA 5B5EC 3FISA 3OHAA 3BJOA 5H6QA 5KFEA 3Q8LA 1OCRH 3S93A 3D5LA 3GTOJ 1ZXIA 2CS3A 2G07A 4NLNA 2B21A 3FMRA 3KD3A 3BY6A 1SVOA
chains in the Genus database with same CATH topology
4B43A 4NQWB 4BJTA 3F9KA 1A6SA 3BCAA 1T94A 2JMGA 4BEHA 3IAS2 4NC8A 2Y0SC 3K10A 2H3ZA 1N75A 3BLYA 3OR1C 2F77X 4RLFA 3HXLA 2HZDA 2W1OA 3BC8A 4IZZA 2KLOA 3OR2C 4ICAA 4CA0A 3ZQQA 2V6EA 2K9LA 2LYBA 2NV3A 2IS1A 2R7VA 1R6RA 5FROA 1Z21A 3LSMA 3ZXSA 3ONNA 2L2OA 4HSTA 3LMMA 4DBQA 2DCEA 4FE3A 1D1AA 3L2QA 3HUGB 3VSLA 2G06A 4BE1A 2KIWA 1GLNA 2HBMA 2HU9A 2ZXHA 3OL3A 2IGOA 2JH1A 3HL2A 1V5EA 3MGVA 1MMGA 4QPOA 4IQ4A 3H5NA 1BOBA 2WY7Q 4XKBA 2JVHA 2ZFUA 4XLHA 4HRIA 2HBJA 1Y56A 4BS9A 3GU3A 4DGWB 3H0RB 1X1DA 3C28A 2VJJA 4PJNA 2R7WA 5FRNA 2F76X 2K8CB 2WAQA 4U6PA 4CRXA 3MKWB 3SAFA 3KX2A 4E7SA 2BOLA 4DIQA 5HNFA 2K3PA 4NV0A 1WFXA 3E0JB 2KQRA 3HPHA 3NWSA 3LSGA 3ZCOA 2UV1A 1PVQA 2X1EA 3HPGA 3DKXA 3ZRGA 2K4HA 3L2WA 1AA7A 3VYSB 3C2HA 3ICXA 3OPXA 3EUAA 4X0GA 3N7RC 2X85A 4QNLA 4OJPA 2OUMA 4N4NB 2ZIXA 1Z3YA 2JUGA 3J7AY 3PNYA 1T95A 3H9QA 3QOEA 4Y4RA 4BQQA 2VB6A 3K6GA 4YEJA 4IKFA 4OJ5A 2VPLA 1YE9A 4BDZA 3OYKA 3OYIA 3H0MB 4AYBC 2MYSA 2RREA 3UR3C 3K4LA 3DPLC 2KHQA 4XN3A 5HR7A 1P7DA 3OIQA 3HKZC 1XNSA 3DWLE 2HVSA 2YB4A 2OC6A 4ZDOA 2RHFA 1TT0A 2DJIA 1HA8A 2A3VA 4QIWF 4O3MA 1D8BA 4Y3OA 4CCLA 2Q2EB 4E7LA 4E7KA 4OAZA 3OYHA 3HOSA 2F5VA 3K70C 4CCKA 2CV2A 2DF4B 4XLCA 3F2CA 2KNJA 2CUJA 2VKHA 1FMWA 3OYCA 4ACOA 3I3LA 4P0PB 3H35A 1HIWA 2A6TA 4PJMA 1WJFA 4NLCA 2KRCA 3H5AA 2XC7A 4BGDA 4J01A 2ZIWA 1WUDA 5CQGA 2GH1A 2WB1F 2W82A 2BW3A 4GRIA 4B47A 4NUBA 4BE2A 3IUOA 3W2VA 4II2A 1L6NA 4LG3A 3K4KA 2XF7A 5CKTA 4CCMA 2DGZA 2QKLB 1ZELA 2KHMA 1X19A 3VWBA 1SFKA 4XMYA 2XI9A 4PK4A 2G09A 3KZXA 1WJBA 2KP6A 4C2UA 3AL0B 1ZQ1C 4NC7A 4XKCA 4XN0A 1DP3A 3D5SC 2PJRA 2VL8A 3TBIA 3AQEA 3F53A 2LY2A 4JOMA 3HC7A 2CFOA 2LY1A 4CGZA 2VJ4A 4IQJA 1Q3UA 4PFPA 1UG0A 4ZDPA 4XKVA 2R18A 3O0FA 3K4BA 1D1BA 3MKYB 1E0EA 2LHTA 3GZFA 2HBKA 4KX5A 2LBOA 1YX3A 3W2AA 4R79A 3F5EA 2BDUA 1BR1A 5HVQC 2K8BB 2M0NA 3OYDA 2KJ8A 3EUKL 3OL4A 4BE0A 1W36C 1X1CA 4OO1J 3BG6A 1VZ0A 4P5OA 4CZCA 2DOAA 3IAM2 4H4KC 2RNGA 4BJQA 2V7FA 1D1CA 3OYEA 1Q3VA 2KKVA 3SEQA 4KITB 5HOOA 3C29A 4ZTJA 4NNJA 2KKPA 1PVRA 2X6WA 5CQEA 4E7JA 4A8EA 2ZG6A 1G59A 1LVKA 2WAQF 1GO3F 4XONA 2W00A 4IX7A 1Z19A 4FZMA 1S9HA 1WJDA 3RCOA 2CV1A 2KRHA 3LL7A 2XSJC 1UAAA 4PSWA 2ZIUA 3FKJA 3VSKA 2KMUA 1YT3A 3DPUA 3C2GA 4RMNA 2W7NA 1OLTA 2LC2A 4N4OB 5T14A 4XLEA 3SQIA 3DTIA 5A0LA 4CUGA 3PSFA 2L9NA 4HG2A 1CRXA 1UPHA 1K6YA 3LYSA 4BEHB 4WJ3B 2CMPA 1Z7LA 3LSKA 3DPTA 4ZC3A 5LFAA 2R4GA 3VC8A 3SAHA 2XF5A 2MRLA 3DKYA 3AL0C 3FBNB 2LOOA 2VQLA 1QU3A 4BX9C 1UELB 2VXDA 2Y0SF 3OYNA 3IN5A 3S3MA 3IG8A 3VYRB 3H9GA 3EPZA 2W7PA 3F2DA 2YX8A 1DGRM 3DU6A 2G08A 3IP4B 2A5WA 2K89A 4OJLA 3A1YA 3OYAA 2X1DA 1EA3A 2IS4A 2W4SA 4BXFA 3L3FX 2V9KA 4CDGA 4HNUA 1F44A 3BCBA 3PNTA 2HOFA 2M0MA 2GOXB 4PUSA 2PMZA 4E4HA 3EUHC 2R7XA 1Y6IA 4KISA 2E1FA 2IGKA 1BR4A 2HPMA 3W2WA 2LG4A 2H3QA 1KBUA 2VKQA 2VIXA 2E60A 2CW7A 2IXSA 4C0ZA 1N78A 1HEKA 2LBFA 2KHVA 4F92B 2LREA 3LFUA 2KVCA 2WAEA 1P9QC 1DQUA 4NWIA 1PVPA 2AQEA 2L5QA 3RPUD 4FZLA 2ZIXB 5C0YA 2Y0SA 3OYGA 5TGTA 2E1MB 5KL1B 2P0WA 4ZTFA 2JH7A 4EATA 1V5GA 4FASD 3KFUF 4OAYA 4P0QA 3CZ6A 2VKDA 3OYLA 3V42A 2K4EA 3NRWA 4NLBA 2V4JC 3DTKA 4E7ZA 4J00A 3OYJA 3CF2A 3K4MA 2VJIA 2K4IA 3W3CA 2RQQA 4U87A 4BQOA 2KD1A 3RFAA 4AYBF 2E1EA 1QHGA 2MABA 2OXOA 1BR2A 2WA0A 3M6KA 3IG5A 2KL4A 4OWRB 3BG7A 3HKZF 3E1SA 3OIPA 1G8XA 4BDYA 2X51A 3CP8A 4PJLA 2FUG2 3U21A 2CPRA 1MMNA 3ALRA 2XVTA 3QYBA 3H9JA 2E5SA 4LIUA 2VLAA 2R7RA 2KOBA 3FBIB 4ZDLA 2UUZA 2Z7JA 2ZIWB 4KX3A 4XM3A 2K8AA 3CJQB 2BW3B 1D0ZA 2X6XA 3OYFA 2H3FA 4HEA2 2M7AA 4KMOB 4PL2A 3PSPA 1X1AA 1X1BA 2BVLA 2VXZA 3PSIA 2V1NA 3N05A 4DBRA 4E7HA 3CP2A 4AVZA 4Y33A 1URJA 2F4IA 4AYBA 2G5HB 2ZIVA 2BVMA 3UNGC 1X4OA 2M4KA 3CESA 5LD2C 2WAQC 4C30A 3OYBA 1SZHA 2Q1ZB 3HKZA 2LYAA 4GFJA 3OS0A 5CPRB 2XICA 4PFOA 4AU7A 3KEYA 2RP5A 3M8JA 3VDXA 4B3XA 4BL0B 2H3VA 1Z3XA 2PJRB 1JI8A 1IRXA 2DXIA 2KEYA 2VQCA 3OWTA 3NWTA 3DEEA 4BUGA 1XO0A 4LITA 4OJOA 4PJJA 3ZR8X 3S8PA 2VQGA 2CN1A 4ZJZA 1NZBA 4XNFA 4BACA 3PFYA 3K70D 4F52A 4F93B 3OS1A 1TZLA 3M7DA 2X6YA 3CJRB 2OH2A 4E7IA 5KNLA 2Z2SB 4DJAA 2Z16A 5HNHA 2IS2A 1OUQA 2JGAA 2KPMA 3I9V2 2CV0A 1WJAA 2RRDA 5HLTA 3N7PD 2PMZF 3AKZA 4XORA 5KHDA 2KZVA 3ZGKA 3T79A 2R7OA 2CH0A 2WAFA 4HPQA 4II3A 4YRVA 3F5AA 2R7SA 1NG6A 3FHNA 4XKWA 2VJ5A 1SAUA 3RQ4A 2GOMA 4CSWA 4QIWC 2M7BA 3PL8A 4MLOA 3HOTA 3AQFA 1T0FC 4U7CA 2LKYA 3D5RC 4D9JA 2M3AA 3H0DA 4C2TA 4CCOA 2F8LA 2ZIUB 2HQAA 2KJ5A 2XF6A 2Q4TA 2ZSHB 1Z1BA 3OY9A 2H3IA 2E5ZA 2W7OA 3DQVC 5FRMA 4OJ6A 4U7BA 4IC9A 3D2QA 1OR7C 1D0YA 2KDOA 1MMAA 3E0FA 2I8DA 4JQFA 2OV7A 4YELA 1WJEA 2DT6A 2OM6A 3AFHA 2JVGA 4XOPA 2WBMA 3QYFA 2MD0A 2NOJB 3H5RA 3SYTA 3K1ZA 1PYVA 4XR6A 2CW8A 4BUPA 3SZGA 3OYMA 3MKZA 4BJ5C 1W36D 3CYMA 1KONA 3PNVA 4XL9A 3TMOA 4RM2A 1PJRA 4RM3A 2XAUA 1X4PA 2KJ9A 4QJFB 2JA2A 4KJZA 4P1WA 1U0JA 3K4NA 4FETA 2AQFA 4F55A 4F91B 1FMVA 3S3NA 2GOLA 1IIPA 3QODA 2WB1C 3LVVA 4D1QA 3DLAA 5KL8B 3S32A 4BQNA 3OMYA 2KV2A 2LYCA 2VASA 1MNEA 2JHDA 4HNTA 3KYLA 2R7QA 2G5IB 1WJ5A 3F2BA 4P0PA 1ECWA 1LDKB 1TAMA 2CRXA 2K5CA 3SEZA 2VQHA 2XDVA 2HDWA 2JSPA 1YX5A 1DRGA 1LFPA 2IS6A 3OOUA 4BJ6C 2LBFB 3SAGA 5JHFA 1MW7A 3NUQA 2G0AA 2E5NA 2Z1DA 3FDYA 4G6TB 2OYYA 2N1RA 4KT6A 2DQNB 4JMUA 3LSHA 2CUZA 3MMYB 1QHHD 4E6KG 3L2UA 2ZSIB 4F3QA 3D2NA 2HVRA 4ZYAA 2W04A 1D0XA 3LVWA 4P0QB 3H0LB 2LRDA 2DT7B 1N77A 2WY8Q 2F2AB 2K9MA 2QKMB 4C9YA 4DOZA 4CCNA 1MMDA 2HMXA 2YB1A 2ELJA 2LH9A 2ZXIA 4BU2A 3CMMA 3N7SC 2HVQA 4PSXA 3ONQA 2HOQA 3K4JA 3RSNA 1DGWY 4XOTA 4ITVA 4HSRA 3A2KA 2XIDA 3K4CA 2IGNA 4CH7A 1V5FA 3PJRA 2MA1A 2MC4A 3D2SA 2KICA 3RTRA 1LKXA 2L7KA 4XQFA 3PZPA 2O5RA 3RF9A 3OS2A 3CRXA 3QYEA 3G2BA 3MD2A 4B44A 2WADA 3PUBA 3VYTB 4XLAA 1MA7A 1MNDA 4FZNA 2X1CA 2HNHA 2L9SA 3GBGA 3SDBA 2UWMA 2V26A 3SMVA 4RLQA 4LIVA 1ED1A 3PSTA 2D6FC 5HR6A 4CCJA 2IGMA 2MFZA 3VYUB 2W03A 4ANJA 2R7TA 3S3OA 4PL1A 2HBLA 1NG7A 3LSIA 3L2VA 2WB1A 2E1MC 1A0PA 5KCMA 2R7UA 3DU5A 4B48A 2ZIVB 2PMZC 3L2RA 3M1CA 2HPIA 4XLFA 3M6ZA 3HG9A 2M4GA 3A4CA 3VCBA 1J09A 3TL4X 2HOIA 3S93A 3D5LA 4QPQA 5CRXA 2CS3A 2G07A 1WJCA 1ERDA 2F6CA 3DTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFU F;  3H0R B;  3IP4 B;  3H0L B;  2DF4 B;  2G5H B;  1NG6 A;  2F2A B;  2D6F C;  4WJ3 B;  2DQN B;  3H0M B;  1ZQ1 C;  3AL0 B;  2G5I B; 
#chains in the Genus database with same CATH topology
 1Z6T A;  2DQR A;  1TC3 C;  3RB4 A;  5DB7 A;  4NQW B;  5F04 A;  1YW9 A;  3MKL A;  4IEJ A;  5BMZ A;  1DRG A;  3KCC A;  1IN6 A;  2DU9 A;  3IAS 2;  3KP3 A;  4BEH A;  1WKM A;  5ALJ A;  3PX0 A;  1KQ8 A;  2H3Z A;  2NVY J;  4L9J A;  3ISC A;  4IHV A;  2EAO A;  1ZQZ A;  5JU5 A;  2W1O A;  3QWL A;  1ZQB A;  4ICA A;  5DUI A;  4CA0 A;  1ZQK A;  4KLO A;  1I50 J;  2K9L A;  1R5G A;  1A36 A;  8ICI A;  3COA C;  2Z9O A;  2IS1 A;  2R7V A;  2EZH A;  5ALN A;  3LSM A;  3ZXS A;  2L2O A;  5IYB J;  2JXJ A;  2IA1 A;  4DBQ A;  2DFI A;  1XMX A;  3A02 A;  3HJE A;  2YML A;  1D1A A;  2EZX A;  3VPR A;  4LG0 A;  1UB9 A;  2ELK A;  3HUG B;  4F7Z A;  1X9X A;  5J40 A;  4BE1 A;  2HU9 A;  2IA0 A;  2ZXH A;  2LSO A;  2LPE A;  5F6F A;  2DMP A;  2K02 A;  3GLL A;  4MHG A;  2JH1 A;  1ZQF A;  4QPO A;  5F27 A;  4D7N A;  1LKY A;  2H09 A;  2K3F A;  3DBH B;  1XCV A;  2WY7 Q;  4XKB A;  5HHH A;  2EJR A;  4B3A A;  3HTU A;  4C4R A;  4BS9 A;  4DOA A;  1U2W A;  1X1D A;  1R1V A;  4UVC A;  4A3J J;  2VJJ A;  4DFJ A;  2CQ7 A;  2W9C A;  4HLY A;  2K8C B;  4Y13 A;  2M2E A;  3ED5 A;  2BOL A;  3K4G A;  5HNF A;  4G6D A;  1WFX A;  3E0J B;  1U78 A;  3LSG A;  5EG0 B;  3BTI A;  2I5H A;  1VQ8 I;  3F8N A;  1HKQ A;  4UB8 U;  1I3A A;  1G6N A;  5G5G A;  5B1B H;  3ZPL A;  2X85 A;  3J7A Y;  1OYW A;  4A6E A;  3H9Q A;  2YR2 A;  3QOE A;  4Y4R A;  1X58 A;  2R93 J;  2KSO B;  3ABK H;  2QLZ A;  4QZF A;  3UKG A;  3GV7 B;  3NVZ A;  4BDZ A;  1X42 A;  5AI9 A;  4TUP A;  2B7E A;  4DZP A;  2MYS A;  4QZD A;  2BCS A;  3K4L A;  3GFK B;  3DPL C;  5ALX A;  1SV0 A;  5AK4 A;  4MFA A;  1K83 J;  2P5V A;  3KEO A;  4M3G A;  2LR8 A;  3N97 A;  4PH5 A;  1FLI A;  2STT A;  8ICE A;  4NDL A;  4KLU A;  2K9S A;  4A0Z A;  3TOB A;  1D5V A;  3S6J A;  4Q43 A;  3M9O B;  3WG7 H;  3J81 j;  3PW0 A;  2BPF A;  3KE2 A;  1TT0 A;  2LP0 A;  1WWX A;  1ZYR F;  5BPC A;  4JYK A;  4LJX A;  5KAI C;  3QEB Z;  2ZUD A;  4DQP A;  2D1H A;  3KP7 A;  4Y3O A;  1HF0 A;  1LE8 A;  7ICG A;  1ODD A;  4PCQ A;  1M6Y A;  3HOS A;  1D8L A;  3PIO F;  2LKS A;  5IT9 K;  1L7P A;  2V79 A;  2GQQ A;  5D5V B;  5M3F J;  3OYC A;  4NBQ A;  3PY8 A;  4U0Y A;  2E2H J;  5GPC A;  3WTX C;  3CTA A;  3KYD B;  2MUT B;  3REO A;  2AHQ A;  3WKB A;  4P0P B;  1JUP A;  4XRM A;  2DPJ A;  3WK7 A;  1SMY F;  3ZMZ A;  4BGD A;  3KKA A;  1WUD A;  2GH1 A;  3FWE A;  1XS9 A;  4Y2X A;  5M5Y J;  4A5M A;  3LSP A;  4IHS A;  3MR3 A;  1L3S A;  3A03 A;  1R5H A;  3SDG A;  4ESF A;  2DPU A;  2EV5 A;  4HF0 A;  4NUB A;  4BE2 A;  5KFJ A;  4M2Y A;  3W2V A;  4D0P A;  1AHD P;  4II2 A;  1ZK8 A;  2EIN H;  2XY7 A;  1U5T A;  1ZAR A;  1DDN A;  3RH5 A;  3Q0V A;  2M0C A;  5TZV A;  2BE5 F;  2HDO A;  4QTR A;  3KFW X;  3E7L A;  1Q8K A;  3AL0 B;  3C23 A;  4XN0 A;  1PZN A;  4DO9 A;  4UV9 A;  1ETY A;  4FQG A;  4HNV A;  4F4X A;  8ICP A;  3JRH A;  2PJR A;  4I29 A;  2XRN A;  3AQE A;  4RUC A;  4ZYD A;  2KDZ A;  2LY2 A;  2HHS A;  4M9G A;  1RKT A;  3HC7 A;  4DFP A;  3OHB A;  5DGA A;  1ZRC A;  5AI5 A;  3RR7 A;  2DT5 A;  3WTU C;  2RQ5 A;  2YU3 A;  4I09 A;  2R18 A;  3QQA A;  1R7J A;  5E20 A;  3BJA A;  1E0E A;  3GZF A;  4KX5 A;  1ACI A;  2YQE A;  2HXO A;  4RB2 C;  1NK0 A;  3F5E A;  1BR1 A;  3QRF F;  2RDI A;  1R1U A;  5K7H A;  4LGW A;  3OYD A;  4NM1 A;  4OO1 J;  2JR5 A;  1CUK A;  1UMQ A;  2ZJQ F;  3CCQ I;  3GIK A;  1QQ6 A;  3L2C A;  3SEQ A;  9ICC A;  1X9S A;  5KFU A;  5JLW A;  4ZTJ A;  3V8K A;  3ZQI A;  2PI5 A;  1RDF A;  4E7J A;  2V6C A;  4RQ1 A;  2RN7 A;  1G59 A;  3G73 A;  4R8H A;  4EEK A;  2ZJ2 A;  2K4J A;  5J8C A;  4I27 A;  2OTL I;  2XCA A;  1ON2 A;  5LEK A;  4NY8 A;  3WTV C;  1SKW A;  4AIJ A;  4HQE A;  1H0M A;  3SI8 A;  2QSH X;  4TQS A;  9ICS A;  2BEO A;  4O6J A;  2HFH A;  7ICR A;  1HKS A;  2NVQ J;  8ICV A;  2KRH A;  5D4S A;  4HW0 A;  1MC8 A;  1UAA A;  4PSW A;  4O0I A;  4ESB A;  2ZIU A;  5KG6 A;  4TQR A;  5LEJ A;  1G3W A;  2MD5 A;  3IH3 A;  3FKJ A;  3FKI J;  1PUE E;  3E97 A;  3ZQG A;  5ICE A;  4X6A J;  9ANT A;  1LEB A;  4Y17 A;  1YT3 A;  3LST A;  3DPU A;  4RMN A;  1SAN A;  3DBR B;  4J03 A;  5J0P A;  3JPO A;  7ICE A;  4PGY A;  2HHU A;  3ZQL A;  2CFX A;  4KLM A;  8ICA A;  3SQI A;  1TNS A;  3DTI A;  2DO7 A;  4UB8 C;  3J81 K;  1SL2 A;  3I54 A;  1CRX A;  5K7F A;  1K6Y A;  4US9 A;  5KFV A;  1MKM A;  1BI0 A;  1QCK A;  1BPE A;  2GXB A;  3MDA A;  1H9T A;  3GFJ A;  5KFD A;  5LFA A;  5IT9 Z;  2IEK A;  3VC8 A;  1FBU A;  3C1Y A;  2XF5 A;  4Y2U A;  2R8K A;  3AL0 C;  5ALO A;  3NEU A;  3SD7 A;  5KFX A;  1OYI A;  4HX8 A;  1B72 B;  4HF1 A;  2LOO A;  2HOA A;  1QU3 A;  2KEY A;  3HGG A;  1ZQY A;  2H94 A;  3JPN A;  3IN5 A;  3IG8 A;  2L0K A;  3VYR B;  4KN4 X;  3EPZ A;  3F2D A;  1P4X A;  1DGR M;  1SKS A;  1IXR C;  1REP C;  2ZTC A;  1XC9 A;  1XPX A;  2KIM A;  4GXJ A;  1GXQ A;  1N61 A;  4OJL A;  4UBC A;  4ED7 A;  2G9W A;  4XUS A;  1DU0 A;  2W24 A;  3IC7 A;  3RYP A;  4CDG A;  4HNU A;  1F4K A;  3BCB A;  2BPC A;  5ALT A;  3PNT A;  2M0M A;  3GZ5 A;  5DTD A;  2GOX B;  1EJ9 A;  1KFT A;  5LLQ A;  2NYV A;  4NJ8 A;  2DA4 A;  3D0S A;  1BR4 A;  4UAT A;  5F0H A;  3RB3 A;  4F5R A;  3KP2 A;  3EDP A;  1LQ1 A;  2CYY A;  1KBU A;  2IP2 A;  2VE9 A;  2VIX A;  2E60 A;  4IOC F;  5AIA A;  2FLP A;  5GTH U;  2EH3 A;  5HHI A;  2OF7 A;  2LBF A;  1B8I A;  1WWV A;  2H8R A;  2G0E A;  8ICY A;  1ETX A;  5AM1 A;  4NWI A;  2AQE A;  2L5Q A;  4G3I A;  1ETV A;  1L7M A;  2ZIX B;  5C0Y A;  3MCZ A;  5K1Y A;  3OYG A;  2EA2 A;  2X9D A;  5AKI A;  3F6O A;  3THV A;  2FOW A;  1BM9 A;  2TDX A;  3PQJ A;  4Z6C A;  5KFF A;  4EAT A;  2K60 A;  8ICH A;  2DA3 A;  5AIC A;  2MSN A;  3CZ6 A;  3MZY A;  4I7H A;  5DB6 A;  2XY5 A;  3V42 A;  4MO7 A;  2MH9 A;  1YJN I;  2K4E A;  3H7I A;  3NRW A;  4J9O A;  1GUU A;  2HSZ A;  2V4J C;  1LVA A;  2XAQ A;  3DTK A;  4XK4 A;  4M6W A;  1YJW I;  4RB3 C;  2Z3Y A;  3CF2 A;  2QKQ A;  2P6S A;  3SV4 A;  3FHZ A;  2VPR A;  1UHW A;  2L4A A;  1XS9 D;  2OXO A;  1QHG A;  1BR2 A;  4C3J J;  4EM0 B;  1MJB A;  3CO7 C;  4EVI A;  1APL C;  3M6K A;  1QRY A;  3IG5 A;  1U8B A;  1EF4 A;  4PHE A;  4UBB A;  3K7A J;  3BG7 A;  4RA2 A;  1U8R A;  1G8X A;  3ROU A;  3TW6 A;  4G9B A;  2R0Q C;  1U9O A;  2P4W A;  1RNL A;  3CP8 A;  2FUG 2;  3U21 A;  2AS5 F;  2F8K A;  2CPR A;  3ZMD A;  3ALR A;  4I2D A;  3IH2 A;  4LIU A;  1A04 A;  5J3L A;  3FBI B;  2FSW A;  3ERE D;  4V2G A;  4EGZ A;  5GAE J;  1J9I A;  4ECR A;  2XRO A;  3FDS A;  4C8O A;  4B9V A;  1IDZ A;  3IM1 A;  5DB9 A;  2UUZ A;  4FS1 A;  1RIO H;  2VON A;  1XCB A;  1HW2 A;  5J0U A;  4YXJ A;  1TAQ A;  1OW5 A;  2A1J B;  2P6T A;  4XM3 A;  4BY1 J;  2LF7 A;  3CJQ B;  2K8A A;  1D0Z A;  2X6X A;  2BGC A;  4RNM A;  4ASN A;  2K7L A;  4PL2 A;  4PGQ A;  2DPI A;  1U47 A;  1X1A A;  1U49 A;  2BVL A;  3I59 B;  4RQ2 A;  4I2H A;  4DBR A;  1XD7 A;  4ECW A;  3AU2 A;  3J81 Z;  5J2K A;  5L1J A;  3G4S I;  1UT5 A;  2E8N A;  4J9Q A;  2BY2 A;  4AP9 A;  1MQ3 A;  3UNG C;  4GC6 A;  3CES A;  5LD2 C;  1RXV A;  2WAQ C;  3HKZ A;  3C2B A;  4GXO A;  2DDA A;  1ZQN A;  3ERM A;  3BR2 A;  5JVT A;  3KEY A;  4DS5 A;  3VDX A;  4P4P A;  4RNO A;  3M8R A;  1NKE A;  4KLG A;  4ENM A;  2Y30 A;  1IRX A;  2R7D A;  1SVL A;  1HDP A;  1S29 A;  4Q47 A;  3N4M A;  3OWT A;  2DXI A;  1A5J A;  1TL8 A;  5ALL A;  4X5V A;  5C44 J;  4BAY A;  3HWT A;  1XO0 A;  3IKT A;  4LIT A;  5D8L B;  4ECU A;  4PJJ A;  3U26 A;  4KLI A;  4RT3 A;  1W0U A;  2XAS A;  4UB5 A;  4BXO A;  4Q44 A;  1JUS A;  8ICJ A;  1NZB A;  4ENK A;  3E6B A;  4RQ8 A;  4F93 B;  2OH2 A;  3CF5 F;  1VND A;  1FBS A;  4RB1 A;  3H8S A;  2OAZ A;  2X48 A;  3CCJ I;  4DJA A;  1YS7 A;  1NZP A;  1OUQ A;  2ELH A;  3E6M A;  4I02 A;  2NVU B;  2RRD A;  1IG7 A;  5DBB A;  3Q8P B;  3N7P D;  1WRJ A;  1YRN A;  1RQN A;  1SGG A;  4F4Z A;  3AEV A;  5GP9 A;  1X1P A;  5KHD A;  1D8Y A;  5L3E A;  4C7Y A;  1J2X A;  3ECO A;  7ICU A;  2FLN A;  2DMT A;  2CH0 A;  4YRV A;  4DQR A;  3VEP A;  3EUB 2;  4QWD A;  4CE6 A;  2W25 A;  4XKW A;  2HW3 A;  1SAU A;  3T1B A;  1JKR C;  1N63 A;  3H0G J;  3AQF A;  3H0D A;  5AKH A;  2M3A A;  4UUS A;  4YFK F;  1TAU A;  2KIF A;  4EMS A;  3MQ0 A;  1IRG A;  1S0M A;  1WCM J;  4GYI A;  1UST A;  1JUM A;  3OY9 A;  4DL7 A;  5GTH C;  4R8U A;  3KEQ A;  2FI1 A;  3HSR A;  1XDS A;  4IC9 A;  1BW6 A;  3JPR A;  1OR7 C;  4A3D J;  4NC6 A;  2KTQ A;  5HS9 A;  3S2W A;  4O5V A;  2IOF K;  2BCQ A;  4I6Z A;  1WJE A;  1TKD A;  3F8F A;  4R63 A;  1MH3 A;  4DYC A;  2LNB A;  2QQA A;  5E17 F;  3V8L A;  5DCM A;  3PO3 J;  2F44 A;  5AM3 A;  4DOC A;  2QAR A;  4F4K A;  9ICM A;  3QYF A;  2MD0 A;  4EJU A;  2PFN A;  1QBJ A;  5KFY A;  4UB2 A;  1ZQH A;  3GXO A;  3JTH A;  4BNC A;  3SZG A;  3MKZ A;  3IRR A;  4B9M A;  3PNV A;  8ICG A;  4Q4Z F;  2JA6 J;  4ECT A;  7ICI A;  3JW4 A;  1X4P A;  3V4G A;  2J5P A;  2KJ9 A;  4KJZ A;  2FF4 A;  3SEN A;  4FET A;  3K4N A;  5IIN A;  4F72 A;  1P2F A;  4ED2 A;  1IIP A;  3ETL A;  3LVV A;  1XGN A;  2K9N A;  4F5O A;  3LA7 A;  4RDU A;  2I1Q A;  1DPR A;  1ZKG A;  2W9M A;  5KG4 A;  1FP1 D;  2Z5U A;  2G5I B;  1X6I A;  1WJ5 A;  1MD0 A;  4TUQ A;  3PFI A;  3MC1 A;  1LDK B;  2BY1 A;  2I9G A;  1Z6R A;  2CRX A;  7ICF A;  2GIZ A;  2K5C A;  2F3N A;  2E2I J;  5GTI U;  5KG3 A;  2O0Y A;  2R92 J;  2TCT A;  5D6E A;  3CLO A;  4BHC A;  2ZB9 A;  3I5U A;  3OOU A;  1TFR A;  1UG2 A;  5JHF A;  1MDM B;  2QB0 B;  4A6D A;  1B4A A;  1DXS A;  5IIK A;  4KT6 A;  3J7Z I;  2HOT A;  5C4X J;  1X66 A;  4JMU A;  5CVJ A;  1Y8R B;  1MSE C;  7ICN A;  2JN6 A;  1WQ2 A;  3JTG A;  4LMY A;  4E6K G;  2BZT A;  1ZGJ A;  4A0Y A;  2ZSI B;  2WHE A;  5E3M A;  3K9T A;  3IV5 A;  4LB5 A;  1V3F A;  4ZYA A;  2GXA A;  2HVR A;  3TAN A;  1NOM A;  1MSW D;  3LVW A;  4UAY A;  3SZT A;  2NS7 A;  4RGS A;  2HOS A;  3H0L B;  2DW4 A;  4WXD A;  2F2A B;  5KFT A;  2QSF X;  1LB2 B;  5CYV A;  2ZJA A;  2YB1 A;  1N60 A;  2ZXI A;  3BR3 A;  4XRS G;  2JMW A;  3HHH A;  2HVQ A;  3ABL H;  5IIO A;  5ALD A;  1IRZ A;  2A19 A;  5EWE A;  3MFK A;  2CWE A;  4ZYG A;  1QVU A;  1L5U A;  2ZFW A;  2CW0 F;  2IGN A;  1ORK A;  4BHP A;  2MA1 A;  3JSP A;  5A2Q Z;  2OWO A;  1HC8 A;  4IQV A;  4F4Y A;  4JV0 A;  3B02 A;  2L7K A;  4XQF A;  2WWY A;  1NHA A;  3ABT A;  2HR3 A;  2ZXJ A;  3OS2 A;  1S6L A;  4ON0 A;  3TQN A;  2DOE A;  2GLO A;  1S7A A;  5HLG A;  3EPG A;  2PMH A;  2XHK A;  1XTA A;  1R71 A;  4R64 A;  2M34 A;  3SMV A;  2V26 A;  2AXT U;  1RZT A;  2F1I A;  5BOL A;  2KMD A;  3OJU A;  3M1E A;  1VQM I;  1PP8 F;  4CCJ A;  1L3V A;  2EZK A;  3FX3 A;  2R5Y A;  2V1X A;  3DLL F;  1IF1 A;  3HOV J;  2DJN A;  4YN4 A;  4Q45 A;  3H92 A;  3FM9 A;  5KCM A;  2FOK A;  2HVI A;  5DDG A;  2W43 A;  1ZQL A;  3ESW B;  4B48 A;  4IO9 F;  2JZB A;  4XLF A;  2HPI A;  5BS6 A;  1IO2 A;  3KHR A;  1ZLK A;  4UVB A;  2FE3 A;  3A4C A;  5H6R A;  3X2Q H;  4UUT A;  4K4H A;  4FO6 A;  3DEU A;  3HKZ N;  3P5J A;  2OQR A;  2VBZ A;  5EGO A;  3ISB A;  3NQO A;  2F5D A;  1LFU P;  2XKO A;  1K7A A;  2IW5 A;  1CEZ A;  3G1M A;  1WJC A;  1GV5 A;  3F72 A;  3CMA I;  1ULY A;  2DFH A;  3V7R A;  3CO6 C;  1VQO I;  2F6C A;  3DTE A;  1YIJ I;  1G3S A;  1FYK A;  2NO4 A;  3BQ7 A;  4C4T A;  1IG6 A;  4B43 A;  3L9F A;  5DLG A;  3F9K A;  1A6S A;  2HHQ A;  3FMS A;  5AIP A;  1D8J A;  1L3T A;  2Y0S C;  3K10 A;  4WF2 A;  3KTQ A;  4P2H A;  2YMM A;  2CJJ A;  1I6H J;  3OR1 C;  5FLV A;  2F77 X;  4RLF A;  4Y2P A;  3TAR A;  3F8M A;  5AKX A;  2JA8 J;  4EJV A;  4M72 A;  5L3G A;  2HZD A;  1K1Q A;  3BC8 A;  2VE8 A;  2KLO A;  3MN2 A;  3OR2 C;  4X1E A;  4ENJ A;  3ZQQ A;  1VQ7 I;  4OMY A;  3WGH A;  3S1N J;  2NV3 A;  4EBC A;  3TO9 A;  2ZCW A;  5H20 A;  5FRO A;  3B6C A;  1HJP A;  2VUM J;  1YYV A;  2DCE A;  2H6B A;  3L2Q A;  3HIL A;  2G06 A;  3S1Q J;  4XRS A;  1GLN A;  2HBM A;  4FFD A;  5E1Z B;  3OL3 A;  3BJY A;  4IRD A;  3LA2 A;  1QSL A;  2HGC A;  1MMG A;  4IQ4 A;  2DPD A;  2EIL H;  3H5N A;  4XLH A;  2ZFU A;  3FXO A;  3BZK A;  2W8K A;  1BJZ A;  4FBU A;  1Y56 A;  2FNP A;  3WG9 A;  2Y9U A;  1MJA A;  1J2M A;  3H0R B;  3C28 A;  2F76 X;  3KLO A;  3FM3 A;  1JMS A;  2IA6 A;  1P4W A;  3WKC A;  5CB1 A;  5J0Q A;  5DDY A;  4E7S A;  2JZY A;  2QM3 A;  3ZP5 A;  1PVQ A;  2KQR A;  1CF7 A;  1R00 A;  4B9T A;  4KLJ A;  1J75 A;  1M1E B;  3DKX A;  5GTI C;  1ETO A;  2Y0M A;  3VYS B;  5IOZ A;  2EFW A;  1ZRD A;  3C2H A;  2ZTE A;  1NKC A;  1O3Q A;  3N7R C;  3FIW A;  1YIT I;  4QNL A;  4OJP A;  2OUM A;  5C3E J;  3WU2 U;  5L3C A;  2JUG A;  5J0X A;  3U2R A;  1T95 A;  4IKF A;  5JLX A;  3DV9 A;  3NGD A;  1Y1V J;  3H0M B;  4MQV A;  3OYK A;  3CC4 I;  5ED4 A;  2YPR A;  2CQN A;  3J7A O;  1DK3 A;  1SV4 A;  5J0W A;  2I5U A;  2UVR A;  2KIS A;  5HR7 A;  4C2M J;  1JXL A;  3OIQ A;  1FSH A;  3F0C A;  3TP3 A;  3DWL E;  1XG1 A;  4DYQ A;  1T08 B;  2YB4 A;  5AKE A;  3AG2 H;  2W9C B;  1XNS A;  1TP4 A;  4EEY A;  2RHF A;  3CMY A;  2X4H A;  2D2W A;  1HA8 A;  4O3M A;  2EQR A;  5KT4 A;  4BWM A;  4L9N A;  4OIP F;  3HGY A;  3K1R B;  1L7N A;  3I55 I;  5CJ7 A;  4CCL A;  2PXI A;  2Q2E B;  2WTE A;  1FOK A;  4UVA A;  4OAZ A;  5KTQ A;  1R1T A;  3OYH A;  4J9M A;  1BA5 A;  2F5V A;  1ZLJ A;  1DPU A;  2FXA A;  2CV2 A;  1N5W A;  5IIL A;  3R61 A;  2DI3 A;  4XLC A;  1MGT A;  4JP0 A;  3GTM J;  2GA1 A;  1FMW A;  1E3H A;  2VKH A;  2KNJ A;  4ACO A;  3I3L A;  1D3Y A;  1TK8 A;  1UCR A;  5JUM A;  3V7K A;  2QF7 A;  2O61 A;  2QCO A;  3NVY A;  4UAR A;  4F5Q A;  4PHA A;  2KRC A;  3O8G A;  1XX5 A;  4J01 A;  2ZIW A;  5CQG A;  2XY6 A;  3V8J A;  3G6V A;  4DF8 A;  1KLN A;  3RYR A;  2AXT C;  2GO7 A;  1KZH A;  2FE9 A;  2HDD A;  2EPF A;  2OD5 A;  3IUO A;  3RJP A;  2XO7 A;  2DLL A;  4ELT A;  1SMT A;  5LBQ A;  2OZU A;  5HDK A;  3E3V A;  2MGQ A;  2FU4 A;  3HOU J;  3GF2 A;  4CCM A;  2XV4 S;  2P7V B;  1D8K A;  3OIO A;  1R4M B;  2KZ3 A;  3JAM K;  5DQG A;  1KW4 A;  3ETR A;  1TWH J;  2OEH A;  4I28 A;  1X3W B;  4EX6 A;  5HOD A;  1Q1H A;  4PK4 A;  3TQ1 A;  2OQG A;  1Z0X A;  4L9V A;  2GM4 A;  4OIQ F;  2E7X A;  1ZRN A;  4XKC A;  3BQ2 A;  1T8E A;  1DGJ A;  2JWT A;  1PDN C;  3D5S C;  2EQY A;  1ZGW A;  2ASL A;  2VL8 A;  5FJ8 J;  1U4B A;  1ZGA A;  3TBI A;  1MZB A;  2O6K A;  4GIB A;  3BRO A;  3QP5 A;  2CFO A;  4IXA A;  2E1O A;  1R49 A;  5FKO A;  4CGZ A;  2BQ3 A;  2P81 A;  1JRO A;  1HDD C;  4ZDP A;  4QZH A;  4IHY A;  3T5J A;  1TT5 B;  4LLG F;  5FFZ A;  4DW6 A;  4Y2R A;  2LHT A;  1S7E A;  1NJZ A;  2HBK A;  4FBT A;  1U5T B;  4KIG A;  4RZR A;  2BDU A;  1UFM A;  5IT3 A;  2Y1I A;  3K1N A;  2MSY A;  2P5K A;  1W36 C;  4ZYH A;  4XRH A;  4NLZ A;  1X1C A;  3K69 A;  4QZ9 A;  4KTQ A;  3WU0 A;  1UA1 A;  1LDD A;  1POG A;  2DOA A;  3IAM 2;  4H0E A;  4RUA A;  4KMU X;  2PQ8 A;  1D1C A;  1Q3V A;  2KKV A;  3RJI A;  4A0X A;  5HOO A;  4K2E A;  2FLL A;  2W54 A;  1XO1 A;  4QZC A;  2WV0 A;  4NNJ A;  1PVR A;  2EZI A;  2X6W A;  3MEX A;  3SFI A;  1TQP A;  1UJ8 A;  5EEA A;  2ZG6 A;  2M5W A;  1OFC X;  5L1M A;  3RBE A;  2AGP A;  1YOV B;  4ECQ A;  1C0W A;  2W00 A;  1Z19 A;  3ZOB A;  4J19 A;  2F5E A;  4CHU A;  2OHF A;  2R5Z B;  1NKB A;  3RJG A;  1WYG A;  9ICF A;  4V2F A;  2ASD A;  1S9H A;  3F22 A;  2YSR A;  1JX4 A;  2CV1 A;  1L8O A;  3UQ0 A;  2XSJ C;  4DSJ A;  4HV6 A;  2DA2 A;  1FSE A;  3CC2 I;  4PPX A;  4NXZ A;  2QQB A;  1RYR A;  4FT8 A;  5ALW A;  4A12 A;  5III A;  4S04 A;  4DF4 A;  2LKX A;  3C2G A;  2BR0 A;  3U1K A;  1BPX A;  5AIB A;  3KZZ A;  5DM6 F;  3PSF A;  1UZC A;  1YG2 A;  2F5C A;  2W8L A;  2ALZ A;  4KLE A;  3LYS A;  2CMP A;  1Z7L A;  8ICM A;  1RR7 A;  1MMS A;  2CRG A;  4ETS A;  5CEH A;  3WU2 C;  5E3N A;  2HHW A;  3DPT A;  1QO0 D;  3MZ8 A;  4ZC3 A;  2DQL A;  5JR3 A;  4ENN A;  3RB6 A;  3QXG A;  3QUQ A;  2MRL A;  3R0J A;  3DKY A;  3FBN B;  2BCU A;  1NTC A;  2AH5 A;  3WKA A;  1HBX G;  4O5K A;  2Y0S F;  4KLL A;  2M1B A;  3OYN A;  1K78 A;  1ZAO A;  2Y1J A;  2YX8 A;  3DU6 A;  2G08 A;  1YTY A;  3IP4 B;  3K2Z A;  3F2C A;  3QPS A;  4BKX A;  3ZDC A;  4EZ6 A;  4Q48 A;  1BNP A;  3OYA A;  2X1D A;  4A3L J;  1KGS A;  1FIQ A;  1HQC A;  5ALM A;  1RXW A;  5CA7 A;  5KT3 A;  7ICS A;  2XAJ A;  2VOO A;  2ZNY A;  1JJ6 C;  2HOF A;  2MU2 A;  1BPB A;  4PUS A;  5CR0 A;  1XB4 A;  3TGN A;  2PX9 A;  4AWX B;  4E4H A;  2KJC A;  3CLQ A;  4A3K J;  1SXD A;  4CYC B;  5ALE A;  5GAG J;  1PK1 B;  5G5H A;  1SWW A;  1XC5 A;  2EBI A;  4LLL A;  4UAV A;  3JAM Z;  1KN5 A;  4ZYE A;  2KRF A;  1T98 A;  1QA6 A;  1K79 A;  4P4M A;  1WCL A;  2KVC A;  2LRE A;  4XBF A;  1F5S A;  1P9Q C;  4CXF A;  2KIU A;  2B0C A;  2FPK A;  1MNM C;  3E5X A;  3PW7 A;  3RH6 A;  1OKR A;  5ALV A;  2GWR A;  8ICQ A;  3RPU D;  5ILS A;  5AI4 A;  5KNI A;  5KG7 A;  5TGT A;  2P0W A;  5AM5 A;  5CJ9 A;  4UHT A;  3FXJ A;  1V5G A;  3QNM A;  3KFU F;  3R60 A;  4OAY A;  8ICF A;  3TDZ C;  2MAX A;  5D8K B;  2NRW A;  4C8M A;  4HV5 A;  1JJ8 C;  5FLM J;  4QWC A;  5L1I A;  3ASN H;  3GW2 A;  3ABU A;  3OYJ A;  3K4M A;  1BOA A;  4OD0 A;  5D5U B;  1W1W E;  4BQO A;  2VT2 A;  3JRA A;  3QPL A;  2KD1 A;  1VQL I;  1JXS A;  2ZC2 A;  2MAB A;  5J0R A;  2VBW A;  2WA0 A;  3I56 I;  4JUZ A;  2QBY A;  3Q8S B;  2FJ6 A;  4M9H A;  2A5Y B;  3S1M J;  3QYP A;  2NO5 A;  3RB0 A;  8ICR A;  3OIP A;  4BDY A;  1RKW A;  8ICS A;  1TBX A;  1NJX A;  5J47 A;  2NXN B;  9ICX A;  1MMN A;  3NRV A;  5CLS A;  3H9J A;  2E5S A;  2VLA A;  2A3S A;  4U0V A;  4ZDL A;  2HTJ A;  1VFC A;  2W3S A;  3H8M A;  2P6R A;  1PUF B;  4Y15 A;  1KYZ A;  3SQN A;  2WFA A;  3K1M A;  1JT6 A;  1R22 A;  5BQT A;  3LSJ A;  5J2C A;  1MJ9 A;  4CYD A;  2BW3 B;  4WXH A;  3Q5F A;  5ALI A;  1MA7 A;  4RQ7 A;  5K5R A;  4KMO B;  2FMP A;  1ZRE A;  5EZG A;  2E35 A;  3PSI A;  2VXZ A;  1YW7 A;  1EXN A;  4A3B J;  4UAU A;  4RPX A;  4IF4 A;  2Z33 A;  1PVE A;  2NS8 A;  4AVZ A;  3R0A A;  4Y33 A;  1FJL A;  2F4I A;  2ZIV A;  2ZUB A;  4JWN A;  2XAH A;  3JPP A;  4P55 A;  3ISD A;  5J2G A;  2BHZ A;  1R23 A;  2VT3 A;  2K4B A;  1XGO A;  1O4X A;  2GLE A;  5EEG A;  2YY6 A;  4NL9 C;  2XIC A;  1OPC A;  1ENH A;  2QVO A;  2H1L A;  2W48 A;  3DFG A;  3M8J A;  4LFU A;  2RP5 A;  3PX4 A;  5KFB A;  3DCF A;  4S0H B;  2MH2 A;  1SFX A;  2G7H A;  2ZXW H;  2VQC A;  4NQW A;  1Z00 A;  3DEW A;  2OCC H;  2P7C B;  3DEE A;  5FD6 A;  2XKP A;  3HIF A;  4KFC A;  2P6U A;  4OJO A;  3OSN A;  3ZR8 X;  3S8P A;  3KYC B;  4IPA A;  3TW7 A;  3AMZ A;  3HSE A;  3NTU A;  3RQI A;  2A6E F;  5DD8 A;  2IRF G;  4ZJZ A;  2CN1 A;  2IT0 A;  1XU4 A;  5J8F A;  2VOD A;  4AUX A;  1KFS A;  2IHN A;  4F52 A;  3FXR A;  3OS1 A;  1TZL A;  3BQT A;  3M7D A;  4GCV A;  3LSR A;  2L02 A;  1FZP B;  2ISZ A;  4E7I A;  2HI0 A;  5HNK A;  4I01 A;  2IOH A;  9ICJ A;  2DAO A;  3LK9 A;  3SV3 A;  4ELU A;  4USA A;  4BHB A;  3HUG A;  4AID A;  1L3L A;  5KFL A;  3G1O A;  3E5U A;  3WK4 A;  5J2I A;  2CV0 A;  1KFD A;  5DM7 F;  5DS9 A;  5KG0 A;  3IRU A;  3BDP A;  3N4M B;  1VTN C;  2QSG X;  2VBY A;  4EEF G;  4YCX A;  4M9J A;  5J0T A;  2RDP A;  1P92 A;  3T79 A;  1NK4 A;  1BNO A;  5AKG A;  4QWQ A;  3WU1 B;  1F1Z A;  2R7S A;  3FHN A;  4PZN A;  4J9P A;  2VJ5 A;  3RQ4 A;  4QIW C;  5D6F A;  1F43 A;  2AGO A;  3I58 A;  3PL8 A;  1E17 A;  4Z6D A;  1T0F C;  5AKY A;  2BCR A;  3D5R C;  4D9J A;  2F8L A;  4C2T A;  4CCO A;  5EG0 A;  4MIM A;  5ICF A;  1TNT A;  1OXJ A;  3H8J A;  1Z1B A;  3FK6 A;  3E6C C;  1STZ A;  5FGM A;  1ZQC A;  4TV7 A;  4F3O A;  1DOQ A;  5K5Q A;  5FRM A;  2AU0 A;  4OJ6 A;  3RJF A;  4W97 A;  1XN7 A;  4D7M A;  3S2H J;  3I71 A;  1RM6 C;  2KSO A;  2N8G A;  3F21 A;  5J2A A;  5DG7 A;  1MMA A;  2L9V A;  3E0F A;  3PO2 J;  2GZW A;  1RYS A;  2I8D A;  4JQF A;  1OCC H;  2Y31 A;  5ALQ A;  2DBB A;  2OM6 A;  3AFH A;  2A6H F;  4C3H J;  3M8E A;  1J0R A;  3I53 A;  1P7I A;  5LGN A;  2JEG A;  2VAN A;  2JV3 A;  1QQ5 A;  3H5R A;  1HW5 A;  4Q5S F;  3FXK A;  5JRT A;  4KDP A;  1PYV A;  4PZJ A;  2EK5 A;  1VF9 A;  1W36 D;  3G6E I;  4ED6 A;  1OJL A;  2NYX A;  4XL9 A;  1MIJ A;  3BZC A;  3P7N A;  1GDT A;  2LM1 A;  3L00 A;  2XCP A;  4KLF A;  4P1W A;  4RGX A;  3BTL A;  2W55 A;  3KZY A;  4YFK A;  2ISP A;  3QOD A;  1NK2 P;  2WB1 C;  4YP3 A;  3DLA A;  4MFC A;  4WX9 A;  3S32 A;  2R7F A;  3OMY A;  4BQN A;  1U6G A;  1N5X A;  2LYC A;  1Z4O A;  2VAS A;  2KV2 A;  2JHD A;  3L4P A;  5AM4 A;  3KYL A;  2R7Q A;  3BR6 A;  3IWF A;  1Z1V A;  2MUT A;  5EJC A;  4P0P A;  5F64 A;  2DMN A;  4M9S A;  1ECW A;  3EYZ A;  1ZRF A;  2BPG A;  2I10 A;  2HQR A;  5E79 C;  1OCO H;  4M6X A;  2NVT J;  3ZI4 A;  2VA2 A;  1MSF C;  2D3D A;  2F5F A;  3A0B U;  4DL5 A;  2E1C A;  1A6I A;  2E7W A;  2QEX I;  2C28 A;  1FIA A;  3F3X A;  2HXI A;  3LQR A;  1YX5 A;  2GXG A;  2V1D A;  5J2B A;  1ZRM A;  1Y39 A;  5AKK A;  5GPA A;  4BJ6 C;  1R9T J;  3TAC B;  1G3Y A;  4XRF A;  3L7W A;  1ZET A;  2AXL A;  3C18 A;  5E1X A;  2G0A A;  2VC0 A;  3FDY A;  5TIS C;  1MH4 A;  1NH3 A;  4DL3 A;  2DQN B;  2OJE D;  1BVS A;  3A01 B;  2V4Q A;  4KUM A;  2E36 A;  3PV8 A;  1QHH D;  3GX4 X;  5KFM A;  2FBH A;  2FJ1 A;  4E70 A;  3FZV A;  5KK1 A;  4EX7 A;  3GVA A;  1F0M A;  4ECY A;  2M30 A;  4P0Q B;  4A3G J;  9ICH A;  2ME6 A;  5DG8 A;  2LRD A;  2ZJR F;  4J9R A;  5KT5 A;  4J9K A;  4I2C A;  4OIN F;  4KT5 C;  1O7L A;  4C9Y A;  1AKH B;  4JK1 A;  2LK2 A;  4CCN A;  4LZD A;  2W9A A;  5E18 F;  5FLX K;  2O9L A;  1IJW C;  5HDN A;  2ELJ A;  4V19 K;  1FEZ A;  5F3X B;  4B6J A;  1VQP I;  3ONQ A;  2DTR A;  3K4J A;  5FKM A;  1IXR A;  5CP2 A;  4GO1 A;  5ILU A;  4O3N A;  3O6B B;  4ITV A;  4HSR A;  3A2K A;  1QZE A;  2XID A;  3PJR A;  2VA3 A;  1RG6 A;  2KIC A;  5J4Y A;  1J97 A;  3HRT A;  3S1R J;  2H8W A;  2M8G X;  2BXZ A;  3PZP A;  2BY0 A;  3LWM A;  3JRC A;  5DYM A;  3RF9 A;  4F2S A;  2HQ5 A;  1K5O A;  9ICR A;  3UQ2 A;  3G2B A;  1TVA A;  3MD2 A;  4B44 A;  4CF5 A;  3Q0W A;  1CGP A;  4XLA A;  5JFR A;  1MND A;  2KG5 A;  2X1C A;  2UWM A;  4Y52 J;  4FZN A;  5KFO A;  2PFQ A;  3UMC A;  1N48 A;  1COO A;  4LIV A;  4YXM A;  3UXN A;  4F71 A;  5AM2 A;  1ETK A;  1ZQW A;  1F36 A;  2IGM A;  2XAG A;  3AG4 H;  5AI8 A;  4PL1 A;  3RDI A;  3UMG A;  4M71 A;  4ABZ A;  2HBL A;  3LSI A;  3GYH X;  4YFX F;  3MZH A;  2Z99 A;  1R4N B;  2WB1 A;  2CSO A;  2VN2 A;  3M9M B;  5C5J A;  4F50 A;  1UA0 A;  5LRR A;  2PMZ C;  3UM9 A;  2YU9 J;  3M1C A;  4WXC A;  3QPH A;  3M6Z A;  3HG9 A;  4L5E A;  2M4G A;  3VCB A;  1J09 A;  4I98 B;  3TL4 X;  3N28 A;  4XID A;  2HTS A;  4N9I A;  4A2U A;  3QU9 A;  4DFK A;  4IL6 U;  2HOI A;  4RAG A;  3GDX A;  2RNJ A;  2OBP A;  2B0L A;  3RH4 A;  1BC8 C;  1ERD A;  4O3P A;  1ZQD A;  5AI6 A;  2MLK A;  2MA3 A;  3VOD A;  1UHM A;  2FD5 A;  2ZO4 A;  3O8H A;  1T8I A;  3H40 A;  3OSP A;  3BCA A;  1VDV A;  4Y2J A;  2AJQ A;  2JMG A;  2DA7 A;  1X6J A;  4NC8 A;  2I6X A;  1LPQ A;  3TAP A;  1XSV A;  5EEH A;  4R65 A;  1DGS A;  5E8G A;  3S15 J;  3CCY A;  2A07 F;  2EFN A;  4LOC A;  3H3V K;  2FQ3 A;  4YII A;  2LYB A;  5AK3 A;  4CO8 A;  3GV8 B;  5FKK A;  3WHB A;  1B72 A;  2BZF A;  1R6R A;  1IW7 F;  3DBL B;  4B8X A;  4RNN A;  4HST A;  2IAI A;  2KZM A;  2EH9 A;  3K1P A;  1XSN A;  5EE9 A;  1EV7 A;  3VSL A;  2GA2 A;  4B9L A;  4ELV A;  2IPQ X;  1OIS A;  4AM3 A;  1SWV A;  3EPI A;  2ZME B;  2DFF A;  2IGO A;  4DSE A;  3MGV A;  4G8X A;  3BS5 B;  2Y9Y A;  1A77 A;  4BQA A;  2HDC A;  1YJ9 I;  3P9I A;  1ZQE A;  4HX7 A;  4HRI A;  5KVR A;  2OA4 A;  4DYR A;  1KQ9 A;  4DGW B;  2CU7 A;  2E1N A;  1QZZ A;  3ELK A;  3GTJ J;  2BDP A;  2R7W A;  3FXM A;  4PJN A;  3WK5 A;  4U6P A;  2WAQ A;  1XSP A;  4Y7N J;  2WF8 A;  3KX2 A;  3CCV I;  1QSS A;  2WF7 A;  2IJL A;  5LGU A;  2K3P A;  1G4D A;  3JPS A;  3ZCO A;  3NWS A;  2WTF A;  3HPG A;  3ZRG A;  3A0B C;  2E8M A;  3WE2 A;  3FXQ A;  3L2W A;  2K4H A;  2FMS A;  1AA7 A;  2DA5 A;  3CQZ J;  2FDR A;  4IS7 A;  9ICN A;  3GME A;  1ZOL A;  2CUE A;  4X0G A;  1IN4 A;  4N4N B;  2KIQ A;  2NVX J;  2ZIX A;  4RQ4 A;  4QIW F;  3ZQC A;  3AG3 H;  4BQQ A;  4OJ5 A;  4YMM A;  3Q8R B;  2LLK A;  3C5F A;  2JEF A;  4Q8E A;  2VPL A;  1YE9 A;  3CUQ B;  4AYB C;  3OYI A;  4DQI A;  1VI0 A;  2RRE A;  1SD7 A;  1FY7 A;  2KHQ A;  2QYO A;  3PML A;  4I2A A;  1U9N A;  3ZMU A;  3CC7 I;  1QTM A;  4L0Y B;  5ERI A;  4DSF A;  1SL1 A;  2OC6 A;  4UV8 A;  5ALG A;  9ICA A;  3C7J A;  2DJI A;  5DV5 A;  4A93 J;  1D8B A;  1HOM A;  3QU5 A;  2F4O B;  4B09 A;  1N25 A;  1TTY A;  3SZ2 A;  3E2E A;  5J8Y C;  1XGM A;  4E7L A;  4E7K A;  4XIC A;  1G3T A;  3WE3 A;  3T5H A;  3GFL A;  3K75 D;  3QZ8 A;  3C3W A;  5F0F A;  5EDN A;  1IM4 A;  4CCK A;  4BH9 A;  4ZZD A;  2DF4 B;  2A05 A;  1UHS A;  5ICC A;  9ICO A;  5E8I A;  3LAP A;  3C2L A;  4LVS A;  3OOP A;  1HIW A;  4JV1 A;  4QSH A;  2L9R A;  3KP5 A;  2A6T A;  1U48 A;  1KU2 A;  4CZZ A;  3TKA A;  1ZQM A;  4NLC A;  1H89 C;  5KG1 A;  1SFU A;  1PUZ A;  4QWE A;  1T7P A;  3EYI A;  2WB1 F;  2A1J A;  2W82 A;  2V9W A;  3NAR A;  2UXX A;  2ZME C;  3SR6 A;  2GIV A;  5J29 A;  4NLG A;  2M9H A;  4GRI A;  4B47 A;  3VB2 A;  1Y88 A;  3I59 A;  3JRG A;  1OR7 A;  4HZF A;  3K0L A;  3MFH A;  2RDJ A;  1L6N A;  2W9B B;  3ZN0 A;  2FMQ A;  1OYY A;  3GV5 B;  3K4K A;  5CKT A;  3IRQ A;  5JVG F;  1MBK A;  2LMD A;  2ID3 A;  2QKL B;  5LHH A;  3CCU I;  2KHM A;  4M3E A;  1SEU A;  1YZ7 A;  3MVP A;  4BYY A;  9ICI A;  9ICG A;  3VWB A;  3TAD C;  4XMY A;  2E8O A;  4QIW N;  3KZX A;  5FKL A;  2KP6 A;  4MEX A;  3HRU A;  2BXY A;  2XVC A;  1LVH A;  1QPM A;  1JKQ C;  3AM9 A;  1LDJ A;  4IL6 C;  1J5Y A;  5L1K A;  5IP6 A;  4QLC U;  2RVC A;  4GXK A;  4EM1 A;  2O03 A;  4JOM A;  1WSU A;  1QSY A;  4A69 C;  2VJ4 A;  1H9G A;  3B73 A;  3CDL A;  3DP7 A;  2HYF A;  1UG0 A;  4PFP A;  3G1L A;  5IOY A;  4IQJ A;  2XAF A;  4YR3 A;  3MKY B;  2LBO A;  2ME0 A;  2QEN A;  1YX3 A;  1FYL A;  3VOE A;  4R79 A;  3W2A A;  2FEZ A;  7ICK A;  3OSG A;  2EB7 A;  2K8B B;  1NNL A;  2GAU A;  2KJ8 A;  2M0N A;  3OL4 A;  4BE0 A;  1KKX A;  1YS6 A;  4RAY A;  2XSD C;  4P4O A;  3BJ6 A;  3H36 A;  3BG6 A;  3EQL F;  1SD5 A;  1VZ0 A;  3RKQ A;  4P5O A;  4YG2 A;  4R1H A;  1Y0U A;  4CZC A;  1T2K A;  4H4K C;  1S72 I;  2RNG A;  2V7F A;  3OYE A;  5AK6 A;  1SAX A;  2NOG A;  2CG4 A;  3C29 A;  1SD6 A;  2BY3 A;  1W7P B;  5HR6 A;  2K27 A;  5F9N A;  5CQE A;  4A8E A;  4QZ8 A;  1HUO A;  2XPV A;  1B0X A;  2CQX A;  3KZI U;  1MBE A;  1LVK A;  3I4N J;  1BI3 A;  2QQ8 A;  4MFD A;  1GO3 F;  2WB1 N;  1U9L A;  4IX7 A;  3H3U A;  2WAQ F;  3H4D A;  1B59 A;  3GFI A;  2EV0 A;  3WKE A;  1R58 A;  4FZM A;  4EYI B;  2C2E A;  3FC4 A;  4O3S A;  1LJ9 A;  3A0H U;  4UUV A;  4RQN A;  4M47 A;  2H27 A;  3AAF A;  3B6A A;  5K5O A;  2D1V A;  1BC7 C;  1U3E M;  2EZY A;  1QQI A;  3VSK A;  2R3S A;  2HKX A;  1WI9 A;  3M07 A;  1FTZ A;  1IN8 A;  1H88 C;  4Y2Q A;  4L5J A;  7ICP A;  3PX6 A;  3EZ5 A;  2BV6 A;  4N4O B;  4XLE A;  1Z91 A;  2XGE A;  2JA5 J;  5AI0 A;  5A0L A;  3PQK A;  2XPU A;  5DBA A;  1ZR4 A;  1XSX A;  1YW8 A;  2V9V A;  4BEH B;  4O3O A;  3I64 A;  3ZN1 A;  2AQ4 A;  3LSK A;  1JT0 A;  2P5L C;  3P9C A;  4Z6Y A;  2PI0 A;  2EFO A;  3MBY A;  4GYG A;  1CQT A;  3SAH A;  4QW9 A;  1YI2 I;  1RYU A;  2PBI A;  2XC9 A;  2DBY A;  1Z3E B;  3F8B A;  2X0L A;  3QZ7 A;  4U0W A;  1ZQU A;  1IDY A;  4O3R A;  1UEL B;  3GO5 A;  4XLP F;  5K4L A;  5BPI A;  2NRZ A;  2HYJ A;  4LG0 B;  5AK5 A;  2B9S A;  3IH4 A;  2VBX A;  2VKV A;  4U7D A;  4HYK A;  5E1W A;  4HAI A;  3HOZ J;  2K89 A;  5BPD A;  1VQ4 I;  1KEJ A;  4EM2 A;  3IHQ B;  2IS4 A;  1XMA A;  1IAW A;  5J1R A;  1S97 A;  2GBY A;  2V9K A;  1LKY B;  4IOA F;  4KN7 A;  4JX6 A;  5B1A H;  3SJM A;  3OTQ A;  2XB0 X;  3FM5 A;  3HYI A;  4EBD A;  3NS1 A;  3EUH C;  1Y6I A;  5DD4 A;  4KIS A;  2E1F A;  3TFR A;  1GVJ A;  2HPM A;  4F5P A;  4YR0 A;  3W2W A;  2LG4 A;  2WAQ N;  1BW5 A;  4U88 A;  3QX7 A;  1TWG J;  4RBO A;  3JRI A;  2ID6 A;  1FT9 A;  2MBF A;  2AQ0 A;  4MF8 A;  4TUS A;  1BPD A;  2E3T A;  1IN5 A;  2CW7 A;  2VKQ A;  4C0Z A;  1KQQ A;  3PNC A;  2ODG A;  2QB0 A;  3BQY A;  1MDM A;  5LRS A;  3GII A;  3TFS A;  2MLG A;  1RES A;  3L09 A;  3RPU A;  4MFF A;  1DQU A;  5M3M J;  3GCM A;  1XGS A;  1J59 A;  5ALF A;  5DGB A;  6PAX A;  4XQ8 A;  3TO6 A;  1PVP A;  4FX0 A;  5J2F A;  2Y0S A;  3M8F A;  1I1S A;  4MEX F;  4JX5 A;  1C7Y A;  2E1M B;  5KL1 B;  1JAL A;  2W11 A;  1X3U A;  2M87 A;  5LHI A;  3GTL J;  1CI4 A;  3CCL I;  1VQ5 I;  1HXD A;  4FAS D;  1NI3 A;  4O3Q A;  4B9N A;  1Y1W J;  2C2R A;  2VKD A;  3CCM I;  4ECZ A;  2A69 F;  2E2J J;  1LB2 A;  2E8P A;  2FPL A;  1F5T A;  4NLB A;  3N97 B;  4E7Z A;  4J00 A;  1FTT A;  1JHF A;  2ETH A;  3AN1 A;  4F5N A;  5L3D A;  1FOX A;  3BPV A;  3SFZ A;  2RQQ A;  3HSF A;  4U87 A;  4EYH B;  4AYB F;  2E1E A;  5J4V A;  5E3O A;  1W0T A;  5J2J A;  3IL2 A;  1E3O C;  8ICW A;  1LE8 B;  4YVZ A;  4C4S A;  4OWR B;  3RZD J;  3I76 A;  3HHG A;  4YG2 F;  1B43 A;  2OPT A;  1T33 A;  2X51 A;  4HA8 A;  4J9N A;  4DSI A;  4PJL A;  5HDG A;  9ICL A;  8ICT A;  2DOD A;  3BZ6 A;  2Y69 H;  2EV6 A;  2KOB A;  2NNN A;  1J2N A;  3T8R A;  4EV0 A;  1XSL A;  3WTZ A;  2YMP A;  2DOF A;  2Z7J A;  2F4M B;  2FRH A;  5IYD J;  5ALZ A;  1S76 D;  3HBL A;  3W6J B;  3ZQH A;  1IGN A;  4HEA 2;  2M7A A;  2KE7 A;  3PSP A;  1USS A;  5ICG A;  3SYZ A;  2K40 A;  2V1N A;  3EET A;  4OU0 A;  3N05 A;  3OJS A;  3RPQ A;  2DK8 A;  4AIH A;  4DL2 A;  3KZI C;  2PEX A;  2LM4 A;  2CUF A;  1SFE A;  1X4O A;  3GEZ A;  2HQN A;  2M4K A;  3EUH A;  3JR9 A;  4GXI A;  2EZL A;  4F2R A;  1S77 D;  4IQT A;  4C30 A;  1SZH A;  2Q1Z B;  3E6D A;  3NAU A;  5C4J J;  1YFH A;  2EDU A;  3A0H C;  3DKW A;  4PFO A;  2ADU A;  4AU7 A;  3R9K A;  4MHV A;  5ALR A;  3S2D J;  4B3X A;  1X2M A;  2LYH A;  4YMO A;  1Z3X A;  1S0N A;  5CVU A;  2PJR B;  1JI8 A;  3HB9 A;  4S05 A;  1TW3 A;  2LY9 A;  3DDH A;  3WK8 A;  4YD1 A;  1IXS B;  2FNA A;  5JHU A;  4BUG A;  4F4W A;  2LTP A;  1Q1V A;  4JX4 A;  1VQK I;  3HP6 A;  1BGX T;  2CQQ A;  3PW4 A;  4HDU A;  2VQG A;  4AIK A;  3T3F A;  1FO4 A;  2WF6 A;  3M3Y J;  4D5C A;  1ZQI A;  2LFB A;  2O8X A;  4XNF A;  4AYB N;  4BAC A;  4HDV A;  3PFY A;  1IUY A;  5AM0 A;  1TK5 A;  2HWV A;  1SV0 C;  3BR1 A;  2C2D A;  1I3Q J;  1WH5 A;  2LF8 A;  1S8O A;  3G6X A;  3CME I;  4UB6 U;  2QWW A;  3I0T A;  2Z2S B;  4GC7 A;  3BPX A;  3M9A A;  4FIS A;  5DEQ A;  1T38 A;  2IS2 A;  3L5K A;  3HOX J;  1TW2 A;  1Z9C A;  2KPM A;  4I2J A;  2JRM A;  4XA5 A;  3JPT A;  2K85 A;  3I9V 2;  1ZD3 A;  2H1K A;  4Y2V A;  5HLT A;  3RJK A;  5M5X J;  5J6X A;  1GXP A;  4DQ2 A;  4UAW A;  1Z00 B;  2AGQ A;  4KLT A;  2RV8 A;  5DUK A;  4JWM A;  3CDH A;  1Z77 A;  4KIB A;  4XOR A;  4D5F A;  3QAH A;  3ZGK A;  2B63 J;  2R7O A;  4KMF A;  3ORY A;  2Q0O A;  1BJA A;  5F0C A;  4II3 A;  2WAF A;  4HPQ A;  1QQ7 A;  1SB3 C;  2BGW A;  1NK8 A;  4CF4 A;  2AO9 A;  2JPB A;  3BT9 A;  4ED3 A;  4XSX F;  5ALY A;  3TP0 A;  4CSW A;  1V55 H;  3LNQ A;  1FFU A;  1SC7 A;  5ALU A;  3WK6 A;  4MTE A;  4U7C A;  2LKY A;  2PI4 A;  1FWZ A;  1KA8 A;  1T56 A;  2KIV A;  2ZIU B;  4MQ9 F;  1WZ2 A;  3KKA C;  3H3Z A;  3H4B A;  2V9P A;  2XF6 A;  1NJY A;  8ICO A;  2UVU A;  3HM5 A;  2NRA C;  3ZDE A;  1RPW A;  2E5Z A;  1I6X A;  3HRM A;  1TWC J;  3DQV C;  2W7O A;  1TQI A;  4M9Z A;  4U7B A;  4LJZ F;  3TED A;  2O6G E;  3ZD9 A;  3JRB A;  3KP6 A;  1D0Y A;  2KDO A;  5ALS A;  3RAQ A;  3HZJ A;  4EEL A;  4ED1 A;  1U5T C;  2VA8 A;  4YEL A;  1JI7 A;  8ICN A;  2DT6 A;  1ZD4 A;  4XOP A;  1W4M A;  1LUJ B;  3ZDD A;  2WBM A;  4FHT A;  3MFI A;  1SFO J;  1AQ6 A;  3T5X A;  3FAH A;  4IQW A;  4A5N A;  2RGV A;  5KAF U;  1RI7 A;  3K1Z A;  3U1D A;  3R4K A;  4XR6 A;  4GDF A;  1V54 H;  2CW8 A;  4Z2Y A;  4BUP A;  1JRP A;  3H1C A;  3OYM A;  3HRD D;  3CYM A;  2YUS A;  1LEA A;  3GTG J;  1JTY A;  1A6Q A;  1PJR A;  1FC3 A;  2Q2E A;  2JA2 A;  4F91 B;  1FNN A;  1U0J A;  4F55 A;  4L9T A;  4ED8 A;  4O9M A;  3BS7 A;  2ZBK A;  1T3N A;  4D1Q A;  5KL8 B;  5KFK A;  3C2K A;  4QZG A;  1X9M A;  2KKO A;  4RAZ A;  4FTH A;  4M9N A;  1MNE A;  4G6Q A;  4G94 A;  1RRJ A;  4CF3 A;  3F2B A;  3L1P A;  1V9P A;  3C2M A;  3TOA A;  3QUC A;  5DDM A;  1IXC A;  3GIL A;  3RJJ A;  4G12 A;  1BBY A;  4YD2 A;  2RAE A;  4YQW A;  1ZQ3 P;  3SEZ A;  2VQH A;  3GTP J;  2JSP A;  1DUX C;  2ZJP F;  2LI6 A;  2JJ7 A;  2PFB A;  2JQ7 A;  3D1N I;  2ECC A;  4HOB A;  3WTY C;  2CGP A;  4M6V A;  3W6K B;  3ZMT A;  5J0Y A;  1B8I B;  2LBF B;  3SAG A;  4DSK A;  2COM A;  2DYS H;  4NB5 A;  3CDI A;  2OYY A;  2ESE A;  1L3U A;  2N1R A;  2EAM A;  3IKV A;  3Q9V A;  4G7Z F;  1S9F A;  2WV1 A;  2DKZ A;  5FP0 A;  9ICW A;  3LSH A;  2CUZ A;  2Y0S N;  5D46 A;  1HW1 A;  3GUD A;  2HEO A;  2W3R A;  5E79 U;  4B9U A;  1FX7 A;  3RJH A;  5KG5 A;  3NVV A;  4ZH4 A;  4F3Q A;  2PKE A;  3GZN B;  3O3K A;  2E34 A;  4BXU A;  2W04 A;  2NRV A;  4OMZ A;  2OU2 A;  3QUB A;  4BXX J;  2PFP A;  1HST A;  2HOE A;  4QZE A;  4UB1 A;  1VQ9 I;  5K7Z A;  2FML A;  1N77 A;  4DWI A;  9ICT A;  4M0A A;  2QKM B;  4DOZ A;  3IV6 A;  1MMD A;  5DCF A;  3GTK J;  1MN8 A;  5CVI A;  3U9G A;  4M6W B;  5TIS U;  5KFN A;  3HX0 A;  3AU6 A;  4BU2 A;  2LKP A;  2OZ6 A;  1A31 A;  2DFL A;  2LMR A;  1I27 A;  3N7S C;  4CNQ A;  1ITY A;  4YFN F;  2ISY A;  1K1S A;  5EOZ A;  3V72 A;  5IP7 J;  4FE7 A;  3Q8M A;  3QP6 A;  2R8H A;  3HRS A;  5DG9 A;  1WI3 A;  2H6C A;  1T6S A;  2YS9 A;  4RQM A;  2EIK H;  1JGS A;  2MC4 A;  2H5X A;  1NK7 A;  1IN7 A;  4UNO A;  2Q0Z X;  2O5R A;  3TAQ A;  3PO5 A;  3CRX A;  3ZD8 A;  2CXY A;  3BR0 A;  1ZQG A;  5FD5 A;  2MC3 A;  3PUB A;  3VYT B;  1O08 A;  4PJ0 U;  4M6Y A;  3GBG A;  3FK7 A;  4QW8 A;  4DOB A;  5D49 A;  4RLQ A;  2XGP A;  4RPZ A;  5KFC A;  1QNT A;  2KK0 A;  5DQH A;  4UB6 C;  3J80 K;  2YTU A;  1TWF J;  3PST A;  5HMM A;  1IV8 A;  5KFH A;  5B66 U;  3M8S A;  1NK5 A;  4B1R A;  5BOX A;  2D6F C;  4GGG A;  2A1A A;  1U45 A;  1QLN A;  2DL0 A;  2W03 A;  2A68 F;  4ANJ A;  2WC2 A;  5L3B A;  3S3O A;  3GWZ A;  2R7T A;  1W7P D;  1Q46 A;  5ALK A;  1KDH A;  4M9L A;  9ICK A;  2JT1 A;  1A0P A;  2FQ4 A;  5DB8 A;  2R7U A;  2R5Z A;  3QOP A;  2UVV A;  1O3R A;  4NLK A;  3HOW J;  2YMQ A;  3IDW A;  1HKT A;  5CHG A;  2HVH A;  2J6T A;  3NRZ A;  4QPQ A;  4US8 A;  3KPH A;  5CRX A;  2D45 A;  2P8T A;  3ULQ B;  1JE8 A;  4LK1 F;  3UXO A;  1K61 A;  1Z4N A;  1MBJ A;  2XGX A;  2K4P A;  2PLY A;  3PMN A;  3QU7 A;  3Q0U A;  5L1L A;  3ASO H;  4BBR J;  3CCR I;  4AD9 A;  4BJT A;  3PO4 A;  1AWC A;  3MGI A;  1T94 A;  1S0V A;  3SXY A;  2WF5 A;  2ISO A;  3OSF A;  1JIH A;  8ICB A;  1N75 A;  4BXO B;  1S7O A;  1S3J A;  3BLY A;  1DP7 P;  5F1J A;  2DK5 A;  3HXL A;  1VQ6 I;  4YMN A;  2DYR H;  3HEF A;  3ZQ7 A;  4IZZ A;  2L7M P;  4IHT A;  4KN4 A;  4QWB A;  3EYY A;  2V6E A;  1N2X A;  1X40 A;  4OIO F;  3M4O J;  3ONN A;  1Z21 A;  1ZG3 A;  2XB5 A;  3OGU A;  3S14 J;  4P9U A;  3NAS A;  3LMM A;  1ZR2 A;  4FE3 A;  5KAF C;  1WCN A;  9ICE A;  1H8A C;  1X2N A;  2KIW A;  5EWG A;  1YZ6 A;  1UT8 A;  1KYW A;  3HL2 A;  1V5E A;  1YRN B;  3RIR A;  4DLE A;  3KP4 A;  1SD4 A;  5KT2 A;  1B1B A;  1BOB A;  2HBJ A;  2JVH A;  1K4T A;  1ZN2 A;  3E5Q A;  1EH6 A;  3G71 I;  2KFD A;  4ESJ A;  5KFI A;  5CVV A;  3RZO J;  3GU3 A;  4DZJ A;  1W5C C;  4PZO A;  2BQR A;  4CYC A;  3IHU A;  1PK1 A;  2NRT A;  4ED0 A;  1SKR A;  1X3Z B;  3LWL A;  5FRN A;  4CRX A;  2NAZ A;  3MKW B;  5D4R A;  3SAF A;  7ICO A;  2Y75 A;  1LFB A;  2JRZ A;  3LQQ A;  4DIQ A;  4NL9 A;  4NV0 A;  1WH7 A;  1LV5 A;  3HPH A;  1DK2 A;  4UUS B;  2UV1 A;  4QZA A;  2X1E A;  1KL9 A;  4ZZL A;  2EFQ A;  5IP9 J;  3VFZ A;  2ZJ8 A;  1XSD A;  3ICX A;  3OPX A;  4ZH4 F;  1J7K A;  9ICQ A;  3EUA A;  4R8U B;  2L4M A;  1ZYQ A;  5KFA A;  3QE9 Y;  1Z3Y A;  2JEI A;  3PNY A;  2IA2 A;  3V6H A;  2BHY A;  3RKW A;  2VB6 A;  3K6G A;  4YEJ A;  3HPO A;  3GTQ J;  4YR2 A;  2ACJ A;  1FOY A;  7ICM A;  3E58 A;  1YIO A;  3UR3 C;  3EWA A;  2EAN A;  4K4I A;  2F1H A;  3GLX A;  5FKN A;  4XN3 A;  3T8T A;  1S10 A;  1P7D A;  5DCM B;  1B9N A;  3LAJ A;  3HKZ C;  3SZP A;  2QAR B;  3RR8 A;  2KFZ A;  1L0O C;  2HVS A;  5DKW A;  4KLS A;  2R8G A;  4FCY A;  4ZDO A;  1COK A;  2A3V A;  3ZDB A;  3WOD F;  5KFG A;  2JA7 J;  3J80 Z;  3PR5 B;  3J7Y J;  5J1U A;  7ICJ A;  4IRK A;  1O57 A;  1X2I A;  3K70 C;  1WVR A;  2MG4 A;  3LFK A;  3Q9S A;  1OCP A;  2CUJ A;  2XRL A;  4RQ0 A;  5HP4 A;  2ZNZ A;  5AIQ A;  1GV2 A;  4I2G A;  3H35 A;  2V1U A;  2JSC A;  2L5Y A;  4PJM A;  1ONV A;  5CVR A;  1YO5 C;  1PUF A;  1WJF A;  1DU6 A;  1T0F A;  3H5A A;  4HYE A;  1GVD A;  3WGG A;  2XC7 A;  2QB1 A;  1T39 A;  2DDB A;  3MAJ A;  4TUR A;  3BQ1 A;  2DA6 A;  5D4B A;  4PJ0 C;  3P9K A;  3R6S A;  1YQA A;  5IY5 H;  1RQL A;  1XMK A;  2BW3 A;  5J2D A;  1MBH A;  4WWC A;  3AUO A;  4MEY A;  3RKY A;  5B3S H;  3I1Y A;  1B22 A;  1EKE A;  3DF8 A;  2ECB A;  4P9F A;  5B66 C;  3FXU A;  4N0B A;  2M9N A;  4I0B A;  2M8E A;  4LG3 A;  4C8N A;  2VC1 A;  5JTI A;  4O5E A;  2P66 A;  2XF7 A;  2DGZ A;  2P35 A;  3BDD A;  2ZUC A;  4PHD A;  1ZEL A;  3KBB A;  1X19 A;  8ICZ A;  7ICQ A;  1Z05 A;  1I1G A;  1SFK A;  4C7Z A;  5HLI A;  3PW5 A;  1F9N A;  1BL0 A;  2G09 A;  2XI9 A;  3ZDA A;  1WJB A;  1ZQ1 C;  4C2U A;  5HS8 A;  3G6Y A;  2CQK A;  3HT3 A;  4NC7 A;  1DP3 A;  3T5L A;  2CO5 A;  3B0Y A;  4GFB A;  5TRD A;  5DQI A;  4O5C A;  5EE3 A;  1QVT A;  2FBK A;  3F53 A;  5IPA A;  4RQ6 A;  2VI6 A;  2LY1 A;  3QUT A;  3Q8K A;  1BPY A;  1IRF A;  4BDP A;  2ZKZ A;  2O3F A;  2DUY A;  3BG3 A;  4JBA A;  4XKV A;  2KZG A;  1S5L U;  3O0F A;  3K4B A;  4JK1 X;  4J9S A;  5ALH A;  1D1B A;  2IMW P;  4I2B A;  1JTX A;  1UQV A;  1I39 A;  1G2H A;  4RT2 A;  3I4M J;  1WHU A;  1KSP A;  2NRX A;  2V4R A;  1KRP A;  5HVQ C;  5GAD J;  5LHG A;  5KG2 A;  2EZZ A;  2RKH A;  1ZTR A;  3EUK L;  1HLV A;  1ZQS A;  2L54 A;  1I5Z A;  5TJJ A;  1FEX A;  1ZG1 A;  2Y9T A;  1RZ4 A;  1RET A;  2DFE A;  2W84 A;  3Q3S A;  4M3D A;  2ES6 A;  1Q3U A;  5HLH A;  4EBE A;  4BJQ A;  1JHH A;  3QU3 A;  5KFR A;  4KIT B;  2C6Y A;  3WHC A;  5AKL A;  1Y8Q B;  5DBC A;  3MGH A;  3RJE A;  3BTJ A;  1EH8 A;  2KKP A;  1XDU A;  2R5Y B;  4MF2 A;  2XGC A;  2MW8 A;  2JTV A;  3M7G A;  2EIJ H;  4PGG A;  2F1J A;  4PHP A;  4CIC A;  3DV8 A;  2FBI A;  2L3D A;  4XON A;  2EA4 A;  4IR1 A;  3WTT C;  3JRE A;  1X9W A;  1KU3 A;  3G3Z A;  7ICH A;  1FYM A;  2XIG A;  4UY8 I;  2JZB B;  4K4G A;  1KQ0 A;  1WJD A;  3RCO A;  1ZH5 A;  4BBS J;  2NNY A;  3LL7 A;  1OQY A;  3F8C A;  4C8K A;  4MNU A;  3I4P A;  3OV8 A;  4IRG A;  3LA3 A;  2FMY A;  2JUC A;  5EGO B;  3WK9 A;  3WKD A;  1N56 A;  2KMU A;  1IUF A;  1C20 A;  3W6V A;  2F48 A;  4AVP A;  5IIM A;  4M73 A;  4DL4 A;  2JPC A;  3T0Y A;  2W7N A;  3MR5 A;  4DLG A;  3NVW A;  4KLD A;  1OLT A;  2G7U A;  2LC2 A;  1ZG5 A;  1T4G A;  5A2Q K;  5T14 A;  3C5G A;  4CUG A;  2L9N A;  4HG2 A;  4UB3 A;  1JUD A;  1UPH A;  4A3I J;  4E0D A;  1V4R A;  4WJ3 B;  3CCS I;  4DEZ A;  4A3C J;  9ICB A;  4RPY A;  4AC0 A;  1O3S A;  5LGT A;  4G7H F;  1FFV A;  3JPQ A;  5GAH J;  1K4S A;  2R4G A;  2VOP A;  3LDA A;  4DSL A;  2EIM H;  5F9L A;  3EW9 A;  2YX4 A;  1ZQO A;  2UVW A;  3ML6 A;  4FS2 A;  8ICK A;  4KIC A;  4KA4 A;  2VQL A;  1H38 A;  4BX9 C;  1KTQ A;  2VXD A;  1NK9 A;  1WWU A;  3S3M A;  3UPQ A;  3H9G A;  2UZK A;  2W7P A;  1JXE A;  1ZQA A;  2O8K A;  5FLX Z;  1RR8 C;  2Q8K A;  4UQG A;  2A5W A;  3CD6 I;  4OCZ A;  3A1Y A;  2BYV E;  2DMQ A;  1EA3 A;  8ICC A;  2ICW G;  2W4S A;  4BXF A;  3L3F X;  5KFW A;  7ICL A;  1ZJN A;  1F44 A;  4RB0 A;  2HHX A;  2W57 A;  3CJT B;  8ICX A;  4EEN A;  3SHF A;  5DLF A;  1BI2 A;  2PMZ A;  3V7S A;  2R7X A;  4Y2T A;  5F08 A;  2B6G A;  5H2F U;  2IGK A;  2KZZ A;  1HCR A;  2F2E A;  4LD5 A;  2DA1 A;  4MEY F;  3MR2 A;  4C80 A;  4G9Y A;  3V6K A;  1TQM A;  2H3Q A;  4HQM A;  4L18 B;  3JSO A;  2D8C A;  2IXS A;  2Y2Z A;  1N78 A;  1CF7 B;  3RAX A;  3HDD A;  1HEK A;  5IIJ A;  5D5X B;  4UXN A;  5EF6 A;  2KHV A;  4F92 B;  3LFU A;  2WF9 A;  3KET A;  3GQC A;  4IJA A;  1BN5 A;  2WAE A;  4I99 C;  3DXJ F;  4KYW A;  2BHN A;  3SEI A;  4IHX A;  2LD5 A;  2QGU A;  1P4A A;  4B4C A;  1PP7 U;  4FZL A;  1EH7 A;  3A01 A;  2OCE A;  4EQQ A;  2PN6 A;  4LZG A;  2FX0 A;  4A3E J;  1S8N A;  3K2A A;  4HLX A;  4RGU A;  4ZTF A;  2JH7 A;  3RRG A;  8ICL A;  2KP7 A;  1V85 A;  4DQS A;  4P0Q A;  1VLB A;  3OYL A;  3ZMS A;  3C1Z A;  2DKX A;  4JB3 A;  1BIA A;  1AKH A;  3MWM A;  4G7O F;  2R8I A;  2VJI A;  2STW A;  1SXE A;  3W3C A;  2K4I A;  4DQQ A;  2J6S A;  2HHV A;  4IRI A;  3ECH A;  3RFA A;  3WTW C;  3GIJ A;  7ICV A;  2KL4 A;  5D5W B;  1SIJ A;  1ZQP A;  3HKZ F;  2XGD A;  3E1S A;  3I28 A;  4C3I J;  4IQU A;  5J0O A;  2HS5 A;  4YIF A;  5J2H A;  1QZY A;  5FO5 A;  3GZ6 A;  4DFM A;  3JCU C;  3T5K A;  1S5L C;  4MFE A;  1WG8 A;  2HKO A;  3TO7 A;  4EJW A;  3UXP A;  4J9L A;  7ICT A;  1RPL A;  2IOF A;  2XVT A;  1HSJ A;  3QYB A;  1W5T A;  3F23 A;  4I2I A;  3PR4 A;  2R7R A;  4MTD A;  4EZ9 A;  2O7O A;  4L0Z B;  4KLH A;  2RQP A;  3GIM A;  2X6O A;  5AHX A;  1ARO P;  1ETQ A;  2ZIW B;  4P96 A;  4KX3 A;  2BQU A;  2COB A;  3KHL A;  4ECS A;  1ZJM A;  9ICU A;  3C1D A;  3V6J A;  4KNY A;  1MBG A;  5BNG A;  3OYF A;  2H3F A;  4B9S A;  1Z67 A;  3BP8 A;  2IVM A;  4KIF A;  1VJ5 A;  5EWF A;  4GLX A;  1YLF A;  1X1B A;  4UW9 A;  2RC4 A;  3CUQ C;  2L7Z A;  3CJN A;  3ISP A;  4E7H A;  1O7F A;  2QQ9 A;  3CP2 A;  1URJ A;  2G5H B;  4AYB A;  4Y2Y A;  9ICV A;  3KIO A;  2YN4 A;  2BVM A;  3QPT A;  4IVN A;  2ESH A;  1VQN I;  2BCV A;  1ETW A;  2M45 A;  4WK8 F;  1ZQJ A;  4UB4 A;  3OYB A;  2LYA A;  5BOM A;  4GFJ A;  3OS0 A;  3QU4 A;  5CPR B;  5EE0 A;  3FXL A;  2BKE A;  4BL0 B;  1FBQ A;  1YHQ I;  4ECX A;  2H3V A;  1ZQX A;  1ZD2 P;  4IRH A;  2FPM A;  1AOY A;  5HML A;  3BOQ A;  1Y0N A;  4EGY A;  2FA5 A;  2ESN A;  2JRT A;  4HF2 A;  2KVS A;  3NWT A;  1OMI A;  3JRF A;  2ZJ5 A;  1ZQV A;  5J8Y A;  2KN7 A;  1MQ2 A;  2DTZ A;  3PIP F;  3KHG A;  3D6J A;  1D9F A;  3C21 A;  4XLN F;  1SVM A;  1HUZ A;  3FF5 A;  2AHO B;  2HZT A;  1E2X A;  5L9X A;  2LVS A;  3K70 D;  1LNW A;  2X6Y A;  3CJR B;  2IBD A;  3AG1 H;  4IHW A;  4LLN A;  1TV9 A;  3S17 J;  5KFS A;  2QA4 I;  1RUN A;  3QU2 A;  2BBY A;  5M5W J;  4XSZ F;  5HS7 A;  5KNL A;  4IR9 A;  2PG4 A;  2Z16 A;  5HNH A;  1KU7 A;  3KHH A;  2JGA A;  2IBK A;  4M9X A;  2XGQ A;  4M04 A;  2ZME A;  1WJA A;  5KFP A;  4M3B A;  2PMZ F;  3RBD A;  3BS5 A;  5J0S A;  3AKZ A;  2LDU A;  2ZTD A;  1S0O A;  1E3P A;  3H8W A;  2KZV A;  1O03 A;  1OCT C;  1NK6 A;  1B4F A;  2HCF A;  5B5E U;  5KFQ A;  4QZB A;  1QGP A;  1IV6 A;  4PDK A;  3F5A A;  1NG6 A;  3F6V A;  1JKP C;  2GOM A;  1D5Y A;  3M1Y A;  3TAD A;  2M7B A;  1IC8 A;  1R36 A;  4MLO A;  3BWG A;  4M74 A;  3HOT A;  3PVX A;  3HOY J;  5H2F C;  3V7L A;  4RAF A;  2UXN A;  2HQA A;  3V7C A;  3TKY A;  5JI6 A;  2J5O A;  3PM1 A;  2Y9Z A;  1JN3 A;  2OTJ I;  2KJ5 A;  1ZD5 A;  2ZSH B;  5ILV A;  2Q4T A;  4I2E A;  4RQ5 A;  2H3I A;  5J1Y A;  2IHM A;  4HAM A;  1QH9 A;  4Z6F A;  4RS8 A;  1R5I D;  1KU9 A;  4QZI A;  2ATL A;  1NJW A;  1T3Q A;  3D2Q A;  4JV2 A;  2R7Z J;  3O2P E;  5ALP A;  2QZ8 A;  1UCV A;  3CUQ A;  1JGG A;  1ZHF A;  2OV7 A;  3Q8Q B;  3B9J A;  2JVG A;  4NM2 A;  3ZMV A;  1AU7 A;  2NOJ B;  3SYT A;  2VKE A;  3BR5 A;  4LK0 F;  1L8L A;  1L7O A;  3ABM H;  2HHT A;  3BQ0 A;  1SL0 A;  4BWJ A;  4BJ5 C;  3WTS C;  1KON A;  3TMO A;  2PJP A;  2RLT A;  1Z7U A;  2KJB A;  4HBL A;  4PGH A;  1OCZ H;  4RM2 A;  2KT0 A;  4RM3 A;  5KT7 A;  4RGR A;  4DNC A;  2XAU A;  1K78 B;  1RC9 A;  1TLH B;  5EE1 A;  4QJF B;  5KFZ A;  1GHC A;  4DFD A;  2XPW A;  5EZH A;  3S3N A;  5KT6 A;  2AQF A;  2GOL A;  4R66 A;  1FMV A;  4KLQ A;  1ON1 A;  1FIP A;  4FE4 A;  1XWL A;  3RI4 A;  1FP2 A;  1FPQ A;  2KFN A;  2TRT A;  5FFX A;  5J2E A;  1B9M A;  1PK3 A;  4HNT A;  3CNH A;  4C8L A;  3RRH A;  4A3M J;  2PMZ N;  3MAB A;  3HW8 A;  5FB2 A;  2DN0 A;  4WCG A;  2K86 A;  5AKJ A;  1TAM A;  1B6A A;  4BY7 J;  2W85 A;  3ZQF A;  2XDV A;  4KN7 X;  2HDW A;  1K6O A;  2L7F P;  5AON A;  4ZOH C;  1TK0 A;  1LFP A;  1WGX A;  2IS6 A;  5CWR A;  5IYC J;  1W5S A;  1WPK A;  3BG5 A;  1SZP A;  1MW7 A;  3NUQ A;  2YX7 A;  2E5N A;  2Z1D A;  3LOC A;  4G6T B;  4I0A A;  4ECV A;  2ASJ A;  2PFO A;  1NK3 P;  4UAS A;  1D9D A;  4I2O A;  3M9N B;  2W9B A;  2D5V A;  1QPI A;  3B0X A;  9ICP A;  2NS0 A;  2A61 A;  4UAZ A;  3QEA Z;  3MMY B;  1FOW A;  8ICU A;  1IZ1 A;  3WGI A;  3L2U A;  4Z6E A;  4RU9 A;  3KLN A;  3BQZ A;  3D2N A;  3KOO A;  1D0X A;  4N9H A;  2JK3 A;  2E71 A;  2R8J A;  1P6R A;  3UMB A;  4PGX A;  1RUO A;  4Y2S A;  1ZQR A;  3GFM A;  4LB6 B;  2DT7 B;  2PMU A;  3PW2 A;  2WY8 Q;  2K9M A;  5L3F A;  2HI3 A;  2HMX A;  2DMU A;  4RQ3 A;  3BTC A;  4L5I A;  5KAI U;  1A76 A;  2C22 A;  2LH9 A;  4CCH A;  2K9Q A;  4NHJ A;  3MR6 A;  3CMM A;  3TDU C;  1P7J A;  4PSX A;  4I76 A;  5AKZ A;  3CCE I;  2HOQ A;  4DL6 A;  3RSN A;  1BI1 A;  1A35 A;  2EWN A;  4QWA A;  2GWS A;  1DGW Y;  4XOT A;  4IRC A;  4F8R A;  4FX4 A;  3S16 J;  2L01 A;  2QBY B;  3K4C A;  3CW2 C;  4CH7 A;  1TWA J;  1V5F A;  4EJO A;  1Z1D A;  3TI0 A;  2Y48 A;  3D2S A;  4KMU A;  4Q8F A;  5EYR A;  3RTR A;  2XUB A;  3HTS B;  1LKX A;  3LWF A;  4A3F J;  4OIR F;  1N62 A;  1UHU A;  1V97 A;  4DS4 A;  3MDC A;  3QYE A;  2EFP A;  4MGR A;  4W1U A;  3IWZ A;  2WAD A;  2DWQ A;  3RKX A;  2HNH A;  2L9S A;  3SDB A;  4YIR X;  1TE2 A;  2JEJ A;  1ZQQ A;  3RTV A;  4OOI A;  1ED1 A;  4HX4 A;  1ZQT A;  1W7P A;  2MFZ A;  3FYH A;  3VYU B;  3JRD A;  2J6U A;  1GT0 C;  2QUF A;  3PUF A;  4EJT A;  2EAP A;  1JKO C;  2E19 A;  1BIB A;  1NG7 A;  3V7J A;  1BPZ A;  3L2V A;  4M3F A;  3CUO A;  2E1M C;  4I2F A;  1MBF A;  3FMQ A;  3QU6 A;  5F1R A;  3DU5 A;  1O3T A;  2QLT A;  2ZIV B;  3BG9 A;  3L2R A;  2HYG D;  5E3L A;  1V38 A;  4DCC A;  5B5E C;  3FIS A;  3OHA A;  3BJO A;  5H6Q A;  5KFE A;  3Q8L A;  1OCR H;  3S93 A;  3D5L A;  3GTO J;  1ZXI A;  2CS3 A;  2G07 A;  4NLN A;  2B21 A;  3FMR A;  3KD3 A;  3BY6 A;  1SVO A; 
#chains in the Genus database with same CATH homology
 4B43 A;  4NQW B;  4BJT A;  3F9K A;  1A6S A;  3BCA A;  1T94 A;  2JMG A;  4BEH A;  3IAS 2;  4NC8 A;  2Y0S C;  3K10 A;  2H3Z A;  1N75 A;  3BLY A;  3OR1 C;  2F77 X;  4RLF A;  3HXL A;  2HZD A;  2W1O A;  3BC8 A;  4IZZ A;  2KLO A;  3OR2 C;  4ICA A;  4CA0 A;  3ZQQ A;  2V6E A;  2K9L A;  2LYB A;  2NV3 A;  2IS1 A;  2R7V A;  1R6R A;  5FRO A;  1Z21 A;  3LSM A;  3ZXS A;  3ONN A;  2L2O A;  4HST A;  3LMM A;  4DBQ A;  2DCE A;  4FE3 A;  1D1A A;  3L2Q A;  3HUG B;  3VSL A;  2G06 A;  4BE1 A;  2KIW A;  1GLN A;  2HBM A;  2HU9 A;  2ZXH A;  3OL3 A;  2IGO A;  2JH1 A;  3HL2 A;  1V5E A;  3MGV A;  1MMG A;  4QPO A;  4IQ4 A;  3H5N A;  1BOB A;  2WY7 Q;  4XKB A;  2JVH A;  2ZFU A;  4XLH A;  4HRI A;  2HBJ A;  1Y56 A;  4BS9 A;  3GU3 A;  4DGW B;  3H0R B;  1X1D A;  3C28 A;  2VJJ A;  4PJN A;  2R7W A;  5FRN A;  2F76 X;  2K8C B;  2WAQ A;  4U6P A;  4CRX A;  3MKW B;  3SAF A;  3KX2 A;  4E7S A;  2BOL A;  4DIQ A;  5HNF A;  2K3P A;  4NV0 A;  1WFX A;  3E0J B;  2KQR A;  3HPH A;  3NWS A;  3LSG A;  3ZCO A;  2UV1 A;  1PVQ A;  2X1E A;  3HPG A;  3DKX A;  3ZRG A;  2K4H A;  3L2W A;  1AA7 A;  3VYS B;  3C2H A;  3ICX A;  3OPX A;  3EUA A;  4X0G A;  3N7R C;  2X85 A;  4QNL A;  4OJP A;  2OUM A;  4N4N B;  2ZIX A;  1Z3Y A;  2JUG A;  3J7A Y;  3PNY A;  1T95 A;  3H9Q A;  3QOE A;  4Y4R A;  4BQQ A;  2VB6 A;  3K6G A;  4YEJ A;  4IKF A;  4OJ5 A;  2VPL A;  1YE9 A;  4BDZ A;  3OYK A;  3OYI A;  3H0M B;  4AYB C;  2MYS A;  2RRE A;  3UR3 C;  3K4L A;  3DPL C;  2KHQ A;  4XN3 A;  5HR7 A;  1P7D A;  3OIQ A;  3HKZ C;  1XNS A;  3DWL E;  2HVS A;  2YB4 A;  2OC6 A;  4ZDO A;  2RHF A;  1TT0 A;  2DJI A;  1HA8 A;  2A3V A;  4QIW F;  4O3M A;  1D8B A;  4Y3O A;  4CCL A;  2Q2E B;  4E7L A;  4E7K A;  4OAZ A;  3OYH A;  3HOS A;  2F5V A;  3K70 C;  4CCK A;  2CV2 A;  2DF4 B;  4XLC A;  3F2C A;  2KNJ A;  2CUJ A;  2VKH A;  1FMW A;  3OYC A;  4ACO A;  3I3L A;  4P0P B;  3H35 A;  1HIW A;  2A6T A;  4PJM A;  1WJF A;  4NLC A;  2KRC A;  3H5A A;  2XC7 A;  4BGD A;  4J01 A;  2ZIW A;  1WUD A;  5CQG A;  2GH1 A;  2WB1 F;  2W82 A;  2BW3 A;  4GRI A;  4B47 A;  4NUB A;  4BE2 A;  3IUO A;  3W2V A;  4II2 A;  1L6N A;  4LG3 A;  3K4K A;  2XF7 A;  5CKT A;  4CCM A;  2DGZ A;  2QKL B;  1ZEL A;  2KHM A;  1X19 A;  3VWB A;  1SFK A;  4XMY A;  2XI9 A;  4PK4 A;  2G09 A;  3KZX A;  1WJB A;  2KP6 A;  4C2U A;  3AL0 B;  1ZQ1 C;  4NC7 A;  4XKC A;  4XN0 A;  1DP3 A;  3D5S C;  2PJR A;  2VL8 A;  3TBI A;  3AQE A;  3F53 A;  2LY2 A;  4JOM A;  3HC7 A;  2CFO A;  2LY1 A;  4CGZ A;  2VJ4 A;  4IQJ A;  1Q3U A;  4PFP A;  1UG0 A;  4ZDP A;  4XKV A;  2R18 A;  3O0F A;  3K4B A;  1D1B A;  3MKY B;  1E0E A;  2LHT A;  3GZF A;  2HBK A;  4KX5 A;  2LBO A;  1YX3 A;  3W2A A;  4R79 A;  3F5E A;  2BDU A;  1BR1 A;  5HVQ C;  2K8B B;  2M0N A;  3OYD A;  2KJ8 A;  3EUK L;  3OL4 A;  4BE0 A;  1W36 C;  1X1C A;  4OO1 J;  3BG6 A;  1VZ0 A;  4P5O A;  4CZC A;  2DOA A;  3IAM 2;  4H4K C;  2RNG A;  4BJQ A;  2V7F A;  1D1C A;  3OYE A;  1Q3V A;  2KKV A;  3SEQ A;  4KIT B;  5HOO A;  3C29 A;  4ZTJ A;  4NNJ A;  2KKP A;  1PVR A;  2X6W A;  5CQE A;  4E7J A;  4A8E A;  2ZG6 A;  1G59 A;  1LVK A;  2WAQ F;  1GO3 F;  4XON A;  2W00 A;  4IX7 A;  1Z19 A;  4FZM A;  1S9H A;  1WJD A;  3RCO A;  2CV1 A;  2KRH A;  3LL7 A;  2XSJ C;  1UAA A;  4PSW A;  2ZIU A;  3FKJ A;  3VSK A;  2KMU A;  1YT3 A;  3DPU A;  3C2G A;  4RMN A;  2W7N A;  1OLT A;  2LC2 A;  4N4O B;  5T14 A;  4XLE A;  3SQI A;  3DTI A;  5A0L A;  4CUG A;  3PSF A;  2L9N A;  4HG2 A;  1CRX A;  1UPH A;  1K6Y A;  3LYS A;  4BEH B;  4WJ3 B;  2CMP A;  1Z7L A;  3LSK A;  3DPT A;  4ZC3 A;  5LFA A;  2R4G A;  3VC8 A;  3SAH A;  2XF5 A;  2MRL A;  3DKY A;  3AL0 C;  3FBN B;  2LOO A;  2VQL A;  1QU3 A;  4BX9 C;  1UEL B;  2VXD A;  2Y0S F;  3OYN A;  3IN5 A;  3S3M A;  3IG8 A;  3VYR B;  3H9G A;  3EPZ A;  2W7P A;  3F2D A;  2YX8 A;  1DGR M;  3DU6 A;  2G08 A;  3IP4 B;  2A5W A;  2K89 A;  4OJL A;  3A1Y A;  3OYA A;  2X1D A;  1EA3 A;  2IS4 A;  2W4S A;  4BXF A;  3L3F X;  2V9K A;  4CDG A;  4HNU A;  1F44 A;  3BCB A;  3PNT A;  2HOF A;  2M0M A;  2GOX B;  4PUS A;  2PMZ A;  4E4H A;  3EUH C;  2R7X A;  1Y6I A;  4KIS A;  2E1F A;  2IGK A;  1BR4 A;  2HPM A;  3W2W A;  2LG4 A;  2H3Q A;  1KBU A;  2VKQ A;  2VIX A;  2E60 A;  2CW7 A;  2IXS A;  4C0Z A;  1N78 A;  1HEK A;  2LBF A;  2KHV A;  4F92 B;  2LRE A;  3LFU A;  2KVC A;  2WAE A;  1P9Q C;  1DQU A;  4NWI A;  1PVP A;  2AQE A;  2L5Q A;  3RPU D;  4FZL A;  2ZIX B;  5C0Y A;  2Y0S A;  3OYG A;  5TGT A;  2E1M B;  5KL1 B;  2P0W A;  4ZTF A;  2JH7 A;  4EAT A;  1V5G A;  4FAS D;  3KFU F;  4OAY A;  4P0Q A;  3CZ6 A;  2VKD A;  3OYL A;  3V42 A;  2K4E A;  3NRW A;  4NLB A;  2V4J C;  3DTK A;  4E7Z A;  4J00 A;  3OYJ A;  3CF2 A;  3K4M A;  2VJI A;  2K4I A;  3W3C A;  2RQQ A;  4U87 A;  4BQO A;  2KD1 A;  3RFA A;  4AYB F;  2E1E A;  1QHG A;  2MAB A;  2OXO A;  1BR2 A;  2WA0 A;  3M6K A;  3IG5 A;  2KL4 A;  4OWR B;  3BG7 A;  3HKZ F;  3E1S A;  3OIP A;  1G8X A;  4BDY A;  2X51 A;  3CP8 A;  4PJL A;  2FUG 2;  3U21 A;  2CPR A;  1MMN A;  3ALR A;  2XVT A;  3QYB A;  3H9J A;  2E5S A;  4LIU A;  2VLA A;  2R7R A;  2KOB A;  3FBI B;  4ZDL A;  2UUZ A;  2Z7J A;  2ZIW B;  4KX3 A;  4XM3 A;  2K8A A;  3CJQ B;  2BW3 B;  1D0Z A;  2X6X A;  3OYF A;  2H3F A;  4HEA 2;  2M7A A;  4KMO B;  4PL2 A;  3PSP A;  1X1A A;  1X1B A;  2BVL A;  2VXZ A;  3PSI A;  2V1N A;  3N05 A;  4DBR A;  4E7H A;  3CP2 A;  4AVZ A;  4Y33 A;  1URJ A;  2F4I A;  4AYB A;  2G5H B;  2ZIV A;  2BVM A;  3UNG C;  1X4O A;  2M4K A;  3CES A;  5LD2 C;  2WAQ C;  4C30 A;  3OYB A;  1SZH A;  2Q1Z B;  3HKZ A;  2LYA A;  4GFJ A;  3OS0 A;  5CPR B;  2XIC A;  4PFO A;  4AU7 A;  3KEY A;  2RP5 A;  3M8J A;  3VDX A;  4B3X A;  4BL0 B;  2H3V A;  1Z3X A;  2PJR B;  1JI8 A;  1IRX A;  2DXI A;  2KEY A;  2VQC A;  3OWT A;  3NWT A;  3DEE A;  4BUG A;  1XO0 A;  4LIT A;  4OJO A;  4PJJ A;  3ZR8 X;  3S8P A;  2VQG A;  2CN1 A;  4ZJZ A;  1NZB A;  4XNF A;  4BAC A;  3PFY A;  3K70 D;  4F52 A;  4F93 B;  3OS1 A;  1TZL A;  3M7D A;  2X6Y A;  3CJR B;  2OH2 A;  4E7I A;  5KNL A;  2Z2S B;  4DJA A;  2Z16 A;  5HNH A;  2IS2 A;  1OUQ A;  2JGA A;  2KPM A;  3I9V 2;  2CV0 A;  1WJA A;  2RRD A;  5HLT A;  3N7P D;  2PMZ F;  3AKZ A;  4XOR A;  5KHD A;  2KZV A;  3ZGK A;  3T79 A;  2R7O A;  2CH0 A;  2WAF A;  4HPQ A;  4II3 A;  4YRV A;  3F5A A;  2R7S A;  1NG6 A;  3FHN A;  4XKW A;  2VJ5 A;  1SAU A;  3RQ4 A;  2GOM A;  4CSW A;  4QIW C;  2M7B A;  3PL8 A;  4MLO A;  3HOT A;  3AQF A;  1T0F C;  4U7C A;  2LKY A;  3D5R C;  4D9J A;  2M3A A;  3H0D A;  4C2T A;  4CCO A;  2F8L A;  2ZIU B;  2HQA A;  2KJ5 A;  2XF6 A;  2Q4T A;  2ZSH B;  1Z1B A;  3OY9 A;  2H3I A;  2E5Z A;  2W7O A;  3DQV C;  5FRM A;  4OJ6 A;  4U7B A;  4IC9 A;  3D2Q A;  1OR7 C;  1D0Y A;  2KDO A;  1MMA A;  3E0F A;  2I8D A;  4JQF A;  2OV7 A;  4YEL A;  1WJE A;  2DT6 A;  2OM6 A;  3AFH A;  2JVG A;  4XOP A;  2WBM A;  3QYF A;  2MD0 A;  2NOJ B;  3H5R A;  3SYT A;  3K1Z A;  1PYV A;  4XR6 A;  2CW8 A;  4BUP A;  3SZG A;  3OYM A;  3MKZ A;  4BJ5 C;  1W36 D;  3CYM A;  1KON A;  3PNV A;  4XL9 A;  3TMO A;  4RM2 A;  1PJR A;  4RM3 A;  2XAU A;  1X4P A;  2KJ9 A;  4QJF B;  2JA2 A;  4KJZ A;  4P1W A;  1U0J A;  3K4N A;  4FET A;  2AQF A;  4F55 A;  4F91 B;  1FMV A;  3S3N A;  2GOL A;  1IIP A;  3QOD A;  2WB1 C;  3LVV A;  4D1Q A;  3DLA A;  5KL8 B;  3S32 A;  4BQN A;  3OMY A;  2KV2 A;  2LYC A;  2VAS A;  1MNE A;  2JHD A;  4HNT A;  3KYL A;  2R7Q A;  2G5I B;  1WJ5 A;  3F2B A;  4P0P A;  1ECW A;  1LDK B;  1TAM A;  2CRX A;  2K5C A;  3SEZ A;  2VQH A;  2XDV A;  2HDW A;  2JSP A;  1YX5 A;  1DRG A;  1LFP A;  2IS6 A;  3OOU A;  4BJ6 C;  2LBF B;  3SAG A;  5JHF A;  1MW7 A;  3NUQ A;  2G0A A;  2E5N A;  2Z1D A;  3FDY A;  4G6T B;  2OYY A;  2N1R A;  4KT6 A;  2DQN B;  4JMU A;  3LSH A;  2CUZ A;  3MMY B;  1QHH D;  4E6K G;  3L2U A;  2ZSI B;  4F3Q A;  3D2N A;  2HVR A;  4ZYA A;  2W04 A;  1D0X A;  3LVW A;  4P0Q B;  3H0L B;  2LRD A;  2DT7 B;  1N77 A;  2WY8 Q;  2F2A B;  2K9M A;  2QKM B;  4C9Y A;  4DOZ A;  4CCN A;  1MMD A;  2HMX A;  2YB1 A;  2ELJ A;  2LH9 A;  2ZXI A;  4BU2 A;  3CMM A;  3N7S C;  2HVQ A;  4PSX A;  3ONQ A;  2HOQ A;  3K4J A;  3RSN A;  1DGW Y;  4XOT A;  4ITV A;  4HSR A;  3A2K A;  2XID A;  3K4C A;  2IGN A;  4CH7 A;  1V5F A;  3PJR A;  2MA1 A;  2MC4 A;  3D2S A;  2KIC A;  3RTR A;  1LKX A;  2L7K A;  4XQF A;  3PZP A;  2O5R A;  3RF9 A;  3OS2 A;  3CRX A;  3QYE A;  3G2B A;  3MD2 A;  4B44 A;  2WAD A;  3PUB A;  3VYT B;  4XLA A;  1MA7 A;  1MND A;  4FZN A;  2X1C A;  2HNH A;  2L9S A;  3GBG A;  3SDB A;  2UWM A;  2V26 A;  3SMV A;  4RLQ A;  4LIV A;  1ED1 A;  3PST A;  2D6F C;  5HR6 A;  4CCJ A;  2IGM A;  2MFZ A;  3VYU B;  2W03 A;  4ANJ A;  2R7T A;  3S3O A;  4PL1 A;  2HBL A;  1NG7 A;  3LSI A;  3L2V A;  2WB1 A;  2E1M C;  1A0P A;  5KCM A;  2R7U A;  3DU5 A;  4B48 A;  2ZIV B;  2PMZ C;  3L2R A;  3M1C A;  2HPI A;  4XLF A;  3M6Z A;  3HG9 A;  2M4G A;  3A4C A;  3VCB A;  1J09 A;  3TL4 X;  2HOI A;  3S93 A;  3D5L A;  4QPQ A;  5CRX A;  2CS3 A;  2G07 A;  1WJC A;  1ERD A;  2F6C A;  3DTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...