3QU9A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with magnesium and tartrate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
225
Chain Sequence
SHMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 79
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu9A01
3EPRA 3L1VA 2YJ4A 1YS9A 3R09A 4Y2RA 1RMTA 1N9KA 3QUTA 3VAYA 3RF6A 5ALSA 2W43A 1FEZA 3I76A 3BA6A 5AI6A 4KYTA 5AKXA 4BYGA 5AM3A 1RLOA 1NF2A 1N8NA 3WGUA 4L6CA 4YCLA 4AS3A 1WZCA 2OBBA 3QU2A 2P9JA 4BX3A 4UASA 3B8EA 4YCNA 3SD7A 2X4DA 4UU1A 5AVUA 3E8MA 3ZX5A 1Z5UA 2FI1A 4UMVA 2HCFA 3QYPA 2G09A 3N28A 2PR7A 1Z4KA 3L1UA 2OA0A 2FPSA 1T9ZA 3U19A 4UAVA 2O9JA 3FPSA 2ZBEA 3CNHA 5ALOA 1O08A 1ZRMA 5AKIA 3E84A 1EK2A 1Z88A 5AM4A 1YV9A 5AKLA 2GFHA 1VJ5A 3QUCA 2DQSA 4ZEWA 5AW9A 3WK4A 2PQ0A 2B1RA 2GO7A 3KDPA 4XPZA 5AVSA 3SMVA 4KNWA 3AR5A 3MPOA 4NV0A 4B6JA 1QH9A 2B8JA 3AR9A 2P69A 3EWIA 3M9LA 1L6RA 1XVIA 2YMPA 2YJ3A 4FYPA 3SF0A 1MH9A 5ALIA 3IJ5A 4HAIA 4MWOA 2FUCA 1ZD2P 3OTQA 2HI0A 4UM5A 3PCTA 4NABA 3N1UA 1SWVA 4CNQA 3KOOA 2ZXEA 2WHEA 4DWOA 4EEKA 2RARA 5AW2A 4NFLA 2MU1A 1QQ5A 3L7YA 5AVVA 5AICA 5JJBA 1U7OA 2OYCA 4EENA 5ALMA 5ALRA 2HOQA 2R8EA 3WK5A 2R8ZA 4YIHA 5ALFA 1RQLA 2G1AA 5AVRA 3ZTYA 3WK6A 3I6BA 4BNDA 2B0CA 4E88A 4GIBA 4C4TA 2GHQA 4Y2SA 3L8EA 2C8KA 1YMQA 3ZTWA 3L5KA 5ALZA 4FE3A 2AUTA 2FUEA 2MSNA 3OCUA 3ZW7A 5ALYA 4YH1A 1XPJA 3AR8A 2VKQA 5AKYA 1RKUA 4Y2PA 1TA0A 4UU0A 5AVZA 3MC1A 4FFDA 2GMWA 2I34A 2RAVA 2WF5A 1RMYA 2ZG6A 1Z4PX 2YFYA 4QQFA 4RETA 3L0BA 2NO5A 1L8LA 2ZBGA 2CN1A 2JAOA 5IT4A 3U26A 3OPXA 3QU4A 1IWOA 4HYTA 2ZBDA 1T5SA 1AQ6A 3ZI4A 4UW9A 4UARA 5IT0A 5AW1A 2FEAA 4BKMA 5AK4A 2B1QA 3L0CA 2G80A 5AIBA 2W11A 2JARA 2HF7A 3PGVA 2YN4A 4UMFA 4C4SA 1L7PA 2G0AA 1U2TA 2JAUA 4IG4A 3ZU6A 3ZVNA 3ONNA 1WVIA 3NUQA 2YJ6A 3WKAA 3ESQA 2G06A 4ZEVA 1J97A 2OM6A 3A1EA 3NANA 5AI5A 3W5AA 3FM9A 3ET4A 5AIAA 2WM8A 2BDUA 3L0YA 1EK1A 3TLMA 1Z4NA 2O2XA 3E58A 2IOFK 3ZX4A 3U7FB 4YGYA 3ZVMA 1QQ7A 1F5SA 2HSZA 1RPZA 4EELA 1QYIA 1Z4OA 5AM5A 2YJ5A 5AW5A 5ALJA 2FPXA 3HLTA 3UMCA 1Y8AA 4KX3A 5A3RA 5ALEA 3WKBA 1U7PA 2AGVA 2WF7A 1RDFA 4Y2XA 3QU5A 1L7OA 4J2TA 3KC2A 3FPBA 2NO4A 1X42A 2EAUA 2RB5A 3J7TA 4CF3A 3NAMA 5ALVA 3ZWKA 1XP5A 3ESRA 4HGPA 2IOHA 2PKEA 3M1YA 3NIWA 5AW7A 5E0OA 4I9GA 4KNVA 4QJBA 2G07A 5AKZA 4I9FA 5AK5A 4MUMA 3D6JA 4ZEXA 3AR7A 3AR6A 4Y2YA 2I54A 3QXGA 3NASA 2HF2A 3GYGA 1Z4IA 3QUQA 2Q5EA 2WF9A 4HGOA 3U7EB 2IA5A 3HYCA 1ZS9A 2Q4TA 5AW6A 4CF4A 1LVHA 4Y2QA 1SU4A 2I7DA 5AVTA 3UMGA 4XQ0A 3MMZA 2R8YA 2P11A 5AM0A 4NWIA 5ALXA 3N8GA 1VFPA 3P96A 5ALHA 4Y2JA 3W5DA 1U02A 1ZRNA 1Z4JA 4HGNA 2GHTA 3I28A 3QNMA 2YBDA 4BEVA 4BBJA 3L8FA 3QU9A 1WPGA 1RKQA 2FDRA 1TJ3A 4PNHA 1VJRA 4DW8A 1RRCA 4JB3A 4UAUA 3SKYA 1JUDA 2B82A 3OCWA 2HHLA 3DNPA 1J8DA 1TJ5A 4UATA 3A3YA 3F9RA 1S2OA 1SWWA 2HDOA 3I1YA 5ALTA 5AK3A 4BNDB 4YCMA 5ALLA 4OD0A 2RBKA 4AS2A 3U7HB 1LTQA 2I33A 5AKEA 1RQNA 2CFRA 1ZD4A 2I55A 3WK7A 1ZD3A 4GXTA 3QX7A 4C4RA 4DFDA 5AW3A 5AI9A 2D2VA 3DV9A 3AR2A 3AR3A 4DCCA 2AMYA 1ZOLA 2HX1A 1ZD5A 5A3QA 3SHQA 2WF8A 5ALNA 3WK8A 1TJ4A 2EATA 3KZXA 5AM1A 4UMEA 1CQZA 4IFTA 1RLTA 3S6JA 1NRWA 2HO4A 5ALPA 1QQ6A 5AW0A 3KBBA 1RLMA 2R8XA 2B30A 4EX6A 3FZQA 2C88A 3W5BA 5AW8A 3OCVA 5ALKA 5ALDA 5AKJA 3N07A 1Z4MA 2BY4A 3ET5A 5ALWA 4BX0A 2W4MA 2C8LA 3WKCA 5T41A 1WR8A 2HEGA 2C4NA 3QUBA 3SKXA 2YY6A 1Q91A 3UM9A 2EARA 3L8GA 4EX7A 1Z4LA 1RKVA 3A1DA 4Y2TA 3PDWA 2YMQA 2CFSA 4UMDA 3CZ4A 2YMLA 3ZUPA 3ED5A 1U2SA 4BX2A 1ZJJA 2CFTA 4CE6A 3OCYA 5AKGA 3K1ZA 3U13A 2C9MA 1Z4QA 1RC8A 3EF1A 3WK9A 2AH5A 2YMMA 5AI0A 3B9BA 4UM7A 4NAVA 4HGRA 4L6AA 3ZWDA 4J03A 4F72A 3UMBA 1NNLA 5AVXA 2G08A 5AI8A 3IB6A 4OFZA 1KYTA 3NALA 1Z5GA 1TE2A 1S8OA 1L8OA 2IYEA 3N5KA 4KX5A 4BEWA 4CF5A 1L7NA 1Q92A 3OCXA 4L57A 4Y2UA 1YNSA 3PGLA 1K1EA 1YJ5A 4XOUA 1T5TA 5ALUA 5AVQA 3QGMA 4H1WA 2FPRA 2ZBFA 2Q4RA 3QU7A 4OCZA 3R4CA 5AESA 3RFUA 1PW5A 3IRUA 5AKKA 5A3SA 5FP0A 4RESA 5ALGA 3NRJA 5AVWA 3WKDA 5AK6A 5IS2A 5AKHA 5AVYA 2WF6A 3KD3A 4KN8A 3U7GA 4AP9A 3E81A 3L8HA 5ALQA 3AR4A 4O8CA 2ZOSA 4HGQA 1YDFA 2JGAA 1L7MA 2WFAA 3WGVA 3B9RA 4JDPA 3W5CA 2B8EA 2JAWA 1CR6A 4YIKA 1RMQA 5AHXA 4XE5A 1O03A 4Y3UA 4EZEA 4F71A 3FGOA 2ODAA 2FPWA 3OCZA 2MU2A 3MN1A 3BWVA 3EF0A 4OHFA 3R9KA 2P27A 2QLTA 3DAOA 2IOFA 2NYVA 3ZVLA 2QYHA 4G63A 4G9BA 2BDEA 3A1CA 3SLRA 4Y2VA 3WKEA 5AM2A 2I6XA 3QLEA 5AI4A 2FPUA 5AW4A 3FVVA 3DDHA
chains in the Genus database with same CATH superfamily
3MUOA 2FK7A 4ZZIA 5ILOA 4JI4B 4OYHA 4KWCA 4GMHA 4TKLA 5AO9A 1MFZA 3H5WA 3LX8A 4XUDA 5LBIA 3KB1A 1HNNA 3PICA 1DL5A 3ILSA 3VNSA 3RREA 3H19A 3F5QA 3M5PA 4FR5A 4YO7A 3VPXA 3MFQA 4YXFA 3LCMA 3ILVA 1UBMS 1CUUA 3UATA 2AF4C 3IPRA 5DBIA 5B58C 2Y1KA 4RPCA 3QSGA 2J9ZB 3SEFA 1A9ZA 1G18A 3KSMA 1C7QA 4AXXA 4MWDA 2RJOA 3CIOA 1PNVA 3DPUA 1ODSA 2CNBA 3CN7A 5EJMA 4YJFA 3L0SA 1T3GA 5GJBA 3VNQA 4Z99A 4FEEA 1GAEO 4RSRA 5F23A 4ZAZA 1T1EA 7ICTA 4IR9A 3WNDA 4QZAA 2HSGA 4WJLA 4P4TA 4PSVA 5IH3A 3TG2A 4XIIA 3Q3IA 5EMJA 2J3DA 3MWGA 3TCKA 1PUJA 4A7PA 2GK6A 1GG2A 3E1SA 3ZJ5A 2BKAA 3LW7A 1DADA 1E99A 3L6BA 5AUPB 4H1HA 4QTTB 1LY1A 4H7EA 2VUHB 4FS1A 4OQYA 3N97B 4AY4A 1WCXA 1YE3A 2CXOA 3CLRC 4PNZA 2A84A 3TIFA 4GXKA 2PMDA 4IDOA 2G0AA 1WZUA 3DEHA 4WZBA 3BXGA 4X6LA 2C4VA 1GTL1 5IXYA 1TM3E 5KU7A 3TLCA 5HR5A 5BSHA 4E0DA 4LOKA 3PO4A 4KMOB 2UVUA 5L8VA 1B23P 1K1QA 2VZ9A 4HR7A 3RSSA 3ZGLA 1IONA 1H1TA 1XZAA 3WKBA 1DQPA 1L5RA 3IESA 5LP6C 4DCGA 4LYGA 4DQKA 3ZWKA 3HJBA 4LXGA 3L7OA 4BN4A 1JTEA 2I3DA 3LRTA 4JBIA 1S3SA 4CW7A 5LYJB 1N2CE 2FX5A 5EKDA 5AW6A 4WE3A 1OXTA 4IEIA 2AFIE 2P6NA 3ODPA 5AM0A 3VPBA 2FCAA 4LNUB 2HK7A 4BO1A 3KHSA 4ZRNA 1XV5A 5HBGA 5J8YC 3ZE9A 1E4OA 4BASA 3RH5A 3AF2A 3OX1A 3GD7A 3GT0A 3F9RA 2VDUE 2W8KA 4A36A 1JEDA 2VNIA 4G8DA 1T0JB 4JN6B 5J0YA 2W9CA 2C5HA 2DQKA 3UXYA 1GYPA 1SZPA 3QPWA 1NXOA 2Q2NA 5JNTA 3H7IA 4MR8A 1NN5A 4YRNA 3PE6A 3JQGA 3KYCA 2Z6QA 3ZEIA 4UXJA 3A6EA 4X1YB 1AHIA 2F3QA 1U7WA 4TYMA 2P7HA 1N5DA 4EJMA 3OZXA 2DFDA 1Q17A 3RS9A 3RB3A 2A33A 3H9JA 7ICUA 3SSMA 1YA4A 1A5TA 4BJ5A 5CCDA 1F3OA 1HE8B 4OGLA 2W4MA 2Y0SC 3E5RA 4XI9A 4M4SA 1H1LA 5J58A 3L8GA 4BQRA 2PUDA 2XD4A 1L5MA 4AVYA 1ID8A 5J2UF 1QCKA 2RKOA 2R6FA 4EMBA 4EG7A 5HR6A 5CYPA 5EE3A 3QEJA 4QO8A 2VWGA 2KHZA 2OWEA 1JKXA 4A6PA 3RJIA 4FFNA 4WBXC 1SU7A 4REOA 3OCXA 4XD7A 5BV7A 1TMOA 4EQ6B 4CDGA 2V3WA 1LSJA 1N62A 5A3SA 2PUHA 4ED9A 4X94A 3ISVA 4O8CA 3LVRE 3N0XA 3H13A 3RAGA 3B9RA 1SUSA 1RLIA 4ABYA 3TD9A 5JXGA 2DBZA 2VHWA 2GNAA 3O21A 1JGTA 3HPRA 3WKEA 1KJZA 3QWHA 3V7FA 5H68A 1SVMA 5FADA 1OX6A 3PEVA 4PV7A 2Q0ZX 1BFUA 4K7JA 2Y2VA 3MTEA 3OBIA 3QVLA 3NYQA 2PJZA 4BWYA 3W7VA 2J67A 4K6HA 4PZLA 3P9RA 4HWRA 4CMHA 4FOOA 3Q0TA 4LHVA 4FMDB 4CKCA 2GHRA 4MWGA 3ZI7A 5BN5A 3K9WA 5KNBA 4YR0A 4KMRA 4LHWA 3HE3A 3KP1A 3G5MA 2GNPA 2V97A 5HA5A 4R7GA 9ICQA 3RT7A 4V1CB 4C0ZA 4B6PA 3C8MA 1U81A 3RK4A 2ASEA 3PCTA 2H1LA 2EKLA 3W5VA 2QD4A 3F5DA 4JQCA 1V2HE 1ZNXA 1XTRA 5LB2A 2NSJA 2UUOA 4UHJA 5HMLA 1NVAA 1XXHB 3V8BA 2UVWA 1IV8A 3WK5A 4C06A 2AUMA 4QTUB 5C4GB 2GN6A 1I24A 3KLOA 5BW4A 1CR4A 1KKUA 5FI0B 4ND4A 1XDZA 1SRQA 4Q4JB 5CT5A 2FE9A 2IXDA 3QG1A 1MORA 2CN1A 1JPVA 3FZYA 3I32A 5JZBA 1N6NA 1H2BA 4OJOA 3UWPA 3RVJA 4XZ3A 3I4LA 3D0OA 4IUBS 4NCIA 2HNAA 3TB4A 1J97A 1BAPA 4WZBE 4IJ5A 5DIZA 1XMIA 1F0KA 1PT7A 2AVDA 5DB6A 1N9GB 4L8GA 4E51A 1U9LA 2XTMA 1CS0B 3FMGA 4BC0A 4FGKA 3SU8A 3FPCA 4Y9DA 1GNPA 3KOWA 1JSLA 2HIHA 2YOGA 4F7DA 4KLMA 1KQQA 1NBOA 3OQ6A 2ZANA 1JG3A 1AUPA 2VQEB 3TI0A 4HGPA 3G8BA 1YQQA 4K28A 3D4BA 2R8RA 4L02A 1QLJA 1VA5A 4N6GA 3JQPA 3MRVA 4ROTA 2FPIA 4B3DA 1TA9A 5DQHA 1RBZA 2Z9BA 2JH9A 1WMEA 3GLGA 3MMZA 4U9IS 5LMUB 1UK8A 2WIGA 2AXTU 4OYLA 1GNLA 3H8JA 2VDKB 4POOA 1RQRA 3RF7A 1MHTA 4TS9A 1CEEA 1BHQ1 3UH1A 2GBCA 1L1FA 1FY2A 4DUGD 4DOCA 4X54A 4EBFA 2A78A 2RAPA 4P4SA 5EJ9A 4NYIQ 3IPLA 2AMJA 4YUAA 3CRW1 1GL9B 4R41A 4UQPA 3WX0A 3N7SC 3CVYA 4MP6A 2HEIA 4KXLA 4R3NA 1IHUA 1WP4A 4C7OB 3D6VA 5D4BA 4GRIA 3PRHA 4PLPA 2BFCA 1ZOOA 2MINA 3SJBA 2PWAA 1ARZA 1E3WB 3NFYA 1BX0A 5HM6A 4LJ7A 2RIPA 1KOLA 5KFZA 4RELA 3KXDA 5HNKA 1TKRA 4KLOA 3BREA 4DL7A 2W7OA 2OQIA 2D06A 4MB6A 1KU6A 4M37A 2V7WA 1YVDA 3CNLA 2DPHA 2GM5A 4G0WA 1SUFA 4O4LB 4B9TA 2HGSA 2JEZA 3DCJA 2I80A 5MN6A 4G0PA 8ICNA 2D3TA 1I1OA 1JDBC 9ICMA 4HMOA 1DDOA 1Z06A 1VPTA 2YV5A 2J0UA 3KHLA 4MUNA 3C1OA 3SS8A 2VRNA 1H9AA 1DIRA 5C37A 2IOYA 4NY8A 4HT3B 4LOIA 1LPAB 5AOAA 3ANXA 1J1ZA 4KN8A 5AFSA 1E61A 1L7MA 5DJ5A 4Y6OA 2XOKA 1QC5A 5ECGC 4N0DA 2PQ6A 4U6NA 3UC5A 5KT3A 1DMRA 5JMOA 1AH2A 1YQTA 2RGWA 4G4IA 3BH6A 1E6LA 1FDSA 4PU0A 4TZTA 1YZGA 3FWKA 3RQIA 4HAUA 5HKBA 1B00A 5JY1A 3HDTA 5DH9A 2JA1A 3NAZA 1HNZB 4HLUC 3V8MA 3V42A 3AQ4A 2IZZA 1YIDA 3HK2A 3FNIA 3OWXA 4L28A 1C9JA 1T24A 5IEJA 5KHOC 1DO8A 2OB1A 3H5NA 1SUEA 4GPAA 1RRGA 4I19A 4JI3B 5KVQA 2ABWA 5J5AA 4NCAA 1KR2A 1R0RE 4ZDJA 4N82A 2XA9A 5A4JA 5CP2A 5AWFC 4XVUA 1DXOA 3M0EA 8ICYA 1QP0A 1RFGE 2BPFA 3DDSA 3OIWA 5KJ1A 1OH5A 3G0OA 4ZRDA 1V2GA 5IHPA 3KOOA 4JK1A 1IXRC 1OUQA 2YWGA 2V7QD 3HBJA 4WNAA 3KV1A 2JHPA 3A6GA 4A5SA 2XCSB 3RBVA 4GKBA 1H9BA 4V38A 4XLZA 2R751 3PKIA 4PL2A 3IPXA 3PF8A 2VDNB 1UEJA 3KR0A 4JBGA 2NV3A 1TCAA 2WLSA 3WC4A 3ETLA 5K09A 3AJ9A 5AK4A 7ADHA 1YUMA 4QEZA 3TPZA 3DLPX 1SL0A 3U5ZB 2O2JA 2W7TA 3A1EA 3BQMB 1FJGB 1RYNA 4L27A 4AP6A 3A06A 2AGPA 2QY9A 2MT9A 1M1XB 4QUDA 3NJ8A 5F33A 2DC1A 1JR4A 4F8EA 2YJ5A 1Y8AA 2W9XA 3GP8A 3R9WA 3NAMA 4WLUA 5K20A 2HQSA 4G0NA 4JUDX 2R97A 5FHRA 2XXAA 2OG1A 5CFNA 4LZPA 1SCBA 1CIPA 1V3TA 3F5EA 3H16A 5J2TA 4W5NA 1PR3A 3GYGA 4JUAA 1QGUA 4OBEA 3T8YA 4E46A 4G01B 5DP2A 3ZI0A 4AYBC 3ITKA 3N8GA 3GLGE 4RK7A 2J6HA 3TFRA 1FNCA 1OZAA 1U7TA 1YUNA 4GAEA 3D3EA 5DM60 4X91A 4I2EA 4BZXA 3ZGZA 1J8DA 2AQHA 2BT4A 4MFFA 3BSSA 3UGQA 3IAXA 4UB3A 1U3DA 5BORA 1GQFA 1VMIA 7ICFA 3CO0S 2GDZA 3IBGA 2ZWPA 2Q9BA 3CNEA 2Q2WA 4QEDA 2P35A 2PV7A 4L0QA 3HI4A 4CIBA 2J3QA 2G3YA 2DWQA 3QK7A 1QGZA 2D00A 2HFJA 4MI1A 2O14A 5FBVB 4GOXA 3M34A 3BJYA 5K4AA 1T2CA 1XF9A 3PXAA 1E5QA 4Q6BA 1EB9A 3JARB 3CLSC 3UPQA 3BWXA 2BY4A 1GGKA 3MGKA 4E4YA 4BP1A 4WY2A 4Z4GA 1T43A 4WK0B 2EAMA 4KQ1A 1QJCA 4KTQA 2IYSA 4MKHA 2EEPA 1AK1A 2CSUA 1XKQA 5H9VA 3UQ0A 3BORA 4I1YA 2H2FA 2NV6A 1NV9A 4LZWA 5G53C 4I1SA 4BEWA 3A9TA 2BGMA 4NFSA 5IKEA 1RC1A 1R5BA 2J07A 4GM4A 2FPRA 3A1NA 3NGMA 4RJJA 1NR7A 5KQLA 4NPHA 5ALGA 4O1HA 4RKYA 5EIXA 5CB4A 4H3HB 3SXUB 3C3BA 4IX1A 3UIEA 1X7DA 3E0XA 5SZKB 2Z1NA 2BR0A 1LJ8A 2ICAA 3C1TA 4M0AA 4BZWA 1N0VC 3VR3D 2DLCX 3PG5A 2F1OA 3CU5A 2VPPA 4OMUA 1MRSA 3NUZA 4PAGA 1RJEA 4PZOA 1RW4A 1RRFA 4ZYUA 4E5YA 2YJ4A 5L1KA 2QV7A 4LDAA 3LXRA 3HJUA 3Q6NA 1RZRA 1MOSA 4JKIA 4PC2A 3LUAA 1OZGA 4H6VA 1IY2A 1S10A 3TTVA 1NVVR 1UOEA 3IJRA 2OCEA 3UMYA 3RF9A 5EJ2A 1V5EA 5FDFA 1GJRA 2QG6A 4BVEA 3JAWB 1R0CA 4FI3C 4JVNA 2WABA 1ZH0A 4HYYA 2B1JA 4HMPA 5TJHA 2AYXA 3SICE 5F76A 2IPXA 2ZZNA 1OPXA 4YT5A 4Q1VA 3AETB 3GU3A 3Q3CA 2JVIA 3F78A 1O8BA 1NZBA 3PDIB 1BXRA 5IW8A 5IARA 1P7YA 4ZOHC 3VNBA 3JSXA 3PUXA 2C31A 4CDNA 2GZ1A 3HCDA 5LYYA 4MRMB 3CIFA 5JWOA 3KT6A 1PF7E 3GDFA 1JYEA 3PNQA 2JI9A 1RM6C 1RWNA 4OM7A 5DM2A 2BGTA 3WIBA 1SGGA 4GM0A 2XMCA 5J43A 3BK2A 1F7UA 1Q83A 3HY4A 1CE8A 4Q8FA 5F51A 3U60B 4E33A 1QOPB 2PWPA 2XIDA 1NBIA 2NNWB 1L5YA 5EIFA 4YJKA 3T54A 2NRWA 1MRZA 5TDHA 1A9YA 1AM4D 2JIBA 2BKVA 3NO4A 3QEKA 4DMCA 2WMYA 3OTGA 1AT1A 4W99A 1KEKA 4HFMA 2YN4A 2I6QA 3T1YB 1T9GS 1JHZA 4BNZA 1G2PA 3Q12A 4FYIA 5U4QA 4NCNA 3X1DA 1I6MA 3C15C 1QYVA 4MRNA 5LU8A 3T3EA 1MAWA 2QN2A 1LI5A 1Z62A 2NRVA 4GI5A 3RABA 4UTOA 3GGOA 4PZZA 1X2BA 2VP9A 3OJXA 4O4HA 1AN9A 3E1KA 2Z4SA 2EAUA 5EXXA 3JQBC 1HQKA 4H3KB 2XSZD 4UHHA 1HT3A 5KTNA 1QRRA 3PVXA 2WM3A 5KNCH 4E32A 2G1PA 2H16A 3P4YA 5KTPA 2G1JA 4FWTA 3GRFA 5E3HA 3ENWA 1LQUA 4Q93A 5LOVA 5EHIA 4Z4IA 1EM8B 2NO1A 5B3LA 2HHLA 4QZHA 4PGHA 4Y18A 1MG5A 3E5NA 4WLVA 4JEUA 2VXCA 4MWCA 4G84A 1W93A 3QA3E 1X7XB 2OENG 4GI7A 4AWXA 4E03A 1JG6A 2P3SA 5JJIA 2WU8A 1VZ2A 3N9IA 2YRWA 4PPYA 3U80A 4PS0A 4M83A 4RD4A 2XCAA 2C7BA 1AQUA 3WRXC 4YO8A 3BICA 3I1IA 3R3WA 4TWZA 4RH3A 2B30A 3HJNA 2CDAA 2CFCA 3TTSA 3BTVA 4N49A 2V6MA 5GIOE 1W85A 2ZULA 3EZ5A 3IILA 1DQYA 4F4YA 4DL3A 4KLHA 3EIEA 1N1GA 1DAIA 4US8A 1RCFA 4KPYA 3H9BA 3IEXA 5L7TA 1E79D 3LT0A 5B57C 3X3HA 1ZR2A 4GVXA 3FWZA 1TK0A 5DCYA 5B2EA 3X1XA 4ON9A 3F6RA 2IQ5A 2PYDA 5KYTA 1J07A 5HF5A 4PFSA 5IINA 4IJUA 4FZ5A 1NP7A 1IOLA 1CBUA 5IF9A 3INGA 3FH0A 1UZMA 2C2MA 5CFQA 5FEMA 3GOQA 1LK0A 1CWUA 5B3KA 1JEYB 4TQ9A 3PXEA 2QTVA 3EYZA 4L2IB 4YN3A 3C6KA 3CO5A 2OB2A 4EFMA 5JZOA 2JCVA 3HA7A 3RPEA 2AJCA 1G2OA 3QVUA 721PA 2YINC 2A5GA 3GIDA 1TU3A 5EJ7A 4JOQA 3VDQA 5JAHA 2CWDA 4CMKA 5JVDF 2FEWB 2Q6LA 1B42A 1GPDG 3F6YA 4X61A 3AVQA 1FFDA 2XKAA 3FOAA 1E92A 3FF4A 3V7JA 1RBYA 4KMOA 1WW3A 3ORHA 5I7AA 2ZRDA 4CQNA 4OK5A 2DGDA 2WIJA 4X6XA 5AVUA 3ELBA 1WPRA 2A9KA 1EDDA 1DU4A 1KF0A 3MILA 4I4NA 2DF4B 5JAQA 1Q7TA 2X15A 3L6RA 1T15A 4EJFA 4D74A 2DQSA 1V43A 2DU8A 5NLLA 3DE5X 4X63A 5LYJA 4OAOA 1JFLA 2WNIA 5DTEA 3CF4G 3SDZA 5CGQB 3QJ5A 2WPDD 3COZA 1FXWF 4LNUA 4LYAA 4J2OA 3U31A 1T4DA 1DAMA 1R4NB 3SYKA 3AVVA 4DNQA 3TMYA 1KQGA 1ZIDA 3O6VA 1GO3F 5AVVA 5A2QA 4JXJA 3T34A 1A7AA 1HZZC 2XB6A 4BFXA 3SXPA 4A27A 3SLKA 4LDPA 2UAGA 3UUGA 4NYJR 1Z2NX 3MTAA 4DEXA 3SVZA 4JWMA 3QY0A 1OWPA 4LZJA 1XKTA 4JNKA 4UNNA 2VWHA 2BFFB 4K5QA 4CDMA 1Y82A 1TI7A 5LBUA 1A95A 2J3KA 4HXEB 1XCPA 3R7FA 3CX4A 1ZSYA 4HGZA 1STOA 3KSRA 2PWZA 2ZJ3A 4DGQA 1GRVA 3GELA 3KYIB 4HEQA 1VI5A 3OQNA 4YI5A 3DAHA 1EFTA 5EIOA 5J0QA 4HWKA 3G0IA 4PLYA 4GC7A 3EASA 4I50F 5JD6A 3KHTA 3QE4A 2VTBB 1QYIA 1Z4OA 1A0OA 1TRHA 3SZRA 1XQYA 4JI0B 1T0BA 3X1JA 3U1VA 1Y3CE 5KFLA 1UIMA 4J76A 1HUZA 3EZ6A 3LOUA 4AQ7A 2NO0A 3VBCA 2QTFA 2K5UA 4EQ6A 1Z4IA 1TECE 4C7JA 4I8IA 4GT1A 3DKRA 3ND7A 4Y2QA 2HQRA 1T13A 3U1TA 5IM4F 2VP2A 3K1AB 1L8XA 1ZMTA 2Q5LA 1U4OA 3V80A 1ZXLA 1W8DA 3CF4A 4FMBB 2QVZX 4I6GA 3A6HA 1P18A 3GJTA 2O20A 1EA5A 1R3DA 1IY9A 5CITA 3KEGA 1FU8A 3EDCA 3DTVD 3GRAA 5DBOA 3UMJA 1Y4SA 2R6JA 2R6AA 4F3KA 2I5HA 2DUMA 3E03A 3CUWA 1QE3A 2ZJ2A 2HK6A 4K0RA 4MUYA 1ZITA 1H23A 3JD0A 4JL6A 3L9XA 3SQLA 3EW7A 1LNQA 1N25A 1F44A 3AUJB 3H6HA 1I2MA 3IBFA 4IY1A 1Z0IA 4PXSA 5KNDH 4DLRA 1Q1EA 3PWZA 3V9AA 3SEQA 4D99A 4V1CA 5K3FB 5M04A 4YUVA 4MZXA 3C45A 2B5OA 1QHIA 2XECA 2ADMA 3M6MD 1RZ3A 4RT2A 1EZ4A 1M83A 5T4HA 1P9OA 1XXHA 1FQJA 3OQPA 2YXNA 1CNMA 1Y7PA 3FDFA 9ICWA 1IPFA 3GARA 2M9NA 9ICNA 4JI5B 1EXWA 4Q4JA 3OA2A 4QZFA 2VRCD 4N5NA 1T94A 4Y2GA 4JV0A 1BTOA 1R00A 1IN8A 4DLZA 4RVFA 1PU2A 4HGQA 3MTIA 1KFJB 1L4BA 4A8JC 2Q62A 1NVDA 5THXA 4W7IA 3LX4A 2B35A 2FPWA 4QZ9A 2EF1A 4WACA 5D86A 4GMFA 5DOVA 1YRHA 4EHLA 2KICA 3SX0A 2C3UA 1N9GA 1XZMA 5HDBB 3PDHA 2VI5A 1RYRA 1CS0A 1OCEA 4R1MA 1SPBS 2ATVA 1JAYA 1S77D 3WS7A 5REQB 2HMWA 1U28C 1OLXB 4UVHA 5HKOA 2B21A 3DR5A 3FUWA 2JLZA 2PE5A 2IYZA 2ES6A 2GCPA 1DXYA 3C16C 1Z8NA 4PLTA 1EFDN 1NWCA 1GLVA 1VJ5A 2H59A 2OP1A 2EKZA 3BD8A 1XZKA 5ECWA 4ONEA 1R7RA 4R63A 2J59A 3LHFA 1DPFA 1KAEA 1JQEA 2PZJA 3VV3A 1Q20A 3WDMA 4IF4A 3C2LA 3KVOA 2Z1DA 1T0IA 2UZIR 3T94A 2FN9A 2C8VA 4ZDKA 2IIQA 4BNGA 4AKGA 4MEAA 4ZVTA 2CPRA 1E7RA 4Y1EA 3DE0X 2O6HA 2GO1A 2GH1A 2IRWA 2YHAA 3C21A 4R1SA 2VANA 1IXKA 1UBGA 5U1PA 4TZ6A 3DWGA 3OEYA 3PFCA 4IX9A 2O2DA 1X9XA 2HBYA 1IBKB 5KG3A 2NO6A 1VI6A 1WABA 1B6GA 2WQZA 3DMYA 3J80A 1TEHA 4UNRA 2C4UA 2H00A 4C7OA 3PUWA 1EVLA 1W9MA 1Z33A 2FJUA 2C20A 4JYZA 2WJAA 4G5YA 3QEAZ 1E2JA 1QG2A 4CMEC 4LDNA 5C81A 2OM6A 1E3WA 1K6XA 3UQZA 4NZZA 1ESZA 3ZDRA 3DUFB 4KXYA 4Y8VA 4RNDB 5C8XA 3I3SR 3UB2A 3OWOA 1QAOA 3VYUB 2ZWVA 4JJIA 2OZPA 3LO8A 5CEEA 2VHXA 3WDSA 5DKWA 1ZQFA 3H05A 4O4LA 2XQGA 2YXPX 3HM2A 5K6RA 2JJ2A 2NZVG 2QPOA 1AUOA 3AR7A 1X8LA 5GZ6A 1NFQA 4XSVA 1P80A 1R3UA 3OZEA 1T29A 3GAFA 5LB4A 5KAIU 4BNJA 3DT9A 2IZ1A 2WT8A 4R84A 1COZA 4IIFA 5AVTA 1E77A 1NXVA 2Z2XA 4FONA 1KQNA 3E9DA 1KI7A 5M34A 4MAFA 3V4VB 1M5RA 4LSGA 3IGFA 1A5ZA 4S2EA 4PHAA 2EDUA 3HFGA 1CQJB 1W44A 4LQ4A 2FDRA 1J0DA 2PEZA 3SKYA 1ZD9A 2H1IA 2OSBA 3RVBA 3KBOA 3AC0A 4GI3A 4B7ZA 2XZDA 3B9JA 4B47A 1FW6A 4JLOA 1YMUA 4ROSA 5F1OA 5I4IA 3QVTA 1H2RS 1Y6RA 1UJMA 1JWAB 1FMLA 3BX1A 2YQ5A 3VHXB 4AXBA 1S8FA 1BMFD 4A9AA 3PWTA 4A10A 2ZT5A 1CQZA 2RG7A 1OTXA 3H5LA 4BNNA 3LP8A 3KBBA 3BDAA 4LOAA 4A6DA 1IBLB 2GRJA 1Y7HA 1EUQA 4B3TB 2QVCA 5KG6A 2DCUA 3NHMA 1RXCA 3ROXA 4PSKA 3S8YA 3A2KA 1VP9A 4P0PB 4B33A 2VKTA 2M1ZA 3ORYA 3LQQA 4RUCA 1GQQA 2KZ3A 1SHLA 4UQGA 3TVTA 3PNYA 1M0EA 2XUQA 3CVVA 4L0CA 4FINA 4LSMA 4E1AA 2WTBA 4BKOA 3O31A 2X41A 5CLFA 1XJCA 3EC2A 2Z83A 4UE3S 5HGXA 4U7HA 4ZVOA 2YCLA 3AM5A 3QVWA 2QTTA 1IK4A 1MABA 1IHDA 5FP0A 2QG9A 4WOPA 5AK6A 2VUIB 2D2FA 1AO0A 1MO4A 1TCUA 2KSQA 4PCLA 4URHA 3IERA 1XF1A 3RHFA 1P1KA 4FYMA 4C2AA 4F56A 4LRWA 2PX0A 5KFGA 1H2HA 3IS3A 4LBZA 4C3UA 3ZR4B 4CF7A 1RAIA 3EOAI 4DCTA 3PDUA 4Y0NA 2RE8A 3BQ2A 4TMYA 2A94A 5JECA 4PZCA 4PL1A 5JNLA 5LQAA 4B2PA 4MQLA 5TR9A 4YCLA 4FPXA 1QE0A 5EIBC 4UASA 1HF3A 5L4SA 2B1IA 4LVUA 3FJOA 4PC3A 2BV3A 3VH4A 5J0PA 1FNSA 4GHWA 4MYTA 3ICVA 3ISJA 4R0MA 1VIVA 1ZH4A 1T8TA 5A06A 2F00A 2AHRA 3GFOA 1U8YA 1QZZA 2YJ3A 3HU2A 4YN4A 3DM5A 3F9CA 2R2GA 1NZDA 5DG9A 2XJ9A 5K8VA 4CLDA 3H4IA 4J91A 1N2CA 1HRKA 3JRXA 4QFBA 2PH7A 3ETRA 4B4WA 4J0DA 1IE3A 4PX9A 4R40A 2M1XA 1RHJA 1CYDA 3T1OA 2LW7A 2YDXA 4FDTA 3I0ZA 1GADO 3EMKA 2JJQA 1NQXA 4M9CA 3IP5A 3CRRA 4ZAVA 2KD1A 1HORA 4L73A 4UZFA 3PC2A 1ZUD1 5DB8A 1NW7A 2JFOA 5CVTA 1O95A 2WAOA 4D4HA 1QE5A 3GZTB 4Z4HA 5EHQA 3JARA 3ZDCA 3RVQA 2IW1A 2QWXA 2EAPA 1UKEA 4YDRA 2GF0A 3DE7X 1K63A 2K4HA 5EGSA 3QE3A 1CR1A 4QOIA 4EW6A 2H5XA 5IVDA 1RPZA 5I7SA 3IDQA 4AKIA 3NVVA 5K4HA 3SZUA 4TLAA 1JH8A 3B1JA 5A3VA 2GCGA 4HPXB 4I6EA 2NO4A 2QK4A 3ZBPA 8ICEA 4LV5B 2GAOA 4FFPA 1LSSA 2DWPA 5CFOA 4ECTA 3WLIA 1Y1LA 3KKAA 1Q3TA 1PZXA 4KK3A 1NJYA 2JKVA 2E8OA 4BFSA 2BSXA 3I0NA 2ZSHA 4ZPJA 5HTOA 4J6FA 3TLZA 4MRAA 4F3OA 1FMFA 3SXUA 1ADJA 3I2JA 4DV0B 5KWVA 3IDZA 4Q24A 1KEEB 3RC1A 4ECZA 4C8NA 4XD2A 4CR8A 1I4EB 1UP4A 3K53A 2DY1A 4U2BA 3OCWA 2CVOA 1ULZA 1KOJA 4KUHA 2KBEA 1VRCA 4BMXA 4HBGA 1JAIA 1VL0A 3TXXA 3W79A 1OC4A 4OQXA 1E9BA 5DLYA 4XGIA 3NB0A 4JQZA 4IMPA 2BR4A 3WK8A 1WB4A 3B52X 3C3JA 4WEOA 2DHDA 2NSYA 5IKOA 4FE7A 4LCJA 4Q3NA 2VXYA 5KG5A 1R88A 4NAUA 2GAFA 4W1SA 4ZAWA 3JAWA 1NOJA 1SKQA 4XFKA 4HLNA 1DDIA 1W76A 3GLHB 2WTEA 2Y9MB 3O8OB 5KAFU 4NC9A 4K9RA 2C4NA 4WN3A 2C00A 2PMZF 2X58A 3USCS 2YMQA 1RCUA 3PDIA 2DZDA 2E1RA 3ED5A 2K4MA 4DJEC 3EC1A 1OYYA 1T2FA 3WQBA 4LHEA 2AH5A 4MRMA 4J07A 3GJRA 3VPCA 5DNEA 1C41A 3FCCA 3RVDA 3ZY4A 1KGDA 4ZCSA 3ZLTA 4QAJA 5A3JA 3HKEB 3FYUB 1K1EA 4XOUA 3CISA 2X22A 5LDDC 1NFRA 4FQ7A 2V54A 5EZSA 3ROPA 4U7PB 4RV9A 7REQB 2ATXA 1PLJA 4DGSA 2BQ3A 3AVYA 4TMFA 1OFUX 4JZKA 4HPWA 4BFYA 3DUWA 2XVYA 1CY8A 4KYIB 2ZUCA 2UU9B 2ODAA 4EFLA 2PBRA 2IOFA 1NQOA 2LBOA 4KPEC 4IH1A 1F9AA 2YRXA 3ND5A 4LBYA 5G5HA 3NXKA 4QDJA 2CHVA 4QBFA 2AZ4A 4D4LA 5HM8A 2I9PA 1SU8A 1SBYA 5IMSA 5DGIA 1ML3A 4LHYA 4KVFA 4GPZA 1E62A 4QGBA 4Z3KA 4BNXA 3EAQA 4FX2A 3TW0A 3N28A 1VCMA 4OB8A 3T7JA 4HQ6A 2C84A 4MFCA 4CCSA 2H18A 1DG1G 1ZRMA 3TCXB 4HEA6 1LDYA 2PBFA 1MJGM 1PQUA 1FUUA 4KQKA 3R0QA 4BJHB 3WGTA 4OU5A 4KR9A 3JU3A 3C2KA 1WZNA 1EM8A 1SVOA 2OFFA 4Q5IA 5EMHA 4REMA 1A0PA 3INRA 2GZRA 1EEHA 3Q11A 3IQGX 4I4LA 2NZUG 3RS0A 1XUOA 1EWYA 1H38A 4F6LA 2B0CA 3AUXA 2ZATA 3DULA 3ASUA 2R4UA 4IUDS 2P2GA 1X7XA 4D45A 3DEAA 4N5IX 4QUKA 4L5IA 1NBMD 2IS4A 1GGEA 4GPD1 2GFQA 4IIJB 3KYBA 3PUYA 2PS9A 1XP8A 5CA0B 4LC9A 1EVJA 2W8ZA 4PPNA 1GN9A 1Z8HA 4A6XA 1GAJA 1S1MA 2ZWMA 3MNFA 1YJXA 2I7VA 2IV2X 4RIEA 1DHTA 3MERA 4OJKA 5SICE 4ZCTA 1NJXA 2EZUA 4O0IA 4DLEA 3GLVA 3JR3A 4WCFB 3BZKA 3E7DA 5JSQA 1S02A 1G6OA 4B48A 4ZMRA 3JQ7B 1P3JA 2Q8NA 2HSJA 1FQOA 4PLWA 2IVZA 4OBXA 2XMSA 3AIMA 4QUEA 3K71B 5LM3A 2R2AA 1BDBA 4DSNA 4I2FA 5K0SA 4KQXA 3EXHC 4F9TA 2G0NA 1K3UB 3CF0A 4TL9A 2F9MA 3A05A 1VKRA 3DDOA 4S1VA 4UBBA 1N2IA 5CB0A 1TQHA 4RQ0A 2BFAA 2D2IA 2IP2A 4F5QA 2Q4TA 5J2TF 1JHOA 5DKFA 3WDKA 4L2IA 5JAIA 3JPNA 9ICCA 2XVXA 1QZ3A 2Z1MA 4Q9IA 2QRMA 5J4YA 3VYTB 3DBRB 3KWLA 2NXNA 1XU9A 4Q4DA 4HDMB 2O2IA 3GMIA 4Q37A 2R6HA 3N6RA 2XHZA 4QGGA 2JRZA 1B8UA 2MMCA 3L6OO 4RQ2A 2ENWA 1QVRA 4QJFB 1YZFA 1NK5A 3W06A 1JWBB 1Z18A 3LVFO 1WLYA 2I33A 4W63A 4XKJA 4EZBA 2NRXA 2CUKA 3UV7A 3ZV4A 1SOVA 3LDGA 1KJYA 4MQ5A 1WA5A 4UNIA 2D8CA 4E13A 4Z7QB 3KT8A 1U31A 4EKDA 4EHFA 3QPAA 1QONA 3AF4A 3NHRA 2P90A 3C41J 1PJRA 5JAOA 5FA8A 4Q3OA 5MN4A 3DPSA 3CH6A 3LC7O 3TO5A 3DE1X 1PL0A 2W93A 1CC1S 5SYNA 5CFPA 2CC2A 4PR0A 2H2AA 2QLJA 5JSFA 3MJTA 2ZUUA 2B94A 4RD6A 1V7QA 3K9QO 1SOAA 1H0HA 3NVYA 1PGJA 5C1PA 4M1WA 3IURA 3CW2A 2NVWA 4EEZA 1NLMA 4US2R 4C7YA 2INGX 2V6IA 4CFYA 5DBGA 2VFAA 2YQ4A 1FSZA 3HR7A 5TF0A 2FAXA 3B9PA 1GTSA 1A9XB 4OHZA 2QM7A 5J0SA 4IRUB 1QQAA 1QFZA 4R3UC 3T7SA 3PRKE 4R54A 4OMDA 4XXHA 3SX2A 3WY9A 2EX1A 2HKIA 2BFFA 3PX4A 4MJLA 4BQNA 1I01A 2ACKA 2ALJA 2EZ9A 1QCYA 3H4TA 4HVCA 421PA 4Z0PA 5CB4F 3TGLA 5DIFA 2Y27A 2HREA 4CJXA 1YB5A 1O54A 3D2BA 4ESOA 1POXA 5LQKA 3EIQA 3HL0A 1NZPA 2YWRA 3S2IA 1AHHA 2FPUA 1FFVA 2VUUA 5D1HA 4PYRA 2H7CA 2VTBA 2WHQA 1RKBA 4DL4A 1AQLA 2VTVA 4MF2A 2LIVA 3IPAA 4O2BB 1YDGA 2KKPA 1AKYA 1ZM2A 1E6MA 3ETEA 3HU3A 4HKTA 3JPRA 4D42A 1J4AA 2UYHA 4FGLA 4Q12A 2WVGA 1MX3A 5ELLA 5FWAA 2AT1A 4IXNA 4M98A 4YRQA 1M7HA 2ISSD 2BDPA 4HAZA 2EC5A 3X44A 1AHNA 5KNBH 3NM5A 3SF0A 4HAIA 3W78A 4EG0A 3ST7A 2PL9A 2CV2A 1KFKB 2O5VA 2QY6A 1FNBA 1ACMA 4QG7A 3GQBB 4B09A 3OECA 3ZHUA 4R3WA 3UAVA 1Z0FA 1ZL0A 3EGWA 3TK1A 5K03A 2YNMA 5FULA 3B82A 4K9OA 1G5IA 2VZ0A 5E38A 2PKRA 4QARA 3OC6A 4X8MA 4RMGA 2QRJA 4QZVA 2GBLC 3DEFA 4ZI2A 3M4JA 1JMKC 4G0XA 2O54A 5MFPA 1IZ9A 1EP1B 4DFPA 5LNK6 4M0EA 1SKAA 1L7PA 5E2BA 3ZU6A 1BKSB 2GPTA 2Q6OA 3BE4A 4R1QA 2G5IB 1WXHA 1XZJA 4MWTA 1AUXA 2ODPA 5K3FA 3VZRA 2C5GA 4CM8B 3GJSA 4E70A 5CVEA 5F1KA 4OLJA 1EWKA 4KHZA 2DLDA 2HBKA 5D3ZA 2ZRPA 3D1VA 3TTTA 4LY9A 4BBZA 1LFAA 3BM5A 3OVMA 2XNDD 4RCZA 3K4HA 4YMOA 3OOJA 1ADGA 1UKAA 3AW8A 3HLKA 4O4HF 2PKYX 4W4TA 4AIRA 4OATA 1Z34A 4DSTA 1SC3A 1DKRA 4JJGA 3IXQA 1D6MA 3HW8A 1UPTA 2LR0A 2D6FC 2XB8A 8MHTA 1CZUA 1XZFA 3C5EA 3M6LA 2PUEA 2ZI7A 4J75A 1UP7A 2FWAA 5K2OA 3MCWA 1PFGA 4TS3A 2YBDA 2VTKA 3MMSA 2WRZA 4GLOA 4XLLA 9ICRA 1YHYA 4ICIA 5LOVF 2H1HA 1R18A 5IIIA 3OM9A 1XZGA 3TTYA 3ZPXA 2C8JA 3C1AA 1P74A 3CC8A 3BQ7A 5BSTA 1IZ8A 5REQA 5F2OA 1C4XA 1OLXA 3MTGA 5C7OO 3E4DA 5ALNA 2BBWA 1CHDA 1IEVA 4B6EA 4PN7A 1QDEA 3IUNA 1QWSA 1SBQA 3FHCB 5BURA 3RC8A 3H2GA 3PQ4A 4AKTA 1GARA 2WJ6A 4TN5A 3FMFA 4YWJA 5LQDA 2IHYA 4U7GA 1J99A 2XWSA 4PYNA 1IAVA 1Q7CA 3TAPA 4O5OA 1JQLB 5T6BA 5T4EA 1ZKDA 4FCTA 1X74A 5J0RA 3C5HA 4B7XA 3IAM6 3VX4A 1H2FA 3KQMA 2HIGA 1Z7WA 4QNNA 2QD3A 1MEEA 4TOIA 1TIPA 1ZSVA 2CLHB 5EINA 4Z7OB 4G9EA 3GA7A 3H5TA 521PA 1GZ4A 1Y5RA 1V3VA 1GY8A 2QYTA 4OJNA 5C7LO 3E3AA 3DOFA 2ZJ7A 3ZXSA 4RVCA 3F3KA 3AJDA 3O8CA 4C3ZA 3IDOA 3C5FA 4G65A 1G5TA 2GUGA 1VP3A 1N7HA 2WE8A 2BONA 4W5RA 4LA4A 2WKSA 1ANKA 2E8PA 1CF2O 2GWSA 1IY1A 5K6AC 2J3JA 1N77A 5JSHA 5H83A 2ISOA 4HVTA 3TYXA 1M10A 4DPKA 3ZHRA 1I2CA 3DUFA 1BVSA 2FLPA 3IKTA 3O94A 3PLNA 1VZ3A 2CUTA 3ZCQA 1TMYA 1ZQNA 4PJ0U 4EGCB 1DXHA 2NGRA 4GF5A 1UPAA 1BWQA 3W8RA 1Y5NA 4Q6WA 5DHAA 3DVAB 3E2PA 3R0IA 5ED0A 3LL7A 3KHGA 3V72A 3ZS8A 1QANA 1OD6A 1PYGA 1XIVA 4KQJA 1DAOA 1IHXA 1LTHR 2ZYUX 1T1RA 1RD4A 3SOPA 5KIAA 3HN2A 1JLLA 3OPQA 3VJMA 3LSYA 2X2PA 3PFBA 2ZCJA 2AOWA 5LYJF 4RDCA 1LJLA 1KEZA 2PH3A 3ONEA 3IAS6 2XLBA 4ID3A 4LOJA 1X86B 1RPJA 1CQJA 1JG4A 4RLHA 3L7KA 5I9LA 3V3KA 2VXBA 4HZIA 4P1ZA 3ZQ4A 8ADHA 2YV3A 5A4KA 1PVVA 4MW9A 4HQNA 3H2YA 3HUUA 3NBFA 3ZTWA 2HJGA 2OHVA 4TLDA 3LYSA 5IIKA 5L7WA 2IBSA 2RAVA 3VHXA 4JSTA 4UKDA 3WJAA 1VIDA 3WB9A 3JWHA 3H0KA 3QFHA 3UVEA 5AR1A 4N8DA 1XNSA 1D2CA 4ZTUB 2VC2B 2R8KA 3FFTA 2O48X 3WIOA 4OI2A 3K1YA 4PF1A 3LXXA 3KSZO 1VE9A 1V48A 3M2TA 4F9FA 2B1GA 2F8TA 1UMBB 4UJ3A 1IN6A 2RH9B 4JMUA 3EIOA 4P0PA 2QN3A 4OHBA 1UL1X 2I9KA 1F6WA 4RZHA 5GJWC 4OIMA 2QMHA 1NBAA 1MVOA 2AGVA 4TTJA 3FMIA 2BRUC 9ICHA 1BPDA 5EE9A 1XKXA 5KSWB 3A9VA 1SD1A 2NP6A 4MUMA 1GM5A 1UDXA 1Q14A 2B83A 2W6OA 3L82B 2HF2A 2FMFA 2QL9A 1TGYA 2Y8EA 1LPMA 4BBPA 1SB9A 1KRXA 5KJEA 5KZMB 4C0LA 3GFSA 1OIWA 4F2PA 3R5SA 4CF4A 1Z5ZA 5EQTA 3W7BA 3U4DA 3QX9A 1UBNA 5EUBA 2CZCA 4P82A 1S89A 3ZZUA 5C8DA 3S5UA 1XZHA 1NBEA 4LJAA 2JEOA 4LRQA 2C7GA 5IZCC 5SYMA 4XJVA 2DWOA 4E12A 3G2KA 3UUWA 3STYA 3L7DA 2XHEA 3PK0A 2I55A 1S4MA 2BF7A 3AJ8A 2P5YA 5F7JA 1R9MA 4FKMA 1YJQA 2X7JA 3W6OA 3F8TA 4TZKA 1R2QA 1MW9X 1J90A 3C2QA 5KQPA 4FLEA 3ESYA 3D6AA 2RHHA 4ZU3A 1R10A 5JWHA 1IN4A 4MVCA 3F3YA 3I1JA 2BGJA 4HRYA 4FMDF 2Q0SA 3INYA 2H4ZA 3BE6A 2Q3CA 2RRDA 1L4FA 5EHGA 2J6BA 3TFOA 5CT8A 1VL5A 3LPDA 1U2SA 5L3ZA 4OHMA 5LD2B 3PA6A 5G3ZA 5KG7A 2XZPA 4DA9A 3ZEAA 4B9MA 5KJCA 1L5GB 2HZ7A 2GRAA 3K70D 2PU5A 2H2IA 2MMGA 1TZJA 3FPHA 2B9EA 1F3LA 3QZ7A 3FYCA 4Z51A 3ZLVA 7ICIA 4HSEA 1DRJA 3K0CC 1TAGA 2BIFA 3DMHA 4ED6A 2HBQA 4OXYA 1P7DA 1I6KA 1GL6A 1EFPB 2P6OA 3HB0A 1ZYQA 3L2OB 3I45A 1IJEA 1APBA 4EZEA 1Q7EA 3RHZA 4LF7B 4YAWA 3CCCA 1I5EA 1POWA 2XYGA 2FOXA 1RWKA 2H1RA 3H99A 2CD9A 3X2FA 1RS0A 2UXBB 4E3WA 3MGCA 5EWFA 3LY7A 1N8NA 2KJ5A 3IVAA 2XUKA 2X4DA 1X8JA 5JYCA 3Q88A 1JA0A 2ZE5A 3FGZA 1S9FA 3WMRA 5ADUS 3M7DA 2VDLB 3GFVA 3QPVA 3P27A 1D2MA 3C3PA 5GV8A 3EYAA 1NPTO 5FUBA 3CZPA 4M9UA 4AULA 4I2IA 3B78A 3OE7D 4TKUB 2JBAB 4X90A 4L4XA 1YS7A 3QF4B 1XTQA 5IN4A 5CIQA 1K9VF 4KZKA 2QHXA 3AI2A 4TPKA 1GGVA 5KINB 5CFZA 3TZLA 2WICA 2RGUA 3LGXA 1KEEA 1JLRA 2GD0A 3ZOZA 4AJKA 5TQJA 3GC6A 3DLIA 4AQYB 1L4NA 3RG8A 3E9MA 1J8MF 2QZ4A 3VPFA 3TLKA 3IP8A 7YASA 1VJ0A 5B1EA 1TA4A 4AO8A 1YJ8A 3GJ0A 3WMGA 3V7YA 3W6NA 4II7A 1W47A 3B12A 1ZCZA 2CYBA 4BBAA 3Q8RB 2JI6A 4TKVB 1ZGCA 4LE2A 3RKRA 4HL6A 1AU9A 4J2HA 3I04M 5CRXA 1KMHB 1A2QA 1E3LA 3AVTA 2XYRA 4Q4CA 9ICEA 4H27A 5KHAA 1HYEA 1DEHA 3GLHA 4DCUA 1X8XA 1WVGA 2EVWX 3O8OA 2YWCA 1VSVA 1F9EA 3W2TA 4GZ5A 5FLXA 3V3TA 2IYOA 2O2CA 2HHAA 1VG8A 3E58A 3OOYA 4YXWD 4FYWA 5B36A 4I1OA 1DIOB 3GH3A 3Q98A 2J3LA 3DTVB 3W6ZA 4O4LF 1I3MA 2XDYA 3HKEA 2C95A 3FYUA 3LQRA 3HWTA 1CZRA 4CKYA 1ZMOA 3JV7A 3D2SA 5BR8B 3GI1A 4KIWA 4Q47A 4HGOA 2HCBA 4ER6A 2RCNA 7REQA 1E2FA 2GEJA 3PR4A 2XY5A 3ZE1B 3WAJA 5F9NA 3CMCO 3BSYA 1EG7A 2EV9A 2V7XA 3SIRA 3WLLA 3K0EA 4OLHA 4M88A 3LYHA 1H2XA 4RPLA 4I4IA 4RTMA 4NMHA 4R8MA 1EVZA 1JJBA 1SWWA 3D64A 4U6SA 4BNDB 5DE3A 2P0YA 4M2YA 3B3GA 3A4TA 5E4TA 4IILA 4C76A 3BWMA 1LB1B 2HPHA 3HN7A 5DLDA 2IXTA 4EH1A 1TM4E 4PAOA 1PRYA 3NTXA 1GKUB 1W73A 1REQB 3SVTA 3RB6A 4L0MA 3DLBA 2H4JA 3IVMA 3E2MA 4BJ6A 3L4JA 5JLJA 4DQDA 4JJ4A 3BHJA 4LF4B 3ZIAA 3TSOA 2IHMA 1UOQA 1E1QD 1P62B 1PJQA 3UM9A 2Z3WA 5KBYA 4DCNA 1UOOA 2HA4A 2J5RA 2F8LA 1WXXA 4RIFA 3OM0A 3K1ZA 1ZXIA 4IKOA 3PJRA 3EF1A 2OXTA 4UM7A 3I01A 5DK6A 3VTZA 4KLRA 2JHAA 4XYGA 3HKZC 1JHDA 4M9JA 1A72A 3T5MA 4UDOA 5J3JA 1OXVA 4FEGA 1DUSA 1DINA 5ALUA 2D0IA 2AEFA 4YDHB 4M54A 5H8WA 5BPCA 2V65A 1UUFA 1KOFA 2HHVA 4OP2A 5AVWA 3NKFA 5AKHA 5AVYA 2WVHA 4WD3A 4IIJA 1G9XA 5J1TB 4GI1A 1KH2A 3NDJA 2YXBA 1IEWA 2QPTA 2QP4A 3BD9A 4XVHA 2AEJA 4D9CA 3FVQA 3L7LA 5B1SA 5JNWA 1RWVA 2C2WA 2JIZA 4XR9A 2VG8A 4YTEA 2W8BB 3TKAA 4HB0A 4X1YA 2IIBA 1ED1A 4LXIA 2XTNA 4XPIB 1NRXA 4WK2B 4YPVA 4WCFA 2Y1FA 1H5UA 1Y80A 2W43A 2OUIA 3JQ7A 1EFKA 4C4YA 1D0IA 1R4ZA 3GZJA 3P5SA 4WK6A 3SF8B 1ULTA 4DJAA 3IDFA 3B8EA 4DUGA 1HTWA 3BUSA 3ELDA 1EWTA 2PFKA 3OHSX 4CCHA 4AJ2A 4EWLA 2IX3A 2DETA 2BCRA 5KG2A 1PQYA 4ER5A 1QFXA 1WUIS 4BFLA 4ZQBA 1Z88A 2Z43A 1MQ8B 1QH0A 3HP7A 4EYGA 2BC9A 5DX0A 2V1UA 1X6JA 2XY4A 4FOLA 4LF6B 4E2ZA 3IH5A 4OYYA 4NMWA 1E1KA 5DT9A 3AILA 4QDZA 4IO1A 3PFFA 3B6MA 1X40A 3DZBA 3DBRA 4QTXA 5EESA 3WHKA 4HDMA 3WAKA 2YVUA 4BLUA 3RU3A 2ZRCA 3WO0A 3DYIA 1Y5MA 2BHSA 3EUWA 4U7DA 4KQWA 5E4JA 4KQEA 3RB4A 1D6SA 3IMEA 3VU0A 5CJJA 4KODA 4KL8S 2FZKA 3IA7A 2WY2D 3WLEA 2FCRA 3O9ZA 4P2HA 3TQSA 1TZKA 5IIJA 4E31A 4Y9RA 2FEOA 4PGGA 4DEZA 4GS5A 4EUSA 5C46F 1CRPA 4PYJA 4YACA 1CQXA 1OVMA 1Z19A 3KQPA 4UPVA 4RDHA 1H2AS 4RJTA 1E8NA 3GLHE 4S24A 5B58T 4C3VA 1SOUA 1AZSC 2Q3MA 3NPAA 1E3JA 3IL2A 5KWJA 5CR9A 3JR7A 3THOA 2WKRA 2GTPA 1DWUA 2HWKA 4J16C 2ODNA 3RSOA 3S29A 2YXLA 2ZXIA 4MP8A 2Y1IA 4PQEA 1J6UA 2PLNA 4NESA 2TSYB 4EB0A 1A9XA 5A0TA 1CUVA 2PS0A 1HH4A 4X6UA 3H0LB 2PKEA 5AW7A 3FSRA 2J6TA 3PTAA 2PFPA 5E0OA 3ITDA 5AKZA 4DLUA 1FYWA 5ADVA 4MPDA 4GYKA 2PXXA 2RC6A 4U2FA 4RU1A 4YY3B 3DTTA 2YWXA 3K6KA 1LSUA 4BGVA 3BWDD 4JH0A 3A32A 1MQ2A 3RRJA 3LHSA 4JHXA 1GGMA 4OV6B 2FW9A 5CVUA 4EO7A 3FOZA 4E5VA 4U00A 3JWGA 2P3LA 2Q9UA 4TWIA 3L6DA 4YP7A 4M36A 1G4UR 2NTEA 2XOEA 3Q72A 4BNYA 1Y33E 3ENKA 3RGWS 1NVEA 3COJA 2FMXA 4WESB 1ZD3A 1S3IA 3SCZA 1P4GA 2V7QA 4EG8A 4MGYR 3L8MA 1U04A 4RH0A 2WA1A 2IZ7A 4TTAA 3S3TA 1CEYA 3KT0A 3SHQA 3IQEA 4ZV4A 2DR2A 2Y9TA 3SM9A 4CV2A 4O2BA 5D6NA 5BVGB 1NRWA 3TRHA 1NN1A 5BMOA 1U90A 4PLVA 1D4FA 5DLFA 4KK4A 1IN5A 4IDQA 3T4EA 1LBTA 1F2DA 5GWXA 4RL6A 3QWFA 1MOZA 2A4MA 3UCFA 4M9QA 1NM5C 4NLBA 3Q15C 5KNIA 4UPDA 1U8CB 2IYUA 4RFVA 4JT9A 4WA8A 1TDJA 2EYQA 2ORWA 1F20A 2FV8A 3GQBA 3B9BA 4F6CA 2G9RA 2VO1A 3FPKA 1D07A 3DB1A 1SVWA 2XYQA 1C9YA 3NHYA 2WG2A 3WYFA 4JEHA 1EGHA 3EXIB 2PIDA 2WFMA 1OXUA 4IQUA 1G59A 3CQ9A 3BQ9A 5KDOA 1TQ8A 2YTUA 4DJFC 3G2HA 1F14A 2HA3A 1NONA 4P0QB 4JDPA 3WSWA 1P8AA 4I1VA 3T7EA 4P36A 3TQHA 3KUCA 2ONYA 2A9QA 4JCOA 5FXMA 3VR4A 2V59A 1SY7A 2R62A 2UZ4A 2ADOA 1LNSA 4I66A 3QBDA 1THZA 4X20B 3WLOA 2XE6A 5EHXA 4F9EA 4CM8A 1AZTA 5JS2A 2X76A 5BQFA 3WBFA 4JA2A 4I3FA 4EUFA 1XNHA 4BYGA 4TLMB 2W3RA 4QFDA 3EZ2A 4ECVA 1ONOA 4M1YA 3U9SA 2G09A 5EPEA 3V2HA 2YHUA 2CJPA 3WLSA 3TIXB 4LJLA 1FDWA 5LA6B 1Q77A 4IMIB 2ZSBA 3F7NA 2IYTA 3PX7A 4FGWA 4U1RA 4UB6U 3ZD9A 1MO3A 1U9IA 2H0RA 4R8SA 2JH1A 3ZZ0A 3GV8B 3A11A 4AWBA 2HHJA 1CUGA 5K8IA 1KBOA 4R69A 5ICFA 3T0IA 1YS2X 3VC7A 2YN2A 1FLAA 3DEYX 3FPFA 1MJHA 4P92A 2JASA 2OILA 1VBKA 1Y8QB 4ACBA 1NV8A 3CRMA 3ED1A 3NBAA 5LCXA 1DKLA 1JBKA 2PMEA 3ZY5A 2B69A 3D7MA 3GZFA 5CPFA 3K09C 4WKGA 3TAHA 5F5NA 3OTHA 5EHZA 4P38A 4LJKA 4XX1A 2PMBA 5K9ZA 3PFWO 4BO5A 2PGXA 5FPKA 3VMFA 3GXOA 2NLOA 2NVBA 1A9PA 1GPKA 4KXUA 5KTYA 2CHUA 2HF7A 4C4SA 1L7AA 5KFKA 4PFQA 3F6BX 1S0OA 2C4WA 1BGWA 2XAAA 5H1YA 5JDIA 4H0NA 5FH9A 3H2IA 1NKCA 5DTJA 4CPDA 3LWLA 1PIWA 4Y2HA 1NMSA 3KJNA 3V9PA 1NJGA 1DKMA 1WSAA 4LCEA 4DF8A 1RI5A 3R3SA 4J0QA 1QR2A 3P2KA 4AROA 3TRIA 4RF3A 1ZQTA 2ZSDA 4QGHA 3MVEA 2QS9A 4RHTA 5AK5A 3MB5A 1DMSA 2WA2A 4S0ZA 1CFZA 4ADSG 1J2RA 4DS4A 5JZVA 2BZ0A 2Q5EA 2IW3A 3P2IA 1UXHA 3A4VA 1OT5A 5TV2A 1AKMA 2V5AA 5FT9A 4LFBB 2ZWIA 5ALHA 2JGIA 2ERYA 3P26A 4PPFA 3MDAA 1VECA 1M9NA 4X45A 2F3TA 1V8DA 1IZZA 1HETA 4L5CA 3GCWA 4KPFC 4QZDA 5J0XA 3WG9A 4LMAA 4C0AC 5LJLA 3ZU3A 4N54A 2PGAA 3UOAB 1W4CA 4YDQA 4E21A 3BT7A 5AKEA 2VHYA 1MNQA 2YS6A 1M8JA 2I9GA 3OY7A 4A0SA 2P2LA 1AG9A 2NTJA 3ND9A 3CE6A 3TQQA 1JSCA 3FJYA 3VFDA 4QU0A 2H08A 1XZCA 2I67A 4G0ZA 2G67A 3Q8QB 3NH6A 4MIEA 1V1RB 1NK0A 2RGNC 2PA0A 3QUAA 2KM1A 2DKFA 3PS9A 2IFTA 1SIWA 1EJ0A 4C6TB 4EJSC 4JSYA 5JTTA 1BD4A 2HEGA 4YCDA 1WHTB 2LCIA 4BFZA 3E27A 4IQ4A 3NR2A 2VWQA 1KYYA 4D7AA 3JPSA 3RRYA 1VL1A 1XQVA 2UVVA 2M2IA 1X3SA 3HP6A 3BMXA 1RWPA 2ODEA 1IATA 4R9RA 4K9DA 4EY3A 2O19A 4D3XA 4QUJA 4D26A 5MDHA 4I2DA 4LHSA 1ZGJA 2A0XA 3ZHYA 1JDUA 3HYLA 2EKQA 3BSWA 4Q03A 2XSZA 4L5BA 2RHTA 3KVRA 3STUA 3ESDA 1PR2A 3I9V1 3AU9A 1DOAA 5EWGA 4OXKA 5CLJA 3VKWA 3EEIA 5KVVA 3IAFA 1M6VB 4PSDA 5JWRA 2KJ8A 1RCTE 2V96A 1KTIA 1B6SA 4A73A 1M2EA 2XXBA 5FOTA 3GRUA 1NX6A 4FXPA 1UMBA 4MUHA 2PJRA 1B6TA 1ZK3A 5FKJA 4GMKA 1OUMA 2B4YA 1IXZA 1IUKA 3LNTA 4J29A 5C5CA 1HYGA 2IHTA 4PY2A 1WZCA 5IZ4A 2B8NA 2FP3A 3G2MA 1Z4KA 3QOYA 2WB1F 3MHPA 3L1JA 4BKPA 2ZJ6A 2IVFA 3LC2O 4WN9B 1ZGBA 3AV0B 4PICA 5JUMA 1TVKB 1NMYA 3KD2A 4XJSA 4QUAA 2XUHA 3EZYA 3OLZA 2OMKA 1ZQUA 5B3AA 1GSHA 3FLBA 1KDHA 5J23A 1QTRA 1FTNA 2Y3IA 1I3CA 3TZ6A 2XB4A 3WBKA 1GZUA 4EDFA 4C05A 3OJOA 5J2CA 3WIDA 3EZ7A 3T7AA 2XNCA 3L8DA 1ORIA 4EENA 4KW7A 4IRDA 1M74A 3E0FA 4TLLB 3MGAA 3WA7A 1Z29A 3RBDA 3MUFA 3UNXA 4LN1A 4NYMQ 5LLDA 3RSQA 3BFKA 3ZHTA 3EZLA 1ZRSA 2HSDA 4WCDA 4Z86A 3RV3A 5D5PA 3UF0A 3SC2B 2PYZA 1RI2A 4ZICA 5IRCD 1P4AA 1EK5A 3WWOA 1CY1A 1JU4A 2FEAA 5AQ1A 3DXYA 3BXEA 5AIBA 2H5EA 3VR5D 5DGAA 1L5ZA 2QUIA 1XMQB 3ESQA 4V03A 3H9GA 4WY8A 4KJZA 5I5GA 1HUQA 1GSIA 4O2LA 3BJEA 1DHRA 4XCQA 3NC1C 1DB3A 3TZBA 2F43B 4ODIA 3AETA 3MBIA 2GB4A 4ZANA 2P4SA 2JEIA 1KS2A 1XEFA 1P1BA 4N5MA 1O94C 3OPYB 2ESEA 1LBIA 3CF2A 4BFTA 1YB1A 2J4CA 3HGQA 1CUEA 4MMXB 5KQSA 3RVLA 1P19A 5GY7A 5K45A 3KTDA 2GD1O 2YZNA 1DIBA 2I3AA 4M38A 5HUQA 1QOZA 3WGQA 2ACVA 1EFPA 5GGYA 3OU7A 5G40A 3PT9A 3W5SA 2YV4A 3IQFA 3OCCA 5A5EA 3GAZA 2WPDA 4C7BA 3T3NA 4JLAA 5EFZA 2G1UA 3CLKA 3E61A 4DV7B 4M60A 4GXTA 1H9CA 1JFVA 4Q4HB 2X8LA 4YAGA 1N3BA 5AM1A 5K8JB 2P8SA 4FZ3A 2FR8A 3SG0A 1BRTA 3RUEA 3WB0A 3B85A 1TZBA 1RLMA 1W4ZA 4ER3A 3JTEA 4S05A 1FSPA 4DCVA 1PVOA 1NU8A 4JIGA 2QAGB 4TKUA 2JBAA 1O89A 1SMKA 3QF4A 3L18A 4AJOA 4EG6A 3U56A 2M9MA 1FJHA 1VE3A 4AUNA 1TAHA 3R41A 5KFWA 1C3VA 3KKEA 4GXNA 2UUAB 2O8VA 1Y9AA 1Z8DA 2DTXA 2PEYA 1JI0A 1ZPDA 4WOJA 1P2BA 3VU8A 1MF7A 4P08A 4JNCA 4ED8A 2Z9DA 2EAOA 4NSNA 1MHPA 1NX9A 4NULA 3JQFA 2H3FA 2ZTVA 2GGSA 4NDZA 7ICOA 2O6LA 2A1TR 2ZBFA 3HG7A 1I7QB 4PC7A 4RVOA 3RSZA 4J9QA 4R9UC 3AIKA 4QECA 3GG9A 3FW1A 4TKVA 1WOMA 1L1QA 1OZHA 3L7CA 3DCNA 3EPPA 5BYBA 2A6PA 2NTNA 3IG8A 1E4EB 4RDIA 2ODGA 3REFA 5TGZA 2VOEA 2DRIA 3N70A 3LC1O 3AO0B 1KMHA 5DHPA 2H1VA 2NZXA 1RVV1 3T0GA 1W6UA 3PVSA 3FVVA 4QBHA 4PZYA 4BUZA 3DT8A 5ITWA 1EPUA 1PQWA 2WYIA 4FHEA 3FWHA 2FN4A 4N8EA 2JGLA 3V8QA 3IEIA 1UC8A 1XWLA 1DQZA 3A6FA 2A9OA 4INPA 1NVKA 4G5XA 5KVCA 4FFRA 3RKUA 3CWCA 1JDJA 1UFVA 3DTVA 3UHOA 2EQ5A 5L7YA 4LWQA 3KKLA 2W2XA 3HA2A 3N7TA 2ZAYA 4B81A 1RBMA 4FUQA 3HJEA 3RD5A 4H7JA 1P0FA 2X8AA 2VYND 2P3OA 2Z4TA 4YFKA 3LP6A 5JD3A 3RARA 2IS6A 1JEYA 2AKEA 1SZHA 2HBJA 1BHSA 1DCFA 4WXEA 1L4MA 5B6PA 3VU3A 3H42B 4K03A 1O97C 1ZGGA 4ND7A 3NU1A 4F86A 4G5SA 1LK5A 4BNDA 2CNWD 3PV8A 2REXB 1CDEA 3VZPA 2CKMA 3AB8A 4Z9FA 2J7KA 1PX2A 1SUDA 2RHWA 1P7WA 3KHRA 4FGUA 1KKXA 2VH5R 3WL8A 1A04A 2CLLB 1REQA 3MJEA 4FR2A 4L5AA 1ABBA 3UH0A 4UEKA 3F1LA 4EA6A 1KRPA 5HOEA 3Q9LA 4ETIA 4ZCQA 3FXAA 4YRBA 5C35A 4LRXA 3OTOB 1XU7A 3SDBA 3IIKA 1ZD1A 4KIGA 3TNFA 2IHKA 3GV0A 4M7RA 4EHJA 2DX7A 3H11B 2QV0A 5L9XA 1IAQA 1PTJA 3FA2A 2NAFA 3ABSB 2WAAA 1K4YA 1KMNA 4Z8XA 4NYIR 1G8HA 4MI9A 1NQAO 3LUHA 3ESRA 1SO8A 3EPKA 1VXOA 4DLPA 2I29A 4RH1A 1R4NA 4C21A 4C0BA 4C4PA 2CVPA 1G2IA 2EJWA 4H6XA 1IZ0A 4BWGA 2AI1A 3KQSA 2HVHA 4UPEA 1ZJ6A 1LDNA 5FPYA 4MIYA 2OWOA 4PEVA 4MEYA 3PEUA 1OXSC 1KYWA 1PW7A 1VC2A 3L41A 2F1KA 3IR7A 1GV1A 3W5DA 5I4BA 2HRBA 4BBJA 1Z28A 5I8ZA 2IBKA 1F5NA 1SB8A 4UAUA 5KWSA 3P9YA 4UB8U 2EFEB 2W8BA 4BRSA 2CLMB 1M54A 3MR3A 3T9AA 4XPIA 5LR6A 2M0NA 1X6IA 4UEQA 4EP1A 2X9NA 2D2VA 5BQ5A 3SF8A 4G1BA 2J46A 2AN4A 1KRHA 1LLFA 3LUBA 3DDNA 5BWBA 3VJKA 2PTHA 4W1PA 3KR2A 1GT6A 5TQ0B 3KZKA 3EFBA 1M2NA 3AF3A 5ALKA 4R1PA 4GI2A 1A8PA 5IJ9B 3FOFC 4G25A 5EPUA 3TF5A 4BV9A 4FZVA 4G8CA 1Z2AA 2YV1A 3T5JA 2QGFA 1V6CA 4UDXX 1OXXK 4UB1A 3DOEA 4EGJA 4D98A 1M72A 3KCQA 3UHFA 5FFMA 4FNAA 4U39A 3FYTA 5IDYA 3T79A 2ESRA 2VEOA 3U37A 3H75A 1O57A 2V5UA 3QEBZ 4OF4A 6PFKA 3K1AA 2DKZA 1N2GA 4AECA 2H3IA 1AQYA 1RXVA 4B79A 1RACA 2GM4A 1X14A 5AKKA 2X1HA 2JJYA 1A4XA 1I9GA 1COKA 1P5RA 3IT1A 4XM2A 3EA4A 5ESRA 1U9YA 1YAHA 4D9EA 5EQJB 2NSHA 4NCJA 3D6NB 3NCHA 5KREA 5KNLA 4ZKEA 2ZAGA 3RVMA 4GP7A 4OUKX 5KOHB 1Q50A 5B2ZA 4J7XA 3F4BA 1F8GA 2OXFA 4L51A 1GR0A 2N3ZA 2XE7A 4RXTA 4P32A 4UREA 3CY6A 2WUEA 3GRKA 5A2GA 4FLFA 16PKA 3K0SA 3P71T 5HK8A 5I9BA 4RQ8A 2ZRGA 3OEHD 3ZV7A 5CLQA 3IIJA 1DO0A 1WW8A 3GN2A 4IRXA 4F1KA 3JASB 3OJUA 4N6OA 1J5PA 5FOUA 1AA9A 4F06A 3BWEA 3I1FA 2VYFA 1QIIA 5JC8A 1MXHA 1JLHA 1BE1A 3RAPR 3O1LA 1OJ7A 5FWNA 4F4UA 1A2BA 2WHEA 3KLPX 1G3IA 1K6JA 2XAUA 3CLTC 2JLWA 3CZMA 2PAAA 1PSZA 5C8YB 3KB2A 1YS1X 3ZUGA 5JBIA 3STVA 3OZRA 3EGCA 4WESA 4FWBA 2YWHA 5JCZA 1WUDA 4FKBA 3W3AD 3AQEA 3NWJA 5HG0A 4DQLA 3L0BA 2A88A 2H1OA 1NOIA 5BVGA 3NGXA 2REBA 4I5GA 3MJHA 3E5MA 1GHTA 2W98A 2XUOA 1F0PA 3H5AA 1L4HA 2FLVA 1JH9A 4I1PA 5JQWA 1ENPA 3HTXA 1TC1A 1BN7A 4RQ5A 2JIDA 4M7PA 5IBQA 1YCDA 3GFFA 4IV8A 2Z2JA 5FTNA 4QU5A 2DPGA 2A3NA 4O1MA 2PSEA 5L3VA 3FJ1A 4HDOB 1VCHA 3HLTA 1UC4B 2OHJA 1AOXA 1E7WA 1G3MA 4W6QA 1MC5A 3TDNA 1JDNA 2P78A 2OECA 3EXIA 1ZK0A 2ZRJA 4QNLA 4KFCA 3ETJA 5HOQA 5D5QA 1QZUA 3N2IA 1KFEB 2PKQP 2QR2A 3W5JA 3U48A 2FPGB 1N6PA 1F6BA 3LWMA 4L22A 1A2KC 5AJZA 4ZODA 2A2ZA 4MS1B 4B4DA 4P0QA 3QU9A 2X3UA 1TJ3A 2PPLA 3HX0A 3DBIA 5KKCA 2WIAA 3D8HA 1E9VA 3TL6A 3SM3A 1IDN1 2ZXUA 2QJTA 3LYLA 1GNTA 4YUYA 4PCVA 1B43A 4QW9A 1P2FA 1ZQRA 4OSEA 4C4RA 3JYHA 2YH2A 4IL5A 4Z49A 2Y1OA 2ZSJA 3K70B 4LBWA 2ID8A 4XVCA 4ZOEA 1W0CA 3T3HA 2IP4A 3WTBA 4MQ4A 4PFKA 1KEVA 3TADC 4OQMA 3N2KB 5LA6A 2V6BA 4HC4A 2Y1DA 1Z68A 3NBUA 2ODWA 3WKCA 4KC0A 3T5BA 1A7JA 4J94A 2O57A 2Q8PA 1FRNA 3A1DA 4X24A 4UMDA 3VR6D 2E8NA 5FBRB 3LDUA 3B2NA 3HJGA 2VATA 4W1QA 3H5OA 2HLNA 2YMMA 1Y8QA 4B17A 3FUTA 3RNOA 2FFJA 4U7WA 4IKPA 1PV2A 5J2JA 2QBYB 1XN1A 4I8DA 1D9DA 3QOWA 1T26A 4P7GA 4ND8B 4RVGA 2XE4A 2PUGA 4V2UA 4BX9A 1BHJA 2LV8A 3T61A 3R20A 4P2GA 1YASA 3PC7A 1FZTA 4UCFA 4RL4A 2WF6A 1T8YA 1YNOA 2ZDQA 5GM2A 3UA4A 5TSDA 3FKSD 2N1BA 1Y6QA 1YHZA 4IIJF 3AKDA 1KH3A 3HZOA 4F71A 3NDRA 3R7DA 1QFJA 5CA0F 1KQFA 4DLKA 1Q57A 4AT1A 1ZBDA 4M1MA 2PD3A 2YUIA 4OQQA 3CLUC 3O7MA 2OE2A 2O5RA 1CDDA 4ZN6A 4R4JA 2Q3JA 4G0VA 3D59A 1E4YA 2GJ8A 1D8BA 1PNOA 3S1LA 2BGKA 3CNQS 3AM4A 4BNMA 2QSZA 3P19A 1VHWA 3V6JA 3D3QA 1Z5UA 4OA8A 5HJEA 3ELWA 2CF6A 4PGQA 3LUKA 1ML4A 2ZBEA 3UMVA 1YV9A 4QVKA 1X3LA 3DV2A 2ECFA 4BGIA 2QUKA 4P53A 3TSCA 2R1ZA 3DC2A 2H5JA 1AGPA 1OX5A 4I2JA 1MD9A 4DM3A 1LI7A 4D4KA 4KAFA 3IVCA 5L6LB 1NT4A 2P6PA 1IVNA 3CNBA 4X1KB 4KWTA 3IQIX 4OU4A 4R8KA 1U0OC 2BD0A 3WLTA 4HNRA 4N8SA 1I3NA 4OSOA 4WBNB 2CDCA 1U7OA 2IEZA 1ABEA 1EQAA 4ARAA 5BR1A 2R7AA 5FBHA 4UCXA 2DT8A 4E30A 5J4HA 4YUXA 1LBEA 4C4TA 1KHHA 3IOYA 5T3UA 3PRYA 4LYFA 3A36A 2JVJA 2XNHA 1X7YB 4GZ3A 4A0QA 1H6AA 1ODLA 4EY7A 1XRJA 4EYOA 1E5TA 4RJKA 5E3IA 4Z2YA 2ORIA 4JGIA 1OZ0A 4E08A 1H0RA 1E4VA 4RTNA 4GE0A 5G0UA 4MKFA 3TNLA 3UWDA 1JROA 3LDAA 4ZO8A 1V1RA 1HRDA 4KFSA 4TMZA 1ZQKA 3M8SA 2PMWB 4QIWC 3C4VA 3K6SB 4RNOA 3NFRA 4C6TA 4M0LA 3ZV3A 3EZ9A 3FNBA 2W9AA 1DBPA 3I5XA 1MQ3A 1WHTA 1RPAA 2AI2A 3D4IA 2HMTA 4B73A 1TB4A 5PNTA 1G8JA 1EK1A 4ZYTA 5IASA 2W6NA 3THXB 3C6YA 2LGJA 1E2QA 1D2GA 1BXGB 1JBEA 2BCJQ 1FA9A 4DJ5X 3GJ6A 9ICTA 3OT5A 1MVNA 2A58A 2B6NA 1Y3DE 4EGAA 4JYAB 3LZ6A 2A1IA 4F5RA 4EHDA 7ICEA 2BE9A 3GRRA 2GPSA 4UTRA 3VCBA 1O96B 1E1DA 1OIXA 4FZMA 1F0NA 3AR6A 4WFQA 4K88A 2JLVA 3PTZA 3N6VA 1ISGA 1BN6A 2N0SA 5LC1A 3O2NA 2NXCA 3NMUF 1UFRA 2DFKB 1Z56C 1RZTA 1CUDA 2XQJA 3LHKA 1GNQA 1DT3A 4JKYA 3ZHQA 4PLGA 3PE4A 4COKA 1NTRA 3C5VA 5AHWA 4RK4A 3ICEA 6Q21A 1Y8CA 9ICFA 3IBCA 1M6VA 2EGHA 1BA2A 2G28A 1QIEA 3TRFA 2DH6A 4NY1A 2YV2A 2HT1A 4U02A 5FPHA 3R24A 4JT4A 4XQEA 2PH1A 4CKZA 3QPCA 2AZXA 2Z2ZA 4WXRA 3UQ2A 5TZVA 2JLYA 2KZMA 2ZB7A 1SXPA 2HR1A 1GFWA 1U47A 4HBZA 3SY8A 1A8HA 1C30B 2ZUTA 1LX6A 1Z26A 4PGMA 5F9MA 1JXLA 4UUMA 1LS6A 4O2BF 1U3VA 1N5OX 4JD5A 1PFYA 2IX9A 4LY0A 1AXGA 5BV2P 2XRZA 3K16A 4QUIA 4RS3A 3A0HU 3JALB 4FEYA 1C3XA 4JLJA 1TVKA 2QI9C 3CVWA 1OWNA 3ZHSA 4OXNA 1NMEA 4KAXA 3JWJA 4NTZA 2ZXFA 3CNNA 1QYXA 2VNAA 1JQ5A 4NBTA 4RCYA 5JRJA 5EXPA 1Y3FE 5FI3A 1CETA 1WF3A 2WWIA 4OOFA 3OICA 4CKXA 3PGMA 1DAFA 1KKMA 1PZHA 3RNLA 1VIMA 4JFAA 2I7TA 1F8XA 3O8QB 5I45A 2XWQA 1E2UA 3UV6A 1KO4A 2E5FA 4L57A 1TD9A 2JFYA 3M3DA 3CPJB 4C22A 3T35A 4YPOA 4HJXA 3MLBA 1DJQA 3EXFB 5JMTA 1U99A 1J2UA 5GIPE 2OAGA 3SC2A 2Q49A 3WICA 3MSCA 4GMDA 2G1KA 3CLRD 1RM0A 4B6RA 1DTSA 5THQA 4LDQA 2JH7A 4ZEMA 1ZGAA 3G8AA 3OZDA 5IVIA 1MX5A 2D54A 4OXXA 4M9XA 3UXNA 2QYHA 2IYYA 1KFCB 5CUQA 3UANA 3HDQA 3K2BA 3ZJTA 2DBQA 2B5WA 1XELA 1H2ZA 3IELA 2PIAA 5GOTA 3JZFA 1PFKA 3ICQB 2BI8A 1EA7A 2F43A 3QLUC 5IAKA 3N8DA 1JF8A 3RAXA 4RTPA 4I14A 1NASA 5KFIA 1T9ZA 3OPYA 4ASUD 4R7TA 3C8DA 2H7YA 3Q8MA 4NV3A 3I4FA 1P5FA 2QJFA 4X7MA 3VZCA 4NU6A 3UJNA 5F5XA 5E9WA 2MOKA 4LV6A 1EHYA 1E2EA 4FBLA 3NTRA 3GH1A 1VLHA 3QNUA 1HQCA 4EEKA 2PUCA 3O8DA 2IPAB 1Z00B 3G2OA 5DLQC 1EK6A 4O08A 1NSYA 5DYNA 5FOVA 4X00A 2X4GA 1WCYA 3F1KA 3S99A 5LLTA 1QPBA 2FUEA 2Z57A 1XK7A 2XGPA 3OJLA 4B45A 1H0SA 6AT1A 1SAYA 1T8PA 4Q4HA 1OGIA 1XS9D 1UMCB 3ECCA 1X7GA 3TS1A 3BC1A 2CEAA 2XITA 4RETA 2CMKA 1TJNA 5I8WA 5EJ8A 2X0DA 3HO8A 1QG0A 4AS1A 4XASA 4P4MA 4KXXA 4DBLC 4P54A 3WMXA 3DAGA 2V9CA 1YF3A 5E7IA 1WD5A 2QAGA 3NATA 1XRRA 2WJ3A 5CG1A 2G0TA 4F5OA 4QWDA 5CH5A 4Z4EA 1ODIA 4Y6LA 3HU1A 3CCBA 2GKGA 4O5AA 5I4CA 1DK3A 4C7XA 4QXRA 3U4HA 1U0GA 3KSUA 5D3MB 1KZHA 5E3JA 2QD1A 3EVAA 3K5HA 3WRVA 3SBXA 2RHGB 4JP1A 1O2DA 2GEFA 5J2EA 1BRMA 1GU1A 1L5FA 3LUFA 4J2TA 3FPLA 3C14C 1UQVA 1AN0A 2J85A 4ND1A 8OHMA 2OZLB 2YFKA 2I0FA 4KLNA 2FE4A 3WNBA 1IHYA 3A04A 4I0WB 1XDSA 5TVKA 5KYKA 2KNJA 1DPGA 1N32B 3ES9A 4KOEC 3LCVB 4DY6A 2CNOA 5E7JA 3I5YA 4ZAGA 3WBBA 3KKZA 2ZPUA 1CJCA 3LFUA 4TURA 2QRVB 1ZQ1A 3RC3A 2QRZA 4N9QA 2VP4A 4Q1BA 3LDHA 1VYVA 3RWOA 4A2QA 4C4OA 1E4EA 1MJ5A 3AJEA 1Q1NA 5IC4A 2JHDA 5FUWA 5ARBA 2BGGA 1ZVJA 5ED4A 3PU6A 1UF9A 3UKOA 7AT1A 1D7OA 4ZJYA 1PTKA 1CQIB 1S2OA 4JUZA 3PGJA 2J7PD 2RBKA 5CA0A 1FC0A 4QT4A 4E2FA 1OMOA 5L3RA 2F3PA 3GNLA 5K3CA 5B5SA 2CE2X 3K9