3QU9A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with magnesium and tartrate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
225
Chain Sequence
SHMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 79
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu9A01
2I55A 1AQ6A 3HLTA 2HOQA 4IFTA 3HYCA 1K1EA 5ALMA 1CQZA 2Q4RA 4OHFA 5AI8A 5AW0A 3ZVNA 4BNDB 5ALDA 2CFTA 3W5BA 1RQNA 2FEAA 3L1UA 4AS3A 2JGAA 4C4TA 5AI0A 4YIKA 1VJRA 4DCCA 2G09A 1SWVA 3A1DA 5T41A 5AW6A 1X42A 1PW5A 5ALPA 2PQ0A 2DQSA 1Y8AA 3VAYA 3QGMA 3OCYA 3ET4A 5AVXA 1QQ7A 5AK4A 2B8JA 2NYVA 4Y2YA 5AW1A 3U7GA 3WKBA 5AVZA 2MU1A 2P9JA 1QQ5A 1YDFA 2JAOA 2WFAA 2I33A 3PDWA 3AR6A 3L8FA 2YFYA 4UMDA 5AM4A 3DV9A 3L0BA 2WF7A 4KN8A 5AW9A 2OA0A 3UMCA 2YJ5A 1L6RA 3WKAA 2YJ6A 3U7FB 3RF6A 3A1EA 2YN4A 2BDUA 4YCLA 4CF5A 3KZXA 4L6AA 3WGVA 5AKLA 4UARA 5ALRA 1RMQA 3U13A 4ZEVA 4YCNA 1YMQA 4ZEXA 4NV0A 5AVTA 2HF2A 2P27A 5ALOA 4UATA 3AR8A 1VJ5A 5ALQA 3QUBA 4HAIA 1Q91A 1XPJA 3CZ4A 2IYEA 3AR2A 4UU1A 3FPBA 1SWWA 3N1UA 3ZU6A 2W11A 3D6JA 3SKYA 3A3YA 1L8OA 4RESA 4Y3UA 4UM5A 3B9RA 5AVQA 3U7HB 2R8EA 4EENA 2YY6A 2I7DA 1FEZA 1F5SA 1ZD5A 3U7EB 1Z5UA 3OCXA 1U7PA 2FPUA 3OTQA 4YIHA 4Y2QA 1L7NA 3FGOA 3ZI4A 4GXTA 3SKXA 1S2OA 2PR7A 3BWVA 2R8XA 3NASA 3DAOA 5ALFA 3P96A 3AR5A 3ET5A 2B8EA 3ZTYA 3ZX4A 1QH9A 5ALZA 5ALWA 1EK2A 3FPSA 3RFUA 3QU5A 1IWOA 4UAVA 5AI5A 3AR4A 1ZD2P 5AIAA 5ALNA 1EK1A 3R9KA 3B9BA 5AVRA 3ZUPA 1ZRNA 2W4MA 3A1CA 2ZBEA 2ZBFA 3QLEA 3SF0A 5AVYA 4DWOA 2BY4A 3U26A 2HF7A 5AM5A 3PGLA 3I28A 2HHLA 3QXGA 2GMWA 1Z4LA 4UMFA 3ONNA 4HGOA 5AM2A 5ALYA 5AHXA 4OCZA 5AI4A 1WZCA 4Y2VA 4IG4A 5AW2A 1TJ4A 2C8KA 3WK6A 3L8HA 4Y2JA 2RAVA 1RMYA 2G07A 4HGPA 2ZBGA 3BA6A 1T9ZA 3E58A 1Z4MA 2G0AA 3L5KA 3NUQA 4CNQA 1ZRMA 4Y2PA 2G06A 3NIWA 2IA5A 2O9JA 3R09A 4NAVA 1WR8A 2WM8A 5AVSA 3QU7A 2GHQA 4ZEWA 1TJ5A 4OD0A 4BKMA 2ZXEA 4KX5A 3WK5A 2WHEA 3ZW7A 4HGQA 4NWIA 3M9LA 3J7TA 4H1WA 4NABA 5E0OA 2G08A 1RKQA 3UMBA 5IS2A 3QUQA 5AKEA 5AKYA 4KYTA 3WK4A 1XVIA 5ALEA 3GYGA 2R8ZA 3EPRA 2Q4TA 5ALXA 3K1ZA 3WK8A 4BX0A 1U02A 3ESQA 4UM7A 2OBBA 3MC1A 1Z4IA 5AESA 3L7YA 5AK6A 5AICA 2FPWA 3QU4A 1U7OA 4XE5A 4CF4A 3KDPA 2WF9A 5ALLA 3FVVA 3TLMA 2CN1A 2CFSA 4CF3A 1RQLA 5AI6A 2C88A 4I9FA 1N9KA 2QYHA 4AS2A 3L8EA 3QU9A 1RDFA 5IT4A 3KBBA 2AGVA 3N28A 3ZX5A 4UAUA 1Z5GA 4KNVA 2JAUA 3DDHA 2HDOA 2P69A 3OCZA 4XOUA 2GFHA 3E8MA 4Y2XA 1Z88A 2NO5A 2I6XA 2YMLA 5ALJA 4F72A 3NRJA 1RMTA 2W43A 5AI9A 3B8EA 4I9GA 4QJBA 5AW5A 5AVUA 5AK5A 4EX6A 4RETA 5ALTA 4FYPA 4O8CA 1VFPA 1J97A 2ZG6A 1O03A 1YJ5A 1Z4KA 4C4RA 3I6BA 2WF5A 4KX3A 3U19A 3DNPA 2YMPA 4UMVA 1MH9A 2EARA 4UASA 5FP0A 2HX1A 1RRCA 1YNSA 2JARA 3WK7A 4EELA 4G9BA 1ZS9A 2FUCA 4JDPA 2B82A 2WF8A 1WPGA 1NF2A 3W5DA 4GIBA 3SD7A 2B0CA 5AW8A 4EZEA 2X4DA 3R4CA 3UMGA 3L0YA 3SHQA 4B6JA 3WGUA 3ZWKA 4HGNA 3SMVA 5ALIA 2FDRA 3WKCA 2HEGA 3EF0A 1L7PA 2HO4A 3N07A 5AVWA 2D2VA 2EATA 2GHTA 3QUTA 3OCUA 2OM6A 4Y2TA 4YH1A 5AK3A 3NANA 4EEKA 3L1VA 5IT0A 2MSNA 2BDEA 3F9RA 5AVVA 2YBDA 5ALKA 5ALSA 4BNDA 2IOFK 4UMEA 2O2XA 3IJ5A 3I76A 5ALUA 5AKZA 4F71A 2IOHA 1NNLA 2HI0A 3CNHA 2B30A 4BEWA 3OCVA 3OPXA 5A3QA 2R8YA 4UW9A 2B1QA 3QX7A 1LTQA 5A3RA 1Z4NA 1CR6A 4Y2SA 3N8GA 4MWOA 2ZBDA 3W5AA 3AR9A 5AKXA 1YV9A 1RKUA 2JAWA 5AKJA 4KNWA 3S6JA 2RARA 1TA0A 1YS9A 1WVIA 4NFLA 3ED5A 1N8NA 3QYPA 3N5KA 2NO4A 1RLTA 5AW3A 1L7OA 4Y2UA 1T5SA 2Q5EA 3MMZA 1L8LA 3UM9A 4BYGA 1U2TA 5ALVA 4E88A 3IRUA 3FM9A 1Z4OA 1ZD4A 4XQ0A 2OYCA 2YJ4A 3NAMA 4L6CA 4BBJA 3OCWA 1Z4QA 1O08A 2C4NA 1Z4JA 5AKIA 2YMQA 2RB5A 3PGVA 3W5CA 4BEVA 1RPZA 2MU2A 3MN1A 3MPOA 4PNHA 3KOOA 3L8GA 3ZWDA 4YGYA 5AKGA 2FUEA 1RC8A 2RBKA 2GO7A 1LVHA 4FE3A 5ALGA 3KC2A 1NRWA 2I34A 2FPXA 4L57A 3KD3A 1RLMA 3E81A 4BX3A 1TJ3A 1JUDA 1RLOA 2G80A 5AKKA 2IOFA 1ZJJA 5AM3A 4J2TA 3WK9A 3QNMA 5AIBA 2CFRA 4YCMA 2FPRA 3EF1A 3EWIA 3ESRA 4DFDA 4MUMA 5ALHA 1QQ6A 2YMMA 2ZOSA 4AP9A 4G63A 2HSZA 5AM1A 1QYIA 3WKDA 1Q92A 2HCFA 4C4SA 3M1YA 2C8LA 5A3SA 2PKEA 4HYTA 4EX7A 2EAUA 4J03A 2YJ3A 1ZD3A 4QQFA 3E84A 1TE2A 2AH5A 1SU4A 1ZOLA 1U2SA 4XPZA 2B1RA 4JB3A 4CE6A 3FZQA 3ZVLA 1S8OA 2AUTA 1T5TA 3I1YA 2P11A 1Z4PX 3L0CA 3AR7A 3NALA 2G1AA 1RKVA 4OFZA 2FI1A 5AM0A 3ZTWA 3QUCA 2C9MA 3QU2A 1L7MA 5AW4A 2FPSA 3WKEA 4UU0A 2QLTA 3PCTA 4HGRA 3SLRA 5JJBA 3ZVMA 1KYTA 2AMYA 2VKQA 5AW7A 3AR3A 5AKHA 1J8DA 1XP5A 2I54A 3IB6A 2WF6A 4Y2RA 4BX2A 2ODAA 4FFDA 4DW8A
chains in the Genus database with same CATH superfamily
5IX8A 1E9BA 3T1VA 1F48A 3AMZA 5GV7A 4FYXA 1DV2A 1PT8A 4NKRA 3I9JA 4YDRA 3TDNA 4CEHA 1VJRA 3E22B 5CA0F 1DKNA 4KMSA 2HBRA 4OIFA 2DFDA 1YU6A 2QY6A 3N8HA 2UZ1A 4QBFA 2ZDQA 4F21A 4G25A 1COWD 1PQYA 5DI9A 1KOLA 1TQDA 1Z0AA 4CDRA 4HRXA 3PX2A 1VPTA 1H5QA 3G7UA 4X66B 4LJ8A 2IZ7A 2YN4A 1EXWA 5ALRA 4CLRB 2QW1A 1SRRA 5ALOA 2WU3A 4PXYA 4F86A 1NVFA 4V2UA 2FR0A 1O95C 1MV8A 5JMPA 4QKQA 3AUTA 5BQ3A 1U3DA 1TFUA 1NYRA 2J5XA 4A8PA 2ODBA 1J23A 4LZAA 1SRQA 4PO9A 3WVNA 1ODSA 4OQFA 4OXRA 4H6PA 3LC7O 2Y1OA 2LIPA 4KLJA 2VHUA 3DZBA 4C6HA 3ZWXA 2HHUA 4UE6A 4PHPA 1YHZA 2QRUA 3OZRA 3RUIA 1E99A 4IEIA 1C4KA 4C8NA 2C00A 5BV2P 3RNLA 3KEMA 3MMSA 3N2IA 1KY3A 2X23A 1SD5A 4A91A 4I50F 2VYND 3ONFA 4ZMSA 4XIYA 4ON9A 4LF8B 4L5JA 2B7BA 1N2IA 3ROZA 2JRLA 4JT4A 4OGKA 3U48A 3DE2X 4U2EA 4DLTA 4K9KA 1PNTA 1XF1A 5L53A 4ARIA 1ZAKA 2EIHA 5FEUA 1NJZA 2POCA 3FB4A 5B7GA 4KGDA 4YP7A 3DV2A 4LY0A 5JO0A 1A9YA 1ONBA 1H05A 4K6CA 1G5RA 2QD1A 1P18A 4CKEB 4GM1A 4AS2A 4EA8A 1U5BA 2HOIA 2WWWA 1GGFA 5HBRA 2GFHA 2Q5HA 4ZFNA 1R6UA 4C8MA 1DXHA 4Q8EA 1NDHA 2JH7A 1FSFA 4JA2A 1II8A 2PN1A 2YWJA 1GZDA 2DUWA 3UA4A 4PIVA 1OXVA 1U9ZA 2GK6A 3IUJA 2HT6A 3SNHA 1FOEB 3GD7A 3BFJA 3ZDXB 2B0CA 2X4DA 3R4CA 1KXJA 1J0DA 1P7CA 4FGUA 2VHWA 4NE2A 1ZM4A 3O4IA 1I14A 2PRJA 4C30A 4LF9B 3PICA 1E0SA 3AVYA 2FF5A 4HK4A 2H7YA 3HVUA 2BFEA 1C1HA 4K87A 2YVAA 1O8BA 3HX0A 1YE3A 5DWQA 3F96A 4KSBA 1ZGBA 3QOWA 2ZM6B 3RAEC 1F9AA 2E4UA 5LSAA 4R9VA 3ZV5A 1FBNA 2R8YA 1H3FA 4QHSA 3PEFA 2BR0A 4ENSA 1S0VA 4Q4JA 3GLFB 3A3PA 2PO7A 3K71B 4IIHA 5EESA 3ZXYA 4K4HA 3LA8A 1YZNA 4PYLA 3GEEA 1T2EA 1IONA 1LDBA 2D1TA 5IDVA 2HSJA 4D8UA 2LCFA 3SYZA 3N97B 4Y7CA 3MCWA 3TFRA 4I5FA 2VK4A 4OBXA 2QBYB 1UBSB 4DCNA 4EGCB 4PNHA 5M5BA 3CW9A 2PMEA 4FPXA 4D44A 1Z0KA 3ETEA 1MC1A 4YAUA 2XUOA 1J56A 5CYOA 1NUUA 2PRIA 2KQUA 1PDOA 2DKOA 2XZDA 1LWOA 4EDFA 2MWMA 3UJPA 4QDKA 4Z2YA 2ZSDA 3QVSA 4PZOA 2QAGC 4N5IX 5LYJF 1EJ6A 4MR8B 1ULUA 4O4HA 1W2WB 1IM5A 5A6VA 4Y0VA 3SZOA 4OAQA 4OB6A 1AKNA 4BNTA 3L0IB 3SPXA 4FHEA 4HL6A 5CEJA 5GADl 5DQHA 2CLEB 4PAMA 5LXTB 3IJEB 3GLIA 3AKYA 1M34E 5IU6A 5JYBA 1GEGA 1ZN7A 1MBZA 2D62A 4NLBA 1Z6ZA 3Q98A 3QVVA 1KTIA 1QGDA 1GPJA 5EXTA 5CD1A 3BQ2A 1QIJA 4FZJA 3GNLA 1E58A 5ALPA 4OHXA 3UQZA 2HIAA 3WFJA 4RLQA 4G9EA 5K99A 3DLBA 3N5CA 1N9GA 1ZH4A 1MO6A 4P86A 1PNVA 5D1NA 3KD2A 2YHBA 4NEHB 3DS8A 2DUUA 1T0BA 3WOHA 2CJPA 4MEXA 4GXNA 2BDUA 4BVEA 1Y37A 1NW6A 2I3ZA 5ICMA 3I09A 5TGTA 4IIDA 3HB0A 4KQCA 3V00A 3R8XA 1V45E 4JI7B 5L4SA 1QVAA 2AN5A 4EENA 4C0HA 4YP6A 4H17A 3P71T 1RLIA 2JLQA 3TMKA 2JHCA 2R25B 3SJBA 4N1AA 3GROA 1Q95A 3BWVA 1R6VA 4G2TA 4N39A 5CLQA 1SB3C 4A6XA 4YRZA 3D1JA 1KBOA 4MI3A 4BEBA 5IARA 4YRDA 1ATIA 2IYTA 4XOIA 4LGCA 5E4FA 1G60A 1Z73A 4NECA 5H80A 2F59A 5DBFA 4RY2A 5CLFA 2DRIA 3I83A 4PG6A 4Z7QB 3SSMA 1JHRA 2MYPA 4UTNA 2W9CB 3WNBA 4WLOA 3BA6A 3IQEA 1J5XA 2QUAA 1FFWA 1YFKA 3ZGYA 2IY8A 3DULA 4GPBA 4PG4A 4PM4A 1Q0UA 3IS3A 4FDUA 4ANFA 2ZJOA 1BPEA 4I1IA 3C8UA 2WHEA 1IN4A 1IOVA 4QUAA 3BHIA 3RRYA 1EZZA 1P2BA 2X9LA 2ZTLA 1F0KA 3ES9A 1QMPA 1KJYA 2BGIA 1X1SA 1FQWA 4GGOA 3PR1A 5GJWC 4AJLA 3A11A 4FYWA 1EVKA 5IN5A 2OB2A 1VJCA 5E7QA 3AFIA 3LW7A 2I6XA 4OQZA 3VHLB 1OY1A 3B6KA 1THTA 2D2FA 5E2IA 1X80B 1RM5A 2HXSA 4DDMA 1JMKC 3A6GA 3HJCA 5JC8A 1LPSA 3WQSB 3QY9A 1T36B 5F7JA 5E95A 3R0JA 4ND4A 3FWZA 5JVDF 4IIBA 1IHYA 4PHCA 4BWVA 5A2QA 3PFHA 4NBRA 2D2VA 3ETDA 4RDCA 2I8AA 5J2HA 4O5OA 2CLSA 3UXHA 4H4EA 5JANA 1XTBA 1Y6QA 5IT0A 4C08A 2P4UA 1MIOA 1IMJA 1QGUB 5B55A 2GB4A 2RFLA 3TPZA 3NHKA 2G9QA 1NZFA 5AKZA 2BEUA 3EG5A 3GWGA 2JFUA 1EP9A 1D0SA 4PAGA 4KYVA 3GLKA 1SVOA 1NJSA 4KUHA 4RNCA 1T6YA 3IG8A 2I3AA 2QQEA 2BEKA 4IX1A 1G8MA 4BZPA 3WLRA 3LPMA 5FQNA 4LJAA 3GWZA 3EGOA 1Z56C 3E4DA 3DMGA 1NN0A 4FS3A 4ZT6A 1U2TA 1NPDA 1QSYA 2B25A 1XA3A 2GPAA 4X0EA 4JP5A 3EW9A 5AYVA 4IIJB 2RB5A 3SCZA 1DWUA 4Q3NA 2C3MA 2VQ6A 4M55A 1AGNA 4A26A 4W4TA 1PR4A 4ALJA 3I32A 2IEIA 3SEIA 1C8LA 4UEOA 4JMPA 9ICWA 2LV8A 4KXFB 1ACMA 1OOEA 3CNEA 5JI2E 3KZOA 2CJWB 4NTZA 3L6DA 4KMRA 5G41A 2J9YB 3SXJA 2C3UA 4RK4A 2CWDA 5D3MB 1LDEA 2ZSFA 1L9KA 1FMLA 1W36C 10MHA 3TBFA 1U1DA 1L5KA 2EAOA 2XO7A 1ONOA 4FDVA 2C59A 2W03A 1NJ1A 2NRZA 3W7VA 4M0FA 3WKEA 2AR9A 4J49A 4PZUA 4KPUB 5D01A 2JI7A 1Q0ZA 4JWKA 5KTOA 3NHPA 1KJNA 4A8JB 2PXIA 2UU9B 3IQHX 4QU5A 3PDCA 1KU6A 2ADOA 2NUTB 1W2HA 1GPWB 4R4JA 4JP8A 3P20A 4AO8A 4XLZA 4DOBA 3UT5A 3FFAA 4WPGA 2WQ7A 5DNWA 1O96B 2V4MA 1EX9A 2ZJ5A 2QSUA 3CJQA 2P9FA 3P0RA 4CF5A 4HMPA 1RS0A 3G85A 2FJPA 3O4HA 4URWR 4F5QA 1H4VB 2ID7A 3EZFA 3REOA 1P5HA 3EFEA 2RE8A 5JAOA 1E2BA 3AF4A 4O02B 2P1ZA 3QLTA 4F4UA 3G13A 1S3IA 1QYXA 1E2HA 3Q3EA 5DHFA 1LB1B 5AJWA 3A4LA 1GLGA 3D8SA 3UB2A 3CCFA 2PKRA 2QHXA 2OCXA 1YTLA 3NV7A 1M1UA 1JLLA 4WJZA 1K5HA 2QQFA 4JBIA 4X6LA 2GMWA 3WG9A 3UXPA 4DV0B 1YQDA 3QWFA 4JUCA 3HKCB 1CZOA 5EZYF 2WSSD 5F5LA 2ZRFA 4W1RA 1EFVA 4DQRA 5IC4A 3CH5A 1SXJC 3WK6A 4Y2JA 1BHO1 3OM9A 4P3OA 1OBFO 2HWUA 4RH0A 2WSYB 2H92A 3V7WA 2JLYA 1EVJA 3KXDA 4C43A 2ORYA 1SOVA 3AEUB 2AOUA 2HQSA 1HE5A 2FWMX 3ZVRA 3G0GA 1E1RA 2KMLA 3IAUA 2NV0A 1WRBA 4OFWA 2OK7A 4RPJA 1N2BA 3Q4GA 5IUNC 5U1PA 1XKLA 3HJEA 3K1YA 4JYPA 4F5YA 2AXNA 2EEZA 4DA4A 1UWCA 1UFKA 5F1OA 1T2FA 1PLKA 4MWTA 4H9GA 1T35A 2X5OA 2EQAA 3T9AA 1M5RA 4AG5A 1BOOA 3BQ7A 3MWEA 5JZBA 3NWOA 1TUBA 5I7FA 3QU9A 5FUVA 1KYYA 4UBOA 5CYGA 3AB3A 2H9YA 3PCRB 2CB0A 4PIMA 2X42A 4MUAA 3GEIA 1ENZA 1EU1A 3S2EA 4YPVA 2DH5A 3MYYA 1A88A 3OLQA 2CJFA 3I5AA 3GVCA 4RNOA 2CYAA 1H22A 1KKMA 2P9TA 4IP0A 3ANXA 2P2CA 2OQVA 1J97A 3AZQA 3OEEA 1XEFA 4BNVA 1NBMA 2YMPA 1A96A 2HJWA 5FP0A 2EQYA 3FBWA 4F5RA 1YD7A 4I2JA 4W7SA 4UQPA 4GS5A 4CFSA 1YDMA 4J2OA 3DVAB 2QLNA 5IP5A 3CA8A 3LA6A 2D4AA 3QIAA 1XZCA 1TI7A 3EAGA 1XPRA 2ZR7A 2Z1MA 4C21A 4P81A 2GPBA 4WZAE 5BSTA 5JCOC 1PWEA 3EXHA 4BGDA 2QPLA 4AJ4A 4JVMA 2YV4A 4Z9AA 4NESA 2XQGA 4ECVA 4RENA 1ISFA 1DOZA 3U3MA 5EXEA 4NULA 4J0EA 3HNOA 2IYXA 4PLYA 2C78A 3K8YA 2ZJYA 2GF0A 4NZMA 3BXFA 1SXIA 1TLTA 1C7QA 2VBIA 3O38A 2NYRA 5CX4A 4UTRA 3P9SA 4ZOCA 3VZCA 1Y4DE 2EFJA 2A2ZA 2WIFA 5F98A 8ICJA 4TQRA 1ZD1A 2DWOA 3ORHA 4JWNA 1R4NA 5JRZA 2IQIA 4W9RA 4BPBA 4K4GA 5B1SA 4O29A 1SUBA 4PHAA 4P0QA 3QNMA 2HBYA 4LXIA 1PT5A 4PF1A 3VX3A 1BXGB 1QM5A 4AP9A 5IDWA 1K8QA 1BU5A 5EIBC 1DVRA 3GCDA 3OZAA 2ZAOA 3L7AA 3BB1A 4ZOAA 2XHEA 3ZHBA 2FP4B 4GKAA 2DEUA 2D4HA 1AMOA 3GA0A 3I4CA 4D79A 1JFVA 5KYNA 3QF4B 1DO2A 3VPDA 3O84A 3OIUA 2QYOA 3CIFA 1SC4A 2WYWA 4BQSA 4H4CA 1N2CE 2W2OA 3PWKA 1Z0JA 1E59A 1DAMA 2ZU6A 3M5PA 1K2WA 3PBKA 2V98A 2PUEA 4HT3B 1ZJMA 1OXXK 5AI0A 1R9NA 4FB4A 3WTBA 4G97A 1ZONA 4QTUB 2QR5A 3N2GB 4HQLA 3KAQA 4KBYA 3PX0A 1NXXA 5AM4A 1D04A 3PV8A 2WF7A 1YR7A 1VDMA 2OO3A 1CUUA 2CLOB 3EXG1 1LY1A 3U44B 2PSJA 3VPFA 4KFRA 1L2TA 3ZUGA 3BIOA 2JBAB 3NTUA 4RZHA 4AI6A 2P41A 1MRZA 4EB0A 3OF5A 3UH0A 2AI3A 1UDXA 2WMOB 1DJLA 5IK2A 2D5AA 4RWZA 1LLCA 2J3EA 4Z6FA 3EFOB 4DGSA 4EATA 2JPDA 5BV7A 1PSZA 5DG8A 2HU8A 1TK3A 3LC0A 3C3DA 1T1JA 3TLEA 4FOOA 3RIEA 4EKEA 1SUAA 2H1IA 4RGYA 3OUUA 3JPWA 5CAEB 1U0JA 1P19A 2ZWPA 3L06A 1G17A 2JHDA 3BGIA 3V48A 2B6NA 1JU4A 4RPZA 4LHVA 1KQPA 4ZV7A 1DEKA 4ZA2A 2GETA 1QRTA 1EH5A 2IA5A 4MJLA 3Q8WA 3MW8A 1QWOA 5EHNA 4AXXA 5KO2A 1E9DA 2VJ4A 1SBCA 4OHPA 4Z7OB 3FJOA 4DB2A 1PG5A 4IJMA 2D8CA 2BD0A 3EVNA 2Q62A 2EERA 2CLFB 2ZTHA 2JAPA 2HHCA 3EH1A 1JKFA 3II6X 1S5LU 5ICSA 1T0JB 1EFRA 1BVSA 4LHSA 4JOCA 4TLLB 3H17A 4M6WA 3QU4A 5LQKA 2BGGA 3DFZA 1USUA 1FFHA 4D8XA 1THMA 3IMKA 3UG6A 5K05A 4MYHA 3H84A 3LRPA 4DF3A 3IMEA 3T5KA 1KKLA 1JEQA 5IT4A 1GNQA 1GGHA 1MB0A 4BRWA 3E8MA 2PBFA 3HYLA 2OILA 1O6FA 1X9GA 2AB0A 3TSAA 1A4RA 4AKSA 3NUZA 3NC0C 2QYSA 5CYPA 3RVRA 2BGKA 2IIQA 1SCJA 4DWJA 3T9BA 4UB1A 2OYRA 2WTMA 2FW1A 1KIMA 3EBLA 4CKZA 4RNNA 4DUGA 4LXUA 1KAEA 4QEZA 2QZJA 2YVQA 1KJZA 5JWRA 1DMSA 1O6ZA 2YJNA 4U6SA 2FW0A 121PA 2QTWB 1UPHA 2VJNA 4EB8A 3BZCA 1ZG3A 4LJXA 4EZBA 5CNMA 5JSFA 1UEXC 4YXJA 1P7DA 2ZJ0A 2WA1A 3FF4A 4KHZA 2QIPA 3BD9A 2KG5A 3L9WA 4UXJA 2ZQZA 3BUSA 5EVCA 5IHPA 1UJ4A 2DCUA 1S8AA 1GQ2A 2YWRA 3W2GA 4JQYA 4AYWA 3S6JA 3CFYA 4CR7A 5I8PA 2IS1A 2I9PA 4B7AA 1NR1A 1P3JA 2FPLA 3GUVA 3QYPA 3HZHA 4KGZA 3GFSA 3VPCA 2OAEA 4TWZA 3O0FA 5C8VA 2WW8A 3BXOA 3ZK9A 4YJKA 2OOKA 4Z54A 3G5AA 4ETMA 1SA0A 4TQSA 2AKAB 3RQIA 3K0CC 1KYQA 1R0SA 2VQDA 4G26A 3D8UA 1QAMA 4U2DA 5TMEA 1COKA 2WJ4A 2XQVA 3QX8A 4RK5A 3GCZA 2GNAA 1II0A 1BE6A 2HIHA 2JLBA 3KZ1E 4Q9LA 3OMXA 4BB5A 4LVNA 5LMZA 4HXYA 1P0QA 4EDHA 5BXYA 1ISJA 4XVRA 1J9GA 3F53A 1CJBA 3CN9A 1DAHA 3A4IA 1FSPA 4YJ3F 3IKTA 3L4BC 4JI4B 3OJLA 5EPEA 4EH1A 1NUTA 1C8KA 4PLGA 5ARDA 3BTSA 4R40A 4CKWA 2QI9F 1FB5A 1L7XA 1H69A 2XMQA 4YRJA 7ICNA 2BP7A 1TQHA 4YAOA 1QFSA 5I4CA 1I01A 3T9DA 1KVTA 3FTDA 3TKYA 3TFWA 1B2LA 5EQTA 1VDVA 4TS4A 4W99A 5EIXA 4YCNA 3NVMB 5LQJA 4CM6A 5AHWA 7ICFA 2W2MA 5C0OE 3W5IA 5EZ5A 2NVUA 1NPYA 2BI8A 2GKGA 3R7AA 3JAKA 1QZXA 3GJ3A 3JZIA 5AFSA 3L8CA 4O3PA 3AVOA 3A05A 3IQWA 4OI2A 1PKEA 1KIFA 2C94A 4G1BA 1P9LA 1KERA 3GAMA 3BMQA 2Q1UA 2O5VA 5E3JA 3ICVA 4EPTA 2A4MA 1EESA 2IBKA 5HJ5A 1CZHA 4D0LB 2DLNA 1Z2DA 3JR7A 2JCVA 1E1RD 4CKXA 1G20E 2A9KA 3FNRA 4XWGA 1TB4A 4FI3F 4OJYA 2GEDA 1OVGA 1V3QE 1FE8A 2ZWOA 5AVKA 3AEQB 2JHGA 1KGSA 3HXKA 4GZ6A 4XIGS 4YR2A 2J6UA 3IUMA 1G38A 4ZZIA 4MCHA 1TCBA 2BBOA 3I5UA 1EP2B 3AHHA 2ZYIA 3WS7A 5DP1A 4LXGA 1NL3A 1K1SA 2NQ8A 4MJ7A 1TZCA 3RIHA 2W43A 3GQCA 2ZWMA 3Q88A 1NBMD 2CXUA 4D4JA 5PNTA 4MVJH 9ICAA 2NUPB 3QVWA 2NQTA 3ESAA 1NJFA 4UASA 2UDPA 1U3FA 4CIYA 1LTHR 4NOLA 3WLQA 2JFYA 1XO1A 4B84A 1FSGA 1YS6A 4ZAFA 4X7MA 4S35A 4BQPA 4KQ2A 3EDOA 4PNPA 3USCS 3X2FA 5D5QA 1XV5A 1O9HA 5L4LA 3UBMA 1KMMA 1YA4A 2NIPA 1R27A 1TIBA 1OUMA 5IAAA 3R7WB 1J0EA 2V6IA 5A0VA 1CX9B 1E77A 4C0ZA 1ZCFA 5MF6A 5K09A 3AUSA 2ONYA 3BZUA 2HMAA 4GGPA 4J0JA 2EDAA 3LUGA 1U4BA 1ODIA 4F97A 4GRIA 3JPTA 1CYEA 3C2MA 1QGOA 2JAWA 1CI4A 2XUHA 4QLOA 3NBFA 3W0LB 3K0KA 1W85A 4FBUA 2YJZA 4IRUB 3KTAA 2AI1A 1D8AA 3QEAZ 5ALVA 3N6VA 1KMQA 3JW8A 5SY6A 5TR9A 3GJSA 3N3AC 3T7CA 3MN1A 2XSZA 3MABA 1ZQVA 2YB4A 4IJWA 3NYIA 1XNSA 2QRPA 1RLMA 1PTJA 1MN8A 4KO4S 4J2TA 2JI8A 4HBGA 1QQ6A 4W9NC 2IIVA 1T8WA 1RTTA 5JXIA 2GZHA 3KVYA 4I4IA 1JJAA 5AJVB 3GEDA 4Q3CA 4MVJF 4BTVA 4YYZA 2FSSA 5I48A 3QZUA 5AQEA 4BL5A 3IDFA 3LZ6A 2HR1A 3LLUA 5C35A 2CHGA 1A7UA 4FNMA 1YSCA 3IUSA 4XTRA 5DDYA 1NU6A 2A84A 3TDKA 2Z6VA 1SCAA 5JYEA 3DBHA 5JASA 4AF8A 4AURA 5EIAA 5C1DA 2H16A 1Y8AA 2VRNA 1KSHA 5ESDA 1B26A 2OUKA 1QMGA 3R5KA 4X7BA 2CMDA 2JFGA 2XUAA 5CLJA 3DMTC 4A0QA 1E6WA 1R37A 3D5QA 3B9PA 1H2RS 3LKZA 3W8NA 1WMAA 4QU8A 4C88A 4K9LA 1ZQMA 4L0QA 4R1OA 2C7GA 4MGHA 3F7OA 2F1HA 3QWAA 3NYWA 1G6Q1 4UATA 3AR8A 1R6DA 2WHPA 4O4HF 5KYXB 4IRKA 5DNYB 5IK2D 3PDIB 2ZRDA 1UIRA 2C3YA 2Y8EA 3KT0A 1DJNA 3ZV3A 5K0EA 2F1KA 2PFOA 4FSHA 2JATA 1BX3A 3EEQA 2HMUA 3JR3A 4E5UA 4UAVA 3O73A 3HJAA 4ECXA 1ZRNA 3KIPA 1E4EA 1QZUA 1NA5A 3EQ8A 1JMVA 1DKOA 1IEWA 1ZA2A 3RTBA 4NNOA 1Q1ZA 1OT3A 1VHLA 2HTEA 1Y89A 5CU7A 2XUJA 1W2GA 3JAMA 1E3MA 4U6QA 2Q3FA 1N2XA 3GZNB 1TJNA 1V47A 1MTZA 2BZSA 4L4YA 1QTNA 4RPHA 2QVYX 3GFOA 1W5EA 4TMTA 1KAGA 5BUSA 1MNQA 3EPIA 5GVRA 2CSUA 1SBYA 2RJ3A 3PY8A 2ZSJA 1RJWA 1RXYA 2F3RA 3H4VA 1EFRD 3T3PB 1NNUA 1N7HA 1AQLA 1KK3A 4EYOA 4I2CA 2WQ6A 1QRAA 2V9CA 2IYZA 2PWPA 3JCZA 2BTQB 1GA1A 2OT3B 4K0KB 3H5IA 2XWQA 5F7XA 4FE4A 4L6IA 4ENVA 4J16C 3O8CA 4EF4A 1JDVA 1TTHA 3S2UA 4LY6A 2N0SA 4WN3A 5J8YA 5ECWA 2YHIB 4IJVA 4ZXFA 4B4VA 4RA9A 2PBZA 1CNEA 1ZQGA 4ZT5A 3I5MA 2XD4A 3B0YA 4F72A 1PJTA 4CCYA 1J0CA 3I05A 2H1LA 3RAJA 5LU8A 2Q9UA 5FF9A 4W7IA 3E3AA 2JC3A 3N8IA 1AVTA 2YS6A 2ZIXA 2DHRA 2QARA 1C14A 2LIVA 1E79A 2C2EA 3PC3A 3M6IA 1M34B 4AVYA 1W8DA 4HWKA 3T34A 4IDDA 1NI5A 3WWCA 4BWGA 3NGXA 1AMNA 4ND8B 2RQ5A 2GRJA 5JPCA 3N0XA 4AO7A 4KQMA 8ICPA 5LMNB 3QWHA 2H4XA 4HYEA 3CLHA 4OO3A 2IOFK 3CRW1 4J0DA 4B75A 1Y6JA 1BRTA 3VOBA 1ADYA 2P9CA 2R11A 1UT5A 3GZ4A 4EO9A 5JXGA 1SBHA 4EJMA 3DE4X 1RXVA 3V8MA 1H85A 2X6RA 4EQZA 4WASA 2DUYA 2A1UB 4DIMA 2HBZA 4CG2A 1ZQYA 2SCUB 1KK0A 1ZN8A 2HA6A 3KOZA 1FDOA 5BOVA 4BWMA 4XQ0A 2P6MA 5LZ5A 3HABA 3BYZA 3HPQA 1PZEA 4ZZ0A 5F7ZA 1E96A 3MILA 1SU8A 2DR0A 2OPBA 4Q4CA 2CFCA 3OD1A 1S3GA 4LZDA 1MOSA 1HYGA 4JLUA 4EI7A 3HCOA 3DE1X 5L3SA 3WMXA 3LDHA 7ICLA 4DT1B 2X2PA 3O94A 3RFAA 1BRMA 2JGJA 1FDVA 4JYAB 4HLUC 3NBKA 1OF1A 3NWJA 1KS2A 3A06A 2R9VA 3GJ8A 4NFHA 2BCVA 4P08A 2F2AB 4M0MA 2AT1A 3X1JA 5HR6A 2FX5A 2XE4A 1QR6A 1V5FA 4JUAA 1K92A 2GWRA 5AM0A 1M1NA 3BN3A 3DT9A 1PD0A 4UHEA 3IMFA 1AC5A 1UMBB 2DPHA 3UB4A 3P0IA 1XP5A 3M34A 4DL2A 2ECOA 2QL5A 3QSGA 4GSYA 4Y6OA 4MTCA 3DCNA 1GT91 3A8TA 2OZEA 3JZAA 3JX9A 3QGMA 4CLEA 4NL4H 2PXAA 3QQ5A 5HTOA 4NLLA 5A5VA 3HVIA 1JYEA 2CNDA 1NKTA 5KFIA 1GZVA 2WV7A 5DG9A 2KEYA 2ZT6A 3FOAA 3I64A 3I72A 2XRMA 4HYQA 3T7AA 1JKJA 3SDSA 2JD1A 5KL1B 4TKMA 2W71A 4YMNA 4MRMA 4DSZA 2IITA 2BM8A 1ADJA 3CZ4A 4JGBA 2ETVA 4RYDA 1XDDA 3MWDA 1DC6A 3MJDA 1WULS 3UWPA 2OL4A 3EODA 1ZD9A 5E0KB 1E0KA 3CNNA 3RG2A 2B4AA 4OX9Y 4B4OA 4DDTA 3IYLW 1ZK4A 4QE3A 4JLKA 3BILA 1ZIYA 1JJVA 3PUIA 2ZYWX 5KHOC 4J9KA 1N7JA 4B46A 4ZI2A 3W5SA 4NPAA 5H3CA 1TK0A 1PWYE 2NTYC 4M9QA 1BCRA 3T7TA 3ZWAA 2R6CA 1ZQLA 1TTPB 1TAUA 4RIHA 4IDEA 2XGSA 2BGLA 4EPWA 5CJPA 3KB1A 4MGZR 2W4QA 3V46A 3ADKA 4DPKA 2QB0A 2YOHA 4OJ5A 2YL2A 3U17A 2W6JD 1YK0A 4LSWA 3S7ZA 4ECTA 3IVXA 4N82A 1R5JA 4DWVA 1PR9A 3IT3A 3B1XA 4BGIA 1KDOA 4DSTA 4Q1CA 3FPHA 3BWEA 4RK7A 2NP6A 2G9ZA 3OTIA 2FOLA 2CLMB 2IP4A 2I91A 3OZDA 5FPPA 2HHVA 3ZE0B 3FCAA 2LWIA 4ND1A 2CNNA 3V32A 3VDNB 2ID4A 5L9XA 1JVNA 2VJYA 4FBMA 2DP4E 1O94A 3NZEA 1CYDA 4KE7A 3K1RB 3IELA 5DHPA 3QXSA 5EUCA 5JS7A 1XQ9A 1ADFA 2J6BA 4JOBA 1V5WA 1XMQB 4D9KA 1HPLA 1EK6A 5FXMA 3V8VA 2WTUA 4D82A 1P33A 3EXEA 4PC2A 5KG7A 3DPIA 2DHDA 2E4ZA 4PX2A 1F0PA 3W2EA 5DLGA 3F2DA 5F76A 3SMVA 2HEGA 4GEKA 1HM5A 2HO4A 4OMUA 1UZAA 2L69A 3HCCA 3A2KA 5KOHB 1KSPA 1GRVA 3RRNA 3VOSA 3D0KA 3DR5A 3GVIA 3L7NA 2XTZA 3C1UA 2XADA 4NC9A 1WUKS 1KR2A 5DN9A 1R74A 1EI9A 2QJOA 5SYMA 4FFMA 1EFKA 4RUCA 3CN7A 3FYSA 2PL5A 2BEJA 2H07A 4R2HA 4A82A 4FKMA 2OCIA 3BD8A 1DRGA 1BKSB 5CWRA 5TMDA 4C8LA 3HH8A 3BMCA 3WNCA 5H9WA 3L6EA 1DQRA 4E88A 5E8RA 3NC1C 7ICOA 2XSZD 3ZY4A 5LQRA 4JLDA 1YHYA 5CLIA 4XVCA 1P6QA 3DOFA 3FAHA 5EJ6A 3WWZA 3D31A 1ZR4A 4RV9A 3RYIA 1D2CA 3CLUC 4Q48A 2YQEA 5JOQA 4DRYA 4RPIA 4L3OA 1M2JA 4M9NA 2Q4DA 2IE0A 3UW1A 4NSNA 5FI3A 5IAGA 2XIJA 3A4YA 4K86A 1K4KA 1R6XA 1JRPA 3FPGA 3GH1A 1L1EA 4BLOA 3LP8A 3QA3E 3DOEA 3BFKA 4G1MB 4MLZA 4Y2RA 5DB9A 2I55A 3O4FA 4JV0A 3E22A 1C7FA 2V0CA 3BH7A 2B37A 3DJFA 1MABB 1ZWKA 2WSSA 5K0CA 1JWLA 1Q0TA 3F49S 4H7IA 1S9DA 3VU9B 2CUNA 1KR5A 3PC8A 2HNAA 3DDSA 5KYYB 2V3CC 1YQ9A 4TUSA 2M9MA 2EZTA 1RJEA 4U6PA 2CUTA 1BMDA 3ORFA 5IH3A 2Z3ZA 4U00A 3KXPA 4OJKA 4BO3A 5CJ7A 2BBTA 4CLRA 5JSZA 5C0YA 2GLXA 4CCAA 3WICA 2UVWA 3PIDA 1F06A 3UJNA 4RFSB 4A8HA 5EOZA 2V5UA 1Z6YA 3HE3A 4DMLA 4P58A 5FNVB 3B9RA 1SKSA 5IWAB 4GECA 3U7EB 2VBFA 1FRNA 3OIVA 4ZRMA 3PO5A 3TBKA 5FUBA 1XLTA 5ALFA 1K7XB 4DLPA 3WXBA 3FTPA 3FFTA 2A9QA 3E0QA 4Q7QA 4JYCA 4PGHA 4X00A 3HTXA 1ZNYA 3OM8A 2UVVA 2H0AA 3W9YA 3DDNA 1E7WA 2TMGA 3AG5A 4AY6A 3FFWA 3R5FA 3GEBA 1QSGA 4B7XA 2WNHA 2EJTA 4BNFA 1HE2A 1M73E 3KT6A 1R7RA 4R54A 4CQMA 4AKHA 1EUCA 2QR3A 1D4OA 3B0XA 5J2BA 8ICYA 1T2CA 3ZQ6A 2G06A 2X1HA 2ZI6A 4NABA 5FUWA 3HUEA 4HO1X 4B4DA 4L5AA 1BFDA 2C5FA 3T1NA 2C4UA 1R8YA 1XVIA 5GGXA 4WW0A 3Q8QB 5MHTA 3FPJA 3L4PA 3ZYCA 1NVVR 2QTVB 1ZOOA 2PUHA 2HWXA 2BFBA 5AESA 3MLBA 1QKJA 3GFGA 4FEYA 4MW1A 2DKNA 2MR5A 3B13B 3CF0A 3TB6A 1GU1A 3V72A 3S5JA 4E2XA 2ZITA 2I67A 2F67A 1A9ZA 1SOUA 3FWPA 2EHDA 2RH4A 2HC9A 5IAKA 3MIZA 2ONCA 1E79D 3V4SA 2NTJA 3S4YA 3ZDFA 3IE1A 2RGRA 1LI5A 3GR6A 1AKWA 2PMCA 2B69A 3SFZA 3FHCB 2OTCA 4LHWA 3RFCA 1QIDA 3GRKA 4GX1A 2X0RA 2XBLA 1K3TA 3AU2A 4I7EA 4UVGA 3GRFA 2ZAYA 2QJTA 1P1KA 2YY7A 3QZ8A 1PEDA 2ZRCA 2VC2B 3AETB 4YJ2A 4G5QA 1I7DA 2YV1A 3I5XA 2WD7B 1DQZA 5BWOA 4Q12A 4ER6A 4JJ7A 1HE3A 2ZYAA 3B3FA 1FFUA 4XZ3A 3UXNA 3AILA 4YCDA 3WYGA 2WAQC 2MINB 2PSSA 2PUVA 1FFDA 2RC5A 3FMPB 3OPXA 3MBYA 4LIPD 2VTDA 4P82A 1XAIA 2J3MA 1PK7A 5KX5B 2WR8A 3T0GA 2BMFA 3FG9A 4I4TA 4LSMA 4F2DA 1KYXA 2AQKA 3LVQE 6ABPA 3RADC 3T35A 4LRXA 2F43B 5FI1B 2NO4A 1IZ8A 2QBYA 2DPMA 1BVUA 1V1RB 3IRUA 2VPYA 2H3IA 2CYCA 1V8DA 2HQOA 1I94B 2O3TA 2IXTA 2OEHA 1JX6A 2D06A 3HKZF 2CLLB 2X0JA 5CA1B 1N77A 2NPOA 5JDCC 2PQ2A 2VWHA 2V97A 3OZBA 4FQ7A 4PZ0A 3VKFA 2V7EA 3E81A 4YRLA 4DIFA 2C7RA 4JITA 4ZQHA 9LDTA 2HK6A 1PL0A 1XD8A 3PPIA 3DC2A 1N5WA 4ZPJA 1CK4A 3GY0A 4GO1A 1BWQA 1GZ7A 4YAIA 1RYNA 2XKKA 3JQQA 3C2LA 3PFGA 3OZCA 4BVKA 2LGJA 2P11A 3QE2A 2P2GA 3I2IA 3FI9A 3NALA 4I66A 3CV3A 3T3FA 2Y1EA 2XEXA 2O7NA 2CD9A 3GG2A 4UU0A 4LDJA 3IAS6 1FLVA 4TMFA 5GWXA 4I2HA 1N3YA 2I54A 3A4NA 4M9RA 1Q83A 2PRYA 3MS7A 1E3LA 1GXSB 4DKXA 4RD1A 3IEPA 3PC7A 1N32B 2Z57A 4X6XA 4LRYA 4DBLE 1ESDA 4ZWNA 3L7BA 3D8TA 3PXBA 2COEA 3E9YA 3ZQKA 4Q39A 2D1YA 3CF6R 1S7GA 4G4SO 2ZROA 3H87A 5DBEX 1PJ4A 3GIDA 4G81A 4J3NA 4P84A 4TYWA 3PW0A 4WWHA 4OJNA 4JY7A 4C76A 2OLKA 3TSZA 5J2JA 1JSCA 1RPTA 2D6FA 1U5AA 5DYNA 5T3YA 4FOSA 4S1WA 4G4GA 1JXLA 1FFXA 2FSHA 4WJLA 1B4DA 1P7PA 1JR4A 3TZKA 1KP2A 2MMCA 4GWGA 4XPIA 2VPZA 4EPVA 1EK1A 3LY7A 1O0CA 4RQ8A 1DU4A 2HF7A 1ZBQA 2JLZA 1GZ6A 3RHFA 1JR6A 3G2MA 2PZGA 3N0VA 4YUYA 2W9CA 1N48A 1N7GA 3M6MD 3T38A 2R18A 2PMBA 4GU5A 4I36A 3OLVA 1FPMA 4DPMA 4Q8FA 5L4NA 2Z2YA 2FE9A 3KQTA 3L8MA 2ZR9A 4Y2PA 1H1DA 2B4TO 3HKBB 5TT0A 2Q3CA 5EZSA 1GPLA 2YIVX 3TL3A 5LUAA 5B6PA 3Q7SA 4WXPA 2AQHA 4WNAA 4IOLA 1QSLA 4CQLB 1IVSA 4NEGA 1GL9B 1H2YA 5EN4A 4CT4B 3H4MA 5ENDA 1ZOSA 1QF9A 4L8VA 1P5JA 3DMHA 4KSYA 3TLMA 1SOWA 1BDMA 2NUAB 3C1TA 2QK4A 1QS0B 4MGYR 4D9FA 1O94D 1TKCA 1ZXLA 3TE7A 2Q9CA 3USES 2J0UB 5GM2A 1IUNA 3ODPA 2QGZA 4FO6A 4LQLA 2HWYA 5DE3A 4QM6A 2ORIA 5DQGA 1N5OX 2ZG6A 1I6LA 1C1XB 4Y0AA 4HEA6 4MVJP 3EULA 4EG8A 1ODJA 2RKOA 4D0NA 3F9CA 3AY0A 2VPWA 5KKAA 3ZW9A 1UQRA 1W0CA 1X8LA 5I47A 2JJ2A 4NMWA 3R0VA 3INYA 1MOZA 3I1IA 1I24A 1DJQA 2D8MA 1QGUA 2Z56A 1CUSA 3OQMA 3CNLA 3R7FA 4S3MA 2X0FA 1FYFA 1LC0A 1GPYA 3QXCA 2Q2OA 4G65A 2VNHA 4FMDB 4G9GA 1CR6A 1MRSA 2VDOB 3HBNA 3NPMA 4L4SA 3HVRA 4PQGA 2YXNA 4KRYA 4C0XA 2ZR0A 1DKPA 1HFWA 1HURA 1M6YA 4LWQA 2AFIB 3HUTA 2XTJA 1H5UA 1EDEA 4R84A 1Y3AA 2ZDHA 1UBEA 3R77A 5KFDA 4IYRA 2BKEA 3F4LA 2H7XA 3CH6A 4B5LA 2CJWA 4PX9A 5CHGA 3L07A 5KQGA 4MQFB 1WMFA 4PG7A 4QAQA 2WD9A 4WL0A 1IOWA 1QIIA 1D8YA 4MEJA 2D00A 1H65A 2DQ4A 4WQMA 3F9IA 4BBAA 2CEKA 4YRSA 3OGUA 5CIQA 5AHRA 2IUTA 1GVNB 4XPZA 3CT4A 2ZE8A 1UP4A 1GGVA 3N58A 1J2NA 3D2LA 2QRHA 4RL6A 2HMTA 5JJBA 1EDBA 1Z63A 3K2IA 1KE1A 1AQ6A 4V24A 4BV9A 4BN0A 2V7WA 1YR8A 4HTFA 2QX9A 3GPLA 3LHIA 2XI4A 2LUOA 3RS9A 2EYQA 1C8BA 2AGQA 1VLVA 1D4ZA 5AVXA 4Y2YA 1NF3A 2ISSD 4ZKEA 4DJEC 4KRFA 3AI1A 4JL8A 3BJRA 3C4JA 1RP1A 4LBWA 4FFPA 4BMSA 1W48A 1L6RA 3INTA 3OA0A 5EXPA 4BLUA 4HKTA 1CUVA 3V8EA 1C0KA 2GO1A 1Z75A 1XTZA 2Q6VA 3G6YA 3GVXA 1YO6A 1G6HA 1EFDN 2WZDA 1EGAA 4MR7A 1NVUQ 4YB8A 3NATA 3TQTA 3I2KA 1NR5A 3QTLA 3OURA 3HRIA 2MUTA 3I9V1 2O0LA 5JHGB 4NU6A 2DHCA 1GTL1 1J2JA 1F20A 3HDQA 3R9XA 4UE2A 2WJVA 4RKWA 4IL6U 2WC1A 1O7JA 1SV4A 4F6CA 1SCNE 3QZ7A 1ETHA 4FR0A 1F14A 3QVGA 3Q2IA 4GOXA 4RQNA 4DARA 3EIQA 3QNUA 4CQMD 3B48A 3RBVA 2JLXA 4P4LA 3SYRA 5NULA 4FGJA 4EGJA 1DB3A 3I9KA 3C2KA 3OOSA 1T4MA 4HQ6A 3B53X 3PNPA 3JQFC 3JAWA 4KIWA 2CLCX 3E05A 1F8GA 3N87A 4OGLA 4ZEWA 5KQPA 4RHYA 4MIKA 3IP4B 2Q5LA 4N7JA 1UKBA 1IBCA 1R6BX 3H9UA 3IV7A 3B82A 3G5MA 3H40A 4RK0A 3KYCA 1Z5NA 4DTIA 3MDAA 2X76A 1G4AE 2A58A 2CB9A 2VJCA 1HDGO 1HI9A 3DQPA 5CLHA 2FWNA 4W8HA 4L85A 1QBGA 1G0OA 5CDTA 4OLBA 3FVVA 2R1TB 3EGDA 2UZ4A 2ID9A 3GLSA 4XYEA 1Q0RA 1AX9A 4KRXA 1PKXA 4HVLA 1XDSA 4R83A 1S4QA 4UUOA 4J9NA 2NO5A 1KDPA 1CFJA 3F97A 5KOIA 1KQQA 3D81A 3DDOA 3PITA 3U4MA 4ZJUA 4MQ6A 3GLHA 1H93A 2JVIA 1CHDA 2PNJA 1DKQA 1ZUNA 3CZ9A 2FY8A 1NMEA 1X7HA 1X7XB 4K6GA 4QDXA 4BBPA 1PL7A 1P2GA 3PYXA 3PWSA 1XR3A 4LA4A 4NOJA 4E0DA 2C0PA 3KEOA 5A0FA 4JI5B 2ZJ1A 4AQDA 1UBJS 1PQWA 4MNTA 3C85A 2SBTA 4DMGA 2F76X 5JSQA 2CXSA 4ADSG 5EUMA 4QWEA 4BJ1A 4HRVA 3HQ4O 4QRIA 3MXOA 3MTQA 4DR2B 4FFNA 1D8TA 4W5QA 1GEEA 1OXKB 4C7YA 3PR5B 3F4KA 3A1NA 1MJGA 3O9ZA 4GG1A 2PR2A 4MWOA 5F23A 1WDWB 2ZVJA 4G8JA 3O82A 2J0VA 4KLMA 3CLKA 2X6TA 4US2R 4M8IA 1Y1PA 4IXTA 3SBDA 3E7XA 1W5BA 1EP3B 4KE9A 1L7OA 3NTOA 1IY1A 4DOMA 1EMDA 2VJMA 4HWSA 5K0BA 1T5DX 3FR8A 4FZVA 2HPZA 4RIEA 4AL4A 1DAGA 4PFSA 3ZJ4A 3EDMA 1XRPA 2Y2UA 1JI7A 1I1QB 1SIWA 1MQAA 1Q11A 2W3RA 3W5JA 2BGUA 4J91A 1N5JA 1B4FA 1ZGJA 2R6JA 3MK31 1Z3IX 1ZQFA 1BXGA 1NJGA 1RXWA 2K60A 3WDMA 4BEJA 2FPIA 2UVUA 2WB1C 3Q7RA 3GELA 1Q92A 2WAYA 1QU2A 4UBNA 3E5HA 3D2QA 3OD5A 4KZKA 1KOJA 2A5LA 5I9IA 3P32A 5LDGA 2HKIA 3AERA 4JFAA 2OGTA 5HHHA 2G4LA 2AWOA 4IIGA 2KJ5A 4OGGA 1BX1A 1TUIA 1CEQA 2HHHB 4ZVKA 1GAEO 1KY4A 2AG0A 1Y9DA 2XWJI 4UBKA 2LKCA 1N60A 5HM8A 4NLNA 1MIHA 2VNKA 1BU8A 1JQJC 1WUDA 4QARA 4ZI5A 3LWDA 1OXUA 1AXEA 4KLTA 1FP2A 3OESA 5HIAA 3KXKA 2G09A 5DW3A 1JNXX 2C77A 1PW5A 4M4SA 3HU1A 1E6MA 2YVKA 3WGGA 2O8EB 1JHMA 2OBFA 4E32A 3GD5A 4A8EA 3SR3A 1KMHA 4ZAXA 4I2VA 1NKEA 4CQNA 4UCFA 4QZAA 1NC1A 1NQVA 4YO7A 1AM4D 3VCBA 3STXA 3OKFA 2LZ0A 4RORA 4LJSA 5L1LA 2RK6A 1AGRA 5C4GB 1Q22A 3T5PA 3JYOA 4RKQA 1MEEA 1P5FA 1L5ZA 3F2CA 2XBMA 5CCXA 2X4LA 4F84A 5J4YA 3QYFA 5ESXA 1C7ZA 2UUPA 4U7JA 5BN3B 2IU0A 5K4AA 2DHQA 1GSHA 1MTOA 3ANSA 2ZZMA 3AVWA 1I6KA 1HE4A 4R8LA 3X1YA 2PJDA 2IFTA 4JBHA 2I1LA 1EX6A 1PGNA 1J9EA 3OZFA 4X20A 1Z4LA 3RDPA 2BCUA 5EIFA 5AM2A 4WN9A 2IE8A 3BOSA 2B8TA 1C7YA 1TO2E 2I4RA 3QF7A 2C8KA 4BP8A 1OYVA 2REOA 1NBHA 1U0TA 4F6LA 3KPVA 1Q7GA 1HUOA 1NJ5A 3VI4B 4QRDA 1TLLA 1V96A 3CYFA 3Q7QA 4AROA 5K5EA 3ENKA 4HJRA 4Q7KA 2KP7A 2DKXA 3LP6A 3C3YA 4OHWA 2C2OA 3AIKA 3KPJA 1E0DA 3TZEA 2OWDA 2B6HA 3IBGA 4R5MA 3MFIA 3RYCB 4IIVA 3ZS9A 1NY5A 1IJBA 1FNCA 2WRZA 4FJ1A 1DJMA 4MX8A 2JGMA 3ASVA 1XQ1A 3H8JA 4L3WA 4RPLA 4DR1B 4JH0A 2GVDC 2RGUA 1W7AA 5ES3A 2BHLA 3JQ9A 3ZWCA 4FWTA 4YCCA 3PRKE 2QXUA 2XUQA 1A8IA 2V4UA 1T24A 2IA6A 3MYRA 1YA8A 5EYPA 8ICLA 3FUTA 2W2XA 3ZLTA 1RPNA 1XTVA 3JQ6A 2JJ2D 4C05A 4TXJA 1OH5A 2QJFA 4DCOA 1FS6A 1I3MA 1IBKB 2V0NA 3PJFA 4D3FA 5CFPA 4BNWA 4K9MA 1ZQJA 4XM1A 5L40A 1Y4AE 2N1MA 4Q4HA 3MJHA 4YP0A 4MS1B 3E03A 3PGJA 5E2AA 1T2DA 4IH1A 3SR4A 4PNEA 4RK1A 1M0EA 2DL0A 2WM9B 3THWA 4C0JA 3PHHA 1OZGA 2X0KA 3SI7A 3CYMA 3UK1A 4PANA 4URHA 1C1YA 8ABPA 3M1LA 5CFLA 3KU1A 3EJ6A 1WZEA 5J5AA 5KMGB 3K70C 3MMZA 4CL3A 2YX1A 1OWPA 4C07A 1CS0B 1QK3A 2MRLA 2CVQA 3JVIA 4WA7A 2WJPA 3LFHA 1WB5A 5FTMA 3W4IA 2P3QA 4HHEA 1AHNA 1LI7A 4M9LA 3HCFA 1DHRA 4RY9A 3JQCA 1MKYA 4FDMA 2NZVG 2A9JA 3M9OB 3EVZA 3WB0A 4H0NA 1QCZA 4GLJA 4MI1A 1HO3A 1WB9A 2JIOA 1E9CA 1B0AA 3U49A 4NPCA 1PNQA 2R00C 4R8MA 4OQEA 4UAYA 3N2LA 4DC0A 1Y9AA 5CHEA 1GFZA 2C9MA 3P26A 3OP4A 9ICSA 5EWMA 4CHTA 1LKZA 3HCEA 3HEAA 1J8DA 2JHAA 1HE8B 4IVRA 3WIUA 2EV9A 4JNCA 2TECE 2BEVB 3AUFA 1QF7A 4ARCA 1FQJA 2XE7A 5JNWA 1O89A 1L3SA 4JT2A 4C4TA 4ALNA 3SKVA 2VCHA 3L46A 3EOBI 3D9QX 3U81A 1X92A 3GFTA 1QG0A 3AINA 1VRCA 5LOVB 2HVIA 4XM0A 1N5XA 4CMGA 3GLTA 2R85A 5AT1A 3IMGA 2FF7A 2I33A 2J9ZB 2B8NA 1HX7A 2NO7A 4KQ1A 2G28A 4DJAA 4W1PA 3QPVA 2W6JA 4US0R 3WJ1A 1NR7A 2VHJA 2IUYA 1KBUA 3VYVA 1Z06A 4QU9A 3IEIA 3BDIA 4N0DA 4PONA 5I3CA 3RC2A 4EGFA 1N56A 2Q8NA 1OD6A 5BSGA 3BMNB 3U2QA 2V6GA 3GHHA 4BKPA 1D4FA 1VCOA 3BE8A 3USZA 4L72A 1DJOA 2FXVA 1XDWA 4K28A 4GGMX 3FUCA 3AFOA 5AXDA 4D74A 1U2ZA 3EUEA 4AK9A 3RLIA 2F3QA 3JWPA 3EQ6A 4M7PA 9MHTA 4MHVA 4J7XA 3QM1A 2FUNB 5DSTA 3LT2A 2BFCA 3HJRA 4EG0A 4DXDA 2HUNA 4A2PA 3B12A 1V3TA 3AL3A 3KLMX 4QOGA 4M9JA 1J7KA 1ZHHA 4IUDS 4YR3A 3ZOZA 3VYWA 2AGPA 4EIWA 2ONZA 2H08A 5HA5A 1X2EA 3TLGA 3P9ZA 3DEHA 3TQRA 3CPSA 3F78A 4GI3A 1AJEA 3RFXA 1JEYA 3F5SA 1PGJA 1A6SA 4QASA 1Q7CA 5P21A 5CUQA 2CBGA 3OM0A 1Y6RA 5K2MA 1MXFA 1Z8HA 2QLLA 2KHZA 1QIEA 4BNYA 4EBFA 4KG7A 1RTKA 4TVBA 1OBHA 4V02A 2FJ0A 4Q44A 3B7WA 2RAFA 3CMCO 2RAPA 3LLMA 3PL5A 3EA4A 3PX4A 1NVDA 2BQUA 3K3PA 3O83A 4NV1A 1VKNA 3UMMA 4CF4A 4FHFA 3BB4A 1DIBA 1UC8A 3RH4A 4CM7A 1F0MA 1A5ZA 4DQPA 2O8FA 4Q9IA 2QVCA 3HDGA 4X1KA 4MFCA 4AMBA 2JRZA 2HA2A 1ZQSA 4AX4A 3ZWBA 3DR3A 4BCCA 5CB6A 2D1QA 1EB9A 2WF5A 5CK5A 3R6LA 4QJFB 2HIMA 3B52X 3ZH9B 3N0WA 2OGSA 1ZU4A 4F6RA 3CLTD 4GXQA 4DR4B 3KYIB 2A5FA 4KUEA 1G9TA 3EF0A 3VKHA 1ZQDA 1HGXA 2FLVA 2QQ5A 3NEJA 1J2UA 4FYIA 3E9EA 2GM4A 3RQSA 4GAEA 1UKYA 2Q50A 1E8DA 2FV8A 3S2ZA 1EM8A 5HPYB 4G5SA 1MPXA 2YFKA 1ABFA 4RT2A 3VPSA 2P75A 4D81A 3EIEA 1CUHA 2OM2A 5H8WA 1OIWA 2BBSA 1I5RA 1RE0A 4MYSA 4E1VA 4QZFA 2GVZC 3EISA 2QN1A 1JHVA 2IH2A 3RF9A 4BLRA 5JFTA 3J80A 3SLKA 2YWEA 5K0SA 4MRPA 1U2DA 3PKIA 1HKUA 1N7IA 1SY7A 4J9OA 3DMRA 2PY6A 3U4DA 1FTGA 2ZWVA 4X7RA 5HE8A 3WNVA 3N7RC 2P40A 2F8SA 4D98A 1IHPA 2YC2C 2QW0X 3RUCA 1T4DA 4N8SA 4IMIB 1VG9B 3SS9X 1T3GA 4QZIA 3KZMA 3LUCA 4JEHA 4HZUB 3R7LA 1MOQA 5LLSA 2IK8A 4GC9A 2PGJA 1F51E 4JYBA 4YCSA 4DLAA 3EYAA 1VTKA 2ZYHA 4CIWA 4YJ2F 2H65A 3GQVA 1XDZA 3MR3A 4NLGA 3HP1A 1QH1B 1NM5A 1P1CA 3O8BA 4YMMA 2AUMA 5BVGA 4R1LA 4KVFA 3KB2A 3CKMA 2H5LA 1G42A 3H0LB 1OLSB 1PHPA 4D9CA 2C2BA 3FJ1A 4PQFA 2H29A 1AQUA 3CRXA 2HD4A 3DNMA 3ENNA 5D8DA 1FRFS 4KWCA 3O3MB 1SVMA 1JZTA 3LPAA 4R2IA 3QEMA 2M32A 4EUKA 3PEYA 5KFEA 1HRKA 1HEUA 4I4TF 4EG3A 1JHOA 2Q0QA 3MWLA 1YASA 1JQDA 1XTQA 4MLPA 5JH7B 5G1OA 1ZK1A 2EL9A 3QXXA 5DNCA 2Z8YA 4D9NA 2J5KA 1CNMA 3OQBA 2QPOA 2QPAA 4M0DA 4LWOA 5L6MB 2KBEA 2BOVA 4X62B 3VAZA 3A4TA 4BO5A 3PQEA 4RCYA 1CUEA 4JKYA 5LNK1 5TVGA 4L9AA 1RT9A 4EO7A 2CLDX 2PD6A 3I01M 1P5ZB 4WAUA 2AC7A 1DP4A 3EDRA 3PD1A 3ESXA 3D0QA 3TH5A 3PJDA 1M1YE 1YB7A 5E6SA 1JEDA 1FMCA 3QK7A 5CM9C 3IQDB 3V4ZA 1Q0LA 5KOJA 2WHQA 3CEHA 1BSVA 3PC6A 1L5HA 3LX4A 3P96A 4RTJA 5ARBA 5ALWA 3UPUA 2QTLA 2X19A 2QN2A 3C97A 4PL1A 1VJGA 2XIQA 1Q1GA 3K9BA 1AD2A 3VDQA 4DA7A 3CSUA 3KKKA 4EVIA 3ILSA 2OAQ1 3L40A 3C1ZA 2DSTA 2X8JB 3OLXA 3PIRA 1UBKS 1TJ4A 2G9RA 4KO1S 5KSZA 1RPAA 5CT4A 5IKPA 2I66A 5B7QA 3SS7X 3MWFA 3W4JA 4QUBA 2BGNA 4P2BA 4CFYA 1U28C 1B15A 1TYDE 3W1WA 3PNBA 4USAA 3KAKA 2WWYA 2TMKA 3F6EX 2JFXA 4PAOA 3OUTA 1M6NA 4KYTA 1US8B 2AMFA 4G8CA 1A27A 3DXYA 4HNVA 2YHIA 2JCXA 3THOA 4WZ6A 1RDFA 2K5UA 1LPPA 4YRAA 4LQ4A 4I08A 3IVMA 4KR0A 3V7YA 3NNNA 2PUDA 5H0IA 3U3KA 2O48X 3FDFA 2B2XA 2XVXA 3WL3A 3GXOA 3X3HA 3VM6A 4BTLA 3PB3A 1X3LA 3KSAC 5DGTA 5GZ6A 1K7CA 2V9WA 3T7SA 5JJCA 5KQMA 4Z4IA 1ZKDA 5K4LA 3NVYA 1V4NA 3VR2A 2DFNA 4N65A 4RTMA 1HETA 1IPEA 1L7PA 1QRRA 2A9PA 1MA0A 1R8SA 3OCUA 1GDHA 3FKQA 1WY5A 5FOVA 2H1RA 1O8CA 1TV9A 5FTWA 3HSYA 3SHTA 3UFXB 3MOSA 2BFDA 1JPVA 3RJEA 2QV7A 4K26A 5JFOA 1C0EA 4Z8YA 1V6CA 3HS3A 3UQ0A 1ZVQA 1Q74A 3MR2A 3IURA 3CNHA 3TNDA 3BDAA 3CXUA 2X5NA 4HUQB 3ZWOA 3F5EA 1M74A 3OPMA 3KL2A 5EMLA 4X9XA 5FLEX 4YAKA 1U4SA 2FFBA 1PD1A 3NRBA 3WLFA 3WYEA 1NJ8A 4DJ5X 1GPBA 3QVLA 2ZPUA 2RAUA 3HZZA 3E5MA 2RHWA 3C6YA 5ELMA 3W6UA 2C97A 1MENA 1GGMA 2GPWA 3STYA 5DQIA 2GLTA 3N4MB 1CD5A 1NGSA 3PZRA 1YACA 2C4WA 1I3NA 3K2QA 1VGQA 5B64A 5HMLA 1VE6A 2YRFA 4QTYA 4IXMA 2ZUCA 2HA7A 3CPEA 1P9OA 4DSKA 3NGDA 4DTCA 4R9NA 1E61A 2ZI3A 1GNRA 2OHOA 1FP4B 3PPVA 1J06A 4Q3DA 5IH7A 1FVXA 1LJUA 3M9LA 5TQ2B 1U9CA 5CDUA 4B6GA 1H2BA 1UPXA 3IXQA 3PLRA 2E4WA 3K4HA 2Q5FA 1CRZA 3F1LA 5DGXA 4E30A 4I9UA 2NYVA 3WKBA 3MUNA 1X6IA 3ENVA 5K4HA 5J59A 3L0BA 3SAFA 1ED1A 1NK4A 1B6GA 4K81B 4UDYX 5EE9A 4TL8A 1H66A 3BXHA 1XD2B 1F7UA 4LYDA 5ILGA 3MPUA 2O59A 3GDWA 1RMQA 1YF3A 1QHGA 5FHQA 4N40A 4ZOLA 5DEOA 4ZOQI 4PNZA 2YVLA 3N59A 5IYZB 3DE5X 2VXBA 1I3OA 1KZ7B 1AXRA 4BNZA 4FCCA 2JZNA 1BJKA 4PXSA 1Q1EA 1NKBA 4G23A 4OP1A 3EX7C 1LB2B 5BV0A 4C6RA 4C20A 1H23A 1RYYA 3RFUA 1Y98A 3A7EA 2CLIB 3HCNA 4UB3A 1QYVA 2I1WA 1H1LB 2PMDA 3ZJUA 3ZWYA 1B14A 5HJ2A 1V85A 2BCSA 1NJXA 4JGIA 2EQ5A 3ACCA 1C20A 3QSYA 3U7RA 3H99A 4U3JA 4W1SA 2V7BA 2YJTD 5C4MA 2ABWA 2FW7A 3L8DA 4Q05A 1X1EA 2HJHA 1GPAA 3IP5A 3OPVA 3WRXA 1JDNA 1ZIPA 1Z9BA 1U8TA 2IU3A 5LWHA 2WIKA 3PNQA 1DBVO 2N46A 4NDZA 2QM7A 1UM9A 4P83A 4GOJA 3L2OB 2XYHA 1LSOA 3SSNA 5D46A 1WV1A 4A15A 2PUFA 1BXZA 1KI6B 1VE3A 3LBNA 2FZGA 1VKRA 4FQ8A 5AWFC 3QMMA 1B0ZA 4LJYA 4IJ6A 1U48A 4FFSA 1KGDA 1LU9A 1YKGA 3RU3A 1KKUA 3FROA 5F4BA 4LK3A 4BE9A 3L4JA 1N3LA 3UFBA 5KFZA 3BF7A 1JG3A 4IDQA 4R16A 2IOQA 1NMZA 5JEDA 3D4BA 5KYWB 4FLFA 1JPUA 2K87A 5TRTA 1Z4KA 5G4KB 1DAIA 2HPVA 2BKVA 1P17A 4IJ5A 2GEVA 1NKVA 1ZGCA 2ZTSA 3W05A 4F1WA 1G2IA 3ZDQA 3DOCA 2XODA 4RD3A 1AN9A 3DZDA 4ZO4A 1DGSA 9ICXA 5JMWA 2GNPA 2EW1A 5CRXA 3RS0A 2ZIUB 2GZRA 1M54A 1Z2CA 4U7FA 2EW2A 4QC2A 3ZY2A 1NQ5A 4M8LA 4D7AA 1P2TA 1X74A 2Y76A 4XEHA 4LDPA 4C7OB 1CZRA 2ZJ7A 4KXVA 4BPRA 3F7TA 4YALA 3IJ5A 4AYTA 2ZIGA 4BVGA 4RU1A 3DMYA 1KOFA 4EGAA 2BFOA 4IRCA 1H6DA 1H2ZA 3UT0A 1WMSA 2G1PA 1B1AA 1TPYA 4MGKR 2PZMA 5ETJA 1FNNA 4GZ5A 4U2GA 2CEAA 4DV3B 3DHYA 3A2LA 4MVJM 1YQGA 1N8NA 2WOJA 1SM4A 4BRSA 2AKEA 2ZIZA 1BAPA 3VQTA 4HQOA 2Q6IA 4TKVB 3NG1A 1AOXA 4TMWA 1K63A 3ZY5A 2VLBA 4BZWA 4X64B 1WUIS 4CQJA 4A9AA 3Q3CA 4WFQA 4OBBA 4ZCMA 3B5EA 1R0LA 1OWMA 3R6GA 3EDCA 3T5BA 1OI7A 3B2EA 1I1NA 2RBKA 3E2IA 3LDUA 1HT2E 2F8KA 2MSDB 1LNZA 3L93A 4I3GA 3CZPA 4QGGA 2K4EA 3TSOA 1J4AA 3CJTA 4R2JA 4I55B 4ECEA 2WSMA 4B3MB 1YVUA 1JFRA 3M1YA 4HYTA 4IJQA 4RFVA 5JXWA 5EQJB 1OV6A 1IPFA 1GSOA 3ZGZA 4ETNA 4WZAB 4OHCA 4Z4HA 1FFSA 2WJJA 5BWBA 1TYAE 3FYUC 2QMOA 1OFUA 4E3ZA 3D8BA 3ZVMA 2XMSA 5A6SB 1GG8A 3ZZ1A 1MABA 5AXAA 4BC1A 1LSUA 3P0HA 2A1IA 3TIGA 3SYTA 5IBRA 4OF4A 3K4GA 4IQFA 2XT9A 1THZA 1NPTO 3ZBTA 1GTMA 1OZFA 3TQIA 3I2HA 3K8ZA 1SVNA 4K9RA 4O5EA 2WU8A 5DTEA 5THQA 1HKHA 1UP6A 3T15A 5DKWA 4TRRA 2I65A 1V41E 2VA8A 4CKEA 1P4HA 1TYBE 2A8YA 5FNVA 2I29A 3IOBA 3D3QA 4ILEA 1KW4A 1XPJA 3DT6A 3QKRB 5LBIA 2MSEB 5BSHA 2W2VA 1V9CA 4RHTA 1D2AA 4OXNA 1MDBA 5A03A 3DLAA 4HQFA 2Q1SA 5B3KA 2DPLA 3ET5A 4DJTA 2IUEA 1NW5A 5A5EA 3IJRA 3F6YA 5F9LA 1MX9A 4X61A 3SAJA 1FZQA 3O3NB 3R7NA 2OECA 1EVIA 2BMWA 1N2CB 3LK9A 4FJ2A 3T3EA 3E35A 3V1KA 1W6UA 3HB1A 3IGFA 3QV1A 2A5GA 1JRLA 3MGGA 5BQXA 2QP4A 4EF6A 2FYTA 4P31A 4P34A 4DLVA 4UVDA 1APBA 2Q0ZX 1JFFB 3PE6A 3KFLA 4RZXA 2L42A 5AVSA 4A0RA 1ISPA 4EKNB 4PYNA 5EJFA 3GLFA 4RQ4A 1FSSA 3RKRA 3TKLA 4Z1OA 1KYIA 3GRVA 5DCYA 3DP9A 3V1LA 7ABPA 2R1UA 2J9RA 4RQ0A 3JWIA 4ZAYA 4DV4B 3WLIA 1P61B 1V5GA 1XN4A 1PVDA 4MRAA 1YZTA 3RTGA 1W73A 3JPSA 5LQDA 2CFSA 3T3GA 2C88A 4ID3A 4UAGA 2G5HB 3GL9A 3GPIA 2W9MA 3VTFA 2VR1A 4IHKA 3ZWMA 4P6VF 4ZQBA 5IDXA 1SGGA 4RU9A 3ANYB 4OXQA 2I3DA 4G09A 3HVJA 4E7PA 4DDUA 4EUFA 4GLFA 2X22A 3GW8A 2NRXA 4IL5A 4P4UA 5DULA 1YT5A 2O0HA 2V7VA 3GV7B 4MR8A 5J63A 3VR2D 2IDMA 3H2HA 1B8OA 5HQJA 3H1EA 4F3CA 1GV0A 3ESDA 1XJ5A 3ZWKA 4P5EA 2NSHA 3WLPA 3I9NA 5LXTA 3QVJA 4YRFA 1AUQA 4QZDA 4QM7A 3C3JA 1I7LA 2IC5A 1XEWY 2MINA 4ZYWA 1H9AA 5HWSA 1XP8A 5F33A 5JNLA 3D5TA 1P3Y1 2O2XA 1JLSA 4ZK6A 4UNPA 2MMGA 4U4AA 5KX5A 2AF3C 2J08A 2J9FB 1WTAA 1GRRA 2VI5A 5JJIA 1U9LA 3I0MA 4MPPA 4R8SA 2B61A 2UZ3A 2GOLA 5E2BA 1G64A 3H9EO 5JZVA 4C5BA 5KC8A 4K8OA 4A1OA 3C2QA 3NCHA 4DY6A 1FJGB 3NH9A 1IXRC 2C4HA 2YMQA 3F74A 3LPLA 4JBNA 1DAKA 2WHYA 4JVNA 5CDYA 2LP4Y 4D57A 4RVHA 1U6KA 4K1XA 1XDGA 1O6GA 3Q87B 2CFRA 2F17A 1T9DA 4XQ9A 4KBFA 4DMRA 2JD2A 1SH7A 4FNGA 1GV1A 3P2JA 4IYJA 1GVHA 3H05A 4URYR 4XIFA 4X6UA 4P7BA 2XF8A 2B35A 1OFUX 1I5EA 1KI8A 1T3LA 4PE5B 3QUCA 2ZIVB 4M7OA 4LQCA 4CPDA 2RH5A 3IALA 4BDSA 3FWNA 1NQXA 3LUDA 4LZJA 1L8XA 1YTUA 5C8YB 5HYVA 3TZBA 4LHYA 2WWVD 1QGYA 2PGAA 3LLSA 5DXAA 1UEJA 1W4BA 1KPHA 2AMVA 2PLWA 2HSDA 4COKA 1E20A 2ZJ8A 1OTHA 4P7FA 3UCFA 3D8HA 2FHPA 1E5DA 1HNZB 3O1IC 3TQSA 1YBMA 3LWBA 4MZXA 5DM2A 4Z7NB 5BMOA 3MCZA 1HNWB 3VH2A 3N86A 4QVKA 3OJ0A 2V5VA 3V8NA 5CVTA 4M0CA 2FOIA 1GTJ1 4C01A 5D7NA 2EG9A 3ETGA 1RQGA 4BRZA 3D2AA 1GJRA 4Q16A 3AUOA 3Q8MA 4B47A 2XGGA 2VF5X 2XRYA 5ITZB 2YTUA 3MT8A 4J1TC 1X80A 2R5FA 3MLAA 4RJTA 1KTQA 5FHRA 4G1FA 1D0IA 2XMPA 4R81A 1E7SA 1VM6A 5EP4A 1YUBA 4DSIA 1T36A 2Y1DA 2VQEB 3GJTA 4L76A 1JE1A 4QGFA 4X71A 5C31A 5KFQA 5AVYA 2O8VA 1RWWA 4PGMA 1A8QA 3C15C 2ZB4A 5KTMA 3ICWA 3K16A 1NMQA 1WCLA 1T91A 2W2PA 1Z4MA 4ZQGA 2FMXA 1JGTA 1ZQWA 1GYPA 1BD3A 4CQLA 5GTIU 4L3VA 2RI1A 3E9CA 3WAKA 4H1HA 4F9GA 4D8YA 3QHQA 4KQWA 1TJ5A 4UBMA 1EVQA 4LGVA 4OQPA 2DCMA 1G3UA 5H7XA 4QUJA 4O08A 1JG1A 2QG6A 4GRAA 4WTOA 5TMPA 2ZT5A 2QL9A 3EEYA 4PL2A 3IEXA 4RMNA 2FEPA 2E82A 4I29A 5JQWA 2AA3A 4GH5A 2XICA 4LV5B 4H7JA 1Z4IA 3X0DA 4ZVSA 1YJCA 5AK6A 5EWLB 4Z51A 4H3KB 2YXLA 3TTWA 2RHGB 1WSWA 2NQ2C 2C2MA 2QYHA 4IIJA 5DNAA 1JIHA 3EVAA 2WWIA 5J2DA 2RGGA 3BS5B 1F1BA 4UHHA 1CUJA 2ORED 4ILKA 1YFLA 1XQXA 1K6MA 1NLZA 1W4AA 3JARB 1E1QA 1XC7A 2ASLA 4RH3A 5D3MA 3HPRA 3VVBA 4LF7B 3GIKA 2C28A 3PSHA 1YIAA 4IC9A 3SY8A 3FLMA 4WK2B 5CM8B 2FETA 4M47A 1II9A 3Q2KA 3SDBA 1SVWA 3G8DA 2VOJA 1Z7BA 1C9EA 1G20B 3ZBQA 4KPUA 4L5CA 2BZ1A 3ZNPA 1CT9A 1HZZA 2AYXA 3AFNA 3NBZC 4YYEA 4EEKA 4KLDA 3X44A 1DRKA 4ZAGA 4A8JA 4NMLA 3GA7A 5ALKA 4ZVUA 2GJ4A 2YWBA 1PQPA 1Q1AA 2NUTA 1FFCA 1JQ3A 1JQKA 2FR8C 4B4WA 2GEJA 4GQIA 1M2VB 3TARA 4IG9A 2EDUA 2P66A 3O8LA 2CF5A 4AB1A 4JJIA 1O96A 2PSEA 1SHKA 1FIUA 1ZUD1 2AFIA 4BV2A 1BHJA 3VFDA 3PA8A 1TKRA 1Z16A 3MS2A 1MB2A 2HV9A 2BC9A 4I9NA 1AKTA 3NHBA 1UK7A 5C46F 1HL3A 1TVCA 3ZCXA 4Q24A 3R20A 1Y8QB 2JFNA 4GP6A 1SB8A 3EZGA 3UYKA 4IAOA 1YBAA 4GUAA 1N1GA 1EJ2A 3LP5A 4NENB 1Y8ZA 4BQRA 3GAFA 4YI5A 3RIXA 3TZLA 3B78A 4MDYA 4NZYA 3ADDA 4G5OA 3G0BA 3SEQA 2YKGA 1SHLA 1XZKA 9ICHA 1Z6PA 3MA0A 5CDHA 3K94A 1YT3A 3HKCA 1PFUA 3UNXA 4MV8A 2J7KA 4UFPA 3A70A 2QLTA 6REQB 3UJDA 4BB0A 3QLVA 1DKUA 4D3YA 2E85A 3PV0A 1ZQ1A 4MW2A 3U61B 3ZNNA 2PRZA 5HKLA 3ESCA 4LYJA 4WV3A 1RQ7A 5HMMA 1T0UA 3AEUA 4ABTA 1YZQA 1E32A 5I51A 2WPNA 2G3YA 4Z8XA 1XWLA 3MEQA 1MQ3A 1SKUA 2Q99A 3H0CA 4LFCB 4IQWA 1T94A 3F2IA 5HEKA 1KQGA 5KFPA 1AUPA 3OF2A 1NSTA 2QB5A 3SXUB 2MR6A 3VKUA 3EDYA 2YCLA 1IHXA 3HJTA 1A1SA 5BSFA 1BE8A 1RM4A 1S2MA 4C04A 1RC0A 1NXTA 1YU9A 3PENA 2OCBA 2I7DA 4JA0A 2G4CA 3QPUA 5DGCA 4H08A 5C7LO 2DBQA 1S97A 1CXZA 2EP7A 4RQAA 1N63A 1KBQA 5DM70 2Z0MA 4RQ2A 1T2AA 5LP6B 1LDYA 4B3RB 5K3DA 1FYEA 2ZBFA 1PYDA 1T26A 3PGLA 1VL2A 4XARA 4RSHA 1TRHA 3I6MA 3O8QB 3DVAA 4UQOA 3VZQA 4NH4A 3IT2A 4RANA 4ID9A 3RYHB 2Y1XA 4RZIA 4UU8A 5J4VA 3P9KA 4V0NA 1SHZA 2KFZA 1R3UA 4GI2A 4NATA 5TQVA 4MYUA 1ZRMA 1XROA 5ADWA 5IJZA 2B98A 1GU0A 2IXFA 1JG7A 3MM4A 4XWKA 2PZBA 1SBZA 4BY9E 2Z4SA 3VV2A 1RPJA 2WI8A 3TW8B 4BNJA 3ROFA 1L8AA 3PX7A 5CW2A 7ICHA 4M0EA 3D6FA 2VQSA 2J32A 1IN7A 4K6KA 4KZPA 4AIRA 2Q6TA 1BHSA 3QXJA 2QUBA 1E2MA 3AFMA 2OK8A 3WBJA 3PUWA 4DOAA 3I8XA 5GZ3A 5FA6A 1EE2A 4JR1A 2JA1A 4UHBA 3BCUA 4I9GA 5B1YA 2XGMA 4CL2A 2DZDA 1BWPA 1B73A 5J0UA 3BGDA 3DL4A 4KOEC 4K4IA 2OZLB 4JP1A 4BGVA 1JIVA 2VZLA 5FDFA 2FP4A 1YGYA 1FUKA 3NH6A 2MYTA 1SQ6A 3TQQA 2YYSA 1I1HA 4J7AA 1INLA 2AHOB 3KRTA 4QQKA 4MKRA 2J6IA 1E2PA 3H5TA 3QF4A 1TCAA 1AKEA 1PNRA 4M36A 4CTMA 4G3XA 3FMVA 4CMKA 1X86B 5KFJA 2YWHA 3RV4A 2AVDA 1M2OB 2BDEA 4WIAA 2P2NA 3GYBA 1BPYA 1QG2A 3T3NA 2ZW9A 1IEVA 4LNAA 2POQX 3O9MA 5JDIC 1DOHA 2AYZA 1EVZA 1DARA 3N2GA 1M8PA 4NFSA 4RO0A 3VI3B 1AQYA 3IPYA 3WJ7A 3AF0A 3WOVA 4ZHQB 2R79A 1WO8A 2J33A 1MO2A 5J2CA 3T9FA 4WZBE 8ADHA 4CM9A 3U44A 1SHUX 2GZ3A 1X7GA 1TM5E 4IKOA 4QECA 2OVFA 3QKWA 2JBAA 2XVYA 3TUZC 2VDWB 5SY9A 3EYWA 4I2EA 4RSRA 3AVXA 5L7YA 2DMRA 4M9SA 3CZRA 2ZYRA 4RUAA 3ZGLA 1AROP 3TADC 3UY4A 3GLVA 4UUMA 1JUDA 2F3PA 5I01A 2BGRA 4DQVA 3Q8SB 3IDZA 4R01A 2VOEA 1P72A 4RMIA 3OFJA 3EFOA 2B20A 3OT1B 4MROA 3ZW8A 1JHXA 1F8YA 5J2UB 1KWGA 2Y4OA 3FTCA 3PUHA 4IQ8A 4PZYA 5DM0A 2HT1A 2AH5A 4M86A 4MP8A 2CHQA 4DAOA 5CAEA 3UWMA 1SUFA 3PQ8A 4CU2A 2C7OA 5JSKA 3M7IA 1P2DA 3B5JA 1AUXA 3ZQ4A 3O3OB 4IQUA 1ENYA 3I9LA 2R8GA 4MK4A 3GZTB 5E6RB 1Q14A 4X90A 3UBTA 4MP3A 1C30B 3DE7X 2ASJA 1EHCA 3BZBA 4REQB 5AK4A 4G4SP 6PFKA 1TL7C 1CRPA 3KL4A 1JT2A 1UWKA 5EJ2A 4OHVA 3IN5A 2ZRHA 1LPBB 5K6AA 4DUYB 4J8PA 1S9HA 5BNTA 4PO8A 3FAKA 1GQOA 5KNLA 2XYGA 3P27A 1HF3A 1OBVA 3PJEA 2YIMA 3NBYC 3GJ4A 2BKAA 5F3RA 1VOTA 2IYEA 1WYGA 2EFHB 1K9SA 4UM5A 5BN3A 1WZ2A 5JUMA 4NJEB 3ILYA 4C14A 4IIEA 2GX6A 4JI1B 5TS3A 1SQFA 5KG5A 3Q72A 5H5JA 4KDCA 5I45A 3RB6A 3E8SA 3G3EA 4UPEA 5NLLA 2DFVA 1NVMB 2C2ZA 4A2QA 4J0FA 4WD3A 3W2HA 3H4DA 3WRWA 3NAGA 4KDRA 1F3LA 4S04A 4F06A 2W58A 3R76A 3DKKA 5J40A 3WYNA 2RCNA 4OXXA 3FIJA 3CISA 1FDSA 3N8KA 1QVRA 1JWBB 2C5SA 3OTGA 1HLDA 3HL4A 1ZOIA 2P5YA 1ICIA 5TPWB 1M8FA 2HHTA 3KWFA 5DZSA 2FQYA 3K5PA 4DS5A 4KIGA 2XGPA 3H2ZA 3NORA 3G7SA 4ZOLF 1YCFA 4HMQA 4FZNA 3FSGD 4X63A 3RYCA 1HL7A 4QHTA 4YCBA 3OWOA 4FMCF 1NDUA 2O57A 3UHPA 4LVCA 3RVLA 1P0FA 4ED9A 1JDBB 4L7VA 4LPKA 3QLUC 5FJJA 4PG8A 5KTNA 4YQFA 4L1KA 1G41A 2XNKA 1Y3CE 2B5WA 2VXOA 4GYJA 2J45A 2IF0A 4GYKA 4PBSA 1E1QD 1MJNA 4FUQA 4RCVA 3ITNA 2NT3A 2QU7A 3DWEX 3G2PA 3JASB 5BNZA 1VA4A 4N3GA 5AI9A 5HCUA 5EFOA 4B8WA 5JQGB 3KHTA 3PQ5A 1IHDA 1SEVA 1CWUA 3KV1A 4B6FA 1Z47A 3E3OA 4R7GA 4I2NA 4QYMA 4IINA 2R7NA 4KHPB 3N2NA 2ZULA 4D46A<