3QU9A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with magnesium and tartrate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
225
Chain Sequence
SHMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 79
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu9A01
3QU4A 3UMGA 3WKDA 3QUTA 2G06A 4RESA 2B30A 5A3RA 3WK5A 4QJBA 5ALGA 1NRWA 3FZQA 1WVIA 3U7EB 5AICA 5ALQA 2FDRA 1TJ4A 4OCZA 1J8DA 1YJ5A 3SKXA 3MPOA 4YH1A 3OPXA 3AR7A 1Z5UA 3R9KA 4UATA 1RLTA 5AW1A 5AW4A 1L6RA 1FEZA 5AKJA 3QU2A 3S6JA 3SKYA 1Z4PX 4KNVA 5A3QA 4Y2VA 2R8YA 3PCTA 5AESA 4EX6A 4UASA 5AI0A 1YV9A 3L8GA 1JUDA 1RC8A 4YGYA 5E0OA 2YFYA 3E58A 4Y2TA 5ALTA 2OA0A 4L6CA 3B8EA 3A3YA 4KNWA 3U7GA 4DFDA 3KOOA 4EELA 4CF4A 3EF0A 1ZOLA 2B8EA 1RPZA 2MU1A 5AVQA 1ZD4A 2P69A 3WKAA 1Q92A 3L1UA 4XPZA 2W4MA 4MUMA 5AKHA 1Z4OA 3HLTA 2HX1A 3FGOA 2BY4A 4GIBA 1ZD5A 1U2SA 3I1YA 3ED5A 4CF5A 2YN4A 2EATA 4EZEA 2Q4TA 2G07A 2FUEA 2YMMA 1RQNA 3WKCA 1YMQA 4I9FA 3NALA 3SF0A 4O8CA 1TJ5A 3L8HA 4IFTA 4FFDA 1O03A 4UMFA 3WKBA 1Z88A 1VFPA 1XPJA 2GMWA 2HDOA 3U7FB 5AW5A 1Z4JA 3NIWA 2D2VA 2FEAA 1LVHA 4Y2JA 5AKZA 1TA0A 2CFRA 2B8JA 1F5SA 3EF1A 3PGLA 2G80A 3AR9A 3A1EA 2B0CA 4F72A 1Z4KA 1SWVA 3DAOA 4NFLA 2QLTA 1L7MA 2ZBGA 5AKLA 4UU0A 1ZRMA 5AM5A 2ZBEA 5AVVA 1N9KA 3OCWA 3WGVA 3BWVA 3QU5A 3L1VA 3QYPA 2B1QA 5AVRA 3TLMA 4KX3A 2IOFA 4AS2A 3WK7A 3ZX4A 4DWOA 2HF7A 3ZTWA 2ZBDA 3R09A 2IOFK 5FP0A 5ALIA 4BEVA 1RQLA 3AR5A 3QUBA 4AS3A 2MU2A 1QH9A 4KYTA 3I28A 3ESQA 5AK6A 2O2XA 3QX7A 2HEGA 2P27A 1S8OA 3MC1A 2VKQA 2P11A 3ZWDA 2AGVA 5AIAA 4UM7A 2R8EA 4HGQA 4ZEVA 3QU9A 1VJ5A 5AI5A 3IJ5A 2HOQA 5ALSA 3SMVA 3U7HB 2OM6A 2IA5A 4UU1A 1T5TA 5ALWA 1L8LA 4FE3A 1QQ5A 2HF2A 2YY6A 5ALRA 1O08A 3OCVA 1NNLA 4HGNA 3WK8A 3M1YA 3EPRA 1X42A 2I7DA 2ODAA 5AW6A 1SWWA 4BX2A 1XVIA 1N8NA 5ALFA 4F71A 1RDFA 4G63A 5AI8A 4Y2QA 1QQ6A 4QQFA 3UM9A 2BDUA 3GYGA 1IWOA 4HGRA 5AM4A 2CFSA 3L8EA 1ZS9A 1U02A 5AVTA 4IG4A 3RFUA 2ZBFA 4NAVA 4GXTA 3ONNA 4L6AA 2G0AA 3DNPA 3ET5A 3N8GA 1U2TA 2PQ0A 2W43A 2FPRA 3P96A 1T5SA 2NYVA 4EX7A 1YS9A 3L7YA 5AW2A 4PNHA 4UM5A 1QYIA 3VAYA 3U13A 4XE5A 2EAUA 2EARA 5AI9A 2GO7A 2WHEA 1RKVA 2C4NA 3L0BA 5AKGA 4HGPA 1ZRNA 4DCCA 3D6JA 3L5KA 3NAMA 1SU4A 3ZUPA 5AI4A 2YJ6A 3KD3A 5AVYA 1RLOA 5AW3A 3CNHA 1L8OA 2AH5A 3ZVLA 3NUQA 2ZG6A 1TE2A 2WF5A 4UMEA 1Q91A 1L7OA 4Y2RA 4RETA 4CF3A 2C8LA 3E81A 4YIHA 3ZX5A 1T9ZA 5ALVA 3N07A 3U26A 4BKMA 4J03A 1Z4LA 3B9BA 2NO4A 3L0YA 2RAVA 3MN1A 4C4SA 3FM9A 5AW0A 3ZU6A 1WR8A 3A1DA 3ZWKA 2GHTA 1RLMA 3PGVA 3AR2A 1ZD3A 5AIBA 2JAUA 5AKIA 3ZTYA 2I34A 5ALYA 3QXGA 5ALJA 1LTQA 2AMYA 3AR8A 3QUQA 3L8FA 1ZJJA 4EENA 3EWIA 4FYPA 5IT4A 4OFZA 2C8KA 4BX0A 5ALDA 4EEKA 3OCZA 1WZCA 4JDPA 5T41A 3ZVMA 1QQ7A 3CZ4A 5ALMA 2DQSA 2QYHA 5AVXA 4L57A 5AW9A 1RKUA 1WPGA 3ET4A 2YJ5A 1RMQA 5ALKA 1L7NA 4XQ0A 4MWOA 4JB3A 2OBBA 4UAVA 2YJ3A 4KN8A 5ALNA 1EK1A 2RARA 3WK6A 1CR6A 1VJRA 2YBDA 5AVUA 4Y3UA 4HYTA 4CE6A 2WF8A 3R4CA 2Q5EA 5ALXA 1RKQA 2O9JA 5ALPA 2AUTA 3ZI4A 2YJ4A 1Y8AA 3SD7A 1Z4NA 3FVVA 4DW8A 2WFAA 4C4RA 2HI0A 4Y2UA 3M9LA 2I33A 2IYEA 3K1ZA 3OCYA 1TJ3A 4BNDA 5ALUA 2B82A 3ZVNA 1NF2A 5AHXA 5AKYA 4G9BA 3QU7A 4CNQA 2CN1A 3W5DA 3W5CA 5AM0A 4YCLA 5AM1A 3U19A 3FPSA 5ALEA 3SLRA 1Z4MA 4B6JA 2C88A 3AR3A 2I54A 3PDWA 3WK9A 5AVWA 3L0CA 2MSNA 2YMQA 4C4TA 2G1AA 3AR4A 4YCNA 4NV0A 2IOHA 2JAOA 5IT0A 1L7PA 5ALHA 2OYCA 3SHQA 5AKEA 4Y2SA 1YDFA 1YNSA 1KYTA 1ZD2P 4BYGA 5AKXA 4ZEWA 1PW5A 4KX5A 2C9MA 4BNDB 4UMDA 5IS2A 2Q4RA 1RRCA 2HHLA 3BA6A 3KDPA 4Y2YA 3N1UA 3QGMA 5AKKA 5A3SA 2X4DA 2GFHA 3NRJA 3E8MA 2HCFA 5AK3A 5AM3A 3QUCA 4HGOA 3QLEA 3KBBA 4UW9A 2R8XA 2ZOSA 1J97A 2ZXEA 4OHFA 4BX3A 5ALOA 4BBJA 2BDEA 2PKEA 2W11A 2WF6A 4I9GA 4YCMA 3F9RA 3ESRA 2HSZA 4Y2PA 2B1RA 3AR6A 3DV9A 2FPWA 5AVZA 3IRUA 4BEWA 3B9RA 3N28A 3KC2A 3A1CA 2WF9A 2HO4A 2FPSA 5AVSA 5ALLA 2G08A 3UMCA 2JAWA 3OCXA 2FPXA 3I6BA 3W5AA 1RMYA 5AW7A 3WKEA 4OD0A 1RMTA 3ZW7A 2I6XA 1CQZA 5AM2A 5AI6A 1MH9A 2G09A 3WK4A 1Z4IA 4YIKA 1K1EA 1U7PA 4H1WA 3RF6A 5JJBA 3FPBA 3DDHA 2PR7A 4J2TA 3KZXA 2NO5A 3MMZA 2I55A 1S2OA 2FPUA 1AQ6A 3UMBA 1Z5GA 2FI1A 2P9JA 3E84A 4NABA 3I76A 2WM8A 4HAIA 2YMLA 2WF7A 4AP9A 2YMPA 2RBKA 3HYCA 3N5KA 3OCUA 4XOUA 2RB5A 1EK2A 4ZEXA 3QNMA 1Z4QA 2CFTA 3OTQA 4UMVA 4NWIA 3WGUA 2FUCA 4UARA 3J7TA 5AK4A 4Y2XA 3NANA 1U7OA 3IB6A 4UAUA 4E88A 2JGAA 5AK5A 2JARA 5ALZA 1XP5A 3W5BA 3NASA 5AW8A 2R8ZA 2GHQA
chains in the Genus database with same CATH superfamily
1MO2A 1JWAB 1CG6A 1P5ZB 2FGKA 4BQSA 4GXKA 3JTMA 2JF0A 4K81B 4XEUA 1FXUA 1L4BA 4P7FA 1RAEA 3CF4A 5D51S 3SVLA 5KTKA 3PFNA 2WP8J 1EFAA 3OJFA 1HKUA 1Z36A 2Z58A 4LBVA 1LQTA 3GJSA 4RM3A 2LKCA 2Z8YA 3NDRA 1REQB 1H4VB 4A2QA 1BX3A 2DC1A 5LXTA 4X0EA 1E96A 3WBBA 1X7YB 2OOSA 3MRTA 1IOZA 1DRUA 1Z6XA 1ZD9A 2YXEA 5F5XA 3OVMA 4V38A 5F21A 2P2NA 2WYHA 4RPLA 4ZHQA 1QHEA 4HK4A 1PT8A 5DM4A 1VPEA 3DXFA 2PE5A 2KZZA 3EBPA 1ORHA 2EW8A 4M1SA 4FP9A 4P84A 2HMUA 4Q3DA 4R8RA 4UTOA 1L5KA 4H59A 4Q15A 5DLEA 1TK5A 4KLMA 2HC9A 2GPAA 3E9RA 4EX6A 2RK4A 4L50A 4A5SA 2OCGA 2NZYA 1FSPA 1ZQFA 3EFOA 3L8GA 4RK0A 4QDTA 4YVFA 4FS2A 2ORIA 5KFZA 3L1IA 2F2AB 3UYKA 1RC8A 1O57A 1NMSA 5C46F 4D98A 5B7GA 3UUEA 3JZIA 4KR9A 3CJQA 3LVWA 1JEDA 1KJYA 4R40A 3UVEA 4B43A 5IF3A 4W8HA 1N34B 3U7GA 1NF8A 1G38A 3OOYA 1Q12A 2VBGA 4IQGA 2EBUA 1N32B 4UB6U 1G9SA 2QD4A 3FG9A 1D09A 2YNMA 5DWQA 3VA7A 4V0NA 4MZXA 3QE9Y 1VI2A 3I58A 9ATCA 4PHGA 1KRXA 1HDGO 3NOQA 4MW4A 1NJYA 3RPEA 5JNWA 3P5BA 4JEHA 1DRWA 4N7RA 2SKDA 4CKWA 3GLHA 4DO9A 1BCSB 1MB2A 2W4MA 3A4YA 3CISA 3IHTA 1G8YA 3K1TA 4QWAA 1QFSA 4UEKA 4Y6LA 5F7JA 3TL6A 3K70B 5KSWB 1LWOA 4PX2A 3AESB 4D6YA 3IBCA 4YRCA 1QS0B 1ZYUA 1EFCA 4MW2A 1W0JD 5ELMA 3GAFA 4CKBB 1G18A 1ZD8A 3BRWA 2JEZA 5SY6A 5WRFA 3A2NA 3HO6A 4YRNA 4B4OA 1GNVA 3MGGA 5CLIA 5IWAB 2LIVA 5KTTA 3NGMA 4J75A 1C0PA 3R9WA 2IX9A 3GAMA 4JX9A 1KETA 2AJ8A 3L8HA 4DGSA 1S02A 3E9DA 4NHEA 4ALLA 2DY0A 4Z1MA 6ABPA 1VCOA 2FV8A 3KU4A 1AK2A 4YMWA 1X9GA 1ZBQA 4EG4A 4ZV4A 4MV3A 2VDJA 4FHEA 3SYZA 3A4TA 7ICNA 1O95A 4G8CA 4KV9A 1SU6A 3GLQA 4CMBA 1HFJA 2J9XB 1YE5A 2EC5A 1CR1A 3LE8A 3DVAA 4JBNA 4UHKA 1TD9A 2W6MA 4W1PA 4D74A 2WYVA 4UTVA 3AHEA 5IVKA 3VHLB 3WV5A 2AF4C 3RVMA 4WAUA 4ZWNA 4I5GA 1PHRA 1WY5A 1YQQA 3A1EA 1CUDA 4G23A 2WLSA 4D96A 2XMCA 1P9WA 1RPTA 2CDCA 2JIPA 2WZBA 2WFZA 2VZ9A 1M7BA 4GQBA 4HGYA 2EX0A 4WN3A 2NADA 2OGWA 3RK1A 4REMA 5C5EA 3EEOA 1L7MA 4RU9A 4DBLE 4ZYTA 2XADA 1I2CA 2LMRA 2HQBA 1I6KA 1XKXA 2HU2A 3DNMA 1KI3A 4B6FA 4BZXA 3JQ6A 4YB8A 3BMOB 2AG8A 2OHOA 3CNLA 3FUXA 3EFOB 1KYIA 3TFSA 4KBGA 4LK3A 4U0KA 2F67A 5TZVA 2Q7OE 3ZJ5A 4BNVA 3WGVA 4ZGGA 3A6KA 3OFVA 1E9EA 2YN0A 2NUTB 4Q44A 2NSHA 1FSZA 3GMTA 4D4GA 3U5TA 1WA5A 3JQ7A 4UBOA 3HL0A 3R5HA 4YYZA 4PLYA 4QVKA 3C43A 1VLLA 1J0DA 5LNK6 4ESOA 2VBFA 3ND9A 4KR3A 3QPCA 1RT9A 4K9SA 4BEVA 4F9EA 2SKCA 3QUBA 1U8XX 1WOYA 1ZOSA 1X92A 2YX8A 2Y9PB 4KYTA 5KDLA 4LQ4A 1A2BA 3CR3C 4LMBA 1OA1A 4UXIA 1NBMD 3T4UA 4CMHA 4F6LA 1KY3A 3MC1A 5JCPA 3EUWA 5D00A 2H3QA 4B81A 5L7TA 5JUMA 1EWVA 1QGUB 2PMEA 3SF8B 2AZDA 2VDPB 1O8CA 2AC4A 3JQPA 1NQAO 5L45A 1QH8A 2DEUA 3MMPA 3A2KA 4JHLA 1SOVA 2E87A 1FTQA 3H6GA 3D59A 1W36D 4P7KA 1THTA 3LYSA 4PGHA 4M8NE 5K5EA 3ZNQA 1XL1A 3C3MA 2O8BB 2CXQA 3NTLA 5L1LA 3A27A 5A03A 1HPLA 5BSMA 2W6ID 3VPXA 3H0CA 2BKUA 3FROA 3E7WA 3ES9A 1CLEA 4DDVA 1GCGA 1W88B 1RXWA 1L1QA 3GFSA 3E03A 3F8SA 2QZZA 3SHFA 1E2KA 3QTLA 4PAQA 2QV7A 3NKVA 1VJ1A 4DV0B 2V6JA 5K0ZA 1R9NA 1R4ZA 5FAXA 3FW1A 1T3HA 4RA6A 4YLYA 2HVHA 3EWNA 1T2CA 3LVRE 1M2FA 2ARKA 2JLYA 3U4HA 4XOIA 3DKIA 3WU2U 1ZN7A 4JI3B 3W1VA 3WB2A 3NB0A 1QQTA 3QLUC 2X86A 4DTIA 4K4HA 3MGBA 4ZDIA 2WJIA 1D0VA 3NVWA 4ALIA 2BBWA 1ZH0A 3L7AA 4K0KB 4K6FA 3IA2A 3H1AA 4FUTA 3PT5A 2PFOA 1KHHA 3VU1A 1NN3A 5KFRA 1QQ6A 3WL7A 1CUEA 3ZLUA 2GR9A 2XR1A 4J9SA 3IP9A 2ZJOA 1UBFA 1FVHA 4ZREA 2DPXA 4WY5A 1XQVA 5FHRA 3NATA 3SV3A 5IXJA 3JQFC 2Z3ZA 4ACBA 4DQSA 4KLQA 1NONA 1ZNWA 5EKSA 1J21A 2BKLA 2HVIA 2KYRA 2X8BA 4DNOA 4IJKA 2W43A 4FLMA 5A0VA 1BFKA 1F6WA 1TC1A 2ZJ3A 4K7JA 5KHAA 5DP2A 2CMKA 3IDZA 2A30A 4KQIA 4OAQA 3ZCPA 1ZHHA 4KJXA 4XB6B 3R3XA 3QF4A 3C39A 1QG4A 1S5PA 4Y2HA 3DEIA 2LI6A 4UHHA 3OT1B 2HIHA 4AKSA 3GQBA 5DIFA 1AB5A 1Z12A 2KE5A 2PV7A 2HLPA 3BDAA 4DQPA 2I7VA 3DFUA 4IQ8A 4IAOA 3RUAA 1QAOA 4YXWA 4DCVA 3BF7A 6LDHA 5JZSA 4PPXA 5JXGA 4AO8A 2CMDA 4H08A 1XT6A 4FYXA 2J9GA 4INJA 1FVFA 4UQGA 1W0KD 3KZ1E 5CYFA 1JFFB 3AJRA 3C7AA 2AV6A 4LC9A 4O5CA 4EMBA 1N78A 1J23A 1M1NB 3Q5GA 4RVGA 2A0UA 3G59A 2Q3HA 5JCXA 2GBPA 2O2DA 7YASA 4OQDA 1QBGA 2QTAA 3Q87B 3UWPA 4RTKA 2BR3A 4EZ6A 4TKUA 2O2GA 4D4LA 2SHKA 3KS9A 3REQA 2A3VA 3BDIA 2C4KA 3GG9A 1GSOA 3OSUA 5SZKB 5JXHA 4DR3B 2GM4A 2C9ZA 3F9IA 1E59A 1OFUA 5HX7A 5KG2A 2YYZA 2B6NA 5C0OE 3ILVA 3QHQA 3ZX5A 2P62A 2JGNA 1UEIA 1V97A 5HHHA 1QF7A 2LDBA 3NRCA 4DQ0A 1Q1BA 4A03A 5JAHA 2O8DB 4A23A 5KOJA 1CJKC 4QWBA 2BW0A 2PRIA 3B9BA 2FZEA 5J0TA 4MUGA 9ICKA 1ZNXA 5JRDS 2VK2A 3FM9A 2R6AA 2OGUA 4E7PA 3M6VA 4FEGA 2R44A 1H23A 2RC5A 2VNIA 2TMYA 1RG6A 2PRYA 2W0SA 3EVAA 1GTJ1 4TZTA 3ZWKA 4ZYYA 1TX4B 3MERA 1JQ5A 1H6AA 2ZB4A 4BJ6A 5JXIA 4F4CA 2J45A 2Y2UA 3T7JA 3SXUA 3OSPA 5AKIA 1E61A 2IL1A 4JYCA 4EW6A 4GS5A 3N9IA 2I34A 4P53A 5DHTA 5DHFA 3HN2A 4JBIA 4WUVA 1QE3A 5KFSA 4R8UB 3KVRA 3LS2A 4ASUD 3QUQA 5K03A 1HZZA 4KQXA 2CDBA 2PRSA 1NATA 3G9QA 3PFWO 2C4HA 3VJLA 2HBZA 2RGEA 4N6NA 2BFMA 2G25A 3OZUA 2Z5LA 4AYWA 4I6JA 5GGXA 8ICAA 3GG2A 3OCZA 1JA1A 4AZ0B 4JDPA 5JCOC 4C1NA 2ZTCA 5EWEA 1FNCA 3IMEA 4NJEB 3EG9A 2MT9A 1HFWA 2BMAA 4WVLA 3QTTA 3O4IA 4RPHA 3PUYA 1QOPB 1U0FA 1MG5A 1WPGA 2JBWA 2QNIA 3CRQA 4B48A 1RMQA 1GIAA 1W76A 3HP4A 2GXQA 2Z3WA 4BNNA 5CEJA 1FU8A 1Z5OA 3MCVA 3D43A 4JQZA 4MA0A 4UAZA 4LBZA 2YJ3A 5IBPA 4GNKA 4I1IA 1G8KA 4S1PA 4LKRA 2DTXA 4GKAA 2W42A 1YL6A 3KT3A 1V7QA 5AXBA 4KPFC 3D8NA 4RFVA 3K9WA 3B7PA 3UK7A 3OCCA 3L04A 3TQ1A 5JCJD 4IGFA 2N75A 1RKQA 2PVSA 4R1OA 1FCJA 1Q7CA 4JI7B 2QXYA 3OPYB 4PVCA 4B4KA 1UPTA 3K15A 5GJWC 4MV8A 4BFWA 4IS2A 1Z45A 3I04M 2C0QA 2JGFA 2H51A 3FNIA 2E49A 2FX2A 3B5EA 3MAAC 4HFMA 2IS4A 5LOVF 2NMVA 2QD1A 5A05A 1MZPA 1UOPA 2UKDA 3C41J 1NLYA 1FX0B 4U5XA 4EARA 2EEZA 2O52A 1WTAA 3V9PA 3IQDB 1Q3KA 3FYTA 5KNCA 3S1LA 3EOBI 1SHTX 1DELA 2A9RA 4FHCA 3ZHVA 2C9CA 2PZBA 4MW0A 2WTFA 1FYWA 4U3JA 2I2XB 4JJ6A 4QGSA 2DF4B 4PO3X 1RLIA 2WE8A 3FYUA 5JTTA 3GA7A 3EPHA 2XJ4A 4FR5A 4EQ6A 1U65A 3OEHA 2VDLB 3BSSA 3HYSA 2BCUA 1B42A 1VDZA 4DIOA 3E5HA 2HU5A 1I1NA 3U0VA 1NKBA 4D9EA 4DMUB 2D0PB 4QW9A 2JLCA 4M8LA 1SZDA 2VJPA 3PKZA 1HNNA 1U3TA 3EMBA 3TANA 2OD9A 2ZXHA 4FDVA 4LY9A 1H6BA 1Q0RA 4RJJA 3RYFA 1IJBA 2WWTA 3W5UA 2AX3A 1VZ2A 3IN5A 5KFOA 5ERXA 4Q7KA 2BJVA 5ER9A 1L5UA 3FFXA 4JOBA 4RD2A 2XUZA 3AUYA 3QVVA 3VMFA 4R4JA 1XRMA 4BGUA 1OLSB 2PWPA 1KDOA 5E1OA 4D97A 4DSTA 5DTRA 4YCNA 3AVYA 1R0YA 3VVBA 1TO6A 8ICXA 1FNDA 1N0IA 1TUEA 2YCLA 3SC2B 1TA9A 3Q0TA 4FNOA 4HADA 3IV9A 2O2EA 3IUQA 4LYDA 4P3OA 4TT3A 5C9ZA 2JFZA 4MUAA 2YZNA 3PJDA 2BEVB 3O73A 5DBBA 1ZINA 4ZOCA 5ICEA 3IEMA 1DIBA 4EFLA 4XX0A 3URMA 4LCJA 3H16A 1GUZA 3BA6A 1PNQA 4P2HA 1QO7A 2EKPA 3KJEA 3NRBA 5LPNA 1IM2A 4WXRA 5I45A 1GA1A 3IBYA 4H4EA 4W1QA 4B6EA 3KBBA 4D8UA 1EWYA 4I4NA 3SZGA 3P9QA 4YRBA 1ODCA 2DOKA 2ALJA 2Q8NA 2QEQA 3IA7A 1LF0A 1HDRA 3IYLW 3SXJA 2KEYA 3R7DA 3JD3A 1RCFA 3NG1A 2P9GA 3K0KA 3M81A 2QRVB 3AVXA 2FA9A 3CZ9A 1XFDA 3HBAA 4JH0A 4YCMA 2IA6A 2Z6QA 1V1RB 2RG7A 1FSFA 5CD9A 4OTZA 2LWIA 1DIHA 2R65A 4D4HA 1IJFA 3BVPA 1YU9A 3GDOA 3ICXA 4GFJA 4ED2A 2B1RA 3I34X 4E7OA 1LH0A 4LRUA 4O1MA 4X45A 1CCWA 3DCYA 3FIJA 2GN4A 3G1WA 2Q5CA 4TN5A 3ECAA 3U62A 5I7RA 2V55B 4V0RA 1QVVA 3DBRA 2G70A 2QF7A 2IT1A 2KPOA 3UCXA 2WF9A 3DT9A 4F5QA 1GZ7A 4CIBA 5H4GA 1Z16A 1L9XA 2P6OA 2Q0HA 3B51X 3PHHA 4R2MA 5MGBA 4M1WA 2BC9A 1LDBA 5KT6A 3C5CA 3SR0A 4GC6A 5GQSA 1NXVA 4FHFA 1UDWA 2JAWA 3BD6A 2PCJA 3FDZB 5KX5F 2Y1EA 4HH1A 4HS9A 4W7HA 5LWHA 1PF7E 4R69A 3I05A 3IUSA 2I22A 1CUFA 2VK1A 3IEUA 3GQCA 4TSFA 5EIOA 1HLPA 1XQXA 4H6XA 4MQBA 4MV1A 2SKEA 1WZIA 2Y1FA 3E9NA 1CNMA 1T9AA 4H1WA 3L4BA 4QATA 2N42A 2B69A 2CLSA 4M55A 1NIPA 1ADYA 4Q7LA 1I2AA 1TZBA 3REOA 3V4OA 1JQJC 4ED6A 1QGAA 3Q2IA 5E9WA 2BZFA 1OH5A 2W8ZA 2IOYA 4WCVA 4E3WA 5BSEA 3X0DA 5C34B 2BFEB 1QB7A 2GJSA 3PPVA 4I4IA 4RDIA 5C7LO 1TAMA 2RCNA 1Z7YA 3R4VA 2KFZA 2WV7A 2OYSA 2X14A 3UXEA 3WWPA 3BJZA 1SCUB 1Q20A 4KN6A 1F6DA 3VO2A 4OSOA 3PP8A 5DW0A 4YMMA 3MMXA 3WI7A 1SXJA 1WMBA 2GCOA 2P4HX 4F96A 4LNUB 3F49S 1HRDA 4FDMA 2X7XA 1S01A 2UAGA 3TD6A 5L3QB 1GNTA 4NXZA 4RTNA 4NFHA 4J9LA 4Q1VA 1W19A 1KEKA 1KNXA 3CLUC 4IEIA 2ZDGA 4W9NA 2P9YA 2W2VA 3G0BA 2JCSA 1UDAA 3ANMA 5T6BA 4Q8FA 3AOGA 4DF8A 4GW3A 2FXVA 4NXNB 2W58A 1QDEA 4AMGA 3T4PA 1N9ZA 2QYOA 3DFFA 3DUWA 4QU5A 4XTRA 2JB9A 1KWGA 5BRJA 1V9SA 1Y4UA 3GZ4A 2C7PA 3T7IA 1RWBA 3G23A 3GBVA 2C1EA 4UAUA 5LLSA 3WWOA 2Y3IA 4ZAGA 3MW8A 1YGYA 3H13A 3OIFA 4MVCA 1I0IA 3TYXA 2DTEA 3BXOA 4J0QA 4X5OA 4LW8A 1B4DA 3BILA 4ZVMA 3TLBA 3CRRA 3CZMA 1IXRC 4OHBA 1HDEA 1LF5A 3IL2A 3SYLA 2LYBA 2CKDA 3G5LA 3IVGA 1H05A 5EIAA 2WPDA 3E7DA 1W75A 3SSAA 3OQ1A 3BB3A 1XCMA 8ICYA 4O5KA 2OO5A 2PD3A 3AETB 3EBOA 3EBLA 4WXPA 4YRRA 3ZBTA 2QTRA 4KUGA 2FDRA 2BSAA 2IHKA 9ICCA 2VQSA 3RC1A 3ZGZA 2WVHA 1C7JA 5B6IA 4EVQA 4MS4A 4OCZA 3WQSB 2G5IB 1NRIA 3BGOS 4DL2A 4V03A 3URKA 1LZLA 1NP3A 3GVXA 3HR8A 4ZOLA 3X43A 2WU8A 3DLCA 3NIBA 4HWTA 4GM0A 1D2AA 5E6UB 5I5EA 3GDHA 1KK3A 1PDVA 1YJQA 4LOHA 4D9GA 2YXBA 5T64A 2CDAA 3C0KA 3RSFA 3A04A 2ZSKA 2V54A 4FSHA 1DOAA 2WFLB 2H5EA 4N0QA 3D7KA 4QYSA 5FQOA 2YVUA 2NZVG 4O4HA 4RAOA 1B0XA 1QCKA 1Y3AA 2FRXA 3WHPA 1BMFA 1A0OA 2WWWA 2R1TA 3ANNA 3HXLA 3QVWA 5DRYA 5TE9A 1JUDA 4F93B 3MS7A 1T7PA 1I6WA 3A6EA 4DHEA 1T26A 2PUFA 1TKRA 2ZJ6A 2H4YA 3IULA 1G291 4LNHA 3TSZA 4Q16A 1V0JA 1G66A 2QB0B 4O2LA 5LZ9A 1X2EA 3D02A 3L7CA 4D8YA 1Z6QA 4NENA 5HVNA 5EESA 5BSRA 1PL0A 1R1DA 4MQEA 1K0UA 1IBLB 4EB6A 1C5KA 2CB9A 3BCUA 2GVZC 5I9MA 1TXGA 3HEMA 3ZE7A 2VZ0A 5D01A 4WEOA 5TPWA 3QITA 4DVJA 1UJ2A 1V45E 1ZD4A 1T0PA 2PGNA 3IUNA 4KO8A 4HPJB 4WLNA 5FFFA 2XW6A 1Z7EA 2OXEA 2R48A 2ZSBA 2L5YA 3G68A 3ZOKA 3K0FB 2IC5A 1XEWY 2DAPA 3LL7A 1TMYA 1L9KA 4MW9A 3ER9A 3MGKA 4GPIB 4ENRA 5DBFA 4QRDA 2P2LA 5GTDA 2FMTA 1LW7A 4DLVA 3U4MA 2VDWA 1N5LA 5FOWA 4M0LA 5BOSB 1XMXA 5IIOA 1JB9A 1W93A 2R7LA 1RQNA 1QIGA 4US9A 4B3TB 2FN3A 4KAJA 2M1ZA 3JYLA 1COOA 3PFGA 3U9LA 2BTOA 3D7SA 1MGPA 2C9BA 3RBXA 3I52A 1E1KA 2SNIE 3WKBA 1Z88A 4OHCA 1RWVA 4QGBA 3VKWA 4PAWA 4YN3A 1ZDMA 4R8MA 1ESEA 4E21A 4HQ0A 3SN6A 3MIIA 5FUYA 1CW2B 4GPTA 3EVTA 2WMNB 1Z73A 1NJZA 1P17A 3VKFA 2UVWA 2X9QA 3J80A 1E79A 4E13A 2HF8A 2WMDA 5DTEA 5CT6A 5HG0A 5L3ZA 3SF8A 1RI2A 3BQ0A 3AWIA 4ZZ1A 5L6MB 5I7FA 1CR2A 2VA9A 3CKKA 4MI9A 1ZUD1 3LDGA 4I2DA 2XICA 4WCFB 1Q19A 4N5HX 3RREA 5E6RB 2FWJA 4ECTA 5KJ1A 2YWDA 3NM6B 2B83A 5C7OO 1B3BA 2BEWA 2E2WA 4HL6A 1AKYA 4TL6A 1EJBA 3HR4A 2ONJA 4ENPA 1Q95A 1HKHA 1JXMA 1WMDA 3A4LA 4DM4A 1M6YA 2OXRA 3KQYA 4YC7A 3ENWA 3GRPA 5CVEA 5CCDA 4QZFA 1ZISA 2OMEA 1FSGA 3W04A 1G41A 2PKQP 1LNSA 1XQYA 2JD0A 5CMLA 3RBVA 3LWMA 4UU0A 4XTCS 2ZBEA 3ISJA 2FPPB 4J6FA 3F5EA 4RANA 1EFUA 1IEVA 3Q5DA 4I55A 3IEVA 4NCHA 4N82A 3RIGA 3RAXA 2VJQA 3Q4GA 3S0JA 3VQTA 5HUHA 1BXKA 1XYVA 4FBMA 4LMRA 3DT8A 1VIMA 3DFMA 3ZY5A 1AJEA 1DHRA 2XVMA 4IDPA 4MTCA 4MVJD 1GFIA 3QY0A 4KV7A 1O95D 4LPSA 2VEOA 4OSEA 3WP1B 1C41A 3WNVA 4CLRB 1XMJA 4HH3C 4L75A 1MTZA 4LTMA 2EAMA 1A7AA 4J9MA 3L4SO 2FF7A 3ESQA 3EXEA 4PF1A 4QQRA 1ADFA 4WN9A 4UAYA 1ZQSA 1N9GA 5IBRA 2JW5A 3PHCA 2UUCB 1YO6A 1PTKA 4GO1A 2K8CB 4IXDA 4KGVA 3T0FA 5KZMB 3GFPA 1L5GB 2HAEA 2IF2A 3ASZA 4ICIA 3ZWYA 4AJNA 1B6TA 3GUZA 5IDWA 4CV1A 1KIFA 4BO9A 2OM6A 2YJNA 3U7HB 3HJAA 5AUQA 3VR4H 1NBOA 2OZVA 2YYAA 4JBWA 3BE8A 3H9EO 1T9BA 4QREA 4RELA 4AZVA 1TK0A 4D82A 5DGAA 2QE6A 1KN5A 3VYRB 4DA4A 2J9FA 5G5HA 4OI4A 1KI1A 1Z2NX 1ZMBA 3QEOA 1PK3A 4XWAA 1ZLXA 3ETJA 4GOXA 5CYOA 4A73A 1HZJA 1N1MA 4FDUA 1JZQA 3MK31 3VU3A 2J6IA 2B4RO 5DHAA 4Q3CA 1DQZA 1KKUA 1TU4A 2DQYA 2VHVA 3TZHA 2Y1CA 1P2GA 1ZW6A 3NOVA 2LPEA 1E6MA 2QDKA 3ABIA 1W6UA 4X41A 4C8NA 1XVIA 4B3RB 1VLMA 3GJTA 4CLOB 2ZLBA 3NCHA 2DU8A 2R00C 1ULSA 1SBCA 2XVZA 3QBTA 3DR5A 3A8TA 4QQFA 1OGYA 2O20A 1YZFA 2R2AA 1PGPA 3HCFA 1I10A 4EABA 5JH7B 1CU1A 1PG0A 3H11B 4JY7A 2P1DA 3TI7A 2CXYA 3AEKB 2Z95A 5BVGA 3RT7A 1QTNA 2ZTUA 3KV3O 3VTFA 3RBDA 2KSOA 4ZAFA 3HXTA 1QVZA 3WGNA 1Z3EB 1P5HA 3GWGA 3NWJA 1X6VA 2IQ5A 2GD2A 4GXTA 4N01A 3RJIA 1XNSA 1RYFA 3M33A 1N2CE 3OT4A 3SFTA 2QQFA 5B4UA 3IBFA 3JSAA 3P96A 1KO4A 1UAAA 1XTUA 1VC2A 3E9MA 4GGMX 4HDKB 3EQZA 2PZEA 5BN1A 1J24A 1T9GR 2WKPA 4MO2A 5ECDA 3UNXA 3PE6A 2KICA 2HIAA 421PA 3DQZA 3ADPA 4IV5A 4PV7A 5KJFA 4KE6A 3S5JA 2QTVB 3ZY2A 2D7JA 4AMYA 1WMFA 2IOQA 3NTOA 1W0JA 4IXMA 2ZQYA 4FCCA 2R3SA 4QU9A 1DUIA 4XQ9A 5AKGA 2XEDA 2ZT6A 1SB3C 5ERGB 3TPZA 3Q3EA 4BYMA 1NVBA 2ZWOA 2W2MA 3FY4A 1XHFA 1J1ZA 3O1LA 4MLCA 2VNKA 2WJYA 2K2WA 2G9UA 1B76A 1DEKA 1TK8A 1KYQA 2RDMA 3EMVA 1QO9A 1WG8A 4HATA 3IP8A 2JFXA 4RTRA 4F2WA 1P7YA 2AIRA 4F11A 1NTOA 5AHWA 2WYUA 4DLUA 5A9SA 3NUQA 3U44B 1ZAYA 5KFYA 2D8MA 4KI0A 1WDMA 3H42B 4GYJA 2X8WA 1OXSC 1G2QA 4NZMA 4CN9A 3RJ9A 4EW2A 4OJOA 3CVXA 1DKNA 3QPDA 3BMCA 3CUVA 5EZYA 2KJ5A 3L7LA 4R8VA 3COJA 4WY8A 1N5DA 5FV7A 2DBZA 5LXTF 1OB5A 2NP6A 1G21A 1Z4LA 4IX1A 1XA0A 1ISMA 5IZCC 2IYLD 2JJ2D 3PEWA 4HH0A 1I5RA 5J63A 2REXB 3A1DA 3GC6A 4CCSA 1HNWB 1C1HA 2CZQA 4X90A 2NYUA 2FETA 3PGXA 1JE1A 4XYLA 4YP9A 3GP8A 1XJWA 4BN0A 3R74A 3EZXA 5B5SA 1BC5A 2EERA 4MKRA 3C4QA 1L5YA 3QXGA 4PC7A 4IKOA 5IUJC 1PSDA 1LTQA 2JEJA 2AMYA 1H69A 2VDNB 5IXSA 1XEXB 2XO7A 1PGOA 2DF8A 1L5FA 3O4FA 3W3AA 4FFLA 5DW3A 3RV3A 2Q0QA 3EWIA 1JNYA 1W1UA 4C7JA 5HK8A 5ALDA 2R68A 1KO1A 3D0KA 4ASUA 4JEIA 2BCQA 4NYMQ 2DQSA 5JBQA 3EH1A 5ES4B 2AB0A 1N2GA 5EJ7A 2UU9B 3I5MA 1EAYA 2O8EA 3EC1A 5CPFA 3TCNA 1PTJC 4YT4A 3D4LA 4MAMA 1SC1A 3NHFA 4FMPA 5KU1A 5KYWB 4UAVA 4HMOA 5NULA 3AESA 3V4VB 1P77A 2GK6A 3TEFA 2ECKA 1G8GA 1O4VA 5KNIA 4NCXA 1MEJA 1EK1A 1WF3A 1ZZEA 2VEDA 2C84A 2K4MA 4L7VA 5K0LA 4AG5A 4CVNA 4XDGA 4NH4A 4C9BA 1P74A 4E03A 3F2DA 4F5EA 5HKAA 1I33A 3A9TA 3E1GA 2XXBA 3OU2A 1OTXA 5ALXA 4YR3A 2FJ0A 3BB4A 3VC3A 4R64A 3P52A 4LFAB 1SCIA 1RM3A 3DEFA 1AG9A 1KYYA 1Z4NA 2EZTA 1E66A 4IFEA 3K6SA 1KORA 3AEQB 4C4RA 4GBGA 4UBIA 2J31A 4X97A 4XD7A 2O23A 3UANA 4BQEA 1KU6A 4KPGA 1KAOA 4QUGA 1BVHA 1XCGB 2B5OA 4BTEA 1KI7A 2QM7A 3G8YA 2ZE6A 3CLRC 4M9LA 5A62A 2B7LA 2BE7A 1Y8QB 4X85A 4RQTA 2YB1A 5ALUA 1USUA 1YK1A 4OI2A 5KVQA 3I83A 3SNKA 2XTMA 4ERNA 1JWBB 2A1UA 1X6IA 4G9BA 2AI1A 3LH5A 3SXPA 1ZMOA 3WTCA 1KOGA 1UJCA 1VKOA 2A33A 2PL1A 3LSTA 3FPSA 2ZI9A 3HS3A 3GLGB 4TMWA 2YQZA 3ZHUA 3NKFA 2I5PO 2QTCA 3U09A 4DUZB 3T5CA 4IOKA 1QZUA 4TV8B 2XB6A 4CBVA 1J49A 1Y7PA 3OZ7A 3R3WA 3H9CA 4LJXA 1N5IA 2Q4EA 2CV1A 1IXZA 4QJFB 1MV8A 1N6RA 1WU7A 2A7XA 1VG8A 2DWCA 2NZJA 3G9TA 1SC4A 3L0CA 4C4TA 4HNAB 3H1GA 4L8VA 3KYJB 5EXPA 2G40A 1KFCB 3T5BA 5DFAA 1E7SA 3AL3A 1U2DC 3WYDA 1CUKA 5J0RA 2H8KA 2WKQA 2Z57A 4I5DA 4FX2A 1FP4B 1YA8A 3JATA 1WM1A 2EH9A 2JIQA 1NF9A 1PEDA 3EA0A 2XECA 3E7XA 4J7AA 3PQ8A 2F44A 1YXMA 2E3TA 1P2UA 4QOIA 4X6UA 3R7NA 1LPPA 5EUMA 1WHSB 2FFBA 4I2EA 5IVIA 2BPOA 3EULA 4MUBA 3R7BA 5L1KA 1A4UA 4CM9D 5SICE 4OLAA 3BFVA 4QO8A 4RACA 5G1OA 3VR3D 5LUAA 3DF7A 3I1JA 1D6JA 4JMLA 4UD2A 5H02A 4E5DA 4PO8A 3JQGA 3ZIDA 1KARA 4NENB 3DFKA 3RS4A 3KJZA 4GP9A 4GBJA 1AMNA 1XZFA 2E82A 4L8GA 3VJKA 1A8SA 1MR3F 3PC4A 3PQ7A 4NF2A 1TD1A 1UDRA 4HDMA 5CEEA 4OHFA 5JD6A 2HTEA 1A0PA 1YRWA 1JX4A 2C5FA 4HDOB 5FJIA 1S7CA 3ZBPA 4BBZA 2JIOA 5K8CA 1FQKA 2J4FA 1WY7A 2QENA 3KQNA 2A9PA 3T3PB 4TYQA 1YS1X 3EE6A 2BZ1A 3LAWA 2RHHA 3EGIA 5HE8A 2FPWA 3E61A 4FEAA 1JHYA 3D4OA 2EW2A 4ZTBA 3IRUA 5AVZA 4I1OA 2Q9AA 2ZRFA 3G1TA 4KLZA 1E1CA 1S2MA 2QG6A 3OQIA 3BL6A 2NUAB 1D6SA 4B9TA 2GAOA 3HDTA 4US8A 1ZQ9A 4ND3A 3TMKA 3QFCA 4K86A 2RB4A 1KBUA 4UCWA 4ER5A 2N46A 4IILA 1KXZA 4MF8A 3GYBA 1QP0A 2O2JA 4BGDA 2XD9A 3IURA 1LDYA 2Q3LA 4OJLA 1KPHA 3Q3VA 3WRXC 3KNZA 4FR0A 4KLOA 4KR2A 3W5AA 5HZGA 5G2OA 3Q6MA 3AB7A 3D2QA 2W9BB 1ECLA 4B71A 4DM3A 5KNBD 1YF3A 3LX4A 3OZIA 4XIIA 1CJBA 3PFBA 1T5BA 2W8LA 3A6LA 3PNQA 1EI9A 2YXLA 4IIBA 4BQIA 5J4KA 2D2EA 4L6IA 4BS9A 3I9JA 5EAIA 3RF6A 4WNAA 3SWWA 1RYDA 1K08A 2VP3A 3LWZA 3ICVA 1XRRA 1YC5A 3T95A 2Y1XA 5CPBA 1QUEA 4P7JA 4QUDA 5K4AA 2WU0A 3F0TA 4YUVA 1O4WA 1Q0ZA 2G4VA 5D87A 2QT0A 2VP4A 4O2BB 4ECUA 5F23A 4HBZA 2GKSA 1DHTA 2XVAA 1IM8A 3F3KA 4LJYA 2OZLB 2JEFA 1L4GA 2FZGA 4UPDA 3RTBA 4AVYA 3E48A 4N8SA 4P98A 1DFGA 4TL7A 1NP6A 2WG0A 3ZR4B 5DXAA 2RGYA 3HWRA 3JCZA 1EVLA 1RADA 4CKZA 2AZTA 5HPYB 1GTMA 3M6FA 1RAGA 1UQUA 1YBVA 3O90A 3KDAA 5EPUA 1RM4A 4ARVA 2C92A 3F46A 3PKJA 3Q5EA 4NQRA 1P4SA 5KL8B 1LTHR 3QY9A 5FWXA 2F3PA 3GLFB 5DLGA 2O5VA 2OB1A 3UB2A 3VHXA 1TQ8A 4EYIB 1I36A 1DWQA 2BGRA 4FXOA 2ETXA 4GWGA 4XVCA 4KQKA 1P0MA 1QIHA 2AN5A 1RE1A 3COVA 3N0TA 2Q99A 1HFEL 1ODKA 4OKIA 4JNKA 2FE1A 2JK1A 3QUSA 2H29A 4MWSA 3P4UA 1U7OA 4CLRA 1X3LA 4AX8A 1Q3TA 1XCOA 2GZHA 4HNHA 1E3MA 4I3GA 3RC7A 4ELTA 5E7IA 1WUTA 4XIFA 4OQNA 1C0EA 1KAMA 1PL8A 3TKYA 4BQOA 4DB2A 4AYXA 5BR8B 1MXFA 1ISHA 1W47A 2G83A 2GX6A 4PG6A 3N97B 1P0QA 1NUSA 1E4EB 2QR5A 4E94A 2GCIA 4MVJE 3LCMA 1BDBA 1IN1A 5J2UB 1DC7A 3WDSA 1AQLA 3UAWA 2DRIA 3IXLA 4CG2A 1XD9A 2H7XA 1WVGA 1UT6A 2H1VA 3Q3CA 3NRZA 1GO2A 1B14A 2KW5A 1DG3A 4R2KA 3TR5A 5LQDA 1HOXA 1YAHA 1ZGHA 5DHUA 5IDVA 1HYGA 1MXHA 1X15A 4CEIA 5J2EA 4L3WA 1QLNA 2X2PA 4UVIA 3E3OA 3ROQA 5CITA 4G89A 3C29A 3Q9NA 4WK6A 3WQRA 3SKYA 2ASVA 2Q8QA 4FPXA 2XZDA 4AF6A 5FWXB 3MBIA 3FCXA 4LAFA 4BQRA 5HHIA 5JC8A 4C0AC 5JNRA 1E89A 2H1OA 1LV7A 4HTFA 1GA6A 3U4DA 3L7JA 3QX8A 1YZTA 4A0RA 4AG6A 2YWXA 2D8AA 2KV2A 1MJ5A 2RHBA 4JXJA 4ZT4A 3V2HA 4UQOA 3PSTA 5BQFA 2EIXA 4LC0A 5JG7A 4EB6B 2MSKA 2JEGA 9ICXA 1ZJ4A 4L6CA 3N58A 5E1BA 4DYDA 1EWTA 2PFKA 4HEHA 3TTUA 4CQJA 3RAGA 2QN2A 2IU6A 2V9CA 2D1QA 3TSOA 2IXDA 5J47A 4OP1A 3BIWA 5DT2A 2Q1SA 1ZGJA 3GX1A 3GMIA 2MSLA 4IIYA 4RWZA 3TB6A 2A5LA 5J5AA 4WK0B 3QKSB 1LDMA 4X20A 4EZ9A 2P69A 2XCUA 3RRZA 4ZJZA 4OJPA 2BEKA 4AURA 4O5EA 1CY2A 1D8AA 2VYND 3A9VA 3LWDA 2XUOA 5F1OA 3D0OA 1GPDG 2FKAA 1RU3A 3P9YA 1TIPA 1PZMA 1DBQA 5B3AA 1RR6A 2B99A 3R6WA 5HIIA 1WXEA 5IJAA 5EJ6A 4P4SA 3HXQA 4P0QA 3CQ9A 4CTNA 1G1MA 3COYA 4CF5A 1Z17A 4CYMA 4USAA 1V96A 3UMSA 3EXG1 1V6SA 2BVNA 3MYRA 2GRUA 4J0IA 1J2RA 1NWHA 4GPD1 5EHXA 4I9FA 4BJ5A 1R4AA 3QFTA 2YDXA 4KLRA 4NLGA 1B6GA 5J0XA 1ZA2A 2GETA 3FMIA 4L15A 4Y1RA 3SIPA 3VUFA 4BNJA 1AF4A 4BMCA 3V6KA 4F4ZA 2JHGA 1VIDA 5TS2A 1XTVA 1HT3A 5DBGA 1QP4A 3FAHA 1TVKB 1X86B 4ND1A 5HKLA 4MHVA 2Y1IA 1IHPA 1EESA 1GSIA 2UXCB 1CD5A 4LXYA 1NU6A 4F3OA 2ZIUA 4IV0A 1TYDE 1Y1TA 2OORC 3B38A 4ABTA 2GD1O 1EU1A 3NGXA 1HG0A 3ADBA 3V7FA 3E7FA 4I19A 4KN7A 2BGIA 5BV0A 4MRPA 4BEBA 4EHKA 1DJOA 4C88A 1EBUA 2PD4A 4I1PA 1UCVA 3NCTA 4NIMA 3PGLA 5HRAA 3TFOA 2ZR9A 3B13B 2Y0DA 3AW9A 4XM1A 4YCCA 4XWOA 3Q2OA 2B36A 1KZYC 3DZFA 1LRLA 2V6MA 2FMFA 3QFSA 1R4MA 1T9DA 3WL4A 1C20A 1OKKA 2HYDA 2JGJA 4HF7A 2VKTA 4ZICA 4NFLA 4M9CA 3EXHB 2IPXA 4Q3KA 4DCUA 4HNVA 1PQWA 1OKKD 2ZYTX 4N65A 1O5OA 2TECE 1XZLA 4FZNA 3Q15C 1HLDA 4J1TC 4X8HA 3B0XA 1JHUA 1PK8A 1TRHA 4XJVA 3B1FA 5ULLA 1S2GA 4P4GA 1BRMA 1XEXA 4YJHA 2QVLA 2B1QA 2R97A 3TLMA 4XGRA 3IIJA 3UJ3X 1SEPA 4ZMSA 1TYAE 4CUZA 1X38A 1I51A 1ZPDA 2GBLC 2HF7A 3VISA 4D26A 4K5QA 2VHJA 4DA7A 4GOOD 2O54A 2WAMA 4NNPA 3RJ5A 4PGQA 2FSHA 3B0YA 3HBFA 2F1OA 1MFPA 1N7HA 2BCJQ 1JLHA 5JMTA 3TWOA 3AUAA 3O8LA 3C5VA 5D2CA 3I28A 4XZ3A 5L4SA 3GB9A 1NMQA 2V7WA 2AUNA 2F48A 1J09A 3L8YA 3OPQA 5CK4A 3VOTA 5CA7A 4PN7A 4X1YA 4BVBA 3A6GA 4YAUA 5J2TA 2DHRA 3V1KA 3UKJA 1J2EA 3EWSA 3OC6A 2E6KA 4UZEA 4BNTA 1TL7C 2W6CX 2G1JA 3V6HA 5DMHA 2PKRA 4YUXA 3AGPA 3EGVA 3OC0A 3RW9A 3IEKA 5CRXA 1NJ2A 4H35A 4KCGA 4O6VA 4X61A 4TQRA 5DU2A 1CQJA 4BFTA 4M9HA 4WL0A 2HGSA 1JJBA 1DXQA 1XA3A 5KG5A 1ANKA 4ZQEA 1YL7A 3UMFA 1X87A 3KFXA 4EBDA 4DBZA 2FFRA 2IBSA 2IS2A 2J0SA 1IIRA 5SZIA 2R7MA 3OP1A 4JWTA 5HGXA 5L4NA 1A4IA 4CMCA 5B3LA 5CYPA 2XOXA 4UDOA 4WEQA 4F1WA 3FTCA 3KHLA 3HJBA 2PUCA 3R6TA 1SCAA 4X3OA 1PWYE 4H7JA 4HWGA 5IWCA 2XYGA 1ZN2A 3W9UA 2NRXA 3FCUB 4YG2A 4H1HA 5BWCA 1QO0D 3G1UA 1U7UA 3PYXA 4RPGA 4BLOA 2VFAA 1QYDA 5AW6A 1G5HA 3GLIE 1W44A 3L0PA 1J39A 1U6JA 1PJCA 2GZAA 1P1KA 4AKTA 3HWTA 2FSUA 4A8JC 5TF4A 3GPIA 3L7BA 1J1UA 4HWOA 3RB4A 3I2YX 4FM9A 4DJEC 4V2IA 5KAIU 5HYVA 2XUGA 4TQUS 1SXHA 3O6VA 5K0JA 3R3JA 2DULA 3THWA 3GVIA 4QFCA 5BURA 4R9SA 4LHEA 1CIVA 7ICLA 1K5HA 2IYYA 1GZDA 3WRYA 1U5AA 4WBXC 4TVSA 2HPVA 2NTVA 3KT0A 3ONNA 4L6AA 5HQJA 3ZGNA 1V3QE 4QDUA 4IDDA 1RRMA 1UBMS 3EIWA 1SXJE 1VE3A 1VHJA 3EB9A 2K4PA 4N40A 4Z8XA 2BGGA 3DD1A 5IG2A 2H3EA 1YB6A 2HWUA 1ZI8A 1F1JA 2G9ZA 2VHZA 3SG0A 3B3AA 4CI0B 3NW9A 4MEAA 1YH3A 2HJHA 3AUSA 2UV8A 2EANA 3F4LA 1PEYA 4RKRA 3UJ7A 3L4JA 3HKCA 1L2TA 1B2RA 5U4XA 3X1ZA 1PIWA 4BNWA 4HOYA 4EIWA 4M22A 3BUSA 3R1IA 1BU5A 2VPXA 4A9AA 1KDYA 1IJKA 3CVWA 1G0NA 3M1LA 4S1TA 5AJYA 3I8OA 1C7FA 1O96A 1SULA 5SZHB 3VC2A 5COQA 4BMXA 3ZJ4A 2PFQA 5DNAA 5EIHA 4EDFA 1SZHA 4WJLA 1FMJA 4RD0A 3R8XA 2BHNA 4D02A 4MPDA 2VYNA 5CAEA 4FYYA 5FYDA 2FEOA 2W6ZA 4BLWA 4E2FA 2QJFA 1OBCA 1JA0A 1RJWA 3C4JA 3L6OO 3B12A 3OX4A 3ZYZA 5KC8A 1SXPA 4B9LA 3ID6C 3EFEA 1CRLA 1AKNA 2QRHA 4P34A 4N47A 2GN8A 3DLAA 3STWA 3BA1A 2E7ZA 5D5HA 5T7BA 3A9SA 4BUGA 1OGJA 1OIXA 4FILA 4RKQA 1T4CA 4MR8B 5TR9A 1ZIPA 5PGMA 3DMPA 4UM9B 5D7BA 2VHQA 2C2RA 3V7UA 2JAPA 1PT6A 4ZODA 2QN8A 3O5AA 4M36A 1JB1A 1I1QB 3BAFA 2F55A 1YSCA 2E8NA 1WRBA 2VQ6A 3LX8A 3OQIB 1RLMA 2ZYDA 2VHUA 3QYFA 5FJJA 2XMGA 4NCBA 1B15A 2K7ZA 3PENA 4W9NC 3BJEA 1OIVA 5KPJA 5E4JA 3JYQA 1F3OA 2LUOA 3V6LA 5HQTA 5GGYA 2ZRQA 3ND7A 3FJYA 3ZK9A 4ETWA 5JJIA 4A8EA 5DI3A 1RXEA 3E8SA 1N5WA 2GZMA 2XUHA 1T2NA 3GLVA 2JH1A 1Q6YA 2DPHA 3IAS1 5G53C 3LXMA 5BT9A 3ZGOA 4K03A 2I3DA 4OUKX 2XC9A 4MRMB 3P2OA 3L8DA 4WJ3B 1N62A 4O3SA 3HZZA 1G6KA 3EPGA 3JYHA 3HPQA 4ZMRA 4R2WA 3KQOA 2JZBA 2O7RA 2P5SA 4QT0A 2EYQA 5AW9A 3NFRA 3MAGA 2DH6A 5CGQB 3DBIA 2YXNA 3T38A 3HEBA 4IZIA 2F64A 4QXQA 2ZDHA 5KT2A 5JWOA 2J1LA 4K6HA 2R1ZA 5DBAA 2AI3A 3IOCA 1Y9DA 3KQSA 4GZMA 4ELVA 3LUGA 2FKNA 2NU6B 2ZTMA 1P0PA 3RSZA 2B5WA 2WSIA 2QJRA 3KALA 4N0MA 5F51A 1KHTA 1MX9A 3SQNA 5IYZA 3L05A 1V6CA 1DKUA 1XZ8A 3TNJA 2P65A 1GQYA 2YBDA 4BN5A 1NGSA 2QTBA 3CPEA 1MAAA 4CE6A 2WF8A 4WQMA 3IUPA 1QAMA 1UKVY 2Y99A 4H7DA 3TJZA 4YI5A 3ZE0B 4DHWA 3QXXA 4DT1A 3ZQ6A 1Q1NA 1GT91 2JAHA 5BR1A 1X7YA 4DSJA 4TPKA 1C9KA 1ND5A 2WU3A 4HDSB 4DCOA 1C29B 2YASA 1SQ0A 4JK3A 3K1ZA 2R5WA 3PGJA 2OUIA 5HR6A 1UQTA 2LIPA 1QNFA 4IVNA 5F52A 2J3HA 5FBZA 3CEHA 1NUUA 2AQHA 4P8RA 2C04A 1C3OA 2FFHA 3EAFA 3GJ6A 2EJVA 3LW8A 1ZOOA 5G0VA 4DMRA 1KBQA 1UANA 1U1EA 1BCSA 3EYWA 3KLNA 2J6CA 1XEWX 2E4XA 5HM8A 3W5DA 3I5YA 4PCAA 3LDAA 1QTMA 4RW0A 3ZGLA 4CV0A 1UFVA 2Q28A 3VZQA 2CE7A 1KYXA 1TCCA 4MYRA 2BKAA 4PNZA 4E5MA 2MWMA 4MUXA 4TWBA 1YZ7A 4CQLA 5ILOA 4X9XA 2X1VA 3FN4A 3U3XA 4AZTA 4RH3A 4ECQA 3PQ2A 2B34A 2ZRLA 1MW8X 5CXSA 1VBNA 4NG5A 3AFMA 3R44A 3STYA 3EY9A 1NWCA 3HPOA 4PG5A 3ER8A 3DLTA 4TZ0A 1QSGA 8ICOA 4QZVA 3SMQA 2LYHA 3H5IA 2JAOA 5JR3A 1R18A 3ISDA 1H2HA 5CJJA 4RMGA 4Y2SA 4FZRA 1FBNA 2HV8A 5K2MA 4KIFA 2EFDB 3LF2A 1NK5A 1T35A 3GLHB 4NCJA 1PR9A 1IQUA 2CJYA 3AK4A 3I6IA 3SK0A 4CMEC 4ZCIA 5IKPA 3K1JA 3PTAA 4RY9A 1QZXA 3SI8A 5L1MA 3B2NA 4JLVA 3PQEA 4LJKA 2FH5B 2HHLA 2FDXA 1RRCA 3KDPA 5CGZA 1GT6A 3PU6A 4U8GA 2GYWA 3OU7A 4PLWA 4UEWA 1Q0TA 2H2HA 2JBAA 4H7PA 5J0YA 2JFWA 4HGOA 2ISOA 4DL6A 2V4RA 1DAHA 3CYFA 3SNHA 3UAXA 4QULA 1G21B 4MI1A 1Q0LA 8ICBA 3FUUA 1G3QA 3OURA 3B1JA 3HCRA 3LDHA 5FBQB 3U4CA 3WB9A 3M1AA 4QZEA 2CNLA 4MKHA 3DTTA 2H0QA 4E5KA 3UJNA 3KJXA 4H7KA 1NVDA 1NW7A 3C6XA 1NQWA 2PD6A 3BD8A 3AR6A 3LIPA 2JIZD 1WMSA 3K0CC 4JJIA 4ZYLA 1A9TA 1FE8A 1WP4A 2UUPA 1P72A 1UZAA 2IZ5A 3S68A 1CY6A 4PW0A 4X7MA 1XXHA 3K9GA 1O97D 2WWHA 4D79A 1SR8A 4RQ6A 3D3KA 1RXIA 1Q0PA 1M6WA 3IUBA 2EAPA 4HO1X 4NOMA 5TS3A 3U17A 4RHTA 2D62A 4CM9A 2Q3DA 1M2EA 4D0SA 4MYDA 1U2PA 4RHFA 2ZZMA 4ZVPA 2EP8A 3N2ZB 4LI0A 5FI5A 3SC4A 1CDZA 3UMCA 1Y0BA 5EP1A 4K9PA 4OX9B 2OHFA 2IF0A 3K6JA 1MBZA 2JD2A 1XR3A 2HXSA 3U3OA 3ZHZA 4L07A 1UOQA 1MH9A 5AM2A 1JQEA 1Z0UA 2I4MA 4NICA 1QGYA 4N3CA 5FT9A 1UDBA 4JMUA 4IWYA 5LLTA 4DQIA 3TTXA 4DGQA 4ENWA 1Q17A 3PUJA 2DR3A 3FMVA 3RFVA 5EWJA 3SOZA 4NFSA 1IULA 1X1TA 4B7CA 4C3UA 1SPXA 4OL0A 3NTUA 1AURA 1XWWA 2JVIA 4L27A 1KKMA 1UMBB 4BEJA 1N61A 4LG1A 5HIJA 2CHUA 1UQRA 1R4MB 3VU9B 4C7BA 4MO9A 5KAFU 1WCIA 4N54A 1X8JA 1E2HA 1R66A 4GLLA 4M89A 4ETIA 1ESZA 1ZJMA 3EZ7A 4GR9A 5KQSA 1S77D 4D4MA 2ONYA 4OHPA 2VH2A 3CUWA 4AZSA 2A3RA 3GGPA 4P33A 4TV9A 4KRGA 3I01A 1K68A 5CIWA 3RYCA 1NM5C 2PMBA 4V2UA 4KFUA 1YBFA 2FPMA 2CCGA 4LTDA 4M1MA 4EUSA 2HM7A 4CCYA 3UHFA 5I9LA 3WISA 5DNYB 1COZA 1TLFA 1EFDN 1X1EA 1XJQA 4EMSA 3MJTA 3V8PA 5CP8A 3GDWA 1ZIDA 1HG1A 5FF9A 2O8FB 5AR1A 5EZ6B 5EWGA 1DFHA 5IX8A 3CXUA 1J42A 2GD6A 2VP6A 2ORWA 1EDEA 3C16C 1X2BA 1M2GA 5C8VA 2F3TA 3PRHA 3UAYA 3N2EA 1ODIA 5TF0A 4HT3B 1KI9A 4OJMX 4PLCA 4EMTA 3H0RB 3T9FA 5KQMA 4ZU3A 1YFLA 1D6MA 4R9VA 2IHVA 3LC0A 3GZNB 2V97A 3T7KA 4QBGB 1HUOA 1UIMA 2JARA 5ALZA 1XP5A 2AGOA 4TWZA 5C1PA 3K20A 4WLEA 3BIXA 4G8JA 3WJ7A 1DIAA 4RK6A 2HRBA 3CG4A 1THGA 1G8FA 1DRGA 1CQJB 2B30A 1N0VC 3OX2A 1MABB 4P82A 2AFVA 4ND7A 1KZGB 2AF3C 2EBHX 3U7EB 3ZY6A 4B45A 2R96A 1GUYA 1QF6A 1AK1A 4RPIA 1KVRA 4URUR 5CM9C 2X9VA 1HFKA 1NVEA 5BN5A 2O5EA 5K09A 4YCBA 2YJGA 4YECA 1FX1A 2NUPB 2O1WA 2QX9A 3MJCA 5HXAA 5MN5A 5CCXA 1E9FA 1F2TB 4LSMA 3GV8B 4DSIA 4ZJUA 4FOLA 5J2FA 3N2KA 1K7CA 4OJKA 1WP9A 5IPFA 4UBBA 3C3BA 4CG0A 4OJTA 1H93A 4DXHA 3VO8A 4MIYA 1WXWA 1E7MA 1FUKA 2VTEA 4WT7A 5BV8A 5AW4A 4KKXB 3KX2A 4C76A 2Y27A 1JN0A 4Y2VA 9MHTA 1QOZA 3WLIA 3EJ6A 2XJ9A 5DOZA 4D1YA 4XCVA 3HH8A 4ZT3A 4OLBA 3T5LA 2CFCA 5AW1A 3QP9A 1IBCA 1KJZA 4X54A 2QB5A 5BYAA 1P5FA 3BQ7A 3BQ2A 1VMKA 2AEJA 2H1FA 2ZE8A 3RS0A 4F1JA 1RRFA 4LN1A 2X8AA 3CXRA 3E53A 4IHJB 3SBXA 5B7NA 4TV8F 3NHLA 3PO4A 4JZKA 5K1ZA 4EFNA 4MQEB 2F6RA 2J0VA 4KNWA 5DNEA 3LA8A 3ONFA 3M9OB 3HSYA 1Q83A 2KKVA 1JFFA 3B6KA 1B26A 3A3OA 2BELA 1TCVA 4QU8A 5JNLA 2VAVA 1T34A 4KL8S 1A96A 1ZOLA 4RQBA 3G7NA 1GN8A 1JRLA 1U8EA 2B8EA 1Y1QA 3GUCA 2HBMA 2GI4A 3R9XB 2PMFA 3F3SA 2PA0A 1T3TA 2GUGA 3I5UA 5F3RA 3SJCA 3VRHA 3EFHA 4Z2AA 2EFJA 2GPNA 1DOHA 2FWNA 2QY6A 4TXLA 1QRSA 5L9XA 2Z83A 3A11A 3EG5A 2G6BA 3EQ6A 2IODA 1AB6A 1Q0SA 3DYBA 4CODB 5KWIA 3LHDA 4MUYA 1B1CA 3ED5A 2CVZA 3TCXB 3IELA 2POQX 1A76A 1AKWA 1B8UA 2O0JA 3B78A 4G86A 3ZV5A 2ZIWA 1WYGA 5TISU 1HORA 4LYAA 1EG2A 3IVAA 1CV2A 3TM5A 4IJ5A 2QGNA 1NVVR 1V37A 1T24A 4ML3A 5J0WA 3E70C 1PHPA 1MPTA 2BFPA 3NHKA 8ICPA 1NPYA 5A7FA 1Z00A 3RODA 1V25A 3G6VA 5H8WA 4I2GA 2WDPA 2A5YB 3N0XA 5LP1A 2AFHE 3LDFA 2OCAA 5E3JA 4ZALA 4FX5A 4WFKA 1JFTA 4RFSB 3GCZA 1XZBA 1YQDA 2WMOB 4TL8A 3UHAA 1FFVA 3RVSA 1AHHA 3EVCA 5K99A 3ORSA 1U9CA 3E9CA 3AU2A 5LMCA 1YIOA 1AXEA 3RM3A 2QLMA 3CHYA 1NI3A 5JYCA 4Y6RA 3GARA 9ICLA 1G3RA 4E4YA 1HEUA 3EF1A 2VTBA 4K6KA 1ZQRA 4MJ7A 3TNFA 4BP9A 2XI4A 1E6WA 3U48A 2C7BA 3D6MA 1WOMA 2C0CA 4IICA 2Q0ZX 5ICGA 4RJIA 4X1KB 4JEMA 3V1NA 3DPIA 3QV2A 1HLFA 3BXGA 1GSHA 3DYIA 3V7LA 3FI0A 4ZZ3A 5JIBA 2ZBGA 3HYLA 4GX1A 1E3JA 4IDNA 4N8EA 3BT7A 1E9BA 2VQ3A 4TKZA 3NOXA 1T0UA 2OBYA 5FBKA 2Q7DA 1JH9A 4UEOA 3BMQA 4MICA 2PA3A 4IIJB 3SE0A 2QP9X 3ICWA 1Y8RA 2W6PA 5HP4A 5GMOA 1Z0DA 1G20E 4J9KA 2IU3A 1AGNA 2RK6A 4ZARA 4DVGA 4AY2A 5DB6A 3AQEA 4JJGA 1KMMA 2HLNA 3BIFA 2O7QA 4OP2A 4Z9AA 1GNQA 2DLDA 3ROZA 4YV2A 4B2IA 8OHMA 4A8TA 5EWMB 4BFUA 5HZHA 3ZZNA 5I5GA 3AY3A 2ZVPX 1DO0A 3C3AA 3ONDA 4B80A 1Z1BA 1ADCA 2QE7A 2DE0X 3I01M 3RYFB 5KWSA 1VPWA 1P81A 1JXAA 5CA1F 1WV1A 5HDQA 4JV1A 5F35A 4CCAA 1S8OA 4IR9A 1W5TA 2I99A 9ICQA 2QLFA 4HWSA 3VTKA 3MHPA 5G41A 3ETEA 3M7DA 4K28A 2W0MA 3JW8A 1KDTA 2R8EA 3PJGA 4L5IA 4MH0R 4PS0A 4MEJA 4URYR 4NLNA 1IPHA 3H9QA 3V2UA 2XGGA 1G8SA 5AI5A 8ICLA 1EGAA 3LZ6A 2P6NA 2NU9B 8ABPA 3JTEA 4NYIQ 3ZWXA 5JQGF 3RADC 3KHRA 2XMDA 2IA5A 2YV1A 5I48A 3CX6A 1E62A 3D2CA 3IUYA 5ALWA 1L8LA 3H05A 4J07A 4OHKA 4TXMA 4UBMA 2C2KA 4HMPA 3K16A 4YJGA 3NPMA 4AUEA 4URXR 5M2QA 3D6FA 4X6LA 4J1SA 4NL4H 1Y1RA 3C3CA 4MVJA 4N5NA 4CIWA 3JVDA 4HQKA 1BHO1 2CL5A 1FRFS 1TAGA 2OCXA 3KK0A 2BYTA 1D8LA 1CB0A 5AP9A 3S5UA 1PL7A 2BI8A 3K1AA 2XZOA 2W5UA 3AI1A 1XU4A 1T1IA 1LRJA 1DBWA 1JEAA 4YR0A 2CXRA 1GKLA 2PUWA 4TWIA 5EWJB 4DC0A 5MN4A 1SC9A 3Q7EA 4U39A 5A4DA 1QNLA 2ODAA 4KXVA 2O0KA 5JTIA 2WD8A 4H2DA 2WQ6A 3HXMA 4A2CA 4BWMA 3M1IA 4NONA 4A0GA 3LPLA 4CHTA 2OXFA 1SKAA 3GPDG 3TLAA 4FNAA 3WGOA 2X7JA 3AUKA 3V4RA 1X9SA 2FLPA 4J1TA 4UU8A 1SBZA 4BLQA 4HGRA 3PXAA 1C9DB 1DEAA 2Y66A 1RYUA 2BUAA 5I9SA 1DDGA 1AZSC 3CB2A 4MGKR 3RS3A 4EA9A 2XPCA 3RJKA 1M83A 2MSCB 3SM3A 1S8FA 5G4KB 1MX1A 4LOLA 1MENA 4WOPA 1H1TA 5LBTA 1XL0A 3RFUA 4F3TA 4C8OA 3AM5A 1UPUA 5TQ0B 4CQLB 2IE0A 3ICCA 4G4IA 4NOLA 4IRDA 3T5PA 1HRKA 1FZQA 1C1DA 2BL4A 2CL7X 2PV0A 2RKOA 3L92A 3VR6H 2VDWB 5I47A 2ZZKA 4ARZB 3IT3A 3HKCB 4JU9A 1L7VC 3D6TB 4QWMA 4ECZA 2AOTA 2F4VB 1G2PA 3RTEA 1MRSA 4FGKA 2QMUA 1HT1E 3WY9A 1W0KA 3FYUC 1GL7A 4JJFA 3W2IA 3QYAA 3NBXX 4OLFA 3AEUA 4QZ8A 4BZZA 1E2BA 3IUMA 1SQ5A 1TVCA 2KWIA 3TADC 3OF5A 2WHRA 2P41A 1XZHA 2Y1JA 2VTVA 2HIGA 2VWGA 2WICA 5HFJA 1FRQA 1HNZB 3WC4A 1IG3A 2VJOA 2VRWA 2FQQA 3CURA 3STVA 3UK1A 4PSCA 3MGVA 3I4FA 2I4OA 2I2FA 1SMKA 1VCHA 1O1YA 1AO3A 1OWOA 1FF9A 3A3KA 3GFGA 3N8DA 1GP2A 3NTVA 1XU7A 2WJWA 3NP9A 4IZOA 1QGDA 3CCBA 5EMMA 3HMQA 3SEFA 2XUIA 2A9FA 4H0NA 5FI1B 4F4HA 1A5ZA 2WUEA 1WETA 5K0BA 2QQGA 4BVJA 3OIVA 4LZWA 1AK9A 9ICVA 1S7GA 1MO5A 1RP1A 2I6UA 5CB6A 2QSZA 2XGPA 5KX5B 4NEQA 3PW4A 4B8ZA 3U61B 1ZZGA 2FOLA 2X77A 2BLLA 4TV9B 5CVTA 3M4YA 2AOUA 1MV5A 3GGJA 4UUMA 5A9RA 1R5OA 3C70A 4OHUA 2DQNB 3F2BA 3DXZA 1B93A 3GFFA 3Q7SA 3VKHA 3ZHCA 2VLBA 1BMFD 2MR6A 3HCNA 3N39C 4L8WB 1XX6A 2BUBA 2XT0A 3GD5A 4NK4A 4RQUA 2IUEA 3AB3A 3I73A 3V4ZA 1UBJS 5A5FA 1SZCA 1E5LA 1BXRA 2JS7A 3AR2A 2HY7A 2H2DA 5CBPA 3AERA 2GVDC 4KMMA 1Q50A 5HA5A 3ZTYA 4LXTA 3CRVA 1K4KA 4BX8A 5ALYA 1DP4A 1OAOA 4NHOA 5JDIA 5F3XB 4I2FA 5F98A 1JA9A 1V1RA 3WLOA 1A5AB 3FPAA 3RH5A 3PFFA 2OL4A 4GMDA 1BX0A 2BFCA 4O2RA 4BCDA 3T52A 3NLLA 4D9HA 3IR6A 3Q72A 2HPZA 3KJFA 3PC2A 1LY1A 4XGKA 3RLFA 5BSHA 4OFZA 1XFAA 1N4DA 6NULA 4Q7QA 8ICIA 4NATA 4EEKA 1RQXA 2JIZA 1WZCA 5T41A 1FXWA 1KGDA 2N9UA 4S35A 5KTMA 2H4FA 3DDNA 1AH2A 5JCOA 1F48A 2CJWA 4QRHA 3ICQB 4TVOA 3GLUA 4OQEA 4LECA 2M6SA 1JWLA 3CSDA 4EG0A 4D9NA 2X23A 1C2TA 4PFJA 3IHKA 1AV7A 1FMLA 1BOFA 1HMPA 1QK3A 5ANRB 2IHTA 5L40A 1WHSA 5A06A 1JQDA 1MDBA 1TKCA 1VTKA 3I2KA 3OZCA 4D3ZA 1X7XA 2QSUA 4AJIA 1SPBS 1U9IA 5L3VA 4BWFB 1CUWA 5FXMA 5M7EA 3O4GA 4AS1A 2GKGA 5KOHA 4EY3A 2I5HA 5AVUA 2WHPA 4Q1AA 2GN6A 1XHEA 3F6YA 4GDMA 4M76B 2AS0A 2Q5EA 2HN9A 4UEQA 4F50A 4JWMA 2TRSB 5KFHA 1N0UA 2ZSHA 3I9V1 2MSEB 4L5CA 4GOLD 5BYBA 4BNFA 1F4PA 3W77A 9ICRA 2ZJ2A 3EDOA 4WBSA 1W5SA 1ZQYA 3HLKA 3LQRA 1MO4A 3E82A 4HDRA 5T3YA 3S1AB 2FMIA 4AP5A 4C0QC 1U28A 1KK1A 2H3VA 1TMGE 4NE9A 3HGQA 4IV8A 2I33A 1NZFA 2B21A 3PR1A 4NECA 1P0IA 1WB5A 2VDOB 5E2BA 2ABWA 1PJ3A 4XIGS 1JF8A 1MUUA 1SZJG 2Z9BA 2Q0XA 5ES3A 4CNBA 2VF2A 5K6TA 3O0FA 2P30A 1NF2A 2V1UA 2B6HA 1R4NA 1XVAA 1KYVA 2ZUCA 4OO1J 1FNBA 4KO1S 3W5CA 2C9YA 4CEJA 1WSBA 3D4IA 1UBSB 3U19A 4G5YA 3WAJA 4Z6EA 4H7IA 1AUXA 4Y6OA 4F4XA 5EKTA 5SY9A 4IL6U 4M60A 5F2OA 3ZDAA 9ICBA 4FIDA 5AXCA 2GYVA 3IDAA 1NBHA 3TIFA 2QV0A 1NXPA 2P8JA 5JO9A 4EY5A 3WK9A 2YR0A 2NGRA 4TUYA 5C1OA 3NBUA 1II8A 2YIJA 4WX2B 1FRVA 2X2FA 1FRZA 3BXHA 2FHPA 4AECA 1OV6A 3PF9A 5FLXA 3IVMA 2F76X 3GH3A 1VB5A 3OJWA 3DDSA 3OOWA 3IR5A 2DUNA 4N5LA 4Z4EA 1VDVA 1LBHA 1QG0A 4ECRA 4UBLA 4PFSA 1QH0A 4ER0A 3DXYA 1XNJA 3H4MA 3X3HA 521PA 1OX6A 1JR3D 4UB2A 3GT3A 5JAOA 1QFYA 2D7CA 3ZQJA 2H0RA 3OIYA 1XV5A 2Z2YA 1HSZA 2VXBA 1RZ3A 2Q4RA 4BNDB 4D42A 5IS2A 2NRTA 4O0MA 3T4EA 3WLKX 3P45A 4OO3A 1LC3A 4TMFA 4QDZA 2XRFA 4GRDA 2F59A 3RUEA 2K60A 1RLUA 3UQ0A 1XLUA 4U00A 1R3UA 4WINA 4DA6A 5KNCD 2WY2D 3DVSX 4M53A 1EFVA 5FTWA 1L3BA 3DDOA 1I32A 1ODFA 2C07A 1JJIA 3CM0A 1G1AA 1D7OA 2FEMA 2XY4A 4ZVNA 1B3RA 1SXIA 3NHAA 4Q0MA 2GARA 2QW0X 3AJDA 4IS7A 4I9HA 5LA6B 4IOJA 1NJ1A 3D8BA 4DEZA 3KHKA 1L1RA 4KIGA 3DHVA 4Q3OA 2ZTHA 5SV2A 3OPMA 2FWIA 3LO8A 3TNDA 5LQUA 2QRPA 2VWQA 3FHOA 4EPXA 1W87A 2XRMA 3MWYW 1JR3E 2ID8A 4TKUB 4PGXA 5K51A 4J9PA 2GEBA 3MSXA 2ZS7A 3C1OA 1B00A 3FCAA 4MX8A 3G7UA 3MNFA 3M6WA 5M34A 3QA3E 1II8B 1SN7A 1PGJA 2X5JO 5ALLA 3K70C 4AQ7A 1JDZA 2RHCA 2OUKA 3FX2A 3NHMA 2OAP1 1ULZA 1E5XA 4RADA 4R6XA 4E5NA 4EGFA 1JIHA 4Q39A 1T2AA 3QOXA 4GM1A 4TLAA 4WVFA 2XWPA 1P9LA 3H8JA 3RTAA 4G1MB 4KVAA 1DC3A 2PKXA 3NMUF 2A57A 4F8RA 3BULA 4JFAA 4YAKA 2FPPA 5KHOC 3O3OB 3HYTA 1BVRA 4FOSA 1EXVA 4CGZA 2YQ5A 3DMRA 4LV5B 1GKKA 3T7SA 3KEFA 4ZIRB 3V33A 1GVHA 4LE0A 2ASJA 4D44A 3KZXA 4Q9AA 4R1SA 3O03A 2J3KA 2KQUA 4YO7A 5L6LB 5L7WA 5GM1A 2HBLA 5KT7A 1NJFA 2JCVA 4LDQA 3Q12A 1TJYA 1WZUA 4TQGA 4YDHB 2BRUA 2CSXA 3QRWA 3I5XA 2Q5IA 5F1PA 1U9JA 4C1BA 1EWQA 2RGRA 5TARA 3NIFB 3O8BA 4EUNA 4D25A 2KMDA 3RB3A 4P86A 1R0BA 4JUDX 2R1TB 2WM8A 1HE5A 1WSAA 5AOVA 3D6NB 4YUAA 3UMRA 4FWTA 4G0OA 2RBKA 1Y8RB 2CXTA 2Q6IA 4BPBA 3THXA 1QIJA 2CVQA 4FW8A 3UWKA 4BL5A 2QL6A 9ICFA 3MR5A 2WP0A 4LF4B 1TMOA 3TLKA 3GDGA 2AKEA 1CUCA 3TW8B 3T3EA 1GRCA 2W55A 1XAJA 4JITA 4C2AA 1ZRHA 4BO2A 1VM6A 1S3FA 5JVDA 2ODPA 5LYJB 2OCLA 2O5CA 4QAJA 4XGQA 3JPOA 3UHPA 3EPPA 5TEWA 3SX2A 1C3JA 1DZIA 4POOA 4Y2XA 2RDIA 5CR0A 1HIWA 2VH1A 1P7CA 1DU4A 3JZDA 4H18A 4MZDA 4P5DA 1Z22A 4XYBA 3V2GA 4CIDA 1M0EA 4PLVA 3HCWA 1QR2A 4E2ZA 4KLFA 1VGRA 4B5LA 5H3LA 2VPZA 2G04A 4IYRA 2V7EA 3K0FA 5EYPA 5B58T 2XNHA 4DDWA 4YQFA 5TVGA 1EMDA 1Q15A 4OPMA 5HJEA 5C8ZA 1EDBA 1KE1A 4RF3A 1VE6A 4BOYA 2UYHA 3CZPA 4G41A 3AVOA 4C5CA 1KP3A 1P45A 2E4UA 5K6AC 1BXRB 5T5QA 3B60A 1JHXA 1DAGA 2ISSD 3EA4A 5M3BA 2O2ZA 1V11B 4GC5A 1ONNA 4QLAA 4BV8A 1GPBA 1ZA1A 1I01A 1J33A 4RO0A 4E5PA 2I0FA 3K4QA 3LQ1A 5BPFA 2O6KA 5ITZB 5IJ0A 4RNDB 4KSCA 3N7PD 1IOLA 1R64A 1Z5UA 4D3FA 1H9AA 3B1ZA 4LY0A 5FULA 3YASA 3PB3A 3THRA 4AW9A 1NNUA 4EZIA 1SVKA 4WUTA 3VC7A 1QS0A 2RHDA 1JHVA 3INNA 5LIRA 2AGQA 3H83A 1IEXA 5A3QA 5KBYA 3THXB 4WACA 4RQ3A 3BTSA 3TBHA 1IAQA 1PWHA 2ZYGA 2R9VA 3GLGE 1YR8A 3C3PA 3E9ZA 3ILHA 2FX5A 4S0ZA 5DLYA 2CV0A 2Q5LA 4DY6A 4F3CA 2GWHA 3UYLA 4HNTA 1NM5A 3QZUA 3WMFA 4DSAA 1IUNA 2PY6A 4YGYA 2Z1NA 3VDQA 2I3ZA 2X1MA 4AJ1A 4DC9A 3EPJA 3A6ZA 3E5RA 1CVIA 4CEIB 3OZFA 1IDN1 3QE4A 3WGKA 3RG8A 4DCJA 5I9IA 1RACA 1PT9A 1LU9A 3BQ1A 2FPIA 1C8BA 2ZUBA 1UPBA 2FJPA 2W4QA 2XV1A 2K4EA 2YXPX 3BIOA 2WU4A 821PA 3UFXB 3QOWA 2W9CB 2B92A 3IBTA 1IB6A 1UMCB 4MR7A 1XCLA 1VSVA 4RAQA 3VPDA 4E5YA 1LW6E 3KKEA 4JP8A 3IP6A 4PICA 1JQBA 3BORA 2WINI 3EODA 3QMPA 4P4TA 4QOJA 1EFTA 3RSHA 1WXGA 3L01A 1PEKE 1ZQVA 1BIFA 2AOTB 3DP7A 4Q9DA 5A5VA 4IIUA 2SECE 2FUG1 1MO3A 4P32A 3FHCB 4I2BA 1YVDA 3PGKA 3OM8A 3AQIA 3CGWA 4F5WA 1WSDA 5BQ3A 3F5MA 1NQOA 1QFXA 2VATA 3T0GA 1N60A 3L0DA 3G8AA 3CUKA 3QKRB 3ZH2A 4CQMB 2ILVA 3RBZA 1N5KA 2HMTA 1NKSA 3OMWA 4BMVA 4FFDA 1EIZA 1VP9A 2JJ8A 4UMFA 4S05A 1ZYQA 5KCMA 2AHRA 1VFPA 2Q4DA 2AFIB 4BTVA 1NQVA 5DOVA 1L4YA 3SS9X 3ZHTA 3UAZA 4KPYA 3QLVA 2AG0A 4OQXA 2A6PA 3RVQA 2HDOA 3D7RA 3GJRA 3T5JA 3I2JA 1AC5A 1FP6A 4C3VA 1HJPA 2ZUDA 1P31A 2O3TA 4E09A 2FE4A 2QLNA 4XUGB 4XDZA 5EKUA 3VNQA 3FTQA 5I7EA 3GIIA 1DAOA 1Y5IA 2P9CA 3KYCB 4G1BA 3G3EA 4INAA 2XKAA 1HSOA 4ZCQA 2Z7JA 1TA0A 1GZVA 2JGMA 1KFJB 2VXYA 3IILA 4ED7A 4F45A 1WDWB 4J0JA 3CVUA 2G17A 3IT1A 4L08A 4HH4A 3DWEX 1TK9A 4PQYA 4ZI7B 2HT6A 2RHGB 2PMZF 1OLUB 2JLBA 3V3TA 4QHTA 4V3CA 2QB0A 1LPOA 4LRQA 5KJCA 4U5QA 3LT5A 3F7MA 5JCZA 5E2IA 4KXMA 5EE9A 4F9FA 3HX0A 1SH7A 4L16A 4Q6BA 5CLQA 4QFDA 1I7SB 5AVVA 4QZIA 4IQVA 2CHEA 1E5DA 2FSSA 4MKZA 3PSIA 1ZIYA 2O8BA 1LUAA 3KXLA 4PYLA 4ND8A 3T15A 4BGVA 1I3CA 5C53B 3DDZX 3O75A 5JAUA 2Q6VA 1HF3A 2EHJA 3LYLA 3TACB 4P5PA 3M9MB 4QICA 4UOZA 5A5EA 1BQ3A 1XALA 2CK3A 3A05A 3WXBA 4JP2A 4M37A 3UHJA 4D45A 1USGA 3K0HA 3TZLA 2A9JA 3GJ3A 1VG9B 4LMPA 4K87A 1YRBA 2D5AA 5K8LA 2HEGA 4KE8A 1TM5E 2JHAA 4XB2A 4C3ZA 2PKWA 2QGZA 5HK9A 2GLTA 1D2CA 4KLCA 4N0DA 1XMVA 4IY1A 4PGMA 5K0GA 3DTVD 2WYIA 3EHEA 4F8JA 2Z2XA 1NK8A 2EKZA 4ZYWA 2NP7A 1RW4A 2O2CA 1XQ6A 3SJUA 4ARAA 4GKKB 4TMZA 2F3QA 3R7FA 1YOBA 4QYIB 4DG8A 1L8XA 4FYIA 2QB1A 1QE0A 3G9ZA 1EK0A 3MCTA 2RDJA 1AMOA 4HDRB 4IDHA 1EQUA 5F7ZA 2YY7A 1KNQA 4IZ6A 1I80A 4DJDC 2WSSD 3D3QA 5JMOA 1TVMA 3CLTC 1P44A 2CVFA 4GVXA 2ZYAA 3HHPA 3S2GA 4Z4GA 3UAVA 4ALMA 2IW3A 3EQ9A 4F8EA 5J4YA 3SQWA 4C05A 5BQXA 1E9AA 4RXTA 4XIYA 5DG7A 4KYVA 3VTZA 4Y2QA 3GT4A 2BR5A 4MIKA 1E20A 2NZWA 3HP6A 3KXDA 4MR9B 3PC8C 4QNRA 3AM3A 5DGBA 4CN8A 3KSDO 4KGZA 1CRZA 4YQYA 3DTVA 1EP1B 4A0QA 1GG9A 2GDJA 3ZK7A 2EKDA 3AKYA 3MJRA 4M1TA 3IDOA 3X1JA 2D5BA 3DZHA 2PO7A 1BVYF 2ZBFA 4NNJA 4AD8A 3RAFC 2NACA 4ZAYA 4S3MA 1J8MF 4WNIA 5BY2A 5HKKA 4D0LB 1YFJA 2ENWA 3DNPA 2QU7A 2RGWA 3PG5A 4MUNA 5BW5A 4S1VA 4JUCA 2V9PA 4BVLA 1L5SA 2QVBA 2GPTA 4MJXA 4ZKDA 5B55A 3PNBA 2PMDA 4QJ3A 4ZHSA 5FA6A 3Q7RA 3TUZC 4YBRA 2SCUA 1U7ZA 3N2LA 5FPPA 3NOOA 1FDSA 2W6JA 5JAZA 3RK0A 3BFJA 4ON9A 3I0ZA 1HE8B 1HYBA 1YJCA 2WQ7A 4AN4A 3RR7A 1XSLA 2XZPA 3OJLA 5AI9A 3CF0A 2FOXA 5FNVF 4OJ6A 2NQ2C 5J40A 1FQJA 1KF0A 1QWOA 2EU8A 1Q46A 3HBNA 3JQAB 3JVIA 4L9RA 2L42A 1U1FA 2QRUA 4NZNA 2XF2A 3OGUA 4JWKA 5BR4A 3D6JA 3M3HA 2DKZA 3T7AA 2O2YA 2WIFA 3LGAA 3M4NA 3NBYC