3QU9A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant complexed with magnesium and tartrate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
225
structure length
225
Chain Sequence
SHMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 79
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu9A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu9A01
2IOHA 3SHQA 1Z4KA 3ZUPA 1Z4OA 2HOQA 3E58A 4BBJA 2FI1A 4J2TA 5AVRA 2RAVA 1RLMA 1K1EA 5ALYA 2MU2A 3A1EA 4JB3A 3WKDA 2B0CA 2IA5A 4ZEWA 3ED5A 4UAUA 2QYHA 2YBDA 3R09A 3ET4A 3ZTYA 2C88A 1S8OA 5ALJA 5ALHA 3IRUA 2W4MA 4AP9A 4EZEA 2JARA 2G1AA 3GYGA 3N07A 3OCWA 3HYCA 4CF3A 2NO4A 3CZ4A 3B9RA 4BYGA 1J97A 3AR3A 5AK6A 4OD0A 3SKYA 4HYTA 4YCLA 4BNDB 2OA0A 2YJ6A 1RRCA 1L6RA 5AM3A 3QU5A 2JAOA 1X42A 4HAIA 5ALFA 3HLTA 3RF6A 4Y2SA 1Z5UA 1Z4PX 4L6CA 4G63A 2ZBDA 3L8HA 2G09A 5AKEA 4F72A 1L7NA 1WPGA 5AW7A 1ZRNA 3ZTWA 4AS2A 4UASA 2ZG6A 4G9BA 5AKYA 5A3SA 1RKVA 4KNVA 1VJRA 1YDFA 2YJ3A 1EK2A 4I9GA 5ALWA 3WK8A 3QYPA 1LVHA 3L8FA 3WKEA 2B8JA 4Y2XA 3DV9A 3TLMA 1L7OA 4OFZA 2MU1A 3U7FB 1Z5GA 3RFUA 2P11A 2HCFA 2CFSA 2R8YA 5ALIA 4EEKA 1IWOA 5ALRA 3DNPA 3N1UA 3N5KA 5AW3A 1L8OA 2R8EA 1RKQA 3QUCA 2YMPA 1PW5A 2FEAA 4UATA 4EELA 2BDEA 4HGRA 3SLRA 3VAYA 2EATA 5AW5A 5IT4A 2FPRA 3QGMA 2RARA 4UMDA 4H1WA 2G06A 2P9JA 1SU4A 3D6JA 5AW6A 2W11A 4UAVA 5ALPA 4EENA 5AM0A 4RESA 1FEZA 4XQ0A 2D2VA 1NRWA 3L8GA 1N8NA 3IJ5A 2HDOA 3PGVA 2GO7A 1ZS9A 2AH5A 2CFRA 3U19A 2FPSA 4ZEVA 4KX3A 1RC8A 5AK3A 1TA0A 4XOUA 4E88A 2FPUA 3M1YA 2JAWA 5ALNA 4BKMA 1O08A 3FPBA 3I1YA 3U7EB 2ZXEA 3PDWA 4HGQA 1T5TA 2HSZA 4XPZA 3UM9A 4L6AA 1U02A 2G80A 1RMTA 2HX1A 3QUBA 2G07A 3MC1A 1YS9A 1Q92A 3NRJA 2YJ4A 3MN1A 5AVVA 1U7PA 5AM5A 5AVWA 2I6XA 1RMYA 1O03A 3SKXA 2FDRA 1Y8AA 2IOFK 3QXGA 1YJ5A 2G0AA 4DCCA 4UM7A 5AI4A 1N9KA 3WGVA 3B9BA 3I76A 5ALUA 4C4RA 3NUQA 3U7HB 1RLTA 2I33A 1RQNA 2RB5A 4NWIA 1XP5A 5A3QA 4NABA 1ZD2P 4CNQA 1U2SA 4BX2A 4UU0A 3NALA 4FE3A 2P27A 3DDHA 2HF2A 3FGOA 5AW4A 3N8GA 1KYTA 4HGOA 2FUCA 2IOFA 4Y2UA 2C4NA 3B8EA 2X4DA 3KC2A 4DW8A 1J8DA 3FPSA 1CQZA 3QU2A 3ZVMA 1QQ7A 3UMBA 1WZCA 4BNDA 5AKLA 4Y3UA 2RBKA 3L7YA 1F5SA 3R4CA 5AI5A 2R8XA 4Y2TA 5AVXA 2W43A 4QQFA 3BWVA 4YIKA 3R9KA 4F71A 2P69A 3W5CA 3ET5A 2AGVA 3A1DA 5AW0A 4CE6A 3UMGA 2ZOSA 1TE2A 3FVVA 4YIHA 5IT0A 4C4TA 2WHEA 5AVQA 3WK9A 5AK4A 3NANA 3I28A 3QU9A 1RPZA 5ALGA 1Z4QA 1MH9A 2HHLA 2GHTA 4MUMA 3WKBA 4DFDA 2OBBA 3I6BA 3W5AA 5AI9A 1ZOLA 1U2TA 1QYIA 2O9JA 3WK7A 2HEGA 2OM6A 5AICA 1RQLA 4HGPA 4Y2PA 4KNWA 3OCXA 5AK5A 3ZI4A 5AI0A 5AW9A 2EARA 4MWOA 3KD3A 5E0OA 3W5DA 1VJ5A 2VKQA 3AR8A 5T41A 5AVUA 3K1ZA 5ALTA 4UW9A 3J7TA 3L0CA 5AW2A 5ALSA 3OCZA 1YMQA 4YCMA 3DAOA 2ODAA 1L8LA 2HO4A 4KN8A 2BY4A 3SD7A 2PKEA 5AKJA 3KBBA 3EF1A 3WKAA 3ESRA 3NASA 2Q4TA 2NYVA 4UU1A 3L0YA 2AMYA 3EWIA 3ZVLA 1WR8A 1XPJA 1TJ3A 5AKXA 5ALOA 5AM2A 1ZD5A 2Q4RA 2YMQA 3L0BA 4QJBA 5ALXA 2B1QA 2WF6A 3A3YA 2YFYA 1TJ4A 3PGLA 4I9FA 5ALQA 3W5BA 1T5SA 4NAVA 2O2XA 4UMFA 4RETA 5AM4A 3ZX4A 4XE5A 2I7DA 4J03A 3QX7A 5ALVA 1RMQA 3WKCA 4UMVA 4DWOA 4C4SA 4NV0A 4ZEXA 3ZU6A 2MSNA 4Y2QA 4B6JA 2WF9A 3F9RA 2BDUA 5AI8A 2FPWA 3OPXA 4EX7A 3ONNA 3FZQA 4YCNA 2NO5A 2FPXA 2JAUA 2HF7A 4Y2JA 3SMVA 1YNSA 2GFHA 1RDFA 4BX0A 5AESA 4FFDA 5ALMA 4IG4A 2B82A 5AVZA 3S6JA 2ZBGA 2WF8A 3QUTA 2I55A 3NIWA 4UARA 2HI0A 3OTQA 3U26A 1RKUA 1ZJJA 4PNHA 4KX5A 1L7PA 5ALKA 1L7MA 2DQSA 1QQ5A 4AS3A 2WF7A 1LTQA 3L8EA 3AR5A 2CFTA 3BA6A 3PCTA 4BX3A 2B30A 3AR7A 3OCUA 4UMEA 2R8ZA 3EPRA 2YJ5A 4O8CA 4OCZA 1QH9A 3QU4A 4UM5A 3ZW7A 2YN4A 2WM8A 3ZX5A 1JUDA 3U13A 3ESQA 3M9LA 5AVTA 3WK5A 1WVIA 5AKZA 1Q91A 3CNHA 1Z88A 2IYEA 3QLEA 5A3RA 3QU7A 3AR9A 5AIBA 1NF2A 3OCYA 1Z4IA 2FUEA 3KZXA 4GXTA 5AKHA 1SWWA 3UMCA 4JDPA 2CN1A 2ZBFA 3AR2A 2ZBEA 4BEVA 3MPOA 3MMZA 4BEWA 1Z4LA 2B1RA 5AW1A 1S2OA 5IS2A 1QQ6A 4EX6A 4IFTA 5AKIA 3E81A 2QLTA 2G08A 2PQ0A 5AKGA 2C8KA 4FYPA 1EK1A 3A1CA 1YV9A 4YH1A 2EAUA 3ZWDA 5ALDA 2YY6A 3ZWKA 2GMWA 3SF0A 4L57A 1TJ5A 2OYCA 5AM1A 5AVSA 3QNMA 1T9ZA 3P96A 3WK4A 1AQ6A 3KOOA 3E8MA 3WK6A 3L1UA 4GIBA 5FP0A 2C9MA 2WF5A 1ZRMA 1ZD4A 3QUQA 3AR6A 3L5KA 4KYTA 1NNLA 2Q5EA 3AR4A 4NFLA 4CF5A 3L1VA 2JGAA 3U7GA 5AI6A 1XVIA 2GHQA 5AVYA 3KDPA 3OCVA 2I34A 5ALZA 1Z4JA 4Y2YA 4OHFA 1RLOA 2WFAA 3EF0A 5ALLA 3ZVNA 5JJBA 1CR6A 4CF4A 3NAMA 1SWVA 5AHXA 2PR7A 5ALEA 2AUTA 1Z4NA 4YGYA 3IB6A 4HGNA 4Y2RA 1VFPA 1Z4MA 2YMMA 5AW8A 3WGUA 4Y2VA 3FM9A 5AKKA 2C8LA 3N28A 1U7OA 5AIAA 2I54A 1ZD3A 2B8EA 3E84A 2YMLA
chains in the Genus database with same CATH superfamily
1MRZA 3HJUA 3M6IA 4ALMA 1Z4KA 1I30A 2WD7B 3GJXC 5DDYA 2ERYA 5D01A 4A03A 1DUIA 3MJFA 1T2AA 2EBHX 2HU8A 2MSLA 3BX1A 2IS6A 2BUCA 3IBCA 1NIPA 2AXPA 1YC5A 3R40A 5CNKA 5B1DA 3RO7A 3ZHBA 4UTNA 1IUNA 1JU4A 1XXHB 2IE8A 1I1HA 3OFSA 3D2CA 3O73A 4US9A 1SVWA 1ZISA 2JMGA 1M76A 4G9GA 2VBCA 4KQFA 4Q6WA 4BZWA 4JB3A 3I8SA 1RRFA 1TYEB 4OVKA 4MYDA 3PUKA 3SICE 3GA7A 1YB4A 3HUFA 1AUVA 3ZJTA 1KBOA 5BSMA 3ZXYA 5I7EA 1EGQA 4FHEA 2CE2X 3ODGA 3DE4X 4EUHA 1VKZA 4MEAA 5DGAA 2IL1A 4NHEA 3VUFA 3B2EA 3RBXA 3HB9A 1SCNE 4BO4A 1DGSA 1U9YA 3H2GA 5FFMA 4ZFNA 9ICHA 1J0DA 1FDUA 2YC2C 4UBKA 1K88A 3I9V1 4CKWB 4YQYA 3CX8A 1P60A 3UK1A 3NRCA 2M32A 3SJAA 3EPGA 1P61B 2P41A 1Q0TA 2A4KA 1XNQB 3FTFA 2X14A 3A2NA 1D09A 1JHXA 5IJ0B 3L06A 3ZWPA 1U5BB 2Y4OA 4JB8A 2RGUA 4UAYA 1Z5UA 3FKJA 2YZ7A 5DEIA 3LZCA 1CU1A 4MYCA 2GTHA 2XNJA 3T3GA 5EJFA 2CPRA 4BLRA 4DCNA 2ZIZA 4WD3A 2F1RA 1HRDA 2ZSJA 1SOVA 4HQNA 2C5BA 2QUHA 2L42A 4BKQA 1JR3D 2I7XA 2BTQA 4B9LA 3LYSA 4W5WA 3TDMA 4FS1A 3ZLBA 4AKGA 4E3ZA 2C2MA 2LIVA 4R3NA 4TTIA 3U7JA 4ARZB 4B76A 4WZAB 2PZAA 1AF4A 4YT2A 1KOJA 4PGGA 3TRFA 1BXRA 3ZNPA 4RGYA 1NLZA 5TC4A 5K6RA 4F9TA 2Y76A 7ICJA 1BSVA 4QNLA 5BN1A 1BA2A 3L41A 3CF0A 5JSHA 1P3DA 1JDSA 1VPLA 3CNNA 3G2HA 1G5PA 3ZPXA 1LJUA 3WK8A 4Q1DA 3MS4A 4GQAA 3O31A 4KQ6A 2M0NA 4DL4A 1YULA 2OHJA 2RKWA 3Q8KA 3E1SA 3DOJA 8ICLA 2B4AA 2WYWA 1J39A 1WIWA 4GXKA 4F2GA 4RPXA 3HN6A 1TPZA 3INGA 2GZDA 1THZA 4HQLA 3GHYA 1JX6A 2P11A 2YUIA 3V6MA 3WU2U 2P4EA 3N2GB 1FXUA 3AQFA 1M0SA 3ONWA 5E8RA 2BHNA 3S27A 4DA6A 4MJXA 4Z4IA 3BF8A 2PL3A 3VAAA 2F8SA 5IDQA 1YOVA 5D3MB 2QQ5A 3AFGA 4PFJA 4IXDA 3JY6A 2VJBA 5SZHB 4V3CA 1DKMA 3TLZA 3UAYA 1ZHFA 1QQAA 2IDMA 2VPWA 4LY9A 4B9UA 1NJZA 3TTWA 1ZQPA 5FDFA 1ULZA 5JATA 1P1KA 1RR6A 1YONA 2PE5A 2QDKA 3L40A 2Z9BA 4YJ2F 3DOIA 3ZHXA 1H8ED 3RJTA 1G4AE 1L5WA 3UK7A 5FH9A 2RAUA 1QU3A 2ZJOA 2UYQA 3IT2A 3CZMA 4H7HA 5EY5B 1UKEA 5WRFA 5ITSA 3ZWXA 2P0EA 3W5UA 1NG1A 2DFPA 4H1WA 2VP5A 2HYDA 1KTVA 2RHRA 3ZK9A 1NOMA 4A2QA 3C7KA 1X1BA 4HB2A 4BRZA 5ALPA 1UZLA 2BKAA 2Y1DA 3K1AB 1OAOA 2QL6A 3LLUA 3U4QA 4TN1A 4J1SA 5J0TA 5CYGA 4S12A 4HVLA 1WDWB 1Y7TA 3Q3VA 2C5EA 1N8NA 3DV2A 3AF3A 1I2AA 1ZM3A 4MQLA 1KWKA 1MQ8B 4YO8A 1ECCA 2AH5A 3KYIB 4WVFA 1IQRA 2HQSA 2R66A 4WFIA 1Q0RA 1UHUA 4WZAE 4YJHA 16PKA 3V42A 2GBFA 1LRLA 3D8RA 2OORA 3F0TA 4KE7A 4XM2A 4YO7A 3PQDA 5C32A 5CITA 3DVQX 2C7OA 1ODIA 3E35A 2RGYA 2Y3IA 2YY5A 2Z2IA 1O0SA 4NENA 5ALNA 1IM2A 1C9DB 2ZIWA 4QWAA 1UBKS 1HT3A 1WVMA 2VYNA 2P8SA 2XNSA 1MG0A 2ZXEA 3E03A 3MT0A 4MINA 3IIMA 1II9A 2X41A 3T8YA 2PSEA 4LV8B 2YJGA 4BWMA 4XPZA 2IYAA 4HPJB 2WE8A 1AS3A 3MR5A 3FPKA 3SYKA 4YRSA 2HREA 3FKSD 3UJ3X 2ZU0C 3MN1A 2XC9A 2Q41A 3BB1A 4QPDA 4IHKA 3IQXA 3WDSA 1RZVA 3UAWA 3PC6A 1IATA 4XIIA 1ZGJA 4F5NA 4NZ9A 1JHUA 1O58A 1R4AA 5HFAA 2C94A 4C4RA 2PKRA 4I2VA 2XRMA 3KPWA 4MWBA 4DUZB 2O0JA 5I9IA 4KIUA 3TTUA 3ZV7A 2A5YB 2WJAA 3DMRA 3CLSD 4XIYA 3EGDB 3MWLA 1E3LA 1RM3A 3G68A 2IU3A 5JCJA 4X93A 4GVXA 2EANA 4FE3A 2OGWA 1T4CB 3TDKA 2AQ0A 1QK4A 3TAXA 3TOZA 3DDHA 3NHMA 1FYWA 1G21B 2RGRA 4URWR 1DO2A 1NOIA 1DTWA 1ZH4A 2GS9A 1KI1A 3S68A 2W37A 3AF0A 4EFDA 4OJ5A 1VKRA 1YZ6A 4HZGA 1OB2A 1K92A 4YXWD 1RAHA 3FYTA 2P9GA 1LPBB 4TQ9A 5DBAA 1DT3A 2V6JA 4ED8A 3EODA 4U7HA 5JEEA 1Y3HA 1EJ2A 3KOYA 5INTA 2QE7A 1XIVA 3U56A 1QOPB 4PYLA 2HK9A 3TSCA 5JNSA 4LRXA 4ENTA 4KLCA 2Y99A 5I4KA 2GYYA 2H4ZA 3EDMA 3PNPA 4OHRA 2GVDC 1QVWA 3GAAA 3GRAA 5F78A 4O4HF 3F5SA 3TANA 1LPMA 3AU8A 3DBHA 3A6GA 4DEVA 3B12A 5DHFA 1E9RA 1OWNA 4XRRA 1WX1A 2GEVA 2ILTA 3OWOA 3WNCA 2N1BA 2BZGA 2V4MA 2I7CA 1IWPB 3W5CA 3R7SA 2VHYA 1CUUA 5GM1A 1WMBA 1GRVA 3H3FA 1IHUA 3FSEA 1BVSA 1HGXA 3MTDA 4DCJA 2XKKA 2R751 4JI7B 2BKEA 3JAKB 1Y3FE 3G6VA 1JJIA 2BEUA 4IXNA 2A5FA 2WB1C 2ADOA 4OB7A 3ZS8A 4CUZA 1FBTA 4TXNA 1VYHA 2P67A 1LBSA 1LDYA 4G4IA 4BOYA 4CIYA 1XKLA 4EJ0A 3LXMA 3GU3A 1L7EA 4IBOA 5E7MA 2AFHB 4TVKA 4NOLA 3ICXA 3OOWA 4QQKA 4PPXA 5DM0A 2AS0A 4YJGB 4MUGA 1WLSA 1HE1C 3GO4A 3OU6A 2XZTA 4TS3A 1XS9D 1EFRA 2PK3A 3EUFA 2PIDA 1BE1A 4I1PA 1KGSA 1W5AA 1BPZA 1YI8A 2PEZA 4TMYA 5FBQB 3U4AA 4EPRA 3I6BA 4PLHA 2OQVA 3TO5A 3G9TA 2EX1A 3BS7A 2I66A 3K15A 5IUNC 2HNAA 2X7HA 3LWBA 3MZ0A 1U2GA 3LBHA 3RG2A 3DDUA 1Y9DA 5E7JA 5JPCA 2UUCB 1W1WA 4D0NA 1T3GA 3ZDQA 3ZQ4A 2NSLA 4GXNA 3VNVA 4LQLA 3KG2A 1WXFA 2LPMA 3HADA 3OCXA 4I2CA 5KTRA 4JGBA 3DL7A 4BCCA 2L82A 2GO1A 1QNFA 4QL3A 1S3GA 1V37A 4JGIA 5F5LA 5H7XA 5CG1A 1SJ9A 3F90A 3SQWA 3L4KA 4G0XA 2EFDB 3JQPA 3N2IA 3TLGB 2YY7A 1E2KA 4O3MA 1FFUA 1MC8A 1JB9A 2AQIA 4L15A 4H31A 4A1FA 3ZHRA 2BAGA 2XB2A 5SYMA 2HCRA 4L5BA 5J29A 2GN9A 3FAHA 4OGLA 5AXDA 4AYBF 4ESVA 1DRVA 3BBLA 3LQRA 5E3IA 2GI4A 1EWTA 1ZESA 3D02A 4MW5A 1FJ2A 2RJOA 5KG1A 3WV5A 3TKYA 3RANA 1J2UA 2QS9A 1JNXX 5EQJB 2YZGA 4H1VA 4WLFA 3KKEA 3NC4A 1L8AA 3WXBA 1Z0UA 2IKSA 4O2AF 3UOAB 5KSOA 4FOOA 1UXJA 4RTQA 1VB5A 2DFKB 4ITUA 2EH9A 1RFGE 2XCSB 3RH0A 2UUOA 5C8DA 1ZW1A 4PXYA 2BZ0A 4B6RA 3UWMA 1KI6A 4C7KA 2APJA 2ZTCA 1XZQA 4F96A 1U90A 5BPCA 2JBAA 3RU2A 2ZTLA 1EM8B 3G0GA 2BN4A 2BRUC 1QCYA 3RFTA 2A0UA 4CJXA 2PPLA 2W5UA 3HHEA 3L5OA 2BH9A 1Z63A 2CNBA 1JIVA 3B1YA 3N0TA 4GKKB 1DKUA 1Q7BA 3INNA 1G9SA 2J3KA 3E48A 2QTAA 5CFPA 5KT2A 2P2GA 2BUBA 3NP7A 3DMDA 1ZC4A 3VJKA 1JJVA 3DHYA 3FTCA 3A9UA 2HW3A 3U3MA 3UHAA 3HN2A 4NZZA 3PPVA 4K2HA 1CUVA 1ZJWA 4CV1A 4JP3A 4RPLA 1YKFA 3BRWA 2C95A 3A25A 3M2PA 3P9NA 2QRZA 1ECJA 3CZCA 4JR1A 4X8OA 5IVIA 3A9TA 4MRRA 1ELOA 4K8RB 4PO9A 2WFZA 3LYLA 2QVXX 5AHKA 1WWVA 2FPXA 2QJOA 2H2WA 5KG3A 1MEEA 1XAHA 2J46A 5DG9A 3K8YA 4FYIA 4KR7A 3D6VA 4DOCA 2ZXFA 3BQTA 2RDMA 2FPKA 4YXFA 3BUSA 3FUVA 3USES 3ON5A 1BAPA 2QD3A 3E70C 1U94A 5KPJA 2BEWA 4JS0A 3NDPA 1EFPA 3U26A 1RKUA 1U65A 2EKBA 1EX7A 4KX5A 3OG9A 4UNPA 2KMLA 1RYHA 3ROXA 1L7PA 3F5AA 2GJ8A 2PU5A 3TI9A 5D3QA 4B3DA 2IPMA 1E79D 2QMYA 3KVNA 2WD7A 4RMGA 4UVHA 3RSGA 5EC8A 4UDNA 3A1UA 2CVHA 1PJBA 3RB0A 2OEHA 1MOZA 4G5RA 1G8GA 5KWVA 5HHIA 1NR5A 4C5BA 5IKOA 4UEJA 2QN7A 1V35A 5I7VA 1GZ7A 2FGKA 2OQIA 3N76A 2Q8QA 5CLLA 3CVYA 3UWPA 3L79A 3ZEAA 2FQQA 3GGSA 4K88A 3SWWA 3K3PA 1O9GA 4QLOA 3C3BA 2DSNA 2I2DA 3K0FA 1P91A 1NJSA 4FOSA 2C0PA 2N3ZA 1TK9A 2Y0PA 1KARA 2ZS7A 4Q6BA 2E6UX 1VMEA 3R7BA 1SOWA 1T3ZA 3KQPA 3OMXA 3PB3A 4G5XA 3VYSB 1O6BA 3QLEA 4RUKA 1DIBA 3SEQA 2AZMA 5BMVB 1MBZA 3T3NA 3UWOA 4NC9A 4JI4B 1J49A 3CT4A 4DOAA 1P1HA 1SGWA 1QFYA 2BUAA 3V8EA 1Z39A 3QPVA 4IIDA 2LBOA 4EJSC 4Q8FA 1NRXA 4EBDA 1AA9A 1SCUB 2J7PA 3K1AA 4FUQA 3KZXA 2A9FA 3DAPA 4EQ6B 1Q1EA 1DTWB 1N78A 1K6JA 1LBIA 4QG7A 1EUZA 4NI5A 3VPBA 4C1BA 2IFTA 2YYYA 1RI4A 4G5YA 4J49A 1YQEA 2CEKA 5MN5A 1KEUA 1X15A 3RVMA 3WL6A 4N82A 2FWIA 1C1XB 4AJNA 1JKXA 4W8GA 5EJMA 1IBMB 1K86A 4KMOB 1C0EA 1G8FA 3EWAA 3HU2A 1J7JA 1SZHA 3RF9A 4V3BA 5B5SA 2O14A 1DPFA 1XMQB 3ACBA 2AZTA 1RJ9A 1CZRA 1T24A 1Z25A 3HG7A 3AEKB 3KZKA 3QY9A 4FDTA 1HOXA 4PAGA 4ZOLB 2W6JA 4X7MA 1SK8A 3RI3A 2A94A 5JO0A 4URFA 4DYDA 3HCRA 1R74A 4OFBA 2NVWA 5F33A 2ROQA 3T1VA 3W5SA 3A3KA 4IM7A 2BGTA 2C5SA 2XZDA 5EL0A 1KDYA 4UBBA 1E89A 2C4HA 4RMIA 3Q3HA 5H80A 4M4SA 5C8YB 2BHTA 2A92A 1NMXA 2AOVA 3W2FA 4WFJA 1XD2B 3UT5B 3A04A 4DGQA 3QPUA 2R97A 1KQPA 5AD1A 3PL1A 3TRKA 3HACA 3RJKA 4Q7LA 4MHOA 1ITZA 5AH0A 2HIMA 2QD5A 5F3DA 5B36A 1WD7A 2V6IA 3UMYA 3EC7A 3SS7X 2ZIWB 4RQ6A 1E7RA 1KNXA 1ZYQA 1SQ0A 1S8FA 2AJ8A 3K2IA 1KRHA 3NEYA 3PGKA 1CB0A 2FUG6 6YASA 2QV7A 4NL9C 2X9GA 4GPEA 2ZSUA 3UJ6A 4LEIA 3TW6A 4JUBA 3EG5A 3F7NA 1SKQA 1SVSA 3I32A 1G7RA 1RIFA 4RDHA 3SXUB 4CLEA 2CLEB 3GX1A 3OCVA 3P9RA 2XOXA 4ZI3A 4TMFA 3TG2A 1UOQA 2QQEA 4MQ4A 4PAWA 1R8SA 4FBTA 4BB6A 3KKAC 4DJTA 4EEXA 1ADCA 1IN4A 2ZW9A 3H9JA 4CKXA 4UB6U 3W3AD 2V03A 1N33B 1KRWA 1Z5OA 3LBIA 5DGBA 1FRQA 2GESA 1X1QA 3DUFB 2N42A 4HSEA 3F47A 3NP9A 4MWTA 2XY6A 2VA3A 2JH7A 2OHVA 5K0EA 1X7DA 1PRYA 4Q8EA 1Y80A 3DEZA 1E1NA 2P7IA 3BJRA 3EGDA 4TS9A 3FM9A 2C8LA 2OESA 2WJIA 3CX6A 3DJYA 4HMOA 4R8MA 4ZVQA 4BVGA 4EYSA 1SKYE 1QCDA 5BPHA 2G5PA 5IM4F 1CB7A 4Q9LA 1NLUA 1Z17A 3NI2A 4JC5A 4NPHA 4DWIA 1TM2A 5GZ6A 4XD7A 5HQ3A 2RHLA 2WTAA 1HUZA 3FCSB 4NCIA 1OLOA 2K7ZA 2PWAA 2NN3C 4MQMA 2PFQA 4Q3EA 3JZDA 3WWZA 3K70B 1SMKA 4TROA 4BXOA 4AJ9A 4ENRA 3R74A 1ZQWA 3NDJA 4YAJA 2VANA 3HUDA 2FU5C 3WX0A 3UB3A 5C52B 4LC1A 3GDWA 1OWOA 2YXLA 4NLZA 2A6PA 1K1EA 3O4IA 4K8OA 3SC6A 2EFCB 4F4HA 4RJTA 2GDJA 2EWVA 2KSOB 3SHVA 1CQIB 1MC4A 1Q0SA 2VSQA 3REQB 1W30A 4XWYA 3IQFA 4F9EA 5CR0A 1GAQA 4EB6B 3ZOKA 1WHSB 4KGVA 1HQYE 3JWJA 3NUGA 1J8QA 1BMDA 2GYUA 4EW1A 2K89A 1Y3IA 1AQJA 1UPAA 4HRXA 1K98A 3PTLA 3EVAA 1Z1VA 9ICAA 3GRYA 3KQMA 4UEQA 4Y7DA 4BQEA 5LSAA 2D6FA 1IBCA 4KPUB 2V8OA 4PYQA 3UQYS 5IXYA 3DL4A 4ZO8A 5DKFA 4EFNA 5JDIC 1SKWA 2NO4A 4LBYA 4CVNA 4GYYA 1D4AA 3GR6A 3H97A 4R8VA 2FSFA 2W6NA 4PCVA 4LDNA 3WB2A 2WD8A 3T9CA 1MW8X 3REFA 4WOKA 3PLNA 4B17A 5C37A 5JTIA 2PMDA 1VL1A 4QBIA 4BNHA 2JAOA 3MR2A 1Y1TA 8ICTA 2OHFA 5CDFA 2BQUA 1FSZA 2O8NA 1K97A 4L6CA 4XPIA 4C6HA 2R1TB 5JD5A 2YOFA 1ID8A 2DH6A 5LC1A 1FQOA 2XOKA 2GZMA 1JLSA 3DPIA 4HEA1 2G09A 5BV2P 1HV8A 1MAWA 1W5FA 2Q6OA 3B5JA 3E7FA 3I2FA 1CUZA 1RQGA 3KTDA 4D3ZA 5AW7A 4L3WA 5HBGA 2QK4A 2KG5A 4IDDA 4Q37A 1GV1A 1C9NA 2F59A 1VBKA 4YQWA 2FJUA 5FPQA 4N0PA 1DDIA 5IJWA 5J0PA 1UPUA 1VCNA 4KNVA 5FO1A 5TNXA 2GPTA 5CDTA 4PO3X 3KKNA 2E5LB 3LO8A 2AMLA 3HXMA 4TLAA 4ZAFA 1I3CA 3GEHA 4QXPA 3TUJC 2QX8A 3BMOA 1DJQA 3RVLA 5ICEA 5G3ZA 4LGYA 4IX1A 5BYAA 1JEYA 3UW3A 3IALA 2XT9A 1VMIA 1EVKA 4A6XA 3R7LA 3UPUA 1UT5A 2PKQO 2WFLB 1T8YA 2VZEA 3OGUA 1L7AA 2WTXA 1J5XA 3RFUA 4IHAA 5FWXB 2NRTA 2WWRA 4JBLA 3TE6A 4FD2A 3ANLA 2W6ZA 3KOUA 2CVPA 2ZSEA 3SJBA 4X5VA 1Y1LA 4TSFA 4ARBA 2KEYA 3Q8RB 1J8FA 2YWDA 4XGNA 2RHDA 2BGMA 5JH7A 4BRWA 3C2KA 4MCJA 3L8YA 2FQ1A 4HVCA 3FF1A 2NUAA 7ICLA 1P45A 1PL7A 2ZTVA 1M7HA 2GM3A 4WFKA 1XJWA 5D2CA 2NYRA 3VR2A 2HQOA 3PF8A 1C7JA 2B7BA 2ZI5A 2ZSBA 3UCEA 3B6KA 1YXMA 1VJDA 1QJ4A 5L45A 1YR7A 1PU2A 3FNEA 3OIUA 4Y9SA 4QXOA 4NLKA 1P5JA 1FOEB 1UXIA 3DOCA 4ED2A 3BOSA 1XMVA 3N0WA 2P62A 1YJAA 3ELUA 1U98A 1I01A 3ZE9A 2YB1A 3LOQA 5HK8A 3D6JA 5IDVA 4L5JA 3E7DA 7ICHA 3SE0A 4F2PA 3C8HA 3PE3A 1Z13A 3FDSA 3OZUA 1ZQSA 3G1UA 4R1SA 4XGKA 4AROA 4P22A 1HQCA 1V26A 2UUPA 3DVAB 3L8GA 2QRQA 4WY2A 4DLRA 4U3JB 5JC8A 3GMIA 1TF2A 5CB6A 5L3QA 3U60B 1G4HA 1ONOA 3GCXA 3P97A 4GPD1 4RV5A 2EXXA 1VIDA 3LT2A 5CHGA 1UWLA 2B78A 2CVFA 2HHCA 3PHGA 3UUFA 3W7AA 4AKSA 4LJ7A 1JXMA 4KWIA 1PZMA 2TECE 4D5GA 4FXOA 3AIMA 1MLDA 3EA4A 5A0FA 2JAWA 1BS1A 2P5SA 4KV7A 3TAPA 2QPOA 3VR4D 1ZIYA 1V85A 8GPBA 5HPYB 3AI3A 2AFIA 2ZS8A 3E2IA 4DIUA 4HNAB 3RBAA 1Y5RA 2JCBA 1J99A 4KQ2A 4BO7A 1HFJA 1UBHS 1K8ZB 5HRCA 2YW9A 2BGGA 9ICLA 2AKAB 2B36A 2CSUA 4OHWA 1Y7HA 3DEHA 5KQRA 3EZYA 2IZ5A 5AVVA 3JQRA 4B40A 5AM5A 5JANA 3B5IA 1P2SA 3HC7A 3WP1B 1LPPA 3NV9A 3LC2O 4HTFA 1ODKA 4FQ7A 3MR6A 5LA6B 4CKYA 2WQ7A 4DF8A 1MQ3A 3JV7A 1CSEE 1DDGA 2ZRPA 4Z53A 5BRAA 4IR9A 2HK6A 2WMDA 1IZ9A 1OLUB 1WV0A 5ECDA 4DEYA 1WU8A 4MHTA 3BGIA 1D9FA 1F6BA 1FYVA 1U8XX 2PX8A 5E38A 5EIXA 4D3YA 3K70D 3QOYA 5JFTA 1Y7LA 3ZBTA 4IS7A 2NQ8A 2YOHA 1SCDA 1U6JA 3DWGA 4RDCA 4BLVA 4X1IB 3OZTA 3AM5A 2XKAA 2DXIA 1CKEA 4H6XA 1MB0A 2E4YA 3NQ41 2ZJFA 1ULSA 4OBEA 4NXMB 1GYRA 2E1PA 3NIBA 3Q8MA 4C7YA 4I5FA 4PLYA 4F0JA 2EBFX 3FGOA 3N8NA 4BFYA 1F7VA 2Q5JA 2WHQA 3K70C 5A9SA 1P7VA 2QE6A 1UPXA 5JMWA 4X62B 1CRPA 1C8LA 2IYUA 4KQCA 3S3TA 5TT0A 3W78A 4I6EA 1V1MA 1M1NB 2HL6A 1R0RE 1G64A 2FN9A 3SM9A 4X1YB 5BY2A 1Q6ZA 2OORC 2GAOA 3FPSA 4JVLA 4ENVA 1Q0PA 2HXSA 4L0QA 1X7YA 2QVCA 4RH3A 4BNLA 4BNDA 5EJ9A 5FWYA 1NI5A 2C98A 1S8AA 3AB8A 4Z4GA 4HP8A 1LDNA 3TACB 2XDYA 1RYSA 2W2TA 2H3EA 3D0OA 3ILSA 2WV9A 3CX4A 3LDHA 1P2UA 3PSTA 2MHCA 1ZY2A 2BR4A 1O5OA 2ZYIA 3HJGA 3PA8A 5LYYA 2MA1A 3S2YA 3UJPA 2E4UA 3RUHA 4D6YA 3NHUA 1BXGA 1UEXC 4KR6A 2V4RA 2BEKA 2K4EA 3K0AA 3ZHUA 4D9EA 4YAEA 4OJYA 5IINA 4FHGA 3GK3A 4K9KA 1D1SA 2FZVA 2HWYA 4XZ3A 1LA2A 3MWJA 1U0OC 3B5EA 3V1NA 2D00A 4KLIA 4WN9A 1JLLB 3NT5A 4OQMA 1L3UA 2OKCA 2OOKA 4GM1A 1T43A 2ZE5A 3OFJA 4I81A 4FFRA 4IH1A 4O4LA 2OHXA 3Q3EA 5TPWA 2ZAIA 1AGXA 2JFUA 4DJAA 1BWSA 5CFRA 5DNUA 5ADHA 1XDDA 2XVAA 4DV2B 2AJLI 4C4TA 2PKWA 3IAM6 2OCIA 4PXAA 1VYTA 3PJEA 4MICA 5DCWA 5DNVA 4RSRA 2KW5A 1B00A 2G9RA 5A9SB 1V8OA 1NHGA 1ZKMA 4YMVA 1IXYA 2B9VA 3IPXA 5CLIA 1A9SA 1KMQA 1LS1A 1NVKA 3H2BA 3IKMB 2HMXA 3NGMA 5EUQB 3LDAA 4LMRA 1V4BA 4HFRA 1DE0A 1J2MA 2XKBA 1GGNA 1OBFO 4F3OA 1IZYA 3GJ0A 3I9JA 2HQBA 3EHDA 3K16A 4MVJH 2D0IA 3JYOA 1G21E 5CVVA 3SP1A 2HEGA 4YP1A 1MR3F 1PVPA 4Y2PA 2OP1A 3OA2A 4S1WA 5PGMA 1CEQA 3AOEA 3C3CA 3EGIA 3GRUA 4IS3A 5FB3A 1ZIXA 3UH0A 2B4QA 3HDQA 5JJIA 4J7UA 4OUKX 2D2IA 4PR3A 4J0HA 3WP0A 1LZKA 2VJKA 3BA1A 2LVBA 2NO1A 1B4FA 1PK8A 2VAPA 3ESXA 3HFGA 3IJEB 1DBQA 3RJZA 4FTWA 3HVHA 1KO5A 5B2EA 4OBWA 3ZV4A 2BTEA 3TTVA 5MF6A 1KC3A 3A0HU 4KN9S 1ZMRA 4KXWA 2EJWA 5IVKA 4WK0B 3VO1A 1G7SA 1UMCA 3H8WA 1E2MA 4RZXA 2NU8B 4KQMA 2YWEA 4MVJD 1N0WA 1GUYA 3RS3A 4NR0A 3TQQA 5AJWA 1YR8A 3KUCA 1KHTA 1POWA 3RBZA 5KTOA 3SVTA 1YGPA 3OD1A 4NCNA 1FX1A 2EF0A 4TXHA 3KFVA 3RODA 4B2LA 5J43A 1KAQA 3A6JA 1TKAA 3O75A 3HI6A 5DM2A 5FBKA 1JH8A 2WP0A 5KT3A 4U39A 4M83A 3T34A 3E2MA 3G02A 1PFGA 3ADOA 3PRJA 1QR6A 1SKBA 2RD2A 4RKYA 3GJ6A 1MW9X 4JEUA 3N2ZB 4AQDA 4H0CA 1UAGA 4YAFA 3T5MA 4DPMA 2HA7A 5IAOA 2DH5A 2PLNA 3EQ6A 4XFJA 5DN9A 1KYWA 1PJSA 1VP9A 2O3RA 5DDIP 4FDMA 1USKA 1P2DA 1X1TA 2H3ZA 1ZQUA 2ZJ4A 5ALXA 2XGMA 3L0BA 1DEOA 4KMMA 3VCBA 2JA2A 2NXWA 3MT7A 4GE0A 4L7VA 4JLUA 3V3TA 4EDFA 2BDPA 2DJ5A 4EVQA 4NBNA 3B2NA 2R7MA 2PWPA 1D8YA 5D5PA 1UAYA 1NF8A 1QHSA 4JVOA 4BKRA 1DAOA 4YAWA 3KZ1E 4GP9A 2J3EA 1FFHA 2ZWIA 2NPIA 4JUCA 3QFHA 4PYMA 5HZKA 3IRVA 3W4IA 1JS1X 1SC6A 1MENA 2CY0A 2IYZA 3G88A 2CLMB 4TOIA 3RLIA 4ND8B 1JMVA 7MHTA 1HE8B 3CVOA 5I7HA 4AKHA 2E2WA 3IQEA 2GAJA 4NLLA 4X85A 4CFSA 4Z1OA 2VH1A 4Z1MA 2ERXA 5LXTA 2PH5A 4NV0A 2Q2VA 4OKNA 3OA0A 2Z3WA 1ZQDA 4B9TA 3OQIB 4PZEA 2NRVA 2ILVA 1XEFA 3AG6A 2R48A 1G20A 3MINA 2RBEA 4KPUA 4MGKR 2FPWA 2G4CA 5AJYA 5EWJA 2OPHA 2WWXA 3FZQA 4G8DA 3VHXB 3RAPR 1NAIA 1SEPA 3I6MA 1I1OA 2BEJA 1I5RA 2E1FA 2PQMA 4EUEA 4FX2A 3KZIU 4KBYA 3KB8A 1QZZA 3DC7A 4HNQA 1O95D 4BLPA 4E21A 1ZJ5A 2WIFA 2YXEA 3H4DA 4PC6A 4ZI5A 2HFKA 2KVCA 2PGAA 1L5GB 1NBMD 1O97C 3A31A 4LNHA 5J0UA 5F77A 4PZCA 3GQBB 3KJHA 4CLRB 5B64A 2NT4A 3RB4A 4X66B 1F2UA 3DTTA 3HA2A 3QFFA 1MMFB 3NTQA 1KQGA 1AXEA 2D1RA 1DO8A 4NM2A 4GM0A 5CUQA 5EJ6A 1PVOA 1VSBA 1D1QA 4HL6A 3TLYA 4H7FA 5M2QA 2QBYB 2XUAA 4MROA 3ZDBA 2DF8A 2BFAA 2GUGA 3LVWA 2J48A 1E18A 4IG9A 4XWGA 1KSHA 2PMZF 3D7RA 1IIPA 4Q4JB 1NQXA 4J43A 3UC5A 4O3OA 1EG2A 3ZWMA 1WPXA 3GUZA 4OUDA 1N6HA 2I76A 1MX5A 2R7AA 1SA0B 5T4BA 4E0DA 1FYFA 4R2HA 3W4KA 1ZH0A 3F96A 5KQGA 1L4LA 2HRDA 4WLOA 1OTXA 2IIPA 2ODWA 3EMDA 3A1VA 4WJZA 4CV3A 3ND7A 3GLHB 3EZNA 4MJLA 4CFZA 3PNMA 3O1LA 4URZR 5FUXA 3L1JA 1YZ3A 4A8JC 1AQLA 1TVEA 1FRVA 1PAUA 1V7ZA 3H9BA 2CDBA 4LE1A 4X60A 3ZDYB 5EIHA 3MVEA 1KFKB 1VLHA 2HA3A 3BRCA 3QW4B 4WNCA 5CEEA 4BEBA 1XZGA 2QAGC 3B3JA 1KI3A 1KYZA 5G0WA 1GA1A 4L5CA 4RF4A 2I91A 4R8UA 1E9SA 5MFZA 2CNNA 1NK7A 3MBYA 1S3FA 3OCYA 3RUEA 4R71A 4F4IA 1KHHA 2DCUA 1KO8A 2JKZA 4KWHA 1SXJC 2BJWA 1C9YA 1V6SA 1X39A 4O4JA 4FZ5A 4GXTA 2QXUA 4ZU6X 5ADWA 2Q1SA 2O54A 2PZMA 2QRLA 3SIXA 4JEHA 5E79U 1M2VA 1ZIPA 4YJ3A 4XYLA 1YJBA 4UB4A 4IUYA 4IZHA 2JJ2A 3VR1A 1YF3A 1PDOA 4KDEA 4MUIA 5TGZA 4ECAA 5LZ5A 4B6EA 1N2IA 1RZUA 2K60A 1GN8A 4YJ3B 1ZQQA 1M9NA 2JH8A 2I78A 2B4KA 2VPXA 5KNIA 3AUFA 3ORYA 4M2YA 4PX3A 2BCEA 4YPVA 1VIAA 1DC6A 1CUJA 2N75A 2OV3A 4IAOA 1NSYA 4N18A 4OKIA 3SC4A 4FZMA 4F91B 1QIJA 4EITA 1H2AS 4LZPA 3I92A 3ISTA 4ZDWA 5AKIA 1C3OA 1FFSA 1GRCA 2YN0A 3DAGA 1J33A 2PQ0A 3RU9A 2VDOB 4Y6SA 1PWHA 1TAUA 4GYWA 1B0PA 2DPXA 3X3HA 3F1LA 4IIBA 4ZYVA 1NZDA 5FAKA 4AUEA 3ZWDA 1L3BA 3ZWKA 3FHCB 3ETLA 2Q5FA 3QOFA 5H9VA 3C3EA 4DV4B 1GG8A 3FNHA 3MWEB 4G09A 4BLQA 2C29D 2VT3A 1XNJA 2DT5A 1DHTA 4GOXA 4HN4B 4UBCA 2XD4A 3QVOA 1R0KA 4OYHA 2P3OA 5AK0A 3B7WA 4WXPA 1JAXA 1YBMA 5EPEA 1JFTA 3AEKA 3E8MA 3GLHA 3WK6A 1NXOA 1Q3UA 4DQPA 1LU9A 2GBIA 1VJGA 2BFEA 2Z3VA 2ZWMA 3B9QA 2VA2A 3ECSA 4HLDA 3IKVA 2HV9A 1BDHA 4RD4A 2AV6A 3U4CA 3AG5A 2B92A 3HSYA 3L6UA 4KMOA 4I1OA 4AC9A 1EBUA 2WZQA 3GCGA 4BKPA 2DUYA 3O8OA 1ZVJA 3PNBA 3EGXB 3N0VA 5SZJA 4DT1B 5K8TA 4HYQA 4MUYA 1MA3A 4QUDA 1C0IA 2B69A 3BMXA 4EAAA 3DVSX 3V7JA 1G19A 4OJOA 2QGFA 2NUPA 2XYGA 1G8JA 2Y1KA 3AV0B 3DF7A 3P2MA 5CX1B 3KQQA 3RRNA 5FYDA 3SIRA 3GNLA 2P1ZA 3AEQB 3VAZA 2P4SA 1R9JA 3IO3A 1PL0A 1OFUX 4PL2A 1GT6A 3NM6B 3VKFA 1T15A 5K8CA 4F3YA 1Q1ZA 1VLBA 3DBLB 3SHTA 5K0FA 2F43A 2M9NA 1HJPA 2BSXA 1MTOA 2PXCA 4EG3A 1NZPA 2F4NA 2ZTDA 4F92B 3RIGA 3MUOA 1XRLA 1N5XA 3GLUA 3K9WA 5HF5A 3LT0A 5CXUA 3MEQA 4KLSA 2WEKA 1W2GA 4BMNA 3TSZA 4CM6A 1LC3A 3NYIA 4ZZIA 1VRWA 3EXFB 3Q72A 1A7UA 3G2IA 5IFLA 1FW6A 4ACBA 2L2QA 5HKOA 2VEDA 4DPLA 4MVJA 1GG2A 1WZ2A 1CEXA 4C7XA 4JYMA 2RKOA 1Q7EA 5F7XA 1EFVA 2NSYA 2DQKA 2J5BA 3D7LA 3UAOA 3T94A 2WTBA 2DR2A 4EHKA 2DKZA 1TZJA 4EY8A 5AVRA 1JE0A 4EY6A 3EY4A 3EX7C 2W2OA 5DN6A 2P78A 1DG9A 1C7QA 3PR3A 2A3RA 3UH1A 2CUTA 3CZAA 2AKEA 2AXTU 1K2WA 4L6IA 2VAWA 2I3AA 3CB4A 1ZINA 2XV1A 1N2GA 3CT6A 7AT1A 2H0QA 2QJWA 3H1AA 3Q8QB 3TGPA 1CJCA 4DIFA 5EE1A 1JA1A 4YI5A 2YJZA 4FUTA 1RRVA 4RHYA 5ERYA 4WSOA 1BQEA 3K0AB 4AXXA 1ZQIA 1ICEA 1QZUA 2IVFA 2VJMB 3ESDA 3Q85A 4M1WA 5TB5A 4BHTA 4HNUA 2X2EA 1B14A 4Q12A 4UBMA 3KKAA 3OZAA 1F0KA 1GZ6A 2WYUA 1G60A 3HYCA 5B3LA 3VR0A 1U1FA 4YP3A 3ROEA 3I5XA 5FTNA 3JQ8A 3VH3A 2NQ2C 4RDXA 5JTTA 3IBYA 3HCOA 1T8SA 3NOVA 1OFGA 1RWOA 3K6JA 2YJ6A 4IMPA 4IRCA 4Y1RA 2OA0A 3WL8A 5EZQA 4RZSA 1UL1X 2J4CA 2F17A 3SNHA 4Q4DA 4IDCA 5F7OA 1RAFA 5FPHA 3RH5A 4AAYA 4LXYA 4L1KA 1XI2A 2HDNB 1VA4A 4ZI7F 5K4HA 4LJAA 2C5FA 2EDCA 1D7AA 2WILA 2H63A 4K03A 3BZCA 3DZKA 3I1FA 1FDWA 4BQSA 3U48A 2MSEB 4GO1A 4Y1GA 1NJ8A 4FYWA 4P31A 5EHNA 1IOVA 2QYTA 5FOTA 1WWUA 3BTSA 3N0RA 3H4TA 3QEKA 4DRXA 1G5HA 3R44A 1WSWA 4JBYA 3ZIDA 3R1IA 2BDTA 4J9VA 5AVJA 3H5OA 3SHFA 4OLAA 5I47A 2H1IA 1CJVC 4QX6A 5LP6C 2KZMA 4U7FA 1LVHA 4JVSB 2CE7A 1R5NA 1JG2A 3BGVA 4POAA 4YC7A 5FO0A 4A73A 3ZCRA 5KG7A 1IY2A 4R6WA 2YHBA 4I0WB 4GXRA 4HX5A 5A04A 1AKTA 4R65A 3TLMA 2F1OA 1RPNA 1UMDB 2HBZA 2YXBA 3CUUA 3H5VA 1EQ2A 3OZEA 4I2EA 3U7FB 5L1MA 4Q7MB 3INYA 5LBIA 4HEHA 2PUBA 1X40A 4LI0A 1EUDB 3PC2A 4A2CA 2A1JB 3SI7A 3NKVA 1WD5A 2O05A 1W1IA 4BX8A 4LF5B 4P4OA 4BIMA 1JG3A 1G8MA 3MMXA 2ZVPX 3V3KA 4G07A 6CHYA 3ECCA 3QWBA 2IYTA 1QCCA 5IJXA 3QPWA 3TX6A 4KLNA 4BTLA 1S7CA 1GR1A 4EVRA 3IB3A 2BFCA 4BBAA 3WGZA 4TYWA 1KIAA 1J9GA 3VZRA 2FPIB 5DW0A 3SLRA 2O6HA 4MS4A 1UDCA 1E1YA 1W6UA 2OHGA 4JEMA 4QICA 5AW5A 4CGYA 2GZ1A 2WWTA 5IT4A 3OJCA 1S2MA 2RONA 1FP7A 2V7PA 3F2IA 1L5UA 3R20A 4UFOA 1R6DA 4HTAA 2PFOA 3DQQA 4IFIA 3AONB 4K6CA 4KYIB 5TQ2B 1E3IA 4BS9A 4CG2A 2GERA 5B58C 2J3HA 5CD1A 3HPQA 1R8XA 1VL6A 2QG6A 1XZIA 5KFZA 4ZXPA 3P9QA 4CHTA 2B83A 4MIYA 5DBGA 2ZATA 2R7LA 1N5WA 4KUGA 2HDOA 4P3NA 1T94A 3I6ZA 3WWYA 5I7WA 4NXNB 2NZXA 1XDBA 5THQA 1P7YA 1H2YA 2QB1A 3HPOA 5F2EA 1MIHA 2WUVA 1J90A 2RP5A 2YJTD 3H84A 5L7YA 3H05A 1AMOA 4TL7A 3BDIA 4HS4A 2XH8A 4XW2A 4NG4A 5DWDA 3CW8X 2Z43A 3G7NA 3ASZA 2BL4A 4NPCA 5C18A 5A5DA 4B9EA 4B80A 5PNTA 1GVHA 3PJDA 2E0IA 1T5TA 4CGZA 2CHQA 2YUTA 1V7PC 4JL6A 4LWOA 4O4IB 2ZSAA 1HMPA 1W9MA 2WP8J 1NUTA 3EDYA 5AOCA 3OJUA 3M9MB 2XSZD 2ZB3A 2OLKA 3PENA 2YOGA 4ZT6A 4EEZA 5IT5A 2FEPA 2ZJZA 1YH3A 4MEBA 3WMRA 4ZAXA 2QMOA 7ICSA 2FOLA 2BEWB 3RJ9A 2VA8A 2YJ4A 3L8DA 3X0DA 3CLTC 4E30A 5J4KA 2P2NA 4BIIA 2W8KA 2B9EA 3HJRA 4GFJA 3CE9A 1BNCA 3A4NA 3ZY4A 1Y8AA 2X42A 4ZOLA 1QF6A 2B0JA 5IW8A 4UM7A 1HG0A 5DCUA 1CIVA 3MTGA 2WYIA 4TYPA 3Q98A 2LM1A 1HM5A 3VR2D 4A0RA 2CV0A 1V38A 2O8VA 3QOXA 4D2IA 1RLTA 1SBCA 2MRLA 3EZ7A 1NVUQ 1RJ9B 2D5CA 2PZFA 1F14A 3C1ZA 2XTMA 4UHDA 3SQNA 3KSAC 9ICOA 2PX0A 4ONEA 1OH7A 1XB2A 1N4DA 1XVVA 1SK9A 3ADKA 1WDLA 3H6KA 2D7DA 1DAKA 4XUSA 3JPQA 1OYOA 2VOEA 3Q7RA 2G17A 5GINE 8ICGA 2XR1A 1DC8A 1DQPA 9ICVA 2IHKA 3WNVA 2GYVA 4TUPA 4IRKA 4MFCA 4JENA 3F53A 3B0YA 2VZ0A 1OROA 3IULA 3N8GA 4PANA 2O3UA 2WTMA 2FJ6A 4LX8A 4MO2A 1LEHA 1QAOA 2R00C 5FRDA 4GVPA 5IVPA 3H04A 1RQRA 1KP3A 1XU9A 4UAGA 4IW3B 3ZCVA 4K26A 3GFRA 1F1BA 2QM0A 3PC7A 2LD4A 1V2HE 2WWWA 3KC2A 4BMZA 4JV2A 3HTXA 4QUEA 5FJJA 3BIXA 4WBNA 1DOZA 3O4RA 3UQZA 4BNFA 4CG3A 3FGNA 2GD6A 1EM8A 4EB8A 4HK4A 4JOSA 1NW7A 2E1EA 2GX6A 4IV0A 2RFLA 4YRNA 1SXDA 3H18A 9ICPA 2FLNA 3AKZA 3T5GA 3NCTA 1MABB 1U2PA 4Y2TA 1KI6B 2BGRA 4H16A 2AFRA 1ZGAA 1B3RA 4NTZA 3F7MA 4DC0A 3DXZA 4HWOA 4LY0A 3PZRA 3IAS6 1NXQA 5LQNA 4GC9A 4M1MA 1UM9A 1HTBA 5G4KA 9GPBA 3NAGA 3JPTA 2X4LA 2Y1JA 2E37A 3PR2B 5KFEA 4F4KA 4G97A 4LZOA 5KPDA 5CGZA 1G9TA 2PXAA 3O2JA 1CEYA 4B71A 2WIJA 3LDUA 5TPZA 2PBZA 3EULA 1PEAA 2H57A 2OGUA 3RS4A 3QVJA 3EGEA 2FFBA 1ULHA 3KHTA 5DNWA 1E3QA 1TQHA 2OILA 3U81A 2CZQA 1R7RA 5C7LO 1TO6A 1ZQXA 4PHEA 1WTAA 2BFFB 2RHWA 3DHNA 3KCQA 5DT9A 2WHEA 5FL7A 3RT7A 1G38A 5AK4A 2WB4A 4OU5A 4TMVA 4CQJA 2WM2A 3TM5A 2HHLA 3FDZB 4WKGA 2AVNA 3GZFA 4P33A 2AD5A 4UAJA 3HCFA 1PR3A 2Y9TA 3HU5A 4KPEC 3P9IA 3VA7A 1QO9A 1A5BB 1WPQA 3QKWA 4OREX 3TBKA 3V4SA 3ZJYA 4DBVO 3AL0C 4KLRA 3THVA 1NJXA 3NHSA 5LCXA 2ZRJA 3NOXA 1SU6A 2W70A 3IBSA 3K92A 4HDRB 4P4NA 5FFNA 4IL5A 4ZV9A 3EQZA 1WCXA 4N3BA 5FUMA 2H4YA 4U2KA 4M1OA 4RS3A 1RM0A 4F6LA 4H3VA 2H8KA 1DG3A 1XDSA 3O38A 2CHEA 4UVEA 2PFPA 4OSEA 5FNVA 3GAZA 2D8MA 3JQEA 4M0MA 1ENOA 1P3JA 1JLKA 2AVDA 3CJQA 3HCCA 3C6XA 2QZSA 3I6QA 3JRXA 1EB9A 3L1KA 1ZUNB 2P2ZA 1MO3A 4B8WA 5JEDA 1NNI1 1C0PA 2VTDA 4O08A 1WKBA 1D6MA 3GEIA 5K0SA 5GGYA 3RFAA 3DKRA 3IPLA 4GC5A 3ZXSA 3ETEA 3LY5A 4YWJA 2QTLA 3R9XA 2DU8A 2GCEA 2ORYA 5DULA 1GGMA 3KWMA 2VWGA 3G6YA 4LDAA 1Q7TA 3GLTA 4QJ4A 4RPZA 1AX9A 2F8MA 3PL5A 4KN8A 1FU7A 2V58A 4YV2A 4O3SA 1UA0A 3BE4A 4H7PA 1CY0A 2ZUSA 1VJTA 2PL5A 2PX2A 1C9MA 4I66A 5AKJA 3OQVA 4JZKA 5CR9A 1SXJB 3O3OB 5AT1A 5D7BA 2IV2X 4XIFA 1KAGA 1P2BA 2HMTA 2WY2D 4B2IA 3TPZA 3RWOA 4D8XA 1N32B 4P3KA 3K6SA 2ZIAA 3H16A 1USIA 5HIJA 1EESA 3OPMA 9ICKA 5NULA 4ZGWA 4KIFA 1JXLA 1W85A 3IR7A 3M9WA 1IJFA 1E9AA 1VI6A 1X2EA 4DJJA 2YNMC 1CUWA 4BE7B 3KLMX 1KEZA 1DWQA 3SDBA 1G59A 1FTNA 1SL0A 2B1QA 2LCFA 3KZMA 3THOA 2AGOA 1A1VA 4JMUA 3MW8A 3DM9B 1XRMA 5KOHA 2UVWA 3MWDB 1CP3A 4R2KA 3TPFA 1E2HA 3ZE8A 1KY2A 4TQAA 1WXXA 4ZD6A 2IXFA 2YS6A 1MO2A 3HLYA 4JC0A 1G21A 4I3FA 4P36A 1AE1A 1LFAA 1XHFA 1KTIA 4UMVA 1N2EA 1NPYA 4B6SA 4U7CA 3GBPA 4ZQEA 4MULA 4QHSA 3W90A 4UQPA 4JX9A 3W6PA 3UATA 1AHHA 1J2JA 1T9GR 1U8ZA 2ZIVA 2BR3A 4IQWA 3H65A 1DINA 3ZU6A 2W6ID 4EKGA 4JX8A 5JALA 5T57A 4I2JA 2YRWA 3OPXA 4YCNA 3RRJA 4DCSA 4EATA 1CUDA 3GJ3A 4V0OA 2KV2A 3T7DA 1JYSA 1R15A 4O3QA 2JLRA 5HIIA 3ZJ4A 3J81A 3UXYA 3LA6A 4P80A 2PS1A 3K31A 2HF9A 3ISJA 3TR0A 1PKEA 5F4BA 2ZBGA 2H9AA 3E9MA 1T35A 2WF8A 1R4MA 2O3QA 1EE9A 3TZQA 4ZK2A 4UPEA 5HKKD 2PMBA 3OT1A 1PVVA 2IH2A 1NX6A 2J5KA 1AKWA 5D3ZA 1C3JA 2JIQA 1ZJJA 2ZI3A 2QUZA 2ZTUA 3MJHA 2HKIA 3BL8A 4ZVNA 2A1UA 5ILQA 2AK3A 4LMBA 4QATA 5EXTA 4R5HA 1ODTC 4YP7A 5HKAA 1O97D 1W4ZA 2X0RA 3GUYA 4M0UA 5EXEA 2DPMA 2IX3A 3FOFC 1BHQ1 3AHJA 3URMA 1E3WA 1UJNA 1TGYA 1JDJA 8ICEA 3IPCA 2W2KA 2WM9B 1O8BA 5J2TA 4F85A 1LX7A 2B30A 1MP0A 2H00A 5F2OA 2ZRIA 1L5OA 2O4CA 3U3ZA 1NL3A 3A9VA 2DR0A 4YAUA 1IIRA 1G6KA 3AGQA 1M0TA 3O4HA 2O0HA 3GL9A 4M9RA 5CT4A 3QU4A 4UM5A 1JHOA 1TW3A 1XWFA 3Q0IA 3FPGA 3E82A 1YS4A 3T5HA 2WM8A 2PUAA 1QE3A 1SV0C 1Z6YA 1WVIA 3NBXX 1RZRA 1OXXK 3FAKA 3V4ZA 2C8JA 3GP5A 5IRCD 3W6ZA 3LZDA 1Z1BA 4HDNA 1BE0A 1G4UR 1XCOA 4K6OA 5EG5A 4ZHSA 2HRBA 5LDHA 3ZOZA 5AIBA 2JFVA 1XPUA 3QE3A 5KFWA 2GEKA 3I5MA 1ISGA 1YBVA 4XEUA 2FDCA 3IDOA 5C5DA 4G41A 4GQIA 5KT4A 2C22A 1RYBA 3GH1A 3RAQA 3JZFA 4KLOA 3LK7A 1Z8DA 1ZETA 3M6AA 4RH0A 4XWKA 2F8TA 3A37A 4ER3A 1ZR4A 1R4MB 3O3MB 1RD4A 4QU5A 4KMSA 3V2GA 3NMUF 1FXWA 3FLMA 1NP3A 3HUTA 4Y1RB 2VUIB 3AEUA 3KQSA 2GGSA 1WO8A 3T12A 2OAP1 2VHJA 4YD2A 1KQNA 4FN5A 1L6IA 4PRZA 4V0SA 4HCJA 3EGWA 5AFSA 4EKIA 1BPYA 3JPOA 2QMQA 2B1RA 3K53A 2PUDA 3IP4B 1YJXA 4GI2A 4ELTA 1UFVA 3GY0A 5KDDA 1X0VA 4N7BA 2NRWA 4RHCA 1Y8QA 3JARB 2H2HA 4HF7A 2WMOB 3LLMA 4LCJA 4RO0A 5EMKA 5L1IA 5AUQA 4KO3S 4ZODA 3H0KA 2DP4E 1CERA 3FHJA 1DVRA 4DM3A 2Z5FA 4TQGA 2ZRKA 5DYYA 3TOSA 2VT6A 4JJGA 2GZAA 3B1KA 4BE9A 2J41A 2B1JA 1M67A 5ALDA 1QZ3A 1J2EA 2JDID 5CB4F 4ED9A 5ITVA 1YNOA 4NU8X 4DC9A 5ESRA 3KWLA 2OFOA 3IEKA 1FSGA 4ZYYA 4QOEA 3QNMA 2C2XA 3RS5A 1AKRA 4JAVC 3T4XA 2HJRA 3THWA 1Z0ZA 1AQ6A 5J2UB 4JT2A 4ALNA 2BFDA 2K87A 3HBFA 3OIDA 5L3SB 5G4KB 1BCSA 1LDGA 5HTOA 2PFGA 4WZAA 1XC9A 1ZQZA 2EV9A 4B6FA 4C03A 2BFDB 4Z2YA 1KO4A 3IR5A 1KTQA 2ZRGA 2P9BA 2QL9A 4E4YA 4MV1A 2IUSA 4IY1A 4WMLA 1JFRA 1SXJA 1JLMA 3THXA 3U7GA 4QBFA 3MTBA 3OBBA 3EZ5A 1TO1E 3FHOA 5KB3A 3JAMA 4LFAB 3C1YA 3DE1X 3VSCA 3W0LB 2I34A 5F9LA 3M6UA 3MD9A 4OHFA 5ITWA 2H08A 4ZZ0A 3DYVA 5BNZA 1KPIA 4C29A 2MIIA 3AYZB 1NVFA 1PTJC 2JHCA 4YCDA 1D2MA 3UZUA 1WVGA 1SOUA 2A9PA 3M1LA 4R7ZA 3CZQA 5IAEA 3IB6A 4RNMA 4JFRA 4GH5A 3M3DA 3CONA 2C0CA 4B2PA 1RWWA 4YD1A 1P4RA 1M1UA 2W8ZA 3QSYA 4Q39A 1M3SA 3CNQS 4TQRA 1GRQA 4Y2VA 5JW6A 4H1HA 1JG1A 5DX8A 4ALIA 1OFHA 5IBCA 1W94A 2VTEA 1BFUA 4IQVA 1CRWG 1QONA 4IFEA 2UYHA 2D1FA 4FR0A 1KQFA 3LCCA 4O2AB 2QQFA 3M70A 5GONB 4LC9A 4IZOA 2L5YA 4MVJM 4M46A 4Q1EA 2TMYA 2H85A 4BY9E 1CJKC 3EISA 1EXWA 2NZWA 2NP7A 2BT4A 1Y1SA 2C77A 4EZ9A 1XEWX 3FJYA 4ZHQA 3SSAA 4DSIA 4Q7QA 2RAVA 3FNGA 5JIBA 1GNVA 5A0VA 1NQTA 4O4HB 1EVJA 3EOAI 4YT5A 2EDAA 4IVQA 2GLTA 1UPHA 3GILA 3EUWA 4KH0A 1T91A 1H22A 1RG6A 2DPGA 3RTCA 3NFYA 3NGDA 5REQA 4JK1A 5HXAA 4UAUA 2X9NA 1OW3B 3GIMA 1A9QA 1PR9A 3TI0A 2OCYC 3VU1A 1T36A 2FWPA 2VRNA 3I58A 3R09A 2QV0A 5EJEA 1S8OA 2AC4A 2EYUA 2ONKA 3GZNB 3OBIA 3P2IA 3QPAA 4QODA 3NATA 4MW6A 3I1JA 5HZHA 1AB6A 3LMKA 2X5OA 2Q9AA 1T36B 2YWJA 5JFOA 1DT5A 5IILA 9ICQA 3P2OA 1IV8A 4F4FA 5J2HA 4LOIA 4NMWA 5FLXA 3G2OA 2WSBA 2GT1A 2VLBA 2W2KB 3IG5A 4PYOA 2XUOA 3AVOA 3KJIA 1SBNE 4M7PA 3FTQA 3GMDA 4J9RA 3U3DA 4QYIA 1AQIA 4XYMA 1IPEA 1WTCA 3JYHA 4WN3A 1V1JA 4R1NA 2RI6A 3I12A 3QNUA 3WR5A 1P18A 2EFHB 2ZEJA 4YCLA 1ZNWA 4I5GA 4C0ZA 4KH1A 5CFOA 3IOYA 1RRCA 2O8EA 1GQYA 4I99A 2V6FA 1JF8A 4ICAA 4AECA 1N5MA 1YHZA 7ICQA 1S0MA 1XRQA 3N05A 3QW2A 4K9DA 1L5LA 4ZVTA 3VU9A 4CBVA 4UAWA 4B34A 5JNUA 1H38A 1P81A 4G63A 4JBWA 4MAAA 3R7DA 4OQEA 4EJ2A 1HDRA 2JEIA 4BB0A 1EZZA 1WEKA 1ETHA 1ODLA 2E1RA 3JASB 4AF6A 4JHXA 1KIFA 3MJSA 1Q2XA 3MWYW 4EG5A 4DT1A 5K3FB 4PSKA 4TYYA 4BP3A 4TVOA 1IG3A 2HF8A 4UUAA 4XARA 4RJJA 5KFJA 5A7GA 2P77A 4EJFA 4RA9B 1GILA 1KS9A 3Q9NA 2AB0A 1BROA 1VG8A 4LVNA 4KIJA 4P0QA 2QG9A 2WTNA 4YRRA 4R1UA 3QPCA 1Z2OX 3CRMA 2ID9A 4U1RA 4YMHA 2CMKA 2YWGA 2HVIA 1JSCA 1EDBA 2GAFA 1K3UB 1R0ZA 3CLRD 3G5AA 5EMNA 2ESRA 2VCHA 4YXWA 5JARA 3HBJA 3ENQA 1EJBA 3KETA 3WB9A 3AKEA 4BTVA 3EC2A 4CU5A 2ZI7A 4I1UA 2C31A 1V3VA 2CWWA 2NUTA 1YCGA 1DRGA 4MEXA 3I2KA 1NYLA 1GCUA 3QZ7A 4PBRA 2GWHA 2B5WA 1HDOA 3FPAA 9ICNA 1HKHA 4QVGA 2VUSA 3QFRA 3N97B 2MWMA 4H6VA 1I7DA 2QW8A 5HTKA 4DSLA 4I50B 1NC3A 3N5KA 4CKBB 2J0SA 1U28A 2R8EA 3S7ZA 3EWNA 1XD8A 5KFBA 4GP7A 3FMPB 1T3LA 5B66U 1ZQMA 2FEAA 2OCBA 4JP5A 2ES6A 4JYPA 3TD6A 4ENWA 3TFOA 4HQ6A 2PGIA 3V8PA 2ZDGA 5LLTA 3TQSA 4MGZR 1A2QA 1RRKA 4X95A 4I4NA 2FPRA 3VPGA 1VTKA 4CXMA 2FKNA 3NAQA 1Y8CA 2BHLA 5IDXA 2EKZA 3CISA 1AO0A 3MF4A 1WHTA 3TIIA 1GP2A 3MLBA 1YTLA 1Z6XA 1X94A 2VYFA 3HWSA 4FCVA 4Q01A 4BC0A 1SU4A 4ZVLA 2C9DA 4I55A 4TKVA 2VPIA 4OKSA 4NYIQ 3DWFA 2UVRA 4IIVA 4HDKA 1DFHA 1W87A 2YXDA 1IM4A 3M6ZA 1LW7A 2EJTA 3RIEA 5JAHA 1EFCA 2XMRA 2IRWA 2JJ8A 1N5IA 1DSSG 3U19A 4TMZA 3QEBZ 3IMKA 4FYMA 4K81B 1Y88A 3G0HA 3OEEA 2VXBA 3KYDB 1UBUS 4O59O 1KBZA 1H2RS 1QC5B 2GN4A 4E88A 4EVIA 5LZ4A 2HU2A 1XALA 3UK0A 2BCSA 2NMVA 5C4IA 2OWOA 1CYDA 4LOJA 3DZGA 4Q4AA 5TV2A 4OQLA 3TXXA 4BKMA 2NX2A 5CXQA 121PA 3SIWA 2XUDA 1DUSA 2JPDA 4IV5A 1TAQA 2AHRA 4X61A 3TEFA 4B7ZA 1G3IA 1WZIA 2J07A 4Q7JB 1BFDA 5JSFA 2BQ3A 5KNBD 3MLEA 3CLUD 1XTPA 3T79A 3C6BA 4OSOA 1Q8KA 4Q9HA 2ZE6A 1PHRA 9ICTA 2NVUB 5CH3A 1R6AA 3C8DA 3HR8A 3LWDA 1GGVA 1N1EA 3ZCSA 1XDUA 4HJRA 2NADA 1UXHA 2G8NA 5CM2Z 5BT9A 2QLLA 1CQPA 1CK4A 5SICE 3SQLA 1M34A 2DPLA 2DJIA 4DCCA 4FN4A 1H8EA 1JWBB 1TZKA 2D5LA 1Z36A 2I1VB 2OM2A 3EIFA 3QFSA 4HQ0A 1UMDA 4RD3A 4DQKA 5C4GB 1TC1A 4BMXA 1A82A 2IUEA 3U7HB 2C4WA 1QDEA 2GRUA 2WIDA 1XRJA 1KMIY 4NWIA 5BYBA 3KHKA 1WP9A 2DWQA 3KJZA 5K3AA 1QV9A 2JG3A 2XMSA 3G82C 3JQBA 1U2SA 4UB2A 5CRXA 1SCJA 4J75A 1V97A 1VI5A 4UNIA 4BX2A 1ZVQA 3E7XA 2R0QC 4TXJA 3ENZA 2QM7A 2E5SA 5BMVF 3IQHX 2CUZA 4LBWA 4B3BA 5K6AC 3AUOA 2HF2A 3I45A 4YMTA 3CZ5A 3GZTB 1GLNA 4DQDA 2XXBA 5HHTA 4LUCA 1NXSA 2IOFA 3IESA 4AX4A 3JWHA 3K2EA 3QKRA 2KMDA 4I2HA 1BDBA 2NAFA 4FDUA 1UKAA 1FMLA 1O8CA 2ABWA 4FYYA 4GWLA 2CYBA 2ZXUA 3M49A 2OC4A 4LDQA 3DFUA 3DGFC 3ZVMA 2ZE8A 1YZ7A 4WKPA 4ZVPA 2DOKA 4HDQB 1OASA 4M87A 4QUGA 4MVCA 4P1ZA 5AKLA 4W7SA 4OHOA 1CRXA 3HFJA 2J7KA 3BB4A 1FC0A 2QRPA 2ZUCA 1VLMA 1N9GA 3ENKA 3VUEA 2Q3BA 3G17A 3L3BA 4FSXA 1JFFA 2OV1A 5TPWB 1T1SA 2W43A 3UJ9A 1PFQA 3JQ8B 1U1CA 2RAFA 2P69A 5EESA 1T0UA 1Y5LA 3A6ZA 4DMHA 2YKGA 5C81A 1DAHA 2AGVA 1R5BA 3R5XA 3A1DA 3TXYA 3AHDA 1VRVA 1CR0A 1PUIA 3TR5A 4TV9A 4F5YA 4ECZA 3C7AA 1Z6QA 3DE5X 4RIFA 3FRIA 2AFVA 4FWBA 5TJ9A 3CUSA 4M0LA 3NBKA 1ICIA 2UZ3A 1G3UA 2C7BA 3KXDA 4URHA 3MRXA 2YQ5A 4N47A 4YRGA 4I19A 3N74A 1Q5PA 5FLYA 4UQOA 3ORFA 3EEFA 2WUEA 1CDZA 3GCDA 4KAFA 2O8CB 3VU0A 2XE4A 4RQNA 1GUBA 2O2JA 2CCJA 1B7GO 1UMCB 3G89A 3GV7B 1QG4A 2VHUA 3CN7A 1X7XB 2AEMA 3K4QA 2XYQA 3MMSA 4KN5A 5F21A 4YWHA 4MCAA 4CUKA 1W8IA 3EPHA 1UFKA 2ACEA 3FI0A 4C2AA 4PN7A 1GKUB 3CRZA 4RDIA 4B9MA 1NBEA 3O47A 4R9RA 3DE6X 3EOZA 3X43A 1RJFA 2ODEA 2IEZA 3UMVA 3KD2A 4B0OA 3PXGA 1VE6A 4CV2A 2EAMA 1BGXT 1JFLA 1U7HA 2JIBA 4MUKA 3KHLA 4RHUA 3FCAA 8ICIA 4ZKDA 4BWJA 2O9JA 5HUQA 1CYEA 3BD6A 3IA2A 5AHOA 4DRXB 1NKSA 2G1JA 2NACA 5CBKA 2XBMA 1IVNA 5B2ZA 2WZCA 5THXA 4RZ3A 5JNVA 1A04A 1C8KA 2PJZA 2XGSA 1X3LA 3D81A 5FI0B 5CA1A 3HEMA 1JG7A 1X3SA 2QMEA 2V9ZA 4TM7A 3C6YA 5T41A 3RYHB 2A0WA 4RIGA 3T9EA 4QQNA 1Q1AA 3VNQA 2ZDQA 3UYLA 3U37A 5K09A 2A14A 4RXUA 4L95C 1RTTA 2IHMA 3GN1A 2OXOA 3A2LA 3HL4A 2PVPA 2Q6IA 2JZBB 5ALSA 5IM5A 1DG1G 3EFHA 3F5MA 5DHAA 5K8LA 4D92A 1W36D 1KFEB 1EVEA 3QFCA 3ZYCA 4EO4A 1LI4A 4BNKA 2AGPA 2UXBB 4GWGA 1OH6A 1RU3A 2QUJA 6AT1A 2JLCA 4I36A 1NJ2A 3SEFA 1E5LA 1E9FA 1UM8A 1Z26A 3MDCA 1KAOA 5E8JA 5IVDA 5LZ7A 2CFOA 3KBBA 1I10A 1C5KA 3VSEA 2D0PB 5D51S 2EKPA 1MOQA 3X1DA 2ISCA 3GELA 4P4GA 4FMPA 1FNDA 4IFBA 4F2HA 2R8IA 5EP1A 4RV4A 1CW2B 2YINC 3FB4A 2KIWA 3BDVA 1FFEA 3PFIA 3P0JA 4GSYA 3ZGOA 4IIYA 3PSFA 2PRIA 2IYRA 4HDOB 1PSWA 1L4UA 1ZK1A 1VFNA 2P2LA 4GL2A 2Q3JA 3AUXA 3HWWA 2GN6A 4IWYA 4JSYA 4KLDA 1E9BA 4YAOA 4H6PA 4RNOA 4Q4HA 3LM8A 3FDIA 3L7BA 4FB4A 2PMCA 5IYZB 4BFLA 1U04A 1U80A 4BL5A 1QRTA 2FGJA 4Z3OA 3BHIA 2NXEA 2WPNA 2LYAA 2LE0A 4G24A 2OZLA 1JV2B 3W5IA 4MW4A 5B3JA 5IXJA 4W8OA 3TF5A 5C0OE 3NHKA 1Y9EA 1ZK4A 5EKXA 4DQVA 2I1WA 3BJMA 1C1DA 5CBPA 1DAFA 3KXPA 1X6JA 4J03A 1Z56C 5HW0A 2O6KA 1HMYA 1YIDA 3NRZA 3LO5A 5LKRA 4NL9A 4KITB 2AJBA 1AM4D 3ABZA 5DJ5A 2XMBA 2ZJ1A 3CZRA 2XZOA 3CVXA 1I4EB 1NQVA 4FGUA 4N12A 2WVJA 1R0SA 2OLEA 1DKNA 2BFMA 2WTFA 1H8HD 2UV8A 3FUTA 3MAAC 4L74A 5CPBA 2XRFA 3NHWA 1ZN8A 4OO1J 1PVDA 4HMPA 4AYWA 3BH6A 3K5IA 2JLXA 2GXAA 1IOLA 5BYJA 1JU9A 3EZ6A 5BR4A 2C5GA 2GLUA 2Z8XA 5JWRA 4Y2GA 4HAWA 5KQMA 1CV2A 1Y5MA 3EPLA 2QTMA 5KX5A 1IB6A 1F0NA 1KVRA 2EEPA 5EGNA 4C0HA 1QO7A 4UARA 3VISA 4D9MA 2VPYA 1RXVA 3G8AA 3IX7A 3ZZMA 5EWMB 1QSGA 4KI0A 1Q0HA 5A4AA 5ALKA 2XEXA 1DQYA 3F6RA 4NBSA 4IQ0A 4QFBA 2QX6A 1KJ8A 2ZJ2A 5D6OA 1LTQA 1WETA 4DJEC 3BULA 4PWZA 2ZYRA 2FWAA 4LJRA 2LV8A 3J81k 1VLZA 1LDBA 2P0YA 2OWEA 2PO5A 3VMFA 3C3JA 4BX3A 2VDMB 4E33A 1CF2O 1JDZA 1N75A 4HZUB 4DS4A 4NCKA 1U8CB 1XU7A 4UMEA 3EPRA 4YMSA 4C6SA 1FLAA 3KT8A 5DW3A 4OJQA 4GZ6A 2EKDA 3WZ2A 2IYOA 2H1RA 1NOJA 3TLKA 1DKQA 4EABA 4CKEB 1HNWB 1YR1A 4OM8A 4FFPA 4P38A 4C0SA 1GQ2A 4FMCB 1EVLA 3MAGA 2JA1A 4NAUA 1AS2A 1GADO 3LY9A 2OHOA 1QTMA 1E60A 5J58A 2ST1A 2E3JA 1F9AA 3K9BA 5DM1A 3ZWNA 3EXHB 4JP2A 3WBBA 3AJAA 3UMCA 4OJNA 4DZRA 2NSDA 3DBOB 1J8VA 1SUAA 1B0XA 3GQBA 3USZA 1RC1A 2DETA 3QMWA 4YP5A 2A84A 2CYCA 2LYBA 3FVRA 2IT1A 2ZBEA 4U2CA 1QPGA 4OEHA 1BFKA 3KYCB 3F6CA 2GNOA 3PFKA 4ER5A 2HMUA 1X9HA 4D8UA 3MPOA 3IA7A 1GYPA 1ZI6A 1JEAA 4Y0VA 5I8WA 3FHTA 4DXAA 2ANBA 2Q4EA 3PLAE 2BF4A 3TZ6A 3SG0A 2DHCA 5G5GA 3PX3A 1J0EA 4NH4A 4RORA 2Q3DA 1GNTA 1X7ZB 1ESMA 2ZRCA 1U9CA 1C1YA 1J2RA 1I14A 2QN1A 1TZMA 4WCVA 4BN5A 4DQLA 4M2LA 3HUUA 4IHQA 2XGJA 3PQ2A 4LA4A 4NFHA 1KDOA 3RVPA 1RJWA 3ZCXA 2I8CA 4BWYA 1NLYA 1DXOA 2Q07A 3BS4A 1Y63A 5JMOA 1QFSA 3BTOA 5KTTA 4UUQA 4C2BA 1L8QA 4CF7A 3WK4A 1IYZA 1LQTA 2H18A 2O48X 2DHDA 1D3AA 3KJNA 3UMRA 2G5TA 4TV8F 2WUWE 4Q4AB 3AU6A 4KRYA 4LQCA 2Q6LA 2XNHA 5LDGA 2B34A 4JI1B 1QXSA 3QEMA 1QYWA 3MCWA 1SVUA 1VGVA 2RMKA 4JLDA 1MB3A 4NFLA 1VKNA 2PSHA 3IHWA 2JGMA 2PSFA 1XSPA 1OBVA 3N59A 1ISMA 4OXIA 2IBTA 7ICRA 5G02A 3TW8A 1II8B 2M1ZA 2CLCX 2OD9A 3B9PA 4RLFA 4UCFA 5DI3A 1NPTO 5LA6F 3S2IA 2J6SA 1E0JA 8ABPA 4BMOB 4O8ZA 5M34A 4QNNA 3STWA 1KO7A 2I9GA 5ALZA 2UZAA 1MV5A 3GEGA 1P2GA 3Q41A 2ONZA 3FG9A 4FEGA 4X41A 4CMHA 3GPLA 4XD2A 5ALLA 4RZHA 4R8KA 1W96A 3GA5A 1F8XA 4NEHB 1KWGA 3WYBA 1NJ1A 4DTCA 1QVVA 4MJ7A 2X1LA 3DBIA 3QLTA 4PJ0U 2XVTA 1C3OB 3KTAA 4EA9A 3ZI7A 4HGNA 5CGQB 4TUQA 1UPBA 3HVUA 1UDBA 1K0UA 1VZ2A 1FMJA 4J9KA 3DKIA 2YMMA 1OC2A 2HW8A 1TK3A 3V33A 2ZZMA 1Y3AA 4H35A 4P82A 1QTNA 1JBKA 3UWKA 3CRXA 3PQ5A 3W9UA 5F76A 4J9PA 4IRXA 5COBA 3VNSA 1UWCA 2C57A 3WFZA 3IUPA 1MPTA 2SKCA 5H82A 4DAOA 3RBEA 1I7NA 5EYPB 1E77A 2GKSA 3KBOA 4EA7A 5D6NA 1EFHA 3X2EA 2FI1A 1K66A 4J2TA 4KBFA 3EASA 1NR1A 4U6NA 1JMSA 5J2KA 4DCOA 3ICOA 4TWIA 4FYVA 4IVPA 5FV4A 1XLTA 3L6CA 4HQKA 5ALYA 3UV3A 3A1EA 5BNTA 2XLCA 3EQ8A 1JPUA 3DLTA 2GARA 3SR3A 1X1AA 2YWCA 4N4AA 2JGFA 2YCBA 1AH2A 1MN8A 3C3PA 2PRJA 3CY6A 3WJ7A 2WJHA 1EQUA 1Q1GA 3KWFA 4GR9A 5FI1B 2WABA 3KB6A 4A5OA 3RTDA 8ICSA 3B13B 4EI8A 5IYZA 1YB1A 1NLFA 2QSZA 2R6HA 3DPUA 2HFJA 4MTLA 5FA6A 4F3CA 2IP1A 3ORSA 4UNQA 3K35A 1Y1QA 4EJMA 3UK6A 4J9LA 3FRHA 4OMCA 3WQSB 2ECQA 2V4QA 1GQOA 1N0HA 3B48A 4C4YA 1WDKA 2QD1A 2F48A 1IBRA 3CZ4A 2VWHA 4QDUA 4Q9KA 5JFGA 4E09A 1Z2EA 1ML3A 2YWBA 3D3KA 5FPYA 1L1RA 3OIGA 5FCDA 2FE1A 1MU0A 3C5CA 1A9YA 3A8TA 1JQ3A 3H2KA 3T7TA 2JLBA 1RRGA 2J9FA 4EGJA 3RB3A 4EG1A 1FJXA 1BWRA 2CLIB 3O4VA 3LV8A 3F1KA 8AT1A 1PQUA 3BORA 2G77B 4MVJG 1QG6A 1N5LA 1F4VA 4GBJA 5G41A 3RF6A 5HK9A 4XA5A 1DBIA 1PR6A 3GT7A 1RABA 3AETB 4MSUA 1Z68A 1NK4A 2YHSA 4J9NA 1E1QD 4P2GA 3D5EA 2O8BA 2O2IA 4PPNA 1ABEA 4DSKA 1FF9A 2V9CA 1XNSA 1ISJA 1ENYA 3IAXA 3IIKA 3IYLW 2CLLB 1XMJA 2Q5OA 2A9RA 3GFFA 4JLVA 2AI2A 5HA5A 1CG6A 1G20B 4DG5A 3NUZA 3WRXC 1CJSA 1IEXA 2O7RA 3N7AA 1YVPA 1I0LA 2ZWPA 5A5EA 3WAGA 1CIPA 4KWTA 3RYIB 3KQVA 5IARA 3RJHA 1EK2A 1PR0A 3E23A 3ILVA 4R40A 4AKTA 3HK2A 4IHJA 3H3XA 2QP9X 1KO1A 5FFFA 1TKRA 1JBEA 3TK1A 1BG6A 1QGYA 1OILA 4ZCIA 2WFLA 3T3OA 1PGNA 1L4HA 2XGOA 4Y2XA 3F2VA 4E1BA 3IURA 5C7YA 3V8RA 3VH1A 1C3XA 1WXDA 3K71B 1YFLA 2Z9DA 3GRPA 4UM9D 1XKXA 2MYNA 1Z5GA 2F9LA 2HXGA 2OXRA 1WQ3A 4HWPA 4V2IA 2NW6A 2WNSA 4OQNA 5KNDH 2HCFA 2QU7A 2PLAA 1HURA 3IILA 4L8WB 4M60A 4GI5A 2R8YA 1YU9A 4A92A 4BMDA 4M0DA 2C1ZA 1FSPA 4KE9A 4LRUA 1YBFA 2QGZA 4P4SA 4ZQIA 5B58T 2KJQA 1J8YF 2JEJA 1CUIA 5BOMA 1RSZA 1Z8NA 2OO7A 3BRQA 1VE5A 4ZJYA 2QRJA 1KK0A 1BC5A 3EEBA 4A9AA 1XSNA 1TL7C 3UJBA 4OLBA 2I6TA 3P9XA 2V5VA 3OFNA 2XI9A 2JGJA 3FFTA 3WRWA 4R2IA 4PHHA 4X90A 4ZHQB 1HZZC 3VV3A 3IEVA 3MJ4A 1TKDA 1PK3A 4U7WA 5FUYA 5TR9A 1HE2A 3DOUA 2Z6QA 1LPNA 4C7JA 2NAPA 4I1VA 2NZ2A 1ZK2A 5GMOA 3SM3A 1OUQA 1UP7A 1IN8A 2H3IA 1GPH1 4PTYA 2GBLC 1ML4A 1UBGA 3BWBA 4KFRA 3U5ZB 3PFCA 1KF0A 1IG6A 3PXAA 1GUDA 2BLLA 1RXIA 2IVZA 2P0AA 3DMGA 4RQ0A 3IDZA 3NZEA 2KB0A 4IXTA 4TWZA 4RESA 4B8ZA 4F6RB 4OAPA 3OESA 1DAIA 1H4TA 1BH6A 3KXIA 3RUCA 5F9HA 1YL7A 3WYGA 1ZI9A 4JWMA 1C2TA 4H7EA 2HQRA 1PNVA 1SFRA 3PNCA 3DOHA 4KQHA 5E9JA 4QYIB 4X24A 4XOUA 1SGGA 4JJ7A 3AF2A 3RVBA 3IBGA 5GTDA 1NKVA 5JH7B 5E2IA 1CS0A 2YNMD 1P7CA 1OH8A 2Y0SF 3V2IA 1RM4A 4ZTBA 2RDJA 2R47A 2DLCX 4ICIA 3GUCA 3CW2A 4YUYA 4B7CA 2K4MA 4KLFA 3DO8A 1JIHA 4E14A 1LSOA 3LTEA 2QNRA 4NYIR 1KZ1A 2VL7A 1N7JA 4U2DA 5EA2A 4Z7NB 1K7SN 2JK1A 2ZVDA 4TRMA 4IIEA 1T3HA 4KXVA 4YA6A 3PO4A 5K0ZA 1KGDA 1RP7A 4DQQA 2BSAA 1XZFA 4ECSA 2I6XA 3HZOA 3BMOB 3DHWC 3KAQA 2FDRA 1ED1A 3PITA 4LMPA 3QXGA 3HGMA 3RSHA 4EO9A 3H40A 2VHCA 1P9NA 1SG9A 3E9YA 1WMFA 1XEWY 1BMFD 4E46A 1U0HC 3CX7A 2D54A 4QM7A 8ADHA 4I27A 1PWXA 1A4IA 1LJLA 4BU1A 4Y8VA 3DAYA 3BWCA 3VNRA 4DL6A 4JYZA 1CIJA 4K9LA 1REQA 4DMLA 1QWOA 4DL2A 2R86A 4TKUB 2V0GA 2F1HA 4XAQA 10MHA 1YZFA 4L85A 4L4ZA 5HCIA 2KLBA 3BKXA 3LPAA 2C4VA 3V8MA 3AX6A 2EZ8A 1XMPA 1OA0A 1C29B 4PZNA 1E94E 3LOPA 4RY9A 4KXMA 4W1PA 3S8MA 4BQIA 2GCPA 1JRLA 3RRHA 4IGIA 1J2YA 3EMVA 1CBUA