3UMBA

Crystal structure of the l-2-haloacid dehalogenase rsc1362
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
227
structure length
227
Chain Sequence
TSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords dehalogenase-like hydrolase
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Ralstonia solanacearum
total genus 80
structure length 227
sequence length 227
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3umbA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3umbA01
5AI5A 4Y2PA 4UM5A 3QXGA 5IT0A 5IS2A 4AP9A 4KNWA 2WF9A 4CF4A 1N9KA 2I33A 1U7OA 2B1RA 1ZD4A 3S6JA 1YDFA 4Y2RA 2FUCA 3M1YA 3EWIA 2I6XA 3PDWA 2W4MA 1QH9A 1LTQA 3E84A 3U7HB 2W11A 3QLEA 2BDEA 2ZBDA 3ZWKA 2OM6A 3IB6A 2HEGA 3AR9A 3ED5A 3KBBA 2NYVA 3IRUA 5A3QA 3BWVA 4HGRA 1JUDA 2B8EA 4CF5A 5AVWA 1Z4KA 3EF0A 2WFAA 5AKHA 4O8CA 2FEAA 4F72A 1T9ZA 5ALEA 3WK8A 3A1EA 4G63A 2I54A 4Y2YA 3OPXA 1VJRA 2O2XA 1Z5UA 2PKEA 5AM2A 3M9LA 5AKIA 5AW1A 2P69A 1RLMA 3B9RA 5ALKA 2G09A 2G0AA 2FDRA 3DV9A 3WKAA 5E0OA 1U02A 2Q4TA 5ALOA 1S2OA 2AMYA 5AI4A 1IWOA 1TA0A 1ZRMA 1Z4OA 4AS2A 5AVTA 3BA6A 2WM8A 3L8HA 3ET5A 2IOFK 2FI1A 3I76A 1Z5GA 3B8EA 3L8GA 2BDUA 5AW8A 4UATA 4EX7A 2YY6A 3R4CA 2IA5A 4Y2SA 3NASA 3UM9A 1N8NA 3AR8A 3D6JA 1L7OA 3MMZA 4CF3A 4PNHA 2R8XA 3ZVLA 4H1WA 4C4TA 1Q91A 3ZWDA 2C8LA 3L5KA 2JAOA 3AR5A 4I9FA 3UMCA 3L0BA 4HYTA 4EENA 4QQFA 4OCZA 4UU0A 4KN8A 5FP0A 4UU1A 5JJBA 2HX1A 3QYPA 3P96A 2HDOA 1Z88A 5AKLA 1EK1A 2FPXA 2GHTA 3WK4A 2EAUA 1ZD5A 5AVQA 4RETA 1XP5A 3AR3A 5ALLA 3QNMA 2PQ0A 4KX5A 5A3RA 3FPSA 3L1VA 5AI0A 1RRCA 5AK4A 4GIBA 2GFHA 5AVZA 4DFDA 1Z4QA 5AKGA 1WR8A 2EARA 5ALHA 2YMPA 2GO7A 3DDHA 1XPJA 3U7EB 3W5AA 2HCFA 5AM4A 4EZEA 3U7FB 2R8EA 4YCLA 3W5CA 5AK5A 3UMGA 4BKMA 4JDPA 3OCZA 1T5SA 2YN4A 2MU2A 5ALGA 2AGVA 4KX3A 1S8OA 3K1ZA 2GMWA 3NRJA 4C4RA 3EF1A 1RKUA 3WGUA 4XE5A 4GXTA 4DW8A 3WK5A 4YH1A 1L8OA 4BX0A 1J97A 4QJBA 5AVUA 3SKYA 2AH5A 4ZEWA 1WPGA 5AW5A 2YJ4A 2G80A 3ET4A 3L0CA 3W5BA 3WKDA 1CQZA 3QX7A 5AKXA 3ZTWA 5AKYA 3U7GA 4FE3A 3FGOA 1YS9A 3SKXA 5AM1A 3ZW7A 2YMLA 5AHXA 5AVSA 4G9BA 2VKQA 5IT4A 2RBKA 4L6AA 3KC2A 1RDFA 1TE2A 3WK6A 2I55A 3AR2A 1L6RA 1Z4MA 3RFUA 3QU5A 3N8GA 2ZOSA 2ZBGA 4Y2VA 5AW3A 2YJ3A 3ZUPA 4E88A 3F9RA 4IFTA 3OCWA 1RKVA 3ZTYA 3QGMA 3E8MA 2B1QA 5AKKA 4I9GA 3WKEA 3OCUA 1RMQA 3AR6A 2W43A 2IOFA 5ALRA 4Y2JA 5AIBA 1NF2A 5ALYA 4XQ0A 2JAUA 1ZRNA 2WF7A 1ZD2P 5AVRA 2YMMA 3WKBA 5A3SA 2PR7A 4BEWA 1QQ7A 3DNPA 1YMQA 4OFZA 1SWVA 4UMDA 2FPUA 5ALPA 2FUEA 2JAWA 2B8JA 3SD7A 1Z4PX 4MWOA 3I28A 1ZOLA 1RQNA 4YCMA 4ZEVA 5ALVA 1TJ3A 1U7PA 2HOQA 3CZ4A 3U26A 4RESA 3WK7A 5ALTA 4XOUA 3ZU6A 4AS3A 4EX6A 1VJ5A 2QLTA 4UARA 2HSZA 5AICA 3PGLA 1KYTA 2JARA 2P11A 2EATA 1ZD3A 3MN1A 2C4NA 2NO5A 4CNQA 2QYHA 3W5DA 1QQ6A 5ALZA 1L7PA 2ZXEA 4DWOA 3GYGA 3NUQA 2YBDA 3OCXA 3WGVA 5AM5A 1SWWA 3N1UA 3FPBA 3QUCA 2R8ZA 1YV9A 4UM7A 4F71A 3DAOA 1WVIA 5AVXA 3ZVNA 3QUTA 4XPZA 3QUBA 5AIAA 2FPSA 3SHQA 5ALWA 4UMVA 4B6JA 3L0YA 3AR4A 3OTQA 4FYPA 1RQLA 1WZCA 2IYEA 5AVYA 3ZI4A 4ZEXA 3TLMA 4YIKA 3B9BA 1F5SA 2DQSA 3J7TA 3WK9A 3HYCA 2ODAA 3U19A 5ALXA 2WF6A 2P27A 4OD0A 2HI0A 1PW5A 3NALA 1U2SA 1NNLA 1ZS9A 2OBBA 5ALSA 2JGAA 3FVVA 4HGQA 1J8DA 2CFSA 4UMFA 1CR6A 4EEKA 2G08A 3HLTA 4J03A 4HGPA 3KZXA 4HGNA 1T5TA 2CFTA 4BX2A 1YJ5A 1L7NA 1EK2A 3A1DA 4C4SA 4Y2UA 4Y3UA 2MU1A 2OA0A 2YJ5A 1YNSA 5ALJA 1K1EA 1L7MA 1RLTA 2ZBEA 3ONNA 4CE6A 1FEZA 5ALUA 5AKEA 5ALQA 4BX3A 1LVHA 3NANA 2WF5A 2WF8A 3I6BA 5AKJA 1TJ4A 5AW7A 3R9KA 4NFLA 2AUTA 1Q92A 2ZG6A 1NRWA 3QU9A 2IOHA 3A3YA 4L57A 2Q4RA 2C88A 1U2TA 5AW2A 3SMVA 3ZX4A 4J2TA 5AW9A 4KYTA 4NWIA 5AI6A 2I7DA 1VFPA 1RMTA 3QUQA 3PGVA 5AK6A 2G1AA 2O9JA 5AESA 3KOOA 4EELA 5AM3A 4HAIA 2D2VA 3SLRA 2FPRA 4NABA 3UMBA 3KDPA 1O03A 3MPOA 2BY4A 2WHEA 1AQ6A 5ALDA 5AW0A 3ZVMA 2G07A 3OCYA 2NO4A 4YIHA 3U13A 3I1YA 2GHQA 2RAVA 1SU4A 1RC8A 4BEVA 2HF7A 2P9JA 2CFRA 2FPWA 2X4DA 1Y8AA 1RPZA 5ALNA 3L7YA 4NV0A 3EPRA 2B0CA 4BBJA 2I34A 5ALFA 2C8KA 3OCVA 2B82A 3FZQA 1L8LA 3FM9A 5AK3A 4IG4A 4NAVA 1MH9A 3ESRA 4FFDA 1O08A 2YMQA 4HGOA 2RB5A 4L6CA 4UASA 2RARA 2HHLA 2HF2A 1ZJJA 5AKZA 4MUMA 3PCTA 1Z4LA 3VAYA 3RF6A 2C9MA 1Z4NA 1QQ5A 3QU7A 3NIWA 3QU2A 1X42A 4UW9A 3N07A 4OHFA 3CNHA 4DCCA 4KNVA 2YFYA 1Z4JA 2HO4A 3SF0A 3E58A 3ESQA 3NAMA 5AVVA 3L8EA 3ZX5A 4Y2XA 2YJ6A 5AM0A 2ZBFA 3KD3A 4BYGA 4Y2QA 3N28A 3L8FA 5AI9A 3QU4A 1Z4IA 4UMEA 5T41A 4YCNA 5AW4A 3IJ5A 4UAUA 1RMYA 2MSNA 1RKQA 5ALMA 1XVIA 4JB3A 4Y2TA 3L1UA 3A1CA 2R8YA 4BNDB 2G06A 5AI8A 2OYCA 3E81A 2CN1A 3WKCA 3N5KA 3MC1A 2Q5EA 4YGYA 3AR7A 3R09A 2B30A 1TJ5A 5AW6A 4UAVA 1RLOA 1QYIA 5ALIA 4BNDA
chains in the Genus database with same CATH superfamily
5HIKA 3QWHA 3AKCA 1ZFNA 1U3WA 4UZEA 4QWDA 4BMYA 4C5BA 5CP2A 1SHUX 1XNGA 5B1YA 4IF6A 1Y8QB 4HYKA 3DMPA 5EMHA 1Y1PA 1C1YA 4WEOA 5LNK6 1U8AA 5A03A 3AKZA 4X24A 3EIXA 1O57A 3EBLA 5CJPA 1ZISA 4EF6A 1V7ZA 4CCSA 9LDTA 4JT8A 4EUEA 1U31A 3B9RA 3BHIA 3WV5A 2YY7A 2GS9A 3NVZA 4EGJA 4ZVMA 5HFJA 1LBQA 1NYRA 2I1WA 4M8NE 4MUEA 3GD5A 2PSEA 3V48A 3AHGA 3RVBA 3WTCA 3RBVA 1BE8A 7YASA 1U2DA 7MDHA 5BUCA 3UG6A 2QDXA 3EN0A 2QAGC 3M4YA 4F4ZA 3JAWA 1IU9A 2BR4A 2Q4OA 1EIWA 5LR6A 1G59A 2IUYA 1MEEA 1UJ4A 1C7RA 1CUVA 1T43A 4J1TA 4EG7A 5I4IA 5KFVA 1L8AA 5CEFA 5BNWA 3N0WA 4X66B 1JU3A 2BEWA 2DETA 3OIFA 2X9QA 2GEDA 1DJQA 4DCNA 2GLTA 4KIFA 5E1OA 1VLBA 3OZFA 4ZJYA 4GXTA 3S2YA 2IL1A 2K60A 2VK1A 5DB6A 1QZUA 5JARA 1O8BA 1AKVA 5IIIA 2QN7A 2RGNC 4RCYA 3RCBA 3O26A 4EB6A 2PO7A 3EWSA 2EF0A 5AKYA 5LLTA 3FGOA 3LF1A 4TRMA 1WKBA 1YR3A 3MGIA 3I58A 2X5OA 2RJNA 4Y2VA 4R1PA 4HEA6 5E2AA 1PT9A 5ECDA 3CEPB 2WWTA 4GEKA 3ZKAA 2K5UA 5DHFA 4F7DA 2BF7A 3T7TA 4NOLA 2PR7A 1Q0LA 1ZSNA 5IKMA 1E2LA 2NZVG 3BBLA 3GJYA 1JIQA 1KPHA 2D8MA 2BRUA 4YCAA 2AR7A 5K8LA 3Q7RA 3C74A 3HO8A 3IR7A 3L4EA 1E7QA 3COSA 1Q83A 3MN1A 1Q1EA 3T5KA 4AJPA 2UZ1A 3DZFA 2AYZA 3JQGA 1FK8A 1FX1A 3VTZA 1FOEB 1NBOA 3A9CA 3AP3A 3Q72A 3UYKA 4MEYA 2MYPA 2IY7A 3QEMB 3Q9SA 2GT1A 3PVSA 4LOJA 1RQ7A 1CRWG 4II7A 1ZCAA 3KHSA 2F6RA 1Z5VA 4NEQA 4A2PA 4CMIB 1UPUA 2HU8A 3B9BA 4R69A 3D9QX 3FVVA 2VJNA 1ZN2A 3N53A 4OHZA 1M6VB 4CMGA 3HO1A 5TMBA 3K7EA 5A3JA 3MLEA 4IICA 4TTSA 3K20A 1YASA 1Q95A 1H0SA 3BJZA 1US8A 3DG9A 2O0KA 4IJMA 3WAKA 2FSGA 1U9ZA 5HQJA 3T6KA 2LKCA 3SJZA 5IF9A 2ZG6A 3QU9A 1PG2A 5AW9A 4H31A 1KL9A 3OQHA 1VMAA 1YE3A 2C5AA 1WCIB 2D2VA 5DBHX 3PC8A 4GLFA 3T3EA 5DNWA 4EUFA 1GKUB 3EVNA 1OXKB 3KSMA 4DQXA 2XQIA 5JD3A 1XJWA 3KZMA 5KYWB 1M1NA 3KQQA 2FPOA 2XB8A 3SKVA 1KVUA 4HB2A 3FI9A 2NRWA 3TEFA 2XEXA 3I04M 3BKXA 5KDDA 4ESOA 1WF6A 3KQYA 4ENSA 4CM4B 3NTOA 2PL5A 4U2DA 4DARA 4HYEA 3IQZA 2OH2A 2W0SA 1JBQA 5CTJA 4LXGA 3EEQA 2YB4A 3I6ZA 2WP0A 2QIOA 4B74A 4OI0A 3NOQA 4OGLA 2ZS7A 3ZLJA 2H1CA 1N5LA 1JE0A 2QRPA 4EATA 1LD3A 5EIXA 4UVDA 1KK1A 1DTWB 2J0VA 1ZSVA 4QZ8A 3C3CA 2BFBA 3WKCA 1C30A 2X8AA 4WFQA 1AQYA 3KFVA 1RJDA 1JLHA 1NVFA 1VHWA 1TJ5A 3PLNA 1BFUA 4BB5A 4LWPA 2H1WA 5ARCA 2C4VA 4YJHA 4GDFA 2A92A 4HLQB 3ZZTA 3CLUC 3FZYA 5KYXA 3RS5A 1UAYA 1QH9A 1T9DA 4RAOA 3NHYA 4LPKA 2I4TA 5BOVA 3OM8A 1RNLA 4RPYA 5D3MB 5B58T 3TN7A 3B1JA 1UKCA 3RFXA 3SC2B 1H0KA 1PF7E 5HCUA 1VRWA 5DO9A 2O2XA 2ONJA 3O6VA 1NMXA 4O1MA 3N75A 4KJXA 1T29A 1Q5PA 5FPHA 1Z4OA 2R68A 3Q1LA 4QC2A 2HBRA 4WPGA 3T4PA 1X66A 3RVOA 4AMVA 2OGZA 2NO9A 2UUAB 5JAHA 3FUXA 1GQFA 1I13A 1XPUA 3P96A 3ALRA 3DWEX 2WHQA 4WBSA 1GTMA 1HC7A 1B42A 2D2XA 2LXNA 1IY0A 1Z37A 1SKYE 2PZKA 4U0JA 5GPBA 4EG3A 3N58A 1N6HA 2A1TS 4GPD1 2BH2A 4K9OA 2J0EA 4WSOA 5CLFA 2KPOA 4GBJA 3FKSA 4A8JC 3WRYC 1IAQA 3HRDD 1QH8B 5CA7A 4PAQA 1S77D 1TU0A 4M8LA 4HRXA 1UZMA 1AT1A 3K53A 5COQA 4MCAA 4KLOA 4QFCA 3WXMA 4EYEA 2QN3A 1NUHA 3OLYA 1ZJZA 2CDNA 4M9GA 3DVSX 3PFHA 5IVPA 3ZIDA 4N65A 2C9ZA 4GPIB 1YT5A 3LLVA 2H8KA 4OSOA 5CVEA 4MS3B 5B4VA 1VG1A 2ZYVX 3BG5A 5C34B 4RANA 3D3WA 5I48A 2YWFA 3FYDA 2YYSA 2X6RA 1ZNZA 1ZD3A 2XTMA 3FLAA 4EA7A 3F4LA 3QVKA 2YJGA 2QPTA 4MI6A 1YV9A 4WKCA 2IXFA 5L51A 2FX5A 2H17A 3U80A 2W9CA 4CLDA 1RYSA 4XDHA 2JL1A 2I80A 4PPGA 3HDHA 2PAFA 3ICPA 4PIPA 4L08A 5LL6P 1V2HE 2CB0A 4QIHA 4W7SA 4P0QA 3EXIA 4Y1RB 5LXTF 3VPBA 3Q3EA 2WUWE 3N8HA 5HVNA 5EERA 4QLOA 3ND9A 3UY4A 5HJEA 5KJCA 4P4PA 2X7XA 4P83A 5E4TA 5L9XA 1N5IA 4NLLA 3NDRA 3SMVA 3U4HA 1R6UA 5F4BA 4JL8A 1H4VB 3ES9A 2YHUA 2RDMA 3SS9X 5L4SA 1M2FA 3UT6A 2AMLA 5ALDA 1L4GA 5T3YA 4OO3A 4UU8A 3UG7A 1F51E 3IHLA 1SK9A 3EIQA 1NE7A 4FN4A 1E32A 4NV0A 2GNOA 4NZOA 2CMHA 4DS5A 1XRLA 4KPEC 2IBTA 1FFSA 4EA8A 1Y3IA 4RJLA 5JALA 4OOFA 4LYEA 3MTGA 1WMBA 1SVIA 4LRUA 4HQ6A 4K26A 3ELBA 2IP1A 1M2GA 3QF4B 3EQ6A 3H2BA 5TMPA 4Q82A 1FMFA 3HM2A 4BN4A 3VA7A 2P78A 3EPIA 2DGDA 1X9GA 1GYRA 2F4NA 2R8YA 3Q6MA 5L3SB 3LT0A 5SY4A 2C92A 4IY1A 1RBZA 3GCDA 5FA5A 2AUMA 2FZWA 5E9AA 1YCGA 3HEAA 1JR2A 1XJ0A 4EKNB 3M4JA 3IAS1 3BS5A 3DBHB 1I3NA 1IYZA 3WGGA 2PL3A 1Z0ZA 4RL6A 1MB0A 3VZRA 2HSWA 4CHGA 4MB6A 3SR0A 1JXAA 1MO2A 3I64A 4BQEA 4KE6A 2DPXA 3KR2A 4NCXA 3AUOA 1C7ZA 2BFMA 3A0HU 4JJEA 2PVCA 4YRNA 4HC4A 2EGGA 2G77B 1Y81A 1KTVA 2DH6A 2IGTA 4WY5A 5LLSA 4TLEA 3WY9A 1RQXA 2ODNA 3D5EA 2PD4A 2WNHA 4LJRA 4AIRA 1GRNA 2QLNA 4RPCA 5AQEA 3CSSA 5HZHA 1NP7A 4EUSA 4UZFA 4MQ5A 3HDYA 4EYQA 3NWJA 3A26A 5H0IA 4WK0B 3BWCA 4Z53A 3FETA 2C84A 1SCNE 2QN9A 3R9XB 5KT7A 5KAMA 5G1PA 5TPZA 1OX4A 2HIGA 4XR9A 5D4BA 4F06A 2GO7A 4DM3A 3KNZA 4RW0A 1URPA 3L7JA 1XTSA 2N46A 1ONPA 2H1LA 3ADKA 3WBJA 2R47A 5DI3B 4MV7A 4N5LA 1I5EA 2D3WA 7ICEA 3O3NB 4WRRA 3DW1X 4BY9E 1M2JA 5F64A 3HMQA 3SAGA 1K5OA 2DPGA 1Y3BE 1AMUA 1Z3IX 4PQFA 4L6AA 3HJBA 1USKA 1WD5A 2WG0A 4TKZA 4E88A 4QJ5A 3THXA 3IEXA 3HJUA 4DL4A 4HI0E 2ZU0C 3R7FA 3AEQB 3BQ1A 5B30A 1PVOA 1CVLA 2PY6A 1NXTA 4QZHA 1N1EA 4AY6A 1HQDA 4EJ2A 3AVUA 3ADBA 2DUJA 4DLWA 2PHZA 1YACA 2C3UA 4MQBA 3X1JA 4H2DA 4YJ2A 4RVGA 3VCBA 5FBRB 2P11A 1ADBA 4EAQA 1MU0A 3DAHA 3X44A 2P2YA 1WM1A 2C2GA 1KJ9A 3I45A 4OM7A 1AHHA 3LHFA 1F8YA 4LV8B 2AFHA 2Z1MA 4DWOA 1O8CA 3WGVA 2OZKA 4RC9A 4Y9RA 2JEFA 3TIXB 5F5NA 3EQZA 4H3SA 1T2FA 4MFFA 3Q5DA 4E2WA 4F4YA 1FVFA 4D3YA 1VPTA 4JP1A 4JV0A 1GSAA 4RZUA 3N7SC 4YN4A 3NS1A 2JH9A 3VNVA 1LV8A 2GAFA 3DYIA 4QJ3A 5JJKA 4EEKA 1Q44A 4GOJA 3IDSA 1RZRA 4XQ8A 2H5XA 5LUAA 4C4SA 3VU3A 1R0RE 4TSRA 4W5QA 4YRRA 1QSGA 2DWUA 5I7VA 2CY0A 4CLRB 2RGCA 1ORIA 4NFLA 4WGGA 2F8TA 1BU8A 3ORQA 2R5FA 4GBED 2NUTB 2X9LA 3IEIA 3SJCA 3DUFA 2IFTA 1CU1A 3G9UA 4RUAA 1T10A 1ZINA 5B2ZA 4EECA 4AUEA 4UJ5A 4IPTA 4O2BA 3O8LA 5HWSA 1KO5A 4ZVPA 3D6UA 3R6LA 5UKDA 2OESA 3CLVA 3QYAA 3SV3A 1Y6JA 4ND8A 1OROA 3DT9A 4IRXA 4HX2A 5K0NA 3P1JA 3CRMA 2QRVA 1RJ9A 3O4FA 4YCSA 2X2FA 2KJQA 3SC6A 1KSPA 4AB1A 5CH3A 3KXKA 1GRRA 3GEPA 3LOUA 3KT3A 4J3JA 3SF0A 1Z34A 3B6IA 3DE1X 2A5JA 4XYMA 4M1SA 4F5OA 3VYTB 4YY3B 1VCNA 4Z1OA 2IXTA 3AVYA 3C15C 3HXLA 3CXRA 1UWKA 3N0VA 2AUNA 3BC1A 1MFZA 1PR9A 3ZXUB 1S5PA 3BDVA 5ICSA 2O2HA 3QXCA 1MJGA 1ZVJA 1N8TA 1XZCA 3KPWA 9ICSA 1T5HX 3LPCA 1KI6B 4BB0A 2ODBA 3WICA 2PU7A 4KTTE 2EAPA 5IIJA 2P5YA 5K3FA 1ZXBA 3CA8A 1U9JA 4G89A 8ICBA 3FTFA 5HKBA 4G0XA 1UODA 1E7SA 2O7NA 2W4QA 2WILA 1XRRA 4G41A 1ZRMA 1YRHA 3WGKA 2GZRA 3CN7A 4BLRA 4K6OA 2PJRA 1NT2A 3OQMA 4ZT4A 3T1VA 2JLRA 2X8JB 1J39A 1H3NA 1XFDA 1UK9A 5A9SA 4NEHB 4NCAA 3G2HA 1YRWA 5C8VA 5BOSB 3V55A 2H4XA 3VNRA 4ZOQI 2X1HA 2Q5OA 1NW6A 4IS2A 3FDJA 4UEKA 1KDRA 2DWQA 3FLEA 1LPAB 3T54A 3ADDA 4YUAA 2R751 5ENZA 1NI5A 5LOVA 1OWPA 2WG2A 1OASA 4C6TB 2MU2A 1OMOA 1XTUA 9ICEA 3AM1A 4CTOA 3EF1A 1O96B 1JFFA 1OIWA 3MDAA 4YREA 3PZBA 4FZ3A 4E15A 4P6VF 2IWHA 4CDGA 4X1KB 3EF3A 1N0HA 4KGVA 1G5QA 5AXBA 1XHFA 1KQGA 3KQHA 3TR5A 3K3PA 4OHBA 5J0OA 3V72A 3UAGA 2ECKA 3KVOA 1M0EA 4TLLB 3KYDB 5JDCA 2EP7A 4IDQA 3DCNA 4I9NA 2FY8A 1A98A 5EHZA 4QWBA 1D1QA 4FLMA 2ZRCA 4MCHA 4JJGA 4IVQA 5DYYA 3CSUA 4BZWA 2Z4SA 3VH3A 4OQDA 2BKXA 2J5BA 3LK6A 3F6BX 3ZQKA 5EMLA 4F8RA 2B8WA 2FUEA 3SEIA 5EJ5A 3RSOA 2C78A 1IHPA 2WA2A 3MWLA 4Q3KA 3RABA 3CH6A 1TF7A 3MSCA 3T4UA 3M7DA 2VK4A 1AZLA 1DUVG 2RDJA 1O94A 4D8WA 1R6TA 3SZMA 3RSQA 5JXHA 3FTPA 3DO5A 4KSBA 3REQA 1B43A 1L7XA 1F1JA 3N1UA 3QUCA 2K4PA 1PWHA 5ILQA 8ICZA 3QUBA 2W2NA 3QK7A 2Z5VA 5J2AA 1G8GA 2C0QA 1P45A 2DHEA 5CVUA 2FXVA 3H4DA 5HRCA 1XCJA 1HKHA 3GP8A 1TIBA 4BNZA 2FSFA 2GXQA 4D46A 3K9BA 2KZMA 1N2HA 4IHQA 5DN6A 4LBVA 5IPFA 2CNBA 5FOWA 1W4ZA 1LVHA 5G41A 1NJ5A 4BNNA 1P5FA 2AW5A 2H9AA 4B79A 1SQSA 1X15A 3TQHA 3DH0A 3DVQX 3GIJA 5AW2A 2Z8ZA 5KSZA 4RIFA 3BZKA 5LDGA 3JVIA 3K9LA 2J5XA 5CDSA 2ZB3A 4ZTZB 2WHPA 3KLBA 2MSCB 3M6XA 1YTUA 1KH1A 1W2WB 3EVCA 2C2OA 2I3AA 3SDBA 3GARA 2VR1A 2ZRPA 1USWA 4NE9A 3F7NA 2I76A 4ZYLA 1RYEA 3DMTA 4Q12A 4NZNA 1P4GA 2BEVB 3DBLA 4M0DA 5KFAA 5AUNB 2XGOA 4HWKA 2H0QA 1H5NA 4IOKA 1CF4A 2HCBA 2JKVA 3ZI0A 4G2NA 3SZRA 1YZ7A 4Q3CA 1Z6YA 4RTMA 2WQ7A 3KZKA 5ECYA 4HRYA 5T41A 3MYYA 4KGXA 1UAGA 3VR4A 3EAQA 4O5CA 1W47A 4UOQA 1C3VA 4MWBA 2I1LA 4ZFNA 4JT4A 1BHJA 4HWOA 1KY4A 1WMDA 2PGNA 2I4LA 3EMVA 1P80A 2QV0A 3OIGA 4DE5A 4ED9A 5FJJA 3SHWA 5LZ5A 1UJNA 2XMZA 3LWMA 3RH0A 5H82A 2HFJA 2BSXA 1QIGA 5JO0A 3DDUA 3ZQJA 4IL6U 1VKOA 4H35A 1W19A 2PUJA 5IC5A 2B5OA 5EXPA 3G49A 4Y6LA 4YJ3A 2XZPA 1RBQA 2UVVA 4JITA 2OKCA 2JV3A 1WHSA 2R6HA 5DX8A 1RVDA 2QTWB 3EISA 2V4RA 4ND5A 4MULA 1EM8B 4W6ZA 5JO9A 2YC4C 4C4PA 1JJVA 3KBOA 2BTEA 1IG3A 2QLMA 4HQNA 2ZUDA 5KJ1A 3KYIB 4GL2A 4Z5XA 5I3CA 2MMCA 1RM3A 1ISFA 5K0GA 1Q3UA 2DFTA 5TXGA 2VJMA 1ID1A 2XGPA 4RA6B 3MWEA 4IR7A 4MO9A 5BN4A 4ZREA 3O4HA 1V7PC 4P36A 4P4SB 4F2GA 4OQFA 3S2GA 1U6JA 3KOXA 2RH4A 2WWFA 1X1CA 3HE3A 1SHJA 5JJIA 4J9PA 4YRMA 4KLLA 3F5SA 1SG0A 4K6HA 1F4PA 2D1TA 2WTXA 5DCUA 4ZIRA 2CT8A 3IFSA 3EVFA 5T8KC 1WZIA 1IHUA 2DSNA 4J0HA 3RJ5A 2HMYB 2F48A 9ICJA 2V5VA 4GD3Q 4RZIA 5IT4A 1P29A 4CG3A 3GRCA 3DCIA 4I2BA 1JHAA 1K8QA 4DN6A 1NBMA 3A70A 5J4VA 2VP6A 1AM4D 5D85A 2HWKA 1ZM9A 3WL6A 3OWHA 1DU4A 5KOJB 2FPMA 2PI4A 4LC0A 5J0RA 1RPJA 5AHOA 3B1ZA 4PX9A 2QARB 5DGTA 3IV9A 2W9AA 2YHIA 3R0ZA 4NNOA 5J2CA 5D5PA 3ZHZA 5FBLB 2IYZA 1ZUD1 2VWGA 1RZ3A 3GV8B 3QA9A 4BE4A 1SBTA 2P2NA 5B2FA 3ZHUA 1RU3A 1XKLA 5FULA 3ZWXA 3HVHA 2XB6A 4JP3A 1WWVA 2FCRA 4MFAA 1VIVA 4TTVA 2BP7A 2OMEA 5JS2A 3LPLA 1EDOA 3AU8A 3CE6A 4DWVA 3RLFA 1GSHA 2IE0A 2RHFA 2EL9A 5DBGA 1Y6ZA 3UUFA 5KFHA 4DMGA 1E2EA 2FFRA 3RK1A 1NKBA 1W5FA 1WMFA 5J2HA 3ZJ4A 1SUAA 4C7OB 3GLSA 5F52A 4QXPA 9ICFA 2EJTA 2R66A 3H6KA 4BWGA 2AD1A 2HNKA 3VYWA 1ACLA 3A25A 3H2IA 3PFFA 4TMKA 3ANSA 3KZ1E 4MV8A 3UWPA 4D0RA 3DWIA 4OJPA 4RT2A 3LSYA 5TE9A 4YAJA 1ARZA 1JWLA 4R64A 1MOSA 4TQAA 4F4CA 1S4QA 5FXMA 4EIWA 4PLVA 4DEXA 2B4QA 1JHOA 1DQRA 4L74A 5TVKA 4C6HA 3JQFA 2GZMA 1O6ZA 3KEGA 4XR4A 1Q15A 3N2NA 1B7GO 2WZDA 4GSLA 3IMKA 2A0WA 3LVBA 2GRUA 2ZVQX 4BMNA 4DA9A 3LV8A 4F5ZA 4EB0A 5EZ5A 4DF4A 1ZQGA 5IFKA 5IJAA 1UANA 2OBFA 5I8ZA 4QZ9A 2YMQA 4RDCA 4KQFA 3GHHA 1DPGA 1JDBC 4WZAA 3I72A 4OHFA 3N5CA 2R18A 4NU6A 2WZQA 4MQEB 4FOTA 2JIZD 3A8TA 2OCKA 3NHRA 4FCWA 2ZAMA 2ZLBA 2FQQA 4E2YA 3R09A 1ZQDA 1WXEA 1F6DA 3NHJA 4DXHA 1IJKA 4N3BA 3Q12A 1D2CA 1REQB 3RB3A 4NG5A 2H52A 4OJTA 4RMGA 3LWNA 2I4IA 4MZXA 4AJOA 3FDSA 1ZXLA 2Q2NA 1JDZA 1IEQA 3RB8A 4ARIA 4HNUA 3I61A 1T8WA 1I3KA 1N3LA 4RPJA 2XXAA 2XMGA 1JH8A 5CJ7A 2FMUA 1GU1A 2WVGA 3KJHA 4GPBA 1S8FA 3KJXA 5JJCA 5LB2A 2OFFA 2WQZA 2ZUVA 4PYJA 2Y67A 2O57A 1B0PA 4J16C 1L1RA 4E30A 2OILA 2W2MA 3MB5A 2E55A 4GI2A 3L8GA 1JAHA 3FAKA 3GFGA 3RVRA 2Y92A 5BT9A 2PYIA 3RWBA 1IIPA 1TKCA 5T7BA 3KHKA 1E5DA 2X86A 1JQBA 1BZYA 1J8MF 2AXNA 1T8YA 4ZVQA 1KZ9A 3DOOA 4CG2A 5DHSA 5EN4A 1ZD5A 5IBRA 5L7WA 1GA6A 1ZQFA 4HGZA 3SPXA 3B7GA 2QQGA 2JHPA 4LY3A 3DXXA 1L4KA 4RXMA 7GPBA 5FWXB 2E6KA 2I5PO 2JZBA 3K5PA 2FJ0A 3RIXA 3DDOA 2XBLA 3U5TA 3WGUA 2BGRA 3R3HA 4RTOA 1GTJ1 4OJQA 1P9OA 1JKJB 4KRGA 1T2AA 1CQZA 4B9AA 1NDHA 1Y7TA 1GPH1 1YR7A 3D81A 3QSYA 4EJFA 2B3TA 2PX4A 3T5TA 3GRVA 2EQYA 3RIYA 1HTBA 4C7KA 5DBEX 3N0XA 3ZTYA 1MJFA 3PX2A 5CLQA 1LKYB 4EBFA 3AF3A 1U99A 2GM4A 1P1CA 3R7NA 1SG6A 4KPUA 2XRZA 2QX7A 2FLNA 4B6PA 2WSYB 2AR0A 3B12A 4RF3A 5FFMA 1XTBA 1P3Y1 2G71A 2BFDB 2BONA 3TIGA 2C4MA 4R81A 5CT6A 3CH7A 1CJBA 5A02A 3TLGB 4INOA 3SE7A 3IAUA 1U4NA 3WL7A 4BKPA 2VHXA 5LQDA 1HLGA 1UOPA 3TB6A 5KFXA 2QM7A 3GUCA 1JDSA 4JK3A 5FNVF 5C1DA 3ROEA 5LZ7A 3JWPA 2GYVA 4J43A 5KHOC 4WQMA 5ALWA 4OHPA 2ZUCA 1EXMA 2X0JA 2UVPB 3NG1A 3GGJA 1X9SA 3WO1A 1N4DA 3VPHA 4QDJA 3TGPA 1PNQA 2P91A 5F5LA 1XQYA 3KB8A 3F3YA 2VP0A 1LBHA 4TV8B 2SKEA 3BMXA 5KDOA 2PA0A 3B3QA 3L7DA 1K1EA 4NY8A 4P3PA 1SVNA 1P7WA 3JZIA 1RM4A 4TWJA 3BXGA 3VM6A 3KAPA 4IJQA 3PMLA 4R9NA 3IUNA 4FMBB 1CEEA 5FUYA 4V2UA 1Z2AA 4PHGA 2Q9UA 3E9RA 4DLGA 2D62A 3WL5A 1WZEA 3C6QA 5TQJA 5ILOA 2PUWA 5EINA 5K5EA 1GL6A 3O9ZA 1M34A 3E5NA 4EVQA 3FD8A 1FQWA 2VKTA 2HIAA 1RQRA 1SFRA 2OYSA 2GTPA 1MHPA 2HPAA 4XSVA 3HP1A 3A6LA 1WLYA 3SQWA 2ZIUA 3OX2A 1D07A 4C3ZA 1Z18A 1ZITA 1TTPB 2X2PA 2OG2A 3V7FA 3GO4A 4Q1BA 4XIIA 4X6XA 1W85B 2VSNA 3FIJA 1MAAA 3QVGB 4U7TB 4DYVA 3R3WA 2BBWA 4E5NA 1JQLB 1DARA 1UM9B 4MV5A 1NK8A 1YH3A 2H3QA 3SZOA 1FLVA 3M9MB 1T9GR 2QD3A 4ARVA 3ZWOA 4JVMA 1HRDA 1OC4A 1WMAA 1ABEA 3Q5EA 1GTG1 1GPKA 1SK8A 4LXQA 3ZVRA 1WS6A 1KY3A 4RVFA 2ZBQA 2GXAA 5J4LA 2VJLA 5BNTA 3VV3A 4A2CA 1PK7A 3R7WB 5JWOA 3O73A 1KMIY 1EUQA 3NJ8A 5F23A 3VOAA 3PDWA 4E5PA 2IUEA 1ZQWA 5FAXA 4KL8S 4Y7CA 1EVZA 5KT5A 2Z98A 2B37A 1ZIPA 3IILA 1N48A 2I9KA 2PLRA 4RQBA 2EGUA 2PTGA 2JGKA 4LYHA 2IW3A 2QTTA 1EXWA 3TBKA 7ICOA 4DKXA 5LWQA 2WM8A 3FJ1A 1D3AA 2Z30A 4KXYA 4O3MA 3OZ7A 4QRDA 3ANLA 2JBAB 4HH0A 1TUGA 3CRQA 4Q39A 1POWA 3HVRA 4C4OA 3S40A 4UU1A 4PGFA 1A82A 7AT1A 3PDIA 1B1AA 3ZBTA 2RHWA 3IHQB 1GCUA 3OBBA 4XQEA 5I9IA 2COEA 2BCUA 1J2EA 1HE3A 2RQ5A 4QOGA 5C0OE 3IAFA 2PQ0A 4IXTA 4U2BA 1NA5A 1XLTC 4TYNA 1E6KA 4BVBA 4D9KA 3C8ZA 2NZUG 3AI1A 2WM3A 3G68A 1ZCBA 3W5CA 8ICCA 2B94A 1M72A 3HI6A 4EQ6B 4RL4A 2R1UA 4UTXA 1IBKB 3DEJA 4NBWA 5FTWA 3JSXA 2NRZA 4PU0A 1S6YA 3H1TA 3WK5A 1GYQA 4TTJA 5CCBA 1J21A 1ZAKA 1LZKA 4YT5A 1U3FA 2XC9A 2DY1A 3VTKA 1JQ3A 4B4UA 3E82A 5B6JA 1YR8A 2P4EA 4Q44A 2OV6A 2LP4Y 2OHHA 4R2IA 3VJRA 2Z57A 2OCIA 3T9BA 5K3EA 2C3PA 3DEEA 1BWPA 3W5UA 1TYAE 3KK0A 4G4SP 2FEXA 4WESA 2D1YA 3ESDA 1DXOA 1PNVA 3GMDA 3WG9A 5F2EA 3MWYW 4WUTA 2KE5A 1DBVO 4W5TA 3A0BU 4TYYA 3E61A 1L4UA 2G8NA 1X74A 5DLPA 5IKPA 3KQPA 4RNCA 3AONB 1O95D 3TR0A 5EUQB 1Z15A 2YUTA 4YXWA 1SCIA 4WBNB 2H7XA 3W6UA 3HWRA 1ZXXA 4MS1B 3HP7A 1SBQA 1S7CA 4OXQA 3LECA 2H07A 2QRZA 2ZRBA 2DTEA 4D2IA 4XD7A 3EIOA 4DC1A 2FPSA 1X7YA 5FNVA 1N1MA 1HEYA 3FPFA 4UNRA 4JQOA 2E37A 3SQXA 2P66A 2F3NA 4EJMA 1TJYA 4BP1A 3WO0A 1QG6A 5DGHA 3OE1A 1CT9A 2GPYA 4YQWA 3KZXA 3FWYA 1Q17A 4D9MA 3OZBA 3HP6A 1X9XA 4F4WA 4HAUA 3OJWA 2HW8A 3HHPA 3QZ7A 2MU1A 4E5UA 4EBBA 1TEXA 3V4SA 1IOWA 3RTEA 3KQVA 3OIWA 2RHTA 3R9KA 2PKWA 1OH7A 4R9RA 4RQUA 4WKOA 2GERA 2XE7A 4KQEA 7ICHA 3U4CA 3U40A 4HAWA 3K9NA 2L18A 5L9AA 1CZUA 1ABFA 3L6CA 3ZVMA 4ZMSA 4D0GA 1QIFA 3PRKE 4QUKA 3KEOA 2WDPA 2BW0A 3LP5A 1XD2B 1Q3TA 4YNBA 3FDZA 4PH5A 2OAP1 4EHLA 7ICTA 3HUEA 3KP1A 4H60A 3EOAI 4MB2A 3BMQA 3STYA 1KOGA 5HPYB 1EMDA 4GI5A 2HBQA 2QRGA 1N34B 1O2DA 4WKGA 3EAFA 2NOAA 4FP9A 5DNDA 4WZBB 5IMSA 2EFGA 2WE7A 1Q1QA 3U44B 4YRIA 3OI7A 1DBSA 1UMDA 3H5WA 4PO3X 4DPKA 3OU2A 4CV2A 5DB8A 1WSWA 5G5GA 3RVNA 3GLGE 4UE6A 3SHVA 1ECGA 4QUAA 3S70A 4RSMA 1XKQA 3WGZA 4F5NA 2BMEA 4TS9A 4MROA 3AY7A 1WB9A 1YJXA 2AWNA 4V1CA 2W4MA 3IKVA 4Z4IA 2JH1A 1U7UA 1S89A 1EPUA 1SKYB 1GOTA 2FWNA 4JCCA 3P9PA 4DHWA 3BEDA 4IILA 1ISIA 1NBHA 4J9MA 3RH4A 5EJ6A 1BMTA 1J7JA 1Z68A 4R54A 4RMNA 3NDPA 3NC1C 1HE1C 4FCVA 1PE0A 1VGRA 1UDXA 4UDYX 1OI7A 4LNAA 3MAGA 1G98A 1UQVA 1VLQA 3ETHA 2O8EB 2PVPA 2ZSIA 3DM5A 4U9HS 4CF3A 3IV7A 2LPEA 4LDZA 1XLVA 5KHAA 2XTNA 3ZWVA 2I03A 4CCHA 1SHZA 4GQAA 4OX9Y 2VWQA 1PDVA 3UJ8A 1Z88A 4L3VA 1LPPA 3GD7A 2O2EA 4U2EA 2E7ZA 1Y9JA 4TTTS 1ECWA 5BQ3A 2Y6UA 5BW6B 4R1SA 5JQWA 4R2WA 3UQZA 3OJCA 3PUZA 2BFCA 2AG5A 5K03A 3AM3A 1ECLA 2X1VA 2G5TA 1KGDA 4HB4A 3FWPA 5BPFA 2XECA 1U1IA 3F67A 2VQ6A 1A76A 3QVUA 2XY6A 3PF9A 1LPBB 3L49A 3ZYCA 2P77A 5EFOA 1X8XA 2AOUA 1F06A 5BUZA 5I9TA 2J09A 7ICKA 1Q21A 4TQ9A 2JJQA 1YZYA 4ECVA 2JLBA 5J2TF 3UAYA 4KO4S 2DKNA 4OKSA 3I3OA 4XIGS 1WQ3A 1XSPA 5KQMA 2FWJA 1H3FA 6Q21A 1V9CA 1JQDA 3IEMA 1ORHA 1ONSA 2G5PA 5BN3A 2H4WA 2MR6A 4A0QA 2OCEA 4HS9A 4MW1A 1P73A 1WV0A 1I6MA 4YHHB 4PAOA 2J45A 5CA0F 3NHZA 1W46A 4U00A 4EG4A 3QNUA 2GN0A 1E79D 1KAGA 1CQXA 2VZ0A 3AETB 4KREA 1UPXA 2OD2A 4YG2A 1QCYA 5J23A 4K6CA 2YICA 1Z13A 3SIPA 1U0BB 4M0PA 4I4TB 4OB6A 5ESXA 1GQSA 2Q3EA 2N75A 1E4EA 4JSTA 5L3ZA 1XTKA 5BW4A 4XTRA 1V38A 3DT8A 4LHYA 4DCMA 4HY3A 4O3NA 1OZFA 4Q1DA 3M6VA 2Y8EA 3G7SA 4XA8A 5TQ0B 1TQDA 1UKBA 1PFYA 3IP6A 3KHTA 3HDTA 3PX6A 2YY5A 2QNIA 3VR5H 1TW3A 5DQGA 4C30A 4O59O 5AUPB 1EZ1A 4EHFA 5A4IS 1NQUA 4DJTA 3EQ9A 4F9FA 1UBMS 3TARA 1NBIA 2CJPA 1ABBA 3MJVA 4NOJA 4AJEA 2LCFA 3K94A 4FW9A 1B93A 5CBKA 1NVAA 1NJWA 4Y0AA 2BSQA 3ROPA 5G0SA 3K32A 3AEVA 1Q0RA 1L5GB 2ORWA 3IB3A 4RE5A 1LTKA 2GK7A 3C6XA 2QSZA 3SZGA 3L8DA 5ICCA 4WZBE 2CF6A 2XOKD 3EUWA 1XS9D 2DLCX 2RAFA 3Q11A 1E59A 2ACKA 3ZU2A 1A4XA 2X4DA 4RH0A 4P3XA 4Q1EA 1YCDA 3HCBA 2O2DA 5LP6F 4NBKA 1I1HA 3EGDA 3EOZA 1NY5A 4UB4A 1GUDA 3K72B 5EJAA 3G8YA 5BOLA 3QFRA 3PXAA 3HYSA 1JEYB 1WB6A 1IEWA 1FPQA 1RHRA 4N7BA 4DBVO 5FUVA 3C5HA 3RAFC 2ZTEA 1V9SA 2IE8A 5IRCD 1GEEA 3HXOA 1C9DB 2M6RA 4JUCA 4B33A 3T5LA 4FS8A 3PJRA 4MIYA 3GGCA 3EDRA 4JENA 1K1QA 1RYZA 2XSZD 3MS4A 1JN0A 4O2AF 1CJCA 1XQ6A 1J22A 4YDSA 1PQYA 3MPUA 1NR1A 3G9TA 2HTEA 2C9DA 4EW1A 3ZLTA 5BWNA 1Q12A 3A9TA 1O6CA 2FZCA 1KEPA 1TM4E 4NBRA 3H65A 1HL3A 3C6KA 1VPDA 3KVVA 3KQWA 4CDRA 2JVIA 1UMCA 3RVJA 4TOIA 3SSOA 2VQSA 3KTOA 3AZQA 1ZIDA 1UJ6A 1SU6A 2JCXA 5A3QA 1T5IA 3I9NA 3MCUA 4HAOA 3G2OA 5DCLA 4I6JA 3AWIA 1EE9A 3KAQA 4M86A 4TVSA 5IK2A 1IWOA 1W4BA 4DYHA 4M87A 1ZUNA 1ZNYA 1JAIA 1I33A 4BV2A 2A9JA 4YJ2F 1DK3A 4FR5A 5LQNA 4J29A 5DF1A 2F1RA 1XJCA 1A9OA 4U3JA 1FXUA 4PYRA 3QYPA 1PJ4A 3OF2A 2ZIXA 5KSPA 3L1IA 5ARDA 4YP5A 3CZAA 5JATA 3H2KA 1YZTA 2C95A 1PT5A 2D4HA 4KX5A 4LK3A 2Y27A 2W3SA 4P2HA 3L1VA 1EDEA 4DFDA 4Q43A 2VXBA 2Y93A 4LVNA 3ZHYA 2J48A 4ECWA 2CXSA 1ZIXA 3C8DA 2Y9UA 2X0KA 5K8JB 5BN1A 2L0XA 1L5YA 3G5LA 3R2JA 4Y6GB 2GMWA 1IUPA 3VU9A 1MO6A 2J1LA 4QREA 4TZ6A 1H22A 2WJWA 3THRA 2FMIA 2JBHA 3L0CA 5CG1A 4LZAA 1A8PA 2PU5A 1EK0A 2BHNA 1MAVA 3LWDA 4MRNA 2O1XA 1JYFA 3IBFA 4JT2A 4KNYA 2JZNA 2W6ZA 1ISPA 5E6UB 5J2TA 3OCWA 5F7ZA 4C43A 4OHVA 4GEGA 2AX4A 4EJSC 1EUDB 3NBFA 4O2BF 1KEEB 2QLFA 1C80A 5KYYA 3LRPA 4TMYA 3I9KA 3OICA 1FIQA 4R8RA 5HFNA 1J56A 4JWKA 3JQPA 1TVKB 1G5IA 2KKVA 2NVOA 3BT7A 1JFVA 1PWEA 3HADA 3CZ4A 5CA0A 1BVHA 1SVWA 2H18A 4Q4HA 3AFGA 1CS4C 2EL7A 2BHTA 1RE1A 4P0PA 4QOFA 3LYLA 1V5WA 3ZU4A 3E3AA 3QQPA 3T0FA 1PZXA 2CMFA 2X2EA 1DWQA 1EINA 5HILA 1Y9AA 4C80A 2H2FA 3ORYA 2V6JA 2WWGA 3GAAA 3ZLUA 3VSDA 4KI0A 4REQA 3TLMA 3QKSA 4YGXB 4JUDX 2Z9DA 4Q4AB 2A58A 5TQ2A 4UMFA 4X90A 2JDIA 2M2IA 1JZTA 3QE3A 3WWYA 4N5HX 4M7OA 3OEHD 4P4GA 1RLTA 4LRTB 3PCXA 1H2FA 4OAQA 3JQAA 3R24A 1YS6A 2F4VB 1ECJA 2Q0XA 1QGZA 1HYHA 5EIEA 3ANMA 1E6MA 2CMKA 3RO7A 3SVZA 1BIFA 4EW3A 1U0RA 3QUQA 2BFEA 1BWSA 3AL0C 2PFOA 1E6CA 1JHXA 1CWUA 1F7UA 4OIFA 2R0QC 5F3XB 2VG8A 3DNFA 4OOEA 3T9FA 2W6JD 7ABPA 4IRUB 1FS4A 2V7XA 2Z8XA 3QLVA 4HQFA 2RAVA 3SS8A 4EO4A 1DE0A 3RW9A 2VSXA 4ZVUA 1WSDA 4R0VA 9ICBA 3Q7QA 3GG9A 4YWJA 1EFPA 1PG0A 1NPTO 3RRGA 4JQSA 5LP6A 2YHSA 2G9RA 3WLPA 3FFWA 1UKAA 1Z4LA 8ICRA 2QSUA 1JALA 2MRLA 3A2LA 5K01A 2WWWA 2RH8A 2QUHA 2R1VB 2DEUA 3RSCA 3H9EO 3OPYA 4TRNA 1Z4IA 4UMEA 3JD2A 4Y30A 4PS1A 5LOVF 1Y1RA 5JBQA 4O2AA 4MKHA 5HEKA 3CVYA 4K28A 5EWLB 1DC6A 2GD2A 4B34A 1DMRA 1YKGA 4B6GA 2RC5A 1E2KA 2ZUEA 1YB5A 4GS5A 2VTVA 3MT9A 5IJZA 3B1WA 4HG2A 2RHGB 1Q11A 4ITRC 1B14A 4OJ6A 3TEJA 2E0IA 4P31A 1NP3A 3IRUA 1AV6A 3IP4B 4KLJA 5IYZA 3BA1A 1N77A 2WUDA 1Q7TA 2BPOA 1OFIA 4L95C 4UXJA 4GI3A 8ICFA 1CSEE 3FJOA 1TOAA 1AK9A 4B3XA 3JX9A 4BUCA 3L8HA 1KWGA 3EUEA 4NESA 1KFTA 4BFYA 4PR0A 2OQIA 3ZCRA 1Y37A 1C1DB 2HBLA 1H2EA 2DLDA 1A8UA 5EMKA 4QOJA 3TNFA 1CE8B 4PZCA 2CBZA 1IXRC 4TS3A 2AN4A 3K1AB 1V71A 3QNMA 3UV7A 4F4FA 5DULA 1NVEA 1THGA 4UHJA 5F77A 3PIIA 3CF6R 2ORYA 4TLBA 2HK9A 1JHQA 1OFHA 1MZVA 4NK5A 2EZ8A 5IVHA 2Q21A 2BBOA 4ZC8A 1Q22A 1SUBA 4AJHA 4B4KA 4WCVA 4XSGA 4Q1CA 3WP0A 1JG1A 3SM9A 3EYZA 4KRFA 4NL9C 5GV7A 1Z7EA 2X4LA 4QWMA 3QTTA 3NTUA 2FJPA 1ONOA 4M6WA 2MSKA 3FNQA 3B2EA 2HA5A 4F50A 1SHLA 3Q7SA 1RP1A 4KE8A 5LQAA 4FE7A 5FORA 4FX5A 5BNZA 4YAOA 1AX9A 3DF7A 2C1EA 4F8YA 1ZD2P 2JATA 4R2MA 2EGHA 4RVHA 1CY8A 1DDGA 4MO2A 1YMQA 1QKIA 1SWVA 1N5WA 3UK2A 1DKQA 3RVLA 1WP4A 5IXSA 1RADA 3CLRD 1D7AA 4IIJA 3H3JA 3FRHA 1GPDG 3NP9A 2PJZA 2E18A 3EBOA 2W54A 4FFVA 4E32A 3KCNA 1XDGA 4KK3A 4H7EA 2HHWA 1FO4A 2FN7A 2OV4A 4XPZA 3RYFA 4YRLA 1PGQA 1ANKA 4Z8YA 5DBCA 4QTUB 3AQIA 1VRCA 2CJFA 4ZOHC 2DF4B 4AT1A 2ZSAA 2KP7A 1W9HA 4ZHQA 4EYOA 4D4KA 3OJOA 1IOVA 2WOJA 1JILA 5KSOA 2HA2A 4FYKA 4G4SO 3HN6A 1E9DA 3OKCA 5GQSA 1TKAA 5JI2E 1R12A 3G8DA 2BZ1A 1SCDA 4QUHA 1NK7A 2P6UA 5G0TA 3D2LA 1QS0A 3H2GA 3WP1B 3MGAA 5H02A 2XDYA 3EVEA 1R37A 4OUDA 1TK3A 5EYPA 4OJLA 2WYHA 1ZNWA 4DABA 4YJ3F 1M3SA 4XVQA 1X7WA 2W7PA 2WMYA 2R1TB 5K8TA 3QBVA 1E0AA 3QKWA 3CU5A 1NURA 4HFNA 3AUAA 4I1IA 4F56A 4M0CA 4YYZA 4K86A 2QBYA 1LCIA 2YUIA 4NK4A 1H93A 3VR4H 3MWGA 1QIEA 4Q3NA 1T2UA 1RRKA 4GWKA 2HHTA 4IUCS 3X1DA 3CM0A 3Q8PB 2RB5A 2A3VA 2OFWA 7ICGA 2HF2A 4OK5A 3RF6A 1CUYA 1ZMTA 1QV6A 1CV2A 1T0IA 4H3VA 3F47A 4AZTA 3E9NA 1RMYA 3AQ4A 3BSFA 5CCXA 5J40A 3L1UA 1S0UA 3ND6A 3VYVA 1N3YA 3IQXA 2NPFA 1A6SA 3B20A 3AM4A 5GJVC 2OCAA 2QLJA 3OOHA 2NU7A 3RREA 4KLUA 1BOOA 3C7DB 3WVNA 4LQ4A 3QNWA 1LTQA 5A4AA 3QBTA 2YWCA 1DCFA 1M2WA 4RGBA 3JPYA 5IAJA 3KD2A 4YBRA 5CYFA 1N25A 4MUYA 2YN2A 2MINB 4F72A 1GD1O 3JPRA 3TRJA 2CV1A 5IZ4A 4JB8A 4MV3A 3M3HA 1OLUA 5KTYA 5CMLA 6AT1A 5ALKA 1I3CA 3PI6A 4N5MA 1NK5A 5FT9A 1XN4A 2DFDA 2P2LA 2DPIA 2PV7A 1Y8RB 5AVJA 2OWDA 4DVJA 5KFYA 4Z8XA 4ZVOA 3UHPA 2V9PA 4B3BA 1B6TA 2IHVA 5A5GA 1GPWB 8ICJA 4PBTA 4QNNA 1P4AA 1NAHA 4EFLA 2NZ8A 2K6GA 2X3YA 3ESZA 5AP9A 3V32A 3ESYA 4RADA 8AT1A 3DVAA 3PUIA 3VDNB 3IIIA 3TL3A 1GZ6A 2HJWA 2P6RA 1DLIA 5CB4F 2CFOA 1W1WA 3NOVA 4N12A 2KSQA 1V0JA 5K20A 2JMGA 3OVMA 1T5SA 3TLJA 4QO8A 2CUZA 5JAZA 1G63A 4C04A 5JS6A 4H6XA 1A8QA 4BX0A 2KSOA 3GWZA 1KYZA 1MZPA 3SYKA 4UBJA 2AJQA 2GYYA 1WOMA 2QMEA 3WZ2A 1U80A 3RS8A 3DHVA 2RH9B 5CH5A 4Z4QA 4AYXA 4CGYA 4P3OA 3E3MA 4GRDA 2OGUA 3OOSA 1BVUA 2FH5B 1ZQ1C 4BFUA 4V03A 3ZZUA 1CZKA 3BSWA 4BLVA 3KQKA 1UZAA 4AKEA 1YCFA 4B9EA 5FD8A 3QG5A 4URFA 2IXEA 4TS1A 4E4YA 3AHFA 4AQ7A 4BO7A 3QENA 3CMMA 3HRKA 4UFPA 3E7PA 4L2IA 1TUEA 5AXCA 4ZI2A 1Y8ZA 3DHEA 3MMXA 1ZEJA 2EATA 4ZU1X 4PPNA 1FNDA 1ZA1A 3HO6A 3FSGD 1Z8DA 4NZMA 1GV0A 5KI6A 5KQRA 3EGEA 5DOZA 2YBDA 3WQSB 5IH3A 5ITZB 1B0UA 2DBZA 4IHJB 2Q9AA 1OYWA 4OYRA 2FWIA 3KSRA 1JHUA 1WUYA 3G6VA 1E4VA 4Z49A 1R2QA 2G8LA 4RT3A 3S1LA 1UBOS 4WACA 1SUWA 1U6KA 2ZRLA 3TAPA 4HNRA 2P8SA 4ECSA 3K0BA 2BAGA 4B3MB 4FBTA 3F5QA 1UXGA 1ZW1A 5JAIA 3HKZF 1PYGA 2RIRA 4FN5A 5HZMA 2FMFA 4HQRA 3X1MA 1GCOA 3JVEA 4GC5A 4NEGA 3NTXA 5M5BA 1V6AA 2D13A 3CMCO 5EMNA 3OUTA 4X7MA 4JI8B 5CLIA 2R4QA 3GAMA 2BCEA 2BM9A 3CR3C 4YP6A 2OAEA 5DCWA 1V3UA 4G3XA 4BWFB 3DM9B 1NXPA 1BW9B 1RXEA 4I19A 2XMCA 1OILA 4F4XA 1W0JA 5AHRA 1W36B 4L0QA 3C8MA 2WB4A 1OLSB 2A7QA 3EGVA 2Q28A 1O08A 1XTTA 5IJ9A 2GDJA 4WLNA 5A62A 5C8DA 4X1YA 1X42A 4ES6A 1SKBA 3AI3A 3THWB 2VDRB 2ZBFA 1UKEA 3PENA 1HDEA 3MGBA 1KI4A 4HX9A 1TD1A 1T91A 3VZPA 2XX3A 1VRVA 4FKMA 1K27A 2O1EA 3TMKA 3K9FC 3MC1A 1I7DA 3N70A 3PZPA 4WN9A 2FYTA 3TBFA 5IT0A 1E2GA 1HOTA 2OHVA 1QOZA 4DJDC 2BSAA 4AUNA 4PS0A 1V1MB 4GSYA 2C2KA 5EKUA 4IZIA 5TX7A 3M2PA 1IN1A 1N63A 3BHNA 4K3UA 3R6DA 1GGJA 4FMCF 3SOPA 3I4FA 3AUFA 1VGVA 1MEJA 4GUAA 4Y6SA 2ZSHA 2KLHA 4BNUA 4DSNA 2MJLA 4C0JA 1Q0TA 3L6RA 3FE2A 3ZW8A 1KMCA 5I7SA 3KJQA 1W5AA 1CY0A 2SKCA 1NXQA 5DIFA 1L7OA 2GFQA 5LA6B 1VE5A 3BMNB 4MEXA 1IRIA 4BJ5A 4RTNA 3CFYA 2B4TO 4TYPA 3UWOA 4JBHA 4GX2A 3AB8A 1RXCA 4PSAA 3SG0A 3LFUA 4A6DA 4QJIA 3UXMA 1OTHA 4WFJA 3ILYA 1TO1E 4YUXA 2OZLA 1Q1NA 1BTOA 1GNVA 4DQIA 3HEMA 5CNMA 1CD5A 1WR8A 5LZ8A 1PDWA 2OGSA 3LQ1A 2B0JA 1G21A 2F3RA 2W22A 2P1ZA 5CB4A 2CL6X 4RV4A 2MUTB 4W4TA 1ZYQA 1V95A 2W03A 3B78A 4S1WA 1XCGB 4V2IA 3T5AA 4D4JA 2JLYA 3FLMA 2O52A 1N92A 4G5QA 3W34A 3AXTA 3AJRA 1HQYE 3TOVA 1HO3A 4V3CA 2YBEA 3NYRA 2XT6A 1NKCA 1KJ8A 4GR5A 3WGHA 1XZBA 1SB3C 2CK3A 3LBFA 3SI8A 4F93B 1FCJA 3F9RA 4EFMA 1I4TD 3UT5B 4GP9A 3I2FA 2GNPA 1OWNA 1MVOA 1RWXA 3H9GA 5BMVA 1SOAA 3PLRA 4GSKA 3TLEA 1DG3A 4JEMA 5I5GA 4QDKA 4U7JA 3NKLA 4WNCA 4UBIA 4YCMA 3NWEA 3N4MB 4XTCS 3LUJA 4ML3A 3ICXA 3SXUA 1XPOA 2EAMA 3HPOA 2ZJ8A 3QYFA 2H65A 1MIHA 4HCJA 3T12A 1P75A 4CVNA 5DB7A 2XNDA 3E7WA 3KALA 5KFZA 4JLVA 3ANYB 4FDLA 2IHZA 2RGWA 4R2LA 3HNOA 1PW5A 1TCVA 1Q0SA 1YGYA 2JLCA 1RYRA 3A1DA 3CZMA 4BX9A 4E70A 2IF2A 3UJ6A 4F96A 4X65B 4BX3A 2QJWA 2VP4A 1ESEA 1H69A 4MPRA 5IKEA 1RYHA 1IPEA 1T4DA 1JP7A 4G0VA 1KBZA 2I7DA 3R5JA 3TW4A 1I2ZA 3FG9A 2YQ4A 2LM1A 3G3EA 3UXNA 1HMPA 5CLJA 3FUVA 1CRQA 3TQQA 3UWKA 1KH2A 3G0IA 1MJHA 3DKKA 4WK4B 4PVCA 3IPLA 3FOFC 2HF7A 3HILA 2LBPA 2Q2OA 2BI4A 1WCYA 2VNKA 5I4BA 4NJOA 4DR2B 3PQ4A 1KP3A 2P3LA 5AK3A 3SR4A 4AY5A 3K2IA 4P0TA 1A50B 1E2JA 2AQHA 1QLHA 1VYVA 5F7OA 2GASA 2POCA 1A1SA 5K45A 5KOYA 4JYMA 2Y2VA 2CNKA 5GMOA 3C8UA 3NEJA 1XWFA 4U39A 2MSWA 3UB2A 3UKDA 1I51A 4CETA 1N6OA 3K6SB 5JAUA 5C1IA 2YIVX 5FDFA 1P1KA 1DAHA 4CQMA 1A0PA 3M3PA 5GVSA 5BSEA 4YGYA 2FR0A 4YFKA 3BH6A 4NFHA 3DR3A 1DRKA 4DQPA 3JQ9A 2J8ZA 3I1JA 1H42A 4TKVB 3USZA 5TLSA 3SVLA 3HCOA 5REQB 5HIIA 2RKBA 3K9QO 1JTEA 1PVPA 2HNBA 1KAMA 1UC8A 3KZNA 2YRXA 1RQGA 1GNTA 3ZHQA 4Z54A 2KWIA 221PA 1SXGA 2B8EA 5DM2A 4RH1A 1WBJB 5BR1A 3EF0A 4I14A 2OXEA 3A1EA 5AJYA 3OPXA 5DN9A 2IITA 1GNSA 1TEHA 1H3EA 2WIDA 1ZU5A 3DV9A 4IX9A 4Y6PA 4BUJA 5KIAA 2J7KA 4PZUA 2QRHA 5HDQA 1U9LA 4TXNA 2PE5A 4GX1A 5DHAA 4NCHA 4LXXA 4A8TA 4HEQA 3PICA 3ELWA 2HKIA 1KJZA 2JJ2A 5ICEA 4XOIA 2HL6A 1T2EA 4ZT7A 2SCUA 1P9LA 4L7QA 2O7QA 2VAVA 4BRSA 2IKSA 3TZ6A 2QX6A 4O3SA 2BISA 5ULLA 4UNIA 1H8EA 5KG6A 1TW2A 3W5AA 1S0NA 1JMVA 2VRCD 1OXJA 2X9NA 4IIBA 3NUZA 3RB0A 2Q3HA 3OCCA 4QNRA 4RY0A 1XROA 4DRYA 1YQDA 1YRYE 3LUHA 4RJ2A 2AEMA 2X42A 2JS7A 1TPZA 1OLXA 4J0QA 3FYUB 1FSSA 4QIWF 4HDMA 2QVLA 4WBXC 1OCEA 3ZW7A 4TUYB 2SBTA 4BB9A 2E4VA 1G6HA 4YUZA 4BNGA 5AXDA 1P2VA 3E22A 1BXGB 3MTBA 1AVTA 2YWGA 6REQA 4M98A 5AVRA 3TUZC 3K30A 3S8MA 1QZ3A 5C53B 5CDGA 1QVRA 4I0WB 4JUAA 3G6WA 2Z3WA 2HOQA 5L40A 3CB2A 4QGSA 1O0SA 1C50A 2YASA 4HWGA 1NW7A 4HSGA 1M5TA 1RPLA 3S8EA 3IRVA 1Z82A 4CLHA 4DOCA 2FQXA 2EZ4A 1AUVA 3VMFA 3MTJA 2ZPTX 3UA3A 3I01A 3DAOA 3P2KA 1ZMOA 2XCSB 1NQ5A 2JD0A 5EIWA 2AXPA 1U1GA 1F5SA 1E7RA 2ADMA 1GG2A 4UNPA 2R8JA 5EHNA 2OCPA 5CUQA 1JWBB 1G5HA 2CVHA 1JPVA 4FHEA 2F00A 2VC2B 3O21A 1F7VA 1XZKA 3SCZA 5F7XA 2ASJA 3WRVA 4KMSA 5AW7A 5E7IA 3CO5A 1RQ2A 1L5SA 2ZSBA 3BM5A 2C88A 1U2TA 2Z2XA 2E89A 1HOXA 1LBEA 2ASLA 3G1UA 4S35A 1F2UA 1AGXA 1KZHA 3O3OB 5HR5A 2FDCA 4PGMA 5LP1A 4IQ0A 1CJTC 1LY1A 3GLGB 3ACBA 1XB2A 2PLAA 4V1CI 3I92A 3HXQA 1N2GA 3L01A 4BNJA 2X77A 1IV8A 2IP2A 4PAMA 4I7EA 4QECA 4TUPA 4G56A 4INZA 1ZH8A 2BM0A 2X15A 3WBBA 4B81A 5F76A 4OSEA 5EQDA 1FMLA 1AURA 3NM6B 3I4LA 2GPAA 1EK6A 2GDZA 2V65A 2HMTA 3FYHA 3U9SA 1FNSA 2HHLA 4HHEA 5IIOA 5BYKA 2B4YA 4PZPA 1G60A 5E6RB 4LRXA 2XUPA 3DOEA 4KOEC 1A97A 2AOXA 3OP4A 3UAZA 4YRPA 4B17A 1R0YA 1EM6A 3G0GA 3DE5X 5AYVA 2HSDA 2FWAA 4I3HA 2GZ1A 3QPBA 3Q6IA 1R8JA 1ONBA 4YCBA 4ZGBA 4G0YA 4XWTA 3ZZ0A 3W5SA 3FFXA 2OR3A 1FW6A 4GG1A 1ZAYA 3OMXA 4QBIA 3LD9A 3NH6A 2OPHA 3H1AA 1K06A 1ETUA 4RS3A 1QJ4A 1MJGM 1R8YA 2EFCB 4ARUA 4RXUA 4LEIA 1AK1A 3M83A 3T5HA 3U0BA 1XZIA 3E84A 1HE2A 2UYOA 3FB4A 1Z8HA 1Q14A 4E5SA 2IVZA 5HDBB 1BQEA 2L5YA 1NI3A 1DVRA 2REBA 4E1BA 3CNEA 3O93A 3VO2A 2OWOA 2XGSA 5J0YA 4BTEA 4L9SA 5C3UA 2JRLA 2WAQC 2HD4A 1U0HC 3QLUC 3BICA 1E1CA 1SB8A 2CZCA 5DWVA 3MK31 4ND2A 1J8QA 3L07A 2HV9A 3SEAA 3FUWA 3EXAA 4NFYA 1BXZA 1HZJA 4AULA 4UATA 1DIOB 4XRHA 4JVNA 2ZE8A 3AUYA 3G0HA 4YECA 3JTEA 1NMYA 1ND5A 4FOSA 1QK4A 2NZJA 1M8FA 1GPMA 4BQIA 1YF3A 3K0HA 1V9LA 1XZNA 1Z56C 3LQ2A 3WQRA 4GMKA 2NU8B 1ZH6A 1AC5A 2Q6OA 2HAEA 1VSQA 2XBUA 2XZTA 1MAUA 1CYEA 1FQOA 3BH7A 4E14A 2JI6A 3UJ3X 1FDIA 3NRJA 5AT1A 4RGVA 4RFLA 1W2GA 1V85A 1VXOA 3E35A 5K6RA 4G23A 1F0PA 1WBBA 2MYUA 5JMPA 3F49S 1X2EA 5HKLA 3RFVA 3TD9A 4RVNA 1DQNA 4XCXA 4BO6A 2FN4A 5LYJB 2BDTA 1DO8A 1L5KA 2XMBA 4FSDA 5IJ0A 4Z51A 2G9QA 1JYEA 2ATLA 1SHTX 2FN3A 4JODA 3VGJA 5F2KA 3G9XA 2QJRA 1ZJ6A 5GZ6A 3L6UA 4MA4A 3R0IA 4KR9A 3H5OA 5TSDA 1E9CA 2PZGA 1T2DA 2WKSA 5HJ2A 4QGBA 1Q46A 3FNFA 1T9AA 4GNKA 1DINA 3MJHA 4B44A 3DTNA 3FPKA 2G5HB 1H0HA 4GR9A 1GM5A 2Q9CA 2R00A 3DDSA 2FRVA 2KIWA 1U9YA 4IVPA 3T0GA 1IXYA 1Z6GA 1SBIA 3T4XA 4FZNA 4JH0A 3KQOA 1K7CA 3FDXA 4AYWA 4L8YA 3FA2A 4CWAA 3VNSA 4UC0A 4MHVA 4ND4A 4UBLA 1YE5A 4UZSA 2WIKA 4IDHA 1M54A 1XJ5A 3P20A 4OHWA 1ZBDA 2YX1A 1HZZA 3NGDA 2ZJ0A 3PUWA 4LZJA 2HQSA 4OD0A 2HI0A 2IJGX 4CIAA 1X2BA 2A1AA 3HFGA 2VRBA 4NS4A 3GRYA 4FJ2A 4XEHA 1BE6A 1KI1A 3IMFA 5KFJA 2FG6C 1HR0B 2OC4A 2Q2WA 2GZAA 4H15A 3S2UA 4E0BA 1JQJC 4DFMA 4FT2A 1D03A 4Z3KA 1YBMA 2RB4A 1PJRA 3KFXA 4PQRA 2E6UX 3A0RB 1YL5A 2FMPA 1EFRD 5I01A 4C7ZA 4OHKA 5E7MA 5TS2A 1IVNA 4KN7A 4AY3A 2R5NA 3N8NA 2PLFA 2FKAA 3SQNA 3AT1A 1NZDA 4LW8A 3RJJA 3I23A 2FPWA 2H51A 3HL0A 1BX1A 2K4EA 3U49A 3T7IA 4FEGA 1EVLA 3I2IA 1U47A 3R8FA 2J3LA 3OOWA 3L92A 1VDZA 4JEIA 1U7TA 2Z95A 4MYDA 4CKYA 3ER9A 2WTNA 1DT3A 2H5JA 2RSLA 3WISA 4CMAA 1OAOC 1RFLA 5BR4A 1WXXA 4RF5A 1CP2A 4QJ4A 1JEQB 4BNXA 1YC5A 4DM4A 2H3HA 1G2OA 3B85A 3N2KB 2DOKA 1ZQOA 5KNIA 2ODTX 2FNAA 3QXGA 1W8IA 1JDVA 4QOSA 1YJCA 4DCOA 1K7SN 2BZFA 5CR9A 3O1IC 4ECXA 4WLVA 4K6MA 2O6LA 1NV9A 4QGHA 3T3HA 4DLXA 3AL3A 3MILA 4AUMA 3CCFA 1N3BA 3DMFA 4TMFA 1BKSB 4F8EA 4YJGB 1Q7BA 4BMOB 1M7BA 1KQ3A 1DQPA 3WSWA 4RKFA 3GDWA 3V33A 2VPWA 2Q4TA 2BKVA 4GYWA 2XB4A 3ETNA 3RIGA 4ONEA 3WLQA 5IBCA 2Z0MA 3TNYA 2DCMA 5CFRA 4RLSA 4LSMA 3V1YA 1L5HB 521PA 5JTTA 1M2VB 4B6SA 2GAAA 3AHDA 1EP9A 5KG3A 3PT5A 4MVWA 2EBUA 3TW8A 3RH5A 1KFSA 1S5LU 5ECGC 1LBSA 4X1OA 1FRFS 5B6IA 1BDIA 1GL3A 4BLOA 4UNSA 2KQUA 4ENUA 3GEHA 1M2OB 3TTXA 1CY1A 3T7CA 2EKBA 2QKYA 3BOSA 4GR4A 5MF6A 2VH5R 4HPWA 4H7PA 1C9KA 2NYUA 5F9NA 2Z08A 1WSBA 2B92A 4J0IA 4RD0A 1DC8A 2G76A 2J7PD 4TTRA 3SVTA 1U8TA 1A0OA 3N0RA 3JS5A 4WJ3B 3WNCA 2FXIA 1DKNA 1K7XB 4RHYA 2G80A 1A9XA 4OF4A 5FX2A 1RZVA 4XW2A 2YV4A 1WCV1 3I83A 2ZPAA 2DQKA 4RKYA 2ZYWX 3RFUA 1IN6A 4FT4A 3AL2A 3GY0A 4UJ3A 5AJXA 1P4SA 5KVCA 2L69A 1N60A 1H4SA 4ITVA 3VISA 3OQOA 2X19A 2Y3IA 3KUKA 1IZ8A 4GVXA 4KLGA 4WNIA 4L16A 3QZUA 3F5MA 5B6PA 4TVBA 3R77A 1ZK2A 1A71A 3KKNA 3M34A 1C0LA 3IOBA 4QW9A 4N6GA 4CLEA 4PGXA 3TFQA 2DKFA 2AJTA 5KKAA 4QBGB 2VDUE 3FVWA 2G72A 1D8AA 4EKIA 1EFLA 5HS4A 1AN0A 5DBIA 4C7JA 2QW8A 4D92A 2GF2A 1XMVA 1M73E 1G9TA 2QYHA 4Q7JB 1N2IA 4BO2A 2FSVA 4EFDA 2AL7A 5HSGA 4BWJA 5AFSA 5K3AA 5EZSA 1XAGA 4JYAB 1MJNA 4C0WA 3CEJA 1ZCJA 1P2GA 2QZSA 5JWHA 3EHDA 4MIEA 1NW4A 4P7KA 4D4LA 1VYUA 1T5TA 3OPYI 8ADHA 1KC3A 4KUGA 1MV5A 1S9FA 4QTYA 4AF8A 1M67A 2ZBEA 3V7LA 2ID4A 2NT3A 1GT6A 5IYZF 1V1RA 1W8DA 3HR8A 3VZQA 1VI5A 5ELXA 5AK6A 1EWTA 3ANTA 3T5GA 3IKLA 3W5IA 3SWWA 4QYIB 5KFEA 2B20A 4KPFC 5IXYA 2ODGA 5E1BA 3EODA 2H06A 3CF0A 4OL9A 3GYBA 3THSA 2R85A 1A7AA 5M7EA 5HQ3A 3WGTA 3V8VA 2VPPA 1E8DA 5KOHB 4UEWA 1QGUB 1FSPA 4FFDA 1QV9A 2QTLA 2F44A 2B9EA 2P6NA 3RYHB 4HMPA 1ZY2A 4MDFA 3ENQA 2PGXA 3GEGA 1L4NA 1NDUA 4KNVA 1PK1B 3ZX5A 3D7KA 5H83A 3EGOA 3QUAA 3T1TA 4A27A 1FP4B 2DFKB 3FHCB 1EWVA 3GUZA 2ZUFA 2GO1A 3H0CA 5LZ4A 2ZUBA 1X14A 4M9ZA 4DJJA 3T79A 2F8MA 1G55A 3W1VA 1IK6A 3I32A 4G1UC 2XCAA 4CQLA 2X3FA 5CRIA 4RIIA 1V5GA 2ZCVA 2JLZA 2Z5FA 2BFNA 1DO0A 2GN6A 1A7KA 3CKLA 5AVOA 2IYPA 1H8HA 2ZUWA 3E5MA 1X13A 3P97A 1NQTA 2A78A 4XM1A 4QZEA 2NSJA 1IXSB 1NVXQ 5LJLA 4DR3B 4J7CA 3UVEA 2FK7A 1QSYA 1ZK0A 4JXKA 2XY4A 1IJBA 3E03A 3QFHA 2JFNA 2O4UX 3GAFA 5BNIA 4YCXA 3P94A 3GRKA 1CDOA 3WLAA 2H54A 4ZMRA 3MCZA 1TK2A 1KOJA 1R0WA 1B41A 4C0BA 5A1JA 3SIRA 1QV7A 3COZA 2B5WA 2UYHA 1FBNA 2FI1A 4D8TA 1E20A 5K0ZA 4DA7A 5J2GA 4IIJF 3COJA 5CCEA 3DCJA 3IQEA 4KH0A 5EUMA 2GCIA 2ICAA 3K0KA 1CX9B 2YN0A 3CX6A 2FCAA 3NKVA 1CNEA 1EGAA 1Z2EA 3FTEA 5EJEA 2IV2X 1YQWA 2AOVA 4CKWA 2DWPA 1NJ8A 1LLCA 2DKXA 5EWGA 4GFDA 2XOXA 3NORA 2H85A 1TJNA 3LWBA 2E8MA 1U0OC 1INLA 1AY0A 3KEFA 3F8SA 3RJFA 3DLTA 2O5EA 4MHSA 5AK5A 5EP1A 2YWDA 4ZHQF 3JQ7A 1D1SA 2D0DA 3CZCA 4UNNA 1XZEA 4JNKA 5AVUA 1ZQHA 2GBGA 4HN9A 1SL1A 1MG5A 1RRGA 5E0KB 1U9IA 3C48A 4X63A 5DBBA 4N7RA 1ZUIA 3PFWO 1YA8A 3KC2A 2A0UA 2XPCA 2FHSA 1VA4A 3LH5A 4HNAA 4ZO4A 4H7JA 4Q7QA 3NHWA 4Z4CA 2I4OA 3FX2A 3EULA 2HLHA 1XMOB 1NF2A 5DYGA 3VPCA 3DHNA 2FFJA 2XE6A 2V6BA 4I27A 3ENVA 5TMDA 4R71A 1L1QA 1EZZA 1ODFA 3PJDA 5JEEA 5JLJA 2ZR9A 3GLHA 4HH1A 1KRHA 5JRDS 1KYVA 4J07A 4G9EA 2QHXA 4XOUA 4I1VA 5BSWA 5KFOA 4EGQA 3KJEA 2PGDA 1Z7BA 1XNQB 5AICA 1L1EA 1PNRA 3PQ7A 1DDIA 1A2BA 1TLTA 1UM8A 4XB2A 4UTOA 2ATXA 1GXSA 3R6GA 2F43A 3WL3A 3D7RA 4PQEA 3Q3CA 2PXAA 3TLZA 2O50A 4HZUA 2G0TA 1DX9A 2IQIA 4IEIA 1MB3A 4ENWA 3PLAE 4BEJA 5HF8A 5BRAA 4UXHA 3D6VA 1OKKA 4U7WA 4KWHA 2A5YB 3CCBA 2WEKA 2WF6A 3EE6A 1C1HA 2HYDA 3AFMA 4RTJA 1EFAA 4HGPA 2IPMA 4B35A 2F55A 4YDHB 4LCBA 4EUNA 4L7VA 1YB1A 4MPTA 2YZNA 4LOHA 5ALQA 2BZGA 4S1PA 1KJQA 1MT3A 4IWXA 1LWOA 4J2TA 4B31A 2IYYA 1NKVA 3DMNA 2ZK7A 2X13A 3A9VA 3PE6A 4G2TA 5K2MA 1YFJA 4FIZA 4YIHA 2Q8PA 4OXKA 2AFIE 4ELUA 1I14A 4JV5B 3T9DA 3RAPR 4AF7A 1H9CA 3NNNA 4B87A 3QITA 5IDWA 1SUPA 3BWXA 3NHLA 2R6ZA 3L7YA 2P2DA 2JKYA 3EPRA 4Q4JB 3UMVA 1UINA 1UAAA 3BL8A 3AU2A 4NI5A 2YZKA 3BMOA 2P4UA 1PT7A 1E61A 4AC9A 3V2UA 5B1SA 3TOZA 3VR1A 2RHJA 4WCDA 4YRTA 4K7JA 1Z00B 4PSKA 3C5EA 3JD0A 5J29A 4FS2A 3W5VA 1TAQA 4M1EA 1GCAA 2C00A 1FVHA 1X1SA 3WSTA 1YB2A 1CUHA 3DMYA 4IR9A 4F9EA 3CUVA 4YCDA 4QDUA 1Z0KA 1UBFA 2C82A 1MNAA 2P5UA 4L4YA 3ZU5A 4DL7A 2FUKA 4GYKA 5IIMA 3N3AC 4C89A 4AYTA 4M0KA 4FDUA 1QE0A 4ZQBA 1Q2UA 3CEHA 4UU7A 4I99A 1GZVA 2V7QA 3HYRA 4QUGA 1JV2B 1U28A 2F2AB 1J8VA 3ZDEA 4C3VA 2BBTA 5I7FA 2ZB2A 5FWYA 3HYNA 2R6R1 3V42A 1Q1AA 1BO6A 3BJRA 3WLIA 3TTSA 4KVZA 4PO9A 4QZCA 5HRUA 1NW3A 3O95A 3NOXA 2A0FA 2XUZA 3R4CA 9ABPA 5A9TA 5DDYA 3BIJA 3WAJA 1JX4A 3ORHA 4MPJA 1WUJS 4LFCB 2AA3A 1P91A 4FMDB 3ZH2A 3F0TA 3BZUA 4G0QA 2GARA 2JIPA 1MA7A 3RFFA 3T3DA 4RIHA 3VSAA 2EWWA 1M1YB 1JL3A 3PEEA 4R66A 2ZJ2A 1ESDA 2PZBA 1O9HA 1Q6YA 2W6PA 4OMCA 2B1IA 5BWBA 3QVSA 1TU3A 3WYGA 4B3RB 4IL5A 2ZIVB 2ZJ5A 4NAHA 2BEJA 2ERCA 4YP9A 5ABPA 1J5XA 3VR3D 2BFFA 2HQBA 2O7RA 2QGNA 2O8FA 3KLMX 4WXMA 2XCUA 1V97A 4BO9A 4N49A 3VH4A 4M9HA 4N4AA 3BEOA 2Z2YA 3O1HB 2DBRA 3O47A 4K05A 1N57A 3C5GA 3RAXA 1G3IA 4NPHA 4I2FA 4D5GA 5A4JA 2PL9A 1WHTB 1JPJA 1QYXA 3THYB 5LQSA 4MCJA 1T2VA 2IHYA 3DNPA 4LI0A 4LE0A 3H86A 3VU0A 4R8UA 3AM9A 1PJBA 2NW6A 2QORA 2Z3ZA 2HWWA 2LIPA 3D4LA 4A9AA 1YA6A 4OG2A 3MMNA 5SZJA 2GJ9A 3LGAA 3CGWA 1X0VA 2F2TA 3HUTA 2JARA 1G2IA 3GZNB 3UW3A 4FGLA 3B1VA 4Q7EA 3VFDA 4W99A 3ILSA 4C0AC 1HG1A 1L5LA 5TT1A 5JXIA 3K09A 4HYQA 3LBIA 4OEHA 4G97A 2XZOA 3F71A 3IO3A 4W6QA 3DTVA 1PG5A 4ZVRA 3E4CA 2LWIA 1XTQA 1ZNXA 4ZRMA 2IDKA 1ZGJA 3U19A 3EARA 3DEHA 3TIFA 3STTA 1QAMA 1A9RA 1J8DA 3UCXA 3WIEA 3RT1A 1G8PA 3T34A 1U2EA 3IDQA 3ACCA 2A88A 1R88A 4RHXA 5GV8A 4W9NC 1HFKA 4KQCA 1C5KA 1MENA 2OLEA 3SDZA 2AKAB 3I6BA 1SXDA 2XWSA 4ZAWA 1DBQA 1OV4A 1JG2A 4TT3A 1CS0B 4WXPA 4KWTA 3RJHA 4BJQA 2WPDA 1EQ2A 5K99A 2QI9F 4JXXA 4ASUD 4M2YA 2VRWA 3JQBA 1YQEA 1NQVA 5AW0A 3AVXA 1DC5A 4KSYA 4JMPA 4K4IA 4M9LA 2H1OA 1Z63A 1SQ5A 1FRQA 1P0PA 5KJ6A 2OHJA 4QWAA 1ODIA 1XZPA 3IBGA 1D6SA 4LGVA 5B12A 2GVDC 4NAVA 5AOCA 1IPFA 3KVNA 2WM9B 4DUPA 4M88A 3B7PA 3KWFA 3V8PA 3HBFA 1ZQPA 2C9MA 3WYCA 1W59A 1I1NA 1T35A 3OOEA 2Q1YA 3C2MA 1YE8A 4LG1A 1XQVA 4TWAA 3NAMA 2OUIA 2IBSA 3PDJA 5KFQA 9ICLA 4J0JA 1KL7A 1SO8A 5FAKA 3V8EA 3EPGA 1E6UA 3B38A 1XU4A 1K66A 2AOWA 4RUKA 3AJEA 1JEDA 3R1IA 3EXG1 4RLQA 1QOQB 2RGYA 1VECA 3WWOA 4IOLA 1N7GA 3YASA 3OM9A 3BFJA 3DULA 3UJHA 2OHOA 1TK5A 4V0QA 5IFLA 2FUCA 4I2NA 2ZREA 1FRZA 1V16B 4PANA 3OAAD 3EXFA 1H6CA 5DHUA 3ELYA 4BNTA 1I0LA 2OEHA 2PMWB 5B5SA 1I80A 2V0CA 1E5LA 1E0KA 4Z1MA 1PFGA 5LD2B 4G63A 1W1UA 2PD3A 2QR2A 5AM2A 2BCQA 3RYIB 1KSFX 4NLKA 5BMVF 1PJZA 1ZD9A 3TLAA 4DQUA 3O3CA 5LVAA 2FPGA 3FRIA 1M1YE 5AVTA 1W36D 5B1IA 3ET5A 3GLFB 1ZWKA 1KS2A 2IUSA 3LVVA 5DBOA 3MGGA 4FFLA 1QB8A 4K9QA 2QA5A 1OE0A 4IUBS 4JI1B 4IDEA 3ELDA 2YL2A 1ZC3A 4LYGA 3V4LA 3NVMB 5LUBA 4UCWA 4PYKA 5FO1A 4LVUA 4K40A 3VBEA 1AQJA 4B8ZA 1TAHA 1XTIA 4TQUS 4QJFB 3I8OA 3QA3E 1FB5A 5KFBA 1QBGA 1U0FA 3M4NA 2ZRAA 3B89A 1ZK1A 4B82A 4ZYTA 1MEOA 1F2VA 1BJTA 1KXZA 3DYBA 5JRTA 1DMSA 3JU3A 1X9IA 4DV0B 4UB8U 5FHQA 4NCIA 1JQ5A 4MMYB 1DQYA 3D54D 2Z4RA 2YJ4A 1FXSA 4DQSA 5DKWA 3WKDA 1BQ4A 1RRPA 4XARA 2IBMA 1I30A 4E1AA 2W58A 3PC3A 3D5TA 3VX4A 1WCLA 3P5SA 2HA4A 4WOKA 1JHZA 5CVTA 1DADA 2QYSA 2QTMA 2EKZA 3RRJA 2J6HA 5GGXA 3NAQA 1BGVA 4N03A 5HF9A 4L8WB 3ND5A 4NONA 5ALYA 2EHDA 1NUUA 1MC8A 3A58B 3W04A 4YJFB 3RJZA 1JJAA 4BRUA 3CLTD 3R0VA 4M89A 3BD7A 5DM1A 4BGDA 3O8RA 1G3UA 1FLNA 5KT3A 4AY4A 4J0EA 4R3UC 1OUQA 2VUSA 4MAMA 5CRXA 4DL5A 3C3WA 3L02A 3ZE1B 5IG2A 1DGSA 4CEHA 3O91A 1DWOA 2HMVA 4JHLA 4ZKEA 1WMEA 2VYVA 5GJWC 3DFFA 1II0A 3TNDA 2VJDA 2AF4C 4QX6A 1FYDA 1CC1S 5FBVB 1Z19A 1R10A 4OL0A 3KWJA 5KG1A 2C0PA 4Q3LA 4J94A 2FZGA 2DQSA 1JU9A 2YS7A 5HZGA 2FDXA 1IULA 4NE7A 3LBNA 2IIQA 3VR0A 4C8MA 3IESA 4GPZA 1TQ6A 1PKEA 5E3IA 5F21A 2QG4A 1K3UB 1D9DA 2OYRA 4QU8A 1P72A 1THMA 3IV6A 2JIQA 1DEAA 1F0KA 5EOZA 4I1UA 5D1NA 4MKIA 5JNUA 1N2JA 1VOTA 3UJ9A 2BVNA 4N3AA 4BHTA