3UMBA

Crystal structure of the l-2-haloacid dehalogenase rsc1362
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
227
structure length
227
Chain Sequence
TSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Ralstonia solanacearum
molecule tags Hydrolase
molecule keywords dehalogenase-like hydrolase
total genus 80
structure length 227
sequence length 227
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3umbA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3umbA01
4XOUA 4PNHA 2CFSA 2QYHA 1N8NA 4KYTA 2VKQA 2RAVA 2PKEA 2YJ4A 1YS9A 2G80A 3FPBA 3E84A 3EF1A 3B9RA 3RF6A 4Y2UA 2PR7A 1ZS9A 3OCXA 3ZTWA 3HLTA 3NUQA 5ALMA 4G63A 4BNDA 2RBKA 3ONNA 2IOFK 2YJ3A 3E8MA 5AVVA 2AUTA 1VJ5A 3B9BA 3KZXA 4E88A 1L7NA 2FPWA 3AR8A 1ZOLA 3KD3A 5AW7A 1L7PA 4NV0A 2HCFA 3SD7A 2YMLA 1RLMA 3KOOA 1RKUA 5ALGA 3PGLA 1O03A 1MH9A 5AK6A 3IRUA 4HGPA 3U26A 3WK8A 3HYCA 3GYGA 4YCLA 4HGNA 3SHQA 1RMYA 5AW2A 2FPUA 4NABA 2G08A 1L7MA 1L8OA 4YCMA 4KNWA 2GFHA 2WF6A 4UW9A 5AHXA 5AW5A 4J2TA 1YNSA 3AR3A 2G09A 4YCNA 3F9RA 4BYGA 5ALVA 1SWVA 3ZX4A 5A3QA 3WK7A 2EARA 1U02A 2FPRA 3ZW7A 4C4RA 1QQ5A 4J03A 2HHLA 4BBJA 5IS2A 2AH5A 1KYTA 5ALRA 5AM5A 3K1ZA 4UASA 3DAOA 3WGVA 3OTQA 3N07A 2I54A 1Z4JA 3WGUA 2B1QA 3L1UA 4UMEA 2YY6A 3WKAA 4L6CA 3N28A 1TA0A 4KN8A 4UMVA 5AI0A 5AVRA 5ALZA 3WK4A 4DW8A 3WKEA 1L6RA 4L6AA 2YMMA 5JJBA 3N5KA 3TLMA 4I9FA 3UMBA 3PDWA 4IFTA 2B0CA 3ZVLA 4GIBA 3PCTA 2C88A 1NF2A 4NFLA 1F5SA 2PQ0A 1LTQA 3NRJA 3NANA 3R09A 4I9GA 2FPSA 1TJ3A 2BDEA 2JARA 2OM6A 2HF2A 5ALEA 5AKJA 4UAUA 2GHQA 3NIWA 4AS3A 4DFDA 3QGMA 3WK6A 3B8EA 1S8OA 2FI1A 4JDPA 1CQZA 4UAVA 3L8HA 4Y2QA 3U7EB 4OD0A 3NAMA 1U2SA 1Z88A 3FPSA 3BWVA 4BEWA 5AVYA 2NO4A 3OCVA 1T9ZA 3U7HB 1Z4LA 3WK9A 3D6JA 5AKXA 5AVWA 3E81A 5AKYA 3FM9A 1J97A 1YJ5A 2ZBEA 4HYTA 3SF0A 5ALSA 4UARA 1TJ4A 1YMQA 2HI0A 1ZD2P 2GHTA 4RETA 3OPXA 1L7OA 5AVTA 2FUCA 2OBBA 3A1CA 1O08A 1S2OA 2HO4A 5ALOA 5AW3A 2YJ6A 1RPZA 4YGYA 2YMPA 2C8KA 2YMQA 4O8CA 3AR7A 5ALKA 1QQ6A 1Y8AA 4Y2YA 4H1WA 2I34A 2P11A 4Y2RA 3EWIA 2C4NA 5ALUA 4HGRA 3MC1A 2BY4A 4Y2PA 4Y2VA 2R8ZA 5AW4A 4YH1A 3QU5A 2G0AA 5ALDA 3QLEA 1ZRMA 5ALYA 2R8EA 2B1RA 4MWOA 3CZ4A 2EATA 3W5BA 1RMQA 4EZEA 4L57A 4YIKA 4JB3A 5ALQA 1NNLA 4FYPA 3SKXA 5AM0A 2QLTA 1X42A 3A3YA 4CF4A 2P69A 5AKLA 2ZOSA 3L0YA 2YFYA 2D2VA 3ZWDA 4UMDA 5ALTA 2I6XA 3W5DA 5AIBA 4DCCA 3AR9A 4KX3A 5AIAA 1Z4MA 2R8XA 2YBDA 3QUBA 5AI6A 3FVVA 2HEGA 1U2TA 2I33A 3L7YA 3ESRA 4OFZA 2AGVA 5ALLA 5AW8A 4AP9A 4Y2XA 4BKMA 2JAWA 2GO7A 3N1UA 1Z5UA 1Z4QA 3J7TA 3W5CA 1XVIA 2DQSA 1TJ5A 2JAUA 3SLRA 2HOQA 4BX3A 2Q5EA 4EX7A 3QX7A 2IA5A 5A3SA 4BNDB 1RQNA 4YIHA 5AK5A 4F71A 3P96A 5AW6A 5ALHA 3WKBA 3FGOA 2JAOA 5AVUA 5AW9A 3ET4A 3EPRA 3A1DA 2IOHA 3L0BA 3BA6A 5IT0A 1RLTA 3ZU6A 5AKHA 3SKYA 2WHEA 4OHFA 5FP0A 4CF5A 2W4MA 3L8EA 3KBBA 4HGOA 5IT4A 5AM3A 1SU4A 4NWIA 4UM5A 3QUTA 4OCZA 4FFDA 3ZUPA 3PGVA 2P27A 3FZQA 1QH9A 5AI9A 1ZD4A 1U7PA 1L8LA 3NASA 2RB5A 5AM4A 4NAVA 4Y3UA 5AI5A 2B30A 2CFTA 2FDRA 4EEKA 1RMTA 3U7FB 4HGQA 4BX2A 2IOFA 5AKKA 4EENA 2JGAA 4ZEWA 3KC2A 2ZBFA 5ALFA 3ESQA 2CN1A 1RKVA 5AVXA 5AICA 5AM1A 3S6JA 5E0OA 2NO5A 2HX1A 1ZD5A 1ZRNA 2YN4A 1T5SA 3U13A 1T5TA 4UU1A 2NYVA 1N9KA 4ZEXA 1U7OA 4G9BA 1Q91A 2ZXEA 2FUEA 4EELA 5AVSA 3L5KA 4KNVA 4XPZA 4Y2TA 2P9JA 1YV9A 2G06A 3QXGA 5ALWA 3AR4A 2B8JA 3QUQA 2WF9A 1IWOA 1Z4PX 3AR6A 3E58A 4UMFA 3IJ5A 1XP5A 3WKCA 3QU7A 3L8FA 5AKEA 2YJ5A 4QQFA 3QU9A 4CF3A 3ZVNA 1FEZA 2WF7A 3KDPA 4IG4A 3I76A 3QU4A 3ET5A 5ALNA 2RARA 3DV9A 3N8GA 3QUCA 3UM9A 3M1YA 1XPJA 1NRWA 3WKDA 1SWWA 2MSNA 1WPGA 1Z4NA 1K1EA 4AS2A 2B82A 4CNQA 3UMCA 1RKQA 2MU2A 3I6BA 2G1AA 4KX5A 3MMZA 4BX0A 2ZBDA 3NALA 3W5AA 3IB6A 3ZX5A 2HF7A 3ZTYA 4UM7A 2Q4RA 3UMGA 4B6JA 4C4SA 5AK4A 4HAIA 3RFUA 5AKIA 1Q92A 5AVQA 1TE2A 3MPOA 1LVHA 1Z5GA 3L1VA 1PW5A 1VJRA 2ZG6A 1RLOA 4BEVA 3QYPA 1WVIA 2O9JA 2G07A 1RRCA 4UU0A 2ZBGA 4EX6A 2WF5A 3SMVA 2HDOA 3L0CA 4F72A 4C4TA 2C9MA 1RC8A 2W11A 3OCYA 1QQ7A 1CR6A 3R4CA 3AR2A 2AMYA 5AI8A 5T41A 5AVZA 5ALXA 2B8EA 1EK2A 3EF0A 3OCUA 1JUDA 3MN1A 5AI4A 5AESA 3U19A 3QU2A 4Y2JA 3VAYA 5AW0A 5AW1A 1J8DA 2R8YA 5ALIA 3OCZA 4RESA 3QNMA 2EAUA 2GMWA 2MU1A 2FEAA 1RQLA 2WM8A 4QJBA 1RDFA 2WF8A 3WK5A 4FE3A 1YDFA 1ZJJA 1EK1A 2OA0A 3I1YA 5AKGA 2OYCA 3M9LA 2HSZA 4UATA 4CE6A 3I28A 1WZCA 2I55A 3OCWA 5ALPA 3CNHA 3DDHA 5AM2A 3A1EA 1ZD3A 5AKZA 3L8GA 4XQ0A 2ODAA 3U7GA 5AK3A 2I7DA 1Z4KA 2Q4TA 2IYEA 5ALJA 3DNPA 2WFAA 3ZVMA 4XE5A 4Y2SA 4DWOA 5A3RA 2X4DA 2W43A 2FPXA 3R9KA 3ZI4A 4GXTA 1VFPA 1Z4OA 1AQ6A 1WR8A 3ZWKA 1QYIA 2C8LA 3AR5A 2CFRA 2BDUA 3ED5A 2O2XA 1Z4IA 4ZEVA 4MUMA
chains in the Genus database with same CATH superfamily
4BQFA 4LHXA 4PO3X 4GWLA 3G79A 1RHJA 2YHIB 4G4IA 4TMKA 2GAJA 5FUXA 3SSMA 4RKRA 5EWLA 2XR1A 3PQ5A 5BR7A 1RQXA 2AYZA 4L75A 3WX0A 1YE5A 1YS9A 2WYVA 4GX0A 4MSUA 5DM70 3WP0A 1TKAA 3HHEA 1KE2A 3FFTA 3IV7A 3U9TA 4C4PA 3WGKA 5DYIA 5DH9A 2W2QA 7ICMA 3R3YA 5D5HA 2RH5A 4YRRA 3H16A 3FYUC 3KQWA 4OI4A 4IDFA 4BU0A 4EL5A 2RBKA 1P2GA 4F93B 2BFPA 2XWBF 5BSTA 4F4DA 3AETA 3B1VA 2A1TR 5EJMA 4PZOA 1PNQA 2P2GA 2FMFA 3WBFA 3FF1A 2DULA 2VWPA 1L7NA 5H2FU 3HSYA 2G1UA 3LKZA 1ZL0A 1V1MA 3GJSA 3IHLA 3TUIC 1PEKE 4IVRA 4NH4A 2CUZA 3WDKA 2IYZA 4HMQA 3HRHA 2AEMA 1D4OA 2P65A 2E1EA 1EK0A 3V8RA 4C5AA 2YHIA 4OU4A 5FOQA 1OI7A 1SA0B 1Y7IA 2OHVA 1H93A 3A1VA 5EI5A 3WS7A 3S1LA 1X40A 4NONA 3UAZA 3Q7RA 3ADDA 1O03A 2ZRJA 3H1AA 2P77A 5F2NA 1NOKA 3G9UA 2YX8A 3QM1A 1GQOA 2R6ZA 3GT0A 5CAEB 3O8DA 1P1IA 4MV4A 1TT5B 4HGPA 4X90A 3UMMA 3I9LA 2I6FA 2Z57A 3PQDA 5FUWA 1UKCA 5BQPA 5IKOA 4CMIB 1HLPA 3H2SA 4X94A 2QXUA 5BR8B 1NP6A 3GLGB 4H7PA 2GBGA 3U49A 3WNVA 4FMBB 2GLTA 4RPIA 2CLFB 3RHFA 4RL4A 1G8YA 3DEEA 4BPRA 3ZDDA 1O97C 3QPUA 1RCFA 2JZCA 1JEOA 4IIFA 1V97A 2XCPA 2RDJA 3LVFO 1FFEA 4YI5A 5IJXA 4O4JB 3DW1X 4UJ3A 4LOIA 2FSVA 4QPJC 3RGWS 2AU0A 5JAOA 3U6KA 2ODBA 1YQUA 3QKWA 4AJNA 4LVNA 4AJ1A 4MDYA 1TL7C 1AY0A 2OHXA 1JXOA 4KKXB 3E82A 5JWHA 1AN0A 4CLHA 1I33A 1D6SA 4AZ0A 1XL1A 2X0JA 1PUIA 4XUSA 1DUSA 1YK1A 2DH5A 3E9MA 2BKVA 3F1KA 4J03A 4II3A 1IBCA 2BONA 5I7SA 4FDMA 1DLJA 1UQUA 2BD0A 3NNSA 3PNPA 1J9ZA 4RQ2A 3KXDA 4XQ9A 1N3IA 1XSPA 3LV8A 4M38A 2PBRA 4UHKA 5EYPB 4OHYA 1SB3C 3OTQA 3N8DA 4PXSA 4RWEA 2I54A 3DZ8A 4HCJA 3PA8A 1Z4JA 3Q1KA 4FDAA 2JI6A 2WU1A 2I65A 4MCAA 1FU7A 2FW0A 4I66A 4H1TA 3KL4A 5B1EA 1SMKA 1HFKA 4CCHA 3NNNA 5DIZA 4XWTA 4DW8A 1ZQRA 2QAJA 2FUKA 5K3OA 1U0OC 1UK8A 2A59A 4P34A 4GNRA 2J0VA 2D2FA 3G2NA 1L7DA 3TIFA 4M46A 4I8DA 5G0SA 2ZRHA 4AY3A 3IAM6 2PY6A 4LXHA 4G26A 3DBHB 2WU8A 4IJUA 5CLJA 3ND6A 1BJRE 2UXCB 1HT1E 2WSLA 1L5MA 1RJEA 5IUJC 2DLDA 1MJHA 1S0NA 2IU6A 3JCZA 2C04A 2R85A 1VJ1A 3M5PA 5BN5B 3RJ9A 4BO1A 4XAQA 1T6YA 5JJIA 3I4LA 3O7WA 5F9MA 2PCJA 3N7PD 2ST1A 1FXWF 3WIDA 3LK9A 2QTMA 1MQAA 5KFPA 2FPSA 1ECCA 1ABBA 4X7BA 5TF4A 3E9QA 2G6BA 3V32A 2YXNA 2AOVA 3B82A 3GFRA 3ESZA 2OR3A 2W7PA 3L8YA 1WUIS 3LIIA 4MYCA 4ZZ1A 1OYWA 1Q7EA 3FCOA 3QWAA 2O0HA 1P4AA 3U6BA 5FOUA 4BXOB 2BBTA 3C3DA 4M9GA 4X0EA 5CDFA 4DFDA 2VHJA 2XIDA 1T2DA 3OZUA 2SBTA 4TT3A 1C0KA 2GPSA 2OFPA 3TX6A 1X8LA 4OATA 1L5RA 3RF7A 3L8HA 3ZLVA 1J49A 5DYGA 4HDKA 2PNFA 4DLTA 1SUFA 2QXYA 4PYKA 1PS9A 3PXXA 1K7YA 3AJ9A 5BOLA 4HPXB 4NY8A 1MVOA 3C6XA 4M88A 4UHHA 1WSBA 3AY7A 3K6JA 4PSDA 5F4BA 2O2IA 4DUGA 5IW8A 3RG8A 4L6IA 4I2DA 3HP1A 4MYHA 2C5SA 1FNCA 3OY7A 3VDNB 5KNIA 2WG2A 1E5XA 3AILA 3P4UA 1C3JA 4QWMA 2QGZA 5FBLB 5HKOA 4K7JA 2ECPA 1N6NA 4KSBA 2EYUA 3CG4A 3A0UA 4Q39A 5HJ5A 2BPOA 1PYDA 5D86A 1DCTA 1FBTA 4OXYA 4J1SA 4HYTA 5I51A 3D8SA 3T5HA 2B2XA 2Q8PA 2PR2A 5F1OA 3T3PB 2R84A 3GEBA 4KN7A 1EYZA 4FOOA 1GPJA 3I73A 1YL6A 3QVWA 1Y5NA 4KWCA 4TUYA 5DBEX 2RQ5A 1ZJ4A 4Q8EA 2COEA 2CNWA 3HDYA 4YMOA 2JD2A 4TYQA 5KTPA 2XZOA 4DWVA 1K89A 3EARA 1R0RE 2QJRA 2MUTB 1GU7A 4MDEA 2RRDA 1CR2A 1S8AA 1SOVA 3CB4A 4FMDF 1P1BA 5KFDA 2XB8A 5SZKB 4YGYA 2Y71A 3P2JA 1TQ4A 1YS1X 1P8JA 2WTEA 3C7KA 3EYAA 1VHQA 2DG2A 1H0RA 2XYHA 3ZZNA 5CB1A 2AX3A 1ZM3A 4Q24A 5KHOC 3EX7C 1XJ5A 3GFTA 9ICGA 4V0NA 1N1EA 5IBPA 2VP5A 4BFLA 2FPGB 3NCHA 3CUWA 2IXTA 2WUGA 3KELA 4WZBA 4N5IX 4Y2RA 5KDLA 1P72A 4J1TC 4NBLA 2EWMA 4NNJA 5DCLA 5F21A 1R6XA 2LD4A 3KWMA 4J8PA 3VOTA 5F98A 3JQ7A 4HWOA 1GFIA 2VTDA 4KLSA 1I32A 2XQFA 2WINI 5ALYA 1C7ZA 2R8EA 4RIGA 3TDNA 5HZGA 1FZQA 2PX6A 1NI5A 1XQYA 1P2DA 5K7SA 3HWWA 2FN8A 3Q9LA 1RQRA 5LZ4A 3NM5A 5J1SB 1PD1A 4Q44A 1TYEB 3IUQA 4AJJA 3NDRA 2QN8A 4QGFA 3OOHA 1PR2A 5TMBA 5A04A 4ICIA 4XIJA 2C03A 4BPBA 1FSSA 2V8BA 3ZHBA 1HDCA 1DKQA 5EKUA 4JA2A 1GZUA 5TPWA 3T6KA 2W9CB 3OJEA 1DBIA 4BO0A 4ALMA 4M0MA 1F6WA 2OG1A 3BL5A 1K8ZB 3FYSA 1K5OA 3R6TA 4J7XA 5JNSA 3L7MA 4X1KA 5EUCA 1OH5A 4DSLA 5CYPA 5IVIA 4WFQA 4JUCA 1MENA 1G4AE 3DMFA 2UZ1B 3VFDA 4G3XA 4PZAA 5JCOA 3DEKA 1PGPA 2IDKA 4LBVA 4BC0A 4J2OA 3D31A 3NDJA 4AO6A 3WBKA 2Q1XA 3QOXA 2O2YA 3B53X 4DIUA 1FFBA 5DU2A 4GF5A 5HILA 3AXSA 1IXKA 4KXUA 1BS2A 1QV9A 4P4SA 3AY3A 4D3ZA 5IT5A 3GBSA 2F17A 1TDJA 1UJ5A 3ZN2A 2I7VA 3D1LA 2FLNA 1JHVA 2EYQA 1MB2A 1KVTA 4E12A 1WXQA 2F62A 2R1UA 4DSNA 3CYFA 4JC0A 4BMXA 5IPFA 1EP9A 3SFTA 1WD7A 1J2JA 3HYLA 2Q5EA 3UHFA 4Q4AA 1HYHA 4F71A 2G0NA 2W2VA 2GPNA 4FCTA 3C24A 3NTQA 1Y3DE 1XZFA 4R63A 2F1OA 2ZWPA 1ZICA 1N0IA 4DUGD 3RUIA 1B43A 3EE6A 3TX2A 1T0UA 5LQNA 4ZODA 4P8RA 3IN5A 2FPIA 4I2NA 4P33A 3MCUA 2VHCA 4IUDS 3DHYA 3A6FA 1HDZA 1RYZA 4IUBS 1QSLA 1QV7A 4R5HA 2GRJA 1EFUA 2IZ1A 5J5AA 4HDKB 4I8XA 4D02A 3GD5A 3MOIA 3ZWWA 2H8KA 3N2GA 4X1KB 2AFVA 1G3UA 5KC9A 2IEGA 4QBTA 3NBQA 2P27A 1JLHA 3ICQB 3I5XA 1ZD4A 9ICOA 2KX7A 5ERYA 1I5RA 5EWEA 4FM9A 4B3JA 1NJZA 2FZVA 1JMYA 1KDRA 4FB4A 2P6RA 2WMOB 1NYQA 4Y3UA 1I10A 3WHIA 2CFTA 2IUTA 4MUYA 1AKQA 4ROTA 5JZVA 3VMMA 3MT9A 3PMLA 4E3WA 2XXAA 5KQSA 1P33A 3TANA 1G8JA 1X7ZA 4BX2A 2OZKA 3JTMA 2C9DA 1F5NA 3PNQA 4CQMD 4OQYA 3KTOA 4HJRA 4X71A 3TUJC 3VBEA 3ZYCA 2LM4A 4K9MA 5E9AA 3V4ZA 1GZHB 4PNEA 1GUZA 2GN6A 1TOAA 3INTA 4IMJB 5CD9A 1WQ4A 4REOA 1SZJG 2PTHA 3T7EA 4GXKA 1AGYA 3EOZA 4KFUA 3ZXYA 1OILA 4BNWA 1SK9A 3GLIB 4QM7A 3NM4A 3VR6A 4O59O 3GXOA 2JGDA 4K6CA 4MIOA 3NV9A 4TQGA 4E7OA 1OWOA 1W25A 2KK0A 2GCNA 4ILKA 5HW0A 1T5SA 4GSKA 4D57A 4WZBB 1D2MA 1RAFA 1SBCA 2VJAA 3KYIB 4WDRA 3HXQA 2E4XA 1LBTA 1MDBA 4G9BA 1P9WA 2EDAA 3RU7A 1SXHA 3UJ6A 1CEQA 3DMHA 1UPFA 2JFFA 3KJXA 2NU9A 1ACMA 3LZCA 3LAWA 4RK6A 4WN9A 5D3QA 4KOEC 2BKLA 5ELXA 5KMGA 2AE1A 4UBJA 2C0CA 2E8MA 2V96A 4QBKA 1BTOA 2ZRGA 1R4NA 4TRMA 4TTRA 2ZVDA 1MOPA 2FH5B 3I6IA 3TOSA 4D9HA 3KPUA 5EJ7A 1Q0HA 4OX9B 3SYKA 2PMKA 4BWFB 4Q16A 3U0BA 1ZPDA 2EAOA 2WM3A 2PXIA 4TUYB 3DEAA 4X1YB 3KQKA 1MHTA 2HGZA 3HEMA 1EQAA 1UP7A 4TKUB 4RPYA 2X8WA 4UCWA 3ZGXA 5B3KA 2WF7A 2P78A 1XRLA 3VDRA 3UK1A 2I9KA 4DSZA 2Y1JA 9ICIA 1IQUA 2R86A 3ET5A 3GEIA 4LE0A 2E49A 5DW0A 3SGLA 4ARZA 2ODTX 2VZEA 3DMPA 3K16A 3MT0A 4GC5A 3VX3A 1G7SA 1H22A 3OTIA 4E31A 1U0RA 2P68A 1IH8A 3T4XA 2QAGC 3WKDA 2YWCA 4ZN6A 3IUBA 2R6CA 4W82A 1CYEA 4IGIA 5GADl 3C74A 5KFHA 4FDUA 4PZUA 1ZLYA 4QZHA 5BWCA 2BJHA 3HT3A 3BJEA 1GPMA 4OEHA 4UNRA 4O2AF 1P2SA 2EF1A 4IDOA 4C5BA 2QVYX 1NW7A 4F4WA 2JZNA 2ZB8A 2XPCA 4DR6B 1J00A 4BLVA 5KQRA 1NVTA 2QYSA 2R7MA 5JS7A 4UZEA 4B47A 4B7UA 1WQ1R 5TQ2A 4B33A 1LQUA 2HGSA 4G8DA 4C03A 3FOAA 1NE2A 2QAIA 5HKAA 2V7TA 2YXBA 4CMIA 1EU1A 1C30B 1SCUA 4MW6A 3P71T 2EU8A 2OTCA 5DX0A 1T3QA 4FGWA 1KSFX 3DXYA 3FDJA 3OPMA 3PC8A 3W77A 4C4SA 4CMEA 5JS1A 4US1R 1ADJA 3IBYA 3P5BA 3ZHZA 1DAHA 1MB3A 4O2AA 4AY5A 4F12A 2DQ4A 3BS5B 4E1AA 2FRDA 3OZWA 4YRMA 4GMDA 3SICE 2PJUA 1KC3A 3TLJA 1S5PA 2VCHA 2VJDA 3H4DA 1WVIA 1LC0A 1GO3F 1IBLB 3JRWA 4BWVA 3EEFA 2WWVD 4GKAA 3PIRA 2RSLA 2QK4A 4U02A 3QNWA 4RZRA 4LC1A 4N5NA 2H2FA 1SVLA 1T2NA 1NJ6A 2IEZA 2PXCA 3E0QA 1BW9B 4F72A 3RR8A 1NMEA 1Z3IX 3VV3A 3CB2A 2LMRA 2VPWA 1QCDA 4K9PA 3M6XA 4NFHA 5KTOA 4I1SA 7ICTA 1R5OA 2DBRA 3JWHA 5F9FA 1YASA 5HHIA 1KP2A 4U2EA 3HYRA 5AI8A 4G1EB 1AK2A 2B98A 4X8OA 1U1GA 3E8SA 3NB0A 1AV6A 4JQZA 2Q6IA 3EPIA 3K92A 3CV3A 3OICA 2NX2A 4L27A 1EVKA 1P9LA 4NCXA 1RYFA 4YY3B 5JY6A 2QU8A 4QDTA 1IEQA 1TTHA 4S1TA 2Y0BA 1A0PA 1BXGA 4X6LA 4EL0A 3TQQA 2OL4A 1C7YA 1P18A 3GUZA 1MX1A 3LFUA 4LRYA 4RVUA 4DMKA 1C7QA 1NXXA 4H4EA 4LY3A 2IYPA 3L46A 3AL0B 2A9PA 4QJBA 5LZ8A 3G49A 3WGGA 4DDTA 5BSEA 8ICWA 1GUFA 4GT1A 5DOZA 1BKDR 4QOGA 4DA9A 4D9JA 4CL3A 5AKGA 1B0XA 3C1OA 2OYCA 4RZUA 3TGWA 5IAAA 5IF9A 1E7RA 1W96A 1N7JA 4ZKEA 1MAAA 4D0NA 4I28A 2Z2XA 2JV3A 2VAMA 4QUJA 1Q0ZA 4UC0A 3SJZA 3UFXA 2R6DA 5A4JA 3PR5B 2YIDA 4MGZR 1V11B 3CU5A 2IA6A 1X94A 3FPCA 4CNBA 1XO1A 4NU6A 3G8BA 5AM2A 1YSCA 2Z9CA 2Y1GA 3SEFA 3ZCQA 4YR9A 1XHLA 1CDOA 2ZFUA 3L6CA 1G7RA 3QY0A 3TIGA 3LJKA 2AWOA 1P19A 2EFDB 2D7JA 2JFZA 3C0KA 4H7EA 4HUQA 4K9SA 1DEKA 5GJCA 3WTBA 3NVZA 2Z1NA 1SB8A 4S1PA 2E37A 3RFTA 1L5HB 1QE5A 2M32A 4PO1A 1GADO 4GE0A 5KG3A 1E6UA 2IGBA 4FKBA 4B75A 1BHO1 5EE5B 1H4TA 2WYUA 3RREA 5A9TA 3FHCB 4GOJA 3PEYA 1FLAA 4C7KA 2H5JA 3D5QA 5IKEA 3LK7A 1JV2B 3BD8A 2BR3A 4O3MA 3PUHA 3H97A 1FDOA 3C2KA 4PGYA 1M2HA 2QTZA 2IHJA 5E9QA 3VKUA 1OTHA 4CCWA 3G2HA 4IHJA 4BNGA 3W3AH 4U7CA 5DWDA 5DT2A 1SBQA 2HWYA 1P1CA 4I5GA 4IVPA 2M0NA 4YUVA 3C41J 2WJ6A 4BQSA 4DMUB 1DBQA 2QPAA 1HI9A 1XB2A 3OM0A 1V9CA 3RU9A 3TRKA 1GN9A 4D8VA 3GT7A 4W1SA 1NNEA 1ZONA 2J9FB 1LBHA 3H1TA 1UMBB 4OHPA 4RY9A 3QY9A 3ZTWA 9ICHA 4USAA 4Q93A 1RJDA 3JQCA 4QE3A 1WUHS 4RHYA 4NMHA 5EP4A 1SXGA 2GPAA 2WOOA 1REQB 1O96A 3Q8XB 5CNMA 3QEBZ 2WLTA 5FBKA 5IN4A 3U5TA 5J2TB 2RGRA 2QXTA 2Y2UA 2JKYA 1UJ2A 1SFRA 4TN1A 3DQPA 5DHQA 2JH1A 2GAIA 4B7XA 2LRHA 4TUSA 4BCBA 4DYDA 1C41A 1VYUA 1YR8A 3NFYA 4HZUA 1DX6A 4FIDA 5KDDA 2NMVA 4TRJA 4MUJA 5K0SA 1KYWA 4BFTA 3PDUA 3QWHA 5E6RA 2DY0A 5LQCA 1VXOA 2BGKA 2VDNB 3Q88A 4OA8A 5FHQA 4CCYA 2OYSA 3OFJA 4F7DA 4HTFB 3DC7A 2OY0A 2OO3A 3IO5A 1AB6A 1M72A 2OHJA 3MTEA 1WXHA 2BLLA 4IL6U 4DZRA 2JF0A 5IDQA 1TJNA 5CDHA 3QIVA 3CRQA 1VLBA 1ADCA 3WWCA 3KHUA 3FZGA 2DGDA 3CKMA 1C9MA 4BJ6A 1VQ1A 4Q9LA 1FYDA 1FW8A 4UB6U 8ICLA 1AF7A 4OQLA 4BECA 4DBZA 4XTRA 5EIWA 2JHPA 2GN9A 3ZNOA 1M1XB 2KKVA 1L1FA 1CK4A 3HYCA 4G1BA 5FL3A 4Q45A 3W9SA 2CVZA 3NVVA 1QR2A 2GBFA 3EG5A 3M49A 5C7LO 3CHYA 3TBHA 2MINB 5AW2A 2FPUA 2FB9A 5E4JA 3NHBA 4O3OA 2FFAA 2MYPA 4JH0A 1D2EA 3KJIA 3OE4A 3ACCA 3ESDA 4QYMA 1ZQYA 2AGPA 1SL1A 3L7CA 4Q0MA 1HSOA 4YCMA 1IXRA 3SC3A 3RPEA 2MYTA 4S05A 1JZTA 1NPTO 1XELA 3HVHA 3C48A 3CUKA 3MSCA 1JR3A 3LQYA 2R6GA 2A1IA 3A2LA 1FW6A 4LF5B 1P5FA 5FFFA 2AOTB 4AY6A 4MHTA 1Z6TA 2W8KA 3Q3EA 4KHZA 1DTSA 1T0JB 2Z3VA 3ZNNA 1R4AA 3H7AA 3QG1A 4HNRA 3SFZA 3VSBA 2FHSA 1UINA 3ZX4A 1O1YA 2NV0A 4UEOA 1QVAA 2JNWA 4K9OA 4V0OA 1ILEA 2XZLA 3GJZA 3RTCA 4QSMA 2RD2A 1PJLA 3GCZA 4TV9A 1LDYA 2JHDA 3ZGNA 2R4TA 3AB3A 1V5GA 1TQ8A 6REQA 1PR1A 4MEBA 2HMXA 2AH5A 1QLJA 3QFFA 2IODA 2M6KA 4LZZA 2F4VB 1T91A 3IKVA 1M76A 4X6YA 1Z2CA 5KYUA 2E55A 1G60A 3ZK8A 2DVMA 2DYKA 5EL0A 1EE2A 4DB4A 1R00A 3O31A 1QVRA 3P9IA 1QCCA 3IKLA 3DG9A 2JFBA 2JLAA 2C2YA 4PZZA 2VK2A 1SO8A 5KG1A 4HPJB 2OO5C 4EHBA 1N2GA 5EIBC 3BAFA 1U48A 1JKIA 3TVDA 5F3XB 4TLEA 4NYIQ 5LXTF 3GV8B 1FC0A 2JFVA 3FTQA 2X0DA 2OV3A 3WKEA 1CUGA 2F3PA 3IUMA 1RYUA 4RD3A 3B52X 4L6AA 1ZQUA 4OK5A 5KAIU 1ZQ1C 1X70A 3A1NA 4IKOA 1N4DA 1VMIA 4QKQA 3U4HA 2Z4TA 2C3OA 1L3TA 1KXJA 3DMGA 3TSOA 3UMBA 5K0LA 5K0BA 4TUPA 3P9NA 4LJ6A 4CF7A 1YOVA 2OOKA 1UBNA 1I2BA 5DN9A 3M4XA 1HLGA 1NQXA 1EX9A 2EJCA 3JZDA 4WK6A 1A4IA 3V97A 3LBAA 2A67A 1V5FA 2OHIA 3GMTA 6YASA 1QWOA 1SCKA 1Y7TA 3HE3A 1RJWA 3AVOA 1EFRD 3PI7A 2J30A 2GX6A 3OECA 4JS0A 5JO9A 2DFLA 2HHVA 2FETA 2OCIA 2PSEA 4UVGA 1WO8A 5A02A 3SC2A 5A4IS 1QRAA 4YXWD 1XQ1A 3AGPA 3RYHB 1M2EA 2JARA 1U8XX 2ALJA 5HF5A 3O9VA 3BJMA 3C85A 1DAMA 1MB9A 5AKJA 3D3QA 4KWIA 5JD6A 2PH3A 4ID3A 2BGLA 2QAGB 4RNNA 3ZHYA 3RK0A 1GT6A 1L1EA 4UXIA 4RNOA 4DV3B 4MRPA 2IVZA 2KZMA 4M04A 3HKZF 1D8BA 3OZGA 3GROA 1Z75A 4YQEA 4CJXA 1LSJA 1F4LA 2PGNA 2WHYA 1JSRA 1HY3A 2Y0DA 4ZV7A 3SZ3A 4CRWB 1QRSA 1A9XB 2SICE 3BWBA 3TO5A 1DDOA 1O6FA 2W4QA 4Q18A 1T4MA 4CCYB 4W5OA 1KDHA 1QP7A 3CA8A 4JEHA 1P2TA 4HLDA 4FKZA 5D84A 5LZ2A 3WK9A 4GYKA 1RJ9B 5FTKA 2VCYA 2GJ8A 4U7HA 3RJMA 2E4AA 1N3YA 5AKXA 1XF9A 2FSIA 5A6SA 2NV6A 1R88A 2QB1A 2QROA 1PKEA 3TCXB 4Z9FA 3FNIA 4TWRA 5KKAA 2KLBA 3V8VA 1O94C 3CZQA 5IDVA 4W9NC 3S55A 3SXJA 1XPRA 2IYQA 4BMYA 4RETA 5EWGA 2J3QA 1OR8A 2P6MA 1D2HA 1GSIA 1IHDA 3A6JA 4LNUA 5AVTA 1ZN2A 4HDSB 3EPKA 1O08A 4NCKA 4BMSA 2F7SA 9ICMA 1GG9A 3KJGA 1Q95A 3C98A 4US9A 1VKOA 1XCGB 1J4AA 2A4KA 3MJ4A 5KFZA 4G1FA 3VZDA 3GGGA 3DR3A 1LK7A 4MULA 4RVGA 4YR0A 2BI4A 2BGWA 1DAKA 2HT6A 3LBNA 5TS3A 3UT5B 2W6QA 5JEDA 3KSAC 4UZSA 1D04A 1S4MA 3TNDA 5LKAA 2HDWA 4OYLA 5JH7B 4BNZA 4C14A 3R9WA 4Q37A 5IF3A 3BMXA 1Y88A 2AEFA 2YJNA 1LPPA 1FPMA 3G9XA 4MVJP 3TOZA 3H1FA 1YZKA 2VP2A 1Z13A 3DE2X 4R1TA 2Z3WA 5ESDA 1HE5A 3EA4A 2FWJA 2IDJA 3EGDA 2YV1A 3F46A 1LLUA 3IBSA 4HUJA 4YQZA 3SIRA 4DILA 3W5BA 3KKMA 4LVSA 1G19A 2GVZC 5KFKA 1JFVA 2X2OA 2X4IA 2ZQYA 3A4MA 3EFHA 4ZK2A 4G24A 2ZVPX 4EZEA 4J9OA 4JJ7A 4A0FA 1WHSB 4TKMA 2ISSD 4YREA 1E6CA 1JIIA 5AM0A 1S7CA 2B7BA 3LGXA 4KGXA 4M9CA 2VHXA 4PAWA 1P2FA 3CR8A 2VAVA 2PGIA 3GJ7A 4PXYA 4ECZA 5LLDA 2BFCA 4W9RA 5HCNA 4MKXA 4B3DA 2WSBA 3T5JA 1O57A 2JIRA 4GR4A 4QQ8A 1HEIA 1OU4A 2PKXA 5HOQA 1BWRA 3EDYA 1U8UA 3R5SA 4OMFG 3DW3X 4MGKR 1M8JA 4DIEA 4FFOA 1AQYA 1S3GA 2O8FA 1L0BA 1FUKA 1RACA 2EVWX 4C43A 4JWMA 4XYLA 5H80A 2X5JO 2XNKA 2DFPA 5EHQA 3RNOA 1D1PA 2Z1MA 2DUWA 4JVNA 1SVNA 7ICIA 4K86A 5LN1A 1TUGA 3AF0A 1HZZC 2J67A 1XWIA 3I39X 4PCVA 5BT9A 3RYFB 1O94A 3VC7A 2QRJA 3L7YA 3LVRE 1KOGA 3KQPA 4IGKA 3GDFA 4PRZA 4WZAA 4HDCA 5IABA 1BEEA 1CY1A 2AGVA 1UPHA 1IDOA 3E05A 1GT91 3K05A 5EC8A 3LUAA 3TAUA 3TIVA 1OUQA 1YZLA 5IBRA 2Q07A 3WYBA 1G7TA 1ISPA 3OM9A 4DIOA 4HYEA 3PPIA 5TV2A 2GN0A 5CIWA 5C4MA 4D8XA 1XTRA 1ZGBA 1YB1A 2KHZA 3GG9A 1XZCA 3QX7A 3UQYS 4HDMB 2NUAA 2W2LD 5AW6A 1E63A 3WC4A 3RVOA 1OYOA 2C2HA 1FQOA 1DINA 2IQIA 2RMKA 3A05A 4LJSA 4R8MA 4XX0B 4BRWA 3TFOA 1N78A 2X8AA 2VDQB 3UXMA 2Q7XA 1A5ZA 3KJNA 4MGHA 2ZRMA 1KQGA 1U4OA 3GJ3A 3LDHA 2C4MA 5DSXA 5IT0A 1RG6A 3N70A 3WLSA 4DQSA 2GA9A 2G76A 1GLNA 2ODGA 2X3FA 3NJ8A 2VXBA 4LZOA 1IEVA 1SKAA 2FUG1 3AEUB 4CKYA 5JXHA 3ZGZA 2SHKA 1OKKA 2V7QA 3VSCA 5DB8A 1BXRB 1OA0A 2FZLA 5JUWA 4O2AB 3ZKWA 2LYAA 3AVWA 3QUTA 1G42A 3FR8A 4D80A 4UUBA 2PMDA 1GR1A 3P45A 3ZUPA 4AK9A 3HCDA 3NTLA 3NGMA 5H3HA 1TW3A 4RZIA 3H04A 2CXTA 3NASA 2A9FA 1OAOA 3C6KA 1OLOA 2LM1A 2J5BA 5KOJB 1VDZA 5EUMA 4C4AA 5DGDA 4IQ0A 5TQ2B 4CG1A 1XDUA 2XY6A 1N6KA 4Z0NA 2PWZA 4Y1EA 2YW2A 1NI4B 5HKBA 2Y0EA 1G2OA 4MW1A 3SS7X 1BX3A 3KC2A 3V4RA 2IF2A 2AHRA 2FOIA 5K2OA 2KE7A 4Z3KA 1MRZA 3DWIA 4J4BA 4GX1A 4C8OA 5ILQA 2A1AA 1T2AA 3AYZB 4F5PA 1GNSA 3BMCA 1OFHA 3DBOB 3ND7A 4GLLA 3FFXA 5DLEA 4G4SP 4XDHA 4ZAGA 5YASA 4EBFA 2HHJA 2HJSA 2WJPA 2CHFA 2JCVA 1C3VA 2FDXA 2CZCA 2L17A 5CNIA 4RD4A 5BURA 2ZPUA 2H5XA 2FCRA 2MCFA 4IXWA 4KRFA 1G8SA 2VUUA 4B4VA 4QXRA 4WLNA 3HFJA 5F5NA 1OI4A 5JAMA 1IXSB 1YHZA 2DR3A 5BSKA 1Y7HA 4RMGA 1LK0A 3PRJA 1JH9A 4EELA 1S97A 3ROTA 1D9ZA 2IX9A 5C2JB 1R3UA 1TLLA 1DRUA 1M0SA 1NW3A 3G85A 3URMA 3WHPA 3QUQA 5J3JA 3IXMA 3MCVA 3ABRB 3WP1B 1RAIA 2J46A 1N9ZA 2FG5A 221PA 2BH9A 2DUYA 1UMKA 8ICJA 3F5QA 2YJ5A 3WGTA 2V0NA 3LYUA 3TW4A 4PG4A 4E2ZA 4G0OA 4XCXA 5JXJA 2H4JA 3L7KA 4IR9A 3IMFA 3HB0A 2QY9A 1DOAA 3OFVA 5H59A 3U2QA 5KT2A 4EYEA 4A6EA 1PT9A 3T1NA 1YR7A 2NO1A 3GZNA 2A5JA 1M66A 4TYWA 3RVSA 4JCOA 1ZQIA 4WE3A 5NLLA 3R3WA 4GGMX 4GZ6A 1C1DA 4KLAA 2BFCB 1N5XA 4FSDA 4DVGA 1ZOSA 2NZYA 1ZKDA 2QTCA 4YR3A 2WSSA 4J90A 5EWMA 2V6JA 2ZJZA 1F0NA 3JPTA 5IMSA 1Z2DA 1THZA 3G2IA 2WJIA 2KJ5A 3AK4A 1KBQA 3IMGA 3PUKA 4MV3A 3D9QX 5CW1A 1FX0A 1IOLA 4YRQA 5FEMA 3TW0A 4DV7B 3DDOA 2FMSA 2VH2A 3DD1A 3IHQB 1MVNA 2KP7A 1Q14A 2NNWB 1U3DA 2XXAB 4P4MA 1TX4B 4BX0A 1TEZA 2MOKA 3DVAB 1YB5A 3GLRA 3H3XA 1BA3A 2ZXHA 3RH6A 1LPNA 1T3GA 3FSGA 3I8SA 4M3NA 4RH3A 5DHPA 3RE1A 3SK0A 1KZ6A 1T1SA 3JZAA 5FEUA 1HR0B 5M2QA 3MJSA 1ZN9A 3PPWA 3UMGA 4HNHA 2DFNA 5AK4A 2NVWA 4HX9A 3RFUA 4FX2A 4JOBA 3A6PC 4ACBA 4C08A 1RHKA 3OPYA 2PPVA 3R44A 2PMZF 1JI0A 1TF5A 1DI0A 4KH0A 1ULTA 4NJEB 1UQTA 2REBA 4RSGA 1NJ5A 4B74A 5JCPA 2Q8QA 3H9JA 1DRVA 4ZI5A 1ZNZA 2AVNA 1KSGA 1VSVA 1ZW1A 1AURA 4G25A 3WSTA 5JPCA 2FHPA 5FTNA 1QO0D 1OX4A 1U4SA 2IOQA 5HEKA 2ZUSA 4TV8F 3R7LA 3UB4A 1G9SA 1X7WA 3A8TA 3ZDZB 2PN1A 4YQYA 4Q4DA 3HKCB 3E0FA 2IBKA 1ES9A 3K1AB 3ZU3A 2R1ZA 3C3MA 4B43A 5KVVA 5C18A 2HDOA 1EJ0A 4M87A 5T67A 4ZK6A 1J2NA 3BIWA 3BVPA 4QUEA 1OW5A 1JQAA 4QC2A 4LXTA 5LP6B 2O19A 2E0IA 3AI1A 4ENQA 1NN5A 3KJFA 4XEHA 2ZSHA 2W8BA 1VHWA 1DOZA 2QPOA 3FKSA 2UVDA 1OZHA 2FPMA 2ZRNA 4KH1A 4ZI7A 1OV6A 4L2IB 3LK6A 2Z5GA 1YAJA 1I1HA 2DPJA 3AHEA 2I2CA 1L3UA 4EHIA 3CF4G 5H16A 3KPYA 4YJHB 3ZW8A 3D7KA 3L4PA 3KV1A 3HACA 3MN1A 3JQ9C 4JV0A 4R1QA 1W52X 4REQB 1UWVA 1RWMA 5IAGA 1C3EA 1DQPA 1RI4A 3LXXA 5AW1A 3AO0B 5TDHA 3E61A 3BB3A 3T5TA 4DL9A 5K5EA 2AFIE 1Z25A 4UVEA 2W0SA 1P0MA 3A1UA 3A4VA 2P1RA 2XE8A 3L6BA 5E4YA 2B6GA 1PW7A 3VHXA 3L8CA 4GR5A 2GMWA 3HA7A 1SZPA 2FEAA 2R11A 3H42B 3JSAA 2KD1A 4OFBA 4PLFA 1KKXA 1N6RA 2I91A 1RDFA 4L72A 3IBGA 4RJ2A 2SKEA 3OURA 4UBKA 4AKEA 1F2TA 5L7WA 4Z1OA 4NH0A 1SPXA 1J9EA 1QHEA 2V7XA 5CU7A 4CMKA 2ZTEA 4PRYA 2R2AA 3IVCA 4CHTA 4UBMA 3KHHA 4B4DA 1NYLA 2VNIA 1YUBA 1J7JA 1EVLA 1XSEA 3S5JA 1RPAA 3A32A 5TARA 4YRPA 3X44A 2Z43A 3M6ZA 1CQIA 1DKPA 3L8GA 4U7FA 1QC5A 3JALB 1FRVA 5IDYA 1KJJA 3OPQA 1T3SA 1UK7A 2BTQA 2D1QA 4B8YA 3R5JA 1K4MA 4IX9A 5FUYA 4DJFC 3GJTA 1JAZA 1IZ8A 1ZO8A 5LB2A 4S35A 4DMGA 1TQ6A 3AW9A 1MH1A 2VDWA 2NV2B 3PFBA 1HNNA 3E15A 3G6VA 4PWZA 1KHTA 1LS1A 3CPEA 3W7AA 2DBVO 5T3UA 1XZJA 4D99A 3A11A 2PSSA 4FFPA 3VPXA 5JRZA 3VTZA 3KQUA 1PVRA 1C2TA 1F2DA 1T6NA 2QRUA 4GPAA 2NU8A 1NONA 2CXYA 3VR6H 5IJZA 3M82A 5K8TA 2RONA 4GSYA 2WIDA 4X66B 1VHJA 5IBQA 7ICUA 1EGMB 2BFEB 2FG6C 1K6IA 2BDUA 1XJWA 1CZKA 3R5KA 2JJ1A 2GEUA 3AIOA 3QKUA 5CJ2A 3WB1A 4E0DA 5F12A 2ZDGA 3JSXA 4UB3A 3WYCA 3VOSA 1VP9A 2O06A 3C4JA 4WSOA 1KO5A 3HC7A 2PKEA 2WK1A 4OB8A 4GQIA 3WDMA 3W8RA 6REQB 1GZ7A 3EF1A 2KPOA 3LZ6A 2PXAA 1MDFA 4Y2UA 1JJAA 4W7HA 4U9HS 3ED1A 2ZYVX 3JQ9A 3P2YA 4YRGA 2WKQA 5KX5F 2XMBA 2G5IB 2QTLA 1AS0A 2WTMA 1EUZA 4YUYA 3NEYA 2AUMA 4KVFA 4OQMA 3GDXA 2JPDA 5DOVA 4L5JA 2IOFK 3E8MA 3JQAD 1B6SA 2DKZA 2JH8A 3LE8A 4JKIA 4OHVA 2ESEA 5KQGA 1EM8B 2CVPA 5L53A 1CF2O 3GFPA 4Z7QB 3PV8A 1O8BA 2AW3A 2R6R1 1M1YB 1ZKMA 4O3FA 2W8ZA 4L9RA 5A1TA 3PGA1 3ZD9A 4QOJA 2XA2A 4W7IA 4RV5A 4MS3B 2A5GA 2YMLA 3KUCA 2ZTMA 3ECAA 3VZPA 2IYVA 4IR7A 1KRXA 4B9UA 4RF2A 3KLPX 3GLIE 4AU1A 1P5JA 2QDXA 4JKOA 2FJPA 4YMTA 4RTLA 2J8ZA 3PX4A 4NV1A 3KQHA 2BSAA 1ZNXA 2R6HA 3RC1A 3NMUF 3UBTA 1OH6A 3MUOA 5T3YA 2R1TA 1MC5A 1CRWG 2GYUA 3KSBC 2V65A 1QQAA 3QLUA 3ZNPA 2QTGA 2CVHA 4P7JA 1UFQA 1EDZA 4MUBA 5K8CA 3E70C 3KAKA 3GVXA 5KG0A 3JW8A 5AH0A 4UOEA 1DX4A 2QENA 4KNWA 2OXIA 4W6ZA 2OGSA 3H9QA 3VAZA 3DQQA 5JDCC 3HFSA 4KK4A 4F85A 1L4LA 4R65A 1KQQA 1DWUA 4I6GA 4P4NA 3AHDA 5CX1B 3E2MA 2H1CA 2OAQ1 5FYDA 5AW5A 4BRZA 4TRNA 4L5AA 1BQ3A 1H2RS 5FWDA 5KU7A 5IM4F 2KHVA 5HNKA 2WNIA 4CG2A 4ZOHC 4EPXA 1L5FA 2R60A 2LYBA 1K4YA 1VKHA 4JLNA 3L1HA 3PUWA 4BRUA 5IKPA 3PC2A 5IULC 2ZWOA 2NO9A 3TLYA 4ZYYA 3LBIA 4R8LA 5B7QA 1HT0A 1YC5A 4K2HA 4LUCA 3ANTA 4C4RA 1QFSA 1U2GC 3HU2A 2JJ2D 4N1AA 7GPBA 3NHLA 1I6MA 2HR1A 3TACB 1GRVA 4INAA 1JDTA 4R1NA 4BU1A 4DQXA 1OH8A 1VGVA 1P61B 4DL6A 2B34A 2Z5FA 2CMKA 4NYJQ 1THMA 4P54A 1R0BA 4H3KB 5JWRA 4YAIA 2QD1A 4CN9A 1JAXA 4ATNA 4A16A 1SULA 5HFNA 1IIPA 1PGNA 2B1QA 2F1RA 2GLUA 3Q6NA 2KS6A 4OX9Y 3N28A 1V8DA 2WM9B 1RHQA 2VS1A 1DKRA 3AESB 5HF8A 3MWDB 5K3AA 3GFGA 1RIFA 5DGBA 1MN6A 2YDXA 1CUBA 2OMEA 2KMDA 2W9AA 3R23A 3UXYA 1DBSA 1HIWA 1ZC4A 3KXIA 1FB5A 1V47A 1S4QA 2P41A 4KWEA 1J25A 4QQKA 4BO4A 2C2RA 3B48A 1PZMA 2P9TA 1Y4ZA 3N5KA 3U80A 5GINE 1F8YA 1SXPA 3OCJA 4MWBA 5KVQA 1A7AA 3L6UA 1KAQA 1T5DX 3PHBE 2ZJ0A 4JYZA 5DB6A 2B0CA 3AB7A 4YN4A 2IT1A 3DR5A 4NCBA 2RHOA 5J2EA 5AK0A 2FN4A 1F38A 3BWDD 4H18A 5K3EA 1LPOA 2E8OA 1CZUA 1LLFA 2ABWA 2WVHA 3TQCA 1D8YA 4WN3A 3SV3A 3HDHA 5SYAA 4WQMA 4LK3A 4P3XA 3ZLUA 1NVBA 3QZ7A 1NUHA 1S96A 2HMAA 3PCXA 4A4DA 4C3UA 1ENPA 2TMDA 3VKGA 3V6HA 1IXRC 2RAFA 5CXSA 3GLUA 1UM9A 1WNTA 1ZH6A 4KO8A 1C4OA 3TK1A 1UQRA 3A06A 4JVOA 2W83A 5A9RA 4QT0A 1HM5A 5EUBA 1K7XB 4KV7A 5ITWA 3I83A 1BNPA 9ICTA 1AQIA 2GJKA 4KOAA 4TXNA 4L0QA 1IQ0A 4QVKA 5IFLA 3OH8A 3MBYA 4CQMB 2H1RA 1AUVA 2JBHA 4EZ9A 1VL8A 2Y05A 3S2FA 4R8VA 5BR1A 3HEBA 3NTUA 3FX2A 1XEWX 1EP3B 1BXGB 1M7BA 3G7UA 1SVSA 2BW0A 3GGJA 3K73O 1CY2A 1SNYA 4HN9A 2QI9C 1W6UA 2NW6A 5DHSA 3DE3X 3WIVA 4UM8B 1NATA 1M74A 1TGYA 3E1KA 3M34A 1L5LA 1HPLA 3EPJA 1T2VA 1CQWA 3OHMA 1PR9A 2PRKA 3ZHTA 1L3BA 1OKKD 3W3AA 2EDUA 1QZ3A 3HL0A 3D6JA 3A1TA 3DAHA 4Z3OA 1CDEA 4RQ6A 3E5HA 2NYUA 3VKWA 3AETB 4J07A 5D8DA 4G5GA 3VC8A 1EVJA 5F4ZA 1WCV1 5AWFC 3SF0A 7ABPA 5A7HA 1ZD2P 2GCOA 2OO5A 4B85A 5BW4A 1LS6A 3VR0A 4O4JF 1L7OA 3PW2A 1ODTC 3KHTA 2CRXA 4TSFA 1QGYA 4NCNA 4A6PA 1MR3F 4RQMA 4KAXA 1KKLA 2XI9A 1MIHA 1V4VA 4MV7A 5FNVA 3STWA 4BGEA 4FPXA 1OTYA 1UKVY 2KFNA 4XVCA 5B3JC 2F48A 1RXYA 2BFOA 2LNDA 5KT3A 1XCBA 2FW8A 4QIWF 2JLZA 3HDTA 2CLOB 3PMNA 3OHSX 3IUSA 4ID9A 4K28A 4L7QA 2JH3A 1NT4A 2VEDA 1O6ZA 1YWGO 1LDEA 4QRIA 4EWLA 5JZ9A 5K45A 1FJHA 5I7UA 3PO4A 8ICXA 1PJRA 3GAFA 1NX6A 3UIEA 5I7VA 4U0JA 4RFSB 2RHBA 4YJ2F 2X1LA 2V1UA 1F8FA 5AW4A 4RTRA 2QMOA 4OOEA 4AG5A 1GGNA 3TS1A 2C20A 5A5FA 3WFIA 3GAMA 4C2AA 2H54A 3QLEA 1ZZGA 2JKZA 3C3KA 2A9QA 3DL2A 3NR2A 1L7QA 4IPTA 3W5IA 5TEVA 3GJRA 2ZYWX 4HXEB 4OVKA 3PNSA 2XCAA 1BJTA 3V6MA 3R8FA 3K1YA 3CO5A 3GRPA 8ICRA 1VRVA 2XT0A 4RTNA 4QYIA 4FMPA 3C7DB 2O4UX 1XZQA 1BH6A 3M3DA 4CTOA 3AI3A 2Q3CA 4CF4A 4M0FA 3KU1A 1A9PA 1WSWA 2I4MA 5GVRA 3LG2A 5JTTA 2IYTA 4G0PA 1YZ6A 5K03A 2FZKA 1H9CA 3ZWDA 3JPNA 4DN6A 5EQTA 1JG1A 1S6YA 1MQ9A 2UYQA 4LXYA 3TCKA 4RTQA 5KHAA 3RIHA 1M2VA 1JU4A 4CFZA 1T3TA 1BDJA 2WHXA 2PGJA 3R41A 1YDHA 1ODJA 4J0JA 3NYIA 3G6YA 1G6HA 1EUCB 1NBAA 2ECOA 5ECYA 5LXTA 2AFHA 3G7NA 3T3DA 4DLGA 1SIUA 2QIPA 1QKJA 4EI8A 4WLEA 3TKAA 5IJ9B 5EWFA 2Q5HA 1V8PA 2V4MA 4JZKA 4UBCA 2IZZA 4MGIR 4MUKA 4HQLA 4BJQA 1PYGA 4U7PB 3T79A 1H8ED 5DASA 1HNXB 1P17A 4JWKA 1W4CA 5KG2A 2Q7DA 4C0XA 4ZCIA 1Z4QA 1DMSA 4NR0A 3NKFA 2L5YA 1RRGA 2FY8A 1LD3A 4RGQA 4RIEA 3VSEA 3W06A 1NVFA 3S28A 5J2FA 2A58A 5I7RA 1C2YA 5BV7A 1E9FA 1V16B 1UJ6A 1R5NA 1NA5A 1I4DD 2XECA 3W6UA 1A71A 2H3ZA 2O1EA 2AG1A 2I99A 3E9ZA 3FGOA 3MOGA 4PXAA 5AJWA 5F2OA 8GPBA 1J2TA 1HLFA 1KMNA 5IXSA 4JI0B 1XDGA 2PLAA 1SKMA 2FWPA 4IJ6A 4FYIA 4EAAA 1TEXA 2B1JA 4KLQA 1SKSA 1GKIA 3GBPA 4LIPD 4NBWA 3SKYA 1TO6A 1LB2B 3DM9B 5A3VA 4CF5A 4Q66C 2XQIA 4TN5A 5LUBA 4R41A 4D4IA 1AUQA 3KQNA 5EXSA 1XCPA 4DDHA 1VG0B 5AM3A 4K8OA 4Q3KA 3B1YA 5G3YA 2W54A 3AGQA 2EZZA 4PWYA 4XJXA 1BROA 1YT3A 3ZJ4A 3LW8A 4E4YA 1RI5A 2JLUA 4H16A 3M4NA 1Y9JA 4A15A 4N5MA 4NAVA 1S9HA 1W0JA 5I9MA 1JIVA 4MQFB 2I6TA 4NHOA 3H84A 2PH7A 4JL8A 4UNIA 1UFRA 1YBVA 4ASUD 5SY9A 1OZ0A 3PZRA 1JLRA 5KUTA 4AKHA 2WWWA 1MJ5A 2QBYB 1GARA 2EFEB 3GRUA 2FPIB 4JBYA 4EA8A 3AL0C 8ICVA 2GWRA 2QU7A 2YZKA 2ZE6A 4A23A 4J6FA 3ZDRA 4CM5A 3EUFA 3VKFA 2Q9CA 4QYSA 1U0TA 2CHQA 2JB9A 4J9SA 1GCAA 2GZ1A 1ZQFA 1PJ4A 3G23A 3KQMA 4J43A 4ZVKA 3WIBA 2F3SA 2B9EA 2XTZA 2KVSA 2QTWB 1X8JA 1YZTA 3JQPA 2DWPA 3KK0A 4NE9A 1IULA 2DT5A 2FK8A 5CLLA 4ZQGA 4YAOA 3WGLA 4PZPA 3QYFA 3S6JA 3ICXA 3V5NA 1S7GA 3QVMA 1RZVA 2ZUDA 1EZZA 1ZD5A 3G82C 3K15A 4TL9A 4NBNA 4OUKX 1BVUA 2IYRA 3JQFA 4YJ3A 4DLWA 5LYJF 2AR7A 4MLZA 5FTJA 1X9GA 2ERCA 2LDXA 3SYMA 4F4XA 4DQIA 1DXSA 2P5UA 5J23A 3DE7X 3O8QA 4O2BA 2RGNA 3I01M 4TMVA 5ELMA 3CBQA 4QZ8A 4YMWA 4MLDA 3QXGA 4CV1A 4QZBA 5JZSA 3X2FA 1ENOA 3B3FA 3CISA 4M9XA 3U7JA 3RKUA 1G6OA 1USGA 2H1FA 4U1RA 4EPWA 3CZPA 2I8AA 2Y1OA 3ACBA 2WT8A 5B58T 3HCEA 4FZ3A 4IIDA 4RZQA 1EEHA 3WKCA 2WVGA 3L8FA 4M22A 4RAOA 3TWOA 1BFKA 4ZZ0A 1TTTA 3JVIA 1P31A 4PSVA 2REOA 2O8NA 3PWTA 4NOJA 3KTQA 2W9CA 2QV0A 1H4QA 2BUAA 3GA0A 3GJ5A 4FHEA 2ZPTX 3MDAA 3ESYA 3IERA 4KI0A 4B3GA 4P5EA 4ARBA 4H1HA 2CBGA 3L1IA 4RMNA 4C1BA 2FMTA 3QELA 5DBBA 2NZ2A 2X8JB 1GAXA 2WM2A 2Y2VA 1O5OA 4NPCA 1QRTA 3VPCA 4DQUA 2EG9A 4QGAA 1ARZA 2CNNA 2I4OA 2XOXA 3CLHA 1SWWA 4QL3A 2Z83A 1WKBA 2HA5A 3TG8A 3EBOA 4MYTA 4EG8A 4MI9A 2D1SA 5I9SA 4WA8A 4ZOLB 5C1BA 4DQRA 1SBZA 1TK9A 3K2QA 3U17A 1JMKC 2HJGA 1L2TA 4D44A 2QZJA 3D2BA 4LBZA 4CTNA 5J0SA 2KG5A 1VKJA 2ZWIA 2CLKB 2BR5A 2FSUA 2IZ5A 1Z0DA 3MMZA 5HS4A 3WNBA 2RDIA 1N56A 1B00A 3FGZA 1QWSA 1Y37A 3FNGA 3ZX5A 1N32B 1E2KA 1L5SA 1XCJA 2REQA 3L79A 3T7KA 4B9NA 1ZL2A 3FGPA 3CGGA 1X3SA 2VWQA 3V4OA 4LMRA 1Y34E 2WYHA 3FBWA 1HX7A 4IHAA 3UJBA 1W0KA 2QORA 3JQAA 3TAXA 1EWQA 4P9NA 2AXEA 4D8UA 3QQ5A 1P60A 3D64A 2NU7B 3U61B 3C28A 4JJAA 2UVPB 4FN5A 1F1BA 5AO9A 4OLBA 2HVIA 1F6DA 3V48A 4EGAA 3DV2A 5J29A 2HMTA 2JZBA 2WV7A 4BC1A 5JTIA 1OROA 3KHKA 4TWIA 3B7GA 3TMAA 2FLWA 3A1SA 1NULA 3DOEA 4K88A 3BERA 3NATA 1CUDA 4UAZA 3Q8RB 2XMZA 3L0CA 3LWNA 1UBUS 3P19A 2WZDA 4KQHA 4NZNA 3TG2A 3RAEC 2YYSA 3BRCA 3CRRA 1PJCA 5EA2A 3X1XA 5BWLA 1Q7TA 5J8YC 4LDQA 1ILWA 4JELA 1DBVO 4EJ0A 3L9XA 4BNJA 2ZSFA 3UMRA 2CV2A 4Y0AA 1LJ8A 1R10A 1GL6A 1SG0A 2BZ0A 2V7EA 3O8RA 4ETMA 2JW5A 4QHTA 1G5TA 1LA2A 1W4LA 1Q0UA 1X7WB 1XXHE 3L07A 4NDNE 5CVVA 2QOEA 2VPQA 5AESA 1Z38A 1ZX1A 2JFGA 2P3SA 5IIOA 2V7BA 3D4LA 3NGLA 1AGPA 1IB6A 2ZP1A 3RBEA 4TOIA 1LU9A 1EXVA 4V1CA 5KYGA 4D0GA 4A0SA 5ALIA 2ZYIA 4CKCB 1UHUA 1D03A 2HV8A 5BSUA 1YE3A 3D7SA 4MV5A 1XD2B 3UTCA 3FVQA 3IS3A 3DOCA 1WOYA 5HR6A 3GI1A 3NCTA 4HEA6 5ER9A 5GQSA 4EQ6A 5EZ5A 2F55A 2CJYA 4YP6A 5KSYA 4BXOA 2WF8A 5AQ1A 4DLAA 1JE0A 2XH8A 5B37A 1EK1A 1Q77A 4UPEA 4H1WA 3UICA 3F6YA 4JP3A 4K9QA 3FUXA 3DBLA 1F06A 1HDGO 5EMKA 1KYQA 2DH6A 5I01A 4DC9A 3I28A 2IWHA 1VI6A 2HBZA 1A9OA 1P1JA 2VP4A 2D8MA 3G13A 3OJXA 4I4TA 3JWEA 5JG7A 2G5GX 2PZFA 3BXPA 2C92A 3ISJA 2ACKA 3GJ0A 4ZH4A 2PXHA 3H65A 3NT2A 2WAAA 3O3MB 3QF4A 3VKVA 2W37A 3VOBA 4EA7A 4AN4A 5AK3A 2WJJA 2BHTA 1LBEA 4OUDA 5BQFA 3CVWA 1KI9A 5IG2A 5G1NA 3MTBA 4PYQA 2XT9A 4MVJH 3TD2A 4EHDA 4R9UC 2AD5A 1MAUA 2GEDA 4F4HA 1PLLA 2QY6A 1AROP 1R0CA 2II6A 2XF2A 5JYBA 4HB2A 4DV6B 1U0HC 2Q5OA 1X9XA 2WWFA 3ESCA 3R7DA 3OOEA 1G4HA 1SIOA 4HH1A 1T3NA 2AJQA 4ZI3A 5BWMA 3RC7A 3TF5A 1A4RA 1DEXA 4EP1A 4N49A 1YT5A 5BWOA 2O2XA 3BFKA 3DB1A 3EMBA 3FCYA 1KS2A 1W9MA 2FMXA 2BP7A 4AQDA 1MT0A 3BJZA 4NLNA 3P2IA 4Q3LA 1J56A 4D8TA 3KB6A 2TMYA 5AJYA 1O95C 3OFSA 5IANA 1WULS 3VNVA 2Q3JA 3K0AA 4IQTA 2QUZA 2ACWA 2G80A 4MRMB 3F0TA 2VF8A 3PE6A 4BYMA 1A9SA 1PJQA 4JAVC 2BM0A 1KERA 3I12A 1GZ3A 3M2TA 2OHFA 3V4SA 4Q05A 4DA4A 3ND9A 4X60A 4CM6A 1KNQA 3MCWA 4BKQA 3L7LA 4DQVA 1FJ2A 5DGCA 3AOGA 5JPDA 1EBBA 3TOCA 3X1DA 4M1KA 5HUJA 3LUDA 2YJ3A 3MWLA 4RTOA 2PVCA 2FF5A 2AUTA 3GNSA 1QZUA 5C0YA 3IBFA 5CLGA 5TSDA 2NSHA 3VRHA 1A82A 3HHPA 4JUFA 2PSFA 2XKKA 3ZI7A 2JRLA 2GERA 2VHEA 4G2TA 3MYYA 1E8MA 1B0ZA 1E3DA 3QEMB 4PYNA 5EOVA 2JIZD 2IDZA 3A6EA 3WXBA 5TRTA 1HKUA 4I4CA 1RLMA 5EJIA 1C7EA 3VU1A 2G82A 7ICLA 2D1TA 3CBGA 1ZEMA 1BNCA 4L8FA 4MNTA 2IY9A 5KOJA 3VR5H 3O3CA 1UDWA 4GC6A 3GLFB 3DTVB 5JRJA 3GUVA 4FILA 3IH5A 3G2OA 3DWGA 4R1LA 1E5DA 5KBYA 5IVHA 3WLOA 3SIXA 3ENZA 4D9GA 1Z74A 5D1HA 1JWAB 1TA9A 3OO0A 4O5OA 1E2JA 3KEGA 3SP1A 2XWJI 5L4LA 3MGCA 4FUQA 1Y0BA 3SHFA 3S99A 2MSDB 3D6TB 3EA5A 5CYFA 2H08A 4QIWC 1IEWA 3PQ6A 1O6BA 2X76A 3GARA 3KR9A 3O94A 4ER7A 4TTVA 5EMNA 4I5FA 4FBUA 4DABA 1Q2XA 4POOA 2YUTA 4GLJA 4ALKA 2BN4A 3GX1A 2H6EA 2OLKA 1Z0SA 3A1WA 4Z4HA 3S8EA 3CT6A 3BWCA 4JWNA 2XGGA 1KO1A 2XUDA 1B16A 3I2GA 8ICGA 4RKQA 5IUKC 4I2JA 4I1IA 2Q2OA 4OJ5A 4IIBA 2FE4A 4LI3X 3ZG6A 4Q4CA 5BXYA 2XDQA 5KSWB 4ARCA 4QNMA 5J2KA 1RYMA 3H1BA 4DOMA 2HQOA 3GLFE 5DTRA 2EW1A 1VPLA 4WJKB 5FO1A 1Q74A 2FPRA 2HDHA 3IA7A 1BS1A 1V8BA 4DZZA 3ZW7A 5A5VA 4KLHA 1NLZA 3OSNA 3GELA 1IAVA 3PHGA 4QWCA 4H1UA 1QXSA 4KLCA 5CFMA 1NBMD 3AP2A 3I1IA 3LGAA 4X84A 1GAEO 1YJQA 3AIMA 5GJWC 4C21A 2AFIA 2E5LB 3HCOA 2XF8A 2H65A 2O2DA 1ZJZA 3IVRA 4N82A 4OYRA 3TGPA 1AXEA 4JK3A 2OO7A 3DAFA 1O97D 3DSRA 4MR8A 1BDMA 1NRIA 1QIKA 2NSYA 2X5NA 4E2WA 3KOXA 1HYBA 2Y92A 1EG2A 1AB5A 1GJRA 2O1SA 6LDHA 4PZNA 4CTMA 1Y1RA 5E1MA 1FQJA 2HF8A 3N87A 2QTAA 4QECA 4TXHA 2J6SA 1L6RA 3E3AA 3ND8A 4N9QA 1JMSA 4JSYA 2YMMA 3ULKA 2G63A 2NZJA 8ICEA 2BAGA 3U3DA 3LQQA 4JJEA 5A4DA 2YR0A 4RMJA 3ORYA 1F51E 2I2AA 2HA2A 1XMOB 1H85A 2IMWP 3DLHA 3A0HU 4N3NA 4GH5A 3ZVLA 3EIFA 1CSEE 2C88A 2IPMA 3HJRA 1JR6A 2YC2C 2E48A 1Y1LA 4ZTZB 5DYNA 4R71A 5JC8A 4DJJA 4YR2A 4ND5A 1AV7A 2NZWA 4R4JA 3BXEA 3RODA 1W36D 1X1DA 3EZNA 2O20A 2R3SA 3VBCA 1G66A 1GPUA 3UXPA 1E64A 4XLZA 5MFZA 5IN5A 4L5BA 4PHEA 4D26A 5SICE 4RQ8A 1P9OA 3QQPA 1GU0A 3KSMA 3NU1A 4UTPA 4C7JA 2YFQA 1XHFA 1RXIA 2XMRA 2QL5A 1E4EA 1KI6B 3QOFA 4IQ8A 3UENA 1XD9A 4ECTA 3DH0A 3QUAA 4D2IA 3D6FA 2DGZA 3U40A 3AVVA 5KNCA 3VVCA 3WK6A 2PFNA 1BKSB 4X1IB 3AM1A 1IM4A 4J9NA 2KLHA 4UNPA 3ZS8A 4RZHA 1NN1A 3PLRA 3MUFA 4I4NA 2JBWA 1TMGE 2V58A 3CEMA 3FPSA 2FSSA 2PIDA 3KVOA 1QHHB 3TZKA 4N03A 1X14A 3P9QA 4IRKA 3M6MD 1D4FA 5CG2A 2O6KA 1JQ3A 2Y1XA 3PB3A 3PR4A 4P4UA 2L82A 4BCDA 3VU8A 1YU9A 3FDXA 4MO9A 4MS1A 4RYDA 1VJ0A 2PO7A 4EQZA 3GP5A 2JD0A 2JHAA 4ND6A 1V7ZA 4OAQA 3UV3A 2F8SA 3FM9A 3ORQA 1J24A 2V3VA 2P2DA 2V03A 5DE3A 2LIVA 1Z7GA 2VF4X 3R7SA 2AEJA 4KLFA 2V7PA 4FOTA 3VC1A 3SHOA 1INLA 1U9IC 3ABIA 1XALA 3ON5A 1RI3A 3PSAA 3I9JA 3M1IA 5A6SB 4YRFA 3IP6A 1DAEA 1PX0A 5C0OE 3ZYZA 4DIKA 1V3QE 4LI0A 4CEJA 4MRNA 2WUEA 2XIQA 2CLCX 5F9HA 1A9XA 1PR5A 3DYIA 1T2CA 1F0MA 3COYA 4PQEA 4UTXA 1HE1C 3P4YA 5DNDA 4IZIA 1IEXA 2V45A 4PHFA 4RGYA 2J6CA 3HXMA 1NVXQ 1UBKS 2K7FA 3IUJA 1Z6ZA 3LX4A 4FYVA 4DAOA 1YDGA 1G2PA 3BIJA 5D49A 3GEMA 4G0MA 2I34A 3TADC 1E9VA 1YO6A 4EYHB 4HATA 3C2QA 3DEZA 3NBYC 3DOUA 5JECA 4B2LA 2Y1EA 4Y2VA 1POWA 3M33A 3LTEA 3BMNA 4V2UA 1PR4A 4HPWA 4Q4LA 5HKLA 4BNFA 1KEEB 1Q44A 4N41A 4M1EA 1HBJA 1HDOA 1ZRMA 2C98A 4U7JA 5ERGB 4CLRB 3ESBA 1RMQA 1XK6A 3G89A 1KH2A 3IGFA 4YS6A 4JD5A 4L57A 5FL7A 3TW8A 3UHOA 4C04A 2HRDA 4D3XA 1CR4A 1Y6RA 2IY7A 1XV5A 3H5RA 4MW5A 5K4LA 1Y1PA 5KNBD 4IQ4A 3A3YA 1U2RA 3C6BA 4WCFC 1KVQA 1IY0A 1KJ9A 4L9SA 3TIIA 3MRTA 4QFCA 4BASA 3ACDA 1KFDA 5ICMA 1N5JA 3X43A 4MVJG 3GN1A 2DZDA 4IQFA 2P2YA 3P2MA 5GONF 2ZCUA 5LOVF 4Q3BA 4FFBA 2FP4A 4LQCA 4QJ4A 2KIWA 4ASUA 4XD7A 4F1WA 4XWWA 5ITZB 3G68A 4MWDA 1MOZA 1J70A 4Q9IA 1Z5WA 2AI2A 4RBNA 2ZIWA 2ORWA 3FYUB 1ZM4A 2HEGA 4R5MA 1ADBA 5DV9A 4A8HA 4XGNA 2I9PA 4FFRA 2H1OA 1CUJA 4JEUA 4E4TA 1PZGA 3L5OA 2HFJA 3A6ZA 4PQGA 2C99A 4F3CA 2HJRA 5CP8A 3NIDB 2KWIA 1B8NA 2PYDA 4QOFA 4Y2XA 1CE8A 3U1VA 3AHHA 2QX6A 2VP3A 4KIUA 1V9PA 2P7IA 2ZRFA 1T35A 2HBRA 1EFPB 2X15A 4Q9KA 4X20B 2ZSDA 1NIJA 4JA0A 1I3KA 2K4EA 1N48A 1ZBDA 2E7ZA 5B6IA 5G1PA 1JZQA 4LSZA 1XMSA 2ZJ4A 5LBUA 3FRIA 3K5PA 4HS9A 5ALHA 2CYBA 3RVJA 5CD1A 2Z30A 2PKQP 3FTDA 2JI4A 4F2GA 3DT9A 1QHXA 1IFXA 2EGUA 2W2PA 3SSNA 4NU0A 1RLTA 5J2UB 4IHJF 3W1WA 3HVIA 4K05A 3PTAA 4TZKA 2OD2A 4JC8A 4Z5XA 2V3CC 5HP4A 3WI7A 3WADA 2DL0A 1OWPA 1QH8B 2VYQA 2ZUEA 4JJIA 3O8NA 1SQFA 4HDNB 3WFZA 1XTUA 5CNKA 1ZVVA 2DM6A 1CRPA 2QG4A 1J1ZA 4FCCA 3T4EA 2KJ9A 2HMUA 4GKKB 3ZXSA 5LIPA 4RIHA 1CVIA 3QXJA 5ELLA 4C4ZA 4J1NA 3CX3A 3ERCA 2EC5A 1LQTA 1FP4A 3BE8A 3W6PA 1FTSA 3F2CA 3TTWA 3VGJA 4BMDA 1IJKA 2FJ0A 4EM6A 4OGKA 4ZCQA 1JWLA 2FQQA 2RGAA 2ZIFA 2ZJ7A 3F5AA 1B76A 1J99A 1N9GB 3C5FA 2VUHB 2ZRKA 5DTIA 3ZQJA 3K1TA 8ADHA 3AFMA 3MYRA 4IOJA 3ZGLA 1Q83A 3C3JA 1S3IA 2JGAA 1BYUA 4ZRDA 1PJ8A 2HQSA 4GHWA 2ZBPA 4Q1EA 2MSWA 3U3ZA 4DM3A 4M6WA 3AUTA 3DKIA 5DLDA 2YCLA 5FD8A 2DSNA 4IIEA 2VJNA 3S44A 4INOA 4ILEA 2PFOA 1C9JA 3DDNA 3FW1A 4PL2A 5FUBA 3ZUGA 1BGXT 2Q4OA 4E11A 1A7UA 5LSAA 3OPNA 4ZMSA 4CWAA 5AM1A 1CWUA 1EDDA 1PEYA 3ICWA 3ISVA 1X9WA 5AHWA 3U62A 5K9ZA 1NKTA 3FJ1A 1PFYA 4NBUA 4XRRA 3DZCA 1B15A 5T57A 1R0WA 2WSSD 3AFOA 3THVA 1S0MA 3RUFA 5K05A 1K8YB 3HO8A 1YIAA 3DMNA 4KLZA 4OHKA 5D6NA 1RPLA 2ROQA 1WPRA 3JQ6A 4HQFA 3SDBA 1NMYA 4AZ3B 3H11A 3N8IA 2R00C 3HXTA 4KNVA 4QJ5A 4YMMA 4UTNA 4DXAA 2PIAA 2FMQA 3AEQA 1IWOA 4G81A 1N3LA 3KB2A 4JBNA 4OMDA 4R68A 4F46A 6ADHA 3O2QB 5CFNA 2VRBA 3GLVA 4WJZA 2P4UA 3C8MA 2J3EA 3F5DA 5EP2A 2X9GA 5E0KB 4D3FA 5D1NA 2HSJA 8ICOA 1OY1A 3BZUA 2D7DA 3OHBA 1R6UA 1E59A 2C5BA 2FOXA 3NHFA 1U9CA 2D1YA 3FN4A 1S2IA 2R6AA 3KCQA 4LJ7A 3RSZA 3WNZA 4HT3B 5HQ3B 2I3ZA 1WKCA 1PGOA 3KZMA 4HD8A 5LD2B 1CJCA 2P6NA 4Q1CA 2BFDA 3OFND 5J40A 3UMVA 1CFZA 2DTDA 4J16C 3ZE9A 4A92A 2Y93A 4E7PA 4ZCTA 1YQTA 3EG9B 3NDIA 1P9NA 4F5EA 1NW9B 3H13A 4BFYA 4KGZA 3LO5A 9ICAA 1SM4A 2O3SA 2Z2IA 4TZTA 3L7NA 1ZITA 3SFVA 1B1AA 5L8VA 5T14A 2XOKD 5FWYB 2WWGA 1DC7A 3HBJA 2EQYA 3R9XA 2IELA 3IP3A 5LFAA 1QYCA 3OQ6A 4PICA 4QEZA 3P0RA 5CXQA 2ZKLA 4ER5A 1JIHA 1DAFA 5C8YB 2XCIA 1QCKA 2FP3A 8OHMA 3UQ0A 1CUWA 1SJ9A 5DP1A 3SMQA 1U1IA 4CCAA 4CMHA 2ZDQA 3OE7A 4UUMA 3KDSE 3ZEIA 4JEIA 3LW7A 3GCDA 1EVEA 2PZMA 3QIAA 3GGCA 4HVAA 5AKIA 3BWXA 5EESA 5JT1A 4IEEA 3FOZA 1I2DA 1VXRA 2AOUB 2XA1A 3H0EA 3KLBA 1I9CA 2ONYA 2VR1A 4LQLA 2WE8A 3WLTA 2A33A 4QAQA 3A4IA 3NWOA 2FLPA 1SBYA 4P4TA 1Y6FA 4MX8A 1QHYA 1JDVA 3BMQA 3M6LA 4NU5A 1UIMA 5KCZA 3UJ8A 4Z7NB 1I0ZA 2AHOA 3QVOA 2CLSA 1DKOA 3SMVA 1J5PA 1XEXA 4FBMA 3F8WA 4UULA 5JYCA 2PL1A 1DV2A 2JIZA 1CW2B 3DLAA 4JJZA 4JODA 4MITA 4AFNA 1JDNA 3C4QA 2RP5A 5DG9A 2B20A 1JR4A 2BPGA 1RWKA 2QLMA 3LKBA 3OCYA 2HXGA 4DGSA 5K6RA 1G5PA 2OUKA 3TMKA 5P21A 5KTNA 3SQXA 1EH5A 3QWBA 4QTXA 1L7EA 4WJ3B 4JUZA 3I6QA 3MWFA 3NAQA 1KL9A 2FW9A 2NVBA 1DO0A 1JUDA 4BUGA 2W0MA 3GC6A 1ESCA 2HPAA 1N2EA 1NJFA 5D3MB 5TQJA 4B0PA 4F5DA 5DM60 3ZU4A 4IWYA 1IJFA 3C39A 4GYJA 3VHRA 4Y2JA 1F6BA 1XZNA 4IW3B 3UK2A 1A3CA 3O4JA 2EQBA 4XX1A 4ANFA 3DBRB 1J2MA 3FOCA 4QDJA 4II7A 3GG2A 4EUSA 1IN6A 3QMMA 4I55F 4Z54A 4KVAA 1GG5A 1XZDA 2WM8A 3DZFA 1EINA 3FTPA 4FONA 2NAPA 1QHNA 3B85A 4XA8A 4P5DA 5K6TA 4EH1A 3PRKE 2WWHA 1L4HA 4FT4A 2ZUFA 4RA6A 1W19A 5KYVA 1WCWA 5KAMA 4EDFA 4LYAA 3RNLA 1AHNA 4J9MA 1SCBA 2JJ1D 3FDIA 1DPFA 4N54A 5TISU 1L5WA 2B4TO 5HRAA 3OCWA 2AQ4A 2OK7A 3PNYA 4K6KA 1PGQA 3SNHA 5A5DA 2IU3A 4EDHA 3DZBA 3ZD7A 1SUDA 4I55A 1RLUA 2X7JA 5BSMA 5IVPA 4W5WA 2C4TA 3IHKA 4BO9A 2D54A 3UTDA 2EQ5A 2DTEA 3W7VA 4C0LA 4U63A 4DLNA 2CNKA 1Z4KA 3KUXA 1T24A 1HKHA 1A2BA 1DC8A 2OP0A 5FNVF 5DM4A 3CRW1 2GAAA 3BZCA 3V1MA 3NTRA 4MIYA 5FR1A 2K8AA 1R64A 1UBJS 2XUIA 2XY7A 2Z8YM 4MKGA 5DSZA 3MFYA 5JAIA 3UJNA 2CKMA 5FPHA 3ILXA 4JASB 4BVFA 4ZGGA 2W43A 3PXEA 2LCIA 2WNHA 5CMLA 5B53A 3UUWA 2G1PA 3FROA 1C81A 5KTQA 4L0DA 2OC9A 4E5NA 4K9KA 1USKA 4PLPA 2JAQA 3VNBA 3SZUA 4P58A 3ZS9A 4DWWA 2VEOA 1QUFA 1VHLA 1XXHB 2W93A 1JHYA 3JWGA 3GCXA 1XN4A 1OBCA 1CETA 1CFJA 3K1RB 1Q3TA 1R6DA 2XCLA 3ONEA 3S2IA 1ZVMA 5I8PA 2W2TA 4YVFA 2PZAA 4I99A 5TR9A 3ZCUA 1QIDA 1P45A 3ITNA 5IHPA 2ZAYA 4JOSA 1Z29A 3BG5A 1L4EA 3MHPA 4MUAA 2LCFA 2O8DA 1QK3A 3V9AA 1EUDB 1ZD9A 4N0QA 2NXNA 2WJGA 3TKLA 1RLIA 2H06A 4PX9A 4GFJA 3G0IA 1AS3A 3KYDB 3QRWA 2LV8A 2YWEA 1G20A 5JXWA 3DOHA 1L1RA 2E5SA 2XE4A 3PQCA 4LC0A 8LDHA 3H9BA 2QP3A 4DKJA 1RQGA 1YH3A 3QVVA 1X38A 2UXBB 3ZE7A 2IPNA 3UV7A 1ISJA 1NAHA 4CM8B 2GXSA 4L8LA 3MQ2A 4G5RA 4PNZA 4IO0A 3MGIA 1WNFA 1DWOA 4EKGA 3KZXA 2APJA 1XLTC 2FPWA 3JATA 1CG6A 4V3CA 5CA1B 4AECA 2UVWA 1S3FA 1M2OB 1POXA 4IYRA 4S1OA 5AMXA 3RK1A 1IN5A 3X1ZA 4C0WA 4IDAA 1WDKA 3EVFA 4BN4A 4YMHA 4G5YA 1Y80A 2HHWA 1C0LA 1HDRA 3SD7A 1M34B 1ORRA 2A6PA 2VG8A 1Z33A 4BB9A 5A9SA 2WJYA 1X7ZB 1CJMA 2OGTA 3C6YA 4LDZA 4EBCA 2E4YA 2X1HA 3PGLA 4GSLA 3UAXA 4Q7JB 3OJLA 3OO1A 1UR5A 2DSTA 4RUAA 1UBCA 3ANYB 2BFBB 3L4BC 4B31A 3CJQA 3AM3A 4LJYA 3G2MA 3EBPA 3DYVA 2OILA 2VWGA 4A9AA 4YCLA 1RWNA 4C80A 3T54A 4ZQEA 1I3CA 3PKJA 4QASA 1EFRA 4LYEA 1HE3A 3RFAA 3CZ5A 3IT3A 4RDIA 3UFBA 4DR2B 1EKXA 1TM1E 3PNKA 4JBLA 1G3MA 3AH8A 3O4HA 4ESHA 1VA4A 3NC4A 3EGXB 3PDHA 4H2DA 2GFHA 1R8JA 4ND8A 2PAAA 2IV2X 3KHLA 1VCIA 3NM6B 8ATCA 3THXB 5B2ZA 2W9BA 1YNSA 4UDYX 5IAKA 3V3TA 2WHQA 1CS4C 4FZ5A 1U3GA 3QWFA 1PDOA 4WKCA 4LZWA 1T8SA 1JA9A 2YWGA 3H17A 4PAOA 4Q15A 5D7BA 1R12A 1KY3A 4I2FA 5E95A 4G84A 1QYDA 5I5EA 4PX3A 4LRQA 3KKEA 2ONCA 5FWXA 3VDMA 4EO4A 1SB9A 1XZKA 3V3KA 4ZRNA 4C0KA 3L4JA 1Y42X 4C0SA 4C20A 2WTUA 5JADA 1H1TA 2R1VB 2IBMA 5G3ZA 3T7DA 1JJ7A 2XUOA 3IDZA 3CLSD 5JRDS 4P0PA 3N2IA 2DKFA 1SKQA 3LUCA 2PSHA 3BE4A 3GXBA 5JC1A 3QZ8A 3EXEB 3PP8A 4QFDA 4TYNA 2WMNB 2Q49A 2FMUA 3TTVA 2G5HB 1EJBA 1IHUA 3CLKA 1FFXA 1FLNA 1QSYA 2B4RO 3NIFB 3D59A 4JLUA 2SKDA 3QTLA 4J4TA 2M98A 4YLEA 2XO7A 3HUEA 5TB5A 3JPPA 1NVMB 3BH0A 3E9CA 2WILA 4Q4JB 3W79A 3CF0A 1QRUA 3QKRB 4O3PA 1PVPA 1CP2A 4JSTA 3VR4H 3BDIA 1ZUD1 3LIPA 4G1VA 1H2EA 1XR3A 1Z7BA 2G4LA 4HEQA 4IFEA 1T2EA 3WL7A 4WV3A 1WB4A 1U2ZA 1U7XA 1M1ZA 2Z98A 1LDGA 4UE6A 4JYMA 4G5SA 1IZ7A 3HW8A 3VR4A 4JJ6A 3N39C 2Y99A 5LJIA 3TNYA 1AQNA 3HFGA 4H6PA 2IXAA 5ENDA 3P9RA 1YS6A 4Q01A 3L4BA 1G38A 1KI1A 2BR4A 5CH5A 3GQVA 3NRJA 4C78A 3PUJA 3NANA 5FB3A 3VJRA 4GBGA 4ECQA 1YFZA 3I9NA 4FQ5A 4I9GA 3RT9A 1R18A 1FY2A 2BKUA 5IH3A 2V7QD 1L5GB 1JQLB 2OE2A 5G02A 5TMEA 1I4OA 2FSHA 2R96A 2FVXA 2B8TA 2P90A 3JQ7B 4J76A 4LFCB 3VR6D 5ALEA 5A05A 1DCFA 1RZ3A 1A4UA 5DBCA 5I8WA 3BICA 4Q00A 5KG4A 2QRVA 3G0GA 1XEAA 2Y1IA 3TXYA 2HA7A 1I2MA 4AYXA 4FFLA 4CR7A 4Z51A 5C1PA 3PQ8A 2ZYRA 1QTIA 3EMDA 4MB2A 1W29A 3QE2A 1PN3A 1Y63A 3ROMA 1TQ2A 4QHYA 5BVHB 3DP9A 2NRTA 1DDIA 1W0JD 2HU2A 3IT0A 1NOIA 4QPPA 1BEUB 2F9MA 4BGIA 5C46F 1EVQA 1PSZA 1PFGA 2VYVD 2JLWA 1WIWA 1OJLA 4MJLA 2YASA 2ZWVA 3G9QA 4O3NA 4O8ZA 3VO1A 5IDWA 1QP8A 1P44A 2HMYB 1Y5IA 5IKMA 4ED6A 4REMA 4D0LB 1U5CA 4G0QA 4EJ2A 5BMVB 3DFKA 1IY9A 4NRDA 2MSKA 2P6OA 4GOND 2ZBEA 5J58A 4EZ6A 3OF3A 2XMQA 5LMUB 5B66U 1U98A 5MFPA 1QHIA 3GRAA 1G7CA 3SBDA 4YCCA 2QWXA 1ZYQA