3UMBA

Crystal structure of the l-2-haloacid dehalogenase rsc1362
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
227
structure length
227
Chain Sequence
TSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dehalogenase-like hydrolase
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Ralstonia solanacearum
molecule tags Hydrolase
total genus 80
structure length 227
sequence length 227
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3umbA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3umbA01
3WGVA 1CR6A 5IS2A 2WF7A 3KD3A 5AW8A 4UASA 3I6BA 1N8NA 2ZBGA 4YIHA 2PKEA 2I6XA 2HF7A 1RKVA 4UW9A 4QJBA 2DQSA 3L8HA 4YIKA 4BKMA 3L7YA 4OHFA 1L7PA 1QH9A 4BNDB 3DDHA 2GFHA 4BX3A 2NO5A 2OA0A 3IB6A 4G63A 1NNLA 3ET5A 5AM2A 5AM4A 1RLMA 3L8FA 3DV9A 5AKHA 3L0BA 5ALXA 4C4TA 3ET4A 1U7OA 4HGPA 1TA0A 5ALEA 4YCNA 1L8OA 5AKGA 1Z4KA 3OPXA 4UM5A 3L8EA 1RRCA 3E81A 2GHTA 1Z4IA 4Y2PA 2YJ3A 5AW7A 2PQ0A 2GHQA 2FDRA 3U7GA 3ZX4A 3GYGA 4Y2SA 1Z4NA 2B1QA 3DAOA 3SKXA 4HGOA 5AKXA 2WHEA 2MU2A 2HO4A 5AESA 4UMVA 1Z4PX 1WR8A 1U02A 5AVWA 3WGUA 2C8LA 2I55A 2FPRA 1U2TA 4UAVA 3R9KA 5AW2A 3B9BA 5ALSA 5A3SA 1YNSA 5AW9A 5ALGA 4E88A 3AR4A 3SF0A 3WK8A 2G07A 3TLMA 4AP9A 5ALNA 1Z4JA 5IT0A 1SU4A 4UMEA 2WF8A 3AR9A 5AVTA 2BDUA 1YS9A 1O08A 2I34A 2HSZA 3L5KA 4BBJA 3E84A 3KOOA 4CF5A 5ALHA 1RMYA 3KZXA 2ZG6A 3DNPA 5AKJA 1TJ4A 4Y2JA 5AM5A 3U13A 2WFAA 3PGVA 4KX3A 5AM1A 5AW6A 3WK4A 3AR2A 4UMFA 1ZS9A 4NABA 3QYPA 3N5KA 5AK5A 2G0AA 4DW8A 2G80A 1Z4OA 3ZUPA 3ZWKA 3PGLA 5AVZA 2I54A 3ZU6A 1RC8A 4H1WA 3HYCA 3OCXA 3QXGA 1JUDA 2G1AA 1L7OA 4RETA 5ALLA 2O2XA 1QQ6A 2HOQA 4FE3A 2AUTA 3A1EA 3FVVA 3OCYA 5ALZA 1ZRMA 5AKZA 1Z4MA 3WK9A 2RAVA 2YMLA 1Q91A 5ALRA 4UU1A 1K1EA 1VFPA 4PNHA 3MN1A 2CFTA 1X42A 4GXTA 2P11A 4NWIA 2HI0A 1Z4QA 3ZI4A 5AKIA 4NV0A 1RQLA 5AKKA 3ZVNA 4HAIA 3L0CA 2P27A 1T5TA 5AI6A 5AK3A 5A3RA 2AMYA 3AR6A 3UMCA 3W5BA 1RLTA 4UAUA 1LTQA 5AIAA 2YJ5A 1S8OA 5ALUA 2OM6A 3KC2A 3P96A 3QU4A 4DFDA 3ZX5A 3WKAA 2C4NA 3B9RA 2X4DA 3NANA 5ALIA 4XPZA 1ZD4A 5AM0A 5AVRA 4ZEWA 4BYGA 1S2OA 3RF6A 5ALDA 3U7EB 3U26A 4MWOA 1Z4LA 3L0YA 4Y2RA 2HEGA 5ALMA 1RLOA 3SD7A 2HX1A 3R09A 5ALTA 3WKEA 3QGMA 5AI9A 3D6JA 3ESRA 4KN8A 5ALPA 3UM9A 3F9RA 2CN1A 4IG4A 2YFYA 3ZW7A 4CNQA 5AI4A 1NRWA 5AKLA 5AVYA 2BY4A 1RKQA 2ZBDA 3MPOA 1Z88A 2W4MA 2WM8A 4EEKA 3PCTA 3U7HB 1XVIA 1O03A 1FEZA 5AVQA 4Y2YA 5AICA 2IYEA 4YGYA 4Y2XA 3B8EA 5JJBA 1QQ7A 3E58A 3CNHA 4KX5A 2YMMA 4CF3A 4QQFA 2Q4TA 2CFRA 2GMWA 5ALFA 4MUMA 3QX7A 4EELA 2EAUA 4BEVA 2IA5A 3A1CA 3QU7A 2WF6A 4OCZA 3OCUA 2VKQA 3AR7A 4NFLA 5ALKA 2MSNA 2P69A 2CFSA 4BNDA 1WVIA 2YMPA 3QUBA 1U2SA 3M9LA 2FI1A 4BX2A 3WK5A 3PDWA 3U7FB 3KDPA 1T5SA 5AW4A 1ZD5A 3WK6A 3OTQA 4L6CA 3W5DA 3A1DA 4EENA 3QUTA 2FPXA 2B0CA 5AVVA 5IT4A 1J8DA 2O9JA 2HF2A 2FPUA 3NALA 3ESQA 1ZD3A 4I9FA 1QYIA 5E0OA 1Q92A 3I28A 5AW0A 1RKUA 3L8GA 3WKBA 5ALVA 3W5CA 2JGAA 5AK4A 4KNWA 4Y2QA 4Y2TA 2B8JA 5FP0A 1CQZA 1XPJA 4ZEXA 4B6JA 1YJ5A 3I76A 3A3YA 4BX0A 3EPRA 4RESA 4I9GA 3FPSA 1QQ5A 2B8EA 4KYTA 1EK1A 2JARA 3SKYA 4AS2A 1MH9A 3VAYA 2I33A 3SLRA 2YN4A 5AIBA 1Z5GA 4G9BA 2Q5EA 4EZEA 4YH1A 4HGNA 3MC1A 5AVSA 1NF2A 3MMZA 4L6AA 5AI5A 3QU5A 5AM3A 3QLEA 4Y3UA 4O8CA 4YCMA 1VJ5A 4JB3A 2BDEA 2WF9A 3WKCA 4DWOA 3QUQA 4UM7A 2AH5A 1U7PA 2ODAA 3ONNA 1SWWA 2RBKA 3AR5A 3OCZA 2I7DA 2NYVA 1XP5A 1SWVA 1Z5UA 3R4CA 4IFTA 4CE6A 4UARA 2R8ZA 3S6JA 5AW1A 5AVXA 2JAUA 2ZXEA 4Y2VA 1PW5A 3W5AA 3QU9A 5AVUA 4GIBA 5ALJA 4UU0A 4J2TA 1RMQA 3NRJA 2JAOA 1L8LA 3ZVLA 4YCLA 3QU2A 1EK2A 4EX7A 1Y8AA 3SHQA 4KNVA 3BA6A 3E8MA 1RMTA 2MU1A 1F5SA 2B1RA 1ZRNA 2IOFK 3UMGA 4F71A 3N28A 2GO7A 2R8EA 5AW5A 3UMBA 4Y2UA 2OBBA 4CF4A 1WZCA 2C9MA 3HLTA 3N1UA 3K1ZA 1IWOA 1RQNA 2YBDA 4BEWA 4AS3A 3I1YA 3N07A 2HHLA 4HGQA 5AKEA 4F72A 4EX6A 2YY6A 3ZVMA 3FZQA 3N8GA 2FEAA 2OYCA 3NUQA 1T9ZA 5AW3A 3QUCA 3M1YA 3EF1A 2C88A 3L1UA 2EATA 4FYPA 1L7MA 2W43A 3BWVA 2G09A 2NO4A 1J97A 4L57A 3ZTWA 2Q4RA 1ZOLA 2ZBEA 1WPGA 3ED5A 3IRUA 3KBBA 2EARA 1RPZA 1TJ3A 5ALQA 3J7TA 1LVHA 3ZWDA 4OD0A 2G08A 2PR7A 2IOFA 2R8YA 3SMVA 2W11A 3CZ4A 5AI0A 5ALWA 4NAVA 3FPBA 3QNMA 3NAMA 1ZD2P 1N9KA 2QLTA 2FUCA 4C4RA 4UATA 2IOHA 2RARA 2QYHA 4C4SA 2YMQA 4XQ0A 3FGOA 3AR3A 3OCVA 4OFZA 4FFDA 1L6RA 2R8XA 3OCWA 4HGRA 1YMQA 2FPWA 3U19A 1KYTA 2YJ6A 3FM9A 5ALOA 3WKDA 2B82A 4ZEVA 2JAWA 5AI8A 2HDOA 2C8KA 2AGVA 1TE2A 4XE5A 1YV9A 3NIWA 4J03A 1L7NA 3EWIA 5AK6A 3NASA 2YJ4A 3IJ5A 1ZJJA 4JDPA 2B30A 3L1VA 1YDFA 4HYTA 5T41A 4DCCA 3AR8A 3EF0A 3ZTYA 2HCFA 2ZOSA 1AQ6A 5ALYA 2P9JA 1RDFA 2D2VA 5AKYA 1TJ5A 3WK7A 2ZBFA 1VJRA 2FPSA 5A3QA 4XOUA 3RFUA 2WF5A 2FUEA 4UMDA 2G06A 5AHXA 2RB5A
chains in the Genus database with same CATH superfamily
2VHWA 3AMVA 4BASA 2C2RA 3QKWA 3VOSA 4U3JA 4ZALA 2W42A 5K4LA 1OIVA 5AM2A 3OJ0A 4CG2A 4PNZA 3KAJA 4JXZA 2PN1A 1UR5A 4I8DA 2TMGA 1DZIA 4CV2A 1MX9A 1IY2A 1WKCA 3RUIA 2DUWA 3UWDA 3U3JA 3RNLA 2P75A 3HO8A 1SKWA 5LWQA 3U3KA 4DR5B 3T5GA 4ESOA 1SUAA 3DW1X 1MPXA 2W2PA 4XX0A 5B37A 1HJPA 1X9MA 1W4LA 4IDOA 4MWGA 1ZJ4A 4QZEA 2Q9CA 3GDFA 1X1SA 2Q4BA 3OQ6A 3QZUA 3E4DA 4E7PA 3HJUA 3C3KA 1CJUC 2GYVA 3VZRA 1IOZA 1FLAA 3HGMA 3PP8A 4IIEA 4QZDA 1ZQMA 2I8LA 2ZSKA 2ZE6A 2ZQ5A 4CL0A 4MIEA 1RXIA 1PWHA 3BWBA 5B6JA 4OJ5A 4LGVA 2ZRNA 2R0QC 2BRUC 5IIOA 4PC1A 3MQFA 1VRWA 3LCVB 5TPWA 3H9GA 1L7OA 5E0KB 2KVCA 4E3WA 1PQYA 3C1OA 3FXAA 1AT1A 5AKZA 1Z4MA 5K0TA 4TLBA 4LXGA 2BC9A 1E3JA 1JS1X 2J6IA 1ZZEA 3ITNA 5K99A 4GU5A 4TLCA 3NHFA 2VQFB 5DM70 3LNCA 3H0MB 3FX2A 4REOA 4IOMA 3IPAA 3U62A 3CURA 5I5GA 5CXUA 2VXCA 3TQTA 4R2XA 3LUPA 1FDIA 1PQUA 4L28A 5J2UF 4B9EA 2YC4C 4JQSA 5BR1A 3GVHA 3HG7A 3AQEA 4C6SA 1UMCA 2X4IA 2HMTA 4P2BA 2R2AA 1ZIPA 4U8HA 3HXQA 3AHHA 4FOSA 3PMLA 3ZHYA 4A15A 3ANMA 3UJBA 3AF2A 1NBMD 3O9VA 3PEFA 2DPJA 5HUJA 3OWHA 3DMYA 3O8CA 3IC5A 3FYDA 4H17A 3MTIA 1YSCA 5AWFC 1S8AA 1CJMA 2FK8A 1S1MA 3B1WA 1TB4A 4IDGA 2FLKA 1L0BA 3OURA 4EVQA 3NR2A 3GX1A 2WICA 4KLRA 3QKIA 4PL2A 4JUZA 2PMZF 3BK1A 2EW1A 2NM0A 4G67A 4A8HA 4G8BA 2W2MA 3V3TA 2IFTA 1SKUA 3KTAA 1BE6A 2FG5A 1JVSA 3KQUA 3NIBA 4X0EA 4R68A 4WXRA 1EX7A 2ZDHA 1OASA 3AX6A 3CLRD 4DWOA 4KO8A 2JEYA 2YXPX 1WMSA 2H1OA 3ISVA 4RH3A 3R76A 4BDPA 3BSSA 3V00A 3U0BA 4RL4A 3RYHB 4QBTA 4FMDF 3WDKA 5GIPE 1RRPA 4J7XA 1VKNA 1QCKA 4MEAA 8ICLA 1KL9A 3ZV5A 5B57C 3U4QA 1GPDG 3PA8A 3V6KA 3ZE1B 4BZWA 3V8BA 2Q5LA 2PGDA 2QU7A 4LYJA 1M2OA 4FJ0A 3ZVMA 1TK8A 3HXTA 5JPCA 1E9FA 2A35A 4JC0A 5HE9A 3M1YA 2AI1A 4S2UA 1U0SY 3C3XA 3RVJA 1G3IA 2I7TA 3UGJA 2X2FA 3K2QA 5ALQA 3MSCA 2QUAA 5FL7A 3DMHA 3RT9A 1GADO 3BICA 3TOVA 3QNMA 1RE1A 4FD2A 1RPTA 3PLAE 1DAEA 4PWZA 3GARA 1FYFA 2EKPA 1KI9A 3VXKA 5KVVA 4GNKA 1EWKA 2J45A 1W0KD 1NQXA 3C15C 2GEDA 5IASA 3C29A 2QYSA 4O0MA 2C95A 2E49A 5DX8A 2FQQA 5DF1A 4F3TA 4RQ7A 2HU8A 3PWSA 2NPOA 4YC7A 2AHOB 4I5EA 3QVGA 4FO6A 1GLGA 2QTAA 4DXHA 4Q1EA 2BCEA 5J0WA 2BFPA 3UB2A 3AW8A 4WESA 3CF4G 4WHMA 2B4RO 5CUQA 1RG6A 4FPXA 2JAQA 1SNYA 1YCFA 5YASA 5E1MA 1V1RA 1SK9A 1A4XA 1YS7A 1R0XA 1Z56C 2B1JA 3IUNA 2H18A 4IDDA 4PSUA 4GI1A 3IXMA 4KIGA 1DKPA 4CKBB 4E22A 1F2TB 3EZ7A 2AW3A 2PRYA 4IQUA 2VF8A 2YWHA 1LLQA 4HH3C 1T3GA 2P9CA 5KX5F 1REQA 4ILKA 5TQJA 2IYOA 4RLFA 4E88A 1P33A 5G0WA 1HUZA 4AYBF 1TTHA 1WQ3A 4DMUB 3ABOB 5KJ6A 1XF1A 3OFSA 1G6Q1 1VZ2A 3HKEA 2NP7A 3DXZA 4FZVA 2X41A 1PNOA 3L5OA 4MMYB 1T5BA 2TMKA 1MIOA 4DR3B 2IY8A 1RCTE 4B8YA 3ROXA 3B36A 2OCDA 3I05A 1Y81A 2YJZA 2PX8A 4QZBA 4V1CB 5F7OA 5JRJA 1ZM7A 3OP4A 3UKJA 5IUJC 3O95A 4QELA 3V4ZA 3SHFA 1ENYA 2DCMA 2R00A 5CLQA 4PO3X 7ICEA 3C43A 2BTQA 2APJA 4LYAA 2NW6A 4BQIA 3L92A 2YKGA 3W79A 2QR2A 3W8RA 3ZXUB 1R74A 3EA4A 4LK2A 3WLJA 3ONFA 1I0LA 1O6BA 4Q9AA 4CTJA 1XHLA 2F4NA 4QZ8A 1GQSA 3Q8WA 1XALA 2H65A 4B1FA 2MR6A 1W8DA 4PYNA 1DK3A 1T6ZA 2GCEA 1DTEA 4IIJA 1FTYA 2XTAA 2OO7A 3ETNA 3LY9A 3UJCA 3RU9A 4DEYA 4EYIB 1MRZA 3KTOA 2VATA 4PM4A 3GRYA 3HFRA 1VE6A 1JDBB 2FFRA 3IQHX 3A1NA 4MUNA 2A92A 3ONEA 1USGA 4JXJA 4L4RA 1L3TA 3CRXA 1ADCA 4JSRA 4LJ8A 3HADA 1ZK1A 4PAMA 1ZQHA 2JARA 2R3SA 4I3GA 3ITDA 3GIJA 3BZKA 3W2FA 4LJYA 4MKXA 3WY9A 1XZBA 4R9NA 1TD9A 1V1JA 3LVFO 1AMNA 1XZHA 3DPIA 3RB3A 4G1VA 3I3OA 1DHTA 2WG2A 1Y88A 3NH6A 4Q3LA 2HREA 3PSFA 2V7UA 1BWRA 7ICRA 1OUQA 4DM3A 1UWLA 2C98A 4MHSA 4REMA 5K8UA 2IC5A 1GDHA 2H5LA 2LXNA 1J0AA 1KY4A 1ZSNA 1D4OA 3ZDAA 2RGYA 4BIMA 5D4BA 1HDOA 2ZBEA 2P9EA 4MYTA 1AZSC 1K86A 4NX2A 3SSMA 1DBWA 1OAKA 3PW7A 1ZD2P 5BT9A 4PX9A 2B20A 4WV3A 1FTSA 4IHJA 4KQJA 4X45A 3N2EA 4OHZA 3A9CA 2ZYVX 5HKAA 4IILA 3L0DA 3V4VB 1PK3A 3ICOA 4MWZA 5ITZA 3IVRA 2XGSA 9ICLA 4JA0A 4DRYA 3K9BA 2R00C 1JH9A 4BKQA 1Q0HA 4OXKA 1YMUA 2G4LA 5A3QA 3F5MA 3OIYA 2ACKA 2PGOA 1SHKA 1IY9A 2XKJE 5KQLA 5K3FB 3A9RA 1CW2B 2GCNA 4O2LA 3KDAA 2XY5A 4BGEA 4WEQA 3IB6A 4ENPA 2V55B 5L3RA 3TZCA 1YS2X 2VHEA 2ZJ8A 4II3A 3HXPA 3IDFA 1ZITA 1CEYA 2YJ3A 2EIXA 3P0EA 1E1DA 4LKRA 4PHPA 2BD0A 5GONA 2PUBA 2NV3A 1QYXA 1H93A 3TQQA 3F9IA 1T0PA 1Q7BA 4PQGA 3VPFA 2EZUA 3CW2A 1U0HC 4CLRA 4DBLE 2G5PA 3LQ1A 4N3NA 1SGWA 3DKKA 4A0QA 3V1TC 1Q77A 3D02A 4ZV9A 3TNFA 1ZONA 3P8ZA 4MLCA 2A86A 2W2VA 1KO7A 1XTIA 3VAZA 5CJPA 2D2EA 5KINB 4ED2A 4JUCA 4CETA 4YDRA 2JFZA 1E0AA 2WSMA 4CUZA 1IRXA 4KQ9A 3ZWKA 4KK3A 2WIFA 1NUSA 1G7TA 2PAAA 5KAFU 4IDEA 4OB7A 4CQNA 2YMLA 2Y3IA 4ML3A 2QL7A 3H9BA 1SU7A 3H16A 5A0VA 1PR1A 4GOJA 6ADHA 4TRRA 4NV0A 1ICEA 3WHIA 3MR2A 3L0CA 3GIKA 1EM8B 1ZRHA 3F3YA 3DGEC 4GHWA 4IDPA 1UMDB 2EBUA 3K70D 4WY5A 2B34A 1LNQA 2MAXA 1P74A 4RVSA 4EHNA 3HVRA 1OI7A 3G17A 4M1KA 4OUDA 3L7BA 2DR2A 3ZW7A 1NQVA 1CQIB 1RWOA 3MGVA 3E27A 3EBOA 4DRXB 2PJRA 1S89A 3VSCA 2QPLA 1K2WA 1KAMA 3G13A 1CZNA 1RI5A 3LKZA 1N25A 5AJTA 5EN4A 4F8EA 1YK1A 4IIBA 1QPGA 1U7UA 1V8PA 3GV7B 3M7IA 3EGIA 1T5LA 4KL8S 3TB6A 4B47A 5B6IA 5IVIA 3UH0A 1QDUA 1BKYA 1GTZA 5B58T 4QAQA 4U2FA 1DUVG 2GERA 1YUNA 1LDMA 1XQWA 2RGDA 2CCKA 1YIDA 1KE1A 2J0SA 3TFQA 4LOIA 8ICXA 1PG0A 4LHXA 4GPEA 2VUTA 5H2FU 2ZATA 3RHTA 4I4TA 3K6KA 3X3HA 1POWA 3E2IA 1RJGA 5AXAA 2W8KA 3EGDA 2JLCA 2PFKA 2PZJA 4LFBB 4I1SA 2GBGA 3TFOA 3X1MA 5CB6A 4TYQA 1WD7A 2QMYA 4MZXA 4L0DA 1RD4A 2P90A 5IJ9B 1NIPA 4RE6A 5K3OA 5DBBA 2OR3A 3SJZA 3QIVA 3RUFA 3L8ZA 3EASA 4M1QA 4F3CA 4IQWA 2GASA 4ZT4A 1OAOA 2B1RA 2M9NA 4JKIA 3IO5A 5DM1A 1KBUA 4ABYA 3CW2C 4H27A 4TTJA 5KVSA 3AETA 1XL0A 4IDFA 3SZ3A 5C5EA 3I5UA 4IL6U 5BYBA 4S1PA 2BJWA 4V38A 1ZOLA 5I9NA 1RPZA 3GP3A 4YRNA 4D79A 3P2OA 1A8HA 3ZNOA 2GBPA 2FPKA 2RARA 2HC9A 3ZWYA 2VXYA 2AYYA 5FUWA 5L4NA 2Z1NA 3DULA 3N3BC 4JVOA 3U19A 4KLSA 1BA3A 4K9DA 3WSVA 1A5ZA 1EJBA 5JISA 3GFKB 4D0SA 3C45A 2CL5A 3H84A 3PZRA 1JLSA 1ESCA 4UUQA 1P61B 2NZ2A 5CHGA 3TJZA 5J2TA 4PIVA 3I6ZA 1FW6A 2REBA 2KBEA 2OK7A 4ESEA 3AIKA 3UJ8A 1EIWA 1FFEA 4ECQA 1YIOA 2JFWA 2BGNA 2XXJA 4AUNA 1L5MA 1NY6A 2G9UA 2YXBA 5C3UA 1N8NA 4DV3B 1V16B 4F4DA 3WAJA 1JFFB 4IM7A 1C4WA 4D44A 4LI3X 2Q6LA 5KKCA 1ZN7A 1MB2A 4B3SB 5GZ1A 3L7AA 2XBMA 3FPEA 1V35A 1AE1A 2G36A 3MFIA 1T9HA 1M0SA 5IG2A 3CZRA 4BJQA 2H9YA 4QTUB 2A3NA 1ZQKA 2BBSA 5BYAA 5DPMA 1XVLA 1RFLA 3K0BA 1W4BA 2AK2A 2P3OA 3A14A 4FGUA 4XLLA 4FS2A 5AVTA 1EVYA 4LHEA 4MQUA 3RBEA 1W4RA 2B7BA 1S7GA 3HYRA 3AZQA 3UO8B 4GDMA 4MKFA 4KVZA 4IR1A 4DSJA 4HNTA 4NABA 2HA4A 4LQDA 1GV1A 4NJMB 4I2AA 1FY2A 4JASB 2FQYA 2X0KA 2HOQA 2UXBB 2FOXA 5IEBA 3WBKA 2WC1A 4HNAB 3IHWA 2HI0A 1YBAA 4HKTA 2I5PO 1UFVA 2BR4A 1NVFA 4GQAA 2Q6OA 5K3SA 3ZQKA 2VDMB 3H6GA 3HSSA 4I1VA 3VYUB 2D3DA 1F6BA 3LOQA 2JIMA 1XA4A 3VISA 1OX4B 3C1TA 3LGSA 4YR0A 1OAOC 4YRRA 5DQGA 3T79A 2R96A 1TK2A 3IUEA 1XK6A 1EBFA 1ZSVA 3OQVA 4EQ6B 2XAUA 4R51A 5HF9A 2PQ6A 5FB3A 3PO4A 3RJZA 3BQTA 2Q62A 4EZ9A 3P4UA 1NVMB 1XLTA 2PUJA 4LPSA 4IRUB 2HF9A 4RT2A 4FZ5A 1UC8A 4P3PA 1H5NA 4CCSA 1RW4A 3IXQA 4NZOA 2WKWA 3F2IA 2CKDA 2HJGA 2I03A 5JSZB 5JATA 2A1UA 1NRXA 4P4TA 4QDKA 4U2DA 4M2YA 4D9IA 5JT1A 3FROA 2XRZA 5P8WA 5KB3A 2RGAA 3SBDA 2NYUA 1TRKA 1JQKA 2BISA 3B1ZA 3MUEA 3UHPA 3WO1A 4FDLA 3QVUA 3VR1A 2FETA 4OGGA 3UOGA 2Z83A 2P68A 4ZZ3A 2H29A 4LOAA 3VZCA 4I55F 1MH9A 4PVDA 3BC1A 1NUPA 1KZYC 2REQB 4NOKA 5B3JA 1T36A 1Z62A 1E3LA 4F5ZA 1L4EA 5IFLA 2JG3A 1JP7A 3GUUA 3AB3A 4P4UA 4OSEA 1E2NA 1QO0A 2HRDA 1W0JD 3ESYA 2K60A 1V1MA 4Q93A 2JIOA 3FNIA 1M34A 2MSDB 4O63O 4JOSA 4QJ5A 3FPKA 3D3KA 1T9GR 4FEAA 4NLBA 2H4YA 4BV8A 2FAXA 4WCVA 1BDIA 3K31A 1NURA 1XTUA 2C9BA 5CWRA 1DTSA 1WTCA 1E59A 3N8GA 2WKQA 1JBQA 2BEUA 1S9DA 2OHFA 3HP4A 4QGAA 2I62A 3HKZF 3ORSA 1X80B 4HQKA 1DO2A 1LRJA 1J21A 3KO8A 4TWJA 2RHLA 4LMBA 4CMJA 3FF1A 3MWLA 3QPAA 2W11A 3NFYA 5TIIA 4O2BA 1CY4A 3VPCA 1YFZA 1XQ1A 4KXVA 5JH7F 2DXIA 2ZXHA 4YACA 4EHLA 1KYTA 1VBNA 4JUDX 2Y92A 4ZOQI 2IP2A 1W59A 1Q3TA 2B78A 1XDSA 4LPKA 2L19A 1N57A 1OC2A 3ZTYA 5FUVA 4G1MB 1ZQQA 1ZQLA 4KR3A 2W2TA 4BMXA 3JZIA 1M2VA 1FRVA 9GPBA 3WQBA 1RZRA 8ICPA 3IP3A 4M0UA 1CZUA 1HGXA 4B6RA 1RPNA 1H8EA 5DTRA 3V4SA 5TY0A 1H0KA 2F62A 2GEVA 5L6MB 3IODA 4UJ3A 3JPSA 5JTUA 4IS2A 1DXYA 5BWCA 4XA8A 3FZNA 5BUSA 4RUKA 1NRJB 3V8PA 2YIJA 4C8LA 2HNKA 4C3VA 5KTKA 3VYSB 3T7JA 1FP7A 4CEIA 5DW0A 5AESA 1ED1A 1XLTC 4EHIA 4FFVA 2GPYA 5JZOA 3IPCA 1YA8A 5BYJA 3THWB 3AP2A 1TV9A 4ARBA 4FW9A 4Q3KA 1U4SA 5A3SA 4F4YA 4CGZA 4PH5A 1F44A 4RS3A 4EA7A 3BL6A 4PS1A 3ZHUA 4Q45A 5I9TA 1YBHA 3AUYA 2OD2A 3U1BA 3TH5A 3GLGE 3KZCA 4Q19A 1NYTA 5LLDA 3ER8A 1KBQA 1RWWA 3RODA 5DHUA 3R3UA 4L74A 5CVCA 4D98A 1H5UA 2E37A 5FR2A 5B3JC 3G5MA 4HG2A 3IAS1 4IICA 3UICA 1G21E 2PMDA 3M9MB 1VL1A 4UTPA 1LD3A 2IY7A 2NVBA 4D9NA 4HXFB 3DBOB 3RF9A 4OF4A 2XHEA 1CJKC 4A6XA 4P36A 3GVCA 2REXB 4WJKB 3ERCA 3CIOA 4OQFA 2AC7A 1U0RA 3DMGA 4I66A 3QU4A 1MB9A 4TTSA 3AZOA 4NNOA 3M89A 2BONA 1HNWB 4JI1B 4MS4B 2HEGA 2QY6A 3EN0A 4DC0A 3DZDA 5IXYA 3QE2A 3W06A 2WYHA 2VRCD 3DUFA 4N5NA 1TM4E 2O06A 1Z3CA 2XMSA 2W4MA 4W99A 1G5RA 1XJ5A 3NEJA 4G2NA 4R8KA 2VAPA 3F4BA 1ACJA 2MIIA 1SC4A 5FUMA 2G1PA 1TK3A 2OUIA 4ZH4A 4D8TA 1D1SA 1P0MA 3ISBA 1SXEA 1TPZA 3NHPA 2GETA 1Q0RA 2WB1C 2KMDA 1JA0A 4PSCA 4LDPA 3A4LA 4YP0A 3PUVA 2DQYA 1J9GA 2H3HA 5M2QA 4CLEA 2J9ZB 4PAOA 1HLDA 1NL3A 3S1LA 2GCIA 1YR9A 2AEMA 3DL7A 3MWFA 3QOWA 1PFQA 3PRKE 2ZBPA 4MUGA 2MCFA 1HYBA 2AZ4A 3KKNA 5TQ2B 2C9ZA 2WT9A 1DX4A 4DT1B 2O3UA 1G8FA 3TOSA 2FX2A 2G8LA 4L8GA 2GH1A 1UF9A 7ICTA 2Y9UA 2AG0A 2Z2ZA 1Y8RB 2G5TA 3GRCA 2D59A 3UV7A 3QE3A 1NGSA 3DLBA 2HGSA 1ZRNA 1UC4B 5DI3A 1Y33E 4DMGA 3EBLA 5EZYB 4X62B 2IDMA 4EQZA 4DQ0A 4ER7A 1TKAA 4O2RA 4RK6A 2EERA 1R16A 3T15A 2XV1A 4B44A 4JYCA 4NIMA 4BJ5A 2ETVA 5WRFA 3VNAA 4QUHA 8ICNA 1N48A 1Z35A 4D41A 2VTDA 4J0CA 1SXJA 5G3ZA 1QVVA 1N5DA 1SXHA 2YVQA 4RXUA 4ENTA 2HRZA 1NVAA 3KQHA 4QVIA 1CVIA 3JAKB 2V65A 5K03A 2XB9A 1ML3A 2JLVA 3E22B 1JA1A 4MRVA 1HDZA 5DB9A 1KEJA 1C9YA 1XZLA 3DC2A 3REOA 2ZOSA 1NN5A 2IV7A 4PZNA 2P4EA 1EFTA 2JHPA 2Q3MA 5G0TA 2G06A 2QAGA 4C0SA 1BMTA 1RZVA 2GZ3A 2BZGA 2REOA 5IT5A 1ANKA 1XA3A 2DHQA 2VAXA 4XR4A 2FZ5A 1CZOA 2OD7A 2JKZA 3DS8A 4US1R 5LZ8A 1YZTA 4IQ8A 3T94A 1TM1E 2FCAA 4BX3A 3ET5A 4JBHA 3UWPA 3G0OA 4QICA 1V3QE 2DPHA 5BWLA 4MP6A 5KSYA 1ZK4A 4WKGA 5FYDA 1TW2A 5KPDA 1Q7TA 4OFWA 4LBVA 4FMCB 5FL3A 1K5GA 3TIVA 2G7ZA 3NWBA 2G9VA 4ZVRA 1QFJA 1U99A 4ZMBA 1X6IA 1Y7HA 3P0FA 4E5MA 2E85A 4DLRA 1IK6A 4IFEA 4RFSB 1SU4A 4MW5A 4XCXA 3F5SA 5KFKA 5DX0A 2V4UA 5KC8A 4LJSA 3G88A 3JWIA 3V8QA 4Y2HA 1Q6ZA 3ZHBA 5CHEA 1NLZA 2OD9A 2JJ1A 1T26A 4OK3A 2GPAA 2AMVA 4LX0A 3WK4A 2BCRA 1XE3A 1T2VA 3AEUA 3NHWA 1N78A 4NS4A 1GZ4A 2Z9DA 3BWCA 2AK3A 4MDYA 1YQDA 4MWEA 3RIXA 3C8DA 1NVBA 1PHPA 3EY4A 5CYPA 3C6BA 4GSYA 2ID4A 2ZKLA 1ADJA 5EJ9A 2VQEB 2XCIA 3PFWO 2AR9A 4YPOA 3N2KB 1DGSA 5DBGA 3BWXA 1L5SA 2HQOA 1FNCA 2J0EA 5C34B 1T0IA 3O8DA 3W2TA 4B4UA 1L5VA 1QK5A 1BFKA 2VDPB 3GIWA 4JKOA 4DARA 5KJ1A 9ICTA 1IN8A 4U6PA 3UK0A 5K8CA 2H1HA 1PI3A 1A04A 3F78A 3IS3A 3EZ9A 1K4MA 3HH8A 2Y0SC 2Z3ZA 4O6VA 1P5ZB 4RHEA 2BM0A 2GYWA 2DKNA 1DAOA 3ENZA 5F1YA 2F2TA 4LF6B 3V55A 4GMFA 5FUBA 3RJKA 1YZFA 2NG1A 4ZN6A 2QKYA 3PJGA 4NATA 1JE0A 5EI5A 3JW8A 4GRDA 4GLXA 4MVCA 3LQRA 1SXJC 4BTEA 1CUSA 1OAAA 4EHHA 4X93A 1TDJA 4PG6A 3M83A 3MAJA 1KAEA 2C2WA 3HZOA 4P86A 1E6UA 3IMCA 3RI3A 1QHFA 2BEVB 4KRXA 2ONCA 2NVWA 2O9JA 3W4JA 5ESRA 4FDAA 2VTVA 1WS6A 2HHTA 1R8YA 3O3OB 5E6RA 2ESEA 2ZTLA 3NT4A 2DLNA 4JELA 4ZAGA 4JQCA 1D2CA 3FPSA 4CFSA 4MVJG 5LQUA 4MP3A 3FTCA 2QAGC 4G0OA 4MEBA 1I5EA 1IJBA 1T94A 1W2HA 5TX7A 3QJGA 3E48A 2WW8A 4IX9A 2VTEA 2OYSA 5DLPA 3GFSA 4BZQA 1KMQA 1KI6B 3E2PA 4F7DA 2B4TO 3AQFA 3HJBA 3FE2A 1FMFA 2QARA 4DO9A 4B45A 3RFUA 2EHDA 1E9BA 5IP5A 3OPNA 4RH1A 3UT5A 4HYEA 3I1YA 4C06A 3H8VA 5LL6P 1ECCA 3EFHA 3G7SA 1I7PA 4L7QA 4F8YA 2O1WA 4GICA 3MYYA 2PGJA 4G5QA 4HDAA 1N4AA 3ZJTA 1U7ZA 3BWVA 3AY0A 3OQNA 4R8UA 4W1PA 2PMEA 3QKSB 3HABA 3CX7A 4REQB 4RUAA 4EJFA 5CU7A 3H2BA 1SUBA 2ZRPA 3TX6A 3FHTA 2V3VA 3A9UA 3T0IA 5EINA 5FPKA 1RLIA 4RBNA 4PX3A 4MR8B 1I4WA 4UEOA 1TM3E 4Q15A 2FLLA 3HWSA 4TVKA 3LT4A 2VKTA 2QZ4A 1RYNA 1KP9A 1VYHA 3WGVA 2Y1OA 3DBVO 2C8JA 4N7MA 5BMOA 1K5DA 1JIIA 1WLSA 4EYEA 3UPTA 4G56A 3D6HA 2V7XA 4QZHA 4G63A 1S0MA 5KC9A 4D56A 1FP4B 3MINA 3I1JA 3PEVA 3IIEA 4J9QA 4PC2A 4UDXX 4OXNA 2WJ3A 1MF7A 3STWA 2XX3A 2Q28A 1VMIA 3FRHA 4A03A 4HGOA 3RUPA 2Y9TA 1RT9A 4Q8FA 3ZWQA 5IFKA 2IXGA 2BGLA 1OWOA 3GWZA 2JRCA 3DT9A 3K15A 1IUOA 5H81A 3D5QA 3KJGA 1WXGA 1N2IA 1LBHA 4K9LA 5CT8A 1QGED 2GLTA 3BDIA 4YJ3F 2BSXA 3UW1A 3LYHA 3W78A 1JJVA 3DXFA 3NTUA 4YMSA 1EVLA 2PL5A 2R79A 4X1IB 2QL6A 4ZYWA 4HL6A 1LPBB 3TMYA 1BJKA 5DM0A 3FMVA 1ZD1A 4QPPA 1V2HE 4YRMA 2I3BA 2PWPA 4WECA 2Z3WA 2PZ8A 4DA6A 2ZRQA 2Z2JA 3D59A 4RIIA 4ZYTA 2G6BA 2J4FA 4C8NA 8ICRA 1QHXA 1VMDA 3MUNA 3VPBA 2VUUA 1XRNA 1DPFA 3Q6IA 4QM6A 1GARA 5B7PA 4N3CA 4K46A 2B61A 4OEHA 2CSXA 2HXGA 1N8SA 4UNPA 2OWOA 4DDMA 3ZYZA 3ZD9A 2I9PA 1CP2A 4KFTA 2AQKA 2OZLB 4PZ0A 4EB0A 3KUUA 1NBME 3QEOA 2IU0A 3VSEA 4NH0A 2QRVB 3ASZA 1GN8A 4CQMB 3GRAA 3D2LA 1X9HA 3LVBA 1G60A 3QK7A 4MCIA 1KQ3A 3E53A 1LPPA 2HSGA 5B3AA 1NV8A 2EP8A 4MB6A 3H5VA 1NDUA 3KUCA 4F5OA 1VSTA 3I34X 3O92A 1NPYA 1EFVA 1Z2DA 3DBRA 2IYQA 4Y6GB 4JK1A 3F6YA 2ZANA 1A2OA 1FSZA 1QC5B 3OQHA 2F3UA 3D5EA 3U7FB 4RJTA 5HKOA 1ZD5A 4F3YA 2RJNA 1YB7A 1WOMA 4M0DA 4F56A 3V7NA 1JN0A 5H0IA 1V5IA 4YV7A 2Q6IA 4C07A 2K89A 2WAOA 4Q4AB 4GXQA 4JODA 4H2DA 4LX8A 3OJOA 2ZJ5A 5FP0A 2QL9A 4Q4HA 3FNEA 3HU2A 2WU8A 2BFMA 4X7PA 1DKUA 5IWCA 1ZZGA 1B14A 1MGOA 4P81A 2IPNA 4G3IA 5AVSA 2ORVA 3HDGA 4LJ9A 4LOKA 5LIPA 1AQJA 1LXCA 4RQUA 1UJMA 5KHAA 4BFZA 4HLCA 5DBCA 3NTRA 5HQ3A 4D0NA 4OLBA 4LF5B 1Y1RA 3F53A 4ZO7A 4OIMA 4JP1A 2DZDA 5KG7A 1GGFA 1Y0BA 2JAOA 1RTKA 2O54A 2GLXA 4LTMA 1HNZB 1IWOA 4UDNA 1CX9B 3E5HA 2QEQA 3GJ0A 3GU3A 4FLFA 3PW5A 2VTKA 3OT4A 3VDMA 5REQA 4QUAA 2A19A 1ZMBA 4GPD1 1VXRA 1C1DA 1NFRA 2RI1A 3BIFA 4UBJA 2W43A 1ORWA 1NXXA 1NNUA 3ZQ4A 4HLNA 2YZNA 4X61A 5DWDA 4Z9AA 3S8EA 4XCQA 1E2LA 1Q74A 4J9VA 3WZ2A 4TPKA 5DMXA 3UHJA 4O5AA 4HO1X 1YRLA 4YRGA 4PLHA 2H8GA 3JQ8B 4B43A 1WCLA 1BRMA 2FCRA 5K0NA 3QI2A 3TYXA 2IPOA 2FZGA 4CKCA 3ND7A 1G2QA 4G5RA 2ZE7A 1X8XA 1ZUHA 1JWBB 1GA4A 4JLMA 3ZXXA 2PZLA 3HKBB 3B89A 1GVHA 3GQVA 4OXXA 1WXQA 2NYAA 3Q3EA 1DAPA 3WG9A 5ICMA 4L2IA 1FMTA 1GD1O 3V46A 1NMQA 1XA0A 1QZ3A 3PIDA 1XZPA 2BPCA 2NVUA 3OWOA 3AI3A 2NTNA 1W2WB 5FWXB 5AR1A 1XZJA 1XZGA 2NU7A 1Z4IA 2P62A 3WGTA 4KLLA 2Z2XA 2BKUA 1QV6A 3C1ZA 5IWAB 3K94A 1P8JA 1XP8A 2B94A 5KFDA 4YN3A 4QTXA 1CUKA 4GZ3A 4YLEA 1GDTA 2OK8A 1L7AA 2X15A 3ZDZB 4G3XA 4BQSA 2J85A 3U4GA 3D7MA 4WBNF 1ZMRA 4QJ4A 3E5MA 1CJBA 4X24A 3WWDA 1T5HX 1SA0A 5IKMA 3AR9A 3ELDA 5CG1A 1VBKA 3AUKA 3LTEA 2H31A 3C8UA 3RHSA 3CVUA 5AM1A 3N5KA 5HFAA 4DW8A 4FNOA 5HSGA 4FWTA 5H70A 5C1PA 2WTEA 4DJFC 5DDIP 5K6TA 3ODPA 4M98A 4X8HA 1U1GA 4TXMA 2G25A 1KAGA 5H1YA 1K1EA 3KM0A 1JFSA 5KKNB 1C5KA 3HEMA 4Q1BA 4W8GA 4PPGA 3ESXA 4DPLA 2JCVA 4YRLA 4MINA 3DE0X 4F9GA 4CMGA 1R18A 1GGMA 5IC4A 2O8CA 3B1JA 3BOSA 4BATA 3DZBA 3N7TA 4ZHQF 2E6UX 4LRXA 4MWOA 4V0MA 5KT7A 4B3TB 4I2NA 3CYMA 4YCXA 3D6JA 3H0KA 3AM5A 2K6GA 1SKYE 3S2YA 3I1FA 2WM8A 1NWHA 1M8FA 3AP3A 3JYHA 2FUG1 2FJ0A 4M9GA 3WJ7A 1OOEA 1MG5A 2EW8A 1KXZA 4L5BA 4OJLA 3OCUA 4S2EA 2HA5A 1AXRA 2BR3A 5T57A 2AJBA 4P98A 3UUWA 1L7QA 3S99A 3HX0A 2CBXA 2ZBUA 2JFOA 4J3FA 5LD2C 3KKQA 2G28A 1SKQA 3IQWA 4UCQA 1CG6A 1Q1EA 2P4HX 3W9BA 5CNKA 4RVGA 1KYIA 5K0FA 4XXHA 4Q03A 4KPUA 1N8KA 3GLUA 3QVXA 1KEWA 9ICBA 3CMCO 4HNUA 5AIBA 1OTHA 2OMEA 3ZCVA 4OJ6A 5FBZA 3EQZA 5NULA 3EVBA 4RSHA 1Q0UA 1X1TA 4JB3A 2BFBB 2IYYA 4CL2A 1GRRA 5ECDA 4ER3A 1SQ0A 2X5OA 5F35A 5E6SA 1MOZA 4M0MA 5IDQA 4ZRMA 4NLCA 2X86A 1DMSA 1UBLS 4G25A 3SYLA 1FSGA 4ENSA 3IP4B 4ZAZA 4NY1A 1E2GA 5BV2P 3VVMA 1T9CA 1SQFA 2XYHA 1N2OA 1QKKA 1QZUA 2HHVA 3O4GA 1B3BA 3PUIA 2OC4A 4U5XA 1C1HA 2W98A 2LP4Y 3LY8A 3MTJA 3BWYA 3WU2U 4OBEA 2XXAA 5B1DA 5I9LA 2J08A 4MUYA 2EX1A 2LKCA 4EPVA 1OI3A 1Z3IX 2E1PA 2ZZKA 4BNIA 3Q9NA 2Z8XA 5CA0A 2KZZA 3CW9A 5CBPB 4Q8EA 4GLBA 2ZSBA 1K7XB 1XNSA 4J7CA 2WJYA 3F6PA 1Y3BE 5JOQA 1P80A 5AOCA 1EDOA 5JHHB 4RHFA 5JNSA 3K9NA 4Z51A 3C7KA 1R5BA 3H5AA 4XKJA 2BFEA 1SC9A 1CUBA 1E6KA 1LKYB 3NORA 4N5DA 1G0NA 7ABPA 1SUEA 4TN1A 4IRDA 5JD4A 3TCXB 1FB5A 3GUCA 1E58A 3HN6A 4ROSA 3S5UA 3PDIA 1UBEA 3O8NA 3WB9A 1XRSB 2PZEA 1J23A 4EGQA 3R6DA 4HH4A 4M1OA 4NBUA 4DUPA 5DP1A 2QAJA 5LNK6 1VP9A 5K0SA 4D8WA 3L7LA 3GAAA 1F20A 3LVVA 1RWXA 4C0KA 1WDKA 3I12A 3FTQA 2AEFA 1HDGO 1GL3A 2VZEA 4XVRA 4C20A 1DWOA 4P9NA 2QR3A 4OHWA 4GLFA 2W9BB 1VHDA 4LAFA 5GTDA 2GKSA 4L3WA 3HL4A 1WWUA 1C9EA 1SVMA 4LS3A 2J48A 1H2HA 5CB4B 3GJTA 3O1JC 4XWYA 4D6PA 2IUSA 1UCFA 1CS4C 3D4OA 4IF4A 1H1LA 4UMFA 8ICKA 3T7EA 1SCIA 1FW8A 3V7YA 4H1WA 5CX1B 4RLQA 4C0ZA 1G55A 1QTQA 5E9WA 3IILA 5K8VA 3EZYA 4NBWA 4C22A 4DMMA 1JEDA 5FOSA 4UM9B 3T0GA 2ODBA 1AMUA 2BW0A 3QFCA 1N2ZA 2W9XA 4QQ8A 2PJUA 4DANA 4WKNA 2IHUA 3GY0A 3W5BA 5ALUA 4V1CI 3QPCA 4C8KA 4B9UA 2EFDB 2V9PA 1M7GA 3ANNA 2AOTB 4DN6A 3WA6A 2QN6A 1YR1A 1SBZA 4UUAA 4XGQA 1LFDB 3OKFA 4ZZ1A 3SBOA 1OTYA 5KL1B 1AXEA 3AL3A 1T5DX 2H0RA 4FEEA 3GOHA 1PK8A 1RCFA 5L8VA 4WAUA 1MC1A 2HWYA 2VKQA 4BY9E 1YVRA 4BFLA 3CNOA 3RSGA 1APBA 1RQ2A 2VUSA 4M1YA 1ULBA 2FE4A 1B4DA 1JR4A 4S1OA 1F7VA 3RD5A 4F92B 3UC9A 1RJEA 3BHJA 2NZYA 1P6UA 1CR4A 2EJCA 4OKIA 1K88A 5IEJA 3TIGA 4DQRA 1MD9A 3L8GA 4QOJA 2FJPA 4MR7B 4NJOA 3FNHA 4K5QA 2I6SA 4JT8A 4UAWA 4UPDA 4HQNA 3BYZA 1JL3A 4YMMA 4H7PA 3G2KA 1IBLB 5BR8B 5AUNB 3PFFA 5B7GA 4ZQIA 5JFGA 3L8MA 5EGNA 1XJQA 1N7IA 2D5IA 3EDQA 3NAQA 4EYGA 2BQRA 3P2EA 1UDXA 5JLAA 3QXCA 4TXLA 1U3DA 3I9MA 2KW5A 1CZHA 4EHKA 2G40A 4GLJA 3DLAA 1D6SA 3HHEA 2VPXA 3R9WA 5LP6A 2DCUA 5CW1A 3E05A 3SP1A 1D2AA 2RK4A 1L1QA 4D26A 5KYXB 1B0XA 3UJHA 2PRSA 2P5TB 1P0IA 2KYRA 1NW9B 1T3ZA 5FO0A 1YVUA 2XOKA 3RRHA 1NK4A 1U1EA 3QFSA 1GYQA 4OPMA 3IEUA 4WNYA 2QVLA 3RDPA 1E99A 2PH3A 2JIRA 1ISPA 2OCKA 1I36A 3FYSA 1FPMA 2VP4A 1MFPA 5FL7D 5KO2A 4LF7B 4TWAA 2NWQA 1X77A 3F2CA 4CIWA 1GTRA 4DLAA 2OVFA 2F9FA 2KNJA 3I39X 4OSPA 1Z45A 4GVXA 3LY7A 1NA5A 3TPCA 4RU9A 4NNPA 3ZDEA 3E82A 3OZCA 3P0IA 4TSFA 2PLFA 3JZMA 2IWHA 1IUPA 3C2KA 3EA5A 2LR0A 3NBMA 1GLNA 1PV4A 1L8AA 1T9AA 4K6FA 1LWNA 2K4IA 3JQAB 4JBYA 2R8JA 1MOQA 1TTPB 2HMWA 4QJBA 2YHAA 1K68A 1LRKA 1ZHFA 4RPKA 3TLEA 1EPUA 3PQ4A 1KK1A 1FUEA 4X1OA 5IN4A 3AESB 1DFHA 1SOUA 4QWBA 3MWDA 4F6LA 3BK2A 4JYPA 4YFVA 2HXYA 3QE0A 2I6TA 2FDRA 5B4UA 3MGAA 3MTGA 2GZAA 3KPJA 2C82A 3F6RA 3TLGB 1F17A 3SR4A 2RIPA 3KP1A 4JMLA 1F1JA 1DJOA 3HCRA 2VBCA 4O4LA 4R1TA 4PO1A 1LNZA 5JSFA 5ESXA 4GPZA 4EBCA 4TL9A 2UYOA 4GP6A 1JU3A 2XQKA 3F3KA 5I4BA 1N1EA 3MJHA 2F43A 3G5TA 4EY6A 2VF5X 4G89A 1TYBE 5EMMA 5KFEA 2HSZA 3ANYB 2XD4A 9ICWA 3ENVA 1RMYA 2C9OA 3H5NA 2Y67A 3VAAA 3BQ1A 1TM5E 5LOVA 3UCEA 5ARBA 3WNBA 4WLEA 2XOEA 1GQQA 1E7RA 3QMWA 2MSWA 3MBIA 1V9PA 2GTPA 5DTQA 3VC3A 2N1RA 3DFFA 3AH8A 2BGGA 4IO0A 1ZVMA 4J0JA 1R0YA 3FFTA 5EVJA 4X5VA 3AF6A 1RFGE 2PXCA 3B8HA 2HJWA 5L1JA 1ULZA 4MTCA 4HDQB 4KHZA 1CHNA 3DF9A 3OZ7A 3USES 3WKAA 1ZLYA 4CR7A 2YL2A 4WE3A 1FXUA 4ARZB 5EIWA 1U65A 1GOTA 2X2EA 1ZK2A 3SZ2A 4CTMA 4D2IA 1P73A 1N9ZA 2X2OA 1SOVA 5LP6C 2F1RA 4QUDA 2JH7A 5DHQA 4G86A 2GJSA 2LW7A 3AYXB 3T3OA 2EBHX 4RA9A 3AK4A 4XDZA 5KOJB 1X8JA 4BEJA 3WWEA 4PZLA 3MDCA 3LRXA 5F98A 5TR9A 4QBGB 3L18A 3U3RA 2YWEA 5ANRB 1KY3A 1NUUA 1I2DA 1G1MA 3ZWVA 4BLSA 2QRLA 3UJNA 2GDZA 3V7FA 3KT8A 3F97A 5C5CA 1DT3A 1P29A 2RSLA 2ZS9A 3IHQB 4QWEA 1MUUA 4PPXA 3TECE 2OAGA 2Z98A 4A92A 1HEUA 5JU6A 3AF4A 2HDWA 3SZMA 4HI0E 1P1KA 3HUUA 1GNQA 4X92A 4ELVA 4AZTA 1EDDA 3A1FA 4FNGA 1ZYQA 2P9YA 3SX4A 4JIGA 4O4HB 3D0RA 1MQSA 2QXTA 1O5IA 4ZCMA 3DWFA 3DEIA 3GVXA 2W6ZA 3CIFA 3LDHA 1MX1A 4TKZA 4WUTA 1EK1A 4TTPA 4N5IX 4E0DA 3WTCA 1L5OA 4YH1A 2NGRA 2Q1YA 2WE8A 7ICJA 3D3EA 3L7JA 2QD5A 5KDLA 3RF7A 1ENOA 4J1QA 1U8YA 3NOQA 5KG3A 1S6YA 2A84A 2V0NA 2QQ5A 4FKBA 2ZWPA 3K0SA 1E2HA 2NQ8A 1RR6A 3THYA 3MYRA 4BIIA 4X3PA 3CSDA 3B48A 3KQVA 3LBNA 1TQ8A 1KYYA 1CTQA 2P30A 4MVJH 1UWCA 2GO7A 4YJ2F 3B1VA 4LRWA 5J0SA 2ANBA 4TXJA 2SNIE 4RCYA 3MR5A 1NJ2A 3QWIA 3K16A 2R84A 4YECA 3GNSA 1L5YA 3ZYCA 1O0CA 3E3OA 1PR5A 4IMPA 1P44A 4ZDJA 2VDKB 4PZEA 3CZ9A 4GR5A 3UG6A 1WPGA 2ZIGA 2BF7A 1PGOA 3Q3JB 4Z54A 2E8PA 2H4FA 3CZ4A 5ALWA 3FSEA 3RH0A 1GA1A 5E1DA 3EVNA 2JRZA 4R0NA 3NUZA 3CVVA 3T8YA 4QPCA 4H1TA 3T5TA 3F71A 3ILXA 5J2AA 1KMNA 1FX0A 4M55A 4QULA 2CEKA 2V98A 2EFJA 2FX3A 2JFGA 2AW5A 4R64A 3BJZA 2XTJA 2CT8A 1SHZA 5DNDA 1MJHA 1U0GA 1JLKA 4EKGA 3PK0A 3ZE6A 5DM2A 2PHZA 3FHOA 4YBRA 1LBTA 1D2NA 3D1LA 3EQ7A 1ZQZA 5CM2Z 4ZIRA 4E2ZA 2VNHA 1YTLA 3C7TA 3RRZA 1T4CB 4HH0A 1ZUIA 3OZXA 3UMMA 3PENA 2EYUA 4K3VA 2A0UA 3WBJA 3TQCA 4UHFA 1N2HA 2WWIA 4RF3A 4K05A 4E2YA 2XTZA 4TROA 4O1IA 2JGLA 1RYBA 3TLKA 2EGUA 1DKOA 3T12A 3WGKA 3L41A 4QOGA 4URHA 1FX1A 2G9RA 3OLZA 4B6SA 5IAOA 2AQHA 4YONB 2H4XA 4MYRA 3DYBA 1ZWKA 1CQPA 3NC4A 3TANA 4ALNA 2DKFA 1C3EA 4A0HA 3LO8A 4RDCA 4N3BA 1LBQA 4EB3A 1LDYA 1EP1B 3DD1A 4RM2A 3GGJA 1E2BA 3EMKA 4IEEA 3ECAA 4K86A 4BCBA 3OMXA 2Q9UA 2X3UA 3E0XA 5I7SA 1EJ0A 1NN0A 2QLJA 4KXWA 3KZMA 1GLVA 4CMEA 1EFRA 4KIJA 2R62A 2ZSDA 4A23A 1KIMA 4RACA 4H18A 1I6LA 1WQ1R 4AY4A 1N1DA 3CUSA 3OEHA 5BN5B 4ZK2A 5B3LA 2QA5A 4MR9A 1U90A 3EQ6A 4E4RA 3DJFA 3UB4A 5JIBA 4ZJZA 5CT4A 1Q1NA 1OBFO 2IUEA 3MCAA 3JALB 5HFJA 1I3KA 2YJ5A 3W6NA 5JVDA 2QMQA 1G8MA 2IS6A 2ZCVA 1HYEA 3CO5A 4BJ3A 4EG3A 5KVCA 3DPUA 4CCYB 3BULA 4PBTA 3CVYA 2Z43A 3QVOA 3JAMA 2V5UA 2YQEA 2ZPAA 4TT8A 4L78A 4OBWA 4DSTA 3HZZA 1C14A 2PA0A 3ZGZA 3ROZA 3AV0B 5TB5A 4OOFA 3RFAA 2R44A 3AY3A 3MOSA 4RF4A 3TAXA 3EUWA 3DL4A 2ZS7A 3EEBA 1RPJA 2OO5A 3WDSA 3TI0A 1XLUA 4JVMA 3AVOA 4KLAA 2Q8QA 5BQ5A 3WIEA 2GK4A 5JXGA 1TFRA 2CJWB 3RRMA 1XEAA 5HF5A 2HCBA 1RLJA 4B6GA 1Y9DA 1L5HA 4M9UA 3UMVA 2W5UA 1XDUA 3QTBA 1F38A 3UWMA 2WUVA 4PQRA 3T06B 4H1HA 1YT3A 4G9BA 4EOGA 3AYZB 5CNMA 4BNXA 4KFUA 8ICYA 1L3UA 1KTQA 1J49A 5KS2A 3RG2A 2YUIA 4PYOA 1MA0A 4MWSA 2EAPA 5A9TA 2RBKA 3IAHA 4BFVA 1NW8A 1YB2A 1MQ9A 1V9LA 1G8HA 2ZAYA 2HHJA 3RVRA 1X7YB 1MO3A 4R1QA 3U39A 1QDLB 2GPSA 4P80A 5C8XA 1JYSA 2OYYA 2RCYA 3O1LA 1UM8A 3VO2A 2OKCA 1OB5A 4X20A 2C7QA 1KZ1A 1T5OA 3FJYA 4G5XA 4QYWA 4QREA 1PWXA 1QIMA 1V7QA 1QTMA 4B7AA 1YOVB 1V95A 1XSLA 5IH3A 4LYDA 4P4SB 4YUXA 2MRLA 5HIJA 3WXBA 5C2JB 2QUJA 5IZ4A 2F4VB 4MVJA 3FF4A 3H2ZA 3G7NA 2W7PA 4MMZB 5DT9A 1NI4A 1E1CB 4FIZA 4NV1A 5EP4A 4CMEC 5K0CA 1WCWA 2NO9A 2OXTA 4ER0A 4DABA 3D7SA 1VL8A 5KTMA 1QTNA 4WKPA 2QZZA 1YV9A 4OA5A 1LF5A 4W5HA 4FYYA 2QXUA 3NASA 1M34E 3LP6A 4MSUA 1D8YA 4GC5A 5DIFA 5A71A 4D46A 1ZW6A 1JHZA 1D5WA 1QFYA 1FFHA 1Q0PA 1U5AA 1CRQA 2Q2OA 2GD6A 3LZDA 3WL8A 4GBED 5DYNA 5ED4A 5SZIA 3FZYA 3OF5A 2ZR0A 3F3MA 4H1UA 2B5VA 5HVNA 2BGTA 1UM9B 1P75A 4QGFA 1BX3A 1W34A 3K2IA 4Q5IA 3HGTA 3PA6A 4GKJB 2RI0A 2EWVA 4M9XA 4KE8A 1MNQA 3MBYA 4M0EA 4IQTA 7ICFA 4MCHA 1LY1A 4FYIA 3SKXA 1BH6A 3OQOA 4AO8A 4EFNA 1ZQVA 4AROA 4XSVA 1C8BA 3WJAA 1UDAA 1UAAA 3I6QA 1Q50A 2JL1A 5G5HA 4B6OA 3ONWA 1WVMA 1QYVA 2OO5C 3VKWA 4UHCA 1MN6A 1SKBA 3ZQUA 1P91A 1DSSG 3B7WA 3OZAA 4ZPXA 5ESDA 4GM4A 1ZOIA 3AQIA 4YAFA 3VZDA 3JZDA 1JVNA 3B1XA 3V6MA 3ZHTA 5F9NA 5FORA 2ZRHA 4N03A 3CNEA 1VTKA 4JBLA 4QASA 5ICGA 3PYMA 5I01A 2PMBA 1ZPDA 1VJ0A 4J7AA 5TNXA 1BJRE 4F4UA 1QZTA 3B0YA 4QXOA 2KSOA 4D4JA 1VMEA 2P11A 1QB8A 4MQFA 1RI1A 3RGGA 3L7MA 3UFXA 3AC0A 3HU3A 4HC4A 5KIAA 2NIPA 5EZSA 1TUIA 2HUNA 3AKYA 4FJ1A 4YR3A 2ATXA 1NOMA 1W48A 4FEGA 2ORED 2XY6A 1T2AA 4XQ9A 1FNMA 5L3VA 2AFIB 4PXAA 4KPEC 4FLEA 4W5OA 4Y9SA 3KU1A 1RKQA 2FN4A 4FSXA 2QP4A 3SDZA 1XT6A 3K3PA 3H75A 4MWTA 3AUUA 4CF3A 2W6NA 3HO1A 5ELMA 2FE9A 3A32A 2AEJA 3C3BA 3TUJC 4Q7JB 2HF8A 3VJKA 1NE2A 3JD3A 2BHNA 3H87A 4ABTA 1KI2A 2PTGA 3MGKA 3QX3A 2OHOA 1C4OA 1UDWA 3A36A 2OSVA 4HK4A 1WSAA 4KOEC 4Q9DA 2GK7A 3QJ5A 3LLCA 3EK2A 3T61A 2UYHA 3RU3A 4PAGA 4EPXA 4P54A 3GLRA 5G40A 1T1JA 5FWNA 3CCFA 2PX4A 1ORDA 4MKHA 3VX3A 5D5QA 5IIKA 4USAA 2Y68A 3BX1A 2VVTA 2ZRBA 1NNSA 3WLFA 5HX7A 4URFA 3D7NA 4KLEA 2PKYX 2BOVA 4HSGA 7ICSA 3PUWA 2I4TA 3G85A 3BXGA 5FNVB 5IAAA 3M9OB 3PI6A 3RWBA 3QU9A 1QO0D 4J2TA 1BS2A 2H51A 3HV2A 1IM8A 3CY6A 2OFWA 2JKYA 2EV9A 3DDOA 2N0SA 2IRWA 3IG8A 4CF4A 2IHBA 1OGYA 3MT7A 2HSDA 1Z34A 2HH9A 3QFFA 2W6MA 3GEDA 1R6VA 9ICQA 5GVSA 2OYCA 2P9BA 4KZKA 3NB0A 5DSTA 1NVVR 4LHYA 1EQ2A 4YY3B 5E8RA 1HC7A 3KQPA 4TZ0A 4EAQA 4DR1B 3D3NA 1M6WA 2CCGA 3KB6A 4EGCB 3AUOA 3X1DA 1BQ4A 1TYDE 2QYTA 2YXLA 3LP5A 2BZ0A 3F6SA 1UBJS 3NKFA 5DGTA 4QYTA 4M53A 1ISHA 3S1AA 3HN7A 3TIXB 2HWXA 3PPVA 4NEHB 3N2YA 2VDOB 4HNSA 3NIWA 4YT4A 1X7XA 3IAXA 1WB5A 5T4HA 4J9NA 4I99A 2PFSA 2WHYA 1E6CA 4FHFA 3CSUA 4J8PA 3O3MB 4KUHA 2WTBA 3OZBA 3K5WA 3TEMA 2JW5A 4L9SA 3LXMA 5IS2A 1R1DA 2IELA 1KO5A 2BZFA 2ZBGA 3QX9A 5A7GA 1YJCA 4UB8U 4RY9A 1AN9A 3WC4A 4TV9B 3FYTA 3IV9A 1RZRD 4ICIA 2Y99A 3I61A 1H8ED 1VLBA 1GYRA 4LXTA 4QRIA 3EEIA 1CY0A 4JV0A 1G6OA 3A2KA 1K75A 1RJ9B 4ZU3A 3CEAA 4HLUA 2WSIA 4GQBA 1PDVA 1ADFA 1TQ2A 4O4IA 5JD3A 3MWEB 2LRHA 4TS9A 3EXIB 4ZT7A 8ICEA 2C83A 3H11A 4GL2A 4B5KA 5ALGA 1II8A 2NUTA 4ZAXA 1R9JA 5AJUA 4Q9HA 3ZBTA 3V8RA 5LP1A 2YR0A 3SEZA 1WZUA 2PFPA 2UUOA 1VSVA 4GC6A 4M2LA 2QPTA 5KFRA 1L3SA 2RHBA 4JL5A 2AUNA 4FB4A 4OM8A 5EOVA 2W2KA 1HLFA 2W6PA 4C14A 1TEHA 5HEKA 3IQIX 1LTKA 1Z47A 1H22A 1F0PA 2Q2WA 4R0MA 2IIQA 2KKPA 1ZRSA 4C1BA 5J4HA 3I04A 4F84A 4QX6A 2L17A 4FCTA 3QEBZ 2W7OA 2ASDA 1IYZA 4FYJA 5EFOA 2Q5IA 4P0PA 1YK0A 3FPFA 1B15A 4IVQA 3JQFA 1M6YA 1ZG3A 4I8XA 4U63A 4DWIA 4KQGA 4GX2A 4IJ5A 2IH2A 3AMZA 2JGDB 4FFSA 4X1YB 4BO0A 1H4SA 5AI4A 2V7GA 2Q45A 1ID8A 5FI0B 2FJUA 2P6RA 3HA7A 4KQEA 5F9LA 4Q44A 3F7TA 1BDMA 4ZOAA 2HBRA 1HA3A 2FV8A 3ZJYA 2LM1A 2ZXUA 1AY0A 4I50F 4ND8A 1MV8A 2VYCA 1HFKA 3HJEA 1VDZA 4ZREA 5TT0A 1BKSB 2WABA 5T7BA 3VTAA 2HSWA 2C3PA 5K6AA 2H52A 5KVAA 1Q17A 4EF4A 1GWNA 3M6MD 1GPUA 1CRPA 1XZQA 2NTEA 1A2KC 3SYKA 1DC4A 1Q92A 4UCFA 1KHHA 5DI9A 3BKXA 3FH0A 3SQNA 2WK1A 3ZDFA 2I2XB 2R5NA 4F4FA 3G8CA 2UVPB 3HPQA 1ZOOA 3SBEA 3RVNA 3AL2A 5I6DA 3SKYA 5JYEA 3AP1A 2W3SA 2XIJA 3ENQA 2GD1O 5J0UA 4DQXA 4O29A 2PD6A 1MPTA 3WWOA 2ZSJA 3BRWA 5BNTA 4HFNA 4IQGA 2Z6UA 4BMZA 2X8WA 4JXKA 4OQPA 3VR2A 4LY3A 2PRKA 4ZVSA 3RSQA 4B9LA 2CYBA 1Q12A 3P97A 4YXWA 1FTGA 4A1OA 2XA2A 2RKBA 4ZD6A 1ZK0A 1E1QD 3QF7A 1FC0A 4M9JA 1AG9A 4HLUC 4YALA 2GYUA 1AZTA 1H94A 4WK4B 3LUDA 4DXDA 1QBKC 2Y2UA 1BOOA 2IF0A 6REQA 3NUQA 1ZQBA 5L9AA 5EP1A 5D3MA 1JQ3A 2Q4RA 4ANFA 4JWMA 5LB2A 1LQ2A 5LXTF 5JWHA 4C4RA 2H3ZA 5EPEA 1SK8A 2VCHA 2H2AA 3L8YA 4NF2A 4BTLA 4C04A 1SXJD 1G64A 4QECA 1EAYA 1CUHA 2EZZA 1P7ZA 3BAFA 5B6PA 1GPJA 3ZE7A 1JXLA 4B80A 5KYUB 3CPEA 4O59O 4A16A 1ZL2A 3ROQA 2ILVA 1QYRA 3FLMA 3W90A 2V45A 4LZLA 5BNIA 4D42A 3TXXA 2RGWA 2JAPA 5C5IA 1D4AA 1UL1X 2XLCA 1GP2A 1VE7A 3T4EA 3D2QA 4UASA 1HURA 1TZJA 1RKVA 3VOAA 4LQ4A 3UXPA 1SHLA 5IMSA 3L7YA 1Z00A 1WDMA 2H2FA 3LUHA 4BNDB 3JQFC 5IIIA 1EFCA 1N5WA 4PCUA 2X9NA 5JMTA 5AXCA 3MOGA 5LBIA 3C28A 2CV2A 2BH9A 2JLQA 4NM1A 4UMVA 4ZGWA 2EJTA 1THGA 4WI1A 5SZJA 4YASA 3KSUA 3ZK7A 3B5JA 2C4WA 4CF7A 3E15A 1UJBA 2AMJA 5IAEA 4AP9A 5JSHA 1Z4JA 3JRWA 4FS8A 4E1AA 4PG4A 4KHPB 3NHLA 3KHSA 2D1FA 5K6AC 3IJEB 1W94A 2I34A 3UUGA 2IKQA 4RU1A 3SZUA 3M2PA 2AOUB 2K2QB 4TV8A 3V2GA 2QX7A 5J4KA 3DV0A 2JJ1D 3RWMB 4OHYA 1T43A 3U3ZA 1MOPA 4KSBA 1NX9A 5J5CA 1OXKB 1YRWA 3JYLA 1S2DA 3NC0C 2GRJA 1PZHA 3SDBA 4ZVOA 4B3IA 1VHLA 2J0UA 2WWHA 1MHPA 4GF5A 1J99A 1ISRA 4DOCA 4KU4A 4AS1A 2ZI5A 1AS2A 3ZVNA 2VXOA 4PG8A 4QIHA 4N3GA 1CLEA 3UJ9A 1A98A 1KFBB 3U7QA 1W5FA 4CYMA 3NBAA 4K9MA 1KR5A 5ULLA 3RBVA 4QIWC 4I36A 4J0DA 4IINA 4D8XA 5KSOA 1SKRA 3DUWA 4Z6FA 4K6MA 5AVYA 1X15A 4TUSA 1FEZA 5JBNA 1DE0A 3IQDB 2X7JA 2R47A 1JEQA 1KEZA 1TJYA 1IQPA 1A8UA 2E4YA 2FEWB 4ECXA 2MSNA 2YXDA 4M0LA 3E9CA 3TW8A 3FCEA 3KXIA 4Y2GA 3Q5DA 3P1JA 1OW5A 1GQ2A 1OT5A 4HVAA 2QTWB 2JDIA 4RJKA 5FHRA 2ZRFA 3U4CA 1Z5NA 4RHXA 4QL3A 2QRZA 3BGOS 2B8EA 3O38A 2R5WA 3K5PA 4MUXA 1V3TA 4YRCA 1JZTA 2RAUA 4HZUB 3K0KA 4YCMA 5MGNA 4RQNA 4OQ4A 5KHOC 5EC8A 4Q66C 3EWNA 2EKZA 4IHKA 1D9DA 4BWGA 4P3YA 3KL2A 5ICSA 3FKSA 4G0VA 4FI3F 3B6JA 2Z58A 1PEDA 1X9GA 1WMDA 3UF0A 1Q95A 2WPNA 4OMDA 4ZOLB 3U9LA 4RCVA 3PR5B 1PJ4A 4RABA 3A4NA 4ND4A 4J7UA 5F73A 4JITA 1ELOA 2ZDQA 2W7TA 1C9JA 4TVOA 2FEAA 1JBEA 1X8LA 2YICA 4G1FA 2AQ8A 4OFXA 4WOJA 1RYUA 4RNOA 1CFZA 5GOZA 2AYZA 4CVNA 5AVJA 4JWTA 2GZSA 2E82A 1NBWB 3KUXA 2OM2A 3SAGA 2V1XA 1KOGA 2ISOA 4JCCA 2DT8A 2Z95A 1X38A 2G9QA 3AHJA 3WQSB 2DULA 4EO7A 2XPCA 4JVLA 3KJFA 2VDLB 3N5CA 2O5VA 1E9RA 3GHHA 4U7HA 1XDZA 3EH1A 1NW5A 1LDEA 1W4ZA 1BN7A 1JHRA 1SG0A 1KFEB 2E1RA 4CUJA 1KSHA 3C5VA 3R3VA 1X1CA 3WRXA 2O2CA 4IIXA 1J2RA 5HR6A 2COKA 4EWLA 4N6NA 2IMWP 3BXPA 3KD3A 3FW1A 3DEEA 4NYJR 3F6BX 1L5ZA 1HM5A 4ENWA 5CJ7A 1TYCA 3R3JA 3WR5A 5L7WA 5EWJA 4BDSA 4ER5A 4G1CA 1X2IA 3DGFC 4O2AB 1DX9A 5ALXA 1YU9A 3MTBA 3RG8A 1EUQA 3DTVB 2QBYB 3GA0A 2NU6A 1YUMA 2Q6KA 4NDAA 4B7CA 3AXTA 3ZX4A 4B81A 1AKUA 4OGKA 4A8JB 2V8OA 3PHBE 3GCXA 1RYZA 3Q8RB 3RJTA 5EXEA 1PL0A 2ZJYA 1PCXA 5JTIA 1JRPA 5F4BA 2D00A 3OZEA 3DBLA 5H3HA 3ABSB 1N5OX 3DO8A 1FTWA 3F73A 3IMFA 1OLXB 4HUQA 3QG1A 4HNGA 5TQ0A 1ZC3A 4GSLA 2HLDA 5KG2A 2WYOA 3ZDCA 1TJ4A 4EBFA 3HVJA 5BSTA 3CRMA 2FWMX 5F52A 5IJ0A 4CXMA 3WZLA 1BVRA 2RJOA 4HWKA 3RYFB 3UWSA 4L27A 4HX2A 2DHRA 4RETA 3L1JA 1ZI6A 4NU8X 3T1QA 1QYDA 1U8ZA 4Q39A 3EXG2 3RC7A 2RHMA 3NGMA 2VAVA 3SEIA 2EWMA 3PKJA 1KMCA 4PYQA 2JLAA 2H3QA 2AMYA 1R4MB 2X1MA 2X9LA 4WZAB 2RD2A 4DLYA 1UKCA 4MW4A 4ZEWA 3CYFA 1JHMA 2AVNA 1N32B 4FZ3A 5ECGC 5HF6A 3C23A 1T9GS 4N6GA 4MFAA 3GJ8A 1COWA 3PUZA 3K0EA 1UK8A 4AC9A 1U8TA 2Q3JA 1UXJA 2R6R1 1ODIA 3TRIA 1H2EA 3OETA 4OYHA 2YV1A 1XTKA 4KN5A 1F4PA 5B7QA 5LQNA 4NFHA 3MTQA 1JYEA 4DKXA 1V6CA 5JJLA 2QSUA 1H0HA 6CHYA 4ERXA 3V1LA 4OU4A 2CD7A 4GYWA 3V2UA 2QRMA 4BC1A 2A0YA 2HF2A 3L77A 3VU9A 4CU2A 3I28A 1A9RA 1F5NA 2VDQB 1U2QA 2WOOA 4RTOA 1F3OA 6PFKA 4ED7A 5E9JA 3WRXC 1TIBA 1KH2A 4UE6A 2BZ1A 4WZBB 2BPFA 2XZPA 2R6DA 4Y1GA 2FF5A 2W2XA 4DMKA 3PKZA 1Z6TA 3WKCA 3EGXB 3N75A 5JNTA 4V3CA 5TF4A 2JD1A 4L02A 5I7OA 5ADUS 5B58C 1ZISA 4W1QA 3R4CA 4EA8A 2KLBA 2YWGA 2NV6A 2Y1XA 3EIXA 3KXKA 5KCZA 3KJNA 2XDAA 3FDJA 2H63A 3QSYA 4DL6A 2Z4RA 4XQ8A 1LS6A 1HDRA 4OJPA 3C7CB 4IIJF 2YS7A 3OP1A 2Y6VA 5AT1A 3MGIA 1QU3A 3IEKA 5E6UB 2XZLA 2HR1A 3CUTA 3VO9A 2EEPA 3VHXB 1STOA 3ZZ0A 4WRRA 3UFBA 3IQXA 1BQ3A 3OLWA 2AN1A 4HX5A 2RI6A 3N86A 4RZ2A 4EAAA 3TG8A 3OT1B 1FXSA 2R25B 4TT3A 1Y6JA 1GFSA 3MRXA 1FZQA 2ZJ2A 3OCWA 1I5RA 2QRUA 3RVDA 4MZDA 3QFHA 1FRFS 1X6VA 2X5XA 2UDPA 5HUHA 4I28A 4RHYA 5A2GA 4H7KA 1D09A 4BLVA 4DMLA 2X8LA 4B31A 1IDOA 4AQ7A 5E2AA 2I3DA 3E9EA 2ZBFA 4L72A 5KTPA 3C74A 1PT8A 4NZZA 1M3SA 1ZXBA 4TKLA 4Z4EA 3WLLA 3HY3A 5LWHA 1GG9A 3T9FA 5TGZA 5CP2A 5EJFA 2EFEB 2O7RA 4A8TA 1Z8FA 3L0IB 3NJ8A 4WADA 3RCBA 1N3IA 1A72A 5KG0A 4IGIA 1QJCA 2W8BA 1U7OA 3O4JA 5BN3B 1PV1A 1YACA 4YI3A 9ICHA 2FUKA 3PFKA 2D5AA 2HEIA 1Z0IA 1RBQA 3E3LA 2JH3A 4KJXA 1X1RA 1BC5A 1EFDN 3H4VA 3UT6A 2BVNA 3NBYC 4DIDA 3SZRA 4YMOA 2I29A 4YR7A 4FNAA 2GQ0A 1HTBA 1NPDA 1XMJA 4QQKA 2PKCA 2LDBA 2YHIA 1XTQA 4M8NE 3EG9B 4L4ZA 3ACBA 4IHJF 3PT5A 1XKXA 5AW6A 4DRZA 4S24A 3QKRB 2WD7B 1VL2A 4BO9A 4ZVNA 5GINE 1OH5A 3SC3A 2YRFA 3DD5A 1TOAA 3CZAA 3F9CA 1QQ6A 1X66A 1D6MA 1XN4A 3N3AC 1N2SA 3VR4A 4JVNA 4R3WA 4RDIA 5AHOA 3ZNPA 1OFUX 4LY6A 2WR8A 4RGQA 3JQ7A 3PSTA 2CE2X 2XNDA 3V8VA 2P9ZA 3D6AA 3KOMA 4JUFA 5K4HA 5KFPA 1ZOSA 2FXVA 2WIGA 4WGFA 3JWJA 1L5RA 2H1VA 1E9CA 4BYGA 1FLNA 1RXYA 4Z7NB 2C9CA 3AF0A 3RQIA 4FBUA 1CUCA 1QGUA 4M0FA 3W5IA 3TXYA 3QY9A 1G5PA 3H5WA 3BZUA 2OFPA 3W9YA 4ENQA 1OKKA 5GONF 3S28A 1XNGA 5KOYA 3QP9A 1ZQFA 1NKSA 1ZUNA 4O33A 1RHRA 5IYZA 2VYVA 1FDTA 2WQZA 3GCWA 2CXPA 1THZA 1YB1A 1JG3A 1AROP 1L6NA 2FPIA 2I9KA 3NBQA 1EX9A 2PL3A 3V3KA 2EKBA 2VJDA 4R98A 3VR6A 2ONZA 1O77A 3OO0A 4Y98A 1Z17A 1RWQA 4ATNA 5G0VA 3AVQA 3CEMA 4QWDA 1EVJA 3RB0A 5EYPB 5LNK1 1K63A 4H7FA 2VZ9A 5LIRA 5HJ2A 3DNMA 4MKIA 4BRWA 3GZNB 3VU8A 3G7UA 3PNSA 4Z4FA 3TQOA 4J07A 3OFVA 4QSHA 1CE8B 3G59A 1QG2A 4Y18A 4BPRA 1BGWA 4QYIA 2PLAA 1XD2A 3EF3A 4HJXA 1ZNZA 3EGEA 1E92A 3VPGA 3MOIA 3ESBA 4LRTB 3ZTTA 4ES6A 2HBLA 4PVCA 3KYDB 3DMDA 3KT3A 2Y66A 3ETJA 1SPBS 3OTHA 2IW1A 4B4DA 2Y1GA 4UKDA 2YY6A 1YB6A 2GTHA 3C6YA 5BVGA 3VTKA 1ZDMA 2Z5GA 3QPUA 1NW6A 5E79U 3DOEA 4OV6B 2FXIA 4H6XA 4QLAA 1PS9A 4X84A 3H2YA 1B6RA 1WXFA 5G41A 4WJLA 4QNNA 4I3FA 1B41A 4LY9A 3IVCA 3Q6MA 1VBFA 2L69A 2J41A 4HGRA 1JTEA 3FNFA 5CEEA 1LBEA 3EIQA 2IZ5A 2CXOA 4DQDA 2VDWA 2Z9BA 3EUAA 4Q4CA 2XKBA 3OIUA 3CEJA 2H17A 4FS3A 4I4TF 4YAGA 3F5DA 1FU7A 2O1SA 1SU8A 4G0WA 1DBSA 1YFJA 1PL7A 10MHA 2NSJA 3VR0A 3LI2A 1K6JA 1XWWA 1NLFA 3O2NA 1WVGA 3PVXA 3F96A 5E38A 3U48A 5JNVA 4W5WA 1A71A 1K3UB 4PLCA 3LG2A 2BP7B 4LCJA 3R24A 1X94A 4OQLA 4MKGA 4LE2A 3T3PB 3NHAA 1GJRA 1X0VA 1UKVY 3DXXA 3T9EA 3HM9A 4Q9IA 4EFLA 1WR8A 2V6IA 3H0RB 5F3XB 3VFDA 2IX9A 1E20A 3KV3O 5CXSA 1LH0A 1MG0A 1X7HA 4UAVA 5AW2A 1ZO8A 2CYAA 5TMPA 1Y98A 4CKWB 2Z08A 2ILTA 3UJ7A 3ICQB 1U7WA 5K0EA 4ZICA 3RIHA 4IY1A 3D81A 3LPAA 4XIFA 3HQ4O 3LWLA 3DXYA 3QENA 1G17A 1W6UA 2QLNA 2PG3A 5F5LA 1XXHA 4PC7A 1KK3A 5FOXA 5C7LO 4IUBS 4EFMA 3EXHA 2GXSA 3HC7A 3V7UA 3KOUA 1QS0A 3EEFA 1DIOB 2V4QA 2VRNA 3OCXA 3E8SA 4QUIA 3JATA 5J2TF 3I8XA 3GEIA 5IXJA 1Q91A 2II6A 2A9PA 3VOTA 1LJUA 2IDJA 4QO8A 3MCWA 2C1XA 3CH5A 5C1BA 2BEWA 3MTDA 4DS4A 3F7MA 1B00A 2KTQA 4KO2S 3QPVA 3OIFA 1MR3F 1QTRA 3HA3A 3H0EA 1KYZA 2IHJA 1W47A 1FYWA 2FEKA 1E5TA 3OQMA 2R8IA 2O7VA 3F47A 3KHHA 1ZCAA 3KFVA 1XYVA 1WW2A 2JZOA 3DP7A 3MSXA 4ND3A 4QWCA 2I76A 3PL5A 2BKAA 2WKRA 3ZCTA 3HFGA 4RVUA 2NU9A 3SN6A 3QXJA 4ALKA 5EWGA 4AJKA 1D0IA 3ICPA 2FSGA 1W19A 2WUWE 4O4JA 2VWHA 5LDHA 5A5DA 4XYEA 1JHQA 3ZOZA 2Z7JA 2JZBB 4FHGA 3H9EO 1M1NB 2X13A 4BYMA 4W7HA 4MB2A 2QV0A 3CH7A 4EGFA 2ISQA 2R8HA 1M5UA 1MAUA 1GUAA 3LS2A 2GVZC 3RVBA 5CFRA 4LISA 3VSAA 8MHTA 5GGXA 3K9WA 2B6NA 1J24A 5ICFA 4AJJA 1CF4A 3EXFB 4JZKA 3I76A 4FQ7A 4P35A 3EXEA 5L7YA 5JQGA 2RG7A 4FT4A 4TMZA 1UH5A 4OXQA 3BCUA 4FC6A 2MYUA 1U1DA 2H0AA 2A94A 3PRJA 1GUDA 3D8NA 3DF7A 1G6HA 4CG3A 5E7QA 4BQFA 1KKMA 1C0IA 3K71B 2VTBA 1EK6A 1J0BA 2IS1A 2PL1A 5FTJA 2R8EA 1M73E 4EUKA 3ZV7A 4C9BA 2VIXA 2J0QA 4H9GA 4DPKA 2YINC 5KQRA 2NUPA 2A8YA 4AUKA 1B1AA 2PUEA 3GMTA 5KFHA 3EF1A 5GGYA 1Y8ZA 1TGYA 5EXPA 2W9AA 1FNNA 1J42A 1R00A 5BURA 3IA7A 4F4XA 2XOKD 1Q46A 3FCCA 2HHHB 1S2MA 4ZRDA 1FIUA 3T4PA 3B51X 4MGEA 3HCAA 3EXHC 1IBMB 1YMQA 3UHOA 1BHJA 2CMFA 3MRTA 3U3XA 4P83A 3VBEA 1NT2A 5CIWA 4Q3BA 2CHUA 3HVUA 4HATA 1KORA 3PDCA 3SX2A 1X1EA 2BHLA 1NG1A 1KP2A 3ISDA 1ZJNA 4AKGA 1SOMA 4TSFD 2C7OA 3ANSA 5TV2A 1UZNA 1Z29A 1P7CA 3GRVA 1J39A 4A8EA 2X2PA 4J9MA 1NMXA 4P3NA 1GZSA 2NO5A 4Y9UA 2YTZA 4R6XA 1SBCA 1W9MA 3WNQA 2IEDA 5AJWA 2XCSB 3DQPA 2FWRA 5K8JB 3CGGA 4P7FA 3NJ4A 4WOCA 1E9SA 4DJDC 5F5NA 2RAPA 4CQLA 1NE7A 2VEDA 1Z4NA 4OUKX 5IM5A 4G09A 1P81A 1KBZA 1P2SA 4MCJA 1PR2A 4IO1A 4TTRA 1DWQA 3WYBA 5J23A 2BGRA 4RD4A 4P2GA 1FJ2A 1Z5WA 2ONKA 3GV8B 3IOEA 3D4IA 4N48A 5HKLA 2J30A 3KB1A 1DG1G 3X44A 4JDUA 2MSCB 4QWAA 4NM2A 4TZTA 3NDPA 1WKVA 4JIMA 4O2BF 1Z07A 4IWNA 5CYFA 2A6PA 1OMOA 3C5GA 2WB1F 1WDTA 4K1XA 2HWKA 3HGQA 5SY9A 5BOVA 4XSGA 1L4LA 2ASJA 1KO1A 1EZ4A 2O8FB 2IHKA 4IGAA 4DL9A 2FN7A 1M1YA 1HDYA 4UBCA 2G1JA 2ZTSA 2QW0X 2I9GA 1KDTA 4OOEA 2B4KA 4JUAA 1Z16A 1Y6GA 2FP3A 4C7KA 1YKGA 4EK9A 2BCJQ 4AICA 3ORHA 1HYHA 3KLNA 1W0CA 5JSQA 4EJ2A 4YAIA 3R9XA 2DQKA 4GC9A 3KV1A 4U7JA 2HVHA 2XNCA 3DVAA 5LBTA 3TZHA 3VDRA 4KR0A 1J0EA 2OP0A 4ZJPA 4JKYA 4AJEA 3SOZA 4CIAA 3TZBA 4BN0A 4TQAA 3DE6X 1V4NA 2F59A 3EPGA 2VFAA 3A4MA 3USZA 1IAVA 5BSKA 4K0RA 1LI5A 4KNYA 1RSZA 4B4VA 5AVVA 4LSZA 2X3YA 1QYIA 3ADDA 1V11A 3CUKA 2GI4A 1DK2A 3IVMA 4WMLA 2GN6A 1IN5A 3UUFA 2HHAA 1NR5A 3WTBA 4XQGA 4Z99A 4PR0A 3TW0A 1NNEA 3UPUA 4UD2A 3N2GB 5EL0A 3EIOA 1RXEA 1QOPB 4UJ5A 5A4DA 4MI9A 1F2VA 4BQOA 1SWVA 1IVYA 2J07A 1YZVA 1MB3A 4NENA 1QHHA 2GAJA 2ARKA 2P40A 3LDFA 3KTFA 3V7WA 3GFFA 1XAHA 3DOIA 3DQQA 4Q7LA 2W3RA 4HZGA 3WGNA 5MN4A 2YV3A 2FSVA 4CM1A 2WNIA 3QFTA 4MV6A 5JSYA 4BGDA 2WINI 3EFOA 3EAGA 1MMFB 3HE3A 2Q5FA 1F8XA 4W1RA 3ZZTA 2A1TR 4RH0A 4B4OA 4CTKA 2XD9A 5JADA 3R5JA 1P4JA 2NO4A 4M4SA 2AZDA 4BGVA 2ATIA 1X3SA 2FP4A 1Z75A 5HMLA 1ORRA 1CFJA 1F7UA 4GOMD 2RB4A 2V1UA 4MRNA 1E3WB 4UD6A 5IVKA 2Y9MB 5EKXA 3M5CA 1TRHA 5KPJA 3BKWA 2C7PA 1UKYA 3KZKA 2CNKA 5BXYA 2Y0PA 2AG1A 4MRPA 1WHTA 2YXNA 5KJEA 5F76A 2YJ4A 1P4RA 2BJHA 1QANA 4AW9A 2O23A 5CDGA 5HQTA 3S8YA 3TIFA 1ZQ9A 1LSUA 2QVYX 1TECE 3VU3A 4DG9A 2PBRA 5IW8A 1KOLA 4CMAA 1NI5A 1X7ZA 4NVRA 2AV6A 4YJDA 3GN2A 4CMKA 1JNYA 4DLSA 2HF7A 5D87A 1KLNA 5GTHU 3CINA 3MJFA 3K0FA 4NKRA 9ICSA 1NNLA 4F3OA 8ICIA 3A1VA 5EPUA 2JH8A 5GTIU 4MVJE 2QRJA 2P2SA 1WE2A 1SIJA 3Q7TA 1T0BA 1JHDA 1HQYE 1T1RA 5TVGA 5B1IA 1NXTA 2PNFA 2CK3A 2PWAA 2VSYA 3I8OA 4EL5A 1KDYA 3RB4A 3C98A 4YMIA 1M6EX 5CXQA 7AT1A 3SXUA 3CBQA 4X3CA 1Z06A 3X2EA 1M0WA