3UMBA

Crystal structure of the l-2-haloacid dehalogenase rsc1362
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
227
structure length
227
Chain Sequence
TSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Ralstonia solanacearum
molecule tags Hydrolase
molecule keywords dehalogenase-like hydrolase
total genus 80
structure length 227
sequence length 227
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3umbA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3umbA01
3BA6A 1FEZA 3B9BA 5AW8A 3S6JA 5AW3A 3QGMA 3SHQA 3WK6A 3UMCA 3ZUPA 4FE3A 2FDRA 3PDWA 2HI0A 3U19A 1RMTA 5AK3A 4G9BA 2FUCA 3ZVNA 5AI0A 4IFTA 2G1AA 5IS2A 1QH9A 3DV9A 1JUDA 4Y2RA 3L8EA 1QQ6A 1RLTA 3ED5A 2G08A 3MPOA 4BEWA 4Y2QA 1YNSA 3HLTA 3ZI4A 3IJ5A 4FYPA 4EELA 2Q5EA 3BWVA 2R8XA 4UW9A 4JB3A 4UASA 1IWOA 2JAOA 3NIWA 3MMZA 3AR2A 3QYPA 5ALNA 1T5SA 5AKYA 2WF5A 1L6RA 3SMVA 2ODAA 5ALSA 2BDUA 1YDFA 5ALOA 3E84A 3WKEA 1CR6A 3N8GA 2G06A 5FP0A 4UM5A 4UMVA 4GIBA 1U2TA 3I28A 1EK2A 4Y3UA 3WK5A 5AVWA 2P27A 2IA5A 1RKVA 1QQ5A 4GXTA 4CE6A 3TLMA 2I55A 2ZBGA 5AESA 2RAVA 1L8LA 2G07A 5ALHA 2RARA 1PW5A 1NF2A 5ALZA 1Z4JA 2G09A 4F72A 1Z4MA 4UMEA 1Z5GA 3N28A 3NALA 1NNLA 1Z4PX 3FPBA 3W5AA 1T9ZA 2RBKA 1Z4OA 3OTQA 3KC2A 4I9FA 5AI9A 1RQLA 2HF2A 5AHXA 2FPWA 4UU1A 2WF7A 4OD0A 4ZEWA 3WGUA 3I6BA 2R8ZA 3HYCA 1TJ3A 2I6XA 1Z4IA 5ALGA 4PNHA 3CNHA 4CF5A 3FM9A 3WK9A 3NAMA 4DWOA 5ALDA 2YY6A 2W11A 4FFDA 2JAUA 5AW6A 1RMYA 3PGVA 2WM8A 1J97A 2AMYA 5ALKA 3UM9A 5A3RA 2B8EA 3F9RA 2MSNA 5ALXA 3QUTA 2AUTA 2CFTA 2VKQA 1Q92A 3ZW7A 3NANA 5AKHA 1RKUA 2I33A 2YJ6A 3EF0A 2IYEA 2I34A 4IG4A 4JDPA 4BX2A 3GYGA 2BY4A 1ZS9A 4KX5A 3DAOA 2HHLA 5AVTA 5AK4A 1VJ5A 5AW9A 5AVVA 4Y2TA 4L6CA 1RPZA 4Y2YA 2PR7A 2JAWA 2WHEA 2YMQA 1RKQA 4BKMA 2CFRA 3E81A 1SU4A 3DDHA 3SD7A 3ZVMA 1N8NA 2GMWA 3PCTA 3QXGA 4I9GA 3EPRA 4HGQA 1Z4KA 1K1EA 3FPSA 4QQFA 3MC1A 4J03A 2HDOA 4UU0A 3ET4A 3NASA 3QU5A 5AM2A 2RB5A 3L8FA 3QU4A 3QLEA 2B1QA 3WK4A 4EX7A 3L0BA 1ZOLA 2EAUA 2GHQA 3UMGA 1NRWA 4XOUA 2MU1A 5A3SA 4UAVA 2P9JA 3B8EA 2OYCA 4BX3A 5ALYA 4AS2A 4L57A 1RDFA 5T41A 3MN1A 2B30A 4C4SA 2YJ5A 4YH1A 5AI6A 3N1UA 4UM7A 3RF6A 3L5KA 2X4DA 3AR6A 3ZTYA 1RRCA 2C9MA 4KNWA 4CNQA 1CQZA 5AICA 3SKYA 1ZRMA 1TE2A 2YN4A 1MH9A 2HX1A 5AVYA 4XPZA 3U7GA 3J7TA 4H1WA 2I54A 1XVIA 1WR8A 5A3QA 3ZWDA 5ALQA 5ALIA 4HGRA 2YMMA 3A3YA 2ZBDA 3OCWA 2HEGA 2QLTA 1Z4QA 3OCVA 4MUMA 4EENA 1T5TA 2C4NA 1KYTA 2P69A 3R09A 4HYTA 2O2XA 3WKCA 1SWVA 3QU9A 4YIHA 3L8GA 3N07A 1YJ5A 4RESA 4EZEA 4EX6A 2OBBA 4AP9A 2P11A 4HGPA 4Y2PA 3AR9A 1ZRNA 2EARA 1TJ5A 2AGVA 4OHFA 2W4MA 3WKBA 1SWWA 1O08A 1J8DA 1YMQA 3QUBA 3IRUA 3U26A 4Y2UA 4DW8A 3L8HA 5AVSA 1WPGA 5AM4A 3L1UA 4B6JA 3AR3A 3W5CA 1U2SA 3KZXA 1S2OA 2NYVA 5ALJA 5AW5A 5AVXA 4KYTA 4KNVA 4XE5A 4YCLA 5AIBA 4HGOA 5IT0A 4Y2JA 1L7MA 4CF4A 1XPJA 3EWIA 5AKXA 4HAIA 5AW1A 3QUQA 2YMLA 4Y2VA 4NWIA 4C4RA 2ZOSA 2I7DA 5AW0A 3WKDA 3B9RA 2G0AA 1AQ6A 3ZVLA 4AS3A 2W43A 4DCCA 1L7PA 2YJ3A 2HCFA 5AKLA 1ZD3A 5ALLA 3L1VA 3W5BA 2OA0A 4NFLA 3OPXA 1YV9A 5AKGA 3AR8A 4J2TA 2IOHA 2R8YA 2IOFK 4UMFA 2Q4RA 2AH5A 5ALWA 4YCMA 1ZD5A 2HSZA 1L7OA 2YMPA 2IOFA 5ALUA 2ZG6A 5AW4A 5AVQA 3IB6A 1Z88A 3ZU6A 2MU2A 1RMQA 3ZX5A 2G80A 2DQSA 3AR5A 3ONNA 4MWOA 3VAYA 3I76A 3WKAA 4HGNA 1L7NA 1S8OA 3M1YA 3KDPA 4XQ0A 4CF3A 4Y2XA 4BEVA 2FI1A 1F5SA 1VFPA 2FUEA 3SKXA 4QJBA 2NO5A 2YBDA 4C4TA 4UARA 2WF6A 1QQ7A 1ZD4A 1YS9A 1LVHA 4BNDB 2PKEA 4Y2SA 2FPSA 2YJ4A 4BBJA 5AI4A 4NAVA 3QUCA 5AW2A 3WK8A 5ALVA 5AM5A 4UATA 3L0CA 1Q91A 1X42A 3FZQA 2FEAA 3U7EB 3QNMA 3E8MA 3N5KA 5ALTA 5ALMA 1N9KA 5AI5A 1RQNA 2JARA 4ZEXA 2EATA 3ESRA 3U13A 4G63A 3I1YA 4L6AA 3R4CA 3ZWKA 2OM6A 3SLRA 1WZCA 4UMDA 1ZJJA 2FPUA 3ZX4A 4RETA 4NABA 5AVRA 4YCNA 5AVUA 1O03A 2HOQA 2PQ0A 3SF0A 1Z4NA 5AKJA 3QU7A 1RLMA 5ALPA 2B0CA 3OCXA 3FVVA 3QX7A 1LTQA 4ZEVA 2C8KA 2Q4TA 2GFHA 1ZD2P 3NRJA 3RFUA 1L8OA 1QYIA 3KOOA 2HF7A 2NO4A 4BX0A 5AVZA 4KX3A 3L0YA 2D2VA 3OCUA 2WFAA 2O9JA 3WGVA 2ZBFA 1RC8A 3E58A 1VJRA 2B1RA 4NV0A 2ZXEA 4E88A 4BNDA 1TJ4A 5AKZA 2GO7A 4KN8A 1WVIA 2C8LA 1Z4LA 5AM0A 3KD3A 3WK7A 3NUQA 3M9LA 3A1CA 1U02A 3UMBA 5AK6A 1U7OA 2WF9A 4O8CA 1TA0A 5JJBA 5AIAA 2FPXA 3OCZA 2GHTA 2BDEA 5AM3A 5ALFA 3AR4A 2QYHA 2B8JA 5E0OA 3ZTWA 5AKIA 5IT4A 5AKEA 3D6JA 5AK5A 3OCYA 3U7HB 3L7YA 3AR7A 3U7FB 2R8EA 2CN1A 3DNPA 5AKKA 3EF1A 2CFSA 2YFYA 1Z5UA 3ESQA 4OFZA 4OCZA 2ZBEA 1XP5A 3CZ4A 1RLOA 2B82A 3A1DA 3ET5A 3PGLA 3FGOA 3A1EA 4F71A 1EK1A 4UAUA 3W5DA 4BYGA 5AM1A 4EEKA 5AI8A 2FPRA 3P96A 4DFDA 4YIKA 1Y8AA 3KBBA 4YGYA 3R9KA 3K1ZA 2C88A 3QU2A 2HO4A 1U7PA 2JGAA 5AW7A 5ALRA 5ALEA 2WF8A
chains in the Genus database with same CATH superfamily
4HDRA 4ZN6A 3K0AA 3NBAA 3IN5A 1S9DA 5BURA 2W3RA 4WBXC 1CJMA 4JR1A 1YB5A 5BSGA 1EK5A 3KYCA 5CAEA 4A3SA 1GPJA 5EJ7A 3HKEB 3S27A 2JGIA 2O2YA 2D8CA 4YRKA 2EQBA 5JLAA 2Z30A 4JGIA 1SRQA 2AOTB 4GWLA 2YXEA 1CUCA 1VMDA 4R0NA 3MWGA 5DTJA 3ZXUB 2LMRA 2L2QA 2YWEA 2QM3A 5L6LB 2ADOA 5DPMA 3FA2A 5HQJA 4GLXA 3NHZA 2E6KA 4P31A 3O6VA 3RRHA 2E1RA 3V80A 2QT0A 3NTRA 4LWOA 3DMRA 4YT5A 4TSFD 5AVKA 3F2VA 2H3ZA 4PLFA 1YQXA 4X24A 4OH7A 1NKEA 4BRWA 4GWGA 4GC6A 1O6CA 2BN4A 4JJAA 1ZYUA 2F43A 1N2IA 4KSBA 5B6PA 1S6YA 1ECFA 1W0KD 1CB7A 1G6OA 2AX3A 1UP7A 3MAJA 4BN4A 4NY8A 1WSWA 5CB4A 1UK9A 2OZEA 1A7UA 4D98A 5IT5A 5LZ8A 5JXWA 4UUNA 1CF4A 2BDUA 2RI6A 1VG8A 1K66A 3G5AA 3SQXA 1WLYA 1CJCA 2R6CA 3W8FA 7ICQA 1AKUA 2BCUA 4S04A 3UXYA 4N1AA 4IF6A 3P94A 5G0UA 1RU3A 1FTQA 2AI1A 4ECXA 2O3TA 4DY4A 5KKCA 5J9FA 4E4YA 2VPIA 1P2GA 1S9HA 1QQ5A 2IPAB 3BGWA 3BIWA 3K9NA 3K9HA 3U3DA 4AG5A 2IC5A 1MA0A 3WP1B 4DM4A 3SZGA 5AESA 2DHQA 1U8CB 2OGSA 4AJLA 3ECAA 5KCZA 1JDSA 2H51A 1GZ6A 2J6CA 4KQHA 2HJRA 1PNQA 1WTAA 3GJ4A 5DW3A 5FI3A 5K3SA 5I47A 4OJTA 5CLIA 3B3FA 5FPTA 1UBHS 3ROFA 5E6SA 2G4LA 2JZBB 3HDTA 4M9LA 5JPDA 3DLAA 5NULA 3SKVA 1T9GR 1Y3CE 2OCPA 3HYSA 5GONF 4CTJA 1UJNA 3GZNB 5KFQA 2W0SA 1MAWA 4PTZA 1G20E 4NS4A 1E77A 3E8XA 5H81A 4BWMA 5EUMA 3DKPA 1YVDA 3B1WA 1WPQA 4RKFA 4E13A 4M1SA 5A7GA 2NQ2C 4D8YA 4KW7A 5B64A 1U0OC 3GPCA 2HA7A 4KH1A 3FTFA 9ICQA 1SCBA 4FCTA 4JI6B 4AJ4A 2EAPA 1LDGA 4FDVA 3I0NA 1A8HA 4Y7CA 2OAEA 3AJAA 3M5CA 2FEPA 4MW1A 1BXKA 1LH0A 3AVWA 3AG6A 4O3PA 1KDPA 3AM3A 3CZMA 3NR2A 3UPTA 1Y4ZA 2FWJA 2DH5A 3DOCA 4MEBA 4Z4GA 2XB2A 3BRWD 5KNBH 4FFDA 3E6AA 1YR1A 4DBVO 3PLRA 1WAMA 1OHHD 1WCNA 1PL7A 2R7MA 5J2CA 2YC2C 4I19A 2HHQA 4AM8A 5CCEA 2ZJ0A 3GFSA 1P1HA 3ZGYA 1DBPA 2BI7A 3OWOA 3KZOA 4MR8A 4OJQA 5ILGA 5M04A 1MQ3A 4ZO4A 4A9AA 4S0XA 1J2RA 1II8B 2CFOA 1FYVA 1T8EA 3V7LA 4BL5A 4NYIR 1EXWA 3FHTA 4D8VA 1G2OA 4PIPA 1NNSA 1Q92A 4IOKA 3SGLA 4HAOA 4PAQA 4GXKA 3V7JA 1BE8A 3FROA 5DBHX 3BF8A 2IE8A 3NJRA 4MYDA 3WLQA 4ZVQA 1FW6A 3EIEA 3I0ZA 2OP1A 2ASVA 1IM2A 2VHYA 3W2TA 3B6EA 1VSQA 1R4MB 2F44A 4AU1A 1A9SA 3QFCA 2G72A 2KNJA 1CUAA 1DFGA 1WXDA 4J0IA 1N2HA 2I8AA 1KI6A 3IVMA 3CYMA 1R10A 4R2WA 2PL5A 1F6DA 2OFXA 4LCBA 4TUYA 4ZVPA 5REQB 1Z7GA 5JNSA 3HP4A 3PE4A 4BMSA 4URYR 4B3TB 1FMTA 1P5HA 2QN2A 1ZJ4A 3GDOA 1A5SB 3AUYA 2C5BA 3RC2A 1FS4A 3AL2A 3NBZC 1JHDA 3ZWPA 1D2MA 1QRUA 1KAMA 4HYEA 3FTEA 1XTVA 5TMBA 3STWA 4DA4A 1ZWKA 1TKCA 2JGNA 3DZ8A 4CMKA 2F9FA 4J7UA 3WYAA 4CIYA 2UYQA 5DB8A 1OLUB 3RUEA 1ID8A 3Q3IA 2GBGA 3EPRA 2HJGA 2MR6A 2AZDA 3C1UA 4O3OA 1OGJA 3L6UA 4YD1A 1O6BA 4TMYA 2J41A 1LFDB 3RBAA 1UAYA 4JNCA 3X3HA 3ZE8A 3CPJB 1JQAA 5AJZA 3T5MA 3ZWYA 4M9NA 1XPUA 1B8PA 4TXJA 1XQ6A 5AM2A 4CKZA 3W04A 1XZHA 2V8OA 1SKRA 4FFMA 4A8TA 2V7VA 2VIIA 3B9JA 4MDYA 4WL0A 3SV4A 2VG8A 2Z9DA 3WK4A 4U1RA 2ZVPX 3LA8A 4YMOA 1WVGA 2FEWB 4KIFA 4P0PA 3W9UA 1KO8A 4DG5A 1ZZGA 3RSLA 2PFPA 1HQKA 2F8TA 2AC7A 1NF8A 4B1FA 1XE3A 1PR3A 4TWRA 2IWRA 3WY9A 3GJZA 3HYRA 4K86A 4BX3A 2PMDA 1FB5A 4MJXA 4WGGA 2FVXA 3HS3A 4DL7A 3OLCX 1CRQA 3P97A 4LJ6A 4AZSA 5JCZA 4DFMA 2PWPA 3RGWS 3MN1A 3MTGA 3OKPA 2WSBA 4GSYA 2X4LA 4RY2A 1K86A 1Z0JA 2BMVA 4HUTA 1EX9A 1M1NB 2ID9A 1NONA 2ZKIA 4ZPXA 4BTEA 3AR6A 1L3IA 1JYSA 5EIBD 1PBNA 4I27A 4PG8A 5CM8B 3RAXA 5HOEA 5I3CA 3T3NA 4US0R 4JL5A 2Q1TA 1ODFA 1BX0A 1VP3A 2QQGA 4E2FA 5KSYA 2AQ0A 1ORHA 4OJ5A 2K6GA 4ZI7A 3I5UA 1PP4A 1I4LD 3I23A 4G4GA 4UTOA 1I2ZA 2OQIA 1G3UA 3ESZA 3HW8A 4YMHA 1GG9A 3VGJA 1PKEA 1MN8A 8ICNA 3F67A 3FWPA 3TK1A 5CFPA 1MP0A 3MXTA 4Z0PA 4PQRA 1OSNA 2Y6VA 5T4EA 1K1SA 2FMQA 2BBOA 2LIPA 1N3YA 3ADKA 4ZU6X 2WM9B 1Z4QA 3VX3A 1QG6A 1QX4A 2B69A 4U0KA 3ND9A 4F4FA 4CMJA 1KYTA 4JSYA 5KTKA 2MYUA 2UAGA 3LPMA 5F7ZA 4IINA 4KMUA 3NBYC 2C9DA 1E92A 2CCJA 4RZSA 3LVRE 3KYIB 4JY7A 4YAOA 3WLIA 2IUFA 4MDHA 2JKZA 1FTSA 4DCMA 3OJCA 2YC4C 3Q11A 2A9VA 2Y0SC 2PYDA 3EQ8A 3CRW1 2OBBA 2C7BA 1KXZA 3PQCA 3RJFA 1O87A 1NVEA 3ASUA 1DV1A 2JEOA 1MUUA 4NU5A 3A58B 3SMQA 3TQSA 5F78A 5LN1A 3HWTA 2WQ7A 3JARA 2PL3A 3G3EA 4TQUS 1KVUA 1ODLA 5EMNA 1LDNA 5GQSA 2JHFA 3A9SA 4K28A 4PGYA 2W8BA 3ZZTA 4DV1B 4GSLA 2HYIC 4PO9A 3CSSA 3S2GA 2PGDA 1VSBA 4MCJA 3A26A 1HT0A 4DW8A 5BW4A 5KFLA 1V5WA 4PH5A 1DZ3A 1VYHA 3NFYA 4NMHA 2JGJA 4O59O 5FHRA 4EQ6B 5LFAA 3ZOZA 5IM4F 1SXPA 3T7IA 2X0EA 4H4DA 4OU4A 4K9SA 1ZP6A 2I65A 3ZDYB 3V4PB 2Z08A 3GFTA 1W7AA 1F4VA 1GFZA 4J1QA 1DB3A 2PX5A 3RE1A 4UB1A 4ACOA 1GPNA 1Q3UA 5KFRA 4L7QA 5DT2A 4Q9AA 1AD2A 2GZDA 1L4FA 2XI4A 3B0XA 1CK4A 1UZUA 3H6KA 3IOBA 5F4ZA 1QDUA 1RAFA 3T5CA 1B23P 5GM2A 4XTRA 1NE7A 1PT9A 1H6CA 3PGKA 2EW2A 3RFTA 3UO8B 4TLDA 2PGXA 1MJ5A 4YLYA 4V0OA 2H9IA 3QMWA 1L7PA 1XN4A 3MGCA 4L4YA 4N7BA 1N77A 1JHZA 5K6RA 1E66A 1V3QE 4PO1A 4B83A 1LPNA 3D2QA 1IQUA 2IEZA 5AKLA 2GCNA 1KI9A 3K5PA 2G1KA 2QD5A 2OA0A 1IH8A 3U4HA 3D4OA 5TGTA 2L17A 4YK7A 3WMEA 5JQGB 2AG8A 4EBCA 4FS8A 3GXBA 1YRWA 4FW9A 3HKCA 1W5TA 4L72A 1ND6A 5JR3A 2ODTX 1BX3A 3X1JA 2DHDA 1FUEA 1LI4A 3JARB 3OJLA 4B9VA 3M49A 2AFIE 4NBUA 5CNKA 4B5LA 3A0RB 3T1HB 4CEJA 2QN6A 2WTBA 2AI2A 4PRYA 1BN6A 4BLSA 3N7SC 2YMPA 1F7VA 4OXKA 1M1YB 3GVHA 1Z5PA 3HY4A 3SXJA 3KHTA 3GLFA 1K3TA 3SICE 1QP4A 4G07A 4TRRA 1X2BA 2QTCA 4MOWA 4EW6A 1BXZA 3IP9A 3AJ8A 2TECE 3Q0EA 3QA3E 4PG6A 4V0NA 4UREA 2H1HA 3Q3GE 2CXRA 3PUHA 3OLYA 1JA1A 1U63A 1VL1A 4Q82A 3SR6A 3VR4D 8ICEA 4H0CA 1G8KA 1YK0A 4GF5A 4H60A 2NV2B 4OLJA 1S8OA 4YO8A 1GVNB 2IZ6A 4Y2XA 4PPGA 4MGYR 4JFAA 4ZQIA 2F77X 4U02A 3UN1A 1ST3A 5CRXA 2K8AA 2FSGA 4WXRA 5F35A 1SXEA 2QX7A 2IYYA 2JIRA 3PS9A 5A5FA 1MB9A 3VMMA 2WF6A 3VHLB 4QPJC 3LBHA 4E5VA 1KXJA 1LVGA 1M2JA 5ERXA 1LVHA 2R751 2Y9TA 4EJ0A 5FL3A 1PZMA 4IQTA 4MEJA 3RRXA 5J2GA 3SOZA 5FBZA 4RQ3A 3VNRA 4YV0A 1AMUA 4POAA 3ZJTA 4Z4FA 1DPGA 2H4ZA 4WT7A 1UDCA 3GXOA 3L0CA 1E6UA 2QTVA 2R85A 2HK7A 4RHEA 3VVMA 1O4WA 3NPMA 4CODB 4BNGA 1RYZA 2QBYB 4EKEA 5L95A 2MIIA 4DM3A 1NUPA 3H5WA 1XQXA 4DQXA 4RK5A 1CRXA 5ALMA 2WHPB 4X64B 5KOHA 1CR1A 3M5PA 5BV7A 3IX7A 1RYBA 3L0PA 4NE9A 4TT3A 4RY9A 1QGED 1JXLA 2EH9A 1DIAA 4MRNA 3S70A 1XELA 1QCCA 1ZG3A 1HYGA 1I9CA 5FPYA 2AL7A 2J3LA 1XTIA 5EIOA 4KJXA 4EFMA 2O5VA 4V3BA 1PTJA 4B9SA 5K0JA 3GLFB 1NVKA 2EJCA 2SBTA 5ABPA 3ZX4A 2NV3A 5BRNA 1IVNA 1X8XA 3H2BA 4YCNA 5CYPA 3THWB 1MOQA 2PMZF 2H9YA 3OVMA 5AHKA 2HOQA 1SZHA 3CW2C 1U2RA 4ZO8A 5C7LO 4M98A 3OCJA 1Y3FE 1EAYA 4MYHA 3MBYA 1OXTA 2B0JA 2J48A 4C4OA 2Q3JA 5H3HA 1XZJA 2EANA 4U4AA 5BUSA 1ZC3A 4LYJA 3N8DA 2Q1XA 1L8OA 1HDOA 4RZXA 3CLSC 1OFUX 2OBNA 2NO4A 4ZC1A 1CULC 4PX2A 2LYBA 4Y1RB 4QTTB 3IVCA 2WG0A 1YZ7A 3SK0A 3W8RA 4AMGA 2IMWP 4PHCA 4F5YA 3CXUA 4DUGA 1I30A 1UADA 5MDHA 1FP2A 4DLKA 4I8XA 1RC8A 1CHNA 1Q0QA 4MHTA 1T1RA 1FP6A 3FI0A 5DYTA 3KQVA 5ES3A 3BM5A 2QRLA 1KH1A 4EHHA 2GYUA 5HVNA 5KYUA 5KJFA 5A0TA 3WGJA 2VRWA 1L4HA 2QQEA 5D1HA 4CM8A 3MTJA 3SBXA 2JZNA 1X14A 2J8ZA 1HNZB 2WNSA 4YCXA 3X1KA 2NVOA 4M87A 4C21A 5CHEA 1PK1A 2WU4A 1BYUA 1Y89A 3DAYA 4J16A 3UK2A 3U61B 4QXOA 5ELLA 3BQ1A 4C03A 1BH2A 2Y2VA 3R5SA 3ZV6A 5FX2A 2G9UA 2WA1A 4RA6B 3RHTA 3TX2A 4C30A 4AJ9A 2BTEA 4DZZA 1A04A 3HPQA 3LT5A 4PZOA 2FHSA 2I67A 4JUCA 1VB5A 3SPXA 2EZZA 1DEOA 2PH3A 2XMBA 4F4WA 4S0ZA 5F7OA 4DA7A 2F59A 1NYQA 1RWVA 5AJUA 5FOUA 3VNVA 1YT3A 4LV5B 3U7FB 5J3JA 2R6JA 2NAFA 5AKKA 2NZWA 3GJ5A 4PW0A 3C7KA 1WMBA 2J6UA 4QT0A 5FUVA 4RANA 3KYDB 1A3CA 2A78A 2FZ5A 3CTMA 3N2IA 4RNOA 3PG5A 1QFZA 5A03A 2UVRA 3OOJA 4IH9A 4EBDA 2EP7A 4P0QA 4F4ZA 1D2NA 1OR8A 2JJ8A 2BOVA 2PZKA 4LVNA 4QJ4A 1RI2A 1IG3A 4QX6A 3FTCA 5HG0A 3ZLTA 2PA3A 2XE6A 3KJEA 4AJIA 4F84A 4H1VA 3SQDA 4M6WB 1BJRE 5DRTA 2M0NA 4EGQA 2GUWA 3VR1A 4IVRA 3FNGA 4EHKA 2QXTA 4JXZA 1QBKC 3JYHA 4PG4A 4G0ZA 4WBSA 2ZS9A 3VO2A 1JQBA 3VZDA 2LR0A 2BGGA 1XMSA 3U81A 1HIWA 4RF5A 2HNKA 2Y1JA 5LUAA 1PEAA 4FOLA 1FYDA 3LQYA 4BO5A 1QHSA 4YIKA 3LQ4A 3ZBQA 2VH5R 1U9IA 2BGLA 2IYVA 2WUGA 2OLEA 3ESDA 3EVEA 2EFYA 3C14C 4G5RA 3VR6D 2PSSA 3VJLA 3DS8A 1YWGO 2B83A 1MXHA 4PONA 1TLFA 3B8HA 3INNA 4UBMA 4MW5A 1N57A 3REQB 2OZPA 3D7MA 4ZT4A 3VRHA 2NNLD 4QQKA 1QQAA 4J4BA 5TQJA 8ICXA 5ALRA 1J24A 1T29A 5E4JA 3W4IA 2Q49A 4KRXA 5H9WA 3KQWA 1SKUA 1FEZA 3AF0A 3DW1X 1DLJA 3T5JA 3FZYA 4P4UA 3WYCA 1AOXA 4G65A 1N1EA 3SHQA 4E51A 1D2HA 4B3RB 5F7XA 2W6JA 1YZYA 3BOSA 4LMBA 2QU8A 2GPTA 5CCDA 1XSEA 2DPHA 1PTJC 1E79A 4PSVA 1K7XB 4ZOLA 4RJTA 5BWCA 2D2EA 2CXOA 2QB5A 3AO0B 1GPMA 4IQGA 3W9YA 4IQ4A 2D3DA 3S2FA 3PSPA 4CFYA 3KPJA 1NK6A 1TTTA 4R4JA 4RAQA 3KEMA 4MI6A 1Z25A 2GCGA 4RJIA 1ODJA 1EGMB 1QRRA 1H94A 3N7PD 3B85A 3ED5A 1NAHA 5HM6A 2PS0A 4OP3A 3HLTA 2B5OA 2R48A 1T5DX 4YFYA 5L7YA 1FNCA 3E9RA 3AXTA 2IHNA 3GG2A 4KYIB 4U2KA 4UXIA 5E2AA 4TWJA 3DULA 4PANA 4GI3A 4BJ6A 4MV5A 3A7DA 4NG4A 1KI2A 2V7BA 2XRFA 5BN4B 2V7QA 4B3HA 2ZIXA 3VDXA 5CBPB 3BT7A 1OKKA 1Y6JA 2G40A 3PC7A 3RU9A 2FWIA 4M0LA 2P62A 3N9IA 1DTSA 1TZMA 2X77A 3EFOA 3HNOA 3KJFA 4LQCA 4N0QA 4NV1A 1PJBA 1YDFA 2CBXA 3OZUA 4J75A 4PX5A 1QYCA 1EM8B 2LUOA 4XM1A 3QSGA 4EKGA 2CVOA 5HRCA 3FNQA 4XTCS 1UPXA 1L4MA 2W2NA 3K6RA 4ED0A 2OAP1 3G0CA 3HZZA 3UWSA 2WWYA 2DP4E 2FSSA 1HL3A 4KO3S 2GO1A 1BPBA 4GFDA 2PX3A 2CJYA 1N5IA 4B40A 1JN3A 4FVTA 2ID8A 2R6R1 1R0ZA 2XQGA 2KHVA 4EPXA 1ILEA 3DQPA 5CXSA 1B8VA 1GLNA 3KPUA 2G07A 1M2OA 3M33A 1XMQB 2PUBA 1OTYA 1E5DA 2OV4A 4AN1A 4R16A 2Z5FA 3QEMA 3SC2A 4REQA 1KQPA 2BR3A 1YB1A 2JGMA 3HKBA 1OMOA 1KVSA 1NJFA 1TX4B 2O8VA 5ARCA 3TCKA 3NALA 3U4QA 1M8JA 1NNUA 2RBKA 1R8XA 2RG1A 2RGNC 2ASDA 2QW1A 3MGGA 4Q9DA 4MGEA 5AI9A 2HF2A 4ZI3A 1VBKA 5D3ZA 4KLNA 3IURA 1ZK4A 4GZ3A 2HMWA 3DO8A 3FWKA 4MYTA 4R7TA 5HR5A 3KLOA 3DR5A 1JEEA 2X76A 3I6YA 1GZVA 3FDIA 1TIPA 1O1YA 2FJ0A 3MINB 5L3RA 4J9MA 4DQ0A 4BOYA 1NG1A 4MP3A 3NUZA 4MRMB 3UG6A 4JMPA 2ECFA 9ICMA 4XWYA 4KWEA 3TQTA 3QMVA 4YAFA 3CNHA 1USUA 1ZN7A 4DZTA 5DWDA 4P7KA 5BOVA 5BWOA 2F8LA 2VJBA 5CFLA 3KZCA 5A2GA 4CXMA 4B4WA 1K0UA 1E1MA 1OTXA 3EY4A 2JAUA 4V0RA 3WQBA 3RAEC 3HNRA 5F77A 4ARZB 3T9EA 2AR7A 5LWQA 1YIDA 3AHEA 3MG9A 2AA3A 4W7HA 3ZE9A 4YR9A 1P9RA 3GT4A 2ES4A 5G41A 5TS2A 4PYJA 3KJHA 2QIPA 2RK6A 1OAAA 1EINA 1JEQA 3HBAA 2Q6OA 3UJBA 3V8VA 5U9CA 4FGJA 3A6GA 4FYVA 4YVZA 1VLMA 1PX0A 2AUTA 2I6UA 1A69A 2IITA 2WAAA 3J7AC 4NOMA 4OB8A 3F7TA 4BLWA 1H22A 3AL0B 3G9UA 3S2UA 4OUKX 4B9TA 3M2PA 2Q9BA 2IWHA 3BTOA 4AZ3B 1F2UA 2YHUA 3DEAA 3D5QA 4N6OA 3U7RA 4L75A 1NR7A 1XLWA 5T5QA 9ICJA 3P8ZA 1I6WA 4Q48A 2XCRB 1EIZA 4BHTA 4R2LA 1ZD9A 4TVBA 2MCFA 4OMUA 4DS5A 3S28A 2AZTA 2ODPA 5K1ZA 2HHLA 5J8YA 4I2GA 2KYRA 1GCAA 4J1TC 4UOZA 1JN0A 2RJ3A 1US8A 1VJ5A 2BSQA 1FDVA 3T4EA 1NN3A 1BPDA 2ZRNA 3WLAA 1NRXA 1RKQA 3RYFB 4XQGA 5FR1A 1SU4A 1BJKA 4KV9A 3UUWA 4EW1A 4H7HA 5JS1A 2NRXA 4KEAA 1VXRA 3BB4A 2BFOA 2WJ3A 1ZC4A 5CDUA 2I3BA 3AKEA 4OMCA 1S2IA 4DQIA 2V98A 3C5VA 3B9QA 4MUBA 3QYAA 3RS8A 4L0QA 3EXEB 5DB7A 2HU8A 3JZDA 2V1XA 5K8CA 2XGPA 1VIVA 3R5KA 4LMAA 4YJ2F 5FOSA 4DA8A 2YIVX 2EOAA 4MWGA 2GEDA 1NF9A 4F4HA 3ABQB 1IK4A 4AX4A 1A95A 3JZMA 4RQ6A 4AMBA 4CL8A 2OV3A 5KYYA 2EG5A 1FQJA 7ICLA 1MORA 3V4RA 5EIWA 2FFHA 3V42A 4EX7A 2JB9A 1B3BA 1QPZA 4HB0A 1DC5A 1DT3A 3DGFC 1C3JA 3EEIA 5CLJA 1TZKA 4HUJA 1CUUA 2QW0X 4XOUA 1RABA 4DADA 5JH7B 1O9HA 1D6SA 3ABSB 2F64A 1NQXA 3RJKA 2X2EA 4EPRA 1T2UA 4M76B 3ROXA 1HK7A 3GJ3A 4LPSA 5E6RB 3D0OA 3ICWA 4FJ1A 3V7NA 4DS3A 1F2UB 3K1TA 3TACB 4BTLA 4LRSB 1I1QB 5HDBB 2C1XA 1CCWA 1Y3DE 1U04A 3PKIA 3W3AD 3OLVA 3ORRA 3RG2A 3ZTYA 3L6RA 421PA 1ZAYA 4WKGA 1KY4A 2C9MA 3PQ2A 4PN7A 4NEGA 1XXHE 2VTEA 1L0BA 3M9WA 3JVEA 1A27A 3U9TA 2H1OA 3SQMA 1VPDA 3CN7A 3PFIA 1XEXA 1OB5A 5JS6A 4E5YA 3OSNA 2M98A 3I12A 2QJFA 4DSIA 3AEQB 4K9DA 4ZOQI 3FJOA 3PK0A 1JR4A 1LCIA 3E35A 4ENUA 1G1AA 1IFXA 2FEOA 2M9MA 3D7KA 4HRXA 4QOFA 4W5RA 3AL0C 1LPMA 2J9ZB 4HB2A 3T7JA 1CVRA 2I54A 4R9VA 1MJNA 1N5WA 2GRUA 2HJHA 3M6FA 3R3WA 2HFKA 3DKKA 4XIIA 4HGRA 4ZVKA 1M7HA 5C3MA 4WFIA 2ZREA 3G2MA 1XDSA 2YHAA 2R11A 3ZR4B 5DSXA 4U7CA 1JEAA 3I9V6 3LO5A 4D4GA 1LSUA 1J42A 1EEXB 2AQ4A 2J0SA 2XMGA 1Z7WA 2QI9C 2X42A 1BRMA 1N0IA 5DGCA 1KZGB 1ZMTA 2WHYA 1D5CA 3MM4A 3BXFA 1ZQMA 1U3UA 3ICVA 3NTQA 2Q3EA 1XB2A 4HNSA 4JEMA 1FDRA 4G0QA 1MDBA 3D43A 2QY9A 3HJTA 3MPUA 3B60A 4TUYF 2FOXA 1PCXA 2BDTA 2P9QA 3NCHA 2QD2A 2V65A 3DMFA 4H6WA 4DV0B 4W5WA 3U4DA 1HOTA 3BD9A 5I4CA 1JLKA 4RPZA 1ZGZA 2ECQA 3A2NA 3DOUA 3H2ZA 4M9QA 3IUPA 2EARA 2QVXX 1AQYA 4FKZA 1QIDA 2AUNA 4GRAA 7MDHA 2Q6LA 1M66A 2C98A 5TPWB 3DLCA 1ULSA 2F4VB 4DLLA 2XNJA 4DAOA 1DC4A 3OE7D 3C2QA 3PEFA 1NJWA 3PLNA 4HTAA 4UBJA 2GSWA 4V0KA 4V0ME 3T3OA 2C9ZA 3A8TA 3L8HA 1KYXA 1IY1A 5IXSA 4KR7A 4KE7A 1KLNA 1GYPA 2G5CA 2I99A 3QFTA 4JU8A 4NAUA 4YMSA 4BGEA 5JCOC 4I6JA 3DTYA 3EOBI 4V24A 1IVSA 4TMKA 4YEDA 1KSGA 3V3KA 1J9ZA 1I2CA 5AUQA 2ZEJA 7ICFA 1I33A 5EZSA 4KFTA 4HAIA 1DHTA 3H99A 3K7EA 4NV3A 2ZU6A 1UQUA 3G1WA 3C7AA 1MLDA 2J6SA 5DYGA 3JYNA 4ZK2A 4Y2VA 1BIFA 3X1DA 1R6AA 4F4CA 3P9SA 3NRZA 4B84A 3H4TA 4O2AA 1QIGA 3OQNA 2D1QA 4MV1A 4M0CA 2RCYA 2AUMA 1X1AA 2BL4A 4NDZA 5AO9A 5EKXA 2KIWA 2R7LA 4B31A 4CN9A 2PJRA 4UHHA 5BOLA 2VT2A 3GNSA 5MN4A 1JW9B 2AJBA 1TMOA 2IDJA 2YVKA 3HCRA 3TOXA 9GPBA 4MAMA 2HMXA 1JHUA 2HK8A 1G19A 2VDLB 4OKNA 3PDIB 1M8FA 4TV8B 1OAOA 1R0SA 1PS0A 3BGDA 3AHGA 2Z0MA 1UXIA 2ES6A 1IK6A 3KE8A 4KAAA 4Y6SA 4BP9A 2DB3A 1GCIA 2XBLA 2OEPA 2WKPA 3MTBA 1C41A 3GLIA 3P2KA 3L92A 4ZAZA 5HS6A 3BL8A 4BVBA 4EMSA 2ZSIA 5L51A 5LPNA 1I4TD 3QEAZ 3PPXA 1F17A 4MP6A 4UB2A 1CY6A 2QTBA 2VJCA 3GLQA 3OPNA 5LB4A 2BGIA 1UDBA 3F6RA 3G8CA 4PAWA 2COEA 3IT2A 4WOBA 5TQVA 4DCTA 2C7PA 3MLAA 1V5FA 2WIAA 4G1EB 1CJUC 4GUAA 1CT9A 4JIGA 1RXCA 2HQBA 1W1WA 2CXQA 4MVJG 3Q12A 3TMYA 2PD6A 4JJ6A 2RONA 4MR9B 3EZLA 4O1IA 3BWDD 4AO7A 1Y7HA 4XI9A 5F3DA 1JHPA 3CRXA 2E82A 5EP1A 1SU7A 4CMAA 1X86B 2WWTA 2BR0A 4IY1A 1CR2A 1QIIA 5L40A 1C1XA 1QTMA 4KHPB 1DKRA 4PLTA 4OJOA 4GYYA 1S0UA 5EKSA 4MIKA 2B2NA 4R2KA 1AUXA 1KP9A 3UVEA 1I14A 1ZUD1 4HDSB 4HGNA 3TECE 4QVIA 1ECWA 1G2PA 8MHTA 1KC3A 4H1TA 4JJ8A 3VM6A 4RTSA 4BEVA 4GECA 1VFPA 2FUEA 4IS2A 4BO0A 2RHOA 5JZOA 3BZBA 4AROA 3C29A 3U48A 1T2EA 4RMNA 2PKYX 2XUFA 7AT1A 4OBXA 1QZZA 1NW7A 3Q9LA 4QO8A 4QC2A 5FBWB 2WJAA 3F1LA 3DD5A 5KHOC 2RIRA 2PLNA 3KWLA 2GJSA 3LMKA 5HBRA 1PV1A 5F2OA 2WJYA 3HL0A 3KJIA 1IU9A 1PR1A 1N4DA 1T8WA 2A5YB 1WDTA 4PTYA 4R3UC 4ZQEA 4BNKA 1V9CA 2XCIA 2BJHA 3TSAA 1YE5A 5AW2A 3OIUA 1AF4A 1QLHA 1FFGA 4DABA 4YP6A 2AN3A 2W6CX 4KO1S 2AFHB 4CRWB 1H23A 4FQ5A 4A16A 5CXUA 4RTMA 4KGZA 5F73A 3MCZA 1I80A 3U7EB 9ICLA 3ZBUA 4YRSA 1IHPA 4N40A 4OA5A 4Q3OA 5GV8A 1QVAA 2OVBA 5DHAA 4ALMA 2QD3A 4H7DA 3KHLA 4OF4A 4ZYLA 3O7WA 2QN8A 2JARA 1GCGA 2QVLA 1K8XB 221PA 1U81A 2ZRPA 2AMFA 2JEZA 1R0KA 3PRKE 3ZV4A 5I01A 4K0KB 1G8SA 3PR4A 3HADA 4BUZA 5CG1A 2CB0A 1KEEA 3K9BA 1JR6A 1I1NA 1LB2B 4OJMX 3LVFO 4WXMA 4J07A 1BVRA 1R18A 4LYHA 1HFKA 1Y1TA 1TVCA 2IELA 3IMEA 4H1UA 4YQEA 4IRKA 5AVUA 3JS5A 4FFPA 1N7IA 4L50A 3E48A 5J2BA 1JKFA 2ZSUA 2FPPB 1MO3A 4ELTA 3C6BA 3ICXA 8ICCA 3IPXA 4P35A 4S1PA 2C4KA 4UTPA 4X65B 1FSPA 4DM7A 3RUDA 3WGYA 5H7XA 3G6KA 7ICPA 3BZWA 3MELA 4H15A 4V0LA 2ROQA 4IIGA 4DBLC 3V1YA 4Q00A 1BKYA 4ROTA 3KOOA 3TOCA 3HCCA 3WJ1A 2GBFA 2C97A 4JWNA 1LLDA 4LYDA 4IW3B 4MVJF 4BDSA 3LX6A 2VWGA 2Z58A 1BS1A 4EATA 1J7KA 4HADA 2QUKA 2K89A 5LR6A 5DYNA 5GMOA 1BFUA 5A5EA 1PT8A 3AUSA 4M1KA 2NP6A 4KXUA 1OXKB 1S8NA 2NYRA 1C7QA 1FJHA 2E6UX 5DG7A 1QTRA 2ZI4A 3IBTA 3PWSA 3QE2A 9ICIA 1OJLA 2FLNA 1A9ZA 4TXLA 5TGDA 5JJ5A 1DRJA 3EYAA 5BY2A 3OT1B 1N5MA 2AXTU 3RVDA 4Y9TA 3MFQA 2OHOA 3WGLA 2FPMA 4BFLA 4DQPA 3HJEA 4KITB 4DMCA 1A4XA 3IG8A 1Z5ZA 2DX7A 2XODA 3CSDA 1I2AA 2D5IA 4FNMA 4JGBA 1E1RD 1UQVA 1FVXA 2RC6A 4F9EA 4MUXA 2OG1A 3U1VA 1WX1A 4LGVA 2YRFA 4I36A 5AK0A 1I7DA 4DSKA 2Q5JA 5BN1A 3UWOA 1VG0B 1WDLA 2C57A 4JLVA 2ZANA 3B6KA 3TQHA 4ESOA 4MROA 1E4EB 3DAPA 4DEVA 2PVCA 2A3VA 1B0ZA 1J99A 4N82A 1UMBA 4L8LA 4DV2B 1QPBA 1NE2A 3C1YA 4MQEA 5JMWA 3DNPA 1S8AA 4WMLA 1M0WA 4DL4A 3AESA 5TSDA 1DRVA 3QE9Y 1C8KA 4EYEA 4TMVA 5C8DA 1O8CA 2QHXA 4OI4A 3UTCA 4EW2A 5AHOA 5BR1A 2XUPA 5A3VA 3S8EA 1GQQA 4ZCMA 4V02A 3F6EX 4YCBA 1P6QA 2BJVA 3MJDA 4YP9A 2MRLA 1XIVA 1DRGA 2VAWA 1F5NA 4RQTA 3WGZA 4DRZA 3A1EA 4OYYA 3BCUA 2E48A 1BDBA 5C8ZA 3KB8A 4ND7A 1UCFA 3O03A 2J3DA 4V0MA 1SXIA 3TIXB 1KFTA 1OX4A 4MS1B 1Y1KE 2XQVA 1YBHA 2AG0A 3ODGA 1UT8A 5IMSA 2WVAA 3OZWA 2PRSA 2VJPA 2UYHA 2ILVA 8ICVA 3KXLA 5E7QA 3KFXA 3SY8A 1H0RA 2DPYA 3AOEA 5FL7D 2OCIA 2XXAB 5F2KA 3R7SA 4C89A 5KT6A 3FHLA 3W8EA 5IK2D 4UE6A 1QQBA 1R88A 5FBRB 1JR3D 4CZ2A 1HUZA 2XLBA 3UJCA 5KZMB 2HO4A 1DEKA 2HADA 4KC0A 3WB1A 3PEEA 3KVNA 1ZUNA 3AF5A 2Q6KA 5CLQA 2IDZA 2AQIA 3B9BA 4XD7A 3I52A 2OWOA 1E2JA 3BWXA 3KV3O 2IPMA 5J5VA 3GV7B 1ZQTA 1XJWA 4CUKA 2HI0A 5IZ4A 2QTTA 1KEZA 5C81A 1E4EA 4TLCA 1VQ1A 2EX4A 2HLHA 2BHLA 3KKOA 3ZWBA 5IVHA 1DQRA 1XRQA 1XAGA 3QPDA 3LPCA 1NUQA 1RC0A 1VE3A 2HV9A 1T3QA 1HNXB 4JV0A 5JAUA 1YKFA 3LVVA 5EPUA 2D00A 3ZGXA 3O9MA 4NBLA 4R0MA 2AD1A 3DT8A 8ICHA 4BEWA 1DX9A 3E7PA 5B58T 4CVNA 4QZEA 1NA5A 2GDJA 2YX1A 1XVVA 1F0KA 4O4HB 3DLIA 4F7DA 2QUIA 3INRA 3ETRA 1Y5NA 3PPIA 2KN7A 3PE3A 4URWR 2QQ0A 3JXEA 2BBWA 1U1EA 1NY6A 5J2EA 2P9TA 1F9EA 2ZZKA 4H16A 2VC2B 5B6IA 4YUAA 5FWNA 3UCFA 2EC5A 4L5IA 2ODAA 3ISJA 2PE5A 3FD8A 4TV9A 2QP3A 2OHIA 1U7HA 4XJXA 5LA6F 3TUZC 4GT1A 5CH3A 1TCAA 1B0AA 1RXUA 1LKZA 2ZITA 4G24A 5FP0A 4K3UA 4B6EA 3BS7A 4XZ3A 4V38A 1Y1QA 3H4MA 1JL3A 1VZ3A 3GRZA 3W78A 1SZCA 4RTNA 4F2DA 1Y8ZA 4D81A 3H6GA 1NUAA 1O96A 3BA1A 5I9NA 4L9AA 5DLGA 2NIPA 2FW6A 1YUNA 4RU1A 1UDWA 4LZPA 2V0GA 1WUYA 5J8YC 2QUAA 4ODIA 1VJ0A 2AXEA 2PRKA 1AU9A 1COZA 4KLAA 4EPTA 4XWAA 2FPOA 4XRHA 2EFCB 2PMEA 4W1RA 2IY9A 2QTLA 1L8LA 2WZQA 3WAKA 2I87A 5KOYA 1L5YA 2A33A 2O7NA 4X92A 4WKOA 1PW5A 1D3AA 3BG5A 5ALZA 3U4AA 4OV6B 1ZQXA 1G6Q1 5DNWA 1PK7A 1GL7A 1NJGA 1RYUA 8ICAA 5BPFA 3TTUA 1RWMA 1KI8A 5KFXA 1ZONA 1NZJA 2H31A 3NAZA 3HDJA 4OQEA 3G2IA 3B38A 1U8TA 3HUEA 2ZRBA 1PJZA 3B3QA 4IZHA 1TCVA 4DTCA 1TZCA 2O2DA 1LKYA 1H2EA 1ZL2A 1UR5A 3NT4A 1PNVA 2IP4A 4S12A 1ODKA 4RZQA 2PGOA 2QKQA 3AEUA 5A62A 3L7KA 2W2OA 2GAIA 2D0IA 4ENQA 3R8XA 5KDDA 2HLDD 2R1TA 3BJRA 4PCUA 1YS7A 3V00A 4HZIA 1NVFA 4IC9A 2QPTA 2E49A 3VJKA 2IH5A 1C7FA 1Y6ZA 3EGDA 3M4JA 1AQUA 4MGIR 4CF5A 1TA4A 3L1KA 4MO9A 5IJ0B 1M0EA 1GN8A 5TXGA 3PHJA 1O9BA 4C3OB 5J4YA 1XS9D 5ALDA 5JUMA 1RXWA 1NHGA 3DC7A 4QHTA 1ISSA 3IT0A 4G97A 4JXJA 3Q87B 4RVDA 4EB8A 2KFNA 4U7DA 1BGXT 2XMPA 3PGVA 3F5AA 2BCRA 1DEAA 1DIRA 1QGYA 4N12A 4TV9B 4XYEA 4HLQB 2W8ZA 5D2CA 4F06A 4ZD6A 5B7NA 3QYFA 5J2TA 5JPCA 4O25A 1JKJA 3WR5A 2OC9A 1SVIA 1HYBA 3THXA 4BMZA 4RHYA 1JU4A 1UAGA 1ND5A 3DD1A 1CEEA 3ZDAA 1JG3A 4CN8A 1N34B 1ZGHA 3WGNA 2CXPA 5A5GA 1HMPA 3URMA 4F5QA 2CMDA 3ML1A 3Q6IA 1H3NA 3NV7A 3TAQA 2AD5A 1NI3A 1KAGA 2KBEA 2R5WA 4L73A 1MFZA 3ITEA 4MCAA 3EGXB 2Q5FA 4PTLA 4UHEA 4BNHA 1MA3A 2W4IA 1PD1A 1KW4A 1VB3A 1ZUIA 3COPA 2YINC 4D5EA 4O2BF 3LA6A 4J0GA 3WFIA 4XJSA 4JCCA 1FPMA 3T0GA 2Z8YM 5K3BA 2AQKA 4PZCA 2I71A 3T7CA 5K03A 4DLZA 5KNCD 1SKWA 4WOPA 5AVVA 3QHPA 2YXDA 4BWFB 4H7EA 3OECA 5EYPA 1LFAA 1EWRA 1IEVA 621PA 5EOZA 2I4MA 4IYRA 5JAZA 1M34B 5DN6A 2XNCA 5E9QA 2FG6C 3FVQA 2Q4BA 4Q44A 1S4QA 2GEFA 5B5EU 3NOXA 2W9CA 3EYZA 3SV3A 2IGTA 2EJUA 2ZCVA 2J87A 5BXYA 1T9CA 1VIYA 1L5WA 2XX3A 3IUQA 1Y3BE 3BMOB 4LDAA 3SQLA 3ILVA 4BZQA 4LZNA 1SL2A 5HX7A 1EQAA 1ZSNA 3BWYA 1EFPA 5FQNA 4C04A 4RVCA 4KQCA 2WIGA 3WJAA 3DV0B 1TZ2A 2BH9A 4N3CA 3TRJA 3QLEA 3HC7A 1NR1A 5EJ2A 4A73A 4C0HA 1KK2A 1U3GA 1GNPA 1T3GA 1E3IA 4TYQA 4HEA1 3V1MA 5CWRA 2VWPA 2HPAA 4UB3A 2DKXA 1E3JA 5KWSA 1Y3IA 1ZN8A 4WRRA 2D54A 3HGMA 1NRWA 4JV2A 4KMOB 1ZCZA 2QPOA 3HDGA 1I6LA 1RZ3A 4H77A 4B3IA 2FYTA 5BWBA 5JYCA 4DR2B 4KLDA 7REQA 4LF6B 3EPJA 3CT4A 2VT6A 4MWTA 4RLSA 3MOIA 4LV6A 3RABA 5LLTA 3MDCA 4NTZA 3ZZUA 5B7QA 1GRVA 1KAEA 1V1MA 1Z38A 2FNAA 2NUAB 5KQRA 4NRDA 2P4SA 2CLKB 1TCBA 4K8OA 2RGAA 2CVQA 3FY4A 4IJVA 5IZCA 5KB3A 3KETA 2R8PA 4DQKA 4BPRA 4DLUA 3AK4A 3C8DA 1Y1PA 3IBSA 3IE0A 3TH5A 2Q9UA 5F9FA 1JB1A 3LX5A 2QRPA 3W5UA 4YT8A 3H2GA 2Z56A 1YVRA 1DCTA 4WNCA 5B1YA 3I4FA 4XX0B 1MC8A 1TYCA 3GZJA 3F3MA 4KVFA 1NQAO 2VJAA 4Q1AA 5LYJF 3G89A 1Q17A 3NC0C 1UFKA 1PR0A 1TE2A 1S76D 1LK0A 1PK8A 2X0FA 4H7IA 1VHJA 1WWKA 1BE6A 1NPDA 5EMKA 4IH1A 4ZKEA 5HCNA 5KYVA 3LXMA 2WUFA 2B5VA 2QG6A 2WE8A 4WJLA 4UZSA 5A3QA 1J2EA 2AU0A 1F3LA 2ZRMA 5EAIA 2EF1A 4Q3CA 4BJ5A 1E0KA 2YMMA 1J20A 1LGYA 1IEQA 3GLUA 4EBBA 1ODSA 4DCPA 2G67A 1HQDA 4S2EA 3PJFA 2Q4OA 3AOGA 3NWJA 4LGYA 1ORDA 3C24A 1T3NA 3RVKA 4MJ3A 3KFVA 2JBAA 4MUJA 1ULBA 1UFOA 1ML3A 4L85A 5KTOA 1XTJA 1H8EA 4KK3A 2JFGA 2GYVA 3KU4A 3ZU5A 5D4BA 1XBTA 2CYCA 1UZLA 1W88B 3EPPA 1YOBA 3MJRA 1CPYA 3EXHC 3T3IA 3V8PA 1S0OA 2JFYA 1VLBA 2BQUA 3ONFA 1WRBA 3DF7A 9ICKA 1X77A 2PLAA 2RHHA 1S3IA 3LUJA 5KFVA 3QXSA 5GTIU 3IJPA 1HGXA 1EHIA 5GINE 4TN1A 1Y7TA 4I3HA 4ED3A 2E18A 3EFHA 3MJEA 3BL5A 1QTIA 4CTMA 1E6MA 4DDVA 3LK9A 1OW3B 2PBZA 1WHTB 3ANYB 3Q41A 4QU9A 1QC5B 5A4AA 3QUBA 1B3RA 2R1UA 2ZUCA 1BJTA 3M4YA 1N48A 2EJWA 4NBWA 3V4ZA 3ZXSA 4F6RB 5HS4A 3C28A 1NVVQ 4IV5A 1XQ9A 3EIQA 4MMYB 4KPEC 5K99A 4F6CA 1BEZA 1EPUA 1GNQA 1ZIPA 2UZAA 3DMTA 3MTAA 3MT8A 1ODTC 2ZJ8A 1H9AA 4ZEMA 1RE0A 3HVJA 5ALJA 4L8VA 1N92A 5KCMA 1QHNA 2VP9A 4O2BB 1DAHA 3TNLA 5AIBA 4JLKA 5IC5A 1EE9A 4IFEA 5ENVA 3T38A 2WYHA 1SC3A 4RVHA 5LNK1 4P1ZA 1EUCB 1SCUB 3D5TA 4ED2A 4H6XA 2R7KA 2V5VA 4GXRA 2NUPB 4FCCA 2P4QA 3WJ7A 2DUYA 1MABA 1Y37A 1L7BA 1SELA 4FDLA 4MUEA 4OUDA 4M9CA 4C22A 3LWZA 2IXBA 1SOVA 1A72A 2B4QA 3QLJA 3DAFA 3HYNA 1MEJA 3NRBA 3RAGA 1DC8A 4LX0A 3ILSA 1ACMA 1E9BA 3QMPA 1EWQA 1AQ6A 3VPAA 4AKIA 1ANKA 4AS3A 4JEIA 1WVMA 3O4RA 5JVDF 1GA4A 1K9SA 1QNFA 4RDXA 1H85A 4ZKDA 1N78A 3LAWA 3Q7TA 4DQUA 2QEQA 4U6QA 3I5YA 1TYAE 2VUTA 2JLUA 4HN9A 1OF1A 4OHXA 3OG9A 4OO3A 1QP0A 1GAXA 2GCIA 3E9MA 3SNHA 2GKGA 3DEKA 3QJYA 4K6FA 4ENPA 2H4WA 4Q3LA 1A6SA 2NXCA 2JH7A 2H17A 1QFJA 1E18A 1MDFA 1EFDN 1ZMXA 2Q4RA 1KHTA 3JQAD 1RG6A 3A0BU 1C5KA 2QD1A 3C16C 3FCEA 4FN5A 3GF4A 3HJFA 1MV8A 5CLFA 3KQMA 3MJFA 3K0CC 4NIMA 1V96A 1WHTA 3DPUA 1LRLA 4E5KA 1E5QA 1DKNA 2YYAA 3L0ZA 3UJ3X 1DJPA 2CYAA 2R47A 4CCWA 1BDHA 1Z88A 3T52A 2J3JA 2FUG1 3UAVA 4KRGA 3N0XA 1TW2A 1D4ZA 3B89A 4YRRA 1OI4A 2B2CA 1AQJA 3VJMA 4ZMRA 3C5WP 3HPRA 3OESA 2BGJA 2IK8A 4R2JA 3L40A 1DXHA 4WNAA 1N62A 1KU0A 5JATA 5B2ZA 3U4GA 3CURA 4ZAVA 5A9SA 1NVXQ 1RFGE 4ILEA 2FCRA 4INJA 2W2XA 5JPIA 3TZQA 1ZH6A 2DWUA 3V4OA 5I7FA 1HDEA 2C2OA 2IYZA 4LZWA 4RZIA 1OBHA 1UUFA 1GTG1 2W6OA 4CNBA 1KIAA 2CNDA 1H93A 5J59A 5LIPA 2A19A 1N2JA 4D46A 1TKAA 2JD2A 4HJXA 5LMNB 3PUZA 2QRZA 1RAHA 3QWFA 2VUUA 4BBPA 1U8ZA 4Q24A 4QGFA 1ZD4A 1GGHA 1N5OX 1NIJA 1ZMBA 5EIEA 4FYYA 3HJHA 2QRVA 2PCLA 2ZXIA 3A6LA 3N53A 4H7JA 3IP3A 4OQZA 3N59A 3GJXC 2C4VA 2CVZA 3M4ZA 3N5CA 3PU6A 3RVQA 3TR5A 4MYCA 3DKIA 4UATA 3THRA 1D2AA 5DN9A 3H19A 4PHPA 5KG0A 1Q91A 3N6XA 1XK7A 1FX1A 5KFIA 2A92A 4FHCA 4IIBA 3GEEA 1WPRA 3QNMA 2XCLA 2PMWB 3T5HA 5AI5A 3UHJA 1JEYA 1M0SA 5KFHA 3HYLA 4LHWA 1SCQA 4TKMA 3S3TA 2H29A 1TC1A 2FZGA 1MTOA 2OHGA 3Q5DA 4OSOA 4ZRMA 3O8DA 4MEYA 1T1IA 2OCBA 1C7JA 4C7OB 1GUZA 1Q12A 4FEEA 3KJQA 1F0MA 3ESAA 4E30A 1NNI1 4D7AA 2PKRA 2HFJA 2DLNA 1L7AA 4NABA 4W99A 4CDRA 5AVRA 1E3SA 1RCUA 1UBLS 3HCOA 3SXPA 4GSKA 2PQ0A 3P9QA 3SF0A 1XZKA 4YRLA 1XCMA 2OD2A 1WHSA 3HB9A 2OWDA 2J08A 4I5EA 1XWIA 1KQGA 5AOCA 5TNXA 1O54A 3FSRA 2Q4TA 4HNVA 1YS2X 3V8RA 4TRMA 2RHMA 4NENA 4C9BA 4YDRA 1J2UA 2D6FC 2CB9A 2HGSA 3QOFA 2YWGA 5KPDA 3GLGE 1T2CA 5HHHA 2GA9A 2HRRA 1E0SA 2WUWE 1YE8A 2H65A 3DFKA 4KXNA 3OC6A 3QBVA 1HFEL 4UVDA 4PZNA 1SZPA 2C2HA 3DFMA 3PX3A 4W4TA 8ICIA 5HJ7A 4JJ4A 4G4SP 1PGOA 1AXEA 2JDIA 3PV8A 5EEHA 1QF6A 2EX0A 2G71A 4P4MA 1YH3A 2GN6A 2VF8A 3FMGA 4R65A 3LT1A 1GAQA 1G8JA 3TTWA 5KAPA 1L4BA 4EB0A 4EVQA 1HO3A 1L1QA 3AJEA 5L1MA 1NVWQ 4BGIA 4KN8A 3RM3A 1OH6A 1H4QA 1Z4LA 3UA3A 4WZAE 1N7HA 2CSUA 3TW8B 4OBBA 5KFMA 1VLLA 1CYEA 4KQ9A 1ZSVA 1X94A 3ZIAD 2JFHA 5I7AA 3H1EA 4CYMA 1OBCA 1IN4A 2AOVA 2O52A 2Q1UA 3H9UA 5DP1A 5CB4F 1ZXIA 1Y48E 2VLBA 1USVA 5C1OA 2WQ6A 1VIDA 4GKAA 4Q16A 5THQA 2B1IA 3BGVA 3SZ3A 1HC7A 3DVRX 4I46A 3RRFA 4FCWA 1E7WA 1NXVA 1MXFA 1S3FA 2WOOA 1ZQJA 1JHOA 2R0QC 3GLSA 5BSMA 2JH9A 2P2DA 2H11A 1Q0UA 2NLOA 2VXCA 3ITKA 1S0VA 5FPSA 3L7YA 4DWJA 4IGAA 4J9NA 4R68A 2JLXA 4JNKA 4L15A 3GEBA 2R8EA 1P62B 4LI0A 3GARA 5BW5A 1TOAA 4UNIA 1YUMA 1JKXA 2OKGA 2WJIA 3B5IA 3M6UA 4LJ8A 4Q0MA 3UZUA 4AUEA 2ZIWA 5JDIA 4AQYB 1T26A 2BUCA 4ECTA 1ECGA 1K5OA 3BMXA 1ISIA 3W05A 1E60A 1VL5A 4MWDA 1TK5A 1AGYA 1RLOA 4YY3B 1MIHA 1JHQA 1AM4D 3ZI0A 4CQNA 2WTEA 1YB2A 4N5HX 4YAWA 4DL9A 4CCSA 4OQDA 1DSSG 3EQ7A 3EK2A 4LDJA 2QE7D 1ORRA 3NMUF 3PO4A 1EXDA 4F71A 3ZCRA 4Q66C 1NHWA 1KN5A 2YHSA 3KHUA 4QYWA 5CB4B 3R5FA 3W5DA 3EWAA 1XK6A 3SEQA 5AM1A 3RH6A 2G36A 1KRWA 2V5AA 3VR3A 1I32A 1ED1A 4JGGA 4RJLA 5EZYF 3WFZA 2GK3A 4NY1A 4YJHB 4KPGA 1GNRA 3KR2A 3DB1A 5ISMA 1N2OA 1UJ6A 2PWBA 4WY2A 3WIEA 2QQ5A 2F1IA 2A5JA 2ADMA 1BN7A 4QOHA 3ZK7A 1C9KA 2WFMA 3UMFA 4UAWA 4HNTA 1A98A 3QXCA 5EXSA 4KXWA 3FUWA 1JLSA 2XC9A 1O58A 3PCRB 2JGAA 3RYHA 1SXJD 1KDHA 5ALEA 1EDOA 3HV0A 3IEIA 4ARVA 3VSDA 4EABA 2P65A 1QG4A 2KI5A 1OPXA 5BT9A 4ED1A 1T8RA 3IEPA 4F3CA 1DKPA 2IY8A 3C8UA 2HUPA 3K70B 4RFLA 1XVLA 5E6SB 5AK3A 1IPEA 4R2XA 1IG0A 1I0LA 3O4GA 4RQ4A 5AXDA 3ZDZB 5I4IA 2HO5A 1LC3A 4JQSA 1TYDE 2G1AA 2XZDA 3Q2IA 5H16A 4UFNA 2OO5C 4EJ2A 1QO0A 2P90A 5C5IA 3DV9A 1N1DA 2BAGA 5T7BA 4UAYA 3K35A 1P2FA 2DHEA 3T95A 4L1KA 4A8JA 4EPYA 2EZTA 1J4AA 4YMMA 2FKNA 3IEVA 1A82A 1LLQA 2NVUA 2GUGA 5FULA 1KPIA 1TTHA 2HK6A 1M83A 3X2FA 4C87A 1QSGA 1VRCA 1DL5A 4B4VA 4EG0A 4RGQA 1SPXA 3QY9A 3QUSA 4AQ7A 5CEFA 1U47A 1FP4A 2PMBA 4G01B 4RHFA 4RFSB 3TKLA 2BELA 2C5FA 1FTWA 2JGLA 1FL9A 4NVRA 4OI1A 3THOA 4EYOA 1OZHA 1Z1VA 5BPCA 4HF7A 4IF4A 4CT5A 3FX2A 2WIBA 4X1IA 5HTOA 1NRJB 2NU8A 4Z6CA 2JMGA 3ZDDA 2XB6A 5EJIA 3NG1A 2DBVO 1VJCA 5CJJA 4JVMA 1DOHA 4EA9A 4R98A 4XJVA 1BCSB 1DV2A 4R9RA 2NRTA 3CJTA 4CL3A 3HJBA 3DFFA 1YD7A 2BMAA 5IDWA 3A14A 4ELUA 1EKXA 1JDJA 1WABA 5ED4A 1UMKA 1ONBA 9ICRA 5DB9A 1GSAA 4RQBA 3B48A 2JHAA 1PT7A 4Y6RA 5DTQA 4TKUB 3VSBA 3CVWA 3OQ6A 2V4ZA 1UZNA 3MT9A 1Z3IX 3OPVA 4G56A 3V6JA 5KNIA 1RVDA 1K06A 2VDKB 4Z3DA 1UPFA 3EZYA 1OPRA 3OTQA 2NTYC 3FN4A 2IHZA 3PC8A 1DO2A 2I9GA 4Q9HA 5CXQA 4IDAA 2LGJA 2WIJA 4A23A 1JECA 3AJ9A 2G5PA 2K2WA 2J33A 4FW8A 2WF7A 4L8WB 3QKTA 3GRKA 4A8JB 4EP1A 3R6DA 1TK0A 1VKNA 1E1YA 1FYFA 3KB2A 5L53A 2ET6A 2OGWA 2ZYHA 4RSGA 1C0PA 4GBJA 4M99A 4CT0A 5I5EA 1LV7A 3AVXA 3BMNB 4K81B 3RBVA 4FFSA 3TUIC 3CVYA 1KRPA 4GDMA 1HM5A 3AM4A 5EWEA 1FW8A 3MD0A 1P75A 3FVWA 3HDHA 4MB6A 5K8UA 2FMPA 3I04M 3R0JA 2H18A 3AIKA 4CIDA 1RFLA 5KAIU 4RFSA 4RSRA 1XX6A 4I99A 5IN4A 5JFTA 2WM8A 1BKDR 4FDMA 2JEYA 4PZAA 1OX6A 1YGYA 1PUZA 1KGSA 4P0PB 4L8FA 2IIPA 3NWEA 5J0UA 2HVHA 1U2DC 4MQ6A 2B8EA 2QVZX 1BVHA 1GTJ1 2X5KO 1QK4A 1CUFA 1L7XA 3GVXA 2I1WA 4QZBA 3BDIA 2FZLA 2FMXA 5JU5A 2Z6UA 2FSUA 5IILA 4HTFA 1VKRA 1NW5A 2ZRQA 1A96A 1DMRA 4C6SA 1YFKA 2B61A 4RUCA 2R68A 4TTAA 4BGDA 5EKTA 1B76A 3CZCA 3QG1A 4KBGA 4PR0A 2CHGA 4P0QB 4U7JA 1WB5A 5JMTA 3HO1A 1OI3A 1W4ZA 2ZCUA 1PLLA 4X7MA 3CZQA 2P5SA 2F8KA 1V7ZA 4F4KA 3IAFA 3MSCA 4XM2A 3WGHA 4ENRA 4RTQA 3VA7A 3L6BA 1W30A 1YA8A 5HKLA 2VSOA 2G25A 4QBHA 1OH7A 4KQJA 4BLRA 4EHAA 1SD2A 2QUBA 4RGBA 2IH2A 3HEBA 4X5OA 5L4NA 1Y8QB 5JJLA 7ABPA 4Y2YA 4FWTA 2A0FA 4NPHA 3PW4A 1K4MA 8ICPA 4PHFA 4D0GA 4PS1A 4DJFC 3G6WA 1AZSC 1HXHA 5TISU 4FEGA 1WA5A 3QOWA 3TO5A 1VI2A 3CO0S 3WWZA 5LU9A 1ADBA 1S2LA 2KE7A 2F9MA 4TTJA 2Z6VA 5TV2A 2PMFA 2EDAA 3WA6A 4KE9A 4QE3A 2H08A 4HGQA 3U7IA 4CU5A 1JTFA 3M70A 4H08A 2C61A 2ZTLA 3FPSA 3MWLA 3V5NA 3II6X 4J03A 3B1JA 3OX3A 2OPHA 3TD6A 3TLJA 3H5NA 3TQCA 2J7KA 3I2KA 4NI5A 3QU5A 1HUQA 1W5EA 2XPCA 4TSFA 3S1SA 1HYHA 4ZYXA 5KTYA 5DRYA 2RGBA 3D8NA 4R0VA 4A2PA 4Z4QA 2E5FA 1G59A 4MV8A 3B3AA 4B2YA 1JHXA 2YW2A 3CRVA 3OA2A 1AKEA 2RH4A 3DBIA 3O95A 4ZOLB 4YWHA 1ZJWA 3FCOA 1XSPA 3P9IA 3EZFA 4HAVA 3ISBA 4UAVA 4HQNA 1HEYA 2ORVA 3J81j 3OX1A 5DJ5A 2VA3A 4RZUA 1DAGA 2OB2A 3O92A 1KDRA 1DU4A 3F6SA 2Z9BA 3ZGNA 3T3DA 4IIJF 5KYKA 1NKVA 5D51S 4RYDA 3S2ZA 3LXUX 3ZQUA 5T8KA 3PT5A 1KS9A 1IY0A 3HZHA 5AOBA 5B30A 4HRAA 2C4HA 1QYXA 2VJMA 3FJ1A 5DX8A 1Q3KA 4EJMA 4QFMA 1F6WA 2N1BA 5BSUA 1GAWA 4TLAA 3AL3A 5E4FA 3TGPA 3JQ8A 4N0PA 1OXSC 2FPIA 3EARA 3EXIB 5EUQB 3HVRA 1DFIA 4FMDF 4B79A 3EFOB 2KMLA 1NMEA 2WFZA 5ANRB 2HX1A 2CLSA 2W5UA 1EJBA 4FI3F 1SGWA 1Y6RA 2FQYA 2AJCA 1YRQA 1B16A 2EHDA 4XPZA 4RQ5A 2B4RO 2DFVA 4DJ5X 9ICXA 3I58A 4WCVA 4UUBA 3UKOA 3UW1A 1THZA 1AHIA 1C0LA 3A06A 3GEMA 3HYTA 3QW4B 3VO8A 3GDXA 1NBMD 1WW2A 2X1LA 4IJQA 3ND7A 3QM1A 2YB1A 2J9FB 5B1DA 1RXSA 3KIPA 2V8BA 3SN6A 4JLMA 3L07A 1Z29A 3VVCA 4EENA 3HUFA 4AG3A 1T0UA 5E95A 2N42A 5B1IA 2PSJA 1ZQKA 4J9PA 3C85A 4ZQBA 1YZKA 2QRHA 3Q8QB 2AJTA 3ESCA 4M53A 4KLUA 4MKHA 4UAGA 4KG7A 4UXHA 5B37A 4AJNA 4EI9A 4F93B 1TM3E 2H1CA 1KFKB 3MB8A 4PFSA 4OXYA 2XIDA 4REQB 3Q8RB 3M6LA 4FZ5A 4K6KA 3H6HA 4KPUB 5DMHA 3I1JA 3B6ZA 4FZ3A 2R6FA 1IBRA 1P1BA 5H8WA 1ZL0A 2X1VA 1WUDA 3GV0A 2BEUB 2ECOA 3DLTA 3LGAA 1DQSA 4N7JA 5IKOA 2PK3A 5C8YA 3AHCA 4EVRA 3VR0A 1TM7E 2GBLA 3DZCA 1QVZA 5HA5A 1WKVA 2AGVA 2OK8A 3OLQA 1Q0TA 3TAXA 3CNNA 3SEIA 4C7XA 3OJOA 3EVAA 3WVNA 1Z17A 3E61A 3VZBA 3QI2A 3TEJA 4Y2UA 3VR4A 5AXBA 4DFKA 1Q44A 4BMPB 2OZKA 4IFIA 8ICGA 5M3BA 4KN7A 1BVYF 2ORYA 1P1JA 1S2OA 3F97A 5EVJA 3AU9A 5EJ5A 1PGQA 2ANCA 4FHDA 1BYIA 1KQOA 3U40A 5IT0A 2X4IA 2W37A 1N61A 9ICEA 2Y77A 4BCDA 3IPRA 4Y6LA 1WG8A 1XQYA 4FC6A 2FJUA 5U1PA 5JU6A 2HRQA 3GFPA 1B43A 3A0UA 3R44A 5U4QA 4B9EA 4G1FA 4H3HB 5D6OA 1I4DD 3R76A 1ZESA 2HV8A 4NJMB 1MVLA 1TGVA 1EFVB 1ZIOA 2FJ6A 1S10A 1R66A 1XVTA 4JR0A 4K6HA 4GOND 4AZ3A 2AKAB 3A4MA 4IOMA 4DRYA 5C2JB 3Q7SA 1GQRA 4OAPA 4B48A 5KVQA 3OAAD 3VHXB 4D45A 3GAMA 3I5AA 1F06A 1TB4A 4FBLA 4TS1A 5MFPA 5SYAA 3RH4A 4CIBA 1U1IA 2GBLC 2EU8A 2P30A 3T34A 3S40A 1SCJA 5LZ2A 1E8NA 2OQ2A 4P5PA 1KEKA 4HC4A 4M7WA 1ZLXA 2BRUA 2QTVB 1IUPA 3KXDA 1T34A 3PI6A 1KIMA 5B58C 5LLDA 3TFRA 2IOFK 2HPVA 2WHPA 2FE1A 3BE5A 3CW8X 5C8YB 1R3DA 5IHPA 5JSUA 4HT3B 5KOHB 3H11A 4BIMA 1V8ZA 5JQGF 2RGNA 4N5MA 2Q99A 3A3NA 4FZLA 3HBFA 3KAPA 3D2SA 2ZBUA 3O2SB 5EZ6B 4CKCB 2WD7A 3NBKA 5FWXB 4AKGA 2HBJA 3K4GA 2F1JA 1JLHA 2JA2A 3IILA 1XCBA 4B9AA 4ARIA 1KL9A 3K1AB 2RKBA 4ZAYA 4B3XA 1UFRA 1QXSA 2MU2A 1NJ6A 2DFPA 2W2MA 3OOYA 1RKXA 5BW6B 3WDLA 3ZX5A 2BI4A 3IT1A 5IM4A 4FYJA 1XO0A 1JIJA 1SM4A 4V03A 1GU0A 3CCBA 2EKZA 1LS1A 1U7WA 3KO8A 4GM4A 4RAOA 5M7EA 5GONB 2VP4A 3G2HA 3P0FA 5TARA 4DQDA 3KDPA 1H0KA 4TM8A 4KGXA 3OZVA 4HX5A 1T8UA 1TK2A 3NLLA 4BKPA 1NJ8A 3RFXA 4EM6A 4QBFA 2ZATA 1KFSA 1ZQLA 3VPXA 1EUZA 1F4LA 4L02A 2B4KA 2GA8A 5P8WA 5T6BA 1WV1A 2GEUA 4HV4A 2XUDA 3UK0A 1D6MA 1KTVA 1NX9A 3L04A 4FHGA 4ZCQA 3VVLA 3W6ZA 3R41A 2Z8ZA 2AKEA 2K4EA 4N18A 3ZV5A 5EHNA 2QLMA 3RT9A 3QHAA 1OU0A 4U9IS 4AJ1A 2M6SA 1JWAB 1JSRA 4X45A 3UCEA 4DIBA 5KYUB 1GHTA 1MW8X 4HYYA 5DEOA 1ITZA 4IV0A 7ICKA 5EWMB 5JAPA 1ZZEA 3MMNA 4IIHA 4OHZA 4G8BA 3PP8A 2ZB4A 3NTOA 4PL1A 4E15A 4OI0A 4YMIA 4NULA 2J6TA 3PYXA 1FUYB 2HPZA 2ID7A 2Y0BA 4WSOA 5J2DA 3OTOB 3A05A 2NRVA 2EATA 3H0CA 3ILXA 1U0TA 4S35A 4U9UA 2VRNA 1QHGA 3BYZA 4ALLA 4HATA 3R5XA 4F6LA 4N3NA 1XKTA 5IBRA 5IT9A 1E9RA 1GSHA 3ZYCA 4D4MA 5ITZB 2JS7A 2NSYA 5GWXA 1IJKA 1H3FA 3PUJA 1SUBA 2WVJA 2XQJA 4X8OA 3PGJA 4DOMA 1CEZA 1CQJB 2Z2ZA 1AB6A 4PRLA 2IPNA 2E3JA 3FPKA 1O03A 2M32A 3WXBA 2VQEB 1XC7A 4RGYA 4TKZA 1NVTA 1XTTA 3GFBA 3NHAA 1RLMA 5ALPA 1UH5A 1N7JA 4B81A 1N2CE 2OUKA 1UMDA 4DQVA 3OFND 2O0JA 4QGHA 2ZYTX 1SUWA 5J4HA 3KL4A 2YHBA 3UXEA 4BNNA 3ADBA 2GEBA 1U90A 2VBCA 3JASB 4MEXA 3LT2A 2HF7A 2LHTA 1CQPA 3Q72A 3R4VA 4XVQA 3NWPA 1UT5A 3WWOA 2JLSA 2HSWA 2O5CA 1BDJA 5DI3B 3VHRA 2XDWA 3RSSA 2D1FA 4XW2A 5DLDA 2GN2A 2OCYC 4GX5A 3Q7PA 3E58A 2OM2A 2B1RA 2GVZC 2VL7A 3TQQA 1VHQA 2ZIEA 1Q84A 2IUUA 4RPCA 3PR1A 4RCVA 1CDEA 2ATXA 4WXPA 1UF9A 2KLBA 1VG1A 5ARDA 4MDEA 2UUOA 3TIGA 1C3EA 1PO7A 3VU3A 2ZI7A 2HJ9A 3Q88A 4LG1A 2QMOA 2IU6A 2RGYA 3PIIA 4JBGA 1YA6A 3W5JA 1O95C 1U02A 4EG5A 2ZR9A 1AMOA 1YVEI 3CF6R 5B5SA 1QNLA 1TAHA 1XTRA 3PNBA 1GPUA 2VA8A 2XUGA 3L8YA 5CH8A 2V3CC 3ZWNA 4ZVMA 2I5HA 4M9ZA 2BDEA 3B13B 2ZR0A 5F1OA 2Q45A 1KMCA 3TVTA 3WZ2A 5DCLA 5FWDA 1JSXA 2C92A 4G67A 4NXMB 5JCXA 1XYGA 2QROA 4RPXA 2ZJ1A 3JR3A 4L5BA 4ZOCA 5M5BA 3RH0A 1ZH8A 3BDVA 3FAHA 2VF5X 1X6JA 2QXYA 1M2NA 3C5GA 2SKDA 4QQNA 1KQFA 3GJ0A 3UJ7A 1G5RA 3EIWA 5JHHB 1VZ2A 2DU8A 2JIZA 5JEEA 3U5ZB 1RTKA 3ISTA 4QYTA 2YFYA 2K8BB 1Z5UA 4OYLA 3NX4A 4QZVA 2ZETA 4JA0A 4CLOB 3GLFE 4RE5A 5AP9A 2BE9A 1PZHA 5CJPA 3NHLA 3BEOA 3OX2A 3JPRA 2RP5A 4LFAB 5F9MA 3L8DA 3IEUA 1DTWB 4RXTA 1QJ4A 2X0NA 2Q5IA 3T9DA 4IR7A 2FZVA 2FKAA 4FR0A 5DSTA 5IH3A 2FB9A 5A4MS 3ITDA 3CNQS 1SUCA 2ZIXB 1VL6A 1Q6YA 3ZZ1A 3AUAA 2H9AA 4OQ4A 4MWBA 1M0TA 1VLQA 2RAFA 2CDBA 2WYVA 1B8UA 2FPRA 2ZTVA 2VFAA 5KWVA 4HWGA 2VOEA 3W2HA 2BSAA 1ODIA 1UDRA 3BCRA 1RNLA 5F5XA 4MVJP 1P72A 3AW8A 1T6ZA 3HI6A 2ZWOA 3GUYA 3LUDA 3LUKA 4PLYA 2EYQA 2AS0A 2LCQA 4BO9A 3J81k 3I5XA 2DHCA 5K0EA 2EXXA 1CZKA 1GPYA 4QDXA 2V9PA 5LLSA 1AZTA 3I39X 2RIPA 4OREX 5SV2A 4Q4JB 3M6ZA 3M8KA 4YO7A 5AW7A 1ONPA 1K5DA 1JFTA 4Q3NA 2AZXA 1M6EX 1U1GA 2EW1A 2DSNA 3PQ6A 3RO7A 2EJBA 2PA0A 3WGMA 3WLNA 1JQKA 3ZGVA 4JITA 3LL7A 5DYWA 1U7XA 2EFDB 3AP2A 3KS9A 3B6MA 1JXMA 3H75A 5GJCA 4POOA 3MGAA 4ZXFA 3SC2B 3EQ9A 1XCGB 4X91A 2R25B 5DNYB 3HP6A 2YWBA 4AIIA 2PPLA 5LWHA 3GRRA 3HVUA 2DL0A 1DELA 5AJHA 5FA8A 2BCVA 2BGWA 4FDAA 1L1FA 3BB3A 4K9KA 2ZI5A 3A4LA 5I9BA 4Z7QB 3HCWA 3HSSA 3PFGA 1XJQA 1UIMA 1YZLA 4F3TA 1G291 3ROGA 4EY7A 4NLZA 3LUCA 1CKEA 2X7JA 3JW8A 4GLOA 2H2DA 1G5HA 1XAHA 3KZNA 4BQPA 1NRIA 4N54A 1CETA 1O5TA 4J9QA 1XWWA 3FYCA 3WNCA 4EIWA 1RRMA 1A7JA 5G0VA 1M34E 3NNSA 2M1XA 1BAPA 2V0NA 4HPXB 3RSFA 4TYNA 2I2BA 1BHSA 1IWOA 4QUBA 4G1CA 4II2A 3RS5A 3EC1A 1EWVA 4ZGWA 3EG9A 4QL3A 3EUB2 1KYYA 3KQHA 2RJNA 3AR2A 2R8HA 3CZPA 3EJWA 3IQIX 3NEYA 5ESDA 4KH0A 5WRFA 4Y6GB 3TVDA 2I22A 3PMLA 2YVAA 3OZCA 1MB2A 1L6RA 5AJVB 3K5HA 4IIVA 5KYXB 5CP8A 2VVTA 1QFYA 4JJFA 4BWJA 1G6KA 1XMVA 3FWHA 4OPMA 2FR8C 2SICE 1Y7LA 2BEVB 4ZREA 3TQIA 3W8DA 4E46A 5IIKA 2D3WA 5PGMA 4ZTUB 3D4IA 3HVIA 3RTVA 2K2QB 3BD7A 3OD5A 5D87A 1E2EA 4MUAA 5HQ3A 2HMVA 4B4UA 3EH1A 3H0LB 5DBIA 5EJGA 2D7JA 1T2VA 4DR3B 1VYUA 1WUTA 1KBQA 1P0FA 3EC2A 5SZIA 1GLGA 1DQYA 3R6WA 4X54A 2WLTA 3G0DA 4XDYA 1Z13A 2G1UA 1A7AA 2D6FA 3CXRA 3FYUB 4ZOAA 3DZHA 4MV0A 5K4AA 3CRZA 1I01A 2GNOA 4RDHA 2QRJA 3OJWA 4JT2A 2VHUA 5EMJA 4ON9A 3TZ6A 5L1IA 1R6BX 3CT6A 1XZPA 2XY5A 3EBPA 5A4DA 1CBUA 2WT9A 2WNIA 1VDVA 1ECCA 5DM2A 1NNLA 4AQDA 3D6HA 3AY3A 5EE3A 4JB2A 4P32A 1JQJC 5C5CA 2O8EA 3FH0A 1M2VA 2OH2A 5IF9A 2IA6A 3SNKA 2B25A 2LBOA 5FEMA 2Y93A 1KJZA 2BHNA 1FA9A 2VJYA 2QX8A 1DRUA 2DKZA 1OGIA 3OFNA 4DIEA 3MYRA 1U9YA 1XXLA 1BEUB 1EAMA 2XMDA 4I7EA 2WMDA 4NBTA 2XLCA 4X8HA 2DLDA 4EGJA 2WY2D 3FDFA 3FPGA 3DV2A 3VPHA 2E2WA 4ITUA 2RQ5A 2PX8A 3FM9A 3HDQA 5DIZA 4X66B 4DRXA 3MS7A 4IQUA 2Q28A 3DZIA 3MS4A 5I3ZA 3KHHA 3KUCA 2XXJA 1FP1D 2O6KA 1X9MA 2QTFA 4NK4A 1RPAA 2F1OA 2DCMA 4FD3A 2M6KA 2BFEB 2FV8A 3DEEA 4GXNA 4IFBA 2GHIA 4E1BA 3IBGA 2BEVA 2FGJA 4LI3X 1RCTE 2X0KA 1QWSA 3PHBE 3QFRA 3RD5A 3WRXC 5ALXA 4GMFA 1YJCA 3NORA 5KOJB 2G7ZA 3W77A 3AQ4A 4FXOA 5CT9A 4BEBA 4E22A 2KJ5A 3QLTA 1NQ5A 4GC9A 4Q7LA 4UHBA 3ZWOA 5HGXA 3BMCA 3BULA 3ROPA 2AFIB 3OAAA 3NNNA 3REGA 1DBRA 5EXXA 1R27A 2ZUUA 3LKBA 5FDFA 1DDOA 2XECA 3KLNA 3ND6A 4XUDA 4B17A 1GA1A 1JIQA 4HNAA 2Y68A 1XDBA 3NVWA 1ZW6A 2RHDA 2QLNA 4IMJB 3VDMA 2XTZA 1ZQVA 1ST2A 3JPTA 2KX7A 2J0VA 4XPIA 3PGA1 3NVVA 1OT3A 2DRIA 1EE2A 3PL1A 4FI3C 4ZVLA 4ICAA 4Y2TA 1N5XA 1FMCA 1H5QA 1NXOA 4G9EA 4ZCIA 4A2WA 1YA4A 2D1SA 3X1MA 1CP2A 2ECPA 1G7TA 2XCAA 4DF4A 3VX4A 2R00C 3SDZA 4ZIRB 1SV0A 1N8NA 4RVGA 5DISB 3RCBA 3DP7A 1NU8A 1YK1A 1OY1A 4CGZA 2LBPA 1WCIB 1L1EA 2ZRDA 3JQPA 3O93A 2ZIFA 1Z4KA 2IXFA 3B1ZA 1M6HA 2ACKA 1ESCA 2VAXA 5DASA 2GBIA 1A9YA 2EKBA 3TQ1A 3OEHD 1RWXA 1K6MA 4Q3EA 3U37A 3F3YA 3TEFA 3R0XA 2DM6A 2W2QA 1L5QA 1Q7EA 1I4WA 1AB5A 2Q2WA 4UB6U 3ANTA 1UBUS 2WJWA 3B2QA 4AUNA 4CHGA 2QZSA 1HF3A 4IG9A 2Q0QA 2EGGA 3OZEA 4XUGB 3LPDA 4TZTA 5FBVB 5KT3A 1TF2A 1ZGCA 2RDMA 2YWRA 3TJMA 4BNMA 3X1YA 5K45A 2XIQA 1BSVA 1RQPA 2GLUA 3G59A 4Q01A 2ZI6A 4Q6BA 2C99A 3ZCQA 4E11A 4TZ6A 3I34X 2I7CA 2QNIA 1DP4A 1NY5A 4F8EA 4RTOA 1NOKA 1VE9A 4Q9LA 5EC8A 3SBEA 4DR1B 2DT8A 2EW8A 2B34A 4FMCB 3CUWA 2G9ZA 3EQ6A 4OQFA 2H3HA 1IYZA 1P5FA 3FNEA 4XDHA 2L82A 4ZDKA 4B3SB 3EEOA 3DMPA 1OVGA 3JRXA 4CWAA 2JJ1D 3GLKA 4QU0A 1MQ8B 4BFXA 1HT2E 1CQZA 2GPAA 3F5SA 3HR4A 3RSGA 1VDMA 1YHYA 2P77A 3T5DA 5JSYA 4QWEA 3HVHA 4MS4A 1GQSA 4OM8A 5FKJA 4UD6A 4D3XA 3IYLW 4HN2A 2EJVA 4KTTE 4OM7A 5KFEA 2GARA 4W9NA 4F1WA 4Z6EA 2P6RA 1KPHA 4AF8A 5C5JA 3H2SA 1X6VA 4FYIA 4AZVA 5BSEA 3U7GA 4QGBA 1E1CB 2H0QA 2FQXA 2G9QA 2J3HA 1XVIA 5C46F 5LQDA 1PJ8A 5MN5A 1SG0A 5GVRA 3QFHA 1SCAA 1VTKA 4PQFA 4B3BA 3IDOA 2QZPA 4O5KA 1SN7A 3A3YA 2CF5A 3MAGA 4FWBA 3UV7A 3QITA 3FHOA 1DBVO 1M6WA