3UMBA

Crystal structure of the l-2-haloacid dehalogenase rsc1362
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
227
structure length
227
Chain Sequence
b'TSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dehalogenase-like hydrolase
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Ralstonia solanacearum
molecule tags Hydrolase
total genus 80
structure length 227
sequence length 227
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3umbA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3umbA01
3N8GA 4YGYA 1L8OA 4CE6A 4OFZA 1ZS9A 5AM4A 1YJ5A 1ZRMA 1L6RA 5AESA 5AIAA 3I6BA 4RETA 3QU4A 5AKJA 3I1YA 2B30A 2C88A 2P69A 3L0YA 3FVVA 4JDPA 4QJBA 4BNDA 1CR6A 3L5KA 3ONNA 4UASA 2YJ3A 2ODAA 3AR6A 2YJ6A 1RMQA 1Q91A 2YJ4A 3AR4A 2B1QA 2EARA 4XPZA 5ALPA 3MMZA 1L7MA 2I33A 1FEZA 2QYHA 1Z88A 3AR8A 3U7GA 2IA5A 1F5SA 2X4DA 3NIWA 3WK5A 5AVWA 2HOQA 1ZOLA 4NV0A 2ZBEA 1U02A 3QNMA 2G80A 2GHTA 3HYCA 5AKEA 2WHEA 2PKEA 2G08A 3A1EA 5ALGA 2C8KA 4EEKA 2CFSA 3QLEA 2I6XA 5ALFA 1U2TA 1XP5A 2NO4A 3EPRA 3M9LA 5AW6A 3EWIA 5AKKA 3NUQA 3WK4A 3UM9A 2BY4A 1U7PA 5AW2A 2IOHA 5AM0A 3CNHA 4Y2UA 4EX7A 1O03A 2AUTA 2IYEA 3OCXA 1Z4JA 3BA6A 4BEWA 2Q4TA 3SD7A 4UW9A 4UU1A 2WF8A 1XVIA 3QUQA 3FZQA 3OCUA 4MUMA 4YIKA 3ET4A 1Q92A 2FPXA 3J7TA 3ZVNA 3WGUA 2W4MA 2ZG6A 3WKEA 2QLTA 3VAYA 1YV9A 2HO4A 1Z4OA 4UAUA 5AW3A 2BDEA 3E84A 1WPGA 3QUBA 2WFAA 5IT4A 3QU7A 4Y2RA 2P9JA 1Z4PX 3U7EB 2O2XA 3TLMA 2HX1A 3DAOA 2GO7A 5AW5A 3U13A 3RFUA 5IT0A 2HDOA 4ZEXA 3QUTA 2FPUA 3E81A 3SF0A 2R8YA 1LVHA 3SLRA 1RLMA 5ALSA 5ALQA 4HGNA 3AR3A 4IG4A 2YY6A 1QYIA 5AKIA 3QGMA 4F72A 5ALTA 2OM6A 4KX3A 4RESA 2HEGA 4JB3A 3WK7A 5ALLA 3A1DA 2EAUA 2G06A 3KOOA 2GMWA 4EZEA 3WK6A 1SU4A 3W5DA 1RPZA 1Z4IA 2B82A 3WKCA 4CF5A 2YBDA 3A1CA 3L7YA 3S6JA 4C4RA 2WF5A 3AR7A 3KC2A 4KNVA 3U26A 4XQ0A 1U2SA 1AQ6A 3NASA 3EF0A 4GXTA 3P96A 4DCCA 2FI1A 1Z4NA 5A3QA 4Y2TA 4FFDA 3KD3A 4Y2XA 2YMQA 2YMLA 5AM3A 3B9BA 3ZX5A 3ED5A 3ZWKA 3L8HA 2IOFA 5A3SA 1QH9A 4UM7A 3N07A 4OD0A 4XE5A 3DV9A 3E58A 3L8FA 1EK2A 3DDHA 5ALVA 4DWOA 2I34A 1L8LA 2JAOA 2PR7A 1WVIA 5ALRA 2B8JA 5AKHA 5AKYA 1KYTA 4BX3A 3UMBA 1VFPA 3WKBA 1YS9A 3B9RA 5A3RA 2WF9A 4UATA 2YN4A 1VJRA 1QQ5A 1TJ3A 1EK1A 1NF2A 2G1AA 3QU9A 2MSNA 3QU5A 3L1VA 2Q4RA 1TE2A 1YDFA 3GYGA 4UAVA 2HHLA 4AP9A 2FPRA 5IS2A 1RLTA 5ALXA 3WGVA 2AH5A 4UMVA 1Z4KA 2HI0A 2AMYA 5AW9A 4Y2VA 3M1YA 2B8EA 4BNDB 3OCVA 4UU0A 4OHFA 5ALKA 2P11A 5AHXA 5FP0A 1Y8AA 1TJ4A 3N5KA 2G07A 2RB5A 4FE3A 1TJ5A 2C4NA 3AR5A 1Z5UA 2MU1A 4NABA 2O9JA 3U7FB 5AVQA 5AI5A 3ZW7A 3IB6A 4MWOA 4HGQA 2W11A 5AI0A 1YMQA 2R8XA 4HGPA 4AS3A 2GHQA 2I7DA 1ZRNA 2W43A 4HGOA 2IOFK 5AK3A 4YCMA 1ZJJA 3L8GA 5ALOA 4AS2A 4O8CA 2CFTA 5ALDA 1WR8A 5AI6A 1K1EA 3FGOA 1ZD4A 2HCFA 5ALNA 5AK5A 5AVUA 5AM5A 3W5BA 2DQSA 2HF2A 2OBBA 1YNSA 2Q5EA 2FPSA 4Y2JA 3NANA 2OYCA 5ALEA 3SKYA 5ALMA 3WKAA 4YH1A 4UMEA 4OCZA 4I9FA 4G9BA 5AK4A 3E8MA 4KNWA 5AM2A 1SWWA 5AW8A 1RC8A 4Y2SA 4NWIA 4GIBA 4KYTA 2FUEA 2YJ5A 4BKMA 4BBJA 2P27A 3QU2A 4C4TA 1CQZA 3F9RA 2BDUA 2I55A 1RKUA 2HF7A 2NO5A 1T9ZA 5ALHA 3R09A 2EATA 1O08A 4E88A 1L7NA 3W5CA 3L0CA 4B6JA 1Z4MA 4J03A 4UARA 3K1ZA 1RKQA 4EELA 4C4SA 1T5SA 3U7HB 3R9KA 1J97A 4HAIA 1RQLA 3FPSA 1RKVA 2R8EA 3ZTWA 3DNPA 5AIBA 2YMMA 2NYVA 2RBKA 1U7OA 3NALA 3ZWDA 3PGVA 5AVSA 3OTQA 4UMFA 4CF3A 1RLOA 5ALJA 2JAUA 5AVYA 1JUDA 4Y3UA 2WF6A 3L0BA 5AKGA 2JARA 2JGAA 1Z5GA 3ZVLA 4I9GA 1NRWA 1S2OA 4NFLA 2YMPA 5AICA 4DFDA 4EX6A 3I76A 4CNQA 3AR2A 4L6AA 2ZOSA 5AVZA 3KZXA 3QUCA 3FM9A 5ALWA 4EENA 3QX7A 3BWVA 3ZX4A 2ZXEA 3FPBA 5E0OA 5AKLA 3ZI4A 3MC1A 3W5AA 1N9KA 3SKXA 5AW1A 3IRUA 5ALYA 5AW4A 2OA0A 5AVVA 2ZBFA 3NAMA 4IFTA 2RARA 4J2TA 4CF4A 5AVTA 2YFYA 4QQFA 4BX0A 3MN1A 1Z4QA 3D6JA 2C8LA 3WK9A 3RF6A 3I28A 3ZTYA 4L6CA 5AI4A 2ZBDA 3ZU6A 2WF7A 1RMYA 2JAWA 1L7OA 5T41A 4BYGA 3B8EA 1L7PA 1QQ7A 1PW5A 1Z4LA 3HLTA 3PGLA 1LTQA 1RQNA 1ZD2P 2HSZA 5AVXA 4PNHA 2FEAA 2G09A 4Y2QA 3AR9A 3N28A 5AKZA 2FPWA 5AW0A 3ET5A 2PQ0A 3KDPA 4G63A 5ALIA 1MH9A 2B0CA 2CFRA 4HGRA 4HYTA 2GFHA 4NAVA 4YIHA 1RMTA 1IWOA 2CN1A 3UMGA 5ALUA 1XPJA 2B1RA 2RAVA 3OCWA 4L57A 3ZVMA 5AW7A 3QXGA 4Y2PA 5ALZA 4KX5A 3ESRA 4FYPA 1WZCA 2FUCA 3OCYA 3PCTA 3ZUPA 2ZBGA 2WM8A 5AVRA 4XOUA 3SMVA 4DW8A 3KBBA 2VKQA 2AGVA 3L8EA 5AI9A 4BEVA 3U19A 1X42A 4Y2YA 3UMCA 4ZEWA 1QQ6A 2C9MA 2MU2A 3L1UA 3WKDA 3NRJA 4ZEVA 3IJ5A 3QYPA 1RRCA 3ESQA 4BX2A 2G0AA 2I54A 5JJBA 1VJ5A 1N8NA 2D2VA 5AI8A 4UM5A 3PDWA 1SWVA 4KN8A 2FDRA 2R8ZA 3WK8A 3CZ4A 4F71A 4YCNA 5AK6A 1J8DA 1T5TA 4H1WA 1ZD3A 4UMDA 1NNLA 3MPOA 5AKXA 1ZD5A 1RDFA 5AM1A 3N1UA 3A3YA 3EF1A 1S8OA 3OPXA 3OCZA 1TA0A 3R4CA 4YCLA 3SHQA
chains in the Genus database with same CATH superfamily
3ZLTA 3HO6A 2OT3B 1G7CA 4B3TB 3O4RA 2VP0A 1PK7A 3G13A 5JZMA 2OHXA 2JHGA 1AK1A 3KR0A 5IAEA 4G0PA 1BKDR 2R1TB 3T7DA 2XSZD 1JQJC 1J2UA 1P75A 1DQSA 3PL5A 4P7GA 5CRXA 3C2QA 2W37A 3I39X 3KAJA 2N1BA 3VHXB 4RTQA 3GIDA 5IDXA 2WZCA 2VSYA 5ED4A 4O0LA 4HJRA 2OFPA 3BXPA 3ZU5A 3K32A 2VJCA 1A72A 1XVVA 2GPJA 4BHTA 5A2GA 5JNLA 1XIVA 5IP5A 1SUPA 2E3JA 5J58A 3W2TA 1B8PA 1O0SA 1MEJA 1T2EA 4J4HA 1D2GA 5PGMA 3NI2A 2AQ4A 2HX1A 3DAOA 3TRHA 2B21A 1ITZA 1Z56C 4P3PA 2JFXA 1I24A 4IG4A 2YZKA 5G1NA 2FXVA 3QKUA 3M8SA 1F1BA 1GQSA 2VFAA 3GFQA 1FMCA 1CQJB 3FLEA 3CHYA 2OCIA 3OP4A 3WQBA 1CEYA 5HVNA 3G5TA 4F4WA 1O9BA 3F98A 4A8TA 1U0RA 2ATLA 3SYZA 2IYRA 1UWCA 1MT0A 5KNCH 2IYPA 2CWWA 4E5MA 3DMTC 4N0MA 1XLTC 2WDPA 2P75A 2JAOA 1EGMB 4LOLA 5G40A 3H0LB 2CW5A 4YBRA 1NKCA 3MMPA 2J9GA 1ZZEA 2ZSHA 3QU5A 2MSNA 4WN3A 1N5DA 1ISJA 1PP4A 5E3IA 1XZKA 5JMTA 3II6X 5EJ9A 3NOOA 2VDKB 2VNIA 4B4KA 5CXQA 4DT1A 2IJGX 3EFBA 4INPA 2YW2A 1YI0A 4BJ1A 4UEJA 3W6PA 2VHEA 4B2LA 4QWWA 3PKJA 4HNAA 1G8HA 4YK7A 1G1AA 5F12A 3VR6D 3LLSA 1TZCA 3OX1A 3DUFB 4Q7EA 4NKRA 9ICNA 3SJ7A 3B6IA 2PZJA 3RYIA 1W4RA 2JBHA 2QM3A 3A04A 2Q5CA 5D7BA 3ADPA 3P94A 1JEOA 1D9ZA 2P27A 4Q43A 3WGLA 5T8KA 2WUGA 4EH1A 4HWSA 3AG5A 4B32A 2UUAB 3PUHA 2DFKB 3GEPA 1JE0A 1AGXA 5FBZA 1TD9A 3TS1A 4EELA 1YCDA 3M4YA 4AKGA 1J24A 2A0WA 1IHPA 2ZGVA 2FW6A 1ACJA 1IM5A 4Q37A 3A9VA 1KYXA 2QMQA 4E0BA 1TADA 3N2KA 3IH5A 4EZ9A 2YWFA 4CDRA 4F4XA 2Q2OA 3EIOA 2QTZA 3DWGA 4IIVA 2ZP1A 1UF9A 2QX4A 1ADCA 5ECWA 4FILA 3N2YA 2PLWA 2D5LA 4M1SA 1YB5A 1OIVA 3HLTA 1C7YA 5KTNA 3K6KA 1V7ZA 2V65A 3ZE2B 2HW8A 4N48A 1NJ8A 1JZSA 1DDOA 1CLEA 4Y2QA 3OZGA 3R2JA 4M89A 3S5UA 1KMCA 3T5LA 1GCAA 2GYYA 2D8CA 1RZRA 4EY6A 3VR6H 4FIZA 2B1RA 1NG9A 4QOFA 4RPLA 2JEOA 5FULA 2BMEA 1GO3F 4P38A 3P1JA 4RDIA 1C2YA 4NZOA 4PZOA 4A2CA 1GGHA 2I3ZA 5FQOA 1BS2A 3PW2A 2D2VA 1QCKA 4KN8A 1SBIA 1PFWA 2BIFA 4AN0A 1E7SA 5I4BA 4AZ0B 1AUQA 5IYZB 5FPQA 3KU4A 5D01A 1L4NA 4G09A 2VJ5A 1FZTA 2PZGA 3MWGA 5F7JA 3CWQA 4MQEB 3O21A 3OO1A 5EPEA 3ZWCA 4AZVA 1EE1A 4MR7A 4KKVA 3EQ8A 1RVDA 2R6ZA 5DEOA 4HPJB 3TH5A 3LT5A 2EYUA 4PIVA 2OPHA 4GI7A 4YP3A 1KKMA 4P5PA 3AEKB 1QCYA 4GSKA 5ESXA 1P7CA 2AJQA 4DUGD 3G0HA 1O6CA 3MQFA 3OU7A 1BIFA 4MLZA 1A9QA 1ZQHA 3LDUA 2C61A 9ICUA 4LC0A 3I5YA 2BEKA 5BN1A 3IC5A 3JQFA 1SU7A 3DDWA 3ACDA 1TVAA 2WWTA 1YOVA 1WCIA 1BNCA 3U6KA 3VU8A 3LX8A 2WYOA 4L3VA 1ZXBA 4IDNA 3IP8A 3H8MA 3A3KA 1JWAB 1IOZA 3GLHA 2C4KA 4Q4DA 1E6UA 1FNNA 1PGNA 4PEVA 1U7ZA 4U63A 1C5KA 1P0CA 7REQA 2W04A 3MCVA 3P2YA 1IDOA 1E18A 3O7WA 1OF1A 4YYZA 1WHTB 3AILA 2JV3A 1OB5A 4JB3A 4LOAA 4GLFA 5ERYA 3O8RA 4MVJM 2OECA 3PR5B 3L4BC 1DC3A 1R0WA 2RG7A 2WIDA 3Q8XB 3K5WA 2IPAB 4U9HS 1S02A 1JKXA 4CNBA 2AE2A 4KRFA 2QMUA 3WV4A 4DOBA 1RRFA 3CE9A 3OX3A 5JI3E 5TF4A 1X8KA 3JQRA 3QKWA 4UM7A 1H8HD 4DZZA 1EVKA 2SBTA 5WRFA 3JD0A 2NNLD 4RLFA 9ICHA 1E6CA 4BO9A 1FRNA 4JBNA 3PKIA 4P80A 3LQ2A 1NC1A 1UOQA 3F5FA 2EH9A 1V6CA 4G1CA 3U9TA 3SQOA 3I5XA 5LMNB 1GQRA 1G5QA 3MHTA 1R50A 3B6JA 3N58A 1TE2A 4JVOA 5DGXA 1BPXA 4DS4A 3SC2B 3K72B 1HLPA 1P5HA 1W0JD 4B9MA 3L0OA 3AVWA 4ZDKA 3WFZA 4UB1A 4G8CA 1H0HA 4RCYA 1QHHA 2Y6VA 4S05A 1HE5A 1LNSA 2YVLA 2AQHA 3UHPA 4BVFA 2MT9A 2WU0A 5DN6A 4P3OA 3AEZA 4E7PA 3RAJA 3IP1A 2FK8A 1Y6GA 1DKPA 1CEXA 2W6NA 1NXTA 3AY6A 4WVLA 2ZE6A 4UDOA 4XGKA 4D0SA 3ITKA 4MKXA 1PVPA 2QQ0A 3FRJA 2PY6A 2BH2A 2J9RA 2PG3A 4RJLA 2WSIA 3M6MD 3AHGA 1RC8A 4LW8A 3RTEA 1RC1A 3UW1A 2GM5A 3IELA 5KCZA 5EG5A 3R09A 5I4CA 2JW5A 2FNAA 2CV1A 4XH9B 3C98A 3Q3JB 4MS1B 1MFZA 1FDRA 4RANA 3A9SA 2F90A 1U65A 4M1YA 4O63O 3IQXA 4JFRA 1HL7A 3RB0A 3EDQA 2R86A 2VA3A 2R44A 3LAWA 2BE9A 4OAOA 1DCTA 1L5GB 3EC1A 2X3YA 3H4TA 3D3NA 4KDEA 2W4QA 1Z00B 1A1SA 2IL1A 3PLRA 2X7JA 1PK1A 2FN3A 3UVEA 3TAPA 1ORTA 5IANA 4DUYB 2M9NA 4JYBA 2HO5A 1DO2A 1G9TA 4KQFA 4WBNF 4CEHB 4K6GA 2QL5A 2BISA 4L73A 4CMKA 2EKLA 2EF1A 2ZSBA 3S2GA 4HN4B 4ILKA 2ZCJA 3UKDA 3OPNA 4B9VA 1BVUA 3CA8A 4YDSA 2P6RA 2B1GA 4ZALA 3TLGA 5AI9A 5E1MA 3E0QA 3T1VA 2YHAA 4KLQA 2A0XA 1LXCA 1NF9A 1T4BA 3BTUA 4NBLA 1DFHA 1SZDA 1T26A 2XLBA 2E4VA 1PT8A 3K96A 3WMEA 3ZIUA 2FPGA 2FU5C 4KHZA 3EXHB 1KZYC 4UQPA 4TKLA 4BAUA 4OI0A 5CB1A 2FW1A 3CRW1 4LA4A 3NHJA 4KN6A 2UYOA 1P9NA 2BEUB 3WLRA 5ICEA 2XMRA 1LCIA 3H9UA 4OXXA 2XCPA 1OX6A 2VYQA 1GPWB 1U0TA 4N9WA 1Z33A 1C9JA 2R4TA 1MHTA 4ECRA 1IM4A 3MS2A 4OFXA 1IOVA 1EJ0A 4ZZ2A 4UTNA 4F5DA 1P2GA 4IKOA 1Z5VA 1R12A 1IQRA 3H0MB 4O3OA 2QM0A 2VAVA 5CD9A 5DHTA 1A6SA 4RQTA 3T3PB 1KQFA 3PEVA 4XM2A 4G85A 2XB9A 2AN9A 4Q9LA 4JLJA 1KJQA 1YC2A 4UBIA 1Y88A 3JYOA 4PCLA 1W36C 1LB2B 2HU7A 1QHXA 4J8PA 4KMMA 4EDFA 1JLMA 1VE5A 3RASA 1NP6A 4HFMA 2C7OA 3LT1A 1TQDA 1GZ6A 5FWNA 5LDDC 1QIDA 4D2IA 1QIIA 3TZ6A 3DYVA 2VYCA 3FWZA 3IIKA 4ERXA 5K8VA 4LX0A 3G8DA 2R7AA 3N2GB 5CUQA 1KEEB 4PICA 1E7MA 3NO4A 1BGXT 5KREA 3A1DA 2PRIA 3CLTC 1WW3A 4O08A 3FSGA 2KEYA 1URJA 1ZHFA 3KC2A 2IBTA 4XX1A 4H0NA 1NVXQ 3A4LA 3JAKB 1NR1A 5BPCA 4G0WA 2CMDA 4ZCTA 1R6XA 2IYUA 1NPYA 521PA 5E9JA 3RADC 4RD0A 2NU7A 1ENPA 3AF1A 2APJA 1EM8B 4G0QA 2PUJA 5AKYA 1BO6A 2V6JA 2G9QA 3BGIA 1KH1A 3KFUF 2WHPA 1E0DA 5CURA 1JDJA 1PEAA 4B5LA 1SUSA 2DWUA 4W9NC 1MOSA 5JVDB 4XZ3A 1IBCA 4Z6KA 2A4KA 3IE0A 4XCXA 1AC5A 1OLSA 3GZNA 1MVOA 4LV6A 2P30A 1GUBA 1Q77A 1YASA 4ZEOA 1VGQA 1U5BB 1DI0A 3IB6A 2HRRA 2YW9A 3RYHA 2NUPA 2CLCX 3RIMA 1N3BA 4YRIA 1WR8A 5LOVF 5E7MA 3G8CA 4FYWA 3M9NB 3QQ5A 2BKXA 3CFYA 4TV8B 3FOWA 5D6NA 4YAJA 1Y9EA 3NANA 5HEKA 2C8VA 5KL8B 3UXHA 3GJRA 4R2MA 5HKLA 4L1KA 3V4ZA 2C58A 2Z57A 3PEWA 3H2HA 3GIWA 3GOQA 3O84A 1JHRA 1XTSA 4IWXA 1W1IA 3ZZTA 3DNFA 3OC6A 3WNDA 3NTVA 3BL6A 5DGIA 3P8ZA 3W3ZB 2NVWA 4KDFA 4O3QA 3DLBA 4E15A 1ECWA 3ITNA 2MRLA 5B2ZA 1JG6A 4MKHA 1N6LA 3EK2A 4HCJA 2VDMB 3C4VA 4NLGA 3IHLA 4PG7A 3AUUA 2JPDA 1J22A 4MZDA 4JWMA 1YVPA 1H23A 3C21A 1U9LA 3EEYA 1YQXA 3I5MA 2I5HA 4K4HA 2O52A 1AV7A 2GBGA 5BWBA 2WIJA 421PA 5LDHA 1KDYA 1J2MA 2VAMA 3TCKA 2EG9A 2QTGA 4HHEA 3K5IA 3HDGA 2QXUA 2VNJA 1LQ2A 1JEYB 4QGBA 2P9GA 1A2BA 4NS4A 4W63A 1XZPA 1UP4A 1S3GA 3CISA 4CL8A 1TA4A 3R3VA 2BQ3A 1LWOA 1Z74A 1EGVB 3AFIA 3WYDA 4OAPA 4WGGA 2BBSA 5IBRA 3GMSA 4UTVA 3A2MA 4PHDA 3WSWA 3Q9SA 4L5BA 1P31A 3LKBA 4Q6WA 5K3EA 2FDRA 2LWIA 3OCJA 4DTIA 5AKXA 2FEMA 2KS6A 3BHIA 3U60B 1J07A 4GH5A 4M6WA 4IDDA 1VLHA 5BYKA 1HJPA 4I1UA 2OILA 4JLVA 4RE6A 1ZRMA 4TQ9A 1G6KA 5F76A 4KBFA 4DYDA 3SZ3A 4MJXA 1Y3DE 3WWZA 2GI4A 1KETA 2REQA 3CPHA 4ZOLA 4AT1A 5KFHA 4RF2A 1W4LA 2R6HA 5LCXA 3FPHA 4BO0A 5KEIA 4NV1A 4BUCA 3E2PA 3QWIA 5KFXA 3LDAA 3AHHA 4OHUA 5HIJA 4QARA 4H7FA 2J08A 3H2BA 1D9FA 2I62A 4PLZA 1Y8QA 3RTBA 1E2GA 4H1HA 3QFSA 1EK5A 4YO7A 2QMZA 2PO7A 5M7EA 1WWUA 3PICA 5IVDA 1ZIXA 3R3YA 2AOVA 2EFYA 3VNRA 4PY2A 2IXDA 4P9NA 1FU7A 2YZ2A 4NJOA 2R6GA 2GDJA 2K7ZA 1GOTA 5K6RA 4Q3AA 5JFTA 4GRIA 3AVYA 1G17A 1MJGA 3GJTA 1X86B 5BSTA 3W6ZA 1VIAA 4TRNA 1IQUA 3AFGA 3TKYA 1FNBA 3FGNA 4CLRB 3EGCA 3RHFA 2L2QA 2IODA 1FSZA 1ZMTA 1EX7A 3G5LA 3G1UA 3QLUA 4QTYA 2MINA 1P7DA 3JAWA 3LQYA 1CUKA 3RC2A 1KR2A 1GIAA 5JAUA 4I27A 5L7WA 1Y9DA 3DWEX 1I0ZA 4JC5A 2PPVA 3HADA 3SENA 5BSWA 1I1HA 3R40A 3ONVA 1TAQA 2JI6A 3D6UA 1EFVB 3AY3A 2Z2JA 4WBNB 2ZI9A 3OQPA 4OL0A 4PGHA 1YVEI 3IEVA 1EJ2A 1I3LA 2NV2B 1E32A 1EHYA 2WJJA 2X9LA 1WXQA 4BVEA 3PQCA 1L7AA 3AWDA 2QARA 5FAKA 1M74A 5KTQA 3DZHA 2BR0A 3QELA 4E07A 2FYTA 3M1AA 4JCCA 1L5YA 2POCA 1LBQA 3S2UA 1CJSA 2I9GA 1K66A 3T1OA 3Q5EA 2H5LA 3VYVA 5DM1A 5ELLA 3ZCXA 5SYNA 3H5VA 2R4UA 5HM6A 1L5MA 3CP8A 3GRVA 5AK5A 2GD2A 2W98A 1EU1A 1DAPA 4LOHA 1NJFA 4L51A 2B6NA 3UQZA 4GIBA 1IXZA 4NBRA 2K4PA 4EO7A 2VAWA 2W2MA 1DE0A 3ZKWB 121PA 1S3FA 4Q82A 3LBFA 4OSOA 4D0RA 3QWFA 1SR8A 4LZNA 1ENYA 1PAUA 1ZETA 2QR3A 4KGDA 4WQMA 3L06A 4EENA 1TK8A 1V85A 1NZFA 4C2TA 3OF5A 2E3TA 4JCOA 5GY7A 4HRVA 2YV1A 1TM1E 4YWJA 5MGBA 3E9MA 2VHVA 2PRSA 4K81B 1U98A 3CGGA 2L42A 1V2GA 5JS1A 3ZU3A 2KE5A 3BKWA 2YNMC 2D0IA 1CQIA 1LK0A 1YI8A 4TM8A 1UDAA 1DUSA 5I5GA 3EISA 1H0SA 5EMLA 2R0QC 5F98A 1TQHA 1E79D 4BGDA 4MUHA 3OM0A 1DXQA 4E0DA 3AERB 2IDMA 2Z5LA 5FBLB 3TL6A 4X1IA 3NJ4A 1XAJA 1AXRA 5J2TF 4BRUA 3DCYA 1F2VA 4MX8A 1NK0A 3E2IA 3DAGA 3VC7A 2AGVA 5EI5A 4YAOA 5FPSA 1PR4A 2M6RA 2AKYA 3RRGA 3CLVA 5B3JA 2J3EA 3KKPA 1RWWA 1KSJA 2QN7A 3S27A 1R15A 2Q9AA 2IX9A 2BCVA 3CX4A 4KRGA 4JC8A 2HHHB 1VCNA 3VYWA 1W76A 3DO8A 4OP3A 3JAMA 1YMUA 4UBNA 1S8OA 1DXOA 5H1YA 2E87A 3P4XA 1TA0A 1VI5A 3ER8A 4PONA 4DBLC 3WMXA 3JASB 1QS0B 1C7RA 3TQCA 2QK4A 2ZAYA 3L5KA 3TI7A 3HDVA 3PXXA 1Q44A 2JIQA 3F6PA 1TKBA 2LKCA 2CY0A 3CBQA 1KW4A 1CUFA 2P66A 3V1UA 3RRHA 1ORRA 4BLQA 1EKXA 1ZOLA 4B84A 3RJJA 1L7XA 5LOVB 1U4NA 3FMIA 3U3RA 2H6EA 1KDHA 1DXSA 4QBGB 1U81A 4AICA 2PCJA 3V4RA 3C2MA 2MSLA 1U1EA 2B98A 5A03A 2DFTA 4M1MA 2J6UA 4OJYA 5CW1A 4PC1A 4M9RA 4LBZA 1KZ6A 1GSHA 3E84A 3MAGA 3ZDRA 3QUBA 2HHWA 4HQLA 1W36B 2VRNA 2ASVA 4CETA 4F11A 2BFEA 1N33B 4MF8A 1G63A 1PK8A 3ZIAD 4BMYA 1ULSA 4NMWA 3KJNA 3OT5A 1J21A 4QC2A 4EG7A 5L4NA 3S5JA 2B1IA 2P7IA 3O8CA 1GTJ1 4DY4A 1XTVA 5FHRA 3ZHBA 5G02A 1F48A 1AG9A 2R3SA 4LXGA 4EKGA 5C51B 3FHJA 3BD6A 1VIMA 2JEIA 3BWMA 4S24A 4IXTA 1II0A 1PWEA 3U6BA 4YRJA 1C0PA 1GG9A 2BCSA 1Q0SA 8LDHA 3V4VB 3PQ2A 3M0EA 4PLGA 5IJ9A 2XCAA 1V8BA 4PRYA 2FTKE 1UOOA 1JFFA 2JFUA 1ULHA 3UC5A 4B83A 3ZQ4A 2KI5A 4BJ6A 2QS9A 3K9WA 1RR6A 1WQ4A 5DDIP 1Z5UA 4L08A 3DBVO 1D4FA 4P7KA 4OG2A 2J67A 4YQFA 4PHHA 3EC2A 3RK1A 2FMHA 3TINA 2EYQA 4Z0PA 5BXQC 3A1VA 2UU9B 1NHWA 5J2UF 1T5IA 4CGYA 5K0NA 4YMNA 3DQZA 4EG8A 1M1YB 2YC2C 3X1DA 4D4HA 2PMWB 1ESZA 3I6MA 4G0MA 4ZV7A 2G7MC 3E9CA 3JWEA 5M2QA 2PD6A 4UAZA 1RWXA 4UUNA 3S8YA 2YVAA 4PWYA 1JH8A 2P41A 2GCIA 4ECZA 3TSCA 3TRIA 2P1RA 4IIBA 4MRPA 1RFLA 4NG5A 4IEIA 1XG5A 4MR8A 2HHCA 4JOBA 3HA7A 3LPAA 3OU6A 4L6AA 2FSFA 3FPBA 1G20E 3SJZA 4LDPA 3P0RA 1TCVA 4TMYA 1FSFA 1JBKA 4TTRA 3TIXB 1CNFA 5LMZA 1RAFA 4FCCA 4C0XA 1JE1A 3QQPA 4E94A 2EBHX 1P1RA 3C6BA 4LQDA 4N5IX 4D9HA 1M34A 4PPNA 3V55A 2BELA 2B0CA 3NS7A 2AK3A 2Y0EA 4NAVA 8ICGA 5A0FA 3BM5A 3VPHA 1NMQA 3L43A 1GU0A 1N1MA 4RTOA 3B12A 1B00A 3KK0A 1SUCA 4EG4A 3KJXA 4RA6A 2BTQB 1V4BA 1IEXA 1M5UA 3ETEA 3MOSA 5CDTA 3W9SA 2Y76A 1J1ZA 1NI5A 1SA0B 1U7DA 2V5UA 3E1KA 1AO3A 3RYCA 4QFMA 4PBRA 4UM5A 2BEWB 8ATCA 3D3QA 1W6UA 2GJAA 2OHGA 4PLCA 4DR1B 5BWMA 4GKBA 2E55A 2R1TA 3OE5A 1VDZA 3WBKA 1C2TA 3IQZA 4HMOA 3PNOA 1MIOA 2IA6A 5B5SA 4OLBA 4DAEA 3DL0A 2LBOA 4BNDA 4JDPA 1JKJA 4ROSA 3VZPA 4GVPA 2M98A 3A2KA 3MMZA 4A26A 2J3DA 3ZJ5A 3HCBA 2VIXA 3Q2IA 1KI7A 2IY7A 1CUDA 2DP4E 3WR5A 3WWDA 1NHGA 1E3TA 1NPTO 4AG5A 4PSDA 3H4VA 1U6KA 5C7LO 4OGFA 3LOQA 2YR0A 3EBPA 4XYGA 1SULA 4CM5A 1XE3A 3PNSA 2YXLA 4TVBA 5DTJA 1JDUA 1AF4A 2VJMB 2XMGA 2I87A 3COSA 4FINA 3SVZA 4XGNA 4NMMA 1I3MA 4KPGA 4CHTA 3TARA 1HQKA 4ZO4A 1PDWA 2PWPA 4LVCA 1P81A 1PZFA 4YJ2B 2HDOA 4Q7LA 1NVVR 4I1YA 2RQ5A 4WKOA 2PL5A 3JWPA 4CMIB 1TMGE 1RP1A 4IIDA 3LD9A 1R3UA 4CHGA 3UWKA 2GZ1A 1M2NA 1DKNA 5EIWA 4KWHA 4MVJF 3HI4A 5C4GB 4KQ9A 5G41A 4NBNA 2KIWA 3IQIX 3FTDA 3KPJA 1KIAA 2F2AB 3ZWXA 2EJTA 2GB4A 1R10A 4YPFA 2LGJA 4RYLA 1TI7A 3SC3A 2CXYA 3H5LA 3ZW9A 2FX3A 5B36A 1IMOA 4K6OA 4M0DA 5G3YA 4RNDB 3DUFA 5TQJA 2Z30A 5HFJA 2P6OA 4RYDA 3K5HA 4ZJUA 4Z0HO 1YJBA 2GSDA 3R9IA 1PV4A 3Q8MA 4FEGA 3NJ8A 1NQTA 4LISA 1TJ5A 1CHDA 3GEEA 3RYTC 4JXXA 1ZRNA 1QOZA 3ZWBA 3LF2A 2HD4A 2XCRB 2WJYA 4QT4A 4Q47A 4B45A 1TM2A 4P2BA 4ZYTA 5CITA 3UUFA 4OLAA 4IZIA 5TV2A 3H86A 5KKNB 1ZJ4A 3BREA 3DE7X 4IDEA 2XZDA 3UMMA 4RK0A 4D6PA 2G88A 3PHLA 4RK6A 3TSYA 5CH8A 4WZAE 1C7ZA 4GNKA 2DQKA 1XYVA 1FXSA 4AB1A 2NP6A 4MO9A 4B4DA 4CR8A 1PJ4A 2ZRJA 2HMUA 4MV3A 1VPEA 1CUSA 4HN2A 4KYIB 2RRDA 2Y0DA 1Q74A 5DB4A 5ALJA 5JUMA 4XCVA 3ZCUA 1DGJA 1RHRA 4Y6QA 4RZIA 5IC6A 4OV6B 4J9RA 1FQJA 4TZKA 4OTZA 3WLHA 3I8OA 3OZIA 1J7JA 5F4ZA 3LBNA 2ZYWX 2Z09A 3VKUA 1B41A 3RFAA 3BRCA 1EEHA 1W9MA 3W5VA 5KTTA 4XUSA 1H5NA 4YY3B 3KXKA 1L3IA 1ONPA 4N8DA 3RJ9A 1QRUA 2C8LA 3TAXA 1MGPA 3A36A 5LYYA 3A58B 1L7OA 1T2AA 2HPAA 2I1VB 3CM0A 3NHRA 4IZHA 3ZGLA 1ZCBA 2D0PB 2SECE 1SM4A 3D54D 5AVXA 4QTXA 1LSSA 1U49A 3WLPA 4R5MA 5CIWA 1HYQA 2VRWA 2W2NA 4AZ0A 5IYZA 3U09A 1V5FA 4NCNA 3OMLA 2B4YA 2X9VA 2CVPA 1DUIA 4RD3A 1X6IA 4RZQA 3DP9A 4Q4AB 1DG3A 1ZD9A 4CL3A 4BEJA 3D0QA 1EFUA 1ISPA 10MHA 1OA1A 3IDAA 3DFKA 4GM0A 3JZIA 4F2HA 1WEHA 2XMPA 5KTMA 1P9RA 4DKXA 4Z2YA 5BVGB 4GEKA 2YCLA 4HNGA 1SXQA 1HY3A 2G25A 3V8MA 1WOYA 4YNBA 1EUZA 3NQ41 3HDQA 2VXCA 1RYDA 5DB8A 4KPUB 2RGGA 2SKDA 4A0HA 3FVVA 1KU6A 4FB4A 3AR6A 5EGSA 2XVXA 5BSRA 4OIFA 4CM7A 4OQMA 2QD5A 4DYHA 4RV4A 4QDUA 3WNQA 1R8JA 3PGXA 3JZDA 1G21B 1JBQA 2VOEA 4ZT5A 1RYMA 3PBKA 2NO4A 3BX1A 4Z4HA 5F2NA 3GJ6A 3SM9A 4EGJA 4I19A 3L7IA 2WTEA 2BT4A 1WHTA 1ZN2A 3GJ0A 3MFIA 5FL7D 4EL0A 1S2NA 1IRIA 4JLKA 4GOKA 1NF3A 2GR9A 5I7HA 1OD6A 1NVEA 4YV0A 3OIDA 4DZTA 3SXPA 1QTMA 3ICCA 3FKJA 4DJDC 4IF4A 3MEQA 3VO2A 2W3RA 2FDXA 5HMLA 1NYLA 3I83A 3EG5A 2C7RA 1AKMA 1FDIA 3MLEA 1AKNA 3SJCA 1KOGA 3H2YA 1XTRA 3FVTA 3GFKB 1NN0A 4IXNA 2VHJA 1MO2A 1Y3HA 2JCBA 5IC5A 4GGPA 2Q62A 3F5AA 1VI2A 3UCEA 3A6GA 5IMBA 5I7VA 1VIDA 3T5CA 1QFJA 1ZITA 3EIUA 2GA8A 3SC2A 3FFTA 2LP4Y 3VTZA 5IUNC 2EP5A 1I6LA 2OBLA 1ZUD1 5CDHA 2WM3A 3NV9A 2AQ8A 3N07A 4OD0A 2P8SA 2O8VA 5B5EU 1U8UA 3SCZA 3CUTA 3KYCB 4FYHA 3JD2A 3I37X 1NUSA 1T25A 4NFSA 5BWOA 2QVBA 1F3LA 1EK1A 1CUWA 1HNNA 1JXOA 5H3CA 5M29A 2HHLA 5JJCA 3UB4A 3WDSA 3X3HA 4EY7A 3PT5A 3WX0A 3EAQA 4QBIA 2PMCA 1XRPA 1EXMA 3PSPA 2I3DA 2VXBA 3P20A 5BSUA 5C7YA 3I23A 4PSKA 1XDWA 3WLSA 1G7SA 2FA9A 4LCEA 1QF9A 3H8SA 3TW0A 1XA4A 5EHGA 4HNSA 4MS1A 3M7DA 3LUJA 1U8XX 1JDSA 1V3UA 1XQVA 2V7QD 1JJVA 2ROQA 4H3SA 3BILA 4AS1A 4QPDA 3U31A 4QUEA 1I01A 5CFZA 2HLPA 3VX4A 4DM3A 3CVXA 4HRYA 2JJ1A 4K1LA 4D6YA 4RFLA 5JQWA 4EHNA 2QRPA 4ETWA 4IXWA 1TO1E 5DP2A 1E6EA 1Z00A 4ND3A 1XDGA 2BM8A 3ZH2A 4DCUA 3WB0A 2ZT7A 3UMYA 3SQIA 3ZTWA 4BO7A 4IIXA 2CMHA 3VR3A 3V1MA 2EFGA 3MGAA 5D3ZA 2W3SA 1EFCA 5CVVA 3LOUA 4G26A 3SN6A 2Q9UA 3R44A 5BSGA 1S89A 3WICA 3MTGA 3CVJA 4OHWA 5BRAA 2YASA 4CEHA 2F55A 2BDPA 1JP7A 4YP5A 4RMJA 4QTUB 1DBSA 3ADDA 9ICBA 1AVTA 4QFCA 2QEQA 4Q9IA 1WXFA 3LNCA 5FNVB 1W34A 1GNPA 4FZNA 4MRMB 5AQ1A 1FMTA 1CUHA 3FOFC 1WDKA 4GBGA 4X91A 3GO4A 2QRJA 3WYAA 4UM9D 4OUKX 3IBCA 1AK9A 1ZVVA 3C43A 5GZ6A 1FTGA 4DNFA 1R00A 1MABB 3LPMA 1W59A 3TLZA 4AUNA 1WMFA 2IC5A 3EXHA 2Q0ZX 9LDBA 1TCCA 1T8SA 1DRKA 1LPMA 3KM0A 3M6FA 1X9IA 3N74A 1QG4A 2BEUA 2E5WA 3PSHA 1E8NA 2WM8A 3EE6A 4DA4A 4HR7A 1MO6A 3HDYA 2X5XA 4U2EA 3B38A 3UMCA 1A4IA 1QTNA 1I36A 2H8KA 5DB6A 4HWGA 3M6XA 4KC0A 3EEIA 3SSAA 5KFCA 1MB0A 3QWBA 4Q16A 3ZWOA 2AWNA 3OZEA 5CGZA 5JZSA 4NQRA 3A4VA 1JJAA 4OXYA 4GHWA 3FCAA 3DE1X 2ZT5A 4UHBA 5D1HA 4K0KB 3DPIA 1TC1A 1FX1A 2ZRCA 3MGHA 4PQYA 2WSLA 1BD4A 1OFHA 3ZHVA 1XCPA 3EMVA 4TL9A 2Q4EA 4NHEA 1DC5A 2I33A 4LQCA 3NEPX 1ESNA 1Z0IA 2WA2A 1GPJA 1FQKA 2FN7A 2AXTU 1J0BA 3NIWA 1N7HA 2BPGA 2RIPA 5K8TA 1BXZA 2A9FA 1XSEA 4QZIA 1JRPA 4LI0A 5GGYA 1W7AA 3VJKA 4W6QA 1OZGA 1JKIA 3JCZA 5J43A 3EWIA 3SZOA 1U0LA 4BNIA 8ICUA 4OB8A 3DYIA 2VBIA 1NX9A 4NK5A 2Y92A 4ZVUA 1XZQA 3N2GA 1EUQA 2CXRA 4UVHA 1FW6A 1KEEA 2R6AA 3RPEA 1D6SA 2AD1A 4L4ZA 3ZK7A 3A4TA 1VCHA 5G0TA 4UPDA 4UB8U 5DHUA 2QJTA 3JAKA 2WFAA 3K9LA 4HBZA 4QWBA 4TLAA 1P17A 2VTBB 2VBGA 4FBTA 4V1CB 4XJSA 3LWDA 2KMDA 1DTWB 3EH1A 4PLVA 1NVWQ 5I9NA 5FBHA 1EM8A 4IR9A 4A73A 4OATA 3DP7A 5FWAA 2PSDA 3DMTA 1O57A 3HW8A 3K0HA 5JVDA 1H4VB 5BQ5A 3LLCA 2GN9A 2WF5A 2WD8A 4P35A 4NBUA 2J41A 4B31A 1Y6ZA 3OT1B 2WDZA 2AU0A 1E1QA 4YMWA 3K09A 4GKJB 1VKOA 3RNOA 1Q5PA 1EDZA 1UC4B 3JY6A 1HR0B 1U5BA 5TT0A 5JXJA 4ENWA 3K9HA 1KAHA 5FUQA 5I9IA 2P4QA 1JDVA 3KVOA 3F6BX 2HC9A 3G9ZA 4P2GA 5C7OO 4Q4HB 4XX0A 1T8YA 4ASUA 4UAVA 2BKVA 3AVOA 3NHYA 4TV8A 4D8YA 3BS7A 4AVYA 4BLOA 1UBRS 1K6IA 3D7MA 3SEAA 3KCQA 4BFZA 4ALNA 4ES6A 2AEEA 5DTQA 2IOFK 5T6MA 4TS9A 4EGFA 4AS2A 3E70C 4LC1A 4PIPA 1LZLA 2W71A 3K2IA 5D49A 4MYRA 3OIGA 3OTGA 5KOHB 2ZPTX 3PR4A 5THXA 4ZGWA 1T2DA 4YT2A 2W00A 4EVSA 3DTVB 1CSEE 1GQ2A 2H1CA 2ZZMA 2OLKA 4TVOA 5LLDA 4E88A 3GMDA 1SRRA 4EEXA 3IAM6 3TB4A 1UDRA 5D8DA 5F33A 4A7PA 3OLVA 3WYFA 3DLIA 1WQ3A 2WP0A 2RBKA 3ZWDA 4UMFA 1HYBA 1DEKA 3I9NA 4ZICA 4B6EA 1H9CA 4AY2A 3QEMA 2PGIA 3L1HA 2FZKA 1OH7A 4HGZA 4W5TA 3L41A 2DFPA 1V8ZA 2ZBFA 1WCLA 1NW4A 1DRWA 3URMA 3RSLA 3G23A 3BJIC 2JA2A 2HMAA 5BQFA 4QBTA 4N65A 1D1TA 1A9RA 4FFOA 3JQBC 2FVYA 4HAOA 5BMVF 3GPLA 7MDHA 5BR1A 5KDLA 1ZVQA 3KB1A 3RBXA 1ZNZA 2H63A 1AUXA 3DMHA 5FB3A 4D4GA 3PVSA 2F8TA 8ICHA 2AN1A 5FBVB 1OYYA 3D4NA 3KDPA 2GPWA 3WP0A 1P9OA 4O4JF 4RQMA 3NWJA 3IR6A 4Z6EA 4JBYA 4KX5A 1XMOB 4CQLB 1TXGA 2HQOA 2G6TA 1Z6TA 3HJAA 4DIKA 1XZHA 3FYHA 4Q44A 4N8SA 2QE7A 4JLPA 4MCAA 1FB5A 2BE7A 2CXQA 1Q0ZA 4BU0A 4RQ8A 1P4JA 2A0FA 4B4UA 4ZN6A 4F3TA 3N53A 1T5TA 5LC1A 3UKJA 4L8FA 4US8A 4RS3A 1Q8KA 2EZUA 3WIBA 3IV7A 4H77A 2X4GA 1EZ1A 3NHWA 4AF7A 4PH5A 4OQFA 1Z34A 3I64A 3GN1A 2ZYIA 3KXLA 3FLBA 3PENA 3DMRA 4KIUA 4QJBA 4DR3B 2XB4A 1X9SA 2A7XA 4FYKA 4LZAA 4E2FA 1CLUA 3M5WA 1H2ZA 1Y7IA 3MBYA 1FEZA 1MAHA 3BE6A 4EO4A 3MGCA 3EYZA 3RSOA 3TF5A 2ZI5A 2Z5VA 3T5GA 5CR0A 4O4HF 5D3QA 5AKEA 2J31A 1WW2A 3BD8A 3FOCA 3LQKA 5I9TA 4PZ9A 1XJ0A 2QR5A 2FF7A 7YASA 5CB8A 3BS4A 3F47A 4CLRA 4WLOA 4RV5A 5BUCA 1PR2A 5BW8A 3OZFA 1SXJC 4DDWA 1CIVA 4QHTA 1OH5A 4PLWA 3ZV3A 4LMBA 3OE7A 1TZ2A 5CNJA 5KTYA 3T9DA 2VF8A 5CJPA 3E9EA 3WNCA 4MVXA 2I7VA 4QZVA 1BZYA 4I1OA 1XSPA 1H9AA 1SG9A 5L6LB 3LBAA 3O3NB 1RWVA 4PBSA 1EFVA 1Z0DA 2Q3MA 4WBNA 3PRJA 2C3OA 2VPQA 2UVPB 3SS8A 2V74B 2J3MA 5JQGF 2XUJA 2XW6A 2CK3D 4AJLA 5F78A 1G6Q1 4TLEA 4M8SA 4EUHA 3FR7A 1I5OA 2AFHB 1Q57A 4QJFB 4MMYB 3LCCA 4BQPA 1NM5C 2FMQA 4AN1A 3LLMA 1GDHA 1H6DA 4JL6A 1N5MA 4B2PA 2OXTA 4UFOA 3TTXA 3LWZA 3RUHA 4HVLA 3HN2A 2ZXUA 3SK0A 2ZBQA 1MQAA 4O25A 5HK8A 5KNLA 3KQNA 2JAHA 4RNCA 1PBNA 2DPXA 4AJEA 4N12A 4LZWA 4KWTA 2XCSB 2PIAA 1L5SA 3IUYA 1RYZA 3C7CB 3ZKWA 4EF5A 1Q1QA 1P1JA 2EFJA 3VPSA 4KH0A 1C30B 2VJ4A 4U02A 3PPIA 1J2TA 1VCMA 4N5NA 3IMKA 3KKAC 5KJ6A 5IWCA 4XXHA 2XKJE 4QKQA 3Q3IA 4BB0A 4MIYA 3N2EA 3IURA 4EFKA 3QOFA 3TM5A 3NAZA 4UBLA 4JOQA 1P33A 4YASA 5BNFA 3OQMA 4IDGA 1PG0A 4QFDA 5C18A 5HOQA 1M10A 4JUBA 2NYVA 5FL3A 1DELA 2JIDA 2FMTA 4PZAA 1YR3A 2NVUB 5DVZA 4Z8XA 3H3JA 4I9GA 3P4YA 1NU8A 4F5QA 3F8TA 5DYNA 2F8KA 3O2JA 1JJBA 1ZIPA 4HWOA 1GCIA 4XJXA 1FFBA 4QM7A 2IKSA 4AO6A 3AERA 3NG1A 1H94A 2IV2X 1ZINA 2IUFA 4DLZA 1VHLA 5CLHA 4YFVA 2W8BB 2D5AA 4LZJA 2UVWA 4JN6B 3T54A 3CEHA 3AY0A 2QD4A 1K98A 1NVAA 1JDZA 2IPLA 4FBUA 2JFPA 4R63A 4I2FA 1JA1A 4R9UC 2CFRA 4FX5A 4DKJA 1R4MB 3H4DA 3F1KA 5K0JA 3OFJA 3GZTB 4YAEA 4GR4A 3KD2A 2PZFA 1ZP6A 1JVNA 3TLYA 3JASA 1QS0A 4BKQA 5TMDA 2O8BB 5EOVA 3V4FA 4B6PA 3WQSB 1BH2A 4FHEA 1IHOA 1QP4A 3O8OB 3AP2A 1K7YA 4C03A 3OPMA 5EKDA 2DKXA 3FW1A 3JQCA 4UMDA 1K6MA 1QK4A 5LOVA 3T3DA 1UJNA 2QVXX 4QJ4A 2R18A 2WBLC 1C0KA 4JGIA 3AXSA 5HX7A 4EYIB 2VUSA 4C21A 2RHOA 4ITUA 3WIUA 1U8EA 5LQNA 1PFQA 2IEAA 4QRHA 8ICXA 1I6WA 4BATA 1VGRA 4MUAA 1V6SA 3G0DA 4ATNA 4UZEA 1D9XA 3GQCA 3TUIC 5DHFA 4ALKA 3HL4A 2PXXA 4FS3A 3CG0A 4J1NA 2WJZB 4RZXA 4EITA 1YZTA 3QNMA 2R5WA 4X7RA 4BIIA 1ORWA 2CFSA 1DKOA 3ELYA 3LY7A 8ICLA 4ZP1A 1W96A 1ZK4A 1CRWG 3D6NB 3ELUA 2H5IA 3CVUA 1XDDA 3PIIA 1YI1A 4HBGA 2Y67A 3F78A 4QPNA 3GNSA 1XA0A 2WAYA 1HG1A 4A82A 1V37A 4TXJA 2CB0A 3PQEA 1PGOA 1RW4A 5AJXA 2ZIUB 4KWIA 3IJRA 3ZY3A 4BN0A 1DMSA 5IT5A 1LRJA 2BVNA 5ILOA 2OVBA 1PE0A 3NEJA 1GU7A 2D0DA 2EKDA 4OI1A 4MYUA 4J0EA 5HHIA 3JVDA 1SVMA 3WMFA 5L9AA 3LWLA 5KDDA 3UAYA 4EA9A 2OD7A 2HUNA 5EMHA 3OLZA 1RRGA 3HU2A 1ZQQA 1J7KA 4R1MA 5AVKA 4WI1A 3NDIA 1GL9B 4F2SA 4ZXPA 2PJRA 2FE9A 3BD7A 2Z4RA 4BV9A 4A0FA 1UXOA 2VJBA 3RVMA 3AR7A 5KIAA 4IICA 4XKJA 2GUWA 1E5LA 1L8QA 1MNAA 4JJFA 4AYTA 5JISA 4QOHA 2IPXA 3P9ZA 1HPLA 3ROKA 1D7AA 1DOHA 4I2CA 2ZVDA 3CE6A 4V0QA 4O4JB 3MILA 4JIGA 1YU9A 1G6HA 4KLSA 3RLFA 4DJEC 3QJ5A 3RJ5A 2WJPA 4QBHA 5HWSA 5JC1A 4UBBA 1M1YA 4AP9A 1VBMA 4MROA 2O2HA 1RXCA 2D1SA 1K7FB 1X0VA 2E2WA 2DUNA 5I8WA 2JGNA 2YC4C 4C20A 2KSOA 1V45E 1I94B 1FFGA 3UJ6A 4ZVRA 4HDMB 3R8XA 4C5CA 2WE8A 1CY6A 2Y9UA 1AA9A 3NKVA 1ZJJA 1NWCA 2QTHA 1O77A 1G3MA 3QJGA 5KHAA 4H4DA 3MFQA 2PGJA 3WC4A 3D6TB 1G66A 5ALNA 1TYAE 4GFDA 1ISGA 4LFAB 4PR3A 4C0AC 4K05A 3WOVA 3B9JA 1P7WA 1C7QA 5ALMA 3GRAA 3Q40A 3AUJB 5BO5A 4KR2A 2O4CA 3IQEA 4B34A 1DDGA 1T5HX 1OGIA 3C2KA 3N6RA 2JLSA 1EFTA 1FDUA 1T5SA 4JHLA 5HHHA 1NRJB 4CT4B 5AXBA 1E2LA 1FP4B 1ILEA 1NULA 3CIFA 4MYSA 4CLDA 2RHWA 1HF3A 4QO7A 4H60A 2PZBA 3MT8A 2ZI6A 2HU5A 1M76A 4YC7A 1UJ6A 3PUVA 1KKUA 3UWPA 4B3XA 2C2DA 2G9NA 4PAQA 5IG2A 4RZHA 3IRUA 3OG9A 4XR9A 3BD9A 1LVUA 3G2QA 1ZQBA 1Y81A 1LF5A 2BTQA 1HTWA 4HI0E 1SQ5A 2J85A 2WKWA 1YDHA 3FIJA 3N76A 3D6FA 2EANA 4EHIA 1SA0A 4NZMA 4X66B 1HZJA 2BEWA 2OBFA 2WYIA 1UC9A 2GEJA 1ZQGA 1R16A 1E7RA 2RAVA 4I6EA 1Z08A 2AG8A 1ZRHA 3MCZA 5EKUA 2OB2A 4FONA 5HCIA 5IHXA 2A9KA 3ZZ1A 2PMBA 5GTIU 1GPDG 1UKBA 1V25A 3RAXA 1X42A 1HT3A 7ICMA 4NLBA 2AFIE 3DZJA 2H00A 3Q2KA 3OETA 3HWSA 4TZTA 1EUYA 3UMFA 2YZNA 4DQRA 1KJWA 5H3HA 3I73A 3KEGA 3N1UA 4R84A 2JBWA 2YOGA 1W4CA 2WWYA 3RR8A 4YD1A 5K0BA 2RAUA 3KYJB 5B3LA 3VPCA 2ZXFA 5CGQB 1IAQA 5BR8B 2ZE8A 2VJMA 3JQ9C 5BWNA 3T3GA 4MCIA 3VR5A 3RJZA 3MJTA 3FYCA 1M6HA 2EX0A 3T3IA 3MWEB 5ICMA 2PYZA 1NBMA 4FMDF 4ECXA 3OFNA 3SBXA 2WHEA 4NCHA 4X0EA 2DHDA 4KTTE 2C8KA 5GV7A 2BMVA 5B2EA 3QLEA 1GKLA 3DMGA 4YJ2A 1LDMA 4JP8A 3E5MA 1SL0A 4CMIA 4N0QA 5JECA 4Y30A 5JJ5A 4C0WA 1W25A 4YQYA 4AJJA 4FW8A 2Q28A 3Q7SA 2UZ0A 4C0JA 1D4OA 1J0CA 3K9QO 2XGSA 4LXHA 1ZJZA 1SXJB 1ZUIA 4RUKA 1UXGA 4HQRA 4I1IA 3UUWA 5KOYA 1NFFA 2BLNA 2MA1A 2B99A 4LYJA 2QJFA 3VM6A 2WINI 5J4HA 2FW8A 5AVOA 2FWNA 4U0JA 4X63A 2M6LA 3RRBA 4IH4A 2JLRA 1T4CB 3PNMA 4JY7A 4K87A 2DE0X 3MIIA 2K87A 2B82A 3KP1A 2W93A 4ZJYA 2EJBA 4DL3A 4KQEA 4JVLA 5JLAA 4NONA 4DANA 2BZ1A 3VOSA 1PVDA 3RR7A 2JFOA 2OC4A 3GLQA 1Q7EA 3V2GA 1PDVA 4KBYA 3AQEA 3E53A 1GD1O 1X8LA 5GZ1A 3KV1A 3GF4A 2CL0X 2G0TA 2X4LA 3HABA 1Q1NA 3GGSA 3TR5A 3PJEA 3UGTA 2JATA 3ZLUA 4UEKA 1C20A 3RG2A 2RHDA 5KDOA 3C48A 5L1IA 1PGJA 5IM5A 1NKBA 3DVLA 2D06A 3CNEA 1ZU4A 4PAGA 2QHXA 1FP7A 1OAAA 3MD9A 3NAQA 3UPDA 1HEIA 3QHPA 1A5ZA 3AOGA 4UD2A 1RLJA 4ZVPA 2Q5EA 3V7YA 1MRNA 2X0JA 1W47A 1VJCA 3P0IA 4XW2A 3J81k 1B0PA 5F7XA 5IN5A 1GAQA 1P18A 3CR7A 2ZR7A 1C3VA 2NXEA 2X8LA 4Q39A 5A06A 4MYCA 1CJMA 2IPMA 4LBWA 1E3LA 2DPGA 3AI3A 3BB1A 3STTA 1XQXA 3U2QA 2PI4A 3FPSA 1JA0A 4MV5A 4QUGA 4QXAA 1FOEB 3FCUB 1VLQA 2HREA 2YV3A 1E6KA 2B9VA 4X6XA 1M0WA 2QNBA 2XNKA 2WI8A 7ICQA 3PR1A 5ALWA 2EWMA 4MUIA 4QJIA 3KPWA 3N8NA 4P1ZA 2PS3A 5CDUA 2DQNB 3AM5A 4LE1A 5MFZA 4C8KA 1EBFA 3Q9UA 3BCHA 1M8JA 3TKAA 3LHDA 3AJRA 3KHTA 3NBAA 4W4TA 3TR6A 4Q4AA 4IP0A 1N2ZA 5HZMA 2JF0A 1BD3A 3IT1A 2RAFA 2IYOA 4B6OA 4N6GA 1FUYB 4GL4A 5BVGA 3MRSA 2XWSA 4ZO8A 3HO1A 3O26A 3F4LA 1SV4A 2D59A 3KLOA 4GMKA 2ZJOA 1HIWA 1G5FA 2OXOA 1T0PA 1CZLA 1G16A 1A4XA 4KPUA 2ZUWA 3RJFA 4IQGA 3EA5A 3UHOA 4CLXA 3Q3GE 1WMEA 1JNXX 4K5QA 3ZHSA 1OPRA 2WWHA 4UU8A 2XDAA 1OFUA 2CV0A 1YNOA 1M7HA 4DIMA 4USAA 1G21A 2PGAA 1PUJA 2GPSA 4FJ0A 2DF4B 4NH0A 4Z9YA 1JF8A 4E30A 4EKEA 3FZEA 1QIJA 4CG1A 4G84A 1M1XB 3I05A 5A02A 2CUTA 3AEVA 2EARA 4OYYA 5SY6A 1NLZA 2O7NA 3QP9A 2FJ0A 3S2ZA 4JBGA 4XSVA 3RVRA 5BV7A 1JQKA 5JXIA 2OEHA 1H5UA 3EDOA 4H3KB 3LYLA 2RGBA 4Y9SA 1ATIA 4OI4A 1S9FA 2RJOA 1JAZA 1L3CA 3RB4A 4M9JA 3RSGA 5UKDA 3FKSD 5KFZA 3B5EA 2NRWA 1Z4JA 9ICWA 1UKVY 5I8ZA 4ZAYA 4PGFA 4ZVSA 1Z1VA 2D1QA 3CY6A 2XADA 1PVVA 5KSYA 3KLMX 2LI6A 2W4IA 1L7EA 2ZTLA 5ARCA 4F5OA 1W0KD 3DKVA 4YALA 3IODA 1ZI9A 1ZMBA 1B8VA 3CEPB 3T41A 3KYCA 4TYNA 4KVZA 3I53A 3TEJA 2QA5A 3EW7A 3ETGA 3I1JA 4BBPA 3ORRA 5LIRA 3TMYA 3EZ2A 3MPUA 5LKRA 3QVVA 3H3XA 1G1MA 3OUTA 1MSWD 1RI5A 3A4YA 4XGQA 1Z4NA 2JVJA 3M34A 3ED5A 4PYOA 1MQSA 1SURA 3L6CA 4WXYB 1H4SA 4AZSA 4HB0A 2Y1KA 1WVIA 3VSAA 4YUZA 4MB0A 1C29B 5BWLA 1TUIA 1E9RA 3W3AD 5DNVA 1GDTA 1YDFA 2AKAB 3HUDA 3RU3A 3FHTA 3T06B 3DKIA 3TADA 3SI8A 4KW7A 3SBOA 2I4OA 2Z95A 4TTJA 3PW4A 3FCSB 4QZFA 2XGOA 1DIHA 3L0IB 3FR8A 2EDUA 2IYQA 3GLGB 1T34A 4J6EA 3TD2A 1J56A 4G5SA 2IDZA 4EMTA 5KKAA 3WXBA 3ND6A 5JSHA 3QBEA 4Q1AA 1T9HA 1MB3A 1MC5A 2ENUA 3IS3A 4I99A 3VR2D 3K0FB 2AL7A 1Q6YA 2AZMA 1T9ZA 5JAPA 2HDWA 5HDQA 3KIPA 4YRRA 5FNVA 2D62A 4MRMA 4GLBA 4KN9S 1D5WA 1PDOA 5JAHA 4LS3A 3AFHA 4GBMA 2GZDA 1MABA 3VHXA 1Z5GA 2HHJA 3QV2A 2X86A 2PT7A 2FMPA 4GXNA 2X0NA 1TZKA 2HZ7A 1O97D 3AM4A 2ZDGA 3SKXA 4YN4A 5CDFE 3EQ7A 2IY9A 3ZE7A 3ZGXA 2CRXA 4J2TA 4MVJA 3L8CA 1T5OA 3PRKE 1S2LA 3LX6A 4W5HA 2FLWA 3GK3A 5D1NA 4YAWA 1EVIA 4ZOEA 5JARA 1M75A 4D0LB 1NK8A 6PFKA 2Y0BA 3G0IA 3ZR4B 4C8LA 1S9DA 2CWDA 1CQJA 3VI4B 4Q19A 2CYBA 4Z54A 4IHJF 2R6FA 4V0LA 4YJGB 2C54A 5AOVA 4JNKA 4DL4A 1AA6A 4UTOA 4Q1FA 1L5ZA 2BWJA 1T0UA 2BFCB 4JOCA 2EKZA 4BE7B 4EI2A 3M6VA 1GFIA 2AX3A 3MSXA 3AFOA 1SH7A 5T3YA 3P52A 1DCFA 4JVMA 3TQ1A 3UMRA 4O2LA 4UNQA 4RSRA 2GETA 5DM4A 4DY6A 1KI1A 5LLTA 3AKEA 2ZVJA 3T0GA 1CS0B 5IF3A 3E5RA 4C1BA 3RHSA 2AI2A 4G0NA 3ZJTA 4YTEA 4JWNA 1YGPA 9ICPA 2A1AA 1B7GO 3NH6A 4D56A 5L4SA 2R8PA 5EQFA 4ELUA 5AXDA 3UJ3X 4FEYA 2CEAA 4QYMA 3GGPA 3EQ6A 1PQ4A 1BHO1 4LZOA 4I2GA 1ZSNA 4YAFA 2PK3A 5J2TB 4NESA 4V1CA 1UKCA 3MTDA 1GA6A 1SXIA 4RQAA 1DTWA 2PFNA 1JXEA 2A30A 3K5PA 4G8DA 2C42A 3D43A 2EQBA 4OSPA 4KLDA 3LQQA 2F44A 3A4MA 3KLNA 1OI2A 3WLOA 5H9VA 2VP2A 4L4UA 3CVYA 2B92A 1XRMA 4RD6A 2O2YA 3RFUA 2CEKA 2OCLA 4B3RB 3A0BU 3I4FA 4O8ZA 1SMKA 3TAUA 1Z07A 5C1OA 2DWPA 2QUHA 2DM6A 3QPDA 5CFPA 4Q4HA 3ROEA 1VSTA 1JHOA 3K0KA 4BC1A 3SU8A 4I3FA 4R54A 4WOJA 2H4YA 3JWHA 3L01A 2W55A 4J0HA 4TUYF 2KWIA 4KITB 4YDRA 2FI1A 5FUMA 1UT8A 1YR1A 3PGA1 3CRXA 1XDZA 2XKKA 4AZWA 4DLSA 1RAHA 3KX2A 4K03A 4HVCA 5B1DA 5ER9A 2P7HA 4BBAA 5EIOA 2ZIVB 2PR2A 1U0HC 1YHYA 4BQOA 1NW7A 2GBLA 3ZYCA 2XMQA 1WP9A 4KI7A 1GU1A 1IHDA 4EW3A 3ONEA 4HB3A 5KOHA 1AO0A 4Q3CA 1R6BX 3CF4G 2Q99A 5KFBA 3QLVC 3ISJA 5TZVA 3DTVA 1OGYA 4QTZA 3PF9A 2EW1A 2RIRA 4GQAA 3IT2A 4RD2A 1HTBA 1SUFA 4IX1A 3THOA 3NYRA 2GWHA 2VHXA 4JJ7A 3G59A 3OQJA 2UVUA 4H3HB 3IA7A 4MQEA 4DQUA 1LLDA 1VB5A 3LMKA 4PN7A 5KG4A 1BHJA 4BNLA 5LBIA 4J94A 3NHBA 4GFJA 1YVUA 2QAJA 3VR4A 2QLMA 1OGJA 2RDMA 3TBKA 2FMSA 3ML1A 4M0LA 1K6JA 3E9NA 2SCUB 3ODPA 3AEKA 3FUTA 3ZLJA 2R8EA 5J3JA 5AIBA 2G9ZA 2OBXA 3KYIB 3LCRA 3PFBA 2VTVA 2C77A 2H0AA 3PX2A 2R8OA 3EMKA 2QX6A 5K0TA 3GDWA 1IH8A 3O3MB 1O95A 4LVUA 2ATXA 1W5TA 2X8JB 2OR3A 3SZLA 1S4QA 4EY4A 2B5VA 2OEPA 3MC1A 4GP9A 4BFXA 4NZYA 2E49A 5CBKA 3AVVA 3RK0A 4CQLA 4RLHA 5DMXA 2QX7A 1IY8A 4G1FA 2GK4A 1KL9A 3VR1A 4YJFB 3AUXA 3AUYA 2H2AA 3LVVA 5J2UB 4D4KA 4EKDA 4PG5A 4I4IA 4HQOA 3U4HA 3C28A 4FP9A 3N28A 2HBYA 1HDIA 4QATA 3RB3A 3ZOKA 5FIUA 3MD0A 2IOQA 2W2LD 2Q7DA 3ZVMA 2DLDA 4FHGA 1W93A 2IZ7A 1T9GR 3OCYA 1MG5A 4HQ6A 4L9RA 1X40A 4WZBB 1VKZA 2RFLA 3M9OB 1W6RA 4MYHA 4HWKA 3U19A 1PS0A 3PPVA 4X8OA 3A7DA 2PJZA 2GO1A 4U7CA 1ZUNB 1N2OA 3GV7B 1N8KA 3R8FA 4FMPA 4IDCA 2FGJA 4MUXA 3L6UA 1UKEA 1HDYA 3K05A 2IFTA 2PJDA 4YCLA 1EDOA 2ALJA 1QG2A 1Z18A 4UB5A 1CFZA 3WMRA 1IZYA 5GINE 2YDXA 4TROA 4ENVA 3G6KA 2R7KA 4RF3A 3OSNA 3MGKA 4K9NA 2IVFA 2IBSA 4TL7A 4QNLA 2VHWA 2O23A 2UKDA 2BUBA 1IU9A 2EBUA 3GCGA 5I6DA 2O1SA 2HHQA 1DJOA 1QKKA 2WU8A 4MHVA 5IEBA 4NOLA 5BQ3A 3MJDA 4JBIA 3GDOA 3PHIA 1FYVA 2BZGA 3DFMA 1XPUA 5G1PA 1KDVA 2UVPA 3B85A 4BQRA 2CLHB 1XVIA 5HILA 2DX7A 2GUGA 3PTLA 4KXQA 1Z4OA 5CH5A 3OH8A 1SC6A 1ZXIA 1X1EA 1Q0RA 4V3BA 1WPGA 3FPGA 3DO6A 3K94A 2AFHA 1E3QA 3VH1A 4FX2A 3PZBA 3TOSA 2V9ZA 4C3VA 1EUDB 4F5NA 3CKKA 1TTPB 3HUFA 4UPVA 2BHTA 2CUKA 3PRHA 4IV8A 5BW4A 3RKUA 2Z3ZA 3W2IA 3RKRA 2XNHA 3T1TA 4KPEC 3B5JA 3DW1X 5LYJF 3W0LB 2BGMA 4A4DA 1L5HB 4NBTA 3L18A 4GXRA 3INYA 8ICSA 2OCPA 1E1RA 1MPTA 1YCHA 1PWZA 3ABQB 1QHSA 5KT7A 2GEUA 3RVJA 1BFKA 2MDTA 3PSAA 5LPNA 3EXIB 1U4OA 5EAIA 3SOZA 4KRXA 1V39A 3KTDA 3TEFA 5DX8A 3KZMA 1XD2B 2DHCA 2JHPA 4JGGA 4PL1A 4B9AA 2OZVA 4IO1A 4BLPA 4QWEA 1DBQA 2CL7X 4ECSA 4K1XA 4BMCA 2YXNA 5ALXA 2MSCB 1IN8A 2ECKA 5LBUA 1PHPA 1FFXB 3K0AB 4YRZA 3FZNA 4UHJA 3SQDA 3W90A 2PZKA 1WB9A 3LVFO 1QH0A 1MB4A 3ZW7A 2GDZA 4HGQA 2W11A 3OQIB 2C99A 3UAZA 2RGCA 4XYEA 2A3NA 1TK9A 5CB6A 4KO1S 1Z5WA 1JILA 5AI6A 4JMUA 3K1YA 4DJ5X 4V0SA 2NVUA 5ALEA 3LUCA 1F8UA 3KSDO 2JZNA 3F2BA 3CUKA 2WR8A 3D3JA 1T4GA 1XU4A 1U80A 3GLRA 9ICTA 4NPAA 4OBBA 1XCBA 3HJFA 5AJWA 5E2BA 3COPA 1RKQA 3C5WP 1RHQA 2ZJ4A 1QX4A 4QSHA 1BCSB 2FSPA 4NVRA 2W8BA 1U7OA 1BWRA 2MTBA 3OU2A 1LBEA 1B42A 2HGSA 5D46A 2C2YA 2JARA 1E2NA 5CLIA 1X1BA 3W78A 1UBCA 1NJ5A 5E0OA 1EFLA 3K9FC 1R4MA 3TPZA 3OLWA 5ALYA 1MBZA 1CE8B 2NP7A 4DCSA 5KYNA 1VL2A 1Y7HA 1RS0A 1Q3KA 2FP3A 1N5JA 2V7VA 1Y33E 1GCGA 5JG7A 4DMUB 2RH4A 5T41A 2O8BA 3K2BA 1L7PA 5BP7A 3X0DA 3G3EA 3I12A 2B61A 3GN2A 3GEBA 3O8OA 4HUTA 3JD1A 4D43A 3KWLA 3K6RA 4QBKA 3Q87B 3GVIA 2C3PA 4W7IA 1N5LA 1KJIA 4X7MA 3GP3A 3C70A 3GIMA 3Q7RA 1N34B 2YH2A 2FH5B 5AW7A 3OZUA 5FPHA 2O2SA 2PL3A 3IHWA 4NI5A 1M66A 2HA4A 2FFRA 1Q1BA 1JAYA 3WLAA 2HJGA 4TUYB 2AXQA 4WEOA 1TAUA 4RVNA 5HXAA 3BCUA 1OH6A 2DGDA 1E5XA 1IVSA 1OAOC 1UODA 3L4EA 1YRWA 1QCCA 4NV3A 3QYPA 1OI4A 2GEVA 1UP7A 3H1BA 1U2QA 2K60A 3D4OA 1QAQA 4RGVA 5K8UA 1J8DA 4B0OA 4MH0R 1KFEB 3C85A 5L3SB 1XLTA 4UB4A 1OI7A 1F44A 3I9MA 2HA7A 4G0OA 4HXYA 1GNQA 2QT0A 3LUPA 4TXNA 3TGPA 1SIWA 2Q5IA 1P8AA 3I9FA 2X0DA 4FBLA 1W30A 1SC1A 5CA0F 1PI3A 2H18A 4KN4A 4HYEA 4BNUA 4ENQA 1BDJA 3G6YA 4NPHA 2VZLA 3WVNA 9ICLA 4KWCA 4MP6A 1SUDA 3N2LA 2ZIUA 2X0KA 4DQSA 2LM1A 4DIBA 4HS9A 3AK4A 3TNJA 4OL9A 2OBNA 2P2ZA 3QMVA 3KKQA 4B6FA 1ACMA 3BDIA 3MINB 4Z86A 1PN3A 5DI9A 1K0FA 3QW4B 2VRBA 1M8KA 3PQ8A 4L9WA 2DMRA 3CNBA 3VKVA 8GPBA 2O19A 2PLAA 5GTDA 1OX4B 2WM2A 3VNBA 3R3WA 1PVRA 2F9FA 3F7OA 4V39A 3O0FA 1NXVA 1MJ5A 3FRHA 3C87A 3H04A 1A5AB 2QZZA 2YY6A 2P9YA 1WDTA 3QGMA 4FDAA 4O4JA 4CF6A 1WVGA 3CLHA 1ZQEA 1VJGA 5FOTA 1TLTA 4NENB 4IH1A 3GW8A 4QDTA 1EQAA 2ZUTA 4E1BA 1E3JA 4DQPA 2HWKA 1ZNWA 2F3TA 4PM4A 4F1WA 1OTXA 4HDMA 1EK2A 3CV3A 2DWOA 3IOMA 4HDCA 1JEYA 4NL9C 4JT9A 1PW7A 1V48A 1WPXA 2VNAA 1WMAA 2ZWVA 3EXAA 5K01A 3E0FA 4BTLA 4CGZA 2NTJA 1A50B 3EFEA 4N7BA 5EKSA 1ZIDA 1HI9A 2GNPA 4ARSA 4UFPA 1AKWA 2G6BA 2WMDA 5LWHA 3MK31 4MW4A 3O8QB 3DBLB 3MT0A 1FRQA 3KZ1E 2IQ5A 1LPBB 3PVZA 3ZD7A 1AKTA 1T6BY 1SHUX 4DRXB 4DCOA 3ABIA 1UR5A 1FP4A 4KIJA 5LZ5A 3J81j 1Y8ZA 2ZBRA 1L1RA 1JXMA 1Q7TA 1ESDA 3CPSA 2JKZA 4YMSA 3L7MA 1T9AA 4M0EA 5EMNA 2ZUSA 1XMJA 3MYRA 2FLLA 2VDOB 1X7DA 2YWCA 1VPWA 1SPBS 3V6JA 1X7XB 1DBRA 4DLNA 2UV8A 3OZAA 1MMFB 5JPDA 4FPXA 3MR2A 1P2BA 1XTZA 3OLCX 1M0TA 1D2RA 2JEGA 4ED1A 2I8LA 1PJZA 2PRKA 3E1SA 3AYXB 2JZCA 3KZXA 2VP3A 5JMOA 3FM9A 3M9XA 2FG6C 1ODLA 1KAQA 3RR2A 2C9ZA 4B0PA 4LYYA 3BXFA 2A1TS 2AMLA 5J5CA 5AVVA 1TKRA 2YXEA 2H9YA 2VK1A 3UENA 4GSYA 3IGFA 2PS0A 4X97A 5KNDA 4MJLA 4PO3X 1JFVA 5DEIA 3PEFA 4B33A 3G0CA 3WO1A 4ESOA 2VDQB 4CL0A 4EPWA 1N2JA 1F3OA 4CUZA 3EZNA 4LJKA 3GGDA 3D6MA 4W5QA 2A0UA 2VYND 2CLEB 4TMXA 1WZCA 4QE3A 2Z4SA 3OKFA 4FHFA 2Q49A 2VZ8A 5K9ZA 3FCXA 3M6ZA 1T8RA 2JZOA 4GR5A 2HA5A 5KFJA 2KJ8A 3TLAA 3L4BA 4OREX 3LQ1A 1E3MA 3M4ZA 5JIBA 5AI8A 5IVIA 3MWEA 3DR5A 2JI9A 4RPHA 2Q1YA 3P9PA 3QLTA 5JAIA 3LFUA 5DM70 1PHRA 1HFWA 2V7EA 5DDMA 1KYIA 1QRRA 1JU4A 2ODTX 1IBRA 5KFPA 1M2FA 1Q0HA 2NAPA 5DBHX 3K30A 4QVGA 5DKWA 2Q8QA 3WTCA 3E03A 1TTHA 3OPYI 1Z88A 3ZNNA 1RE0A 1KO5A 1QIGA 4G3XA 1REQB 1TTTA 3S3TA 4PINA 1GA1A 2ZBEA 2AA3A 2JLXA 2Z43A 1WMBA 3RIHA 4RZ3A 3UJNA 1OZ0A 4BNHA 4QAQA 4ZI5A 4TT3A 2JEFA 3EAFA 3H2GA 1X6JA 4AF6A 3HKDB 3SDBA 3CR8A 3PW7A 4BZXA 4IDPA 5JCOC 2WF8A 1T4CA 1N57A 3CRMA 1ZUHA 2XODA 3IEUA 2JLWA 5CT9A 2BEVB 4HRAA 2O0MA 1K4KA 3Q7IA 5J40A 3LZDA 3NM4A 1DEXA 1E2JA 4KR7A 4X92A 4F3RA 1FDVA 5F5NA 3VVCA 4K6FA 4RPJA 4EY5A 4J7CA 3TFOA 5A6VA 2ZQZA 1FE8A 4N01A 4KJXA 1QQBA 3GFFA 4F4ZA 3KOZA 5KVCA 3UMVA 2WW8A 1XZFA 1GPAA 4KFUA 3FIUA 3S8MA 4RTSA 2GMWA 4KJZA 1D6MA 1ZQUA 1LX6A 1NM5A 4UAGA 1Q1ZA 3AF3A 1KLNA 3ADKA 3DA8A 1NQAO 4V0ME 3B1JA 4OXQA 3DDCA 4EFLA 1JLSA 1Y1SA 3PX7A 5C0YA 1YS1X 4Z9FA 1O58A 4XQCA 4KLUA 3TPFA 4LF8B 5AWFC 4L6IA 4BLVA 4ZI7F 1NJWA 4HSEA 4RBNA 1KK2A 4E3WA 3CCFA 2MUTB 2GK3A 4QQNA 1I3CA 4L85A 4GZ6A 1OXJA 2ZYRA 1DKLA 1QP0A 1VE7A 5C8VA 1E9VA 3JQAD 4G89A 5BSEA 5LD2C 5CP8A 4AU1A 1OTYA 4YXMA 3KKAA 3NOXA 5DN9A 3RRXA 1O4WA 1QKIA 3ICEA 1GZVA 3CW9A 4YCMA 4JD5A 1QFXA 3G7UA 3MRVA 1GNVA 4UCXA 4NMHA 1ZOPA 2FV8A 3U1TA 1KYZA 2C2XA 4X61A 4HDOB 5C3MA 2DWCA 3RCBA 4EZ6A 4O3RA 4BBJA 3HA3A 5TB5A 4LSMA 4QYSA 5B6PA 1OI3A 1JI0A 3ZWPA 3FC4A 4OQ4A 1AZWA 1SD1A 3C3EA 3QHQA 4EUFA 2G8NA 3EASA 1EGHA 1F0KA 3KKKA 1J49A 1M2WA 4BX9C 4N82A 5FLKA 3PY8A 4MUBA 3PX0A 2G8LA 3P32A 3PT9A 2XE7A 3SIWA 2VF2A 1QVRA 3WBJA 3D8UA 1MVLA 2ZI7A 2CNLA 1O89A 2RK6A 3EDMA 1K1QA 1CUGA 1TMOA 4IFTA 3EVGA 1CB7A 4NY1A 2HR1A 2UYGA 5KJ1A 2BHSA 1TA9A 221PA 2PFQA 4PV7A 1XTKA 4LHSA 3DW3X 3ANMA 5DLFA 4JUIA 5DGHA 1QUFA 2DSTA 5DBGA 4RQ7A 5HKKD 1BPDA 2Y2UA 4LJAA 3ZQ6A 4JP1A 4R5HA 4F8EA 4IV5A 1Y5RA 1N0HA 2B6HA 1XPJA 3O2SB 1YDGA 5SZJA 5C1DA 1K3TA 1GUDA 2NWQA 4YROA 5HE8A 5KWJA 1EFRD 4IVNA 4QJ3A 3SXUB 4I2NA 4LXTA 3KHRA 1W581 2QN8A 1WE2A 1TVCA 3OURA 5IINA 1VJ5A 1F20A 1U8ZA 1GTMA 3GT3A 4HDRB 4Q48A 2BKUA 7ADHA 1PG5A 4A6XA 1V41E 2YWBA 1THZA 1L7DA 5KFIA 1ZDMA 1WB6A 4IRCA 2XWBF 3DMYA 3ZBQA 2P1DA 2M2IA 4WKPA 1W94A 4HZUB 3O8DA 1RJWA 4D3DA 5BMVB 1X9XA 2ZSFA 1RRPA 2H3QA 3HYLA 4W9NA 3T9BA 1NOIA 4X62B 5FFFA 4I1SA 3DL4A 3K1AB 1H05A 3BAFA 3IPYA 4AQ7A 3DHNA 1GRVA 2AOTB 4AIIA 2CBXA 3N8IA 4XAQA 1EVQA 4I81A 3AO0B 1NW8A 2VYVD 2YRXA 5KYGA 3FNQA 1JPJA 3RANA 3G0GA 4EEYA 3WL5A 5DI3B 2PGNA 2P78A 1TCBA 4U6NA 1N3YA 3PNLA 3LCMA 2ZVPX 2WK1A 5E38A 3GOHA 1KH3A 2BDEA 1DWQA 5HA5A 2BHRA 1WUTA 2FWIA 3TLMA 3GUZA 3P0FA 4H2DA 3UY4A 4FHCA 4MIEA 4FNOA 1FYDA 1OSNA 5JPIA 3KHUA 4US0R 2DL0A 4K28A 1U2PA 1NR7A 1GNTA 1G7TA 4UBCA 1RKXA 3O9VA 4GDMA 1Q20A 3JPPA 3G5AA 2JLUA 4ZVQA 2P5YA 3BIFA 2JGEA 2H9IA 4FFVA 2GNAA 1RPLA 1F2TB 4O4HB 3COVA 4E6PA 5K3BA 1NQUA 2KLHA 5DYYA 3DH0A 4AMBA 5H8WA 3EA4A 4JB2A 3FN4A 3GLGA 2FW7A 4O5CA 1YQDA 1A2KC 3LZ6A 3M81A 5T57A 3KXIA 2JNWA 4LCBA 4J0GA 4R2WA 5CXXA 2DT5A 1CY2A 1FTQA 2CKDA 2HWYA 3VOBA 4G56A 4C22A 5AJTA 5JJKA 2BM0A 1JPNA 4EO9A 5D6OA 3W7VA 2EBWA 4DSIA 3V48A 4OHOA 2HU8A 2IU3A 4UJ3A 4FLFA 5K0ZA 3L4JA 5K5EA 1MB9A 3K0FA 3I01A 5COAA 1HOXA 1F4PA 3EVEA 2X40A 4OYHA 1RYUA 3HCOA 3TX2A 2XQGA 5JQGB 2ZB3A 1B74A 1K1EA 1W73A 3L40A 3PXCX 4KQJA 3WYCA 1ZD4A 2BGTA 3BFJA 3TG8A 3PUXA 1V11B 4YH1A 4Q7MB 1TPZA 2I7XA 4RIHA 3OKCA 3HKEB 4TLLB 4YMTA 4XVCA 1IN5A 4D44A 3M89A 4JSTA 2GYVA 3A06A 4I08A 2W6PA 5JCJA 2JGIA 3RAPR 4WFJA 2AUNA 3VPDA 5JJLA 3VU3A 1ZD8A 5KPJA 3IA2A 4GWKA 3GRUA 1FFSA 2JAUA 2CGEA 3ZVLA 2WHXA 4C3OB 4PHPA 3JVVA 2C9BA 5JAZA 1HM5A 3UMSA 3H1AA 3FHLA 4H35A 4YJGA 1TYZA 1IXKA 3IKMB 4BB6A 3C15C 4JEUA 2BFCA 5IH3A 2HSWA 2V6IA 1DT3A 2D13A 4I28A 2DTXA 4UFNA 3EXFB 5JR3A 2ZROA 4QOEA 1HG0A 5JMPA 3PDIB 4R2XA 3JD4A 3A0HU 1U0JA 2ZR0A 5J2CA 4BVLA 3K8ZA 2PFOA 4NLKA 4G07A 3H0EA 3NYWA 7ICVA 4E09A 1T36B 2ERYA 3F3KA 4Q8EA 3GT0A 3HM2A 3UV3A 1E7YA 3T3NA 2OCEA 1UBGA 2B7BA 1JIJA 1CS0A 4LDJA 1MA0A 2Q0HA 1KZ7B 4CV2A 1V8FA 2GD6A 4J7AA 4HKTA 3ANTA 2X58A 2R79A 2VJOA 1Y37A 4C5BA 2JFBA 2X2PA 2KG5A 1YZLA 1RABA 1FLAA 1PWHA 5J2TA 2R8BA 3SNKA 5TQ2B 4G4IA 3C16C 1QK5A 2XMSA 1CNEA 4ZT4A 4BBZA 2YWEA 2RGAA 1ZW6A 2UAGA 4Q9DA 3W1EA 2HHSA 1PZNA 5U9CA 3GPCA 4HQ0A 3A6DA 3LO5A 2WG1A 2IZ0A 4COKA 1ZA1A 4YONB 2MR5A 3VVLA 1CERA 2BP7B 4BFYA 5JTIA 3I5UA 5MGNA 5KMGB 1OY1A 4BCCA 3SHFA 3TZKA 1QHEA 3CUYA 3QY0A 3ZVRA 4Q4LA 1P44A 5EXPA 3OICA 4WECA 7ICJA 2Z6UA 2RGUA 1YFLA 4DJTA 1HE8B 1Q92A 4COOA 1WIWA 3N6VA 2G40A 2P0EA 3G0BA 3FYTA 1SVKA 1RYEA 2PH7A 3Q8LA 3QVUA 3TG2A 1ZQVA 4ZEXA 3VRHA 2WIGA 2VEOA 4ME6A 4YJ3F 2NZYA 1B1CA 3FNGA 2ZBPA 2IHJA 1FS5A 3ZXXA 3R9WA 1B22A 2ZIVA 3GJ3A 4KTQA 1KJNA 1GZ7A 5E7IA 3D4LA 3UGKA 5MDHA 3TZCA 4B3FX 3IPLA 1TJYA 3RDPA 3TZQA 3S6JA 3R7BA 1Z6XA 3FPKA 1NKEA 2YTUA 2XE4A 3H84A 4DLVA 2R96A 4JBHA 2NN3C 2Q27A 1M5RA 4U2DA 3A70A 1QP8A 4ZKEA 3D31A 4NXMB 5F73A 3AINA 1IG6A 4LJLA 3RJEA 2Z56A 4LJ8A 3T5AA 3EJWA 3FPFA 2YNMA 1NF2A 3HL0A 4K9OA 1RLUA 2JHCA 4OJKA 1UJ4A 2DT8A 1Z68A 3K20A 1RLTA 2QGNA 5GIOE 1Y3FE 4B8YA 1D8BA 4US1R 3A2LA 2XOKA 3P0JA 5DK4A 4BFWA 2CHQA 1KZ9A 3K8YA 5JTUA 2OGUA 2R6DA 2DECA 2O9JA 3RGWS 4Q18A 2I29A 1IE3A 2QY6A 3HEAA 3V00A 2Q5FA 3T95A 1JQEA 2I7DA 3W8FA 2SCUA 1J33A 2CFCA 1HDGO 1E9SA 3BK7A 3RH5A 2WOJA 5FNZA 1Q2UA 1Z7WA 5LD2B 2ZIWB 1TLLA 4LSGA 3HNPA 1KQ3A 2JZBB 3DKRA 4J07A 1OXMA 2X8JA 4KG7A 3KFVA 1R6TA 3U3ZA 1ZRSA 2I2CA 2QVCA 3HN6A 4MKIA 4DMCA 1EX1A 1L5UA 5KFKA 2CBGA 3THYB 3EEOA 1DINA 1XTBA 4CTNA 3AT1A 4FT4A 4YJFA 2QSYA 4B3JA 1DAKA 5J2UA 4EBBA 2J3HA 4GC9A 4PYIA 3WRXC 4C7KA 2WMYA 4C8NA 1S2OA 3KT0A 1XAHA 3KQVA 3QUCA 2EBFX 1YQWA 3ND8A 2Z4TA 4UQLA 1ZOOA 4JOSA 4KXWA 1K92A 1N9KA 5D7NA 3N05A 1NI4B 2D3WA 2JFYA 4O5OA 2X14A 4IHQA 1NE7A 5HTKA 4PX9A 2A58A 2Q2QA 5LQUA 9ICCA 4WZBA 2KYRA 1PZGA 3HGMA 4G0UA 5EZYF 3EZ5A 4L5YA 4DREA 3SNHA 2FGKA 3VO8A 4S12A 2EGGA