3UMBA

Crystal structure of the l-2-haloacid dehalogenase rsc1362
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
227
structure length
227
Chain Sequence
TSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural adaptations of L-2-haloacid dehalogenases that enable hydrolytic defluorination
rcsb
source organism Ralstonia solanacearum
molecule tags Hydrolase
molecule keywords dehalogenase-like hydrolase
total genus 80
structure length 227
sequence length 227
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3umbA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3umbA01
3I1YA 3VAYA 2YMQA 3SF0A 4BNDB 3HYCA 3WKDA 4DW8A 2G80A 2IA5A 1TJ4A 1QQ6A 2O9JA 2FPXA 4YGYA 3SD7A 3FM9A 2GHQA 2P9JA 3J7TA 4IG4A 3NAMA 1NF2A 4OHFA 5ALXA 2YJ6A 3QGMA 4XOUA 2G0AA 3I76A 3EF1A 2MSNA 3ET5A 2WF5A 3FGOA 3L5KA 1NNLA 1Z5UA 3KBBA 3WK5A 4KNWA 4DFDA 1RKQA 1Z5GA 4HGRA 4UARA 2YMLA 2NO5A 3NASA 1J8DA 1WZCA 3EWIA 3S6JA 4HYTA 5ALTA 2ZBGA 3A1DA 3A3YA 3QUTA 4FFDA 2W43A 5ALYA 3ONNA 5AW9A 4H1WA 1L7NA 4KNVA 5AKZA 3A1CA 3P96A 3PGLA 1WPGA 3GYGA 3QUCA 2JAWA 1QQ7A 1ZD4A 5AW7A 1XPJA 4Y2VA 4EENA 4UAUA 4DCCA 2YJ4A 2ZBEA 5AI4A 3SKXA 4YCNA 5A3QA 3U19A 3K1ZA 2BY4A 2G09A 2WF6A 3I6BA 5ALWA 5AW0A 4UU0A 1N8NA 1RLMA 2OM6A 4HAIA 1YV9A 4F71A 4J2TA 3ZW7A 2JARA 3N8GA 1JUDA 1VJ5A 2I6XA 3DNPA 2HO4A 2PKEA 3B8EA 3U13A 5E0OA 4PNHA 2I33A 1ZJJA 2WF8A 2IOFK 1L8OA 5AIBA 3OCZA 5AVUA 2WF7A 3U7EB 2HI0A 5AK6A 1MH9A 2Q4RA 1IWOA 3W5AA 3MPOA 4C4RA 3QU5A 2QYHA 4BX3A 2CFRA 3E81A 3L8GA 5AKGA 2B8EA 1Q92A 2FEAA 3QX7A 3ZX5A 1TE2A 3PCTA 2EARA 5AM2A 1RMQA 4BKMA 1YS9A 1U7PA 5ALHA 2OBBA 3IRUA 3WKCA 5AVWA 2R8EA 5AW3A 3QNMA 4F72A 3W5CA 1SWVA 2R8YA 2ZXEA 4YIKA 2HF2A 2NO4A 2C88A 3FVVA 3L8FA 2G08A 1AQ6A 2FPSA 2CN1A 2X4DA 3WGUA 5ALEA 4UATA 3QUQA 4YCLA 4BNDA 3ZWDA 4CF5A 1T5SA 1K1EA 4I9GA 1RMTA 3B9BA 3AR6A 5AVYA 5ALIA 2R8ZA 3ZWKA 2RAVA 5AK4A 3KC2A 3E8MA 1Z4OA 3CZ4A 2FPRA 2QLTA 3CNHA 5AHXA 3QUBA 5AW1A 3IJ5A 2Q4TA 2G07A 5AKYA 1WR8A 2I7DA 1XP5A 1Z4NA 3OCUA 2ZBFA 3UM9A 2HHLA 3OCWA 4Y2TA 3ZTWA 5AKIA 1O03A 2B1QA 2G1AA 3QU7A 3SMVA 3L0CA 4CF4A 4OD0A 2CFTA 2GHTA 2RARA 4Y2RA 2W4MA 4EX6A 4BEVA 4Y2PA 3U7FB 1Z4MA 1F5SA 3NANA 4L6AA 4CF3A 2NYVA 1Z88A 2C4NA 4Y2UA 1L7OA 4UMFA 4RETA 4OCZA 4UAVA 3UMGA 2EATA 1L8LA 3MMZA 4ZEWA 2B82A 5IS2A 2AH5A 1TJ5A 4Y2JA 5ALGA 2IYEA 2FUCA 3AR3A 5AI6A 4EX7A 4UM7A 3ED5A 5T41A 1RPZA 2YN4A 4Y2QA 1S2OA 5AKLA 3PDWA 5AVVA 4Y3UA 2AUTA 1T5TA 2ZG6A 3EF0A 4ZEVA 3L1UA 3E58A 2OA0A 1Z4JA 1O08A 5ALJA 2DQSA 1U7OA 3ESRA 3L8EA 3KOOA 4UMVA 2YBDA 2B8JA 1TJ3A 1ZD5A 3WK4A 4C4TA 4CNQA 4NV0A 2ZBDA 3DV9A 1Z4IA 5ALOA 2B0CA 5AW5A 3ZVMA 2AGVA 3E84A 5ALSA 4FYPA 3L1VA 4NWIA 3EPRA 5AKKA 3WK6A 2C8KA 2HOQA 1QQ5A 5AKHA 3B9RA 5AVSA 4QQFA 3OPXA 1VJRA 5AW2A 3M1YA 2P69A 3L7YA 1RLTA 2RB5A 2YY6A 1U02A 3QU9A 5JJBA 3ZU6A 3ZVLA 2RBKA 3SLRA 3PGVA 2EAUA 4IFTA 1YDFA 3NALA 5AESA 3AR4A 1RKVA 4KYTA 4UMDA 1RQNA 5ALDA 4BYGA 1J97A 5AM3A 3KD3A 3FPBA 1FEZA 5AM5A 3R9KA 2JGAA 1TA0A 3WK7A 3NUQA 3FZQA 2OYCA 4YH1A 3ZVNA 4YIHA 2R8XA 5AI5A 3OCVA 5AM4A 5FP0A 4J03A 5AM0A 3U26A 5AI9A 2HDOA 3ZTYA 4JDPA 2IOHA 3KDPA 2P27A 2I54A 3AR8A 2YJ5A 2AMYA 1Y8AA 5ALKA 1XVIA 3ZX4A 4UM5A 5AKEA 5ALVA 1U2SA 4KX5A 3IB6A 3ZI4A 3ZUPA 2FI1A 1T9ZA 5AW6A 2W11A 4HGQA 5AVQA 1Z4KA 5AVXA 4I9FA 4GIBA 4HGOA 5A3RA 3OTQA 3M9LA 4E88A 3QU4A 5ALUA 2D2VA 2BDEA 5AKJA 2HCFA 4KN8A 4BX0A 5ALZA 3R4CA 4ZEXA 4MWOA 5AI0A 4CE6A 4DWOA 1LVHA 2GO7A 5IT4A 2WM8A 1WVIA 2WFAA 1RRCA 1RQLA 3UMCA 3FPSA 5ALLA 1PW5A 2G06A 3R09A 2PQ0A 1N9KA 5AVTA 5ALRA 2VKQA 1L7MA 2YJ3A 3AR7A 4UW9A 3N28A 4RESA 3W5BA 2GFHA 1QH9A 4NAVA 2FPUA 2FUEA 4Y2YA 3SHQA 2I55A 3NRJA 3RFUA 5ALQA 2JAOA 1VFPA 2I34A 3WKEA 5AVRA 4GXTA 3D6JA 3KZXA 3ESQA 5A3SA 5AW8A 2MU1A 2MU2A 2FPWA 1EK2A 4KX3A 1CR6A 3SKYA 4XQ0A 4BEWA 2YMMA 2HSZA 3RF6A 4NFLA 3MC1A 2HX1A 2ODAA 4O8CA 1S8OA 1ZD3A 3DDHA 1LTQA 3L8HA 3TLMA 4G63A 4AS2A 3BA6A 3QLEA 3WGVA 1ZS9A 2GMWA 5IT0A 1Z4QA 4XE5A 5AK3A 2HEGA 4UMEA 4EELA 4MUMA 5AW4A 1SWWA 3L0YA 3AR9A 5AIAA 3L0BA 1Q91A 2JAUA 3DAOA 4JB3A 4L6CA 4B6JA 4AP9A 4BX2A 4UU1A 1SU4A 4QJBA 3F9RA 3N5KA 1RKUA 1NRWA 1ZD2P 1RLOA 1QYIA 3OCYA 2C9MA 5AKXA 3A1EA 3WKBA 3QU2A 4Y2SA 5AI8A 2C8LA 5AM1A 1RMYA 1L7PA 3QYPA 3U7HB 4YCMA 4OFZA 1CQZA 4NABA 3ET4A 1X42A 3W5DA 1YNSA 5ALPA 4HGNA 1L6RA 1ZRNA 1ZRMA 4FE3A 1YMQA 2CFSA 2WF9A 4Y2XA 2Q5EA 3U7GA 3UMBA 2YFYA 2PR7A 3I28A 3WK8A 1EK1A 4UASA 2P11A 5ALNA 4XPZA 4EEKA 4L57A 3NIWA 1KYTA 5AK5A 1Z4LA 3WK9A 2B30A 3HLTA 4EZEA 2IOFA 3AR5A 1ZOLA 4BBJA 1RC8A 5ALMA 2ZOSA 3BWVA 2O2XA 2WHEA 2BDUA 4HGPA 2FDRA 4C4SA 5AICA 2YMPA 5AVZA 5ALFA 1U2TA 1Z4PX 4AS3A 3MN1A 3N1UA 3AR2A 3OCXA 3WKAA 3N07A 3QXGA 2B1RA 2HF7A 4G9BA 1YJ5A 1RDFA
chains in the Genus database with same CATH superfamily
1G7RA 1QZUA 3LG2A 5HJ2A 3CZ5A 2XUDA 3GLGA 2HY7A 1FRZA 1HYGA 3UGKA 1NR1A 3HYCA 4AKTA 1LKZA 5KCMA 4AU1A 5DTJA 2CCKA 4FBTA 2B0JA 4YRCA 5FFNA 2WP0A 2GAJA 3GVIA 3O8DA 2HA5A 3OWXA 2GHQA 2Q2OA 3V8QA 3NAMA 2VPZA 4H3VA 1UUFA 2WWVD 3C8ZA 2A0WA 2CNKA 2GUGA 1Q0PA 2GVDC 3AUTA 5GOTA 1SG0A 1I7PA 2JH9A 3BXEA 1T3QA 1URPA 1XUOA 1Z5UA 4KNWA 1CUGA 3FHLA 1EQ2A 3ISTA 1FW6A 1P5ZB 1UKZA 1OIXA 4J0IA 4KMOA 5D5QA 1JEOA 3ZV3A 3U56A 1H1LB 1QK4A 2OGTA 2ZYRA 5T4HA 4B48A 2FFBA 1NR7A 4DR7B 2GKGA 5DNEA 3M4XA 1INLA 2BZGA 2H2HA 2QTGA 1KYQA 1NXXA 3GFBA 1GZ5A 3EGXA 3NRCA 3U7RA 5MN4A 4ZDJA 2IHTA 1UQVA 4H1WA 3Q8KA 1ZDMA 1DQYA 1Q84A 3OD5A 3Q15C 4MV7A 4OUDB 1NVMB 2IBTA 3NHKA 5CLGA 4QQ8A 1WPGA 4DCNA 5KG0A 4G24A 1W96A 2BKLA 3SJAA 1QE0A 1KOLA 1NOMA 4P4OA 1KJYA 2AZDA 1NAHA 5FA8A 2TMKA 4PZ0A 1UXOA 1U0EA 4X20B 5DDIP 3E82A 3SR6A 2WD8A 3K1ZA 2QB0B 4CR6A 1VLQA 3P5SA 1EGHA 1MJGA 1H5NA 4CIXA 4FS1A 1M1NB 3VDNB 3WBFA 1P4JA 5DHTA 5HWSA 3TAPA 4J0JA 4OM8A 9ICTA 4RF5A 4W7HA 2W6JA 3WQQA 2QR5A 4YP0A 4A8EA 5EMHA 2PSSA 2FB9A 3V97A 1SURA 1X13A 2OAQ1 1J2TA 3GRAA 4BZZA 3M5PA 3UWKA 3TL2A 1F38A 1MJFA 3PBKA 1YACA 4HAVA 3RK1A 3A9VA 4BLSA 1C7ZA 2RIPA 4EPYA 1P9NA 5FNZA 3HR8A 4GPIB 4PNHA 4QUAA 4HNGA 3ZDXB 4P83A 4E94A 4P3XA 1MIOA 3DMTA 1GG5A 2QZPA 4W1QA 4TZ0A 1Z7BA 3FE2A 1A95A 4KLNA 1E64A 1K5PA 1PGQA 3PQ5A 3T94A 3UFXB 3TFQA 4C0WA 3ROTA 4X1KA 3C41J 5JPCA 3WGIA 3G6YA 3P2KA 1BKYA 4DB2A 4ER0A 1DG9A 3KHKA 2HA7A 4F4FA 4X7BA 4NL9C 3LIIA 3RIGA 4NX2A 5BORA 5CITA 5L4LA 2GPJA 3MXTA 3R3WA 3K71B 4OKSA 4YMSA 1L5ZA 5ES3A 4C6TB 4XFJA 2LHTA 5AKGA 1GT6A 3PUVA 4H6PA 1LUAA 3QEBZ 1DP4A 3HXMA 9ICWA 1AKVA 3OEHA 7ICVA 4XCVA 3M8SA 2IHBA 1UMCB 3D59A 3WGYA 1WPQA 1H93A 5B2ZA 4ZT2A 3WLNA 3TGPA 3QHQA 1UBTS 1TM1E 4N7BA 1N75A 2E5WA 1ISSA 3OLQA 2Z09A 5FPKA 5AVWA 3HNRA 4F4ZA 1NBEA 4G9GA 4DEXA 1WO8A 4AWXA 1R0XA 1OFHA 4MO2A 5DYIA 2F64A 2IUTA 2O4UX 3U44A 1KJZA 1W47A 2NU6A 3DB1A 3DQPA 2AXQA 4KTQA 3IQIX 4XTCS 3VKHA 2QV0A 2WJ3A 3N86A 5KTQA 1JKMA 2AJDA 2WILA 1V5EA 4OQPA 4TTJA 2XZOA 3HBMA 2AT1A 4FZMA 3PA6A 4R8SA 1I6WA 3OA0A 5C4MA 5KO2A 4I2JA 2ZQYA 3W2IA 5CB0A 3DLCA 4FJ1A 1J23A 1M72A 2FPIA 3U81A 4MQBA 1MABA 2I1LA 2HSWA 5A02A 3HXTA 4B3FX 5ERGB 4KDRA 1Q20A 2P9QA 3OZBA 3OA2A 4KVZA 4ZOLB 3RS7A 4QDTA 3ESCA 1XVTA 4PLHA 2FCRA 1DKRA 3TB4A 4DKJA 4KLUA 4O0LA 3IHTA 1BMFD 3O6VA 3DF7A 1GPNA 3FBGA 1NVAA 3OLZA 4RV9A 1BWQA 3SP1A 5J0SA 1CY2A 5GZ6A 1LI4A 3K9FC 1XC9A 2VH1A 4IHJF 4CKZA 3A2KA 1BE1A 3ZYCA 5KTSA 3FLAA 3FVQA 4MWDA 1TFUA 2CFTA 4XYLA 3G7NA 4UBOA 1E99A 1AN0A 2V59A 1NXOA 1R0RE 4QOSA 1T1SA 5CEEA 3IAUA 1SPXA 4B6EA 1V25A 3JVDA 4YI3A 5K45A 4LX0A 1KTQA 1JQLB 4PYJA 3WAKA 3SQOA 1DBPA 4MUHA 4NCKA 2O5EA 4O3OA 2WNSA 1V6AA 3EAQA 1PR5A 3FSJX 3GA0A 2I4IA 4M9GA 3NTRA 4NZ9A 4MUJA 1YTLA 1L7OA 4UMFA 5FCDA 3RRFA 3UMSA 4OMDA 1PKEA 2XECA 3GZTB 1D0VA 2E0IA 3L6OO 3SAFA 2JCXA 1M5UA 4BIIA 4R1TA 3CEMA 1TQDA 3C5VA 3HV0A 5NLLA 4CT0A 3RUHA 3ZHOA 1HJPA 4Q4DA 4CCSA 1OH7A 4BC1A 4QW9A 3CUWA 1H2EA 3KD2A 3KL4A 4JBIA 4R51A 4YJGB 3W5VA 3JS5A 2OG2A 1I4EB 3ILYA 3L7DA 4JJEA 2VDOB 2H57A 4O3MA 4MI9A 1OTYA 5BQFA 5CX1A 3RRJA 5JARA 1X1AA 2GFIA 3JTMA 3TLJA 3FOEC 1YH3A 1K97A 3F73A 1BN6A 2HLDA 4XVHA 3W8DA 1BXGB 1XI2A 1KZ1A 2AFHA 1TM4E 1H6DA 1GTG1 2J6TA 4IX1A 4XGIA 4QFMA 1KO8A 5CCEA 1G3RA 5CJ2A 3X1WA 2GM4A 3C4JA 2YFHA 5EE3A 4NHEA 2D2EA 4GPTA 5EUQB 2FKAA 4C9BA 2GI4A 2H2WA 1L5SA 5FWDA 1XL0A 1NW9B 4Q4LA 4CMGA 2F4NA 3ZV6A 2ZU6A 3EW9A 3VJLA 4BO4A 5G3ZA 2ZUWA 1F20A 4IDQA 1W25A 2F3SA 4MPJA 1ID1A 5G5HA 1W1UA 1WHSA 2B1GA 1ENYA 1Z83A 2WJJA 1KP9A 2X8AA 3LT4A 1A9YA 5DV9A 5CCDA 4DPMA 1DTSA 1TTTA 1IJFA 3MERA 1RRMA 3OURA 3ZZNA 1A97A 2EQYA 3IG5A 1WKVA 4IDDA 3L1VA 5AVJA 1GEEA 4XUGB 1EUQA 4TT8A 4TWIA 5LVAA 1G6HA 3O1JC 1MN6A 1IMJA 3SQMA 1YCHA 4NV3A 1VJRA 1N1GA 1SN7A 4D4LA 4DXAA 3UMMA 1WB5A 3R7BA 2JK0A 2IUFA 4RHTA 1Z6GA 3KYDB 3PWSA 4BVJA 4NBKA 2UZ1B 1SZPA 4HB0A 5F2EA 1TADA 3OPYB 3BT7A 3BMNB 2GXSA 4GZ3A 3PX6A 1JKJA 1S4QA 3MJDA 4XJVA 3A0HU 3LY9A 4XWYA 1QHHB 2JZBB 2Q29A 9ABPA 2QN1A 4Q9HA 4ATNA 9ICNA 4HH3C 1I94B 5KS2A 4WESA 2V1UA 4UB2A 1PJTA 2BI8A 3ILHA 1NL3A 4U6QA 2E8NA 2VP0A 2JRCA 3ZQ6A 3CB2A 4DWJA 5B3JC 3A27A 4UREA 1J97A 5BN3A 5MFZA 4C2AA 3K9HA 5AM3A 2NZXA 1E5DA 2BV3A 3OQIB 2E4YA 4EUKA 4OHUA 4IQWA 2K89A 1B41A 3JQAD 4JUAA 4RGQA 5HKAA 5DEIA 3I6QA 4UAJA 3D1LA 2J59A 1PWHA 5DYGA 3QLUC 3KUUA 1A4IA 3BCHA 3F8SA 1JL3A 1QX3A 1WMBA 1PEYA 2RQ5A 3IUBA 5F3WB 3GDHA 3LKZA 3PPIA 3QKWA 2Y1EA 5HKKD 1GQRA 1NY5A 1QG4A 2DQKA 3DWIA 1MJ5A 3OMXA 3REQB 2JMGA 2PVCA 4O5CA 2PGAA 3O2NA 4EVIA 4RQUA 3M6AA 1OGJA 1ZUHA 3CXUA 3DZ8A 1J7JA 2Q9BA 4F84A 5AM0A 3IOEA 3AYXB 1CZKA 2XOKD 5IJAA 4DQIA 3Q9LA 5T7BA 4D0SA 4E11A 3MT7A 4RNNA 3G1WA 4PQRA 4LVSA 1AXRA 1KMMA 5AVUA 3F2CA 1O7JA 4X97A 4DG5A 2Q3FA 4QEDA 5B1YA 5I48A 2H31A 4RVHA 1V96A 3RRGA 4GPBA 3V7YA 5LQKA 1PZXA 1FA9A 3L6DA 2CV1A 1OH6A 3L41A 2E37A 4JLMA 1E6EA 3NBUA 2RRDA 5AJHA 1EEHA 2W8ZA 3HJBA 1B16A 3TW0A 2C2WA 5CHGA 3PL1A 1HDZA 1UEJA 3VKWA 4E5NA 5LR6A 4UEKA 2P62A 3R7SA 4DYHA 4ZQFA 4DBLE 2G4CA 2A1JB 1N8KA 2I3DA 2YVUA 4JVNA 3UZUA 4HB3A 1XEWY 3GJ8A 4USAA 2IYFA 1JEQB 3O3NB 4LYEA 4IQUA 4A03A 2I29A 2ORWA 1QR2A 2EGGA 1KMHA 2GYYA 1E3IA 4WJZA 2YIMA 1OY1A 1X87A 2E8OA 1B76A 1Y5LA 4JJ6A 4XZ3A 2PMEA 3SS7X 4CFZA 4ZEXA 3TKLA 1HTTA 1U2DA 1XFAA 2B2XA 1IOWA 2WUFA 3QPWA 1R27A 3DM9B 3G8AA 1RQ2A 2GO7A 2PSEA 4GPEA 3PUYA 3DPSA 4XWGA 4ZVOA 3RUAA 4EG3A 3WJ1A 5IM4A 2DBRA 4AC9A 5IKEA 2IZ7A 3SLKA 2QQ0A 2HPHA 3CVJA 3STUA 1RE1A 5AJUA 3GVHA 3ID6C 4R7TA 2VIXA 2GQ0A 2BTQA 5CR9A 5WRFA 7ICKA 2YZMA 4KOAA 5JDCC 1R4MB 2C57A 3LCUA 4B17A 4FLMA 2HIHA 4ZZ3A 1FUIA 2N9UA 5TY0A 3SSAA 5IDYA 3FETA 3ISDA 3ZYZA 5A6VA 2Z8YA 1H22A 3PI7A 4QASA 1G63A 5LP6F 3RLIA 1U0JA 2R47A 1UMDA 4CL2A 1TTHA 2ES6A 4D98A 3GLVA 5BSEA 9ICSA 3OY2A 3F6PA 3V42A 2OB1A 1HYQA 4B84A 1JIXA 1COWD 5EGSA 2JGFA 1O87A 1E7RA 5JSKA 4ECUA 1YUNA 4B5LA 4HAUA 4NICA 3MTBA 4P2HA 3FTPA 2JFOA 3OHMA 4UBJA 5FWXB 5A03A 3JZDA 3I4LA 4IDBA 2Q6TA 3OPYI 4ZODA 5J2TA 1GGFA 3PC2A 1ZMRA 3FOCA 2REOA 4U2GA 5IYZB 1EWKA 1R10A 3CCBA 3VNUA 1MVNA 1VHLA 2GN9A 1GVNB 3DLAA 3L7IA 2A9PA 4K6OA 3JVEA 2G5CA 2HQSA 4POOA 4GUDA 5L1KA 1BFDA 5T6MA 3NIDB 5LDHA 1YOVA 2A1TR 3I9KA 4UBLA 4LYDA 4AKIA 3RROA 4R68A 1UZUA 4CQMD 5FI5A 2IWRA 1HLPA 4PQGA 4XE5A 2HEGA 1JXQA 1TEVA 3RJGA 3M1LA 2MSKA 4J7AA 4QPCA 1R0CA 2CF5A 1F2UB 2DHDA 2RIRA 5HKLA 3CBQA 4BQOA 1ZN2A 2XUGA 3PVZA 1NC3A 1O54A 3KQTA 1Q22A 1V35A 2XVTA 2FAXA 3G1TA 4R1QA 1P5FA 4URYR 4MB0A 3ENWA 5EYPB 1Z0KA 3T79A 4F3OA 3QK7A 4C0LA 3FYUB 2BM9A 1IUNA 5FUYA 3WYDA 3D2CA 4BRWA 3F9RA 4K9LA 1CLUA 3E7PA 3GUYA 3G0BA 5JC1A 1NRWA 1SCDA 2AV6A 2VPYA 2FQXA 1C9NA 2ZVJA 3HWSA 5E7QA 5EQFA 3RUDA 4EO7A 3GLIA 4Q34A 4CIDA 4PLFA 3AEKB 4NFYA 4BNTA 3JWHA 1TZMA 2J0VA 4LGYA 5J0WA 4A2QA 2QTBA 4KIUA 4GR9A 4LRTB 5BWCA 1NGSA 4ECWA 2C8LA 2YIDA 1N2CA 3QVOA 1KNQA 5DH9A 4FQ7A 4L15A 3MIIA 5SYNA 3RRMA 3TOCA 1X66A 4EUFA 3IL2A 3NVKI 1D1PA 1OV6A 1VPWA 4I8XA 4OJYA 1FLNA 3D5TA 3DTNA 3KWLA 4TUYF 5KFZA 2BKVA 3L7MA 2ABWA 2Y67A 1DJQA 1U0FA 3GT0A 3N8HA 3S28A 1ECJA 2PH7A 3H2YA 5ADVA 1K5GA 3FROA 3ZE7A 2VJ5A 2JFHA 1U9JA 1Z5PA 3AFIA 3LBAA 4QU0A 1WVGA 3R0JA 3TLXA 2Z0MA 1WXXA 1B1CA 2OHJA 4XLLA 3FFAA 4XYBA 3IC5A 3Q0TA 3RNLA 1SUEA 2M32A 1E94E 3QOYA 3JPTA 1NV9A 5IARA 3ZIAA 4AO7A 2PLFA 4F21A 3CSUA 4XDGA 3SICE 4KLSA 1OXUA 4YD2A 3GU3A 1V7ZA 2C4MA 4JLJA 4Q6BA 2ZZKA 3UTCA 5H70A 4CT5A 1K08A 3UPQA 5CDHA 3T3MB 3KOUA 1L3UA 3OU7A 4NENA 1RS0A 2A88A 2ZRFA 3CYFA 2O8CA 3RAJA 4ZZ0A 2QXYA 1SK8A 3GQVA 5FTLA 1AK1A 4KLMA 1UJNA 3BK1A 3AERB 3BUSA 3F4BA 4RZ2A 2XIDA 1ZOPA 2Z8XA 4KXUA 1SKWA 3R7LA 5BSFA 1NF3A 3WS7A 1FVOA 3MFHA 1JRLA 1Y7PA 1DOAA 2BAGA 1GA6A 3V8PA 4L8GA 3ZGLA 1E2GA 1SCBA 5C7LO 1ABBA 1PSDA 3JATB 1DRUA 2R6FA 3HLTA 4BNXA 1E5VA 2AJBA 4LJ5A 4H7PA 4EHIA 1USVA 4QBKA 4NXNB 4Y0NA 5BMOA 3EMKA 5TMPA 1VIAA 1USWA 2C8VA 3FSRA 4Y0VA 2C29D 1MORA 1OZGA 3G0IA 3IIEA 3HA5A 4P5PA 5K3BA 3PO5A 2GN1A 4TKZA 3EPGA 5CFOA 4TTVA 2H3HA 1QB8A 3AONB 2EAPA 1WDTA 2I78A 2JZCA 3TACB 4R1MA 3WTBA 3BWBA 2W2LD 5D5HA 4C0BA 3D6UA 2UYQA 4CM9A 4DDMA 4CLOA 5FWNA 3EDYA 2RH8A 2E3JA 5MN6A 3TDNA 1ZVJA 1JDSA 4ZAZA 4DSNA 1GA1A 1KWKA 1TJ4A 2QVCA 2WZBA 1MA0A 4FYYA 3FH0A 1F5NA 1KPGA 3VU9A 2D2XA 2RG7A 5CA1A 2O7SA 5I9TA 1E69A 1P2DA 3P9KA 4JYZA 3T41A 2VWGA 3K0FB 1GU1A 3GUZA 1ZJMA 3QSGA 1V7QA 3KVVA 3SHFA 1G16A 4OI2A 4B44A 1XJ5A 3RRNA 2JIZA 2OYYA 1NNLA 4E03A 3WLJA 1AGXA 5CFNA 5L3QB 1JYEA 1RKQA 1T9CA 3AO0B 3GPLA 2WTUA 1T1EA 5DBGA 1OVMA 4AP5A 2CNLA 3TR5A 4RPKA 1OLUA 4QAJA 4PYNA 3AJ8A 1CDZA 1T3SA 2FG5A 2EYQA 4G89A 3CLHA 3E9RA 4OFBA 1DT3A 1U11A 3L43A 3D4PA 3BGWA 4FYJA 4H9GA 3ZQ4A 2F3QA 4HLQB 4KAFA 3W8FA 2PCJA 1MR3F 1HT1E 4G5QA 4KVAA 1IEWA 2C8JA 5EWJB 3FF1A 3K6SB 1Z0DA 2R00A 4YMVA 5AXBA 3UUEA 3MFIA 2UDPA 4G09A 4BP1A 3L49A 4JLKA 3B5JA 1QKKA 4Y2VA 1DAIA 4NU0A 4RK4A 4DCCA 3L0ZA 5C8XA 3GRKA 5J2HA 4LSWA 5A3QA 1NSFA 3FI9A 4FINA 2QUBA 1QB7A 4OP1A 2YBEA 2G09A 4Q44A 4MFFA 1FO4A 1FMCA 3GROA 3IEPA 5FR2A 3AUAA 4PTYA 1I6KA 1RLMA 1Z36A 1C30B 2CD7A 4BO8A 1SBZA 4RF3A 1KL9A 4I2IA 1EK5A 3BL5A 4F71A 1YDHA 4PTLA 4P8RA 3WO0A 4ZO4A 8ICAA 1THZA 1BXKA 8ICXA 5IINA 3P9IA 2I6XA 2CHFA 2CSUA 3EMBA 1KI2A 4ZQBA 3M5CA 3DNPA 3SQNA 4B4VA 1X86B 1YVUA 4P7FA 4DV0B 2PZBA 4B2YA 3GLIE 421PA 2X6TA 4WERA 4N5HX 3ETHA 1SVMA 1UWKA 1GO2A 1G3IA 1D0SA 1H2RS 4WZ6A 6GPBA 3TQRA 4R66A 1NZBA 4QGBA 1JHQA 1JPNA 1Q14A 2QRKA 3E70C 2QZ4A 3KJZA 1LEHA 3R2JA 5IBQA 3ADCA 2J9RA 1KEZA 4YN4A 2OLKA 2CLDX 1KL7A 5A0LA 1OFIA 3N0XA 3QYJA 4E1AA 2D6FA 2P9ZA 3U7EB 4FDTA 1L9XA 2I2WA 4I7EA 2CXHA 3H97A 4K9MA 1HURA 1T0BA 5AK6A 2J3HA 3L8MA 4RPHA 1RIFA 4DTIA 2G67A 3HR4A 4BWYA 5L8VA 1TIBA 3BD7A 1LV8A 4JLAA 1XTUA 4M0FA 3EGOA 4BX3A 2YV1A 3QJGA 3PKJA 1QF7A 4HXFB 1DKPA 2H7YA 4EI2A 2ODPA 4YP3A 2G3YA 3D8TA 3IEVA 3ZX5A 3CRRA 3OHBA 2XY7A 3RF9A 2HVHA 3DBRB 1ZMOA 4NS1A 1VHDA 1QU2A 3QE3A 1NATA 1D8LA 1I2ZA 4AZ0A 2XKJE 3HDHA 4X1IB 3T9EA 3EC1A 3GQBB 4CWAA 2HGZA 5E1MA 2QI9C 5FNVF 4ZHQF 1VZ3A 3KFXA 4JT2A 4MOWA 1NE2A 4O3SA 4MQMA 3NGMA 2CN1A 3UQ0A 4IZOA 5BQPA 2JH1A 1FLVA 2BVNA 2EX1A 2O2YA 3WGUA 3ZWAA 1RZUA 1I2BA 1MRSA 3I4FA 5A6SB 4LF6B 2RH9B 3SR0A 1O6CA 2QP9X 3AUOA 2LUOA 4OO3A 4PO3X 2NPFA 2OV1A 5U9CA 1GP2A 2IZ5A 1XMVA 2H1HA 3MD0A 3WV5A 1RW4A 4FMCF 3QPCA 4KNYA 4QFBA 3KCQA 1F8UA 5HCUA 1WLYA 2B5VA 4DDWA 3RAFC 3DLPX 4XR9A 1PWZA 4B8YA 1Z4OA 9ATCA 1DOHA 3LPAA 4TV9A 5TQJA 4V24A 3W4IA 3WXBA 5JYBA 4M38A 3DOCA 3RJFA 2J67A 3BILA 1OX4B 3BFJA 4QZBA 1D8YA 1BS9A 1VGQA 1D2AA 3IS3A 4DKXA 2IUYA 3GEMA 3PENA 4R2KA 5TISU 1PGJA 5AKYA 4RCYA 1SKBA 5HSGA 4DA0A 3QVKA 5JAPA 5JE8A 1FFSA 4B3DA 3MRTA 4B2IA 2CXUA 2LCIA 4WXHA 4F3KA 4PSUA 2IY8A 4L5JA 3P0HA 5A4FS 4XJSA 2OCDA 3A10A 4JB2A 4XI9A 3GGJA 2J4CA 4AURA 1L9KA 3GJSA 4MQ6A 1P9RA 5KNCH 3EPPA 4Y2RA 1N6IA 1N5MA 2QN2A 4EX6A 3QMPA 5DNWA 5BNTA 3OMLA 3RARA 4IGEA 2BJHA 3AYZB 2KHVA 1I3CA 2Q3EA 2EFHB 3NORA 4BEVA 3NFRA 5BN4B 1IE3A 1T3LA 1R88A 1H6BA 3OIGA 4YT4A 2A3VA 2PFOA 3DHEA 3HDJA 4FJ2A 4GI1A 3D81A 2I3ZA 2CLHB 2I99A 5FAXA 2WG0A 5KOHA 2D7DA 1PNOA 4RUAA 4M1QA 1FDUA 2WZQA 4BMOB 1KHHA 2R96A 1F0NA 4E7PA 2O48X 4FO6A 3ODPA 4AVYA 1JRPA 3R5XA 4D6PA 2ZROA 5FPSA 1VG1A 4YAIA 3KQNA 4QXPA 3IDOA 4QOIA 5JAOA 3F9CA 4LPKA 1LV7A 5HJ7A 4Z4CA 5AI6A 3TB6A 3GWGA 3O4IA 2EEZA 3TN7A 5EWMB 1RHQA 3ILSA 1XTRA 1MHPA 1SCQA 1FQKA 4PANA 1DKNA 4K05A 1GA4A 3E05A 4Y67A 1P0FA 1M2VA 4MW5A 4CMIA 1RABA 4RMHA 4N03A 4ENUA 4MKIA 3K9NA 4QPNA 3F6YA 3I09A 5FORA 1YQQA 1LQ2A 2D8AA 5CTJA 4OP2A 3N2GB 1SV0A 1ZQNA 2WU0A 3ZOKA 3E9DA 1YZTA 3RVNA 1BD3A 1ILEA 4EBEA 1G18A 4QOEA 3T7TA 4EECA 2RKOA 2OUKA 4HXYA 1PZEA 3UBMA 4ZI2A 1QSLA 1KARA 3F8TA 5CR0A 5EIHA 2VBIA 4LZWA 4P0PB 1P74A 3ESRA 3K2IA 3ZBQA 4DSAA 3I83A 2PMCA 4W5RA 1DFHA 3F97A 2H7CA 3KR2A 1DMSA 1Z4IA 2H0RA 1T36B 3ILXA 3BDVA 4YREA 3ZVMA 1JR4A 4IMJB 5FXMA 4FOSA 3B51X 3IR6A 5MHTA 3WLKX 3ZXYA 4N47A 9LDTA 1M9NA 3IA2A 3LXMA 3AB8A 4LISA 3NKVA 4GKAA 2RJNA 2GYWA 2UVWA 1YGYA 4NE7A 1QCCA 2CKDA 3E7WA 3VBCA 3L79A 3P9SA 4OREX 2XDQA 3OPXA 1GAJA 3ECAA 3JALA 2I62A 4LY3A 1YSCA 4ALIA 2IBSA 3DOOA 4ALJA 1S9HA 2R7KA 1OI4A 1JF8A 3MJSA 4MITA 4XQGA 1PN3A 3PR5B 2PH3A 3NBZC 2JAPA 2MINB 4HXEB 2I9GA 1XV5A 3G49A 2XWQA 2JD0A 3EK2A 5HVNA 2JEOA 1MQ3A 1DKOA 2P2LA 2X5JO 1VMEA 3AUXA 3MUEA 2PYIA 3SBOA 4DM3A 2JIDA 5BN1A 5CD9A 5CFLA 4HNTA 3IM1A 5FIUA 4C29A 1TEZA 1B43A 4A8JA 5HRCA 1E4EA 4KYTA 2XXAA 1KU0A 4NM2A 1IH8A 1YVRA 1X0XA 2F3TA 1RU3A 4TV8A 2OK7A 1RADA 2DTEA 3DDSA 3QA3E 3QPVA 4YRZA 3Q8QB 3CXRA 4FBUA 5MN5A 1DZ3A 3PVSA 4EFNA 1WP4A 5KTMA 2HH9A 1IC6A 5DDMA 4ED7A 4FKMA 1LTHR 4PC3A 4FLEA 3GNSA 1F6WA 4MR7A 3U49A 5IJ9A 3L4JA 3QW4B 2ID9A 2MSWA 1Y9ZA 3K9WA 1IN4A 3BHNA 1Y0BA 2EZUA 3GUCA 5DI3B 3REGA 4FK8A 3FOFC 1IZZA 3C23A 3EFOA 1PT8A 3RV3A 3KBOA 1OPRA 4IJMA 3N8DA 4YUYA 1WW3A 4OX9B 4NOKA 3D6HA 4ZQCB 5K0NA 1FLDA 2AFIE 2HXSA 1EIZA 2PDAA 2CUNA 3DEIA 4LDAA 1MW9X 4GHWA 1ZESA 5DM1A 5ICGA 1S0VA 1K3FA 3Q1LA 3FPEA 4NK4A 4PRLA 1CZOA 2YJ5A 2R6DA 3AR8A 4U02A 4DC9A 5KFEA 4LHWA 3Q40A 3PX4A 1UPXA 1ZQIA 1B6RA 1P7VA 3EXAA 1D9ZA 5ALVA 3HDYA 4MH0R 1U2SA 4X1OA 2I8AA 3F5AA 4LHSA 2JIZD 5FADA 3G0HA 1P3DA 4JT8A 3R77A 1GN9A 1X9HA 4ED1A 1Q1AA 1QIKA 2Z1DA 3LPNA 5B3JA 5KHOC 1M74A 1CEEA 3DE7X 4PZDA 2A19A 1A04A 1D6NA 2BFAA 2XT0A 4MA5A 3CEHA 3H5AA 1KMIY 1CYDA 1PGPA 3TXAA 2J0UA 3BE5A 4R9RA 5FLKA 1DEKA 4DQLA 1Z08A 3DWEX 2VCEA 3G0GA 2WTBA 3KSMA 3T5DA 4YMUA 2R66A 3EARA 2HCFA 1HNNA 4EYQA 5K4LA 2IYRA 2UXCB 1VGVA 1QYDA 2BUBA 1ZMTA 2I4OA 3R4CA 4GOJA 4IDEA 5EXDA 4UPDA 5AI0A 5KT4A 1H6CA 4OG2A 2H65A 4XSVA 1H2ZA 4RMGA 3NC1C 2GETA 4X6YA 5ABPA 721PA 1AJEA 5C4GB 4X5OA 2W6CX 5JCPA 3TOXA 1UZMA 4MCJA 3Q8RB 4Y18A 2BLLA 4HTFB 5I51A 4ECRA 5JECA 1AUXA 1BWPA 3ELDA 4B0OA 1RI5A 2VRBA 4D6YA 1DWOA 1DINA 4TM8A 3OEED 4TURA 1U2PA 5IBPA 2QRHA 2V5VA 5JCOC 1UC4B 2CMKA 4BP3A 2QSUA 1GCOA 5HZKA 3AR7A 2ZE5A 3T7CA 5C8VA 2P4QA 3N28A 3ZLVA 2FNAA 1UBOS 4Z6CA 1M75A 2MINA 3ANNA 3B7PA 4DL4A 1MAAA 3KRTA 5D3MB 3ZE0B 1JEYA 3LYAA 4ABTA 3IBCA 4F2HA 3NHPA 3A14A 1AGNA 1HQCA 2GEKA 2I55A 1BGWA 3N70A 4HUJA 4IIVA 4D25A 1OAOC 3H4DA 2JLAA 3W2GA 4AYBC 5TE9A 1JAYA 2BMFA 2CDNA 4OQQA 5KYYA 2CNWD 3TSOA 2YS7A 4MJLA 3S2YA 2Q45A 3QVUA 1TK5A 2VTBA 1TYDE 4CMEC 1FX1A 4GC6A 2QRUA 3DLHA 1DUIA 3DA8A 4RPCA 2FJUA 2X41A 3H0MB 2A0XA 2BHTA 2MU2A 2FPWA 7ICIA 1C4OA 4HX9A 3G68A 3ZY3A 5L51A 5BVGA 3L7LA 5I9LA 3FIUA 4GS5A 3SKYA 3RB3A 7ICSA 1BW9B 4PGYA 2JGDB 2HMTA 3ZS8A 3IOBA 3PVCA 5K0GA 1DE0A 2GEVA 1KYIA 3P9CA 2RHDA 3MABA 4ZT4A 1N7GA 3OJOA 1JW9B 4LS3A 4QBIA 2IY9A 3LLUA 4IILA 1KQOA 1RI1A 1H0KA 5F52A 1N62A 3T5KA 2HHTA 1A69A 1E9SA 1R5JA 1MX1A 3BS7A 1MA7A 1O95C 2GPTA 3NHFA 3PDIB 4LWOA 1E7YA 1QRTA 1CUAA 3DFZA 4GEGA 4MVWA 4EHDA 2AQ0A 2RHBA 2PUCA 1SVWA 4NS4A 1FVFA 1KRHA 2IP2A 1SB9A 1BXRA 4NIMA 2KB0A 1GQOA 3ZXSA 2HU7A 4MHOA 5THKA 1EVQA 3AR9A 3E4CA 2BELA 2IODA 3GILA 3I92A 1W4LA 4XQEA 3PJDA 2KSOB 1JIUA 2GPSA 4YDRA 4I1VA 5C0OE 3ZE9A 4G23A 1XK7A 2ATVA 3BSFA 4HYQA 4PU0A 1IHYA 2RH5A 3V3KA 7MHTA 3LOPA 5KB3A 4L6CA 4R6WA 3HO6A 1BTOA 2BZ1A 3GWZA 3I6ZA 5M34A 3I2JA 3L7KA 8ADHA 2QLNA 3QE2A 2ZSJA 1U8CB 3FVRA 2J6UA 3Q8SB 2YZ2A 5D00A 1JFSA 4KLJA 3LLMA 2GHRA 3QFCA 2AG5A 4LZZA 4CQMA 4HNVA 3EIFA 4KQCA 4GOKA 1NR5A 1QFYA 3M6WA 4KO1S 1NVFA 3A1VA 1HA3A 3A1EA 1CNMA 1G5FA 1RJWA 1TO1E 2GAIA 4QOGA 3VFDA 4C5CA 3PWTA 3LCVB 4RTPA 3FKSD 3GJQA 1G5IA 4ELUA 1F51E 2YVQA 3OOJA 5CEHA 3AP2A 3K6RA 3QKSA 2C5BA 1M8KA 1DIGA 2XODA 4U2CA 4HEQA 4U3JA 3T8YA 3LSYA 1OXJA 3CKMA 4AJNA 4I1PA 3NEAA 3PHIA 1FFWA 2HIGA 3AF1A 2CXYA 4HQFA 4MQUA 4H17A 1S3SA 2WZDA 1E66A 2O2CA 9ICEA 4QDZA 2E48A 1NZPA 4BFYA 4JXKA 2HUPA 1EHCA 3NYIA 4RXMA 1J99A 1VECA 4RYDA 2QQGA 2AMFA 5H16A 2FUKA 4GXNA 5G2OA 5BW6B 2H3EA 2HSDA 2OAP1 3IMCA 4RQ7A 2Y99A 4MWEA 3HJTA 4QG3A 1V95A 3DJYA 4HC4A 2EDCA 4QNNA 1I4OA 1IUPA 3WK8A 1N9ZA 3AEXA 1HKUA 3HZHA 1RI3A 4IGAA 4QDXA 3TCXB 5SYMA 1MOZA 2DY1A 3TTWA 3U6BA 4XVQA 1JG3A 3C2KA 3WNQA 4O4IF 3ZCUA 1BE0A 3JQ7B 3N7RC 5ICEA 5KYWA 1NKSA 1RXVA 1XTTA 4F2RA 8ICPA 3WC4A 3JW8A 2W48A 4NNJA 5H82A 3DDUA 1PWYE 3WK9A 2QTNA 2ZI9A 2Q28A 2OWEA 4YJFA 3WDSA 3BXFA 1M83A 5DKFA 4EKYA 2WLSA 1TLFA 2W2VA 3C6YA 5IUKC 3AR5A 4HEHA 5JISA 3IELA 2XH8A 2OECA 1DC6A 3NOQA 2ZOSA 1GNQA 4OATA 1M67A 3JASA 1PFKA 3PW2A 1KQNA 3F3YA 1NJZA 1YRBA 1TIKA 3F6RA 1U9LA 2EANA 4U5XA 4GYJA 4QJFB 3CTMA 4JI3B 2DULA 1Z0ZA 2BT4A 4K9QA 2Q4EA 5L3SB 4P08A 3WADA 2EJVA 4NAUA 1YJ5A 4MKHA 1ZK3A 1FBTA 3BGSA 3QNUA 4RSHA 2EKBA 4IDCA 5AOCA 4HG2A 3CZMA 3AMZA 4ONEA 4WVLA 4ZVVA 1JXAA 2VG8A 4FQ8A 4WKPA 1JIJA 4UTVA 4BGUA 1U7WA 3WKDA 4FYWA 3SYRA 2IEAA 3K30A 5KSYA 4ADSG 3CYMA 4JOQA 3FM9A 5I7SA 2VAMA 2VAWA 3C1OA 3VV2A 1NF2A 1Z3EB 2PT9A 2D8CA 5ALXA 1SV4A 1T2FA 3SV4A 1Z7WA 1NJ1A 2A30A 1K8QA 2YJ6A 3FSGA 2AR9A 4XOUA 5SY6A 3M3HA 3M3DA 3SHOA 2A9OA 3IODA 1P7WA 1QDUA 1KFJB 2HWKA 4F2WA 2ZRMA 4DCPA 4HDSA 4S35A 5A4IS 5BO5A 3UGJA 5EIAA 1NVXQ 3MD9A 2LTAA 3PYXA 4CMJA 1DTWB 4TMVA 3ICXA 2IHYA 2H2FA 2F8MA 2GEJA 4FNAA 5CLQA 4ZREA 4BL5A 5FAKA 2IHKA 2ZXUA 2I2DA 1P8JA 3KWMA 3TLGA 4BCCA 1JTFA 3RTAA 5C32A 5JRZA 2WU3A 1XR3A 3ABSB 3PU6A 4E09A 2DKXA 3RTGA 3IT2A 3N2NA 1G6KA 2W5UA 2WBLC 4DLBA 1ZR4A 4JN6B 3FAZA 5D01A 2CXSA 4B35A 2FSUA 2J0QA 4PLPA 1WU7A 1ZQXA 1XPJA 2ISSD 4TMWA 2RCNA 1G20A 3WQRA 3ZXUB 1EI9A 2WT4A 2WWXA 2ZBEA 5I3CA 1NF9A 2W2OA 2ZPAA 1L5FA 2JIOA 2NNWB 2O1EA 4O6VA 3ICWA 4ON9A 4P1ZA 4AY4A 4BZXA 2F8SA 4CI9A 1XEWX 3Q5DA 4LZNA 5A2GA 2YNMA 2Z43A 4PO9A 5IIOA 4XLZA 3GNQA 3KAQA 3IBSA 1NSTA 3NVDA 1U63A 4RVGA 3FHTA 4CGZA 3C6XA 1L5HB 2RI6A 2JV3A 2QENA 3CX4A 3AVOA 3LQQA 2PKEA 2BFWA 4K81B 4YO8A 3BTVA 3ROEA 5J0RA 2WTNA 4J90A 1KI8A 5A71A 2I1VB 1XO1A 3U37A 2OE2A 4NLGA 4YUZA 1ZJJA 1AIPA 4RS4A 3RS5A 4Z99A 2RK6A 3TRIA 3DMHA 5ED0A 4FMDF 2J4DA 3VMMA 3KEQA 4N4AA 1QYRA 1HQYE 1USIA 5ESWA 4ZA2A 4RTMA 4C7KA 1Q3UA 3K0FA 1TT5B 2G63A 4M9SA 4G0QA 1HQDA 4P98A 3OPQA 4P93A 3VZCA 1NOIA 1TZBA 3MPOA 2K4PA 1GQFA 2X3YA 4KQWA 4LWQA 4ID9A 5CT4A 4C7BA 2YCLA 1A82A 1PJ2A 4DEVA 2QAIA 1DBIA 1L5QA 3GD7A 4IIEA 3G6VA 4GAEA 2ACKA 1RJGA 3F4LA 5ADWA 5AUPB 2HPAA 2DUUA 3UC9A 3HABA 4AG3A 1T43A 2GHIA 5DGBA 2JBAA 2WYUA 4FFMA 1JLKA 1U31A 2G7MC 3ZCXA 4RQAA 2BF4A 2E4WA 4BKMA 2DFKB 2QUKA 5KFRA 1ADCA 4H7KA 1GVHA 1R6AA 1XBTA 4EKDA 2X0EA 2V7VA 5IXSA 1C3EA 1FJ2A 2G72A 3EEFA 4P4NA 1GTMA 2R8YA 3OEWA 1M2FA 4XIGS 3DF9A 5DBIA 3RI3A 2ZAYA 3GB9A 1JHUA 3S7TA 3UK6A 4ERXA 1E1QD 1M6VB 4OM7A 1GCGA 2FPSA 1N3LA 2HF9A 1QOQB 3BWXA 3DXZA 2XHEA 2X4DA 3ZE8A 4HFRA 3AU8A 1AN9A 3R3UA 4GXIA 2ORED 2ZE7A 1FRQA 1OTHA 3PD0A 2WJIA 5GJCA 3ZWDA 4XD7D 3AHCA 4FFPA 2HHWA 5E4JA 5KMGA 3IE1A 2NYAA 4HBZA 3P45A 4WUVA 5CNIA 4RQ3A 1LQTA 2CE2X 5FPQA 1GNPA 5JT1A 4H4CA 4X66B 4LC0A 4ZO9A 3B52X 2IS1A 2QORA 2R65A 2ISQA 4TKUA 3W1EA 5IILA 2HRBA 1FNMA 4KZPA 2ODTX 5F23A 1B0XA 1E79D 5JQWA 3ZGZA 4DJ5X 1UFQA 4NBNA 1FNNA 2XC9A 5HJEA 3HB9A 2SHKA 4OLBA 1E60A 3FWNA 4G0MA 3SSNA 4YRDA 5AD1A 3A0RB 2VA2A 4DJFC 3WRWA 1WS6A 1XRRA 2R5WA 3L3BA 4NLKA 3OCWA 4QO7A 3UH1A 3ELYA 4WJKB 4AJLA 2W9MA 2P9HA 2VDMB 2X7JA 4L1KA 3NCTA 1I2AA 1SELA 1ZM4A 1H8EA 2ACWA 4AN4A 4E3WA 1BDIA 4KSYA 3D3WB 3TRFA 3RTBA 3WLPA 3UENA 3CPJB 3BMCA 3UXMA 1XDUA 3C1TA 3KLPX 3K1RB 3L4PA 1F5SA 2PL1A 3QTBA 2WTFA 3IQHX 4Q66C 4U7HA 1NG9A 2I4LA 2MR6A 3PHJA 2J87A 5A5GA 4NYJR 1EVYA 2RBEA 5C8DA 1EKXA 2G77B 3F7MA 3OM0A 1B23P 3W9UA 4FDVA 5CHYA 4S04A 5DISB 2GX6A 5C8YA 3QVGB 4JENA 4MQEB 3P2OA 4R2MA 1CUUA 3EEBA 1OFGA 1KOFA 5K3SA 1K5HA 4MRVA 4I1OA 4X91A 1DKMA 2BR3A 3RFCA 4HADA 4AD8A 4G1UC 4M04A 5GGXA 1X39A 4GMXA 4RYLA 5FOQA 3CA8A 3D3JA 3ZCVA 1VE6A 2FUCA 4MVXA 5FKJA 3KX2A 1Q74A 4WEQA 7AT1A 1OW5A 1W94A 1T4MA 2AX3A 4IWXA 1LWOA 2R7NA 3BIJA 1Y88A 3VU1A 1JDNA 1B22A 2CGEA 3C3MA 1K5DA 4HDQB 1ODCA 3RYIA 5IFKA 2LR0A 4CTKA 3FYHA 5THXA 3SE7A 5AKLA 1FTYA 2ECPA 2O3TA 1N5OX 2VKTA 4LJXA 3DONA 3PHGA 4FSDA 5EKDA 4DRXA 1MW8X 1T5TA 1A9RA 2QSJA 3NLLA 4N39A 5FV7A 3PJFA 1YRAA 3F1LA 5I7AA 5KCZA 5LXTF 4YV1A 4GOMD 2APJA 4JJZA 3IMKA 3FTEA 2H1RA 4UBKA 2WWWA 2Q6KA 5DBEX 5KJEA 5KNLA 2CBZA 5D4BA 1CULC 2VSFA 2ZB7A 2LE0A 3OECA 5JPIA 4MFCA 4OH1A 2OTCA 2WRZA 3K2BA 1YVPA 4OBXA 4U7TB 4WGGA 5J2TB 4JOCA 3W2TA 5AHOA 2BGJA 4Z0NA 2CYAA 2ASVA 4BOYA 4CU5A 5BNZA 3WR5A 1R8QA 1XKTA 4OQLA 5JBQA 2GZSA 3QX3A 3I2HA 3O82A 1F4VA 1M6HA 1JHRA 4ZI7B 5KJCA 2HOQA 1CNFA 3U7IA 3RJJA 3SC6A 2W0SA 4J8PA 3RIXA 3BH7A 4AULA 2PO7A 3DE5X 3PDHA 1LVGA 3RWBA 3BZCA 2IKQA 1RBQA 2HJVA 3TFWA 5CD1A 1ISRA 3H1FA 2XUIA 2EGUA 3L7YA 1SGGA 4OX9Y 2YY6A 5LLDA 2OBXA 4D9NA 2VDVE 2V96A 3EGVA 3PPYA 3IVMA 4EPWA 5HXAA 3OF3A 4DT1A 1A9QA 2YN2A 3H3FA 3NG1A 1G2PA 3THOA 3R7WA 4ZVLA 4HH1A 1P17A 5AESA 3G2OA 2OYRA 2B5OA 1RKVA 9ICLA 4WBSA 4KREA 4PPYA 1HXHA 1SUBA 1U04A 3C0KA 4BN4A 2ZJ7A 5ALDA 3I04A 4NARA 1FRFS 2Q4BA 2ZUUA 1S89A 4B83A 4TL9A 1MNAA 3KYJB 3X1MA 3V4RA 4RHUA 1X9SA 4X24A 3RSLA 2WG1A 3ZJUA 1V1MA 3HJEA 1T0JB 3C5WP 2Z2IA 3HYSA 5A0TA 3FMIA 1JBEA 3TNJA 2IBMA 4N48A 2CWWA 4B34A 2LIVA 5JO0A 1RXCA 2QT0A 2A9JA 3WRYA 5KTPA 3PFIA 3M4ZA 3TXYA 3U4DA 1CR0A 2WOJA 4P80A 1M8PA 1PFUA 3TJZA 1E9AA 3C6BA 5JS7A 5LU8A 2W2NA 3VNQA 2HO5A 3DPUA 1G8HA 2ZSIA 4PE5B 2QNIA 3WGLA 4DWIA 2PYZA 2C2ZA 4XYGA 2WD7B 5JS2A 5BNFA 5IRCD 2ZRCA 1P1RA 4RZQA 3PTZA 1YDWA 1J4AA 1UL1X 3CIFA 2ZUSA 4JLVA 2VNIA 4X9XA 2ZIXB 3DCYA 4MRSA 2KI5A 4A16A 1E3DA 1JKFA 3K4GA 4QHSA 3SU8A 8ICZA 1XZLA 1N5WA 1EDBA 4G84A 4HPWA 4Q24A 5EKXA 2V65A 2V7GA 5JS6A 4RK5A 3G9ZA 3N0WA 1HEIA 4YV2A 5BYKA 5EP1A 3DNFA 4DLTA 5A3VA 1E2LA 3D4LA 2Z2JA 1CFZA 4FW8A 3P9PA 3HLKA 4NYIR 4QOHA 1ENZA 1L5UA 1T6ZA 4RFSB 4ZWNA 3SZGA 3DOIA 4E88A 4GGPA 1WW8A 4YAEA 2PZEA 2H4YA 2AQ4A 4K26A 2CK3D 4OJLA 4BMXA 2FMUA 3LKDA 3OEYA 2CNBA 1SGWA 1PJCA 3JQAA 1T15A 3MDAA 3PNMA 4HDSB 4JL6A 3NETA 1E2UA 3N7PD 1NWHA 3AP1A 1BDMA 2HZBA 3A25A 4UAGA 2Q2WA 1GZUA 5F1YA 2YWRA 2R44A 4ZGGA 5IDWA 1GPH1 1EFKA 1RJ9A 3OX3A 5DLEA 1BSVA 5H0IA 2NNLD 4M0DA 1KI3A 1NG1A 4WOCA 5CB4B 1QRDA 5GTDA 3NJRA 2ZAIA 4DZRA 3R7NA 9GPBA 3DBIA 4UCWA 2P40A 1JKIA 5HP4A 2NV0A 3NHUA 2V97A 2ZWAA 2PBFA 4MGZR 4QPZA 2G06A 3THXB 1ML3A 1RM6C 2PQ0A 1C1XA 4LTMA 4DC0A 5AVTA 4M9JA 3MUNA 4QIWC 4N40A 5EJ5A 1YB1A 2P41A 4JEIA 4GVLA 2OKGA 5JZMA 4DADA 2R4QA 3BJMA 2GTPA 4MPPA 3WWDA 4TQRA 4K2HA 4O25A 5J4YA 2FPUA 1MLDA 1ODKA 2M0NA 1OJLA 3MGHA 3NU1A 2R8GA 2XYGA 3G89A 2XUPA 3IEIA 4F04A 2FMPA 5IC6A 1X7XB 1ACLA 3P19A 4EJ0A 3C7TA 1NKCA 4M76B 1V8OA 5CHEA 1IXYA 1K1SA 3R8CA 1BHO1 3QFHA 2C3YA 1QQAA 2OHGA 1EX1A 2GEFA 3OF2A 4KO4S 1CE8B 4D96A 1J5XA 1L3BA 2IPXA 4WE3A 5BV2P 1TYEB 2Q0QA 4YHHB 1NQWA 3T0IA 4BAUA 1E32A 2IU4A 2YMMA 1H2WA 5DGAA 4L5IA 1BAPA 2F76X 2H5JA 1LNSA 4G0OA 4QICA 3W2HA 2IDKA 4JUDX 4B43A 4BIMA 3ADKA 5F98A 2ODAA 5CTAA 4Z9XA 2XUHA 4UNNA 4ZVKA 1K06A 1DIHA 2HM7A 2E55A 1KN5A 2LWIA 4INJA 4WFKA 1D9DA 1L8AA 5E6RB 4G63A 5ERYA 3L4EA 2ZJ8A 2PRZA 3UXNA 1H3EA 3H05A 4MVJH 2HA6A 1YQEA 3CF0A 3ZJ5A 1SUCA 8ICBA 2OV4A 2EFGA 2EKLA 3OKAA 4FOLA 1CQJA 3DO8A 1JTEA 1C7QA 2XUOA 3STTA 3WGMA 4I1SA 4AT1A 1NUUA 3OF5A 2AKAB 2MT9A 4B73A 8ICEA 1FFGA 4A73A 1ZQAA 5AW4A 1ZJNA 4F8RA 4P81A 2VHEA 1Z7EA 3ITDA 3AWIA 3L0BA 4PC1A 3L7BA 3ND9A 3STXA 4DFJA 5HDBB 1Z13A 4XIIA 5IWCA 3BDAA 2C3OA 8ICMA 1FX0B 5JSZA 4RQ0A 1D4AA 4WL0A 2EP8A 2L5YA 1OBVA 3HKCB 3ONVA 4KXYA 1V1RA 5ECDA 5EN4A 4D9KA 1HNZB 3BICA 4LY0A 2V54A 1ZQ1C 4Z6KA 5GZ1A 5COAA 3OAAD 5IEBA 4FYVA 3JPQA 3O4RA 3TVTA 4D9CA 3B82A 3N6XA 1U8UA 2CYCA 3KVYA 3UGTA 3CF4A 1UK9A 2I71A 5HGJA 5IKXA 1S96A 2I76A 3JVUA 2CD9A 2YFQA 4GC9A 5EY5B 3IDZA 2GCOA 3LWDA 3W6PA 2I4NA 4J9NA 1E6WA 2OVFA 4A82A 3KTOA 1Y7IA 1N2HA 4FDAA 3W5BA 1Q3KA 2MYPA 4YVZA 1OFTA 1JJBA 1R9GA 5JBIA 1QGUB 2FH5B 3M7DA 3WKBA 3R0QA 3TI9A 1EWYA 2E1PA 1MT0A 3RGWS 4O2BA 1MAUA 2QLLA 3JRXA 4L3VA 1B8PA 5AUNB 2C2RA 2HAEA 1R6VA 1AS3A 1A4UA 1T5BA 4Q03A 5F3DA 1P4SA 3VH1A 3ZQUA 1X1DA 1LU9A 2HZ7A 3R9WA 3SAHA 1ZN8A 3H4TA 4DC1A 4UD2A 5FPTA 2H1SA 4MP3A 2Z5LA 4BBPA 4RTJA 4Q3DA 4RABA 1GPBA 2KKVA 1PX0A 3SE0A 4EJMA 2ZM5A 2BGUA 1RYHA 4CI0B 4IS2A 4RAOA 5IK2A 4J16C 1CUDA 4MIYA 2CFSA 4E5KA 5DB6A 3U16A 4Y2XA 5EJ6A 2P3QA 1FP4B 1RWPA 2DSTA 4PLGA 5JFOA 1HIWA 3ZN2A 2QX6A 4JQCA 4UM9D 1DAKA 4JNCA 4WJ3B 2JVKA 1LC0A 4OAQA 4KBYA 5KMGB 1G7TA 3O8CA 3MYYA 4K1LA 4TRMA 3PQFA 2VK2A 3NIWA 2ZIAA 3HJGA 2NX2A 5AK5A 1LH0A 5B7GA 1M2GA 2AWOA 3QM1A 3WGGA 2IF2A 2ZYGA 5DLQC 5KJ6A 1FCJA 1FNSA 4WLVA 3BZKA 3S8EA 4WEOA 1H3NA 1NU8A 2PG3A 2PZFA 2NP6A 5BWNA 1C7FA 1IZ8A 4FYMA 4R1OA 1SAYA 5DHRA 3UH0A 2FN3A 3GFSA 1PTJA 4MS1A 2NPIA 3L7NA 4XQCA 5H83A 5TQ2B 4F4DA 1SNYA 2X13A 3QMVA 4Q4JA 3W05A 1K4KA 1EUZA 1W29A 3QH4A 4P54A 3FFTA 3WL4A 4EPRA 5D2CA 5GTIU 1QXSA 4HLDA 1ZINA 1GZ6A 2FW6A 4H6WA 4N5LA 1NK4A 4W1RA 2W6IA 3EXFB 1K89A 4YBRA 2VNJA 5H81A 5IZ4A 1H85A 1JSZA 1KJWA 4D8XA 1KFBB 3OOYA 4G9BA 4LJYA 1JQDA 1NVDA 2EZ9A 2K4EA 3TGWA 4E0BA 1NJWA 2NQ8A 4GZMA 4LIPD 4I2HA 5J47A 1KVTA 5ICMA 4EG8A 1F4PA 2ERXA 7ICNA 2ODQA 1GPUA 5F5LA 3R40A 1YQXA 1ULBA 5B6JA 3FY4A 1N77A 1LBTA 1N2GA 1UOEA 3EXHB 3NBQA 3O95A 3AM9A 1L1QA 1SQ6A 3AFNA 3JYHA 3REOA 3QEOA 1TRKA 2Y4NA 4IG4A 2KZ3A 4M1EA 1UBCA 1YASA 1V1RB 4OFXA 2HMVA 2VNAA 1GU7A 2CMFA 5HILA 1ZUWA 3PXCX 1SR8A 1JR2A 4K8OA 4TWZA 2FLLA 1DQSA 1ODFA 5HUHA 1Y34E 4G1VA 2J9FA 5DB9A 5ANRB 1SB8A 3ACDA 1A8UA 2TS1A 3KZIU 2Y93A 3H0KA 2J5KA 2FHSA 3CRXA 3K75D 3NJ4A 3Q5GA 1N9GA 2ZI4A 1VL2A 3B0XA 5FTJA 4H77A 3ZU5A 1IM4A 4PQYA 5KWJA 2O2GA 5LYJB 1EFLA 1LF5A 2EZYA 2I3AA 1Z0UA 2RCYA 1YKGA 4TRRA 3HG7A 3C3DA 2H8GA 1FVHA 4K3VA 3GGOA 4FFSA 4KNVA 3UT6A 5A1TA 3RR2A 3E2MA 2YX8A 1TC2A 2ZRJA 4B71A 2QRVA 2P7IA 2WVHA 1NQTA 4R2XA 1UAGA 2XUZA 1YA8A 3LRPA 3EEOA 2JLVA 3QZUA 1PV2A 1AE1A 4KG7A 2VDQB 2XYPA 3JAKA 2NVOA 3JR3A 2WU1A 4QJ5A 1FXSA 1VKOA 5F7OA 3NO4A 4YS6A 4BWGA 5AW0A 3T5GA 2OC9A 4Z9BA 2OM6A 3IHLA 1VSUA 4HAIA 4PHTA 4RY8A 5KT3A 3GLQA 3P0IA 1SL0A 1JT2A 2Z2ZA 4LTDA 5E9WA 5P21A 2DWPA 5C52B 9MHTA 3LKBA 3ZNNA 2A7XA 1USKA 3ZW7A 1PRYA 7ICOA 3VHXB 4RMIA 2JAXA 2V6IA 3MW8A 3EGXB 2WWTA 5FA6A 1AROP 1XTSA 3E9EA 1RHUA 1OXVA 3Q7TA 3ECCA 4EPXA 2WWYA 4RQTA 1Y8CA 4RH3A 3LZ6A 4JH0A 5EIBC 2WAOA 1MOPA 4ASUD 5EZYB 3ADDA 4KK3A 2FJPA 4IOLA 2I33A 2WF8A 2PA3A 3HBAA 1YJBA 2IHUA 2FRDC 2ZRKA 4YRFA 4CV3A 1RI4A 1US8A 5CRIA 4Q12A 1G42A 3PC8C 1SIJA 3VM6A 4XCQA 3AX6A 5DRTA 5JY6A 2PU5A 2BFEA 2EW8A 3H40A 4MWBA 5JI2E 4O4HA 2ORYA 3ZDEA 4HGZA 2DOKA 3DMFA 1ITZA 1UKAA 2CL6X 2QTHA 4LJAA 3SHTA 3O9MA 1K2VN 3TPZA 4PZPA 1P33A 2WSIA 3Q8PB 3PR4A 1UAAA 3FTDA 5LOVF 3OC0A 2HMWA 3E48A 2OORC 5J2IA 4MWSA 3T7JA 5GIPE 1ZRSA 1XJQA 3UKOA 2BHRA 1Q92A 1D7AA 3QOFA 3T3IA 3I6YA 2XKBA 3P7MA 1NULA 4GMGA 4IW3B 4ND1A 3QE9Y 2W6ID 1L7RA 1QYWA 1SHLA 1WPRA 3FSGD 1YK0A 4XB1A 1V6CA 1TM3E 3WHLA 4A36A 1ISGA 2OY0A 1RIIA 1A98A 1C3JA 2XB6A 4K03A 1PSZA 4L0MA 3WKCA 2EDUA 1KA9H 3KPYA 3MBKA 4GQBA 4OF4A 5EI5A 2O14A 3SHVA 3IE0A 3AY7A 3M6MD 3FCXA 4PINA 2NO4A 5K3FB 3VA7A 3MQ4A 2P1RA 4FIZA 2Y1OA 5J4HA 2ZT7A 3C3EA 3QVXA 2JHGA 3A1UA 2ZIWA 2J8ZA 3CRQA 2CDCA 3SYMA 3S7ZA 5E2IA 5EHNA 2HVIA 1JE1A 3P8ZA 1K1EA 2VA9A 5CDSA 3B6MA 1U28C 1I7QB 4F5WA 1W85B 3RAEC 3DKIA 4N5IX 2ZTHA 4UTPA 4HVLA 4HH4A 4HNAA 1P5RA 1UANA 1Z45A 1VE3A 2CJPA 4TV8F 4COOA 1ADJA 3QXHA 5IVIA 2HBYA 3C6ZA 3ZCSA 1QFMA 3EVAA 3KT0A 4PGAA 4UOZA 1N9GB 3TRDA 3N2EA 5A9SB 2O3JA 3HFRA 2W7OA 1XNJA 4DCOA 1S2MA 4OJTA 1DG1G 4CRWB 5CDTA 2I7DA 3K8OE 4P3OA 3BIWA 3U4MA 1O6BA 1CS0A 3PV0A 3RRHA 4CCHA 4JWKA 1WY7A 2QGFA 4BV9A 2C3UA 1UC8A 1OLUB 1R9NA 3ZTWA 1XZJA 2V4MA 5BMVF 3L4KA 1QX4A 3MJCA 4DF3A 1UKYA 1C9MA 1CUYA 2VHXA 3AF5A 3B9JA 3O8LA 9ICKA 3UTDA 4L02A 1ZSVA 4G65A 4LVCA 3GIWA 2PFKA 3D2NA 3GBPA 1M8JA 2ZVQX 5KFAA 2J41A 3KEOA 1J2EA 2Z4RA 4DM4A 3VC7A 4Y1FA 5JY1A 3UJNA 3SI8A 2QMYA 3A6FA 4P7BA 4IXNA 4D2IA 4RETA 1U3CA 5IDQA 4DMUB 3NT5A 1DMRA 3A04A 4WCVA 2H4JA 2V7BA 3K31A 4ND8B 3I01M 5CH5A 5B4UA 3LC1O 1RSZA 4EMBA 5I4CA 5C8YF 1HX7A 3HO1A 2QVXX 3FGPA 4LQDA 3EPJA 2CJFA 3PQDA 2GO1A 5LDGA 4N5MA 5BRJA 1CVIA 1DPGA 4FSXA 2DKFA 3BG5A 3S5JA 1ETUA 2FSSA 4R81A 4UM7A 5G02A 3RS2A 3QEAZ 4F2GA 5LP1A 2VUSA 1CZLA 2O3SA 2X1HA 1NBME 3H8VA 3DL2A 2GUWA 4N9WA 1A5ZA 2WAAA 4REQA 4Q9IA 3VR0A 4YPVA 2XCTB 4MPDA 3Q5EA 4OKNA 4N54A 4Y3UA 4R98A 1DFIA 2OFFA 3QVLA 3L1KA 1CVLA 2AYXA 3RBDA 2C77A 2N46A 2YXLA 4KPYA 2VRWA 3RBZA 2YJGA 4RNDB 1O1YA 1QH1B 2EFCB 3PC7A 3SZ3A 3JVIA 3UAXA 4C30A 3UJPA 3ZI7A 1Z4JA 2A33A 2F8KA 2WU8A 4ZVNA 4EPTA 4KUGA 3SWWA 5I8PA 2H3IA 3LDUA 3W04A 3H4IA 4EEYA 2NTVA 5JAMA 4MGHA 3JAMA 3N8KA 4HB2A 4C4TA 2YY5A 1TZKA 1ZIDA 4QTTB 1YO6A 5CVVA 4RWEA 3VPSA 5JQGA 2JFFA 5LIRA 1NQOA 3E23A 1QUFA 5EMLA 3SXUA 3PKZA 1L6NA 4FX5A 5CW2A 2ZXFA 4M37A 5CT6A 5LP6A 2BC9A 3FWKA 3K8YA 3HCPA 4EWLA 4J4HA 4I2DA 4XVUA 1UFVA 3QBTA 2AG6A 3HXQA 2F55A 3DWGA 3SEQA 4C87A 4CMCA 1JEYB 2FJ6A 4MEYA 4B4UA 4BB9A 4JYAB 1P2BA 5GIOE 5FQOA 4F3YA 2FPKA 1FFXB 1IQUA 4E22A 4ZHSA 2EAMA 2VOEA 4BFSA 1FZQA 1JR3D 1MQ2A 1FDIA 1J0DA 3Q7IA 2N42A 4RK0A 4XW2A 2QBYA 2ZXHA 3ZGNA 1THTA 8ICFA 1QJ4A 3A6LA 3R3YA 4L85A 3HU5A 3MT9A 3OETA 5JVDA 1ESZA 4J9MA 5JZVA 4D99A 1GYQA 1LI5A 4L75A 1RYBA 4PW0A 4U7FA 4FGZA 1ZVVA 3E5MA 1WUYA 4G0PA 4B81A 3GIMA 2W8KA 3JQ8A 3F8WA 1I4TD 1UIRA 4MV5A 2VT2A 1KO1A 3DV2A 1JXLA 2PPLA 4ZXPA 4LKRA 4O5EA 3X44A 3TTXA 3E4DA 3O1LA 5L3VA 2OQVA 2QVBA 2RSLA 2VBCA 4ZRDA 3COVA 3NEYA 2XSZA 4Q19A 1JWLA 3GIJA 3E2EA 2H5EA 1AV6A 1NLYA 4DA6A 2OQ2A 2YNMD 3H1TA 3V4OA 3LPMA 5ICCA 4NESA 4XQ8A 4M8NE 4FCVA 2DL0A 1V4VA 4TYPA 4BTEA 1JG7A 2BD0A 3VDRA 1LJLA 2Z58A 2ZCUA 4MVJA 4RKEA 4AMVA 1W4ZA 2BZSA 4E2XA 4PCUA 3TMYA 3GRZA 5JNVA 2C0CA 4FKZA 1JSCA 1T3GA 2JKVA 2E3TA 5D49A 1TM7E 3D0KA 3HQ4O 5F12A 5DZSA 1YAJA 2OYCA 2BPOA 4NE2A 3WBJA 3DHNA 2X4LA 1L8XA 4NU8X 4Z0HO 3V8MA 2QNBA 5AI5A 1PBTA 3B8HA 1XDWA 3AF0A 2QRVB 4YTEA 5AJZA 5FBLB 2IH5A 2CEKA 3IPRA 4XIYA 4JUFA 2H1IA 2AMJA 4Y1RB 4J29A 4QGGA 1QP7A 2HV8A 1KDVA 1U2GC 1SUDA 2UZAA 1M0SA 1OLSA 5E3HA 4P58A 2Y0SC 4YCXA 1XTKA 2GASA 2Z2YA 2WABA 3RJ9A 2QP3A 4KQXA 1YZGA 3H1EA 2PH5A 3UJAA 3WSWA 4BKPA 4YMMA 4C8LA 3MB5A 5DMXA 3WWOA 1MHTA 1DDOA 1Y81A 2EERA 4LHYA 1FTNA 4H60A 3KR1A 2O0MA 3IILA 3KHLA 2Z4SA 3K35A 3IESA 3NTUA 1I7DA 1R8YA 2QQEA 3DH0A 4OJKA 1ESNA 2FI1A 1T9ZA 2GGSA 3GN2A 1R0BA 1XYVA 3G7UA 1PT6A 3E0QA 9LDBA 1TQHA 3BYZA 4OB8A 3I2GA 5BOSB 2BMVA 4OYRA 3PY8A 2FE4A 2JLRA 1RM4A 4JBXA 4BNMA 5IFLA 3THXA 2KICA 2ZLBA 4D9HA 4RTLA 2GAFA 2R7LA 1Z2DA 4HP8A 3SR3A 4CM3A 5J2JA 4U6SA 1A9ZA 3K9GA 3G5UA 3IVCA 2GBIA 3DHWC 4RS3A 2VJMB 2ROQA 3O4FA 4HZUA 4KXFB 5FR1A 1UEXC 4J1SA 3AHEA 3ZZMA 1KIFA 4ZD6A 5CYGA 2EZZA 1XF9A 5EQDA 2CNDA 3COWA 4WK2B 2QRZA 5LXTA 2H2AA 4JX9A 2B8WA 4FZ3A 4NNOA 5D85A 3V7KA 3RSCA 5C35A 1YBHA 4BFWA 3NXKA 1J2YA 4NXMB 1NMZA 3SFVA 3ETNA 1ZD9A 4WCDA 3MILA 4B4WA 4QBFA 1A8IA 4J7XA 4RE5A 1F2TB 3GZ4A 2AI3A 3H1PA 4KLEA 5EESA 1PW5A 1Y33E 3AFGA 4BV3A 2HR1A 1XLVA 5F3XB 5DGCA 4JJ4A 4UB3A 9ICCA 2X14A 4HX2A 2GBPA 2Q3MA 5CVTA 2NRWA 5KFPA 2OXEA 3OO0A 4RESA 3LFHA 5JPDA 1FDVA 1QOPB 2RAPA 1FQWA 4ZT7A 2IYQA 2JCSA 3OLVA 3NBFA 1KSJA 2ENWA 2GLUA 3H87A 3HC7A 3NRJA 4P4TA 3PIIA 4PAOA 4RAQA 4ZO8A 3RFUA 4PC2A 3TX6A 4BQFA 1VG8A 4EF5A 4QVIA 4Q3CA 1X0VA 3H04A 4YONB 3JQPA 4W82A 2KJ5A 1NK0A 2VP6A 1G5RA 2V4QA 3DEKA 4CQLA 2FMFA 4LXTA 3ZU2A 1GADO 1P1BA 5FBQB 3ERCA 1U28A 3ZK8A 3BJZA 4IH4A 1FP2A 1VCIA 4NG5A 5BN5A 4RXTA 1CR6A 3KYIB 3TBFA 4BMZA 3PP8A 4EYOA 3AB7A 5FULA 1OZAA 4IFEA 3X1YA 5C5CA 2V3CC 2B6GA 2FVXA 2JAHA 5JXIA 3D3NA 1UAYA 8ICJA 2NN3C 2ZYIA 1DBRA 1HO3A 2RDIA 3ER6A 3TUZC 1ENPA 3MLBA 3WE7A 2JFUA 4PNEA 4WIAA 4BNKA 4JYCA 4ZCIA 2Y1XA 5K0LA 1ZGCA 5EJMA 2OD7A 1X1BA 3B6KA 3VHLB 1GKKA 1T0HB 1KS9A 2GWHA 2IQIA 3FVWA 1EGAA 1D6MA 1LPNA 3KWFA 1G1MA 1II8B 1N3BA 2QMHA 3N2KB 3U2QA 2VPIA 5FI1B 3ZJYA 3N53A 1W8DA 4MV6A 1KI7A 4UFPA 4GP6A 2O0KA 4I1YA 2HK6A 4G9EA 3BL6A 4IL5A 3RBEA 3INYA 3JQQA 3H1GA 1FYDA 4QECA 3GDGA 5FWAA 4I14A 1M1YB 1Z9BA 2X0RA 1G8YA 2G9ZA 2H1WA 4JB3A 1RZTA 3EDQA 4DT1B 3H0EA 2ZBPA 1CLEA 3IR5A 1CXZA 1YZQA 3V7NA 4C78A 4ZOLF 1NUPA 2GRAA 1ZJ6A 5C9ZA 1DT5A 1WCIA 4K7JA 4KGVA 4CKEB 2HYIC 1GPDG 2N1RA 1NVTA 4IRMA 4ENVA 3T3OA 3Q10A 1P2TA 4CLEA 1N4AA 2QD1A 3N58A 5LN1A 2H07A 4JVLA 3SM3A 1TDJA 4O4HF 5DHSA 4OIFA 4UZFA 2A5YB 4Q5IA 3VH2A 4BGEA 2C5SA 4QTUB 2H4HA 2WINI 5BOSA 5DX1A 2QARB 3DMYA 1LB1B 1UM9A 2WAYA 1Y6FA 4MVJE 1W19A 2F2TA 4GWGA 3VI4B 1J8MF 3VX4A 3KQOA 4DYDA 1V7PC 2HN9A 4ZPXA 4PIVA 1X9MA 4R5HA 1N56A 3VHXA 2G83A 5TMDA 2VEDA 4MICA 2BGGA 3ETDA 3V1UA 4Q7MB 1SKYB 2SKEA 5EEHA 4EI9A 1SVOA 2P0AA 3C97A 3FCUB 3GVXA 4YP7A 1L5KA 4A15A 2N0SA 1QO0D 1M10A 3IXLA 2I4RA 4N49A 5K09A 1AQIA 3KK0A 4FWIB 1M2KA 4OQZA 4FE3A 4V39A 4P3PA 1RYSA 1K88A 2K4MA 3BRCA 1FMFA 1JFRA 2GN4A 1QGZA 3S99A 4YCJA 4EP1A 4G0NA 4B8ZA 2V4ZA 3R3VA 2NZJA 2YXDA 2E1EA 2PWBA 4PLYA 3F3SA 1K0FA 2NYUA 4FS3A 2WIBA 1LQUA 1G9SA 4X6LA 2H4WA 1V7CA 1G5QA 3KTAB 3FCSB 5E7MA 4D9BA 3GNLA 2HTEA 2XWPA 4N18A 1XWLA 1D6SA 2YV2A 3DOEA 2B4RO 2M9NA 1ZH0A 4PCAA 1IHDA 1VYHA 2XVAA 4YRMA 5C1PA 1FUEA 3LBFA 5FWXA 1P9LA 4ML3A 3WNBA 2BR5A 4A10A 8ICYA 3CWQA 4KKVA 5JD5A 2F62A 3LK9A 4NJMA 5EIXA 1W4BA 1ZUNA 2R6R1 4ZT5A 1QMPA 3CLUC 3PZBA 4WX2B 1ZOLA 4X1IA 4Q9AA 3RS9A 3UB4A 2ZJ3A 3LUDA 4RLSA 5JBNA 2BFFA 1TGYA 1UMDB 2BN4A 4BBAA 5C5DA 5JXWA 1EHIA 5GQSA 2C4TA 5L6MB 3HA3A 4B46A 1G6OA 3ACCA 4EIWA 3TWOA 2XGJA 4KIFA 4R31A 2VK8A 2PD3A 5AVZA 5E4TA 1OPXA 4QLBA 1DC8A 1E9CA 2WUDA 4CKEA 2CHUA 4QWCA 2EP5A 1JALA 3E27A 3OZDA 2ZI6A 4G07A 4K9NA 3GAMA 5TNXA 1RJ9B 4JBYA 1XHEA 3EMVA 4EZIA 2A1UA 4DDTA 3I1YA 4BZWA 3EXG2 3NHJA 4M4SA 2B25A 1GXSB 1PZMA 4MO9A 4R2JA 5JU6A 4P4GA 1X7YB 2DPIA 1WF3A 4UUQA 1Z00A 2UUBB 4IXMA 5F33A 2Q3JA 4RFSA 2MSEB 2VXOA 1JX6A 2DWCA 1L3VA 4XA5A 1HSZA 4OHFA 3U4AA 1CPYA 1IG3A 3HDQA 3HMQA 2OGZA 2PV7A 3OZVA 1QIDA 1SA0B 3B2EA 2KSOA 3HBLA 2PANA 2VAVA 2XQKA 3FCEA 3FJ1A 1WDLA 3E03A 3HADA 3G2IA 5JD3A 4WRRA 8ICCA 2AE2A 1QPGA 4Q3KA 1T9AA 2AQ8A 4UARA 1BXRB 4X54A 1GSAA 1J8DA 2C2EA 3S6JA 2YXEA 1KP2A 3PCXA 3AUFA 2KFNA 1S97A 2IPOA 4ZOCA 4PLVA 5BVHB 2ZBGA 1QRSA 2JJ1A 2RGNA 4A6PA 5FUQA 3LDAA 2OCAA 2XAAA 4D45A 1M6NA 4V0MA 4EJSC 1S0NA 3GEPA 3EVGA 4C7OA 1G55A 2J9ZB 3GIIA 1NMQA 2IITA 2JLCA 4J7CA 5I5EA 1XPRA 2EJCA 3GYGA 3UK1A 3U4GA 4J16A 4BLRA 3HB1A 3DOHA 4EENA 1P73A 3H9GA 4FHDA 1KW4A 3PR1A 1WDMA 1JP7A 2R5NA 3PQ6A 1F6DA 4QZ8A 1JHAA 3T1VA 1KOJA 2WAXA 1C9DB 3AF3A 3DVSX 4WACA 1N4DA 2G28A 1W1WA 4G26A 5KFOA 1TKBA 4LV6A 1ODLA 1A1VA 2GN8A 4HEA6 1PQ4A 4JLUA 4UE3S 4HWGA 4W7IA 1ZN7A 4MQ5A 2ZSEA 4WY2A 2PUDA 3JWEA 3LWLA 3IQXA 3TTUA 1HFKA 4FC6A 3SC4A 1YB6A 5KFLA 2WHPB 2QW0X 1NXSA 1T8YA 1C8VB 2Y0PA 4OXQA 4AY5A 1X8LA 2GD1O 2TMYA 3K6JA 2W71A 4YAWA 2D1RA 1XVUA 1NI4B 4A5OA 4ZVMA 4DHEA 5BUZA 1JYFA 1K4MA 1RZVA 1TC1A 1AGPA 3KEMA 4BRUA 1XA3A 1YZVA 3S55A 3EC2A 3FLBA 3S4YA 3AVTA 4TTPA 1AKUA 1SG9A 1TM2A 2IYUA 2XJ4A 3IX7A 3ABIA 2KNJA 4GW3A 5LXTB 2D5LA 4UUOA 3DTTA 3DO6A 3GYBA 3ZXXA 4ZIRA 1TZ2A 1MJGM 3PXEA 4Q21A 4WKCA 4HVCA 4BQSA 4NY1A 2XRZA 3GZNB 3UXEA 3LP5A 4JLSA 2PMZC 3C1ZA 3HVUA 1M34B 2PXHA 3LVWA 2Q3CA 2HDWA 2YDYA 4WESB 3CR3C 4INZA 3L8GA 4R7ZA 2DM6A 4P92A 3CNBA 4KWCA 4U2DA 2L19A 1UT8A 1KDTA 3VPXA 1U8ZA 3D7KA 3AC0A 3I05A 3PCTA 1E61A 1QO0A 4H7EA 1L1FA 1Z18A 1RMQA 1DBVO 3GP3A 4Q3LA 3GV7B 3EDOA 4O8ZA 4UE6A 2QDKA 1EINA 2OBBA 2D5AA 3T38A 4F9EA 1FC0A 2DUJA 2BI7A 3S1AB 3E0XA 3GUHA 2RDJA 2I6GA 3KVOA 5UKDA 3TS1A 5KFTA 1NURA 2JIQA 3I53A 3PIDA 4QSHA 3EX7C 4FS2A 5C1OA 2NQTA 4JQZA 5L7YA 5A5DA 1IY1A 4KLGA 1LK0A 2QIOA 5J2GA 4GC7A 2OILA 1H4SA 3THVA 1SVLA 5ALEA 2JNWA 2YYYA 1J0BA 2E5SA 1DELA 2DPMA 2IDJA 2XVZA 3V5NA 2Z04A 5EJIA 4CF5A 1E20A 1NDQA 2O8CB 1AMNA 1QZTA 4X1YB 5IMSA 3C7DB 4ER7A 3B9BA 1M1XB 3CM0A 2YTZA 2LYAA 1RWNA 5JOQA 2AJLI 3AJAA 1MX5A 5IP5A 2Q7DA 4MUFA 4NLBA 4O9MA 1XYGA 4RQ8A 3KC2A 4PLCA 1LDYA 2O50A 2QD5A 3GFFA 2HHQA 5ER6A 3W9BA 4IDAA 2F9FA 1Z2PX 2EBUA 1XXHB 3C87A 2ODWA 1UT5A 1Y6ZA 3P9NA 1C29B 1OBCA 3VR2A 1CERA 5A0VA 3LPLA 2KWIA 4OXXA 1L4YA 2BCEA 1PYOA 4JK1A 1L7DA 3TFRA 1IK6A 1NN3A 1W59A 2JJ2D 2QS9A 1XDZA 3RRXA 3P0EA 4BQQA 1S0OA 3EPLA 7ICEA 1TKRA 2P2GA 3SJCA 3GMDA 1H1LA 3LK6A 3ROMA 8ATCA 1GTL1 5EIWA 4UNQA 4WN3A 3A32A 1F0KA 1X1TA 2P77A 3G2QA 1K66A 3MWJA 5J0UA 2D3WA 3B85A 4RNOA 4RDXA 4JITA 3AKCA 5FYDA 3VR5D 1UDAA 1WCLA 4PHHA 5DSZA 1QE5A 2IXDA 3WOHA 3U7FB 1GNTA 2OHHA 2FOXA 4RT2A 2X0KA 2ZW9A 1F0MA 4ZU1X 4ZCPA 4CCYB 1K1QA 1FP6A 5L1LA 3GX1A 3MTDA 4OA5A 3RAQA 1AD2A 2C4NA 4K86A 4R0NA 4PWYA 3CWCA 4IQGA 1BGVA 5TB5A 3UMGA 1R0LA 4EQ6A 4JWMA 2FFHA 2HK9A 3RJKA 2ZYTX 2D1YA 3ENQA 3KHTA 4U7WA 4M87A 1EFRD 1NN1A 5CDYA 3TUIC 1KZ9A 1ZD8A 4X3PA 3BAZA 3R6TA 4IQ4A 5LQNA 2W03A 1TJ5A 2YXPX 2I4MA 1MQAA 1IBKB 5LA6F 2REQA 4ZOEA 2ILTA 3R0XA 4JI4B 3N2KA 3IERA 1NJXA 5IIKA 2DLNA 5JMOA 4WCFC 5I7WA 1S6YA 1W8IA 3O21A 4C0HA 3MBYA 2CDAA 1VG9B 3WB2A 2I8CA 3FOAA 5FOUA 1ZI8A 3E9MA 4O33A 4PIPA 2Q2VA 4BLOA 4Y2QA 1YI8A 4Q1DA 3HCFA 5AP9A 2OCGA 5J1TB 3SDBA 1N0VC 2QE7D 5EKUA 3BKWA 4QM7A 4I5GA 4NKRA 1ZL0A 4ND7A 4YMTA 4I99A 4UFOA 4ENQA 2VVTA 2B2CA