2HMXA

Human immunodeficiency virus type 1 matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
133
Chain Sequence
HMGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the human immunodeficiency virus type 1 matrix protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Matrix protein
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 MATRIX PROTEIN
total genus 33
structure length 133
sequence length 133
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2hmxA00
4ICAA 2K4EA 2K4IA 2H3ZA 1HIWA 1UPHA 2HMXA 1TAMA 2GOLA 1ED1A 1L6NA 1A6SA 2H3QA 2K4HA 2H3IA 2NV3A 1HEKA 2N1RA 2JMGA 2LYAA 4IC9A 2H3FA 4JMUA 1ECWA 2LYBA 2H3VA
chains in the Genus database with same CATH superfamily
2FMQA 4QW8A 5FP0A 5J0SA 4DQPA 2YMQA 1S77D 2BCQA 4JB3A 4OO1J 2MU2A 8ICIA 1S0OA 2QARB 2W9BA 3JPPA 1DGJA 4DF4A 3EPGA 4TQRA 3IN5A 4PZOA 3PSIA 1Q3VA 1ZQMA 2K4EA 2Y9UA 5KT7A 2AGQA 3AUOA 5KAIU 4B9LA 1KEJA 5KFMA 4ED0A 3OHAA 3M9NB 5DB9A 2BQRA 2ODGA 1A6SA 4DEZA 5KT6A 4QIWC 5ALOA 3OSPA 1T7PA 5D46A 5AK6A 2QB0A 1NJZA 1AQ6A 3K1RB 1RG6A 3J81j 3A0BU 2FE9A 4M0AA 3N28A 1NK8A 1IIPA 9ICJA 1JX4A 2DF4B 2V4QA 2E3TA 2WAQF 2BGWA 5KFIA 3EUB2 3NTUA 2JEJA 1Z1BA 4F8RA 4DL2A 1MQ3A 4J9SA 2R8IA 5KG4A 3Q8RB 3AMZA 5EE3A 4PGYA 1PK1B 5KFKA 2FLPA 5AM2A 3MR6A 1ZD2P 1X2IA 3TANA 4O3PA 4JUZA 5KFXA 4EYHB 3G6XA 2FJ6A 1PK3A 3S6JA 2Z7JA 4DSEA 4RQ6A 5J2FA 3CRXA 2KICA 1L8LA 4C8MA 1Z00B 3NS1A 4LZGA 1VDVA 4ECWA 1N48A 4RNOA 4NM2A 1U9LA 3UQ2A 3WKAA 4O0IA 1F44A 9ICFA 2LHTA 5E79U 4UARA 1XU4A 2ZIVB 4FZMA 2W8KA 2HSZA 1ZQCA 4KLDA 4GXKA 5AI0A 2AH5A 3WKBA 8ICWA 3RRHA 1A76A 2DQNB 4I2HA 4A8EA 2WB1C 4ECUA 4MEYA 2ZUBA 2EQYA 8ICKA 4IQWA 4K4GA 5BPCA 3N4MB 4JV2A 4EELA 1ZQPA 1HIWA 3QNMA 2BR0A 5JRTA 2I5HA 3L4PA 2ZIVA 4FZLA 4HYKA 4P4MA 4UAZA 3F5EA 3F5AA 2HVHA 8ICLA 2W9AA 4M9HA 3SV3A 1MN8A 3M8SA 1JXEA 2ES6A 4KLJA 3DEEA 1S8OA 1L8OA 4FBTA 4UASA 3PX4A 4KLEA 1J97A 5JU5A 3FDSA 4QWCA 2VKQA 2GOLA 2E8NA 4DFDA 2FI1A 3PSPA 4NWIA 3M9MB 2HDOA 5AKKA 4DSIA 1RYUA 4Y2RA 5AK4A 3WKDA 4J9KA 2NO4A 3C2MA 1B4FA 1V9PA 1Z00A 2HHSA 3U26A 5EE0A 2H3ZA 3B0XA 5ALDA 2KE7A 1SXDA 1XWLA 3CP8A 2HHTA 9ICHA 5DB6A 2JMGA 2PMZF 4PJ0U 2VA8A 2E1EA 4RT3A 5KT3A 3QU5A 5AI5A 4C8NA 2IOFK 3HILA 7ICMA 2EZXA 2RRDA 5ALWA 1IG6A 3SR6A 4ECTA 1C7YA 2KZZA 4DL5A 1D8LA 4DL3A 4F71A 4FFDA 3WU2U 3TACB 3L5KA 4CF3A 3SAFA 1UQVA 1D9DA 1B43A 3OSNA 4K4HA 1N61A 2W8LA 2YB4A 4DOBA 2K4PA 1ZQOA 5ALKA 2LI6A 7ICIA 5ALLA 2MUTA 1RYSA 2A1JA 1QQ7A 1X6IA 3RJHA 1KTQA 1JUDA 3ICXA 4LVSA 2CXYA 1T8EA 3E0FA 2VIXA 1PVPA 4RUCA 5DG7A 4CDGA 1ZQTA 3RR7A 3GU3A 4YVZA 2H5XA 3CW2C 5AI4A 2Y1JA 3IG8A 4EX6A 5CHGA 3SZ2A 2WF9A 4M6WA 2HW3A 3RAXA 3ORYA 2J6SA 5KFUA 4RQ3A 2OCEA 1KDHA 2P35A 7ICGA 1JI7A 4QZIA 1NK9A 2DGZA 2B6GA 1Y88A 4ICAA 5KFAA 1ZQIA 5J0PA 3EPIA 4B9TA 4R8UA 2W43A 2KP7A 1TAUA 4UB4A 1UHUA 5KFVA 1X9SA 4F5NA 3C5FA 3H4BA 2KEYA 2DKZA 4M04A 5DQHA 1PK1A 3SENA 5A0LA 3V7LA 1TK5A 8ICHA 3QX7A 1EXNA 3WKEA 2QKQA 3GIIA 3QE9Y 2OWOA 1KW4A 2I6XA 1QH9A 3N7PD 3KKAA 3WK4A 3N7RC 1NJWA 4IR9A 1S5LU 2E8OA 2FLNA 1KSPA 5EWGA 5L9XA 4DSJA 5AKYA 4F5QA 4DSKA 3E2EA 3SMVA 2JH7A 1Q3UA 2KIWA 4Q43A 5KL8B 4Z6EA 2DUYA 5KFNA 4CNQA 3MDAA 4ECVA 4IRKA 4IQUA 2WHEA 5TISU 3Q8SB 4YD2A 4JV0A 5D49A 1ZQAA 4TUSA 1JIHA 3K75D 3PW7A 3SV4A 2P6UA 3C21A 3KFUF 4NV0A 2JEGA 1RZTA 1ZQBA 1DK2A 5CA7A 2HOFA 5HR6A 8ICCA 3WK7A 1JRPA 1PZNA 2KOBA 1TVAA 2F2AB 4YR2A 1BNPA 5AI8A 1V85A 5HP4A 2OH2A 3PV8A 4I2JA 3BZKA 2IMWP 3MDCA 2ZJAA 1SB3C 5J2IA 4F4WA 2HOIA 5C5JA 4PPXA 3QU7A 2ZJ5A 3F2BA 4ED8A 4DQQA 3TQ1A 2XIDA 3BQ7A 3KHHA 8ICMA 4R66A 2IOHA 1TAMA 4GLXA 1BPBA 4P0QB 1K5OA 3ETLA 2C22A 1Z1VA 1N56A 2P6RA 2WFAA 3FM9A 2HOQA 5JUMA 2BZFA 2NYVA 2FPMA 4EBEA 2KJ9A 1Q8KA 2HBLA 5IIIA 9ICLA 5HHHA 4C4TA 1QQ6A 1Z19A 2W9MA 4DSFA 1FEZA 2K4HA 5AKHA 1BPZA 5C0YA 4NLKA 2AU0A 1WWUA 2JRZA 4QZAA 3RJFA 1T3QA 1SGGA 4DCCA 2YQEA 2W7OA 5B5EU 4P0QA 3C2LA 2KJ8A 1K1SA 4CGZA 3MBYA 4RZRA 2Y1IA 7ICSA 3V6JA 2H3FA 3BDPA 5EE9A 3BQ1A 4BWMA 2Y0SF 4Y2YA 1CRXA 5KFDA 4UB5A 3LYSA 5L1LA 2KD1A 2GH1A 2KNJA 7ICNA 3T5HA 3QUBA 3NRZA 5HMMA 1JN3A 5EOZA 4DFJA 4F2RA 3JPNA 5ALGA 2JEFA 1H38A 4F4YA 1NI3A 4U6PA 5DQIA 4JK1A 5ALYA 4KN4A 4QWDA 4E0DA 3RRGA 5DB7A 2VA3A 4M47A 3VCBA 5BOLA 2NV3A 3CNHA 2XCPA 2LYHA 4YXJA 2J6UA 3T5LA 4UBBA 9ICGA 2FMSA 1OUQA 3SD7A 3TADC 4Z6DA 1ZXIA 2BKEA 3HWTA 4P4OA 1BPDA 3G6YA 4R65A 1XC9A 1SV0A 2FDRA 3OTQA 2A19A 3C1YA 4I29A 3NVYA 4YMOA 8ICBA 3H8WA 3T5KA 8ICUA 9ICCA 5KFRA 2F1HA 2M9NA 4QZ9A 5AKZA 2O6KA 2PFPA 3ZDBA 4FE3A 1MA7A 4AP9A 4MFCA 4O3RA 5DLFA 2M0NA 4U7CA 4YP3A 3H4DA 5DDYA 4MEXA 4KLIA 2F8LA 3ZDEA 4YMNA 2JZBA 2LM4A 2F1JA 4KLTA 4KLSA 4EYIB 4AYBF 1T94A 3ZDDA 9ICOA 3TADA 5DBCA 3HRDD 5TZVA 4TUPA 2E5SA 4YFKA 4PHEA 2BCSA 4AYBC 5J0TA 1SL0A 3H7IA 5KFTA 1TK0A 1A0PA 3SI8A 2DFLA 4CRXA 3QXGA 2DPIA 2QARA 5ALIA 2PFQA 3RJIA 4Z6CA 3QEBZ 4RPZA 5KT4A 3C29A 1DXSA 3D2SA 2F1IA 4YR0A 4US9A 2WF7A 3BZCA 2W7PA 2ISPA 3IM1A 5L1MA 4ELUA 2ZIUA 3QU4A 1SKSA 3KHLA 3M7DA 5J2GA 5KT5A 3ZDCA 3C5GA 1MC8A 4EX7A 4YQWA 1SZPA 1NK6A 1D8BA 3QZ7A 3QEAZ 8ICFA 4J9MA 3KHRA 3RB3A 3GFKB 4M9JA 4KLHA 5F9NA 1X42A 4EEKA 2W3RA 3RBDA 1N62A 2BDUA 4TQSA 2EH9A 1HJPA 5J0YA 4XA5A 1BVSA 2NRTA 3HP6A 3JPSA 4DQSA 4J9RA 2W55A 3B9JA 1LVHA 1WUDA 4MFAA 1QCKA 1JALA 3QUQA 5KFCA 5L1IA 1Z3EB 4LJXA 3C2KA 3AU2A 2KVCA 1ED1A 2WF8A 2VJ4A 2JR5A 8ICXA 4QZ8A 4KLUA 4NLZA 5IINA 2IA6A 3NGDA 3PX0A 4I2GA 1XNSA 3RJJA 2JV3A 2W03A 3QUTA 4IC9A 4QWEA 2WF6A 3EZ5A 1L3TA 2BPFA 4P0PA 5DBBA 4KMOB 9ICEA 4F3OA 1PUZA 5ALMA 8ICRA 1UT5A 4BXOA 3MFHA 3UM9A 4RQ5A 1NKCA 2AQ0A 2NRZA 4B6JA 4P0PB 7ICHA 3HPOA 2GWSA 2I1QA 1QSYA 4Q8EA 3AL0B 2WAQC 2MA1A 5J29A 4NY8A 9ICBA 2E8PA 1BGXT 5IIMA 2DKXA 2PXIA 3GV8B 2V9WA 8ICVA 9ICKA 3KTQA 2KHVA 3AN1A 4GIBA 4F5RA 3MC1A 1AROP 5B66U 2C2DA 2YTUA 2ASJA 1N60A 2BCUA 3UPQA 3L3FX 2UVVA 4PHPA 4UB3A 1JMSA 4C7YA 1ZJNA 1ZQJA 2W11A 1NK0A 1ZD4A 5AKIA 2XY7A 1HUZA 2PKEA 1TV9A 4J03A 2B21A 1X66A 1F5SA 1GO3F 9ICTA 5AKGA 1URJA 2ZXIA 4P4PA 1KFTA 2HBKA 2PFNA 2XCAA 1ZQHA 3H40A 5ALNA 4F72A 2KSOB 2MSNA 4MF8A 5KFSA 5J8YA 4G9BA 4CF4A 3DV9A 1S0NA 2LYAA 3KOOA 3LVVA 3LDAA 2WTFA 2NRWA 3N7SC 2D6FC 5F3XB 1FIQA 2Y9TA 3JPOA 3K4GA 1T3NA 7ICRA 2K60A 3KZXA 4TUQA 1U49A 5AM3A 1YZ7A 1X9WA 2KZ3A 1NKEA 1RQNA 3I1YA 3T5JA 3NVZA 4OJLA 3K1ZA 3QUCA 5KFHA 1ZD5A 3M6ZA 1L3SA 1RXVA 2IHNA 2LPEA 5KG0A 2JH1A 2RLTA 3IG5A 4DL6A 5KFBA 1KN5A 5KG7A 4JWMA 4ECZA 1ZRMA 2H3IA 2HHWA 1V38A 3SEIA 5AI9A 5J2HA 1D8YA 3D2QA 1DGSA 2HHUA 1RYRA 5HNKA 3GV7B 1KL9A 2C28A 3GIJA 2MAXA 2J6TA 1NK4A 5J0UA 3M1YA 5HHIA 2AGPA 2HHXA 1FFUA 2L5YA 8ICEA 3A0HU 4B9MA 2XY5A 4DS4A 2LYBA 2D8CA 5J8YC 3M8RA 1J2NA 4UB2A 3MGIA 4NM1A 3PY8A 1UPHA 1KFDA 4NLCA 5AICA 1XSNA 4UB6U 4Q8FA 2XC9A 5KFFA 4DWIA 3UXOA 1L7OA 1S76D 5KFGA 3KD3A 4ED6A 5KG2A 3V6KA 4EBCA 1TFRA 1RQLA 2K8CB 3KKAC 2N1RA 4R63A 4GXJA 1T4GA 2FPLA 2WB1F 4USAA 2KJ5A 1KQQA 3FC4A 2G5HB 3D6JA 1LKYA 2ASLA 1HUOA 1NOMA 3BJYA 4ECRA 1LB2B 4ED3A 4JWNA 3WKCA 3Q8LA 2RHFA 2DPJA 1VLBA 2ESEA 4J9QA 4O3NA 2FLLA 2PMZC 1MSWD 1ZQXA 5IIOA 5AM4A 4F4KA 4M9GA 1SWWA 4QZBA 3IRUA 3B0YA 4DF8A 5DKWA 1JROA 3AQEA 1COKA 7ICPA 1X9XA 4DFPA 3GILA 3ED5A 4QZCA 5AI6A 4RNMA 1CI4A 8ICOA 3MGVA 3H8MA 5J2CA 5AHXA 2F8KA 4F50A 5J2DA 1X6JA 5KG1A 2KKPA 2JGAA 4RNNA 3NUQA 3RB4A 1Z4NA 2ISOA 4IRDA 2KG5A 3ZD8A 2Q4TA 5G5HA 4KLLA 3HJEA 2E8MA 4RQ7A 5AM0A 4YG2A 2RQ5A 4K4IA 3QYPA 9ICUA 1UA1A 2XY6A 7ICQA 2MRLA 2BPCA 3TKAA 3QU9A 1PVRA 4X5VA 5L1KA 3TI0A 4EENA 3C23A 1CEZA 3PSTA 4FS1A 5CWRA 3H0MB 4ED1A 5AIAA 3ONNA 4NL9C 4OJ5A 4UB1A 2K4IA 4DLGA 4YCXA 4UAVA 5AKXA 5EWFA 3WK8A 4DFMA 1J2MA 2K8AA 1SV0C 4QJFB 3TFRA 3ZDAA 4MF2A 1ZQQA 2ZTCA 2KN7A 2KMDA 4B9NA 2R8KA 2EANA 3KZIU 1ZQYA 3MFIA 4ELVA 5DQGA 1JXLA 2LM1A 1ZQFA 3MR2A 4UB8U 5KAFU 3TAPA 3KBBA 4QZFA 1ZQLA 2MUTB 3TAQA 3BS5B 5DBAA 5KT2A 4NXZA 4PH5A 5J0QA 3FAHA 3UXNA 2IHMA 1ZQEA 3RB0A 1L7MA 2OYYA 4F2SA 1WCNA 1K1QA 2XICA 1UCVA 2CN1A 5KG3A 4XQ8A 9ICXA 2LMRA 3M6KA 8ICQA 4CE6A 3PR5B 5AKLA 4UW9A 5KL1B 2HBMA 4QW9A 4UQGA 3Q8MA 4EBDA 5CRXA 3SAGA 3PMLA 1QTMA 4I2CA 9ICMA 3HT3A 5KFWA 1KBUA 2W9BB 4PZNA 1B22A 4C7ZA 3PMNA 3FYHA 2Y0SC 3GIMA 3BQ2A 1S0MA 2EDUA 1OXJA 4IL6U 5AIBA 5J2BA 4Y2TA 4Y2PA 1SKRA 4KLOA 4DS5A 2ZIXA 5CP2A 5KFEA 4YD1A 3GV5B 4NL9A 4DO9A 2Q0ZX 2QB0B 4JV1A 1SZHA 5AKEA 3ISBA 2BCVA 4PL1A 2F77X 7ICTA 2GO7A 3QU2A 2HI0A 3ALRA 3E58A 2XGPA 3GDXA 3GIKA 3NVWA 1BPXA 4US8A 5J2EA 4BXOB 3PR4A 4GXIA 4UAYA 3RTVA 3C28A 3IP4B 5KFLA 4O5CA 2YY6A 4OJ6A 5J2AA 2XI9A 1XO0A 4QIWF 1NJXA 4WJ3B 8ICAA 2G5IB 1KFSA 5F9LA 3V7JA 1U47A 1BNOA 3RH5A 3Q8QB 1ZQSA 7ICUA 2VJ5A 3NASA 9ICSA 1X40A 5CJ7A 1FO4A 4YN4A 2YMPA 1WWVA 4QZHA 3H8SA 1M6YA 1WCLA 1NZPA 2W3SA 3DDHA 2NRVA 2HHVA 2NO5A 4ACOA 1U4BA 5GTIU 4QNLA 2BDPA 3F2CA 4UAUA 4NJ8A 4XUSA 3C1ZA 2IOFA 4R64A 5K4LA 4M9LA 4RPXA 1SIJA 4C4RA 5ALJA 7ICOA 5JTIA 2PI4A 2OHFA 4OJOA 5CEHA 4UBCA 4ELTA 4BX9C 5KFOA 4PGXA 5D4BA 4NLNA 4LZDA 3OPXA 1B0XA 3EYZA 1XSLA 3ZD9A 5KG5A 3N97B 2UVWA 5EWEA 3F2DA 2ZJ8A 2DL0A 2KSOA 1BPEA 4O5EA 2W04A 3SAHA 3Q8PB 2H3QA 4J9NA 4TURA 2EAMA 4RQNA 3R9KA 4I27A 2KFZA 5BOMA 2FPKA 8ICZA 4M9NA 3F53A 3OJUA 3WK9A 3AQFA 3EWAA 2ALZA 3UMBA 4MHVA 3T3FA 3UMGA 4IRCA 1TE2A 1C20A 4RT2A 1UA0A 1SXEA 4B9SA 2VA2A 4DQRA 4B9UA 2B0CA 1NJYA 3PW0A 3IV6A 5J0XA 1ECWA 4R8UB 2KK0A 8ICSA 2FMPA 1QLNA 3V7KA 2R18A 1ZQNA 2ZTEA 3PVXA 4DFKA 2ZIWB 5KFYA 1WG8A 4F92B 2ZIUB 1ZQGA 3SQIA 2IBKA 5AM1A 1S10A 4IQTA 4C8LA 3CYMA 2RP5A 2A1JB 2BCRA 1U48A 1MQ2A 1LV5A 1Z4OA 3IHQB 4JMUA 3THVA 9ICAA 1SV4A 4EZ9A 4RQ0A 2G07A 1ZQDA 5T14A 3EW9A 5ALHA 3MGHA 3ZI4A 1L3VA 5DGBA 1ZQVA 3Q8KA 3O0FA 3RJGA 4C8OA 1YT3A 3BQ0A 5DG9A 1ZJMA 9ICVA 4KLMA 4XRHA 1NKBA 5IIJA 3PW5A 3PSFA 2F3NA 2R8HA 1SWVA 5ALVA 2EAPA 4Z6FA 1ZQUA 2VANA 4M2YA 2AHOB 4ECQA 2ZIXB 3MR5A 2ZG6A 4O3MA 5L1JA 4RQMA 5DLGA 4PGQA 3NVVA 4DLEA 3RFAA 3PZPA 1CUKA 9ICRA 7ICLA 1RPLA 2C2EA 3WK5A 4ECXA 8ICNA 9ICIA 1F0MA 2KV2A 1ZQKA 1NK5A 2ZUCA 4F5PA 1XO1A 5AM5A 9ICWA 1WYGA 3GQCA 4Y2XA 4B9VA 3LWLA 9ICNA 2KVSA 2JEIA 4PHDA 8ICGA 3GZFA 5J0WA 3JPTA 2HMXA 4KX3A 2KKVA 1L6NA 3OGUA 4UATA 3UXPA 1ZETA 4I2AA 7ICKA 3BS7A 3UQ0A 4QZDA 2EZYA 2KIVA 2EAOA 3MABA 5DB8A 2UVUA 4DQIA 2AGOA 4BUGA 2YN4A 4RU9A 2YB1A 5ALTA 2A3VA 2YMLA 2PI5A 1V97A 3HKZF 3T79A 2JZBB 5IILA 8ICPA 1IV8A 4GC6A 4O3QA 4Q44A 2HHQA 4GC7A 4O3SA 3SYZA 2BPGA 1N2XA 3D2NA 4RPYA 3LVWA 5IIKA 2DBYA 4I2BA 1N5XA 4BWJA 3RJEA 4BGDA 5ALPA 2E1FA 3BS5A 1TK8A 1D9FA 3IDWA 2QLTA 4FBUA 1S9FA 1N63A 4IR1A 4BDPA 1OW5A 2C2RA 3RBEA 3ETRA 2ZTDA 5CB1A 1U45A 2G0AA 5DDMA 5ALZA 1FFVA 5ALXA 2RDJA 4KMUA 2XVTA 4KITB 4YR3A 4CCHA 3AEVA 1ZQWA 3V6HA 5KFPA 4KLGA 5HR7A 4UAWA 3HKZC 5KG6A 1ZQZA 2GLEA 4ED2A 2D3DA 4MFFA 4G3IA 5G5GA 3OHBA 3TFSA 4O9MA 2CPRA 4J9PA 2XGQA 1RM6C 2WF5A 4BJQA 4DSLA 4I28A 5HMLA 1ZYQA 2P66A 4OD0A 3PW4A 4FS2A 3RH4A 4Y2QA 2KFNA 3HW8A 1L7PA 1PVQA 8ICYA 4Y2VA 2K89A 1X9MA 1O03A 1NNLA 4QWBA 3OJSA 2I9GA 2YMMA 4DL7A 1L7NA 7ICEA 5J2KA 4DOCA 1ZOLA 4F91B 5KFJA 2PFOA 3M9OB 4NLBA 7ICFA 3PNCA 4C8KA 2BQ3A 3LK9A 5KFZA 4IS7A 4EZ6A 2G09A 2R8JA 4J9OA 4IQVA 2AQ4A 2ATLA 1NZBA 4ZH4A 3JPRA 2EZZA 5ALQA 1TKDA 1ZRNA 5AK5A 4ECSA 4OCZA 2A1AA 2ASDA 4RQ4A 2V4RA 4P2HA 1NK7A 3WK6A 1RDFA 2XO7A 3LWMA 5H2FU 7ICVA 1S97A 1O08A 2ZUDA 3MR3A 4DOAA 3QZ8A 3I28A 3RB6A 1DK3A 4QZGA 1SL2A 5KFQA 2OEHA 3H8JA 5DG8A 4C0ZA 4J9LA 1SL1A 4ECYA 2H3VA 3G6VA 1ZQRA 3TARA 1XSPA 1S0VA 3H0RB 1A77A 4M6WB 1COOA 3I76A 4Y2UA 2OXOA 4ED7A 2OM6A 3HX0A 4RQ2A 3RH6A 3UMCA 4HAIA 4DL4A 1LKYB 4OJPA 1UT8A 2JXJA 2LBOA 4KLFA 3AM9A 2QB1A 4I2DA 4O3OA 3RF9A 4I2FA 2G08A 3PW2A 2KZMA 1DRGA 4O5KA 2JHDA 3ISDA 4PHAA 2UVRA 1TAQA 5AK3A 5J2JA 4KLQA 9ICQA 4Q45A 2AXTU 4Y2JA 1KRPA 3ISCA 2KTQA 4F4XA 1RXWA 2AJQA 5ALFA 8ICTA 4ZOHC 2BHNA 1L5UA 2CRXA 5ALRA 4EEYA 2HCFA 4F4ZA 4RQ1A 3AU6A 3H0LB 5J0RA 2LKYA 1YZ6A 3V72A 4PL2A 4CF5A 4QWAA 2HVIA 3RJKA 1N5WA 3KHGA 2NRXA 5KTQA 4Y2SA 3RAQA 1SKWA 1HEKA 5GTHU 2R8GA 1IM4A 5AKJA 3RR8A 2W9CA 4FO6A 7ICJA 1ZD3A 3BQTA 4QZEA 1KKXA 4KX5A 2F44A 1L3UA 4I2IA 1DOQA 2W9CB 2ZXHA 5KNIA 3PX6A 4RQ8A 5DGAA 4KTQA 4NLGA 2G06A 4RUAA 5ALSA 2KHQA 2W54A 5ALUA 2BQUA 4C4SA 4YMMA 2RDIA 2K8BB 5ALEA 4FZNA 8ICJA 3JPQA 4KN7A 3VC8A 1QSSA 2DWQA 5EE1A 3PO5A 1QSLA 1IXRA 1XS9D 3NRWA 4C80A 5CR0A 4F5OA 2HBJA 1Q46A 1VJ5A 4I2EA 4F93B 1ZQ1C 2F76X 4GFJA 5J0OA 3PO4A 1BPYA 9ICPA 1QQ5A 1KLNA 2ZIWA 4YXMA 1P7DA 2YX8A
chains in the Genus database with same CATH topology
3M6ZA 4ICAA 1DRGA 2VJ5A 2Z7JA 2H3ZA 2WAQC 2MA1A 2PMZC 2XIDA 3GZFA 4U6PA 2R18A 3CRXA 2JHDA 4BJQA 2KICA 2HMXA 2JH1A 3IG5A 4KX3A 1TAMA 3C29A 3CP8A 2KKVA 1L6NA 2ZIWB 2ZIUB 3SQIA 4OO1J 3D2SA 4P0QB 1PVQA 2K89A 2KHVA 2W7PA 3CYMA 2KEYA 2RP5A 2H3IA 3VCBA 2OYYA 2NV3A 2ZIUA 1F44A 3AQEA 2CRXA 5A0LA 2JMGA 2LHTA 2HOQA 2PMZF 2CN1A 2XICA 3M7DA 4JMUA 4ACOA 2ZIVB 3PSIA 3M6KA 4FZMA 1Q3VA 2E1EA 3H0LB 4BUGA 5KL1B 4QNLA 2G07A 2LKYA 3L3FX 2K4EA 3D2QA 3MGVA 2HBMA 3F2CA 1D8BA 1OUQA 2YB1A 4PL2A 4NLBA 5T14A 2KJ9A 3N7PD 5CRXA 2RRDA 3SAGA 2A3VA 3N7RC 2DQNB 2G09A 2HBLA 4A8EA 2WB1C 1A6SA 2BDUA 2KKPA 3HKZF 4QIWC 3O0FA 3T79A 2JGAA 1Z19A 1NZBA 3NUQA 5HR6A 1YT3A 4OJOA 2K4HA 1KBUA 4BX9C 1HEKA 2Q4TA 3SMVA 3OPXA 5C0YA 1WUDA 2JH7A 2Y0SC 1Q3UA 2KIWA 2LYBA 5KL8B 3SAFA 1GO3F 3D2NA 3LVWA 1HIWA 3PSFA 1UPHA 2ZIXA 1URJA 2ZXIA 4KX5A 2YB4A 4FE3A 2W7OA 3F2DA 1IIPA 2ZIVA 1MA7A 4FZLA 4P0QA 3IN5A 4NLCA 2DF4B 2HBKA 2KVCA 2E1FA 2KJ8A 3F5EA 1ED1A 2W04A 2VJ4A 2WAQF 3SAHA 3F2BA 3F5AA 2H3QA 2M0NA 4U7CA 2ZXHA 2MRLA 4CGZA 2F8LA 3ICXA 2ZIXB 2G06A 2ZG6A 1PVRA 1SZHA 2KHQA 3DEEA 1Z1BA 2K8CB 1XNSA 2N1RA 2W03A 4IC9A 2LYAA 2F77X 3LVVA 2G0AA 2H3FA 3E0FA 4PL1A 2VIXA 4NV0A 4O3MA 3KFUF 3N7SC 3PSTA 4C0ZA 2D6FC 1PVPA 2K8BB 2H3VA 3ALRA 3F53A 3H0MB 4CDGA 4FZNA 1T94A 3ONNA 2XVTA 3AQFA 2WB1F 3GU3A 4OJ5A 4AYBF 2HOFA 2K4IA 2Y0SF 3KZXA 4P0PA 4KMOB 3VC8A 3RFAA 3PZPA 3H0RB 1CRXA 2KOBA 2KJ5A 2F2AB 2VKQA 2E5SA 2OXOA 3IP4B 3C28A 2OH2A 3NRWA 2GOLA 2G5HB 2OM6A 2K8AA 4OJ6A 2HBJA 3IG8A 3LYSA 4QJFB 5HR7A 2XI9A 4AYBC 1XO0A 2KD1A 3HKZC 4QIWF 3PSPA 4NWIA 4WJ3B 2KV2A 2GH1A 2G5IB 2KNJA 4P0PB 1ZQ1C 4OJPA 2F76X 4OJLA 4GFJA 2LBOA 3K1ZA 2HOIA 2DGZA 1A0PA 2ZIWA 1ECWA 2RHFA 1P7DA 4CRXA 3RF9A 3AL0B 2CPRA 2YX8A 2G08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICA A;  2K4E A;  2K4I A;  2H3Z A;  1HIW A;  1UPH A;  2HMX A;  1TAM A;  2GOL A;  1ED1 A;  1L6N A;  1A6S A;  2H3Q A;  2K4H A;  2H3I A;  2NV3 A;  1HEK A;  2N1R A;  2JMG A;  2LYA A;  4IC9 A;  2H3F A;  4JMU A;  1ECW A;  2LYB A;  2H3V A; 
#chains in the Genus database with same CATH topology
 2FMQ A;  4QW8 A;  5FP0 A;  5J0S A;  4DQP A;  2YMQ A;  1S77 D;  2BCQ A;  4JB3 A;  4OO1 J;  2MU2 A;  8ICI A;  1S0O A;  2QAR B;  2W9B A;  3JPP A;  1DGJ A;  4DF4 A;  3EPG A;  4TQR A;  3IN5 A;  4PZO A;  3PSI A;  1Q3V A;  1ZQM A;  2K4E A;  2Y9U A;  5KT7 A;  2AGQ A;  3AUO A;  5KAI U;  4B9L A;  1KEJ A;  5KFM A;  4ED0 A;  3OHA A;  3M9N B;  5DB9 A;  2BQR A;  2ODG A;  1A6S A;  4DEZ A;  5KT6 A;  4QIW C;  5ALO A;  3OSP A;  1T7P A;  5D46 A;  5AK6 A;  2QB0 A;  1NJZ A;  1AQ6 A;  3K1R B;  1RG6 A;  3J81 j;  3A0B U;  2FE9 A;  4M0A A;  3N28 A;  1NK8 A;  1IIP A;  9ICJ A;  1JX4 A;  2DF4 B;  2V4Q A;  2E3T A;  2WAQ F;  2BGW A;  5KFI A;  3EUB 2;  3NTU A;  2JEJ A;  1Z1B A;  4F8R A;  4DL2 A;  1MQ3 A;  4J9S A;  2R8I A;  5KG4 A;  3Q8R B;  3AMZ A;  5EE3 A;  4PGY A;  1PK1 B;  5KFK A;  2FLP A;  5AM2 A;  3MR6 A;  1ZD2 P;  1X2I A;  3TAN A;  4O3P A;  4JUZ A;  5KFX A;  4EYH B;  3G6X A;  2FJ6 A;  1PK3 A;  3S6J A;  2Z7J A;  4DSE A;  4RQ6 A;  5J2F A;  3CRX A;  2KIC A;  1L8L A;  4C8M A;  1Z00 B;  3NS1 A;  4LZG A;  1VDV A;  4ECW A;  1N48 A;  4RNO A;  4NM2 A;  1U9L A;  3UQ2 A;  3WKA A;  4O0I A;  1F44 A;  9ICF A;  2LHT A;  5E79 U;  4UAR A;  1XU4 A;  2ZIV B;  4FZM A;  2W8K A;  2HSZ A;  1ZQC A;  4KLD A;  4GXK A;  5AI0 A;  2AH5 A;  3WKB A;  8ICW A;  3RRH A;  1A76 A;  2DQN B;  4I2H A;  4A8E A;  2WB1 C;  4ECU A;  4MEY A;  2ZUB A;  2EQY A;  8ICK A;  4IQW A;  4K4G A;  5BPC A;  3N4M B;  4JV2 A;  4EEL A;  1ZQP A;  1HIW A;  3QNM A;  2BR0 A;  5JRT A;  2I5H A;  3L4P A;  2ZIV A;  4FZL A;  4HYK A;  4P4M A;  4UAZ A;  3F5E A;  3F5A A;  2HVH A;  8ICL A;  2W9A A;  4M9H A;  3SV3 A;  1MN8 A;  3M8S A;  1JXE A;  2ES6 A;  4KLJ A;  3DEE A;  1S8O A;  1L8O A;  4FBT A;  4UAS A;  3PX4 A;  4KLE A;  1J97 A;  5JU5 A;  3FDS A;  4QWC A;  2VKQ A;  2GOL A;  2E8N A;  4DFD A;  2FI1 A;  3PSP A;  4NWI A;  3M9M B;  2HDO A;  5AKK A;  4DSI A;  1RYU A;  4Y2R A;  5AK4 A;  3WKD A;  4J9K A;  2NO4 A;  3C2M A;  1B4F A;  1V9P A;  1Z00 A;  2HHS A;  3U26 A;  5EE0 A;  2H3Z A;  3B0X A;  5ALD A;  2KE7 A;  1SXD A;  1XWL A;  3CP8 A;  2HHT A;  9ICH A;  5DB6 A;  2JMG A;  2PMZ F;  4PJ0 U;  2VA8 A;  2E1E A;  4RT3 A;  5KT3 A;  3QU5 A;  5AI5 A;  4C8N A;  2IOF K;  3HIL A;  7ICM A;  2EZX A;  2RRD A;  5ALW A;  1IG6 A;  3SR6 A;  4ECT A;  1C7Y A;  2KZZ A;  4DL5 A;  1D8L A;  4DL3 A;  4F71 A;  4FFD A;  3WU2 U;  3TAC B;  3L5K A;  4CF3 A;  3SAF A;  1UQV A;  1D9D A;  1B43 A;  3OSN A;  4K4H A;  1N61 A;  2W8L A;  2YB4 A;  4DOB A;  2K4P A;  1ZQO A;  5ALK A;  2LI6 A;  7ICI A;  5ALL A;  2MUT A;  1RYS A;  2A1J A;  1QQ7 A;  1X6I A;  3RJH A;  1KTQ A;  1JUD A;  3ICX A;  4LVS A;  2CXY A;  1T8E A;  3E0F A;  2VIX A;  1PVP A;  4RUC A;  5DG7 A;  4CDG A;  1ZQT A;  3RR7 A;  3GU3 A;  4YVZ A;  2H5X A;  3CW2 C;  5AI4 A;  2Y1J A;  3IG8 A;  4EX6 A;  5CHG A;  3SZ2 A;  2WF9 A;  4M6W A;  2HW3 A;  3RAX A;  3ORY A;  2J6S A;  5KFU A;  4RQ3 A;  2OCE A;  1KDH A;  2P35 A;  7ICG A;  1JI7 A;  4QZI A;  1NK9 A;  2DGZ A;  2B6G A;  1Y88 A;  4ICA A;  5KFA A;  1ZQI A;  5J0P A;  3EPI A;  4B9T A;  4R8U A;  2W43 A;  2KP7 A;  1TAU A;  4UB4 A;  1UHU A;  5KFV A;  1X9S A;  4F5N A;  3C5F A;  3H4B A;  2KEY A;  2DKZ A;  4M04 A;  5DQH A;  1PK1 A;  3SEN A;  5A0L A;  3V7L A;  1TK5 A;  8ICH A;  3QX7 A;  1EXN A;  3WKE A;  2QKQ A;  3GII A;  3QE9 Y;  2OWO A;  1KW4 A;  2I6X A;  1QH9 A;  3N7P D;  3KKA A;  3WK4 A;  3N7R C;  1NJW A;  4IR9 A;  1S5L U;  2E8O A;  2FLN A;  1KSP A;  5EWG A;  5L9X A;  4DSJ A;  5AKY A;  4F5Q A;  4DSK A;  3E2E A;  3SMV A;  2JH7 A;  1Q3U A;  2KIW A;  4Q43 A;  5KL8 B;  4Z6E A;  2DUY A;  5KFN A;  4CNQ A;  3MDA A;  4ECV A;  4IRK A;  4IQU A;  2WHE A;  5TIS U;  3Q8S B;  4YD2 A;  4JV0 A;  5D49 A;  1ZQA A;  4TUS A;  1JIH A;  3K75 D;  3PW7 A;  3SV4 A;  2P6U A;  3C21 A;  3KFU F;  4NV0 A;  2JEG A;  1RZT A;  1ZQB A;  1DK2 A;  5CA7 A;  2HOF A;  5HR6 A;  8ICC A;  3WK7 A;  1JRP A;  1PZN A;  2KOB A;  1TVA A;  2F2A B;  4YR2 A;  1BNP A;  5AI8 A;  1V85 A;  5HP4 A;  2OH2 A;  3PV8 A;  4I2J A;  3BZK A;  2IMW P;  3MDC A;  2ZJA A;  1SB3 C;  5J2I A;  4F4W A;  2HOI A;  5C5J A;  4PPX A;  3QU7 A;  2ZJ5 A;  3F2B A;  4ED8 A;  4DQQ A;  3TQ1 A;  2XID A;  3BQ7 A;  3KHH A;  8ICM A;  4R66 A;  2IOH A;  1TAM A;  4GLX A;  1BPB A;  4P0Q B;  1K5O A;  3ETL A;  2C22 A;  1Z1V A;  1N56 A;  2P6R A;  2WFA A;  3FM9 A;  2HOQ A;  5JUM A;  2BZF A;  2NYV A;  2FPM A;  4EBE A;  2KJ9 A;  1Q8K A;  2HBL A;  5III A;  9ICL A;  5HHH A;  4C4T A;  1QQ6 A;  1Z19 A;  2W9M A;  4DSF A;  1FEZ A;  2K4H A;  5AKH A;  1BPZ A;  5C0Y A;  4NLK A;  2AU0 A;  1WWU A;  2JRZ A;  4QZA A;  3RJF A;  1T3Q A;  1SGG A;  4DCC A;  2YQE A;  2W7O A;  5B5E U;  4P0Q A;  3C2L A;  2KJ8 A;  1K1S A;  4CGZ A;  3MBY A;  4RZR A;  2Y1I A;  7ICS A;  3V6J A;  2H3F A;  3BDP A;  5EE9 A;  3BQ1 A;  4BWM A;  2Y0S F;  4Y2Y A;  1CRX A;  5KFD A;  4UB5 A;  3LYS A;  5L1L A;  2KD1 A;  2GH1 A;  2KNJ A;  7ICN A;  3T5H A;  3QUB A;  3NRZ A;  5HMM A;  1JN3 A;  5EOZ A;  4DFJ A;  4F2R A;  3JPN A;  5ALG A;  2JEF A;  1H38 A;  4F4Y A;  1NI3 A;  4U6P A;  5DQI A;  4JK1 A;  5ALY A;  4KN4 A;  4QWD A;  4E0D A;  3RRG A;  5DB7 A;  2VA3 A;  4M47 A;  3VCB A;  5BOL A;  2NV3 A;  3CNH A;  2XCP A;  2LYH A;  4YXJ A;  2J6U A;  3T5L A;  4UBB A;  9ICG A;  2FMS A;  1OUQ A;  3SD7 A;  3TAD C;  4Z6D A;  1ZXI A;  2BKE A;  3HWT A;  4P4O A;  1BPD A;  3G6Y A;  4R65 A;  1XC9 A;  1SV0 A;  2FDR A;  3OTQ A;  2A19 A;  3C1Y A;  4I29 A;  3NVY A;  4YMO A;  8ICB A;  3H8W A;  3T5K A;  8ICU A;  9ICC A;  5KFR A;  2F1H A;  2M9N A;  4QZ9 A;  5AKZ A;  2O6K A;  2PFP A;  3ZDB A;  4FE3 A;  1MA7 A;  4AP9 A;  4MFC A;  4O3R A;  5DLF A;  2M0N A;  4U7C A;  4YP3 A;  3H4D A;  5DDY A;  4MEX A;  4KLI A;  2F8L A;  3ZDE A;  4YMN A;  2JZB A;  2LM4 A;  2F1J A;  4KLT A;  4KLS A;  4EYI B;  4AYB F;  1T94 A;  3ZDD A;  9ICO A;  3TAD A;  5DBC A;  3HRD D;  5TZV A;  4TUP A;  2E5S A;  4YFK A;  4PHE A;  2BCS A;  4AYB C;  5J0T A;  1SL0 A;  3H7I A;  5KFT A;  1TK0 A;  1A0P A;  3SI8 A;  2DFL A;  4CRX A;  3QXG A;  2DPI A;  2QAR A;  5ALI A;  2PFQ A;  3RJI A;  4Z6C A;  3QEB Z;  4RPZ A;  5KT4 A;  3C29 A;  1DXS A;  3D2S A;  2F1I A;  4YR0 A;  4US9 A;  2WF7 A;  3BZC A;  2W7P A;  2ISP A;  3IM1 A;  5L1M A;  4ELU A;  2ZIU A;  3QU4 A;  1SKS A;  3KHL A;  3M7D A;  5J2G A;  5KT5 A;  3ZDC A;  3C5G A;  1MC8 A;  4EX7 A;  4YQW A;  1SZP A;  1NK6 A;  1D8B A;  3QZ7 A;  3QEA Z;  8ICF A;  4J9M A;  3KHR A;  3RB3 A;  3GFK B;  4M9J A;  4KLH A;  5F9N A;  1X42 A;  4EEK A;  2W3R A;  3RBD A;  1N62 A;  2BDU A;  4TQS A;  2EH9 A;  1HJP A;  5J0Y A;  4XA5 A;  1BVS A;  2NRT A;  3HP6 A;  3JPS A;  4DQS A;  4J9R A;  2W55 A;  3B9J A;  1LVH A;  1WUD A;  4MFA A;  1QCK A;  1JAL A;  3QUQ A;  5KFC A;  5L1I A;  1Z3E B;  4LJX A;  3C2K A;  3AU2 A;  2KVC A;  1ED1 A;  2WF8 A;  2VJ4 A;  2JR5 A;  8ICX A;  4QZ8 A;  4KLU A;  4NLZ A;  5IIN A;  2IA6 A;  3NGD A;  3PX0 A;  4I2G A;  1XNS A;  3RJJ A;  2JV3 A;  2W03 A;  3QUT A;  4IC9 A;  4QWE A;  2WF6 A;  3EZ5 A;  1L3T A;  2BPF A;  4P0P A;  5DBB A;  4KMO B;  9ICE A;  4F3O A;  1PUZ A;  5ALM A;  8ICR A;  1UT5 A;  4BXO A;  3MFH A;  3UM9 A;  4RQ5 A;  1NKC A;  2AQ0 A;  2NRZ A;  4B6J A;  4P0P B;  7ICH A;  3HPO A;  2GWS A;  2I1Q A;  1QSY A;  4Q8E A;  3AL0 B;  2WAQ C;  2MA1 A;  5J29 A;  4NY8 A;  9ICB A;  2E8P A;  1BGX T;  5IIM A;  2DKX A;  2PXI A;  3GV8 B;  2V9W A;  8ICV A;  9ICK A;  3KTQ A;  2KHV A;  3AN1 A;  4GIB A;  4F5R A;  3MC1 A;  1ARO P;  5B66 U;  2C2D A;  2YTU A;  2ASJ A;  1N60 A;  2BCU A;  3UPQ A;  3L3F X;  2UVV A;  4PHP A;  4UB3 A;  1JMS A;  4C7Y A;  1ZJN A;  1ZQJ A;  2W11 A;  1NK0 A;  1ZD4 A;  5AKI A;  2XY7 A;  1HUZ A;  2PKE A;  1TV9 A;  4J03 A;  2B21 A;  1X66 A;  1F5S A;  1GO3 F;  9ICT A;  5AKG A;  1URJ A;  2ZXI A;  4P4P A;  1KFT A;  2HBK A;  2PFN A;  2XCA A;  1ZQH A;  3H40 A;  5ALN A;  4F72 A;  2KSO B;  2MSN A;  4MF8 A;  5KFS A;  5J8Y A;  4G9B A;  4CF4 A;  3DV9 A;  1S0N A;  2LYA A;  3KOO A;  3LVV A;  3LDA A;  2WTF A;  2NRW A;  3N7S C;  2D6F C;  5F3X B;  1FIQ A;  2Y9T A;  3JPO A;  3K4G A;  1T3N A;  7ICR A;  2K60 A;  3KZX A;  4TUQ A;  1U49 A;  5AM3 A;  1YZ7 A;  1X9W A;  2KZ3 A;  1NKE A;  1RQN A;  3I1Y A;  3T5J A;  3NVZ A;  4OJL A;  3K1Z A;  3QUC A;  5KFH A;  1ZD5 A;  3M6Z A;  1L3S A;  1RXV A;  2IHN A;  2LPE A;  5KG0 A;  2JH1 A;  2RLT A;  3IG5 A;  4DL6 A;  5KFB A;  1KN5 A;  5KG7 A;  4JWM A;  4ECZ A;  1ZRM A;  2H3I A;  2HHW A;  1V38 A;  3SEI A;  5AI9 A;  5J2H A;  1D8Y A;  3D2Q A;  1DGS A;  2HHU A;  1RYR A;  5HNK A;  3GV7 B;  1KL9 A;  2C28 A;  3GIJ A;  2MAX A;  2J6T A;  1NK4 A;  5J0U A;  3M1Y A;  5HHI A;  2AGP A;  2HHX A;  1FFU A;  2L5Y A;  8ICE A;  3A0H U;  4B9M A;  2XY5 A;  4DS4 A;  2LYB A;  2D8C A;  5J8Y C;  3M8R A;  1J2N A;  4UB2 A;  3MGI A;  4NM1 A;  3PY8 A;  1UPH A;  1KFD A;  4NLC A;  5AIC A;  1XSN A;  4UB6 U;  4Q8F A;  2XC9 A;  5KFF A;  4DWI A;  3UXO A;  1L7O A;  1S76 D;  5KFG A;  3KD3 A;  4ED6 A;  5KG2 A;  3V6K A;  4EBC A;  1TFR A;  1RQL A;  2K8C B;  3KKA C;  2N1R A;  4R63 A;  4GXJ A;  1T4G A;  2FPL A;  2WB1 F;  4USA A;  2KJ5 A;  1KQQ A;  3FC4 A;  2G5H B;  3D6J A;  1LKY A;  2ASL A;  1HUO A;  1NOM A;  3BJY A;  4ECR A;  1LB2 B;  4ED3 A;  4JWN A;  3WKC A;  3Q8L A;  2RHF A;  2DPJ A;  1VLB A;  2ESE A;  4J9Q A;  4O3N A;  2FLL A;  2PMZ C;  1MSW D;  1ZQX A;  5IIO A;  5AM4 A;  4F4K A;  4M9G A;  1SWW A;  4QZB A;  3IRU A;  3B0Y A;  4DF8 A;  5DKW A;  1JRO A;  3AQE A;  1COK A;  7ICP A;  1X9X A;  4DFP A;  3GIL A;  3ED5 A;  4QZC A;  5AI6 A;  4RNM A;  1CI4 A;  8ICO A;  3MGV A;  3H8M A;  5J2C A;  5AHX A;  2F8K A;  4F50 A;  5J2D A;  1X6J A;  5KG1 A;  2KKP A;  2JGA A;  4RNN A;  3NUQ A;  3RB4 A;  1Z4N A;  2ISO A;  4IRD A;  2KG5 A;  3ZD8 A;  2Q4T A;  5G5H A;  4KLL A;  3HJE A;  2E8M A;  4RQ7 A;  5AM0 A;  4YG2 A;  2RQ5 A;  4K4I A;  3QYP A;  9ICU A;  1UA1 A;  2XY6 A;  7ICQ A;  2MRL A;  2BPC A;  3TKA A;  3QU9 A;  1PVR A;  4X5V A;  5L1K A;  3TI0 A;  4EEN A;  3C23 A;  1CEZ A;  3PST A;  4FS1 A;  5CWR A;  3H0M B;  4ED1 A;  5AIA A;  3ONN A;  4NL9 C;  4OJ5 A;  4UB1 A;  2K4I A;  4DLG A;  4YCX A;  4UAV A;  5AKX A;  5EWF A;  3WK8 A;  4DFM A;  1J2M A;  2K8A A;  1SV0 C;  4QJF B;  3TFR A;  3ZDA A;  4MF2 A;  1ZQQ A;  2ZTC A;  2KN7 A;  2KMD A;  4B9N A;  2R8K A;  2EAN A;  3KZI U;  1ZQY A;  3MFI A;  4ELV A;  5DQG A;  1JXL A;  2LM1 A;  1ZQF A;  3MR2 A;  4UB8 U;  5KAF U;  3TAP A;  3KBB A;  4QZF A;  1ZQL A;  2MUT B;  3TAQ A;  3BS5 B;  5DBA A;  5KT2 A;  4NXZ A;  4PH5 A;  5J0Q A;  3FAH A;  3UXN A;  2IHM A;  1ZQE A;  3RB0 A;  1L7M A;  2OYY A;  4F2S A;  1WCN A;  1K1Q A;  2XIC A;  1UCV A;  2CN1 A;  5KG3 A;  4XQ8 A;  9ICX A;  2LMR A;  3M6K A;  8ICQ A;  4CE6 A;  3PR5 B;  5AKL A;  4UW9 A;  5KL1 B;  2HBM A;  4QW9 A;  4UQG A;  3Q8M A;  4EBD A;  5CRX A;  3SAG A;  3PML A;  1QTM A;  4I2C A;  9ICM A;  3HT3 A;  5KFW A;  1KBU A;  2W9B B;  4PZN A;  1B22 A;  4C7Z A;  3PMN A;  3FYH A;  2Y0S C;  3GIM A;  3BQ2 A;  1S0M A;  2EDU A;  1OXJ A;  4IL6 U;  5AIB A;  5J2B A;  4Y2T A;  4Y2P A;  1SKR A;  4KLO A;  4DS5 A;  2ZIX A;  5CP2 A;  5KFE A;  4YD1 A;  3GV5 B;  4NL9 A;  4DO9 A;  2Q0Z X;  2QB0 B;  4JV1 A;  1SZH A;  5AKE A;  3ISB A;  2BCV A;  4PL1 A;  2F77 X;  7ICT A;  2GO7 A;  3QU2 A;  2HI0 A;  3ALR A;  3E58 A;  2XGP A;  3GDX A;  3GIK A;  3NVW A;  1BPX A;  4US8 A;  5J2E A;  4BXO B;  3PR4 A;  4GXI A;  4UAY A;  3RTV A;  3C28 A;  3IP4 B;  5KFL A;  4O5C A;  2YY6 A;  4OJ6 A;  5J2A A;  2XI9 A;  1XO0 A;  4QIW F;  1NJX A;  4WJ3 B;  8ICA A;  2G5I B;  1KFS A;  5F9L A;  3V7J A;  1U47 A;  1BNO A;  3RH5 A;  3Q8Q B;  1ZQS A;  7ICU A;  2VJ5 A;  3NAS A;  9ICS A;  1X40 A;  5CJ7 A;  1FO4 A;  4YN4 A;  2YMP A;  1WWV A;  4QZH A;  3H8S A;  1M6Y A;  1WCL A;  1NZP A;  2W3S A;  3DDH A;  2NRV A;  2HHV A;  2NO5 A;  4ACO A;  1U4B A;  5GTI U;  4QNL A;  2BDP A;  3F2C A;  4UAU A;  4NJ8 A;  4XUS A;  3C1Z A;  2IOF A;  4R64 A;  5K4L A;  4M9L A;  4RPX A;  1SIJ A;  4C4R A;  5ALJ A;  7ICO A;  5JTI A;  2PI4 A;  2OHF A;  4OJO A;  5CEH A;  4UBC A;  4ELT A;  4BX9 C;  5KFO A;  4PGX A;  5D4B A;  4NLN A;  4LZD A;  3OPX A;  1B0X A;  3EYZ A;  1XSL A;  3ZD9 A;  5KG5 A;  3N97 B;  2UVW A;  5EWE A;  3F2D A;  2ZJ8 A;  2DL0 A;  2KSO A;  1BPE A;  4O5E A;  2W04 A;  3SAH A;  3Q8P B;  2H3Q A;  4J9N A;  4TUR A;  2EAM A;  4RQN A;  3R9K A;  4I27 A;  2KFZ A;  5BOM A;  2FPK A;  8ICZ A;  4M9N A;  3F53 A;  3OJU A;  3WK9 A;  3AQF A;  3EWA A;  2ALZ A;  3UMB A;  4MHV A;  3T3F A;  3UMG A;  4IRC A;  1TE2 A;  1C20 A;  4RT2 A;  1UA0 A;  1SXE A;  4B9S A;  2VA2 A;  4DQR A;  4B9U A;  2B0C A;  1NJY A;  3PW0 A;  3IV6 A;  5J0X A;  1ECW A;  4R8U B;  2KK0 A;  8ICS A;  2FMP A;  1QLN A;  3V7K A;  2R18 A;  1ZQN A;  2ZTE A;  3PVX A;  4DFK A;  2ZIW B;  5KFY A;  1WG8 A;  4F92 B;  2ZIU B;  1ZQG A;  3SQI A;  2IBK A;  5AM1 A;  1S10 A;  4IQT A;  4C8L A;  3CYM A;  2RP5 A;  2A1J B;  2BCR A;  1U48 A;  1MQ2 A;  1LV5 A;  1Z4O A;  3IHQ B;  4JMU A;  3THV A;  9ICA A;  1SV4 A;  4EZ9 A;  4RQ0 A;  2G07 A;  1ZQD A;  5T14 A;  3EW9 A;  5ALH A;  3MGH A;  3ZI4 A;  1L3V A;  5DGB A;  1ZQV A;  3Q8K A;  3O0F A;  3RJG A;  4C8O A;  1YT3 A;  3BQ0 A;  5DG9 A;  1ZJM A;  9ICV A;  4KLM A;  4XRH A;  1NKB A;  5IIJ A;  3PW5 A;  3PSF A;  2F3N A;  2R8H A;  1SWV A;  5ALV A;  2EAP A;  4Z6F A;  1ZQU A;  2VAN A;  4M2Y A;  2AHO B;  4ECQ A;  2ZIX B;  3MR5 A;  2ZG6 A;  4O3M A;  5L1J A;  4RQM A;  5DLG A;  4PGQ A;  3NVV A;  4DLE A;  3RFA A;  3PZP A;  1CUK A;  9ICR A;  7ICL A;  1RPL A;  2C2E A;  3WK5 A;  4ECX A;  8ICN A;  9ICI A;  1F0M A;  2KV2 A;  1ZQK A;  1NK5 A;  2ZUC A;  4F5P A;  1XO1 A;  5AM5 A;  9ICW A;  1WYG A;  3GQC A;  4Y2X A;  4B9V A;  3LWL A;  9ICN A;  2KVS A;  2JEI A;  4PHD A;  8ICG A;  3GZF A;  5J0W A;  3JPT A;  2HMX A;  4KX3 A;  2KKV A;  1L6N A;  3OGU A;  4UAT A;  3UXP A;  1ZET A;  4I2A A;  7ICK A;  3BS7 A;  3UQ0 A;  4QZD A;  2EZY A;  2KIV A;  2EAO A;  3MAB A;  5DB8 A;  2UVU A;  4DQI A;  2AGO A;  4BUG A;  2YN4 A;  4RU9 A;  2YB1 A;  5ALT A;  2A3V A;  2YML A;  2PI5 A;  1V97 A;  3HKZ F;  3T79 A;  2JZB B;  5IIL A;  8ICP A;  1IV8 A;  4GC6 A;  4O3Q A;  4Q44 A;  2HHQ A;  4GC7 A;  4O3S A;  3SYZ A;  2BPG A;  1N2X A;  3D2N A;  4RPY A;  3LVW A;  5IIK A;  2DBY A;  4I2B A;  1N5X A;  4BWJ A;  3RJE A;  4BGD A;  5ALP A;  2E1F A;  3BS5 A;  1TK8 A;  1D9F A;  3IDW A;  2QLT A;  4FBU A;  1S9F A;  1N63 A;  4IR1 A;  4BDP A;  1OW5 A;  2C2R A;  3RBE A;  3ETR A;  2ZTD A;  5CB1 A;  1U45 A;  2G0A A;  5DDM A;  5ALZ A;  1FFV A;  5ALX A;  2RDJ A;  4KMU A;  2XVT A;  4KIT B;  4YR3 A;  4CCH A;  3AEV A;  1ZQW A;  3V6H A;  5KFP A;  4KLG A;  5HR7 A;  4UAW A;  3HKZ C;  5KG6 A;  1ZQZ A;  2GLE A;  4ED2 A;  2D3D A;  4MFF A;  4G3I A;  5G5G A;  3OHB A;  3TFS A;  4O9M A;  2CPR A;  4J9P A;  2XGQ A;  1RM6 C;  2WF5 A;  4BJQ A;  4DSL A;  4I28 A;  5HML A;  1ZYQ A;  2P66 A;  4OD0 A;  3PW4 A;  4FS2 A;  3RH4 A;  4Y2Q A;  2KFN A;  3HW8 A;  1L7P A;  1PVQ A;  8ICY A;  4Y2V A;  2K89 A;  1X9M A;  1O03 A;  1NNL A;  4QWB A;  3OJS A;  2I9G A;  2YMM A;  4DL7 A;  1L7N A;  7ICE A;  5J2K A;  4DOC A;  1ZOL A;  4F91 B;  5KFJ A;  2PFO A;  3M9O B;  4NLB A;  7ICF A;  3PNC A;  4C8K A;  2BQ3 A;  3LK9 A;  5KFZ A;  4IS7 A;  4EZ6 A;  2G09 A;  2R8J A;  4J9O A;  4IQV A;  2AQ4 A;  2ATL A;  1NZB A;  4ZH4 A;  3JPR A;  2EZZ A;  5ALQ A;  1TKD A;  1ZRN A;  5AK5 A;  4ECS A;  4OCZ A;  2A1A A;  2ASD A;  4RQ4 A;  2V4R A;  4P2H A;  1NK7 A;  3WK6 A;  1RDF A;  2XO7 A;  3LWM A;  5H2F U;  7ICV A;  1S97 A;  1O08 A;  2ZUD A;  3MR3 A;  4DOA A;  3QZ8 A;  3I28 A;  3RB6 A;  1DK3 A;  4QZG A;  1SL2 A;  5KFQ A;  2OEH A;  3H8J A;  5DG8 A;  4C0Z A;  4J9L A;  1SL1 A;  4ECY A;  2H3V A;  3G6V A;  1ZQR A;  3TAR A;  1XSP A;  1S0V A;  3H0R B;  1A77 A;  4M6W B;  1COO A;  3I76 A;  4Y2U A;  2OXO A;  4ED7 A;  2OM6 A;  3HX0 A;  4RQ2 A;  3RH6 A;  3UMC A;  4HAI A;  4DL4 A;  1LKY B;  4OJP A;  1UT8 A;  2JXJ A;  2LBO A;  4KLF A;  3AM9 A;  2QB1 A;  4I2D A;  4O3O A;  3RF9 A;  4I2F A;  2G08 A;  3PW2 A;  2KZM A;  1DRG A;  4O5K A;  2JHD A;  3ISD A;  4PHA A;  2UVR A;  1TAQ A;  5AK3 A;  5J2J A;  4KLQ A;  9ICQ A;  4Q45 A;  2AXT U;  4Y2J A;  1KRP A;  3ISC A;  2KTQ A;  4F4X A;  1RXW A;  2AJQ A;  5ALF A;  8ICT A;  4ZOH C;  2BHN A;  1L5U A;  2CRX A;  5ALR A;  4EEY A;  2HCF A;  4F4Z A;  4RQ1 A;  3AU6 A;  3H0L B;  5J0R A;  2LKY A;  1YZ6 A;  3V72 A;  4PL2 A;  4CF5 A;  4QWA A;  2HVI A;  3RJK A;  1N5W A;  3KHG A;  2NRX A;  5KTQ A;  4Y2S A;  3RAQ A;  1SKW A;  1HEK A;  5GTH U;  2R8G A;  1IM4 A;  5AKJ A;  3RR8 A;  2W9C A;  4FO6 A;  7ICJ A;  1ZD3 A;  3BQT A;  4QZE A;  1KKX A;  4KX5 A;  2F44 A;  1L3U A;  4I2I A;  1DOQ A;  2W9C B;  2ZXH A;  5KNI A;  3PX6 A;  4RQ8 A;  5DGA A;  4KTQ A;  4NLG A;  2G06 A;  4RUA A;  5ALS A;  2KHQ A;  2W54 A;  5ALU A;  2BQU A;  4C4S A;  4YMM A;  2RDI A;  2K8B B;  5ALE A;  4FZN A;  8ICJ A;  3JPQ A;  4KN7 A;  3VC8 A;  1QSS A;  2DWQ A;  5EE1 A;  3PO5 A;  1QSL A;  1IXR A;  1XS9 D;  3NRW A;  4C80 A;  5CR0 A;  4F5O A;  2HBJ A;  1Q46 A;  1VJ5 A;  4I2E A;  4F93 B;  1ZQ1 C;  2F76 X;  4GFJ A;  5J0O A;  3PO4 A;  1BPY A;  9ICP A;  1QQ5 A;  1KLN A;  2ZIW A;  4YXM A;  1P7D A;  2YX8 A; 
#chains in the Genus database with same CATH homology
 3M6Z A;  4ICA A;  1DRG A;  2VJ5 A;  2Z7J A;  2H3Z A;  2WAQ C;  2MA1 A;  2PMZ C;  2XID A;  3GZF A;  4U6P A;  2R18 A;  3CRX A;  2JHD A;  4BJQ A;  2KIC A;  2HMX A;  2JH1 A;  3IG5 A;  4KX3 A;  1TAM A;  3C29 A;  3CP8 A;  2KKV A;  1L6N A;  2ZIW B;  2ZIU B;  3SQI A;  4OO1 J;  3D2S A;  4P0Q B;  1PVQ A;  2K89 A;  2KHV A;  2W7P A;  3CYM A;  2KEY A;  2RP5 A;  2H3I A;  3VCB A;  2OYY A;  2NV3 A;  2ZIU A;  1F44 A;  3AQE A;  2CRX A;  5A0L A;  2JMG A;  2LHT A;  2HOQ A;  2PMZ F;  2CN1 A;  2XIC A;  3M7D A;  4JMU A;  4ACO A;  2ZIV B;  3PSI A;  3M6K A;  4FZM A;  1Q3V A;  2E1E A;  3H0L B;  4BUG A;  5KL1 B;  4QNL A;  2G07 A;  2LKY A;  3L3F X;  2K4E A;  3D2Q A;  3MGV A;  2HBM A;  3F2C A;  1D8B A;  1OUQ A;  2YB1 A;  4PL2 A;  4NLB A;  5T14 A;  2KJ9 A;  3N7P D;  5CRX A;  2RRD A;  3SAG A;  2A3V A;  3N7R C;  2DQN B;  2G09 A;  2HBL A;  4A8E A;  2WB1 C;  1A6S A;  2BDU A;  2KKP A;  3HKZ F;  4QIW C;  3O0F A;  3T79 A;  2JGA A;  1Z19 A;  1NZB A;  3NUQ A;  5HR6 A;  1YT3 A;  4OJO A;  2K4H A;  1KBU A;  4BX9 C;  1HEK A;  2Q4T A;  3SMV A;  3OPX A;  5C0Y A;  1WUD A;  2JH7 A;  2Y0S C;  1Q3U A;  2KIW A;  2LYB A;  5KL8 B;  3SAF A;  1GO3 F;  3D2N A;  3LVW A;  1HIW A;  3PSF A;  1UPH A;  2ZIX A;  1URJ A;  2ZXI A;  4KX5 A;  2YB4 A;  4FE3 A;  2W7O A;  3F2D A;  1IIP A;  2ZIV A;  1MA7 A;  4FZL A;  4P0Q A;  3IN5 A;  4NLC A;  2DF4 B;  2HBK A;  2KVC A;  2E1F A;  2KJ8 A;  3F5E A;  1ED1 A;  2W04 A;  2VJ4 A;  2WAQ F;  3SAH A;  3F2B A;  3F5A A;  2H3Q A;  2M0N A;  4U7C A;  2ZXH A;  2MRL A;  4CGZ A;  2F8L A;  3ICX A;  2ZIX B;  2G06 A;  2ZG6 A;  1PVR A;  1SZH A;  2KHQ A;  3DEE A;  1Z1B A;  2K8C B;  1XNS A;  2N1R A;  2W03 A;  4IC9 A;  2LYA A;  2F77 X;  3LVV A;  2G0A A;  2H3F A;  3E0F A;  4PL1 A;  2VIX A;  4NV0 A;  4O3M A;  3KFU F;  3N7S C;  3PST A;  4C0Z A;  2D6F C;  1PVP A;  2K8B B;  2H3V A;  3ALR A;  3F53 A;  3H0M B;  4CDG A;  4FZN A;  1T94 A;  3ONN A;  2XVT A;  3AQF A;  2WB1 F;  3GU3 A;  4OJ5 A;  4AYB F;  2HOF A;  2K4I A;  2Y0S F;  3KZX A;  4P0P A;  4KMO B;  3VC8 A;  3RFA A;  3PZP A;  3H0R B;  1CRX A;  2KOB A;  2KJ5 A;  2F2A B;  2VKQ A;  2E5S A;  2OXO A;  3IP4 B;  3C28 A;  2OH2 A;  3NRW A;  2GOL A;  2G5H B;  2OM6 A;  2K8A A;  4OJ6 A;  2HBJ A;  3IG8 A;  3LYS A;  4QJF B;  5HR7 A;  2XI9 A;  4AYB C;  1XO0 A;  2KD1 A;  3HKZ C;  4QIW F;  3PSP A;  4NWI A;  4WJ3 B;  2KV2 A;  2GH1 A;  2G5I B;  2KNJ A;  4P0P B;  1ZQ1 C;  4OJP A;  2F76 X;  4OJL A;  4GFJ A;  2LBO A;  3K1Z A;  2HOI A;  2DGZ A;  1A0P A;  2ZIW A;  1ECW A;  2RHF A;  1P7D A;  4CRX A;  3RF9 A;  3AL0 B;  2CPR A;  2YX8 A;  2G08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...