2HMXA

Human immunodeficiency virus type 1 matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
133
Chain Sequence
b'HMGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 MATRIX PROTEIN
publication title Three-dimensional structure of the human immunodeficiency virus type 1 matrix protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Matrix protein
total genus 33
structure length 133
sequence length 133
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2hmxA00
2HMXA 2H3ZA 1TAMA 1UPHA 2N1RA 1HEKA 2H3VA 1L6NA 2K4EA 4ICAA 2LYBA 1HIWA 2LYAA 4IC9A 1ECWA 4JMUA 1A6SA 1ED1A 2K4HA 2H3QA 2NV3A 2GOLA 2K4IA 2JMGA 2H3IA 2H3FA
chains in the Genus database with same CATH superfamily
3EPIA 5KG2A 1C7YA 3LK9A 4NM1A 8ICLA 2PXIA 2VANA 4EBEA 5HMMA 1LB2B 5KFLA 3QZ8A 8ICPA 4JMUA 3JPPA 4QZHA 4K4GA 2W9CA 3PO5A 2W9CB 4GXJA 4DQRA 2WB1C 2HOIA 2KTQA 1YT3A 4PHDA 2CN1A 1RQNA 5AM3A 1B4FA 4PGYA 4RNOA 1D8BA 4RZRA 3JPTA 4KX5A 3RF9A 2E8NA 1WYGA 2JMGA 4YXJA 4B9VA 4NLNA 4UB1A 4C8MA 4Q44A 5KT4A 3SQIA 2OWOA 3HJEA 3GILA 1U48A 3LYSA 1PVRA 2HHVA 3EW9A 4YN4A 4Y2QA 4M6WA 1HIWA 4M6WB 4I2BA 2OYYA 2WF6A 1UCVA 2O6KA 1WUDA 4XA5A 3OGUA 1BPEA 1ZD3A 4Z6EA 4C8LA 4DFPA 2W9MA 4E0DA 3QU5A 3IG8A 1NZBA 2KG5A 4O3RA 3TKAA 3TQ1A 4YMOA 2DFLA 3BJYA 1L6NA 2K8CB 4NLGA 9ICEA 2IMWP 5IIMA 4QZAA 4CF3A 2LBOA 5KFUA 2DBYA 2H3QA 2JH1A 5EE0A 4MFFA 1D8YA 4LZGA 3KHLA 4F4YA 3UXPA 1N5WA 4NLZA 2W3RA 5KFCA 9ICSA 1ZRNA 5KFGA 4KITB 9ICJA 3ZDAA 4K4IA 1L7MA 4DFKA 1MSWD 5J0TA 2C22A 4OJ5A 4F5NA 5KFMA 1KDHA 4LZDA 3UMBA 2BDPA 9ICTA 3RAQA 2EQYA 9ICVA 4I2IA 3AL0B 2F77X 4ED1A 3RAXA 3QU2A 1ZQ1C 5AI5A 3KHHA 1NKBA 2D6FC 2YMMA 2G5IB 2PI4A 2KZZA 2P66A 3KHGA 1DK2A 4Q8FA 4JUZA 3HW8A 4M47A 1ZQOA 1WWVA 3NASA 4GXKA 2W9AA 3FAHA 4O3QA 1PVQA 9ICPA 1KEJA 8ICXA 7ICSA 2KP7A 3C29A 1RXWA 2P6UA 1CRXA 4U6PA 3C2KA 2AGOA 2R8GA 2F1HA 1Q3VA 1NJXA 5F9NA 1V85A 1ZQHA 3PR5B 2ESEA 3T5LA 5J0UA 1EXNA 1QQ7A 2FLPA 1SV4A 2R18A 5AI0A 3M9NB 3F2CA 5J2AA 1Q46A 2OH2A 1DGJA 2W54A 4ED8A 3HRDD 2RHFA 1N5XA 1ZQLA 4YQWA 2M0NA 5BOLA 4JK1A 1WCNA 4DL4A 3NRWA 1ZQPA 3LDAA 2GOLA 4QZFA 3V6HA 2F1IA 4QIWF 1ZXIA 1JRPA 3FYHA 4O3SA 3AQEA 5EE3A 2JXJA 5J0PA 8ICCA 1ZQYA 2EANA 1RYSA 3ZI4A 1J2NA 4XRHA 1P7DA 3RFAA 4ACOA 3GIKA 4I28A 1ZQSA 1NI3A 3SEIA 1KQQA 2BQUA 1SL1A 3AEVA 4O3OA 3B9JA 4UASA 4FBTA 1UQVA 1WG8A 3JPRA 4J9OA 1S0MA 4PPXA 1RQLA 1L5UA 8ICOA 4AP9A 4NLKA 2OEHA 1UA1A 3LWLA 1KFSA 5AK3A 3KFUF 3V7KA 2MAXA 7ICVA 1RYUA 4R63A 4Y2PA 3B0XA 3K1RB 4EYHB 3SAFA 3GV5B 5J2BA 3PW4A 1WCLA 3A0BU 4DSKA 4ECXA 4PH5A 3E0FA 4C4RA 2BCQA 5ALEA 1S8OA 3C23A 1NKEA 1T4GA 2DUYA 1FO4A 1X9XA 3S6JA 3OSNA 2VIXA 5F9LA 4UB2A 3Q8PB 2B0CA 5KFKA 1DOQA 2AHOB 1CEZA 3SV3A 1Z3EB 3T79A 4QZDA 4US9A 3D2SA 9ICUA 5CRXA 3WK7A 3RJJA 4IR1A 1HEKA 2ZXIA 5AI4A 4NLBA 5JU5A 3NVVA 1K1SA 1SWWA 3H8SA 1SKSA 4FBUA 3H0RB 4CCHA 4Z6DA 2AQ0A 1UT5A 4EZ6A 4RPZA 1L7PA 4ED3A 4RPXA 3KZXA 5ALWA 1OXJA 1ZQAA 1VJ5A 3PW7A 1CI4A 2KKPA 4O5KA 3CP8A 5KFOA 1VLBA 2HHUA 4Y2RA 3AU2A 1B43A 2G5HB 5ALXA 1Q8KA 4DEZA 2A19A 2ATLA 3PY8A 4FZNA 2G07A 2XICA 3AN1A 2WTFA 3BQ0A 5AKZA 3K75D 3JPQA 2BPFA 2WF8A 3SD7A 5TISU 3HKZF 4QW9A 4TUQA 1A77A 5AIBA 1BPYA 2KVCA 8ICUA 5KFIA 3HWTA 1V38A 4PHAA 4Y2SA 1QCKA 4C4TA 5KFTA 5DLGA 2DGZA 1RXVA 5EWEA 2W8KA 3PMLA 3GZFA 3RB3A 5IIKA 2F76X 4TUSA 2MU2A 1XO1A 3ETRA 5AICA 4UBBA 1SV0A 3M1YA 5DG8A 3Q8SB 4P2HA 4PL2A 3ISDA 3RH6A 5EOZA 1Y88A 2HSZA 5HMLA 3NS1A 4RU9A 2K4PA 9ICNA 4EX7A 3KKAC 1RPLA 3DEEA 3ED5A 5IIOA 4RUAA 2WAQC 4PZNA 3MGVA 2HVHA 4Y2XA 4UB5A 3AU6A 2F1JA 4FFDA 2WB1F 3UQ0A 1ZQCA 4O3PA 5KFJA 4B9LA 9ICLA 4PL1A 4BUGA 2JHDA 4MHVA 3WK6A 5HR7A 2W3SA 3ONNA 8ICZA 1Z4OA 5J0XA 5ALPA 1UA0A 1ZD4A 4Y2TA 1BPDA 3QX7A 3H40A 4JWNA 1ZRMA 4OJ6A 3JPOA 5AM1A 5D4BA 2FE9A 2Y9UA 4IRKA 1FIQA 1CUKA 5J2GA 4OJOA 3PSPA 4IQVA 3CW2C 2R8HA 5AKJA 2B6GA 2FI1A 3J81j 1U9LA 9ICAA 4ZOHC 3RJKA 1S5LU 4GC6A 2BGWA 2EDUA 3PR4A 3H0LB 4Y2UA 1A0PA 5AM5A 2Y9TA 5KL8B 3OHBA 2KZMA 3M9MB 1J97A 2E1FA 2YY6A 1JX4A 2V4RA 4IQWA 5ALKA 1NK8A 3U26A 4EBCA 2RDIA 1SKRA 4NWIA 4B9UA 4NL9A 1NNLA 5J8YA 4PJ0U 3K1ZA 2PFPA 4G3IA 7ICHA 5KFYA 3MFIA 4J9LA 2IHNA 2ZIUA 9ICBA 2W55A 2ZIUB 2ISOA 3BDPA 1X9MA 3B0YA 3VCBA 1NJWA 2Y1IA 4Q8EA 2KSOA 2KSOB 1L3SA 1ZYQA 4DQPA 5KG3A 1N48A 1LKYA 3SAHA 1LKYB 2UVRA 2K8BB 1JN3A 8ICSA 1HJPA 4QWEA 1QLNA 4UAWA 4YD2A 1JROA 1TE2A 3GFKB 5KTQA 3PZPA 4F3OA 3H8MA 4EZ9A 1N62A 3UXOA 5H2FU 3TADC 5DGBA 5DQHA 1F44A 4ECWA 4DQIA 4TQSA 8ICAA 3M7DA 1NJZA 1TK5A 1ZQFA 3GU3A 2F3NA 5ALRA 5DB8A 2LYBA 2LYAA 2XVTA 7ICFA 5KFEA 5KFZA 2L5YA 3T3FA 3TFSA 4B9SA 1ZJNA 4YD1A 8ICRA 4I2FA 8ICQA 3BQ2A 2YTUA 3H4DA 2PKEA 1L8LA 1GO3F 5EE1A 4P0PA 4P0PB 3MR2A 5CJ7A 1DK3A 2E5SA 5DKWA 3C2MA 1BNOA 3PSFA 1K5OA 4ECTA 3IP4B 4PHPA 4F5QA 2NV3A 7ICNA 2NRVA 4CRXA 3NVZA 2XCPA 2I6XA 4NM2A 4DQQA 4C0ZA 1KW4A 3KKAA 5B5EU 1JXLA 2KEYA 1FFVA 4CF5A 5KFHA 5DBAA 1NOMA 4PGQA 2K89A 1XS9D 5AK6A 8ICYA 2LPEA 1ZQVA 2HCFA 1SL0A 1NKCA 3WU2U 3MR6A 5IIJA 3FDSA 2ZUBA 3H4BA 1N2XA 3WKCA 3OHAA 4NV0A 5AM0A 1DXSA 3PW2A 1T3NA 1ZQWA 2F8KA 3UMCA 4QWBA 8ICKA 4J9MA 7ICKA 3BQTA 3K4GA 4OJPA 4US8A 4B9TA 1A6SA 1ZQUA 4P4OA 2R8IA 5ALGA 2FPKA 4KLOA 1ZQJA 4BWJA 3PO4A 4GFJA 3V72A 5ALZA 5ALQA 4YCXA 2XY6A 1N61A 4IR9A 3RBDA 4RNMA 4ECVA 2Y0SC 3ICXA 2AXTU 3D6JA 5AKEA 5DG7A 2KHQA 5ALUA 4F72A 5D46A 4RT3A 9ICKA 1QTMA 4F5OA 2JZBA 4YMMA 2BPGA 1XSLA 2C2EA 4PGXA 1S97A 3NTUA 3AM9A 4IS7A 5TZVA 2F44A 2G0AA 2HOFA 4F8RA 4RQ7A 4DOCA 2YB1A 5CR0A 4EENA 3ZD9A 1NZPA 4XUSA 3L3FX 5ALDA 5CEHA 2KVSA 3KOOA 1T3QA 2EZZA 4JV1A 5ALHA 3ALRA 3I76A 4R65A 3OJUA 2EH9A 4P0QA 3VC8A 2I9GA 2FMSA 4P0QB 1ECWA 3OPXA 2HHXA 5J2EA 5KNIA 2ZIWA 5KT7A 3BQ7A 2ZIWB 4R66A 5BPCA 2M9NA 5ALLA 4GXIA 2NO5A 5KT5A 9ICMA 4FZMA 2FDRA 5CB1A 1S0NA 4MFCA 4UB4A 3QEAZ 4C8OA 3KBBA 1NK7A 2LKYA 3G6XA 1ZQIA 3OSPA 3PSTA 2WF7A 5DBCA 1KRPA 3GIMA 2DPJA 4LVSA 3V6JA 3WKDA 2K4IA 2XO7A 3ISCA 4F5RA 4RQ4A 1IM4A 2FMPA 4J9PA 3NRZA 2YN4A 9ICGA 1L3TA 5EWFA 5KG1A 2KE7A 4O3NA 2FPLA 5B66U 2K8AA 2C2RA 1S0OA 3NUQA 4CNQA 3WK5A 3BQ1A 3WK8A 3RR7A 3IG5A 3MR3A 1S9FA 3RJHA 2KZ3A 4UAYA 4M0AA 1VDVA 1RYRA 2ZUCA 2BHNA 4Y2VA 3HILA 4RQMA 4TURA 1AROP 3QUTA 4HYKA 2DKXA 2W43A 4GLXA 1N60A 7ICQA 2GO7A 2HBJA 4YP3A 4IL6U 4RQ5A 2WAQF 4BGDA 2ZIXA 4F92B 1NK9A 2ZIXB 2JH7A 5AKHA 3KTQA 5J0WA 1NK6A 2J6TA 8ICEA 5IINA 5AI6A 1COOA 4C80A 2LM4A 2AGPA 5KAFU 4QWDA 3SZ2A 1DGSA 8ICTA 3TARA 5JUMA 4NY8A 2BPCA 2UVUA 4WJ3B 1ZQZA 4Z6CA 1JMSA 5HR6A 3SYZA 2DWQA 3RJIA 2VA8A 3C5GA 2HI0A 2ES6A 4P4PA 2E8MA 3LVVA 1BPBA 2NO4A 5KG0A 4EEYA 3PSIA 2EZXA 2UVWA 1SZHA 2BCVA 5C5JA 2D8CA 5AM4A 4NJ8A 3M9OB 1XO0A 4KLTA 2PI5A 5IIIA 7ICIA 4KLIA 2WHEA 3QU9A 1LV5A 3GIIA 2ZTCA 1NK4A 2OXOA 1U47A 8ICWA 2HBMA 3QUQA 4BXOA 4OCZA 2E3TA 4F5PA 3TAPA 3PW5A 2BZFA 3WK9A 2HMXA 3A0HU 3WKEA 2OHFA 2IHMA 2NRXA 1BVSA 2DF4B 4BX9C 3RTVA 4F71A 2K4EA 2HVIA 1TKDA 3NVWA 2ZXHA 1N56A 4Z6FA 2W11A 3TANA 1YZ7A 4DQSA 1PUZA 4RQ0A 2K4HA 1Z1BA 3H0MB 5GTHU 1TV9A 4RQNA 4ED6A 1TAQA 4J03A 4KLUA 2RDJA 5K4LA 3ZDEA 4YMNA 2EAMA 2XY5A 2QB0A 2QB0B 4KLDA 5HHIA 4I2EA 3AMZA 5ALYA 1ZQGA 5KFSA 3GQCA 3L4PA 3RRHA 5EWGA 4Q43A 4DLGA 1PK1A 1SB3C 3NVYA 1B0XA 1TK0A 4I2DA 2JV3A 4DFDA 4DL3A 5BOMA 4ELUA 4DOAA 4JV0A 3Q8LA 3V7LA 2ISPA 5HHHA 1QSLA 2C2DA 1OW5A 2HHSA 2Z7JA 1QSSA 3UQ2A 8ICNA 1M6YA 2JEIA 1J2MA 4ECZA 1OUQA 4DFMA 8ICFA 1ZQKA 3R9KA 7ICOA 3PMNA 3Q8QB 4QZIA 5A0LA 2HW3A 4AYBC 2ZIVA 3ZD8A 9ICOA 1X6JA 3MDAA 5DGAA 4DL6A 2ZJAA 5J29A 5AKLA 4RQ1A 2LHTA 2VJ5A 4PZOA 4EX6A 1ZQQA 2KJ9A 2V4QA 4FS2A 1XNSA 2PMZF 3THVA 4XQ8A 1SKWA 2EZYA 4PHEA 1MA7A 4B6JA 2VA3A 3AQFA 3TAQA 4KLHA 4GIBA 4YR0A 2E8OA 4KMOB 2RQ5A 2AGQA 5KFAA 4RT2A 3T5KA 2KD1A 1X40A 4BJQA 5DLFA 5AKKA 3QUCA 5AKIA 5IILA 2LM1A 2MA1A 1ZQBA 1KN5A 2UVVA 3RB4A 3EUB2 4KLEA 2BDUA 2NRZA 5KFVA 2RP5A 4U7CA 9ICIA 4KLLA 3AUOA 2GWSA 5J2HA 2FLLA 3SENA 2ASDA 3TFRA 2IA6A 2EAOA 3N7RC 3F5AA 3IRUA 5AI9A 4I2AA 4OO1J 8ICBA 2DPIA 2H3ZA 2D3DA 5KFFA 5KT2A 3PNCA 2QLTA 3SV4A 2YMQA 4DOBA 1COKA 5DQGA 2YX8A 5AK5A 2KIVA 3PW0A 4ELVA 1D8LA 1T94A 1HUZA 1ZOLA 4JWMA 3RH5A 2Y0SF 1O08A 4RQ3A 2G06A 2CXYA 1JIHA 2W7OA 2MRLA 4KX3A 2DKZA 5J2DA 3IM1A 3C21A 1S76D 2KJ8A 2ASLA 2KHVA 5J2JA 2XGPA 4TUPA 1O03A 4IRCA 2ASJA 4C7YA 1NK5A 5L1MA 4DF4A 5ALVA 3ZDBA 2ZTEA 3IDWA 4F93B 4KLFA 2HHWA 1TK8A 3EYZA 4J9SA 1XSNA 4CDGA 5GTIU 3MGHA 4O0IA 5CWRA 2YQEA 2WF5A 4UAVA 5KG6A 8ICMA 2W9BA 3M8SA 1S77D 4QZBA 2KN7A 4F50A 2P6RA 5KFNA 8ICHA 3M8RA 4UQGA 3QE9Y 1NK0A 4M2YA 4F4XA 2W04A 7ICPA 1QH9A 1L3VA 5L9XA 3C2LA 2FMQA 5CA7A 2BCSA 2XCAA 2JGAA 3V7JA 5J2FA 4DSFA 5T14A 1U49A 3UMGA 7ICGA 8ICVA 1F0MA 2YMLA 4K4HA 4DFJA 1N63A 1Z4NA 2ZJ8A 2PMZC 5G5HA 2GLEA 4Q45A 3C28A 3RBEA 3M6KA 9ICCA 4YR3A 1KFDA 1KSPA 1MN8A 4O5EA 3RB0A 9ICXA 3RR8A 4UATA 2LYHA 4R8UA 5DDYA 5CHGA 4R8UB 2DQNB 3HX0A 4QW8A 4KLJA 3WK4A 1SGGA 4YG2A 9ICWA 5J0OA 3C1YA 4I2JA 2IOHA 4CF4A 5ALMA 4DWIA 3BS7A 4F4ZA 1ZD5A 3V6KA 4UB8U 5AKGA 3EZ5A 2W8LA 3PVXA 1TFRA 3QUBA 1KFTA 4MEYA 1ZETA 4DL2A 5KG4A 9ICFA 4B9MA 2FLNA 4CE6A 5CP2A 4TQRA 2DL0A 3O0FA 1TVAA 3C5FA 5C0YA 7ICRA 2ODGA 4IRDA 2ZJ5A 4QZCA 2NRTA 2C28A 2MUTA 2MUTB 3SMVA 1BGXT 4KN4A 2CRXA 2NRWA 4UW9A 4QZ8A 5E79U 3KD3A 2HBKA 3WKAA 3QXGA 4M9HA 2WFAA 4M04A 2ZTDA 4KLMA 9ICRA 2VJ4A 4USAA 2JZBB 5JTIA 2VKQA 1L7OA 2HBLA 4J9QA 3TI0A 5DG9A 5KFQA 4RUCA 1LVHA 1B22A 3MBYA 4UARA 4DSJA 1U45A 4ECSA 5J2CA 3JPSA 1ZQTA 1T8EA 4RNNA 2HHQA 1QQ6A 4ED7A 2XC9A 5ALJA 1V9PA 1ZQEA 2KJ5A 3E58A 3M6ZA 3QEBZ 5J0SA 4QZ9A 4UB6U 5DQIA 4QZGA 4EYIB 4RPYA 4M9NA 2N1RA 2BQRA 3F2DA 4MEXA 1UT8A 3UXNA 4ECUA 1Z19A 3IHQB 3HT3A 1KBUA 4RQ2A 2AU0A 3C1ZA 1U4BA 3QU7A 3E2EA 3ORYA 1QQ5A 3GV8B 3H8WA 1RG6A 2QB1A 4UBCA 2KV2A 4QNLA 4M9LA 5DBBA 3T5JA 1PZNA 3D2NA 3OTQA 4ICAA 4NXZA 2JR5A 5HNKA 5J0YA 5AK4A 3LVWA 1TAUA 1X6IA 4F2RA 2W7PA 5J2IA 1SV0C 2KMDA 4DL5A 1S0VA 1ED1A 1BPZA 4FZLA 2BQ3A 1XC9A 4P4MA 2QKQA 1PVPA 5FP0A 3TADA 2AH5A 1L8OA 4C7ZA 4F91B 1WWUA 2F8LA 4AYBF 3PX6A 3Q8RB 5DB7A 2KFZA 1XWLA 4DO9A 5KAIU 3FM9A 1JXEA 4QJFB 3QZ7A 3MFHA 4M9GA 4ED2A 4UAUA 3CRXA 3RJGA 1QSYA 4KTQA 1MQ3A 2E1EA 1C20A 5HP4A 2PFQA 4F4KA 5KG7A 3HP6A 3EWAA 4J9KA 4EELA 1XU4A 3WKBA 1FEZA 1KKXA 3FC4A 4DSLA 4I2HA 1SWVA 5KT3A 7ICMA 1JI7A 2BCRA 1L7NA 2YMPA 2ALZA 2EAPA 3ZDCA 3N97B 2LI6A 2YB4A 4O5CA 4DL7A 5KFPA 1IV8A 1D9DA 4I2CA 2IOFK 2H3VA 3IN5A 1PK3A 5J2KA 3N7SC 1D9FA 1X2IA 3F5EA 1UHUA 1FFUA 4NLCA 1RM6C 4KLSA 1X66A 4DS4A 9ICHA 4FE3A 3GV7B 3CNHA 4GC7A 1XSPA 4QWAA 3N7PD 4YVZA 5JRTA 2Q4TA 4G9BA 3GIJA 2IOFA 3RH4A 4ECRA 2K60A 1A76A 3RB6A 5KT6A 1RDFA 3Q8KA 3F2BA 4KMUA 4MF8A 1F5SA 2XI9A 2A1JA 4KLGA 2I1QA 4BWMA 2JEGA 2JEJA 3RJEA 2A1JB 3MR5A 4DSEA 4FO6A 4BXOB 2OM6A 1BNPA 5KL1B 4I29A 2JEFA 3BS5A 3BS5B 2P35A 4O3MA 4ED0A 2BR0A 3H7IA 2FPMA 4X5VA 4NL9C 4C8NA 2V9WA 5J8YC 3QU4A 4Y2YA 1X9WA 2QARA 4IC9A 5J0QA 4RQ8A 2QARB 1MQ2A 5ALFA 7ICEA 4CGZA 7ICLA 1BPXA 2IBKA 4C8KA 3DV9A 5ALNA 3KHRA 5KG5A 4LJXA 1Z00A 1Z00B 3NGDA 3UM9A 1TAMA 3DDHA 5KFWA 3LWMA 1Z1VA 2RLTA 2KICA 2XY7A 1PK1B 4FS1A 2PFNA 1AQ6A 5L1JA 1SIJA 4F2SA 2FJ6A 1KL9A 4QWCA 3GDXA 3QNMA 3Q8MA 1KTQA 9ICQA 3QYPA 3G6YA 2I5HA 2KFNA 4JB3A 1IG6A 5DB6A 4YR2A 4R64A 4DF8A 3PX0A 2ZIVB 3MABA 2H3FA 4JV2A 1UPHA 2A3VA 2MSNA 4EEKA 5ALOA 1NJYA 1URJA 4QIWC 2XIDA 2RRDA 2KKVA 2J6SA 1JALA 4HAIA 7ICUA 3I1YA 4ZH4A 3N4MB 5DB9A 3I28A 4UB3A 2G08A 4MFAA 5AI8A 1K1QA 4DCCA 7ICJA 2LMRA 2G09A 4YFKA 1L3UA 2KNJA 2ZG6A 1ZQRA 1SXDA 2CPRA 4ECQA 4J9NA 2KOBA 4I2GA 1ZD2P 3F53A 1SL2A 3T5HA 2KK0A 2F2AB 4O9MA 5KFRA 1DRGA 2XGQA 2H3IA 5DDMA 3OJSA 2WF9A 2R8JA 4I27A 5AKXA 3MGIA 3ISBA 3L5KA 3ZDDA 5J0RA 4F4WA 1HUOA 3SR6A 4KN7A 3BZKA 2AQ4A 4DSIA 2W03A 2OCEA 5KFDA 5ALIA 3KZIU 3EPGA 3RJFA 3ETLA 2NYVA 2R8KA 5F3XB 2HHTA 4A8EA 5KFXA 4EBDA 8ICGA 1ZQDA 5KFBA 1KLNA 3RRGA 5AM2A 4QZEA 3BZCA 4M9JA 1ZQMA 3G6VA 1T7PA 3MC1A 4DS5A 1IIPA 1YZ6A 2H5XA 3H8JA 7ICTA 4Y2JA 1Q3UA 1SXEA 4IQUA 3N28A 4UAZA 2BKEA 1X42A 1RZTA 3UPQA 5D49A 3IV6A 1ZJMA 4ELTA 4OJLA 5AKYA 3CYMA 4YXMA 2KIWA 4C4SA 2Y1JA 2JRZA 8ICIA 4RQ6A 1IXRA 2BCUA 2PFOA 1ZQNA 4MF2A 3JPNA 5ALTA 5L1KA 3D2QA 2J6UA 2ZUDA 3HKZC 5L1IA 1X9SA 1H38A 1ZQXA 4ECYA 3SAGA 1V97A 5EE9A 3TACB 3MDCA 2W9BB 5ALSA 2VA2A 5AHXA 5G5GA 4B9NA 2AJQA 4J9RA 2HDOA 2B21A 1SZPA 3PV8A 2GH1A 1S10A 4DLEA 2A1AA 2HOQA 4IQTA 4KLQA 4BDPA 2E8PA 3PX4A 3SI8A 8ICJA 5AIAA 5L1LA 1MC8A 2Q0ZX 3HPOA 1JUDA 4OD0A
chains in the Genus database with same CATH topology
2G06A 3KZXA 2YB4A 1SZHA 4BUGA 3AQEA 2JHDA 2W7OA 2MRLA 2N1RA 4KX3A 4A8EA 3F2DA 5HR7A 4PL1A 2H3VA 2LHTA 3IN5A 2KKPA 2VJ5A 1XO0A 3CP8A 3ONNA 2K8AA 4OJ5A 2KJ9A 3SAHA 3N7SC 2KJ8A 1Z19A 4OJPA 1P7DA 1XNSA 3RFAA 4ACOA 2G5HB 2KHVA 2PMZF 3F5EA 1KBUA 2K8BB 4FZNA 4JMUA 1A6SA 2G07A 4NLCA 3NUQA 2OXOA 2XICA 3AL0B 2HBMA 2F77X 2ZIVB 1MA7A 3IG5A 1IIPA 3AQFA 1ZQ1C 4FE3A 3PZPA 2H3FA 4GFJA 4OJ6A 2HMXA 2D6FC 3HKZF 1Q3UA 1F44A 3N7PD 2KV2A 1UPHA 2WB1C 4QNLA 2A3VA 2HOIA 2G5IB 3O0FA 2Q4TA 5C0YA 4KMOB 1YT3A 2DF4B 2KVCA 2Y0SC 2CN1A 3D2NA 4BX9C 3ICXA 3M7DA 2K4EA 1URJA 3GU3A 2KHQA 4QIWC 4ICAA 3KFUF 4OJOA 2ZXHA 2LYBA 3PSPA 2LYAA 2XVTA 3LVWA 2XIDA 4CDGA 3F2BA 2KD1A 1D8BA 2RRDA 2XI9A 4KX5A 2W7PA 2KKVA 3RF9A 4BJQA 1ED1A 4OJLA 4FZLA 2K4HA 1PVPA 2DGZA 2G0AA 1Z1BA 3CYMA 1PVQA 2HOFA 3H0MB 3SAFA 2KIWA 3SMVA 2HBJA 2MA1A 2JMGA 2OM6A 2YB1A 5KL1B 4QIWF 3C29A 2CRXA 2WAQF 2G08A 1GO3F 4P0PA 3GZFA 1CRXA 4U6PA 3SQIA 4P0PB 4O3MA 2W04A 2F8LA 2ZIXA 2F76X 3L3FX 3E0FA 3LYSA 4AYBF 2ZIXB 2G09A 1Q3VA 2BDUA 2JH7A 1PVRA 3H0LB 2HBKA 1A0PA 2KNJA 2RP5A 2ZG6A 3ALRA 2E5SA 3D2QA 5KL8B 2JGAA 4U7CA 2CPRA 1HIWA 4P0QA 2E1FA 3HKZC 3PSFA 3VC8A 4QJFB 4IC9A 4PL2A 1ECWA 2OYYA 2KOBA 2VJ4A 5T14A 4P0QB 3OPXA 3IP4B 3SAGA 4CGZA 1WUDA 2VKQA 3F53A 2NV3A 3CRXA 2HBLA 2VIXA 2ZIWA 3N7RC 2ZIWB 3F5AA 2F2AB 4CRXA 2E1EA 4OO1J 2R18A 4NWIA 4C0ZA 3T79A 1DRGA 3F2CA 2H3IA 3D2SA 2Z7JA 2H3ZA 2KEYA 2PMZC 3IG8A 1NZBA 2OH2A 5CRXA 1TAMA 3C28A 4FZMA 3M6KA 4WJ3B 2GH1A 1HEKA 2RHFA 1OUQA 2ZXIA 2K89A 2YX8A 3K1ZA 5HR6A 3DEEA 2LKYA 1L6NA 2M0NA 2K8CB 4NLBA 2HOQA 2WAQC 5A0LA 3MGVA 2KICA 3PSTA 4AYBC 2DQNB 2ZIVA 1T94A 3LVVA 3H0RB 2W03A 2LBOA 2ZIUA 2WB1F 2H3QA 3NRWA 2ZIUB 2GOLA 2JH1A 2K4IA 2KJ5A 2Y0SF 3VCBA 4NV0A 3PSIA 3M6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMX A;  2H3Z A;  1TAM A;  1UPH A;  2N1R A;  1HEK A;  2H3V A;  1L6N A;  2K4E A;  4ICA A;  2LYB A;  1HIW A;  2LYA A;  4IC9 A;  1ECW A;  4JMU A;  1A6S A;  1ED1 A;  2K4H A;  2H3Q A;  2NV3 A;  2GOL A;  2K4I A;  2JMG A;  2H3I A;  2H3F A; 
#chains in the Genus database with same CATH topology
 3EPI A;  5KG2 A;  1C7Y A;  3LK9 A;  4NM1 A;  8ICL A;  2PXI A;  2VAN A;  4EBE A;  5HMM A;  1LB2 B;  5KFL A;  3QZ8 A;  8ICP A;  4JMU A;  3JPP A;  4QZH A;  4K4G A;  2W9C A;  3PO5 A;  2W9C B;  4GXJ A;  4DQR A;  2WB1 C;  2HOI A;  2KTQ A;  1YT3 A;  4PHD A;  2CN1 A;  1RQN A;  5AM3 A;  1B4F A;  4PGY A;  4RNO A;  1D8B A;  4RZR A;  3JPT A;  4KX5 A;  3RF9 A;  2E8N A;  1WYG A;  2JMG A;  4YXJ A;  4B9V A;  4NLN A;  4UB1 A;  4C8M A;  4Q44 A;  5KT4 A;  3SQI A;  2OWO A;  3HJE A;  3GIL A;  1U48 A;  3LYS A;  1PVR A;  2HHV A;  3EW9 A;  4YN4 A;  4Y2Q A;  4M6W A;  1HIW A;  4M6W B;  4I2B A;  2OYY A;  2WF6 A;  1UCV A;  2O6K A;  1WUD A;  4XA5 A;  3OGU A;  1BPE A;  1ZD3 A;  4Z6E A;  4C8L A;  4DFP A;  2W9M A;  4E0D A;  3QU5 A;  3IG8 A;  1NZB A;  2KG5 A;  4O3R A;  3TKA A;  3TQ1 A;  4YMO A;  2DFL A;  3BJY A;  1L6N A;  2K8C B;  4NLG A;  9ICE A;  2IMW P;  5IIM A;  4QZA A;  4CF3 A;  2LBO A;  5KFU A;  2DBY A;  2H3Q A;  2JH1 A;  5EE0 A;  4MFF A;  1D8Y A;  4LZG A;  3KHL A;  4F4Y A;  3UXP A;  1N5W A;  4NLZ A;  2W3R A;  5KFC A;  9ICS A;  1ZRN A;  5KFG A;  4KIT B;  9ICJ A;  3ZDA A;  4K4I A;  1L7M A;  4DFK A;  1MSW D;  5J0T A;  2C22 A;  4OJ5 A;  4F5N A;  5KFM A;  1KDH A;  4LZD A;  3UMB A;  2BDP A;  9ICT A;  3RAQ A;  2EQY A;  9ICV A;  4I2I A;  3AL0 B;  2F77 X;  4ED1 A;  3RAX A;  3QU2 A;  1ZQ1 C;  5AI5 A;  3KHH A;  1NKB A;  2D6F C;  2YMM A;  2G5I B;  2PI4 A;  2KZZ A;  2P66 A;  3KHG A;  1DK2 A;  4Q8F A;  4JUZ A;  3HW8 A;  4M47 A;  1ZQO A;  1WWV A;  3NAS A;  4GXK A;  2W9A A;  3FAH A;  4O3Q A;  1PVQ A;  9ICP A;  1KEJ A;  8ICX A;  7ICS A;  2KP7 A;  3C29 A;  1RXW A;  2P6U A;  1CRX A;  4U6P A;  3C2K A;  2AGO A;  2R8G A;  2F1H A;  1Q3V A;  1NJX A;  5F9N A;  1V85 A;  1ZQH A;  3PR5 B;  2ESE A;  3T5L A;  5J0U A;  1EXN A;  1QQ7 A;  2FLP A;  1SV4 A;  2R18 A;  5AI0 A;  3M9N B;  3F2C A;  5J2A A;  1Q46 A;  2OH2 A;  1DGJ A;  2W54 A;  4ED8 A;  3HRD D;  2RHF A;  1N5X A;  1ZQL A;  4YQW A;  2M0N A;  5BOL A;  4JK1 A;  1WCN A;  4DL4 A;  3NRW A;  1ZQP A;  3LDA A;  2GOL A;  4QZF A;  3V6H A;  2F1I A;  4QIW F;  1ZXI A;  1JRP A;  3FYH A;  4O3S A;  3AQE A;  5EE3 A;  2JXJ A;  5J0P A;  8ICC A;  1ZQY A;  2EAN A;  1RYS A;  3ZI4 A;  1J2N A;  4XRH A;  1P7D A;  3RFA A;  4ACO A;  3GIK A;  4I28 A;  1ZQS A;  1NI3 A;  3SEI A;  1KQQ A;  2BQU A;  1SL1 A;  3AEV A;  4O3O A;  3B9J A;  4UAS A;  4FBT A;  1UQV A;  1WG8 A;  3JPR A;  4J9O A;  1S0M A;  4PPX A;  1RQL A;  1L5U A;  8ICO A;  4AP9 A;  4NLK A;  2OEH A;  1UA1 A;  3LWL A;  1KFS A;  5AK3 A;  3KFU F;  3V7K A;  2MAX A;  7ICV A;  1RYU A;  4R63 A;  4Y2P A;  3B0X A;  3K1R B;  4EYH B;  3SAF A;  3GV5 B;  5J2B A;  3PW4 A;  1WCL A;  3A0B U;  4DSK A;  4ECX A;  4PH5 A;  3E0F A;  4C4R A;  2BCQ A;  5ALE A;  1S8O A;  3C23 A;  1NKE A;  1T4G A;  2DUY A;  1FO4 A;  1X9X A;  3S6J A;  3OSN A;  2VIX A;  5F9L A;  4UB2 A;  3Q8P B;  2B0C A;  5KFK A;  1DOQ A;  2AHO B;  1CEZ A;  3SV3 A;  1Z3E B;  3T79 A;  4QZD A;  4US9 A;  3D2S A;  9ICU A;  5CRX A;  3WK7 A;  3RJJ A;  4IR1 A;  1HEK A;  2ZXI A;  5AI4 A;  4NLB A;  5JU5 A;  3NVV A;  1K1S A;  1SWW A;  3H8S A;  1SKS A;  4FBU A;  3H0R B;  4CCH A;  4Z6D A;  2AQ0 A;  1UT5 A;  4EZ6 A;  4RPZ A;  1L7P A;  4ED3 A;  4RPX A;  3KZX A;  5ALW A;  1OXJ A;  1ZQA A;  1VJ5 A;  3PW7 A;  1CI4 A;  2KKP A;  4O5K A;  3CP8 A;  5KFO A;  1VLB A;  2HHU A;  4Y2R A;  3AU2 A;  1B43 A;  2G5H B;  5ALX A;  1Q8K A;  4DEZ A;  2A19 A;  2ATL A;  3PY8 A;  4FZN A;  2G07 A;  2XIC A;  3AN1 A;  2WTF A;  3BQ0 A;  5AKZ A;  3K75 D;  3JPQ A;  2BPF A;  2WF8 A;  3SD7 A;  5TIS U;  3HKZ F;  4QW9 A;  4TUQ A;  1A77 A;  5AIB A;  1BPY A;  2KVC A;  8ICU A;  5KFI A;  3HWT A;  1V38 A;  4PHA A;  4Y2S A;  1QCK A;  4C4T A;  5KFT A;  5DLG A;  2DGZ A;  1RXV A;  5EWE A;  2W8K A;  3PML A;  3GZF A;  3RB3 A;  5IIK A;  2F76 X;  4TUS A;  2MU2 A;  1XO1 A;  3ETR A;  5AIC A;  4UBB A;  1SV0 A;  3M1Y A;  5DG8 A;  3Q8S B;  4P2H A;  4PL2 A;  3ISD A;  3RH6 A;  5EOZ A;  1Y88 A;  2HSZ A;  5HML A;  3NS1 A;  4RU9 A;  2K4P A;  9ICN A;  4EX7 A;  3KKA C;  1RPL A;  3DEE A;  3ED5 A;  5IIO A;  4RUA A;  2WAQ C;  4PZN A;  3MGV A;  2HVH A;  4Y2X A;  4UB5 A;  3AU6 A;  2F1J A;  4FFD A;  2WB1 F;  3UQ0 A;  1ZQC A;  4O3P A;  5KFJ A;  4B9L A;  9ICL A;  4PL1 A;  4BUG A;  2JHD A;  4MHV A;  3WK6 A;  5HR7 A;  2W3S A;  3ONN A;  8ICZ A;  1Z4O A;  5J0X A;  5ALP A;  1UA0 A;  1ZD4 A;  4Y2T A;  1BPD A;  3QX7 A;  3H40 A;  4JWN A;  1ZRM A;  4OJ6 A;  3JPO A;  5AM1 A;  5D4B A;  2FE9 A;  2Y9U A;  4IRK A;  1FIQ A;  1CUK A;  5J2G A;  4OJO A;  3PSP A;  4IQV A;  3CW2 C;  2R8H A;  5AKJ A;  2B6G A;  2FI1 A;  3J81 j;  1U9L A;  9ICA A;  4ZOH C;  3RJK A;  1S5L U;  4GC6 A;  2BGW A;  2EDU A;  3PR4 A;  3H0L B;  4Y2U A;  1A0P A;  5AM5 A;  2Y9T A;  5KL8 B;  3OHB A;  2KZM A;  3M9M B;  1J97 A;  2E1F A;  2YY6 A;  1JX4 A;  2V4R A;  4IQW A;  5ALK A;  1NK8 A;  3U26 A;  4EBC A;  2RDI A;  1SKR A;  4NWI A;  4B9U A;  4NL9 A;  1NNL A;  5J8Y A;  4PJ0 U;  3K1Z A;  2PFP A;  4G3I A;  7ICH A;  5KFY A;  3MFI A;  4J9L A;  2IHN A;  2ZIU A;  9ICB A;  2W55 A;  2ZIU B;  2ISO A;  3BDP A;  1X9M A;  3B0Y A;  3VCB A;  1NJW A;  2Y1I A;  4Q8E A;  2KSO A;  2KSO B;  1L3S A;  1ZYQ A;  4DQP A;  5KG3 A;  1N48 A;  1LKY A;  3SAH A;  1LKY B;  2UVR A;  2K8B B;  1JN3 A;  8ICS A;  1HJP A;  4QWE A;  1QLN A;  4UAW A;  4YD2 A;  1JRO A;  1TE2 A;  3GFK B;  5KTQ A;  3PZP A;  4F3O A;  3H8M A;  4EZ9 A;  1N62 A;  3UXO A;  5H2F U;  3TAD C;  5DGB A;  5DQH A;  1F44 A;  4ECW A;  4DQI A;  4TQS A;  8ICA A;  3M7D A;  1NJZ A;  1TK5 A;  1ZQF A;  3GU3 A;  2F3N A;  5ALR A;  5DB8 A;  2LYB A;  2LYA A;  2XVT A;  7ICF A;  5KFE A;  5KFZ A;  2L5Y A;  3T3F A;  3TFS A;  4B9S A;  1ZJN A;  4YD1 A;  8ICR A;  4I2F A;  8ICQ A;  3BQ2 A;  2YTU A;  3H4D A;  2PKE A;  1L8L A;  1GO3 F;  5EE1 A;  4P0P A;  4P0P B;  3MR2 A;  5CJ7 A;  1DK3 A;  2E5S A;  5DKW A;  3C2M A;  1BNO A;  3PSF A;  1K5O A;  4ECT A;  3IP4 B;  4PHP A;  4F5Q A;  2NV3 A;  7ICN A;  2NRV A;  4CRX A;  3NVZ A;  2XCP A;  2I6X A;  4NM2 A;  4DQQ A;  4C0Z A;  1KW4 A;  3KKA A;  5B5E U;  1JXL A;  2KEY A;  1FFV A;  4CF5 A;  5KFH A;  5DBA A;  1NOM A;  4PGQ A;  2K89 A;  1XS9 D;  5AK6 A;  8ICY A;  2LPE A;  1ZQV A;  2HCF A;  1SL0 A;  1NKC A;  3WU2 U;  3MR6 A;  5IIJ A;  3FDS A;  2ZUB A;  3H4B A;  1N2X A;  3WKC A;  3OHA A;  4NV0 A;  5AM0 A;  1DXS A;  3PW2 A;  1T3N A;  1ZQW A;  2F8K A;  3UMC A;  4QWB A;  8ICK A;  4J9M A;  7ICK A;  3BQT A;  3K4G A;  4OJP A;  4US8 A;  4B9T A;  1A6S A;  1ZQU A;  4P4O A;  2R8I A;  5ALG A;  2FPK A;  4KLO A;  1ZQJ A;  4BWJ A;  3PO4 A;  4GFJ A;  3V72 A;  5ALZ A;  5ALQ A;  4YCX A;  2XY6 A;  1N61 A;  4IR9 A;  3RBD A;  4RNM A;  4ECV A;  2Y0S C;  3ICX A;  2AXT U;  3D6J A;  5AKE A;  5DG7 A;  2KHQ A;  5ALU A;  4F72 A;  5D46 A;  4RT3 A;  9ICK A;  1QTM A;  4F5O A;  2JZB A;  4YMM A;  2BPG A;  1XSL A;  2C2E A;  4PGX A;  1S97 A;  3NTU A;  3AM9 A;  4IS7 A;  5TZV A;  2F44 A;  2G0A A;  2HOF A;  4F8R A;  4RQ7 A;  4DOC A;  2YB1 A;  5CR0 A;  4EEN A;  3ZD9 A;  1NZP A;  4XUS A;  3L3F X;  5ALD A;  5CEH A;  2KVS A;  3KOO A;  1T3Q A;  2EZZ A;  4JV1 A;  5ALH A;  3ALR A;  3I76 A;  4R65 A;  3OJU A;  2EH9 A;  4P0Q A;  3VC8 A;  2I9G A;  2FMS A;  4P0Q B;  1ECW A;  3OPX A;  2HHX A;  5J2E A;  5KNI A;  2ZIW A;  5KT7 A;  3BQ7 A;  2ZIW B;  4R66 A;  5BPC A;  2M9N A;  5ALL A;  4GXI A;  2NO5 A;  5KT5 A;  9ICM A;  4FZM A;  2FDR A;  5CB1 A;  1S0N A;  4MFC A;  4UB4 A;  3QEA Z;  4C8O A;  3KBB A;  1NK7 A;  2LKY A;  3G6X A;  1ZQI A;  3OSP A;  3PST A;  2WF7 A;  5DBC A;  1KRP A;  3GIM A;  2DPJ A;  4LVS A;  3V6J A;  3WKD A;  2K4I A;  2XO7 A;  3ISC A;  4F5R A;  4RQ4 A;  1IM4 A;  2FMP A;  4J9P A;  3NRZ A;  2YN4 A;  9ICG A;  1L3T A;  5EWF A;  5KG1 A;  2KE7 A;  4O3N A;  2FPL A;  5B66 U;  2K8A A;  2C2R A;  1S0O A;  3NUQ A;  4CNQ A;  3WK5 A;  3BQ1 A;  3WK8 A;  3RR7 A;  3IG5 A;  3MR3 A;  1S9F A;  3RJH A;  2KZ3 A;  4UAY A;  4M0A A;  1VDV A;  1RYR A;  2ZUC A;  2BHN A;  4Y2V A;  3HIL A;  4RQM A;  4TUR A;  1ARO P;  3QUT A;  4HYK A;  2DKX A;  2W43 A;  4GLX A;  1N60 A;  7ICQ A;  2GO7 A;  2HBJ A;  4YP3 A;  4IL6 U;  4RQ5 A;  2WAQ F;  4BGD A;  2ZIX A;  4F92 B;  1NK9 A;  2ZIX B;  2JH7 A;  5AKH A;  3KTQ A;  5J0W A;  1NK6 A;  2J6T A;  8ICE A;  5IIN A;  5AI6 A;  1COO A;  4C80 A;  2LM4 A;  2AGP A;  5KAF U;  4QWD A;  3SZ2 A;  1DGS A;  8ICT A;  3TAR A;  5JUM A;  4NY8 A;  2BPC A;  2UVU A;  4WJ3 B;  1ZQZ A;  4Z6C A;  1JMS A;  5HR6 A;  3SYZ A;  2DWQ A;  3RJI A;  2VA8 A;  3C5G A;  2HI0 A;  2ES6 A;  4P4P A;  2E8M A;  3LVV A;  1BPB A;  2NO4 A;  5KG0 A;  4EEY A;  3PSI A;  2EZX A;  2UVW A;  1SZH A;  2BCV A;  5C5J A;  2D8C A;  5AM4 A;  4NJ8 A;  3M9O B;  1XO0 A;  4KLT A;  2PI5 A;  5III A;  7ICI A;  4KLI A;  2WHE A;  3QU9 A;  1LV5 A;  3GII A;  2ZTC A;  1NK4 A;  2OXO A;  1U47 A;  8ICW A;  2HBM A;  3QUQ A;  4BXO A;  4OCZ A;  2E3T A;  4F5P A;  3TAP A;  3PW5 A;  2BZF A;  3WK9 A;  2HMX A;  3A0H U;  3WKE A;  2OHF A;  2IHM A;  2NRX A;  1BVS A;  2DF4 B;  4BX9 C;  3RTV A;  4F71 A;  2K4E A;  2HVI A;  1TKD A;  3NVW A;  2ZXH A;  1N56 A;  4Z6F A;  2W11 A;  3TAN A;  1YZ7 A;  4DQS A;  1PUZ A;  4RQ0 A;  2K4H A;  1Z1B A;  3H0M B;  5GTH U;  1TV9 A;  4RQN A;  4ED6 A;  1TAQ A;  4J03 A;  4KLU A;  2RDJ A;  5K4L A;  3ZDE A;  4YMN A;  2EAM A;  2XY5 A;  2QB0 A;  2QB0 B;  4KLD A;  5HHI A;  4I2E A;  3AMZ A;  5ALY A;  1ZQG A;  5KFS A;  3GQC A;  3L4P A;  3RRH A;  5EWG A;  4Q43 A;  4DLG A;  1PK1 A;  1SB3 C;  3NVY A;  1B0X A;  1TK0 A;  4I2D A;  2JV3 A;  4DFD A;  4DL3 A;  5BOM A;  4ELU A;  4DOA A;  4JV0 A;  3Q8L A;  3V7L A;  2ISP A;  5HHH A;  1QSL A;  2C2D A;  1OW5 A;  2HHS A;  2Z7J A;  1QSS A;  3UQ2 A;  8ICN A;  1M6Y A;  2JEI A;  1J2M A;  4ECZ A;  1OUQ A;  4DFM A;  8ICF A;  1ZQK A;  3R9K A;  7ICO A;  3PMN A;  3Q8Q B;  4QZI A;  5A0L A;  2HW3 A;  4AYB C;  2ZIV A;  3ZD8 A;  9ICO A;  1X6J A;  3MDA A;  5DGA A;  4DL6 A;  2ZJA A;  5J29 A;  5AKL A;  4RQ1 A;  2LHT A;  2VJ5 A;  4PZO A;  4EX6 A;  1ZQQ A;  2KJ9 A;  2V4Q A;  4FS2 A;  1XNS A;  2PMZ F;  3THV A;  4XQ8 A;  1SKW A;  2EZY A;  4PHE A;  1MA7 A;  4B6J A;  2VA3 A;  3AQF A;  3TAQ A;  4KLH A;  4GIB A;  4YR0 A;  2E8O A;  4KMO B;  2RQ5 A;  2AGQ A;  5KFA A;  4RT2 A;  3T5K A;  2KD1 A;  1X40 A;  4BJQ A;  5DLF A;  5AKK A;  3QUC A;  5AKI A;  5IIL A;  2LM1 A;  2MA1 A;  1ZQB A;  1KN5 A;  2UVV A;  3RB4 A;  3EUB 2;  4KLE A;  2BDU A;  2NRZ A;  5KFV A;  2RP5 A;  4U7C A;  9ICI A;  4KLL A;  3AUO A;  2GWS A;  5J2H A;  2FLL A;  3SEN A;  2ASD A;  3TFR A;  2IA6 A;  2EAO A;  3N7R C;  3F5A A;  3IRU A;  5AI9 A;  4I2A A;  4OO1 J;  8ICB A;  2DPI A;  2H3Z A;  2D3D A;  5KFF A;  5KT2 A;  3PNC A;  2QLT A;  3SV4 A;  2YMQ A;  4DOB A;  1COK A;  5DQG A;  2YX8 A;  5AK5 A;  2KIV A;  3PW0 A;  4ELV A;  1D8L A;  1T94 A;  1HUZ A;  1ZOL A;  4JWM A;  3RH5 A;  2Y0S F;  1O08 A;  4RQ3 A;  2G06 A;  2CXY A;  1JIH A;  2W7O A;  2MRL A;  4KX3 A;  2DKZ A;  5J2D A;  3IM1 A;  3C21 A;  1S76 D;  2KJ8 A;  2ASL A;  2KHV A;  5J2J A;  2XGP A;  4TUP A;  1O03 A;  4IRC A;  2ASJ A;  4C7Y A;  1NK5 A;  5L1M A;  4DF4 A;  5ALV A;  3ZDB A;  2ZTE A;  3IDW A;  4F93 B;  4KLF A;  2HHW A;  1TK8 A;  3EYZ A;  4J9S A;  1XSN A;  4CDG A;  5GTI U;  3MGH A;  4O0I A;  5CWR A;  2YQE A;  2WF5 A;  4UAV A;  5KG6 A;  8ICM A;  2W9B A;  3M8S A;  1S77 D;  4QZB A;  2KN7 A;  4F50 A;  2P6R A;  5KFN A;  8ICH A;  3M8R A;  4UQG A;  3QE9 Y;  1NK0 A;  4M2Y A;  4F4X A;  2W04 A;  7ICP A;  1QH9 A;  1L3V A;  5L9X A;  3C2L A;  2FMQ A;  5CA7 A;  2BCS A;  2XCA A;  2JGA A;  3V7J A;  5J2F A;  4DSF A;  5T14 A;  1U49 A;  3UMG A;  7ICG A;  8ICV A;  1F0M A;  2YML A;  4K4H A;  4DFJ A;  1N63 A;  1Z4N A;  2ZJ8 A;  2PMZ C;  5G5H A;  2GLE A;  4Q45 A;  3C28 A;  3RBE A;  3M6K A;  9ICC A;  4YR3 A;  1KFD A;  1KSP A;  1MN8 A;  4O5E A;  3RB0 A;  9ICX A;  3RR8 A;  4UAT A;  2LYH A;  4R8U A;  5DDY A;  5CHG A;  4R8U B;  2DQN B;  3HX0 A;  4QW8 A;  4KLJ A;  3WK4 A;  1SGG A;  4YG2 A;  9ICW A;  5J0O A;  3C1Y A;  4I2J A;  2IOH A;  4CF4 A;  5ALM A;  4DWI A;  3BS7 A;  4F4Z A;  1ZD5 A;  3V6K A;  4UB8 U;  5AKG A;  3EZ5 A;  2W8L A;  3PVX A;  1TFR A;  3QUB A;  1KFT A;  4MEY A;  1ZET A;  4DL2 A;  5KG4 A;  9ICF A;  4B9M A;  2FLN A;  4CE6 A;  5CP2 A;  4TQR A;  2DL0 A;  3O0F A;  1TVA A;  3C5F A;  5C0Y A;  7ICR A;  2ODG A;  4IRD A;  2ZJ5 A;  4QZC A;  2NRT A;  2C28 A;  2MUT A;  2MUT B;  3SMV A;  1BGX T;  4KN4 A;  2CRX A;  2NRW A;  4UW9 A;  4QZ8 A;  5E79 U;  3KD3 A;  2HBK A;  3WKA A;  3QXG A;  4M9H A;  2WFA A;  4M04 A;  2ZTD A;  4KLM A;  9ICR A;  2VJ4 A;  4USA A;  2JZB B;  5JTI A;  2VKQ A;  1L7O A;  2HBL A;  4J9Q A;  3TI0 A;  5DG9 A;  5KFQ A;  4RUC A;  1LVH A;  1B22 A;  3MBY A;  4UAR A;  4DSJ A;  1U45 A;  4ECS A;  5J2C A;  3JPS A;  1ZQT A;  1T8E A;  4RNN A;  2HHQ A;  1QQ6 A;  4ED7 A;  2XC9 A;  5ALJ A;  1V9P A;  1ZQE A;  2KJ5 A;  3E58 A;  3M6Z A;  3QEB Z;  5J0S A;  4QZ9 A;  4UB6 U;  5DQI A;  4QZG A;  4EYI B;  4RPY A;  4M9N A;  2N1R A;  2BQR A;  3F2D A;  4MEX A;  1UT8 A;  3UXN A;  4ECU A;  1Z19 A;  3IHQ B;  3HT3 A;  1KBU A;  4RQ2 A;  2AU0 A;  3C1Z A;  1U4B A;  3QU7 A;  3E2E A;  3ORY A;  1QQ5 A;  3GV8 B;  3H8W A;  1RG6 A;  2QB1 A;  4UBC A;  2KV2 A;  4QNL A;  4M9L A;  5DBB A;  3T5J A;  1PZN A;  3D2N A;  3OTQ A;  4ICA A;  4NXZ A;  2JR5 A;  5HNK A;  5J0Y A;  5AK4 A;  3LVW A;  1TAU A;  1X6I A;  4F2R A;  2W7P A;  5J2I A;  1SV0 C;  2KMD A;  4DL5 A;  1S0V A;  1ED1 A;  1BPZ A;  4FZL A;  2BQ3 A;  1XC9 A;  4P4M A;  2QKQ A;  1PVP A;  5FP0 A;  3TAD A;  2AH5 A;  1L8O A;  4C7Z A;  4F91 B;  1WWU A;  2F8L A;  4AYB F;  3PX6 A;  3Q8R B;  5DB7 A;  2KFZ A;  1XWL A;  4DO9 A;  5KAI U;  3FM9 A;  1JXE A;  4QJF B;  3QZ7 A;  3MFH A;  4M9G A;  4ED2 A;  4UAU A;  3CRX A;  3RJG A;  1QSY A;  4KTQ A;  1MQ3 A;  2E1E A;  1C20 A;  5HP4 A;  2PFQ A;  4F4K A;  5KG7 A;  3HP6 A;  3EWA A;  4J9K A;  4EEL A;  1XU4 A;  3WKB A;  1FEZ A;  1KKX A;  3FC4 A;  4DSL A;  4I2H A;  1SWV A;  5KT3 A;  7ICM A;  1JI7 A;  2BCR A;  1L7N A;  2YMP A;  2ALZ A;  2EAP A;  3ZDC A;  3N97 B;  2LI6 A;  2YB4 A;  4O5C A;  4DL7 A;  5KFP A;  1IV8 A;  1D9D A;  4I2C A;  2IOF K;  2H3V A;  3IN5 A;  1PK3 A;  5J2K A;  3N7S C;  1D9F A;  1X2I A;  3F5E A;  1UHU A;  1FFU A;  4NLC A;  1RM6 C;  4KLS A;  1X66 A;  4DS4 A;  9ICH A;  4FE3 A;  3GV7 B;  3CNH A;  4GC7 A;  1XSP A;  4QWA A;  3N7P D;  4YVZ A;  5JRT A;  2Q4T A;  4G9B A;  3GIJ A;  2IOF A;  3RH4 A;  4ECR A;  2K60 A;  1A76 A;  3RB6 A;  5KT6 A;  1RDF A;  3Q8K A;  3F2B A;  4KMU A;  4MF8 A;  1F5S A;  2XI9 A;  2A1J A;  4KLG A;  2I1Q A;  4BWM A;  2JEG A;  2JEJ A;  3RJE A;  2A1J B;  3MR5 A;  4DSE A;  4FO6 A;  4BXO B;  2OM6 A;  1BNP A;  5KL1 B;  4I29 A;  2JEF A;  3BS5 A;  3BS5 B;  2P35 A;  4O3M A;  4ED0 A;  2BR0 A;  3H7I A;  2FPM A;  4X5V A;  4NL9 C;  4C8N A;  2V9W A;  5J8Y C;  3QU4 A;  4Y2Y A;  1X9W A;  2QAR A;  4IC9 A;  5J0Q A;  4RQ8 A;  2QAR B;  1MQ2 A;  5ALF A;  7ICE A;  4CGZ A;  7ICL A;  1BPX A;  2IBK A;  4C8K A;  3DV9 A;  5ALN A;  3KHR A;  5KG5 A;  4LJX A;  1Z00 A;  1Z00 B;  3NGD A;  3UM9 A;  1TAM A;  3DDH A;  5KFW A;  3LWM A;  1Z1V A;  2RLT A;  2KIC A;  2XY7 A;  1PK1 B;  4FS1 A;  2PFN A;  1AQ6 A;  5L1J A;  1SIJ A;  4F2S A;  2FJ6 A;  1KL9 A;  4QWC A;  3GDX A;  3QNM A;  3Q8M A;  1KTQ A;  9ICQ A;  3QYP A;  3G6Y A;  2I5H A;  2KFN A;  4JB3 A;  1IG6 A;  5DB6 A;  4YR2 A;  4R64 A;  4DF8 A;  3PX0 A;  2ZIV B;  3MAB A;  2H3F A;  4JV2 A;  1UPH A;  2A3V A;  2MSN A;  4EEK A;  5ALO A;  1NJY A;  1URJ A;  4QIW C;  2XID A;  2RRD A;  2KKV A;  2J6S A;  1JAL A;  4HAI A;  7ICU A;  3I1Y A;  4ZH4 A;  3N4M B;  5DB9 A;  3I28 A;  4UB3 A;  2G08 A;  4MFA A;  5AI8 A;  1K1Q A;  4DCC A;  7ICJ A;  2LMR A;  2G09 A;  4YFK A;  1L3U A;  2KNJ A;  2ZG6 A;  1ZQR A;  1SXD A;  2CPR A;  4ECQ A;  4J9N A;  2KOB A;  4I2G A;  1ZD2 P;  3F53 A;  1SL2 A;  3T5H A;  2KK0 A;  2F2A B;  4O9M A;  5KFR A;  1DRG A;  2XGQ A;  2H3I A;  5DDM A;  3OJS A;  2WF9 A;  2R8J A;  4I27 A;  5AKX A;  3MGI A;  3ISB A;  3L5K A;  3ZDD A;  5J0R A;  4F4W A;  1HUO A;  3SR6 A;  4KN7 A;  3BZK A;  2AQ4 A;  4DSI A;  2W03 A;  2OCE A;  5KFD A;  5ALI A;  3KZI U;  3EPG A;  3RJF A;  3ETL A;  2NYV A;  2R8K A;  5F3X B;  2HHT A;  4A8E A;  5KFX A;  4EBD A;  8ICG A;  1ZQD A;  5KFB A;  1KLN A;  3RRG A;  5AM2 A;  4QZE A;  3BZC A;  4M9J A;  1ZQM A;  3G6V A;  1T7P A;  3MC1 A;  4DS5 A;  1IIP A;  1YZ6 A;  2H5X A;  3H8J A;  7ICT A;  4Y2J A;  1Q3U A;  1SXE A;  4IQU A;  3N28 A;  4UAZ A;  2BKE A;  1X42 A;  1RZT A;  3UPQ A;  5D49 A;  3IV6 A;  1ZJM A;  4ELT A;  4OJL A;  5AKY A;  3CYM A;  4YXM A;  2KIW A;  4C4S A;  2Y1J A;  2JRZ A;  8ICI A;  4RQ6 A;  1IXR A;  2BCU A;  2PFO A;  1ZQN A;  4MF2 A;  3JPN A;  5ALT A;  5L1K A;  3D2Q A;  2J6U A;  2ZUD A;  3HKZ C;  5L1I A;  1X9S A;  1H38 A;  1ZQX A;  4ECY A;  3SAG A;  1V97 A;  5EE9 A;  3TAC B;  3MDC A;  2W9B B;  5ALS A;  2VA2 A;  5AHX A;  5G5G A;  4B9N A;  2AJQ A;  4J9R A;  2HDO A;  2B21 A;  1SZP A;  3PV8 A;  2GH1 A;  1S10 A;  4DLE A;  2A1A A;  2HOQ A;  4IQT A;  4KLQ A;  4BDP A;  2E8P A;  3PX4 A;  3SI8 A;  8ICJ A;  5AIA A;  5L1L A;  1MC8 A;  2Q0Z X;  3HPO A;  1JUD A;  4OD0 A; 
#chains in the Genus database with same CATH homology
 2G06 A;  3KZX A;  2YB4 A;  1SZH A;  4BUG A;  3AQE A;  2JHD A;  2W7O A;  2MRL A;  2N1R A;  4KX3 A;  4A8E A;  3F2D A;  5HR7 A;  4PL1 A;  2H3V A;  2LHT A;  3IN5 A;  2KKP A;  2VJ5 A;  1XO0 A;  3CP8 A;  3ONN A;  2K8A A;  4OJ5 A;  2KJ9 A;  3SAH A;  3N7S C;  2KJ8 A;  1Z19 A;  4OJP A;  1P7D A;  1XNS A;  3RFA A;  4ACO A;  2G5H B;  2KHV A;  2PMZ F;  3F5E A;  1KBU A;  2K8B B;  4FZN A;  4JMU A;  1A6S A;  2G07 A;  4NLC A;  3NUQ A;  2OXO A;  2XIC A;  3AL0 B;  2HBM A;  2F77 X;  2ZIV B;  1MA7 A;  3IG5 A;  1IIP A;  3AQF A;  1ZQ1 C;  4FE3 A;  3PZP A;  2H3F A;  4GFJ A;  4OJ6 A;  2HMX A;  2D6F C;  3HKZ F;  1Q3U A;  1F44 A;  3N7P D;  2KV2 A;  1UPH A;  2WB1 C;  4QNL A;  2A3V A;  2HOI A;  2G5I B;  3O0F A;  2Q4T A;  5C0Y A;  4KMO B;  1YT3 A;  2DF4 B;  2KVC A;  2Y0S C;  2CN1 A;  3D2N A;  4BX9 C;  3ICX A;  3M7D A;  2K4E A;  1URJ A;  3GU3 A;  2KHQ A;  4QIW C;  4ICA A;  3KFU F;  4OJO A;  2ZXH A;  2LYB A;  3PSP A;  2LYA A;  2XVT A;  3LVW A;  2XID A;  4CDG A;  3F2B A;  2KD1 A;  1D8B A;  2RRD A;  2XI9 A;  4KX5 A;  2W7P A;  2KKV A;  3RF9 A;  4BJQ A;  1ED1 A;  4OJL A;  4FZL A;  2K4H A;  1PVP A;  2DGZ A;  2G0A A;  1Z1B A;  3CYM A;  1PVQ A;  2HOF A;  3H0M B;  3SAF A;  2KIW A;  3SMV A;  2HBJ A;  2MA1 A;  2JMG A;  2OM6 A;  2YB1 A;  5KL1 B;  4QIW F;  3C29 A;  2CRX A;  2WAQ F;  2G08 A;  1GO3 F;  4P0P A;  3GZF A;  1CRX A;  4U6P A;  3SQI A;  4P0P B;  4O3M A;  2W04 A;  2F8L A;  2ZIX A;  2F76 X;  3L3F X;  3E0F A;  3LYS A;  4AYB F;  2ZIX B;  2G09 A;  1Q3V A;  2BDU A;  2JH7 A;  1PVR A;  3H0L B;  2HBK A;  1A0P A;  2KNJ A;  2RP5 A;  2ZG6 A;  3ALR A;  2E5S A;  3D2Q A;  5KL8 B;  2JGA A;  4U7C A;  2CPR A;  1HIW A;  4P0Q A;  2E1F A;  3HKZ C;  3PSF A;  3VC8 A;  4QJF B;  4IC9 A;  4PL2 A;  1ECW A;  2OYY A;  2KOB A;  2VJ4 A;  5T14 A;  4P0Q B;  3OPX A;  3IP4 B;  3SAG A;  4CGZ A;  1WUD A;  2VKQ A;  3F53 A;  2NV3 A;  3CRX A;  2HBL A;  2VIX A;  2ZIW A;  3N7R C;  2ZIW B;  3F5A A;  2F2A B;  4CRX A;  2E1E A;  4OO1 J;  2R18 A;  4NWI A;  4C0Z A;  3T79 A;  1DRG A;  3F2C A;  2H3I A;  3D2S A;  2Z7J A;  2H3Z A;  2KEY A;  2PMZ C;  3IG8 A;  1NZB A;  2OH2 A;  5CRX A;  1TAM A;  3C28 A;  4FZM A;  3M6K A;  4WJ3 B;  2GH1 A;  1HEK A;  2RHF A;  1OUQ A;  2ZXI A;  2K89 A;  2YX8 A;  3K1Z A;  5HR6 A;  3DEE A;  2LKY A;  1L6N A;  2M0N A;  2K8C B;  4NLB A;  2HOQ A;  2WAQ C;  5A0L A;  3MGV A;  2KIC A;  3PST A;  4AYB C;  2DQN B;  2ZIV A;  1T94 A;  3LVV A;  3H0R B;  2W03 A;  2LBO A;  2ZIU A;  2WB1 F;  2H3Q A;  3NRW A;  2ZIU B;  2GOL A;  2JH1 A;  2K4I A;  2KJ5 A;  2Y0S F;  3VCB A;  4NV0 A;  3PSI A;  3M6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...