2HMXA

Human immunodeficiency virus type 1 matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
133
Chain Sequence
HMGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 MATRIX PROTEIN
publication title Three-dimensional structure of the human immunodeficiency virus type 1 matrix protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Matrix protein
total genus 33
structure length 133
sequence length 133
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2hmxA00
1HIWA 2H3IA 2H3ZA 2JMGA 4JMUA 1UPHA 2K4IA 2NV3A 2N1RA 2LYAA 4ICAA 4IC9A 2K4HA 1HEKA 1L6NA 2H3QA 2GOLA 1TAMA 2H3VA 1ED1A 2H3FA 2K4EA 1A6SA 2LYBA 2HMXA 1ECWA
chains in the Genus database with same CATH superfamily
1YT3A 5AI4A 2XGPA 3IHQB 5AKEA 4ELUA 8ICRA 2JR5A 2LYAA 2JZBA 1NNLA 5B5EU 2JXJA 3RAXA 4UB4A 3ICXA 3UMGA 3FYHA 1KQQA 4PHDA 2YMQA 9ICBA 5KFUA 3KHLA 2PFOA 4I2JA 3PZPA 8ICXA 1X9SA 1PVQA 1NK4A 4G9BA 4MFCA 4M2YA 1T94A 4UAVA 5AI9A 3IG5A 1PVRA 4DS5A 3ISBA 3PX6A 2WFAA 5F9LA 4DL3A 5AK3A 4YD1A 2RDJA 3C1YA 3C23A 5DB8A 1AQ6A 2ZIUB 3EWAA 2FPLA 2KZ3A 2BPFA 3SAHA 3RRHA 5ALIA 3F5EA 2Y0SC 4FO6A 4EZ9A 1XSNA 5KFWA 3C1ZA 5AKLA 2BKEA 1IV8A 5AI8A 1JXLA 4DL6A 2KP7A 8ICLA 3LDAA 2HI0A 1QH9A 2WAQF 3KTQA 4KLGA 5J8YA 2DBYA 3KOOA 2D8CA 2W11A 2Z7JA 3E0FA 3THVA 1V9PA 4EEKA 1L8OA 1S10A 4KX5A 5HP4A 1FEZA 2DQNB 1V97A 1RXWA 1N60A 8ICFA 3T3FA 4ZOHC 3I28A 3TADC 3M8SA 1N56A 9ICNA 4EX6A 4UB5A 1ZQUA 1U45A 2V9WA 2R18A 2K4HA 3T5JA 1TKDA 5DB6A 2V4QA 2MUTA 4IRDA 5CA7A 3F2DA 5AKHA 3KZXA 2ZJAA 3WU2U 5ALQA 2E1FA 1WCLA 4O3RA 3GU3A 3RAQA 2P6RA 1SGGA 4Y2PA 2IMWP 3B0YA 4F4WA 5JRTA 1QQ6A 3IN5A 1JRPA 2DPIA 4QZCA 3SMVA 3TFRA 2WTFA 5J2FA 1JMSA 4RPZA 4GXKA 2HHVA 4Z6FA 1K1SA 3EUB2 1U4BA 3WKDA 4MFFA 5DDYA 3QU7A 4YCXA 2W8KA 3RTVA 2RRDA 1MQ2A 3TFSA 3TARA 5J2GA 2WAQC 3K1RB 1KTQA 2BPCA 3C5FA 5EWGA 2KIVA 4CNQA 8ICHA 4NXZA 3KD3A 1ZYQA 3M7DA 2W3SA 4B9MA 4DSIA 7ICKA 2UVWA 4O3PA 4GLXA 3PW0A 4B9UA 3PO4A 1GO3F 3PX0A 4RT2A 4IC9A 8ICPA 3H4BA 2HCFA 3T5KA 4ECSA 4AP9A 4MEXA 4KLIA 3RFAA 5DG7A 4FFDA 3IDWA 2Q0ZX 2LMRA 2AHOB 2AU0A 5CRXA 2Y9UA 1IM4A 4O5EA 1COKA 2YMPA 3QU4A 5BOMA 2NRTA 5IIMA 4QZIA 4I2BA 3LVVA 2E8MA 5KFNA 4I2AA 1KN5A 3RJKA 3J81j 3QU9A 4UATA 1U9LA 4I2DA 3KBBA 1TVAA 5HHIA 1PK1A 1X40A 3JPSA 3C28A 5KG0A 3MR3A 9ICTA 2RQ5A 4RQ6A 5KFAA 1MC8A 1N5WA 1SB3C 4F72A 4OJOA 3T79A 2FMPA 3CYMA 4BGDA 1IIPA 5HR6A 4AYBF 3BQTA 4ED2A 3UM9A 3WK4A 5ALSA 1SXEA 3MABA 4NLCA 5J0XA 7ICMA 4GXJA 3I76A 5ALDA 2W3RA 5A0LA 4UBBA 1KFDA 1D8YA 1SV4A 8ICSA 2JZBB 7ICJA 2W9BA 2RHFA 2JEIA 4Y2JA 2HDOA 5KFXA 4QZAA 3DDHA 1ZQNA 3RB6A 4PPXA 2WF6A 1TAUA 3RF9A 3PR4A 4JMUA 2JH1A 2ODGA 3D2NA 4DCCA 5K4LA 4UB8U 2OYYA 1SL1A 5G5HA 4OO1J 4K4HA 4F50A 1WWVA 2EZXA 2KTQA 2HVHA 7ICSA 4IR9A 4QWDA 3C5GA 5J2HA 1NK5A 9ICVA 5F9NA 5ALWA 2KV2A 4FZLA 3ORYA 5KFGA 5KG7A 1SZHA 2AGQA 3UQ2A 1ZD3A 4IQVA 4CCHA 1TE2A 1XS9D 5KTQA 4AYBC 2BQRA 1ZJMA 3CW2C 1ZQYA 5DB7A 5KT7A 2KKPA 5TISU 3N7RC 4DQQA 4QW9A 4TQSA 1FFUA 5EE1A 2NRZA 2DFLA 5CR0A 4I2FA 4M9JA 3HKZF 5AKKA 4TUPA 4BXOA 2GO7A 3C2KA 2J6TA 2K8AA 3HPOA 4EBDA 3EYZA 2BQUA 4B9LA 5CB1A 4GC7A 3PSTA 2XC9A 4F93B 5J2IA 4KTQA 2MUTB 5KFOA 5KFEA 4US9A 4Z6EA 2A1AA 3SV4A 4DSKA 4MHVA 4M04A 4R8UB 4C4TA 4B9NA 4QWBA 4DQIA 1FO4A 1Z00B 1V85A 1C7YA 2JV3A 4YVZA 2DPJA 4DQRA 3C29A 4C4SA 4Y2XA 1X6JA 1T3NA 4DSLA 2HBLA 4DF4A 2PXIA 2I5HA 4US8A 2B6GA 1X2IA 4F91B 4ECVA 8ICKA 4PHPA 5AM0A 4ECWA 3Q8MA 2DWQA 4PHAA 2BZFA 4XA5A 5J2DA 1X66A 4F8RA 1HJPA 3ONNA 5J0QA 5JU5A 5ALGA 4J9MA 4KN7A 2XI9A 4KN4A 4LZDA 3MGHA 1SL0A 3L4PA 1L3VA 1KSPA 3KHHA 1SZPA 1KEJA 1RG6A 5EE9A 1L7PA 1BPZA 1BPYA 2A19A 2XCAA 4KMOB 3C21A 2AH5A 3IV6A 1O03A 2EAPA 3PW5A 4HAIA 1F44A 1ZQDA 3HKZC 1L6NA 4YMNA 1UA1A 3AM9A 4JV0A 4YD2A 4EENA 4O3MA 3RBEA 4LVSA 1M6YA 5J8YC 3BZKA 2HHQA 3SENA 3UXPA 1VJ5A 4O5KA 4FZMA 1N48A 4KLMA 4KLQA 3KZIU 2JGAA 4UAUA 5KAFU 3MC1A 2YB1A 4RNNA 1Y88A 5KFSA 3RB4A 4DLEA 3JPPA 5ALJA 2KNJA 3MR2A 1JN3A 2IOFK 4QZHA 1NI3A 1KFSA 4F71A 4K4GA 2KHVA 4JUZA 5DLFA 4QZEA 3KKAC 2P35A 1PK1B 2BCSA 5CEHA 1NK8A 2L5YA 5DQHA 4DFMA 3Q8PB 1KFTA 3ZDEA 4RQMA 4YMMA 3H8MA 2NRWA 1RYSA 2JH7A 1L7NA 3PW4A 1IXRA 2F1IA 1XSPA 3G6YA 3QXGA 2PI5A 1NKCA 1TFRA 4OJ6A 5AK5A 2FDRA 5HMLA 4EX7A 2VKQA 4DF8A 8ICVA 4E0DA 3AQEA 4O3NA 1NJZA 3FAHA 3ISCA 4NM1A 8ICCA 2IOHA 2KEYA 4ICAA 3OHBA 9ICIA 2YQEA 4MFAA 2KK0A 3PSPA 4TQRA 4QZ9A 3D2SA 1HUOA 2G5IB 4IS7A 1U49A 1ZQSA 2E8NA 1ZRMA 3PO5A 3ZD8A 4RZRA 2JHDA 4ECUA 3IP4B 4QZDA 3QYPA 1KDHA 1F5SA 5ALOA 1TAQA 1VDVA 2FMSA 1BPDA 3GZFA 5EE3A 5KFRA 3NTUA 5KFFA 3WKEA 4I2EA 1ZETA 5J2EA 5KNIA 3MDAA 2F2AB 4ECXA 1HUZA 3H7IA 1RQLA 5L1LA 2VANA 2FLLA 5KT6A 2V4RA 3OTQA 5KFTA 5JUMA 4C4RA 2ESEA 3OGUA 1J2MA 4FBUA 4Y2VA 5L1JA 1CI4A 2R8KA 2KJ5A 3WK7A 4UB1A 1K5OA 2NRVA 4UARA 5AM4A 4YR2A 4CF3A 2KSOA 3D2QA 4J9RA 3RR7A 4PGQA 2HMXA 3RJJA 1UA0A 2PKEA 2E8OA 3ISDA 2ZIXA 2AGOA 5ALXA 4NJ8A 4F4XA 5ALHA 5KFQA 1MQ3A 7ICGA 4C0ZA 3JPQA 2WHEA 4BXOB 3R9KA 2W04A 3M1YA 4RQ2A 3Q8LA 3GIMA 5J0RA 2IOFA 8ICNA 5KFHA 2W7PA 3QUQA 1H38A 2A1JB 3AN1A 4F3OA 4KLUA 4I28A 2OWOA 2XGQA 1SWVA 4P0PB 1HEKA 1OXJA 2NO5A 4UQGA 4NY8A 1NK6A 3RJIA 2IBKA 3TANA 5J0OA 3LVWA 4XRHA 1UT5A 4YP3A 5J2CA 4UBCA 1QLNA 2YMLA 1S0VA 2FPMA 4UAWA 3PR5B 4R8UA 2MSNA 2OEHA 3UPQA 1Z19A 3SAFA 4KLFA 7ICVA 4M6WB 5DBBA 3PW2A 4KLJA 5C0YA 1Z00A 1N5XA 1B0XA 4QWCA 3TI0A 1T8EA 1ZXIA 1SV0A 3PY8A 2D3DA 1RM6C 2H3VA 5IINA 3WK9A 2OHFA 1KLNA 2BDPA 5ALYA 1KRPA 3N7PD 9ICHA 3NRZA 3GIKA 4PH5A 4BWJA 3H0MB 5DQGA 2VA8A 3H8JA 2QLTA 4M9LA 1QSSA 2K60A 4NV0A 2H3IA 4FBTA 2DL0A 2M9NA 1L5UA 4YFKA 5AM2A 3HILA 7ICQA 2LM1A 2LPEA 1DRGA 4KITB 2EANA 2YN4A 2BR0A 2HOFA 4RQ1A 3SR6A 5EWEA 4F5PA 1S0MA 2JEFA 4DEZA 4ELVA 4DQSA 4ZH4A 4ED1A 4ELTA 1ZQRA 1PUZA 5G5GA 3TQ1A 1KBUA 2ZIVA 3WKAA 1NZPA 1SIJA 4KX3A 4P4PA 1LKYA 2JEGA 3PV8A 4DL4A 2DF4B 1NK9A 1T3QA 1LV5A 5L1IA 2YMMA 7ICPA 4Z6CA 9ICPA 5KFZA 3SAGA 5AKZA 4YN4A 1NK7A 2WF7A 1V38A 1TAMA 2HOQA 2R8HA 3K4GA 4F2SA 1X9MA 5J0TA 2KICA 3M9OB 4QNLA 1L8LA 5CJ7A 1ZD4A 4ECQA 3NVWA 4RQNA 2NV3A 1UCVA 1ZD5A 2QB0B 3ETLA 3TACB 5J0SA 4R66A 5ALFA 4IQTA 2Y1IA 3L5KA 4C80A 2IHNA 4JWMA 3KHGA 4DLGA 3V6JA 1L3TA 2G0AA 2KVCA 4C7YA 9ICUA 3WK5A 4ED3A 4J9PA 2J6SA 3RB3A 4PHEA 3CRXA 4ACOA 4TURA 4FE3A 2ALZA 1ZQHA 1MN8A 3RH4A 7ICIA 4JV2A 5KFDA 1RXVA 4RQ5A 5TZVA 4QWEA 4R64A 2H3QA 3UXOA 5KFMA 1Z1VA 2F44A 1D9FA 4P2HA 1L7MA 2AGPA 3RB0A 1ZQWA 4F4KA 1KKXA 5DBCA 1QTMA 2HSZA 1SXDA 4EBEA 1A77A 2EZZA 4I2GA 4M9NA 2VJ4A 4O3QA 3UMBA 3TADA 2KKVA 5KFKA 3VCBA 1RQNA 4YR0A 4FS1A 4QZBA 2C2DA 2K8CB 1NK0A 1U48A 3RR8A 5AI6A 2HBKA 2KIWA 8ICGA 3OJUA 2ZUDA 3WKBA 1EXNA 3GV8B 2M0NA 1ZQ1C 2XIDA 1P7DA 2DKXA 1S9FA 1ZQOA 5DG8A 2XVTA 8ICOA 1DK2A 3ED5A 2W8LA 2KOBA 2WF9A 1WYGA 1DGJA 4Y2TA 3MFHA 5AIAA 2F76X 4F4YA 4CGZA 4F5QA 2NYVA 2HHSA 1ZQZA 4DFPA 5BOLA 1ZD2P 1ZQEA 5AM5A 4DL2A 2KSOB 2OCEA 5DGBA 3AL0B 5IIJA 7ICEA 2ASJA 1Z1BA 4M47A 2ZIXB 1Z3EB 4DOCA 3WK8A 4Q43A 1CRXA 4DL7A 3QX7A 4U6PA 2FPKA 1S97A 3ZD9A 1YZ6A 1Z4OA 5ALPA 7ICLA 4UAYA 2BHNA 1IG6A 2H5XA 7ICFA 1XNSA 2W9MA 3M6ZA 3UMCA 2HHTA 2Y1JA 3NVVA 9ICKA 5AM1A 3NVYA 5GTHU 2KFNA 1Z4NA 4MF8A 3BS5A 2I9GA 3HRDD 1BGXT 4Q8FA 3Q8RB 5J2BA 4BX9C 3ETRA 4MF2A 5ALVA 2A1JA 2B21A 3C2MA 4C7ZA 1S76D 1ZQGA 4GC6A 4I2IA 4RQ0A 1WWUA 4ECZA 4P0PA 5J2JA 2BDUA 3CNHA 3QU5A 5BPCA 5CWRA 2KE7A 2NO4A 3OSPA 5AIBA 2ZIWA 9ICXA 5B66U 4YQWA 4M6WA 4NLNA 4PL1A 3S6JA 3BZCA 2AXTU 4J03A 3EW9A 3GV7B 3G6XA 4KLHA 5IIOA 5DLGA 1K1QA 5IILA 2G07A 4DSEA 1F0MA 5ALKA 3V6KA 4F2RA 3B9JA 2KN7A 2UVVA 4EYHB 5JTIA 3QUCA 2G06A 1JROA 1ZQLA 7ICRA 3K1ZA 4I29A 2FJ6A 5IIKA 4U7CA 5KT4A 3OPXA 3V72A 5KT5A 4EEYA 3ALRA 4O0IA 5AKYA 4Y2RA 4PJ0U 4F92B 5HR7A 5EWFA 3QE9Y 2MRLA 3QEAZ 3QUTA 3BJYA 2KFZA 1ZQPA 2ZIVB 4J9LA 3JPNA 1LKYB 2ATLA 4ECYA 3GFKB 4I2CA 9ICRA 4EZ6A 4QZFA 3SYZA 4GIBA 3PW7A 1BPEA 2XO7A 3V7LA 4B9TA 4K4IA 2EAOA 2QARA 1X9XA 9ICEA 3H8WA 4YG2A 5DQIA 4PZOA 1FIQA 3AUOA 1BPXA 1ECWA 4DFJA 4MEYA 1J97A 4C8LA 4C8NA 1NOMA 4M0AA 2AQ4A 3MGVA 1RPLA 2AQ0A 2GH1A 3A0BU 3JPTA 1BNPA 3RH6A 5D46A 3BQ7A 2ZTCA 2LYBA 5C5JA 2YY6A 4J9OA 5ALMA 2QB0A 2K4IA 2PFNA 3GDXA 1ZQKA 1SV0C 1DGSA 4Q44A 5E79U 3TAPA 1N2XA 4RQ7A 3U26A 1QQ7A 3QEBZ 9ICLA 1PZNA 1ZQIA 3B0XA 4ECTA 9ICOA 3V7KA 2KJ8A 3H40A 4Y2QA 4DSJA 4IRCA 4UB6U 4YXJA 2BPGA 5L1KA 1QCKA 8ICTA 4QWAA 3BQ0A 1Q46A 3QZ7A 1B22A 1JUDA 4EBCA 2DKZA 2E1EA 2F1JA 5ALUA 1SKRA 2E8PA 5IIIA 3AU2A 1X9WA 1N62A 3UXNA 1QSLA 5KFVA 3AU6A 2W9AA 4NLZA 2Q4TA 2MU2A 2XY5A 3M8RA 4BDPA 4DS4A 3NRWA 2VA2A 4OCZA 1U47A 8ICUA 1QQ5A 5AKGA 3GV5B 2PMZF 3QUBA 4ECRA 2UVRA 3SI8A 3RRGA 8ICJA 1Q8KA 2JRZA 3H4DA 4UAZA 1ZQQA 2BCQA 1B43A 3NUQA 1O08A 5ALLA 2ISOA 3SV3A 3M9NB 5KFBA 9ICCA 3WKCA 3T5LA 3I1YA 3Q8SB 4YR3A 4C8OA 1D9DA 4OJ5A 4DQPA 1AROP 1WCNA 4DFKA 4R65A 2HW3A 1JXEA 4BUGA 4F5RA 4LZGA 2W55A 5KFCA 2OXOA 3MR5A 3LK9A 4DOAA 1JI7A 1X42A 4PZNA 1NJWA 3BS5B 4B6JA 2C2RA 4CDGA 1S0NA 1D8BA 3M6KA 4ED8A 3GIJA 3CP8A 3O0FA 1C20A 4EYIB 2WB1F 2KVSA 4NL9A 5DDMA 2QKQA 5AKJA 3F2CA 5AKXA 4QZ8A 4PL2A 3PX4A 4QIWF 7ICHA 2W43A 5KT3A 1SL2A 3N97B 1NKEA 3ZDCA 5KFJA 2PMZC 3H0RB 1DXSA 3QU2A 2F8LA 2EAMA 1BVSA 3N4MB 2VJ5A 1Q3VA 4RU9A 2JMGA 5AHXA 3FDSA 2ZIWB 2KZMA 2MA1A 5D49A 4O9MA 4OJLA 5ALTA 2LM4A 3RH5A 5GTIU 3QNMA 2F1HA 2PI4A 2C28A 5KG4A 7ICTA 2ZXHA 4IQWA 1CEZA 2PFPA 2H3FA 3TKAA 1XO0A 3SQIA 9ICFA 2XCPA 3KKAA 4QW8A 2OH2A 3RJGA 2ZJ5A 2OM6A 7ICOA 9ICGA 2BCUA 1KW4A 3VC8A 5EE0A 3A0HU 3OJSA 4XQ8A 2BCRA 1XSLA 4M9HA 1ZJNA 2CRXA 3ZI4A 4Y2SA 3ZDAA 9ICAA 3ZDBA 4F4ZA 2G5HB 5HMMA 3AQFA 4KLLA 2HBJA 1NZBA 2CXYA 3HWTA 3EZ5A 2A3VA 2UVUA 2ZTDA 2LBOA 3SEIA 3PMLA 2WB1C 1DK3A 2FLNA 3ZDDA 4Z6DA 2ES6A 2IA6A 1T4GA 2FMQA 4RQ3A 4QIWC 2K8BB 1TK0A 3DEEA 2QARB 8ICAA 1XU4A 5DB9A 1JALA 3PSIA 1N63A 1XO1A 3BS7A 4UW9A 2G09A 2R8JA 4G3IA 1FFVA 3G6VA 1ZQTA 3BQ1A 1SKWA 4KLOA 3H8SA 3C2LA 3NS1A 1ED1A 4RT3A 4LJXA 5J0YA 2P66A 3WK6A 2D6FC 4C8MA 2YX8A 4RNOA 2ASLA 4PGYA 4RPYA 1WG8A 5AK4A 1ZQJA 5KL1B 3PNCA 4DFDA 3DV9A 5CHGA 3NVZA 3NASA 4HYKA 2I1QA 1YZ7A 5CP2A 4I27A 5ALNA 1XWLA 4B9VA 5ALZA 4IL6U 5J2AA 3PVXA 4C8KA 1L3UA 2CN1A 1OW5A 8ICMA 4QZGA 4ED7A 5KFIA 4BWMA 2E3TA 3BDPA 3HX0A 5AI0A 4NLKA 2J6UA 2XY7A 8ICWA 4J9SA 7ICUA 4DO9A 3RJHA 2P6UA 5L1MA 1SWWA 2LYHA 4KLTA 1CUKA 5KT2A 2WF8A 1SKSA 2DGZA 3OSNA 1HIWA 3IG8A 2PFQA 3AMZA 2EH9A 2BGWA 4P0QA 4Y2UA 5H2FU 4NLBA 4CF4A 3HJEA 4KMUA 2GOLA 4NWIA 1COOA 2YB4A 2RDIA 5KL8B 9ICQA 2QB1A 3M9MB 2AJQA 2O6KA 5D4BA 1ZQCA 3GILA 5J0WA 1LB2B 1Q3UA 5FP0A 2KJ9A 1J2NA 3HW8A 1KL9A 2XY6A 3E58A 3LWLA 2W9CA 3QZ8A 2XICA 4DSFA 3IM1A 5DBAA 2R8GA 2ZUCA 3LYSA 5AICA 3EPGA 8ICIA 4B9SA 3MFIA 4UASA 3GQCA 1NKBA 8ICBA 4UB2A 5ALEA 1DOQA 2EQYA 2G08A 2JEJA 1S8OA 3RBDA 9ICSA 3OHAA 2B0CA 5AI5A 4DOBA 5KG1A 2YTUA 3AEVA 2W7OA 3HP6A 4FS2A 4JV1A 2EZYA 8ICQA 1XC9A 8ICEA 3NGDA 2N1RA 3MGIA 3IRUA 2F3NA 3JPRA 2C2EA 2ZIUA 3F53A 3EPIA 3SZ2A 4CRXA 3MR6A 3V6HA 1T7PA 1UQVA 1MA7A 1ZQBA 4RQ8A 1WUDA 4Q45A 3FC4A 3E2EA 4J9QA 4J9NA 2ASDA 4CE6A 4ED6A 5DKWA 4WJ3B 1JX4A 4XUSA 1N61A 4R63A 3Q8QB 4JK1A 2FE9A 2W03A 4M9GA 3MDCA 1X6IA 4Y2YA 4RNMA 3T5HA 2K4PA 1A6SA 3N7SC 5KG5A 1VLBA 4YXMA 2RP5A 4USAA 2F77X 3GIIA 8ICYA 3KHRA 1URJA 3UQ0A 1MSWD 3LWMA 5KG6A 4TUSA 1B4FA 2FLPA 5KFYA 1RZTA 2KG5A 1RDFA 7ICNA 4A8EA 1S77D 4Q8EA 4YMOA 2LI6A 3Q8KA 4RQ4A 4KLSA 1A76A 2RLTA 2ZJ8A 3D6JA 2E5SA 5J2KA 1TV9A 4UB3A 2KHQA 1UT8A 2R8IA 4IQUA 4JB3A 4QJFB 5F3XB 3RJFA 3L3FX 1RYRA 5KAIU 1S0OA 3V7JA 3PSFA 1PVPA 4DWIA 2C22A 3HT3A 1BPBA 2H3ZA 4TUQA 5DG9A 4NLGA 3RJEA 1ZRNA 9ICMA 3FM9A 5HNKA 4J9KA 4F5OA 1OUQA 4EELA 2BCVA 1TK8A 4OD0A 4F5NA 1ZOLA 3PMNA 2HHXA 4NL9C 3SD7A 5KG3A 2VA3A 5T14A 2WF5A 2FI1A 2HHUA 2Y9TA 4FZNA 1BNOA 2NRXA 3F2BA 1D8LA 3N28A 4JWNA 2HVIA 4I2HA 3MBYA 9ICWA 1TK5A 1ZQXA 1ZQMA 2VIXA 5KFLA 2KMDA 5HHHA 2BQ3A 1RYUA 2HOIA 2K4EA 4DL5A 5AK6A 3KFUF 4IRKA 1L7OA 5J29A 2DUYA 4IR1A 2KZZA 5L9XA 2LKYA 4ED0A 5J0UA 4P4OA 1PK3A 2HHWA 2I6XA 1QSYA 1UHUA 4KLEA 5ALRA 1ZQAA 2W54A 4P0QB 5DGAA 2GWSA 2Y0SF 5KG2A 3BQ2A 8ICZA 3H0LB 1NJYA 4GFJA 2K89A 4NM2A 4CF5A 2CPRA 2LHTA 9ICJA 1S5LU 3F5AA 1ZQFA 4RPXA 4O5CA 2ZXIA 4P4MA 1JIHA 2GLEA 4PGXA 4KLDA 1ZQVA 1A0PA 4RUCA 3TAQA 3K75D 1UPHA 4O3OA 1LVHA 2ZUBA 5EOZA 4RUAA 4BJQA 4O3SA 2EDUA 1L3SA 5AKIA 2F8KA 2KD1A 2IHMA 2ZTEA 5KFPA 4OJPA 2W9CB 2W9BB 2ZG6A 5AM3A 3JPOA 4GXIA 4X5VA 2HBMA 1NJXA 5J0PA 2MAXA 2ISPA
chains in the Genus database with same CATH topology
2HBJA 1HIWA 1YT3A 3IG8A 2E1FA 2VKQA 4FZNA 4BUGA 1NZBA 2ZIWA 4KX3A 2M0NA 2KV2A 3GU3A 4FZLA 1ZQ1C 2XIDA 1P7DA 4P0QA 3AQEA 3F2BA 2K4IA 4KMOB 1SZHA 2A3VA 2LYAA 4PL1A 4WJ3B 2LBOA 2KEYA 4ICAA 2WB1C 2OXOA 2DF4B 2XVTA 4P0PB 3ICXA 1HEKA 4NLBA 2KOBA 3IN5A 1F44A 2VIXA 4AYBC 3HKZC 2W03A 3C28A 1L6NA 3PZPA 3PSPA 3SMVA 3LVWA 3SAGA 2F76X 3D2SA 4CGZA 1PVQA 2GOLA 4CDGA 4QIWC 2G5IB 2K8BB 1TAMA 2KKPA 2HOQA 2KJ8A 3DEEA 3M6KA 4NWIA 2HOIA 2K4EA 1T94A 2YB4A 1D8BA 5KL8B 2G07A 3CP8A 3IG5A 3N7RC 3O0FA 1PVRA 3N7SC 1A6SA 4O3MA 4OJOA 3KFUF 3T79A 2KICA 3CYMA 4QNLA 3PSIA 3AL0B 2JHDA 2RP5A 2WB1F 3IP4B 2F77X 2G06A 1Z19A 3SAFA 1Q3UA 1IIPA 2G09A 1Z1BA 2NV3A 2ZIXB 3K1ZA 1URJA 2KJ9A 5HR6A 4AYBF 2E1EA 3HKZF 3F2CA 5C0YA 2RRDA 1CRXA 4FZMA 4PL2A 3GZFA 4U6PA 2XICA 2LKYA 2K8AA 2ZIUB 3OPXA 4QIWF 4U7CA 2JGAA 3ALRA 2WAQC 2G0AA 2KVCA 3LYSA 4NLCA 3SAHA 2PMZC 3PSTA 3F5EA 5HR7A 2Y0SC 2YB1A 2F2AB 2H3VA 1ED1A 3H0RB 4A8EA 2MRLA 2Q4TA 2F8LA 2KNJA 3M7DA 2D6FC 2YX8A 2VJ5A 2ZIVB 5A0LA 1XNSA 1Q3VA 2JMGA 3CRXA 4ACOA 3M6ZA 3NRWA 4FE3A 2ZIWB 2E5SA 3N7PD 5KL1B 2MA1A 4P0QB 1GO3F 2WAQF 4OJLA 2G08A 2KJ5A 4IC9A 2PMZF 3H0MB 2KHQA 2KHVA 2Y0SF 2RHFA 3H0LB 2Z7JA 3E0FA 4GFJA 4QJFB 2K89A 2H3QA 2ZXHA 3L3FX 2CPRA 2LHTA 3RFAA 3C29A 2W7OA 4BX9C 3F5AA 3PSFA 2H3FA 4KX5A 1PVPA 3D2QA 1XO0A 2DQNB 3SQIA 2ZXIA 2HMXA 2CN1A 2HBLA 1ECWA 4NV0A 2OH2A 3RF9A 2H3IA 5CRXA 2OM6A 2H3ZA 1A0PA 2ZIXA 3NUQA 4JMUA 2JH7A 1UPHA 2N1RA 2JH1A 3D2NA 2VJ4A 3VC8A 4P0PA 2ZIUA 2R18A 3F53A 4BJQA 1OUQA 2BDUA 3MGVA 2OYYA 2KKVA 4C0ZA 2K4HA 2KD1A 2GH1A 3VCBA 1DRGA 2W04A 4OO1J 4OJPA 2CRXA 4CRXA 2HOFA 2K8CB 2ZG6A 3ONNA 2HBKA 4OJ5A 2XI9A 2W7PA 1MA7A 2HBMA 2KIWA 3F2DA 4OJ6A 5T14A 1WUDA 2G5HB 3KZXA 3LVVA 2DGZA 1KBUA 2LYBA 2ZIVA 3AQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HIW A;  2H3I A;  2H3Z A;  2JMG A;  4JMU A;  1UPH A;  2K4I A;  2NV3 A;  2N1R A;  2LYA A;  4ICA A;  4IC9 A;  2K4H A;  1HEK A;  1L6N A;  2H3Q A;  2GOL A;  1TAM A;  2H3V A;  1ED1 A;  2H3F A;  2K4E A;  1A6S A;  2LYB A;  2HMX A;  1ECW A; 
#chains in the Genus database with same CATH topology
 1YT3 A;  5AI4 A;  2XGP A;  3IHQ B;  5AKE A;  4ELU A;  8ICR A;  2JR5 A;  2LYA A;  2JZB A;  1NNL A;  5B5E U;  2JXJ A;  3RAX A;  4UB4 A;  3ICX A;  3UMG A;  3FYH A;  1KQQ A;  4PHD A;  2YMQ A;  9ICB A;  5KFU A;  3KHL A;  2PFO A;  4I2J A;  3PZP A;  8ICX A;  1X9S A;  1PVQ A;  1NK4 A;  4G9B A;  4MFC A;  4M2Y A;  1T94 A;  4UAV A;  5AI9 A;  3IG5 A;  1PVR A;  4DS5 A;  3ISB A;  3PX6 A;  2WFA A;  5F9L A;  4DL3 A;  5AK3 A;  4YD1 A;  2RDJ A;  3C1Y A;  3C23 A;  5DB8 A;  1AQ6 A;  2ZIU B;  3EWA A;  2FPL A;  2KZ3 A;  2BPF A;  3SAH A;  3RRH A;  5ALI A;  3F5E A;  2Y0S C;  4FO6 A;  4EZ9 A;  1XSN A;  5KFW A;  3C1Z A;  5AKL A;  2BKE A;  1IV8 A;  5AI8 A;  1JXL A;  4DL6 A;  2KP7 A;  8ICL A;  3LDA A;  2HI0 A;  1QH9 A;  2WAQ F;  3KTQ A;  4KLG A;  5J8Y A;  2DBY A;  3KOO A;  2D8C A;  2W11 A;  2Z7J A;  3E0F A;  3THV A;  1V9P A;  4EEK A;  1L8O A;  1S10 A;  4KX5 A;  5HP4 A;  1FEZ A;  2DQN B;  1V97 A;  1RXW A;  1N60 A;  8ICF A;  3T3F A;  4ZOH C;  3I28 A;  3TAD C;  3M8S A;  1N56 A;  9ICN A;  4EX6 A;  4UB5 A;  1ZQU A;  1U45 A;  2V9W A;  2R18 A;  2K4H A;  3T5J A;  1TKD A;  5DB6 A;  2V4Q A;  2MUT A;  4IRD A;  5CA7 A;  3F2D A;  5AKH A;  3KZX A;  2ZJA A;  3WU2 U;  5ALQ A;  2E1F A;  1WCL A;  4O3R A;  3GU3 A;  3RAQ A;  2P6R A;  1SGG A;  4Y2P A;  2IMW P;  3B0Y A;  4F4W A;  5JRT A;  1QQ6 A;  3IN5 A;  1JRP A;  2DPI A;  4QZC A;  3SMV A;  3TFR A;  2WTF A;  5J2F A;  1JMS A;  4RPZ A;  4GXK A;  2HHV A;  4Z6F A;  1K1S A;  3EUB 2;  1U4B A;  3WKD A;  4MFF A;  5DDY A;  3QU7 A;  4YCX A;  2W8K A;  3RTV A;  2RRD A;  1MQ2 A;  3TFS A;  3TAR A;  5J2G A;  2WAQ C;  3K1R B;  1KTQ A;  2BPC A;  3C5F A;  5EWG A;  2KIV A;  4CNQ A;  8ICH A;  4NXZ A;  3KD3 A;  1ZYQ A;  3M7D A;  2W3S A;  4B9M A;  4DSI A;  7ICK A;  2UVW A;  4O3P A;  4GLX A;  3PW0 A;  4B9U A;  3PO4 A;  1GO3 F;  3PX0 A;  4RT2 A;  4IC9 A;  8ICP A;  3H4B A;  2HCF A;  3T5K A;  4ECS A;  4AP9 A;  4MEX A;  4KLI A;  3RFA A;  5DG7 A;  4FFD A;  3IDW A;  2Q0Z X;  2LMR A;  2AHO B;  2AU0 A;  5CRX A;  2Y9U A;  1IM4 A;  4O5E A;  1COK A;  2YMP A;  3QU4 A;  5BOM A;  2NRT A;  5IIM A;  4QZI A;  4I2B A;  3LVV A;  2E8M A;  5KFN A;  4I2A A;  1KN5 A;  3RJK A;  3J81 j;  3QU9 A;  4UAT A;  1U9L A;  4I2D A;  3KBB A;  1TVA A;  5HHI A;  1PK1 A;  1X40 A;  3JPS A;  3C28 A;  5KG0 A;  3MR3 A;  9ICT A;  2RQ5 A;  4RQ6 A;  5KFA A;  1MC8 A;  1N5W A;  1SB3 C;  4F72 A;  4OJO A;  3T79 A;  2FMP A;  3CYM A;  4BGD A;  1IIP A;  5HR6 A;  4AYB F;  3BQT A;  4ED2 A;  3UM9 A;  3WK4 A;  5ALS A;  1SXE A;  3MAB A;  4NLC A;  5J0X A;  7ICM A;  4GXJ A;  3I76 A;  5ALD A;  2W3R A;  5A0L A;  4UBB A;  1KFD A;  1D8Y A;  1SV4 A;  8ICS A;  2JZB B;  7ICJ A;  2W9B A;  2RHF A;  2JEI A;  4Y2J A;  2HDO A;  5KFX A;  4QZA A;  3DDH A;  1ZQN A;  3RB6 A;  4PPX A;  2WF6 A;  1TAU A;  3RF9 A;  3PR4 A;  4JMU A;  2JH1 A;  2ODG A;  3D2N A;  4DCC A;  5K4L A;  4UB8 U;  2OYY A;  1SL1 A;  5G5H A;  4OO1 J;  4K4H A;  4F50 A;  1WWV A;  2EZX A;  2KTQ A;  2HVH A;  7ICS A;  4IR9 A;  4QWD A;  3C5G A;  5J2H A;  1NK5 A;  9ICV A;  5F9N A;  5ALW A;  2KV2 A;  4FZL A;  3ORY A;  5KFG A;  5KG7 A;  1SZH A;  2AGQ A;  3UQ2 A;  1ZD3 A;  4IQV A;  4CCH A;  1TE2 A;  1XS9 D;  5KTQ A;  4AYB C;  2BQR A;  1ZJM A;  3CW2 C;  1ZQY A;  5DB7 A;  5KT7 A;  2KKP A;  5TIS U;  3N7R C;  4DQQ A;  4QW9 A;  4TQS A;  1FFU A;  5EE1 A;  2NRZ A;  2DFL A;  5CR0 A;  4I2F A;  4M9J A;  3HKZ F;  5AKK A;  4TUP A;  4BXO A;  2GO7 A;  3C2K A;  2J6T A;  2K8A A;  3HPO A;  4EBD A;  3EYZ A;  2BQU A;  4B9L A;  5CB1 A;  4GC7 A;  3PST A;  2XC9 A;  4F93 B;  5J2I A;  4KTQ A;  2MUT B;  5KFO A;  5KFE A;  4US9 A;  4Z6E A;  2A1A A;  3SV4 A;  4DSK A;  4MHV A;  4M04 A;  4R8U B;  4C4T A;  4B9N A;  4QWB A;  4DQI A;  1FO4 A;  1Z00 B;  1V85 A;  1C7Y A;  2JV3 A;  4YVZ A;  2DPJ A;  4DQR A;  3C29 A;  4C4S A;  4Y2X A;  1X6J A;  1T3N A;  4DSL A;  2HBL A;  4DF4 A;  2PXI A;  2I5H A;  4US8 A;  2B6G A;  1X2I A;  4F91 B;  4ECV A;  8ICK A;  4PHP A;  5AM0 A;  4ECW A;  3Q8M A;  2DWQ A;  4PHA A;  2BZF A;  4XA5 A;  5J2D A;  1X66 A;  4F8R A;  1HJP A;  3ONN A;  5J0Q A;  5JU5 A;  5ALG A;  4J9M A;  4KN7 A;  2XI9 A;  4KN4 A;  4LZD A;  3MGH A;  1SL0 A;  3L4P A;  1L3V A;  1KSP A;  3KHH A;  1SZP A;  1KEJ A;  1RG6 A;  5EE9 A;  1L7P A;  1BPZ A;  1BPY A;  2A19 A;  2XCA A;  4KMO B;  3C21 A;  2AH5 A;  3IV6 A;  1O03 A;  2EAP A;  3PW5 A;  4HAI A;  1F44 A;  1ZQD A;  3HKZ C;  1L6N A;  4YMN A;  1UA1 A;  3AM9 A;  4JV0 A;  4YD2 A;  4EEN A;  4O3M A;  3RBE A;  4LVS A;  1M6Y A;  5J8Y C;  3BZK A;  2HHQ A;  3SEN A;  3UXP A;  1VJ5 A;  4O5K A;  4FZM A;  1N48 A;  4KLM A;  4KLQ A;  3KZI U;  2JGA A;  4UAU A;  5KAF U;  3MC1 A;  2YB1 A;  4RNN A;  1Y88 A;  5KFS A;  3RB4 A;  4DLE A;  3JPP A;  5ALJ A;  2KNJ A;  3MR2 A;  1JN3 A;  2IOF K;  4QZH A;  1NI3 A;  1KFS A;  4F71 A;  4K4G A;  2KHV A;  4JUZ A;  5DLF A;  4QZE A;  3KKA C;  2P35 A;  1PK1 B;  2BCS A;  5CEH A;  1NK8 A;  2L5Y A;  5DQH A;  4DFM A;  3Q8P B;  1KFT A;  3ZDE A;  4RQM A;  4YMM A;  3H8M A;  2NRW A;  1RYS A;  2JH7 A;  1L7N A;  3PW4 A;  1IXR A;  2F1I A;  1XSP A;  3G6Y A;  3QXG A;  2PI5 A;  1NKC A;  1TFR A;  4OJ6 A;  5AK5 A;  2FDR A;  5HML A;  4EX7 A;  2VKQ A;  4DF8 A;  8ICV A;  4E0D A;  3AQE A;  4O3N A;  1NJZ A;  3FAH A;  3ISC A;  4NM1 A;  8ICC A;  2IOH A;  2KEY A;  4ICA A;  3OHB A;  9ICI A;  2YQE A;  4MFA A;  2KK0 A;  3PSP A;  4TQR A;  4QZ9 A;  3D2S A;  1HUO A;  2G5I B;  4IS7 A;  1U49 A;  1ZQS A;  2E8N A;  1ZRM A;  3PO5 A;  3ZD8 A;  4RZR A;  2JHD A;  4ECU A;  3IP4 B;  4QZD A;  3QYP A;  1KDH A;  1F5S A;  5ALO A;  1TAQ A;  1VDV A;  2FMS A;  1BPD A;  3GZF A;  5EE3 A;  5KFR A;  3NTU A;  5KFF A;  3WKE A;  4I2E A;  1ZET A;  5J2E A;  5KNI A;  3MDA A;  2F2A B;  4ECX A;  1HUZ A;  3H7I A;  1RQL A;  5L1L A;  2VAN A;  2FLL A;  5KT6 A;  2V4R A;  3OTQ A;  5KFT A;  5JUM A;  4C4R A;  2ESE A;  3OGU A;  1J2M A;  4FBU A;  4Y2V A;  5L1J A;  1CI4 A;  2R8K A;  2KJ5 A;  3WK7 A;  4UB1 A;  1K5O A;  2NRV A;  4UAR A;  5AM4 A;  4YR2 A;  4CF3 A;  2KSO A;  3D2Q A;  4J9R A;  3RR7 A;  4PGQ A;  2HMX A;  3RJJ A;  1UA0 A;  2PKE A;  2E8O A;  3ISD A;  2ZIX A;  2AGO A;  5ALX A;  4NJ8 A;  4F4X A;  5ALH A;  5KFQ A;  1MQ3 A;  7ICG A;  4C0Z A;  3JPQ A;  2WHE A;  4BXO B;  3R9K A;  2W04 A;  3M1Y A;  4RQ2 A;  3Q8L A;  3GIM A;  5J0R A;  2IOF A;  8ICN A;  5KFH A;  2W7P A;  3QUQ A;  1H38 A;  2A1J B;  3AN1 A;  4F3O A;  4KLU A;  4I28 A;  2OWO A;  2XGQ A;  1SWV A;  4P0P B;  1HEK A;  1OXJ A;  2NO5 A;  4UQG A;  4NY8 A;  1NK6 A;  3RJI A;  2IBK A;  3TAN A;  5J0O A;  3LVW A;  4XRH A;  1UT5 A;  4YP3 A;  5J2C A;  4UBC A;  1QLN A;  2YML A;  1S0V A;  2FPM A;  4UAW A;  3PR5 B;  4R8U A;  2MSN A;  2OEH A;  3UPQ A;  1Z19 A;  3SAF A;  4KLF A;  7ICV A;  4M6W B;  5DBB A;  3PW2 A;  4KLJ A;  5C0Y A;  1Z00 A;  1N5X A;  1B0X A;  4QWC A;  3TI0 A;  1T8E A;  1ZXI A;  1SV0 A;  3PY8 A;  2D3D A;  1RM6 C;  2H3V A;  5IIN A;  3WK9 A;  2OHF A;  1KLN A;  2BDP A;  5ALY A;  1KRP A;  3N7P D;  9ICH A;  3NRZ A;  3GIK A;  4PH5 A;  4BWJ A;  3H0M B;  5DQG A;  2VA8 A;  3H8J A;  2QLT A;  4M9L A;  1QSS A;  2K60 A;  4NV0 A;  2H3I A;  4FBT A;  2DL0 A;  2M9N A;  1L5U A;  4YFK A;  5AM2 A;  3HIL A;  7ICQ A;  2LM1 A;  2LPE A;  1DRG A;  4KIT B;  2EAN A;  2YN4 A;  2BR0 A;  2HOF A;  4RQ1 A;  3SR6 A;  5EWE A;  4F5P A;  1S0M A;  2JEF A;  4DEZ A;  4ELV A;  4DQS A;  4ZH4 A;  4ED1 A;  4ELT A;  1ZQR A;  1PUZ A;  5G5G A;  3TQ1 A;  1KBU A;  2ZIV A;  3WKA A;  1NZP A;  1SIJ A;  4KX3 A;  4P4P A;  1LKY A;  2JEG A;  3PV8 A;  4DL4 A;  2DF4 B;  1NK9 A;  1T3Q A;  1LV5 A;  5L1I A;  2YMM A;  7ICP A;  4Z6C A;  9ICP A;  5KFZ A;  3SAG A;  5AKZ A;  4YN4 A;  1NK7 A;  2WF7 A;  1V38 A;  1TAM A;  2HOQ A;  2R8H A;  3K4G A;  4F2S A;  1X9M A;  5J0T A;  2KIC A;  3M9O B;  4QNL A;  1L8L A;  5CJ7 A;  1ZD4 A;  4ECQ A;  3NVW A;  4RQN A;  2NV3 A;  1UCV A;  1ZD5 A;  2QB0 B;  3ETL A;  3TAC B;  5J0S A;  4R66 A;  5ALF A;  4IQT A;  2Y1I A;  3L5K A;  4C80 A;  2IHN A;  4JWM A;  3KHG A;  4DLG A;  3V6J A;  1L3T A;  2G0A A;  2KVC A;  4C7Y A;  9ICU A;  3WK5 A;  4ED3 A;  4J9P A;  2J6S A;  3RB3 A;  4PHE A;  3CRX A;  4ACO A;  4TUR A;  4FE3 A;  2ALZ A;  1ZQH A;  1MN8 A;  3RH4 A;  7ICI A;  4JV2 A;  5KFD A;  1RXV A;  4RQ5 A;  5TZV A;  4QWE A;  4R64 A;  2H3Q A;  3UXO A;  5KFM A;  1Z1V A;  2F44 A;  1D9F A;  4P2H A;  1L7M A;  2AGP A;  3RB0 A;  1ZQW A;  4F4K A;  1KKX A;  5DBC A;  1QTM A;  2HSZ A;  1SXD A;  4EBE A;  1A77 A;  2EZZ A;  4I2G A;  4M9N A;  2VJ4 A;  4O3Q A;  3UMB A;  3TAD A;  2KKV A;  5KFK A;  3VCB A;  1RQN A;  4YR0 A;  4FS1 A;  4QZB A;  2C2D A;  2K8C B;  1NK0 A;  1U48 A;  3RR8 A;  5AI6 A;  2HBK A;  2KIW A;  8ICG A;  3OJU A;  2ZUD A;  3WKB A;  1EXN A;  3GV8 B;  2M0N A;  1ZQ1 C;  2XID A;  1P7D A;  2DKX A;  1S9F A;  1ZQO A;  5DG8 A;  2XVT A;  8ICO A;  1DK2 A;  3ED5 A;  2W8L A;  2KOB A;  2WF9 A;  1WYG A;  1DGJ A;  4Y2T A;  3MFH A;  5AIA A;  2F76 X;  4F4Y A;  4CGZ A;  4F5Q A;  2NYV A;  2HHS A;  1ZQZ A;  4DFP A;  5BOL A;  1ZD2 P;  1ZQE A;  5AM5 A;  4DL2 A;  2KSO B;  2OCE A;  5DGB A;  3AL0 B;  5IIJ A;  7ICE A;  2ASJ A;  1Z1B A;  4M47 A;  2ZIX B;  1Z3E B;  4DOC A;  3WK8 A;  4Q43 A;  1CRX A;  4DL7 A;  3QX7 A;  4U6P A;  2FPK A;  1S97 A;  3ZD9 A;  1YZ6 A;  1Z4O A;  5ALP A;  7ICL A;  4UAY A;  2BHN A;  1IG6 A;  2H5X A;  7ICF A;  1XNS A;  2W9M A;  3M6Z A;  3UMC A;  2HHT A;  2Y1J A;  3NVV A;  9ICK A;  5AM1 A;  3NVY A;  5GTH U;  2KFN A;  1Z4N A;  4MF8 A;  3BS5 A;  2I9G A;  3HRD D;  1BGX T;  4Q8F A;  3Q8R B;  5J2B A;  4BX9 C;  3ETR A;  4MF2 A;  5ALV A;  2A1J A;  2B21 A;  3C2M A;  4C7Z A;  1S76 D;  1ZQG A;  4GC6 A;  4I2I A;  4RQ0 A;  1WWU A;  4ECZ A;  4P0P A;  5J2J A;  2BDU A;  3CNH A;  3QU5 A;  5BPC A;  5CWR A;  2KE7 A;  2NO4 A;  3OSP A;  5AIB A;  2ZIW A;  9ICX A;  5B66 U;  4YQW A;  4M6W A;  4NLN A;  4PL1 A;  3S6J A;  3BZC A;  2AXT U;  4J03 A;  3EW9 A;  3GV7 B;  3G6X A;  4KLH A;  5IIO A;  5DLG A;  1K1Q A;  5IIL A;  2G07 A;  4DSE A;  1F0M A;  5ALK A;  3V6K A;  4F2R A;  3B9J A;  2KN7 A;  2UVV A;  4EYH B;  5JTI A;  3QUC A;  2G06 A;  1JRO A;  1ZQL A;  7ICR A;  3K1Z A;  4I29 A;  2FJ6 A;  5IIK A;  4U7C A;  5KT4 A;  3OPX A;  3V72 A;  5KT5 A;  4EEY A;  3ALR A;  4O0I A;  5AKY A;  4Y2R A;  4PJ0 U;  4F92 B;  5HR7 A;  5EWF A;  3QE9 Y;  2MRL A;  3QEA Z;  3QUT A;  3BJY A;  2KFZ A;  1ZQP A;  2ZIV B;  4J9L A;  3JPN A;  1LKY B;  2ATL A;  4ECY A;  3GFK B;  4I2C A;  9ICR A;  4EZ6 A;  4QZF A;  3SYZ A;  4GIB A;  3PW7 A;  1BPE A;  2XO7 A;  3V7L A;  4B9T A;  4K4I A;  2EAO A;  2QAR A;  1X9X A;  9ICE A;  3H8W A;  4YG2 A;  5DQI A;  4PZO A;  1FIQ A;  3AUO A;  1BPX A;  1ECW A;  4DFJ A;  4MEY A;  1J97 A;  4C8L A;  4C8N A;  1NOM A;  4M0A A;  2AQ4 A;  3MGV A;  1RPL A;  2AQ0 A;  2GH1 A;  3A0B U;  3JPT A;  1BNP A;  3RH6 A;  5D46 A;  3BQ7 A;  2ZTC A;  2LYB A;  5C5J A;  2YY6 A;  4J9O A;  5ALM A;  2QB0 A;  2K4I A;  2PFN A;  3GDX A;  1ZQK A;  1SV0 C;  1DGS A;  4Q44 A;  5E79 U;  3TAP A;  1N2X A;  4RQ7 A;  3U26 A;  1QQ7 A;  3QEB Z;  9ICL A;  1PZN A;  1ZQI A;  3B0X A;  4ECT A;  9ICO A;  3V7K A;  2KJ8 A;  3H40 A;  4Y2Q A;  4DSJ A;  4IRC A;  4UB6 U;  4YXJ A;  2BPG A;  5L1K A;  1QCK A;  8ICT A;  4QWA A;  3BQ0 A;  1Q46 A;  3QZ7 A;  1B22 A;  1JUD A;  4EBC A;  2DKZ A;  2E1E A;  2F1J A;  5ALU A;  1SKR A;  2E8P A;  5III A;  3AU2 A;  1X9W A;  1N62 A;  3UXN A;  1QSL A;  5KFV A;  3AU6 A;  2W9A A;  4NLZ A;  2Q4T A;  2MU2 A;  2XY5 A;  3M8R A;  4BDP A;  4DS4 A;  3NRW A;  2VA2 A;  4OCZ A;  1U47 A;  8ICU A;  1QQ5 A;  5AKG A;  3GV5 B;  2PMZ F;  3QUB A;  4ECR A;  2UVR A;  3SI8 A;  3RRG A;  8ICJ A;  1Q8K A;  2JRZ A;  3H4D A;  4UAZ A;  1ZQQ A;  2BCQ A;  1B43 A;  3NUQ A;  1O08 A;  5ALL A;  2ISO A;  3SV3 A;  3M9N B;  5KFB A;  9ICC A;  3WKC A;  3T5L A;  3I1Y A;  3Q8S B;  4YR3 A;  4C8O A;  1D9D A;  4OJ5 A;  4DQP A;  1ARO P;  1WCN A;  4DFK A;  4R65 A;  2HW3 A;  1JXE A;  4BUG A;  4F5R A;  4LZG A;  2W55 A;  5KFC A;  2OXO A;  3MR5 A;  3LK9 A;  4DOA A;  1JI7 A;  1X42 A;  4PZN A;  1NJW A;  3BS5 B;  4B6J A;  2C2R A;  4CDG A;  1S0N A;  1D8B A;  3M6K A;  4ED8 A;  3GIJ A;  3CP8 A;  3O0F A;  1C20 A;  4EYI B;  2WB1 F;  2KVS A;  4NL9 A;  5DDM A;  2QKQ A;  5AKJ A;  3F2C A;  5AKX A;  4QZ8 A;  4PL2 A;  3PX4 A;  4QIW F;  7ICH A;  2W43 A;  5KT3 A;  1SL2 A;  3N97 B;  1NKE A;  3ZDC A;  5KFJ A;  2PMZ C;  3H0R B;  1DXS A;  3QU2 A;  2F8L A;  2EAM A;  1BVS A;  3N4M B;  2VJ5 A;  1Q3V A;  4RU9 A;  2JMG A;  5AHX A;  3FDS A;  2ZIW B;  2KZM A;  2MA1 A;  5D49 A;  4O9M A;  4OJL A;  5ALT A;  2LM4 A;  3RH5 A;  5GTI U;  3QNM A;  2F1H A;  2PI4 A;  2C28 A;  5KG4 A;  7ICT A;  2ZXH A;  4IQW A;  1CEZ A;  2PFP A;  2H3F A;  3TKA A;  1XO0 A;  3SQI A;  9ICF A;  2XCP A;  3KKA A;  4QW8 A;  2OH2 A;  3RJG A;  2ZJ5 A;  2OM6 A;  7ICO A;  9ICG A;  2BCU A;  1KW4 A;  3VC8 A;  5EE0 A;  3A0H U;  3OJS A;  4XQ8 A;  2BCR A;  1XSL A;  4M9H A;  1ZJN A;  2CRX A;  3ZI4 A;  4Y2S A;  3ZDA A;  9ICA A;  3ZDB A;  4F4Z A;  2G5H B;  5HMM A;  3AQF A;  4KLL A;  2HBJ A;  1NZB A;  2CXY A;  3HWT A;  3EZ5 A;  2A3V A;  2UVU A;  2ZTD A;  2LBO A;  3SEI A;  3PML A;  2WB1 C;  1DK3 A;  2FLN A;  3ZDD A;  4Z6D A;  2ES6 A;  2IA6 A;  1T4G A;  2FMQ A;  4RQ3 A;  4QIW C;  2K8B B;  1TK0 A;  3DEE A;  2QAR B;  8ICA A;  1XU4 A;  5DB9 A;  1JAL A;  3PSI A;  1N63 A;  1XO1 A;  3BS7 A;  4UW9 A;  2G09 A;  2R8J A;  4G3I A;  1FFV A;  3G6V A;  1ZQT A;  3BQ1 A;  1SKW A;  4KLO A;  3H8S A;  3C2L A;  3NS1 A;  1ED1 A;  4RT3 A;  4LJX A;  5J0Y A;  2P66 A;  3WK6 A;  2D6F C;  4C8M A;  2YX8 A;  4RNO A;  2ASL A;  4PGY A;  4RPY A;  1WG8 A;  5AK4 A;  1ZQJ A;  5KL1 B;  3PNC A;  4DFD A;  3DV9 A;  5CHG A;  3NVZ A;  3NAS A;  4HYK A;  2I1Q A;  1YZ7 A;  5CP2 A;  4I27 A;  5ALN A;  1XWL A;  4B9V A;  5ALZ A;  4IL6 U;  5J2A A;  3PVX A;  4C8K A;  1L3U A;  2CN1 A;  1OW5 A;  8ICM A;  4QZG A;  4ED7 A;  5KFI A;  4BWM A;  2E3T A;  3BDP A;  3HX0 A;  5AI0 A;  4NLK A;  2J6U A;  2XY7 A;  8ICW A;  4J9S A;  7ICU A;  4DO9 A;  3RJH A;  2P6U A;  5L1M A;  1SWW A;  2LYH A;  4KLT A;  1CUK A;  5KT2 A;  2WF8 A;  1SKS A;  2DGZ A;  3OSN A;  1HIW A;  3IG8 A;  2PFQ A;  3AMZ A;  2EH9 A;  2BGW A;  4P0Q A;  4Y2U A;  5H2F U;  4NLB A;  4CF4 A;  3HJE A;  4KMU A;  2GOL A;  4NWI A;  1COO A;  2YB4 A;  2RDI A;  5KL8 B;  9ICQ A;  2QB1 A;  3M9M B;  2AJQ A;  2O6K A;  5D4B A;  1ZQC A;  3GIL A;  5J0W A;  1LB2 B;  1Q3U A;  5FP0 A;  2KJ9 A;  1J2N A;  3HW8 A;  1KL9 A;  2XY6 A;  3E58 A;  3LWL A;  2W9C A;  3QZ8 A;  2XIC A;  4DSF A;  3IM1 A;  5DBA A;  2R8G A;  2ZUC A;  3LYS A;  5AIC A;  3EPG A;  8ICI A;  4B9S A;  3MFI A;  4UAS A;  3GQC A;  1NKB A;  8ICB A;  4UB2 A;  5ALE A;  1DOQ A;  2EQY A;  2G08 A;  2JEJ A;  1S8O A;  3RBD A;  9ICS A;  3OHA A;  2B0C A;  5AI5 A;  4DOB A;  5KG1 A;  2YTU A;  3AEV A;  2W7O A;  3HP6 A;  4FS2 A;  4JV1 A;  2EZY A;  8ICQ A;  1XC9 A;  8ICE A;  3NGD A;  2N1R A;  3MGI A;  3IRU A;  2F3N A;  3JPR A;  2C2E A;  2ZIU A;  3F53 A;  3EPI A;  3SZ2 A;  4CRX A;  3MR6 A;  3V6H A;  1T7P A;  1UQV A;  1MA7 A;  1ZQB A;  4RQ8 A;  1WUD A;  4Q45 A;  3FC4 A;  3E2E A;  4J9Q A;  4J9N A;  2ASD A;  4CE6 A;  4ED6 A;  5DKW A;  4WJ3 B;  1JX4 A;  4XUS A;  1N61 A;  4R63 A;  3Q8Q B;  4JK1 A;  2FE9 A;  2W03 A;  4M9G A;  3MDC A;  1X6I A;  4Y2Y A;  4RNM A;  3T5H A;  2K4P A;  1A6S A;  3N7S C;  5KG5 A;  1VLB A;  4YXM A;  2RP5 A;  4USA A;  2F77 X;  3GII A;  8ICY A;  3KHR A;  1URJ A;  3UQ0 A;  1MSW D;  3LWM A;  5KG6 A;  4TUS A;  1B4F A;  2FLP A;  5KFY A;  1RZT A;  2KG5 A;  1RDF A;  7ICN A;  4A8E A;  1S77 D;  4Q8E A;  4YMO A;  2LI6 A;  3Q8K A;  4RQ4 A;  4KLS A;  1A76 A;  2RLT A;  2ZJ8 A;  3D6J A;  2E5S A;  5J2K A;  1TV9 A;  4UB3 A;  2KHQ A;  1UT8 A;  2R8I A;  4IQU A;  4JB3 A;  4QJF B;  5F3X B;  3RJF A;  3L3F X;  1RYR A;  5KAI U;  1S0O A;  3V7J A;  3PSF A;  1PVP A;  4DWI A;  2C22 A;  3HT3 A;  1BPB A;  2H3Z A;  4TUQ A;  5DG9 A;  4NLG A;  3RJE A;  1ZRN A;  9ICM A;  3FM9 A;  5HNK A;  4J9K A;  4F5O A;  1OUQ A;  4EEL A;  2BCV A;  1TK8 A;  4OD0 A;  4F5N A;  1ZOL A;  3PMN A;  2HHX A;  4NL9 C;  3SD7 A;  5KG3 A;  2VA3 A;  5T14 A;  2WF5 A;  2FI1 A;  2HHU A;  2Y9T A;  4FZN A;  1BNO A;  2NRX A;  3F2B A;  1D8L A;  3N28 A;  4JWN A;  2HVI A;  4I2H A;  3MBY A;  9ICW A;  1TK5 A;  1ZQX A;  1ZQM A;  2VIX A;  5KFL A;  2KMD A;  5HHH A;  2BQ3 A;  1RYU A;  2HOI A;  2K4E A;  4DL5 A;  5AK6 A;  3KFU F;  4IRK A;  1L7O A;  5J29 A;  2DUY A;  4IR1 A;  2KZZ A;  5L9X A;  2LKY A;  4ED0 A;  5J0U A;  4P4O A;  1PK3 A;  2HHW A;  2I6X A;  1QSY A;  1UHU A;  4KLE A;  5ALR A;  1ZQA A;  2W54 A;  4P0Q B;  5DGA A;  2GWS A;  2Y0S F;  5KG2 A;  3BQ2 A;  8ICZ A;  3H0L B;  1NJY A;  4GFJ A;  2K89 A;  4NM2 A;  4CF5 A;  2CPR A;  2LHT A;  9ICJ A;  1S5L U;  3F5A A;  1ZQF A;  4RPX A;  4O5C A;  2ZXI A;  4P4M A;  1JIH A;  2GLE A;  4PGX A;  4KLD A;  1ZQV A;  1A0P A;  4RUC A;  3TAQ A;  3K75 D;  1UPH A;  4O3O A;  1LVH A;  2ZUB A;  5EOZ A;  4RUA A;  4BJQ A;  4O3S A;  2EDU A;  1L3S A;  5AKI A;  2F8K A;  2KD1 A;  2IHM A;  2ZTE A;  5KFP A;  4OJP A;  2W9C B;  2W9B B;  2ZG6 A;  5AM3 A;  3JPO A;  4GXI A;  4X5V A;  2HBM A;  1NJX A;  5J0P A;  2MAX A;  2ISP A; 
#chains in the Genus database with same CATH homology
 2HBJ A;  1HIW A;  1YT3 A;  3IG8 A;  2E1F A;  2VKQ A;  4FZN A;  4BUG A;  1NZB A;  2ZIW A;  4KX3 A;  2M0N A;  2KV2 A;  3GU3 A;  4FZL A;  1ZQ1 C;  2XID A;  1P7D A;  4P0Q A;  3AQE A;  3F2B A;  2K4I A;  4KMO B;  1SZH A;  2A3V A;  2LYA A;  4PL1 A;  4WJ3 B;  2LBO A;  2KEY A;  4ICA A;  2WB1 C;  2OXO A;  2DF4 B;  2XVT A;  4P0P B;  3ICX A;  1HEK A;  4NLB A;  2KOB A;  3IN5 A;  1F44 A;  2VIX A;  4AYB C;  3HKZ C;  2W03 A;  3C28 A;  1L6N A;  3PZP A;  3PSP A;  3SMV A;  3LVW A;  3SAG A;  2F76 X;  3D2S A;  4CGZ A;  1PVQ A;  2GOL A;  4CDG A;  4QIW C;  2G5I B;  2K8B B;  1TAM A;  2KKP A;  2HOQ A;  2KJ8 A;  3DEE A;  3M6K A;  4NWI A;  2HOI A;  2K4E A;  1T94 A;  2YB4 A;  1D8B A;  5KL8 B;  2G07 A;  3CP8 A;  3IG5 A;  3N7R C;  3O0F A;  1PVR A;  3N7S C;  1A6S A;  4O3M A;  4OJO A;  3KFU F;  3T79 A;  2KIC A;  3CYM A;  4QNL A;  3PSI A;  3AL0 B;  2JHD A;  2RP5 A;  2WB1 F;  3IP4 B;  2F77 X;  2G06 A;  1Z19 A;  3SAF A;  1Q3U A;  1IIP A;  2G09 A;  1Z1B A;  2NV3 A;  2ZIX B;  3K1Z A;  1URJ A;  2KJ9 A;  5HR6 A;  4AYB F;  2E1E A;  3HKZ F;  3F2C A;  5C0Y A;  2RRD A;  1CRX A;  4FZM A;  4PL2 A;  3GZF A;  4U6P A;  2XIC A;  2LKY A;  2K8A A;  2ZIU B;  3OPX A;  4QIW F;  4U7C A;  2JGA A;  3ALR A;  2WAQ C;  2G0A A;  2KVC A;  3LYS A;  4NLC A;  3SAH A;  2PMZ C;  3PST A;  3F5E A;  5HR7 A;  2Y0S C;  2YB1 A;  2F2A B;  2H3V A;  1ED1 A;  3H0R B;  4A8E A;  2MRL A;  2Q4T A;  2F8L A;  2KNJ A;  3M7D A;  2D6F C;  2YX8 A;  2VJ5 A;  2ZIV B;  5A0L A;  1XNS A;  1Q3V A;  2JMG A;  3CRX A;  4ACO A;  3M6Z A;  3NRW A;  4FE3 A;  2ZIW B;  2E5S A;  3N7P D;  5KL1 B;  2MA1 A;  4P0Q B;  1GO3 F;  2WAQ F;  4OJL A;  2G08 A;  2KJ5 A;  4IC9 A;  2PMZ F;  3H0M B;  2KHQ A;  2KHV A;  2Y0S F;  2RHF A;  3H0L B;  2Z7J A;  3E0F A;  4GFJ A;  4QJF B;  2K89 A;  2H3Q A;  2ZXH A;  3L3F X;  2CPR A;  2LHT A;  3RFA A;  3C29 A;  2W7O A;  4BX9 C;  3F5A A;  3PSF A;  2H3F A;  4KX5 A;  1PVP A;  3D2Q A;  1XO0 A;  2DQN B;  3SQI A;  2ZXI A;  2HMX A;  2CN1 A;  2HBL A;  1ECW A;  4NV0 A;  2OH2 A;  3RF9 A;  2H3I A;  5CRX A;  2OM6 A;  2H3Z A;  1A0P A;  2ZIX A;  3NUQ A;  4JMU A;  2JH7 A;  1UPH A;  2N1R A;  2JH1 A;  3D2N A;  2VJ4 A;  3VC8 A;  4P0P A;  2ZIU A;  2R18 A;  3F53 A;  4BJQ A;  1OUQ A;  2BDU A;  3MGV A;  2OYY A;  2KKV A;  4C0Z A;  2K4H A;  2KD1 A;  2GH1 A;  3VCB A;  1DRG A;  2W04 A;  4OO1 J;  4OJP A;  2CRX A;  4CRX A;  2HOF A;  2K8C B;  2ZG6 A;  3ONN A;  2HBK A;  4OJ5 A;  2XI9 A;  2W7P A;  1MA7 A;  2HBM A;  2KIW A;  3F2D A;  4OJ6 A;  5T14 A;  1WUD A;  2G5H B;  3KZX A;  3LVV A;  2DGZ A;  1KBU A;  2LYB A;  2ZIV A;  3AQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...