2HMXA

Human immunodeficiency virus type 1 matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
133
Chain Sequence
HMGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the human immunodeficiency virus type 1 matrix protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Matrix protein
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 MATRIX PROTEIN
total genus 33
structure length 133
sequence length 133
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2hmxA00
2GOLA 1HIWA 2K4EA 2H3ZA 2LYBA 2H3IA 1TAMA 1HEKA 2N1RA 4JMUA 1ED1A 2LYAA 2JMGA 2K4HA 1A6SA 1L6NA 1UPHA 2HMXA 4ICAA 2K4IA 2H3FA 2H3QA 1ECWA 2H3VA 4IC9A 2NV3A
chains in the Genus database with same CATH superfamily
5KFEA 5ALPA 5F9NA 3L4PA 7ICPA 2HBLA 3K75D 3B9JA 7ICVA 1D8BA 3D6JA 3ZDDA 1VLBA 3HP6A 4M0AA 2KMDA 2OH2A 2KFNA 2D8CA 5J0WA 1MQ3A 3KHLA 4QWBA 4DOCA 3ZDAA 3QYPA 2E8MA 5AM1A 1IXRA 2I6XA 5DDYA 3GDXA 4GC6A 4LZGA 4DFDA 2HBMA 4IL6U 2DFLA 2R8GA 2ASDA 2BCSA 1KLNA 4EEYA 2YB4A 2Y1JA 3GU3A 3BQ0A 4PH5A 4UB6U 2DF4B 5C5JA 7ICQA 4ACOA 2VA3A 2PFPA 5ALVA 1ZQIA 2AQ0A 4Y2XA 3IG5A 3G6YA 2WFAA 3GZFA 4O3QA 1S8OA 4MEXA 2AH5A 1JXLA 3NVVA 4RNOA 5J2DA 4ECQA 5ALJA 5IIKA 4DF8A 1N61A 3T79A 5AM0A 2LI6A 1SL1A 2DWQA 1N2XA 2JH1A 3HPOA 5J0PA 5CA7A 3H7IA 3Q8SB 2HDOA 5EE0A 3F2BA 2P35A 3PW2A 2AU0A 2H3IA 2EZZA 5C0YA 4US9A 5HMLA 2FPMA 5JRTA 1ZQBA 4NLKA 5AK5A 4KLLA 3RFAA 3N28A 2CRXA 2ZXHA 2H3VA 3V7LA 1L7NA 4PL1A 1TFRA 3F5AA 4JUZA 3PMNA 3L3FX 3MGVA 4B9VA 3U26A 1DOQA 4PJ0U 3NS1A 2F44A 5AI9A 1SKRA 4ECTA 4QZDA 4I2JA 5J2BA 4UW9A 4ED7A 1BPXA 2IA6A 4P0QA 4DSJA 1XSNA 3SZ2A 4MF8A 4RQ7A 3IG8A 2FJ6A 5AIAA 4UB2A 2BPGA 1ZQ1C 3LVWA 1X66A 4UBBA 8ICQA 2KKVA 1RXVA 2QLTA 1Z19A 2KSOA 2VA2A 1A6SA 4KLQA 1ZQQA 5EOZA 3AU2A 3Q8KA 2WTFA 4B6JA 2KJ5A 3H8WA 1L3SA 1KW4A 1NNLA 2KZZA 4GXIA 3NGDA 4RNMA 4XA5A 2EZYA 3C2LA 1SL2A 4F3OA 3KKAA 4O9MA 1S0MA 3AUOA 1SGGA 3F2CA 3AEVA 2FLLA 4QJFB 4DQRA 1F0MA 9ICRA 2XO7A 1L7MA 3C21A 2H3FA 2AGOA 4DL2A 1AQ6A 4O3OA 1L5UA 2BKEA 2HHSA 2F76X 4EZ9A 2F2AB 5TZVA 4Y2TA 2WF6A 2PFQA 5KL1B 2QKQA 2W9AA 4DLGA 4RQ1A 1RYRA 1JXEA 1L3VA 4O3PA 2M0NA 5L1IA 4CF5A 2HOFA 4YVZA 5KG7A 5J2AA 1JROA 5J29A 3AU6A 7ICKA 4CCHA 9ICGA 1HUZA 3PO4A 1L8OA 4YMNA 2P66A 4F4WA 2B21A 2JRZA 2DKXA 1ZQWA 5CWRA 3FDSA 3WK9A 4R64A 1IM4A 2VJ5A 3OHBA 3WK8A 1U49A 4DFJA 2Y9UA 3DEEA 2IOFK 2YQEA 4QWAA 4TUPA 5ALDA 2K8AA 3QXGA 4UAZA 1ZQAA 9ICTA 5KFUA 4DL6A 5AKZA 2VKQA 1SXDA 3PNCA 4DFKA 4DCCA 3BS5B 1CI4A 7ICIA 7ICRA 1XNSA 2VIXA 2K8BB 3H8JA 3SENA 5J2IA 3F2DA 1U9LA 1WWUA 2NRTA 5AI4A 3A0BU 4F5OA 3E58A 2H5XA 1ZQOA 5J2JA 2ZIXB 5L1MA 4YD1A 1Q3UA 4K4HA 1JX4A 3GV7B 5J8YC 1WWVA 3N7PD 4US8A 1TAUA 4ELVA 7ICOA 3ONNA 5KFWA 5ALZA 4BDPA 4BX9C 5GTIU 1NJWA 3CP8A 1DGSA 3HRDD 5JU5A 2KOBA 1QCKA 4I2AA 3ETLA 4FZNA 4RUCA 3GILA 2ZTEA 3FYHA 3ZDEA 2J6TA 1ZD5A 1L6NA 4DL7A 1T3NA 3JPRA 3H8SA 2GLEA 3ZDCA 1NK8A 4ECYA 4YMOA 3BJYA 4CF4A 3UMCA 3LVVA 1J97A 3RJHA 2LYHA 2YY6A 2N1RA 5HR7A 5J2KA 4DF4A 4O5KA 1CRXA 2ES6A 3AQEA 4J9KA 5KFMA 8ICXA 2K4IA 2M9NA 1URJA 1NKCA 2UVUA 4PGXA 3RJGA 3MR6A 1PK1A 1YZ7A 3K1ZA 4O3NA 5ALKA 1TK8A 1YZ6A 1KN5A 8ICRA 5ALNA 3NVZA 3EWAA 3E2EA 5AKKA 1ZOLA 2KG5A 4CDGA 5DGAA 4DSIA 3M1YA 1S10A 1RM6C 2H3QA 3QU9A 4DFPA 2BDPA 2KHQA 4QW8A 2W9CA 1ZQYA 5AKLA 1SZHA 4KN7A 3TARA 9ICMA 3N7RC 4EEKA 3QUCA 1Z4OA 2JHDA 2ZJAA 4KLSA 3SV3A 3BQTA 4Y2SA 4M47A 7ICLA 4J9LA 4JV1A 3RH5A 1ZQHA 1KFSA 1C20A 2ZIWA 2WF7A 4F5QA 1H38A 2W3SA 3QZ7A 2KIVA 2JMGA 3UXNA 3EZ5A 1J2NA 4JV0A 1S97A 4OJ6A 1UA0A 5ALRA 5AKYA 1IIPA 4OJ5A 5CEHA 2FMPA 1XWLA 4R66A 3QNMA 4J9OA 2F1HA 2ZUBA 3WKBA 2EQYA 1DK2A 5AM3A 5KFYA 2O6KA 4PZNA 4J9RA 3C1ZA 1T8EA 2G06A 4F92B 4QZEA 3KBBA 3SAHA 3HJEA 4UAYA 8ICMA 3RJKA 3PSFA 3AL0B 5HHIA 4UQGA 5ALFA 4JWMA 2NRVA 5K4LA 3V7JA 5AKEA 1ZRMA 5J2FA 3OJSA 3OHAA 5AM4A 1ZQTA 2WHEA 4P4OA 2WAQF 8ICCA 3GV5B 3UPQA 1TAMA 2BQUA 4IQWA 4PL2A 8ICPA 4RPZA 1T94A 3D2SA 9ICVA 3QU7A 5ALYA 3UQ2A 4J9MA 4GFJA 2R18A 1ZQPA 3FM9A 1UQVA 1L3TA 3MFIA 3EPIA 4J03A 2ZJ5A 4UASA 4NLNA 1LV5A 4XUSA 5DQGA 2DL0A 2PXIA 3I28A 2WF8A 2FDRA 4PHPA 1WCLA 3N4MB 2F1JA 3Q8QB 4ED0A 3HKZC 4MFFA 2VANA 1KKXA 3QE9Y 4C7YA 2BPCA 1N62A 5AICA 3SYZA 4EX6A 3BQ7A 4WJ3B 4FZMA 9ICLA 4RUAA 4OO1J 5DB8A 3GFKB 3Q8MA 4QWDA 1XS9D 4Q45A 4Y2UA 1WCNA 4P0QB 1TK5A 3OGUA 1UT5A 3C5FA 4I27A 2JXJA 2ZIUA 2BPFA 1NOMA 2J6UA 4KLFA 2Y0SC 3KZIU 3PR4A 4M04A 1Q46A 2GO7A 4RQ6A 1X9SA 5CP2A 1KTQA 4G9BA 5KT5A 1PZNA 1LB2B 1TE2A 8ICJA 3PMLA 3N7SC 1TV9A 3HKZF 4NLCA 1V9PA 1Z3EB 3H40A 3TACB 4M9HA 2OCEA 2E3TA 7ICFA 1S9FA 1T4GA 1RPLA 3JPNA 4LZDA 3TFRA 1SWVA 4KLUA 2Y9TA 2ZTDA 2FLPA 9ICPA 3BQ1A 1S76D 3MFHA 3NVWA 1X2IA 4YR0A 3PW0A 1RQNA 1XO0A 4C8MA 4CGZA 2BCUA 4I2FA 2K4HA 4TQRA 2DGZA 3MC1A 4Y2VA 2MA1A 9ICAA 2HHUA 2E8NA 1XSLA 1ZQCA 2WAQC 1IV8A 1D9FA 1A76A 1HIWA 3KHHA 3RTVA 4K4GA 4NL9A 1ZXIA 3NRWA 3QUQA 3SR6A 5KFFA 1ZQJA 2KD1A 2UVRA 5EWEA 4ED6A 2BR0A 1DXSA 3C2MA 4O3RA 3RH4A 5ALXA 2QB0B 8ICYA 2YX8A 3SD7A 2MUTB 4IRKA 3T3FA 4BUGA 5L1JA 2FMQA 2JEJA 1JUDA 2H3ZA 4GIBA 2K4PA 4FBTA 3NVYA 4R65A 3LWMA 3OJUA 4P4PA 4A8EA 2HHVA 4KLOA 4F5NA 5DQHA 8ICGA 5IIIA 7ICJA 4EELA 4DFMA 1B0XA 2FI1A 5IINA 1CUKA 4F71A 3T5KA 2ISPA 1PVPA 2DBYA 8ICIA 3RB4A 4RQMA 4GXKA 3IM1A 4F5PA 2FE9A 5DG7A 2PMZF 4P4MA 3PX6A 4C8OA 2W8LA 2W9MA 2PI4A 4EYHB 3F53A 2LPEA 5KFGA 2F1IA 2PFOA 5F9LA 1RYUA 1NK0A 2EDUA 4F2SA 2EH9A 4Y2PA 5AM2A 1ECWA 2IHMA 3V72A 5J0SA 1TVAA 4JV2A 2BDUA 5KFHA 2F8LA 4ED1A 4OJLA 4CF3A 5JTIA 1UT8A 1COKA 2W43A 4I2CA 2A19A 2HBJA 3QZ8A 3PVXA 4EX7A 2JEFA 5IIOA 3WK6A 2I9GA 4KX5A 3HT3A 5KG6A 1UCVA 4PHDA 3TAQA 5DB7A 7ICSA 2ASJA 2XY7A 2ESEA 4F2RA 3ZD8A 5KTQA 5G5GA 5DB9A 2A1JB 2YTUA 4QZBA 5EE1A 2KVSA 3MDCA 4R8UB 1DGJA 2KK0A 4PGQA 5KFQA 2WF9A 4F4YA 1O03A 2RP5A 3WU2U 4DWIA 3PW7A 4OJPA 1GO3F 1PVQA 5AI5A 2G07A 4TQSA 2BGWA 3HW8A 5EWGA 2BHNA 2ZIVB 5J0OA 2QB0A 3TADA 5KFBA 4R63A 3ZI4A 5L1KA 2ZXIA 3WKEA 8ICBA 2K8CB 4MF2A 5AKHA 4CNQA 5AM5A 3WKAA 1FFUA 2Q4TA 4B9LA 4ECWA 5CB1A 2E1EA 4RZRA 1UA1A 1ZJNA 4JK1A 3SAFA 2C2RA 1ZQEA 3WKDA 2XY6A 3OTQA 1S5LU 5ALUA 2KN7A 3KHRA 2R8IA 5ALWA 2MAXA 5HP4A 2RDIA 1MN8A 4CE6A 3QEAZ 3QUBA 2NRWA 4UBCA 1LKYA 5DG9A 4DOBA 3RR7A 3KFUF 5KG4A 4Y2YA 2XICA 2EZXA 4YCXA 9ICQA 2JEIA 1N60A 4RT2A 3PZPA 3TAPA 2NV3A 1RZTA 4YXMA 2C2EA 3HWTA 4F4XA 5KFLA 2IOFA 4I28A 7ICNA 2V4QA 2KZ3A 1U47A 4BGDA 1B22A 3WKCA 4DS4A 2W8KA 4NV0A 2LKYA 2XCPA 4DL4A 4JWNA 4M9JA 1C7YA 4X5VA 2ZJ8A 5ALMA 2XI9A 7ICUA 1ZD3A 9ICCA 4IR9A 4KLTA 3H0LB 1JIHA 5AI6A 4GXJA 2D6FC 4YR2A 4RQNA 1Z00A 4BWJA 2W03A 5KFCA 5DLFA 3RJJA 5HMMA 4ZOHC 1S77D 1L7OA 4I2EA 4DSFA 2W54A 4R8UA 4KLEA 2RDJA 5AHXA 2K60A 5IIJA 4U6PA 1HJPA 1X42A 2DKZA 1ZQUA 4OJOA 2A1JA 8ICVA 3A0HU 1BPEA 2W04A 4C7ZA 4B9MA 1Q3VA 7ICMA 4G3IA 4O3SA 3H4DA 4YG2A 4ED3A 1OXJA 3RBEA 1QSSA 5H2FU 4ELUA 4B9SA 1WYGA 3MABA 3RR8A 7ICHA 4NY8A 2KVCA 4B9UA 2YMMA 2C2DA 4EYIB 2GH1A 3UXOA 3EW9A 3RB3A 4YQWA 4EBDA 5KL8B 4B9TA 3CNHA 5G5HA 2KE7A 1B43A 5ALHA 4F5RA 4Q43A 1AROP 2NYVA 2OXOA 5DGBA 7ICGA 5DBBA 9ICHA 2HOQA 2Z7JA 1BPYA 3T5LA 2W7OA 2XVTA 4IQUA 2F77X 1B4FA 1ZYQA 1M6YA 4KLJA 3RRGA 1PK3A 1VDVA 4EZ6A 4O5CA 1NK9A 1L8LA 1RYSA 2DQNB 4Q44A 1SKSA 1CEZA 4NLGA 3Q8LA 2QARA 5KAIU 3THVA 5DG8A 4IQTA 1NKEA 3UMBA 5E79U 5AI0A 3PR5B 4EBCA 4KTQA 4I2BA 2QARB 4RU9A 2JEGA 1LVHA 5D4BA 3HILA 4AYBC 3QU2A 1NJYA 1IG6A 2CXYA 2KEYA 2BZFA 4ECXA 1FO4A 2OWOA 1KL9A 4RPYA 3M8RA 2IBKA 5L1LA 1TAQA 5AI8A 1COOA 2YMLA 5KG5A 5J0XA 1BGXT 5KG0A 4M2YA 1X40A 3C5GA 2I1QA 1SV0C 3IP4B 1KEJA 8ICTA 2HSZA 1T7PA 1JALA 3QEBZ 8ICUA 5AK3A 3SI8A 4QNLA 3LDAA 4ECZA 1KSPA 1U45A 3PX0A 1T3QA 3NASA 5TISU 5HNKA 2ZG6A 3WK4A 2XGQA 5KG3A 1ZQNA 2E5SA 1UHUA 3WK5A 2PKEA 2YMQA 1ED1A 4RQ0A 5KFRA 2W9CB 4NM1A 2AQ4A 2ODGA 4UB3A 3N97B 1OUQA 3VCBA 3JPQA 3T5JA 3BS5A 1ZQKA 4YD2A 4Z6FA 1SV0A 3TANA 3KD3A 4MHVA 4M6WB 1SV4A 4NM2A 2ASLA 5CJ7A 5AK4A 1X9WA 3R9KA 5KG1A 4XRHA 3MGHA 2KFZA 8ICKA 3V6KA 1BNPA 2XIDA 1Z4NA 1BPBA 2HHTA 4QZAA 4KLGA 4YMMA 5F3XB 3C29A 2G5HB 1QLNA 4F93B 1V85A 2CN1A 4QZGA 3GQCA 2PMZC 2F8KA 2BCVA 4C80A 5KFDA 3T5HA 1N48A 4C8KA 4P0PA 1SKWA 5DDMA 3BDPA 1BVSA 3G6VA 4QZ8A 3RRHA 4Y2RA 1L3UA 4F50A 4DQQA 3KTQA 1LKYB 2OYYA 3H0RB 5HR6A 1Z1VA 5DQIA 4F4KA 3ED5A 2R8KA 1Q8KA 1ZRNA 2IMWP 4TUQA 1JN3A 1D8YA 4DEZA 8ICOA 1Y88A 2ZUDA 3LYSA 9ICXA 3M6KA 2LM1A 1KBUA 1N5XA 3EUB2 3EYZA 2KJ9A 4ECSA 2I5HA 2HMXA 2K89A 1D9DA 2ZIXA 2ISOA 3PSIA 1SZPA 2XC9A 3VC8A 2A3VA 1QSLA 4BWMA 2QB1A 3ISDA 2KP7A 2B0CA 2P6RA 4YN4A 4EBEA 1KRPA 2EAOA 5J0TA 3OSNA 1XO1A 3H8MA 4KN4A 4EENA 1ZQXA 1NK5A 3RB6A 4IS7A 5CRXA 4NWIA 2K4EA 4PGYA 4I2IA 2YB1A 5KFXA 4XQ8A 1S0NA 3RJIA 2HVHA 5IILA 3J81j 4YR3A 3TKAA 1ZQGA 3SQIA 3QU4A 3MGIA 1X9MA 4QZCA 4M9NA 4M6WA 3JPTA 1V38A 5J2HA 3RBDA 3IDWA 4IC9A 4ELTA 4PHAA 3TADC 1ZD2P 4ED2A 3PO5A 1SL0A 1ZQDA 3OSPA 4P2HA 2NRXA 2JR5A 4ECRA 2D3DA 1K5OA 5J2GA 2LYAA 2C22A 2UVWA 4O0IA 2RQ5A 8ICNA 1RDFA 2IHNA 2V9WA 1JRPA 2XGPA 2HHWA 4JB3A 5D49A 2Y1IA 2MSNA 4Y2JA 1JMSA 3LK9A 3AQFA 9ICFA 4UARA 2PI5A 4I2HA 3UM9A 4I2DA 5EE9A 4UB5A 3WK7A 3MR2A 5EE3A 1N63A 1X9XA 2E8OA 4KLMA 3F5EA 4RNNA 4DLEA 2JZBA 4YFKA 4FO6A 1ZD4A 1ZETA 3RJFA 1O08A 2KZMA 2ATLA 5AK6A 2LYBA 1SIJA 3M8SA 1QQ6A 4QWEA 3TQ1A 5KFVA 3PW5A 3ZDBA 3I76A 2EANA 2ZIUB 4DSLA 5KT6A 5IIMA 3PY8A 2ZIWB 4HYKA 3MDAA 3MBYA 4P0PB 4MEYA 4RQ4A 3SMVA 1KFDA 1QSYA 3NUQA 4KLDA 4ECVA 3PW4A 4RQ5A 3UMGA 4NLZA 4I2GA 9ICUA 4Y2QA 4RQ2A 4CRXA 2HCFA 2JV3A 4C4TA 3M9NB 8ICZA 7ICEA 3UQ0A 2RLTA 4QIWF 5CHGA 1ZQLA 3IV6A 5KT4A 4BJQA 3K1RB 3KHGA 2EAPA 3C2KA 4NLBA 2FPLA 2KJ8A 3ISBA 3BQ2A 1S0VA 4KX3A 4UATA 5DLGA 1NK6A 4UB1A 4E0DA 2WB1F 1X6JA 5ALGA 3M6ZA 1MQ2A 5J0QA 5KFAA 8ICSA 3BZCA 1NZPA 9ICWA 2E8PA 2F3NA 1KDHA 5KT2A 2HHQA 2G5IB 5ALLA 4LVSA 3V6HA 2C28A 1QQ5A 2G08A 4JMUA 4FE3A 4IQVA 2W11A 4UAWA 5KFSA 4GC7A 1SXEA 1OW5A 4TUSA 4C8LA 2CPRA 4NL9C 5J8YA 1XSPA 2HOIA 1YT3A 3LWLA 2DUYA 1ZQSA 3M9MB 2GOLA 1QH9A 5KFOA 1ZQRA 3SEIA 3ICXA 4J9SA 5L9XA 5A0LA 2FPKA 4DSKA 2JGAA 4Z6DA 3GIJA 8ICLA 5KNIA 5ALIA 5KFJA 2VA8A 4YXJA 1J2MA 1TK0A 3V7KA 3RB0A 4F72A 4Z6CA 1A77A 1RG6A 4PHEA 4DQPA 8ICAA 5ALSA 4ZH4A 1NJXA 3JPSA 4RPXA 5KFPA 2LBOA 3HX0A 3CYMA 5ALEA 2HW3A 2HHXA 2BCQA 4M9LA 3PX4A 4C4SA 1NZBA 4OD0A 4PPXA 4F91B 4QZIA 1BNOA 2LMRA 3Q8RB 1EXNA 1HEKA 1MSWD 5CR0A 4NXZA 1PUZA 5DB6A 2XCAA 2RHFA 1SWWA 4KMOB 9ICNA 3MR3A 3UXPA 2OM6A 3ZD9A 3SV4A 9ICBA 3FAHA 3GV8B 5JUMA 3JPOA 3OPXA 3IN5A 2FLNA 4DQSA 2AGPA 9ICKA 4DL5A 3GIKA 1VJ5A 4KLHA 3AMZA 8ICEA 2JZBB 3C1YA 3C23A 4FS2A 1F44A 3FC4A 4C8NA 4BXOB 1UPHA 4FS1A 1U48A 2ZUCA 5KT3A 3L5KA 3PSPA 4QWCA 3M9OB 5KFIA 1WUDA 3KZXA 4F8RA 1ZJMA 3KKAC 2KV2A 2MRLA 2OEHA 3B0YA 4IR1A 8ICWA 5KFZA 5AKGA 1S0OA 3CW2C 3D2QA 1NKBA 2Y0SF 7ICTA 4FZLA 4KITB 4Z6EA 3DV9A 2Q0ZX 9ICOA 1QTMA 4M9GA 1XU4A 5BOMA 2EAMA 3C28A 5DBAA 4DSEA 1RQLA 4IRCA 2AJQA 1DRGA 2WB1C 1ZQMA 1PK1B 4C0ZA 5AKJA 2WF5A 2W55A 5B5EU 2NO4A 4ECUA 4UB8U 5GTHU 4U7CA 3S6JA 5DKWA 2RRDA 4ED8A 4LJXA 4B9NA 1ZQZA 4GLXA 3IHQB 2W7PA 5D46A 5J2EA 3H4BA 2NRZA 2JH7A 3KOOA 5ALOA 1D8LA 1BPDA 2KNJA 3DDHA 2AXTU 1TKDA 4RT3A 3ORYA 5J0YA 4IRDA 2E1FA 4FFDA 4QZ9A 4K4IA 4QZFA 9ICEA 2LHTA 3RAXA 2PFNA 3B0XA 2KKPA 1P7DA 2HI0A 3BZKA 1Z1BA 5J0RA 4DO9A 4RQ3A 1BPZA 1ZQVA 1JI7A 9ICJA 1KFTA 2NO5A 4Q8FA 1PVRA 2LM4A 1Z00B 3QUTA 5KT7A 2HVIA 1XC9A 2L5YA 3AM9A 1SB3C 4AYBF 3NRZA 1U4BA 4USAA 4O5EA 4QZHA 2IOHA 1FIQA 4J9QA 3RF9A 4HAIA 2G0AA 1FFVA 4AP9A 5ALQA 2FMSA 3K4GA 4UB4A 2KSOB 5AIBA 1NI3A 8ICHA 4YP3A 5KAFU 2KTQA 1N56A 4BXOA 2XY5A 2W9BB 4J9NA 1K1QA 3M7DA 3E0FA 4MFCA 3PSTA 2P6UA 3RH6A 5KFTA 3GIIA 3Q8PB 4I29A 2G09A 1NK7A 4UAUA 3O0FA 4Q8EA 4OCZA 3V6JA 2VJ4A 8ICFA 4DOAA 3D2NA 2DPJA 4J9PA 3EPGA 2V4RA 5KFKA 2R8JA 1DK3A 1NJZA 2BQRA 5HHHA 1KQQA 3TI0A 4QW9A 1A0PA 5B66U 1QQ7A 2J6SA 3GIMA 5BPCA 4NJ8A 2DPIA 2MUTA 3PV8A 2UVVA 4PZOA 5ALTA 2YMPA 5J0UA 2BCRA 5AKIA 4RQ8A 1K1SA 2W9BA 2ZIVA 2MU2A 1RXWA 3ISCA 4ICAA 4DL3A 3RAQA 1MC8A 1ZQFA 1WG8A 4DS5A 9ICSA 5EWFA 2ZTCA 4FBUA 3I1YA 3QX7A 2BQ3A 3SAGA 2GWSA 3IRUA 3BS7A 3TFSA 4KLIA 4TURA 2B6GA 2AGQA 4KMUA 2HBKA 1HUOA 4C4RA 4QIWC 2YN4A 3JPPA 1V97A 2A1AA 9ICIA 2W3RA 3QU5A 3AN1A 3NTUA 4F4ZA 5AKXA 2KIWA 5T14A 4MFAA 4DQIA 4O3MA 2R8HA 2KICA 5J2CA 4UAVA 5KFNA 1FEZA 2ALZA 3ETRA 1L7PA 2AHOB 3MR5A 3G6XA 1N5WA 3RJEA 1F5SA 3ALRA 5DBCA 1NK4A 3CRXA 5BOLA 2KHVA 1X6IA 5FP0A 2OHFA 5KG2A 3H0MB 1MA7A
chains in the Genus database with same CATH topology
3D2NA 4PL1A 3H0LB 1A6SA 2RRDA 3C29A 2G5HB 2H3ZA 3F5AA 3LVVA 2W7PA 2D6FC 2DQNB 4P0QB 2G06A 4NLBA 2HBLA 2KJ8A 1HEKA 2CN1A 2JH7A 2N1RA 3L3FX 2PMZC 2W03A 2RP5A 2ZIUA 3MGVA 4A8EA 5HR7A 3SAHA 2KNJA 2LYAA 1D8BA 4KX3A 4P0PA 4OJPA 2Y0SC 1GO3F 1PVQA 2RHFA 4KMOB 1CRXA 2VJ5A 2G07A 3AQEA 2E1FA 2OM6A 3PSFA 3AL0B 2WB1F 4P0QA 4U6PA 3M6ZA 4AYBC 1A0PA 2KEYA 2K4IA 2OYYA 2ZIVB 1URJA 2OH2A 3H0RB 3IG8A 4OJOA 5HR6A 3OPXA 1PVPA 3IN5A 2ZXIA 2LHTA 3DEEA 3N7SC 2W04A 3HKZF 3K1ZA 4NLCA 2K8CB 2KKPA 3AQFA 2G5IB 1P7DA 1ZQ1C 3LVWA 2WAQF 2HBMA 1TAMA 2Q4TA 1Q3VA 2K8AA 4BJQA 2G08A 1Z1BA 4JMUA 3IP4B 2E1EA 3LYSA 2VKQA 2KKVA 2PMZF 3M6KA 4CDGA 4FE3A 1KBUA 1Z19A 2KJ9A 2YB4A 4PL2A 3F53A 1F44A 2ZIVA 4QNLA 1T94A 3GU3A 3SAFA 3D2SA 1UPHA 2HMXA 1PVRA 3F5EA 2K89A 2CPRA 2DF4B 4ICAA 4GFJA 2R18A 4ACOA 2HOIA 1YT3A 2H3QA 2ZIXA 1ECWA 2VIXA 2K8BB 2ZG6A 3PSPA 1XNSA 2KJ5A 3PSIA 2KHQA 2GOLA 3IG5A 1WUDA 2KVCA 3KZXA 4AYBF 1SZHA 3GZFA 3VC8A 3SAGA 2BDUA 3F2DA 2E5SA 2F8LA 3ICXA 2A3VA 2LYBA 3KFUF 2KV2A 2GH1A 5A0LA 2MRLA 3N7RC 4OJLA 2JGAA 1ED1A 2HBKA 4QIWC 1XO0A 4CGZA 2XICA 3F2CA 2JHDA 2K4HA 3D2QA 5KL8B 2DGZA 2HBJA 3RF9A 4QJFB 2ZIXB 2ZIUB 2Y0SF 1Q3UA 2KIWA 2MA1A 3T79A 2G0AA 5T14A 1OUQA 2H3FA 3N7PD 4O3MA 3VCBA 2ZIWB 4FZLA 2JH1A 2OXOA 4KX5A 3ONNA 3PZPA 4P0PB 2WAQC 2KICA 2NV3A 2F76X 5CRXA 3SMVA 2HOQA 1HIWA 2Z7JA 4NWIA 2F2AB 3HKZC 2K4EA 4BX9C 2W7OA 3F2BA 3NUQA 2XVTA 2ZIWA 5KL1B 2H3IA 3NRWA 2F77X 2YB1A 3CP8A 3C28A 2KD1A 5C0YA 4WJ3B 3M7DA 2KOBA 4FZMA 2JMGA 3E0FA 4CRXA 2M0NA 4FZNA 2LBOA 2WB1C 1DRGA 2HOFA 3CYMA 3PSTA 3SQIA 4NV0A 4OJ6A 1L6NA 4OO1J 2LKYA 2YX8A 2XIDA 4C0ZA 3RFAA 1IIPA 4OJ5A 4QIWF 3ALRA 2G09A 2CRXA 2XI9A 3CRXA 3O0FA 1NZBA 2KHVA 2ZXHA 4U7CA 2H3VA 2VJ4A 4IC9A 3H0MB 1MA7A 4BUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOL A;  1HIW A;  2K4E A;  2H3Z A;  2LYB A;  2H3I A;  1TAM A;  1HEK A;  2N1R A;  4JMU A;  1ED1 A;  2LYA A;  2JMG A;  2K4H A;  1A6S A;  1L6N A;  1UPH A;  2HMX A;  4ICA A;  2K4I A;  2H3F A;  2H3Q A;  1ECW A;  2H3V A;  4IC9 A;  2NV3 A; 
#chains in the Genus database with same CATH topology
 5KFE A;  5ALP A;  5F9N A;  3L4P A;  7ICP A;  2HBL A;  3K75 D;  3B9J A;  7ICV A;  1D8B A;  3D6J A;  3ZDD A;  1VLB A;  3HP6 A;  4M0A A;  2KMD A;  2OH2 A;  2KFN A;  2D8C A;  5J0W A;  1MQ3 A;  3KHL A;  4QWB A;  4DOC A;  3ZDA A;  3QYP A;  2E8M A;  5AM1 A;  1IXR A;  2I6X A;  5DDY A;  3GDX A;  4GC6 A;  4LZG A;  4DFD A;  2HBM A;  4IL6 U;  2DFL A;  2R8G A;  2ASD A;  2BCS A;  1KLN A;  4EEY A;  2YB4 A;  2Y1J A;  3GU3 A;  3BQ0 A;  4PH5 A;  4UB6 U;  2DF4 B;  5C5J A;  7ICQ A;  4ACO A;  2VA3 A;  2PFP A;  5ALV A;  1ZQI A;  2AQ0 A;  4Y2X A;  3IG5 A;  3G6Y A;  2WFA A;  3GZF A;  4O3Q A;  1S8O A;  4MEX A;  2AH5 A;  1JXL A;  3NVV A;  4RNO A;  5J2D A;  4ECQ A;  5ALJ A;  5IIK A;  4DF8 A;  1N61 A;  3T79 A;  5AM0 A;  2LI6 A;  1SL1 A;  2DWQ A;  1N2X A;  2JH1 A;  3HPO A;  5J0P A;  5CA7 A;  3H7I A;  3Q8S B;  2HDO A;  5EE0 A;  3F2B A;  2P35 A;  3PW2 A;  2AU0 A;  2H3I A;  2EZZ A;  5C0Y A;  4US9 A;  5HML A;  2FPM A;  5JRT A;  1ZQB A;  4NLK A;  5AK5 A;  4KLL A;  3RFA A;  3N28 A;  2CRX A;  2ZXH A;  2H3V A;  3V7L A;  1L7N A;  4PL1 A;  1TFR A;  3F5A A;  4JUZ A;  3PMN A;  3L3F X;  3MGV A;  4B9V A;  3U26 A;  1DOQ A;  4PJ0 U;  3NS1 A;  2F44 A;  5AI9 A;  1SKR A;  4ECT A;  4QZD A;  4I2J A;  5J2B A;  4UW9 A;  4ED7 A;  1BPX A;  2IA6 A;  4P0Q A;  4DSJ A;  1XSN A;  3SZ2 A;  4MF8 A;  4RQ7 A;  3IG8 A;  2FJ6 A;  5AIA A;  4UB2 A;  2BPG A;  1ZQ1 C;  3LVW A;  1X66 A;  4UBB A;  8ICQ A;  2KKV A;  1RXV A;  2QLT A;  1Z19 A;  2KSO A;  2VA2 A;  1A6S A;  4KLQ A;  1ZQQ A;  5EOZ A;  3AU2 A;  3Q8K A;  2WTF A;  4B6J A;  2KJ5 A;  3H8W A;  1L3S A;  1KW4 A;  1NNL A;  2KZZ A;  4GXI A;  3NGD A;  4RNM A;  4XA5 A;  2EZY A;  3C2L A;  1SL2 A;  4F3O A;  3KKA A;  4O9M A;  1S0M A;  3AUO A;  1SGG A;  3F2C A;  3AEV A;  2FLL A;  4QJF B;  4DQR A;  1F0M A;  9ICR A;  2XO7 A;  1L7M A;  3C21 A;  2H3F A;  2AGO A;  4DL2 A;  1AQ6 A;  4O3O A;  1L5U A;  2BKE A;  2HHS A;  2F76 X;  4EZ9 A;  2F2A B;  5TZV A;  4Y2T A;  2WF6 A;  2PFQ A;  5KL1 B;  2QKQ A;  2W9A A;  4DLG A;  4RQ1 A;  1RYR A;  1JXE A;  1L3V A;  4O3P A;  2M0N A;  5L1I A;  4CF5 A;  2HOF A;  4YVZ A;  5KG7 A;  5J2A A;  1JRO A;  5J29 A;  3AU6 A;  7ICK A;  4CCH A;  9ICG A;  1HUZ A;  3PO4 A;  1L8O A;  4YMN A;  2P66 A;  4F4W A;  2B21 A;  2JRZ A;  2DKX A;  1ZQW A;  5CWR A;  3FDS A;  3WK9 A;  4R64 A;  1IM4 A;  2VJ5 A;  3OHB A;  3WK8 A;  1U49 A;  4DFJ A;  2Y9U A;  3DEE A;  2IOF K;  2YQE A;  4QWA A;  4TUP A;  5ALD A;  2K8A A;  3QXG A;  4UAZ A;  1ZQA A;  9ICT A;  5KFU A;  4DL6 A;  5AKZ A;  2VKQ A;  1SXD A;  3PNC A;  4DFK A;  4DCC A;  3BS5 B;  1CI4 A;  7ICI A;  7ICR A;  1XNS A;  2VIX A;  2K8B B;  3H8J A;  3SEN A;  5J2I A;  3F2D A;  1U9L A;  1WWU A;  2NRT A;  5AI4 A;  3A0B U;  4F5O A;  3E58 A;  2H5X A;  1ZQO A;  5J2J A;  2ZIX B;  5L1M A;  4YD1 A;  1Q3U A;  4K4H A;  1JX4 A;  3GV7 B;  5J8Y C;  1WWV A;  3N7P D;  4US8 A;  1TAU A;  4ELV A;  7ICO A;  3ONN A;  5KFW A;  5ALZ A;  4BDP A;  4BX9 C;  5GTI U;  1NJW A;  3CP8 A;  1DGS A;  3HRD D;  5JU5 A;  2KOB A;  1QCK A;  4I2A A;  3ETL A;  4FZN A;  4RUC A;  3GIL A;  2ZTE A;  3FYH A;  3ZDE A;  2J6T A;  1ZD5 A;  1L6N A;  4DL7 A;  1T3N A;  3JPR A;  3H8S A;  2GLE A;  3ZDC A;  1NK8 A;  4ECY A;  4YMO A;  3BJY A;  4CF4 A;  3UMC A;  3LVV A;  1J97 A;  3RJH A;  2LYH A;  2YY6 A;  2N1R A;  5HR7 A;  5J2K A;  4DF4 A;  4O5K A;  1CRX A;  2ES6 A;  3AQE A;  4J9K A;  5KFM A;  8ICX A;  2K4I A;  2M9N A;  1URJ A;  1NKC A;  2UVU A;  4PGX A;  3RJG A;  3MR6 A;  1PK1 A;  1YZ7 A;  3K1Z A;  4O3N A;  5ALK A;  1TK8 A;  1YZ6 A;  1KN5 A;  8ICR A;  5ALN A;  3NVZ A;  3EWA A;  3E2E A;  5AKK A;  1ZOL A;  2KG5 A;  4CDG A;  5DGA A;  4DSI A;  3M1Y A;  1S10 A;  1RM6 C;  2H3Q A;  3QU9 A;  4DFP A;  2BDP A;  2KHQ A;  4QW8 A;  2W9C A;  1ZQY A;  5AKL A;  1SZH A;  4KN7 A;  3TAR A;  9ICM A;  3N7R C;  4EEK A;  3QUC A;  1Z4O A;  2JHD A;  2ZJA A;  4KLS A;  3SV3 A;  3BQT A;  4Y2S A;  4M47 A;  7ICL A;  4J9L A;  4JV1 A;  3RH5 A;  1ZQH A;  1KFS A;  1C20 A;  2ZIW A;  2WF7 A;  4F5Q A;  1H38 A;  2W3S A;  3QZ7 A;  2KIV A;  2JMG A;  3UXN A;  3EZ5 A;  1J2N A;  4JV0 A;  1S97 A;  4OJ6 A;  1UA0 A;  5ALR A;  5AKY A;  1IIP A;  4OJ5 A;  5CEH A;  2FMP A;  1XWL A;  4R66 A;  3QNM A;  4J9O A;  2F1H A;  2ZUB A;  3WKB A;  2EQY A;  1DK2 A;  5AM3 A;  5KFY A;  2O6K A;  4PZN A;  4J9R A;  3C1Z A;  1T8E A;  2G06 A;  4F92 B;  4QZE A;  3KBB A;  3SAH A;  3HJE A;  4UAY A;  8ICM A;  3RJK A;  3PSF A;  3AL0 B;  5HHI A;  4UQG A;  5ALF A;  4JWM A;  2NRV A;  5K4L A;  3V7J A;  5AKE A;  1ZRM A;  5J2F A;  3OJS A;  3OHA A;  5AM4 A;  1ZQT A;  2WHE A;  4P4O A;  2WAQ F;  8ICC A;  3GV5 B;  3UPQ A;  1TAM A;  2BQU A;  4IQW A;  4PL2 A;  8ICP A;  4RPZ A;  1T94 A;  3D2S A;  9ICV A;  3QU7 A;  5ALY A;  3UQ2 A;  4J9M A;  4GFJ A;  2R18 A;  1ZQP A;  3FM9 A;  1UQV A;  1L3T A;  3MFI A;  3EPI A;  4J03 A;  2ZJ5 A;  4UAS A;  4NLN A;  1LV5 A;  4XUS A;  5DQG A;  2DL0 A;  2PXI A;  3I28 A;  2WF8 A;  2FDR A;  4PHP A;  1WCL A;  3N4M B;  2F1J A;  3Q8Q B;  4ED0 A;  3HKZ C;  4MFF A;  2VAN A;  1KKX A;  3QE9 Y;  4C7Y A;  2BPC A;  1N62 A;  5AIC A;  3SYZ A;  4EX6 A;  3BQ7 A;  4WJ3 B;  4FZM A;  9ICL A;  4RUA A;  4OO1 J;  5DB8 A;  3GFK B;  3Q8M A;  4QWD A;  1XS9 D;  4Q45 A;  4Y2U A;  1WCN A;  4P0Q B;  1TK5 A;  3OGU A;  1UT5 A;  3C5F A;  4I27 A;  2JXJ A;  2ZIU A;  2BPF A;  1NOM A;  2J6U A;  4KLF A;  2Y0S C;  3KZI U;  3PR4 A;  4M04 A;  1Q46 A;  2GO7 A;  4RQ6 A;  1X9S A;  5CP2 A;  1KTQ A;  4G9B A;  5KT5 A;  1PZN A;  1LB2 B;  1TE2 A;  8ICJ A;  3PML A;  3N7S C;  1TV9 A;  3HKZ F;  4NLC A;  1V9P A;  1Z3E B;  3H40 A;  3TAC B;  4M9H A;  2OCE A;  2E3T A;  7ICF A;  1S9F A;  1T4G A;  1RPL A;  3JPN A;  4LZD A;  3TFR A;  1SWV A;  4KLU A;  2Y9T A;  2ZTD A;  2FLP A;  9ICP A;  3BQ1 A;  1S76 D;  3MFH A;  3NVW A;  1X2I A;  4YR0 A;  3PW0 A;  1RQN A;  1XO0 A;  4C8M A;  4CGZ A;  2BCU A;  4I2F A;  2K4H A;  4TQR A;  2DGZ A;  3MC1 A;  4Y2V A;  2MA1 A;  9ICA A;  2HHU A;  2E8N A;  1XSL A;  1ZQC A;  2WAQ C;  1IV8 A;  1D9F A;  1A76 A;  1HIW A;  3KHH A;  3RTV A;  4K4G A;  4NL9 A;  1ZXI A;  3NRW A;  3QUQ A;  3SR6 A;  5KFF A;  1ZQJ A;  2KD1 A;  2UVR A;  5EWE A;  4ED6 A;  2BR0 A;  1DXS A;  3C2M A;  4O3R A;  3RH4 A;  5ALX A;  2QB0 B;  8ICY A;  2YX8 A;  3SD7 A;  2MUT B;  4IRK A;  3T3F A;  4BUG A;  5L1J A;  2FMQ A;  2JEJ A;  1JUD A;  2H3Z A;  4GIB A;  2K4P A;  4FBT A;  3NVY A;  4R65 A;  3LWM A;  3OJU A;  4P4P A;  4A8E A;  2HHV A;  4KLO A;  4F5N A;  5DQH A;  8ICG A;  5III A;  7ICJ A;  4EEL A;  4DFM A;  1B0X A;  2FI1 A;  5IIN A;  1CUK A;  4F71 A;  3T5K A;  2ISP A;  1PVP A;  2DBY A;  8ICI A;  3RB4 A;  4RQM A;  4GXK A;  3IM1 A;  4F5P A;  2FE9 A;  5DG7 A;  2PMZ F;  4P4M A;  3PX6 A;  4C8O A;  2W8L A;  2W9M A;  2PI4 A;  4EYH B;  3F53 A;  2LPE A;  5KFG A;  2F1I A;  2PFO A;  5F9L A;  1RYU A;  1NK0 A;  2EDU A;  4F2S A;  2EH9 A;  4Y2P A;  5AM2 A;  1ECW A;  2IHM A;  3V72 A;  5J0S A;  1TVA A;  4JV2 A;  2BDU A;  5KFH A;  2F8L A;  4ED1 A;  4OJL A;  4CF3 A;  5JTI A;  1UT8 A;  1COK A;  2W43 A;  4I2C A;  2A19 A;  2HBJ A;  3QZ8 A;  3PVX A;  4EX7 A;  2JEF A;  5IIO A;  3WK6 A;  2I9G A;  4KX5 A;  3HT3 A;  5KG6 A;  1UCV A;  4PHD A;  3TAQ A;  5DB7 A;  7ICS A;  2ASJ A;  2XY7 A;  2ESE A;  4F2R A;  3ZD8 A;  5KTQ A;  5G5G A;  5DB9 A;  2A1J B;  2YTU A;  4QZB A;  5EE1 A;  2KVS A;  3MDC A;  4R8U B;  1DGJ A;  2KK0 A;  4PGQ A;  5KFQ A;  2WF9 A;  4F4Y A;  1O03 A;  2RP5 A;  3WU2 U;  4DWI A;  3PW7 A;  4OJP A;  1GO3 F;  1PVQ A;  5AI5 A;  2G07 A;  4TQS A;  2BGW A;  3HW8 A;  5EWG A;  2BHN A;  2ZIV B;  5J0O A;  2QB0 A;  3TAD A;  5KFB A;  4R63 A;  3ZI4 A;  5L1K A;  2ZXI A;  3WKE A;  8ICB A;  2K8C B;  4MF2 A;  5AKH A;  4CNQ A;  5AM5 A;  3WKA A;  1FFU A;  2Q4T A;  4B9L A;  4ECW A;  5CB1 A;  2E1E A;  4RZR A;  1UA1 A;  1ZJN A;  4JK1 A;  3SAF A;  2C2R A;  1ZQE A;  3WKD A;  2XY6 A;  3OTQ A;  1S5L U;  5ALU A;  2KN7 A;  3KHR A;  2R8I A;  5ALW A;  2MAX A;  5HP4 A;  2RDI A;  1MN8 A;  4CE6 A;  3QEA Z;  3QUB A;  2NRW A;  4UBC A;  1LKY A;  5DG9 A;  4DOB A;  3RR7 A;  3KFU F;  5KG4 A;  4Y2Y A;  2XIC A;  2EZX A;  4YCX A;  9ICQ A;  2JEI A;  1N60 A;  4RT2 A;  3PZP A;  3TAP A;  2NV3 A;  1RZT A;  4YXM A;  2C2E A;  3HWT A;  4F4X A;  5KFL A;  2IOF A;  4I28 A;  7ICN A;  2V4Q A;  2KZ3 A;  1U47 A;  4BGD A;  1B22 A;  3WKC A;  4DS4 A;  2W8K A;  4NV0 A;  2LKY A;  2XCP A;  4DL4 A;  4JWN A;  4M9J A;  1C7Y A;  4X5V A;  2ZJ8 A;  5ALM A;  2XI9 A;  7ICU A;  1ZD3 A;  9ICC A;  4IR9 A;  4KLT A;  3H0L B;  1JIH A;  5AI6 A;  4GXJ A;  2D6F C;  4YR2 A;  4RQN A;  1Z00 A;  4BWJ A;  2W03 A;  5KFC A;  5DLF A;  3RJJ A;  5HMM A;  4ZOH C;  1S77 D;  1L7O A;  4I2E A;  4DSF A;  2W54 A;  4R8U A;  4KLE A;  2RDJ A;  5AHX A;  2K60 A;  5IIJ A;  4U6P A;  1HJP A;  1X42 A;  2DKZ A;  1ZQU A;  4OJO A;  2A1J A;  8ICV A;  3A0H U;  1BPE A;  2W04 A;  4C7Z A;  4B9M A;  1Q3V A;  7ICM A;  4G3I A;  4O3S A;  3H4D A;  4YG2 A;  4ED3 A;  1OXJ A;  3RBE A;  1QSS A;  5H2F U;  4ELU A;  4B9S A;  1WYG A;  3MAB A;  3RR8 A;  7ICH A;  4NY8 A;  2KVC A;  4B9U A;  2YMM A;  2C2D A;  4EYI B;  2GH1 A;  3UXO A;  3EW9 A;  3RB3 A;  4YQW A;  4EBD A;  5KL8 B;  4B9T A;  3CNH A;  5G5H A;  2KE7 A;  1B43 A;  5ALH A;  4F5R A;  4Q43 A;  1ARO P;  2NYV A;  2OXO A;  5DGB A;  7ICG A;  5DBB A;  9ICH A;  2HOQ A;  2Z7J A;  1BPY A;  3T5L A;  2W7O A;  2XVT A;  4IQU A;  2F77 X;  1B4F A;  1ZYQ A;  1M6Y A;  4KLJ A;  3RRG A;  1PK3 A;  1VDV A;  4EZ6 A;  4O5C A;  1NK9 A;  1L8L A;  1RYS A;  2DQN B;  4Q44 A;  1SKS A;  1CEZ A;  4NLG A;  3Q8L A;  2QAR A;  5KAI U;  3THV A;  5DG8 A;  4IQT A;  1NKE A;  3UMB A;  5E79 U;  5AI0 A;  3PR5 B;  4EBC A;  4KTQ A;  4I2B A;  2QAR B;  4RU9 A;  2JEG A;  1LVH A;  5D4B A;  3HIL A;  4AYB C;  3QU2 A;  1NJY A;  1IG6 A;  2CXY A;  2KEY A;  2BZF A;  4ECX A;  1FO4 A;  2OWO A;  1KL9 A;  4RPY A;  3M8R A;  2IBK A;  5L1L A;  1TAQ A;  5AI8 A;  1COO A;  2YML A;  5KG5 A;  5J0X A;  1BGX T;  5KG0 A;  4M2Y A;  1X40 A;  3C5G A;  2I1Q A;  1SV0 C;  3IP4 B;  1KEJ A;  8ICT A;  2HSZ A;  1T7P A;  1JAL A;  3QEB Z;  8ICU A;  5AK3 A;  3SI8 A;  4QNL A;  3LDA A;  4ECZ A;  1KSP A;  1U45 A;  3PX0 A;  1T3Q A;  3NAS A;  5TIS U;  5HNK A;  2ZG6 A;  3WK4 A;  2XGQ A;  5KG3 A;  1ZQN A;  2E5S A;  1UHU A;  3WK5 A;  2PKE A;  2YMQ A;  1ED1 A;  4RQ0 A;  5KFR A;  2W9C B;  4NM1 A;  2AQ4 A;  2ODG A;  4UB3 A;  3N97 B;  1OUQ A;  3VCB A;  3JPQ A;  3T5J A;  3BS5 A;  1ZQK A;  4YD2 A;  4Z6F A;  1SV0 A;  3TAN A;  3KD3 A;  4MHV A;  4M6W B;  1SV4 A;  4NM2 A;  2ASL A;  5CJ7 A;  5AK4 A;  1X9W A;  3R9K A;  5KG1 A;  4XRH A;  3MGH A;  2KFZ A;  8ICK A;  3V6K A;  1BNP A;  2XID A;  1Z4N A;  1BPB A;  2HHT A;  4QZA A;  4KLG A;  4YMM A;  5F3X B;  3C29 A;  2G5H B;  1QLN A;  4F93 B;  1V85 A;  2CN1 A;  4QZG A;  3GQC A;  2PMZ C;  2F8K A;  2BCV A;  4C80 A;  5KFD A;  3T5H A;  1N48 A;  4C8K A;  4P0P A;  1SKW A;  5DDM A;  3BDP A;  1BVS A;  3G6V A;  4QZ8 A;  3RRH A;  4Y2R A;  1L3U A;  4F50 A;  4DQQ A;  3KTQ A;  1LKY B;  2OYY A;  3H0R B;  5HR6 A;  1Z1V A;  5DQI A;  4F4K A;  3ED5 A;  2R8K A;  1Q8K A;  1ZRN A;  2IMW P;  4TUQ A;  1JN3 A;  1D8Y A;  4DEZ A;  8ICO A;  1Y88 A;  2ZUD A;  3LYS A;  9ICX A;  3M6K A;  2LM1 A;  1KBU A;  1N5X A;  3EUB 2;  3EYZ A;  2KJ9 A;  4ECS A;  2I5H A;  2HMX A;  2K89 A;  1D9D A;  2ZIX A;  2ISO A;  3PSI A;  1SZP A;  2XC9 A;  3VC8 A;  2A3V A;  1QSL A;  4BWM A;  2QB1 A;  3ISD A;  2KP7 A;  2B0C A;  2P6R A;  4YN4 A;  4EBE A;  1KRP A;  2EAO A;  5J0T A;  3OSN A;  1XO1 A;  3H8M A;  4KN4 A;  4EEN A;  1ZQX A;  1NK5 A;  3RB6 A;  4IS7 A;  5CRX A;  4NWI A;  2K4E A;  4PGY A;  4I2I A;  2YB1 A;  5KFX A;  4XQ8 A;  1S0N A;  3RJI A;  2HVH A;  5IIL A;  3J81 j;  4YR3 A;  3TKA A;  1ZQG A;  3SQI A;  3QU4 A;  3MGI A;  1X9M A;  4QZC A;  4M9N A;  4M6W A;  3JPT A;  1V38 A;  5J2H A;  3RBD A;  3IDW A;  4IC9 A;  4ELT A;  4PHA A;  3TAD C;  1ZD2 P;  4ED2 A;  3PO5 A;  1SL0 A;  1ZQD A;  3OSP A;  4P2H A;  2NRX A;  2JR5 A;  4ECR A;  2D3D A;  1K5O A;  5J2G A;  2LYA A;  2C22 A;  2UVW A;  4O0I A;  2RQ5 A;  8ICN A;  1RDF A;  2IHN A;  2V9W A;  1JRP A;  2XGP A;  2HHW A;  4JB3 A;  5D49 A;  2Y1I A;  2MSN A;  4Y2J A;  1JMS A;  3LK9 A;  3AQF A;  9ICF A;  4UAR A;  2PI5 A;  4I2H A;  3UM9 A;  4I2D A;  5EE9 A;  4UB5 A;  3WK7 A;  3MR2 A;  5EE3 A;  1N63 A;  1X9X A;  2E8O A;  4KLM A;  3F5E A;  4RNN A;  4DLE A;  2JZB A;  4YFK A;  4FO6 A;  1ZD4 A;  1ZET A;  3RJF A;  1O08 A;  2KZM A;  2ATL A;  5AK6 A;  2LYB A;  1SIJ A;  3M8S A;  1QQ6 A;  4QWE A;  3TQ1 A;  5KFV A;  3PW5 A;  3ZDB A;  3I76 A;  2EAN A;  2ZIU B;  4DSL A;  5KT6 A;  5IIM A;  3PY8 A;  2ZIW B;  4HYK A;  3MDA A;  3MBY A;  4P0P B;  4MEY A;  4RQ4 A;  3SMV A;  1KFD A;  1QSY A;  3NUQ A;  4KLD A;  4ECV A;  3PW4 A;  4RQ5 A;  3UMG A;  4NLZ A;  4I2G A;  9ICU A;  4Y2Q A;  4RQ2 A;  4CRX A;  2HCF A;  2JV3 A;  4C4T A;  3M9N B;  8ICZ A;  7ICE A;  3UQ0 A;  2RLT A;  4QIW F;  5CHG A;  1ZQL A;  3IV6 A;  5KT4 A;  4BJQ A;  3K1R B;  3KHG A;  2EAP A;  3C2K A;  4NLB A;  2FPL A;  2KJ8 A;  3ISB A;  3BQ2 A;  1S0V A;  4KX3 A;  4UAT A;  5DLG A;  1NK6 A;  4UB1 A;  4E0D A;  2WB1 F;  1X6J A;  5ALG A;  3M6Z A;  1MQ2 A;  5J0Q A;  5KFA A;  8ICS A;  3BZC A;  1NZP A;  9ICW A;  2E8P A;  2F3N A;  1KDH A;  5KT2 A;  2HHQ A;  2G5I B;  5ALL A;  4LVS A;  3V6H A;  2C28 A;  1QQ5 A;  2G08 A;  4JMU A;  4FE3 A;  4IQV A;  2W11 A;  4UAW A;  5KFS A;  4GC7 A;  1SXE A;  1OW5 A;  4TUS A;  4C8L A;  2CPR A;  4NL9 C;  5J8Y A;  1XSP A;  2HOI A;  1YT3 A;  3LWL A;  2DUY A;  1ZQS A;  3M9M B;  2GOL A;  1QH9 A;  5KFO A;  1ZQR A;  3SEI A;  3ICX A;  4J9S A;  5L9X A;  5A0L A;  2FPK A;  4DSK A;  2JGA A;  4Z6D A;  3GIJ A;  8ICL A;  5KNI A;  5ALI A;  5KFJ A;  2VA8 A;  4YXJ A;  1J2M A;  1TK0 A;  3V7K A;  3RB0 A;  4F72 A;  4Z6C A;  1A77 A;  1RG6 A;  4PHE A;  4DQP A;  8ICA A;  5ALS A;  4ZH4 A;  1NJX A;  3JPS A;  4RPX A;  5KFP A;  2LBO A;  3HX0 A;  3CYM A;  5ALE A;  2HW3 A;  2HHX A;  2BCQ A;  4M9L A;  3PX4 A;  4C4S A;  1NZB A;  4OD0 A;  4PPX A;  4F91 B;  4QZI A;  1BNO A;  2LMR A;  3Q8R B;  1EXN A;  1HEK A;  1MSW D;  5CR0 A;  4NXZ A;  1PUZ A;  5DB6 A;  2XCA A;  2RHF A;  1SWW A;  4KMO B;  9ICN A;  3MR3 A;  3UXP A;  2OM6 A;  3ZD9 A;  3SV4 A;  9ICB A;  3FAH A;  3GV8 B;  5JUM A;  3JPO A;  3OPX A;  3IN5 A;  2FLN A;  4DQS A;  2AGP A;  9ICK A;  4DL5 A;  3GIK A;  1VJ5 A;  4KLH A;  3AMZ A;  8ICE A;  2JZB B;  3C1Y A;  3C23 A;  4FS2 A;  1F44 A;  3FC4 A;  4C8N A;  4BXO B;  1UPH A;  4FS1 A;  1U48 A;  2ZUC A;  5KT3 A;  3L5K A;  3PSP A;  4QWC A;  3M9O B;  5KFI A;  1WUD A;  3KZX A;  4F8R A;  1ZJM A;  3KKA C;  2KV2 A;  2MRL A;  2OEH A;  3B0Y A;  4IR1 A;  8ICW A;  5KFZ A;  5AKG A;  1S0O A;  3CW2 C;  3D2Q A;  1NKB A;  2Y0S F;  7ICT A;  4FZL A;  4KIT B;  4Z6E A;  3DV9 A;  2Q0Z X;  9ICO A;  1QTM A;  4M9G A;  1XU4 A;  5BOM A;  2EAM A;  3C28 A;  5DBA A;  4DSE A;  1RQL A;  4IRC A;  2AJQ A;  1DRG A;  2WB1 C;  1ZQM A;  1PK1 B;  4C0Z A;  5AKJ A;  2WF5 A;  2W55 A;  5B5E U;  2NO4 A;  4ECU A;  4UB8 U;  5GTH U;  4U7C A;  3S6J A;  5DKW A;  2RRD A;  4ED8 A;  4LJX A;  4B9N A;  1ZQZ A;  4GLX A;  3IHQ B;  2W7P A;  5D46 A;  5J2E A;  3H4B A;  2NRZ A;  2JH7 A;  3KOO A;  5ALO A;  1D8L A;  1BPD A;  2KNJ A;  3DDH A;  2AXT U;  1TKD A;  4RT3 A;  3ORY A;  5J0Y A;  4IRD A;  2E1F A;  4FFD A;  4QZ9 A;  4K4I A;  4QZF A;  9ICE A;  2LHT A;  3RAX A;  2PFN A;  3B0X A;  2KKP A;  1P7D A;  2HI0 A;  3BZK A;  1Z1B A;  5J0R A;  4DO9 A;  4RQ3 A;  1BPZ A;  1ZQV A;  1JI7 A;  9ICJ A;  1KFT A;  2NO5 A;  4Q8F A;  1PVR A;  2LM4 A;  1Z00 B;  3QUT A;  5KT7 A;  2HVI A;  1XC9 A;  2L5Y A;  3AM9 A;  1SB3 C;  4AYB F;  3NRZ A;  1U4B A;  4USA A;  4O5E A;  4QZH A;  2IOH A;  1FIQ A;  4J9Q A;  3RF9 A;  4HAI A;  2G0A A;  1FFV A;  4AP9 A;  5ALQ A;  2FMS A;  3K4G A;  4UB4 A;  2KSO B;  5AIB A;  1NI3 A;  8ICH A;  4YP3 A;  5KAF U;  2KTQ A;  1N56 A;  4BXO A;  2XY5 A;  2W9B B;  4J9N A;  1K1Q A;  3M7D A;  3E0F A;  4MFC A;  3PST A;  2P6U A;  3RH6 A;  5KFT A;  3GII A;  3Q8P B;  4I29 A;  2G09 A;  1NK7 A;  4UAU A;  3O0F A;  4Q8E A;  4OCZ A;  3V6J A;  2VJ4 A;  8ICF A;  4DOA A;  3D2N A;  2DPJ A;  4J9P A;  3EPG A;  2V4R A;  5KFK A;  2R8J A;  1DK3 A;  1NJZ A;  2BQR A;  5HHH A;  1KQQ A;  3TI0 A;  4QW9 A;  1A0P A;  5B66 U;  1QQ7 A;  2J6S A;  3GIM A;  5BPC A;  4NJ8 A;  2DPI A;  2MUT A;  3PV8 A;  2UVV A;  4PZO A;  5ALT A;  2YMP A;  5J0U A;  2BCR A;  5AKI A;  4RQ8 A;  1K1S A;  2W9B A;  2ZIV A;  2MU2 A;  1RXW A;  3ISC A;  4ICA A;  4DL3 A;  3RAQ A;  1MC8 A;  1ZQF A;  1WG8 A;  4DS5 A;  9ICS A;  5EWF A;  2ZTC A;  4FBU A;  3I1Y A;  3QX7 A;  2BQ3 A;  3SAG A;  2GWS A;  3IRU A;  3BS7 A;  3TFS A;  4KLI A;  4TUR A;  2B6G A;  2AGQ A;  4KMU A;  2HBK A;  1HUO A;  4C4R A;  4QIW C;  2YN4 A;  3JPP A;  1V97 A;  2A1A A;  9ICI A;  2W3R A;  3QU5 A;  3AN1 A;  3NTU A;  4F4Z A;  5AKX A;  2KIW A;  5T14 A;  4MFA A;  4DQI A;  4O3M A;  2R8H A;  2KIC A;  5J2C A;  4UAV A;  5KFN A;  1FEZ A;  2ALZ A;  3ETR A;  1L7P A;  2AHO B;  3MR5 A;  3G6X A;  1N5W A;  3RJE A;  1F5S A;  3ALR A;  5DBC A;  1NK4 A;  3CRX A;  5BOL A;  2KHV A;  1X6I A;  5FP0 A;  2OHF A;  5KG2 A;  3H0M B;  1MA7 A; 
#chains in the Genus database with same CATH homology
 3D2N A;  4PL1 A;  3H0L B;  1A6S A;  2RRD A;  3C29 A;  2G5H B;  2H3Z A;  3F5A A;  3LVV A;  2W7P A;  2D6F C;  2DQN B;  4P0Q B;  2G06 A;  4NLB A;  2HBL A;  2KJ8 A;  1HEK A;  2CN1 A;  2JH7 A;  2N1R A;  3L3F X;  2PMZ C;  2W03 A;  2RP5 A;  2ZIU A;  3MGV A;  4A8E A;  5HR7 A;  3SAH A;  2KNJ A;  2LYA A;  1D8B A;  4KX3 A;  4P0P A;  4OJP A;  2Y0S C;  1GO3 F;  1PVQ A;  2RHF A;  4KMO B;  1CRX A;  2VJ5 A;  2G07 A;  3AQE A;  2E1F A;  2OM6 A;  3PSF A;  3AL0 B;  2WB1 F;  4P0Q A;  4U6P A;  3M6Z A;  4AYB C;  1A0P A;  2KEY A;  2K4I A;  2OYY A;  2ZIV B;  1URJ A;  2OH2 A;  3H0R B;  3IG8 A;  4OJO A;  5HR6 A;  3OPX A;  1PVP A;  3IN5 A;  2ZXI A;  2LHT A;  3DEE A;  3N7S C;  2W04 A;  3HKZ F;  3K1Z A;  4NLC A;  2K8C B;  2KKP A;  3AQF A;  2G5I B;  1P7D A;  1ZQ1 C;  3LVW A;  2WAQ F;  2HBM A;  1TAM A;  2Q4T A;  1Q3V A;  2K8A A;  4BJQ A;  2G08 A;  1Z1B A;  4JMU A;  3IP4 B;  2E1E A;  3LYS A;  2VKQ A;  2KKV A;  2PMZ F;  3M6K A;  4CDG A;  4FE3 A;  1KBU A;  1Z19 A;  2KJ9 A;  2YB4 A;  4PL2 A;  3F53 A;  1F44 A;  2ZIV A;  4QNL A;  1T94 A;  3GU3 A;  3SAF A;  3D2S A;  1UPH A;  2HMX A;  1PVR A;  3F5E A;  2K89 A;  2CPR A;  2DF4 B;  4ICA A;  4GFJ A;  2R18 A;  4ACO A;  2HOI A;  1YT3 A;  2H3Q A;  2ZIX A;  1ECW A;  2VIX A;  2K8B B;  2ZG6 A;  3PSP A;  1XNS A;  2KJ5 A;  3PSI A;  2KHQ A;  2GOL A;  3IG5 A;  1WUD A;  2KVC A;  3KZX A;  4AYB F;  1SZH A;  3GZF A;  3VC8 A;  3SAG A;  2BDU A;  3F2D A;  2E5S A;  2F8L A;  3ICX A;  2A3V A;  2LYB A;  3KFU F;  2KV2 A;  2GH1 A;  5A0L A;  2MRL A;  3N7R C;  4OJL A;  2JGA A;  1ED1 A;  2HBK A;  4QIW C;  1XO0 A;  4CGZ A;  2XIC A;  3F2C A;  2JHD A;  2K4H A;  3D2Q A;  5KL8 B;  2DGZ A;  2HBJ A;  3RF9 A;  4QJF B;  2ZIX B;  2ZIU B;  2Y0S F;  1Q3U A;  2KIW A;  2MA1 A;  3T79 A;  2G0A A;  5T14 A;  1OUQ A;  2H3F A;  3N7P D;  4O3M A;  3VCB A;  2ZIW B;  4FZL A;  2JH1 A;  2OXO A;  4KX5 A;  3ONN A;  3PZP A;  4P0P B;  2WAQ C;  2KIC A;  2NV3 A;  2F76 X;  5CRX A;  3SMV A;  2HOQ A;  1HIW A;  2Z7J A;  4NWI A;  2F2A B;  3HKZ C;  2K4E A;  4BX9 C;  2W7O A;  3F2B A;  3NUQ A;  2XVT A;  2ZIW A;  5KL1 B;  2H3I A;  3NRW A;  2F77 X;  2YB1 A;  3CP8 A;  3C28 A;  2KD1 A;  5C0Y A;  4WJ3 B;  3M7D A;  2KOB A;  4FZM A;  2JMG A;  3E0F A;  4CRX A;  2M0N A;  4FZN A;  2LBO A;  2WB1 C;  1DRG A;  2HOF A;  3CYM A;  3PST A;  3SQI A;  4NV0 A;  4OJ6 A;  1L6N A;  4OO1 J;  2LKY A;  2YX8 A;  2XID A;  4C0Z A;  3RFA A;  1IIP A;  4OJ5 A;  4QIW F;  3ALR A;  2G09 A;  2CRX A;  2XI9 A;  3CRX A;  3O0F A;  1NZB A;  2KHV A;  2ZXH A;  4U7C A;  2H3V A;  2VJ4 A;  4IC9 A;  3H0M B;  1MA7 A;  4BUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...