2HMXA

Human immunodeficiency virus type 1 matrix protein
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
133
Chain Sequence
HMGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Matrix protein
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 MATRIX PROTEIN
publication title Three-dimensional structure of the human immunodeficiency virus type 1 matrix protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 33
structure length 133
sequence length 133
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2hmxA00
2K4IA 2H3FA 2K4EA 1HIWA 1TAMA 2JMGA 1UPHA 2LYBA 2H3VA 2H3IA 2N1RA 2H3ZA 1L6NA 4JMUA 2H3QA 2GOLA 1A6SA 2HMXA 4IC9A 2K4HA 2LYAA 1ED1A 2NV3A 1ECWA 4ICAA 1HEKA
chains in the Genus database with same CATH superfamily
4UBCA 4KX3A 4I2IA 4KLTA 2KZMA 3AEVA 3FDSA 3OTQA 1ZD2P 9ICJA 5CJ7A 5F9NA 2R8IA 4EEKA 3LYSA 1OUQA 4I2AA 3F2BA 2K8BB 1QH9A 2PMZC 2KSOA 3LK9A 4G9BA 4CF4A 3NASA 2H3FA 4OJLA 3BQTA 5ALRA 4I2DA 3LVVA 5KG3A 7ICNA 4DFPA 5KT6A 1ZQLA 5CR0A 1LV5A 2LPEA 3I28A 4FE3A 5KFJA 2W9BA 1WUDA 3KFUF 4RNNA 5KFOA 5KG2A 4DL3A 3JPPA 3RF9A 5IIKA 2WB1F 8ICFA 3CP8A 1NNLA 2R18A 4IQUA 3MR2A 1L7MA 5AHXA 3SMVA 2AGQA 2VKQA 2WTFA 3NS1A 3RJIA 4F4ZA 5DB6A 2LM4A 5KFKA 2HHVA 1WYGA 3N7SC 2RP5A 1L3SA 3RH5A 3RBDA 3FYHA 3AM9A 5J2FA 4Y2TA 3F5AA 4EENA 2HCFA 3TQ1A 5KG4A 1JXLA 5L1JA 3WKAA 4OCZA 3MFIA 5AIBA 2OXOA 4DOCA 1T8EA 4QZ9A 3BQ7A 5F9LA 2F2AB 4OO1J 2F3NA 1UA1A 1WCLA 3PVXA 5IINA 3NTUA 5KFXA 1S9FA 2HSZA 2JZBB 2ALZA 5CEHA 2ISPA 4R63A 3GIJA 2JEJA 4YCXA 1JXEA 5CHGA 5AKJA 1ZQKA 2BQUA 1DOQA 2FJ6A 5ALMA 1L3UA 1X9XA 1YT3A 3EWAA 2NO4A 1RQNA 5TZVA 1BPYA 1WG8A 2HBLA 1XSNA 5DG9A 1ZQOA 2EZYA 1U49A 5KG5A 3PV8A 3Q8QB 3JPRA 2BDPA 5AKLA 9ICAA 3MDCA 3E2EA 5ALGA 2NO5A 5KFTA 2KKVA 4J9RA 2PI5A 1DGJA 1ZQWA 2RRDA 3H4BA 1N48A 2JR5A 3HP6A 2I9GA 2P35A 1B0XA 2AU0A 4OJ5A 1X40A 3T5JA 1X9MA 2XY5A 2ASLA 4NV0A 1DRGA 1WWUA 4F5OA 5L9XA 2ZUDA 3SENA 4LJXA 5DG8A 4ELTA 1L3VA 2JV3A 1ZQTA 4M9NA 4TUPA 1TKDA 1SKRA 1KRPA 3UM9A 4RT3A 3T5HA 4IQWA 2WF8A 1XNSA 5KFGA 2CN1A 3FM9A 1MC8A 2KD1A 5HHIA 1ZRMA 9ICBA 4MHVA 1S8OA 3IDWA 5IIMA 1FFUA 5KT5A 4GC6A 5KFHA 2XO7A 1KTQA 3G6YA 1XC9A 2CPRA 2XY7A 4UB5A 8ICOA 3AQEA 4C8LA 2F77X 4TQRA 4GXJA 4DL5A 5ALZA 3RB4A 1V85A 2MUTA 1RG6A 4M9HA 3C29A 1SB3C 5ALJA 2UVVA 3PO4A 3AUOA 4C8KA 4KLFA 5L1KA 1UCVA 1UT8A 3D6JA 3PSIA 4ECTA 5A0LA 2HVIA 4XA5A 1IM4A 3D2NA 3JPSA 5HP4A 3ZDCA 4Y2YA 1KKXA 3R9KA 4EYHB 3WK9A 2NRVA 4RQ2A 3Q8PB 3N28A 4C8MA 4NL9C 2EZXA 2WHEA 4KLLA 2HBKA 2NV3A 4QIWC 5ALQA 1QTMA 9ICWA 5ALNA 2KKPA 7ICUA 3BQ0A 2R8JA 3T5LA 2FI1A 2GH1A 4BWMA 4O3MA 4M0AA 3EPIA 3RJKA 4O3SA 4I29A 3L4PA 2YX8A 1SV0C 5ALPA 3SZ2A 2ASDA 3RJHA 4GLXA 4Y2SA 2JZBA 4Q43A 1TV9A 2LKYA 3AQFA 3G6XA 2G07A 2K4PA 2YQEA 4KITB 1RPLA 3BS5B 4KTQA 7ICPA 3H0LB 1NKCA 2K8AA 2F76X 5JUMA 4M9JA 3D2QA 3V6KA 3WK7A 2EAOA 2W8KA 5J0RA 1L8LA 1JALA 4DL2A 4QWEA 1DK3A 5ALOA 3QZ7A 1SIJA 3N7PD 5KFFA 3HJEA 5AM2A 1MQ2A 3M6ZA 5J0WA 3H40A 5HNKA 4KX5A 2KVSA 1LKYB 5ALHA 4C4RA 4F5NA 2WAQC 8ICIA 2AGPA 4O3OA 2NRZA 4RPZA 1NKEA 2F1HA 1SZPA 2KN7A 1ZJNA 2JHDA 4EZ9A 2OH2A 3KZIU 5ALYA 1Q8KA 4BWJA 4QNLA 3RH6A 5DB9A 1XSPA 2XICA 5KG0A 1ZXIA 5F3XB 5DG7A 3RJJA 2CRXA 4FS1A 1ZQCA 1MA7A 4TQSA 5AI9A 4YFKA 1T7PA 5T14A 2LBOA 4QWCA 4RPXA 2C2EA 3PSPA 3GFKB 2IBKA 4J9PA 3G6VA 4RQ6A 2V9WA 2M9NA 2J6UA 3WK6A 1ZQVA 5HMMA 3KKAC 3V6JA 1LVHA 3L3FX 5AIAA 3HWTA 2WF7A 3DDHA 5DBBA 4RU9A 1X42A 2A1JB 4KLQA 1ZQUA 1JUDA 4OD0A 2F1IA 4PHAA 3ETLA 4C0ZA 4M04A 2FPMA 3H4DA 2C2DA 2ZUCA 3SR6A 1D8BA 1RQLA 4DSIA 1U9LA 5BPCA 3RB0A 3UMGA 4B9NA 3V7JA 2G08A 3UXNA 1WWVA 4ACOA 3GV5B 1NK6A 3QYPA 3V72A 3AN1A 3RRGA 4UW9A 1ZQGA 3T5KA 2BGWA 4DOAA 1XWLA 2BCSA 1S97A 2ESEA 3BZKA 9ICNA 4XQ8A 3N97B 1QQ7A 4ECWA 4USAA 4GXKA 3WK5A 8ICGA 1K1SA 5HR7A 7ICSA 4Z6DA 1U45A 4ICAA 3GDXA 1A76A 3V7LA 2KJ8A 1Q3UA 4ED1A 3M1YA 4RNMA 4RQ4A 4X5VA 4ZOHC 1IIPA 4P0PB 3IN5A 3PW7A 4UAZA 3QX7A 2WF9A 5DB8A 4BX9C 4B9VA 4YN4A 4I2GA 1ZRNA 3NUQA 1XO1A 4KLSA 2KG5A 1S0VA 5J8YC 5KFIA 3GILA 1QSSA 2FPLA 2OM6A 4J9QA 2XY6A 2ZXHA 1NK7A 2EZZA 8ICXA 3IG5A 3C21A 4NLNA 5AI4A 1SZHA 4YR0A 2QARB 5ALTA 4QZ8A 3E0FA 1PZNA 5DGBA 4F72A 4K4GA 4BJQA 1GO3F 4FFDA 2PI4A 5KAFU 2W7PA 3PX0A 2QLTA 1VDVA 3GV7B 4R8UB 4DSEA 5ALUA 3ZDEA 2BPCA 4JWNA 2F8LA 3QU2A 4DSJA 3WKBA 1LKYA 5ALKA 1UQVA 4JV0A 4QZIA 4KLDA 4RNOA 3NVYA 1UA0A 3V6HA 4O5CA 1COKA 3MR6A 3C2LA 2FE9A 2LI6A 3JPNA 5J29A 3Q8SB 3HKZC 3THVA 7ICFA 4I2JA 4DL4A 4R64A 1NK4A 4DEZA 2W54A 3PY8A 4O3RA 5AKZA 3NVZA 3ZDBA 9ICQA 3QUBA 1ED1A 2EANA 1PUZA 2Y1IA 5DQGA 1AQ6A 4AYBF 4P2HA 3RH4A 3RJEA 2BQRA 3RFAA 3Q8RB 2E1FA 7ICMA 3UXOA 4Y2RA 3GIKA 4RQMA 2WAQF 2DL0A 4IRCA 2A1JA 3FAHA 1UT5A 2HHSA 5J2GA 1AROP 2W9CB 1H38A 4J9LA 3TFSA 1QCKA 4HYKA 2F44A 1EXNA 1D8YA 5D4BA 3GZFA 1BPZA 1S76D 3IHQB 2QB0B 1PK1B 3C5FA 1NI3A 1QLNA 5AKYA 3D2SA 4UBBA 1MN8A 2I5HA 3O0FA 3HT3A 4TUQA 4M6WA 8ICEA 5DLFA 1X2IA 4ED2A 2KEYA 4KLMA 2NRWA 4QWDA 2LHTA 1Q3VA 2P6RA 3MR3A 9ICKA 1X9SA 1TAUA 1TVAA 2W8LA 5AK5A 3T79A 3PR4A 1NJYA 4I27A 4FZMA 4EYIB 3QNMA 3MGHA 4MFCA 4JWMA 1PVPA 2YN4A 5AM0A 4F2SA 8ICKA 2KP7A 1ZJMA 4UAWA 1IG6A 2E8MA 5KFPA 3RBEA 1LB2B 8ICAA 5AKGA 8ICTA 4JK1A 4FBTA 1OW5A 3C1YA 4Y2XA 2GLEA 3HW8A 4UQGA 4P0PA 2ZIWA 2HHXA 3MGIA 1Z4OA 4YVZA 3HPOA 4P4MA 5DDMA 2G5IB 3TADA 4FZLA 4RPYA 1SL1A 3GIMA 3ISDA 2DUYA 2F8KA 4WJ3B 5EE1A 4YR2A 1RXVA 2YMLA 4KLEA 5KFLA 1ZD5A 4QZFA 2HOIA 4DSFA 3WU2U 1ZQEA 3HILA 3QU9A 4OJPA 2ZTEA 2LYHA 1K5OA 1Z1VA 9ICOA 3ISBA 4R8UA 4F4XA 4ZH4A 2LMRA 3BQ2A 2W55A 1KL9A 2WFAA 3QU4A 2W3SA 2H3ZA 2KICA 4CGZA 1ZYQA 4DQIA 2G06A 4UB8U 3KHRA 4UB2A 2XC9A 8ICJA 5AK6A 4F93B 3OSPA 2G5HB 5L1LA 2H5XA 4OJOA 4EBDA 1S77D 2IHNA 2PFQA 4C7ZA 2AXTU 3TACB 5KFZA 4CNQA 3UQ0A 8ICSA 4C7YA 4DFKA 2ZJ5A 1N5XA 2ZIXB 2MRLA 3K75D 2V4RA 4UARA 1TK0A 1S0MA 4J9SA 1CRXA 5CB1A 2Y0SF 5KFVA 1HUOA 4FZNA 4DQPA 4QZEA 4UB1A 1SWWA 4GIBA 1ZQSA 4Y2JA 2BKEA 1TK5A 4QJFB 4F5QA 8ICWA 5DDYA 3JPTA 4Y2QA 1S0NA 3TFRA 4PZNA 3WK8A 3PW2A 9ICRA 2VA3A 1ZQMA 8ICZA 1KFTA 4JUZA 3OJSA 9ICLA 3PSTA 1TAQA 5AM3A 2IA6A 5AKEA 5D46A 2XVTA 2E8NA 2F1JA 1CEZA 3TANA 4DL6A 4O3NA 2VANA 4Q44A 2QB0A 1RXWA 2A19A 5J0QA 1NJWA 1TK8A 2IOHA 2DPJA 2L5YA 3MC1A 1KEJA 1B43A 3M9OB 5CP2A 5EWFA 1CUKA 3RB3A 2D8CA 1J2NA 2ZIVB 2Z7JA 2ZIUB 1L7NA 1T4GA 5ALIA 5AM5A 4MF2A 1S10A 1KSPA 5DBCA 2HBJA 2JEFA 2LYAA 2XI9A 2FLLA 1SKSA 3CRXA 2ZG6A 2W03A 2PMZF 2I1QA 4DF8A 3HRDD 7ICLA 2MA1A 4IR9A 1X6JA 3PX4A 1Q46A 4ECVA 4UB6U 2EH9A 1QQ6A 4CE6A 2HMXA 1SV4A 3ORYA 2HHUA 3M6KA 4NLZA 2E5SA 4DFMA 3K1RB 4BDPA 1U47A 2UVRA 1QSLA 4Q8FA 2DBYA 2IMWP 1QQ5A 2NYVA 3MGVA 2XGQA 3E58A 4F92B 3EW9A 3Q8LA 1MQ3A 3C5GA 2ZJ8A 7ICKA 2O6KA 3N4MB 4CF5A 5J2KA 2VA8A 1ZQFA 4F4YA 1SXEA 2YMQA 1SWVA 1RYSA 1FEZA 5KG6A 2KFNA 8ICBA 2G09A 2W04A 3GV8B 3QEBZ 2BCQA 4BUGA 9ICEA 4OJ6A 3EZ5A 3FC4A 3PMNA 1CI4A 5KAIU 5IIOA 2GO7A 3Q8KA 1J2MA 4Z6FA 2UVWA 2PFPA 5BOLA 7ICJA 3C2KA 4I2EA 3ZDAA 2RHFA 5KFSA 4J9OA 4O3QA 1ZQBA 1C7YA 2KVCA 4DQRA 1NZBA 5J2IA 1PK3A 2BR0A 4IQVA 4F3OA 5EE0A 2P6UA 4YXJA 4EEYA 9ICXA 2MSNA 3H7IA 4P4PA 3NRWA 4QZGA 2WB1C 5CWRA 2HI0A 1JIHA 3PNCA 4IQTA 3ISCA 3GIIA 9ICSA 5J2JA 1V97A 3OJUA 4LVSA 1HEKA 4PH5A 5ALFA 4ECYA 3MBYA 4FO6A 1NJXA 3BJYA 3C28A 1TAMA 3B9JA 4RQ5A 1IXRA 4PGYA 5KFCA 1RYRA 3KHHA 4QZCA 3V7KA 4XRHA 4GFJA 5ALWA 2KE7A 3PZPA 3QUCA 3KD3A 1O03A 4C4TA 3KTQA 2HDOA 4Y2PA 1NK5A 4F2RA 2KSOB 5J0PA 5KFNA 8ICRA 1ZQ1C 2KFZA 4DSKA 2CXYA 2HHTA 4O3PA 2B0CA 3WKDA 4MEXA 4YXMA 2W9BB 4RQ7A 4JV2A 1XU4A 2ZTCA 4MFAA 4PHPA 1BNOA 5IIJA 2W7OA 4UATA 7ICIA 1ZD3A 2AJQA 4NLCA 4NL9A 4C80A 4ELVA 5KT2A 2HHWA 1BPBA 1D9FA 4QW9A 4US8A 3SAGA 4F5PA 1NJZA 4EX7A 4IC9A 2XIDA 2K89A 1SV0A 1JMSA 3F5EA 1SGGA 2KJ9A 3OGUA 5J0YA 5H2FU 4LZDA 1C20A 2ES6A 3BS5A 5HR6A 1N61A 4F5RA 4M2YA 1L6NA 4F50A 4O0IA 1SL0A 3K1ZA 3BDPA 2DKXA 1BNPA 5KFMA 1B22A 2RDJA 3IRUA 2KHQA 4CCHA 3RR7A 1ZQAA 4ED3A 4YP3A 2BPFA 2OWOA 9ICHA 4QIWF 1HUZA 4EX6A 4AP9A 5B5EU 5KG1A 2K60A 4Z6EA 5AI5A 2EDUA 2MAXA 4LZGA 4C4SA 3KHGA 2BQ3A 4BGDA 3QEAZ 4YMOA 5J0TA 1KFDA 3MFHA 1N60A 1ZQQA 1FIQA 4EBCA 1KW4A 4ED8A 1WCNA 4RZRA 3SAHA 2BPGA 1K1QA 5CA7A 5ALLA 4O5KA 5C5JA 4NM1A 4G3IA 1JRPA 4A8EA 3AMZA 1T94A 1Z4NA 2ZUBA 4ECZA 3M8SA 1ZQNA 4M9LA 2E8PA 5B66U 5IIIA 1FFVA 9ICTA 2JH7A 3F2CA 4JV1A 3WK4A 1NKBA 1N62A 1BVSA 2KHVA 7ICTA 5AI8A 1SL2A 4U6PA 3KKAA 1DK2A 2A3VA 2G0AA 2ASJA 4I2CA 3J81j 3QU5A 4C8NA 8ICNA 1BGXT 2XCPA 4F71A 2B6GA 4F91B 2C2RA 2FMSA 4M47A 4I2HA 5KFEA 4NJ8A 1MSWD 1RZTA 4DL7A 5C0YA 3ETRA 3B0XA 1YZ6A 1ZQZA 1ZQRA 2KIWA 5JTIA 3ZI4A 8ICCA 3WKEA 2KZ3A 3SD7A 4ECRA 4XUSA 1KBUA 4J9MA 9ICMA 2E3TA 2XCAA 1ZETA 3TAPA 5DQIA 4O9MA 3OHBA 1O08A 4Y2UA 5AKIA 4Z6CA 2D6FC 5KFWA 2C28A 2J6TA 3QXGA 2FLNA 7ICEA 2BCUA 3I1YA 3IM1A 5KFUA 2PFOA 9ICPA 1Y88A 5GTIU 1P7DA 3LVWA 3MR5A 1U4BA 2MUTB 2RDIA 5JRTA 2R8GA 9ICCA 1RYUA 1BPDA 5L1MA 8ICQA 3EPGA 3IG8A 3UXPA 4PL1A 1F5SA 4DFDA 4B6JA 4YR3A 4P0QB 3RAXA 2KNJA 3PSFA 4YMNA 2JEGA 7ICVA 5ALDA 1X9WA 5ALSA 5D49A 2PKEA 2BDUA 3CNHA 4JB3A 3TAQA 2YTUA 4CDGA 4DOBA 2C22A 1Z19A 1PVRA 2K8CB 2EAPA 4DLEA 2Y1JA 3UPQA 5KFRA 2FPKA 5J8YA 3M9NB 2UVUA 1A0PA 2OHFA 2FDRA 4HAIA 2QARA 5HHHA 3SYZA 2P66A 1VLBA 4JMUA 4QZBA 2QKQA 4R66A 3H8JA 5KFBA 7ICQA 1S5LU 1JI7A 3PO5A 5ALXA 3PW0A 2FLPA 3NVWA 2DFLA 4EZ6A 4R65A 1ZQJA 4RUAA 1HIWA 4ED7A 4PGXA 3H8WA 4U7CA 1N56A 5IILA 4NLGA 2HOQA 2H3VA 4DCCA 2RLTA 2H3QA 2GOLA 2DQNB 2V4QA 4QZHA 5AM1A 2W3RA 1QSYA 4MFFA 3QE9Y 2E1EA 2K4IA 3RJGA 8ICMA 3KZXA 3U26A 1URJA 4MEYA 2R8KA 7ICRA 1KDHA 4NM2A 3AL0B 5J0SA 2IOFK 1SKWA 1COOA 1L7OA 3SQIA 4FS2A 2OYYA 2EAMA 1D9DA 3L5KA 4NWIA 2A1AA 1ZQXA 5J2DA 5DGAA 4UB3A 4RQNA 5TISU 2QB1A 4P4OA 4UAVA 4ECQA 4B9SA 4US9A 1Z00B 5AI6A 3SV3A 3K4GA 5KFYA 3AU6A 3F53A 3GU3A 1JX4A 5EWGA 1X6IA 1TE2A 4DFJA 5GTHU 3SEIA 1U48A 1NK8A 1A77A 4DSLA 1NZPA 1J97A 3H0MB 2DKZA 4DQQA 3PR5B 4BXOB 5G5HA 5DQHA 4QWAA 2AQ4A 5CRXA 1RM6C 8ICUA 1BPEA 4NXZA 2E8OA 7ICHA 5KT7A 3B0YA 3IV6A 4ECSA 4UAUA 3H8MA 2W9CA 4RUCA 3HKZF 3TARA 3H0RB 1PK1A 3RR8A 1F44A 4I28A 5AK3A 3CYMA 2HVHA 4IL6U 7ICGA 2YB4A 2KTQA 4O5EA 3KBBA 1KFSA 2M0NA 2YB1A 3LWMA 8ICYA 4B9TA 5EWEA 2JMGA 2HHQA 4QZAA 1ZOLA 9ICIA 2IOFA 3WKCA 1A6SA 2Y9UA 4QZDA 1KQQA 4DLGA 5ALEA 5AK4A 3RB6A 3RTVA 3NVVA 4DQSA 4C8OA 5DKWA 8ICHA 4P0QA 2K4EA 3OPXA 3ED5A 2JH1A 4Q8EA 5KT3A 2ZXIA 4DF4A 3ICXA 3M7DA 3BS7A 4B9LA 4RT2A 2JXJA 3QZ8A 7ICOA 2LM1A 4EBEA 1L3TA 4PJ0U 3QU7A 5DBAA 2FMQA 3ZD9A 5G5GA 2BZFA 9ICVA 3UQ2A 1OXJA 4YD1A 4NY8A 2KOBA 3SAFA 4IRKA 4CF3A 2VA2A 5J0OA 3PW4A 5KG7A 5E79U 5JU5A 2VJ5A 1PVQA 2JGAA 2K4HA 3TI0A 1TFRA 3RRHA 4TURA 4YG2A 8ICVA 3EYZA 1M6YA 2YMPA 2YMMA 3LDAA 1UHUA 2KK0A 1RDFA 1F0MA 4PPXA 4F4KA 4TUSA 4MF8A 2ATLA 2MU2A 2BCVA 5AKHA 4YMMA 3OSNA 9ICFA 5ALVA 3C2MA 4QW8A 4AYBC 4PL2A 5KFDA 1L7PA 1NK0A 3ALRA 5J2EA 1N2XA 1T3NA 2ZJAA 3DEEA 1ZQDA 1KN5A 2WF6A 4IS7A 5EE3A 4K4IA 1V9PA 3M9MB 2DF4B 3MABA 2WF5A 1D8LA 3PMLA 1DXSA 4KMOB 1XO0A 4YD2A 1L8OA 3F2DA 2IHMA 2NRTA 3TKAA 1Z00A 2ZIXA 2XGPA 3C23A 4M9GA 1Z1BA 3BZCA 4CRXA 4KLIA 4KLOA 2I6XA 4B9MA 1UPHA 4YQWA 2AH5A 1HJPA 5EE9A 5KFAA 4BXOA 2OEHA 1ZQPA 4B9UA 3QUQA 3JPOA 4QWBA 4ED0A 2AHOB 2W9MA 3PX6A 4DWIA 3ONNA 4EELA 5KTQA 3DV9A 1X66A 2KV2A 2W9AA 4KLJA 2AGOA 5J2BA 2NRXA 2KIVA 3PW5A 2B21A 1JROA 3OHAA 2W43A 3C1ZA 4RQ8A 4DS5A 4GXIA 1ZQYA 2KZZA 2ZTDA 1ZQHA 4KLHA 2HBMA 4IRDA 1JN3A 1NK9A 5KL8B 4ELUA 2KJ5A 2D3DA 4DO9A 2Y9TA 4K4HA 2ZIVA 4KN7A 2JEIA 1XSLA 3S6JA 5L1IA 5BOMA 2HOFA 1YZ7A 3SI8A 2H3IA 1NOMA 2ZIUA 3MDAA 4PHDA 1DGSA 1B4FA 3UMBA 5HMLA 3EUB2 5J2CA 4M6WB 5DB7A 9ICGA 3GQCA 3Q8MA 3UMCA 2PXIA 4J03A 4F4WA 3JPQA 5KL1B 2J6SA 4Y2VA 4F8RA 5AICA 2KMDA 4NLBA 3ZDDA 4UB4A 2BHNA 2ODGA 5J2HA 3LWLA 2W11A 2PFNA 4DS4A 3BQ1A 4FBUA 4ECXA 4I2BA 2R8HA 5EOZA 4RQ3A 3ZD8A 1KLNA 2ZIWB 3CW2C 4PHEA 2LYBA 1ZD4A 3NGDA 2VJ4A 2Q0ZX 1XS9D 3VCBA 4RQ0A 3TADC 1Z3EB 1N5WA 1S0OA 4UAYA 1T3QA 4ECUA 3I76A 3KHLA 2BCRA 5K4LA 9ICUA 1VJ5A 4GC7A 3RJFA 4E0DA 1BPXA 1ZQIA 5AKXA 2DWQA 2YY6A 4ED6A 4I2FA 1SXDA 4NLKA 4KLGA 3NRZA 2Y0SC 4PGQA 2FMPA 2DGZA 1ECWA 1L5UA 5FP0A 2HW3A 4KMUA 5DLGA 4KLUA 4IR1A 3SV4A 2ISOA 4UASA 4J9KA 3N7RC 2GWSA 3AU2A 8ICLA 4KN4A 5KNIA 1FO4A 2AQ0A 3RAQA 4RQ1A 1V38A 2RQ5A 2EQYA 5AM4A 2JRZA 3KOOA 2DPIA 3A0BU 3A0HU 4J9NA 1N63A 4Q45A 3IP4B 3QUTA 2OCEA 1IV8A 5KT4A 2Q4TA 5J0XA 3T3FA 3M8RA 3VC8A 3HX0A 2N1RA 4PZOA 5KFQA 2VIXA 5AI0A 5J2AA 5J0UA 5AKKA 8ICPA 3H8SA
chains in the Genus database with same CATH topology
2E1EA 3HKZC 2D6FC 2K4IA 3N7PD 1Z1BA 2CPRA 1CRXA 4KX3A 2Y0SF 3KZXA 4P0QA 1URJA 4FZNA 4QIWF 2K4EA 3OPXA 3AQEA 3M6ZA 3C28A 1TAMA 4CRXA 2JH1A 3AL0B 2ZIWB 4KX5A 2F77X 1UPHA 2ZXIA 1P7DA 4P0PA 2ZIWA 3ICXA 3M7DA 3LVWA 2WAQC 2LYBA 3MGVA 1YT3A 2VJ4A 4GFJA 3SQIA 2OYYA 3PZPA 4NWIA 3C29A 3VCBA 4QJFB 3LYSA 3IG8A 1OUQA 3F2BA 2K8BB 1ED1A 2G5IB 4PL1A 5HR7A 2PMZC 2JHDA 3ONNA 1ZQ1C 3PSIA 5A0LA 2OH2A 2HBLA 4ICAA 2KJ8A 2KOBA 4AYBF 3D2NA 1Q3UA 4FZLA 3PSTA 2H3FA 4P0QB 4OJLA 3F53A 2KV2A 3GU3A 4QNLA 3SAFA 2XVTA 2KNJA 3LVVA 3PSFA 3SAHA 1IIPA 2XICA 4P0PB 3RFAA 3IN5A 4WJ3B 2E1FA 4BX9C 3H0MB 4FE3A 2CRXA 2BDUA 2VJ5A 1PVQA 1WUDA 4CDGA 3NUQA 3KFUF 2WAQF 2JGAA 1MA7A 5T14A 2KKVA 2K4HA 2LBOA 4A8EA 1Z19A 1PVRA 2HOIA 2W7OA 3PSPA 5CRXA 1T94A 2G09A 2HBMA 2W04A 2K8CB 2Y0SC 2HBKA 2RRDA 2NV3A 3RF9A 4QIWC 2DGZA 2OM6A 2WB1F 1ECWA 4NLCA 5KL8B 4BUGA 4OJPA 2KKPA 3CP8A 2KJ5A 4OJ6A 2ZXHA 2JH7A 2R18A 3F2CA 2ZIVB 4OJ5A 3L3FX 3IG5A 2Z7JA 3SMVA 2KHVA 2ZIVA 2GH1A 2VKQA 1A0PA 4U6PA 4O3MA 3HKZF 3GZFA 2A3VA 4NV0A 1SZHA 3N7RC 1DRGA 2HOFA 3H0RB 2G0AA 2ZIUB 2H3IA 3E0FA 2H3ZA 2ZIUA 2KICA 2RHFA 4CGZA 4JMUA 3SAGA 2YX8A 3N7SC 3D2SA 2RP5A 1F44A 3O0FA 2G06A 3CYMA 4IC9A 2HBJA 2KVCA 2LYAA 2XI9A 4BJQA 4AYBC 2XIDA 1GO3F 2K89A 4PL2A 2YB4A 3CRXA 2W7PA 2KEYA 4C0ZA 5C0YA 2ZG6A 3ALRA 2G5HB 3F5AA 1NZBA 2M0NA 5KL1B 3F5EA 2W03A 2LHTA 2YB1A 2KJ9A 2LKYA 3AQFA 3IP4B 2G07A 2PMZF 4OJOA 1HIWA 2KIWA 1Q3VA 2F8LA 2Q4TA 1XNSA 4U7CA 2CN1A 3DEEA 4NLBA 2JMGA 3H0LB 5HR6A 2K8AA 3T79A 3VC8A 2F76X 2MA1A 2KD1A 2OXOA 1D8BA 3NRWA 4FZMA 2HOQA 2H3VA 2DF4B 2N1RA 1L6NA 3D2QA 3K1ZA 1KBUA 2F2AB 2H3QA 2GOLA 4OO1J 1A6SA 4KMOB 2VIXA 2WB1C 2DQNB 1XO0A 1PVPA 2HMXA 3F2DA 2G08A 2KHQA 2ZIXB 4ACOA 2MRLA 2ZIXA 3M6KA 2E5SA 1HEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4I A;  2H3F A;  2K4E A;  1HIW A;  1TAM A;  2JMG A;  1UPH A;  2LYB A;  2H3V A;  2H3I A;  2N1R A;  2H3Z A;  1L6N A;  4JMU A;  2H3Q A;  2GOL A;  1A6S A;  2HMX A;  4IC9 A;  2K4H A;  2LYA A;  1ED1 A;  2NV3 A;  1ECW A;  4ICA A;  1HEK A; 
#chains in the Genus database with same CATH topology
 4UBC A;  4KX3 A;  4I2I A;  4KLT A;  2KZM A;  3AEV A;  3FDS A;  3OTQ A;  1ZD2 P;  9ICJ A;  5CJ7 A;  5F9N A;  2R8I A;  4EEK A;  3LYS A;  1OUQ A;  4I2A A;  3F2B A;  2K8B B;  1QH9 A;  2PMZ C;  2KSO A;  3LK9 A;  4G9B A;  4CF4 A;  3NAS A;  2H3F A;  4OJL A;  3BQT A;  5ALR A;  4I2D A;  3LVV A;  5KG3 A;  7ICN A;  4DFP A;  5KT6 A;  1ZQL A;  5CR0 A;  1LV5 A;  2LPE A;  3I28 A;  4FE3 A;  5KFJ A;  2W9B A;  1WUD A;  3KFU F;  4RNN A;  5KFO A;  5KG2 A;  4DL3 A;  3JPP A;  3RF9 A;  5IIK A;  2WB1 F;  8ICF A;  3CP8 A;  1NNL A;  2R18 A;  4IQU A;  3MR2 A;  1L7M A;  5AHX A;  3SMV A;  2AGQ A;  2VKQ A;  2WTF A;  3NS1 A;  3RJI A;  4F4Z A;  5DB6 A;  2LM4 A;  5KFK A;  2HHV A;  1WYG A;  3N7S C;  2RP5 A;  1L3S A;  3RH5 A;  3RBD A;  3FYH A;  3AM9 A;  5J2F A;  4Y2T A;  3F5A A;  4EEN A;  2HCF A;  3TQ1 A;  5KG4 A;  1JXL A;  5L1J A;  3WKA A;  4OCZ A;  3MFI A;  5AIB A;  2OXO A;  4DOC A;  1T8E A;  4QZ9 A;  3BQ7 A;  5F9L A;  2F2A B;  4OO1 J;  2F3N A;  1UA1 A;  1WCL A;  3PVX A;  5IIN A;  3NTU A;  5KFX A;  1S9F A;  2HSZ A;  2JZB B;  2ALZ A;  5CEH A;  2ISP A;  4R63 A;  3GIJ A;  2JEJ A;  4YCX A;  1JXE A;  5CHG A;  5AKJ A;  1ZQK A;  2BQU A;  1DOQ A;  2FJ6 A;  5ALM A;  1L3U A;  1X9X A;  1YT3 A;  3EWA A;  2NO4 A;  1RQN A;  5TZV A;  1BPY A;  1WG8 A;  2HBL A;  1XSN A;  5DG9 A;  1ZQO A;  2EZY A;  1U49 A;  5KG5 A;  3PV8 A;  3Q8Q B;  3JPR A;  2BDP A;  5AKL A;  9ICA A;  3MDC A;  3E2E A;  5ALG A;  2NO5 A;  5KFT A;  2KKV A;  4J9R A;  2PI5 A;  1DGJ A;  1ZQW A;  2RRD A;  3H4B A;  1N48 A;  2JR5 A;  3HP6 A;  2I9G A;  2P35 A;  1B0X A;  2AU0 A;  4OJ5 A;  1X40 A;  3T5J A;  1X9M A;  2XY5 A;  2ASL A;  4NV0 A;  1DRG A;  1WWU A;  4F5O A;  5L9X A;  2ZUD A;  3SEN A;  4LJX A;  5DG8 A;  4ELT A;  1L3V A;  2JV3 A;  1ZQT A;  4M9N A;  4TUP A;  1TKD A;  1SKR A;  1KRP A;  3UM9 A;  4RT3 A;  3T5H A;  4IQW A;  2WF8 A;  1XNS A;  5KFG A;  2CN1 A;  3FM9 A;  1MC8 A;  2KD1 A;  5HHI A;  1ZRM A;  9ICB A;  4MHV A;  1S8O A;  3IDW A;  5IIM A;  1FFU A;  5KT5 A;  4GC6 A;  5KFH A;  2XO7 A;  1KTQ A;  3G6Y A;  1XC9 A;  2CPR A;  2XY7 A;  4UB5 A;  8ICO A;  3AQE A;  4C8L A;  2F77 X;  4TQR A;  4GXJ A;  4DL5 A;  5ALZ A;  3RB4 A;  1V85 A;  2MUT A;  1RG6 A;  4M9H A;  3C29 A;  1SB3 C;  5ALJ A;  2UVV A;  3PO4 A;  3AUO A;  4C8K A;  4KLF A;  5L1K A;  1UCV A;  1UT8 A;  3D6J A;  3PSI A;  4ECT A;  5A0L A;  2HVI A;  4XA5 A;  1IM4 A;  3D2N A;  3JPS A;  5HP4 A;  3ZDC A;  4Y2Y A;  1KKX A;  3R9K A;  4EYH B;  3WK9 A;  2NRV A;  4RQ2 A;  3Q8P B;  3N28 A;  4C8M A;  4NL9 C;  2EZX A;  2WHE A;  4KLL A;  2HBK A;  2NV3 A;  4QIW C;  5ALQ A;  1QTM A;  9ICW A;  5ALN A;  2KKP A;  7ICU A;  3BQ0 A;  2R8J A;  3T5L A;  2FI1 A;  2GH1 A;  4BWM A;  4O3M A;  4M0A A;  3EPI A;  3RJK A;  4O3S A;  4I29 A;  3L4P A;  2YX8 A;  1SV0 C;  5ALP A;  3SZ2 A;  2ASD A;  3RJH A;  4GLX A;  4Y2S A;  2JZB A;  4Q43 A;  1TV9 A;  2LKY A;  3AQF A;  3G6X A;  2G07 A;  2K4P A;  2YQE A;  4KIT B;  1RPL A;  3BS5 B;  4KTQ A;  7ICP A;  3H0L B;  1NKC A;  2K8A A;  2F76 X;  5JUM A;  4M9J A;  3D2Q A;  3V6K A;  3WK7 A;  2EAO A;  2W8K A;  5J0R A;  1L8L A;  1JAL A;  4DL2 A;  4QWE A;  1DK3 A;  5ALO A;  3QZ7 A;  1SIJ A;  3N7P D;  5KFF A;  3HJE A;  5AM2 A;  1MQ2 A;  3M6Z A;  5J0W A;  3H40 A;  5HNK A;  4KX5 A;  2KVS A;  1LKY B;  5ALH A;  4C4R A;  4F5N A;  2WAQ C;  8ICI A;  2AGP A;  4O3O A;  2NRZ A;  4RPZ A;  1NKE A;  2F1H A;  1SZP A;  2KN7 A;  1ZJN A;  2JHD A;  4EZ9 A;  2OH2 A;  3KZI U;  5ALY A;  1Q8K A;  4BWJ A;  4QNL A;  3RH6 A;  5DB9 A;  1XSP A;  2XIC A;  5KG0 A;  1ZXI A;  5F3X B;  5DG7 A;  3RJJ A;  2CRX A;  4FS1 A;  1ZQC A;  1MA7 A;  4TQS A;  5AI9 A;  4YFK A;  1T7P A;  5T14 A;  2LBO A;  4QWC A;  4RPX A;  2C2E A;  3PSP A;  3GFK B;  2IBK A;  4J9P A;  3G6V A;  4RQ6 A;  2V9W A;  2M9N A;  2J6U A;  3WK6 A;  1ZQV A;  5HMM A;  3KKA C;  3V6J A;  1LVH A;  3L3F X;  5AIA A;  3HWT A;  2WF7 A;  3DDH A;  5DBB A;  4RU9 A;  1X42 A;  2A1J B;  4KLQ A;  1ZQU A;  1JUD A;  4OD0 A;  2F1I A;  4PHA A;  3ETL A;  4C0Z A;  4M04 A;  2FPM A;  3H4D A;  2C2D A;  2ZUC A;  3SR6 A;  1D8B A;  1RQL A;  4DSI A;  1U9L A;  5BPC A;  3RB0 A;  3UMG A;  4B9N A;  3V7J A;  2G08 A;  3UXN A;  1WWV A;  4ACO A;  3GV5 B;  1NK6 A;  3QYP A;  3V72 A;  3AN1 A;  3RRG A;  4UW9 A;  1ZQG A;  3T5K A;  2BGW A;  4DOA A;  1XWL A;  2BCS A;  1S97 A;  2ESE A;  3BZK A;  9ICN A;  4XQ8 A;  3N97 B;  1QQ7 A;  4ECW A;  4USA A;  4GXK A;  3WK5 A;  8ICG A;  1K1S A;  5HR7 A;  7ICS A;  4Z6D A;  1U45 A;  4ICA A;  3GDX A;  1A76 A;  3V7L A;  2KJ8 A;  1Q3U A;  4ED1 A;  3M1Y A;  4RNM A;  4RQ4 A;  4X5V A;  4ZOH C;  1IIP A;  4P0P B;  3IN5 A;  3PW7 A;  4UAZ A;  3QX7 A;  2WF9 A;  5DB8 A;  4BX9 C;  4B9V A;  4YN4 A;  4I2G A;  1ZRN A;  3NUQ A;  1XO1 A;  4KLS A;  2KG5 A;  1S0V A;  5J8Y C;  5KFI A;  3GIL A;  1QSS A;  2FPL A;  2OM6 A;  4J9Q A;  2XY6 A;  2ZXH A;  1NK7 A;  2EZZ A;  8ICX A;  3IG5 A;  3C21 A;  4NLN A;  5AI4 A;  1SZH A;  4YR0 A;  2QAR B;  5ALT A;  4QZ8 A;  3E0F A;  1PZN A;  5DGB A;  4F72 A;  4K4G A;  4BJQ A;  1GO3 F;  4FFD A;  2PI4 A;  5KAF U;  2W7P A;  3PX0 A;  2QLT A;  1VDV A;  3GV7 B;  4R8U B;  4DSE A;  5ALU A;  3ZDE A;  2BPC A;  4JWN A;  2F8L A;  3QU2 A;  4DSJ A;  3WKB A;  1LKY A;  5ALK A;  1UQV A;  4JV0 A;  4QZI A;  4KLD A;  4RNO A;  3NVY A;  1UA0 A;  3V6H A;  4O5C A;  1COK A;  3MR6 A;  3C2L A;  2FE9 A;  2LI6 A;  3JPN A;  5J29 A;  3Q8S B;  3HKZ C;  3THV A;  7ICF A;  4I2J A;  4DL4 A;  4R64 A;  1NK4 A;  4DEZ A;  2W54 A;  3PY8 A;  4O3R A;  5AKZ A;  3NVZ A;  3ZDB A;  9ICQ A;  3QUB A;  1ED1 A;  2EAN A;  1PUZ A;  2Y1I A;  5DQG A;  1AQ6 A;  4AYB F;  4P2H A;  3RH4 A;  3RJE A;  2BQR A;  3RFA A;  3Q8R B;  2E1F A;  7ICM A;  3UXO A;  4Y2R A;  3GIK A;  4RQM A;  2WAQ F;  2DL0 A;  4IRC A;  2A1J A;  3FAH A;  1UT5 A;  2HHS A;  5J2G A;  1ARO P;  2W9C B;  1H38 A;  4J9L A;  3TFS A;  1QCK A;  4HYK A;  2F44 A;  1EXN A;  1D8Y A;  5D4B A;  3GZF A;  1BPZ A;  1S76 D;  3IHQ B;  2QB0 B;  1PK1 B;  3C5F A;  1NI3 A;  1QLN A;  5AKY A;  3D2S A;  4UBB A;  1MN8 A;  2I5H A;  3O0F A;  3HT3 A;  4TUQ A;  4M6W A;  8ICE A;  5DLF A;  1X2I A;  4ED2 A;  2KEY A;  4KLM A;  2NRW A;  4QWD A;  2LHT A;  1Q3V A;  2P6R A;  3MR3 A;  9ICK A;  1X9S A;  1TAU A;  1TVA A;  2W8L A;  5AK5 A;  3T79 A;  3PR4 A;  1NJY A;  4I27 A;  4FZM A;  4EYI B;  3QNM A;  3MGH A;  4MFC A;  4JWM A;  1PVP A;  2YN4 A;  5AM0 A;  4F2S A;  8ICK A;  2KP7 A;  1ZJM A;  4UAW A;  1IG6 A;  2E8M A;  5KFP A;  3RBE A;  1LB2 B;  8ICA A;  5AKG A;  8ICT A;  4JK1 A;  4FBT A;  1OW5 A;  3C1Y A;  4Y2X A;  2GLE A;  3HW8 A;  4UQG A;  4P0P A;  2ZIW A;  2HHX A;  3MGI A;  1Z4O A;  4YVZ A;  3HPO A;  4P4M A;  5DDM A;  2G5I B;  3TAD A;  4FZL A;  4RPY A;  1SL1 A;  3GIM A;  3ISD A;  2DUY A;  2F8K A;  4WJ3 B;  5EE1 A;  4YR2 A;  1RXV A;  2YML A;  4KLE A;  5KFL A;  1ZD5 A;  4QZF A;  2HOI A;  4DSF A;  3WU2 U;  1ZQE A;  3HIL A;  3QU9 A;  4OJP A;  2ZTE A;  2LYH A;  1K5O A;  1Z1V A;  9ICO A;  3ISB A;  4R8U A;  4F4X A;  4ZH4 A;  2LMR A;  3BQ2 A;  2W55 A;  1KL9 A;  2WFA A;  3QU4 A;  2W3S A;  2H3Z A;  2KIC A;  4CGZ A;  1ZYQ A;  4DQI A;  2G06 A;  4UB8 U;  3KHR A;  4UB2 A;  2XC9 A;  8ICJ A;  5AK6 A;  4F93 B;  3OSP A;  2G5H B;  5L1L A;  2H5X A;  4OJO A;  4EBD A;  1S77 D;  2IHN A;  2PFQ A;  4C7Z A;  2AXT U;  3TAC B;  5KFZ A;  4CNQ A;  3UQ0 A;  8ICS A;  4C7Y A;  4DFK A;  2ZJ5 A;  1N5X A;  2ZIX B;  2MRL A;  3K75 D;  2V4R A;  4UAR A;  1TK0 A;  1S0M A;  4J9S A;  1CRX A;  5CB1 A;  2Y0S F;  5KFV A;  1HUO A;  4FZN A;  4DQP A;  4QZE A;  4UB1 A;  1SWW A;  4GIB A;  1ZQS A;  4Y2J A;  2BKE A;  1TK5 A;  4QJF B;  4F5Q A;  8ICW A;  5DDY A;  3JPT A;  4Y2Q A;  1S0N A;  3TFR A;  4PZN A;  3WK8 A;  3PW2 A;  9ICR A;  2VA3 A;  1ZQM A;  8ICZ A;  1KFT A;  4JUZ A;  3OJS A;  9ICL A;  3PST A;  1TAQ A;  5AM3 A;  2IA6 A;  5AKE A;  5D46 A;  2XVT A;  2E8N A;  2F1J A;  1CEZ A;  3TAN A;  4DL6 A;  4O3N A;  2VAN A;  4Q44 A;  2QB0 A;  1RXW A;  2A19 A;  5J0Q A;  1NJW A;  1TK8 A;  2IOH A;  2DPJ A;  2L5Y A;  3MC1 A;  1KEJ A;  1B43 A;  3M9O B;  5CP2 A;  5EWF A;  1CUK A;  3RB3 A;  2D8C A;  1J2N A;  2ZIV B;  2Z7J A;  2ZIU B;  1L7N A;  1T4G A;  5ALI A;  5AM5 A;  4MF2 A;  1S10 A;  1KSP A;  5DBC A;  2HBJ A;  2JEF A;  2LYA A;  2XI9 A;  2FLL A;  1SKS A;  3CRX A;  2ZG6 A;  2W03 A;  2PMZ F;  2I1Q A;  4DF8 A;  3HRD D;  7ICL A;  2MA1 A;  4IR9 A;  1X6J A;  3PX4 A;  1Q46 A;  4ECV A;  4UB6 U;  2EH9 A;  1QQ6 A;  4CE6 A;  2HMX A;  1SV4 A;  3ORY A;  2HHU A;  3M6K A;  4NLZ A;  2E5S A;  4DFM A;  3K1R B;  4BDP A;  1U47 A;  2UVR A;  1QSL A;  4Q8F A;  2DBY A;  2IMW P;  1QQ5 A;  2NYV A;  3MGV A;  2XGQ A;  3E58 A;  4F92 B;  3EW9 A;  3Q8L A;  1MQ3 A;  3C5G A;  2ZJ8 A;  7ICK A;  2O6K A;  3N4M B;  4CF5 A;  5J2K A;  2VA8 A;  1ZQF A;  4F4Y A;  1SXE A;  2YMQ A;  1SWV A;  1RYS A;  1FEZ A;  5KG6 A;  2KFN A;  8ICB A;  2G09 A;  2W04 A;  3GV8 B;  3QEB Z;  2BCQ A;  4BUG A;  9ICE A;  4OJ6 A;  3EZ5 A;  3FC4 A;  3PMN A;  1CI4 A;  5KAI U;  5IIO A;  2GO7 A;  3Q8K A;  1J2M A;  4Z6F A;  2UVW A;  2PFP A;  5BOL A;  7ICJ A;  3C2K A;  4I2E A;  3ZDA A;  2RHF A;  5KFS A;  4J9O A;  4O3Q A;  1ZQB A;  1C7Y A;  2KVC A;  4DQR A;  1NZB A;  5J2I A;  1PK3 A;  2BR0 A;  4IQV A;  4F3O A;  5EE0 A;  2P6U A;  4YXJ A;  4EEY A;  9ICX A;  2MSN A;  3H7I A;  4P4P A;  3NRW A;  4QZG A;  2WB1 C;  5CWR A;  2HI0 A;  1JIH A;  3PNC A;  4IQT A;  3ISC A;  3GII A;  9ICS A;  5J2J A;  1V97 A;  3OJU A;  4LVS A;  1HEK A;  4PH5 A;  5ALF A;  4ECY A;  3MBY A;  4FO6 A;  1NJX A;  3BJY A;  3C28 A;  1TAM A;  3B9J A;  4RQ5 A;  1IXR A;  4PGY A;  5KFC A;  1RYR A;  3KHH A;  4QZC A;  3V7K A;  4XRH A;  4GFJ A;  5ALW A;  2KE7 A;  3PZP A;  3QUC A;  3KD3 A;  1O03 A;  4C4T A;  3KTQ A;  2HDO A;  4Y2P A;  1NK5 A;  4F2R A;  2KSO B;  5J0P A;  5KFN A;  8ICR A;  1ZQ1 C;  2KFZ A;  4DSK A;  2CXY A;  2HHT A;  4O3P A;  2B0C A;  3WKD A;  4MEX A;  4YXM A;  2W9B B;  4RQ7 A;  4JV2 A;  1XU4 A;  2ZTC A;  4MFA A;  4PHP A;  1BNO A;  5IIJ A;  2W7O A;  4UAT A;  7ICI A;  1ZD3 A;  2AJQ A;  4NLC A;  4NL9 A;  4C80 A;  4ELV A;  5KT2 A;  2HHW A;  1BPB A;  1D9F A;  4QW9 A;  4US8 A;  3SAG A;  4F5P A;  1NJZ A;  4EX7 A;  4IC9 A;  2XID A;  2K89 A;  1SV0 A;  1JMS A;  3F5E A;  1SGG A;  2KJ9 A;  3OGU A;  5J0Y A;  5H2F U;  4LZD A;  1C20 A;  2ES6 A;  3BS5 A;  5HR6 A;  1N61 A;  4F5R A;  4M2Y A;  1L6N A;  4F50 A;  4O0I A;  1SL0 A;  3K1Z A;  3BDP A;  2DKX A;  1BNP A;  5KFM A;  1B22 A;  2RDJ A;  3IRU A;  2KHQ A;  4CCH A;  3RR7 A;  1ZQA A;  4ED3 A;  4YP3 A;  2BPF A;  2OWO A;  9ICH A;  4QIW F;  1HUZ A;  4EX6 A;  4AP9 A;  5B5E U;  5KG1 A;  2K60 A;  4Z6E A;  5AI5 A;  2EDU A;  2MAX A;  4LZG A;  4C4S A;  3KHG A;  2BQ3 A;  4BGD A;  3QEA Z;  4YMO A;  5J0T A;  1KFD A;  3MFH A;  1N60 A;  1ZQQ A;  1FIQ A;  4EBC A;  1KW4 A;  4ED8 A;  1WCN A;  4RZR A;  3SAH A;  2BPG A;  1K1Q A;  5CA7 A;  5ALL A;  4O5K A;  5C5J A;  4NM1 A;  4G3I A;  1JRP A;  4A8E A;  3AMZ A;  1T94 A;  1Z4N A;  2ZUB A;  4ECZ A;  3M8S A;  1ZQN A;  4M9L A;  2E8P A;  5B66 U;  5III A;  1FFV A;  9ICT A;  2JH7 A;  3F2C A;  4JV1 A;  3WK4 A;  1NKB A;  1N62 A;  1BVS A;  2KHV A;  7ICT A;  5AI8 A;  1SL2 A;  4U6P A;  3KKA A;  1DK2 A;  2A3V A;  2G0A A;  2ASJ A;  4I2C A;  3J81 j;  3QU5 A;  4C8N A;  8ICN A;  1BGX T;  2XCP A;  4F71 A;  2B6G A;  4F91 B;  2C2R A;  2FMS A;  4M47 A;  4I2H A;  5KFE A;  4NJ8 A;  1MSW D;  1RZT A;  4DL7 A;  5C0Y A;  3ETR A;  3B0X A;  1YZ6 A;  1ZQZ A;  1ZQR A;  2KIW A;  5JTI A;  3ZI4 A;  8ICC A;  3WKE A;  2KZ3 A;  3SD7 A;  4ECR A;  4XUS A;  1KBU A;  4J9M A;  9ICM A;  2E3T A;  2XCA A;  1ZET A;  3TAP A;  5DQI A;  4O9M A;  3OHB A;  1O08 A;  4Y2U A;  5AKI A;  4Z6C A;  2D6F C;  5KFW A;  2C28 A;  2J6T A;  3QXG A;  2FLN A;  7ICE A;  2BCU A;  3I1Y A;  3IM1 A;  5KFU A;  2PFO A;  9ICP A;  1Y88 A;  5GTI U;  1P7D A;  3LVW A;  3MR5 A;  1U4B A;  2MUT B;  2RDI A;  5JRT A;  2R8G A;  9ICC A;  1RYU A;  1BPD A;  5L1M A;  8ICQ A;  3EPG A;  3IG8 A;  3UXP A;  4PL1 A;  1F5S A;  4DFD A;  4B6J A;  4YR3 A;  4P0Q B;  3RAX A;  2KNJ A;  3PSF A;  4YMN A;  2JEG A;  7ICV A;  5ALD A;  1X9W A;  5ALS A;  5D49 A;  2PKE A;  2BDU A;  3CNH A;  4JB3 A;  3TAQ A;  2YTU A;  4CDG A;  4DOB A;  2C22 A;  1Z19 A;  1PVR A;  2K8C B;  2EAP A;  4DLE A;  2Y1J A;  3UPQ A;  5KFR A;  2FPK A;  5J8Y A;  3M9N B;  2UVU A;  1A0P A;  2OHF A;  2FDR A;  4HAI A;  2QAR A;  5HHH A;  3SYZ A;  2P66 A;  1VLB A;  4JMU A;  4QZB A;  2QKQ A;  4R66 A;  3H8J A;  5KFB A;  7ICQ A;  1S5L U;  1JI7 A;  3PO5 A;  5ALX A;  3PW0 A;  2FLP A;  3NVW A;  2DFL A;  4EZ6 A;  4R65 A;  1ZQJ A;  4RUA A;  1HIW A;  4ED7 A;  4PGX A;  3H8W A;  4U7C A;  1N56 A;  5IIL A;  4NLG A;  2HOQ A;  2H3V A;  4DCC A;  2RLT A;  2H3Q A;  2GOL A;  2DQN B;  2V4Q A;  4QZH A;  5AM1 A;  2W3R A;  1QSY A;  4MFF A;  3QE9 Y;  2E1E A;  2K4I A;  3RJG A;  8ICM A;  3KZX A;  3U26 A;  1URJ A;  4MEY A;  2R8K A;  7ICR A;  1KDH A;  4NM2 A;  3AL0 B;  5J0S A;  2IOF K;  1SKW A;  1COO A;  1L7O A;  3SQI A;  4FS2 A;  2OYY A;  2EAM A;  1D9D A;  3L5K A;  4NWI A;  2A1A A;  1ZQX A;  5J2D A;  5DGA A;  4UB3 A;  4RQN A;  5TIS U;  2QB1 A;  4P4O A;  4UAV A;  4ECQ A;  4B9S A;  4US9 A;  1Z00 B;  5AI6 A;  3SV3 A;  3K4G A;  5KFY A;  3AU6 A;  3F53 A;  3GU3 A;  1JX4 A;  5EWG A;  1X6I A;  1TE2 A;  4DFJ A;  5GTH U;  3SEI A;  1U48 A;  1NK8 A;  1A77 A;  4DSL A;  1NZP A;  1J97 A;  3H0M B;  2DKZ A;  4DQQ A;  3PR5 B;  4BXO B;  5G5H A;  5DQH A;  4QWA A;  2AQ4 A;  5CRX A;  1RM6 C;  8ICU A;  1BPE A;  4NXZ A;  2E8O A;  7ICH A;  5KT7 A;  3B0Y A;  3IV6 A;  4ECS A;  4UAU A;  3H8M A;  2W9C A;  4RUC A;  3HKZ F;  3TAR A;  3H0R B;  1PK1 A;  3RR8 A;  1F44 A;  4I28 A;  5AK3 A;  3CYM A;  2HVH A;  4IL6 U;  7ICG A;  2YB4 A;  2KTQ A;  4O5E A;  3KBB A;  1KFS A;  2M0N A;  2YB1 A;  3LWM A;  8ICY A;  4B9T A;  5EWE A;  2JMG A;  2HHQ A;  4QZA A;  1ZOL A;  9ICI A;  2IOF A;  3WKC A;  1A6S A;  2Y9U A;  4QZD A;  1KQQ A;  4DLG A;  5ALE A;  5AK4 A;  3RB6 A;  3RTV A;  3NVV A;  4DQS A;  4C8O A;  5DKW A;  8ICH A;  4P0Q A;  2K4E A;  3OPX A;  3ED5 A;  2JH1 A;  4Q8E A;  5KT3 A;  2ZXI A;  4DF4 A;  3ICX A;  3M7D A;  3BS7 A;  4B9L A;  4RT2 A;  2JXJ A;  3QZ8 A;  7ICO A;  2LM1 A;  4EBE A;  1L3T A;  4PJ0 U;  3QU7 A;  5DBA A;  2FMQ A;  3ZD9 A;  5G5G A;  2BZF A;  9ICV A;  3UQ2 A;  1OXJ A;  4YD1 A;  4NY8 A;  2KOB A;  3SAF A;  4IRK A;  4CF3 A;  2VA2 A;  5J0O A;  3PW4 A;  5KG7 A;  5E79 U;  5JU5 A;  2VJ5 A;  1PVQ A;  2JGA A;  2K4H A;  3TI0 A;  1TFR A;  3RRH A;  4TUR A;  4YG2 A;  8ICV A;  3EYZ A;  1M6Y A;  2YMP A;  2YMM A;  3LDA A;  1UHU A;  2KK0 A;  1RDF A;  1F0M A;  4PPX A;  4F4K A;  4TUS A;  4MF8 A;  2ATL A;  2MU2 A;  2BCV A;  5AKH A;  4YMM A;  3OSN A;  9ICF A;  5ALV A;  3C2M A;  4QW8 A;  4AYB C;  4PL2 A;  5KFD A;  1L7P A;  1NK0 A;  3ALR A;  5J2E A;  1N2X A;  1T3N A;  2ZJA A;  3DEE A;  1ZQD A;  1KN5 A;  2WF6 A;  4IS7 A;  5EE3 A;  4K4I A;  1V9P A;  3M9M B;  2DF4 B;  3MAB A;  2WF5 A;  1D8L A;  3PML A;  1DXS A;  4KMO B;  1XO0 A;  4YD2 A;  1L8O A;  3F2D A;  2IHM A;  2NRT A;  3TKA A;  1Z00 A;  2ZIX A;  2XGP A;  3C23 A;  4M9G A;  1Z1B A;  3BZC A;  4CRX A;  4KLI A;  4KLO A;  2I6X A;  4B9M A;  1UPH A;  4YQW A;  2AH5 A;  1HJP A;  5EE9 A;  5KFA A;  4BXO A;  2OEH A;  1ZQP A;  4B9U A;  3QUQ A;  3JPO A;  4QWB A;  4ED0 A;  2AHO B;  2W9M A;  3PX6 A;  4DWI A;  3ONN A;  4EEL A;  5KTQ A;  3DV9 A;  1X66 A;  2KV2 A;  2W9A A;  4KLJ A;  2AGO A;  5J2B A;  2NRX A;  2KIV A;  3PW5 A;  2B21 A;  1JRO A;  3OHA A;  2W43 A;  3C1Z A;  4RQ8 A;  4DS5 A;  4GXI A;  1ZQY A;  2KZZ A;  2ZTD A;  1ZQH A;  4KLH A;  2HBM A;  4IRD A;  1JN3 A;  1NK9 A;  5KL8 B;  4ELU A;  2KJ5 A;  2D3D A;  4DO9 A;  2Y9T A;  4K4H A;  2ZIV A;  4KN7 A;  2JEI A;  1XSL A;  3S6J A;  5L1I A;  5BOM A;  2HOF A;  1YZ7 A;  3SI8 A;  2H3I A;  1NOM A;  2ZIU A;  3MDA A;  4PHD A;  1DGS A;  1B4F A;  3UMB A;  5HML A;  3EUB 2;  5J2C A;  4M6W B;  5DB7 A;  9ICG A;  3GQC A;  3Q8M A;  3UMC A;  2PXI A;  4J03 A;  4F4W A;  3JPQ A;  5KL1 B;  2J6S A;  4Y2V A;  4F8R A;  5AIC A;  2KMD A;  4NLB A;  3ZDD A;  4UB4 A;  2BHN A;  2ODG A;  5J2H A;  3LWL A;  2W11 A;  2PFN A;  4DS4 A;  3BQ1 A;  4FBU A;  4ECX A;  4I2B A;  2R8H A;  5EOZ A;  4RQ3 A;  3ZD8 A;  1KLN A;  2ZIW B;  3CW2 C;  4PHE A;  2LYB A;  1ZD4 A;  3NGD A;  2VJ4 A;  2Q0Z X;  1XS9 D;  3VCB A;  4RQ0 A;  3TAD C;  1Z3E B;  1N5W A;  1S0O A;  4UAY A;  1T3Q A;  4ECU A;  3I76 A;  3KHL A;  2BCR A;  5K4L A;  9ICU A;  1VJ5 A;  4GC7 A;  3RJF A;  4E0D A;  1BPX A;  1ZQI A;  5AKX A;  2DWQ A;  2YY6 A;  4ED6 A;  4I2F A;  1SXD A;  4NLK A;  4KLG A;  3NRZ A;  2Y0S C;  4PGQ A;  2FMP A;  2DGZ A;  1ECW A;  1L5U A;  5FP0 A;  2HW3 A;  4KMU A;  5DLG A;  4KLU A;  4IR1 A;  3SV4 A;  2ISO A;  4UAS A;  4J9K A;  3N7R C;  2GWS A;  3AU2 A;  8ICL A;  4KN4 A;  5KNI A;  1FO4 A;  2AQ0 A;  3RAQ A;  4RQ1 A;  1V38 A;  2RQ5 A;  2EQY A;  5AM4 A;  2JRZ A;  3KOO A;  2DPI A;  3A0B U;  3A0H U;  4J9N A;  1N63 A;  4Q45 A;  3IP4 B;  3QUT A;  2OCE A;  1IV8 A;  5KT4 A;  2Q4T A;  5J0X A;  3T3F A;  3M8R A;  3VC8 A;  3HX0 A;  2N1R A;  4PZO A;  5KFQ A;  2VIX A;  5AI0 A;  5J2A A;  5J0U A;  5AKK A;  8ICP A;  3H8S A; 
#chains in the Genus database with same CATH homology
 2E1E A;  3HKZ C;  2D6F C;  2K4I A;  3N7P D;  1Z1B A;  2CPR A;  1CRX A;  4KX3 A;  2Y0S F;  3KZX A;  4P0Q A;  1URJ A;  4FZN A;  4QIW F;  2K4E A;  3OPX A;  3AQE A;  3M6Z A;  3C28 A;  1TAM A;  4CRX A;  2JH1 A;  3AL0 B;  2ZIW B;  4KX5 A;  2F77 X;  1UPH A;  2ZXI A;  1P7D A;  4P0P A;  2ZIW A;  3ICX A;  3M7D A;  3LVW A;  2WAQ C;  2LYB A;  3MGV A;  1YT3 A;  2VJ4 A;  4GFJ A;  3SQI A;  2OYY A;  3PZP A;  4NWI A;  3C29 A;  3VCB A;  4QJF B;  3LYS A;  3IG8 A;  1OUQ A;  3F2B A;  2K8B B;  1ED1 A;  2G5I B;  4PL1 A;  5HR7 A;  2PMZ C;  2JHD A;  3ONN A;  1ZQ1 C;  3PSI A;  5A0L A;  2OH2 A;  2HBL A;  4ICA A;  2KJ8 A;  2KOB A;  4AYB F;  3D2N A;  1Q3U A;  4FZL A;  3PST A;  2H3F A;  4P0Q B;  4OJL A;  3F53 A;  2KV2 A;  3GU3 A;  4QNL A;  3SAF A;  2XVT A;  2KNJ A;  3LVV A;  3PSF A;  3SAH A;  1IIP A;  2XIC A;  4P0P B;  3RFA A;  3IN5 A;  4WJ3 B;  2E1F A;  4BX9 C;  3H0M B;  4FE3 A;  2CRX A;  2BDU A;  2VJ5 A;  1PVQ A;  1WUD A;  4CDG A;  3NUQ A;  3KFU F;  2WAQ F;  2JGA A;  1MA7 A;  5T14 A;  2KKV A;  2K4H A;  2LBO A;  4A8E A;  1Z19 A;  1PVR A;  2HOI A;  2W7O A;  3PSP A;  5CRX A;  1T94 A;  2G09 A;  2HBM A;  2W04 A;  2K8C B;  2Y0S C;  2HBK A;  2RRD A;  2NV3 A;  3RF9 A;  4QIW C;  2DGZ A;  2OM6 A;  2WB1 F;  1ECW A;  4NLC A;  5KL8 B;  4BUG A;  4OJP A;  2KKP A;  3CP8 A;  2KJ5 A;  4OJ6 A;  2ZXH A;  2JH7 A;  2R18 A;  3F2C A;  2ZIV B;  4OJ5 A;  3L3F X;  3IG5 A;  2Z7J A;  3SMV A;  2KHV A;  2ZIV A;  2GH1 A;  2VKQ A;  1A0P A;  4U6P A;  4O3M A;  3HKZ F;  3GZF A;  2A3V A;  4NV0 A;  1SZH A;  3N7R C;  1DRG A;  2HOF A;  3H0R B;  2G0A A;  2ZIU B;  2H3I A;  3E0F A;  2H3Z A;  2ZIU A;  2KIC A;  2RHF A;  4CGZ A;  4JMU A;  3SAG A;  2YX8 A;  3N7S C;  3D2S A;  2RP5 A;  1F44 A;  3O0F A;  2G06 A;  3CYM A;  4IC9 A;  2HBJ A;  2KVC A;  2LYA A;  2XI9 A;  4BJQ A;  4AYB C;  2XID A;  1GO3 F;  2K89 A;  4PL2 A;  2YB4 A;  3CRX A;  2W7P A;  2KEY A;  4C0Z A;  5C0Y A;  2ZG6 A;  3ALR A;  2G5H B;  3F5A A;  1NZB A;  2M0N A;  5KL1 B;  3F5E A;  2W03 A;  2LHT A;  2YB1 A;  2KJ9 A;  2LKY A;  3AQF A;  3IP4 B;  2G07 A;  2PMZ F;  4OJO A;  1HIW A;  2KIW A;  1Q3V A;  2F8L A;  2Q4T A;  1XNS A;  4U7C A;  2CN1 A;  3DEE A;  4NLB A;  2JMG A;  3H0L B;  5HR6 A;  2K8A A;  3T79 A;  3VC8 A;  2F76 X;  2MA1 A;  2KD1 A;  2OXO A;  1D8B A;  3NRW A;  4FZM A;  2HOQ A;  2H3V A;  2DF4 B;  2N1R A;  1L6N A;  3D2Q A;  3K1Z A;  1KBU A;  2F2A B;  2H3Q A;  2GOL A;  4OO1 J;  1A6S A;  4KMO B;  2VIX A;  2WB1 C;  2DQN B;  1XO0 A;  1PVP A;  2HMX A;  3F2D A;  2G08 A;  2KHQ A;  2ZIX B;  4ACO A;  2MRL A;  2ZIX A;  3M6K A;  2E5S A;  1HEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...