2WF5A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and trifluoromagnesate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf5A01
5AVZA 5ALNA 1ZOLA 3ESQA 2PKEA 2YJ6A 3A1EA 2FPRA 5AK5A 1L7OA 3R9KA 2B0CA 4ZEXA 3WKAA 3AR2A 2Q4TA 4BKMA 3FM9A 2RBKA 2YMPA 5AI4A 3WK7A 3CZ4A 4UARA 3I6BA 2JAOA 5AHXA 1U2TA 2C88A 1Y8AA 2ZG6A 2MSNA 2QYHA 1N8NA 3GYGA 4EX7A 2AMYA 4L6AA 4RESA 2HO4A 3RFUA 2R8YA 1ZJJA 3IB6A 2R8ZA 2FPWA 4DCCA 3L8GA 4UM5A 3KOOA 2B1QA 2IYEA 1ZD2P 2YMMA 4IFTA 3N1UA 5AW5A 1J97A 2BDUA 4UM7A 3J7TA 4Y2SA 3UM9A 3KBBA 3UMBA 3F9RA 3P96A 1L6RA 3L0BA 4EZEA 1F5SA 4FFDA 5AW9A 4OFZA 1XVIA 2AGVA 4XPZA 2HCFA 2R8EA 4YGYA 2WF8A 1CQZA 4BEVA 5AKIA 4BX3A 4EELA 2FPXA 3IJ5A 5AKJA 3OCXA 1S2OA 3KDPA 5AI8A 5ALVA 3N5KA 2ZXEA 4Y2QA 3ZI4A 1TJ5A 3E8MA 1RMYA 3QYPA 4CF4A 4BYGA 3L5KA 2VKQA 4UMFA 3U7HB 3PGLA 4XOUA 5AVSA 3QLEA 2RB5A 1O03A 5ALHA 3WK5A 2O9JA 2YY6A 1ZRMA 2FPUA 5ALDA 1RKUA 4BNDB 3OPXA 1J8DA 1KYTA 1L7MA 1TJ4A 1TE2A 3EWIA 2NYVA 3MPOA 3DV9A 4B6JA 2FDRA 5AVRA 4FE3A 3FPSA 2JAWA 1QQ6A 2AH5A 3I1YA 3ZWDA 2I54A 1K1EA 3QU9A 3K1ZA 1JUDA 4Y2TA 3DAOA 3WK4A 3OCUA 3SF0A 2FUEA 5ALRA 2G07A 4BX2A 3L8HA 2YMQA 2WF5A 2GFHA 2WM8A 2B8EA 3ET5A 2YJ5A 3OCYA 4Y2RA 5ALOA 1EK1A 2X4DA 1Z4QA 3ZVMA 2GO7A 2IOFK 3EF0A 5ALXA 1L7PA 3BWVA 4PNHA 5AKHA 4BX0A 1T9ZA 2JAUA 3AR4A 4UAUA 1ZRNA 5AVUA 3M9LA 5AVQA 2GMWA 4HYTA 1WPGA 2ZBFA 3A1DA 4QQFA 2CFRA 1L8OA 4BNDA 3SLRA 5AI0A 3QU5A 2EAUA 1RDFA 4Y2YA 4HAIA 4Y2JA 3QGMA 5AKLA 1NNLA 4DFDA 1CR6A 5AKEA 2HEGA 1SWVA 4YCMA 2DQSA 3PCTA 4UU0A 4Y2VA 3D6JA 2IA5A 2W4MA 2FUCA 3WGUA 5AIAA 4OCZA 3U13A 4HGQA 3TLMA 5ALWA 3SKYA 1WVIA 4CNQA 2I7DA 4JB3A 5AM1A 3MMZA 3NRJA 5A3SA 2HOQA 5AW1A 1U2SA 2GHQA 3QUTA 2B82A 1XPJA 1QH9A 3S6JA 2C8LA 2I33A 2CFTA 4C4RA 2ZBEA 2G06A 1RLOA 1T5TA 4OD0A 3QUBA 2YJ3A 1FEZA 2PR7A 4CF5A 1Z5GA 5E0OA 2WF7A 5IT0A 3ONNA 1ZD3A 3L7YA 3N28A 3RF6A 4G63A 3CNHA 4MUMA 4ZEWA 3VAYA 3DNPA 1NF2A 1N9KA 3ZX5A 5AKKA 4HGPA 3BA6A 2P9JA 5AW0A 2ZBGA 4Y2PA 1L7NA 2WF9A 3B9RA 4E88A 4CE6A 5A3QA 2OA0A 5AW7A 1S8OA 2G80A 3QNMA 3AR8A 4XQ0A 1ZS9A 4AS2A 3ZVLA 5AW4A 3HLTA 5ALPA 1VJRA 4KX5A 3ZU6A 2Q4RA 2ZOSA 1Z4NA 5AK4A 3OCWA 5ALYA 4JDPA 1QQ5A 3IRUA 3WKCA 3WKEA 4KNWA 3WK6A 4UMEA 3L8FA 3U19A 5JJBA 4O8CA 3L0YA 5ALZA 5IS2A 2B30A 3SHQA 4KYTA 2B1RA 1LVHA 2HF2A 3N8GA 3UMGA 3W5CA 3QUQA 2ODAA 4ZEVA 5AVTA 1VFPA 5AVVA 1T5SA 4J2TA 3W5AA 4NWIA 2I6XA 2BY4A 1PW5A 1WR8A 2I34A 3EPRA 3HYCA 5AW2A 4KNVA 2P27A 5AVYA 4C4TA 2YMLA 3FVVA 5AK6A 2OBBA 4YIKA 5AM3A 2G1AA 5ALLA 4Y3UA 2C8KA 3AR3A 1RPZA 3E58A 3E81A 2NO4A 4J03A 3NAMA 5AVWA 1Z88A 5T41A 3AR5A 2D2VA 2R8XA 4C4SA 3U7GA 5AM0A 4I9FA 1YDFA 5AM5A 5ALMA 1Z4IA 1Z4KA 4AS3A 4L57A 4EEKA 4CF3A 3U7FB 3N07A 2YN4A 5AK3A 1Z4OA 2IOFA 4BBJA 2ZBDA 2YJ4A 2WF6A 3ZUPA 5AKYA 3SMVA 3NANA 3ZVNA 2AUTA 4NFLA 5AI6A 1RLMA 1Z4JA 2FPSA 4H1WA 2OYCA 3U7EB 2W43A 5ALQA 5A3RA 1YJ5A 3B9BA 3B8EA 3ED5A 3QUCA 3NALA 4HGNA 4L6CA 4UASA 3ZTYA 3WK9A 3QU7A 4YCLA 1QQ7A 1ZD4A 1RQNA 5AI5A 1WZCA 3EF1A 3U26A 2P11A 3I76A 3NIWA 1EK2A 4XE5A 4IG4A 4F71A 1Z4PX 2RARA 1O08A 1IWOA 3ESRA 2G08A 3OCVA 1YNSA 5AKZA 5AVXA 4Y2XA 2EARA 4GXTA 4UMDA 1X42A 3R4CA 5ALSA 2I55A 4NAVA 2NO5A 4KN8A 3E84A 3SKXA 2W11A 4UAVA 1TJ3A 1YV9A 3SD7A 3QU2A 3DDHA 2Q5EA 3A1CA 4UMVA 4EX6A 4HGOA 3FZQA 4G9BA 1LTQA 1RMTA 1Z4MA 4KX3A 4UU1A 3WK8A 5AM4A 5AW3A 2RAVA 1RC8A 4MWOA 3W5BA 2JGAA 2O2XA 5ALTA 3PGVA 1RKVA 1U02A 1RQLA 3FGOA 3L1VA 3ZX4A 2C4NA 2MU2A 2BDEA 4GIBA 2P69A 2PQ0A 4YH1A 1ZD5A 2OM6A 3L1UA 1Q91A 3NASA 2YFYA 4DWOA 2IOHA 5ALUA 3PDWA 1Q92A 3M1YA 5AKGA 5AM2A 1L8LA 1NRWA 3W5DA 3ET4A 4NABA 5FP0A 4YCNA 4HGRA 4FYPA 4AP9A 1TA0A 3KZXA 1XP5A 2MU1A 3ZTWA 1RKQA 5ALJA 3A3YA 4YIHA 2B8JA 1SU4A 3L8EA 3MN1A 3KD3A 3QU4A 3WKDA 5AW6A 3L0CA 1Z4LA 2GHTA 3OCZA 3ZWKA 3QXGA 3OTQA 4UATA 3AR6A 2HI0A 1YS9A 2WHEA 2CFSA 5IT4A 4Y2UA 1U7OA 3QX7A 5AI9A 5ALFA 1MH9A 4UW9A 3FPBA 3KC2A 2YBDA 5ALIA 4F72A 2G09A 2HF7A 4RETA 4OHFA 2HHLA 4QJBA 5AIBA 1RMQA 3R09A 1Z5UA 5AESA 2C9MA 2JARA 5ALGA 3WKBA 2FEAA 4BEWA 2G0AA 1QYIA 3NUQA 2QLTA 1SWWA 5AKXA 2HDOA 1VJ5A 5ALEA 2WFAA 4NV0A 2CN1A 1U7PA 3WGVA 3AR7A 2FI1A 1AQ6A 5ALKA 3ZW7A 4DW8A 2HX1A 4I9GA 3UMCA 1RLTA 5AW8A 3I28A 1YMQA 1RRCA 5AICA 2HSZA 3AR9A 4EENA 2EATA 3MC1A
chains in the Genus database with same CATH superfamily
5H7XA 1NYQA 2AFHB 4D9IA 2J6BA 1GKIA 2Q4TA 1Z6GA 2PZLA 2V5VA 2E1PA 4L2IA 3OEHD 2Q7XA 4IJVA 4O5AA 1A9ZA 4FKZA 5TLSA 4KMUA 2HO4A 4JOQA 3G9QA 1P17A 3MW8A 1SCAA 1IZYA 4R98A 1D6SA 1XJQA 1ZK0A 2BFEA 4BB0A 4CXMA 4B3IA 2IJGX 4O2AA 3E5HA 4A23A 1FSPA 5EYPB 3W04A 3LPLA 4YALA 4PFKA 3KSZO 4Z99A 1UMBA 3IP4B 4UBLA 4PCAA 4NCKA 1E2EA 1X66A 1K1SA 4ZODA 5LNK1 3FCOA 3LBAA 4B34A 4HN2A 2V03A 2FZ5A 3BMQB 3RUIA 5J1SB 1U98A 1JLMA 1H0KA 1PYDA 4QNRA 3QU9A 3ESDA 2JI9A 1U0JA 3TE7A 1IQRA 4G65A 1E8DA 1SHJA 5JZ9A 1ZWKA 1Q0ZA 5EJMA 4GD3Q 2IOFK 3TM4A 2O06A 2XGQA 4AUKA 4RDXA 1R9MA 3U4IA 3SSNA 2ANCA 1K27A 3AY6A 1XEWX 2HC9A 1WP9A 4KVAA 4X9XA 4FW8A 3C6YA 2JFYA 1UJ5A 2QW0X 1BW9A 1CR6A 4UZSA 2F8SA 5EHIA 2ZB3A 4M7OA 3UH1A 2QJWA 1RPJA 1G59A 1NJFA 3WNVA 4DA0A 4Q3BA 4OU5A 5DB4A 4Z7QB 4M9SA 2P9FA 4MB6A 1LKYA 1KWGA 4E2YA 3HWSA 1NBMD 2Y9PB 3PUHA 4H60A 1TVCA 3F3SA 3QF4A 3DNPA 3SYLA 1ZQWA 1XX6A 3Q0IA 2A9OA 2WQZA 5FTLA 4DL4A 1KO7A 5GADl 1B41A 5DBGA 3TFQA 4XQ0A 1ZU5A 2QI9F 4RBNA 3KQUA 1LC0A 3WGQA 4D57A 4DG5A 1VL5A 1VSBA 1LVHA 3PHBE 2WIJA 3RC9A 3LOPA 4ZVLA 2PMWB 4R2LA 4GDFA 4PRKA 3A6HA 2HOFA 4QJ3A 3PFKA 5IIKA 3K9FC 5JAOA 1IYZA 4J03A 4MHVA 3L7IA 1HXHA 3S5JA 1I3NA 1ES9A 1ISPA 3M6ZA 4QOHA 3NVMB 2EW8A 1EVZA 4FGZA 2F3NA 2YHBA 2ZETA 4GI3A 2H54A 3RVSA 1RT9A 2Q9BA 2D06A 4V02A 3NVKI 3DXYA 2A9VA 2NTNA 4MGKR 1Z3CA 1MNAA 3AB8A 3ZTYA 1Y34E 4TSRA 2X9VA 5EUCA 4QDUA 4MWGA 3CH7A 1U4BA 4KEAA 3CG0A 3VZBA 1BXGB 4E31A 1RYZA 3FYCA 3IN5A 3OKAA 2A0FA 4RHTA 4XX1A 2EARA 4ECEA 2PRJA 2BFDA 5FKJA 2NO5A 4ZRNA 4EUHA 1TLFA 3V6JA 3CR8A 5LC1A 4YT2A 2ZIVA 4RTJA 1G7SA 1IIPA 1NKCA 3HB5X 7ICMA 2DUUA 5JYDA 4FHCA 3BWEA 3WNCA 2W9BA 2AX3A 5CFLA 4BXOA 3E1SA 2R60A 4GZ6A 3I4LA 5KX5A 1ULTA 1EXMA 2P0AA 2HYIC 1C7RA 2IXTA 5I9NA 2DSTA 2HREA 4KPFC 1Y82A 4C89A 5DCYA 2BEUB 1XLVA 2AE2A 4CM8A 4KQJA 4JHXA 2BP7A 4E5PA 3A6PC 1OPXA 4MCAA 1ZR2A 4B9AA 2QMHA 3UJ9A 3PXEA 4URFA 1DOZA 4YT5A 3WA7A 4CM9A 1NRJB 1GO3F 2HLDD 1YS9A 4DR5B 1NN1A 1JYEA 3GT3A 5GTHU 1NBME 3ETGA 2YBDA 3P9XA 4KXNA 3UQ0A 3PX3A 3HEBA 3GLQA 3ISCA 5AESA 3M8KA 4RAOA 1G21A 5LA6A 3KU4A 2NU6A 4L9RA 1U7PA 4Z7OB 3CLVA 3CRXA 1NQXA 4Q12A 4KV7A 3U56A 2XOKD 7ICFA 3HWTA 3TLXA 5E3HA 1MC1A 4IEEA 1L9KA 2B2CA 5JCZA 1L7EA 4U02A 1YVEI 1KO1A 1VMKA 4J1TC 1U0RA 4IV8A 4OQYA 4MUNA 3F5SA 4UM5A 3GC6A 3EWAA 4TTPA 5DYIA 4M0LA 3KBBA 4RM2A 5DPMA 4JVOA 2RB4A 1QFXA 2E1EA 2Q50A 2FOXA 3T9CA 2DY0A 3F7TA 2QOEA 1WXDA 3M89A 4LXTA 1RBZA 2WICA 1SXJC 2AJTA 3KV3O 4CDRA 3GV5B 1Q7BA 4TQGA 1OI4A 1Z6QA 5D5PA 3SR0A 1A76A 3LKVA 4P9NA 1I6KA 4HH0A 2FYTA 2NNWB 3GEGA 4RPHA 3ZK7A 1SBCA 2XEXA 3KTAA 2O8FA 3R8CA 4MQLA 5LYJB 9ICOA 4QOSA 4LUCA 1OYOA 3C3JA 4Q6BA 1ZLYA 3OZTA 2REXB 1I3MA 2WYHA 4GQAA 2O0KA 4CGYA 1GUDA 5K0EA 3VAZA 2XCQA 4HCJA 3BS5A 5FV4A 4Y0AA 4XDZA 2LIVA 3TARA 2EF0A 2YY7A 4EHAA 1T8PA 3ZCUA 3KFUF 4EG7A 3OE1A 4TKLA 3HB7A 5GIOE 3NU1A 4HVAA 5E95A 3GJ0A 1NNEA 5HFNA 3PS9A 1ORWA 4IJKA 1A9XA 3LW7A 3M6KA 3SZUA 4S35A 4RGYA 5BSMA 4BE9A 1VI5A 5HP4A 1B00A 1J1UA 3LDHA 1JH9A 4ZQGA 1Z6ZA 5F5LA 4RJ2A 2B8WA 3SYKA 4LFCB 2Z7JA 4U7DA 2UDPA 5D85A 3QV2A 2P90A 3IIKA 4FLEA 1O95A 4M0CA 4MW4A 3AB7A 4QWDA 4JT4A 2K8BB 4D4IA 5KFAA 1M2VA 3GNQA 3K2QA 4K86A 3KVYA 4B3CA 2Y0EA 2ZTVA 3BZBA 2HLHA 3O3NB 1GTVA 1OXJA 4UCXA 2BKXA 2QLFA 4KNVA 3GHYA 2P4QA 2JVJA 5C5IA 1S7CA 3ABZA 5E6RB 3KETA 1C7JA 4CZ2A 5LDHA 3OX1A 3HSYA 3NI2A 1C7IA 3V80A 1LRJA 3RVLA 4QXQA 1ZIDA 5JSQA 3WV5A 4R6WA 5GJVC 4BMSA 3R0XA 1JG3A 3HJNA 5AOBA 4GI1A 4X1IB 1TFRA 4YI3A 4LGVA 5G1OA 3I6QA 2GRUA 3FUXA 2W2LA 5FYDA 3ST7A 3DHYA 5DNCA 4PAQA 1PX2A 4IDGA 3BB1A 3UWDA 2PJUA 4BDSA 2A57A 4RY8A 1X1QA 4OU4A 4UNRA 4EY3A 4EYEA 4C7YA 4P4NA 4DR7B 5IIOA 2X5NA 4A6DA 4HEJA 2ZAMA 2X8BA 5F2EA 2AJQA 3UHPA 1FJ2A 1H0SA 2D59A 1W4CA 2IOHA 4EDFA 4MIYA 2OZEA 1E2PA 2RDIA 1QHGA 4KO8A 2BMJA 1ZQAA 2MU1A 4DLWA 3VC8A 3O84A 2HA6A 4BASA 3PVSA 1YZUA 4U2GA 5A0VA 4IVRA 4G23A 2A5DA 4OKIA 3V4OA 5AI9A 4JYMA 2P30A 4RU9A 2UZ4A 4ZAZA 1LDGA 3JD3A 3AVWA 3WZLA 4IXDA 1WQ1R 2ZM5A 2FEOA 5K0BA 2OORC 3MD0A 2PGAA 3QPAA 4TS3A 5KNIA 3V1UA 4AJ4A 4QTZA 2ALZA 3IT3A 5IVIA 5KYKA 3D5EA 1XQVA 4LDZA 5FOSA 2H1CA 3VR3A 1TKDA 2P2YA 4DNXA 4QIHA 4W5OA 1TK3A 2W6JA 4PFQA 4DNOA 2G1JA 4NJOA 1L3CA 5F3XB 3LI2A 4QWAA 4IIJF 3FOCA 2BMWA 4ML3A 1S0MA 3R76A 1ZQ1A 1C4WA 2VP0A 1PCXA 2WD9A 1QQAA 4I6EA 3LE8A 5D01A 5CPBA 4A9AA 2FAXA 3ZV7A 5KFPA 2P5YA 4XRGA 3QLUC 1VM6A 3L7AA 3KSDO 4JI2B 5HDBB 3GQCA 3N74A 4LWPA 1J9GA 2HFKA 4OFZA 5E79U 1RHMA 2ZYWX 3E3AA 1BDMA 3NVVA 4MEJA 3MPUA 1L5WA 3TFRA 2H1WA 4M1OA 4IZ6A 3ZV6A 3PPXA 2WWYA 4DXAA 4BX9A 2ZFUA 2JJ2A 3L6CA 1G18A 1L3VA 2QYOA 1QCYA 2JI7A 1K63A 3D64A 7ICKA 5KQRA 3BULA 1NLUA 3TQSA 5TVGA 2RAPA 4KQGA 4NFHA 4FYXA 3ORHA 2FR0A 2J3HA 3BXHA 2H1SA 4MGEA 3O3MB 3V72A 4NOMA 4PAGA 4EG3A 4M9NA 4XEHA 5JQWA 1DX6A 3U3RA 4HAOA 4GXNA 2Z58A 5GWXA 4BFWA 4EUNA 2IIVA 2OG2A 2PBFA 1LDBA 1C0IA 2OOSA 4FK8A 4URZR 3NPMA 1H9AA 3L8YA 4NYIQ 3WYEA 4ZKDA 4OCZA 2AX4A 4OMCA 1YOBA 3DKIA 5CA1A 4KLMA 3AKYA 3K1AA 1IBKB 4NK4A 3Q5EA 4KR7A 2J9YB 4EHHA 4CT5A 5KFYA 4NJMB 2FQ1A 1Z6TA 3I1FA 2WB4A 3H87A 5BSEA 1RR6A 1EP9A 2JRLA 2C07A 1QSSA 3PDJA 2OB1A 4S1OA 1EESA 1PT5A 1E9EA 4XQCA 3WGKA 3OHPA 1I0LA 4D5EA 1U2EA 5CXSA 1ZQQA 3ISVA 2EQ5A 3G1WA 1X9GA 3T41A 4OXRA 4OK5A 1VJRA 3VNQA 5ALYA 3HP4A 1NVAA 4K2HA 3GUZA 2HF2A 2O48X 4ER7A 2WVJA 3TADC 5EKXA 1UZMA 4KQ6A 5AVYA 1EVLA 4CMIB 5KTNA 3VTKA 2C8KA 1UFKA 2D0IA 1ZUHA 3QWIA 4OHMA 3G8YA 1NLMA 5T8KC 2CL5A 1SKRA 1V16A 2DC1A 3FAKA 3MTBA 5K6AA 3U7FB 4MKGA 2ZBDA 1XVVA 1N2HA 3LO5A 4TOIA 2F67A 4AKIA 2XTAA 3HO1A 5HE9A 4DMGA 1CZUA 1PR3A 3N7RC 1R0CA 1MBZA 2TMGA 1FS4A 4WBXC 5J2DA 4UXJA 4Z9BA 3T3EA 4BLWA 4IG4A 1QDLB 2RARA 4QU5A 3LOUA 5HJ7A 3T1YB 1JXEA 2O3RA 4RVGA 3DL7A 4RH3A 2H2GA 4KRYA 3G2KA 1HDOA 4QIWC 1FW8A 3A1NA 2HZBA 2BRUC 4EGSA 1NR1A 2QSJA 1SQSA 4KX3A 1J24A 3GWZA 5AM4A 1K0FA 4M99A 5CFRA 3IA2A 4GMDA 1A82A 3ILXA 5I9TA 4JUDX 4P4OA 4C29A 4M9GA 2F9LA 4QOIA 5L1KA 1POXA 2GZ3A 1OWLA 2FN9A 4DWOA 3AI1A 3HA5A 4J91A 4JBWA 7YASA 3IUQA 3IOYA 1JXMA 5CM8B 1FUUA 5NULA 1GGNA 5G2OA 4P34A 5DTIA 3QEKA 2NZ2A 1NMSA 1MH1A 4M8KA 1JG6A 3SNKA 1WM1A 4R2MA 3N3AC 5KJCA 1H6CA 5JXGA 4MV7A 4YACA 1Z29A 5B2EA 1THGA 1WDKA 1BXRB 3DFZA 4O0LA 3WLRA 2YYYA 4ZARA 1YAHA 3MTJA 2YOGA 3F2IA 3FSEA 1MENA 1GPNA 4JA0A 2AYXA 5EINA 3VDMA 5BSUA 4TYNA 7ICEA 2YIMA 4RANA 1D2NA 1M6EX 2QTNA 2UV8A 4XM0A 1BQEA 4TUYA 1Z6XA 1IBSA 1CQJA 1TF7A 2LPEA 3HKEA 2HU8A 2B4YA 1JEYB 2BMFA 3U3XA 2FFAA 4UFOA 2R8ZA 4NCNA 2P9EA 4P0PA 1BRTA 3GVCA 5IK2A 1T2EA 3EZ9A 5FO1A 3K9BA 5J2JA 2WA1A 5FEMA 4M7PA 1LZLA 2NGRA 1NMXA 1UWKA 4O02B 3VQTA 3C3WA 2IVZA 4YAEA 4E51A 3LVWA 3OSNA 4BO1A 4QGHA 5C31A 2W2KB 4DLSA 4OL0A 3PFFA 1OLUA 2ZUDA 1WB9A 2VP2A 1BN6A 4F4DA 2P2NA 2ILTA 3LL7A 3VPBA 3ET5A 2GJ4A 4UHFA 1UPTA 2I65A 2IYLD 2AYYA 3F96A 5HWSA 2D6FA 2NZ8A 4RVNA 1HUOA 121PA 3PITA 3K5HA 1JALA 3GFGA 3M9LA 1MORA 4RD0A 4DJFC 1D1QA 3H5NA 3M7DA 1NBAA 2IZZA 2YFHA 4M1YA 4JYAB 2X23A 1CRQA 2VHTA 3BD7A 2YN0A 4FX2A 4LS3A 1JW9B 3N53A 5SV2A 1RWMA 2G5PA 3I05A 4PSAA 4C4RA 1G4UR 4R8RA 1MG5A 3T9BA 1QQBA 5KHAA 4LZOA 2EBWA 3CNBA 5F64A 4GOKA 5HUJA 4R8MA 1T3SA 3N6XA 2V5AA 1Q74A 5IUJC 2M2IA 2C03A 4MW0A 1G2PA 2ZRLA 3EGEA 2GZSA 1X9SA 4UCQA 5IDXA 3ZE2B 1SZCA 2ZCVA 5COBA 4AJPA 2PPLA 3T7SA 2BR5A 3B0XA 2W2QA 1RCFA 3DM9B 3WKEA 1P4SA 4LVOA 1PS8A 4O8CA 1I8TA 2RGUA 3TOZA 2B1RA 5A1JA 4I2HA 1JDUA 1A95A 3U1VA 3TVDA 1S2IA 3KLNA 2I9PA 3EPRA 1OA1A 9ICAA 1ENZA 3MT8A 4B7XA 5TS2A 4DL7A 1J09A 4KZKA 1JSCA 1R16A 5GVSA 3BH6A 4DMFA 4XWTA 4GYYA 2QAIA 1R3UA 3DBHA 1AQLA 2QX9A 1ECLA 2R68A 4ER3A 1SB3C 3ABRB 4R5HA 1TMGE 3LK7A 3ZU5A 1G20E 4EJSA 3OHBA 2MUTA 2X86A 3LPNA 3WYCA 4ECSA 3H8MA 3RTBA 3RAFC 2NSLA 1RQNA 3C3AA 2HZ7A 4YJHB 3EZ5A 4UNNA 1Y0BA 1X13A 5DULA 1BO6A 2CF6A 1SCUB 2FZVA 3ABIA 2II6A 5KKAA 1T29A 4TXJA 3HNOA 5EIFA 2HHTA 3GARA 3V1KA 3FYUC 3M6AA 4WXMA 4IHJF 3UHOA 2GASA 5DG7A 2DG2A 2C98A 2WU0A 5IXJA 4NCHA 5AXBA 3KQKA 2VDRB 1LH0A 1L5NA 1KEEA 3JCZA 4YH1A 4KUEA 1LLCA 1OKKA 1JAIA 5A1TA 2O8DB 3W2GA 3PTZA 3P0IA 4PF1A 2QQ0A 5SY9A 1D2GA 4YMHA 1Z28A 3TG2A 1NN5A 4X7PA 3O8DA 3N3BC 5EZQA 5JZOA 3OJWA 4GICA 4F4CA 2W0SA 4WLOA 3R3ZA 4JYPA 4C6HA 5IT4A 3OI7A 1BMQA 1COWA 3FPBA 5GJCA 4JVMA 9ICQA 4HI0E 4BNLA 5HX7A 5I9SA 4C5BA 1ADYA 1L4EA 4OSPA 4G36A 1FUYB 3MR5A 3PMNA 4CMEA 3OF3A 5KKCA 1KY2A 4US9A 4A0QA 2XW6A 4YQZA 1KETA 3QF7A 4Y6SA 2N46A 3V1NA 8ICWA 3SAJA 1NKEA 1K7EB 1JKJB 3A1EA 1HNXB 2HVIA 3FLEA 4RLSA 4CRXA 4DLPA 4PX3A 1O4WA 1V85A 2GKOA 1Z5NA 5TRTA 3AM5A 3SFZA 2IHTA 1EGMB 4HHEA 2ISPA 3PUWA 1TQ4A 3EA0A 4DSUA 1V9SA 1CZHA 4PHEA 1PFUA 5K0FA 1L5GB 4MROA 1Z5VA 2UKDA 2PX8A 1AQIA 1DAHA 4R63A 3ZW8A 1GN8A 1IRXA 3KKMA 4X62B 3OBIA 4JKIA 3WY9A 8ADHA 1G8JA 3T34A 4J9SA 4BC0A 2GPYA 2Y3IA 5SICE 1P18A 2YZKA 3MOSA 3ONVA 2WTEA 4KLDA 4WKCA 4DOCA 4PHFA 2APJA 1QQ6A 1GTL1 3X44A 4DA6A 2X1LA 3C23A 1AU9A 2W9CB 3LHDA 1AO0A 3F1KA 4R01A 3M0EA 5ECWA 5ALXA 4BLTA 3LWBA 2ZLBA 2QTVB 1ZMOA 2PE5A 2GA8A 1X9HA 3UPUA 2ZUWA 4RGBA 5KFTA 2XBUA 1IY1A 2J3IA 3ZJTA 5J29A 3KLMX 3VZQA 3F2BA 2C1XA 4CV1A 3GX1A 5DNUA 4Q47A 3WWEA 2GVDC 3VOTA 5CXUA 1G8AA 4XYMA 2OENG 3LBNA 3CWCA 4EVIA 2H1RA 5BMOA 1R9JA 3PSIA 1Q50A 2J0UB 2WF7A 5C9ZA 2E0IA 3B1ZA 1K7CA 4EO7A 5EIOA 5FR2A 4AMYA 3FSGD 4GLOA 4F46A 1F8XA 4LRWA 1IPFA 4RM3A 2ZYRA 3N2KA 3ISTA 3VTZA 2ONZA 3P32A 3SWWA 3EDQA 3IL2A 4KACA 4M7WA 2OBNA 4DXHA 2FMUA 3PNPA 2VSNA 4MO2A 1E96A 4C0WA 1RM6C 5JWRA 2QRZA 3WBKA 3JYNA 4PXYA 4QUEA 4YLGA 4JB8A 4K9LA 4BECA 5E4YA 3ORYA 3RBVA 3VX3A 1HL7A 2AS0A 2X9NA 1XNRB 3OZVA 4PGFA 1KDTA 2HY7A 3MT7A 3D7MA 1Z0IA 2AQIA 4KP7A 5B7NA 3I5YA 2ZUTA 3GMSA 5BWLA 1XCMA 4EB0A 4W6ZA 3O8QA 1BPXA 4HDOB 2F4VB 4HWTA 3NGMA 1PJ3A 4CVNA 4BMZA 1SQ5A 2XEDA 4FR5A 3WK9A 5DYWA 3UC5A 4LRXA 2VAVA 4OX9Y 5DGAA 2CSUA 1M8PA 1I4OA 2H4WA 3BQ2A 1JS1X 5M5BA 4B48A 3L0SA 3NRBA 2NXCA 5LJIA 1QO0D 2XMSA 1ZUIA 1GCOA 1EVEA 2QBYA 4NENA 1ZOOA 3PQFA 3L0PA 1IM4A 2WAAA 1KZ4A 3T9AA 4ITRC 4YJ3A 2PS1A 2Q3FA 4OBWA 1ZQYA 1RQLA 2YW2A 4F9TA 4OUDB 4B35A 5KU7A 5LYJF 3U1BA 3LHKA 2I71A 2C7RA 1EYZA 2SKDA 1XZBA 1K6JA 2XE8A 2WQ6A 4DRXB 1YR2A 3Q6MA 5HKKA 2J3LA 4RMIA 3UAOA 3CP8A 5ESDA 2A7QA 5LMUB 4KREA 2JBHA 3CX7A 2BKUA 8ICYA 4H9GA 2YV5A 2R47A 5FWYB 2C9MA 3ROGA 1T9KA 3TK1A 1IUNA 3FFXA 3QKTA 1L8AA 4BBAA 2Z08A 4KDFA 4B3TB 3TF5A 4F92B 3KKAC 4F5OA 5CT8A 5GP1A 3CBQA 2FN7A 1DTWA 3DC7A 5A7HA 1ZN8A 1PGQA 2ECQA 2FWIA 2JGNA 5A4DA 3QBEA 2KKVA 4EMSA 2UYCA 4INJA 1XZCA 3A11A 3HA3A 2HBZA 4WERA 4IVQA 1O97D 3SXPA 5G1PA 4JVSB 3WLSA 4M0EA 3ZHCA 1DJQA 1Y3DE 1HPLA 3CH4B 1JDBB 4GPEA 1ZEMA 3FCCA 4L9SA 4CQNA 3UMBA 4Q19A 5EGSA 4C6TB 5ECYA 1KYVA 4BE7B 2G67A 2QXUA 2VJAA 2VSYA 4X65B 3D3EA 2P9TA 1BNCA 2IPOA 4ZYUA 4DOBA 4LC0A 2JGIA 1EBBA 4DHWA 4EH1A 2H9IA 2JFNA 1RAGA 1XD9A 1CC1S 4G84A 3W1EA 1PL0A 5G0TA 1WUDA 1ZRMA 1QG4A 3F67A 3P45A 4J29A 1RRFA 5BR8B 1G8KA 4TUSA 5EVCA 1GZDA 4NG5A 3M49A 3D1VA 1GEGA 3HUEA 1IOWA 3M2TA 3BXZA 4YO7A 3EDMA 1ESMA 1XQWA 5HQ3B 2KLBA 1UT6A 4MV9A 3COZA 4BP3A 5BUSA 2VNIA 4HG2A 3DV0A 1IG0A 3HZZA 1QFJA 3TBFA 5CIYA 1QHIA 3SKVA 4TWRA 2X4LA 2QORA 5H5JA 1M66A 4QOEA 1UDRA 1ABBA 3E9EA 4LJKA 1E0SA 2VZEA 4B7ZA 4BDTA 1SOUA 1ILEA 4IDBA 2C2KA 1JIVA 3FTEA 3QGMA 4CKWA 2IA5A 3EZNA 2W58A 4G0WA 1KFSA 5I4KA 3TJMA 1GO2A 4V39A 3HR8A 3THYA 2G06A 4DPMA 5AJWA 2WOOA 1DBVO 4E22A 5CB8A 2H3VA 1SXPA 5BNWA 3EGCA 2VJPA 1Q15A 3IEUA 4XVHA 1VBKA 2Y92A 3OPMA 3GGCA 1L7BA 2I99A 3ZU4A 1XU9A 1WUTA 3G23A 3FCUB 3DWIA 3CNOA 3HN7A 4K1XA 1M34A 2J9ZB 2AD1A 2EAOA 4MMXB 4JT8A 5HF9A 7ICRA 4MR9B 4TROA 2Y0SC 3TLKA 3N6RA 4Q1BA 4GKAA 1JE0A 4M0UA 4YIKA 1KJQA 1RE1A 2B25A 4E2FA 1NUUA 1TF2A 4Q3LA 3F98A 3KZIU 3ROKA 4P31A 3ZHYA 2LXNA 1E3QA 2QVBA 1GLGA 3RUFA 1RYHA 3NANA 2BEJA 4YP7A 3OU6A 4RENA 5DLGA 2WFZA 3L93A 3KQLA 1DS6A 5DN6A 1BDBA 3HADA 3UGTA 4QGBA 4RPXA 5JIBA 3HDYA 5F98A 2JGFA 3CLRD 3HCWA 3C15C 3V7NA 4PO8A 3LIPA 5HOQA 1U5AA 3JPYA 4OO1J 2J0EA 3OCVA 5BP7A 3JAMA 2WJIA 1XTSA 4G0UA 2UYHA 1IY2A 4PZNA 4JVLA 1YFLA 1GN9A 4ZQFA 1J2TA 5DM2A 4QO7A 4IUDS 4P0QB 1NVEA 4CG0A 5CLLA 5DLFA 1IJFA 2H5XA 4W6QA 3BL6A 4D2IA 1K3TA 2PQ0A 1HDGO 5DSZA 4O33A 3OQ1A 2YFYA 3CVXA 3W6PA 1F17A 4R1MA 4PQFA 2ZYSA 4ENSA 2OHOA 4XUDA 4NV1A 3OGUA 3DDUA 4G0OA 3A9UA 2LCQA 4ENQA 1VLBA 4F2RA 1GFIA 4C2AA 3UJ7A 2HCRA 4FVTA 1QTMA 3CZ9A 3LECA 2F3QA 2OXEA 4IGEA 1Y89A 1TKBA 1F20A 2QNIA 3H04A 1DEKA 2SCUA 4DY4A 4G5QA 4F72A 3TQ1A 4QYIA 4QVGA 4NEGA 3AJEA 2VT3A 1GAEO 4UM9D 3COPA 3GLFB 5LN1A 3LA6A 1YJ8A 1N6NA 3BKWA 1ZI8A 4P8RA 1CF4A 1MP0A 4YJDA 2DFVA 3I92A 3ZQKA 2X2PA 4D8TA 1NVBA 1NK4A 4G0NA 2WE8A 3B60A 1MPXA 5E4FA 2C7VA 1QUEA 1IIBA 5HOEA 2WTNA 1JR2A 1I5EA 1FU8A 2E5LB 2A19A 4HTFB 2I8CA 2XGGA 4KWHA 3DYVA 4Q1AA 3KP1A 4I2NA 1Y8ZA 2DRIA 2F9FA 2FF5A 3QMVA 2MR5A 1MR3F 3GAMA 4JBYA 3F9RA 1GGEA 1MAAA 2PX0A 1AKWA 4Y9SA 1OASA 3FGNA 4O2BF 4F11A 4GXRA 1N92A 3IEMA 2BUCA 4B7AA 1ACJA 1EWYA 4C20A 2H1OA 2JR5A 1PSDA 2O5VA 5ADUS 3C1AA 2QVYX 2PYIA 4TLLB 3LY8A 1GZ7A 3PO4A 1DMSA 3N76A 3OJOA 2XVYA 3TEJA 1SGGA 4I55F 1GY8A 1KQNA 4BNXA 4OI2A 2W9AA 1X3SA 3T5GA 2PUAA 1CULC 3K09A 4CWAA 2F43B 4HYQA 5IC6A 4RQ4A 1LV5A 4E94A 3PJFA 3VHXB 1M33A 3P5SA 1UAAA 1EK1A 2EP7A 1ZQZA 1S2GA 3ANSA 3VNBA 3NKVA 4NAUA 4AZWA 1QCKA 1PWZA 2HIHA 3FSRA 5H68A 1XMOB 3LP6A 4AWXA 5AJTA 1LLUA 1XT6A 4NH0A 4NYJQ 5A7FA 1QFMA 1R4NA 3Q6IA 3K9LA 1NR5A 1U3FA 3QLJA 4P3PA 2UZ0A 5HTKA 4Y2VA 5AJHA 4FYMA 5IN5A 3GRCA 4TRMA 3SZGA 1HDRA 4KWCA 1WHSB 4YT8A 4WJKB 4CN8A 2YYAA 3CVYA 2W8KA 1FP4B 1XHEA 1I1QB 1LK5A 3KEMA 3HO6A 2BFOA 2WUVA 3R5SA 3TX2A 3D02A 4DS5A 5EE1A 1NW9B 4BC1A 4JMUA 3HDTA 3CRW1 4CI9A 1UKZA 3V46A 1VKJA 1HF3A 3ZEAA 2GBPA 3R2JA 1EX7A 1RPNA 1T5SA 5HEKA 1ZWLA 1P2VA 2PWBA 3KKEA 2WZQA 1P60A 1UK8A 4CL8A 4MVWA 4EBEA 2BBSA 2O50A 3U4GA 3NTLA 3GLUA 4CJXA 1J06A 3TOSA 1KJJA 4O5KA 4GOLD 1DDGA 1SHZA 4JL6A 1E1CB 3OUZA 3ZIAA 1JIKA 3RF7A 1U5BB 2Q3BA 3OHSX 4XGQA 1Z22A 2JC3A 1WSWA 3ADKA 5IANA 1I36A 3ZY2A 1AUOA 1PR0A 3VU9B 1FJGB 4Q45A 4FYWA 1NURA 3PRYA 2OAP1 5BN5A 4DV7B 1KJWA 1JH8A 1SA0B 2PQMA 2PUDA 4IP0A 4P36A 2AEMA 1SKWA 4RQ6A 1D9FA 2HRBA 2VJ5A 1AKTA 4ZKEA 2VTBA 3DO8A 3RJZA 1U0EA 3HCBA 2Q3JA 3FWKA 3RVQA 7ICNA 2GAIA 4C7OB 1HE1C 2XRMA 3NUZA 3T9FA 1LTQA 1DC6A 2BGGA 4YG2A 4OLAA 2QR3A 3WRXA 1PT6A 1TZJA 3UTDA 5IKOA 1RLUA 3ADPA 2AI1A 1O77A 1QV7A 4JV5B 3CUVA 3LC7O 3LP5A 4RNDB 4O5OA 4A8TA 1JEJA 3DDNA 3JASA 4XEUA 3R7LA 2N0SA 2PV7A 3KQSA 5ESWA 5H82A 3TLJA 3PGKA 5JNVA 1PK1B 3PSFA 4V0QA 4TKUB 3D6UA 1WXGA 2GDZA 2VJNA 3VJRA 1NR7A 2XE7A 4U00A 1S97A 2VK2A 1C20A 2YC4C 4GPBA 4P98A 1TVKB 1HEIA 5KFGA 3W9SA 4JZYA 3WC4A 5EZYF 1FDOA 3TW6A 2F4NA 2GS9A 2MR6A 3UJ8A 2CHVA 4F4UA 2ZB8A 3VPHA 1P2BA 3FPHA 1T5IA 4J9NA 3WGVA 2W7OA 4F50A 3KB2A 1LJLA 3D2QA 1WYGA 4FD3A 2VDNB 4V1CI 4LYFA 3UZUA 2UXCB 4L74A 1DFIA 2OCBA 4V0OA 3HXPA 5J23A 5TEWA 3UW3A 4TKVB 4B73A 4JC0A 2AGQA 1RJFA 2MSNA 5KQLA 1W47A 3OURA 5KDDA 3BTUA 4BFUA 1CB7A 1Y3AA 1U3UA 5B64A 5I7WA 5F77A 5KB3A 3T5LA 4K6KA 3NTRA 5DLQC 4FFPA 4B9SA 4HRYA 1KNXA 4GRIA 4IGFA 5DI9A 2CJFA 1QZUA 2RE8A 4BEVA 3EVZA 3FTNA 2G76A 1MPTA 5HCUA 5IG2A 1DAIA 1OVGA 2WUWE 2B2XA 9ICIA 3PD7A 1X1EA 3HYTA 3O95A 1YRBA 4FXPA 5KREA 1C3VA 3E2EA 2GN4A 5ED0A 3F6RA 2GZRA 3KQQA 1N2CE 4C07A 5ARBA 3D4NA 3WWOA 3KAPA 4JCOA 2ANBA 1R9NA 4BU0A 5CBPB 4KO1S 4BX2A 3PENA 2ZB2A 1THTA 4GR5A 4BAUA 4RQUA 3CLTD 3QPWA 3ZLVA 4KC0A 3HC7A 4D42A 1U0FA 3OPYI 4J07A 5BVHA 3KSMA 1C81A 4C8LA 1L3TA 1RP7A 1HBJA 1SUIA 2EH9A 3JAWB 2I7TA 3F73A 1PAUA 2VJMB 3QLVC 3A4IA 3EUB2 4Q7QA 2X7XA 4KE7A 1BVHA 4HLUC 4US1R 2ZBEA 3KHRA 1JEDA 1AE1A 4EYGA 4XCVA 5THQA 5CB4A 2IP2A 2GPSA 1JAHA 1XKTA 3GMTA 4FPXA 4NU0A 1RBYA 3GDHA 5EEHA 1YBAA 4BP9A 1ADFA 5TMDA 5LBIA 2WYWA 4K5QA 3PJRA 5BWMA 4EJFA 3Q7TA 5DHSA 4E88A 3GLRA 4ZOLA 4YAOA 2R11A 2VXOA 1XNGA 3TCNA 4J3NA 1KR2A 1S0OA 4J4BA 4OIFA 3WYDA 3C2MA 1PJSA 2ZK7A 1DFHA 3GPLA 1I0IA 2FPIA 3JV7A 2EJWA 2R6R1 4OJLA 2DUWA 1N2BA 3BXPA 1OB5A 4KPEC 1IOLA 4DIOA 1QYWA 3EVCA 4DT1A 1PJ4A 5KNDD 1RYMA 2JBWA 2WSSD 4UHKA 3HHPA 5KOIA 3FKQA 1TADA 1FVOA 3W1WA 1YDWA 4XAQA 1T2UA 4DSJA 2XXJA 4N3CA 4EMBA 2Q21A 1G5IA 4H1WA 2W43A 2GEKA 3KKKA 2XF2A 2NQ2C 3GDOA 1YI0A 2XT0A 1EXNA 1QQ7A 5C4GB 1BFUA 2Q0QA 5C8ZA 2JNWA 4CR6A 4J7CA 1Q11A 2CKMA 3EDCA 2DETA 4KYUA 6Q21A 5MFZA 3CVVA 3AUXA 3TLZA 3QMPA 1EFRD 2ZPAA 1XSEA 4LG1A 1YC5A 2FLKA 3CY6A 1YRHA 2ZAIA 3RK0A 4XVQA 1QVZA 4KO4S 2WAMA 4C0QC 1RXYA 1QYRA 5FHQA 3O8NA 3EIEA 3GOHA 4XSHA 4ZO7A 4IMJB 1SNYA 1LB2B 4B9MA 3JPPA 2P2DA 4E13A 3ZGLA 2HXSA 2M0NA 2XCAA 4CRWB 4HRAA 2OMKA 2YJNA 3BREA 5JYEA 5LKRA 3RRXA 3LTEA 4TYMA 4CCWA 2KV2A 1I5RA 4H7HA 3OE5A 5I9IA 1U8ZA 4KOAA 4IXTA 1FLNA 4QJBA 2CXNA 2WWVD 3HJAA 5D87A 2VQEB 1KZ6A 3KOUA 1C1HA 3UOAB 2DUYA 5JVDA 2G9QA 2WMYA 4FJ0A 3AHDA 3QVUA 2I1WA 1V8DA 5K01A 3I28A 4QT0A 5MFPA 2KJ8A 2QT1A 5JUWA 1MXFA 4MLZA 4Q9IA 2X4IA 2PUBA 1CI4A 1PTJA 3UH0A 5KOJA 2IE8A 4F2WA 2Z6VA 5C5CA 1BKDR 2I6QA 4J6FA 5B57C 4JWNA 3B2EA 2ORYA 2ZXIA 2ZR8A 5L6LB 1D8TA 3PEUA 3QHAA 2OZLB 4PPQA 1MOSA 1J1ZA 2QRVB 1KDYA 1GL9B 4QTUB 1B73A 4PQEA 1V1RB 3C45A 4K9KA 1BNOA 3LRXA 3DF7A 3K1JA 2ACKA 2Q0ZX 3GLSA 1KSGA 3SYRA 1WNFA 1EGVB 4RZ2A 3O9MA 2FPMA 5ALHA 1YIDA 4L85A 4K6MA 1YUMA 4Z6DA 2IHMA 2XX3A 3DV9A 5KMGA 1RWXA 1XDZA 2FFRA 2QTFA 3EC2A 1B2LA 2HU7A 4Z1MD 2RAFA 3R74A 1U0NA 2AK3A 1X9XA 3GDWA 4XWGA 4CODB 2OLKA 4X8LA 1MTOA 5JSYA 3W90A 3ETHA 3RHTA 3LKBA 2QQGA 2P41A 2ZWMA 2ZCJA 4ZA2A 3G13A 4RD4A 2AMFA 1VLMA 4YRBA 4DKXA 3BGWA 2WYIA 3WTBA 3L2OB 3PYLA 5AKLA 4JV0A 2VLBA 2H3HA 3K0SA 4NBKA 3WU2U 2HM7A 4IICA 7ADHA 1Q0HA 3R8XA 3QKRB 1NULA 3H5IA 1P3Y1 2CY0A 3V7KA 1QE3A 2A0UA 3C87A 3OZEA 4Y6GB 4D9HA 4RAQA 5HHHA 1TJNA 5T67A 1DELA 2QL5A 4RHFA 3TAUA 4H7KA 1REQB 4M21A 3NOOA 4EKDA 1EZZA 2OE2A 4EYOA 1V3VA 3FHCB 1QBKC 1ZUNA 5H0IA 4B82A 2YWRA 4AZ3A 2JAHA 4GZ3A 2ZYVX 2AEJA 1KH1A 2AN1A 2AXNA 5AW4A 5AQEA 2AOWA 1VLJA 2D0DA 4YMOA 1I4EB 4G1EB 4RF4A 1HLFA 3QUSA 3MOIA 4BV2A 4UTZA 2FJPA 3LZ6A 4HFMA 1XFAA 2I34A 5CHYA 4F3RA 3L92A 3REQB 5JD4A 3MD9A 3R1IA 3P9PA 4G5OA 2F3TA 3ZLJA 4OHCA 3WLEA 3L4JA 1JDVA 3PX6A 3O38A 3MCUA 4KQ9A 1P4GA 4ZT5A 3SXUB 3DT6A 4IDAA 3G2NA 5A5DA 2ASEA 5H80A 2I4IA 2PGOA 1CP2A 1RYNA 3HVRA 3O4HA 1T3TA 1SIUA 5KJ6A 1NWHA 2R8IA 3P20A 3RS8A 1L4GA 2NXNA 1VYVA 4DF8A 1RBQA 4G09A 2W7PA 3G7UA 9ICJA 4GXTA 4IW3B 1ETHA 3OEWA 4HT3B 4DV5B 1P91A 4Z3OA 4ZTBA 4ECAA 1VCIA 4UUAA 3T95A 5IIMA 4K81B 5IVDA 3KO8A 3TGWA 2QX4A 2FG6C 2VFAA 5A3JA 3Q4GA 3TZBA 3GIMA 3GJTA 3AU2A 5K8JB 3WDSA 2AFIB 3OQMA 4MI9A 4NFYA 2H1IA 2FMHA 3SN6A 5H83A 3JAKB 4GC5A 4A2PA 3I3SR 1NSFA 1LBQA 3NHBA 4WOCA 1RZUA 6AT1A 3L4SO 2O4UX 2QXYA 3LUJA 4BVJA 3PL5A 3O0TA 4AJ9A 3X2EA 5CCXA 2Q6IA 1NP7A 2KBFA 3VYUB 2H17A 3PQ5A 4F4IA 3IHWA 5FI1B 1NBOA 1MV5A 3HY4A 3R24A 4Q4JA 4DLKA 1YQEA 1N77A 4X94A 3K70B 4EY8A 3F6SA 4CMAA 5KT3A 4ED3A 3FCSB 2EFYA 1HZZA 3SVTA 1CT9A 3MBKA 4PLVA 3VTAA 3RK4A 1NUSA 1WLYA 3KKOA 2MTBA 4EHBA 2ZT5A 2DFPA 4V38A 4HK4A 1ODIA 1FFSA 3PY8A 5J2UB 3N2GB 1L6RA 4KFRA 3CB4A 4H3VA 2UVUA 3N75A 1KDHA 1ZISA 1P5JA 3K9WA 5TPZA 1X40A 4EELA 5DTQA 4RA6B 3VA7A 2FEKA 3ZK9A 2GCOB 3DULA 2XZOA 1ECFA 2K8CB 4JEHA 4ZD6A 1L5VA 5IASA 2OCXA 2IYWA 2IYTA 4YQWA 3UJBA 3RG8A 5KJ1A 2B6HA 5AVRA 1YR6A 4PFJA 2PH1A 2QZSA 1K86A 2WQ7A 2BI8A 4D1YA 1YRWA 4CL3A 3FBTA 3BIJA 3TNJA 3LTNC 2GT1A 2ZVQX 1WV1A 4GNKA 1KNQA 2GWSA 5CP8A 4F4KA 1EG7A 2UYOA 3M1IA 1GCGA 3FWYA 2AF3C 2H1LA 5F76A 4OKSA 2C2RA 1F7VA 1WPGA 2N1MA 2DWCA 2P77A 1U28A 4NMLA 4B4OA 3OE4A 5D49A 1Z45A 2ZRKA 4Z8YA 2ZSEA 3FRHA 2WJAA 4DQRA 1JSRA 2YVQA 2ZRJA 2CNBA 1ZQCA 5CNJA 4UU0A 1OR8A 4BY9E 2R00A 2C5HA 3MTAA 5JJLA 4MVXA 3FROA 1JHMA 1N6PA 1IN1A 5EP1A 2JFUA 3BSFA 1K9SA 4NXMB 4GKVA 2B82A 5KT2A 4JDUA 4MFCA 4CKZA 4ENUA 3W7BA 5KAPA 3T9EA 1GL3A 2ID9A 3AHIA 5KFVA 4O29A 2C5GA 3H3JA 2C4HA 4ZPJA 4J7AA 5JZMA 3O8OB 4KFTA 1GPH1 4Y2PA 2JI4A 2JZOA 4COKA 2G7MC 4MHSA 3AONB 2C94A 1KEWA 3PRJA 3CZRA 1XUOA 1K1QA 1UJ2A 1CRLA 2Q6KA 3SBOA 4KITB 3R6GA 5TF0A 3C8HA 5HG0A 2WTMA 1IN5A 1E0JA 3OECA 1M2NA 4KYTA 4C87A 1AT1A 3AF2A 3IP8A 5C8YA 1N0VC 4GBED 3WG9A 2VG8A 2FWAA 1U1CA 1ZI6A 5MN4A 2KMLA 4H18A 4E7PA 4EI9A 1T4BA 1R18A 1XAGA 2D2VA 4NESA 2FDXA 1B74A 4NCXA 4F2PA 3ZI0A 5AM0A 3BSYA 4KIGA 1MC4A 3PE3A 3CZQA 4N8SA 1SBZA 5JARA 3A2NA 3V8MA 1DIBA 1EFVB 4OUKX 3KR9A 2HGSA 3ZVNA 3CTMA 5LQKA 5BPHA 2QZZA 5FADA 1L5HA 3L7MA 5CRIA 2OQIA 2ZTMA 3THRA 1X9MA 3K0CC 1U47A 3C7KA 5DB7A 1ECWA 2EGHA 3ZPXA 1T2NA 4G26A 1SRQA 4HWSA 3ESRA 8ICFA 4E5MA 3BWDD 2R6AA 4XB2A 1RAFA 3ZDFA 3OM0A 1FLDA 3AIIA 2HT1A 1TUBA 2QRGA 2OO5A 1M6VB 2OXIA 3SIXA 4MHOA 4RTRA 4BGIA 4UQLA 1UOPA 4QW9A 5HIIA 4PR0A 2RC5A 2QUJA 1UMDB 2Y1EA 1L7DA 3L43A 3DDOA 3M1YA 2IKSA 4O4HF 1N5XA 4CM9D 5AVJA 4YX9A 1TC1A 5J2EA 4IBOA 1DAFA 5ER6A 3O2NA 3A4YA 3HVHA 1XLWA 1IXZA 2FMSA 4PICA 4ZVVA 2EW2A 4RIEA 3CH6A 1Y3CE 3A32A 3QHQA 2DKFA 2VQDA 2Q27A 1EJBA 5CTAA 1GTRA 5C7YA 1TT5A 2KLHA 1M2EA 1MT3A 5I7OA 4IGKA 1MOPA 1Z6PA 3MF4A 2XUOA 3UY4A 3AR7A 2R4QA 5ESXA 3GGPA 3L7NA 4PQYA 2WYOA 1EVIA 2EP8A 4AUEA 2PT6A 1ICIA 2FGJA 1U0LA 2RBKA 2COEA 4O5CA 3ZW9A 1KMIY 2VF4X 4BBZA 3FI9A 2C42A 1VBNA 2R1TB 2O2JA 1EX1A 4IJ5A 3IQHX 5BYJA 3IQZA 4NSNA 4O4LB 4YD2A 2XMZA 3QOFA 2L18A 2XWSA 4Q39A 1D4ZA 3SFVA 2NXEA 3JD1A 2A9KA 2PLWA 1U2DA 1RABA 3GWGA 4A8JC 3AZQA 3QVLA 4Q00A 2EWMA 3PZPA 3ISJA 2X22A 3A9WA 1VIAA 4ZOAA 2IOYA 2PS9A 8ICMA 3LQ1A 3IMKA 2CHUA 4REQB 5A9SA 1AH2A 5HE8A 4Q34A 3REFA 3UUGA 3JQ8A 5C4MA 1DG9A 4UQOA 2IXGA 1FQOA 1IOZA 4CQJA 4Y2TA 4J1SA 1CXZA 1B8UA 1US8B 4YRQA 3UJCA 2EVWX 4X6UA 4L7QA 2NQTA 3W8NA 2QKYA 4LECA 2KJ5A 3K94A 1ZRNA 5E4TA 3AEUB 2F7SA 4YJFB 5J4LA 3ENQA 2IEAA 2I2CA 2QRKA 4V0ME 1SR8A 5KWVA 4K9PA 4PIPA 4Y2YA 4QZAA 3AVYA 2QMEA 4B3BA 1H3FA 1SUCA 1P7CA 4WVFA 2BLLA 5JQGA 1AF4A 3K1TA 3U13A 1QU2A 2ICAA 2JZNA 4Y2GA 2I7DA 2YZNA 3B7PA 1P5ZB 1OLSB 4QPCA 3KLBA 2BOVA 3Q87B 2QM8A 2PV0A 1XE3A 4H16A 2CLCX 1KE1A 1HETA 5FQOA 1ZD3A 2R8GA 5F9NA 3D5TA 1O95D 3KEFA 3Q12A 3QWFA 5FIUA 3HXMA 1T9GS 5JC1A 4Q1DA 1P7VA 2XA9A 3H2BA 3QVXA 2C5LA 1M2OA 3RVDA 2WFLA 1CQWA 3IX7A 1I3KA 3ZVLA 1R0KA 2XLBA 1HLDA 3T5JA 2E49A 1NQVA 1W35A 4X66B 1JEQB 1YB1A 4D4GA 4K9QA 4FBGA 1N7GA 2G5IB 4F2DA 4JNKA 3UKOA 1NPTO 2WTFA 3DOIA 4BRZA 2V7UA 4A5SA 1N0WA 4YJ2A 2BY4A 2DUJA 5AK6A 1NQWA 4QSMA 2CJWA 4NCIA 3UQZA 2CE2X 4AKSA 3QBTA 1PBNA 1UPUA 2HBQA 5KTOA 2OXTA 1FNCA 1GAXA 5EL0A 1N33B 4E4TA 1Z0KA 4OSEA 4WNAA 2RGRA 2JFPA 4IKPA 1C1XA 1RLMA 3HV2A 1DNPA 1CJVC 2QN8A 4P38A 3ZD9A 1LBSA 1CDEA 1LJ8A 3M6LA 2IYSA 2WMDA 4YMTA 3ZS8A 4QASA 3E7DA 3KQPA 1RI3A 1V7CA 1IHDA 3I6ZA 5G0SA 1OC2A 3JWHA 2VL7A 1PUJA 1EQAA 1IWOA 1GSIA 9ICHA 1JG2A 3HRHA 3ZE0B 4LF8B 2I1VB 2PZEA 4OJKA 3DEEA 1R0XA 1DJLA 3LF1A 1K6IA 2Q5EA 3RJEA 4OGLA 2AQKA 1OYVA 4IRMA 4KMMA 2OCEA 3NWBA 1JFSA 1QORA 4IZHA 1NJSA 2ADMA 4JJKA 4CLHA 4MZXA 4PXSA 4DMHA 1JPNA 3CR7A 4DQLA 3O82A 2XVMA 4ED0A 3G2QA 3OPNA 1TA0A 4Q7MB 2N3ZA 3DKVA 4X95A 3CWQA 1BYIA 1OH8A 1XEAA 3UXNA 4KSYA 1XAJA 3IKJA 4N1AA 1OOEA 2XBMA 1LSOA 4OYLA 3WKBA 3V4ZA 3VR3D 3PQ6A 2CNDA 4JI8B 2VOEA 3OM8A 2PJZA 3U3OA 5KFEA 2O7QA 1Y5MA 4WCFA 1MX1A 2QMYA 4ND6A 2QS9A 1Q44A 1KRWA 3MWKA 1UM9A 3SSOA 3KX2A 4RZUA 3IIIA 1FUEA 2OHHA 3HM9A 4BWMA 3W77A 1PTKA 1S2DA 2VAWA 3DTVA 5GZ3A 2R0QC 1O96B 2JLRA 2C2EA 3VH4A 1B0ZA 2I4TA 4X5VA 5DJ5A 1JT2A 5CXXA 4N0EA 4OJYA 4AMUA 4XDGA 1F6WA 4J9RA 2BMAA 4FFLA 1T6YA 4JT2A 3KSRA 4GFJA 1Q3HA 3WWCA 6REQB 4NBLA 3OZUA 5J43A 3C7DB 3GJQA 2R8KA 2VYCA 2C0QA 2OCKA 3WRYC 4B3DA 3KYDB 3F90A 4FFRA 3KDPA 2JJ2D 3TI9A 3SR4A 3UQYS 2AI3A 2YY6A 1FTQA 2P3OA 1FYWA 2BGLA 1R6VA 2PBLA 1VHLA 1VG0B 1UWCA 5EHGA 1OD6A 2REQA 1PD1A 3ER6A 3BRSA 1BRMA 3UANA 4BAZA 4C4YA 3UWSA 1Z3IX 4Q1CA 2HBYA 2K87A 5M34A 4UDXX 2YYZA 3JTMA 2NPFA 2EX1A 5JHHB 1P31A 1R66A 1R8SA 1PS0A 2ZSIA 3O83A 4BCCA 5DGCA 5KFXA 3FTDA 3ANLA 3RRZA 3VNAA 4FZMA 3NVYA 4AMZA 2VH2A 2PM8A 2NP6A 2CLMB 5L1MA 1CYDA 4IO0A 5IJ9A 4B0OA 4QOFA 3RIXA 3K0FA 4HZUB 2LKCA 2P5UA 2QI9C 1SL2A 2C2HA 4QNMA 5J0OA 2CFTA 4PZUA 5AOCA 3W4IA 4EGCB 4KE9A 4MR7A 5BSHA 2C9DA 1ANKA 1Q19A 1B8VA 1TK9A 4BP8A 4B84A 3EXG2 2X0JA 2BEVB 5KTMA 2IKQA 5JSUA 2ZRBA 4AWBA 1B14A 2ETVA 3P2EA 1QCZA 3OQPA 1E7WA 3PJDA 2Q4DA 1SKUA 1K5OA 3T94A 4M9LA 2V4UA 1NUQA 4FNGA 2YV1A 4IWXA 4ACBA 4OHBA 4J9KA 1ECCA 3ENNA 5KVSA 3S7ZA 2HT6A 4KRFA 3D3JA 1JG1A 3P2MA 1D0VA 2YUTA 4HR7A 3FBGA 4PR3A 3THWA 3ME5A 3M3DA 2ROQA 1EXDA 4FP9A 3MXOA 5TPWA 2AJBA 2P2ZA 8ICCA 1HG1A 3WLTA 3CLSD 5LQDA 4F9EA 2XGJA 3T7JA 3T06B 1X7ZB 9ICMA 5B2FA 3RO7A 1Z6AA 1E92A 3TB4A 2CZGA 1OLOA 3GFBA 4WTOA 2P9ZA 5H81A 3CU5A 3ILVA 3P9CA 1W1IA 4YDSA 3D4OA 2BM8A 1JVSA 2H2AA 2FWRA 2BI7A 5A06A 3LZDA 4GMHA 4M0PA 2SECE 4U4AA 1Y6JA 3EFBA 3TVYA 5KDOA 4TRNA 3WMWA 1UFQA 3GA7A 1BEEA 2A94A 3A1VA 1GU0A 1LY1A 1AN9A 4C76A 1AGRA 4DADA 4LEIA 2BDEA 3LBHA 4IHAA 2D1SA 4DANA 1Y8RA 1W96A 2WMOB 1V7PC 4YHHB 4PLCA 1XJWA 1TAUA 2O3JA 4ZVPA 4JI5B 1K92A 3KWMA 4BNHA 2P62A 3FDZA 3VVCA 5LD2C 3CV3A 3LYSA 4DFJA 3NATA 3O4VA 1WA5A 4EVRA 3KKQA 1FB5A 4ENTA 2PKXA 3KJNA 2W48A 5HPYB 2GBCA 4MH0R 2JV3A 3I09A 5LCXA 3BMNA 1FFYA 5KL8B 4KMOA 3B9JA 1CR4A 3BEDA 2QAGC 3O90A 1KFCB 4I9GA 1R00A 2PZ8A 4YRSA 1A9TA 4YRKA 4MQFB 1XK6A 1E4YA 1AZLA 2C7OA 1LW6E 1MN8A 4AYWA 2JK1A 3FUCA 3TLGB 1NNSA 2H51A 2C1EA 3PIIA 3D6AA 2X40A 1E7YA 4XYLA 1P19A 2Q9AA 1ZJJA 3PIRA 5KHOC 4FT4A 2WWWA 5DXAA 1LV8A 1J6UA 1ZQFA 1U2ZA 5FAKA 4MWCA 5C18A 4JWMA 7ICLA 1PG2A 4NL4H 4O3OA 1THMA 2VBFA 5KNLA 3UJPA 1TYEB 1TXGA 521PA 4ZICA 4DM3A 1B26A 1U94A 4LQ4A 2BUBA 3THXA 3CEJA 4U7WA 3G68A 3D4BA 2J8ZA 3NBMA 3FA2A 5DKFA 1SVSA 4N39A 4FR0A 3Q7IA 2XC9A 1T4GA 1L5ZA 2Z9BA 3CF6R 1KS2A 4YB8A 3VRHA 1CZOA 3BCUA 3DCIA 2FPPB 2QKQA 2CT8A 3T3PB 1YD7A 2AH5A 2HA2A 1RWKA 1Y8QA 1JDNA 1H2BA 3TOCA 1M7GA 4N49A 1OFUX 3GNLA 4DJEC 1NUPA 2FWJA 1U9YA 4EJMA 1Z4QA 5A2QA 2IODA 4HATA 2JHFA 3KHSA 2JAUA 4MR8A 1HGXA 4RHYA 3O9VA 5EJ8A 4OY3A 3NLLA 4ZN6A 1NI4A 2IV7A 1MD9A 5B30A 4FFMA 3MJDA 1Y5IA 1ST2A 1PEKE 2QDKA 4XJVA 3PPYA 2ERCA 1UKYA 2A30A 2RHMA 5EIAA 5B7PA 4XYEA 5KAIU 3PRHA 4PL1A 2Q3LA 5DBAA 1C7FA 1QYDA 3QUTA 1T6XA 4QGFA 3S6JA 1RM0A 5CGQB 5T4HA 3UCXA 3PUJA 5JS6A 2M6LA 4O2LA 5GONB 3QW2A 1JE1A 1J0AA 4CEIA 4R65A 1Y1RA 2QX7A 3ICWA 2BR4A 4OQXA 4F1JA 5CPFA 3IXQA 3VSEA 4ZZ3A 3H19A 2ETXA 3R0IA 3MWEB 2FUKA 1CG6A 3FCYA 5FWXA 4AS2A 2YWBA 5KOYA 3TZ6A 3TJRA 3UXMA 4FSDA 4JDPA 3TZEA 1V1MB 3KHKA 4RV5A 4ZJYA 3R5KA 4E15A 1XC9A 1K7FB 1XMQB 2ZIWB 2CF5A 2P27A 2KIWA 3MGCA 3ANTA 3HP1A 4W9NA 2I3ZA 4HOYA 4YMGA 4DLGA 1N1MA 1USWA 1AS3A 4GM0A 3EQ2A 5ALMA 1IAQA 4K87A 3TKYA 1V9CA 2O3QA 1JHUA 2WHYA 4DSIA 4J7XA 1JF8A 3CZPA 1GITA 3AYZB 3A0HU 1CIVA 5K0ZA 3OE7A 2Q3MA 1OX4A 1VQ1A 2HO5A 4BDPA 3K72B 1OB2A 5IP5A 2QL9A 2Z0MA 2GTHA 1MW9X 4QEDA 2QL6A 3EGDB 3PQCA 4WNCA 1TQ8A 4B44A 1S77D 4U2KA 1R50A 2PLRA 2H3ZA 2ZJAA 4CDNA 3L4BC 4ZYXA 2REBA 4KJZA 4XIIA 3SD7A 2RHTA 3O03A 2IHKA 5LPNA 3C16C 5CVJA 4GSLA 4DL6A 8ICJA 1FNMA 2X7HA 3IUMA 4G25A 2ADFA 1TRHA 3E8SA 3CE9A 4IDDA 1YQGA 2EYQA 3N8DA 4YVFA 5GAJA 3HJUA 2Z04A 3SC4A 2EWWA 2H85A 2AN3A 4J0FA 1FPQA 3B9QA 2XCLA 3OT5A 1QAOA 3D4LA 2GZAA 3WXBA 3UB3A 1COWD 4LC9A 1VHQA 8ABPA 5T4BA 1RYUA 4MS4B 2CL0X 4X20B 4GL4A 3P0FA 4TYQA 3SC6A 5LZ4A 3C6BA 1B2RA 5JS2A 4N5IX 1JMKC 3AUKA 3U3MA 2FH5B 3C5EA 2J0SA 2PMZF 1XC7A 2HHQA 1W5FA 3E3LA 2CN1A 5JLAA 3D4PA 4AQ7A 5HZHA 4C22A 4IX1A 5KFQA 3OF2A 3IQWA 4BO4A 3SC2B 3MHTA 2WY2D 2VHZA 1YUBA 1V11B 1LI5A 2ID7A 3VGPA 1BVSA 3CONA 2BCJQ 3DAPA 1O5OA 2Q41A 5KKNB 2F1RA 2YKGA 4IQ4A 4YRZA 3ZKAA 3EIWA 1RE0A 1YZNA 4YQYA 2Y99A 4FZNA 2B1QA 4X63A 1MO5A 3Q7SA 2CXRA 3PUVA 2XE6A 4G85A 4EZEA 3V32A 5KFBA 2WJJA 3HGTA 4MDHA 2V1XA 3ZCPA 1FOEB 5EFOA 4GU5A 3B5JA 2OV3A 3UJHA 4NR0A 4MKRA 1WB6A 4MICA 4FFOA 2QUHA 2GTPA 3ILYA 1UPFA 1VE1A 4NCJA 1O9HA 1C4KA 1WCIA 2ATXA 1DJMA 2NXJA 3IYLW 3WLPA 4ZQIA 1U4SA 3EEIA 3ZWQA 5KFOA 3RBAA 1SD2A 1LF0A 2DH6A 4KUGA 4GXQA 4AJEA 1TLLA 4GVXA 4MJ7A 4Z51A 4YO8A 1E3JA 1XBTA 3B89A 5FD8A 1QB8A 4ZCSA 2G88A 1VE6A 3OA2A 4JQSA 3CNQS 3KEOA 2Z6UA 2C5FA 4QRHA 1XPOA 3BS7A 4NECA 1WQ4A 4KQIA 4AN1A 1YZ6A 2VAPA 4R9SA 1Z8DA 1VDZA 1HQCA 3D2BA 4M0FA 1S10A 2HA5A 1LQUA 4ZYTA 1YS6A 1P80A 3FPEA 4EW6A 2EIXA 4KFCA 2O5CA 3ZBQA 4H1VA 4LNAA 4E14A 4LHVA 1O4VA 3O92A 16PKA 1SKAA 3OF5A 2GM5A 5IPFA 3S7TA 2J5XA 3H97A 1OFTA 2M6KA 1J2MA 3TECE 1W5EA 4FMCB 4NDAA 2OB2A 2PI5A 1QQ5A 4IDEA 1JQAA 4RL4A 5BRNA 1YR8A 1U5CA 2Q4EA 4IXNA 2A1UA 1JEOA 4KWTA 4E2WA 3GMIA 3TH5A 4MPRA 4QKQA 2YMLA 1RJ9A 2UZIR 1OGYA 4URXR 3LX4A 4YDQA 3JPOA 4IDPA 1JXAA 4S0XA 1JU4A 4DN6A 5B1SA 1ZNQO 2EJTA 1W76A 3GILA 3H86A 4AAYA 4EPVA 2NAPA 2IZ6A 1QH1A 3G1UA 1QF9A 4BKOA 3KQMA 2B36A 1VKNA 3CSUA 2IDJA 1TCCA 2R6HA 3C1ZA 1F3OA 1D8LA 3KQNA 3AESB 1H4QA 4EYIB 3QBJA 4RKYA 3AF3A 4MUAA 4KN4A 4ZH4A 1TAQA 3HYNA 3LUGA 1S02A 3HY6A 4A92A 1ORVA 3I6YA 1R0BA 1ZSYA 4JV2A 5LB2A 4ZV4A 3UT0A 2YNMA 2GFQA 1CS0B 4I99A 2CBXA 5KNCH 5CDYA 1Q46A 1DZIA 2QYTA 5JDIC 2BCVA 4H7PA 5HKKD 1ZNYA 3QKSA 3OCJA 5FBRB 1H2ZA 1QHSA 3QMMA 4IIGA 1U3TA 1X2IA 3K9QO 5IT9A 4IDFA 5ICSA 3H65A 4QLAA 2B8JA 4BKPA 3LRPA 3L0CA 5KTRA 2F1JA 3PNBA 4I0WB 1JVBA 5K2OA 3ZD8A 1U81A 4ZXPA 5ALIA 4M60A 5B3JC 1Y5NA 4OQNA 1Q1EA 2D74A 4EG6A 2DKZA 1P9RA 4COOA 3NUQA 2QB1A 1XNHA 4DPLA 5LOVB 1OZFA 1EVYA 3DE5X 1EE9A 4E0DA 1RYDA 2JLVA 2HF9A 3LF2A 3EZYA 2CLKB 3AJRA 2PMKA 2CFIA 3PUKA 1U0TA 1KTIA 5DIZA 4RSRA 4LVNA 3DH0A 1T10A 3LX6A 2R8PA 1T5BA 1W9MA 4UUBA 4LSMA 5JPDA 4TURA 4GEKA 5DYGA 2FR8C 3EPGA 4F4YA 2B21A 5IZCA 4HZIA 5LIRA 2BDUA 5LU8A 4QGAA 1I14A 2HIMA 4LDJA 4MS1B 1JHVA 3V1TC 1TD1A 4C7BA 3O5AA 4AJ2A 4PHGA 2NSYA 1Q0PA 5K99A 5HQTA 1Y6FA 3CX8A 1FJXA 4PBRA 4RTQA 1E3WB 1MG0A 4KTVE 3CRVA 4LQDA 2VA3A 3EEBA 1NIJA 4PWYA 4M0MA 4ZWNA 1SC1A 3CISA 1KYTA 2VSFA 2IHJA 2A1TR 4RXMA 4IFEA 4L28A 4PXAA 2ID4A 3ZCXA 3G79A 5D3QA 1MB4A 3MJTA 1UKEA 4N8EA 1P9NA 2WAOA 1JUDA 4ZZ1A 4TL8A 3URKA 1GNTA 3F5MA 1RQXA 2OKCA 1XQXA 1W1WA 3IR6A 2VRNA 3PLRA 2OAEA 2O6KA 4OMFG 1L7AA 3GCZA 1KZHA 1Q16A 5AVQA 1M2FA 2UVPB 1KAMA 5K3BA 1F12A 3EXEA 5J0TA 2VH1A 4MB0A 5K05A 4EPXA 5IRCD 8ICKA 6NULA 2YIDA 3GLGE 1EFDN 4HS9A 3HJFA 3ANXA 4CLEA 4HNSA 5J2BA 5AKEA 5HR7A 4IIEA 5EE3A 3LX8A 1NZPA 4DMLA 1MHPA 2F3PA 5DP1A 2FUCA 3BHNA 1L7RA 4Q43A 3HP6A 2UZ1A 2EKDA 3KKPA 5F3RA 1WW2A 4FKBA 2PD3A 2VQ6A 4J9LA 5KUTA 3QZ7A 2HD4A 5GPBA 1XPJA 1JV2B 4PEVA 2PK3A 2N1BA 4I14A 3HKBB 5B53A 3TZHA 1QGYA 3HPRA 3K4PA 1YK1A 2WILA 3FHJA 5BOVA 2VA9A 5J59A 3RD5A 4FGLA 1PGPA 1HFJA 3BL8A 2FSPA 4F5RA 4INPA 1ZIXA 2ESRA 3DUFB 1G6HA 4KGDA 1CF9A 5JCOA 4IO1A 4L76A 2OVBA 4KLAA 1N5JA 721PA 5J4VA 1MQ2A 5L3VA 3C7TA 4G2NA 3MJFA 2IE0A 3T5DA 1LWOA 4MP8A 3B1XA 3GJSA 2DF4B 5I01A 3L49A 4MMZB 4K2AA 3CSSA 2Q7DA 4NMMA 1GILA 5F35A 2Q0HA 1JA1A 1Y63A 4KVFA 4D81A 4MLDA 1JHRA 3LDAA 2D5CA 3OD1A 5DX8A 5K3DA 3HKDA 3CURA 1J25A 3U7GA 1T15A 3WB9A 3ORSA 4KLFA 4UPEA 3PC2A 2JGDA 2WLSA 3IPYA 4EG1A 3PC8A 2VP5A 4FEAA 5BT8A 4GH5A 5BURA 1RG6A 4FOOA 1VBFA 4MEXA 4JJFA 3I01M 2VPQA 4TS9A 3RYIB 1GOTA 3RH6A 3T15A 4C7VA 1O94C 4WLFA 3OM1A 4R0VA 1JHXA 2FMXA 5EE0A 4TLMB 2ORIA 1NJ2A 1TQ6A 2G08A 3ZLBA 2HMAA 4EUSA 2C78A 4ZVOA 2GCEA 3MJVA 4M9CA 1UMCB 4HVLA 3F8SA 5B36A 4OQLA 2ZZNA 1OWNA 4DM7A 2R86A 3QWBA 4MYRA 3MDAA 1UKVY 5BOSA 3RIEA 1NMZA 1RYYA 2FFBA 2WLTA 1ZUWA 3K0BA 4TQUS 4D6PA 4YAKA 3R7WB 4V0LA 1Y1PA 1E2GA 1KMNA 2AQHA 4N0PA 3EXIA 1N2GA 1EDDA 3RJFA 2G71A 1GFWA 3P19A 4P33A 3W2EA 2OK8A 1NKTA 2Z3WA 1MH9A 4MMYB 1JHYA 2XITA 3ZWNA 2HWXA 1HRKA 5CB6A 3JXEA 2E8PA 5EY5B 2NVUA 3NCTA 3D7SA 2H2FA 1C14A 3G88A 4I5GA 1SUPA 2HX1A 4CCYB 3T3DA 4PO1A 1DB3A 1FRQA 4XQ9A 5LMZA 1QHHA 3BHMA 1VL8A 1OXKB 3SC3A 5GJWC 3WWZA 1I2DA 2RGDA 1QF7A 4C4XA 1HFEL 2FX5A 2EG5A 2VT7A 4EI8A 3I5UA 4JA2A 2XECA 1ATZA 2B3DA 8ICPA 4BWGA 3IB6A 1GGFA 3EGXB 2EU8A 1AGXA 2BGNA 2HTFA 1BWSA 2DKOA 2YJZA 2VNAA 4E5VA 3OLZA 1YCFA 2AOTA 3K9CA 4I3GA 4C2UA 1ZSNA 3QK7A 4XPZA 4BVLA 1RVDA 2CXOA 2PZBA 3I5AA 3U3JA 2WJ4A 1JSZA 3R5HA 4OHVA 2V6BA 3OU2A 4UE2A 1O03A 1Q6ZA 1G41A 3EW9A 4BLPA 2JH9A 1QRSA 2PG3A 4PAOA 3H1AA 3E3OA 2A78A 2IYXA 3WMXA 3GZFA 1DI0A 1URJA 3PR5B 3AY3A 2YN2A 4KK3A 4CEHA 1Q1GA 4E08A 3A6KA 1M2JA 2R1UA 2E9SA 4ALIA 1XXHE 4PC3A 3FH0A 3FTFA 2NU8A 2VPXA 3OJCA 2PRKA 5FTKA 4KYIB 4KVZA 1O87A 4YROA 5F7JA 1PKEA 5KFZA 4JP1A 1SC9A 5K0TA 2F64A 1LDYA 2ZROA 2AOUB 1A9SA 2XUFA 3VR6H 4ARZB 1D7AA 1OMOA 1A97A 1Z17A 4TV8B 4KODA 2PN1A 1II8B 3CF2A 1W87A 1Z2DA 1XYGA 3Q0EA 1FQKA 1G20B 4N6OA 5DM0A 2XGSA 3T7KA 4JBGA 1QQTA 4FLMA 1KEUA 1O9BA 4RKWA 2ZGVA 3WB2A 2Q5OA 3WQSB 1W0CA 4DBLC 3E5RA 1GPLA 3B53X 3N2LA 3E0FA 4FCVA 3P94A 3TIVA 3TJZA 5ELXA 4LOKA 3S5UA 1LV7A 4JI1B 4Q4CA 3KHTA 3X0DA 3EUEA 5CDFA 2C82A 1YUNA 1FYXA 1UJ6A 1E8MA 3QEOA 2XJ9A 3FF1A 5HCNA 1INLA 2O3TA 2RGNC 3HYCA 3R9WA 1KZGB 2VT2A 5C3UA 2FMPA 4I2AA 4MWTA 1U8UA 1U9LA 3QIVA 5DI3A 2NO4A 4LMAA 1ZG3A 3EWNA 2F62A 2GN6A 4MVJH 2DQZA 2Y6VA 2HSGA 4BLQA 3ELDA 3OQIB 1Z4KA 4YMLA 3UA3A 1NF8A 3DJYA 2R44A 1OVMA 3AJDA 3RC7A 2ZBUA 5K0SA 2PUGA 3C7AA 2HQBA 2AUTA 5FLEX 4MVJF 3I2HA 2O1XA 4QJ4A 7ICIA 1SU6A 4EHNA 1H93A 1OHHA 2B8NA 2OWDA 3V2GA 1J07A 1E9AA 4I36A 4NLBA 5KSZA 2P6RA 3NJ4A 4PG7A 9ICCA 1CUHA 3RYHA 4MARA 4HWGA 3GA0A 4BFSA 1JVNA 3HSSA 5TQ0B 3BGOS 1H2XA 3FTPA 1PQ4A 1PEAA 1MAWA 5F1KA 3A27A 2EFDB 2QVXX 1DVRA 2IZOA 2WWGA 5IWCA 3QA9A 3DZFA 4JLBA 5KVQA 3WFJA 3UICA 3A7DA 3HA2A 1F8FA 3MJ4A 5BV1A 4EABA 1H8EA 4EVSA 1KFKB 3NNNA 3PX7A 4DV6B 3OFKA 3EXHB 3DBVO 2QE7A 4P3YA 3V7WA 5FOTA 4NE9A 3SJ7A 1NW6A 2FW8A 1KJNA 3L8EA 3I39X 2E3JA 3QXXA 2F8TA 2PO5A 4M37A 1U7OA 1B4FA 3KC2A 4MKZA 3C24A 3K53A 3R09A 4GMKA 1K7YA 3COWA 1C7ZA 2QT0A 2FEAA 5EXXA 2H11A 1QH8B 5DM4A 5EZSA 3A6EA 4PO3X 3RODA 1PZHA 3LCRA 1AJEA 1L3UA 1Z2OX 3UWMA 1DGJA 4W1QA 4JMPA 3MC1A 1G66A 4J1TA 5E1MA 1ETUA 4ZQCB 5GONF 1XLUA 1E4EA 9GPBA 3PSHA 3NDRA 3HHEA 5J2TA 3UWPA 1A4IA 1WPRA 1GHTA 4GBMA 2X2EA 1TZMA 4DO9A 4YMNA 3KHUA 3A1WA 1UK9A 4ONEA 1SVWA 2NN3C 1X7YA 3HN2A 3FPAA 2QN3A 2NO6A 2RH5A 3DV2A 2AC2A 4XWWA 1ZEJA 4Y1EA 2HJWA 5HHIA 2YXDA 2PFPA 1SXJA 2AW3A 3NHJA 3BQ7A 3UPQA 2SNIE 3TL6A 3L3BA 4E11A 4P4SA 1I9GA 5IYZA 2DULA 3UJ6A 3KTDA 3U62A 4M1ZA 3GRRA 5IAKA 1JB9A 4DV0B 1Z2PX 4TVBA 2WT9A 4XTCS 3GAZA 3VPDA 1PR9A 1ZXBA 3OQBA 3CZMA 4FFBB 1S5PA 3BRWA 3EIOA 8ICUA 5JXJA 2X0EA 1O89A 3RJKA 3VFDA 3TKLA 2AKEA 4HQOA 3N39C 5T6BA 3OJLA 1EP3B 3WLLA 1E9RA 3SJUA 3ZWWA 3U4DA 3FNGA 4NU5A 1AXRA 5CR9A 1SG9A 3ICPA 2EZ9A 2C0PA 2H4FA 1ZZGA 1Z18A 2QT9A 4GR9A 2E4XA 3A06A 3DZ8A 4XSGA 2IEBA 3GVHA 3KJIA 1UT8A 1WUKS 1WVIA 1KY5A 3PPVA 2ZJBA 4A8HA 3RV3A 4YRAA 2OECA 5B3LA 4MIEA 5LWHA 3RAPR 3IJPA 3FOBA 4RVHA 1ESZA 4JK3A 4TWBA 2I8AA 4M1MA 2R48A 1T3GA 2EQAA 2B98A 2O0HA 4X8HA 2BUAA 2JJ1A 3NTUA 1Z56C 2IGBA 3TUIC 1Z68A 5KINB 2IX3A 3LNCA 1M1YA 3L0DA 3HLTA 1WUYA 3NJ8A 2YHUA 3OZXA 1MABB 1EFPB 4NYIR 4I4TB 4YBZA 3V4LA 5BNZA 2VPTA 5AYVA 1B8NA 3HKCA 4B2YA 3E1GA 2V9CA 5A0TA 2PA3A 1JNYA 3EY9A 2AR9A 1A4RA 4J9VA 2E5WA 1DX9A 3RRNA 3B6EA 4OFBA 1D7OA 4HDMA 3DZCA 4ZHQB 1J5EB 1BDHA 1ESDA 1T8WA 1XZAA 4S1WA 5HRUA 3STHA 2HADA 3HU3A 1JI3A 2O7VA 3Q3VA 3W5VA 5DDMA 4A16A 2POCA 4G1MB 2BTOA 2L5YA 2YQ5A 5G4KB 1DQZA 3RS2A 3CNEA 4CM1A 4B0PA 1MV8A 1KOGA 1XCGB 3N59A 4BVHA 1YS1X 2VIXA 2H0AA 1RXUA 1WCLA 5IT5A 3M6MD 4W8GA 2FLLA 2BJVA 4D0SA 1RI5A 3E5MA 1UJMA 5FTWA 2C9OA 2EJVA 5EIBD 5H3HA 4GSKA 5B2ZA 3ZKWB 5A05A 1I33A 5TEVA 4KE8A 4QNLA 1LDNA 2O1WA 4RU1A 3C8MA 3M83A 6GPBA 2VHXA 1R6TA 5LJLA 2VDJA 1D3AA 2FW1A 5ALTA 3QYAA 4ER0A 4NLLA 2Q5QA 1HNZB 3PP8A 4OATA 5GINE 4QDXA 4G5FA 1TNDA 2XRZA 4NX2A 1S2MA 2XCRB 4LJAA 4FC6A 1AA9A 4FNOA 1XYYA 4MI6A 4CN9A 4PRYA 5CM2Z 2C77A 2V8BA 5CA7A 1CUAA 1RRMA 3PX0A 5A0LA 1DO2A 1CETA 5D5HA 3GZNB 4FWIB 4TT3A 2NYRA 4FWTA 2VP9A 4FDAA 5KNBH 4ZI2A 2OQ2A 2UZ3A 2BONA 3DFUA 1IM5A 2PKYX 5A71A 1H2AS 2BI4A 7ICTA 3DS8A 2QVCA 2KTQA 2O6LA 4BKQA 1VPWA 1DXSA 2HB6A 1WKBA 3PDIA 1XZGA 3Q3IA 1NQ5A 1S7GA 2Q2OA 1JQLB 3RLFA 3OQ6A 4JC8A 3TQIA 4LSZA 4WE3A 1M10A 2FX2A 3RARA 1XAIA 1G8GA 5KI6A 1KFTA 4AY4A 4X3OA 2OY0A 3R75A 3CPHA 4RGQA 4BKMA 3FIUA 5CLHA 3NPAA 2R1VA 2QTCA 3OFNA 5FAXA 2D8MA 2OEPA 3PX4A 3QLUA 1W73A 1G21E 4DCCA 2H4ZA 4FMCF 4MV8A 4QSHA 4IFTA 4K88A 3PWTA 3OEYA 2Z43A 4ENPA 3N2NA 3T6KA 1W85B 2E4YA 2XQJA 4DEZA 3QVVA 2AWNA 5IMSA 3OHAA 1JR4A 4WDRA 3BWYA 3PXUA 3I52A 4OQ4A 3AMZA 2P9CA 2K7ZA 2PJRA 4OOFA 3KTFA 4H6PA 5CLFA 1UBFA 1M1UA 1CJBA 4ROTA 1HE2A 2GKGA 1Z2NX 1EP2B 2H92A 2G04A 3FMOB 4N12A 4Y0VA 3OVMA 4B33A 3G8CA 5JAHA 3QLTA 1IUOA 1UC4B 3ZWVA 4BMOB 3QOWA 4ALJA 2I7CA 2BCGY 5E6UA 4NNPA 5A5GA 3ZDZB 4BJ1A 2W2LD 4L73A 4O3RA 3QU5A 1JEAA 1XWWA 4TMTA 1EGHA 3KWJA 5DBEX 5FL7A 2BPCA 5CJPA 1WTCA 3WNQA 4Q3NA 2QSUA 4DFPA 3B3FA 4ECWA 2HQSA 4Y1RA 2R3SA 5M29A 2MIIA 3AEKB 3ONNA 4G86A 4LYJA 1ISJA 3PGXA 4YCAA 1IJEA 3EZ7A 1V26A 1Q21A 1GRNA 1JR6A 3FPGA 4KX5A 2NTVA 3TADA 3QYJA 2JIQA 3ESBA 4HGYA 3CHYA 2H2DA 3P2IA 4MPDA 5JPIA 3GF4A 1PNRA 5KT4A 1GRQA 3HPOA 5DGTA 5T8KA 4R1LA 3UG7A 4Q1VA 4FZJA 5KCZA 3BSSA 2QMQA 5LP6A 2BQRA 2WW8A 1KP2A