2WF5A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and trifluoromagnesate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf5A01
1ZRNA 4Y2PA 3L0BA 1Z4MA 5ALMA 3WK7A 2PQ0A 4UM5A 5E0OA 1RQLA 5AW8A 5IT4A 5AVVA 3W5AA 1ZD3A 3WK5A 3L8GA 5A3SA 5AW4A 5AKEA 4UMEA 2ZBEA 1WZCA 2RAVA 2G0AA 3N28A 3HLTA 2G08A 3NIWA 3PDWA 1N9KA 2GMWA 4Y2XA 5AKLA 3MPOA 1J97A 5AI9A 1Q92A 2YJ5A 3P96A 1LVHA 4KYTA 4Y2QA 4UASA 4YGYA 1FEZA 3FM9A 1RLMA 3I28A 4CF3A 2W43A 4B6JA 2HF7A 1J8DA 3L0YA 2G09A 4UARA 5ALHA 1RKUA 3QUCA 1RDFA 3PCTA 1QYIA 2IYEA 3QU5A 4E88A 2I6XA 1CQZA 3EF0A 2WF6A 2HX1A 3ZTWA 2P27A 1TJ3A 4CNQA 3I1YA 4BEWA 3AR2A 3N07A 2C4NA 2CFTA 3WGVA 1NF2A 3WKDA 2BDUA 1RMTA 4BYGA 2B82A 3B9BA 4UMDA 1SWVA 4JB3A 3VAYA 5AVQA 3RF6A 3FPBA 3AR5A 5AM1A 4AS2A 2R8XA 2AUTA 3U26A 4HYTA 3IRUA 3U7EB 3KBBA 1RKQA 3ZU6A 5AI0A 5AKYA 4DFDA 4JDPA 2GO7A 1CR6A 5AICA 2DQSA 3CNHA 1XVIA 4QQFA 1LTQA 3U13A 2JAWA 1U7PA 3A1EA 4DW8A 5AM4A 3KD3A 1Z4LA 2O9JA 2JAOA 4HGPA 4C4TA 3SLRA 2ZOSA 5AVTA 1VJ5A 1YNSA 1XP5A 3SHQA 4YCLA 1QQ7A 3KC2A 3ZVNA 5AW2A 3A1CA 3W5BA 3ZWKA 2R8YA 1SWWA 2NYVA 3IB6A 4NAVA 3L8EA 3UMBA 2P11A 3HYCA 4L6AA 4KX3A 5IT0A 5ALJA 3MC1A 2AH5A 4Y2JA 2YJ4A 1RLOA 4ZEXA 5AHXA 1T5TA 3N5KA 4MUMA 4C4SA 1XPJA 5AKIA 2Q4RA 2B0CA 2YBDA 4FE3A 4EENA 2MU1A 3A3YA 3S6JA 1ZJJA 3U7GA 1TJ4A 2AGVA 2RARA 4BX3A 2P9JA 2X4DA 3OCZA 5AM0A 2B8JA 3SKXA 4L6CA 5AIAA 2WF5A 1EK2A 3R9KA 4F71A 2FPWA 2YMQA 3ZW7A 3FVVA 5ALYA 3A1DA 4CE6A 5A3RA 5AVRA 5JJBA 2CN1A 1TJ5A 4KNWA 3NASA 2C8KA 2PR7A 5AKKA 2YJ6A 2NO5A 2ZG6A 4YH1A 1RMQA 2FDRA 2YFYA 5AKXA 4FYPA 1WR8A 2OYCA 5AKZA 4I9GA 1NNLA 2HF2A 4PNHA 3I76A 1YDFA 4Y2TA 2FUCA 5AVWA 4IFTA 5ALSA 3OTQA 4EELA 1L7MA 3WKBA 3BWVA 3QU7A 1U2SA 5ALWA 2Q5EA 3WKEA 2IA5A 4DWOA 3QUTA 3M1YA 3CZ4A 1ZOLA 4C4RA 2BDEA 3L1UA 4F72A 2RB5A 3DDHA 4G63A 4YIHA 5AW6A 3OCUA 2RBKA 4QJBA 3K1ZA 3GYGA 3UM9A 1RKVA 2I54A 2HCFA 4BBJA 3ZI4A 1L7NA 3WK9A 1WPGA 2IOHA 1Z4OA 4NABA 2MSNA 2IOFA 3AR7A 3WK8A 2C8LA 2BY4A 5ALFA 2ODAA 2ZBFA 4HGOA 5AVZA 5AI4A 3ONNA 5AIBA 5ALRA 3UMGA 2G06A 4FFDA 1O08A 4UAVA 3SD7A 4XQ0A 3QYPA 3ET5A 3PGLA 5ALEA 1ZD4A 2QLTA 4HGQA 2FEAA 1Z4NA 3M9LA 5AVSA 3KOOA 2IOFK 2HSZA 1L8OA 1WVIA 3NALA 5ALZA 2EARA 1ZRMA 2GHTA 5A3QA 2WF8A 2HOQA 5ALUA 1K1EA 1U2TA 4Y2RA 1N8NA 3NRJA 5AKGA 3AR4A 3OCVA 3QUQA 2I7DA 4OFZA 1VFPA 3D6JA 2R8EA 1RC8A 4NFLA 1QQ5A 3DNPA 3ZWDA 2I33A 3F9RA 4YIKA 3WGUA 2B1QA 2YMMA 1QH9A 3DV9A 4CF5A 4IG4A 3WK4A 4YCNA 1RRCA 4HGRA 5FP0A 3NAMA 1RMYA 3L8HA 5IS2A 2QYHA 1L7PA 1L7OA 4KX5A 2ZBGA 3DAOA 2OM6A 1L6RA 3IJ5A 2WFAA 2EATA 1Y8AA 5AW1A 3I6BA 4HAIA 5AI8A 5ALQA 3W5CA 1U02A 5ALGA 2O2XA 4BNDA 2CFSA 2HHLA 2B30A 4UU1A 3WK6A 2FPSA 3ED5A 2CFRA 4HGNA 4EZEA 2YMPA 5AK6A 3EPRA 5ALKA 1AQ6A 4UATA 2FPRA 3ESRA 4Y2VA 4RETA 2G80A 1TE2A 3B8EA 3ET4A 2GFHA 3ZTYA 1Z5UA 5AVYA 3QXGA 2OA0A 3EWIA 4MWOA 4J2TA 4UM7A 1O03A 2FUEA 1F5SA 1Z5GA 3EF1A 5AW7A 2PKEA 2C88A 3ZVMA 2YY6A 3RFUA 1U7OA 1Z4JA 2R8ZA 3N1UA 2W11A 3WKAA 3WKCA 4BX2A 5AVXA 1Z4QA 5ALVA 4OCZA 2Q4TA 3E8MA 1IWOA 4GIBA 4UW9A 4Y2UA 2G07A 4AP9A 3E84A 2JGAA 5AI6A 1T5SA 3R4CA 5AKHA 2ZBDA 5AESA 4H1WA 5AM3A 3ZX5A 4BNDB 4G9BA 4UAUA 3QU9A 2B1RA 3AR6A 4ZEWA 4GXTA 1NRWA 4EX7A 3AR8A 4CF4A 3QU4A 5AM5A 5ALIA 3KDPA 4XE5A 4DCCA 3B9RA 3U7FB 1Z4KA 5ALOA 1Z4PX 1L8LA 3SMVA 4I9FA 4KNVA 3L7YA 4UMFA 4KN8A 3ZUPA 5AW0A 2YN4A 4OD0A 1RLTA 4O8CA 2OBBA 2EAUA 5T41A 2HDOA 2VKQA 2WM8A 4Y2YA 5AK5A 2JARA 3BA6A 3SKYA 1ZD5A 1X42A 3KZXA 2WHEA 1YS9A 3AR3A 1ZS9A 5AI5A 1MH9A 2I55A 3ZX4A 2YMLA 3E81A 4NV0A 3L1VA 2YJ3A 1QQ6A 3ESQA 2WF7A 2FI1A 3MN1A 3FGOA 2MU2A 4EX6A 3L8FA 4BKMA 2FPUA 3OCWA 2B8EA 4XOUA 1TA0A 1KYTA 3FPSA 4UU0A 5ALLA 4EEKA 3OCXA 2AMYA 1VJRA 2ZXEA 3AR9A 1PW5A 3QLEA 4OHFA 4RESA 3MMZA 3QX7A 2JAUA 2I34A 3W5DA 4NWIA 3SF0A 5ALDA 4AS3A 3NUQA 1RQNA 2D2VA 1ZD2P 4YCMA 3U7HB 3J7TA 2G1AA 3FZQA 3OCYA 4XPZA 1RPZA 3QGMA 4BX0A 1EK1A 1Q91A 1T9ZA 1YV9A 1Z88A 5ALXA 1YMQA 5ALNA 2HEGA 3L0CA 3R09A 1JUDA 2HI0A 1YJ5A 3TLMA 4BEVA 1Z4IA 3L5KA 3QU2A 3NANA 3N8GA 3QUBA 3E58A 4UMVA 3U19A 1S2OA 1S8OA 4Y3UA 4ZEVA 5AW9A 5AK4A 5ALPA 1SU4A 5AVUA 2NO4A 5AW3A 3OPXA 2C9MA 3PGVA 2HO4A 2W4MA 5AW5A 2GHQA 4L57A 5AM2A 2P69A 3QNMA 3ZVLA 2WF9A 5ALTA 5AKJA 4Y2SA 3UMCA 5AK3A 2FPXA 4J03A
chains in the Genus database with same CATH superfamily
3RF7A 1NLFA 4B85A 1HDYA 5AVVA 5ER6A 2HHXA 3S2FA 3HPQA 3GEBA 9ICCA 1Z74A 3WO0A 3V7KA 2HHWA 3WWYA 1NVTA 3AJRA 1AS3A 2JD0A 2VTEA 5GGYA 2WSMA 3K4QA 4A2CA 1ODSA 3D4IA 3DONA 2QW0X 5H81A 3SU8A 4RTPA 1M6VA 4QLBA 3QG5A 1RVV1 5KFQA 4OJ5A 2L17A 5G5GA 4DDMA 1N61A 2OCEA 1NF2A 2P9TA 5B5SA 4XD7D 2M6LA 4TRNA 2AE1A 3JYPA 1R9GA 2HH9A 3LGXA 3M6AA 1ED1A 3SYKA 3NIGB 3KZMA 3OE7A 3G82C 1RHKA 1Z16A 4OATA 4UNNA 1JXOA 2PMWB 4W8GA 4ACAA 1Q20A 1GL7A 1ENOA 4MUMA 3CLUD 1GPMA 3NAZA 2ISPA 2NVUB 2LDBA 3ZV5A 1KIMA 2ORVA 1JPNA 1E1LA 5KC9A 1KY2A 2P2CA 2PQ2A 4HD8A 3WL5A 4F71A 1P4GA 1R7RA 1ECBA 2X15A 3HMKA 3UCXA 4YMUA 5L7TA 4TKMA 1KAQA 4R7TA 2ZCUA 4C9BA 4C0XA 1SXJB 5IABA 2I66A 3N0XA 2H1WA 4KOAA 2DUWA 2I6GA 3I8SA 4BGEA 4IUYA 2AXPA 2X4IA 2AR9A 2FW7A 4RVNA 5F2OA 1HYHA 2WA2A 3OZSA 1U2SA 4RAQA 3IJEB 3GRPA 1P2TA 2CPRA 3F4LA 1FLDA 1M34B 3A6KA 4NMMA 2BDEA 5BSEA 4JBNA 4IIBA 3DAGA 3HI4A 4YRMA 4FYMA 2GZ2A 1IQPA 1AUPA 3EFOA 3AEQB 1T1GA 3AW9A 3SKVA 2ODAA 2Q46A 3KLNA 5BT8A 3UK7A 4IGKA 4D9KA 1P0IA 4RMJA 3PHGA 4ZN6A 2OHVA 3QE4A 2J5XA 1Q0SA 3NNNA 1E0KA 4KYUA 2C9BA 1PJQA 4KR0A 5KNBD 3DVAB 5CVJA 2WPDA 5JZSA 1LPMA 1RM5A 3OC6A 3K35A 4R1MA 1LNSA 2Q07A 1JQAA 5F7ZA 4TYPA 2B5OA 1XQ1A 4GBMA 5DBHX 1Z13A 3R7BA 2B9EA 2W9BB 4RSMA 3EQZA 4E07A 1LJ8A 1L6RA 4KN5A 3WWEA 3IEXA 3CMMA 2O3JA 1I1OA 2XD4A 4P3XA 4CMEC 5HW0A 4INZA 4Q37A 5GONB 4I2AA 1QK4A 3GLIA 4ZCLA 4OHKA 2BFFA 5K9ZA 2RBGA 4KRYA 5IH7A 1QGED 3MFIA 3K0HA 1NLZA 1CR2A 2BGTA 4KN4A 1GKLA 1KH2A 2XDAA 3TVTA 4FUTA 4YMGA 2VF5X 4ZEWA 2OGUA 3ZDYB 3WZMA 2IFTA 3AO0B 3EMKA 1JDPA 5F5LA 3KEMA 4FHDA 3ZWOA 4O0IA 1VL1A 2DUYA 4JR2A 1XXHE 4F2SA 1YJAA 1THTA 1QVVA 4UXIA 1CI4A 2PX5A 5CGQB 2MA1A 4B3GA 2I2FA 1UMCB 3OMWA 3OA0A 3GPBA 4PSDA 5U1PA 2XECA 2Q3MA 3HY6A 5EXXA 3SFZA 1Q2UA 1N6NA 3LRPA 2BEUA 1YIAA 2QGNA 4FS1A 2XB2A 5JBNA 1ZQ1A 4UB2A 4KQCA 1NJSA 2JLCA 3IAM6 2N9UA 4YCMA 2D2EA 3OQBA 4OQ4A 5IXJA 1VLVA 1J99A 3E70C 4BQNA 1P9NA 4O3PA 3DUFB 2WZDA 3QIVA 3CVJA 5KVSA 1ZQYA 2VI5A 2ZBVA 5EWJA 1N5KA 2ZYWX 1NG9A 1JLMA 2NVWA 4FYKA 4UUOA 3UMCA 3LZ6A 4Y7CA 3RH0A 4QASA 4IHJF 3U1BA 1ZMXA 3AQ4A 5KQRA 3L7JA 2J30A 4U7JA 4DLBA 1C0KA 1IXRC 3K4PA 5JD4A 2D0PB 1YB2A 2QN3A 1JLLB 1J97A 4QECA 2QQFA 1U7WA 2PLNA 4FFNA 1YL6A 3T7AA 3LBFA 5DQIA 2Q28A 4PV7A 1YE5A 1W8DA 3NVYA 3HA3A 3HCDA 4EG4A 2G9RA 3H5AA 5CDGA 4WBNF 3EUB2 5AHKA 4J7XA 1DC7A 2JZBB 3SIPA 4PINA 4RPGA 1N0VC 1U45A 3Q98A 2WB4A 3G0BA 3ZE8A 3K9GA 3KKZA 5CDTA 2AD1A 4QIWF 2BM1A 4A5OA 1K75A 4DLSA 5LM3A 4GI5A 5DG7A 4Q24A 2BFEB 5KTOA 3NEPX 8ICCA 4BJ3A 2YX1A 4XJVA 3TLBA 4O2AF 3L0DA 4DZTA 3EDQA 1P3Y1 1ZGGA 1XDBA 2JEZA 1GLGA 4I4CA 4ESOA 1CDZA 2BKLA 3ADPA 3BE6A 5DGTA 3ROZA 4D43A 3QHPA 2VT7A 4FONA 3URMA 3S6JA 3DDWA 5BMVA 1UPAA 2F3UA 1M1NB 3FUVA 2JIPA 2GT1A 1OB5A 2KHQA 3GVCA 1NPDA 3B9PA 3NDIA 2VDQB 2JJ1D 2M98A 2DGDA 2DF8A 5B1DA 3I2IA 1CPYA 4JXKA 4X90A 5A3JA 2YWHA 3VKFA 4ZO6A 3VR1A 4COKA 3DVAA 2FR8C 1HM5A 3L1UA 5KFVA 3H13A 4NBNA 3RE1A 3MF4A 3QA9A 3NHAA 4EPTA 5KNDH 2C2MA 2CHVA 1B8UA 2WHPB 2NOAA 3O91A 4ECZA 1TL7C 1ZN7A 2EQ5A 3QKRB 4I1SA 1ZOPA 5I9BA 3LMKA 5E2IA 1A5BB 1VQ1A 1L6IA 2QZZA 5GONA 5CDSA 3RWOA 4F4DA 4JR0A 5AP9A 3LXXA 5CH3A 1BA2A 2O8DB 4ZAGA 4M46A 2R00A 4R2XA 1ZQHA 2G71A 1OXBB 2XE7A 3KJEA 2VEOA 4XSVA 2DL0A 4HQ0A 1WMFA 3QBTA 1PUIA 3ETJA 5JQGF 1GGVA 4ER6A 4L22A 2EVWX 5KFOA 2BZ1A 3TLYA 3HXTA 2XCOA 4IDOA 4BYMA 2WBLC 2H4XA 2GBGA 1SZCA 2CNDA 4GIBA 1RI1A 1OWLA 2CHQA 3HS3A 4A73A 3IMGA 5AKHA 2C97A 2ZBPA 4RULA 3K1AA 2B1RA 4C88A 4FFBB 3JR3A 4TTSA 3QU4A 3QVOA 1AURA 1ZQSA 4E5SA 2BW0A 3G6WA 4ZVNA 1XALA 1HJPA 3ZK7A 3C6KA 2VKQA 3G23A 2ZGVA 2F9FA 1XU4A 2R2AA 3AQEA 1ZS9A 1RXCA 3PNQA 4ZDIA 3L1VA 3GMIA 3DUFA 1ML3A 3N2ZB 3L49A 2RAPA 4I50B 2GAOA 4MSUA 2ZPUA 4ENUA 4JV2A 2HA4A 3W6ZA 2R2GA 1W29A 4PONA 1OE0A 5ALLA 4KACA 3B3QA 4JJ6A 1QVAA 3C7DB 1AF7A 1TMYA 3O75A 3F7TA 4ZHQA 2HHHB 2OCKA 1MQ2A 3PF8A 5J5CA 3ZGYA 1MGPA 4Z4GA 1QHNA 1S3SA 5IANA 2C5SA 5FNZA 2WMYA 3T5PA 2C00A 5T3UA 3DM9B 4XW2A 4QWMA 1L5ZA 1HL7A 5ECDA 3PW0A 1ECJA 2AXNA 3S70A 3HU3A 4L7QA 4XB1A 3TADA 3WMWA 2AN5A 2OGTA 2JZBA 3RGWS 3H4DA 1WZCA 1WWUA 1W1IA 3E2EA 3Q5GA 4LNUA 3KB2A 3WLOA 1TZBA 3VFDA 4A91A 3QPBA 1Z36A 1NV9A 3BJRA 3KB1A 2ZTVA 3WBKA 1GZ4A 4D1YA 5KT4A 4EUKA 3LFTA 4B48A 5CURA 2NP7A 3VOTA 3MHTA 1W85A 4FMCF 2ZJ1A 2PLAA 1VCOA 5HWSA 2A30A 5FLKA 3CW9A 1C3EA 1WXWA 3HXMA 4M0LA 3FROA 4W5HA 5AXAA 2VA9A 2FEWB 1M2FA 4L02A 2GHRA 3QYJA 1YBHA 4R1QA 3CR3C 3V6MA 3ADDA 5BV7A 1MRNA 1GZ6A 4HUJA 1ELOA 4MP3A 3VNAA 1NIJA 1USKA 2VR1A 3QPDA 4KBFA 3BB1A 2Z08A 1MDFA 3OZXA 2PT6A 3K8ZA 3TIXB 1RJ9A 1FTWA 4RYLA 2ZRKA 3H2ZA 1OAKA 2BH2A 4KO8A 3HP4A 4CV1A 4MJXA 4E4RA 4CU2A 3TI0A 1IHDA 2H1VA 2WHPA 3R0VA 4JLWA 4F86A 4EY4A 4BKOA 4OMCA 2C61A 2W2MA 2JR5A 3DJFA 2Y9TA 1A04A 2CF6A 4TZ6A 5BQ3A 3MELA 3BTVA 3LDHA 4HVCA 3OQVA 4MVJE 1XHLA 1HTBA 4WGGA 3JD2A 3VHLB 5JJLA 3OECA 1IVSA 4CKEB 4RV9A 1B14A 3OG9A 1P1IA 4YT2A 1BU8A 1J1UA 4ASUD 4R8RA 1SA0B 4AZ0B 1WLYA 4MWEA 1PWEA 5ELMA 4JU8A 2FEPA 2IEIA 5J0RA 3NALA 1LRLA 3EZGA 1JE1A 2V7QA 1E6KA 1R5BA 2FFRA 1KFKB 2WJZB 3AU2A 2V5UA 2A5LA 3NRJA 8OHMA 2XZDA 2YCBA 4ZCRA 1SVOA 1RC8A 4J0KA 5EJ7A 3IG8A 4P7KA 1CUCA 3CLUC 2J46A 4IS3A 1FDOA 2K8AA 3CLTD 4OG2A 1J70A 4G84A 4NI5A 1O0BA 3MFYA 4R84A 5CHEA 3ENWA 3IKTA 2K8BB 4OKIA 3HYTA 4KPFC 3VHRA 3DBIA 2ZRQA 3HKCA 3LWZA 2VHTA 1ESDA 1ZQIA 2BKUA 1U3CA 1E0JA 3A6PC 1OZHA 4JLAA 3GAFA 2Z0MA 2EBHX 4TQSA 4DF8A 5FYDA 4QODA 2O07A 1WP4A 1Y1SA 1AXRA 4BIIA 4I55F 4HDMB 4EW3A 3I01M 5HNKA 4MXDA 3DQZA 6PFKA 1NW5A 5JU6A 2W58A 3H4VA 3WRYA 1LC3A 2I91A 3SJ7A 4JBGA 4E6EA 4M9ZA 3T9FA 5IKPA 1FFUA 1A9TA 3VYSB 4DMUB 2CVHA 2N75A 1JIHA 4TZKA 4NXMB 3IT1A 3D31A 4QHTA 5CXQA 2NG1A 4ARUA 3PRHA 1NFFA 1NMYA 9ICHA 4URXR 1SPXA 2AMYA 4JOCA 3UCEA 3C6BA 3DXFA 4TRMA 1ORWA 3B89A 4IL6U 4H1TA 3U7HB 3WFJA 3LPNA 4ME6A 1RG6A 2MMGA 1M7BA 4B8YA 5IJXA 2PCLA 3A05A 1A5ZA 5J0PA 3FIJA 4M49A 3EFEA 1XWIA 4JLBA 4CG0A 2N1RA 1K6IA 3ELWA 3SQLA 4IDDA 2VYNA 1OZ0A 5K4LA 1WY5A 5JAZA 1QGDA 1ZONA 2YXBA 4ZTBA 4MQ4A 1BMFD 3LDAA 3KLPX 4HVTA 3LTEA 2QIPA 3GI1A 2GJ8A 1QMGA 2F8MA 1G20A 1RQGA 2CW5A 2K7FA 1JN0A 2NZVG 2OY0A 5ER9A 1I2MA 2X8JB 3JATB 3CINA 1BVHA 5L1LA 1THZA 2HYDA 5I8PA 2REQB 3ORYA 4DT1A 4HBGA 5KTYA 4GDFA 3CG0A 4WMLA 9LDBA 3SFVA 3F7OA 1I5RA 3CUYA 3FXAA 1E5TA 4CMHA 4UBMA 1VL5A 3UFBA 1XA4A 1M8GA 1Y5NA 3P9KA 1DC8A 4OYHA 5JWRA 1RZ3A 4DSUA 2XCQA 5DNUA 3LWNA 4BCDA 1CVLA 1PK8A 3C8MA 5D01A 3BVPA 2WWRA 1SV4A 4X1KA 4EECA 3QPVA 2J4FA 1YXMA 1HE2A 2P4UA 4NXZA 1FPQA 3SZ2A 2I9KA 3KYJB 2OKGA 1CUVA 1EI9A 4X5VA 2X23A 3BG5A 1HNZB 2ID4A 2XT9A 1QHHB 1LBHA 1QRUA 4JBHA 6AT1A 3T5TA 3QLJA 4AZ0A 1W2WB 2XEDA 3L84A 1RAFA 1WUYA 4UNRA 4PNHA 1DU4A 2CD9A 3DTVB 4K2AA 1CY7A 1EZ4A 4FB4A 4QELA 2O8CB 2NQ8A 4FC6A 2EWWA 4R51A 2DFKB 4J7CA 5CLIA 3E7FA 1DUVG 6Q21A 4G4IA 2WYHA 4MCHA 5AHRA 1GRCA 4DMHA 4QEKA 1FLVA 3LUPA 3LI2A 2JGMA 3UB3A 4UHFA 1UWCA 5PGMA 2QP9X 2J0VA 4O3SA 4F6LA 1TMGE 4X63A 5LCXA 2BUAA 2A4MA 3VR4H 5D2CA 1KEZA 1HDRA 3GEGA 3OIDA 2C96A 4F91B 1RZUA 3AR4A 2Z8YA 3TBHA 1XUOA 3MD0A 4LGVA 2DG2A 2YASA 4EB3A 3PR4A 1NFQA 3CZ5A 4Z6KA 4KL8S 5FD8A 4OLJA 2SKDA 5C8VA 9LDTA 4CUKA 4KGDA 4NQRA 3UJ6A 3JAKB 2COUA 1LLUA 2QR5A 3FBTA 2CFSA 3SBEA 3BWCA 3HY3A 2HDHA 2O4CA 4Z3DA 5T5QA 1URJA 3RS5A 4QQRA 4J2TA 2Y66A 3PGJA 3CH7A 1O5TA 2GRJA 4BY9E 2WTFA 4BIMA 1PYDA 3SQXA 2GGSA 3L7LA 5EVJA 3AX6A 1MN6A 3FW1A 2FEMA 1G5QA 4KIJA 1K3UB 4M0AA 4CLXA 3Q8RB 1DRJA 1VIVA 4GLFA 1RJFA 3VZSA 2QN6A 4RMGA 2XMQA 3IKJA 2XC9A 3GUHA 4J0EA 4YMMA 2FMKA 1JG7A 4EGQA 2B7CA 4B3SB 1Y1LA 5JNRA 2ASEA 1PUJA 2IBMA 1BEUB 1KP9A 2YC4C 1FNBA 2A1TR 5CNJA 4XIFA 2ACWA 2J7PA 3HA2A 1QKIA 4CMGA 3T3PB 5F2KA 1D1QA 3VSBA 4OK3A 5NULA 2QJWA 4HH1A 4H0NA 4H77A 1Y42X 3QELB 4K81B 1M72A 3ORQA 1ZQQA 3TZ6A 5CFOA 3GFTA 3DZKA 1IBMB 3Q9SA 3TXAA 2ODTX 1JG3A 3IOBA 1I7QB 3NTLA 3U37A 4IV8A 4P34A 4QQ8A 1MJ5A 2CVPA 4PLZA 3N6VA 1QH1B 1IZYA 3JVUA 2WFZA 4RXMA 3DT6A 3JATA 4LXHA 2ZXFA 5ADUS 2JLYA 1XKTA 4IFIA 1RQLA 4TVSA 5KFDA 1RW4A 4OIFA 1YQGA 3G2JA 4J16A 3ZWCA 3G6XA 2GMWA 1I51A 3ASUA 1U3TA 3CS3A 1AGNA 2NU8A 3PQFA 1JEJA 4B2IA 1E2UA 1I6WA 2CLCX 2EBUA 2GJ4A 1IU9A 1EE2A 4YGYA 3TXYA 2HF7A 4RUAA 2HLNA 2PMZC 1OLUA 3LK7A 4NJEB 2I1LA 4PQRA 3CLHA 3LCJA 2QY6A 5E8RA 3U3ZA 1UOQA 4R71A 4AMGA 3G85A 2F3QA 1U0FA 3KJXA 1Z47A 2IHJA 3CMCO 1DB3A 3L46A 5TGTA 1O95C 3BBPA 1G5PA 2KIWA 4JI2B 3OGUA 1B1AA 1JHRA 2AEEA 3S4YA 1SUCA 4KXUA 1OJ7A 3A4NA 4RLQA 2NIPA 3MSXA 2E7ZA 2QRVB 4G0PA 1SQ5A 2G1PA 1R3UA 2WWWA 4RPYA 3FVTA 4OAQA 1AB5A 1BGWA 4DRYA 3EH1A 3MC1A 3FYSA 1N2SA 3DTVA 5L4SA 2Q8PA 4WESB 4O5OA 1L7QA 5EZ6B 1TIKA 5KT5A 2DKFA 4MF2A 1FK8A 1SU8A 3M7IA 3AF3A 3QVSA 1RYMA 3FMVA 4HNTA 4P0TA 5SY4A 4WQMA 2EOAA 1UEIA 2MSKA 5SZIA 3P4UA 5JYCA 3ZWMA 4NV3A 1NF3A 2XNCA 1CVIA 1ZH4A 4GW3A 1OXXK 1T5OA 1RWPA 1M10A 5SZJA 1TQ6A 4JSTA 3WQRA 5DYIA 1KETA 2ENWA 3IALA 1SHUX 2DY0A 5JNWA 3H2HA 2RBKA 3UM9A 2BJVA 3VNQA 3H5TA 3L0PA 1ZRHA 1JPUA 1V5FA 3OHBA 5C5JA 5FTKA 2A3VA 1Z62A 1OUQA 3HP7A 4MUGA 4BKRA 5KJFA 1XXHB 4LVCA 2VBFA 4X71A 3VKUA 1UBUS 3AF5A 5L1IA 2PBRA 4YXWA 3JAKA 1X7ZB 1W96A 4E1BA 3D8SA 5C8YF 1M3SA 5B2ZA 1VDZA 3P0JA 5T3YA 4TT3D 4TKUB 1YGPA 3GQBB 4YRIA 4RD1A 2J3LA 1FUYB 1L3UA 2R8EA 3B78A 5CVDA 1FTSA 2KP7A 2HF8A 5T4HA 2X41A 4RU1A 3EPPA 4JIMA 2IIQA 4HB2A 4BAUA 2JRCA 3GRKA 2RJOA 3OJCA 5HIIA 4A2PA 2V7XA 1S77D 2VJOA 4Q9AA 4F5QA 2V4QA 1ZQEA 3U5TA 1RTKA 5LQMA 1QLNA 5DTQA 1OH8A 2C2WA 2PUVA 3IBGA 4L95C 1ESNA 1WBDA 2MRLA 1IWBB 2XYGA 1YONA 4B4UA 4DBVO 3DBLB 2R62A 1N6KA 1E3QA 5KTTA 4AKTA 1VPWA 4DANA 4G8JA 3C5HA 3FPEA 2WTAA 1RRMA 4I99A 4MKFA 4B9MA 1F60A 2FN7A 1AIPA 1M2EA 4HB0A 4G1BA 2XUHA 2B1GA 4TSRA 4WXHA 5GPBA 3AR6A 3EUWA 1Y7IA 2EDAA 2LKCA 4MV6A 5TE9A 1BDMA 1Q0LA 2VNIA 3RKUA 2MUTB 3HKZC 1ZSNA 4C6TA 4JITA 3IOYA 2JHDA 2FP4A 4AWBA 2OV4A 4ENRA 4BUJA 2YS7A 4ZZ0A 2JARA 2WHEA 3P7MA 1IUKA 3D3NA 1U8TA 3SXPA 2C9DA 3EG9B 1FC0A 3NW9A 5H2FU 1UBRS 4ZO7A 4D7AA 2FMHA 3FHCB 3PE3A 1QP7A 1II8B 1RM3A 2JD1A 5MDHA 2Z3WA 4FT4A 3KQVA 2XOEA 1WOMA 1HK7A 1XD8A 4IVRA 3CLTC 3G2LA 4PZNA 4TPKA 2F7SA 2X8LA 4BJ6A 1EK1A 1ZK2A 4BNNA 4BXOB 2I4TA 1CP2A 4S04A 4RHEA 1RJEA 1TM3E 2L69A 5BN1A 4C2AA 2HLDA 1I4EB 4X7PA 2JXJA 2VWHA 2FHPA 4MQFA 1KQPA 2XT0A 3P97A 2Y1FA 3DPIA 3KR0A 2V1UA 4ECUA 4P0PB 2VDKB 2ODQA 1WB9A 2ESEA 5J1SB 2ZB8A 4CDRA 2EQAA 4FKMA 3X1JA 4HQ6A 3NWEA 1JG2A 3A9RA 2UYYA 3G0OA 4JI4B 3RH5A 2W8KA 2V6JA 5KFAA 3TCKA 2Q3DA 2VPWA 1BVSA 1DOZA 3GFFA 3E2IA 1Z1BA 2QRVA 3V2IA 4AZ3A 1QC5A 4M1SA 3KWLA 4EBFA 4P80A 3QNWA 4HXYA 4F2RA 1CHDA 4XUDA 3OAAD 1IQRA 2YWCA 1BYIA 1QJ4A 3FPBA 4LSZA 1SQGA 1TQ4A 4HYTA 5LJIA 4NHEA 1KKLA 2DFDA 3GYBA 3O7MA 4LZPA 5BY2A 2HU7A 1ZQWA 4DRZA 4XIIA 3A1EA 3GIIA 1LF5A 3KD3A 4CGZA 4CKCB 3OFJA 4PQFA 1ORDA 1M0TA 1J2UA 1MAUA 3KD2A 4F9EA 5FWXB 1LK7A 2AX3A 4MB2A 4L6AA 1FS4A 2GO1A 4E2FA 2PL3A 2YBDA 2R1VA 3E53A 2EX1A 3G79A 3MGVA 4BX3A 2WUWE 4D26A 1H42A 5DBEX 4ZVVA 5LWQA 3ND6A 4ADSG 1X7GA 1EK2A 2ZIEA 1A5TA 1KO1A 2JLUA 1R37A 4R1OA 2PFOA 1FSSA 4Q4AB 4EKDA 5JJBA 4NK4A 1K2VN 1GG9A 4QL3A 5AKXA 1T3LA 1N2OA 2XGMA 2DAPA 1NNI1 3OTQA 2OYYA 1TTPB 5EJEA 3EXEB 3GCGA 4BE4A 1PRYA 121PA 3GQBA 2EZUA 5EGSA 3G9XA 4OJPA 5IEBA 1CUZA 4URZR 5F52A 2EYQA 3HZZA 3CW8X 3PZBA 5JASA 2ZCJA 1JHZA 3W3AH 3S44A 1QTQA 1KYQA 5F7XA 4F1KA 2GAJA 3FWKA 4Z49A 3Q8QB 1NUSA 2WY2D 3SQOA 4XYMA 1FNDA 1YDGA 5B2FA 3H6HA 4NH0A 3F5AA 1QU3A 2HUNA 1JH8A 1ZVKA 2Q8QA 1N8NA 1PQUA 1F14A 4RT3A 1RD4A 4PLYA 1Z6GA 2BV3A 1S0MA 2WW8A 4Q03A 1RRCA 5DGIA 3VHQA 1DRWA 3CC8A 1XD2B 4CEIB 1AVTA 2WAAA 3M9WA 1LUAA 4E3ZA 3EYAA 4N6NA 3H5VA 1K8YB 2CFRA 2AB0A 1T0IA 4JUIA 3IERA 1OBCA 1XVVA 2J41A 4MUFA 3SZLA 4A0GA 2JLAA 4KLGA 5K8UA 2FY8A 4HJXA 1M74A 2OV6A 4R54A 1XZPA 2AEJA 4WDQA 1GN9A 3FMPB 5KNDD 2OBYA 1PE0A 5LZ4A 3VPAA 3KZIU 2MINA 2FPIB 3F67A 3HBMA 3QZ8A 2IXAA 4MQ5A 4EHJA 3A6FA 2GXAA 3OEWA 3R0JA 1J0XO 1ZUNB 5KSOA 2JI8A 1XFDA 1TO1E 1PS8A 2Q29A 3AJDA 4ZT6A 2RDJA 2Q49A 3PE6A 2OBBA 4RQ1A 4URWR 3S8EA 4BXOA 1MXFA 1Y7PA 1K8QA 5A5VA 4XX0A 1P9WA 4XASA 5FBLB 3UXNA 2XTAA 2WIKA 3D3EA 3GIKA 4WEQA 3OCWA 4ZODA 3PEFA 1E0SA 3S2GA 3OCXA 3OKFA 3V6LA 1VZ2A 4KO4S 1WAMA 2NVBA 4TL6A 4MKRA 4KR6A 2HWUA 4HJRA 1OT3A 2C57A 1RYYA 5D46A 4FFMA 1W0KA 5B7QA 3A4LA 2RK6A 2AYYA 3R09A 5EJ4A 5JXIA 4Z0HO 1Z18A 3U19A 4N3BA 3HLYA 4J3NA 2NO4A 3M1AA 3PFBA 3WP0A 1HUQA 3KZNA 5T4BA 3FPHA 1LCIA 2YH2A 5HHTA 3EQ9A 3IE2A 4M89A 3KVOA 5B6JA 3AVTA 5KVAA 3E7XA 2H52A 5EGNA 3T3IA 2QLNA 2XAUA 2ZP1A 3N0VA 2CC2A 3DD1A 3UJ7A 5CCEA 1NZFA 1KZ9A 4O1MA 2R8IA 5EJIA 1FXWF 1QCYA 3OTHA 3CVVA 3NC1C 4H08A 4CKCA 2K89A 1FJ2A 1JRPA 1NOJA 4KQ2A 5FWXA 1T8RA 1SZHA 1AS2A 1ZH8A 3BMNB 2HMXA 2A9KA 4LWQA 4UUPA 3RVLA 3RODA 1GCUA 3QPAA 3I45A 2QP4A 3G49A 4HWPA 2JW5A 1UMDB 3UQYS 4WINA 2X0JA 3KQPA 4N8SA 4Q4AA 4TX1A 3TEJA 2B3DA 2YXEA 5TY0A 3EPKA 1E18A 1MTOA 5HKAA 5TQ0B 1OGJA 4P7GA 1RWXA 3LUJA 1JIKA 4JQZA 5BW8A 3EXEA 3OEHD 4LXXA 5K6RA 1D03A 3H97A 3IBSA 3T15A 3ROTA 3ISTA 4X41A 4WZZA 4CKWB 4IX1A 1KJWA 5TV2A 4JQOA 1F7VA 5K2OA 1FUKA 5DGHA 1PQWA 4CIDA 4ZOLB 5H59A 3I76A 1CWUA 1WDWB 1UQRA 2FRVA 1AN0A 1ZJWA 4B32A 3IEPA 4B9SA 3GEIA 1TM7E 2VNKA 4DR2B 2C4MA 5DTMA 1PTJC 1QK5A 2PSSA 1E63A 2XW6A 3NBAA 3SZRA 1AGYA 3PUXA 1A2BA 4JAVC 1NVUQ 1XZCA 2F8SA 1ZM9A 3F53A 1E64A 1QPBA 2RGCA 3PHLA 3CISA 5AHOA 1DIAA 1M5UA 1JT2A 1Q21A 5AI4A 2O0MA 4K9OA 4IQ8A 1JWAB 4YPVA 3CA8A 5K20A 3LWDA 5MN5A 4ZJYA 1DBPA 1LFAA 2XUAA 4OP2A 2OHHA 2R5WA 2V9ZA 3TQHA 2FV8A 3VSAA 3ZV3A 3L93A 4PGQA 1TRKA 5C5EA 1NJGA 2J6BA 1U2GA 4YIKA 2Y4OA 1LQTA 3L7OA 3ELYA 3I9MA 2W98A 3CN7A 4TGLA 1L5GB 5FP0A 3NAMA 2QQGA 4DKJA 3JXEA 4Z0TA 5LIPA 2Z30A 1DPGA 4ETWA 3P4XA 3BBLA 1MV5A 1BHO1 1E3MA 4WJZA 5C7LO 2VAPA 3V42A 4UE2A 2HT1A 1UZMA 1HI9A 4DQUA 1NKTA 2N3ZA 2OEHA 2F9LA 3BZUA 3QLVA 1MABB 4IS7A 1R4AA 3AG5A 3GZFA 16PKA 2KX7A 4UOZA 2C2KA 5CITA 4BX2A 5C1PA 3CR8A 1YKSA 5EE3A 1KKMA 1DXYA 4ENWA 3GV5B 1GFIA 4X1OA 4N3AA 2UUOA 5KJEA 1SELA 2ST1A 1IJKA 5MN6A 3B2EA 2DTEA 1UOPA 3S1SA 3GIDA 4I2FA 4V3BA 4AYXA 2NQTA 2WTMA 1RWQA 1TUBB 2CUZA 2HK7A 3MT7A 5BSMA 1JJFA 4RQTA 5K0BA 1RP7A 2C83A 2G5HB 1TYBE 4D02A 1RR6A 2VHUA 4NONA 4IF4A 2X3FA 2X2FA 4MCAA 2A2ZA 3A1TA 4MJ3A 1KYTA 4N82A 1FMCA 2IK8A 4XLTA 3R3YA 4MWBA 1T3QA 3DVQX 2MYPA 1NQXA 2J1LA 3NHJA 5DIFA 3U9LA 4CKXA 3BICA 3ZWYA 1ZN2A 1OYWA 2XUFA 5GTHU 1DWQA 4TLDA 3EIOA 1GL9B 4Z1MD 3CH4B 1UJ2A 1DVRA 5U4QA 5E1MA 3MINB 3ZNQA 5A4IS 5DYNA 3MT0A 2AS0A 3ZY5A 3AMZA 2G25A 2FR1A 4MVJA 4AMZA 2YRXA 3ZOZA 3FPFA 1Z45A 3AI2A 1BS2A 4V0KA 3EEOA 4PZEA 4ZPJA 9ICNA 4LK2A 3F8SA 1N5OX 3A3NA 2QRGA 4JEHA 4QOSA 4NQZA 4C43A 4BO7A 1X15A 5BRAA 4NENA 4ZQIA 3VPSA 2XJ9A 3CY6A 3AVVA 1A4UA 4JHXA 4MMZB 4V1CB 3HQ4O 4TV8B 3UGKA 4FILA 4AP5A 2R7LA 2Y0SF 1JP7A 1KI6B 2ORYA 3O6VA 4QRIA 2V4MA 2C4NA 5ANRB 1AKYA 8ICUA 2R0QC 2VAXA 4G01B 5AVQA 5E1BA 4NRDA 5KBYA 1KPIA 3EXG1 5SYAA 2YKGA 3PC8C 2UVWA 4CLRB 3EWNA 5CR9A 4CKWA 1XMSA 4C1NA 4V02A 1M8KA 1DKUA 1T3GA 2VF4X 5LZ5A 3S2ZA 4HV4A 1Q3HA 3LC2O 4ZGGA 4HZUB 4EHBA 2UVQA 5ITWA 1SCUB 3DKRA 4UPEA 4MPTA 3T3FA 1KY5A 3HJNA 4ZOLA 4ND5A 2QXUA 4MI9A 3K9LA 3RSSA 4DV7B 2GNPA 2PZLA 1OW3B 3CVXA 2H8KA 1W6RA 4MHTA 4C7ZA 2OG1A 3KDAA 1ZJJA 1O4VA 3OPYB 3UGJA 2HHCA 3KR2A 5BSHA 2A1UB 1LDYA 1GT6A 1W46A 1TVKB 2JAPA 3RFTA 4IJWA 4D4MA 1V6CA 3TJZA 4GUAA 3TRHA 5LIRA 2P2YA 5CCXA 1V96A 2WICA 2J3JA 4RVSA 2H65A 4D99A 1RE0A 4GOMD 4MWGA 3WWPA 5TEVA 5ITVA 4B7XA 4PZCA 1B41A 2WUDA 3GR6A 5FWNA 3EPIA 4JMPA 4D6YA 4KEAA 1L7NA 3D6FA 1Z4OA 4HDSA 2IWHA 5DNDA 2P3OA 1N2HA 4LYDA 1QLJA 2GM5A 4IXNA 4RK5A 4OQPA 1YCFA 2BPGA 1MJGA 2YQZA 1YIOA 1DBRA 4TLEA 3PX3A 1N36B 1KFDA 3G1WA 2FB9A 5TDHA 4E70A 5JH7B 1QSLA 2BC9A 1MABA 1T2FA 2BR5A 3ONFA 2XWSA 1I2BA 2MT9A 3C3PA 3DE7X 3F1KA 4M0MA 3I6IA 1U8AA 5CIQA 2RH5A 1TK9A 4M9RA 1ISIA 1LPNA 1Q1QA 1KK1A 2BFMA 3RS9A 3VH2A 2CHGA 4EQ6B 1I32A 1HUOA 3IP7A 3LUCA 1H69A 4G1MB 1PWHA 4U4AA 1SB8A 4HVAA 4V0ME 5DWDA 1JS1X 1JI0A 1TUBA 1Z5GA 3PICA 4MPPA 3VZPA 3EIUA 1U5BB 1SN7A 1A98A 2BF7A 1I1QB 2Y27A 4CDNA 1XZIA 4LHZA 1QIFA 3O4FA 1NWCA 1QX4A 1F5NA 1U28C 1KYYA 4UCQA 2GESA 2GN0A 4DR1B 4YMTA 2BFOA 1VP9A 5B3AA 5DYYA 2YZGA 2QD4A 3VR4D 3KJFA 1HWYA 1Z3CA 3CSDA 5EXDA 5CIWA 3JYLA 1RLTA 4C7MA 5A6SB 3RTEA 1QFXA 2OQRA 3DTNA 1I0LA 3C3KA 2Q1YA 2AGOA 2J87A 2P91A 1D4FA 3OUZA 3VNUA 5J0QA 4WNYA 4YREA 2MYUA 2AEFA 1X40A 1QAOA 5BYKA 4MUKA 4IKPA 2NVUA 1IPHA 1NT2A 4E2YA 3K09C 5I4CA 3QOFA 4YRPA 1G3MA 5DB8A 4F46A 3KXPA 2YYZA 2ILVA 2B98A 3J7TA 1T9ZA 3FSEA 3ZGVA 5H0IA 1SXJA 1X80B 4Z0NA 1E3EA 1NYLA 4PZOA 3PNCA 3EQ2A 4QO7A 2H2DA 1PEYA 2P3LA 4PZUA 4ZZ2A 4GRIA 3QV1A 2JIMA 5JCXA 1DZ3A 1WMEA 9ICAA 3D6AA 4TV8A 2QLJA 3F6SA 1M34A 3OWOA 1KZGB 4DSEA 4DQQA 4Q9DA 3PDHA 3C45A 3EDOA 4Y1EA 1ZPDA 2GD1O 3Q4GA 1E5VA 3AEQA 4PVCA 1VHQA 3TVYA 4JUCA 1RCFA 3HA5A 3P4YA 1L1RA 4BVJA 2QMEA 3DE1X 4QZBA 3KEOA 4RWEA 1Z29A 4BO4A 5I4BA 1RYNA 1Y81A 2YDXA 5G0WA 5GOZA 1SKUA 2UYQA 2P41A 5KHAA 1Q1GA 4ML3A 4HZUA 1G2OA 1P7YA 1QWOA 5E6UB 1JTFA 2ICAA 4PCLA 4KE9A 4ZCTA 5I9SA 4O6VA 1EVEA 1KBZA 1GG5A 5JSYA 1YASA 3WRVA 1KRHA 1DQNA 3B6ZA 1FVXA 2W9BA 3IG5A 2O2SA 1ZXIA 3LFUA 2GCPA 3L77A 4J9LA 4P3OA 4I2CA 1YZNA 2R8XA 3OPYA 1KR2A 4QXAA 3SAHA 7ICEA 4LIPD 4GP7A 2N42A 1GAWA 1X7YB 2A1UA 2A5JA 3RR2A 1TVKA 4DJEC 1G2IA 4MROA 1QHYA 2PRIA 2O48X 3GWGA 2DU8A 1MOPA 5IF3A 1R66A 3QUAA 1FSPA 4XQCA 1KJYA 4YAEA 4J1TA 4R5MA 3HFJA 5L3SB 3G17A 2YWXA 1AA9A 4BVBA 3I9OA 1UWKA 3FHJA 3B3FA 2V5AA 4P2BA 3QVLA 2Z98A 4EHNA 3TNDA 2WSBA 1G6Q1 4N0PA 3PGKA 4Q3EA 5KYKA 4CKZA 4U6QA 1AY0A 1MC5A 3FY4A 4H3KB 5DM60 3HP1A 4D41A 1HETA 2H9YA 1TJ5A 5KSPA 4FZVA 4QLOA 4KITB 2GJSA 1KKXA 5FQNA 2OXRA 3A1NA 4TSFD 1NMSA 3RC3A 1P1FA 3EIFA 2KV2A 2GWHA 1UMCA 4UBCA 3BKWA 2ODWA 4A2WA 3ERCA 3F6EX 1R74A 4IEIA 4EL0A 5ALWA 3UMRA 9ICTA 1D8AA 2BN4A 3H4MA 3LOUA 4MJLA 4BECA 5BOLA 3WIEA 2RRDA 2ONYA 3V3KA 1ULSA 5DX1A 3O1LA 5CB0A 3KUCA 2Q6LA 2RC5A 1D2NA 3V8RA 5TISU 2J08A 2YOHA 1O08A 1UZUA 2JL1A 3LX6A 3CZPA 3IURA 1QORA 2XVXA 4PPXA 2LTAA 4UTZA 3R2JA 1HZJA 5E6RB 2D00A 4US8A 1M6EX 1VFPA 1YRQA 3V1YA 5L6MB 3ZLBA 3WGUA 3FJ1A 4HNAB 2VS1A 1N7JA 5EEGA 3UHJA 1O95D 1TAUA 4BPRA 3MJRA 2VQ3A 3VSEA 2YWEA 1J5XA 1KDHA 4JDUA 3TW0A 4N0QA 1UFOA 1BCSB 3A70A 5BRNA 1JLLA 2C2OA 3I3SR 1YUBA 2BCQA 2ERXA 2AC4A 4DL3A 3PCXA 3ZHYA 2J6CA 3N39C 4R8SA 1GPDG 1B6TA 3ZC3A 3MM4A 1Y1KE 1BAPA 3QENA 2HD4A 4Y2UA 3LIPA 3N7UA 3COWA 2MSWA 3RRZA 1O7JA 4E22A 4H1WA 1YL7A 2FETA 5DHSA 4E7PA 2VT2A 1FNMA 3ZVRA 4KXMA 3ZDFA 2BP7B 2H11A 4FO6A 1GSOA 1OWOA 2VHQA 2BFEA 3IAS6 1N6OA 1RBMA 3A4VA 1RQPA 1X42A 3ELDA 3ZX4A 1V41E 4PPGA 1Z6QA 2OVFA 3K0BA 3R40A 1NLYA 2VCEA 3K0KA 1B0UA 1ZI8A 3T35A 2X8AA 3H75A 4RD3A 1YA6A 2LDXA 3A58B 2ZWPA 5A62A 3DDNA 1M1NA 1KF0A 4CFSA 2LBOA 1ZJYA 2ZIFA 5KOHB 2CMFA 4FBMA 2QTBA 5DGXA 2NLOA 2C5LA 2CB9A 2KKVA 3R1IA 2VZ8A 2C3PA 5HFJA 3M8SA 3HCNA 2WP0A 1GDTA 3RR8A 5KFUA 3LP6A 1GGJA 4RHFA 1CUEA 1J22A 3W2IA 2OWDA 1HTTA 1EVLA 5E6UA 1FDUA 3AJAA 5BYJA 4NCXA 1H2HA 5B1YA 1K98A 2PHZA 1JHPA 3JQFC 5J58A 1JJ7A 4UAJA 1KJIA 2KHZA 4FZNA 3ZGOA 2VJLA 1YFKA 5G0TA 3DF9A 4RQ4A 1FTYA 3RU9A 1NM5A 2VTVA 1I4OA 1R6DA 4JD5A 5I47A 3TLAA 3QKRA 3WJ2A 3M70A 2JANA 4QAJA 5JC1A 5HCUA 4A15A 5DBAA 3GA0A 2O8DA 3QPCA 3D6NB 5EIFA 1A9PA 3O0DA 3HEBA 4QPDA 2HX1A 3N07A 2H59A 3FNQA 3H3FA 2PVCA 3PEVA 2N1MA 4KYVA 4RQ6A 5D86A 2JK1A 5IKEA 3D6VA 1JSZA 2GO7A 5BYAA 3ZV6A 4E11A 3RLIA 4CEJB 4AY3A 4BNWA 4G1VA 3LBIA 1XCPA 2CMKA 1GPWB 3GV8B 2O8VA 1FY2A 4KX3A 2XKBA 1Z8HA 2Y8EA 3HSSA 1TQDA 5LDDC 2QD3A 2NXCA 4NNOA 4D0LB 3RBXA 1MQ9A 2RARA 5ES3A 4FFBA 3EGCA 1TUIA 3V4PB 3LVFO 2H5EA 1SC6A 1DADA 4TYMA 1L7EA 5IJ9B 3MAGA 1U0JA 2I4MA 1XZAA 4QA9A 3HCBA 3KQWA 1TCVA 1IN7A 1IXSB 2XDYA 2F43B 2XUZA 3HXPA 1ZA1A 2I80A 1QG4A 4TRRA 4I50A 3T1VA 2FDCA 3GD7A 3MTQA 4O3OA 3EDMA 3CF0A 3D02A 5IDVA 4UB1A 3OC0A 5CRXA 2D1RA 2IOHA 3B1FA 2Q2VA 3G1UA 3ICEA 4A0HA 3R77A 4GRDA 2MR6A 3QXSA 4YQEA 4WSOA 3V7NA 3IVMA 1NVXQ 2QLTA 3JQPA 1BGVA 2R44A 3ZGZA 3BMQB 1WVIA 2HHVA 1M8JA 3O5AA 4QX6A 3NP7A 3ZJ4A 2WIDA 4H0FA 4RSHA 2RHHA 3Q12A 4P5DA 4FDLA 3D2CA 1I3MA 3ZHVA 4LV5B 3MGIA 4O9MA 1TK0A 1AA6A 5TX7A 4C05A 5LWHA 5DNVA 4II7A 4BMVA 4BVEA 3WB1A 1NW7A 3NIBA 4EYHB 1WG8A 2CKDA 4XM0A 3TZKA 1P2SA 1ETUA 4HDKB 5LC1A 4W5OA 3PNMA 1KEWA 4LZOA 1RWMA 1CZLA 3V7WA 3C4QA 4UATA 1WCXA 4RETA 2E5FA 9GPBA 4KE6A 3ZTYA 2HL6A 1Y0BA 1G6KA 2W11A 2JBWA 1H1LB 3UW1A 2KJ8A 4JB8A 5A0VA 1PR6A 3TQTA 1H8ED 3W3AD 4OFBA 1TK8A 2UYGA 1CUWA 4KLDA 2PPVA 3QE9Y 1R10A 2YCLA 4MZDA 3RROA 4OHRA 1WW8A 5E8JA 3TAPA 2YB4A 4LE2A 3LQKA 3BJIC 3QBVA 1GPNA 1R8JA 4LF5B 1SB9A 1RZRA 2AL7A 3CNNA 1COWD 4WLVA 2OHOA 1P81A 5ARDA 3DCIA 3V8QA 3S0JA 3DLIA 3I8OA 1TDJA 3LVRE 3VH4A 2OO7A 2PSDA 1TA0A 3W05A 4GXKA 5E9WA 4PANA 4DSKA 4FSXA 3D7NA 3NXKA 4REQB 3GU3A 3U3JA 5IK2D 1RWNA 4ZMBA 2E1FA 5CDUA 5F4ZA 3AV0B 2KZMA 1SVSA 1ZGBA 2M1XA 4OQYA 4AJ9A 8ICJA 1KHHA 4KQGA 1N6IA 3VJRA 2KJ5A 5BVGB 1YUNA 4M4SA 4MX8A 4FMDF 2WR8A 4DG9A 4GXQA 4LYHA 5SV2A 4CKEA 2YJNA 4RZQA 2BWJA 4F5NA 4UE3S 5E0OA 1Z0FA 1SA0A 1K86A 1MO4A 5T67A 3Q1LA 4O4IB 5HQTA 5DVZA 2GSDA 5J9FA 4Q39A 4JC8A 4H9GA 4YFYA 1F3OA 4AKSA 1L3TA 2R66A 4MQUA 2J4CA 3EXFB 1H0KA 3ZYZA 3D8TA 3NHPA 3BTUA 2Q50A 2QM8A 3FBGA 1N8SA 4CLEA 1IG3A 1UIMA 2ZI6A 1Z17A 4CEJA 2ZSHA 2F1IA 3CYMA 2ZIXB 1UWVA 3WGNA 4JL8A 2EJTA 1L5OA 2H92A 1VB5A 4LOJA 3SEZA 2Q1WA 4H2DA 4E03A 4PHEA 2IY7A 1WV0A 5IIIA 2MSLA 3NEAA 2IBSA 3AR5A 2JH8A 3DQPA 3K2IA 4WXYB 3T3GA 4KIFA 3WYBA 2HA2A 2ZDQA 3T7SA 3MIZA 2NYAA 3UXHA 8GPBA 4DW8A 3WBJA 4CT5A 1A4IA 4UPVA 2W8BB 4QWCA 3QE0A 4Y0NA 4HN2A 5MN4A 1YT5A 4F4FA 3QVVA 4WFKA 1WDMA 3W5BA 5SZHB 2LIVA 1ZLYA 4ETIA 2VRCD 1UP4A 2F43A 3BPSA 3MGHA 3RT7A 3GFPA 2Y1OA 4YB8A 3K96A 4MQMA 4N01A 2EHDA 2V7TA 4HLNA 3I83A 3FNBA 1RYFA 3KUXA 2E48A 1O5OA 3KU4A 4DE5A 2ESRA 4HDMA 1ZR2A 3KCNA 1X9WA 4PZ9A 1X2EA 1VKJA 2Q62A 2OL4A 5AKZA 4I9GA 1E20A 1V0JA 3N0RA 3STXA 2PSEA 3MOSA 2DFVA 1BEZA 4IZOA 3KXLA 2JIOA 3GRFA 4B81A 1J0DA 4Q4LA 3FWPA 4RPLA 1SVUA 2HXGA 1UL1X 4WK2B 3JD4A 3EBPA 5BNFA 2BSQA 1MOZA 1YMUA 1V9CA 1E32A 5KEIA 2KSQA 5AIBA 4AN0A 4E2ZA 3KOZA 4EKEA 1DCFA 4ZVUA 4YAUA 1QAMA 3KPUA 5T7BA 3ABQB 4AO7A 5AKGA 3AY7A 3OCVA 2PPLA 1F8UA 2KM1A 2JFGA 2VNJA 3AL3A 3D1LA 1X86B 2R8KA 2ZU0C 2WM2A 3WLFA 1IXZA 2ZBGA 2NRWA 4M9CA 2O2HA 1PZXA 2RJNA 1NK8A 2JRLA 1D0IA 4GC5A 4E2WA 1T4BA 3K31A 1XRNA 1RXUA 1BWSA 3FTQA 1UDCA 1U3WA 3NORA 3PI7A 3VJMA 1QOPB 3UEOA 3G7UA 4R8VA 1SEPA 1COZA 1GOTA 2ZTUA 3R3HA 1XVAA 1RRPA 1C1HA 3AF6A 4U2FA 2X8JA 2WWXA 2KB0A 3C7CB 1A88A 1UAYA 1QIJA 1XQXA 1IBRA 2REQA 4BMOB 4E7OA 3RBDA 2OB1A 3LVBA 1ZNZA 3CWQA 4C3ZA 1RSZA 3ZBUA 1N75A 3PUIA 2VDNB 2XCAA 3VAZA 5DGCA 1W34A 5BQOA 2VFAA 1L8LA 4IM7A 1TVCA 3CKMA 2O54A 3ESAA 1M2VB 3C1TA 1GWNA 1JR4A 4MGHA 4FSDA 4XEHA 3ZV7A 4BDPA 2OFOA 4N7MA 3IULA 2RGWA 4GR9A 1E61A 1NUTA 3TNYA 1KHTA 2UDPA 4QYMA 3MN1A 3FGOA 4TQ9A 1YWGO 4GE3A 2P35A 5FORA 3AWDA 3AUTA 3SDZA 5JJIA 5BVGA 1BNCA 3UYKA 5ICMA 3IM1A 4TUPA 4U2BA 1BOFA 4PG4A 4DHWA 5I7UA 1QHHA 4U7GA 3OU2A 3Q6MA 3MGCA 1TECE 1E0DA 2BZ0A 3B1WA 3W5VA 4GGMX 4MUHA 3UY4A 3VR3D 4YMOA 4O4IA 2GUGA 1PDVA 3QUBA 2YWFA 3E58A 5CG1A 4EGJA 2IDJA 1PL8A 3B7PA 2O8CA 3ZYCA 4XVQA 3I09A 3VVLA 2IZ6A 1XEFA 1HOXA 4YT4A 3NVDA 4Q3KA 2A9JA 1I6KA 2V7VA 2UXCB 3PUVA 1T4MA 5LOVB 4UMEA 4BP1A 5EQTA 4Y2XA 5BQPA 1PBNA 1E9EA 5JSKA 4KXXA 8ICMA 2VK8A 4P5PA 3QE3A 3R24A 1G5RA 2DH6A 4G89A 3VAAA 1E2PA 4P08A 2FGJA 3IHTA 4JYMA 1E2MA 1EKXA 1ISHA 1GU1A 1IHPA 1RKXA 3UJDA 3PHCA 4V24A 4BC0A 1H8HD 4PCVA 3A3PA 8ATCA 3SF8B 2PZGA 1FIQA 1BPYA 4FCVA 1Y8RB 2E3JA 4D9CA 2O6LA 3VZDA 1KK2A 4QNNA 4Q9IA 4MUNA 5G0SA 3IT3A 4KUEA 2DULA 2HFJA 821PA 3NOOA 4NYMQ 5IC6A 4L51A 1MX5A 4RH1A 3M82A 3UFXB 4RTSA 1LF0A 3CLRC 2NTVA 4UVHA 2NAPA 1K8XB 1J2TA 3C14C 2PU7A 4L78A 1OV4A 4WA8A 4GI7A 4Q7MB 2JFZA 2V7EA 4M21A 4RQUA 3U3KA 2VIXA 1T8PA 3LQ4A 1YQQA 4UHEA 3HB9A 3LA8A 2R6AA 4ZJPA 2O5CA 2IYTA 2Q7XA 4XKJA 2X0KA 1OHHA 4W5JA 3S2IA 1AUOA 1IM8A 4GXRA 2Y2UA 2FSUA 3NVVA 4RNDB 5HCIA 5D1NA 2O2DA 2OZEA 4BUZA 1TPZA 2UUCB 2W7OA 3DTTA 4GOOD 1RI3A 4B40A 1M5TA 1CY1A 4DXHA 2MMCA 2H5LA 5LD2B 1N48A 3QELA 3TUZC 2EKLA 2YV3A 4LJ6A 2PWPA 2Q3JA 3CO0S 3C3XA 4U7TB 3U3OA 1NE7A 3LT2A 2HQBA 4WRRA 4IUBS 1BKDR 2IYNA 2WJWA 2XGOA 1NYRA 3Q2OA 2Q1XA 3TAQA 1MAWA 2JJQA 2CNLA 3DFIA 2CJXA 1J2EA 2HOQA 2FN3A 2P9QA 2NYRA 2WHQA 2NMVA 3STYA 1QH1A 1FFBA 4ZRDA 1MO3A 2EDCA 1UOOA 1WMBA 3OQ1A 1VJCA 1YC5A 4C7KA 2OXCA 1AHHA 3P9NA 3Q10A 3RJ9A 2E4YA 5TVKA 5I4KA 3KJHA 4JT4A 3QOXA 2QRLA 4KMMA 4RKRA 4G5XA 3BFVA 2IW3A 4Y2HA 3N74A 1ZH0A 1Z06A 4H6WA 1R12A 4V0RA 13PKA 2W48A 3BYZA 2ZI4A 4J1QA 2D62A 2JIZA 4Y2GA 1LSSA 2C58A 4JBXA 1GQYA 1WW2A 5HDBB 3ZWXA 1TE2A 1BXGB 2Y0BA 4LX8A 5HJ7A 3LXUX 2FK8A 4H60A 1OYOA 4NJEA 1M66A 2L0XA 4CN9A 1GQRA 1SIBE 1MEJA 1EP3B 3EQ8A 4Q3LA 2YYYA 4KAJA 3NUZA 4WCFB 4NE2A 4IOKA 1CRXA 3T5JA 2JH3A 2JEOA 5B36A 5ECYA 2B4QA 5FUXA 3Q6IA 3B5EA 3GCXA 4N12A 2G04A 3GLRA 1RS0A 5C1BA 4TXJA 5K0SA 2VTBB 1XF1A 4BO6A 1VL0A 3KPVA 1QSSA 3A11A 2ZJ6A 3D0KA 1JI7A 2Z9DA 4PLWA 5E7QA 4ZU3A 4IGAA 1II9A 2BOVA 4B4WA 3SHVA 5LXTB 4DV5B 3GPIA 4DM4A 4WESA 1LDNA 4BCBA 5K6AC 2YQ5A 3CKKA 2IOYA 4HXFB 2ZXEA 2I22A 4CV0A 5CB4B 2B99A 2OXFA 3K1JA 2RI1A 3DZ8A 4X6XA 1TOAA 1JSRA 3GDXA 1XKLA 4YDQA 2GBLC 3EZ9A 2ZAMA 3Q8XB 2GEUA 3L0CA 4US0R 3WYAA 2HGZA 2GZMA 1ATIA 4F5YA 1U7ZA 3CEJA 4QUGA 5AJZA 4Y3UA 2DR0A 1QVWA 3L4BC 5AUPB 1NDQA 3RFCA 1JGTA 3PD0A 4ENSA 1DBWA 4X7MA 3BSSA 3KSUA 2XNJA 2PGIA 1ZRNA 5GJCA 1QGUB 3V7JA 4RKFA 1FF9A 4FD3A 2Y6UA 1XXHA 5H3HA 3I9V1 3GEPA 2VAVA 2LKYA 3HK2A 4DV3B 1X7ZA 1IY8A 1BNPA 3P96A 2W6ZA 4EZIA 4TKUA 3UFXA 4L27A 1AROP 3PE4A 5CR0A 3DR3A 1OXJA 5DTRA 2A1AA 1KYIA 4KRGA 4ELUA 3DEEA 2VLBA 4UDNA 1MOQA 1NZBA 1CK4A 2VWGA 3EHEA 3IR5A 4K9DA 4IJ6A 2XVMA 3MT9A 4LF6B 1Z35A 4BFYA 4OXYA 1U0TA 4ZZ1A 3FDZB 1DAGA 1G2PA 3RADC 2EGGA 1J9ZA 2PL5A 4V0MA 4DMKA 1V4NA 3SX2A 3DBLA 1GPAA 3FFWA 3MRSA 1CUDA 2NW6A 3JU3A 1CF2O 1YR1A 1T9GR 4NLKA 3ONWA 3DLBA 1VHLA 3V1UA 1QS0B 3VU8A 3BWXA 5I7EA 4HXEB 1EWVA 1GO2A 1UKBA 2OCGA 3IO3A 2VH5R 3B6EA 2BKAA 2QRZA 3S81A 4MKXA 1GCGA 2MUTA 3RYCB 4WZAE 2G40A 3S5UA 4RQ5A 3N4MB 5IDWA 3H65A 2BLNA 1WCLA 2P4HX 4RU9A 3KSRA 3ZCXA 1Z2PX 1Y3AA 3EG9A 3PS9A 5G1NA 4CL8A 4KXFB 2UUBB 4IH1A 1Z0JA 2ETXA 2D3TA 4PHPA 2CDNA 3HKEB 4ROSA 1II8A 4QBKA 1C4KA 2QSZA 3H0LB 2BSXA 4MVCA 1GQSA 3MBKA 3JAWB 1B3RA 5J0XA 4AJ1A 1KPHA 2WG0A 4JGBA 4KPUB 3PSAA 1EVKA 3M9MB 4H6PA 4LDRA 1OROA 2XSZD 4ZOEA 4FYIA 2ZSAA 1JG4A 3B9QA 1L3SA 4CL3A 4R9SA 3EFBA 3HSYA 4R2JA 3LH5A 4TM8A 4U8GA 1XEAA 1FMTA 4P0PA 3FDSA 2H7CA 4KLEA 5IN4A 3ANLA 1T4CB 3DT8A 3WFZA 3EVFA 4WCFA 4FS2A 1R6AA 3SQIA 2YL2A 4C4XA 4DV0B 4K1XA 1S0NA 2CV1A 1RXYA 1K1QA 4KZKA 3W04A 3N86A 3C3JA 4RMHA 2QZPA 1P9LA 1V4BA 1T6ZA 1AQ6A 2W9MA 3GQCA 3HWWA 2A57A 2QXYA 1WF6A 3QMPA 1Q0TA 3OSPA 1AF4A 4YHHB 3I6YA 1Z2DA 1JDUA 4JLOA 2CUKA 3CNEA 3TZLA 3WKAA 2YZMA 3G89A 2V6BA 4L74A 3T7IA 5EJAA 1FDSA 3NHLA 4QZVA 4ZD6A 4EJMA 4RZXA 4GOND 2W2LA 1FVFA 5JAUA 3G5TA 2XOKA 2GM4A 3O9MA 4XQ9A 5ADHA 4PM4A 3FG9A 3DMHA 1FQOA 5A05A 4ZV7A 1G8PA 4C3UA 4XRGA 3TOXA 2PDAA 4E4YA 2QW8A 3QE2A 1JAIA 1I7PA 3NM6B 4KPGA 3DTYA 3I52A 1G0OA 4ERNA 1DCMA 3PQ6A 2HK6A 4FWIB 3DOCA 2PZBA 1NOMA 1DAMA 2J9GA 3RT9A 4R9NA 3STWA 4FDUA 3VR5H 4G36A 4WLOA 2OO3A 2ZB3A 4UXJA 3KM0A 3LP8A 3CUTA 3ZLVA 3BD7A 2KS6A 5J8YC 1QFYA 3T4XA 3A2KA 3EK2A 1GTL1 3T3MB 3P0IA 2G4LA 4XWGA 4B7UA 1EESA 4MA0A 3MJVA 2P4QA 1EAYA 7ICPA 1FTQA 4QZDA 3R8XA 1GRNA 1KWKA 3P9PA 1CIPA 4XYEA 1NVBA 2C9CA 4HQOA 4MEJA 4UB4A 3RC8A 3TR5A 3BXHA 4CV2A 1ZW6A 4KXYA 5AK3A 1B00A 4K6FA 2A67A 5LZ7A 4MLZA 3SC2B 4S24A 1F51E 3PDJA 2I6TA 1P5RA 5D49A 2XZOA 4GLLA 2CCKA 5DNEA 4NH4A 1UBKS 1TV9A 3GVIA 1IXYA 1EX1A 1JRLA 1N2BA 1A9QA 1Z6AA 4RZIA 3FDZA 1NSYA 1Z7BA 5C5CA 2IRWA 4NBLA 3MMXA 1ZM4A 2XQVA 3EF0A 2E4XA 3U7RA 4QBFA 4F8JA 1YB6A 1ZAYA 1NN5A 3GH1A 2O1EA 5G1OA 1XD2A 9ICMA 4CEIA 4KQXA 1EFRD 4US2R 2Q3FA 1QS0A 3LKVA 4RIGA 5KHLB 3RF9A 3EDYA 1ND6A 1UBNA 3SAGA 4MW6A 1S02A 2C2EA 5TPZD 4B84A 2JFYA 3C98A 3LRXA 2DF4B 3AEYA 3B2QA 3SI8A 1KVSA 3ZGLA 4BWVA 2BISA 4LW8A 3LCCA 5E9AA 4DYDA 4BO5A 4UAGA 2JHCA 1JQ5A 1Y8CA 2H2HA 2B25A 3O8BA 2RK4A 2FPIA 2FW9A 4FFSA 1YOBA 3LC7O 5E3IA 4DLTA 4G0MA 1ZUNA 2Y0SC 4B6SA 1TCAA 3JAWA 2FYTA 4GR4A 2UKDA 1ZW1A 3HLKA 3KALA 4DJFC 1IZ8A 3GRUA 2RFLA 4O08A 1RWKA 4L5BA 4AY2A 4S2EA 1GPJA 1HLPA 3P32A 3D8UA 4FJ0A 5EIEA 3EODA 5JPDA 3NRZA 2Q5EA 3VO9A 4S05A 2OUIA 1GG8A 4IZ6A 1VIMA 4W4TA 2ID7A 2H7YA 2E21A 2AT1A 3DMTA 1D6NA 2YWDA 1I24A 3ACCA 1PJLA 2XH8A 1K3TA 4UNIA 1HLGA 4MICA 1T4CA 3EVZA 4D4HA 1P7PA 3A1FA 1GKYA 4EIWA 5L3RA 4E33A 4UULA 5K8JB 1G55A 2PZEA 1GHTA 3D1VA 3PSFA 4UHDA 4IRMA 3OSUA 2OWEA 1QGOA 3WGGA 2F1OA 1XD9A 5CT4A 5LQRA 1O97D 1SBZA 3AT1A 4KN9S 4IIDA 3DV9A 2WFMA 1TYEB 4ALLA 4M1WA 4XDHA 2JH7A 1PX0A 3C3CA 4QDZA 2ZUEA 3BL8A 1OFVA 4Q3CA 2H54A 2JHAA 3H8WA 2VN8A 5ALKA 1R0YA 2WSYB 1K7EB 4GOXA 4YRQA 1VJ1A 2BTQB 1L4HA 4FSHA 3FDJA 3LBAA 4U2EA 5IZCA 2BEWB 1BWRA 1MW8X 3BL5A 3LKBA 3C3YA 4NC9A 3BMNA 3I5MA 4BV2A 2KOBA 2P5YA 4TSKA 4YUAA 2R8RA 5K05A 5HUJA 1WUHS 4NARA 4Q7EA 1MRZA 2VKTA 2X1LA 2CXRA 4JJFA 2V6FA 1RHUA 2WB2A 1CRPA 4KXVA 4QEZA 1UMDA 4Y98A 2C84A 5I8WA 5JCOC 2V3WA 3KUUA 1U2PA 2FZEA 4YX9A 5HFAA 2CBZA 4JELA 1L7XA 2F3SA 1Z0UA 2DE0X 1T9KA 1ZJ4A 8ICFA 2CZQA 3NM4A 3W4JA 5TQ0A 1SUIA 1DX4A 3C3WA 221PA 2PIAA 1G7TA 4JP8A 4C7XA 4ENPA 5JS1A 4J0CA 4WK4B 4YP0A 1X7DA 4RHXA 2QJRA 5KG6A 5BUSA 4U5XA 3MMZA 1JLRA 1PJZA 1ADJA 5J3JA 2BHLA 1KJQA 3RD5A 2P0AA 1IULA 4B0PA 2CXPA 1EFLA 5KTQA 1JILA 4ZAVA 1QR2A 2JD2A 5P21A 4ETMA 1YJ5A 1STOA 5C4IA 3L5KA 2V55B 2NQ2C 2PGJA 3N8NA 1U0HC 4EW1A 3DKPA 3GQVA 4GX5A 2WE7A 3NQ41 1SUBA 5JI3E 1KAOA 5IKOA 2QROA 3GLFE 4WL0A 3SK0A 3WLRA 3AHHA 4B3JA 3RVJA 4BU1A 1AM4D 2WOOA 4DOAA 3TSWA 1JZSA 3PVSA 4J0QA 4LWZA 2GZHA 2O7SA 1T34A 2XA9A 3TFWA 4M36A 4R16A 5DYGA 3H4IA 2IDMA 1PX2A 3F3KA 4QIWC 3ETLA 1X9MA 3AHIA 3ZDAA 2XTMA 2JDIA 1J0AA 2PZ8A 3I9JA 2XUKA 1A72A 1Q84A 4YVZA 2ZE8A 2PUHA 3VAYA 2XBMA 4EDFA 4HNGA 3REGA 5I45A 1SOVA 1JDBB 5G41A 1OF1A 4ZC1A 3CVOA 2PKXA 4MLPA 5AVTA 3KAPA 1E9VA 5DULA 3GEMA 3G02A 3IUSA 3BA1A 5KFTA 3VC1A 3H99A 3M4YA 2GN1A 4AU1A 4MKHA 3RSQA 1OLXB 4NLNA 1ZU5A 1UT5A 1UXKA 1EXVA 1N9ZA 1BDIA 1ML4A 2ORIA 3ZHRA 2WAQF 4JKIA 3E18A 1ZHHA 5IT9A 3AEUB 1G2QA 2ACVA 5BSTA 5EUMA 1HA3A 3GRYA 2Z1NA 3LWLA 3RAGA 1RPAA 2E0IA 1B74A 3QU7A 1KJ8A 2C4HA 4GI1A 2IYXA 1Z75A 3L6OO 3PFHA 1WB4A 4D96A 4LI3X 3A06A 4B71A 3FYDA 4ZQFA 4DMLA 2EDUA 2OORA 4TMTA 1A69A 3HXKA 3ETNA 2AGPA 2C29D 1ZVJA 2ZE5A 3MINA 5COQA 1XZBA 3NNDA 2EP7A 3U56A 5JTIA 3OVMA 3LPAA 3FKSA 3LC1O 5LYJB 4PC1A 1TM4E 2GA9A 4JP5A 3B82A 1HZZC 1NMEA 5HSGA 3UXOA 2BEWA 4BQRA 3SSAA 2OCIA 4UDYX 3L5OA 3DQQA 3P0FA 1RAIA 4WJLA 4YAGA 3I5XA 4QE3A 1ZUIA 1PJ3A 5CJ7A 2NXEA 4CDMA 1JJIA 1NIPA 1NXSA 4I1VA 1JFSA 2GAAA 3SJUA 4OREX 5JMOA 2PS1A 5KT6A 3AXTA 1KS9A 3BH0A 2NPFA 4F2HA 4UE6A 4V1CA 3S7ZA 1ODTC 5T57A 2C5AA 5FA5A 4I5IA 4V0NA 5LU8A 4UJ3A 1KI6A 4C4YA 4BB6A 3QYFA 2MYTA 2PNJA 5L95A 3FKQA 3OWHA 5EHNA 4P4PA 1R6VA 2R6ZA 3QU9A 2NSYA 2FRXA 1H3EA 3IFSA 4CLRA 5C31A 3AW8A 1QVZA 4DJ5X 1DGQA 3SEFA 1BN7A 3KU1A 4EJSB 5J2HA 1RWWA 1SCUA 1WBBA 1UOEA 3E3MA 2OXTA 4NCHA 4Q3BA 5LMCA 2VOEA 3DOJA 1C9MA 5FPSA 1ULZA 2A33A 3ZCVA 3L6BA 1TI7A 1ABEA 4FFVA 4YP3A 1O96B 1WNFA 3U4IA 2LPMA 4KSBA 3ZCQA 3H1BA 2UU9B 2B6GA 3OX2A 3WRXA 1N3LA 3QHAA 1ZXBA 3ZE0B 4AD8A 4XVCA 4YASA 5ALPA 3L8ZA 5HZKA 5KFGA 2BKVA 3OY7A 3RRJA 4MFCA 2YDYA 4C78A 5LZ8A 3DMGA 4F93B 3U1TA 5KQGA 3SZOA 3TGWA 4TUYF 3LT1A 3OCCA 1TA9A 3S1LA 1VSTA 1YB4A 1P4RA 4TMXA 4J9MA 4HMQA 1XKQA 3I3OA 1UZLA 4RVUA 3MCVA 2FUKA 2I6SA 2FMFA 3BD9A 5K8CA 1NTOA 5CLGA 4PYLA 1DJLA 3LY9A 2IV7A 5JH7A 3HXQA 2G4VA 3QU5A 4W5WA 4JEMA 2WE8A 3L02A 3LX5A 4Y6GB 3ZDBA 5A6VA 5DO9A 3II6X 4MV5A 3OOWA 3RASA 3LWMA 3FGPA 3ZN2A 3ZU6A 5AI0A 3OLXA 4EQ6A 2QZ9A 2NSDA 2JGDB 3SLRA 3C7AA 4A6PA 3ZWBA 2QD2A 1WPRA 4J9PA 2PUGA 3JARB 3AEUA 2GERA 3IUPA 3Q9UA 2ZRJA 3BUSA 1U5BA 4WOBA 2AZ4A 1B16A 1QIDA 3USZA 1L7BA 3ZQJA 2QE7D 3NCTA 3KNZA 4EUHA 3AF4A 2O2YA 1GFZA 5I48A 2FN4A 3ZH9B 5K8IA 5C0YA 4Q1CA 5KKCA 4BFCA 1NRIA 2GLUA 2M9NA 4A6EA 1JYEA 4DDKA 2W9XA 4TROA 5A6SA 4OBWA 4QU5A 1K5OA 2PAAA 1J20A 1SEVA 1KWGA 4BNFA 2IVZA 2CKMA 4JKOA 4OB7A 1NATA 2CNNA 3RWMB 3GV0A 3BCUA 2E1RA 5FULA 4OUKX 3KWMA 1LVUA 5CHGA 3TX2A 1T0UA 5FUYA 2ZRHA 3UO8B 1YQWA 2I54A 4QNRA 4RANA 3GFQA 4M7PA 5EE5B 5TQJA 2BY4A 1TZMA 1TGVA 1SAYA 4ZV4A 2YIDA 1V16B 3C2MA 1XR3A 3ASYA 1NT4A 2QAGC 4G1UC 1X80A 3TD2A 3ANYB 1FDRA 4ZAYA 1TCUA 4FX2A 5DBGA 4KJXA 5JXGA 2B5VA 2E8NA 3JQEA 3LT5A 3TIIA 1G8YA 5I6DA 4O3RA 4LFAB 2YX8A 1OU0A 2XTZA 4CIAA 1N0HA 3LYUA 1KO8A 3GELA 1QNFA 3KZKA 1KO5A 1UDXA 2M9MA 5KL8B 4GPD1 3EVDA 5A7FA 2VWPA 3KHTA 1NBAA 2HSWA 2XLBA 2FJ6A 2QM0A 4M04A 4IMJB 4H6VA 3CLRD 1Z07A 3N2YA 2JPDA 2VHJA 2YMPA 1FW8A 3CT6A 3HI6A 3UV6A 3QUSA 3N58A 4L3OA 2JKZA 2CSXA 5ICSA 1S8NA 1Y1RA 4EJSA 2AHOB 4NTZA 2KLHA 4RLHA 3WZLA 2ZYVX 3TH5A 1EGQA 3NP9A 2BE7A 1T2CA 2GWSA 4ID3A 2CJYA 2J9FB 3UJHA 3CP8A 4F4XA 3TARA 1YHZA 1I0IA 1Y9DA 4E4TA 2HT6A 5DNAA 3G8YA 2QR2A 4A8PA 4BP9A 3THVA 5DQGA 4Q4CA 2H08A 4D46A 1X7YA 1O96A 4U5QA 3P9SA 1T7PA 2FRDA 5EIOA 2JRZA 1VCNA 2X13A 4NFSA 3BSYA 3CWZA 4GKVA 1A4XA 3NDJA 4LDQA 4RVGA 4R8KA 5L3SA 3SOZA 4H6XA 2JFWA 4FMPA 1G7RA 1O97C 1B4FA 1RAEA 1UADA 3VTFA 2KYRA 3GLHE 3I39X 4K46A 1XOIA 4GBGA 4S1PA 9ICPA 1DEOA 3LKZA 1CZOA 4NWIA 3L82B 4U39A 5IUJC 2FW6A 4KI0A 1DKOA 1JX6A 1SBHA 4DSAA 2EW2A 1UODA 4AUKA 4YP1A 1Z8DA 3PQCA 5JRTA 5E95A 5I7VA 1EYZA 2J8ZA 4TLLB 5CA0F 1Q95A 1JN3A 4CTNA 1L5NA 1AZTA 1QDUA 5DNCA 2LCQA 1IUNA 5TXGA 1QFSA 2FE4A 3HJHA 1JYSA 4KLJA 3PHHA 4JVOA 4QGAA 4N5IX 1RIFA 4WZAB 4ZT7A 1MPTA 3FUTA 3PPYA 3E9YA 3GFBA 3O1IC 4YCSA 3R7AA 2P7IA 4F2DA 2IVFA 2KZ3A 1E1YA 1OREA 2HRDA 3BQ7A 4RKQA 1FFSA 5E0KB 1Q92A 1BD4A 4F8RA 4IRUB 2PJZA 3VNSA 1ECWA 1B42A 5HMLA 4AICA 2JGDA 3W5IA 1DNPA 5E6RA 1IY1A 2AFHE 3JARA 3KQUA 2RHFA 2BCUA 4HNAA 3RJFA 3ZTWA 5JFOA 1JAXA 5DGAA 4C89A 4PF1A 2OV1A 3V8EA 2RGNA 3ZWQA 1II0A 3DL2A 1UAGA 2HR1A 4B5KA 3U7EB 2GYYA 1IXKA 1BCSA 3QPWA 5EIWA 4HNHA 4BO1A 4AXXA 1R15A 4C4TA 3M8RA 3Q41A 4G67A 4NS4A 2WZQA 4UBKA 4R2LA 5WRFA 4L72A 5CLLA 3UMFA 1CR0A 3PXXA 1BRTA 2OP0A 3ED1A 3GOQA 4PBSA 2Q5IA 2I1VB 4R4JA 5LU9A 3LHSA 4FLEA 3LU1A 2YXLA 4KQ9A 1JFFB 3HY4A 3CUUA 3HXOA 3HJFA 4RADA 2BP7A 2IEYA 3UMYA 2W7PA 3GF4A 1XLVA 7ICVA 1V5EA 4FK8A 1X74A 1D8YA 4NCIA 1LWOA 3PW4A 3O2JA 4UZSA 2BAGA 5FB3A 2PRZA 4K6GA 5KFYA 2H18A 1J2YA 3FWYA 2I8CA 4N0MA 5FRDA 2XXAB 4UB5A 1Y4DE 4IHKA 3ZBPA 4B4OA 5KOHA 2FG6C 2X4LA 4UM9D 4DM3A 4KI7A 1A8PA 3PK0A 1NI4B 1ZYUA 5EWFA 2G06A 1CZNA 1RAAA 3PRJA 4TTAA 3SXUB 3TI7A 3M9XA 4L9WA 1PJRA 4BRZA 4B6RA 3KXIA 1WCV1 3OZDA 7ICTA 3PUJA 4UTOA 3VR6A 5JCJD 2G83A 3D6JA 2QTTA 1OU4A 3Q7RA 2Q6OA 1LU9A 2GPTA 3EHDA 2RD2A 4BRWA 2D5IA 1NAHA 2HV9A 4Q01A 1X9IA 2PBZA 2J9FA 3M4JA 1O6FA 1GARA 3IIEA 2ZVJA 4QU0A 1XZLA 5BWLA 3LUKA 2P1DA 4P54A 1F0YA 3NV9A 2IU4A 3NX4A 4NEQA 2Z2ZA 4IIEA 4BQQA 4EO4A 2HRBA 1AMUA 1ZQZA 1JDJA 2W03A 5FUWA 3SEAA 3E0XA 2HDWA 4WI1A 1F7UA 4Z4EA 1KGSA 2ASLA 3BAZA 4ECSA 1LBSA 2WC1A 5ITZB 1J8QA 2HSEA 3EQ6A 3UJPA 3GEHA 4WLFA 4UDOA 3ZE2B 2PV0A 2QK4A 4DDTA 4ARIA 3AJ9A 2ZITA 5GJWC 2GUWA 1ZQPA 3HDTA 5C7YA 5EFZA 3FD8A 3BD6A 4RZUA 5IG2A 2VP4A 4QOIA 1OAOC 3OOSA 2I9GA 3SWWA 4QW9A 4L4XA 5B1HA 2VTDA 1WM1A 3L8FA 3DC7A 3GEDA 5J2AA 1O6BA 2A9OA 1VJRA 3GUCA 4BC1A 3AR9A 3EBOA 2XHEA 4ZVKA 3CX3A 3UTDA 3KKNA 4PC3A 1TKDA 5IJ9A 1NMXA 3DE6X 2JEIA 2BFPA 5DXFA 1X1TA 1RXEA 4PYQA 1Z0DA 2R6JA 1Z4IA 3G5UA 1SHKA 4M8SA 4J0GA 2ZI5A 3E7DA 5AOBA 3DAPA 2W0MA 2VPPA 5FTWA 2VQDA 4TLAA 4MTLA 2W54A 5B1SA 4F60A 5AW5A 5IBRA 3JR7A 4X1YB 3BK1A 1P0FA 5IIMA 3MAJA 4ZZIA 2ZYGA 5AW8A 2V6IA 4DIDA 3QX3A 1YK0A 2B83A 1CUJA 1PKEA 4R63A 2C4WA 4G09A 4LPSA 3BMQA 4DEVA 4KYTA 1RXWA 2B4KA 4JSYA 3SDSA 3PFNA 4JJEA 3ZHZA 1XO0A 4KQFA 3ROQA 3ZXSA 4N5MA 3RTCA 2ARKA 4V38A 3EXHB 3VR5D 3NHUA 4NE7A 4JL6A 5GQSA 3WGVA 3P71T 5IIKA 1SWVA 4JB3A 4TXHA 4HDKA 1UQVA 3KJGA 1JFFA 1JWBB 1N6HA 5IKMA 4PFJA 3TMAA 5K6TA 2EV9A 1Z4LA 2V96A 2Q1TA 4R7GA 1YR2A 2IHVA 3ZI7A 4QBTA 2R8YA 3B1YA 3KLMX 4XRRA 1T0BA 1H1LA 2PANA 5A1JA 2HPAA 1U9YA 4EP1A 3I0NA 5E9JA 4JQCA 2QBYB 2QF7A 4JS0A 4CF6A 5A02A 1NBOA 1UDWA 3LO5A 4C22A 1IC6A 3HYNA 1JKFA 3DLHA 1UPTA 1Y1TA 4TMWA 4ND3A 2O23A 3BORA 4K86A 3C5FA 2ID9A 4CMCA 2R8JA 1P6UA 2BGRA 3PSHA 4Y2TA 3DZJA 5FUBA 4KDRA 4YNBA 4LQCA 3QUTA 2GBCA 3CZ4A 3MLEA 2VO1A 1GZHB 3HBLA 3A32A 4HWRA 3GC6A 3GGDA 1ZEJA 5P8WA 4REQA 4F21A 2YY7A 3PUHA 1OBOA 1E5LA 2VPZA 5DLPA 1CW2B 2PZAA 3K32A 2R7KA 5FPTA 4CNBA 3THYB 1DX9A 4CCSA 3R0XA 3IILA 3NHYA 2GHTA 3OF5A 3D59A 4HUQB 4M22A 4JFRA 1N9GB 3AQFA 5I7HA 1RJGA 2W42A 4G2TA 3LL7A 4I1UA 3DVSX 3GP8A 2NNLD 5EMKA 3TQCA 3JQ9C 3CTPA 4N4AA 3B0YA 3K0EA 5KINB 2ADFA 1GVNB 1H4TA 4QPPA 1FX1A 4LHVA 4QQNA 3QY0A 4GLXA 5B7NA 4U7WA 5J2CA 1E8DA 4PRKA 2Y68A 5LKRA 3RRBA