2WF5A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and trifluoromagnesate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf5A01
4UM7A 3OCYA 4L57A 2ZOSA 2W4MA 4Y2PA 4IG4A 4BX3A 3MPOA 5ALFA 2WFAA 4Y2QA 1N8NA 3MC1A 1Z88A 3ZUPA 5ALJA 2OYCA 4HGNA 3QXGA 1ZD5A 5ALUA 2ZG6A 2IYEA 2G06A 3U7GA 5AKIA 4FFDA 4GIBA 3ET5A 4XQ0A 4RESA 1YNSA 1WVIA 4UU1A 4HGPA 2HSZA 3L0BA 2P69A 1AQ6A 3U7EB 4J2TA 1WPGA 1SU4A 5AW9A 1X42A 5AI0A 1S8OA 5JJBA 2BY4A 4G63A 3SMVA 3UMCA 1IWOA 5AVWA 3WK7A 3AR5A 1SWVA 4F71A 3U7HB 3EPRA 3R4CA 1QH9A 3E8MA 2ZBEA 3BA6A 1Q91A 5AI4A 1JUDA 4MUMA 3EF1A 3DV9A 5AI9A 3OCUA 3KOOA 4UAUA 3L0CA 3L5KA 5ALOA 3AR3A 3WK5A 2I6XA 4YIHA 4Y2UA 2FUEA 3QU7A 3WK4A 3WKDA 2VKQA 1Z4MA 1EK2A 2PR7A 2GMWA 4YIKA 5AVZA 1L6RA 2G80A 2WF5A 5AW6A 3ZTYA 3L7YA 1XP5A 2EAUA 4OFZA 3NIWA 2C8KA 4IFTA 4FE3A 3AR2A 3ZVLA 3L8GA 3ZWDA 1NRWA 5AVUA 1QQ6A 2YJ4A 4EX6A 4Y2YA 1RRCA 2RARA 1Z5UA 2PQ0A 3FZQA 4YGYA 2CFTA 2P9JA 5AKLA 4XOUA 5AVSA 4G9BA 3WKEA 2HF2A 4BX2A 4GXTA 4JDPA 5AVRA 2QLTA 1TJ5A 2NYVA 2YMLA 2YN4A 3OCXA 1U2SA 2HX1A 4C4RA 3L8EA 5E0OA 2DQSA 3KBBA 1CQZA 2WF6A 1L7NA 2HDOA 2R8ZA 4UW9A 5AKKA 4CF5A 1TJ4A 3UMGA 5AW5A 4YCMA 1TE2A 1ZD4A 2HO4A 2HI0A 4UAVA 1U7PA 1Z4KA 1WR8A 4BEVA 1L7PA 4EENA 1RC8A 3I1YA 3DAOA 3R09A 4HAIA 1YV9A 4C4TA 3QLEA 4C4SA 3HLTA 4HGOA 2X4DA 1L7MA 5AICA 5AKZA 4EEKA 3A1EA 5AK3A 3F9RA 1VJRA 5AKYA 3WK6A 2YJ5A 4HGQA 1NNLA 3P96A 2G08A 3PGLA 4MWOA 3I28A 2YMMA 3SLRA 4KNWA 5AKHA 1NF2A 2ZBFA 4UARA 2YBDA 5ALIA 1T5TA 3PGVA 3QX7A 1RLTA 1RKUA 5AVYA 1ZRNA 3NALA 1Z4PX 2EARA 3QU9A 3L8FA 5ALEA 3ZI4A 3WK9A 3L1VA 2Q4TA 5ALHA 1ZD3A 4CF3A 2FI1A 1L8LA 4OD0A 4KX5A 3A1DA 3BWVA 1RLMA 1Z4JA 3QU5A 3FVVA 3QNMA 5ALKA 3ESQA 3NUQA 2RB5A 4BYGA 2CFRA 3SKXA 3S6JA 3ZTWA 4I9FA 1ZRMA 2JAWA 3N28A 4RETA 4L6CA 3PDWA 4QQFA 2CN1A 5AW1A 2FPXA 3ZWKA 4NV0A 4DCCA 4KNVA 4PNHA 2I7DA 5IT0A 5ALVA 5IS2A 4L6AA 2EATA 5ALTA 4CE6A 4Y2RA 2Q4RA 4NFLA 4AS3A 3HYCA 5AM4A 2B82A 3OPXA 3W5BA 2G1AA 1Y8AA 4YCLA 1VJ5A 3U19A 3E84A 2FPUA 3I6BA 5ALGA 4AS2A 3U7FB 2I33A 1Z4LA 2YFYA 3ZX4A 5AK5A 4ZEWA 3RF6A 2NO4A 3W5DA 3SHQA 4DWOA 3NRJA 2OA0A 4AP9A 3ESRA 2HCFA 4EZEA 1TA0A 2YY6A 3QUCA 3OCZA 1O08A 3AR7A 5AIBA 1RQNA 1RMTA 3QUBA 5AVVA 1XPJA 2C8LA 3D6JA 2Q5EA 4UU0A 2OBBA 4I9GA 4HYTA 5AW3A 4E88A 3U13A 1N9KA 5ALMA 4Y2TA 2HOQA 2R8YA 2HF7A 2FPRA 2ZXEA 1RMQA 1QQ7A 5AW4A 5AM0A 3QGMA 2WF7A 1EK1A 3WGVA 3CNHA 5AKXA 2FPSA 5AVXA 2B1QA 1ZOLA 2WHEA 3B9BA 1LTQA 1RPZA 5AHXA 4KX3A 3QUTA 5AI6A 4CF4A 4UMVA 3RFUA 2W11A 2MSNA 1Z4QA 2JARA 2I54A 4Y2VA 3MMZA 1PW5A 3SF0A 1Q92A 1TJ3A 3OCWA 1YDFA 3FPBA 4NABA 5A3SA 2IOFA 1S2OA 1ZD2P 2O2XA 2JAUA 2QYHA 5AI8A 4BBJA 1RKVA 5ALLA 5ALSA 2MU1A 5AM3A 3J7TA 3UM9A 5AESA 3N07A 4UATA 2WF8A 2B1RA 1QQ5A 4UASA 3R9KA 2IA5A 2O9JA 5AKGA 4F72A 3K1ZA 4ZEXA 2G07A 3W5AA 1Z4OA 4Y2SA 1L7OA 3FGOA 4UMFA 4XE5A 2R8EA 5AI5A 2ODAA 4B6JA 5AVQA 2GHTA 4YCNA 1U7OA 5ALPA 4NAVA 3L8HA 2NO5A 2AUTA 2D2VA 1SWWA 2P11A 3AR9A 3SD7A 4UM5A 1YMQA 3EWIA 3WKAA 2AH5A 1L8OA 5AK6A 2GHQA 2CFSA 5A3QA 5AKEA 5ALRA 5AM5A 3ET4A 3CZ4A 2YMQA 2C9MA 2P27A 2RBKA 3KD3A 3ZVNA 5AM1A 4CNQA 1J97A 5ALNA 2C88A 2RAVA 3A3YA 3IB6A 3NAMA 5ALZA 2B0CA 4EX7A 3IJ5A 3M1YA 5AK4A 3QUQA 3KC2A 3N8GA 3QU4A 4Y2XA 2BDEA 3KDPA 1FEZA 5A3RA 3NANA 1KYTA 5AVTA 3PCTA 1RDFA 5ALYA 3AR8A 2JAOA 5IT4A 3FM9A 3DNPA 4BNDA 1J8DA 4FYPA 4UMDA 3QU2A 2G0AA 3EF0A 4Y3UA 5AW7A 1K1EA 5ALDA 2FPWA 3WKBA 2R8XA 1YS9A 4KN8A 5AW8A 3FPSA 2YJ3A 3ZU6A 3ZVMA 5ALWA 1Z5GA 2B30A 2B8EA 2B8JA 2ZBDA 5ALXA 3DDHA 1RQLA 4J03A 5ALQA 2BDUA 2IOFK 4H1WA 1CR6A 4DW8A 4JB3A 4BX0A 4HGRA 2MU2A 1T9ZA 3ONNA 3UMBA 3N1UA 2IOHA 3SKYA 3MN1A 2YJ6A 3L0YA 4XPZA 3ED5A 4Y2JA 3U26A 1U2TA 2FEAA 1QYIA 4BKMA 4BEWA 3WGUA 2JGAA 2YMPA 4O8CA 1Z4IA 3NASA 2AGVA 4DFDA 2WF9A 1O03A 3WK8A 5AW2A 2HEGA 1RMYA 5AIAA 1U02A 3OCVA 3E81A 3VAYA 3A1CA 3IRUA 3ZW7A 4ZEVA 1T5SA 3B8EA 1MH9A 3GYGA 2G09A 4BNDB 2OM6A 5T41A 5AM2A 5AW0A 4OCZA 3L1UA 1VFPA 2ZBGA 4KYTA 3TLMA 1ZS9A 3B9RA 3N5KA 1ZJJA 2HHLA 1WZCA 2AMYA 2W43A 1F5SA 3AR4A 1LVHA 1RLOA 1YJ5A 1XVIA 2PKEA 3WKCA 4YH1A 3ZX5A 1Z4NA 2WM8A 4QJBA 3KZXA 3M9LA 3QYPA 2I34A 2GFHA 4UMEA 1RKQA 2FDRA 3OTQA 4NWIA 2GO7A 5AKJA 2C4NA 3I76A 5FP0A 3E58A 3W5CA 4EELA 2FUCA 3AR6A 2I55A 4OHFA
chains in the Genus database with same CATH superfamily
4I0WB 3DVAA 4Q1VA 4UUAA 4X1KB 4HRYA 4Y6PA 3RAJA 1QLHA 3TNLA 4PPFA 3M9XA 1KZHA 4B9EA 2FPPA 2J6BA 2XXAA 3EUB2 4NYMR 3T54A 1HLFA 2HT6A 3I2FA 5A5GA 3GRPA 2Z5VA 1SU6A 3HHPA 3OOEA 3PT5A 4FYXA 1Y6GA 2O7VA 1NHWA 4HPWA 4O5CA 1CIJA 1RAGA 1RT9A 1PD0A 4I50A 5KFDA 5J43A 1V3TA 1SK8A 3MTBA 4CUZA 2HFKA 3CG0A 1TXGA 1M76A 3CV3A 2J32A 2B8NA 3E9EA 3LK6A 3NEAA 4BDTA 2KZZA 2EW8A 1W0JD 1ZQ1C 3OM1A 4KW7A 5JCZA 2IY9A 3II6X 3C43A 3C5FA 4LY3A 5FR2A 4I4TA 3UWDA 2NACA 3OEHA 2A0XA 1F0NA 3WLEA 1WBBA 2QUZA 1LKYA 4QXRA 3OJFA 2H2WA 1XD9A 3NTLA 3H75A 1R6VA 3R3ZA 1L3SA 2HFJA 4R8UA 1AXEA 2X15A 1I0IA 2WR8A 1X14A 1XC7A 2C3OA 3PHCA 1N2XA 4MUAA 1O5OA 1XZJA 3P2MA 4G63A 3RGWS 3UJ3X 1BWSA 1A4XA 4QOIA 2XMCA 4DUPA 2HT1A 4O3OA 1TAMA 4TMKA 5LZ9A 3CNBA 3REQB 2GB4A 1LKYB 2EANA 2GN8A 4H9GA 5KFRA 3P0IA 4X41A 1YB1A 2GN4A 2NVWA 4ZP1A 4E0BA 1B0UA 3P0HA 2I91A 3DDNA 1K89A 3F5MA 4EY8A 3ACBA 1DS6A 1AK2A 1Z18A 1CJTC 1KK0A 5KNBD 3GPLA 4OJPA 2Q4BA 3E2IA 4Q43A 4AKGA 2CLOB 3NRCA 2G70A 2GJAA 3C16C 4FZVA 2ANBA 3DBIA 3KSMA 4EWLA 3CNQS 2DT8A 2H3HA 4JLUA 4NECA 4CTOA 5HNKA 4Y7CA 4UC0A 4A8HA 2JAQA 3ENNA 3JWPA 4I4TF 1J42A 2VF7A 4OQNA 5CGQB 1XD8A 3RWBA 2PUJA 2RGRA 2R4UA 2GLUA 2A7QA 1DG1G 3ULKA 4GBMA 1RADA 5EVCA 3R3JA 3TVTA 4G25A 1L6RA 5EIBD 5TGZA 2K6GA 2O4UX 3GAFA 1NXPA 3VBEA 1S9HA 2QDKA 3OP1A 3SJCA 5LWQA 1IMOA 3CC8A 2DBZA 5DVZA 2RIPA 2Q27A 2VWPA 5SZHB 2HPVA 1JQAA 1O89A 5ILQA 2ID4A 1VE3A 4QZ9A 3G23A 5CHYA 3V34A 4ZFNA 3D7SA 1HH4A 1VB5A 4FKMA 1LBIA 2HHWA 3K2EA 2GSDA 1YDGA 3OTGA 3DZ8A 4C0HA 2A0YA 2Z6QA 3CLKA 1DV2A 8AT1A 5CB1A 3FTEA 8ICZA 5KFZA 3QY9A 5J58A 2YXPX 1U9LA 1T43A 1XEXA 2WG0A 5AKLA 4YQYA 5IG2A 3L0IB 2V58A 1QVWA 3UGKA 1OBOA 3BIWA 4BVBA 2UXCB 2OCKA 5AQ1A 3BH7A 1EFPB 3R2JA 1JTVA 1XQVA 2VIIA 2VHWA 1BQ3A 5AVRA 1P0QA 3U39A 5DG8A 1X7ZB 3PC7A 1RM6C 4YTEA 2FQ1A 2R00A 4ESOA 1X1EA 5JJLA 3DAPA 3PQDA 5KFIA 3S2UA 1WD7A 5E6SB 2QE7A 2WPDA 4WLFA 1K8YB 5LQRA 1O0CA 1MDFA 1Y0BA 3FPGA 4KMRA 2C59A 1U2SA 1ODKA 2X40A 2AJDA 3A6GA 4L75A 1FCJA 2WILA 1SU8A 3FNFA 5FNZA 4EUEA 1H4TA 4U3JA 3IOBA 1GTG1 9ICAA 1FE8A 3DE0X 7ABPA 2NXNA 3DHVA 4QUIA 1MZPA 5I5GA 2DUJA 3MTIA 1C9KA 1B42A 1NUHA 1H0SA 5DM0A 2CMDA 4WV3A 3ZOKA 1VPTA 3V8QA 2XI9A 3KZMA 3BSWA 2CDCA 3AUFA 1EVJA 1ZD4A 2QU7A 3WLTA 1KMQA 1IY1A 1K88A 1TD9A 4BO1A 5B1YA 1XAHA 5CITA 1ZEJA 3STHA 4ZCIA 1JWAB 3EVAA 4IEIA 3I8OA 1GQSA 4LDQA 1YU6A 3RSLA 5BMOA 3NVYA 1NUUA 1ED1A 3D8UA 1L0BA 8ICFA 1H1LB 1U6KA 4MRVA 1Q2XA 5BQPA 2X4DA 5A0LA 3E61A 2J6CA 2FFRA 1R4MB 4G65A 1U0FA 5C34B 4B6OA 1U7TA 3NOVA 3AY6A 4Q3KA 1A96A 2IUUA 1DRGA 4YXWD 3U1BA 2UU9B 4R71A 3EMDA 3N6XA 4ZT3A 2V8OA 1RQGA 2CF5A 1CEZA 1E58A 4TYQA 5DNDA 4E5VA 1N5JA 3F71A 4XDZA 1VMDA 4OHRA 3NM4A 5G02A 3OZRA 1V1MA 1R50A 4HYYA 2ZSJA 1FPQA 2NYRA 5A6SB 1NMZA 3KIPA 5F1OA 3UAXA 3M9OB 1VKHA 5IT5A 2AFIA 2W6PA 4R66A 1TGYA 1LH0A 2ZSEA 3Q12A 1RKUA 2YXEA 4HPXB 2OC9A 4RXTA 2VUUA 4AMZA 1XHEA 2EARA 2VZEA 2P2YA 4N5DA 3ZHOA 4RXMA 2DCMA 2AL7A 1XRRA 2EKLA 3GJRA 4B47A 1SVKA 3DDUA 4EJMA 3IQWA 1EWYA 2CLIB 5KFJA 1MR3F 4X8LA 1CZHA 4Z8XA 1P3Y1 1KYQA 5EIOA 5U1PA 3ZBUA 5A5DA 3K4GA 3KHLA 3FG9A 4C4PA 4CV2A 2CLKB 1GA6A 1VHWA 1D8LA 1DXHA 2FK8A 4I3FA 4DNQA 5JECA 3PW5A 4Q9LA 4G89A 3ZD8A 4RTKA 1E2HA 5ARBA 5DM60 4EHDA 1C4KA 1GAQA 1BE6A 2B25A 2C4HA 2CN1A 4JZKA 4O08A 4QQFA 3WNQA 3EXHC 3AFIA 4ZA2A 3FAHA 2F76X 2BFDB 4OP1A 3NBQA 4C07A 3PC8A 5JZOA 5LP6F 4HUQA 1RZRA 4P53A 2R9VA 3B5EA 1NV8A 4YRSA 2GVNA 2B7BA 3ROKA 2XWPA 5A4MS 4HBZA 1JHRA 3VYSB 4KQXA 3UXMA 3X44A 5BY2A 1B2RA 3DL0A 3MK31 1LJUA 5JEEA 1PJ2A 2G9ZA 4WPGA 4AIIA 1GL9B 4IO0A 4RDIA 4RABA 1E3IA 3ICVA 5KOJB 2BFEA 4MV6A 5TQJA 4D42A 4CKEA 4WK6A 3V6JA 4J3NA 3TZEA 1J9GA 3CH7A 2D1YA 1A9ZA 3RJ9A 1KDRA 1I0ZA 2VF4X 2BIFA 1L5HA 1OLSA 2Q6VA 3MWKA 4XUDA 3UJ8A 2GVDC 5ITZA 3KU4A 2PZBA 3QWHA 2FVXA 3HEAA 1GKKA 1S4MA 2CCGA 3C8MA 7YASA 1AU9A 1X3LA 3CW8X 3NBFA 2HBZA 4WN9A 4EATA 1OH7A 1PV2A 3FCAA 1DIOB 1BNPA 2RC6A 1SOVA 4DF3A 1XKLA 3WZMA 2B9EA 1IBKB 1ABBA 5LCXA 1N75A 2OA0A 3RVOA 5GONA 1IVYA 1IOVA 4HRAA 2YY6A 4QAJA 4X97A 1NURA 4EUKA 1O4VA 2G82A 4MUNA 3W1EA 1MAUA 1UXOA 3PVCA 4LI3X 1O08A 1Z12A 4NMXB 4R2MA 5FEMA 5HFJA 3TSYA 5BQXA 1NE2A 1O54A 1PZHA 2I9PA 2V7VA 2Y2UA 3LGSA 2B4TO 3HKDB 3OFVA 3QHPA 1SBYA 4KPGA 2I7CA 2CD7A 1DEKA 4IIBA 4P32A 2ZREA 1ISPA 2AC7A 4OIFA 5DW3A 3KHRA 4MEXA 1OR8A 1Z7GA 4NDZA 4N7JA 5HKLA 1DXYA 3W34A 2LRHA 3GX1A 5DPMA 3RIEA 1QCYA 4BE4A 4ND8B 3CUSA 4DIOA 3LXRA 2A5GA 5I7OA 2XMGA 4O2AF 4WZ6A 1KNQA 2BH9A 1E1KA 1HSOA 3VKGA 1JG3A 1LPSA 3EG9A 3JQEA 3QVJA 4DV3B 1LX7A 1YKFA 1ZL0A 1G98A 3HMQA 3WL6A 3FWKA 4B4WA 4B6EA 4CIYA 2NO7A 4M2LA 5HPYB 3R5SA 4ZPXA 4CM9A 3R75A 2ZB3A 1Z68A 3FMFA 3OG9A 4UNNA 3CTMA 5CA0F 4YT8A 1W30A 3TDNA 2PZGA 1D03A 3EXFB 2ZUEA 1EFRA 1BMDA 2C2GA 2FUKA 4QWBA 1MPXA 3Q2KA 4OTZA 4W7IA 1QBKC 1T3QA 2CBXA 2QZZA 3F2VA 3PX3A 1AK1A 3AU9A 5J9FA 3BMOA 3U17A 1T6XA 3V97A 5BN1A 1JEQB 5AI6A 3HFSA 1QSYA 1RIIA 4FBUA 2J0UA 4YYEA 5KDDA 2W11A 3N2KA 1AKUA 4AJLA 2I54A 2V45A 1ABEA 3MT7A 4K6HA 1JIKA 1K7EB 2XUFA 2ZK7A 3OZAA 3RRZA 1KZ9A 2DP4E 3TMYA 3UH0A 1Y63A 2DHRA 4FYHA 4FMCF 4EHFA 3N5CA 4HADA 3DL7A 2ORVA 2QZPA 3GA0A 3KXLA 4JVMA 4K88A 1WF6A 5F3RA 2Z5GA 4KVZA 3CPHA 3RVDA 1C3LA 1I5OA 4CW7A 2E5SA 4EZIA 1HNZB 1QH1B 1VLZA 2ZQZA 2UUCB 3AVTA 1LDYA 2EBUA 3SSMA 2KE7A 4ZMRA 3AU2A 1AGNA 1C81A 1CBUA 1KL7A 1RHUA 2PFKA 3OX1A 2NRXA 4ML3A 1E2FA 1Y9AA 3E05A 3VC2A 4O5OA 4RZ3A 1SB9A 1W5FA 2XADA 3G2OA 4ETIA 2NP6A 3LPMA 4XR9A 4MS4A 5BV8A 3O90A 4G36A 1FTYA 3GUUA 3FGOA 4UHBA 4ZWNA 4Q34A 1LBTA 1BFUA 3WGMA 1LX6A 3NS1A 3EZFA 4MR8A 1YE5A 2V4UA 4TWZA 2YWRA 4X93A 4PN7A 1O9GA 2CNNA 3KYCB 1NZDA 4IQFA 1QZ3A 2DR3A 1W47A 5DHFA 3KV3O 1GCOA 4UDYX 4DWJA 4K6KA 5JZVA 3RF7A 4IQ4A 1OC2A 3O8CA 1ATIA 5KT5A 1Z7WA 3ABIA 4P7GA 3NIFB 5LXTB 2R97A 4FK8A 4BAUA 3HRHA 1FQOA 2YZNA 1JYEA 4KFUA 3EXEA 1F2TB 4NJMB 2VFAA 5FYDA 3WKAA 3SQIA 2CUNA 2PRZA 3FDZB 4KO3S 4N8DA 2ONJA 3OZDA 3H9QA 1LA2A 4KLRA 2WVJA 2OB1A 1ZQXA 1WNTA 4MVJD 1ZJ5A 3WWYA 3RFTA 1Q95A 2OE2A 3H3XA 5M3BA 1AGYA 4XQEA 1HUQA 1N5KA 2DKOA 1X7YA 5JSFA 2RAVA 1VLLA 2G88A 3N58A 4CMIB 4OQYA 5T6BA 1SIUA 4F5ZA 3VNAA 2XJ9A 5F78A 3X1MA 4I55F 3DLBA 2BAGA 4K9DA 4LHSA 1ZQTA 1PYOA 1JEAA 1KKLA 1FOEB 2FRXA 1PGQA 3X2EA 3ZDBA 1FVXA 2XQIA 1V4VA 1ZI9A 2KHQA 1JRPA 1JW9B 2AQ0A 4WFQA 4CRWB 3GRCA 2AEJA 4EHNA 6REQA 4K1XA 5CHEA 2RGUA 5FPTA 4TLAA 2HHXA 1F60A 1MENA 1W5AA 3JATB 1WU7A 1ZGGA 4U4AA 1TO1E 1FP6A 2JIMA 4J94A 1BKYA 2D8MA 1XMXA 2DTDA 1UDRA 3RRMA 4EHBA 1WXGA 3DMHA 3PXXA 2ZCVA 3HLKA 4NCBA 1FFEA 2QKYA 1WMFA 1CUJA 1E1RD 2EL9A 4HUJA 4LQ4A 3DZGA 1Q22A 2ZRLA 3TNDA 3ZVMA 4LSZA 1ADGA 1P75A 1FNCA 1GNQA 4F5RA 4CG1A 2UVRA 2YQ4A 3C74A 4P2BA 1BXKA 4R8KA 1JHPA 1D8TA 3B0XA 1NLFA 1R8SA 4PM4A 4BX0A 1TLFA 1LFAA 4PZZA 4E0DA 1Y4SA 2OCXA 5IK2A 1FSGA 1CHDA 4HN2A 3L7JA 4O4JB 1SBNE 5JPCA 2ZTSA 1COKA 3Q7IA 4FGZA 1MC4A 3MJVA 3HCBA 5TRTA 3BQ7A 3L0YA 2C82A 2XWSA 4P3PA 5EXTA 3FZNA 1GYQA 1XAJA 2Q21A 1JBEA 1B93A 3NUZA 1CUXA 1GPH1 3A70A 3V4SA 4AXBA 1QYIA 4Q37A 4CODB 1KVQA 2BZSA 2OPHA 4DM4A 4YALA 5KYUB 3QNWA 5KKCA 3V80A 1ZWKA 1A9XA 1ZIPA 2IYLD 4O8CA 5FNVA 4KVFA 2HVHA 1BAPA 1UMBB 2P8JA 3PHHA 2JFBA 4OXQA 4R3NA 3RABA 1AV6A 3JR3A 1QSGA 5CPFA 4D3XA 1QH8A 1RYSA 1QX4A 1EHYA 1NRJB 5KT7A 1IFXA 1Z0AA 2MMCA 2P3SA 2P75A 3H04A 1TF5A 3G2KA 4P7BA 4F45A 5C35A 1T5SA 4L4SA 4RMIA 2BSXA 4YP1A 1M7BA 2L0XA 4B3MB 1PJQA 2DWQA 4DQSA 2GK3A 2N3ZA 2OM6A 3QBEA 2FE9A 4TVOA 1SCAA 1QHHB 2I2AA 1SB8A 2J9YB 2WHRA 2ZZKA 4ROTA 5JSZB 5K0CA 1G5IA 2G17A 3SNHA 4OCZA 3T5AA 1B1AA 3CYFA 3C3BA 5EGNA 1R0WA 1LBQA 4B9MA 4YUZA 3TLMA 3FWYA 3G9XA 3N5KA 3RVQA 1G5FA 3TTXA 3ZE9A 3QKRA 1GPJA 4IJKA 4ZTBA 1BSVA 3QEBZ 1QRAA 4OFBA 4R2HA 4YQEA 3WLOA 4CJXA 4E2FA 3AR4A 1N48A 1G8JA 1RI1A 3E7FA 5DP1A 3LU1A 1HEIA 2V7TA 5LYYA 3MUFA 2PDAA 2ZI5A 4MA5A 5JZBA 2ZDGA 3F5FA 3GDHA 1OU0A 4L8VA 4HNGA 2O3UA 5J8YA 4PX9A 3DZFA 1P0PA 1XSPA 1A5TA 2J9FB 2AJTA 4WGGA 2ZAOA 2BCSA 5FWYA 5HJ5A 4Q39A 3EDMA 4YBRA 3PFNA 2W93A 2YOHA 3E58A 4CKZA 1GUDA 3TIXB 2DHQA 3AI2A 2BH2A 1LQUA 4BV8A 4Q45A 1IHPA 1ICEA 3MJSA 4KACA 1IUKA 1Q3VA 5C8XA 3WG9A 1ZHOA 4MDFA 2IHZA 4AL4A 2W9BA 2QENA 3FUXA 5G1PA 1EFRD 2DPXA 2DBQA 4URUR 2WFAA 1W36C 5HRCA 1DJOA 4U7PB 1V8FA 3DMGA 1QAMA 4ZVRA 3TQCA 4DY4A 2JD1A 3H1GA 4JT8A 4IIGA 2V9WA 1E2MA 2OSBA 2ZFUA 2AC2A 3IPXA 3L8MA 3MTDA 3U31A 1T0IA 6LDHA 1SEVA 4YRNA 3GCDA 3IOEA 5F4BA 3EFEA 1YFLA 3LXMA 3CNNA 1C9EA 1OF1A 2B94A 3HJCA 4BB6A 4DA9A 4TTIA 1GPUA 1S6YA 2FY8A 4WZBA 2XI4A 2GYUA 4GIBA 2H85A 1ORTA 4HMPA 4L8GA 3DXZA 1QWSA 2VCYA 2R6CA 4MGZR 3WLNA 3C5CA 1GNLA 5JO9A 5T3UA 3WHIA 3MHTA 4LHXA 1WHTA 4E4RA 1UANA 1PFQA 1PJSA 4HGPA 1PVDA 2O7QA 1P39A 2Q46A 3Q8LA 1QFJA 5HYVA 3S70A 1DQNA 3E48A 2XTJA 3AEUB 3F8SA 3RS0A 1TW3A 3QBJA 1DXQA 5ED0A 3I39X 3CZAA 2VHYA 4OA8A 1GG5A 4XGRA 2GOLA 2NTVA 2PO7A 3ISJA 5EOVA 5HTKA 5AW9A 3Q9SA 5DHSA 3N8KA 1JDBB 1WMAA 3WGYA 5KFPA 4C03A 3AERA 1I3LA 1RYBA 3V5NA 1G6Q1 3NG1A 2FYTA 4HVLA 5JHHB 4QYIB 2IXAA 4EARA 2NP7A 1YASA 3W2HA 1G4AE 1SBTA 2VATA 3RUHA 3K6SB 4NMWA 1B8NA 3BSFA 5COBA 2QT9A 1CW2B 2HZBA 4D9NA 1OZGA 121PA 1U3FA 1NVBA 3VTAA 1Z73A 5FEUA 1QGAA 1U3CA 1KIMA 1UBLS 1QNLA 3LVRE 4J75A 4NJOA 1UM9B 4ON9A 4Y0NA 1XZ8A 2GEKA 3KOOA 3HVIA 4NHEA 3V4OA 4BWGA 1TEZA 2CUZA 1H8EA 2O05A 5KTOA 2P2CA 2JIDA 4MQUA 1D6JA 3EIXA 3IPCA 4UUMA 1I7QB 4Y2UA 3IKLA 2R87A 4ER6A 3BSSA 3WFIA 1K7SN 2O8FA 4K28A 4NQRA 4IQ0A 1OTXA 4DAEA 1MH1A 4BJHB 4Z7QB 1QDLB 2QTTA 2DGDA 2GMWA 3L6DA 2OLJA 4O0MA 4GP7A 2G80A 3JPRA 2X86A 4XM0A 3FZGA 5HJ7A 3BE8A 3NAGA 2C0CA 2QM7A 4LXUA 1SKSA 1EK6A 2KE5A 1JH9A 3C3AA 4M9QA 1XRMA 4E5YA 4OQLA 4DMUB 3NIWA 5DG9A 1F6BA 3CONA 4IFTA 1QHHA 3TXXA 1TO2E 4D79A 4WZAB 3BMQA 2FQXA 3UCEA 1TYZA 4ETMA 4AG3A 4JJEA 4DABA 3BIOA 1LC3A 4R1SA 5DN6D 3EEOA 4CN8A 4URYR 3QPVA 1INLA 1IOLA 4YS6A 2XUPA 4DBLC 1KZYC 2RARA 5MN6A 3PQ8A 3ON5A 2ZPUA 5J4HA 3TE7A 1GV0A 2BCGY 2FCRA 4JA0A 5AVSA 1D3AA 4TXHA 3OSUA 1MAWA 2DJIA 2WJGA 3NVVA 2D7DA 1E0KA 1R6XA 1USIA 3EZXA 3RSZA 4YRZA 3TRKA 2OO7A 5DFAA 1M2VB 1SNYA 2IXBA 4GOND 3FJ1A 3RJTA 1JVBA 5BSMA 3U7QA 1EVQA 4JJKA 3FUVA 4UVDA 1SELA 4MS3B 5CJPA 1HUZA 3D0KA 4GF5A 5E4TA 2OXIA 4UB3A 1N1MA 5CFQA 4UEKA 2PS1A 1IQ0A 2QW1A 3MERA 1TM2A 3VU3A 4QDXA 1EHIA 2X5XA 3SQLA 2BTQB 1YJXA 2JIBA 3VRHA 2OG1A 2CT8A 1KY3A 4CV1A 4FZLA 3FRJA 2P9TA 4IMRA 1T2NA 2K8AA 2PO5A 2XA2A 2DQSA 3E22B 1RJGA 3IHWA 3KBBA 1CLUA 5K51A 1EAMA 4S1NA 4K9QA 1UK6A 2VEOA 1F4VA 2QD1A 2P77A 2ZUWA 3HXLA 3UJAA 4ZTZB 1PGJA 4DJFC 5GZ1A 4UW9A 1D8BA 3IQZA 2PU7A 4CF5A 2VJMA 3PNPA 4TLBA 1IXKA 1UZLA 5E3JA 2A0KA 3W05A 4EL5A 3K7EA 4JC8A 4U6PA 4HQRA 4YCMA 4RORA 3LHIA 3ZHSA 2UVVA 3FSGD 5IIKA 2FK7A 3MUEA 3IR6A 1RZ3A 5AJUA 3U5TA 1ZH0A 3EASA 4D4KA 2ZTDA 1Z36A 2IT1A 4A73A 2JGJA 2VSNA 2VYCA 3QIVA 1GIAA 1NOJA 1C20A 2W2KA 2ZXFA 3SHTA 2VH5R 3WYGA 4D0NA 4QDOA 1U94A 1BMFD 2BFDA 2Q5OA 2QGZA 1FQWA 1N5OX 3B3FA 3HB0A 3OZVA 2HQOA 3H5NA 4HGQA 2GLEA 1G17A 2JLWA 5KFQA 4N0PA 1U3WA 1FDWA 4HH4A 3EBOA 2VO1A 2HY7A 1XL1A 2BEWA 1TFRA 2GAIA 2VXBA 1XA0A 1ZY2A 3NU1A 4KE9A 4ZK2A 4OXKA 4R1PA 2PSHA 10MHA 1ZJNA 1ZONA 1G5PA 2FR0A 1PK8A 2PGJA 4KNWA 5H3HA 4D46A 3L40A 4AYBC 1HQKA 2EXXA 2NUPA 3PQ3A 4C43A 2C5GA 5G0SA 2CL7X 1BA3A 2OD2A 1NZPA 4X66B 4EZ9A 3AUYA 2GZSA 4TPKA 3L01A 1I4DD 3O1IC 3OY2A 2NZJA 3EA5A 3A06A 4M6WA 3CVXA 3CE9A 3ZH9B 4AI6A 1SKAA 1TMKA 1Q0UA 1Y9DA 2I29A 4P22A 4OD0A 1PQUA 2LCIA 1PFKA 3MGHA 3QF4A 3DWFA 3RVJA 4FE4A 4E08A 3ORQA 3PFGA 2A1UB 2FSSA 3JQGB 4Y6OA 3RCBA 4C2AA 2CFRA 4OP3A 1UPFA 2I78A 3L5OA 2AWNA 1M9NA 1X2BA 3FE2A 1IRIA 3SBOA 3ICWA 4N47A 3WB9A 2ODTX 3LT1A 4WDQA 3V46A 1DBIA 1RHKA 2V97A 4YDQA 3VV3A 4F38A 5KTYA 2RKBA 2YIVX 3Q3VA 2PN1A 4B3HA 4FM9A 3NCTA 4IH4A 2ZRAA 3NEPX 4KIGA 3HJBA 2NU6B 3A1UA 3JQGA 4MOWA 4ZU3A 5CT9A 1MA7A 3ADBA 2QZSA 1RBZA 2DFKB 4X6LA 1H0KA 5BOVA 4ARSA 4K9OA 2X2OA 1JMVA 1JN0A 3VR4H 2JFNA 2H0RA 1SKYE 4ZQFA 5G5GA 1BCSB 2BM9A 5IYZB 2JCBA 2C0QA 2R60A 4GC7A 3MIIA 1T36A 2DF8A 3I83A 2OHVA 4K9KA 4L2IB 2Q4RA 3BD7A 4ZGGA 4R16A 4CM9D 3JV7A 4OUDB 3FNEA 3TZ6A 4I7EA 3IP8A 1MVLA 2BJHA 3GR6A 1RABA 3ENZA 1XZNA 3IHKA 4E1BA 1I6WA 4Q48A 1RCUA 2MIIA 4ZCPA 4ID9A 2VHEA 1WBJB 1PR5A 2XSZD 3CY6A 4B83A 1T36B 1K7CA 4AY6A 4PCAA 1YDHA 4JKOA 1SKWA 5JAZA 4IFBA 1BQ4A 4MMZB 4O0LA 3LOUA 2KOBA 3IE2A 2ZEJA 1WKCA 1Z0KA 3JQ9C 3VNQA 2QP3A 5CGZA 1B6TA 4EVRA 1QE5A 2ZTLA 3AINA 4F2WA 4QRHA 1GDTA 1PNRA 4A2CA 1Q3HA 1GGNA 4AP9A 1VLMA 1XSLA 1WSWA 3AP3A 3IODA 3LO8A 2FWIA 2W90A 3BD9A 3BF7A 3MRVA 3TZCA 3G0CA 2RHWA 3PK0A 4H31A 2JCYA 3UAYA 1RIFA 2Y4NA 1QZUA 4IXTA 3WP0A 3RAFC 4J7UA 4KXQA 4TV9B 4ZJPA 1HT3A 3TKYA 5DBHX 2QI9F 1PR1A 2C8LA 2HD4A 1NYQA 2Z6VA 1CSEE 4CBVA 1N4DA 1BQEA 5EKXA 3B12A 3L07A 4UU0A 4FTWA 3RR2A 4BKPA 3HYTA 3WLRA 2RGEA 1CULC 4GKBA 4A8JB 1QO0A 1CQIB 1JHVA 2Q3JA 3DLAA 1XCJA 2ZS9A 3JS5A 5K6AA 4JB0A 4JODA 1BPYA 2KW5A 2HF7A 1WPRA 5JNVA 4J9VA 4QAQA 2VTBA 4I8DA 3WQBA 1ADBA 1O94C 2ACEA 3D6MA 1CR4A 3OQBA 3E03A 3QGMA 4RPIA 1TKBA 1W4RA 5GJVC 3G13A 4BIMA 3W2EA 2OV2A 2ISPA 1CX9B 4MH0R 4G5XA 3A9WA 4KOEC 2PWBA 3GBSA 1NKEA 1BTOA 1RVV1 2FPSA 4I3GA 4BNTA 4BTVA 5A4KA 4PO1A 4YT4A 1U7HA 3GIDA 1ZQKA 2KWIA 2GEUA 4P84A 1QRUA 3D2SA 2BKEA 1AKQA 4R1UA 5EJ4A 4HX9A 4GVXA 4N6OA 4KX3A 2EGHA 1K08A 4DQRA 3O6VA 5K3BA 1XCPA 3QXJA 1J1UA 1TF7A 2R11A 1W85A 3TQ1A 4G8CA 1TUBA 1W4LA 4MYUA 3SAJA 4U7HA 3AVVA 2JEJA 3MMZA 1V5GA 3UNXA 2HCRA 3WWCA 1T24A 1X9XA 4U0JA 4MYCA 3L4BA 5EWGA 1ADJA 5IBPA 4IHQA 4NSNA 3EAGA 4F8JA 1KDYA 1RZVA 5G40A 3RB4A 4U7DA 2O2XA 4Q1DA 1G38A 1NXWA 3V7LA 5J2FA 3DPUA 2V7EA 2PYZA 1RKVA 3KQPA 5B1HA 1TUBB 1X94A 4ZKDA 3LBAA 3QENA 1SHLA 2IHYA 4RNCA 4RQ6A 1RBMA 3W06A 4RZIA 3ESDA 3QKUA 3AUSA 4LMPA 2LIPA 5A4AA 1ZD8A 3NVKI 3COVA 2DPLA 4KSYA 4QUAA 4D7AA 5BSVA 5BOSB 4KKXB 3PJRA 4QZBA 4OI2A 4KO1S 1IATA 3V1LA 1QFMA 3VC3A 1GA1A 1L7OA 3SK0A 1IIPA 3FMOB 5EWMA 2OCBA 1Q0RA 2GCOA 4H0NA 5GGYA 5H80A 3U0VA 1M2HA 2Z2XA 5AI5A 5J0UA 3ANMA 4A82A 1OFIA 4CCSA 2GHTA 2V9CA 3VOBA 3IIEA 2UVWA 4FB4A 3L8HA 4RZHA 4BLPA 2POCA 1QKKA 4AJJA 2QRGA 4EA8A 2D1SA 2WAYA 4R65A 2C5AA 3KALA 1R9MA 1VPDA 3IHLA 4IZOA 3WWDA 2EFDB 2WD9A 3DOEA 1J21A 4K05A 1UAYA 1TVMA 1ZSYA 3ZCRA 4DLWA 5A0TA 3M5PA 1DEXA 5HR5A 1GL7A 1DCFA 3S2FA 1EFVA 1BFDA 3UOWA 4ZOQI 4C8OA 3QLUC 4EY7A 4AZSA 1EQ2A 1A77A 1Y9ZA 2X13A 3IUJA 3R7AA 5DNYB 1WUHS 3BXPA 3PIRA 3M8KA 2YMQA 1FDIA 2D74A 2JFFA 2ZUVA 3VR4A 2GN6A 5J0PA 1WU8A 1L8QA 1T4CB 2I2XB 4LAFA 4J6FA 3C6YA 4PBSA 5A04A 5A5FA 4NU6A 4GDFA 3CURA 1NNEA 1C7QA 1L7QA 5AXAA 3KLBA 4E2YA 7ICTA 1OI3A 2D2FA 4OMUA 1TAQA 4ZT6A 1NONA 3DEKA 4JYPA 4QUJA 4EKGA 2CMHA 4Z1MD 4JIGA 1HSZA 2X9QA 4ECWA 2KKVA 3M5CA 3RRYA 1EVLA 5IJ0B 4LZNA 3TCXB 1PNOA 3GQVA 3HBFA 3N8HA 3PRYA 1J2RA 3L4SO 3I9JA 1IWPB 4Q9NA 1P2FA 3BL5A 4J0FA 1V37A 1H2WA 2GTHA 2VHZA 2VOJA 1KJYA 4PS1A 5DWVA 4I28A 4LZPA 1JAYA 1PSZA 3H6KA 1FEZA 1RNLA 1YMVA 4FR2A 4TTVA 5AJXA 1QH0A 2XUAA 1DC8A 3EY4A 3JTMA 4JUIA 2JI6A 5DNUA 3RG8A 4IQ8A 3PUVA 1I2AA 2ZJ8A 3EMVA 4X1YA 1MA0A 1OXUA 2WSMA 3H1TA 4C2TA 3IL2A 2H59A 2WHXA 4TSFD 3MOGA 2IUSA 5I7UA 1EM8B 1N3YA 1YB5A 1G42A 2QYSA 3JWIA 1M5UA 2VYVA 3HR8A 2GTIA 1L3UA 2MYTA 3PWTA 2EAOA 3AZPA 3OOHA 3JVDA 8ADHA 5JD5A 3KYCA 4QX6A 3PEYA 3PO4A 1EGMB 4UTNA 1HLDA 1QH1A 3GA5A 1LDNA 3KKAC 2NPOA 3CXRA 1SOWA 4H35A 1B6SA 1Y4DE 1JLKA 2B30A 1N9GA 4F4YA 2B7CA 2ODWA 3ABQB 3HXTA 3WYNA 4BQRA 4C4YA 5J2UF 5ALXA 4XLLA 3TBFA 3WJ1A 3HKCB 4B8YA 5J2DA 3KJIA 4PGQA 2NRWA 5T8KA 5G0UA 2BCEA 1ULUA 4HX5A 2NZ8A 4RACA 2JD0A 3ONNA 4YJKA 1JG2A 2H18A 2I4RA 4RK0A 2GZ2A 1SHTX 3VDRA 2IZ6A 3NBYC 4Z4GA 1UINA 3G8CA 7ICMA 3OO0A 2H16A 3Q7QA 5GP1A 4UBNA 4BVHA 1MX1A 3MJHA 4OB7A 1E8DA 1NOMA 1ULBA 2ZSFA 3EZ2A 2X2PA 1U8FO 3UT6A 4B3RB 4MV7A 4K6FA 5J4YA 2G5HB 3DZBA 4Q47A 3GV0A 3KCNA 4RMJA 1U9CA 5FBZA 5KFYA 3BFKA 3A31A 4UCWA 2J9GA 2HKIA 1VIYA 1G5HA 2HEGA 4GQIA 4I99A 3DXYA 5J2KA 2ZRGA 1KORA 3AFHA 3ZY6A 2C7QA 1QR6A 2J1LA 2YW9A 1EH5A 1G3RA 4PYIA 1MT0A 2CZGA 5CRIA 1I8TA 1XAIA 1DCTA 1ZIXA 4RVDA 4G0UA 2IS4A 2O3TA 4CTNA 5BNIA 4W5OA 2PGOA 2Z5LA 1N56A 1I3KA 3SSNA 4YK7A 3DAHA 4FINA 5IINA 5D2CA 4CQMA 2R2AA 5DNVA 5K0JA 4MB2A 1SKUA 3I6ZA 3K2QA 4RY8A 3QX8A 4YCCA 1GAEO 1HORA 2QT1A 3TVDA 4ARCA 1GG8A 2ZSHA 1C7IA 5KBYA 2GF9A 2GH1A 3I3SR 4FO6A 3AVWA 1O2DA 1MQ8B 2FX3A 3K4PA 2A6PA 4YH1A 2JH7A 3CUTA 3O94A 4FMBB 3S3TA 1HM5A 2EG9A 2H5EA 2R1TA 2WM8A 3TM5A 5C32A 1SMKA 3M9LA 4TM7A 2QMHA 5DW0A 4ZXFA 3SLGA 4B6RA 3T5KA 1FRNA 4QNLA 4B80A 5K8VA 4WEOA 1W87A 4MPRA 2ATVA 1TT5A 2GN0A 3IV9A 3EULA 4DC0A 4XIIA 2RHFA 4G4JA 2A30A 3JTEA 2V5UA 1CJBA 3HU2A 1JHZA 3AQFA 1FTNA 4HBGA 2Y1IA 4NC9A 4QC2A 4D9KA 3C3XA 4LOLA 3OIFA 4DUGA 4F9GA 5TZVA 4KIUA 5IC4A 3UT0A 1NW4A 3T1VA 4G0MA 1ZXBA 4V0OA 4BMYA 4NU0A 4Y2PA 4COOA 3K09A 3BMNB 3UB4A 1JXQA 3V3KA 5M04A 3DTNA 5KMGB 4EMBA 3RSGA 5DGAA 2CZQA 5FNVB 2AOXA 4I9UA 1ECBA 5AVJA 4PYLA 1R8QA 4M7PA 2QA5A 1NM5C 2VCEA 4ND3A 2FW1A 3A0HU 1CZUA 1T0UA 4N1AA 4O3PA 3HLYA 4C6TA 1XUOA 3NHBA 5JW6A 2IHVA 1FXWF 5HX7A 2WIBA 4FYVA 3V7FA 4DGSA 3DZCA 1OUQA 2W6ID 4L3WA 4PPGA 4M9JA 2ERXA 4MZDA 3HBAA 3K73O 3TH5A 1DKMA 3AW8A 5F7OA 3H9EO 3KTOA 5DM4A 4M46A 5IM4A 4TSRA 1J2EA 4TURA 1GAXA 3B82A 2H07A 4U7GA 5HMMA 4DWWA 3KHHA 2W2PA 3M9WA 4B6FA 4JUBA 2PL9A 4BRWA 1C4OA 2ZI4A 3VU1A 1EA7A 1AUXA 3UUGA 3ND9A 3SQWA 2LBOA 4M0DA 1FVHA 4J1QA 1TPZA 2DU8A 4OA5A 3SMQA 3HNOA 4B4DA 2OCPA 1ZI6A 4KV9A 2HM7A 5CLFA 4C5AA 3L6BA 4WCFA 3D8RA 1DAHA 1JIVA 4Q3LA 5HRUA 1PI3A 3RVPA 4L3OA 1OLXB 1VCMA 2IVFA 4NQZA 1HFWA 3B3GA 3O4HA 3AR5A 4IXWA 1C0LA 4PZDA 5E8JA 2WG2A 3JPOA 5HQJA 2ZS7A 1JHXA 2V98A 5CFRA 1B2LA 1O9HA 1T9BA 2ZYWX 2XHZA 2ZYDA 4CMKA 2HQBA 4GEGA 3C2MA 1WHSA 3FSGA 1O6FA 2SBTA 4R31A 1YBHA 1KSHA 5CDFE 3V2UA 3NETA 1Z38A 2DYKA 3KDSE 3R5JA 2VLBA 4ZT7A 1JFVA 3KL2A 1MG0A 4EA7A 1DPFA 5TQ2A 2HQ1A 2R7NA 2OTCA 3C7DB 3OQIB 4I2DA 3F96A 2M6LA 4F4CA 2NUBA 1SXHA 4ZOBA 4OL9A 4DADA 3GLIA 4HLDA 4UM9B 5FX2A 3FPJA 4UE2A 3GLTA 4JGBA 2QG6A 3R44A 4WSOA 5CA0A 4QGSA 3TPZA 1Y3BE 2ARKA 1PIWA 4LXXA 3WR5A 2B5WA 4L07A 2PR7A 4Y2HA 2J7PA 4MVYA 3VI4B 4BNIA 4RULA 4R3UC 4BNVA 3K8ZA 4OQMA 5JBIA 1PW7A 1U0JA 2XDYA 2K5UA 3S7TA 1QUEA 3DBLA 5AW6A 5FOXA 5A4JA 3VHQA 5ICMA 1F2UB 3GBVA 1CT9A 1P7CA 1J5XA 1SO8A 1GSIA 2CVHA 3TIGA 4Q3AA 4XWKA 4OFZA 3IT1A 4W6ZA 2BFNA 1YC5A 2VJOA 3DYBA 4YP6A 3OZTA 4IYJA 3SYRA 1JBKA 1IBCA 3P2KA 4G5HA 1GOTA 4OV6B 4LGMA 1V5IA 4PG5A 1DJLA 1YZQA 1EJ0A 1RZTA 1TU3A 2IYSA 3GGOA 3HJGA 2BFBA 3TNJA 3RFCA 4M1WA 2NXEA 3ISTA 4YC7A 3B9QA 2Q3FA 4OI1A 1J0DA 4MP3A 3SYNA 4EJ0A 4ERXA 3JD2A 2GD6A 5BSFA 4ECRA 4W99A 5KFAA 4NI5A 4QBIA 2JW5A 4U2CA 1UWKA 2C28A 1MQ2A 2ZIFA 3HFRA 2IU3A 4QZDA 3NLLA 3I6YA 2YOFA 4URFA 3UJNA 1N34B 3HDVA 1G18A 4Q7EA 4BX2A 2V65A 3SENA 4RQ2A 1AHIA 2PS3A 2X41A 3E7DA 5DGCA 4TYWA 4LFCB 5JXWA 4ER7A 2DQYA 2FSPA 2R6R1 5GTIU 2E3JA 4N9WA 2QT0A 2HPAA 5ENVA 5LQMA 4DL2A 1S77D 4X92A 1S2DA 4XZ3A 1Q21A 4P1ZA 4WIAA 4ED3A 1BN6A 4KXYA 4WDRA 3B1JA 3T41A 4LJ4A 4P3KA 5L95A 3OA0A 5IJXA 3DEIA 2ASLA 1NZJA 1PJ4A 1V0JA 2DFNA 2Y71A 5E0OA 1Z06A 421PA 4PRYA 3GEHA 5ITWA 4XKJA 4UHEA 5KIAA 1NMSA 5FWXB 3CZQA 3HBLA 2P66A 1T5DX 2C84A 2OC4A 3L18A 1U8YA 3I9LA 1RC1A 1JEDA 1D9XA 1PYDA 1UUFA 2D1RA 2I76A 3HKBA 3K31A 5HCUA 5DYIA 4DNOA 5C8DA 4QECA 4URHA 2HIAA 4U8HA 4YAOA 4AULA 1E32A 4OPMA 1PQYA 5KG4A 4V3CA 1J7JA 4HDOB 4ZRDA 1S8AA 1WR8A 2ZTMA 1GLVA 4KR0A 3MR2A 4RVSA 1L7PA 3PHJA 1GKIA 2UAGA 3QKTA 4DTIA 3E53A 4RTNA 1S0OA 3B53X 3IDQA 1ZQ9A 4LTMA 5EPEA 5J47A 1J39A 1T5BA 4TS1A 1W52X 4FIZA 4RJLA 2WKQA 4KHZA 1I14A 4DL3A 4BVLA 4CYMA 4YWJA 3VNSA 1BGVA 2G5TA 1KK1A 3IESA 2MCFA 5BRJA 4BQSA 4RCVA 4B73A 1SG9A 1E9EA 3TL2A 4QWCA 2WC1A 4HUQB 4LYYA 5CIWA 4AJIA 1O95D 4FYIA 1YS4A 2H8KA 3OLXA 4MP6A 3GMTA 1A8PA 4V0NA 4YV0A 3K0AA 1GTZA 2CFCA 2CMKA 4QZEA 1UPBA 3AT1A 4BP9A 2XRMA 3KXDA 3L1IA 2NX2A 1A98A 1JKJA 1V2GA 3DMRA 3T1NA 4ZYUA 4JXXA 4I8IA 1SUIA 4MPDA 4B4VA 4X20B 3JPSA 4KTVE 1ESEA 2HO5A 4KQFA 1MW8X 3ONWA 1I24A 1SBIA 5DBCA 3HY6A 4JEMA 4PQEA 4KYIB 5FPKA 1ZRNA 2Z4SA 3MCZA 1N2SA 2I4NA 3NALA 1YBFA 4TVSA 3WZ2A 5J0QA 3HXQA 3PT9A 4IGFA 3GEIA 1CE8B 4BDSA 5BQ3A 2QQEA 3KJNA 3BZUA 2P9QA 1UFOA 4L95C 4D74A 1G3QA 2XZLA 4BU0A 2Q4EA 4DEXA 3D2BA 4OO3A 4PPNA 4LXGA 5DT2A 5JV5A 2FMIA 3QU5A 1KYWA 1O57A 1V6CA 2AOVA 1RU3A 2K2QB 5KNLA 1FJGB 5C8VA 1FFHA 4BP1A 2DF4B 1CVIA 3CEPB 3U4CA 5F9HA 4R5MA 1IB6A 1K27A 4K8RB 4XLTA 2NMVA 5KX5B 5HF9A 1M72A 1Y42X 3LX6A 4DDTA 1LI4A 3N0WA 4RAOA 5BRAA 2L17A 4AM8A 4LHVA 4JK1A 4ZODA 3SBDA 2QSUA 1NUTA 1IU9A 3UAVA 3UFXB 1ACLA 1GSHA 4LNHA 3ZWKA 3THXB 4ZT2A 2CJXA 3ZE6A 3RB3A 4JGGA 1G21E 2PX3A 1N0UA 3QITA 3AEYA 4CM3A 3A1TA 5CB4A 4TKLA 4E94A 2HK8A 3V8MA 3ICPA 1V7QA 4CF6A 5CDYA 5C3MA 4JQOA 4PCUA 4IM7A 3NDBB 1TK0A 3VVLA 4MGIR 1MDBA 1P31A 3UK6A 5EIEA 1T2DA 1GGKA 2RAUA 1E4EA 2XMPA 4J0DA 3S29A 1EVZA 4F3YA 2C29D 4PHCA 3PJGA 3O8QA 4QU8A 1KE2A 3ANLA 2PH3A 2JEGA 1ZUD1 2XNDA 4MW9A 3HYRA 4HKTA 2FOLA 1L5KA 2GF0A 3V1UA 5CBKA 3MCUA 2BGWA 2QUIA 2VPZA 2VJAA 5AUNB 2XZTA 1ZQCA 3FX2A 1OI4A 2FWMX 3OHMA 1EIWA 2G1PA 3DA8A 4QYIA 3ECSA 4ZVNA 2BMJA 1KW4A 2EKQA 1CEXA 3FIUA 2FRDC 5KFKA 3UKOA 1Z0JA 2BM8A 1BOOA 1RP7A 2WJ6A 4NBUA 1V48A 3RS5A 1SUEA 4C6HA 5BSUA 1OSNA 1HPLA 5CLHA 3TL3A 3HRKA 3OM8A 1KR5A 1P9NA 5DULA 4WX2B 2KIWA 4WBNF 2UZ0A 2Q1YA 1LI5A 1CFJA 4N3BA 3T7IA 5JMPA 2Q5QA 4QZFA 4F4XA 5CLQA 1DO0A 4GYKA 1X8LA 4IJ5A 1P7PA 2WIGA 3O21A 3NWOA 1A8UA 3F2DA 4WFKA 1XIVA 2IYQA 3EXIA 5J2BA 5THXA 1L7RA 2A9KA 3A9VA 3E35A 4KBFA 5ERGB 2JHFA 1OW3B 2BZFA 3KVYA 4GC5A 2ZRQA 3FLAA 1QP7A 4NDAA 3NOQA 5AW4A 4QGHA 3HV0A 2DHEA 1FXSA 2IP4A 3LLVA 3PUHA 2VNSA 4KXVA 3TFWA 3HE3A 3HXPA 1OLUA 3TSOA 2XXAB 5IUJC 3IDZA 3WFZA 3FDIA 2NTJA 4L0QA 5HFAA 1ARZA 1B6RA 1IAQA 2C0PA 2C4VA 1XMSA 2WUDA 3ITDA 3X1DA 4GICA 4KQKA 2WLSA 2K89A 1N2GA 1KWKA 3NONA 4EFMA 1H1TA 4JBHA 2PLNA 5DG7A 4GWGA 1ZOLA 1IY2A 1SL1A 4R63A 1NUQA 2I2FA 2VVTA 5J0OA 1CUAA 5AHXA 4N49A 5C4IA 3DB1A 2G36A 3CPEA 2HMWA 3LL7A 5E1BA 2XAUA 1XCOA 3ND5A 3M2PA 1RS0A 5KTQA 4PPYA 4QM6A 9ICEA 1P7ZA 3VKFA 1IZ9A 4HDAA 4IUBS 1T3HA 1MJGM 3KT8A 4FR0A 3ELBA 5SYMA 2XRFA 5LP6B 2KJQA 5EOZA 2OBFA 1U28A 2WRZA 3HVHA 3K9HA 3PGJA 3QXHA 2NU9A 5DI3B 4YJDA 1B4DA 5FBQB 4RM2A 4YYZA 2JAUA 5FUWA 4PICA 4Z1MA 1W8DA 1Y9EA 1XHFA 4DL9A 5FH9A 2WJYA 2W6JD 3HBJA 3LS2A 3QPBA 4HWTA 2X1HA 4LCJA 1EDBA 4DF4A 1FK8A 1ZMOA 2CNBA 1GZ3A 2H1HA 2O57A 3AHGA 3F6RA 4LJAA 3W7VA 4AJ4A 2CPRA 9ICJA 4G5QA 4L8WB 4P82A 2WDZA 4M9XA 3USES 4CT4B 5CB4F 3RJEA 3MWDB 3F9IA 2YN2A 4MVJE 4XD7A 4F04A 2H7VA 3TBKA 5KFGA 4M1EA 4NXZA 5JZSA 4RTMA 3QZ8A 1PJCA 5T4FA 2HMTA 1EUCA 1BDMA 2QNIA 3OIWA 2XB6A 3QZUA 1NR5A 3M6XA 3OU2A 4FFBA 4K86A 2IPNA 4P36A 2EFEB 6REQB 1VGVA 3D02A 5MFZA 3IBFA 1ISSA 4P3YA 1GPAA 3T0IA 3DT6A 3GJ3A 3IG5A 1CF9A 3VX3A 2QUJA 4YCNA 4BQEA 4G24A 3AIKA 4QXAA 3W2FA 2GESA 4C8NA 3IAEA 1S3IA 3RUDA 5B3JC 4CWAA 2P7HA 3ZLTA 2Q3HA 2HMAA 3M6MD 3ASVA 1JS1X 3MJTA 4AO6A 4PZ9A 1ZGJA 3FW1A 4MFAA 1Q12A 1MG5A 1WJGA 1KZ1A 3OF3A 1KZ6A 3V8PA 1WCNA 1IXZA 1E2DA 4ZICA 2AH5A 2D4AA 2QX8A 2XB2A 4HMQA 8ICSA 2OCYC 1XTRA 3Q72A 4FI3C 4IYRA 4LY9A 4RXUA 5D1HA 3VGPA 3RYFA 4F5DA 2H1CA 2J30A 4JENA 4EGSA 3WNDA 4JI7B 5KCZA 2XRYA 1ULSA 3IERA 4FS1A 4ENUA 3FYUA 4FE7A 2VWGA 1GARA 5HBRA 1WMEA 4D80A 4IIUA 1QSLA 4HXYA 5ALNA 3SI7A 9ICUA 5LXTA 1MOPA 3BKXA 2B6NA 3NC4A 1Y3HA 3R0ZA 5ESWA 1NT2A 4Z2AA 2H5LA 3F4LA 1ZR4A 4D4JA 4F6CA 3BTSA 1L4UA 3OEHD 2QVGA 2ADMA 2KSOA 1F1JA 4BO6A 2A5YB 2LP4Y 1C3OA 3BIXA 4KGZA 4QOHA 3QX3A 3MA0A 4CCHA 1MQSA 1R0CA 2V1XA 4ZC1A 4M87A 1DARA 2XW6A 1FJHA 3K92A 3KQMA 1UM8A 3LECA 4J6EA 5EMMA 4Z0NA 1QTRA 3T7TA 4N18A 4EGAA 5E9AA 1GO3F 4L4RA 5ALYA 3OZBA 1FB5A 1U99A 4Q9IA 2QR3A 1KMHB 1QIIA 1GHTA 1U1GA 2WOOA 2IITA 3FM9A 3JVUA 3DR5A 4CDMA 1J8DA 4RJTA 1Y5LA 4EVQA 1LRJA 2Y93A 3HP7A 4DIBA 4EVSA 2PKWA 4J8PA 1DX4A 5CXQA 3HO1A 1LEHA 2LZ0A 5LB2A 1YRHA 3RK0A 3GIKA 3AUOA 1YVEI 1J00A 1C9JA 1V6SA 1XYVA 1Z5GA 2J9ZB 2QY9A 2FPGB 3EPPA 5BOMA 1RACA 1K75A 3G7SA 3O8LA 5D6OA 3TXAA 4RW0A 5B1EA 4IDOA 1F8GA 1ZN9A 1PDOA 5K6AC 3M6WA 3TB6A 1BVHA 2IOFK 2J07A 2WTXA 3LGAA 3EYZA 2FLPA 3OAAA 3OU6A 4RQAA 3TLCA 1M66A 3OM9A 1L9KA 3LPNA 2IBMA 4KH0A 1K3TA 3ZVKA 2QRPA 1K63A 5ANRB 3A10A 1H2AS 1QTIA 1OT3A 2NVUA 3RRXA 4J7AA 1KEEA 3EXHA 2E82A 2JGIA 3BRSA 1IULA 3C5VA 3X2SA 2BM1A 1QG6A 4BPBA 3MCAA 3Q8XB 2Y9UA 3QEOA 1RM5A 2OB2A 3RAPR 2JRZA 1QCCA 4Q93A 4CUJA 1SIWA 2F8MA 3GFOA 1YRAA 2AGVA 2Z2JA 3F67A 3W9UA 5HUHA 4MKHA 3DLHA 1AK9A 1DFGA 4GWKA 4YMUA 3O8RA 4YMSA 3M8RA 2FMQA 4FOOA 3A1CA 4IL6U 1TJPB 1UK8A 1H9BA 2ETVA 2KPOA 8ICLA 1JHAA 2Q9UA 3GEBA 2W9MA 1BCRB 1CP2A 3LH5A 1SKRA 2JATA 5JSYA 1J1ZA 1N7JA 1T8UA 2FW8A 2WAMA 3SDZA 4CLEA 3LX4A 5L7WA 3UZUA 1DUIA 4G3XA 3QOXA 3ASUA 5AM2A 4DA8A 2C4TA 1YBMA 4GSLA 4JVNA 1E77A 2GI4A 2H4YA 4LPSA 5LJLA 2PD3A 1DAEA 1TRKA 3BB1A 1VZ3A 3PEVA 4N40A 5EEHA 5HOQA 2REQB 1KSPA 4D8WA 3ABOB 4XX1A 3SBEA 1T3ZA 4P80A 4V1CA 5L45A 4R83A 1ULTA 1ZJWA 1QZXA 1WZCA 2WM9B 3LFUA 4YMHA 1DK3A 2YN0A 1A2KC 4LWZA 9ICKA 16PKA 2GBGA 3KKNA 2ZZNA 1NMEA 3WKCA 1OZAA 1LTKA 3SF8B 4AZ3A 3EN0A 1H9CA 4LOHA 1P17A 5JDIA 2GFHA 1SB3C 4UMEA 3DV0B 5E6RB 1L4NA 1RLJA 2V54A 3FVQA 3SHFA 2B4KA 4K6CA 4NBRA 1QC5A 4FLEA 1ZU4A 3T7EA 4DG8A 1P62B 1VTKA 4HAXA 2J0SA 2WB1F 3BJEA 1NN3A 3Q7PA 1B8OA 1PV1A 4G1EB 4CM7A 3DP7A 4AKIA 4F4KA 4NK4A 2ECOA 5A7FA 1JKIA 3KPUA 5CLIA 1CUYA 2IH4A 4OHFA 1AMUA 3KJHA 2CXPA 3HWX1 4BXOA 4OIMA 1CJCA 4BX3A 3DJYA 1UWVA 2NSHA 2P67A 2J6IA 4QIHA 1DADA 3TNFA 4HQKA 1CQWA 4PG8A 4S24A 3AP1A 3Q10A 2PRKA 2QX4A 3QVUA 2V0GA 1UOPA 5KSYA 4TSFA 4TTPA 4RPYA 3PV0A 1SCQA 1VHJA 1YAJA 2CNOA 2XMSA 1JQDA 1ZCBA 4YJFB 1IDOA 1M2OB 3RVKA 2ZIWB 1SUSA 3PPWA 4IG9A 1X2IA 3AW9A 3QSYA 4PFJA 5JQGB 1E59A 1OXKB 2H1IA 5FOWA 2YY7A 3AESA 2C2RA 2XB4A 4NLLA 1EBBA 4R1OA 2R7MA 3EXG1 2QJRA 3RVLA 4CU2A 2I8AA 4X90A 1U0TA 1YCGA 3HJNA 2KV2A 2WWWA 1GGFA 4L9SA 5FR1A 4OOFA 4TUSA 4UU1A 3UXHA 1PK3A 3EJWA 2H1WA 3SFTA 2AZMA 5JVDF 1MORA 1QVRA 3HCRA 3QP9A 2F3UA 4REMA 1P1IA 2BBWA 4ZVVA 1DGQA 5HIAA 3GXOA 2WA2A 4I50B 4HLCA 4WN9B 4JR1A 2DFDA 1VDMA 3CM0A 2IPXA 2CHVA 4IDHA 5KKNB 1O1YA 1FDRA 2JH8A 1YR2A 3WI7A 3RSQA 3WIBA 1F9EA 2P3QA 1JXAA 1VIMA 3ABSB 2O23A 1DTWB 1ND6A 3N74A 1M1YA 4PZPA 4UNIA 1Z3IX 1D9DA 2ZU0C 3GFRA 4XUGB 1YL7A 3W3AA 1A5AB 1FRFS 3ZEIA 5BMVB 3HCPA 4U2GA 1D2GA 1GNRA 1T3LA 4ECTA 4AG6A 4BNFA 2YUTA 4BHTA 1K5DA 3E8MA 5SZIA 4HTAA 1US8A 4RIHA 4WK4B 3QEMB 3NVAA 2OK8A 3UJ6A 2W6ZA 4UUPA 3HMKA 1T94A 2WINI 3I2HA 5DDYA 3Q8SB 2JAPA 2VEDA 4KN5A 1L5OA 5NLLA 2RH4A 5KSPA 3LUCA 3RUIA 5LIPA 4M9NA 2RMKA 2KIVA 1JFFA 1SH7A 3H1EA 4R84A 4WUTA 5T4BA 1C8KA 4DVJA 5JS8A 2A9OA 4V0MA 1XMIA 3I5MA 1CJSA 2H65A 2OL4A 4MKGA 4MPPA 1ZESA 5J0XA 3WY9A 1JPVA 2KMLA 3BMCB 1JSLA 1U48A 4JUAA 3ZQ4A 4O3NA 1K2WA 2HBQA 3LBYA 4DUYB 3JPWA 1JLLA 1NP7A 3KJQA 2YCLA 3O03A 4Z8YA 3OZ7A 4MQ4A 4BLQA 2EZYA 4OAQA 4O3SA 3O8NA 1ZL2A 2F44A 3MFYA 2H52A 2UKDA 5CT5A 1RQ2A 3O4GA 4MWCA 3RC7A 2QF7A 3GLHA 4XB1A 1OQAA 1X9SA 1I9CA 4INJA 1E94E 3WRYA 4H6VA 2CDBA 3QEKA 4OATA 4PGFA 2ZRMA 3O2JA 4ZV4A 1S9FA 3F8TA 4AURA 2HHAA 1GUFA 1Z5UA 2RCYA 5CYFA 3GAAA 4N3GA 5E7JA 3KQUA 3B89A 5BN3A 4ZCRA 4DLXA 1RWMA 1WRBA 3OP4A 1JLHA 4MVJM 1U8XX 4B3JA 5HJ2A 2GD2A 1Z0FA 4Y9DA 1F3OA 1RYFA 2YNMD 3Q4GA 3RAEC 4ILKA 1LPOA 5KB3A 1ZC4A 3KKZA 1R4AA 1NXQA 3UWKA 4MEJA 4LQCA 3ELWA 4IX1A 5DM2A 3NTVA 1Q77A 3HA5A 2ECQA 5BXQC 2HJHA 1K4MA 2AR0A 2COUA 1U47A 1BYUA 3DB2A 3H4IA 4HNAA 4WVLA 1QDUA 3OA2A 3LP8A 4S1PA 4HDSB 3T3DA 1NFRA 1I6MA 4YJ3A 1QJCA 4XUCA 3G0DA 1U7DA 4L3VA 1NYRA 1DO2A 4H17A 5ED4A 2CBGA 4WNAA 3DMTA 4JBGA 1QTQA 4L50A 3QF7A 2L69A 3AYXB 3ZXSA 4GP6A 2O54A 2QHXA 2ZI3A 2JFOA 3R0XA 4UTPA 5AKKA 1L4MA 1BROA 3RD5A 3EE6A 5ESDA 2Q3CA 1KVRA 3QFFA 3FDZA 1ETUA 2A9RA 2C20A 2HO4A 2HI0A 4IDQA 4ZIRA 1VSQA 2WTNA 3MWGA 3BB4A 4ZQEA 3CH5A 3GXBA 4EENA 1E3QA 3RHTA 2CXYA 5CB0A 3PYLA 4ND4A 2V4RA 1ID1A 2ICAA 4IRUB 1YV9A 4IVNA 3C3CA 1GUZA 1KBUA 3AJAA 2Y0SC 2O8VA 1GZ6A 3ZDCA 4HGOA 3FMVA 4OAPA 3X1KA 2WP0A 4DG5A 3H9GA 4EEKA 1U2ZA 2FPIA 4DQXA 5AK3A 1GGEA 5J23A 4L72A 3VNBA 4IR7A 3BAZA 1Y9JA 4Z49A 4Q15A 4A2WA 1BPZA 1EWKA 4L7QA 4P83A 3JCZA 3OHAA 5HS4A 5J2UA 5GV8A 2V6JA 1DB3A 4REOA 5CK4A 4E6PA 4ME6A 5AHKA 4A0RA 2BFFB 3RSCA 3UQZA 3JATA 2ZWVA 1QS0A 3WLAA 4EG6A 5JTIA 3HSSA 3PGVA 4NCXA 1P1BA 3FTPA 2G9RA 3I4FA 4M8SA 2CL6X 2GM5A 3A11A 3GGSA 5DDMA 2R5FA 3TRFA 2J6SA 2Q1SA 3H8MA 1A7KA 1D07A 3RUFA 4OQZA 4C21A 1XVTA 1OWMA 2ZRNA 1VG9B 2BRUA 3KVOA 3JZFA 4G5SA 1QRRA 3TG2A 1KSJA 3M0EA 2OVFA 1Y48E 1J1IA 4IJ6A 2I5PO 2RHCA 3LIPA 4JHLA 5BSRA 3WRYC 3MWFA 5GQSA 4D4MA 2ZE5A 5A6SA 5BYKA 5KJFA 3GLFB 3SP1A 4M0KA 4KLZA 4JLJA 5IN4A 3PDJA 4EJ2A 4Z3OA 5FB3A 3RYCB 2KVSA 1EFPA 3WDMA 4EDFA 5KSZA 4LHYA 4YJHA 4CUKA 5IX8A 1DFIA 4LUCA 2BFCA 4HJRA 1MUUA 4QDUA 3KPYA 4Q7QA 3I8XA 3PF8A 2K4PA 2VHCA 3T99A 1ZKMA 5ETJA 1TIKA 3TXYA 3UTDA 3ESYA 4PXYA 1A9XB 4RZUA 3NGMA 3MG9A 4WXPA 3ZCPA 4HT3B 5BV7A 3P94A 3KQLA 1W0CA 2XC9A 2JJ8A 3HPRA 4FBGA 4GLBA 1FU4A 3V7UA 3DE2X 2R4QA 1ZA1A 3MT8A 5TV2A 2QN3A 1Z39A 4PFKA 4ENPA 3UVEA 3VPCA 5T64A 1MEOA 4OQPA 2WV9A 1LV7A 2B82A 3QPCA 3C28A 4ITUA 7ICPA 1RYNA 1KMNA 2CRXA 1AN9A 1Y8AA 4DRZA 4I4TB 2G9UA 1WUYA 4CRXA 3T94A 4IDAA 2FPUA 3PHIA 1TECE 1W5SA 2MRLA 1MO5A 3QHAA 4H3KB 4YRKA 3AEKB 3DAYA 3I01A 3CRRA 3IE0A 3L93A 2QV7A 4CDGA 2HLDA 3ZS9A 1XI2A 3ZX4A 1KQFA 5IT9A 2F77X 1JMKC 5AK5A 1RPAA 1Z19A 1I2BA 2C57A 3N6VA 4IR9A 3NOXA 4P0QA 2UZ1A 1XQXA 3CX4A 3OEWA 1DUSA 4IXDA 3HDYA 4PZEA 4XGNA 4Y1RB 4D3ZA 1YF3A 7ICJA 2NV6A 1Z00A 3IPYA 1ONOA 2FPLA 2ZI6A 3BMQB 3FIJA 4EZEA 3CRQA 5C3UA 1WMDA 3JYPA 2QOEA 3LWDA 3JW8A 4E5SA 5DH9A 1PVOA 4HDNB 1C4XA 3ZK7A 4EB3A 1VKZA 5CFZA 3TG8A 3LWMA 5AIBA 1BN7A 1NUSA 2OHIA 3A1FA 3BH0A 3KFLA 1F8UA 3N8DA 3QNUA 4R2LA 4TV8B 3D2NA 4S0ZA 2IOYA 4JT2A 3UXOA 5EP2A 5I4BA 5B5SA 1UBCA 2GCIA 5AMXA 5B7GA 1BC5A 1V3VA 4DR2B 3FWPA 5BN5A 4I2IA 2DMRA 2QD3A 3ELUA 2OZEA 4UFPA 2Q0ZX 1FO4A 2WIDA 2ZGVA 1FBNA 1ZNZA 4BRZA 4IJMA 4UBOA 4M0LA 1K98A 1R9JA 4PINA 4DKJA 3NVWA 1RLIA 1TEXA 1W46A 4I2NA 4ZVKA 5CVVA 1UA1A 4PHPA 1WDLA 2PL1A 3DCYA 4YPOA 4EQ6B 4DV5B 4MYRA 1YUMA 3WGTA 4AJHA 1O96A 3NC0C 5KS2A 3N2IA 2NVOA 1F0KA 3IALA 4M2YA 1QZZA 2VRNA 1XZHA 3IJRA 2ZETA 4GOXA 1NBWB 4PPQA 5JU5A 3AUTA 4JA2A 2ZROA 3SZGA 5IVPA 3TAXA 3PNCA 3OKPA 1QB7A 4BY9E 3KBOA 3QUTA 1L4GA 3EIQA 3RIYA 4CL0A 1WXDA 2OOSA 1SD5A 2W71A 4GR5A 4JXKA 4H7EA 3S0JA 4D4LA 3ABRB 2MSNA 1W0KA 1FTQA 2JA2A 1KFSA 1K6IA 4TL6A 1U9IA 2WD7B 2IY8A 1QO9A 3REFA 2EZ9A 1P8JA 3GJYA 5JHGB 3FOEC 1EWQA 4MUXA 9ICPA 1SA0B 3CZ9A 1U1FA 1IRXA 3KR0A 1FNBA 2QRKA 4GPZA 4EPVA 1TV9A 3NTOA 3FPEA 3TOVA 4RQ0A 5T5QA 4MNTA 1IZYA 3DEZA 1S5LU 2I80A 4OGGA 1NQ5A 1BPDA 3B5IA 4TQRA 1E6LA 5IVKA 3NNDA 1OC4A 4ALMA 4G84A 1QTMA 3K1RB 3G1TA 3AJ8A 1V8BA 3ES9A 1KFKB 1TYBE 2ODQA 4FUTA 4P6VF 1W7AA 1KA9H 1WL8A 2C97A 1JEJA 2EF1A 2WYUA 1DIAA 3C3WA 3HJUA 1PT8A 4QGAA 2XT0A 4PG7A 2GLXA 2O8BA 5F51A 4C6SA 4EZBA 3LCMA 3CLRC 4C05A 2REBA 2BOVA 4RV9A 2ST1A 1GM5A 2OECA 5D3MA 4D98A 3FUCA 5DTMA 1Q16A 1MHTA 2P9FA 2RE8A 4Q3OA 3RVRA 4Q7JB 3RUAA 9ICXA 5LDHA 1P1KA 2QPLA 3NHSA 4NAVA 2GPWA 1QLNA 1RTKA 4INOA 1BMQA 4K6MA 3UFBA 4CEIA 5KQPA 2AUTA 2XDAA 1PJRA 1XQ1A 4B76A 2ID9A 1VECA 3GJ7A 3LF2A 3OZUA 4OSPA 4RGVA 4TZKA 3QIAA 1A88A 4GKKB 5KFNA 1E64A 1GSAA 2B9VA 5B1IA 2YX8A 2NGRA 5J0RA 3V72A 3MB5A 5EP1A 1CUCA 1D9ZA 3S2SA 4H3SA 3T52A 1X7ZA 2ALZA 2EKDA 3L79A 2A14A 4C7JA 3AI3A 1XXHB 4QZVA 3JARA 3VQTA 5D7NA 1PWXA 4ZI7A 3CUKA 3WLQA 2A5LA 2W6OA 1OWNA 5KC9A 2V5VA 2PJUA 4KFSA 3GU3A 2HWXA 4QGFA 2X0DA 3TS1A 2HBRA 2ORWA 2EH9A 3TK1A 3LTEA 1E1NA 4DANA 5C5IA 2CJWB 5E3IA 2Q5IA 521PA 1UXIA 4ZI7F 5K01A 5EQTA 1KZGB 3SOZA 3U7RA 1L5GB 5DBAA 5KINB 2XOEA 5KT2A 1NSYA 3EY9A 1SCUA 3VR6A 3M1YA 2OAQ1 3GDOA 4JI5B 3TOCA 3W5VA 2UYQA 4P0TA 2CNWA 2P0YA 1MB2A 2P5SA 3FKJA 5KI6A 1NP3A 1P1JA 2JIPA 3QU4A 4KAJA 3ZGOA 1KC1A 3FDXA 1ZBQA 1XLVA 2IYVA 5KFLA 1WABA 4HZIA 3HSKA 3KHKA 4LZLA 4UDOA 1LS1A 2JEZA 1RDFA 3E8SA 1IY0A 4X85A 1KK2A 2IHKA 5EZYB 4RX1A 3FMGA 1CU1A 2BMDA 2FH5B 3G8YA 4BN0A 1AKNA 2EFGA 2WSSD 4RHEA 4RL4A 3TZHA 3BWCA 7ICVA 2MDTA 4UAWA 3OC6A 2PZLA 2NT3A 4Q05A 1UP6A 5IXSA 5C18A 3PDCA 2V7QA 1FIUA 1OV6A 4KE8A 2MR6A 3DBVO 1T6BY 2D8CA 5K6RA 1PK1B 1NBHA 4JSYA 2E8PA 4QXMA 4TTSA 4CQLA 2FN3A 3GCZA 1EM8A 3K9GA 3U3KA 3KOUA 4R9SA 8ICYA 1VA5A 2WTMA 4CCYB 3OSNA 3MN1A 1JKXA 8ABPA 1ZR2A 3ED5A 2J3HA 3GI1A 3MBIA 3PTAA 1S0MA 1KY2A 1C3XA 4TV9A 4MXDA 4RQBA 3CA8A 1DDOA 4ZRNA 4ZCLA 3RKUA 1AF7A 1U1DA 5IF3A 3TSCA 4MR9B 1ZQJA 1UL1X 2SHKA 3NASA 4FZRA 3H5RA 4LK3A 1GPDG 2JFUA 3OFND 3WK8A 1ANKA 3AOGA 1RMYA 2WTEA 4UB6U 2ZT6A 1XX6A 2X7HA 3C5HA 2VZ9A 3NNSA 4BMPB 2EWMA 3ZE2B 2GPYA 1M6WA 3G0BA 3DEAA 3W3ZB 3FCUB 5I7EA 3ZS8A 1RXEA 3L82B 1G7TA 1ODJA 1UBJS 1TZJA 2C5SA 4IV5A 1KRXA 3GYGA 3AZOA 2FV8A 2I7VA 3F5QA 4HEHA 3BJRA 3GP3A 1I1HA 4FR5A 1P91A 4ENRA 1FDUA 1S1CA 2MT9A 3P0RA 3LTNC 1OROA 2ZIVB 1FYVA 3L1UA 3NIBA 2O5RA 3O9MA 5IUKC 2QG4A 1NKCA 3B9RA 3FDFA 2C8JA 1K86A 1P2SA 2WABA 1WG8A 2DY0A 1UKYA 2HHLA 2W9AA 2W43A 4N8EA 4E3ZA 4DSZA 5H9WA 2WIKA 2YVLA 4G8BA 1LB2B 1CUZA 3UYLA 5CWRA 2EJCA 4NVRA 4ETNA 2WWXA 2Z98A 4KLCA 5M29A 1V11A 3QYPA 4RLSA 4PYNA 3EFBA 5C9ZA 5KQSA 2H9YA 4I46A 3HXKA 5MHTA 4PLVA 1T29A 4W5WA 3A6EA 5TJHA 3THYA 4FWTA 1GXSA 2K4HA 3OT4A 2HR1A 1RM0A 4ELTA 1LQTA 3DKVA 1RE0A 4MCHA 2QPOA 2RAPA 3RKRA 2ZXUA 4I1PA 1PT7A 2GPAA 4DRXB 5D5QA 4F46A 2YKGA 2W7OA 3D2CA 1NK0A 4MHVA 3JRWA 1AQJA 1PRYA 2H54A 1EFVB 4DO9A 2FX5A 2RONA 1F4LA 3IPLA 1F51E 1M5RA 1C3EA 5B66U 5DYNA 4KO2S 3QEAZ 1Z88A 4DMCA 2QU8A 1PYGA 5IFKA 1ODFA 1JQBA 1KS9A 4HVTA 2ISSD 4K1LA 5FUYA 3ZV7A 3THWB 3KPJA 3BQTA 2YIDA 4GFDA 1DMRA 2Q29A 2FWRA 4BFYA 3W6PA 1E61A 5BP7A 1R3DA 4GI5A 4NL9A 3AKCA 1CUKA 1J20A 2QRJA 3MFIA 2FP4B 4GRDA 2G06A 4U2FA 4MGHA 1L3BA 4R2WA 5H16A 4FFDA 2HMUA 3BMOB 1V2HE 3GPCA 4K9NA 2D5IA 2X8JB 4CM6A 3WWPA 2XLBA 2J0UB 2JCVA 3E4CA 5DXJA 4B2PA 3AVOA 2DCUA 3BMCA 3KZOA 5DU2A 4BMDA 1RSZA 2AOUA 1VYTA 5IPFA 3JY6A 4PGAA 1ES9A 5EIXA 1JLLB 3PFCA 3VU8A 2XYHA 3W1WA 4LDAA 3IDFA 8ICMA 3N0XA 1AQ6A 3I9NA 1FZTA 1C80A 1SC1A 3JAKA 4G5OA 4IZ6A 4TRNA 2XCLA 1M1NB 2ZR9A 4IBOA 4TRRA 3QUSA 4MWSA 4YP5A 4A9AA 4YRBA 2CV0A 1Z83A 3HCOA 5EESA 1FYFA 4XWGA 1EUDB 1SKYB 5CHGA 4B3DA 4A0SA 3Q41A 5CAEB 4CMGA 2VYFA 4FEEA 3PW2A 4FFBB 4L7VA 4QO8A 4F12A 1OYOA 2C2DA 3LQ2A 1VJTA 4U5QA 5TC4A 4G0NA 1QH9A 2CXQA 2HA6A 2BE7A 2XNKA 2E5WA 3WLKX 3PKZA 5AI4A 2ZJAA 1WVGA 2VHJA 3D6NB 3P2JA 4JUFA 4MUMA 4XWAA 3U81A 4E4YA 1V7CA 1NDUA 4RY2A 4D3YA 2VPQA 5JFOA 5DGTA 1AKRA 5L3QA 3JRXA 4F5YA 4ZD6A 2I6XA 2C95A 2WWHA 2WIFA 5AJHA 1R66A 3DM5A 5BMVF 2VTBB 4QFCA 4W1SA 1E3WA 4BFLA 3DZIA 3LCUA 3ZIUA 2P1RA 3V2IA 4LVCA 5LYJB 3ZE8A 3J81A 3GT7A 5DLPA 2WB1C 1EK0A 5L3QB 3LBIA 3F74A 3F5EA 3BDIA 4XSVA 3LYHA 1KBOA 1LSSA 4I8XA 1S4QA 4XARA 4RPJA 1DC7A 5HM6A 4U2EA 5DHUA 3QLUA 2XNDD 5K3EA 3LNCA 3TR0A 4MA4A 4CIVA 4BBPA 3D0RA 2WFMA 3LMKA 4C1NA 3KHGA 3NM6B 4IF4A 2H4HA 1E1CA 1QFZA 3A6KA 1DKLA 4GS5A 4EX6A 9ICGA 4E1VA 4QE3A 4JXZA 2BHLA 3H19A 2HXSA 3N6RA 3ETRA 3PI7A 1UPTA 3T0FA 5B6IA 1NC1A 2RI1A 2O0KA 2YXDA 3GFSA 1X66A 1IXSB 4QRIA 3UCFA 4EPYA 4PN3A 2XICA 3NFYA 1UDAA 3ZWQA 1OI7A 4DMFA 4JR0A 4AXXA 3MS4A 3I30X 2XVMA 4BDPA 3AX6A 3JX9A 3W3AD 2ZRIA 4UPDA 2D62A 1UPUA 1SQGA 2R47A 3DEJA 1X0XA 4FS8A 1FUEA 3H87A 1HKUA 3ZI7A 2ET6A 4LOKA 1J8YF 2V3VA 1C0KA 4EI8A 2AZTA 3O0FA 1QDEA 2DLDA 1CETA 2G77B 1E60A 5IBRA 5GJWC 3D6VA 3GCXA 4TL8A 1D2NA 1L5RA 4PLPA 5FD8A 3A2KA 4XEHA 1JSCA 3KP1A 2R18A 3F73A 5EWEA 2W9XA 4FB5A 1GPYA 1R4NA 3CH4B 1ZNXA 2A2ZA 5DTJA 1MIHA 2Q50A 3FDJA 1JAXA 2R6HA 3WDSA 1MO2A 3ZLJA 1TJYA 1UJNA 1ZW6A 3L7MA 5ILGA 4DLUA 3WGGA 2BI4A 5AQEA 1ZVVA 1SAYA 2E5FA 3JD4A 2VHVA 2X2FA 3O1JC 2JJ2A 3D59A 4RF2A 5TGDA 4DCVA 2DLNA 5L1KA 2YVKA 4MW4A 3HU3A 4C0KA 4M53A 5FPPA 4DMRA 2J3IA 4B7XA 2AXTU 4TT8A 4C4SA 2NTNA 1JEYA 4ZCQA 4QTXA 2BGTA 5IYZF 3THOA 1JE0A 5AKZA 1FLDA 3M81A 1N1EA 3OUTA 4GGPA 2EP5A 5AOVA 2J6UA 2GKSA 1D7OA 3T0GA 1DKNA 2BLLA 3DT9A 2YJ5A 1SCDA 3RIMA 3V7NA 4Z9AA 7MDHA 3C41J 1T4MA 3AWDA 1JJIA 4ZVPA 2EVWX 3H2SA 3CLHA 1NKBA 2DUWA 2G08A 1KMCA 1CQJA 1Q11A 2GERA 3M5DA 3OX2A 1GU7A 3WTCA 2YMMA 4MJ7A 1ZQFA 1LFDB 1YTLA 3AZQA 4M1OA 3SJBA 3SQXA 1KH1A 4FFWA 3KJXA 4M38A 4QWAA 1NF2A 2HBMA 2Q5JA 4HAWA 4MJ3A 3U4QA 4L0DA 2XTMA 1XZKA 1FNMA 2FSHA 4BFUA 1K6JA 4Y30A 3GG2A 4DR3B 4DSOA 2CY0A 3EUWA 2E89A 3L1VA 2Q4TA 1G19A 2Y1FA 4L51A 2X9NA 4M0PA 4G23A 3PY8A 2KI5A 2P65A 1E99A 4DDUA 4Y7DA 1FFGA 5CPBA 3KO8A 5DNAA 4TWAA 1Z4JA 4FC6A 2AMLA 4LECA 5ALKA 1GPKA 4PNEA 3DWIA 2P91A 1II0A 2WICA 2QTHA 3PNLA 4O4IB 3I12A 4WINA 2VA9A 3O7MA 1Z17A 8ICBA 3PA8A 2CSXA 3EVBA 4F0JA 5BWMA 2ZT8A 2D3TA 1DBSA 2JAWA 2XKKA 1GEEA 4TN1A 1NXSA 4MFCA 2A0UA 3N86A 1MA3A 1TAUA 2C4MA 1XCGB 3E2PA 2PCJA 4QZGA 4UB4A 3LT2A 3N2LA 1BS9A 1FYWA 1U8TA 2C3UA 2I2CA 4NV0A 3HB4X 4HQOA 1REQA 5TEVA 4KNVA 4IGKA 3DKIA 1LDGA 5HGXA 3R5TA 3GGJA 2ALJA 3SYLA 4AWAA 3PC4A 2BTQA