2WF5A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and trifluoromagnesate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf5A01
5AW0A 5AKLA 2CFSA 2I55A 4I9GA 3I28A 1RMTA 4OHFA 2Q4RA 3MMZA 3SD7A 4OFZA 4O8CA 3ZX5A 1Z5GA 5ALLA 4HGNA 5ALFA 3ESRA 1U2SA 3ZX4A 4YCMA 1Q91A 4XOUA 2YMPA 5ALIA 2HEGA 3M9LA 4UMFA 3L5KA 5ALHA 5ALTA 3QLEA 3ZUPA 5AVWA 5AI6A 3NALA 1QYIA 3A3YA 3ZTWA 2B0CA 1RRCA 3CNHA 1F5SA 4UM5A 5ALZA 3W5BA 5AVXA 5AK6A 2FPXA 3MPOA 3L8FA 3WK4A 5AI8A 1ZD3A 1L7NA 3ZWDA 4OD0A 4BBJA 5IT0A 3L1UA 3A1CA 1U02A 5AM4A 3UMGA 2MU1A 2HO4A 4G63A 2HHLA 1LVHA 1L7MA 1Z4MA 3NIWA 3OPXA 1ZRNA 4DWOA 3OCZA 3L8GA 2YY6A 2YJ6A 4BX0A 1Z4JA 3IRUA 2R8ZA 2RBKA 4Y2YA 2C8LA 5AW5A 3DNPA 4BEVA 2B30A 3EF0A 5ALGA 3AR2A 2WF6A 1SU4A 1L7OA 1YS9A 5AI9A 5T41A 2YJ5A 2BY4A 5AVTA 2IOFA 1Z4QA 4NABA 3GYGA 3U7GA 3QYPA 5IT4A 1JUDA 1TJ4A 1WVIA 4C4RA 3SMVA 4Y2VA 3CZ4A 5JJBA 3EPRA 3QUQA 2ODAA 2HSZA 3QUCA 4UARA 5AK3A 4NWIA 4HGPA 3PGVA 3I1YA 3BWVA 3FGOA 2JAUA 1T5SA 3R9KA 2I6XA 5AICA 1TJ3A 4B6JA 3N8GA 5A3RA 3WKDA 2G80A 5AW4A 1IWOA 4H1WA 1TE2A 4JB3A 3ED5A 4FE3A 5ALUA 1QQ6A 1RKQA 2EARA 4YCNA 3UM9A 4HAIA 4DW8A 5AVYA 2ZBDA 5ALWA 2PKEA 2GO7A 4G9BA 4NV0A 3OCUA 3QNMA 2IA5A 2ZBEA 4UMEA 3F9RA 4QQFA 4UU1A 2JAOA 2RAVA 3WK7A 3ZVMA 2NO5A 1WZCA 2R8EA 1CQZA 4L6AA 3ZVLA 4IG4A 1RLTA 5A3SA 3DV9A 5ALJA 3ZTYA 3QU2A 2D2VA 1SWVA 2ZOSA 4XQ0A 2JGAA 5AM2A 1RPZA 5ALMA 2OBBA 1XP5A 3FPSA 1Z4IA 1QH9A 3U7EB 2C9MA 3QX7A 5AKKA 5FP0A 3QUTA 3QXGA 2VKQA 4DFDA 5ALYA 3WK8A 4UU0A 5ALPA 5AI0A 3P96A 3W5DA 3N28A 2QYHA 1Q92A 2NO4A 1NNLA 2R8YA 5AW8A 3OCVA 3AR4A 4BKMA 2YMMA 2FPRA 2CFRA 3L8EA 1ZD4A 3AR6A 5ALKA 1U2TA 4NAVA 4YIHA 1WPGA 1CR6A 5AVUA 3WGUA 3ESQA 3R4CA 3U19A 3VAYA 3AR8A 2W43A 3MC1A 1KYTA 3PDWA 3ZW7A 1ZD2P 5ALEA 2R8XA 3FPBA 3QGMA 2YJ3A 4EX7A 4CF5A 5ALNA 3KDPA 1RKUA 1VJRA 4KX3A 4ZEXA 5AIAA 3L1VA 1ZD5A 3KZXA 2W4MA 4MUMA 1EK2A 5AKGA 4XPZA 2W11A 2GHQA 4GIBA 1Z4PX 3PGLA 4CF3A 4AS3A 3L8HA 5AHXA 2MU2A 4Y2SA 5AM3A 4HGOA 1YDFA 3K1ZA 4YH1A 4UMVA 1Z4LA 4FFDA 2P11A 5AESA 4KNVA 3KOOA 2JARA 3A1EA 5ALVA 2AGVA 4BNDA 3L0CA 2FUCA 5AKIA 5ALDA 2G06A 2B8JA 3UMCA 5AM0A 5IS2A 4UAUA 2AUTA 4Y2RA 5AKHA 3RFUA 5ALXA 3L0YA 3QU9A 3L7YA 4UW9A 4ZEVA 2ZBFA 2RARA 5AVVA 5AK4A 2MSNA 5AKJA 1N8NA 1L8LA 1PW5A 1XPJA 4HGRA 2EAUA 3ZVNA 2RB5A 4EENA 1Z88A 3RF6A 2FI1A 2HX1A 2FPSA 4AP9A 4L6CA 5AKZA 1YNSA 2QLTA 3NRJA 1N9KA 2Q4TA 3ONNA 3U13A 2FPUA 2CFTA 3B9RA 5AIBA 1U7OA 2B1QA 1YV9A 1J8DA 2WF5A 4AS2A 2IYEA 3KD3A 4YCLA 5AVZA 5ALRA 1Z4KA 3FVVA 4YGYA 1VFPA 3U26A 5AKXA 1O08A 2B82A 3NASA 2GHTA 4Y2PA 3N07A 1RC8A 1NF2A 4Y2XA 5AW1A 4Y2JA 2C88A 2WF8A 1AQ6A 3KBBA 2ZG6A 4C4TA 2AH5A 4PNHA 3N5KA 1S2OA 1T9ZA 1ZJJA 3DAOA 1ZS9A 3NANA 3IJ5A 4BNDB 4UM7A 1YJ5A 2B1RA 2C8KA 3AR3A 3N1UA 1XVIA 3AR7A 3QU7A 2P9JA 2ZBGA 3B8EA 3HYCA 1Z5UA 3I76A 4KX5A 2WHEA 3ET5A 2X4DA 4Y2UA 4KYTA 2ZXEA 1WR8A 3OCXA 2YJ4A 5AKYA 3SLRA 3UMBA 4KN8A 4Y3UA 3ZI4A 2HOQA 5A3QA 2HF2A 2WF9A 4XE5A 4Y2QA 2AMYA 3E8MA 3KC2A 3ET4A 1S8OA 2CN1A 4BX3A 3WK5A 1RMQA 2WM8A 5AVRA 1LTQA 3EF1A 3PCTA 2B8EA 1ZRMA 5AVSA 4RETA 2OYCA 1FEZA 1SWWA 3QU5A 2I54A 3QUBA 1NRWA 1O03A 3J7TA 2IOHA 5AI4A 2I34A 5AK5A 4JDPA 2YMLA 1X42A 3QU4A 4IFTA 3WKEA 5AM5A 3W5AA 2YN4A 1ZOLA 2O9JA 2FPWA 2NYVA 2YBDA 4FYPA 5AW2A 5E0OA 4BYGA 1TA0A 3AR9A 3M1YA 2C4NA 1VJ5A 1L7PA 3U7HB 4UAVA 2WF7A 4OCZA 3AR5A 3EWIA 4YIKA 3E81A 3E58A 1EK1A 2FEAA 2PQ0A 2I7DA 3W5CA 4QJBA 1QQ7A 1K1EA 1RQLA 4Y2TA 5AW7A 2I33A 4ZEWA 4UATA 4C4SA 3WK6A 5AW9A 5AM1A 1T5TA 4UASA 4CF4A 2FUEA 3SKYA 4EELA 2HF7A 4MWOA 3I6BA 1RQNA 3FM9A 2OM6A 3DDHA 2BDEA 3WK9A 5ALQA 2GMWA 3L0BA 5AW6A 1MH9A 3A1DA 4NFLA 1QQ5A 4DCCA 1Y8AA 1YMQA 4HGQA 1L8OA 3WKCA 3D6JA 4I9FA 3SKXA 3FZQA 1RKVA 4F71A 3TLMA 3WGVA 1RDFA 4CNQA 2PR7A 2HDOA 3IB6A 3S6JA 3SHQA 4BX2A 3R09A 5AVQA 4BEWA 5ALOA 4EZEA 2G09A 4KNWA 3ZWKA 1J97A 1RMYA 2GFHA 1RLMA 1TJ5A 4L57A 4RESA 2FDRA 3OCYA 3OTQA 2G08A 2Q5EA 3WKAA 4EX6A 5AW3A 4CE6A 2HI0A 4EEKA 3MN1A 2YMQA 3WKBA 4J2TA 2IOFK 2YFYA 2P27A 1RLOA 2G0AA 2JAWA 2HCFA 5AI5A 3HLTA 1Z4NA 2WFAA 5AKEA 3NUQA 4F72A 4J03A 2OA0A 3SF0A 4UMDA 4HYTA 3ZU6A 3BA6A 3E84A 2P69A 1L6RA 2BDUA 3NAMA 2G1AA 2EATA 2G07A 2O2XA 3OCWA 1Z4OA 5ALSA 1U7PA 3B9BA 2DQSA 4GXTA 3U7FB 4E88A
chains in the Genus database with same CATH superfamily
2EW2A 4K2HA 4ENVA 1P17A 5KFFA 3E2PA 4RIFA 2I6SA 4Z0NA 4CTKA 4R9VA 1WCLA 3KPUA 4DOBA 2QR5A 1D5WA 4MVJE 1RRVA 3MW8A 1M1YB 1RYBA 2OAGA 8ICWA 2DQNB 3PL5A 3FNBA 1FS6A 2LV8A 3ESRA 3HNRA 4I4CA 3UAOA 4CT0A 5CFZA 1KJIA 8ICHA 2D7JA 4C0SA 3FUTA 2QXYA 2ZSFA 4C0QC 2FLWA 3IJRA 3ND9A 3D59A 1QGOA 2XHZA 2AEJA 2ZJBA 3CUWA 4IIYA 2B7CA 2VS1A 3L5KA 4OHPA 2C97A 3EC2A 4UAZA 4F2SA 3TNJA 2GBLA 3HBAA 3OT1B 1C9DB 5HZHA 4UBOA 1UEXC 4RM3A 2I4MA 2A5JA 3BTVA 2R8HA 4LQCA 5DULA 1AU9A 1Y9AA 2OXRA 4NV1A 1R5BA 5HGXA 2C5GA 4EUHA 1QHXA 4L3OA 4TS3A 3TEJA 1DX4A 4MWTA 4R2KA 3WGMA 4J91A 2GEBA 3GVPA 4C1NA 3DG9A 4WI1A 8ICCA 1RXSA 5AVOA 4YMOA 3BHJA 2CZGA 4M9JA 2HKIA 1TCVA 4DV2B 3UB4A 2E18A 4EPVA 4E51A 3DVLA 4MWBA 3TW8B 5A3VA 3KKLA 2X0DA 4J07A 5FWYB 1LCIA 1A8IA 3A1TA 1OAKA 1QIKA 4PLHA 1JSZA 3ZDQA 1B2LA 4CW7A 2F90A 2JBWA 5FUXA 3HU3A 4FOLA 3LH5A 2O8CB 2XMRA 1P1IA 2HLDA 1C7RA 2YJ6A 1TKBA 4J0JA 4AJPA 2VTDA 4F56A 4Z4EA 2ZB4A 3OKFA 2R8ZA 1HK7A 2BRUA 2ZZKA 1PZMA 3JASB 3K7EA 4WNAA 4CMKA 1K98A 3HLKA 3IYLW 3MB5A 4YXWA 4XFKA 1DAHA 2ZGVA 4HD8A 2D5BA 1U0RA 7MHTA 2W4QA 2AQKA 2B4RO 1NBWB 5L8VA 2PO7A 3QWHA 5E1DA 2ZBPA 3RV3A 1AOXA 1VG0B 1XQ1A 3P94A 4QTUB 1ELOA 2WQ7A 4BV3A 2HR1A 1R5JA 1M34A 5BR1A 2DPJA 1L3IA 3A6DA 2C59A 3ZD6A 3MGVA 4G0NA 4IIFA 4XXHA 1SK9A 2HTFA 3N2YA 1MJNA 4HRYA 5I7WA 5AK0A 4BNUA 1CDDA 1N9ZA 3KV3O 4MKXA 4NYJQ 2JR5A 3EUWA 2XBUA 5KG2A 3RODA 1UJCA 3P4UA 4H1VA 3HU1A 4KGZA 1DIGA 3O8NA 4M8NE 2GSWA 3GLHB 4PAGA 4Z6DA 3DZCA 2I8CA 2PUCA 3KXKA 1RYUA 2FMIA 4R0VA 3IODA 1H9BA 4OJPA 4MVJI 2JEZA 4AMYA 3M6VA 2CVZA 3UUGA 5CAEA 4HFMA 3U2QA 4N0QA 3UK7A 5JAHA 3ZK7A 2QMHA 5KS2A 3I2KA 1SUBA 4PHDA 1DP4A 1T8SA 1UOPA 1ZJZA 2G1UA 4PY2A 1WPXA 3PX4A 1KIMA 2K4HA 4TV8A 3FWHA 4XYGA 3CIFA 4H1WA 1EZZA 1GN8A 1P4SA 3H4IA 4HRVA 1XVLA 2BMWA 2XUDA 4HWRA 1PK9A 3KR0A 2OO5A 3LO5A 5E4FA 4E6PA 2HU7A 5FLXA 1W87A 2B21A 3H8JA 1QHSA 4YRKA 3I09A 1DC4A 1Q0UA 1KARA 4HEA1 1J4AA 4EOGA 2ZJZA 5ALWA 2PKEA 1BVRA 1EAYA 4MUXA 3LBHA 7ICRA 2P0YA 1P2VA 2GM9A 2OY0A 4H7DA 2H63A 5EJFA 1VJTA 5FPQA 3KQYA 1LW6E 3AI7A 5FBLB 3A26A 2JF0A 3JY6A 1DBWA 3O2SB 3AEQA 3TD2A 3D6HA 5LP6A 1DO8A 4XQEA 3UFXB 1LQTA 4KOAA 2XZTA 4U5XA 2YZ7A 5JJCA 5JV5A 4GC6A 5K6AA 2X2PA 3I9OA 4OQMA 4WZZA 3KYBA 3V4FA 1II9A 4PG6A 2XICA 4PCVA 4OK3A 5JJ5A 2WIKA 2OT3B 3RFTA 3PTAA 4HATA 3MWEA 3SAGA 1WJGA 3AJRA 1U7DA 1AKNA 2IRWA 3DBOB 1O5TA 2X9VA 3DV9A 1G7SA 2GPNA 3IAM6 3OOWA 3QU2A 3PDIA 2PLAA 1U45A 1XQVA 2KJQA 4JGGA 1ZNYA 4NE2A 3TMAA 4MWGA 2RSLA 3TXXA 3Q8PB 3UOAB 2XCSB 2O8VA 3SYTA 2JW5A 2XMZA 5JE8A 4KXYA 1VXOA 5DSTA 4F6RA 5KNBA 4UTVA 4IVNA 4M0AA 1PWEA 2ZAMA 1QU2A 1G8SA 2Z6VA 2AI3A 2C03A 4TS4A 4X1IA 3AF2A 2V7UA 3IG8A 2QRUA 3G9QA 5TNXA 1FSSA 3RC8A 3BQ7A 1OYOA 5HIJA 4M7OA 2YWCA 2GAIA 4LCEA 4MA5A 3KZKA 1I0ZA 1OX6A 2H3HA 3R8FA 2KV2A 1URPA 3CLRC 1TMGE 3R7WB 4I1UA 1QRUA 1FS4A 2BMEA 4IDFA 3M7DA 1JFLA 1ORTA 3OE5A 1OH6A 1XSPA 1QCZA 3AEZA 3GLHA 1ZGAA 3I6YA 3LQYA 2UZ0A 2R8YA 3RLFA 2C5LA 1U9JA 3GFVA 4FCWA 4L4XA 4Y1EA 2J87A 3S1AA 1WCWA 1E32A 4JC5A 1G0NA 4ECQA 4TPKA 4BKMA 3A9SA 3R3WA 4F3NA 2I6UA 4IEEA 3AR6A 3E7XA 3U17A 9GPBA 5KMGA 2FP3A 4OHXA 4B0OA 4PTLA 3DHVA 4MKRA 5CDFE 2PUDA 3EOZA 4FGLA 3FKQA 4YCXA 5D46A 3I01M 3TSYA 3AERA 3SQNA 2BUBA 1JIHA 1KIAA 2DYKA 2RDMA 3HMQA 4MYHA 3V42A 3ADPA 3O8QB 1AZSC 1X80A 3ZZ0A 4YPOA 1QFZA 4KLDA 1JQDA 3ETLA 1ADYA 2FEKA 1E79A 4Q1AA 1QCDA 3D2BA 3L1VA 3LVRE 4DNOA 2ANBA 3V1LA 1WTAA 4F3RA 4U6QA 1RS0A 5JS1A 4XR9A 1ESNA 1LLUA 3AUUA 1N7JA 1P80A 3AI1A 3MUOA 1IEQA 4GP7A 1VKNA 4ISCA 1UBUS 4TSKA 5FA5A 1L1QA 1BA3A 5JCJA 4J9SA 3H19A 4AZ0A 2IXGA 2F8MA 3CF6R 5HJ5A 1GCGA 1OI7A 1Y3AA 2DECA 2OLEA 2C3YA 3GLTA 4O4LB 3VYSB 2IHJA 3G2LA 4P4LA 7REQB 1JLKA 3BL5A 4CNBA 4O3OA 1QBKC 2MA1A 3FY4A 1EBFA 1M5TA 1IFXA 1VSBA 1GV1A 1O9GA 2DHQA 2JJYA 4MYRA 1CEYA 3SEQA 5DHRA 2O2DA 4F8JA 5IS2A 1DXSA 4YXMA 2GM3A 3CUKA 2YFKA 3L4BC 1JQJC 2W2OA 2H2DA 4TYMA 3VV2A 3CVOA 5TXGA 5EY5B 4ZEVA 5HKLA 3C2KA 1WUIS 4IBOA 4YUZA 5AKJA 2AK3A 1XQWA 3STHA 4G65A 1NW5A 3VHXA 5IVKA 1PG2A 2X7JA 1J09A 2WHQA 3LVWA 1ZQBA 2YKGA 3A6ZA 3ESDA 3N70A 3ACBA 2DQ4A 2Y0DA 4KPEC 4WJ3B 2NPOA 5KL8B 4IR7A 1DTEA 3F3SA 7AT1A 3A10A 3X2SA 5B6PA 1YNSA 2VPQA 3RGWS 3PXAA 3UWOA 3IT2A 4I1YA 3VYVA 4PINA 3NJ8A 2NUTA 1ZQRA 4HXFB 2DCUA 2XUGA 3ETDA 3NUGA 2ADMA 4NCJA 3TLBA 3UOWA 3PQ5A 2DWOA 4JH0A 1LPNA 2M9MA 4YJ2F 2MYNA 3HVHA 5DNUA 5KYYB 4RK4A 2XOKD 3IV7A 3HRHA 1A97A 2ERCA 5JS8A 5FNVF 3RARA 3RHSA 2OLKA 2I8LA 3EGEA 3KHHA 1Z4KA 2PLRA 3FDZA 3F46A 2C31A 1OFHA 3PSPA 4MRMA 4FNAA 4NZZA 5AHRA 5CFQA 3U26A 3K70D 3FNRA 1VDMA 3CEAA 3EW7A 2HA4A 3P0JA 2QBYA 4TYWA 4RJLA 5HPYB 2GLTA 1O95A 4EEYA 4Y7DA 1J25A 3MABA 4Y2PA 4WLFA 2JJ2D 4ECZA 3ADDA 2KJ8A 2YCBA 2OC4A 4AG6A 4Y2XA 1UEIA 3G8DA 4R41A 1UK7A 1UINA 4AKTA 4FYWA 3CUUA 1MTOA 4GOKA 3N2KA 3PDHA 4ITVA 4QTYA 3K5HA 1CD5A 5AJVB 1U0BB 3KBBA 3HG7A 3DAPA 1YACA 5I9MA 1USIA 4GQAA 4CV1A 3ZHQA 3D3JA 3N5KA 3C3DA 4OP2A 3TD6A 4G41A 3WHLA 3ZHYA 4PLCA 4I55F 3RASA 1WXIA 3U6KA 2R7LA 4P0PB 1X70A 3QEJA 4UB6U 2GILA 2XYHA 5BQPA 2X0EA 1U3TA 2PUGA 1BMTA 3OSNA 3RU3A 1EVZA 1JH8A 2Z98A 1V35A 1TQHA 2ZI7A 3H0CA 3V9AA 1N77A 1TAGA 4LCJA 1JNXX 2JZCA 3CE9A 1OTYA 2MT9A 4H1UA 2OSVA 4X6XA 5E7MA 5CXUA 2J3EA 4L27A 1D1TA 4WESB 3HDGA 3TLCA 3A2NA 3QHAA 5ESRA 4R83A 1XE3A 2JBAB 3AY3A 4M8LA 1DK2A 2BGIA 1FLAA 4H1TA 1SZCA 4L0QA 4PHTA 3SICE 2TMGA 3EY9A 4MV0A 3TXYA 2GSDA 3W5VA 1Z5PA 3MYYA 1P81A 1JQEA 1MF7A 3E8MA 1GTMA 3EFEA 4C3VA 3W78A 1NFFA 1J0DA 2Q8PA 4ZZ3A 3G6VA 1CBUA 3DDZX 4EZIA 3A1FA 4UHEA 5L3QB 2ZIWB 3KIPA 2VA2A 3ND5A 1AUVA 3AI2A 2Q6IA 2R7KA 4C8OA 1FNBA 2FZEA 4GSYA 2A59A 3KLBA 4E12A 1AE1A 4TUYF 1EP1B 5ISMA 4FZ5A 3T3MB 4NDZA 3B1WA 3QXXA 1OMOA 2VTVA 1KAGA 4JQSA 4YQWA 2QW1A 4I2CA 3H9JA 3WJAA 4UREA 1OASA 2B2NA 2C2WA 3PRYA 4IUYA 5CT4A 3U7QB 2X15A 2P9QA 3EW9A 1LC3A 2P68A 4F5WA 1ZHHA 5GONF 4EY5A 4FZ3A 4DCOA 4LBVA 1FDUA 4RW0A 3HYSA 4FBGA 4X71A 2JEOA 3C5EA 4X20B 4YAJA 3MJFA 3P27A 5DN6A 1PZEA 2C4NA 3PUYA 2E5WA 5DHAA 1B7GO 3JVEA 2DBYA 2FMSA 5IIKA 4IYRA 4EW3A 3WMGA 4GWKA 3H5WA 3KFXA 1XMOB 1ZH2A 5JS7A 5B58T 4O5AA 1OZAA 1UJ5A 2V9ZA 4KGVA 3KKOA 1POWA 3LTEA 1MABB 4TZKA 1YR2A 5ER9A 4MIYA 5FCDA 5HIAA 3C87A 1DADA 4RELA 2IY7A 4PZAA 2OGTA 1UPTA 3ZLVA 1QQ7A 3VA7A 8ICUA 1G3IA 1U2PA 2PRYA 2OAQ1 3G8YA 3OIWA 4GMXA 5J2AA 5EJ8A 3MSCA 2D7CA 1EK6A 2WB2A 4CHGA 4PFSA 2ADFA 2BZFA 4HADA 1XCJA 1BOOA 2FVXA 1GGVA 1QUFA 1IQPA 3NVAA 4KQ1A 3SLKA 1WUTA 3ICCA 2CFIA 3A4VA 4U2BA 5ILQA 2Y1JA 3M9XA 3LG2A 3SQDA 3LY5A 4MWOA 1F4PA 5FORA 4ER0A 3B6ZA 4QOFA 3OQMA 1YR1A 4QYSA 4EHFA 4IV5A 2G9RA 1DBQA 4NCXA 5F9MA 1GGJA 2WQ6A 1T8YA 5DB4A 2F62A 1QRAA 2R7AA 3AU8A 3NM6B 4WESA 4HZGA 4DCCA 2I4OA 2IGBA 4BV9A 4Z9AA 1LLQA 1KI6A 4UCFA 2XY7A 5F1PA 3W4IA 5KT3A 3G9UA 5BV1A 2I91A 2QVGA 4JL6A 3O0DA 4M8SA 4Q5IA 4RA6A 2X7XA 2R65A 4O9MA 3SYZA 3GUCA 4FJ0A 5DHFA 2VQ6A 1RKVA 1HQDA 1XC7A 3H6HA 5E3JA 4D8UA 1G8PA 2J07A 2Q41A 3K05A 2Q1TA 4KLCA 4LDZA 3S6JA 4BX2A 1RW4A 5JADA 2QKYA 4AP6A 1JIUA 2R6HA 4YMUA 2WJIA 4QT0A 4BJQA 3TQCA 1K1SA 1S7GA 2PA3A 3CEHA 3LVFO 3EEYA 5FBZA 3UICA 1FP1D 3BD6A 2CNKA 2D54A 1MSWD 1NATA 1ICEA 2CNNA 2KBFA 3MCVA 1RM4A 3FKSA 3KZ1E 4XQCA 4C43A 2PL1A 2IYRA 3SNHA 3W6UA 2VRNA 4G56A 4KFRA 3VKHA 1UM8A 1PK1B 5FUBA 2VDKB 1HMPA 2ZPAA 3DOJA 1RKBA 5F73A 5FPYA 1Y98A 3IHLA 4ZOAA 1C3EA 3KNZA 4JCCA 2SBTA 2A0FA 2HI0A 3IAS1 1Z2OX 2SICE 4QWMA 4YMIA 5B55A 2PTHA 4GE0A 3FXAA 1MCZA 4JI6B 1KU0A 3TI7A 3V4PB 3ZK9A 2C94A 2WTUA 5K0ZA 1WUJS 3KJGA 1X77A 1ZMRA 2ORIA 3DE7X 3CXUA 1GT6A 2B98A 4ZEOA 4OLBA 4MI6A 1DRWA 5JVDA 4EHDA 3R0IA 4A4DA 4QLBA 1ODIA 4II3A 3RS0A 4QWAA 1L6NA 3LUCA 3NP7A 1QAQA 5GTDA 4R66A 3WLHA 3E9ZA 1KFBB 1BMQA 3P71T 5IARA 1U1FA 4BFUA 3AHEA 2EKLA 2MINA 2JA2A 3A2LA 4HDCA 2ZANA 1EJBA 2FDXA 2LYBA 4GBJA 1Q74A 5F12A 3VV3A 3ZWMA 1N8SA 4QZHA 3PVSA 2H06A 3L49A 1GDHA 1Z4OA 4TS9A 4R9NA 4I1PA 3THVA 5ALSA 1H4TA 5EE3A 3ZJ5A 3NEAA 4M4SA 4X0EA 3AY0A 3DB1A 4OHYA 4KLGA 4BZPA 1SVNA 5EHZA 1M8GA 5DB8A 2Q2QA 1UPBA 4FS1A 1JQAA 2JFXA 3GEGA 4MAMA 1ZCJA 4OHFA 3PLNA 1XYGA 3EXHA 5EIBD 2J9FB 1G3MA 2AOUA 3H83A 5DXJA 3WB2A 1VDVA 3E18A 5KC8A 3BERA 5HMLA 4I46A 4OHOA 1O57A 1LDEA 1SHKA 1GUYA 4O8ZA 1KI6B 4RSHA 4L5JA 4HXGA 4CLRA 1W19A 2ZXFA 4TXLA 4C5AA 5JXWA 1H38A 2AUNA 4RQ8A 1S89A 3GMIA 4Q03A 3U16A 2PX3A 2BGKA 1JQKA 4P5EA 3THYA 3DEAA 3F7MA 5ALHA 1PNVA 4YCJA 4P7FA 3AM9A 3QX8A 3OPYB 1EXNA 4RORA 3WU2U 3CJRA 3U7JA 1L7EA 4RD4A 1ZCZA 2GPWA 2GRUA 2PY6A 5C31A 3TNFA 5ITVA 3K0SA 2PL5A 1TADA 3EIXA 3MDCA 3GT7A 1F6DA 1A2OA 5AVXA 3EOAI 4IMJB 5FXMA 4CM4B 3SKVA 1D9DA 4FN5A 3B5IA 2O3RA 2C5HA 1X86B 1U0FA 3BM5A 2NX2A 1KMMA 4RQ0A 3GRKA 4R31A 3VYRB 3COYA 1Y3DE 3OEHA 2YVUA 4JYAB 3W8RA 5FA8A 1U2RA 5C35A 4AO8A 1ZOOA 2GX6A 5JY6A 4R40A 1Q84A 2H1OA 3L05A 1FNCA 1NYTA 3D7KA 3VR4D 1MJFA 2R85A 4HPXB 4L6IA 4UZFA 4ADSG 4ND7A 1EK5A 2X5KO 5KTQA 2ZIGA 4FFMA 4EB3A 4Z7JA 1S8AA 3GCGA 1R1DA 4HUQA 1M67A 2QPLA 4GU5A 4RZXA 5FIUA 5IX8A 2GI4A 4KJZA 2HWYA 3R3HA 5KQSA 2XMSA 3WL6A 5L1LA 1TUEA 2BKXA 1QE5A 5BR8B 3PPIA 4PZUA 2R1TA 2FW8A 2QSYA 3O0TA 4MUIA 2P9EA 3ROZA 5K8VA 1V16A 2XUAA 4DR6B 2R9VA 2XUFA 2HSJA 3SQXA 1BEEA 2B6GA 4D3ZA 3QH4A 4R1UA 1AIPA 3U4CA 2ALZA 1BD3A 1ZQAA 4RK6A 1OZHA 3CLKA 2ZJ2A 3VR6H 3RVOA 3GQVA 4NK5A 1YS9A 4A26A 1J1UA 3WIVA 1RZTA 4ZOLA 3LK7A 2PMCA 3LQ4A 2JASA 3GGSA 4OLHA 2ZYRA 3VNRA 2F77X 2C82A 3SR4A 5K9ZA 2C4VA 3QFCA 1FX1A 4LJ6A 2XMDA 4B87A 5KDDA 4AN0A 2IPOA 2AZ4A 5E6SB 5U9CA 2H1WA 3SHTA 3V7FA 3K5PA 3HHPA 4GMGA 3LC0A 2F2TA 3ANSA 5TQ0B 3N7SC 1LDMA 1K7YA 2WWYA 5HFJA 1V48A 3ADCA 5C2JB 2WSIA 3VC2A 3L7BA 1JDPA 3PGVA 4DMCA 1MEOA 5EIFA 2MRLA 1GNTA 3M0EA 2CSUA 5IKOA 1A76A 2FZLA 3F78A 4QEKA 5DIFA 3B7WA 5JD4A 1JEQA 1SO8A 4HJXA 3INNA 4LVCA 5H82A 2ZIXA 3MELA 1U9CA 3E70C 4LDPA 4AMUA 3WKDA 1E1QA 2F3PA 1KP3A 4PGHA 5K8TA 2QD3A 1LF0A 1Z2NX 4V0LA 2AHOA 5J5CA 3RRZA 3WRYA 4AF7A 2O7SA 4JR1A 2IYOA 2J4FA 4RUCA 1HDYA 2GN4A 3Q3CA 4GDFA 2J3MA 4GL4A 3RT9A 3IUYA 3QLVA 3P2JA 3U9SA 1AF7A 5DWVA 1UAGA 4HAIA 1V1MB 1CUJA 1EWRA 1L5HB 1I2BA 1R6TA 1T5BA 2P77A 3IDZA 2OD2A 2XBLA 3MUEA 3P1JA 4J0CA 5F2EA 4R6XA 4E08A 4NCAA 3IVGA 4QL3A 3R0XA 4DJFC 5B30A 1JH9A 2YTUA 1XRNA 3GH1A 3RR8A 1F2DA 1QKIA 3DQQA 3JZAA 1YD7A 5C80A 1JXQA 2KVCA 1YCHA 2J7PD 1V8BA 3ACDA 1S3FA 2O19A 2NO5A 4KIGA 3MWKA 4HP8A 1OY1A 2BFCA 4MGIR 4HMOA 4HWPA 3HKZC 2BH9A 2A78A 1F9AA 3OG9A 4GD3Q 4QW9A 1R50A 2ODGA 4CLEA 4BNXA 1TUIA 1E3QA 3HVRA 4LNUB 4EYQA 2IY9A 3R41A 1U3VA 2ZR9A 5KJ6A 4I81A 1W6UA 1HWYA 3RK4A 3JCZA 3P20A 3T7EA 4Q3BA 4JBLA 1DXQA 5DZSA 5E1MA 1N0WA 5FTWA 1KFDA 2DFKB 3IELA 2GWSA 1E1YA 3TL6A 1IVYA 1RIFA 3M2TA 1F4LA 4IQTA 3N4MB 3OETA 5KPJA 3VDNB 1YI8A 3GJTA 1MLDA 3C74A 1EP9A 2ZJ5A 1UODA 4KQ2A 1J22A 2W8ZA 5FWAA 4Z7NB 4O4HF 1QP4A 4Z0PA 3ELWA 5ALMA 3DBIA 4QU5A 7ICVA 3NAZA 4PYJA 1CB7A 3PSIA 2XQGA 2OBBA 4PC6A 2QMOA 3WL3A 3WRVA 3LRTA 3VPCA 2H3IA 4B9VA 1YO6A 4IG9A 1A5SB 4BB5A 1ZLYA 3AINA 3QX7A 3DMFA 1CUIA 5SY9A 4BC0A 5EOZA 1N3YA 1W88B 2WUWE 1LBIA 3CF0A 3KB1A 4IQFA 4NMWA 3RKRA 3EASA 5FTLA 5BNFA 3IJPA 3AW9A 4UU0A 5T4FA 3ZDBA 4QEDA 1G5HA 4CZ2A 1M0SA 1U11A 1T34A 3VSEA 1NJWA 1P0PA 4WZAE 2XRZA 3PR2B 1V4NA 3BQ0A 4KTTE 3STUA 2DEUA 2UUBB 3S68A 3WRYC 3AJEA 3ONFA 1KYVA 5K2MA 821PA 1UHUA 2IKSA 4HH0A 2P9CA 2O2CA 1EKXA 4DQ0A 4WASA 5I4IA 1S2DA 2GYVA 4JYZA 3D2SA 2XCPA 1V3QE 1H4VB 1CUHA 2AV6A 3CA8A 1T36A 3ADKA 4QNMA 1LFAA 4ZOEA 3R4CA 4IDHA 3BXZA 3L1IA 4LYJA 4Y9SA 3JAMA 4YR3A 4KQMA 1REQB 3WFZA 1JMYA 2ZU0C 3QY9A 3TAQA 1YR9A 4MGKR 2VDRB 4CDGA 1LLFA 2PMWB 4W9MC 4ZJYA 1C50A 2FF5A 1T0IA 2G28A 2Q28A 5HYVA 4EX7A 1P4JA 3EIQA 1YOBA 2H1SA 3G8BA 2PUTA 3LHDA 4CCYA 1VRWA 4I9UA 1WB4A 1I6LA 3DC7A 3QSGA 2CD9A 3JASA 3BK7A 3ALRA 4NICA 3G0IA 4Q4LA 2WG1A 2DVMA 3OLQA 5IT5A 1O9HA 1Z4PX 2GEDA 2GHQA 2VHTA 4P08A 5IT9A 4CF3A 4RZ3A 5LP6B 4MRNA 3OU2A 3VM6A 2GZ3A 4O2BF 5BR7A 2AOVA 2FOXA 2P91A 3LY9A 4V2UA 5HCUA 2FWIA 3WB0A 1VRVA 2P75A 5A3JA 2WMDA 3KOOA 4M87A 2JARA 1WD5A 3O2QB 1XEXA 5C0YA 2JEIA 1ILEA 2CL7X 2BFNA 4LF7B 3MOSA 4J90A 5CPFA 4B3BA 1IWPB 1Z8DA 3F3YA 4DOCA 3L06A 1AMOA 3D1JA 1DQNA 2QY9A 3N8IA 5CW2A 2OMKA 1BFUA 3GEPA 1WHTB 7ICPA 3ABZA 1REQA 1VZ2A 4J49A 1R0XA 1ZD9A 4LDNA 3C8DA 1N8NA 2P9ZA 2W7OA 3LYAA 3NNSA 2LP4Y 4Q21A 5AJTA 3ROQA 1IOLA 5EE9A 1U1EA 1YB7A 3E3MA 3DXYA 2PFGA 2EAUA 3EVCA 3O83A 1VKHA 1SC6A 4KYIB 4LRQA 4FB4A 2YWFA 3F71A 5JD6A 5GINE 4GBMA 4WCFB 4DY4A 5J2GA 3TQQA 5CCXA 2IS2A 2BKVA 3RTVA 1T9GS 3G5AA 3ZCQA 1VCOA 3LNTA 2WU1A 1YS2X 5LD2C 5FQNA 2E87A 2QZ4A 1E63A 2ZQYA 1MVOA 9ICRA 2I3BA 3MRTA 5K0NA 3ZR4B 3ZLUA 4DADA 2C2OA 3ZHRA 5TSDA 4QWDA 1AMUA 4Z1MA 3TCXB 1BHO1 4IJMA 2XVTA 3PSFA 1E9BA 2HREA 4NG5A 4D6PA 2W6ID 3PNYA 5AVZA 3JRNA 1Z75A 3RYIB 2NRVA 3QJYA 1L4KA 1K2VN 2QWXA 4WPGA 4UNQA 1C4OA 4W4TA 1T3HA 3SHWA 4LZDA 4HDMB 3CTMA 2DWCA 4IUBS 3SN6A 4BO2A 4E07A 5CNJA 1QRRA 2XGSA 2P5UA 3N0XA 3GGGA 4R5HA 2IPMA 3OT5A 1URJA 5AW1A 2ZTMA 4OF4A 3MK31 1RRFA 3F0TA 4QIWF 1E5QA 1HNWB 4DA7A 2WF8A 3WV5A 4IJQA 4C4TA 4HTFB 3PY8A 3QVKA 2F4VB 1V95A 3GRYA 4PNHA 1A9RA 2XUQA 2EKBA 1MNAA 4W5RA 4A0GA 4EI8A 3WGKA 2EU8A 2W6NA 1TECE 3ECSA 4J76A 3VR3A 2FQQA 5KFVA 4P54A 4OAQA 3KTOA 1YB4A 1HJPA 3PC7A 4H60A 4PYMA 3OZRA 2FUG6 2Z9DA 4Q8EA 4Q7JB 3BVPA 2JLWA 3WR5A 3GPCA 3HYCA 3I32A 2W2KA 4H16A 3AHIA 3N0WA 3G89A 1HSZA 2XEDA 1JIIA 4M1TA 4MIEA 4JUIA 2Z6UA 2BCSA 4DV7B 1DTSA 1MT0A 4HYQA 2VQFB 3DPIA 4QDTA 1DJLA 2EHDA 2WAOA 3FTPA 3IUJA 4I2VA 1XP8A 1Z0UA 4MS4A 4R2JA 2IV2X 3VO9A 4KMMA 4YMWA 5DFAA 4EVRA 1IRIA 4HVCA 2JVIA 1MO2A 3A7EA 3AWDA 1UA0A 4X1IB 4UTRA 1P5FA 1K3FA 3UMVA 4EATA 4S1OA 4B7AA 5M29A 5KFXA 1ZQLA 4UZSA 2XQKA 4MJXA 1F8XA 2VJKA 2ZBVA 3A6PC 1UL1X 3EVZA 1Q77A 1WU7A 3ZH9B 1GY8A 3QWAA 1OB5A 4YT5A 4DBLC 3AL0B 5J29A 1NXVA 2V45A 3EF1A 4H4EA 4AJ9A 1NQUA 2LRHA 2OGWA 3HFRA 4OATA 5FF9A 3AUYA 3GRAA 2GD1O 3KJFA 4LW8A 5JXIA 1ZCFA 1FYFA 1L7VC 2CMKA 2Q07A 2R1VB 4YRQA 4R63A 2Q1YA 2GHRA 1KK3A 3OOEA 2D8AA 4WFKA 1SXGA 3EPPA 4R8UA 3LPNA 1RFLA 3PIRA 2G04A 3FGZA 1BXRB 1DJNA 1L4EA 3PGJA 3OPYA 1FP4B 2P1ZA 3QBDA 5TMBA 4AUEA 3ZHCA 4HWTA 3H3FA 5EXTA 1FLNA 3W5AA 3JPSA 4B2IA 5LD2B 5EOVA 5B53A 2NYVA 1Y7HA 4FKMA 2WMOB 1BCRA 1J23A 5C8YA 2PS3A 4UB3A 2GNOA 3H86A 2WZDA 4J1TA 1TVMA 4OSPA 3VUEA 2QJOA 1JLLA 1BWPA 5CVEA 1MN6A 3UCEA 1EUCA 1PNRA 2LPMA 3AH8A 2PUJA 3WVNA 2XE4A 1ZNXA 3T9EA 1W85A 1ZJYA 4Y9DA 3COSA 3BL6A 3LFHA 4ZVSA 4M36A 3RC9A 4ATNA 4OJ6A 4KK3A 1CR4A 3R44A 3UGQA 5HXAA 1E9AA 5KFJA 2DLCX 3LPDA 5H7XA 1I3OA 1UBGA 2FMTA 1G2PA 4L2IB 3OA2A 3RHZA 1L5OA 1V7CA 2X3UA 1OREA 1GA6A 2X6TA 3T7CA 3VVCA 4F5NA 1D0SA 1OW5A 3FMIA 1PJLA 2KS6A 1PGPA 4QG7A 1PEDA 3A9WA 3L92A 1MP0A 1XSEA 4Y30A 5BYBA 4AJEA 4F3KA 4DIEA 3V4SA 4KLOA 1KRHA 1RZVA 1P2SA 4O4IB 4W5TA 4OB8A 1Q3VA 2BR4A 2HJHA 5LOVF 3MTAA 2PGOA 4AF8A 2OESA 1C1DB 2VRCA 1CQIB 1G66A 2W71A 4J3NA 4S1VA 3L0BA 1U4SA 2CBXA 3DCIA 4BMPB 2RGAA 1LZLA 1GRCA 2OBMA 1S3SA 3B2NA 5SZHB 1Z07A 5J0OA 2WVHA 3VZDA 5JBNA 5B7NA 1T2DA 2ES4A 4I2IA 5C3UA 4E32A 1SHJA 1L7RA 3C45A 3JWIA 5BV7A 1AS0A 4FOTA 1X1QA 5WRFA 1CPYA 2WT4A 4NPCA 2X2OA 3SKXA 1JG7A 3VNAA 2VJPA 2GPYA 2VXBA 3UZUA 1FCJA 3IIMA 4Q4HB 4G0UA 3OURA 2ZQ5A 4XD7D 4FIDA 3GIDA 1CTQA 1FJXA 1TZMA 3LPLA 4UUNA 4NCBA 2PSHA 4IZIA 1HT2E 3HSSA 4RK5A 2BGMA 3Q6IA 2QD2A 4KLRA 2X4IA 1GA4A 4GXNA 1FTWA 1L4BA 2P4SA 5HNKA 4EZ9A 1MV8A 4CLHA 3FETA 3LIPA 3HUTA 2CJXA 3WOHA 4Z0HO 4F5RA 1OVGA 3NKFA 2Q5EA 4DNXA 1Z18A 2ZETA 2VF2A 1H2HA 3QNWA 1C0KA 4ER6A 3TZKA 4RZUA 5AW3A 3KUDA 3OESA 4CJXA 1U2ZA 3BS4A 2HMWA 3K16A 3M4XA 1FFXA 1IYZA 5TLSA 2EZZA 4IIJF 1LPPA 1UBCA 4PGGA 1BW9B 1OGIA 3T1YB 1F51E 4HDQB 4EPTA 4M9HA 2A0XA 4BNJA 1OKKD 1MQSA 1X2BA 3KAJA 1O94D 2VYVA 4F5DA 1IHDA 4R68A 4WLVA 1F3LA 5LLTA 2IH2A 5HVNA 1QTNA 4UVHA 4BL5A 3E7FA 2OXEA 3KS9A 2WU0A 1S0UA 4YP3A 3FCUB 4HYTA 4RNOA 3OT1A 5IH3A 5TQJA 4B4KA 3VOSA 1HE5A 4BO1A 1D3AA 2VSXA 3BA6A 3HKEA 3KAQA 2NU6B 1C3OA 4LTDA 2WLTA 2ODQA 1HNXB 4PRKA 2G07A 3OMWA 4P9NA 1YRBA 1GR1A 4XB2A 2X2FA 2X6RA 3KCQA 3FWNA 2DBVO 1EM8B 1H9CA 1IB6A 4YRGA 1GZHB 3TX2A 1RLIA 2BGLA 4CYMA 3BMNA 4ASUA 1OUQA 4ZFNA 2F4NA 4BJ5A 4G0VA 2B5VA 2A8YA 5F9LA 2I55A 2FWAA 1WP9A 4RQ3A 4S1WA 3W79A 2TRSB 3ENQA 4Q39A 4KLLA 3FTFA 4G0XA 5JSKA 4WX2B 2A1UB 4FR2A 2WAXA 4K9KA 4MZXA 1R4NA 4O8CA 4OFZA 1EXVA 1E5LA 3EMDA 4YJDA 4CMIA 5FEUA 2XI4A 1BD4A 1T9KA 3JWEA 4PX3A 1ZMBA 3I9V6 4PW0A 1JB1A 1IN1A 4WY2A 5DXAA 1MV5A 2AMJA 3D2LA 1X6JA 1K66A 3D4OA 5BSKA 2QAGA 3G7SA 3T5HA 5ALIA 1NI5A 3HXQA 1R3DA 1JHMA 3B1FA 3ZWPA 2KLBA 3PITA 2GOLA 5ALTA 2QM3A 4AIIA 4B1FA 4P34A 5CAEB 3MBYA 2VJMA 3KHKA 2WA1A 3NALA 1K6XA 1SCKA 4LWOA 5DEOA 3R7NA 3WWYA 3ZTWA 4YRAA 9MHTA 3KHUA 2GK4A 1QV6A 2JH3A 3T5GA 2JLVA 3RAJA 2C5BA 4GZ3A 3T15A 1F5SA 1B8VA 1XTRA 2FZGA 2HH9A 3BL8A 2H29A 3FNIA 1AN0A 1RACA 3GT4A 2PVPA 1E2PA 5D3KA 3FB4A 4IDDA 5I9TA 4ECEA 4EYSA 1KAOA 4E2XA 2RLTA 4TUYB 1EP2B 3L07A 2PQ6A 5KT7A 3C3MA 3EXIA 4NYMR 5J5AA 4EVIA 3OQNA 3A1CA 3WWPA 1FK8A 4K9LA 5AM4A 3DR5A 3PWSA 3R6TA 2GXQA 3T4XA 2AFVA 1AKMA 3A27A 3UXNA 4TROA 3Q8MA 3RIXA 4CEHA 1FP7A 5CA1A 4XJSA 3U44A 1ECFA 4YDSA 8ICKA 3FJ1A 4TYQA 1NJGA 2FR8A 3VU0A 1RQ2A 1SC9A 2QUAA 4IFBA 5EHNA 3H5NA 3EGVA 2EEZA 3HCRA 4IIXA 2VLIA 1ZR2A 1J2YA 3HPRA 4PLVA 4WKBA 5EUBA 1A9OA 1DPFA 3GLRA 3KDSE 4GLXA 3UCXA 2ZUFA 4UM9B 4RZRA 1L5QA 1QB8A 1ZYUA 1PAUA 3MHTA 4BKOA 1KVSA 1LJ8A 3N7PD 2GAFA 1QRSA 2ZRMA 1NDHA 1DRKA 1NZJA 5GM1A 1PT7A 2DGZA 1I4DD 3A32A 1IEVA 3TLKA 1WQ4A 3V3TA 2FF7A 3AIMA 3M9OB 1FTGA 1WUKS 1LV5A 1L8AA 1Z4QA 2HBKA 2IXAA 4ECSA 1PIWA 2OHOA 3BZBA 3ITDA 4RAQA 4GWLA 4EYEA 5ARBA 2HB6A 2QSJA 1R12A 4FGJA 3KLPX 3C7CB 3N2ZB 1DUIA 2QVZX 5HZGA 1ZW1A 1K8XB 1WVGA 2ZQZA 1QCKA 9ICTA 3FWPA 5JNVA 3SMVA 1AXGA 3QEMB 4PYRA 3TDNA 1PLJA 3VDMA 1JDVA 2OHFA 1QHEA 2QARB 1QVZA 1U0JA 3DZ8A 3MAGA 1E89A 2R86A 5KG5A 1R4NB 3T7SA 2FE9A 1JHPA 4KXQA 2BFFA 2O6KA 4NWIA 5AK3A 3JPTA 4NM1A 5D49A 1GTVA 221PA 3C4VA 4G2TA 4PLFA 3ZCXA 3A6LA 4BB0A 4F84A 1THZA 3IEUA 3ZIUA 3C3KA 3IP1A 1Y3FE 4ND5A 5KNDH 1BMFA 3LQRA 4FDMA 1HDXA 3DWGA 1Q83A 5G3YA 2GLUA 3RJZA 1SMKA 3GLIA 1ZHOA 1WZ2A 2XF2A 2ESRA 3PGMA 2D5LA 2GZAA 2FMHA 3KJQA 5CH5A 2G5PA 4ZRMA 3TZBA 3Q9NA 2D62A 1CY6A 1RWXA 3BDPA 1LBSA 1V8ZA 2R8PA 3LKBA 4R1SA 4FE3A 4JITA 1P2DA 3VPFA 2PLNA 3RAXA 2AXEA 3ZD9A 4LDRA 1DIBA 2C61A 2Y99A 4MIOA 5GOZA 1U3FA 4V3BA 3VBCA 3KQUA 4P0TA 4N7BA 3NWPA 2D3DA 2R6CA 1CIVA 1DIHA 4HFNA 4Q0MA 5EPOA 1CCWA 4GRIA 2VRCD 3LA8A 3HDYA 1Q0HA 3E82A 5EIAA 1P7CA 4TTQA 3UHFA 2JANA 5C8XA 4W5WA 3TIIA 1KERA 2AJBA 5IH7A 3DEIA 4QATA 2ZTCA 7ICMA 2QGZA 2XQJA 3IFSA 2VTBA 2CXHA 2X42A 4ZT4A 2IXEA 1WKBA 1QV7A 2O3QA 1Z7BA 4GOND 1OT3A 4RPIA 2V8OA 4G1EB 3NGMA 4UC0A 3IHWA 5DF1A 3RAFC 4LGCA 3O8DA 4ZT5A 4BAGA 3OBBA 3VGPA 5KHOC 5A4JA 1Z0KA 1USGA 3B1JA 1GZ5A 5EP1A 1T13A 4OB6A 1PK1A 4BQQA 3IPRA 2NZWA 5IJ9A 3A28A 3C1UA 1IY1A 4DWIA 1J5PA 2V7QA 3GRRA 1HL7A 3JQ9C 3O26A 2LZ0A 4RZSA 4UAJA 4YQYA 3F8TA 2O2HA 2VWHA 1IZ0A 1D8AA 1U7TA 4M7WA 4MULA 2FFHA 1ORVA 4GR5A 1NVEA 3OMLA 3KZIU 4B9LA 3WDMA 5AM2A 4F9EA 4MV8A 3MJDA 4C0AC 5B5EU 4CKCA 1SAYA 1WZEA 2I6QA 1R10A 1SA0B 3SHOA 5IZ4A 1A8SA 5JEDA 3PX3A 3BXHA 2ZFUA 9ICKA 5JVDB 3UTCA 4M1MA 3TZEA 2ZWPA 4LYEA 2HA7A 3R5SA 4R01A 1LPMA 1UMKA 4NBKA 3TVYA 3P0FA 4ZK2A 3FBWA 3MS4A 4B4UA 1EHYA 2QTFA 4DCSA 3DDNA 2W0MA 3IP7A 3TR6A 1J9EA 1MRSA 2D3TA 3RGGA 3P2YA 4ZCIA 1EX1A 2O8BB 5TVKA 4D8XA 1U8XX 3WLEA 3H8SA 2OK8A 5KZMB 5L53A 2RJ3A 3KUCA 4E31A 2Q50A 4H4DA 3V3KA 2YMMA 5IDVA 5EJ9A 2P9FA 2P62A 1OLUA 4HFRA 1U2TA 4G5OA 4BNHA 4JQCA 3L7AA 3VZBA 4Q66C 4Z3OA 2DX7A 3NAGA 2M32A 4JQYA 2YJZA 3ESQA 4GL2A 3MD0A 4GQIA 4CTMA 1CY1A 1HEYA 4YP7A 3FFXA 5L45A 4NL4H 2GK6A 2OCPA 4A92A 5JQGF 4INZA 1GG8A 3K8QA 4WLEA 1NKSA 2XCAA 1CRQA 3WGJA 1DQSA 3MTDA 2DKNA 2GVNA 1JSCA 1RQRA 2B6HA 4WUVA 2J0EA 4OXKA 3ZHBA 2A5YB 2FRDC 5A6SA 3ETEA 1W85B 1T4MA 4RYLA 1LLDA 3H75A 3NDPA 2E3TA 1ZDMA 2GPJA 4DCUA 3OLCX 4QT4A 5IIMA 4YRIA 4J16A 2IYFA 1EK2A 2ADOA 2ORVA 1AHIA 4QU9A 5LXTF 3QKRA 4HWSA 4FTWA 1JG4A 1GZUA 5BWOA 1SIBE 4WRRA 1L3CA 2BM0A 3N2IA 1ZQTA 1S5PA 4LC0A 1YUMA 3LZ6A 4G4SO 3S4YA 1J42A 1E6WA 4NMMA 4Y2SA 5DP1A 2BL4A 1LH0A 2YJNA 4UMVA 4PEVA 3Q7EA 4MW6A 3U7RA 1XNSA 4XLLA 5JI3E 5FFNA 1F06A 1FTNA 4I2DA 3EFOA 3A1EA 3H65A 4UUBA 3ZQ6A 4TN5A 1NK6A 1JLSA 1LTHR 2H5IA 2Q2OA 5IDQA 1AF4A 2ZJYA 4G5YA 4TM8A 5IKEA 3DLPX 3QIAA 4G97A 1PQYA 3QE4A 7ICTA 4XW2A 5AOVA 2NWQA 1HLGA 2WOOA 4GZ6A 4LJLA 3RFUA 1KQNA 4BIMA 1N1MA 2EV9A 4MW5A 4TTAA 1SQ6A 3HUFA 2ZVDA 1QS0B 1JKJA 3BF7A 1ZN7A 4WADA 5B36A 2Q7OE 2YYSA 4BQRA 2AOTA 2IYNA 1KEZA 3HLYA 4EO4A 3Q2KA 3HCAA 1GD1O 1SA0A 5J2FA 2W9AA 1S1MA 3T1NA 2A67A 3T9DA 2Q4EA 4QULA 1PX0A 3RF6A 4A6DA 2FI1A 1J9GA 4FQ5A 3SIRA 4R9SA 2OP0A 3OHPA 2P4HX 2R2AA 3HB0A 3WRXA 2VAMA 1NBIA 3EGDB 1L4LA 1KHTA 3Q41A 1G59A 3RRMA 3ND6A 1MOSA 4X84A 5CEEA 2A5FA 5JG7A 3RVDA 2FPUA 1C9NA 1VG9B 1P4GA 1Z17A 1PUXA 1NXTA 1BQ3A 1J07A 4F5ZA 4K4GA 1ZR4A 3LP6A 1UPHA 4RPYA 3HL4A 4DLUA 3RUHA 3OM8A 4DGSA 5CBPB 3AQEA 3FVVA 3I2FA 3WHKA 3VKGA 2DQKA 4WWHA 3QVGB 5T6MA 1LJUA 2GWHA 2JFUA 1ZMTA 3KKQA 5D6OA 4U2DA 1M2OB 3VDXA 3CGGA 2E4AA 4MCAA 3Q1LA 2C54A 5DHTA 1Y6FA 2UUCB 1SY7A 3ONWA 2O54A 4MDYA 4Y6GB 1SHZA 1BFDA 2QTLA 2FG5A 3TK1A 4ZAZA 4HTFA 2BMDA 2OC9A 3NM4A 3B3QA 1T4GA 4MUNA 2CRXA 1RJEA 1K75A 2MYPA 1JKJB 2D0OB 3E9EA 2VNKA 1ZQEA 3IDQA 4B3FX 3KSZO 1RWKA 2YHUA 4HYEA 5IN5A 4EG4A 1JA9A 1SURA 4REQB 1ZI6A 2W55A 3G23A 3L8YA 2Y1OA 1FVXA 1FTQA 2N1RA 1F2VA 3OF2A 4A8TA 1ZS9A 2FW7A 4R84A 4FONA 1X8XA 1GUFA 2QW8A 1PKXA 2BV3A 2GZ1A 3W9YA 4NARA 1YWGO 2PFSA 4FB5A 3M6UA 1S4MA 3VNBA 4D0SA 2KK0A 3WMRA 3RRXA 2SCUA 3DBVO 1Z5UA 4KX5A 3FKSD 4H17A 2WHEA 2XLBA 4JJ7A 1KJQA 3SV4A 1GSAA 2P2SA 1L5UA 4LXQA 4D3SA 2NYRA 3B9JA 3Q8WA 4GMDA 4KYTA 4NZMA 4CCSA 4Y6OA 5BSEA 4TRMA 4JVNA 4A6PA 5JRZA 2B4QA 3OCXA 5H5JA 3RC2A 5HDBB 5D85A 2ZVQX 1DWQA 5H3LA 4IIHA 3K0FA 1XSNA 4ED3A 1X7XA 3CR3C 3GZJA 1HEKA 1P7DA 3E2EA 1FFWA 4WW0A 3HXOA 1ZSNA 5BOMA 1KQOA 4QWBA 4YASA 2AOTB 4OGLA 3D0KA 5KUTA 4RD2A 2WEKA 2HRQA 1DL5A 4X41A 4PS0A 2X5JO 4E2FA 2BJWA 3VAAA 4V0QA 4J3FA 2VQEB 1LTQA 4HPJB 4IJ5A 1UIMA 1IQ0A 3ICOA 1O6BA 2PGXA 3HO8A 3RRHA 3PI6A 4XSGA 5ER6A 5IAKA 3ZV3A 3WLLA 4B6PA 4ER7A 3SJCA 3CZQA 2JZOA 1VL8A 1M2VB 3IEMA 2CLLB 3L7LA 3EGDA 1NRWA 4HX5A 3BE6A 3GEHA 3USZA 1JHDA 2E4ZA 2JCBA 4HNRA 3ZHTA 4KQFA 1TM3E 1J0EA 1ZBDA 4RMHA 4MUBA 1HZJA 1ZNWA 4C7OA 1X42A 3BJRA 4EHNA 2IODA 4YJFA 3WKEA 3TECE 2R87A 4ZHSA 2ACKA 2JHGA 3BZWA 1X9XA 1TF2A 4IVQA 1ZOLA 2O9JA 2J6BA 4JAVC 4RUAA 4J9RA 5EZSA 4BMZA 1XN1A 4FZNA 2P2CA 2ZE6A 1Y3BE 4QNNA 3Q12A 1EFPA 1NP3A 1MVNA 2QTHA 2V5AA 3BK1A 4GXQA 4RTJA 4UAVA 2NZXA 3CJQA 2XCUA 3V7UA 4LGVA 4G1FA 3EMBA 1Z5WA 4F12A 3AHHA 1CWUA 1YUBA 3M9NB 1L2TA 4LYFA 2D1SA 2ALJA 2ZIVA 2CE7A 2XA2A 4GI5A 1Z56C 3RNOA 5I4CA 3NMUF 3NGDA 1QC5B 5A7GA 3LPCA 7YASA 2PQ0A 4Q6BA 5GMOA 2I7DA 2NADA 2JVKA 3FYCA 4LXGA 3U3KA 4GYKA 2BQ3A 1JHUA 4MI3A 3ER6A 2EKZA 2P9GA 4D92A 2GN6A 3TD9A 3K0CA 1OROA 1SCNE 5HR6A 2FZ5A 1RWMA 2XD4A 1QQBA 2ASVA 3O93A 2C2GA 1XHLA 5HRCA 5JECA 1U63A 4AI6A 1QYRA 1T5TA 1H23A 4GC7A 3PEFA 1QO0D 4LNHA 4GR9A 1MOPA 4B47A 2CUTA 3MR3A 3PHBE 1XDDA 4W5HA 3SQMA 1CLEA 2P9HA 4ZAGA 3AKDA 3RBVA 4EGSA 6REQA 1L4FA 1XAHA 5ARDA 1C3VA 5KFZA 1RAEA 2D1RA 2HCRA 2YDYA 2J08A 2NZVG 3RJTA 3GOHA 3CPEA 3KB6A 1M1XB 2R8KA 3CZCA 2PS1A 4G25A 3EK2A 4OYRA 4PC3A 4G07A 4B9TA 4HB2A 1CQPA 1W1WA 4X7BA 5FR1A 5K51A 1FS5A 2AX4A 2HNKA 4EQ6A 7ICHA 2YY7A 4FHCA 1JDSA 1PGNA 5JFGA 3ZU4A 4RFSA 3C39A 4IDAA 1TOAA 1BJRE 3K5IA 4QDOA 1K89A 3JALB 2IHYA 3I2YX 4KLZA 2MWMA 3PV8A 1TLTA 4L4YA 4UBIA 4Z4IA 3NWOA 4CCWA 4D5EA 1WWVA 1WDWB 2AL7A 2E9SA 2YW2A 1JKFA 2V98A 2B99A 8ICMA 4G5SA 5LU9A 2Y05A 1KSHA 1QGUA 4OX9B 2DH6A 3ROKA 4RHUA 2J6IA 4NOLA 3W2FA 3FVWA 2MINB 1CUFA 1GKKA 4V38A 4AKSA 2FSIA 2NVWA 3SX2A 1RI3A 2BHRA 1VHTA 2IEIA 3PC8A 4Z4CA 2GZHA 1U48A 1TIBA 1NJZA 2CLEB 2QI9F 1Y48E 3C8ZA 4QOIA 1BKSB 3N2GB 4L8WB 4P58A 2NO7A 1UKEA 2ZI9A 3ABRB 5CJ2A 4EFKA 3T3HA 4G6ZA 1E3TA 4JXJA 1LU9A 1ZD8A 2O23A 1EAMA 3OTQA 5SY4A 4IICA 1BCSA 2N1BA 4LQ4A 3TX6A 2D74A 1BX1A 1RCUA 3H1GA 4YJFB 5GONB 3V1MA 1EFAA 5I7SA 3EXHB 5F7ZA 1YA4A 4EEKA 1WPRA 1UF9A 1GL6A 3TFSA 1FUYB 2DOKA 4E1AA 3OJOA 1KOJA 3DWIA 1I13A 4YUXA 4WLNA 2VJCA 1ZK0A 5BQOA 3R7WA 2Y0BA 9ICIA 4BP9A 2J0QA 1Z28A 1GGHA 4E5UA 4ARUA 4TURA 1OQAA 3DT9A 4B17A 2C9ZA 4PYOA 3DMGA 4RLHA 5JUMA 1Z33A 2NTYC 5KJEA 3L4JA 1BDHA 3JQAB 1L9XA 5HG0A 2OFXA 1OU0A 1TK5A 1VQ1A 4Q16A 1MJGA 1ZQKA 1G0OA 3L41A 4B74A 4UMDA 1H66A 2BR3A 1QFYA 1K7FB 4A27A 1U28A 1WRBA 2YH2A 4ESHA 4P32A 1QMGA 2QMYA 2CD7A 1CS0B 5KYXA 4JC0A 5JMTA 1DBPA 3PXBA 1NONA 1H6AA 3PQ4A 5D3MA 1NN1A 3V1KA 3OQ6A 3TLJA 8ATCA 4TLBA 4EI2A 2R1ZA 4F8YA 1R0CA 3EE6A 1O3YA 2WU4A 1XZJA 4ZTBA 1DJOA 1A88A 1ZVJA 2PFKA 3U7IA 2FLLA 2QAGC 2AR7A 4EITA 1FFVA 1QXSA 3UV3A 4ELUA 3QPWA 2UVWA 4JWTA 3W5UA 3IA2A 4KVZA 3STTA 3H11B 9ICLA 2YIJA 5FOXA 2RCNA 3K6SB 1K6EA 1X1SA 1GTG1 1NN3A 4TT3D 4ZQEA 1WB9A 2K4EA 1MDFA 3P5SA 1H8ED 3DEFA 5J2TA 1FIQA 1EG2A 2Y77A 3ROFA 1YNOA 4I27A 4BO7A 1XZKA 2EFGA 4CG0A 1TT7A 1XD8A 4JWMA 3VVMA 3LLVA 3IE1A 1W4RA 4AWAA 2HEGA 2QD4A 2QLBA 3H1PA 2K6GA 3FRIA 4A6EA 1XZFA 4EIWA 4OHMA 3OF5A 2CBZA 4FEYA 1NBAA 4RZIA 3RK0A 4ZMBA 5F64A 4E13A 1CNMA 1SB8A 1YC2A 3OZ7A 2UZAA 4Q82A 2H2GA 3MGIA 3IBGA 1PVRA 1D5CA 3FOAA 4ZOLB 1UMCA 1UXJA 3SU8A 3RS4A 4BJHB 2QVBA 2NQ2C 4YYEA 2G76A 2PI5A 4D56A 4UHFA 3GVHA 4MO9A 4X64B 5H9WA 3BQNB 1Z2AA 3K09C 4YXFA 1T3GA 1FE8A 3SAHA 3I6MA 4DS4A 4J7XA 4RZQA 4TUPA 3RK1A 4DC0A 2Q7XA 2LBOA 1NXOA 2Z09A 3KT6A 3VSAA 4MJ3A 5LUAA 2G25A 4QASA 2BSQA 3TPZA 1JS1X 1D4AA 3Q9SA 2W83A 2HDHA 3HUUA 3UF0A 1Z4MA 4FXOA 3MWFA 1UOQA 2FFRA 4M0MA 5DVZA 2YXNA 4ZHQB 2QV7A 1FW8A 3PE3A 3UAYA 3HA2A 5KYXB 3OLYA 2Z1NA 4OQDA 3ASZA 2JCYA 3T3FA 1H9AA 3EBPA 4YP1A 2P9YA 3H2IA 1NR5A 3L9WA 5JHHB 3UGTA 4F5QA 3AF4A 2PU7A 4PZLA 5B3AA 3F2IA 1ENPA 3EZ2A 3E1SA 3RG2A 1J70A 4AF6A 3KFUF 4WGGA 4FKZA 2ARKA 2QY6A 4LXIA 2PD3A 3BXOA 3HWRA 4JZYA 3M4ZA 4KQGA 2JFGA 3T54A 3DV0A 1V8FA 2A35A 3QX9A 4BQEA 2LYAA 3NFRA 1E62A 3B3GA 2NU8B 4QJ4A 3EZ5A 2BY4A 5AVTA 1FJHA 2QUIA 3FGNA 3R2JA 1XJWA 4FI3C 4MRSA 4O4JF 5D3MB 3ZCUA 4OJTA 5FRDA 5KU7A 1XVVA 3U7GA 1F0MA 2VR1A 3S7ZA 1TEXA 4R1OA 3G6XA 4AYBF 2EYQA 3HBMA 4GPEA 5ECWA 3D4LA 2EFJA 2RC5A 1E6EA 3ETCA 3O3CA 4O08A 4N7RA 1UDCA 3FHTA 4A36A 3HKZF 4QGHA 4TQRA 4KUEA 2OUKA 1DARA 5DNWA 4MI1A 4AB1A 3L82B 3L7KA 5TC4A 3UYKA 1G8AA 4ZT6A 4PYKA 1QRTA 3OKAA 2G82A 3GBVA 1MA7A 3IC5A 3RB3A 2VCYA 3NEJA 3IDSA 4O59O 4Q3CA 4V02A 2XNHA 1HY3A 1CJBA 1JXOA 2O7QA 1MW9X 1T43A 3F6YA 1SXDA 3CU5A 5BSUA 2C7QA 2EC5A 1QH8B 2DQYA 2H1VA 1JYFA 2ZSDA 2Z8YA 1KWGA 2XNDD 1NV9A 3MWGA 3P45A 1CJCA 1PZNA 2NTJA 3QLUC 1ZGHA 1ATIA 1BXKA 2PZBA 1M6VB 1U98A 2EG9A 4X8LA 5C34B 3ZG6A 3N6VA 1XZHA 3L8CA 3SXUB 4B81A 2G70A 3EF3A 3N8HA 3OECA 1P4AA 3N2NA 5D1NA 3KYCB 2NU8A 3PU6A 1D0VA 2D2IA 4UHKA 1R8XA 3ZWXA 3AXTA 3UM9A 1Z39A 2P65A 1WHSA 4WOJA 4D9NA 1IK6A 3KUUA 2UYGA 4G5QA 5KTPA 4MTLA 2PX8A 3O7WA 4PC2A 2A9RA 1MG0A 3CX3A 3JU3A 2KN7A 1GTJ1 2Y1XA 2PBZA 1HT0A 4DZRA 2KHQA 5J2UA 1IVSA 2YOGA 5F1OA 2X1VA 1H6CA 4NNPA 1XVUA 1F8GA 1V1JA 3CH5A 4GVPA 4POAA 2IYXA 3I1JA 4JLBA 5DBHX 3UXYA 5HIKA 3PR3A 1ZICA 2MSWA 2WSYB 3EZFA 4P3YA 4RQTA 3RFFA 3I6ZA 4C8KA 1FSGA 3BHIA 1G63A 3MJVA 3NIFB 3O2NA 4Q9KA 3L8MA 3GGCA 3QKIA 1C0PA 1RJGA 2WDPA 4HMPA 1UWKA 5F4BA 5K0FA 2V9CA 3GUUA 1I10A 5C5EA 3T9CA 2IW3A 2PKWA 4H0NA 3MBIA 2XNDA 4RU1A 1L4GA 2PGNA 5DLFA 2AC2A 3EPIA 3M6IA 4BBAA 5JH7F 2P9TA 4PYLA 1B43A 3PL1A 3L43A 2WV9A 1GCIA 1HPLA 1MFPA 4D6XA 3LP8A 1IZ8A 1CS4C 1BW9A 1DHRA 1Q95A 3ESCA 1WX1A 2FSHA 1T3LA 2IX9A 3H2SA 5B3KA 2FNAA 1B0PA 5TMDA 5C0OE 2O3TA 5DN6D 1Q3KA 2GCOB 1I4OA 3IXMA 1UKCA 3UGJA 3HBFA 3NCHA 4NU8X 3RSGA 1OYWA 1THMA 4XGNA 4OY3A 3DC2A 2QAJA 4RPHA 2QN3A 2C8VA 3WYGA 3R5KA 4K9DA 1G20B 1OBOA 4O4HA 4JELA 4PPYA 3TRDA 3P96A 3S81A 3D2QA 1SVMA 4V1CI 4BQSA 2VRWA 3CZMA 3FC4A 4PG7A 1GPLA 1PS0A 1T8TA 3ICPA 4HUJA 2H4WA 2Z83A 1VG1A 2R4TA 4NP6A 1NK7A 1JJVA 2FPRA 4RDIA 4YRBA 3BZKA 4O02B 5KFOA 4IKPA 4EG1A 5JATA 4I8DA 3H5AA 1LD3A 7ABPA 1VPLA 4P3PA 5IJWA 1CR6A 3FR8A 4MROA 2ZCVA 4JA0A 3K0AA 4MR8A 1ZQUA 2C7BA 2FW0A 1YJAA 3TQ1A 1JDNA 3P0EA 4OKNA 3O1JC 4WMLA 4ECVA 1RADA 5AH0A 2QB0A 4L72A 1J56A 2J4DA 3SBDA 1Z3EB 3AETA 3QBJA 4ZVMA 5HUJA 5DB9A 4OJQA 5L4NA 1ZD2P 3BHNA 4OI2A 4X90A 4L3WA 2YC2C 3QPUA 5MF6A 5DG9A 2VZ9A 1SPBS 2D8CA 1PEYA 1D09A 2MOKA 2XHEA 2XYPA 3CLVA 5ALNA 2YUIA 4HAOA 4KQJA 4LBYA 4V2IA 1L1EA 4W1SA 1IUPA 2HQ1A 4AMVA 1Q6YA 2H9YA 3LBAA 1N2EA 1X0XA 1CJSA 1NBMD 2QE6A 3GIKA 2G1KA 3KELA 4NX2A 2W7PA 2IU0A 4AQDA 4GIBA 1XFDA 3ZE7A 1R0RE 3OE1A 4HLUA 4MB6A 4UDYX 4ZI7B 3K1AB 5ADWA 1SG6A 1OPXA 2BTQB 2IHTA 2BZGA 2HU5A 2I1QA 4LQLA 1JEDA 3A04A 4MGZR 1XCOA 4YMVA 5BR4A 4FFDA 1W8IA 2RFLA 3QOXA 1L7BA 2AOWA 4EY7A 1YCDA 1JYEA 2XRFA 1E5XA 3SIXA 3RS2A 1CZNA 1IM4A 3OHMA 2IYQA 4G5GA 1CNEA 3D3NA 4PICA 4Q4AA 3WISA 1IXYA 2UUAB 1KRWA 2B8JA 3T9AA 3ETRA 4B3MB 1RBMA 5EIEA 2XVXA 1MU0A 2WFLA 5AKHA 3B9PA 2OK7A 4AUNA 1G19A 2B9EA 3L7YA 5DO9A 3IL2A 4ZC8A 4JVLA 1US8A 3OZCA 3R7SA 1W44A 4YO8A 3ZKWB 2FPPB 4FFWA 4KR2A 5BQ5A 1MO4A 2MSKA 1Q1GA 2RGBA 2VAPA 4EGFA 1A71A 1NI4B 5L7WA 2HQBA 1Y1PA 1XJQA 1XTJA 1U8EA 1LS6A 2RB5A 4S0ZA 3CISA 5F35A 3V1TC 2AD1A 4K8OA 1QP8A 2HDWA 4IQGA 5GIOE 4LC1A 4F11A 1Z35A 1PBTA 4KBFA 4BBPA 1CF4A 3ROPA 4N6OA 1K5OA 4F4WA 2P0AA 5JNTA 3GLIB 3QEKA 4RHFA 2GPTA 3GT3A 4MVJH 4W5QA 2EKQA 4B4VA 2JEFA 9ICUA 1WA5A 3I9NA 4HAUA 4F2RA 5CHGA 2WRZA 1NPYA 2J9FA 1QSLA 3HC7A 1RPAA 3LUPA 4I08A 5IC4A 3PF9A 4HNQA 3LYHA 2JHAA 3P9NA 1Z19A 1DC8A 3AFHA 4RXMA 4X7RA 2AE1A 1TK9A 3WI7A 5B1YA 1BPBA 1QZZA 1ZI8A 2PZMA 1UC8A 2G8LA 2QTBA 2PDAA 5EYPB 2APJA 2Q3BA 4DDHA 1O08A 4E5KA 1KK2A 2B82A 4UEKA 3TLEA 3VNQA 1M6YA 3CXRA 3EEOA 4BO3A 3VVLA 1L5SA 3RS5A 4OXYA 4UPVA 1OB2A 3IQXA 4MVJP 5IC5A 1EJ2A 5MN6A 1BVSA 5C5JA 4YT8A 1Q46A 2PZ8A 1SZPA 2ZG6A 2W2NA 3DT8A 3JYNA 4PXAA 2VHJA 2HL6A 4RZHA 5JO0A 4MVJD 4GFJA 1OWLA 1JTVA 3AOGA 3EFOB 4UHDA 1G3RA 3U6BA 2I76A 2G6TA 4NK4A 4WTOA 2WHYA 5JFOA 3LWBA 4BMYA 1YVDA 2F1RA 4U3JA 4C4PA 4ER5A 3RAEC 3MCZA 1HLFA 5KNIA 1PUZA 2C7GA 1DAEA 1O95D 4WKOA 3C8MA 3PPWA 2UVUA 1MC8A 1PYOA 1TO2E 2Z8YM 4M9UA 3O74A 2DUUA 4IOMA 2HSWA 3PFGA 3CT4A 1KFJB 1TD1A 5EERA 4CR7A 1T1SA 3RJIA 1CSEE 4P5PA 1M66A 2PS0A 2UUPA 1E1NA 1QCYA 3PT9A 4MFAA 5A4FS 2W2QA 5IM4F 4FBTA 2WB4A 4Z86A 4RPZA 4OA5A 4XE5A 2IS4A 2JIZD 1Z38A 4XX0B 1KORA 3B20A 4JD5A 3AVQA 5FBQB 1JEYA 4K46A 2JIRA 5LC1A 1T6ZA 2A58A 1B16A 2G9ZA 2GJ8A 3CUYA 2IC5A 5K20A 4V0SA 4JV5B 1XNGA 4WBNF 2BEKA 3ZGVA 4QNRA 5LA6F 8ICTA 4MYSA 3IQFA 1I6WA 3OJCA 4MJLA 4P1ZA 2BQRA 3D8BA 4IXMA 5EMHA 5HK9A 1Z8HA 3NHBA 1KKMA 3DOCA 5KFNA 1Z73A 1O03A 2AG5A 2IOHA 1KFEB 5SZIA 5T57A 5J5VA 3V6LA 5B58C 4MQUA 3DVRX 2XB2A 2H3FA 1JDBB 2EJBA 2FPGB 1VOTA 3H1BA 4G5FA 5IKMA 4X54A 3K0FB 1KYIA 5FR2A 1P4RA 2JJ2A 3GUVA 3P8ZA 4Z99A 3TUZC 4HFJA 4R1LA 3KOYA 2HZBA 4IDGA 4ED9A 1MZVA 4FYPA 5SY6A 2AQ8A 4AZTA 5H2FU 4OQ4A 3TM5A 2RGCA 4BMOB 5FTNA 1E9DA 2L2QA 4IXDA 4KG7A 1FMTA 1COKA 1L8QA 2JEJA 1AKTA 3FHJA 5D3QA 2Z3WA 2WWXA 1SVLA 1U0GA 1D9FA 3HJBA 4B6OA 4L07A 1E3MA 2FE1A 1H8EA 1W2HA 4J0DA 3CMMA 2HXYA 2E5LB 5LZ7A 3AVUA 3KZNA 3FBGA 3LK9A 4BLPA 2P2LA 1QYDA 4KW7A 2NAFA 4LTMA 2NG1A 4K6GA 3W04A 4BVGA 2KZMA 1QIMA 1ZAKA 1ZGGA 1ZIXA 2ZRAA 3BTOA 1EJ0A 1G7CA 3HJUA 2QXUA 5JJIA 1X19A 3KQPA 3B78A 4AN4A 1G8MA 3NJ4A 3T4UA 1UFVA 4YV2A 5KHAA 4F2DA 1MJHA 2AYXA 1OAAA 1WEKA 4BWFB 4N5IX 5B37A 3WWEA 1P6XA 4O2BB 1ZQ9A 4GS5A 1N2IA 3TQSA 3PHLA 3VPXA 3SHVA 4J9MA 2EKPA 4N65A 4C6TB 1FO4A 3AZQA 3AKZA 2KSOB 1ZUNB 1T8WA 2R751 4GZMA 5BQFA 1RABA 3A4NA 4I55A 3NHKA 3F4BA 4DQLA 1RXVA 3QEOA 4E30A 1EDOA 3CE6A 2NSDA 5ITZB 2OOKA 4NDNE 3RAPR 4B6GA 4YN4A 1LQ2A 4MVJF 4I1RA 4MRPA 3DDHA 3GDFA 2GZDA 3NORA 4ZO9A 5KTTA 3TI9A 4DSZA 2BHTA 3IULA 4IZOA 4KLSA 1WSAA 3DP9A 4HR7A 4L28A 3WQQA 3PZPA 4Q7EA 1L8OA 2REBA 2BLNA 1FZTA 4DM7A 1Z5VA 1O95C 4M22A 3JATB 3PHHA 4TKUB 1N1GA 3C8UA 4WBSA 2J31A 4URUR 4ZYWA 4M47A 1UBOS 1PF7E 2FSVC 1CC1S 5IZCA 3UT6A 3ZD7A 1GR0A 1DFIA 1SV4A 2OCDA 2ZRGA 4FGUA 3E5RA 3FE2A 5T4HA 1I3MA 1OI3A 1RTTA 1DC3A 4NZPA 3GZTB 1UA1A 4IX1A 3R09A 5CLJA 2WPNA 2X8WA 2QMUA 2X5OA 5ALOA 5EZ6B 7REQA 2QPOA 3BC1A 2PIAA 1Y82A 2RHGB 1N6OA 2KZ3A 1C30A 2JI6A 4GPD1 5DWDA 2HJWA 5CNKA 5JAUA 4L57A 4D4HA 1WZUA 4N3AA 4PZZA 3V8BA 4K0KB 7ICNA 3WDSA 3L0SA 2CPRA 3DL0A 1QLJA 3KJIA 1TC2A 4NOJA 4N8DA 3UXMA 4FDVA 1YAHA 3C6KA 3EQZA 4Z4QA 5K4LA 1CF9A 3SC4A 3TWOA 2E1PA 1P3JA 3OVMA 4G0MA 4CMJA 4D45A 1JI7A 4HK4A 4FMDF 1DKNA 2C29D 3TN7A 2F1KA 3OM1A 2PSSA 4Z3DA 4ZI5A 3R5FA 3X1MA 2C96A 3WLPA 2ZAYA 1XDZA 3L0DA 3RBXA 5LDHA 5IEJA 1JFTA 1V2HE 1Y8RB 4X5OA 2CMHA 1M75A 4H7JA 5DGDA 2A9FA 4NECA 3NOVA 2OA0A 1NU6A 2H4YA 3ITEA 4E15A 3ABIA 3FUXA 4DOMA 4YRDA 1E0DA 2NRWA 2YWEA 4R7GA 1NHGA 2IPNA 4GXIA 1CY4A 2MSEB 2WIFA 3LZDA 1Y80A 1ZJ4A 3I6QA 3NGLA 4J75A 2QRJA 2X22A 3PNMA 1WQ3A 3N2KB 3RWBA 2QM0A 3TL2A 4MGYR 4TYYA 2JLBA 5CBPA 4J4HA 3C4QA 4IHKA 1OH5A 2LW7A 4Q1VA 1DV1A 1EGQA 4I7EA 4YAIA 1VGVA 2P4QA 2OEHA 4HYYA 4O4IF 3ROGA 1D8BA 3T7DA 1IXZA 2WYHA 4OYHA 2NSHA 4L16A 2ZTUA 3DQZA 4BMCA 4QFMA 4WZ6A 5CIWA 2Y93A 2XI9A 4ZYVA 2Y4NA 4TYNA 5B6IA 2XTMA 3X2FA 2GXSA 4NHEA 1O8BA 1VLQA 2DFNA 2FP4A 2C7RA 1R2QA 1TPYA 2DERA 4UBJA 1P4HA 1DG1G 4UBBA 1WLYA 2V4UA 3K09A 4D97A 2IHNA 1W2GA 4IGAA 1NKCA 1BCRB 2I6FA 3K0CC 2XF8A 3OIYA 1BYUA 3Q98A 3BQTA 2AB0A 3RF9A 1TGYA 3FX2A 1ZU4A 5DW0A 1XNQB 1NUHA 3AB7A 5EWMA 3L7MA 3MQFA 3GBPA 2OCBA 3A4TA 3VFDA 1QYIA 2MDTA 4I2JA 2K89A 3NT5A 3IGFA 1PT5A 4N3CA 2JK0A 1Z2DA 5GJBA 2F3NA 1GRQA 3EXFB 3FMFA 5KVVA 1J21A 4DFJA 1Z74A 1TEVA 3N2EA 3RJJA 2QMEA 1L9KA 4XYMA 1ECGA 3DD5A 2OHHA 1XTBA 5F76A 3CS3A 3RQSA 4QUHA 4JKOA 3ETGA 3KB2A 5DHQA 5C8ZA 2QZZA 4JKIA 1R9NA 1KXJA 1KYYA 2ENWA 4KLEA 1PGOA 3OA0A 3QHQA 5DNVA 3WQSB 9LDTA 5FPHA 4WCFA 5CXSA 4JKYA 1J2EA 2F43B 2IEBA 3RHFA 4RE5A 3RVMA 3VMMA 1DQPA 1B0UA 1PQUA 3VZPA 4O63O 1D7AA 3NIWA 4WKGA 4LI3X 2B3TA 3ZWYA 4ETNA 3IP3A 1D7OA 4ND4A 2HHWA 1VECA 2V1XA 4MEBA 4BX0A 4JLNA 2D0DA 2ZR7A 3KWFA 4UE3S 4G8JA 4E4YA 1WMDA 3QVLA 4C8MA 4XRHA 1KYZA 2OPHA 4C78A 2FPLA 2KKVA 1I2AA 1X0VA 3EPKA 1E96A 1KZGB 1Q5PA 2O0HA 4QPCA 2PL9A 1U5CA 1P3Y1 1V5GA 2WSSA 2YJ5A 4P8RA 4HX2A 2ES6A 3FLMA 3HB9A 2M6LA 1TTPB 1RAAA 2RH5A 2QYSA 4YGXB 3S28A 1UOEA 2F1IA 1OJLA 3KEQA 4GRAA 4Y1RA 4CT4B 2AZXA 4IKOA 2KE7A 2G5TA 4KPGA 3NTOA 2YWRA 1MQ3A 2BI7A 4P6VF 4TS1A 5BV8A 4PPGA 1D2RA 5DDMA 3OO1A 1B23P 1VB3A 2VPTA 3REQB 3V6HA 1P8JA 4TQUS 4KWCA 2M6SA 1V47A 1X40A 1EB9A 4TV9A 2J30A 4C5BA 3HWSA 3MR5A 3C3EA 5KTSA 2UVPB 4IIDA 5L9AA 1AY0A 4FD2A 4ZARA 4LBWA 4UBNA 3ZLTA 2J6UA 1ZCAA 4QX6A 4REMA 5JSZB 3OP4A 4LGMA 1OXMA 3P9YA 1T5SA 1WULS 4RTRA 4EUFA 4DR1B 2EQ5A 4H4CA 1TJ3A 3KOUA 4KACA 2R44A 3CRZA 1EFVA 4N54A 3TRFA 1UXOA 3PZBA 2YYYA 4TWZA 3HE3A 3W3AH 4XD2A 3CZ5A 4KQCA 2GUWA 3UEOA 3D7SA 4RWZA 4CMGA 5LQKA 2DFLA 1T0PA 4HAZA 1AZWA 3AEKB 5GZ6A 4XDGA 3B51X 4EF6A 1RKQA 1R6XA 2ZJFA 4FVTA 3SC3A 5DDIP 2OR3A 3SZLA 3GLQA 4F97A 4HWGA 4P98A 2AX3A 3I53A 3MCUA 4JYPA 4NESA 4FHGA 3JR7A 2M9NA 5JZOA 4M88A 3I83A 4QUKA 4UEQA 3GN1A 4N39A 3S1LA 4CKZA 3O90A 3GFKB 1XKXA 2CE2X 3BG5A 5BUZA 1HGXA 5J1SB 3BMNB 4JLAA 1XRSB 4L7VA 5FD8A 1HX7A 1Y0BA 3JQ8A 3O9ZA 4J0HA 5FJJA 1YU9A 1Z47A 4J8PA 4KPUB 3QE9Y 1PVQA 2B2CA 1R16A 2NIPA 4MRMB 4Y2HA 2LCFA 2BEUB 6PFKA 4M1EA 1XA4A 5FO1A 4EVQA 1FIUA 2C9BA 3KEOA 5J0QA 3KOXA 2FXIA 1WE2A 3IBFA 3A05A 3R0ZA 4PQYA 4RMJA 1T6XA 1DO2A 5DNYB 4J0IA 5LLSA 3GA7A 4IG4A 5DE3A 4BNFA 4AKIA 5G3ZA 4RCZA 5K8IA 1V2GA 8ICZA 1G21A 2O06A 2CCKA 2PXXA 5HKAA 5DHSA 3EQ6A 1PNTA 2K4MA 1RI1A 5DW3A 2P1DA 4LY6A 1AQJA 1EFUA 4Y1RB 5M5BA 5J63A 4LMPA 4DDUA 2W37A 5LB2A 5SZJA 4JI3B 3A4IA 8GPBA 5HKKA 2W6MA 4I1VA 3UMFA 5JYEA 2H1CA 1IIRA 4KQIA 3NHMA 1FZQA 5THQA 1Q7RA 3FH0A 5AJUA 3V1YA 4BNMA 1KMIY 5KFMA 1SKYE 3HBJA 5AJXA 1NE2A 2H7CA 4YMGA 4FBUA 4M55A 4CM1A 2VT7A 5CX1A 5BOSA 1M6NA 3EWAA 2Q8NA 4M0FA 4MPPA 4MS3B 2XWSA 4QIHA 4UUMA 3KKAA 1XTPA 4UB8U 3QUTA 4HNAB 5CLLA 2JGEA 1K06A 2ONCA 1GPNA 5E8JA 4ABYA 4L8LA 2JJ8A 1SXJE 1LBQA 3NVMB 3K20A 3W9SA 4F96A 2W54A 4XR4A 4KPUA 3C5HA 4I50B 2VJ5A 3THWA 4PM4A 4AKGA 3FF1A 3GY0A 3NEPX 3AR4A 1OX4A 1GU0A 1PR6A 1M33A 5MGBA 5AR1A 2ZZMA 1I14A 2YZNA 1HFJA 1JPJA 3HN2A 3BXXA 4XCXA 4KN5A 4IDEA 4EQZA 3FTNA 1TW2A 4JB8A 3BKWA 1II8A 3S1SA 3ZGXA 3GV8B 4DRXA 3GA5A 4XM0A 3U56A 2PKYX 4HQLA 1KY4A 3TJMA 4KIWA 4R1MA 2WD9A 3RVSA 1GWNA 3EZ7A 4PZNA 4DMFA 4HYKA 5T5QA 3P32A 1IM5A 2O2JA 3NUZA 1CIJA 1GFWA 2X7HA 4MVWA 2J59A 1HT3A 4UDXX 1JBQA 3GJQA 3HCOA 8ICAA 4X1YA 4A8JA 4RY9A 4ZCQA 1X9IA 3Q8RB 3D9QX 4FHFA 4GXRA 3RVRA 3C5CA 2C2XA 2C2YA 5EN4A 3VR5D 2C78A 1C9JA 1QONA 4GM0A 3IUNA 2W6JD 1ESCA 5DN9A 5EMKA 2X8AA 2Q62A 3HB5X 5FOUA 4PJ0U 4XPZA 2GR9A 1DOQA 3BCRA 5FH9A 1KPGA 1MTZA 3TAPA 1D9XA 2JFNA 3OQ1A 5FWYA 4RTMA 4E1VA 1MG5A 1LV7A 2QU7A 3E2IA 4ITUA 2GTPA 2WAMA 1E3IA 1FDRA 3TLZA