2WF5A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and trifluoromagnesate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf5A01
5AKZA 3WK8A 2JAOA 3MN1A 1ZD3A 4UM5A 3L0CA 1RKVA 3L8HA 3IJ5A 2ZBDA 2B30A 3N28A 5AVSA 1SU4A 5AM3A 3E81A 2AH5A 3W5CA 3KBBA 5AW4A 4EX6A 4EELA 1Z4KA 2I54A 3B9BA 3L0YA 2HHLA 5AKKA 4XPZA 1Z5GA 3A3YA 3B9RA 3WK7A 5ALXA 5AKLA 3QUQA 3EF1A 3ESQA 5AVXA 3ZUPA 3N5KA 1FEZA 4IFTA 3I1YA 1RLTA 2P11A 3QUCA 4HGOA 4PNHA 4YH1A 1XP5A 4DW8A 5ALDA 3BA6A 3U26A 4BNDB 1T5TA 4OFZA 1K1EA 3K1ZA 4I9FA 4UMDA 5AW0A 2GFHA 2VKQA 3DNPA 1QQ6A 1WPGA 5JJBA 5AI8A 1Y8AA 2B8EA 5E0OA 2HF7A 5AW5A 4J03A 3QUTA 2W43A 3OCXA 3SMVA 3AR4A 3ONNA 3QU4A 1YMQA 3UMBA 4Y3UA 2P9JA 3QLEA 5ALTA 4AS2A 5AVWA 3FVVA 2B1QA 1X42A 1S8OA 3QX7A 1CQZA 2FPXA 5AVZA 4EENA 3FZQA 5A3SA 1T5SA 3IRUA 1TE2A 2WHEA 2P69A 4BX3A 3U13A 5AVUA 4UASA 2WF9A 3I6BA 2HOQA 4Y2JA 5AI9A 2WF6A 4Y2QA 2YMLA 4UAUA 4KN8A 2ZG6A 3ZVMA 3OTQA 3L1UA 1Z4NA 2P27A 1KYTA 2RARA 1O03A 5ALUA 3N1UA 3AR3A 2PKEA 3WKBA 4BNDA 5AVTA 2IOHA 2W4MA 3M1YA 3R09A 1RQLA 3WKDA 1U7OA 1EK1A 3NANA 5AKXA 2GHQA 1RMYA 1VJ5A 2BDEA 2YJ6A 5ALJA 3SKYA 2JAUA 3WGUA 3U7HB 1NRWA 3OPXA 2DQSA 3WKEA 4HAIA 1RMTA 5AM1A 1YJ5A 3KZXA 2YN4A 2CFSA 3FPBA 2EATA 5AW1A 5AKYA 4KYTA 5ALZA 2FEAA 1XVIA 3L8FA 1ZD5A 4ZEXA 3EPRA 2WF8A 4BX2A 3N07A 4KNVA 3ZU6A 2RB5A 2I33A 4XQ0A 3KDPA 4XOUA 4YCLA 1L7PA 2AMYA 2ZXEA 4Y2UA 3UMCA 4UARA 1L8OA 3AR5A 2BDUA 3HLTA 2CN1A 1WVIA 3OCZA 1RRCA 5AK4A 3QNMA 5FP0A 4F72A 1U02A 1O08A 4JB3A 5AIAA 5AI5A 1T9ZA 1Z5UA 2WF5A 4BBJA 1LVHA 2W11A 3AR7A 2ODAA 2PR7A 2EAUA 2WF7A 3U19A 2AGVA 2G08A 1Z4IA 4CNQA 1L7OA 3OCWA 3OCYA 3L0BA 1YS9A 3FM9A 5AVQA 1AQ6A 3PGVA 1N9KA 3ZW7A 3WK6A 4QQFA 3SLRA 4G63A 4O8CA 3L7YA 4KX3A 1Z4PX 4AP9A 1ZD2P 2NO4A 1J8DA 3MC1A 3DAOA 2YY6A 4KX5A 1Z88A 3FPSA 3L1VA 5AKHA 2R8ZA 3DV9A 4NV0A 2GHTA 2I6XA 1Q92A 2HSZA 1YNSA 3AR8A 1RMQA 5AW9A 3SF0A 5ALIA 5A3RA 2WM8A 4RETA 5AM2A 3R9KA 3FGOA 3J7TA 1TA0A 5ALMA 4FYPA 1U7PA 1NNLA 3MMZA 3WGVA 5ALPA 3R4CA 4BKMA 4UATA 3RFUA 4BEVA 2B1RA 3WK9A 1YV9A 1IWOA 1Z4OA 1U2TA 1RQNA 5AM4A 4NWIA 5ALLA 3A1DA 3A1EA 4BEWA 5ALOA 1QQ5A 3F9RA 1RDFA 5AKGA 5ALQA 4HGQA 3QUBA 3U7EB 2C8LA 4OD0A 2OM6A 2OA0A 1TJ5A 5AESA 4Y2PA 1SWVA 3GYGA 2Q4RA 4L6AA 3ZI4A 3AR2A 3KD3A 3MPOA 1QQ7A 3E8MA 4GXTA 2B0CA 2G09A 3RF6A 2HCFA 2JAWA 4UAVA 1PW5A 3WK5A 4C4SA 1LTQA 1RKQA 2ZOSA 1ZOLA 5AW2A 4YIHA 1TJ3A 5AW3A 1Z4JA 3U7GA 2X4DA 5T41A 4CF3A 1WZCA 4DFDA 2MSNA 1ZD4A 4J2TA 3WKCA 2O2XA 3NASA 2FI1A 3QU2A 4OCZA 3NAMA 3QXGA 1MH9A 5AKJA 4OHFA 2PQ0A 2HF2A 4ZEWA 4L6CA 3ZWKA 5AKIA 1ZS9A 2FUEA 5AVYA 4RESA 2R8EA 5ALHA 1RKUA 3SD7A 4HGPA 2ZBEA 3B8EA 4YIKA 3DDHA 2I7DA 2HEGA 3E58A 3SHQA 3TLMA 2WFAA 4KNWA 1L8LA 1L6RA 5AIBA 4YCMA 4EZEA 2YJ4A 3OCVA 5AICA 3WKAA 3QU7A 5ALFA 2OBBA 2I55A 4QJBA 5AW6A 3A1CA 3ED5A 5AK6A 3ET4A 4UU1A 3IB6A 4MWOA 4DWOA 3P96A 2O9JA 5AKEA 4Y2YA 5AW8A 1F5SA 3CNHA 3D6JA 3NALA 3ZWDA 3SKXA 2BY4A 4CE6A 5AM0A 3EF0A 1J97A 4I9GA 2FDRA 4NABA 3I28A 3ZVNA 5AVRA 2G06A 5IT0A 4C4RA 1RC8A 2G07A 5ALVA 5AM5A 4UMEA 3L5KA 3W5DA 3UMGA 4E88A 2Q5EA 5AK5A 2I34A 3NUQA 2R8YA 2IA5A 3AR9A 2YFYA 4XE5A 5AI4A 1Z4QA 4IG4A 4L57A 2C88A 2GO7A 4Y2TA 4CF5A 2QLTA 3U7FB 3QYPA 2C8KA 2YMMA 4AS3A 2Q4TA 4Y2RA 3KC2A 1Z4MA 5ALGA 5AI0A 3OCUA 3E84A 2JARA 2IOFK 2G0AA 4DCCA 1TJ4A 1L7MA 3WK4A 1ZJJA 3AR6A 4HGNA 4JDPA 1SWWA 2OYCA 5AHXA 4NFLA 2C4NA 4UMVA 2YMPA 1CR6A 5AW7A 2HX1A 1RPZA 4HYTA 2QYHA 3I76A 3NIWA 1JUDA 5IT4A 5AK3A 4H1WA 5ALNA 2ZBFA 4C4TA 5ALEA 3L8EA 4UM7A 2EARA 2RAVA 4YCNA 1ZRMA 3ZX5A 2AUTA 2YJ3A 1RLMA 4FFDA 3M9LA 2JGAA 5IS2A 1XPJA 3ZTYA 3UM9A 2C9MA 2HI0A 4EEKA 4CF4A 3PDWA 3KOOA 1S2OA 3ET5A 1YDFA 2CFRA 3ZX4A 2HDOA 1L7NA 4Y2SA 2RBKA 2GMWA 4MUMA 1QH9A 1VFPA 1NF2A 1WR8A 2B82A 4B6JA 1Z4LA 3S6JA 5A3QA 1EK2A 3ESRA 4FE3A 2IOFA 3VAYA 2HO4A 3W5BA 5ALKA 4ZEVA 1Q91A 4UU0A 3CZ4A 3EWIA 2FPWA 3ZVLA 4F71A 2NYVA 4BX0A 2ZBGA 1VJRA 4BYGA 3QU5A 2B8JA 1ZRNA 4UW9A 5ALYA 3QU9A 4NAVA 2FPSA 5AVVA 2YJ5A 2FPRA 4HGRA 3HYCA 4Y2VA 2NO5A 3QGMA 3L8GA 2FPUA 1N8NA 2YMQA 2G1AA 2IYEA 2FUCA 2YBDA 3N8GA 2CFTA 1QYIA 2MU2A 3PCTA 4Y2XA 2D2VA 1RLOA 1U2SA 4YGYA 2G80A 3PGLA 2MU1A 2R8XA 5AI6A 5ALRA 3NRJA 4G9BA 5ALWA 4UMFA 5ALSA 3W5AA 3ZTWA 4EX7A 3BWVA 4GIBA
chains in the Genus database with same CATH superfamily
1OXJA 3ESDA 1VPDA 3WYBA 2Y6UA 3KJFA 3G6XA 5JZSA 3UB2A 2RG1A 1ZVJA 1UC5B 1M2WA 1ZU5A 2FWBA 4DOMA 1UMCB 4ZAGA 3TADA 2I7XA 3KXKA 2XLCA 2RBGA 4PC1A 4NX2A 4KMUA 1A50B 1P3DA 1UJBA 4PNHA 3HILA 4DLYA 2G72A 4BC0A 2GX6A 5EP4A 4ZT5A 3AONB 1B4FA 2IBTA 1VHLA 1E5QA 4R63A 2G1KA 3HB7A 3DEHA 1H1LB 2VK2A 4LDPA 3FCYA 3IGFA 3A1VA 1YZ3A 4CIDA 1EFCA 2Z1DA 1O3YA 4DJFC 2VJBA 5DLYA 1C3OB 2V7GA 1EYZA 2REOA 2VNKA 4ECVA 4DV7B 2DHEA 2DSTA 5UKDA 1ZQDA 4Y7DA 2O1XA 3E7DA 3FAZA 2XT0A 1SM4A 2GEKA 3NBQA 3FMFA 2YN4A 2DFNA 2A9QA 7YASA 2F64A 4DJAA 1YJQA 1LCIA 2WJJA 4F04A 1SUBA 2DVMA 5PGMA 2D3DA 4HV4A 4UARA 3TL2A 2OAP1 1EZ1A 2FFBA 5ER6A 3RFXA 1GAXA 2KFZA 4B9VA 1T0HB 5B5SA 3DEEA 5TQJA 1O94A 2IEGA 2I6UA 1ST3A 3A6KA 3EIQA 3SR6A 4B9SA 4TTVA 4ZOHC 1VYTA 3IR6A 4BNIA 1KZ1A 3THWA 5K20A 1U0TA 4Y6LA 5KDLA 4XSHA 1ILEA 1YS1X 3IFSA 4RK1A 4W1SA 3HADA 3QVLA 2C99A 9ICGA 4RZHA 2VP5A 3EZ7A 2ZUDA 1NMXA 2J09A 3W8DA 2WHPB 4OU5A 1RQRA 1RLUA 3BGVA 2WE7A 3HB1A 1NFRA 4YTEA 3DL7A 4B7UA 2FWNA 3TZ6A 2Q9BA 3WK9A 2GD0A 1JW9B 3PX7A 3NHYA 1DAIA 1QQ5A 1SCQA 2XF8A 1JROA 1QDLB 3AF2A 3EXG2 4HLCA 3T35A 2SKCA 1Q21A 4Z3DA 2ZJ1A 4PHDA 3V4FA 2ZUBA 1KP9A 5GGYA 3OA0A 2VJKA 1T1IA 5KKAA 5PNTA 4KDCA 1SOUA 4MQ6A 2KE5A 3H2YA 3A2KA 4HJXA 7ICLA 2IE8A 2ANCA 3PWKA 4BO8A 2M2IA 5HF5A 2BHNA 4JJKA 1FFDA 1MOQA 3IP7A 4DFJA 3OIYA 2VYCA 1VCOA 1DOHA 2GN9A 1NR1A 1QAMA 1X80B 4CR6A 4JASB 2XUIA 3IAHA 3W5DA 1FQKA 1Y3IA 5CH5A 2YASA 2OAQ1 4KWTA 4XGIA 2GO7A 2C8KA 3EZ6A 3FFXA 2ZB2A 1I36A 5F2OA 1AKRA 3REGA 1WKBA 1E9SA 1K8QA 1ECBA 3RC8A 1SCIA 4FZMA 5KX5A 2NVUA 3O92A 3W6UA 4MRPA 1WY5A 3ZX5A 2EBUA 3A6JA 1EINA 4L4XA 3OJWA 1D2EA 1U11A 4O5OA 3D1LA 1SVLA 4E5KA 4I2NA 1X94A 3TQCA 1TQHA 1RWBA 3HXKA 4YAFA 4B3SB 3CVYA 1ZGCA 4PEVA 5M34A 1OGJA 3BZUA 2P9HA 3EPHA 1QYXA 2A5LA 2NTJA 1HYBA 3CF4A 4M9RA 2PZBA 4ZO6A 1Z5ZA 3KFUF 1ZVMA 2WU1A 4TTAA 4U2GA 1CJKC 2NT3A 2C1XA 1SKBA 4GXJA 3JD0A 1SC9A 2YJGA 1YB6A 3N8GA 1BN7A 2CFTA 3PD1A 3G8CA 3OWOA 4OIFA 1UDAA 2VK1A 3G0HA 2K8BB 1Y9DA 4ECAA 4ETNA 2O8CA 1I2BA 4MKHA 4I4IA 2BBTA 4HB4A 3KWLA 1A8QA 3RJGA 4Z53A 2BZSA 1QG4A 3KPWA 4OXQA 3G1TA 4GEKA 4S1WA 3H9UA 3AOEA 3VPCA 1SUCA 1FMFA 3F4LA 1PI3A 5GAJA 1F1JA 3NBKA 1I6KA 4JWMA 1FNDA 2E6KA 3AF3A 4RZUA 2C3UA 2C42A 3HB5X 2CNKA 3H84A 1ZSNA 1SUIA 4JNCA 3OLWA 1L7RA 2R60A 2L5YA 3BRWD 1S89A 4IV5A 2KPOA 4F7DA 5IJ9A 2GZAA 2ORWA 4KAJA 3HZRA 5CT5A 5C8DA 4BS9A 1NTOA 3L1UA 3HBNA 1CFJA 3MJTA 4YP5A 4RLFA 3BZCA 1B22A 2JB9A 3UN1A 1LDNA 3LW7A 4C7YA 1F0KA 1HBJA 3B3AA 2X7JA 3OPXA 3GV0A 3D8BA 5HIIA 2B9EA 3PR1A 3OQHA 4G0MA 3AL0C 1K6XA 5E7IA 4L5AA 2J0UB 1S2LA 2SBTA 4WBNB 4LS3A 5EEGA 2XWJI 3BD9A 3E82A 2FF7A 1W2GA 2FWMX 2XVAA 4IY1A 2F1OA 1EKXA 1ZUHA 3DVRX 3N6XA 3WWOA 5JS1A 2BJWA 5FUBA 4RGQA 2CD9A 5CYOA 4EGCB 2QSUA 3DTNA 2YQEA 1R9MA 3HKBA 3D7KA 2GT1A 1L0BA 4AULA 4MLCA 2GWHA 1LVGA 4JI3B 2FFHA 4FGJA 1WPRA 4KKXB 2CFOA 2OSVA 2PANA 4X3CA 2C5HA 2A5GA 5CD9A 2QR5A 4TTQA 5D7BA 3EVDA 3AETA 2FFRA 4BNGA 4K28A 2QU7A 2P2CA 1FNBA 2PV0A 3KZNA 4A8JA 4QGBA 3AKZA 5C4MA 4RH3A 1QB8A 2PUEA 1PGPA 3OSUA 4DABA 3EVCA 3HNPA 2IPMA 1YZTA 4YQFA 3DVAB 5JQGA 4IDHA 4YJHB 1SVNA 4G5RA 1J2MA 1I01A 4O3MA 2DJ5A 2I71A 3QG1A 5DHSA 5FV7A 5JBNA 3VC3A 3QPUA 5FDFA 2E4ZA 3PEUA 2E6UX 1Z7EA 4BLWA 3U7GA 2GAFA 3D2NA 3RS4A 2GARA 2R96A 2YZ2A 3BIJA 4LN1A 5BNTA 1ZQEA 1XMSA 5CHEA 5K1ZA 4L6CA 2PRSA 5LQNA 4PLZA 4RESA 4E2YA 1LS6A 2FN8A 1E0DA 8ICOA 4MGIR 4EZEA 4K1XA 3FPFA 2HJRA 3KETA 1OFUA 2TECE 3AM1A 4G25A 2XA1A 4XLLA 4B40A 2ZP1A 1AMOA 2O9JA 2QJRA 1NUTA 1XU4A 1E2MA 3LUKA 3TW6A 1X7GA 4DM7A 1HDEA 2N46A 4KOEC 3V7LA 4LNUB 4MHVA 5HRCA 3GMTA 2RHJA 3OSNA 2GZ2A 2X8LA 4W1PA 5ALGA 5DLEA 2Z3ZA 4Q39A 5FD8A 1IN5A 2HHAA 1W46A 4RACA 3M4YA 3VO2A 2CXOA 4CL8A 3F3MA 2HX1A 4A0QA 1KK2A 2H1SA 1G291 3ZDDA 3RJJA 2PKYX 2BDTA 5HJ2A 1L4UA 2NLOA 5ESWA 3U4GA 1SHTX 3AZPA 1E2DA 1NMYA 2EP8A 1E62A 4XD7A 4YCCA 3TX2A 1CUYA 1N2OA 4R1NA 3SFVA 4Q9HA 4D9EA 1UBTS 1E5XA 3BSWA 1KJWA 3OM9A 4GNRA 2UYHA 2RJNA 4DG9A 2H4HA 5B58C 1GRRA 1Z00A 2V3CC 3UK6A 1HT1E 2CFIA 5TRTA 2W3SA 4U0KA 2FSVC 2R6GA 1W36D 3RRMA 4EEXA 2CZGA 4IHJB 1U7UA 4EX7A 1L4EA 3NQ41 1EVIA 4C88A 4PPXA 5L4LA 3RKUA 1RRFA 2J9GA 1S6YA 4V3CA 2P2YA 2IF0A 3RRGA 2GKOA 1GYPA 2K87A 5EUMA 4OHRA 3GLIB 5IAKA 1NJ2A 1DBVO 5A9TA 3TG8A 4A23A 3FMPB 3FWHA 4EIWA 3C1AA 4XUGB 3D4PA 2OD9A 4OKIA 1OWPA 2CVOA 2JFOA 4CT5A 4J03A 4RHXA 1FJXA 4F6CA 2WK1A 1UEXC 1M7GA 4RCYA 4ED0A 4IDGA 2GNPA 1V3UA 5IJ0A 2KKVA 4I3GA 1WV0A 3U13A 1QVRA 1PR0A 2CDAA 2R5FA 1A7UA 3OTQA 1NUSA 4NCXA 3W4IA 2WOOA 3N1UA 3K9FC 2H8GA 3GEDA 1NN1A 4P33A 2X19A 2WZDA 3T5DA 2C4HA 1FYWA 2ASLA 3B7PA 1MW9X 2GHQA 2C7VA 2B7CA 5K0JA 1TT5A 1Q3UA 3A27A 1RNLA 4HAIA 3OD1A 4LFBB 5HKAA 4OHUA 4IS7A 5J2UB 5AW1A 1SUWA 2VJOA 1GTMA 2RRDA 1AB5A 1AHNA 2VP4A 1R6VA 2WB1C 2AKAB 2D3TA 2PTGA 1JNYA 1I9GA 1GAWA 5HQJA 4OL9A 2OXRA 4GPAA 1BGWA 1H1DA 2VG8A 2FA9A 2HCBA 4QRDA 1IUKA 2FRDC 1OFVA 3RV4A 3Q8MA 3ZXIA 4QYMA 4BWYA 1PZHA 4I9HA 4YJKA 1HEIA 3OKFA 1IBRA 4J8PA 1SIOA 2R6FA 8ICSA 3RM3A 1MQ8B 4K9NA 3AFNA 4IMRA 4RTOA 5CG2A 3AXSA 4XGRA 2FY8A 5DN6D 3KDAA 2H1VA 3ZGXA 3BXXA 5IM4F 2GEUA 1NVFA 3ZV5A 4DLBA 1SHLA 4FBTA 3REQB 3G0BA 3QELB 2F00A 1C3EA 4QT4A 5KOIA 2D5IA 1O57A 2O5EA 5A05A 3GJ6A 1ISMA 1E1RA 4BO6A 3OQIA 4Q48A 2IHKA 4ZFNA 5DG8A 3N74A 2FW7A 3IT2A 3KQYA 1NGSA 4GOOD 3P9ZA 5EIWA 4DSZA 2BGNA 3OGUA 1Y1LA 5L1LA 4QODA 3V72A 4CM5A 1U8AA 4GBGA 1DQNA 4WK0B 2R8EA 2CL0X 3L4PA 1ZQGA 4KXWA 5JATA 3JVDA 4FJ2A 3TM5A 3CA8A 4WN9A 4OGKA 2YYYA 4P3PA 4I1PA 1ZGJA 1NXPA 4AJLA 1OXMA 4ZVLA 1OV6A 3R1IA 2H3IA 2ISPA 4DWOA 2OESA 1Y3FE 1SB8A 3ZLUA 4QO7A 3R44A 5IF9A 4HNUA 4MROA 1W49A 4RMJA 4RV5A 2R7AA 1U1EA 2G07A 1KSHA 3EG9B 2XYPA 3EQZA 3VHXA 1N5XA 1DB3A 3L04A 1WOYA 3ECSA 4XWYA 3RYCA 1VZ3A 4AS3A 1ST2A 1RR6A 1MN6A 2CVPA 4BVFA 1PP4A 4BFLA 5BSKA 2P6OA 1G3UA 1P29A 4ND7A 1O9HA 2ZIUA 3PXGA 3ZQUA 5CHGA 4Q02A 4JI7B 1PR3A 1TEVA 1TMYA 3INNA 3HRKA 1YA8A 4ENWA 4Q1FA 5J5VA 3FB1A 1VE5A 5KO2A 1QHFA 1G3QA 3K2EA 4YRBA 3CB2A 4EB6A 2VBGA 4C8LA 4HN9A 2RK3A 1VPLA 4GLXA 1OH8A 2Q27A 1J1IA 4RHTA 4P9NA 3CZAA 4CKCB 3HI4A 1PK1B 1RQ7A 4X62B 2X0DA 2I7VA 2W8BB 5KNCA 1DEAA 2XQGA 4D0LB 4DLUA 1NVAA 2BMJA 3BKWA 4KLJA 3NEJA 8ICAA 3HYRA 4K8RB 5C8ZA 2VDKB 5C5CA 2A1UB 1NLMA 1JAXA 4NPCA 5DGXA 2BFEB 1GKLA 1ZD3A 3DCYA 4GSKA 4H6VA 3BWCA 4EPWA 3VUFA 2HIAA 2DWQA 3F78A 1CRXA 3QEBZ 1ANKA 4JVLA 2BM0A 4V2UA 2RD2A 1OU4A 4ED3A 2JJQA 1ZSYA 3IM1A 4CKZA 2FNAA 1Z62A 5T64A 2V7PA 1Z13A 2POQX 5C5DA 5HJ7A 4UDXX 1KFSA 2LRHA 4I9FA 2YBEA 5FWYA 3H8VA 4CM4A 4EEZA 5I7SA 3CEHA 2DFKB 4GGMX 2JEIA 2CXXA 1EFPA 3ZR4B 2PMBA 2XQVA 2YOFA 3PSFA 2DP4E 2R6HA 3HU1A 1CU1A 2ZG6A 2EHDA 2OC9A 3F9CA 1KYQA 3IVMA 2ZE7A 1RQLA 2XR1A 3A3KA 3KHGA 3WDMA 2V7UA 4EYSA 1V5EA 1RXIA 2PMWB 3N5CA 2OORC 3TNDA 2ZRFA 3S1SA 5CIWA 3MFIA 5B1YA 3WL6A 5J0XA 3LVQE 4J1SA 1YR7A 3L0IB 2GD1O 2J32A 3G7NA 4EG1A 4RF2A 2WJAA 2DCMA 4YP0A 3AFHA 4IM7A 4CUJA 2B34A 3BHJA 3CY6A 2A92A 3I9JA 1CEXA 2O05A 1IHOA 1J5PA 4PTLA 2R4TA 4GRIA 2E4XA 2QY9A 1P4RA 3G8DA 4CNQA 3F6PA 4G65A 3IKMB 4UD2A 5J8YA 4O2BB 1TUIA 3SE0A 5KNDA 4PX5A 4Y7CA 1NM5A 1TLFA 2J3HA 3DBVO 4D9HA 3VTAA 4ZVVA 5JPIA 1ZQQA 2GPBA 2PWAA 1I5OA 4BZPA 4FMBB 3B82A 4X0EA 4MXDA 1COZA 3RRHA 4MDFA 3TTVA 2WI8A 4F2PA 3LDAA 4P3OA 2BFOA 7AT1A 3K09A 1T3TA 3ENZA 1K1QA 1DIAA 5DBEX 4H7KA 4HDRA 1GXSB 1UZLA 4DRXB 1OI7A 1K4MA 4F0JA 2O52A 1Q22A 5AJVB 5K0GA 5DXAA 1J06A 1TUBB 3RGGA 1U65A 4YAJA 4OHKA 1SBTA 4P22A 1TU0A 5EUBA 3WLKX 2PZGA 1LV5A 2Y1KA 1SKRA 5EEHA 3UY4A 2PXXA 5DTRA 5HHHA 2AD5A 1U2ZA 1LTHR 3U17A 4FEEA 3LTEA 1E66A 4R01A 4E70A 1GPKA 5U4XA 3B78A 3FZYA 3GLKA 5BWLA 4EB3A 2I76A 4KQCA 4DA7A 5IJZA 2LUOA 2E5LB 4QO8A 5JAOA 2B2CA 4NK5A 2XGMA 1V16A 4GKBA 1Y7LA 3HTXA 4DY4A 1RPNA 2KOBA 1V95A 4BMYA 3MD0A 1WLSA 2AXEA 5FOTA 1YF3A 5FR1A 2TS1A 1Z16A 5EWGA 3QYPA 3E3OA 4FZLA 2PGAA 5JDIC 5HK9A 4C6TA 3L93A 1MZPA 3UXPA 3GLHB 5GOZA 1FS4A 2AFHA 3H40A 3T3FA 3UMFA 3KT6A 2JJ1A 4L0MA 1UR5A 4YRLA 1QCZA 3IUQA 3RUAA 4GKAA 2Q5CA 1K6MA 3VU1A 4YDRA 1ZETA 1QSYA 4O29A 1S2OA 3RIYA 5H02A 4MGKR 3OY2A 2Q46A 4H3HB 3IVXA 3UMYA 5TVKA 2NIPA 3TNFA 3HJGA 1YB2A 4N3BA 4ES6A 3ZVLA 2B8NA 4MW9A 1A6SA 5IH3A 3NFYA 3PHIA 2GESA 3LPDA 2JAHA 1N2CE 5E6UA 2FX2A 1N78A 1XYVA 3ZDZB 1TQ2A 1P8AA 1Z37A 5KFIA 3RJZA 4BN0A 1QVVA 3JALB 1FDSA 3HWSA 1RXVA 2OUIA 2XI9A 1EQAA 3A36A 1HIWA 1HEUA 1NXTA 1PNTA 5K0EA 5BOLA 1XQ6A 3H42B 5KC9A 3CZRA 4GGPA 1XEAA 1P2SA 2HXGA 1Z56C 1QO7A 1GV0A 2OWOA 5E9JA 3NDIA 2K4IA 4P4SB 1NW5A 3D4IA 4V02A 2W98A 1P1BA 2Q41A 4WVLA 3PQEA 3LXUX 2OO5C 3HUUA 3O75A 2XRYA 4N1AA 3R24A 2OYSA 3OU6A 3V80A 4I0WB 4QPNA 2R6CA 1R88A 1F2UB 2HMTA 1X7WA 4NPHA 1T5SA 2VZ0A 2VBFA 3O3OB 5K45A 3SI7A 1YDWA 821PA 3PRHA 3MWFA 2JIRA 3M5DA 4DEYA 2UVVA 5D3ZA 4YJ2F 3LQQA 2FZWA 3QENA 2GRUA 5BYJA 1J09A 2ZYWX 4F85A 3COSA 1WBDA 3S5UA 3QF7A 4RELA 2E87A 2P40A 3V6LA 4KRFA 4NBLA 3QV1A 4E7PA 3RJ9A 2PE5A 1MQ9A 2AOUB 5JH7A 4IFIA 2O2JA 1M8KA 2ID7A 1ZH0A 4WKOA 3GWGA 2OQVA 3R5HA 1BXGA 2QKYA 5BSFA 1VJ0A 2C77A 1H23A 2B4YA 2XKBA 4Y67A 5AQEA 1KEUA 3MJDA 3AR7A 5JR3A 1N9ZA 3L07A 3HI6A 1KDZA 4Y8VA 4G8JA 2FZVA 4F12A 2JGDA 1LSJA 5F1KA 1NW9B 4TPKA 4C0LA 4QQFA 2PGJA 1GQQA 4B46A 1ID8A 4AJNA 5D5HA 3BIFA 3DV9A 3IQFA 4PNZA 2GHTA 1QTQA 4Z0NA 1GA6A 4ZQEA 1GGNA 5A3RA 3PJEA 3KKZA 2GYVA 1RRMA 2H1OA 1HORA 2QQ5A 1T2NA 2HAEA 1R5OA 3W6ZA 3EF3A 4RE6A 3WHKA 1NPDA 1LDYA 3WK5A 3B6IA 4U9HS 4XIIA 2D0DA 4PF1A 1MRSA 1SKMA 4FILA 4ML3A 1DHRA 1EJ2A 3CVOA 2FI1A 6CHYA 1KRHA 1MB0A 1YR8A 1ZS9A 2JH1A 1WTCA 3GLSA 2Z30A 1U2RA 3E58A 1FRZA 2ZKLA 3CUVA 4TWAA 4NDAA 1LPOA 5L1JA 3E4DA 2QNBA 1E79A 4QLOA 2XUZA 5BMVA 1GQFA 3P2YA 3A9SA 1BE6A 4U7TB 2QJWA 3HGTA 4O5CA 3C3AA 4JI0B 2O54A 2XDAA 4DDHA 2MINB 4AKEA 3PEWA 1TYZA 4AC9A 2W03A 4ZU6X 1W94A 2I2CA 3LFHA 2YC4C 1X3LA 2QRVA 2YMMA 2EF1A 4O4HF 1G1MA 3LUFA 1JG4A 2I1VB 3QEMB 1ZQPA 4N8DA 5B30A 4BV9A 1ZJJA 4X91A 3WMFA 3PCXA 1CR6A 1XD8A 1YRQA 3ZE6A 4G8DA 5AYVA 1RWOA 4GS5A 3CH5A 1QZ3A 5DQIA 3PDUA 1Z8HA 2JR5A 2IT1A 2HUPA 5A62A 4UPEA 2C9MA 4PG7A 2NACA 2OBFA 3BTOA 3PFFA 4OQEA 3FPJA 4ARAA 1LDGA 3HCPA 3E1GA 3W5BA 5ALKA 3TJZA 3G9ZA 3OOWA 3RH5A 1Q7GA 1ZCJA 4BYGA 5IKEA 4PGHA 2PUAA 1DKLA 3SMQA 4CM6A 4HRYA 4I50F 3I04M 4C0ZA 1SCDA 4WZZA 2Y0SF 1S2IA 4F2RA 4RYLA 5CT9A 1WV1A 1O77A 1VGRA 5KL8B 1C8KA 3MABA 4XRGA 3LO8A 3Q98A 4LIPD 4KTQA 3HV0A 3WK8A 4H3VA 1ZQLA 3FYDA 3LXRA 3TZKA 2GLXA 2VA2A 3ADCA 3TXXA 1Z68A 1ED1A 2I7TA 1TVKA 4QZFA 4WJKB 4FJ1A 2ZQ5A 4BX9A 2MSLA 3PUIA 2X4IA 1KS2A 5G0WA 1MPTA 4RNOA 2IEAA 5KYUA 4RY0A 1HTBA 2AJQA 1EUDA 9GPBA 1AV7A 1LX7A 4BWMA 1J2RA 4W9NC 1DUSA 5FNVF 1JDJA 2GCOA 1MX5A 2LHTA 1Z2DA 3FW1A 4ZVUA 3UGQA 5CB0A 2ISCA 1WEKA 1KRXA 2WWHA 1U9CA 3TNLA 4ISBA 1WDWB 4PR0A 5HR5A 5KWSA 4B6FA 2IOHA 4N8SA 2LBPA 1E60A 4HATA 1LFDB 3C0KA 2FV8A 1U3TA 2OXIA 1GCOA 1EI9A 2C07A 3QSYA 4UBIA 2A9PA 4Y0VA 4WKNA 4BO5A 4EG7A 1FTSA 4IKEA 1P7WA 1HDOA 1ORRA 2QR3A 3WLEA 2VHYA 1LPNA 3WBBA 4M9ZA 4FW9A 5KJEA 1MP0A 1DDGA 2VDMB 2R7KA 3RRBA 4FZNA 3GROA 4GL2A 5FBRB 4BFXA 1II0A 4B4UA 4X94A 3B0XA 1UKZA 2W90A 7ABPA 4DAEA 1N4AA 3UUEA 2E4AA 3NRWA 1C7FA 4TWIA 1RCFA 3ZV3A 2AQIA 5KPJA 2OR3A 4AO6A 3EMKA 4REMA 3ZGNA 2FFJA 2J4DA 4R9NA 4AZSA 1T9GS 1QAQA 4YMOA 4BXOB 5JD4A 3EJ6A 2GBLC 1L4LA 4D46A 1X9SA 3N2KA 3HXOA 4P0QA 3KYDB 4PZ9A 5BSTA 1Z06A 4YAEA 1GCGA 4UHEA 2HSWA 2VK8A 4DLKA 2IS4A 5AWFC 2C4KA 1XVTA 3KT0A 4UXJA 3S29A 1I1QB 3RTBA 2P2NA 2WVGA 1CV2A 4NJMB 4KH1A 2AEEA 4C4PA 4BQRA 3S2GA 2C5SA 3AVWA 2V4QA 2HYDA 2D4AA 1UXKA 1KI6A 2JIBA 3D8HA 2P1RA 4BNUA 1TM5E 1RLJA 5F4ZA 3QHAA 4U2KA 2NZXA 1Q0RA 1YI0A 3FJOA 4X8OA 3V1LA 4S0XA 3EY9A 4DEXA 1ZQIA 4KK3A 4Q00A 3DT6A 4GBMA 1EUQA 4G1BA 1XNQB 3L6EA 4J7XA 4WKGA 2V74B 1XZLA 1K5OA 5JXGA 4YFKA 2ZBEA 2G83A 3BGDA 2XIQA 1Z07A 3A1FA 2P9FA 1JL3A 5ESRA 4RXMA 1UBKS 3FCOA 3T95A 1WCWA 3LC0A 1DC8A 1RAFA 3DBRA 5CP8A 5CA0A 2QI9F 2JZCA 1HTTA 1BS1A 1QNLA 2NQ2C 5KMGA 4RKQA 1NVTA 2ZYSA 1D04A 2IW3A 2W6IA 4K9PA 1FDIA 4QXOA 4YPOA 4BLTA 2QE7D 4CGYA 2VHUA 5K6RA 4DCCA 2FG7C 2FZCA 2GHRA 1JILA 1SWWA 3G17A 4XB2A 3VR1A 4EGJA 2HQRA 4LE1A 1IIRA 3GOHA 1VFNA 2EZ4A 4C0XA 3GUYA 4YCNA 1ZQMA 4EUNA 3V4LA 2YZNA 1TKRA 3VTZA 3DZHA 3SAFA 2DFVA 1B2LA 1VMKA 4KBFA 4XPIA 4W1RA 4WEOA 2X2EA 3TCKA 1TEHA 4HQRA 1P1RA 1ZM3A 4PZNA 1XQ9A 4M1YA 4XVHA 4ENUA 1U0FA 1VCNA 2BM9A 5B3AA 2B1IA 4D6PA 4QIWF 1WQ1R 1V41E 2V5VA 2BEJA 1U8CB 2MSWA 5KWJA 2ZJ0A 3AEKA 3CBGA 1VHTA 3TZCA 3G2IA 3H13A 2RHHA 2EQ5A 3DP7A 1D7AA 1YBFA 3NHSA 1Z19A 3WLTA 3EIXA 1U0SY 4RZQA 2YQ4A 1RM5A 4M8LA 1Y98A 4K9RA 4KLZA 1NP7A 2AK3A 3I4FA 2W6MA 2IJGX 1OFHA 4CL2A 1TPYA 4QYXA 4ZHQA 3GLGE 3M3HA 3BBLA 2J3JA 3S81A 2PAFA 3U5ZB 4DQDA 2AZ4A 3TE6A 1J42A 3LUJA 3RT1A 1N36B 2V7XA 4M7PA 4AJ2A 2W6NA 1LK5A 4YXMA 1OWLA 3QY0A 4LJ5A 1JTFA 3LVVA 5GJBA 5L8VA 4IXTA 5FI3A 3EPLA 3CLUC 2R00C 2VQSA 4EENA 1QK3A 5HTKA 4OG2A 2P69A 4JI5B 3SZ3A 2GUGA 2X2OA 1QH8A 2MYPA 3VMFA 3TTTA 2Q6OA 2HEIA 4ZALA 1IEQA 3IIMA 3EODA 3L49A 3K5WA 2ZULA 4XWOA 3MW8A 2QAGA 4J7CA 3PUYA 1X38A 4YCJA 3AJAA 3M1AA 2VDQB 3GD5A 3QE4A 4UU8A 1Y1QA 3E7WA 3FPBA 1EJ6A 2J07A 3LOUA 4EUHA 2XCUA 3GV8B 2XWQA 3SQOA 1WMDA 4BNHA 1A9XB 3T3MB 4YMWA 3BJIC 3CG0A 5E1DA 2YW9A 4B3DA 4UCWA 2X6TA 3Q9LA 6PFKA 2VF2A 5DSTA 2QN3A 1ZOIA 5A3VA 3SFZA 5K0BA 3QKRA 4I2AA 4FI3F 5BR1A 3LBAA 1QC5A 3IT1A 4XEUA 2KJ9A 2K4EA 2LYAA 3ZDRA 2GK4A 2H11A 4FS2A 1X2EA 3A1UA 4X20B 1FDRA 3HQ4O 1KY5A 3LP5A 2ZTEA 3JQ7B 1H3NA 3LRPA 3U4QB 2OOSA 5KSOA 2QMZA 2I2WA 3L46A 5I7OA 1X70A 3LVBA 2QTCA 2KZ3A 1L4GA 3DUFB 4M0AA 4R2JA 1XHLA 2Y0CA 1GNLA 4GXTA 1R8JA 3B53X 4X65B 5L45A 4OYLA 4BUZA 3SHWA 1RI5A 4HAUA 2PUHA 4M49A 4HX9A 7REQA 3N0XA 4Y30A 4Y1RB 4IKOA 1AA9A 3GZFA 1KK3A 3ZHQA 5ALHA 2VWQA 4QQ8A 4HGPA 2UAGA 2EZXA 4YFVA 2PY6A 5K3DA 4AS1A 4DOAA 3HT3A 5JNWA 5IHXA 1OTHA 2ZPAA 3R0QA 3CMCO 1HNXB 2D8CA 4HGYA 1VLJA 3DOEA 2QTZA 1IIBA 3Q8RB 1TCCA 2CZQA 2KK0A 1NZDA 3U3DA 3LCRA 2O1WA 2X0NA 4KP7A 3EPPA 2CXSA 5LLSA 2VJCA 1M5UA 4QZDA 2NO9A 1Z4MA 5FI1B 1XNGA 3R0ZA 5AJXA 4MVJI 1T3ZA 3AQEA 3WK4A 2G1PA 2IY9A 1G8GA 4S2UA 5GOTA 3CYFA 4OXIA 1W88B 1CJBA 1Z45A 2Y1GA 3F5DA 3AC0A 2OV8A 4FINA 4KLSA 3PX3A 3UWSA 2RHFA 4HN4B 4UVIA 4M04A 1E1KA 1MAWA 1J90A 3FVQA 1G20A 4G2NA 1P17A 1VCMA 1NBHA 4CNBA 2JGAA 1WRBA 4JOCA 2A9FA 4ND4A 4JIGA 2ODWA 2HI0A 4AQYB 4QPZA 4CG2A 1QH9A 1JLMA 3GJRA 3HC7A 4WK4B 5TISU 4G5SA 3NHZA 3BMNB 3QKIA 2UZ4A 5ES4B 1SOMA 5ED0A 4BX0A 4H0CA 2XNCA 3F73A 3HJEA 4HVCA 1SB9A 4DCMA 1WLYA 2HLNA 1X7YB 3LF2A 1QTMA 5KFUA 3NNDA 1PJLA 3FWZA 3BWBA 5FUXA 4XQGA 2OFFA 2NRVA 5KQSA 2NXJA 2VF5X 2VHJA 2CJWB 5AVSA 1UQRA 1XLUA 4I14A 3B2QA 3C1UA 4YAKA 3HCCA 4AO7A 2BD0A 3TSOA 1MSWD 3H18A 3QFFA 5G3YA 1NZBA 3QE0A 2YJNA 4CCSA 4WECA 4KE6A 3H4DA 1U9LA 4JVOA 2EFEB 3KG2A 5FWXA 3QOFA 2JIZA 4KAFA 1CVIA 4H1VA 4NQRA 1S02A 3GPLA 3SMVA 1JECA 3G7SA 4B47A 2VHVA 2O0MA 3R20A 1J0EA 5JADA 3CCBA 3W7VA 4LHXA 3GCGA 5EUCA 3K0BA 2IXBA 4WZBA 2AUMA 5JD3A 3NKVA 1N8SA 2DL0A 4AYXA 4GWKA 3LWMA 3H9GA 3JTEA 3K35A 4I9NA 2QMQA 2QRMA 3RH4A 4GX0A 4DADA 1JFVA 4DA8A 2R1VA 4PHTA 3N8NA 3RC1A 2WFLA 4KPFC 1NQUA 1TPZA 1A9ZA 2D5LA 3STXA 3BSFA 3K9LA 2FEXA 4EZ9A 5KOJA 2A35A 5HXAA 4EHHA 1TKAA 4FDMA 2PFNA 2W8KA 1SUSA 1F8GA 5BUCA 5IKXA 3JYQA 4JEUA 1SQ5A 2QS9A 2XY4A 1EWTA 2OGSA 1V1MA 4HNRA 5IH7A 3WOVA 2ZT7A 1U4NA 1YHYA 2KHZA 5LFAA 3Q87B 5TT1A 1Q7RA 4Q9KA 4U9IS 4J29A 1NX6A 4XARA 2D0PB 5HIAA 1U8XX 1AB6A 3B48A 3PDJA 2HA6A 1TZKA 2AZTA 1U7PA 5JVDB 4FM9A 3P7MA 1FTGA 3MTBA 4WASA 1J2JA 2ZYTX 5JXIA 1FC0A 5AJWA 4AJPA 2Q4RA 5CB4F 1A4UA 1UWVA 1VL1A 3M9NB 4JENA 4II7A 2N1RA 1GY8A 4V0SA 5GQSA 3EVAA 3KKAC 2WJVA 2WDZA 4FO6A 1JHOA 3NJ4A 1QH0A 3JCZA 1RM0A 2SCUA 5CEJA 4I55F 3SF8B 2GEJA 2ZJOA 3LDFA 1R9NA 4AWAA 2ZK7A 2G4VA 2EWMA 4N01A 2Z2KA 3GXOA 4OHVA 3LUPA 3ZDFA 5HZGA 1CUXA 3MRVA 3VDMA 5CXSA 4Q66C 2QZJA 4XWTA 3PXXA 5IP5A 1Q7CA 2OHGA 5IM5A 1OGYA 4EFLA 4IUBS 4GI7A 3DWGA 3H4TA 1JEDA 4FLEA 4Q3KA 4BTLA 4C22A 5D4BA 4ZZIA 1REQB 2C88A 2VDUE 1Y3BE 4QBHA 4OV6B 3PRKE 3QLVA 2GN4A 1ZUD1 3BAFA 3P9YA 4G37A 3B1XA 1WXIA 4EO9A 2HSEA 3F5FA 4Q7QA 2I3AA 2ZB4A 5A9SB 2RAVA 1JG1A 3EW7A 3K8QA 2O20A 2V5UA 4KW7A 3G8AA 2WJ4A 1LBIA 2RGDA 3HEAA 2EKDA 2QK4A 1KDOA 2D1TA 3OJCA 4LJ9A 3HB9A 5EJFA 1CRLA 4NZOA 1TEZA 1AF7A 4O8ZA 4B9MA 3EWIA 3KQTA 4DQVA 3ZU4A 2B99A 1VIDA 2AKYA 5HW0A 2XI4A 1JVSA 4ZOQI 5DG7A 5DYIA 2OHFA 4S1OA 4ME6A 3O7MA 3EOZA 4IV0A 3ADKA 3JTMA 4O3FA 3FBTA 4YXJA 3VSAA 3ABIA 5JOQA 3CRVA 2AGOA 1LLQA 2Q5IA 5IC6A 3BSSA 3IB3A 1DUVG 1G8AA 2EDAA 5HG0A 1E2JA 2YRWA 1YCGA 2OLEA 4D6XA 1I0ZA 3BPSA 3O5AA 1OFUX 3B9RA 2D5AA 1L6IA 4U6PA 3NS7A 2Z5LA 4JLSA 4Z9XA 3CH7A 4G3XA 1VB3A 3K0EA 1POXA 4I27A 4C30A 3UKJA 4BGUA 3TFRA 3RVSA 2NV6A 3DNPA 2HT6A 3LNTA 1PGQA 3WHPA 4TKMA 1P2FA 2COEA 5IVIA 2GK6A 1ISHA 4PNEA 1XL0A 1B16A 4EF5A 1YUBA 4F8JA 4CM8B 1YC2A 3TE7A 4BDSA 1JDNA 2YMLA 3HVIA 2ZTVA 4L15A 1TV9A 1R27A 2JCXA 2IRWA 3GLIE 1KYZA 4FW8A 4M98A 4AF8A 1XKXA 2O2CA 3BIOA 5CLLA 4JIMA 4B44A 3WGTA 3CX3A 3WWDA 2QVBA 5DX1A 4OJOA 2SHKA 1UBEA 3W5IA 3CUUA 5JAPA 3SYLA 1EAMA 3SNHA 1E5DA 1R8YA 4FT4A 3DDUA 1X86B 1NVBA 2Z1MA 2CK3D 5CR0A 4Y2UA 1DCKA 1TM2A 3T54A 4GZ6A 1LWOA 2ZRKA 3LT2A 4F6RA 4A2WA 5U9CA 4F72A 1YVDA 4K0KB 3O4HA 5AIAA 3JASB 4BKRA 5AXBA 4K6CA 4PRYA 3GJ3A 1KQ3A 5JDCC 3U19A 1TAQA 3OLVA 1G21A 1Z4PX 5J1TB 3KT8A 4ALNA 1KQGA 5EHXA 3ELYA 2HT1A 3S1LA 2H7XA 4RTJA 1B0UA 1V26A 4O5AA 3R9KA 1JZQA 3JWIA 3T5BA 2ZXIA 3MSCA 3R4CA 3IIJA 3L8YA 2ZJ5A 1TVEA 4TSFA 4EJSC 1QAOA 4WGFA 1ACMA 1IM8A 3IBTA 1IXZA 4CLDA 3QUBA 2PFSA 3U9TA 4C0AC 2VL7A 4R0VA 4Z4HA 3MS2A 4XFJA 4UBBA 2CLSA 4BRWA 1Z6GA 3GPIA 4JB0A 4KMSA 1C9DB 1NMQA 3H5IA 5G0TA 4RQ8A 4Q45A 2AN4A 2QMOA 1O6GA 3AINA 4DR4B 3SQWA 2WYOA 2ZSBA 5BW8A 3V4RA 4FFRA 1HYEA 2XZOA 3Q3GE 2I3DA 4B8WA 1NBIA 2VSYA 1RADA 3DOHA 1DJMA 3HJBA 3KUXA 4MWOA 5H68A 5KG3A 3ASUA 3KB8A 5KTPA 2BY4A 4KQ6A 3WG9A 1ULBA 1PE0A 1M0TA 1BYUA 3F46A 5CA1B 4MHTA 1LUAA 4KLMA 3MPUA 4AMVA 4IGEA 1K9SA 3RQSA 3GK3A 4YAUA 2XWBF 1EFUA 1XBTA 4DIKA 1UJNA 2EQAA 4H16A 4JJZA 3AP1A 2HA4A 1I1OA 4HTFA 3H0RB 4H1UA 2IIPA 4CTKA 5ALNA 2V8BA 1C8BA 1A96A 3KSUA 5BSHA 2NYRA 1J2UA 4AQDA 1X1EA 1QBGA 3G8BA 1ZAKA 5KFSA 1ORHA 1YGPA 4E6EA 4OA8A 3L0DA 2IZ7A 4YX9A 1ZQ1A 1R5BA 3AERA 3CZ4A 2Z1NA 1KETA 1KMNA 5P8WA 3CG4A 1BW9A 2J30A 1OVMA 4U2CA 3LCMA 4BOYA 1YBVA 2Q3LA 4UEQA 1KL7A 5J2HA 3T7CA 3FKQA 1AHIA 4QDJA 1JHMA 1U1CA 4RVDA 4DIEA 1GPJA 1T6YA 2PKQP 2O3JA 5TQ2A 4GM0A 1C14A 2ZYRA 3PU6A 3OE4A 5CX1A 1U6IA 2HBZA 3B7WA 1XFDA 1XEWY 3GIDA 3IHQB 2HRBA 2G5CA 3LT0A 3DD1A 2NTVA 2P3OA 1X92A 4RKFA 3U3KA 2HR1A 1Q3KA 1WX1A 3HO6A 3RE1A 3T0IA 3JQPA 1Z25A 1S01A 3OH8A 3RIXA 4DV1B 3OLQA 4C1NA 3JQAD 4K9MA 3KX2A 1LPAB 2AQ4A 4US0R 1SXJD 4GZ5A 4UREA 1E6WA 2KWIA 3E9QA 4K4IA 2GETA 4J0JA 4R2WA 5CXXA 5JIBA 1NI5A 1O87A 2GJSA 4HEA6 4X60A 3C14C 4HDOB 4HVAA 2PWYA 4Y6OA 8ADHA 1IMOA 4II2A 1KI9A 4EA7A 2RHOA 1RABA 5BY2A 3SDBA 4HUJA 2EDUA 4U5QA 3N0VA 1AQNA 1ZNXA 3AM4A 4QDOA 1T4BA 5FAKA 1R5JA 2XKAA 2ZPTX 3G8YA 1Z3CA 4OB6A 4JLJA 1NQTA 3THWB 2QVYX 3DMHA 3LT5A 5L1MA 4L27A 3MSXA 3RVRA 2C4MA 1DRJA 2QMHA 3T5GA 1BOFA 1G9TA 3CLVA 3ND6A 1JBKA 1T9ZA 1FW6A 4IUCS 1TIPA 4YMTA 4CFYA 2EDCA 1TGVA 5LOVA 2Y2UA 3UC9A 4KBYA 9ICRA 4IR7A 3V8RA 1GPNA 1LLFA 3C7KA 1SQ6A 4LY3A 5COBA 5TARA 2Q5FA 1DRUA 5KT5A 4A27A 2YY6A 2DGZA 2I8CA 2I62A 4JWNA 1N5RA 1U9IA 4YNBA 5I5GA 1UPHA 4EY5A 3ND9A 1YD7A 1H2RS 4ZQIA 3C3CA 4DQUA 3NJRA 4OLFA 1ZUIA 4XWWA 2TMYA 1V2HE 1BWPA 1Y37A 3I92A 4JLKA 3AF1A 3TTWA 5AOCA 3OIGA 1RQXA 3ANMA 1S9HA 3WDLA 1GP2A 4B9EA 4MFCA 2ETXA 4UD6A 3ECCA 1MH1A 2ADOA 4LNAA 2IGTA 3U1VA 3EZ9A 3WIOA 4UQGA 4F96A 4CF3A 1PLJA 4DFDA 5CJPA 2VF4X 1FXSA 3DGEC 4L74A 4RPLA 3MTAA 5KZMB 1Y3DE 4E32A 2O2IA 4B9NA 3NNNA 3THYA 3L18A 4R8LA 3TTSA 1CUVA 3VPHA 2ZSUA 1EQUA 3AT1A 2GPTA 3OCVA 4J6EA 3G0CA 4WERA 3AHIA 2OFPA 1M1YA 3RAFC 2DGDA 1NDQA 1MFPA 3UEOA 4B0OA 3AHGA 3ETJA 3BQ9A 5EQDA 3G5TA 5FTNA 2XVTA 1K5HA 2PA0A 5TR9A 3E9EA 3HK2A 3CIFA 5KX5B 2Y9TA 1SCAA 2P6MA 2NVUB 4E5PA 5H4HA 1MEOA 1IWBB 4I2CA 4EUKA 3W5VA 3ZCVA 1ADCA 2YFKA 5K3CA 4JV2A 3DAGA 1T2UA 1Q50A 4OM8A 4QRIA 5C37A 1Q44A 3TI9A 1IRIA 3S8EA 1ZMOA 1DLIA 5DG9A 2PT7A 5I3CA 2X3FA 1TZ2A 4C7MA 1PX2A 3V7KA 4F3NA 5L3SA 4A5SA 1XD2A 4IICA 3QXSA 5E7QA 5FBVB 5LWQA 1OU0A 1VIYA 4PQEA 3CYMA 1WABA 4ICIA 3W2IA 4MKFA 1N48A 2DBZA 3SJZA 5I7EA 3OHPA 1JWAB 3L4KA 2XE4A 1DV1A 3N8HA 3EULA 1XMJA 2JH9A 1AMUA 1I7SB 4G07A 3O73A 4RSRA 4YRFA 3MT9A 3GLHE 4WLEA 2AB0A 3ID6C 3FMGA 2J0QA 4BJQA 2BPCA 3Q8QB 4C7ZA 4LHZA 1VSQA 5KFQA 3ZZUA 1JEQA 3FPAA 5AI6A 3BFPA 4YP7A 4G0ZA 5AHWA 4QA9A 1E4YA 4YXWA 1JEAA 2ZRDA 3ETDA 3F2VA 3MYRA 3SENA 3FDJA 4Z99A 1J8VA 4C4ZA 2F1KA 5IANA 5JAQA 5IJ9B 3CF6R 1ENPA 4WLVA 5H1YA 1GU7A 4PG5A 1WQ3A 4GP9A 4ND8A 4H4EA 4X7BA 4RNCA 2QAJA 1NKCA 1AQLA 2XLBA 1U7WA 3AR4A 4P4UA 3IMEA 1W2HA 1Q7EA 4U7WA 2E1RA 4PCAA 1Z2PX 3COYA 2X8JA 3TDNA 1FE8A 3LRTA 4UTNA 1E9CA 1A2KC 4W99A 1P81A 2IPOA 1XSEA 1TJYA 3J7AC 5FHQA 2EF0A 3UW3A 2I67A 4ZI3A 1YZGA 3KPUA 1XWIA 1RMYA 4YR7A 2A0UA 1P7ZA 2JCGA 4EB8A 3KHHA 1M72A 3ZBPA 4WKCA 2IV3A 3R7AA 3N3AC 2VRWA 3HKBB 4PLCA 3N7RC 3EBLA 2FPPB 4ZPJA 1CEZA 3MFYA 4K9QA 3ESXA 3UMCA 3CPEA 3AETB 1OROA 1WS6A 1OAOC 3WQRA 4Z9FA 3ELDA 2C5LA 5AI5A 4CT4B 4F5NA 3NTQA 1UF9A 1N7JA 4YXFA 2AOWA 1XP8A 2QMYA 4RA6A 2CVFA 3QVWA 4YECA 5C0OE 4IGFA 3TAHA 2DWPA 2GN6A 5JQGB 2ZSEA 4KX3A 2P6PA 2B7LA 2BGRA 1CJUC 2GAAA 3RAPR 3A11A 4IDOA 1ESZA 3DM9B 1VKNA 4WFKA 2J3EA 2APJA 5CH8A 3Q7PA 3ZW9A 4NV1A 2PUJA 3I72A 1ZIYA 2E5FA 2R62A 3F3YA 5TNXA 1FRNA 1U3GA 3T7SA 1ZO8A 5KVAA 1IJBA 2VOEA 2HNAA 2WNSA 2BFFA 1TL7C 2JDIA 4HKTA 2ASDA 2I4IA 1DCFA 1VOTA 3L8DA 2A0WA 1K0FA 2FEOA 4PLYA 1BMFA 5TVGA 1QV9A 3RUCA 4X93A 2BFWA 3GH3A 3FYUC 3FBWA 3FF4A 1RRKA 3CISA 1GEGA 4PFQA 1PG2A 3ZHSA 3IXQA 4JGGA 3IBSA 4P2HA 1OR8A 5FOWA 1QKKA 3RARA 1IL0A 3R40A 1PKXA 4LZGA 4EOGA 2GM3A 1PZMA 2AFRA 1NIJA 4M1EA 2OB1A 3KZVA 4H18A 1V37A 5B12A 5KVSA 5J2TA 2J5QA 4HNAB 1S0VA 2J85A 4IOLA 3HO1A 3GOQA 2B37A 4IILA 1YZKA 1P5RA 3LXMA 3T3HA 1UKYA 3KRTA 4AKHA 1DAPA 4MB2A 1ZUWA 4L3WA 3ZBUA 3NC4A 2NYAA 3H8WA 2ONJA 4E14A 1I30A 1QDEA 2HA5A 2VJPA 2IYRA 3IKTA 2VT6A 3D1JA 1OB2A 4NESA 1YZUA 4J0GA 2C5EA 4C21A 2O50A 5HS4A 1Q57A 3BCUA 2WNIA 3PNQA 4EA8A 4HYTA 2C2KA 2LM4A 5AJHA 4NECA 2XVMA 1SKAA 3WWZA 2RDJA 2HPVA 1RYMA 2JGEA 1U5CA 3WA7A 5IS2A 3AP3A 1Z00B 1T0UA 1PTKA 2EW8A 2IHNA 3IN5A 4JOQA 9ICXA 4DR6B 4QD3A 3CRW1 1BPYA 1Z6PA 2QSZA 4RWEA 3E48A 4PZ0A 2Y1EA 2O57A 3ANYB 5BPCA 4H4CA 1LGYA 2M6RA 3DMTC 4DLNA 1ILWA 3K6SA 3C43A 1JSXA 3IQXA 3E35A 3Q7SA 4UW9A 4R2KA 3R6GA 1Y5NA 4Q1VA 1W36C 3MCWA 4IXMA 4MF8A 4HZGA 2Q8PA 4JZKA 2P9BA 1R6BX 1RXYA 4XYLA 5AFSA 4KZPA 2VK4A 3HBAA 1ZHOA 1GUAA 1S4MA 2O7QA 3KTDA 1MB2A 1H8EA 1PQYA 1IUNA 4UMFA 2V9CA 3RVOA 4C0JA 3BFJA 4C7XA 3BA1A 3U39A 3CGWA 4RPKA 4KCGA 3BC1A 4NR0A 2XDYA 4IUDS 1PR2A 2MSCB 2VHQA 2CYBA 4YUYA 1ZWKA 1PT9A 4QPCA 1ZW6A 3AUAA 5IJ0B 1F60A 5BXYA 4LW8A 4EB0A 3EK2A 5FBLB 3DDOA 1UPCA 1E4VA 4U2EA 5J2AA 3RRNA 1U3FA 4WAUA 1F8UA 3K8YA 1AXRA 1GL6A 3ETHA 4G0YA 2ZRMA 5IHPA 1V25A 2OBNA 5ALTA 3DBHA 2EC5A 1WCV1 1MC1A 5KIAA 4CKXA 4K6GA 3K15A 4Y9SA 4EG8A 2WF6A 3ZE2B 4DMRA 2W55A 2OCYC 3MTGA 5T4BA 1DTSA 9ICNA 1WBJB 1CI4A 1O1YA 2JK0A 1COWD 3S2YA 2XB4A 1DCMA 1N8KA 4AUKA 4Z7OB 3SKYA 4MTLA 4K9LA 4CEIA 3LQFA 5HQTA 3DAFA 5T3UA 1DKUA 3C3KA 3JYPA 1BPBA 4X54A 3ZYZA 1UK9A 4HDNA 1W44A 3T7IA 1I4OA 2GZ1A 4RD0A 4A73A 3WLQA 4HDAA 3OZCA 1JAHA 4F3KA 4LX0A 2J6TA 1E6EA 2ZSDA 1WSWA 1BXKA 1NLYA 2QV0A 3B1WA 3GUUA 4YO8A 3ISVA 1TAUA 3I9MA 5THQA 3PRYA 3OQIB 4RZSA 5AKHA 2R8ZA 3GX1A 4ZI2A 3ANXA 5LZ5A 2AI1A 5EKTA 2E48A 2HK7A 3RLFA 3EN0A 1UDCA 5JHHB 2BL4A 2DBVO 2N1MA 2V7EA 2KS6A 4MTCA 1WHSA 4UOQA 4QLBA 5D3KA 3VVBA 3QLJA 5K0ZA 3CX4A 2JRLA 2B83A 4AY4A 4JFAA 3WNDA 1YA4A 4R2LA 4K81B 4J9UE 1XZHA 1M0EA 2Q0ZX 5KFXA 3U9LA 1XA4A 1ZY2A 4OHFA 5JCPA 3TBFA 2OCKA 5KHLB 4HX2A 4G5XA 3VR4A 4BQQA 1SRQA 4F1JA 4J0KA 5G40A 3VHXB 1NDUA 1UP4A 5ESDA 4QWMA 2JAXA 3RYCB 2BCQA 3SSOA 4DDVA 3PDHA 4EK9A 4KQ9A 4UUAA 3HRDD 4E2FA 3ED5A 1TFRA 4R2MA 4ARZA 3M6KA 1R4AA 4XKJA 4V1CA 4S3MA 1W8IA 3UJDA 1SHJA 1T2CA 1RWKA 3OQBA 4PXSA 1BH6A 1P31A 1EVZA 1YXMA 4K05A 3FGNA 3LK7A 4B6SA 4EG0A 5IKOA 2YIDA 4L57A 3MT7A 4AICA 4ZGGA 1DTEA 2C0CA 1G18A 4NLKA 1FNNA 1HM5A 4EB6B 4MP3A 1L9KA 4GYWA 2CXPA 3FTCA 3DZIA 5HJEA 4H15A 4B3HA 5C46F 3DB1A 1WSAA 3W2EA 4BAZA 3ZWBA 2GBFA 1H0HA 1NKVA 4NG4A 4ZCIA 4HDKA 4WCFC 4UU7A 1R0YA 1LSUA 4C4XA 1XXHA 1H1TA 1BJTA 421PA 5HDBB 3WGNA 2A9JA 3VAYA 1D8BA 4JJ7A 1SCKA 4JOBA 1T1JA 1Q6YA 1XKQA 1IBMB 4F71A 1JHVA 5F78A 2X9NA 1EWRA 4TMYA 3TLJA 1XQXA 3KVVA 5TMBA 2HHJA 1YMVA 4EY4A 2VHWA 1U31A 2F9LA 2NOAA 3D7SA 2R65A 5DBAA 1YIOA 2FPGA 3LDUA 3NAZA 4W5QA 3GW8A 4YGYA 4E12A 3NVVA 2HDHA 2NTEA 4A0RA 1KY4A 1YVRA 1PK9A 4GM4A 3UXOA 3AIKA 2BRUA 5FWYB 5B1HA 4HNHA 3M6AA 5LQMA 4CM4B 4BASA 4ECXA 2QQGA 2WTNA 1UM9A 1T2VA 4OPMA 3W5UA 3VRHA 5C8XA 2OO3A 3V8PA 3OX3A 4KQXA 1I7NA 1EFPB 3ZYCA 4OUDB 5LP6F 2CLEB 5ALDA 2BKVA 1FIQA 4UB1A 2I3ZA 3EXEB 2QRJA 4AECA 4HN2A 1T24A 4JFRA 4WJZA 2O2GA 2HJVA 2NU6A 2ATXA 1Y1TA 4EW3A 2ACWA 5A3SA 5EOVA 1I3LA 5KC8A 1M76A 5K2OA 3L40A 1MQ3A 1N0WA 5LR6A 1QMPA 1L4HA 1HYGA 1BDIA 3VR6H 1DFHA 2DT8A 3QKSA 2GN2A 1XZPA 4RCVA 1XAGA 3EFBA 3AHCA 2YWDA 3BDVA 5K3FA 2W22A 2WU0A 5C31A 2A1TS 3RB4A 3SYKA 2BFDB 1YS7A 4NS4A 1RCTE 3EG5A 3C5CA 2I2DA 3I42A 3G5MA 1U6JA 2JG3A 4R9SA 1CR2A 4PLPA 2MYTA 3S27A 4LRWA 1Z6AA 1E9FA 2OMKA 4ACBA 1ZQYA 3PXEA 5M2QA 4F38A 1NXQA 4ZRMA 5BNFA 3L7MA 2OV3A 1QORA 1KMHB 5CLFA 1QSLA 2UVDA 1VLBA 4FNOA 5GVSA 4WESA 1JQEA 4BMXA 3L4BC 3UBMA 1GSHA 4YHHB 1HFEL 2C5FA 5L7WA 5M5BA 2LVBA 4O3RA 2A0FA 5LYJF 1CB0A 1SA0A 2VXBA 3OMLA 4LYJA 5G4KA 1HDXA 2OGTA 3SQXA 2Q5JA 3NHWA 4J4BA 3BMXA 1NBAA 5C34B 4KPGA 4NOMA 2O7NA 3EUB2 2XMRA 4RQ2A 1W87A 5L6LB 3REOA 4WFQA 4M9HA 1V3TA 2W4QA 1V16B 3D3WA 1EHCA 3AIIA 3KQVA 3CRXA 4FR0A 2SECE 3O21A 3RRXA 1AO0A 2AW3A 4MHSA 4PX9A 1WSDA 1E92A 4CVNA 3K53A 2EL7A 1S0MA 2ZE6A 4PZZA 3W6PA 4K9KA 5I8PA 3RD5A 3PFCA 3O8CA 3KOYA 2QT1A 2AFHB 3AUYA 1YJ8A 2Z2IA 3HFJA 1UC4B 3BUSA 5E4JA 1K08A 1DE0A 4XE5A 1B7GO 3LPNA 3E0XA 3OIUA 5LQUA 1I7LA 3DL2A 2JARA 4F5WA 3GJTA 4G0WA 2QTMA 1QIGA 2XUQA 4YB8A 2WSBA 1NI3A 4ZCPA 3RIGA 4RPGA 3INYA 1MX9A 3A2MA 1E2NA 1H2ZA 3HCRA 5E6UB 2C4TA 4MCHA 4PLHA 1NUAA 3PEFA 1XPJA 1W0JA 3ZE8A 4TROA 3CNNA 1ZK4A 3ANTA 3KJIA 1TTTA 3KR2A 4MWEA 4QU0A 4R4JA 1ZICA 4LY6A 3RUIA 1F2DA 2RHBA 3SYRA 3QVXA 4K7JA 1V6CA 5AVOA 3GAZA 1NZPA 3VYSB 1E6KA 5TE9A 1E99A 4FHGA 3RVLA 1U8UA 2Q50A 1KN5A 4CPDA 3TKAA 3CZQA 4JQYA 1QR2A 2OBMA 2JLBA 1PTJC 2L18A 2UXBB 5JW6A 1PUXA 3EW9A 2PKQO 2NUTA 1F38A 1WCIB 3VI4B 1HYQA 5KFJA 2Y67A 3EY4A 4AQ7A 5FTLA 2Q5LA 4DQPA 3JWPA 4M1TA 2BR3A 1OZAA 4UVEA 3JPYA 4CFSA 3D0OA 1RJEA 5BORA 4O4IF 4RD4A 3BFXA 4IVQA 4LJ8A 1I2MA 3QNWA 2FWJA 3UAOA 4W63A 4FYHA 4UFOA 3VZDA 4G24A 1E8MA 4IMIB 1Q2UA 3FNBA 3PMLA 1FCJA 4LV6A 2AGQA 1PVOA 1H8HA 3TZEA 1PWEA 1Z6ZA 5JH7B 4LYEA 3IELA 4FU0A 3UJ6A 4CLHA 1ZAYA 8ICWA 3CR8A 3TK1A 3W1VA 4JB2A 2JEOA 5J43A 1HNNA 4B80A 5DIZA 3Q3VA 3PUHA 2OZLA 5DHRA 3GEEA 4LRQA 5K03A 2IZ1A 2R6AA 3VNUA 3OZGA 2JGDB 5AKYA 1TGYA 1PG0A 4QU5A 4BGVA 3WGZA 2RCYA 3MBIA 2JF0A 1CJMA 4AWBA 5TJ9A 2G5GX 4M1KA 2N47A 3KBOA 4U2FA 1PT5A 3N6VA 2FZEA 2GTIA 4BN4A 2EKLA 2ODAA 2H0RA 2FG5A 2CRXA 2PL3A 4Y9RA 3OT1A 1X9XA 4O0IA 2HN9A 2Q1XA 3WMXA 2Y93A 1H65A 2PX3A 4AP9A 3UJBA 3ZXYA 5DV9A 3UHPA 2Z83A 2EBFX 2GNAA 4R9RA 2DKFA 1MFZA 1LRLA 3VGJA 1F5NA 4JUAA 3FGOA 1C3LA 4DUYB 3DE7X 4FSXA 4YAOA 3GEIA 1E1CA 1EBFA 4QW8A 1HZZC 1ZOPA 3AZQA 4LF5B 2ZZMA 1T43A 1ZQZA 2EZ9A 4LJXA 3JWEA 5KFHA 1H6AA 2VRNA 3RG2A 2OCDA 3H75A 2VTVA 3VH3A 1E18A 1UKBA 3VFDA 3DOUA 3TQSA 2FUG1 2H57A 3OWXA 1V4NA 4D81A 1Y63A 1G8HA 4A82A 1SR8A 4EHFA 2E9SA 4YJ3A 1TZJA 1SU7A 5GY7A 2FJ6A 3TOZA 2X4DA 1CF2O 4IIEA 2WTUA 3G6VA 4QFCA 3HVRA 2AR9A 2GI4A 3NASA 3VBEA 3D6AA 4I4TB 5F73A 5IXJA 4UEJA 3V4OA 1GNTA 4FI3C 2NVWA 3FG9A 4EVSA 4KN5A 3F2BA 2QRVB 3AU6A 3CLTD 3H6KA 3A25A 4QEDA 4EI2A 2PFGA 3IPLA 1FX0B 1RHKA 3ET4A 5AK6A 1YR9A 4WOJA 3P96A 4W8HA 4A6PA 4F11A 5KYYB 3THXA 4B75A 1D0VA 1BPXA 1MUUA 1GLNA 5JU6A 2CHFA 1J97A 5GTIU 3ZZMA 3HSSA 1EU1A 1KC1A 1QZTA 2A4KA 5JYDA 1ZJYA 4YMLA 1UAAA 1QYRA 3O8RA 5JC8A 1XK6A 4UULA 2BKLA 3O47A 1L7MA 3V6JA 1MENA 2CPRA 3I0NA 2YB4A 5FO1A 1GVHA 5KTRA 3V33A 4HMPA 4OXRA 3GRZA 1U5AA 2J31A 3IHLA 5DM60 4ND1A 5J5CA 3OA2A 4JBNA 1UL1X 2IDZA 4MYSA 3EH2A 1G63A 3T7RA 1VC2A 4QHSA 3BBPA 4H4DA 2GPWA 5FT9A 4AMGA 3LP6A 3M34A 4FDAA 2I6QA 2IYYA 3EB9A 1QP8A 3MHPA 5AUOB 3V4SA 3TRJA 4OQ4A 1TK5A 5DRYA 2NPOA 3ZQKA 1QIFA 5KWEA 1ZQXA 4TL9A 1ETHA 1G5QA 3RO7A 3ZJUA 3MGAA 5JG7A 3FCAA 2FH5B 2X77A 1Q46A 2E1EA 2QGNA 1KBUA 3N7SC 4NSNA 3JQDA 1P9RA 4O2AB 3H4IA 1A0PA 2CCKA 2BKUA 3E2IA 3D9QX 2XCRB 2J6BA 2XCTB 3RJHA 1CR1A 4X7RA 1ECFA 3T3GA 2C9YA 4YRIA 5KYUB 2P79A 1RHUA 5DM1A 1FFHA 2Q2VA 1USUA 2C94A 1EUDB 5C52B 1LXCA 1YZYA 3WIBA 5G5HA 5DHPA 3FNGA 2R0QC 3CS3A 2GCOB 4D3YA 1KF0A 3GRKA 5F1OA 1VI6A 4R1LA 1MB9A 3U4HA 1WU7A 4MKZA 1HKHA 2BBWA 1KNQA 3RTVA 1W25A 2GFHA 4HNTA 2ET6A 3RK1A 4QFDA 1MOSA 2HRDA 2P77A 3TNYA 2EJTA 1XTQA 3AZOA 4RENA 3UAYA 1TLLA 3T1HB 4I2IA 1JXLA 1Y6GA 4LBVA 2XICA 2JRCA 4Q3OA 2JH3A 4TQ9A 2PQ2A 4LMAA 4RNNA 1Y5IA 4MFAA 5BUZA 2IHMA 4CCAA 1C0IA 3B3FA 5BQPA 3C5GA 4RT2A 1IBSA 3U6KA 4PCLA 1NR5A 2YJ6A 3UK0A 1T6BY 4DQSA 4I1RA 1JNXX 4JHLA 1KBOA 3D0KA 1Q0TA 1MKYA 2HPZA 3BIWA 1KKUA 4GYYA 3KPJA 5KSYA 2Q4EA 2Y6VA 1WB6A 1ZQKA 3GV7B 3LWDA 5FRDA 4GMXA 1AXGA 3NM5A 3NOQA 5AK4A 3LUCA 3HXQA 9ICOA 4J0IA 5ANRB 4P0QB 1E5TA 1NRJB 3R3XA 5IDYA 4QOIA 3NHMA 4HPJB 3LU1A 3GZ4A 2H29A 1N3YA 1RM6C 2BN4A 2EX0A 3BIXA 4MCJA 5C81A 4MW7A 1JTEA 2XMQA 4MDEA 1PR6A 1O4WA 1LDMA 1KI6B 2QN9A 3U3OA 4BB0A 3PDCA 4NMXB 1CEEA 3FNFA 4BN5A 4DWWA 1RYFA 2ZLBA 3BXOA 3OX1A 4JELA 4PZPA 5J4KA 4JKIA 1JU4A 2JCYA 4LCEA 3F9RA 3LBIA 2K7FA 2X41A 4TTJA 4CGZA 1BX0A 3JRNA 3I58A 4PAGA 2RKBA 4GWLA 4PO3X 3GYGA 2XITA 4MV0A 4AF7A 3HKCA 4OBBA 2HB6A 1HSZA 2JKZA 4FIDA 3Q8WA 2N9UA 1FXWF 5LD2B 1W581 4O4JF 3O95A 1Q3VA 1PAUA 1GJRA 2P91A 1F17A 2R79A 1LK7A 1TW2A 1AJEA 3DBRB 5L3ZA 5CA0B 1EWVA 5KMGB 1ZH8A 4ZU1X 1KIFA 1UEIA 2PCLA 4JYCA 1VRVA 1KC3A 4FB5A 1D4AA 4QUGA 3LY9A 5B53A 4DR5B 4MI3A 1O6CA 4D9MA 2WKRA 5TPWA 2I6SA 4ZI7F 4RQ0A 4CQNA 4L5JA 1GKYA 4UCXA 3OZUA 2ZGVA 4QEKA 3DAHA 3HY6A 2I7CA 1HA3A 5HRAA 4RIEA 2G06A 4C5CA 2Q07A 5I4CA 4YD2A 1AXEA 3RSSA 2PNJA 3ENVA 3I2FA 2QB0A 1XEWX 3TCXB 4KIFA 1IULA 1IAQA 2RGWA 4XIFA 4XPIB 5F76A 4RGVA 5HBRA 4MNTA 4TVOA 2RH9B 4MX8A 4WWHA 2P4SA 3PC2A 5FQNA 3ZD9A 4QM6A 2FRDA 1CYEA 3OF2A 5CRIA 1P5FA 3S40A 2JI4A 4GKVA 4MZXA 2R48A 3EHDA 1Y7PA 4U6NA 4KE9A 5LBTA 3HYTA 1PFGA 4OK3A 3U7QA 3AEKB 3E2EA 3EQ6A 1PG5A 2PRIA 3AHFA 2W5UA 4HUQA 3UAZA 3SAJA 4HYQA 4ILEA 2I4RA 4ALJA 4LK2A 1Y9AA 3P9CA 3MR3A 1R0CA 2VP6A 4LPKA 4ZGBA 1LV8A 5F64A 3RUPA 1L1QA 4QUDA 5EE5B 5FWAA 3V5NA 4KQGA 5KINB 1T0JB 4ZHQB 1L2TA 3PGLA 3O4JA 1U8TA 2FYTA 1S10A 4G1FA 4N3AA 1FTQA 1ZQSA 1Y9JA 5BURA 1OIXA 1YT3A 4EECA 3DXFA 1GNVA 1EA7A 4FOPA 4FDVA 3SAHA 1Y48E 1QVZA 3TGLA 1R6XA 4HAXA 2BM1A 4LQLA 1QH8B 4OQMA 1W5SA 4I29A 4NMWA 5EMHA 3OLZA 2ZCVA 1J0BA 1YQXA 4D92A 5KHOC 2GXAA 2ZREA 5BN5A 4ZVTA 4AS2A 1L5SA 3ZV4A 3UJ9A 1FFUA 4N6GA 4IQGA 3R6TA 4KC0A 5LIRA 1T6NA 1B41A 4MJ3A 1ENOA 5AI9A 5ADHA 1E9AA 1RAHA 2HTFA 4NZMA 3DMFA 3EIWA 2COUA 1LC3A 3WYFA 2X9QA 1ML4A 3IOYA 1OXTA 3LHFA 1L4NA 2QUZA 2RONA 2ECFA 1Z0SA 2QD3A 1PJCA 4KKVA 2JAUA 3CT4A 3FTPA 4DCOA 1XO1A 4RPCA 2PL9A 3QKRB 5B7NA 3V48A 4ZVQA 5JE8A 1PK3A 2B69A 1D2CA 5CLGA 2Q99A 4QU9A 5DQHA 1CY4A 2JIDA 3RH0A 1U9ZA 1MLDA 1ZA1A 4DXDA 5CM8B 4F86A 2XB9A 2P0AA 3N4MB 1PVRA 1ELOA 2WG2A 4EJMA 1DPGA 4LDAA 4CQMD 4EYKA 1KFJB 4OHCA 4ZDKA 4NFHA 3CNLA 3WQBA 3VC1A 1DKRA 3GP8A 3I37X 2KNJA 3RAJA 3IAUA 3MLEA 3M89A 5BQFA 3CR3C 4GRAA 3T7KA 1KPHA 1WSBA 5HUHA 3P9PA 3TAQA 7REQB 1ZCAA 4JP1A 2QRPA 2BFAA 2QKQA 4TWJA 2GAOA 3HL4A 4C05A 3FHCB 3IQHX 1NY5A 3SC2A 3CNOA 4N48A 5JJ5A 1GR1A 2FK7A 3DHNA 4NARA 3AP2A 4HADA 3L02A 4V0QA 2KICA 3TUIC 1HLFA 4PL2A 4ECRA 5DYWA 4BJ6A 4X8MA 2XXAA 2V6JA 4GI3A 4EMTA 4RD3A 3ZK7A 1I0IA 4LX8A 4YCMA 3ON5A 5JAZA 1JR6A 3NHJA 3RK4A 2GASA 4Y2GA 5DDIP 3P9IA 1JT9A 2BKAA 5DKWA 3MRTA 3LWBA 2OORA 4B32A 5KQRA 3WFZA 3CNHA 4IR1A 4DQQA 3V1UA 2IQ5A 4DV2B 3I28A 1TB4A 1G20B 1TQ6A 3Q3CA 4RJ2A 1QPBA 2UYQA 3B1ZA 1G41A 1SQSA 4NJ8A 4Q93A 1XO0A 2EFGA 4LXQA 3V7JA 3TIIA 5AI0A 3OCUA 2KYRA 2NO6A 3RASA 1U47A 4CZ2A 3G6YA 1K7CA 4FK8A 3KVOA 3DULA 1G98A 2BZ1A 3C5HA 2IUTA 1A9PA 1R6DA 2Z5GA 4YCBA 4L0CA 2ZATA 4N82A 1PR9A 2XTAA 4FZ5A 4PQGA 2YDYA 4IQ8A 5D1HA 3SV3A 3GP3A 4EEKA 1HUOA 4DL2A 3VX4A 5J2EA 3MGCA 1T9HA 4HI0E 4Y6QA 3H83A 4MHOA 2PV7A 4PH5A 4RVUA 5KFGA 4PX2A 3RNOA 3H5LA 4QUBA 1OH7A 5IAOA 1Q0SA 2EFYA 2PJDA 2EXXA 5I7RA 5KFRA 3AVOA 4TV9F 1WG8A 4ED2A 4MO9A 1KZGB 1QZZA 1OHHA 4NAUA 4ZOBA 5JASA 2YBDA 3CM0A 1SHKA 4DDKA 1HQDA 4HNVA 4RHYA 2QN6A 1MRNA 2I6FA 5T6MA 4YRDA 4L95C 3AB3A 2BLNA 4ZYXA 5ALWA 1XMQB 4PTZA 4H60A 1U7DA 3TRDA 5FWXB 3I12A 4MPJA 4UAWA 4Q3DA 4OGFA 1V7CA 3PK0A 2R8PA 3IAAA 3DC7A 2R751 3HCEA 1F9EA 5ALXA 3IILA 3VOTA 4TWZA 4MEJA 1A77A 2WBLC 3GT7A 2G5HB 2W2NA 2WJ6A 3VYUB 2ODBA 8ICKA 1N7GA 1YMUA 4FKZA 1YDHA 3SC6A 4L4SA 1MNQA 3B13B 3ZVKA 1W73A 1L1FA 3LZ6A 2P3LA 1CUWA 3E3AA 5DBFA 5IAGA 1USKA 2JFZA 4HQFA 4DQXA 1N2JA 3E2PA 1A4RA 2WFLB 3ONVA 3T06B 2LCQA 5B2FA 5JDIA 3E9CA 2MRLA 5BSRA 4JUCA 3MCUA 4BPRA 4LQ4A 1EUZA 5DHQA 2CNDA 1FX1A 4XIJA 1STOA 2XX3A 2IYWA 3W34A 1XQ1A 4JK3A 4TV8A 4KV9A 3DZGA 2VA3A 1FNCA 4P81A 1A82A 2NX2A 1SKWA 3JQ8A 1FQWA 1CUCA 4P08A 1EFKA 4HQKA 3U3RA 3PF9A 4QXRA 2QN1A 2FEAA 2WOJA 2WF8A 4BVJA 1NBMA 4GXNA 8ICGA 3SC3A 2IP4A 4U7JA 4OL0A 3OE1A 1ORVA 3GI1A 3QNMA 4RKRA 4RTSA 3P0JA 4F4KA 5FLKA 1NP3A 5BW5A 3EQ9A 5J4VA 1WZ2A 5JRDS 4DHWA 4L8FA 3EZYA 2XNSA 4KJXA 1VP3A 4PLWA 1Z18A 2NPIA 5SZKB 3AL3A 5KYWA 3PKIA 4H17A 4RTMA 2XB6A 1F4LA 2WSSA 1PSZA 1J8FA 1N0VC 2AI3A 2F4NA 2GDZA 3N7AA 2VDWA 4RMIA 3PYXA 4RETA 5DI3A 3J81j 1R0RE 2IEIA 1JPUA 2R6DA 3R23A 4RVNA 1EFLA 4L5YA 3PUZA 1L3SA 4JA0A 3MD9A 4RLQA 2YJTD 4OQQA 5JMPA 3TEFA 1QP7A 2OVFA 3ZI4A 3E1KA 2VQ6A 4ISCA 1VGQA 3OM0A 4UUPA 3FLBA 1UBHS 1KMCA 4J0EA 3KOZA 2OO5A 3UQZA 1KEZA 2RHCA 5CTAA 5A6SA 2Z2YA 1GTL1 3UWMA 5K3AA 1JHYA 4L4YA 2O8CB 5BSWA 3WKCA 1BXRA 3V00A 3PENA 4AJIA 3FFAA 4MAFA 3P32A 2A3VA 5H59A 4DR2B 1TTQB 3GA7A 2ID4A 5AKIA 1G6Q1 3F5SA 1I24A 1XTPA 4CYMA 3W2TA 5DDMA 2BSQA 4W6QA 1L8XA 1ZL2A 3H9JA 2GBPA 4J4HA 4JCOA 4M0FA 2CLCX 4JBHA 5KDDA 3VMMA 1UA0A 4HSGA 3MM4A 1LDEA 2OB2A 2XMBA 1AZLA 4ZTUB 1RI2A 3A1SA 4OHBA 4HG2A 3KVYA 4BX8A 4URUR 1PJ3A 2YFYA 1Q1ZA 3OI7A 4FNMA 4DVJA 4YT5A 1JPJA 4WBXC 3ELBA 1GCAA 2R8HA 1JIUA 3IJPA 1K27A 3ZZNA 4NFLA 2ISOA 2QX9A 4N6NA 1RWPA 5L3QA 1CRZA 4F8YA 3WL5A 4HMQA 3PF8A 4B2YA 3JPNA 2L2QA 5TDHA 4L8WB 4UAGA 2REXB 2XUPA 5I7UA 4A92A 1I4LD 1DBWA 1A71A 4EYIB 1T3SA 5CB8A 2HO4A 2BZGA 2B5VA 1YCDA 4M8NE 2NYVA 1JR3D 1E64A 5HFJA 4IGAA 5IK2A 2HRZA 2A4MA 3BXEA 5FWNA 3L0PA 4WRRA 1TK8A 1E7QA 5LNK1 5DTIA 2UYOA 2MR6A 4C07A 2ZCJA 1UAGA 1DG9A 1CUAA 4TZTA 3GFGA 3BWDD 5BRJA 4R8RA 4KHZA 3A4NA 4GOJA 2OQIA 2V9WA 2V1XA 1KH2A 1NTRA 5CFLA 4A8JB 1W4LA 4U6SA 2PUWA 1J39A 3A6ZA 3R41A 4CMKA 4A0HA 4DXHA 3WIVA 4FBUA 3IPRA 4DF4A 2IA6A 5J47A 3CH6A 5HYVA 1K88A 4N03A 1EB9A 2Z5VA 3HU3A 5IILA 5BOSA 3GJ7A 4IQUA 1U49A 2RDIA 5LQAA 2G9QA 2H5XA 4Y3UA 1WXHA 4HLDA 1S8OA 3GNLA 3IRUA 3KOXA 5T6BA 1ZJNA 4KIGA 4UAUA 5D3MA 1GL7A 3KYIB 4H9GA 2IMWP 5EQTA 5ALUA 1A27A 4F6RB 1DARA 1C29B 1MHTA 1BHQ1 3A37A 1OUQA 3Q5EA 1CKEA 2I1WA 2WY2D 4JGIA 3CVVA 2ZUCA 1PJZA 1EFAA 5EIFA 2HBLA 3IIIA 5EHNA 1K98A 1H42A 3ZNQA 1C7YA 4QYTA 1G21B 1I3CA 5KWVA 5IBQA 3Q9NA 1QYDA 2C3YA 1C9MA 1TZMA 1T5HX 3Q2IA 3H2IA 3K20A 1RAEA 4NEGA 4RU9A 1PK7A 2FSFA 2W11A 2TYSB 1QGAA 4RPZA 4DA9A 4CMIA 2VLBA 3GUHA 3OE5A 1N5LA 3CLSD 3OZDA 3Q10A 2Q6IA 3L7YA 2X4LA 2AMFA 3LTNC 2WKQA 2E0IA 3L1VA 2GEFA 3R6WA 4XR4A 1FFVA 2VHCA 3DF9A 1O6FA 3ZTTA 3EGIA 3T1NA 3V34A 5JD6A 3FDZA 4CR8A 4JV1A 5EKSA 3DLCA 4Z4QA 4BCCA 4ND2A 1E2HA 1HL3A 3I2KA 4ETMA 2XY7A 3F5EA 3GGSA 5DWQA 5IG2A 1MORA 2KJQA 4YCAA 1ZJ5A 3BHIA 1K89A 5J2FA 1WUDA 5IXSA 2JVJA 5FBKA 1UADA 1G2OA 1PEAA 4ECSA 3SZMA 2CUKA 1KO4A 4BLRA 3E5HA 4P80A 3BXPA 4RORA 2A5JA 1PFVA 2D1YA 4GOLD 2CF6A 3WIDA 5E79U 5D2CA 5HOQA 3R0XA 5CFZA 2I4MA 4NY8A 5IZ4A 1XQYA 3AGQA 3ICQB 2XZPA 4KUGA 4BMPB 4HAZA 3RRJA 4HTFB 1PVPA 1T8TA 2JI7A 3D6MA 5ITVA 5IC5A 4K6FA 1CBUA 4MW6A 4RIHA 4ENVA 3HP7A 2PR2A 5ALVA 1JB1A 2BZFA 2QM3A 5C1PA 3GWZA 2LNDA 1ABEA 2P78A 4YRNA 1C9EA 4ZOLF 5FL7A 4D5EA 3HNOA 1E1LA 5K0NA 1VKZA 4YP9A 4FFLA 2Z3WA 1F6WA 1KAGA 2HZ7A 5EXPA 4Q7JB 2KHQA 3AERB 3KLBA 1ZJWA 5GMOA 3AJEA 4NOKA 2EIHA 3NWJA 1TT5B 2J6HA 4ALKA 2GBLA 3N76A 2R8JA 5K6TA 3MDCA 3WLJA 3P2EA 3IVCA 3X44A 3IG5A 2CLHB 1WR8A 3PS9A 1YULA 3WLFA 1RD4A 3X1WA 3L5OA 4D1YA 5CX1B 2PUVA 2LCFA 4CLOA 3UJ3X 3TR6A 1ZVQA 3B0YA 4HS4A 1M66A 4BAGA 4C9BA 5AVKA