2WF5A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and trifluoromagnesate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf5A01
1L7PA 3AR4A 5AK4A 2BDEA 2I33A 4HGNA 2MU2A 2OA0A 2ZXEA 1Y8AA 4BEWA 3WGVA 2IYEA 4BKMA 3EF1A 3DNPA 1ZRMA 4IFTA 2B8EA 2EATA 4H1WA 1ZD3A 4ZEWA 3QU5A 4O8CA 4CNQA 2WFAA 2FPSA 4BEVA 2BY4A 5ALOA 3WK4A 2YMMA 1U02A 4AS3A 4Y2PA 4EX6A 3L8HA 3QXGA 2GMWA 3ET5A 4JDPA 2HX1A 4NV0A 1O03A 1N9KA 4NFLA 2ZBGA 3AR9A 5ALYA 3ZVMA 3ZTWA 2FUCA 5AKHA 4F72A 3NALA 3AR2A 5ALPA 3N07A 2YBDA 5AKLA 3ZTYA 2WHEA 2NO4A 1NF2A 3I76A 3QGMA 3A1DA 4Y2VA 3ZU6A 1RKVA 5AW1A 1KYTA 3FZQA 1WZCA 1L7NA 3FPBA 3CZ4A 3NUQA 4UMFA 3IB6A 1CQZA 5ALFA 2R8EA 3NAMA 1Z4LA 5IT0A 1RKQA 3BA6A 5AW8A 2PKEA 2ZBDA 4CF5A 3KC2A 5AW3A 3ZWDA 4CF4A 1RDFA 2C88A 4XPZA 2B0CA 4AP9A 5ALHA 1RC8A 2NYVA 5AKJA 1TJ3A 4BYGA 2YMLA 1Z88A 2PR7A 3HYCA 1RMTA 5ALTA 3L8GA 4Y2SA 2GHTA 1ZJJA 3ZW7A 2W43A 2RARA 5AI9A 5ALJA 1FEZA 2GFHA 1QQ7A 5AHXA 1QQ6A 3PDWA 4FE3A 2RB5A 2FPWA 5AI0A 3WK6A 5AVRA 1K1EA 3OCZA 4HGQA 4EZEA 5ALMA 3ZX5A 3ZVNA 1Z4OA 5AVTA 1YJ5A 3QYPA 2HI0A 4UMEA 5ALNA 2X4DA 5A3QA 3B8EA 3EF0A 1PW5A 2YFYA 3L0YA 4MWOA 1Z4PX 2IOFK 3IJ5A 4AS2A 4YCMA 4HYTA 4YIKA 2GO7A 5AIAA 2ZG6A 1ZD4A 2G0AA 3FM9A 2NO5A 1Z5UA 2WM8A 4G63A 5A3RA 2P9JA 4UU1A 1Q91A 4C4TA 1SWWA 2YY6A 3CNHA 5AKZA 3FPSA 3SKYA 1QQ5A 3R9KA 2YJ5A 5ALGA 5AKYA 1NNLA 2G06A 3OPXA 1RPZA 2G80A 2Q5EA 2FDRA 2IA5A 4FYPA 1ZS9A 3KOOA 5A3SA 1RQNA 3WK7A 4UAUA 4C4RA 3W5AA 3FGOA 4BNDB 2B1QA 5AI8A 4OCZA 2I34A 1EK1A 1YS9A 4UW9A 3J7TA 3A1CA 5AM0A 2QYHA 2FPXA 3B9BA 2W11A 3E8MA 3W5CA 2I55A 5AW5A 2HO4A 1Z4QA 1O08A 3U7EB 5AM5A 3WKCA 5AW6A 3NRJA 5AI6A 5AVQA 3AR3A 1JUDA 3QU4A 3UMGA 3QU9A 3ZUPA 2HHLA 1ZOLA 4PNHA 1VJ5A 4HGOA 1J97A 3DAOA 1RMQA 2OM6A 3WKBA 2B30A 4E88A 3ZWKA 3QLEA 3UMBA 3L8FA 5ALWA 4EENA 2RBKA 4QQFA 1XPJA 4L6AA 3AR6A 5AKXA 4OHFA 5AW7A 3MPOA 1T5SA 4Y2QA 2I7DA 2WF5A 3SHQA 4BX2A 2MU1A 2YN4A 5ALQA 2I54A 5AKIA 3K1ZA 3N1UA 3EPRA 1Q92A 3BWVA 3WKAA 4KNWA 1IWOA 2ODAA 4YIHA 5AM2A 4IG4A 2JAUA 4ZEXA 3RF6A 4GIBA 1LVHA 2P27A 2WF8A 3DDHA 2PQ0A 3IRUA 2C8KA 5T41A 4I9GA 1RMYA 3DV9A 5E0OA 3UM9A 3U26A 2VKQA 5AKKA 2B82A 4HGRA 2Q4RA 4NWIA 1Z4NA 4L57A 4UU0A 1TJ5A 5AKGA 2D2VA 3U13A 4F71A 1XVIA 3E58A 3NANA 5AKEA 2JAOA 3L0BA 4CE6A 2Q4TA 4NABA 1RLTA 2R8XA 1X42A 5AI4A 4DFDA 1U2TA 3L1VA 2YJ3A 2FPUA 1YMQA 1Z4MA 2HEGA 2YJ6A 1Z4IA 2B8JA 2FEAA 2O9JA 1L7OA 3R09A 1TJ4A 4CF3A 1T9ZA 5AICA 3M9LA 1S8OA 4Y2TA 2EARA 3ED5A 4EELA 4UATA 2EAUA 1L8LA 4HAIA 5AVZA 1EK2A 1WVIA 3QUBA 4BX3A 3WK5A 2ZBEA 3KD3A 1MH9A 2WF6A 5IS2A 3QX7A 2G07A 2HDOA 3M1YA 1L6RA 2DQSA 3ONNA 3N28A 3SF0A 1XP5A 3S6JA 2O2XA 1RQLA 4OD0A 5AVUA 1WPGA 3D6JA 1Z4KA 2AMYA 2OYCA 5AESA 4QJBA 2CN1A 3MMZA 4B6JA 5AVYA 2YJ4A 4ZEVA 3OCVA 2HF7A 4Y2YA 5IT4A 3U19A 1SU4A 3QNMA 3P96A 2C4NA 2IOHA 2P11A 2HSZA 3KZXA 5AM4A 4C4SA 4YGYA 1TE2A 1N8NA 1QYIA 3I28A 3WGUA 5AK6A 5ALUA 2WF7A 3TLMA 5AW2A 1YDFA 5ALZA 3OCWA 3PCTA 2G08A 2G1AA 4XQ0A 4DCCA 4J2TA 4JB3A 2R8YA 1ZD2P 1U2SA 2AGVA 3MN1A 3WK8A 2MSNA 1TA0A 4DWOA 1NRWA 2QLTA 2IOFA 5AVVA 2P69A 2AUTA 3I1YA 5AW9A 1U7OA 3WK9A 3OCYA 2FUEA 3E84A 5FP0A 4YCNA 2HOQA 1Z4JA 5AIBA 1ZD5A 2BDUA 4YH1A 3L7YA 3ESRA 3FVVA 3EWIA 3L8EA 2GHQA 3L1UA 1SWVA 3U7FB 3SMVA 5ALKA 1RRCA 3NASA 3QUCA 5ALDA 2AH5A 2ZBFA 4UM5A 1Z5GA 5AK3A 1J8DA 1U7PA 3QUQA 4RESA 2CFSA 3KDPA 4MUMA 2CFRA 3E81A 5ALXA 5AM1A 2FI1A 2RAVA 2I6XA 5AVSA 3OCXA 2YMPA 3GYGA 2R8ZA 3OTQA 4RETA 4UASA 3SD7A 3AR8A 4UARA 2YMQA 3ZI4A 2HF2A 4Y2UA 5AW4A 3A1EA 3MC1A 5AI5A 4Y2RA 3OCUA 1RKUA 3R4CA 4J03A 5ALEA 3PGVA 1RLMA 3RFUA 4KYTA 5AW0A 5AVWA 3WKEA 2HCFA 4UM7A 3AR7A 3N8GA 4BNDA 3N5KA 3L5KA 4KNVA 4L6CA 4UMVA 4KN8A 3AR5A 4EEKA 5JJBA 4UAVA 3I6BA 2WF9A 1AQ6A 3ZVLA 4Y2XA 4DW8A 5AM3A 3QUTA 4BX0A 3WKDA 3ZX4A 3SKXA 5ALLA 3U7HB 4XOUA 3NIWA 3A3YA 2JAWA 2G09A 4KX5A 2FPRA 4YCLA 5ALVA 4G9BA 4BBJA 3ET4A 1RLOA 3F9RA 2JARA 3ESQA 5ALSA 4Y3UA 3QU7A 4HGPA 1T5TA 1WR8A 5ALIA 3SLRA 3VAYA 4GXTA 1CR6A 4OFZA 1F5SA 2JGAA 4I9FA 1YV9A 4Y2JA 5ALRA 3PGLA 3U7GA 2ZOSA 4XE5A 4FFDA 1LTQA 5AK5A 2B1RA 3L0CA 1QH9A 2OBBA 5AVXA 4NAVA 1L7MA 1VJRA 3HLTA 1VFPA 1YNSA 4UMDA 2W4MA 3W5DA 2C9MA 3B9RA 2CFTA 3UMCA 4KX3A 2C8LA 3QU2A 1ZRNA 1S2OA 3W5BA 3KBBA 4EX7A 1L8OA
chains in the Genus database with same CATH superfamily
1CUYA 4P31A 2KMLA 2VPYA 4RAQA 1Y4AE 3K8OE 5IG2A 4EZIA 2E82A 4V1CB 5BQPA 2QLLA 2Y1DA 1GTL1 3PW2A 4I8XA 4M1WA 2YMMA 3PFHA 3L8HA 1B22A 3CR8A 2OCIA 1O57A 4MOWA 2YXLA 4RAOA 2PYZA 4UZSA 4ZKEA 3LBFA 1L5NA 5COQA 3Q87B 1HLPA 4O2BB 3MAJA 3X1XA 2VJ5A 3CS3A 1NASA 4LJRA 2VHVA 3NAMA 2FWMX 3VZQA 1JEAA 1KZ4A 3AG5A 5L3SA 4L9AA 5CJJA 1XCBA 1V85A 5AKJA 4G0ZA 1ZN9A 4RCZA 3VNUA 3CTPA 1U90A 4J0EA 4EHAA 3L4PA 1KC1A 1TEVA 4BLQA 2LUOA 4BLOA 4QZFA 1NX9A 2GM4A 2CLDX 4PCVA 2HHXA 4P7GA 4HN4B 2E85A 5E8JA 4L02A 2EOAA 2PA3A 3LWBA 3L7NA 5B1IA 1KZGB 5DB8A 1KK2A 2Q0SA 2AQIA 1FJ2A 3DOUA 5BPCA 2QI9C 2IZ0A 3HKBA 3A06A 4GPBA 1PYOA 1NV9A 4UB6U 4Z9XA 3DNMA 1MC1A 1V9SA 4BNKA 3PKZA 1DCFA 2I34A 3N9IA 1IATA 3OLQA 2I4RA 3DULA 1QZUA 2VYND 3G13A 1BO6A 2W11A 1EP2B 2ZRKA 1CYDA 3FLBA 1EHIA 2ZIZA 4FT2A 4XIYA 3DCYA 3M3PA 1QYCA 1G21E 4M86A 3QU9A 1KETA 2HBZA 2G82A 1Y7LA 2QKQA 4C0JA 1OLXB 5K0EA 2FW8A 3HWRA 3NT4A 4HQFA 2ZCJA 4DADA 3UPTA 4Y2QA 1FRVA 1YB5A 2BGJA 2PPLA 1MEJA 2PXIA 1PT5A 3AEKA 4KGDA 2DFPA 3G02A 4TGLA 1CUGA 3WQBA 4R66A 3FLEA 3DDHA 3PQ7A 3WNCA 2EW1A 2Z1NA 2Q1XA 5TV2A 3FAHA 2Y6VA 4WT7A 1ZSVA 5IJ9A 4BO8A 4AG3A 1DXYA 2XH8A 2J5RA 1ZQOA 1BS9A 4RUKA 3HR4A 4BS9A 3QWFA 1RXWA 1A4UA 5EMHA 4CEJB 1W73A 2XUZA 1BJRE 1ZN2A 4J16C 4H1HA 4O3SA 2EZTA 4ZJUA 4PYNA 3LM8A 2VBCA 1Q15A 2Q50A 3IMKA 3D7NA 4RHYA 2WOOA 2DUWA 1Z4KA 4TTQA 2UYYA 1C30B 4KLFA 2Z8YA 4TL6A 4TLDA 1OPXA 3IAS1 3SZGA 4IUYA 7ICQA 3I6MA 4UPEA 2PFQA 2ECPA 4BWYA 4YJFB 5K8IA 1UCVA 2FOIA 1S8FA 3GFPA 2VDQB 2R7NA 2B8TA 5IKEA 1HKHA 2VRCA 4BL5A 2AT1A 2ID8A 3E84A 2GT1A 5EXEA 3FSJX 3L7BA 3LBNA 3EGVA 4US8A 5FUXA 4OHMA 3RS4A 3HDVA 3QFHA 1M1ZA 4RNCA 2I1QA 4MUYA 4I2CA 2Y71A 3D4PA 1KQFA 1ZLYA 1R64A 2CMGA 1FFXB 1PL8A 1WEKA 3U4HA 2FZ4A 1TZMA 5A6SB 3UGTA 1U2GC 4P81A 4E14A 1W4CA 1Z2NX 2ASVA 2XSZA 3EFHA 1DBVO 4JI4B 3EZ6A 5BRAA 5EEHA 1LEHA 4URWR 2ZAGA 1IZ9A 3SKXA 3E1SA 4BVJA 4K6FA 1OIXA 4F3OA 1Q7BA 4KX5A 3B5EA 4YCLA 5FUWA 1NR7A 3UW1A 5HRAA 3L92A 1XJWA 4AYXA 2Z3ZA 5EGSA 3I2KA 3LLVA 4XTRA 3IULA 5LKAA 4J9OA 2A2ZA 1Q6YA 4YI5A 2D5CA 4UAGA 4Q3EA 4DB4A 3KEGA 4NCIA 1L7PA 4LISA 2Z7JA 1XTQA 5HIJA 2HU7A 3OZTA 5CH5A 5DBGA 3SX2A 4NZNA 1HYEA 1B74A 2FZEA 2WIBA 3CR7A 1YCDA 1TPZA 1VA5A 2R6HA 2B35A 3QE4A 3PDHA 5KINB 3GGOA 2FW0A 2R8GA 3MQ2A 2AKAB 1OILA 3EG5A 2BCUA 5ADVA 4DIDA 5E3HA 3C7DB 1HT2E 3A28A 4EEZA 3EPGA 1IOLA 3ELBA 1Z4LA 4J16A 4ZVSA 3ELWA 2FWAA 2AN4A 3BGIA 1ZW6A 5KWSA 1QKKA 3CMMA 3NWJA 4DQRA 3WLQA 2DECA 1U98A 1WMAA 1ZOOA 1QHNA 1OYYA 3ILSA 1XWWA 2R84A 1I2AA 1X7ZB 3AEUB 4JJGA 3GIJA 3LQ4A 1GZ7A 3SYZA 4F85A 4QW8A 1E32A 3T5TA 3H5TA 1ILEA 1GTZA 5IMSA 4ENVA 2XDYA 2GSWA 4X3PA 3K70D 2WTEA 4X20B 4CM9D 4H2DA 5CH8A 1Z5PA 1DJLA 4FGUA 3NGLA 1RT9A 4L73A 2YVKA 1FJXA 3D1VA 1RBQA 5L9AA 2XXJA 3M1AA 3H04A 4FFVA 4AY3A 4LYAA 3OE5A 1HEYA 3DE3X 2AVNA 1A8UA 3UNXA 5A9SA 1YONA 3JZAA 4RQBA 5LC1A 1R0KA 2PE5A 4GEGA 1SZHA 3ETLA 2HHTA 2OESA 4K87A 4KWCA 3PTAA 1FMCA 2ORYA 3ZPXA 3RREA 1FSFA 2XNDD 2VPIA 3KP1A 4BECA 1U2GA 1E7QA 1P0MA 3SZMA 4OHRA 4IR1A 4M04A 3BK1A 2JAXA 1C3OB 3HZZA 3M5PA 3NHLA 4O2AA 2F77X 3D3WB 4FBMA 2WJYA 2JIOA 3E7XA 1YGPA 1O96A 1C7IA 1J20A 5CEHA 2WUVA 4WKNA 3Q8MA 1LFAA 3CURA 2RKOA 2YKGA 2PJDA 1QIDA 4GOOD 1JPVA 3BC1A 1JHUA 4DL6A 2GCEA 4RJKA 4K6CA 2PN1A 3C8HA 2HCRA 2YC4C 2DJ5A 3P19A 2JHFA 2C2ZA 3HU1A 4ACAA 3ED5A 4EELA 4CN8A 1ATZA 2ZRQA 5C8XA 1YQQA 1CVRA 1AN9A 1UBLS 3C6XA 4OD0A 2XMPA 2HMTA 3ONVA 2R751 5AYVA 1RI2A 2ZIEA 4DMGA 5JQGA 1YQUA 4WOCA 3BZUA 5IAGA 4HYQA 2TYSB 2HBQA 5CJPA 3LTEA 3JX9A 1SU4A 4OFWA 1BWRA 4FZ3A 1NJWA 2WTMA 4PC6A 5GV7A 1TK8A 3NWEA 4HADA 1ZFNA 1YS1X 2AZTA 2QJFA 2KK0A 2QL7A 2EQAA 3BQ7A 4P08A 4LTMA 2FSSA 4PZYA 3PNCA 4B3XA 1Q21A 2ZRDA 2L5YA 2V4QA 1ZMOA 3FPLA 5HTOA 1P7VA 1L4MA 1SPBS 2AVDA 1GEEA 3CLTC 2AXQA 1NQOA 4A23A 2P9QA 1SBCA 3SNHA 4OQXA 2XA2A 2QQ0A 2IH5A 3TEJA 1ONBA 4CZ2A 5AVSA 3JALA 1A72A 3T94A 2FLPA 1SUBA 1R2QA 4YK7A 1I0IA 2C5EA 4J03A 5JUWA 4Z4CA 1DB3A 3TARA 3LK9A 2XE8A 1JPJA 3THRA 1CQIA 1NVVR 4JJFA 1H2HA 5KFHA 1RHJA 3HKDA 1VPLA 4XB2A 4YAJA 5A3VA 2ZJ6A 3OIUA 2WT9A 2X8LA 4ND3A 5GWXA 2GFQA 1ISMA 4A03A 2QV7A 3UFXA 2M2IA 2R79A 4YRKA 2YC2C 4ZZ2A 4G1EB 5HF6A 3DUFA 5J43A 5HOQA 1VIMA 3DAHA 4CCYB 5CEJA 1UH5A 1A9XA 3DBLA 3FHJA 2P6UA 5KSPA 3A6HA 4KPEC 1ZM9A 4LJKA 3UT0A 5HF9A 2Z8YM 3B9RA 4JJAA 3WL4A 4A73A 4EX7A 3GLUA 3ROFA 2G9RA 1MVOA 5DJ5A 5DCUA 4GX5A 4DV2B 3W8DA 6AT1A 1N6HA 3BK2A 3W5JA 1N9KA 1YZNA 4JLDA 3VAZA 5K3EA 3ADCA 2C3YA 1BMDA 1YZTA 1NXXA 1KO7A 1KNQA 3TIXB 1YDHA 3P32A 5CHYA 1FNNA 4GXIA 1E7SA 1FLVA 3IMFA 3K2IA 7ICPA 2R00A 2ZULA 2BFBB 4QWMA 3LC1O 3SQNA 5F1PA 1E2UA 5LWHA 3GW8A 3KM0A 1EJBA 4PN3A 2NNWB 3EVZA 3O94A 4AP9A 1YT5A 3NHFA 4ZODA 5A5EA 4NAHA 5HR7A 2AX4A 1JQDA 1BGXT 1O9GA 1C8VB 3RJGA 1HDRA 4M7OA 2H1VA 5DTIA 1P5HA 5BY2A 4CDRA 1K1EA 1VE1A 3ZX5A 3LWLA 2E1EA 4QYTA 4M54A 5CNJA 3N0RA 4D42A 4Y1FA 2X4LA 3QTBA 5KKAA 2CLOB 1SXJD 4MYCA 4R2WA 3LTNC 4MINA 3M3DA 1ZQHA 4HNTA 2ERXA 2Q5EA 2FDRA 1XZCA 4Q02A 3FWKA 1KZ6A 4M22A 3VVCA 4S1VA 4Y6OA 1GFZA 5EPUA 2C7BA 3VR2D 4YFYA 3K1YA 2ONCA 4XKJA 2PKQP 1OH6A 2COUA 3S8YA 2ZJ3A 1E79A 1ZOLA 1K5PA 4LEIA 3ABZA 4DFJA 1PF7E 3ANXA 1BE6A 3O95A 4K6GA 5JW6A 2XRFA 2Z9BA 3IMCA 3F96A 4ECZA 1XZIA 3KOWA 4B5LA 1Z45A 3VYVA 5KQLA 2V3VA 1QP0A 2HA0A 3PCRB 5JXGA 3ZWWA 3HFRA 5LPNA 5KTKA 4IV0A 4RQ2A 4IGAA 5EFOA 2W2KB 4XX1A 4B6EA 3KFXA 2OBMA 4Q18A 2QBYA 3MFHA 3OT1B 2OFOA 7ICIA 4Q3LA 2A1TS 2P7HA 1UFVA 1ONPA 3RJIA 4A0SA 1XQ1A 2OHFA 4C4AA 3AOGA 1HDXA 1WVIA 2G4VA 3NBZC 3VZRA 4MW1A 4QZEA 3KKMA 5IDXA 2WZCA 1ZJ4A 2YRWA 2XI4A 9ICTA 3ECCA 4M9UA 4RKQA 3SEQA 3FAKA 3RGGA 1BXZA 3HBLA 1PWXA 1GHTA 1CB7A 3G8YA 4O2BA 3PXBA 3EC2A 2Z43A 1ONOA 4RF4A 1BCRB 3BHIA 4HB0A 3TLZA 1EKXA 3ZJ5A 2AN9A 4EVIA 3KEOA 3M82A 1JVBA 2YVAA 3HR7A 1FTQA 4HAZA 3AEVA 1F9EA 2OAQ1 8ICZA 1ETUA 2GVDC 2UVVA 1KBZA 2FMPA 5JFOA 1TZBA 5TQ0B 3NYIA 1UK7A 5E79U 1US8B 3PWKA 3LVBA 4B6QA 4KR6A 3NS1A 3IPCA 2OCLA 3ITNA 2QXUA 1EEHA 3F7TA 3MOGA 4TYWA 4CGZA 4JL8A 3H4MA 2WG1A 2ZIXB 2DPYA 2F2TA 1UK6A 1IEXA 2AR7A 1S5PA 2OV1A 5FTJA 3SBDA 5LNK1 4QQ8A 2A9FA 4U7GA 4ARZB 2OQVA 4G4GA 4C0LA 3GILA 4MW6A 3C23A 4HRAA 4J4BA 4TS3A 2IU6A 4QDTA 4BX0A 1PNTA 3FDSA 1BC5A 3EFBA 4IL5A 1V2HE 2R6JA 5A4JA 4FFSA 3FCXA 4ZCLA 3OIDA 2W8ZA 4E6PA 2BZSA 2C57A 2QP3A 1L4EA 4GAEA 2H5LA 5TQJA 4WOPA 3GAAA 3ZE1B 3LQYA 4ALIA 2G72A 4YJ2B 3T3FA 5ITZB 4V3BA 4RJLA 2C2EA 1N2XA 3KHHA 5DTRA 1ODJA 4C0SA 3DNPA 3QX8A 2PANA 2ZANA 3WK4A 4OGLA 2GM5A 3ZVMA 4FBTA 2LRHA 3HZOA 3I9JA 5MN5A 4U9UA 4CEJA 4V0KA 1A7AA 1EXNA 4EZ9A 1UPXA 3GLIB 1C8KA 3OZFA 5IT0A 5I6DA 3L49A 3RUEA 3BKXA 1W581 1QH1B 4PHHA 1R1DA 3Q3VA 5DNCA 1H1TA 1OLSB 3ZW7A 5CG2A 4PICA 1YC2A 5KFUA 4FFRA 1YA8A 1VKRA 2VNHA 2QLNA 5JS8A 5IFLA 4KQ6A 1ECBA 3F67A 4O3MA 4REQB 3FZEA 1Y8QA 2XOEA 5JYCA 1VSUA 2CHQA 2BR3A 1MV8A 3RUDA 3AMZA 2KVCA 3I09A 2JBAB 1W4LA 4G37A 5E2BA 2YXEA 4JENA 3F74A 3U4GA 4JXXA 1ZQAA 5ALGA 2NQ2C 2Z6QA 3MHTA 3R3HA 2R85A 5ILQA 5KMGB 2QY9A 4BLRA 1KL9A 5AH0A 3W4JA 3QHQA 4JP8A 2R9VA 1RQRA 4UFOA 4QO8A 5AM0A 4B48A 3UBMA 2PYDA 3N70A 2OORA 3HFGA 3EDMA 3H3XA 5G40A 3LUDA 2H5XA 4KQJA 1KMIY 3STTA 2OM6A 3KHRA 2QQFA 1LBQA 2RBKA 3VR6D 1K6IA 4M0KA 3ZCXA 1GP2A 5B2EA 2GA8A 2Z98A 3RYHB 1PEAA 1R16A 1IK4A 1RC1A 1GGKA 3WYAA 4YIHA 3KLNA 4GPZA 2Y1GA 1JLLA 1FDSA 2F7SA 4AY6A 1RW4A 1NNEA 3GLVA 1E7WA 1LB2B 1T9KA 5C8YF 3HXPA 2XT9A 5BURA 3GJRA 4UHDA 5DBAA 5TF0A 3V8VA 2BP7B 3TJZA 1ZR4A 2QGNA 5EJIA 5AI4A 2FFAA 3U44A 4U4AA 3P2OA 9ICWA 2O8VA 4NBKA 2CLIB 4UATA 3OECA 1U8AA 2OQIA 2QYTA 3TVTA 5DN6D 3KQHA 5F1OA 1S0OA 4ZOLB 2HJ9A 4YLYA 3C5WP 3H2YA 3BM5A 4OSOA 1J4AA 4PCAA 3UK2A 4BX9C 4Q44A 4F4DA 1FL9A 1WCIB 5JT1A 3GVIA 3H42B 4CT0A 1G5TA 4QBHA 3KKLA 2A5GA 2SICE 2PUAA 4R68A 2HF7A 2QNBA 2YDXA 4INPA 1Y37A 2WLSA 3KQPA 3DEIA 3GLGA 4LQLA 1JNXX 5IBCA 2EBFX 1L0BA 3CHYA 2WK1A 5E6SB 2R1TA 2WTBA 4O5OA 1E8NA 4K9RA 4DDTA 3L0OA 4NPCA 3T8YA 3ZDZB 4CKBA 3C3PA 3AU9A 4J8PA 4FPXA 4FOTA 4DWOA 4C9BA 3O21A 2PRYA 1YDEA 5E1BA 1W49A 3MJFA 2FGJA 1ITZA 1GRRA 3ADKA 2IK8A 4TMFA 1CEZA 1LS6A 2HMXA 4WPGA 2FRVA 2JHGA 3NUGA 2NX2A 4ZCPA 4EECA 3QOYA 2RI0A 5DG9A 1MKYA 4RF2A 2FFRA 3TW8A 1T2AA 2ZIFA 1IJEA 3FYUC 4V02A 1ZLXA 5T7BA 3O9ZA 4OBXA 2IZ6A 4O3QA 1R12A 3ZE6A 4MVWA 2ATEA 1MW9X 1FDRA 4BFSA 3ISTA 3OFND 3ONDA 1U5BB 2FF7A 5DWDA 4K1XA 4Y2UA 4KO1S 2WFZA 2ET6A 4AVYA 3OX1A 4YVFA 3OOHA 2KVSA 1UXGA 4QDOA 4B7ZA 4GM0A 1DC6A 5JFGA 1AGNA 2OBYA 1KHHA 1M2HA 4OQLA 3C7TA 4Q9KA 4YWJA 2C5AA 2BQUA 4BP8A 5F98A 3IEVA 3VOAA 2P6RA 2FXIA 4BE4A 3UCFA 2DBVO 2WDPA 1WVGA 3CH4B 1RHMA 4X1IA 2C1XA 3IDOA 2C5BA 2HMUA 4D4HA 4KQCA 5K4HA 2VA9A 3BH7A 1V6AA 5GONB 4PZEA 2O8FA 4WXMA 1AC5A 3ACDA 4F5PA 1SUFA 3B78A 3VPFA 2PX2A 4QBGB 4GEKA 4LYYA 2YN0A 3AB8A 1LC3A 2FN8A 5T67A 1Z7YA 2G4CA 2MU2A 3JQQA 5ARCA 2H57A 3X1MA 4LMAA 3NWOA 3VM6A 1S1MA 4BEVA 2XUJA 2GS9A 1Z47A 4NCJA 1J9GA 1G3UA 4CETA 4EAQA 2FMKA 1KH3A 1NW3A 3S0JA 1WUJS 3AR9A 2IBKA 3BPSA 3ZD7A 3W3AD 4HAUA 1OZFA 2WHPA 4CLDA 2QIPA 1IG6A 4TWZA 2C96A 4UUBA 2GFIA 2ZJFA 4KLCA 2E4UA 2Y1LA 1J42A 1W96A 1Y3HA 4DA6A 3PENA 4NBLA 5BWCA 2KZ3A 3V8BA 1XMOB 2NO6A 2WMYA 2LBPA 4DILA 3I2JA 4UUQA 4FEAA 2C29D 2Y99A 4M88A 1XVAA 5HMMA 1GNRA 4MQMA 2VP3A 5A1JA 4WLFA 4CCWA 1OV6A 4KTTE 4NMLA 5JFTA 1PVRA 2CFIA 3ZCSA 3B8EA 4OHKA 1GFWA 3HBJA 4OMCA 3RFXA 3VOSA 4R98A 2O8EA 2I91A 3W1WA 1Z5UA 4DQVA 3D1LA 2N1MA 2VZ9A 5L3SB 4TWBA 4OIMA 3IP8A 3UQZA 1BPXA 1OAKA 2J5XA 1QHYA 4BNDB 1JMVA 4XVHA 3VPSA 3KLMX 1H9AA 1P8JA 1FXSA 3AONB 4KAAA 3AG6A 5BSGA 1L2TA 3FYUA 1HA3A 3B3GA 2PGNA 4KLEA 5AVQA 4CUJA 2UZ3A 1XVUA 5HK8A 4WK6A 3UMBA 3WR5A 1VE6A 1FP4B 2IW1A 1ZUNA 4WW0A 5K09A 1E9CA 2CV1A 1JR2A 1EFAA 2WJWA 3VV3A 3DGEC 3KYCA 2P5YA 4MKXA 4B84A 3HHEA 4A3SA 1B76A 1MQAA 2VT2A 2XWPA 2CDNA 5H4HA 3GH3A 3HKBB 1CUJA 4B2LA 4NBNA 3D4IA 2BF7A 4PGAA 4KHPB 1EQ2A 2NACA 3QRWA 1T8PA 1SU8A 3UV7A 5K0TA 5FULA 3DOCA 2J0EA 2C95A 2GRAA 1TJ5A 3RARA 4AWXA 7ICUA 3SBEA 4R2HA 1L5HA 4PE5B 3GCWA 1XXLA 2H1SA 1OBHA 5ESRA 2OK7A 3AF4A 3U3XA 4DQSA 4BFWA 1EK2A 2VL7A 3HGQA 2I2CA 1QF7A 3B1ZA 3BYZA 2PL1A 3LWDA 4YRSA 1VMDA 3AEKB 3IURA 4NL9C 2HDOA 1EIZA 3KB6A 2Y67A 2ILTA 3LOPA 3V7KA 4OK5A 4II7A 3OH8A 4LX8A 2HD4A 4ARBA 2I9KA 3DJYA 3H99A 5IJ9B 3A4VA 2XOKA 1V3VA 3PDUA 2GYWA 4P5EA 1JVSA 2BFBA 1ZA2A 4AFNA 3TANA 2L2QA 4E2WA 4EO9A 2VAPA 2Z5LA 2P5TB 4IIGA 3FTNA 2RGYA 4IHAA 2XYHA 4NXNB 2XVYA 3A6KA 1WL8A 3WGYA 3BQNB 1NVFA 3KU1A 3ZS8A 4HDCA 3JWJA 4DJ5X 1ISHA 3IQIX 1H9BA 5ALKA 2ZE6A 1NZJA 3TZQA 1QAMA 5FEMA 1ICEA 4AO8A 1KYIA 4TV8A 5BRJA 3PFKA 2Q6VA 2VH1A 5K3DA 1FP7A 3L6EA 4O9MA 3BH0A 1Z62A 1KI7A 3R4CA 1Q11A 3LY9A 4B3SB 1QJ4A 4IPTA 1OUQA 3ERCA 4RMIA 2XTJA 4HGYA 3DDCA 1SKBA 3AUOA 1TRHA 1O6FA 4FHGA 4Q9JA 4Q37A 1HDZA 3ESXA 3ICOA 4UBNA 1Q95A 3C3BA 2J6HA 3HVIA 3DL4A 1Z0SA 2J59A 4ZVMA 5LOVF 4TS9A 5BUZA 5M34A 6REQA 3T4XA 3H65A 1G3RA 2RGXA 2D2EA 5DPMA 4DIFA 2UVRA 2DWQA 3F6SA 3MGGA 3DYBA 4BFUA 4J1TC 3FLAA 4D9BA 4AMZA 3MS7A 1M9NA 3HLYA 2XRZA 3ENZA 3OPQA 3BN3A 1M1XB 1ZJZA 2WKSA 1N34B 1YWGO 2E5FA 2DWCA 4AS3A 4TV9A 5DM0A 4OI0A 1NJGA 2Z2XA 1U9LA 4JGBA 5JYBA 5C1IA 4L5YA 1IAVA 3ZU6A 2A92A 4U7WA 2ZTDA 2P7IA 2ZI3A 2CF5A 2D0OB 4ZMSA 1SL0A 4WOBA 1TQHA 3TJRA 3GFTA 3M7DA 2I4IA 1HZJA 1E2PA 5SY6A 2ILVA 3O91A 4JP1A 1FSSA 1P2UA 4LJ6A 2HOFA 1I6KA 3DGFC 4I1RA 4M0UA 2PZFA 2PX3A 1EP1B 5D87A 4Q21A 1Z38A 2C2GA 1E7YA 1ZM7A 1K68A 1RM0A 4MP6A 4AO6A 1MABB 4QJIA 4RTRA 4BMZA 1JR4A 1ISSA 2PX8A 4B31A 4C7KA 2VPQA 1RJ9A 4NOKA 1OWMA 2QTHA 3CUVA 1XV5A 3L0YA 1UPUA 2IOFK 1E1RD 1LBEA 1EVJA 4F5NA 2QQGA 3E9MA 1TVMA 4GXKA 1XZJA 4Z9BA 1KWGA 5H68A 8MHTA 4DPLA 4B9LA 2ALZA 1SZPA 4OUKX 5TQ0A 1D5CA 3IV9A 4PZ9A 1T5OA 2WBLC 1GPDG 4TYPA 3WLRA 3CF4A 4OJYA 5EUBA 3KQOA 3ELDA 3FOAA 5CT5A 3PFIA 1E8DA 2Z58A 4CIBA 2V45A 3LF1A 1BS2A 3E1GA 3FE2A 1CS0B 4HC4A 3L4KA 1R6TA 4M38A 2P79A 3AR3A 5GGXA 2XCPA 4P22A 1FO4A 3C4VA 4FHZA 4ARZA 3I45A 3AM9A 3HP4A 3BRQA 3UH0A 2ERYA 1OFTA 5EXSA 3N1UA 1B7GO 4RSHA 5CA0A 5CDGA 4XD7D 4FLFA 5CMLA 2O3TA 2ZDHA 3UMRA 1D4AA 3P0HA 3KB1A 3F1LA 3PNKA 1Z0IA 3BL8A 4D3XA 4PU0A 1AROP 4E09A 2R2AA 4QREA 4BO0A 1T1IA 3PYLA 2R6R1 2TS1A 2Z8ZA 4YJ2A 1DKRA 3RVSA 7ICVA 4W8HA 3FB1A 2IEGA 4MUBA 4DSZA 1NDQA 2IXTA 3C2KA 3I23A 5F9HA 4M49A 3NM5A 1SBYA 1ZH4A 1DRUA 1GAEO 4O2AB 1JG2A 2QG4A 3I5AA 3WNZA 1O96B 521PA 3RG2A 4B6JA 2E0IA 1IZYA 1ZNWA 1QORA 4KEAA 4AUKA 3AO0B 2P11A 1QRRA 4UM9D 2F3NA 5BNWA 1K89A 3V3KA 4H7JA 4S24A 3O93A 4KSCA 4YUZA 2ETVA 1U4SA 4RYLA 1SXEA 13PKA 1OLSA 3DZDA 2JFNA 3HI6A 4MPRA 1LDGA 3V32A 1RXVA 1T43A 2AFHB 1MF7A 5E0KB 2HWWA 2R87A 2XB6A 4FO6A 4DIKA 4M1QA 1LDEA 1R9GA 4YROA 3HVUA 1PJ4A 1UJMA 4YMOA 4XJTA 4X24A 1LJLA 5JQGB 3Q9NA 1G20B 2YX1A 4ZHSA 2FSFA 4FX2A 4DT1B 5DGCA 4TVOA 2R6AA 1N77A 4M53A 1S2DA 3HJRA 2Q3MA 4B71A 2O1EA 4K0KB 2JBAA 2VZ8A 4Y8VA 2NO0A 4H1TA 4CL2A 5HUHA 2K6GA 4X66B 3NT2A 1Y4SA 1F7VA 4B80A 2HGSA 1ZJ5A 3ZXXA 3TLEA 3IQEA 1WUKS 1SQSA 2XTZA 2PS1A 4DGQA 3PQ5A 2JIMA 8ICEA 3V6MA 1U8EA 4I4NA 1T5TA 4OKIA 4KW7A 3WL6A 5A7FA 3DMFA 1F5SA 4LC1A 1U0HC 2WV7A 1DC7A 3WGNA 2QRKA 5JH7F 1Q17A 1VPWA 2B21A 2EKLA 2I3BA 1JDBC 2XOXA 4R2JA 1DCTA 4NLCA 1SVOA 2WUEA 5M04A 1CQIB 5IHPA 3KKNA 1SG0A 1GPKA 2R5FA 3HKDB 4DL9A 2VTVA 7ADHA 5TT0A 3H5AA 2UYCA 2Y9UA 3O8CA 2HO5A 5TSDA 1NPYA 3UFXB 5B12A 1C7JA 5BYBA 2R48A 1FMFA 2IXGA 3P94A 3MDAA 5IYZF 2Q27A 2Y1OA 3WZ2A 1KN5A 4BBZA 4ZOLA 3DBLB 1VBMA 4O25A 4YP7A 1L3SA 3KELA 4BB9A 5JCJD 1FSPA 1JGTA 1M54A 1JA1A 3QWAA 1ZONA 1WCIA 1KJNA 3QPUA 4OI2A 2Y27A 4NM1A 1ZJJA 3WYDA 3D6HA 4C0XA 2CLFB 4LOAA 1PDOA 2YWHA 2EZYA 4YHBA 2XKBA 3FD8A 2ZXIA 1HYHA 3LF2A 3UJBA 1C50A 5E6SA 5AOCA 2H9YA 2ECKA 4RVOA 3WYFA 3IAEA 3W2GA 4BNMA 5BOMA 1Y80A 2NOAA 1KVSA 4TKUB 3BIFA 1XYYA 4GH5A 3UJDA 5FFMA 4JU8A 3KHGA 1GGMA 5LQAA 4TMTA 4GXQA 4AO7A 2VSYA 4TMWA 5JMTA 1JIVA 1WKBA 4EUKA 4XX0A 3HO1A 4PRYA 4RK0A 1Q84A 5INTA 4TVBA 4GE3A 1S2IA 1QG6A 4C0KA 4DAOA 1TF2A 2Q2OA 3I8SA 3UXPA 1EINA 3QFFA 2C4TA 2AN1A 1PVDA 3KOZA 3KUCA 2R47A 5C9ZA 5EMLA 2ECOA 1QIFA 1SUEA 5KSWB 1ZRSA 1E63A 3HN7A 2XXBA 4PLWA 5EWFA 4QBFA 1DEHA 4C0HA 2WA2A 2GN1A 3LCCA 1BVRA 5G3YA 4KO2S 2ZWPA 3QHPA 4AJIA 4AMBA 3T7KA 3MD0A 1UFRA 4DR1B 5BW5A 4IHJA 4DKJA 2BH9A 1WDKA 1RG6A 2HKIA 1PGQA 2W58A 4NPHA 5F51A 2HCTA 1P5FA 3IEIA 1Z4NA 1QE0A 1SKAA 2W03A 3LG2A 1FDUA 2K5UA 3B51X 3CINA 1E9DA 1CZLA 4AYTA 2ENUA 2WY2D 5WRFA 1HK7A 4R2KA 2WWIA 4B47A 3CRW1 5ARDA 2CLKB 4BE7B 1ZNQO 1CU1A 3U0BA 1UZLA 4XW2A 4IDDA 1E6MA 1AKYA 2O2XA 5DM60 2V4UA 3AYXB 2Z0MA 4O2LA 4BE9A 1QO9A 4QC2A 1A77A 5ADUS 3LW8A 5B7GA 3ENNA 2XDAA 2FG5A 4NJEA 4YMSA 3RH0A 5IT9A 2QBYB 1ODLA 2X76A 1KKUA 3QWHA 4Q9AA 1OI2A 2A5LA 2Q8NA 1KP9A 4F3CA 3EW7A 3G2IA 3RHFA 1CETA 4XFKA 8ICIA 5CA1A 4NATA 4AQ7A 2GYVA 3RANA 1N2HA 4L8YA 1GLGA 1A9OA 3L8EA 4M0PA 1XTKA 3QPVA 4ZYWA 2C4VA 1EX7A 4TRJA 3LIPA 4EHLA 4CXMA 1IM2A 4U3JB 1K6JA 3DE1X 4MWBA 3PEYA 3LFUA 4PZDA 4TMXA 1R00A 4P4OA 3ADBA 1U7DA 2FRDC 3IESA 5ES4B 2IV3A 3PPVA 4BNDA 1PWEA 3FNHA 3V2IA 3TEMA 3RYCB 1R0WA 2CVOA 1V11A 5AXAA 3RWBA 1JBEA 4MZXA 5CT4A 3J80A 3U16A 3DMNA 4LY6A 1VE9A 1IK6A 2VTBA 1LPMA 2FLNA 3BWXA 4U7FA 1FP4A 5BR1A 3H9QA 2G1UA 2GD1O 2E55A 5CDFE 3M9XA 5E7IA 4JL6A 4Y2JA 3GFKB 4RK6A 3NPMA 3L0CA 1U9YA 3F7OA 2AHOA 1D2NA 3DHWC 1BXKA 4FYJA 4FYVA 1GXSB 2WP0A 2AQ0A 2A1AA 5F21A 1IIBA 4Q48A 1OC4A 4HXEB 3I53A 3KOXA 1NN1A 5LZ4A 3VR4H 4MSUA 2XGPA 3BXZA 2D1SA 1SKQA 3EAGA 5CLJA 1CUHA 1CB0A 4PF1A 3BZKA 3HUDA 4GI3A 5EJMA 2J6TA 2PXXA 1RRFA 3N75A 1Z5NA 1J8VA 2Z9CA 3UYLA 2WKWA 2OV8A 2I8LA 3KR2A 4FTWA 4WLUA 3EGEA 1MJ5A 2C31A 4YP1A 1E9FA 3M4NA 4EHFA 4FCVA 1QU3A 4YMMA 3ONWA 3OQ1A 2OWEA 2PZJA 2GPBA 3OVMA 3Q2KA 4CQJA 1THGA 4QASA 1P9OA 4BQPA 1NQVA 5FB3A 3OURA 5EKXA 5TS2A 4IFBA 2E5LB 4M0CA 1D2CA 4J0DA 2AMFA 3GRRA 4GSYA 1F7UA 2F8KA 1TRKA 5AJZA 2Q1UA 1GD1O 4I19A 4AC9A 4IEFB 5G41A 3IT1A 5ETJA 1Q83A 3E2EA 1LPPA 4YAGA 3O3CA 4F93B 2PUGA 1TO1E 1GTVA 5FI0B 2QLBA 3CG4A 2P9TA 4XFJA 1C29B 4C43A 1AK1A 1G4UR 1DLJA 1A6SA 5KG4A 1FU4A 1QYVA 4JR2A 5U4QA 4E88A 4B17A 1Y8QB 3VR4A 2IQ5A 1QWSA 2CHEA 1K4MA 1E3JA 4QJFB 3D3JA 3U40A 1QQAA 5IULC 1FP1D 1JZSA 4GPD1 2WAQC 2J41A 2O20A 3VR5D 5LXTA 2OHXA 3QEJA 3UAOA 1K8QA 2SKCA 3O9MA 4HF7A 4I2JA 4NV1A 4AX8A 3AM1A 2O50A 4LBWA 1IEVA 1EAMA 4MWEA 2O3JA 3F4BA 4URUR 3QZ7A 5TX7A 1K97A 5EL0A 3FROA 2JGMA 3RS5A 1YQGA 1RM5A 1NG9A 2ZWOA 2VAXA 1WMDA 1G64A 3SV4A 3Q8WA 5I7AA 4HAIA 5CR9A 2WB2A 4E94A 1NURA 4M0FA 1BX1A 5F9MA 4FW8A 5IJXA 3CNOA 4GKBA 1JLLB 2CJPA 8ICTA 4RV5A 4M4SA 3K9LA 4WAUA 3UK1A 4UBBA 2SHKA 3K9GA 3UHOA 2H9AA 1ZD8A 5CX4A 1JKJB 2BM8A 4YUWA 4MTCA 1NZBA 5DTJA 2IHUA 3K3PA 3D9QX 1TKBA 4Z9AA 1G9SA 3U44B 5CFLA 4MW5A 4X1YB 4B09A 3EMDA 4WACA 2GBLC 1YHNA 3GRUA 1M0EA 2J3KA 5LQCA 5KJEA 1KSPA 1MABA 1XG5A 5FV4A 5KYYA 2OL4A 5DISB 4AJKA 3WBFA 1AT1A 5DNDA 4P3XA 1R6UA 3GLGB 1L4YA 4F56A 2QGFA 3IOYA 3S28A 1ENZA 2IKSA 3BWYA 4R8RA 2DAPA 4ZRDA 2R1TB 3IDFA 4CKBB 1RYHA 2JHCA 2FW1A 3SZ3A 3FG9A 1LNQA 1YVRA 4BY9E 5AQ1A 5KU1A 4UMVA 3JWHA 3TNDA 4MKZA 3CF4G 1ILWA 1ZQYA 4G0PA 2E3TA 2ZRFA 3OA2A 1E1YA 3LC7O 4RTPA 3GP8A 3PYMA 1CS0A 2WABA 4CV0A 2DETA 5BV1A 4ZI5A 1N33B 3RD5A 3TW8B 4DANA 4B6FA 2F9FA 4DLBA 3A9RA 1OTXA 4XASA 5C5EA 4XE5A 3FJOA 1QFXA 3G2KA 4R9RA 2YXBA 3I30X 4QA9A 2A88A 4O4JF 1D5WA 1FYWA 1N5IA 4WDRA 1AKVA 1QYWA 3DDOA 2BH2A 4TLMB 2QSZA 3KR9A 3EZFA 4RENA 4EWLA 4B33A 4BU0A 1YZYA 2PMFA 2GARA 4INZA 3RUFA 4X1IB 3T3EA 3EARA 4WL0A 5KYNA 2YVUA 3PUKA 3PRJA 5CCXA 3MMNA 1YRHA 2PWAA 4XQEA 2O8FB 1MB9A 2RDJA 1UT8A 1YK0A 1JHAA 2PH1A 2NZ2A 3M6MD 1MT3A 3AY7A 1PYGA 1G9TA 4XIGS 4KYUA 4LJ5A 3NYQA 1L3IA 1FEZA 4N9WA 3LV8A 1TJNA 3GIWA 2NSHA 2XD4A 4IH9A 3PX7A 1EX6A 2WHPB 4BMNA 3AX6A 1II9A 1ED1A 1KEWA 3VHQA 2CVQA 3HB0A 1IMOA 1RTTA 2WIFA 4FP9A 2ZR9A 5F5NA 2ECQA 2PUDA 4GM4A 2AFHA 5GJCA 2M6RA 1YA6A 1SL1A 1GYQA 4MV8A 1SNYA 2OPBA 4DSNA 1V5IA 1G20A 3LO8A 1YGYA 4DT1A 1M0WA 1R50A 2ZBPA 3EEBA 1ECWA 4LF6B 1U0EA 3UCEA 2I55A 4J3FA 1I0ZA 3U7EB 3FDZA 3TLCA 4YMHA 1GUYA 2VJLA 2UUOA 2QMEA 2QIOA 2EWVA 1Q20A 4OO1J 4OH1A 2Y77A 3KUDA 4FI3F 2UVQA 2HFJA 2O8EB 4YP9A 5C4GB 1V7ZA 3HL4A 2GD2A 2B9EA 1QCYA 1EGVB 2HHHB 3ENKA 1LGYA 2WU0A 2QD2A 4G09A 2WA1A 2GNPA 1KAHA 2PGAA 5JV5A 1VHTA 2ODNA 1ABFA 1D09A 2J7PA 4YDSA 5EIBD 2W00A 3WGMA 3PHIA 1N6RA 1TM5E 4UUOA 3FYUB 1DBIA 1BMTA 3M6LA 3TSWA 4JLOA 2VEDA 2DPGA 4X0EA 3KSMA 2IT1A 3UMYA 4EYSA 4IVRA 3QPDA 1PL7A 3HILA 1ZUNB 3NI2A 3KYCB 3TKYA 2CSUA 1QDEA 1Y9EA 1JDSA 2YFHA 5EOVA 3D6TB 2F1IA 3OZGA 3LYSA 5DIFA 4CQMD 2J9YB 2XC9A 2AMYA 4KIUA 4LVUA 5FJIA 2J6BA 4RIEA 1H8HD 1LQ2A 2FSPA 3F97A 3UK6A 3ETEA 1TE2A 4QNNA 2D2FA 3MTEA 2VNSA 3TBHA 1KO1A 1L5HB 3WGUA 5A9TA 3IT0A 1F51E 1XRNA 3IERA 4LC0A 2X2PA 2YW9A 2JCVA 2PHZA 2FQXA 2BI8A 3T9FA 3UJNA 1DBRA 3HPRA 4P3NA 4UHHA 7ICKA 1NMXA 4TQUS 1YL6A 2C8JA 5DTEA 5FXMA 3PC8C 4DQQA 1WF3A 3ZQ4A 4NM2A 4CMCA 4J0HA 3QOWA 1R4AA 1T8SA 3NHBA 4YJDA 5ALDA 4TKUA 2OB1A 2PBRA 1NW4A 1IY1A 3HGMA 5LMNB 1T4DA 3SFZA 4ND4A 1QFMA 1YU9A 4B3IA 1OXVA 1SY7A 2HCFA 3KTAA 5CFOA 2HSJA 1RZRA 2A9QA 4K4IA 1CVLA 3E70C 2JRZA 4X3OA 4Z0TA 4AI6A 2AXTU 3FC4A 3UAZA 1AKQA 4LPSA 3AIIA 5ED0A 1P72A 2KV2A 4G0YA 1PL6A 4ZVVA 5HJ5A 5DGDA 3GUYA 5E4JA 4OHXA 2YDYA 3S99A 4DJEC 1ZY2A 5EIFA 5K8JB 3RV4A 5HR6A 4TV8B 4XJVA 2EFHB 4X92A 1DZIA 3OE1A 1W76A 1HTTA 3SK0A 4HSEA 4V0NA 1G7SA 2IODA 5J5CA 2JK0A 4RVCA 2GZ3A 3AR4A 3CX6A 1J5XA 5KT6A 3UWOA 4PLVA 1E9RA 4GI7A 2ZYRA 3HJGA 1KI6B 2V7BA 2NZYA 4BJQA 5CW2A 3F8SA 3GQCA 3GFBA 4ITUA 3HW8A 2A9KA 6REQB 5L1LA 4A10A 2GCNA 5ICGA 1A0PA 3ALRA 1QPGA 1Q0QA 1PIWA 3DYIA 1OFHA 1E1MA 2ORED 1M1YE 1RYBA 5FPYA 1YDWA 2GN0A 1JFLA 3NTLA 4D4KA 4C04A 1RJDA 1FFEA 1S3FA 3I4CA 3HBNA 4ABYA 1SFRA 1X0XA 3EXEA 3WK6A 2CXYA 3PI7A 2UZAA 4FGKA 2MHCA 4TV9B 2WUDA 3P9RA 4WZBE 3AH8A 5B53A 1GLVA 3TKAA 4CKEA 1LLUA 2GNAA 2QRZA 4C08A 4HLQB 2CV0A 2BGUA 1T91A 4GRIA 3QLVC 4NMHA 1DAIA 2BKUA 4QLAA 1SCAA 1YB2A 5K6AC 4ZYZA 2F1HA 1DOZA 3WK7A 4JT2A 5CLIA 2J3MA 1DADA 2VG8A 5ITSA 1XLUA 4M0EA 3OQMA 4U3JA 2IYRA 3AI2A 2AZMA 3I39X 3CKMA 3RRZA 4IF4A 4B9SA 3DXFA 3NWPA 4B9EA 4KR7A 4BQQA 1XRJA 4ALNA 3NIGB 3GNLA 2E6UX 4EP1A 2V8OA 3VPDA 3V4SA 1RJ9B 4Z4QA 3ZHQA 4YRNA 2UUCB 2QN1A 5H8WA 4M36A 4P7KA 4BTLA 2HT6A 1NFRA 5KWIA 2D13A 1FYEA 3RYCA 4CKZA 5C4IA 2NXNA 3TXYA 1QFJA 2I2DA 2HDWA 3JQ6A 4OBWA 1RHRA 2PEZA 3GRCA 1F6WA 1VL1A 4FYMA 2DFNA 4REOA 4HMQA 3MT9A 2IY8A 4I9GA 4QTXA 3ZJ4A 5DKWA 4RA9A 2D5IA 5AKKA 2QZ9A 3P2EA 2D2VA 5AOAA 2F67A 3HSYA 1VJDA 4MIOA 5BQ3A 4DMRA 3G2MA 3I3OA 2FFJA 2NP7A 4PXSA 2OZLA 2O5RA 4MQUA 5IFKA 1GXSA 2HFKA 4OJ6A 3BFVA 4HMPA 1ZI6A 1F1BA 1C7RA 3ULKA 2AYZA 1IUKA 2W93A 4Q1FA 1SOVA 1MH9A 3H8SA 5HVNA 5CA0B 2IIQA 4IQVA 1D2GA 1N92A 1L6IA 4HDNA 2EXXA 3E9QA 1UAGA 3ELYA 5JPIA 1NRIA 5BR8B 3KAPA 2QRJA 4ETNA 4OJLA 3BWBA 1A97A 1UR5A 4EATA 2MT9A 4AX4A 1T8YA 3QA3E 2EERA 3LDFA 3C74A 4KQHA 4TLCA 3E9DA 3IP7A 1PLLA 3QSGA 2G08A 3FYCA 4EYGA 1I7QB 3PR3A 4IDAA 4OXKA 3OTOB 4MI1A 2VQEB 2AL7A 3A6LA 4KWIA 4Q1BA 3FDFA 2QPLA 1W87A 2WVGA 4QYSA 3ISVA 1DQPA 4BDTA 2R8HA 1Q57A 3L1HA 3OUUA 5L3RA 1T35A 3EWIA 3R23A 1U3CA 2VC2B 4D0GA 4ZTBA 1W75A 3HCRA 4PG8A 1A50B 4MUGA 4XQ8A 3ZLTA 1YZHA 3AYZB 1TF5A 1UC9A 4DNPA 4QL3A 3K4PA 1PJAA 3ZG6A 4Q9NA 1SA0B 3K0AA 4QUJA 4JUFA 4UTVA 3WSWA 2Q1TA 2WU4A 1C1XB 5AVWA 3GRZA 3UQYS 4NLZA 3GVCA 5YASA 2F3QA 3C6QA 4OJ5A 2IRWA 2WZBA 1WCLA 1GDHA 3ZWBA 4HVLA 1VKNA 3E2MA 1I4WA 3CR3C 4XDZA 3CFYA 1W29A 5A0FA 4G25A 3B3FA 2G09A 3RH5A 3TG2A 2KEYA 3NEPX 2EP7A 3G1UA 1XC7A 3KHSA 2ZIWA 1MHPA 1PX2A 5GVSA 4F6LA 1EFTA 2OD7A 4YV7A 4FHCA 2ZUUA 1WW2A 4QUGA 2K4EA 1JHQA 3WGKA 4UB8U 2QD5A 1FFUA 4DVGA 2CFTA 1HR0B 1J7KA 3CSSA 1W0KA 3ELUA 4ARSA 2IZZA 1QKJA 5H4GA 4HCJA 4DQ0A 1YF3A 5HHHA 2WIAA 1YIDA 5J2UF 4F2RA 4ZWNA 1PHPA 2O19A 4ZV7A 2NT3A 2PUCA 5IKMA 1IEWA 3MUNA 4HQOA 1MAUA 3IEKA 1U02A 4Y2PA 3K2EA 1Z0KA 4EBCA 3NEYA 3LCRA 1RYRA 2YCBA 4RIGA 4WJKB 4F9TA 4OGKA 2XGSA 4E0DA 5CEEA 2NXCA 4Z6DA 2WWHA 2CXPA 4O3OA 3CCCA 1QM5A 3D4BA 3TI7A 1JLKA 1U65A 4CR8A 4OXIA 3C6ZA 2EZXA 4D25A 4I08A 4KYVA 4D9EA 2IC5A 3Q8XB 1RDFA 1XD2A 1ZOPA 3FDXA 2VVTA 3MPUA 1IHXA 1JKJA 1F0PA 3DAFA 5G3ZA 3HCNA 1UKAA 4TS4A 1H4SA 5EWMB 4YAEA 5AVRA 3SZOA 4G01B 5EUMA 2OCXA 4DN6A 4M47A 1F0KA 1SUPA 3HFSA 1DIBA 4X1YA 4E31A 4MYSA 3BICA 1XKQA 1O4VA 1XEAA 2NO5A 4U2GA 4UHCA 2MJLA 4C2AA 2ZT6A 1SWWA 4RFLA 5K0JA 3T12A 2INGX 3OU2A 2H51A 5AKYA 2LM4A 2LCIA 3WB9A 3S5UA 4BEJA 2I67A 3D6MA 4QG7A 1EIWA 3WWCA 1F60A 4X1OA 4K4HA 2C5GA 4LZOA 3D8UA 5K3SA 1P1IA 3Q7SA 1NBME 1Q7RA 2BGMA 2GXUA 4UOQA 2I80A 3U81A 3L05A 4K6MA 4DSJA 3L01A 3VOTA 1SBNE 2AMJA 5I5GA 2P68A 4UDXX 4XX0B 4JKIA 3V7FA 2XBUA 3FIUA 4YCAA 5T41A 3G8DA 2X1MA 1FUIA 2CJFA 3KUXA 5DI9A 5HJ7A 4CF6A 1BJKA 4MJLA 4L57A 1LI7A 1H2YA 1ISPA 1MP0A 3Q8QB 2KS6A 3CZPA 5K0LA 2W6ZA 3DFFA 4LJ9A 1QHFA 5JJLA 4KK3A 3ZCQA 2IVZA 4DEYA 4MVJM 1URPA 1JAYA 3DONA 4UXIA 5AICA 4ZALA 1FFBA 4HQLA 1WYGA 4X93A 4FIZA 1CD5A 4Y2GA 4K9SA 1W2GA 2GD0A 4AN1A 3L1JA 2IGTA 1UM9A 2X0NA 4NH4A 1AZTA 5IHXA 4EF5A 3D4LA 3BZCA 2LCQA 1DAHA 1NQAO 3RVJA 1R9NA 4IHJB 2GDZA 1XLVA 3I6YA 1LQTA 4D0NA 5H3CA 4KN6A 2Q6OA 1M74A 3GQBB 3P96A 2PVSA 1D6NA 3OSUA 3TG8A 2RHDA 4ZZ1A 4QD3A 3EY4A 2WYHA 3TD2A 3N6XA 3QFSA 5DBIA 3JVEA 3DV2A 2HWKA 2WPDA 2YOFA 1ZQPA 1JDBB 5TMPA 2UVWA 4ELUA 3AQFA 1XMIA 4F4HA 3TVYA 2AUTA 3EK2A 4I5GA 2Q3HA 7ICNA 2QPOA 2QQ5A 3RUPA 2JLXA 3EULA 3P9IA 4YRJA 4DQPA 3FFAA 4RBNA 3MOSA 2ZDQA 1PQPA 3LY8A 4WGGA 5ICMA 4RESA 4NJEB 4KG7A 1I1HA 5E3JA 1X7XB 4YAKA 2IPXA 2UUPA 5BWMA 4PZPA 1EUQA 4DA8A 5CA1B 4F4XA 4BX9A 5P8WA 1JN3A 1WZNA 4PIVA 2PJUA 4RORA 4Y2XA 1Y1PA 3MWFA 2X3FA 4F7WA 2VNAA 4YGXB 1PK8A 3A3YA 2V9WA 4EEYA 9ICRA 3OQOA 3ET4A 1W36D 2QROA 2ODEA 4K3VA 5HKKA 1X1CA 5JAUA 4YLEA 4R71A 1KP2A 3VNVA 2DUYA 2UYOA 1GAWA 1N7IA 2BFMA 1EPUA 4QX6A 3ZH2A 1ZRNA 2DZDA 1ZINA 4K9PA 1CUZA 2XYQA 1USIA 3ZDQA 3K8ZA 4N3BA 2AF4C 1RWKA 1V11B 2I2AA 1XDUA 2VRCD 3ITDA 5KPDA 4C7VA 1BFKA 5HBGA 2RMKA 2VTBB 1E5LA 2VJKA 2YV2A 2WB1F 4DUGA 4RVHA 2CMFA 1L9XA 4HL6A 1QLHA 1RKVA 4QOFA 2FW6A 1A9SA 3KS9A 5KQGA 1E3WA 2WZQA 1KMMA 1JQEA 1ZHHA 3PKIA 1NTRA 2AHOB 4ZXPA 5D5HA 4OBBA 1G291 2RAPA 4B4UA 5AW3A 5BYKA 2GQ0A 3HADA 3CEJA 4DBZA 3QEBZ 3RSLA 4YMVA 4UC0A 1S0VA 4BVHA 2PWBA 3AIKA 2EFEB 4FN5A 3P26A 4PLFA 4XTCS 4I1IA 4RTNA 4G5YA 2ZTVA 3MSXA 5ECYA 2AKYA 5AVTA 4CIDA 3CSDA 2BQ3A 3QV2A 1L3CA 4K6OA 4MCIA 3TACB 5J2EA 1SD1A 4EY3A 4CEIA 2WAOA 4QDKA 1D03A 3N7UA 4QWWA 4Q8EA 1DG1G 1E2FA 3PP8A 4JLSA 3L7JA 1DAMA 2CB9A 3KSAC 2WD7A 1I2CA 2AJ8A 3RWOA 4HGZA 4RH3A 3G88A 2MWMA 3O03A 1L7VC 2EX4A 2IHTA 1L7RA 8ICJA 2QYHA 4IRCA 3F90A 5GZ1A 1UC4B 1I3OA 3OZXA 2E1RA 3HKEA 4WKGA 2FG6C 4IIJF 5JSZB 3E7WA 3EMVA 4DR7B 2E8PA 1N0WA 3WLPA 3VNAA 3OC0A 4P3PA 3BB1A 1QX4A 1W2WB 3FF4A 3EPPA 5KFPA 3QPBA 3R7BA 4JJKA 4ISCA 4CI9A 4RK1A 3I0MA 1ZQEA 3ZZMA 3I5YA 3AL2A 5G0TA 4LHWA 5KIAA 4EEXA 2GTHA 2XT6A 1JBKA 4GLJA 1XEWX 4BVFA 3PPXA 2Y05A 2IX9A 1L8LA 8ADHA 4HNGA 4B45A 5EZQA 1YR8A 3RAQA 5DCLA 4BQFA 5KHOC 2P6MA 2FH5B 4PLZA 5LXTB 2H1WA 3SF0A 2DHRA 1KI6A 3QFTA 4N0QA 1PNOA 4RH1A 2JH8A 2ISOA 2QDKA 4EMBA 1T5IA 2HIGA 4YPVA 3EN0A 4IIHA 1ZQDA 1B2LA 1RAAA 4WX2B 4EMTA 5KFZA 3KNZA 5DSZA 2C2XA 2D4AA 3ROQA 3VSEA 5JISA 2DGZA 3P2YA 5LZ8A 3U7JA 2N3ZA 3ZHOA 4HDQB 3SC2A 1Q1EA 1DKPA 1M34A 1BD3A 1UKZA 4MVJG 3JWEA 3CRNA 2ODPA 2YV3A 2QLMA 2Y68A 4C14A 5LQMA 2K8CB 1CNEA 4ZYLA 3WLEA 4YPOA 3H1EA 3ML1A 1U1FA 3PC6A 1VZ3A 3ZD6A 2RHRA 4CHTA 4TMKA 3SKVA 5IC5A 4EGAA 3G6WA 4RJIA 1J8DA 2C3PA 5K2MA 2KKVA 1XS9D 3FTDA 1RHUA 2O3SA 3SD7A 1NK9A 1B0PA 2Q99A 4NL9A 2IZOA 3HJCA 4NEQA 3K6SA 3PLNA 3DKIA 3T5HA 2QAGC 5G02A 5B3AA 2GZ1A 2CFCA 4LMRA 4DUZB 4YN4A 1KGSA 4NYMR 4LGVA 3PWSA 2FUNB 2NVUA 3WTBA 4JQYA 5CXUA 1ZK2A 3G9UA 5KYYB 3R5HA 5I3ZA 1EB8A 2VA8A 5IU6A 4N7JA 1UF9A 5KBYA 5ALRA 1MG5A 2UUAB 1KAGA 4WCFC 5DLGA 2D0PB 1PR3A 5LMUB 4ID3A 3GGPA 4M83A 2K7ZA 3U4AA 3EIUA 1LW6E 3DEJA 3ND5A 3ASVA 2W8KA 4BMSA 4BU1A 2HQOA 5EXXA 1VKJA 3VX4A 1ML3A 3CUUA 1G16A 4FBLA 3PUXA 2Q0XA 4BJ6A 2BY4A 3MZ0A 3ZHCA 3T54A 5AWFC 4CI0B 2IHMA 3ZZNA 3V1NA 3UG7A 1B73A 1ZGZA 3N87A 5DH9A 1UBTS 4YRCA 5AR1A 3G2JA 1R8QA 4B74A 1NLYA 3E6AA 1WZCA 3X1JA 2IEZA 2ZVQX 5HQJA 3RR2A 1NW9B 2HA5A 2EL9A 3IAFA 1JEYB 4C21A 1U47A 4TQSA 2MDTA 2EQ5A 3DCNA 3TGLA 1IQPA 1SZJG 4OBEA 5LZ7A 4ESOA 1KA9H 4IHQA 2GUGA 3K0CC 3C70A 3F49S 4NKRA 3WADA 3H17A 5ALMA 2YHBA 4M9SA 2JH3A 2D1QA 3RHTA 4OKSA 2XZLA 3ODPA 4IJVA 4J1TA 1X9WA 1ZD4A 1YRQA 1V6SA 1FJGB 1J9ZA 2I1LA 4FZLA 3IN5A 4ZK2A 2PNJA 2BOVA 2KE5A 4MW9A 3A4TA 4AYWA 3OOEA 2EFYA 4J9RA 3EAQA 4I2FA 1NI4A 3THXA 4RZSA 2GAIA 2D3DA 5KTTA 1SA0A 1Z4QA 1ZIOA 4L1KA 4PBRA 1WP9A 3DAOA 4OHUA 2AOVA 1C1XA 5G4KA 4D9HA 3KPWA 2CYAA 4YCDA 2QAGA 3BTUA 3WWPA 4AYBF 4XCXA 2OAGA 4V0MA 2R96A 3HH8A 4F3TA 5C35A 3WKAA 1ACLA 1EBFA 3PK0A 3G6KA 4PYRA 2JEOA 2I78A 3R5SA 5L4LA 2OBNA 3TS1A 5BMVA 4FXOA 4FD3A 2J3IA 3PV8A 3FDZB 2CBZA 5CB4A 2O8CA 4FHDA 2EJTA 3C39A 4DFDA 2QX4A 5KAMA 2A1JA 2A9OA 5HF5A 1KZ7B 5AVZA 5CFQA 3T34A 4MGEA 4IILA 3UJ9A 5MFZA 4WZ6A 1TKRA 3TKLA 1L5VA 4GMDA 4G1UC 2JFHA 1JU4A 1E6UA 2GO1A 3KVYA 2BHLA 3PY8A 1JDTA 1T9BA 5AVYA 3MTBA 2C2HA 3CLTD 2K7FA 4YRAA 5F3RA 2ZJ2A 2PCJA 2N75A 4B6RA 1XD8A 4MKHA 2IEYA 1CY4A 3OZDA 1E79D 3TWOA 3K9WA 2BM1A 4JLAA 3GP5A 3U4QA 4FK8A 3OQJA 2LI6A 1JIJA 5FR2A 1X9GA 4HX5A 4YRTA 2ZM6B 1ZD5A 5FORA 5EWMA 2O6LA 9ICIA 4RPIA 2IUFA 3GDFA 3IUMA 1KERA 4KTVE 2H85A 2FAXA 4RH0A 3TZKA 1MAVA 3AUXA 3NVAA 2PO7A 4Q3DA 1YMVA 1MOZA 1XQ6A 3A1EA 4FGSA 1I94B 2D7DA 2WRZA 4HJXA 2YYAA 2NZUG 2ALJA 1PUXA 1RFLA 3OBBA 2B0JA 5BOSA 1CY1A 3R44A 1XQXA 5DNWA 5BSTA 5JC8A 2DBQA 5IXJA 5BNZA 3S81A 2D7CA 1T36A 7ICRA 4FYIA 3BBLA 3BOSA 3JQDA 1Z6XA 1IN4A 3GN1A 3F6EX 3HEMA 4CQNA 3AINA 5KWJA 2CF6A 5J0PA 3ROGA 4NY8A 3S29A 1ZVJA 1QH9A 5B58C 1UOPA 4DOAA 3CRXA 1ISRA 4W5QA 1VI5A 4NL4H 3KTAB 4GOMD 1DQNA 3CLSC 1Q7EA 2VPXA 1BKSB 1Q0LA 5CYPA 1VJCA 1B8NA 1XWIA 4JUIA 2F4NA 4C22A 3JD3A 4QELA 5EPOA 1EHYA 3OHPA 4R2XA 2PNFA 5JU5A 4QXOA 1YZLA 1TW3A 4KP7A 1N6NA 4C3VA 3PPIA 3TL2A 2ACWA 1A88A 1COOA 1ZQNA 4KXMA 1YZUA 3BHJA 3DZ8A 1BVSA 5J5VA 4QTYA 5BR7A 4BOYA 1DO2A 2OO3A 2GBFA 4M0LA 1Y82A 1XN1A 2C03A 2QTAA 3GQBA 2DVMA 3IXQA 3OF5A 5JCOC 2RHTA 3I34X 2B34A 1BIFA 2HA3A 3HXTA 3DL2A 3X0DA 4KPFC 4X7MA 3NNSA 4ZP1A 3H9BA 1X86B 3I9V1 3IUQA 2ONJA 5HBRA 4K46A 4S1PA 2VBFA 4RDCA 4NMWA 2IXBA 5K99A 2IYOA 5EE0A 2PU5A 1E6LA 5FA8A 5J2GA 2B1IA 2W2PA 4NNPA 1P0QA 2IYQA 3N0VA 4B9UA 2QSJA 4C2BA 1ABBA 1D9XA 1AOXA 4QFBA 3CW8X 5KDOA 4DABA 4P4SA 3MQFA 1FQJA 3THWA 3B38A 5EINA 1X7XA 3EXEB 4C8MA 3CPJB 4GD3Q 2NYRA 5GMOA 4NOJA 3AUSA 4CLXA 1SRQA 2I1WA 5UKDA 4CKEB 3K35A 4H7KA 4AICA 1AB5A 1E98A 2NAFA 2YWRA 4OQNA 4ZK6A 1PWZA 4Z9FA 3OKFA 4L7VA 2HSGA 3N86A 2UV8A 3A2MA 4YD1A 4XVQA 1IQ0A 1TNDA 1JXMA 1NDUA 1IBRA 2JRLA 4HXGA 3NBYC 4CRWB 2YR0A 3ADOA 2PX6A 4EHDA 1YUBA 1FS4A 2J0QA 3EZGA 5FTLA 4KQ1A 4F1JA 1VOTA 5FNVF 3FBWA 2X5KO 3IVRA 2PMWB 4C0WA 5AHWA 2IJGX 5K8UA 1X77A 1UMBA 4FNAA 1GPNA 1EWYA 4ZT6A 3VPAA 3EJWA 1QBKC 4Z49A 2WJVA 4XQCA 4MCHA 2VHCA 2PUVA 5DYTA 5KX5F 3RG8A 1GRCA 2C98A 5T4EA 2X7XA 3RRMA 1C1YA 4MS4A 2H4JA 2VJDA 1CG6A 1J8QA 1Z8NA 3ABSB 4F8EA 5C52B 2H29A 1L8AA 4WADA 4M9XA 4K9KA 2BCVA 1XP5A 2HQBA 3GBVA 3C3DA 3KXIA 1RI5A 2XQGA 4M46A 1PVVA 4RA9B 1AIPA 5IT4A 5F64A 5JMWA 4ZMRA 4BFVA 1GN8A 1UP6A 1I5RA 2DQKA 2QY6A 4JT4A 4V0LA 2ZZKA 4NH0A 5KZMB 2PT9A 2WQ6A 1I5EA 1Q16A 1PFKA 4LBZA 1ODFA 2OZLB 3K7EA 1WCNA 1HOXA 4FZRA 1VLJA 3CLVA 3KLPX 1WXIA 4GKVA 5FBZA 2XB4A 4IFEA 4JJ4A 4LRYA 2LW7A 1F48A 4DEZA 2DX7A 4NFYA 3TLGB 4FT4A 1JHOA 3WNDA 4Q9LA 3TR0A 4WZZA 5JCOA 2FE4A 4HDNB 3CZMA 1VBFA 4GI2A 3R8XA 5EIXA 3QOFA 1W52X 1KDZA 3V46A 4WJLA 3VSBA 2P3SA 1UAAA 1L4LA 5H3LA 5EJ8A 1SIUA 1GRVA 4AXXA 3LPDA 1PS9A 3EB9A 5EZYF 3GBSA 3PDIA 3INNA 4O63O 3WLOA 5LMCA 5IWAB 2OMEA 3BS4A 3GLTA 1BPEA 4R8KA 3KAJA 4MVJP 2JLQA 2KJ5A 4PGMA 4IJUA 4JHXA 2JZCA 3KAQA 3Q40A 3W4IA 3ORHA 1FYDA 1P2SA 1X9IA 5JSZA 1JHVA 1NF3A 5J0TA 1OI3A 2ZCVA 1EDZA 4M9NA 3GEBA 3WU2U 4CFYA 5AK5A 3K0AB 1MO2A 1P2VA 3EPIA 2V7PA 1B3BA 5EA2A 2K8AA 4DJDC 1XZAA 2AD5A 4H59A 4QZDA 1PD1A 4I6EA 4Y0VA 2BDEA 2F3RA 2LKCA 1B93A 3VDMA 1LX7A 4XLTA 4QT4A 4I2GA 1KYQA 4QYIB 1ZVVA 2ZIWB 2FXVA 2AXNA 3OOYA 3KJHA 4U39A 3LGXA 1K8ZB 1PG0A 4EHJA 4K6HA 3B2EA 1KFSA 2FRDA 2P6NA 3GJ8A 4PLPA 4IJWA 1P77A 2GWHA 4NAUA 4I2IA 3PW4A 4K9MA 4HS4A 5A4IS 1U3WA 1K5DA 3FCOA 3WHKA 1USGA 5DGBA 3ITKA 1KHTA 3IVMA 4KQFA 3H2IA 3M6XA 5JANA 4AJ1A 3LPAA 1ZNXA 1CPYA 1ACMA 4LRUA 5KU7A 5IVKA 1KMNA 3NV7A 1Z83A 3F3KA 5J2TF 2A1TR 4MR8A 4K81B 2FNAA 3ESBA 3TOVA 4FLMA 3OU7A 5IBQA 3KZOA 3S70A 1DEXA 3ILXA 1YDMA 4TVSA 4DHWA 2WEKA 1RCTE 5JDIC 1HE8B 3DLIA 1IL0A 4GOXA 3IP9A 4EYOA 1CW2B 1H6DA 4KR0A 1S0UA 3L82B 5GJVC 3K5IA 8ICXA 3MWGA 1Q91A 4XWAA 4DVJA 2GKGA 1BHQ1 3GIMA 4ECAA 3D8NA 4ZPXA 3OF3A 2BIFA 2JH1A 1XD2B 1FUEA 4EBBA 2B1QA 4NBSA 5IANA 3HMKA 4OCZA 4Z0PA 2A1UA 2GUWA 4R81A 4HHEA 3EA0A 3SZLA 1D2HA 5ADWA 1IN8A 1GTSA 3W6ZA 1JLMA 3LFTA 1I30A 5IUNC 4MKFA 3TXAA 1C8LA 4QPNA 1NSFA 3AKEA 4Q3KA 2ID7A 4OM7A 1B41A 2V65A 4AUNA 2FEOA 1UL1X 2X40A 1A5SB 3L4BC 1QNLA 3HRDD 2Q9UA 1M2KA 2BZ0A 3K1TA 1PT6A 1PT8A 3CCFA 4RGYA 1L4UA 1EXDA 4GIBA 4BN5A 3CY6A 1TB4A 1A8SA 1WIWA 3D7MA 4TKLA 4UVGA 1F0MA 3GX1A 1JG6A 4ZOQI 1VIVA 1DIRA 4QDUA 3IBFA 3KQLA 4RQ1A 5HEKA 4DWIA 4LY3A 1DO8A 3NVYA 4OUDA 2OOSA 3W7AA 4KU4A 5L3ZA 5CT9A 2PKYX 4YRFA 1ZVMA 4FGJA 4WE3A 1KZ9A 1WPGA 1NI3A 4NI5A 3LJKA 3UB3A 2PLAA 4OB8A 2Q2VA 4IJ5A 4OHVA 4X65B 4H16A 4LA4A 2F1KA 3Q1KA 3G0HA 5CDUA 2E4VA 1TPYA 2UXBB 3R8CA 1KJJA 3GJ3A 2HBRA 1JEYA 4KJZA 3AFHA 2F55A 2M0NA 3B6KA 1E5XA 5M3BA 1C0LA 4MK4A 4D81A 4A9AA 5J0UA 1ORHA 3SEFA 4YXFA 3TZCA 3H5LA 1XQYA 2DERA 3F1KA 3TZLA 2PY6A 1JEQA 3S27A 2MUTA 4C03A 1UM9B 3KWFA 4HBGA 2WJ3A 4KPYA 3WMEA 4NDNE 1M6HA 2W42A 1E77A 2MCFA 2WE7A 4PYKA 3SICE 1N1DA 2V6GA 4LKRA 4WY5A 3F5QA 2RH4A 5JDIA 3R5TA 4DZRA 3DLCA 3M9WA 3UXOA 4D56A 1TTQB 2PUHA 1E59A 3A1WA 4F4CA 3GJ5A 3P7MA 3L1IA 3ACBA 1O0SA 1RHKA 4O1MA 4R8SA 5BXYA 4GL4A 4PR0A 1RZVA 1XMSA 3EHDA 1Y0BA 1ZGBA 1E20A 3UXHA 3X1DA 4NNJA 4UFPA 1R0SA 4XGKA 3GCZA 1R9MA 4DJTA 1JMYA 5KFOA 4C6SA 1UBMS 5KS2A 1NHGA 2FETA 3LX4A 2C00A 2XOKD 2GBLA 2NZJA 3D2QA 3T5MA 2QVCA 1E9AA 3FY4A 4K1LA 3RVQA 2YYZA 1YL5A 3I5XA 4JWMA 1ZRMA 1M6YA 5CIWA 5KVQA 1DTWA 5FNZA 4A1OA 4QOEA 3OOJA 3H3JA 2WVHA 3AJ9A 1Z56C 1MU0A 4D45A 4BFTA 3V72A 5BMOA 2OUKA 1OC2A 3RRYA 2PR2A 3ICPA 5DMXA 3KTFA 3T1NA 1XMXA 4B32A 2XWSA 5TDHA 3QE9Y 1DARA 4NYJQ 5FX2A 3TRDA 3ILHA 1T0PA 2QUBA 3NFYA 2WWXA 3AN1A 1LV7A 3GAZA 2R60A 1WQ1R 1XAGA 5D84A 3VO8A 4QPZA 5FBQB 5BSFA 3MGBA 1ZZEA 5BQOA 1UBEA 2H11A 3ZHTA 4IJ6A 2VO1A 4A4DA 3GXOA 4TTTS 1GVNB 2M98A 1CJMA 1YA4A 1AKUA 4RGQA 3CRRA 4N7MA 3LA8A 2FRXA 4MP3A 1JTFA 1E3WB 1Q2XA 3RRFA 2HSDA 3NAQA 3UA3A 3PITA 4CCHA 4I3GA 3AVOA 4J6FA 2JFPA 1OU0A 3UY4A 3ONEA 4C80A 5J9FA 3H84A 3CVUA 3FGNA 3MSCA 1A2QA 2C9DA 3W8EA 5D3MA 1MA3A 1GT91 2HIAA 2ANBA 3RSZA 4D9FA 2RFLA 2FJ0A 1MJHA 1U63A 1QRTA 2C3MA 4KRXA 2IS4A 4A0QA 3FYDA 2I29A 4CEIB 4MYHA 4G4SO 1JV2B 4KXXA 3VKFA 2O7SA 3FB4A 1A8PA 3UICA 2JFBA 4V1CI 4F06A 3DBRA 4DC0A 2F00A 2VANA 3PTZA 2WD7B 3KSDO 2V58A 2VXBA 3LDHA 1KVTA 3M2PA 4FKMA 3W90A 2Q4RA 3IELA 3BERA 4L4YA 4DR5B 3SIRA 3VJRA 4JJ6A 4JXKA 2R8XA 3CPSA 1N2GA 2JD1A 4W7IA 3HKEB 1YU6A 2YJ6A 3ZGOA 1V41E 4MVJH 1YASA 4DF3A 1PEKE 5BSKA 1Z6ZA 5KAIU 2JIRA 1E0SA 4WNYA 1JTVA 3W9YA 2Y1EA 4TLLB 2O7QA 3JPPA 3G6YA 1XPUA 3BF7A 1TYBE 5TISU 5HIIA 1QHEA 4D99A 2D0DA 3VDNB 1Z6GA 1M2FA 2W6IA 2LV8A 8ICWA 1XROA 2YJ4A 3MGVA 4F7DA 4O4HF 1U0NA 1A82A 1T5LA 2QG9A 3AHJA 7AT1A 4PW0A 3NPAA 3F4LA 4MDEA 4B6PA 3IDAA 2VJCA 2PXCA 1RD4A 2Q2QA 3RSCA 3TSOA 3ESCA 5B64A 4BWMA 2A58A 3ZEIA 2K2QB 3DKVA 3D0OA 4RDIA 4KQGA 4L3WA 1DMRA 4IH1A 2P3LA 2PMZC 1TMKA 1K6EA 4ZIRB 1N8SA 1MPTA 1PEYA 3LLUA 4N65A 5L7WA 3WG9A 5JADA 3M5DA 4ITVA 2V59A 3K05A 2IXAA 4BUZA 2ONYA 4AULA 3KDPA 4O33A 3ABRB 2F59A 2QL5A 2V1XA 4IXMA 3VCBA 1EA7A 2FLKA 3AVTA 2WNHA 5L7YA 3PEUA 2I3GA 4JU9A 5KCMA 4P0PA 1XRLA 1YR2A 1M10A 4P1ZA 2UAGA 5CJ7A 3UQ2A 3SC2B 3T95A 3FMFA 1K1SA 4MVJA 4C7OB 3RT9A 5I8WA 1M34B 1W4RA 2H8GA 2V9CA 1I4LD 3FJ1A 1SHLA 3F78A 2BM0A 4O8ZA 1CY8A 2JFZA 1GEGA 3I4LA 4DB2A 1UODA 3R1IA 2B8WA 1LXCA 3EXG1 4ADSG 3R7LA 4HPJB 4OX9Y 4ZYUA 3INTA 1M6WA 4J9SA 2BSQA 3ZDFA 5D8DA 1JHDA 1R6DA 1EFVA 1GQ2A 3HU5A 3RODA 4JKOA 3K6SB 3PC8A 4F2GA 2QVZX 3UMCA 4JGGA 3V7UA 2O3RA 4Q39A 1SXQA 1E64A 2GD6A 2XF2A 2VDOB 1NW5A 1GUAA 1I2ZA 3F3YA 1YZVA 4CGYA 1N0UA 4G0XA 2NVUB 4GSLA 3I0ZA 4J7UA 3K4GA 4UPDA 3AVVA 2Y4OA 4YMTA 4MA0A 4QGAA 1RS0A 4C7ZA 2FUCA 5AHOA 1V45E 3AEYA 1VSQA 1C7FA 4MRAA 5E9WA 5AVOA 5KT3A 4Z0HO 3T5LA 4RADA 3KRTA 5A05A 2EX1A 3C5VA 4ECSA 3EEYA 1DL5A 3PC7A 3ASZA 4RK4A 4OYHA 1O0CA 2DQYA 1EFCA 1FNDA 4I1OA 2Q3DA 4JXZA 2PZGA 3ON5A 3MW8A 5EFZA 2O2DA 1K5OA 1GQFA 3T38A 1GCIA 1NBEA 3OSNA 5KVCA 1N5RA 1XCMA 3RC8A 1U9CA 4AIIA 4NONA 1P3Y1 3AIMA 3DTVA 2QL9A 4DLAA 5CM9C 1ZN8A 2ZVPX 2OAEA 1NY6A 4PRLA 3AI3A 3IQXA 2G0AA 1M1UA 4E33A 3D64A 1FQKA 3TLGA 3CNHA 4XI9A 2BFAA 4KO4S 3VTKA 4ZI7F 1M2GA 5HNKA 1JT9A 1X1SA 3CB2A 4XWTA 3T3GA 1YUMA 4QGGA 3H9EO 1T9GS 4LTDA 1J39A 4N47A 2X5OA 3JSXA 4UU8A 3ANSA 4Q00A 1GA4A 3V1TC 1CJSA 2VT7A 2NU8B 4YRMA 4KIGA 3A6DA 1OX5A 4OHFA 4KMMA 1NNI1 2OHVA 4QU9A 5J59A 4CCAA 1VC2A 1SQGA 5JY1A 3I1JA 1NI4B 2HRZA 3THXB 3AVWA 1AZLA 1PS8A 3O8BA 4ZDWA 5MHTA 4F5YA 1MENA 3M33A 5JBIA 4D44A 5JARA 2AWOA 3EOZA 3QLVA 2H9IA 3IP3A 1ZJ6A 1SH7A 2AOTA 1BWSA 2PZAA 2VIXA 5G4KB 4TMZA 3JWIA 4DPMA 1UJ5A 3H4VA 2AZXA 3MVEA 5K6AA 1DTEA 3E9YA 2QAGB 1YSCA 1FQWA 1V9LA 1H4TA 3QUBA 5JHGB 1YR7A 2VPWA 3EMBA 4W5JA 2FZWA 1FA9A 4QYIA 2ZUCA 3DV0B 2FF5A 4DOCA 2FN7A 1QHHA 3DT8A 2VUUA 4C4OA 1Q1QA 5BMVB 5J2DA 1CX9B 4O08A 2HNKA 3A1UA 5CB4B 5FTWA 2O8CB 2GK6A 1O1YA 1C80A 4BAGA 3H9CA 3IKLA 4AMYA 4WCFB 3GFOA 2A1JB 4KE8A 1POXA 2WU1A 5HHTA 1SN7A 3RJEA 1FDTA 1EZ4A 3F2BA 1RPTA 4I66A 1FPQA 1DKLA 4YONB 1UUFA 1MT0A 1E2MA 2Y1JA 1K8YB 2OT3B 2X3UA 1EM8A 5JAPA 1EFKA 1EA5A 1GZ6A 1QCZA 5K8VA 4BO6A 5CX1A 1TAGA 3IPRA 2WTXA 3IA7A 3MXOA 4IUDS 2OYRA 1E3MA 3M8SA 2R3SA 2A67A 2DUNA 1CC1S 1UOOA 1UOEA 4J9KA 2I3AA 1AXGA 1DLIA 4LJAA 4Z86A 3T7TA 4B8YA 2G76A 2HCJB 1XUOA 3U4QB 4NICA 4OM8A 1KYYA 3AR5A 5E4TA 1MO6A 3UMFA 2VNJA 2JLZA 5TIIA 4CG1A 4QUIA 2CE7A 4YT4A 4RTQA 2CBXA 1XLTC 4KACA 3UAWA 1JPNA 1M8PA 4CR7A 3D5TA 2B4YA 4LI3X 2A33A 2BT4A 5JNUA 1PK3A 2HM7A 4O0MA 1BSVA 3WAJA 1FZQA 4RM3A 4DG9A 5LLSA 2CDBA 1FP2A 3TSAA 5BOSB 3IPXA 1UFOA 4BEWA 1ZCFA 3E1KA 3TTVA 2WT8A 4E5VA 5I9IA 4BFZA 5KFGA 2YUTA 2FPSA 3OFSA 4YQFA 1T36B 1EZZA 1RLUA 4OLJA 4TTPA 5DNUA 4UTZA 3RKSA 2I4OA 2YHSA 2E5WA 4D9GA 3MXTA 2PH5A 1T9DA 4RVDA 2ZQYA 1NI5A 1FRNA 1IIPA 4E22A 4PHDA 3KKOA 4I2DA 5LVAA 3A7DA 1RXIA 4I36A 1BROA 4UQLA 4QSHA 5FKJA 3RNOA 1NVMB 2PD6A 3DZBA 2V6JA 5FBHA 4ZYTA 3FUCA 4PSAA 4FFBA 5JD6A 4KH1A 1SG9A 4HI0E 4CMKA 4XA5A 3HWX1 4CW7A 2R86A 3UOWA 4A2CA 5HPYB 4A8PA 3GPLA 4MQBA 3KHKA 1G8SA