2WF5A

Structure of beta-phosphoglucomutase inhibited with glucose-6-phosphate and trifluoromagnesate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic details of near-transition state conformers for enzyme phosphoryl transfer revealed by MgF-3 rather than by phosphoranes.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 77
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wf5A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wf5A01
4IFTA 1ZOLA 5AHXA 3NIWA 4OCZA 1YJ5A 5AIBA 5AKKA 4H1WA 1YDFA 2FPSA 2WF9A 1RLOA 5AI8A 5AVSA 1O03A 2HCFA 5ALFA 3I28A 4EX7A 3CZ4A 3ZVLA 3W5CA 3OTQA 2YJ4A 1TE2A 4QJBA 4EZEA 3A3YA 3UMCA 4KYTA 2I33A 3SKXA 2FI1A 3OCZA 1ZD5A 4L57A 2R8EA 2B8JA 4XPZA 3WK5A 1Z4KA 3AR7A 2FUEA 1SU4A 3FPBA 3L8GA 3KBBA 5AM5A 3J7TA 1Z4QA 3ZVMA 3FPSA 4JDPA 5A3QA 4JB3A 3WK9A 2HOQA 1FEZA 5AK3A 2B1QA 3OCUA 2YN4A 4BBJA 1QYIA 1ZD4A 1Z4OA 3N07A 2CFTA 2HDOA 2AH5A 1IWOA 3SLRA 4CF3A 3U19A 4E88A 1YMQA 1QQ6A 1VJ5A 3SD7A 2GO7A 1K1EA 5ALVA 5AKZA 4HGOA 3L1VA 1RKUA 1LVHA 1ZD2P 1U02A 3L1UA 1S8OA 2BDEA 5ALRA 4CF5A 3VAYA 2AMYA 3WK7A 4G9BA 3RFUA 2IOFA 3U26A 5AVUA 3I1YA 2NO5A 1Z4IA 4NFLA 1N8NA 5IT0A 5AW2A 3A1DA 3SMVA 2PR7A 4NV0A 2WM8A 5AI0A 3N1UA 2ZBFA 2WF8A 5ALZA 3L7YA 4YIKA 4BYGA 1Y8AA 4G63A 1WPGA 5ALGA 1LTQA 1RC8A 5AI4A 3FVVA 1RQNA 4UU1A 2PQ0A 1L6RA 3K1ZA 1RPZA 1KYTA 2P11A 2I7DA 3B8EA 3MN1A 3FM9A 1X42A 2GHTA 3DDHA 3TLMA 3IB6A 4XQ0A 2OBBA 2G1AA 3L8HA 1EK2A 3A1CA 1Z4NA 1Z4LA 1O08A 4UASA 1ZD3A 3WK8A 3ZX4A 3L0YA 2RARA 5AM2A 1NNLA 2I54A 4DW8A 3OCVA 1VJRA 4ZEWA 1YNSA 3EF1A 1WZCA 5FP0A 2YFYA 2IYEA 2QLTA 4Y2QA 3M1YA 2C8KA 4YCNA 1CQZA 2FUCA 5AESA 3R4CA 2GMWA 1YS9A 4BNDB 2HO4A 3SHQA 1NRWA 2R8YA 3B9RA 4F72A 1S2OA 1RMQA 1TA0A 1QQ7A 5AIAA 2B1RA 4Y2PA 3I76A 1T5SA 5AKXA 2W11A 3KOOA 1Z5GA 1TJ3A 5ALNA 5A3RA 2P9JA 1MH9A 2R8XA 2C8LA 1RLMA 2HF2A 2HX1A 4I9GA 3FGOA 3QU9A 5JJBA 4AS2A 5AVVA 2MSNA 1ZJJA 3L8FA 2RB5A 3ESRA 2ZBGA 2MU2A 2EARA 3QGMA 3N28A 5ALJA 3U7EB 1TJ4A 3KC2A 3SKYA 5ALKA 1U7PA 4BX3A 2GHQA 2YBDA 2WHEA 3DV9A 2NYVA 3MMZA 3MPOA 2FPWA 2D2VA 1JUDA 5ALPA 4EX6A 5AICA 3NUQA 2YJ6A 2ZXEA 2FPXA 4ZEVA 3U7GA 3QXGA 4KX5A 3NALA 4BEWA 3PCTA 2C88A 4HGQA 3U7HB 3WKBA 2P69A 5AK5A 1L8LA 1YV9A 2W4MA 1L7OA 3NANA 1RQLA 5AKIA 3M9LA 5ALOA 5ALWA 2G06A 1XP5A 4BX0A 5ALTA 4Y2YA 3HLTA 5AI5A 2WF6A 2RAVA 3GYGA 3ZTYA 3NAMA 4CF4A 3AR6A 4UATA 2MU1A 5ALEA 3EPRA 5E0OA 3ED5A 2Q4TA 2G80A 1RLTA 1SWWA 2WFAA 3E8MA 3P96A 3ZVNA 2C4NA 2Q4RA 3QU4A 1U7OA 3IRUA 5AVRA 3R09A 2AUTA 4UMFA 3HYCA 5IT4A 4UAVA 5ALIA 3I6BA 4Y2SA 2YJ5A 3AR4A 3DNPA 3A1EA 2BY4A 4OD0A 1RMTA 2OM6A 4F71A 4UARA 3WKAA 4MWOA 4XOUA 5AW9A 5AKLA 1L8OA 4UMVA 4UM5A 4FYPA 3FZQA 2HHLA 3L0BA 2Q5EA 4NABA 1NF2A 1ZRMA 3L8EA 2R8ZA 2IOHA 4C4RA 3UMBA 2AGVA 4AS3A 3QU5A 3UM9A 2FPRA 4Y2JA 3ET4A 3QUTA 2JARA 2X4DA 3L5KA 1RRCA 2B8EA 5AKEA 2CFRA 5T41A 3PGLA 1T5TA 4J2TA 2YJ3A 5AKGA 3W5DA 3QU2A 4MUMA 5ALQA 4C4SA 1Z4JA 4Y2XA 2HSZA 4Y2TA 2EATA 2C9MA 3E84A 4Y3UA 3NRJA 4L6CA 2BDUA 5AK6A 2B82A 4KN8A 4QQFA 2HI0A 3ZWKA 4YGYA 4YIHA 1Q91A 2B0CA 5AM1A 4KNVA 2G0AA 2JAWA 2B30A 3BA6A 3BWVA 3QUBA 2G08A 5AVZA 2O9JA 4OFZA 3QU7A 1F5SA 3ZI4A 5AVYA 5AW4A 5AW1A 3QNMA 3AR9A 5AKJA 5A3SA 2EAUA 5AW3A 5ALDA 1Z4PX 5AVTA 4CNQA 3PDWA 4UMEA 1VFPA 4BNDA 2I34A 2DQSA 2RBKA 4KX3A 1U2SA 2PKEA 5AKHA 4YCMA 4CE6A 1Z88A 4FFDA 2ZBDA 5AW6A 4B6JA 3SF0A 5ALXA 2VKQA 4NWIA 3KZXA 1RMYA 3U7FB 3W5BA 2FDRA 3ZUPA 5AKYA 3U13A 4EELA 5ALHA 1QH9A 2YMLA 5ALSA 4UMDA 3WGVA 4HGPA 4GXTA 2JGAA 3CNHA 5AVXA 1WR8A 4DFDA 3R9KA 1Z5UA 3KDPA 4RETA 3WGUA 1L7NA 4KNWA 4J03A 3IJ5A 5ALYA 3F9RA 3ZW7A 5AVQA 2IOFK 4DCCA 1TJ5A 2ZOSA 1SWVA 1QQ5A 1RKQA 1XPJA 3ET5A 2NO4A 4RESA 2P27A 4C4TA 2OA0A 3E81A 3PGVA 2YY6A 2YMMA 2G07A 4Y2UA 5AW8A 3ZTWA 2GFHA 1J8DA 4Y2RA 3DAOA 3WKCA 4YH1A 3QX7A 4HGNA 3RF6A 4UM7A 1CR6A 4PNHA 1Q92A 3EF0A 2O2XA 3KD3A 2YMPA 1PW5A 1U2TA 3EWIA 3OCYA 3QLEA 1ZS9A 5AM3A 3AR5A 3AR8A 5ALMA 1Z4MA 2CN1A 3OPXA 1T9ZA 4IG4A 4Y2VA 3ZU6A 3QUQA 5AM4A 2HF7A 2FPUA 4BEVA 2WF7A 5IS2A 2HEGA 3N5KA 4BKMA 1ZRNA 3WK6A 3WKEA 1J97A 2W43A 4HYTA 3E58A 5ALUA 3L0CA 3ONNA 3OCXA 2I55A 4BX2A 1XVIA 5AI6A 1RDFA 4EENA 2ODAA 3S6JA 3UMGA 3ZX5A 3B9BA 4GIBA 5AW5A 4UW9A 5ALLA 3NASA 2JAUA 3WKDA 2FEAA 4AP9A 2CFSA 1L7MA 3MC1A 3D6JA 4DWOA 3ESQA 4HAIA 2I6XA 4UAUA 2JAOA 2IA5A 4O8CA 5AM0A 4NAVA 2YMQA 5AK4A 3ZWDA 1N9KA 2ZG6A 4HGRA 3W5AA 2QYHA 2OYCA 3AR2A 3QUCA 3OCWA 1L7PA 5AVWA 1EK1A 1WVIA 2G09A 5AW7A 5AW0A 4UU0A 3QYPA 4YCLA 4EEKA 3WK4A 3N8GA 4L6AA 1RKVA 4XE5A 4OHFA 5AI9A 4FE3A 4I9FA 1AQ6A 2WF5A 3AR3A 4ZEXA 2ZBEA
chains in the Genus database with same CATH superfamily
5EUCA 4FT2A 5LKAA 1H9CA 1GNSA 2LUOA 1IK6A 1WMBA 2Y0BA 4AM8A 3DFMA 5K5EA 2AHOA 1W1WA 3GNTA 4ICIA 2PRKA 4J2HA 1VYUA 4BJHB 3FOAA 4U8GA 4RQMA 2IHTA 3HKCB 5CJJA 3ZIDA 4DDMA 4ZVMA 4F2HA 2JCGA 1L5KA 4ETNA 2W6QA 4GLFA 1B1AA 4KC0A 2PD6A 2A0UA 1JHMA 5L3ZA 1CHDA 3EYWA 3TIFA 2BMWA 1J1IA 2BFDB 5DEIA 1HTTA 4DS4A 3JQ9C 3NS1A 2JI4A 3Q9UA 4G5QA 1Y7LA 2I33A 4DJ5X 1Z08A 3FNHA 4KN5A 5F21A 3JYQA 1WUJS 2PYDA 2AXTU 2XECA 4YR9A 1OXUA 2R8EA 1PSZA 4KWTA 4UXJA 2R7KA 4XPZA 4URXR 3C21A 5KJ6A 5JAMA 1NVFA 3O26A 4UAYA 3CEPB 2RE8A 1S2NA 3EPHA 1P3JA 2FUEA 3WGTA 8LDHA 5JDCC 4EQZA 3PNVA 1IEXA 1ELOA 1CJUC 1UBOS 1WDTA 3TMAA 4IHJF 3P2YA 2OXTA 1SC1A 3BAFA 1RRMA 1Q15A 1HTBA 3ULKA 1NNEA 1GNQA 3NRZA 3K9WA 1E20A 4I2BA 4KAXA 4S05A 2D74A 3BSYA 4AJOA 5I45A 1AKTA 1VPVA 4HDRB 1EP2B 2BM0A 3B12A 3QPUA 4QLAA 4UXIA 1OI2A 1YBMA 1U8YA 1YZUA 5KFUA 4OXQA 3UWPA 4JLAA 2G9ZA 1EZZA 2XKBA 4QZ9A 5DGAA 1FP7A 1LPMA 4QYWA 1E79A 2G0TA 1DQZA 1HNNA 1KTIA 5FPQA 3FIUA 4D3XA 4CF3A 1A82A 1YT5A 2W2PA 4K2HA 3ZS8A 3SQMA 1XFAA 2MAXA 1O97D 2XZDA 1Z00B 3C87A 2JHPA 2RBEA 3G89A 2DGDA 3RYHA 4CCYA 1C4OA 1KOLA 4URVR 3KX2A 4HAUA 3C5WP 3FCSB 5T3UA 4WOBA 4D74A 2G7ZA 4ENTA 3HDQA 1DTEA 2C99A 4NFSA 1GRRA 1JHVA 1HLPA 1MORA 1BAPA 2CXSA 3GD7A 3MCWA 4XX0B 5TF4A 3TQQA 4AROA 3FUVA 1FJXA 2UUAB 1S02A 1KOGA 5FWXA 4EB0A 3ALRA 1K1SA 1E2QA 1P3DA 2R6GA 2IUEA 2WJHA 2WNIA 2WU4A 4EYKA 4C7OB 2GH1A 2CXNA 4JYPA 3BWXA 2NO5A 3KU1A 2A0FA 4R2WA 5KC8A 4P08A 5DDMA 4WZBA 5JZ9A 5AW2A 1PUZA 4W4TA 3UQ2A 3CLUD 4WERA 3BIFA 2OCPA 2CXPA 4F93B 3WFZA 5KAIU 2H52A 4OVKA 5K4GA 2HL6A 1BPZA 3S1LA 2E8PA 3W90A 5ADHA 5JRDS 4RQ3A 3OIDA 2NO7A 1SC6A 4DMHA 1XYGA 3GNSA 3SYNA 3NI2A 1KRPA 3JRXA 1U0EA 2HHJA 1RC8A 1HSZA 2BLNA 1E6LA 2GI4A 3PRKE 3U3DA 4QGHA 1DV2A 3HJEA 1VG8A 4MVCA 2GPAA 3G2NA 3CSUA 1PJAA 1Q0UA 3HN6A 3NHAA 2H3IA 1NRIA 4QVKA 4IVNA 4BJQA 4P34A 4NY8A 1JHOA 2WLTA 4IWXA 4HRAA 4KXQA 3MFHA 1SUAA 4KK3A 2XMQA 3IKLA 1FBTA 1KEZA 3EARA 1ZQQA 5KT5A 2WHYA 5CU7A 4CR7A 5IKPA 1UA0A 2JFQA 2XCIA 3B1KA 3KL4A 1VL1A 4K4HA 3VGPA 3M81A 3BPSA 3A37A 1VPDA 4I7EA 4RTJA 4E0DA 3VVLA 1O08A 2LBPA 4PS0A 3Q88A 2IBTA 5A03A 2IEBA 1UXJA 1GDDA 4ZTZB 1TYZA 2RARA 1E2FA 3VO8A 4DDWA 2DUUA 1OW5A 3B0XA 4NLNA 4ZYWA 5KYXB 1QVZA 4JLKA 1XWIA 1WB5A 3HVRA 4MHTA 3O0DA 1JPVA 2HREA 2DJIA 4YRRA 5J4HA 3S0JA 3JARA 1PR3A 3UNXA 1FTQA 2QG6A 3OF2A 2V3VA 3IMEA 5JLAA 3I09A 1A0PA 2H5EA 4KLIA 4ZEWA 4YUAA 3H5TA 1RHJA 3PLAE 4IO1A 4MCJA 2R3SA 1I2AA 2V59A 3H1AA 2X40A 4JXKA 2ZWVA 2GKGA 3GJ7A 2IH5A 1IJKA 4IRDA 3V7FA 1JBKA 1KAQA 4FE4A 3W7BA 2A4KA 4HG2A 3G79A 2XIDA 1NJ1A 2WD7B 3DOIA 4FEYA 4P93A 4TM7A 1J1UA 1Z6AA 3ZOZA 1KI4A 1M76A 8ADHA 2XA9A 4BNDB 4Q9JA 3TGPA 2YDYA 3LI2A 5HZKA 3GEPA 4C0BA 2QL9A 4OXRA 2V55B 4XQ9A 4D79A 2I4MA 2VPWA 1QTMA 3OH8A 4R2MA 1HFEL 2O6HA 1WG8A 4ND3A 4KOEC 3EVCA 4P98A 4E30A 1IY8A 1X1TA 4JI4B 2G1JA 4LXYA 4OLHA 5HR6A 3HPRA 2GZRA 4HS4A 2HBYA 2ZTEA 5IU6A 1L5YA 2B34A 2E89A 3FYUC 8ICUA 2P9JA 1N6OA 4DM4A 1RLMA 3LK9A 3LX4A 2PXAA 3TQFA 2R11A 5NLLA 4I2AA 1NX6A 3FA2A 4JT4A 4PPYA 2CGEA 4QHTA 3JPRA 2CLHB 5CLGA 5FFMA 3W2GA 5ARDA 1YZ6A 6REQA 3DR5A 1IY0A 1Q22A 2R6DA 1WAMA 3CX7A 3QELB 4J9UE 3PPYA 2J0SA 3AZOA 3T7DA 1B3BA 3H2BA 4JUIA 1GO2A 2OL4A 5A5FA 3SP1A 1KQPA 1S1CA 3I52A 3FCYA 4NCXA 3G9UA 5JPDA 3OPQA 4URZR 1THGA 1C2YA 5DULA 4YR7A 7ICMA 1HYHA 3VR4D 5ECYA 1IE3A 3O1HB 2HVHA 2O7QA 4E6EA 1LVGA 1YR2A 3F5FA 4Y7CA 8ICSA 1Z63A 1DU4A 5KIAA 3WC4A 2PR2A 1ODLA 2VDOB 1GUFA 3OETA 2D62A 4GUAA 2CCKA 3LAWA 2BFAA 3CLUC 2OCGA 2FR8A 4ACAA 1VIVA 1K8QA 2JFFA 5DJ5A 3REQB 1NZFA 1Z2EA 1PJRA 2C0PA 5H4GA 1AV6A 2B2NA 3KQWA 1XALA 3KKNA 4C0AC 2JLQA 4C14A 1AKEA 4RVCA 4LDQA 3TR6A 5HS4A 2UVPA 2CSXA 4Y0VA 3LXUX 3U7HB 5FYQA 3SE7A 3H8WA 4RHFA 1B76A 1S2GA 5A6VA 3TL3A 4ZHQB 1I80A 5HE8A 1NMSA 1JHUA 2DPGA 2Z5FA 3GPBA 2BAGA 3M9LA 4DIFA 1E9SA 1E9EA 1RRKA 1RFGE 3NW9A 4R9SA 2HZ7A 2X6RA 2C0QA 2JNWA 3AERB 4OQLA 3SR3A 3U62A 4F6RB 4Z4CA 3RU7A 2ZK7A 1M2JA 4GW3A 1U5BB 1E3SA 1AE1A 5AI5A 1CUKA 3DZBA 1VPLA 2ENUA 5IWAB 2YV2A 4FILA 1L0BA 2DGZA 1MB3A 2PZBA 3R3WA 4C7MA 1XN4A 3BL5A 1O8CA 4BKPA 5JXIA 5GQSA 2BMVA 2HOIA 4IUDS 5KFLA 3HA2A 4QBIA 1QF7A 3RT9A 2JXJA 4YJGA 5IZCA 1NXOA 3FH0A 3AFOA 4MSUA 3MTEA 3ED5A 3QXHA 1JPJA 1UL1X 1TJNA 3NTUA 4F4IA 5JYCA 1GNTA 1ZKMA 4EYSA 1Z33A 5CVVA 3IOMA 1WPRA 1ZH0A 7ICKA 1ULBA 4K0RA 4C06A 5C8VA 1CIVA 2W8KA 2OM2A 3PNQA 3SS9X 3GLFA 2CT8A 1KL7A 2QIPA 3RUEA 3L0ZA 5KFJA 4UNIA 4BEBA 3EEIA 5C1OA 3PX7A 2LNDA 3OQOA 4DLSA 3OIVA 3R3JA 3E5NA 4J4TA 1H3EA 3N8KA 9ICVA 4D9MA 4ED6A 3A3NA 5KG4A 1XZJA 1JQDA 3AEUB 5F7OA 4BBZA 2PKQP 4PIMA 1IN7A 5LZ2A 4XOUA 5AW9A 4TLDA 5DNDA 4AMVA 4J0FA 2IDMA 2RQ5A 1HT3A 2YTZA 4XIGS 2YXPX 1TIBA 2P62A 2V96A 3NDRA 3MB5A 3X1JA 1PGOA 4I3HA 1IUKA 2XCLA 3DS8A 3E2IA 1ADYA 4QQKA 2PGDA 5IIIA 1M6VA 4TSFA 1CUAA 2YV1A 4G4GA 1MA7A 2ZI9A 3HEBA 2H1SA 3I12A 4GG1A 5JMPA 2FPMA 1F2TA 1PJSA 3URMA 1Y42X 3VCBA 1ODJA 1P9OA 3H11A 3W4IA 1QKIA 1LXCA 1FUKA 4K0KB 4P0TA 3T8YA 2BHLA 4ZMSA 1Z4JA 2H2AA 4RD1A 1B4FA 3DEIA 3O8QB 5I8ZA 3BS7A 4HAVA 5KU7A 2PGAA 4Y3UA 1PP4A 4Q00A 4A3SA 3C1TA 3NM6B 1Y4UA 3A9UA 5K45A 3B6MA 4BVEA 3JATB 5KG1A 4Q4AA 4BNTA 1C3JA 1Z2CA 4JB8A 5F1OA 4WVFA 4W8HA 4TQSA 4N5HX 1AZWA 1Z6TA 1JJBA 1YKFA 4J90A 2FW9A 4MVJM 3RHFA 4HQFA 2V8OA 3ZYZA 4F5RA 3H87A 4QWCA 4F8YA 1YTLA 1FDIA 4MWZA 4DIUA 1Q3TA 1QHYA 2FWRA 2M9MA 3D2BA 1N9GA 2BFCB 4RT2A 2F00A 2ORYA 5EZ6B 2ZPUA 2A9JA 5H59A 4GR9A 3SAFA 1TADA 2GPNA 1N5XA 3GDHA 4YN3A 1B3RA 3QNMA 4M21A 2PGLA 2GEDA 4OQPA 5EE1A 3TXAA 4NMHA 4FCVA 2EIXA 3U4CA 1SM4A 1JX4A 5U4XA 3VSAA 3EDMA 4PIPA 4HPWA 1A72A 3AC0A 2DQSA 2J5QA 4XTRA 2D0PB 1GKUB 2GN0A 2H8KA 1H5QA 1V95A 2WHPB 3C43A 1EZ4A 3MM4A 4URYR 3W34A 3AO0B 4AZ3A 2O7VA 4II7A 3IKVA 1UDRA 4Q4CA 5AW6A 5KL1B 1VYVA 1W5TA 2V5AA 1T2FA 2BTQB 4MWGA 3GPLA 3RKUA 4DM3A 1NI3A 2GN9A 3G3EA 3ZHRA 1IN1A 1JB1A 1D8LA 4Q1BA 3T1OA 3ZK9A 3LQ1A 2K4HA 5FOTA 3IAXA 1EVEA 3BE5A 2GD1O 3AB7A 5DCLA 1DEKA 4FSXA 4BUGA 3W5BA 3G6YA 4NU6A 4OJPA 4EELA 2XRYA 3MAGA 1U0TA 2EQAA 3I9V1 1SXJA 2Q5JA 1PJBA 1QQBA 2B7CA 3B6JA 5GONF 4RPYA 2CDNA 2CK3A 1ZWKA 4Q4HA 4WK2B 1SRQA 3CH7A 1AF7A 1ZSNA 2XW6A 3AB3A 3HR4A 4UBKA 3H9CA 4EJSA 2C98A 4K6FA 3KPJA 2XYGA 4Q9HA 3LU1A 2FQ1A 1L7NA 4YP6A 4EKEA 4F3TA 1E9RA 3W3AH 1JKFA 3BRWD 2W6IA 3H6HA 3KDAA 3P0JA 2VHJA 1D07A 4HQLA 1R7RA 3BQ0A 5EWGA 4W5TA 2FPGB 3KB1A 3R3VA 3TPZA 2ONZA 1C7JA 2XE7A 4EQ6B 4MLCA 3CG0A 4DGSA 2CK3D 5B5EU 2X5OA 2OLJA 3GARA 1AS2A 4G2TA 5FUYA 3VJLA 1M6EX 2PXCA 1ZVVA 3DD1A 3PMLA 2W9XA 3ETLA 1OXVA 3K4QA 4EI8A 1FVFA 1RADA 1JHQA 4B47A 4B84A 4UTVA 3EPGA 1IN4A 1JE1A 2HQBA 5FBZA 1KI7A 4F91B 1U6KA 1VA5A 2X42A 2XQIA 4EF5A 4EMUA 5MN4A 4MARA 2JF0A 4JUDX 1NUAA 2H07A 5CXUA 1HX7A 2WWHA 4LBWA 1YB6A 1HO3A 3IAS1 3IMKA 3EZ5A 3F4KA 3QX7A 1KSHA 1KI6A 1O9HA 1Y1LA 2GXSA 1X86B 2ZIUA 3G7NA 4HGNA 5CGZA 3S2ZA 2WJJA 2IEDA 1CY6A 1HG1A 2ZS7A 2AZ4A 4L74A 3T3GA 4O5CA 1ZVMA 3IUMA 3PICA 4A0GA 2K2QB 3RUAA 5BORA 5LLDA 1GM5A 4NYIR 1SCNE 2BV3A 1XLWA 4R6WA 3OHBA 3PCRB 4M55A 1BEZA 1JU4A 4R8RA 3V4VB 3NJRA 4KR9A 3COWA 1KR2A 5KTQA 1Q57A 4JX9A 4D9KA 4NLBA 1X2IA 4U4AA 5DWQA 5JFGA 3AF5A 3ODPA 5L9XA 1JWBB 3EGDA 2VHQA 4GVXA 2GZ3A 2PFOA 1WDKA 1R3DA 4NCHA 1XL1A 4Q1EA 3QUQA 5AM4A 1YI0A 2HF7A 3LPNA 4TT3D 3EG9A 3L93A 4EOGA 3ISBA 1SCKA 1LNSA 1II8A 3RF7A 1E6WA 2VZLA 3LPCA 1LWOA 1W59A 3DZGA 3NR2A 1Z2DA 3WKEA 1AU9A 1ZCBA 3ASYA 3PHCA 1CZOA 1L4NA 3P2KA 4M38A 2D8MA 4RXUA 5J2UB 4IVQA 2JK1A 3BXPA 2XXAA 1KEPA 3GLTA 1CG6A 1X80B 3ZI7A 1NYLA 2IODA 5HTKA 4MJ7A 1AHHA 3O31A 3COJA 3I6IA 1NLYA 1YJAA 4HNSA 3SVZA 4ER3A 3TZ6A 5JU5A 4B4VA 1PV2A 4RK0A 4CM6A 4GIBA 4KP7A 2ERCA 3U7QB 2PL5A 1NV9A 2G8NA 2ZBPA 2SKEA 3BDVA 4LXXA 1IIPA 3QXJA 4V03A 1N0WA 4AP9A 2QGFA 4WEOA 2BPGA 3M4ZA 3KIPA 4ZJZA 5HFJA 4Q1VA 2VPXA 4WLOA 4IQ4A 3ESQA 4MV9A 3OJEA 2BT4A 1N2OA 3LQYA 1NOIA 1JAZA 1ZQ1C 1QFSA 3LQ4A 4HP8A 3FTEA 3M6FA 3A4IA 1QNLA 1UK7A 3R7WA 3PIRA 3SLGA 2CL0X 5KVCA 3MWKA 4KPEC 1BKSB 3TACB 3GLGA 3MTDA 2BGLA 4XA5A 2IEYA 1MEOA 2PV7A 5IJ0B 1RWXA 4RZRA 1P0IA 3RUFA 5KX5A 1AZLA 4YK7A 4GXKA 1P5FA 4BTEA 4P6VF 4FP9A 1KRHA 1CK4A 4LCEA 4LBVA 1AS0A 4QQRA 1C1XB 5EXTA 3TXXA 1PHRA 2HBZA 1P2GA 4HAOA 1PSDA 4HNHA 2NNWB 3K09A 4Y8VA 3W9BA 1QS0A 4D99A 1KVTA 3RODA 3LBNA 4LW8A 1I4OA 3QYPA 4YCLA 2J6SA 3CC8A 5IK2A 3F6CA 5JQWA 5IBCA 4RVOA 4OHFA 4BNWA 1TQ6A 4D8TA 3JD1A 5SY9A 4RZ3A 4JNCA 5TMEA 3SBXA 3HGMA 1TPYA 4UTOA 3TW8A 1X0XA 1YRAA 2CVFA 3E53A 3AHEA 4IDNA 2X5KO 3A7DA 4TMWA 2J87A 2D6FC 5EQJB 5IKMA 3F53A 1TC2A 2Z2IA 4L3WA 2GPWA 4IILA 5FTKA 1JHYA 2ZBEA 5KYTA 2GCNA 3GYBA 1YS6A 2HMYB 3DEAA 5D6NA 5GP1A 2FLWA 1XZMA 4H1WA 2V7QA 1FFVA 1IXRA 1HURA 4MVJH 1KVSA 4UAWA 2EVWX 3AEQA 3AF2A 4R8SA 1Z34A 1RLOA 1BXGA 1OLXA 5AJUA 4TUPA 4D98A 3Q8PB 4J7CA 1KKMA 1GPBA 2R8KA 1P2SA 2IDKA 2PXHA 4F7DA 2BIFA 2Q1YA 2NXNA 2ZWAA 3CNLA 4GP9A 4ZP1A 1SZHA 1PNTA 2O1SA 2EZYA 2B3DA 1M2OB 1Q1AA 2FR8C 3PQ6A 4S0XA 4G23A 4WINA 3ZIUA 5F9NA 5CIQA 4ESHA 1NP3A 1L5UA 3MUOA 1ZD5A 4Z86A 5EMKA 3SV4A 2VK2A 1RXEA 3NRWA 5ENDA 1XSNA 5FNZA 3QEJA 5C80A 2IA6A 3K1AA 2EG9A 3IV6A 1ZUIA 2LKCA 1U63A 4JUCA 1T0UA 2WNHA 3BIOA 1XXHB 4MP6A 2K8AA 4U8HA 4WKGA 5K51A 2Z9BA 5DP1A 1BH2A 3L8GA 3MS4A 3KBBA 4V1CA 3DNFA 2WUEA 4JDPA 4M0LA 3TQHA 5JATA 4U2FA 3L8ZA 1WD7A 1UBEA 2B1QA 3A70A 2BD0A 3BJYA 5LZ7A 3ISVA 3KLMX 4F86A 2DRIA 4FGZA 1T4DA 1SVMA 1ZD4A 4M53A 4MV7A 1A2QA 1KZ1A 3F49S 4NL4H 1T4CB 5DRTA 3QVSA 3SLRA 2O06A 3LNTA 5KKAA 4RZ2A 4Q9DA 3U19A 1R12A 5CNJA 3UYKA 1EFVA 4DA7A 2C54A 1H2WA 2OHJA 1B74A 1GTZA 1LNZA 1W9MA 3I8XA 4FS3A 4U63A 1H6BA 4ERXA 2E85A 5EJFA 1KZ4A 2DVMA 1BU8A 2BP7A 3IJEB 1XF9A 2YVAA 1V16B 1DCFA 2D2XA 3CF4A 3KT8A 5F5XA 5HJ2A 1N5MA 3NX4A 5DNVA 1YHNA 3VX4A 1ZQLA 2JJMA 3G17A 3RYIA 4BMYA 1GHTA 2D1QA 4BYMA 4BJ3A 2ZXUA 1BVYF 1RI2A 2WWWA 4MULA 4WJZA 4DT1B 2C4WA 2H29A 4TLEA 3RFUA 2QN7A 2IOFA 3L7BA 3H16A 4HX9A 3LHDA 2V4ZA 3OX3A 1AK1A 4G8BA 4JL8A 4LDZA 4QREA 1P2FA 3P2MA 1DJQA 1H69A 1JEQA 5JNLA 1NM5A 4KBFA 4OM8A 2F64A 3DYVA 9ICFA 1Y7PA 4GO1A 3OT5A 2C78A 2HIHA 3ZDDA 4BGDA 2P6MA 5DBCA 1J70A 2G40A 5B55A 1UKCA 2IH4A 3P5BA 2ODNA 4EG5A 5EJIA 5KHAA 4YJ2F 3PQ7A 3NZEA 1VA4A 3S70A 5BN4A 5JYDA 4D41A 1TQDA 3INYA 4PGFA 3DVAB 5CB4B 1WPGA 1ZY2A 3EW9A 3K1TA 4OHOA 3UAZA 1RQNA 5ICFA 4TYPA 3BCHA 2XA2A 4MIOA 1U4NA 2Z43A 4H0FA 4S04A 3PL5A 2UV8A 4KQEA 4EQ6A 4ZDWA 4M0PA 3ZHSA 4Q02A 3ZZMA 3GIWA 3ZHBA 1B1CA 3DVAA 2BCQA 2FH5B 1M33A 3MTIA 5LJIA 4R9VA 3AVYA 4M0KA 3HMQA 2WKRA 4LJRA 1A9ZA 1GGKA 4KOAA 2OORC 3HZHA 4LJ4A 1V11A 1WSWA 4MW5A 3WYNA 3ZWOA 5BWNA 3MBOA 3P9XA 4DC0A 2ZWPA 1W5FA 4ZCLA 3D3KA 4RPKA 2ZWMA 3CNOA 3FUWA 2J5RA 2NVOA 1CQJB 3SZMA 2Q3MA 3L7MA 4KMSA 4N0QA 2V7WA 4I4NA 1N36B 1T3HA 2YBEA 2ZR9A 3AMVA 1J56A 2O7RA 3IQHX 4XUCA 1PJLA 3U40A 1EM8A 2I3GA 1DWUA 3PZBA 2Q3JA 3LPDA 4TLMB 3OT1A 5DI3A 1B8NA 1N2HA 1OLSA 2BKUA 1B42A 3FFTA 4I55A 1I0IA 2WD9A 3P9KA 3M5WA 5GONA 4OEHA 1IN5A 2JDID 3STTA 3R0QA 2DX7A 4UCFA 3EF1A 4DR6B 2FMPA 3CVWA 5FF9A 4F6LA 2FEXA 5EE0A 1CQZA 4ZIRB 3AINA 1OD6A 4IZHA 4JBIA 1ONNA 2DQKA 2VJDA 4JITA 4OAOA 3OQ1A 4YLEA 2QXTA 2L69A 5GMOA 3QQPA 3OQBA 2DXIA 3IIKA 3NM5A 3QKRB 5DISB 5ES4B 1QWOA 4JVNA 2GEKA 3HLKA 3MWDB 5K3FA 1PN3A 3FWKA 1U47A 1WSBA 3DOHA 1U3CA 3LY7A 1F8YA 1ZQOA 2YWJA 1KN5A 2ZIZA 3ZE2B 4AKEA 4M98A 3RJTA 2D2IA 1VL2A 5HKLA 4CQJA 3A0HU 3UXMA 4BV9A 3K7EA 4M83A 4NAUA 1D5CA 1KEUA 1XTQA 4JA2A 1T5SA 5YASA 4BC1A 3L4SO 5C9ZA 3KOOA 3U1VA 4NL9C 4QQNA 4AG3A 3IQFA 2WPDA 4BASA 3OKAA 2IIVA 3OWXA 3U7RA 3V9AA 2RK4A 3NVKI 2FU5C 5F76A 5FPSA 4F5NA 3OT4A 4WRRA 3GDFA 5HBRA 4EYQA 1TUEA 1YAJA 1GFIA 3HYRA 2FW8A 1Q1QA 1UJ4A 3DMTC 2Q3EA 3FKJA 4D9IA 4OQZA 1CJTC 4QOSA 4O9MA 2CXTA 4XDYA 3I01M 4K9SA 1A9OA 3PJGA 3RRYA 3CX3A 4BUZA 3L8FA 3RH0A 4O2RA 3VNBA 4NJMB 1PAUA 2R68A 3QFHA 1LX6A 1ZI8A 1FTWA 1Y9JA 2QQ5A 3AVPA 3D5TA 3RSGA 5EKSA 2VTKA 2RGEA 5C5DA 1AMOA 2JIPA 4EA6A 2FZKA 2Q9AA 2RBGA 3VBCA 2YCLA 2XY6A 1ISJA 4J75A 3TI7A 1U1IA 4BU0A 3PJFA 1RPNA 2SNIE 5L3RA 3U7EB 1HETA 2GZDA 3AERA 3COYA 3I4LA 3OOEA 4Q37A 1E4OA 2IF2A 4TSKA 2OKCA 4TWIA 1MNQA 4XVHA 1Y9DA 1NW6A 3EC2A 2Q50A 1FSZA 3AWIA 1JHZA 2BGNA 2CHGA 4PQFA 4B85A 7ICLA 2DR0A 3MJHA 4HXGA 2XXBA 1TLTA 4JR2A 3GV7B 4N9WA 2Z8YM 4CCWA 2BCVA 2ZEJA 3RC3A 3R6GA 4YDHB 5FPTA 2KYRA 3W3ZB 2HJ9A 1NR7A 3NOXA 3LWNA 3TBKA 2P6RA 4ELVA 1OU4A 1W9HA 1XRPA 3ETJA 3FJOA 3MK31 4OL9A 1XWLA 2JB9A 1B2RA 5B3JC 4UREA 4I2GA 1THMA 2OCXA 4PPXA 4WASA 2AG8A 2IYSA 2RGXA 3DMGA 2ZM5A 3MRXA 2FPKA 3OMLA 1QH8A 1N6KA 4CI9A 2PBRA 3C3BA 2AKAB 4F2WA 1U48A 2NZ2A 3IT2A 1F7UA 3RIXA 1WXGA 1T25A 2CJXA 2FZGA 5A3JA 4BWFB 4O4HB 5HZMA 1QHIA 2FUKA 2HJWA 1YZHA 1WMEA 1PGPA 3MT0A 2JVJA 3AF3A 3P9PA 4HMQA 4D8UA 3GYGA 5J1SB 4BKRA 1X77A 4HEQA 3NHFA 1G3IA 5F78A 1M1NA 1NFFA 4HTAA 3O8NA 5DASA 1L5QA 2MMCA 2XX3A 3OFNA 1X7WA 3WJ2A 3HM2A 5K0NA 1OV4A 3S68A 1DDIA 1JEOA 4DJJA 2RD2A 1S4MA 4JJ7A 5CXSA 3P71T 2Q4TA 2MSKA 4KXNA 4CMHA 4E3WA 3DFZA 3UCEA 5JAOA 3FCXA 2ZJAA 4OGWA 3WU2U 1ESDA 3BMQB 2BTEA 2O19A 5AVRA 1TM4E 1WDLA 3F3YA 4HOYA 3WWYA 5EJ9A 4Y18A 2JLCA 4NM2A 1P7CA 2AMLA 1BDMA 1GAJA 1W96A 3OM1A 4PICA 4U7GA 4OXIA 3A9RA 3GH1A 1CUBA 1OGIA 4C2UA 1MC8A 4Y2SA 4RTSA 4Z49A 2NV0A 3H2KA 1CFZA 4ZCMA 2M32A 4R3WA 1DUIA 2VRWA 4COOA 2J08A 1HDRA 5FFNA 1E2JA 1NQXA 1NULA 3ASZA 1G5IA 3GEGA 3MS7A 3F7TA 5ILOA 4IIJF 4MWDA 3PSTA 3N7PD 1C81A 1PL8A 4ZGBA 3KKAC 3F3KA 4NQRA 1EVKA 4EI2A 2C1XA 1I5OA 5I7OA 2VQ6A 4Q9LA 4R0MA 2R85A 3C85A 4C4RA 3UMBA 3G8DA 3KQTA 2AD5A 2CXQA 2GA9A 2PKQO 3E7XA 3H8SA 5EGSA 2EL9A 2HK7A 5HRAA 4GMKA 4HQNA 1WWKA 4HUQB 4LRUA 3COSA 3D3WB 1NK7A 1GPLA 5LMZA 5IMSA 4O8ZA 5FB3A 1BDJA 1N3YA 4BLWA 3HJFA 5T41A 4BKQA 2LDBA 4MV5A 1T5TA 4NY1A 2QMZA 3KT0A 4J2TA 4X3PA 3HDHA 4HFRA 2GN6A 4YDSA 2FNAA 4PONA 1MV8A 3QRWA 2AR9A 3ANTA 1VXRA 2W2TA 3EVTA 4MQMA 4DQSA 1QTNA 3DLCA 1BWRA 3I04M 3AV0B 3AU6A 3V9PA 3BQ9A 3CE6A 1XD8A 1VG0B 2OVFA 4C3VA 4OPMA 5FIUA 4B3HA 1G8HA 3RIGA 5HE9A 4KNVA 1SKMA 5K0LA 3OQ6A 3RVQA 3TW6A 3WSTA 2X76A 1XZDA 4CKBA 5KYUB 1CUHA 3C6XA 1V3UA 4HEA1 3HVIA 4NX2A 4XYEA 4I19A 1ZJYA 3VYUB 2XZTA 2IYVA 1COZA 2ONCA 4K8RB 1JTVA 2OQ2A 1TKBA 4ND5A 4AO6A 3PGXA 4BP8A 3UOWA 2EAUA 4JU8A 2ZJ8A 3IEKA 3P26A 3RIEA 5AK0A 4EUSA 1ZQRA 1F60A 5SV2A 2HY7A 2ZB4A 4ZVLA 2C61A 1O4WA 1GPAA 5J2KA 1MX3A 1JIVA 3ISCA 2XYVA 1DNPA 3OC6A 3UMVA 1ZGJA 2SHKA 3R3UA 4N0EA 1R4MA 2Q6TA 1G9SA 3VMMA 5B4VA 2EYUA 1G0NA 1M1YE 1NZJA 1E1RD 1U5CA 2X0NA 4TRMA 4U2KA 4X91A 2VUTA 4OHZA 4ALJA 4TKLA 1QONA 1EM8B 2GFIA 4R1SA 5LJLA 1AQYA 5KNIA 1P8JA 4GNKA 2MIIA 1P61B 4MUJA 2FE1A 1T3QA 2ZYWX 2NN3C 3FUXA 4R2HA 4RHUA 1RMYA 2HA0A 4XX0A 4XPIB 5CH3A 3T95A 4AMZA 4E0BA 4HUTA 2DLDA 2UUCB 1UADA 3M7IA 3U7FB 2P66A 1H1DA 1RIIA 2OAEA 3L4BC 4ITUA 4HX5A 4ODIA 5DK4A 5E2IA 3RWBA 1T1JA 4RTQA 1MB9A 2HA5A 2KKPA 1ZH8A 2D5CA 2VJCA 3EC7A 1UFRA 4O2LA 4DMGA 5L3QA 1ZGAA 1IQPA 3R3ZA 3WGZA 3UT6A 2PAFA 3ZWQA 1S1MA 3MS2A 2OC9A 4G0VA 3ZZNA 5HW0A 3F73A 5J1TB 2C7VA 3MYRA 1W36D 2ZIUB 4YRFA 1P7ZA 4TPKA 4RETA 1X13A 5T3YA 3QEAZ 1HDIA 3V34A 2A1JB 1YS4A 1NZDA 3AY7A 4KQKA 4MTLA 1RYMA 4PYLA 4YCAA 3MJ4A 3RC9A 1V3TA 3AFNA 3UMSA 5BMVA 3SHTA 3H8JA 4JKOA 4ENQA 4PHTA 1N0IA 4GDMA 1O87A 1ND6A 3ZUGA 2AX4A 1U0LA 3CH6A 1D2RA 1QR2A 2DBVO 2J41A 4I9UA 4JB0A 4LMRA 5C8YA 1W87A 3VUEA 4B3RB 3K9HA 4ICAA 4BX9C 2ZRHA 5KT3A 3UXYA 1ZBDA 2VP4A 4AKHA 3MTAA 1TZCA 2NUPB 3B36A 4YAJA 5DBHX 1O6FA 3H3JA 4LHZA 1SHTX 2DLCX 3NBQA 5FH9A 3S2GA 4N7RA 2PMWB 2E4VA 4G37A 1DZ3A 1R15A 1VP3A 2D1YA 3OZTA 3GLIE 1EG7A 2PM8A 2NXWA 1JFFA 1HOXA 3M3HA 5AHOA 4C01A 2UZ4A 3QVKA 2NUAA 2XUHA 2BKVA 5BPCA 3DAYA 4MWTA 1QHXA 4UPEA 3QHAA 2QGNA 3TARA 4MFCA 3MDCA 1XS9D 1E5XA 1NXPA 1Z2NX 4LOJA 2VNHA 3MOGA 3RBDA 5JD4A 2DFDA 1VE3A 5KSZA 1EDDA 3A06A 3CXRA 3HKCA 3O8BA 2YJNA 4HWSA 2OOSA 3EGXA 3LK7A 5C31A 3ACBA 4DOCA 1T6XA 3DFFA 3KV1A 3PT9A 4HI0E 4I1VA 4OLAA 4KRFA 3OF5A 2B6HA 2FSVA 2PBZA 4DV3B 3OJFA 1B8PA 4ED9A 4ECZA 3ZCPA 1NKCA 3ZK7A 4OQFA 3NT4A 4LSMA 4FBUA 1ZGGA 1ZJ6A 2XQKA 2ZRFA 2AI2A 4V0QA 1ZC4A 3HLYA 5KAPA 1QIFA 2JL1A 3N2KB 3E2MA 4BVKA 3FLMA 4HS9A 3OMWA 2QJTA 2ERXA 4WT7A 1SUDA 3UJ9A 1KJIA 3BXGA 4QWDA 1M1ZA 4Z51A 2LDXA 3LKVA 1RDFA 1QC5A 1L8XA 2Q8PA 2WUVA 2KSOB 4PBTA 5JNSA 2YZMA 4K88A 3UJNA 3OY2A 3TUZC 4C3ZA 4RQUA 3PW7A 1DG9A 3TIVA 2YHUA 1TPZA 4JOCA 4FC7A 4GX0A 5CA1F 3WKDA 1MHPA 3AI3A 2CFSA 5DHRA 2WYUA 3TKAA 1NR5A 2XZOA 3C1UA 3HKDA 4Q16A 4BQPA 2BPOA 1M5TA 1W46A 2OHXA 2VT2A 5JSZA 2AOUA 1OYYA 4AZ0B 4E4TA 1W47A 2CUKA 4R05A 2OESA 3WTCA 5ARBA 2EHJA 3QZ7A 1GDTA 1XMIA 1I7LA 5BN4B 3U09A 1OZHA 3HYNA 4IP0A 1L7RA 3UWDA 4F5EA 4ED2A 1RRGA 1ATIA 1L7PA 3L8MA 4OSPA 3V55A 4YCCA 5JYEA 2A1TR 2A5YB 1YC5A 3WIOA 5JISA 2PJUA 1UQRA 1G8FA 2F6RA 3GL9A 3I0ZA 3OIGA 4OBXA 5FUVA 2BVNA 2DR2A 4QVIA 5TVGA 3DWGA 4N8SA 1Y7HA 3SAJA 3CTMA 4BO2A 2RAFA 4BJ1A 3IBCA 4ZPXA 3TX6A 5TMDA 4XARA 3E0XA 1XQ6A 4LQDA 4RMJA 1PG2A 3EIOA 1K89A 5CVCA 1CCWA 2H6EA 2PANA 2I2WA 4RY9A 3G8AA 3KYDA 3PEVA 4DARA 4G4JA 2ZXHA 1XMPA 3IXMA 2XB4A 2A59A 2F1KA 3GFOA 4G0ZA 1TVAA 4IZOA 2C04A 2AJ8A 3DBRA 4URUR 1SGGA 1CBUA 5SZKB 3W4KA 4KR6A 1HLFA 1ZZEA 3IC5A 1GLGA 1X6IA 4XIFA 4EK9A 3IUJA 4BV8A 5KFFA 3U3OA 3PR1A 1YMUA 4EMSA 5GZ1A 3NB0A 4GE3A 4IIHA 3CG4A 1G8AA 2RHBA 2P6NA 4A8HA 1TJYA 3G5TA 1PNVA 1K5HA 1UODA 2ROQA 3GQBB 4CODB 4DM7A 4YYZA 1FX1A 2Q0ZX 2GM5A 2C31A 4DA0A 4E2ZA 1Z68A 9ICOA 2FFAA 4RKEA 1QIHA 1WV1A 2FMHA 4JHLA 5KFZA 5A4AA 3DTYA 5I7HA 2VJKA 3I83A 4E12A 2WAYA 5KWJA 3V6HA 2XUZA 2E8MA 1P4RA 2HU2A 2JI9A 2X2PA 3H9QA 2RJOA 2YXLA 2VUHB 3QHPA 4IIBA 4OB6A 3UMCA 4I29A 1CJCA 3W06A 4Z8XA 4G1CA 4PLTA 2B98A 5K3BA 5LCXA 1OSNA 3SKXA 4ED1A 1SKRA 2KVSA 1MQ9A 4ROSA 5KYWB 2KJ8A 3VR1A 2O2CA 2OV4A 5KWVA 5CK4A 1W19A 5KYUA 1Z6XA 4NBVA 4MEAA 5B1IA 3REFA 1SELA 2ZIGA 4TZ6A 2HRQA 3LC1O 4M9XA 3DEEA 3QOFA 2RC5A 2QSJA 4O63O 1SV0A 3H1EA 5A9SB 8ABPA 2GHRA 1PDWA 1CWUA 3WY9A 1BCRB 2DUNA 5JXWA 1GA1A 1H2EA 3UC9A 1RU3A 1FEZA 4X8HA 1J0XO 4ALNA 4LNUA 4RJIA 3VH4A 3ZJ4A 3NWJA 3ANMA 4A6XA 2GVZC 4HDRA 2GBPA 3TNDA 4CTKA 4L8LA 5H4HA 1U49A 3JVVA 4UFNA 3NVYA 4YR2A 1NJ5A 2Z4TA 3O8RA 4IV8A 4FJ2A 4EHFA 1I3KA 2YHAA 1EB8A 3EPIA 2FQQA 1J5PA 4BCCA 2UUOA 3KYDB 3OOYA 3LZ6A 1RM3A 3KFVA 4YTEA 2B8WA 5E6SB 3LZCA 1E2PA 3QVXA 4V38A 4FYWA 3ZWVA 5J3JA 2WWRA 2FLNA 3UBMA 1SKSA 2HV8A 4BLRA 4GNRA 1IBSA 1Z2PX 2G9QA 4KB5A 4MO2A 1NMQA 4XM2A 3C8ZA 1U2GA 2B83A 1WVGA 1ML4A 1R4NA 2EFGA 4AZWA 1RKUA 5HSGA 2ZM6B 1U02A 2C2KA 2VF8A 1O95A 3BAZA 3PV0A 2WG1A 4FHDA 4BO7A 1CNFA 4AXXA 3LL7A 2JAHA 3HB1A 3STUA 1GRNA 4QOFA 4JOSA 3E5RA 1DWQA 3R7DA 1JZTA 3P9QA 1JEEA 3U80A 1UWLA 4IXTA 3E23A 3SKVA 4EW1A 4FQ5A 4IIXA 1FYEA 3QELA 4HATA 1SXPA 3BCRA 2HZBA 4AP6A 1FRZA 1SA0A 2F4VB 3Q8QB 3IUSA 4YONB 4LOKA 3EOZA 3NEJA 5ITZA 3NWOA 3MQFA 3H0KA 1SU8A 3BXHA 4QEDA 2E8NA 5ALGA 4YT4A 1R8QA 1OAKA 2DHCA 3C3YA 2OFFA 1XQVA 1HE2A 1M9NA 4XASA 2W83A 2K4IA 4GZMA 2DPLA 1QOPB 3VO2A 3IJPA 3OFVA 4O2AB 3HB7A 2YFHA 1KOJA 4DUZB 3OJWA 2I4OA 1NVAA 2GCIA 3MIIA 3O03A 4HSGA 1RYDA 1CNMA 3RDPA 5A5VA 2XB2A 5GTHU 2FWAA 2QUAA 1R9JA 3FM9A 1YB1A 4OP3A 3TLMA 5DU2A 2X1VA 1VHQA 4UM9B 3THOA 1W4RA 1GNPA 1M0EA 1G20B 3IO5A 4F4WA 1UIRA 2WOOA 4OY3A 2X0IA 2XCPA 3BFPA 4GSKA 4RVSA 1WCV1 4FS2A 3IVXA 3L8CA 3EJ6A 1NJ8A 5U1PA 3TOCA 3S8YA 3RAJA 2HPAA 4QYIA 4UHHA 5DSTA 2GZHA 5IHXA 3IR7A 4UE2A 1VKZA 4RVUA 1FP2A 2Q3DA 1HDGO 1X1CA 3HUFA 2YTUA 1RYNA 2QMUA 1E7QA 3Q0TA 2EFJA 3BGVA 1D09A 1E2DA 1XRSB 5CRXA 5E3IA 2I66A 4NICA 2B5OA 4BTVA 2HJSA 1X9WA 3BILA 2QTZA 5LQRA 3IIIA 3H04A 4Y2QA 1QPBA 2Z56A 4HL6A 4U39A 3SQDA 4C0WA 5CEEA 4AG5A 4EBEA 4DWJA 5EP3A 3KJGA 1ZQ9A 2NQTA 4BFVA 1Y5LA 1Y3CE 3OGUA 3CH5A 4PWYA 1BMDA 2JBAA 4WGGA 2WPDD 4Q34A 3TDMA 3TLAA 3B9RA 4DIKA 4EARA 4RGBA 4ZJPA 5C8YF 4YD2A 3I92A 4TXHA 4LNAA 4L4UA 5T67A 1QQ7A 3M8SA 1RWWA 2IBMA 5EINA 4Y2PA 5BOSA 3EVDA 4PV7A 1V0JA 5I01A 1T8PA 4HXEB 3STXA 3PNPA 1VJDA 2R25B 3L06A 2ZJ3A 5THQA 4MITA 2VANA 1ZM9A 2HFJA 1BX1A 5JQGB 4I2JA 5IIKA 2GEBA 2QN1A 3IAHA 1BMFA 1X7XA 4QYTA 3FGOA 4JBGA 3RHTA 4FDLA 3W8FA 4M1KA 2EJTA 3ZGVA 5LQSA 3JZIA 4NYMR 5M3BA 1V1JA 1R8JA 4C76A 2QL6A 2B4QA 4ARAA 1CC1S 1F4PA 1S2LA 3WIVA 3S8EA 2HHHB 1LK0A 2C7QA 4CLDA 2RDIA 1W2WB 2F8KA 3RB6A 3RQIA 2A57A 3AQFA 1A9SA 3KFXA 4AW9A 1VB3A 1XDGA 2P2GA 4GYYA 4ER6A 2XGPA 2NSLA 3KWMA 4MYHA 1SEPA 3EFOB 5BUSA 1D04A 3HFJA 2IXAA 3N28A 1Z6ZA 2AC7A 4OUDB 4LOIA 1YQXA 1V7PC 5TT1A 5BNZA 4H2DA 1BNCA 3GUYA 2DKFA 2G9RA 2R6CA 4TUYA 4DEVA 5CEFA 1S9HA 4FGJA 3R8CA 3G0CA 2H4ZA 3PXAA 1MB4A 1VRWA 3GU3A 1M8GA 3A8TA 4Q4LA 4FFVA 4XA8A 1M6NA 2MWMA 2F77X 1V4VA 3B2EA 3OZXA 3Q7EA 1ST3A 1TCBA 3H8MA 2Q3HA 3UHOA 3ZW8A 5LQMA 1SVKA 2R7LA 4RELA 1R4MB 2QMOA 5G41A 2IV3A 2H5IA 1XMVA 3DA8A 3EHEA 3W5HA 4ZI3A 1T35A 2IXBA 2QUJA 4ES6A 3KT3A 1QZXA 4UOQA 4OB8A 5IUKC 3BQ7A 3DFUA 3CIFA 4NKRA 3KETA 4RU9A 3GNQA 2KTQA 2HT6A 5B1DA 2QVGA 1PTKA 1RYBA 5LU9A 1W6UA 3FKQA 4CM4A 1T8SA 2X5XA 1QH0A 3EVAA 1RAEA 2QT9A 3R77A 2WJ6A 4FCTA 4GBED 4HPXB 4U1RA 3UKJA 2F44A 2D59A 3X1MA 2D06A 4BX0A 2PKCA 2V9ZA 1KLNA 1IVYA 3SS8A 1PLLA 4DYHA 5BV0A 1PVRA 1J0DA 2HCBA 3ND6A 4KFUA 1USUA 2H2DA 1N48A 3PJEA 2W2LD 3RJJA 1NMYA 1LKZA 3GLUA 3ANSA 4RSGA 1Y3FE 3QPBA 2WD7A 3UK2A 5TT0A 3NHPA 3ZCSA 1K4KA 3VU9B 9ICSA 4CV0A 1Q0LA 5FWAA 2CL6X 3GJ3A 4V1CB 4BATA 2CXUA 2J0UA 1ZMXA 3QLVC 1FO4A 2QAGA 4MRVA 5JSFA 2EL7A 1VPWA 1CEQA 5ADUS 8OHMA 1MX1A 3I2KA 4H1HA 3H2GA 3F9CA 4PHHA 1FU7A 4WIAA 3SX2A 2I99A 3Q1KA 1P9WA 2FWJA 2J9FB 4C80A 1E1CB 1U0NA 2ZETA 3WB2A 5EWLB 4RPLA 4UCXA 4FD2A 2WWXA 4NOJA 1FTNA 4DPMA 1ODSA 2X4GA 4EJ6A 2VH5R 4WH0A 2G0NA 1C3VA 3I5UA 4JBWA 4MWOA 4ZJYA 1T94A 5AKLA 1MO2A 2SECE 5K3SA 4TMFA 1L8OA 4I3FA 3H9UA 4FYPA 1J33A 4PQRA 4C1NA 4F8EA 1M73E 1K7EB 5T14A 2DHDA 4ITRC 6REQB 5MF6A 4GYJA 3IAAA 3IT1A 2H3ZA 4KN7A 1YRYE 1CZLA 2AFVA 2EGUA 1N8SA 3AU8A 3B1ZA 3EUEA 3ISTA 4JDUA 4URWR 4RJLA 2LR0A 1ZW6A 3LVRE 4WBSA 1XAJA 5FCDA 2IYOA 3WLEA 4X3CA 3PTZA 3I9JA 2Y27A 1TU0A 4RM2A 3F3SA 3WYGA 6NULA 3ORHA 2VUUA 3PX3A 4P82A 4YAEA 1KIAA 2I6GA 2OUKA 4G0MA 4PTLA 4RDHA 1E1MA 2QTBA 4K6MA 4XWTA 4B7XA 3FBWA 4LDJA 4DSNA 1ODKA 4I2CA 4MUMA 3WGNA 3KUKA 3VO9A 3ROXA 1JI7A 1XZLA 2Z1DA 1G7RA 2IUFA 4L50A 2ESRA 1L5ZA 1F38A 3TADC 3HACA 4PYQA 5AK6A 4OHVA 3DH0A 1QWSA 2Y71A 5TQ0A 4OXYA 1MAAA 2AW5A 3ZGLA 1XGKA 1VI5A 1HKHA 4ATNA 5HZGA 5AM1A 5J2FA 1BG6A 3EASA 3RS9A 4BS9A 2R47A 3D7MA 1EEXB 2A0KA 2JFUA 3BS5A 3BN3A 3ENWA 2UAGA 3EXEA 3FNEA 2R96A 3LO5A 3NNDA 4HDQB 4UUMA 1T0BA 4YO8A 1DI0A 3UAXA 4C0QC 3ADBA 2J7PD 2Y6UA 3OJOA 5CH5A 2E49A 1FMCA 2GDZA 4ZVNA 2LD4A 3EIQA 5DEOA 2G7MC 1Y7IA 3JTMA 1W75A 3M2PA 1JSRA 4FFWA 5IDVA 2IE0A 4LAFA 3HVJA 2IF0A 4L4XA 1PK1A 1XF1A 2DFPA 4PGYA 2IZ5A 3K5PA 3AZPA 4MUXA 4N7BA 2DPJA 2FWIA 4IINA 4WXMA 4ZANA 2B5VA 1MO5A 1RWBA 4UMEA 4Q3AA 2E1RA 2VBFA 3BULA 1L1EA 3G59A 4ZVOA 4PL1A 1MQSA 4TMKA 4CIWA 1THTA 1U2SA 5JR3A 3D9QX 2WZCA 2FPLA 5CDFE 1E5VA 3ESDA 3MBKA 4U2GA 1OBHA 4Y9DA 1TCCA 2YWDA 4TGLA 1I2DA 2BP7B 3CFYA 3IOEA 2CRXA 3VA7A 1FLDA 2O54A 1C9DB 3E0FA 3ILSA 5C4IA 1HMPA 4C8LA 5BSHA 1X38A 1MJGA 1R6XA 2O2IA 2ZR8A 1K2WA 2VK4A 3AIKA 4O3FA 3Q7QA 1E1QA 4PGGA 5IM5A 2XTAA 4KMOB 5FJIA 3C3MA 1FMLA 2A88A 1NBWB 2QENA 3TZQA 1UZMA 2Y2UA 4QWBA 2MA1A 2MRLA 1TK5A 5D01A 2ZSIA 3UJ8A 1MC5A 1TC1A 3CO0S 3RUCA 4RPZA 2ECOA 3C6BA 2ZW9A 1ZQZA 4KFRA 1HEKA 1LPNA 3BMCA 4FW9A 1W88B 1REQA 3Q7TA 1MQ3A 4JIMA 4RD0A 4M9LA 2PY6A 4JK3A 1U3FA 5DSZA 4NHEA 3PHJA 3K6RA 3TKLA 1HFKA 1QUEA 3BSFA 2Q3FA 4QT4A 5BNIA 3BQTA 2WTFA 2VT6A 1E5DA 3VV3A 2Q07A 4F60A 1HF3A 5G5GA 4ZEMA 5LIPA 4FHCA 1M8PA 4U7CA 1E3DA 2XYHA 5CYOA 5K3AA 1G291 1YDMA 1ZICA 1UFQA 4YALA 1Q6ZA 5ENVA 4ZTBA 5IJ9A 3HUUA 2XGGA 4C6SA 2GK6A 4Q7LA 1QYVA 1WBJB 3MJSA 4HLQB 4BLUA 4C29A 2J85A 3TD2A 3EISA 3WLHA 4P7GA 2B99A 5IXJA 1LSJA 2VDQB 1PL7A 2A78A 3K0HA 5L1MA 1SQGA 4I1UA 5ECGC 1WCNA 1PVDA 4PRZA 1OIXA 4YP9A 3ZJTA 4B7ZA 3T4EA 4CDNA 2WINI 2R60A 4UQLA 3PXDA 5EZYA 1DBQA 3ADKA 1XX6A 2I5PO 1M1YB 4W7SA 4P2HA 4DUPA 3FGPA 5MDHA 2X7HA 2O1XA 2FZLA 2JBWA 1P5HA 3WRXC 1DP4A 1GGFA 4BFCA 4W63A 3ZV4A 1U2ZA 5KG7A 1ZRHA 3W3AD 4FN4A 3N39C 1B73A 5EE3A 4FSDA 1JB9A 4OJ6A 2A2ZA 4OTZA 2GM4A 1XEWX 2IPOA 4AS1A 1X15A 2J8ZA 2FPOA 7ICGA 4ZRMA 2QRPA 2WMOB 4KSCA 1TMYA 3KLNA 1XKTA 2A4MA 4P33A 3CCFA 3SNHA 2NSJA 3V2IA 4YAIA 2W93A 4L8YA 2XWPA 3HQ4O 4IIGA 4A16A 5BRJA 5HWSA 1EVZA 1PT8A 4O2AA 2R6HA 2AGOA 4ELUA 1P45A 1A4IA 3FHOA 3V00A 2WF7A 2PZKA 3PC3A 3IOBA 2Q9UA 3V1UA 4BKMA 3WK6A 3IVRA 5JG7A 3BMCB 2YOHA 3SK0A 3V6LA 4BGIA 3IP5A 3L0CA 4ZGGA 3ABSB 1Z15A 1M3SA 3HFGA 3GRZA 2ESEA 4C3OB 4AO8A 2FHPA 2BM8A 3IBGA 4IR7A 3O4IA 4BX2A 1VE9A 3ZE6A 1V3VA 1GQYA 5H1YA 5THXA 5D51S 5K0EA 2QZPA 1WDWB 1XZGA 1J2YA 3A28A 3TFRA 1MQ8B 1ZIOA 5F1YA 4AAYA 1F8FA 4IIYA 1VG9B 4KN4A 3R6WA 5REQA 1EGHA 4XW2A 3ER8A 4UW9A 2AZTA 3IBFA 4MI1A 2FF5A 5AOBA 4MKZA 4ZPJA 1G2QA 1R16A 1YSCA 4IGFA 4DWOA 2HM7A 5JJKA 1AK9A 4HSEA 2RKBA 4ZHQF 3KXPA 1LPAB 4Z4QA 3D02A 4LJ7A 4RLQA 1NK5A 1ZQPA 4DSJA 1MN6A 3O9VA 3RASA 3QXCA 2J0EA 4Q4JA 4TWRA 5KVQA 3WMGA 4CKWA 2CVHA 3AR2A 4CQLB 1BVRA 3RR8A 2HRZA 3FRIA 2VS1A 4KXMA 1CP2A 2YUIA 2EAMA 2G09A 2BI7A 3PI7A 4MZXA 3WGMA 2XUDA 1BX3A 2VI5A 2F59A 5CFRA 4F50A 5D8DA 3D8BA 4Z7JA 3U4QA 3HKBA 5AVOA 1LJUA 4RZIA 3N8GA 4E2XA 1RKVA 3TJMA 1FNNA 3IR5A 1FXSA 4EG6A 3H1PA 4CG0A 4M9GA 2PT5A 2A9PA 3ENNA 2QTTA 2Q6IA 3S27A 4DMCA 2HLHA 3BZWA 1N5WA 4HTFB 4IFTA 4IGKA 1PEYA 4TZKA 1TZBA 2P3LA 2X23A 4JYCA 2BW0A 5J63A 4BQRA 4CN8A 5SZIA 1GXSB 1HDYA 1M7BA 2NZJA 3FPCA 3RT7A 4YPOA 3L4EA 3GJ0A 2GK7A 2VIXA 4F2GA 3CLKA 1JGTA 2Y4NA 2UZAA 3HBNA 3M6LA 2MINA 3VKVA 4DF8A 4J0GA 4OUDA 2CFCA 2RJ3A 3DCJA 4OQQA 2VCYA 3BIJA 1R37A 4J0KA 2WVAA 1AQUA 4IIFA 4F5WA 1Y6GA 1YCFA 1IBMB 5F1KA 3PZRA 3E22B 3LP6A 5JCZA 2ZPAA 2OWEA 5AMXA 1QZUA 3MIZA 3JVIA 1V9PA 5J0TA 2FI1A 1W49A 4XEUA 2JIZD 3DHVA 3H13A 3VI3B 1Z3CA 4DB2A 2R5WA 1DC3A 2KVCA 4P4LA 4NR0A 3KWLA 4ZT5A 2V5VA 3ZCTA 5EJ6A 1QP7A 5F98A 2Q28A 2JLZA 1EFDN 4GC5A 5HUQA 3L9WA 1UANA 1V4BA 2FUNB 3GLKA 1X87A 3Q85A 4BO6A 3BXEA 1C3EA 3ZVKA 3JPTA 1XQXA 1I51A 2VFAA 3R0IA 4TMYA 1KJWA 1S2IA 1N2EA 2FCRA 3SVLA 2AZXA 5F4ZA 1ZP6A 2X0DA 4MNTA 4BRWA 1Q0SA 2V97A 3WLAA 3JV7A 1JDUA 4GE0A 4QNNA 3SC2A 1SO8A 1YBVA 1MIOA 3PX6A 5CJ2A 2C00A 3R7BA 3MELA 4XYLA 3DKIA 1RQRA 2YH2A 1GOTA 3AW8A 5C35A 3R4VA 5JS8A 5K0SA 4IDQA 4E88A 4XSHA 1DXOA 5BYBA 1CF4A 2OCEA 1DG1G 3SD7A 2AX3A 2C2GA 3NCHA 3DZ8A 1Y81A 2A1TS 3OIYA 3SR0A 4RA6B 4EHBA 4QU8A 3GLIB 4ZYTA 3B3AA 4IY1A 1VC2A 4YCBA 1XJCA 1YB5A 1W44A 1MUUA 4IEFB 3IO3A 2CVPA 4A1OA 3AI1A 4C0SA 3VHLB 1Y5NA 3UUFA 1SKYE 1BVUA 3IAEA 1RTTA 2C1ZA 5HDBB 4R8UB 3PC6A 4ZQCB 1S5PA 1Y1TA 2J6HA 2PUVA 4V0ME 5TE9A 2Q7DA 2BGWA 1ZIXA 1T3LA 2AV6A 2WIGA 4G1BA 2DP4E 3DMYA 3FKSA 4O25A 4U0KA 3I9MA 4NV0A 1PJZA 1KE1A 1O6GA 3JQAA 4MH0R 1UBGA 2A3RA 1YUMA 8ICCA 1ZESA 4D0RA 2FUG6 3WL5A 2QEQA 5FBRB 5D2CA 1TQ8A 3GAFA 1WCIB 2JGKA 4DNXA 4M8NE 3OA0A 2FCAA 3IE2A 4DVGA 4PM4A 3FVVA 4LYAA 1YR6A 4MWSA 2XO7A 2I9GA 2ZAIA 2IP1A 3CW9A 2EF0A 3HYLA 4L0DA 4UU1A 5EN4A 3EVFA 2R4TA 2NU8A 3KSBC 2PL1A 2XVMA 4TQGA 1T36A 2VUSA 1RPZA 4X1IB 1RBQA 4DRYA 4D9GA 5E3HA 2V9WA 1V7ZA 2JS7A 4IYRA 3TZKA 3UPDA 1F0KA 1JIHA 2JCXA 1UPAA 4PZAA 2VA8A 3G6VA 3SXPA 4C4AA 2GLEA 1QRDA 4NE9A 4DRXA 5C4MA 1T7PA 2FQYA 3WBBA 4NXMB 4X5VA 1SVNA 1Z5WA 1AM4D 4JEMA 2J9RA 2IHNA 4IJUA 4MR7A 821PA 3WAGA 1RYZA 1U65A 3O82A 1NVMB 4NS4A 3IDSA 1Z25A 2A33A 4RA6A 3QENA 4KJZA 2EERA 2WJGA 1Z6GA 4O4JF 4EFLA 5HHTA 1CQWA 1JG2A 4JGIA 1W5EA 2ID4A 1WZCA 4CQMA 1L5FA 2ATVA 3WL6A 1P4AA 3TL6A 1T2EA 4KKVA 2KQUA 2QHXA 3W9YA 3E48A 4AWXA 1XIVA 3R5HA 1T26A 2VQDA 2DBQA 1R88A 3C5GA 2OFPA 1RI4A 1VIAA 2VRCA 4TVSA 3W5SA 2PKXA 1FSGA 2Y92A 1CQIB 3OUZA 5DHAA 2IRWA 3M4NA 4W5OA 3ROKA 2DJ5A 1KGSA 1YOBA 3CS3A 3AUYA 4DBZA 4GEKA 4M0DA 5LR6A 1SCDA 1E32A 4KL8S 1Z0KA 4KQWA 2GEVA 4G5HA 1NK8A 1ZL2A 5KDOA 3DT6A 1MEEA 1RI1A 5KYXA 1K7XB 1GZ3A 3FAKA 5G53C 1JAHA 1HTWA 2X9NA 1WY5A 2ANBA 3GC6A 4IR1A 3EBPA 4POAA 1R00A 1W85B 2WFMA 1G20E 1QIEA 1LLFA 4GXRA 1I8TA 4U9IS 1IRXA 1YBHA 2H1FA 3AY6A 3BWYA 4KE8A 4F5PA 4YJHB 4CDGA 2G3YA 2HWXA 1TCVA 3LGAA 1C29B 2YVUA 4INZA 4PGMA 1ZOIA 3ABQB 4PRYA 4RNMA 1J0EA 2EH9A 3F5SA 1C30B 5BUQA 3TQIA 3DGEC 1N7GA 1XNQB 1JE0A 2G5HB 2UUPA 1BQEA 4S1VA 1NJ6A 1YK1A 3KQOA 4J6FA 1IC6A 4RQ2A 3OQVA 3QKUA 2QVLA 4EECA 1FDSA 4GVLA 3CB2A 2FR0A 1ANKA 3FTCA 4FMCB 3N53A 4O3QA 3U4HA 1QK5A 1XWFA 3C5EA 5LDHA 4B3FX 4P2BA 3VDXA 4YY3B 3T4PA 1K8XB 3RRMA 2D2VA 2QKYA 4EHHA 1T0PA 2ZRLA 4QASA 3Q1LA 3TEMA 1BRMA 3GFFA 5JV5A 4CM5A 1M6YA 5C3MA 2CLFB 2QI9C 3DAFA 4JELA 3A3PA 5C1DA 1N7IA 5CVDA 4RTRA 4KW7A 3NTQA 4D43A 3JPOA 4HNGA 4IOKA 1V6SA 2PTHA 3IAFA 3PCTA 4K5QA 1KVQA 1S01A 3F47A 3H9JA 1BVHA 5F2KA 3DLIA 5KNDD 1LRKA 2QD1A 4X66B 2GPJA 8AT1A 5MGNA 3MFIA 2O7SA 1V5FA 2OB1A 1HQKA 1A4UA 3EW7A 4DQKA 3PO4A 2Y76A 1GNRA 1PWEA 4I55B 1M66A 1S6YA 3UEOA 4UAGA 4EVSA 4WOCA 3O3MB 1YDEA 3V4OA 3J81A 3IAM1 3THWB 4QBTA 2WF6A 3W5VA 1LPSA 4LVSA 5B37A 2BISA 4F92B 4O4IA 5FWYB 4J1TA 4GXIA 3VZBA 3G0IA 1GAXA 1NL3A 1OB2A 1X7WB 5E6UA 3WRXA 2MU1A 1ZJZA 4JLSA 2COUA 4Y9SA 4WA8A 1E2UA 4GGPA 1MT3A 5K1ZA 3OO1A 3U3XA 1J0AA 1EBFA 3DPUA 3OKPA 3EPJA 1EFAA 5HP4A 3UJDA 2GQ0A 3VTFA 2ZUEA 4QZFA 2IH2A 3C3JA 1CR0A 3IXQA 2IYAA 4UEKA 3QU4A 1GPJA 1U7OA 4MA5A 3R09A 4U6PA 4X54A 5I7FA 1KK0A 4UMFA 2GYUA 4F04A 1EP9A 1FYFA 3V2HA 3WMFA 1C7ZA 1NVTA 3PENA 4AXBA 4HFNA 1C0PA 1HEYA 1Z2AA 4BVAA 4D4GA 4BV2A 4BLQA 3DOOA 1E7RA 1Y7TA 5HUJA 3VVMA 3H0CA 2LHTA 1ZAKA 5P8WA 3CO5A 1KDTA 1FIUA 5JLJA 1ODIA 2PVPA 4DWWA 3A4VA 2F3SA 4M0FA 3MILA 4Q7EA 1KERA 1NTOA 1YU6A 1TAMA 2W2KB 1JG7A 2ZYGA 3KOZA 3CGGA 3OIUA 5F7ZA 3SDSA 3MERA 4ID9A 4H27A 3WL8A 2VLBA 4XVRA 4AS3A 3QU5A 1PCXA 2ETVA 4RD3A 3C3XA 2PRZA 1Q5PA 2GSDA 4M0UA 4JVOA 3KV3O 3RV4A 1KO4A 4C7KA 1U04A 4LJ9A 9LDBA 5HM6A 1IV8A 2WM3A 4XSGA 3CLHA 1XSEA 4L27A 3WWPA 2ZPTX 3KOWA 2PJDA 2WQ6A 3HRDD 4DQLA 5DNUA 3DP7A 3DQZA 3EIUA 4MCIA 3ZDCA 2XCTB 4HEA6 4HN2A 4RTLA 4G01B 4R8UA 3CN9A 1NLUA 4A4DA 4RTMA 4Q5IA 4J3JA 1EVLA 4JENA 3VKHA 1VSUA 1CR2A 2CJWA 2ZRIA 4N6NA 4YJFA 1E2IA 2P30A 3SN6A 2XRZA 1HQYE 3H65A 1BMTA 4LK3A 4PX5A 3KZMA 4JYMA 5BQFA 1ZQEA 1G7TA 1KF0A 2C7OA 1AB6A 2G04A 2O50A 5K3CA 3ELUA 5KCMA 2WYHA 5AJTA 2FE9A 2JAWA 3BWVA 3O9MA 3FSJX 4RKWA 1GL6A 2WAAA 2H1VA 3KZKA 2QX9A 3GEMA 1TOAA 2ZBRA 2GEJA 3CW2C 4B3TB 2P4UA 1E2MA 3VZPA 1EJ6A 3L2OB 4MQEB 4WK0B 1GVHA 1L7XA 1K5GA 5DCYA 5AW4A 5DLYA 1IJEA 1POXA 4MV0A 3HZRA 1TCUA 4CMKA 3F5MA 3FVRA 2VZ8A 1DJLA 2O7NA 4PC7A 4K7JA 3FPLA 2V6JA 1G2OA 1XQYA 1DJOA 4CF7A 5DQIA 2YX1A 3NHKA 4MW4A 3TVTA 1RHRA 1UJNA 1ZXIA 4AK9A 1GPYA 3FJYA 3JATA 5A2GA 1BDBA 3LKDA 1OGYA 3ZWPA 2QN9A 4B79A 2AG0A 1RJGA 1CDDA 3AHFA 3DMTA 2BBSA 5DHFA 5FTJA 4DRZA 4E5NA 1NFRA 1ZQUA 5DKFA 3RFAA 4ECXA 5L3SA 2BOVA 2V5UA 3G2PA 2PLNA 3FIJA 1TVCA 1CB0A 2FOIA 4IJ5A 3TIIA 2FZWA 3NAGA 3UO8B 4LC1A 2PUGA 5CB8A 4P7KA 3D3QA 3E27A 2D3DA 5F7JA 3OD1A 4EPTA 1GY8A 1U1CA 3IFSA 1QH9A 1KA9H 1V8BA 3FETA 1J2JA 2OHOA 3N2GA 3WGVA 2VK8A 1UKZA 3D1JA 4LBZA 4NENA 4Q7MB 4UCQA 3HP1A 1P4GA 3FSRA 5DNEA 4ARVA 2JHDA 4DIBA 4KFTA 1H0HA 4QPNA 5G4LA 4IPTA 3TSAA 1NVUQ 2C07A 3U3ZA 3ADCA 4L75A 4DA4A 3N2LA 4V2IA 2JGDA 2VC2B 2XI4A 4AKSA 2HMVA 3R9KA 3WO0A 5IC4A 1JKJB 4HMOA 4BQNA 4WXHA 3I0MA 4JV2A 2EGHA 4F4FA 4LWOA 5ALYA 3T12A 3VKUA 5JALA 3LIPA 3JQFC 5F9LA 3FCAA 5BUZA 2OV8A 3BGDA 4RK5A 3NWBA 3QVJA 2KOBA 1ID8A 3U44B 3CKKA 2PGOA 3WL3A 4BRZA 4Z4HA 2QR2A 2QG9A 1SUWA 5L7YA 5KU1A 4K2AA 5KTNA 1QG2A 2KI5A 2DQYA 3E81A 1QYCA 1E0AA 1J25A 3RH5A 2O8DB 2Q5IA 3ITNA 4R64A 3L6BA 3GP5A 3SZ2A 1MJ5A 4MX8A 5EERA 3OE4A 2EEPA 4ENWA 4DA6A 4OJNA 3SXUA 2E1FA 1C41A 2ES6A 1T3SA 1R8XA 2BKXA 1IMOA 3QFFA 3RAXA 3TLEA 2DR3A 4DPKA 4NM1A 1W8DA 1COOA 3LWLA 1EQAA 1N1MA 1R5BA 4QC2A 5BURA 2J3HA 1XHFA 3P4YA 5CDTA 3D31A 2OQRA 1TEZA 5KG0A 3CCBA 1HLGA 3GJXC 3SBDA 1PJTA 5HF9A 2BZSA 1LC0A 4J49A 1ZVKA 3AL3A 4C30A 4EHNA 2WMYA 2HBLA 4US1R 4YASA 5CFPA 1DXYA 1IY9A 4LVOA 4C04A 5I51A 1YONA 3HCRA 3AR8A 2VHTA 1PE0A 4JR0A 5JUMA 2XY5A 1TIKA 4JWKA 4AJEA 5JECA 4NU0A 3VAAA 5TX7A 1OFVA 4JNKA 4Q39A 3UIEA 1LQ2A 3R7LA 5B64A 3IV7A 3DDZX 4WSOA 2QRGA 4MR8A 3JASB 5CVJA 2KHVA 1EQUA 4B1FA 3RARA 3UQZA 4TM8A 4L7QA 1ZITA 4DQIA 4RENA 1U0OC 3IBSA 4YJ2B 8ICPA 1H94A 2IE8A 2K5UA 4CM3A 3DEJA 5IKEA 3OE1A 4HYKA 2AWNA 4JBXA 4KTTE 2PX4A 4RLSA 3GLGE 2HNBA 4HF7A 1IXSB 5BV1A 2X4IA 3LDAA 2Z6VA 3UTDA 4F3YA 2RH9B 4W6ZA 4BNNA 1VLJA 3A2MA 3KQPA 4LF9B 5LD2C 3RPEA 1KY3A 3WMRA 2ODAA 1EFRD 1P6UA 2H5LA 7ICHA 3KSDO 4O5KA 1QYWA 3IKJA 1Z45A 3Q41A 1PR0A 4M9SA 1L5LA 3U7IA 3HS3A 5JSHA 2EP7A 3B38A 4WCVA 4UTXA 4HDKA 1L3TA 5ARCA 1LK7A 1G5PA 3O1JC 5KFCA 2AN1A 2BWJA 4MCAA 2B37A 3LQKA 3OAAD 4JJZA 2ZT5A 3H2JA 4E22A 1C8KA 4RSHA 3ADDA 4QFMA 4V2UA 5B66U 2X22A 3DLPX 3PIIA 4L3OA 4X1KA 5JT1A 4CEHA 1PZFA 1CJVC 1KYQA 2GD2A 1D9DA 4FD3A 3B8HA 4C89A 2R5FA 1KQFA 5CT8A 1XVTA 3UAOA 3RUIA 3ZGXA 1VGQA 2OD7A 4K81B 4RKRA 2HOFA 2X0JA 2ZDGA 4FYXA 4DLWA 1NLMA 4KR3A 121PA 5T4HA 4I28A 2P40A 2VYCA 1X1EA 1RIFA 2C3UA 2I1QA 3JQQA 1GQQA 4I8IA 2QRVB 2TMKA 1J2NA 3ELYA 2WKPA 2Y0PA 4A8PA 4DWIA 4MK4A 4RKQA 5HFAA 5FYDA 5BWLA 2ZSUA 3I04A 3I61A 1JALA 1Q11A 4M36A 4IS3A 4BCDA 1LBTA 3D1VA 2WF5A 3NOQA 1T0HB 1Q46A 8ICGA 1NN1A 1QGZA 2HYDA 2GN8A 4QDZA 2H11A 4CGYA 6YASA 4OLJA 2C2XA 4CIAA 2V03A 1CW2B 2LTAA 1E3EA 4F9GA 1T6BY 1WJGA 3DSRA 1TVEA 1QCCA 1X7DA 3H2SA 3JQEA 5FPPA 2SKCA 4D0LB 1NQUA 3OZCA 5D3KA 5F33A 1CRZA 3NBXX 3ABRB 3LLUA 4G1EB 5HIKA 1GFSA 1VL5A 1OXKB 5LYJF 3R3HA 4FZLA 4I2HA 3MTBA 3OUUA 4TWZA 5E4FA 4HNTA 2JFBA 5CDUA 1XR3A 1A5TA 1SCIA 2XCOA 1UPTA 3L49A 4P32A 4QYSA 5E95A 3I28A 1UK9A 1QG0A 5KPDA 5EVJA 3SY8A 2YS7A 1U5BA 4JROA 2CL7X 1MTZA 3NIGB 1S0VA 4H31A 4K9QA 5C1BA 3T35A 2Q1XA 3KQQA 4F4JA 3A1TA 1SB8A 4M1WA 4CKEA 4PCUA 3JCZA 1R74A 2OK7A 5H0IA 3NVVA 1BFKA 4H17A 4MLDA 1AVTA 1TECE 2WILA 3RS7A 1TD1A 3PYXA 3ESBA 2HIMA 3PFNA 1H65A 2RHLA 1PSWA 1I2ZA 1XEXB 2OCAA 2XOKD 4U6QA 4V0SA 3TOZA 4INJA 2UYGA 5AM5A 2VG8A 3IR6A 2VIIA 1S2DA 3KPUA 4IX9A 2Q5FA 1Z7YA 2HDWA 1UMCA 2QPOA 3PNSA 1ZO8A 2EJVA 4DAOA 3WXBA 1CVLA 4KQJA 3WBJA 2HV9A 4ZD6A 3HO6A 4WXPA 4DUGD 2Z5VA 4L5JA 2FOLA 5AJWA 3A6PC 2CCJA 4I9NA 1QIGA 3KQVA 1ZDMA 2QX7A 3R6TA 3ZE1B 5JSZB 2D6FA 3LUCA 3RG2A 1S77D 1Q1GA 3IUEA 1T9GR 1EA5A 2CL5A 2P9FA 2JC3A 2BCJQ 1KDHA 2VJNA 4W7IA 1Z6YA 4C5BA 4QZHA 4QPPA 1WXWA 4O02B 4JXZA 4Q47A 2ID7A 4TTVA 4R8VA 3CRXA 4L15A 2XICA 2FZ5A 4WZZA 3N0RA 2BUBA 3CM0A 5GV8A 2E5LB 5B7PA 1D1PA 2OV6A 1EBBA 2AYXA 3QMMA 4HDMA 4L0MA 2BHTA 2WSLA 3I4FA 2ZS8A 4OJKA 5HHHA 4QPZA 4DOBA 3VPCA 3IP4B 2AJQA 5D3ZA 4LZAA 1LEHA 1KHTA 4TXJA 1BDHA 3I32A 3FB4A 1N8NA 3BE6A 4NFLA 4Q9AA 3EY9A 3QEBZ 2I87A 5C52B 3CF6R 1CUGA 1QGDA 1SUPA 5HZHA 3ONFA 3CLVA 1DAIA 2EWVA 1Z47A 1E6KA 1DE0A 4ME6A 3RJ5A 2ZTSA 4QOGA 5E6RA 3PC2A 2VYVA 5F7XA 2M6KA 5ESWA 4EUNA 3RFCA 1NXSA 1QFXA 4FWBA 4RL4A 1EUZA 2WSYB 3DUFA 3KR9A 4AQDA 1X70A 5FPKA 4TL6A 1XMJA 1ZJMA 2QD4A 1N9GB 4WNAA 5IM4A 2PXIA 3EH1A 7ICJA 1XI2A 2F1IA 3OJSA 4DSFA 4O3NA 1SB3C 7ICSA 1IHXA 2N3ZA 5CJ7A 2IW3A 3GWZA 1UH5A 1I5RA 4PG4A 4LF7B 1Z0UA 2JH1A 4GSYA 1J8VA 3OZGA 3N4MB 4IAOA 4MUBA 3T52A 3TNJA 3MR5A 4LRYA 3T4XA 3VPXA 1MOZA 4N03A 5E6UB 4L2IB 5TEWA 1RZUA 3O2JA 1T91A 2ODGA 3A1CA 4UB3A 4F2SA 1EGQA 1NGSA 2JKZA 2PKYX 3G02A 3FUCA 3GFQA 4YMIA 4CKBB 3EK2A 5JH7B 5EJ4A 3Q0IA 4HWOA 4P4NA 5BSWA 3FZEA 4QXPA 4ZO4A 4FMCF 4EATA 4YRGA 1L7AA 3IG8A 4B40A 2O05A 3FMOB 3EPLA 4XSVA 2BGRA 1JDPA 3D8RA 3CEMA 1UT5A 4A0RA 3IIJA 3A58B 2MTBA 3A9TA 2A0WA 3JD0A 3K8OE 3Q5DA 3Q7IA 1OHHD 4BB5A 1FVHA 1B22A 1NXXA 1UP6A 2ONYA 3FNIA 3GRRA 3H0EA 2IKSA 1EHYA 3QVGB 5TQJA 1TMOA 5EEGA 4FDVA 4UQOA 2JLRA 2JKYA 3RCBA 4Z4IA 1NWCA 2QLTA 1WF3A 1HL7A 2Z3VA 2BN4A 4LZPA 1MH1A 5JS2A 1KI8A 2Y0SF 1O6ZA 1JI3A 1IONA 1K7CA 2OZLA 3GW8A 1ZQDA 4EZ9A 4DMLA 3UPTA 1DV1A 2OFOA 4P36A 4YAOA 3ZXYA 2J5KA 1EFPA 1YA6A 4L5IA 4CCSA 4CCYB 1FDUA 1S2OA 1Y1QA 3R7WB 1UOPA 1WLSA 5DQGA 2O0KA 1L1QA 3PW4A 3G5MA 1LD3A 4JBYA 3EZFA 4BN4A 4DLAA 4GPEA 3WHLA 4FGWA 4RKFA 3DLTA 3LG2A 1T5BA 1MIOB 3L6UA 4FFNA 3HDJA 1XQWA 3V7JA 2IUTA 3B20A 2ZIAA 3OFSA 1JQAA 2Q4EA 2QJOA 2HXSA 2HX1A 4LRTB 1LC3A 4RW0A 1E96A 1VSBA 2FR1A 1Q6YA 3QU9A 2VPYA 1ZH6A 3TZCA 3USZA 4YUWA 1DIRA 2ZJFA 3KDSE 4PC2A 1NMZA 2B2XA 3DMHA 4RGQA 4AS2A 3E61A 4BAGA 4B71A 3D5EA 1VL6A 2HO5A 2ON6A 2I4LA 3Q8LA 3WGLA 3ESRA 3OFKA 4OBEA 4B9SA 4NOMA 4Q82A 2PPVA 3KKKA 5DNWA 1HK7A 2VPPA 3KJIA 4RY2A 2PYIA 3MNFA 4Y30A 2VDMB 5ITZB 2AEJA 3KJNA 1L5MA 3W78A 3PXCX 4AYXA 2BFMA 2VLIA 3KC2A 5J2TB 1G9TA 3CYMA 1NK9A 3DV9A 1OZAA 3ZWXA 1G1MA 2FG7C 1KORA 2Z7JA 2FPWA 3OEYA 5CD9A 1YF3A 1VKHA 1T3NA 3L3BA 1OF1A 5KOJA 2IYPA 3SSAA 3EGEA 3I37X 5DW3A 1RYSA 3K9LA 4FYJA 3T1NA 4JHXA 1EX6A 4JKIA 5A4JA 4JP2A 1KY4A 4G3XA 1FNMA 4HH0A 1UF9A 1D4OA 4IS7A 4RPJA 1X9HA 4OQXA 4N48A 2IHBA 4BP9A 4J9MA 1K3FA 2BUCA 2HMTA 2XMBA 2Y1DA 1U7DA 3GUZA 1GGNA 3PUVA 5BT9A 3OURA 1X7ZB 3OX2A 4X90A 4EGSA 5M5BA 1RWVA 1S4QA 3B0YA 1Q2UA 3P9SA 1QMPA 3BUSA 3JARB