1UA1A

Structure of aminofluorene adduct paired opposite cytosine at the polymerase active site.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua1A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua1A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua1A01
3IHQB 4Q45A 4FLUA 3LDSA 1COOA 1FKOA 5KG2A 2YV0X 4E19A 1CXUA 5J2QA 1TK0A 3KK3A 3BQ1A 5KFBA 5I3UA 4K4HA 3EPIA 5KFQA 3GV7B 3MEDA 1VSFA 3NBPA 2D0CA 3DM2A 2PFOA 3QEWA 3RB3A 3PUFA 2BCVA 3C1ZA 5KFAA 3HYFA 4OPKA 2JZBA 1ASVA 4FJKA 1GOCA 2X74A 3SUOA 4YR2A 4KRFA 4B9SA 5DMRA 1RILA 1S6PA 3QINA 4MEYA 3G6YA 3OSNA 4ZTJA 3ZT2A 3CG7A 3EW9A 1C0TA 4QAGA 5HROA 9ICCA 4C8NA 3HPOA 4IR1A 2W9MA 4CHNA 3UQ0A 8ICZA 4DTUA 4TUPA 4KLHA 4GLXA 1JLBA 9ICRA 5KFLA 4YMOA 3V9SA 4MFCA 2ALZA 4ED1A 5DBCA 2FBXA 2JGUA 4LH4A 1S1VA 1RT3A 4Z6FA 2V4RA 2LSNA 1RT6A 3T1AA 5DGAA 1HJPA 1Y88A 3WNHA 4E89A 5KG6A 3C2LA 3ALYA 4F2SA 1CZ9A 1W9HA 3S3NA 2RKIA 2BCRA 3NGDA 5KFWA 5HRRA 2C2RA 1NK7A 4IQWA 3AVBA 3DLEA 3HPGA 1V9PA 3K4GA 3QLHA 5DG8A 4F50A 3LZIA 4LVSA 1UOCA 2ZTDA 4NCGA 3RH6A 8ICJA 1U49A 2FLLA 3SV4A 3SI8A 4BDZA 2Q0ZX 1RBUA 3QZ8A 2FPKA 1LV5A 1S1XA 4AHSA 2Z1JA 2IHNA 4KTZA 3C94A 5I42A 1ZQXA 4RQ3A 4C8OA 1Q9YA 2XGPA 4CK1A 4O44A 3PO4A 3ZSQA 3TARA 4I2EA 3RJKA 4NYNA 3SCXA 4R64A 1LAWA 4M3ZA 4EP5A 3AUOA 3ZT1A 2VA2A 4GXKA 3MDAA 3TFSA 3RR7A 4J9SA 1D5AA 1RDCA 2FLNA 4O3NA 4O55A 1XHXA 4M42A 4ECUA 3OYFA 4W5OA 2VWKA 4M3YA 9ICFA 2VG6A 3H7IA 5HP1A 4CE9A 3K2PA 1S1WA 4KLDA 1YVUA 2UVVA 1BIUA 4KKOA 9ICBA 1S9GA 4HHTA 5EWFA 3I0RA 4C8LA 1XHZA 4CJSA 5CP2A 4KLMA 3GFKB 4UBCA 3B6PA 4DQQA 4P4MA 2ASDA 4RQ5A 5CJ7A 3T5JA 3C1YA 2YKMA 5KFDA 3QNOA 1XWLA 1HNVA 4G3IA 1NOZA 2HHWA 5DBBA 4J9LA 3AO4A 3RAQA 1ZBHA 5IINA 5DDYA 3NCIA 1S5JA 4H4MA 1RDAA 1A5WA 3AA2A 4LD0A 3PW7A 3LZJA 1ZQOA 3ZSYA 2ZD1A 1RTIA 1JXEA 2R8KA 1KDHA 4DQPA 4R8UB 2G8UA 4DTJA 4RPXA 3VQ8A 4DTRA 1LWCA 3U3GA 3H8SA 4F8RA 3G0ZA 4G1QA 4E1NA 2R8GA 3TANA 5J2MA 5HRNA 1RCHA 3PW2A 4QZAA 2NRTA 5DK5A 4ICLA 1EX4A 3T5KA 3KJVA 4YFKA 1L3UA 3VA0A 4RW8A 3NAEA 4DMNA 3QEIA 2J6SA 3GIJA 1QHTA 4UAZA 7ICOA 4HVJA 4KI4A 2G8WA 4I9LA 1KTQA 5KFIA 5KT6A 3C95A 4FJNA 2HHSA 4BE0A 2HB5A 2KZZA 3HK2A 4KTWA 3AVNA 2FLPA 9ICJA 2ZUBA 3PX6A 4MF8A 3MFHA 1HMVA 3ZSVA 3HPHA 3L2QA 7ICKA 4FBUA 4R5PA 3QE9Y 5KG5A 4B9MA 3Q8RB 2BCSA 4W5RA 4NM2A 4F4XA 4IRKA 1QE1A 5T7BA 4M6WB 4QWDA 1ZQGA 1TVAA 2E6LA 3FYHA 4Z6DA 2ZQBA 1XSNA 1HRHA 3CFOA 8ICEA 5IIIA 3AA3A 2ASJA 1S10A 1ASUA 2ZJ5A 4YFUA 4QZIA 3MXIA 4KLUA 5CYQA 1YTUA 1LAVA 2UVWA 1BVSA 3OYGA 4PGXA 3PR4A 4ED3A 1C7YA 1O1WA 2IGIA 3GIIA 2JEGA 4DF8A 3Q8QB 3LWLA 3BQ2A 3BQTA 1ZQDA 3PR5B 8ICRA 9ICMA 4OKJA 4EZ6A 3H08A 2R8JA 4KREA 1B22A 1KFSA 1RT4A 3RB0A 3KKSA 4FW2A 5DB6A 2IHMA 2IBKA 4EBEA 5CWRA 3PV8A 8ICAA 3V1OA 3TAFA 1Q9XA 9ICVA 4NLZA 4ED2A 1RYSA 1TL1A 4Z4IA 7ICLA 3L2WA 8ICWA 3MXMA 3C21A 4Q44A 1RTJA 5HMMA 3ZT3A 1UA1A 3B6OA 3KLIA 4F4KA 4DSJA 2RF2A 3G6XA 1RXVA 4HCCA 4MQ3A 3OYCA 9ICTA 3OGUA 4XUSA 5EWGA 3P5JA 3PX4A 2X6NA 1D8YA 1TKXA 1J5OA 4CJWA 2G8IA 3ZT4A 2A1JB 2DTUA 3H4DA 4F5OA 2MUTB 4BWMA 4F5RA 1U47A 5CYMA 2XY8A 1SL0A 3RMAA 2OWOA 4I9QA 1DLOA 4MFFA 3RJHA 3SNNA 2XC9A 3H8JA 3LP3A 1JXLA 5J2KA 4YXJA 3JPRA 1TKDA 4CF8A 1IXRA 1EETA 4Q5VA 1NJWA 3JPQA 2PY5A 1RT5A 1WAJA 4M3XA 5KFOA 1XI1A 4CJQA 3TAPA 3K5MA 1ZJMA 4ELTA 2W9BA 2XHBA 1EXQA 4KI6A 4FS2A 2OPQA 2VG7A 3T19A 3LALA 5KT5A 1NKEA 3ZDDA 3OHAA 7ICIA 4YR3A 4B9TA 4RUAA 1ZQVA 5HMLA 4ELUA 3UPQA 3RMDA 3GIMA 1KSPA 3E01A 3QESA 3Q8PB 3KLEA 2R8IA 3HT3A 2FC0A 4K4IA 1TKTA 4DSKA 5J2JA 1KFDA 2ZE2A 3RJFA 1S9EA 1W0HA 4EP4A 2QK9A 1N5YA 1RTDA 1TK8A 3MEGA 1IM4A 4F5PA 3TQ1A 3V81A 3ASMA 3PO5A 5DLGA 4UAYA 4J9KA 2YNIA 5DG9A 2KN7A 2F96A 9ICPA 4B9LA 3VQBA 1BPDA 5D3GA 1X1PA 4DTPA 5HLFA 1B9DA 1RT1A 4RW9A 3ISCA 4LZGA 5J0QA 4IQTA 4DFJA 1X9WA 2BDPA 1C0UA 4RG8A 3ZSXA 3ZD9A 8ICPA 4FJIA 3C6TA 4M9LA 3MFIA 4YG2A 3Q8LA 3SQ1A 1RBSA 2AJQA 4TQSA 4H4OA 1QS4A 2BGWA 2AGOA 1ASWA 4N76A 4UB4A 4IR9A 1QTMA 2BPGA 3H4BA 4AH9A 1X2IA 2VANA 3KTQA 1RNHA 1BPYA 4FXDA 4KLJA 1WAFA 2JZBB 4ECWA 1JLFA 8ICQA 3HW8A 3K58A 3AVJA 2KZMA 5KI6A 3ZCMA 2YHAA 4KLOA 1C1AA 4O5EA 4RNOA 4C8MA 4O3QA 4XA5A 5C5JA 2XY6A 4UB5A 3ZD8A 5C42A 1KCFA 4AHCA 3NGZA 3DLKA 2BHNA 5TZVA 1MC8A 4UB1A 4XIUA 4ED0A 3HP6A 4Z6CA 4FBTA 1KEJA 5DKWA 5DBAA 2Z1IA 3MECA 4UAWA 4DOCA 1TK5A 3M8SA 4PQUA 4UQGA 1NKCA 5KFPA 4RT2A 4HUEA 4FZZA 4FJ8A 4M3UA 4M04A 1RT7A 5C25A 1SKWA 3DLRA 3QEPA 4IQVA 5KFTA 3OJUA 3M9MB 2XY7A 5J2PA 4PHDA 1HJRA 3ZDAA 3RJEA 5J29A 4CK3A 4FK0A 4YMNA 4RNNA 4OKEA 4FS1A 1BGXT 3JPSA 1C1BA 3BJYA 1WCNA 5KFUA 1F21A 4DFPA 3G10A 4FK4A 1IKVA 4O5BA 3OYAA 4CHZA 4KB1A 4CERA 5JS2A 4OGCA 3AO3A 3HP9A 2W8LA 2QKBA 3QNNA 3RTVA 2Z1GA 4DSLA 3DRRA 4YCXA 4HTUA 3M9NB 3PNCA 4J2BA 4M9JA 3OS1A 5E41A 3QIOA 4F91B 3M8QA 2BANA 3JPTA 4I2JA 8ICGA 5J2NA 2X6SA 4CJ3A 1RDBA 4NLNA 3C5GA 5KFFA 4RPYA 1WSHA 4DL5A 4CFDA 4UBBA 3HVTA 1XU4A 3HO1A 1FXXA 1HPZA 4TUQA 4CF9A 4GXJA 1RXWA 5J2HA 2PYLA 1U45A 2W9AA 3L8BA 3RB4A 1RBVA 3EPGA 4Z4FA 1ZQNA 1C0MA 5KFGA 1ZETA 2UVUA 3TWHA 4RQ8A 1BQMA 4JV2A 4I2QA 4RZRA 4QW8A 1HQEA 4BE1A 2P5GA 2F1HA 1WSGA 3D45A 4C8KA 1T7PA 1JIHA 2FBYA 1BPEA 2I1QA 4CHQA 5KFYA 3LWMA 2AQ0A 4F4YA 1S0OA 1B92A 1JXBA 4FLXA 1ZQLA 4R63A 4PGYA 4ECSA 1IH7A 4O0JA 5J2CA 2V4QA 4DF4A 1D9FA 4E7LA 4NM1A 3V9XA 1ZQEA 4NLKA 2PXIA 3IS9A 1XSPA 4PHEA 3OVNA 2PFNA 4IG0A 3VQCA 3NH0A 2HVHA 3L3VA 3V6HA 5KFRA 1JMSA 4F2RA 5HP4A 5J2AA 4E7KA 5HHIA 4J9QA 4TQRA 3C2MA 3DYAA 1UWBA 4YVZA 1VSHA 3CFPA 3SUNA 3AU2A 2ISPA 3AO5A 5KRTA 2PI5A 5KT2A 4IDKA 3OYLA 5BOLA 4JUZA 4DQIA 1ZQTA 4IBNA 3KD1E 4M3TA 1KVAA 3UXPA 4CEAA 4B9UA 3V6DA 1RZTA 1QLNA 1WNSA 2R7YA 4PY5A 3DRPA 5DB7A 2JLEA 3F73A 3MGIA 1RT2A 4B08A 8ICVA 4R66A 3NGYA 2VWJA 1VSIA 4NXZA 3NDKA 4DG1A 4OKKA 2ZTEA 1TVRA 5JS1A 1MU2A 5BOMA 1U9LA 4BACA 1JLEA 7ICHA 1VSEA 4KLLA 4XRHA 3HWTA 4M3RA 1DTQA 3V7JA 5J0XA 7ICQA 3ZDCA 4KITB 7ICEA 3WNFA 4ECZA 4QWEA 4BE2A 5IIOA 4E7HA 4QWBA 2E6MA 9ICEA 1BCOA 4CEEA 9ICSA 4CEDA 3NGIA 1RBTA 4YD1A 4N56A 3RRHA 2P6RA 1MQ3A 4JV1A 4O5CA 1N6QA 1ZQZA 3PY8A 4BXOA 2B5JA 4JRQA 3NH1A 5KRSA 4FM0A 4AHTA 3KLGA 1QSLA 3OHBA 2RPIA 3NF9A 4CEOA 3BQ0A 4RQ1A 3O3HA 3RH5A 1ZQHA 5KFEA 4M3WA 4CECA 3KIOA 4CFAA 2BKEA 5FDLA 4MFBA 4CFCA 4M0AA 8ICNA 3AVMA 2HW3A 1R0AA 5KFSA 1JLAA 4ECTA 2BR0A 4QWCA 7ICJA 1WSFA 4EEYA 3SQ4A 8ICOA 3FFIA 4IG3A 4Y1CA 4CJPA 1SKRA 2C2DA 4BGDA 1AROP 3AVHA 2I9GA 4YMMA 1JN3A 4P4OA 3VQ5A 4J9NA 4QZHA 1VSKA 3OYDA 2P66A 4CEQA 3OYBA 9ICQA 1A77A 4DOBA 1NOMA 3LPTA 2W9BB 4DL3A 4CJ5A 4KHQA 3M8RA 3AVAA 1BQNA 4LSNA 3CQ8A 5CHGA 4HYKA 3PX0A 5HRPA 5KG4A 4UB2A 1ZQMA 4RQ0A 1LW0A 4CK2A 2JEJA 3GILA 2XY5A 1SV5A 4M47A 1NK0A 1S77D 1HNIA 2GBZA 2F8TA 1HQUA 4I2DA 4KPYA 4M41A 4B8AB 2V9WA 3JPOA 1ZQIA 4ID5A 5CY4A 4OJRA 5IIKA 5KFXA 3MXJA 5KG0A 1BPZA 4CESA 4IFVA 1ZQKA 1UA0A 4KLFA 3QEBZ 3H40A 3AO1A 1UT8A 5FRNA 4F3OA 1HYVA 4PA1A 3DI6A 1JX4A 4I2BA 2JEIA 8ICUA 4I2IA 3NF8A 3S9HA 3AA4A 5L1LA 2OPSA 1VK0A 4KLIA 3SQ0A 3ITHA 3C23A 4JWNA 1WLJA 3ISNC 3PW5A 3VN5A 3O3GA 3SQ2A 3UXOA 4DQRA 4M45A 4FJLA 2KTQA 3PW0A 1Z26A 5CZ2A 1ZQFA 1HYZA 1LW2A 3SPYA 3TFRA 3JPNA 1NK6A 3BDPA 4NCAA 1YT3A 3LP2A 4NYFA 5J2IA 1Z00A 2RDIA 2QXFA 5J2EA 1SKSA 5L9XA 5KT4A 3LAMA 3EY1A 3V7LA 2OZMA 2IA6A 8ICBA 5EWEA 3HSTB 2FPMA 3OYIA 8ICHA 2EX3A 4ECYA 5EOZA 4DL2A 5J0TA 3RWUA 3OJSA 5KFNA 2XCPA 1CLQA 1FK9A 4KLSA 2D5RA 3MR2A 3RJJA 2XRIA 1WCLA 4FJXA 5FROA 2IAJA 4ECRA 2WOMA 1ZQSA 4Z4GA 1Z25A 5BPCA 3TAEA 2AQ4A 1Z3EB 2VA8A 4YR0A 4N5SA 4FZYA 3SYZA 2Y1IA 2PYJA 4CGGA 4FLVA 1FKPA 3OSPA 1TL3A 4I2HA 5J2BA 3OYMA 3GDXA 3PMLA 1REVA 1PZNA 9ICLA 2BQUA 2BPCA 5KFVA 5HNKA 4RNMA 1KRPA 3K5NA 4LY7A 3V9UA 2B4JA 3MR3A 4MFAA 2R8HA 3DMJA 2ZJAA 4DS4A 4I27A 4CJFA 3JSMA 4JWMA 1ZBLA 4BWJA 4W5QA 2LYHA 1QQCA 4CCHA 4I7FA 4F4WA 2G8HA 1S1UA 4ZH4A 4N47A 3CM6A 2W9CA 4F5QA 1L3SA 3DOLA 4FO6A 3OYKA 2G8FA 4CJRA 4QZBA 1X9MA 3H8WA 4K4GA 4OGEA 4I28A 2M9NA 1S0MA 2YNHA 1KLMA 3MGHA 4QZFA 1TAUA 5IIMA 4CEFA 3WNGA 1IKWA 5DQIA 3GV8B 3K57A 4FJHA 4I2CA 1XS9D 4EBCA 4MEXA 4DOAA 4FLTA 2GWSA 2XCAA 1BPBA 4PHPA 1ZQAA 1CZBA 2O4GA 4J2EA 9ICAA 2NRVA 4CGHA 3QIPA 3EZ5A 2G8KA 4QZDA 2AU0A 5F9NA 1L3VA 1TFRA 1BI4A 2P5OA 4PWDA 4RW7A 4GC7A 4TUSA 3O3FA 3HX0A 4E0DA 4YD2A 2KW4A 4BDPA 7ICRA 3MAQA 4CGIA 1CXQA 1ZYQA 2YHBA 3ETLA 1U48A 1J53A 1GOAA 1ZJNA 4QWAA 3V6JA 4J9OA 3MR6A 3T5HA 5KT7A 4FJ7A 1A76A 3PW4A 1EXNA 3L2VA 4O5KA 2J6TA 4CIFA 4CHYA 4JRPA 3AO2A 3KK1A 3QEAZ 1X9SA 4F93B 4KHNA 3AV9A 3CYMA 2DFFA 5L1KA 1XC9A 2OZSA 1ZQUA 2OA8A 1D8LA 4TURA 1LB2B 8ICMA 3KLHA 9ICIA 4DU3A 3G6VA 4CEZA 5DB8A 1JLGA 1EKEA 3KK2A 5KFCA 4ELVA 2D0AA 5KG7A 1BCMA 3VQ6A 1YTAA 4RQ6A 4H8KA 1K1SA 3BGRA 2W42A 3AA5X 4IKFA 3QO9A 1D9DA 1DGSA 1ZQWA 4J9MA 4DU4A 2BGGA 4QZ8A 2NRWA 5K14A 3OS2A 2BQRA 2G8VA 2RN2A 1IKYA 1HUOA 1N48A 4LZDA 2DPIA 1I3AA 1VSMA 1TAQA 4KTQA 4YP3A 2YNGA 4FVMA 3WNEA 3RBEA 4AHUA 2ATLA 5DQHA 3OYNA 4K8XA 1QSYA 4CEBA 9ICNA 1WN7A 2FMSA 4EBDA 3RRGA 3V9WA 4MF2A 3RB6A 8ICYA 4QCLA 1NOYA 1TGOA 4RW6A 4B9VA 2IOCA 3DLBA 2IS3A 1EP4A 1JKHA 2E4LA 4FW1A 4QZGA 1DTTA 4KLGA 5CA7A 4FLYA 3CFRA 4PH5A 4KFBA 4O0IA 4OPJA 3IM1A 1K1QA 3NH2A 4M2YA 4KHUA 4TSXA 3S3OA 1VSJA 4CJLA 5KFHA 1UAXA 1VSLA 4J2DA 1QSSA 4GC6A 1HYSA 2OYQA 4DTMA 3KD5E 7ICVA 4PGQA 1S97A 1BPXA 4QW9A 4ZTFA 3SUQA 2WONA 4JLHA 4P4PA 4F3TA 1I39A 2NRZA 3ZDBA 5SWMA 3VQEA 3ZT0A 4DTNA 3IG1A 3L3UA 2ZUDA 3Q8MA 1NJZA 1SL1A 2ZJ8A 3V72A 3I8DA 4J2AA 4Y1DA 3VQQA 4KAZA 2FMPA 4ZHRA 7ICSA 3KLFA 9ICHA 2GUIA 3EYZA 3HM9A 3O4NA 2Y1JA 4CJ4A 2FBTA 2HHVA 4BXOB 4JS5A 3L2UA 3O4QA 4CJVA 5L1IA 1LWFA 4ED6A 3AVLA 2D0BA 1U4BA 4Q8FA 7ICMA 4L8RB 4EZ9A 4F4ZA 8ICKA 3C5FA 8ICLA 3C2KA 3SJJA 2KZ3A 2AGPA 1RDDA 2Q3SA 5J2DA 4NY8A 3DLHA 4ED7A 4GW6A 4YNQA 3QZ7A 3ISBA 5L1JA 3FDSA 2A1SA 4DTOA 4O9MA 1SZPA 1KVBA 4KB0A 2W8KA 1VRTA 1C6VA 2C28A 4ID1A 3PVXA 3V9ZA 2FMQA 4DL6A 5CR0A 4KHSA 4IRCA 2HNYA 4Q8EA 3SI6A 2DY4A 4FJJA 3NF6A 1BL3A 3JYTA 5KFKA 4DS5A 1JLQA 7ICFA 4AHRA 3TI0A 3K5LA 3QEXA 2B21A 3ISDA 5D49A 3RMCA 3KHHA 1MQ2A 1IO2A 4NLGA 3VA3A 1ZQPA 3SUPA 2ATQA 4E7IA 1IG9A 8ICXA 4FJGA 2MAXA 4XQ8A 1MSWD 1H38A 4CJUA 1S6QA 4B8CA 2IDOA 4J9RA 4DL7A 3T3FA 4ECVA 2F1IA 5IIJA 3LAKA 2KFNA 4I2FA 5DG7A 4P2HA 4E1MA 4KMUA 5DLFA 1S76D 3VQ4A 2C22A 4DU1A 1T05A 4RQ4A 9ICWA 3VQDA 1G15A 4YN4A 3TAQA 2X78A 4O3PA 5D4BA 4CGDA 7ICUA 3L2RA 4M9HA 3C6UA 4KV8A 4Q43A 3Q8KA 3AVCA 3RH4A 1CEZA 4ED8A 3N4MB 3TAGA 3TABA 4PUOA 3LK9A 4OVLA 3K59A 3V7KA 2ISOA 9ICXA 4GMJB 1CUKA 4NCBA 5DB9A 1A5XA 9ICKA 4FZXC 2BPFA 4X5VA 1N56A 1T3NA 1T8EA 3UIQA 4CGJA 4DSEA 4OLBA 2RDJA 4Z6EA 3B0YA 1SL2A 1BISA 2KFZA 3DOKA 8ICFA 3KKRA 1A5VA 4CGFA 4AILC 1ZQRA 4Z0UA 1Y97A 1SUQA 1RYRA 3NHGA 1BHLA 2P6UA 3K75D 4PHAA 1NK5A 3RAXA 4I2AA 4F5NA 1Z00B 3LANA 4RU9A 3THVA 4EYIB 2OPRA 3IRXA 2BE2A 9ICGA 4I2GA 2PI4A 5J0YA 4QZEA 5J0UA 4FM2A 4O3SA 5DQGA 4DSIA 4HUFA 3MEEA 1IKXA 3KHLA 2C2EA 2HHQA 3F9KA 4RPZA 2HHXA 4FJMA 3HVRA 2GV9A 4PPXA 2FBVA 3RMBA 2ASLA 3RR8A 3EWAA 1KVCA 3VQ7A 5D46A 3P83D 1B43A 4CJKA 4O3RA 4ECQA 2ZUCA 4Z4CA 3QERA 2H5XA 4IQUA 1NK4A 1ZQCA 3IAYA 4CJEA 3JPPA 4RQ7A 4RQ2A 2AGQA 3HJFA 3T5LA 1NK9A 2Z1HA 5JUMA 3OYEA 3VQ9A 1ZBFA 4O4GA 1S0NA 1UT5A 1T03A 1K6YA 1BIZA 1NJYA 4M9GA 7ICPA 3V4IA 3RJIA 4JS4A 1ZQYA 3ZSOA 2XO7A 3U6FA 2HVIA 4R8UA 4IFYA 1ITGA 2XGQA 4DLEA 2HHTA 1S1TA 3LPUA 5DDMA 1J9AA 2ZTCA 4DO9A 3P1GA 1WSIA 2W9CB 3K5OA 5DGBA 4DFMA 5CB1A 4DSFA 1XSLA 3AVGA 4FLWA 3D0PA 1JL1A 4DTXA 4GXIA 5F9LA 4IRDA 1J54A 1DOQA 3RBDA 5J2GA 1ZBUA 2VA3A 2A1RA 3V1RA 1L5UA 9ICOA 3ZSRA 2JEFA 1ZBIA 4WE1A 4CIEA 4HCBA 5J2FA 4O3OA 3HXMA 3NFAA 2B6AA 3ULDA 4DFKA 8ICTA 5J1EA 3PMNA 1ZQQA 7ICTA 1RBRA 4CFBA 3QETA 9ICUA 4FK2A 4FCYA 3AU6A 1BI4B 3GIKA 4I2PA 4N41A 5FRMA 1NKBA 2O4IA 4R65A 4ECXA 1NJXA 1S0VA 1WSJA 3HL8A 2BCUA 4CF2A 4M6WA 3Q8SB 4KLTA 3M9OB 5KFZA 4JV0A 1TKZA 4AHVA 8ICIA 2HHUA 1RPLA 3LDAA 2EHGA 7ICNA 3I0SA 3LP1A 4BDYA 1WSEA 5J0SA 3AVFA 2FPLA 4CHOA 5SZTA 4DTSA 1U04A 4B3OA 2PFPA 3GV5B 4DL4A 5KFJA 4K8ZA 1ZQJA 4FJ9A 4KO0A 1XO1A 2UVRA 4E3SA 2IC3A 2NRXA 4EYHB 3NF7A 1KLNA 3KHGA 3ZDEA 5KG3A 3SZ2A 1Q8IA 4I29A 4CF0A 3VQAA 2IMWP 2P51A 3AVKA 4GVMA 5C24A 1NK8A 3KHRA 3SPZA 2NUBA 1T4GA 3LP0A 5KFMA 4FLZA 1L3TA 5J0RA 2OPPA 5EU7A 4QZ9A 3ZSZA 2PFQA 5J0OA 1C1CA 3VQPA 4J9PA 5CZ1A 3MR5A 8ICSA 5KT3A 2F8SA 2DFLA 3V1QA 3E2EA 5J0WA 3N97B 1JL2A 4YQWA 1GOBA 3RJGA 3MABA 4M9NA 4W5TA 4FM1A 2A1JA 4RW4A 1KFTA 1TV6A 3B0XA 1HUZA 4LH5A 4Q0BA 4FYDA 5HBMA 4F92B 1B9FA 1JLCA 2MUTA 4DLGA 4RT3A 2VG5A 2P1JA 4CF1A 3QEVA 3M8PA 4E7JA 7ICGA 2PZSA 2YKNA 4KN7A 4JK1A 3ORYA 5HHHA 3V6KA 2KQ2A 3CM5A 2DFEA 4DQSA 4QOZB 2WTFA 4Z4HA 4OLAA 5KGXA 4CHPA 4HUGA 4CJTA 3TR8A 1LWEA 4Z4EA 3SV3A 5KG1A 3OS0A 4KHWA 3MBYA 2ETJA 2F1JA 3ZSWA 3DRSA 4KHYA 4LSLA 1RTHA 3NTUA 1TV9A 3OY9A 4YXMA 2HMIA 5J0PA 5HRSA 4W5NA 2DFHA 2I5JA 3OYHA 8ICCA 2QKKA 2BQ3A 4CIGA 3DLGA 4RUCA 3OYJA 2ITGA 3U3YA 4FJ5A 2HNZA 5KGWA 5KTQA 4DWIA 4KN4A 5IILA 1VRUA 3A2FA 3UXNA 3AVIA 3UQ2A 4B9NA 3NE6A 3S3MA 2YNFA 2J6UA 4UB3A 4KLQA 3MDCA 1VSDA 2DPJA 4DEZA 3TAMA 4QZCA 2HNDA 2BCQA 1S9FA 4KLEA 3GQCA 1ZQBA
chains in the Genus database with same CATH superfamily
1RA6A 2VFSA 3AB4B 1P1TA 3LDSA 3J81O 2ZH9A 3CVKA 1CXUA 1YJWS 2OGUA 1WOQA 1R8AA 3BQ1A 5KFBA 5I3UA 3EPIA 1FRJA 4JI6F 5HMYA 3CEDA 3NRBA 3VQTA 4OMFG 5HR6A 2CQPA 3PUFA 2YJEA 4PL1A 1Y5NB 4OYPA 3H59A 4FJKA 4C0HA 1GOCA 3SDEA 4DV6J 4KRFA 3ETRA 1TUVA 5ETKA 1FERA 2P9EA 3OSNA 4ZTJA 3ZT2A 3CG7A 2HVDA 2G06A 2A2CA 4IR1A 4CBWA 2W9MA 1I3OB 3WQPA 4CRJA 1FF2A 3MMCA 4KLHA 1Q5YA 5E5NA 1JLBA 1TR0A 3WIVA 1RA7A 2LXUA 4DUZJ 3AOCA 1ILYA 4ED1A 1HR0F 4HAIA 1M5VC 2FBXA 1R31A 2LMIA 3Q8UA 4LH4A 1S1VA 1RT3A 3FE1A 3R9PA 2P9SA 1AUDA 4MN4C 4BREA 1Y88A 1VISA 3JAMY 3ENHA 1HNVB 2M88A 3ALYA 1MN7A 4F2SA 2D4WA 1CZ9A 1KWMA 2RKIA 3HHLC 2BCRA 4S0MA 5KFWA 4LFCJ 2QARB 1NK7A 1VC0A 3PACA 1V9PA 3CJ5A 3UKRB 5DG8A 3FK4A 5F41A 5B0AA 3RH6A 2MZRA 3SQGA 1U49A 2YXLA 1B0TA 3GYXB 2VJ4A 3ID6A 1JROA 3SV4A 4LMZA 1ATNA 2Q0ZX 2DHXA 5AZIB 3A5NC 5IV4A 2VIXA 2JVOA 2QV6A 1WHYA 1VJ5A 4RQ3A 4CI6A 1ZAXA 4TU8A 4CK1A 4LJMA 3ZSQA 3R5BA 1Q81O 3OVSA 2OPRB 4DV3F 4M3ZA 3MTJA 3TFSA 3RR7A 1NDPA 1DQ9A 4O3NA 1LKYB 2NPFA 2QLXA 2JC1A 3D4JA 3D3CJ 5BREA 3C16B 4DR7F 3ZZOA 4LFAJ 3H7IA 4DV6K 4QS7A 1S1WA 1WC1A 2UZAA 2FI1A 4UB8U 4CLUA 4MDBA 4KKOA 4J90A 2O8EB 2D8CA 3GJQB 4IQMA 4C8LA 4CH0S 1T9WA 4OZ5A 4ZDNA 1F2HA 3KUEA 4BCAA 4KLMA 1T3OA 2EBEA 3B6PA 2EZXA 4CNQA 5ALIA 3WKBA 1YJ9S 4DUZK 4P4MA 3M7VA 2PFFB 5CJ7A 4WCEQ 3WEEB 4JV5J 3O2IA 4GNIA 1F9FA 1NOZA 5DBBA 1SV0A 3DKDA 3DGVA 3I87A 1MWKA 1PAEX 4H4MA 3AA2A 4XEIA 4A5BA 1JQGA 3ZSYA 4U6PA 1KDHA 4DQPA 4NZ6A 2CFXA 1RT4B 1IR2A 3DRXA 1NAQA 3H8SA 2VODA 2QL9B 3G0ZA 2ZC3A 2VOOA 4E1NA 1P6TA 3ZZTA 2LI6A 1I94F 3CNHA 1OJ4A 2LM4A 2Q4TA 5HRNA 5E7OB 4OJHA 3PW2A 4LQ3A 4AQYF 7FD1A 3KJVA 4YFKA 3KLIB 4CBUA 4RW8A 2ABYA 5E3PA 1QAIA 1ZA2B 2GV1A 2J6SA 2BE9B 5AT1B 5K9FA 4WIQA 1MA9B 3F5TA 2F4FA 1F5AA 4LFCF 2MLZA 2LYAA 1FE4A 2Q0RA 1ZD4A 2JX2A 2OD4A 2EFPA 4KGXB 2G9OA 4LRAA 4KTWA 1X6JA 2GNKA 2HOEA 9ICJA 1HMVA 3ZSVA 3HPHA 1Z2LA 4ZLPA 3I96A 1WOPA 3TZZA 4IO8A 3T1YK 1EX8A 3M1VB 4WP9A 3CCRS 2VC1A 1QE1A 1TZ0A 4LFAK 4QWDA 1VQ8S 1TVAA 2YMLA 2QA4S 5T7LA 2QW9A 3CERA 4TVAB 4A57A 2ZQBA 4Z6DA 3VHQA 1YX2A 2RE2A 1KAYA 3EUNA 3OV7A 3WKCA 3CCSS 3AA3A 5ALDA 5A2QU 4FWKA 5ALZA 1U1LA 2ASJA 2PAVA 4BRKA 3LM9A 2ZJ5A 1ZTWA 4YFUA 3MXIA 1CLFA 4MK7A 3HJVA 3AHPA 3SXLA 1HARA 3OYGA 3PR4A 4QPXA 4A8KA 2IC3B 3EGNA 4M5GA 3UW1A 3QIDA 2JEGA 4WP3A 1NJIO 1F5CA 2KHOA 4EAHD 2IRYA 3D2NA 1SQEA 3AXMA 4JV5K 4ZITA 1JCGA 2KVIA 2R8JA 4KREA 1B22A 2P9LA 2EZYA 2DISA 3SCIE 1Q86T 5C24B 2X3GA 2ZDOA 1N8RO 1KAZA 2UXDJ 2XMVA 3NASA 1F0XA 3QGHA 2YHXA 3R27A 2Y1RI 4RLEA 1RYSA 1TL1A 4RBVA 7ICLA 4O8UA 5HANA 3RF9A 2LYBA 4ZKAA 3ZT3A 2DHHA 4W98A 3G6XA 4DR5K 2Q1NA 3OYCA 5C2CA 3CT9A 1RB0A 1WJ9A 3P5JA 4CWBA 3OLAA 4CJWA 2G8IA 3ZT4A 3D6MB 2A1JB 3C15A 1TMJA 4URGA 5E0OA 1U8WA 1JLCB 2R7RA 2ZH4A 3KDNA 3FBFA 1LK5A 2B8PA 2XY8A 2ZUAA 3R2CJ 4YOUA 5J2KA 2E8PA 2Q0UA 2DT9A 1TKDA 1T44A 4CF8A 4Q5VA 1E4GT 3AOAA 5AE1A 4DB3A 2ZOFA 1UFLA 1UZDA 3N5FA 4I1TA 4MTPA 5CZVA 3PLAA 4DFDA 2OKQA 2PT0A 2W9BA 5A8WB 4A8WA 4E1JA 4JI2J 3T7ZA 1TL5A 4HKQA 1RJJA 4FPRA 1EB0A 4H54A 3DRSB 1PYOB 5KT5A 1OO0B 3I32A 2BEFA 1MA7A 2YJFA 4IC9A 5HMLA 4ELUA 1TU0B 2D9OA 3RMDA 3GIMA 3E01A 1NSQA 4UOGA 2MQPA 2FC0A 4RNHA 1SI9A 4EP4A 3RJFA 5AIBA 3KG4A 4HTIA 5DLGA 3QNWB 3VETA 4JI1K 1OWXA 1VRUB 4A8XA 1COKA 2I1RA 4B9LA 2BJ9A 5FPMA 2MSSA 1BPDA 2UXDK 2I6WA 5C12A 2L41A 5G5GA 1RT1A 4MKYA 2F9WA 4RW9A 3ISCA 2VKZG 1JNZB 2CA9A 4X84A 4IQTA 1C0UA 2RU3A 8ICPA 2BMBA 4LF8K 4M9LA 3MFIA 2DNHA 3RBZA 3HKZC 3Q8LA 3W8GA 3SQ1A 2J7UA 1RBSA 1FKOB 1MWQA 3TJ9A 2Q6BA 4LREA 1G3OA 2AGOA 3KKFA 4UB4A 4IR9A 3DN9A 2C3UA 3DM2B 2VANA 1BUXA 5KAKA 3KTQA 1FEEA 4JYAF 4BRGA 4ZS6A 3O1BA 1NEEA 4FXDA 2HFZA 2RQ4A 4KT0C 4ZIVA 3ZCMA 4KLOA 1OMSA 1T95A 4O5EA 2YWKA 4JHDB 2EC2A 4O3QA 5C5JA 4X64J 3ZD8A 3HVTB 3I82A 2HLTA 5M1KA 2UXBJ 4OJGA 4OX9K 3OXLA 4AHCA 2ZIWA 3NGZA 2KKPA 2G07A 4XIUA 4ILLA 3H25A 4ED0A 3HP6A 1XMOJ 2RP5A 4Z6CA 1AA1B 4JI2K 1KEJA 4NA3A 2DHAA 3MECA 2N3LA 3R5AA 3IGNA 3TSQA 3M8SA 5JTIA 4PQUA 3TSPA 1UQVA 1NKCA 1CJVB 4BRDA 1FJGJ 1RT6B 2WSCC 2JWNA 1HWLA 2ASYA 4M04A 2F8KA 4CDIA 5CH7B 3VZIA 3DLRA 2ZIVB 1FNXH 2W04A 2MY8A 1DXSA 1P8GA 3ET6B 5K8NA 2OP5A 4NLTA 1CJKA 3O9QA 2EKYA 3KUHA 2KOBA 5GTHU 2B0GA 2A6AA 3QLHB 4RNNA 1R8HA 2F7TA 4M7YA 4OI0A 2YY6A 4NL9C 4KB1A 2LEAA 2B7BB 2ILYA 4OZ2A 3D1QA 3TA1A 2QSWA 2RHQB 5JS2A 3RGIA 3VR1A 3N6MA 3AO3A 3HP9A 1SCJB 2HMXA 2WVEA 3RTVA 3C65A 4YCXA 4USJC 3PNCA 1J2NA 3D0HE 2AYBA 1YKWA 1SC4B 4DV5J 4F91B 2DEJA 2BANA 3JPTA 4OYOA 1YJNN 1MROB 5BR9A 1ZC6A 4F4AA 1VK3A 1V4SA 1JJ2M 4DV7F 4BVOA 3DCAA 3CUNA 3JSYA 3H0RB 3HO1A 2VJ5A 3W2WB 3TP2A 1V5IB 1HPZA 1F6TA 1FEZA 4CLFA 4JKBA 5HVFA 2R7TA 1S9GB 1TQLA 1RWPB 2UXBK 1WF1A 3DDHA 1WKLA 2BW7A 2YWFA 4RQ8A 4NLVA 1N2XA 3BKFA 2C1EB 4JV2A 1U0SA 1S72S 4EMDA 2P5GA 3HHLD 1Y10A 1NPRA 3DXMB 3AAPA 1JIHA 4I0WA 2I1QA 4CHQA 1FJGK 3GSIA 2FTRA 2BW2A 4F4YA 1JXBA 2O8FA 3H2LA 3D2WA 2ZJQL 1ZQLA 5FP0A 4PGYA 1IH7A 4O0JA 4X64F 2V4QA 3KOAA 1D9FA 2A19A 1LWCB 1K8AT 4NM1A 3WX4A 1VC5A 3ELHA 3IS9A 3NUQA 4G1QB 4PHEA 1XMOF 2B4PA 3OVNA 3QT7A 4E98A 2BZFA 4DUTA 1DAXA 1RWVB 3MD1A 2KJVA 5HP4A 2ADBA 3QFWA 4J9QA 2VV5A 1U2VB 2C3OA 3DXSX 1KD1O 3T6JA 4JOUA 4UAUA 2V0NA 3QAUA 4MFBB 2MQQA 3GU0A 3AO5A 2XSJB 1L3KA 4IDKA 1OH7A 4JUZA 4AXJA 3KZBA 5HQMA 5JICA 4IKAA 1B70B 1YITN 1EAYC 4BRMA 3UXPA 4B9UA 1R3NA 3V6DA 4ID8A 1BMQB 4GV3A 4R5PB 3CQXA 4MLHA 1S48A 1RM6C 2R7YA 1GX5A 4PY5A 3DRPA 5ALWA 4BRLA 4B1YB 3MGIA 3NGYA 1RHKB 2VWJA 1X5OA 1T9TA 4NV0A 2NRHA 1VLOA 4OKKA 2ZTEA 3A3NB 3CJ8A 1S4FA 3K8WA 4DV5F 1BQNB 4QIVA 4BACA 5CYQB 3WKEA 4KLLA 4XRHA 3HWTA 1IN0A 3MMAB 3THWA 4GVBA 1PJ5A 3ULHA 3W5XA 2IBOA 2GC8A 3IR7B 4QWBA 1FESA 9ICEA 2E6MA 4UZBA 4LBPA 4MO5A 2QB0A 2DGQA 3RRHA 2RUSA 1MQ3A 3G4SN 4BXOA 1BQXA 5K5MA 2B5JA 3D2FA 3H0MB 1QQNA 2DNKA 1WBDA 4DU7A 2D1CA 4FM0A 3KLGA 1HQ2A 1RTJB 2RPIA 3E1YA 3I56S 2IMOA 2OMOA 4RQ1A 3HD1A 3BM7A 4PAAA 2CVEA 3O1WA 4CFCA 4M0AA 4X62J 2V7ZA 2FF3B 2HW3A 2HQGA 1JLAA 2ODGA 3J80Y 2R7SA 2KIWA 4EEYA 4LF2A 3IBCB 2EG1A 4URSA 4IG3A 1ZD3A 3D2QA 4TY8B 1R8BA 4CJPA 4C1NK 4HH1A 4LC9B 1NMDA 1BU6O 3FCVA 4NLRA 1Q8KA 4ANDA 2KJ8A 1NH7A 4RL1A 2W6LA 3TKAA 3MPWA 2MEWA 4QZHA 1QM9A 4B3SJ 2P66A 2K3KA 4NLQA 4X4VA 4BGAA 9ICQA 5H9FJ 4DOBA 1NOMA 3BPSP 4DL3A 4M5DA 4DR2J 1NGEA 4BC2A 1KC8O 4AUKA 3WKDA 1GLFO 2WF9A 5IQ6A 3JAMU 1LCUA 3PX0A 1HFEL 2OPQB 3HSGA 2K89A 5LSLA 4GVEA 4DJBA 4UB2A 5ADXH 1S12A 3LO3A 3H2UB 5KL1B 2PE8A 2OEHA 1Z4NA 1HD1A 2F8LA 2VKRA 3KLEB 1SWVA 3FQLA 3POTA 1TKTB 5LJWA 1RTDB 5KFXA 3J7Z5 3MCOA 1UFKA 4ITSA 2PDAA 1XN9A 4IFVA 4YB6A 2YNIB 3MGJA 4ETZA 2IOFA 3CC2S 2GIQA 5FRNA 1SH3A 4F3OA 1HYVA 4PA1A 4KH6A 3DI6A 2JEIA 3BS9A 2W3RA 2VFVA 3HD2A 2OPSA 3P31A 1XR5A 3BZKA 3ZX3A 3SQ0A 3C6TB 3ITHA 3VAHA 4WFBQ 2H4YB 3C23A 2HAIA 3DC2A 3ISNC 3H1VX 3AL0B 3PW5A 3VN5A 4H4OB 3PSTA 3SQ2A 3UXOA 2O8CB 2XS7A 3PW0A 1Z26A 5CZ2A 4KGZB 3THXA 4ER8A 5AK3A 3SPYA 3TFRA 4QIEA 3S1TA 3SCKE 2DPNA 4X62K 1JMTA 5J2EA 1A6SA 2E5LJ 2HRTA 3I55N 3LAMA 2V8PA 4P10A 3KKAA 3TUPA 2OZMA 4A8EA 2BVZA 3P4UB 3SFGA 1JLFB 5E2QA 1Z4OA 3TVKA 3OYIA 2VPWB 2E8AA 3CCLS 3OJSA 3D6HB 2IIRA 2N1RA 2LKYA 5GAEI 3MR2A 3VF6A 4FJXA 4F25A 6FD1A 1N32K 2KJWA 5AQZA 1RDUA 1JJ2R 4IOXA 5IT4A 1ZQSA 4P73A 5H9FK 3CCUN 1VHIA 2EW9A 4L74A 3J7AN 5BPCA 1Z3EB 3ZNJ1 4YR0A 5AZJA 4FZYA 5HK4A 2V67A 2ZZTA 1SC6A 5I4MA 2OD6A 1GLBG 2V8HA 3EICA 4U7BA 3QPIA 3OYMA 3W9IA 2V9KA 2CRXA 1PZNA 9ICLA 1T94A 2BPCA 5KFVA 3GB0A 3ENQA 1W25A 1TFWA 4B3SF 2B4JA 1ZBSA 1T0TV 2JLGA 2ZJAA 1FD8A 4DR2F 1TL4A 2VB6A 1QQCA 3HKZD 4I7FA 2JMGA 3D6RA 3WK8A 4F4WA 4ZH4A 4P6QA 4N47A 2W9CA 2G4BA 3THTA 3BH6B 3GIRA 1ZPWX 4YDXA 5L9NA 4QU6A 2GO7A 2JXJA 2G8FA 2DNOA 4CJRA 3AXKA 4K25A 4K4GA 4ZVGA 1IQTA 2CQHA 3MGHA 2IHR1 4QZFA 1TAUA 1A9NB 5DQIA 3C3LA 4LF9K 3K57A 3M8QB 3J8AA 1U1QA 2CXEA 3TYTA 4EBCA 1DGKN 4MEXA 2JFKA 3E51A 3UPFA 2J0SD 4DOAA 1O8BA 2E5LK 2GWSA 2MJNA 3PIPL 2CJKA 3P49B 2ZEJA 9ICAA 5CD4A 2G8KA 1V3ZA 2UUCF 3OLBA 4B1UB 5KAFU 2P5OA 2QI2A 2XIDA 4GC7A 3NAIA 4C3MA 3O3FA 2KJ9A 4EX6A 2R7UA 2B4VA 3SJHA 2XTJP 4YD2A 1VQ4N 3QU4A 2KW4A 5ETSA 1CXQA 4WQ4A 1ZYQA 1HBOB 3ETLA 1J53A 3I28A 4WFNQ 1GOAA 4QIWF 2CQ1A 3T5HA 4RBTA 4U8YA 2I2YA 4I6MA 3TA2A 1EXNA 4I2QB 3RFAA 3M2UB 4IEEA 4AYBC 2EVZA 2JNJA 5HN0A 3QEAZ 1MLAA 2ZJQQ 3JB9k 1X9SA 4Y2PA 3IP0A 1S7IA 4FYWB 4KHNA 3AV9A 2M2BA 3IFEA 3KDOA 5E3AA 1RWUA 2Y0SF 5D4PA 2OA8A 8ICMA 2WB1F 5DDPC 1ECWA 5DB8A 3MMBB 3KLFB 4FSVA 3FKBA 1SQFA 3CJ7A 3KK2A 4NEYA 3W63A 2VONA 2VCPA 5AQKA 2W43A 1K1SA 3BGRA 2W42A 5M2PA 3AA5X 1D9DA 3QFHA 2Q3PA 4J9MA 5IT9U 3CC4N 1U0HB 2KE7A 2AYEA 3B4MA 2G8VA 2RN2A 2QFIA 1HUOA 1GXTA 3KJFB 2DPIA 3QUBA 1S22A 1G99A 1TAQA 2HOIA 1UWBB 4TYAA 2HQFA 4KY3A 3CJBA 4P74A 3OYNA 4K8XA 4UY85 3P45B 2CQCA 5KNIA 3NVZA 1WN7A 2GHVC 1QQ6A 4MF2A 4DCOB 4QCLA 8ICYA 3QATA 4ALZA 4FFDA 2CQ3A 5H1SV 1CJTA 3M8YA 3OR2B 4RW6A 1FNOA 1FKAF 1WHXA 4E8UA 3J7ZO 3VCDA 2WAQC 3SAHA 3HZGA 3VGSA 1JLQB 2FDNA 2RQCA 4CO3A 5CA7A 4FLYA 5ETLA 3CFRA 5ETRA 1BC6A 2GQQA 3D68A 4M2YA 3EKSA 3HLUA 3NGSA 3TNVA 1VSJA 2OFHX 1UAXA 1B0PA 1QSSA 1JLEB 2HZCA 2OYQA 5IC4B 3KD5E 3BKUA 1RLDA 2J8SA 3ZX0A 1VBKA 3SUQA 4AXIA 4WTYA 2MLXA 4ZVHA 4HHUA 2OTJN 2Z0GA 1N4LA 4DTNA 1NZBA 3NY0A 1SIZA 2FSKA 3I8DA 2MKYA 5M1NA 4C6AA 3N4PA 1NG9A 4NXNK 2D69A 2GVZB 2E3TA 4CLKA 1DT9A 2HQCA 2VIHA 1WC3A 3DU6A 4BJQA 3MN9A 3HTVA 1HWJA 3L2UA 1LWFA 2J0QD 3CD7A 4EZ9A 3OR1A 3H2VE 2FJVA 1O08A 2Z4PA 2W3SA 1W2BM 5HQLA 4P0QB 3SJJA 3U4LA 4HT7A 2Q3SA 4NY8A 2F44A 1V38A 2GEMA 3MM8B 4ED7A 5ALLA 4YNQA 3RSEA 4FL9A 5FDLB 3R7SB 2K8CB 4DTOA 4J7CA 1YIJS 2CVIA 3OW2M 1R0AB 1EIYB 3VGTA 4L73A 3HHKA 1KBRA 1KOHA 4ZVOB 4K8RA 2FMQA 4DL6A 4KHSA 2R7VA 1RDFA 2N7CA 3PTWA 3NF6A 4Y2IA 5LMNJ 2KG0A 4FF3A 4LF7J 3K5LA 3I76A 5HL7Q 1KL9A 3LPYA 3W5ZA 1S99A 3N79A 3SK3A 2AJ1A 4XPEA 5D49A 1RBAA 5E79U 3RMCA 2RRNA 4TU7A 3DJCA 3OTBA 2AZ3A 4MIWA 2V2QA 1ZQPA 4QR1A 5B09A 3GCWP 1K73T 2NRRA 4HVZA 4FJGA 2XYHB 2FDRA 4B8CA 4J9RA 4YDDB 3T3FA 1SV5B 4ECVA 1YJVA 1EWRA 5IIJA 1HNIB 2APOA 4TU9A 4P2HA 4E1MA 4OYXA 2FGCA 4DV2F 2CDQA 1WYGA 2CZ9A 1RFQA 3VQDA 4FN5A 5ETNA 5D0EA 4O3PA 2X78A 3NCPA 7ICUA 1RHJB 1YLXA 2XMJA 4M9HA 4PKDB 4CZKA 4QYZK 2P9PB 3CDUA 4KB7A 3AVCA 3RH4A 4ED8A 3N4MB 2QARA 3TABA 4PUOA 2HHPA 4L72B 2HF4A 4ZIWA 3K59A 3MHYA 1N36J 3UKRA 1VJWA 1XEZA 4DZ6A 2NYVA 4O3MA 2Q31A 5DB9A 4DUYJ 9ICKA 3AA9A 5IC6B 2GX8A 4X5VA 1N56A 1ZD5A 1T8EA 2UUBJ 4I6AA 1BE4A 4GV9A 4CGJA 3F0NA 3MUVP 1SAZA 1IBKK 2DKZA 1TL7B 2Y3YA 5L8RC 4Z6EA 3B0YA 1BISA 1RGIA 2KFZA 4P71A 2JSXA 3J7YI 4Y2KA 3UNYA 1A5VA 3P5TL 3CIPA 1LW2B 3K75D 3KWMA 1R0CB 3LP2B 3RAXA 5JU5A 3GDQA 2W40A 2B4OA 2OPRA 3ZC4A 5J0YA 4QZEA 5J0UA 5LJ3Y 3CMAS 2VQFK 4FM2A 4H0OA 2K2PA 4FYVB 2IVPA 1PYSB 1IBLJ 3IM9A 3UFCX 1W7WA 4XTTA 4BC9A 2EWSA 4RPZA 3C16A 2D0PA 4FJMA 4LF7K 3M2VB 2JDJA 4HHJA 3OBIA 2HBYB 1VAZA 5C7PA 3M8WA 3OT9A 3EWAA 3CTRA 2FJAB 2XVTA 4O5FA 5F2RA 2CZVC 4PWUA 2GCFA 2E2OA 4ZMMA 1BNPA 1BA1A 4IQUA 4H5VA 4ZN1A 4WU2A 2K60A 3JPPA 1RP5A 3HJFA 2MHEA 3IO1A 3WEEA 5LMNF 1NK9A 1VQ7S 4NA1A 5E3CA 5ALSA 5HO4A 3PXGa 4EELA 2ADCA 1K6YA 1BIZA 1NJYA 4M9GA 5C10A 2M7SA 3RJIA 2WW8A 4CM0A 1R89A 3U6FA 2IY5B 1VLYA 2X7IA 3R2DJ 3LPUA 3VC8A 3ISND 1FWKA 2ZTCA 1GK8A 3PDNA 5F1XA 3LP0B 2O8BB 5DGBA 1XNRF 4F36A 4FPBA 1ESVA 5CB1A 4DSFA 2OPPB 3R7BB 4B6JA 1FRHA 4GO7X 3QYYA 3HVAA 2ZJRL 4I6WA 3O5BA 2VA3A 1IV8A 3IMXA 1L5UA 9ICOA 3MM9B 2JEFA 3C7NB 4AM7A 4KGKA 4N77A 5IQQA 3PIPQ 5CHCB 4O3OA 2YHWA 3VWSA 3ZFVA 2W25A 3S7RA 3A0IX 3FSIA 2AW0A 4EX7A 1N36F 2BKPA 2B9WA 4WP8A 1RI7A 1RBRA 4DUYF 2YWWA 3QIPB 1ZOTA 2G0JA 4OX8A 1J2VA 9ICUA 2UUBF 3EVOA 3N7PD 3AU6A 2WSEC 3GIKA 1K8KB 1IBLK 1M5KC 4ECXA 3M1VA 5AM5A 2QE5A 2DKOB 1HNZJ 3CXCM 1YITS 4H5TA 2Z30B 3M9OB 1DY3A 2AXTU 8ICIA 2KP7A 3QICA 1CC8A 3LDAA 4BDYA 3N7RC 4C7YA 3AVFA 4KQZA 2FJXA 1U04A 5GADI 2PFPA 3SMSA 2OHFA 1ZQJA 1KHVA 1XO1A 3T69A 2IC3A 1N5VA 3R5GA 2PFUA 4RR5A 1WI6A 4KH5A 5ALYA 4EYHB 1KLNA 3VEYA 1FTRA 1GLLO 4JI7J 1RGVA 1MDUB 1JLGB 2IMWP 5JVHQ 2P51A 4TKTA 4GVMA 3QU2A 5C24A 1NK8A 3IR5B 3MF5A 2RB7A 1VIOA 4K4XA 3FZMA 4FYYB 2ZWOA 3FVYA 1SV0C 2F5GA 4JKAA 3OPXA 2Y8WA 5J0OA 5K14B 4YY3K 5EGYA 2HOFA 3J80U 3LF0A 2HYIB 3TAMB 3CB4A 3U1MA 3GOIA 2DFLA 1GO3F 2M0GB 3E2EA 5J0WA 5IT9O 3VAGA 1HKCA 1YVFA 1GOBA 3ZTSA 4BR7A 2DIUA 2P9NB 4K42A 5I9EB 3P5BP 4Y2VA 2A1JA 2YWGA 1KFTA 4H0TB 4LH5A 1JLCA 1SH2A 3J81Y 4DLGA 1X4EA 1U24A 2YX6A 4RT3A 3QEVA 2R2UA 4Y6IA 5EHHA 3QWUA 2NNWA 2PZSA 1FCAA 3OW2R 5EE0A 4CLWA 3ADAC 1JKHB 3ULEB 2MZQA 4Z7CA 5KPRA 3BGUA 4XO0A 4UY8T 2RHKA 1VI7A 1UZHA 4QOZB 2VQEJ 1Q3UA 4FVCA 3I5BA 4OLPA 4AYBD 2BKNA 1LFPA 2IM3A 3OUYB 2Q66A 4P72A 5A8WA 3D2EB 4OD0A 5LXYA 1HNZK 3ILJA 1F5SA 3MBYA 2ETJA 5MLCV 1JLBB 2WCXA 3EGWB 5HSPA 2VBYA 3DRSA 3FEYB 2WONB 2JHEA 3BPDA 1NU4A 1WHVA 4DHYA 2OEJA 4NLWA 3IG1B 2CUYA 4NA2A 2YQ1A 2EFOA 8ICCA 2BQ3A 3ZI4A 3I31A 4JI4F 2FPHX 3IR6B 2PMZC 2G5HB 2V6AA 3G71S 3OYJA 5GIOA 2C2ZB 2ITGA 1EO1A 1H7XA 2C2OB 2G2YA 1VRUA 5AQLA 3A2FA 1JCFA 3AVIA 3KFWX 4V19J 4B9NA 2J6UA 4UB3A 1HBMB 4I6YA 4HEA9 3SQGB 2BA9A 4U95A 5GAEU 2GUPA 1TFYA 3W0LA 3IHQB 3K0JA 3AFGA 4YMEA 1COOA 3FBBA 2F9DA 1X40A 1FKOA 4P9SA 4E19A 1AZSB 2GZOA 5ALVA 4NLCA 1WF2A 5EUHA 4Y00A 1Q1KA 4JI7F 2WAQD 3GV7B 4RJVA 1NSAA 5ALQA 4DN9A 3DM2A 1WOSA 5F0UA 3RB3A 1UEKA 1IR0A 4OZ3A 2FJDB 4C3KA 5KFAA 3HYFA 1TE2A 2JRSA 2C3MA 4YR2A 3ENAA 2V8GA 5A0LA 2YHYA 2NXNA 3QINA 4JHDA 2K1RB 3OD2A 2CPZA 3I55S 3EW9A 2ZH5A 9ICCA 2IVMA 1NLKL 2VQEK 1MWZA 5GMDA 4A4JA 3WKAA 8ICZA 2IJFA 1H98A 5F8GA 5KFLA 4YMOA 2DIVA 2E5IA 4MFCA 3P3DA 5DBCA 1Y3JA 1DZ5A 2AX0A 3ZZYA 1O13A 2JGUA 2DF4B 5RUBA 5KOXA 4PXCA 4LSZB 2RAQA 4Z6FA 1CJVA 4PKHA 1RT6A 2HHHF 2CQDA 3ETMA 3T6BA 5DGAA 1V4TA 1T05B 3M5RA 4F04B 1NGDA 4E89A 2F4VK 2ZIVA 5CA5A 3LGMA 4JI3F 5LJVA 3LYSA 3UWTA 3ET6A 4OPAA 3S3NA 3NGTA 1F60B 4H4MB 4B02A 3D7EO 2NYHA 2C2RA 1EKRA 4IQWA 3AVBA 1QZ5A 3HPGA 3QLHA 3CDWA 1HW9A 3ZO7A 3EZWA 2VPYB 2E1RA 4X2BA 4J37A 3SI8A 4BDZA 2WVDA 2XHCA 5ELZA 1YZ7A 2FPKA 2Z1JA 1P9YA 4U8VA 1VDVA 3M6WA 3DOKB 3C94A 3ZZPA 1VBXA 2OJ3A 2AJ0A 4C8OA 4PPDA 5IS2A 3MPDA 4OZNA 8RUCA 1Q9YA 2K06A 1VHXA 3PO4A 5GAGI 2VWBA 1XNSA 4JKGB 2HBMA 3BYPA 4NYNA 3SCXA 1WC0A 3IRXB 5C15A 2DD8S 5GAHI 3QU9A 4RO0A 4CGZA 3ZT1A 4BHQA 2QWOA 1GAOA 2VA2A 4CBXA 3LDPA 3UMGA 5M1QA 2ILZA 5AKZA 4O55A 5AK6A 2ESEA 4M42A 1IKXB 2PMWA 2FC8A 3Q2SC 4FZMA 3VVTA 3MOZA 2VWKA 9ICFA 4G9ZA 2O01C 3W2WA 3K2PA 3MMVA 1U6BA 2CG8A 3KUGA 2W2PP 2QT7A 1BIUA 2D3UA 2BH1A 2WBRA 1S9GA 5IOLA 2ZH7A 4CJSA 1D09B 1JWWA 3N28A 3C66A 1B7FA 1GLAG 2KG1A 2QLTA 2OTLN 2XM3A 5FPDA 4RQ5A 3CXCR 4YEAA 3T5JA 3DXMA 3B6BA 5KFDA 4C0BA 4G3IA 4CNYA 1WDDA 3HT0A 4J9LA 1ZBHA 4NWBA 4Y2XA 5DDYA 2CADA 3NCIA 4FO0A 3V4IB 1ZQOA 1DK2A 5H1SQ 1V5VA 2HRYA 1JXEA 1VS3A 2I7PA 1YHQS 4IFYB 2G8UA 4DTJA 3VQ8A 1S1TB 1LWCA 2X3DA 4ZLJA 3U3GA 4M5JA 2YKAA 2BUPA 4K41A 4BRNA 4TNOA 4DPYA 4G1IA 3K1ZA 4G1QA 2YI1A 3CJ3A 3MPUB 1V85A 3TANA 1OQ6A 2ZJRQ 5J2MA 2YMMA 3LTOA 2VGMA 1RCHA 4QZAA 1GLDG 1G1XA 5AM2A 5DK5A 5D0RA 1NRKA 2FY8A 2HQ3A 1EX4A 1NNEA 1U2VA 1NNLA 4DMNA 4BG9A 3E8OA 2RNEA 3F5EA 3EJMA 4KI4A 4Y2JA 2Z58B 1SVDA 2XSJA 4W92B 5KT6A 2GVDB 2QG9B 4FJNA 5J1EB 2HMPA 2HHSA 1RAHB 3CIMA 2HB5A 3HK2A 2O66A 1JJCB 4ZCLA 2E8OA 2KKVA 4DV4F 3PX6A 1CS4B 2D3O1 3L2QA 1D8ZA 1YTYA 4R5PA 1NPKA 1FX4A 1I51B 4K2XA 3NCRA 2M8DB 3KZXA 3NVYA 2J8AA 1MMDA 4M6WB 3NVMA 2WFBA 4Z94A 1KW4A 3PG9A 3FYHA 1TKZB 4P0PB 3CFOA 3I0SB 5IIIA 1NM1A 3VESA 1S10A 1Q5VA 3QT6A 4KLUA 5CYQA 1LAVA 2YTUA 1BVSA 4PGXA 3MMAA 1C7YA 2W55A 2POKA 4UASA 4A8YA 4K0KK 4ED5A 5HATA 1U7LA 1ZQDA 3ILLA 2RMLA 3RBXA 1KFSA 5DB6A 1NHKL 1O6XA 2HVZA 2IBKA 5CWRA 3QAEA 4BQZA 2OTJS 2LDIA 1VQLS 4KHMA 3CD6N 1CI4A 1Q9XA 3GJRB 4Z4IA 2YX8A 3L2WA 2QWNA 2CPXA 4Q44A 1RTJA 5AQRA 3TACB 5AFUH 1D4XA 2GIRA 3F9MA 4DSJA 1N34J 5CE3A 1RXVA 2XNQA 2ASPA 3Q8YA 5E26A 4MQ3A 4F02A 1XO0A 3FSYA 2ACYA 3NGRA 3GJSB 3BZCA 1Y0HA 1J5OA 1HHQA 1JB0C 2DTUA 1TV6B 5U47A 4F5OA 1IUJA 1S8OA 2QYGA 4OZLA 1X6IA 2E5GA 1T6CA 5AM1A 2VG5B 3BN4A 5AXNA 3AD7C 4URQU 1F9HA 2KJ5A 2J9EA 2VASA 3SNNA 2XC9A 3L7PA 1JXLA 5A6PA 1SS6A 4NXMF 5AJ3J 4EHUA 2DBYA 3JPQA 4A46A 2RDDA 3GZ7A 1QH9A 1WAJA 4M3XA 3A13A 2X51A 3RAMA 3GYGA 4BC7A 4DPWA 2BJ3A 3EX7B 3TAPA 2ALYB 2QL7B 1PK3A 2ERRA 3QU5A 2XHBA 2YPZA 2IM2A 2W03A 3MUMP 2R7OA 3AJ2A 5BR8K 4USTA 1A0PA 4ES2A 2OPQA 2VG7A 2CNKB 3LALA 1VK8A 1U09A 1KOOA 3L4QA 1R59O 3AQFA 4B9TA 5BRFA 1VOMA 3J7YU 2MMYA 3Q8PB 2Y0BB 3KLEA 4PQUB 4LF5J 1VLBA 1VFJA 1TKTA 1KFDA 2VL1A 3UCUP 5EY4A 2ZM6F 3SBMA 2QK9A 2NXJA 1RTDA 5H9EK 3MN6A 4X66K 2UUWA 4FZVA 3TQ1A 3ASMA 3PO5A 3VF0B 2YNIA 4ED4A 1X1PA 4FE3A 1B9DA 4RQMA 5HMXA 1HNWK 5J0QA 3CO9A 4DPOA 1X9WA 3QDKA 5IT0A 3ZD9A 3KYLA 3EVMA 4MYUA 2FHMA 3C6TA 2A41A 2AHOB 1HNXJ 4ERDA 2AEJA 4TQSA 4H4OA 1QS4A 2O8CA 4KHPJ 1BY9A 3GE9A 2BPGA 4KYZA 1X2IA 1RNHA 1TYQB 1FW6A 4KLJA 2JZBB 3SMPA 1JLFA 4H4KA 1Z1ZA 1UPHA 4DZDA 3AVJA 1BDGA 1S6PB 5AE3A 2IYIA 1N34F 1XJWB 4XA5A 2CGLA 4NLBA 2EFVA 4UB5A 1U25A 2EAPA 1RAGB 5IZHA 1UVJA 3DLKA 6AT1B 1MC8A 4M95A 2KFYA 4O4RA 2JWLA 4DR1J 3L4BC 2QC3A 4BX9C 4C11B 1ZBTA 1OW5A 1OKJA 5DKWA 1FFGB 5DBAA 2YQEA 2J7KA 4DOCA 2PMZD 1NMNA 3AM9A 4HUEA 4FJ8A 3PYEA 5AJ3F 2JZ5A 4J9VA 1MWYA 4IQVA 4QS8A 5KFTA 3OJUA 1HLUA 5AQYA 1HA1A 3M9MB 2XY7A 4PHDA 4CE6A 3RJEA 1QZ6A 2FZKB 4HDHA 3FCWA 3VAFA 2CWXA 2PSZA 1UVKA 4FS1A 1BGXT 4AD6A 1F21A 5KFUA 4DFPA 4NCGB 1MWMA 5M2UA 5AKJA 4QR0A 1KBUA 1S1XB 3LM2A 2PKEA 5I42B 1EQ0A 4G1PA 4LF5F 4HH0A 2KYXA 2DR5A 4DSLA 2RLTA 3BS5B 3M9NB 4H5NA 4ZJOA 2GLEA 1FHTA 1HWKA 4IQXA 4LF4J 2DUYA 1YAGA 2CJQA 3M8QA 4KHPK 4I2JA 3N0VA 4AF1A 3JSBA 4IDKB 2X6SA 4CJ3A 3HJEA 4NLNA 4RPYA 1V9OA 1VYAA 4CFDA 4UBBA 3K1RB 3UD5A 3H90A 2F8EX 1ZOLA 4WTOB 2VG6B 1YZ6A 4DX5A 2MQLA 3WT0A 3FJ2A 1HNXF 2FVQA 1RXWA 5J2HA 3IM8A 1U45A 2PYLA 2W9AA 3KKAC 3RB4A 3EPGA 5K4LA 1C0MA 5IXUA 1HBOA 1Q53A 2X1GA 5AQSA 1GLEG 4DR1K 4I2QA 4BE1A 3M2UA 5AI8A 1WF0A 4C8KA 1P9QC 4WYBA 2HAFA 3D1OA 2AQ0A 1NSKL 3HKZF 3UDEA 2ZD1B 3AGKA 1RTIB 3X3UA 4DF4A 4YB7A 5AQPA 3MMBA 2LLZA 4RPFA 4FWSA 2PXIA 1X4DA 2J5AA 2V51B 2PFNA 2RJZA 2KSOB 2BX6A 4Y2AA 3NH0A 2IYGA 1VDHA 1WWUA 3DDKA 4ZP6A 2HVHA 1U0HA 1F9EB 3V6HA 4PPZA 4FWLA 1JMSA 2V7YA 4TQRA 1UWBA 4DR4J 4YVZA 7AT1B 3CFPA 2RILA 3US5A 3AU2A 3Q8VA 2CH5A 5L1MA 3SENA 3M6KA 2PI5A 1KKXA 3CJ2A 2E9ZA 3VENA 4DQIA 4I69A 4LFBJ 1ZQTA 4ZVTB 3QRPA 1VQMS 3OR2A 4EENA 2YKQA 4IJAA 2DWQA 3B54A 2NSBA 4MHVA 3P4IA 1O03A 4OYMA 4USHA 4YHHJ 1OY9A 1WNSA 4CP5A 3L9ZA 5DB7A 3BREA 1M1KT 1Q16B 2M5YA 1SJFA 3CJ1A 2L9NA 2ZOGA 3R6GB 2QLWA 2BJDA 3FM9A 4EI2A 2YH0A 1Y9OA 3U7JA 1NZPA 1T9VA 4M5DB 2KLAA 1D1UA 1EARA 3BKTA 3L7UA 4LF4F 1L8LA 1IBMF 5BOMA 1U9LA 1JLEA 1HUXA 7ICHA 4P7VA 2L9WA 1VSEA 4M3RA 3MTKA 1TTHB 2ZIXB 3V7JA 1NWKA 2RT3A 3FRZA 3BR8A 4BRHA 4KITB 4WQ4C 7ICEA 2ZG6A 1C20A 1UEUA 5IIOA 3POTB 4JKHA 1BCOA 4CEEA 4CEDA 4FF2A 2GVZA 3OFEA 4N56A 4TXSA 2DHSA 4O5CA 2DNGA 3PY8A 2WBMA 3UQSA 2MGZA 4P2MA 3P8BB 3BBFA 4JN4A 2OH2A 1ZD2P 4L3KA 3KLVA 3KJNB 1QSLA 3OHBA 4P0QA 4CEOA 2LP4A 3BQ0A 3RH5A 1ZQHA 1HD0A 2MPUA 2RRAA 5KFEA 3D54A 3MM8A 1CPZA 4K43A 2V5HG 4GKKJ 4CFAA 5FDLA 1D8BA 4AL7A 3W3SA 5GAEP 5DZ6A 8ICNA 1R0AA 1VQON 4FKYA 3BO4A 5KFSA 5DDOC 2WF6A 5A6WA 2RQKA 5CYMB 2BR0A 4QWCA 3KFUF 7ICJA 1WSFA 5B8HA 4JAXA 3QT8A 1DHMA 1QVFM 1DLOB 2QEXN 2F76X 2DR6A 4LFBK 1KEKA 1KQSM 1SKRA 4ZVPB 2VZ9A 5G0RB 5ADXA 1PC4A 2FYXA 3VQ5A 2G0AA 1PBUA 3NS1A 4YHHK 1GQEA 3WIUA 4EHTA 5T14A 4F0MA 4KBOA 1DFDA 3S6EA 4B3TF 4DR4F 2KICA 2LDYA 1UJ6A 2CGKA 1L7MA 4XH1A 1XR7A 3NNAA 5AM0A 3WBZA 4A61A 1I5OB 3RYLA 4RQ0A 3MPYA 1Z6RA 3MZIA 1H2UX 1Q8BA 3U8XA 5AZJB 2V68A 2XY5A 1SV5A 1WSVA 1FJ7A 1RWOB 1HNIA 4BY9C 1IQZA 2C2MB 3DFEA 2FZGB 4M41A 2V9WA 3JPOA 2RRBA 2ZE2B 4YHHF 4DV0J 5GAGU 5CY4A 5IIKA 2VFUA 4KIAA 5B08A 3MEGB 3MXJA 5KG0A 2Z2MA 1U26A 4CESA 1ZQKA 5GAHU 4WCEL 1UA0A 4KLFA 3JTOA 2B9YA 3VAJA 3H40A 3P38A 4AM6A 3R5DA 5D3GB 5HLFB 2HFNA 3G6ES 3MWPA 4DV1K 3AQPA 1ULRA 3WK5A 4UTGA 3VEWA 2UU9F 1BA0A 3NF8A 4M7XA 3AA4A 2AWZA 3PRBA 1U6ZA 4JD2B 4KLIA 5FLXO 1RYUA 1TL7A 2LCWA 1PSDA 1BWVA 1N61A 1EQMA 3O3GA 5AXMA 4DQRA 4NB4A 3I5CA 1HYZA 1LW2A 3JPNA 1X9XA 1KKHA 1NK6A 1R27B 2KHVA 4NCAA 3LP2A 4NYFA 5J2IA 2DXDA 4DR6F 2DCUB 1QQOA 4C2MA 1FXLA 5ETMA 2KNJA 3CCQN 5L9XA 5KT4A 3EDRB 4YN3B 3V7LA 1PCAA 2ZGYA 3Q86A 1NGJA 5AQTA 4GKJK 3HSTB 2FPMA 2V2VA 3UM9A 4DOZA 2HSZA 4KHRA 4IOCL 5J0TA 2QZ8A 1HWIA 2LA4A 2WRMA 4DCJB 1RAOA 1CLQA 2GW8A 4X65J 2NCKL 3V2UC 4NX9A 2M70A 2XMMA 2XRIA 2DJWA 1WCLA 2EDUA 3M2VA 3THYB 4GKKF 4X4OA 2V8VA 1FEHA 4Z4GA 1K0VA 1YRTA 1BNOA 1IG8A 2IIHA 3QFUA 2VA8A 4U7UD 3THPA 2E20A 2Y1IA 2PYJA 4CGGA 3OSPA 1X66A 1M90T 3F2CA 4I2HA 4ZJLA 1N5QA 2DQNB 5CABA 4BVPA 3C6AA 3GDXA 1RT7B 3PMLA 3NLCA 2BQUA 2ZFHA 4L76A 2XI9A 3U9DA 3K5NA 2F7VA 2KMDA 2D74B 2KT2A 4LUBA 4N7TA 5J2PB 5CRXA 4DV0K 4DPUA 4MFAA 2R8HA 4PABA 4DS4A 5KQ8A 2CN1A 3ICLA 4JWMA 1ZXOA 4L3NA 3LDOA 4W5QA 3VERA 2LYHA 3A3PB 2PBDA 2VDHA 2FJ6A 4ZPTR 1L3SA 1FWPA 2O8BA 2B0CA 4GY2B 5ALEA 4Y2YA 3S41A 3CO0P 4M63A 3CCEN 1SPBP 3DRRB 1Q0NA 3ENVA 4RQNA 4WFXA 4I28A 1V6HA 4PXBA 2LYVA 2VKQA 3MM9A 4CEFA 4QZVB 3C7NA 3MCPA 3CULA 1J2MA 4FJHA 2HBQB 1OS5A 3D66A 4ENOA 4I2CA 3E3XA 4BR2A 4V19X 4EGLA 5J2NB 4FLTA 1L7OA 2HK2A 4WPAA 2XCAA 4KJIA 1CZBA 3PJWA 1LNQA 4CGHA 3QIPA 1K8KA 2NSCA 4PWDA 4YB1P 3GE1A 1R6VA 2DGSA 3BF1A 4DX6A 2GO9A 4BDPA 3MAQA 2I8EA 2YHBA 2UUAF 2ZHOA 3A5MC 1ZJNA 4I64A 2PEBA 4B9QA 5KT7A 2GOLA 2CJBA 2YVSA 1P8ZA 3CIZA 2QTWA 4O5KA 3K17A 1U1KA 2HGMA 4CIFA 4JRPA 2BBEA 2KB2A 4BC3A 4Y65A 2H3GX 1LEOA 2FQQB 2OZSA 2GMLA 4X65F 3AOBA 1D8LA 4TURA 3CP8A 3I9ZA 2E66A 4DU3A 3A8KA 2AYMA 1JLGA 1Y00A 2HS3A 3H5UA 4B3RF 4MK8A 3BO3A 2JFDA 5KFCA 2F63A 3VQ6A 1YTAA 4RQ6A 4H8KA 3GPAA 2MHNA 3GR1A 1LWFB 3LDLA 2G5IB 1X9JA 4JI6K 5K14A 3CMEN 3R3TA 2BQRA 2DRBA 4C98A 3WXLA 3R6MA 3Q89A 1I3AA 2VBWA 4MLEA 4YP3A 2YNGA 3HSCA 4DR7J 3VCBA 4FVMA 2QJ3A 3CJSA 4AHUA 5DQHA 3CJTA 2P9NA 1MG7A 3O9TA 9ICNA 4DR3J 1RTZA 2FMSA 4EBDA 4B17A 3RRGA 5AQWA 2X1FA 3RB6A 3H3NO 3GR0A 1TGOA 5AIAA 3VF4A 1FRIA 3K9KA 2HDOA 4U7UK 1MW7A 5C0YA 2Z56B 3R97A 1HR0K 1JKHA 2E4LA 1LK7A 3ULEA 3LVWA 3HFVA 4LF6J 3SMVA 1QVFR 3IG8A 3CCTA 5F0WA 2QXLA 4O0IA 3NH2A 4PG5A 3LOUA 5EX3A 4DG1B 3G9CA 4TSXA 3S3OA 1KQSR 1TVRB 3LGHA 1MU2B 3OUYA 3A5OC 4V19S 3D2EA 1VSLA 4Y3CA 3OTQA 2RU9A 4JI8F 3FZLA 2QO3A 4HDGA 2W4PA 2XNRA 7ICVA 1ICEB 3GFZA 3DU5A 2ROGA 2WONA 4P4PA 4JLHA 4F3TA 1VQ6N 1K44A 2HZVA 4OZ1A 2J0XA 2W2OP 2NRZA 1Y5LB 3EVWA 4OJ3A 1I94J 3BB5A 4QJFB 2CQ4A 3IG1A 2F3NA 1NJZA 2ZJ8A 1Y4ZB 4US9A 4XDDA 2FY1A 4AQYJ 3OPKA 2J76E 3J7YP 1ZXIA 7ICSA 1CRXA 3HZ6A 2VF3A 2E1YA 3MGVA 2GUIA 3O3LA 3CRXA 2HHVA 4CW7B 4K4TA 4CJVA 3AVLA 1U4BA 4Q8FA 2HFUA 1BO5O 2O6KA 4PUOB 2CXYA 3ETOA 1VQPS 2H9ZA 4DV3K 4DCCA 1HBMA 3Q24A 1RDDA 4YOYA 1QUVA 4GW6A 1JK9B 3TJ8A 5DM6L 4USVA 4KH1B 1KVBA 2U2FA 1FRLA 3W62A 4KB0A 5A76A 2MKHA 1AZSA 5EE9A 4DR7K 4ID1A 1Q86O 4OFZA 1URJA 1SXEA 5CR0A 4C8ZA 3I33A 4OO1J 4IRCA 3FNNA 3FFIB 1HJOA 4WKYA 1BL3A 3CWJA 4RU2A 3LDQA 4NI2B 1KP6A 4OI2A 3TI0A 3AQOA 4BS2A 2B21A 2K4PA 4ZJQA 2K1RA 3PM9A 4PYDA 1DRGA 2OEKA 4CZCA 3EZUA 3E58A 4LSNB 1AYEA 1WBBA 4WFZA 2C2KB 4NLGA 3VA3A 4DR3F 2ATQA 4CO2A 1IG9A 2FHKA 3IDHA 1Q7YT 1MSWD 2IOFK 4CJUA 2IDOA 3EKUA 2CAJA 2NZ4A 4OI6A 2VH7A 4KMUA 1S76D 3LL3A 3VQ4A 2HBJA 4ID5B 4DU1A 1I94K 1T05A 3IUCA 2FVCA 4KX5A 4RQ4A 1RZMA 2YX1A 4LF6F 2ZNYA 3MDFA 4AQYK 2MSNA 5EE1A 2LQBA 4B3MJ 2K8AA 1CBKA 3Q8KA 1CEZA 3C19A 3W5YA 3LK9A 1HI0P 3WC2A 4LRFA 1XMQJ 1QHAA 3FCHA 4NCBA 2K4IA 4LFCK 3FAHA 4FZXC 4XK8C 3IMQJ 1G7CB 1FTCA 3UIQA 3M7DA 2QLJB 2OIHA 3RZAA 5M2RA 4JP8A 2FLOA 2RDJA 5HJXA 1SL2A 3DOKA 8ICFA 4KH0B 1ZQRA 5C2FA 1RYRA 2W01A 3NHGA 3MWBA 2P6UA 4PHAA 4K4VA 1OSCA 4I2AA 4F5NA 1Z00B 4JKGA 5AKIA 1PO6A 4EYIB 3IRXA 4BG8A 4IOCQ 1NUEA 3GJTB 2VBZA 4UUXA 3W61A 2PI4A 5AKKA 2W4DA 3BEGB 3PSFA 4GVLA 1N5SA 5GADP 1PKUA 4O3SA 3KNAA 4DSIA 4DCPB 4HUFA 1IKXA 3BF3A 2HHQA 2WSFC 3JTNA 3KK7A 2GV9A 2R4FA 4PRFA 1AW0A 1Q3VA 2V4JB 3FEZA 3RR8A 4NE9C 4F67A 4BRAA 5D46A 4P2XA 3P83D 3H46O 1LQ9A 3W8PA 4O3RA 1TUGB 1KQKA 5KPZA 2ASMA 2H5XA 1H7WA 3SCJE 1FKPB 3CCMN 1TL3B 4L75A 4M5IA 1NK4A 2P35A 2CQGA 1REVB 4RQ2A 2AGQA 4FKXA 2NXUA 5JUMA 4Q7AA 2KHQA 1OXJA 1X31C 2H1YA 4QIWC 3TTCA 1ZBFA 4O4GA 2J9DE 3DRYA 1T9UA 3PRVA 3V4IA 1UL3A 1WG5A 2XO7A 1CSJA 4IFYA 3EXYA 1ITGA 4DLEA 1S1TA 2NPIA 5AQQA 1S1UB 2QWLA 1RSCA 4DO9A 4ZCIA 3EMTA 2OSQA 3OVBA 2C42A 4JYAJ 1GMWA 1QQ5A 2Y0SC 3UMBA 3M6ZA 1RQLA 1LWXA 3D0PA 4FLWA 2WB1C 4DTXA 2LVWA 4CNZA 4GXIA 1Q82T 5LMUJ 2P8IA 1J54A 3RBDA 3VTHA 2E1ZA 1ZBUA 3DAWA 2CPHA 1KLMB 4OQJA 4PZVA 2B7CB 4CO1A 1ZBIA 4MO4A 4LIWA 2F1FA 4B3MF 5J2FA 5J8YA 4ZA1A 3HXMA 5BN9A 5IT9Y 1FDAA 4YDUC 2YB4A 1F0MA 2GVDA 3QUTA 5J1EA 2MQOA 7ICTA 1XMQF 3DNCA 1J5EJ 2FXUA 2W41A 2D3DA 3HKWA 4FK2A 1BHNA 2O8DB 5HVGA 1CS4A 2B3TB 3HCXA 3ISZA 4N41A 3TZXA 3AGRA 2HS0A 1ZM9A 3HHDA 3PSPA 1NJXA 1S0VA 1WSJA 5ETQA 2BCUA 4CF2A 4M6WA 4UW2A 3QBXA 3D0GE 1TKZA 3EDQB 4P0PA 3KD3A 3I0SA 7ICNA 5JJBA 1VJQA 3F44A 4OPHA 3O44A 5THWA 1ZAWA 1HW8A 2ZBPA 2OI2A 1U6FA 4I4BA 5IWAF 2UVRA 4K4ZA 2HURA 2ATCB 3NF7A 3CE8A 2YCHA 4RUBA 3CJRA 3R5JB 1HBNB 5ETPA 3DEEA 1DQ8A 3IWLA 5AQJA 3AVKA 3SPZA 3IA0A 3SIPB 2DNQA 3N5BA 3EM1A 2D0OA 5J0RA 5EU7A 4QZ9A 3ZSZA 1D3WA 1IKYB 4JYAK 3PIOQ 4DV7J 5D4OA 5CZ1A 8ICSA 2F8SA 1MMNA 1FFWB 2FVPA 3B4DA 1JL2A 5AKEA 3L95X 5LMUK 3RJGA 3A0BU 1D9AA 4M9NA 3T79A 1ACMB 1TV6A 3OHRA 1WEZA 4X4QA 2LFVA 1K8AO 1VQYA 4WFBL 1K0TA 2VG5A 2P1JA 4WF9L 4DPTA 4ZP8A 2RRDA 2QWQA 1JJHA 7ICGA 1ITPA 4DMZA 1VCTA 4JK1A 2DGOA 2HIYA 2KEYA 2DFEA 3O9RA 1N0UA 2KG5A 3MUTP 2KXFA 5LMUF 3TADA 2DH9A 1AFIA 2WTFA 4Z4HA 3QRRA 2XMAA 5KGXA 5ADZA 2DXFA 4CJTA 1VQ9N 3TR8A 1YJUA 4H0PA 3EZOA 1OH5A 5AI4A 1N5WA 5KG1A 3SFUA 4KHWA 4K5SA 2DITA 3CCJS 2AIRB 3FUYA 3PFOA 3Q83A 1J5EF 1X60A 2Q2RA 1CC7A 4W5NA 4GV6A 4ZHRB 2VD3A 3WK9A 1DKGD 4MIAA 2IRUA 3E9OA 1YWXA 4WWSA 1NI3A 1RBLA 1BWEA 2IFXA 4FJ5A 5KTQA 4KN4A 3GSDA 2W7OA 3R9KA 5AKXA 3TPQA 3BQ7A 4E2FB 3GCXP 1TMMA 1O0PA 2DPJA 5DM6Q 3CCVS 2GWKA 4DEZA 1SJ4P 2AJ2A 4KLEA 3L7OA 3GQCA 5G4DA 3ZZRA 4Q45A 2ZIUB 3WHIA 3KNGA 4DX8H 1X3NA 4DV7K 3ZTQA 2G08A 2V2ZA 4NYPA 5KG2A 4IO1A 2CH6A 3IAM9 2ZH1A 4OL8A 5EDWA 1VRTB 5D77A 1RK8A 3N6LA 1UPMB 3SBGA 3CCRN 4K4HA 5HOOA 3M6XA 1VSFA 4DQ8A 3H42A 2D0CA 4M1KA 2HNYB 3PHEA 1NGHA 2PFOA 3QEWA 2ZUGA 1TYQA 3CCSN 3JYTB 5HAOA 3CW2C 4OPKA 2DYAA 2JZBA 1ASVA 3ZTPA 3SUOA 1RAFB 4B9SA 4ZOHC 5DMRA 4J03A 4JI0J 1S6PA 3A8JA 4MEYA 3CCQS 2HRUA 2JC0A 1SB6A 4CO0A 3BUZB 3D9BA 1Q18A 4C8NA 2K8GA 2I5HA 3IKMA 2KVSA 4CHNA 3UQ0A 5A0YB 1CQMA 4GLXA 4X64K 3C28A 4HLBA 3UE2A 2CJXB 1QDUB 4C11A 2ALZA 1S6QB 3PKYA 3CMQA 2MZSA 1XNQJ 1FVQA 3WXJA 2V4RA 2LSNA 3T1AA 1XMOK 2CPRA 4WFNL 2ZITA 4KPCA 3L3CA 3WNHA 4KC5A 5KG6A 3C2LA 1UEVA 4ISEA 5AI5A 4KV8B 3NGDA 1XMBA 3K4GA 3FZHA 1R8CA 4AL5A 1X42A 4F50A 3JQKA 3LZIA 4LVSA 4IO9L 3SEIA 3EN9A 2ZTDA 1GEHA 4NCGA 1N33J 4CZFA 4Q2LA 3M32B 2ZF5O 2UP1A 1RBUA 5JRTA 3QZ8A 1YBAA 5J2MB 1S1XA 1YBUA 3HFZB 5MAOA 4PHTX 2CJAA 2IHNA 3TOQA 5I42A 3QSYB 2N82B 2GS8A 3BS5A 3EO3A 2GH1A 3C0BA 1WC5A 5LY3A 5E33A 2RHFA 4I2EA 2IRXA 2KH9A 5AXKA 1LAWA 3N4WA 1H2VZ 1IVZA 3FRYA 2YMQA 4GXKA 3MDAA 1F44A 1QAYA 4OJLA 4J9SA 1RDCA 4DV5K 3MEEB 3QJJA 2PFDA 4ECUA 4U67Q 2X1AA 3OYFA 1EWQA 4W5OA 2MLYA 3W9JA 4M3YA 5AKYA 2VG6A 2DHGA 5HP1A 4CE9A 1FT8A 3DV9A 4PQAA 1S3XA 3SSSA 1UKUA 4ACOA 4NRTA 1YVUA 3TZWA 4X4RA 2JWKA 1FFUA 3A3OB 2V8DA 3IXQA 4H4KC 5CAAA 2Z2YB 5AQXA 2W54A 5CP2A 1FA0A 4A8QA 4A2AA 3GFKB 4FP9A 3SD7A 1YDLA 4BGBA 2ASDA 5K8PA 4NLXA 5F3XB 1E6VB 1IG6A 1XWLA 5B7WA 2Y9UA 3IAS9 5CHIA 4JI0F 3G86A 5IINA 2R18A 1X5SA 1A5WA 3LZJA 4LD0A 3DHXA 2DNPA 2ZD1A 1RTIA 2N7YA 1VR6A 2R8KA 3NCQA 4R8UB 3EGZA 4NO7A 4F8RA 4MT1A 1NBEB 1BLUA 2KSOA 2HCFA 3UDLA 3TQEA 2E5SA 1XNQF 3FBEA 5ALHA 2EKNA 3QGIA 4IFEA 3T5KA 4CF3A 1L3UA 3VA0A 2E9RX 2YPYA 3NAEA 3SQOP 3GIJA 1QHTA 4UAZA 2JVRA 4GFJA 1J5OB 2WBNA 3CD0A 4USKA 4ILMA 3K7RA 1UCNA 2H54B 4K7QA 1SB3C 2EAOA 4UW9A 3U9ZA 3C95A 4HWIA 2L9DA 3N9UC 4P75A 2VBXA 1N33F 3M4XA 1E4FT 3AVNA 2WVCA 2FLPA 1B7YB 1CJUB 2ZUBA 4MF8A 3MFHA 4EFHA 7ICKA 2XBPA 4YUDA 5KG5A 3TZYA 3JS9A 4B9MA 3Q8RB 4F4XA 1WD6A 2UUTA