1UA1A

Structure of aminofluorene adduct paired opposite cytosine at the polymerase active site.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
b'AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua1A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua1A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua1A01
3V6KA 2F8TA 4CJEA 3QEPA 1ZQEA 4RW7A 2NRWA 4KMUA 4B08A 4AHCA 2VG7A 4RQ2A 3HXMA 4YMOA 3HSTB 3SUNA 4RU9A 4Q43A 3GV7B 2HNDA 3ISNC 4M3TA 4O3NA 3FYHA 8ICQA 4QAGA 2Z1HA 3AV9A 1HQEA 4HHTA 1ZQJA 4KLDA 1CLQA 2IHMA 4ZTFA 2IA6A 2OA8A 3M8QA 4I7FA 1NK0A 4PPXA 3OJSA 9ICOA 4DQIA 4DOBA 4FLVA 4UQGA 4KRFA 5DG7A 2OPRA 2P1JA 4CCHA 3SUQA 2FBTA 2QKKA 1BPXA 8ICWA 4CJKA 5CR0A 7ICIA 4JRPA 5E41A 1Q9YA 4OVLA 2P5OA 1ZQRA 3KHGA 4UB1A 2ZD1A 3SZ2A 4PH5A 9ICPA 4W5OA 1SV5A 3ORYA 3K58A 3C23A 4DQRA 2AGOA 3OHBA 4ED1A 5IIMA 2I9GA 5J2PA 4B9UA 3QIPA 3PW4A 1W0HA 4Z4CA 4UAZA 1NK9A 8ICVA 4QZCA 4OPJA 5D46A 3RB4A 2KW4A 3TARA 5IILA 2BDPA 4E7KA 1NK5A 1T8EA 4DQQA 5C42A 3H8SA 4E7HA 5DGAA 1RT1A 1A77A 2BGWA 3D0PA 3VQ9A 3H40A 3AUOA 1C7YA 2O4IA 3HL8A 3VQQA 3K5MA 3LZIA 3T5HA 4NXZA 1S10A 5CHGA 2KQ2A 2FBVA 2F1JA 3DRRA 4KHWA 5KFPA 1VSKA 1BPEA 4GVMA 4F2SA 3KLIA 3LAKA 1C1CA 4BACA 1MQ2A 4Z4EA 2W9BA 1T7PA 3RB3A 3RMAA 1KFDA 1ZQYA 1S6PA 3HPOA 3KKSA 4DOAA 3RR7A 5JS2A 3KIOA 4J9MA 2LYHA 2JLEA 4C8LA 1SKWA 4YVZA 4ED8A 1RPLA 2BPFA 3OY9A 3JPTA 1RDAA 3PX6A 3VA0A 4EP5A 4DTJA 8ICRA 3SPYA 3Q8SB 5CYQA 4F92B 4CHQA 1S0NA 4CHOA 4B8AB 1T3NA 3SPZA 3V7LA 2FPMA 4TURA 1NJYA 1IO2A 1S1UA 2GV9A 1QE1A 4BDZA 3GV5B 4DSJA 4M3YA 4NLKA 5J2JA 3MEDA 2BCUA 2PZSA 2AQ0A 4KLUA 4YQWA 8ICYA 3G6XA 3CYMA 1LB2B 2DTUA 1B43A 5JUMA 1ITGA 1KSPA 1EXQA 3RH6A 2YV0X 3OYNA 4FJNA 3ULDA 3PY8A 4KHQA 1ZQBA 3QESA 4KLTA 3NF6A 4DL3A 4FJ9A 3RAQA 3OYCA 4ECRA 4F8RA 1T05A 4KLLA 2HNZA 3MGHA 5KT4A 1KTQA 3PR4A 3VQ6A 1C0MA 3HP9A 3K4GA 2DFLA 1EX4A 4W5QA 1YTUA 1ZQUA 4ECZA 2HVIA 1XSLA 5KRTA 3EYZA 2XCAA 2R8KA 3RJFA 3V81A 4BGDA 4M3XA 1ASVA 5DDYA 3S3NA 1ZETA 4DL7A 3KJVA 5HHIA 4FM0A 4GLXA 3OYAA 1LWCA 1X2IA 3SQ2A 3V7KA 4RNMA 1VSFA 2B6AA 1L3UA 1IG9A 4ZH4A 1F21A 4P4MA 3UQ2A 3K2PA 4JS5A 1FKOA 4F3TA 4J9LA 3ETLA 4AHTA 4FLUA 5HRPA 4BXOB 4FW2A 4CEAA 4JV1A 5IIJA 4DLGA 1RDDA 2ZJ8A 4KLJA 9ICUA 2JEGA 3KHRA 4W5NA 3PW0A 3QLHA 1HMVA 3QETA 3GIMA 3GIIA 3E01A 2MUTA 2XGQA 3QO9A 2HHVA 1QLNA 3AA4A 3ZT4A 1ZQHA 3TABA 4KLFA 3MECA 1LWEA 1S5JA 9ICKA 3M8RA 1XSNA 4JS4A 2NUBA 7ICEA 1RTHA 3KK1A 1WLJA 1BI4A 1IH7A 4PQUA 3KD5E 2ISOA 3G6VA 3HYFA 9ICTA 2VG6A 4KHUA 4Q0BA 4J9OA 3QZ8A 3NBPA 4FJXA 1BIZA 2RN2A 4ECYA 4TUQA 4UBCA 2R7YA 3AO4A 2JGUA 4J2EA 1BPDA 3KHHA 1J5OA 8ICUA 1V9PA 5FRMA 4G3IA 4M3RA 3Q8QB 2C22A 5CZ2A 4KLOA 3LK9A 2PY5A 2W9MA 4DTRA 4G1QA 3NGDA 3JPPA 4TQSA 4TSXA 3WNFA 4JLHA 3PO4A 4FZYA 4B9SA 2XY8A 1GOCA 3WNGA 4KB1A 1VSEA 3NF7A 1KLNA 3MFHA 1W9HA 2DY4A 4GXKA 4CJFA 4E89A 4HUEA 3UXNA 9ICQA 4EYIB 1SZPA 3CM6A 4LD0A 4O4GA 5KFMA 1G15A 1LW2A 3RMDA 4RT3A 4CJ3A 1RYRA 3RB0A 2ALZA 4FW1A 8ICLA 2A1JB 1HNVA 1Y97A 4X5VA 4QZFA 4FJJA 3HM9A 1TVRA 4O9MA 3AO3A 4J9PA 4AHUA 3MR6A 4Z0UA 3WNHA 3AO5A 4OGCA 3L8BA 1RILA 8ICOA 1D9DA 5KFFA 4OLAA 4RQ0A 2EX3A 5CP2A 4UBBA 1T03A 3NFAA 1BPZA 4NLNA 4M3ZA 2OPQA 3MXIA 1SUQA 2DPJA 2J6UA 3AA2A 2FLPA 5KFOA 3QNNA 4ECVA 5EOZA 1RT4A 4UAWA 5KRSA 1BCOA 4I2EA 8ICFA 1NK4A 7ICLA 5KFXA 4UB5A 1D9FA 2RKIA 4GW6A 1QSLA 1LAVA 7ICJA 3E2EA 4QZIA 3EW9A 3RMCA 3ALYA 4I2IA 4LSLA 4ZTJA 2PI5A 3V6DA 1ASWA 3C2KA 5IIKA 1K1SA 4DF4A 4CEOA 5CZ1A 2RDJA 3T5LA 2FBYA 4ELUA 9ICSA 5J0TA 2YHBA 3NGIA 1ZQXA 3GIKA 4FS1A 1WSHA 3ZDAA 2F1HA 5J2CA 7ICOA 4CGJA 4B9MA 9ICIA 2VG5A 4F5NA 3IS9A 4IRCA 4KLHA 1JLBA 4ED7A 5KT3A 4CEZA 2RDIA 3EZ5A 1JLEA 3OS2A 3EY1A 3IHQB 2R8JA 4FZZA 3HVRA 3O3GA 1HYVA 3UPQA 5J0QA 5FRNA 5KT2A 1ZBHA 1QSYA 3JPNA 3L3UA 4FJIA 2GUIA 1NOMA 1S9GA 4FS2A 4DO9A 4C8OA 4DTSA 4F50A 3BJYA 2BQ3A 4GC7A 4ICLA 4IFYA 4F5PA 1KVBA 3ISBA 4R65A 1BCMA 9ICRA 3C6UA 4O44A 3MAQA 2X78A 5KFBA 3H08A 4ED2A 1U47A 4ED6A 5KFUA 3K5OA 2YNHA 1VSDA 3H8JA 5HRSA 1NOYA 1S97A 4I2JA 3RJGA 4O3RA 3M8SA 9ICEA 3K57A 5KFVA 5I3UA 4C8NA 4B9LA 1CEZA 4YD2A 1HJPA 3EPIA 1UT5A 3AVCA 2FLLA 3VQ5A 2OZSA 1RTIA 3QIOA 5D3GA 2G8WA 5DG8A 1DLOA 4RPXA 5J2KA 2AQ4A 3O3HA 4IQUA 3VQPA 5KFRA 1MU2A 4CFBA 4RPYA 4BDPA 4FLZA 4F5OA 3DMJA 1XHXA 2BPGA 1XSPA 2FBXA 4LSNA 3VQAA 5J2DA 4GXJA 3MXJA 5J2AA 1IKXA 4GMJB 4LZDA 3MGIA 4KTWA 3G6YA 4MEXA 2E4LA 4PGQA 3EPGA 1IKYA 2ZQBA 2KZMA 3AVKA 3I0RA 1ZQKA 3LP2A 1KFSA 5DLGA 2Z1IA 1BQNA 4YN4A 4RW4A 1RT6A 1JXEA 5KG3A 2AU0A 3DRPA 4HUGA 1SKRA 3HK2A 3K59A 3IAYA 3PX0A 4DSLA 4FYDA 4TUSA 5J2NA 1RCHA 4JV0A 4KV8A 4ECXA 2IS3A 4E7IA 1RT3A 5KG5A 1NK6A 3AVGA 1X9SA 3C5FA 1QHTA 4DS5A 1SL2A 3L2VA 1L3SA 2WTFA 3H8WA 5EU7A 4AH9A 5DQHA 1JLGA 4M3UA 2JZBB 1HUOA 1HQUA 3RWUA 1N5YA 3AO2A 4UB4A 2VWKA 1HYZA 3QEVA 1S0OA 7ICNA 3MFIA 2HHQA 1ZQDA 3OS1A 3DLHA 4HUFA 5KG2A 4CJQA 4FJLA 4YFKA 1JIHA 3JPQA 1TVAA 1XS9D 4RNNA 1A5XA 1S1TA 4BDYA 2G8FA 4FJ8A 2Z1JA 3P1GA 7ICUA 3EWAA 5KFNA 1EKEA 2G8KA 4PHAA 3B0XA 4DSFA 4M41A 5J0WA 2IGIA 3C21A 3NH1A 3VN5A 3ZSOA 4EBDA 3ZCMA 3M8PA 1Q8IA 2FMSA 4O3PA 3ASMA 4CGHA 1U48A 3AVIA 5BOLA 1S76D 3NF9A 2IHNA 4BXOA 9ICNA 3ZSRA 5DBCA 4CJWA 4E7JA 1UWBA 5KFGA 4QZDA 2RF2A 4DU3A 1Z00B 1C6VA 3NGYA 4FVMA 2P5GA 1UT8A 2E6MA 3C5GA 4CHZA 3OS0A 4FJHA 1X9MA 4MQ3A 8ICJA 4B9NA 1WN7A 2G8VA 5JS1A 3C94A 3M9NB 8ICSA 3O4QA 4E0DA 1ZQFA 3KD1E 8ICEA 2PFQA 1NKBA 3O3FA 3NDKA 4QW9A 2R8HA 3TI0A 4FXDA 2DFEA 4P4PA 3JYTA 3H4BA 1ZQZA 4O0JA 4BWJA 2C2EA 3BQ2A 2F1IA 8ICTA 4Z4FA 4O3OA 1RBRA 4R63A 4J9SA 1WNSA 3OYHA 3RJKA 2ASLA 4YR0A 4IRKA 3HP6A 4CJRA 1N48A 4UB2A 3RRGA 5J0PA 2BANA 5I42A 4QZEA 4ECSA 1TGOA 2PYLA 4Q5VA 4F5RA 4K8ZA 2YHAA 4F2RA 4M45A 4FBTA 4DTPA 4CECA 2OZMA 4CF8A 3LALA 1TK0A 4MFFA 4M04A 4CESA 3S3OA 5DBAA 3TFRA 1UA0A 5D49A 4IG0A 2ZTEA 3VQBA 4Z6CA 4RQ5A 1U04A 4CIFA 2W9CB 4IFVA 4NLGA 1ZQGA 1YT3A 3OSNA 3OYGA 2D0AA 4QZ9A 4Y1DA 4N76A 2KN7A 3DRSA 3V6JA 1B22A 2IAJA 4R8UB 2GWSA 2I1QA 3SYZA 3V6HA 1BL3A 5KFAA 1MC8A 5C25A 5DB6A 4M0AA 2J6SA 3HW8A 4KHYA 1JKHA 3RBEA 1LAWA 1ZBLA 1COOA 3GDXA 4KAZA 8ICGA 2A1JA 1BVSA 1ZBIA 4B9VA 3K5LA 1R0AA 1H38A 4M9JA 4IDKA 5J0OA 1VRTA 2XY6A 5KFIA 4O5EA 2IMWP 4QZBA 4NCAA 1RBSA 4I2PA 5J2BA 5SZTA 2ITGA 1S77D 1FK9A 4QW8A 4M42A 4O55A 1BGXT 3RMBA 3DLRA 1VRUA 1QSSA 4MFBA 5HHHA 2ZUBA 2OWOA 5KGXA 1VSHA 4YFUA 4XQ8A 4DS4A 4I2BA 5K14A 4JWMA 4O3SA 1KLMA 1A5VA 3NE6A 1B9DA 3ITHA 3NH0A 3LZJA 1JN3A 1ZQWA 4YG2A 3B6PA 4AILC 1TKTA 3NTUA 8ICMA 3T19A 1JXLA 4CGFA 1U45A 4NLZA 5KFEA 4CJ4A 4HCCA 3C2LA 1RBTA 3RB6A 4FLTA 5HP1A 2GBZA 1VSLA 3CFRA 1JLCA 7ICSA 7ICGA 3MABA 3KK3A 2ZUDA 3THVA 2M9NA 5CWRA 4DQPA 1SKSA 4KI4A 4FO6A 1J53A 4E7LA 4M9HA 3IG1A 1JMSA 1J54A 1C1AA 9ICWA 1C0TA 4EP4A 5KFCA 1NK7A 4RG8A 4I2AA 4K4GA 1NJZA 1BPYA 3OVNA 3VQ7A 4FBUA 3TAMA 3ZDBA 1JL2A 4KN7A 3DYAA 2QKBA 3L2WA 3LDAA 5J2MA 4EEYA 4CIGA 1RT2A 2G8IA 1B92A 4YNQA 2ZJ5A 4RW9A 2F8SA 3T5KA 4KKOA 4CF2A 4FJKA 2E6LA 5L1LA 1CZBA 3ZSVA 1TL3A 3CG7A 1UAXA 1ZQQA 4CHNA 5KFQA 2VA8A 4RPZA 4BE2A 4DQSA 4J9QA 2BHNA 1BISA 2D0BA 4KHNA 3QEAZ 3PUFA 1K6YA 3KKRA 5J2HA 1TL1A 3LWLA 5CB1A 3JSMA 3MR5A 4JUZA 4YXMA 1D8YA 3S9HA 3LPTA 1Y88A 4I29A 3C1YA 3Q8PB 4KLSA 4KLMA 5T7BA 5C5JA 2W9AA 3OYMA 5CA7A 4M3WA 2RPIA 4P2HA 3AVLA 1ZQVA 9ICHA 4DEZA 3V9ZA 2BR0A 5KG1A 5J0SA 4MF2A 1EP4A 4O3QA 2V4RA 1L5UA 2HW3A 5DQIA 4Z6EA 3U3YA 8ICBA 3Q8KA 4ECTA 3KTQA 1XHZA 1RBUA 3N97B 3P83D 1IKVA 1RXVA 5BPCA 2H5XA 3MR2A 3PW5A 1LWFA 4CFCA 4CJPA 1QTMA 4W5RA 3TR8A 3TWHA 5F9NA 4Y1CA 4NM2A 2KZZA 1BHLA 1LW0A 4R66A 3AVNA 2P66A 1WAFA 1JLQA 2LSNA 3NH2A 1ZQTA 9ICGA 3ZSZA 3SJJA 3VQ8A 3OSPA 1CXQA 1SL0A 4E19A 5J0YA 4J2AA 1ZBFA 1ZQAA 1WCLA 3DLKA 1WSGA 1L3VA 5F9LA 2PYJA 4DSEA 3IRXA 7ICMA 3KLFA 3SCXA 5KT7A 1ZQNA 3I0SA 3ZT2A 3AU6A 2DFFA 4B9TA 3DI6A 3SI8A 4FLYA 4JWNA 2DPIA 1GOBA 2WOMA 4IKFA 1U49A 3D45A 4YCXA 4EBEA 1ZJMA 4DOCA 5L9XA 3HPHA 1U4BA 2HHWA 3ZSYA 3RH4A 4ID1A 4YMMA 4W5TA 3PVXA 3OYLA 1JLFA 3RBDA 1NKEA 3AVFA 3QE9Y 1ZYQA 4DU1A 1S0MA 4KLQA 1ZQPA 4BWMA 3U3GA 1JXBA 7ICVA 2W8LA 2HHTA 1PZNA 3HX0A 1ZJNA 2X6SA 3ZSXA 3OYBA 1S1XA 4H4OA 5DB8A 1VSJA 3V1RA 4Q8EA 2WONA 4CJVA 5DB7A 5J1EA 4F4XA 3GILA 3VQEA 1TAUA 4ECUA 4RW8A 2HB5A 4CERA 1TKDA 3SNNA 3ZD8A 3PO5A 5TZVA 4DL2A 3VQDA 4K4IA 2UVVA 1WAJA 4RQ6A 1NJXA 2W8KA 3G0ZA 1WSEA 4LY7A 2PXIA 1YVUA 4NCBA 4CFAA 5HLFA 4HYKA 2C2RA 2ASJA 3OYKA 1YTAA 3G10A 1HJRA 5EWFA 3HT3A 3K5NA 4CEEA 3TAPA 2FMPA 4KLIA 1Z00A 2P6RA 4DFKA 2BKEA 4YP3A 2ISPA 3SUPA 4M6WB 3V72A 4HVJA 3LDSA 5J0RA 4RQ7A 3JPSA 3FDSA 1MQ3A 2PFOA 3CFOA 3HJFA 8ICXA 3HVTA 3V9UA 3MDAA 3UXPA 1DTQA 4IQWA 1N56A 4ID5A 3Q8LA 3AA3A 2BCRA 4FK0A 4I9LA 4J2BA 3DLEA 4Q44A 3HWTA 1AROP 3V7JA 3AO1A 5HP4A 3M9OB 4FLWA 5KT5A 3RRHA 4Z4HA 4K8XA 3BQ0A 3PR5B 1RBVA 5KG4A 3QEBZ 5CJ7A 8ICHA 3DLGA 4DTUA 2P51A 2BQRA 1D5AA 1GOAA 2ZTDA 3AA5X 3ISDA 1HPZA 4N41A 3KLEA 9ICFA 4PHEA 3ZSQA 3AVHA 2PFPA 4CGIA 4FLXA 4KFBA 4RQ3A 3TAQA 3BQTA 1MSWD 4DFPA 7ICQA 4CJUA 2ZTCA 4QWAA 1CUKA 3TFSA 2W9CA 1JX4A 2IBKA 2IDOA 5HMLA 3HO1A 5J0UA 4J2DA 3HPGA 3ZD9A 2XGPA 1KVAA 2G8HA 4R8UA 4OPKA 4KN4A 3RJIA 2QK9A 4O5CA 3DOLA 4CEQA 2UVWA 5EWEA 5KFLA 2AGQA 4DWIA 4N47A 3IM1A 2PFNA 3NGZA 4CJLA 4PHPA 4MFAA 2XRIA 4QWEA 3DLBA 1CXUA 4DTMA 1T4GA 3JPRA 1EXNA 4OJRA 5FDLA 2R8IA 3LWMA 3RR8A 2BQUA 5IIOA 2JEFA 4FJGA 3V4IA 4DG1A 1KVCA 4OKJA 4RW6A 2FLNA 4I2GA 3C1ZA 2EHGA 3B6OA 3SV3A 2FPKA 4UB3A 1TKXA 4QWDA 3QERA 1IXRA 1KEJA 2XC9A 2XO7A 2OPPA 1Z26A 1DGSA 3FFIA 5DG9A 4CJ5A 5KT6A 5L1IA 4ECWA 1RTJA 2OYQA 4NY8A 1HYSA 4EYHB 4RQ1A 2B4JA 5HROA 3RJJA 2XY5A 4LVSA 3V1OA 4XUSA 4CJSA 3PX4A 1NK8A 2ZJAA 1DOQA 2NRVA 3KLGA 3VQ4A 2Q0ZX 3H4DA 4BE0A 3CM5A 1XWLA 4P4OA 4XIUA 5KFSA 1QS4A 3OYDA 1O1WA 2NRZA 1WSJA 4DTXA 1RDBA 5KG7A 4NM1A 2HHUA 4IQVA 1HRHA 1K1QA 1S0VA 5KI6A 4QZ8A 3M9MB 5FROA 1JL1A 5SWMA 3F9KA 3ZT0A 3S3MA 3PNCA 4OKEA 3CFPA 2ZUCA 3AU2A 1ZBUA 4MF8A 4PGYA 1C1BA 2BCQA 2YKMA 1X1PA 5DB9A 4N5SA 5J2QA 2I5JA 2B21A 2X74A 3GV8B 3UIQA 3MXMA 4FM2A 3Q8MA 5CYMA 4J9RA 4QWCA 5DMRA 4F5QA 5HBMA 3VA3A 8ICAA 4CK2A 4E1NA 2KZ3A 9ICVA 5KFWA 3OJUA 4Q8FA 3LPUA 1RT5A 2XY7A 3C95A 1TFRA 5DDMA 5KFZA 2BCSA 4N56A 3ISCA 1XO1A 4M47A 2Z1GA 3RAXA 4DF8A 4YR2A 2HHSA 1QQCA 2HMIA 3BGRA 3JPOA 2VA2A 9ICMA 7ICKA 1S1VA 2YNGA 3MR3A 2V4QA 4CF9A 1REVA 3QEWA 1N6QA 1ZQLA 1ASUA 5C24A 4KTZA 4E3SA 4RQ4A 4F91B 3GQCA 3PW2A 3KK2A 5DLFA 3MDCA 5KFHA 5J2GA 3U6FA 4ED0A 1RNHA 2QXFA 4CK3A 3V9SA 2OPSA 3BDPA 7ICFA 1D8LA 9ICAA 3B0YA 3DOKA 4DTOA 3OYJA 4O0IA 4KITB 3SQ4A 3TQ1A 2BCVA 5CY4A 1ZQSA 2G8UA 3L2UA 4KLGA 4PUOA 3T3FA 4FZXC 2PI4A 4I9QA 4JRQA 3RTVA 4LH4A 2JEIA 3P5JA 4RNOA 4CF0A 2P6UA 1I3AA 4NYFA 4IG3A 1VK0A 4K4HA 4CHPA 5KFDA 1WCNA 5J2FA 4DFMA 3ZT1A 3MEEA 1UA1A 3NAEA 1DTTA 4HTUA 3LP3A 4I2FA 8ICZA 4HCBA 4DL5A 5DQGA 5IIIA 4ZHRA 4CJTA 4RUAA 5L1JA 4R5PA 2ATLA 2ATQA 3PW7A 4F4KA 1JLAA 5KTQA 4GXIA 5J29A 4PY5A 5KFKA 4I2DA 1KCFA 4DL6A 2MAXA 2HHXA 4LH5A 1KFTA 1RTDA 3C6TA 4YR3A 4KHSA 3T5JA 1TV6A 4CE9A 5BOMA 2NRTA 1FKPA 3SUOA 3CQ8A 5KG6A 1XU4A 2AJQA 4FJ7A 9ICCA 3ZDEA 3TANA 1TAQA 3GFKB 4B3OA 3GIJA 4M9GA 1J9AA 4QZGA 2W9BB 4MFCA 4L8RB 3OYFA 4KO0A 3QEXA 3QZ7A 4XRHA 3RJHA 3V1QA 3KHLA 2D5RA 3L2RA 4CHYA 2KTQA 3OHAA 1RYSA 4CF1A 3QEIA 4J9KA 3PV8A 4I27A 4DSKA 8ICIA 4FK2A 3QINA 4NYNA 4ELVA 4EZ9A 3UXOA 1C0UA 4KLEA 3BQ1A 9ICBA 5DK5A 1BIUA 3KLHA 3H7IA 4Z4IA 4IQTA 2O4GA 9ICLA 2Q3SA 2UVUA 4DFJA 1S9EA 1ZQCA 3WNEA 4CEDA 2KFZA 5HNKA 3OYEA 4F3OA 1Z3EB 1TK5A 9ICJA 1RDCA 1SL1A 2BPCA 4QZAA 1HUZA 4I2QA 3L3VA 1KRPA 3DM2A 1NKCA 4AHVA 4ED3A 4QZHA 1U9LA 1L3TA 4F4YA 2KFNA 1CZ9A 4MEYA 4RT2A 4EZ6A 5HRNA 2XHBA 4CGGA 4QOZB 2B5JA 4CEBA 5KFYA 4M6WA 4Z6FA 4IR1A 4KTQA 3C2MA 2A1SA 3LP0A 3AVAA 3NHGA 5HRRA 2FMQA 4GC6A 5L1KA 4DMNA 3AVMA 2IOCA 2C28A 2ZE2A 1VSMA 1XI1A 2X6NA 3A2FA 8ICPA 1VSIA 2AGPA 1XC9A 3ZT3A 1RT7A 1IM4A 3LAMA 4Z6DA 1B9FA 1Q9XA 3SI6A 4Z4GA 2ETJA 4QWBA 1TK8A 2IC3A 3LP1A 4KPYA 1TKZA 2D0CA 4QCLA 4B8CA 3RH5A 4O5BA 5EWGA 4FK4A 4AHRA 2VWJA 3VQCA 2HVHA 5D4BA 1NOZA 4DU4A 3N4MB 3PMLA 4FJMA 3ZDCA 2DFHA 2YNIA 4H8KA 5DKWA 4YXJA 4CIEA 4R64A 4YMNA 5J2EA 1ZQIA 8ICKA 4ECQA 4F4ZA 3AVJA 3SQ1A 2Y1JA 4CFDA 3TAEA 3K75D 2MUTB 1LV5A 4BE1A 4JK1A 3V9XA 4DSIA 4M9NA 1I39A 3L2QA 4PWDA 4TUPA 2JZBA 4ELTA 4CK1A 1A76A 4XA5A 1Z25A 2YKNA 4KB0A 1RZTA 5DBBA 3UQ0A 2FPLA 3SV4A 4H4MA 4IRDA 4TQRA 3RJEA 1EETA 4RUCA 4LZGA 4DTNA 2Y1IA 1BI4B 4FJ5A 1BPBA 4CGDA 4DLEA 1NJWA 2R8GA 4UAYA 4AHSA 5IINA 5KFJA 2JEJA 4NCGA 7ICTA 4IBNA 9ICXA 3V9WA 3T1AA 7ICPA 2BE2A 4DL4A 4F93B 3O4NA 1IKWA 4I28A 1TV9A 4EBCA 2FC0A 2UVRA 3SQ0A 1FXXA 1WSFA 2A1RA 8ICNA 3TAFA 4I2CA 2VANA 3F73A 2ASDA 4Q45A 4RZRA 2F96A 4FCYA 2C2DA 3OYIA 3TAGA 4CEFA 2HNYA 2V9WA 4JV2A 3LANA 3NCIA 5DGBA 4KI6A 1HNIA 4I2HA 7ICRA 3Q8RB 2VA3A 4C8KA 2J6TA 3MBYA 1S1WA 3MEGA 5J2IA 4OGEA 1X9WA 4F4WA 1BQMA 4IR9A 4C8MA 1KDHA 4M9LA 4OKKA 3I8DA 1UOCA 5KGWA 2BGGA 5KFTA 4YD1A 3PMNA 5KG0A 4FM1A 2NRXA 1S9FA 3NF8A 3OGUA 8ICCA 4M2YA 1S6QA 1A5WA 3ZSWA 2W42A 1WSIA 1RXWA 4KREA 5J0XA 7ICHA 1ZQMA 2YNFA 4PHDA 4PGXA 2XCPA 4J9NA 5HMMA 1ZQOA 3ZDDA 4E1MA 3QNOA 3AVBA 4WE1A 4RQ8A 4O5KA 4PA1A 4OLBA
chains in the Genus database with same CATH superfamily
4P74A 2WHOA 3VVTA 2F8TA 1Q86T 1ZQEA 4QYZJ 4JI6J 4RW7A 5JVGL 1WOOA 2XYPB 2WHEA 3O3LA 2ZM6K 4B08A 4RQ2A 2Q36A 5HATA 2KXFA 3PRDA 1XEZA 1ULRA 4P9SA 3W1YC 4YB5A 4NYPA 3ZO7A 2Z1HA 5AXMA 2YHWA 2CZ4A 4KHPF 4F0HA 4HHTA 1WI8A 1TL5A 5D4LA 4K5RA 4J7CA 1CLQA 1U0HB 4ZVOB 5LXRA 2WTUA 4WYWA 3C15B 1NK0A 3D2QA 3OJSA 2UUAF 4DQIA 4FLVA 4DV0K 4P72A 4KRFA 4NLTA 3CC2S 3KWMA 2QKKA 2HQCA 5F8IA 3I5BA 3MOZA 2DTJA 5CR0A 7ICIA 5ADZA 3M3ZA 4CZIA 4OVLA 4YDUC 1ZQRA 4HACB 3KHGA 2CRXA 2H65B 9ICPA 5CZXA 1VFJA 1U2VB 4DZDA 4QIVA 4ED1A 2I9GA 3QUTA 5IIMA 4CM0A 2HVZA 1W0HA 3WKEA 1IBKF 4UAZA 4Z7YA 1NK9A 2KG1A 4QZCA 1B0XA 1XR6A 3L9ZA 3RB4A 2F3NA 1RHQB 3NMRA 5JLFA 1C4AA 1T11A 4WTOB 4E7KA 2YNHB 1NK5A 3A13A 4DQQA 1NDKA 1KQQA 4FZLA 1XMQF 4FYVB 5DGAA 3AODA 2F9JA 1KHWA 2Q43A 3D0PA 4XEIA 4LFAK 1FNXH 3WC2A 3H40A 3BB5A 4RWTA 2AEFA 3HJEA 3R1LA 1N5WA 3K5MA 2J9CA 3EZUA 3VQQA 4FPRA 3T5HA 4C3LA 2W11A 5D3GB 4A2BA 2A6AA 2MSSA 2FBVA 3DDNA 4KHWA 3CCLS 1MG7A 3KLIA 4BACA 5AQYA 4M5GA 4ZJOA 2YTCA 2MGZB 2O8CB 2P9LA 1APSA 4Y2MA 3OXLA 3N28A 1NJIO 4URSA 4USMA 4PZNA 4KC5A 5CRXA 4H54A 5AI0A 2H3FA 1RU2A 2GMHA 1IKXB 2JLEA 4WP3A 1GMWA 3LGMA 4ED8A 1UJ4A 2E20A 3MM9A 5MAOA 5AT1B 2DNQA 4KAIA 3C65A 1IKYB 4NZ6A 2G1HA 5LM7E 2G0JA 4DTJA 3LGNA 3LP2B 3SPYA 1M0SA 2MLXA 5AK5A 2DGOA 4F92B 4LREA 3B4MA 5CQGA 2ZEJA 2WF6A 3V7LA 2FPMA 3QATA 3U1MA 3DU5A 1XNRK 5J2NB 5J2JA 1NGEA 2FJVA 1UCVA 4KLUA 3HHKA 5ETOA 2MSTA 8ICYA 2DGZA 3G6XA 3CYMA 4YY3J 3R3LA 3D2NA 3TACB 3PRBA 2DTUA 2VU5A 5JUMA 2UXBF 5LT5A 2V7YA 3RH6A 4LJMA 4H03B 3OYNA 4QJVA 5HVGA 5AE2A 3VENA 1SJ1A 1RWWB 4JI1K 2R2RA 1HQUB 4ECRA 1NUEA 4NLQA 5ALJA 1FT8A 3HSZA 1WWUA 1KTQA 3WKBA 4MAKA 3PR4A 1V3SA 3VQ6A 3JSRA 1E6VB 1C0MA 4OYOA 4M5HA 4ZVUB 1Q82T 2DFLA 1EX4A 4LF4J 4W5QA 2PMZC 3PNIA 3W5XA 5KRTA 3EYZA 2Q0RA 2FLOA 4PEOA 3V81A 1ASVA 2M0NA 5DDYA 4DL7A 5DO2A 2R3VA 2CIMA 3RBZA 4F36A 5GIPA 4RNMA 4MTPA 1M5SA 2E7VA 1VSFA 2B6AA 2V67A 2VQEK 4CF4A 1L7OA 1VAZA 2HOFA 2PN6A 3K2PA 3HI0A 3IGVA 4OJLA 4F3TA 2H5IB 5ALOA 4OYIA 4BXOB 4U7UK 2I8EA 3D68A 5DM6Q 3KHRA 1VQMN 2KSOB 4ZCMA 1KD1O 3GIMA 4OD0A 3GIIA 5D4NA 1PYOB 2BOAA 2MUTA 4AYBF 1FJ7A 3P3DA 3QO9A 3TEHB 4C3MA 1QLNA 3AA4A 2K4HA 3HFVA 1PK3A 3F5TA 3MECA 2HAFA 2DH8A 2JWKA 4DB3A 1XSNA 5B0BA 1IV8A 1RTHA 2G5IB 1FO4A 2MQOA 3NRZA 1YF5L 3I1YA 1BI4A 4Y2QA 1IH7A 1HKGA 2KXHA 2KEYA 9ICTA 5JJBA 5KL8B 4KHUA 2OTLN 2MU2A 4OZ5A 3OFFA 3ZZUA 2KKHA 2BTFA 1XR5A 5HO4A 5I42B 3RSEB 5F8JA 1J5OA 2Z2LA 1Q53A 4NRUA 2YB4A 2V7ZA 2H3QA 1VJQA 4M3RA 2PY5A 3I9V9 4G1QA 3NGDA 1WWVA 4IG0B 3BBCA 4IJAA 3V2UC 3CJAA 1GOCA 2ASPA 4BG8A 4KB1A 5LOQA 1JJ2R 2KMDA 1S79A 2BKNA 4L72B 3MFHA 1W9HA 4GXKA 1H2UX 3RJMB 3T1HJ 3IR7B 4A4JA 4HTLA 4O4GA 5C25B 1LW2A 4Q7AA 2P9NA 2UYTA 1JKHB 4DHVA 2NLXA 3S01A 2WVFA 4FW1A 5AK3A 3F2DA 2A1JB 1HNVA 3NNAA 1KAYA 2BZ2A 4MH8A 4JI6F 3E66A 2ROEA 3RG6A 3E3XA 1W26A 5JRTA 1TVRA 3SSQA 4DV1K 1HI1A 3P31A 1CS4A 1VRTB 3OL6A 5ALVA 1JROA 4Y6IA 5KFFA 3OR1A 4QBUA 2EX3A 1VQOS 4I6MA 2PMZD 1ZD3A 4PAAA 3NFAA 3TA0A 2E2NA 3TEGA 4M3ZA 1RWUA 2CXYA 3VZHA 2LQ5A 2J6UA 1FD8A 3DXBA 3ZX0A 2FLPA 1B7YB 4LF6K 5AZJB 1OWXA 2ZBRA 1HKBA 1QDUB 5K14B 2R7UA 1KLMB 2C3MA 2ZOGA 2U2FA 3CJRA 4UAWA 3MM6A 4V19S 1WG1A 3K9KA 8ICFA 2DH9A 3NXZA 2QV6A 1S7IA 4B3MK 4DCHA 2J8AA 1TKTB 1LAVA 4GY2B 1N32J 3BM7A 3ALYA 5L1MA 2LLZA 3X1LB 1KVKA 8AT1B 5IOLA 2B4PA 5AKYA 3NGRA 4LSLA 4CO0A 3BO4A 1WWHA 4PPZA 5FJ4A 3VPZA 1VJWA 5AQWA 3CQXA 3IUCA 4PYAA 3M30A 5J0TA 3NGIA 5H9FK 4X84A 3ZDAA 1EZZB 3A3NB 1C0TB 1PYSB 4CBXA 1RSCA 3HHDA 3IS9A 4X4TA 4KLHA 1WB9A 1X4BA 1JLBA 5KT3A 3D7EO 2R8JA 3HVRA 1HYVA 5FPEA 2F77X 3WK5A 1T02A 4IEIA 1QSYA 1VQPS 4RW9B 1Y5LB 3FEYB 2G0IA 1U26A 4OI3A 4FOEA 4KKOB 3OD2A 2O3DA 3CCRN 3HX9A 4DO9A 4F50A 2OD6A 2Y0SF 1M5HA 4E1JA 3QBXA 4ICLA 4IFYA 4F5PA 1XIQA 4R65A 9ICRA 4O44A 4ANDA 2FHJA 3VAIA 1U47A 1Q8BA 3NGSA 1FKAF 4ED6A 4JKGB 3UFCX 3O08A 4CO5A 3HILA 3JSMB 2RNEA 3H8JA 5B8HA 1ZD5A 4FDFA 5C2FA 3RU0A 1WHXA 3ZLJA 3CD0A 2FXUA 5J8YA 3K57A 1MWQA 5AJ3J 4YD2A 1N34J 1HJPA 4JBCA 1E6YA 2IRXA 4IDHA 2ZBPA 1RTIA 3CXCM 2HG4A 3M32A 1YITN 1MWYA 1DLOA 2C1EB 5LSOA 4A62A 4WP9A 1EP4B 4GKJF 3PSFA 2XMUA 1YG0A 2UZAA 3O3HA 3VAGA 2MDAA 1FDNA 4HDGA 1IUJA 3VQPA 5KFRA 3DRXA 1MU2A 2V2KA 4IFEA 4RPYA 4BDPA 5G5HA 4YY3F 2D9OA 1XSPA 3VQAA 1X8DA 4JI5J 5TKWA 3MGIA 1OUQA 1LW0B 1YBUA 3G6YA 3VGLA 2IVPA 2MQLA 5D0RA 2OMLA 2CJYB 1NPPA 2DNHA 1KFSA 5DLGA 4DR1F 3DLKB 4LF4F 4C4RA 5AE1A 3L4QA 3C16B 3W9HA 4IH6A 3LVVA 1C2PA 3PFEA 2QJ3A 3IRXB 3ZZOA 1PCAA 2NNWA 3KLFB 1Z4UA 1X3MA 3VC8A 4KV8A 4W92B 2IS3A 3KG4A 4E7IA 4WBFA 1X9SA 1QHTA 1YQHA 5DS7A 4DV7F 2AHOB 2X1AA 2ITMA 3ENVA 2PD1A 1BHNA 1VCTA 1OKJA 1HWJA 5EU7A 2D7SA 4LT6A 2JZBB 2HHHJ 1FJCA 3HF5A 1N5YA 4ICAA 1HNXJ 4DV2J 1NM1A 3KLVA 2MZQA 1VQNS 2VWKA 2GX8A 5E3CA 1YJTA 3QEVA 3GYGA 4DDFA 2HHQA 4M5DA 2JJ4D 2VPYB 2DY1A 3EGWB 4CJQA 4RX6A 4FJLA 5B66U 2B9EA 3DU6A 4H4OB 1CJUA 1TVAA 2KN4A 1XS9D 2GCFA 4RNNA 2WONB 3QJJA 3QGHA 3QGPA 2QWNA 2V34A 1EKEA 3DDHA 1NHUA 3QT5A 4DUZK 4DSFA 1CJVA 2EG1A 2X3DA 3J8AA 4CF5A 2DNZA 5J0WA 2VBZA 3H0RB 3NH1A 2JWNA 3BKTA 3GMGA 4EBDA 1J2NA 2F3JA 2RS2A 2MLYA 3PKYA 4L3QA 5BN8A 4CGHA 2Q6CA 1S76D 2C3YA 2IHNA 1HL6A 3TNVA 1NGJA 1GQEA 4BRHA 2O8BA 5BR9A 4C4WA 4QZDA 2QLTA 3GB0A 2RF2A 4JK7A 1MMLA 1C6VA 2O5DA 3PHEA 3WKCA 1RJJA 5K8MA 4OX6A 3OTOK 1UT8A 3VEOA 2HFUA 2U1AA 3I5CA 4FJHA 2WBMA 5AKLA 2DRAA 3UW1A 1WN7A 1FWKA 2F9DA 1DK3A 3JAMY 4E0DA 1S4FA 1HHSA 8ICEA 2LXUA 2R8HA 2AKWB 3T1HF 2Z0GA 3H4BA 3BQ2A 3DRYA 1NH8A 4O3OA 4BC7A 2YPYA 1TQLA 3AMZA 3QRQA 2R7TA 1WNSA 3OYHA 1ZBSA 3RJKA 4HLBA 4DX5A 2ASLA 3DLGB 1XNQK 5ALRA 3T9ZA 4I4BA 4UB2A 3W8PA 2BANA 4OZ0A 1GLBG 4ECSA 1TGOA 2XQCA 2FJWA 3E9OA 1SXDA 1MROA 4CZJA 2HSZA 1S59A 3LALA 4CIOA 3S3OA 4Z6CA 2AH5A 2KG0A 3OSNA 2D0AA 4OYBA 2YQEA 4U9RA 4XDCA 2ZZMA 5F1XA 4QZ9A 4OPHA 1ZZNA 2NS1B 3V6JA 2RMLA 1YIJN 2KYXA 5KFAA 1MC8A 2YWKA 3R5AA 5ELZA 3LDNA 1ZTTA 4OJ5A 5EE3A 3H20A 4CO1A 2AV5A 3G9CA 3P39A 2O8DA 1CJKB 3VTIA 4RWXA 3OL8A 4BG9A 3J7A1 4HKQA 3GP9A 3AXKA 2N7CA 4ER8A 2QYCA 4YHHJ 1GMUA 2IMWP 2VBYA 4NCAA 2ZJQQ 3F41A 5SZTA 2ITGA 3ET6B 3GU0A 2HGNA 1T9WA 4O55A 4ETZA 1FRIA 2VJVA 1BGXT 1FEHA 4W4MA 2IVYA 1U1QA 2M7SA 3CMAN 3DLRA 2WSFC 3EE3A 1Q8LA 2ZUBA 5AXNA 6AT1B 4DX7A 1W2BR 4I2BA 4XQ8A 3S6EA 1S8OA 3AL0B 1YJ7A 3CCJS 5GINA 5CHCB 3NOGA 1RTJB 3MMBB 1A5VA 2GMLA 1PAUB 3ITHA 4K4SA 1GTEA 2RE1A 1TUYA 4YG2A 1NJIT 4AILC 3AQEA 3NTUA 1Z2ZA 4A5BA 5AQPA 5HROB 1WC4A 4QR1A 4DV6F 1XK8A 4HCCA 4N8NA 1P1TA 5A2QY 4LQ9A 3RB6A 5GAHU 4FWQA 1L3KA 4J9VA 1NWKA 2ZUDA 3THVA 5M2PA 4CBWA 1IR1A 3QICA 2KXNB 3TTCA 4P0PB 2QARB 2KP7A 3QNMA 4FO6A 3UVJA 4E7LA 1X66A 3E51A 3G87A 9ICWA 5CR4A 1Q5YA 4RG8A 4I2AA 1NJZA 3QJPA 3NVMA 3VQ7A 4FBUA 2HURA 1LOTB 2G4BA 3GONA 3L2WA 3D6MB 2W7OA 3PLAA 4CI0B 2ZIWA 1PVPA 1RT2A 3ULEB 3W7BA 2F8SA 2YKAA 1X6JA 3C6AA 4AXJA 4O23A 1TZ0A 4ZKAA 1BC6A 5AK4A 1KVIA 1TL3A 4YB6A 4R0JA 1UAXA 1KTVA 4A8KA 3E9PA 4RPZA 4BE2A 4DX8H 4DQSA 4J9QA 3UN3A 2EK6A 3LDLA 3R6MA 1TL1A 4HTJA 4JI5F 5AM1A 4C98A 3MR5A 3CDAA 2Z7JA 2VBXA 1I1GA 1D8YA 3FZBA 4FN5A 4ZJLA 3IV6A 2B43A 1JJHA 2J7WA 4CW7B 3S9HA 3CDUA 2W03A 4A8SA 3ATVA 3LPTA 3OLBA 5IC4B 2ZIXB 3GYNA 4KLMA 5C5JA 3LPYA 4P2SA 3AVLA 4L73A 4OI2A 4P2MA 1RABB 9ICHA 3MMJA 5E2QA 2BR0A 4AD6A 3W5ZA 5F3TA 1VI7A 4Z6EA 3U3YA 4LFCF 3PDNA 2CRLA 1IKVA 2BA9A 3MR2A 2EH9A 1LWFA 3PW5A 4R0EA 4YORA 2DHSA 1QTMA 4PUOB 3O5BA 1KD1T 3I33A 4Y1CA 4O0NA 2CJXB 3DCAA 1RK8A 3THWB 4IG3B 4GVEA 4PWWA 1V9OA 5HANA 1JLQA 1BWEA 2HHHF 1HNXF 4DV2F 3ZSZA 4ZHRB 4QS7A 2QIFA 2K06A 2QT7A 1XTZA 4J2AA 1X5SA 4URGA 1JLAB 5F9LA 4CLUA 4DSEA 2DXEA 2BW2A 3ETRA 3L7PA 3SCXA 3I0SA 4PG4A 3PACA 4K4YA 4FKXA 4NB4A 4B9TA 1HARA 3SI8A 2AX0A 3N5FA 4JWNA 4OYMA 4MDAA 4EBEA 2KRBA 3HPHA 1T44A 3SMPA 3D0GE 2E2QA 1BMQB 1ELOA 1PKUA 1RA6A 3RH4A 4Y65A 1R3NA 1WNEA 3TSUA 4W5TA 2W1BA 1WHYA 3PVXA 2G07A 3KVGA 1JLFA 2W54A 2XSFA 2HHPA 2WF9A 4KLQA 4P2XA 3ID8A 4LF9K 2VIHA 1RB0A 1PZNA 3E8OA 4FYYB 2X6SA 3OYBA 1S1XA 2R2TA 2FZGB 1IQTA 4CJVA 1FIQA 1ZQ1C 4P73A 5J1EA 3GILA 1CPZA 2YX8A 1JCFA 4RW8A 2BE7D 1ATRA 3A5LC 2P9KA 3PO5A 1NM2A 2UVVA 4V19X 2GGPB 4KHRA 2W8KA 3G0ZA 2Z2YB 4I2QB 2ZWHA 4LF1A 3EE8A 2PXIA 4Z37A 4NCBA 3AGKA 4DR6J 1HJRA 3HT3A 5EWFA 2I5HA 3D6JA 1NSKL 3BS5B 4CEEA 2FMPA 2WW4A 1MMNA 2XBPA 4AYBD 4JI2J 2BKEA 3H3NO 1U8SA 4MMOA 3V72A 3EDQB 2QZ8A 2YWGA 4C7ZA 2P6SA 1MQ3A 3CFOA 3CP8A 2JH3A 2DB1A 4USKA 2AZ3A 3MDAA 4IQWA 3M2RA 4ID5A 4WFNL 3D2FB 4I9LA 3DLEA 4Q44A 3V7JA 2DR7A 2CDQA 3WQTA 3M9OB 4FLWA 4FFDA 2P9PB 5IFMA 2CN1A 1IBLJ 1RT7B 2LXFA 1B0PA 3TJ9A 3BQ0A 1TUWA 1T03B 3MPUB 1BU6O 3KZBA 8ICHA 3VMFB 2P51A 2OPQB 3TP2A 2BJ8A 2ZTDA 3AA5X 4A8QA 5BPMA 4N41A 2ASYA 4OJ6A 2V4JB 4YHHF 3TOQA 3TSPA 3UQSA 3TAQA 1X7VA 2KT5A 4DFPA 7ICQA 2YNIB 1HHQA 4QWAA 3TFSA 4IH5A 4UTGA 3A5NC 3ENWA 4OO1J 2AYGA 2GJIA 1FFGB 2ILYA 5BYSA 3WIUA 2G8HA 1GTHA 4OPKA 4KN4A 2RP5A 1XJWB 2E5GA 3RJIA 1OJ4A 1WBBA 2X51A 4CYUA 9ATCB 2ZHBA 2Q4TA 3DOLA 1KBRA 2PFNA 2RSQA 2YKNB 2P9IA 4MFAA 4DTMA 1T4GA 4IC9A 3JPRA 5FDLA 2P9CA 5C2DA 2MLZA 2XWYA 2HS4A 4YOEA 1ESVA 3RR8A 2VJUA 4B3SJ 5IIOA 1Y11A 4M1KA 4FJGA 1IJFB 1SB6A 1EETB 4I56A 4RW6A 5M1FA 4XDDA 4UOHA 3C1ZA 3W64A 1HNWK 3IBCB 3OV7A 4ZIVA 4JKFA 5GAGU 2FPKA 3AEVA 5ADXH 2Z4PA 4UB3A 4DR7K 1TKXA 2NZCA 3SD7A 3LH2S 1KEJA 1L8LA 4Y28C 3F5EA 4KQZA 1DKGD 3QAUA 5KT6A 5L1IA 1S72S 4DR3J 4FF2A 1URRA 3WKAA 1S48A 1HYSA 4EYHB 1RQNA 4RQ1A 3TVZA 5AI9A 4RKUC 5GVQA 3V1OA 2FIUA 1NK8A 3G6ES 3VQ4A 4MYTA 3H4DA 2K89A 2W2NP 1B4FA 5KAFU 1SJQA 5KFSA 3MEGB 5T14A 2DNMA 2LECA 1NH7A 3L4BC 3O9RA 4NO7A 4LF8K 2QSFA 1S0VA 2OD4A 5KI6A 1YDLA 3I28A 3M9MB 5B0CA 5FROA 4IOCL 3CWJA 4K0KJ 2GO7A 2LQ9A 1FA0A 2BM1A 3PNCA 2DNPA 4HH0A 2HWIA 2DISA 4PGYA 3OR2A 4OYAA 2MKIA 2YKMA 1K0VA 2FYXA 2HQFA 5H9EK 3WX4A 4EX7A 2X74A 3GV8B 1KOOA 3UIQA 1Q3UA 1LCUA 2Y0SD 3HHLC 2RVJA 5HBMA 1ZD4A 8ICAA 3U9DA 4OJGA 3LVWA 1GLFO 3QFPA 1C20A 5BJRA 3K17A 5ALTA 3QMQA 1XO1A 3TU5A 4IL6U 2W6LA 1NNDA 1WSVA 2HMIA 1HR0J 1OSDA 4WKRA 1V3ZA 9ICMA 2YNGA 4WP8A 2HRYA 5DZ7A 4CF9A 5L39A 5DM7L 5C24A 3KMQA 2HNDB 1LNQA 4F91B 4U8VA 3PW2A 3KK2A 3AY0A 4CTAB 1Q46A 7ICFA 3O6QA 3R2CJ 5B08A 2OMOA 4DTOA 3M8QB 2ILZA 2DD8S 4I7FB 3SQ4A 1RAOA 4F26A 3JAMU 5CY4A 2NLWA 1ZQSA 1WBDA 1TP7A 3IWNC 3S1TA 2HVEA 2I38A 2WF8A 1U1LA 4JRQA 5D8HB 3ATUA 1Q16B 3ICXA 4KX5A 2V8GA 2ZD1B 2MQMA 1XR7A 4C8ZA 1QQ5A 5KFDA 2HLUA 5J2PB 3QIPB 5J2FA 3GFXA 5AM5A 4HTIA 3Q86A 4DL5A 2HKEA 4CJTA 5L1JA 2WB1C 5CXTA 5AXKA 4ZP9A 5C42B 1WF1A 4GXIA 2MKSA 1M90O 4B3RJ 4P75A 2F63A 3C7NA 1N2XA 5IS2A 2E5IA 2QGFB 3GCXP 3IR5B 4YR3A 4LF5K 1R8PA 4KHSA 3GJQB 3R1XA 5ADXA 2VF3A 4DPYA 3VF2A 1VBZA 3H42A 4UASA 5KG6A 5AKEA 1IBKK 1F5AA 2AJQA 1RHMB 2EFGA 2WFAA 9ICCA 1NAQA 2PMWA 1OSCA 1ZAXA 5F0UA 1WC0A 4XAKA 1NMNA 3GIJA 1C1CB 4QZGA 3NS6A 4L8RB 1Y9OA 3QEXA 4DR6F 2DKZA 3RJHA 4WCEL 1I94J 3L2RA 3OA9A 4S0MA 2D3UA 4CHYA 2WK4A 4JI2F 4YDUA 4MKAA 8ICIA 2J9EA 5C15A 4EZ9A 1V5VA 1C0UA 9ICBA 2EBGA 3M1FA 1FCAA 9ICLA 2Q3SA 2EFVA 4DFJA 5IV4A 4ISEA 3WNEA 1NB2A 1EWQA 1EB0A 1T3QA 5CYQB 2FJBB 4L75A 1Z3EB 2K1RB 9ICJA 3JAMO 1O08A 4AF1A 4QZAA 4JI8F 1IBLF 4MKYA 1S1UB 1KRPA 1QE1B 1NKCA 1L3TA 3MEDB 5H1SV 2KFNA 5I9EB 4LRDA 4EZ6A 1QUPA 4PWUA 1N36K 1XMOJ 5HRNA 3MUMP 3U7JA 1KOHA 5SUHA 1Y64A 4ED5A 2V8HA 1A0OB 2A1SA 3IWXA 1T05B 4BGAA 3NHGA 4FNHA 2D3OR 1RWKB 1VQ6N 4FWSA 5L1KA 4NI2B 4DMNA 3AVMA 2C28A 3J7Z5 1VSMA 5ETNA 2VFTA 1PC4A 1U1KA 3A2FA 3L4IA 2O6KA 2UXBK 3CJ8A 1B9FA 2GHWA 4FNIA 5BR8J 3VQTA 4XO0A 4FO0A 1VQ8N 1TK8A 3KJVB 3H2UB 2IC3A 5AM0A 1LWCB 4NLBA 3RH5A 2BACA 2BW7A 1N62A 4ZP7A 2CG4A 4B3SF 1VMBA 4YDDB 4DOZA 1GNKA 2G5HB 3N4MB 2D6FC 2NZTA 3WQUA 2DQNB 2QB0B 4YXJA 4IXCA 1LK7A 2PEBA 4LMZA 5C2CA 1T95A 2EWHA 2VWBA 2MTLA 8ICKA 2MB0B 3AVJA 3K9JA 3QLHB 1HMVB 2NYVA 3CD5A 2Y1JA 3OVSA 3EJMA 4H0OA 2AJ0A 3E01B 4IOCQ 2L3MA 4CFDA 2OEMA 1AZSB 2VJ4A 4M9NA 1WORA 2JZBA 4ELTA 3G86A 4DR3F 1K9MO 1A76A 1VK8A 2QA4N 1YUWA 5AQFA 2BH1A 2V94A 2P9SA 5DBBA 1SWWA 5CEHA 3UQ0A 3KK1B 2VC0A 3GU3A 4FJ5A 2FHKA 2R8GA 2HQ3A 1P7DA 4UAYA 4OLPA 5A2QO 1HIYA 2FF3B 1VQYA 1K47A 3NBPB 2RE2A 1QQOA 2WAQF 7ICTA 4NXMJ 3N7RC 9ICXA 3TVKA 3CCVN 4NLCA 1M1KO 4DL4A 3UI3A 4I28A 1FO1A 3C66A 4B17A 2CPIA 5AQXA 3UB5A 3I31A 1KXPA 1WSFA 2CJBA 1PSDA 1Q95G 3BGOP 4J91A 3N6NA 2VANA 2M2BA 3F73A 2GIFA 1ZS6A 1TL7A 4RZRA 1X4CA 3GWCA 2HNYA 5LMNJ 2UUCJ 1F6TA 4GKKK 5HMWA 3MWPA 4BX9C 4I2HA 3U02A 3C14B 4TU8A 4L76A 5ALZA 2VA3A 4WFAL 1S1WA 3WK8A 1T3OA 4OGEA 5F8GA 2IVOA 5KQDA 4WIQA 5B0EA 4OZLA 1HR0F 3MPVA 3J7YP 1WSRA 1GXTA 5KGWA 4YD1A 5KG0A 4FM1A 4EK2A 3J81j 2XYGB 5M2RA 1QJHA 4K4UA 1XN9A 4O8UA 1S22A 3ZSWA 2DRBA 4JI7J 2ASMA 3J81Y 4HT7A 1SUQB 4BRPA 2Y1RI 4F71A 5J0XA 7ICHA 3THPA 3MM7B 3F2BA 2XNQA 1VQ5N 4QYZK 1H7WA 4JI6K 2COLA 2YNFA 2W7PA 2KVQE 3W2WA 2VGNA 2FJAB 4K8RA 1RT4B 2GJ2A 3N4QA 3CIZA 1ZQOA 3ZDDA 4LR7A 2EXUA 4LBHA 1X6IA 4WE1A 3A8EA 1R6YA 3EKSA 4CJEA 3QEPA 2RKIB 1PG5B 2HBRB 2GH1A 2FGOA 4IO8A 3VEYA 3QU5A 4PHTX 1JALA 4KMUA 2WB4A 1KW4A 4AHCA 1VHIA 3UMCA 1U6BA 3UNYA 4YMOA 3V6DB 2YX6A 2DUYA 3CC7N 2R18A 3QUBA 4MKVA 1N5QA 2ES6A 2BRKA 4NWBA 3AV9A 1NRKA 2AJ4A 4KGXB 4OJ3A 5BPNA 1HQEA 5JMVA 2EG2A 4DV5F 1QZ6A 2QWOA 1Q18A 5F0WA 3CMES 2IHMA 1F60B 4B3RF 2OA8A 1NU0A 1OY8A 3S7RA 4C4TA 3O1BA 4CCHA 2R7RA 1ZH5A 2UV8G 2FBTA 1BPXA 4BC9A 8ICWA 3LO3A 3VQSA 4CJKA 1XQSC 4JRPA 2VV5A 2VCPA 3M2VA 1ZD2P 3ORYA 1Z4OA 2QMXA 4DQRA 2HS3A 3OHBA 2EI5A 4USVA 4B9UA 4QU7A 4QNLA 1I94F 1FJGJ 3PW4A 2CQ1A 2HWTA 3C6UB 1RDRA 1GMWD 8ICVA 2ZDPA 5D46A 2A41A 1HWKA 1AUDA 3TARA 4O8KA 3BS9A 3MCOA 2VFRA 2ZZNA 3DEEA 3FK4A 5AQZA 4FE3A 3FGVA 5A6PA 1VBKA 3VQ9A 6FD1A 2QSWA 5I3UB 2EW9A 2HQDA 3AUOA 4OX7A 1C7YA 2DBYA 1HKCA 4PYDA 3ICLA 2O4IA 3Q83A 3SAHA 4WU3A 5HL7L 1S10A 4B1YB 5CHGA 2F1JA 1FXLA 1VSKA 4Z4EA 1MQ2A 1T7PA 1FDDA 4IQMA 3UWTA 1VQMS 1KQFB 4DR5J 3KKSA 3R1HA 3DMJB 1XMOF 2DR5A 4LSNB 4J9MA 4DPXA 4P10A 1IIPA 2LYHA 4I68A 4C8LA 4UW2A 3SCLE 3C29A 2ZH3A 3JPTA 2NXCA 4UUXA 4BJQA 3CJ3A 3FCVA 1U02A 3I0RB 5IT0A 1WC3A 3Q8SB 5HQLA 2FJ6A 2UXDF 1BQNB 3PRVA 5HMZA 4B8AB 4YY3K 4RW4B 2FI1A 5K9FA 1NJYA 1RT6B 1IO2A 3W2VB 3DRPB 4FVUA 1X4EA 2GV9A 5EXWA 4Y2TA 5BR8F 3BEXA 2UP1A 1CQNA 1UFLA 3IAS9 1OXJA 5H2FU 4WU2A 2R42A 1ROFA 4HWIA 1EXQA 1LFWA 1JQGA 4MLHA 3MEKA 2IOFA 4FJNA 3ULDA 4KHQA 2BUPA 1ZQBA 2B4OA 3QESA 2CKWA 4YEAA 2RRDA 3TW0A 4LF4K 2K60A 2XWXA 2D0PA 2EFQA 3OYCA 4JN4A 5GADP 4QJFB 3T6JA 2FJEB 4LRCA 3Q7BA 2EFNA 2ZH1A 5ALMA 2CPFA 1QVFR 2VOOA 2WBNA 1SS6A 4K41A 2DF4B 3SCKE 4XH4A 1YTUA 4OI4A 1NI3A 4ECZA 2WSEC 1J5EJ 3QSIA 3PCOB 2DGTA 2FZCB 3RJFA 1QAXA 1ZOTA 4M3XA 4OCZA 3W61A 5IQ6A 4N7TA 3B6BA 2E5SA 1S1TB 4GLXA 4ES3A 3OYAA 4C11B 3SQ2A 1X2IA 2GQ2A 8ATCB 2RH3A 2KKVA 1BWFO 2KD1A 1IG9A 4NPOA 4ZH4A 2ABYA 2XZWA 1F21A 3IO1A 4FKYA 3M2UB 5F8LA 4P4MA 4I64A 3M7VA 4IO1A 5ITHA 4AHTA 4FLUA 3ZNJ1 1TUGB 4NXMF 3OBYA 3M4XA 4DXLA 4JV1A 1UWBB 2XMMA 1RDDA 4DLGA 4KLJA 1RAGB 4WIIA 1RWNB 2HI0A 2DEIA 2GS8A 2LU1A 2HHVA 2BYCA 4C0BA 2WSCC 3OW2M 3LL3A 4IJNA 3ZT4A 2CPZA 4GNIA 2GFFA 1ZQHA 3TABA 2MQ8A 5J8YC 2NYHA 4KLFA 3MGJA 1S5JA 1TYQB 3HSDA 3M8RA 1NSQA 2LMIA 4EO8A 2I6WA 4PCQA 2UUCF 4PQUA 3KD5E 3HYFA 2VG6A 4Q0BA 1BIZA 3MN7A 1NNLA 3FQKA 3Q2TC 4FVCA 3AO4A 4CT9A 2R7YA 2K2PA 3T1YK 4GV9A 4J2EA 4LRAA 2F8MA 3FCWA 5GAEP 4USIA 1SCJB 1PBAA 3KHHA 2RRAA 3MM5B 1NGGA 3HHNB 1V9PA 2FSKA 5FRMA 4U96A 3H2LA 4CBUA 3Q8QB 3T1HK 3LK9A 3EX7B 5JU5A 2XMAA 4TQSA 3M1VB 3LGHA 3ULHA 4IFVB 4FZYA 4FSVA 1Y5NB 2ZFHA 1VSEA 3NF7A 2DY4A 4CJFA 4QU6A 1AYEA 4EYIB 4P7TA 3D4JA 3CM6A 4LD0A 4CZGA 2QRRA 2PIIA 1G15A 1KDNA 3BSAA 1IBCB 3FVYA 3DHXA 3RB0A 2ALZA 4DV4K 5CH7B 2GELA 2L9NA 1LKYA 4WYLA 5B0FA 2V0NA 3CJ5A 4FJJA 5L9NA 3ENBA 4GO7X 3HM9A 4O9MA 2ADBA 4AHUA 3MR6A 1PJ5A 5IWAF 4Z0UA 3WNHA 2DIUA 4OGCA 2KHCA 1Y3JA 1M90T 3IDWA 4I2PB 3GJSB 3EVWA 1T03A 3U9ZA 3CCZA 1FD2A 1VYAA 2OPQA 1KBUA 1I5OB 2DPJA 1VRUB 1VQ4S 4MFBB 4FOIA 4ILRA 4PZVA 3CCUN 3BYPA 5KFOA 2F2AB 3POTA 1ECWA 1T9UA 3SCIE 1N32K 2XICA 3BPDA 5TKYA 5KRSA 1N33J 3PJ9A 3MEEB 4OYXA 4M7XA 5KFXA 4GW6A 3VEWA 1QSLA 3ZC4A 2ZF5O 3CERA 4QZIA 4LR9A 1F5CA 4K4TA 4H5RA 1N5TA 1RQLA 5HP1B 2PI5A 2IDEA 4P2FA 3SK3A 2NO5A 2DGUA 1FJGF 3KK3B 2HDOA 1K1SA 5CZ1A 2RDJA 1RISA 9ICSA 3P5TL 1JJ4A 2HIYA 2CGJA 3OQ2A 3TA2A 4A8XA 3HMJG 5LXYA 2LM4A 1MA9B 2VFSA 4B9MA 9ICIA 2B8QA 2VG5A 4ES2A 3TAMB 4H0YB 1SQFA 4OV6A 1EO1A 4BRCA 4LF7J 2RDIA 4DBQA 1JLEA 1KC8O 4WZQA 3EY1A 3IHQB 2GW8A 2OTJS 3FZFA 5KL1B 3O3GA 4M63A 3UPQA 5FRNA 4CLLA 3ZZZA 4WK1A 2KT2A 4USWA 1YJRA 5DZ6A 4A8YA 2RILA 3JPNA 3HBTA 4PKHA 1S9GA 2W40A 4DN9A 2E7XA 2DEJA 3BJYA 4NLWA 4DR5F 2CPXA 4PQAA 1KVBA 1BCMA 3F0NA 3MAQA 2V2QA 4RBVA 5AJ3K 2IM3A 5KFUA 3K5OA 1N34K 1P8GA 3DM2B 5ETMA 3CE8A 1A6LA 4U6PA 2NXUA 4NLXA 2HRTA 4I69A 2XMKA 3FMWA 5KFVA 4TY8A 4HR2A 3QUCA 1G1XA 3EPIA 1UT5A 3AVCA 2FLLA 4JD2B 5AICA 3QIOA 4I67A 1VQKS 4RPXA 1T9TA 4JI5K 4Y2JA 3SQGB 1D1UA 4FLZA 5EY4A 1UFWA 1P27B 4CNYA 3TO8A 5J2AA 5HMXA 4CLFA 3MXJA 3Q7CA 2KHOA 1D0EA 5AM2A 2CQHA 3CW2C 3MUTP 4NXNK 1EQMA 4H0TB 4PGQA 3JTPA 1K9MT 2KZMA 4ZCKA 4JNEA 1NGHA 2HMPA 5C12A 3AVKA 3WQPA 1K8KB 4IS7A 2Z1IA 3MMCA 1NZBA 2ZWPA 4BC4A 5IM0B 1Q81O 4YN4A 5AI4A 2YI1A 1YKWA 1F1BB 1JXEA 5K4LA 5AI6A 4WXOA 3HK2A 5T7LA 4NLPA 3IAYA 3PX0A 1YHQN 3CJ2A 2V51B 1WEZA 5A8RB 3DI6B 2HHHK 2ZH7A 1M1KT 4DV2K 3AVGA 3Q8UA 3C5FA 2WOMB 5ALKA 1X4DA 3WXJA 2KIWA 3TR5A 1SL2A 2WTFA 4AH9A 1JLGA 3M6KA 4ALZA 2HFSA 4PWDB 1HUOA 2D1KA 1QQ6A 5GADI 4ACOA 3L95X 3UKUA 2R9LA 4LJXA 2ZKUA 3A8IA 3CMQA 1HYZA 4BRQA 1NGFA 3BQ7A 1OH6A 3QWPA 2QWRA 1JIHA 2QG9B 1XNSA 3M7DA 3J81U 1R89A 2X1GA 3P1GA 7ICUA 1MNEA 3E58A 2WVBA 3EWAA 1Z2LA 1WEXA 3B0XA 2IGIA 2YX7A 2DR9A 3ZSOA 3M8PA 3VCBA 3IDHA 3MK6A 1YJ9N 1SC6A 3CMAS 4KPCA 3ASMA 2XIDA 4M7YA 2HPUA 1S6OA 3AVIA 2O8EA 3NF9A 2EC2A 4GVBA 3D3CJ 2RQMA 2ZBIA 4C48A 9ICNA 2YCHA 3ZSRA 5DBCA 3OFEA 4E7JA 5ALNA 2BKOA 4PXBA 3R2DJ 1RUSA 3IRWP 5DJBA 2E6MA 5AZIA 1F2HA 2YMMA 3OS0A 3QIDA 2C2ZB 2KVCA 3QSYB 3ZEUB 3VALA 4B9NA 2G8VA 2Q97A 3HVTB 1HWIA 2CADA 1ZQFA 3KD1E 2VODA 2J0WA 1NKBA 3CD6N 2K8GA 4FXDA 4P4PA 3JYTA 3SQIA 1ZQZA 2MSNA 2C2EA 2WAQD 2F1IA 3HFKA 1GLEG 5EE1A 4Z4FA 1Y0HA 4H5WA 3GL1A 4R63A 1J2MA 2VFUA 5KPZA 1HBMB 4IRKA 1NGCA 3HP6A 3WX8A 3MDFA 5H1SQ 5J0PA 4ZA1A 5CD4H 1FX4A 4K8ZA 4DX6A 1PVRA 4CECA 2OJ3A 2AP1A 2OZMA 1TK0A 1K8AO 4CESA 2KV2A 3RFAA 5DBAA 5EVZA 2ZTEA 1GXUA 3C2PA 1E4GT 1U04A 1CLFA 3VQBA 2W9CB 3UNGC 1YT3A 2VASA 2GNKA 4FWRA 1NZPA 1CJTB 4KY3A 2AJ1A 2DT9A 3DRSA 3J81O 3L6QA 1FW6A 3SMVA 2IAJA 2NYIA 4R8UB 2GWSA 5CHIA 2B9YA 1BL3A 2HF3A 2OIHA 5AQGA 1P9YA 3HKZF 4QPTA 4KHYA 3ELHA 3BH6B 3MPDA 2HZCA 5LMUF 2VB6A 3GDXA 3DAWA 8ICGA 1RAJA 3BY5A 2DGSA 3WK9A 3KDNA 3NL0A 1TAMA 3R9PA 1ZBIA 1IBMF 5FD1A 4CLSA 1YI2S 2NPIA 2KJWA 2NSCA 3K5LA 4NI2A 1R0AA 5AQNA 3E0FA 1FNMA 3IP0A 2VH7A 1QVGM 4IDKA 3OTQA 4O5EA 4ZPTR 4QZBA 1EARA 4Z2XA 3SEOA 1S77D 4M42A 3VR1A 3TWZA 4A8OA 3P8BB 2OWOA 1WTBA 1CI4A 4DS4A 1ICEB 1TUUA 3KUHA 1VBXA 4DCOB 1B9DA 3W9IA 4LF7F 2ROPA 3R7NB 1ZQWA 3B6PA 2W2PP 4BBYA 2GVZA 4TU7A 2C2KB 3VEZA 3UD5A 2CPYA 4NZ7A 3K1RB 2QE5A 1K44A 3BREA 3MCPA 3I4PA 1LFPA 1VOMA 1VSLA 3CFRA 3BS7A 3CD7A 7ICSA 2UUAJ 2LP4A 1RACB 4CP5A 4F72A 4LVNP 3VETA 4X4RA 4LVOP 2M9NA 2K4IA 4DQPA 1SKSA 3CCEN 2QEXS 1SWVA 2W3RA 4KI4A 1J6ZA 2J9DA 4M9HA 3IG1A 1J54A 5GAHP 2E9RX 4Y34A 5IZHA 3OVNA 3EVOA 3BF1A 4ZVPB 1BDGA 3DYAA 1S3XA 1C1BB 3BZCA 3N7PD 3D1QA 5EN1A 3H98A 2I5JB 4EEYA 1WC6A 5CYMB 3OVAA 1UZDA 4KB7A 2CPEA 2HF4A 3T5KA 2DY9A 5EE9A 2OHFA 4FJKA 2ZOMA 3T7ZA 1XMQJ 1F2GA 4BCAA 4ZVEA 1CZBA 1FRHA 3CG7A 3NVVA 1ZQQA 2IIRA 2RS8A 2HIQA 1IG8A 4PKGA 2BHNA 1BISA 1LXNA 3G4SS 1K6YA 3BGRB 5J2HA 1S1VB 3PTWA 4RNFA 5CB1A 4I6YA 1YK9A 4RTFD 1KAXA 1JJCB 4RBUA 1N6QB 1N63A 3TRGA 3HTVA 4FWNA 2AEJA 4KGZB 2W55A 4Y2AA 1FFUA 2MXYA 4I29A 4GRSA 2FVCA 3OYMA 3H5YA 4M3WA 2AYBA 2OPSB 5EHHA 2RPIA 1ZQVA 3WKDA 1PK1B 4DEZA 3D6HB 3NLCA 5KG1A 3MMAA 1HPMA 3LM9A 4F0MA 1UEKA 2HW3A 1OH7A 5DQIA 4EFHA 5HOOA 3Q8KA 4ECTA 1XHZA 3NAHA 4CLPA 2ZM6F 2H5XA 1ZA2B 4US9A 2Y9TA 2XNRA 2E1PA 4HHHA 3TR8A 1OW5A 5F9NA 3FSIA 3FRZA 2RHQB 3QJLA 1B4SA 4JI0J 3KOOA 2B3TB 4OYPA 2H51B 3AVNA 4ATNA 2G2OA 4JI4J 2X1FA 4BRGA 3DXMB 3HKWA 3NH2A 1CQMA 2QWLA 3VQ8A 3OSPA 2HLTA 4TKTA 1CXQA 3AN1A 4E19A 5J0YA 4QYRA 1ZBFA 4P71A 1V4TA 1WCLA 4R5PB 6FDRA 3DFEA 4DV0F 2PYJA 2O66A 2KJ5A 4D3HA 2CAJA 2CXEA 3AU6A 2GTDA 2KH9A 1FKPB 4X4VA 1UETA 4FLYA 1KAZA 4HI1A 3EGNA 3D45A 1NSAA 1R6VA 1U4BA 3O9QA 2F65A 4B3OB 1CULA 5HJXA 1IG6A 1SVDA 2MZJA 4CH7A 1EIYB 1ZRNA 1KWMA 4C7YA 3FEZA 1N60A 2ZH9A 3I32A 3IFRA 2HMXA 3RBDA 2FC9A 5H9FJ 2WRMA 4DU1A 1F9EB 1ZQPA 2OELA 4JYAJ 4EHUA 3U3GA 3F44A 2HHTA 3HX0A 2Z58B 2OI2A 3VAJA 4BVOA 4C0HA 4LFAF 3OUYA 4PG6A 4K42A 4F4XA 2J5AA 4ILGB 4ECUA 3SQOP 2HB5A 4CERA 3SNNA 3ZD8A 4DR6K 3D9BA 5ALWA 3FC4A 1WAJA 3SBMA 1X3NA 2Q31A 1JCGA 2ZH2A 3A1YG 4JI2K 3U8XA 3OBIA 1YVUA 1SH3A 5HLFA 3TJAA 2QTDA 3G10A 4PXCA 4TLRA 4D3GA 3GR0A 3UR3C 1M1HA 2J76E 1NPRA 4KLIA 2V2ZA 3TSQA 3I9ZA 1Z00A 1SQEA 1COKA 2B5JB 4DFKA 1SQKA 2HFVA 4N8OA 2PC6A 2Z56B 3SUPA 4HVJA 3LDSA 2ACYA 4CDGA 3EUNA 3AQPA 3H2VE 1IBLK 4OJPA 1LQ9A 3RW7A 1Y7PA 1DTQA 3UXPA 4PL7A 3V9UA 1HWUA 1N56A 3H0PA 3MZIA 3Q8LA 4JP8A 3AA3A 4CNQA 2BCRA 4YOXA 3TYTA 2VL1A 4B6JA 3GR1A 4DCJB 3HHLB 3UDLA 2X1BA 2PKEA 3TQEA 3SDEA 1RDWX 2W24A 3PR5B 1RBVA 5ETQA 2RDDA 4ZVTB 1UP1A 1NMEB 4DTUA 2PO4A 3CT9A 3LP1B 1TKZB 3CTRA 1GOAA 1GT8A 1WUDA 3G82B 1HPZA 4RUBA 3P96A 2OFGX 2RUSA 3KLEA 9ICFA 2PFPA 4KFBA 4J5OA 3BQTA 3OTEA 1FXDA 1SPBP 1Q0NA 2FY1A 1JX4A 1U1PA 4ZOSA 3CHWA 5JTIA 1BNPA 2IDOA 3GTYX 3NRWA 1KC8T 1F9HA 5AQTA 2E9ZA 4F02A 2AXTU 3ZD9A 3ZETB 1VQ9S 2IIHA 2I7NA 4MK7A 4C0ZA 3BGLA 2KVSA 3DXKB 3C19A 5M1PA 4B3SK 4O5CA 1Q8KA 1CZAN 4CEQA 2AGQA 3D2EB 3A12A 5JXSA 1Y3KA 1VQPN 1Q7YO 2FSNA 3NGZA 2DO4A 2XRIA 3DLBA 4QWEA 3R5CA 3B9JA 1EXNA 1OYDA 4H4MB 1FVQA 1DHMA 2BQUA 3BPSP 2JEFA 3V4IA 2XI9A 4DG1A 1KVCA 2ZIUB 1FRLA 4JK8A 4AP9A 4EMDA 3ENAA 2EHGA 5AQOA 3THXA 2YHXA 5U47A 2MKCA 3QERA 4DR3K 3CF5Q 2BE2B 1AB8A 2XC9A 2XO7A 2KNJA 1SAZA 2B56A 2OPPA 3ENHA 3NWRA 2BJDA 3CVKA 3OLAA 3QU7A 1DGSA 3FFIA 1WTFA 2R7VA 5DG9A 4MO4A 2CQ2A 3GDQA 5GAGP 3CCMS 2H9ZA 3UN5A 3GG4A 2OYQA 4FL9A 2MJUA 1IXKA 4FPIA 3MM8B 4NYOA 4F25A 4DI6A 4K4WA 1CVJA 4EUVA 4Z94A 3CJ9A 2JRZA 2YH0A 2DBBA 1DQAA 1S12A 1DOQA 4AXIA 2D3DA 3KLGA 5ALFA 3MAAB 2AD9A 4BE0A 2XG8A 3K89A 2E2PA 5A8WB 1XWLA 3M6UA 4XIUA 3FEXB 4K0KK 4CI6A 2QMUB 1L7NA 1O1WA 2NRZA 2UXCJ 3UMBA 4J9UE 5KG7A 2HHUA 2FB0A 4M5IA 1RKJA 1BQMB 3OTOJ 1ZBTA 2VQFJ 1Q81T 1HRHA 1AW0A 1XO0A 4KBOA 1SBRA 3NKYA 1JK9B 2MEWA 3FLCO 3KNGA 4K4XA 3S3MA 3FZKA 1S6QB 2ZUCA 3AU2A 4MF8A 4NLDA 2BCQA 1FDAA 2ZDOA 5J2QA 2B21A 2QFIA 2FTRA 4FM2A 2FJXA 3Q8MA 3RBXA 4J9RA 3J80Y 4RJVA 2YPZA 3UCZP 3UKRA 3VA3A 2GVDA 4CK2A 2KZ3A 9ICVA 1HR0K 4P0QB 3JQMA 1S99A 3C0BA 1M5PC 3MHYA 1RT5A 4W98A 2XY7A 1TFRA 5DDMA 2BCSA 3D3BJ 4RW7B 2KM8C 2VGMA 3DHWC 4M47A 3B8HA 2R7QA 3RAXA 5LY3A 1IM6A 4JI0F 3MR3A 4FWPA 3WXKA 2V4QA 1XMBA 2PT0A 1VQNN 4JI4F 1REVA 2BRLA 4GKJJ 1ZQLA 1NU4A 2CNLB 4X4PA 4KTZA 3D0IE 3H5UA 3GG0A 1T6CA 3GQCA 1FTCA 3A0HU 1F44A 3MDCA 5KFHA 5AQLA 5J2GA 3U6FA 1RNHA 5AKGA 3FQLA 4CK3A 3V9SA 1KL9A 4ZLJA 4FZNA 2ESEA 3DOKA 2YJFA 3R97A 3AFGA 3OYJA 4O5FA 4KITB 5AIAA 3OL9A 4Y2RA 1OS5A 3CXCR 5E26A 3U26A 1IJJA 5DDOC 2CQPA 4DR1J 5CYJA 3T3FA 4B1XB 4WWSA 4ZPDA 3P5JA 1OPZA 4RNOA 2LXIA 1I3AA 3WK4A 3CC4S 2QA2A 2QMWA 4F3QA 1WCNA 4DFMA 3ZT1A 3MEEA 1F0XA 1DTTA 3LP3A 3CIPA 2P9UA 4I2FA 4HCBA 5DQGA 4R79A 2ZIVA 4JYAF 4CF3A 3ZZPA 4RUAA 3H46O 2FZKB 4DV7J 1WKJA 3IXQA 4NEZA 2JV3A 3FBCA 2B7BB 1FFWB 2BJEA 2A0FB 4LIWA 7FDRA 2GHVC 3ETOA 4DUYK 4PY5A 5KFKA 4I2DA 2DGWA 5ALEA 1KCFA 2MAXA 3HKZC 3D1OA 3HRGA 1YJNN 2CQ3A 4OI6A 1RTDA 3C6TA 4PL8A 2YWFA 4TLQA 4V1Ak 1TV6A 1ZAWA 2NRTA 1I94K 1JI7A 3Q22A 3KBBA 1YZ7A 3THYA 3H25A 4A5AA 5FLXY 3KLIB 1K8AT 4M9GA 4MFCA 3OYFA 4KO0A 3B8AX 4XRHA 2P9LB 2D5RA 2Q3PA 4DPUA 2YKQA 1KHVA 3OHAA 4FXVA 5AM3A 1U1RA 2XI2A 3I6PA 4FK2A 4A61A 3QINA 1BUPA 3PKMA 3L09A 5A0YA 4IWVA 4B9QA 3UXOA 2J7UA 2EBEA 3MM9B 1UKUA 2R2SA 1FEZA 2CNOB 5DK5A 1E3MA 1BIUA 3KLHA 3H7IA 4Z4IA 4IQTA 2O4GA 3KZIU 1S9EA 3QU9A 4CEDA 2ZKTA 1R8BA 4R25A 2J9DE 4M5KA 1TK5A 5BYQA 1NPKA 1SL1A 4CJ7A 2BPCA 1XMOK 1HUZA 1NEEA 2DHXA 5EUHA 3L3VA 3PIOL 3CCVS 4KGVB 3DM2A 3BF4A 3B78A 4IKAA 2LQBA 4F4YA 1OVYA 5ALLA 1HHTP 3FUYA 1CZ9A 3SENA 3EICA 3ZZTA 1LKZA 2XHBA 3JS6A 2Y9UA 3AT1B 2LM1A 4M6WA 2FSJA 1ED1A 4IR1A 4NLSA 3G71S 4KTQA 3LP0A 2ACMA 4HH1A 1DXSA 1IJEB 2MYFA 1FTRA 1AFIA 5HRRA 3CCJN 1OQ6A 2FMQA 4GC6A 3S8SA 5BR8K 2VICA 2ZE2A 1FVSA 3EZWA 1UPMB 4ES1A 1XC9A 1LWXA 3BP8A 3V81B 3LAMA 4Z6DA 4PKIA 1Q9XA 3SI6A 1N54B 4Z4GA 1Y10A 3ZTOA 2ZUAA 4KPYA 4QCLA 2D0CA 1Y4ZB 1RAHB 1N5VA 1LVHA 5EWGA 4FK4A 4AHRA 2B6AB 3VQCA 2VWJA 2VPXB 3MCMA 3BSOA 4TY9A 2MKKA 4H0XB 4DU4A 4CVNE 4GV6A 3A0IX 4DV3J 3OFHA 3ZDCA 3QX7A 1FFSB 3SSSA 5DKWA 2ZH5A 3P6YC 4CIEA 1UAWA 2DK2A 4YMNA 5J2EA 5FP0A 4BRKA 2LDYA 3BN4A 1G2EA 3TKAA 1ZQIA 3HKZD 5M2UA 4F4ZA 1I6JA 2VFVA 1SIZA 2NQPA 2DNYA 3K75D 2MUTB 3O6WA 4H5VA 2ERRA 1JLCB 3FE1A 2JFKA 4DSIA 1LOUA 3QO9B 1I39A 3H5XA 4PWDA 4TUPA 1U24A 3N79A 1Q1KA 2VIXA 3MECB 4X62J 2H3IA 1RZTA 3FZHA 2FVPA 1RTHB 3SV4A 4NXMK 2BBEA 2DRDA 4DZ6A 5K8OA 3DGPA 2FVQA 2QO3A 4RUCA 2Y1IA 1BI4B 1BPBA 2CVEA 1NJWA 3BH7B 5LJ5Y 4NCGA 2UXCF 3UM9A 4IBNA 3GFHA 4BRFA 2MKJA 5J2MB 4LF9J 4UY8O 3OTOF 2VQFF 3KNAA 2XULA 4F93B 4DV6J 1J5OB 5HSPA 3VAKA 1IKWA 1GLAG 1T0TV 4E8UA 2HFNA 3M8WA 1DBDA 2UU9J 1YBAA 4G1QB 5LMNK 2UUCK 4DKWA 2ZJQL 3QBCA 3GYXB 1FXXA 1X5TA 3TTDA 8ICNA 1RHKB 4I2CA 4A8MP 1NCLA 5F2RA 4Q45A 3WEEA 4FCYA 4U7CA 2C2DA 3TAGA 3AH6A 4KH4A 4O4GB 4PABA 3JXOA 2E1RA 1LW2B 4JMUA 5DGBA 3M8YA 4KI6A 1HNIA 2P9NB 4QIFA 3ILOA 2HGLA 3EXCX 4WYBA 1N61A 1AUSL 1RCXB 4JV5K 1HNVB 4OZNA 2QWPA 5J2IA 4XTTA 2L5YA 1X9WA 4JI7K 1TVRB 3BF3A 2E3TA 1JB0C 4UUWA 4M9LA 1CS4B 1RADB 2BGGA 2NRXA 5JLHA 3OR1B 4I6MB 4F0KA 5EX5A 2Y8WA 1WSIA 5K8PA 1O8BA 2B6GA 4AT1B 4URQU 3NVYA 2FPHX 3NP5A 3CIMA 4MYUA 1ZQMA 1HNZJ 1YAGA 4PHDA 4PGXA 1UJ6A 4JK9A 1NGIA 3H8MA 3CJBA 2NUUG 2DPNA 4OHZA 1UCNA 1H72C 3MM6B 1U0SA 2PAVA 2ZJRL 1OH5A 3AVBA 2FHOB 4PA1A 3PJWA 2DGQA 2NRWA 4OHYA 4Q2LA 2VG7A 3HXMA 5KPTA 4LSLB 3RYLA 1ATNA 3HSTB 4RU9A 3FSXA 4Z7CA 3TX0A 4LFCJ 4CDIA 2ZWOA 3FYHA 8ICQA 4QAGA 2EZXA 3M30B 4X4NA 4FZVA 4AUKA 1ZTWA 1S49A 1HX1A 1ZPWX 5BREA 4ZTFA 2IA6A 4NYZA 1RCOB 3IS9B 4PPXA 1MLAA 2RHKA 2H3EB 2DR8A 4DOBA 1O6XA 4C3KA 4UQGA 1RI7A 2P1JA 4EO6A 1BO5O 1FJGK 4KE5A 1YLXA 2QWMA 5E41A 2Z2MA 4UB1A 3KFWX 3PIOQ 3SZ2A 4PH5A 3NY0A 1SV5A 1RKIA 3QUQA 3K58A 2AGOA 4NV0A 1KP6A 4ICLB 4IFYB 4O44B 4EIAA 5E3RA 2F9TA 4KH1B 3KYLA 4OPJA 4BR0A 2GZOA 2KW4A 5IILA 1K5OA 3DXSX 3LDOA 2BDPA 5RUBA 1WOSA 4ZVSB 2Q1NA 3KXDA 2HK3A 5DETA 1A77A 3M6GA 4DFDA 1O03A 3OPXA 5MLCV 4RLEA 2BMBA 2XHCA 3W8GA 3SIPB 3ZTSA 4DR5K 1XUPO 2K7JA 4ILLA 1E6YB 4USJC 3LZIA 1KQSM 4PG8A 2D41A 1RTIB 4NXZA 1BE4A 3ZTQA 2KQ2A 3M32B 1DLOB 4JHDA 1PBUA 3DRRA 5KFPA 3KJFB 4GVMA 4F2SA 3LAKA 2W9BA 2R7XA 1UZHA 1G99A 3RMAA 5AQMA 1ZQYA 1S6PA 3HPOA 2NSBA 1MU2B 4DOAA 2GQCA 3HFZB 3D5MA 3I4HX 5JS2A 1HBOA 2CDRB 4I6AA 4U95A 3KIOA 5BRFA 3EXYA 4CT8A 4E98A 1XC3A 4YVZA 1YJUA 4QS8A 1RPLA 2ZHAA 3OY9A 4YDXA 3VA0A 4K43A 3TJ8A 3EMTA 4ZJQA 1VQ7S 1IR0A 1Q7YT 3BGFA 1RWVB 3MCNA 1BWVA 3RW6A 4ERDA 4CHQA 1S0NA 1DQ8A 1MN7A 2BDUA 1FESA 2A18A 2GOLA 1S5LU 4TURA 2RQ5A 1CSJA 2DR6A 4CO2A 4BDZA 3GV5B 4M3YA 1ZZFA 2DITA 2PZSA 2AQ0A 4KV8B 4YQWA 1IQZA 3C8YA 3WT0A 1P8ZA 3WK7A 3VESA 2JX2A 3JB9k 1LB2B 4UQTA 1B43A 4CE6A 3UD4P 1QAJA 4KGMA 1FXRA 4ZPCA 3PY8A 3D28A 4CZEA 1Y00A 4DV3F 1IV0A 4DL3A 4FJ9A 1NXIA 1UVJA 1J5EK 4F8RA 3SFGA 3A5MC 5AQQA 1HBNA 2HNZA 2XEXA 2MA1A 4KH6A 4ED4A 2P5VA 1S72N 3DGVA 4M5DB 2E1ZA 5KPRA 3OTCA 2CFXA 5G0RA 1H98A 1ZQUA 1XSLA 2ZVSA 2XCAA 1CJUB 4BGDA 2OXOA 3S3NA 3R8YA 4B1UB 3NS5A 2G0AA 4X62F 2C2OB 4HT5A 3G6EN 5HHIA 4ZVFA 4DR2J 1P1LA 2NXJA 3F56A 1CJVB 2OKQA 1Q5VA 4M63C 2QX0A 2P9EA 4XPCA 2LU2A 3M05A 3UQ2A 5AI8A 3DOMA 1FKOA 2YTUA 4J9LA 3S41A 2DNLA 3CCUS 1MA7A 1SQGA 5IT4A 3AM9A 1A6SA 5K5MA 2QL7B 4LF9F 4FW2A 2O8BB 3NVKA 2MKHA 2GA7A 5IIJA 2RF2B 1NGBA 4W5NA 3PW0A 1P9QC 1S7HA 3QETA 4X4UA 2UU9F