1UA1A

Structure of aminofluorene adduct paired opposite cytosine at the polymerase active site.
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA primer strand
publication title Observing translesion synthesis of an aromatic amine DNA adduct by a high-fidelity DNA polymerase
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 211
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1ua1A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1ua1A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ua1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1ua1A01
4HYKA 4JWNA 4GC7A 4Q0BA 2HHQA 4M6WB 3IRXA 3KHLA 2BQ3A 1J54A 3RAXA 1CUKA 5KFDA 5IIMA 1WSFA 7ICKA 3VQ6A 2FLPA 3ZDCA 3O4QA 3EZ5A 1JMSA 2Z1GA 1KDHA 5DDYA 8ICYA 3DOKA 1X9MA 3RWUA 4KTQA 2HHSA 1D8LA 4B8AB 1CZBA 3SUPA 5J0UA 4J9NA 3KHGA 1HQEA 4DSIA 5L1IA 4JLHA 1CLQA 1GOCA 2YNFA 4CJPA 3CFOA 4JS4A 4DSFA 1F21A 3G0ZA 3QLHA 2UVWA 4IRDA 1ASVA 1ZBFA 4TQSA 2R8KA 3C1ZA 2IHMA 5KFVA 3RAQA 4I2AA 2VG5A 4MEXA 4GLXA 3FFIA 1IH7A 4DO9A 4O4GA 4JV2A 2ITGA 2WOMA 4IKFA 3V7KA 4EYIB 4E0DA 4CESA 2BCUA 3GIIA 1UA1A 1BI4A 4FJ5A 2ALZA 3LK9A 1TV9A 9ICUA 4HCCA 3NF7A 8ICVA 2G8UA 1XU4A 1B22A 3KK3A 5L1KA 2D0CA 4CK3A 3SUNA 1X9WA 4CEEA 4QWBA 4CEOA 1S1TA 9ICIA 2KW4A 4CK1A 1XSPA 2ASLA 3MXMA 2I9GA 3V7LA 1QLNA 9ICJA 4NCAA 7ICFA 1EXNA 3AVGA 3JPOA 4KLSA 1VSHA 2ZJ5A 5KT4A 1I3AA 3NHGA 4MFBA 4Q8FA 2NRTA 4YMMA 1NK7A 4DTNA 4P4MA 2ZTCA 2B4JA 3TQ1A 4QWCA 4QZDA 1IKVA 4J9OA 3RMBA 2G8IA 4IG0A 3JPQA 3KLEA 2IAJA 2NUBA 1S97A 4FBUA 4W5RA 4TURA 2W9CB 4O3PA 2ZD1A 3SZ2A 4MF8A 5K14A 2C2EA 2JLEA 5KFXA 2ASJA 2FMSA 4Q8EA 3QNNA 5KFFA 3EYZA 3OYJA 2Q0ZX 3TAPA 5IILA 2X6SA 4R63A 5J0OA 1WSEA 4O55A 5TZVA 4ECVA 3AA2A 4RNOA 2FMPA 2A1JA 3IM1A 3UXPA 4EEYA 2OPQA 4QW8A 4I9QA 2Q3SA 4KKOA 4KLQA 1RZTA 4AHUA 4PGQA 1IM4A 4ECTA 3MR2A 3Q8LA 3BQ0A 3GIJA 1NKBA 2HHVA 1S1UA 3OJUA 4BACA 3AVFA 3LWMA 1A77A 4FK0A 1XSLA 1UT8A 4M9HA 4M3YA 4RQ6A 2P5GA 4FJLA 3V81A 1QSYA 4M6WA 2ATLA 2JEIA 3IS9A 2AGQA 1S6PA 3G6VA 4C8LA 4KLIA 5KFGA 3HVTA 1LW2A 5KI6A 3B6PA 1GOBA 1U9LA 1KCFA 3ZT1A 4DL4A 3NGIA 4DU3A 2PYJA 3K5MA 4DL2A 3RJHA 4I29A 3C5FA 5C42A 5KFYA 2IA6A 1VSMA 4RNMA 2BPGA 2YNIA 1LAWA 4KO0A 1ZQSA 1RT6A 2F1IA 5F9NA 4Q45A 4IR9A 3NBPA 5KFKA 1QTMA 2OWOA 1ZBHA 3ZD9A 2W8KA 4UB1A 3RJKA 4EYHB 1NK6A 2UVRA 4I2PA 1NJXA 2ZUDA 3VQ8A 5HP1A 3KLFA 4RQ1A 3VN5A 3K58A 4I7FA 5KG1A 3PR4A 7ICEA 3DLBA 3KLHA 3L8BA 4YN4A 4E1MA 2FBYA 4UAYA 3RJGA 3V6DA 3TAGA 4I2QA 5HLFA 9ICEA 1XI1A 2JGUA 4CJQA 4IDKA 4O5CA 1N6QA 4KHYA 4B9NA 1BPYA 4FZZA 4RW7A 4TUSA 1WN7A 4B9SA 2G8HA 4J9LA 9ICOA 1EETA 4RQ0A 4FZYA 4M41A 4DSJA 1COOA 4CGDA 2BCQA 4J9MA 5EWEA 4I2EA 4G1QA 4H4OA 5KG5A 1B9FA 5HHHA 3NGYA 4J9KA 1ZQMA 4EP5A 3K5NA 4EZ9A 4X5VA 3ZCMA 1Y88A 5KG0A 1R0AA 1SL1A 4FJGA 3TAEA 3ALYA 4CFAA 4DSEA 3SV4A 8ICBA 3G6YA 1ITGA 4Q5VA 1U04A 1HUOA 5J2FA 3EPGA 2HHUA 2BGGA 1NKEA 3SCXA 8ICLA 3AV9A 3K75D 1A76A 3MGHA 3Q8PB 2R8IA 4CJRA 4QW9A 1BPEA 3CQ8A 3LP0A 2AQ0A 2RKIA 2FLLA 3V6HA 3T5KA 4I9LA 4RW8A 1SKSA 3HL8A 1C0MA 8ICTA 2KZMA 2BCRA 2GBZA 4KPYA 3OS2A 8ICXA 5KFQA 8ICAA 4DTMA 4M3WA 4O3QA 5CYMA 4KRFA 4RNNA 4F4XA 3OY9A 4N41A 3HPHA 1RTJA 1IKWA 5JUMA 1C7YA 1ZQFA 3G6XA 3VQ4A 3ZSXA 2VG6A 4F92B 3MEDA 3F73A 1L3UA 4CF8A 3VQCA 1Q8IA 4CEDA 4ICLA 1RT7A 3HT3A 9ICGA 4N56A 4Z4IA 4J2BA 1JLAA 2YHBA 4O9MA 4BE2A 5KG4A 1WSJA 3O3FA 1ZQYA 4QOZB 2BE2A 4KLHA 1Z26A 4F5RA 4CIFA 5KRSA 1D9DA 4M0AA 3B0XA 2D0BA 1C0TA 3C2MA 4UQGA 4M9LA 4OKEA 2P51A 5KT7A 4YG2A 8ICUA 3C95A 4DTRA 1K1SA 8ICEA 1RBUA 4DLEA 2C28A 2ZUBA 3THVA 4M3TA 1EXQA 2DFFA 4MF2A 3D45A 3MR3A 2C2RA 4FLXA 1KSPA 2MUTB 1H38A 4M3RA 3ETLA 4J9SA 4RPYA 1WSIA 4JRQA 4KLGA 2Z1HA 2PFOA 2YHAA 1U45A 4O3RA 3L2RA 2B6AA 3SV3A 4UAZA 3ZSYA 1HNIA 1HJPA 1BGXT 7ICRA 4P4PA 1IG9A 2BQUA 4KLLA 1RT4A 4DQIA 2R8JA 1TVAA 3KJVA 4FJNA 4I2CA 1RT2A 3S3NA 2XRIA 1QE1A 1LWEA 2LSNA 4I2BA 4GXIA 2BKEA 3HYFA 4NYFA 1JXLA 4KHSA 3UPQA 3AVMA 1UWBA 3HXMA 4RQ2A 2ZTEA 3LP2A 2J6SA 3UXNA 1VSEA 5KFTA 4TQRA 5KG6A 4E7HA 2VA3A 1ZQNA 3OYLA 3PY8A 5FDLA 1BPDA 3ISNC 3NE6A 5J0RA 3ZSOA 3ZSQA 3AVHA 2H5XA 1JLQA 2OYQA 1ZQJA 3AVJA 4RW6A 4DWIA 4W5TA 4ZH4A 3L3UA 1JX4A 5KFJA 5D49A 3UQ0A 4I2GA 3MEEA 4ELVA 4FJ8A 2PI5A 5CR0A 3PVXA 3Q8KA 4JWMA 3OHBA 4AHCA 4QZEA 1U47A 4I2HA 3M8QA 4BGDA 3PMLA 1S9FA 1XS9D 4ED3A 4E7JA 3I0RA 4PQUA 3BQ2A 4BWJA 1ZQRA 4CHOA 3KTQA 8ICPA 5EOZA 3V72A 2X74A 3B0YA 4FS1A 1NK8A 4DQSA 3P83D 1WNSA 3PW2A 1ZBLA 1D9FA 2X6NA 3DRRA 3VA0A 3TAQA 4PHPA 2D0AA 5SZTA 5J0SA 3GILA 3AVKA 2BR0A 1NKCA 4XQ8A 3RMCA 3ZSRA 1CEZA 4I2JA 4R5PA 3LAMA 2P66A 4KI4A 3NGZA 2IHNA 3GQCA 3OYKA 1BISA 4DTSA 1TVRA 3M8PA 8ICMA 1BPBA 4OPKA 4F5PA 4O3OA 4YR0A 9ICXA 1QS4A 3HO1A 1DTQA 5KFZA 1XWLA 4F3OA 4O5EA 9ICAA 1U4BA 2W42A 4LD0A 3RR8A 3MDAA 1SZPA 1ZQVA 2R7YA 1O1WA 4F2SA 2G8WA 3U6FA 3ZSVA 4ED0A 3PV8A 2RN2A 2BPFA 5DLGA 4JV0A 3TAFA 1ZYQA 2HMIA 1T3NA 2M9NA 1SL0A 7ICUA 4M04A 5J2EA 5BOLA 1S76D 5DBAA 8ICIA 3PO5A 3OYAA 3T5JA 3CFPA 5CJ7A 4YP3A 3AVAA 3KK2A 5J2PA 3IAYA 1JL2A 3DYAA 1RDDA 3DLGA 8ICHA 4CCHA 3SPZA 1GOAA 1TK8A 5DB7A 3ZDDA 2O4GA 3V9XA 5KFUA 4DL5A 1D8YA 2OPRA 1YTAA 9ICSA 4CJLA 3MFHA 1JIHA 4AHTA 5CHGA 4NLGA 5IIKA 4E7LA 1RBVA 5DK5A 4IQWA 4RPXA 2HVIA 4KMUA 4F4WA 3AUOA 5E41A 5HP4A 1JLBA 1LW0A 3ZDBA 4E19A 2IOCA 3AA5X 4QZBA 4F5OA 4B9LA 4F4ZA 3KK1A 4OGCA 2G8KA 3S3OA 1RNHA 1FXXA 2VWJA 1DGSA 1RBSA 5DMRA 4CJ5A 4NXZA 4CEQA 2HB5A 1BCOA 2P5OA 3KKRA 9ICQA 1HMVA 3V7JA 5IIOA 5J29A 1AROP 3C6TA 3SQ2A 1JKHA 3LDSA 4CF0A 4LZDA 4RQ4A 3RH4A 4EBCA 4CJ3A 4XA5A 3C6UA 5J2MA 4DU4A 2XGPA 3CYMA 4GC6A 3RJFA 3H8WA 3H8JA 4FJKA 5HRPA 5DGAA 9ICFA 3HWTA 3TFSA 3KHRA 3ORYA 4K8ZA 4DS5A 1CXUA 4KV8A 4CE9A 3QINA 4O44A 3NF9A 3T5LA 1EX4A 2FBVA 4MQ3A 3NDKA 1HNVA 1T03A 5J2GA 3L2QA 4DL7A 4KHWA 3BJYA 1S10A 4Z0UA 3RB0A 2JZBB 4DL6A 1IO2A 3K4GA 1B92A 1ASWA 2XCAA 3JYTA 3KLIA 3DM2A 4RUCA 3S3MA 4QWDA 2ZTDA 3TFRA 1WAJA 1ZQDA 5CB1A 2HW3A 5DQHA 1G15A 1RTIA 3IHQB 5KRTA 4AH9A 2XY7A 4FM0A 1LV5A 1XC9A 2UVUA 4QZ8A 3SI6A 3C2LA 2R8GA 4FJXA 1S0VA 4FS2A 4DTJA 4N76A 5T7BA 4DG1A 3ZD8A 4DOBA 4ZTFA 1SUQA 3DRPA 5EU7A 3C5GA 1ZQUA 4CJEA 4KB1A 4GVMA 3UQ2A 2AQ4A 1KLMA 7ICMA 2EHGA 2NRZA 4UB5A 3V9UA 4BDYA 5IIIA 3CM6A 3C23A 3ISCA 2FPKA 4B3OA 3M8SA 1C1CA 4OPJA 5D4BA 1DOQA 4CGIA 4UBBA 4IQUA 2LYHA 5J2IA 4M3ZA 3ITHA 4FJ9A 4RQ7A 1XHXA 2RDIA 5KGWA 1EP4A 3K2PA 2ETJA 4FK4A 5HRRA 2W9MA 4FW1A 3RB6A 2XY8A 4FLWA 5EWFA 8ICNA 2X78A 2FBXA 1WCLA 2PXIA 1C6VA 3V9WA 3RMAA 2IC3A 3LANA 2B21A 5C25A 5JS1A 3RJEA 9ICWA 3RB4A 4TSXA 1KEJA 4Z4HA 3L2WA 1BVSA 5J2CA 2QXFA 1TL1A 4M9JA 4KLOA 1LAVA 1VSFA 2HHXA 2BQRA 4J9PA 4M45A 2Z1JA 2DPIA 4PGYA 4IQVA 3NCIA 3ZT0A 4RW9A 4BE1A 2FLNA 4DSLA 7ICTA 3NH2A 4R66A 3BDPA 3GFKB 3U3GA 4JUZA 1RXVA 4KN7A 3T3FA 5J0WA 1JN3A 2W9CA 4KLDA 1K6YA 4N5SA 4GMJB 4FXDA 1Y97A 4Z4FA 5J0PA 1ZQLA 1KVAA 3MDCA 4PHEA 4HTUA 4ZTJA 4KI6A 1WCNA 1RT3A 4DOAA 3PW0A 3QIOA 2YKNA 1X2IA 4BE0A 4PH5A 5DG9A 1RXWA 4C8KA 4M2YA 3QESA 4BDPA 2KFNA 1I39A 4JRPA 4JK1A 4G3IA 2XO7A 7ICPA 1TKZA 2OPSA 2AGPA 5CZ1A 5KT6A 2JZBA 1ZQIA 3RJJA 2RPIA 5FROA 3L2VA 2XHBA 3K57A 1KVBA 3NF8A 3BGRA 4FVMA 4XRHA 2V4QA 1RILA 5JS2A 1HYZA 3ZSZA 4KITB 4O0IA 3L3VA 3QZ7A 5KG2A 4EZ6A 4JS5A 4FLVA 1VK0A 1TKDA 3PW4A 4CJWA 3CM5A 2YKMA 3CFRA 3LPTA 3OYNA 4E7IA 5DDMA 8ICFA 5KTQA 3ZT4A 3V1RA 3DLKA 4DTPA 4YCXA 3G10A 3O4NA 1C1AA 4CJSA 3SPYA 3KD1E 3GIKA 2Y1JA 4E7KA 3MEGA 3QEWA 1T8EA 1ZBUA 2F96A 3HM9A 1FKOA 3PW5A 2R8HA 4ECUA 1N5YA 4FJIA 3MABA 4DMNA 3SJJA 3KD5E 4NLZA 4OJRA 1FKPA 3PUFA 4DLGA 1VSDA 5KFRA 3JPNA 4M9NA 1XHZA 4KLJA 4DTOA 2QKKA 2P6UA 4B9TA 1CXQA 1S9EA 4DFPA 1S5JA 1VSJA 2HNDA 3AO1A 8ICGA 4KHUA 2F1JA 4NLKA 5KT5A 2G8VA 3MBYA 4ED2A 3I8DA 1ZJNA 4C8MA 3HK2A 5HMLA 4Z6CA 2QKBA 2HVHA 1NOMA 1EKEA 3PR5B 1RBRA 3SUQA 3AO2A 4QZFA 2F8TA 1ZQPA 2JEGA 3OVNA 3ZT3A 5J0TA 5J2DA 3WNFA 1S0MA 3E01A 4CHNA 4DTUA 4ID1A 2IBKA 1XO1A 4M3XA 4AILC 1NJWA 4FZXC 4FO6A 2PFPA 4DSKA 3ZDAA 2IDOA 5DLFA 4F91B 4ECQA 4FK2A 3HX0A 3RB3A 3K5OA 2W8LA 4KLUA 1S77D 4W5OA 2XCPA 4ED6A 5J2NA 3VQ9A 3NTUA 1TGOA 1RTHA 3RMDA 4M3UA 5L1LA 4HUGA 3H8SA 1HQUA 3VQAA 4CJKA 3MR6A 4BWMA 4R64A 2OZMA 4NCGA 4B9UA 7ICVA 3P5JA 3C21A 4C8NA 5KFNA 9ICHA 4WE1A 3UIQA 3OYIA 3S9HA 2FMQA 2FC0A 3QEXA 4LH5A 4CF9A 4W5NA 5KFIA 1NK5A 8ICRA 1BCMA 1ZBIA 1MQ2A 4KAZA 1BQMA 3K5LA 2FPMA 5J1EA 1KFTA 3D0PA 1ASUA 5HRNA 3ZT2A 4FCYA 1S1VA 3JPRA 1B9DA 4GW6A 3OYHA 1ZQAA 1NOYA 3TI0A 1V9PA 4NLNA 3LP1A 1HPZA 1A5VA 2DY4A 5KFHA 3MXJA 3IG1A 2VWKA 5D46A 4Q43A 4YMOA 2IMWP 3OGUA 3TAMA 2I1QA 9ICKA 3QEVA 9ICPA 3RRGA 1IKXA 4F4KA 4B9VA 3T1AA 2BHNA 3H7IA 3OYEA 4IFYA 1D5AA 3V4IA 4EBDA 3C1YA 1RT5A 1NK0A 3O3HA 3QEAZ 3RBEA 3RH6A 4UB2A 4CK2A 2G8FA 3LP3A 4DQRA 4M9GA 1WLJA 5KFWA 5DKWA 3HJFA 2XC9A 4IBNA 3N97B 5C24A 1K1QA 1VSLA 4QZHA 8ICCA 4Y1CA 4KHNA 4N47A 1TFRA 4EBEA 2EX3A 5FRMA 5KFEA 1XSNA 3KHHA 2V9WA 4OVLA 1L3SA 3OYFA 2FPLA 4MFAA 3RBDA 4O5KA 3LDAA 3GV7B 2ATQA 4FJ7A 4CHYA 5J2BA 2C2DA 3KIOA 2MUTA 2HNZA 4ZHRA 1QSLA 3AO4A 2IGIA 1X9SA 1KTQA 1ZQXA 5J2QA 3L2UA 4DTXA 1REVA 5HRSA 4DF8A 2W9AA 2J6TA 2OPPA 3LWLA 1YVUA 1FK9A 4K4GA 4Z6FA 3MFIA 4XUSA 4Z4EA 3ULDA 4F50A 4YQWA 7ICHA 4I28A 4H8KA 3PNCA 4J9QA 2P6RA 3ISBA 1JXBA 4KTWA 4OKKA 3NH1A 3DMJA 2BCVA 2AJQA 3KKSA 3GV5B 3LALA 4ECZA 1TK0A 4FW2A 2NRXA 3T5HA 4DS4A 3VQ5A 1ZQHA 1B43A 1A5XA 3VQEA 4HCBA 4RQ8A 4UBCA 8ICSA 4CF2A 5DB8A 3HPOA 4MFFA 3P1GA 4LSNA 3QO9A 4HHTA 4CHPA 3V1OA 4RQ5A 1S1WA 1JLEA 2GWSA 2ISOA 3BQ1A 1NK4A 4CEBA 1RT1A 1TV6A 3FDSA 2E4LA 2HNYA 1U49A 4LZGA 2A1RA 5HNKA 1ZQEA 4OLAA 4E3SA 8ICQA 3QEBZ 4FJMA 4BXOB 4IG3A 4DOCA 1VRUA 3OJSA 4QAGA 4DEZA 3HP6A 3AVCA 4R8UB 4DFKA 1Q9YA 5KFBA 4DQQA 1KVCA 2A1SA 4KFBA 4CFCA 1QSSA 2WONA 5KFCA 2C22A 5DGBA 2NRWA 2W9BB 4CGGA 5DBBA 2XY5A 3RH5A 5J2KA 1RDAA 7ICGA 5CY4A 4YMNA 1C0UA 1X1PA 1L3VA 4FLZA 1N56A 5KFOA 1J9AA 5J2HA 4YD1A 3MGIA 3TARA 3K59A 9ICVA 4IFVA 3OYGA 5CP2A 3NH0A 4CJTA 1S1XA 4Z6DA 1Z25A 3OS0A 3QNOA 1IKYA 5DBCA 4YVZA 5L1JA 4I2FA 4O5BA 4LVSA 4F5QA 3MR5A 3H4DA 2HHWA 4IQTA 3DLEA 3V6JA 8ICOA 3GIMA 1ZQWA 1T4GA 1BIUA 4GXKA 5IIJA 4C8OA 3C94A 3JPTA 5HHIA 4B9MA 4CJUA 2F8SA 3LZJA 4FLUA 2D5RA 1T7PA 3V1QA 3UXOA 4W5QA 4CEFA 3ISDA 4YFKA 4FJJA 4J2EA 3OYMA 3EY1A 4FLYA 3QIPA 3HW8A 4M47A 3OYCA 1RYSA 3HPGA 4ECRA 5KG7A 2KFZA 3OYBA 4LSLA 4CEAA 3U3YA 4J2DA 3Q8RB 7ICQA 3C2KA 5KGXA 1W9HA 1HYSA 3V6KA 2QK9A 2ASDA 1Q9XA 5DQGA 5I42A 8ICJA 4P2HA 4CERA 1JXEA 4NY8A 2DFEA 3A2FA 5HROA 5J2JA 2P1JA 4NM2A 3E2EA 2ZE2A 2MAXA 4RU9A 1ZQTA 3WNGA 3LAKA 1Z3EB 3SYZA 2Y1IA 2YV0X 8ICKA 1VSIA 3SQ4A 3EPIA 1T05A 1BHLA 4AHRA 3Q8MA 4RG8A 3FYHA 1VRTA 1TKXA 4QWEA 3QE9Y 4PHAA 1MC8A 2V4RA 1WAFA 1ZQQA 4ED8A 3TR8A 4CJVA 2XY6A 4RPZA 4ECXA 4R65A 4HUFA 3AVBA 4UB4A 4PA1A 4F93B 3M9OB 3JSMA 4CIGA 4ED7A 4LY7A 4K4IA 7ICOA 4CGJA 4K4HA 3NF6A 2E6MA 1SKWA 2VG7A 3M8RA 2PYLA 7ICSA 4NM1A 4I2IA 4YD2A 4NYNA 4QWAA 4H4MA 3N4MB 2RDJA 3JPPA 1Z00B 5KG3A 4CECA 5BPCA 1JL1A 1ZQKA 1RTDA 3Q8QB 4BXOA 4RZRA 1U48A 3PMNA 2ZQBA 3AU2A 1KFDA 5KT2A 1SV5A 1HRHA 4QCLA 2KTQA 4R8UA 3VQQA 5HMMA 3M9NB 3MXIA 9ICTA 4DU1A 4AHSA 1C1BA 1RPLA 4YXMA 3DLRA 4PY5A 2W9BA 4DL3A 3AU6A 5DG7A 2AGOA 5CWRA 9ICBA 3I0SA 4UB3A 5KFPA 3VQPA 2PFQA 4F2RA 3DI6A 3OS1A 4FJHA 3OSPA 4CJFA 2I5JA 4K8XA 3JPSA 1TKTA 2BPCA 4E89A 5L9XA 4HVJA 3RJIA 2HHTA 3AA3A 4PUOA 4QZGA 1J53A 3VQ7A 2E6LA 1WSGA 1HYVA 1BL3A 3HP9A 4IRCA 3B6OA 4TUQA 4OLBA 1ZJMA 1JLFA 4CF1A 1SKRA 1KRPA 2OZSA 4Z6EA 4F5NA 4ELUA 4YR2A 1ZETA 4RT2A 2XGQA 4KTZA 4KLFA 3NGDA 4MEYA 5KFLA 2WTFA 1NOZA 4CFDA 1IXRA 3EW9A 1A5WA 1RBTA 2ZUCA 3T19A 2ZJAA 1MU2A 3NAEA 5J0YA 2JEFA 7ICLA 3O3GA 4OGEA 4CIEA 3PX0A 4JV1A 3DOLA 2YNGA 2KQ2A 3PX6A 1TK5A 2BCSA 1TAUA 4DFMA 3OSNA 2IS3A 4O0JA 4KHQA 9ICLA 1ZQZA 4YFUA 3SNNA 5CA7A 3WNHA 1RDCA 4RT3A 4LH4A 5D3GA 2PZSA 1QQCA 3SQ0A 1RDBA 1HJRA 3AO3A 1NJZA 3EWAA 3AO5A 4KLMA 4UAWA 2GUIA 4CEZA 3OYDA 1YT3A 3HSTB 7ICJA 5DB9A 4KLTA 2PFNA 3QZ8A 9ICCA 2BDPA 2DFLA 1LWCA 4PWDA 2VANA 4KB0A 4CGHA 2OA8A 1RCHA 4I2DA 3ZSWA 1NK9A 5KFMA 4DF4A 3PW7A 3TANA 4P4OA 5CYQA 4ECSA 1RYRA 3LZIA 4PHDA 4E1NA 1HUZA 1ZQGA 1DLOA 3BQTA 3PO4A 4I27A 2Z1IA 3MAQA 4EP4A 5KFAA 2KZZA 5SWMA 2PI4A 1YTUA 2F1HA 4KN4A 1L5UA 4ELTA 4RW4A 4FM2A 3GDXA 4HUEA 1QHTA 2VA8A 4QZIA 2AU0A 4FM1A 5DG8A 3RRHA 1Z00A 4PPXA 3Q8SB 2JEJA 1BQNA 4BDZA 2UVVA 3M9MB 3SI8A 1ZQCA 9ICNA 3AVNA 2PY5A 5HBMA 1MSWD 4Z4GA 3QEPA 5C5JA 4ED1A 4MFCA 4IR1A 2BANA 1CZ9A 5I3UA 4FBTA 3ASMA 1W0HA 4B08A 7ICIA 1KFSA 5DQIA 1S0OA 4O3SA 3H4BA 8ICWA 1UA0A 4NCBA 4ECYA 3HVRA 1SL2A 1TAQA 4B8CA 1LB2B 2DTUA 1S0NA 1BPXA 3DRSA 4YXJA 3GV8B 3OHAA 1N48A 3VQBA 3VQDA 5BOMA 2KZ3A 3NFAA 1TL3A 4CGFA 4RQ3A 1BI4B 3KLGA 2DFHA 4RUAA 4XIUA 1UAXA 4CJ4A 1S6QA 3H08A 4KLEA 4DQPA 2ISPA 4OKJA 4GXJA 3V9ZA 3CG7A 3QETA 3RTVA 4KREA 1BPZA 4ECWA 1L3TA 4YNQA 2ZJ8A 4F8RA 4PGXA 4FYDA 4O3NA 3SUOA 5CZ2A 3AVIA 5J0QA 3RR7A 2FBTA 3MECA 4J2AA 1ZQBA 4TUPA 1WSHA 3F9KA 4YR3A 4M42A 3V9SA 3TABA 1UT5A 4AHVA 3DLHA 1MQ3A 3SQ1A 4F3TA 4Q44A 2DPJA 3ZDEA 4QZAA 1BIZA 7ICNA 4QZ9A 5KFSA 2J6UA 3H40A 2KN7A 3QEIA 5F9LA 4DFJA 3TWHA 4CHZA 5J2AA 4L8RB 1LWFA 1DTTA 4F4YA 3LPUA 2YNHA 1VSKA 9ICMA 1J5OA 1KLNA 8ICZA 2BGWA 3PX4A 2VA2A 4Z4CA 3AVLA 5DB6A 5EWGA 2GV9A 2NRVA 3VA3A 2B5JA 3QERA 4CHQA 2A1JB 4ID5A 1PZNA 1JLCA 2RF2A 5FRNA 4IRKA 4QZCA 5J0XA 5IINA 4J9RA 4FLTA 3WNEA 1ZQOA 1NJYA 4Y1DA 9ICRA 4CFBA 3AA4A 5KT3A 1S9GA 1JLGA 1UOCA 2O4IA
chains in the Genus database with same CATH superfamily
3W2VA 1VQLN 4HYKA 2OTJS 2IOFA 4GC7A 3KVGA 1HWIA 3JTPA 5CD4H 2BQ3A 3IS9B 1J54A 3RAXA 5IIMA 3VQ6A 2RD5C 4LF6J 4FWLA 4NLRA 2CFXA 3VZIA 2OSRA 4QR0A 3WC2A 1T94A 2CZVC 5HATA 2Z1GA 1KDHA 2EPIA 1S6OA 1X9MA 2ZM6F 5HMYA 1D8LA 3SUPA 4ZDNA 2YHWA 5L1IA 3DNCA 2YNIB 4KO0B 4BRPA 1GOCA 1JUDA 3N4PA 2HBZB 3CFOA 2YHYA 2HWIA 2FVSA 2QIFA 2MKCA 7AT1B 2A2DA 5HP1B 4QQBA 4OMFG 3KLFB 2UUAJ 4MEXA 5F8MA 3KLHB 2EZXA 3EKSA 1AQ6A 4O4GA 4W92B 2KVIA 4JV2A 2WOMA 3AN1A 5GAEP 2ITMA 3V6DB 4E0DA 3TTCA 1RWKB 2GLEA 2DGUA 2OLWA 4I2QB 4FJ5A 2ALZA 1WOSA 3H3OB 2LFVA 5AK5A 9ICUA 4CM0A 5AE2A 8ICVA 3FC4A 4QIEA 2PE8A 3CD6N 2JNJA 2KRBA 4WZMA 5M1QA 2W54A 1X9WA 4RW7B 1QUPA 1VK3A 1N34J 2KJ5A 1EETB 1XSPA 4DPXA 3DV9A 3V7LA 1QLNA 4G1QB 5A8RB 2RS2A 4NCAA 3JQMA 1XNQF 4IOAL 4EENA 4EMDA 3JPOA 4KLSA 3KMSA 2ZJ5A 5KT4A 1I3AA 2DH7A 2QJ3A 1NK7A 3VOVA 2ZTCA 3S7RA 4QZDA 2G8IA 4J9OA 3HRGA 3WKBA 2J0XA 3DDKA 5LM7E 1HKGA 2RUGA 4TURA 5AQTA 4TLQA 2K3KA 1CBKA 2ZM6K 4MF8A 2C2EA 5H9EJ 2BM1A 2ASJA 2FMSA 2FPHX 2LXUA 2RKIB 1XNRJ 1V4TA 4ECVA 3EUB2 4RW8B 4YOEA 3TPQA 1D8ZA 3Q86A 2A1JA 3IM1A 4MLEA 1VJQA 2OPQA 4I9QA 2Q3SA 3SQOP 1VI7A 4HH0A 2GEMA 5AQMA 3GCWP 2B4UA 4NB4A 4X65J 5LSOA 3C8YA 4U8YA 3OVBA 3UW1A 1PK3A 4MO5A 4BACA 3ZNJ1 3LWMA 4OPAA 1IKWB 1A77A 5B0BA 1VHFA 1JJ2R 4H54A 4USIA 1QSYA 3HTVA 3WEEA 2AGQA 3CF5L 1T6CA 4JP8A 4H5NA 1RT7B 4C11B 3GJQB 5KFGA 4QPTA 5KI6A 2CPZA 4L72B 2I6XA 5AI9A 3B6PA 5BREA 3TNVA 2GQ2A 3HHNB 1SQGA 2FVCA 2OI2A 2PYJA 1H73A 3K5MA 3X3UA 5GAEI 1S3XA 1QAXA 3CJAA 4F7VA 5KFYA 4RUHA 3MM8B 1NJIO 2C2KB 3MM9A 1SS6A 4F0KA 2F1IA 2LQ9A 2O67A 4WU3A 2UXBF 1XNQK 5AQRA 3NBPA 5KFKA 1QTMA 4HR2A 3QU5A 2W8KA 1FI4A 3BO3A 2HHPA 4IL6U 1YJWS 3F5EA 4I2PA 3H0RB 4BS2A 1YLXA 2E7WA 1W7AA 4DB3A 2NLWA 5KG1A 3J7A1 5ALLA 4YN4A 3ULEA 1TTHB 1SXDA 3O4WA 4UAYA 1Z4NA 2R7OA 4FWMA 2M70A 2ADCA 5HR7A 4NL9C 1RT4B 5A8WB 9ICEA 3TA2A 5F8JA 1ZXIA 4AP9A 4BREA 4GV9A 1RT2B 1L8LA 3D4JA 4K4VA 4KHYA 5GTHU 4FZZA 4FZNA 2OCEA 2YWEA 5I3QA 2LPEA 3HFKA 1COOA 1UWBB 4J9MA 2O8EB 1R8PA 4DPYA 3IFEA 3SAHA 3LP2B 1Y7PA 1Q4RA 2B43A 1Y88A 2VJ4A 2ZH5A 1SL1A 4C4RA 4ILMA 3ALYA 4X64J 4QU7A 3KFWX 5GADP 8ICBA 4Q5VA 1ITGA 1WUAA 4ACOA 2ROEA 3CCVS 1NKEA 1GK8A 1MWQA 2YPYA 3K75D 5AICA 4CJRA 3OR2A 5IT9U 2R2SA 5CRXA 3MEEB 3VF6A 3T5KA 3TVKA 2P9GA 2E2OA 4N7TA 3D54A 3UN5A 4OZJA 1SKSA 1UEVA 2UXBK 4URQU 3IRWP 2AH5A 1B0XA 4C4SA 4TN2A 2BCRA 4A61A 3OS2A 2ERRA 5KFQA 4G1IA 4KRFA 4Y0FA 2ZBPA 4F4XA 2C2ZB 1RTJA 3K1RB 1LOTB 3G6XA 3K7RA 1A6SA 3ZSXA 4F92B 1X5SA 2XMJA 4LRFA 3VQCA 2MSNA 1NNEA 4CEDA 4ICLA 5B66U 2VIXA 4Z4IA 4OYOA 1BU6O 4NXMJ 4PJ0U 2KKPA 1NZBA 1CS4B 2CQ4A 1ZQYA 1Z26A 3E9LA 4KGKA 4F5RA 2BMBA 5GINA 1D9DA 2B0CA 1RDFA 3VALA 3CJ7A 1C0TA 1OY6A 3CD0A 4ZOSA 5CXTA 4M9LA 5KT7A 4YG2A 8ICUA 1NH8A 3ZZYA 2ZGYA 1K1SA 2W2PP 4UW2A 1ATSA 4FZVA 2KD1A 2AYMA 4U67L 1U02A 4AXIA 1QTNB 3MR3A 4QIWF 4ZN1A 2C2RA 4FLXA 1KSPA 4HDHA 4RPYA 2B56A 2KXNB 5AR0A 4WQ5C 2K4PA 3A5MC 1Z05A 2KKVA 3N9UC 4MKAA 1SQFA 2B8QA 4UAZA 3ZSYA 1HNIA 5GAHP 2NO5A 1WEZA 2HMIB 1IG9A 4KLLA 1GLJO 2R8JA 2GV1A 1SKUB 5GADI 2XLIA 3NEKA 3M32A 2HCFA 1APSA 5F0WA 3LDQA 3UN3A 1KD1O 5A6WA 1LWEA 1PVPA 2E29A 3DHWC 2BKEA 1N60A 3HYFA 5J2PB 4ZCLA 1JXLA 3J8AA 1QAIA 3V4MA 1GMWD 3MAHA 4NV0A 5BR9A 2D1CA 4OL8A 3ZEUB 2RDDA 2IM0A 3WUHA 3FM9A 3C16B 1NSQA 5KFTA 3PSFA 3PY8A 5FDLA 1URJA 3W9HA 2MQPA 3DHXA 4DV5F 4LF5J 4U96A 4IXCA 1N63A 2ODGA 2LBOA 3ZSOA 2H5XA 1PC4A 1JLQA 2OYQA 4WKRA 4LBIA 1HWUA 4PZNA 4RW6A 5DZ7A 5K9FA 3CCRS 4W5TA 4XK8C 4ZH4A 3W5ZA 5A0LA 1M1KO 2DISA 1JX4A 4DR4F 2OMLA 5T7LB 5LMUF 4I2GA 5ALIA 1YVNA 3BKFA 2VOOA 1RAGB 5D4NA 2XYGB 3DN9A 5CR0A 3PVXA 3CPWM 3OHBA 4AHCA 3M8QA 4I2HA 3C6TB 2V69A 1EWQA 3I0RA 4PQUA 3BQ2A 4QS9A 2J76E 5F3XB 3KTQA 3C6UB 4LFBF 5DDPC 2D8CA 5J2MB 2QFJA 2DO0A 3P83D 4KH5A 2RRDA 4ZVSB 3R2DJ 1D9FA 2BRLA 3UKUB 3VA0A 2O6KA 2PMHA 3JQKA 2UV8A 4PHPA 2D0AA 4OD0A 1VQYA 5J0SA 4OYWA 2JX2A 2BR0A 4Y2VA 3QPIA 4O44B 4YDUA 4F0MA 5J8YA 1XR7A 1PKUA 1T03B 3ZSRA 4DN0A 2JXJA 4I2JA 1VQ4N 2P66A 2FJVA 4KI4A 2FJWA 2IHNA 2RIJA 3GQCA 3OYKA 3JXUA 4O23A 3FZFA 3JYTB 1BPBA 3VEZA 5GAHI 5F2RA 3CWJA 3IV6A 1V5VA 2CH5A 3J81j 5F0UA 1IV0A 3THYB 1NXIA 4F3OA 9ICAA 3F2KA 3H5UA 2ZBRA 3EDQB 1FTCA 2HIQA 3D6HB 3CRXA 5I3PA 3CDUA 4DV5K 1V5IB 4DG1B 2G8WA 2VU5A 2YH1A 3C6HA 4TYBA 4IS7A 3U6FA 5AQIA 4ED0A 4BRDA 3MCSA 1UWAA 3EGVA 5DLGA 4JV0A 1HBNB 2PDAA 4DR4K 1O5JA 5LMUK 5J2EA 8ICIA 1UKUA 2JGAA 2GIFA 2YX7A 5EUHA 1C1CB 2MZ1A 3VAHA 1SC3B 3LVWA 3VAFA 4NA3A 4OZ3A 1WEXA 1TL7B 3KK2A 2K2PA 4O4RA 3IAYA 3NAIA 4OJOA 4LFBK 4X4PA 5M2UA 8ICHA 1YJ7A 4CCHA 4OHVA 2FJXA 3V9XA 1HWJA 4DL5A 2CRXA 1YTAA 1L7OA 4AHTA 4NLGA 4MJKA 4V1Ak 4ZVQB 1VQ5S 3VEVA 5DK5A 4ZLPA 2XMTA 2B3TB 5J1NA 2QLJB 2HVIA 1VQSA 3SEOA 4F4WA 1J2NA 1CJKA 5C25B 2FVRA 4PXBA 1JLBA 1LW0A 3W2WA 4CBUA 3QWPA 4MT1A 3BQ7A 1U7LA 4F4ZA 2BE7D 4NLYA 3KK1A 2H3QA 2Z56B 1LKZA 2FVPA 5DMRA 3B82A 1IG8A 4JB3A 2FC8A 4YHHJ 3Q23A 1J27A 2HVEA 2HFOA 2HDOA 4DHVA 4L76A 1AROP 3N79A 1MWKA 5BYSA 1VQ9S 3RH4A 1TFYA 3QT7A 4C7YA 1WOQA 3EL2A 3QGGA 3CYMA 3QFUA 3GYGA 2FSNA 3GZFA 2DBYA 3O3LA 1AT1B 2CG4A 3ILLA 4BLGA 5IOLA 9ICFA 1RT3B 4A47A 3KHRA 2YKNB 3ORYA 4UZCA 2EC0A 4KV8A 3ATVA 1IG6A 2FGOA 2Q6BA 4EX7A 5J2GA 1TKZB 4HT5A 2OPSB 3M8YA 3L2QA 1FXRA 1R31A 2IYIA 1B64A 1ASWA 2XCAA 3CTRA 2W4PA 5AJ3J 2ASOA 4WJ3B 3KLIA 4C3KA 5EHHA 2KM8B 4ZVTB 2XMUA 3IMXA 1RQ0A 3HSJA 3SR6A 2EK1A 2BA9A 1RTIA 4XO0A 3IHQB 2IY5B 1VBKA 4DOZA 4ZP9A 2XY7A 1AFIA 1XC9A 4JI6F 2H3ZA 5IC4B 1FNXH 5IC6B 4FJXA 4QIVA 3US5A 1SJRA 5T7BA 4Y2KA 1MWZA 4ZTFA 1PIEA 1TYQA 3D2EB 4K7QA 5CAAA 5EU7A 3C5GA 2B8PA 1KVKA 3MUTP 3UQ2A 1TELA 3UD5A 1KLMA 2NRZA 3CCRN 3FLCO 3DC2A 3NMUA 2D1KA 1Z2LA 2NPIA 4MMOA 5IIIA 2CVEA 2FJEB 4F3MA 4K4TA 3N5FA 2FPKA 1S99A 3QATA 2XZWA 3ZNUA 2ZH3A 2OTLS 1H1VA 4ISGA 1Q5YA 1UVLA 3B6BA 5J2IA 1VS3A 9RUBA 1S9EB 2PA3A 4FJ9A 2HNDB 4ZVUB 1FDNA 3I76A 3E9OA 1LQ9A 2HGLA 3K2PA 5K8NA 2OELA 4DR7J 5HL7Q 4IH7A 1CQMA 2AEMA 4BQLA 2X7IA 1F60B 2C2OB 3I55S 4RW4B 4BVPA 2MDAA 5CH7B 2FBXA 1WCLA 5AM2A 4FWOA 3R7NB 1P90A 2J9CA 3RMAA 2W3SA 2IC3A 5F8LA 3CCJN 4FO0A 2BX6A 3D6JA 3I28A 2F7VA 2XULA 3WKCA 3P4IA 5AZJB 4LFCF 2B7BB 2BW7A 5BJRA 2ALYB 5IV4A 3VMFB 2BE9B 4DUYJ 4IQVA 3MDQA 3JS6A 3AM9A 3ZT0A 4RW9A 3THXB 1M5SA 3MWPA 3SBMA 3PTWA 2CQDA 1NLKL 5KPTA 2MYFA 2P9LB 3NH2A 2AJ0A 3E51A 3GFKB 3G71S 2VONA 3UD3P 2QI2A 4JI6K 3W9IA 4M5LA 3L3FX 3GMGA 2M0NA 5J0WA 2W9CA 2WAQD 2ROGA 4GMJB 1Y97A 4Z4FA 1KP6A 4EU0A 3OLAA 3RBZA 2EAMA 4KI6A 4DR3J 4DOAA 3PW0A 5AIAA 2HAIA 4BE0A 3IP0A 4M2YA 1HI0P 4HT7A 5LT5A 2KFNA 1MW7A 1I39A 2POKA 2WVCA 3NLCA 3EX7B 2YY3A 2O01C 1EJ7L 1YJ9N 5L8RC 3LP1B 1ZRNA 3PFOA 2CPDA 2W01A 4YOVA 3RJJA 2RPIA 2LYBA 3R8EA 1KVBA 3BGRA 2PO4A 4UOFA 1RILA 2PFDA 1HYZA 3OW2M 3ZSZA 3QZ7A 5KG2A 1TKDA 2E9TA 4A59A 1GAOA 2E1AA 1IKXB 3OYNA 4E7IA 1NPKA 4MN4C 1RT5B 2AJFE 3V1RA 4JI5F 4DTPA 2NLXA 3L7PA 1CC8A 1C1AA 2VB6A 1H3DA 3ENOA 3KD1E 2Y1JA 4E7KA 1IBKJ 1RHJB 2ZIUB 3QEWA 2F96A 1FKOA 3PW5A 1DGJA 1NMEB 2F76X 1FDAA 4LFCK 3FC9A 1N5YA 5TKWA 4BC2A 3D0GE 2B0GA 5EE3A 4FYXB 5EY4A 1YSJA 3VVTA 3QQCD 2RNEA 4J37A 3SJJA 3SMVA 4TY9A 4ANDA 3H2VE 2BEFA 4N77A 1HX1A 3I87A 4NXNJ 1VSDA 3EZWA 2HNZB 4NL9A 1X3MA 3FEYB 1R6VA 3J7AP 4B9TA 3AH6A 5D8HB 5J2QB 4DFPA 1NHUA 4L6V3 4AM7A 3AO1A 1HHSA 4KHUA 1QJHA 4RWWA 2XI9A 2X3DA 1KN5A 1F6TA 1ZJNA 2F8EX 3MAAB 1RCOB 1S49A 1BO5O 3C15B 4NA1A 2KEYA 2MHNA 4BR4A 3TUPA 5AZIB 2C3OA 2F8TA 3TUZC 3ZT3A 5JMVA 1FJEB 3E01A 4CHNA 4DTUA 1FFGB 3NWRA 1KQSM 2XBPA 4OZ1A 3D66A 3T1HJ 2DR6A 5C2DA 1X7VA 3SQGB 4C48A 4EO6A 2N3LA 2KKZA 2F7TA 4ECQA 2RU3A 4Y34A 3M3ZA 4KLUA 2L9DA 3TA1A 4DX7A 3CCLN 1RTHA 2KJWA 1Q0NA 2ZBQA 5AQOA 5L1MA 1TV6B 2FJBB 4O8KA 4K4WA 4CBWA 3H8SA 3VQAA 1NGDA 3MR6A 2PAVA 2CJKA 4CRXA 4JI5K 1SJ3P 3K0JA 2ZHAA 3D7EO 7ICVA 2OO4A 4F0HA 1R0CB 5KFNA 1S7IA 4NLOA 4WE1A 4B3RF 3D2QA 4NZ7A 2FHJD 3ILJA 4LH5A 2CQIA 2G0IA 4PYDA 4IDHA 5KFIA 1NK5A 2OUGA 4JI2F 1MQ2A 1N5WA 2C2NA 4ZPAA 5DM7Q 4IFVB 4LIWA 1S1XB 3JPRA 4GW6A 1ZQAA 1NOYA 3BO4A 1HPZA 4QR1A 4JV5J 2BUNA 1A5VA 3D2WA 5KFHA 2HRYA 3I4HX 1CJUA 3IG1A 1FTRA 5D46A 3FZBA 4YMOA 2FJAB 1NNLA 1SV0C 1U25A 4Y2MA 5C12A 2I1QA 1N36J 4QPXA 5M1OA 1BUXA 3ZETB 4KT0C 2O8BB 1SXEA 4WPAA 4W90B 4DMZA 3T1AA 2BHNA 2CPEA 3H7IA 3EE8A 4IEIA 5G5GA 4NMXA 2YXLA 1NK0A 3CQXA 4H5VA 3CJ4A 4XTTA 1FVQA 3RH6A 4M1KA 1WLJA 5KFWA 3ZYYX 4IBNA 2DGXA 3GG4A 1VSLA 8ICCA 4Y1CA 1JCEA 1ACMB 3QIPB 2EX3A 4JD2A 2VV5A 3DOMA 1CPZA 1UPMB 2ZJRQ 2V9WA 1FNMA 4LSLB 2FPLA 3TUJC 3CC4S 3LDAA 2BRKA 3ZZRA 2ATQA 2HOIA 3QRPA 3RBXA 4TXSA 2C2DA 4I6YA 4HWIA 2MUTA 2M5YA 2CG8A 4MTPA 3A0IX 1QSLA 2XTJP 1KTQA 1ZQXA 2QMXA 3L2UA 1A0OB 1UJ5A 1REVA 2VFUA 5HRSA 3JSRA 2PFUA 4BJQA 2OPPA 1YVUA 2F40A 2O8DA 4RX6A 4B3RK 3O8WA 2AW0A 3MFIA 1U6BA 4YQWA 7ICHA 1FERA 4C0ZA 2IOHA 4H0VB 3VQSA 4PYAA 4JI2K 5F41A 4UY8T 3RAMA 1VJ5A 1KW4A 2W43A 3GV5B 1HBMB 1TK0A 1S72S 3WK7A 2RUSA 3QT8A 4KX3A 3T5HA 4DS4A 3VQ5A 5BN9A 3JSMB 4R79A 2W2NP 1B43A 3VQEA 4HCBA 4KGMA 3P1GA 3AJ1A 3CI5A 4F3QA 2NSCA 3C46A 3V1OA 2A40A 4ZJLA 1S1WA 2CQCA 3CDAA 1O03A 2GWSA 1GTHA 2YX4A 3NGRA 2DUYA 4CEBA 3I56N 3FGUA 3FDSA 3NVKA 2KJ9A 5IZHA 5HNKA 8ICQA 2CAJA 1RTDB 3QEBZ 4BXOB 1PYTA 5IT0A 5CZXA 5BYQA 2DHGA 4CH1A 1VRUA 4NLTA 1GXLA 3PG9A 4DEZA 2RRAA 1ZH5A 4R8UB 4KIAA 4ERDA 1Q82O 5E84A 4OHZA 4USWA 2HS0A 3CJTA 3SCJE 1RDWX 4YY3K 4CFCA 3U8XA 2W1BA 2W9BB 3R7BB 1EKRA 2Q1NA 4X4OA 5J2KA 3FZMA 2HQGA 4YMNA 4BRQA 1L3VA 1B4SA 3POTB 2GX8A 3DI6B 3TARA 1AB8A 3K59A 1VISA 9ICVA 2DNQA 5HO4A 3WDOA 1OQ6A 3CJ9A 4TU8A 1RTZA 1FO1A 3LDOA 4PABA 1C20A 2JLGA 1Z25A 1UPHA 4KB7A 5DDQC 1LFPA 3QNOA 2ZIXB 1OPIA 4PUOB 3VEOA 1IM6A 3KBBA 5DBCA 4L74A 2KLAA 4DV0J 2NCKL 3B4MA 3OFGA 4F04B 1JLFB 1U1MA 4I2FA 2KNJA 2OEHA 2D69A 4F5QA 3RJMB 3MR5A 3H4DA 3EGNA 3DLEA 2ZIWB 4KBOA 4AYBD 2VPXB 1MU2B 4M7XA 2F8SA 3J7YU 3LP0B 3VHQA 1ZM3A 3UXOA 3V1QA 3UNYA 4JI1F 1SVDA 2QXLA 2QWMA 1XQIA 2E1PA 3EY1A 3R3LA 3MXHP 5ALNA 4P75A 4USMA 1RYSA 3DXKB 1V6HA 4ZP8A 4B3TF 2KFZA 3OYBA 4J2DA 2P9SB 3CC2N 2CPRA 4GVBA 3KDNA 1HYSA 2KK0A 2Q0RA 1NNDA 2DH8A 4C98A 3MPDA 1Y3KA 4RL1A 3T7ZA 8ICJA 3G96A 4ZK7M 1VQPS 2F4FA 4FE3A 2JRSA 3IWXA 2LQJA 1R43A 4LF4F 1U1NA 2QLTA 5J2JA 2P1JA 2UUTA 1L7NA 4NM2A 5AQXA 1VQKS 2FUG9 4PWDB 1QZ6A 3SENA 3UM9A 2IRXA 1U24A 4A2AA 1T05A 3CJ5A 4LVNP 2R7WA 1BHLA 1RUSA 3Q8MA 2AP6A 2HI0A 1Q7YT 1TKXA 4QWEA 1U2VA 3PIOL 4RBUA 4F9OA 4PHAA 2V4RA 2QL7B 5A8KA 2CN1A 4B9QA 2XY6A 3OVSA 1P6TA 3AVBA 1HHTP 1PAEX 3W8GA 3M9OB 4CIGA 3GDQA 2MKSA 2GMJA 4JI3J 2E6MA 1SKWA 4CJ7A 2ASYA 4UW9A 4NM1A 3WZ0A 2NPFA 4LF6F 4AL5A 4NYNA 4ISFA 4QWAA 2D0PA 1WBBA 2DKZA 1Z00B 3OFEA 5BPCA 2PIIA 1NGGA 1HL6A 3Q8QB 4BG9A 4OI3A 1CLFA 5HBMB 1QUVA 3DGVA 2KTQA 3H42A 2YWKA 1AXQA 3MXIA 1YBUA 4FKXA 4CVNE 1C1BA 1FO4A 1C0GA 1G7CB 4M63C 5I9EB 3GJRB 5HOOA 2Y0SF 2FC9A 4H0PA 3M6XA 2WUSA 4USKA 5HSPA 4B3TK 2EFNA 1MROA 1W7WA 4PCQA 3BZCA 3TTFA 1KONA 2UUAF 4CJFA 3CC4N 4K8XA 3D2FA 1AA1B 4E89A 2WVDA 3RZAA 4HVJA 3CCMS 2NUHA 4LF4K 1FEHA 2O66A 4IRCA 3WQTA 1YUWA 1SI9A 3A8KA 4WF9L 1JB0C 4DL0C 4MO4A 4OLBA 2F77X 4IEEA 4Z6EA 4F5NA 4YR2A 4RT2A 3ALRA 4WYWA 3THWB 2VPZB 1NOZA 1SXLA 4AM6A 3T79A 1UFLA 2K60A 1N34F 1RBTA 3NAEA 2CIMA 1E3MA 3O3GA 1ZPVA 2V8HA 4NI2B 4Q7AA 3R7SB 2D0OA 2O8FA 4BRLA 3C0BA 1VQNN 2JOQA 4H0YB 2BTFA 2YQ0A 1MDUB 3U7JA 4LF6K 4F25A 1YKWA 1HJRA 3AO3A 3QXGA 3EWAA 3AO5A 2KIVA 4P0PB 2YNHB 3BEXA 3AGRA 1J5OB 2RRBA 3A5NC 1D09B 5ALGA 1E6VB 3ZTRA 2PFNA 3QZ8A 1XIQA 1T11A 2RE1A 4NLSA 4ID5B 1IBCB 1V3RA 2A41A 1JLCB 1XNRF 3EICA 2RF2B 2DFLA 1LWCA 4S0MA 1CC7A 3S1TA 4KB0A 3UVJA 4I2DA 1X3NA 5AK3A 1JLGB 3TANA 3BZKA 3PJ9A 1H98A 5CYQA 3W2VB 4X65F 1RYRA 2UUAK 3LZIA 4Y2RA 3ID6A 5A2QU 1DLOA 1BOTO 1YHQS 2KL8A 4I6MA 1HIYA 1DJ0A 2KZZA 3UE2A 2PI4A 5SWMA 1YTUA 1IWAA 2F1HA 4ELTA 4HUEA 2OXOA 2AU0A 1OY8A 2F3NA 5ADXH 2CH6A 3KZIU 2JEJA 2L08A 2IVNA 4CDGA 3AEVA 3M9MB 2W24A 1ZQCA 3RYLA 4Z4GA 4TU7A 4ED1A 2AX1A 1CZ9A 1UTAA 3FQKA 1PVRA 1OQ3A 3MX5A 2LU1A 1S0OA 3PXGa 3HFZB 3H4BA 4ES3A 1UA0A 4K4YA 4NCBA 3CETA 2O5DA 4ECYA 4JN4A 1SL2A 2YKQA 1FEEA 3R9KA 3ZTQA 4O4GB 4MK8A 1BPXA 3DRSA 1XNQJ 4HL9A 2AF6A 3E66A 3CD7A 2BM0A 4K4UA 2WOMB 4C80A 2IJFA 4I4BA 4CZHA 4FDFA 5BOMA 3NFAA 3CD5A 5BPMA 2DFHA 1XEZA 4BCAA 2DRAA 3BPDA 1UAXA 2HIYA 5H9EK 4KLEA 1HBUA 3V9ZA 3QETA 4ZPCA 4K2JA 1NJIT 1BPZA 2HBQB 1XNRK 3FSXA 3BO2A 3UKRA 3GFZA 3VF4A 4FPBA 5CZ2A 3IC1A 5J0QA 3RR7A 3MECA 1QHAA 1ZQBA 4TUPA 4BC5A 2ZJPQ 1FRIA 4M42A 2WF8A 3V9SA 3TABA 4X65K 1UT5A 2V8GA 3SQ1A 4F3TA 3G8QA 1BIZA 2BJ1A 1IBLJ 1F9FA 2DKXA 5KFSA 2J6UA 2QZ8A 3HDSA 3H40A 2LP4A 2KO1A 4DCHA 4FFDA 2IOFK 1DK2A 5J2AA 3UQSA 1X0FA 1KVJA 4KC5A 2MY8A 1X9JA 4ZCIA 5LXYA 3GSIA 6FD1A 2YMPA 3PX4A 3GG1A 1NO8A 2R18A 4Z4CA 2GO9A 2GV9A 3J80O 2NRVA 1F5CA 4CZGA 3ZZUA 2A1JB 2A3VA 1WWHA 1PZNA 2OPQB 3I8BA 2P9NA 1K8KA 1TUWA 2YHXA 4J9RA 1I6JA 2DR9A 3WNEA 3OXGA 1NJYA 9ICRA 1BHNA 3AA4A 3EUNA 1UOCA 4ZVFA 2UXBJ 4HACA 1HJOA 1WB9A 1KAYA 2LEAA 2CPIA 1A7GE 3IRXA 3PSPA 3NASA 2YMQA 3WEEB 1CUKA 5GAGP 3ZX2A 5LXRA 2ZKUA 2J9DA 3EM1A 4DV2J 3FCHA 4IOXA 5EGYA 1S6UA 3G86A 3TSQA 3I6PA 4H0OA 2WSFC 3FBEA 4QS7A 3MCOA 8ICYA 3DOKA 1Q5VA 3FJ2A 2C3PA 2H1YA 2CJXB 1HQEA 1N54B 4MKBA 1KQGB 1CLQA 2IA0A 3MM9B 3P49B 1PJ5A 3NBPB 4JS4A 3SBGA 2WF9A 2CRLA 3AJ2A 3QLHA 2UVWA 4IRDA 1ASVA 4JI8J 4BX9C 2VWBA 1YBTA 4I2PB 5KFVA 4WFYA 2RJZA 4I2AA 2VG5A 3R8YA 3FFIA 1IH7A 2PBDA 3ENHA 1PK1A 3ULEB 2ITGA 2PMZC 2RRNA 4IKFA 4PG8A 1X5OA 4US8A 3V7KA 1VBYA 3JAMU 1U2FA 3M1FA 1SIZA 4MKYA 3AD7C 5GMKa 4U7UK 3FEZA 2XB2D 3NF7A 2G8UA 2AKWB 1QQNA 5L1KA 2D0CA 4CK3A 1NGBA 4M95A 3L0QA 3LDNA 2R7UA 1FKAF 4CEOA 4C7QA 1S1TA 2GNKA 3N28A 5K5MA 4HKQA 2ASLA 3BB5A 4PXEA 5E3RA 1WKKA 2ACYA 2LQBA 4F26A 3AVGA 3P5BP 2EH9A 3IAM9 5K8MA 3MN9A 4YMMA 3QWUA 1B0TA 2EG2A 2AJ1A 1YHQN 2HBYB 1EX8A 3QMQA 4MKVA 1BUPA 3CCQS 4K50A 1SJQA 2IAJA 2E5LF 3KNGA 2YVSA 2QARA 2F1FA 3QT5A 5KQDA 3IG8A 4JMUA 4LF5F 2ZD1A 3SZ2A 1RP5A 4I6WA 1ATNA 3NP5A 3OR2B 1KD1T 4Q8EA 3QNNA 3H6EA 2HAFA 4ZLNA 5GAGI 3HCXA 2P9KA 5BPNA 4R63A 2DHAA 1WSEA 4O55A 4BRAA 4OJPA 4OZNA 1YG0A 4A48A 4YOUA 3UXPA 4EEYA 4QW8A 1CJVA 2RHFA 4KLQA 3E8OA 1RZTA 4PZVA 2Z7JA 1IM4A 4ECTA 5GIOA 3SQIA 1KC8O 3GIJA 2HHVA 1RTJB 2CPFA 3D6RA 4KY3A 4FK0A 4EELA 1UT8A 4LSZB 1FXLA 4RQ6A 4FJLA 2GELA 3GB0A 1S6PA 3G6VA 2B9WA 5KAFU 4ICLB 4KLIA 4OHXA 1M1KT 4KH6A 2XNQA 3HZ6A 2Q1LA 4ER8A 1KCFA 4DL4A 2CGKA 3HOTA 4DV6J 3H0PA 2HLTA 1DRZA 4YOWA 4NPOA 3RJHA 4I29A 1ROFA 5C42A 2AIRB 2IA6A 1C0TB 1J6ZA 3F2DA 2F8LA 4RNMA 1LAWA 2KHOA 5D77A 4LT6A 1RT6A 1YITN 5F9NA 2HPUA 4Q45A 4KQZA 1ZBHA 4KRWA 2AV5A 4OI0A 3A0BU 3E58A 2GS8A 2A6AA 1NJXA 3EXCX 3BBFA 3VQ8A 4KX5A 1ATRA 4RQ1A 3VN5A 5TISU 3UN2A 4I7FA 4CNYA 3UMBA 7ICEA 1TL4A 2E5LK 2QL5B 4DN9A 1MLAA 1GMVA 3L8BA 4LF5K 4LBHA 3N4QA 1HNIB 4LIRA 1Z2ZA 4PL1A 2GHVC 1VHIA 1T02A 1RLCL 2ZBCA 3T9NA 4OV6A 3C65A 5F8IA 4Z2XA 5T41A 1XI1A 3BZQA 3MM7A 2BZFA 2G0AA 4O5CA 3OR1A 3M32B 4QIFA 3VWSA 4NLQA 1N6QA 2LCWA 3CO0P 1BPYA 1LWEB 4M5MA 1VBZA 1Q86O 4B9SA 4Y2YA 1TMJA 1NU4A 4M41A 4DSJA 2DNNA 2WFAA 4I2EA 5LSLA 4WXWA 2MY7A 2QMUB 5HHHA 4ZPBA 3NGYA 1ZQMA 2V8VA 4EZ9A 2DXFA 1HNWJ 3ZCMA 4V19X 3BKUA 2NV3A 3ISZA 1X4GA 5FDLB 2WSEC 3NAHA 3G6YA 5JJBA 1U04A 1SB3C 2LYVA 3N6NA 4UOHA 1JLQB 4NL5A 3D6MB 4RW6B 3ICXA 5AKHA 1RAIB 1A76A 4QYRA 3Q8PB 2R8IA 3CCZA 4QW9A 2WAQC 3GOIA 3CQ8A 2DNRA 2FLLA 3V6HA 2MQOA 3NKYA 4DPOA 1X60A 4QYZJ 4UTGA 1AUSL 4IKAA 4K43A 3SDEA 4OJ5A 3HL8A 3M8QB 2K89A 2KZMA 4JYAJ 3I0RB 4I69A 4PQUB 5JU5A 2GBZA 4C7ZA 3H20A 2VPWB 4K5SA 8ICXA 8ICAA 1DGKN 4M3WA 2OP5A 4DZDA 4KAIA 5CYMA 3GZ7A 1QQ7A 2D9PA 4ZJOA 5IM0A 2WF5A 1FWPA 5JUMA 1C7YA 3EE3A 2VG6A 1VQ8S 2PT0A 1G4CA 3NRWA 4CF8A 3CEDA 5HR6A 2LEBA 4DJBA 1N88A 1N62A 3HT3A 1NSAA 5ETQA 2JHDA 2QB0A 4J2BA 3L95X 4GIBA 1MG7A 5GAEU 4BE2A 5KG4A 4G1PA 1VHXA 3O3FA 3WU2U 4B1YB 2BE2A 4KLHA 4CIFA 3ET6A 5C24B 1YRUA 3Q7BA 4BVOA 3C2MA 4UQGA 5AJ3F 4OKEA 4DTRA 2GO7A 4F72A 3KWGA 1DQ8A 8ICEA 2GQCA 1ZAWA 1QAJA 1RBUA 2NO4A 2OH2A 1NEEA 1EXQA 3D45A 2CYYA 4U7CA 4M3RA 1H38A 3ETLA 4J9SA 2QLFB 1Q95G 2W04A 4ZHRB 4KLGA 2Z2YB 1QQ6A 3IKMA 2YHAA 4M63A 3H0LB 2CZ9A 1V4SA 2B6AA 3SV3A 2AJ2A 4RQNA 2Z4PA 1BGXT 7ICRA 5J1PA 3BSOA 3TQEA 4P4PA 5DDOC 4CGZA 2EBEA 3PHEA 3KJVA 4LQ9A 4WFBL 2CVIA 4FJNA 4I2CA 2NUUG 3NGKA 1QE1A 3DFEA 3O9TA 3MTKA 3KK2B 1WG8A 3HZGA 3KKAA 2HBLA 3C7NA 3UPQA 4IO1A 2QEXN 5HVFA 3HXMA 4DUTA 3AOBA 1HHQA 3O1BA 2ZTEA 3HULA 4Y6IA 1VSEA 4TQRA 4DR7F 3IGNA 5KG6A 2VA3A 1ZQNA 3TU5A 3CCSS 1RU1A 3QFWA 2KKHA 1CJKB 2OMOA 1JLBB 1LW0B 3W2WB 1X66A 1SH0A 3U4LA 3ZSQA 4XH5A 4P73A 2V94A 3PYFA 1LFWA 1QDUB 3C2PA 3I96A 1KQKA 4R0EA 4FP9A 1NGIA 3KK1B 5THWA 3FR0A 4CZKA 4IO9Q 1OH5A 1GLBG 4TU9A 2B9EA 5KFJA 3O8MA 5AJ3K 3TO8A 4PL8A 5ALVA 3MCNA 3IA0A 3DKDA 4UB8U 4QZEA 1S9FA 1XS9D 4ED3A 2I5HA 1H2VZ 2IJRA 4E7JA 3PIPQ 2ADBA 3HZEA 1IJEB 4BWJA 4PEOA 3CXCR 5EOZA 3AQPA 3PRDA 3JS9A 1WOOA 3V72A 3H8YA 3H0MB 1NK8A 1N5XA 3CJBA 3NCQA 3PW2A 1PBUA 4U7UD 3M2VA 1NM2A 8AT1B 5ETOA 1OY9A 4Y2AA 3JAMY 2HBJA 1GX5A 3GILA 3RSEA 1NKCA 4XPCA 3X1LB 4KV8B 3R1LA 4A8XA 2LXIA 2GJFA 4DR3F 1FX2A 1CEZA 3AAPA 3ADAC 4C0HA 4R5PA 5JVHL 2CQGA 1BISA 5ETPA 1TVRA 4OLOA 1JQGA 4WFZA 1ZOLA 5A2QO 3KLIB 3W61A 4LRCA 4P2FA 4YR0A 3ZTPA 3T9ZA 1SH3A 2A19A 1DTQA 1XWLA 4O5EA 5CE3A 3MGJA 3AD8C 3FCWA 2W42A 4DR7K 4O3MA 2JMGA 1GTEA 1G2EA 2KE7A 1ZA1B 1SQKA 3TZWA 2LECA 2ZZTA 1DZ5A 2P6TA 1TYQB 5AQLA 3PV8A 2DRBA 2CADA 4USJC 4L73A 2KMDA 2Q2RA 1KLMB 4OZ0A 3TAFA 4MIAA 1IBKF 2JFKA 4M04A 4UT4A 3H1VX 1S76D 4QNLA 3LOUA 2ESEA 1GMWA 3DLLQ 2GWKA 3CFPA 5CJ7A 3MOJB 1UJ6A 4LFCJ 2XI2A 1U1OA 4MLHA 1KDNA 2ZDOA 1RGIA 5DB7A 3WXLA 1D8YA 4OYXA 3BS7A 9ICSA 1R8BA 4CJLA 5D0HA 3MFHA 3DXSX 5IIKA 4E7LA 1RBVA 5AM5A 3FBBA 2VD3A 3GG0A 1VQ8N 1SB6A 4B02A 2P9EA 1FJGJ 1FFSB 1T95A 2IC3B 2MQMA 1X4CA 4DR3K 5HP4A 4RBVA 2VKQA 3W5XA 1VYAA 4E19A 2AZ3A 5AQSA 4QZBA 4F5OA 5C10A 2VQFJ 4IUFA 4OGCA 3RU0A 2G8KA 3T1HF 1KBUA 3S3OA 1XNSA 3IM8A 1RKJA 1FXXA 3NNCA 1DGSA 1RBSA 4CEQA 4RW9B 4DPTA 2P5OA 3TRGA 4K5RA 1HMVA 2P35A 2B4PA 4C0OC 5J29A 1OKJA 3KK7A 1UFWA 3SQ2A 2R9LA 3MN7A 5FJ4A 4CF0A 4RQ4A 1NHKL 3W7BA 2FZGB 4CO1A 1WSVA 4B3SJ 2G0JA 2ZH9A 2V50A 2XGPA 4IH6A 4FL9A 3RJFA 3H8WA 2OD4A 4NE9C 5HRPA 2E44A 3OL9A 3HWTA 3QGHA 4K8ZA 1CXUA 2JSXA 1IBKK 3FMWA 2VIHA 3VAMA 3P6YC 2FBVA 3NDKA 4ZVGA 1HNVA 1PVQA 1KL9A 4GO7X 4KHWA 2RVJA 4EAHD 1S10A 2HZCA 2MEWA 3RB0A 4XPEA 4RO0A 5HVHA 1YK9A 2LKZA 3K4GA 1H0HB 1N8RO 1U26A 1KXPA 3ENBA 2DTJA 5AQGA 1VLBA 4FF1A 3BGRB 3QYYA 1UVKA 2A1AA 1UPPA 2UU9J 1JJ4A 3DXBA 4ZITA 1RM6C 4JV5F 4QWDA 3S3MA 3TFRA 2GWJA 4EHUA 2I6WA 1WAJA 4AL6A 3QAEA 1G15A 5DQHA 5MLCQ 2HQFA 4I67A 3E9PA 5KRTA 1JNRB 2UYTA 1N36F 1RAJA 4QZ8A 3SI6A 2R7VA 3IM9A 2LQ8A 3GSDA 4DTJA 2BDUA 1WHXA 5M2PA 2P5VA 4DOBA 3K9KA 2WSCC 1SUQA 1NSKL 1FX4A 1FXDA 3DRPA 3CO9A 3M1YA 2MLYA 1FKOB 4GVMA 3QYPA 3KUEA 3O9UA 1N5YB 3T1HK 4AE5A 1XO0A 4UB5A 3MCPA 5HMXA 3EEQA 1IBMJ 4PPDA 2QX0A 3C23A 2KT3A 1OO0B 3I32A 2RQMA 5D4BA 5ALOA 4UBBA 1NWKA 3ITHA 1LK7A 5LL6Z 1F3FA 1XHXA 3MOZA 4F67A 5KGWA 5KAIU 3DAWA 2E9RX 1EP4A 1VJWA 3GONA 1HNZJ 1VFJA 4FK4A 3TSUA 2QGFB 3NS1A 4FW1A 3RB6A 4FN5A 2XY8A 1VQMN 1X31C 1YVFA 2X78A 4ZVRB 5EDWA 2AP1A 2DR7A 1C6VA 3WKEA 3L6QA 2ZHOA 4M5NA 2VKZG 5JS1A 3RJEA 9ICWA 3J80Y 3E01B 3LTOA 3RB4A 3IR5B 4DDFA 3MM5A 3R6MA 5J2CA 4C8YA 3PIPL 3DEEA 5T14A 4KLOA 2QA4S 3VPZA 1U2CA 1RAAB 5JICA 4J9PA 4M45A 1K0TA 3DCAA 3CMES 1QQMA 2XHCA 2DPIA 3I5BA 5JLFA 1RTHB 2FLNA 4XDCA 7ICTA 2KXHA 4A8EA 4WYLA 1N36K 1YDLA 2QLWA 2NXUA 3NVVA 4KN7A 1UP1A 3T3FA 1BWFO 4M5HA 1P1LA 1YJNS 1YJTA 3BN4A 4FXDA 2DWQA 3LO3A 5J0PA 2A3JA 3KUHA 4PHEA 2R7TA 3QFHA 1WCNA 1MN9A 7FD1A 4RPFA 1X2IA 1D4XA 4PH5A 3HHLD 4C8KA 3QESA 1IQZA 2BV3A 4JRPA 3FBCA 2XO7A 1Y4ZB 4YY3J 4FWRA 1KOHA 2HMXA 5CZ1A 5KT6A 2JZBA 5E33A 1HPZB 2G0CA 1Q53A 4OYMA 3J7ZO 1GXTA 4BBYA 3NF8A 2KICA 1CJUB 3IG1B 5JRTA 2YX1A 4DCJB 2WK4A 4O0IA 3L3VA 3K2YA 1OVYA 4JS5A 4FLVA 3PW4A 2NXEA 4BC4A 4EWTA 1Q82T 3DWLA 2B7CB 3DJCA 4FNIA 4DV0F 3LPTA 4O8UA 4IOAQ 1NZAA 1BC6A 3GWCA 5KTQA 1TMMA 3ZT4A 5ALSA 2BJ3A 4DR1F 1VDHA 3O4NA 4CJSA 3SPYA 3MEGA 1XMOF 1ZBUA 3HM9A 2N1RA 2P2CB 3MCAB 1WF2A 4A8YA 3QDKA 4JD2B 3DOMB 4DMNA 5H2FU 2CWXA 4F71A 5M1PA 2AWZA 2NZTA 2H3GX 5KFRA 2DGOA 4M5KA 1XHZA 2ZH1A 2XICA 4DTOA 3BM7A 2P6UA 2AYBA 3QNMA 5RUBA 4DCPB 3HI0A 3JXOA 1S5JA 1VSJA 4RNHA 1T9UA 4CO4A 4P7VA 1REVB 1JCFA 3WIVA 2F1JA 4NLKA 2G8VA 3CCWA 3EVMA 2O8DB 4JOUA 4ED2A 1C4AA 4DBQA 1KHVA 4C8MA 4CTAA 1FFUA 1OSCA 2CPJA 4Z6CA 1EKEA 1ZPWX 3QBXA 1RBRA 3SUQA 3CF5Q 1WC3A 4Z7YA 2DR8A 2JEGA 2DEJA 2W7OA 2E7XA 4CZEA 1S0MA 1SPBP 4ID1A 3CB4A 4M3XA 1NJWA 5ALDA 4FZXC 1JXVA 4FO6A 4DSKA 3ZDAA 2IDOA 5DLFA 2NRHA 4FK2A 3HX0A 1AUDA 3K5OA 5L46A 4KE5A 3R97A 3PYDA 2XCPA 4W5OA 4ED6A 3AOCA 2X51A 1S1WB 3VQ9A 2W41A 1TGOA 1K73O 3CCTA 2HKEA 4JI3F 4MDBA 3BV8A 4BR2A 2XYPB 1RXOB 1FRJA 4DV0K 2M8HA 4M3UA 4YB1P 1VRUB 4CJKA 2ZC4A 3OV7A 3BSAA 2DNLA 4DR1K 4B9UA 5HJYA 2N82B 3C21A 9ICHA 2JR5A 3CSKA 3IBWA 1YJRA 1W2BR 1XMOK 3B8HA 4BRIA 2D6FC 3BN7A 5CCLA 8ICRA 1BCMA 2FI1A 1BQMA 3K5LA 2KHQA 5HRNA 4IJAA 3HFVA 3MEKA 3GU0A 4FCYA 1S1VA 2DCUB 2VFVA 3MX2A 1EKSA 3TI0A 4NLNA 1ZRMA 2QWQA 2DY4A 4HHJA 1PYSB 2JH1A 3VC8A 3F9MA 2KRRA 2VFRA 3MXJA 3CJ8A 1F0XA 1RA6A 2D41A 2VWKA 5EE1A 5AQKA 1N0UA 4NYOA 2VCPA 2IMWP 3TAMA 2GFFA 3MMCA 3DLEB 3A5OC 2ZZMA 2CGJA 2I9SA 3OYEA 4EBDA 3C1YA 5AT1B 3HLUA 2ZKTA 3RBEA 4CK2A 2G8FA 4Y65A 3LP3A 1X4BA 3VERA 2J9DE 2XC9A 2G9OA 4LR7A 4QZHA 2CNKB 1BNOA 4A8QA 4EBEA 5FRMA 1U0SA 3OXLA 5K8OA 3OYFA 4GVBB 4TKTA 2Y9TA 4O5KA 2G4BA 1HYSB 3CMEN 4JI3K 4JHDA 4J5OA 4M5JA 1BLUA 5ITHA 1IVZA 1XBWA 3G6ES 2IGIA 2DNZA 3G4SS 1FF2A 2IM2A 1YJNN 1FK9A 2JWLA 1YBAA 3ENQA 4XUSA 5B0CA 3EZOA 4Z4EA 4F50A 2PC6A 4H8KA 4I28A 3PNCA 1BDGA 3AFGA 5E3CA 2Q66A 1Q81O 3KD3A 5G5HA 1XERA 2PMWA 2A10A 3NH1A 5CEHA 3DMJA 2ZH7A 2BCVA 1TKXB 1U2VB 1YZ7A 3KKSA 2MLXA 2KB2A 3LALA 1CSJA 5A8KB 1NGAA 4FW2A 2B4VA 3U02A 4H03B 4FVUA 1KOOA 4RQ8A 4CF2A 3AAWB 4F4AA 4DU8A 2K4IA 4HHTA 3G87A 3P45B 3F2CA 2L9WA 5E3QA 1RSCA 1NK4A 1SCJB 1RT1A 4K25A 2HS3A 1U49A 4OLAA 1ZQEA 4E3SA 3VAKA 3KOAA 3HJVA 4EFHA 4GO5X 4QAGA 3HP6A 2FHJA 1N61A 3GJTB 3HBTA 2XG8A 1TAMA 4U67Q 3BH6B 2G07A 3ZO7A 2G09A 5LOQA 3IAS9 4FOIA 1QVFR 1KVCA 2A1SA 1C1BB 4CD1A 3LQVA 2GW8A 1IIPA 5DGBA 2NRWA 4CGGA 3HF5A 2DO4A 3H45C 3BR8A 4CZJA 2XY5A 3LGMA 4ZPDA 2Z58B 4ICAA 7ICGA 5CY4A 3AA8A 1C0UA 1X1PA 4FLZA 2K8CB 1MROB 5J2HA 4ZS6A 3ENAA 4NLWA 3NH0A 4CJTA 3D2FB 1HNXF 1KBRA 5CA5A 5K8PA 1NMDA 3HKZF 4OI2A 3PRBA 4B1VA 3HKWA 3HOSA 3PFEA 4YVZA 1NPPA 4OFZA 2GAHC 4DCCA 1DKGD 4FYYB 4DZ6A 1T9TA 2WB1D 1T4GA 3HD1A 2RT3A 1ILYA 1BIUA 3I5CA 2V2QA 3C94A 2EK6A 3B9JA 4B9MA 3J81U 1X4DA 2KVCA 4AFFA 3K17A 4FLUA 2YX8A 2D5RA 1WEYA 4W5QA 4M5GA 2QTDA 2RE2A 1I51B 3BGLA 3OYCA 2IFXA 3CC7N 3GCXP 3LYSA 3THTA 4CI6A 4CEAA 3U3YA 3G82A 3Q8RB 7ICQA 3CJKA 1OIAA 1IBLF 3N7SC 3V6KA 2ASDA 5CYJA 1RBAA 1PGZA 2FVQA 5DQGA 4P2HA 3ZTSA 3CHWA 2D9OA 5AM0A 2LA4A 3CNQP 1Q46A 5HROA 3WIUA 4CLFA 3CJ0A 1FA0A 1N52B 3E2EA 2ZE2A 4KPCA 4ZPWR 2KU7A 4JK7A 5FD1A 5E7OB 3WNGA 3NWGA 1LWCB 5LL6d 2XZDB 4YDXA 2IVYA 1D8BA 4NRUA 3EPIA 1X4HA 3UVJB 3KWMA 3QB0A 2E8MA 4RG8A 3UNGC 3FYHA 2KG5A 3SSSA 5CYQB 1WAFA 1L7MA 5ALJA 4R65A 4HUFA 4PQAA 1HNXK 4F93B 3LUYA 2E1EA 2D3UA 4OHWA 4LY7A 4PKIA 3DU5A 1Q78A 4K4HA 4I6MB 4BGBA 3AT1B 2VG7A 5MLCV 2V5HG 1WHVA 3M8RA 2PYLA 4X4QA 2NXJA 2I7PA 4JEPA 4DV2F 2P8IA 1DARA 2HK3A 1AFJA 4RZRA 1U48A 3MUMP 2BABA 1SV5A 4A4JA 4KHPF 5EE9A 2LKYA 1TFWA 4KBIA 2RHQB 4JKAA 2VC0A 1I94J 1PUZA 4CDIA 2FDNA 4C0BA 1RPLA 3DLRA 2E8OA 2FD2A 5C0YA 1RWNB 3NOGA 2G08A 4F2RA 4JI8F 5CHCB 4JKDA 1WC0A 3DRSB 1IBLK 1NGHA 4QBUA 5ALMA 2I5JA 3GYXB 3JPSA 3VGKA 5M1FA 2XLKA 1HW9A 2VPYB 2P9UA 2OTJN 2WVFA 1BL3A 1HBUB 1VAZA 2EAPA 4TUQA 3G4SN 4CF1A 1SKRA 3QFPA 2OYYA 8RUCA 1FHTA 4ELUA 3UKRB 4A8FA 2XGQA 4KLFA 2QLXA 5KFLA 2WTFA 4ATNA 1RWPB 4ZVOB 1IR1A 3MECB 4EFAC 1DY3A 1YQHA 5J0YA 1FJCA 4OGEA 2K06A 3PX0A 3M6KA 1RHUB 4Y2CA 3CNHA 4UASA 3S8SA 4Y2TA 4B17A 2O8CA 2U1AA 1ZQZA 2YMLA 2GIQA 1M5PC 2M7SA 4CE6A 1I3OB 1Z1ZA 2MJNA 4BC9A 3H5SA 1RDCA 4RT3A 5D3GA 3OPKA 5E5NA 4Y2UA 5AQPA 4DV2K 3SQ0A 1RE1B 2ZWPA 1BD6A 1NJZA 2GUIA 4CEZA 3OYDA 3SFGA 4KHPK 2CQ1A 3D68A 3ZXWA 3D1HA 4Y2SA 2DNKA 2CDQA 4B3MF 9ICCA 5A6PA 4J7CA 4X4NA 1AZSA 2VJVA 3QJPA 1K8KB 5FPEA 4CGHA 1HBOA 3AB4B 3U1NA 4FOEA 1NZ8A 2V51B 4ILJA 4PKHA 4P4OA 4JI8K 3HRDD 4USTA 1HKAA 4M5IA 1YIJS 1SZHA 1X5TA 4HACB 2WTUA 2KN4A 2VYPA 1HUZA 5AFUA 4G9BA 1ZQGA 1Z1BA 3IRXB 4JI4J 2YWHA 3FAHA 3A5LC 3AXKA 3PO4A 4I27A 2V2KA 2OM6A 1BA1A 1NB2A 2YKOA 3UDEA 3J7YP 4RW4A 1NBEB 4ZLJA 3GDXA 3TTDA 2MQQA 1NMNA 1QHTA 2NYHA 4C6AA 2Z57B 4PPXA 4L75A 2Z2ZA 3AQOA 3LA0A 3Q8SB 4BDZA 1HQEB 2UVVA 4DV6F 3CXCM 5C5JA 4NWIA 1Q1KA 1HA1A 1KC8T 1W25A 5EX5A 2ROPA 1W0HA 4WFAL 3A8JA 4B08A 7ICIA 1H6KX 1T9XA 5DQIA 2EG1A 4O3SA 3QLHB 8ICWA 3QNWB 3A8IA 3HVRA 3FFIB 1WJ9A 1RACB 4B8CA 2FSJA 1LB2B 3R5DA 1PK1B 4GKJF 1WI8A 1Y11A 1R8AA 4PZOA 4UY85 1BXNA 2KZ3A 4CGFA 4PG7A 4RQ3A 2W3RA 3R27A 5AQWA 1S6QA 4PL2A 2XS2A 3H08A 4B3MK 2Q4TA 2E5LJ 1E6YA 2PSZA 5A0YA 5IQQA 4YNQA 2ZJ8A 3U1LA 4WCEQ 4PGXA 4FYDA 3F56A 1S1TB 2ZVSA 2QN6B 4O3NA 1RADB 2JJ4D 4I64A 4OCZA 4BR5A 1RHKB 1U09A 1MN8A 2FYXA 5AQYA 5ETVA 5I4MA 2ZH4A 2MHEA 4U6PA 4FYWB 2IVMA 3A3OB 4CO0A 4X62J 2HQ3A 1PYOB 4HTJA 7ICNA 1YI2S 1HNWF 4WTOB 2E20A 4LQ3A 2W7AA 3P38A 2IAJB 2ZJQL 1E4GT 2KN7A 2QARB 3QEIA 1Y64A 4ZOHC 3TWHA 3SAGA 4CHZA 2FTRA 2ATCB 2ZD1B 1YJWN 1RDRA 3WKDA 4NZ6A 4R25A 5FLXY 4F4YA 2K8GA 3L9ZA 4X2BA 3UCGA 1Q86T 2RILA 4YORA 4DV6K 2P9KB 1MNEA 3U9DA 5EWGA 5HN0A 1K0VA 2ASMA 2B5JA 3KMQA 1J2VA 3J7YI 4AUKA 1CJVB 5FRNA 3IBCB 4PG6A 4HEA9 1WORA 4PKGA 3AY0A 3Q24A 2KT5A 2HSZA 4FLTA 5LJ3Y 4ZPTR 1ZQOA 1S4FA 3L4IA 2EW9A 4JYAF 5KT3A 1S9GA 3IFRA 3OBIA 2MSSA 3CCES 4A5BA 4JWNA 4GKJK 4Q0BA 1V38A 2HHQA 2ZH6A 3KHLA 1P9YA 1S6PB 5KFDA 2AYEA 1WSFA 3BREA 1GLAG 3ZDCA 3O4QA 3OHRA 5DETA 4KHRA 1J2MA 2D4WA 5TKYA 5D0GA 5DDYA 1VIOA 4KTQA 2HHSA 4B8AB 2IDEA 3VV2B 1CZBA 1NDCA 4CLTA 1MWMA 3CCVN 2HF3A 4DSIA 5C42B 3EN9A 4JLHA 5B5EU 5A76A 3J81Y 2FY1A 4P2XA 2YNFA 1RT6B 2ZWOA 3KWIA 4A8SA 4CJPA 3CDEA 4A8WA 4URGA 4CO3A 1HKBA 3G0ZA 4ZMMA 3FKBA 3TA0A 2P9IA 4H5TA 1ZBFA 4TQSA 3PLAA 3C1ZA 2KSOA 3RAQA 1HNWK 3VAJA 4I7FB 1Y10A 4DO9A 3BSNA 1FE0A 2KG0A 1OMSA 2IHR1 2F5GA 3ILOA 1RQNA 3D0HE 3GIIA 1UA1A 5B7WA 3MM7B 1TV9A 4CWBA 4HCCA 3OR1B 4K4SA 4IO8A 5LY3A 1XU4A 1N6QB 3KK3A 3SUNA 3QSIA 2IDLA 3H98A 4CEEA 4QYZK 3A0HU 5HQLA 1T3VA 4QWBA 2KW4A 5D78A 3UDCA 4CK1A 3QBCA 1QH9A 1G99A 4JK9A 1R27B 3SAFA 4JYAK 1B0PA 3MXMA 2OD6A 3WK8A 2QWLA 2XM3A 2NYVA 1PJ7A 3SXLA 4BUGA 1CQNA 1DEJA 2DGTA 1EXNA 3QJJA 2ILZA 4BRKA 1YIJN 1XR5A 4BRGA 3NHGA 3LPEA 4Q8FA 1ZTWA 4DTNA 4P4MA 4D3GA 1B99A 2KVQE 3VZHA 3TQ1A 1K9MO 4QWCA 1IKVA 2RQKA 4IG0A 3JPQA 3ZETA 1V97A 3UDLA 2ZIVA 5ALPA 3M6VA 2NUBA 4G9ZA 2JFDA 3AQEA 2WC9A 2GVZA 4K8RA 5K14A 3HKZC 3O9RA 2JLEA 3EYZA 3TAPA 2EWSA 5J0OA 1BWEA 5TZVA 2HF4A 2B4OA 1FD8A 3AA2A 3SDEB 1WBDA 1MA7A 2VBYA 3UPFA 1UEUA 5IXUA 2H9ZA 4KKOA 1Q7LB 4ANEA 2G2ZA 4WWSA 3TUIC 1M5KC 2EFVA 5CYMB 3Q8LA 2XI3A 2BKPA 1S1UA 4GY2B 3QGIA 5LSRA 1XSLA 2ZNZA 4M3YA 5JXSA 2VG6B 4DR2J 5CCMA 3V81A 3GJSB 1F5BA 3P4UB 5ALWA 4M6WA 1X6JA 3GFXA 4EGLA 1UZHA 3HVTA 1LW2A 2QB0B 1Z4UA 3I33A 3AD9C 1F5SA 2E5GA 1U9LA 3ZT1A 3V2UC 5CQGA 4DL2A 1H72C 5AQHA 2BE2B 2YJEA 1YRXA 4NZ0A 3ET6B 3C5FA 1VSMA 2BPGA 5JLHA 2JWNA 3MGVA 3BUZB 1FRXA 3VTIA 4WK1A 1ZQSA 3CJCA 4IR9A 4BROA 3TP2A 3RVCA 2OWOA 3ZD9A 3P5TL 1RGVA 2A1BA 1NK6A 2UVRA 5ETMA 2ZUDA 2KHVA 1ZBSA 4C1NK 4LF1A 3PR4A 2OFGX 3PYGA 1RLDA 2B6AB 2CWKA 2XWXA 4WCEL 1G1XA 3RJGA 3JB9k 4Z94A 5HLFA 3PYEA 3M2RA 3TKAA 5F8GA 4DR5J 1S7HA 3H46O 2JGUA 4CJQA 4IDKA 3KJVB 3MC1A 2E66A 1KQQA 2LEPA 5C2GA 2QWPA 2DIUA 4B9NA 1QE1B 2V52B 1RZMA 1WN7A 4BGAA 1GMUA 1X4FA 4J9LA 9ICOA 2JVOA 3G8SA 1VQLS 4FZYA 3C7NB 4KGXB 4CGDA 2BCQA 3L7UA 4ILHA 5EWEA 4H4OA 3PHTA 5KG5A 3TYTA 3WK6A 1B9FA 1RKIA 3NRZA 5L9NA 1R0AA 3IMQJ 3AA9A 2EI5A 3TAEA 3SV4A 1OW5A 4AXJA 2HBKA 3R5GA 1WC6A 4FKYA 2EFGA 5J2FA 3EPGA 2YN4A 1FJGF 2QA2A 2HHUA 4NEYA 8ICLA 1TZ0A 3AV9A 2QO3A 4G65A 3CIMA 1CG2A 2B9XA 4DX8H 3LP0A 2AQ0A 2EXUA