4DS4A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mn2+
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 201
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds4A01
2ASJA 1I39A 2JZBA 5KFQA 4KO0A 3U3GA 4QZIA 3DLGA 2PYLA 3K5NA 4O3QA 4PY5A 4IQWA 5HHIA 1SL1A 4RQ2A 3NF6A 1VSJA 2P51A 1XHZA 1VSIA 1U47A 4IRCA 2W9CA 4I2GA 7ICEA 8ICIA 1RBVA 4CEQA 4DTSA 3TABA 2Q3SA 3DLEA 4Q8EA 3NDKA 4I2QA 4K8ZA 4UBBA 4YFKA 4RUCA 1BI4A 2GUIA 3GV8B 1TAUA 3HXMA 3RMDA 4KITB 1ZQCA 3F9KA 4YFUA 4PHEA 3B0XA 4W5QA 3LZJA 3NAEA 3EZ5A 1KRPA 7ICKA 1IKXA 4JV1A 4ECUA 5CB1A 4KLEA 5BOLA 1RYSA 4YXMA 4EP4A 5EWGA 1LAWA 4GC7A 4ID1A 5J2IA 1HNVA 1Z00B 4M3XA 4F5QA 4F4ZA 4LD0A 1KVAA 4RQ3A 2H5XA 5CHGA 3HWTA 2EHGA 4O44A 5KFSA 8ICRA 5KFGA 5J2FA 1ZQWA 4KLIA 2R8GA 3K5MA 4FW1A 1NK5A 9ICKA 3AVJA 5DB6A 3AO5A 3QEWA 1BQNA 5IIMA 3OYMA 3ZT0A 3QESA 4ZH4A 2VG5A 1KDHA 5J2JA 4B9LA 1HUOA 5DB9A 1ZQOA 4ECRA 4FLXA 9ICTA 3NF7A 3OYCA 1A5XA 4KHSA 3RJFA 4DL3A 4CIEA 4OPKA 1I3AA 5I42A 2P6UA 1HMVA 1S0OA 4RPYA 2MUTB 5J0OA 3HK2A 3EPGA 4I2DA 4M3UA 4E7HA 2HHWA 1EP4A 4EYHB 2W8LA 4QZFA 3OYEA 5FDLA 4PGYA 4FBTA 4QW9A 1HUZA 3DRRA 3MECA 4ELTA 3MXJA 3T1AA 4LVSA 4BDPA 4KLUA 8ICXA 4KLOA 2JEGA 2B21A 3SQ2A 3T5LA 1X9SA 3TFSA 1CLQA 8ICWA 1ZJNA 3ZCMA 4KHWA 4FK0A 2BCVA 1L3SA 1XO1A 3OSNA 3P83D 4E19A 4AH9A 1RPLA 5C5JA 3PMNA 2P66A 3IHQB 1VK0A 3HM9A 1T3NA 3O4NA 3LWMA 4E7LA 1BCOA 1QTMA 3G6XA 2R8JA 3GV5B 4DTJA 1SKWA 3VQ8A 3WNHA 5KFZA 3VQ9A 4FS1A 3VA3A 3T5JA 8ICSA 4QWDA 3BGRA 3AO3A 2KQ2A 5KFNA 2I1QA 3C2KA 3PMLA 3LAKA 4JS5A 1TAQA 3PX0A 4O5EA 1JKHA 5KFKA 4IQTA 9ICNA 4DF4A 1J5OA 4FJ8A 1WSJA 4CJWA 2W8KA 1IM4A 4QZGA 1TKTA 4FM0A 8ICGA 4JRQA 4PHPA 3OHAA 2Y1IA 3GFKB 2ZUCA 5FRMA 4DEZA 3OS2A 4CJPA 5T7BA 2BQUA 2VWJA 1TK8A 1MSWD 4CEBA 5DBCA 4R64A 4OLBA 2RDJA 4YN4A 2G8UA 3AU2A 2X78A 3RR8A 1RT2A 2RKIA 4RZRA 4Z6EA 4N56A 4R5PA 3PNCA 1C1AA 4CEDA 3O3HA 1LWEA 3RH6A 5KFAA 2F8TA 1TFRA 3GIJA 4DOBA 2OZSA 3ISBA 1JXLA 4M04A 2IGIA 1VRTA 5KFFA 3VQ4A 4NY8A 5DB7A 5HLFA 2Z1GA 3ZSWA 4KHNA 2AJQA 3ASMA 4UB1A 3CYMA 3KD1E 2XCPA 1A5WA 1UAXA 2HHUA 4FS2A 4KPYA 3AA4A 1L3TA 4EZ6A 2F1JA 1ZQPA 1JLGA 4NM1A 4OVLA 3AVFA 3QZ8A 1ZQBA 7ICIA 3DOKA 4DF8A 3TQ1A 3NE6A 1RBUA 4CGGA 1S76D 1FK9A 2DY4A 4XIUA 4DOAA 4CK2A 3IM1A 3QEIA 4RW9A 4KLMA 2NUBA 3MGIA 4F2RA 3FYHA 4RNOA 4QAGA 1BIUA 1XU4A 9ICBA 3QIPA 4KLDA 4QZEA 5C24A 1KEJA 1HYZA 3UPQA 1RT1A 1S1TA 4FZYA 3DOLA 4IRKA 1JLEA 3MXMA 1SUQA 3BQTA 1ZQIA 2DPJA 1JMSA 4M6WA 4DS4A 4TUSA 3HP6A 5KT3A 1ZQAA 5DG7A 1S77D 2BGGA 1RNHA 4DMNA 4Q5VA 5DDYA 4J9NA 1Z25A 4HCCA 3JPTA 3MR5A 2F1HA 5J0YA 4G1QA 1J54A 3K5OA 5KFEA 4IQVA 1CEZA 1L5UA 5SWMA 3HJFA 1BVSA 4CFBA 4AHTA 3OYLA 1QE1A 1L3VA 4UB2A 1WSEA 1WAFA 2FBXA 4XUSA 1C1BA 3TAMA 2KZ3A 2VG7A 9ICUA 1WN7A 1TKXA 5J2QA 4KLQA 4KHYA 3MBYA 3V4IA 4CGHA 1RT6A 1X9WA 3AU6A 4LH4A 4IFVA 3MAQA 3O3FA 4W5NA 2C22A 2R8IA 1DOQA 3H7IA 3H8WA 4CGIA 4F3OA 4CGJA 4FLTA 5J2CA 4C8NA 2YKMA 3ZD9A 4OGEA 5L9XA 1TV9A 4NXZA 3K4GA 5BPCA 1NK7A 1HNIA 4CIGA 3HL8A 3IG1A 3ITHA 2G8KA 3H08A 1KFDA 2IHMA 3ETLA 4FM1A 3NF9A 4C8KA 2DFFA 4F92B 4KTWA 4KHUA 2XY7A 1C0TA 4J2EA 1TK0A 5HNKA 4YNQA 4TUQA 4CJRA 4QWAA 3V1OA 4QWCA 2EX3A 4YMNA 3MABA 5DQGA 1BPYA 1BCMA 2RF2A 2W9BB 2YNHA 3C95A 4UAWA 1VSHA 1JLBA 3QEAZ 2XCAA 5KT7A 3NGIA 5HRNA 2C28A 4HUFA 4DL7A 2V9WA 3LAMA 4B9SA 3JPSA 4KLJA 5J0XA 4KTQA 4XRHA 4GXKA 5D4BA 4RW8A 4BWMA 4E1NA 4B8CA 3GILA 4FVMA 4KLGA 1NOMA 3MEEA 4W5RA 4UB4A 3HPHA 1S1WA 5J0UA 4J9KA 4M9HA 1VSLA 4DSJA 2Z1JA 4W5TA 2A1SA 3RRHA 2BANA 5KG6A 1RYRA 3A2FA 5J2MA 3RMCA 3MEGA 4F93B 3Q8LA 4KB1A 8ICQA 2A1JB 7ICNA 3C23A 5J2GA 4ID5A 4AILC 3RH4A 4CHZA 1R0AA 3UIQA 5KFPA 4E3SA 4DTNA 5HRPA 4CF2A 4MFFA 4I2BA 4RQ5A 3ULDA 3KHLA 1QQCA 3V6KA 1JLCA 3L3UA 2V4RA 3ORYA 4R8UB 1YVUA 3BQ0A 2KZMA 1ASVA 3QEPA 4ECXA 3MXIA 4HCBA 1LWFA 5DK5A 3I0SA 3RMAA 2PFNA 1ZQKA 4CHNA 1RTDA 1RXWA 4FW2A 1BHLA 2Z1IA 5KFOA 1ZETA 1JL2A 3TR8A 2OZMA 1REVA 2KN7A 4DTMA 4QZHA 2E6LA 2HHSA 4Y1DA 4ELUA 4CF9A 3PW2A 5J29A 4LZDA 3V9SA 1U04A 4K4IA 7ICPA 4DL6A 4ED6A 5HBMA 1RBRA 3T3FA 4CEFA 4B3OA 4NLNA 7ICUA 2WOMA 2GV9A 3TAEA 2BHNA 1YTUA 3RWUA 4DTRA 4GLXA 1FXXA 2I5JA 4KAZA 4CEAA 4L8RB 4C8MA 4LSNA 2O4GA 2F8SA 5HP1A 3THVA 3NGYA 4CFAA 4I2PA 4HYKA 2ZJ5A 3ISDA 4CERA 4CESA 3CFOA 5KG5A 4F2SA 3K75D 4J9LA 1RXVA 2OPQA 4M41A 3SNNA 1FKOA 3AVGA 4R63A 8ICPA 4YP3A 5HROA 4ELVA 2A1RA 4CF8A 4DTUA 9ICIA 4BE2A 4M9JA 9ICCA 4FJIA 3PR4A 4RW6A 4DLEA 1NK9A 4DQSA 3D0PA 1KSPA 3VQPA 3ZSXA 4DG1A 4J2AA 4CJ3A 3DM2A 1EXNA 4KN7A 1QSSA 2ZTCA 2D0AA 2FLPA 3CFPA 3U6FA 3JPNA 4DOCA 3JPRA 2YHAA 3TARA 1NKEA 4PGQA 4IRDA 1D9DA 3MGHA 4IBNA 4FM2A 3AA5X 9ICOA 3H40A 4FJHA 4B9TA 2BDPA 3GV7B 3C6TA 3H8SA 2XC9A 3VQCA 3KTQA 5DLGA 1ZJMA 2QKKA 3SQ0A 4JWMA 1T05A 8ICMA 3QEXA 3FDSA 3RR7A 2RDIA 3KK3A 4P4MA 3OVNA 1ASWA 4NM2A 3C5GA 2P5GA 8ICBA 4RU9A 4NYFA 2WTFA 4RNNA 4DSLA 4OKJA 2PY5A 3OYKA 1RDBA 4W5OA 1B92A 4F3TA 4DL4A 3UXNA 5J2BA 4QZAA 5IIOA 4QWEA 9ICQA 1ZQZA 2XGQA 4JLHA 1WSGA 3C5FA 2QK9A 1JXBA 1BPXA 4J9QA 1KLMA 1QLNA 2QXFA 1XI1A 2IOCA 5KFHA 1CXQA 2BGWA 3HVTA 1B9DA 1NJXA 4B9VA 5FROA 1NK4A 3H8JA 4F4XA 8ICFA 2D0BA 3HYFA 5JS1A 4F5RA 3PO5A 7ICQA 3SPYA 1S5JA 8ICOA 4ED8A 3V7KA 4KLFA 5J0WA 4FZZA 2NRTA 1U4BA 2HVHA 2I9GA 1K1SA 4DFKA 3ZDBA 4CJVA 4KMUA 5D46A 3E01A 4PGXA 4ED3A 1K1QA 3ZSQA 4KLLA 4CJTA 3ZSZA 2JZBB 1O1WA 2YV0X 5L1LA 2B4JA 1Q9XA 3FFIA 1ZQRA 4M3WA 3LK9A 2JEIA 1KVBA 1COOA 2XY5A 5SZTA 7ICMA 5C42A 2W9MA 3IS9A 1HJPA 3ZSOA 2IA6A 5CZ1A 4RQ7A 4UAZA 3LDSA 3WNGA 4MEYA 4EP5A 3C94A 2W9CB 2ZUBA 3MFHA 4FK4A 4Y1CA 2P6RA 3WNFA 2BCQA 4FYDA 5HRRA 3MFIA 1WSHA 1RDCA 3TAQA 5HRSA 1BI4B 4B9NA 4I9QA 1T4GA 2ISOA 2DFEA 1HQEA 2FLLA 1LB2B 4ECQA 1KTQA 2FPLA 4Z6CA 2BCRA 1MC8A 4NCGA 4NLZA 1ZYQA 4XQ8A 5KFCA 1J9AA 5KFTA 1TKZA 3C1ZA 1S1VA 3G0ZA 1T8EA 5D3GA 4N47A 1WLJA 3M8RA 3VA0A 5J1EA 1CUKA 4F5OA 4DFPA 1L3UA 3QETA 3B6PA 3ZD8A 5J0SA 4K4GA 3V72A 4IR9A 4GXJA 5F9NA 4I27A 1Y88A 7ICOA 3P5JA 1TL3A 5DMRA 3HPGA 3V81A 4QW8A 4EBCA 2ATQA 1QSYA 1RZTA 4FO6A 4DQIA 4F4WA 1XSNA 5KT5A 3JSMA 1FKPA 2IAJA 4UQGA 2PFPA 5HHHA 4RQ1A 8ICYA 3KLHA 4LSLA 3AO4A 3KKSA 4I28A 3GIIA 3WNEA 4F5NA 5IINA 3O3GA 4CCHA 4NLKA 5DG9A 5C25A 1NJYA 5J0QA 3LP1A 1BPZA 3ISCA 2BQRA 2MAXA 4M9LA 2ZJ8A 2FPMA 2NRVA 1W9HA 4ICLA 1HPZA 3DYAA 1N48A 1ZBFA 4DTXA 4FLYA 3UXPA 2ATLA 3MDCA 4CGDA 3H4DA 1TL1A 4M9GA 5IILA 3V6JA 1ZQNA 2JGUA 2G8HA 4CHOA 1S6QA 4DWIA 1VSMA 5KG4A 4I7FA 4JWNA 9ICSA 3QLHA 3PO4A 4NYNA 1N56A 3ZDEA 4PPXA 4HUGA 3LDAA 1KVCA 3OSPA 1U48A 3K59A 1WAJA 1BPEA 3HT3A 3DLBA 4YCXA 1W0HA 3CQ8A 4DTOA 3OYGA 8ICJA 3ZT3A 1RBSA 3RJJA 1DGSA 3RBEA 3K58A 4HVJA 2D0CA 2M9NA 3PW7A 3PY8A 1CZBA 4KV8A 4O5CA 1B43A 8ICCA 2ZTEA 4IQUA 7ICHA 2DTUA 4R66A 2HMIA 1SZPA 2C2RA 2OYQA 4ED2A 3OS0A 4G3IA 4F91B 4KRFA 4OLAA 3QEBZ 2FBTA 4BWJA 3CG7A 1IKVA 2B5JA 1A5VA 2UVWA 5CY4A 4ECTA 4MFBA 4AHCA 9ICLA 4PA1A 3EWAA 4M0AA 2LYHA 1Z3EB 1ZBUA 3PV8A 1MQ2A 3QINA 2ZE2A 2NRZA 3SPZA 1C0MA 4FJNA 3C1YA 1ZBHA 4BXOA 7ICJA 3K5LA 4CHPA 9ICXA 2BCSA 3ZT4A 4CK3A 1QSLA 3SQ4A 2FPKA 2YHBA 2E6MA 2ISPA 3V7LA 3QZ7A 3QIOA 5F9LA 3M9MB 4RT2A 5KI6A 4FJLA 4DU1A 4RW7A 2HHTA 3HPOA 1TKDA 3VQBA 9ICAA 3SQ1A 4O3OA 3GDXA 3RB0A 4FJGA 2PXIA 1SL0A 3OJSA 3L2WA 3CM5A 1C1CA 1XHXA 4RG8A 5KT2A 3B6OA 2FLNA 1B22A 1RT7A 3N97B 4M47A 3I0RA 1XWLA 4FBUA 1U9LA 1S9GA 3RAXA 4FK2A 4NCBA 2E4LA 4TQRA 2DFHA 4ZTJA 1SKRA 9ICJA 4KFBA 1ZQMA 4JV2A 4N41A 3D45A 1UT5A 2HHQA 4PUOA 4B9MA 1YT3A 2BPGA 8ICEA 3E2EA 1CXUA 1RDDA 1NOZA 5KTQA 3EW9A 3S3NA 4KB0A 3L2QA 2R8HA 1C0UA 4Z4GA 1U45A 1S1XA 3RMBA 1HYVA 4Z4CA 3V9ZA 2F96A 2DFLA 4M6WB 2AQ0A 4TQSA 3MR2A 4FJKA 4O4GA 3ZSRA 3MR3A 4CE9A 3LWLA 2OA8A 3GIKA 3HW8A 8ICZA 4JS4A 4BE1A 3M9OB 4Z4EA 4ECSA 4YG2A 4BACA 4UBCA 4PH5A 1X2IA 4Z4FA 4DU4A 3L2VA 4LZGA 2KFNA 2G8WA 4KLTA 9ICRA 3K2PA 1DTTA 4KN4A 2Y1JA 4F4YA 1WNSA 2P5OA 3C2LA 1JLQA 2J6TA 3PR5B 5EU7A 4ED0A 5FRNA 2AU0A 5DB8A 2IDOA 7ICSA 4YMMA 3EYZA 3BJYA 3LP0A 1S97A 4EBDA 5KFLA 2UVUA 4JUZA 2ASLA 4O5KA 3QERA 3TWHA 4MF8A 5HMMA 3LALA 4RT3A 4AHRA 5IIKA 3DMJA 3VQEA 4Z0UA 3ZDAA 4EBEA 2Q0ZX 3KIOA 4GXIA 1QS4A 3NHGA 4QZ8A 5CYQA 5EOZA 1F21A 2P1JA 4ECYA 3HVRA 5HP4A 2FBVA 4ZTFA 4N76A 1HRHA 1HYSA 3Q8RB 1NJZA 4YVZA 2ASDA 3HO1A 3V6HA 3S3MA 4Q0BA 4Q45A 9ICMA 3RJGA 4I2FA 3QNNA 4KHQA 4RQ4A 5KFWA 3VQ7A 1X9MA 2BKEA 4GC6A 5KRTA 1HJRA 4UB3A 4OGCA 3G6YA 4OPJA 1IKWA 4DFMA 1RT5A 3L2UA 4TUPA 2LSNA 3Q8KA 3OHBA 4KI4A 4UAYA 4J9RA 4C8LA 2AGOA 4Z4HA 4ZHRA 1ZQTA 4MFCA 4QWBA 3EPIA 3H4BA 2OPRA 3NF8A 3VQDA 4F8RA 2OPSA 1XSLA 4RUAA 4DSIA 4EEYA 4QZDA 5CZ2A 1Z00A 5DGBA 2FBYA 2IMWP 1J53A 4DO9A 4J9SA 3Q8MA 1A77A 4P4OA 4M9NA 2ZD1A 4QOZB 5DQIA 2PYJA 2NRWA 4B9UA 4O0JA 1Q8IA 2R8KA 1ZQSA 4FJMA 3AA2A 4H4OA 5KFYA 4EZ9A 4LY7A 2IC3A 1ZQDA 3OYJA 4JK1A 1D8YA 4MFAA 1RTJA 1UT8A 3NH2A 5KG2A 3O4QA 1GOAA 4CJ4A 3SUPA 2JEJA 1K6YA 4M2YA 3ZDDA 7ICVA 3Q8PB 3RB3A 4GW6A 5J0PA 5JUMA 2IHNA 5J2NA 4KREA 2QKBA 2PI5A 1GOBA 3BDPA 4M3TA 3L2RA 3KK2A 3SCXA 3UQ2A 2MUTA 4E0DA 5DGAA 8ICTA 5KG3A 4WE1A 2BCUA 1ZQGA 4YR2A 3V6DA 3NBPA 5J2AA 2XRIA 4DSEA 3PW5A 2YNFA 2ZJAA 5J2KA 4O5BA 4LH5A 1S0MA 3OYHA 4HTUA 1JIHA 2ALZA 3T5KA 4M45A 3OYNA 3EY1A 5DQHA 4DQPA 4FCYA 2HHXA 3NH0A 2GWSA 4MF2A 3N4MB 1CZ9A 5EWEA 4X5VA 1ZQHA 4H4MA 3RJEA 8ICAA 1G15A 1UWBA 3VQQA 2AQ4A 1NJWA 2ZQBA 4E89A 4K4HA 1JXEA 4CFCA 4IG3A 3JPOA 4DSKA 9ICEA 4I2EA 4CJQA 1Z26A 3AVBA 4HUEA 4E7JA 1VRUA 1ZQYA 5TZVA 4RQ0A 3TAPA 1ZBLA 1UA0A 3PW4A 1TVRA 2G8FA 1T03A 3C6UA 3V1QA 5IIIA 5KT4A 4J2DA 4CJKA 1ZBIA 5D49A 3LANA 5JS2A 2X6SA 3LP3A 1SL2A 4JV0A 1XSPA 5L1JA 3NGDA 4PHAA 1VSKA 4CJLA 3MR6A 4ED1A 4DQRA 3AUOA 3KLEA 1YTAA 7ICLA 4M3RA 1NOYA 4BDZA 3OYDA 2BQ3A 5K14A 2BE2A 1Q9YA 3PX4A 4CF1A 3OJUA 1JLAA 2BR0A 3MDAA 4HHTA 5CWRA 3DLHA 4RW4A 4CJUA 2ZUDA 4CJFA 4QZBA 2W9AA 4YD2A 4C8OA 1MU2A 2O4IA 2XGPA 4I2CA 4DU3A 3RH5A 2XHBA 5DBBA 4F50A 2R7YA 3AVNA 1VSEA 3JYTA 5L1IA 4OKKA 4FLZA 1VSDA 1H38A 3CFRA 3RAQA 3UQ0A 1XS9D 3V9UA 5KFMA 4YMOA 1RBTA 4I2IA 5KRSA 2W42A 5IIJA 4ECZA 3QEVA 3IAYA 1KFTA 4BE0A 1JLFA 4IG0A 1NK6A 1XC9A 2C2DA 2HHVA 1S1UA 4M42A 4I9LA 3F73A 1WSIA 3KHHA 1JN3A 3Q8QB 3AVKA 4KLSA 3M8QA 2D5RA 4B08A 4KTZA 2DPIA 4E1MA 9ICVA 1ZQUA 2V4QA 5J2PA 3PUFA 5J2DA 3ZSYA 2KTQA 3LZIA 1D9FA 2ITGA 9ICPA 3DLRA 2GBZA 4CJEA 4Z6DA 4Q44A 3KJVA 2HNDA 4DFJA 4FLWA 4I2JA 1LW2A 1IH7A 3G10A 3AVMA 3SZ2A 3AA3A 3AVLA 4R65A 3KLGA 3RB6A 1ZQVA 3M8SA 1EX4A 4O9MA 4JRPA 1QHTA 2JLEA 4AHSA 1B9FA 7ICGA 5KGWA 1ZQJA 4J9PA 3V1RA 3LP2A 2VA2A 1RCHA 2PI4A 1JL1A 4YD1A 4ECVA 4CJSA 3C2MA 3TI0A 4IFYA 3JPPA 4DL5A 3KLIA 4OKEA 3T5HA 4IKFA 3KD5E 1BISA 4YQWA 5KGXA 1X1PA 2J6UA 5J0RA 5DBAA 2AGPA 4FLUA 1JX4A 4E7IA 4FJ5A 3RB4A 4GMJB 2PFOA 5KFVA 1UOCA 3TANA 5DDMA 3HP9A 1BL3A 4N5SA 3ZT1A 4DS5A 2HVIA 9ICGA 4RQ8A 4CEOA 4PWDA 5CA7A 5CJ7A 1EKEA 4F5PA 1SV5A 4MEXA 3V7JA 4RPZA 3VN5A 3RJIA 2VA8A 5DG8A 2BPCA 3GIMA 4DQQA 3DRPA 1D5AA 3VQ6A 3TAGA 5KFJA 3NFAA 3PW0A 3CM6A 2G8VA 2FMPA 1S10A 3AO2A 3B0YA 3JPQA 4CHQA 1BPDA 1ZQFA 4CEEA 5KG1A 4FZXC 2W9BA 3U3YA 3OS1A 1WCLA 2AGQA 5CP2A 2ETJA 4TURA 5KFBA 1BQMA 4XA5A 3KLFA 4IDKA 1KLNA 3TAFA 3PX6A 5KFIA 1GOCA 1LWCA 3VQAA 4Z4IA 1RT3A 1D8LA 2JEFA 2HNYA 3ISNC 5CR0A 5HMLA 5EWFA 5CYMA 4QZ9A 3OY9A 2OWOA 8ICNA 3IRXA 4FJ7A 4B8AB 4PQUA 2G8IA 3Q8SB 2HB5A 3BQ1A 9ICFA 1NK8A 2IS3A 3SUQA 4MQ3A 4CJ5A 1RTHA 2XY6A 3I8DA 5KG7A 2KW4A 5BOMA 2A1JA 4KKOA 1ZQQA 4DTPA 4FJJA 1DTQA 3SV3A 4J9MA 1NK0A 1EXQA 3P1GA 3DI6A 2KFZA 4PHDA 3V9XA 2B6AA 4TSXA 3OYFA 4ECWA 4CK1A 3HSTB 4CEZA 1MQ3A 2XY8A 4OJRA 4DLGA 3QNOA 3ALYA 3L8BA 1TVAA 2X74A 4R8UA 1ASUA 3SI6A 2PZSA 1TK5A 3ZT2A 3UXOA 4DSFA 4J9OA 1N6QA 3LPTA 2ZTDA 2PFQA 2FC0A 4O3PA 4ED7A 1A76A 1EETA 2HNZA 4RNMA 4BXOB 4RPXA 5KFRA 1RDAA 3SJJA 7ICFA 5I3UA 1RTIA 1S6PA 1C6VA 3AO1A 1V9PA 3S3OA 3KHGA 4F4KA 4AHUA 3OYIA 3M8PA 4YXJA 1AROP 1TGOA 1T7PA 1WCNA 4NLGA 4H8KA 3AVHA 2VG6A 1KCFA 2YNIA 4AHVA 2YKNA 4FJ9A 4O0IA 2UVRA 3SV4A 1WSFA 3HX0A 1LV5A 2VWKA 1RT4A 5J0TA 2XO7A 3NTUA 4P2HA 5E41A 2X6NA 4RQ6A 2F1IA 2YNGA 4FJXA 4M3YA 2VA3A 4BGDA 5KT6A 5KG0A 3OGUA 2J6SA 4CFDA 2VANA 3SYZA 1Y97A 4QZCA 3GQCA 4GVMA 1IG9A 2C2EA 3OYAA 3TFRA 3NCIA 3ZSVA 3OYBA 5KFXA 1ITGA 3DLKA 3M9NB 3SI8A 4KLHA 4KI6A 3NH1A 1ZQEA 4J2BA 1TV6A 3L3VA 3AVIA 4UB5A 1PZNA 9ICHA 1IXRA 4K8XA 2IBKA 4QCLA 3SUNA 2OPPA 2RN2A 3RJKA 1U49A 8ICHA 4I29A 5L1KA 1VSFA 2KZZA 8ICVA 4Q8FA 8ICLA 4O55A 3V9WA 3LPUA 3KKRA 1C7YA 7ICTA 1LW0A 3AVAA 2FMSA 2WONA 5J2EA 2BPFA 4FLVA 2Z1HA 4CHYA 1UA1A 2HW3A 3PVXA 1NKBA 2RPIA 4IR1A 3KHRA 1S0NA 5KFDA 1N5YA 2UVVA 4M3ZA 8ICUA 1BGXT 1IKYA 5DKWA 3RBDA 4E7KA 4I2AA 4BDYA 3SUOA 1DLOA 4CIFA 4O3NA 5DLFA 3RRGA 4Q43A 4O3SA 8ICKA 1S0VA 3DRSA 3MEDA 1BPBA 1ZQLA 3AV9A 1IO2A 4YR0A 7ICRA 3S9HA 1LAVA 3NGZA 2FMQA 3K57A 1ZQXA 3RTVA 1BIZA 4EYIB 4YR3A 1S9EA 5KFUA 4I2HA 3QO9A 3AVCA 3QE9Y 4CF0A 2NRXA 4NCAA 5J2HA 1S9FA 1NKCA 4CGFA 3RJHA 4DL2A 3T19A 1RILA 3KK1A 1SKSA 3VQ5A 3G6VA 4FXDA 4P4PA 3C21A 1KFSA 4Z6FA 9ICWA 4CECA 3BQ2A 4O3RA 1HQUA 3ZDCA
chains in the Genus database with same CATH superfamily
2VPWB 3ZZOA 4QZIA 1YBTA 4O4RA 1YQHA 1OVQA 1DY3A 1RABB 5CYQB 4PY5A 1Q18A 3O9UA 4N77A 4A59A 2AX1A 4OJ6A 4IRCA 2W9CA 3AM9A 7ICEA 2CN1A 5LSRA 1JQGA 3UCZP 1T6DA 4CEQA 3TABA 2Q3SA 2IJFA 2DGXA 2ESEA 1RBOB 2NZ4A 2ASOA 1VQ5N 4M7YA 1Y3JA 4RUCA 2GUIA 3FGUA 1Z1ZA 5ALGA 4ES1A 3QT7A 2O8EA 4UB6U 1IKWB 1S6UA 3NASA 5BREA 2H5IB 3QAEA 5DDQC 3NAEA 3EZ5A 1OY9A 3FVYA 2P9UA 3WK7A 3M6GA 3G86A 5J1NA 2QL7B 2YJEA 2X3DA 3ILOA 2OPRB 3ISND 2OPSB 4ID1A 3HVWA 3JQMA 1HNVA 4YB5A 4M3XA 2WW8A 4H0OA 4CLWA 3SAHA 4RU2A 5JLFA 2XI2A 2W4CA 4RQ3A 2WUSA 4PXEA 3SDEA 4KB7A 2AZ3A 1EWRA 4O44A 5KFSA 3HI9A 4ZLJA 1NGGA 3IN5A 2W2MP 4RR5A 1W2BR 3VGUA 5E3RA 4CNZA 4GKJK 5A8WB 5M1NA 1XNQJ 3D7EO 2HF4A 1VI7A 3K5MA 4FW1A 3IAS9 4P7TA 1NK5A 4DV6J 2CJAA 5DB6A 3AO5A 3Q83A 4KGZB 2CQ0A 4L3NA 3ZT0A 5DRKA 4DU8A 1N34F 4OYPA 3NAHA 4WP9A 1ZQOA 4K2XA 1VOMA 1URRA 4FLXA 2DB1A 2XZTB 3HJVA 1BNOA 3BSAA 1NWKA 4KHSA 3RJFA 1OY8A 4DL3A 2VIXA 1HWIA 5M1QA 2JRZA 4RPYA 2MUTB 5J0OA 1UWAA 2JFDA 1MNEA 2HHWA 3NBPB 1YVFA 4EYHB 2WSFC 1I51B 4QZFA 2YNFB 3GR0A 4KLUA 2LXIA 4MN4C 1ZM4A 3T5LA 3TFSA 1CLQA 2W24A 1VQNN 8ICWA 2GVZA 3FEYB 3QXGA 3E8OA 5HVGA 3P83D 2KVIA 1J5EK 4YY3J 3HM9A 3D0HE 3J81Y 3O4NA 3P96A 3UKRB 1LXNA 3G6XA 3CIZA 1QAJA 4DTJA 3R3LA 3VQ9A 1L8OA 3I55S 3TU5A 5LL6d 3UI3A 8ICSA 4IG3B 3BGOP 3BGRA 4PJ0U 3FUYA 2MYFA 1VJ5A 4M5HA 2D41A 5BJRA 2R7SA 3MZIA 3ZTQA 4GV3A 3PX0A 3BO2A 4P72A 3KNAA 1TVRB 2PMWA 4IQTA 5AJ3K 2CJKA 2ZIWB 2CPXA 1J5OA 1QVGR 5LXYA 3WKDA 4NYZA 1H6KX 2LYVA 1FFGB 4FM0A 8ICGA 1VLOA 4MTPA 4JRQA 1T3VA 2ZKUA 3P38A 1M5OC 3OHAA 2Y1IA 3C0BA 3GFKB 2QYCA 4DX5A 2ZUCA 2GOLA 3MMCA 2NRHA 3G8SA 4CJPA 1FXDA 3NS6A 3FBBA 3J7YP 4URQU 3CIMA 3PKYA 1J97A 1RG6A 4RWXA 3CMQA 3RG6A 2X78A 3RR8A 1RT2A 2RKIA 3PNCA 4KH1B 4CEDA 1NPRA 4NWIA 4RW4B 4DOBA 2YQ1A 2DHGA 1JXLA 1VRTA 1MU2B 3HSZA 5KFFA 3C28A 3BUZB 3VC8A 4LF9K 1HBMB 1WOPA 3VF6A 1M90O 4GV6A 4JKBA 3ZSWA 1VGYA 1N5XA 4D3GA 1OWXA 4ISGA 3KD1E 2KXHA 3OV7A 1J6ZA 1RBAA 4LREA 5GAEU 4FS2A 2DJWA 2F1JA 3W0LA 4MT1A 2H3GX 1JLGA 4OVLA 1YBAA 1ZQBA 1JLFB 3C8YA 2I0XA 5F8LA 4DR4F 2RRDA 5EE9A 2CPEA 2IRYA 4J5OA 2NPIA 3G87A 1RBUA 3HRDD 5F2RA 3GDQA 1OPIA 5AKHA 4PL2A 4RW9A 2HEKA 4KLMA 2MQQA 3MGIA 3M6WA 4F2RA 3FYHA 2P9GA 4HTJA 4QZEA 1HYZA 1RT1A 3HULA 1VMBA 3DXKA 4FZYA 4GMKA 3AODA 1SUQA 4IKAA 1PVQA 4M6WA 5AM4A 4G9BA 5KT3A 3KOAA 4IEIA 2O8CB 2FZCB 3MUTP 4HCCA 2DKXA 4G1QA 1J54A 1PYSB 1SVDA 4IOBA 4OYMA 1CEZA 3W3SA 2PMZF 4GKJJ 2AV5A 2YWWA 3PNIA 3C7NB 1RZMA 4OZ0A 4B17A 4AHTA 3LP2B 2BJDA 2FBXA 2KLAA 2VG7A 2CH5A 2UXBF 5CQGA 3OHRA 4KLQA 3ZZUA 3MBYA 3V4IA 2QWMA 1FERA 1RT6A 3ULEA 3QT8A 4LH4A 4IFVA 2ZH5A 1P7DA 4NA2A 4E2FB 1I94J 1LEOA 2HURA 4W5NA 5AKGA 4MKAA 2HKEA 1DOQA 4CGIA 1P8ZA 5JJBA 2K8GA 5J2CA 2KG5A 4RKUC 5ADXH 5BPNA 4CZKA 3NVMA 4NXZA 4LBHA 3K4GA 2FXUA 4CIGA 4LF6F 3IG1A 3J7AN 4USIA 2DWQA 2HAFA 4YOUA 4PWDB 3ETLA 3I87A 2DXFA 3M1VA 1VBYA 3NF9A 4USTA 3HD1A 4LFBK 4C0BA 5CH7B 1J2VA 3R8YA 2ZGYA 4TUQA 3V1OA 5BYRA 1RWWB 2K4HA 5KL8B 3MHYA 3SEOA 5DQGA 1J5EJ 2JSXA 3R2DJ 2W9BB 1QZ5A 3G6ES 3CCRS 1VSHA 2EVZA 1V3ZA 2XCAA 2V9KA 3KLFB 2RB7A 3PRDA 2C28A 4IDKB 2E44A 1Y5LB 3LAMA 2ZIXB 3QFPA 2IBOA 4UW2A 4AL5A 4CD3A 4KTQA 3WKEA 2XMAA 3PIPL 4B8CA 3MK6A 4FVMA 3VQTA 3HPHA 1S1WA 3CCEN 3ZX3A 5AJ3J 4WCEQ 2Z1JA 3FBCA 1A9NB 3RRHA 2A1SA 5KG6A 4PL8A 4F93B 4FVUA 1U2CA 1PAUB 2R18A 1RXOB 1DTQB 3C23A 5J2GA 4PWWA 1K8AT 2ZH2A 1QQ7A 3LA0A 3QSIA 3UIQA 4DTNA 1A6LA 2B6AB 2CH6A 4X66K 5AIBA 4CF2A 4MFFA 1FDDA 2J8AA 3N79A 4B1XB 2JFKA 4RQ5A 4ZPVR 2ZH8A 3KHLA 3KDNA 3L3UA 1L7NA 3ORYA 4R8UB 2KZMA 1ASVA 2JWLA 1NU0A 1WEYA 2MZ1A 1C2PA 2ZOFA 2C2KB 2IY5B 3QU7A 3I0SA 1U25A 1EETB 1R8PA 2JR5A 2PFNA 3TVYA 2AWZA 2D7SA 3CCLS 3BGFA 4LF9J 2QYGA 3SQGB 4GVEA 2N82B 1S6PB 2Z1IA 5KFOA 3EEQA 1KBUA 3UE5A 2MA1A 3VZHA 2WC9A 2QX0A 4DTMA 3RU0A 4QZHA 4ELUA 3M8PB 4CF9A 3PW2A 2WW4A 3ATVA 4DV4K 1KQKA 5EX0A 3AA8A 1ZZNA 4DL6A 4CEFA 3NRWA 4NLNA 2WOMA 1VIXA 4NI2A 2HIYA 3RWUA 3H5SA 2E1YA 2RQ4A 3HCXA 1VLBA 1U24A 2O4GA 4DV7F 3A0HU 3L7OA 2O6KA 5GADU 4DZDA 4CERA 3UDCA 1TTHB 4F2SA 5AK4A 2B4VA 4M41A 3LGNA 1UEVA 8ICPA 2W3SA 2CJXB 5RUBA 5ALNA 2E1AA 4CRJA 1FJEB 3EM1A 4DLEA 5AQUA 1CC8A 3N9UC 1R7IA 3D0PA 1Y00A 2K7KA 1YJVA 5HANA 2HRYA 4KN7A 2KHOA 5ETLA 1G6BA 5AQHA 2FLPA 2K06A 1H0HB 3D6TB 1FVSA 1FJGF 2YHAA 4WYWA 1XMQF 4FJHA 2CUYA 4RL1A 3CHWA 4DR1F 2Z56B 2XC9A 2GWKA 3QICA 4JWMA 2RS2A 4FYYB 4RNHA 3KKAA 3TX8A 1PVRA 3KK3A 4XH5A 1N5YB 4C3KA 1SZHA 4P4MA 3OVNA 4AT1B 3JAMY 1NGDA 3L7UA 3MURP 3VGTA 1GLLO 4RNNA 3C15A 1NDCA 4BRQA 2PY5A 2KOBA 3B8AX 4PPDA 1RDBA 4W5OA 3R2CJ 2QSFA 4QWEA 3TJ9A 1ZQZA 3PSPA 2XGQA 3G25A 3O9QA 2DRAA 4JLHA 1BPXA 4J9QA 1T02A 4AM6A 2RLTA 3HVTA 2QL5B 2E7XA 4LFAK 2IVMA 1H2VZ 3KKAC 3H8JA 4F4XA 4LC9B 4LFBJ 2GH1A 3JXUA 4F5RA 4J91A 4HAIA 2LECA 1S5JA 8ICOA 5AICA 3V7KA 5LMNJ 2WVDA 4K4XA 3UDEA 1K1SA 2QMWA 1MROA 1SV0A 3NOGA 2LA6A 3DC2A 2XB2D 3CJ1A 4KMUA 2P9LB 2VGMA 2YWFA 1CJTA 2E1PA 7FDRA 1R6VA 3ZSQA 4KLLA 4Y2MA 2ZJPL 4H5TA 1O1WA 2YV0X 2B4JA 3W8PA 3SR6A 1M1HA 2B9EA 2P9PA 3NEKA 3DLGB 3LK9A 3PJXA 2JEIA 1F2GA 1COOA 2KV2A 3IS9A 2RE1A 2IA6A 5CZ1A 1U26A 2LVWA 2EG1A 2F9JA 1EQ0A 5D8HB 4FK4A 4Y1CA 3FAHA 2HK2A 3DLEB 3CULA 4FYDA 3QBWA 3OL7A 4CZHA 4OYXA 4I4BA 3TTFA 3TAQA 1BI4B 4C80A 4B9NA 1H1VA 4UY8O 4FDFA 2GX9A 5AKZA 1T4GA 2YBVA 3MM8A 1FX4A 1V6HA 3TADA 4DUZF 2Q2RA 4X66J 4RWWA 2FPLA 2ZJRQ 4AXIA 4XQ8A 5KFCA 5MLCQ 2P9EA 3AQOA 1IKXB 2FVPA 1HR0K 3O9SA 4IOAQ 1T8EA 2UXCF 4KHPF 4F5OA 1WUAA 2D74B 2W6LA 4DFPA 3ZD8A 4MDAA 1YJ9S 5KQ8A 1Z1VA 4TYBA 1N88A 5AXLA 4I27A 4RQNA 1TYQA 1QQNA 1UJ6A 5AE3A 2VDHA 2ZC4A 2YH1A 5AQZA 3D6RA 3HMJG 4AFFA 1VYAA 2P5VA 5B7WA 2R7TA 1KVJA 4DV4J 3FZ2A 5KT5A 2L9WA 4K4YA 4UQGA 2JC0A 4RQ1A 4EWTA 3AAPA 1WI6A 3AO4A 2DNYA 3U7JA 1SQKA 2VG5B 3ET6B 4EEKA 3O3GA 2JLGA 1VQ4S 4GVLA 4M9LA 3QUCA 2FPMA 4FYWB 4LR7A 1CULB 4TYAA 1W9HA 5KPTA 4DTXA 3UXPA 4NLTA 1QD1A 1HMVB 4CGDA 4RCHA 1GLFO 4M9GA 3V6JA 4UQTA 1ZQNA 1MMNA 2JGUA 2G8HA 2Z58B 2HHPA 1EP4B 5KG4A 3MGVA 5FDLB 3PO4A 1N56A 3DDNA 3DRRB 2RQKA 5DS7A 4BC9A 1YJWN 1KVCA 1B3TA 3P4UB 1U48A 3K59A 5BPMA 3HT3A 4KY3A 1SJRA 2JGAA 2L5YA 5EE0A 3AOBA 3R5AA 4KR0B 3RJJA 3K58A 4DR6K 1Z4NA 4PXDA 4HVJA 2RHQB 1XN9A 3PY8A 1NSAA 1CZBA 2X3GA 3IA0A 2DTUA 5ALJA 2CIMA 1SZPA 4C2MA 3CC2S 3DDHA 4DUYK 1NGBA 3IV6A 1OYEA 2FBTA 1IKVA 2LHTA 2B5JA 2H54B 1TFYA 2UVWA 1A5VA 1X31C 4AHCA 1HI0P 1NPKA 3TYTA 3T1YF 3JS9A 1WORA 1AT1B 1JXVA 4M0AA 1JKHB 1ZBUA 3M6ZA 3PV8A 1HHQA 2MKJA 1PBUA 2NRZA 1B70B 3KLHB 4FWMA 3ICXA 3PYDA 3CCSN 2SXLA 1C0MA 1UL3A 1TKTB 1ZBHA 4Y2RA 4BXOA 4X65F 2LXFA 1N2XA 9ICXA 3PHEA 2HGMA 1FXRA 2BCSA 3LP1B 1QY7A 4LFAJ 3ZT4A 4HVZA 2NPFA 5GAGU 3I8BA 2YB4A 3GWCA 1AUDA 1UAWA 4FZNA 3V7LA 3M9MB 4F0KA 1EKRA 4HKQA 4DR5J 2WAQD 2HSEB 1FRXA 3A4TA 3L4PA 2VBYA 4A8MP 2B43A 4O3OA 2A6MA 4WFAQ 4UOFA 3RB0A 4EO6A 5F0WA 1N0UA 4X62J 3L2WA 3UD4P 2ZWOA 1SJ4P 2MQ8A 7FD1A 4C1NI 1RT7A 4JB3A 1FEHA 4MMOA 1HNWK 2LQ8A 1YHQS 1VR6A 5HLFB 2FJBB 1XR7A 2XULA 2B56A 3EGZA 1JCFA 4TQRA 2E4LA 2DFHA 2DHHA 4JB8B 4Y2UA 4N41A 3QUBA 3FZBA 2ZM6K 1RU1A 2QA4G 3DOKB 3VR1A 2N3LA 3EMTA 1H2TZ 3NVZA 3GYXB 4P73A 1FK9B 4PRFA 2CZVC 1CXUA 5IWAK 5KTQA 2IRUA 3EW9A 1U1NA 3NVYA 3S3NA 4ISFA 3I9ZA 2R8HA 4IS7A 1C0UA 4Z4GA 1VQLN 1HKBA 3QIPB 1HR0J 3GJSB 5C24B 4DDFA 2UU9F 2WFAA 1YXQA 1GX6A 1JLEB 4Z4CA 3Q7CA 2VC1A 1DK2A 4TQSA 2IOFK 3D3CJ 4W98A 2JMGA 4W90B 5F8JA 3HW8A 4JS4A 3GONA 5JXSA 3M9OB 2BJ8A 4AF1A 5AKLA 1ZPWX 4K4VA 1GLJO 4OLPA 4AE5A 1HBOB 4RW7B 1B4FA 3L2VA 2HQCA 3G4SS 2RQMA 1C1BB 3TAMB 1KHVA 4H0PA 1F0MA 2ZGZA 1Q86T 3IGVA 3BB5A 4UUXA 1KD1O 2H3IA 2P5OA 3MMBA 5J2QB 3PR5B 1TL5A 2WHOA 2W6KA 2AU0A 4HACB 2IDOA 1NLVA 2BW2A 3J7ZT 2DT9A 4BROA 4YMMA 2WF7A 4ANEA 3LP0A 1Q46A 4EBDA 8RUCA 5ALEA 5AXKA 4ZVTB 1ZD4A 5ETOA 4WPAA 4MF8A 2YKMB 2FZGB 3JSRA 3LALA 4WQ5C 4B3SK 4ENOA 3GCXP 3ZDAA 2Q0ZX 5EE1A 4MIWA 3WX4A 3ITHB 1DQAA 2Y3YA 1QS4A 1K9MT 2M4MA 3NHGA 5CYQA 4KHMA 3AHPA 1F21A 1URNA 2W7PA 1HW8A 3ZETA 2ZJQL 1X4FA 4N76A 1WSVA 2E9RX 1NJIO 3NWGA 1F0XA 3Q8RB 1NJZA 2BJEA 2ASDA 3V6HA 2L41A 1VISA 4KH5A 4BY9C 3WDOA 3FZMA 3RJGA 4KHQA 4DR6J 4RQ4A 2PDAA 2I7NA 3ILJA 3UO0A 2WAQF 2YNHB 2BKEA 4GC6A 1ZD3A 4U7UK 3GU0A 4OGCA 3R5GA 5ETRA 3VF2A 3ZO7A 1IKWA 4DFMA 3L2UA 1ZZFA 2M8HA 4DUYJ 3Q8KA 2PN6A 3PJWA 1Z19A 4J9RA 4C8LA 3MDQA 2AGOA 4RW8B 1ZQTA 4MFCA 1ZXOA 2LM1A 1T6CA 1IBKK 5AQFA 3MEEB 2OPRA 2MLZA 2OPSA 2I2YA 3F41A 1MLAA 4KGMA 3H0PA 2P9CA 4RUAA 5LT5A 4OZ2A 2HS3A 5DGBA 2LQ5A 3WKCA 2IMWP 1J53A 2BKPA 4KYZA 3SCJE 5DQIA 1GXLA 2K8CB 2OSQA 3F44A 4C4RA 4LFCK 2UUAJ 4O0JA 2NRRA 3CC7N 1R0AB 4KGKA 1WWUA 5GVQA 5A8WA 1FRLA 2EI5A 1SB6A 3VAIA 3RAMA 1YRUA 4JI4K 3SXLA 2VONA 2QFIA 1UFKA 3NP5A 2MJUA 2PO4A 4PCQA 1VBZA 4K42A 3OYJA 2KVCA 3NNAA 1U1KA 4P0PB 1GOAA 1M5KC 2ZF5O 3CJRA 2HZAA 2YTCA 7ICVA 1FESA 1QQMA 3Q8PB 5BXIA 1HNWJ 1PKUA 3BGUA 4FPRA 4RBVA 2QKBA 5F3TA 1GOBA 5E79U 4AYBF 4JI6K 3L2RA 4USVA 4YHHK 1DHMA 3CO9A 3NL0A 1GLEG 2MUTA 1BOTO 4V19J 4UASA 3NBPA 4K25A 4KPCA 4QIVA 2XRIA 2YNFA 1Q79A 2HBLA 3CJ3A 5HBMB 3HFKA 4B3OB 2ZM6J 1IG8A 1NGFA 2ZNZA 4HTUA 5D4OA 1Y64A 1WACA 1HHTP 2CFXA 4C11B 1HW9A 5IWAJ 2GMJA 3GFYA 2GWSA 1S4EA 5E3QA 3MCNA 5IQQA 5EWEA 4X5VA 5KOWA 2OPQB 4M63A 1FKOB 3JB9k 2BUNA 1G15A 3VQQA 2AQ4A 1XNRF 3UKRA 4MLEA 2ZQBA 4EI2A 4IOCQ 2N7YA 4ZOHC 1P6TA 5ALKA 4IG3A 3SLCA 3IR6B 9ICEA 4I2EA 3AQPA 4ZVGA 4DG1B 4B3RK 2GMLA 1Z26A 3AVBA 4HUEA 3C66A 2JLFA 4RQ0A 3WXKA 3FFKB 1HBNB 1TVRA 4IO9Q 4TN2A 1EQMA 3V1QA 2ZIWA 5IIIA 5CE3A 5KT4A 3H5YA 1WNEA 3LANA 4US8A 4ZPWR 2X6SA 3LP3A 1VLYA 5BR9A 4JD2B 3C6TB 2KJ9A 1U8SA 4NA3A 4M63C 2QLJB 4L72B 3G8TA 3FCWA 5L1JA 2UXDF 1VSKA 5H9FK 5ALXA 3CMAS 3WEEB 3WZ0A 3R6GB 5GMDA 1HIWA 2XMWA 2YX8A 1D09B 4M3RA 1BUPA 2YB1A 2KL8A 3C14B 2KSOB 2W4PA 2R42A 4DOZA 3FEZA 5FP0A 4PXBA 4J7CA 4UOGA 2WF5A 5M2RA 2F63A 4B3SJ 5ALVA 1LKZA 4BC5A 1QAYA 4C0HA 2OHDA 5CWRA 3OTOK 2V2ZA 4AQYK 4RW4A 2AP1A 5MAOA 2W9AA 4YD2A 4HH0A 1MU2A 4CH1A 2O4IA 1HBMA 2XGPA 4I2CA 3D2QA 3RH5A 2J7KA 5DBBA 1XMOK 2R7YA 3E0FA 2DCUB 3FR0A 2P9SB 2CQHA 2E1RA 4BLGA 2L3MA 3BPSP 3CFRA 1RHUB 1LK5A 1UKUA 2CPZA 3KWGA 3UQ0A 1VQ8S 5KFMA 4YMOA 2W42A 2LYBA 3W62A 1N32K 2YQ0A 1X3NA 1OXJA 1JLFA 3E01B 4WXWA 2HHVA 1RLCL 5AQIA 1WSIA 2E5IA 1JN3A 3AVKA 4BJQA 2QSWA 2MKIA 3FFIB 3WQUA 4B08A 4NMLA 3D2WA 3S01A 4E1MA 2F3NA 2DNMA 2PMHA 2V4QA 3H42A 5GADI 3MX5A 2KTQA 2F76X 1IBKJ 2BZFA 3CDAA 1D9FA 3QU9A 3DLRA 3ENOA 1YDLA 1XUPO 1DKGD 5B0CA 2M88A 1P9QC 2O8CA 4I2JA 4KIAA 3G10A 3D28A 4R79A 4GVBB 4JI7K 4LFCJ 1NPPA 3HOSA 1NGCA 2ZZMA 1ZQVA 2HSZA 3CJQA 2ZG6A 1B9FA 7ICGA 3C7NA 4NCGB 5KGWA 3LP2A 3HHEA 2RQ5A 1TKZB 4JI4J 2APOA 1RCHA 5HO4A 2V94A 3PIOL 2NV3A 2ZZTA 2Z2LA 1SJFA 2VB6A 3TI0A 3JPPA 3C16B 2D69A 5AQVA 4IKFA 2VIHA 3GBTA 4AM7A 5J0RA 1F44A 2BH1A 4JI6J 3C65A 1JX4A 4E7IA 4YHHJ 1YSJA 2BXJA 2PAVA 4Y34A 1UOCA 2KO1A 1BL3A 1C20A 4N5SA 1WG5A 3GIRA 4RQ8A 4URGA 4PWDA 2ZH7A 3I55N 5CJ7A 2FVCA 2E3TA 2X7IA 3IFRA 4MEXA 1U7LA 3RJIA 2OEJA 4C8ZA 3FSYA 4X4SA 5DG8A 4BCAA 2GC8A 2KD1A 2V63A 3VQ6A 4ERDA 3CM6A 2FMPA 4P6QA 2QTWA 3KK7A 4CHQA 1JJCB 1FFVA 1BPDA 1ZQFA 2A1BA 2LYAA 3PFEA 2W9BA 3UCUP 1WCLA 2AGQA 1N5VA 3KLFA 1NZBA 4IDKA 2BOAA 3N6NA 3TAFA 2YN4A 2CQIA 2ZIXA 4I7FB 4Z4IA 5L39A 2F1FA 2HOIA 2KKPA 2DIVA 2JEFA 3E51A 5EWFA 4BQLA 2IOHA 2HS0A 1ZQ1C 3OY9A 2OWOA 3VVTA 2G8IA 9ICFA 2EDUA 2IS3A 4ZPCA 1N5QA 5LJVA 2JX2A 2E29A 3SUQA 2X1FA 4F4AA 3CDEA 1BY9A 2XY6A 3WK9A 5BOMA 1ZQQA 2J9CA 4DTPA 1DTQA 4KV8B 3OBIA 4J9MA 1G1XA 2DNKA 5H9FJ 2OJ3A 4PHDA 3V9XA 2B6AA 3THWB 3EGNA 5K8OA 1JWWA 4CK1A 3U02A 2FB0A 1ZH5A 2OHFA 1VQOS 2I8EA 3QNOA 2Q0RA 1RGVA 3H3OB 4MFBB 4LVOP 2HQIA 3O1LA 4DR7K 1WSRA 4R8UA 2FI1A 3G82A 5EY4A 2FC0A 3CW2C 1P1TA 1EETA 3OTOJ 3L4BC 4AQYJ 1MW7A 4RNMA 2HBQB 3TWZA 1GLCG 7ICFA 3SQGA 1S6PA 1IBLK 2FZKB 5DZ6A 1XMOJ 3HRGA 1NGAA 1MG7A 4F4KA 5GMKa 2D4WA 2LMIA 3M8PA 1AROP 1FF2A 1WCNA 5AM3A 2G1DA 3DN9A 3FCHA 5ELZA 3CJSA 1XQSC 4H8KA 2MPUA 1N32J 2HOQA 1FRKA 3SV4A 3W63A 1LV5A 1XO0A 3MOJB 2VWKA 4QR2A 1IV0A 4WBFA 4P2HA 3SCIE 4KRWA 4IXCA 1QZ6A 2IIRA 2YCHA 1Q3UA 3N5FA 1X40A 4BGDA 1CLFA 1GLDG 3I0RB 3ZI4A 3SYZA 3AH6A 4JKFA 4NLXA 4CLPA 1O0PA 4GVMA 2OD4A 3OYAA 3CDBA 2DY1A 4WIIA 4UUWA 3Q7BA 3DU5A 3Q24A 1FKAF 3M30B 1O6XA 2YQEA 4EIAA 1HNZK 3QU5A 3QX7A 3S1TA 5ETSA 1NH8A 1I6JA 4DPXA 4USAA 3AVIA 1OSCA 3EZWA 2QL9B 3CF5Q 2ZEJA 2Z2ZA 4XEIA 1QTNB 3CCJS 4C0ZA 3HZEA 1U49A 2E7VA 3KZBA 2VQFK 4Q8FA 4O55A 3W9HA 3EUB2 7ICTA 2ZUGA 4YOTA 2FMSA 3P4IA 4RWTA 3T79A 4CP5A 5J2EA 2GQ2A 5BR8F 4FLVA 4Y2PA 2Z1HA 1VQYA 1UA1A 3RFAA 2GHWA 2EAMA 1N5YA 5EHHA 5ITHA 3W5YA 2ZOGA 5IT9U 8ICUA 4DMZA 2WB1F 3M6XA 4Y2SA 4FXVA 3RBDA 4I2AA 3F56A 1RDRA 4F0MA 4CIFA 1JI7A 4R0EA 3EVMA 2W7OA 2MKYA 4IUFA 3RRGA 1VBXA 1XNQF 3CDWA 3G6EN 3J7A1 3CCRN 3JXOA 2KKZA 4OJPA 3NGZA 2QB0B 4PEOA 3FLCO 3F5EA 3K57A 3CO0P 1ZQXA 2JXJA 3CP8A 1BIZA 1L7PA 1X5TA 4EYIB 1WWVA 1OJ4A 3WK5A 3QE9Y 1OIAA 4DCHA 5C2GA 4JEPA 2OCEA 3W66A 2CXEA 3RJHA 4DL2A 2WTUA 3I96A 5GAGI 5AI9A 3I4PA 3CVKA 2WVFA 4FXDA 1KOOA 2P9LA 3N6MA 2HWHA 4A57A 2FC8A 3CJ5A 1U2RA 4PG5A 2EC2A 3DMJB 2X51A 3H0MB 4CGZA 1I39A 5KFQA 3G2XA 2JNJA 5HL7L 3MOZA 3U3GA 3JTPA 4NLSA 5T14A 1JCGA 3ULHA 3DLGA 2NSCA 1NMEB 4PG8A 2ZIUB 4O3QA 3WX8A 2E1FA 4BRAA 1B0TA 2YTUA 2VJVA 4BRDA 1VQ7S 3S41A 4XAKA 2P51A 4CZIA 4CZGA 1XHZA 2KHCA 1U47A 5A2QU 4I2GA 2HZVA 3JQKA 5AI8A 1E6YB 1RBVA 4K59A 4GIBA 3J81O 3DLEA 3M1YA 3WXIA 5A8RB 4GO7X 3BBBA 4DPYA 4ZCIA 1V4SA 4UBBA 3KVGA 2KJWA 1BI4A 3CCLN 3GV8B 4I6WA 1GX5A 3HXMA 2Q97A 4WFZA 3RMDA 1N5TA 1XIQA 1SWVA 3IFEA 2DXEA 4YOEA 3IMXA 1XK8A 2DNQA 2MSNA 4W5QA 2Y0BB 2FYXA 5CAAA 1FJCA 4QS9A 2IA0A 2DH8A 2A5XA 1IKXA 4JV1A 4ECUA 1M1KO 5CB1A 4ZHRB 5BOLA 4YXMA 4DR7J 1MN8A 5EWGA 4Z2XA 2QLFB 2EAPA 4DV2F 4CZEA 1W25A 2UZAA 4B3MK 2KKHA 5CEHA 1MWYA 4F4ZA 1Q5VA 2ZD1B 2KI2A 1DXSA 5AQTA 5F0XA 1EJ7L 2H5XA 1IBLJ 2EHGA 3R8EA 2ZVSA 1WHVA 2VQEK 1X8DA 1VQKS 1YK9A 2QWNA 2G4BA 2R8GA 3H2VE 4FPAA 2HSTA 2VICA 3AVJA 3QWUA 3QEWA 3WIVA 3JSYA 3CJ0A 1BO5O 1R27B 3OYMA 3L4QA 3QESA 4LF7K 4ZH4A 2VG5A 1KDHA 3ET6A 2XQCA 3A8JA 2YMMA 1NGIA 4FZLA 1TUVA 4ECRA 1Z1BA 2V2QA 2RD5C 3HOTA 2CZ9A 3OYCA 1CULA 1A5XA 2XSJB 2Q79A 2FIUA 4CIEA 1ELOA 4QR0A 1HMVA 1S0OA 2FJVA 3HK2A 2K4PA 3EPGA 5B0DA 2LDIA 4ANCA 1QVFM 4WE1B 4P9SA 4B1UB 3QATA 2KK0A 1HNZJ 4KMOB 2CQ3A 1EP4A 1DURA 5FDLA 4DCPB 2CPFA 2E8AA 3DRRA 3MXJA 3T1AA 4LVSA 4GFJA 2G0JA 4KLOA 2JEGA 1FDBA 5GTIU 2W25A 3THPA 3ZC4A 1HFEL 2VKRA 5ADZA 4ILLA 1H73A 1N52B 2HMXA 2VQFJ 1ZJNA 4KHWA 4FK0A 3ZXWA 1L3SA 5B8HA 1QAIA 3OSNA 3SK3A 4AH9A 4H4MB 2P66A 4E7LA 1T95A 3VCDA 2QFJA 4J9VA 3D1HA 1DARA 1QTMA 4A2AA 3GV5B 1NLKL 2IJRA 3DLJA 2VKZG 3PIPQ 3VQ8A 5KFZA 3VA3A 2XZWA 2A2DA 3T5JA 4I6YA 4XH4A 1UPPA 1U1QA 3OUYB 3PMLA 1VRUB 1TAQA 2DY9A 3EDRB 2G0AA 4YN3B 4JV5F 1JKHA 2XHWA 4U7CA 5AKIA 4GKJF 4LIRA 4TVAB 2Y0SD 2MKSA 1WSJA 2GGPB 2PFUA 1TKTA 3MPWA 2KXNB 4OX6A 3WIUA 5FRMA 4UARA 3EGWB 1VHXA 4FOEA 2XYHB 1YZ7A 5CA5A 5T7BA 2E8MA 2BQUA 2VWJA 1F5SA 4A2BA 1TK8A 4XO0A 4J90A 1I94F 3CJBA 1MSWD 4CEBA 2EZXA 4OLBA 2E8PA 2GNKA 3ENVA 4YN4A 1SPBP 2G8UA 3NCRA 3R1HA 3CJ2A 1JROA 2BE2B 3R6LB 4RZRA 4N56A 3QDKA 3ZLJA 2D0PA 3O3HA 4K41A 2U1AA 3RH6A 3MMAB 3TTCA 5DDRC 1CC7A 2IGIA 4NY8A 5HLFA 2GFFA 3Q2SC 2J0XA 3ASMA 3NS7B 4UB1A 2CNNB 2QJ3A 3DXMA 1A5WA 2O8FB 1IXKA 3AA4A 4CNQA 3AVFA 3QZ8A 3DOKA 1N36F 3FEXB 1YJ9N 4FWRA 5AI6A 4DF8A 3TQ1A 4ZS6A 4JYAF 4XH1A 1S76D 2Z30B 1S8OA 1FK9A 4L76A 3OFHA 3J81U 4EENA 4A46A 4A8SA 3IM1A 2DK2A 3QEIA 2LKZA 4QYRA 1AYEA 3THXB 3BBCA 1B99A 1BIUA 1XU4A 3PCOB 3QIPA 2CQCA 5C24A 5J2PB 2FDNA 3EXYA 4FKYA 1FWLA 3M1FA 1E6VB 1RAEB 2XLJA 1JLEA 2PBDA 1JMSA 2VJ5A 4PL7A 4RX6A 4B3MJ 3GFZA 5DG7A 3GLJA 1J2MA 1VQ4N 4Q5VA 1W7WA 2XWXA 1AFIA 4OI2A 2A2CA 4AD6A 3LTOA 3TZYA 2F1HA 1Q0NA 3M2RB 2VQEJ 3KLGB 4IQVA 2QG9B 3NG8A 2CPIA 1HBOA 5B09A 3HJFA 1BVSA 1R43A 5AIAA 4Q2MA 2YHWA 4XDCA 4J8FA 3OYLA 1WAFA 4XUSA 1C1BA 3TAMA 5CABA 2F4VK 9ICUA 3HHKA 1S48A 3ETOA 2AKWB 5AFUH 9ATCB 1WN7A 1JUDA 4LF7J 5HR6A 5J2QA 2AXTU 2XIDA 4CWBA 2L9NA 4HACA 2HF3A 1S59A 4ZIVA 3OQ2A 2B6GA 5A6WA 3R1LA 4LF2A 4JN4A 2VPXB 3H7IA 3H8WA 3P3DA 4FLTA 1FRMA 2YKMA 4C3LA 5C7PA 3ZD9A 2ZH3A 1QVGM 2BKNA 3TP2A 2A10A 1N33F 2HFNA 1RQNA 2KKVA 3J7Z5 2BJ3A 3B82A 2W01A 2MKHA 4K4WA 3ITHA 2G8KA 2RHSB 1KFDA 1JJ2R 5HMYA 2Y0SF 3FQLA 4JI0K 3CC2N 4H54A 3QRQA 1ILYA 4U6PA 4OHWA 3BZCA 1ZA1B 2O3DA 2DFFA 4KTWA 3UWTA 2XY7A 2YX6A 3DRPB 1TK0A 4OYZA 1K47A 1VHIA 1HA1A 4YNQA 2Q1LA 4CJRA 1WI8A 2QN6B 2ZJPQ 1T11A 4DR3F 3CQXA 3U1LA 4QWCA 5L46A 3DKDA 5I3QA 3THTA 1PJ6A 3QBCA 3MABA 2YNHA 4OX9F 2P6SA 2ROGA 1TUWA 2XVTA 4UAWA 2YHXA 1U0SA 1MWKA 5KT7A 3NGIA 3R27A 2FGCA 4BUGA 4HUFA 2M9KA 1KAZA 4DL7A 3M7DA 1LWCB 4B9SA 3UN5A 3F5AA 4B1ZA 1XBWA 3BDEA 3C2PA 2HNYB 4KLJA 5CYMB 3BS5B 5D4BA 4RW8A 4WFXA 2C3MA 4FPBA 5FPDA 1FNMA 1SXLA 3T1HF 3GILA 3UNYA 4KLGA 3MEEA 2A6AA 4UB4A 1EZZB 5J0UA 4J9KA 4M9HA 2PIIA 3DGVA 4QIEA 4H0YB 4ZJLA 3W2VB 2KMDA 3GOIA 2BJ9A 4BC3A 3OL8A 8ICQA 2V69A 2A1JB 3FC4A 1RWXB 4KKOB 2FUG9 1YHQN 3DI6B 1R0AA 5KFPA 1CQNA 3H45C 4B02A 5HRPA 4WFNL 2F5GA 4MDBA 4JI1F 3UMGA 3F2DA 1QQCA 3V6KA 3VENA 2WF8A 4CZLA 2R2UA 1TMMA 3GG1A 2M3DA 1BWVA 3MXIA 2Z7JA 3OFEA 4P0PA 4HCBA 4M5MA 2FJDB 1WBBA 4JOUA 2HNZB 1ZQKA 5EN1A 1BHLA 1ZETA 1JL2A 3VVUA 3GSDA 1WDDA 4DZ6A 3IWNC 2MU2A 2H4WB 2QWOA 5LMNF 4LZDA 3V9SA 3N5BA 2W04A 1I3OB 4K4IA 1HWLA 3Q89A 3D2SA 2ZFHA 2VG6B 2LQJA 5HBMA 5L38A 3T3FA 4B3OA 7ICUA 5E3CA 5IM0B 4LF4F 3TAEA 2BHNA 2EAOA 2RP5A 5ALDA 1FCAA 2DBBA 2F8EX 2Z8QA 5K8NA 2J76E 4CO0A 3BN4A 4C11A 1YAGA 3IGNA 3DXSX 3ZZ0A 3NGYA 3QGPA 4I2PA 2MLYA 4HYKA 2YNGB 4U7BA 3CFOA 3D54A 1ZAXA 1KS2A 1X4CA 2R7RA 1XR5A 3K75D 3FMBA 1EAYC 2OPQA 3G4SN 2CJYB 5KNIA 1FKOA 4R63A 3KG4A 3NGUA 4CF8A 2HVDA 9ICIA 4BE2A 2XYPB 1V3SA 1Z2LA 4LF5F 3PR4A 2CNOB 3KDOA 2V51B 3NCPA 3BS9A 1TV6B 3A5NC 4DG1A 4QS7A 3ZSXA 4J2AA 2V68A 1EXNA 3HHDA 1S49A 3CCVS 2OPPB 4PR6A 1BWFO 2D0AA 1HBNA 2RIJA 3CFPA 3U6FA 4DOCA 1NKEA 4ILGB 4PQAA 5IFMA 3AA5X 4JKCA 9ICOA 2ZH1A 4B9TA 4ANDA 2ZNYA 2BDPA 1FTRA 2H5EA 4JD2A 3GV7B 3C6TA 4LMZA 4HT7A 2F4VJ 4K7QA 2C3OA 3KTQA 4TLQA 2ZDOA 1ZJMA 3SQ0A 1HD0A 4IEEA 8ICMA 1Y9OA 5AK3A 3WEEA 3RR7A 2LM4A 5HJYA 4BRIA 2OAUA 2ZBPA 3OPXA 1PJ5A 3R7NB 1UVKA 2AJ4A 1ASWA 3C5GA 2P5GA 2V8HA 2QI2A 3C14A 2KSOA 2V7YA 5EXWA 2NXJA 1U1PA 4DL4A 3UXNA 1NBWA 4QZAA 2ASYA 2W54A 5IIOA 3MEDB 1WSGA 3R3TA 3C5FA 1JXBA 4IJAA 3D3BJ 2QXFA 4JI0J 1M5VC 3L7PA 4CVNE 1VQ6S 1KAYA 2EZYA 4BR0A 1F1BB 5FROA 3A13A 2OIHA 2D0BA 1S9EB 2P9SA 4CH7A 4ED8A 4R0JA 5J0WA 4KLFA 1U4BA 2GJIA 1Q95G 3IWLA 3NLCA 3MTJA 2Q4TA 5HK4A 4CBWA 4ZCLA 4FXWA 5D46A 3E01A 2H3FA 2OXOA 4PGXA 4ZLPA 3GZFA 2YXLA 1N5WA 1RISA 3LDNA 3ZSZA 4USWA 2AYEA 2JZBB 3FFIA 1G4CA 4KO0B 2X1GA 1BUXA 1ZQRA 4JHDB 4M3WA 2P9IB 2XY5A 4OPHA 3CJTA 4PKIA 4RQ7A 3OR1B 4UAZA 2BV3A 4F04B 5JU5A 5IS2A 5CD4H 3MFHA 5K9FA 4KH6A 2G1HA 3E3XA 5AQSA 2GEMA 2FSKA 1CS4B 4I2QB 2IMOA 5HRRA 3MFIA 2DEJA 3TA0A 4GVBA 5HRSA 3H2UB 1WG4A 1Y4ZB 3LYSA 5U47A 3TEGA 3F2BA 2YMLA 2ISOA 4PKHA 2V5HG 2FLLA 2CWXA 3AMZA 1LB2B 2QLBB 1MC8A 4NCGA 2FC9A 3IWXA 5E3PA 3PEHA 5KFTA 1TKZA 3UM9A 3GJQB 3KMSA 3T7ZA 2E2QA 3JAMU 3VA0A 3GG4A 3OL6A 3LM2A 2VKQA 4NZ6A 5FPEA 3X3UA 3C16A 4ILRA 5J0SA 4ZN1A 1ZD5A 2V7ZA 1NMDA 4IR9A 4GXJA 3NVKA 4DCCA 2GQQA 2RRBA 5AHXA 3OT9A 2HLTA 1Q5YA 4YOVA 3HPGA 1WC6A 5AQXA 3MWBA 3F53A 4DR5F 4DQIA 4F4WA 1XSNA 3FZLA 4XK8C 3WC0A 2QARB 5HHHA 3IBPA 4UF4A 8ICYA 3ZTPA 2HIQA 2CDRB 2ROPA 3KKSA 4HLBA 4ZPTR 4X62F 3WNEA 2M7SA 4TU8A 3CMES 4F5NA 2DGSA 4CCHA 4NLKA 5DG9A 1RCXB 5LOQA 4I6MB 3ISCA 5DDOC 1UCNA 1KQSM 4Y28C 5LSLA 2DRBA 5AE2A 4K5SA 3MGJA 2NXEA 3CXCM 2ILYA 2E9TA 5K20B 4CNYA 3LDLA 2ATLA 3MDCA 2MY7A 5IILA 5L9NA 2ZJQQ 4A8KA 4CHOA 1S6QA 4ZPDA 4UOHA 4WK1A 3CMAN 4I7FA 3RW7A 1KQGB 1NEEA 2OFGX 3GG0A 4G1PA 4PPXA 3MPYA 3LDAA 2EPIA 2YHYA 4YCXA 3CQ8A 3AJ1A 2NUHA 3VHQA 1UEUA 3OYGA 4MKBA 4O8UA 1RBSA 3NVWA 3RBEA 1S72S 3E9PA 4JI3K 2MDAA 2GWJA 1IG6A 3IP0A 4P74A 2M9NA 4LF6K 3W1YC 4KV8A 1B43A 4UW9A 5ETPA 5IV4A 3RVCA 1W97L 3THWA 3PDNA 2C2RA 2DEIA 4KRFA 4OLAA 3CG7A 4BWJA 5GAHI 2HHHF 4MFBA 1SV4A 3TR5A 1VQ8N 1RADB 5AQYA 1RWKB 4CLKA 3CSKA 2DCLA 4U8YA 2DBYA 4QIFA 5F3XB 2VFUA 1NU4A 4FJNA 3C1YA 5DJBA 1UW9A 3G96A 1RM6C 5D0EA 3AGKA 3M3ZA 4CHPA 2XMMA 2G09A 3GYGA 3H7HB 3S8SA 1RBLA 3CETA 2FPKA 4B1YB 3CQYA 5KI6A 1SH3A 1OQ6A 4FJLA 2WVBA 4QPXA 2HHTA 1GLBG 3SQ1A 5K5MA 2DF4B 3QMQA 3GDXA 1S4FA 4DL0C 3UD5A 3I76A 4ES2A 3QJJA 3N0VA 3CGIA 4QYZK 3U1NA 3B6OA 3PG9A 3CC4S 4F02A 1PK3A 2JC1A 2IM3A 3I0RA 1WJ9A 4FBUA 1Q8LA 3CB4A 1U9LA 3ZZYA 1RDWX 1OYDA 4FK2A 3MN5A 5AQMA 3M30A 4ZTJA 9ICJA 4H0TB 2NYHA 4DJBA 4JV2A 4US9A 1HLWA 2WF9A 3KG1A 2HHQA 1UFWA 2H5JB 5DZ7A 3V5RA 4JI5J 4EHUA 2J5AA 1WG8A 1YT3A 2BPGA 4Y2KA 3IDWA 4NXMK 5AI4A 2Y8YA 5HR7A 3KZXA 2K2PA 4FOIA 4OJ1A 3N4QA 1WG1A 3R5DA 1S1TB 3QBXA 3DOLB 4FJKA 4UY8T 3SEIA 1SH0A 2O8DB 3ZSRA 1IBMF 8ICZA 4FYXB 5AQQA 4DV7K 1T9UA 1U02A 3VEXA 4Y00A 2DQNB 2UUAF 4USMA 3GZ7A 3KJFB 4ECSA 3WQTA 4BACA 4OQJA 4PH5A 4MK7A 2J0SD 4Z4FA 1OQ3A 4QU6A 3PLAA 3NS1A 1QE1B 3PYEA 2NUUG 3ZYYX 3NGTA 4U7UD 5ALHA 2QB0A 2CG4A 1SJ3P 4KN4A 2Y1JA 4F4YA 2KT3A 2BE7D 3CD0A 4Y2CA 1UHUA 3CPWM 2CQ1A 2JHDA 2DGVA 4OFZA 2J6TA 4CLTA 1ZAVA 2IIHA 2MZTA 2F9WA 4U8VA 4FFDA 2XLIA 4P2SA 2XWYA 3BSOA 1E4FT 3BJYA 1S97A 3KUEA 1FJGK 1XMQK 2ASLA 3TWHA 2E5HA 4DR1K 1F60B 1YRTA 3J80Y 5CHCB 3DMJA 2R7UA 3AXMA 3VQEA 2F8MA 2C2MB 1ITPA 4OLOA 4ZP6A 4OZ3A 3HSDA 1H98A 5LMUF 4QZ8A 2ZIUA 3V2UC 2F44A 1NO8A 5EOZA 2P1JA 2RS8A 4ECYA 1SWWA 2FBVA 2VFSA 3EN9A 2OGUA 1VQON 1LQ9A 1C0TB 2FPHX 4MO5A 1DRGA 2YPZA 3ZX2A 5IWAF 5H1SQ 3Q8YA 1YTYA 1UETA 2E5SA 1E6YA 4CLSA 5TISU 3S3MA 3W61A 3HF5A 4I2FA 3QNNA 4ZVRB 3VQ7A 5A8RA 4JI3J 2RF2B 4L3KA 4LF6J 3ATUA 5KRTA 4G6VB 4ZVOB 4JI8F 1HJRA 1JLBB 3MM6B 3TO8A 1ZRNA 3BKTA 4DX8H 2N7CA 3P6YC 1SS6A 1TAMA 4UAYA 2HBRB 2BX6A 4Z4HA 4ZHRA 3UD3P 3AY0A 3NF8A 1QVFR 4OI1A 1X3MA 4EEYA 4QZDA 5CZ2A 2VFRA 1ACMB 2BANB 5J2MB 1BHNA 3MEGB 2ZD1A 3HHLB 2J0WA 4MH8A 4C48A 3QUQA 4B9UA 3U27A 1GMUA 2ZITA 3OPKA 3VOVA 4GKKJ 3FKBA 1Q8IA 3PIOQ 2P9NB 3MN6A 2R8KA 2F9DA 4FJMA 4QIWC 4ZJQA 5KFYA 4CT8A 2EANA 1JLCB 1ZQDA 4DV5J 1DEJA 2W2PP 2PGCA 4B3SF 4JK1A 1SJQA 5L1MA 1T9TA 2JWKA 3NH2A 2QWPA 1X66A 4EELA 5KG2A 3O4QA 4CJ4A 4QYZJ 2D3OR 4A5AA 3CCJN 4L73A 3N28A 1HLUA 1RTDB 5J0PA 5D15A 5EVZA 3ZETB 3PEJA 5JUMA 2IHNA 2J9EA 4PG7A 2XSJA 1F9HA 4DUZK 3BDPA 4KH4A 1JK9B 2DNOA 2EZZA 3UQ2A 4E0DA 8ICTA 4RUHA 2WF6A 3QU4A 4WE1A 2BCUA 4YOWA 4KHPK 4TXSA 3NGRA 1TFWA 2E2PA 1JB0C 3DGPB 1VDHA 4BR5A 4C8YA 2ZJAA 4CIOA 2Z2YB 2NYIA 4LH5A 4MKYA 1ZAWA 3UN2A 1WF0A 2I5JB 4CO5A 2VFTA 4NEZA 1Y10A 2WBMA 4NL9A 2FHOB 3T5KA 1SIZA 4NXMJ 1CI4A 1WC4A 2HWTA 3EY1A 4MYTA 2Q1NA 5DQHA 1GNKA 3CCMS 1K73O 2HHXA 4MF2A 2F3JA 3D4JA 1CZ9A 4Y65A 5EDWA 4H4MA 3OD2A 3PKMA 4YS2A 8ICAA 3BEXA 4CM0A 2M5YA 5HROB 1NJWA 4IC9A 1C0FA 4USJC 4RW6B 3AD9C 3FRYA 3DLLQ 3BBFA 2D0OA 4DV7J 4FF1A 3OUYA 4O23A 1VRUA 1SC3B 1ZQYA 5TZVA 2VBZA 2R7OA 5E0OA 2EW9A 1C4AA 1ZBLA 3FQKA 1T03A 2YQ3A 3ZNJ1 3L3CA 5HQMA 3FRZA 1IWAA 2GGPA 3A3OB 5D49A 1ZBIA 3B4DA 3M8WA 1V5IB 4JV0A 2MZJA 3BSCA 4UB8U 1XSPA 4A5BA 3TNVA 3LVVA 4PHAA 4DQRA 4ED1A 1BC6A 3AUOA 4RPFA 2COLA 3N7SC 1X6IA 4WCEL 1X4DA 4J37A 1OY6A 1Q82O 2C2ZB 1VQ7N 2HAIA 2JL9A 7ICLA 3AT1B 3I33A 1P8GA 5L8RC 1DBDA 1FJGJ 2RU9A 4IDHA 1LKYB 2BE2A 4CF1A 4DR1J 1X4GA 1KD1T 3D2NA 3NRZA 3BF3A 3MDAA 3OLAA 4DV3F 3DLHA 3CIPA 3MMAA 2ZUDA 2HLUA 1HHSA 1R8BA 4F50A 5C0YA 5CR4A 3C6HA 5KPZA 4LUBA 3AVNA 4F71A 3I56S 5FJ4A 4CE6A 3M6UA 1VQ9S 4OKKA 1VSDA 2XMVA 4RO0A 3T1YK 3RAQA 2HGLA 2O8FA 5DM7Q 4I2IA 1VK3A 5IIJA 3IAYA 1HQ2A 3R9LA 4ILJA 3QNMA 2FJXA 2BDUA 4M42A 3NGSA 2DIUA 3WBZA 3F73A 1O51A 1RP5A 4H4KA 4BC7A 4H5VA 1NJIT 1DJ0A 2YKPA 3U8XA 3THXA 1VQKN 5M1KA 1ZQUA 3BZQA 1T94A 5C42B 5J2PA 2E1ZA 3ADAC 1E6VA 4OHZA 1YI2S 1KN5A 4Z6DA 3HHLD 4Q44A 5E2QA 4DFJA 4CLUA 3MN9A 2RRNA 3CNHA 1FXLA 1RA6A 2BVZA 3SZ2A 1T9VA 2EFOA 3M2RA 2QXLA 3KLGA 2WSCC 2KRRA 4JKAA 1NDKA 4LF1A 4JRPA 1CZAN 2JLEA 4PPZA 3N6LA 4NRUA 1Y3KA 4J9PA 3V1RA 2VA2A 4UZCA 1BNPA 5D3GB 2QE5A 2K8AA 1VQMS 2IJNA 4KHRA 2PI4A 3ENHA 5CZVA 3CPEA 2E88A 5ALPA 4YD1A 2A18A 3C2MA 5F3ZA 4DL5A 2CQGA 3AL0B 4AQYF 2OTJS 3KLIA 4NO7A 1HBUB 4DCOB 1BISA 2H4YB 3VAJA 7AT1B 3NXZA 3EO3A 4DUZJ 1TL3B 2Y9UA 2J6UA 5DBAA 3DDIA 2Q31A 3QJLA 2AGPA 4DB3A 4FLUA 4FJ5A 2B0GA 4Y2IA 3AOCA 4LT6A 4GMJB 2BRLA 4LRFA 2MZRA 2UU9K 4KHPJ 3HP9A 1FKPB 2IAJB 4BR9A 3SJHA 1QH9A 1N32F 2IVPA 1V85A 4CEOA 1S7HA 2H48B 4LSLB 3KWMA 4OJOA 2XS5A 3V7JA 4RPZA 2VL1A 2VA8A 1NGHA 3L6QA 4DQQA 1M5SA 3DRPA 4ZIWA 2LEPA 2CNLB 4FZMA 4LR8A 1S10A 3R9KA 3JPQA 2GIQA 4ICLB 3IR5B 5HL7Q 1ATRA 5KG1A 2N3OA 2EFPA 3TEHB 5ALSA 1UEKA 4P7VA 5CP2A 3VEVA 4XA5A 5ALMA 4G1IA 4AXJA 1KLNA 5AE1A 1KQQA 1WUDA 2DGQA 1GOCA 1LWCA 3QLHB 1IVZA 3BV8A 4JI2F 1YBUA 1D8LA 2HNYA 5HSPA 5CYMA 5HMLA 4BRGA 3BS5A 1HPMA 4QZ9A 8ICNA 4FJ7A 2DNHA 2KJ8A 4UAUA 2VPZB 4W4MA 4TY8B 1X0FA 1ESVA 2NZCA 4P2MA 1S12A 1RGIA 3MWPA 3QUTA 4MQ3A 1M0SA 4CJ5A 1PC5A 3W2VA 5KG7A 1FRJA 3ILLA 2A1JA 4KKOA 3MPUB 3SV3A 4KBOA 2NS1B 1QJHA 2QMUB 2QEXS 1VQPS 3DI6A 3P8BB 1UMJA 4TSXA 5JVGQ 5ETVA 3HSTB 5D4LA 2M52A 2XY8A 4A8EA 2QA1A 1IJJA 4OJRA 1VBKA 1VC6A 5AQWA 3ALYA 2DH9A 2LU1A 4O5FA 4LBIA 3I28A 3SI6A 2FQQB 1PBAA 2CNKB 1R3NA 3UXOA 2FF3B 1IR1A 5JVHQ 2ZE2B 3CJKB 4O3PA 1A76A 2ZJRL 4EFAC 4FWKA 2HNZA 3FJ2A 1WKKA 4RPXA 2O5DA 1N8RT 1RDAA 5I9EB 1U0HB 1GFWB 3SJJA 3OVSA 4IOAL 5AXMA 4CLYA 1OS5A 3C6AA 3S3OA 3EL2A 3OYIA 4U67Q 1TGOA 1T7PA 5D0HA 4KT0C 3AVHA 2VG6A 4ZVSB 4Q2LA 1HWUA 2E8OA 5IM0A 2YKNA 3EWGA 4FJ9A 2UVRA 2PSZA 2Z0GA 5J0TA 1AQ6A 2OD6A 2FVRA 2XO7A 3MUMP 2ADBA 2AP6A 1AZSB 3R5BA 4MKVA 2X6NA 4RQ6A 2QT7A 1LFPA 2YNGA 4FJXA 4JMUA 2VA3A 4RUBA 3AJ2A 4F26A 3EGVA 3A5MC 3GQCA 1IG9A 5T7LB 4LRDA 5GADP 3MAAB 5AQPA 2FJWA 3N01A 3NCIA 2WRMA 1HI8A 1ITGA 4QS8A 1BLUA 1NB7A 4KFBB 3SI8A 3KG0A 4KI6A 1ZQEA 4J2BA 1OMSA 4ZOSA 1TV6A 3L3VA 4QCLA 5E84A 4I69A 5IOLA 2OPPA 2ZXIA 4YOYA 2UP1A 3RJKA 3I4HX 3JQJA 8ICHA 2HFUA 2H51B 3FSXA 2FF6A 2UUTA 8ICVA 2POKA 3TA1A 5GINA 1SC6A 4NLPA 1FX2A 1Q7YO 3V9WA 3G82B 1S1XB 3KKRA 1NHVA 1Z4UA 3SMSA 4DXLA 3CCQS 1KC8O 3C29A 2BPFA 3LL3A 1A6SA 2D3DA 3DCAA 2W41A 4C1NK 2QO3A 1NKBA 3RBXA 4IR1A 2RPIA 2WK4A 4EO8A 1S0NA 2G0IA 4O4GB 3GSIA 2GCFA 4L75A 3DFEA 2LCWA 2NR0A 3E9OA 3R97A 2GV1A 5E26A 4TKTA 4M94A 5DKWA 2LP4A 4E7KA 2FY1A 2DHAA 3IP4B 3PSTA 3UMBA 4NLDA 1PAEX 2FHKA 2YMQA 3SFUA 5DLFA 3BYRA 2E5JA 8ICKA 3MEDA 2UU9J 1RWVB 2KN4A 1XNRK 2VJ4A 7ICRA 2ASPA 3S9HA 1RSCA 3A8YA 2IM1A 1DTTB 1D3WA 1G99A 5AKYA 4LR9A 2DR5A 3W60A 2FLOA 1S9EA 1SJ1A 3AVCA 5AK5A 3NVVA 2NRXA 4NCAA 2DR6A 2DPNA 4PG6A 1FFUA 1UTAA 4MK9A 3NNHA 1FEEA 4MIBA 2VCPA 3T19A 3KK1A 1F9EB 2D1KA 1I5OB 4P4PA 1OUQA 1GMWA 1APSA 4TLRA 4A8OA 4Z6FA 1X42A 3BQ2A 1NSPA 4O3RA 5D4NA 4BRHA 2JZBA 4BRFA 2IOFA 4KO0A 2UXDK 2JJ4D 4JHDA 3AQFA 3MM5B 3K5NA 3E1YA 2P9IA 2DGUA 2RE2A 5AI0A 3HSJA 2CJQA 3UFCX 4BX9C 4RQ2A 3OR1A 1VSJA 3KWIA 4F3MA 2VQFF 1VSIA 1UFLA 4Q0BB 2RHKA 4Q8EA 1CS4A 4I2QA 2GW8A 1XTZA 1CJKB 3A0IX 3IM8A 3UR0A 1ED1A 2GVDB 1TAUA 4M5IA 1UJ4A 1Z6RA 4CZFA 2WB4A 3F9KA 4YFUA 1KQSR 2CWKA 1ROFA 3M8ZA 4PAAA 3ZZRA 3B0XA 1G3OA 4OHYA 2V8GA 3LZJA 1NDPA 3CXCR 1KRPA 2OMOA 3US5A 4KLEA 3MC1A 3F5TA 1NZAA 1RYSA 3LDPA 1X4HA 1LAWA 1YG0A 1SQEA 3VEYA 4CF4A 1KNZA 2F77X 1UZDA 5CZXA 4WZMA 1Z00B 3PRBA 4OMFG 4RBTA 4LD0A 1Z4OA 2RU3A 1KVAA 3WKBA 3VEWA 1ZTTA 3N4WA 5CHGA 3HWTA 2KJ5A 3CEDA 2FE9A 8ICRA 1IR2A 5KFGA 5J2FA 2YWGA 4PYDA 3CJ9A 2V8PA 3H20A 1N5SA 3VEZA 3OTCA 1MDUB 2QARA 1KAXA 2KHDA 2IC3B 3MXHP 1WHXA 3K89A 4A8FA 2LPEA 5J2JA 5A0LA 4B9LA 1RTJB 3Q8VA 3KJNB 1B4SA 2F7TA 4DQ8A 4I6MA 3CCVN 4FKXA 2N4DA 4BR2A 5C12A 4QR1A 3M32B 3CT9A 2WZ1A 5J2NB 3GYNA 1M6YA 2MRLA 1R8CA 2P6UA 3QFWA 1F9FA 3KK2B 4FWSA 1SV0C 2J9DA 2ZDPA 4M3UA 3GU3A 3VERA 5SUHA 2D1CA 4PGYA 4FBTA 4QW9A 1HUZA 3HZ6A 4HL9A 2C2NA 4BDPA 1KXPA 8ICXA 1V38A 3SQ2A 3KUHA 1X9SA 2K3KA 4PL1A 2HRUA 2BCVA 3GB0A 4BC2A 2B51A 4E19A 1UVLA 3O1BA 5C5JA 3PMNA 5LXRA 3IHQB 1VK0A 4DU7A 4H0VB 1T3NA 2CVIA 1UWBB 3LWMA 3ZTOA 1PO6A 1BCOA 2XMJA 3RUBL 4A47A 4B3MF 1VQ6N 1SKWA 3WNHA 2KM8B 4FS1A 4PG4A 3TTDA 3M5RA 2WVEA