4DS4A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mn2+
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 201
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds4A01
2JZBB 3TWHA 3AVLA 1Z25A 4G1QA 4FK0A 3Q8KA 5C25A 4GW6A 2XY8A 1C7YA 1ZQTA 4DL3A 3QEIA 4YXMA 3E01A 4DOBA 2P5OA 3TFRA 4DL2A 4HTUA 4DS5A 3LPTA 4H4MA 3QERA 3RRGA 4I2GA 1S0NA 3KKRA 2XCPA 4JK1A 3RTVA 4NYNA 4FBUA 3OHBA 5FRMA 5KFHA 4BE0A 2V4QA 4KV8A 3PVXA 4CEZA 1VSLA 8ICIA 1JIHA 4GXJA 1A5WA 4RZRA 2PFPA 3QE9Y 3SZ2A 4CJUA 4FLUA 5HRRA 4KLDA 4CF0A 3C23A 4CJSA 4Z0UA 4M9NA 3TR8A 4IRKA 5J2HA 4O5CA 4UB1A 3AVIA 3AA2A 8ICOA 3G6VA 3T5HA 4IFYA 4ED3A 4FJNA 1S0OA 1CUKA 3PW5A 4P4OA 4M3WA 4ED0A 4KLUA 2HHSA 2JZBA 8ICFA 5CYMA 3MXJA 4ECWA 4UB3A 3Q8MA 1U49A 4M47A 4XA5A 2D5RA 3HP9A 1C0UA 2F8TA 1LAWA 4FJ9A 2G8FA 3RJKA 2PY5A 3SNNA 4AH9A 4XQ8A 4UBBA 3NH0A 1Q8IA 4FXDA 3UQ2A 1HYZA 3KIOA 2YNHA 4Q0BA 1MQ2A 4KLEA 5IIIA 4F2SA 2JEGA 1K1SA 4AHVA 1N6QA 2W9BB 3BQ0A 4IQWA 1EXNA 1BHLA 4E7HA 8ICPA 1Y97A 3PUFA 2ATQA 3TAFA 3SCXA 2J6TA 4EYIB 2D0AA 2VWKA 4DTJA 4F4XA 4EBEA 1H38A 4Q8FA 4YQWA 5KT5A 2WTFA 3IS9A 3TAQA 3SQ1A 3LP0A 2PYLA 1VSIA 4R65A 2ATLA 5K14A 1Q9XA 4QZGA 2ZJ5A 2LYHA 3U6FA 4FVMA 5HMLA 4N47A 1IKYA 1JN3A 3N97B 2YNGA 8ICCA 3CM6A 1KFTA 2RN2A 3S3OA 3AVGA 3S3MA 2OZMA 3SV3A 1L3TA 5DBBA 4RU9A 5HRSA 9ICVA 4F92B 3UXNA 3ZDDA 1SKRA 3ORYA 4F5OA 4O44A 5KFSA 2ALZA 4DF4A 1TGOA 3DYAA 3RMBA 1GOAA 1JL1A 2P6UA 4E7KA 2FBXA 2IAJA 4DF8A 4YCXA 4KLTA 2LSNA 2AGQA 3NDKA 3HPOA 2EHGA 2Q3SA 3H08A 4AILC 1EKEA 3L2WA 1TV6A 9ICKA 3VQAA 4KRFA 3L3VA 3SQ0A 1RCHA 1REVA 1MU2A 1KVBA 8ICJA 1DGSA 4CEDA 1IXRA 4FM0A 3PW7A 4DL5A 3RB6A 3LZJA 3RB4A 4NXZA 3VN5A 5KFLA 4DFPA 4O5EA 5J0XA 1S1TA 4RPXA 3EPIA 4UBCA 4O0IA 1BQNA 4I2BA 4N41A 4BGDA 3ITHA 3BDPA 5IIKA 1RZTA 1ZQRA 3U3GA 1Z00B 5BOMA 4HHTA 5DB6A 2HHTA 1TVRA 5I3UA 1EXQA 3PW0A 1ZBIA 3DLHA 4RPZA 1RPLA 4M2YA 4RNMA 3K2PA 4FS1A 4CHYA 4CJWA 4ECZA 3C6UA 4TUPA 1TVAA 4IDKA 3V9UA 2W9CA 1JXBA 3NGZA 5KG6A 3EYZA 1UT8A 4I7FA 4X5VA 4I9QA 2H5XA 4QZDA 2YHAA 8ICSA 3RMCA 4KHNA 3OYNA 4IRCA 3JSMA 3AVFA 1ZQJA 4CEBA 4I27A 4C8NA 3MDCA 1LAVA 4FJIA 3OYKA 4DG1A 4YVZA 4Q44A 4DQSA 2HNZA 1JXLA 3Q8QB 4UB2A 2J6UA 4NY8A 1TV9A 1HUZA 2VA8A 2VG6A 3DLRA 1BI4B 3PY8A 2HHQA 3OYBA 4KI4A 4Y1CA 7ICUA 2UVRA 3V6KA 2B4JA 3RJHA 3HP6A 2OPRA 4I2QA 4J9RA 3OYDA 7ICFA 4B9LA 1S1XA 4PHPA 4DTOA 5J2EA 2VG5A 4BDZA 3SV4A 4IKFA 5KG4A 4IFVA 3OGUA 8ICNA 1T05A 3RBEA 3Q8RB 4F3TA 3MXMA 1C6VA 1ASWA 2VWJA 2OYQA 4L8RB 2Z1HA 5T7BA 1JLBA 2G8WA 4KLIA 2ZJ8A 2IBKA 4JRPA 1YT3A 3AU6A 3QNOA 2PFNA 8ICWA 4B8AB 4DQIA 3MECA 3SI8A 4KLMA 4DOCA 1TK8A 2MUTA 2XY5A 1HYVA 4DL4A 3ZDBA 4C8LA 1JL2A 5IIOA 1KRPA 3C21A 2AQ4A 1QSLA 5J2MA 8ICLA 3ETLA 4FJLA 4KLQA 8ICXA 4QOZB 1XHXA 3THVA 3MEDA 2A1SA 3AVAA 4B9TA 4E0DA 2BQRA 1BI4A 1HNIA 3RJJA 4LH5A 1RT1A 3MEGA 1Z3EB 5L9XA 3EWAA 2HW3A 4DSJA 4CK2A 2AU0A 3M8PA 1DOQA 4IG3A 3VQ8A 2G8KA 3V7LA 1NJYA 4I2JA 5DQGA 3KK3A 5IIJA 9ICCA 2Z1GA 4M3ZA 3UPQA 4B08A 4M9JA 1WSIA 4FBTA 2XGPA 1D8LA 2ZUDA 3D45A 1K1QA 3OYFA 4OLAA 4QZIA 1KLNA 1S10A 4O9MA 3GIMA 1D5AA 4IBNA 2C2DA 4EZ9A 5KFQA 3EPGA 1A76A 2BCUA 2F96A 4FM2A 5KFTA 1U4BA 3V9WA 5KG3A 4E19A 3QEWA 3DM2A 5KG1A 4Q43A 5DG7A 4GC7A 5L1LA 4CEFA 5KFUA 2ISPA 3MR6A 4O0JA 3QEBZ 1XHZA 2W8KA 1XSPA 3K75D 5DQHA 2KTQA 4F5QA 3SUOA 1TKDA 2AJQA 3FYHA 1KVAA 4CEQA 4CF1A 3K5NA 4CFAA 3JPPA 3AO2A 2G8VA 5KG7A 3MABA 4JS5A 4FLTA 3PR4A 4ECSA 3JPQA 2Q0ZX 5BOLA 5EWFA 7ICGA 1LW0A 7ICHA 3AA4A 4FZZA 4O5KA 1S6PA 5IIMA 1JLAA 4WE1A 1ZQYA 2XRIA 4W5TA 3WNEA 1UWBA 4QZ9A 3V7JA 2V9WA 2F1JA 4GLXA 3GV5B 1GOBA 2RKIA 4CGDA 4UAWA 1RXWA 3HJFA 5J0YA 4RNNA 5HBMA 5DB9A 9ICJA 4R63A 1BPYA 4OKEA 4CF8A 4Q5VA 3L3UA 4Q45A 1TL3A 4NCAA 4QCLA 3SQ2A 1T4GA 5DLGA 1RBVA 1ZQIA 5HHHA 1ZQAA 2I5JA 3ZSXA 3LAKA 4Z4FA 3EW9A 4TSXA 3ZSWA 4W5NA 4NCGA 2IOCA 1WLJA 3BGRA 2IGIA 3NGDA 4CHOA 3RBDA 1BCOA 4M3XA 4EP5A 2HVIA 5C5JA 2ASLA 4OJRA 3OYGA 1ZJMA 5F9LA 1FXXA 1RBTA 3CFRA 4FLWA 4BE2A 3VA0A 1S1VA 1RNHA 4AHCA 1WNSA 3V4IA 1T7PA 2OZSA 3NH2A 2ASDA 2FMQA 7ICKA 4DU3A 2ZD1A 2HHVA 4E1MA 4FLZA 5J0TA 3DMJA 2FBTA 1VSJA 1X1PA 7ICRA 3RR8A 1RT6A 1L3VA 4B9MA 3T1AA 4CGIA 1SL0A 4K4HA 1J54A 4DTUA 5KRSA 5J2JA 3CFOA 1B22A 4Z6DA 4JV1A 4EP4A 5L1KA 3HK2A 3L8BA 3IAYA 3ULDA 4M9LA 4QZEA 3OYMA 5J2NA 8ICAA 4K4GA 4IQTA 2FPKA 4OPJA 2DFEA 1NJZA 4QWDA 4KREA 1B9FA 2KZ3A 4YG2A 3V9XA 5KFWA 4ECQA 1RTIA 4LZDA 2EX3A 3QZ8A 3JPRA 2P5GA 5KG0A 1S9GA 4YR3A 4DSKA 5KRTA 2OA8A 3FDSA 4DS4A 4QWAA 4IRDA 3VQPA 4QZFA 4GVMA 2ZUCA 3RR7A 2FMSA 3V1RA 1N56A 2R7YA 4IQVA 4M3TA 4DWIA 3MGIA 4YNQA 1CEZA 5J2DA 2VA2A 3LPUA 1RDDA 1S97A 4PUOA 9ICMA 2E6MA 4FLXA 3V1QA 2KFZA 3PO5A 7ICSA 4MF2A 1ZBUA 3Q8PB 3GFKB 4XUSA 3EY1A 3BQ1A 3TAEA 3LP2A 4QAGA 1SZPA 4PHDA 2BGWA 5D49A 4N5SA 3LAMA 1U04A 1NJXA 3KK1A 5KFOA 4YP3A 3PX6A 4W5RA 4HVJA 4RQ7A 4QZBA 3VQDA 7ICEA 4F5NA 3CQ8A 3AVMA 2RF2A 3QNNA 2ASJA 3B6PA 7ICLA 1ZQWA 5HLFA 4B9SA 1MQ3A 1QSSA 1JXEA 3OSNA 3AVKA 1VRTA 3WNFA 4P4PA 4OLBA 4RQ5A 2XC9A 2QKKA 1ZQSA 4CERA 1KSPA 5J0WA 5KFDA 1ASVA 3AUOA 3TARA 4ED8A 3MR3A 5J0UA 1NJWA 4FZYA 4PHEA 1HQUA 3H8JA 4R8UA 4DSLA 3PV8A 4RT3A 1C1CA 3NBPA 5KGXA 2AGOA 1Q9YA 2NRVA 3RB3A 3RJGA 5KFEA 3GIJA 4J9QA 3RH6A 3VQ5A 4TUQA 4J9SA 1WSEA 4CEOA 4JRQA 3PR5B 1S5JA 3SPZA 3DLKA 3ZSRA 1XS9D 2DPJA 3HL8A 4IQUA 3RH4A 4DO9A 2PI4A 4HUGA 3HVRA 4P4MA 1RTJA 4RW6A 3HX0A 1LWEA 3P5JA 2KQ2A 3TI0A 1S6QA 3NF8A 3ZDCA 1BIUA 2DFLA 1B9DA 3O3HA 2JEJA 4MFCA 2GBZA 3RMAA 2A1JB 1ZQPA 4KLOA 4FJ5A 3MFIA 2W9CB 5EWEA 4PH5A 1HYSA 4F5RA 4R66A 2BPFA 4PPXA 1LWCA 3S3NA 3VQEA 3SUPA 4H4OA 3QETA 4JV0A 2ZQBA 4XRHA 3C2KA 4ELTA 4DU4A 4NCBA 3T5KA 1ZBFA 4K8ZA 4FS2A 3PX4A 1U48A 4YR2A 3C5FA 3I0RA 3Q8LA 1NOZA 4F5PA 4AHRA 2BGGA 4I2HA 2ZE2A 2RDJA 5J2KA 2IHNA 1IG9A 4ED2A 4GC6A 1S1WA 3A2FA 2BCRA 4YN4A 2Z1JA 4CFDA 1C0MA 3OYLA 3NCIA 5D46A 3RB0A 4AHTA 5KFBA 1ZBLA 1TK0A 2F8SA 3QINA 1YTUA 3C5GA 4CEAA 4Q8EA 3GDXA 1SL2A 5HNKA 1ZQZA 1JKHA 2HHXA 9ICAA 4E7LA 4NLZA 1RILA 3MGHA 4FJHA 4KO0A 4DL6A 4CIFA 3DRSA 2A1JA 3ZT4A 4CJTA 3G0ZA 1X9WA 5CWRA 3HO1A 3NH1A 1JMSA 3T19A 3SYZA 2XO7A 4KB0A 3C1ZA 4Y1DA 4I2CA 4YFUA 1S9EA 5CZ1A 5BPCA 1HJPA 1VSKA 2NRWA 3AVCA 5KFKA 2IA6A 4MEYA 1TKTA 4ZTJA 2C28A 3SI6A 4J9NA 4NM1A 2MUTB 3K5MA 2KW4A 3MDAA 1DTTA 1WSFA 3UXOA 4LH4A 3ZT1A 7ICPA 3LZIA 4ECYA 1BISA 1RDBA 4ECUA 5DKWA 2QKBA 4RQ8A 7ICNA 4CIGA 3HW8A 2ITGA 4J2BA 2BHNA 2KN7A 1RT5A 5CR0A 3C2MA 5HMMA 4O3RA 4Z4CA 4KB1A 5SZTA 1C0TA 4CFCA 3AV9A 1XWLA 3RJIA 2BQUA 4YFKA 4QWBA 3SUNA 1LW2A 3CFPA 5CHGA 4LVSA 3K57A 2DFFA 1HMVA 1ZQEA 7ICVA 4P2HA 1EP4A 4M45A 4BE1A 4F2RA 5KI6A 3OS2A 4M9GA 2XHBA 1DTQA 3ZD9A 4PQUA 2XCAA 2C2RA 3PX0A 1LV5A 1S76D 5DK5A 7ICTA 2DPIA 4XIUA 1U45A 4CJRA 2GUIA 5KG5A 9ICIA 3V72A 1J9AA 4O3QA 5KTQA 1ZQNA 3WNGA 4DU1A 2PYJA 1RT2A 1NKEA 5HP4A 5L1JA 4RT2A 4OVLA 2X74A 4Z6FA 4UAYA 1QSYA 3TAPA 3DRRA 3ISBA 4ECVA 1XI1A 4DFMA 1HRHA 4C8KA 3K5LA 3VQQA 2X6NA 2G8IA 4DTSA 1JLGA 4PHAA 4J9LA 2B6AA 2V4RA 1CXQA 2YKMA 3HM9A 2BR0A 4CJFA 2BKEA 1ZYQA 1TKXA 4CF2A 3GIKA 3ZSZA 2QXFA 4M3YA 1HUOA 4BDYA 2Y1JA 4M9HA 2HHWA 1COOA 3DLEA 2PFQA 1T8EA 2M9NA 3AO5A 4RW8A 3ALYA 1EX4A 1NK0A 3MEEA 1BGXT 4MFFA 1ZJNA 4ID5A 4KMUA 3TQ1A 2F1HA 3LP1A 1W9HA 3VQ9A 3OVNA 2Z1IA 4CESA 4N56A 4O4GA 8ICRA 4PA1A 5J0SA 4KPYA 3IG1A 8ICUA 4NLGA 5FRNA 3KHLA 3M9MB 1X2IA 9ICHA 1ZQUA 3TANA 1D9DA 1VSFA 3AVJA 3ISCA 4JLHA 3SPYA 1RTHA 2JEIA 4CJPA 4CJ3A 1KTQA 5CY4A 2FLNA 3OYIA 2BQ3A 3L2UA 4OKJA 4CHPA 3NF9A 1B92A 1N5YA 3KLGA 1HQEA 4FJKA 3JPSA 5DGAA 3H8WA 4J9KA 4RUCA 2PZSA 3KD5E 5J29A 3K4GA 3M9NB 1SKSA 3DOKA 3HSTB 4NYFA 3ZSOA 1NOMA 4CECA 3HPGA 5J2FA 3M8RA 3UQ0A 4J9OA 5CP2A 3NHGA 4BWMA 1QHTA 4TURA 9ICUA 4RW7A 4TUSA 1RXVA 1QQCA 1HPZA 4G3IA 1ZBHA 4KLHA 3OS1A 3LWMA 3N4MB 3KK2A 1Y88A 4J2DA 1J53A 3V9ZA 3LDAA 3C95A 4ED7A 4ED6A 3SUQA 4KLLA 4F4ZA 3GV8B 3P83D 3ZSVA 3PW2A 4FW2A 3GILA 5IILA 9ICBA 3IRXA 4O3PA 5KT3A 4JUZA 5KT4A 1VSDA 4CJVA 5KFPA 4MFAA 1NK9A 4ED1A 4TQRA 3PW4A 3CG7A 3PMLA 4HYKA 1L5UA 4KFBA 4DSIA 3KLHA 5KFMA 7ICIA 1IKWA 4ICLA 3K5OA 3RRHA 5CB1A 1VRUA 2RDIA 4J2AA 3K59A 3E2EA 3OYJA 4BDPA 4GMJB 4UB4A 1BVSA 3NF6A 1UA0A 2ZJAA 9ICXA 3V81A 1CLQA 4F93B 2NRZA 2B21A 4QZ8A 3IM1A 2JLEA 4ELVA 4B9VA 4KLJA 3JPOA 5KFYA 2NUBA 1QLNA 4EYHB 3I0SA 2XGQA 3MR2A 4FLVA 2UVUA 3HPHA 4H8KA 1TAUA 5KFCA 5IINA 2PFOA 5E41A 4LSNA 3F9KA 4AHUA 4B9UA 1KVCA 1RT4A 3HWTA 5J2AA 4KTZA 1YTAA 1BPEA 3OS0A 3PO4A 3QEAZ 1IO2A 3OY9A 1ZETA 4PGXA 4I2FA 3ZSQA 4BXOB 4DSFA 1YVUA 4M0AA 4M6WB 3KJVA 4GXIA 5DG8A 1A5XA 4CJ4A 5D3GA 4NM2A 4R8UB 2VG7A 5KT2A 1JLCA 4MQ3A 4ECXA 1X9SA 5KFNA 4PGQA 2JGUA 3QLHA 5C42A 2A1RA 3ZT3A 5DB8A 3OHAA 3PNCA 4GXKA 2NRTA 4CGJA 4E89A 1TFRA 5DQIA 4MEXA 3RJEA 3ISDA 5KFXA 1IKXA 1TAQA 4DLEA 5J2CA 2X78A 2FPLA 4F4KA 4RG8A 1NK7A 4YD2A 2HB5A 1A77A 4KN7A 4ZTFA 9ICQA 4RNOA 3TAGA 3ZCMA 2X6SA 1AROP 3KLFA 1CZBA 4RPYA 1B43A 2YKNA 1S1UA 2QK9A 3QIOA 4KLGA 1S0VA 4CGGA 3L2QA 3G10A 4BXOA 2BPGA 3TAMA 1I3AA 1TL1A 1S77D 3NGYA 3V7KA 4E7JA 4M6WA 1A5VA 4CE9A 3H7IA 1SUQA 3B0XA 4O3NA 3P1GA 9ICPA 1VSMA 5HHIA 1RBRA 5HROA 4LY7A 1RT7A 4DFKA 3HXMA 4CEEA 2P51A 4K4IA 1XSNA 4F4WA 1KDHA 4JV2A 3OYHA 1CZ9A 7ICOA 3AU2A 4CJQA 3VQ7A 1SKWA 2NRXA 4RQ6A 3C1YA 4QZAA 1KFDA 3D0PA 5DBAA 2G8HA 4YD1A 4CHZA 1ZQHA 2KFNA 4ID1A 1V9PA 5J2IA 3UIQA 3OJUA 3RH5A 2FC0A 3DRPA 1RYSA 2YNFA 3CM5A 4JS4A 4M42A 3ZSYA 1XU4A 2BCSA 2WOMA 4FK2A 4TQSA 1BPDA 3LWLA 4J9PA 3OJSA 2AGPA 4CJKA 3M8QA 5KFZA 2D0CA 3MXIA 3V1OA 1TK5A 2O4GA 3ASMA 4Z4EA 5HRNA 4KLFA 5KFAA 2YHBA 4CK1A 2YNIA 3KKSA 9ICEA 4DTXA 2W42A 4DQRA 5EWGA 3RAXA 1RDCA 3VQ4A 3DLGA 3ZDEA 5JUMA 1NK5A 7ICJA 2PXIA 4IR1A 5KT7A 2BDPA 3TFSA 4KLSA 3JPNA 3AA3A 2IDOA 5TZVA 3V6DA 1RDAA 1U9LA 2IS3A 4E7IA 4CHQA 3B6OA 2OWOA 1TKZA 4OGEA 4HUFA 2XY7A 4RQ3A 8ICTA 3AA5X 3HVTA 4O5BA 2BCQA 3RWUA 4RQ0A 2ZUBA 3KHGA 8ICGA 5KFVA 3VA3A 1KEJA 3L2VA 1KCFA 2OPSA 2KZZA 4ELUA 1JLQA 4FJ8A 4I2PA 4E3SA 4DLGA 3C2LA 2FLLA 1SV5A 3AO1A 4UAZA 3KHRA 3SJJA 4LSLA 3TABA 1ZQVA 3O4QA 4DOAA 1ASUA 4O3OA 4OPKA 5J2PA 2W9BA 1BL3A 2ZTEA 4IR9A 1BPXA 5JS1A 9ICWA 2IMWP 1HJRA 1UAXA 2OPQA 5FROA 2GWSA 3NE6A 3QEVA 2E4LA 3KHHA 1K6YA 4CJEA 4KITB 1FKOA 1XC9A 2AQ0A 3OSPA 1QS4A 3T3FA 4F3OA 3LALA 3ZT0A 4FM1A 2I1QA 1EETA 4LD0A 3OYAA 1ZQFA 4BACA 3C94A 3MBYA 1XO1A 1UOCA 4QW8A 5J0RA 1J5OA 4I28A 3U3YA 2KZMA 1MC8A 5FDLA 1WSHA 4EEYA 4HCBA 1NK8A 4RUAA 1Z26A 3QEPA 5J2GA 3AO4A 1ZQQA 4O55A 1ZQBA 4KN4A 2R8KA 3VQCA 4JWMA 1ZQMA 2BPCA 1T03A 5CYQA 3GV7B 3NFAA 3RAQA 4DL7A 4I9LA 1LWFA 4DFJA 4RQ4A 1RBUA 3OYCA 9ICTA 4FCYA 3QO9A 2UVVA 3ISNC 1FK9A 3SQ4A 1VSHA 4DMNA 4J9MA 4FLYA 4KHSA 3RJFA 2IHMA 4NLNA 3G6YA 1S0MA 2R8GA 5KFJA 4PGYA 3QIPA 1R0AA 5J1EA 3FFIA 4M41A 4OGCA 1ZQCA 1T3NA 1WCLA 4DQQA 3JYTA 5DGBA 1WN7A 4FJJA 1HNVA 1BPZA 3UXPA 1G15A 4CIEA 2I9GA 3H8SA 4ECTA 2P66A 4F50A 3GQCA 2MAXA 4QW9A 1UA1A 3AO3A 4M3RA 3M8SA 2W9MA 8ICHA 2DY4A 8ICZA 1WSJA 1Z00A 1DLOA 4I29A 3LDSA 8ICKA 1C1AA 2W9AA 4C8OA 4KAZA 3QZ7A 1IKVA 2JEFA 3BQTA 3KLEA 1RTDA 2PI5A 4CFBA 4FK4A 9ICRA 4KHYA 4F91B 1NOYA 2FBYA 3ZDAA 1NK6A 3KD1E 5SWMA 3K58A 3KLIA 1ZQOA 1F21A 4I2DA 1XSLA 5DBCA 5F9NA 4FJXA 5C24A 1L3UA 4OKKA 4N76A 1KLMA 1JLEA 1U47A 1BIZA 5DDMA 3AVNA 3IHQB 3H4BA 3I8DA 1NKCA 2G8UA 3S9HA 2FLPA 1NK4A 1N48A 1GOCA 1WCNA 3V6JA 5CZ2A 4PWDA 4ECRA 4CF9A 7ICMA 3HT3A 3BQ2A 2C2EA 3HYFA 3T5JA 4CGHA 9ICNA 2GV9A 1W0HA 4CJ5A 1LB2B 1S9FA 1I39A 1D9FA 5HRPA 1QTMA 1ZQKA 8ICMA 4FJ7A 2R8JA 2UVWA 4DTRA 3M9OB 3ZT2A 3OYEA 1MSWD 4AHSA 1PZNA 4KHWA 1ZQGA 3ZD8A 3H40A 3O3GA 4FYDA 3RMDA 4RW9A 2R8IA 4KTWA 5L1IA 2BE2A 1VSEA 4EBCA 5J0PA 2VA3A 3C6TA 1RT3A 4DEZA 4KHQA 3F73A 2FBVA 1WAJA 3LP3A 1RYRA 4J2EA 5KFIA 3JPTA 8ICEA 1CXUA 3V9SA 1ZQLA 4HUEA 4K8XA 5CJ7A 8ICVA 3AVBA 4RQ1A 2B5JA 2ZTCA 1BCMA 5HP1A 4M3UA 4YR0A 2BANA 4QWEA 4RQ2A 3QEXA 5J0QA 4Z6EA 4Z4GA 3WNHA 5D4BA 2W8LA 3NF7A 2P6RA 4KTQA 2HNDA 4RW4A 4KI6A 4EZ6A 3NTUA 1FKPA 3CYMA 4KHUA 4CGFA 3H4DA 1ITGA 4B3OA 5DMRA 2OPPA 4R5PA 4UB5A 9ICGA 3LANA 4MFBA 4CHNA 4MF8A 4Z4IA 4ZHRA 3O3FA 4HCCA 4FO6A 4DTNA 1O1WA 3GIIA 9ICLA 2WONA 1NKBA 3B0YA 4KKOA 5KFFA 2BCVA 2XY6A 3KTQA 4I2IA 4ZH4A 4YMOA 1VK0A 5DLFA 2RPIA 1KFSA 2C22A 5J2BA 2Y1IA 7ICQA 3Q8SB 4CJLA 4DTMA 2R8HA 3BJYA 8ICYA 4UQGA 9ICFA 4QWCA 4CCHA 2O4IA 5JS2A 1L3SA 2P1JA 5CA7A 3PMNA 3AVHA 4I2EA 3LK9A 2FMPA 3DI6A 1BQMA 5EU7A 4W5OA 4DQPA 3L2RA 3DOLA 4QZCA 4E1NA 3NAEA 4BWJA 1ZQDA 5EOZA 3MAQA 5DDYA 3O4NA 1SL1A 2D0BA 4FZXC 5DB7A 2VANA 3DLBA 5KGWA 4DTPA 4FJGA 4QZHA 1IH7A 5KT6A 8ICQA 3MFHA 2IC3A 5J0OA 4Z4HA 5DG9A 2FPMA 5KFRA 1ZQXA 3V6HA 2ZTDA 4W5QA 4I2AA 3G6XA 2HVHA 1C1BA 3MR5A 4LZGA 4Z6CA 5KFGA 9ICOA 2YV0X 5I42A 4CK3A 1BPBA 4IG0A 3VQBA 3QESA 2HNYA 4B8CA 5KG2A 2HMIA 4M04A 4JWNA 1UT5A 2F1IA 3EZ5A 2E6LA 2HHUA 1JX4A 1JLFA 2J6SA 1QE1A 4C8MA 5J2QA 4O3SA 1X9MA 2ETJA 2ISOA 4EBDA 1RBSA 9ICSA 4F8RA 4FJMA 4YMMA 4YMNA 3T5LA 4F4YA 4FW1A 8ICBA 4PY5A 3NGIA 4DSEA 2DTUA 4NLKA 3VQ6A 1IM4A 4R64A 1D8YA 1WSGA 4B9NA 1WAFA 2DFHA 4YXJA
chains in the Genus database with same CATH superfamily
1N5XA 3TWHA 4QNLA 2KH9A 1MMLA 5C25A 3EDQB 1HBMA 4MLHA 1ZBSA 2HWTA 2XY8A 3ONNA 4FYWB 3R5BA 1ZQTA 1UW4A 1HNXF 5L38A 3QEIA 2K1RB 2IY5B 4YXMA 3TFRA 4DL2A 4GKKK 1DHMA 4OD0A 1S12A 4H4MA 3RRGA 4Q0BB 4M5DB 3NRZA 2KICA 4OHWA 3OHBA 5KFHA 1WC4A 3E9LA 3EGZA 3RVCA 4P7TA 1HKBA 8ICIA 4CLFA 2ZIUA 4GXJA 4WFNQ 2VFUA 3T9NA 1BXNA 3EVOA 3OBIA 1IXKA 4CF0A 5AQRA 1H7WA 3C23A 3IS9B 2VBXA 1XQIA 1BWEA 1RWNB 3CIZA 2G2ZA 1XQSC 5CCLA 3CCUS 4XH1A 4WFZA 2YNGB 5C10A 2EWHA 1WYGA 2Z4PA 4IFYA 4ED3A 3EN9A 5B0CA 4P4OA 4MLEA 1U1QA 3M8ZA 2ADBA 1OSCA 4CT8A 4O5FA 3MWBA 3SQGA 5AFUA 3C8YA 4ECWA 2YX4A 4AP9A 1S48A 2IVOA 2GJ2A 4RU2A 3HSGA 3HVTB 3HP9A 4Y2AA 1WD6A 2K1RA 3I9ZA 3RJKA 1KQSR 3SNNA 1IBKK 2OPSB 4AH9A 4IQMA 3NH0A 1JLQB 3V2UC 2JH3A 3GU0A 4FXDA 4Q0BA 4M5DA 2QLWA 1MQ2A 2KHQA 1SAZA 2JEGA 1U2CA 2ALYB 2L3MA 2Q1LA 4OZ0A 4IQWA 5D77A 1EXNA 2CQIA 3NVZA 2H3EB 1Q18A 4EYIB 2UUBJ 3UFCX 1V4SA 4OV6A 4O23A 4EBEA 3NP5A 4LF5K 4YQWA 1NHKL 3IS9A 3UPFA 1KKXA 2AJ2A 1VSIA 5LY3A 2ZJ5A 1BQNB 3C28A 2B4UA 1U8WA 3R5JB 1U1LA 1G3OA 2DH8A 3N97B 4US8A 1ATRA 2YNGA 2NLXA 8ICCA 3CM6A 3AVGA 3S3MA 1T9WA 5FPDA 1N5WA 2ZBQA 5ALQA 2DXFA 5DBBA 2Q79A 4RU9A 3ZDDA 3SAHA 1RAAB 3LDLA 4QR1A 1HBNB 5FPMA 1N5TA 3O80A 3DLLL 1VQKN 1JL1A 3J7Z5 4E7KA 2FBXA 2NZTA 1RYUA 3KUHA 2LKYA 4X4QA 4I7FB 4KLTA 2AGQA 3NDKA 4OJ6A 4L73A 2EHGA 4OHVA 3HMJG 2CNKB 3L3VA 1RCHA 3E9PA 2CWXA 3VPZA 3VETA 1DGSA 3OFGA 1IXRA 3PW7A 4LFBK 1XK8A 3SDEB 2R4FA 2FVSA 3RB6A 1N32F 2JX2A 2CPEA 2MQ8A 3SJHA 2BOPA 3CUNA 2YKQA 3VN5A 3N9UC 4JN4A 1GLAG 3GE9A 4UOFA 2DH9A 2F9TA 5J0XA 1S1TA 4LR9A 2WF7A 2OYYA 3QNMA 3K89A 5IZHA 4IOAL 4YB6A 2VJVA 1BQNA 2LQ5A 1HQ2A 1N0UA 4N41A 4B1YB 1HR0J 3BDPA 5IIKA 3HD2A 4GKKF 1ZQRA 5LMUK 3U3GA 3BKTA 4TY8B 2AJ4A 5ALLA 2PO4A 1NMDA 3PYGA 3VF0B 2QEXN 3DLHA 3BEGB 3FCHA 1EQ0A 1IQTA 1HBNA 4ANCA 2ZEJA 1TVAA 3CCRN 1B4FA 2Z57B 4ZITA 1FEHA 2ZH6A 4ISFA 3Q2TC 2W9CA 3R7SB 1UT8A 3NG8A 4I7FA 4X5VA 4I9QA 1B0XA 3CJ9A 4QZDA 2YHAA 8ICSA 3RMCA 4KHNA 3OYNA 4WKYA 3JSMA 2RNEA 4ZVFA 1ZRNA 3S6EA 4C8NA 4IC9A 4QPTA 2HQGA 4FJIA 3N28A 4DG1A 3WK9A 3SDEA 2KMDA 3MZIA 3AQFA 2NXUA 4CZHA 1FJCA 4F3MA 4NY8A 3MEDB 2FGOA 3H7HB 2VG6A 2B7CB 3DLRA 2H48B 3W0LA 3UR3C 2R7QA 5C2FA 4KI4A 3MX2A 2FJWA 1IR1A 4K5SA 3V6KA 3HP6A 2OHFA 5ALDA 4ZS6A 1SQGA 2HHPA 4ZPDA 1IBKF 5AI6A 1RADB 3M8PB 5ALNA 4BRDA 4TY8A 3W8PA 1H73A 4XDDA 4DTOA 1RQNA 1IWAA 1YJ9S 2DD8S 3LO3A 5AQUA 4P2SA 2E1YA 5KG4A 4MYTA 3I28A 2JC1A 3KDNA 3CNQP 1ITPA 1RT3B 4F3TA 1GMVA 1XEZA 1T95A 2OYQA 4L8RB 2RU3A 2KHCA 3QPIA 3D5MA 5AE3A 4LF5F 5MLCQ 2BANB 2WUSA 1WTBA 2IBKA 4JYAJ 4JRPA 1YT3A 3DM2B 1B64A 3QNOA 4OX7A 4DQIA 2E1MC 3QMQA 3ZZTA 2GC8A 4DOCA 1PIEA 2MUTA 3D1QA 3AA9A 1VQPN 1JL2A 1KRPA 1U6FA 2YPZA 4USTA 5FJ4A 8ICLA 1TP7A 3EE3A 4WBFA 5ALZA 2HBLA 3MEDA 1OQ6A 4B9TA 1TL5A 1Q16B 3AA8A 2BQRA 1WF2A 1WWUA 3SK3A 1KEKA 1Z3EB 2V6AA 3HX9A 3FZ2A 3KDOA 1LW0B 3VEVA 2BJ9A 2QWNA 2AU0A 3M8PA 2UU9J 3G6EN 4GV3A 1S6PB 1HBOB 4Y2KA 5B09A 9RUBA 1FDBA 2G8KA 3OUYB 4NLXA 1U1RA 5K8OA 2WFBA 3ETRA 3QX7A 3VEYA 2RKIB 4LFBF 4FWMA 4B08A 1RHMB 3DI6B 1BQMB 3PEJA 3D45A 3VGTA 1K1QA 4QPXA 2D7SA 4WTYA 4O9MA 2PEHA 5D4PA 5AKXA 4EZ9A 4JI1J 3DM2A 4Q43A 4YEAA 1M1KO 2V63A 2ZUGA 2J9EA 4CH0S 2O8FB 2NXCA 4A2BA 2KG1A 5LMUF 2LHTA 5BYRA 3BGRB 2ZKUA 2GVZA 3MR6A 5H9FK 1YJRA 3RZAA 3QEBZ 3SCIE 3WBZA 3QRRA 1XHZA 2W8KA 1UVMA 5DQHA 2KTQA 1C1BB 4H03B 4BRNA 4KBOA 1FDDA 2AJQA 4PL2A 1TYQB 3BPSP 5GAHI 4CFAA 4FP9A 4ZVTB 3AO2A 2E66A 2QV6A 1DQAA 2NS1B 2HMIB 3JPQA 2Q0ZX 5BOLA 3CCLN 7ICGA 1LW0A 4CM2A 3EKSA 4YN3B 3R7BB 7ICHA 1VQ8N 1IJEB 5HN0A 4DCHA 3A3NB 1S6PA 1HBOA 1U0HB 1ZS6A 2VQFK 3P38A 1HIYA 1RUSA 3OUYA 1N8RT 4W5TA 4ZLPA 4MTPA 1GO3F 1NI3A 4GLXA 4LF4K 5IQQA 2RKIA 2G0JA 2W6LA 1KD1O 2K06A 3CCEN 4X64K 1X66A 2N3LA 5CHCB 3RSEA 5J0YA 4RNNA 2DRAA 4LJMA 5DB9A 2W7AA 2V8VA 2QLJB 2M8HA 4BX9C 5HK4A 4Q5VA 4Q45A 1PJ7A 1T4GA 1ULRA 4PZVA 3FE1A 2HBYB 1L7MA 3UB5A 5FIIA 3I9V9 4NI2B 2P9NA 4TSXA 3E01B 3BGRA 3OTOJ 2VFSA 2IGIA 4EHTA 2KT2A 1BCOA 4EP5A 2HVIA 1VR6A 3OL7A 1QJHA 4USWA 3ETOA 5F0WA 1TYQA 2VGMA 5D78A 1AYEA 2RH3A 4AHCA 3V4IA 1T9TA 2DGOA 5GIOA 3D2FB 4DU3A 4BC7A 4CNYA 3LM2A 4I6YA 4E1MA 4NLYA 5J0TA 2PMWA 4OJLA 3SIPB 3RR8A 4A8FA 4CGIA 3E66A 1J54A 3E0FA 3CFOA 2JL9A 4JV1A 4HL9A 2XTJP 3E1YA 3HK2A 3L8BA 1FTRA 3ULDA 2YH0A 4PCQA 1BWFO 8ICAA 3R97A 4C3LA 2LQ9A 1JWWA 3O4WA 2DO0A 2FPKA 4H0XB 2BH1A 5A8WB 2YWWA 5CYMB 2C2OB 4I6AA 2E5LJ 5GADI 4NLPA 3KG4A 5GMEA 4DSKA 3U1NA 4NI2A 3HHNB 1E4FT 4BR0A 2C3OA 1PVQA 1K44A 4PWUA 5CD4H 2F65A 4QWAA 3CETA 4GV6A 1U2VA 2QN6B 4YUDA 4K4TA 1DXSA 3HHEA 2WRMA 2VA2A 1S97A 3VEWA 2HQIA 3V1QA 3PO5A 4MF2A 3Q8PB 2YHYA 1Q5YA 1X6IA 2GQQA 3S1TA 1SZPA 2BGWA 4CZKA 3C2PA 5K8MA 5KFOA 4YP3A 3CC7N 3EZOA 4HVJA 4QZBA 3NWGA 3VQDA 4JI4J 3BQ7A 3CQ8A 2WK4A 3P5TL 3ID8A 3WZ0A 3EVMA 4DR3J 1MQ3A 1QH9A 3CCQS 1QSSA 5A8WA 5F41A 2OANA 4CF4A 3BZCA 4CO4A 1JNZB 4OLBA 3MMVA 1KSPA 1IM6A 5J0WA 4JMUA 1ASVA 1X4BA 3AUOA 5D0RA 3H5XA 3HKWA 2VQFF 2VWBA 2V68A 4OI0A 5D0HA 5I3QA 5K8PA 2KYXA 1OYDA 1TV6B 2PMZC 2FY8A 4RT3A 4DV4K 4F0HA 1R8HA 4LF4F 2M0GB 3TA2A 2GVDB 2NRVA 1FRMA 3QGHA 4X64F 2ZJQL 2IA0A 1ZM2A 2FLOA 4ICAA 5KQDA 3OD2A 2DJWA 3KWGA 3CD6N 1UZHA 4JRQA 2JHDA 5B0EA 2WVFA 4NWBA 4IQUA 2RUGA 5GMKa 4HUGA 1EKRA 3ITHB 2DO4A 3G71N 3MPWA 2KQ2A 2W2OP 4USJC 1H3DA 2VJUA 3DLJA 2E44A 2MQMA 4P0QB 1L7NA 3O3HA 2JEJA 2A1JB 4KLOA 3NOGA 4ZDNA 4AM6A 4U9RA 4Y2TA 5D0EA 1HWUA 3IXQA 1KQQA 2KFYA 1LWCA 3DU6A 4FWRA 5ALJA 3QETA 1NGGA 2EC2A 3F2BA 4RBUA 2QYGA 2GVDA 1NSKL 4TY9A 1H6KX 3GTYX 1MROA 4NCBA 3J7YI 3T5KA 4IOBA 4DJBA 1ZBFA 2B56A 4YR2A 3AAQA 3KJNB 1NOZA 2E5HA 2BGGA 3RRKA 1DQ8A 3KFWX 3CJBA 3DLLQ 2EQYA 2A42A 3IMQJ 1S1WA 2GO9A 5AT1B 1C0MA 3OYLA 1REGX 3RB0A 4ILHA 3EDRB 3MPVA 2FC8A 1N34K 4MK9A 4CLWA 2CQ1A 1TK0A 5E3QA 1S1XB 3QINA 2RQMA 1KAYA 4Q8EA 2FHOB 2W6KA 3ZTSA 4CLSA 2HHXA 1NSQA 3NS1A 3ZFVA 4DL6A 2A1JA 3G0ZA 2OKQA 5CWRA 1DTQB 2EKNA 3T19A 2XO7A 4KB0A 4Y1DA 1S9EA 5BPCA 2CPRA 1VSKA 4IOAQ 3AVCA 3FR0A 4I64A 1O0PA 3QB0A 3F2KA 3C7NB 3IR5B 2N3OA 4JD2B 2VDHA 2VPZB 4RL1A 3R6LB 1WSFA 3ICXA 2B0GA 1U02A 2RMLA 3LZIA 2MY7A 1D9AA 2K3IA 1PK1B 2NUHA 3K9KA 1HNIB 1TMJA 1C4CA 5ALRA 3MEGB 4J2BA 5AK5A 4BR7A 2H5EA 1JLGB 3MM7A 3C2MA 3VMFB 4DCPB 4Z4CA 3JB9k 3FBFA 2Y1RI 1H0HB 1C0TA 1NLKL 4CFCA 3TSPA 4B6JA 4ILRA 4DV4F 4BRCA 4ZPAA 3KK3B 2NZ4A 5CHGA 3GFZA 2XMVA 2HI0A 3DLEB 2DFFA 2RT3A 4YOEA 3QBXA 4P2HA 3MEEB 4TYBA 4M45A 4NLRA 3OS2A 2XHBA 1DTQA 1RM6C 2ROEA 2C2RA 4TU7A 2F4VK 2L41A 1LKYB 1M5PC 3VC8A 4ZCIA 7ICTA 1EZZB 4XIUA 3SXLA 4CJRA 2I6XA 3C7NA 1X4EA 2KT3A 4AQYJ 2QWPA 4U67L 2R7OA 1ZQNA 4USIA 3WNGA 4FE3A 1WEYA 2XHWA 1DGJA 5HP4A 1RTHB 5L1JA 3F41A 5KL1B 2C3MA 3NASA 3QT5A 4ECVA 1FNOA 4DFMA 1HRHA 5KAKA 3KWMA 1CJUA 1KHWA 2IRUA 3K5LA 4BRGA 4DTSA 2IM2A 1JLGA 1G2EA 1K9MO 3NUQA 5B66U 3Q23A 1RGIA 4F67A 5EE0A 2XS5A 4DR6J 2BR0A 1R0BG 3CCMS 5AQOA 1ZBTA 2GNKA 2BKEA 5IT9Y 4M3YA 4M9HA 2HHWA 1XR5A 1X5OA 3DLEA 2M9NA 4OYXA 2PFFB 3ALYA 4V19J 3MEEA 4YB5A 4ZN3A 5M1OA 3BZQA 4DUYK 4OLPA 1RWVB 3TQ1A 4IO9Q 4ZJOA 1W9HA 5CZVA 3BREA 3CD5A 2Z1IA 2QLBB 3UNYA 4N56A 4CESA 1LKYA 2FIUA 5LXYA 4DV2J 3IRXB 4WFAL 5DO2A 4AD6A 4KPYA 4OHYA 2BDUA 4F0KA 2WVBA 4NLGA 3KHLA 2AEJA 4ETZA 3NXZA 1N34F 9ICHA 1RHJB 3TACB 3AVJA 3MUVP 5HVHA 1FFSB 3CDBA 1RTHA 3GSDA 5HQLA 2E1PA 2BUNA 2M88A 3L2UA 3CQYA 3VALA 3HBTA 4CHPA 4M1KA 4ZMMA 2VIXA 1NBWA 1N5YA 3KYLA 1FF2A 3C14B 4J9KA 1WI8A 4RUCA 3CJSA 1YK9A 2PZSA 3VR1A 3ZSOA 4NYFA 2QG9B 1HLUA 1FDNA 3M8RA 2R2RA 3SCKE 4TURA 4NRUA 5DZ7A 5A2QY 4BGBA 5KOXA 2B4PA 2K4PA 1ZBHA 4JI3J 3OS1A 1Y88A 4IH5A 3LDAA 4A8WA 4W90B 4CRXA 3N4WA 2HKEA 3M2RB 4WPAA 3B8AX 3SUQA 4KLLA 2VOPA 3P83D 3ZSVA 3PW2A 4FW2A 3GZFA 2NO4A 4JV5J 3IRXA 3ZZZA 2O8DB 5KT3A 2OELA 1Q8LA 3M8YA 3WKBA 1KKHA 2CFXA 4XEIA 1M1KT 3NWRA 1WOOA 4KFBA 1WNEA 1N5VA 2CGJA 4DHYA 2XMTA 5KFMA 7ICIA 2LLZA 3RRHA 4LF7J 3OYJA 4UB4A 1N5QA 3CJKA 1OJ4A 4PUOB 3L9ZA 1CLQA 2DBBA 1NDPA 3G8QA 2PFUA 3C14A 2B21A 3PKYA 4OHZA 4MH8A 1DKGD 7FDRA 2F4VF 4M95A 3GCXP 4B9VA 3DXKA 3CB4A 1RAJA 2U2FA 3I0SA 2MQPA 1ESVA 3JAMY 3HJEA 1BOTO 1FXRA 3UN2A 1OPZA 1KQGB 2J8AA 2RF2B 3JSYA 5E41A 5HLFB 1KD1T 5GAEU 2VDIA 3D6RA 1A6SA 4B9UA 3OS0A 1BPEA 1HWIA 3QEAZ 3VF2A 2CH6A 2O8EA 1ZETA 4PGXA 4BXOB 4QIWC 1NDKA 3BSNA 1YVUA 3ILJA 1TQLA 1VQMS 5FLXY 8AT1B 3HKZC 4DX8H 4M0AA 3OPKA 3QXGA 4W92B 2WF8A 4M6WB 2KVQE 4DV6K 2ROPA 4JB8B 1HBUB 4FPBA 5KT2A 5FPEA 4MQ3A 5AXNA 5KFNA 2MY8A 4PGQA 2JGUA 4FYVB 2BJEA 4C9DA 3ZT3A 1Y3KA 4DUYF 4FYYB 4CGJA 5DQIA 4ILMA 3RJEA 2IRYA 2E5GA 3AD9C 5KFXA 5J2CA 1IR2A 1YRTA 3DLKB 3BN7A 4OI3A 3A3PB 4F4KA 2C2MB 5H9EK 1NNEA 3UKUA 2OTJN 4YD2A 4CQ1A 2HB5A 2HBQB 3MDFA 3M8QB 1WBBA 3CDWA 1AROP 1KDNA 3VZIA 5C2DA 5U47A 3EZWA 3LGHA 1RDUA 2CKWA 2GW8A 2YNIB 3QIOA 2F4FA 5HMYA 2D3DA 2X7IA 3G10A 2HRYA 4NLUA 4BXOA 3FFKB 1S57A 1I3AA 2ZXHA 1S77D 2CAJA 2QWMA 1VQLN 3FSIA 3G4SS 4E7JA 1NHVA 4M6WA 3V6DB 3M32B 3QGGA 3HZ6A 2R7UA 4O3NA 1HBUA 5JICA 4DR4K 5HHIA 1VK8A 4D3GA 4KMOB 3HXMA 1KDHA 4OI6A 4JKDA 3OYHA 4DR2J 2GH1A 4WFBL 3TYTA 5KOWA 2MQQA 4JKHA 4QZAA 1KFDA 4DN0A 5CHIA 2DNHA 5ALEA 5ITHA 4YD1A 2BJDA 1WWVA 1V9PA 1MLAA 2WSCC 1FXLA 1KTVA 1M5KC 1YJNS 5BPLA 2A0FB 2O8BA 2YNFA 3NS5A 1BNOA 1B7YB 1YX2A 3SMSA 4NLTA 3L7UA 3H3OB 3TVYA 2AGPA 4NLSA 2JWNA 3M8QA 2OPQB 1S49A 4ZP7A 2R2TA 2O4GA 3ASMA 5KFAA 4Y2CA 3H5SA 3LL3A 4LFCK 2YNIA 1VQ6S 1SQFA 3DDKA 3O5TB 4K50A 2ZJQQ 3HT0A 1LOTB 4FSVA 5E5NA 3DRSB 4IR1A 5KT7A 4K0KK 5LJVA 2W7OA 3AA3A 2IDOA 5TZVA 2GO8A 3V6DA 1RDAA 2IS3A 2XULA 3D1HA 1SJQA 4CT9A 1OH7A 3H3NO 4CHQA 2YTUA 4BJQA 2F77X 3B6OA 4DX6A 5BREA 4HUFA 4A5AA 3Q8UA 1S6UA 1QQ6A 1LWFB 1DTTB 8ICGA 5KFVA 1KEJA 2ODGA 3SMZA 4ZCMA 2KZZA 4HDHA 3IWNC 4DLGA 1NAQA 4HTLA 2LFVA 3QIPB 5J1EB 3LA0A 3FFIB 2W9BA 3D0HE 4AYBC 3TSQA 3BS5B 4URGA 3DU5A 4BY9C 5JS1A 4PYDA 4RBTA 1CS4A 4IJNA 4DV6F 3D68A 2OPQA 2GWSA 5TKYA 3NE6A 2AQ0A 3SAFA 3LALA 2JR5A 1TR0A 4DZ6A 3ENHA 3QAUA 1ZQFA 2W40A 3EGWB 3IWXA 4DDFA 5G4DA 3OXFA 4YHHJ 4QW8A 3TZYA 2KZMA 4MKVA 4RUAA 1Z26A 5J2GA 1ZQBA 2HSZA 4KN4A 3D0GE 2MU2A 3BP8A 3KLEB 3VQCA 2D41A 2XSJB 2OTLN 4LT6A 3GV7B 1NGJA 3NFAA 3RAQA 2LKZA 3UMGA 1LWFA 4RQ4A 9ATCB 2YMQA 9ICTA 2QI2A 3QICA 4FCYA 5AKYA 2DUYA 1DEJA 2Q36A 1VSHA 4KHSA 1QM9A 4CDGA 1S0MA 2R8GA 2EWSA 1SC6A 2ZBCA 3QIPA 5J1EA 3ENAA 2VBZA 1URJA 3FFIA 1XNRK 3BS5A 3SR6A 1T3VA 3TKAA 1WN7A 2QL5B 4NLVA 1AXQA 2B6AB 1A9NB 4DR4F 1ATSA 3K0SA 1G15A 1M1HA 2I9GA 5HOOA 3H8SA 4OYMA 2FY1A 2ZKTA 2B8QA 4N8OA 4QW9A 1UA1A 3AO3A 1RACB 1VQ5S 3OR2A 1N33K 2KVSA 1A6LA 1FJEB 1EJ7L 2EAPA 8ICHA 1Q7YT 4N77A 4E1JA 8ICZA 4XDCA 4WQ4C 2DXDA 3U1LA 2DR6A 3MC1A 1DLOA 1FHTA 1RLCL 1DK3A 4B9QA 8ICKA 4YOVA 3QZ7A 3OVAA 2YWKA 3JSBA 3CSKA 3KLEA 2MKCA 4CFBA 4PQAA 1S4FA 4HH0A 1NOYA 2PKEA 3ZDAA 2CJBA 3TQEA 5KAIU 3R5AA 2NLWA 2VBWA 3BN4A 3HHKA 4MJKA 1ZQOA 2B5JB 1RWKB 4CF3A 4LFCF 3EXYA 1UEVA 5DBCA 5F9NA 1LEOA 1UTAA 4FJXA 3T41A 5C24A 4R25A 1OVQA 1BIZA 2HEKA 4LIWA 3AVNA 3KLGB 4OX6A 1RHKB 4K0KF 3SMVA 1NKCA 3F44A 2G8UA 2LYVA 1WCNA 3V6JA 4PWDA 5CZ2A 3UVJB 3A0HU 1B70B 7ICMA 4K4WA 3BQ2A 1QQ7A 3HYFA 1TELA 1VHIA 5JTIA 3K8WA 1PYSB 4DHVA 2YHXA 3S7RA 4Q2LA 1HPZB 1QTMA 4KKOB 1VQNS 2DR7A 5E26A 1HA1A 4DV3K 3AY9A 3OYEA 4DZDA 4WP9A 3O3GA 2R8IA 4KTWA 3T7ZA 1ACMB 3ZETA 1SXLA 1IJJA 1D1UA 5J0PA 4Y2RA 2XLKA 4KHQA 3LP3A 3T1YJ 1PBUA 3D6JA 2DK2A 1ZQLA 4HUEA 4JI0J 2K60A 5CJ7A 8ICVA 3WC0A 3AVBA 2B5JA 4YR0A 4ZVHA 4QWEA 2V50A 3QEXA 5MAOA 4Z6EA 3HVWA 5D4BA 3IUCA 3CMAN 3NF7A 1BDGA 1LQ9A 4NXNJ 1FKPA 4ETXA 2BM1A 5DMRA 4LF2A 2DTJA 3OLBA 3UVJA 1K9MT 4WFAQ 2UXDK 3AXMA 3CRXA 5IWAJ 4Z4IA 5I42B 3NMUA 1SZHA 2RLTA 4FO6A 1O1WA 3CCZA 9ICLA 1R27B 3B0YA 3ZO7A 4KKOA 2BCVA 2KJ9A 4WF9L 3D28A 4I2IA 4LF9J 3W64A 2CRXA 3RU0A 2RPIA 2DIUA 2C22A 5J2BA 2BBEA 3Q8SB 3IP0A 2R8HA 1HLWA 2MKIA 1XNRF 3PTWA 5HL7L 4CCHA 5EOYA 5JS2A 4NRTA 1EARA 5CA7A 3PMNA 3H42A 3O1LA 3LK9A 2FMPA 3O6QA 4QIGA 1A7GE 3BGOP 5EOZA 3KJVB 3KZXA 3N5FA 2I9SA 3ENQA 5DB7A 1N33F 3R8EA 1UPPA 4DTPA 1FI4A 4IUFA 4IEIA 4B3TJ 1FE0A 2CJAA 4M5NA 5C42B 3CIPA 2ZNYA 2CQCA 4LF6J 1WOQA 2BOAA 2LYAA 1FJGJ 3V6HA 2ZTDA 2EFGA 4OIXA 1G1XA 4LZGA 4ZVOB 3MHYA 3PFOA 4P75A 1BUXA 2BRLA 5CEHA 5I42A 3ETMA 1BPBA 4FFDA 5BXIA 4CVNE 2KIVA 4M04A 1FA0A 1U2RA 1UT5A 4OZNA 3KLFB 2E6LA 4H5VA 3KG0A 3H0MB 3RJMB 5J2QA 4FF2A 2ETJA 2FVRA 9ICSA 2OIHA 3PJWA 1RBOB 1XIQA 1PILA 4YMMA 4OI2A 2HF3A 3B8HA 3T5LA 1VC5A 2DY9A 5A0YB 3VGMA 4PY5A 2QWLA 1Q7LB 3AQEA 4TU9A 3VQ6A 4B9NA 3THWA 2MZ1A 1V4TA 2JZBB 4PL7A 1YDLA 2QX0A 1D4XA 1RT7B 1WUUA 1QVFM 2QMUB 4X4OA 4C11A 3P49B 1FFWB 1NJIO 3QDKA 3QYYA 1NB2A 4NE9C 3VTIA 4DV3F 3LPTA 1GT8A 1ZRMA 1UAWA 3NCPA 2OMLA 1LCUA 5L39A 3RTVA 1W26A 4NYNA 1N6QB 5M2UA 3CMEN 3C16B 4KV8A 3X3UA 2UUAJ 1VQ7N 2XSFA 3W1YC 4JI2K 1SC3B 3H25A 5ALHA 3VZHA 3D2NA 1WF0A 3QGIA 5L1MA 1QZ5A 4CJUA 4KLDA 1RCXB 3QFUA 1NSPA 4CTAA 1VLBA 2G9OA 4Z0UA 2DHGA 4KHPK 5D8HB 1K8AO 4QIWD 1DBDA 2D1KA 1CJTA 3G82B 3G6VA 1ZPVA 1GMUA 5A0YA 4ALZA 1VC0A 4BC2A 4FJNA 3PW5A 5BRDA 4M3WA 4ED0A 4KLUA 2UXDF 4X65K 2JZBA 4HACB 2HPUA 8ICFA 2F3NA 1U0SA 1XMQJ 1U1MA 1RAGB 5F8JA 3QUQA 4Z7CA 3U9DA 4PG6A 2WVCA 2D5RA 1KVIA 2DF4B 1C0UA 2W03A 4PPZA 1FX4A 1SIZA 3NMRA 2PY5A 2HAFA 4K4YA 4UBBA 3R7NB 1Q8IA 4I2PB 2ZVIA 2Y8WA 2YNHA 1ZM9A 3EEQA 3THXA 1MG7A 2DR8A 4KLEA 5IIIA 4LSLB 1WACA 3AFGA 1REVB 4AHVA 5ETRA 5J2PB 1N6QA 3C16A 2L08A 2OEJA 3MF5A 3PUFA 2ATQA 3TAFA 4BGAA 5BN9A 4EI2A 2ZH8A 4WP8A 4K2JA 2WTFA 1VQOS 1YJWS 4CZCA 3NOCA 4WFBQ 4JKFA 5K14A 2CJ9A 1KL9A 4QZGA 4UAVA 2J0QD 3WK6A 4EFHA 5HMLA 4N47A 2AV5A 1JN3A 3G82A 5JLFA 3M30B 2I2YA 3H2UB 4FPAA 2CXYA 4DV7J 3S3OA 2OZMA 5AQJA 2MHNA 1L3TA 3AMZA 2MQNA 4F92B 2RAQA 4RWWA 3ENWA 4F5OA 4HACA 2NXNA 3C6UB 1Z4NA 1AQ6A 2ALZA 4ERDA 2FPHX 4IDKB 2JWLA 2DGSA 2DGVA 4UTGA 4EWTA 5CZXA 2ZHOA 5JXSA 2XHCA 4QJVA 4B1ZA 1HD0A 2KM8C 1UVLA 4K25A 2VFTA 3H08A 1E4GT 2AYMA 3L2WA 3W3SA 2CPHA 9ICKA 2FGCA 1ZQ1C 5LL6d 1UVKA 2IJRA 1REVA 1LNQA 3TJAA 4B3RJ 3KKAC 4B1XB 1JROA 4DL5A 4C4RA 5JMNA 4GVLA 3MMCB 5KFLA 4O5EA 4GNIA 3GJSB 3IAS9 2GWKA 1HFEL 2CXEA 4B17A 4I2BA 2F9WA 3GWCA 2OPRB 3AM9A 2HOEA 2J9DE 4BGDA 2RRBA 1Q81O 3M30A 1RZTA 1Z00B 1KNZA 1HD1A 5BOMA 3CC4S 1GQEA 5DB6A 2VG5B 1SC1B 2HHTA 4RBVA 4NLCA 1IKVB 4KY3A 4M2YA 4RNMA 4CHYA 4FVCA 4CJWA 3C6UA 1WHYA 4TUPA 3HVAA 3L4QA 3A0IX 4IDKA 3NGZA 5KG6A 3C15A 3WK7A 3MEKA 4CLZA 1FRXA 1QQOA 1NUEA 4KHPF 3PKMA 5LMNK 1UFWA 4NYPA 2ASYA 3M2VA 4C0ZA 4FNIA 1FRJA 3OPXA 3MECB 4H0OA 4H0VB 4CEBA 3CDUA 2WHOA 1TAMA 3OYKA 2HRUA 2D3O1 4I67A 3N6LA 3I4HX 3LF0A 1JXLA 2J6UA 5MLCV 4X65F 1TV9A 1HUZA 3HI0A 2VA8A 4DV0K 3WX4A 5HQMA 3I56S 4WYWA 3GJQB 3OYBA 1N54B 4FPRA 4PPDA 5AQKA 7ICUA 2UVRA 3RJHA 2OPRA 4I2QA 3OYDA 1Y64A 3TUJC 1EKSA 1ZZFA 1XNQK 4Y2VA 1R7IA 2VG5A 2QMWA 1T44A 4IKFA 3BPDA 3BEXA 4IL6U 1PK3A 3OGUA 2PDAA 8ICNA 3MXMA 1ASWA 2X1FA 3AGKA 5IT9O 1UHUA 1JLBA 3OV7A 1F5BA 5EE1A 2MZRA 2YWFA 8ICWA 3CJ7A 1VAZA 3MECA 4KLMA 1HYVA 4NASA 3C21A 2AZ1A 4PHTX 2VQEK 1J97A 2DNMA 2QM1A 1S8OA 1XHXA 4B3OB 4F72A 3CC2S 4C1NI 2MZQA 5AJ3J 3BBFA 2XYPB 1M5VC 2HQFA 3AODA 5CXTA 2XB2D 4DSJA 1UJ5A 4CK2A 1DOQA 3VQ8A 1JLAB 3V7LA 1FRHA 4CLUA 2V8HA 1TFYA 2DIVA 3HSDA 4DR5K 1KHVA 3EGVA 5DQGA 1F2HA 4H54A 4DUTA 5IC4B 3CCWA 5BRFA 1HL6A 2V2QA 3UPQA 3Q24A 3LDPA 4DR1K 4UATA 1VQSA 2HGNA 4QZIA 5A2QO 5AR0A 1S10A 3GIMA 1D5AA 1TL3B 2DNPA 2IRXA 2O1PA 1HWKA 1A76A 1UEKA 3POTA 5KG1A 4YOWA 2PN6A 1HWJA 4KBIA 1X42A 2FVQA 3FRYA 1X9XA 2E2OA 4P73A 2AYGA 3F2CA 4CEFA 3GDQA 2ISPA 4O0JA 4A4JA 1WOPA 4DOZA 5BR8K 1XSPA 2GHVC 3M6XA 3PXGa 4O0NA 4Y2UA 3BR9A 2K2PA 2LEPA 4LBIA 5F0UA 3K5NA 4GVBB 4CF1A 1J2NA 4IS7A 3MABA 2LMIA 2P9GA 3WDOA 4J91A 2CGKA 2VIHA 4B3SJ 3DMJB 4JI7J 4O5KA 3BGLA 4FZZA 5AK6A 4K4VA 1RK8A 2DNGA 5LMNF 2HAIA 1JLAA 2Y1LB 1ZQYA 2XRIA 2LXIA 2NUUG 4NXMK 5AKIA 3R3LA 3WNEA 4QZ9A 3V7JA 2FJ6A 2V9WA 2R2SA 3UDCA 3GV5B 1GOBA 4CGDA 5F3TA 4UAWA 4IOCL 3HJFA 4NV0A 5B0DA 5I3PA 3JAMO 1BPYA 4OKEA 4DX5A 4DV0F 1W2BR 3CJCA 1TL3A 4QCLA 1NGCA 1U7LA 3BV8A 3SQ2A 4BRHA 2V7YA 5DLGA 3PRDA 4G1QB 1RBVA 2DR9A 1P8ZA 1ZQAA 1DARA 4RNHA 3EW9A 3ZSWA 4W5NA 1RHUB 4WF9Q 2V2ZA 1GTEA 1WLJA 2P9UB 4DU7A 5IXUA 1XNQF 3BKUA 1JCFA 2QEXS 4CHOA 5FLXO 3RBDA 1J5EK 3P6YC 4LF8J 2BW7A 3A3OB 3FUYA 5C5JA 1Q79A 1RWMB 4OJRA 3OYGA 3JQMA 4CF5A 5HL7Q 3CCRS 5F9LA 3SQOP 4CO2A 1R8BA 4DI6A 4TKTA 3EGNA 1HNZJ 5HQ8A 4OI1A 3CFRA 4BE2A 4F36A 1DJ0A 2LDIA 2QZ8A 4GFJA 1T7PA 4X4RA 2OZSA 3MCOA 3FAHA 2MGZA 2GAGC 3DMJA 2W2MP 4LRFA 7ICRA 4CLPA 2HS3A 3J7ZO 3O5BA 4B9MA 3Q2SC 3ZTRA 3OR1B 4K4HA 2VCPA 3CCVN 4KT0C 4DTUA 2NPIA 5J2JA 2DHSA 1LOUA 4Z6DA 4LQ9A 2VQEF 3DFEA 4QZEA 5J2NA 4K4SA 5A8RA 3ZTPA 3WC2A 4K4GA 2XO6A 3GJRB 4CNQA 4U96A 2DFEA 1NJZA 2D6FC 4QWDA 1QD1A 1B9FA 1PAEX 4P52A 5KFWA 3QT7A 4LZDA 3QZ8A 2P5GA 3RG6A 5KRTA 3O9QA 5AHXA 4ILLA 2ZJPL 3MM6B 2P9UA 1F2GA 3FDSA 3HOTA 2I7PA 3RR7A 2HGMA 4DR5F 3OL6A 5ETVA 2R7YA 4H0YB 2JH7A 4M3TA 3SSQA 1C1CB 3NVVA 4YNQA 1XJWB 3M6GA 5A2QU 5AQZA 1YJ9N 1JJ4A 3KJQB 2NPFA 4ENOA 9ICMA 2E6MA 4H4KC 1Z19A 4DR1F 2HHHJ 7ICSA 3BUZB 5GTIU 3GFKB 1K0TA 3EY1A 4TU8A 3MUTP 3W8GA 4PHDA 3HRGA 4ZPCA 1YBAA 3LP0B 1FO1A 3LAMA 4NPOA 4RUHA 1NJXA 4ISEA 3OR1A 7AT1B 3PX6A 4RQ7A 1NZ8A 4U6PA 2QKQA 1YAGA 4MDBA 4F5NA 3I87A 1UVJA 3AVMA 3W3DA 4CZIA 1SGGA 2ASJA 5BR8F 3J7YP 3IRUA 4KIAA 4F4AA 2HFNA 4BQLA 1Y9OA 3OW2R 1VRTA 3J81U 5AQVA 3G6ES 1T0TV 3TARA 4C80A 3TADC 3GONA 1NJIT 4ZPTR 1NJWA 1IV8A 2WBMA 1XR6A 3A5MC 2RVJA 1SH3A 5I9EB 3FC4A 1HQUA 4NXMF 3H8JA 4BLGA 1MA9B 4OJGA 2ZH2A 3PV8A 1YRXA 1C1CA 2GMHA 1MU2B 2KHOA 4X4TA 1Q1KA 1K5OA 4YOYA 3EM1A 1COKA 3RH6A 1QY7A 3VQ5A 2ZBPA 4R0EA 3WEEB 1RAEB 1X4CA 3PR5B 1XS9D 3HL8A 2UUBK 2WB4A 2H3FA 3HVRA 3FCVA 4P4MA 4FF1A 3K0JA 1J5EF 3P5JA 1HWLA 3QFHA 3NF8A 5I3UB 4HWIA 2Y0SF 1BIUA 1NM2A 2DFLA 2MEWA 4OI4A 4ZPVR 3CCLS 2V9KA 3SBGA 1VQ8S 1BE4A 3OTEA 3MFIA 5EWEA 3R1XA 3AJ1A 2NYIA 3PCOB 4F5RA 3U26A 2DISA 2BPFA 2V4JA 3S3NA 3MI7X 1T3QA 1RE1B 3CCES 3TNVA 1QVGR 3MWTA 1NGDA 4YY3J 3B4DA 3VEZA 3QRPA 3M4XA 1ZAVA 4FS2A 2BYCA 2FQQB 3RF9A 3PX4A 1DRGA 2RQKA 3UW1A 4DCOB 2VYPA 3WEEA 2B7BB 3Q8LA 5EX5A 2ZE2A 1FWKA 5ETQA 3TX8A 1V97A 4J5OA 2BCRA 4YN4A 2O6KA 5G0RB 1SV0C 2LDYA 2HVDA 1ZBLA 1BY9A 2GAHC 2F8SA 2FJXA 3SSSA 1FVQA 2JNJA 1AB8A 1SL2A 1LW2B 5DDPC 2B9WA 2UP1A 1ZQZA 1F9HA 1HR0K 1T05B 1HMVB 1HJOA 3KHYA 2OHDA 1RILA 4FJHA 2A3VA 5EUHA 1EP4B 2WB1C 4CIFA 5AQFA 4WQ4A 4CJTA 1HHQA 4DQ8A 4PAAA 2APOA 2ZDPA 3IMXA 4QIFA 4OYZA 3C1ZA 5T7LA 4I2CA 5AXLA 3H1QA 5CZ1A 3LVWA 4FWLA 4F9OA 1TKTA 1ZPWX 4ZVGA 2C28A 3SI6A 4J9NA 4PXDA 4KSEB 4Q2MA 4PKIA 3IBPA 1IVZA 5IV3A 3WKAA 4LH4A 4KH0B 1QAIA 7ICPA 5JMVA 1H72C 3UKRB 2D3OR 3P45B 4NA2A 3H98A 2QARB 1NWKA 1FXDA 4RQ8A 1RT1B 1M90O 4CIGA 3HW8A 3GSIA 4LSZB 3BB5A 4USUA 2KN7A 1RT5A 3VAMA 3LH2S 1ICEB 4O3RA 2GS8A 1WHXA 2OCEA 3IFRA 5SZTA 3DJCA 3SQIA 1WTFA 4U8VA 3TU5A 2NXJA 1F0MA 1TKXB 4QWBA 1LW2A 2IBOA 1DZ5A 3OVSA 4L75A 3K57A 3FCWA 1HMVA 3MTJA 1ZQEA 2A6MA 2DPNA 1EP4A 3CULA 2H9ZA 3QUBA 5IC6B 3LP1B 3PZPA 4CYUB 2XCAA 5AK3A 1LV5A 1S76D 5LXRA 3VF6A 2G5IB 2UUBF 3CJRA 1WG8A 1WSVA 3BF3A 2GUIA 3THTA 3CXCR 3DGVA 3KJFB 1J9AA 5KTQA 1H98A 3KNAA 4JYAK 2D1CA 4UOGA 4DU1A 8ATCB 1N60A 2DHHA 2XLJA 5EY4A 3UKRA 1P9YA 2QARA 3DNCA 2PT0A 1QSYA 2IMOA 2PBDA 3KVGA 4C8KA 3CCQN 5DJBA 3MMAB 3DCAA 2X1AA 3BO3A 4OX9J 2X6NA 4CO3A 2G8IA 1GLEG 4PHAA 3GZ7A 5D4NA 3HHLB 2V4RA 4Y2SA 4MN4C 1EHWA 4PABA 1ZYQA 1TKXA 2QFIA 2H5IB 3ZSZA 4K7QA 1NEEA 1JB0C 2UU9K 1RISA 1T8EA 2JLFA 4BREA 4KGKA 2WTUA 1BGXT 1RHRB 3CD6S 1U09A 3KK2B 1ZJNA 5CAAA 4PG8A 4KMUA 3LP1A 5H1SQ 4CYUA 2KVCA 2NCKL 1ELOA 1URNA 1UPMB 1C4AA 5HAOA 2IJFA 2M4MA 1CQNA 2IFXA 4AF1A 2EBGA 3G71S 3O8MA 2LA4A 3CJ2A 3MM9B 4NCGB 4JI1K 4PKHA 3KLHB 1FD2A 3GJTB 4YOXA 4DPYA 1VRUB 4CJ3A 1HR0F 2KG5A 2BQ3A 3V81B 1YF5L 3MMAA 1W7AA 2Z58B 5ETLA 1R8PA 2GEMA 1KQSM 4Y34A 2R3VA 4FJKA 3JPSA 1O13A 2EG2A 1FWLA 1RWPB 2AYBA 3MMBB 4IXCA 3ZZRA 3M9NB 1SKSA 3Q83A 4ZVQB 1IJFB 5AXKA 1NOMA 5AKGA 2VASA 3AAWB 3D2QA 3HPGA 3CHWA 3UQ0A 1QHTA 5LM7E 9ICUA 5KPTA 4WFYA 4G3IA 3HSJA 4CO1A 4CGZA 2AMCB 3KBBA 4KLHA 3KK2A 1J53A 3RBXA 3V9ZA 5E33A 3ZZ0A 1Q8BA 5AKHA 2YMMA 1V5VA 4ED6A 1UVNA 3OLAA 3GILA 5ALTA 3CIMA 2L5YA 3MAAB 4JUZA 5KL8B 5AFUH 4MFAA 4DUZJ 4A8EA 3MM9A 4TQRA 3LM9A 1CRXA 4CJ7A 4DSIA 3KLHA 1RDRA 5CB1A 1VRUA 4FZLA 3K59A 3E2EA 4BDPA 2RSQA 3MPUB 3FQLA 1UA0A 3NF6A 3QLHB 3OTOK 2A6OA 4P0PB 4IOCQ 3V81A 3BYRA 5JJBA 3N01A 3RUBL 2NRZA 2W4PA 2HK2A 3MMBA 1YITS 1R6YA 4ELVA 4KLJA 3NVKA 3ELHA 2GTDA 4DMZA 3JPOA 1YBUA 2LVWA 2NUBA 2ZM6J 3C6AA 3MR2A 4FLVA 4JYAF 3HPHA 4H8KA 5KFCA 3ENOA 2PFOA 4F71A 5EXWA 3P4IA 2MXYA 3D2EA 5A0LA 2FHJD 2QFJA 5G5HA 3ATUA 2FTRA 3HWTA 4KTZA 4QIEA 5AM0A 1MMDA 1YTAA 3PO4A 2JGAA 2MSNA 1RZMA 1IO2A 5GINA 2DNOA 2UXBJ 4DSFA 2DHAA 2CPXA 1YHQN 2B51A 3TAMB 5D6GA 1TL1B 2VHGA 2FF6A 2EG1A 4XPCA 2VJ4A 4BC3A 2QLXA 4BC9A 2K7JA 1XTZA 4GXIA 3PHEA 4CJ4A 2E5LK 4FZMA 4R8UB 1AZSA 4ZJLA 2UU9F 4NOHA 3TEGA 2C3PA 3QLHA 4P0PA 2GHPA 2A1RA 2E8NA 3OHAA 3MK6A 5JLHA 3NVMA 2VICA 1TFRA 3CO0P 3I5BA 2KM8B 2MJNA 2K4EA 3ILOA 3DRPB 4DLEA 2E7WA 2X78A 2D8CA 3CGIA 4MYUA 2FPLA 2WOMB 4RG8A 2Y8YA 1Q8KA 1VJWA 3J7ZT 2ZJPQ 1T3OA 4PG4A 9ICQA 1KS2A 4JI1F 1RTJB 2X6SA 4M7XA 3SLCA 4KH5A 4RPYA 1B43A 3R2DJ 4A8OA 3FBEA 3L09A 1I6JA 3TWZA 4JAXA 1B0VA 2Q6CA 5JVGL 3CVKA 4KGVB 2RDDA 2LQJA 1ZC6A 1GMWA 3VGVA 3TAMA 4K41A 1TL1A 1YGYA 3T1HJ 2YY6A 3C66A 3DHXA 3NGYA 2EANA 4OJ3A 4CE9A 4Y2QA 3B0XA 2FYXA 9ICPA 5HR6A 3WU2U 1VSMA 3CI5A 2PFDA 2CPJA 4TNOA 4K4IA 3I33A 1KAZA 5AI5A 3NCRA 5D4OA 4OZJA 5LOQA 3AU2A 3VQ7A 1SKWA 1B4SA 2NRXA 2HSEB 5IS2A 2NR0A 3PSFA 2HSTA 2BW2A 1NGIA 1WI6A 4ID1A 3I0RB 3ULEB 1PUZA 1NCLA 3UIQA 3RH5A 1T9XA 2FC0A 3DRPA 2RRNA 3GL1A 1KBUA 5GAGI 3ONQA 1P27B 2WOMA 3ZEUB 3IP4B 4TQSA 1BPDA 3LWLA 4KE5A 3KKAA 2XQCA 3OJSA 4CJKA 3MXIA 5ALSA 2GQ2A 2PD1A 3SSRA 1RDWX 2LECA 2CGLA 1FKOB 2JVOA 4LRDA 3KKSA 4DTXA 1BG3A 2W42A 3A4TA 2Q6BA 4DQRA 3W2WB 1EETB 3OTOF 1YQHA 2M9KA 4CI0B 3GFYA 3D6MB 4J37A 1DFDA 5JUMA 1IG8A 3OA9A 4UOCA 5GMDA 2ZG6A 2PXIA 3AEVA 3CJ0A 4KLSA 3TFSA 3VAGA 2MHEA 2DT9A 3KXDA 1RDFA 2DB1A 3HD1A 4E7IA 4ANEA 4XK8C 2OWOA 2R7RA 1NGAA 3HVTA 1GK8A 3OHRA 2BKOA 2BCQA 2W01A 2OEMA 4ZVRB 4BG8A 2ZUBA 3KHGA 4P10A 3HTVA 1X40A 3UCUP 2E1AA 3VV2B 2OPSA 4ELUA 4BC4A 1JLQA 1BA0A 3US5A 3QO9B 4GRSA 3ICLA 3NCQA 2FLLA 3ULEA 2ZWOA 3AO1A 3KHRA 1NO8A 3TABA 4OPKA 3M6KA 4X4NA 4DR7J 1D8ZA 3ZEUA 2G4BA 9ICWA 2Q2RA 1YZ7A 4MK7A 2IMWP 3JYTB 1HJRA 1ZM4A 4OZ5A 5FROA 2E5LF 2YVSA 1K6YA 1X5PA 1FKOA 1XC9A 2MLXA 3DGPB 1QS4A 2G0CA 3W2WA 1QAJA 3L7OA 1EETA 4XAKA 4LD0A 3R3TA 3OYAA 4BACA 3C94A 2C2ZB 1F5AA 4C97A 2KJVA 1MC8A 2XNQA 1F9EB 1WSHA 1HKAA 1NK8A 2EC0A 1Q82O 1WG4A 2CQ2A 4PQUB 2GUPA 3AO4A 3D54A 1NM1A 1ZQQA 4E2FB 4O55A 1WEZA 4WJ3B 2G0IA 2M3DA 4UY8O 2O3DA 1MWMA 2VC0A 4TVAB 1VHFA 2FD2A 1ZQMA 2LM1A 3C29A 3H2LA 1SXEA 5ETTA 2EDUA 4DFJA 2BXJA 1RB0A 1RBUA 3OYCA 2UV8G 1KQKA 4LMZA 4WQ5C 2EBEA 3QO9A 4M5GA 4JI4F 3O1BA 2D0OA 4NLNA 4G9BA 3G6YA 3DRRB 1JLEB 5KFJA 4PGYA 1Y0HA 4DR3F 4OX8A 1T3NA 4CNZA 4CW7B 5D0GA 4YDUC 1JXVA 1OYEA 2MSSA 3JYTA 5DGBA 1J27A 1VISA 4QYZJ 1IBLJ 2V34A 4OPHA 5M1QA 1BPZA 5K5MA 3UXPA 2BRKA 2YKMB 2HOIA 3R9LA 3C6HA 3GQCA 2MAXA 1Z4OA 1M0SA 4M3RA 3QMLA 4L3QA 1S6OA 2F7VA 4C3KA 2Y0SD 3UNGC 3U9ZA 3J7AP 3LDSA 2W9AA 4C8OA 4UOHA 1V5IB 1BD6A 2OTJS 5EDWA 4O4GB 1S7HA 3GG0A 5ADXA 5E3AA 4FWSA 3KD1E 4YOTA 3PRVA 3W9JA 5HP1B 4TXSA 1S5ZA 3O44A 4OV1A 1ZD5A 4I2DA 3UDLA 1OQ3A 2YXLA 1JJ2R 3FKBA 4AQYK 2E1CA 4N76A 1XN9A 3NVYA 2QWRA 4P6QA 1X5SA 1JLEA 1U47A 2HBMA 3MUMP 3M8WA 3LTOA 1FNXH 2KDOA 1VQLS 4QR0A 3D9BA 2J9CA 1K73O 4M63C 3AQOA 1M90T 1FT8A 4U7BA 2R2UA 3S9HA 4JKCA 1N48A 3TZZA 5HJYA 4ECRA 4IKAA 4IO9L 2DITA 3B54A 3T5JA 3BF1A 1VS3A 1LXNA 4FWKA 4NWIA 1S4EA 4RW7B 2ZFHA 3A8EA 4PXBA 1W0HA 1LB2B 4QS8A 2JWKA 3QWUA 4DR6K 3LPYA 5C12A 2R8JA 4DTRA 3VENA 3H6EA 3KG1A 1MSWD 3KNGA 3ZD8A 4IO1A 2B9XA 2AYEA 5DZ6A 3W62A 2U1AA 2F9JA 1MN8A 3NNCA 4DV1J 1VSEA 1RT3A 1Q0NA 2FBVA 2LI6A 4J2EA 3JPTA 8ICEA 3CDAA 3MCMA 4K8XA 4UZCA 2FHJA 3PSTA 5HP1A 1QCKA 1YBTA 4DV2K 2BANA 4RQ2A 1RQ0A 4ICLB 3SCJE 4A62A 2V5HG 2KHVA 1F0XA 2WAQC 3ZC4A 3TUPA 4JI5J 1JMTA 2W8LA 2WZ1A 4KTQA 2JMGA 4RTFD 2F9DA 2H4WB 1IV0A 4OHXA 2HBRB 4KHUA 2M7SA 2PC6A 1ITGA 2JZ5A 1QUPA 2JH1A 4ZLNA 3G9CA 1F44A 4MF8A 3I96A 4DTNA 3GIIA 2HBZB 2P9CA 1JLFB 4ZPWR 4ZKAA 2DR5A 5DLFA 2W4DA 4HTIA 1KFSA 4OYWA 4Z2XA 1ZA2B 4JKEA 2BM0A 3FK4A 4CJLA 1VI7A 2OSQA 4QU7A 2I5HA 4UQGA 4JI3K 9ICFA 3ZZPA 3F5EA 1NSAA 4I2EA 3DI6A 1BQMA 3M6VA 3L4IA 1HW9A 3EUNA 3NAEA 2XMMA 1VIOA 1FO4A 5AQPA 2FSNA 4ATNA 1SL1A 2F8KA 4FZXC 4JV5K 2C3UA 2WBRA 2VG7B 2Q4TA 4NZ0A 1JQGA 4FJGA 2W7PA 4FKYA 4QZHA 2ZHBA 2O8FA 4CBWA 6FD1A 5KT6A 8ICQA 4CH1A 1S59A 4Z4HA 4M5KA 2E2PA 5A6PA 4LF7K 1ZQXA 3RYLA 1JALA 2IVNA 2QSWA 2HVHA 1C1BA 4GKJJ 1FRKA 2V2VA 3MR5A 2OTLS 1RKJA 2QA4N 2W55A 5KFGA 9ICOA 2YV0X 3WKEA 3MGVA 3VQBA 3WK8A 2JFKA 4H4KA 1T6DA 5KG2A 2HMIA 3L6QA 4O8KA 2IVPA 4Q7AA 1JX4A 1JLFA 3THPA 2J6SA 1U0HA 3FEZA 4AQYF 4O3SA 1JCEA 1X9MA 1HKCA 1RBSA 1J6ZA 4DU8A 1P7DA 1ZZNA 2E9TA 2MB0B 1KW4A 4PG5A 4F4YA 3D66A 8ICBA 4LFAJ 2KJ5A 3CJ5A 1IIPA 3TPQA 2E5JA 4YOUA 5FD1A 1XUPO 1WSGA 1SUQB 2DFHA 1FFUA 1X4GA 4ZA1A 3AVLA 4NL5A 2AJ1A 1Z25A 2FDRA 4EO8A 5M1KA 1CC7A 2DVIA 4DR6F 1EO1A 2PMZF 4DL3A 2QO3A 2CNNB 3E01A 4DOBA 1GX6A 4C0BA 2P5OA 5JVHQ 2K8AA 3TADA 4HTUA 3QERA 4JI2J 4I2GA 3IBCB 4EEKA 3I55N 3GP9A 5FRMA 1Q86O 2V4QA 1IUJA 3PVXA 3QSYB 2M5YA 1UPHA 1VSLA 4LRCA 1JIHA 1A5WA 1SCJB 3A8KA 3MX5A 3TP2A 3D2FA 3SZ2A 4DV2F 4FLUA 5HRRA 3FEYB 1RKIA 2W4CA 3MPDA 5AQXA 5B5EU 2HMPA 4CJSA 2A2CA 3TR8A 4IRKA 3FEXB 1VFJA 4JB3A 4O5CA 3AA2A 4OCZA 1APSA 2E8PA 2ZOMA 3T5HA 4NA3A 3KK7A 2YJEA 1CUKA 2RHQB 4RKUC 3A8YA 2MA1A 3QJLA 2YX1A 2PA8D 4CO0A 2HHSA 1RU1A 2GJFA 3QFWA 1KONA 5CYMA 1YKWA 3BH7B 4UB3A 5AKEA 4KYZA 3Q8MA 1U49A 4LVOP 4ZCLA 5T41A 2F8TA 1LAWA 3TA1A 5AQHA 4FJ9A 5ALYA 2EKYA 2V8PA 4QS7A 2MYFA 3UQ2A 5JVGQ 2GHWA 4MO5A 4DR2K 3CCTA 3MD3A 1XO0A 3PHTA 1R3NA 4JI3F 2EK6A 4C3MA 1RSCA 2AH5A 3BQ0A 3HFVA 1BHLA 4OZ3A 2KO1A 4ER8A 1ZH5A 1Y97A 1S79A 3JSRA 4F26A 1FNMA 3SCXA 3TTFA 2DNRA 4IO8A 3M1VB 4JV5F 2POKA 2V0NA 1H38A 2AEMA 3KMQA 4Q8FA 3QBCA 3H46O 1Q5VA 4NLOA 3TAQA 3QU2A 2BABA 3OTDA 3CMAS 2PYLA 3UDVA 1U1KA 4R65A 5D15A 1Q4RA 1TL7B 2ATLA 3L3FX 3IR7B 1Q9XA 2F2AB 2LMRA 3SMPA 3D67A 3TA0A 1J5OB 3B9JA 1KVKA 2RN2A 1SV0A 4LF7F 2HG4A 4WZMA 1FIQA 3GLJA 1OS5A 3SV3A 1VYAA 3LW5C 9ICVA 2HLUA 2GCFA 1SKRA 3ORYA 3H8YA 3GE1A 4K4ZA 5F3XB 8RUCA 2I7NA 1OMSA 1I94J 5KFSA 1SB3C 2WBNA 1TGOA 3RMBA 2P6UA 1WUDA 1NGEA 1X9JA 2DQNB 5HATA 4DF8A 4M5LA 2F8MA 5LSRA 1AFJA 3W66A 2EK1A 2WF6A 3NY0A 2LSNA 1F3FA 3HPOA 2Q3SA 3VTHA 1TV6A 3EO3A 4KRFA 3GFHA 3CPWR 4WYBA 1GH8A 3K1ZA 8ICJA 2CH5A 4FM0A 1FE4A 4UT4A 2HNZB 2F8EX 4CRJA 4FVUA 3RB4A 4NXZA 1HNVB 4WIIA 2BUPA 2FSJA 1R8CA 4BRKA 4DFPA 1IBMJ 3QYPA 5AIAA 1SJRA 4NEZA 3Q22A 2WCXA 4BR9A 3EPIA 3O9UA 4HLBA 2YN4A 3L4PA 4UBCA 3KZIU 1P6TA 1TL7A 2AJ0A 4ITSA 4DB3A 3ITHA 4OLOA 2L9WA 2YWEA 1SXDA 4I68A 1EXQA 1ROFA 1QUVA 4RPZA 4KX3A 1HHSA 4P72A 4IFVB 4YHHK 2FJAB 3K2PA 4FS1A 2KD1A 4P0QA 2IYIA 5T14A 3R5DA 1WF1A 2AHOB 2YMPA 3N4PA 2E2NA 2XICA 4X62J 2DGTA 3V9UA 2YX8A 4OJPA 2A40A 3EYZA 1TMMA 2AP1A 2MKJA 2H5XA 1VBZA 3UR0A 3AD7C 4ILGB 4IRCA 2B9YA 3TTCA 3AVFA 2NRRA 1KLMB 3UM9A 1ZQJA 2EW9A 4KGMA 1CPZA 1LAVA 4FYXB 2RRAA 3IR6B 5J2MB 4YVZA 2AF6A 4Q44A 4C2MA 2HNZA 2UXCJ 3I5CA 3H45C 4KH4A 4X66J 2HHQA 1HKGA 2VL1A 1HEKA 3ILLA 3CJ8A 2QB1A 2B4JA 4J9RA 1RWUA 1YIJN 7ICFA 3J7YU 4WFXA 4QU6A 5CABA 4B9LA 1G6BA 4IG3B 5IOLA 1S1XA 4NLDA 5KPRA 4DR2F 2COLA 5J2EA 1KP6A 3SV4A 3R9PA 4RW9B 3G8SA 1Q82T 3UD4P 4IFVA 1CSJA 3D6HB 2HBJA 2CYYA 3RBEA 3N79A 3QU5A 4JI6J 5BR9A 1C6VA 2HRTA 4CZLA 5M1PA 2Z1HA 5T7BA 3UN3A 2I6WA 1BWVA 4NO7A 4EMDA 1Z1ZA 2ZJ8A 2CPDA 1URRA 3MD1A 2CUYA 1YVNA 4IOXA 2V8GA 2UUCJ 3QATA 4A2AA 3BY5A 3SI8A 4JKGB 1SKUB 5L8RC 2E20A 2P9KB 4UASA 1R6VA 4JD2A 5B0GA 5J2MA 1CULB 5A8KB 3ETLA 1OVYA 4WP3A 3IDHA 8ICXA 4QOZB 2YQ3A 4FXVA 3H1VX 2X1BA 2A1SA 4J03A 1PK1A 3HI9A 1MNEA 4XH4A 2VOOA 2VODA 3QT6A 3OTQA 1HNIA 3MEGA 1FRIA 5DS7A 2ILYA 4ZVPB 2HQDA 2P9EA 2A2DA 2LQ8A 4RQNA 4G1PA 4MIBA 3LGNA 4IG3A 2IVYA