4DS4A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mn2+
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 201
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds4A01
2KFNA 3CFPA 5HBMA 1EXNA 7ICRA 4CEZA 1ZQXA 2FMQA 4B9LA 3H8WA 3BGRA 3LP0A 2YKMA 4N41A 3RWUA 5KFQA 4FJ9A 2EX3A 4IQVA 3NF8A 4I2PA 3PMNA 5KI6A 1VRUA 4RNMA 3ZDCA 2KZZA 3OS1A 4DU1A 1XS9D 3V9XA 4BGDA 1DLOA 4Y1DA 3BQ0A 4KHSA 3HK2A 3ULDA 4YR2A 2JZBB 2DPJA 1BIZA 3ZD9A 2AGOA 1NK8A 1YTUA 1EETA 5C5JA 4KTZA 4JWMA 2W9CA 3NF9A 4CGJA 4FJLA 4HCBA 3M9MB 4YMMA 4M3YA 2F1HA 3OYEA 5KFXA 3DLRA 4I9LA 3UPQA 4IFVA 4G1QA 2BPCA 5KG4A 3RJFA 1CUKA 4M3ZA 3BQ1A 2BR0A 1MQ3A 2UVVA 3ITHA 4I29A 1LV5A 1HUOA 4C8MA 3DRSA 3PO5A 2D0BA 4CJWA 3NFAA 5KFOA 4TQSA 1UA1A 5C25A 1ASWA 5KG0A 1JL1A 3AVGA 3G6YA 4QZCA 4B9NA 1EXQA 4PQUA 4DTUA 4DL4A 4CJKA 9ICEA 4F4XA 4BE1A 1ZQHA 4CJQA 4QZFA 4O5KA 5J0PA 3KTQA 3TAEA 3MEEA 2VA2A 1BI4B 3TQ1A 4RW7A 3SCXA 4DSIA 4CIFA 4RQ4A 1T05A 5KFJA 4C8LA 4CGDA 5L1IA 4E7IA 2AQ4A 1ZQAA 1Z26A 4CGHA 3QESA 3LP2A 4FS2A 3I0SA 1X9MA 5SWMA 1QLNA 3H4BA 2YKNA 2XCAA 8ICNA 1WCNA 3G6XA 4DTRA 3HX0A 5KG5A 3OYFA 4KHYA 4OLBA 4UB5A 2AQ0A 4DTOA 4R63A 4ED6A 4BACA 4KV8A 2P51A 1IKXA 1BGXT 3B6PA 2AGPA 3ZT3A 3NBPA 3Q8MA 2UVUA 4W5QA 2W9CB 4IRDA 1ITGA 3SPYA 5DBAA 3ZDDA 2RPIA 4J9KA 1S6QA 4F50A 3B0YA 5HROA 4ZTJA 3IM1A 3SUOA 2C2RA 4UAWA 2BE2A 3K58A 3TAQA 1ZQSA 5KT5A 1A76A 5HP4A 3OVNA 5HRSA 4CK3A 1J9AA 3QZ8A 2R8KA 1JLAA 4EZ9A 4DWIA 4M9HA 3OJSA 4FK0A 3AVNA 2W9BA 2GWSA 3OYNA 5CWRA 1C1AA 2KN7A 3LP1A 4FJ7A 3RJIA 2DPIA 4JK1A 5DDYA 1HQUA 4YNQA 3V1OA 1ZQUA 5HNKA 3ISNC 2ETJA 1NK7A 4FLXA 5DG7A 4QWAA 4UBBA 3EPIA 4CFAA 1EKEA 1T4GA 4PWDA 3DOKA 3MR3A 3QETA 4KI4A 4BE2A 3RJJA 5CB1A 2BCRA 4ELTA 3PMLA 4PHPA 1B92A 3PV8A 2RDIA 4LZGA 1TKDA 7ICJA 2ZUCA 3NHGA 4CJRA 5J0RA 3BJYA 1ZQCA 1GOBA 1L3UA 2ASDA 1VSEA 2ZTEA 3V72A 1REVA 4RPYA 1UT5A 3L8BA 3O4QA 2GUIA 1K1SA 2C28A 3KHRA 4E19A 4AHTA 5DBCA 1I3AA 1VSJA 4RT2A 2NUBA 2XY8A 1D9DA 2HNDA 3CYMA 4NLZA 2ATQA 1CZBA 3KJVA 4QZDA 3V6HA 4RQ5A 4EBCA 1H38A 2RDJA 4DTPA 8ICCA 3PW7A 2KZ3A 2IHNA 1U04A 2IC3A 4ECTA 5DG9A 1JLGA 3QLHA 3C5GA 3BQ2A 4PHAA 4QWEA 4O55A 2FPMA 3ZSQA 2HHVA 8ICMA 1HJPA 1WSGA 4F3OA 3O3GA 4QWDA 2BGWA 7ICUA 2HHTA 4OKKA 3DRRA 2DFLA 1ZBLA 3NCIA 4ED3A 9ICPA 1YTAA 1Y97A 2QKBA 4ED2A 2BCSA 4IBNA 3VQ8A 4FBUA 4EP4A 4E7HA 2A1JA 2BPGA 1RTIA 3MABA 3AVJA 4AHVA 3OYJA 2IDOA 3S3NA 4W5RA 3C1ZA 1SL1A 4DTJA 4YD2A 3NH1A 5DK5A 2OZSA 4M47A 2FBTA 1HYZA 1RTDA 4NXZA 2BDPA 3KHHA 4RW6A 3VQQA 1VSHA 3E01A 2FBYA 2KZMA 2MUTA 2ZD1A 4YP3A 5J2FA 4QZ8A 3EY1A 3JPNA 3RMDA 3AO3A 3LAKA 3AVLA 3LZJA 4EBDA 1WNSA 3GIIA 5SZTA 3TABA 3RB3A 2HW3A 3EWAA 5HRNA 2OPPA 2X6NA 1Z3EB 4IQTA 4DQPA 4UB3A 2HNYA 4HVJA 1DGSA 3DLHA 2XHBA 5KT7A 4M3UA 4OPJA 4UAZA 4BWMA 1LAVA 5DLFA 3AA3A 9ICIA 1DTTA 3HVTA 4RPZA 3PW2A 1HRHA 3MDAA 1UA0A 4LSNA 4N56A 3PR5B 4F5NA 7ICNA 5KGWA 3M9NB 3NGZA 3TARA 5J0SA 5KFWA 5KFEA 3KLHA 1HMVA 5J2PA 3PW5A 3JPRA 3GIMA 1X1PA 5CZ1A 2A1JB 3HO1A 1T3NA 1T8EA 4QZ9A 4FJMA 3NGDA 3V7JA 4EYIB 4CJ3A 3ZT0A 1ZQJA 4QZGA 4MFFA 4JV2A 3KK2A 3RMBA 4Q5VA 1AROP 2ZJ5A 4NCAA 5J2IA 3GQCA 5IIKA 3VA0A 4RZRA 4M9NA 5JS2A 2IA6A 4M3XA 3Q8PB 1A5VA 1LB2B 4Z6EA 2F96A 5CY4A 2FPKA 2PXIA 4GXIA 2X74A 5J2BA 1C1BA 1D8YA 2OA8A 2ATLA 1VRTA 3SUNA 8ICBA 1QSSA 5J2HA 1ZQPA 4KB0A 2FBVA 2PYLA 8ICKA 2OPQA 1ZQBA 1RTHA 3ISCA 4I9QA 3RRGA 3LZIA 3L3UA 3KLFA 3NF7A 1TK0A 1ZQNA 3HXMA 3K4GA 3PW4A 4B9TA 4E3SA 4FO6A 1RYRA 4DSLA 2Z1GA 4RW8A 3JPPA 3Q8LA 4W5NA 3SV4A 2P1JA 3T5LA 3OYIA 4DSKA 5J2AA 3ZSVA 4Z4HA 4FJJA 4ECZA 1KLMA 3IS9A 4CJVA 1RDAA 4J9OA 2FBXA 2VWKA 1ZQQA 2ZJ8A 3S9HA 4RU9A 1TVAA 1RBSA 4O44A 3WNFA 4AHUA 4P4MA 3AU6A 5J0XA 5HMMA 4CESA 4ZH4A 3AO1A 9ICSA 4EZ6A 4ECRA 4AILC 4F92B 1ZJMA 1NJWA 5DB8A 1BPZA 4K4IA 8ICSA 4OVLA 4IKFA 2R8JA 1A77A 5J2DA 2JZBA 4P4PA 1RPLA 3O4NA 3THVA 4G3IA 3SI8A 1RT6A 2JEFA 4DQRA 4O4GA 3DM2A 1WSIA 1IM4A 4B9UA 5BOLA 5C42A 4ID5A 1FKOA 4RW9A 3VQCA 1WSEA 1ZETA 4DOCA 2BCUA 4RQ7A 1WSFA 3LWLA 3DRPA 1S0NA 1SV5A 4IRCA 3PO4A 2ASJA 2G8FA 5DGAA 3OYCA 3V1RA 4FLTA 3RH5A 4DMNA 4PUOA 3KIOA 7ICTA 3LPTA 1BPXA 4K8ZA 3JPTA 4AHCA 1Z25A 4E7JA 3L2QA 4ED8A 2BQ3A 1NK9A 2EHGA 2ZJAA 1RBUA 2E6LA 4FJHA 4KMUA 7ICEA 4ZHRA 4FVMA 4CJFA 1TKZA 2FLPA 1XSLA 2PY5A 3BDPA 3AV9A 3TWHA 4RQ6A 4DEZA 3KKRA 4DFJA 1O1WA 3K57A 2FC0A 3H8JA 1HUZA 1JXBA 4DL5A 3SNNA 5TZVA 1HNVA 2VA8A 4OLAA 4GXJA 1A5XA 4HUFA 2XC9A 4BDYA 4FM0A 2NRWA 1Q9XA 4CF8A 8ICYA 3TR8A 4CJUA 4DFKA 4XRHA 3NH2A 3HPOA 2C22A 1RT4A 3U3GA 4OPKA 3SPZA 3E2EA 2FMPA 4NLGA 1BCOA 3ZSWA 3K59A 4M41A 4KLOA 4E7LA 4DLEA 3KD1E 1C0MA 9ICBA 4RT3A 2MAXA 5HHHA 4C8OA 3OYBA 4QW8A 4NLKA 3V1QA 2ZTDA 3H4DA 3AA4A 3GILA 1NK6A 1RT7A 4OGEA 4I2HA 2PFNA 5KG2A 7ICVA 4NLNA 4O5CA 3ZSXA 4L8RB 1TL1A 5DBBA 4M3WA 3SQ0A 4F5PA 1NK5A 8ICGA 1NK0A 4PHEA 5DKWA 4UB2A 4R64A 3PY8A 5DG8A 4KHUA 2B6AA 1RTJA 1S1TA 4F5RA 2BCQA 3V81A 3OY9A 2X78A 2QKKA 3MR6A 5KGXA 4YR0A 4JLHA 3G10A 3L3VA 4J2AA 4PGYA 2F1JA 4CHYA 1IO2A 1K1QA 1S77D 3C95A 4MFAA 4QCLA 3P1GA 4MF8A 1YVUA 2W8KA 4CF2A 3RJGA 4IRKA 4O3OA 2R8GA 1BPEA 4QWCA 4HTUA 1N5YA 4Z6FA 1C0UA 1ZJNA 3HT3A 3MECA 5KFYA 1S1XA 1WLJA 1T7PA 1S1VA 3TFSA 3LDAA 2FLLA 4Z6DA 5D4BA 4FCYA 4FLYA 3B6OA 3CQ8A 3QEPA 1QSLA 2IOCA 5KRTA 4ELUA 1NJYA 2P6RA 1ZQLA 4DTSA 1TGOA 3NF6A 4I2DA 3OHBA 4E89A 3AVBA 3C21A 2RF2A 4FJXA 7ICPA 4DS5A 1TAUA 3K5LA 3KHGA 4TUQA 4CF9A 2E4LA 1MSWD 3HW8A 5J0OA 3EZ5A 3AVIA 4QZHA 3T5KA 4C8KA 2HHUA 4RQ0A 4IG0A 4RNNA 4CEQA 3V6KA 4Q8EA 1B22A 3V6DA 3TAPA 4NM2A 1VSMA 2BHNA 4KLUA 1T03A 4KLEA 4F2SA 1XSPA 4DL2A 3C2KA 1S0MA 1RCHA 2YHBA 4FW1A 1FK9A 2GV9A 4HUGA 5FRMA 3TAFA 4KLQA 2HMIA 3TANA 2W9AA 1KVAA 5KFGA 2JLEA 1ZQVA 3OSPA 7ICIA 1S5JA 4KO0A 3L2RA 1S6PA 4EYHB 2WOMA 3G6VA 4DU3A 3AA2A 4KITB 4DOBA 4DSEA 5KFLA 4TUSA 2KFZA 1K6YA 3UQ2A 5KFUA 8ICLA 3OSNA 1RDDA 3C6UA 3P83D 4Z4IA 3RB0A 4DL3A 4YG2A 4F4WA 4MQ3A 1NOZA 5T7BA 1RBTA 5KT3A 3ASMA 3ZCMA 2AGQA 4M04A 3VQ4A 1B43A 4KHQA 5I3UA 4CEAA 1RT1A 4CEDA 5D46A 4YFUA 4FZZA 2J6SA 7ICLA 4RUCA 4OKJA 1XHZA 2W42A 1SZPA 1BPDA 2JGUA 1BQMA 3GV8B 4KLDA 2D0AA 1KDHA 2DTUA 4CJ5A 2R8IA 3DLBA 3V9WA 3DI6A 3ZDBA 4R8UB 2P5OA 1ZQWA 1ZQIA 1BHLA 1VSIA 1I39A 2YNFA 4EP5A 3C94A 4YVZA 1EP4A 1RDCA 1V9PA 3V4IA 3ZDEA 3LDSA 9ICCA 8ICZA 3LANA 4NCBA 4YXMA 4ECYA 3RAXA 3C6TA 3QEVA 3H7IA 4RPXA 4KTQA 1RZTA 1NJXA 4B9SA 4B9MA 3S3MA 8ICPA 9ICVA 4QW9A 1S10A 8ICAA 5F9NA 5HRPA 4DU4A 2Q0ZX 3RJEA 1KVCA 5J29A 4B8AB 4PA1A 3OYHA 3AVAA 4FJ8A 8ICUA 3ETLA 4HYKA 5C24A 2G8WA 1L3SA 1SL2A 1KFTA 4NCGA 4RG8A 2D5RA 7ICKA 5KG3A 3U6FA 9ICJA 5CHGA 4KHNA 1QTMA 2Q3SA 3C5FA 4K8XA 3JPQA 3KD5E 4W5TA 9ICHA 4KLSA 2DFFA 3V7KA 2HNZA 4J9LA 4I2JA 1ZQFA 1ZQZA 3GIKA 4F91B 3AO4A 3MFHA 4CF1A 5KFMA 3PX6A 4NYFA 4FLVA 4EEYA 4KLTA 2XGPA 1KSPA 5KG7A 3SJJA 4M3RA 3VQAA 4F8RA 3AVHA 4LZDA 2B4JA 3EW9A 1SL0A 1RYSA 4IFYA 5KFAA 2ISPA 1YT3A 3RB4A 4CK2A 4CHQA 3JSMA 4FM2A 4JS4A 3SZ2A 3ORYA 4QAGA 2XY7A 3HJFA 5IIJA 5L1LA 5KRSA 3SUPA 1ZQYA 5K14A 4ICLA 1N56A 4DO9A 5J1EA 4M9GA 2P5GA 2F8SA 3PX4A 1SKWA 4C8NA 7ICGA 3F9KA 3RMAA 4LVSA 3RR8A 4DF8A 3H40A 3MEDA 4Q0BA 1C0TA 5DQHA 4Z4EA 1TV9A 4UBCA 4TURA 4LD0A 4KHWA 1S0OA 3S3OA 4CK1A 4DL6A 4M9JA 1RXVA 3M8QA 5DGBA 2VWJA 5JS1A 3MR5A 3GV5B 4F4KA 5CR0A 4R66A 2XGQA 3ZSYA 2HB5A 1SUQA 1MC8A 1JKHA 1Q8IA 4FYDA 1BPYA 4I2CA 2IBKA 3T5JA 3P5JA 4AHRA 9ICOA 5CYQA 3Q8QB 1VSDA 2P6UA 4FLZA 3M8SA 1D8LA 3C2LA 5KFCA 1LAWA 3OGUA 7ICOA 9ICGA 8ICXA 5CP2A 4YCXA 2I9GA 4CGFA 3HYFA 3MGIA 2C2DA 4KLLA 2Y1JA 3GV7B 1S0VA 3AVCA 4M6WA 5KFFA 5KFPA 1S9EA 2RN2A 5IIOA 1KFDA 2DY4A 4FLUA 4TSXA 4CE9A 2QK9A 3ZT4A 3SI6A 4I2FA 5KFDA 1ZQKA 5J2EA 3O3HA 3GFKB 2D0CA 1RILA 2I5JA 3KHLA 3H8SA 3H08A 1UOCA 4FJ5A 4O3PA 4RQ3A 9ICQA 1DOQA 2B5JA 3UIQA 3K5NA 2ISOA 1JLBA 4Q43A 3AVMA 2YHAA 8ICFA 4Z0UA 1HPZA 4BE0A 4YQWA 2VG6A 1EX4A 2BANA 2HHSA 3EYZA 1RBVA 3MXJA 4DQIA 1Z00B 4KLHA 2WTFA 1S9GA 4CECA 3QEAZ 1C7YA 1BISA 1UAXA 4CEEA 2UVWA 5J0WA 4IQUA 1CLQA 3RTVA 3K2PA 2RKIA 5CZ2A 1QE1A 3CM6A 4FLWA 4F93B 2UVRA 2XY6A 1BPBA 4K4HA 5EWFA 5BPCA 3M9OB 3CFRA 5J2MA 1S76D 4XA5A 4EBEA 5J2QA 2VG7A 3CFOA 4O0IA 2IGIA 5KT4A 4RQ8A 4DSFA 1NJZA 1LW0A 4FJNA 4J2EA 3FDSA 1XHXA 2PI4A 4Y1CA 4DS4A 4YR3A 4KLIA 8ICWA 3KK3A 8ICEA 2BQRA 4FJIA 4M6WB 2A1SA 1JLCA 1ZBUA 2F1IA 3AU2A 5D49A 1BL3A 4J9NA 2HVIA 4GC7A 5JUMA 3DYAA 1KTQA 4CJLA 2B21A 3NDKA 3ZSOA 5CA7A 3QEWA 1ZQGA 2C2EA 9ICFA 4DFPA 4YXJA 1HNIA 2YNGA 4GVMA 1X9SA 4XIUA 4PHDA 4YMOA 4CHPA 3SQ2A 1U49A 2G8HA 3UXOA 5J0UA 3HP6A 4MEYA 1KFSA 5J2CA 3MGHA 4NM1A 4HCCA 3JPSA 2AU0A 4I27A 2DFEA 5DLGA 2KTQA 4NY8A 4FBTA 2OPRA 5I42A 1XC9A 9ICLA 1UWBA 1JIHA 3D45A 4CHOA 4GW6A 5DDMA 4KAZA 4M0AA 1JLFA 1L3TA 2LSNA 3HPHA 4O3SA 5KFHA 4ED7A 1RT5A 3OYDA 3MAQA 1GOCA 3LPUA 4I2EA 4CJTA 4J9SA 1KCFA 4ID1A 2P66A 3TAGA 1MU2A 7ICFA 8ICVA 5E41A 4ECUA 4I7FA 4BXOA 3I0RA 1HQEA 3RMCA 3MR2A 1TVRA 2I1QA 3KLGA 4R65A 2V4RA 3GDXA 3SYZA 4IQWA 2YNHA 4JRPA 2PFQA 4FJKA 4Q45A 3T3FA 3N97B 4I28A 8ICIA 1WAFA 4J9MA 3HVRA 4JV0A 3V9UA 1RBRA 4YMNA 4M3TA 1JX4A 3NH0A 3NGYA 3LP3A 7ICQA 1JLEA 4B08A 3MXIA 9ICXA 2NRVA 3RBDA 3CM5A 3PW0A 2WONA 4FXDA 3K75D 3TI0A 3OYKA 3RJKA 3QERA 3LALA 4CCHA 1LWFA 1D5AA 1LWCA 2R8HA 4TQRA 4IR9A 2YV0X 8ICQA 1J53A 4TUPA 4LH5A 4O9MA 3RB6A 1IXRA 3QIOA 4HUEA 1RXWA 1IKWA 1KVBA 3AA5X 3QIPA 4FJGA 1LWEA 4LH4A 1S1UA 1IKVA 8ICJA 3VQ6A 1U9LA 4ECWA 5KFBA 4R8UA 3OYAA 4Z4CA 5EU7A 1TKTA 3VQEA 1WSHA 4JS5A 4ZTFA 5L1KA 5IIIA 2HVHA 1RT2A 5DQGA 5FRNA 3VQBA 4CF0A 2J6TA 4M42A 3M8PA 1JL2A 4DSJA 5L1JA 3PVXA 2ALZA 4BXOB 1IKYA 2PI5A 1BIUA 4CJEA 3NTUA 5EWGA 4ECSA 4UQGA 5DQIA 4I2GA 4E0DA 4KLMA 4P2HA 3F73A 4YFKA 2DFHA 3KKSA 4UB1A 2IHMA 1G15A 4PGXA 3IAYA 4I2IA 9ICUA 4I2QA 4P4OA 3FYHA 3AUOA 3HL8A 4M2YA 4PY5A 5DB6A 4OGCA 3QEIA 5IIMA 3RJHA 1QS4A 3MXMA 3N4MB 5IINA 3VQDA 3SUQA 3EPGA 3WNGA 3SV3A 3MDCA 1JN3A 1WCLA 1XO1A 1XI1A 2ITGA 1D9FA 4E7KA 4O5BA 4RQ1A 4OKEA 1U47A 4GC6A 2HHXA 4Z4FA 3NE6A 4UB4A 3OS0A 2W8LA 2FMSA 4H4OA 4PGQA 4FZYA 2QXFA 1X9WA 4RUAA 4B9VA 4Z6CA 3NAEA 4QZEA 4LY7A 3ZT1A 4N76A 4GXKA 1U45A 5KT2A 4W5OA 5HLFA 3NGIA 1SKRA 3L2UA 3A2FA 2NRZA 2VANA 2XCPA 4M9LA 1B9DA 1QQCA 4F3TA 1S9FA 9ICNA 4XQ8A 4J2DA 1C6VA 4MEXA 3ZDAA 3ZSZA 1U4BA 5KFRA 2KW4A 3KK1A 2ZUDA 2ASLA 4JV1A 4Z4GA 4AHSA 3ZT2A 5KG1A 4BWJA 3DLKA 2FLNA 3L2VA 3JYTA 1GOAA 1NOYA 2IS3A 1RNHA 4CJPA 3OYGA 3QO9A 4FK4A 5HP1A 5KTQA 5HHIA 4F4ZA 1CZ9A 3K5MA 3VQ5A 2Y1IA 2NRTA 4DTXA 4GMJB 5HRRA 1CEZA 5KFNA 1ZBFA 3IG1A 4Q8FA 4I2BA 2PFPA 1L5UA 4FZXC 2ZQBA 1HYVA 2W9MA 4XUSA 4FW2A 2E6MA 2HHWA 1XU4A 3AO2A 1KEJA 2PZSA 1PZNA 1VSKA 5IILA 1VSLA 4KN4A 4KKOA 1W9HA 2ZE2A 4RW4A 1FKPA 2G8VA 1LW2A 1Y88A 3HM9A 1BVSA 3VQPA 7ICMA 2H5XA 9ICRA 4BDZA 1XWLA 1KLNA 3ALYA 3QZ7A 3T5HA 1W0HA 4DL7A 1RDBA 4B3OA 4PH5A 4ED1A 1QSYA 1L3VA 4Q44A 4F4YA 2Z1JA 3M8RA 2V9WA 3SQ4A 3OJUA 3RRHA 3Q8KA 4KLJA 1ZQDA 2W9BB 4IDKA 3G0ZA 3T1AA 1COOA 2ZTCA 2ZUBA 4PPXA 5KFVA 3GIJA 2JEJA 3Q8SB 3VA3A 3UXPA 5KFSA 1ZQTA 4FM1A 9ICKA 3QEBZ 1DTQA 2OZMA 4E1MA 1R0AA 4DTNA 1QHTA 4YD1A 2OWOA 4I2AA 1WAJA 4JUZA 4CGIA 3QE9Y 2XO7A 4BDPA 4KRFA 4J9QA 3V9SA 4ECVA 3FFIA 2R7YA 4KB1A 4DQQA 1C1CA 4KREA 2PYJA 5EOZA 3U3YA 3LAMA 2O4IA 2BKEA 2LYHA 5DB9A 1CXUA 3Q8RB 2BCVA 3TAMA 4RNOA 4H4MA 1TV6A 4F5OA 1JLQA 1FXXA 3DMJA 9ICMA 3WNEA 3RR7A 3DOLA 8ICHA 5J0QA 4E1NA 1U48A 2BPFA 1VK0A 2V4QA 1TK5A 1JMSA 4IR1A 5KG6A 4DOAA 1TAQA 4CIGA 4GLXA 4CEBA 3QINA 3AVKA 2XY5A 1NKEA 7ICSA 1WSJA 3VQ7A 9ICAA 4CERA 3C2MA 3RAQA 3OHAA 1ZQRA 2NRXA 2A1RA 4DFMA 2Z1IA 4M45A 1N6QA 3QNNA 4DG1A 3LWMA 4CFCA 2O4GA 4QZBA 1B9FA 4KFBA 4MFBA 4O3NA 2YNIA 3VQ9A 1ZBHA 1Z00A 5FDLA 5DMRA 4DTMA 3PUFA 3ZSRA 4RQ2A 2M9NA 2IAJA 4KTWA 1NOMA 3PR4A 3HSTB 4CIEA 4O3RA 3D0PA 3BQTA 4QOZB 1XSNA 3RBEA 4J9RA 2AJQA 4CJ4A 1JXEA 5J2NA 2PFOA 5J2KA 2G8IA 4R5PA 4ECXA 3DLGA 5J0TA 4KI6A 3UXNA 9ICWA 1RT3A 3HPGA 3WNHA 2KQ2A 4WE1A 5FROA 4J2BA 4CEOA 4JRQA 3DLEA 3KLEA 4DF4A 4F2RA 1SKSA 1TL3A 1ASUA 2MUTB 3O3FA 3HWTA 4CHZA 1ZQEA 2BGGA 1F21A 5KFIA 4KLGA 3ISBA 3AVFA 1HJRA 1S1WA 1NKCA 4K4GA 4CHNA 3MBYA 2OPSA 3PX0A 3C23A 1VSFA 3CG7A 5BOMA 5L9XA 4X5VA 3AO5A 3V7LA 4J9PA 4MFCA 5HMLA 1A5WA 4HHTA 4H8KA 4KPYA 4QWBA 5DB7A 1BCMA 7ICHA 4FS1A 4N47A 1ZYQA 3TFRA 4KLFA 4NYNA 9ICTA 1ZQMA 1ZBIA 1TFRA 1ASVA 4ELVA 1N48A 2F8TA 3UQ0A 3OYLA 4OJRA 1JXLA 3HP9A 5KFKA 1CXQA 3QEXA 4YN4A 4CEFA 4AH9A 4UAYA 3ZD8A 5KFTA 3LK9A 3T19A 3ISDA 2XRIA 5D3GA 3V9ZA 5CJ7A 3B0XA 1S97A 4QZAA 4O0JA 5J2GA 2IMWP 5CYMA 4LSLA 2Z1HA 1J54A 4CGGA 2BQUA 3SQ1A 5EWEA 8ICRA 1ZQOA 3QNOA 2FPLA 3OYMA 2HHQA 3MFIA 3MEGA 3RH4A 4CFDA 4ECQA 4IG3A 1BQNA 4KN7A 4O5EA 1IH7A 4N5SA 3C1YA 2GBZA 5J0YA 2J6UA 5KFZA 4CJSA 8ICTA 4FK2A 4O3QA 2OYQA 2JEGA 4QZIA 3VN5A 3PNCA 1IG9A 1KRPA 1TKXA 3L2WA 5J2JA 3V6JA 4F5QA 1TK8A 4CFBA 5F9LA 4ED0A 1MQ2A 3IHQB 1UT8A 3K5OA 3KLIA 2G8KA 3OS2A 4B8CA 2G8UA 3IRXA 1WN7A 1NKBA 1X2IA 4JWNA 4DLGA 3RH6A 8ICOA 1BI4A 1Q9YA 1J5OA 2VA3A 2JEIA 3I8DA 3JPOA 4DQSA 2X6SA 5KT6A 2VG5A 1NK4A 4MF2A 1HYSA
chains in the Genus database with same CATH superfamily
3UVJB 3S41A 3RSEB 3K8WA 3Q0AA 4KPCA 2DNZA 2FMQA 5D3GB 2Y1RI 2YCHA 5H2FU 4O44B 4N41A 4WK3A 4IOXA 3RWUA 2OJ3A 3RYLA 4IQVA 3NF8A 2I5HA 2D7SA 3EX7B 2FHMA 1VRUA 5AR0A 5E84A 4DU1A 1MN7A 3H8MA 4BGDA 1VQYA 1PIEA 4H0OA 2DPJA 2D41A 3CMQA 2AGOA 3K8VA 3GFZA 4TU8A 4KTZA 4JWMA 5LMNJ 3NF9A 3D6MB 1ZXOA 1XR7A 2F1HA 2PD1A 3OYEA 3N5FA 2MQOA 2VBWA 1GLFO 4NMLA 4ID5B 4KH1B 1B0VA 4B17A 4A62A 4RW9B 2EAPA 3TRGA 3UPQA 2HDOA 2QMXA 4DCJB 3PIOQ 4D3HA 2OTLS 2VUGA 2DXDA 1CUKA 1OW5A 4EK2A 3HOSA 2BR0A 2UVVA 2E9RX 1LV5A 2YTCA 5C25A 1ASWA 2F9WA 4FWKA 5HQLA 1HR0K 3JSYA 4B9NA 2QA4S 9ICEA 2B9WA 3DDIA 4NXMF 4BE1A 3K89A 1TKZB 1BNOA 4O5KA 1SWVA 5D78A 5J0PA 3KTQA 5AQNA 3WKAA 3QUQA 3NVMA 3K5PA 3SCXA 1KVKA 1URRA 2IVOA 4HT5A 4QU7A 4BJQA 3WT0A 1VLBA 4E1JA 3R8EA 4CIFA 4JKEA 5TISU 2E1AA 1OY9A 4E7IA 1WF0A 4OD0A 4RUBA 5SWMA 1RT4B 3EVWA 1HD0A 2XCAA 1QQ5A 8ICNA 4NRTA 1M5HA 4DTRA 1HNXK 4OZJA 3D6HB 2AF6A 4MTPA 4FWOA 4KHYA 3OBWA 4OLBA 2KIWA 4UB5A 2NQPA 1FWLA 3SCIE 1NHVA 5IWAF 5JVHQ 3L3CA 4HH1A 4I64A 3MCAB 3CP8A 2E1FA 3B6PA 5D6GA 3ZT3A 5BYRA 3NBPA 5B66U 4ILLA 2XS2A 4W5QA 2W9CB 4IRDA 2V6AA 1RT7B 3TR5A 1ITGA 1ZM2A 1Q53A 3ZDDA 3CC2N 4BUGA 1RADB 3HRGA 3B0YA 5HROA 1H98A 4TN2A 4IFVB 4UAWA 5AQKA 4CLUA 2E5LJ 1SJRA 5GTIU 3LM2A 4CK3A 1J9AA 2C3UA 5HL7L 3EUNA 1LK7A 3LGNA 4C3KA 3TPQA 2CPHA 4CLFA 3OYNA 2NUHA 1FX2A 2Q0RA 3DFEA 3LP1A 4HTIA 4JK1A 2HAFA 5LOQA 5HI7A 3THXB 2VFSA 2ETJA 1J97A 1NK7A 4UY85 1X40A 4UBBA 2FC9A 5BYQA 1Q0NA 1H2VZ 2IVYA 1X4CA 1NGAA 3FKBA 2IY5B 4KH5A 3OTQA 1ACMB 3HI9A 4ELTA 2DR6A 3UNGC 1B92A 4LZGA 1ZPWX 3LP2B 3NHGA 3J7AP 5J0RA 1ZQCA 4WU2A 2R2SA 1GMWA 2EK6A 2ASDA 2FLOA 5J8YC 3ELHA 2VDIA 4DUTA 4K5RA 3L8BA 1N61A 3Q7BA 5ALYA 1K1SA 3KHRA 2K1RB 2RP5A 1SV4A 2PN6A 1RWKB 4KV8B 4IG0B 4AHTA 2M8HA 3UD3P 3THYB 1CS4B 2KV2A 2H4YB 1VC5A 2GWKA 4V1Ak 1Y10A 1CZBA 2GGPB 4AD6A 4EBCA 1S6QB 1H38A 1HWIA 2EFOA 4DZ6A 3LTOA 3UN2A 1FK9B 2HGMA 2HF4A 1U04A 3NOCA 4YORA 5EE9A 2HFSA 4O55A 2HHVA 2BH1A 4F3OA 7ICUA 4OX9F 1S6PB 4OJ1A 1K73O 1ZBLA 1J5EK 1JROA 4Y2VA 5DDQC 2VQEF 3QT6A 9ICPA 1YTAA 3GG1A 3TKAA 1OS5A 2BCSA 3BR8A 4IBNA 5AZIB 1H3DA 1ZOLA 1EJ7L 4H4KA 4WCEL 4EP4A 4E7HA 1Q7YO 1QQNA 2BPGA 4AHVA 3OYJA 2IDOA 4YD2A 3KMSA 5JVGL 3HDSA 2X1FA 1G4CA 4XO0A 4KQZA 4PJ0U 4DR4F 1UJ4A 3OTEA 2K8CB 2A0FB 1T9VA 1M90O 3KHHA 1VSHA 4RWWA 4YMEA 4GV9A 3PSFA 4K43A 3HX9A 4YP3A 2O8BB 1K9MT 4M5LA 1C4CA 4FL9A 3LAKA 5I9EB 2G4BA 2H3IA 1VJWA 2I9SA 2PA3A 2YNFB 1IWAA 4ZOHC 4BC5A 3AD7C 3VGLA 3G8QA 2OPPA 1CG2A 1PBUA 2RHSB 2QW9A 4CYUB 1DGSA 1RWMB 3KUEA 4YY3K 4M3UA 1X5OA 1OSDA 2MZQA 3AARA 4EX7A 3H25A 1F6TA 2DKOB 2NLXA 9ICIA 2Y3YA 2DRAA 3L4BC 4X4SA 1HRHA 4BROA 3MDAA 4LSNA 4OYOA 3IG5A 4HH0A 4A8SA 1IBKK 3OR2B 1Q1KA 3C16B 2JZ5A 2V8DA 5KGWA 3DKDA 2D1KA 4DV0F 2FVRA 3GJTB 2CAJA 3B78A 3M4XA 4L72B 2A18A 1FFVA 3PNIA 4X4VA 2EEYA 3PW5A 3JPRA 5GIOA 1X1PA 2DQNB 2ZGZA 3HO1A 1UVLA 1Y64A 3CC2S 4EYIB 3KUHA 3BUZB 3SEIA 1ZQJA 3LDPA 3POTA 2C42A 3KK2A 4ZCLA 4Q5VA 4JI6J 2ZVSA 3UKUB 1HEKA 2CGKA 3TP2A 2I8EA 1AROP 3WIVA 1T0TV 2K3KA 5J2IA 3GQCA 3VA0A 4EELA 4M3XA 3SMSA 4NI2B 1HNWJ 2D3UA 4DPYA 3D9BA 3BB5A 1UTAA 3UKRA 4QYRA 5CY4A 5H9FK 4HACA 3CDWA 1SPBP 2X74A 3UE5A 2ZM6F 4HDHA 4B1WB 3P38A 1QSSA 2QZ8A 2P9KB 4N7TA 3O6QA 5AFUA 2BBEA 3I82A 5KAKA 4MYTA 2HQFA 5EGYA 2Y0SF 2BUNA 3NNAA 3L3UA 4U6PA 1TL4A 5T7LB 4E3SA 4U7UD 2MRLA 4KX3A 3CJ7A 4W5NA 2P1JA 2X3DA 3BBCA 1HQ2A 3N0VA 2EFGA 1C0TB 4FJJA 2QL5B 3IS9A 4LIRA 3FBCA 2FBXA 1ZQQA 1MMDA 3MEKA 3F9MA 1NBEB 3BM7A 3OTCA 3J80U 2HIYA 3TZYA 1O13A 2Y0SD 3P3DA 4EZ6A 2DNNA 4F92B 1ZJMA 1ZM4A 8ICSA 3R2CJ 1SUQB 1Q81O 4ILGB 4CLTA 4EO8A 4P4PA 3G8SA 4Y6IA 1P1TA 1RHUB 1U2VB 3T1YF 5C2FA 4G3IA 2QTDA 5DM7L 1RT6A 2HI0A 3GZFA 2JEFA 4PL8A 2ASYA 2NZTA 2D6FC 4DQRA 4O4GA 1WSIA 1IM4A 5BOLA 1FKOA 3CJ0A 5K8MA 3M32A 3UD4P 4DOCA 2BCUA 5AXKA 1LCUA 4RQ7A 1WSFA 1S0NA 1SV5A 3PO4A 2Q6CA 2PFFB 4OX9J 5AKXA 5DGAA 2A5XA 4BRPA 2ROEA 3KMQA 4FLTA 5J1PA 4JK8A 3RH5A 4PUOA 4DMNA 2DY9A 3WUHA 3SFGA 4PYDA 3ONNA 1BPXA 4K8ZA 2LM4A 1S9EB 5HO4A 4KAIA 3OV7A 3NWGA 4YOYA 2E6LA 4FVMA 2FLPA 2QMUB 3HHLB 3KLFB 4K50A 3TWHA 5GAHP 1R59O 1R31A 4DR4J 2LA6A 3QYYA 3K57A 3IRWP 4A5AA 1U2RA 4BC2A 3H8JA 1JXBA 2MTLA 5TZVA 3BO4A 4BDYA 1DY3A 4FM0A 2NRWA 3FC4A 1JQGA 1LEOA 4QOTA 1DT9A 4DR3J 4BQLA 4CLLA 2BOAA 3SPZA 2UUCF 2FMPA 2KD1A 4NXMK 5K4LA 4DXLA 5ALEA 4E7LA 4DCOB 4FF2A 1JNRB 5HHHA 4C8OA 4KGZB 3EKUA 3EKSA 4GKJF 4XDCA 3A13A 3R1LA 3P4IA 3DDNA 4NA3A 3CCLN 3CJSA 2Q36A 1IWGA 4KGMA 4M3WA 3SQ0A 3MN7A 3VGKA 1O0PA 1NK0A 5JTIA 4PHEA 4KHUA 4JP8A 3W5YA 3V81A 2D69A 3HSCA 2V8PA 5KGXA 4A8KA 2P5VA 2OTJN 3F53A 2LVWA 3MK6A 1S12A 4PGYA 3EZWA 4KHRA 3KK3B 5T41A 3CJ3A 3C95A 5IWAK 4KSEB 1UPPA 5AT1B 5AQMA 4URQU 2VPXB 1UHUA 4ZCIA 5H1SQ 1RCXB 2OEJA 3VTIA 4MF8A 4CF2A 2W8KA 1HBUB 4O3OA 1PBAA 2HBLA 1X4DA 3TA2A 1ZJNA 2OSQA 3HT3A 3M8YA 1WLJA 3LDAA 2R18A 1FDNA 3QGPA 4JD2A 3QEPA 1SXEA 1ZXIA 4JKHA 1QVGM 3DCAA 1WWVA 3OL9A 1TGOA 4I2DA 2NXEA 3T1HF 1D3WA 2ZWOA 3I4HX 4LSZB 3L7PA 3C21A 2RF2A 7ICPA 5ALTA 1TAUA 2MKCA 4TUQA 4CF9A 1M1KT 1RT5B 2YMQA 2E4LA 5AJ3F 5E3CA 3OUYA 2A6AA 2ZHBA 1HA1A 2HHUA 4CEQA 3MM8B 1D9AA 1VHFA 1T3VA 2KVSA 2QX0A 1B22A 3D28A 4NM2A 4I6WA 1U09A 4KLUA 1GK8A 1T03A 2V8HA 3H45C 2IPOB 1Z4NA 5D77A 1V97A 3TW0A 5EX0A 3C14B 1LQ9A 1JK9B 3TANA 4ZLLA 3H3NO 4BVOA 2DTJA 4OHVA 2I7PA 3GR0A 7ICIA 3ZZOA 1Y9OA 2E2NA 3WK5A 2HOIA 2I2YA 1T9YA 4B3MJ 1VGYA 3ISZA 1SWWA 3AA2A 1JI7A 2NR0A 3CJQA 2W04A 2G2ZA 1Y4ZB 4WPAA 1JLEB 4DSEA 1K6YA 3N5BA 4H0VB 8ICLA 3CCZA 5FLXY 3GIRA 4DCHA 4Z4IA 3MCMA 5GAEU 3R5GA 3W9IA 2R2RA 4MQ3A 3ENQA 1UZDA 3VQ4A 1PYSB 4URSA 4OL8A 4CEAA 2Z2ZA 1F2GA 2CNLB 2ZIWA 3JTPA 2NREA 4YFUA 2XSFA 2J6SA 4HL9A 4FZZA 7ICLA 4OKJA 3D2EB 5IT9U 2JGUA 1OIAA 2VQEK 2JHEA 1CRXA 2F7VA 4M5DB 4C7YA 2KG5A 3DLBA 3V9WA 3DI6A 3U27A 3ZDBA 5ALMA 3CXCR 3VGTA 2RE1A 1ZQIA 3I76A 1YWXA 4JI5J 3C19A 2MDAA 2FQQB 2GH1A 1EP4A 2ILYA 1RDCA 2E7VA 4WIIA 4C0BA 2G07A 2RLTA 3UQSA 8ICZA 3D2NA 3LANA 2HWIA 4H0XB 5BPNA 4BBYA 2RUGA 3CD0A 3QEVA 2MSSA 5K5MA 2AXTU 2RUSA 3VETA 8ICPA 4WF9L 3Q8VA 2D1CA 8ICAA 3VAFA 3GJQB 4PA1A 4GIBA 3AA9A 4FJ8A 5A2QO 4YHHF 5AI0A 7ICKA 3BEGB 2HS4A 4ACOA 3U6FA 3GYXB 3UDEA 3CCLS 1RAHB 3C5FA 1SZ2A 1X6JA 4W5TA 2HNZA 3WXIA 3W0LA 1ZQFA 2HGLA 1S5ZA 2CPFA 2EWHA 3GIKA 4F91B 1GH8A 3PX6A 2DHSA 4NYFA 4FLVA 5IOLA 2V8GA 4KLTA 2OTJS 4J5OA 2V51B 5ADXA 1JJHA 1TFWA 3VQAA 2MMYA 3AVHA 3PHTA 4DV0K 1F1BB 1SL0A 1RYSA 4IFYA 4H03B 2QA1A 4Y00A 3WKCA 3P8BB 4ZA1A 3W9JA 2DNOA 2VB6A 2R7OA 4YB5A 2GJ2A 3DLKB 2XY7A 4BRAA 1B4SA 3HJFA 1FO1A 5KRSA 3SD7A 2E66A 1KHWA 4ICLA 5HP1B 2HRTA 3QMLA 5F1XA 4ZPBA 1QAIA 4DO9A 3U7JA 4M9GA 2P5GA 3AHPA 2VU5A 4KB7A 4USTA 3MEDA 4Q0BA 1F9HA 3VEVA 4U7UK 5CH7B 2W03A 5DQHA 4DV1K 1TV9A 2ZM6K 3HKZF 3QRQA 2QA4G 4IOBA 4JI2J 4M9JA 1N0UA 2DHHA 1RXVA 3HSZA 1Y00A 5DGBA 2ZE2B 3BBFA 1KQKA 4RW4B 2FGCA 2GQ2A 2ZZMA 4Z94A 3DU6A 5JS1A 4HTJA 4F4KA 5AJ3J 1TP7A 2K4IA 3WK4A 3QFUA 4KYZA 3ZSYA 3I56N 1BPYA 2P9IB 2ZH5A 5LSRA 2IBKA 4KGKA 5CYQA 1ATNA 4DR7F 3HKZD 4FLZA 3DGPB 5ETVA 1NGEA 2JMGA 4IUFA 1YBUA 1NZAA 3CCMN 1VC0A 2CJKA 3AGKA 4YCXA 2UXDJ 3PACA 1REGX 2XHCA 5GADI 2ZZNA 2P9GA 3MGIA 1SH2A 1QUPA 2G13A 3ZTRA 2ZNYA 1NXIA 3GV7B 5JXSA 1SJQA 3AVCA 3IBCB 2GOLA 1C1CB 2DY4A 3J81O 4TSXA 3T1YK 4NV0A 1L3KA 2WTUA 1S79A 4MKYA 2W2QP 5KFDA 1IBMF 2MQ8A 5J2EA 5ALGA 2D0CA 3H42A 4ILRA 5KNIA 1FFUA 5HJXA 2XMAA 2HBYB 1UOCA 5LMUJ 2XYHB 2MKIA 9ICQA 3I32A 4FZNA 3UIQA 3W60A 3K5NA 4LFBF 3B4MA 8ICFA 4GNIA 2VGNA 1HPZA 3JTNA 3O5BA 1E6VA 1NAQA 4X66F 2H5IB 4RLEA 3BV8A 4DG1B 4UATA 2VG6A 2XLJA 4K41A 4J03A 4KFBB 3D7EO 2BM0A 4DUZF 3MXJA 3VEWA 1RQNA 1Z00B 3M1VA 4EMDA 2E1MC 4CECA 3QEAZ 5FDLB 4IQUA 1RWVB 3L9ZA 3PIPQ 3FGVA 2RKIA 4FZVA 5CZ2A 2PBDA 4Y2PA 5HR7A 2ZIVA 4DI6A 4TY8A 1BPBA 1N34F 1UVMA 5J2NB 4K2JA 3M9OB 4LR9A 2HHHF 3FSIA 5I3PA 1S76D 3BPDA 4RKUC 3CFOA 1LW0A 3KWMA 4WE1B 2UUCK 3FDSA 4AF1A 2CPEA 3KG1A 3EGZA 1YIJN 4YR3A 4I6MA 3GU3A 3DLEB 4YHHJ 2C2MB 4FYYB 1K0VA 4USJC 4FJIA 2A1SA 3ZZ0A 2F1IA 1KAXA 4ETXA 5D49A 1S8OA 4GKJK 2QWMA 1SAZA 2QLBB 4J9NA 4TNOA 3C0BA 3SMZA 2BJ7A 2L48A 3OTBA 3CJBA 3HI0A 4C23A 1OVQA 3ZSOA 1S99A 5T14A 3IM8A 1ECWA 2QYCA 1ZQGA 4DDFA 4XIUA 4PHDA 2HLTA 2G8HA 2RS2A 3UXOA 5J0UA 3HP6A 4MEYA 3MGHA 1KTVA 3JPSA 1DZ5A 2BEFA 4NY8A 2OPRA 3VOVA 9ICLA 3N9UC 4A2AA 4YDXA 1UWBA 1A0PA 4KAZA 1KHVA 1L3TA 2LSNA 4O3SA 3MAQA 4ZP8A 4ZVFA 2LKZA 4L74A 4NA2A 1GX6A 1PAUB 3T79A 2XO6A 4DUYF 3TAGA 2CN1A 3ETRA 5BRHA 3J7AN 7ICFA 2WSCC 5K8PA 2R3VA 4LSLB 3B6BA 1B3TA 1HQEA 1XNRF 2YB1A 1TVRA 5ALXA 1MWKA 5AM5A 4ZPVR 1DKGD 1WDTA 3T1HK 2MY8A 1D09B 5AQFA 2OMOA 1M1KO 3SQGB 3MEGB 4IG3B 3A5NC 2MGZB 2YNHA 4JRPA 3VCDA 4FJKA 2VGMA 2F8MA 5CA5A 2EFPA 3N97B 5AJ3K 1C0GA 3C6AA 3HVRA 3I56S 4JV0A 2XG8A 4M3TA 1PYTA 3ULHA 3PW0A 1CSJA 3GB0A 4DR7J 3LALA 2W4DA 1LWCA 4TQRA 2AJ4A 3CCMS 4IOAL 1U8SA 1J53A 1N33F 4OQJA 2MPUA 3RB6A 1KVBA 2LQBA 3QIPA 4FJGA 4Y28C 4JHDB 1SXLA 4JI7K 2F65A 2KP7A 1N60A 5I42B 1A6LA 8ICJA 2XZDB 1U9LA 4ECWA 2G5HB 2HS0A 3OYAA 4Z4CA 3VQEA 4PPDA 1E4GT 1P8GA 1SV0A 3LH2S 2V52B 2JNJA 2QARA 2KH9A 2QWLA 1QVFR 4IO8A 1YUWA 2E1EA 3D0IE 4M42A 3M8PA 3FRYA 4A4JA 4I7FB 2ALZA 4BXOB 3PFOA 3EICA 2PI5A 1P6TA 1VRUB 4CJEA 2OO4A 4NO7A 2LDYA 3OFFA 3NMRA 2R9LA 2YKOA 1IBLJ 2M8DB 2VODA 1YVNA 4LFBJ 2DFHA 4UB1A 1EAYC 2N82B 1T9UA 4LRBA 4KBOA 3IAYA 4I2IA 4ES2A 1SVDA 2HBKA 1UVIA 3AUOA 4X4OA 3GOIA 4PY5A 1RDRA 5DB6A 3MMAA 1S3XA 5IQQA 2LU2A 6AT1B 1QS4A 4XH4A 4DUZJ 2BJ1A 4U8YA 3VQDA 3A1YG 2BKOA 2LQ5A 3MDCA 1VMBA 4O5BA 4IEIA 5D15A 2AYMA 4GC6A 4Z4FA 4C4TA 1WYGA 1AXQA 2JFDA 5C25B 2JLGA 2FMSA 2E3TA 4H4OA 2ZOMA 4TKTA 2YWWA 2ZBQA 5J1NA 4B9VA 5C15A 3PSTA 2B9XA 4LY7A 4N76A 3SCKE 5HLFA 3K0JA 2UXBF 2B7CB 2QL9B 3IR6B 2CQ2A 2VANA 2KK0A 1IKVB 2VJ5A 2KKZA 1S9FA 2OI2A 3D2FA 2EKYA 4XQ8A 5AI4A 4J2DA 5ALPA 3ZSZA 3OD2A 4WBFA 2RRBA 1YITN 3CWJA 4JV1A 4HKQA 3WIUA 2U2FA 3OR1A 3ZT2A 4I68A 2FLNA 1DFDA 1GOAA 5E33A 2UV8G 4CJPA 4F3MA 4BX9C 2PE8A 3NUQA 3K7RA 5KTQA 5HHIA 3K5MA 1CZ9A 1DGJA 4MMOA 5IM0B 3TA0A 4ISFA 1HKAA 4GVBA 4OJGA 2Y0BB 3UCGA 1DARA 2LMIA 2PFPA 1XMOJ 3HILA 2OFGX 4FZXC 2ZQBA 1WC5A 1XMQJ 2BUPA 3NBPB 2HHWA 4GRSA 1S5LU 1XU4A 2O3DA 3A3NB 2RH3A 1W9HA 5GAGU 2D3O1 1IN0A 2LPEA 2G8VA 1LW2A 2BJ9A 1BVSA 3MOZA 1I3OB 2VWBA 2W55A 4JV5K 2BVZA 3UO0A 2ZXHA 3QZ7A 2K60A 1GEHA 1UFWA 1G99A 1QSYA 1L3VA 1V6HA 3TUJC 2XULA 1F3FA 3C3LA 2F63A 4KLJA 1W7WA 3KXDA 1XNRJ 4AYBF 4V19J 4PPXA 4YB6A 1HUXA 1V4SA 1N5QA 4CNYA 3GIJA 1ZOTA 5AQTA 2X1BA 4KC5A 4CE6A 4FM1A 1DTQA 2FGOA 1F0MA 4PL1A 4OZ5A 2AZ3A 1NMDA 1WAJA 3FSXA 1XC3A 2Q79A 2YN4A 1HWKA 4KRFA 3V9SA 1T3QA 3FFIA 5D4LA 2R7YA 2IM1A 1TFYA 5CABA 3S01A 1NLVA 5EOZA 3F5AA 1SC6A 2BCVA 4DR7K 2UYTA 4JI3F 1FRJA 3WNEA 1SIJA 1ROFA 3RR7A 1LFWA 4O5FA 3RJMB 3DOLA 5J0QA 1TMJA 2OFHX 3IG1B 3PSPA 5JICA 2GZOA 4IR1A 5KG6A 1TAQA 4OPAA 2HZCA 1LXJA 3TTCA 1RDUA 2ZWPA 1HBMB 3FZBA 7ICSA 3EE9A 2YQ0A 3VQ7A 1UW9A 4P9SA 3IP4B 2XNQA 2NRXA 3U9DA 2F9TA 1L7PA 3LWMA 2B9YA 1S4EA 1IBMK 4J91A 2ZJPL 4MFBA 1ZD4A 1WG1A 1HI8A 1X9XA 2J9DE 4X65F 4DV4K 3QAUA 3ZSRA 4KTWA 1NOMA 3BPSP 3HSTB 4M63C 1BQXA 4O3RA 4B1UB 3CCRN 3BQTA 4QOZB 4LFBK 2XEXA 4JKCA 1JXEA 3B82A 4FKYA 4X66K 2G8IA 4JMUA 1LKYA 3WKEA 3BKUA 4LF6F 4WWSA 2K4EA 1RT3A 3KOAA 4GY2B 3HPGA 2OLWA 2PC6A 4K4TA 5FROA 2DGSA 3MPUB 1EQYA 2DVIA 2KT5A 3KLEA 4DF4A 1MWQA 1TL3A 1OPZA 2KKPA 1ZQEA 1QHAA 3QGIA 3TAMB 1HWLA 4H4MB 3ISBA 4DL0C 1HJRA 4K4GA 4CHNA 2QLTA 5F8JA 3A3OB 2KJVA 4DHYA 4PKGA 3TVYA 1RGIA 1N34K 1FCAA 3NRZA 5BOMA 2MHNA 2HHHK 3OW2R 3O44A 2ZOFA 4HHTA 1UETA 2E8PA 5AI8A 2D9PA 5BR8F 4F0HA 2EAOA 2OPPB 5A0LA 3G82A 4QWBA 1F9FA 3F44A 5DZ7A 3G87A 1YITS 4X84A 4PKDB 5LXYA 1TFRA 2ZXIA 2FXUA 4BS2A 1ZRMA 4ELVA 2QV6A 2F8TA 3UQ0A 3OYLA 4LSNB 5KFKA 1CXQA 2HMXA 3QEXA 3CCWA 3UVJA 4YN4A 4CEFA 2K4PA 5B0CA 4P6QA 4DR1J 5KFTA 5G5HA 2NCKL 5D3GA 4CO0A 5BR9A 5U47A 2I6WA 4QZAA 1RCOB 1EWRA 3UDLA 4OPHA 1J54A 4CGGA 2BQUA 8ICRA 5DJBA 2GHWA 5C2GA 2FPLA 4C4SA 1R8CA 2C3OA 3W62A 5AK4A 3OL7A 3AQOA 3G6EN 2K8BB 2B51A 3QU5A 2EFQA 1R3NA 2CDRB 3IM9A 4Z37A 2Z58B 2GBZA 2VC0A 5J0YA 1HHQA 2BMBA 2KDOA 9RUBA 4DUYK 1VRQC 1NMNA 2OYQA 3UKRB 2YQ1A 2JEGA 4HACB 3O9UA 4PRFA 3VN5A 1WOPA 3MX2A 3QUTA 5EY4A 2F8LA 3F41A 3LDQA 3ICLA 1TK8A 5FPNA 3LUYA 4LT6A 5F9LA 2CQDA 4CWBA 8RUCA 2JRSA 2HFVA 4B8CA 1KXPA 1RXOB 2PMZF 2ZBCA 3C2PA 3BY5A 8ICOA 5A2QY 4MIWA 1ZBTA 3CE8A 2DGTA 3I8DA 3MAAA 3NL0A 1PK3A 3OBYA 2D3ZA 4FNHA 1NK4A 5C12A 1HYSA 2W41A 2KFNA 3HD1A 3CQXA 3IS9B 1J6ZA 4C2MA 5FLXU 3ZX0A 4CM2A 2IJRA 1ZQXA 3AY9A 2OMLA 4LF1A 4EU0A 2RU3A 3QT5A 4JI3J 3H8WA 1ZTTA 3I87A 3F0NA 1N33K 1NNEA 2IMOA 1K8AT 1RK8A 1NI3A 1GXTA 4DV7F 4RNMA 2G0IA 2GX9A 3OS1A 3B54A 4Y1DA 3BQ0A 3HK2A 4YR2A 4EI2A 4WFAQ 2IVMA 1NK8A 5C5JA 1OMSA 1RT6B 2W9CA 1P27B 4U67L 4FJLA 4HCBA 3QT8A 4O4GB 4YMMA 2E9ZA 5KFXA 2EQYA 5CZVA 3DLRA 3AY0A 4I9LA 1FKOB 3QSIA 5HQMA 3VGUA 3M32B 4IFVA 3P6YC 2HZAA 4B3RJ 2ZHOA 1SV5B 2BPCA 4GKKJ 4M94A 4M3ZA 4ZCKA 3CCRS 2BE9B 2WVDA 3HZEA 4PUOB 3AOBA 3E8OA 3K2YA 4C8MA 2D0BA 3A8IA 4TQSA 2DKZA 1UA1A 4PXBA 2UU9F 5KG0A 3D5MA 1NGHA 1BA1A 3J7YU 3G6YA 1EXQA 1V85A 4PQUA 4DTUA 4Y3CA 4CJKA 4J90A 3KLIB 2D0PA 3W5XA 3IRXB 4F25A 2ZBRA 2A2CA 2KKHA 2AT1B 3R3LA 4OJ3A 3MEEA 2W2OP 4ZJLA 2FIUA 2WCXA 4DSIA 3SSRA 4P52A 2BXJA 3UR0A 5HBMB 2K8AA 2FF6A 2DK2A 3DNCA 1WEYA 2QE5A 5JLHA 2AQ4A 1ZQAA 1Z26A 3LP2A 3LP0B 1X9MA 2YKMB 3RW7A 2JWNA 3EEQA 3H4BA 5ALHA 1ELOA 1DQ8A 1T44A 3HX0A 2IRYA 2HBZB 4NZ0A 3OYFA 2UXBK 4F3QA 2CFXA 2MKKA 1KQQA 4R63A 4KV8A 3CCVN 1IKXA 4F7VA 5HK4A 1BGXT 1CS4A 3Q8MA 4KY3A 5M2PA 2FZGB 4DOZA 3D0HE 3VV2B 4NZ7A 1RAIB 2ZJQQ 1RAJA 1HIYA 2RPIA 4J9KA 1S6QA 2ASOA 4EO6A 2GMHA 3IM1A 3SUOA 2KL8A 2CQHA 3V81B 4FVCA 2YJFA 3HHKA 4DR2J 3CULA 4DX5A 4QR0A 1L7OA 2VPYB 5HRSA 5BN8A 3QNMA 3QZ8A 2R8KA 4NPOA 4QYZJ 4DWIA 5EHHA 4FK0A 1L7NA 2GWSA 4F04B 3FE1A 3M05A 2DNKA 1KEKA 5A6WA 3VF2A 3ZX3A 1P7DA 1M1GA 4WU3A 3G6ES 1SS6A 2F4VF 4KBIA 3D6JA 2DPIA 2Z2LA 3V1OA 1OUQA 3SAGA 3OFGA 4YOWA 2O5DA 4QWAA 2IOFA 3EPIA 3F56A 2FF3B 4K4UA 1SQEA 4CQ1A 4CLYA 2ZKTA 1KD1T 3MR3A 1HKCA 3QETA 4JD2B 4B02A 5CB1A 1CJVB 2BCRA 1BOTO 5IC6B 1NM1A 4CW7B 2RDIA 1VQ6S 2CNKB 2ZH6A 4PR6A 5HR6A 2YMMA 5AFUH 3I0SB 5ALSA 2EFVA 2Z2YB 2O8BA 3CCQN 3BO3A 1VSEA 2E1PA 5B0EA 2YH0A 1UFKA 1GLAG 4RPYA 3D0GE 2YWEA 2C28A 2VV5A 3OUYB 3IKMA 1NCLA 2F5GA 1FTRA 1I3AA 1VSJA 2QRRA 4P0PA 2ZBIA 3SJHA 4RNFA 2XY8A 2B4UA 2MQNA 3ATVA 1D9DA 3TJ9A 3CYMA 4CYUA 2BJ3A 2O8CA 1YTYA 4RQ5A 2RDJA 3EVMA 8ICCA 1FRXA 3M2VB 2PSZA 2IC3A 5AQXA 3C5GA 1F60B 2BE2B 4PHAA 2RT3A 3MTKA 1RWNB 4JI3K 2FPMA 1WSGA 6FD1A 3C16A 4OKKA 5EX3A 2DFLA 1IG6A 1KQFB 2PKEA 2J5AA 4IS7A 3AAQA 2AIRB 4C11A 4DV7J 2CQ4A 2POKA 4ILHA 3S8SA 2QKBA 4OHZA 4JNEA 1J27A 1U6ZA 4FBUA 1GX5A 1RWPB 2VICA 4OJLA 3KZIU 4CBXA 5CRXA 4ZKAA 3WX4A 3S3NA 1CJKA 3QYPA 4DTJA 5AKHA 2AEFA 1GMVA 1OKJA 2UUAJ 2FBTA 1NGJA 4CVNE 3UKUA 1UJ5A 1F44A 5F2RA 2ZIWB 2BDPA 3MCNA 2AYEA 3VQQA 2PMHA 2YKQA 3LPEA 4I67A 2AP1A 2ZD1A 4PEOA 4X65K 5J2FA 2JRZA 1NGGA 2XI3A 2R4FA 4FP9A 3RMDA 3W7BA 3CUNA 3AO3A 2ZH3A 4UAUA 4AE5A 2UU9J 4NEZA 4EBDA 1CJTA 4FKXA 2P9KA 1AW0A 1EP4B 5HL7Q 1LFPA 1VC6A 1UVJA 3K1ZA 4I4BA 1F5SA 2HW3A 3CW2C 4FWRA 3TABA 3QICA 3EWAA 4LF6K 5HRNA 3G96A 2DXEA 4JI8F 4UB3A 2HNYA 3D54A 2HNDB 1CPZA 4HVJA 2XHBA 4IWVA 1PCAA 4CTAA 1FWKA 4UAZA 5T7LA 4IDHA 1FXRA 2N1RA 1JLGB 4HI2A 4MO4A 1YSJA 1TUWA 4N56A 2SXLA 4ZP6A 3TARA 5H9EJ 3FEXB 3CCVS 2VFRA 1A7GE 5J0SA 1YF5L 5BR8K 4ZVGA 1Q82T 4KJIA 5KFEA 4QJVA 3HVWA 1FJGJ 1YXQA 5CZ1A 1RTIB 1T8EA 4QZ9A 4TLRA 3LVVA 2HNZB 2K8GA 4CJ3A 2YMPA 5EOYA 4M5GA 3WK6A 2B9EA 1U2VA 2QWPA 3IC1A 3RMBA 3VF6A 2PT0A 2XWYA 5ALVA 1N36J 2WB4A 1NRKA 2DT9A 2IA6A 4YN3B 5TKYA 4TLQA 2Q66A 1Z1VA 1C0FA 3DRXA 1NDCA 2H5EA 2PXIA 1MWMA 2YY6A 4LF7J 4ZIWA 1NSKL 2ATLA 1OY8A 3M2RB 3P39A 2LEBA 5ALFA 4KMOB 3R7NB 3ZZPA 5J2HA 1RU2A 3CPWR 4Z7YA 2GJFA 4YOXA 4LFAJ 2FBVA 1YJTA 2MJNA 2OPQA 1X4FA 3MM7B 4NE9C 5EE0A 3WK9A 1COKA 3CDUA 4WCEQ 1YJRA 3RRGA 2CWXA 4ZLNA 4TXSA 3KLFA 2LYVA 3NF7A 4JKGB 3PW4A 4B9TA 1VQ7N 1RYRA 2XSJA 3VVTA 5JVGQ 3I8BA 2AEJA 4U95A 2B6GA 3MEDB 4Q0BB 4MYUA 5MLCV 1S72N 4Z4HA 2OYYA 3CCQS 1KLMA 3J7Z5 2JX2A 4BRHA 4J9OA 3D6RA 1FVQA 2ZJ8A 3S9HA 3HHNB 4RU9A 3E9LA 1RBSA 1LKZA 2YQ3A 3KDOA 5HMMA 4CESA 1UCVA 4BREA 3THWA 3QRPA 3AO1A 3BGOP 2W6LA 4ECRA 4AILC 3OLAA 3GDQA 1NJWA 4N8NA 3EDQB 4K4IA 2E5IA 2KMDA 1BWVA 5J2DA 3LA0A 2XQCA 2JZBA 3W61A 3THVA 3R8YA 2P9LA 3R6GB 2LQ8A 3SI8A 5CYQB 2VJ4A 1N0VC 3O6WA 2Q1LA 2NUUG 2ZG6A 3L5KA 1KWMA 3WC2A 5C42A 2ROPA 1VBKA 1U8WA 3VQCA 1WSEA 1ZETA 5LJWA 3GSDA 2FJWA 2LU1A 2UZAA 4OIXA 2A42A 5LJ5Y 3UMGA 3IBPA 1RWUA 3VEOA 3V1RA 3H59A 4A2BA 2WAQC 3DDHA 3KIOA 1QZ6A 3FZMA 1PVQA 1O5JA 4F0MA 1VQ5N 1Q8BA 1C4AA 2H3EB 4WP9A 1P90A 2V4JB 1NK9A 1I94F 2EHGA 1HBUA 4QNLA 2QGFB 3KJNB 3MZIA 1FEEA 4MT1A 4CJFA 1N52B 3BDPA 3AV9A 1NO8A 4H0YB 4BR5A 4DEZA 4CO2A 1O1WA 2GWJA 3J8AA 2FC0A 4NLBA 1HUZA 2YB4A 4DL5A 2GQCA 2V0NA 3SNNA 5KAFU 1HNVA 1NDLA 4GXJA 1A5XA 3E1YA 3PLAA 4OLAA 3EGWB 3GG4A 2ODGA 1HPZB 3BN4A 1E6VB 4CJUA 3W8GA 2WRMA 2YHWA 2GA7A 3U3GA 2VG6B 1HW8A 3E2EA 3QFPA 2J0XA 1XNQJ 1BA0A 3FFKB 3ZETA 3EGNA 4BC3A 4HHUA 2KE7A 4KLOA 4M41A 1B4FA 3M1VB 2CPJA 4C0OC 1C0MA 3I31A 2ZH2A 2W2NP 2XHWA 3BGFA 3H2LA 5BYSA 3V1QA 3WZ0A 2RKIB 1Q18A 4HWIA 2MKYA 3QNWB 2PFNA 2GMJA 3DM2B 2ZIVB 2NXNA 4NLNA 2DNRA 4TY8B 4HI1A 2CVIA 8ICGA 4R64A 3PY8A 2HFZA 3MTJA 2B6AA 1RTJA 3DRPB 4F5RA 2BCQA 2V7ZA 3MR6A 4UUXA 1NB2A 2R7QA 4JLHA 3L3VA 4I6MB 2E5GA 3OFEA 1IO2A 1GMUA 4TYAA 2MZTA 1HNZJ 3Q2TC 4EHUA 1FJEB 5DM6L 1G3OA 3RJGA 4IRKA 1NU4A 1BPEA 2HQ3A 1N5YA 4Z6FA 3A4TA 5E3RA 3ATUA 5F3XB 1C0UA 2VQFJ 2HKEA 5AE3A 3MECA 1S1XA 3W65A 2FZKB 5ALLA 3TADC 2FLLA 5DM7Q 2F3NA 5HMYA 2IOCA 4QPXA 3D2EA 3MURP 3KWIA 2P6RA 1ZQLA 3UI3A 4DTSA 2ADBA 3BF3A 1NZ8A 2OPRB 4E89A 4M5DA 3AVBA 3DJCA 2FC8A 2FDRA 4X4PA 1UWBB 5GAHI 4FJXA 2F4VK 3H5UA 3NXZA 4NL9A 3IGNA 2NRHA 1PC5A 2BE7D 2MY7A 1MSWD 2AD9A 2YWGA 3HJVA 1W7AA 4WK1A 2LDIA 2HPUA 1R8PA 2RS8A 1VQ7S 1VQMN 1XMBA 1HLUA 3QJJA 5KL8B 1U1QA 3ILLA 2BW2A 3TAPA 4LF8F 1VSMA 1VDVA 3N7SC 2IOHA 1HQEB 2RRAA 3W64A 5B0BA 1TVRB 3IBWA 5L46A 4FW1A 2HSEB 4ANCA 1H7XA 1S1TB 3TAFA 4KLQA 4P2MA 2W9AA 2JLEA 4IEEA 3MMJA 3EDRB 2YNHB 3HSJA 2KI2A 2WMMA 3AOCA 1JNZB 3KKAC 4EYHB 4DU3A 1VQPN 4OHYA 4KITB 4A8MP 1B0TA 1M1HA 2QKQA 1X42A 5HSPA 2XLKA 4TUSA 3UQ2A 5KFUA 1RDDA 1K5OA 4UOCA 2KT2A 1YJVA 1Y11A 3RB0A 1AZSA 1WG5A 4YG2A 1M5SA 2E7XA 1B43A 3AN1A 2RDDA 5I3UA 4CEDA 3IUCA 1BWEA 4RUCA 2W1BA 1XHZA 2W25A 4LR7A 3Q22A 3RGIA 4Q2LA 2DB1A 1HKGA 1MW7A 2DR9A 5A8RB 3AB4B 4J8FA 3ZTSA 1X4HA 1VQ5S 2DTUA 2M0NA 2R8IA 2JWLA 1ICEB 1XTZA 1YGYA 1BHLA 3W5ZA 1VSIA 3OXGA 2DJWA 4YVZA 3V4IA 3RFAA 2Q43A 1LVHA 3LDSA 5ETQA 9ICCA 2H4WB 3M8PB 1ZS6A 2DNLA 2F77X 4E2FB 1S7HA 2NNWA 4BHQA 2YPYA 3UM9A 3MM5B 2KICA 2QWOA 4KTQA 2MA1A 3R9PA 2H5JB 2QG9B 4X4QA 1X31C 5JMNA 2P2CB 1RP5A 2A19A 3WC0A 4WXOA 3N4QA 4DU4A 2P9CA 4WFYA 5J29A 2KHVA 5IFMA 1X5TA 2MZ1A 4NXNF 8ICUA 3ETLA 4HYKA 1VIOA 4PKHA 5C24A 1WD6A 2D0OA 1W2BR 3ZNJ1 1URNA 1KFTA 3D3CJ 3CPEA 4KGXB 2V2ZA 1NGBA 5KG3A 4JI8K 3HFVA 5CHGA 1QTMA 5ALKA 5FP0A 3JPQA 2NXCA 3UN5A 3KD5E 1Q8LA 4QS8A 3R1HA 4KLSA 4J9LA 1NPKA 2H51B 3JSBA 4KX5A 1ZQZA 4USUA 2GFFA 3H2VE 1WKKA 5AQYA 1FNXH 4H4OB 5KFMA 4X4NA 3DGPA 4NLXA 4Y0FA 5HLFB 2FVSA 1R6YA 1Q82O 4IQXA 2UXCJ 4FF3A 3EW9A 2V7YA 3MI7X 4EIAA 2KM8C 4ED4A 4IH6A 5KFAA 3TWZA 3JSMA 2R7VA 2WHOA 3UE2A 4RL1A 3CIPA 1ZA2B 3OR1B 3SZ2A 3D7SB 5AIBA 4OJ5A 2QIFA 2IFXA 3NOGA 5L1LA 3CO9A 4C6AA 4AM6A 5GAEP 3AD9C 3CJTA 4GVBB 2P9SA 5J1EA 2F8SA 4E98A 5F3TA 1SKWA 1G2EA 4P0QA 4C8NA 4ID8A 7ICGA 1ZRNA 4DF8A 3RR8A 2VJUA 2ABYA 3CCUN 3CC4N 4ILMA 4Z4EA 2R7RA 2DNMA 1S0OA 3S3OA 3M6KA 4OZNA 2CH6A 1LWXA 1Q16B 4NCGB 1Q7YT 4ENOA 3FVYA 4DV5J 4C3MA 1LW2B 4K7QA 1VQMS 5AQQA 2JSXA 3SSQA 1XNSA 2J0WA 1B0XA 4H54A 4LF9F 5IT9Y 1IVZA 2NYVA 3ET6A 1Q8IA 1WI8A 4JKFA 5A2QU 2AYGA 4LF8J 3T5JA 3VZHA 3P5JA 9ICOA 2LYBA 3KVGA 2P6UA 3D4JA 1E6YB 1SQFA 5KQ8A 4M7XA 3C2LA 5BXIA 3OGUA 4L3QA 4B3TJ 7ICOA 8ICXA 3GE9A 1MLAA 1JCGA 3QQCD 4WF9Q 3HYFA 3I1YA 3DXSX 2C2DA 3VF0B 3Q8UA 4UOHA 3LDLA 1S0VA 2ZH9A 3NGUA 2LMRA 3FFIB 2DNYA 4CZKA 2QT7A 2MZRA 5KFPA 2PMWA 3AJ1A 5IIOA 1KFDA 4FLUA 5B7WA 3NS7B 4X64J 1UCNA 3D6FB 1ZA1B 4P74A 3O3HA 3M6XA 3GFKB 3DOLB 4JI1J 1RILA 1RGVA 3QBWA 4XEIA 3H8SA 3H08A 1PJ6A 4CNQA 4CO3A 4DV6J 3NLCA 3BQ7A 4UT4A 3RRKA 2EC0A 1ZZFA 5HQ8A 1N54B 3MMBB 4M7YA 1MA9B 3X1LB 2ISOA 4Q43A 1DRGA 3AVMA 5HMXA 2YHAA 4KHPJ 2IRUA 2Z57B 4MKBA 3M8QB 4JN4A 4OV1A 2DRBA 2KYXA 4M8LA 1NHKL 1I94K 2VHGA 2JFKA 1EX4A 5J8YA 2VZ9A 1DURA 1NGCA 1NJIT 3LW5C 4MFBB 1G1XA 4FF4A 2QXLA 2E5LF 2CXYA 1JKHB 2WTFA 3JTOA 3ULEA 1BISA 5E79U 1HHTP 2ZOGA 3RTVA 4UUWA 3Q89A 2BACA 4PZOA 4USKA 3CFRA 3HKWA 4EBEA 2NPFA 2VG7A 3AAPA 1V3SA 4NEYA 2IGIA 1V4TA 4DSFA 4FJNA 4J2EA 3IR7B 1F2HA 2PI4A 1XHXA 4DS4A 1JWWA 2OEMA 2FJ6A 4KLIA 3KLEB 3KNGA 2KB2A 2O1PA 2KXFA 3FAHA 4M6WB 1JLCA 2E8OA 1ZD2P 1DAXA 1WI6A 3AU2A 2M4MA 1WTBA 1S22A 1FEZA 2QFJA 3DYAA 4BRGA 3SBTA 2B21A 2I5JB 3O9SA 2DCUB 4ANEA 5CA7A 3MHYA 1RB0A 4P2XA 4DFPA 1HNIA 2B5JB 4GVMA 4YB7A 3J81U 4KR0B 5AM4A 3G82B 3SQ2A 2RVJA 4FO0A 3KK7A 4NM1A 4HCCA 1JUDA 2HYIB 2HS3A 1X3MA 4FBTA 5I42A 1YHQN 2HRYA 3NAIA 1NU0A 4CD1A 1JIHA 4CHOA 5DDMA 3SBMA 3H2UB 3IAS9 2XZWA 4ED7A 4USWA 3M6GA 4KH4A 1GLJO 4I2EA 4CJTA 2YX8A 2Q6BA 1FJCA 4J9SA 1KCFA 4URGA 5M1OA 4ID1A 4DR5J 1DJ0A 4C7QA 8ICVA 4ECUA 2F1FA 4J9VA 4I7FA 4BXOA 3CC4S 2K2PA 3MR2A 1KVJA 2I1QA 4GFJA 3VWSA 3SDEA 3SYZA 3P5BP 4IQWA 3MUMP 2N3LA 2M0GB 2B8QA 1ZC6A 4RCHA 3IFRA 2H48B 4I28A 2ZBPA 3CJ5A 4J9MA 2R7TA 2FI1A 1HBOB 2CJAA 4LF9J 3IP0A 1U25A 3ETMA 4F71A 3LP3A 7ICQA 2ZEJA 1M5VC 4DPUA 2WONA 2KVCA 1JRPA 4CH0S 2BKPA 3K75D 4OHXA 3TI0A 2JGAA 4UOFA 1D5AA 3VESA 4ZVUB 8ICQA 4ZN3A 3U1NA 4B3SJ 4CGZA 4AQYF 4G1PA 5CAAA 4PZNA 1RXWA 3GLJA 3P5TL 3AA5X 2Q97A 2DIUA 1LWEA 4FNIA 1S1UA 1FFWB 1IKVA 1IQTA 5CD4A 5AQZA 3VQ6A 2COLA 3MAAB 5KFBA 2MJUA 4NA1A 1OH7A 4R8UA 1QCKA 1K44A 3HCXA 4BGAA 2ILZA 5EU7A 1TKTA 2RQCA 4ZTFA 1GTEA 1HYSB 4LJMA 4MJKA 2JR5A 8ATCB 2CRXA 5K20B 2OUGA 4OX6A 1TL5A 4P72A 1R0BG 4JKBA 1JL2A 2RIJA 2VOOA 2V94A 5L1JA 4LUBA 5IM0A 4WTOB 4AYBC 1EB0A 4C98A 4ZK7M 5EWGA 3G4SN 5DQIA 4I2GA 4KLMA 4P2HA 3PJWA 5CXTA 4MIAA 2IHMA 1R7IA 1G15A 4PGXA 9ICUA 1U6FA 3FYHA 5AM3A 3HL8A 1F5CA 2I7NA 5IC4B 2IIHA 4JI6F 4OGCA 1X0PA 3QEIA 2E2QA 1SJFA 5IIMA 3MXMA 4U7CA 1PJ7A 5IINA 3NS1A 4DX7A 1HNWF 2I0XA 3A8JA 1XO1A 2J76E 1XI1A 2ITGA 4OKEA 4RQ1A 2BOPA 1U47A 3PZPA 4UB4A 4PGQA 4FZYA 3OHRA 2QXFA 2W6KA 4RUAA 4X4UA 2Q4TA 2A6MA 3GMGA 2MQMA 2QLFB 4PQUB 1IKWB 4XH1A 4ZN1A 1U45A 2KVQE 1WHXA 1V3ZA 3O1LA 2KFYA 1B64A 3NGIA 4NXNK 3L2UA 2NRZA 1RISA 4CLPA 1WUUA 2G2YA 4JI4F 2KOBA 4P2FA 3MEEB 3VHQA 1MROB 3H5YA 2GEMA 3N7RC 4H5RA 1C6VA 3ZDAA 4YOEA 5KFRA 1A0OB 3CSKA 4BRQA 4FDFA 5D8HB 4FPBA 3ENAA 1RT2B 1IG8A 4AHSA 1HKBA 4BWJA 3JYTA 2XBPA 5IV3A 2K4HA 1NOYA 2IS3A 1RNHA 1YAGA 4BG8A 1NH7A 3QU9A 1HX1A 1RBAA 3JXOA 3W63A 1NZBA 3FNNA 3S7RA 4F4ZA 3VQ5A 3H20A 2DITA 3UFCX 4GMJB 3AOAA 3HM8A 1H6KX 1WEZA 1ZBFA 3IG1A 3F2CA 3K0SA 4OZ2A 3V2UC 4O0NA 2CRLA 1RG6A 1IKXB 2LXUA 1YHQS 4IOAQ 2W40A 1NUEA 4MKVA 1KQSR 1QQOA 1X5SA 1EARA 3B4DA 2X3GA 1HBMA 3EUB2 3WHIA 1HBNB 1RU1A 4QR2A 4KKOA 3AJ2A 4LR8A 3VERA 1WORA 1Y88A 2BA9A 1KN6A 1B7YB 9ICRA 1SB6A 4BDZA 1WNEA 4YDUC 4L3NA 3CO0P 1VCTA 3OPXA 4DL7A 5LSLA 1RDBA 2LM1A 4B3OA 1VAZA 2CJQA 2Z1JA 2V9WA 1GLCG 3SQ4A 3RF9A 1IJEB 3RRHA 4DR6J 4KHMA 2M70A 4XPEA 2CQPA 1ZQDA 4IDKA 4FZMA 1XIQA 2GNKA 1TUYA 2ZTCA 2ZUBA 1KOOA 2QB0A 2IVFB 5AE1A 3R97A 2AX0A 4LF4J 2XM3A 5KFVA 2KJWA 4CD3A 4Y2JA 1RI7A 3IAM9 5M2RA 2JEJA 1RUSA 4LFCJ 3Q8SB 5LMNK 3VA3A 5L8RC 5KFSA 1ZQTA 1FXLA 9ICKA 3OBIA 2OZMA 1R0AA 1AFIA 1N32F 3CCJN 2DRDA 4I2AA 3A8YA 5L39A 2MXYA 4CGIA 3QE9Y 3KK1B 4LREA 2XO7A 4BDPA 1N5SA 4J9QA 1YVFA 2CQ1A 4OHWA 4DQQA 3U3YA 3LAMA 1CXUA 1NNDA 3TAMA 4RNOA 3QO9B 4H4MA 4F5OA 4DR3F 1FXXA 3DMJA 4GV6A 3AFGA 3HFKA 3NMAA 8ICHA 4E1NA 3QSYB 2Z30B 5AQGA 1U48A 2XIDA 4PQAA 4AQYJ 4HVZA 1TK5A 1H74A 5A6PA 4ZITA 1Y3JA 4P0PB 2FJEB 4CEBA 3FCWA 2GO9A 2WFBA 3AVKA 3L3FX 3PM9A 4TU7A 2O8CB 4K0KJ 3RAQA 1O03A 3OHAA 3A12A 3FZFA 2JC0A 5B5EU 2LECA 4A8FA 2A1AA 2IC3B 4CFCA 3DDKA 1NGFA 4LVOP 5HVGA 4USMA 1MMNA 4MHVA 3QGHA 3MGJA 3RU0A 2IM2A 2HRUA 2OP5A 3PUFA 3BS5A 4C11B 4B1YB 1XR6A 3D0PA 2VF3A 2V50A 4CT8A 5FPMA 2AJQA 4DPTA 4CJ4A 1KN5A 1PC4A 1CJKB 2OEKA 1A9NB 3CTRA 4R5PA 4AL7A 3WEEA 4KI6A 1NJIO 2PMZC 5GAGP 5AKJA 3EN9A 2M7SA 4Y2MA 4CZFA 4JRQA 4JKAA 2KLAA 2G0CA 1FF2A 2E5LK 1ASUA 2ZD1B 3O3FA 4CHZA 2BGGA 3VAIA 3MR7A 1NKCA 1N63A 2E44A 3CI5A 3PX0A 1CJTB 3ILJA 5L9XA 3V7LA 1WOSA 4J9PA 2KSOB 4MFCA 3GYNA 1A5WA 4ALZA 1U02A 3K17A 4WQ4C 4RU2A 3CT9A 5HVHA 4JI4J 2KNJA 2HNYB 2XMWA 3RW6A 1Y7PA 3TFRA 3KD3A 4KLFA 1YBTA 9ICTA 4NYNA 1GXUA 3QAEA 2DEIA 3VR1A 4CTAB 4MK7A 5B8HA 1N6QB 1ASVA 1UEKA 4WFXA 1XUPO 3J7ZT 3VEXA 5A0YA 4OJRA 2AMCB 3MPYA 3US5A 1FE4A 4P71A 2MB0B 4IOCL 1UVNA 4UAYA 4CRXA 3CD5A 1I5OB 3ZD8A 3T19A 4OJPA 2XRIA 4NB4A 4RWXA 3H0LB 3OTDA 4O0JA 5J2GA 2IMWP 2J9EA 4DX8H 3R9LA 5CYMA 3E3XA 4B3MF 1P1LA 3SQ1A 4RQMA 5ETMA 3C46A 3I6PA 2DO0A 1BMQB 2HHQA 3QFHA 1A6SA 3LF0A 4CFDA 4ECQA 5EVZA 1ZAXA 4O5EA 3EL2A 1Z2LA 4N5SA 3H0RB 5KPTA 3J7A1 4WKRA 2IYIA 2B7BB 4LF5F 2L9DA 3ETOA 4IYQA 4ZVRB 5KFZA 4CJSA 8ICTA 4YOVA 4QZIA 2WF7A 3PNCA 1X66A 1KRPA 1TKXA 2C1EB 2R2UA 4KH0B 2ZJPQ 2OPSB 2IJNA 3RBXA 5J2JA 3MPWA 2RRNA 2FHKA 3VZIA 1OYEA 3R5BA 4CM0A 4JI5F 2JH3A 3PG9A 3UR3C 2OPQB 2V67A 2WW8A 2DBYA 3CCJS 1U1MA 3KLIA 3OS2A 1H72C 2X51A 3M5RA 3IRXA 2P9PA 1WN7A 1N32J 3QIDA 6FDRA 3ALRA 2CIMA 1Q9YA 2DY1A 2XSJB 4DQSA 2VG5A 3ZEUB 2FSNA 1KLMB 5MLCQ 3CFPA 5HBMA 1EXNA 2P6TA 3X3UA 3W3SA 2OHFA 4CEZA 3QFWA 5KQDA 4B9LA 4Y0WA 3WK8A 3NGSA 3BGRA 3LP0A 2DHAA 2YKMA 4DV2F 5HJYA 2OEHA 4MAKA 2EX3A 2A3VA 3THWB 2QEXN 1KONA 5KI6A 2HBRB 1XS9D 1HWUA 1QAYA 2CPRA 3ULDA 3QDKA 2JZBB 5HMZA 1BIZA 1EETA 2P9LB 4CIOA 3QU7A 4CGJA 3HT0A 4M3YA 3H6EA 3MM6A 2FJXA 1SCJB 4U8VA 5C42B 3NWRA 3TZZA 3V5RA 3QJLA 1T02A 2AH5A 4G1QA 4JI0J 3GR1A 3FJ2A 3IWLA 4WFBL 1S7IA 4K2XA 5KG4A 1LOUA 3G8TA 3RJFA 2CJ9A 3M6VA 3BQ1A 3MDQA 3OLBA 4KRWA 4BR0A 2N4CA 1HUOA 5KFOA 5B0DA 3TO8A 5C7PA 3AVGA 4A5BA 2FY8A 3MWPA 2DIVA 1X5PA 3WQPA 4F4XA 2B0GA 4CJQA 3QJPA 2I1RA 2EZYA 2KRRA 4JI6K 4P7VA 4BR4A 4WQ5C 1VJ5A 1X9JA 3TQ1A 2EW9A 4L3KA 4RW7A 2D3DA 4HDGA 1UFLA 1EX8A 3CDBA 1FEHA 3IMQJ 4WIQA 1HNWK 1HNVB 1ZM3A 2YJEA 5BPLA 1CJVA 5M2UA 1SQKA 3UDVA 2F4FA 1RLDA 2LP4A 5KFJA 4CGDA 2H9ZA 5AQWA 5L1IA 1NSAA 4CGHA 1GLDG 1V38A 5A8WB 2X1AA 4FS2A 2YX4A 3I0SA 4JI2F 3K1RB 2YKNA 5AK3A 2WAQF 1WCNA 3O8MA 5KG5A 1FD2A 3ZETB 4CDIA 2FVQA 1DLOB 3CJAA 2H3ZA 1TELA 4ED6A 4JI4K 3PCOB 4DV3J 5LXRA 2J9CA 4C9DA 2UVUA 4H0PA 4IO1A 1DEJA 4Z2XA 3BBBA 4QIGA 2ERRA 5M1QA 1BXNA 4ZTJA 4KH6A 3M2VA 3S6JA 2WAQD 2B6AB 1RTJB 2W7AA 4DPOA 4G9ZA 1VOMA 2BE2A 1DRZA 5E26A 3UNYA 4GO5X 2BJEA 3K58A 2HAIA 3EE3A 5EE1A 1ZQSA 2AJ2A 3I9ZA 5KT5A 1A76A 5HP4A 2B4VA 3I5BA 4NYOA 3OVNA 2UXDF 5AKLA 3ITHB 1NDKA 2XICA 3D1QA 3OJSA 4QBUA 2EI5A 4OZ1A 3MM9B 2W2PP 1DK3A 4PL7A 2FB0A 5CWRA 1C1AA 4FJ7A 3IA0A 3WXJA 3HHLC 5DDYA 1HQUA 2ALYB 4YNQA 4BGBA 1N5YB 5HNKA 3ISNC 4K59A 1C0UB 2HK3A 4MK8A 3OTOJ 1RSCA 3MECB 1W2IA 1S1XB 3SQOP 4CFAA 2MYFA 1EO1A 2UUBJ 4PWDA 3DOKA 3ILIA 4LF5J 3MD1A 5LMUF 4ISGA 4BE2A 4U67Q 4CZIA 4F26A 3PSIA 3ED5A 4OX9K 3D66A 3AODA 2YMLA 3KYLA 3PV8A 4K4ZA 3AL0B 1TKDA 2ZUCA 4DPWA 4DB3A 4CJRA 4GVLA 1XEZA 1GOBA 3I96A 2MKJA 2YH1A 1REVA 5ADZA 3FCVA 3VTHA 3J7YP 5BRDA 1X60A 3WXLA 4E19A 1X0FA 1V5IB 3DGVA 5DBCA 2CPXA 4RT2A 1UP1A 4DR4K 2W2MP 2HNDA 4NLZA 2VDHA 1WSVA 3CJ8A 1KBUA 2A40A 3PW7A 1F3VA 2IHNA 5ETNA 3TOQA 1JLGA 2XS5A 3P96A 4DR3K 4QWEA 2QEXS 3O3GA 1L7MA 1Y3KA 4DV2J 4CZCA 2BGWA 1JLAB 1WHVA 2HHTA 2ZHAA 1E3MA 2YWKA 1CI4A 5ALIA 2JH7A 1Y97A 3T69A 1YZ6A 4JYAJ 7FD1A 2YPZA 5AQRA 2DNGA 2W7PA 4JB8B 1CJUA 2MLZA 1RTIA 3MABA 3ENWA 1AZSB 2FZCB 2I38A 1TL7A 2AP6A 1BHNA 1CVJA 3OPKA 2G06A 3TQEA 5DK5A 2OZSA 2F8EX 5AQIA 4LRAA 4X2BA 1HYZA 5I3UB 3MWBA 4RW6A 3OL6A 1KAYA 2KZMA 2MUTA 4PG5A 1Q86T 1N5XA 1P8ZA 4A8YA 4C0HA 4XK8C 5AQUA 3Q23A 3JPNA 5AKEA 2N7CA