4DS4A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mn2+
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 201
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds4A01
3I8DA 1U4BA 4YXJA 3C5FA 1JXEA 4GXIA 5J0QA 5KFFA 3F73A 3DRRA 3SNNA 4ZHRA 3B0YA 2Q3SA 4DLEA 3BQTA 4CF0A 5DDMA 3CFRA 5J0RA 4RU9A 2RPIA 4FO6A 2HHSA 5D3GA 3K4GA 4IBNA 3V6KA 1H38A 4B3OA 5IINA 4GW6A 4J9NA 3P5JA 4NXZA 1BPDA 1JN3A 2X6SA 4I2AA 4CGIA 4RW9A 4DO9A 2DPIA 2QXFA 1W0HA 3KHHA 3LP0A 2KZMA 4KPYA 4CHYA 3SPYA 1NJYA 1BISA 3H4DA 5CYMA 4W5RA 5EWFA 3AVNA 3MGIA 3MXMA 4KHUA 1S1XA 8ICVA 5KG5A 5HP1A 4CGDA 2HHXA 7ICLA 4YMNA 2G8UA 4E3SA 2J6TA 3AO5A 4HUGA 1ZQRA 4CJKA 2AQ0A 1K1QA 7ICIA 2I5JA 2NRZA 1JLQA 1NJXA 3H4BA 3C2KA 5CHGA 2PXIA 3WNHA 4UB4A 1Z00B 3IG1A 4OKEA 3HJFA 4FZXC 4OGCA 4DOBA 3ZDEA 4RQ8A 1JLBA 4DWIA 2ASJA 4H4OA 4CEOA 9ICVA 3TAMA 1COOA 4DQQA 1SKRA 4JWNA 4IQUA 1LB2B 1VRTA 3ZSYA 1RBTA 3NHGA 4YG2A 5L1KA 1WN7A 3CYMA 4M04A 3O3HA 7ICTA 2GWSA 4IFVA 3RRGA 3RJFA 3QESA 3G0ZA 4FK4A 1ZQPA 2BR0A 1YTUA 1TAUA 4CJLA 3QE9Y 2E6LA 4IQVA 5DG7A 3GDXA 4I2JA 3NF7A 3VQAA 3P83D 1ZQDA 5CA7A 5DK5A 1ZYQA 2XY6A 4DQPA 4OVLA 1ZQNA 5HP4A 5J2HA 1S10A 1IH7A 4F4KA 1WCNA 3HSTB 4PUOA 4KITB 4F8RA 2IGIA 5J2PA 3RJJA 2HHQA 1S6PA 1KFDA 1ZBFA 1CXQA 1Z25A 4E0DA 4E7LA 4KO0A 4KB1A 1ZQCA 3TABA 4E7HA 3RMDA 1TL3A 5KFIA 3RR7A 3MEDA 4DL3A 1RT3A 3OJUA 4M9LA 3ZSZA 3KD5E 4ZH4A 3NF9A 2BCRA 8ICMA 2XGPA 4H4MA 1C1BA 4FZYA 4CK2A 1NOMA 5DB6A 5KFMA 4O5KA 3RB3A 1FKOA 1RBSA 4HCCA 2XRIA 4J9LA 2YHAA 5DQHA 3WNFA 4YQWA 3Q8QB 1L3VA 1UT5A 5EWEA 1TVRA 3RH6A 4J9KA 2X6NA 4NLGA 4LD0A 3AVLA 1BPEA 5J2QA 1ZQQA 2BANA 2BCQA 1WCLA 4M3UA 3O3FA 3HK2A 5J2EA 2UVWA 4Q8FA 2PZSA 4I2GA 1WAJA 4RW4A 3KLFA 4MFAA 3T5JA 4DTJA 4N47A 3MR5A 3L3VA 7ICKA 4PH5A 3C95A 2C28A 2V4QA 4KLUA 3AO3A 3G6VA 3UQ0A 5J2DA 4F50A 3AO1A 4KRFA 4PA1A 3TFRA 2O4GA 1D9DA 1Q9XA 4YCXA 1QSLA 3NH1A 4FCYA 3SQ1A 3RB4A 5KFRA 2BPGA 3DI6A 3OYFA 4M3XA 2PFNA 1RDBA 1TVAA 2XO7A 3HP6A 1JXLA 2G8HA 3S3NA 3HM9A 1RT1A 3DRPA 1S5JA 4QCLA 1ASVA 3GIKA 5IIJA 1BCOA 1WSGA 3RMAA 4CFBA 4K4HA 3GV8B 4LZGA 2FLNA 3AV9A 3NTUA 2PFOA 5J29A 1TKTA 4Z4HA 2NRXA 4RPYA 3AVBA 2A1JA 2G8IA 4JV2A 3PW0A 5KFZA 8ICOA 4O5BA 3C21A 3RH5A 4AHRA 4G1QA 4DL6A 2ASDA 4I2CA 3KHRA 4QZIA 2VA3A 2WONA 4F5QA 3OYLA 4M3ZA 3KLEA 9ICKA 4FJLA 4KHYA 3HVRA 1S0MA 4CFAA 4CF8A 3JPSA 4ICLA 4O3PA 3M8RA 1RDCA 3KK3A 4LY7A 4MFFA 4BGDA 1SZPA 5J2MA 4P4OA 2UVRA 4KLLA 3RR8A 4FJKA 1NK9A 4CEAA 4I9QA 1KVBA 4RT2A 8ICGA 4OKKA 4ECVA 1A76A 7ICHA 3SI6A 9ICTA 2DY4A 1NK0A 1C0UA 1RDDA 1DLOA 3KTQA 4I2FA 1ZBLA 3MGHA 4CK1A 4BE0A 1KFSA 3VA0A 1IM4A 5KFLA 4YN4A 1CLQA 4O3OA 4GXJA 2ZUDA 1BHLA 3BGRA 1Z3EB 4ELTA 4DFMA 1N6QA 5F9NA 2MUTA 7ICUA 2X78A 4F91B 4JUZA 3V6DA 4LSLA 4QZCA 4HUFA 4DQSA 2KQ2A 4DL2A 1WSHA 1PZNA 2Z1IA 1ZQVA 4RW6A 2LYHA 3KK2A 4YR0A 2V9WA 3WNEA 5IIKA 1HUOA 1EX4A 3AVMA 4OPKA 1X9MA 2RN2A 3FDSA 4R64A 2ITGA 4K4IA 4NLZA 4BWMA 4DTPA 5KFPA 4FM1A 4RW8A 2KZZA 1HQUA 2P1JA 3ZSWA 2G8VA 1HPZA 5DBBA 3ISDA 4Y1CA 2F8TA 4KLEA 4W5NA 3OYJA 3K75D 3DOKA 4CJ4A 1U45A 3ZT2A 1AROP 5J2AA 3OYDA 2F96A 4B9TA 3GILA 4CECA 1HNIA 3OJSA 3ZT3A 1R0AA 4M45A 8ICNA 1TV6A 2Y1JA 3KLHA 1IKYA 3RJHA 4G3IA 4B9MA 2HNZA 4C8NA 2R7YA 3HPHA 5DLGA 2HNYA 2FMSA 3B6PA 4JWMA 1XU4A 4M9JA 1T4GA 4F5RA 5CZ2A 5JS2A 3V81A 4DQRA 2NRTA 4Q0BA 2JEJA 4DTSA 3ETLA 2ALZA 3AO4A 3C5GA 4DF8A 5D46A 1NK4A 3VQ4A 3V9ZA 3RH4A 1A77A 7ICNA 4R8UB 3VQ8A 1XSNA 1I3AA 4MEYA 3AVAA 8ICRA 2KW4A 4DTNA 5KG7A 1Q8IA 5HROA 3G6XA 1N5YA 1I39A 2IC3A 3MEGA 5FRNA 1GOBA 2BCSA 4UB1A 5C25A 1VSJA 3OYEA 3IHQB 1RXVA 1A5VA 2B21A 3C6TA 2ZD1A 3NAEA 3SZ2A 3E2EA 2OYQA 1DTQA 5KFXA 2BQUA 1ZJNA 4F4XA 1XSPA 3EY1A 5KI6A 4ED1A 1BQNA 4AHTA 4CF2A 4CJRA 2DFFA 3H08A 8ICTA 3DLGA 4J9RA 9ICHA 4ZTFA 2J6SA 2C2DA 1S6QA 4KLDA 3C1ZA 4I29A 2R8HA 2NUBA 3PW7A 9ICAA 8ICWA 4QZFA 2XY7A 9ICLA 1WSEA 3AVKA 5J2KA 3OS2A 1HRHA 1QS4A 1XHZA 4CJSA 5KFYA 3DLEA 2AQ4A 1HNVA 2ZUCA 1T03A 5IIOA 1LV5A 8ICYA 4O3NA 5CB1A 2RDJA 4N5SA 5FRMA 3QIPA 2P66A 3MXJA 5KFVA 2ZE2A 3AA4A 4R65A 3PUFA 1JXBA 5DB8A 3CM5A 4O5CA 2IAJA 3C6UA 4KKOA 4PHPA 5CY4A 2KZ3A 4FYDA 3SV3A 3IAYA 2P6RA 4RQ0A 4Q5VA 4MF8A 3JPTA 4ECUA 1LWFA 1X1PA 1VSMA 3GIMA 2B5JA 2YNIA 4B9LA 4M6WB 3RTVA 3ZDAA 1VRUA 2ISOA 1DOQA 1VSKA 1D5AA 4FK0A 4I2IA 4TUQA 3PW4A 3L3UA 5J0SA 4NLKA 5KG3A 1XWLA 1WSIA 3RAQA 3DMJA 1UA0A 4PWDA 2GV9A 3FYHA 1SUQA 4BE1A 4AHVA 1CEZA 3SQ2A 4N76A 8ICCA 2BE2A 2PYLA 4RQ4A 5K14A 5CWRA 4KHSA 1B9DA 4TQSA 1ZBUA 2FMPA 4QWEA 3ZCMA 2UVVA 1NK7A 2X74A 5KRTA 1HUZA 4CJQA 3AVHA 5DGAA 1S9EA 5KT3A 4F4YA 5D4BA 3M9OB 3BQ1A 3C2MA 1S76D 5JS1A 4YD2A 3OYHA 2YNHA 5HHIA 4M9NA 3ZD8A 2BCUA 1TGOA 1KTQA 3ITHA 1FXXA 3VQDA 1BVSA 1RT6A 3WNGA 4MFBA 4CJWA 3NGYA 1QE1A 4FJIA 2NRWA 4DOCA 4UAZA 1NKBA 1BL3A 4I2EA 1Z00A 1ZQSA 3S9HA 4KN4A 4C8MA 4MFCA 4QZ8A 2G8KA 2BQRA 2R8JA 5EU7A 3OYBA 3Q8RB 3ZSRA 3HWTA 1SKWA 3GIIA 2BQ3A 2HVIA 4KLIA 2ASLA 3HT3A 4OJRA 4CIEA 2D0BA 3L2UA 4DG1A 4KHWA 3AU6A 1WSJA 4UB2A 3NH2A 1EKEA 3MECA 1TV9A 4KTZA 4IDKA 4CGFA 3QEBZ 4FLXA 3ZT4A 5KFAA 4KLOA 5IIMA 1A5WA 8ICIA 1TAQA 8ICFA 3LZJA 2FPMA 5J0UA 4H8KA 4Z6CA 4DSEA 2KN7A 2ZTCA 1NK6A 1GOCA 1JLAA 4KLFA 2HB5A 3ZDBA 3ORYA 4E1NA 1W9HA 3HXMA 1JIHA 1S1TA 4W5QA 9ICIA 2HVHA 2FPKA 4CFCA 3HP9A 3G6YA 4EEYA 4NCGA 2D0AA 2OPRA 4OLBA 1JMSA 2W9MA 4QZ9A 5J1EA 4JS4A 3HPGA 1QSSA 4M42A 3QO9A 4N41A 2LSNA 4Z4IA 4EP4A 3AA3A 4TQRA 4ECXA 1MU2A 5KG1A 3DOLA 3V9XA 2P5OA 4K8XA 5D49A 4RUCA 3QNOA 2D5RA 2FBYA 3EW9A 3MABA 4IFYA 2XC9A 5CZ1A 4CGHA 2ZJ8A 4Q43A 4F2RA 5DB9A 3AVIA 4DU1A 4CHNA 3ZSVA 3JPRA 1EXQA 4E19A 1HYSA 5J2JA 4E7JA 4RNOA 4ECSA 4CGGA 3MR6A 4CHPA 2BPFA 1ZQYA 3DYAA 3OYNA 4BWJA 1QLNA 1GOAA 1RPLA 4DEZA 4RQ6A 1U49A 4M3YA 1RT5A 3PX6A 3KIOA 3K5MA 3V9UA 3OVNA 1ITGA 5L1LA 2JGUA 3LWLA 4DS4A 1ZQWA 8ICBA 3VQCA 3CFOA 9ICPA 2BGWA 1RBUA 4O3SA 4N56A 1YT3A 1K1SA 4O5EA 2ZTEA 4B9SA 3VQ9A 4FJ8A 4BDYA 4NY8A 3RJIA 4DU3A 3LK9A 4O0JA 4XA5A 1BPZA 1U04A 3MBYA 4EZ6A 4DTRA 5DKWA 4FJXA 4FLVA 4CJ3A 4FLUA 1JKHA 1BPBA 2FMQA 1RT4A 4CEEA 1NKCA 3GIJA 3GV7B 5KG4A 1QSYA 5KFGA 3QEXA 4PHDA 3CG7A 1RZTA 3K5NA 4J9QA 2ZUBA 5KFSA 3PX4A 3T5HA 1L3UA 1A5XA 3KD1E 4UBBA 2BDPA 2B4JA 4O4GA 1RTHA 2BHNA 5KT2A 4DSLA 4KLMA 3T19A 1KRPA 4UB3A 7ICSA 1REVA 3H8JA 5FDLA 3K58A 3JSMA 2FBVA 3OSPA 3V72A 3QINA 4Z6EA 3UPQA 1C1AA 2IDOA 4QAGA 3TFSA 2XHBA 4RW7A 1ZQMA 5KG0A 4ED6A 3SCXA 4I9LA 4UB5A 4CIFA 4O3QA 1UT8A 1IXRA 2E4LA 3VQEA 4MEXA 3D0PA 1T3NA 3V1QA 1MQ3A 4F5NA 3LAMA 4IQTA 8ICSA 3HPOA 2YNGA 3CM6A 1ZQUA 4R63A 3OYAA 2BGGA 4XIUA 3PV8A 1VSHA 7ICFA 4YMMA 4RZRA 2IA6A 7ICRA 5J2FA 4CK3A 4QW8A 2RKIA 2W42A 2YHBA 1HYVA 5DG9A 5EWGA 5J0WA 5KG6A 4M3TA 4FJGA 3HVTA 5J2CA 1DTTA 1U47A 3BQ0A 2W9CB 4ECTA 4IG0A 9ICOA 4CIGA 3TWHA 1TKZA 4KB0A 2PFPA 3VQPA 1BI4A 4YFUA 4EBCA 3ZT1A 2BCVA 3H7IA 3C2LA 4DS5A 1EETA 3M9MB 1BPXA 2EHGA 1VSDA 2VWKA 4ELUA 5KFUA 3ZSQA 8ICAA 3KLGA 5KRSA 4KMUA 4CHZA 1NOYA 2R8IA 1TK0A 1ZQHA 5HLFA 1IKVA 1HJPA 4CF9A 2G8FA 3JPOA 5HMMA 3MFIA 5HMLA 4KLGA 2OA8A 2IHMA 3SI8A 1L3SA 2EX3A 4M2YA 3AVGA 3THVA 3RBEA 1Y88A 3EZ5A 1RT7A 4CEBA 5KTQA 3T5KA 1BIUA 5EOZA 5KT7A 3HL8A 4E7IA 4IKFA 4F4ZA 3NF6A 3K59A 1TL1A 3PW5A 1ZQOA 9ICMA 2P51A 4FJ9A 3K2PA 4LSNA 4CEZA 3RWUA 4RQ5A 3ZSOA 2KTQA 2AU0A 4J2EA 3QEWA 4IRCA 3Q8MA 2I9GA 4QWCA 3KLIA 2YKNA 1BGXT 5J2NA 4P2HA 4B08A 1C7YA 2ATLA 4KHQA 3UXPA 3QIOA 4PGQA 1LWCA 1VSFA 1UAXA 3VQQA 8ICUA 2MUTB 3LPUA 1VSLA 2C2EA 2HMIA 1UOCA 4PHAA 4KTQA 4PQUA 4M3RA 3NGZA 3QEVA 1UWBA 4R66A 5KFJA 2XCPA 1D8YA 2Z1HA 5KGWA 2ZJ5A 5DBCA 4QW9A 3AA2A 2BKEA 4ECWA 2KFZA 5KG2A 3T5LA 3M8PA 4R8UA 4TUPA 4Q44A 8ICZA 1ZETA 4EZ9A 4HYKA 2NRVA 5CR0A 1QQCA 1V9PA 2W9BB 1RBVA 1KCFA 2ISPA 2HNDA 4ED8A 1JLEA 4KHNA 5HRPA 5IILA 4P4PA 3DM2A 1L3TA 4Z4EA 3IM1A 4NYNA 4B8CA 4FLZA 4CJPA 1Y97A 4M47A 1XS9D 4YVZA 3HYFA 4KV8A 4M0AA 1BCMA 4RUAA 1S9FA 3MEEA 2JZBB 4FS2A 4B9UA 3QEIA 1Q9YA 5KFNA 5SWMA 3B6OA 5KFDA 1U48A 4QZHA 1J9AA 3N4MB 1TKDA 3PR5B 4F93B 4NM1A 2DTUA 2P6UA 3TAQA 4IRDA 4CJFA 2G8WA 4RPXA 3OS1A 3BJYA 2PI5A 2QKBA 4YNQA 4CEFA 4Z6DA 2HHTA 4KAZA 3SUQA 5HHHA 4FJMA 9ICXA 4M9GA 3L2WA 2R8GA 3EWAA 3V1OA 3L8BA 3N97B 5J0PA 4CGJA 3T3FA 2FC0A 4FLTA 1RBRA 5HBMA 3DRSA 3PR4A 4JLHA 3AVFA 3NCIA 1VSIA 3PNCA 3QEPA 4C8OA 4OLAA 3EPIA 3D45A 1IKXA 9ICFA 3L2VA 2W9AA 4KLJA 3V6JA 4ED7A 4IR1A 2ATQA 4M6WA 4YFKA 3LDAA 4XRHA 9ICGA 4FJNA 1FK9A 3RB0A 3OHAA 3UXOA 4RQ2A 2VWJA 4P4MA 3RRHA 3L2QA 1B22A 1S77D 1ZQLA 3VQBA 4J9MA 3M8SA 3IS9A 3HW8A 1C0TA 4QZDA 5I42A 3PX0A 1S97A 2VA2A 3SQ4A 2OZMA 7ICJA 3O4QA 3I0RA 5DB7A 5L1JA 2F8SA 4O55A 3RJEA 5KFWA 4FW1A 4CF1A 4CJ5A 3SUOA 2OPQA 4BXOB 5KFHA 1RYSA 3LALA 1ZQTA 3DLHA 1MQ2A 1HYZA 5KFTA 3AA5X 1N56A 3OYCA 1XI1A 1D9FA 4PHEA 1NK5A 4X5VA 2B6AA 4PGYA 1MSWD 1CZBA 4FM2A 4JRQA 4DTMA 4FBTA 3CFPA 4ECZA 3Q8PB 1BQMA 3TR8A 1XHXA 4CJEA 1NJZA 2VA8A 5KFBA 1LAVA 3TAGA 2RDIA 5KFOA 3TANA 3F9KA 1N48A 1ZQKA 5CP2A 4YP3A 4JV0A 4PPXA 3NF8A 3KKSA 3KJVA 4RT3A 3LWMA 3Q8SB 3UXNA 3AU2A 5J2GA 3RMBA 5I3UA 1TKXA 4E1MA 4FLWA 3LP2A 3H8SA 2FBXA 5KFEA 4TUSA 1ZQXA 4J2DA 3NDKA 5KFQA 5L9XA 4KI6A 1D8LA 3MXIA 3C1YA 4FJ7A 3TQ1A 5KT4A 4KI4A 2AGOA 2JEGA 3OYKA 4DSFA 2OWOA 3B0XA 5CYQA 2HHUA 2MAXA 4BACA 5E41A 3LDSA 8ICPA 9ICSA 1T05A 3A2FA 1RTIA 4B9VA 3SUNA 1L5UA 5C24A 2BPCA 3SYZA 1SV5A 4OGEA 1JL2A 1RTDA 3IRXA 4K8ZA 1RCHA 3JPPA 3NH0A 4EP5A 1J5OA 3KK1A 1RILA 4GLXA 4GC6A 2WTFA 4RNNA 2JEFA 3TAEA 4TURA 2UVUA 3ASMA 3PMNA 1ZQIA 4UAYA 3TAFA 5J2IA 4IG3A 3V7JA 5KT5A 4JK1A 4O44A 4YMOA 4CE9A 1VK0A 1B9FA 3AO2A 4I2QA 4CESA 2VG5A 1ZBIA 3KHLA 3GQCA 3DLBA 1KFTA 1ZQJA 3DLRA 4Z4GA 3PO4A 2F1JA 1C0MA 1MC8A 9ICRA 1NKEA 1RYRA 2DFLA 3Q8KA 4RG8A 4M41A 1J54A 4J2AA 4ED2A 1ZBHA 4Q45A 4AHUA 4KN7A 9ICWA 3VQ7A 2E6MA 2W8KA 3RMCA 2F1IA 4C8KA 4MQ3A 1CZ9A 4FXDA 1ZQEA 3DLKA 2OPPA 3ULDA 2V4RA 3V4IA 2HHVA 4EBDA 1QHTA 4Z4FA 3C23A 9ICNA 1T7PA 4XUSA 4NYFA 4EYHB 5FROA 4F3OA 5DMRA 4YD1A 2DFHA 2FPLA 3QLHA 1TFRA 3QZ8A 3C94A 1JLCA 3V7LA 3SV4A 4DTXA 3E01A 5HRRA 4IR9A 3U3YA 3FFIA 4FM0A 4DF4A 4RQ1A 3ISBA 3NBPA 5KFCA 1YTAA 4NCAA 5HNKA 4F2SA 1S1WA 4LH4A 7ICEA 3PVXA 2W8LA 1TK5A 4DFPA 3JYTA 3OY9A 4ECYA 8ICQA 2J6UA 4FK2A 1XSLA 4O3RA 4BDZA 4CEDA 3LZIA 2OZSA 5DQIA 1B92A 1B43A 4BE2A 4HVJA 4RQ7A 3TARA 3MR3A 5DGBA 3BQ2A 1JLFA 5KT6A 3U3GA 4DTUA 5C42A 2AJQA 3JPQA 3I0SA 4DOAA 4I2DA 3QERA 3NGDA 2PY5A 4RQ3A 4EBEA 1IG9A 4JS5A 4I27A 4UBCA 5DQGA 2XY8A 3JPNA 4DL4A 4AHCA 2YKMA 4OPJA 4DFJA 4AILC 3AVCA 3V7KA 1JL1A 2VG7A 3VQ6A 4CJUA 4RNMA 1S0VA 4CEQA 2GBZA 8ICJA 3M8QA 4CHQA 3QZ7A 4I28A 3L2RA 4I2BA 4YR3A 4KLTA 1WNSA 1WAFA 4I2PA 2IHNA 2DFEA 4F5PA 3U6FA 1J53A 3Q8LA 3ISCA 1CXUA 4CJVA 3PO5A 2HW3A 2FLPA 3RAXA 1C6VA 4C8LA 2W9CA 3BDPA 4DL7A 7ICQA 2A1RA 4QZBA 4EYIB 1IKWA 1ZQBA 4GMJB 3H8WA 3AVJA 4ID5A 3QEAZ 9ICUA 4RPZA 1KVCA 3ZSXA 4DMNA 1TK8A 3LPTA 4FBUA 3OS0A 3CQ8A 4F5OA 1LW0A 3ZT0A 1ZQFA 4R5PA 4MF2A 2HHWA 4UQGA 1ASUA 5DLFA 2RF2A 3V9SA 3QETA 3O3GA 4YR2A 1ZQAA 4J9OA 3SQ0A 2ZQBA 4IRKA 1RTJA 4KTWA 2A1JB 4DU4A 4ELVA 1RXWA 1JX4A 4J2BA 3EYZA 8ICEA 4B9NA 2A1SA 4GXKA 1NOZA 4Z4CA 1ASWA 4DLGA 4QZGA 2AGPA 1NJWA 4CCHA 4J9PA 4DSJA 3OHBA 3OGUA 2AGQA 1LAWA 3ZDDA 4ECRA 2PI4A 3M9NB 1YVUA 4KREA 2VG6A 4Q8EA 3V6HA 4F3TA 3LAKA 2FBTA 4AH9A 3SPZA 1BI4B 1K6YA 4Z0UA 4JRPA 1BIZA 2JEIA 2D0CA 1SKSA 2WOMA 3UIQA 1LWEA 3O4NA 8ICHA 1LW2A 5IIIA 1NK8A 1RDAA 1HQEA 2C22A 1IO2A 1JLGA 4B8AB 7ICVA 1ZJMA 1S1VA 1CUKA 5CJ7A 1HMVA 1KLMA 4WE1A 5J2BA 3PY8A 4J9SA 3LP3A 2W9BA 4F92B 4F4WA 2XGQA 1S0OA 2KFNA 5DBAA 5KFKA 3TI0A 3RBDA 2I1QA 4L8RB 2OPSA 2R8KA 4M3WA 5T7BA 4YXMA 9ICJA 5J0YA 3HX0A 9ICEA 2YNFA 1XO1A 1RT2A 3SUPA 3HO1A 2JZBA 5DG8A 3OSNA 2ZTDA 1VSEA 1X2IA 1KSPA 1WLJA 1WSFA 4ID1A 1XC9A 1EP4A 4FW2A 3OYIA 3PW2A 2IBKA 8ICKA 2IMWP 4Y1DA 3V9WA 5KGXA 3MR2A 2FLLA 3QNNA 3KKRA 4ECQA 4QOZB 2XY5A 3MAQA 5BOLA 3VN5A 9ICBA 2F1HA 3OYMA 4CJTA 2H5XA 2Y1IA 7ICGA 5J0OA 4PGXA 1DGSA 4OKJA 4NCBA 3RB6A 4DFKA 4I2HA 3K57A 4ED0A 4O9MA 4KLQA 1S0NA 3LP1A 4E7KA 4HTUA 1ZQZA 5HRSA 4CERA 4XQ8A 1BPYA 4I7FA 9ICCA 3AUOA 4LZDA 1ZQGA 7ICPA 3UQ2A 2Z1JA 4W5OA 4PY5A 2IOCA 4UAWA 1F21A 4LH5A 4NLNA 2Q0ZX 2Z1GA 1UA1A 4HCBA 1SL2A 1U9LA 1X9SA 4Z6FA 1SL0A 4FLYA 1KVAA 3MDCA 4FJJA 4KFBA 4JV1A 4CFDA 3GFKB 1O1WA 4W5TA 1KDHA 4E89A 3TAPA 4AHSA 2YV0X 3RJGA 4O0IA 1S9GA 3T1AA 4DTOA 3VA3A 1KLNA 5J0XA 4DQIA 4IQWA 4NM2A 3EPGA 3ZDCA 5J0TA 2O4IA 4DSIA 2PFQA 5TZVA 4FVMA 4K4GA 2C2RA 1X9WA 4TSXA 2GUIA 3KHGA 3K5LA 3ZD9A 3G10A 4HHTA 3LANA 5JUMA 2QKKA 1RNHA 3V1RA 9ICQA 5C5JA 3H40A 4BXOA 3P1GA 1FKPA 4M9HA 4QWDA 5SZTA 3S3MA 4FS1A 4QWAA 3ISNC 4FZZA 4QWBA 3MDAA 4GC7A 1C1CA 5L1IA 4ED3A 4HUEA 2ZJAA 4BDPA 4KLSA 3OYGA 4QZEA 3GV5B 5BPCA 8ICXA 1HJRA 3NE6A 8ICLA 7ICOA 2VANA 4GVMA 5F9LA 4ZTJA 2P5GA 2JLEA 1QTMA 3K5OA 4FJHA 7ICMA 3ALYA 4DL5A 2DPJA 1SL1A 4KLHA 2IS3A 5HRNA 4QZAA 1S1UA 4CHOA 3VQ5A 3PMLA 1G15A 2PYJA 3MFHA 3RJKA 1KEJA 3S3OA 2M9NA 1Z26A 4FJ5A 5DDYA 3SJJA 3NGIA 4DSKA 2QK9A 3NFAA 1EXNA 2ETJA 2XCAA 4LVSA 1T8EA 5BOMA
chains in the Genus database with same CATH superfamily
2ZJQL 3FUYA 4ZJLA 3H90A 3PYFA 1ZBSA 3F73A 4B3RF 3E0FA 3BQTA 4WFBL 4LF8J 5EVZA 4USIA 5D3GA 1YJWN 1O6XA 3K4GA 5ETPA 4B3OA 5IINA 1SUQB 2WVEA 3OT9A 1HEKA 3KZBA 3QT6A 3MPUB 4H0YB 2VKQA 1VQNN 3SSRA 1JN3A 1KHVA 3N79A 4NXMF 2W55A 4WQ5A 4LF9F 3UD5A 2W40A 3SENA 3CMAS 2B6GA 1W0HA 3CJ4A 3M2VA 1CZAN 2MKCA 2KZMA 3G2XA 4CHYA 4AFFA 4DX7A 5CYMA 1FNMA 3AVNA 3MGIA 4CD1A 1UKUA 1CJUB 4YMNA 3QU9A 1ZQRA 4CJKA 2VQFK 3NS7B 4YMEA 1K1QA 7ICIA 2K60A 2NRZA 1JLQA 4OYOA 4OJPA 5A8RA 4H5WA 3QU4A 3HJFA 2VICA 1X0PA 1Q7YT 3VCBA 3ZDEA 1D1UA 1YJVA 1JLBA 4DWIA 4WP9A 2WAQC 2YN4A 4BRKA 1NHKL 2RT3A 3JTNA 3QJPA 1UVMA 2NRRA 5ALKA 4CEOA 4DQQA 1KXPA 2R7TA 4IQUA 1QQ5A 1VRTA 3CCZA 4BQZA 3TUPA 1NM2A 3O3HA 4LR9A 3RJFA 1MWQA 4JKHA 4HL9A 1ZQPA 4OQJA 4KE5A 2MQPA 3KFWX 2ZEJA 3PJXA 2N7CA 4CJLA 3QE9Y 4MYUA 2DR6A 4NASA 4RWTA 4R0JA 4I2JA 3KK1B 1S1TB 3NF7A 3P83D 1Z4UA 5CA7A 5L38A 5DK5A 4DQPA 2R7QA 4MKYA 2EKYA 4DJBA 4NCGB 1DGKN 2LPEA 1I1GA 3CCWA 1ZQNA 1Q7YO 5HP4A 4X62K 5HMZA 1KNZA 1X4FA 3J80O 2DTJA 4YOVA 4X65F 4F8RA 2WF8A 8RUCA 2ZDOA 3RJJA 2F9JA 4ZPBA 2E9ZA 3B82A 1KFDA 1Z25A 3WK9A 4ED4A 1KAYA 3PTWA 3AQFA 1U2RA 1REGX 5GMKa 5AQVA 3RR7A 3F2DA 2DNKA 3OJUA 1ACMB 5JVGQ 1X7VA 3H5SA 3I76A 2IJFA 1HYSB 4ZH4A 1TL4A 3NF9A 8ICMA 3AB4B 1DURA 2XGPA 2AEFA 3WHIA 2B7CB 1C1BA 2GJIA 4O4RA 3R5GA 1R8PA 1RUSA 1XMQF 4CK2A 3MN5A 1NOMA 4K0KF 4OJHA 5KFMA 1FKOA 3RB3A 2QC3A 3ENHA 4HCCA 2VGMA 2XRIA 3QGHA 5DQHA 5GADI 3UD3P 3WNFA 3TEHB 4YQWA 1SXDA 2HCFA 2FJDB 1TVRA 2WW8A 1Q78A 5AI0A 3MM6A 2QWRA 3CJBA 3AVLA 1V97A 2BANA 2BCQA 1WCLA 3O3FA 2QEXN 2UVWA 1RAIB 4CYUA 2EWHA 4J37A 3HRGA 4RW4A 4DTJA 3C3LA 4ZOHC 2EFVA 3VVTA 4PL1A 4NLCA 1S99A 2OLWA 3IM9A 4UTGA 4EMDA 1UEKA 1DZ5A 3UQ0A 4TLQA 3O0FA 3AO1A 5KQ8A 2CPRA 1ZRMA 2W2PP 1U02A 5AJ3J 4JI4K 5F1XA 1CJTB 5CAAA 4YDUC 3NH1A 4MLEA 2P9NA 2I7NA 5KFRA 3QRQA 1QUPA 1FXRA 4LVNP 3OYFA 2YXLA 3J7Z5 6FD1A 1U2CA 1EB0A 1KQGB 2G8HA 2WB4A 4OX7A 3HM9A 1WKLA 3IFRA 1RT1A 4QCLA 4MDBA 1ASVA 1PBUA 2PEBA 1ZQ1C 1BCOA 4A48A 5AK3A 3I28A 2ZITA 4LZGA 3LL3A 1IWGA 5GINA 2PFOA 3JTOA 2YJEA 3HKZC 2CXEA 4EFAC 1F3VA 4O5BA 2J9EA 4JK8A 1ILYA 4OZNA 4AHRA 4G1QA 4DL6A 2ASDA 2VA3A 4FZVA 4LRDA 3MM5A 3SMPA 2YNGB 1BD6A 4JI1K 5JVHQ 4KHYA 3HVRA 3I82A 2YJFA 3JPSA 2ZIVB 3G6EN 4DR3F 3KK3A 5GAGI 3QFUA 2F65A 2K4PA 4J90A 3UR3C 3RR8A 2I6XA 4CEAA 1KVBA 3IBPA 4ZLNA 8ICGA 4X66K 2VUGA 2KRRA 4ECVA 5JMVA 2AA4A 1LQ9A 3BN4A 2A6OA 4U96A 3VWSA 2K3KA 1RWPB 3HVTB 3MGHA 3TUJC 2RNEA 4IG0B 2PE8A 3IA0A 2UXDJ 5KFLA 4NZ0A 4DCPB 4YN4A 1WI6A 4CH1A 3IWXA 1BHLA 4AL5A 2D3DA 1VC0A 3G6ES 2LQJA 2E5HA 3I6PA 1EETB 2MUTA 4JKGA 2KSOA 2ZVSA 2RE1A 2XMMA 4HUFA 1IWAA 3OXLA 1PZNA 4RW6A 2KG1A 3KK2A 3TO8A 2I1RA 2KG0A 4DI6A 5HQMA 3BR8A 5IT4A 1H73A 2CN1A 4DR1J 2QW9A 2LEAA 4I67A 1G7CB 2KE7A 2ACYA 3S6EA 1Q82T 3RU0A 2FTRA 2LM4A 4JI3J 3AVMA 4OPKA 3FDSA 2P6TA 1GLLO 3UD4P 2ITGA 4ZCKA 4K4IA 5KFPA 1VQSA 5B0EA 2G9OA 1Q5VA 2G8VA 5DBBA 2DNYA 3GR0A 1FE4A 2ZKTA 1N8RT 1B70B 3DOKA 3J81U 1DXSA 1AROP 3OYDA 4F4AA 4B9TA 2OYYA 1LWEB 5AI4A 1RAAB 1U8WA 1BUXA 1R0AA 3PLAA 3KLHA 1IKYA 4WYLA 4G3IA 4B9MA 4C8NA 5TKYA 3KLIB 2AX0A 4NZ7A 2PAVA 5DLGA 2J0QD 2FMSA 1T9VA 3B6PA 3ZZYA 1B4SA 4M9JA 2WF6A 4UASA 3V81A 4DQRA 2NRTA 2KHVA 1Q82O 2JEJA 5HL7L 1V85A 4EAHD 3AO4A 3C5GA 1UWBB 4P2MA 3UNYA 3RH4A 4PG5A 1PIEA 2DGXA 2K06A 1FF2A 1FRLA 5GAHU 1QH9A 3HBTA 1HNWK 3O1BA 1QTNB 1YIJS 3JXOA 4LMZA 3I31A 4DV4J 1N8RO 3G6XA 1I39A 2NO5A 2BCSA 5F0XA 4UB1A 1VSJA 3T69A 4OYZA 5F8HA 2WAQD 4WTYA 4M5LA 4K5SA 2KVQE 4PXBA 4IEIA 3F2CA 3BKFA 1ZJNA 4F4XA 1XSPA 3GL1A 1WOQA 1AFJA 3CCRN 2CWKA 2DFFA 5DM7L 4JI0K 3NVMA 1XMOK 2FJ6A 2BRLA 4DV2J 3SMSA 2J6SA 1GEHA 1S6QA 1C4AA 3A8IA 1NDKA 9ICAA 4QZFA 3J80Y 4AXJA 9ICLA 3AVKA 3CCQN 1D8ZA 3P39A 3OS2A 1WC3A 4CJSA 3DLEA 2AQ4A 4Y2XA 1LV5A 4LFBJ 2AJ4A 2VGNA 4JI8K 4JYAK 1KDNA 5FRMA 3T79A 3QIPA 3FZMA 1GT8A 3CCEN 1GQEA 5HBMB 5D0HA 3ZTPA 4WWSA 4NA1A 4FYDA 4R25A 1BUPA 2HS3A 2GCFA 3IAYA 2P6RA 1S9GB 1RU2A 1B7FA 3EL2A 4ECUA 4AL6A 4LFCK 2A5XA 3EUNA 1SKUB 4O3MA 3PJWA 2IOFK 2Z2ZA 2I38A 5A0LA 3UMGA 3MXHP 4PWDA 3QRPA 1UPMB 1UFKA 2GV9A 3K1ZA 2CPXA 1IV8A 5U47A 1ZAVA 3IGVA 3NNCA 1WC0A 5LJVA 1VQMS 1NSAA 2NSCA 5LMNJ 4AE5A 1LKZA 2HGMA 3D2NA 4X84A 1NK7A 2OAUA 3A0BU 2WHOA 3DDKA 5KRTA 3THTA 5DGAA 2LCWA 2FDNA 3OYHA 4BRPA 1HNXK 2BJ8A 2ZUGA 2JL9A 4M9NA 2OD6A 1ZBTA 2BCUA 4PXDA 3ITHA 1EZZB 5ALHA 1RT6A 4JEPA 1FKAF 4ED5A 3BGLA 4MFBA 3ILLA 5G4DA 3WXJA 1QE1A 2P5VA 1UQVA 5BPLA 4FJIA 2JV3A 2AZ3A 4NL9A 1QQ6A 3ULEB 5AQJA 4QQBA 4DZDA 5G0RA 1G4CA 3QICA 4MFCA 4QZ8A 2G8KA 2BJ1A 1UZDA 5ALXA 3CIPA 3DNCA 3K17A 1SKWA 3JS9A 3GIIA 2FC9A 4BRDA 2DEJA 2HVIA 1HLWA 3CJSA 4OJRA 1S12A 3AU6A 1KN6A 5D3GB 3MECA 2KT2A 4KTZA 5I3UB 4KBOA 1N33F 4DR2K 2EANA 2V34A 2VWBA 4KLOA 5IIMA 4FYVB 2FPMA 5EE1A 5J0UA 4Z6CA 1OH6A 4ZVSB 2NNWA 2HB5A 3VAGA 3ZDBA 2K3IA 2L9NA 1I94J 4E1NA 1JIHA 2QKQA 2XLIA 4W5QA 9ICIA 2DD8S 4LFAF 2P9KB 1M1GA 5CYMB 1HA1A 4EEYA 2D0AA 3DRXA 3LQVA 2EBGA 3OR2A 5C24B 4A8FA 4M42A 4H5TA 4NZ6A 3G82B 4CT8A 4M5JA 4EP4A 4QIGA 2A0FB 5A8RB 1J5OB 3QNMA 5AQOA 2PBDA 3V9XA 4K8XA 1OQ3A 3F5EA 1WJ9A 2GW8A 3K2YA 4OPHA 5AIAA 1FERA 5AJ3F 1JLBB 3NASA 3EW9A 4H0VB 4IFYA 2Y9TA 4U67L 2XC9A 1P9QC 3EGVA 1SV0A 4CGHA 4MIBA 4Q43A 3M1VB 5DB9A 4CTAA 3ZSVA 1UPPA 1NLKL 4I2QB 5J2JA 4CGGA 2BPFA 1ZQYA 4CP5A 1WHVA 3GPAA 1VBYA 1RPLA 2GQ2A 3X1LB 4A57A 2YWGA 4M3YA 4NE9C 4DR7J 3RFAA 3ELHA 1NGEA 4FWRA 1X5SA 4LF4K 2RQKA 3MC1A 5AQXA 1UP1A 1PAUB 1HNZJ 1TAMA 1IBKJ 4MTPA 2RLTA 2MDAA 8ICBA 3ET6B 2OPPB 4CLYA 3CFOA 1IBMK 2F9TA 3TWZA 1B0PA 3O5BA 4MAKA 3TNVA 2KNJA 3IAS9 2IA0A 3TKAA 4FJ8A 4NY8A 1K8AO 2VU5A 3BPDA 4XA5A 1LCUA 2H1YA 1S59A 2D3OR 1MN9A 3MBYA 3UNGC 5E0OA 4CLWA 4ANCA 3HKWA 1JKHA 3K1RB 5KG4A 2XMWA 4PHDA 1RZTA 1C2PA 3P5BP 1C1BB 3ENVA 2KHDA 5KFSA 3KD1E 2CQIA 3H20A 2DGVA 2B4JA 3EXYA 2GHVC 3T19A 1KRPA 4UB3A 2M5YA 3JSMA 5BPNA 1XQSC 3OSPA 3V72A 4F67A 4LF7J 3QINA 4Z6EA 1SJFA 2HOEA 4P74A 1JNZB 3I56S 2RIJA 2IDOA 4NLVA 3VEOA 2CPJA 2PO4A 1MMDA 2ZG6A 4QNLA 3CPWR 3UW1A 1U1MA 4RW7A 4I9LA 2AX1A 3QX7A 4UB5A 4MKAA 3U9DA 2VIHA 2ROEA 2FHJD 4OD0A 2HFNA 5HO4A 3D6RA 2I8EA 3VQEA 3D0PA 4DR1F 3GYGA 3MTKA 2PMZC 3LAMA 8ICSA 1RA6A 3F0NA 3N4WA 4JI3F 2KHCA 2PA8D 4GKJJ 4OX9K 2K8AA 2OKQA 2VG7B 3PV8A 3CJ7A 2VBYA 2A10A 4C3MA 1WACA 2HZVA 2P9NB 2EEYA 5LM7E 2IA6A 7ICRA 1RSCA 5J2FA 1FDDA 1GO3F 3M8QB 4UT4A 3R1XA 4AYBF 2LA4A 3ZZRA 3VQTA 2Q0UA 2DNNA 4CZFA 2C2NA 5DG9A 2GNKA 5J8YA 4M3TA 5KG6A 2AJ0A 4F0MA 1R8HA 1DTTA 3BQ0A 2BUPA 9ICOA 4KX5A 1RAHB 1TKZA 4KB0A 2DH7A 2KP7A 2PFPA 2G0AA 4USVA 3MEKA 2VQEK 4JI6F 1JNRB 4BRCA 3M9MB 1BPXA 1NRKA 3AQPA 3CDEA 5B7WA 3ZZZA 4ZLLA 5KRSA 2RF2B 5AXLA 2E1CA 5GMEA 4N77A 1NOYA 1WWUA 5CEHA 4DV4F 1T9UA 1SJ3P 1RHUB 4U7UD 2DYAA 5HLFA 2NPIA 1OO0B 1T9XA 2AEJA 5HMLA 4OHWA 1D09B 3C16A 4KLGA 1HBMB 4CZJA 3KK3B 1YQHA 1RZMA 1QQOA 5HQ8A 3ID6A 1RT7A 1N32K 3T5KA 1BIUA 4E7IA 4IKFA 3K59A 1Q8LA 1ZQOA 1WDDA 5ADZA 2KIVA 2W11A 4IDHA 4ZP6A 5M1PA 4CEZA 1QVGR 4NLXA 5E2QA 2B8PA 2HWHA 3KMSA 1LNQA 3H3OB 2YKOA 4OJ1A 2I9GA 2K8GA 5BR9A 4ZIWA 4DPYA 2UU9K 1QVFR 1Y4ZB 1ICEB 3QB0A 3QIOA 4P2SA 1LWCA 1TUVA 3VQQA 4QOTA 2MUTB 4A47A 4LFBF 2HMIA 4PHAA 1FJCA 1JLGB 4Z7YA 2GAHC 5KFJA 2XCPA 3NRWA 4WP8A 1S1VB 2DCLA 4RW6B 1IQZA 2KFZA 2DVIA 3I55N 3M8PA 8ICZA 2NRVA 1C0FA 5CR0A 4DUZK 1V9PA 2W9BB 3L5KA 1NMDA 3AAQA 2ISPA 5C2DA 3CMEN 1O08A 1FNXH 4KHRA 3DM2A 1NZ8A 3IM1A 2FJXA 4PKHA 2OP5A 4CJPA 3P5TL 2HFSA 1HJOA 4YVZA 3HYFA 2YNFB 4M0AA 2A1BA 2RUGA 3W7BA 2CG4A 4USHA 3DOKB 3MEEA 3W0LA 5LJ5Y 1Q9YA 3W8GA 1U48A 1V9OA 2WFAA 2N4CA 3N4MB 4ZPTR 3I55S 5LSOA 2FDRA 5B0CA 3TAQA 1L6NA 2XB2D 4CJFA 5F3ZA 3WQPA 3BSNA 4B3SJ 4IKAA 4UY8O 4U7UK 5B66U 2GVDA 2QKBA 4DV6J 4CEFA 1OY8A 3V81B 3RG6A 3QDKA 3CC4N 3SUQA 4EHUA 4OJLA 9ICXA 3FBFA 4M9GA 3L2WA 4QIVA 2Q2RA 2G0JA 3V1OA 3L8BA 5BN8A 3PKMA 4C8YA 4CGJA 1RBRA 3BR9A 1KR4A 3HM8A 1V4SA 1SIWB 3AVFA 5KAFU 3PNCA 3IDWA 1IKXA 3DOMA 3NNAA 2W9AA 1WYGA 2LBOA 2UUAK 1N5VA 1WUAA 2CGKA 4M6WA 2DWQA 4H5NA 4YB5A 4PKDB 1XBWA 1FK9A 2VONA 3OHAA 4LC9B 2VBZA 3CPWM 3G8TA 3ZLJA 1VC5A 4HR2A 1QDUB 1F2HA 1OH7A 3PRDA 1B22A 2GFFA 1NB7A 1ZQLA 5M2RA 1YITS 2KD1A 1S6QB 1C0TA 1VHXA 2OZMA 2K4IA 3CCSN 4OJ5A 4A4JA 3BYPA 1HLUA 4I6AA 3O4QA 2EDUA 3CCVS 3E58A 3LDLA 4ENOA 2F8SA 2AJ1A 4O55A 3RJEA 2PGCA 1I94F 3TX8A 4CJ5A 3AAWB 4KHMA 4KB7A 2Q66A 2QSWA 1AUDA 4BC5A 5KFHA 4OI1A 3QIPB 1ZQTA 1MLAA 1MQ2A 4OZ0A 3RGIA 1S5ZA 2J0WA 2HMPA 3OYCA 2GX8A 4Y2SA 2N3OA 1C1CB 2FHKA 1NK5A 3FCHA 1VOMA 2PN6A 2W1BA 4C8ZA 3A5LC 4JD2A 4FM2A 4DTMA 3C19A 5ALDA 4ECZA 3GFXA 1F2GA 2DQNB 3KK7A 3OFEA 1NJZA 5KFBA 2Y1RI 1LAVA 3R27A 2MSSA 1N63A 2WBRA 1N48A 4DPTA 3J81j 3BBCA 3NF8A 2A6MA 1UPHA 4RT3A 3LWMA 5AKZA 2CQGA 4QJFB 3AU2A 5HMYA 4B3RK 1TKXA 3WC0A 2UV8A 3PJ9A 2HQCA 4JHDA 2ZNYA 3A3PB 4RUBA 5AQIA 2R7RA 1NGJA 2FSNA 2L41A 3NNHA 2E5GA 5KFQA 4NLPA 3AQOA 4DR7F 2LDIA 3R8YA 5L9XA 3ILOA 4G1IA 3W9IA 3J80U 2JEGA 1HNZF 1U0HA 2M7SA 2VPXB 3OYKA 2AYEA 1S48A 1ATRA 3SBTA 2MAXA 2Y0SF 1XUPO 2CPIA 4NXMK 4LF9K 3WDOA 4CO3A 1RTIA 4B9VA 2EFNA 1IR0A 4X64J 1U6FA 3SYZA 4CLSA 1LXJA 3D2EB 1K73T 2PMWA 1YHQS 2ZJRL 5G0RB 2CJYB 3VQSA 3MUMP 2Z30B 2UXBJ 4QYRA 4JI7J 4TURA 2UVUA 2CPDA 1BWVA 4UAYA 5J2IA 2NXJA 3B4DA 4YMOA 1S7HA 1ZTTA 1B9FA 3AO2A 2VG5A 5B08A 1ZBIA 5K8MA 3A0HU 1K9MT 1AW0A 3UKUB 3R1HA 3DLRA 1IUJA 2WF9A 2F1JA 4WU2A 3EVWA 3O9RA 3VTHA 3AODA 2JDJA 1Q86T 3KD3A 3NMRA 4ED2A 1KQSR 1ZBHA 1T3OA 3QUTA 2D1KA 4IC9A 3VQ7A 1SJ1A 4C8KA 1K73O 2B8QA 4K4SA 1RHRB 4W90B 5M1FA 3NS5A 3ULDA 2ZOGA 3V4IA 3LF0A 1QHTA 4U7BA 5C10A 4YOTA 5AKHA 3SBGA 3HILA 1BA1A 2DITA 3FZFA 5LL6Z 3ZETB 9RUBA 4JI2J 5T7LB 4XUSA 3NWRA 4PJ0U 2JC0A 5DMRA 1TQLA 3TR5A 4AXIA 3U1LA 4X65K 3LVWA 4A8EA 2GO9A 3QLHA 4LT6A 5IS2A 3C94A 1JLCA 2EBEA 4QPTA 4IFYB 5AZIA 3RJMB 4FM0A 2DBYA 4DF4A 1JXVA 1ZC6A 5FLXO 3TSPA 4RQ1A 4K42A 1Q86O 3THYA 4OYWA 1UFLA 5JJBA 4WFAL 7ICEA 5D0EA 4KGMA 4NLTA 5E3RA 3JYTA 4R79A 4ECYA 4TXSA 2J6UA 3CF5Q 1FRIA 1FJEB 2QLJB 4HH0A 4FK2A 1XSLA 4W98A 2OZSA 4F7VA 2DHHA 1GX6A 4RQ7A 3TARA 1XMQK 3IG8A 2G0CA 1L8OA 2ZBPA 3MN6A 4K0KK 3I9ZA 3HT0A 3BKUA 1IG8A 5C42A 2OFHX 4XK8C 2DL0A 1RI7A 2W7PA 2NXCA 4DOAA 4I2DA 2XS2A 4D3GA 1KN5A 5M2PA 4I27A 4U8VA 4B3TJ 1PUZA 3D5MA 4AF1A 2YB1A 4N7TA 5DQGA 3DHWC 1X4HA 3JPNA 3N01A 2YKMA 2Q0RA 3FRYA 1EARA 1I5OB 2HIYA 3VQ6A 2QMUB 2JWLA 4RNMA 1B99A 4TLRA 3KWGA 2W2QP 3IMQJ 4CEQA 3HD1A 2CQ4A 8ICJA 3M2UA 3L2RA 1O5JA 3QZ7A 4CVNE 4I2BA 3OPKA 2CQPA 4B1WB 1N34F 4YHHJ 1RBLA 2M8HA 3E1YA 3EX7B 5AKYA 1J53A 1CXUA 3ISCA 4CJVA 3JSMB 4ILJA 3QBWA 1HARA 4C8LA 4ZPWR 1Q5YA 3J7YP 4DL7A 2K4HA 4QYZK 2FGOA 2I5HA 1MNEA 3CSKA 4ID5A 3ZSXA 4DMNA 1TK8A 3J8AA 3LPTA 2F4VJ 3TVYA 2K8BB 4JN4A 1ZQFA 5ETRA 2HHWA 3F2KA 1LKYA 2MZ1A 1RAOA 5DLFA 2Z58B 3V9SA 3QETA 1YRTA 4C98A 2KXNB 4PCQA 3ETMA 1UVNA 3SQ0A 1D9AA 4CDGA 2RILA 2ZQBA 4OFZA 1RTJA 4ILMA 2HBJA 1RJJA 1PYOB 3EWGA 4RBVA 4YB1P 4UAUA 4H0XB 5L9NA 5FPNA 3EYZA 4HT7A 4GXKA 3QWPA 2EFQA 2FVPA 5E26A 2HBYB 2DGUA 3MM8A 3OR1B 3MM7A 4DLGA 3HX9A 1FJGF 4DR3K 2ZHOA 2N1RA 2DRAA 2W4DA 3UCGA 3OGUA 3CMQA 3O8WA 3DXKA 3H2LA 3ZDDA 2XBPA 3SQIA 3F56A 4S0MA 4B3SF 2GO7A 2VG6A 3PFOA 5J2MB 1UJ4A 4ZVFA 4IS7A 2FBTA 3HCXA 3MMBA 4DV6F 1YBTA 1PILA 2DXEA 1SKSA 2CNKB 2G2ZA 3UIQA 8ICHA 4USMA 2B0GA 4BRFA 4YOWA 2LKZA 4US9A 1C0UB 3A13A 4ZVHA 4B8AB 3THXA 1CUKA 3MN7A 4ES3A 1QQNA 5J2BA 3PY8A 3KJNB 4KHPF 2BJDA 5HLFB 3T7ZA 4XPEA 4KC5A 3RW7A 2XGQA 1N6QB 2KFNA 1WWVA 3V6DB 4ZITA 2POKA 2I1QA 1RT7B 5AQRA 2P9UA 9ICJA 3P45B 4I64A 2XZTB 4FL9A 3F5AA 1HKGA 2P9CA 1VSEA 2V51B 1KSPA 1WLJA 4ID1A 3IV6A 1RM6C 4RU2A 4ZVEA 3BS5A 4P0QA 4WFNL 3ONQA 3PW2A 4RW8B 3U1NA 1HQUB 1N5QA 1S79A 2ASOA 1OXJA 2VIXA 3PXGa 1RDWX 1M6YA 5G5HA 3D68A 3CD6S 3VN5A 2QN6B 9ICBA 2HMIB 4JI5F 4OCZA 1FA0A 2W2OP 3CCJN 2H5XA 4KR0B 1K8KA 4M1KA 4PGXA 2Z2MA 2C3YA 5AFUH 3D0GE 2IY5B 4I2HA 3D1OA 3N9UC 4MH8A 3NG8A 1VR6A 1WNEA 4CLTA 5HRSA 2J4RA 3LTOA 2KLAA 1BHNA 4Q0BB 2OH2A 9ICCA 2MPUA 2YWHA 2ZC3A 5A6PA 1ZD3A 1GLAG 2G1DA 4PY5A 2IOCA 2R3VA 1F21A 4LH5A 4NLNA 2HOFA 2QT7A 4CT9A 4ZMMA 3MEEB 4JV1A 1N5YB 1RWKB 4W5TA 1KDHA 1N2XA 1WC4A 4O0IA 3M6UA 3EGZA 4H0TB 1FE0A 2GS8A 3QFHA 5AKEA 2MQLA 2Y8YA 3EPGA 3H0RB 2O4IA 2PFQA 2GVDB 5HVFA 4FVMA 1N0UA 2E9RX 2DKZA 2C2RA 1ZAXA 1MROA 3ZZTA 3ATUA 2GO8A 3C29A 4LR7A 4BXOA 1FX2A 4RBUA 5A76A 3K5PA 2E20A 1R6VA 3P96A 5SZTA 5KOXA 2O8DA 3ISNC 4FZZA 5THWA 5FLXY 3EZUA 3W5XA 4X64F 2KOBA 2FVRA 4GC7A 5L1IA 3DRYA 3R6GB 2F5GA 4BDPA 1IKXB 3DOMB 3QAEA 3OYGA 4DHVA 2ZH5A 4K4YA 1FEHA 3RF9A 2O8FA 2UXBF 4JI7F 1XNRJ 2P9LB 3PIOL 4ZTJA 3JQKA 2DGOA 1X4DA 3K5OA 4FJHA 2DPJA 4UF4A 4CHOA 2Q36A 3L4QA 1G15A 2PYJA 2LYVA 5GIPA 3AGKA 1LWFB 3NGIA 4DR4J 2YHXA 2YNIB 1YUWA 1T8EA 1U4BA 5J0QA 5KFFA 1ZM4A 4ZHRA 1ATNA 4DLEA 2Q3SA 4CF0A 2ZJQQ 3OTEA 1R6YA 2HHSA 4CLFA 1S5LU 4UB6U 1FD8A 1H38A 3LOUA 3R6MA 3PFEA 1FWKA 1Z1BA 1E6YA 4WFBQ 5K14B 3G71N 4NXZA 4I6WA 1B64A 4DX8H 2RSQA 3DWLA 1NG9A 3E9OA 5AQKA 2JH3A 1S9EB 1ZOTA 4CGIA 2XS5A 1Q81T 4RW9A 2DPIA 3CJ9A 4JI2F 2NZCA 4KPYA 2CNLB 3SPYA 4NXNJ 3NVKA 2W25A 4W5RA 4FPRA 3MXMA 1PCAA 4KAIA 4DCCA 8ICVA 1HHTP 5HP1A 4CGDA 2HHXA 4E3SA 3BSCA 4JK7A 2W24A 2MKHA 2YH0A 2I5JA 1XO0A 4USTA 1NJXA 4ZJOA 3H4BA 2UV8G 4Y2IA 5CHGA 2MQQA 2QGFB 1Z00B 5I3PA 4HHHA 2RRDA 1GLFO 5EX3A 4DOBA 4L6V3 4YOXA 1HW8A 1Y5IB 5HVGA 4DG1B 1N33K 2LQBA 4V19S 2ASJA 2DNRA 3L3CA 4J7CA 2L9WA 3QGPA 1SKRA 2QO3A 1Q81O 4PZNA 5GAEU 1RBTA 4K4VA 2CGJA 4M04A 2GWSA 4O8KA 3RRGA 3NL0A 3QESA 3BF4A 1NH7A 1YTUA 1RKIA 2ZVIA 3Q7BA 3GBTA 4OYXA 1FO4A 2OELA 4LFAK 4B3TF 1TAUA 1ZAWA 5IC6B 1VQ4N 2IYGA 3MCPA 2JVOA 5KQDA 2PC6A 3UR0A 1E3MA 3PYDA 4GV3A 3P6YC 2XY6A 4GIBA 2G5HB 1B3TA 2OTJN 1KOHA 3R3TA 2OXOA 1JMTA 5H9EJ 1S10A 4FF1A 1GMVA 2H3IA 2KXHA 1WCNA 4BVOA 1J2MA 3QO9B 3GSIA 2IGIA 3DXBA 2VG5B 5AJ3K 1ZBFA 4YHHF 4OI6A 2DXFA 2H4YB 4KO0A 1D4XA 1F9EB 1ZQCA 3TABA 2FGCA 2V4JB 3RMDA 1TL3A 3MEDA 4FZLA 4DL3A 5JXSA 4BR5A 4NI2B 3ZTSA 5AZJB 3WBZA 3OV7A 3MUTP 3KD5E 1NGAA 3TJ9A 2OTJS 3VCDA 5B0AA 2HK3A 2L48A 2F4VF 4FZYA 5M2UA 3VGMA 2A41A 4O5KA 4RO0A 4UATA 1RT5B 2YHAA 5IZHA 1IXKA 4AYBD 3Q8QB 2MU2A 2BE9B 4RWWA 1UT5A 4GO7X 2ZIXA 2X6NA 2CPEA 2QLBB 4M3UA 4OIXA 3HK2A 5H9FJ 2C2MB 4I2GA 1WAJA 5AZIB 3FBCA 1JJ4A 5RUBA 5CHIA 4WZMA 3CVKA 3K8VA 3MK6A 2COLA 3IG5A 1Q3VA 3MR5A 3L3VA 4PH5A 2Q31A 4V1Ak 2JH1A 5GTHU 3C95A 2DNOA 1TL7B 1UAWA 3EE8A 2V4QA 2ZH2A 3AO3A 1H7WA 5J2DA 2E1YA 4KRFA 3HMJG 1N0VC 3TFRA 2O4GA 3TP2A 4YCXA 2QTWA 3BB5A 4RKUC 3SQ1A 3C15A 3FZ2A 3G4SN 3AN1A 2QLXA 3DI6A 3WXIA 4HKQA 1AZSA 4LREA 1TVAA 1APSA 5E84A 1JXLA 4KPCA 1RTHB 1KL9A 2OCEA 1UMJA 5E3QA 1R43A 3GIKA 2HOIA 3A5OC 5IIJA 1WSGA 3O5TB 2EG2A 2NPFA 5E3AA 2YMMA 2FLNA 3AV9A 5D8HB 4M5NA 2WF5A 2YKMB 3FBEA 5J29A 1VYAA 5ALNA 1RHQB 1TKTA 1QCKA 2A1JA 3AOAA 4ZP8A 4JV2A 1S6UA 2F44A 4CO0A 4DR1K 2LLZA 1XNQF 2HI0A 1DQ9A 1X6JA 3SFGA 2CQ0A 3KMQA 3MX5A 4JI3K 2QB0A 2G0IA 3ATVA 3SR6A 3KDOA 4M3ZA 3KLEA 2ES6A 2C3PA 5HSPA 1S0MA 4CFAA 4ICLA 2OM6A 3M8RA 1RDCA 4G9ZA 3O8MA 1GTEA 3MWTA 4CZGA 1Z19A 1RAJA 5ETKA 1FI4A 2DUYA 4CO1A 2ZHAA 3ISND 2RJZA 1A76A 7ICHA 3UVJB 1DT9A 3SI6A 9ICTA 4C11B 1LKYB 2KK0A 4C0BA 2JLGA 4CK1A 2DNZA 1KFSA 3LDQA 4JI6K 3ZZUA 3VA0A 3SDEB 4L74A 2ZUDA 2E5JA 3VOVA 1SH3A 3HVAA 1Z3EB 5EY4A 2W4PA 4BR4A 4FYWB 1VBKA 3HFKA 2FVQA 3KZIU 4DV4K 4QZCA 3H2UB 3SLCA 2KQ2A 3CXCR 1P1TA 4DL2A 1ZQVA 1WC5A 1BMQB 2DXDA 4YR0A 3DV9A 4OO1J 4PKIA 2KN4A 1HUOA 3L95X 2MY8A 4ZCIA 4DV7J 4FWOA 3WX8A 4R64A 1YX2A 3VAJA 5ALMA 2KVSA 3MMBB 4KLEA 2HBQB 3ZT2A 4URQU 1VMBA 2GQCA 4CECA 1HNIA 3ZT3A 8ICNA 1TV6A 5ALZA 3QJLA 2O8CB 2HNZA 3HPHA 3UCZP 5J2NB 1NGIA 1U6BA 2K1RA 2CIMA 4JWMA 1XU4A 4WTOB 4LFBK 2V8DA 2DRDA 1T4GA 5BRFA 5CZ2A 2QZ8A 3BEGB 2W3SA 2CNNB 2F7VA 2APOA 4U7CA 1T94A 3ETLA 2DPNA 1UW9A 4DF8A 1H0HB 3I5AA 1A77A 7ICNA 4R8UB 1XNRF 3Q23A 2HVDA 4G6VB 1XSNA 2E1MC 4MEYA 5HL7Q 1EAYC 3MMCA 2IFXA 1K47A 3P38A 1Q8IA 5HROA 4LRBA 1GOBA 2ZFHA 3SAFA 2HNDB 5C25A 4P0QB 3AY9A 4DR4F 2MQOA 3C6TA 4TN2A 4BLGA 2ZD1A 3SZ2A 4DR6J 1NZAA 1DTQA 3GLJA 2BQUA 2M0GB 4BVPA 3D6JA 4P0PB 1OYDA 1RADB 1BQNA 2WVFA 4AHTA 4CF2A 4CJRA 2A42A 3H08A 8ICTA 3G8SA 4ZLPA 5AK6A 2EI5A 3DLGA 3QBXA 2RU3A 2IVOA 5AT1B 4IH5A 3MDQA 4KT0C 1OPZA 3CC7N 3C1ZA 3D7SB 4JKEA 3NUQA 2R8HA 1PVQA 5DM7Q 3J81O 1H72C 3I33A 1WSEA 3OTOF 4DV1J 5J2KA 3FQLA 1HRHA 1XHZA 5KFYA 4RBTA 5AM2A 1FVQA 2MHEA 1V5IB 5HR7A 8ICYA 3OW2M 1YJNS 4H5RA 4NXNF 2DGTA 5BJRA 3QYYA 1SB6A 3HI9A 1VRQC 3MXJA 3SQGA 2HBRB 4R65A 2ODGA 4A5BA 2QV6A 1YJ7A 3H59A 1JXBA 5DB8A 3CM5A 2IAJA 4KKOA 1U7LA 2G2YA 1RE1B 4PL7A 1GXTA 4HDHA 4L3QA 1BY9A 2E7XA 4OYMA 3SV3A 4IOXA 4JAXA 1NDPA 4RQ0A 2J76E 2A2DA 3JPTA 2KKZA 2B5JA 1L7OA 1HIYA 1ZPWX 3RTVA 1VSKA 4FK0A 3KOOA 4H4KC 3PW4A 4Y0WA 1Q0NA 3W66A 5J0SA 4QU6A 3SJHA 1JK9B 4FKXA 1WSIA 1JCEA 1YJ9S 1UA0A 2WB1F 4JP8A 4OZ2A 3FYHA 4EU0A 4BRHA 1SUQA 1CEZA 3PHEA 3SQ2A 4N76A 8ICCA 1M1KO 4RQ4A 5CWRA 1B9DA 2O8DB 1I94K 1PYTA 1HIWA 3A0IX 5DS7A 2CUYA 2UVVA 4CBUA 4DBQA 3AVHA 3CJ0A 5D4BA 3M9OB 1S76D 2CJBA 4JKAA 2RHKA 3MCAB 2OPQB 2BMBA 1RG6A 3DN9A 3VEWA 2YNHA 3D3CJ 3KUEA 3ZD8A 2CPYA 1WB9A 5G5GA 3P4UB 1ELOA 1EX8A 3WKAA 1FXXA 1UFWA 2X3GA 3LM2A 1RWXB 4CJWA 1G99A 2RUSA 3SCJE 1U1PA 1N36J 2EC0A 1GLBG 2B6AB 2H54B 4PWUA 5LY3A 4DOCA 4OJGA 3L7OA 4UAZA 5AKXA 4C8MA 2LYAA 2BQRA 2DNPA 2WVDA 5EU7A 3ZSRA 4W4MA 2A40A 4DUTA 2RB7A 2ASLA 3K7RA 5IOLA 4BC4A 3QBCA 1WC6A 1EKEA 2ZM6F 2JWKA 4BUGA 5CZVA 1YZ7A 3TYTA 2JH7A 4DR7K 5KFAA 1PG5B 2UUCF 1X9XA 8ICIA 3LZJA 2GTDA 4H8KA 1HNZK 1UVKA 3MCOA 5GADP 5FLXU 4KLFA 3AAPA 3OFGA 3QSIA 4K4XA 4BG9A 4IJAA 1S1TA 2HVHA 4WIIA 2FPKA 4C4RA 4LR8A 4CFCA 1KHWA 1J27A 4FYXB 2ZH1A 2NYIA 2FJEB 4NCGA 2DHGA 2HKEA 2LM1A 4OLBA 4JS4A 1OWXA 4CF4A 1WKKA 2BM1A 3IRXB 2I5JB 1RWOB 2LSNA 1O03A 4Z4IA 2RD5C 3AA3A 4TQRA 1WOOA 4ECXA 4N8NA 3V2UC 3N28A 1HR0J 1T9YA 5EE3A 4ITSA 4B02A 2D5RA 2FBYA 1M0SA 4IG3B 4OZ5A 3HTVA 4MKVA 4ZVOB 2ABYA 4F2RA 1FIQA 3GFZA 4RR5A 4O44B 3VERA 4DU1A 3JSYA 4LF5F 3JPRA 1SJQA 2FQQB 1D8BA 2Z2LA 4F25A 2MXYA 4E19A 1HYSA 3R9KA 4E7JA 4RNOA 4U67Q 3CJ3A 4CHPA 2VFVA 3DYAA 4BWJA 3CP8A 2E1EA 2VQFJ 4NLBA 4DEZA 3CGIA 4RQ6A 1U49A 2B43A 3JXUA 1VLYA 4P2XA 1Q8KA 1FDAA 1Z6RA 2EFGA 2EW9A 3TPQA 4YS2A 3KJQB 1J97A 3NEKA 1RYUA 2XSJB 2Q1NA 1M5SA 3W2VA 2D0OA 3U1MA 2NXUA 4DS4A 3VQCA 2PEHA 3ZZOA 3HJVA 3M8WA 1YT3A 3THWB 4DR5J 4WKYA 3RAMA 3CF5L 4GFJA 4E2FB 5AM1A 3AD8C 3DDNA 4ZP9A 2NXEA 1YXQA 3GJTB 4O0JA 2IJRA 4RPFA 3D2FA 3VAIA 1PJ6A 1JJHA 3MGVA 4GMKA 1OSDA 4X4TA 5GAGP 4DTRA 3M2RB 3E01B 1CJTA 4P7TA 2AHOB 4CNQA 4CJ3A 1Y7PA 2ZWOA 2JFDA 3NBPB 1BPBA 1RT4A 4CEEA 3EE9A 3GOIA 5KFGA 2ZBCA 4QIEA 4X62J 1S1WB 3K5NA 3PACA 2ZUBA 3B6BA 4ACOA 3T5HA 1L3UA 4UBBA 5ETLA 1DAXA 3QUQA 3DDHA 3H8JA 3VGTA 2FBVA 2CRXA 2VD3A 4E8UA 3UPQA 1C1AA 2ZH7A 3TFSA 5FPMA 3R6LB 4CW7B 4KGKA 1B4FA 1Q95G 2BX6A 1ZQMA 2V2QA 3AY0A 2E8OA 4WFXA 3BQ7A 1N4LA 2F77X 1IXRA 4ETZA 3V1QA 1PVPA 2CPHA 4DV7F 5HATA 4IQTA 1JQGA 3A3OB 2YNGA 4K41A 3PNIA 5ALEA 2FF6A 2LMRA 2ASMA 4YOEA 4K59A 4DDFA 2ZIVA 3D1HA 7ICFA 4RZRA 3ZX3A 3NS6A 2Z0GA 2HWIA 1N34K 2V9KA 1YJTA 3DI6B 2RQCA 4CK3A 2UUTA 4IQMA 4QJVA 4FWNA 2FC8A 2RKIA 3U9ZA 4WZQA 5J0WA 3HVTA 5J2CA 3AD7C 1OY9A 2XZDB 4M5MA 3I87A 4HHJA 2L3MA 4IG0A 4ZCLA 4CIGA 3TWHA 4BR2A 3LPYA 2GX9A 3VQPA 1X42A 5MLCQ 4YFUA 3HHLA 2I6WA 4EBCA 2LXUA 3S01A 3ZT1A 2BCVA 3H7IA 2XZWA 3C2LA 2G06A 1EETA 2GZOA 2VWKA 2BEFA 4GVBA 2MKJA 1DARA 5AQPA 4KMUA 3IRWP 2NREA 1U25A 3RSEB 3KLEB 1HJPA 2JHDA 2HOQA 5HMMA 3MFIA 2N7YA 3DHXA 4ZJQA 5K8OA 1U1QA 2L9DA 1BNPA 1JJ2M 4ICLB 1U09A 4OI0A 1FJGK 2IHMA 3SI8A 4WKRA 5D0GA 1UJ5A 4ISEA 1YI2N 3THVA 4CEBA 3EZ5A 4LJMA 4EO6A 2CRLA 4LF6J 2ZGZA 2VV5A 3EKSA 5CHCB 2P51A 2R2SA 2D3O1 2UU9F 3NMUA 3RWUA 2LP4A 4B3SK 3CJ1A 2G08A 4CO4A 1EO1A 2AU0A 2QIFA 2XHCA 4DV6K 3R5DA 3ZNJ1 2XM3A 3KLIA 3MOZA 4UZCA 3NCRA 3KLVA 1OW5A 3I4HX 1C7YA 2ZC4A 4DV1F 3UXPA 1U1NA 4PGQA 2FJAB 1RHJB 2B7BB 1VSFA 4CM2A 1UOCA 4KTQA 3FCVA 4OYAA 1UWBA 1DBDA 1JB0C 2BYCA 5D4PA 4KHPK 2ZHBA 1HMVB 4X66J 1U1OA 1KLMB 4WE1B 2B56A 3TQEA 2MZSA 4Q44A 1H2TZ 1IJEB 3L4PA 3N5BA 2H51B 4OJ6A 1RBVA 1RISA 4J9UE 2QA4N 1MMNA 5IILA 4P4PA 1XIQA 1L3TA 2WC9A 2F4FA 1TMJA 3NVWA 1VQON 2Q97A 4NYPA 1WOSA 3TZWA 3BM7A 5KFNA 4EFHA 2E2OA 2VPYB 1T11A 5KFDA 1RAFB 4QZHA 4FVCA 2HNZB 3OTCA 2DTUA 5AQZA 2D7SA 1LOTB 4Y2UA 4M5KA 2FI1A 4RPXA 3FM9A 3GDQA 2QLWA 3BJYA 4JI5K 3C66A 2V63A 5AQLA 1RGIA 2HHTA 4KAZA 5HK4A 5D4LA 1QJHA 1VQOS 3VEXA 2R8GA 3HSDA 1RWWB 1NU4A 3N97B 5J0PA 1RLCL 3MMCB 5D78A 3M7DA 2V69A 2PFUA 4FNHA 2GGPB 4DMZA 5HBMA 2EC2A 1NAQA 1N36F 4BR0A 1VSIA 2YQEA 1NZPA 4WF9L 5BRDA 9ICFA 3L2VA 2ZD1B 2EZXA 2VBWA 4MK8A 2ZH6A 3V6JA 2JR5A 4ED7A 4IR1A 4B1YB 3C28A 1TYQB 2P9SB 4EEKA 9ICGA 1F9HA 3KJFB 3BH6B 2QLFB 4KFBB 3UXOA 5AM4A 1BQNB 2MQNA 4F72A 4Y6IA 3W2WB 2ASYA 2B9WA 2FD2A 3HFZB 1HNWJ 3L9ZA 4J9MA 1WD6A 1QAJA 3A8YA 3BV8A 3SQ4A 1NBEB 1HD0A 3I0RA 1F5AA 4FW1A 3EE3A 4BBYA 2YWFA 4NLOA 4EIAA 2DHXA 2VFRA 4Y2MA 3EJMA 1RYSA 4X64K 3LALA 1Z2LA 1FKPB 1HYZA 5KFTA 3AA5X 4KGZB 1XI1A 2Q4TA 2IAJB 1XR7A 5ALLA 2FZCB 1WBDA 4ZDNA 2UXBK 4X5VA 1ZA2B 2GJ2A 2IDLA 3KYLA 1PO6A 4JI7K 1CZBA 4JRQA 2BTFA 1HR0F 2X1AA 3CMAN 2NSBA 4B9QA 1XHXA 2MHNA 3TAGA 1H2VZ 4BROA 5IT0A 5K8PA 3TANA 2X3DA 3T1HJ 1RAGB 4M95A 1WUUA 2BKNA 2R7VA 4PPXA 3K89A 4KRWA 2OGUA 3KKSA 4H4KA 4YOUA 5I3UA 3W5ZA 3NS1A 3BPSP 4E1MA 4FLWA 2FBXA 1P8ZA 4DL0C 2VZ9A 2YMQA 3NY0A 3OLBA 3WKCA 4IOCL 4TUSA 1ZQXA 2LU2A 4LFCJ 2Z56B 2MKKA 1MDUB 4KI6A 3MXIA 2F2AB 4URSA 3TQ1A 4H54A 3T1YJ 3W1YC 2EWSA 4KI4A 1MMLA 5GMDA 2E8NA 2YNHB 2DF4B 2OWOA 3B0XA 2QA1A 3VGVA 2P9KA 4BGBA 3LDSA 8ICPA 3V5RA 5GAHI 1RU1A 4TVAB 2IVFB 4KIAA 3KOAA 4YB6A 3A2FA 3LO3A 4JI2K 4Z94A 5ETMA 1L5UA 5C24A 1SV5A 4OGEA 4DR5F 2A3VA 1ZZNA 3G82A 4YY3J 2ZBIA 3FEZA 4Y2YA 1HBNB 3JPPA 1J5OA 1AUSL 1RILA 4GLXA 2KU7A 5ALUA 4Q7AA 4B6JA 1WG4A 4GC6A 3CJRA 2WTFA 3JSBA 4RNNA 2JEFA 4WPAA 2NQPA 1HHQA 3PMNA 3OTDA 2ZJRQ 1T95A 3V7JA 2DR5A 3UN3A 3OLAA 3M1VA 2AP6A 4CE9A 1GXLA 1CULA 4I2QA 4CESA 3R5BA 3LDOA 3N5FA 3QT8A 3DLBA 1KFTA 5HJXA 4EK2A 4Z4GA 1C0MA 3CCUS 2Y3YA 1IBCB 1NKEA 4GY2B 1VDHA 4H4OB 2V6AA 1J54A 5AQMA 3K0SA 4KN7A 9ICWA 1NSKL 5AQGA 3CJKB 3RMCA 3M8YA 2HRYA 1X40A 3MPYA 2HLTA 2Y9HA 3POTA 2XLKA 2W03A 1PJ5A 1CZ9A 1NSPA 4B3TK 2OI2A 3ET6A 2OPPA 4AUKA 2P9PB 1ZPVA 4OJ3A 3D2QA 4CZLA 2DB1A 3C23A 2ROGA 3SD7A 3PSPA 4CF3A 3DLJA 1V38A 1T7PA 3CPEA 1NCLA 2E88A 2IHR1 1P7DA 2FPLA 1RABB 1HHSA 1TFRA 5CQGA 4KMOB 1CQMA 4DTXA 1UHUA 3B8AX 4IR9A 1UCVA 4PUOB 4YHHK 2GMHA 1MA9B 3ISBA 1S6PB 2IVNA 2FIUA 2BJ9A 1MW7A 5CD4H 4CDIA 4X4QA 1BWEA 3DYAB 4F2SA 2H3FA 1P6TA 3PVXA 1UTAA 2W8LA 2FVSA 2BJEA 3OY9A 1X4CA 1NMNA 2L08A 4BDZA 3AMZA 5ETNA 4CEDA 1RT3B 2LQ5A 4WFAQ 2NRHA 1B43A 2F4VK 5AI5A 2YMPA 4HVJA 5E3CA 3MR3A 3BQ2A 2C3MA 4EENA 4H4MB 2E3TA 3W2VB 3H5UA 2PFDA 1TELA 3ICLA 3I0SA 3NGDA 2AW0A 4RQ3A 1IG9A 3R7NB 4JS5A 4KBIA 1BO5O 3SBMA 3MD1A 5IM0A 4NWBA 2GMLA 3FZHA 1ZM9A 4DL4A 4QIWF 4OPJA 4NMXA 4QS8A 3D2FB 3KXDA 1DRZA 3MI7X 4LF4J 2VG7A 1GMWD 4CJUA 4LF6F 4H5VA 3FSYA 5AR0A 1RT4B 3FMWA 3M8QA 4DUYJ 4CHQA 4KLTA 2XMJA 1WNSA 3VGLA 4I2PA 1WAFA 3HRDD 2IHNA 2IIHA 3OTQA 4C97A 2DFEA 5AFUA 4OLPA 4ILGB 2FLPA 3RAXA 1C6VA 1NJIT 1CI4A 5M1OA 4NPOA 1QAIA 3H8WA 3AVJA 3S41A 3L7PA 1WG1A 3QEAZ 9ICUA 1KVCA 3CJ5A 2WRMA 2G5IB 3C6AA 2EK6A 3CQ8A 3CC2N 1LFWA 4MF2A 1SAZA 4UQGA 4Y2VA 1ASUA 1I6JA 3VENA 2R2UA 4F3QA 2W54A 2RF2A 1YBAA 4YR2A 2AIRB 3M1YA 4DV0J 2MA1A 1XNQK 1VQ5N 5JLFA 4FFDA 4A61A 2E1AA 4M94A 5F2RA 1HBMA 4J2BA 1RWNB 8ICEA 3ZEUB 2A1SA 4EI2A 2YQ3A 1CJVB 1NOZA 2HQIA 3KFUF 4Z4CA 2W2NP 1NJIO 1UEUA 4DPWA 3CC2S 1RGVA 4J9PA 4DSJA 4UOGA 3VZIA 2RKIB 2XG8A 4ZK7M 4GKKJ 4QBUA 1A6LA 4C0ZA 3EVMA 2AGQA 1LAWA 4U6PA 4ISGA 2LQ8A 4M7XA 4F3TA 4OX9J 1VQ5S 2XI3A 3GIRA 1K6YA 3F9MA 3HHLB 1HWLA 1BIZA 4ILHA 3MHYA 2JEIA 1OKJA 2D0CA 2EQYA 4K7QA 3R7BB 3KNGA 3R3LA 3ZX2A 5IIIA 1NK8A 4GVBB 2C22A 1NO8A 3M6XA 1JLGA 4DPUA 1DLOB 1EKSA 4OHXA 1S1VA 1IJFB 3VESA 2GWJA 1UETA 5B0BA 3LP3A 3E9PA 1H6KX 1MWMA 3ADAC 3BGRB 1OYEA 3QQCD 2W9BA 2DGQA 2OMLA 4DCOB 3CIMA 2BM0A 2LKYA 1S0OA 2F8LA 1NGFA 5DBAA 2QL5B 4OJOA 1HWKA 5FPDA 3N0VA 4LSLB 4L8RB 1E6VB 2JC1A 2KRBA 2ZWHA 4FOIA 5T7BA 5ITHA 2YNFA 1XO1A 2OEJA 3SUPA 1N54B 1GK8A 1FRJA 3HO1A 3OSNA 2ZXHA 5CCLA 2ZTDA 5AM3A 1YIJN 1X2IA 4M5HA 2KV2A 2MTLA 5JTIA 1EP4A 2G1HA 2R7UA 4XDDA 1DJ0A 2XVTA 3O1WA 5B8HA 3ILJA 5ALTA 2IMWP 3V9WA 1HPZB 4KJIA 3R2DJ 2VODA 2U1AA 4GVEA 3MR2A 4WFNQ 4ES1A 2MQMA 4NWIA 1R7IA 3M4XA 1W2IA 2YKPA 2C3UA 3SSSA 2CQ2A 3E3XA 2XY5A 3MAQA 4R0EA 4NB4A 2EH9A 3MUVP 3QXGA 4M63C 4B3MF 4CJTA 5J0OA 4OKJA 1K0TA 1CLFA 4NCBA 4NOHA 3UN5A 3EN9A 1S0NA 4GV9A 4E7KA 4HTUA 2XHWA 1ZQZA 2GC8A 4JKBA 4BC9A 2YHWA 4HHUA 4I7FA 1U2VB 2VKRA 1XNRK 3UQ2A 1CS4A 2Z1JA 4UAWA 3NCQA 3GG4A 1U8SA 1KQFB 2Z1GA 3OBIA 1OJ4A 1SL2A 4KY3A 1P8GA 1YGYA 1U9LA 2XS7A 3U26A 1SL0A 3R1LA 1FESA 2Y1LB 1NUEA 4FLYA 2J7UA 2MY7A 4DR4K 3RRKA 1HWJA 3T1HF 4CFDA 2IC3B 1RAEB 4LF8F 4WBFA 2OSRA 4EUVA 2DH8A 4E89A 4EWTA 2YV0X 3RJGA 2DNMA 2O3DA 4BREA 2VASA 4DTOA 5J0XA 4IQWA 2NZ4A 4NM2A 3H2VE 3V4MA 2NYHA 5J0TA 2F9WA 3BBBA 2RS2A 2GWKA 1FNOA 2A1AA 1VQPS 3JB9k 3C7NB 3K5LA 2XI2A 1LWXA 4HHTA 5CABA 3T1YF 5JUMA 3GG0A 1RNHA 2QKKA 9ICQA 1J2VA 3OTOK 3CJ8A 4M9HA 3S3MA 2RQMA 4K8RA 5ALSA 4QWAA 2HRUA 4QWBA 1VQMN 1C1CA 4ZN1A 5HN0A 2DNQA 4NXNK 1UZHA 1HNVB 4ZVGA 2ZJAA 4YY3F 2EAPA 4CZCA 4QZEA 3CD5A 8ICXA 2MJNA 3CHWA 1OQ6A 3QPIA 3NVYA 1MN8A 2VANA 4L76A 2CJAA 4GVMA 2ZE2B 4WQ5C 4L3KA 2ZIUA 2Q43A 2QTDA 4C80A 8AT1B 4M7YA 3C6UB 5HRNA 1CBKA 3PMLA 2BVZA 2O6KA 4C4TA 4UOCA 3RJKA 3HHKA 4I4BA 4WQ4A 3PIOQ 4IUFA 2K2PA 3PYGA 3MX2A 2OFGX 3Q22A 5DZ7A 1V6HA 3I8DA 1NM1A 1VRUB 1XEZA 2DGZA 3I0RB 3SNNA 3B0YA 1VQLN 5DDMA 1O8BA 2OIHA 2UZAA 2UUAJ 3CFRA 1Z1ZA 3K0JA 1HFEL 3R5CA 2V7ZA 3CDBA 2RPIA 4IBNA 2CVEA 2KG5A 4J9NA 1GLJO 1IBLJ 5DDPC 4KH0B 3C2PA 2FXUA 4J9VA 3HSJA 1BPDA 1T9WA 1Y9OA 2X6SA 2M9KA 2ZH9A 5DDRC 1JUDA 3D2EA 5F3TA 1YRUA 4DO9A 2FHOB 1E4GT 3KHHA 3CQYA 1QM9A 4DV3J 3VV2B 1YDLA 1BISA 3H4DA 5EWFA 2CH6A 1VQLS 4IXCA 3IC1A 2ZGYA 1S1XA 4JKCA 5KG5A 3FR0A 4OV1A 4ILRA 7ICLA 2FJBB 2GIFA 2J6TA 4HUGA 1FJ7A 2AQ0A 5AKIA 2EK1A 4C7QA 2PXIA 2BXJA 3UKUA 3WNHA 4UB4A 5KOWA 1XNSA 4OKEA 2VDHA 4FZXC 1P27B 5D6GA 2HFOA 1VJQA 1VQ7S 1CC7A 3HI0A 2ZM6K 2R7SA 4CI0B 3CCTA 2NZTA 2KH9A 3ZTQA 1RQ0A 1Y00A 3IBFB 3TAMA 4JWNA 2UUCK 2V2VA 3G87A 1KAZA 1LB2B 4BRGA 5D4OA 1ZH5A 4NLRA 3CYMA 4LBIA 1YRXA 4IFVA 4DPOA 3G0ZA 4FK4A 4IL6U 2QSFA 1WHWA 1SV5B 2R9LA 2GJFA 2OTLS 5H9FK 4PRFA 5LMUJ 2U2FA 4PQAA 4PABA 3GDXA 2V52B 4C2MA 1DKGD 4JV5J 2C2ZB 2IOFA 2GIQA 3FEYB 4QR0A 3BO2A 6AT1B 3VQAA 1NGHA 3ZETA 1ZQDA 4QS7A 5T7LA 4IH7A 2OPRB 2ZBQA 1S4EA 2K7JA 2QWMA 4LRCA 2O8EA 5J1EB 1IH7A 4F4KA 1JROA 1RP5A 3HSTB 1CULB 2RAQA 4DUYF 5J2PA 3GFHA 2HHQA 1CXQA 3DOLB 4E0DA 4E7LA 2CJQA 4FNIA 1SPBP 5C2GA 4CQ1A 4KB1A 3RBZA 4LF5K 2PFFB 3UQSA 1F6TA 5KFIA 3HKZF 2P8IA 1QQ7A 5AQFA 2QMXA 3BGOP 1PKUA 3IR7B 2BCRA 5A8WB 3POTB 1EIYB 2HHHJ 4K4ZA 3PRBA 1H1VA 1C4CA 4FZNA 5DB6A 2NO4A 1FT8A 2DGSA 1NNEA 4WYWA 3J7YU 4J9LA 2FUG9 3DCAA 2PSZA 3J7A1 3EO3A 5EWEA 3W8PA 2KVIA 5C2CA 4DV0F 4RQMA 4J9KA 2V94A 2EAOA 3FMBA 1YWXA 3LM9A 4LD0A 5ETQA 4C6AA 4K25A 3I56N 4I6MB 5J2EA 4Q8FA 4FXVA 3W9HA 4ETXA 4YORA 4MFAA 3T5JA 4IH6A 2XEXA 1SQEA 3LPEA 7ICKA 4Y28C 4Y2PA 3EEQA 2C28A 4FOEA 4A8WA 2QMWA 1X5TA 4QR1A 2B0CA 2XMTA 4C0OC 4GKKF 4KLUA 1FW6A 3HHDA 2GH1A 4DCJB 5EOYA 4RQNA 2UXDF 3D66A 1KAXA 3RB4A 4J8FA 2P9EA 1QD1A 1RFQA 2XNRA 2WTUA 1RDBA 3VF6A 3O9QA 3D0HE 3KUHA 3VETA 3S3NA 1HWUA 3I0SB 4LSZB 4G65A 3OL7A 1S4FA 5FDLB 2R7WA 1OH5A 2YWKA 1UVIA 3KHYA 5ALOA 2VJ5A 5IM0B 3Q8VA 3JAMO 3MMAB 3NTUA 5F8LA 2OEMA 1FCAA 3DFEA 2BKOA 4Z4HA 4RPYA 5K5MA 3AVBA 4HTLA 2G8IA 5KFZA 3PEHA 1CPZA 4DV7K 1DFDA 1KQQA 2H3VA 4K0KJ 2JRZA 4I2CA 3A8EA 3D4JA 3KHRA 2I2YA 3OR1A 1Z4NA 2VCPA 2CQ3A 3OYLA 4YDUA 3SAHA 4I2PB 3SCLE 4OZLA 2G4BA 1SIZA 3MURP 2KB2A 4FN5A 4O3PA 2DO4A 1R3NA 4MFFA 4BGDA 1SZPA 2EZYA 5J2MA 3UCUP 3SEIA 5A8KB 4FJKA 4I9QA 4PL2A 2RHFA 2DR9A 1YJRA 3MPWA 2YMLA 1C0UA 3IRUA 3AL0B 3KTQA 4QIWC 4I2FA 4F9OA 4C9DA 1KTVA 2D69A 4BE0A 4BGAA 4NEYA 1CLQA 4O3OA 2RVJA 4FPBA 1N61A 3OUYA 4DFMA 1N6QA 5F9NA