4DS4A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mn2+
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 201
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds4A01
3C23A 3AVCA 1ZBHA 4F5RA 5KT3A 2G8HA 5J0YA 1K1SA 5DLGA 2ALZA 2R7YA 4O5BA 4KB1A 4UAWA 1JLEA 4KHQA 5L1IA 4FS2A 2W8KA 4I2BA 3C2MA 4I28A 4DS4A 5EOZA 1JXEA 3V7KA 4Z4IA 4CJVA 4DQRA 3O3GA 1ZQDA 3OYHA 3KHGA 7ICTA 5L1LA 5DG7A 4ECUA 4PWDA 3VA3A 5KI6A 4BDPA 4F5PA 2GBZA 1VSIA 3K4GA 1COOA 4FLXA 3DLEA 3ISNC 4R65A 4CEEA 4RUAA 3EPIA 4YFUA 2ZUBA 1U47A 4FJJA 3KIOA 4PA1A 3DOKA 4P4PA 4ECRA 3AO4A 1ZQEA 4O55A 1Z00A 4M3ZA 1Z3EB 1ZQMA 1IKYA 4BE1A 2YV0X 3HXMA 9ICQA 4Z0UA 3CFOA 3ZD9A 3QLHA 5CR0A 4C8KA 3B0XA 2X78A 2KFZA 1LWFA 2OYQA 3NF7A 8ICHA 3RMCA 4JRQA 3WNEA 5D46A 3P83D 3OHAA 4FJLA 3T19A 4KLSA 4QZIA 4J9LA 4NLKA 3RBDA 4GXKA 3QEAZ 3L3UA 2VA2A 5CP2A 4IQUA 3ZT3A 3LP3A 1B9FA 3AA4A 4M9LA 5KRSA 5JUMA 3HPOA 3KKSA 4DL4A 3AVIA 4I2EA 3LDSA 1SKRA 3VQ5A 3VQ8A 4YMNA 4E19A 4O44A 5FROA 1XS9D 3WNHA 1U49A 1WAFA 4J2DA 2XRIA 4J2AA 5IIJA 3LZIA 2IAJA 4R8UB 4FZXC 3ZDCA 3AO5A 9ICHA 5BOLA 3QZ8A 1NK0A 4ECQA 1RT5A 4IBNA 3SI6A 4CECA 1HMVA 4CEFA 2X6SA 4HVJA 5KFAA 4AHVA 2I1QA 2OZMA 1DLOA 4CF1A 1TK5A 4N56A 4CGIA 1Z00B 1EX4A 1NKEA 1DOQA 4YVZA 3IHQB 5KFNA 2G8KA 3EPGA 3BQ1A 2IA6A 4M3YA 2I5JA 3SV3A 4F8RA 3AO2A 2GWSA 5DQHA 1XSNA 1BQMA 2G8WA 5J2IA 2PYLA 4KN4A 3K59A 9ICNA 4CHNA 1C6VA 9ICVA 3OS2A 3K5LA 3M8RA 1QLNA 2RF2A 4O3OA 4E7KA 2KFNA 4UBCA 5F9LA 3OS1A 4CJUA 3C1ZA 1T8EA 5J0OA 1BL3A 3V9WA 1C0TA 4JRPA 4ECYA 2I9GA 2JEJA 7ICFA 8ICMA 5F9NA 3AA5X 1REVA 4M6WA 1NKBA 2E4LA 3LP1A 4FJMA 4WE1A 3DYAA 2RDIA 4KHYA 1HJRA 4KTZA 2BCRA 8ICPA 4ED8A 4C8OA 4Q8FA 3NH1A 1NK8A 4FXDA 1SKSA 2R8JA 3NGYA 4O0IA 1ZQFA 4DQSA 4UB1A 1R0AA 5I42A 7ICSA 2YNFA 4ECZA 2R8HA 4PY5A 4CGHA 3VQ9A 4E3SA 2M9NA 2C28A 3K2PA 2BCSA 3C94A 3UPQA 4Y1DA 1NJWA 1ZQJA 3IG1A 3VQDA 4CF2A 9ICBA 5J0TA 2KN7A 5DQGA 3SQ0A 4YNQA 4I2FA 4RQ1A 3DRRA 4DTSA 1JX4A 2B21A 3QIPA 1ZQTA 2IHNA 4J9SA 3H4DA 3RRHA 1MQ3A 1TV9A 4C8MA 1KLNA 4KHNA 3T5HA 3TAGA 4JS5A 4XUSA 4RG8A 4J9MA 5DDYA 4I9QA 1YTAA 2V4QA 1TVRA 1LW2A 4XQ8A 1DGSA 2Y1IA 2JEGA 4DO9A 1JMSA 3RAQA 4DWIA 3RB0A 3NHGA 4HCCA 4F50A 2PY5A 3OYEA 2MAXA 3V7JA 4B9VA 4B08A 4O5KA 1NOYA 2NRWA 2C2DA 3Q8KA 1ZQUA 4XRHA 3VQCA 2ISOA 5IINA 3ZSVA 1WCNA 4QWAA 1SL0A 1TKZA 4NM2A 5DBBA 3KLHA 5J2CA 4J9KA 1J54A 3HYFA 8ICIA 4JWNA 4N5SA 1BVSA 3AO3A 7ICHA 1C1BA 3S3OA 4NLZA 3EYZA 4CJKA 5HHIA 4G3IA 8ICYA 5KT7A 1U4BA 2Z1GA 5C25A 1WSGA 4DFKA 4EBCA 4EP5A 4DTPA 4R64A 2Z1HA 4DOCA 2HHUA 4JUZA 3AUOA 4JWMA 4OKJA 3DLHA 5KFPA 4PHAA 1EETA 1RT2A 1HNVA 4CESA 5D49A 3OYAA 4F4ZA 4J9QA 2BGGA 4BWJA 3I0SA 3DI6A 5KFWA 1QTMA 4PHEA 3NF6A 1FK9A 3QO9A 3PMLA 4Q45A 1S77D 2ISPA 4GVMA 5KG1A 3HK2A 3SZ2A 1MC8A 4EBEA 4DFJA 7ICKA 1RBUA 4FZZA 9ICUA 2QK9A 5L9XA 1WSIA 2IBKA 2FLLA 4F91B 3QEXA 2R8IA 2GUIA 4DTNA 4CFBA 3V1OA 3MABA 5KRTA 1D9FA 4JK1A 2P6RA 3MFHA 1V9PA 3Q8MA 3HPGA 1IKVA 5HNKA 8ICEA 3L3VA 5DGBA 2OA8A 4CGFA 4M3TA 2HNZA 3SCXA 4DSIA 5KFSA 5KGXA 4KLOA 2YKMA 2FBXA 3AVKA 1IG9A 1UA1A 3GIMA 4YCXA 3DLRA 1JLBA 5J2EA 2DPIA 1ZBFA 3AVHA 4IFYA 4M9HA 4FJIA 3KJVA 1KVCA 4MEYA 2QKKA 1LWEA 3FDSA 1U04A 3H7IA 3A2FA 5IIKA 5DBCA 1O1WA 4J2EA 2UVVA 3BQ2A 4EZ9A 2OZSA 1ZJMA 2OPQA 8ICBA 3H8WA 2XCPA 4AHRA 2D5RA 2P1JA 1JLCA 4IRCA 5KFMA 1S1WA 2Y1JA 3RWUA 4GXJA 3G6VA 3LK9A 3V81A 5KFQA 2BPGA 3OYBA 2ITGA 4CFCA 9ICCA 4ED0A 1ZQYA 4F5QA 4CF0A 1FXXA 7ICOA 2D0AA 4UAZA 4ELUA 3IRXA 3TWHA 4CFDA 4FK2A 1RT6A 1HUOA 4DU1A 3ULDA 2XY8A 4HUFA 3ALYA 4I2JA 5KFFA 5CY4A 3LAKA 2PYJA 1U45A 1S10A 4BGDA 4F2SA 1T4GA 1S97A 5FRNA 4HUGA 4RT2A 2BPCA 4F4YA 3B0YA 4K8XA 3SJJA 4RPZA 4FW1A 5JS2A 4PQUA 3WNFA 5K14A 4DS5A 5CWRA 4NYFA 3ISDA 4CHZA 4I7FA 4CHPA 2OPPA 2VG7A 4YMMA 2ATLA 4E7LA 2XY6A 2JEFA 8ICQA 1XU4A 5J2MA 4QZAA 4C8LA 3NBPA 4BE0A 3TAPA 4FJ8A 3L2RA 2PZSA 1ZQOA 4FLZA 4DLEA 4NM1A 4E0DA 3RAXA 3S9HA 3LALA 4J9PA 1ASWA 4IG0A 4I2PA 1S0OA 3SQ4A 3VN5A 4O3NA 3MXMA 2E6MA 5J2AA 2FPLA 4RW7A 1FKPA 3TAFA 2FPMA 2NRZA 5C42A 1VSDA 3ZSQA 4ECWA 3PNCA 1ZQAA 3IAYA 2J6TA 2B6AA 5J2QA 4XA5A 1W9HA 3O4QA 4MFBA 4DSFA 9ICOA 4K8ZA 5SWMA 4P4MA 4QZ9A 1LV5A 4B9UA 1W0HA 1K1QA 3C5GA 3QETA 1TKTA 3VQAA 1T05A 4FBUA 3RH6A 4G1QA 8ICWA 5KFGA 1RNHA 3HM9A 3ISCA 4DFMA 7ICLA 2XY5A 4UB4A 1VSJA 4Z4CA 2WOMA 1VRTA 2W8LA 3PW7A 2BR0A 4X5VA 4KLEA 5KG3A 3RBEA 3RMAA 4GC7A 4RT3A 8ICUA 5HRSA 3KHHA 2KZMA 3JPQA 5KFUA 3TAEA 4QZDA 4RQ0A 3HVTA 4DTJA 1RXVA 4DSLA 3SPYA 2WTFA 2IOCA 1JXLA 4AILC 5KG4A 3GIIA 1RXWA 4ID1A 4PHDA 3EY1A 3OVNA 9ICXA 2AGPA 4ED3A 1X2IA 1XO1A 3N4MB 1WLJA 2ASDA 4RNOA 1RBTA 4OGCA 1RILA 1G15A 3RB4A 1S1VA 3DMJA 3L2QA 1RTIA 4CHQA 3Q8PB 2DFEA 2VA8A 3M9OB 2XHBA 4UAYA 3M8SA 4P2HA 5DGAA 4KAZA 3MDAA 4ED7A 4KHUA 3THVA 4E1MA 5KFYA 1TL3A 1A5VA 5KFTA 4DL5A 1XI1A 1WSFA 4J9RA 4W5TA 1ZQRA 1ZBIA 3KD5E 4RW8A 1WAJA 2XO7A 2O4GA 4E7IA 4FJHA 4I2HA 2PFPA 4QZBA 3KLGA 4RW9A 3H4BA 4B9TA 4CHYA 2IDOA 5E41A 2VG6A 2XCAA 2X74A 2G8IA 1TGOA 4YMOA 1IKWA 2BANA 3AVJA 3V9XA 2Q0ZX 4NCBA 1X9SA 3V6JA 3ZT4A 4N76A 4YXJA 1CLQA 3HX0A 2F8TA 3NDKA 4HUEA 2HHSA 4TQRA 2ZTDA 3RRGA 3QNOA 3QNNA 2PFOA 4FLUA 4OLAA 4JV1A 3CG7A 4KLGA 4RU9A 1BPBA 1U48A 3MEEA 3NH2A 3HO1A 5L1KA 4O4GA 2BGWA 1ZQKA 1CXQA 5J2JA 1ZQQA 4ID5A 1L3TA 1ZQCA 3ZSWA 5J29A 4L8RB 1N6QA 1C1CA 5KT2A 4F2RA 4RW4A 3RJIA 4CERA 2OPSA 1VSKA 1SV5A 3NGIA 4RZRA 4DF4A 7ICMA 4RNMA 2D0CA 4CGGA 3V4IA 3P1GA 3PW4A 4GW6A 4BE2A 1KRPA 5C24A 3E01A 4DF8A 2WONA 1SZPA 3OYFA 2W9BA 3OY9A 7ICVA 1RT7A 4TURA 8ICCA 4FJ5A 1J53A 2BCUA 8ICLA 3QEPA 3JPOA 2DY4A 4CJWA 4KLMA 1RCHA 1CEZA 4JS4A 1TAQA 1HJPA 5EWFA 1KSPA 1BCOA 2DFHA 1QSYA 3QEVA 5KGWA 1BISA 3ZSOA 1U9LA 2Z1JA 3QINA 1TK0A 1SUQA 5L1JA 1WSJA 2VWKA 3UXNA 4Z4HA 3U3YA 1KFDA 7ICPA 1CZ9A 1RT4A 4CJPA 1S9EA 3TABA 2JGUA 4CK1A 1LAWA 4KLQA 3AVLA 3O3HA 4F4KA 5J0UA 4IDKA 2RPIA 5CA7A 4CK3A 3OYLA 1LW0A 3KHRA 2JLEA 4CIFA 5HP4A 1DTQA 4DSJA 1ZBLA 3C95A 5J2PA 1ZQSA 2GV9A 4QAGA 1ZYQA 1WNSA 3PV8A 4FVMA 4Q43A 4RPXA 2UVUA 4K4IA 4QZFA 1CUKA 4KHSA 1JLQA 3BQTA 4DL7A 4MEXA 5CZ2A 2B4JA 2ETJA 4QCLA 3JSMA 3RJEA 4KLUA 3T1AA 3UXOA 2UVWA 4BDYA 4TSXA 1VSFA 4I2AA 3NF8A 4FM0A 3GFKB 1K6YA 1TFRA 3UXPA 3M8QA 5J2BA 3DM2A 1BPYA 4ED6A 5DMRA 2BPFA 5CB1A 1PZNA 5JS1A 3M9NB 1RBRA 3IM1A 8ICKA 3AU6A 4FYDA 4CJQA 3RJKA 3AVNA 4DG1A 4O5EA 3SPZA 7ICRA 5HBMA 2KZZA 3LANA 3JPRA 3GV7B 4FJ7A 4QWDA 1BPEA 3RTVA 3QE9Y 9ICAA 2R8KA 3LPUA 2HHXA 4MFFA 3VA0A 3NGZA 3PR4A 1ZQWA 4QWBA 4IFVA 2HHWA 2ATQA 1KVAA 4CJ5A 1JXBA 2G8FA 1RDCA 1XHXA 3AV9A 1S5JA 5KFHA 4CEDA 3LDAA 2IHMA 5KT4A 4CHOA 1MU2A 3RMDA 3TFSA 3RB6A 1RYSA 1JLFA 1ASUA 4CEAA 7ICNA 2BCQA 1S1XA 3NE6A 1D8LA 3RJFA 3KK2A 5HMMA 3HSTB 4F92B 3OYCA 2OPRA 4CJSA 5J2NA 4FZYA 3QEBZ 4OKEA 8ICOA 1ZQVA 3MBYA 1KEJA 4TUPA 1RPLA 2JZBB 1RBVA 5EWEA 4M2YA 1S9FA 1KDHA 3JYTA 4H4MA 4OLBA 4I2IA 1KLMA 4RUCA 3UQ0A 4EBDA 4M3UA 1T03A 4NLNA 1JKHA 4YG2A 1VSMA 5KG5A 4NCAA 4ZH4A 1ZQBA 3MEGA 5KT6A 4CJ4A 2HMIA 4F4XA 4RNNA 4F5NA 4Q0BA 1NOMA 4DTOA 4M04A 4QZ8A 4DLGA 3PX4A 3PVXA 8ICFA 4I2DA 2W9AA 4FLWA 9ICMA 1ZQPA 4M42A 4FLTA 2R8GA 4NLGA 1KFSA 2BCVA 2J6UA 5SZTA 1EP4A 2QKBA 3EW9A 3HP6A 4B9SA 4DQPA 9ICFA 2IS3A 4IQWA 1ZJNA 3TFRA 4KREA 5J0XA 8ICJA 3BDPA 2DFLA 3L2WA 2UVRA 1L3VA 4KTQA 4LY7A 4KFBA 4DEZA 4RQ6A 3MXIA 3RJGA 3ORYA 1S6QA 2F96A 3C6TA 1XWLA 4LVSA 2XGQA 3GIJA 3PY8A 2IC3A 1HNIA 3JPSA 3NFAA 4CFAA 4DQIA 5C5JA 4CF9A 4AHCA 5KFIA 3GIKA 2HNYA 3HVRA 2OWOA 4ZHRA 4FCYA 3AVFA 3V6DA 1A5XA 5IIIA 4N47A 4R66A 2ASLA 4CEZA 4ICLA 1YTUA 3PO5A 5KT5A 3ZT1A 1B92A 4OKKA 1ZQXA 3NGDA 4PGYA 2VG5A 4CJFA 2W42A 1N5YA 4CF8A 5D3GA 1BGXT 4PUOA 3G10A 4K4HA 4DTRA 4W5OA 4F5OA 4UBBA 3M9MB 3V6HA 9ICTA 9ICJA 4E7HA 2V9WA 1BHLA 2PI5A 3AVBA 5KFLA 4EZ6A 4YP3A 2LYHA 3ZT2A 1T3NA 4RQ5A 1BCMA 4DMNA 1XSPA 1HYSA 2ZTEA 1RTDA 2W9CB 3CYMA 1A77A 4DU4A 4FM2A 1HRHA 1HUZA 4B9NA 3LWMA 2RN2A 3P5JA 8ICSA 3MDCA 4M0AA 3PUFA 3LZJA 5DDMA 5HHHA 3G0ZA 2V4RA 4JV0A 3M8PA 1Z25A 3F9KA 1B22A 3MFIA 3I8DA 3K75D 4O3SA 4KLIA 5J0RA 3H40A 3RJHA 5DB6A 5IILA 3ETLA 3AVMA 5KFCA 1JL2A 1S1TA 5KG2A 1D5AA 4F4WA 4KLHA 4QWCA 1TKXA 1KTQA 5HRPA 4XIUA 1UAXA 4IG3A 2FBTA 4Z6EA 5J2KA 2D0BA 3MECA 4M45A 4KB0A 4R63A 3SUQA 4BXOB 4CEQA 5KTQA 4UB5A 4RQ4A 1B43A 5DBAA 4TUSA 4E7JA 2FLNA 4W5RA 3ZDDA 2BQUA 4J9OA 1Y88A 4OVLA 3HJFA 2B5JA 3HP9A 1BPXA 1VSEA 3D45A 1NK5A 7ICIA 4MQ3A 5J0WA 3DOLA 2HVHA 1KVBA 1BI4B 3UIQA 3ZD8A 2QXFA 4LSNA 2FMPA 3C1YA 5KFKA 3ZSZA 3NAEA 4QZCA 3C21A 2DPJA 4KO0A 2O4IA 3H8SA 3L8BA 4M9NA 3ZDBA 4ELVA 1HPZA 4NY8A 3EWAA 1S0NA 2YHBA 1EXQA 1BIUA 3T5LA 3KLEA 2W9MA 5D4BA 5HMLA 3TANA 5KG7A 4HHTA 5CJ7A 5IIOA 4PPXA 1KFTA 3BJYA 5KFJA 3KLIA 4DQQA 3KHLA 4LZDA 2F1JA 2NUBA 3V1RA 4ELTA 2YHAA 2KQ2A 4QWEA 3MGIA 7ICJA 2BKEA 3KTQA 3C5FA 3OYGA 1TK8A 1BPZA 3CFRA 4IR1A 4YD2A 2F1HA 1UT8A 1IKXA 2AGOA 3TAMA 4CJTA 3NH0A 2NRXA 1GOBA 2ZQBA 4QW9A 1FKOA 3IS9A 1S0MA 3SI8A 1HYZA 1J5OA 1S0VA 2FC0A 4MF8A 3AVAA 3KKRA 4IKFA 4RPYA 4Z4GA 1SL2A 1CZBA 3BGRA 2EX3A 5J2HA 3S3MA 4OPJA 4PHPA 3ZSXA 4CJLA 2G8UA 1XHZA 1BIZA 4P4OA 3PW2A 4UB3A 3RR8A 5KG0A 4UB2A 4ZTFA 1VSHA 1QQCA 2F1IA 2KTQA 4DSKA 2BDPA 4KLFA 4E89A 4AHUA 3D0PA 4B9MA 4H4OA 3T5JA 3G6XA 1NJZA 1S1UA 2AQ4A 8ICGA 4HCBA 1WN7A 3OJUA 4W5NA 2BHNA 1WCLA 9ICIA 2VA3A 4F3TA 3KLFA 4CIEA 5KFEA 5IIMA 1TVAA 4CK2A 1J9AA 2F8SA 1B9DA 3CM5A 3GDXA 4I2QA 3ZSRA 2J6SA 7ICEA 3L2VA 4HYKA 3PX0A 2BQ3A 2ZE2A 4O5CA 4DTUA 2PXIA 5J2FA 4B9LA 5CHGA 3RJJA 4KHWA 2NRVA 5J0PA 3MR6A 5KFZA 4FLVA 4Y1CA 2VANA 1A5WA 3KD1E 4AHTA 3RH5A 1ASVA 3ZDEA 2MUTB 1YVUA 1NK4A 4FJKA 1C0UA 2A1RA 3H08A 1N48A 2C2RA 5DK5A 4KLJA 1ZQNA 3PMNA 4J9NA 1NJYA 3V7LA 4Z6FA 1JL1A 5KFOA 1L3UA 1ITGA 3VQ6A 1MSWD 3ZSYA 5DLFA 1HYVA 3MR2A 1ZQHA 3O3FA 4KLDA 3OS0A 2E6LA 3PW5A 3OYKA 1RDBA 4IR9A 1NK6A 1NJXA 4M47A 2YNIA 1UA0A 1RTHA 4YD1A 5CYQA 9ICPA 3DRSA 2PFNA 4KLLA 3VQ4A 3V9SA 2DTUA 3RH4A 4FM1A 3QEIA 4IQTA 2ZUCA 3T5KA 1LWCA 4GMJB 4R5PA 4KTWA 4KITB 3SNNA 4B3OA 4J2BA 1RT1A 3GILA 3ZCMA 3FFIA 1N56A 3Q8QB 4CJEA 3BQ0A 4QOZB 1C1AA 4ECVA 2PFQA 3JPTA 4KMUA 5DB7A 3AO1A 8ICAA 2FMSA 3H8JA 5BPCA 3U3GA 2P5OA 2HHTA 2ASJA 2XC9A 3MEDA 1S9GA 3K5MA 3LPTA 2NRTA 7ICUA 4PGXA 2PI4A 1RDDA 3PR5B 8ICZA 1C0MA 3CQ8A 1D9DA 2H5XA 1WSEA 3ZDAA 3S3NA 3QZ7A 1JN3A 1IM4A 4M41A 1ZQZA 4KI6A 4CEBA 4Z6CA 4BACA 2HW3A 4M3RA 4QZGA 9ICEA 4Z4FA 4YFKA 4ECSA 3AA2A 1LB2B 3HW8A 5CZ1A 1GOCA 4FK0A 2P51A 2KZ3A 1RDAA 1IH7A 1XSLA 2ZJAA 5I3UA 8ICXA 3SV4A 3TQ1A 4BXOA 2RKIA 4ZTJA 3JPPA 3PX6A 3SQ1A 4BDZA 4IRKA 1C7YA 1NK9A 4CGJA 1VRUA 1RBSA 3TAQA 3QERA 2A1JA 4RQ2A 4YQWA 5J1EA 3L2UA 1VK0A 1D8YA 3K5NA 3U6FA 4E1NA 3T3FA 2YKNA 1IO2A 3SQ2A 2XY7A 1LAVA 4YR2A 2Z1IA 4I27A 1HQEA 2P5GA 2JZBA 2A1SA 2ZJ5A 3B6PA 3OSNA 1ZBUA 4RQ7A 4AH9A 2FPKA 3MAQA 4CIGA 3F73A 4YR0A 3OYMA 3KK1A 4I2GA 3VQ7A 1S6PA 3DLKA 1L3SA 2VWJA 3GQCA 2AGQA 4QW8A 4GC6A 3TI0A 2FMQA 4R8UA 3AA3A 3V9UA 2C2EA 1QSSA 2W9CA 3CM6A 1EXNA 2JEIA 4IRDA 4I9LA 3E2EA 5HRNA 2KW4A 5DB8A 4FS1A 4EYHB 3NF9A 3K58A 3HWTA 1L5UA 3DLBA 3KK3A 2AJQA 1YT3A 4M3XA 3ISBA 4EYIB 3JPNA 4NYNA 3Q8SB 4Q5VA 5HLFA 4Z4EA 4B8CA 4CJ3A 1I39A 3SUNA 2DFFA 2HNDA 9ICSA 3MXJA 4OJRA 2FLPA 4CCHA 3Q8LA 5TZVA 4AHSA 1NKCA 4DU3A 9ICKA 2EHGA 4Q44A 4TUQA 5DB9A 3PW0A 1IXRA 4FK4A 4JV2A 4RW6A 1RYRA 3N97B 9ICWA 2ZUDA 4FJ9A 3MGHA 3OYIA 4I2CA 1TL1A 4Z6DA 1WSHA 3OYDA 3QEWA 3G6YA 4DL3A 4DL6A 4CGDA 3WNGA 4CEOA 4EEYA 3VQBA 5J2DA 3LP2A 4MFCA 1RTJA 1AROP 4NXZA 3FYHA 3GV8B 3SUOA 3K57A 3ASMA 4W5QA 1JIHA 3ITHA 3OGUA 4FJXA 4KI4A 3MR5A 1X9MA 3I0RA 1ZETA 3OSPA 1TKDA 3SUPA 2MUTA 4TQSA 5KFXA 4LZGA 1I3AA 3V72A 7ICQA 2ZTCA 4K4GA 7ICGA 1HQUA 2X6NA 3LP0A 4KPYA 5HP1A 4DOBA 2HVIA 2BE2A 4EP4A 1DTTA 3Q8RB 1RT3A 3AVGA 1ZQIA 1X1PA 9ICRA 1JLGA 1TAUA 3OHBA 4LH5A 4B8AB 5J0SA 5KG6A 5BOMA 3EZ5A 4F3OA 4DOAA 4YN4A 5KFRA 2AQ0A 2YNGA 3QIOA 4GXIA 4C8NA 4LSLA 1ZQLA 2P6UA 5EWGA 4FBTA 2HHVA 2FBVA 3HPHA 3TR8A 4KV8A 3AU2A 4NCGA 5FDLA 4YR3A 4O3QA 3LWLA 1NOZA 1JLAA 4O3RA 1Y97A 3DLGA 4M9JA 5HRRA 3VQEA 3OJSA 8ICVA 4YXMA 1X9WA 1BPDA 1Z26A 1QS4A 5DQIA 3NCIA 1CXUA 3B6OA 1KCFA 3RB3A 1TV6A 3V1QA 4IQVA 1NK7A 3C6UA 3NTUA 5FRMA 5DG8A 4Q8EA 3CFPA 8ICTA 2ZD1A 4ECXA 1SL1A 4O9MA 3RMBA 3PO4A 4CJRA 1MQ2A 4FLYA 5HROA 1S76D 9ICGA 3UQ2A 3OYJA 4M3WA 4PH5A 9ICLA 3ZT0A 4LH4A 1SKWA 1ZQGA 4F93B 2AU0A 4GLXA 3DRPA 1A76A 2LSNA 1QE1A 2BQRA 4OPKA 3V9ZA 4JLHA 1RZTA 2YNHA 4LD0A 5KFBA 4ED2A 5J0QA 4KN7A 1XC9A 4PGQA 2C22A 3O4NA 4ECTA 4H8KA 3VQPA 1F21A 4I29A 1T7PA 1UT5A 5KFDA 4DSEA 1BQNA 1GOAA 1QHTA 4DTMA 5KFVA 1UWBA 4KRFA 3K5OA 1Q9XA 4MFAA 2Q3SA 1H38A 4FJGA 5EU7A 3C2KA 2P66A 4KLTA 1EKEA 3LAMA 4DL2A 5DKWA 4N41A 5T7BA 5J2GA 4DTXA 3GV5B 8ICNA 2HHQA 4M9GA 4MF2A 5CYMA 4RQ8A 4FJNA 2RDJA 1BI4A 1UOCA 2IGIA 3HT3A 2ZJ8A 4FW2A 2W9BB 1Q8IA 3TARA 4CE9A 4QZHA 2IMWP 5DG9A 2HB5A 3HL8A 4O0JA 4DFPA 4FO6A 3MR3A 1VSLA 2G8VA 4OGEA 3V6KA 2XGPA 4ED1A 3VQQA 3C2LA 3OYNA 1QSLA 4BWMA 3SYZA 4RQ3A 4KKOA 4O3PA 1Q9YA 2A1JB 3QESA 8ICRA 4UQGA 3RR7A 4M6WB 2FBYA 4HTUA 4QZEA
chains in the Genus database with same CATH superfamily
1C1CB 3C23A 2KJWA 3I9ZA 2G8HA 2EC2A 1VQ5S 2GMHA 3UI3A 5D78A 1K1SA 2ALZA 4BRPA 2R7YA 4O5BA 4KB1A 4UAWA 2W8KA 4U95A 3O1BA 5HVHA 3D6HB 4I28A 4NLQA 1RYUA 1JNRB 5EOZA 1JXEA 3V7KA 2NXCA 3LVVA 2PT0A 2DGQA 5B0GA 2KHQA 1S5ZA 4OYZA 3HULA 3MCMA 7ICTA 4WTYA 1VQMN 1S49A 4PWDA 4KX5A 4RL1A 4FWRA 2ZIVB 1VSIA 3ED5A 4AD6A 1DQAA 1COOA 2RQCA 3QSYB 4QIWF 3DLEA 3ISNC 1WHXA 5K20B 4QIWD 3F2BA 3RGIA 2WCXA 4CM0A 4JI0F 3QBCA 2PSZA 1U47A 4PA1A 5A6WA 4P4PA 2WC9A 3AO4A 1Z3EB 1KXPA 4EHUA 2FQQB 1ZAXA 2YV0X 1SZHA 4Z0UA 3FFIB 4WXWA 1BA1A 5BRHA 4DZDA 4C8KA 3I8BA 4TYBA 5GAEU 3IBPA 2HNYB 3G8SA 3IWLA 2ZIWA 2KFZA 4U67L 1S6OA 1LWFA 2OYQA 4OJLA 2PC6A 1ZQ1C 2CQGA 3GJSB 4CZJA 3KFWX 5D46A 3MWBA 4B3RF 4JKCA 3ENAA 1FE4A 3UD3P 4J9LA 4LJXA 4NLKA 4K2XA 1RTHB 3L3UA 3G87A 1RWUA 5L8RC 4WKRA 5AJ3J 4DV1K 4PXDA 4WP8A 2A3VA 3HPOA 5CZXA 2CRLA 3CERA 4I2EA 3LDSA 3MUTP 3VQ8A 2ZIXA 4URSA 3VAKA 1PYSB 3KJVB 1RWOB 2VDHA 4E19A 2ZEJA 3WNHA 4J2DA 2AEJA 1X9JA 3H1VX 5G4DA 4EFAC 4FZXC 3KLVA 2GW8A 9ICHA 1VQ6N 2DGOA 3Q8VA 4BHQA 3TTFA 5EOYA 4ECQA 3GYGA 5IZHA 4IBNA 1FRLA 4CECA 1HMVA 2NV3A 3W63A 4WF9Q 3E1YA 4IEEA 4X65K 1A7GE 4AHVA 3PKMA 4CF1A 2CJBA 2E2PA 3EDQB 5BR9A 1Z00B 4UTGA 1VQLN 4M5DB 4ZA1A 3L6QA 3AOAA 3IHQB 5GADU 2G8KA 4M63C 4X4UA 3OUYB 3T1HF 2HGLA 4M3YA 5F0UA 1I5OB 3SV3A 4F8RA 3AO2A 2GWSA 3HSCA 1RSCA 2O8BB 2C2ZB 4WFAL 2LA6A 1JI7A 1RBAA 3U8XA 4YS2A 3O5BA 4CHNA 3MCPA 5GINA 2MU2A 4QIGA 4NLSA 3OS2A 2D3DA 3KOOA 1FESA 3HLUA 4E98A 2V8PA 5LMUF 3O0FA 2Z2LA 2VU5A 2KVQE 5C24B 3C1ZA 1T8EA 2DKZA 3BZCA 1Y10A 1BL3A 1YJ9S 1HBNA 1HNVB 2AT1B 3CJ4A 3ZO7A 4JRPA 4ECYA 2I9GA 8ICMA 4I7FB 4IOCL 3PRDA 3KWGA 5IS2A 1Q0NA 1GLJO 4DPWA 3LP1A 1VQON 3M7VA 2YH0A 1YRUA 2V8VA 2IJNA 1FWLA 4KHRA 1H98A 1TUVA 1S22A 4CRXA 8ICPA 2DY1A 3C16B 3ZC4A 2M52A 2OEJA 4C8OA 4Q8FA 2RP5A 2ZZNA 1NK8A 1JWWA 5FPNA 1ZQFA 3LP0B 4FNIA 4P2SA 4UB1A 3AL0B 3UNGC 4URGA 3VQ9A 5A2QY 2DNZA 4M5MA 4Y2IA 4HTIA 5C7PA 2BCSA 5H1SV 3UPQA 4BRIA 1ZQJA 2KN7A 2O8FB 1U26A 2ZIXB 2H5EA 3PKYA 2MHNA 2F44A 2ROGA 3Q8UA 4RQ1A 2Q36A 3DDNA 1ZQTA 2IHNA 2I5HA 1PILA 3RRHA 4B3TF 4C8MA 4DR1J 4RPFA 1UAWA 1RCXB 1UTAA 4DN0A 3BM7A 1VIOA 4XUSA 2OFHX 4I9QA 2GO9A 2V4QA 1TVRA 4LFBK 3ADAC 3CJAA 1RFQA 4QU6A 4ZVOB 3RB0A 2E5IA 2PY5A 4W92B 2GELA 1AQ6A 3PYEA 1LK5A 1NOYA 2NRWA 2X3GA 2XULA 3Q8KA 1ZQUA 3IM9A 1XO0A 2YNFB 2DHSA 5L9NA 3VQCA 3D4JA 1OVYA 3ZSVA 2DHXA 1UPHA 4Y2UA 2L9WA 4NE9C 3KLHA 4F0MA 5HMZA 4J9KA 1J54A 4NA3A 4JWNA 2F3JA 3AO3A 1OYEA 7ICHA 4V19X 1C1BA 3MEGB 4ZVGA 1RDUA 4CJKA 5KT7A 1T03B 5JMNA 2QKQA 3CNHA 4R64A 4OX9F 5I3PA 3W0LA 1BWFO 1W7AA 3LO3A 3AUOA 4JWMA 4WFAQ 3DLHA 4OKJA 2C1EB 4M63A 1F1BB 3PRVA 4IOXA 2PMWA 4ACOA 3DI6A 4J9UE 2E9RX 1XNSA 2IVOA 4ISGA 2KHOA 4UAVA 3M8PB 3PMLA 4KHMA 2X1AA 4A2AA 3VERA 2V51B 5LMUK 4H5TA 1R7IA 4X4TA 4FZZA 4KGZB 3NL0A 5AQMA 2ZUGA 2R7XA 4H5RA 1NSKL 4RWXA 1SXLA 2BXJA 3IAS9 2KSOA 2GO7A 2ADCA 2AF6A 2GMJA 3EEQA 2P6RA 2XMJA 3MFHA 1V9PA 1QZ6A 3HPGA 1IBKF 2VKZG 1BWEA 3OLAA 5DGBA 1YJRA 5AQKA 4JKEA 5KGXA 3C0BA 4KLOA 2YKMA 3UDCA 4CM2A 5L46A 1Q7LB 2GC8A 3GIMA 4ZIWA 4YCXA 3HHLD 3DNCA 1JLBA 2XSJB 2FJDB 1ZBFA 4I68A 2F9DA 4DR3F 2VFRA 1RWPB 2F9TA 1AFJA 3KJVA 4AUKA 3THWA 5AK5A 3FDSA 5DZ7A 4FWOA 4OI2A 3HZGA 5DBCA 1RACB 5HQ8A 2LYBA 3KK3B 2D6FC 1TTHB 5F8NA 4HDHA 4JI7F 1NGBA 2D5RA 2YKAA 4Y2JA 3CW2C 1NPPA 1Q1KA 3G6VA 4WFBQ 2OTLS 3H98A 4CFCA 1OQ6A 3OVSA 9ICCA 4ED0A 5F2RA 2IM1A 5FLXU 4FN5A 1KC8O 3WZ0A 2A2DA 4ELUA 3IRXA 3TWHA 5HL7L 4DU1A 1WBDA 3ONNA 3ULDA 4OYXA 4I2JA 1FKAF 4ZMMA 2H3GX 1HQ2A 2B5JB 1S5LU 2QG9B 1APSA 1R43A 1S10A 3FRYA 4NLOA 1S97A 1L6NA 4YB7A 5FRNA 2GIRA 2MKCA 3QU7A 2KT2A 1IWGA 3B0YA 3P5TL 4RPZA 4FW1A 5JS2A 3GU3A 4NMLA 1HHQA 1NMEB 4FNHA 2XB2D 3LW5C 4DS5A 4DCOB 3HFZB 4I7FA 4FL9A 4JHDA 4JK7A 4YMMA 2ATLA 4DUYK 4Y2RA 8ICQA 5J2MA 3K9JA 4QZAA 4C8LA 3DJCA 1VR6A 3TAPA 1UPPA 1VISA 3TADC 4EO6A 4PKIA 3L2RA 2E44A 1RHMB 4FLZA 4NM1A 3AGKA 3DHWC 2FGCA 3CCZA 5D4PA 1FF2A 1PK1B 4L3QA 3SQ4A 2BRKA 3VN5A 4JI1J 1X0FA 5J2AA 4X64K 1TMJA 1FKPA 3O6WA 3TAFA 2FPMA 2NRZA 1REGX 4TY8B 4Y2QA 4M5JA 2LBOA 4CF4A 4B3MF 3HKZF 5CD4H 4YOYA 2RH3A 1D0EA 3ID8A 2J6TA 5J2QA 4XA5A 3A3NB 3LOUA 2WAQC 1ZD3A 5L1MA 4DSFA 1NUEA 5LMNJ 4X64F 2MKKA 1UVNA 3BZKA 1LV5A 1Z6RA 1W0HA 3C5GA 1KHWA 3MMCA 1KQFB 5KFGA 1VDVA 4HHUA 3H20A 1Q79A 2XY5A 3G2XA 5HANA 3WK8A 2G13A 4PG8A 5ALLA 2BR0A 1PCAA 4KLEA 2BJ7A 3RBEA 3G71S 3KHHA 4FPIA 4KSEB 5KQ8A 4OHYA 5AQFA 3HVTA 4DTJA 2ZHOA 4EFHA 3SPYA 2WTFA 3L4IA 5BN9A 2ZC4A 3IRUA 2I6WA 1TL3B 4NL5A 3M6VA 2DO4A 4ANDA 1WG1A 3GR0A 3UW1A 1OQ3A 1X2IA 1WLJA 2ASDA 3N6MA 1WB9A 3IV6A 4F9OA 1RILA 2XWYA 4NLWA 3QB0A 5ALPA 4B9QA 1RTIA 5B0DA 1NGCA 4IDKB 4U67Q 1ZM3A 3CCTA 2W2MP 2W7AA 2CQPA 4AM6A 4KAZA 3MDAA 5A0YA 1XBWA 2K06A 3HZ6A 1JLCB 3THVA 1W2BR 4E1MA 2NYIA 3GE9A 1VQ9S 1D4XA 3GJTB 4O44B 4J9RA 4J8FA 1ZQRA 5AQOA 3KD5E 3UR0A 1WAJA 2XO7A 4E7IA 4FJHA 1VQYA 4I2HA 2PFPA 3I55S 2C2KB 4DR4F 4DOZA 3N79A 3FMBA 2ZH9A 1TGOA 2CPXA 1CPZA 2HLTA 3SEOA 3DDKA 2Q0ZX 4HACB 4NCBA 1IBKJ 4N76A 3SR6A 3SAHA 2ZTDA 1IBMF 3QNNA 1RDRA 2RF2B 4CH0S 4KLGA 5AZJB 2WMMA 1U48A 3MEEA 4O4GA 3MUVP 5J2JA 1SJRA 5ALNA 5HROB 4HVZA 4LBPA 1ZQCA 3QDKA 5J29A 2AD9A 3UKUB 1J2MA 1COKA 2RRBA 2XTJP 1KBUA 1C1CA 4RUHA 4RW4A 2LXIA 4LC9B 4BLGA 1SI9A 4RZRA 1PVPA 3VZHA 4DMZA 3A3OB 2D0CA 4BE2A 2Y3YA 3E01A 1WEYA 4DF8A 2E1ZA 1SZPA 4FYXB 4DV5K 2F65A 2UZAA 1DHMA 3OTDA 2H54B 4JKFA 4EK2A 1N5SA 1ZA1B 3I33A 5M1OA 3RBZA 3C15B 4BR7A 2CPHA 1TAMA 1I94K 1RCHA 1E6YB 3KLIB 3C7NA 4WU3A 3P5BP 1YVNA 2AYMA 4B3TJ 2UU9F 1KQQA 3PACA 1TK0A 3ATUA 1CJTA 3SQGB 4NZ0A 2V7YA 3MM8B 4YN3B 3SENA 1YKWA 1V5VA 3BQ7A 5CHCB 3O3HA 5ETNA 4I6WA 1NJIT 2ZOGA 1URNA 2RS2A 1O6XA 1HA1A 4CK3A 5LJ3Y 4USJC 4JI6F 2JLEA 5G5GA 3QGHA 4LRDA 3DGPA 3EJMA 4DSJA 2M88A 2GO8A 3C95A 2J9DA 2GGPB 1ZYQA 5IV4A 3PV8A 4FVMA 3KJQB 2PN6A 4K4IA 3NP5A 5HO4A 1CUKA 4PZNA 4F02A 1K9MO 2ETJA 4XPCA 2E7XA 3FEYB 2Q1LA 3NGTA 3T1AA 3MM8A 2UVWA 5IWAJ 2P9LA 1BG3A 4A8WA 3L4PA 4B1UB 4I2AA 4KHPK 4A2BA 1HHSA 1TFRA 3DAWA 4DR6F 4I0WA 4HWIA 1C4CA 1OIAA 4WQ5A 4RJVA 4I4BA 2AJFE 4EWTA 3M9NB 2W04A 1RI7A 1RBRA 3NASA 4FYDA 2E66A 4CJQA 1SBRA 3AVNA 4DV3J 1VRQC 1D09B 1NDCA 3VEVA 4DJBA 7ICRA 3M2UA 2HBQB 3Q7BA 4HH1A 1M1KO 2UXBJ 2HCFA 3T69A 2UUAF 4A46A 3BREA 1EB0A 4FJ7A 2MSSA 5E3RA 2XS7A 3LPUA 4OZ0A 1DTQB 2W43A 3RSEB 4U7UK 3WQTA 4QWBA 4IFVA 3BB5A 2I7NA 3KD3A 4P2XA 3W9JA 2H4YB 2ATQA 2KM8B 4WCEQ 2VQEK 1N36J 2V2KA 4LF7F 1JXBA 4QS7A 1XHXA 1DK2A 3GG4A 3BF3A 3U26A 4CEDA 4AQYK 4JKDA 3H5XA 1MU2A 3FSXA 4C2MA 4KKOB 1KVKA 4I56A 1JMTA 1ASUA 5LOQA 2FJBB 3PCOB 3NNAA 2W55A 4YMEA 3JXUA 1S1XA 3NE6A 4PYDA 1D8LA 2Z7JA 3RJFA 3FMWA 4PRFA 2KT5A 4F92B 1HBOB 1WWHA 1NPRA 2WW4A 3G86A 2CFXA 4B1YB 1RQ0A 1F2GA 8ICOA 3ZNJ1 3D2EB 4YDUA 3MN6A 4DUZJ 3R2CJ 2VODA 4YOUA 2RHFA 3CVKA 4DQ8A 1ATSA 2NXJA 3NMRA 4X66J 3KZXA 3CCSN 1QAJA 5DDOC 2BKOA 2R2TA 4RUCA 2ZH1A 3FZFA 2E8PA 4LREA 3MM6B 4NCAA 2W01A 3AH6A 1UW9A 1ZQBA 5KT6A 3IBFB 1R0BG 1T94A 3NGRA 1DGKN 1N0UA 4DTOA 2CXYA 1CQNA 3CIZA 1ATNA 5FPEA 3PVXA 2QFJA 8ICFA 3QNWB 4OCZA 3SSSA 4FLWA 2MGZA 3HILA 1RHKB 4M42A 5EDWA 1GTEA 2R8GA 4PCQA 3ZZPA 2ZJQL 2K60A 2BCVA 3E51A 2QO3A 2QKBA 1IN0A 3CJSA 4K43A 3BN4A 2A6AA 4DQPA 3AOBA 4IQWA 3TFRA 4ZN3A 1RB0A 2P8IA 1Q4RA 4C8YA 2CQ2A 2DGTA 1DRGA 3KJNB 4WFXA 2FVRA 4KTQA 1XMQK 1IV8A 4DEZA 1YK9A 1S6QA 3NMAA 4ISEA 2XGQA 4JI8K 3GIJA 2AIRB 2BZ2A 3R5AA 2DXFA 4MKAA 4P75A 4CF9A 3GIKA 3HVRA 4CTAA 2IDEA 2KE7A 3J7YU 2R7VA 2CJAA 2CNLB 5IIIA 3SMVA 1IKYB 4OJ3A 4OKKA 4LF6J 2IM0A 5ETRA 1E3MA 2VG5A 5D3GA 3C66A 2CNKB 1S1XB 1NSAA 1PIEA 4DPUA 4MTPA 4DV5J 3V6HA 5B0BA 3OXLA 4WKYA 2MQ8A 3R9PA 1GX6A 4BX9C 3WKDA 3DXKA 2QSWA 1T9VA 3HVAA 4RQ5A 2YKPA 1BCMA 2WOMB 2ZTEA 1RTDA 4OL8A 1A77A 4DUZK 4FM2A 4DU4A 2Q43A 1DRZA 1D9AA 4B9NA 1ZXOA 4GKJF 2P9KA 4DX8H 3MDCA 2CNNB 3PUFA 3C3LA 3LZJA 3F9KA 1B22A 3MFIA 1W2BM 2V8GA 1XR5A 2FHKA 2CQ3A 1YQHA 3H40A 3T6JA 1QUPA 3H3OB 3ETLA 1RTDB 2HRTA 1Q5YA 2F4VK 3R97A 3MCAB 3EDRB 3JSYA 4KLHA 1AYEA 2OM6A 2W25A 4QR1A 3OV7A 1M5HA 5F1XA 2WTUA 5J2KA 2D0BA 2DRBA 4M45A 2O8BA 4LR8A 4KB0A 3AMZA 2W3SA 2D1CA 4DPXA 5CD4A 4CEQA 4IFVB 3VGMA 2HRYA 1B43A 5DBAA 2YWKA 3FGUA 4J9OA 4OVLA 1AUSL 2BW2A 3D5MA 3HJFA 3D6JA 3HHLB 3RRKA 4B1VA 2Q66A 4DR4J 1XTZA 1YJ7A 4MQ3A 5J0WA 2OFGX 4ZS6A 1PBAA 5C10A 2DD8S 1BI4B 3ZD8A 3MURP 2EI5A 2NRRA 4LSNA 2FMPA 2XZWA 2WHEA 3C1YA 5HMWA 4BREA 3C21A 1T9WA 3AXMA 1GLEG 3TEGA 4KO0A 3MR7A 1EIYB 2LCWA 3JSRA 4M5LA 2YNIB 3CC2N 4BRLA 1HARA 4NZ6A 4I64A 5U47A 1AZSB 1BIUA 3W8PA 5D4BA 3SCIE 3MAAB 2R7TA 5HMLA 5E3CA 4FYWB 3JB9k 1QAYA 3IBWA 4HHTA 2W41A 4C11A 3KNGA 5IIOA 1N34K 2CXEA 4GNIA 5KFJA 1E6YA 2AYEA 3KLIA 5GVQA 1R31A 1PC4A 1X4CA 2NUBA 2F1JA 2YHAA 1JJHA 1VQ8S 4USKA 4DV1F 2ZIWB 4QWEA 2D1KA 2K4EA 3KTQA 4K7QA 3BP8A 1VHIA 4X62F 2G0IA 4YD2A 3VQSA 2Z2ZA 4C11B 1A0OB 4AFFA 1Q7YO 5EE0A 3CB4A 4KGVB 4QW9A 4X66F 1HYZA 1CJUB 2A6OA 3B78A 4Z4GA 2XNRA 2HLUA 1X3MA 5ALIA 3M30B 5C42B 4L6V3 3BGRA 1CLFA 2PMHA 3ZSXA 3CRXA 3O9QA 3K2YA 4JI1K 4P4OA 4UB3A 3TNVA 5KG0A 5IT9U 1QQCA 1DZ5A 5HVFA 2SXLA 3TO8A 3G96A 2O8EB 1S57A 1KW4A 4MO4A 4B9MA 4H4OA 2I9SA 1T0TV 1WELA 4C3LA 2QIFA 1SJ3P 1SQFA 1M1KT 2P2CB 1LFWA 2YWHA 3TZWA 3THYA 4CWBA 2D4WA 1I1GA 4F3TA 3V4IB 4LJMA 5KFEA 1ECWA 1VYAA 3R8EA 1IM6A 3S01A 5BPMA 3R7BB 3POTA 2F8SA 1S9GB 1JJ4A 1GLCG 2GQ2A 1KOHA 4YB5A 3N7RC 4I2QA 3NNCA 3CJQA 5AM3A 1SJQA 4HYKA 2PIIA 4DFDA 4O5CA 1R6YA 2XLJA 2ZJPL 2CKWA 3O1WA 5JXSA 5J0PA 3MR6A 5KFZA 3NVVA 2WFAA 3R8YA 2H3FA 2ZKUA 3TJAA 4OFZA 1QVGM 1A5WA 2CPDA 3RH5A 5BYRA 5E2QA 2MUTB 1YVUA 2MQNA 2GCFA 2A1RA 1C2PA 4IZ9A 3CCUN 1SB6A 1WACA 3UMCA 4KLJA 1ZQNA 4J9NA 4OJGA 1Z1ZA 3FR0A 5ALOA 1L3UA 3VQ6A 1MSWD 5DLFA 2YMPA 1UZDA 3H2UB 3THXB 4NLYA 1RDBA 5AQHA 4DX6A 2AJ0A 5CYJA 2YQ0A 4YD1A 5AXNA 5M1PA 9ICPA 1U1NA 3DRSA 2DBBA 3VQ4A 2PGCA 1QTNB 2ZUCA 3AEVA 4Z37A 3LM2A 5D0RA 3UE5A 1TE2A 1TMMA 1LWCA 5EX3A 2POKA 1HNWF 4R5PA 3WXJA 2PMZD 4KTWA 4QR0A 4J2BA 1RT1A 3AAPA 2MTLA 4KRWA 2MZTA 5KAFU 3BQ0A 3P4UB 3RG6A 4KMUA 1Z1VA 4WYLA 8ICAA 2QN6B 5AQIA 5EN1A 3OL7A 5BPCA 4F4AA 5THWA 2HHTA 5HATA 1YJTA 5IC6B 2E1PA 2HVDA 3WK6A 2UV8A 4FWNA 5LMNK 3GOIA 2NPIA 4OIXA 2NRTA 1CJTB 4AL6A 3CMAN 4IYQA 1RDDA 1N0VC 3T1HK 1JJ2R 4C9DA 3UCUP 2KH9A 1NGFA 5AQGA 4I2PB 3QZ7A 5G5HA 2DPNA 4CEBA 1U2RA 4M3RA 3CJ8A 1NHKL 1P8ZA 5JVGL 1OMSA 2GIFA 3CJTA 4DR2K 3HW8A 2GHWA 5T14A 2KXFA 1IH7A 1XSLA 2B4UA 4OYOA 2N1RA 5AM1A 1R0AB 5I3UA 8ICXA 1RTZA 3EVWA 5JVHQ 4K0KK 4RW4B 2MRLA 1RBSA 1N36F 4LF7J 4RQ2A 2DXEA 4MYTA 4IC9A 1OY9A 2VC0A 3QT8A 3K5NA 3U6FA 1FEHA 1IO2A 4OZ2A 1I94F 4YR2A 2YHYA 1HQEA 2P5GA 1HR0K 3QFUA 1F5BA 2A1SA 2ZJ5A 2LLZA 3UD4P 3OSNA 3M1VB 4AH9A 1DT9A 2CZ4A 2P9CA 2FPKA 5GMDA 4A8FA 4ITSA 4U7BA 4CIGA 3KK1A 1PVRA 4AQYJ 4F25A 2VWJA 3IR5B 4ED4A 3GQCA 3TI0A 1CSJA 4JK9A 4LSLB 2YTUA 2G07A 1IBKK 2ZWHA 2C2EA 1FEEA 2KU7A 2KG0A 2FDNA 3X1LB 3CM6A 1EXNA 3VEYA 1YWXA 2YHWA 3E2EA 4QR2A 2FJEB 1MA7A 2R18A 1YUWA 1DY3A 3KK3A 2AJQA 2YJFA 3HJVA 4EYIB 1FIQA 3QIPB 1FI4A 5EX0A 4Z4EA 4NXMF 2XSFA 4CJ3A 4OI3A 3SUNA 3H2LA 3FCVA 3S6JA 9ICSA 3MXJA 4LT6A 3FSIA 4OJRA 2YNHB 3BR9A 1Q3UA 3Q8LA 4HTLA 3H2VE 4H5WA 4CLKA 5DM7Q 1LWCB 2G5IB 5DB9A 4EX7A 1RYRA 3B4DA 1BNPA 1T44A 2ZUDA 5HL7Q 5AICA 2B43A 1QE1B 4ANCA 3OYIA 1TL1A 1B99A 3DOKB 2ZUAA 4ANEA 4X4RA 4B1WB 1WSHA 3OYDA 1ITPA 1CULB 2UXBK 5AI8A 2YMLA 1CJVA 2ZIUA 2IRYA 3G4SN 1Z4NA 4EEYA 2RHQB 2ASMA 5J2DA 1FDNA 4LF8F 3K9KA 1RTJA 4DR6K 3FYHA 3MPDA 2J7WA 3ASMA 2HBJA 1F60B 2QSFA 1JIHA 3IGVA 3CXCM 1C4AA 4KI4A 3DLKB 3K0SA 1XNQF 2HQGA 2OP5A 3IKMA 3QGGA 3U4LA 3M6UA 3OSPA 1QVFM 1XMOJ 2RRAA 4U9RA 2MUTA 3DGPB 3TUPA 3W1YC 3MWTA 4DV6K 1N88A 2FF6A 1I3AA 1IQZA 5IOLA 1HNZJ 3VAMA 4K4GA 1HQUA 1RT2B 1PGZA 4KPYA 1U8WA 4DOBA 5HJYA 3D2SA 1DTTA 3HHKA 3DU6A 3NGUA 9ICRA 4TY8A 1JLGA 2LQJA 2FVQA 4B8AB 3HOTA 5J0SA 3NAHA 4F3OA 3AM9A 3EZ5A 3ZZYA 1TKXB 5KFRA 3POTB 2AZ3A 4QU7A 3K89A 3AODA 3HI9A 3QATA 4EELA 1OSCA 3UKUA 4CZMA 1Q86O 2ZM6J 1N36K 4QYRA 2FBVA 3HPHA 4BC2A 3VGVA 1MMNA 1FO4A 2BJDA 1FKOB 3M2RA 4ERDA 4YR3A 3GZFA 4O3RA 2JOQA 4M9JA 5HRRA 3BPSP 2A18A 4KC5A 8ICVA 1H2UX 4XK8C 3CCMS 1L7OA 5DQIA 1CXUA 3A1YG 3RB3A 2UUBK 1FJ7A 2WF8A 5A6PA 3TRGA 3M8WA 2F76X 3NAIA 5FRMA 2AEMA 3CCES 3GJQB 4NWBA 5K8MA 1MDUB 2E1RA 3RMBA 1N33F 4NXMJ 5HROA 3OYJA 4NA1A 3VTIA 1PVQA 3ZT0A 4O23A 4LH4A 1EQYA 2JH7A 1ZQGA 4F93B 4BR9A 1A76A 2LSNA 3KFUF 2KKHA 3NBPB 1BXNA 3BGOP 1NEEA 5FLXO 2NSCA 3V6DB 2WRMA 2W54A 3VQPA 4I29A 3QGIA 5KFDA 3CUNA 1GOAA 2BANB 2PMZF 2QWPA 1UWBA 1Q9XA 2Q3SA 2UUBF 4G9ZA 3C2KA 2P9SA 2EANA 2P66A 3TTDA 2P9GA 3NCPA 2QTWA 4M94A 3N7PD 1EKEA 2J9CA 3OT9A 5D4OA 2IOHA 1ZOTA 3SEIA 4N41A 1JJ2M 3GL1A 2I2YA 3O2IA 2LXUA 5T7BA 1F3VA 3GTYX 2FY1A 4I1TA 3V5RA 4FP9A 4M9GA 4DV6J 3C6HA 4D3GA 2AYBA 2WF5A 1C0UB 2RDJA 1N62A 3L95X 2DGSA 3R3TA 3D2WA 3EZWA 4CE9A 3UWTA 3BGLA 5DG9A 1ULRA 3BY5A 3HL8A 4O0JA 3ZYYX 4DFPA 3HOSA 3MR3A 2E5LJ 1VSLA 2G8VA 4FKXA 4I69A 1QSLA 5D4LA 4RQ3A 1FNOA 1G4CA 1NSQA 4CLLA 4ZIVA 4C7ZA 8ICRA 4UQGA 3RR7A 2GJ2A 5AQQA 3ICXA 4E2FB 2JWLA 2FBYA 4HTUA 4QZEA 3DLLL 3AVCA 4L3KA 4F5RA 5KT3A 1FKPB 3GJRB 1HKAA 5H2FU 4BRKA 5F3XB 1JLEA 4L3NA 2W2NP 3QRPA 2OO4A 4DUZF 4I2BA 2VGMA 3C2MA 1X5TA 4NASA 1OH8A 3KUHA 4PWWA 5LSRA 3NGKA 1UJ4A 3I6PA 2BH1A 4DQRA 4MKBA 3HJEA 4UOGA 1R8HA 1Z4OA 1YRXA 4ECUA 2NZCA 3RU0A 4Y2KA 2J7KA 1HNWJ 4BDPA 4F5PA 5KI6A 4L73A 2GVZA 3E58A 1SJ1A 5ETLA 4FLXA 3BBFA 4CEEA 4RUAA 4ZVHA 1SJ4P 5L39A 3ZZRA 2HWHA 4ECRA 4WWSA 5J8YC 2JRZA 1HWKA 2P9SB 4M3ZA 3OBYA 1S4FA 1IUJA 4BY9C 9ICQA 4F0KA 3CFOA 1HI1A 4CZHA 3DXBA 2WB1D 4P72A 3BSNA 3NF7A 3RMCA 4WQ5C 3WNEA 2QXLA 3T19A 1K8KA 3US5A 4OQJA 3BF1A 5AI5A 1UWAA 2IBOA 1RUSA 1FJCA 4IQUA 2GIQA 3ZT3A 3LP3A 2XEXA 1B9FA 3AA4A 5JUMA 3FUYA 3KKSA 2HHHK 4BR0A 3M8ZA 2B3TB 3VQ5A 3NWGA 3GFYA 4YMNA 3G6EN 3O3LA 1WAFA 1PUZA 4J2AA 4BROA 3NS1A 2C42A 5IIJA 3LZIA 2IAJA 1FNMA 1NB7A 2M4MA 2F4VJ 4NRUA 4H4KC 4KH4A 4K5SA 1U1QA 1DFDA 2VASA 2CQDA 2JXJA 2X6SA 5AI9A 2I1QA 1EKSA 1DLOA 1TK5A 3H25A 4ES2A 1NKEA 2QLXA 4KY3A 1QH9A 2UP1A 1DOQA 2JH1A 4YVZA 2XYHB 3EPGA 2Y0SC 3BQ1A 2IA6A 2EG2A 4HHJA 1XMOK 1JJCB 1SH3A 3GYNA 5T7LB 3IUCA 3JAMO 1MWQA 1S6UA 1XNRF 4ALZA 2HHHF 5DQHA 5ETSA 1ZA2B 1BQMA 4DV5F 4KN4A 3NG8A 3OVAA 5KL1B 1SB3C 3A0BU 5I3UB 1HQUB 4K4SA 3HD1A 3QMLA 1TYQA 1GMWD 2EXUA 4PPZA 3H3NO 2P9KB 3GYXB 1R8BA 3D66A 2K8GA 5K14B 4DU7A 3K1RB 2LEBA 5JLFA 3NRWA 2FB0A 2GA7A 3H0RB 2OPSB 1NKBA 2E4LA 3MMBA 1S12A 3U9ZA 4FJMA 4DV3F 5KL8B 4WE1A 1BD6A 2RDIA 3DYAA 5DM6Q 4USUA 4KTZA 5GADI 1RAJA 3FZMA 1SH2A 3VVUA 1Q95G 1KOOA 3OUYA 2HS4A 4KBOA 2UU9K 2LQ8A 3CCLS 1N32F 2R8JA 4FO0A 3D28A 2W4DA 5I42A 5B0CA 2YNFA 4CLFA 2R8HA 3MCNA 3LDQA 3MD3A 2OKQA 2OAUA 1Z4UA 1UZHA 4UB8U 5KPZA 3VQDA 4XH1A 5J0TA 1N32K 3SQ0A 1BQMB 3OBWA 4YNQA 4P74A 1JX4A 2B21A 1BLUA 3QIPA 3H4DA 1MQ3A 3GCWP 2CPYA 5L38A 4EENA 2R9LA 3T5HA 3PM9A 3IFRA 1HD1A 3AD8C 3L7PA 4DR5K 3CD5A 4RG8A 5DDYA 3W2VB 2C2MB 4CO3A 4JKGA 1LW2A 2GLEA 4JP8A 1MNEA 1ZBSA 2JEGA 2AYGA 4QIEA 4DO9A 4DWIA 1VQLS 3OYEA 4CZKA 3V7JA 4ZCLA 3CCWA 2MKIA 4B08A 1H72C 4ILJA 2O8CB 4CTAB 5LL6d 2H3QA 3BGUA 4B1XB 1VBXA 1VJ5A 4IL6U 1FXRA 4DR5F 3ZX2A 3MPUB 4PAAA 4OYPA 3PIPL 1WEZA 1TZ0A 2RD5C 4TYAA 2GWJA 4QWAA 4NM2A 2WVBA 4ETXA 1FD2A 5J2CA 8ICIA 4O8UA 2FJ6A 4AYBC 2MQQA 1V5IB 2ERRA 1WC3A 3EYZA 8ICYA 1U4BA 4K59A 4WQ4C 4Y2TA 3D6TB 1NPKA 3HVTB 3R5CA 4EBCA 2Z1HA 4DOCA 2RB7A 3KZIU 2LI6A 2HHUA 4JUZA 2RU9A 1ZM9A 4PHAA 1EETA 1HBNB 1HNVA 4JOUA 3BKTA 3TZYA 4CESA 1S1UB 4F4ZA 2BGGA 1WC4A 5IV3A 3PJWA 1O0PA 2KT3A 1HBOA 4F7VA 1C0GA 1YTYA 5KFWA 4PHEA 3QO9A 3A3PB 1PKUA 1S77D 1IJFB 3TOQA 4GVMA 1RLDA 5KG1A 4F67A 1Z05A 5DM6L 3SZ2A 3LPYA 2RRNA 1MC8A 4QJVA 1RBUA 1G7CB 4H5NA 4WFNL 2QK9A 4K0KF 1WSIA 5SUHA 4H0XB 5GAEI 4CFBA 3V1OA 2WBNA 2WVEA 4WXOA 3RF9A 1X6IA 4AT1B 3CETA 1N8RO 3TSPA 3Q8MA 5M2UA 1IKVA 2E8MA 3L3VA 2F9WA 2A2CA 2GEMA 2AP6A 4XDDA 2QB1A 2HNZA 5E0OA 2ZH8A 5KFSA 2VDIA 2HQCA 1IG9A 1UA1A 1ZD4A 2F9JA 2DPIA 4IFYA 2VPZB 3OR2A 3ZI4A 2KXNB 4ZCIA 3C28A 3FBCA 2R2RA 1KVCA 3FC9A 1G3OA 4AL5A 1U04A 3MF5A 3H7IA 5IIKA 3CDWA 4J2EA 2DCUB 1T6CA 2BOAA 2OZSA 4KGXB 3FZHA 4CF3A 1IXKA 3TADA 3TVZA 2V5HG 4DU8A 2P6TA 3MTKA 3RWUA 1M5SA 2V9KA 4MK8A 2R7SA 4DHYA 3V81A 2Y8YA 1LWEB 5A2QO 5AKGA 5KFQA 1ZRNA 1R0CB 1ZQYA 2KLAA 1FXXA 3F5TA 1F44A 4LFBF 2D0AA 4UAZA 2MKYA 1KBRA 4CFDA 3OXGA 4HUFA 5AQJA 3UN2A 2HVEA 4LVOP 3LAKA 2XLKA 2R7WA 2LYAA 4F2SA 2MLZA 1XNQK 1T4GA 4Y0FA 1GFWB 4JKGB 5LXRA 5GAEP 4RT2A 4OX9J 2BPCA 1YAGA 2EZYA 4RBVA 2ZD1B 3QGPA 4BR5A 1FA0A 1JQGA 1NZ8A 2CQHA 3I28A 2HQDA 5K14A 4WYBA 5CWRA 1JKHB 2CUYA 4N77A 1WKJA 4OI0A 4CHZA 1WTBA 4CHPA 2VG7A 3KK1B 4LF5K 3HFKA 1NZPA 4PJ0U 4E7LA 4CLUA 2B0CA 2JEFA 4DV2K 4CGZA 1NGDA 2HK3A 1VOMA 5ALZA 3NBPA 2EAOA 4BE0A 3LYSA 1MA9B 3S9HA 3LALA 4J9PA 3GB0A 4C4RA 1F2HA 1F5AA 3FGVA 4A4JA 4IG0A 1MU2B 3SFGA 2VICA 1F5CA 2NNWA 3CC7N 3WEEB 2OANA 3AT1B 3BKUA 4MAKA 4DL0C 1V3RA 4PKDB 5C42A 2A5XA 1FJGF 4UOHA 4ECWA 3PNCA 1ZQAA 3C7NB 1QVFR 3CD0A 4PG4A 3UN5A 2Z0GA 1RHJB 2JX2A 2CWXA 4X4SA 1SIZA 2CIMA 5LM7E 2MPUA 5SWMA 4B9UA 1K1QA 1M90T 5HAOA 2O6KA 4K41A 2ASYA 1T05A 4QIFA 3CCVN 3RH6A 1Z1BA 1UW4A 1Z2ZA 4B3RJ 4UB4A 1VSJA 4JV5K 4L76A 1VRTA 2W8LA 1VS3A 1O8BA 4Z94A 2NS1B 3SXLA 3VHQA 3ET6A 2ZVSA 4OX6A 1LKYB 1RXVA 5BYSA 3W7BA 1SV0C 2F8LA 3GSDA 4DR4K 3DHXA 4ZP8A 4X4NA 3GIIA 1WNEA 1MWKA 4UASA 1RXWA 1Q86T 1H2TZ 4JV5F 5A0YB 4ER8A 2AGPA 2L41A 4LBIA 3J80O 4ED3A 2ATCB 5ELZA 3UD5A 1XO1A 2N7YA 3GP9A 1VQ7S 1D1UA 1RBTA 1FTRA 2XBPA 2D69A 2WF6A 1G15A 3HFVA 3DMJA 1Y4ZB 1UVKA 2VUGA 1Q46A 3L2QA 1TL5A 4LSZB 3ETMA 2VA8A 3GR1A 4NLDA 5ALVA 2YBVA 3CJ9A 3NCQA 1VQ4S 5CQGA 2K2PA 4CO1A 1MWMA 4M1KA 5A0LA 1ZBIA 4A8KA 2HS0A 4RW8A 3CSKA 2O4GA 2CPFA 1RWNB 4QZBA 4Z2XA 2BACA 3HDSA 2DITA 4KO0B 1VQ5N 3F2CA 4MIWA 1NHUA 5E41A 2VG6A 1QAXA 3ULEA 2G8IA 4YMOA 4ZPDA 2BANA 3WX8A 1SQGA 2G2YA 4MDBA 3ZT4A 5CE3A 2ALYB 3HX0A 2ASOA 4GMKA 2HHSA 2OSRA 3AJDA 2HHPA 1GEHA 3W64A 3D1OA 4FOEA 3VGTA 2FI1A 1WC0A 4JV1A 2AHOB 4FYVB 2B9XA 3CE8A 4UAUA 2DQNB 3NH2A 2JFKA 4TU8A 1NDKA 2BGWA 2HDOA 5A2QU 1CXQA 2W03A 1RT4B 4ID5A 1SWVA 3VMFB 1U24A 1L3TA 4FPAA 2UYTA 2HAIA 2R2SA 1RWMB 3KXDA 5ADZA 3R7NB 1N6QA 2ZG6A 3E9LA 5GAHI 3RJIA 5LY3A 5FP0A 5HVGA 2MJUA 1EQMA 4DF4A 2GX9A 7ICMA 4RNMA 4ZLNA 3H90A 2E88A 4P9SA 5LJVA 3N6NA 3P1GA 5DS7A 3PW4A 2F7VA 5HJXA 4CLWA 3A12A 5C2CA 2CJQA 3CD6S 5D3GB 1BE4A 3NOCA 1V4TA 3OYFA 5AQLA 5BRDA 1NU0A 1RWXB 5E33A 3OY9A 4JKBA 3KK2B 2QV6A 4PQAA 3TYTA 1T3VA 4OPHA 4FJ5A 8ICLA 2VQFF 2MSTA 3QT6A 1GNKA 3H1QA 3JPOA 4IOAQ 1QCKA 1Y5IB 1JLFB 4CLSA 1CEZA 2MEWA 1BCOA 1GLLO 3OFGA 2YX4A 3QEVA 3W2WA 5MAOA 3FNNA 4YY3K 3CJ3A 4KPCA 3UXNA 4Z4HA 4CJPA 1IG6A 1VIXA 1HNWK 1LAWA 2DF4B 2RRDA 1JLQB 1UP1A 4HI1A 3AVLA 4F4KA 5J0UA 4IDKA 3OYLA 1NAQA 3HTVA 3BSOA 1FCAA 2A40A 4WFZA 1DQ8A 1ZBLA 5J2PA 4IXCA 2QA4N 3T41A 4QAGA 1WNSA 2Q2RA 4R5PB 2DHAA 4QZFA 4KHSA 2VBZA 4MEXA 4OLOA 3BKFA 5IT9O 3HSZA 2KXHA 4P7VA 1U0SA 4TSXA 3I31A 1F6TA 4MHVA 3MOZA 1ILYA 4HAIA 3GFKB 3PFEA 3UXPA 2FIUA 4I6YA 2GOLA 2XQCA 4WE1B 2Z4PA 4XEIA 5DMRA 3DOMA 1V3SA 1LVHA 1RQNA 2M2BA 2ZNYA 3HKWA 3OXFA 4Y00A 5GAGP 4F3MA 2LEPA 2X51A 5EXWA 4O5EA 2JNJA 2HRUA 1L3KA 4K50A 2DCLA 5HBMA 1YIJN 1S6PB 3TW0A 2KVIA 2JC1A 3QE9Y 2YVSA 2DKOB 3NVMA 3CDBA 4FF2A 2G4BA 2HHWA 5AIAA 1KVAA 3AA8A 4CJ5A 1SQEA 2G8FA 5GAGU 4FZLA 1CI4A 2RJZA 3AV9A 1LKZA 4FVCA 2K8CB 2OI2A 3KUEA 4UQTA 1U1MA 5KT4A 2RUGA 3TFSA 2CJ9A 3QJPA 1JLFA 4BR4A 4MIAA 2EC0A 2ZHAA 4LR9A 2F77X 4DV7F 4KB7A 4J9VA 3HSTB 4JI2J 1XERA 2OPRA 1FFWB 3CCRN 4CJSA 5J2NA 4FZYA 3M1VA 1ZQVA 3MBYA 1KEJA 4ILGB 4KHPJ 5EWEA 4M2YA 2UU9J 3JYTA 4H4MA 4I2IA 4ZHRB 2W2OP 3UQ0A 4EBDA 2YI1A 4QYZK 4YG2A 2X1BA 1VSMA 3KLGB 5KG5A 4ZH4A 4JI5F 3MEGA 4F0HA 5B08A 1WDDA 3FFKB 2E1EA 1SV5B 4F4XA 4RNNA 1T9YA 4F5NA 4PXCA 7FD1A 4Q0BA 3TUJC 1NSPA 4RLEA 5HOOA 4DLGA 5HP1B 3G6ES 2DH8A 2V0NA 1KKXA 4GVBA 4YY3F 2XMWA 5GAHP 9ICMA 2KK0A 1ZQPA 2M8HA 1QQ7A 3Q86A 1KFSA 1HLWA 4GRSA 1EP4A 5KAIU 2J9DE 3EW9A 4WU2A 4KMOB 4B9SA 2IAJB 1A9NB 4PYAA 4ZPWR 2IS3A 1S72S 2QL9B 1NNDA 4X4QA 1KD1O 1XJWB 1H1VA 1Q82T 8ICJA 5KAKA 1RA6A 4BG8A 2E1MC 1PG5B 1L3VA 1C1BB 4LY7A 2VC1A 4ZN1A 1ICEB 4KFBA 1RQLA 2F96A 4LVSA 2WHOA 1IBLF 1S48A 1X31C 2G0JA 3MX2A 3JPSA 4DBQA 3QXGA 3F2DA 3DXMB 2HWIA 1VAZA 1DK3A 4AHCA 5KFIA 1OVQA 5F8JA 2V2QA 4FCYA 2HGNA 1Q78A 1ZPVA 1YZ7A 1RAOA 2QRRA 2JWKA 5T41A 1P1LA 3FZLA 5AKXA 4R66A 3CT9A 4ICLA 1YTUA 3WK4A 1B92A 4Y3CA 3DEEA 4FZVA 1CJKA 2W42A 3EZUA 1RP5A 4CF8A 1ZM2A 2ILZA 2WF7A 2JL9A 3G10A 2C3YA 4K4HA 2DR9A 2AXTU 2RAQA 4W5OA 4GVBB 5IT0A 3OPXA 3NXZA 4UBBA 3LP1B 3F5AA 3VR1A 3ZT2A 3U9DA 3KVGA 2QA2A 2P9PB 3BO3A 4P6QA 4ZK7M 3UCZP 3UDVA 2ZIVA 3W9HA 2W9CB 3H59A 4QPXA 3DDIA 4OMFG 2RN2A 3E66A 8ICSA 1UMJA 2KJ5A 5HHHA 3G0ZA 2G1HA 1Z25A 2KYZA 3JQKA 1H7WA 4O3SA 4CO0A 2HG4A 5J0RA 1S7HA 3VWSA 3AVMA 3NUQA 5KFCA 4WQ4A 4CD3A 2B4OA 3WBZA 3QWPA 1UJ5A 2MY8A 3UR3C 4QWCA 2J4RA 2CGLA 4DB3A 1HPMA 4AYBD 5HRPA 1HI0P 2JWNA 3DM2B 4IG3A 5BRFA 3VAFA 2ROEA 2AP1A 3QNMA 2QLFB 1KR4A 2FHOB 4R63A 2QW9A 2RS8A 2APOA 1YI2N 4BXOB 2RKIB 1FXLA 2XZTB 4RU2A 2VBYA 5KTQA 4UB5A 1JLGB 3CQYA 3BYPA 4TUSA 4E7JA 2FLNA 4W5RA 1HWLA 2H3VA 3J7YP 3L7UA 5ALTA 2H5JB 2BQUA 4ZLPA 4CZGA 1N61A 4RNHA 2B5JA 5CHIA 4TKTA 1BPXA 1VSEA 5IXUA 2YWFA 4CP5A 3DOLA 2HVHA 1KVBA 1LQ9A 2JVRA 3UIQA 5AE3A 1VQKS 3BEGB 1Q5VA 1GH8A 3DRSB 3P49B 5GTIU 3ZSZA 1LW0B 4LFAK 1J97A 4M5NA 1HI8A 3AB4B 2DPJA 3UM9A 4UOFA 4WPAA 2O4IA 2A41A 4H54A 3L8BA 3G8QA 2QMUB 4JI4K 3I5AA 2IVFB 3I4PA 3IFEA 5EY4A 1HEKA 1EWRA 1SH0A 2E1AA 3O6QA 4CH1A 3KLEA 3SDEA 3MUMP 4H0VB 1QDUB 5KG7A 3ISZA 4JV5J 4PKGA 4B6JA 3EWGA 2HURA 2AWZA 4DQQA 4N7TA 4Y2XA 1XR7A 2KQ2A 1RBLA 5K4LA 4JB3A 7ICJA 2BKEA 4DV0J 1BPZA 5K5MA 4IR1A 3CFRA 2F5GA 2XG8A 2ZM6K 4ZP6A 2F1HA 1UT8A 1IKXA 2XYGB 4CJTA 2GS8A 3NH0A 2ZQBA 4H0PA 4BRCA 1FKOA 1U6ZA 4C8ZA 4JKHA 4LF2A 4AF1A 2NLXA 1S0VA 3L5KA 3KKRA 4UW9A 4IKFA 2VIHA 2OPQB 1HBMA 2BA9A 1BA0A 2FYXA 3S3MA 3W66A 1WWUA 3ZTRA 4B3SJ 3ENQA 4OPJA 2YX8A 4PHPA 4CO5A 2XVTA 1PJ5A 4CJLA 2G8UA 1FFVA 1BIZA 4UB2A 3BSCA 4CIOA 1VSHA 2F1IA 4E8UA 4DSKA 3CXCR 2BDPA 3RZAA 2VQFJ 4UY8T 3D0PA 4PXEA 3T5JA 1YHQN 2MGZB 3G6XA 1S1UA 2ZFHA 2AQ4A 4FFDA 2DNRA 3I87A 4HKQA 4HCBA 1WN7A 3OJUA 5JVGQ 2E5HA 1HBUB 3BH7B 1XMBA 3DLJA 4WK1A 4LF8J 3UDEA 3KLFA 4A48A 2EFVA 2IMOA 1Q81O 2Y0SD 3R5BA 3KK7A 3T1YJ 3ILIA 4CK2A 4JAXA 2GUPA 2FDRA 2FSJA 2W40A 2YJEA 3ZSRA 7ICEA 1GXUA 3HSDA 2QMXA 2BQ3A 1RT3B 4RKUC 1TU0B 1H2VZ 3NRZA 2PXIA 5IT9Y 3F53A 5CHGA 1BQXA 2QLWA 2E5GA 4LRFA 3SBGA 1AW0A 3ILLA 4RQNA 2NRVA 2H48B 1FVQA 3WIVA 4LVNP 3TEHB 4O5FA 3KD1E 1HIYA 1ZPWX 2F8HA 2Q4TA 3IDWA 1NK4A 1C0UA 3DXSX 1KTVA 2WBRA 5H9EK 3M8QB 2YKQA 1IVZA 3ITHB 1FRMA 2D0PA 1JL1A 5KFOA 4HHHA 4KFBB 4RWTA 1HYVA 4QS9A 2DR6A 1WJ9A 2XYPB 3PIOQ 3OS0A 2E6LA 3C65A 1OW5A 4IR9A 4OLPA 2UXCF 1NK6A 1Y3JA 2E3TA 1UA0A 4FKYA 1N5QA 5CYQA 3AD7C 5ADXA 1XNRJ 5CA5A 4KLLA 3V9SA 2FC8A 4MLEA 4XDCA 3S41A 2FY8A 4OHVA 2E7WA 2G2OA 4DCJB 1J6ZA 4G1QB 1AFIA 3D6FB 4UUWA 1VI7A 3R1HA 4KITB 4B3OA 3SNNA 3CEDA 1B0TA 3QX7A 3GILA 4DKWA 1PBUA 1LEOA 4DR7J 4E1JA 1SC4B 1R3NA 2HF3A 2PFQA 3JPTA 1S9EB 3ONQA 4C98A 1PYOB 1V9OA 5KPRA 3AD9C 2FMSA 3H8JA 3U3GA 3GG1A 2HMIB 5IWAF 2ASJA 1EX8A 4NLXA 2XC9A 2EW9A 1HNZK 3LPTA 1N63A 1TUGB 7ICUA 4PGXA 2DO0A 5ALDA 2JZ5A 3AA9A 3PR5B 1D9DA 3IR6B 3WXKA 1NGJA 1WSEA 1FX4A 3ZDAA 1JN3A 1RT7B 3MCOA 4Z6CA 2HW3A 4QZGA 9ICEA 4EI2A 2YY6A 4EX6A 1K9MT 2O8DB 4DPTA 4YFKA 4ECSA 2YX1A 3AA2A 1LB2B 2Z2MA 2EBEA 3O8MA 2ODGA 3CWJA 4FK0A 2NSBA 3N01A 2P51A 4TVAB 1P9YA 2ZJAA 1FRIA 5CRXA 3HHLA 4PKHA 2OPPB 3TQ1A 4LFCJ 3PX6A 2FJAB 3SQ1A 2F40A 3DXKB 4CGJA 3Q2TC 2DGUA 2RSQA 3JXOA 3SQGA 3QERA 3Q7CA 3UKRB 2A1JA 3MMBB 3DRYA 4B1ZA 1IG8A 1LXJA 4E1NA 1OY8A 3SQ2A 4FPBA 3WEEA 4IDHA 7FDRA 4DX7A 5AM4A 4DR1F 2F3NA 3BR8A 1VGYA 2UXCJ 2BE2B 5F8LA 3B6PA 2MQLA 3CJRA 1W7WA 2EQYA 1HL6A 2J0XA 3O8WA 1T9UA 2QARA 4WIIA 1ZTWA 1KD1T 3FKBA 2EWHA 4JHDB 1B7FA 4I2GA 2FZGB 3IO1A 2W4CA 5CCLA 3DLKA 1L3SA 4IKAA 2UUCF 1HNXK 2AGQA 2KKPA 4GC6A 3NS5A 2FMQA 2E1FA 3AA3A 4G6VB 3V9UA 4DR5J 3NY0A 1QSSA 2KIWA 2HIQA 2W9CA 1B7YB 3ZZTA 2JEIA 2QYCA 5C25B 1CRXA 2WVFA 3VEWA 3MX5A 3NF9A 3K58A 3QFWA 4C1NK 4C0OC 3DLBA 5C15A 1IKXB 2W24A 4Q5VA 2NO5A 5HLFA 1FHTA 4YY3J 2C2OB 2CPJA 2J5AA 4AP9A 2ZJQQ 2V7ZA 1EARA 4FWSA 4DR7F 1S1VB 2MQPA 1KQSM 4CCHA 2QA4G 1VQSA 3PHEA 2EHGA 3IMXA 2EKYA 2FPHX 1G99A 3PW0A 1ZAWA 4JV2A 4KYZA 4RW6A 2VWBA 2HF4A 4FJ9A 2CPRA 3MGHA 3SDEB 4R0JA 2IYGA 4CT9A 1DBDA 1U1KA 1FVSA 3BO2A 2DGVA 3G6YA 4DL3A 3P8BB 4DL6A 5G0RB 4CEOA 2A42A 3QFHA 2GQCA 4FDFA 3LP2A 1OH5A 5D77A 2GH1A 4MFCA 1AROP 3GV8B 1S79A 2W3RA 3SUOA 3K57A 1OH7A 4IUFA 4Y2MA 3I32A 2DNLA 2QGFB 3S6EA 3GONA 3M6ZA 5A8WA 4DV4J 1NDLA 4DUYF 3CF5L 1TKDA 3QAUA 2AH5A 3A5NC 1KN5A 4TQSA 5ADXH 2AJ2A 2Q6BA 4X64J 3A5LC 2M3DA 7ICQA 4J5OA 3O44A 7ICGA 3PSIA 3OL9A 1X5SA 1ZOLA 2YKNB 2HVIA 2BE2A 2Z8QA 3Q8RB 4AXIA 3J7Z5 2KICA 3D1HA 1ZQIA 2R3VA 4I67A 1TAUA 3OHBA 1Y00A 4LH5A 3WQPA 4K8RA 2NUUG 4RW7B 1TL4A 2GVZB 5AQZA 1L7MA 2AQ0A 2BZFA 3LL3A 8AT1B 4OJHA 1X4HA 4GXIA 1BWVA 4YOEA 3N6LA 4N8OA 4C80A 4KH1B 1U1OA 3E9PA 1YVFA 3VCBA 4NCGA 1Y5NB 4YEAA 2N3LA 2DY9A 2UUAJ 4UUXA 1JLAA 4US8A 4JBCA 2KRBA 3NVZA 2ROPA 4OYIA 1FW6A 2AKWB 1HR0F 1QS4A 3NCIA 3D0IE 3B6OA 1KCFA 3FZBA 3PYFA 3EXYA 2B6GA 4OI6A 5AQWA 4OJ6A 2CRXA 2P9IB 3NTUA 1X42A 3KKFA 2LKZA 4WTOB 3S8SA 5J1EB 3SLCA 3CPWM 4ECXA 1SL1A 1J27A 2RILA 3PYGA 1HKCA 4FLYA 3KDNA 1S76D 3UQ2A 3FE1A 5LL6Z 4PHTX 2V68A 3TVKA 1RCOB 3MM7A 5K8NA 1URRA 3K0JA 1SKWA 2A1AA 3M6GA 2XMUA 1RT1B 1ZD5A 2DR7A 2V4JA 4FYYB 2PA8D 4C0HA 5ETPA 1RZTA 1U25A 3KJFB 5J8YA 4HTJA 1UPMB 1O5JA 2EFGA 4PGQA 2ZH6A 3CDEA 4DG1B 3G4SS 3HKZC 5AI4A 1F21A 1PJ7A 1UT5A 1WF1A 1QHTA 4DTMA 2Z58B 2HFUA 4KRFA 2MJNA 2V2ZA 4MFAA 1H38A 4CD1A 3B4MA 3I5CA 1OY6A 1MN9A 2CGKA 4MK7A 3CI5A 1LW2B 1S59A 3FQKA 3H5UA 4BRDA 1VJWA 3WKEA 1YJWS 5B5EU 2VIXA 4DL2A 3B8HA 5EGYA 5F8MA 3QJLA 2F4FA 5J2GA 4DTXA 2ZWPA 1N32J 1TUWA 1QQOA 1M1HA 4MF2A 4IJAA 4UB6U 3F56A 4FJNA 1TFYA 1TFWA 1HX1A 1AXQA 1UOCA 2IGIA 2B8PA 4OYWA 2WK4A 2LMRA 1X7VA 2ZJ8A 4PG7A 4NEYA 2GWKA 4QZHA 2YCHA 5AFUH 2VL1A 2NZ4A 2MZRA 1MMLA 2D3O1 2ZDPA 2EWSA 4DV0F 4HT7A 2DNQA 4OGEA 2VCPA 3B9JA 3V6KA 4ED1A 4KV8B 2FVPA 3C2LA 3OYNA 3NCRA 4BWMA 3RFAA 2OSQA 2H65B 4KKOA 1Q9YA 3OTBA 4M6WB 1EZZB 4DR3J 3AAQA 2W2PP 5ALKA 1PC5A 2OD6A 4OZ5A 1ZBHA 3B6BA 4IO9Q 1Q82O 4ES3A 3MWPA 2XI3A 5DLGA 2DNHA 4A47A 4YHHK 4UATA 4FS2A 1A0PA 3NGSA 2XLIA 2BUPA 2LU2A 3M05A 2YKMB 1RLCL 2XMTA 3J81O 2I1RA 2WONB 4DCPB 2GV1A 4OD0A 3I96A 3SMSA 3T7ZA 4CJVA 4Z7YA 2HVZA 2XMMA 1PYTA 2DVIA 3OYHA 2VOOA 4JYAJ 1WD6A 5L1LA 2VFSA 3MD1A 1T3QA 1F9FA 2COLA 4RO0A 3LM9A 3VA3A 5AZIB 5CYMB 2YQEA 4C1NI 2XZDB 3K4GA 1X3NA 3Q2SC 1CQMA 5EX5A 3A5MC 1ZZNA 4R65A 4KH5A 1X5PA 1S6QB 3EPIA 2FTRA 2ZUBA 2HZCA 1CC8A 2CPIA 3W3SA 4PZOA 4FJJA 3KIOA 1TL1B 3DOKA 2P9LB 3J81Y 1ZQEA 1Z00A 4JI4J 1ZQMA 2O1PA 2GTDA 3LDNA 3HXMA 5HBMB 2D41A 5CR0A 2FZCB 2HIYA 5ETOA 3LGMA 3VCDA 3A13A 1XR6A 3C19A 3ISND 4IOAL 3C14B 8ICHA 1Y64A 4FJLA 3OHAA 2Y1RI 1YZ6A 4K25A 5M2PA 4KLSA 1UCVA 2XI9A 1RDFA 3M7DA 4OV6A 3AQOA 2CJKA 4CLYA 3UVJB 3GBTA 1AZSA 3RBDA 4GXKA 4P10A 5CYQB 2VA2A 5CP2A 2YXLA 4H03B 4M9LA 4C0ZA 5KRSA 4BCAA 1KP6A 4DL4A 3LP2B 4JK8A 1SKRA 2Q6CA 3WK9A 4O44A 5FROA 1XS9D 1U49A 4QIVA 5KOWA 3ICLA 3R5JB 2XRIA 4K0KJ 2MDAA 3ZZZA 2LM1A 4LF1A 4X66K 2V34A 3QUCA 3AO5A 5BOLA 3QZ8A 3MMVA 1NK0A 3N9UC 4HVJA 3D2FB 5KFAA 3GDQA 2E5JA 3CPEA 2OZMA 4GO7X 4DCHA 4N56A 2CJXB 4CGIA 1EX4A 2JH3A 3I1YA 2YH1A 1IBMK 3QUTA 1CS4A 3FQLA 4ZKAA 1VQ6S 5KFNA 2H4WB 1U2VB 1NB2A 3M4XA 1RA7A 5GMKa 4ZVQB 3N7SC 3CO9A 2ASPA 1O13A 4CZFA 8ATCB 2G8WA 2QEXN 3MDFA 1C0TB 2BX6A 4C6AA 2NR0A 2PYLA 2XMVA 4HI2A 1YJ9N 2KHCA 2E5LK 1GAOA 1C6VA 1HLUA 1P7DA 4IG0B 1P9QC 9ICVA 4KE5A 3K5LA 2O8DA 5J2MB 2VBWA 4O3OA 3ENOA 3VF6A 2KFNA 4EGLA 4UBCA 5F9LA 3KKAC 2K8BB 2KKVA 3OS1A 4CJUA 2VZ9A 5J0OA 2B6AB 3V9WA 4KBIA 3MM5A 2VYPA 7ICFA 4LRBA 5F9NA 1RDWX 1REVA 5B66U 2V6AA 3GZ7A 2F63A 2GX8A 3AY0A 3VQTA 2IHR1 2OUGA 1J5OB 2CJYB 2NRHA 3NS6A 3J80Y 4ZJOA 1RGVA 2O67A 2X1GA 2CQ0A 1HWIA 2CZVC 3NH1A 4FXDA