4DS4A

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and rctp in presence of mn2+
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 201
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ds4A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ds4A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ds4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ds4A01
1S5JA 5DQGA 1REVA 3QEPA 1IKYA 3RH6A 1BQMA 4CK2A 3LWMA 7ICSA 4DTNA 2FPMA 2W9AA 8ICUA 2ETJA 4RPZA 4Z6CA 4M9HA 2LYHA 5J2DA 2X74A 3EY1A 1JLGA 1XSPA 3QINA 4CF2A 4MEYA 3K75D 4JK1A 4N47A 1HPZA 4PUOA 1BQNA 2J6TA 2NRZA 2QK9A 4KHNA 4QCLA 4JWMA 2WONA 3DMJA 3JPPA 2QXFA 4DMNA 4CEDA 5KFTA 1ZQCA 3DOLA 1GOCA 3OS0A 4DSKA 3AO5A 4ED7A 4KLLA 5KFZA 3OYBA 2ZJ8A 3C1YA 4CEAA 4I2CA 4LVSA 3OYFA 5KFYA 1S6QA 1TKTA 1HJPA 2FLPA 1S10A 1B9FA 3PR5B 3PX4A 1ASUA 4KPYA 4FW1A 4HYKA 2GV9A 3V1RA 5CP2A 4IR1A 4CF0A 1NK8A 5J0WA 2RPIA 5CA7A 3QZ8A 4Q44A 3OSNA 4CFCA 2C2RA 3Q8PB 5DB8A 3RTVA 2HHXA 3SPYA 1BVSA 4N5SA 1T7PA 5J2PA 3E2EA 4UB3A 3P1GA 4CEOA 5T7BA 5CB1A 4EYHB 4O4GA 3HWTA 3GV8B 3NE6A 7ICEA 3TR8A 3RB4A 3BQ1A 5J0SA 4ICLA 3AVKA 5J2NA 8ICWA 1TVAA 7ICMA 1LWEA 3S3MA 4FZYA 2XCPA 3CYMA 4EZ6A 4CHQA 5D4BA 1S9EA 4J9PA 2PI5A 4CJLA 3FDSA 4DSLA 5HMMA 1NKCA 4CJWA 3O3HA 1SKSA 4Z6DA 1QSYA 3ZSXA 3V7LA 3CQ8A 1T3NA 1LAWA 3AVMA 1QLNA 4JRQA 4CGGA 1XO1A 4I27A 1KVCA 4IFVA 9ICAA 2I9GA 5KRSA 3HPGA 5KFIA 1CXUA 3Q8LA 2F8TA 1C0TA 4RW8A 1TK8A 4AHCA 2R8GA 3THVA 4OGEA 2R8KA 1D8LA 4ECXA 3RJEA 9ICQA 4CK1A 3N97B 1LAVA 3NH1A 2OWOA 3HYFA 3BQ0A 4RQ5A 1VSKA 1XHZA 3CM5A 2ZE2A 3LDAA 3JPNA 1ZQJA 4FS2A 1SKRA 2G8FA 4RT3A 4FO6A 3NF8A 2XY8A 3DLKA 5K14A 1TL3A 4XIUA 2EHGA 1IKXA 2OPQA 1YTUA 4IQTA 3MR3A 2VWJA 3RMAA 1S1UA 4Y1DA 1TFRA 5KT4A 5KFDA 3L8BA 3OJUA 4BE2A 2JLEA 1KEJA 1X9WA 1C6VA 5CZ2A 1X1PA 8ICPA 1BI4B 2MUTA 3L2VA 4BACA 4KI4A 3SUNA 1T8EA 4N41A 3SCXA 4O3PA 2DFHA 1HYVA 1QTMA 2C2EA 4IDKA 4CHZA 5J2IA 4J9LA 3EPGA 4KLOA 4BDZA 3EWAA 4FBUA 3RJGA 3TAMA 3AO2A 4B8CA 2EX3A 2G8UA 2R8JA 4KLTA 1BGXT 5DLFA 4ECSA 3VQ7A 2ZTCA 5L9XA 1ZETA 5DGAA 4BWMA 1IG9A 3KHRA 3OS1A 3V6DA 4QOZB 1S0OA 4Z4EA 2Q3SA 3AVJA 1S0NA 5L1KA 2HW3A 3Q8RB 4M0AA 1WCNA 4GLXA 3CM6A 2YHAA 5D3GA 4FCYA 8ICMA 3VA0A 5IIJA 4O3NA 4KHUA 3M9NB 1IXRA 4NYNA 1XHXA 3TFSA 4RT2A 4DQQA 3AVAA 3VQ4A 2YNHA 3OYAA 4CIFA 4FVMA 4CJ5A 4KTQA 4QW8A 4DSFA 9ICWA 3OHAA 3HXMA 3PV8A 4M9JA 1Z3EB 2W9BA 4O0JA 3H4BA 3RJJA 4CGHA 1HNIA 1WSHA 1BHLA 3HK2A 4DF4A 1BI4A 1BL3A 1A5XA 1HRHA 3JPQA 1UAXA 1EKEA 3OYKA 4DOCA 2UVRA 1S1XA 2F1HA 4DSEA 3SYZA 7ICNA 1BPYA 4DQRA 2JEFA 4OKEA 3KK1A 1WSEA 1KLMA 1RBSA 4RQ7A 5KT3A 4CJSA 8ICSA 3LZIA 3LP3A 2J6UA 1RBRA 4LZGA 4YXJA 4AHSA 4RPXA 3T1AA 1JXLA 1RDAA 2OZMA 2D0CA 3SNNA 3IHQB 2D0BA 1N5YA 1RBUA 2YNGA 1ZBIA 2Q0ZX 4R5PA 3ZD8A 3NF9A 1GOAA 4DL3A 2OA8A 5J0PA 3HSTB 3SV3A 4DQSA 3TANA 4E3SA 3NGZA 9ICLA 1X9MA 1TVRA 4M41A 2D5RA 1IM4A 3O4NA 2GBZA 3K5NA 4WE1A 3BQ2A 2OPPA 4B9UA 3V9XA 5KG1A 1D5AA 3H7IA 5DKWA 3MDAA 3T19A 1FKPA 9ICXA 3TAGA 3C95A 4C8LA 4CIEA 2O4GA 1ZQQA 4ED0A 4E0DA 8ICYA 4KLJA 5KG6A 1ZQSA 4Z0UA 1ZQNA 3KD1E 2KW4A 4QZBA 4DL6A 3MECA 3AU6A 1SKWA 4Z6FA 1Y97A 3AVFA 4RW4A 4RW7A 3NGYA 4UAYA 1KVAA 1NK4A 1L3UA 3IRXA 1TAQA 4O55A 1U9LA 4CJUA 1ZYQA 2X78A 4OPJA 4I2FA 2BCRA 7ICJA 1RT2A 1UA0A 3S3OA 5DMRA 2HHWA 5D49A 4MEXA 1Z25A 5KT2A 3BDPA 3DOKA 4ED6A 5KG7A 4DU4A 4RUCA 3RR8A 3L2QA 4UB5A 4DL5A 2D0AA 1RT7A 4R63A 1UOCA 5KFWA 3JYTA 1KFDA 4KLEA 4DEZA 4FJXA 1RDDA 3L2WA 3M8RA 5J29A 5J2KA 4IQUA 1WLJA 1CZBA 5J2HA 3M9OB 3ETLA 3ZT1A 5CWRA 1C1CA 3AVLA 4W5TA 3OYLA 3DLRA 1VSIA 8ICRA 4J2AA 1I3AA 3OSPA 5F9LA 4CIGA 4IKFA 3KHGA 3OYIA 1RTHA 1W9HA 3P83D 2FPLA 4IQWA 3AU2A 3P5JA 4IBNA 2W9CB 1JKHA 4I2DA 3VQ8A 4F3OA 4CHNA 1D9DA 4LH4A 3QE9Y 2BKEA 4QWDA 1B22A 1YTAA 3QEIA 4KTWA 3AO4A 3AV9A 1ZQBA 4QZEA 4UBCA 4OVLA 4M3ZA 4PGXA 3L3VA 4PHPA 2ISOA 4KHQA 5HROA 3ZSYA 3LP2A 4DL2A 2RDIA 5J2QA 2M9NA 4BE1A 3H4DA 4DS5A 8ICFA 1RNHA 3NCIA 1KCFA 5DG9A 2XGPA 5JUMA 4EP5A 1T03A 4ECRA 1S1TA 3K58A 4KKOA 4CJPA 3LDSA 4DS4A 4YNQA 5FRMA 5KG0A 3VQDA 4IG0A 4O3OA 4FLUA 3OYJA 5CR0A 3QERA 3BQTA 3IG1A 1TV6A 5C24A 1FXXA 1MQ3A 4PGQA 4RQ4A 4W5NA 3K57A 4DTSA 3ZT2A 4I9LA 2DFLA 3HJFA 5KTQA 1DOQA 2X6NA 1RCHA 4CFBA 3HPHA 4E7HA 4DSJA 4I2AA 4YMMA 4I7FA 3M9MB 3RJHA 4FM0A 1S9FA 5BOLA 3GILA 4QWCA 4UB4A 3A2FA 5J0TA 3V6HA 1BISA 5IILA 4QAGA 4PHDA 5DG8A 5DG7A 3HPOA 2BCVA 2YNIA 3KLFA 3QEVA 2R8HA 2ZJAA 2XY5A 3GIIA 4F5PA 2HHVA 3LP1A 4P4OA 4YVZA 4RPYA 4GXJA 2NRXA 2OZSA 3C94A 1RYSA 2DPIA 2ZUBA 3NGIA 4I2BA 2PY5A 1ZQTA 4JRPA 5CYMA 2BHNA 3KLHA 2DFEA 3U3GA 2Y1IA 3AUOA 1JLQA 5HRSA 3UXPA 2PFQA 4DTPA 5C5JA 5J2MA 4KLMA 4CFDA 4CF9A 2X6SA 1ZQPA 3C2MA 3DLGA 3PY8A 1JLCA 1QS4A 3K2PA 5DGBA 2ISPA 1JXBA 4RNOA 3VQ9A 1S9GA 3AO3A 4ID5A 5J1EA 4NLNA 2BCQA 2KN7A 4KLUA 3JPSA 3D0PA 3TQ1A 1XI1A 1UT8A 1ASVA 2HNDA 2ZUDA 3T5LA 3V6JA 4Z4CA 5KI6A 4DTMA 4YG2A 3EW9A 3GV5B 4F5QA 3K59A 1CLQA 5I3UA 4RW9A 3MEEA 3NFAA 3B0YA 2KTQA 1JLAA 2IBKA 7ICIA 1BIZA 4RNMA 4YMOA 4ED1A 2FC0A 4M9GA 4HUFA 3MXMA 2KFZA 1SL2A 2W9BB 1F21A 5EWFA 1ZQWA 5KFPA 1JXEA 1U49A 3GIKA 1ZQYA 4YXMA 3JPTA 4GMJB 2HHSA 2VG7A 3V4IA 3AVIA 4MFAA 3ASMA 9ICSA 1ASWA 2JZBB 3ZSRA 2ZTEA 4F91B 4R66A 8ICEA 1NKBA 4XA5A 3LALA 4CK3A 3L2RA 7ICQA 4DU3A 3SUOA 3ZCMA 3JSMA 2ITGA 2PYJA 5KT5A 4TUPA 2P6UA 4EEYA 4J9NA 3DI6A 3DRRA 2FLNA 1WCLA 3RJIA 4NM1A 3I0RA 1S1WA 4O0IA 3F73A 1A5WA 1ZQHA 3MEDA 5HLFA 2LSNA 4CJEA 2BPGA 4FJNA 3C5GA 2C22A 4RQ3A 1B92A 3U3YA 4F4ZA 2YV0X 4J2DA 1TKXA 3G0ZA 4GC6A 4YFUA 4MQ3A 9ICIA 3OYDA 5J0OA 1A76A 3AVCA 4GVMA 5C42A 2ATQA 1V9PA 2J6SA 1HQEA 3SI6A 3DM2A 3DYAA 4CFAA 4ZH4A 1ZQGA 3MAQA 3ISDA 5D46A 1HUOA 3L2UA 2ZTDA 3KIOA 4FLWA 1VSMA 3RAQA 3RH5A 3C21A 1LB2B 4OLBA 9ICTA 5KGXA 4JS4A 5DB6A 8ICQA 4E7JA 1GOBA 3MEGA 3PVXA 4TSXA 1RXVA 2PZSA 4JS5A 1RTJA 1HUZA 2YNFA 3I0SA 4M45A 8ICBA 5CJ7A 1VSFA 3ALYA 1Y88A 4O3RA 3PW0A 4RQ2A 1J9AA 2QKKA 4RQ1A 2BANA 7ICOA 4K8ZA 2IHMA 4Q0BA 1B9DA 3ITHA 3SUPA 2IA6A 4B8AB 1MU2A 5HHHA 4O5KA 8ICAA 2JEIA 3F9KA 4QW9A 2WTFA 3NDKA 3NTUA 3MXJA 4QZDA 2KQ2A 4QZHA 3RMCA 1NJYA 5BOMA 1MQ2A 3AVGA 5EU7A 1K1SA 4BWJA 3VQEA 4CJTA 4YR2A 4O5CA 4J2BA 2HNZA 3QNOA 4CEQA 4P4MA 2IS3A 5E41A 4FW2A 4KREA 3QIPA 4LSNA 3RMDA 4HUGA 4J9QA 2R7YA 8ICGA 1JIHA 9ICRA 5KFKA 5CY4A 3RBDA 1FK9A 3ZT0A 2YHBA 3TAPA 3EPIA 2XY7A 3LK9A 3H08A 2FBTA 4DG1A 3KHLA 3RJKA 5J2EA 1RZTA 5HMLA 2ZUCA 1WSIA 3JPRA 3T5KA 3B6PA 4DOAA 1KTQA 4E1MA 4KLFA 4CCHA 4QZFA 5KFCA 4FLYA 4AILC 4MFFA 1VK0A 2W9CA 3OGUA 4M04A 1K1QA 3PNCA 1RTIA 4J9MA 4UAZA 2HHQA 3LANA 2HB5A 4AHUA 2QKBA 1RBVA 3S3NA 2AQ4A 4KN4A 4KITB 4NLGA 4BXOB 1U45A 3ZDDA 1ZQXA 2HHTA 3DRSA 1I39A 3V81A 4AHTA 2NUBA 4PPXA 5DLGA 2Z1IA 2V4QA 3H8WA 1ZBUA 4FJ7A 7ICRA 2BQUA 4LZDA 8ICJA 3S9HA 9ICHA 4JUZA 4M6WA 4KO0A 3N4MB 3PMNA 1UA1A 2NRVA 3MDCA 4C8KA 5KG3A 3PMLA 2DTUA 5KG5A 4KV8A 4DTRA 7ICFA 1FKOA 3HW8A 4JLHA 2UVVA 4Q8EA 4CJKA 3KD5E 2G8WA 4DFMA 3NHGA 4DTJA 1TKDA 2I5JA 2DPJA 3ZDBA 4EP4A 5FDLA 3QETA 1HQUA 1X9SA 4KMUA 5DQHA 5L1JA 3HO1A 2O4IA 4EBCA 3MFHA 4NCBA 4BDPA 4YP3A 3UXNA 1T05A 4R8UA 1ZQMA 3OJSA 1RTDA 3GIMA 4FLZA 4CJVA 2F8SA 4K8XA 4NCGA 4DSIA 1SL0A 3RBEA 4RUAA 2I1QA 4FLXA 2HVHA 2W8KA 4I2PA 1KSPA 1HJRA 3C2KA 4J9KA 2PFNA 4QZ9A 1TGOA 3FFIA 3TAFA 2F1IA 2RKIA 5J2JA 4E1NA 3HVTA 1D9FA 2AGOA 2ZD1A 1RBTA 4AHVA 4EBEA 3NF7A 9ICUA 2BCSA 3C6TA 8ICLA 4F4YA 1JLFA 4KN7A 3QZ7A 4KAZA 4DTOA 2F1JA 5HRNA 4DLGA 1RYRA 3M8PA 4YD2A 4W5QA 2P66A 3TAEA 5KFLA 3PR4A 5DB7A 2C28A 4M3TA 2AU0A 4ZTFA 4NLKA 3PX0A 4ECQA 4O3SA 8ICNA 2YKMA 4CEZA 1QSSA 1WAJA 3ZSVA 3ZSOA 3PO5A 3H40A 1EP4A 4PH5A 1NK6A 3QLHA 1ZQVA 2PFPA 4RZRA 3M8SA 1WAFA 1NK5A 1NK0A 4M42A 4FYDA 5KT7A 4Z4IA 3TAQA 3K5OA 3H8SA 2UVWA 1BPEA 1TAUA 2IOCA 2KZZA 2BPCA 1ZQIA 5JS1A 3BJYA 5DDYA 4TUSA 5J0QA 3AVNA 3VQQA 2KFNA 2G8KA 1VSJA 3K5MA 4O44A 3K4GA 2B5JA 4K4IA 2Z1GA 4W5OA 4M6WB 1XC9A 4Q43A 5KFBA 3DRPA 5J0RA 3DLEA 3UQ0A 3LAKA 3SV4A 2XY6A 4FM1A 2C2DA 4M3WA 4QZGA 1NJXA 3L3UA 4RQ0A 2RN2A 1RT5A 8ICVA 3MGHA 4QZAA 4J9OA 1TL1A 3LWLA 3V9SA 3ORYA 3KLIA 1KFSA 1LWCA 2E6MA 4B9NA 4KHWA 4KRFA 4E7KA 3MBYA 3KJVA 1KRPA 2KZMA 4ED3A 3C23A 4I2JA 1LWFA 5DB9A 2H5XA 4CGJA 4E89A 4FM2A 8ICTA 4NY8A 3AO1A 4DFPA 4CGIA 2W9MA 3ULDA 3KK2A 4ED2A 4F2SA 1XSLA 3KKRA 4KLHA 3CFRA 4IRKA 4JV0A 3HT3A 1S6PA 5J0YA 1RXWA 5IINA 4EZ9A 1S97A 4KFBA 9ICGA 3TABA 3VQ5A 3O3GA 1WSGA 5HHIA 4E19A 4L8RB 4OLAA 5KFNA 5FROA 1A77A 2P5OA 4B08A 2JZBA 4PHAA 3T5JA 3HP9A 4Z4FA 5J0UA 3G6XA 1CZ9A 1ZQKA 4AH9A 9ICBA 2PYLA 3PUFA 1KLNA 4FZZA 9ICKA 3MR5A 5F9NA 4DFJA 3KTQA 3SI8A 3EZ5A 3QEBZ 3AA5X 3NBPA 1BPDA 4B9MA 1MSWD 3QO9A 3NH2A 3E01A 3V1OA 7ICPA 1HMVA 4M3YA 1ZQFA 5HP4A 4FLTA 3QIOA 4CJ4A 4BE0A 4QZCA 7ICGA 2V4RA 2JGUA 5C25A 4RW6A 1MC8A 5DDMA 2E6LA 4LSLA 1AROP 1T4GA 4CHYA 4FJMA 9ICEA 1K6YA 3RRHA 4UAWA 2XC9A 4F50A 7ICTA 2BPFA 4YFKA 4CGFA 1RPLA 4F4WA 3V1QA 2AJQA 4FJJA 3ZDCA 5KFEA 4NLZA 4YN4A 3U6FA 3UXOA 5IIMA 4XRHA 4OKKA 5KFVA 4P4PA 4Q8FA 3LZJA 1SZPA 5J2BA 5KGWA 3DLBA 4EBDA 2A1JB 4YR3A 4JV2A 5KT6A 1ZQOA 3Q8SB 4OJRA 4GC7A 3B0XA 4GXKA 3PX6A 1LV5A 5EWGA 5KFQA 5KFMA 5CZ1A 5JS2A 5EWEA 1L3TA 4PA1A 1ZBLA 4F2RA 4DL7A 5HNKA 4FBTA 4IFYA 4M9LA 1JL1A 3IAYA 3TARA 4JV1A 4BDYA 3CFOA 4H8KA 3LAMA 4FJGA 1C0MA 1NOMA 2OYQA 2HMIA 4F5OA 4CESA 2VG6A 4DFKA 3OHBA 3HX0A 3UPQA 3IM1A 8ICXA 4QWBA 5DK5A 3G10A 1BCMA 2BR0A 3FYHA 1A5VA 3ISCA 3M8QA 4I9QA 1O1WA 1U04A 1N48A 5HP1A 4UB1A 4TQRA 4RNNA 1JLBA 4F3TA 3O4QA 3SQ2A 2A1RA 4CEBA 4CHOA 4F8RA 4B9LA 2FMPA 1IO2A 4M3RA 4YCXA 3C5FA 4J2EA 3T5HA 4FJ5A 3OYNA 2OPRA 4QZIA 1TV9A 3SJJA 1EETA 4GW6A 3IS9A 2NRWA 2JEGA 1VSLA 9ICPA 2DFFA 7ICLA 4Z4HA 2MAXA 4I2IA 4CF1A 1NJZA 4YMNA 3GIJA 3SUQA 5CYQA 1BPBA 1HYSA 3G6VA 5J2FA 4F92B 4O3QA 4DWIA 4H4MA 3KK3A 3WNEA 1BCOA 3CFPA 3MR2A 1Q9XA 3CG7A 4IQVA 4R8UB 4DF8A 4DL4A 2VA2A 3LPUA 1YT3A 4OPKA 1RT1A 4F5NA 4RQ8A 3PO4A 4FJLA 2Y1JA 1VRUA 2ASJA 3RB0A 1W0HA 2IGIA 1SUQA 1L5UA 2NRTA 4ID1A 3G6YA 4FJ8A 4DTUA 1EX4A 1RILA 4NM2A 4CEFA 3AVBA 3ZT3A 4PGYA 4N56A 3WNGA 2RDJA 1ZBHA 2HNYA 2JEJA 5J2CA 1TKZA 4RQ6A 8ICZA 1SL1A 5SWMA 4RU9A 5IIOA 1QE1A 2FPKA 4O9MA 1Z26A 3SZ2A 3OYGA 5IIKA 3EYZA 1HYZA 2AGQA 3V7KA 1J5OA 3GV7B 1QQCA 4FJ9A 2ZQBA 3C2LA 3VN5A 2KZ3A 4P2HA 4ELUA 4N76A 3RH4A 5HRRA 2IC3A 3GDXA 2PFOA 1TK5A 3V9ZA 3Q8MA 2B4JA 2W8LA 2R8IA 4ECUA 3T3FA 1JN3A 1UT5A 3C6UA 3NH0A 8ICKA 4G1QA 1Q9YA 2FMSA 4B9SA 4K4GA 4IG3A 3HVRA 4DTXA 3O3FA 4Q45A 4IR9A 5J2GA 1Z00B 1RT6A 1ZQAA 4C8OA 1VSHA 4CE9A 3V6KA 1S0VA 2ATLA 1CUKA 4I2GA 5DBAA 5TZVA 1KFTA 4CGDA 4FZXC 2VA8A 3OYCA 5KFGA 4F4KA 2FBVA 2FMQA 3BGRA 4DO9A 1ZJMA 1ZQLA 1U47A 3RJFA 2P5GA 5CHGA 1JX4A 5DBBA 1S77D 4KLQA 4FJHA 1DTQA 2OPSA 3VQCA 3I8DA 1WNSA 1NOYA 4X5VA 1RT3A 1WSJA 3OS2A 4KLDA 1IH7A 4CERA 4J9RA 3QESA 2XHBA 3TI0A 3K5LA 4MFBA 1XS9D 2VANA 1NK9A 4O5EA 5KFAA 4CECA 1XWLA 5KRTA 4PWDA 4UB2A 4KLSA 1DGSA 3KLEA 4HTUA 4ECVA 9ICOA 4RG8A 4CJQA 1TK0A 5FRNA 3RAXA 5KFUA 5KG2A 3MABA 3KLGA 1U48A 3OVNA 3SQ4A 5KFHA 3NGDA 1EXNA 3QEAZ 2BDPA 3RMBA 3UIQA 2P51A 4W5RA 1J54A 1UWBA 4BGDA 3PW2A 4HUEA 5J2AA 4FJKA 3GQCA 4EYIB 3LP0A 4PHEA 3ZDAA 5J0XA 3DLHA 3MXIA 1JMSA 1S1VA 3V72A 2IAJA 2B21A 3D45A 3MGIA 2Z1HA 4B9TA 1COOA 4G3IA 3TWHA 2BQ3A 2XRIA 1S0MA 4E7IA 1C1BA 2A1JA 2HVIA 1PZNA 1WN7A 3LPTA 1RDCA 2XO7A 1U4BA 7ICUA 4HVJA 4E7LA 1WSFA 1C1AA 2YKNA 2B6AA 4I29A 3ISBA 4QZ8A 4OGCA 5KFRA 4ZTJA 5EOZA 5KFXA 4R65A 1VSDA 3H8JA 1YVUA 3AVHA 4ECTA 2AQ0A 3ZDEA 4J9SA 3PW5A 4B9VA 4CJ3A 5HRPA 5KFJA 4KLGA 2Z1JA 1ZQUA 4HCBA 4H4OA 2BE2A 2ASLA 2FLLA 3RRGA 2XCAA 3PW4A 4YD1A 3TFRA 5KG4A 1IKVA 3SQ1A 3OYHA 4Q5VA 4F4XA 1VSEA 4KB1A 4UBBA 3WNHA 1LW0A 4CHPA 3VQAA 4NXZA 9ICJA 1KDHA 3UQ2A 4FLVA 4FJIA 2V9WA 3AA3A 4ECYA 4OKJA 2ZJ5A 1CEZA 5DQIA 3RR7A 1S76D 4C8MA 5I42A 1JL2A 1J53A 4UQGA 3VQPA 2P6RA 1X2IA 2BGGA 4ECWA 3V9UA 4ED8A 3ZSWA 4KLIA 4NYFA 3NAEA 3HP6A 1IKWA 2E4LA 1ZQRA 1SV5A 4MF2A 2FBYA 5KFOA 3SQ0A 1VRTA 3OYMA 4F93B 3PW7A 4F5RA 5BPCA 4M47A 3QEWA 4ZHRA 3QNNA 2UVUA 1BIUA 1BPXA 5HBMA 4LD0A 1D8YA 1QHTA 3OYEA 2RF2A 3OY9A 3V9WA 4KTZA 4ECZA 3RWUA 9ICMA 4ELTA 7ICKA 4DLEA 1ZBFA 1ZQDA 4Z4GA 1DTTA 4M2YA 1N6QA 1HNVA 4GXIA 4FXDA 1QSLA 5L1IA 1ITGA 4CEEA 3JPOA 4AHRA 4FK4A 7ICHA 1Z00A 1LW2A 4DOBA 3WNFA 2G8HA 1ZQEA 5KFSA 3Q8KA 2VG5A 3Q8QB 4KHSA 3C1ZA 4KHYA 1RT4A 1L3SA 8ICOA 2HHUA 3AA4A 4PQUA 3VQ6A 2WOMA 4QWAA 4BXOA 2IMWP 9ICNA 1EXQA 5KFFA 8ICHA 4O5BA 3V7JA 3RB3A 2GWSA 1NK7A 1XU4A 3ZSQA 4NCAA 2BCUA 1BPZA 3HM9A 2IHNA 4KI6A 4TUQA 4I28A 1G15A 4CJFA 4C8NA 3MFIA 8ICCA 4M3XA 4I2QA 3GFKB 9ICFA 1KVBA 3VQBA 9ICCA 4I2EA 1C0UA 2BQRA 4TQSA 3VA3A 2GUIA 3KKSA 3HL8A 3AA2A 7ICVA 1DLOA 3KHHA 2VWKA 5SZTA 4YQWA 3ISNC 3ZD9A 1L3VA 1NOZA 3NF6A 4FK0A 1NJWA 2AGPA 1C7YA 4YR0A 4CF8A 2W42A 4FS1A 4MFCA 1B43A 3ZT4A 1ZQZA 2MUTB 8ICIA 4B3OA 4TURA 1ZJNA 4XUSA 2FBXA 4DU1A 4M3UA 3RB6A 2VA3A 1RDBA 4XQ8A 2ALZA 2G8IA 4IRCA 1R0AA 2G8VA 4DQIA 4JWNA 4FK2A 3MR6A 4M9NA 4IRDA 4CJRA 2PXIA 9ICVA 1XSNA 4HHTA 3B6OA 4PY5A 4DQPA 2F96A 3ZSZA 2BGWA 2DY4A 2ASDA 4ELVA 2A1SA 4R64A 5DBCA 3QEXA 4HCCA 4KB0A 2IDOA 4LY7A 1CXQA 4K4HA 4MF8A 2PI4A 4LH5A 1NKEA 5L1LA 1Q8IA 4QWEA 4I2HA 4Y1CA 3SPZA 1N56A 1JLEA 1H38A 5IIIA 2XGQA 4Z6EA 2P1JA
chains in the Genus database with same CATH superfamily
1H74A 2YH0A 1IKYA 1BQMA 3QU4A 3LWMA 7ICSA 2X1GA 2NLWA 3MOJB 4RPZA 2MZSA 2LYHA 3M8ZA 1T9WA 1RB0A 3C16B 4EWTA 3DCAA 3UCGA 3LDOA 1RT3B 1WDTA 2VDIA 3VR1A 4CLWA 3ZX2A 2NRZA 2DUYA 1NXIA 2KVSA 5AE1A 2DNQA 5GADU 1GLEG 4DMNA 4CEDA 3D1QA 5KFTA 3CC7S 3ISZA 1ZQCA 4X4PA 1DRZA 4WYLA 2LYAA 3S8SA 5HL7Q 4KLLA 4JMUA 1NDPA 4CEAA 5J2NB 4I2CA 1CJVA 3OLAA 4B1UB 5KFYA 2BJ1A 3O5BA 2V34A 3UCUP 3J80O 1RKJA 1S6QA 4YDUA 4RWTA 2FLPA 1B9FA 1TTHB 1J5EK 1ASUA 4P73A 1J5EF 4HYKA 1RQ0A 3Q22A 4QPTA 4ACOA 1NK8A 5C12A 1WTBA 2RPIA 5CA7A 4JI7J 1X4FA 4Q44A 2C2RA 3MGJA 2MZJA 3OXFA 2DYAA 4G6VB 2HHXA 4N5SA 3EN9A 1T7PA 1RACB 2ACMA 2VJ5A 2HFOA 2VF3A 5J2PA 4K0KF 5ADXH 1VQ9S 2F8MA 2KVCA 4CEOA 3P96A 4EYHB 2I7PA 7ICEA 4F02A 1OH7A 2ASOA 5IM0B 2R7SA 1WWUA 1SB6A 1ZRNA 1LWEA 4FZYA 3CPEA 1EWRA 3OR1A 1WBDA 5ETPA 2PI5A 6FDRA 3BO3A 2X1FA 3FDSA 3TUJC 3EVMA 2HBQB 5CEHA 5HMMA 4ZHRB 1S72S 1R27B 2ACYA 1SJQA 1LOTB 4Z6DA 1JQGA 3ZSXA 1FXDA 3NP5A 3V7LA 1T3NA 3AVMA 4NI2A 1PK1B 4N8NA 1QLNA 3QWPA 3HHLA 2PA3A 3LF0A 1UZDA 3UPFA 4JRQA 5DJBA 1DQ9A 3OT9A 1RBOB 1KVCA 1U2RA 4CZJA 4PXBA 2CGJA 1CXUA 4B3SK 2F8TA 2OPSB 5KPZA 5AQMA 4JI4J 4EX7A 3AQEA 5AR0A 3THVA 2QGFB 2YQEA 2FIUA 3A1YG 2R8KA 4CK1A 5A2QY 3NH1A 4MHVA 3O44A 5D4NA 3CM5A 3JPNA 4DR5J 3J7ZO 4NCGB 3T6JA 5T14A 3VENA 2XIDA 3THYB 3A8KA 2QYCA 4XIUA 3WUHA 1R31A 1N5VA 1O08A 2GHVC 2OPQA 3Q8YA 2VWJA 2DISA 4CLZA 3RMAA 4ZJQA 2KHVA 1TFRA 2F9DA 2OD4A 5KT4A 3ZZUA 3E9OA 3VEWA 4K4WA 3OJUA 3CCVS 8ICPA 1X1PA 2ZH6A 1H1VA 3OD2A 3SUNA 3MI7X 1T8EA 4N41A 3C15A 1YRTA 1HYVA 4IDKA 4CHZA 5J1NA 4NL9A 4J9LA 2LP4A 4ZIVA 1JB0C 4TN2A 5HO4A 2XULA 3EPGA 3EWAA 1N5QA 3TUZC 4P0PB 4J91A 4KLTA 1BGXT 5DLFA 2K4EA 3LOUA 2WC9A 1K9MT 3PM9A 4B3MJ 4KH4A 4DR2J 4NV0A 3AVJA 1S0NA 2GGPA 2HW3A 1WEXA 1URRA 4M0AA 4I7FB 4PZVA 4OI2A 1WCNA 4DV6K 2KKPA 5SUHA 5D3GA 4Y2JA 4KIAA 4TNOA 2K8AA 5IIJA 4NYNA 1XHXA 3W66A 2UP1A 1JMTA 1YITS 1N34J 4FVMA 4KTQA 2OPQB 9ICWA 2QI2A 2W9BA 3BS5A 2HOEA 4URGA 2I9SA 3LGNA 3N6NA 4PG8A 2WBMA 3CDWA 3ZFVA 1HI1A 4P75A 4LF8F 5FPNA 3UKUA 1HRHA 3PSTA 1WHXA 5GAGP 4Z7YA 1EKEA 3OYKA 2UVRA 2HOFA 5ALKA 7ICNA 1WOOA 1BPYA 5AQQA 4LF7F 3B6BA 3BKTA 1KLMA 1V5IB 1RBSA 1NZBA 1EHWA 1WC4A 4RW8B 8ICSA 3EGNA 3OFFA 4V19J 4YXJA 5EE3A 4AHSA 2QG9B 4DV3K 1RHJB 1FFUA 3QU9A 4KC5A 2D0BA 1RBUA 2IVYA 2VUGA 4R5PA 5AM2A 1X5OA 4IC9A 3TANA 4WK3A 1X4GA 2RKIB 9ICLA 1MN7A 1IM4A 3WX4A 2EFPA 3K5NA 2MZRA 2VODA 3BQ2A 3CJAA 3I0SB 1U24A 3D4JA 4JI7K 2RMLA 5CAAA 4KY3A 4FF3A 2JMGA 4Y3CA 1URJA 2ZHOA 3M8WA 3T79A 4K2XA 3CCSN 4BC4A 5BYQA 3TAGA 3VETA 4QIWC 1QVGR 2E1YA 2QL5B 5HP1B 2O4GA 1LW0B 2HQGA 2M8DB 3O9RA 1SC4B 1ZQSA 1B64A 3KD1E 3ZTPA 1KVJA 3DLEB 1M5HA 3GLJA 4RW7A 1GXUA 1KVAA 2F40A 2GCFA 3K89A 2GNKA 4CD1A 4CNZA 1ZYQA 4CJUA 1WYGA 2MKKA 4AL6A 4OPJA 4I2FA 1RT2A 4FSVA 4G1IA 3W2VA 5D0GA 3SSRA 4EGLA 2Q43A 3ULEB 2WAQF 3L2QA 4UB5A 1VLBA 4DL5A 1AUDA 2G0IA 2D0AA 3NASA 3ILLA 1UW9A 4GVEA 5KFWA 4JEPA 1KFDA 1GTHA 3NS1A 4NLSA 4OLPA 4IQUA 5HLFB 5BPNA 1M90O 1FKPB 3OYLA 1RT4B 2OAUA 4J2AA 2VG5B 3I87A 4DR7F 4A48A 4BUGA 1XNQJ 2FJEB 2CWKA 1MN9A 4FO0A 3VQ8A 4F3OA 4J9UE 4CHNA 2CA9A 2NR0A 4LH4A 3KK7A 3CCJN 4C4RA 1VK8A 3QE9Y 1O51A 2BKEA 2SXLA 4QWDA 4ETXA 1KONA 3QEIA 2O66A 3UWTA 4NXMJ 2F1FA 3L4QA 2B4UA 2Q97A 4OL8A 2LQ9A 4I1TA 3L3VA 2A3ZA 2MY7A 5ALIA 1S1XB 5HROA 2RDIA 2W2NP 3H4DA 4ILJA 8ICFA 2ZZTA 4JI1K 3RGIA 5DG9A 2F63A 3PSFA 5JUMA 2ZUGA 1S1TA 3PEHA 1M1GA 4KKOA 1KVIA 3LDSA 4C48A 4WK1A 1I94K 4DS4A 4YNQA 1Z1VA 3AARA 3MXHP 2K7JA 2HMPA 4IG0A 4U8VA 4OI0A 2AWZA 4V1Ak 4ANCA 3QERA 1TV6A 4KQZA 2IVOA 4RQ4A 3IMXA 1N0VC 4QU6A 2DTJA 1X4AA 2UU9K 2X6NA 2PT0A 2DGVA 3HCXA 4AD6A 4I2AA 1BA0A 4I7FA 4YY3F 3M9MB 3RJHA 4FPRA 3PDNA 2ZFHA 3R8YA 3QT5A 1YI2S 1NDLA 2FHJA 4OMFG 2MKHA 2PC6A 5J2PB 4TU9A 3WK7A 4QAGA 1LWFB 2HKEA 5DG7A 2R8HA 2EAPA 2OHFA 5TKWA 2DXFA 2HRTA 2CXYA 3PRDA 1C0GA 2QKQA 4RPYA 1MNEA 2NRXA 2PFDA 2OZSA 5JVHQ 4ZP7A 1HWLA 1OYDA 1UEUA 1IR2A 2B4OA 2LBOA 3NGIA 2HWIA 4CH1A 2BHNA 3ZZYA 3NVYA 3U3GA 2X3GA 2K8GA 4ZVHA 1WF2A 3Q2TC 3GL1A 3SBGA 4BQLA 3AUOA 3UXPA 2H3QA 1YVFA 4CFDA 1O0PA 4CF9A 3SIPB 2X6SA 1VK3A 2K4HA 4UY8O 1KOHA 3DLGA 3JAMY 1QS4A 5FPEA 3VTHA 2ISPA 2KHCA 4BRMA 3M6VA 3VQ9A 2HZCA 4ID5A 2XMKA 4HAIA 2KN7A 3OFGA 4OJOA 2OTJN 1HNWJ 2HLUA 2HNDA 3C66A 4AQYF 1FFWB 5EHHA 3GV5B 4J9VA 2BJ9A 4OZ1A 2E7WA 1F9FA 2BOAA 5I3UA 4RW9A 2RSQA 3NFAA 2DR7A 1JLAA 2IBKA 1S4FA 1TMJA 1H73A 1NCLA 2V9KA 2B3TB 5E33A 4QU7A 1T6DA 2CIMA 4YMOA 3FZHA 4P9SA 2HBMA 4CZIA 4M9GA 1H2VZ 4JI6K 2KFZA 3KUHA 5H1SQ 2FC9A 1YJ9S 1ZQWA 3IFRA 2C3YA 1T9YA 5AKLA 3O9QA 3BB5A 4XA5A 4N7TA 2F44A 2Y0SC 1HD1A 2Y8WA 3LALA 4CK3A 1ZA1B 2ZF5O 4LC9B 2PYJA 1S6PB 2CWXA 1Q3VA 4EEYA 3TYTA 2G06A 1XR7A 3X3UA 2MEWA 1X4BA 2BBEA 3DRRA 5E3QA 5LMUJ 4DHYA 5AJ3J 4QIEA 1FRHA 2W43A 1IV0A 2DR6A 5ITHA 2JFDA 3AEVA 2KL8A 4RQ3A 1T9TA 5AI4A 3U3YA 3UE5A 5C42B 2HBLA 3W9HA 3OYDA 5J0OA 2FD2A 1A76A 2G0CA 4GVMA 3DDNA 2BM0A 3ETRA 2GUPA 3BEXA 3DYAA 1WI6A 3ISDA 3DRPB 1H3DA 1HUOA 1RGIA 3KIOA 1BQNB 4NLQA 3I56N 1LB2B 1REGX 1ZAVA 4FZNA 3DI6B 4C4SA 3PVXA 4TSXA 1RTJA 3I0SA 3M6GA 8ICBA 5CJ7A 3MR7A 1VSFA 1S6OA 3BGLA 3MPDA 4RQ2A 1KL9A 5ALMA 3NEKA 3J7AN 7ICOA 3NS6A 3EKSA 2IHMA 3U02A 2ZIXA 1S1UB 1ROFA 1B9DA 1DGJA 4ZN3A 2L08A 2N82B 2AW0A 2F77X 2IA6A 1HR0F 1M6YA 2GH1A 1MU2A 5LSRA 2WTFA 1M1KO 5AQHA 3G6EN 4QZDA 2A42A 2KQ2A 4PG5A 3AVGA 4EK2A 3O4WA 1ESVA 4B1ZA 1TELA 1CI4A 4A47A 1ZD2P 3HZ6A 3ZTQA 1AA1B 2D9PA 2HNZA 4J37A 3QNOA 4FW2A 5FPMA 3VMFB 2D3UA 1XMQF 2E1FA 3K17A 4LSNA 4H0YB 1KBUA 1TVRB 2IVMA 2WF5A 2GQQA 4J9QA 4RQMA 3GJTB 3SSQA 3KLEB 3I9ZA 1PVQA 4DPYA 2QB1A 5AKHA 2YMQA 4LJMA 3ZT0A 3BS5B 2IYGA 3V4IB 3MCSA 3KHLA 3RJKA 2B7CB 4G1PA 4X84A 3H1VX 1COKA 1RTDB 3JPRA 2ZOFA 3T5KA 3B6PA 2BZ2A 3Q8UA 4LRFA 4AT1B 1QZ6A 2H48B 3D7SB 4DPUA 4FWKA 3CW2C 4CZLA 3MC1A 4K7QA 5B66U 4DX8H 4FLYA 3RF9A 3GJQB 2MQNA 1MMNA 2DNRA 1IBLF 3ONNA 1PUZA 1HW8A 4JN4A 1ZPWX 3TSPA 2ITMA 2ZHBA 3ZETB 2P9UA 3BS7A 4AHUA 4ZOHC 5HAOA 2QKBA 4ZPBA 6FD1A 2AQ4A 4NLGA 1U45A 3ZDDA 2B56A 2LDYA 3LGHA 4OIXA 4DV5J 1VJQA 2F9JA 1NHVA 4B3TJ 2E2OA 1VDVA 3MMJA 1I39A 4PPXA 3AJDA 5DLGA 4OHWA 2Z1IA 4O0NA 7ICRA 4MJKA 1PYSB 1WG1A 4DB3A 1YJWN 1EB0A 1WSRA 1NU0A 4JUZA 2GMLA 1UA1A 2WF8A 3PMLA 1V97A 3UNGC 2O8FA 4OPAA 4I6YA 4DTRA 1GTEA 3SDEB 3HW8A 3H0PA 1Q78A 3CC4S 1U2VA 2V6AA 4LFAK 4WF9L 2I5JA 3LDPA 2R7VA 5K8PA 1CJVB 2LXFA 4ZLJA 2RT3A 4GKKF 5FDLA 3QETA 4LUBA 3VAIA 4NMLA 1TKZB 4WP9A 4ZVOB 1MLAA 5ALOA 5L1JA 2O4IA 1N6QB 3HO1A 4EBCA 3MFHA 4BDPA 4YP3A 1K5OA 1O6XA 2LA4A 1PIEA 1FD8A 1YG0A 4NA1A 3OJSA 4FLZA 4QZVB 5EGYA 1T95A 1VR6A 1MA9B 1VBZA 4IJNA 1QAXA 2I1QA 4ISEA 5AZIB 1LKYB 2HVHA 2OPPB 2W8KA 5KNIA 1YJWS 3C6AA 2RF2B 3C2KA 4NPOA 4J9KA 4QZ9A 3TO8A 1LXJA 2RKIA 3KFUF 2O3DA 3HVTA 2AGOA 2ZD1A 3NF7A 9ICUA 1EETB 5ETQA 3QZ7A 5B0AA 3CF5Q 3M8PA 5MLCV 4DV7K 3AJ1A 1RP5A 3OR1B 2G2ZA 2FLOA 3UVJA 5IFMA 2GQ2A 2OELA 4ZTFA 5E3RA 3RW7A 4ZLLA 2FE9A 2C2KB 1JJ4A 2IM3A 4RJVA 4ECQA 4O3SA 2WK4A 1VHFA 3G71N 2E5SA 3M2VB 4ED4A 1OY9A 3E51A 2EDUA 4TYAA 3CJ9A 3O1LA 3DYAB 5A0YB 5IQQA 2JVRA 3M8SA 3SQGA 1WAFA 2QV6A 5HVGA 1VBKA 3GP9A 5AQUA 1P27B 2KZZA 4NA2A 3TP2A 4C1NI 1OKJA 1WC3A 3US5A 2K4PA 4DUYJ 1A0PA 2VV5A 2Z1GA 2V63A 4WFAL 4M6WB 2M88A 1XC9A 1R8AA 5KFBA 4B1WB 2HZVA 3MECB 2BH1A 3LAKA 1E6VA 3KMSA 5K8NA 2KHDA 4AQYK 1SH0A 4R79A 5M1NA 3MWTA 4FWQA 8ICVA 3MGHA 3LM9A 2O01C 3LWLA 3KLIA 4KHWA 3D6JA 5AXLA 2MB0B 3UDEA 2ZG6A 3KOOA 1IR1A 1RSCA 1LXNA 4NA3A 1KRPA 2KZMA 4NLXA 4HR2A 1LWFA 2W1BA 1S1WB 4FM2A 4H0PA 4KGKA 5C24B 4DFPA 4XK8C 5L46A 4FN5A 3VEVA 3ULDA 4M7YA 3CFRA 4IRKA 2MTLA 5IINA 4EZ9A 9ICGA 2V68A 3O3GA 3O9SA 3HJEA 1YBAA 2MGZA 4OLAA 4B3SF 3SEIA 2KO1A 2R7XA 5KQ8A 5FROA 2HCFA 4B08A 2JZBA 2ZBRA 5J0UA 3G6XA 1L6NA 2CZ4A 3A3OB 4UOCA 1ZQKA 4HKQA 3OUYB 4AUKA 2PYLA 3CD7A 3N7SC 1Z4UA 3MR5A 2POKA 4DFJA 1GXTA 3H5SA 1BPDA 2P9SA 1CJKB 2P9EA 3GB0A 2W4CA 4BR2A 3K9KA 1DTQB 4GY2B 3D1OA 4M3YA 1ZQFA 3I5AA 2FB0A 3AD8C 5HP4A 4FPIA 4H4OB 4CJ4A 2D6FC 1PCAA 7ICGA 2V4RA 2JGUA 4DR3F 3AD9C 1SWVA 2E6LA 1T4GA 9ICEA 1K6YA 5F1XA 3RRHA 5FIIA 1Q5YA 2XC9A 7ICTA 2ZH3A 4CGFA 1KAZA 1V3SA 4F4WA 2D7SA 4M94A 3ZDCA 1FTRA 1QM9A 2GJFA 2KHOA 5KFEA 3NUQA 3DV9A 1W7AA 3PHEA 3DU5A 4XRHA 4CO2A 4A8QA 5KFVA 4P4PA 4OHXA 2XG8A 3TZXA 1ZM3A 3Q7CA 5TKYA 2CH6A 2YI1A 3AOAA 1FJEB 2G4BA 2JFKA 4EBDA 2A1JB 4YR3A 3Q8SB 1F9HA 2AEFA 4GC7A 4DV1J 1PKUA 1WG4A 2AIRB 1L3TA 5HNKA 1RTIB 1WOPA 2R4FA 4FBTA 4IFYA 4NYPA 3ZZOA 2CDQA 4BDYA 3DM2B 1M5KC 3AODA 3JSBA 3CIMA 1YTYA 2OANA 1IJEB 3GG1A 4F3MA 4F5OA 3MMCB 3UPQA 1MMDA 2XSJB 4P0QA 4YDUC 4PXCA 3G10A 1MN8A 1NNDA 2BR0A 2A3JA 1A5VA 1E4FT 3M8QA 4I9QA 4BGAA 2ZGZA 1N48A 1UWAA 4TQRA 4X4TA 4RNNA 1TAMA 4F3TA 2A1RA 3I32A 2I8EA 4F8RA 2HQDA 2FMPA 3CJ5A 4J2EA 2FVCA 2KK0A 5GAGI 3M30A 1TL3B 2MZTA 4GKKJ 2OPRA 3FZLA 5H2FU 4F0MA 2NRWA 2JEGA 1RWNB 4CLTA 2JH7A 3AY0A 3IG5A 4NLVA 3NLCA 2A41A 2BKNA 1YZ7A 2UV8G 4F71A 4KH1B 4RQNA 3KK3B 4CF1A 2AX1A 3HD1A 2BVZA 1HJOA 3SUQA 1HR0J 5AQLA 2FZCB 5J2FA 2OXOA 2V94A 4F92B 4MIBA 4TU7A 2VQEK 4DWIA 4H4MA 4YOVA 4A5BA 4QJVA 1FFSB 1Q9XA 1MWKA 4DF8A 1IG8A 1XC3A 3W9JA 2DT9A 5DM6Q 1JK9B 2VKZG 3NVMA 1OYEA 3T1HK 3FSYA 4RUBA 4QQBA 2VQEJ 4DTUA 3D2EA 3AXKA 3BH6B 3KK1B 2YWFA 3FBCA 4NM2A 3R3TA 3A4TA 3JQKA 3FCWA 1HI0P 2DHAA 3GR1A 5DZ7A 1RAFB 4PGYA 4N56A 4L3QA 3WNGA 4CVNE 4US9A 4YMEA 4C0BA 5KAKA 3M05A 3BO4A 3T9ZA 2E1ZA 5J2CA 4HEA9 1IIPA 1HQUB 2QMXA 4RU9A 4OYPA 2HMIB 5K5MA 3P39A 2RAQA 4WF9Q 1HYZA 1IV8A 3V7KA 1J5OA 1UL3A 2QT7A 2MHEA 2ZQBA 5H9FJ 3C2LA 4K5SA 4P2HA 4Y00A 4ELUA 2UUBF 4ILGB 5AXKA 2HBRB 4X64F 3EUNA 4KR0B 3H59A 3ETOA 3V9ZA 4ECUA 2FJDB 5AI0A 1JN3A 3MHYA 3C6UA 3NH0A 4G1QA 4DR1K 3DHXA 4NE9C 2RHFA 2CJKA 2FDRA 1RAAB 4DTXA 1IUJA 4AL7A 1GT8A 4IR9A 5J2GA 1F3VA 4MK7A 2HI0A 1RT6A 4C8OA 1VSHA 2H3FA 5AZJA 3ENVA 1HLUA 2ATLA 2CKWA 4I2GA 1Y7PA 4M5MA 2KXNB 5BR8J 2WB1C 4F4KA 1BY9A 4IOXA 4Y0FA 1HNWF 3ENHA 1Y5LB 3H7HB 4GV3A 2J9EA 3QO9B 2W41A 4CZMA 1I94J 5FLXY 4OX8A 3MDFA 2L9WA 3JB9k 2JWLA 2C2NA 2CNLB 1S77D 4KLQA 2BE7D 3UM9A 3I8DA 3EEQA 2CRLA 2YVSA 2VPXB 1RT3A 3OS2A 1HBMB 4IOBA 2YX1A 5G0RB 3TI0A 3P6YC 3NOCA 2Q6CA 3KWGA 2VANA 4O5EA 2J8SA 4L3NA 4F4AA 3TVYA 3M6XA 2GHPA 3MMBB 1U0SA 4F36A 1NPKA 2RRDA 2YKOA 1DGSA 2QLXA 3NMAA 2QWQA 2Z7JA 3D6HB 4XAKA 2KG5A 1TK0A 3MM6A 1B0TA 3WXLA 1YIJN 2RIJA 4G9BA 3EX7B 3K7RA 3UQSA 3NGDA 3T1HF 2MQLA 5E84A 2P51A 5U47A 3ZZ0A 1FI4A 1UWBA 2DNGA 2ASPA 4FYXB 1N4LA 2FJVA 3DN9A 2VB6A 3MXIA 1S1VA 2IYIA 1M0SA 3JYTB 5A6PA 4RCHA 5ETSA 1NZPA 2VZ9A 4G3IA 3OBWA 2BQ3A 2KFYA 1S0MA 3TWHA 2DRDA 2JWKA 4JI5J 3LPTA 2MXYA 2KOBA 2B0CA 1SCJB 4NASA 4E7LA 1S7HA 1WSFA 2YKNA 3KG1A 2B6AA 4F0HA 2WW4A 1NLVA 2QA4N 4OGCA 1HHQA 3V6DB 1T9VA 1G6BA 4R65A 3AQFA 4AM7A 1A0OB 4J9SA 3NNHA 2L9NA 2MKSA 3AAQA 1SB3C 2XNQA 3EVWA 4FWOA 3CCQN 5E3CA 2LMIA 4BR9A 2C3UA 3WQTA 3WXKA 2P6TA 4H4OA 2BE2A 1G7CB 2IRXA 2PMHA 2DPNA 1UPPA 3FSIA 3QU5A 3ZLJA 2ZOGA 3DRRB 1WEZA 3CT9A 3PW4A 2ZE2B 4YD1A 1X6JA 5ALTA 4P2MA 1IKVA 4YY3J 2H5IB 4DV2F 1F3FA 4KB1A 1CJKA 1YITN 1SZ2A 2HSEB 2KH9A 2DKZA 3BZCA 4IYQA 2R9LA 4I6WA 1FRMA 3UVJB 2OIHA 3M2UB 4P2FA 1VC0A 3CCTA 4ECYA 3NCPA 4OKJA 4FWRA 2ZJ5A 1VBYA 1GNKA 4QBUA 4C8MA 3VQPA 4W98A 1RT1B 2ZHAA 4ED8A 1CS4B 4KLIA 1SPBP 4NYFA 3HP6A 2DH9A 1B7FA 4GRSA 3C6TB 4P52A 3SQ0A 3LYSA 4F93B 3PW7A 3BBCA 1HIWA 1CJUB 3DJCA 1VIOA 1Q95G 2QMUB 2DIUA 2GVDB 4OJHA 4P71A 3VZHA 1QHTA 2CXEA 1FE0A 4H4MB 3CD0A 4ECZA 1WWVA 5JJBA 4ELTA 2D0OA 2D74B 4DLEA 4JI6F 4USHA 4AF1A 1ZBFA 4Z4GA 1DTTA 4M2YA 1CJUA 5IT9O 3F9MA 2IIRA 1XNQK 1CBKA 5L1IA 3BH7B 2ZH2A 2PAVA 1EQ0A 3JPOA 4DU8A 4CRXA 1N60A 2XMJA 2DR9A 2HK3A 5IOLA 4DOBA 2OPRB 2YWEA 3SEOA 1V3RA 4F7VA 3I1YA 3J7AP 4CI0B 2JSXA 3Q8KA 3C1ZA 3NG8A 4WFNL 4KHYA 3CETA 8ICOA 4GVBA 2WOMA 2F3JA 2VGNA 2IMWP 3Q2SC 2H3GX 1FO4A 4O5BA 1JLCB 1XNRF 2W3SA 1U6ZA 5AJ3F 1NK7A 1FNOA 2JRZA 2BCUA 3OFHA 1SIZA 4TUQA 3H25A 2UUAK 3MFIA 2V2QA 2HEKA 4BR4A 3OBYA 5F2RA 4I2QA 1C20A 4DL0C 2J5AA 4I2EA 4WFYA 5DRKA 4U67L 1ZZFA 3KKSA 4OHZA 3C29A 3AA2A 3DC2A 3C28A 2LVWA 2B9WA 2AJFE 2M9KA 2PBDA 4Q2LA 5HMXA 2YJFA 2HS3A 2A5XA 1NOZA 2B9XA 1C7YA 4I2QB 1Q8KA 2W42A 4FS1A 3OW2M 1ZQZA 2LU1A 2VC0A 3FGVA 4B3OA 4TURA 1IWAA 5C2DA 4DU1A 1NGEA 3QATA 2E8NA 2NZTA 1RDBA 3R3LA 3C15B 4NOHA 3CCMN 3JS6A 3SCIE 2G8IA 4C9DA 2ZUAA 3BY5A 1UETA 3PG9A 2G8VA 2KB2A 4ZDNA 5HMWA 3B6OA 2M8HA 3P5BP 4UAUA 2YKQA 2DY4A 3BYRA 1HWIA 4KB0A 2IDOA 1ZPVA 4MF8A 3D0IE 4BC9A 4UZCA 3WQPA 4LREA 5L1LA 1FA0A 1AQ6A 2CRXA 5DM7L 2MDAA 1IQZA 4OX9J 1H38A 2XGQA 1IR0A 2FY8A 3T6BA 5DQGA 1REVA 2ZVSA 4CK2A 4ZP8A 3MX5A 4DTNA 2FPMA 8ICUA 2P9LB 4QR2A 2IA0A 2WZ1A 5E7OB 2IDLA 1XSPA 1FDDA 4LF9K 3SFUA 5LMNF 3OXLA 2D4WA 3K75D 2JJ4D 4JK1A 2XVTA 1HPZA 3D68A 2K8CB 1PBAA 3D9BA 3GJSB 4NLOA 4PUOA 4KHNA 2EH9A 3DMJA 5B0DA 1NLKL 5IS2A 3EZOA 2QIFA 3D2NA 5ALSA 2UXCK 1YJNS 3OS0A 4ED7A 2E5HA 2E1CA 5KFZA 3CWJA 3OYBA 2XO6A 4LVSA 3VAGA 2F8LA 2GOLA 3N6MA 1HWUA 5RUBA 2HHHF 3DGPA 1HJPA 1S10A 1FXRA 2QLTA 4KPYA 1KW4A 5GAEU 2EG2A 2F76X 2VBXA 4NXNJ 4IR1A 1Z05A 1NGJA 2VPZB 3ILIA 4IEIA 4UZBA 3QZ8A 2QO3A 4CFCA 3R5DA 2OFHX 3RTVA 4CO3A 3SPYA 1BVSA 4CTAA 2UXBJ 3N7PD 3THXB 2NV3A 1RWPB 4CGZA 2HK2A 3LL3A 4A61A 1NMDA 3CF5L 5T7BA 4MKBA 4O4GA 3BF3A 1UPHA 4UUWA 4JB3A 5J0SA 3GE9A 4ICLA 4LFBJ 4A2BA 4KSEB 3TTCA 1WG5A 5J2NA 3K5PA 1TVAA 7ICMA 3NRWA 3MAHA 5IXUA 3HULA 3QSIA 2XCPA 4YDDB 1QQNA 5D4BA 1S9EA 2J9CA 2B8PA 4DZDA 4J9PA 3SAHA 1LCUA 1OH6A 3M2RA 3B4MA 5GTHU 4HVZA 3CEDA 3VGMA 3OTQA 1NKCA 2JRSA 4UW9A 4CJWA 1WWHA 1AXQA 2ZD1B 1WKKA 2I7NA 4I67A 5J2QB 5G5HA 1JLGB 5ALRA 3D28A 4WIIA 2LYBA 1P8ZA 3W63A 4DR5K 3UDVA 2FGCA 4IFVA 5EVZA 2I9GA 5KRSA 1WUAA 3HPGA 5KFIA 5GADI 3Q8LA 1WKJA 2YB4A 4RW8A 3AXMA 2E88A 1TK8A 4AHCA 2GVZB 2JGAA 5HBMB 1BU6O 4OGEA 1VQ4N 1D8BA 3W64A 1Y10A 1RZMA 2ZJRQ 1FO1A 1RAJA 3H6EA 4NEYA 4FNHA 1ZQJA 3GFZA 4RT3A 3CCRN 2XY8A 3DLKA 3JAMO 1Q53A 4YOYA 4TY8B 3QX7A 3UMCA 4NLYA 3NGRA 2E8AA 3N4WA 4WPAA 1IKXA 1YTUA 4IQTA 3MR3A 1SJRA 5G4DA 2IVPA 5KFDA 1JLBB 1OVYA 2DCUB 3BSNA 3P4UB 3M8QB 4BC7A 2FF6A 1QQOA 2E1EA 3A8YA 2MUTA 2E1MC 1E6VB 1RTJB 1VQ5N 3OR2B 2DFHA 5AQGA 2C2EA 4CW7B 3WKCA 2HWTA 2EWSA 4OYXA 2GIFA 4KLOA 4BDZA 4FBUA 5IWAJ 2GELA 4B8CA 1T0TV 3VALA 2V8DA 2G8UA 3MM9A 4PXDA 5CRXA 3FCVA 4G9ZA 3PTWA 3TRGA 2ZTCA 2C2ZB 4A8XA 3KHRA 2U1AA 4DR5F 2ZIWA 3QUBA 3OS1A 2FYXA 2RQ5A 4Z4EA 1OMSA 2Q3SA 2Z58B 2HOIA 2O1PA 3Q8RB 1CULA 2I6WA 1ZBTA 2AX0A 2YHAA 2YHXA 2JOQA 2IC3B 4C7QA 1IXRA 1WI8A 2OD6A 4RT2A 3AVAA 3B8HA 5LJWA 4Y2QA 3OYAA 4PR6A 3B8AX 3IRUA 2Q79A 2ESEA 1Z3EB 2IOHA 5A8KA 3H4BA 3MMVA 3D2EB 3JQMA 3ZO7A 3AA9A 5C10A 3HKZF 3PFOA 3P4IA 1FRKA 3KG0A 3J81O 1UTAA 3HK2A 2CQPA 2P9SB 1A5XA 1V38A 3JPQA 3NRBA 5ALEA 5L38A 1UAXA 3CCQS 3SCJE 1Z2ZA 2F1HA 4H0OA 1P6TA 5L9NA 5EN1A 1V85A 1RU2A 4GKKK 2A2CA 5GAHI 2VKRA 2ZM6J 1SXLA 3LP3A 2J6UA 4Z37A 1RBRA 3MM5A 3RG6A 3QYYA 3T1AA 1HWJA 5IT9Y 2NXEA 1JLEB 3H5XA 2XZWA 2Y1LB 4RTFD 2YNGA 4JKFA 4HTJA 3ZTRA 3MMAA 1GOAA 3SV3A 4DQSA 2GJIA 4E3SA 4GKJK 4FVCA 2DGTA 2XQCA 4KX3A 3AJ2A 3RUBL 4Q2MA 1NM2A 2E7XA 2GBZA 2BUNA 4WE1A 2UXDJ 4KX5A 3A0IX 5F0XA 4B9UA 1UCVA 3NVWA 1N33F 2UUAF 1VBXA 3CCVN 2ODGA 4H0XB 3H7IA 1WELA 3DDHA 1HARA 3T19A 4LSZB 9ICXA 4A59A 5F8LA 3AHPA 4C8LA 4ED0A 3N79A 2E8MA 4TU8A 4Y2CA 4CF3A 2HSTA 4Z0UA 1ZQNA 1KQGB 1I3OB 3AU6A 1SKWA 4Z6FA 1Y97A 5AQRA 1T9XA 1QAYA 3D6TB 4A46A 2I5JB 3BKUA 2P9PA 1E4GT 4UAYA 3HSGA 1ZAWA 4BCAA 3HTVA 1TAQA 2PO4A 3MUTP 1VQ4S 1E3MA 2M0NA 2BCRA 4PAAA 3ALRA 2YY3A 2HHWA 1ZQ1C 3IUCA 1Z25A 3LUYA 2ERRA 1YJTA 2GMJA 4DU4A 2PSZA 4IO1A 4RUCA 1H7WA 4XTTA 4NEZA 1K0TA 5AK4A 3LH2S 4GO7X 1PG5B 2KXFA 1HBUB 4ES1A 1KC8O 1SQEA 1UOCA 3WZ0A 3FLCO 4DEZA 2P9GA 2ROEA 5HVHA 1S72N 4FJXA 1RHQB 1RDDA 2OMOA 2DO0A 1OY6A 2G5HB 4USAA 2V51B 1UW4A 5CWRA 2ABYA 1C1CA 5AQVA 1VSIA 8ICRA 4ANDA 1RHMB 3OSPA 4IKFA 4OX6A 2FDNA 3W5XA 3NVKA 1RTHA 1TP7A 1K9MO 1JKHA 4I2DA 4RLEA 4ZITA 2E5LJ 2MQMA 1UZHA 3W7BA 2OFGX 5I3UB 2YKAA 3H3OB 1IKXB 5I42B 4ZVSB 2OHDA 4M3ZA 5GADP 2PMWA 4PHPA 2QTWA 2KP7A 4OYZA 3HD2A 4USWA 5A2QU 3CVKA 2YX4A 4MIAA 1KCFA 2XGPA 2WVBA 5EUHA 4EP5A 4ECRA 4KGVB 1VQ6S 1Q16B 1B0XA 4EELA 2EAOA 3WKDA 5KOWA 2G08A 1C0TB 1BE4A 1GLBG 3BZQA 3MURP 2NXCA 4FLUA 2YHWA 3OYJA 2BE2B 5CR0A 2ZDOA 2DHXA 2GWKA 3CMAS 1ZH5A 1MQ3A 3ZXWA 4ZP6A 2XMAA 4HHJA 3K57A 3O5TB 4WZMA 3SMZA 1NZAA 2IOFK 3ZT2A 2YNHB 5AM4A 1XMOK 1LWEB 3FQKA 5C2CA 1DOQA 5F3XB 4DXLA 4WCEQ 3HPHA 1UAWA 1N54B 4YMMA 4FM0A 2LCWA 5BOLA 3CSKA 4ZKAA 4QWCA 4UB4A 4WFZA 2HIYA 1CC7A 3V6HA 1NPPA 3TVKA 4QR0A 3SMVA 4PHDA 5DG8A 1ZXOA 2UXBF 1M1KT 2XY5A 4V19S 2GV1A 2HHVA 3LP1A 2R3VA 2RVJA 4IEEA 3C94A 3QRQA 1SGGA 2XYPB 2RNEA 1MW7A 3RW6A 1R59O 2ZUBA 2PY5A 4OZLA 5ETLA 5LXYA 5AICA 5CYMA 2GQCA 2RS2A 4RW4B 1D09B 1U7LA 3LW5C 2DGOA 1JLQA 4DX5A 3ZTOA 4ZVEA 3VCBA 4DTPA 3BUZB 3HRGA 5J2MA 3L95X 3DRSB 1ZQPA 1FFVA 1L7NA 3C2MA 3ZEUA 4QYZJ 1V4SA 1FEEA 2K4IA 3UE2A 4FDFA 1ZXIA 5J1EA 1KEKA 1YWXA 4NLNA 3FZFA 3VTIA 1UVIA 4BRLA 3JPSA 3D0PA 3TQ1A 3U1MA 1VJ5A 2AYMA 3T5LA 3JTNA 5T7LA 3OA9A 2NS1B 4DTMA 1N2XA 2NNWA 4F5QA 5FLXU 2Z57B 3VF0B 3HI0A 1CLQA 2CJQA 3MEEA 5D0EA 3A3PB 1H98A 3G87A 4RNMA 4YS2A 1Q0NA 2XLJA 3DXSX 2LEAA 1M5SA 3I76A 3PJWA 4OJ1A 3MXMA 4BC5A 2W9BB 1YX2A 3C46A 1F21A 3WXMB 5EWFA 5KFPA 3BGRB 2ZM6F 1U49A 5JRTA 1ZQYA 1O8BA 4YXMA 3JPTA 2P2CB 3J80U 3EE9A 3V4IA 3ASMA 1ASWA 2ZTEA 4R66A 2QSFA 4JI8K 4FVUA 1NHUA 3LA0A 3SCKE 3L2RA 7ICQA 4RWWA 2ITGA 3KJFB 5KT5A 3PIOL 4WU2A 3UD4P 2P6UA 3A13A 1YLXA 4EI2A 2LQBA 1EAYC 4X62F 3C7NA 4JD2B 2BTFA 4LBHA 4O0IA 3ICXA 4OYIA 5J1EB 5AHXA 4OV6A 1ZQHA 1F5BA 4PWUA 1VC5A 4CJEA 3HT0A 1ECWA 4FJNA 3KHYA 3TX8A 1F6TA 5IM0A 2EC0A 3LDNA 2D3ZA 2DQNB 2GS8A 1TKXA 4GC6A 4YFUA 9ICIA 3HHEA 3AVCA 2XTJP 1K8KB 2J6SA 5D0RA 3O08A 1LKZA 3SI6A 3DFEA 2FF3B 3D6MB 2BABA 3L2UA 2ZTDA 4DUZJ 1N36F 3R2DJ 4LF8K 4FLWA 1XMOF 3RH5A 1WOSA 1VGYA 1N52B 1N36K 5IWAF 4OD0A 1Y3JA 4JS4A 8ICQA 4E7JA 4K0KK 4XH5A 4K42A 2WSCC 1RXVA 1VQ5S 2YNFA 3DLKB 2XICA 3QUCA 3QQCD 1P1LA 4WYWA 1Y88A 3PW0A 3F0NA 4M1KA 1N32J 3A8IA 1ZM4A 1HNZK 1Q82T 1RHKB 2FHJD 4Q0BA 4EAHD 4KAIA 3F2DA 5B7WA 5HHHA 2JEIA 3DMJB 3NTUA 3MXJA 5JXSA 1U25A 3BO2A 1IQTA 2ZJQQ 4BR0A 4QZHA 3R7SB 3RMCA 5BOMA 4FZMA 8AT1B 2C2OB 3C3LA 1FEZA 1IN0A 2DKOB 4DBQA 3VQEA 2MKCA 3CB4A 1P90A 4O5CA 1DXSA 2R2SA 5AQTA 2YNGB 3J81U 3RMDA 3QGGA 1J97A 3IG8A 4KKOB 2WBNA 4HUGA 3ZNUA 3PJ9A 8ICGA 1WORA 2WCXA 3NXZA 1JIHA 3BGUA 5KFKA 5CY4A 3RBDA 3JTPA 4G65A 2ZH4A 4FFDA 3TAPA 3KJNB 1JNRB 4DCPB 2VYPA 4ANEA 2VG7B 3H08A 4DG1A 2UXDF 1T9UA 1FESA 1RZTA 5AQJA 2O67A 2ZUCA 1FW6A 3QBWA 1GLFO 1W2BM 4B17A 5F8MA 4E1MA 5KPRA 1DFDA 5BR8K 2QB0B 4KLFA 2OTJS 4CCHA 5I3PA 2EFOA 4O4GB 4YHHK 1R43A 2FTRA 2IVFB 2RUSA 4AILC 1Q81O 4MFFA 4F26A 4YHHF 1RU1A 2EWHA 1CQMA 2W9CA 4YUDA 4B3TK 3L7PA 3VAKA 1RDRA 1X9XA 4UB6U 2WBRA 3A5OC 1YIJS 1K1QA 1RTIA 2HHQA 3GSIA 4FOIA 1RBVA 2BACA 4KITB 3KLHB 3MEGB 7FD1A 4E8UA 1LFWA 3EZWA 4MKYA 1U02A 2HHTA 3DRSA 1VQPS 2RHQB 3VAMA 3H0LB 3V81A 4AHTA 2NUBA 5M1FA 1QH9A 4U7BA 2AF6A 1YDLA 3PRBA 1BC6A 4FJ7A 1TE2A 3IDHA 4LZDA 2N7CA 2BJDA 5ALPA 5EE9A 1FJCA 2W4PA 2VFSA 2JH1A 3GOIA 4HWIA 1TKTB 2NRVA 4TLQA 1HKBA 2QFJA 4C8KA 5KG3A 4ILHA 1YRUA 4JI4K 2CJXB 2AP1A 5KG5A 2UUAJ 1FKOA 4ATNA 2NPFA 4F04B 5F0WA 2K60A 2J0QD 4MK9A 3KD5E 1KD1T 1C2PA 4DFMA 3WXIA 3ZDBA 1XN9A 3GMGA 3WEEA 1HQUA 3MMAB 2F8KA 4CYUA 2LYVA 4EO8A 2ZZMA 1ZBSA 1U1PA 5CR4A 3UXNA 1P9QC 1RTDA 3U1NA 2ZXHA 4MKVA 2F8SA 2P5VA 4X4NA 4CLKA 4NCGA 4DSIA 2MZQA 1SL0A 4RUAA 4FLXA 3HDSA 3CO0P 1XMOJ 3THYA 3TADA 1NGGA 2XYGB 4YN3B 2PFNA 3FFIA 3TAFA 2F1IA 3UDLA 4E1NA 2EFVA 1D9FA 1RBAA 4EBEA 4DUTA 4LR8A 2FVPA 3R27A 1JLFA 2B0GA 5F8GA 4ZVTB 1Q5VA 5FDLB 2ZH9A 5HRNA 1RTHB 4DLGA 4YD2A 4W5QA 3EUB2 2V8HA 3TAEA 3L3CA 1JRPA 3R9KA 4CBXA 1I94F 1UEVA 2YQ3A 4M3TA 2ZZNA 3JTOA 2VQFF 1ZZNA 3ZEUB 2JV3A 5AFUH 4GV6A 3NAHA 3PX0A 1RE1B 4DKWA 8ICNA 3ZSOA 2QLFB 1EP4A 3AB2B 2B8QA 1NSPA 1ZQVA 5HR6A 2PFPA 2CQIA 4K4SA 3QT6A 4FYDA 2OEJA 5KT7A 3K5OA 4DV0F 2UVWA 2IOCA 2N1RA 2GHWA 5AJ3K 3C6UB 1VOMA 2R2RA 4DV1K 2G8KA 3V4MA 3K5MA 3E66A 2UU9F 2UU9J 5AQZA 4K4IA 5M1OA 4Q43A 4CZGA 4KMOB 3C2PA 2DXDA 3QIDA 4TYBA 3QNMA 4ZVRB 3DLEA 5ADXA 4BHQA 3KWIA 3QT8A 3A0BU 4FM1A 3A8JA 2C2DA 3J7ZT 3UKRA 4QZGA 2LQ5A 2EEYA 3AOBA 3PLAA 3L3UA 1MMLA 2G09A 2H1YA 4DI6A 3ORYA 4UUXA 1CVJA 3K0SA 1KFSA 1LWCA 1NB2A 4B9NA 5ETMA 4RW6B 2VBZA 3ZX0A 2IM0A 1I6JA 4KRFA 2X3DA 3MBYA 3WC0A 4BS2A 4I2JA 4E89A 4CGJA 4UARA 4NY8A 8ICTA 2Z2LA 4JD2A 1J6ZA 2HQ3A 1F60B 1G4CA 3UO0A 3CUNA 5KAFU 2EBEA 1LQ9A 4JV0A 3HT3A 3SCLE 1RXWA 2MPUA 1DTTB 3TABA 2KRBA 5DDRC 4LF7J 1FT8A 3K8WA 4BRFA 1S1TB 5HHIA 2Z2ZA 3F41A 5M1PA 5LMUF 2JLFA 2KJVA 1A77A 3HP9A 4Z4FA 4DV4K 3MN9A 4AH9A 9ICBA 3RYLA 1U6BA 2DY9A 4GKJJ 3G96A 1KLNA 3I55N 5CD4A 2QEXN 1VDHA 5A2QO 2B4VA 2XBPA 5F9NA 2WHEA 4DR4J 3O80A 1KKXA 4B9MA 3TR5A 1MSWD 4YHHJ 4CNQA 3QO9A 5CH7B 3AQOA 2RS8A 2F4VF 1HMVA 3UN3A 2DITA 5AQFA 2YX7A 3MK6A 3FRYA 2HNZB 5EOYA 4JI3K 3QIOA 2HRUA 3WK4A 1R0AB 1U2CA 1HBNA 4RX6A 5C25A 3A5LC 4RW6A 4LF5K 5CYMB 2MGZB 1WSVA 2X1BA 4CHYA 4FJMA 4UAWA 1R8BA 3C6HA 4YFKA 2DCLA 3QDKA 3OPXA 4DR4F 2DNZA 2EVZA 4NLZA 3B82A 3J7A1 4WQ4C 3IR6B 2ZH5A 3S41A 4MIWA 2FC8A 4IQXA 1SZPA 2KKVA 5J2BA 1BXNA 1VQLS 2ZXIA 1A6SA 4OJGA 2VFVA 3T7ZA 4BREA 1OWXA 2RDDA 4EFHA 3DKDA 4QNLA 2WFBA 1WF0A 4JV5K 3GFXA 3TZZA 1NMNA 4G1QB 5AKXA 3CXCR 1UVLA 4GXKA 1B4SA 4PKDB 4EHUA 3H20A 4IFYB 5AKIA 4JI0F 2G13A 1J5OB 3FM9A 4KBOA 5EWEA 3H0MB 2G1DA 4DL7A 3KBBA 1SJFA 5ETNA 1YJVA 4OZJA 2D8CA 4O23A 1URNA 4WFAQ 2E1RA 4UOGA 4H54A 3T9NA 3F5TA 4H8KA 3LAMA 4NXNF 1DEJA 1C0MA 4FJGA 2EPIA 1NOMA 3H2UB 5IV3A 2HMIA 4CESA 2VG6A 4HL9A 2XS7A 3AN1A 4KH5A 3MEDB 3HX0A 8ICXA 3WK6A 4QWBA 1BCMA 3HKWA 3FYHA 2IBOA 5IZHA 2YH1A 5F41A 2VIHA 2YPYA 5AI5A 1JLBA 4CQ1A 1S1VB 1CC8A 4D3GA 1IO2A 4M3RA 3PYDA 2OJ3A 4FNIA 1S79A 2HWHA 1Y64A 3BGOP 4ZJLA 3HJVA 2P9LA 2HFVA 4QZIA 3BYPA 4F3QA 2Z8QA 2CPJA 1L8LA 4USMA 5K8MA 2M0GB 3CMES 9ICPA 3BSOA 4BC2A 4P72A 7ICLA 4Z4HA 1HNVB 2RB7A 5CYQA 1TU0B 3QWUA 1D4XA 4WTYA 5GAGU 3BZKA 3CE8A 4UF4A 2NUUG 4I69A 2KI2A 1HMVB 2XHCA 5L1MA 4DL4A 3G82B 2Z2MA 2EFNA 2UUWA 4M63A 1RT1A 2W2OP 2F4FA 1FVQA 2DO4A 1Q4RA 1YZ6A 1SUQA 2NRTA 2HGMA 2XS5A 1DKGD 4OJPA 3G6YA 3MM5B 2NLXA 3BSCA 1NPRA 2G2OA 3UN5A 1RILA 1CRXA 5FD1A 4C0ZA 4US8A 4IFVB 2P6SA 2PFFB 3T1YJ 3N28A 4DFDA 3DLGB 1RWUA 1FWKA 3EWGA 1ZOTA 2E9TA 2KJ8A 4JI7F 1FKOB 2E8OA 3UKRB 2VOOA 3L5KA 3W2WA 3FBEA 4J5OA 3HFZB 4QR1A 8ICZA 1SL1A 2Z2YB 2RQ4A 4UATA 3ENBA 2YCHA 4MDAA 3O0FA 5D78A 2AJ0A 1X4HA 2AGQA 4BRKA 3GV7B 1VCTA 2OKQA 4DV4J 1ATRA 3AAPA 3DGPB 4MAKA 4N76A 3RH4A 2EZYA 3GDXA 5HL7L 2PFOA 1TK5A 2PD1A 2YHYA 1RAGB 2R8IA 3T3FA 1X0PA 1RI7A 1UT5A 8ICKA 4H4KC 4B9SA 3CPWR 4CM0A 4IG3A 2LFVA 3O3FA 4Q45A 4DV7F 2NRRA 1ZQAA 1SZHA 2CJYB 2FJAB 1CUKA 2EKYA 4LIWA 1U1LA 3JS9A 5DBAA 2JDJA 5TZVA 3EDRB 2VA8A 1YK9A 2WONB 1VMBA 4GVBB 5JLHA 3HMJG 1BHNA 3E1YA 3ENOA 2FMQA 3QAUA 3GDQA 3OTOF 2DXEA 4DO9A 1ZQLA 4IDKB 1VRUB 2RQCA 2P5GA 9ATCB 4RWXA 4FYVB 3CD5A 3CERA 5DBBA 4NO7A 3POTB 4PQAA 4FJHA 1DTQA 1HI8A 5LL6Z 5A8WA 3HFVA 2HQIA 3P45B 1V4TA 1R8CA 3KOAA 4X5VA 4OI1A 1WSJA 2GMHA 1N0UA 2QWOA 1IH7A 4CERA 4MDBA 3CCLS 4USUA 2NYVA 4J03A 4Y2SA 2V4JA 4LR9A 2DRBA 1NK9A 2E8PA 5KFAA 2MRLA 2CQ0A 3CMEN 1XWLA 7AT1B 4PWDA 3THPA 4PZOA 1ZM9A 1LWCB 4JYAK 4BRHA 5MLCQ 3T1YK 3RAXA 3MABA 1MU2B 3SQ4A 2HS0A 3AAWB 1FE4A 3CCSS 3RMBA 3UIQA 3PSIA 1Q18A 5CCLA 2LXUA 5T7LB 3IFEA 2BJ8A 4BGDA 1X8DA 3TSUA 5HJYA 4EYIB 3LP0A 4B3TF 2D69A 1GLAG 4K50A 3BR9A 2QC3A 5HQ8A 2W04A 2IAJA 2B21A 2WF6A 1COOA 4CM2A 1KS2A 2XLKA 3J8AA 4NJ8A 1YSJA 1N88A 4WFXA 5LSLA 4HVJA 2AD9A 3ID6A 5AK3A 2XMWA 1RAIB 3ISBA 2KU7A 4QZ8A 2Q4TA 1XMQJ 3WBZA 2E5JA 2LKZA 4LMZA 3QFHA 2WUSA 3MTJA 4R0JA 1VSDA 3H8JA 2H54B 1YVUA 3AVHA 4X66J 3ZDEA 4B9VA 3MUMP 3G2XA 3HBTA 3R9LA 1RWOB 5HRPA 2ATCB 4ZCIA 3GJRB 3R1HA 4C4WA 1BUXA 1C0FA 4ISFA 1NUEA 1HBNB 2QSWA 3RRGA 2XCAA 3H46O 1DQ8A 3J80Y 3SQ1A 1Y3KA 4Q5VA 1VSEA 2J7KA 2R42A 3W8PA 2PEBA 4C0OC 1VQYA 3VEOA 1LW0A 3CJ4A 4NXZA 9ICJA 4F0KA 4FLVA 4FJIA 3AFGA 3M32B 3B4DA 3AA3A 2CGKA 1CEZA 3CJ3A 5I42A 1OO0B 2F7VA 1JL2A 4WYBA 2RLTA 3A5NC 3E58A 4CNYA 5ETKA 1X2IA 1GLCG 1REVB 4MYTA 4ECWA 3ZSWA 4JK9A 4O8UA 2CADA 3WK9A 3EMTA 2GVDA 4MF2A 2FBYA 5KFOA 3BS9A 3I55S 3OYMA 2VQFK 4WQ4A 5BPCA 4M47A 3V5RA 2NUHA 5AI6A 5HBMA 4LD0A 3U7JA 3OY9A 4A8EA 4KTZA 4NL9C 3MWBA 3MCPA 4BRQA 1R89A 4OJ3A 4PL1A 3O8MA 1BDGA 1ZQDA 3QGPA 2ZITA 2C2MB 1N6QA 4P6QA 4LF5F 3O2IA 4GXIA 3SJHA 2UV8A 3UCZP 4CO4A 4JP8A 1ITGA 2KE7A 2O8DA 2N4DA 1MROB 1QD1A 1VC6A 4AHRA 4FK4A 4L6V3 5L8RC 1NJIO 4Q7AA 3WNFA 1TFWA 1S8OA 4BVPA 3HSZA 5KFSA 4V19X 1L3SA 3CCRS 1MDUB 2PKEA 4PQUA 4CF5A 2EZXA 3IN5A 5D15A 1IBMF 4JKAA 4BG8A 3WIUA 1EXQA 3LP1B 3THXA 3V7JA 3IO1A 2L5YA 1ATNA 2GWSA 1RGVA 1XU4A 3ZSQA 4UAVA 5BR9A 1H2TZ 2ZOMA 5AE2A 4HT5A 1G15A 4WCEL 2O8CA 2YWGA 4ITSA 2YX6A 1KVBA 4OI3A 1NMEB 2BQRA 4K59A 4DV4F 2GUIA 3KZIU 2FPHX 3HL8A 2IY5B 1EARA 2VJ4A 1YVNA 2VWKA 4C1NK 3H5UA 3N0VA 1QAIA 2CNKB 4YR0A 4XH1A 4CF8A 4MFCA 5CZVA 4IG0B 1NB7A 1ITPA 4LR7A 3RB6A 4M3UA 1NBEB 4XQ8A 1G1XA 2ZWPA 1WJ9A 1F2GA 4ICAA 2A10A 4IRCA 3F2KA 4FWSA 1R0AA 3J81j 2KDOA 2PXIA 1XSNA 1LKYA 4DQPA 2QA1A 1DY3A 3ZSZA 1FDNA 2ASDA 4ELVA 1OQ6A 2CVIA 4DV3J 5DBCA 4P7VA 3PYFA 3EXYA 1GLJO 4LY7A 1FCAA 1UFKA 4M5KA 4LH5A 1HA1A 3VGVA 1NSAA 4U7UD 3WKBA 3PNIA 2OTLS 2NSBA 4NRTA 3SPZA 5BYRA 5IIIA 2E9ZA 3GYXB 4BJQA 3HVWA 4Z6EA 5T41A 1YI2N 4DV6F 2MLZA 4CD3A 3CDBA 3RH6A 1BOTO 4NZ6A 2W9AA 2HVZA 2ETJA 4M9HA 3WU2U 2X74A 4KGXB 1KHWA 3EY1A 5ALHA 1AT1B 4CF2A 1WBBA 4QPXA 2VBWA 4MEYA 2Y3YA 3HHLB 2C3OA 1YJNN 2O8FB 2QK9A 1NH8A 2J6TA 2WONA 3QFWA 3Q24A 2WSEC 4KH6A 3EO3A 2W2MP 2IRUA 1S48A 3AO5A 3A0HU 3DDIA 4ZPCA 3IRWP 3GFYA 2RRAA 1UP1A 3C1YA 2E5LK 1OW5A 3OYFA 1NEEA 5H9EJ 1MWQA 2W6LA 1TKTA 2CQHA 4PJ0U 4O4RA 5GAEP 3KKFA 3HM8A 3MGVA 4CF0A 1A7GE 1FJ7A 3N5FA 4NL5A 4LF7K 5BR8F 1B4FA 1VQPN 4DR1F 1AFJA 3E2EA 5M1QA 2DGXA 2E5IA 4UB3A 4JI2K 3P1GA 3GCXP 1RAOA 3GV8B 1R6VA 3OV7A 4ZS6A 3RB4A 1HFEL 2EQYA 4Y2KA 5M2UA 1HNZJ 3AVKA 4CJ7A 8ICWA 2J4RA 3HKZD 5J8YA 4PCQA 3TX0A 4QYZK 2I38A 3OL7A 3CYMA 5ALQA 5B0GA 2AZ1A 4C4TA 1VQNN 2LDIA 5D4LA 4CJLA 4C97A 2KYXA 4NLTA 4DSLA 4CZCA 3H90A 3OTEA 3MM6B 1VRQC 3QMLA 1SKSA 2NZ4A 3GSDA 1QSYA 1GX5A 4X65F 5CHIA 3CQ8A 4CI6A 1KTVA 1UMJA 4JI5F 2DNLA 4JI4F 2H3EB 4CGGA 4I27A 2DEJA 3MN5A 3LM2A 4DR7K 2PIIA 3BEGB 2HGLA 2XMMA 1M5PC 4DG1B 1S3XA 4NI2B 1C0TA 4OYBA 3SD7A 4E2FB 1WF1A 4H5VA 5AKGA 3MEEB 1HBMA 4LSNB 2HGNA 4BC3A 5AI9A 4Q0BB 2GWJA 5JVHL 2FUG9 3HYFA 3BQ0A 1BD6A 4RQ5A 2ZBPA 2ZJPQ 3ZZTA 1J2VA 2WMMA 2NO5A 4FS2A 2LECA 3UR3C 3ZZZA 2G8FA 3MD1A 3M1YA 1TL3A 3D54A 1P7DA 2GFFA 2BV3A 2B51A 4LF4J 3HKZC 4DPTA 2YX8A 1S1UA 1H72C 2R18A 1SQGA 3L8BA 3WEEB 4F25A 1T3OA 3Q89A 1T05B 4KFBB 1KEJA 3DXMB 1C6VA 4WTOB 5CZ2A 2O6KA 1BI4B 4H03B 3W61A 3L2VA 4BACA 4KI4A 2CPIA 2CPYA 3W5ZA 5D3GB 3TPQA 4UY8T 4PPDA 3MM8A 3M30B 2BRLA 1W2BR 2AMCB 3BREA 4PG7A 3V81B 3H3NO 1U1MA 3UD3P 3AB4B 3NGSA 5F8IA 3AO2A 2AJ4A 1JCFA 4LF4F 2EX3A 4I68A 2R8JA 1RLDA 4ECSA 3NKYA 3VQ7A 2J7UA 1ZETA 5DDOC 2KEYA 1AW0A 2E29A 4BWMA 3R7BB 1IG9A 5F0UA 3V6DA 4QOZB 3JSRA 3C14A 1S0OA 1YHQS 3ATVA 1KAXA 4OYAA 2DH7A 4H0VB 2E7VA 3CM6A 2Z0GA 4K4VA 4OZ3A 4URQU 2CQDA 2FHOB 4Y28C 3VA0A 1VQON 4KHUA 3M9NB 3P5TL 1NGAA 3C7NB 3IC1A 4DQQA 1GMUA 3VQ4A 2YNHA 5HN0A 2DL0A 1WC0A 4IO9Q 4OZ5A 4UB8U 4PL7A 1E6YA 3PXGa 1SUQB 5AKKA 3OHAA 2QX0A 3BF1A 3PV8A 1HBOB 4O0JA 3RJJA 5KAIU 1KDNA 4CLPA 1H2UX 4MLHA 1BHLA 4DF4A 1BI4A 3FNNA 1PO6A 1CLFA 1T44A 4ZPAA 2CVEA 4HLBA 3FFIB 4GNIA 5IT4A 4DOCA 1PYTA 4DSEA 2BMBA 1D1UA 3SYZA 5LY3A 4DR3K 2DVIA 4X65J 2MJUA 1X3NA 4R25A 1WSEA 2HPUA 4RBUA 4RQ7A 4D3HA 4CJSA 2HMXA 3GU0A 3AMZA 5CCMA 4PHTX 1XNRJ 1H7XA 4YOEA 3R5JB 4BRPA 5ALVA 1KQFB 2Y1RI 4YDXA 4U7CA 1JXLA 4XPCA 4NB4A 1RDAA 3RJMB 3SNNA 3IHQB 3QIPB 3EE8A 5AZJB 2JC0A 3ZD8A 4DL3A 5CHCB 3SAFA 4KRWA 5HR7A 3NGZA 1X9MA 1TVRA 4M41A 2GVZA 4DDFA 2D5RA 3N7RC 2A3VA 3TQEA 1RDFA 5C15A 5BJRA 1Y5NB 1DHMA 3V9XA 5KG1A 3QICA 4EO6A 2L9DA 2MSNA 2IM1A 3FZBA 5DKWA 2W24A 3IWLA 3FC9A 1LNQA 1FKPA 2J0WA 3AGKA 4Y0WA 3C95A 3JXUA 4GIBA 4LT6A