1L3SA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*G)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3sA01
1HYVA 1HJPA 3EY1A 3KD5E 1VSJA 3ETLA 3T5KA 1S9FA 4FJ5A 4GMJB 2P66A 4F4WA 8ICCA 5DB6A 4CIEA 3MFIA 1KVAA 3MDCA 5DB8A 3VA0A 4FLWA 4RQ4A 1ASWA 2VG7A 2Y1IA 3AVNA 5KG3A 2WTFA 8ICXA 5DMRA 3K5LA 3HL8A 4CGHA 5KG5A 4PQUA 3AVHA 2FBXA 1NKEA 4YCXA 4NYNA 2C28A 7ICJA 2HHTA 3UIQA 2YKNA 4O44A 4IG0A 1Z25A 5J2NA 4F4KA 4GXKA 4DQQA 4ECZA 3SUPA 1ZBLA 1LW0A 4DS5A 3OVNA 2PFOA 4C8KA 4CIGA 5BOMA 4MF8A 4ICLA 3T19A 3OY9A 3KHGA 1C0TA 4CK2A 2P51A 1D5AA 4E1NA 3NCIA 5KTQA 4F92B 3RMBA 5EWFA 4K4IA 1JLCA 3DOLA 4OLAA 4J9KA 4DFPA 4CGJA 4R65A 3TFRA 4M3YA 1ZQTA 9ICOA 1NKBA 3BGRA 4FBTA 3ZD8A 3BQTA 3OHAA 8ICGA 4Q0BA 4J9PA 4NY8A 1IKXA 1S6QA 3S9HA 4M3TA 4FW1A 4CFCA 2BKEA 4DSLA 4JV2A 1HNIA 4TQSA 5TZVA 2VA8A 2YNHA 3RB4A 2R8KA 3UXNA 1C0MA 4RNMA 2R8JA 4RG8A 4RQ0A 4W5OA 4PY5A 1RT3A 3K59A 3C2MA 1C1AA 4NXZA 4F5NA 4LZGA 5KFVA 4M42A 3ISNC 4CEFA 4E7JA 3AVGA 4Z6CA 4FJMA 3OYKA 5KG1A 3N4MB 3QEBZ 4BDYA 3VQ5A 2XCPA 4Q8EA 4I2IA 2A1SA 5KT6A 5DDMA 4RT2A 1BQMA 1WAFA 3T5LA 1RTDA 2BR0A 4UB1A 3QETA 4M45A 4ED3A 5DB9A 5J0UA 4DFJA 3DI6A 4P4OA 2RKIA 5F9NA 2ZD1A 5J2CA 4RPYA 3QEPA 3NHGA 1UT8A 1ZQVA 3GQCA 4EP4A 4RW9A 3G10A 3SQ4A 3M8PA 3V1RA 3Q8QB 8ICLA 3B6OA 4KREA 4I2PA 4FM2A 4CEBA 4OJRA 3DLHA 3HM9A 3MR6A 5KT2A 3TABA 1N6QA 3K2PA 4M9JA 1BIUA 4O5BA 1S5JA 5KT5A 3VQ4A 4FJIA 1ZQBA 5CY4A 2BCUA 4CJUA 4K8ZA 5KGWA 2BCQA 3JPRA 3O4NA 4QZ9A 2W8LA 4Q43A 3RH6A 2W8KA 3LAMA 3PNCA 1ZQNA 4LZDA 1U45A 3ZSYA 1ZQGA 3SUQA 1D9DA 3TWHA 4QZIA 2DFHA 1WSGA 4IR9A 1A5XA 4KHNA 4DF8A 4IR1A 9ICNA 1ZJNA 2HHVA 4O5KA 3Q8LA 3NF9A 2Q0ZX 5HRPA 9ICCA 5IIMA 3NGDA 5SZTA 3LP3A 1RT2A 1NJYA 2A1JA 4NYFA 1LW2A 1KSPA 4AHRA 4WE1A 4LD0A 1O1WA 4R63A 1BPXA 4DEZA 7ICIA 8ICPA 1T7PA 4I2EA 4F4YA 1VSKA 2HNZA 4QZHA 3V4IA 2VA2A 2ZTCA 4I27A 4HYKA 3QEXA 9ICSA 4B3OA 4FBUA 4FJNA 4EBEA 1NJXA 2C2RA 1DTQA 9ICAA 1ZQPA 3O3FA 4C8LA 2VG6A 3T5HA 3AU6A 5IIIA 4DOAA 1ZQQA 1BISA 3RH5A 1U4BA 3OYAA 2JEFA 3L2WA 5KFDA 5DDYA 3V6KA 2R8GA 4KLGA 1TKTA 2JEIA 3ZSZA 2OPPA 4DOCA 3SPYA 3RJFA 1N5YA 1VSIA 4AHCA 4FJ7A 3EPIA 4DF4A 4IG3A 2PYJA 3GIKA 2F96A 2BPGA 4G1QA 7ICFA 5KG0A 2IAJA 3MDAA 4YP3A 3QLHA 3ZSVA 4RW7A 3K5MA 3EWAA 1RBSA 3RRGA 4E89A 5KRTA 1HPZA 3DLGA 4FW2A 4RPXA 4KITB 4RNNA 5HHIA 1S77D 3O3HA 1NK5A 1IM4A 3V9XA 2KFZA 3IG1A 1S9GA 4DLGA 1RPLA 2AQ4A 4NLNA 1UOCA 3V9WA 4QZGA 3ASMA 1IO2A 2BQUA 3ULDA 2BGGA 2IMWP 3UPQA 1ASUA 8ICOA 1ZQAA 4RW8A 4TQRA 3Q8RB 2RN2A 5KFGA 9ICGA 4AHTA 4FLUA 4HUEA 3HP6A 4BE2A 4DTUA 1S0OA 4JRQA 4F4XA 2XHBA 1ZQDA 3EPGA 1TL3A 1S0NA 3JPOA 4DTSA 1I3AA 4JV1A 1NJZA 1U48A 9ICBA 3V9SA 3MR3A 4OPJA 1UWBA 5CYQA 3UXOA 1A5WA 4ZH4A 4CIFA 2OPSA 2D0AA 4Z4HA 1K1SA 3TI0A 2AU0A 3N97B 4CFAA 3NF7A 4YNQA 3HXMA 3ISBA 4IRDA 2E6MA 4M3ZA 4H8KA 4GXIA 2PI4A 4CF0A 3PO5A 2P5GA 2ISPA 4I28A 4J2AA 3PW0A 2DFEA 4KN7A 4CJVA 2BPCA 3GV8B 1HJRA 1HYSA 1ZBHA 4OKJA 4CF1A 4DMNA 4QZEA 5JUMA 4I7FA 5L1LA 1HMVA 5J0YA 7ICLA 4EBCA 1XWLA 3SUOA 1NK8A 2OA8A 4E7IA 5BPCA 4GW6A 4B8CA 3IAYA 2ZE2A 1JXEA 3O3GA 3C5GA 3KD1E 1RTHA 2ZJ5A 2ASLA 4FJKA 1UA1A 5DGBA 1BPBA 1BPZA 4FM1A 1IKWA 1RDDA 4W5TA 4H4OA 4ECQA 4RPZA 4C8MA 1RDBA 4CEZA 3MGIA 1BL3A 2EX3A 3AO4A 3LDAA 2V4QA 4B9UA 1KLMA 1BGXT 1KFSA 3DM2A 4KLOA 3CQ8A 1U47A 2MAXA 1QLNA 3VQ6A 4W5RA 2XGQA 3OGUA 4R64A 4RUCA 4CJTA 4DL5A 1MC8A 1IKVA 4P2HA 1EXQA 1LV5A 3K58A 1RXWA 2BCSA 1SKSA 2HNYA 5HNKA 8ICMA 2X78A 4QW9A 2KW4A 4CFDA 9ICXA 3BQ0A 3AVLA 3V9UA 1Q9YA 4N5SA 3V6DA 1JLBA 5DBBA 1RTIA 5CB1A 4NCAA 4M9LA 3UQ2A 1X9MA 1WSEA 4CJFA 4EEYA 2AGPA 2MUTA 3KLIA 3PW7A 1WN7A 4LY7A 5KFAA 1XSNA 1X9WA 1S97A 3D45A 1LWCA 4GLXA 4BXOA 4N56A 3KHRA 4ID1A 3L2QA 1N48A 3WNFA 1B9FA 5IIKA 4DTMA 1KRPA 3OYFA 2KZMA 7ICSA 5KG4A 4CK1A 3NAEA 4TSXA 8ICQA 2P6UA 3HYFA 4B8AB 4DL2A 2E6LA 4BE1A 3MXJA 3V81A 9ICEA 4EP5A 4CJSA 1B22A 4IRKA 4HUFA 4ECRA 5F9LA 3LPTA 1JLGA 2OWOA 1ZQEA 2Y1JA 5DB7A 4Z6FA 2BPFA 3MR5A 3V6JA 3OYIA 1SZPA 2KQ2A 3RJEA 3L2UA 5J2JA 3M9MB 3K4GA 1YTAA 4FK0A 1KTQA 2DPJA 1ITGA 3OYEA 1NK9A 1DOQA 1NK0A 4ZTJA 4XRHA 4FJXA 5KT4A 2KZZA 8ICYA 1A76A 4PPXA 2DTUA 5SWMA 3C23A 4KLHA 3P83D 1C6VA 4I2JA 4B08A 3SQ0A 4AH9A 4NLGA 1GOAA 4QZCA 4GXJA 4FVMA 3MEEA 5L1KA 3U3GA 1VSDA 1S10A 4R5PA 4PHPA 2RF2A 2W9CB 4E19A 5C42A 4ZTFA 1XS9D 1IKYA 3SI6A 2DY4A 3ZDAA 2GV9A 4M9GA 4LH5A 1UAXA 1KFDA 1EKEA 9ICWA 5KT7A 3ZT2A 1BCOA 5FRNA 4RQ6A 4OLBA 4UBCA 4ED6A 2G8IA 4P4MA 2YNGA 3LZJA 2RPIA 1S6PA 5J2DA 3K5OA 3C95A 2PI5A 2B4JA 4RQ5A 5KRSA 4Q8FA 1X1PA 8ICAA 1JL1A 2KTQA 4QZBA 4HCBA 5D46A 1ZQWA 3AO2A 4PGQA 4DQSA 4QOZB 4MFAA 3PMLA 4RT3A 3V9ZA 1UA0A 2ITGA 3RR7A 4F3OA 4LVSA 3SCXA 4J9RA 2AQ0A 2VWJA 4O3PA 3ZSWA 2QXFA 4IFYA 4KN4A 3C6TA 4YR3A 5J0TA 3G6XA 4QZFA 4EBDA 4O3RA 1RBRA 5J2MA 4KPYA 5HMLA 4UAZA 2VA3A 7ICKA 5FRMA 4KLQA 1ZBFA 3RBDA 1JLFA 3ZCMA 4DSIA 4I9QA 3VQBA 2NRXA 3RJJA 5CYMA 3G6YA 4DSKA 5CZ2A 4O3NA 2FC0A 3NDKA 4I9LA 1VSEA 1CZ9A 3CFOA 2I1QA 4MFCA 3L8BA 2J6UA 4Z6EA 4UB2A 7ICNA 3RB3A 3U3YA 1BI4A 3L3VA 4QW8A 3NE6A 3MXMA 3ZT4A 3KK3A 4UB5A 9ICIA 4XIUA 4AHVA 1FKOA 1SL1A 2I5JA 4YMNA 5J29A 5J0SA 3DOKA 1G15A 4Z6DA 2OYQA 3V1OA 7ICVA 3LALA 1XU4A 4KO0A 4YD2A 2HHUA 4F93B 8ICUA 3HW8A 1ZQOA 4DL4A 4CHYA 4CEQA 1KVBA 4DO9A 4KMUA 4O9MA 1LAWA 1XSLA 5FROA 3O4QA 2IBKA 3ZSOA 4RQ2A 2BE2A 4B9LA 1ZJMA 9ICMA 1ZQHA 4CF8A 1X2IA 5C5JA 3AA3A 4DFKA 3LP1A 5HLFA 5IILA 1F21A 1TVRA 1NK7A 4RW6A 1KLNA 3CYMA 3QESA 3ZD9A 4I2FA 5D3GA 3TFSA 3AVCA 4Y1DA 3RMAA 1WSJA 5DBCA 5FDLA 9ICKA 3OYMA 3SYZA 4FK2A 3JSMA 3SQ1A 4J2BA 2BGWA 4J9QA 2F8SA 4M9HA 3V72A 1MQ3A 2ALZA 5KFIA 1VSFA 2FLNA 1RDCA 3S3MA 3RJKA 4Z0UA 3EYZA 4YVZA 2PFQA 2UVUA 5KT3A 4J9NA 4CHQA 4BWJA 4MFFA 3MBYA 3I0RA 4CJQA 1ZQYA 1S1TA 4M47A 4AHUA 3P5JA 2YHBA 4MF2A 3H40A 4IFVA 4TUPA 3MEGA 4KLUA 3C2LA 4FYDA 1MU2A 1VSHA 4BACA 1YTUA 5HRSA 2IA6A 4NM1A 1ZQIA 3M9OB 5DLFA 1ZQUA 1Y88A 4YR0A 1TK8A 4EZ9A 4DL7A 4I2DA 4JRPA 1B9DA 4FLTA 2G8FA 3C1ZA 4AILC 3E2EA 5HRRA 5KFJA 3JPNA 4OGCA 4CEOA 1WNSA 4DLEA 2QKBA 5DKWA 3TR8A 3AO5A 4Z4IA 5IIOA 4DTXA 3RR8A 1QSSA 2OPQA 2W42A 4M9NA 1QTMA 4OKKA 5T7BA 3CFPA 4QWBA 1S9EA 4QWAA 4O3OA 5J0PA 3GV7B 4ELUA 3V1QA 3Q8SB 7ICUA 4PHAA 5J2GA 1JXLA 4CHOA 4M3XA 4G3IA 3KKSA 7ICRA 4OPKA 5KGXA 4FLVA 2D5RA 3MXIA 4LSNA 1HQUA 1SKWA 5KFFA 4DQPA 2IDOA 1VSMA 2V4RA 5C25A 2ETJA 9ICPA 3ORYA 3QZ8A 2G8WA 1VRTA 2XO7A 2ATLA 5J2KA 3MEDA 3GIIA 2Z1IA 4CJ3A 3JPPA 1Z3EB 4BDPA 2OPRA 4RQ7A 3SI8A 2OZSA 3GFKB 3K75D 2ZUCA 4DWIA 3ISDA 3OYCA 5DLGA 4M6WA 5JS2A 3RMDA 3DLKA 4DG1A 1RTJA 3RAXA 2KZ3A 1TKZA 3RRHA 4NLZA 3LAKA 3OJUA 4CGFA 2E4LA 5BOLA 1QSLA 3PR4A 3DRRA 3B6PA 5DK5A 2JLEA 3B0XA 2MUTB 1JKHA 3FFIA 3OYLA 1J9AA 4NCBA 2ZUDA 4KB0A 1BCMA 1BPDA 4BXOB 4UQGA 2GWSA 1BQNA 3GILA 4QWEA 1ZQZA 4P4PA 2VWKA 3SQ2A 1S1XA 9ICRA 1NOMA 4IQWA 1RT5A 4QZAA 4PGXA 5CWRA 1NOZA 3ITHA 1Z00B 3TAEA 3D0PA 3MECA 4Z4CA 1PZNA 3JPSA 3QEAZ 4KKOA 3BJYA 5J0WA 1GOCA 8ICIA 1TV6A 3LPUA 2NUBA 1TAQA 1U9LA 1S1UA 2XY5A 3AVFA 1T3NA 1ZQRA 3HVTA 4H4MA 5J2FA 2IS3A 4HUGA 5D49A 1WAJA 2M9NA 1FXXA 3ZSXA 2NRWA 4IBNA 4ECWA 4CJ4A 2A1RA 3VA3A 4O3QA 1EX4A 4JS4A 1S76D 4KLSA 4OGEA 2XY6A 3OYHA 4Z4GA 9ICFA 1HYZA 4M3RA 5HRNA 1BPYA 3HPGA 2OZMA 2YHAA 3VQAA 2DFFA 3RB0A 1RT4A 3OS0A 2FMPA 1W0HA 3FDSA 5DG7A 2BCRA 4M3WA 3WNHA 3RWUA 7ICMA 5J2BA 4F50A 4YMOA 3PW2A 1GOBA 3KKRA 4QAGA 1IXRA 7ICQA 4YXMA 9ICVA 5KFMA 1NK4A 4IKFA 1RYSA 4QZ8A 2FPLA 2DPIA 2F1HA 4CK3A 1B43A 3C21A 3PW4A 5J0QA 5IINA 2UVRA 3KHLA 3K5NA 3DRPA 3L3UA 4BE0A 4DOBA 8ICTA 4KLIA 2ZQBA 3H8JA 1VSLA 4PA1A 7ICEA 4W5NA 4FJ9A 4L8RB 8ICHA 2IHMA 5J2PA 4B9VA 4E7HA 4FO6A 1NJWA 5L1JA 3IHQB 4ED0A 2PYLA 3KHHA 3SV4A 4DQIA 4UAYA 1T03A 4FXDA 5J0OA 5J2AA 1TK5A 1FKPA 3AVKA 4CJEA 3M9NB 2XGPA 1L3UA 4PH5A 2P6RA 4E7KA 1NK6A 1QSYA 3Q8KA 1LAVA 4DSJA 3NH0A 3DLEA 3MABA 1XSPA 4KLJA 4F5OA 4Q44A 4HVJA 3E01A 1ZBIA 2KFNA 3AA5X 4YR2A 1QS4A 1NOYA 1N56A 4R8UA 2WOMA 2GBZA 3OYBA 2J6SA 4K4HA 1L3TA 4F4ZA 8ICNA 4W5QA 3PX4A 3H7IA 2R7YA 3EZ5A 4KI4A 1ZQCA 3GIMA 4RQ1A 5J2QA 1ZBUA 1S1VA 1RBTA 1C1CA 1BI4B 4OVLA 2HB5A 3WNGA 2RDJA 1TV9A 1RXVA 3NF6A 4FK4A 1BPEA 4PHEA 1RT7A 3SV3A 3QIPA 5EU7A 2IGIA 4FM0A 1JLQA 3SNNA 4FJGA 5L1IA 3BDPA 7ICGA 1TKDA 4KAZA 4KLTA 3QEIA 2FPMA 2QKKA 5KFYA 2XC9A 1L3SA 3QNOA 4FJ8A 3G6VA 3A2FA 3NBPA 4B9NA 1KVCA 4MFBA 3EW9A 2VANA 4KHUA 2QK9A 2W9AA 2IHNA 4ECYA 4R66A 3RH4A 1XC9A 2HHSA 1T05A 2Z1JA 4O55A 1IH7A 8ICJA 3TARA 2VG5A 5KG2A 3GV5B 4CECA 2C2EA 4MQ3A 4F5QA 3SUNA 2NRVA 4LH4A 5HP1A 2HVIA 4JS5A 1SUQA 1J5OA 3PO4A 2R8HA 4FCYA 4YD1A 3TAQA 2W9BA 5KFZA 4JWNA 9ICHA 4FZYA 2F1IA 4DFMA 3OYNA 1HNVA 4EYHB 1CEZA 4JK1A 4E1MA 3HJFA 3BQ1A 4TUQA 4RU9A 5L9XA 5DQHA 1R0AA 1XO1A 3KLGA 7ICOA 3RBEA 3K57A 3C5FA 3TAPA 1TKXA 3V6HA 2D0CA 3AO1A 4KV8A 4CGDA 4YG2A 4ECUA 3LP2A 4ED8A 4CHZA 3P1GA 4O3SA 8ICWA 3LWMA 3ZSRA 3HO1A 2RDIA 4YFKA 4B9MA 5EOZA 3ZDDA 3NH1A 2C22A 8ICKA 4F8RA 5J2IA 9ICQA 1J53A 2YNFA 2NRZA 2JZBA 3SPZA 1KFTA 4KFBA 3HPHA 1EXNA 2O4IA 3U6FA 8ICRA 5I3UA 1KCFA 1RZTA 3LP0A 2DFLA 5CJ7A 4FJLA 2A1JB 2ZTEA 4UBBA 3PMNA 2G8VA 1CUKA 5KFEA 2X6NA 4Y1CA 3MR2A 3SJJA 4YN4A 3RJIA 5EWEA 3QZ7A 3ZT3A 1JL2A 5D4BA 1JN3A 5HHHA 3PVXA 2BDPA 1S1WA 1COOA 1TAUA 4RZRA 4XUSA 1DGSA 2D0BA 4KB1A 3QE9Y 3AV9A 2ZUBA 4DTOA 2Q3SA 2I9GA 4F91B 3UXPA 2FMSA 4KTWA 2O4GA 1KEJA 1J54A 4JUZA 5DG8A 3PR5B 7ICTA 5KI6A 1UT5A 4J9SA 3VN5A 1ZQSA 2JEGA 2FLPA 3CM5A 4O4GA 1S0MA 3LANA 3CFRA 2HHQA 1ZQKA 5J2EA 4CHNA 4RNOA 5CA7A 4ED1A 3HSTB 4CJPA 2LYHA 5KFOA 3HWTA 4YFUA 2IC3A 4E3SA 3DRSA 3ALYA 3T5JA 3LDSA 4M41A 5HBMA 3TQ1A 4IRCA 3HT3A 3DYAA 4PGYA 3QNNA 3UQ0A 3QINA 3C6UA 2Z1HA 3VQPA 3TAGA 4MEXA 1I39A 4HHTA 2W9CA 4ECXA 3HP9A 1RNHA 4FJJA 4KHYA 4QWCA 4J2EA 5KFWA 3GIJA 3HPOA 2XY7A 3M8QA 3OHBA 7ICPA 1WSFA 4KHWA 4FS2A 4KHSA 2JGUA 4J9LA 1AROP 4CEEA 4HTUA 2YV0X 4FZZA 4KLMA 3ZDEA 4DS4A 4KLEA 1MQ2A 1CXUA 4CGIA 4Z4FA 3FYHA 1L5UA 4DTPA 3VQCA 2ASJA 1YT3A 4DTRA 1DLOA 4J9MA 3HVRA 5KFUA 3OYDA 4B9SA 4M6WB 3MGHA 5KG6A 4GC6A 3VQ9A 4ECSA 1TVAA 4KTQA 4QWDA 2HVHA 4ED7A 1FK9A 3KTQA 5C24A 4Z4EA 3LK9A 1MSWD 3Q8PB 3QIOA 4UB3A 4CEAA 5E41A 3LWLA 3T3FA 3OS1A 1HRHA 2PZSA 2ATQA 3SZ2A 5DG9A 2P5OA 1JXBA 4JV0A 4EZ6A 4C8OA 2YKMA 4I2QA 4QCLA 3AVBA 2ASDA 4N76A 1C0UA 4JWMA 5JS1A 4DL6A 3C2KA 4C8NA 1CZBA 1RDAA 2ZJAA 3H08A 4RQ8A 4RQ3A 1WCLA 4K4GA 3OSNA 5EWGA 2KN7A 1ASVA 1WLJA 3F9KA 4DU3A 2X74A 1TGOA 3OJSA 4I2AA 3KLEA 2HMIA 1D8YA 3NGYA 4O5EA 4PWDA 3ZDBA 2X6SA 1RYRA 1VK0A 1SKRA 8ICFA 5KFXA 4FLYA 3MFHA 2YNIA 4CCHA 1H38A 4CJWA 4CF9A 3OS2A 5CHGA 4KI6A 1TK0A 1ZETA 1QHTA 3AA2A 4DU4A 1ZQMA 5KFNA 1U04A 4CGGA 2B5JA 5J0RA 2BHNA 2PXIA 2GUIA 4MEYA 4N47A 4DTNA 3NFAA 3WNEA 3PV8A 2C2DA 1ZQXA 4IQUA 3AVIA 4CHPA 4YQWA 1LWEA 4DL3A 3S3NA 4PUOA 3I8DA 1REVA 2ISOA 3PX6A 1X9SA 4ECTA 4KHQA 5KFBA 3JPQA 1ZQLA 4CFBA 7ICHA 1WSHA 1Z26A 3Q8MA 5DQIA 4RUAA 4JLHA 4FLXA 1HQEA 4J2DA 2AGOA 3THVA 1L3VA 2J6TA 4M04A 4FJHA 3AVAA 3L2RA 4ELTA 3OYGA 3HX0A 3V7JA 2HHXA 4YMMA 1RILA 1ZYQA 5KFLA 5CR0A 4CEDA 3NF8A 3QEVA 3NGZA 4Q45A 3L2VA 8ICVA 1A77A 1TL1A 3F73A 3QEWA 3KK1A 2B21A 4OKEA 1BIZA 2HNDA 3H4DA 3BQ2A 1DTTA 1KDHA 4IQTA 3ISCA 3JYTA 1D8LA 5I42A 1V9PA 2P1JA 4DSEA 4CESA 2F1JA 4FS1A 2G8UA 1XI1A 5CP2A 4LSLA 4HCCA 3IS9A 4GVMA 4RW4A 4KLLA 1IG9A 3VQQA 1SL0A 3CM6A 3C94A 4KLFA 3LZIA 2IOCA 3VQ8A 1WCNA 4CJ5A 3KIOA 1LWFA 4IQVA 1RT1A 2PFPA 3KLFA 2ZTDA 4R8UB 4N41A 4CJKA 9ICTA 2W9MA 2XCAA 1QQCA 4KLDA 4DU1A 4F5PA 3AU2A 5KFQA 4E7LA 1T4GA 4GC7A 1WSIA 3KK2A 1Q8IA 5DGAA 3T1AA 5HROA 2BQRA 3PW5A 2WONA 4CJLA 1Y97A 4F3TA 4DQRA 5CZ1A 3CG7A 4ID5A 1C7YA 2G8KA 4J9OA 5KFHA 3V7LA 2G8HA 3DLRA 1HUOA 1EETA 1SL2A 2AGQA 3ZSQA 5KFCA 3RMCA 1XHXA 2FBTA 2ZJ8A 3AA4A 3QO9A 2BQ3A 3GDXA 4O5CA 5KFPA 1D9FA 1Q9XA 1YVUA 4YXJA 1ZQFA 2JEJA 4CF2A 3M8RA 4DTJA 5HMMA 5KG7A 2BCVA 9ICLA 3H8SA 3ZT0A 4Q5VA 2UVWA 3AVJA 5KFRA 5KFTA 3AUOA 2HHWA 4F2RA 2FBVA 2LSNA 4M2YA 2AJQA 2FBYA 3PY8A 1S0VA 1NKCA 3RJHA 4AHSA 3DMJA 2NRTA 2Z1GA 3DLBA 4ED2A 4F5RA 3NH2A 4XA5A 4O0IA 1RT6A 5DBAA 3ZT1A 2W9BB 1W9HA 1K1QA 3AVMA 1JLEA 3RTVA 3H4BA 3VQEA 3AO3A 4BGDA 2FMQA 4I2GA 9ICUA 1JMSA 3VQ7A 4I2HA 3KJVA 1RCHA 9ICJA 4CJRA 2UVVA 4TURA 1A5VA 2XRIA 3TANA 2BANA 4BDZA 3TAMA 5KFSA 4FZXC 5KFKA 2F8TA 8ICBA 4CE9A 3NGIA 4NCGA 4PHDA 4E0DA 2FLLA 2XY8A 3JPTA 8ICSA 4FLZA 1RBUA 2PY5A 3ZDCA 3S3OA 3I0SA 2JZBB 1EP4A 5J1EA 4KRFA 4UB4A 5IIJA 4I29A 1QE1A 1C1BA 1BVSA 4F2SA 4ELVA 5J2HA 2V9WA 4EYIB 4O0JA 4K8XA 1Z00A 4DSFA 3V7KA 5DQGA 4QZDA 3VQDA 4X5VA 4I2CA 8ICZA 3H8WA 3OSPA 1K6YA 1JLAA 1T8EA 3KLHA 4CERA 1B92A 4B9TA 3NTUA 2H5XA 1HUZA 3MAQA 3QERA 4M0AA 1CXQA 5J0XA 2EHGA 1XHZA 3IM1A 3C1YA 4NLKA 3RB6A 4BWMA 1TFRA 1LB2B 1U49A 4ECVA 3G0ZA 3PX0A 1BHLA 3RJGA 3RAQA 1ZQJA 3M8SA 2HW3A 1CLQA 1JIHA 1VRUA 1RBVA 4IDKA 1SV5A 3HK2A 3PUFA 4KTZA 8ICEA 4I2BA 2B6AA 1JX4A 5K14A 5HP4A 3IRXA 4XQ8A 4UAWA 3B0YA 2PFNA 4ZHRA 4TUSA 2R8IA 4M3UA 2FPKA 3TAFA 4NM2A 3OYJA
chains in the Genus database with same CATH superfamily
2QLTA 4RQNA 1MMNA 2KJWA 3BF1A 2JVRA 1TQLA 2CG4A 3MMAA 1V4SA 3BKUA 1NH7A 4KBIA 3QATA 1U1KA 3ETLA 1HNWJ 3T5KA 5DJBA 4F4WA 2HOIA 3DOMA 4OJ1A 1N2XA 1D8ZA 1NM1A 1ZD2P 5HLFB 4G6VB 4JI7F 3MDCA 3VA0A 2B9EA 4NJ8A 3C28A 3VV2B 4WIIA 1KC8O 3LF0A 1XEZA 8ICXA 1VFJA 1MW7A 5KAKA 4CGHA 4LRBA 4L3KA 4PQUA 2PMZF 5DM7Q 1NKEA 4Y2YA 4YCXA 4ID8A 7ICJA 4B1VA 3I32A 3H42A 5C24B 1WKKA 5J2NA 4GXKA 4DS5A 1ZRMA 3TVZA 5HN0A 3KHGA 3BBCA 4ZP6A 2E5IA 5EHHA 2P51A 1Y5IB 1D5AA 5SUHA 5KTQA 3I0RB 3RMBA 1E4GT 1VJ5A 4NLDA 3KZBA 3MEGB 4JKEA 3IFEA 3BGRA 4FBTA 1MU2B 3BQTA 3HHDA 2KT5A 1R8BA 4DR2F 2DR9A 3CXCR 5KQDA 1J5EK 4Q0BA 1SQKA 3DEEA 1IKXA 1GMUA 2MZ1A 2BKEA 5AM2A 4JV2A 3KFUF 4TQSA 1FD2A 2KIWA 2VDHA 4TU9A 4DZ6A 4PY5A 1RT3A 1HR0F 3UW1A 1TMJA 2YCHA 5K8OA 1T3VA 5ALWA 2CNOB 1VQ6N 1UZDA 4X62J 4DR6J 4C7ZA 1KQKA 4LZGA 4CEFA 2BYCA 3T9ZA 4OHZA 2W24A 2IOFA 3N4MB 4LF8J 4WXWA 5ADXH 3HILA 2QFJA 1V4TA 1LWEB 2QFIA 4A61A 1H2VZ 4RT2A 1R8CA 3T5LA 3LGNA 3MUTP 1JMTA 2QLJB 2EWHA 4ED3A 3CDAA 1NBEB 4IL6U 3OL6A 2MZJA 1B3TA 1HQEB 5F9NA 4ITSA 4OYZA 4BS2A 2ZHOA 5J2CA 4RPYA 3EEQA 4G9BA 3FE1A 1NB7A 3NHGA 4WJ3B 1ZQVA 4GIBA 3EGWB 3V1RA 2GS8A 2HGLA 4DHVA 1I6JA 8ICLA 5AQYA 5F0WA 4QIWD 4FM2A 1BUPA 3K0JA 3HM9A 5KT2A 5LM7E 5BRFA 4IQXA 2H3ZA 5JJBA 1RTJB 4LF7K 2DNZA 4USAA 3S6EA 3EMTA 2BCUA 5CY4A 4K8ZA 1TKZB 4CZIA 1KNZA 5KGWA 2YXLA 3UNYA 4KR0B 4PXBA 2YWKA 1U2VB 5TKYA 2DHGA 4FZNA 2EFGA 4YHHK 2W8KA 2DNRA 3DRRB 2MTLA 3PNCA 1H0HB 4HR2A 3CCUN 3I1YA 1SS6A 3HKZD 4DCJB 1UW9A 5K4LA 3W2WA 1UKUA 2AEMA 4QZIA 4LSLB 2V67A 2YX8A 2V34A 3DXKA 5K8NA 1XO0A 1A5XA 1N5VA 3KOOA 9ICNA 2E9TA 1ZJNA 3I56S 2Q0ZX 1Y64A 1C20A 2YMPA 3HHLA 2N4DA 4OX8A 1L7MA 2R42A 4WCEL 3CJKA 1VSKA 2BKOA 4H4MB 3VQSA 5AE1A 4QZHA 3V4IA 2VA2A 4HYKA 3QEXA 9ICSA 3KK2B 3W7BA 2QEXS 2CDQA 4X2BA 1L8OA 2WONB 9ICAA 4C8LA 3RZAA 3GSDA 1VBZA 5BJRA 4CZLA 1ZQQA 3HKWA 3RH5A 3QFUA 4FWNA 4L76A 3C6HA 2OGUA 1VQKS 2JEFA 2CYYA 2FJ6A 1K5OA 2VDIA 3MHYA 3EXCX 4DOCA 2GGPA 2HWHA 3M1VB 3OLBA 1PILA 1N5YA 3SPYA 4BGBA 5F0XA 2KJ8A 2QKQA 3EPIA 2B56A 4DF4A 2ACMA 2PYJA 1NRKA 1N61A 2F9TA 3Q89A 1YIJS 5KG0A 3IBFB 2YJEA 2OHFA 2F8EX 3NWRA 3G9CA 2V51B 3RRGA 4E89A 1IIPA 5KRTA 3BEXA 4RPXA 4KITB 2DPNA 2BJ1A 2W6LA 4USUA 1IM4A 2F63A 3OW2R 2GLEA 3BSAA 2KFZA 4KH4A 2AQ4A 1JLEB 1UEUA 3ULDA 1X4AA 2HMPA 2IMWP 3PFEA 3KJVB 5KFGA 9ICGA 2GO8A 1KL9A 1OXJA 4FLUA 1BDGA 2H5JB 2LEPA 4OMFG 4PAAA 2BANB 4BE2A 1VYAA 5E26A 3D2NA 4JRQA 1ZQDA 1TL3A 3DLEB 4NCGB 4TY8B 4ZVEA 4ZLNA 4BC3A 2PD1A 1EB0A 3AM9A 4CZEA 3US5A 1I3AA 1NJZA 3ZXWA 2R2TA 4KGVB 3B9JA 4PL8A 3AGRA 2ESEA 5AQSA 1FDAA 2QXLA 3N01A 3MTJA 5JVGQ 3MN9A 1UWBA 5CYQA 2FQQB 4ZH4A 2OPSA 3HF5A 2ACYA 4Z4HA 4QJVA 5HAOA 2AU0A 4JKGB 3MK6A 5E33A 1K8AO 3KLHB 3HXMA 2UUCF 4CF0A 3ENQA 1FEEA 2ZH7A 4KN7A 2XMKA 2UU9J 2C2MB 1RT7B 2BPCA 3GV8B 1TUVA 1HJRA 3T41A 1XNQF 4ZPBA 1SJ4P 2X1GA 4RWWA 3P5TL 1RFQA 4Y2CA 5FLXU 5L1LA 2NLWA 4EBCA 4PWWA 1GTEA 3WKBA 5BPCA 4A8KA 4GW6A 3M2UA 4HT5A 5DM6L 4J9VA 4AM6A 2ZE2A 1U0HA 3ILLA 1AYEA 1FRKA 4K4YA 2EZZA 2XI2A 4HI1A 3C5GA 1RTHA 2ZJ5A 2NXUA 1U1LA 2Y9UA 2GO7A 3AQOA 4JKAA 1NMEB 5K8MA 1RDDA 4ECQA 2R4FA 5AM4A 1OMSA 4R25A 4C8MA 1RDBA 4CEZA 3JQKA 4QIWC 4RBTA 2N3OA 1Q78A 2JRSA 3DM2A 1U47A 2MAXA 1QLNA 3VQ6A 3OXFA 3OGUA 4R64A 5IXUA 3TA1A 3AD9C 3L4IA 3O4WA 2ROGA 1HNVB 3MM8A 2DNGA 5IC6B 1D0EA 2KW4A 4C98A 4M7YA 3KXDA 3BQ0A 3V9UA 5GAHI 3THXA 5DBBA 4NCAA 2H5EA 2E8AA 4EEYA 2MUTA 3KLIA 2KXHA 4LY7A 1XSNA 1X9WA 2GIQA 3D45A 4B3RJ 5IT9Y 2HWTA 1RAJA 4WK1A 4YDDB 3OVAA 4ICLB 4DV1F 3GL1A 1RU2A 1C0TB 1B9FA 4ZVPB 4DTMA 1VAZA 2MKCA 1KRPA 3NAEA 3GE1A 1A6LA 8ICQA 4IKAA 4IO8A 5ALIA 3EVWA 2J9DA 2NSBA 1GLBG 9ICEA 2MQOA 2O8BA 4U9RA 1B22A 4ECRA 2OTLS 1JLGA 2XLJA 2KE7A 5DB7A 1YJVA 3N7PD 3AB4B 3WK7A 4NE9C 3MR5A 4O23A 2N4CA 3WT0A 2Z2ZA 4USHA 5J2JA 4DPUA 3M9MB 3W63A 3K4GA 1YTAA 4FK0A 2DPJA 1ITGA 2WF9A 3GJTB 4FJXA 5KT4A 1X40A 3K2YA 8ICYA 1A76A 4IC9A 5EOYA 2J8AA 5AQHA 5SWMA 4TXSA 4FPRA 3UVJA 3FSXA 3SQ0A 1DZ5A 2IM3A 4NLGA 3WKAA 3VERA 3MEEA 5AZIA 5L1KA 1SVDA 2A42A 2RF2A 5CHIA 2VD3A 2N3LA 2RP5A 2DY4A 2PMWA 1UAXA 3KKFA 2H3EB 4BJQA 1U02A 3W65A 3MCNA 3CCES 3ATVA 4U8YA 3GYGA 1DBDA 3ZT2A 2MY8A 5AKXA 3FZHA 3THWA 2VFSA 3JSRA 2CJ9A 2HS0A 3WQPA 3FGUA 2LQ5A 1HARA 5E3RA 5J2DA 3CEDA 4FDFA 4I2PB 5HQ8A 2K4IA 4CO5A 5KRSA 4R0EA 1X1PA 2NNWA 8ICAA 1LEOA 1JL1A 2KTQA 4QZBA 1R43A 1NEEA 2SXLA 1HBOA 2E1MC 3CPWM 1T3QA 1UA0A 3MD3A 3GTYX 4LVSA 3SCXA 4J9RA 4JI7J 2VWJA 3C6TA 3K0SA 4YR3A 1V3SA 4WCEQ 2M8DB 3BGOP 1NBWA 2FZGB 2F9WA 2WSEC 4O3RA 5HMLA 4UAZA 2W6KA 4C4RA 1VISA 3IA0A 1UW4A 4KLQA 1ZBFA 3PZPA 4IO9Q 4X62K 3ZCMA 1ZXIA 3VQBA 1DFDA 2VPXB 4H5RA 3RJJA 5CYMA 3D0GE 1BA1A 2GQQA 3G6EN 3FUYA 2YQ3A 4PL2A 4I9LA 3QYYA 4LF8K 1RT2B 1ZD5A 3MURP 3VEZA 1CZ9A 3CFOA 2I1QA 4RWXA 4IJNA 3U3YA 5A2QO 1BI4A 1PK1B 3NE6A 3MXMA 4C0OC 1F5AA 1S3XA 4IH6A 2HNZB 1FKOA 2I5JA 2YHXA 3MMBA 3KWIA 2Q36A 4WP9A 3N4QA 2CAJA 1N0UA 4LFBF 4Z6DA 1SAZA 2CQGA 4DR2J 2MZQA 2CQ2A 2PMHA 1X5OA 2D3O1 4CBWA 4GVBA 3GFYA 3V1OA 2FZCB 4ZP8A 1IUJA 2KICA 3I33A 5ALEA 3LTOA 3QB0A 2HHUA 3TUIC 3BS9A 1HR0J 4CHYA 2AJ1A 5IM0A 5GAHP 2Q4TA 1VQ8N 2L48A 3ZETB 3LA0A 3ZC4A 4AYBF 1XSLA 5FROA 2CKWA 2GW8A 3OVSA 3IR7B 2IAJB 5ALSA 1JUDA 1FFSB 3QUCA 1ZJMA 3QLHB 4BREA 5F8IA 1NGCA 1CJUB 4CF8A 1B4SA 2GUPA 3DLGB 3AA3A 4DFKA 2PDAA 1TUYA 5HLFA 2F3NA 1HWLA 1S6OA 3ETMA 1KOOA 3EVOA 2XS2A 5C12A 1SWWA 3NL0A 1EWRA 1JK9B 2X1BA 1DJ0A 5DBCA 1S9GB 5AKLA 1HKCA 9ICKA 3SYZA 3Q23A 2N1RA 4JKCA 4FPAA 2DNOA 3ZEUB 5I42B 4DUZF 2JH1A 4XK8C 3L7OA 4AL7A 1FKAF 2HKEA 1B70B 1N36F 2ZNYA 3DXMA 3RJKA 4YVZA 2RMLA 4CHQA 4BWJA 1JB0C 1U24A 2YKPA 3I0RA 4CJQA 3FQKA 4H5VA 4PKIA 2LP4A 3BZCA 4U6PA 3P5JA 4MF2A 3K1RB 3BF4A 2PBDA 3MEGA 4KLUA 2ZC4A 4FYDA 2MQNA 1MU2A 4JNEA 1VSHA 4BACA 2MKKA 3VGUA 4NM1A 1FWLA 3CE8A 4JI5F 4ETXA 1T02A 3PJXA 2FHJA 3CWJA 4PRFA 4BC2A 1Y88A 4YR0A 1HWIA 4EZ9A 1IJEB 1B9DA 4FLTA 4ID5B 3C1ZA 5L39A 3E2EA 5HANA 5KFJA 3JPNA 5HRRA 1WNSA 5DKWA 2CJYB 3X3UA 4XH1A 2GEMA 2ZJRL 3AO5A 4Z4IA 4UZCA 1HMVB 2E9ZA 3P4UB 1A0PA 1QSSA 1YHQS 1Z1BA 2QWNA 1FDNA 2Y1RI 4IQMA 2W42A 3CFPA 3CCMS 3GV7B 3H3OB 2QWOA 4ELUA 4FF2A 3HBTA 4PHAA 4M3XA 4CHOA 5ALFA 4G3IA 7ICRA 4IFEA 4YY3K 4B9QA 1JNRB 1HQUA 1IKWB 1SKWA 3NEKA 5KFFA 5C25A 1ZM4A 1K44A 2HRYA 2HWIA 2CXYA 3QZ8A 4MK9A 4X4UA 2WB1F 3MEDA 4CJ3A 1Z4UA 5K5MA 3M1YA 1UFWA 1SC3B 2NRHA 2ASPA 2NS1B 2BV3A 3GFKB 2P9KB 4F0MA 2EAMA 4QOTA 4M8LA 1L7NA 2Z4PA 3OYCA 3GZFA 3CB4A 3RMDA 1FJCA 1RTJA 3RAXA 2KZ3A 1TKZA 4RR5A 3D2FA 4NLZA 2VJVA 5AM1A 3OJUA 1CBKA 1U2VA 4CGFA 4HVZA 3V6DB 5BOLA 2MJNA 3PR4A 3DRRA 2HRTA 3CMES 4DV3J 4CD3A 1ZAWA 2HFUA 2HSEB 1OQ3A 3OYLA 4XDDA 4AQYF 1U1PA 2UU9K 3PRVA 3NS1A 3GU0A 3CHWA 2V52B 3W2VA 4QWEA 2VWKA 3SQ2A 4A8EA 3M6XA 1S1XA 3D5MA 1NOMA 4IQWA 4PGXA 2HPUA 2B9XA 3EX7B 3C19A 3M6WA 3E51A 1SPBP 2A1AA 1Z00B 3QBWA 3EDQB 3D0PA 3IDWA 2V8PA 3OFGA 1VHXA 3Q2TC 2OTJS 3TSUA 4Z4CA 1PZNA 3JPSA 1XMQF 2E5GA 1RHJB 1GOCA 3HSJA 4KRWA 4OO1J 2EXUA 2HQFA 4UUXA 2W7AA 3TUPA 1T3NA 4H4MA 1ZQRA 2YY3A 5AK3A 5J2FA 3D0IE 2A6AA 3VTHA 4UOGA 2BUPA 3LH2S 3ZSXA 5LXYA 4Y2AA 5AKIA 1C2PA 4MMOA 2D74B 3ISZA 1EKSA 2Y3YA 3VA3A 4N77A 2CWXA 4Z94A 1ELOA 4OFZA 4DPXA 4ZP9A 2UUCJ 4ZOHC 2XY6A 1N34F 3TRGA 5HRNA 2AWZA 2OZMA 1GX5A 1IM6A 3M1VA 1LCUA 3ZX2A 3PTWA 2YHAA 3IDHA 1L7OA 2DNYA 4K4ZA 1R6VA 4M63C 1Q81O 5DG7A 2Y9HA 2KG5A 4OHVA 1X4GA 5J2BA 4QIEA 1YITS 4R5PB 2JR5A 3PW2A 5C42B 1GOBA 4PABA 3ILJA 1IXRA 1B0XA 4WK3A 1ZXOA 2NYIA 2KJVA 4W90B 4B3RK 4MK7A 1ILYA 1VIXA 3BSOA 2WAQF 2ERRA 3BKFA 3PW4A 1HQ2A 2CVEA 2VCPA 1BXNA 3K5NA 3CCQS 4DOBA 2Q6BA 4DL0C 4I6MA 2OCEA 3IR6B 4PA1A 1N60A 3FVYA 4L8RB 2KSOB 5LMNK 4ED0A 3KHHA 1XR5A 5T14A 2JHEA 5E3CA 1IJJA 4UAYA 2E3TA 1BMQB 1E6YB 2QMUB 5C0YA 5J0OA 3AD8C 3N6LA 4MKVA 3NVWA 4CJEA 4I68A 4Z7YA 1VQPN 4PH5A 4OI1A 2DGUA 4E7KA 1QSYA 3Q8KA 1VQLS 2QWMA 1U7LA 3DLEA 3MABA 4TY8A 1QVFR 4Q44A 4P2XA 1FRIA 3QICA 5F8GA 2RQCA 2ZBIA 4K7QA 1N56A 2F76X 3C66A 2WOMA 2J6SA 5A2QU 4FE3A 1L3TA 3CCSS 4FWQA 2ODGA 2W3SA 4DXLA 3AH6A 2C3UA 2Z56B 4FOEA 1S7IA 5BRDA 2ZIXB 4P74A 2KXNB 4DV1J 5ALMA 4JKGA 1K8AT 2WFAA 4Y2IA 2EC2A 2XMMA 1M5OC 2QM1A 4M94A 4F71A 3NF6A 1WUAA 1BPEA 1RT7A 5EU7A 2IGIA 1WTFA 4FM0A 4ZVOB 2P9UA 4KH6A 4NXMF 4OJOA 2FY8A 2HBZB 4ZIWA 2RHKA 4B6JA 3QEIA 2QKKA 4Q2LA 5LSOA 2RRBA 4CM2A 2CPIA 5BRHA 3QNOA 1GXTA 3R9PA 1LXJA 3G6VA 2DCUB 1F2HA 2VANA 4X4PA 1GMWD 1YI2N 2NPIA 2W9AA 2QK9A 2AXTU 4ECYA 2P5VA 5JXSA 4GFJA 4KH0B 1T05A 3CDEA 2LECA 1KDNA 3BO4A 3A0BU 4DX8H 3GV5B 2HVZA 2DXFA 2C2EA 1XQIA 3R3TA 4JI7K 3SUNA 2RKIB 4X66F 3CJAA 4NMLA 3CJRA 1P9QC 5E79U 1HKBA 2FGCA 4DPYA 4DR7F 2B8PA 3M8PB 3TAQA 4RCHA 4LJXA 1G1XA 2F1IA 3ADAC 1CPZA 3OYNA 1HNVA 4GO7X 1S72N 4CVNE 4JK1A 3NGSA 3HJFA 4RU9A 2MKYA 2LQJA 5D3GB 2NQPA 5ETOA 4RJVA 2YBVA 1SJRA 2M70A 2RQKA 5F8NA 1TKXA 1IN0A 3MM9B 5FDLB 4PKDB 4CGDA 3JSMB 4I67A 3VZHA 1JNZB 2D8CA 4B9MA 5EOZA 2NCKL 2MSNA 4AUKA 1TUUA 3AL0B 2QA4S 2C22A 4CE6A 4CNQA 9ICQA 3C65A 3OL8A 4C11A 5HQMA 4AFFA 3SPZA 3I87A 4LRCA 4OJHA 4DR2K 2O4IA 4ES3A 1RLCL 1KCFA 4ZS6A 3LP0A 2DFLA 5CJ7A 2LXUA 2A1JB 2ZTEA 4ILLA 4YB5A 2G8VA 3NRBA 5KFEA 2LU2A 5KAIU 4YN4A 2GJIA 1EHWA 5EWEA 7FDRA 3ZT3A 5FD1A 4BUGA 4UB8U 1JN3A 5M1KA 2AT1B 1S6UA 2EEYA 1S1WA 1COOA 2DGOA 1HR0K 4PWUA 4LBHA 1LNQA 3R9LA 4N7TA 2EBGA 3PACA 3V2UC 3QE9Y 5GADU 2ZOMA 4QIVA 5EE3A 4IOAQ 2G09A 1RISA 4JUZA 3D2WA 3PR5B 2AF6A 2HLUA 1KW4A 3O44A 5LMUF 4EI2A 2XZDB 4FYYB 3LANA 2W11A 4TLQA 4TYBA 4JI4F 3QX7A 5IT0A 1J6ZA 2K4HA 4ED1A 3HSTB 4CJPA 5GAEI 3H1VX 5D6GA 3HWTA 4YFUA 1YK9A 4ZJOA 1WOOA 3T5JA 4IG3B 2WVDA 1S9EB 4IRCA 2ZFHA 1HHSA 1EJ7L 5ALNA 4LFBJ 3D68A 4H03B 2BRKA 4OJ5A 1HBUB 2OEHA 3HP9A 1RNHA 1T3OA 2UUBF 4QWCA 3KDOA 4RW7B 2E7WA 3NRWA 5H1SV 2NZTA 4JEPA 5B5EU 4TN2A 2CA9A 2K7KA 4J9LA 4FZZA 2A2CA 4KLEA 4Z4FA 1L5UA 1Q46A 4WWSA 2OJ3A 2MQLA 6FDRA 3QSYB 2AX0A 5B0AA 1F5CA 1Z2LA 5AKKA 3D1HA 3HVRA 1YRUA 5AQMA 1GFWB 3OYDA 1PCAA 4KTQA 4G1IA 4DG1B 3RBZA 4RW8B 1FK9A 3TUJC 4F25A 2ZZNA 1Y3KA 4JKHA 1MSWD 3Q8PB 3QIOA 2GTDA 1X31C 2BW7A 1FO1A 1YJ7A 1OPZA 2LDYA 1O13A 1JXBA 4JV0A 2NXCA 1KD1O 3FEYB 4P0PB 2CH5A 4ZA1A 1P27B 3GG4A 3LVWA 1C0UA 1XN9A 3GWCA 3ED5A 3H08A 1NUEA 3SR6A 3CJ8A 1Q5YA 1SH3A 1N88A 3OSNA 5EWGA 2KN7A 1NGEA 3OJSA 1WDTA 2JMGA 4WZMA 2LLZA 1Q3VA 1ED1A 1TV6B 1PK1A 2PO4A 4BRGA 2HMXA 3KUGA 4PWDA 4H0TB 1S1UB 2EKNA 1SKRA 1U26A 4FLYA 3MFHA 4EAHD 2HYIB 1HI8A 4I7FB 4ANDA 4CF9A 4JHDB 5AXMA 3OS2A 4KI6A 3D1OA 3P38A 2BJ9A 4HEA9 1DQAA 1QHTA 3OA9A 3ZO7A 1U04A 1IWGA 2Z2LA 2KL8A 5J0RA 4JI5J 1RHMB 4MEYA 1CZAN 1S12A 2F4VF 4NL9C 2C2DA 1PVRA 4CZKA 4IQUA 4BHQA 4FZVA 4DL3A 1I5OB 3S3NA 4BRIA 3CD0A 2ISOA 1ZM3A 4KHQA 2KVQE 3MM5B 1B64A 4OZ3A 4UT4A 1SV4A 2F7VA 4K2XA 2ALYB 4U8VA 3C15B 1QZ6A 4CZJA 3ZETA 4RUAA 2IIRA 2P9GA 1YF5L 1VQOS 4XH4A 1C0FA 2AGOA 3THVA 1CJVB 3NS7B 3BSNA 5AQPA 3GE9A 1IBCB 4ELTA 1TL4A 4LFAF 3PCOB 4QU7A 5IT9U 3VALA 1KVJA 1IVZA 5KFLA 3TO8A 2FVSA 4M5NA 8ICVA 1VMBA 2WVEA 2PEBA 3F73A 4OYBA 3RW6A 1PKUA 3JAMO 1FERA 4LVOP 2IM2A 3JXUA 5I42A 4OJPA 4RQMA 3CC7N 2F1JA 5ADZA 3CT9A 4FS1A 1FXRA 2HDOA 4ZPAA 1LWCB 4GVMA 4JB8B 1RABB 2DR7A 3AJ1A 1AFJA 3AQFA 3LZIA 3VQ8A 3CJ2A 4CJ5A 3KIOA 1LWFA 2KIVA 2UYTA 3TYTA 4IQVA 3J81j 5LSRA 2ZTDA 2UUCK 1VC6A 4R8UB 3UCGA 2W2MP 4AQYJ 1QQCA 4YOXA 4N8NA 1T4GA 1XNQK 5LL6d 4PKHA 1RDWX 4GC7A 2XG8A 3VGSA 1Z4NA 3MOJB 4HDHA 4OI6A 1PYSB 5J8YC 4ZPCA 2ITMA 3Q7BA 5BYSA 1RHUB 5AFUA 4ID5A 2G8KA 3A8IA 2K1RA 1XMQJ 1HBMB 5DRKA 3UMBA 2E7VA 3V4MA 3M2RB 3W64A 2AGQA 3VENA 3PFOA 5KFCA 5I3PA 2K8CB 2ZJ8A 5A8WA 4O5CA 2ZF5O 4JN4A 2NR0A 1URNA 1QHAA 3IV6A 3NWGA 1SBRA 2XSJB 2YWHA 1SJ3P 3M8RA 5HMMA 2BCVA 3KZXA 3AVJA 3M8YA 2DF4B 2VG5B 3J7A1 1N5SA 1EWQA 3D7EO 2FBVA 2LSNA 3VCBA 3RVCA 3U1LA 2LEBA 1S0VA 5HP1B 2QWPA 3F0NA 3ENWA 3JS6A 4CLLA 5AXKA 1SUQB 4OLOA 4MDBA 3P49B 3KBBA 1RUSA 3AGKA 4PPZA 2BJDA 3ZT1A 3H45C 4ZVHA 4X65F 2Q31A 2I1RA 4BGDA 2FMQA 3QAUA 4I2GA 1JMSA 3VQ7A 1R0AB 1HBNB 5L9NA 4DV0F 4IZ9A 4ZN1A 3CJQA 2ZJQQ 9ICJA 2RRNA 1WOQA 4KV8B 2CFXA 1NMDA 4IFYB 3TANA 2XRIA 4DV1K 3TAMA 2DJWA 3SSQA 4CQ1A 2F8TA 3SD7A 1WC3A 3M2VB 4PHDA 4E0DA 4QPXA 1M90O 4ZCMA 2XY8A 1WEYA 8ICSA 1F3FA 3Q22A 5IWAF 3UDLA 5K20B 3I0SA 4Y3CA 2MGZB 1CSJA 2ROEA 2DYAA 4UB4A 3ATUA 4WKYA 1R8HA 3EDRB 4UTGA 5D0RA 5AQKA 5I3UB 2G13A 4F2SA 3MCOA 2XWXA 4K8XA 1Z00A 4DSFA 5DQGA 2K60A 3H8WA 1JLAA 2H5XA 4LUBA 4OX7A 3KK3B 1CXQA 2ASOA 4KGXB 5AR0A 4TU8A 1XHZA 1RWOB 4NLKA 1FDBA 1X4EA 3RB6A 4DZDA 4BWMA 1VS3A 1ZD3A 3SCKE 4U67Q 5HO4A 3G0ZA 3PX0A 2E1AA 1YJWS 3M8SA 2FJAB 3QGHA 1JIHA 1VRUA 2RU3A 2HSZA 4FWRA 2ADBA 4PHTX 4FWLA 1LKZA 3H0RB 3QDKA 1IG8A 4UAWA 4OI4A 1QTNB 2PFNA 4IH7A 4TUSA 3PYFA 3OXLA 5ETMA 4NM2A 2CPXA 5HBMB 3DYAB 1Q81T 3C6UB 3BQ7A 2GOLA 1DGKN 2IDLA 1VQYA 3B82A 3KD5E 1N33F 2C3OA 2G2OA 3QT5A 3EZOA 3GPAA 3VAIA 2YPYA 4G1PA 2K8GA 1OSCA 5DB6A 1Q95G 2KEYA 4QU6A 1KVAA 3B54A 3LP1B 3MAHA 3R97A 1T6CA 5DB8A 1NNLA 2KNJA 4ZMMA 3NVVA 4RW6B 4FLWA 4RQ4A 3CC4S 1HJOA 2FVQA 4PXCA 4ZVTB 5JLHA 2MKSA 1BOTO 4X66J 2P9IB 1Z6RA 4IEIA 3ENAA 3LDNA 4J8FA 3AVHA 3RSEB 3WKCA 2C28A 3IMXA 2HHTA 5HI7A 3UIQA 3HFZB 2YWFA 1UPPA 4F4KA 3SUPA 4ECZA 3UN5A 3O1BA 1LW0A 1U8SA 3QU5A 4PKGA 3OVNA 4C8KA 1VQ9S 5BOMA 4OZJA 2W55A 3NCPA 4JMUA 4CZFA 3NCIA 2ZVSA 3KMQA 2YKMB 1FRHA 3E9PA 4K4IA 1TMMA 4OLAA 4NASA 4R65A 5D8HB 2B7CB 3O6WA 4M3YA 1KVKA 3ZD8A 8ICGA 4FVCA 3PYDA 3CSKA 4J9PA 4CLZA 1S6QA 4V19J 2RRAA 2ZIXA 1A0OB 4FOIA 4LFBK 3RB4A 2A10A 3E0FA 3H0MB 1Y5NB 2YWEA 3K59A 5AI9A 3RUBL 2E2NA 3SJHA 2YNIB 3CI5A 3UE5A 4PG7A 2WVFA 4PL7A 1F2GA 3MDFA 4M42A 4Z2XA 2OMOA 4E7JA 4RBVA 1BY9A 3T9NA 5AKJA 1NLKL 2B5JB 1H74A 1IBKJ 2PKEA 3QEBZ 3M4XA 3VQ5A 4GKKF 3FZLA 4Q8EA 3C16B 4CH7A 5ALKA 5A8RB 1FFGB 5KT6A 3ONQA 4LF5F 5DDMA 2OYYA 1RWNB 4JI0J 1BQMA 5LMUJ 1HIYA 1X4BA 4RUHA 2CXEA 2HFOA 4JI4J 1BC6A 4WFBL 2Z58B 1X4DA 1N4LA 2FDRA 2BEFA 4DR4J 1MMLA 4EHUA 4P4OA 4Y2MA 4OHYA 3EUB2 2RKIA 4FWKA 1SV0A 1QQNA 4EP4A 2F1FA 4WYBA 3G10A 3SQ4A 3M8PA 1KXPA 3Q8QB 2AZ3A 1WI8A 4OJRA 3TABA 3O5TB 1N6QA 2UUBJ 2HZVA 4M9JA 1FT8A 3DLKB 1OVYA 3CD5A 2ZIVB 2KV2A 2IOFK 4WFYA 4Q7AA 1ZQBA 4M5KA 2W54A 1TL1B 3DXBA 4NI2B 1RAFB 2W8LA 2XI3A 4Q43A 3RH6A 1UEKA 3M30B 1N36K 3MTKA 2B51A 2KYXA 3JYTB 2ZH8A 4LZDA 1U45A 1JKHB 2ZJPL 1N5WA 3SUQA 1D9DA 3TWHA 4LF6J 1X5TA 4O0NA 2DFHA 2NV3A 2FYXA 3IS9B 4IR9A 4EENA 3CC2N 5CEHA 3IG8A 2CGJA 4KHNA 1O08A 2DT9A 3FEZA 3P39A 1PBAA 4X4RA 4O5KA 1ESVA 1KP6A 5FPDA 5HRPA 2CZVC 1UCNA 3NGDA 1QY7A 5SZTA 4CLTA 4F3QA 4JI5K 1NJYA 2A1JA 5B66U 2DKOB 3VVTA 1T0TV 4DR5F 4UOHA 4WE1A 1RT1B 1O1WA 4FXVA 4LRFA 2KFYA 1HKAA 4R63A 1BPXA 3CNQP 4JYAF 1UPMB 2PAVA 4I0WA 4I27A 4CO3A 4B3OA 1Q7YO 1OKJA 3OTBA 1NJXA 3A5LC 2PFFB 3PSTA 2ILZA 2IM1A 4HACA 3MGJA 3T5HA 3IMQJ 5K9FA 5RUBA 3AU6A 2PEHA 5IIIA 1V85A 4DOAA 5L8RC 3OYAA 2CJAA 3L2WA 1RAEB 2JEIA 1YJ9S 5GTHU 2E44A 1EETB 2FJEB 3RJFA 1JXVA 5AQFA 4FVUA 2QT7A 3G82B 4JI3J 4E8UA 4FJ7A 1RHKB 1RT4B 3QIDA 3GBTA 4BQLA 4IG3A 2YH1A 3CD7A 2YB1A 4G1QA 4I69A 4WIQA 7ICFA 1DGJA 3MDAA 3R3LA 1Y3JA 1NZPA 3Q8UA 3FFKB 4NLPA 4K50A 4RW7A 3NS6A 4WTYA 2R3VA 1SJ1A 1HPZA 3H8MA 2J9EA 2B4OA 4FW2A 2OTLN 1Q8LA 1PK3A 3S6JA 3ID6A 5C15A 1RWKB 3NNAA 1ATSA 4UUWA 4DI6A 3CCJS 2E8OA 3BGFA 5EY4A 3DRPB 4ES2A 2HOQA 1RT6B 3QUBA 3J81Y 5ALQA 3IG1A 2O8DA 4DLGA 1UOCA 3ASMA 3CMAS 1IO2A 2BQUA 1ZRNA 2AJ2A 4AQYK 2BJEA 4DB3A 3UM9A 1ZQAA 4RW8A 4LFAJ 2LMIA 1UHUA 5DDPC 3BR9A 4AHTA 2CGKA 4HUEA 3HP6A 2RHSB 4NXNF 2W4DA 4DTUA 3KD3A 3OBWA 1S0OA 2I5HA 2FPHX 2VFUA 2R2RA 2XHBA 3EPGA 4HHJA 2Q1LA 5HMWA 2YHWA 1FFVA 2JFDA 4M5IA 1KD1T 5HR7A 4P0PA 4F26A 1MN7A 3J80O 1XMQK 1U48A 3IAS9 5LY3A 3BO3A 3HRGA 3MR3A 2JV3A 4M5DB 3LM2A 1HI0P 4LRDA 3LUYA 4CIFA 4KPCA 2QB0A 2FGOA 5J2QB 3SBTA 1VI7A 4A46A 1ITPA 4LREA 4IRDA 4A8YA 2PI4A 4I28A 4J2AA 1S57A 2FVCA 4CJVA 4IOCQ 2I0XA 3QIPB 3DRXA 3D3BJ 3VR1A 1KVIA 3ZZPA 3CQYA 5CE3A 2Y0SF 1N34K 1U0SA 4I7FA 4RO0A 2AHOB 3B4MA 2CPHA 7ICLA 3E3XA 1XWLA 4L74A 2KLAA 3SXLA 2D41A 3FC4A 3SUOA 3H5YA 3ZX0A 4Y00A 1MN8A 2UZAA 1JJCB 1UCVA 4IDKB 4PG8A 3EGVA 4Y2RA 1JXEA 4YOUA 3BP8A 3O3GA 1OY6A 3KD1E 5AI0A 4FPBA 4FJKA 3C3LA 3N7RC 2VASA 4FM1A 3WXJA 3T69A 2KHOA 3VAMA 5AQTA 3GFHA 4ILRA 2Q2RA 4W5TA 2V8HA 4JKDA 3JQMA 3MGIA 4ZVQB 1N52B 3C15A 3M8ZA 3QYPA 3LDAA 3N9UC 3TW0A 3MMAB 3E8OA 1AZSA 4B9UA 1BGXT 4W5RA 2XGQA 4NWBA 3L4QA 1IKVA 2C2NA 1EXQA 4PZOA 3K58A 4EK2A 1NSAA 5HNKA 8ICMA 5AM0A 4F72A 4RKUC 2DD8S 3GMGA 2ZVIA 1AXQA 4CFDA 2Y8YA 1NB2A 4I6WA 2MA1A 2OSRA 4N5SA 4CO2A 1F5SA 2MHNA 1NI3A 3BZQA 5CB1A 3LP2B 2AYBA 1F1BB 3UQ2A 4BRLA 3KUHA 4PQUB 1WSEA 2K2PA 1HNXF 3KNAA 5AQXA 2AGPA 1B0TA 1FRXA 1WN7A 5KFAA 2FF3B 1H2UX 2BBEA 1LWCA 2IVFB 4X65J 5J2NB 1KAXA 4L3QA 3TJAA 4N56A 5IC4B 3KHRA 1HLWA 4A5BA 4ZJLA 2CQHA 4CNYA 1YTYA 4DV0J 2KZMA 7ICSA 3QT8A 5KG4A 4CK1A 4AL5A 4AXIA 2EFOA 2HG4A 3GONA 4B8AB 2E6LA 4BE1A 4C2MA 1RQ0A 2YTCA 1CI4A 2Y1LB 3NP5A 4OL8A 3BGRB 4CLPA 4IRKA 3KJFB 4HUFA 5F9LA 3IRUA 3EKSA 4OI2A 4Q0BB 2Y1JA 2JWNA 2ZH5A 3VGLA 5H2FU 3V6JA 3OYIA 2ZDPA 1SZPA 2KQ2A 4EFHA 3W9HA 1X6IA 4L75A 3TTCA 3PKYA 1SB3C 1CULB 3TPQA 2HAIA 1RT3B 4M63A 3I5AA 1HBMA 5IZHA 1NK9A 1DOQA 1YBTA 2O5DA 1KHVA 3M2RA 2Z7JA 1APSA 2DTUA 4KT0C 3C23A 3A13A 3MUMP 1C6VA 4I2JA 3DGVA 2LXFA 4ZCKA 3CF5L 3UI3A 2P9CA 2H54B 4GXJA 1CVJA 4NWIA 2KK0A 1VSDA 4X66K 1S10A 2BA9A 2XSJA 2G2ZA 1KN6A 3HD2A 2J7KA 2LVWA 2W9CB 4WF9Q 3HI9A 4E19A 1RQNA 1XS9D 1IKYA 4UZBA 1P90A 3ZDAA 1HNZJ 2GV9A 4DR7K 1WYGA 1YJTA 4URGA 3TACB 2OLWA 3A8JA 3T6BA 3BR8A 2AMCB 3H5UA 4L72B 3AMZA 5FRNA 4RQ6A 2A6OA 1S79A 4QR2A 1RB0A 1BG3A 3LZJA 2RPIA 1S6PA 3WK4A 2FHKA 1X7VA 4CLYA 1N33J 4USVA 2EZXA 2MQMA 4OJGA 2OEJA 1J2VA 1JCGA 5D46A 4QOZB 3V9ZA 3PMLA 4RT3A 1EKRA 3RR7A 4QIWF 4ACOA 3MCSA 4MIWA 1Q86O 4IFYA 2XMAA 4KN4A 4GV9A 4IS7A 4OIXA 5J0TA 4IOBA 3TVKA 3W2WB 1M90T 4K42A 3UD3P 4ILHA 5FRMA 2H1YA 1YGYA 3CIZA 4DSIA 4I9QA 2NRXA 2YN4A 2UXCF 2EH9A 3HKZF 4ZPWR 1JCFA 3A5MC 2IDEA 4P72A 5H9EJ 4ZPVR 1C4CA 2DRDA 1W26A 1XR6A 3NDKA 2OUGA 3TZXA 3HHLB 1VSEA 3MPVA 3KLEB 2XIDA 2HMIB 1GQEA 3L8BA 1ZD4A 4Z6EA 3RB3A 2WC9A 3M05A 3LPEA 4JI0K 1RTZA 3CJKB 3AOCA 3KK3A 5LMUK 3V4IB 4AHVA 1SL1A 4YMNA 5IT4A 3N28A 4YN3B 4JI4K 2HGNA 2K8BB 4ZCIA 1ZPVA 2N7CA 1YJRA 3J7AP 2DQNB 2E1ZA 4PG4A 1UFLA 3LW5C 3VVUA 2FD2A 2VPYB 4RNHA 5ALZA 2M2BA 2XTJP 3SMVA 3CW2C 4KO0A 2B4PA 4YD2A 2FJXA 2LHTA 2VV5A 4PUOB 8ICUA 1W7WA 2PC6A 5AKGA 1ZQOA 2GGPB 2UUBK 1X3MA 1N5YB 1EQYA 4CEQA 1O51A 4CWBA 1NGDA 3HM8A 5DS7A 1WC1A 1GMVA 3WXIA 4KMUA 3O4QA 1UMJA 5BREA 3QNMA 4B1YB 1PVQA 4C3LA 2OTJN 4MO4A 1PO6A 1SIJA 4B9LA 1SQEA 2ZWHA 2QL9B 2CJQA 1ZQHA 5IOLA 4LF5J 1X2IA 3KKAC 1X6JA 1I94F 2E1YA 3ELHA 3G8QA 3LP1A 1S59A 3AAQA 1F6TA 1RLDA 1F21A 4RW6A 1KLNA 3CYMA 2O8CB 4I2FA 3RU0A 1FXLA 4CYUB 3UR3C 3TFSA 4ENOA 4Y1DA 3RMAA 4EHTA 4UATA 2P9IA 1DT9A 1EO1A 1DTTB 2R7WA 4J2BA 4J9QA 2QA1A 1TTHB 2VJUA 2ALZA 4EMDA 4RW4B 1VSFA 2FLNA 4JAXA 5JLFA 4OZ1A 5AFUH 2E5LF 3MM7B 4UW9A 2DUYA 1W97L 2UVUA 3TSPA 3HJVA 1N54B 3AHPA 3MBYA 1S1TA 3NAHA 4F4AA 2L08A 5F8MA 4IDHA 3C2LA 3DJCA 2W25A 5EX0A 5DM7L 1UWBB 2YKQA 5CYQB 2ZNZA 3DGPA 5HRSA 5AI8A 3IN5A 2K3KA 1ZQIA 1FJGF 1ZQUA 2HS3A 1TK8A 5AQQA 3CCQN 2JZ5A 4JRPA 3CPEA 4KJIA 3H5XA 4HH1A 3SIPB 5ITHA 4DR5J 2AV5A 2F4VK 2JXJA 4CEOA 4JYAJ 5IIOA 2B9YA 4NYPA 4DU8A 1WHVA 3RR8A 3M32A 4NZ7A 5CZVA 4M9NA 2YX6A 4OKKA 2H65B 3O5BA 3M2UB 3FGVA 4QWAA 5J0PA 1N63A 1QVGM 1E6VB 2ZE2B 1U0HB 5A8RA 1VQLN 3Q8SB 1Q7LB 7ICUA 2FJVA 5J2GA 1JXLA 1RTHB 2IRUA 4OPKA 1CLFA 1UJ5A 4Y2UA 5KGXA 2D5RA 2RS2A 1UZHA 5LJ3Y 4C8ZA 4UARA 4DQPA 2E5JA 2PIIA 4LFAK 1K0TA 2V4RA 3CGIA 5AHXA 1SIZA 5D4NA 3ORYA 2QLBB 2G8WA 2RVJA 2HBJA 4X4QA 4H54A 4ICAA 3UMGA 4JI1F 4BDPA 3OTOF 3K75D 2ZUCA 1NNDA 2D0OA 1VQ6S 4NLUA 4CLKA 3DDIA 1T9YA 3DLKA 3VEYA 2R7QA 1B0PA 1KKXA 3W62A 2GHVC 1RGIA 4NI2A 3THXB 3AOAA 2BE7D 1VLBA 1QSLA 2F7TA 1AB8A 1BD6A 3UFCX 2JLEA 5DK5A 1YWXA 2MUTB 1JKHA 5GAEU 2Z2MA 3FFIA 4ZKAA 1J9AA 4NCBA 3D6JA 3WK9A 4UQGA 2GWSA 1BQNA 3MEKA 2AP6A 5E3PA 4JK9A 1NOZA 3TR5A 2G9OA 1OY9A 4NXNJ 5HVFA 5IQQA 2XLKA 3AY0A 5J0WA 3KLVA 2P9SB 1NNEA 3LPUA 2O8BB 1TAQA 2VQEF 2B4VA 3VAFA 1U9LA 2XY5A 1D9AA 4WFXA 1JLGB 4ED4A 2VYPA 2IS3A 4NL9A 3EGNA 4IUFA 2GFFA 4LJMA 2C2ZB 5AIAA 5D49A 1M5HA 3FMBA 1Q7YT 1FXXA 2ZC3A 2DNHA 2KI2A 2OEMA 2I7NA 3NMAA 1AQ6A 1WWUA 1LK5A 2A1RA 2MYFA 4O3QA 3O8WA 3CCUS 1EX4A 4JS4A 3F2CA 5IFMA 2R7OA 3IWLA 1RBAA 2D0PA 4Z4GA 5AJ3F 2RQ5A 3DAWA 1HYZA 3WQUA 3IP4B 4M3RA 2AYMA 4C6AA 3TEGA 3VQAA 2Q66A 2QA4N 4Q2MA 3UVJB 1R89A 5ETVA 2Q43A 1RT4A 2DEIA 5LSLA 5D4LA 1UQVA 1W0HA 3FDSA 3MEEB 5AZIB 3HHKA 2BCRA 4TU7A 7ICMA 1QQMA 2K4PA 2RF2B 5C2GA 1VK8A 4ZVSB 2E1CA 1WC6A 2WBRA 1QAYA 4HH0A 5I9EB 9ICVA 2I2YA 2FDNA 1NK4A 1R0CB 4IKFA 4FO0A 4G65A 4X65K 2HVEA 3K8VA 2BM1A 2F1HA 2A6MA 1OH7A 2EAPA 5IS2A 2VG7B 3THWB 3DRPA 1PJ7A 3OR2A 3L3UA 4DV0K 1AUDA 1ZPWX 8ICTA 2IY5B 2G5HB 5GADI 2RRDA 3FCVA 4W5NA 4FJ9A 3D0HE 1OVQA 2IHMA 5HJXA 5J2PA 2FY1A 4UQTA 1NSPA 2BVZA 4E7HA 4FO6A 1M1HA 5L1JA 1FXDA 1XC3A 2YVSA 4CRJA 2PYLA 1UVLA 3I31A 4IG0B 2CQDA 4DQIA 2GIRA 4JV5F 1T03A 1KQSM 5IWAK 3F5AA 3OPKA 5J2AA 1NO8A 2XVTA 1TK5A 2XM3A 1FKPA 2GC8A 3AVKA 5M1OA 3UN2A 5D78A 3OLAA 2E20A 3CCLN 2HF3A 1ATNA 2GIFA 4X4OA 4KLJA 3H46O 5J8YA 2KFNA 7AT1B 2CQBA 3R5BA 4YR2A 4PZVA 4PCQA 1HNXJ 5E84A 2GBZA 3KVGA 3H8YA 1Z05A 1Y4ZB 4M5DA 4F4ZA 8ICNA 3OR1A 4W5QA 1ZQCA 1YVFA 2XSFA 1S5ZA 4RQ1A 5J2QA 4WFNQ 1ZBUA 3EKUA 2YNHB 1S1VA 1RBTA 1C1CA 1BI4B 3D28A 2P6TA 3ULHA 2X3GA 3M6ZA 2G0JA 2RDJA 3U9ZA 2E2OA 2RJZA 4LBIA 3SV3A 2DGWA 1FKOB 2I5JB 3I4PA 3QIPA 3RRKA 4FJGA 3CJTA 3BDPA 1TKDA 3MF5A 2MQ8A 3R9KA 5KFYA 5JVGL 2VBZA 1ZTWA 1L3SA 3CUNA 2VL1A 4BVOA 3UNGC 2EPIA 5FLXO 2JC0A 4KHUA 4M5LA 2RUGA 1N33K 2A5XA 4USMA 2YB4A 3L7UA 2HZAA 1K73O 1XC9A 3SAGA 4O55A 2V2QA 2HBQB 1T9TA 5AI5A 3IG5A 2I38A 1RG6A 5M1QA 3WKEA 5HMZA 4JS5A 1EARA 5AK4A 3PO4A 3D54A 2ZIWB 5THWA 3MPDA 1O8BA 9ICHA 1Y5LB 2FUG9 1SI9A 4EYHB 1CEZA 2QIFA 1VQMN 1FTCA 3DC2A 1MWKA 4DR1F 5H9EK 1PAUB 3KLGA 3K57A 3RBEA 1IBLF 4WYLA 3TAPA 3C46A 2D0CA 3AO1A 3ZI4A 4YG2A 3GYXB 3LP2A 4ED8A 1K9MO 3A5NC 3P1GA 4BRNA 1H98A 2DIUA 3JQJA 3LWMA 3ZSRA 3HO1A 2VJ5A 2DRBA 1YG0A 3OV7A 2AEJA 1Z19A 1HL6A 4WJBA 5GIOA 8ICKA 4F8RA 3FKBA 2V63A 1T6DA 5J2IA 4H0XB 5MLCV 3WX4A 2NRZA 2JZBA 3EZUA 1KFTA 3DXMB 3U1MA 5BPMA 3VF0B 1RZTA 2A0FB 1KEKA 2ZEJA 4FJLA 1VQON 4UBBA 3PMNA 1VQNS 2X6NA 2OKQA 1X4CA 3QZ7A 3Q83A 2C3PA 1JL2A 5D4BA 4UF4A 2F77X 3PEJA 2BDPA 1TUWA 2EBEA 5CHCB 3LL3A 2H5IB 3EUNA 2U1AA 4Y34A 2DY1A 1P8ZA 2UXCJ 2I8EA 4ZVGA 4F91B 3D6MB 5JTIA 2KVSA 4KTWA 1YRXA 3KZIU 5DDOC 3PLAA 1VK3A 2DNKA 5DDRC 1VQSA 5DG8A 1MDUB 1CULA 1HHTP 4GKKK 4PXEA 3F5TA 1TKTB 2M52A 4LF5K 1M5SA 5JICA 3W5XA 4CHNA 4RNOA 3MDQA 1YZ6A 5KFOA 1X4FA 4E3SA 3H0PA 2QYCA 2HI0A 1QD1A 1UPHA 5GADP 3HT3A 1U8WA 3J81U 3QNNA 3UQ0A 3QINA 2EQYA 3NMRA 2VIXA 2LM4A 5A8KA 2F9JA 1URRA 4HHTA 4LR9A 2W9CA 4FJJA 4J2EA 1HQUB 1M5KC 3HPOA 2MLXA 4BRMA 2XY7A 5C25B 1TL7A 4JP8A 4MT1A 1WSFA 4KHSA 2JGUA 4BG8A 3E58A 1NZAA 2FLOA 3ZDEA 4DS4A 3MEDB 3QAEA 1G99A 4FNIA 1S49A 2LQ9A 3QWUA 1OSDA 4DTPA 1IR1A 3CJ5A 5KFUA 3QJJA 4FFDA 4B9SA 3VQ9A 1RKJA 1TVAA 2BUNA 4QWDA 3NCRA 3NASA 2W43A 4KHPF 4NMXA 2WSFC 4U7BA 3D2FB 2WZ1A 3RG6A 1IV8A 2NSCA 4NOHA 5E41A 1Q86T 2FE9A 3PRDA 4BLGA 1UVKA 3MCAB 4C3KA 2DITA 4I2QA 4DR5K 5GAGU 2ASDA 1OYDA 3MAAA 4N76A 3W2VB 4JWMA 3L3CA 2F8HA 5JS1A 2Y0SC 3LGHA 3EE9A 4C8NA 1CZBA 1S1XB 2ATCB 4JYAK 2ZJAA 3O3LA 4K4GA 2Y8WA 4BRAA 1ASVA 2X74A 1TGOA 1Z2ZA 4QIFA 3KLEA 5LJWA 2HMIA 4EEKA 1IG6A 1I3OB 3ALRA 2E5LJ 2NYHA 3LDQA 2QWQA 2LA4A 1ZBSA 2WVBA 4X4TA 3ZDBA 1RYRA 1HYSB 1VK0A 1IQTA 3UD4P 2PT0A 4O4RA 2RE2A 1K47A 4IO9L 5CHGA 4UAUA 1ZBTA 1ZETA 4I6YA 4DU4A 4CGGA 2HVDA 2MHEA 2GUIA 4FSVA 4N47A 2R7SA 4DTNA 2R7XA 3NFAA 4LF2A 3AVIA 1FJ7A 4B3SF 1Y00A 4PUOA 3I8DA 2ILYA 3PX6A 4H4OB 2XYGB 7ICHA 1WSHA 3G6ES 7FD1A 4DX5A 1SC1B 3Q8MA 3B8AX 5JMNA 2DEJA 1P9YA 1KLMB 4CIOA 3CJSA 3NVMA 4GNIA 4M04A 4C7YA 3L2RA 3OYGA 1TYQB 5ALHA 3V7JA 2LPEA 1RAGB 2QRRA 1RILA 3WEEA 4CEDA 3NF8A 4H4KC 3QEVA 3NGZA 1A77A 2O8CA 1GT8A 2HIQA 2RNEA 4CYUA 4I6MB 3QEWA 3KK1A 2DXDA 2MPUA 5F41A 4X64F 1RTIB 4NXNK 3P45B 2WBMA 3H4DA 3CJBA 1YJWN 1DTTA 1KDHA 4YY3J 2MRLA 4CD1A 1G4CA 1D8LA 9ATCB 1V9PA 3G4SN 3P31A 5GMEA 5E7OB 3I5CA 1CQNA 3O8MA 2QJ3A 3QUQA 4HCCA 4RW4A 1VQ8S 3PHTA 2UUAF 1IG9A 3AJDA 4KBOA 2QL5B 3UDEA 4QR1A 3OVBA 4MKAA 2OD4A 3MM7A 1VLYA 9RUBA 2XZTB 2IOCA 2L9DA 2AYGA 2XB2D 1F5BA 4LFCF 4H0VB 2A19A 1V3RA 4UB6U 2KMDA 3SDEA 3WK5A 1M1KO 3UKRB 3KLFA 1Y9OA 4RLEA 5JRTA 2WOMB 4CJKA 3W3SA 2W9MA 4OZ2A 1MN9A 1RAOA 4F5PA 4YORA 5KFQA 2F44A 1U1QA 4U7UD 2BDUA 2DGZA 5DGAA 2XMTA 4WFZA 1U6BA 3CC4N 4NLBA 1S5LU 1BUXA 3SSRA 2MLZA 4HLBA 1PG5B 5H9FJ 1C7YA 4KH1B 5KFHA 2P9UB 4ZP7A 3DLRA 3W8PA 3O9UA 2RD5C 4XTTA 4JBCA 3O1WA 3ET6A 1SL2A 1V5IB 3RMCA 1XHXA 4DFDA 3GDXA 1SC4B 4DV5F 2QLFB 5KFPA 1D9FA 1N5QA 1RE1B 5ETLA 2E5HA 1E6VA 2M5YA 1YVUA 3ISND 4W92B 5FPMA 4CF2A 5GINA 5HMYA 5EN1A 3H8SA 4C7QA 1T05B 1QJHA 4Q5VA 2UVWA 2FIUA 4TY9A 3AUOA 2XYPB 4ANEA 5AJ3J 2AJQA 2FBYA 3PY8A 2E29A 2CRXA 1NKCA 3DMJA 2NZCA 2FJDB 2M0GB 5FIIA 4ED2A 4XA5A 4O0IA 4R79A 4ZVRB 5DBAA 5ETNA 2BM0A 3TVYA 1M0SA 3A3OB 3RTVA 3A0IX 3WKDA 4USIA 3AO3A 4Y2KA 1HNXK 5D4OA 2FVPA 9ICUA 3HKZC 1F60B 3H2LA 3UDCA 1TKXB 4CJRA 1KBUA 4TURA 2BJ7A 4BR5A 5D77A 2OFHX 3CERA 3CCWA 3P4IA 1SKUB 2HIYA 4FZXC 3AY9A 5B0GA 1WHYA 3UKUA 4CE9A 2W4PA 2FSNA 2NRRA 1RBUA 2PY5A 3ZDCA 2HK3A 4K8RA 4Y2PA 4C11B 1EP4A 4KRFA 2A3JA 2EFPA 3DU6A 4JV5J 3LP0B 4BR0A 3AODA 3CIMA 3VQDA 4P7VA 2D9OA 3N5FA 1K6YA 1MG7A 3T1YF 2P9SA 3L5KA 3FMWA 2E8PA 4B9TA 3NTUA 1SXDA 5LMNJ 4RWTA 4L73A 4M0AA 1S1WB 3W60A 4K5SA 3IM1A 3WU2U 2Q6CA 1OO0B 3C1YA 3VF4A 2DHAA 3NOCA 2MDAA 1TFRA 1Y10A 4ECVA 3QUTA 2J76E 2D3OR 3RAQA 5AQWA 2C3YA 2KRRA 1CLQA 1HNWF 4YUDA 2G0AA 3BKTA 3FAHA 1JALA 3MCMA 3UCZP 5K14A 4LF9F 2BZFA 3B0YA 4K4UA 2YX1A 1O6XA 2EW9A 4BR9A 2R8IA 4M3UA 2VZ9A 2FPKA 1L6NA 2QGFB 2VC1A 1PJ6A 2GVZB 1A6SA 4BR2A 3EO3A 4P0QA 4Y2TA 1H1VA 1W2BM 3EY1A 4ERDA 1L7PA 3KWGA 2MJUA 2B8QA 3GP9A 3K1ZA 2HBYB 4NYZA 1P7DA 3LPYA 5EE0A 1VQ4S 1S9FA 2P66A 3I8BA 4MIBA 4CIEA 3MFIA 3DDHA 5AM5A 1MWZA 4V19S 3CCVS 1ASWA 2VG7A 2QLWA 2Y1IA 1FHTA 5KG3A 2LCWA 4IXCA 4P73A 2VBXA 3MN5A 5DMRA 1P6TA 3HL8A 4C0BA 2LYAA 1UETA 2LKZA 2MXYA 4CZMA 1G7CB 1VQ5S 1FK9B 2YKNA 4L3NA 4O44A 1MA7A 1KQQA 1SV0C 4IG0A 5ALPA 1OIAA 4MYUA 4DQQA 1ZBLA 2DB1A 4CZCA 2ZH2A 2UXCK 4MF8A 4DR1J 4DPTA 1WOSA 2HFSA 3FK4A 2I9SA 4BC7A 2O66A 4CK2A 1CJTB 2GMJA 1IBLJ 2CJXB 3QWPA 1WBBA 1RWPB 3PIPL 5EWFA 2CQCA 1P1LA 3KG1A 1C0UB 1JLCA 3DOLA 4DR6F 2YJFA 2HQGA 4CGJA 1ZQTA 9ICOA 1NKBA 3PIOQ 1SC6A 2CPEA 4CO1A 1FVSA 4NY8A 1NAQA 4FW1A 1RBLA 2RE1A 1HNIA 2IFXA 4NLTA 3QPIA 3CCJN 5TZVA 2VA8A 2YNHA 4JD2B 1BA0A 1C0MA 2GX8A 4USKA 2R8JA 4RG8A 1YJNS 5A0LA 2FJWA 4PWDB 1ATRA 2QTWA 5DO2A 1IJFB 3OXGA 3C2MA 2QV6A 3SEIA 1WHWA 3TZWA 1R7IA 3KYLA 2AJ0A 3TU5A 1FJEB 5CCMA 1F9HA 3ISNC 3CD6N 4OZNA 2ZGZA 5ETTA 4Z6CA 3ZZUA 1VQPS 4OYAA 5AQGA 4X4VA 1JJ2R 2VPZB 2XCPA 3LVVA 4FYWB 3AXMA 3JSBA 4I2IA 2LXIA 2LM1A 1BE4A 1RWUA 4MN4C 4WZQA 3I55N 4CP5A 2XNQA 2HQ3A 3VAGA 1WAFA 3HMJG 1VQ7N 2VQFF 4LSNB 2BR0A 4UB1A 1YKWA 1K73T 3K8WA 4PL1A 5M1NA 3QETA 2YY6A 4M45A 5J0UA 1I94K 4DFJA 4F0KA 2IMOA 3QEPA 4BR4A 3GQCA 4RW9A 2HGMA 2ZIWA 3JTPA 4A62A 3BN7A 4KREA 4CEBA 3QU9A 4DX7A 3DLHA 1TE2A 3Q8VA 3R5DA 1KN5A 3R1HA 1S5JA 4A5AA 2R7UA 3VQ4A 3CPWR 3G2XA 1LQ9A 1KC8T 2AA4A 4CJUA 2J5AA 3OBYA 2BCQA 1RWVB 3JPRA 2UXBF 3WBZA 4URQU 2E5LK 5BYQA 3QFWA 1SGGA 4OYXA 3D6FB 4BRHA 5L1MA 1L8LA 2JC1A 1SXEA 4YOYA 3ZLJA 2NXNA 5I4MA 4DF8A 4KHPJ 3FJ2A 2HHVA 4OI3A 1RXOB 3NF9A 5IIMA 2RQ4A 3E9OA 1LWFB 1FJGK 3L9ZA 1KSPA 4EWTA 2KT2A 5AQJA 4LD0A 3IBWA 5HK4A 2H3VA 4DEZA 7ICIA 3T7ZA 3GG1A 1NDLA 4CI0B 4JI2F 1HEKA 4F4YA 4EX6A 2ZTCA 1UVMA 3B6BA 4FJNA 4EBEA 2DIVA 1DTQA 1XIQA 1ZQPA 2VG6A 4H5NA 3F5EA 1P1TA 2ZKTA 3H59A 2GQ2A 3TJ8A 1U4BA 2K1RB 2LQBA 5DDYA 3V6KA 2R8GA 1CQMA 1TKTA 2I6WA 4CGZA 3ZSZA 4J7CA 4BG9A 1H2TZ 3TTDA 5EE9A 4PQAA 5A8WB 4AHCA 3KKAA 2ZIUA 2GVDB 1D4XA 2BPGA 5HSPA 1J97A 2VKQA 4US9A 1GLFO 3BS7A 1HD0A 4WQ5C 1ZOLA 4IOAL 4FPIA 2ZWPA 4JI1K 4K4TA 3EWAA 1RBSA 3OTOK 5F3ZA 5LT5A 1XUPO 2E88A