1L3SA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*G)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3sA01
5L1LA 4KLFA 4K8ZA 3NH2A 1B22A 4XA5A 2F8TA 2HNYA 4DSJA 2DTUA 3OYFA 3QEPA 2HHSA 4HVJA 3V7KA 8ICKA 4KLSA 3SNNA 3VQDA 4Z6EA 3GIIA 2OPSA 2RKIA 4PHEA 3LALA 4NM2A 3BDPA 1HNVA 3VQ7A 3WNEA 1NK4A 4K4GA 4UB4A 3JYTA 1L3TA 1B43A 1DGSA 1L5UA 5EWEA 3T3FA 4O3OA 2LYHA 5J2PA 4ZTJA 3AVLA 1B9FA 1Z26A 2HMIA 5J1EA 5JS2A 2Q3SA 4R66A 3ZSRA 3I0RA 4FJKA 3CFRA 3PX4A 2DY4A 4CJ5A 3P83D 1J53A 4QZFA 3QZ7A 4CGHA 3CFOA 3VQQA 8ICNA 4I2QA 1N5YA 3HPGA 3U3GA 1WSFA 4CJTA 4CESA 4C8LA 4E1NA 3RR8A 5KFPA 1ZJNA 2J6SA 3HYFA 4TSXA 4GMJB 4Q8FA 4MQ3A 3V6JA 1JXEA 3AVCA 2OZSA 3AUOA 4CJWA 4M6WB 1HRHA 3OYJA 3MBYA 1BPZA 3ISBA 4I2FA 1IKYA 3VQ4A 3OVNA 5HROA 2IC3A 4FJ5A 2HHQA 3AVHA 4Z4FA 1ZQKA 1SKWA 3HX0A 4FZXC 3V1RA 1T3NA 9ICNA 4QW8A 2YHBA 3EZ5A 2HNDA 5KFYA 4AH9A 5DQGA 4I29A 4Y1CA 3ORYA 1COOA 1JLGA 1JLCA 2KN7A 1WSHA 2GUIA 3AVIA 3AO2A 4HUFA 1RCHA 2HHTA 4YXJA 1BPBA 1TGOA 2VA2A 2X6SA 1D9FA 1SV5A 4K8XA 2KFZA 4O0IA 4O5BA 3ZT1A 4KFBA 3CG7A 4GC7A 2R8IA 1BL3A 3ZT0A 3OYDA 1KCFA 3NH1A 5J0OA 4QZIA 3T5HA 2BR0A 4P2HA 3RJFA 5KFXA 4NXZA 2NUBA 2KW4A 3H4DA 1UT8A 4FJIA 3MFHA 4CJVA 4ECXA 4W5TA 1RNHA 5BOLA 4KHYA 3LK9A 2P51A 2DPIA 4N47A 2Y1IA 4CIEA 4O3QA 3IRXA 4DS5A 2D0CA 1S9FA 1K6YA 4YMMA 5DG9A 3PX6A 4J9QA 5KRTA 4B3OA 4UAYA 4CJSA 3V9WA 3MDAA 4RW9A 1IO2A 4DS4A 1ZQOA 2VG7A 5KFLA 1JL2A 2OPPA 3MECA 4B8AB 4FJJA 1VK0A 3LP3A 4JRQA 4W5NA 3GV5B 9ICWA 4RT2A 1NJZA 3MDCA 1X9SA 1BPDA 4CHZA 1Z00B 1LWCA 3ZSZA 3MFIA 7ICUA 3KLHA 5IIMA 3FDSA 3TAQA 1ZQNA 9ICTA 3WNFA 4RT3A 5CHGA 4ED2A 4CJQA 3ETLA 4CF1A 4I2CA 4CK2A 2RF2A 3KIOA 1UA1A 4CEBA 2W8LA 3QERA 2BPFA 2XY6A 1FKOA 4YD1A 3ALYA 3DYAA 3DLBA 5KFHA 3AVFA 2QKBA 4KLUA 2V4RA 1K1QA 5J2BA 1ZQVA 4PWDA 4QZCA 3AVAA 4M47A 1NOZA 2YKNA 3LANA 2FLNA 3HL8A 4UAZA 3WNGA 4DTPA 1CUKA 3VQCA 4KB1A 1BQMA 1RT2A 5J2KA 3LWMA 4HCBA 4F5RA 2IOCA 4OGEA 2Z1HA 3S3OA 3RB3A 3QE9Y 1VSIA 8ICAA 3C23A 4KHQA 2BCUA 2O4IA 1ZBUA 4CHYA 2BQUA 2X6NA 4NCAA 3NBPA 2HHWA 3OS2A 3OGUA 4FLXA 1D8YA 2FPLA 4XIUA 3VQBA 4ZHRA 4UB2A 1BQNA 4YVZA 4DF8A 3RMDA 3PR4A 7ICFA 1VRUA 4KLMA 5J2JA 3SQ2A 3LWLA 3DLRA 3PR5B 2IHMA 2KFNA 4DLEA 3C2KA 3D0PA 4JUZA 1RT3A 3BJYA 4Z6CA 3KK2A 3QEIA 3SV4A 4F50A 1IH7A 9ICGA 4DSLA 4RPYA 5DB6A 2FMQA 4KLLA 4FBTA 1EXQA 3QINA 3PY8A 1ZQEA 5KFGA 3RB4A 3OYLA 3PO4A 1S6QA 3DRSA 3V9UA 3TAFA 1BISA 3QETA 9ICKA 3ZSYA 1HNIA 3PV8A 3LZIA 3S3NA 2BPCA 2A1SA 3ZDAA 4DU4A 3QO9A 5KT4A 3KHLA 3IHQB 1RDDA 1RYRA 9ICUA 8ICMA 3TARA 4YR0A 5DGAA 2XY7A 5KFSA 4DU3A 4EP5A 8ICGA 4DQIA 4HYKA 4M3WA 3K59A 4OKEA 5HMLA 2PFPA 4AHUA 4CJFA 3MXMA 3JSMA 3U3YA 4IQUA 3JPTA 4I2BA 4F4XA 1NK7A 3EY1A 2NRXA 4TUPA 4ICLA 4UBCA 4PHAA 1GOBA 1JMSA 3KJVA 1ZQIA 1S0VA 4DSEA 3NTUA 1Y88A 1T8EA 4ID1A 2BQ3A 2F1JA 3MGIA 3HPHA 3ASMA 4IKFA 4M3XA 4FJ9A 1RBSA 5CR0A 2IAJA 4IR1A 3NF7A 5DKWA 2BCSA 3V72A 4YMOA 3NGYA 4DMNA 7ICRA 4RQ8A 2KQ2A 3LPUA 3PW4A 4F4KA 4ECRA 4OKKA 2A1JB 2ZUBA 4G3IA 2VWKA 3O4QA 4MFBA 3SQ1A 4NYFA 1ASUA 3AO4A 4MFCA 2ISPA 2V4QA 2F8SA 5L1KA 1TV6A 2XC9A 4DTJA 2GV9A 4FLTA 3SUNA 4M3RA 3MR2A 1WAJA 2ZUDA 1S1XA 1X2IA 5J0SA 1S1WA 2NRWA 4YQWA 3ZSOA 4DSIA 1TK0A 3D45A 4KLTA 2GBZA 4M6WA 4N56A 3GIKA 3SI8A 4KV8A 2IA6A 1JL1A 2KTQA 3WNHA 4RNOA 3K5OA 3ZDCA 3RTVA 3NGZA 3UXOA 3BQ2A 1ZQCA 2OYQA 4KREA 3KHGA 3LP2A 1FKPA 3O3GA 1NJYA 3H8SA 3RWUA 4GW6A 1G15A 4FLWA 1QSSA 1IKXA 1L3SA 1UT5A 5HHHA 4CEOA 1LW0A 1QTMA 2ITGA 3TFRA 4QZAA 3EPGA 7ICVA 5EOZA 3L2VA 5J2AA 4M3TA 3MEGA 7ICQA 1XSPA 2IHNA 4JV2A 3KK1A 2KZ3A 1FXXA 4MF8A 4F2RA 8ICSA 1ZJMA 4J9SA 5F9LA 2BHNA 2Z1IA 1LAVA 2NRTA 5J0YA 3SZ2A 1RBUA 4RQ4A 2VG5A 2XRIA 2FBVA 4J9PA 4F5PA 4R5PA 4GXJA 4ECTA 3PMLA 4Q44A 5KFJA 1CXQA 1ZQZA 1S76D 1ZQXA 4MFAA 3IM1A 2ATLA 3DOKA 3GIMA 3T5KA 5I3UA 4O3NA 2ZQBA 3AA3A 5C24A 2DFHA 3V4IA 4B9LA 5J0XA 1NJXA 3VQ9A 7ICSA 3RH4A 3TAGA 4O5EA 3C2MA 2W42A 9ICHA 3HM9A 4QOZB 4CJPA 1RTHA 3ISDA 4UAWA 2G8VA 4QWBA 1HMVA 5KI6A 3SPYA 1Z00A 1ZQUA 5D49A 3JPQA 1U9LA 1ZQFA 1MSWD 3PUFA 3JPOA 5HP4A 4CEEA 4YNQA 2Y1JA 3RAQA 3DRPA 4B8CA 3SCXA 1YTAA 4CF9A 3AVJA 3OY9A 3DLKA 3RJKA 4TQRA 5CB1A 5J2GA 4M9LA 2AQ4A 4BE0A 5L1IA 4NLNA 3C5FA 4ELUA 4H8KA 3VA0A 3PMNA 4DOCA 4DL6A 3QEBZ 2ISOA 1NOYA 1S1TA 4FCYA 3M8PA 3QEWA 2AGQA 2Z1JA 2G8KA 4N76A 4Z4HA 4UB5A 4FLVA 4C8NA 1C0UA 5KRSA 3MR6A 3ITHA 3QESA 4M9HA 2VA8A 2KZMA 3GIJA 1S1UA 3AVNA 4DSKA 4KPYA 1S0NA 3RMCA 2FPMA 3I0SA 1JLQA 3T5LA 5KG0A 2DFFA 4J9KA 2NRVA 3C5GA 4AHSA 5BOMA 3NAEA 4RW6A 3G10A 1RT5A 4OVLA 2XGPA 1A77A 3T19A 4GLXA 1CZ9A 1RBVA 4FZYA 3TABA 4E0DA 1UAXA 1ZQPA 9ICIA 4O3SA 3OS0A 1LWFA 3AO3A 4J9RA 4DFPA 5KFUA 3C2LA 4FM0A 2IDOA 1ZQTA 5DQHA 3I8DA 4FM2A 1TFRA 2EHGA 2P5GA 2YNFA 4M3ZA 2BGWA 5SWMA 4CK3A 3L2QA 4FXDA 4CEAA 1TL1A 4DEZA 1JLFA 4CJKA 7ICTA 1KTQA 4Q8EA 1W9HA 4FBUA 3QEXA 1C1BA 4ECZA 3S9HA 3HW8A 4FK0A 3HWTA 4K4HA 1ZQAA 3KLEA 3DLEA 4FO6A 2XCAA 2ZTDA 3GV8B 4M41A 3H8WA 4KLGA 1C1CA 3CFPA 3ZD9A 4BXOA 4YFUA 4IFVA 4ED1A 4FS1A 2HHVA 2YNHA 4YR2A 3L8BA 1JX4A 2E6MA 1NJWA 2BDPA 4DOBA 2ASDA 2IS3A 2ZUCA 2Q0ZX 4RG8A 4CK1A 9ICEA 4HCCA 2P6RA 2C2EA 4AHVA 2ASJA 2UVRA 1RPLA 4ELTA 1VSEA 4H4OA 5HRPA 2H5XA 1NOMA 2NRZA 4J2AA 1BVSA 2PXIA 1XC9A 1C7YA 4F5OA 2F1IA 3PW5A 5T7BA 5KFEA 4YR3A 5KFCA 3ZDBA 5CYMA 1D9DA 4NCGA 2A1JA 4XUSA 2J6UA 4I2IA 4JLHA 1S0MA 4YFKA 2ZTEA 4F4ZA 4Z6FA 7ICKA 3MEDA 4EP4A 4ED3A 1ITGA 1KFSA 2W9BA 4LSNA 1HJPA 4W5RA 4DL3A 1KEJA 3OYIA 4F3OA 4BE2A 5D46A 3EW9A 1S10A 1QSLA 3DI6A 3NH0A 1KVCA 2YNGA 2D0BA 4JV1A 3Q8LA 1NK9A 4O9MA 1HQUA 1VSHA 1IG9A 2J6TA 3OYBA 5CA7A 1U47A 4UBBA 3L3UA 1EXNA 4RQ6A 1AROP 5KT2A 4QWEA 3B0XA 3LP0A 1KVBA 1A5VA 4KLHA 4J9NA 5I42A 9ICRA 3HP9A 5JUMA 4J9OA 3HVRA 2GWSA 3IG1A 5J0TA 4UQGA 4IR9A 1S0OA 4O0JA 8ICVA 2YHAA 4FJLA 4AILC 3V7JA 5CP2A 4P4OA 2C28A 3NDKA 3V9XA 4PHPA 1HPZA 3HPOA 1TKDA 4CEDA 3ZSVA 3OS1A 9ICBA 4M3YA 4YD2A 4I2JA 8ICTA 4KLDA 3V9ZA 4KLJA 7ICMA 4LH4A 4LSLA 1ZQWA 4O55A 1U45A 4AHCA 3FFIA 4ED7A 8ICFA 3ISCA 5SZTA 3LZJA 1NKBA 3C6UA 3VQ8A 4DTNA 4B9UA 1GOAA 2D0AA 3KTQA 9ICQA 1LB2B 1DOQA 4PY5A 5CZ1A 4IRDA 4KB0A 2LSNA 1JKHA 2FBYA 3K2PA 4RQ0A 4KHSA 3AO1A 3AA5X 1RDAA 5KGWA 4O4GA 1VSKA 3CM6A 4QZ8A 4M9JA 4FS2A 4CJUA 4N41A 3KLIA 9ICPA 1RDCA 3A2FA 3RJJA 7ICJA 3C95A 4ZH4A 3SV3A 2JEGA 4DFJA 3H7IA 5KFTA 3PW2A 4FLYA 4NY8A 1ZBLA 5IIOA 4DL2A 2FMPA 1R0AA 1A5XA 1RT1A 4KTWA 1WNSA 3O3HA 2IMWP 8ICCA 3QNOA 3RRHA 3GQCA 3MR3A 4JRPA 2IBKA 1VRTA 3ZD8A 3HK2A 4PGQA 3ZCMA 4PGYA 1QSYA 1K1SA 3HP6A 4O3RA 5DDYA 2ETJA 4OGCA 3OYKA 2HNZA 4DLGA 3RR7A 3M9OB 1LW2A 7ICEA 3M8SA 3N4MB 1ZQRA 4DL7A 1ASWA 1CZBA 4TUSA 5J2IA 1QE1A 3F9KA 4BDZA 5E41A 4RNMA 4BXOB 2G8FA 4DO9A 3ZDDA 3L2RA 1L3UA 5KFBA 4KI4A 3K58A 3CQ8A 3KLGA 4YXMA 2B4JA 4M9NA 1TKZA 1MQ2A 2B21A 3VA3A 5DDMA 3UQ2A 4C8OA 2B6AA 2B5JA 4YN4A 4CEFA 4DTSA 3GILA 4PGXA 2RDIA 5J0PA 4CE9A 4KITB 5HNKA 4I2HA 5HRNA 4KKOA 4IRKA 4M45A 3VQPA 1T03A 2I5JA 2FPKA 2W9AA 4DTRA 4I2GA 2VANA 4HUEA 5DQIA 4CJ3A 5KG1A 4DFMA 3O4NA 5JS1A 1YVUA 3OJUA 4UB3A 4KRFA 5J2EA 1JLAA 1H38A 1XWLA 4DTXA 4F91B 3MEEA 4LZGA 1WN7A 2M9NA 3T5JA 8ICIA 4QW9A 1REVA 4ED6A 4NLZA 1S9GA 1CEZA 4AHTA 2BCRA 4E7JA 3B0YA 5J2CA 3BQTA 3LPTA 5DGBA 4R8UA 4LH5A 4NLKA 2W9BB 3ZDEA 4KN7A 2PI5A 1BPEA 2D5RA 1RYSA 1TKXA 3V6DA 5DBAA 3Q8MA 1B9DA 3TAPA 1VSFA 4UB1A 1S77D 4BGDA 2DFEA 5KFNA 5D4BA 4E7HA 3PW0A 4O3PA 3V6HA 4G1QA 5HLFA 2HVHA 1B92A 1DTTA 2AJQA 3KD1E 4MFFA 1HYZA 1IM4A 4DQRA 5HP1A 5HMMA 4IQTA 4OJRA 4R63A 3RMAA 2BKEA 4YG2A 3M9MB 2Z1GA 4WE1A 3V9SA 1S6PA 1HYVA 3V7LA 4XQ8A 1RT7A 1TK8A 1ZQGA 5HBMA 2W9MA 2UVWA 4GVMA 7ICOA 3ZT2A 4PPXA 1ZBFA 4CF2A 3G6YA 1CXUA 3ZSXA 2JEIA 4J9LA 4JS5A 4OPKA 5KG4A 4J2DA 4Z6DA 1S5JA 4ED8A 1XS9D 1C0MA 4QAGA 5L9XA 2BPGA 1ZQYA 4RUCA 4CGIA 3G0ZA 4R65A 1RT6A 3OHBA 5IILA 4DF4A 4M42A 4ECYA 3JPPA 3RBEA 4F4YA 4K4IA 1KRPA 3ZT3A 3RJEA 5J2MA 4RW4A 5KFAA 1Z3EB 1XHXA 5DG8A 5HRSA 3B6PA 4QZDA 3QLHA 4FM1A 3L3VA 3OYMA 5KGXA 2UVVA 5KFDA 3E01A 4QZEA 2ZD1A 4E7KA 4F8RA 1ZYQA 8ICOA 3UXPA 4C8MA 3G6XA 3O3FA 1Z25A 5KG5A 3NGDA 1HYSA 3DM2A 2AQ0A 4B08A 4L8RB 3KLFA 9ICOA 1YT3A 1KSPA 1XSNA 1BIZA 5KFMA 5HRRA 2MAXA 3HSTB 8ICXA 2OWOA 3OYNA 1F21A 2RPIA 1I3AA 1S1VA 4CHPA 2W8KA 4BE1A 3V1QA 3NF8A 2VG6A 4Z4GA 7ICPA 2R8GA 5J0WA 3C6TA 1QHTA 8ICWA 4B9MA 1SZPA 1BI4B 3ZT4A 5J2QA 4RQ2A 5CY4A 2HVIA 4F5QA 8ICJA 7ICLA 3ZSWA 4XRHA 2EX3A 4QWCA 4JS4A 2C2DA 4X5VA 5KFRA 1KDHA 4GC6A 1ZQQA 4PH5A 4E3SA 9ICXA 4ECWA 1LV5A 5IIKA 3HT3A 4F4WA 1BIUA 1S97A 1IKVA 4I2PA 1ZBIA 4JK1A 4ELVA 3G6VA 2X78A 4PA1A 7ICNA 4ECQA 4DWIA 3K5LA 3DMJA 5DBBA 3OYHA 4Q43A 1ZQJA 1U4BA 5J2NA 5EWFA 5IIIA 1JN3A 9ICFA 1RTIA 2JLEA 1WSEA 1WCNA 3GFKB 5DG7A 5KFQA 3M8RA 1QQCA 1NK5A 2VA3A 2F1HA 3JPRA 3KHRA 4CCHA 4BDYA 4H4MA 3HJFA 4PUOA 4QZHA 3MXJA 3H40A 2IGIA 3F73A 1XO1A 4RQ7A 3QEVA 4FYDA 4RPZA 4LY7A 1T05A 3AU6A 3HXMA 5K14A 3N97B 5DMRA 2PZSA 2UVUA 2P6UA 2BGGA 2BQRA 4I2EA 9ICAA 2PYLA 5KFOA 2XY5A 2HW3A 4ID5A 3KK3A 1NKEA 2ZJ8A 5KG3A 3GV7B 1VSMA 1JXLA 3UXNA 4LD0A 5DB7A 4B9NA 3RH6A 3MAQA 4R8UB 4DU1A 5EWGA 3RH5A 3TI0A 3E2EA 3SJJA 4N5SA 4CEZA 1FK9A 5KG2A 4BWJA 3EPIA 1HJRA 3AVGA 5KG7A 1KVAA 1GOCA 8ICRA 2JGUA 4QZBA 5BPCA 3ULDA 3THVA 2X74A 2XCPA 2ALZA 4CEQA 3HVTA 1EETA 3EWAA 1TL3A 4Z0UA 4FJMA 4RW8A 2P1JA 2ZE2A 3TR8A 2P66A 5L1JA 1WSJA 4O44A 1I39A 1SL1A 4IRCA 4KO0A 4YMNA 2WTFA 2OZMA 1TK5A 1ZQDA 4KTQA 3LP1A 3TFSA 2OPRA 4CGJA 2I9GA 3TANA 2DPJA 1JIHA 5J0UA 1WAFA 2AU0A 3MABA 2PI4A 4I7FA 2BCQA 4DTOA 4FJHA 4Z4IA 3DOLA 3RRGA 3AA4A 3VQEA 4FK4A 5J2HA 2C22A 3LAMA 3UQ0A 3SQ0A 4KMUA 3SQ4A 3VQ5A 5F9NA 4CJLA 3KHHA 3MR5A 8ICEA 3NHGA 1BGXT 2PFQA 3SI6A 1WLJA 4KHWA 3VN5A 2FBTA 4I2AA 3C21A 1LAWA 1A76A 2E6LA 1WCLA 3CM5A 4MF2A 2FLLA 3QIOA 1SUQA 1IKWA 4KTZA 3BQ1A 3RJHA 5FDLA 3NF6A 4CFAA 3KKSA 4IG3A 3AO5A 1L3VA 4CFBA 1NK6A 5KT6A 3Q8KA 4F2SA 5DB8A 1ZBHA 4OLAA 3L2WA 4TURA 3PVXA 3QEAZ 2RDJA 3IS9A 3BGRA 3OHAA 4FJ7A 4PQUA 1YTUA 3FYHA 4LZDA 1C0TA 2MUTB 4NLGA 2G8UA 4MEXA 3P5JA 2A1RA 4CHQA 3VQAA 2ZTCA 2HHUA 1Y97A 1J54A 1UOCA 2QKKA 4M2YA 3QIPA 3K75D 2FLPA 3DLGA 2WONA 1BHLA 3LAKA 4DL4A 1UA0A 4EEYA 1C1AA 1J5OA 4Q0BA 1W0HA 1ZQLA 4TQSA 4CERA 2AGPA 4JV0A 4AHRA 4KLIA 4HHTA 3OYCA 3AV9A 2VWJA 3JPNA 1XI1A 3PW7A 5HHIA 5KFFA 4FJNA 2ASLA 3EYZA 4CFDA 2G8WA 3NE6A 2W9CA 4CHOA 3AVMA 4I9QA 4DQSA 1RBRA 3V1OA 2JZBB 2E4LA 4Z4CA 4CFCA 1JLEA 4RUAA 1O1WA 4CIGA 4Y1DA 3Q8PB 5C5JA 1IXRA 1U04A 5IINA 4DQPA 4Q45A 4E89A 1BCOA 4B9SA 4RNNA 1WSGA 3RMBA 4FJXA 3IAYA 9ICVA 2XO7A 3OYGA 4CIFA 2OA8A 4IFYA 4RQ3A 3L2UA 4I9LA 1N56A 1JLBA 2AGOA 4OKJA 1WSIA 4FW1A 4J2BA 2DFLA 4Q5VA 1TVAA 4CJ4A 3H8JA 3VQ6A 1ZQBA 3MXIA 1ZQMA 1XSLA 1N48A 4IBNA 4J2EA 3NGIA 5FROA 1BI4A 4B9TA 3K57A 4QZ9A 4EBCA 4KHNA 1SKSA 4KI6A 4RQ1A 3BQ0A 4B9VA 1TVRA 3M9NB 3AA2A 1T4GA 3V81A 4P4PA 5CZ2A 5J0RA 4KLOA 3LDSA 4DTUA 1MQ3A 3QNNA 5C42A 2HHXA 3U6FA 1DTQA 1ZQHA 5C25A 1Q9XA 4I2DA 9ICCA 2RN2A 2YV0X 4ECSA 4FLZA 4BWMA 1V9PA 4EBDA 9ICLA 4RU9A 4DFKA 1HQEA 2HB5A 5DK5A 1DLOA 4DTMA 3CYMA 4W5OA 1KLNA 4E7IA 3Q8SB 4CGGA 4HUGA 8ICHA 1Q8IA 1UWBA 4DOAA 3PNCA 2XGQA 1J9AA 1NK0A 5FRNA 4FZZA 5CWRA 3Q8RB 2XHBA 4EZ6A 3NCIA 2PY5A 3OSNA 3OJSA 2YKMA 5KT7A 3SUPA 2OPQA 2G8HA 2O4GA 1D8LA 1LWEA 4M0AA 8ICQA 3GDXA 2P5OA 2F96A 3LDAA 4ECVA 3V6KA 1XHZA 4QWAA 3QZ8A 1RBTA 4F3TA 4NM1A 2ZJAA 4KLQA 5IIJA 3OSPA 1RXWA 3UPQA 4BDPA 4O5KA 4CJRA 4LVSA 4W5QA 4OLBA 4FJ8A 5EU7A 2YNIA 3JPSA 3K5MA 1ZETA 1Q9YA 2R8HA 1HUZA 5J2DA 1VSJA 1CLQA 3H08A 4ZTFA 3RB0A 5CYQA 3Q8QB 3TQ1A 1U48A 3K5NA 4F93B 4DG1A 4KN4A 1KFDA 3PO5A 3KD5E 3DRRA 3SUOA 3M8QA 3SPZA 2FMSA 1NK8A 8ICPA 4QZGA 3P1GA 5TZVA 4ED0A 3TAEA 4GXIA 5J2FA 4ECUA 4YCXA 1ASVA 4QWDA 1TAQA 1RZTA 1ZQSA 7ICIA 1EKEA 3S3MA 3C1ZA 4RZRA 4EYIB 1X9MA 1BCMA 1RILA 1RDBA 2BANA 4FVMA 4IQVA 5KFZA 5D3GA 3RAXA 5DB9A 3NF9A 1PZNA 3K4GA 4NCBA 3MGHA 3PX0A 1D5AA 4KHUA 2KZZA 5KFVA 1T7PA 4CJEA 2ZJ5A 4DQQA 8ICBA 2PFOA 3SYZA 1HUOA 1RTDA 1A5WA 2WOMA 4F5NA 1X1PA 2PFNA 4QCLA 2R7YA 4P4MA 4JWNA 1RT4A 1TAUA 2C2RA 4IQWA 3AU2A 4OPJA 2BCVA 8ICUA 4F92B 4E1MA 3SUQA 3ISNC 9ICSA 1RTJA 3RJIA 1VSDA 4TUQA 1TKTA 4EBEA 4I27A 3TAMA 3OYEA 1N6QA 3AVKA 2R8JA 4MEYA 4CGFA 4DL5A 1KFTA 1MC8A 2I1QA 9ICMA 2W9CB 2FC0A 1BPXA 3B6OA 3C94A 3TWHA 2QK9A 4E7LA 5CJ7A 4KLEA 7ICGA 3OYAA 4C8KA 4IG0A 2BE2A 7ICHA 4CGDA 2JEFA 4RPXA 3C1YA 4FW2A 4GXKA 4JWMA 5DBCA 4CECA 1SL2A 3NFAA 4J9MA 2FBXA 8ICYA 3T1AA 2XY8A 1MU2A 2G8IA 3RJGA 8ICLA 4Z4EA 3HO1A 4RW7A 4RQ5A 4R64A 2MUTA 2QXFA 1KLMA 3UIQA 1QS4A 4DSFA 4EZ9A 5DLFA 5J0QA 4M3UA 5KFWA 1U49A 1SL0A 3AVBA 1NKCA 1EX4A 3KKRA 1C6VA 1S9EA 3RBDA 4M04A 4HTUA 4KAZA 5DLGA 1RXVA 1EP4A 4FJGA 4NYNA 4E19A 4O5CA 2JEJA 4PHDA 5KG6A 3ZSQA 2V9WA 5KFKA 5KT3A 1SKRA 1QLNA 4CHNA 4CF0A 9ICJA 5KTQA 5J29A 1BPYA 1TV9A 3RB6A 1VSLA 4CF8A 4BACA 4IDKA 5FRMA 4EYHB 2R8KA 1XU4A 4FK2A 5KFIA 4YP3A 2JZBA 2ATQA 8ICZA 3H4BA 1X9WA 5KT5A 4I28A 4M9GA 3DLHA 4FLUA 2PYJA 1JXBA
chains in the Genus database with same CATH superfamily
1FRKA 1QJHA 1B22A 4MKBA 2W11A 2HNYA 3OYFA 1N52B 3QEPA 2HHSA 3I32A 8ICKA 3PYEA 5LMUK 1BY9A 3FAHA 4DX7A 4PYAA 3CCES 2MZJA 4ICLB 3W9IA 3LALA 1RAJA 1HNVA 3VQ7A 2ZM6F 3RZAA 5AKEA 3THPA 2BJDA 2M8DB 4KQZA 4ZDNA 4GNIA 5EWEA 3WC2A 2MJNA 4O3OA 1Q3UA 3Q0AA 2E88A 2LYHA 3ILOA 5EUHA 3AVLA 1Z26A 1HBMA 2HMIA 3PFOA 3ULEB 4B3RJ 3T1HF 1IJJA 1PJ7A 1ZPVA 3ZSRA 4DG1B 4FJKA 1U2CA 2ZWHA 4A8XA 3P83D 2RQ4A 3QZ7A 3VQQA 4MFBB 5AQJA 2VV5A 3TZWA 1FA0A 5A8KB 3Q8VA 4DV2F 1T02A 5ETVA 4C8LA 2HSTA 2J6SA 2CJKA 2VU5A 3C7NA 1FFUA 4TSXA 1PJ6A 2V6AA 1J5EJ 2C3MA 5C10A 4ZLPA 3UR0A 2H5EA 1LNQA 3LA0A 4C23A 1VQ6N 4LRDA 1NGJA 1BPZA 4KV8B 5AZJA 1NLVA 4BC3A 5CRXA 4TYBA 5HROA 4NX9A 4DKWA 1IBMJ 1D09B 1RWVB 1BXNA 1SXDA 3C29A 2I0XA 3CPWR 2YPYA 2ZFHA 3LP2B 1RJJA 4FOEA 1FKPB 3EZ5A 2HNDA 5KFYA 4AH9A 5DQGA 3ORYA 4XDCA 4LF1A 1TAMA 2QFJA 2V2ZA 5LSRA 2WF8A 1IM6A 2KN7A 3OTBA 1NZPA 3AO2A 4HUFA 4F02A 1SB3C 2VA2A 2X6SA 1D9FA 1KC8T 3OL8A 4LF5J 5F3TA 1B7FA 4KFBA 3CG7A 4QS7A 3KK1B 3CMQA 3NH1A 5J0OA 2HK2A 4QZIA 1QQNA 3T5HA 5BR8J 5D4PA 3RJFA 5KFXA 2QO3A 4NXZA 1BQXA 2KICA 2D0PA 3H4DA 5AQQA 4DR4J 4FJIA 3B4MA 4ZN3A 4MDAA 2Y0SD 2ZGYA 5BOLA 3CCLS 4N47A 4O3QA 1L3KA 2XSFA 1NSAA 2V52B 1RADB 5L8RC 4DCPB 4J9VA 1XJWB 3SBGA 1K6YA 1TL7A 1RBAA 5KRTA 4B3OA 1X7VA 4UAYA 1MU2B 2HFSA 2VB6A 3DOKB 4RW9A 4DR5J 1IO2A 3O6WA 3S41A 1ZQOA 3CNHA 5KFLA 3HRGA 5E3AA 3VQSA 3MECA 1TUWA 3IG5A 1VK0A 1Q86O 4DR1J 4L76A 3TADC 4JRQA 4KAIA 3B4DA 3RVCA 1GAOA 3MM9A 4NLBA 2ZJPQ 3R5DA 1NJZA 1HMVB 2FZKB 5IOLA 5LSLA 5AQZA 3ZSZA 3KLHA 3CD6S 9ICTA 2DGZA 3C8YA 5E7OB 2VKQA 1EIYB 4CK2A 1Z2LA 4URGA 1FDDA 1UA1A 4WKYA 1NH8A 2W8LA 1EQYA 3J7AP 4IKAA 2O8BB 1UPMB 2G1HA 3CVKA 3QMLA 2QARA 4V19X 3DLBA 2VIHA 3ALYA 4NA3A 3AVFA 2V4RA 1K1QA 5J2BA 4QZCA 3AVAA 2N82B 2VHGA 4OI3A 2YKNA 1H98A 1VR6A 3HL8A 4DTPA 2NS1B 1KOHA 3M8PB 1XK8A 3KDNA 3J81U 2YWGA 3ID6A 1EQMA 3TU5A 4FOIA 3S3OA 4Y0FA 4DX8H 3BPSP 1RWWB 3C23A 2O4IA 4H5NA 2BV3A 4NCAA 4DN9A 4D3GA 4WCEL 4BRAA 4XIUA 3VQBA 2RDDA 3M6GA 3EDQB 4YVZA 4DF8A 3R5JB 4WJBA 3DN9A 1VHIA 4RL1A 1XQSC 1VRUA 4LF8J 3U02A 1RT5B 4X4UA 2P35A 4FF3A 4K4XA 3DLRA 1NLKL 2FJEB 1ZM4A 3C3LA 1U1QA 3BBCA 3IAM9 3UVJB 3PFEA 4A8EA 1FEZA 3KK2A 1ATRA 2QI2A 4F50A 2LVWA 1FJGJ 4DSLA 3G82B 1U6ZA 1VIOA 4F7VA 2KG0A 4FBTA 3D1QA 4BROA 2RMLA 1ZQEA 1TL1B 1X0FA 3RB4A 1J27A 3OYLA 3PO4A 3PYGA 1S6QA 3DRSA 4AT1B 4EO8A 3V9UA 3QGIA 2HQGA 3OVSA 3C66A 1BISA 9ICKA 3ZSYA 2YB1A 2F5GA 3PV8A 3S3NA 4B3SJ 2EK1A 4JI7K 4ZPBA 2KHQA 3CJ3A 2A1SA 3QO9A 3DLEB 3IHQB 3OUYB 3CJ9A 1JCFA 3A8KA 9ICUA 5EX0A 4FDFA 5KFSA 3QRQA 3UM9A 3WUHA 3MM8A 4EP5A 3DU5A 1RACB 1IKYB 1G1XA 4OKEA 2CNLB 5HMLA 2P9LB 4CZGA 2CQ3A 2GEMA 2VOPA 5JVGL 3MXMA 1ZS6A 1K9MO 2NRXA 2RHFA 1GOBA 1S5ZA 3AJ2A 4DV6F 3IP4B 4DR7K 2E2NA 3CXCR 2QYGA 1WTFA 1ZH5A 4M3XA 4H4OB 3HKZF 1RBSA 2JLFA 2IAJA 1N32K 2HQ3A 2EAMA 2BCSA 2Y3YA 1YJNN 3N28A 7ICRA 1NNDA 2ZDPA 5CYMB 2VF3A 2GVDB 2WAQC 1SGGA 4UY8O 3OTEA 5AE1A 2L9NA 3WIVA 2LA6A 4ILRA 1MLAA 1XMQJ 1ASUA 3AO4A 2PEBA 4MFCA 2CVEA 4J37A 4L72B 3K2YA 1TV6A 2WB1F 3G2XA 2DQNB 1T94A 4DTJA 2F4VF 3DDIA 2ROEA 5J0SA 2F8KA 2NRWA 4YQWA 2YNGB 1T9UA 2HCFA 4CF5A 2GBZA 3R6GB 4M6WA 4N56A 1M5OC 3AD7C 2VONA 1JL1A 3ADAC 5ETPA 3NMRA 4DCHA 4OD0A 4OJLA 2FJDB 1KQGB 1FFGB 1MN7A 1WC4A 3K5OA 1Q82T 4BR5A 4JMUA 5AQSA 2VDHA 3LP0B 3J7ZT 4X66F 2OYQA 3VCBA 1FNMA 1NJYA 3RWUA 2FVRA 1G15A 3DXBA 1F44A 2FY8A 3HSJA 2ZM6K 2DNOA 5HHHA 4CEOA 1QTMA 4ATNA 2CQIA 3T6JA 3TFRA 3FZLA 4PWWA 7ICVA 3L2VA 3F2CA 1Z6RA 3VF4A 1T9WA 4M3TA 2K8AA 2IHNA 2KDOA 5AICA 2KZ3A 1GLJO 3F53A 1FIQA 5DETA 4JK9A 4FFDA 1YRTA 1ZJMA 1HKGA 4FPAA 1O5JA 1KVIA 4PWDB 2OFGX 2Z1IA 5B5EU 3JTPA 2NRTA 2XIDA 5D4OA 3SZ2A 2P2CB 2BKOA 5IC4B 1JQGA 1RBUA 3QB0A 4U67L 3AD9C 3NASA 1IBLJ 2XRIA 3C6UB 1A9NB 4J9PA 5AQXA 3R27A 5HN0A 3KJNB 4R5PA 4LF9J 4GXJA 4ECTA 1FXLA 4Q44A 3W64A 5AQUA 1X6IA 2AHOB 5AXLA 3AJ1A 1TUYA 1Q95G 2W4PA 3HOTA 1PVPA 1N33F 3GIMA 4JHDA 1YK9A 5I3UA 3E9OA 3DGPA 2XHWA 5JLFA 4WQ4C 5HVGA 2HFOA 1FEEA 3KZXA 4KHRA 2JWKA 9RUBA 1XMOK 3C2MA 3HM9A 1RTHA 2W40A 2ZXIA 4G1PA 4X64J 2XM3A 3E0FA 3VC8A 5ALFA 5A8WB 1U9LA 1BNPA 3JPOA 2BA9A 4YNQA 1N34J 1RDFA 1VQ8N 4CBUA 3OW2M 1WC0A 3DRPA 1XR5A 3V5RA 4B8CA 5FLXO 4NWBA 1H6KX 5AQHA 2AP6A 2ZBPA 4H5RA 1BC6A 4P10A 2NZTA 3O1WA 3DLKA 3RJKA 3A5OC 3IR7B 3THXB 3QUCA 1R0BG 4B3RF 2XO6A 5L1IA 3C5FA 2BJ3A 1MW7A 4H8KA 1IIPA 1TZ0A 2Z4PA 3ET6A 2HNZB 1WOQA 4DL6A 1KQKA 4YOTA 4B02A 4NEZA 5F8MA 2J9DE 1RDRA 4ZJOA 2IRXA 3LOUA 4N76A 5T7LA 3QJLA 4PKDB 4Y2SA 3L3FX 2H5JB 1GX6A 4C8NA 2E9ZA 4K4SA 4QIVA 1UZHA 2AZ1A 5K8PA 1T6DA 3O1BA 2VOOA 3QUQA 3SAFA 3GONA 4AP9A 2KZMA 2DRAA 3SXLA 1VOMA 1J5EF 1FJEB 1S0NA 4KPYA 3I0SA 1JLQA 3T5LA 4BUGA 2ZBIA 2NRVA 4PXCA 3NAEA 1IBMF 2J0SD 4RW6A 1SI9A 2WHEA 1DY3A 3QBCA 2XI3A 4KKOB 3BEXA 1KD1O 1RBVA 2I5JB 4FZYA 4ZPDA 2LHTA 3MM5A 3OS0A 4O3SA 3C14A 2CUYA 1RWOB 3U26A 2DHXA 2HG4A 2YWEA 3CJTA 1WKJA 3O3LA 2V5HG 2MZ1A 2YNFA 5HQMA 2C2ZB 1CQMA 3SCLE 3U1LA 3CE8A 4P72A 1RK8A 2I5HA 3A3NB 1Z1BA 2L9DA 4CJKA 2BJ9A 4FBUA 3HWTA 4K4HA 1ZQAA 3MMAB 4RX6A 4FZMA 2HPUA 4DR4F 4PQAA 4Y2PA 2FF3B 2XCAA 2ZTDA 1Y0HA 1SC3B 4DHYA 1S1WB 3EDRB 4M41A 3CFPA 2XICA 4BRMA 4YFUA 1DRGA 1HFEL 2Q6CA 5CCMA 4JI4F 1ZOLA 3NVVA 2QFIA 5HLFB 1YJVA 4YR2A 2KM8B 2GJIA 4ERDA 3JS9A 2ZIXA 1JX4A 4JI5J 2YQ1A 3IBPA 4YOYA 4DR1F 2VL1A 2ZUCA 1VMBA 3PJ9A 1LW0B 3D6HB 3E58A 4CW7B 5CABA 2BABA 3O44A 2OEKA 5F2RA 1W2BM 3MEGB 5HRPA 3MCPA 3ZTSA 4A48A 4KHPK 1NOMA 2VZ9A 4L74A 3EVWA 4J2AA 1BVSA 4ICAA 1N61A 3PW5A 3TZZA 3MWPA 5T7BA 4YR3A 3DKDA 3ZDBA 4P75A 3U4LA 4TY9A 4CYUB 2GMHA 3GR1A 4QIGA 2AF6A 2A1JA 2M9KA 1UWAA 3J80O 3TUIC 5JU5A 1S0MA 3RRKA 5ETQA 4F4ZA 2IRYA 2CQPA 3HSDA 7ICKA 1ZA1B 3PIPL 2M0GB 3J81j 1LQ9A 2RE1A 4EP4A 4HACB 4UOCA 3VAKA 5M1NA 2E66A 1HJPA 3L3CA 1V3ZA 3FBCA 1J6ZA 1QQOA 2O8DB 3RF9A 1S10A 1C4CA 1P8GA 2HBYB 1KVCA 2FY1A 4F25A 2DK2A 3EO3A 4WXWA 3IDHA 1HQUA 4HTJA 3QLHB 2AYEA 1FRIA 3NEKA 1IG9A 3I9V9 5DDOC 1OIAA 3BH6B 4P2XA 1HKAA 3WKCA 1P1TA 4MK7A 5FPDA 1KVBA 1A5VA 4J9NA 2K7JA 5FLXY 5I42A 9ICRA 1SPBP 1RAGB 3RUBL 5JUMA 4RQMA 3KLFB 4J9OA 3ETRA 3IG1A 4JI0J 3CNQP 8ICVA 3CI5A 1U02A 2VIXA 4FXVA 3G96A 3C6TB 3V9XA 4CDIA 3VCDA 4QYZK 4CEDA 1VC5A 1JJ2R 3ZSVA 2LU2A 4Q2MA 4YD2A 2WBNA 2BM1A 2P5VA 4P6QA 5AQMA 2C3PA 8ICTA 1OPIA 1FJGF 2G2YA 4CZCA 4KLJA 1MMLA 3OPXA 1QM9A 2GV1A 3P5TL 3SBMA 5HSPA 4ED7A 1KONA 4NJ8A 5HQLA 1LK5A 5ALMA 1Y64A 4WFAQ 1DOQA 4B3SF 4IRDA 1N54B 3IRUA 4RQNA 2LEPA 1RB0A 1R0CB 3L7UA 3A5NC 1N5TA 4DV1F 3AA5X 5KGWA 1VSKA 2WVFA 3D6TB 3UMBA 2COLA 4FS2A 3QDKA 2A6OA 9ICPA 3A2FA 2JH7A 1Z2ZA 3RJJA 5ADZA 2AD9A 5GINA 2PBDA 4W98A 4S0MA 1V38A 3ZX3A 1LWXA 2BRKA 3AB4B 2OAUA 1YUWA 1WG4A 2UYTA 1ZBLA 3I28A 5LMNK 1A5XA 2XMAA 2HKEA 3O3HA 1TMMA 4QJFB 4GVEA 3ATVA 1YGYA 3MR3A 2M88A 2Z30B 1RXOB 3QATA 2IBKA 3HVAA 3HK2A 2UUBJ 3KK3B 1NZAA 4USKA 2NLXA 2DY1A 2HFNA 1OY6A 3T7ZA 4NPOA 2V9KA 3PNIA 4DLGA 1O0PA 2KKHA 4GKKJ 1UFWA 1XR6A 1FK9B 4DL7A 2HHHJ 1I5OB 2G2ZA 2ERRA 3C0BA 3I56N 5J2IA 1V3SA 3TVZA 4USTA 2HF4A 4BDZA 3E51A 3SFGA 1C1CB 4B3MJ 2KJ5A 5BRDA 2KD1A 2Y0SC 1N62A 2NYIA 2QGFB 5KFBA 5AKJA 1BWVA 3CQ8A 3BP8A 3K0JA 3KLGA 5LJVA 4NLPA 2RD5C 4DUYF 4LBPA 3VA3A 3UQ2A 4EFAC 1FERA 2KM8C 3BM7A 3GILA 4FWLA 3RG6A 4USJC 3OW2R 2K06A 1IG6A 5GAEP 1R27B 4KITB 4I2HA 4M45A 3ZNJ1 2W9AA 2W2NP 3AQFA 4I2GA 4JYAJ 3JSRA 4Y3CA 4I7FB 5KAFU 5DQIA 2CQ1A 4CJ3A 3QSIA 1YVUA 3J80Y 5J2EA 1JLAA 2ZZNA 4A2AA 1XWLA 1URRA 3MEEA 3L7PA 3M6UA 3K9KA 4H0OA 2R7OA 3QX7A 2M9NA 2VJVA 2HLUA 2GJ2A 5E33A 2Y1LB 4Y2JA 2FZGB 2BCRA 1NGIA 3AARA 2ZITA 3BQTA 4KHMA 3WQTA 4LH5A 5AIBA 1NDKA 4LIWA 3UCUP 1NCLA 4KN7A 1Q81T 2D5RA 1VBYA 1RYSA 4BGAA 2NPIA 1SUQB 3Q8MA 2PEHA 3AY0A 4X4NA 4BGDA 1HBUB 2EW9A 3DRXA 1PCAA 2DFEA 1JJHA 3TW0A 4NXMK 3OR1A 5EDWA 2FJ6A 3LDOA 2HVHA 1B92A 4YDDB 2AJQA 3VHQA 1EJ7L 1HYZA 1IM4A 4DQRA 4A8KA 1MA7A 2P9GA 1CRXA 3GJRB 4BQLA 4MYTA 5T14A 3VEXA 2I7PA 4MO5A 1F5AA 1N8RT 5ALEA 2POKA 1BU6O 2Z1GA 4NRUA 4X64F 4WE1A 3QT5A 2GAGC 3V9SA 2LM1A 1NU4A 2RUGA 4XQ8A 3JQJA 5HMZA 1ZQGA 4LF2A 5HBMA 5G0RA 2A6AA 2GQQA 2HBRB 2HHPA 1FD8A 4K4ZA 1NMDA 2QM1A 4LSLB 3VAJA 4X4VA 2VC1A 4Y2YA 3GCWP 3G6YA 4LF5K 4Y28C 3F5AA 3KG4A 2XYPB 3MN6A 2E5SA 5KG4A 2OYYA 4Z6DA 3GP9A 4ED8A 3H8MA 3B6BA 5B0GA 2BPGA 2RRNA 3L09A 3G0ZA 4YB1P 3H5YA 1RT6A 3ED5A 5BR8K 3KDOA 4Y2CA 3I96A 2XULA 3JPPA 2DH9A 4DR4K 2MQOA 3RJEA 3QBWA 4RW4A 4PG5A 2EWHA 1N5WA 4TNOA 2JGAA 5E3PA 3OYMA 1Q5YA 3E3XA 3U8XA 5KGXA 5KPRA 1DEJA 4CBWA 4E7KA 3PKYA 2F9JA 3ICXA 8ICOA 3G6XA 4ZVUB 1ELOA 1HHTP 3Q2TC 4IFYB 5L9NA 4DR5K 1KSPA 2BH1A 1BIZA 1T95A 5KFMA 1W2BR 5HRRA 3HSTB 2OO4A 1UFLA 1JLBB 2B7CB 3D0GE 4NMLA 1F21A 1UKUA 1I3AA 2Y1RI 2FJVA 4CHPA 3W5ZA 4BE1A 3I55N 2HQIA 2VG6A 1ECWA 5I4MA 4Z4GA 7ICPA 4NASA 2R8GA 4DV0F 4IS7A 2R7QA 1IBCB 5J2QA 1P1LA 2HVIA 1KBUA 2CQ0A 3KD3A 3ZSWA 4XRHA 2J7UA 2EX3A 1PBUA 3V81B 4ILHA 3VAIA 1OVQA 4F71A 3MZIA 1Q82O 4C98A 1LW2B 3J7ZO 2V8GA 2ZH7A 1X4GA 1QE1B 4UOFA 2X51A 1PK3A 9ICXA 4PCQA 2CGKA 1M1HA 4AXJA 2ATCB 4F4WA 4XO0A 3BSNA 2ZHAA 4Y0WA 3R1LA 1ZBIA 3M30A 5IV4A 4JK1A 4UW9A 3G6VA 2X78A 7ICNA 2A10A 2G5IB 2XZDB 5MLCQ 3OYHA 4Q43A 3H5SA 5J2NA 3DXSX 5AKIA 3NS6A 1RTIA 2JLEA 3HMJG 5DG7A 1QQCA 4IQXA 1NK5A 2I1RA 2VA3A 2K8BB 2F1HA 3JPRA 2H5IB 1WI6A 4CCHA 2D69A 2OPQB 3DHWC 5C12A 3MXJA 3C28A 3H40A 2IGIA 5AM1A 2M70A 1HWJA 4DUZJ 3QEVA 1T05A 3CCEN 2WF7A 5K14A 5IS2A 1QUVA 3N97B 4LF8K 4K50A 2CKWA 2P6UA 1A6LA 2UV8A 2GVZB 8ATCB 3OFEA 2YNIB 2PYLA 2UU9F 3R1XA 2HW3A 3KFWX 4ID5A 1NKEA 3GV7B 4J91A 4X4QA 3T1YF 4PL1A 1GO3F 5CYQB 4R8UB 2V7ZA 5JMNA 3B8HA 3NCQA 4ZVFA 3HHLD 5KG2A 3EPIA 1QDUB 1ROFA 4JI6J 3N6MA 3AVGA 3SCIE 3SDEA 4OX7A 1SQEA 1GOCA 3WT0A 3H90A 2JGUA 4WQ5A 3WXJA 4EGLA 4OCZA 1EETA 3EWAA 1L8OA 3LF0A 4B3SK 4NZ6A 4Z0UA 1Y4ZB 3W8PA 3HULA 5GAHU 2XS7A 1WSJA 2XBPA 2L08A 1YJ9S 1AUSL 2WTFA 3CDBA 2OZMA 2WBRA 3LP1A 1RKIA 3VGKA 3M1VA 1NPKA 4CGJA 3C16A 1WYGA 3GFHA 4QS9A 1F5CA 5IFMA 1WAFA 2P9NB 1S6PB 3MN9A 2BCQA 2U2FA 3FZMA 2BYCA 2Q97A 4FJHA 3OVBA 3DCAA 4M95A 4E8UA 3BYRA 5ETTA 4JI0F 4W92B 3EL2A 4BRGA 1LOTB 2C22A 1DRZA 2OLWA 1WBBA 2CPHA 1XIQA 5ETSA 3VQ5A 3ZZYA 1ZM3A 4U7UK 1CJKB 3VTIA 4FVUA 1CS4A 3NHGA 1BGXT 3SI6A 1RTJB 3P38A 3KKAA 4BX9C 1COKA 2CXYA 3TAMB 3VENA 5KNIA 4M7YA 2AJ4A 1VQ5S 1JNZB 1WCLA 3JTNA 3GBTA 2FLLA 4BG8A 1IKWA 3RJHA 3CJQA 2VQEK 5AQFA 4CFAA 2G13A 4ZJLA 5CQGA 1XMQK 3KVGA 1NK6A 1VGYA 3AM9A 5KT6A 3CJ0A 4ISEA 4JKEA 2QWLA 3CCLN 3E01B 2L41A 4F2SA 5DB8A 6AT1B 1ZBHA 1UW4A 3FRZA 5JICA 2QWOA 1U8WA 2VJ4A 4E98A 3VPZA 4NLYA 2FUG9 3ZEUA 2IJRA 4MEXA 1KLMB 4ENOA 2KMDA 2J0WA 3CIPA 4X4TA 5C7PA 4CHQA 2YY6A 2DNQA 1RWNB 5DZ6A 2ZTCA 2HZVA 1CSJA 1EHWA 2HHUA 4C3LA 2QKKA 3TZYA 3CD6N 3DLGA 5EHHA 1FWLA 2A41A 2D3O1 1KHWA 4Q0BA 4C7QA 1RLDA 3THYB 1NZ8A 2UUBF 2AGPA 4A46A 5HATA 4P7TA 4HHTA 2Q2RA 2CZ9A 2EBGA 1HARA 1XI1A 1S12A 3POTB 3PJWA 2YHWA 2F65A 2G06A 4DU7A 4GKKF 3D1OA 3QAEA 4F26A 3EYZA 3CCRS 4CFDA 4BCAA 2Y9TA 5AM0A 1K47A 1FFSB 3GE9A 2IYIA 1CC8A 4PR6A 4CFCA 5M1QA 4Y1DA 1IBLK 1N0VC 3Q8PB 2ZOFA 5C5JA 1B99A 2O67A 2G09A 2DD8S 4J7CA 4LF9K 1XBWA 4B9SA 1NHUA 4OYMA 5JRTA 3RMBA 4FJXA 1RCXB 2HNYB 4H4MB 3SSSA 4USWA 2QL5B 4RQ3A 2DWQA 4I9LA 4F0MA 2DVIA 5D77A 5BXIA 2XG8A 3CRXA 4RWTA 4LT6A 4BLGA 4Q5VA 4V19J 3I31A 4IO1A 4UUWA 1RHRB 2VFRA 3KFUF 4JYAF 1N48A 4G65A 4X64K 5FROA 3GJTB 3CJBA 1N34K 1HBMB 1TVRA 5D6GA 3M9NB 2DCUB 1T4GA 1VHFA 1SV0A 4FWOA 4IO9Q 4LBIA 5C25A 1MMNA 1UJ6A 2XYHB 1N60A 4NI2A 5F0XA 1CC7A 4F0HA 1TP7A 4OJOA 4M5NA 2V7YA 3Q8SB 1Q7LB 1XERA 4HUGA 3C7NB 2LXFA 4FWNA 4MIAA 4B1YB 4DOAA 4U9RA 2XGQA 2DHHA 1J9AA 4BRDA 3LVVA 1FI4A 4OYXA 3M2RA 2ZIUB 5AZJB 3OSNA 3OJSA 2VD3A 5CE3A 2HQCA 1MDUB 2L48A 4F4AA 5HROB 3UQSA 2LCWA 2BKNA 3GDXA 1L8LA 4BR2A 5JJBA 3PIOQ 3CF5Q 4QWAA 3QZ8A 2HNDB 4WK3A 4X62F 5IIJA 2YQ3A 1RXWA 1FWPA 4C0ZA 4W5QA 4OLBA 1HIYA 4O8KA 4PXEA 1Q9YA 1A6SA 1S59A 1P27B 3VGSA 1VSJA 5J2DA 5HQ8A 4ZTFA 4KFBB 3Q8QB 1GXTA 3K5NA 4DCCA 1OWXA 2WUSA 1U7LA 2BXJA 2HS0A 2AJ1A 4DG1A 2DNPA 3KD5E 3ENOA 3SUOA 4DX6A 1OS5A 4QZGA 2KJVA 3OTOJ 4P2MA 3TAEA 5J2FA 4L73A 4ECUA 1VRQC 1ASVA 1TAQA 3NWGA 1N63A 4ZVSB 7ICIA 3HF5A 3S3MA 1X9MA 2RILA 1BCMA 1MG7A 4Y2RA 1TL7B 1RDBA 1O51A 5H9EJ 4FVMA 2KT3A 4V19S 4B3OB 2OFHX 3OHRA 4MIWA 2GWJA 5FPEA 4RW9B 2AX0A 5DB9A 4I4BA 2FD2A 3NF9A 1PZNA 3MECB 2K3KA 3H45C 2F63A 3TJAA 8ICBA 3SYZA 4JI5K 1IJEB 1WG5A 4UY85 4PKGA 5EE3A 3KLHB 1DKGD 3TQEA 2P9KA 2XSJB 4JWNA 3EXCX 2MEWA 3N01A 5ELZA 2C2RA 1HLUA 4OPJA 4F92B 4OQJA 3D1HA 2KT5A 3SUQA 3QT8A 2ILYA 2LA4A 2ZJRQ 3NNAA 2E2OA 5GADU 2QARB 3CERA 2K8CB 4DV4K 2M2BA 1ZM9A 4MEYA 3H20A 2R7VA 4DZ6A 2YKNB 2Z0GA 2QK9A 4MKYA 4RUBA 2KRBA 3DLLQ 2EKYA 4F3MA 4C8KA 5D4LA 2VPZB 2V34A 4IG0A 7ICHA 4HKQA 1RISA 4DMZA 1GMWA 1DARA 2B4PA 2N1RA 1M5PC 3KG1A 2GLEA 1VIXA 2EH9A 1VBKA 2KSOA 1AB8A 3SMPA 4BR4A 5K9FA 1SIJA 3QGPA 8ICYA 4X65F 4MKAA 1MU2A 4OZ1A 4WFAL 3QQCD 4Z4EA 4RQ5A 2MUTA 3RYLA 2QXFA 1VQYA 2HWIA 3UIQA 3FC9A 5B0AA 2C3UA 1VRUB 2O8FA 1SJRA 1U49A 1SL0A 1FDAA 1VC6A 2KVQE 4DR6F 2V0NA 3EGZA 4P52A 2MQMA 5HMWA 1RXVA 4JI0K 1EP4A 4FJGA 3KK2B 4E19A 1QZ6A 2HIQA 4PHDA 4Y2QA 2JH3A 4CP5A 1N36J 4CHNA 3M7DA 3AA8A 2O8BA 3K1ZA 1UVIA 9ICJA 2R18A 1ED1A 1UVKA 2QLTA 4YY3F 5J29A 1SKUB 1VSLA 1W2IA 2P8IA 4CF8A 1S6QB 3DRSB 2V8HA 1T0TV 1YRUA 4MJKA 2FDRA 4AL5A 5FRMA 4AL7A 1G4CA 3HHLB 4OYPA 2ATQA 4DR2K 3QO9B 1TTHB 1X9WA 1JJ4A 3DLHA 2PYJA 1BO5O 1JXBA 2FB0A 2NSCA 2VBZA 4CI6A 1JCEA 3MM8B 3WZ0A 2MPUA 1LWEB 4HVJA 3WXKA 3V7KA 3Q23A 5ALZA 4Z6EA 2M0NA 5AK5A 1B0PA 3NNCA 2YKPA 2W2PP 1SJ3P 3EWGA 1R43A 4UW2A 4NM2A 4ZVRB 3WNEA 1NK4A 4UB4A 1JJCB 2OSQA 2DNHA 4JK7A 5DM6L 1N4LA 4DV3F 2M4MA 2HRYA 1HUXA 1RAIB 4RLEA 3RFAA 4H4KA 1Y5LB 2IAJB 4F3QA 4UASA 5JS2A 2O5DA 1X4FA 2Q3SA 1IWGA 3WK4A 1YITS 4ZP9A 4EI2A 3UNGC 3I0RA 3FBEA 4B1WB 2OTLN 2J5AA 2DUYA 4K0KF 4C0HA 2UUBK 4CGHA 5AK6A 2ZUGA 4RKUC 1TQLA 3ZXWA 4AL6A 4CJTA 2DH7A 3FZHA 4GKKK 1TV6B 1ZJNA 4DQ8A 1SAZA 2PN6A 2HHHK 4Q8FA 4MQ3A 2BANB 3D3CJ 3G8SA 2XQCA 2LI6A 4B3MK 3K8VA 1QTNB 2L5YA 3AUOA 4CJWA 4M6WB 3OL7A 2P9CA 2E9RX 3MBYA 1IKYA 3VQ4A 3BB5A 3OVNA 2P9LA 3GWCA 5EE0A 2HHQA 1VJWA 1KVKA 2CN1A 4XPCA 2FTRA 3OLBA 3ISZA 4RBTA 4OHZA 1VQ9S 9ICNA 3AQPA 5D0RA 3SSQA 3DXKA 1WDDA 2DNGA 1MWYA 4FE3A 1RCHA 2HHTA 4YXJA 1FFVA 4OFZA 1KNZA 3BGOP 2KFZA 2FGOA 3ZT1A 3M5RA 1L7PA 3EGNA 4CLYA 2R8IA 4XH5A 2X3GA 3ZT0A 3OYDA 2D1CA 3VERA 5M2PA 2A2DA 4OYIA 3L9ZA 2NUBA 4QR1A 2HDOA 1LVHA 4CJVA 5AI4A 2UZAA 2N7YA 4HTLA 1XQIA 4G9BA 1RNHA 3M6WA 5DM7Q 2J8SA 3GCXP 3LK9A 5HO4A 2MA1A 1TL4A 4DS5A 3FBBA 5EN1A 2D0CA 2DEJA 4OZ2A 1WWUA 2KV2A 1FF2A 4R5PB 4BRPA 1RA7A 2E1PA 2V68A 2YMPA 2JHEA 1UVNA 3C15B 1IBKJ 3MDAA 1RABB 4DS4A 5I3UB 1JCGA 3VALA 3DGPB 1W97L 4B3TJ 2Y8YA 4B8AB 4FJJA 1P6TA 2ZG6A 1WUDA 4KX3A 4R25A 5HVHA 1HNZJ 3LP3A 3J81Y 4YB6A 9ICWA 3W9HA 3MDCA 1X9SA 4CHZA 4IOCQ 1LWCA 3MFIA 7ICUA 1AW0A 3FDSA 2EG2A 1WTBA 3DAWA 4A2BA 3WNFA 4RT3A 3G25A 5CHGA 4ED2A 3MPUB 5CZXA 3DRPB 1S72S 4CJQA 3MMCA 4CF1A 4RBVA 3GPAA 3PSIA 4EO6A 4CEBA 2Q0UA 1VQPS 3DLKB 1VQMS 5ALGA 4LFAF 1XNRF 2ZZTA 1AZSA 2DRBA 2B9XA 2QL7B 1G2EA 2QC3A 3DYAA 4ED4A 4CO4A 2X3DA 4PWDA 5I3PA 4M47A 1NOZA 1OSCA 1RAHB 4UAZA 2ZC3A 2DTJA 1BQMA 1RT2A 5A2QU 5J2KA 5T7LB 2ZH1A 1H2VZ 4F5RA 3UCZP 2Z1HA 1UP1A 4BR0A 5E0OA 1VSIA 3L4IA 1H2UX 5AQRA 4DXLA 2PSZA 2G0IA 1ZBUA 1EQ0A 1WWHA 1O13A 2ZEJA 1D8YA 2ZF5O 2AJFE 3SR6A 3K89A 3JAMU 3I0SB 1JLQB 2LPEA 1GX5A 3D5MA 2QV6A 2OCEA 4OI6A 7ICFA 5AM2A 5J2JA 3FGUA 2IHMA 2GUPA 5AQKA 4UAVA 4WTOB 4C11A 2KO1A 4JUZA 4XEIA 3MM5B 1RQNA 1JRPA 3C14B 1RWMB 3D9BA 4Z6CA 5AJ3J 3QEIA 2WK4A 4PWUA 4CH1A 3AGRA 2YNFB 1HHQA 3VZHA 1RAOA 4JKAA 1EXQA 1Y10A 3QINA 2AZ3A 5KFGA 5CHCB 2QMXA 4ZS6A 1NGDA 3UE2A 3QETA 3OXGA 1L6NA 4K8RA 2K89A 2GO9A 4K4UA 4ZLLA 1CZAN 1H7WA 3JXOA 3CC4S 5DGAA 1Y5NB 2FHKA 1RAFB 2ZDOA 3R8EA 5ALHA 3K59A 2PFPA 1LFPA 1V6HA 5IM0A 3CJSA 4CJFA 3FNNA 3JSMA 2RHSB 4IQUA 4I2BA 1SZHA 4F4XA 3L6QA 2BX6A 2Q66A 2EDUA 2ZVSA 4UBCA 2D9OA 3S6EA 1JMSA 1VLBA 2FI1A 1S0VA 3NTUA 5AZIA 3MTJA 4CM0A 3LUYA 3MGIA 1NJIO 3JQMA 1FO4A 3HPHA 3R2CJ 4IKFA 4DUZK 4MDBA 5CZVA 4IR1A 3NF7A 5DKWA 1VJQA 4C8ZA 1TU0B 1YJNS 1T9TA 3UDCA 4OLPA 4DPTA 5F8IA 3NGYA 4DMNA 4YOUA 3P96A 2AEMA 4P7VA 5D15A 3WK7A 3VF6A 2A1JB 2ZUBA 4G3IA 2CVIA 2AYBA 7FDRA 5AQPA 1PIEA 4YOXA 4L3QA 4TLQA 2ISPA 2V4QA 3KWIA 2XC9A 3MMAA 3JXUA 4DCJB 3MR2A 4CO2A 4WIQA 4JI6K 3NAIA 3ZZ0A 1S1WA 4CWBA 1TK0A 2GA7A 2ZIVA 1L7MA 3ZETA 3D2EA 1HNXJ 1WG1A 3SI8A 1HQUB 1PGZA 1E6YA 2MQPA 2XB2D 3BH7B 3C2PA 5EOYA 5FP0A 2F8HA 1W25A 3ZDCA 3MM7A 4LFBJ 2DIVA 3DDNA 4LF7F 1ZQCA 5I42B 3O3GA 2LMIA 4GW6A 3HKZD 4FLWA 4ZLJA 4EK2A 3UKRA 3IG1B 4RTFD 2F40A 4ALZA 1LW0A 3CC2S 2ITGA 5D4NA 2LFVA 4P0PA 5CCLA 3MEGA 7ICQA 4YHHJ 3MX5A 1HD0A 1WOOA 2DXEA 4AYBD 3THTA 3G71N 5AFUH 1K0VA 1Q18A 1FKOB 2W25A 4F2RA 1W26A 2CXEA 2WB1D 4XH1A 3HSCA 4CLLA 5AQOA 1GTEA 2Q36A 4LJMA 5AXMA 2E1AA 3CJ1A 2AXTU 4RCHA 4HACA 5M1PA 4OL8A 3BKTA 4F5PA 1TUGB 1X5PA 3P4IA 4K41A 3SK3A 3AL0B 3L7OA 5KFJA 3AH6A 3HDSA 2BE7D 3UN5A 3NBPB 3R8YA 4MFAA 2BZFA 2ATLA 2B51A 2KLAA 2FSJA 4PHTX 5ETRA 4O3NA 3AA3A 1RE1B 1F0MA 5C24A 3D7EO 3FJ2A 2E1YA 4B9LA 3CJ7A 4L6V3 1HW9A 5H1SQ 9ICHA 4QOZB 4ZCLA 3O9RA 4QWBA 3V4MA 1Z00A 5DO2A 3JPQA 5HP4A 4CEEA 4XTTA 3QU7A 2Y1JA 3WX4A 3RAQA 4ZIVA 3G86A 3QXGA 2KVCA 3PEHA 4IQMA 1QUPA 2XS5A 1APSA 2H9ZA 2GW8A 3D0IE 3U1NA 1KR4A 3VF0B 3SCXA 1NU0A 1YTAA 4CF9A 3OY9A 5GAGP 1UPHA 1Z4OA 5CB1A 1UEVA 2AQ4A 4BE0A 4OJPA 3OV7A 4M8LA 3VA0A 3R5GA 4DOCA 1KKXA 5IT4A 1ACMB 3TTFA 1S1TA 4FCYA 3QEWA 4OYAA 2AGQA 1X4CA 6FDRA 2G8KA 4Z4HA 4UB5A 2CJYB 1C0UA 1KHVA 1B0TA 3MR6A 3ZFVA 3ITHA 2YHXA 5M1FA 1Q8BA 1S8OA 4M9HA 1SH2A 1VQNS 4QIWF 1YVFA 3GE1A 4JK8A 3KLGB 3VVTA 4ZLNA 1LXNA 1X66A 5CH7B 2NO5A 4MKVA 3FZFA 1UZDA 5L38A 3FQKA 2FPMA 3FVYA 4PG6A 3K5PA 2DFFA 4J9KA 4FPIA 3C5GA 2OEJA 5BOMA 3KJVB 1Q53A 4NRTA 1Z4NA 2JC0A 1NNEA 2IA0A 4M5IA 4IH7A 4GVLA 3T19A 5RUBA 3J7Z5 1CZ9A 1MWKA 5A0YA 3TABA 4E0DA 4I6MA 2VCPA 4J9RA 3C2LA 5FPNA 4KH6A 2YWWA 1ZQTA 3H5XA 2JFDA 3PIOL 4WTYA 2EHGA 1RLCL 2H3GX 3QMQA 1T44A 2FHMA 3MDFA 1SJFA 5SWMA 3L2QA 3VGLA 3MAAA 4FXWA 4FXDA 2R2TA 2LXIA 5LJ5Y 4Q8EA 1W9HA 2F7VA 3QEXA 1C1BA 4DV5J 3S9HA 4YDUA 5GMEA 2PE8A 2K2PA 1S1XB 1B70B 1KWMA 3GV8B 3I87A 5IT9U 1C1CA 3ZD9A 1FFWB 4Z2XA 2EZXA 4IFVA 3N7PD 2MMYA 1WWVA 4JKFA 5K8MA 3OR1B 4GKJJ 3AQOA 4NLOA 1QHAA 1VAZA 2EWSA 3MPVA 4US9A 1UFKA 3CCQS 1YJ9N 4FZNA 2FXUA 4WF9Q 5AKKA 2BDPA 2ASDA 4OPAA 2OP5A 1UJ4A 4HCCA 2QA4S 2EZZA 3BS9A 2KHOA 3TSPA 1NB2A 2ASJA 1RPLA 1VSEA 3TUPA 2RSQA 3R6LB 3NVZA 4UUXA 2A3VA 5HBMB 3WKDA 1XC9A 1C7YA 1MWQA 4F5OA 2ZUAA 5KFEA 5KFCA 4CVNE 2XMWA 4NCGA 4YFKA 2BVZA 3WX8A 2ZBQA 1S6UA 3O2IA 1K73O 4HH0A 1K8AT 1BMQB 2G5HB 3VTHA 5BPNA 2QLWA 2MJUA 2VG5B 1G3OA 1R3NA 1PO6A 4ED3A 1ITGA 1KFSA 4A8MP 3PKMA 2ZJRL 1RT6B 2DEIA 3E8OA 2BDUA 3ZNUA 2FHOB 1XTZA 2WSCC 5D46A 2NRHA 3MCMA 1VQ5N 2XZTB 3OTOK 3BBBA 4JV1A 4LR9A 4EHTA 3FC4A 1VSHA 2J6TA 3D66A 3T69A 2XVTA 5CA7A 1WF2A 1J2MA 1TMJA 3L3UA 4RQ6A 1XMOJ 5H9EK 3CETA 2W3RA 3HP9A 2Q79A 4H5WA 4K43A 2HSEB 2VASA 2GWSA 2WW4A 2KHCA 4QJVA 4O0JA 2BEFA 2YHAA 2JXJA 4LQ3A 4FF1A 5CP2A 5AIAA 2VG6B 1X31C 3VEWA 3MHYA 1UVMA 2I9SA 2MXYA 1HPZA 4ZJQA 3HPOA 5J2QB 1FW6A 3KLVA 1KDNA 3DXMA 4O3MA 4KLDA 4LSLA 1ZQWA 4O55A 4QR0A 2GZOA 3HI9A 2HOFA 2G9OA 3FFIA 8ICFA 1NGFA 2CPFA 1RBOB 4DDFA 5ALLA 2CQBA 2D0AA 4BC2A 1GMWD 3KJQB 3M30B 5CZ1A 3CCRN 1JKHA 1U0SA 3U1MA 3EE3A 4A5AA 5J2NB 2DR7A 1RDAA 1RTIB 4O4GA 1E3MA 4C97A 3CM6A 3ID8A 4M9JA 4WFZA 1JMTA 1YAGA 2CWXA 2JEGA 4DFJA 5AQTA 4B1UB 4NY8A 1EO1A 4DL2A 1LWFB 1T05B 2YN4A 4UTGA 5K14B 1WNSA 3VEYA 3D2QA 3MMJA 3FFKB 8ICCA 3ISND 4JRPA 1VRTA 3W1YC 2B9YA 4TN2A 4ID5B 3QU2A 3GU0A 8AT1B 2UXBJ 1QSYA 1D1UA 4GY2B 2EAPA 4O3RA 5DDYA 2A3JA 4OGCA 1HBNA 3RR7A 2QN6B 3PM9A 2AMCB 1LW2A 2R7UA 5FPMA 1VBXA 1N36K 3M8SA 3N4MB 1I51B 2CPRA 1NRKA 1ASWA 1QE1A 1O03A 2E5LJ 5E41A 3CEDA 3SDEB 1MNEA 3BYPA 4M5KA 1H74A 4BXOB 2G8FA 4KI4A 4FWRA 5C2GA 3K58A 1QY7A 2NLWA 1TKZA 2B21A 5FD1A 2LYAA 3O9UA 4CEFA 4DTSA 2F77X 4USVA 1QAXA 3IV6A 3LP1B 5J0PA 3M1VB 3D68A 1DZ5A 1BUPA 4CE9A 5HNKA 4Y2KA 1T03A 1KP6A 2FPKA 1Q79A 1FEHA 2D8CA 5ALWA 2KVSA 3PSTA 1Q78A 3QYYA 5AE3A 4F91B 4DTXA 2DNMA 2C2KB 2HMXA 2QT7A 3VV2B 4YEAA 2W24A 1NGGA 3M7VA 3DWLA 5H9FK 2O8EB 1WSVA 1OH8A 1BWFO 4CQ1A 5DGBA 2MSSA 4R8UA 3OFHA 4NLKA 2NO4A 2W9BB 4LSNB 4Z7CA 3P6YC 3R2DJ 3ZDEA 3GL1A 2MKHA 5B8HA 1RWPB 4ISFA 2PI5A 5ITHA 3CMAS 4GO7X 2RNEA 3WEEA 5DBAA 1RQ0A 3AXMA 3CUNA 1B9DA 3EE9A 4QU7A 3TAPA 2VPYB 2RQCA 3OVAA 3TRGA 2X1GA 5ALSA 4ZMMA 1WELA 4E7HA 3F2DA 1YZ7A 4O3PA 4LF6J 1ZPWX 2HWHA 3R9KA 1O8BA 3TA0A 5DM7L 2CQGA 4OZ3A 2CZ4A 5ALVA 3KD1E 4HEA9 4MFFA 1CJTA 1H7XA 5HP1A 4IQTA 4C2MA 4OPHA 4OJRA 3ZEUB 4F67A 5LJWA 3EICA 1X60A 4YG2A 3QGGA 3M9MB 3WK8A 5MAOA 3N5FA 1S6PA 5GAEU 2CQCA 2E8NA 1RT7A 5AM4A 2BBEA 2UVWA 1B7YB 1WHYA 4GVMA 1YJTA 3DLGB 3ZT2A 2H51B 5AKXA 3OR2B 2BTFA 2UXDK 2ZH6A 3PIPQ 2BOAA 4Q0BB 4PPXA 2G1DA 3SJHA 4CF2A 1DQ8A 3ZSXA 3VAFA 2JEIA 2D3OR 2NRRA 2QEXS 5CHIA 4QAGA 4RUCA 1F60B 3H98A 4CGIA 3ZO7A 3OHBA 4DF4A 3D6RA 4JI7F 4F4YA 4K4IA 1KRPA 3B6PA 1NI3A 2KXHA 5B0FA 3L3VA 3I5AA 3E01A 3VEOA 5LT5A 2YJFA 5A76A 3LYSA 3C19A 4IDHA 1CVJA 2G0CA 4JBCA 3UXPA 3PCOB 3O3FA 5KG5A 3NGDA 3TKAA 1IR1A 4ZPAA 1IBKK 1B4FA 4KH0B 9ICOA 5B0CA 4PYDA 3S7RA 4DZDA 4B3TK 4KY3A 3OYNA 1S1VA 3I55S 3DGVA 1HNZK 2QLJB 2CADA 4M63A 2ROGA 2KB2A 4NO7A 2NV3A 3BSAA 1NSQA 3KG0A 3MCAB 1N32F 4F5QA 1HLWA 4EU0A 3OA9A 5LOQA 1XNQJ 4H5TA 2GHWA 2JMGA 2CDQA 5ADXH 1X4EA 2EC0A 1TVRB 1LK7A 2C2DA 2C2OB 1ZAVA 5KFRA 3NS1A 3CJKA 4JN4A 1KDHA 3THYA 1N88A 5E3QA 3A12A 1S22A 5DS7A 4PH5A 5C25B 1HEKA 3CULA 2H3VA 3POTA 5IIKA 3LDLA 2HVEA 1TYQB 3HT3A 3AOCA 1BIUA 1IKVA 4NI2B 4I2PA 4C48A 1OYDA 1YXQA 4WQ5C 3CTRA 4ELVA 4IOBA 1GTHA 3ILJA 4DWIA 2ADCA 2UXCJ 3DMJA 2RB7A 2RE2A 1U4BA 4H03B 3QIDA 2NUUG 9ICFA 5ETLA 4ZPCA 3WU2U 2K4EA 1WSEA 3GFKB 3BS5B 4I67A 3M2RB 1M5HA 3KHRA 1D4XA 1RGIA 4BDYA 3IO1A 1U6BA 4H4MA 2SXLA 3HJFA 1FNXH 1SH0A 2DNRA 4QZHA 3IR5B 3BO2A 2ASOA 2IM3A 2VH7A 2DR9A 2F44A 5FIIA 4RQ7A 4FYDA 2C3YA 4JD2A 3AU6A 2EPIA 2VODA 3HKZC 5DMRA 1REGX 1NM1A 3TO8A 1Q7YO 1GXUA 2ADBA 4IWVA 9ICAA 5AI6A 5EVZA 4LRCA 4WFNL 4BHQA 1VSMA 4OJ1A 4LD0A 4B9NA 3RH6A 3CIZA 3MAQA 5AJ3K 1PK1A 1P90A 2PFFB 3RH5A 3E2EA 1YITN 3KKAC 3SJJA 4HHJA 2WB1C 2GFFA 2E5GA 2LQBA 1TKXB 2X1AA 1HJRA 2UUAJ 1DURA 5GAHI 1Q1KA 5KG7A 2DGQA 1KVAA 3NVKA 2HF3A 1OPZA 4C1NK 3ULDA 5B66U 3B9JA 2MZTA 4HI1A 5KPZA 2ACYA 5GTIU 4CEQA 4NXMJ 4BGBA 1TL3A 1I94J 4RW8A 2P1JA 2ZE2A 2DCLA 5L1JA 1SL1A 2GHPA 2FDNA 2AH5A 4IRCA 4KO0A 2ZIUA 1TK5A 1ZQDA 1V5VA 3J7YP 3TFSA 2NUHA 1XMOF 1NB7A 4FWSA 2I9GA 1WUUA 3UMGA 5J0UA 5IT0A 2AU0A 3I5BA 3LTOA 2MHNA 1VQ9N 4Z4IA 3AA4A 2MTLA 3VQEA 1KAYA 2HVDA 2P9KB 3UQ0A 1SZ2A 1IQZA 5F9NA 2QA4G 4LUBA 4CJLA 1WUAA 1X8DA 3NS5A 4OI2A 1GLBG 5F3ZA 2ABYA 2PFQA 1RAEB 1WLJA 3I6PA 2F8EX 3N7RC 3NRWA 1X42A 2GMJA 3VN5A 4K7QA 3G4SS 3HX9A 2V63A 2CQ4A 3QIOA 1FDNA 5FDLA 3BQ1A 5K20B 3HM8A 4XAKA 4IG3A 1MWMA 1FE4A 3AO5A 2OIHA 4NZ7A 3EVMA 4IG0B 1E6VA 5AQGA 3WQUA 5EX3A 2V2KA 4TURA 3QEAZ 2HBQB 2KSOB 1X3NA 3UR3C 3A8JA 1Y7PA 5JMVA 3OHAA 4FJ7A 2FPHX 4JI8J 3DFEA 1HNXK 2MUTB 3PDNA 3GOIA 2G8UA 3QWUA 3KNGA 2KIWA 2A1RA 1Q16B 3MURP 4LFBK 1U2VA 1IQTA 2O8FB 2IOFA 1DAXA 1VJ5A 1CLFA 1HR0J 5AM3A 2VWBA 2RAQA 1BLUA 3AT1B 3PTWA 3NNHA 1UOCA 5C2FA 4M5HA 3QIPA 2XSJA 3K75D 4A8QA 3OTDA 4FZLA 2ZJQL 1BHLA 4JKGB 2VBXA 1EP4B 4DL4A 4NLRA 3BDEA 1S72N 3LVWA 3GSIA 1W0HA 4CERA 3TVKA 5B0EA 5L46A 4YHHK 2UXBF 1XO0A 1HWKA 4PL8A 1SV0C 1LEOA 3OYCA 1VQPN 1YVNA 1VQMN 1KXPA 1HI1A 1WB9A 5HHIA 5KPTA 1TELA 5KFFA 1IVZA 3AAQA 4IH6A 4FJNA 4PKIA 2G8WA 3SFUA 4DQSA 5AQVA 3V1OA 2E5LF 2E4LA 4Z4CA 3K8WA 1JLEA 5B08A 4RUAA 3OFGA 4CIGA 1A7GE 3AJDA 5L1MA 3MCNA 1IXRA 4P0QA 5IINA 4Q45A 1HI0P 4E89A 4RNFA 1BCOA 4RNNA 2NXJA 2I2YA 4U7BA 3IAYA 3M6ZA 9ICVA 3OYGA 2OA8A 1K8AO 3IRWP 4WZMA 1FVQA 1LKYA 2W6KA 4Z7YA 4WPAA 1SWWA 4OKJA 3IWLA 4FW1A 2DFLA 1LCUA 4BR7A 2YH1A 4BG9A 1ZA2B 2J4RA 5J8YA 4LVOP 4MAKA 4IBNA 4J2EA 1FE0A 1NO8A 4KHPF 1X9XA 4EBCA 3LW5C 4ILLA 4KI6A 5AI9A 4NLCA 2ROPA 1PKUA 4PXDA 4NL5A 2HZAA 5J0RA 3MWTA 1B0VA 3I0RB 3QNNA 2CRXA 1ZRNA 5C42A 1RYUA 2HHXA 1WC1A 1DTQA 4ZCIA 1QCKA 1ZQHA 4I2DA 2MRLA 4BWMA 3I33A 4C4WA 4EBDA 2VQFJ 2HB5A 2KH9A 3AMZA 3CYMA 4W5OA 3HHLA 4E7IA 4NXNJ 3OL9A 4ANDA 1Q8IA 2RRDA 3PNCA 1GFWB 1URNA 4FZZA 3N4PA 1X5SA 1CULB 3BV8A 2B7BB 3TSUA 2DGTA 2PY5A 3CC4N 2YKMA 2EFPA 2YX1A 3CDUA 3AY9A 2G8HA 1LWEA 2CJQA 2P5OA 2GCFA 4N7TA 3LDAA 4ECVA 2OEMA 1YJRA 4NM1A 2YMMA 2F2AB 3UPQA 3DXKB 4A4JA 2LQJA 4JI3J 4O5KA 3GG0A 4NLSA 4FJ8A 3GYNA 4MK8A 4WF9L 3K5MA 1ZETA 2NSBA 4MMOA 5AK4A 5D78A 5GMKa 2BJ8A 4ZVOB 4RU2A 1WOPA 1U48A 3W8GA 2F9WA 5AR0A 4QQBA 1OQ3A 2DO4A 2R7WA 1KFDA 3R6MA 4C7ZA 4NE9C 1BNOA 2BACA 3SPZA 2FMSA 4AYBF 1NK8A 3P1GA 2VQEJ 5TZVA 1A0OB 3IM8A 1VQKS 2ZWOA 2JC1A 2J9DA 4AE5A 4DV5K 4QWDA 3ULHA 1RZTA 5F8NA 3NOGA 1ZQSA 1EKEA 3QJPA 4OZJA 1OXJA 1RILA 3OPKA 1SJ4P 3H8YA 2BANA 2A2CA 3IS9B 4IQVA 4LF4J 5D3GA 2Q0RA 4Y2IA 1YJWS 2JOQA 4EHUA 2WF5A 2R2UA 2YMQA 2MZRA 3I76A 3LM9A 2KZZA 3S01A 5KFVA 4GKJK 1T7PA 4CJEA 4DQQA 2JNJA 1RTDA 2B9EA 2ZH5A 1X1PA 1LWCB 5C0YA 5GADI 5LMNF 2KFYA 4EAHD 2PIIA 1RT4A 1TAUA 4PG4A 3MMCB 3AU2A 3CC2N 1YRXA 2ZH3A 2CNOB 4E1MA 1HHSA 1IV0A 3OTCA 3ISNC 1XNQF 4C3MA 9ICSA 1AZSB 1VSDA 3DYAB 3CQYA 4P71A 4EBEA 3OYEA 1N6QA 2D1KA 2ZWPA 4NLWA 1MC8A 2KKZA 4C4SA 3IAS9 1BPXA 3B6OA 1AUDA 1S5LU 4E7LA 2CNNB 3L5KA 1PUZA 1BQMB 1RT2B 1WI8A 3OYAA 2BE2A 2RJZA 2N3LA 2N4CA 2JEFA 1T9VA 4OHWA 2EANA 3C1YA 4RPXA 4GXKA 4JWMA 2ALYB 2UXCF 2KK0A 1WEXA 3RW7A 2XNRA 4CECA 3C15A 5KL1B 3NFAA 4J9MA 2FBXA 1NG9A 3C6HA 4DCOB 4IXCA 2G8IA 1OH7A 2MKJA 4RW7A 4R64A 2B43A 4WYWA 5HMYA 2GX9A 5TISU 1TL5A 5DLFA 3CCSS 1BOTO 4GMKA 3VAMA 2H3FA 5KFWA 3ZX2A 2A5XA 4OIXA 1X5OA 4C11B 1S9EA 3CC7S 4PG8A 4XPEA 3HOSA 1LKZA 4WIIA 5A2QO 4HTUA 1X4DA 4U95A 4H4KC 4MIBA 4J5OA 5KT3A 1SKRA 1QLNA 3FEXB 1U26A 1FRLA 5AQIA 2E5JA 2DNKA 2MHEA 4JI2J 4BACA 2E1MC 3JAMO 2E3TA 3D54A 4ZA1A 1DK3A 5IXUA 2YI1A 2XTJP 1FD2A 4IDKA 1DLOB 4EYHB 2R8KA 4FK2A 3WXLA 5KFIA 4GIBA 4YP3A 2JZBA 2ZGZA 8ICZA 2WF9A 2Z58B 3H4BA 3AFGA 1KQQA 5BYQA 4USMA 4M9GA 2X1FA 4FLUA 3QNWB 2YX8A 5L1LA 2F8MA 4NXMF 4KLFA 3NGSA 3NH2A 4K8ZA 1VQNN 1I94F 4EENA 1QQ6A 4DSJA 3K17A 5IWAJ 5IM0B 4KH5A 3JSMB 3U7JA 4Y2AA 3SNNA 5B7WA 3GIIA 1M90O 2RKIA 4PHEA 1WDTA 2O66A 4QR2A 4C7YA 4KBOA 4K4GA 3JYTA 1F3VA 1L3TA 1DGSA 1L5UA 3X3UA 3NGUA 3T3FA 5AZIB 2FC8A 1T11A 3TEGA 1E4GT 4WP9A 1RDUA 1B9FA 2BM0A 4LRFA 4N77A 2YBVA 1RUSA 4R66A 2OTLS 3N4QA 4LFCJ 3GFYA 1Q86T 2GHVC 3CJRA 4LF5F 2DY4A 1RWXB 1IV8A 4QZFA 2CWKA 2P9UB 5ALIA 2UXBK 1IR2A 3Q83A 3GZFA 4K4WA 8ICNA 5IQQA 3IMQJ 4UQTA 4I2QA 5EE1A 2Z2YB 3HCXA 2K8GA 3HPGA 1WSFA 4CESA 1O6XA 5BR8F 3RR8A 4ZOHC 5KFPA 2QWRA 4BRNA 3TP2A 2QWPA 5L39A 4L3NA 2RP5A 4GMJB 3V6JA 4J03A 2E5LK 4K59A 2ZIVB 3ZETB 3D2EB 1HRHA 4ZKAA 3ISBA 4I2FA 1E6YB 1AA1B 1R6VA 2I6XA 2HS3A 1ZQKA 3MM7B 1QQ5A 1SKWA 2QA2A 1EAYC 1U0HA 3O9QA 3OT9A 4DR5F 1T3NA 3NVMA 4QW8A 2YHBA 4ZPTR 1UETA 2LEAA 3NS7B 1PJ5A 3UKRB 1S48A 3CCQN 4I29A 2VFUA 1COOA 3T1HJ 5ALNA 1R8BA 2RQKA 4OMFG 2CG8A 1AFJA 2GUIA 2QA4N 1TGOA 1SV5A 4P0PB 3G87A 4O0IA 2V50A 1BL3A 2FQQB 4Q7AA 3MM6A 1UCNA 1PG5B 4ZVTB 4NLXA 3IM9A 1UTAA 3T79A 4DV4J 1OVYA 1F1BB 4DV2J 2BR0A 4P2HA 2ZH8A 2ZH2A 4X4OA 3K7RA 3N79A 3MFHA 4YOWA 4ECXA 2KKVA 4F0KA 2HLTA 2GGPB 2P51A 2DPIA 2P9EA 1GLLO 1QVFM 3EJMA 2WVBA 3GFZA 3EXYA 2JWNA 1NXIA 1SIZA 2RS8A 4YMMA 4I6AA 3PX6A 2BW7A 3V9WA 1NMNA 2PDAA 1FRHA 5CEHA 3W3DA 2JX2A 5C24B 2KHVA 2FZCB 2OPPA 1JL2A 4LVNP 4IZ9A 2ZKTA 2IY5B 2YH0A 4LBHA 4LF6K 4W5NA 4HAIA 5A2QY 5AXNA 3GV5B 1KN6A 4BC5A 4RT2A 1Z00B 1M5SA 5IIMA 4LR7A 2WSEC 2ZNZA 2M52A 3EZWA 4LF8F 2MLYA 2ODGA 4P2FA 3ETLA 4TLRA 1XMBA 3KIOA 2XMVA 3JAMY 4IOAL 3H2UB 2ES6A 2BPFA 3GU3A 2XY6A 2C42A 1FKOA 3MUTP 4YD1A 7AT1B 2HOEA 1HL6A 3WXMB 3F2BA 4K4VA 5CXTA 3WDOA 5U47A 2FVPA 2XZWA 2CGJA 3BZQA 1NUEA 1WF1A 3MUMP 4UZCA 1S1TB 4M5JA 3WNGA 1XUPO 4KB1A 3D6JA 4EELA 2JLGA 4DR2J 1PSDA 2PFDA 1MN8A 5GVQA 3CCJS 4OGEA 1C0UB 4TXSA 2ASYA 3QE9Y 4IO8A 2R4FA 3ITHB 2FC9A 1M6YA 8ICAA 4LMZA 2HFVA