1L3SA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*G)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3sA01
3M8RA 2JZBB 4E7HA 3P1GA 2ZD1A 4PWDA 2FPLA 3NH0A 5DDMA 3K5LA 4XUSA 2BANA 2UVUA 3SZ2A 3VQ6A 3K57A 1XC9A 4CJWA 3C21A 4F5NA 1BI4B 2RPIA 3RB0A 3AU6A 5BPCA 2D0BA 3T5LA 2C28A 2JEFA 2XCAA 4FLWA 4QW9A 4KREA 3AU2A 1ZQGA 4KPYA 4KLGA 5HRSA 1A76A 2KFNA 3V6JA 4CHYA 3NHGA 2PFNA 4OJRA 4FCYA 1IKWA 4H8KA 3SCXA 2ZTCA 2Q3SA 1ZBUA 1YTUA 4KHQA 3RMBA 1ZQIA 4DL3A 5J0QA 4J9NA 1ASUA 1VSKA 4F5RA 4KO0A 4RG8A 3K5MA 2W9BB 2PYJA 3RJGA 3SQ4A 3OYMA 4E0DA 5KT4A 1QTMA 4RW6A 2Z1GA 4FBTA 4Q43A 2YHAA 2D0CA 3C5FA 2A1RA 3QEBZ 4CHQA 5HHIA 5KI6A 4F4YA 3JPSA 2C2EA 1HYSA 2YV0X 1D8YA 3OYGA 4FLYA 3UXOA 4CJQA 3G0ZA 2AGQA 4B9LA 4OVLA 3C1ZA 3C6UA 4BWJA 4C8KA 4JRQA 3V1QA 4BDYA 5J0TA 4Z0UA 4OGCA 4CGIA 7ICIA 5KFRA 2YNFA 4E3SA 2ATQA 4FM0A 1N5YA 4QZAA 3IAYA 3JPQA 2FMPA 4RQ4A 4O4GA 5J0SA 1ZJMA 3CM6A 4CHZA 4ELVA 3DLEA 1ZQJA 3AVIA 3OS0A 2W8LA 5CB1A 1FXXA 7ICUA 3MEGA 3L2WA 2F8SA 5KFCA 3LPTA 4RQ3A 2KZMA 4UB4A 2YKNA 2PI4A 5F9LA 3LALA 3ZSQA 1VSFA 4DO9A 4FJMA 3BQTA 3RB6A 1F21A 2DFFA 3VA0A 4JS4A 3CM5A 5KT2A 3AO4A 3AVAA 4CF0A 1HJPA 3ZD9A 8ICEA 3WNFA 3OS2A 4GXKA 3VQ5A 1B9FA 2ATLA 9ICMA 8ICQA 4M6WA 4B8CA 4IBNA 2Y1IA 4CGJA 1KSPA 1ASVA 3HP9A 4Z4FA 3KD5E 1CUKA 3RRGA 4RUAA 4CEZA 1I3AA 4KLTA 4F2RA 2FBVA 2P6RA 3N4MB 5CWRA 1Y97A 1JLFA 1TKXA 1HRHA 1ZQAA 1RCHA 4DMNA 4ECTA 4FJKA 2YHBA 4JWMA 5J29A 1JLBA 4CF8A 4O5BA 4AHRA 4OLBA 9ICPA 2JZBA 3AVNA 5KG5A 3I0RA 2QK9A 2WTFA 1QSSA 3UQ2A 4F8RA 5DBAA 4LSLA 3PW7A 1TKZA 1BI4A 1ZQOA 2Z1JA 4KLSA 5DG9A 5HHHA 4H4MA 2AU0A 1J53A 4O3QA 3ZSVA 1NOMA 2HHVA 4CESA 4Z6DA 4DSLA 4FXDA 1Z3EB 1XSNA 1K6YA 3OYNA 4CJSA 1CXUA 1ZQFA 3TAMA 3WNGA 4FVMA 2BPGA 1GOCA 3A2FA 3M9OB 2BE2A 4ZHRA 1ZQYA 1GOAA 1EETA 2W9BA 3EYZA 1BQNA 1LW2A 5C5JA 4K4IA 2G8UA 4E1MA 3MGHA 5CYMA 3HWTA 3QIOA 1HYZA 3Q8KA 3MAQA 3CFRA 2BPCA 1IO2A 1BISA 4O55A 1Y88A 4F5PA 4F5OA 5DG7A 1TK0A 1DOQA 3RMDA 5J2IA 3VQ8A 4M9NA 8ICOA 4M9JA 1ZQPA 5J2CA 9ICQA 2GV9A 2BKEA 2QKKA 1HQUA 3OYEA 4J9MA 4NM1A 3MXJA 3NAEA 2UVRA 1TVAA 4O9MA 1GOBA 3AVMA 4ECSA 5L9XA 3AVKA 4W5TA 3BQ0A 3LP2A 4QZFA 2X6SA 3H7IA 3VN5A 1Q9XA 4O3RA 3QO9A 1BHLA 4N47A 3EY1A 1WCNA 1KDHA 3OHAA 2DPJA 1VSEA 4UQGA 1T7PA 4UAYA 1ZBIA 2PI5A 1RXVA 5EWEA 3VQEA 4K8XA 3VQBA 1Q8IA 3MABA 2HW3A 2KZZA 3RBEA 2BGGA 2ASLA 1WNSA 3SQ2A 3M9NB 4I7FA 4CK2A 3PY8A 4J2DA 1NK9A 4QZHA 1S6QA 2XY5A 3SUPA 3LZJA 5HP1A 7ICMA 3OS1A 4EP5A 4I2QA 1JL1A 3KK3A 4M47A 4O3PA 1WLJA 1N56A 3LP0A 2G8VA 4DL7A 1L5UA 3QNOA 4MFBA 3KHLA 4FK2A 5BOMA 3TABA 2A1SA 1LWCA 4LSNA 4OKEA 2OPRA 5CZ1A 4FJNA 4AHCA 2P1JA 4FJLA 4KMUA 8ICJA 5TZVA 3B6PA 3ORYA 3RTVA 2ZTDA 3DM2A 4J9LA 1XSPA 5KRSA 2VANA 4I2AA 4HCBA 2HB5A 3RJEA 1L3VA 3T19A 2W9CB 8ICYA 4R66A 4PQUA 1S5JA 2D0AA 1H38A 4F3OA 9ICHA 4FM1A 3MXMA 5J2PA 4J9PA 2BQ3A 4QW8A 2ASJA 1ZYQA 4EBDA 4Z6FA 2PFOA 4BXOB 1C1BA 2X78A 1KEJA 5DBCA 8ICPA 3BQ2A 5E41A 5J2HA 1NKCA 3CG7A 2Z1HA 2AGPA 5CZ2A 5KFKA 4I9LA 4DTJA 1NK0A 2YNGA 4KN7A 2H5XA 1MC8A 4UAWA 4M0AA 2HVIA 5EOZA 1NJWA 3V72A 1IXRA 1C6VA 4O3OA 2OA8A 4XA5A 4RW8A 1Z26A 4MFAA 4I2CA 1VSJA 1X9WA 1O1WA 3K5NA 1ZQHA 3PW0A 2NRVA 3K58A 3NE6A 4KLFA 7ICRA 4FJ9A 1QLNA 4PGQA 2C22A 4W5QA 4NXZA 1ZQEA 2O4IA 2AQ4A 3C2KA 3V9WA 7ICQA 5HNKA 4CEOA 2R8JA 4CHPA 1NK7A 3PR5B 5C24A 4QWBA 4KTQA 2UVVA 1YVUA 2OPSA 4JLHA 8ICZA 2WONA 3SUNA 2J6UA 1SV5A 3HYFA 1BPDA 3DI6A 4NLKA 2FBYA 3AV9A 3KKRA 9ICUA 2A1JA 4YVZA 3C95A 3RH6A 1U49A 4CJRA 3MECA 1CZBA 3RWUA 1KLNA 4EZ9A 3L8BA 2IDOA 4NLZA 1XS9D 4EEYA 4XRHA 3V7JA 3KLEA 4GC7A 2I9GA 5C42A 5J2KA 4O5EA 1S1WA 2BCUA 5DG8A 1S0MA 4NYNA 4B3OA 1TGOA 1HJRA 4YD2A 3SV4A 3UQ0A 2ZE2A 1NOZA 4B08A 3TFRA 4M41A 3DLGA 4RW9A 4IG3A 4DF4A 4M3ZA 4CECA 3RJFA 2DTUA 2I5JA 1LAWA 4AILC 2FMSA 2OWOA 3NF9A 2XY6A 4DOAA 2B21A 3EPGA 4CGFA 3KHGA 2BCRA 3AVBA 2GUIA 4ICLA 5J0XA 2YNIA 5SWMA 2GBZA 3M8QA 1RT6A 5KFAA 1D9FA 4CIFA 5KFWA 5I3UA 1C0TA 4FJIA 5KGWA 4BE0A 3EWAA 4DOBA 1RNHA 4M6WB 2EHGA 1T03A 3JYTA 1NKEA 3CQ8A 3NGDA 4TURA 2OYQA 3JPPA 3QLHA 5FRNA 4FJXA 1HPZA 2ZUDA 4HVJA 4RW7A 7ICVA 3T5JA 3C23A 4E7KA 1C1AA 1RILA 4CEDA 2Y1JA 4LD0A 4PHDA 5FRMA 8ICXA 4J2EA 4FLUA 2BR0A 1CZ9A 4PPXA 3SQ0A 5CJ7A 3MEEA 1ZQUA 1NK4A 1NK6A 2I1QA 1A5XA 8ICKA 1RBSA 4LZGA 5HROA 3TWHA 1XU4A 1HQEA 4C8MA 4CFCA 4I2JA 4FS1A 3L3UA 1KCFA 1ZQVA 1S6PA 3QZ7A 3WNEA 1LWFA 2IBKA 1IKXA 3C6TA 3HJFA 3T3FA 4FZZA 1SKWA 5D4BA 4E1NA 3V9ZA 3AO1A 3DRRA 3M9MB 4IRCA 4UB1A 3VQCA 3RB4A 1ZQQA 1QHTA 9ICRA 5D46A 4RQ7A 5JS1A 1NOYA 3L2RA 4L8RB 5KFPA 1B43A 1CEZA 4CJPA 2FPKA 8ICTA 2ISPA 4FK0A 3B6OA 4IR9A 4DL2A 8ICUA 3Q8LA 4KLJA 3MR5A 2ASDA 1W9HA 1ZBFA 1Q9YA 2NRZA 2V9WA 3RJKA 2F8TA 1KVCA 1XSLA 3PR4A 8ICBA 4I2EA 3K2PA 5KFXA 3OHBA 3O3FA 2HHQA 4DFJA 4QWCA 5J2NA 4M04A 3MR3A 3TAPA 3H4BA 7ICJA 5KG4A 4M9LA 1CLQA 3LWMA 4DFKA 4YMOA 3KK1A 4ED2A 1LB2B 4B9VA 4C8LA 5EWGA 5KFVA 2KZ3A 1JLCA 4KLLA 4QZ9A 4YMNA 4QZCA 1U48A 1NJYA 3RAXA 3DMJA 2IHNA 4KLIA 3LANA 1S1XA 1YT3A 4DQPA 5KFLA 3QZ8A 4DTXA 3Q8QB 1RTJA 1B92A 1JX4A 4MFFA 3S3OA 3RJIA 9ICGA 2D5RA 1ZETA 3OSNA 2HNZA 3AVGA 4CF2A 3RMCA 2NRWA 3QEIA 1UAXA 3SPYA 4KLEA 3B0XA 3AVHA 3G6XA 3DRPA 2NRXA 4FLXA 4YMMA 1RBTA 3GIKA 1KRPA 5IIJA 4DTNA 4Q8EA 2PFQA 4CJUA 1BPZA 4UB3A 5J0YA 4CFBA 1KTQA 2B6AA 5KFBA 4CIGA 2YNHA 4BDZA 3HVRA 4Z6EA 4RQ0A 1C0MA 4AHTA 4F4KA 3KLHA 4DL6A 1SUQA 1J5OA 2Z1IA 1SKSA 5IILA 1EXNA 3NF6A 1RBVA 3SQ1A 2EX3A 4M3YA 1X9MA 1QE1A 4P4PA 5DKWA 3RJJA 1L3UA 3KLFA 2DFLA 5JUMA 1RTDA 4ED6A 4CFAA 3V81A 3T1AA 3IHQB 4RT3A 1T05A 2FLPA 2KTQA 4O44A 3VA3A 1JXLA 3OYHA 7ICPA 3C2LA 3Q8SB 4BDPA 2P66A 3RJHA 8ICLA 3D45A 4IR1A 4RQ5A 1U47A 4ELUA 1JLQA 1SL0A 4QOZB 4IRDA 4JV2A 4KI6A 4F4XA 2C2RA 4G3IA 5T7BA 1RDAA 4CCHA 4TQSA 4EBEA 5HRPA 3KHHA 5DGAA 1UA1A 5KGXA 1RTIA 5HMMA 4Z4IA 4RW4A 1TAQA 4E7IA 4IFVA 4HHTA 1VSIA 3ZDAA 4B9UA 1W0HA 2O4GA 2X6NA 4M45A 4CE9A 4FJ8A 3S9HA 4Q44A 4UAZA 3THVA 1DGSA 1TFRA 3V9UA 2F1IA 4DSKA 3PVXA 4E19A 3L3VA 3QEAZ 4CFDA 4DTPA 1B22A 1WSEA 3ISBA 3U3GA 4CGGA 3HVTA 9ICEA 4YR3A 4DLEA 1S9FA 4DQQA 1ZQCA 4FK4A 2OZSA 4OKJA 7ICOA 3GQCA 5KFIA 4YFUA 3AVJA 3TR8A 3MBYA 4KHYA 2C2DA 4YNQA 1HYVA 3HPHA 4CJ5A 1T4GA 4PUOA 2IOCA 3EW9A 1WCLA 2RDIA 2NRTA 5J2AA 2YKMA 3DOKA 3E2EA 3ZDEA 3MR6A 4DU3A 4F5QA 3PW5A 4JK1A 3M8PA 1BQMA 2A1JB 4CERA 2UVWA 5C25A 1SL1A 4I2DA 2HHSA 1RT4A 8ICSA 3DLRA 5D3GA 2KN7A 4NY8A 3S3NA 4Z4HA 1DLOA 2XRIA 1N6QA 5I42A 3VQ7A 5IINA 3O4NA 4CEEA 4RPYA 3PW4A 4QCLA 8ICCA 4OPJA 4CEAA 1XHZA 8ICMA 9ICAA 9ICFA 4CJ4A 4AHUA 1WSJA 1ZBHA 3OYKA 5KFYA 5DLGA 9ICXA 1EXQA 2WOMA 1JLGA 4YXMA 5DQGA 5KG6A 3P5JA 2ZTEA 3GFKB 3AUOA 3ZSYA 5KFQA 4KRFA 1J9AA 4DSJA 4ECUA 7ICTA 3AA5X 4QZEA 9ICBA 1RT7A 1QS4A 4B9MA 1VSDA 4DSIA 3S3MA 1ZQWA 4KHUA 1JXEA 3FYHA 1LAVA 1RT2A 2HHTA 4I2GA 1B9DA 2DFEA 4FM2A 4FZXC 4GW6A 4CJ3A 4M42A 3RB3A 4ECQA 3L2UA 4ECXA 3UXNA 2VA3A 4FLZA 4PHEA 4YQWA 1EKEA 1U9LA 3MR2A 4DS5A 4W5NA 5IIMA 1TVRA 9ICLA 3GV5B 4FJGA 1TV6A 1G15A 1JL2A 4EP4A 7ICEA 2XCPA 2FLLA 1WAFA 2PZSA 4J9QA 3SNNA 2J6TA 5DQHA 5DDYA 4J9SA 1A5WA 1BIUA 5KTQA 4HUFA 3OYIA 3K59A 2E6LA 3NH2A 3KKSA 2MUTB 3GV8B 1MU2A 1SL2A 2F1HA 9ICIA 4LH4A 5KFSA 2KQ2A 4DS4A 2ALZA 2DPIA 4PHAA 2KFZA 4NCAA 4M3UA 4LY7A 7ICKA 9ICSA 3RAQA 4CGHA 1RDCA 2ISOA 5CA7A 1UA0A 3H40A 3QEXA 4KHWA 3PMLA 3KD1E 2R8KA 1RXWA 1SKRA 4RQ1A 4R64A 4F50A 1ZQXA 3QEPA 1QSYA 3FFIA 1BPEA 9ICTA 5KG7A 5KFHA 5DK5A 4FJHA 8ICGA 5HLFA 1T3NA 3KLIA 3CFOA 3GV7B 3PUFA 5CYQA 3EZ5A 3V9XA 4GXIA 4N41A 3TQ1A 1S77D 4M9HA 4MF8A 4MEYA 4FZYA 1WN7A 3CFPA 4BACA 1U04A 3UIQA 4KKOA 4XQ8A 3QEVA 2B4JA 5HMLA 1WSFA 3NGZA 9ICWA 1R0AA 4HYKA 5DB6A 1RBUA 4FS2A 3SPZA 1KVBA 3QIPA 4RNOA 3LZIA 2V4RA 1S1VA 3LAKA 4PY5A 4TUSA 4GMJB 4AHVA 4KLMA 4MFCA 1Z25A 2IGIA 4Q0BA 1X9SA 1ZQKA 4I28A 3AO2A 3HM9A 4PGXA 1TAUA 2PY5A 5DBBA 1JKHA 3ZCMA 4CK3A 4CEFA 1XO1A 2F96A 3HPGA 2VWKA 4JRPA 3G6VA 1JN3A 4EYHB 3TANA 1S1UA 1LWEA 9ICCA 2J6SA 4IQUA 3DLBA 3U6FA 3TAEA 5EU7A 1UT5A 5J2GA 3AVFA 4Y1CA 4E7LA 3JPRA 3IG1A 4I29A 4HUEA 4E7JA 5L1LA 3V6KA 4IQTA 4QAGA 4DOCA 3SI6A 4DTOA 4I2BA 3SUQA 4YXJA 3NF7A 3KJVA 3HK2A 9ICJA 4UB5A 1YTAA 4OLAA 3ISCA 1RT3A 1TK5A 3HP6A 3JPOA 1JLAA 4GXJA 2ZQBA 1DTTA 3K5OA 3RR7A 4B8AB 3T5KA 3PO4A 8ICRA 3GIJA 5IIOA 3ITHA 7ICNA 3OJSA 2QXFA 5HRNA 3H08A 2FC0A 3DOLA 4LH5A 1RYRA 4YR2A 3GIMA 4FYDA 1TK8A 1Z00A 2RN2A 3IM1A 1ZQMA 1BL3A 4KHSA 5IIKA 3F73A 5EWFA 2MUTA 9ICVA 1LW0A 4O5CA 2AJQA 3C1YA 2R8GA 4ELTA 5KFZA 1LV5A 5KFMA 2FMQA 4XIUA 4KLHA 2X74A 3PX0A 3V4IA 4C8OA 2IS3A 3MFHA 4YCXA 3LP1A 3AVCA 4AHSA 3N97B 5KFUA 1VSLA 1IG9A 2FBXA 5DB9A 2XC9A 3G6YA 3SYZA 3ZDDA 3M8SA 4EZ6A 3L2VA 3LP3A 1RDDA 5KG3A 5KT7A 2FPMA 3ZT0A 4ED7A 1U4BA 4KITB 1XI1A 4KLOA 1A5VA 4CJLA 4ED8A 3AA3A 2P5GA 4BWMA 3NGYA 2LSNA 7ICFA 1JXBA 4FLVA 4N5SA 1RDBA 4NCGA 4W5RA 4KV8A 1BPXA 1RBRA 3FDSA 3Q8RB 3K4GA 1MSWD 4C8NA 3AO3A 2JEJA 3UXPA 5J0RA 5J2DA 2BHNA 3GILA 3V7LA 4Q5VA 4DL5A 4RQ2A 4CHNA 4ED1A 2VA8A 1ZJNA 2HHWA 2VWJA 3QNNA 1UT8A 5DGBA 1FKPA 1ZQDA 4JV1A 1ZQSA 2XY7A 2JLEA 3B0YA 3IRXA 1BCOA 5KFOA 1EP4A 3NGIA 4F4WA 3QERA 4G1QA 4N76A 3OYLA 1MQ2A 4QZBA 5HP4A 5D49A 1KFTA 3ISNC 3BGRA 2ZUBA 4HTUA 1IKVA 4FJ7A 4CHOA 3HSTB 2ZJ8A 4GLXA 1KFSA 2B5JA 4F91B 4DG1A 3PO5A 2MAXA 5HBMA 3ZT3A 7ICHA 8ICIA 1VRUA 7ICSA 1NJZA 2R7YA 2R8HA 4BE1A 4DU1A 5CHGA 3HX0A 4B9SA 1HUZA 4FLTA 5CR0A 4F92B 1BIZA 3NCIA 3HT3A 4J9KA 3OVNA 3WNHA 2P51A 1TV9A 4M3WA 7ICLA 3V1OA 4FJ5A 3ZD8A 1VSMA 4QZ8A 4QWDA 3PV8A 5DB7A 2G8HA 1TL3A 4Z6CA 5KG0A 1NK8A 4X5VA 5F9NA 1REVA 4I2FA 2IAJA 2AQ0A 4DTRA 5J2JA 4JWNA 3HL8A 4M3TA 1VRTA 3C94A 2KW4A 4O3NA 4QWEA 4YP3A 3V9SA 3DRSA 5K14A 4M3RA 4CJKA 5J2BA 4YR0A 1RTHA 1S97A 1X1PA 1S76D 4KI4A 2HMIA 3OSPA 4NYFA 4TUPA 3VQ9A 1TKTA 5JS2A 1BCMA 2PXIA 4R8UA 4P2HA 2XY8A 4CIEA 3RRHA 2RDJA 3KTQA 1S0VA 1BVSA 4IG0A 2PFPA 4ZH4A 2Q0ZX 4DF8A 1HMVA 2BCQA 4Z4CA 4ECYA 4E89A 1S10A 4DQRA 4RZRA 1WAJA 5KFFA 3ZSOA 1K1SA 4RPXA 1RYSA 4UB2A 4BE2A 4NLGA 2BGWA 3DLHA 2FLNA 3P83D 5SZTA 3UPQA 2G8FA 9ICNA 4CJTA 3U3YA 2M9NA 1KFDA 1QQCA 3NTUA 2IHMA 1A77A 4YFKA 1JLEA 4DSEA 3L2QA 5L1IA 5J0OA 8ICAA 4KLQA 7ICGA 5KT5A 3MDCA 1KLMA 4RNNA 3O3GA 4IQVA 4IRKA 2QKBA 1WSHA 2IC3A 4ED3A 4KTZA 2W42A 2OPPA 1HNVA 2G8WA 4RU9A 4J2BA 4ECZA 3PX6A 4CK1A 5DB8A 3BDPA 4WE1A 1ITGA 3PMNA 4KFBA 5KG1A 3C2MA 4DLGA 3NH1A 4HCCA 4CJEA 3PX4A 1FKOA 3D0PA 3MXIA 3QINA 4FW1A 1S0OA 3RH4A 2W9MA 4ID1A 3ZT2A 1VSHA 4PHPA 4P4OA 2VG7A 3MEDA 4HUGA 3PW2A 4DU4A 1NKBA 4CJFA 3KIOA 1L3TA 5KT6A 3MDAA 4OGEA 4J9RA 1JIHA 3LDSA 4YG2A 2BDPA 4JV0A 1K1QA 1TKDA 1ASWA 2HHXA 1I39A 3SJJA 1BGXT 2GWSA 4B9NA 4R63A 4PH5A 3SV3A 1CXQA 3H8WA 5J1EA 5J0UA 4UBBA 4JS5A 3H4DA 4ZTFA 4Q45A 3RMAA 1FK9A 4QZDA 2VG5A 1UOCA 4J9OA 4O3SA 3AA4A 3VQQA 5CP2A 4UBCA 3I8DA 4OPKA 2XO7A 3RR8A 3HXMA 4KHNA 2ZJAA 4DFPA 4ID5A 4ED0A 1C0UA 1HNIA 3O4QA 5CY4A 2HNYA 5KRTA 4KB0A 3F9KA 2E4LA 1MQ3A 4DTSA 3AO5A 1D8LA 3HO1A 2HHUA 3OGUA 4CF9A 3HW8A 5KT3A 4M3XA 4MF2A 3OYDA 3ZSZA 4DQIA 3AA2A 1S9EA 3OYCA 3MGIA 4RPZA 4I2HA 5KG2A 4IFYA 3VQ4A 1ZQZA 1L3SA 1QSLA 9ICOA 2RKIA 4F4ZA 5IIIA 4YN4A 1AROP 1KVAA 3VQAA 4KAZA 3V6DA 5DLFA 2XHBA 5J2FA 5DQIA 2OPQA 1JMSA 3KLGA 3KK2A 3NF8A 2HVHA 4O0IA 3JPNA 1C7YA 4DEZA 5KFEA 1UWBA 2JGUA 2G8KA 1ZBLA 2FBTA 3ZT1A 1Z00B 4GVMA 4M9GA 4RQ8A 3C5GA 4Z4GA 8ICFA 4CGDA 1S0NA 5FDLA 2XGQA 3V6HA 5L1JA 2R8IA 3QETA 3G10A 4CF1A 4KB1A 2BCSA 1RT5A 4CEQA 5DMRA 3QE9Y 3V1RA 2E6MA 1NK5A 8ICWA 1ZQNA 4F93B 3K75D 3ZSXA 5KFGA 4IKFA 1IM4A 2AGOA 4NCBA 3TAQA 3Q8MA 4H4OA 1RT1A 1PZNA 3JPTA 1N48A 4RNMA 3E01A 4QZIA 5J2EA 3ULDA 9ICKA 4FO6A 3LAMA 2G8IA 2DY4A 5HRRA 5KFTA 4PGYA 3LK9A 4DL4A 1RZTA 4K8ZA 4K4GA 4N56A 3KHRA 1X2IA 4QWAA 4ECWA 1WSIA 4O0JA 4RQ6A 2XGPA 4BGDA 1IKYA 2DFHA 4QZGA 4Q8FA 4K4HA 5FROA 4DQSA 3NBPA 3TARA 4M2YA 4DWIA 3ZSWA 8ICVA 3DLKA 4IDKA 5BOLA 1D5AA 3EPIA 1WSGA 3ASMA 4KN4A 1TL1A 4CJVA 3DYAA 3H8SA 2ZUCA 3OYBA 1BPBA 1NJXA 3BQ1A 4KLUA 3ISDA 3LDAA 3BJYA 2IMWP 4ECVA 2F1JA 4R5PA 2OZMA 4R65A 4Y1DA 3OJUA 3RBDA 4I9QA 5J2MA 1DTQA 4YD1A 8ICNA 2BPFA 4TSXA 4MQ3A 1BPYA 1IH7A 4MEXA 2IA6A 2JEIA 3NDKA 4GC6A 4B9TA 5L1KA 2VG6A 4NLNA 4Z4EA 4LVSA 4TUQA 3NFAA 4NM2A 2BCVA 3AVLA 3O3HA 1T8EA 3OYAA 3LWLA 3GDXA 3ZT4A 3V7KA 4F2SA 3OYJA 3MFIA 3ZDBA 5J0WA 3TAFA 4O5KA 3Q8PB 4FW2A 2V4QA 3TFSA 3SUOA 4ZTJA 4JUZA 1XWLA 1VK0A 3PNCA 5KFJA 4F3TA 4J2AA 3VQDA 3JSMA 5J2QA 2ETJA 4I2IA 3ETLA 4TQRA 4CEBA 3ZSRA 3OY9A 4OKKA 3OYFA 4KLDA 3H8JA 1HUOA 1S1TA 1D9DA 2P5OA 2P6UA 1ZQTA 2NUBA 4W5OA 3T5HA 2W8KA 1U45A 5J0PA 4EYIB 4I27A 3GIIA 2LYHA 1C1CA 3ALYA 4AH9A 1ZQBA 5KFNA 2BQUA 2JEGA 5KFDA 3TI0A 4P4MA 4DTUA 3RH5A 2RF2A 1V9PA 4DTMA 4RT2A 4DSFA 1ZQRA 4FJJA 1RPLA 4KTWA 3CYMA 3SI8A 4FBUA 4EBCA 3HPOA 4IQWA 4I2PA 4RUCA 1EX4A 4ECRA 2PYLA 2W9CA 4R8UB 2VA2A 1SZPA 8ICHA 3I0SA 2BQRA 2ZJ5A 1J54A 1COOA 3VQPA 1XHXA 2W9AA 3QESA 2ITGA 3IS9A 3ZDCA 1ZQLA 4DFMA 3QEWA 2HNDA 4BXOA 3TAGA 1S9GA 3LPUA 4LZDA 4PA1A
chains in the Genus database with same CATH superfamily
2E9RX 2D74B 4ILHA 4C0OC 2JZBB 4WJ3B 4PWDA 2V2VA 3K5PA 3Q83A 1XC9A 4CJWA 5D0EA 3C21A 4F5NA 1HQ2A 3RB0A 3AU6A 2D0BA 2OANA 1Q8LA 2J7KA 2C28A 2VH7A 3LGHA 1RA6A 2Z30B 3T9ZA 1P9QC 2CDQA 2Y0SD 3O9TA 3KLVA 4DUZF 1SGGA 3AXMA 3OR1A 3T1YJ 3WQUA 1G7CB 2LQBA 5AKJA 3V6JA 3NHGA 2ATCB 1WD6A 5AKYA 1YTUA 2AD9A 4WE1B 1ZQIA 4DL3A 4KFBB 5J0QA 5LT5A 3BPSP 2G2OA 2KM8C 1EX8A 1R89A 3QU7A 1AFJA 4RG8A 3K5MA 2PYJA 2YHXA 1FKOB 2YH0A 2G0JA 1M1HA 1ZOTA 3OYMA 3RVCA 4ZPVR 3WX4A 2Z0GA 3NG8A 5JVHQ 1XEZA 2AX1A 2VG7B 4RW6A 2Z1GA 4FBTA 4Q43A 2YHAA 4PHTX 1GMUA 1D8ZA 5KI6A 3UDLA 3JPSA 2C2EA 1FVSA 4KGMA 3KFUF 3CGIA 4YHHF 4FLYA 3UXOA 4HACA 4QS9A 3QYPA 4CJQA 4OVLA 3C1ZA 5AI9A 1JJCB 2LQ5A 3FR0A 4H0VB 2B7BB 3V1QA 4BDYA 2NZ4A 5J0TA 4GVBB 4ILLA 4ITSA 2Q0RA 2I2YA 4E3SA 3IAYA 3MI7X 5T41A 4CM0A 1DGKN 1N88A 2FMPA 4NWIA 1GT8A 2HFZA 5MAOA 4A8WA 4TN2A 3OS0A 1R59O 5DS7A 5CD4H 2W8LA 4ZDNA 1PYTA 1GMVA 3QUCA 2CQ1A 3MEGA 5KFCA 4RQ3A 2FHMA 2KZMA 3TEHB 2YKNA 2KJ8A 3QJJA 1U8WA 4JAXA 1VSFA 4FJMA 1ZRMA 4NEYA 4I7FB 5ALOA 3UPFA 1AZSB 3DXSX 1RWXB 5KT2A 3CJAA 3AO4A 3W9JA 1FRLA 2GO7A 4EGLA 5F8JA 4CGZA 1OSDA 1RU2A 2VDHA 1NJIT 2ATLA 2RIJA 3W9IA 3IGNA 5IM0B 4TU7A 2Y1IA 2N4CA 1B0TA 1KSPA 3HP9A 3CCVN 1D09B 1FEEA 3KD5E 2VB6A 4MFBB 3LDOA 4MN4C 2WVEA 3GFYA 1LWCB 5KOWA 1T94A 2DD8S 4GKKJ 4F2RA 2L9NA 1UWBB 2P6RA 2MQMA 3CPEA 4AL6A 2GHVC 2W2OP 1TKXA 4ZLPA 1RCHA 4BRDA 4DMNA 2KNJA 1Q7LB 4LF4J 5CR4A 2KSOB 1OVYA 4CF8A 2WF8A 2GFFA 1GMWD 1W25A 2QEXS 4HH0A 2R2TA 4Z7CA 3QJPA 3I0RA 4L73A 2QK9A 2WTFA 4ZP8A 5AQKA 1ZPVA 1VBZA 1QSSA 3THYA 3R9LA 2BJ1A 5J2PB 1BI4A 2VU5A 4NXMK 5DG9A 5GIOA 5D0RA 4JNEA 2QSFA 2AU0A 1QVGM 4WQ4A 2HHVA 1RWOB 4FXDA 1XSNA 1FESA 1YIJS 2IDEA 3CCQS 1CXUA 1ZQFA 1FRXA 3T9NA 2MKJA 2RRAA 3TAMA 1FNXH 3WNGA 3WKBA 3TX8A 3A2FA 4C23A 4B1YB 3HZGA 2OFGX 2IVOA 1GMWA 4YS2A 3OL9A 2HBJA 1FFSB 4UB8U 1ZQYA 4LR8A 3NBPB 5ALZA 4YORA 4DUYK 4GKKF 1LW2A 3U27A 4K4IA 2WSCC 2G8UA 2DKOB 2D3DA 5CYMA 1RKIA 2KLAA 3VVTA 3VTIA 2RQMA 3EWGA 5E3RA 2HRYA 1Y88A 4F5PA 3TVKA 3RMDA 5J2IA 3VQ8A 4M9NA 2KT2A 2M5YA 1ZQPA 2HQIA 5HR7A 3Q22A 2ZOFA 3US5A 2A2DA 3DN9A 5IV4A 3NAEA 4OI4A 4O9MA 2LDIA 1GOBA 2VG6B 5L9XA 3BZKA 1KAXA 5JMNA 1IR0A 4DU8A 3H7IA 1Q9XA 1R6VA 3O0FA 5AHXA 3QO9A 2V67A 2ZWPA 2B3TB 2K4HA 1T7PA 3ZFVA 1I3OB 1WACA 2F9DA 1Q8IA 3FLCO 3K9JA 2KZZA 2ASLA 1CQMA 1VLOA 2B56A 4CK2A 4C2MA 1NK9A 1YJNS 5J2QB 3ETRA 3ATVA 3SUPA 3LZJA 1Q86O 4FPIA 4OJHA 3BZCA 3FQKA 2HF3A 2DNRA 3DLGB 4C3LA 3OUYA 3QUQA 2V6AA 4FVCA 4I2QA 1X6JA 4JD2A 4YDUC 1Z1BA 3KZIU 2BRKA 2W1BA 4O3PA 4JI2K 1BMQB 2G8VA 4DL7A 2NV3A 1XBWA 2MEWA 2O66A 3LUYA 4LRBA 5AI4A 4OKEA 2W41A 1RT6B 2CADA 2VDIA 2RF2B 4B3RK 4IQMA 4KMUA 1Z4UA 4WP3A 3UE5A 1KHVA 5E3AA 3ORYA 3P4UB 2QW9A 4BQZA 3RTVA 4ZPDA 5RUBA 5HMZA 2IRYA 2CVIA 5KRSA 2DR8A 4I2AA 4HCBA 4I2PB 2HB5A 3RJEA 1G2EA 4CLKA 8ICYA 4DV6J 5AE3A 4U9RA 2MB0B 3THXB 4FM1A 3MXMA 4CZLA 3E8OA 1PBAA 1WHYA 1ZZFA 1U7LA 3W8GA 1ZYQA 4O0NA 3VAHA 1FJEB 2E2QA 2P6SA 2VASA 5E41A 3OT9A 3MMJA 3GSIA 4LF1A 4OJLA 2FZKB 5KFKA 3R7NB 3KNGA 1R31A 2GMLA 2DBYA 3RBZA 4H4KC 1NGDA 4I9LA 1HQEB 2C3MA 1WI8A 3CJ7A 4DTJA 3G86A 1NJWA 3V72A 3R5GA 1Y9OA 1C6VA 2WRMA 3WQPA 4G9ZA 3KWMA 4O3OA 2XMAA 3O9SA 1EO1A 3QBXA 2Q3PA 1CJTA 4OLOA 2HCFA 1X9WA 2K1RB 1N5WA 4OV1A 1O1WA 2XYPB 1R3NA 2E5HA 4KLFA 5EVZA 4U7UD 4NXZA 1SCJB 4F26A 2HVDA 2O4IA 1F9EB 7ICQA 5HNKA 3AD9C 3EMTA 3W66A 2P9KA 2CJAA 2RQ5A 4DCJB 1NK7A 4DV6F 4DPUA 3U26A 1FFWB 3CJQA 3NWRA 2OPSA 1Q81T 4ZN3A 4JLHA 5ALIA 2WONA 2RQKA 2LKYA 3TJ9A 2UXCJ 4JKFA 1SV5A 2B9EA 1BPDA 2DH9A 1KC8T 4Y2XA 4KC5A 2FBYA 4TU9A 1BDGA 1GLFO 1O0PA 3C95A 2P9EA 3H0MB 1QJHA 3RWUA 1KLNA 3IAM9 2JHEA 1PJ7A 4MK8A 4NJ8A 4Q2LA 1YZ6A 4EEYA 1F0XA 3V7JA 1OQ6A 3KLEA 2VGMA 4GC7A 3K1RB 4A47A 2YNFB 2BBEA 3W3DA 4DV1K 5J2KA 2YWFA 5DG8A 3BGUA 4ID8A 4B3OA 3TVZA 1TGOA 3DMJB 4YD2A 3UQ0A 3QRRA 2K7KA 4RW9A 2F76X 3HOSA 2OD4A 3TZWA 1QHAA 3RJFA 2DTUA 2I5JA 2B4PA 2B8PA 3NF9A 2EKNA 3W7BA 2OO4A 3AHPA 3C7NB 5I3PA 4CGFA 2BCRA 3IRWP 2MTLA 2GUIA 5J0XA 2VCPA 2FSJA 4URGA 3BS7A 1KVKA 3MCPA 5KFWA 4XH4A 4FJIA 4BE0A 3CSKA 2D7SA 1SS6A 1RNHA 4ILRA 2KEYA 2W55A 4F3QA 2EHGA 4ZCMA 2LQ9A 3BBFA 5IT4A 3PKMA 4RCHA 2UXBK 3JYTA 1NKEA 2AYMA 5IS2A 3NGDA 2VQEJ 4FFDA 3QLHA 1DRGA 4CYUA 5JMVA 1IR2A 3CJTA 2DKXA 4HVJA 1MNEA 3H5XA 7ICVA 4ZMMA 3T5JA 5B0AA 2UUBJ 2CQ0A 1RILA 4CEDA 2Y1JA 3CETA 4PHDA 3L09A 1JLFB 4MDBA 3O1LA 4XK8C 3QFHA 2OKQA 4PPXA 4MDAA 3SQ0A 4LFAJ 4MTPA 3AOAA 4NLTA 3JQMA 1ZQUA 1NK4A 4M5KA 1NHUA 2I1QA 4V19S 1SQEA 1OH7A 2PT0A 3KLFB 1TL7B 4PXDA 4I2JA 2F63A 1YAGA 1R27B 2P9NA 3D2EB 3HLUA 4K4UA 3DDKA 2Q36A 1MMNA 4HVZA 3T3FA 3KHYA 3K8WA 5D4BA 3V9ZA 1XNRJ 4DUZK 3M4XA 4PKHA 3ZTPA 4N8NA 2X1AA 4ANCA 1F60B 5AK6A 2ZIUA 5ELZA 5D46A 4RQ7A 5JS1A 4DX5A 1NOYA 4BRGA 3IWXA 4CJPA 2VQEF 2FVQA 1N34J 4YB6A 3U8XA 2R7QA 2ZIXB 2ZZTA 4NLSA 4DL2A 2FHOB 3TRGA 3Q8LA 1BQNB 1VC0A 2UUBF 4QIWF 4USKA 1W9HA 1JJ2M 3OQ2A 4ZVRB 2NRZA 2XHCA 4ETZA 1Y7PA 5G4DA 1DKGD 2ZOMA 3J7ZT 2Y0SC 2EFGA 2RHQB 3UMGA 3OLBA 1XSLA 3N6LA 2UUAJ 4LFAF 4I2EA 2E3TA 1URNA 2R7OA 3S1TA 4QWCA 3IBFB 3H1VX 1VQSA 1CLQA 4YMOA 3KK1A 2V51B 2QMUB 4NLVA 5J8YC 3F2DA 2ZIVB 5EWGA 1RDFA 2KZ3A 4K4XA 4P9SA 3DOKB 1EQYA 1JALA 5AK4A 1HW9A 4OJOA 2HS3A 2HIYA 1EQ0A 2IHNA 5K8MA 3M7DA 1Z19A 3C29A 1YT3A 1XNRF 4L3QA 4DR6J 5KFLA 3T1YK 2AA4A 3HHLD 1OPIA 1B92A 2JVRA 1JX4A 5EE0A 4MFFA 2QLXA 3CJ5A 3S3OA 1N34F 2C3YA 3KJQB 3EN9A 3ILIA 3MR7A 3KOAA 1EWRA 4PR6A 1V9OA 2HNZA 4CBWA 3QUBA 4MK7A 4PJ0U 4OZLA 3QEIA 1OH6A 4FXWA 1UAXA 3SPYA 4I0WA 1DAXA 2UUAF 3CMAN 3AVHA 4OV6A 5BN8A 4K4SA 3I8BA 3Q0AA 4FLXA 4YMMA 4YEAA 3UE2A 3S6EA 5IIJA 3LP0B 1LKYB 4Q8EA 1XQSC 4UB3A 2F7TA 1Q4RA 5KFBA 2OPRB 4AYBD 4CIGA 1K9MT 2P9IA 2DHXA 2WSFC 5AFUH 2EAPA 4RQ0A 1KOOA 5AKKA 3W5XA 3MAAA 1SUQA 2Z1IA 1HWLA 2ADBA 1AXQA 4JKEA 3SSSA 2B8QA 2LDYA 5HN0A 4DR6F 2UUTA 3OTOJ 1JCGA 4P4PA 5DKWA 3UR0A 3WK6A 1L3UA 2DFLA 3KG1A 1D8BA 3N4QA 2UP1A 2V63A 5JUMA 1RTDA 2ASOA 4ED6A 4USHA 2HFOA 3AT1B 1I94J 1WG5A 3ZTOA 2YWKA 2A6OA 2QWNA 2FLPA 1QAIA 2ZJRL 4DN9A 7ICPA 2A18A 3Q8SB 3DC2A 2NREA 2GWKA 1OH5A 5D4LA 3TO8A 3I5AA 3WK4A 1JLQA 2EFPA 4FWOA 3JAMY 1SL0A 4FOEA 3VTHA 3VOVA 1RISA 3A5NC 1HBNB 4JI8F 4G3IA 1S57A 4QPXA 1BD6A 3CRXA 1LVHA 3KHHA 4USUA 1N32F 4Z4IA 1TAQA 4JB3A 4X4TA 4IFVA 4HHTA 2VPZB 5EX5A 3ZDAA 2JJ4D 2XI9A 1WC5A 4K4WA 1OQ3A 4Y00A 2R4FA 3THVA 2KHQA 1AA1B 2E66A 2XS5A 1TFRA 1P6TA 2GIQA 1K8AT 4E19A 3NAHA 5AQQA 4FF4A 2P6TA 3KKAA 3NVMA 4GKKK 5L38A 2W4PA 4CGGA 4YR3A 1ZQCA 1CULA 1FD8A 4FK4A 1ZC6A 2NQPA 3FNNA 4BR2A 4LF4K 2ZWHA 5KFIA 2DR9A 2OFHX 3AVJA 3MBYA 4U7BA 2C2DA 3FBCA 3ZYYX 4YNQA 3HPHA 1I94F 4PUOA 4Y6IA 1FO1A 3EL2A 3ZDEA 4PAAA 1YI2S 4F5QA 2XSJB 3PW5A 4JK1A 3M8PA 2QFJA 1RGVA 3MPDA 1CJVB 3CCJS 1FHTA 2UVWA 5ADZA 2NLXA 2MKYA 3Q8UA 5C25A 2XMWA 1OVQA 2XMVA 1IBLJ 1BUPA 2HHSA 2HFVA 4DV2F 1FDBA 1RT4A 2NRRA 2JH3A 2PO4A 5D3GA 2KN7A 4X65J 1VQKS 4NY8A 3S3NA 2M3DA 4BRQA 1RQ0A 5I42A 5IINA 2O1PA 4LREA 4QCLA 4OPJA 3T1HJ 2PMWA 1KBRA 1XHZA 1WEXA 5AQLA 4PZOA 9ICAA 9ICFA 2WW8A 2ZE2B 4CJ4A 3L7PA 1WSJA 4NX9A 3OYKA 4LFBJ 1RFQA 5KFYA 2F8HA 1X4EA 8RUCA 5DQGA 1JNRB 3PCOB 1UPPA 1YJ9S 1UVMA 1X40A 4K4YA 3KJVB 5AQOA 1IJJA 2V68A 4JI7F 2KXHA 5AJ3F 4C8ZA 1QS4A 4B9MA 1P90A 5BRFA 1BE4A 1E6VB 5ALVA 3R6GB 3TVYA 1U6ZA 4DSIA 3WK5A 3S3MA 5JTIA 4HTJA 1FVQA 1JXEA 1LAVA 3LDNA 1RT2A 2HHTA 1B9DA 3MN5A 4FZXC 4OO1J 1U26A 2L9WA 4ECXA 3UXNA 4YQWA 3PDNA 1T03B 3WK7A 1RJJA 3PIPL 9ICLA 4FJGA 4RJVA 2IYGA 1YRTA 1IBLF 1SC4B 1G15A 4KHRA 7ICEA 3SCIE 1HPZB 1WAFA 4X65F 1WF1A 3THWB 2YQ0A 2J6TA 1F1BB 1S6UA 4J9SA 1A5WA 1HBMA 5KTQA 1WC6A 2VZ9A 3T1HF 4TY8B 2DXDA 1SQFA 2KQ2A 4DS4A 5FLXO 2QXLA 4LFBF 1CG2A 2DPIA 2KFZA 4PQAA 3HFVA 1QZ6A 9ICSA 3J7YP 4I6MB 3JAMU 3HULA 1UA0A 3H40A 3LP1B 3KD1E 5M1FA 1SKRA 3U1LA 4A8MP 4CBUA 5CHCB 3IC1A 2IMOA 4RQ1A 3CC2N 1WKKA 5KQDA 2XLKA 1QSYA 3C15B 4K5SA 2LQ8A 3F0NA 2NXCA 2NO4A 3B54A 4HT7A 1T3NA 3KLIA 3CFOA 5CYQA 4QIEA 4Y2QA 1RHRB 1BC6A 5AQXA 3BBCA 4M9HA 5A2QO 4MF8A 1NGIA 3GL1A 2WTUA 1F5CA 4BACA 5AQJA 2DCLA 2MZSA 4UW2A 1RLDA 4KKOA 3QEVA 1WSFA 4DV6K 4HYKA 4C7ZA 1RBUA 4XDCA 2QLWA 1RHJB 4ZIWA 4PY5A 4LC9B 1NMEB 4GMJB 4AHVA 4MFCA 2LVWA 4HLBA 3MEKA 2KM8B 4O23A 4I28A 1B4FA 3AO2A 3HI9A 3HM9A 2PY5A 3PTWA 1JKHA 4LF5J 3ZCMA 4PG6A 2LQJA 3FC4A 5BPLA 4FYVB 1XO1A 3NY0A 3HPGA 1LXJA 1NB7A 3Q24A 3DLLQ 2VWKA 4JRPA 5F8LA 4EYHB 3MM5B 1MMDA 2CWXA 3OTCA 4WTOB 3U6FA 2CNLB 5HBMB 2DNQA 3EEQA 4X2BA 4Y1CA 4E7LA 2E5GA 2BKNA 1BUXA 1RTJB 5L1LA 3D6FB 1U25A 3JSRA 3V6KA 4QR2A 2BUPA 2DR6A 4IQTA 4QAGA 4NO7A 3SI6A 2A2CA 3NF7A 3N5FA 9ICJA 4AM6A 3AAWB 3KZXA 4L76A 1RT3A 5JU5A 4FE3A 3HP6A 2UXCK 4GXJA 1RAOA 4E1JA 4B1WB 3O80A 3BEXA 1RUSA 1U8SA 2AW0A 3T5KA 2MHEA 3HDSA 3OL6A 7ICNA 1QTNB 4BRNA 3H5SA 2FC0A 3RW6A 5K14B 4LF5F 5DJBA 5FJ4A 1QQNA 2E8AA 1Z00A 4C48A 3G82A 1RADB 5EUHA 1Q3VA 3WZ0A 5LJ3Y 1ZQ1C 3BN4A 4C80A 2MUTA 4UB6U 4B3SF 2DKZA 1X4HA 4MKBA 2MSNA 3OFEA 3C1YA 1N0VC 1C0FA 1HBUB 5KFMA 5BREA 1NSAA 2K8AA 4KLHA 2X74A 1CVJA 3IM8A 4DV5F 1QVGR 5CA5A 4C8OA 3MFHA 2G08A 2LPEA 4GVLA 4P2SA 3TJ8A 3CXCM 2JZ5A 4M94A 5ETRA 4O44B 3AVCA 1FWKA 4ZS6A 2VC1A 4CLSA 3VGMA 2FBXA 3TUJC 3SYZA 1NGCA 2KL8A 3L2VA 3LP3A 1RDDA 5KG3A 2FPMA 3CVKA 4ANDA 3EE8A 4ED7A 1U4BA 3HZEA 3QUTA 4KLOA 1F3VA 2WFBA 3OFFA 2YWEA 4FZNA 3MM7A 1JXBA 4NCGA 1E6YB 3EVOA 4W5RA 2NZTA 5LOQA 4UARA 3G4SN 3H6EA 1MSWD 2WFAA 2CNOB 1WUDA 3AO3A 3RU0A 4DPOA 4ES3A 1RI7A 3UXPA 5J0RA 3ILJA 1C2PA 4F67A 2VQEK 2RH3A 3V7LA 4Q5VA 4DL5A 1M1KT 3CCLN 2UUBK 3HSZA 1HR0F 2DWQA 2VWJA 2HQFA 4PXBA 1S72S 3C16A 4LFAK 3WXIA 3K9KA 2F5GA 4IWVA 3IRXA 1BCOA 5D4OA 1U24A 5AXNA 4F4WA 3QERA 3MEDB 3OTQA 2HDOA 4IFEA 3PHEA 5HP4A 3ISNC 4NLDA 3PIOL 2QLJB 1X4BA 3ZZYA 3AAQA 4CHOA 4GLXA 1KFSA 2B5JA 1OS5A 2FGCA 3KBBA 4F91B 4C3MA 4DG1A 1FDNA 3PO5A 2BKPA 2AWZA 1E4GT 3J7Z5 5KNIA 4FP9A 4CO4A 2PFUA 2R7YA 2DIVA 3JS9A 4FLTA 1XNRK 3SMZA 1KQFB 3IV6A 3OVNA 2J9CA 2KHDA 1RSCA 2HVZA 1V3ZA 2GHWA 4FJ5A 1N34K 1KXPA 2EZXA 2XZWA 3R1LA 4ZPWR 4OFZA 5CD4A 4YB1P 5F9NA 1REVA 1ZBSA 1RAJA 4G9BA 1S4FA 3FEYB 4JWNA 5CQGA 4XEIA 1UPMB 3QFPA 1Q79A 2IRUA 2KYXA 2UUAK 3MMBB 3C94A 4O3NA 4YP3A 3HHLC 3HKZC 5JXSA 4CJKA 2HSTA 4JK9A 5ALYA 2DT9A 2ZBRA 1SJQA 1S97A 4KI4A 1KAZA 4FZMA 1QD1A 5BYSA 5G0RA 1B64A 1GXUA 3ZNUA 1TMMA 1WKJA 1TKTA 3DKDA 5DM6L 1BCMA 3WC0A 2YWHA 2NPFA 2XY8A 4CZJA 3ILOA 2M8HA 1DGJA 3MD3A 1TVRB 3D28A 4IG0A 2DEJA 4DPTA 4CLYA 4DF8A 2HFNA 4DR6K 3H5YA 2G07A 1ZM4A 1DHMA 3MPYA 4RZRA 3ZSOA 2GIFA 2VJUA 2ZFHA 1YQHA 3A0BU 2BGWA 2KDOA 3N7PD 2MY7A 9ICNA 3CCTA 3H59A 1R8PA 1K8KB 2K2PA 3I5CA 5EOYA 1KFDA 4NYOA 2Q4TA 1M0SA 3KJFB 2OEHA 1A77A 2Y3YA 3GJQB 2ZEJA 5L1IA 1Z4OA 8ICAA 4KLQA 5KT5A 2MQPA 2CDRB 4LMZA 1FW6A 4FWQA 3OV7A 3PYFA 4RNNA 2DYAA 1NJIO 4KTZA 2FZCB 4NL9A 4ECZA 1YHQN 2HSZA 2E5IA 4WE1A 5HOOA 4KFBA 3FSYA 4DLGA 4HCCA 2RS2A 3PX4A 3NGRA 5A8WB 1FKOA 3MXIA 1S0OA 3M8WA 1CSJA 2W9MA 3ZT2A 2GGPB 3NVYA 4PHPA 2VG7A 1TL1B 1I94K 3HD2A 5CH7B 2JHDA 4OHXA 3QU4A 4U95A 1GNKA 4R5PB 1S49A 2BDPA 5J2MB 4JV0A 4C7QA 1ASWA 2HHXA 2F3NA 4QYZJ 3SJJA 4B9NA 3HSCA 4BG9A 1M5SA 4PH5A 1N54B 2DXEA 4DV3J 3I55N 1N0UA 5J0UA 3H4DA 4Y2IA 4ZTFA 3GCXP 2VG5A 4NLRA 5ETNA 4OHYA 2VHGA 2PMZD 2WB4A 3GJRB 3AA4A 2M2BA 4OPKA 3RR8A 3HXMA 3U9ZA 3CDAA 4ID5A 4P2XA 4PG7A 1LWEB 4KB0A 4ZPBA 3FKBA 5HSPA 1D8LA 3QATA 3L7OA 2LEAA 4JI5J 2DH7A 1BOTO 1LNQA 4I6WA 2MRLA 3IG1B 2K3IA 4A46A 3NMRA 2NNWA 1Z1ZA 4HKQA 1RDUA 2YTCA 3CCWA 1FKAF 3ZSZA 1Z4NA 4WKRA 3OYCA 2GVDB 2CJXB 4OMFG 4GKJJ 2EVZA 3CCES 4JKAA 2AMCB 4YDDB 2MLXA 2EEYA 3O9QA 2IM3A 2FJDB 5IZHA 2RKIA 5AJ3K 4F0MA 5IM0A 4JMUA 1X5OA 3PXGa 4DV0J 4A5BA 3TACB 5ALHA 1WYGA 1IXKA 1YJWS 2DNLA 4FWLA 3JTPA 1UEKA 3NF8A 4KGXB 2HVHA 1C7YA 2MQNA 4DEZA 1UWBA 3SMVA 4DV3F 1ZBLA 1KKXA 1WHWA 3R1HA 1IBLK 5L1MA 4M9GA 1HX1A 1BU6O 2KSOA 4X65K 4RQ8A 2WF7A 3I82A 5E3QA 4CGDA 5FDLA 2PA3A 3BBBA 1T9TA 2JR5A 3V6HA 5L1JA 3HHEA 2R8IA 2UU9J 3FBBA 1YF5L 3MK6A 1YVFA 4LF8J 4CO0A 4DPWA 3BDEA 4W90B 4QIVA 3T1HK 3QE9Y 4X4UA 2Q0UA 1NK5A 8ICWA 4JI5F 1J2NA 1IM4A 2ZGZA 4LFBK 2RHFA 3TAQA 3Q8MA 1Q0NA 4KE5A 5CE3A 1PZNA 3JPTA 4RNMA 2A6AA 3AODA 3G2XA 5GADP 3CPWM 3CJ2A 1YITN 3ULDA 3HF5A 5K5MA 5ALLA 4GKJF 4OX6A 5KFTA 1S5ZA 3MURP 2G4BA 1RZTA 4K8ZA 4K4GA 3TPQA 2ROEA 4ECWA 1L7NA 4DV0F 4KJIA 3FZKA 4Q8FA 2CXYA 4GV6A 4DQSA 3NBPA 4DWIA 3G71S 1JJ2R 3U9DA 1Y10A 2B0GA 2O8EB 3Q8YA 2HGLA 4X62J 4IO9Q 4CJVA 2H54B 2ZUCA 1NJXA 2G1HA 3BSCA 3LDAA 5EX0A 4R65A 3OJUA 2UU9F 2CH6A 4AQYJ 2BPFA 4LF8F 3AJDA 1VQMN 2QJ3A 2Z7JA 3VEWA 4C11B 1VHFA 2W3SA 2BM0A 1NEEA 4N77A 1Q18A 2VG6A 3OD2A 4RBTA 4NLNA 3P39A 3EGNA 4TUQA 3D1QA 4NZ7A 4CNYA 2QC3A 2QA1A 5DZ7A 1LKZA 4F2SA 3VALA 5J0WA 1WG4A 4RQNA 4LIRA 2QGFB 3AD8C 4FW2A 2CJQA 1VRUB 2ALYB 3MOJB 4ZTJA 1GLLO 4JUZA 2AYGA 3H3NO 2OIHA 3LPYA 4O8UA 2OEMA 2K89A 3I87A 5J2QA 1IG6A 3ETLA 2K4EA 2QMXA 4B1VA 3PRDA 3GONA 1XNSA 4P75A 1NLVA 1KS2A 2KJWA 3H8JA 4EO6A 3CCSN 2P6UA 2JWLA 3F2BA 3J7AN 4W5OA 2IAJB 1UCNA 2ZNYA 3H20A 4Y34A 4CIOA 5LSRA 4XPEA 3IBPA 5FPDA 1C1CA 1KP6A 2QA2A 4AQYF 3HKZF 3CD7A 1ZQBA 4KHMA 3HZ6A 1RKJA 1VRTB 3P8BB 4Z37A 1BNPA 4A2BA 2YQ1A 2RF2A 1V9PA 4DSFA 4LF5K 1O51A 3EVWA 3CYMA 2Z56B 4EBCA 4QOTA 2RU9A 4A61A 3HPOA 2G5HB 4I2PA 2PYLA 2E8MA 4R8UB 2J9EA 5AKHA 2KIVA 2BQRA 1XNQJ 2ZJ5A 1J54A 1T95A 3DAWA 2W9AA 3IS9A 3TZZA 1AQ6A 4GVEA 2HNDA 1KR4A 1U1MA 1TKXB 2LYVA 4DX6A 4PA1A 1I5OB 2MU2A 1V5IB 4WFAL 2EANA 5B0BA 4CF4A 2FPLA 1C4CA 2H3EB 5DDMA 4XUSA 1FTCA 2UVUA 3SZ2A 5ALTA 3BO2A 2Y9TA 1PUZA 3K57A 3THYB 5F1XA 3BS9A 1BI4B 1OIAA 5AQWA 2YX7A 3T5LA 3BSOA 3ZO7A 4KT0C 2PGCA 5HL7Q 1X66A 3ENQA 2JEFA 5AQGA 4BR4A 2YX6A 3GJTB 3OLAA 3AU2A 4MH8A 2FYXA 1A76A 3ED5A 1DJ0A 2KFNA 4CHYA 2IC3B 2PFNA 3EM1A 1UKUA 2X3DA 4FCYA 1BNOA 4H8KA 3SCXA 4NPOA 1HNVB 4N8OA 2ZTCA 2HKEA 4A48A 3VZIA 2L9DA 4X4QA 5J1PA 4CD3A 2LP4A 1ASUA 5B0GA 1HR0K 1X9JA 3SQ4A 2E29A 1V97A 3SSQA 4P0QB 5KT4A 2CAJA 4I67A 1O8BA 4KSEB 3WEEA 4Z2XA 2KVSA 1SWWA 5K9FA 1T3OA 4R79A 3NRBA 4DI6A 3AA8A 3QEBZ 3J7YI 5FLXY 4JKDA 4OZ2A 3BGOP 2YV0X 3OYGA 3O6QA 3UMBA 1U2CA 3G0ZA 4B9LA 2QB1A 4C8KA 5CEHA 4USIA 2OTJS 3WXLA 4JB8B 4Z0UA 7ICIA 5KFRA 2BW2A 1VQ9S 2YNFA 5J1EB 2ATQA 4FM0A 1VQPS 1W7WA 1FK9B 3CDWA 3ZX0A 3FEZA 2RNEA 1ZJMA 3GMGA 1NB2A 1VMBA 3UW1A 1NNEA 3M05A 2V5HG 9ATCB 4IH6A 5LY3A 2HNYB 4LRAA 1UAWA 3G6EN 1TFYA 4WFBL 3LPTA 4KY3A 3J81Y 3TU5A 5GMEA 2R7RA 3NCRA 3ZSQA 2E2OA 2CRLA 1KN6A 2V4JA 3ZTRA 2GQ2A 4FWRA 4JS4A 4BR0A 3OW2R 2VBXA 4L75A 3NOGA 4ATNA 4EEKA 3FEXB 2OGUA 4IFYB 2V8DA 3S41A 1Q7YT 5I4MA 2CJYB 1NCLA 3VQ5A 4M63C 2DRAA 3CP8A 1NWKA 8ICQA 4JD2B 4B8CA 3V5RA 3GYXB 4EO8A 4CGJA 1ASVA 4WP8A 2BH1A 3OBWA 4M5NA 2H3FA 2QA4S 2CQCA 3ID6A 1N8RO 3QSYB 3M1VB 5CWRA 3L9ZA 1JLFA 1HRHA 3CCRN 4LF2A 3N7RC 4A57A 2VC0A 2YHBA 2YI1A 4JWMA 5AFUA 5GINA 5IWAJ 1X7VA 1FRJA 1HNXJ 2HQ3A 3AVNA 3MAHA 1HL6A 2CYYA 5KG5A 2CPFA 5LMNJ 4A8QA 1NHKL 4MLEA 3LM2A 1TL7A 1RT5B 4FZLA 4LSLA 3PW7A 4L3KA 2R7SA 3D2EA 3NS6A 5IV3A 3NRWA 3ULHA 5HO4A 4FDFA 1J53A 3AM9A 3ZSVA 2JX2A 2WSEC 1IR1A 4DSLA 3PJWA 3SQOP 4F4AA 5K8NA 1NDKA 4K0KJ 3OYNA 1KHWA 2JFDA 1VQLS 2BPGA 1GOCA 2KHOA 3WQTA 3RG6A 1OJ4A 3UNYA 2BE2A 1JUDA 5AQIA 2R2RA 2BACA 2W04A 2ZIXA 1GOAA 1N61A 5A0LA 3CJ4A 2FF3B 2NO5A 4A2AA 4FWNA 1BQNA 1VQYA 3DLKB 3BKFA 4ILGB 1Q86T 3NS1A 2BMBA 3D7EO 3HWTA 3QIOA 3Q8KA 2HK2A 3UKUB 2D3O1 3CFRA 1PCAA 1QQ7A 1BISA 5IWAF 2XMTA 4F5OA 1HNXF 4IJNA 1YJ7A 3FZBA 5FLXU 1K73O 3OYEA 2OPSB 4J9MA 4NM1A 4BC4A 2UVRA 1X31C 3C19A 2ZIVA 1TVAA 3NLCA 4WFNL 3BO4A 1T02A 3AGRA 2HGNA 3GR1A 1LOUA 2CGJA 4QZFA 1VQ5S 3VN5A 1PAEX 5U47A 2FVCA 2A6MA 2A1AA 3UD3P 1WCNA 1SJFA 3JQJA 4UZCA 4UQGA 2M9KA 2AT1B 3FMWA 3L7UA 1XC3A 1RXVA 5EWEA 2HW3A 2GC8A 3NS7B 3RBEA 1K44A 1WNSA 1CI4A 1X4CA 3PY8A 3QT5A 1S6QA 4B3OB 4F0KA 4IOAQ 2KVQE 1G6BA 1JL1A 2I5JB 2F8EX 5KAKA 2ZH9A 5D15A 3LP0A 1LKYA 3CMEN 5BOMA 2A1SA 1PIEA 4LSNA 1F5SA 2OPRA 5CZ1A 2QKQA 4QYZK 4H0YB 2OMOA 2P1JA 1P27B 1OY6A 3N28A 5TZVA 3AQEA 4DV3K 2YY6A 2ZTDA 2JFKA 1WBDA 3NWGA 2RUSA 2W2MP 2X1FA 3UWTA 4CO3A 1L3VA 1ZD4A 1SJ1A 4EENA 2CUYA 3CXCR 3GG4A 4B6JA 3M2VB 1X8DA 4NZ6A 1SV0A 2ZZNA 1GLAG 2E9TA 4JI5K 4Z6FA 2PFOA 1ATRA 2I7NA 4M5IA 2X78A 1AB8A 1S9GB 2U1AA 1T9WA 3BQ2A 4USWA 3AEVA 1HBNA 3PJ9A 2Z1HA 1QM9A 2GH1A 4GKJK 1VIXA 4HHUA 2HYIB 1NK0A 3ZLJA 1MC8A 2P9NB 4M0AA 3CC7S 1IXRA 4DV0K 3HVAA 3K8VA 2P2CB 2VYPA 3CB4A 2F7VA 1VSJA 3K5NA 3PW0A 3NE6A 1VQ8S 1ESVA 5L9NA 2QSWA 5FD1A 1A9NB 4QZVB 4CDGA 4B3MJ 4DOZA 4W5QA 1L7PA 3DHXA 3NCPA 3C2KA 1AUSL 4ZVQB 1RBOB 4CHPA 2HZVA 3HKWA 5C24A 4QWBA 2VIHA 4KO0B 3W2VB 1ED1A 1YVUA 8ICZA 4KR0B 1TFWA 3SUNA 2UU9K 1LFPA 5AQUA 2ZJPL 5F3XB 4CLFA 2J6UA 4LF8K 2WCXA 5BPNA 3HYFA 3I9ZA 4LQ3A 4AE5A 2XSJA 3AV9A 4Y2YA 9ICUA 1F0MA 1CJVA 1D1UA 2ZC4A 3BR8A 4E8UA 3L0QA 4EZ9A 1PGZA 4WQ5C 2IOHA 2GMHA 1RZMA 1F5AA 1NBWA 1PK1B 4C9DA 2O8FB 3NCQA 4NXNJ 1N5YB 4O5EA 2XWXA 2BJ7A 4MO4A 1IWAA 5DM7Q 4O4GB 2DHSA 2V94A 4WYLA 1SJ4P 2ZE2A 3SV4A 4CZHA 3J80O 1NOZA 4B08A 2IJNA 3TTCA 1L7OA 2NPIA 1ZD5A 3OA9A 4M3ZA 3J8AA 4X62K 3GZFA 2FMSA 3L5KA 4XPCA 3A8YA 3KHGA 2ASMA 4V19X 1H2UX 3AVBA 2ZH8A 4DR4J 5SWMA 4AQYK 2IOFA 1E6VA 3IP0A 1D9FA 2HNZB 5I3UA 1AYEA 4CIFA 5KGWA 1MG7A 1SPBP 2QTWA 3UFCX 3C66A 2XS7A 3T6JA 5B0CA 1I1GA 1T03A 2O3DA 2CNNB 4TURA 3JPPA 2NXNA 4ES2A 4F25A 3HHLB 5AIAA 4IJAA 3H0LB 1HPZA 4RW7A 3ENWA 4DL0C 3ENHA 4WXOA 2P9IB 4YOWA 3THWA 4E7KA 2Z57B 1C1AA 4NXNF 8ICXA 4J2EA 4DR5J 4US8A 4TY8A 3LL3A 5CJ7A 3NEKA 1YJTA 3CC4S 2YMLA 1RQNA 3QMQA 4MYUA 4I6MA 3NGUA 3TWHA 1XU4A 2OP5A 3M8YA 3SK3A 1BXNA 3LGMA 1ZQVA 3W2WB 1UJ6A 3WNEA 3FAHA 2KK0A 5EE9A 1LWFA 3EUB2 1VQ4S 2IBKA 3C15A 4PABA 2EI5A 4ZVFA 3FZ2A 5AKLA 4PL7A 2XYGB 1WHXA 2H51B 3R7BB 1VQ6S 3HT0A 3RGIA 5IQQA 4EX6A 2V2ZA 4ILMA 1N33J 1QHTA 9ICRA 1Q1KA 2H4WB 2F1FA 4L8RB 5KFPA 2K60A 3IP4B 1IQTA 3VF4A 4ZHRB 4FK0A 3B6OA 4IR9A 1EETB 2AZ3A 2ZDOA 8ICUA 1CC7A 3ULEB 1Q9YA 1XNQK 3WDOA 3WIVA 3DCAA 4RQMA 1KVCA 5DETA 1U1OA 2A41A 2W11A 2QE5A 3ID8A 3PR4A 8ICBA 2UXDJ 3OHBA 2LMIA 4M04A 1GX6A 5KG4A 5GADI 3LWMA 4ED2A 2OHFA 1FERA 3QGPA 4RNFA 4YUDA 2ZH1A 2DNHA 2DIUA 5G5GA 4DU7A 2FD2A 2NS1B 1JLCA 5D0GA 1UVLA 2W7AA 2LFVA 2AF6A 3LP2B 1U48A 3RAXA 5K8OA 4M8LA 3MM5A 1RDRA 3M6VA 2G5IB 3LANA 2ZF5O 1NI3A 3UNGC 4QU7A 4IEEA 2DQNB 4ZN1A 2KKZA 2HOFA 1N33F 1RTJA 1T6DA 1J2MA 5D3GB 3UI3A 5KAIU 3EDRB 1N60A 5AZJB 2OTLN 4DCOB 1XMOF 3AVGA 3RMCA 3R5JB 1QUPA 3ZTQA 1T3QA 1U2RA 3MX2A 2UXDF 3FGUA 1PG5B 2JC1A 1U1PA 1G3OA 5T14A 3DV9A 1GLEG 5EGYA 1RAEB 2VJ5A 3GIKA 2POKA 2QMWA 1RBLA 4DTNA 2MKKA 2ZUAA 2QYGA 1R0BG 5HVGA 2FIUA 1RE1B 4CJUA 2F44A 5GMKa 2FY8A 2A3ZA 5J0YA 1Q16B 5GAEU 3CCMS 3GBTA 5AK3A 3HVRA 3PKYA 4BQLA 4F4KA 4UQTA 3KLHA 4DL6A 3MPUB 4DR2J 2QWLA 1EXNA 3DM2B 2CZVC 2PDAA 4PCQA 3NF6A 1RBVA 3MMVA 1HBUA 2JL9A 5BR8J 3SQ1A 3W61A 3QNMA 1S79A 1QE1A 3R5CA 1PVQA 2HWTA 5KL8B 1QY7A 1QQOA 3L6QA 4RT3A 3WXMB 2ERRA 1WTBA 4O44A 4DCPB 1JXLA 3AOBA 4IOXA 2X3GA 1C1BB 3RJHA 8ICLA 1T44A 3SENA 1ZZNA 1IV0A 4QOZB 4IRDA 3BREA 1R8CA 4K41A 3CHWA 5DGAA 3UKRA 2PA8D 2KG1A 3HTVA 5KGXA 5HMMA 5HI7A 1S12A 3HJEA 1HKBA 1E6YA 2CPZA 4MJKA 4E7IA 4JP8A 4GO7X 4QIWD 4ISEA 4X64J 4FJ8A 4MO5A 1WSVA 2J0WA 4Q44A 1Z6RA 1UW9A 3V9UA 4QPTA 4GNIA 4J90A 4DSKA 4JKCA 3QEAZ 4DTPA 1B22A 2KE7A 3ISBA 3U3GA 1S9FA 4DLEA 1KOHA 4DR2F 3MGJA 4FF3A 3B8AX 4XAKA 2GZOA 2E88A 1VQ7N 2ZNZA 1RAIB 1KONA 2QLTA 5IWAK 4KHYA 1HNXK 5LMNK 4NL5A 1WG8A 1HYVA 1URRA 3EW9A 2QTDA 2NRTA 2GS8A 3FZLA 1WC3A 3ILLA 3E2EA 4MHVA 1YLXA 3DI6B 1YGYA 3NGTA 5HVFA 1HARA 3OVSA 3I56N 2X1GA 3PM9A 4I2DA 3PRBA 4CTAB 4K0KK 2KG0A 3O2IA 4ZP7A 1NMNA 3CJRA 4GV9A 1VQNN 4Z4HA 3HOTA 4B17A 1VBYA 4FF2A 3CF5L 2E9ZA 2VGNA 3GTYX 3VQ7A 3SXLA 4IC9A 3PW4A 5JLFA 4JI0F 3QT8A 2GWJA 4FVUA 3BEGB 4AHUA 1HHSA 3OPXA 4WTYA 5AR0A 2OEKA 4OYAA 5LJWA 2QWOA 1EXQA 5A0YB 1NXIA 3R2DJ 4LBIA 3CULA 2JWKA 3B4DA 2EBEA 3MMBA 5BR9A 1J9AA 5E79U 1YDLA 2QO3A 4ECUA 4ICLB 3AA5X 4QZEA 9ICBA 2YNIB 5C10A 4K2XA 3QXGA 1CLFA 3ICLA 1RT3B 3EZWA 4P10A 1C0TB 4KHUA 1XJWB 4YDUA 4I2GA 2DFEA 4GW6A 1T3VA 2DO4A 3ONQA 4CJ3A 4M42A 3RB3A 4ECQA 3LW5C 3L2UA 2VA3A 4FLZA 4U6PA 4OPAA 1EKEA 3EKSA 4FOIA 1TVRA 3CIZA 2F9TA 2RLTA 1HI1A 1TV6A 2IIRA 3H42A 1JL2A 3H8MA 4M1KA 2XCPA 2ZH4A 1IBMF 1UHUA 4FNIA 4CT8A 1SJ3P 4HUFA 3ZZPA 4FPBA 4JK8A 2YVSA 1NGFA 3KKSA 3L3FX 2MUTB 2W7OA 2ZM6J 3PYEA 1T9VA 2XB2D 5ADXH 1SL2A 2F1HA 4LH4A 2DHGA 1K8KA 3IG5A 5JVHL 3MEEB 2FC9A 4E98A 3H7HB 4LY7A 2P9CA 7ICKA 1IN0A 4CO5A 5HROB 3RAQA 2D1KA 3LVVA 4CZEA 2ISOA 4ACOA 1WF2A 9RUBA 4WCEQ 3D4JA 3R97A 3B82A 2R8KA 1RXWA 1B7YB 2QRRA 4YN3B 1N63A 1ZQXA 1NU4A 3TX0A 5KG7A 2CQBA 5DK5A 2WW4A 2M0GB 1N4LA 3V9XA 3BN7A 5ETQA 4GXIA 2XWYA 3TQ1A 3AFGA 2O5DA 1PVPA 1RM6C 1KWMA 2RRDA 4NYZA 3I76A 1YZ7A 2BZFA 4NCGB 4X4VA 1U04A 2GO9A 5IT9Y 3H90A 2W6LA 2GGPA 3PRVA 2B4JA 4Y2MA 5HMLA 1U0SA 1R0AA 3J7A1 3C14B 3CT9A 3FZHA 3HVWA 1YWXA 3TEGA 5IFMA 3CDBA 3LAKA 4TUSA 2ZM6F 1WUAA 1Z25A 1ZQKA 4CLWA 5CZXA 5J2NB 2LXIA 3GYNA 4KH5A 2Y8WA 3FZMA 4F7VA 3IRXB 1B0PA 3TZYA 5DDRC 2ADCA 3VAFA 2HHHJ 3EJMA 4PKIA 2F96A 3W63A 5B66U 2IIHA 3AAPA 5EX3A 1J27A 4JBCA 3G6VA 3TZXA 2B5JB 4CF3A 1PAUB 4FWMA 1KNZA 2ZXIA 1HBOB 4DG1B 1LWEA 2DGZA 4CLTA 1FIQA 3ZC4A 1GLDG 1SXLA 1S1XB 2HZAA 2IVPA 1UVJA 3IG1A 4ZPAA 2MGZB 2JDJA 4M5HA 1R8BA 4B3MK 2D3ZA 4DTOA 3NP5A 1ZM9A 2GVDA 2ZH5A 4P52A 4UB5A 2W2NP 2MPUA 5LJ5Y 5C2GA 3ISCA 1NAQA 1SH2A 1TK5A 4L3NA 3QRPA 2DRBA 2ZQBA 3GJSB 3A1YG 1FXDA 3MMCB 1ZOLA 2PMHA 1M5PC 8ICRA 4PZVA 5IIOA 1UJ4A 4BRPA 2ZH3A 3H08A 3G96A 3QICA 4DKWA 4FYDA 2HHHF 4I64A 1O6XA 3A0HU 2UYTA 4JKHA 5G0RB 1BL3A 3R5DA 5IIKA 3F5TA 2YN4A 4NXNK 4DV4J 1TKTB 1ICEB 4WJBA 2D0PA 3VPZA 4O5CA 1AFIA 4BRAA 1X60A 2R8GA 4ELTA 5KFZA 4H0PA 2R2SA 2FMQA 3FBFA 2BJEA 3ZZTA 4IG0B 1VC6A 1Y4ZB 2VFSA 3CJBA 3PX0A 1TUYA 2R7TA 3CCUS 2IPOB 3K89A 1KD1O 1Z1VA 4NLUA 4RPFA 4G65A 1GO3F 2H4YB 3L4QA 3AQOA 1F9FA 1IG9A 2H3ZA 3H25A 2XC9A 3G6YA 4ZCLA 4YHHJ 4DR4K 5BJRA 3GR0A 3MPWA 4NRUA 1XI1A 1W26A 2G0CA 3KXDA 5M2UA 1A5VA 4CJLA 3AA3A 2P5GA 4BWMA 4FLVA 4N5SA 1SIJA 1RDBA 3FDSA 2O8EA 2JH7A 1CZAN 4YB7A 4TXSA 2JEJA 5ETSA 5J2DA 1X3NA 3GILA 1NBEB 2E1MC 1H1VA 4FWKA 1V38A 5A6PA 3DFEA 5IT9U 4CI0B 3SDEB 2D69A 4RNHA 4LJMA 4UUXA 1X5TA 3VENA 1NGEA 4DV4F 2A5XA 2DH8A 1HW8A 3QNNA 3CUNA 1FKPA 1RWPB 2MZRA 4DR5K 1ZQSA 2XY7A 1LK5A 2WUSA 4C11A 4MKYA 3VCBA 4OD0A 1VJQA 4J7CA 1I51B 2J76E 1N62A 2O8DA 3OFGA 3FGVA 1MQ2A 2YKMB 5D49A 3BGRA 2ZUBA 4HTUA 3KYLA 4BC5A 3I32A 4I69A 2ZJ8A 3Q7BA 3X1LB 1BWEA 1UL3A 1UMJA 1VRUA 2D0OA 1SB6A 1NJZA 3RUBL 3BO3A 2WBRA 2G0AA 5J8YA 3RAMA 4BE1A 5CHGA 3HX0A 2J5AA 3CD6N 2ZJQQ 1HUZA 2UUWA 1BIZA 3C2PA 4M5GA 2VG5B 5AKIA 3HT3A 1N33K 3EICA 2CPRA 5AE1A 4RWXA 1QQ5A 5K4LA 4ID5B 7ICLA 1FF2A 4C8YA 3PV8A 4PWUA 2KI2A 2L41A 3ETOA 3MUVP 2IAJA 1XMOK 4DTRA 5J2JA 3EGVA 3AARA 2YQEA 2XQCA 1LOTB 1JLGB 4ED4A 2G0IA 2AJFE 2UXDK 1VRTA 5H9FJ 3AY9A 4QWEA 3D6MB 3M5RA 3V9SA 5ALDA 3F56A 3VQTA 3SCJE 2VF3A 2IRXA 4M3RA 3QAUA 5J2BA 1VQOS 4KBOA 1PJ6A 1S76D 3OSPA 2KT3A 4UASA 2W6KA 4PPZA 2RKIB 3K0JA 2HAIA 3V2UC 1U1LA 1JJHA 3A8EA 2I8EA 1XQIA 2L48A 3N5BA 4R8UA 5ALEA 3ONNA 3RRHA 3D0GE 3KMSA 2PFPA 2Q0ZX 1GLJO 2BCQA 4Z4CA 4E89A 1S10A 5JVGQ 1WAJA 3BV8A 5KFFA 2HHPA 3FJ2A 4WU3A 1RYSA 4NLGA 2C2MB 5FDLB 2VL1A 3DLHA 5FP0A 1N5QA 4F04B 1FJCA 2XICA 1MU2B 4ZLJA 3O8MA 3GG0A 3U3YA 2M9NA 1RAFB 4OZ1A 1FFGB 1Q5YA 2W25A 1MMLA 3TYTA 3NTUA 4R0JA 2IHMA 2C2ZB 5J1NA 4DSEA 1X4FA 5HATA 3IR5B 1Y00A 4X4OA 2XMUA 2W01A 1U2FA 3MDCA 1KLMA 3VAKA 1U1KA 2E8NA 1L6NA 1Q7YO 3S8SA 4IRKA 2PEBA 2QKBA 1WSHA 2QWRA 2IC3A 4K8RA 4DX8H 5DDOC 4ED3A 2OUGA 5CRXA 2W42A 3CJSA 5HLFB 2OPPA 1HNVA 1WDTA 1ILYA 4RU9A 4J2BA 4DR7J 3PMNA 4BC3A 3FBEA 5AM3A 4DR2K 3FVYA 5MLCQ 1TUGB 5D4NA 2CPDA 5BR8K 3M6GA 4P0QA 3IFEA 2M88A 4ID1A 2HAFA 1P1TA 5I3QA 3UDVA 4CJFA 4QIWC 1FEZA 2W7PA 5F41A 2CZ4A 1L8LA 3A8KA 3QIPB 1L3TA 3MDAA 1REGX 2MSTA 1S1VB 3QDKA 1JIHA 1RWKB 3D7SB 4K4TA 3PSTA 4IO1A 4JHDB 1ZA1B 3WKDA 1WF0A 1BGXT 4NMLA 4CZMA 5BRDA 1U09A 3IWLA 1CXQA 3FSXA 5J1EA 3MWBA 3CW2C 4AXJA 3KG4A 2EFVA 1A0PA 1FK9A 1SC6A 2KRRA 2YX4A 3IBCB 2V2QA 2H5JB 3EVMA 2RILA 3QWPA 4KHNA 3TADA 4X64K 3RBXA 5ETLA 4ED0A 3O4QA 1S1UB 5CY4A 3MHYA 2HNYA 3F9KA 4ZPCA 2E1ZA 2E4LA 2E2NA 4JI0K 2RUGA 3W3SA 5AQFA 4PKDB 2HHUA 3OGUA 4DN0A 4O5FA 4DR7F 3E9PA 4KH0B 4ZVTB 2QT7A 4M3XA 4DR3J 4EFHA 5B5EU 2BZ2A 1S9EA 5BYQA 2CA9A 4RPZA 4I2HA 1U1RA 1V5VA 4BGAA 2CXEA 5KG2A 4IFYA 4UY8O 2P9PB 2P5VA 1ZQZA 1QSLA 1FJGJ 2WB1F 4BLGA 1S48A 2I0XA 2F40A 4JI6J 3JS6A 2KVIA 1C1CB 2OPQA 3A8JA 3UMCA 2I7PA 1NGJA 3M1VA 2KICA 1QAJA 2JGUA 5L8RC 2O6KA 1S59A 1OKJA 2VOOA 2FBTA 3E1YA 3UVJB 3M6WA 3C5GA 1S0NA 1EJ7L 4WZQA 1LW0B 4E2FB 2BRLA 3J80U 3FQLA 1EB0A 3SFUA 3ATUA 5ETMA 1RT5A 4CEQA 2G13A 3MDFA 3V1RA 3A5OC 3KDNA 1ZQNA 2LU1A 5AQNA 2EW9A 4IKFA 3IS9B 1VK8A 2AGOA 2BX6A 3FC9A 1BO5O 2X1BA 2HNDB 2BM1A 4DR3F 1N48A 5M1PA 3C28A 4QZIA 5F2RA 1N5VA 2J4RA 3A5LC 2HVEA 2HBYB 3WKAA 2G8IA 5HRRA 2YMPA 2KVCA 4UOHA 2NXJA 1FJGF 3PSFA 1X2IA 2NXEA 4K59A 4RQ6A 4JI6F 1M1GA 4K4HA 5FROA 2G2YA 2AJ1A 1H0HB 4HTIA 1F5BA 8ICVA 2F3JA 2CJBA 2EG1A 2A40A 3DLKA 3MCSA 1D5AA 4X84A 1MWKA 1RXOB 3H8SA 3OYBA 3UKUA 1H98A 3O6WA 4USJC 4KLUA 2DXFA 3BJYA 1MWQA 1P8GA 1KW4A 3PHTA 3IM9A 8ICNA 3CNQP 1N5TA 2ZM6K 3AN1A 2IA6A 4GC6A 5L1KA 3QQCD 3QWUA 3WEEB 4Y0WA 4NM2A 4DCCA 2XIDA 3KUEA 4C3KA 3D2FB 3OYAA 1VFJA 1W2IA 1Y5LB 3L3CA 3OYJA 2AIRB 1AT1B 5CYJA 1XIQA 2DF4B 1PK3A 2R42A 2XI2A 1KEKA 2D1CA 3CO9A 3PNCA 5KFJA 4J2AA 1RHUB 3VQDA 4MAKA 3CJ1A 2HFUA 1U02A 3JSMA 2DL0A 1NDLA 2ETJA 4Y2CA 1IVZA 1VQON 2EK1A 4OI1A 2WVBA 8AT1B 1QCKA 4XO0A 1M5HA 3KUGA 4CEBA 3ZSRA 1NNLA 4OYMA 3OYFA 1HUOA 1PKUA 2BDUA 3W0LA 2P5OA 1Q95G 1X4GA 3T5HA 2W8KA 1U45A 4LRDA 1N5XA 2V4JB 3ALYA 1XUPO 1SZ2A 1X0PA 5GIPA 4P7VA 5KFDA 3TI0A 1YSJA 3I31A 2Q31A 1XR6A 4DTMA 1RTHB 4RT2A 4FJJA 1PC5A 1RCOB 2HMIB 2HHHK 2QEXN 2V8VA 3BSAA 3SI8A 5AI0A 3VCDA 3R8YA 4ECRA 5IQ6A 4OI2A 1SZPA 3U02A 3BR9A 2CG4A 3M2VA 1COOA 1M5VC 5L39A 2HBZB 3QESA 2GAGC 4EFAC 3ZDCA 2GLEA 3WKCA 1YIJN 1XN9A 1S9GA 4URSA 3LPUA 3CCQN 5F8GA 1LK7A 1WOQA 3EDQB 2FJEB 5E26A 3MTJA 3P1GA 2MLYA 3U7JA 1AW0A 3H8YA 3EXYA 4LSLB 3POTB 2RPIA 5BPCA 2O01C 4ZJLA 3SAFA 3IGVA 3BF1A 2XCAA 2PSZA 4JI3J 2W43A 3F2CA 4DMZA 1KAYA 3T41A 2KHCA 4KREA 1ZQGA 4KPYA 4KLGA 5HRSA 1SXDA 4CZKA 2BJDA 4OJRA 8ATCB 1KTVA 1QUVA 3BQ7A 2HRTA 2F8KA 2ZG6A 4BR5A 2Q3SA 1ZBUA 2BE2B 3J7YU 1PO6A 3RMBA 4ZCKA 1VLBA 3HX9A 3ISND 3MCNA 1S6OA 2H3IA 3W9HA 4DV4K 4F5RA 4KO0A 3W2VA 1H7XA 2WAQC 3RJGA 1NZAA 3EXCX 2HURA 1SI9A 2JMGA 1DQ9A 1V85A 5AKEA 5DZ6A 5ALJA 3QAEA 2AEFA 2D0CA 4BG8A 2A1RA 5HHIA 2J0XA 1D8YA 5AM4A 2AGQA 1PSDA 4JRQA 4YHHK 2A3VA 1N8RT 2MZJA 1PK1A 1YJNN 4OGCA 4OJ6A 2P9UA 4CGIA 3H2LA 2O8FA 2VUGA 1N5YA 3JPQA 5AQRA 4O4GA 3QPIA 4ALZA 3AH6A 4ISFA 4JI3F 4CHZA 4ELVA 3DLEA 3AVIA 2KN4A 3KWGA 3VQSA 5CB1A 1C0UB 1FXXA 7ICUA 4Y0FA 3KMQA 1BQXA 3HKZD 4KIAA 4UB4A 5B8HA 3CDEA 4H0XB 4DO9A 3F53A 1F21A 2DFFA 1UW4A 3VA0A 5H2FU 2ACYA 1NGHA 3CM5A 3D9BA 4LBHA 3N79A 2MQOA 1S6QB 2E8OA 4HHHA 3PNIA 2D9PA 3ZZZA 1KL9A 5B08A 4CF0A 4M7YA 1HJPA 4JI8J 8ICEA 3WNFA 4ZPTR 4GXKA 4ZOHC 1B9FA 4CO2A 3GWCA 9ICMA 4ILJA 1N32J 4IBNA 3R3TA 4BRKA 4EI2A 3HHKA 5AQMA 4Z4FA 1RACB 4HWIA 4ZVHA 3HHLA 1CUKA 4WU2A 2CGLA 3RRGA 1R43A 3KLGB 2AP6A 4RUAA 4LSNB 4CEZA 5D77A 2EFOA 2H1YA 2VBYA 1Y97A 1A6SA 2QZ8A 1B70B 4ZKAA 4DV7J 2KU7A 1TP7A 1ZQAA 4ECTA 3D54A 2PC6A 5LSLA 2PKEA 4OLBA 3GZ7A 4WPAA 3BKUA 4A4JA 1V3RA 2NUUG 3NASA 2BA9A 1K73T 4F8RA 1OY9A 1YBAA 5CABA 3W2WA 2PEHA 4XDDA 1RT1B 5AE2A 3E01B 4O3QA 2DRDA 1D4XA 4LSZB 4Z6DA 5CCLA 3VWSA 5H9FK 1K6YA 5AI5A 4NOHA 3L4IA 5IC6B 4FVMA 4DV2J 4LR9A 3DLLL 3M9OB 4WBFA 1U2VB 2HSEB 5GAGP 3M1FA 3AB4B 2EAMA 5A8RB 4M5DA 4ZHRA 4DZDA 1FTRA 2Q1LA 1LFWA 4J37A 1EETA 2F8LA 1KVIA 2W9BA 3EYZA 3ULEA 3DWLA 2FJWA 2B4VA 4E1MA 3MGHA 4DV7F 3CO0P 5CCMA 2KIWA 4ZP9A 1HYZA 3MAQA 5ALQA 2GX8A 3ISZA 2Z58B 4O55A 2MXYA 5DG7A 1TK0A 3D2QA 4CLPA 8ICOA 1UCVA 4NA1A 3VGLA 5C24B 2QKKA 1HQUA 3MXJA 4JI7J 3CD5A 5AJ3J 3QT7A 5LMUJ 4A8XA 3BB5A 3AVMA 4ECSA 2Y1LB 4K50A 4QU6A 3AVKA 3HILA 1IJEB 4NMXA 3BQ0A 2CQ2A 2KJ9A 3LP2A 1WNEA 2E8PA 1UP1A 3IDWA 1TMJA 2X6SA 4PL2A 2R7WA 1RWWB 4OHWA 4USTA 2AP1A 4HR2A 5FPNA