1L3SA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*G)-3'
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3sA01
2W9CB 1S1XA 3TABA 4CGFA 3TI0A 2KQ2A 5HLFA 1BI4A 2JZBB 4CJWA 3ZT4A 4NLZA 2IHNA 5KFWA 1ZQEA 2UVUA 1IXRA 3ZDEA 2C28A 2P6RA 1MC8A 3OGUA 1N6QA 7ICNA 4QW8A 3L2QA 1RT4A 4O3QA 4O3PA 4CJ3A 5T7BA 5J2KA 4IQUA 3QO9A 1KEJA 1TK0A 4NLGA 2WONA 1TKXA 4Q5VA 2UVRA 5FDLA 3MGHA 3G6YA 1ZQHA 3AVCA 3DYAA 4Z6CA 2F96A 3GQCA 1S0VA 2MUTA 3JPTA 3E2EA 4AH9A 3LPTA 4F5NA 5KFKA 3B0XA 3NF8A 2BCQA 3ZD9A 3DLGA 4B8AB 8ICAA 2G8HA 3RR7A 4IRDA 4FZYA 5DQIA 4BWJA 3B6OA 3CYMA 1NK7A 5C42A 3HP6A 5J0QA 5KT6A 4E0DA 1ZQAA 2QK9A 1RILA 4ELUA 3UQ0A 1U45A 2ZD1A 2R8HA 1S6PA 2EX3A 3ZSRA 1ZQDA 3H8JA 1SUQA 3C5GA 4PHAA 1C1BA 1S77D 3T3FA 3NH2A 5DMRA 4KHUA 9ICPA 1XHXA 1HYZA 1SV5A 2C2RA 2FBVA 4M3WA 3BQTA 9ICNA 1WCNA 4RQ6A 4DF4A 4KLOA 1QSLA 3AVHA 2UVVA 3ZSWA 4MFBA 1VSKA 4KLIA 1BPXA 4GXKA 2RPIA 3RJJA 5J0UA 5KGWA 1GOBA 1UA0A 2R8GA 5L9XA 4CK3A 5J29A 4DL4A 4UB1A 2MAXA 5KT5A 4MFAA 4YMOA 4CJRA 1LAVA 4QZFA 2P6UA 5BPCA 2OZSA 2Z1JA 4DTNA 3PW2A 4BXOA 4RPZA 1JL1A 4FLWA 1VSHA 3CG7A 1REVA 4J9RA 3QEWA 4O3NA 1TVAA 3ZT3A 5L1LA 4RQ5A 9ICHA 4JV1A 3PV8A 4K8ZA 4CESA 3LWLA 9ICEA 4Z4IA 4KTWA 4BDZA 4HHTA 1S1WA 4DS5A 1QS4A 1A5VA 3OYAA 3T1AA 4EYIB 2BKEA 1CZ9A 4CGGA 4DQSA 4M9NA 1BQMA 1KVCA 3LWMA 4CJTA 4F5QA 8ICMA 2YNHA 7ICKA 3K75D 4ZH4A 3SI8A 3LAKA 3G6VA 2PZSA 4FLXA 4PGQA 3RTVA 5CWRA 2A1RA 5C25A 5J2HA 3RH6A 7ICMA 2BDPA 3PNCA 3I0SA 1HNIA 4DF8A 4ID1A 4B3OA 2ZUCA 2Q3SA 3U3GA 3JPOA 3H8SA 4FS1A 3AU2A 2W9AA 3V7JA 2B5JA 3L2RA 5KFIA 8ICIA 4ED7A 4RT3A 1K6YA 4E7LA 1ZJMA 1T05A 4QZGA 4TUPA 3UXNA 4ECUA 3VQDA 4DFMA 3TAMA 2E4LA 1BIZA 2F1IA 2KFZA 3MXIA 3LZJA 4JV0A 3QINA 4CCHA 4DEZA 1IKVA 1D9DA 4DQPA 1JXEA 4DSKA 3CM6A 4LY7A 1HJRA 4AHVA 1JLEA 2W8KA 3RMBA 4QWBA 1YVUA 2IS3A 3H08A 4KLMA 2ZTCA 5CY4A 3Q8QB 1S9FA 2FBXA 4KN4A 4CIFA 1EP4A 4RPYA 3PO4A 3QETA 5L1JA 4F8RA 4FCYA 3I0RA 2C2EA 4JLHA 1BPDA 1QHTA 4PHPA 3V9ZA 3DOLA 4UAWA 5EWFA 2HNZA 4J2AA 2F1JA 4JS4A 5F9LA 4GXJA 4Y1DA 3C23A 1RXWA 3MR3A 4IFVA 2FPKA 2HVHA 4FJ8A 4HCBA 3RJGA 4I2AA 2BCRA 3WNEA 2HHUA 3U3YA 4EEYA 2AU0A 3PO5A 2AGOA 3AO5A 3K5OA 4BGDA 4HYKA 5KG6A 5J2AA 4OGCA 2DFLA 4I29A 1X9WA 1LAWA 7ICJA 3ISCA 3DRSA 5TZVA 4CJVA 3GILA 3LDSA 3QE9Y 3KTQA 5IIJA 5KFEA 3JPQA 4I9LA 3O4QA 4KLHA 1WSHA 9ICSA 3NGZA 1D9FA 3V7LA 4F92B 4CF1A 4CJUA 3HM9A 4Z4FA 2ZTEA 3OYFA 4NCGA 1L3VA 4IG3A 2NRZA 4RQ2A 4TQSA 4KRFA 4R5PA 1ASWA 1HYVA 4J9OA 4RQ7A 7ICTA 8ICXA 3OYIA 5KFXA 5EOZA 3C2MA 2D0BA 3CFPA 3RMAA 4KHQA 4F4ZA 1S10A 2KZZA 4KHSA 1LW2A 4XA5A 5DG7A 1SKWA 1A77A 3P5JA 2YNGA 5HROA 1JLAA 4AHTA 1UOCA 2BQ3A 5SWMA 4M9GA 4FO6A 3IS9A 4C8LA 1C1CA 1BCOA 4P4MA 2M9NA 4M9HA 3ISNC 1JLBA 4WE1A 4BACA 3NFAA 5KFOA 1RBRA 4O4GA 4YCXA 3C2LA 1TKDA 4KLUA 2PFNA 3HP9A 1SL0A 4RNNA 3ZT1A 4QW9A 3C1ZA 5CYMA 3C6UA 4CGHA 1ZQBA 4YR0A 4Q8FA 3QESA 5DKWA 1VK0A 3EPGA 3LANA 3QERA 3QLHA 4H4MA 5J1EA 3T19A 4M3YA 3AA4A 5J2DA 2IMWP 1VSDA 4ZTFA 3NGYA 2XY8A 4LZGA 1J53A 2FMSA 4JRQA 2RDJA 4RUCA 3KHGA 1KRPA 1BPEA 4Z0UA 5IIOA 4CJ5A 1IKWA 5J2NA 3K57A 2YKNA 4M9JA 8ICHA 4YXJA 3VQ7A 1NK9A 3HT3A 3WNHA 2BPCA 2GWSA 5DBCA 4QZAA 4CECA 1AROP 4FBTA 5K14A 3AU6A 1C6VA 4CERA 4K4IA 2JGUA 2HMIA 4ED3A 3NF6A 4CGDA 4OGEA 3ALYA 1NJZA 4RW6A 4FJJA 4GMJB 2XY6A 2PY5A 5DDMA 4RNMA 1UT5A 3ZSVA 1WLJA 1ZQUA 3H4BA 4FJ7A 3QZ7A 5EWEA 2VA2A 1KLMA 2ASLA 4CJ4A 1RTHA 1RXVA 2VWJA 1Z00A 3C2KA 4YXMA 2D0CA 4DO9A 4C8OA 4CIEA 2RKIA 3OS0A 1TL3A 1SZPA 3V1QA 1BPBA 1RNHA 4B9TA 3HW8A 4O5CA 3TFRA 2ZTDA 1F21A 5KFUA 4FLYA 4RQ8A 2ITGA 2HW3A 1RDAA 2FBTA 1ZQPA 4KHYA 1IO2A 8ICRA 3LDAA 3ORYA 1J9AA 4H8KA 1JLQA 3ITHA 4AILC 5J2MA 8ICVA 2MUTB 4FS2A 7ICEA 1CEZA 4CIGA 3O3HA 3LP1A 3V6DA 5DLGA 3MR2A 2ATQA 1HYSA 1JLFA 1YTUA 3SQ1A 3AVNA 2HVIA 2XHBA 7ICOA 4KN7A 4JRPA 5BOMA 2IGIA 3VQCA 4CEEA 4UB5A 3ZT2A 3T5LA 1RT2A 3NHGA 1S9GA 1BHLA 4OKEA 5KG1A 1ZQTA 2VG6A 1BPYA 4YMMA 3M9NB 8ICPA 5I42A 3ZCMA 1S97A 2LYHA 3MECA 4YP3A 4Z4HA 4J9KA 3BQ1A 4KTZA 2XY5A 3KLGA 4LVSA 4RQ3A 2PFQA 1CUKA 3GV5B 2VG7A 4CEDA 7ICLA 5DB7A 2F1HA 1MQ3A 8ICYA 3H40A 2NRWA 2RDIA 4FLTA 3QIPA 5JS1A 3T5JA 1X1PA 2E6MA 4DL7A 3TQ1A 3UXOA 3MFHA 9ICWA 3AVIA 3H4DA 4ED0A 4J9SA 4FXDA 4DL6A 1J5OA 4BDYA 1ZQRA 4I2QA 8ICNA 2V9WA 3CQ8A 2PYLA 3V9SA 2XY7A 3ZT0A 1RYSA 1VRTA 1G15A 9ICBA 4ECVA 3AVGA 1HRHA 4K4GA 9ICQA 3KLHA 4RPXA 3LPUA 4HTUA 1RBTA 4F91B 4BDPA 4W5OA 2A1JA 3AVJA 4O3SA 4FZXC 3ZD8A 4ELVA 8ICWA 4NM2A 1BISA 3ASMA 2VG5A 4BE0A 4N47A 4M6WB 1Q9YA 3AA5X 3N97B 1KVAA 4HCCA 3TWHA 3RAXA 1RCHA 5BOLA 4FJIA 4M6WA 4I2DA 3LP3A 1CLQA 2XCPA 3ZSZA 4DFKA 4P4OA 3L3UA 3OJSA 4DSEA 4I9QA 3V6KA 1VSJA 4PHDA 9ICIA 3M8QA 3PW0A 3TARA 3KLEA 4FLZA 4E89A 1MSWD 2O4GA 5KRSA 4CF0A 4NLNA 3C1YA 3HXMA 9ICGA 4Z4GA 1NOMA 3VQ4A 1TKTA 4CHOA 3M8PA 2BR0A 3VQ9A 2R7YA 3V4IA 5KFRA 5DB8A 1TGOA 3KKSA 4ECZA 3OYCA 5KFZA 3ZDBA 4DU4A 3NGIA 4GLXA 4E7HA 1T3NA 2BGGA 4CGIA 1U48A 5KFVA 3RWUA 5KFGA 3NDKA 4CJQA 3V1OA 3KHRA 4RG8A 3L2WA 1XU4A 4M3TA 5CR0A 1Y88A 1KSPA 1YTAA 3NGDA 1RDBA 1T8EA 3PMLA 1S0NA 3KK3A 1WNSA 4QZ9A 4J9NA 5KFYA 5CA7A 3WNFA 5D49A 4CFCA 1ZQLA 4W5TA 1X2IA 3RB6A 2LSNA 2W42A 1N5YA 3SJJA 1WCLA 4QCLA 1WSFA 4M3XA 4HUEA 2HHWA 4LD0A 1IKYA 2QKBA 2V4QA 3BQ0A 4ELTA 2BQUA 1U47A 3KLFA 4JS5A 1WSGA 2VA3A 3ISDA 3AA3A 3EPIA 3RR8A 1WSIA 1WSEA 4ECYA 2YHBA 4B9UA 3RRGA 4Y1CA 2Y1IA 1BVSA 1ZQVA 4QWCA 3HPHA 4CEBA 4JWMA 4O5KA 4BWMA 4FM0A 4RW4A 3HPOA 1KVBA 4KB1A 8ICBA 5KI6A 4EP5A 3SUQA 4FK2A 1T4GA 2BPFA 4IRCA 3PW7A 3MEGA 1A76A 4O0JA 3K5MA 3I8DA 2FPMA 1S1UA 4ED8A 4FJNA 4QZHA 3V9XA 1RT3A 1QLNA 9ICVA 4O55A 4I2HA 1SKRA 4MF2A 3OHAA 2Z1GA 4YR2A 3THVA 8ICJA 3OS2A 3MBYA 2J6UA 1IH7A 3OYJA 1FKPA 2KW4A 5KG3A 4FVMA 3G10A 4PA1A 1B9DA 1NKBA 1RYRA 4KMUA 1VSLA 1RBVA 8ICEA 3G6XA 4UBBA 3GDXA 4JWNA 4I2GA 1BGXT 5DGAA 9ICTA 4M3ZA 1TV6A 3SZ2A 3C5FA 8ICFA 1HQEA 1IM4A 1J54A 3MXMA 1XS9D 1V9PA 5KT7A 1MQ2A 3LAMA 4PUOA 5DQGA 3PR5B 3HO1A 1C0UA 3JPNA 4R64A 3K59A 3ZDCA 3PUFA 1ZBLA 5J0WA 4UAYA 8ICSA 3RBEA 2HNYA 1B9FA 3V7KA 3BJYA 2ZJAA 7ICUA 3FDSA 3EZ5A 4CGJA 4KPYA 1HJPA 2RF2A 3SPZA 4E7JA 2I9GA 5FRMA 3K2PA 2OPRA 4NCAA 4TUSA 4CEFA 3VA3A 4DSLA 1ZQMA 3BQ2A 3PW4A 1NOYA 2DFHA 3CFOA 3A2FA 3ULDA 1RDDA 4RT2A 2BCSA 4O5EA 3JPSA 4GC7A 3MFIA 7ICQA 8ICLA 9ICCA 7ICPA 3S3OA 3RMDA 3NF7A 4UQGA 4N56A 4KREA 4MFCA 2YNIA 4RQ1A 2W8LA 4W5RA 1RT5A 3GV7B 1ZQSA 3OSPA 3HPGA 5CHGA 1N56A 4KLGA 2OPQA 1JX4A 2Z1HA 4KKOA 1S9EA 4G1QA 4QZEA 4CHNA 4FK4A 1RBUA 2KZ3A 5KFMA 1GOAA 1S0OA 4YG2A 2ZJ5A 3ZDAA 2JEFA 5KFNA 4HUGA 1BPZA 4O3RA 4CHYA 4YNQA 3ZSQA 1SL1A 1ZBFA 5DGBA 4HUFA 3RJHA 3VA0A 3QEXA 1EETA 4FJXA 4DS4A 1ITGA 3QNOA 4YD2A 1JL2A 1DOQA 1LWCA 4OKJA 2P5GA 4QZIA 1L5UA 3TFSA 3RJFA 2RN2A 1WAJA 2ZUDA 4QWEA 1S0MA 4UBCA 3QEBZ 1SKSA 4CFAA 4NLKA 4EZ9A 2R8IA 4W5QA 1KFTA 5KFCA 2ALZA 1X9MA 5C24A 2OA8A 3JYTA 4DLGA 4FLVA 4EP4A 4F2SA 3BDPA 1NK5A 1BIUA 2W9BB 1HNVA 3Q8LA 3RB4A 3Q8PB 5HHIA 5JUMA 1Z00B 2OPSA 5HRPA 4J9QA 4IG0A 5KFHA 3EWAA 4G3IA 4TUQA 4I2PA 3CFRA 3UPQA 4KFBA 3ZSYA 4J2BA 3SYZA 4F93B 4DOAA 4K8XA 4J9LA 2WOMA 4DTPA 2B21A 5HRNA 4JV2A 3AVMA 4B08A 3Q8KA 5D46A 1ZBUA 1ZYQA 1JXLA 4KITB 1XSNA 1ZETA 1EXNA 1C1AA 1JXBA 3T5KA 4RW8A 4DG1A 3GV8B 3QZ8A 3ZSOA 2ATLA 1U04A 3VQBA 2P5OA 4F4KA 1C7YA 4QWAA 2C22A 3UQ2A 1RPLA 3QEVA 4ICLA 2ZJ8A 4IKFA 5IINA 5CB1A 5HNKA 5J2PA 5KFSA 4FBUA 4OPJA 3HSTB 5KFJA 4FM2A 1C0MA 4FJGA 2BPGA 4F50A 4OKKA 3PY8A 1ZQGA 5KG5A 5DK5A 3VQEA 2PXIA 3HYFA 3B6PA 4ID5A 4J9PA 3TAPA 5J0OA 1ZQIA 1LV5A 3SQ0A 4TQRA 5J0TA 5J0YA 4I27A 1S5JA 4IFYA 3C94A 4CF8A 3TANA 4CHZA 4RQ0A 3AO4A 3NBPA 1ZQCA 3DI6A 2B6AA 2NRXA 4AHRA 4FYDA 4BE1A 3F9KA 2QKKA 1TL1A 4F4XA 1NK0A 2JEIA 4FJ9A 4F5OA 5KFQA 3NAEA 8ICQA 2ETJA 4IQTA 5DQHA 4TURA 1FKOA 1L3SA 3SV3A 4CEQA 4CJEA 3DLKA 2ISOA 7ICRA 1L3UA 1HPZA 1WN7A 3JPPA 9ICJA 1H38A 5HRSA 4J2DA 5E41A 4Q44A 3EY1A 4M42A 2I1QA 3KHLA 4QZ8A 4IR9A 2DY4A 5KFAA 5DLFA 4EBCA 4E1MA 4M04A 4N76A 1DTQA 2HNDA 1JKHA 1QSSA 4RW9A 4XUSA 3DLRA 3VQ8A 9ICAA 3FFIA 1ZBIA 4GW6A 5CZ1A 4DFJA 4DU1A 4LH4A 3V72A 4IR1A 3AO2A 4B9SA 4KV8A 3GIIA 2G8WA 4E19A 3Q8RB 4UB2A 1HQUA 5CZ2A 3DLEA 3QEPA 1HUOA 3OYNA 1W9HA 4P4PA 1S1VA 4NYNA 2XC9A 3OHBA 3TAQA 2G8IA 3PVXA 8ICZA 1VSEA 2XO7A 5HMMA 4O5BA 3G0ZA 4KLDA 1JN3A 4RUAA 4I2IA 1KFDA 3K58A 1TVRA 3HVTA 3C95A 1FK9A 1NJYA 2A1JB 4E7IA 4E1NA 3O3GA 5HP1A 5CP2A 4I2CA 3F73A 2PFOA 4I7FA 4FLUA 4Z4CA 4ED2A 3QNNA 1TKZA 3AVFA 2HHQA 3HL8A 3ISBA 5HRRA 2HHXA 2NRVA 2XGQA 4KLTA 1RTIA 4PPXA 1UA1A 3DRRA 2H5XA 2D0AA 4FM1A 4XRHA 3ZSXA 4DOBA 3CM5A 2XRIA 5F9NA 4DQIA 5L1IA 5EWGA 2GBZA 3DOKA 3DRPA 3AV9A 3AO3A 2R8KA 3MR6A 4Z4EA 8ICKA 1VRUA 3RH4A 1ZQJA 5HP4A 5EU7A 4M41A 5HBMA 1QSYA 3MAQA 4B9VA 3M9MB 3OYLA 2BE2A 8ICTA 5SZTA 4DWIA 2DFEA 1YT3A 2IAJA 4CK2A 4DLEA 4BE2A 4CJKA 3KD5E 3UXPA 4YMNA 4M2YA 4DMNA 4XQ8A 5J2CA 4DL5A 4JK1A 2V4RA 4M3RA 3V9WA 4KLQA 2DTUA 1DLOA 3BGRA 4QAGA 2W9MA 2FPLA 4W5NA 3OS1A 3HX0A 8ICCA 1ZQWA 1QQCA 5J0RA 4E7KA 4IBNA 2VA8A 5J2QA 3UIQA 4QWDA 1O1WA 5FROA 1A5XA 5KFPA 2HHTA 3S3NA 3V81A 2EHGA 3SPYA 4DQQA 2QXFA 2JLEA 4JUZA 1K1QA 1HMVA 3IRXA 1CZBA 3DLBA 4N5SA 4MEYA 3L3VA 4QZDA 3DLHA 3KLIA 3RBDA 1TAUA 1L3TA 4ECSA 1CXUA 5L1KA 1QE1A 3OYKA 3KK1A 4R66A 2P1JA 1NJWA 3AUOA 4K4HA 3JSMA 3VQQA 2NRTA 7ICVA 3RJEA 3IHQB 3D0PA 3LZIA 4DTXA 3MABA 5DG8A 2FC0A 2ISPA 1R0AA 4UB4A 4J2EA 4R8UB 1RZTA 2C2DA 4LH5A 9ICMA 5KGXA 2KTQA 1Q9XA 3VQAA 2DPJA 3SNNA 3M8SA 4C8KA 1KCFA 1NOZA 4KO0A 3MEEA 3PMNA 1EX4A 2DFFA 3AVKA 4OVLA 1B22A 3V6JA 2AQ0A 1ASUA 3SUNA 4OPKA 4YVZA 1T03A 1VSMA 1ZQOA 3C21A 4KLEA 2HHSA 4CK1A 3RH5A 2BGWA 3NH1A 3LK9A 2NUBA 4RQ4A 5IIMA 1LB2B 3PW5A 4MQ3A 1C0TA 4YD1A 2J6TA 4DL2A 4M9LA 1BQNA 4Z6EA 3OYBA 3FYHA 4PHEA 4N41A 3TAGA 4LSNA 2BANA 3LP2A 2PFPA 2HHVA 4RZRA 4ECRA 3P1GA 4Z6FA 1WAFA 4FZZA 3AA2A 4DQRA 4F3OA 1D8LA 3DMJA 4KI4A 4OJRA 4R65A 2FBYA 1JMSA 2IOCA 2I5JA 4F3TA 1ZQXA 4IQWA 4ED1A 3RJIA 2KZMA 2R8JA 5KG0A 4DTUA 4O9MA 4FK0A 3HWTA 2G8UA 3EYZA 3QEAZ 2Y1JA 4I2JA 1RT7A 1RTJA 5J0XA 3M8RA 1MU2A 4KAZA 2YHAA 2A1SA 3VQPA 3OYEA 2XGPA 4KB0A 1KDHA 3E01A 4KI6A 2ZUBA 4KLSA 3ETLA 2P51A 4YFUA 3SUOA 1UWBA 4BXOB 3D45A 3RRHA 4Q8EA 2ASDA 4UB3A 5DDYA 3NCIA 4Q43A 1NK4A 3V9UA 2F8TA 2O4IA 4QZBA 4I2EA 2OPPA 2P66A 2G8VA 2PYJA 3AVBA 4X5VA 4Q0BA 3PX6A 5KT3A 2X6NA 1U4BA 2KFNA 3SI6A 4FJKA 2PI4A 4M45A 1NJXA 5DG9A 1TFRA 4O44A 3EW9A 4CE9A 3HJFA 3OYDA 4CFDA 5J2BA 2VANA 1I39A 3RAQA 3OVNA 4L8RB 2OZMA 1Z3EB 3PR4A 3TR8A 1GOCA 2JEGA 3MXJA 4QZCA 1LWEA 4XIUA 3JPRA 4PQUA 1BI4B 1NKCA 5KT2A 1IKXA 2F8SA 5DBAA 4LZDA 1FXXA 5KFFA 1DTTA 1SL2A 2FLLA 5J2FA 3V1RA 1RT1A 4HVJA 5KRTA 1BCMA 1D8YA 4PH5A 4PGYA 3N4MB 1ZJNA 4GXIA 5KTQA 1ZQFA 3RJKA 3C6TA 3SQ4A 5CJ7A 4M3UA 4KTQA 1KTQA 9ICUA 3WNGA 3SV4A 1N48A 3NTUA 2FMQA 2AGQA 1TK5A 3AO1A 4DTMA 4KLJA 4CEOA 4FJHA 4C8MA 1Q8IA 1TV9A 5KFBA 5J2IA 4M0AA 4B9LA 4MFFA 1X9SA 1T7PA 3MGIA 7ICGA 4CJSA 3RB0A 1XSPA 1ZBHA 1COOA 4NYFA 4RW7A 1BL3A 4UAZA 4EZ6A 4ZTJA 3V6HA 4PY5A 2X74A 5KT4A 1XC9A 4F2RA 1RDCA 3DM2A 4F5RA 5FRNA 2AQ4A 4H4OA 3IAYA 3MDAA 1KFSA 1VSFA 3MEDA 5C5JA 1XWLA 1UAXA 1NK6A 1KLNA 4OLBA 1JLGA 2J6SA 5DBBA 2PI5A 3K4GA 4B9NA 4DTRA 4AHCA 3PX4A 5DB6A 4IQVA 7ICHA 3P83D 3H7IA 3AVAA 3HVRA 4PWDA 4F4WA 1U9LA 5JS2A 3L8BA 2GUIA 4I2FA 4NM1A 4CFBA 1S1TA 2E6LA 1NK8A 2AGPA 2AJQA 2BCVA 2YNFA 2Q0ZX 3SCXA 3PX0A 1A5WA 3VN5A 4O0IA 4EYHB 3L2VA 4RNOA 4CJPA 4E3SA 4QOZB 2FMPA 2BCUA 9ICRA 5J0SA 1DGSA 3QIOA 3LALA 3OYMA 4F4YA 3VQ6A 3GIJA 3S3MA 4RU9A 4M47A 3GIMA 5J0PA 3T5HA 2W9CA 3OSNA 4FW2A 1ZQYA 3LP0A 3TAEA 1U49A 4NY8A 4IRKA 1WSJA 4YFKA 3MR5A 1JLCA 3L2UA 4YN4A 4KLLA 5CYQA 1ZQZA 3RMCA 4Z6DA 2IBKA 3O3FA 1RBSA 4I2BA 2X78A 4TSXA 3NE6A 4MEXA 1CXQA 1ZQQA 2FLPA 3O4NA 3S9HA 2DPIA 4DU3A 2G8FA 5IIIA 5D3GA 4YR3A 1ASVA 1RTDA 5J2JA 4J9MA 1Y97A 4FJMA 4KHWA 1B43A 2BQRA 4ED6A 2YV0X 4DTSA 1XSLA 4EBEA 4CHQA 4FJLA 2UVWA 4ZHRA 1EXQA 5KG7A 3KJVA 4LSLA 3U6FA 4DSJA 4MF8A 2G8KA 2OWOA 2Z1IA 4GC6A 3KKRA 4KHNA 4CHPA 1UT8A 9ICOA 4B8CA 5KFLA 3IM1A 2JEJA 5J2GA 3MDCA 2IHMA 2OYQA 1B92A 3Q8SB 3KIOA 4DSIA 4CF9A 2FLNA 1TK8A 5D4BA 2W9BA 7ICSA 1QTMA 4FJ5A 5KG2A 3OY9A 5HMLA 3SQ2A 3H8WA 3HK2A 3VQ5A 1K1SA 1S76D 2ZQBA 1JIHA 2ASJA 4ECWA 4DTJA 1I3AA 1EKEA 4KLFA 5KFDA 2X6SA 4DOCA 4CJLA 4ECXA 1XHZA 8ICGA 2IA6A 7ICIA 2GV9A 4AHUA 4B9MA 3ZDDA 4FW1A 2D5RA 3K5LA 4Q45A 2ZE2A 5HHHA 2XCAA 1Z26A 4CEAA 4DTOA 1S6QA 3M9OB 3Q8MA 7ICFA 2B4JA 1TAQA 2JZBA 5I3UA 5KG4A 4IDKA 3GIKA 5KFTA 4EBDA 3NH0A 9ICFA 4CJFA 8ICUA 1XO1A 1D5AA 3TAFA 4NXZA 3IG1A 4YQWA 2WTFA 3QEIA 4R63A 3RB3A 2VWKA 4DL3A 3OJUA 4ECQA 9ICKA 3KK2A 2IC3A 1RT6A 1ZQKA 1VSIA 4R8UA 4F5PA 9ICXA 1IG9A 4OLAA 3B0YA 3AVLA 2KN7A 5IIKA 4PGXA 4I28A 3KHHA 5DB9A 8ICOA 4GVMA 1NKEA 3K5NA 3OYHA 3NF9A 2IDOA 1LW0A 1Z25A 4CEZA 4AHSA 3OYGA 1HUZA 5IILA 2BHNA 4C8NA 1ZQNA 5J2EA 1XI1A 4ECTA 4DSFA 4NCBA 3GFKB 4P2HA 4DFPA 4CF2A 4O3OA 3KD1E 2HB5A 2YKMA 1PZNA 1W0HA 3SUPA 1LWFA 9ICLA
chains in the Genus database with same CATH superfamily
1S1XA 2VF3A 3IR5B 4CGFA 3TI0A 2OFGX 2DH7A 4A48A 2KQ2A 1BI4A 2JSXA 1XJWB 3MM5A 2VV5A 3KKFA 3MAHA 4NWBA 3R6LB 2SXLA 3OR1A 1RXOB 3HCXA 4EK2A 3ZT4A 3TVKA 4W4MA 5M2UA 5KFWA 2ZE2B 1S7IA 1X4CA 1A0PA 4U6PA 3M1VA 2E1ZA 3L2QA 2QB0B 4ZPVR 4O3PA 4CJ3A 2R3VA 1RAOA 2BDUA 3BYPA 2P9KA 3QO9A 1RDWX 2DNHA 4H5TA 1FWLA 2CWXA 5F3ZA 3MGHA 1MN8A 3VAFA 1Q16B 3C14A 3JPTA 3VGUA 4AH9A 1RP5A 1VC0A 3H0MB 2Q4TA 2AJ0A 4ZVFA 1VQPN 3T79A 3MHYA 2UUCK 4CP5A 2MDAA 4DV7K 3O8MA 1NK7A 3HD2A 5J0QA 2MMYA 2V68A 3O8WA 4E0DA 5CABA 3SCJE 2CDQA 2WHOA 4OI3A 1S6PA 1RLCL 2KJ9A 1ZQDA 1X60A 2HRUA 3MZIA 1PSDA 3BPSP 4IUFA 3P39A 3S8SA 4DV4K 4JP8A 1KS2A 2FBVA 3QRRA 2FVRA 3ZFVA 1GQEA 3L4BC 2NQPA 2KNJA 2G13A 2QA2A 3O6WA 2H3IA 1X0PA 4AD6A 3ZSWA 2X1FA 4M5DB 2J7WA 1BPXA 1DFDA 2RPIA 1VQLN 1SH0A 4CH1A 4DPUA 4I6AA 2QWNA 5HQ8A 2F44A 1EP4B 4P75A 1RT1B 2CZ9A 5C2FA 4CK3A 3P8BB 4DL4A 2VQFF 4FDFA 4US9A 1UEVA 3DGPA 1LAVA 2P6UA 3H5SA 4F36A 5BPCA 2OZSA 3FCHA 3WEEA 3VERA 2QWRA 1IBMF 4BXOA 4FLWA 1VSHA 3CG7A 4M5HA 5IWAK 2NSBA 3ZT3A 4ZPCA 5L1LA 4V19X 2B6GA 4K43A 3LGNA 5G0RB 4JV1A 2WVCA 1TE2A 2QE5A 4CESA 9ICEA 3LA0A 5JXSA 2PFFB 4KTWA 4LF8K 2OH2A 3UKRB 1SV4A 4HHTA 2CQ3A 4DS5A 1QS4A 3R7SB 3OYAA 3T1AA 4F0KA 4E2FB 1U1RA 3J81O 2BKEA 2XVTA 4ZPDA 4RWTA 4NXMF 2UU9K 1BQMA 2YQ1A 3S01A 4P10A 4OYBA 3LWMA 3KUHA 4CJTA 2AJ2A 2KVSA 1VGYA 2D1KA 3I56N 3CPWM 2Z7JA 2DGSA 3VGKA 2FJDB 5GAEP 3FZBA 1DGKN 5BR8J 5CWRA 4RU2A 3RH6A 3JQKA 3VF0B 3HI9A 3D2WA 1RWMB 2B56A 1E6YA 3PNCA 3H59A 1HNIA 3I0SA 4DF8A 4ID1A 4ZVHA 3THXA 3OTOJ 4L3QA 5SUHA 4DUYF 3ELHA 3BBCA 3NXZA 3CCRN 1RAHB 1FVQA 3V7JA 2B5JA 3AA8A 4YOVA 2E2NA 8ICIA 3GONA 4DR1J 1FJCA 2NO4A 1MWZA 3UXNA 4ECUA 2X3DA 3VQDA 1HQUB 2RRDA 1DURA 4KB7A 2MKSA 2KFZA 3R1XA 3O9SA 1IR2A 4WFBQ 3ENAA 3H5YA 1TQLA 1V38A 3CM6A 2CQ4A 1WF1A 4HDHA 4Q2MA 1GTEA 3R7BB 4KLMA 3NMRA 5CY4A 4WFXA 3ZZUA 1XMQK 1CJVA 2BV3A 4P2FA 4JI3F 3WK9A 1E6YB 1S79A 2LM4A 1FJGJ 4FF2A 1FX2A 5L1JA 1LOUA 2RS2A 1N34F 4ITSA 2BE7D 3SMSA 4C0HA 3PSIA 3DOLA 4J2AA 3FC9A 4Y1DA 2QARB 5A2QO 4JAXA 4DU7A 1SGGA 4FZVA 3C23A 4NA1A 5DM6Q 4BQLA 2XZDB 1RXWA 4H5VA 1MA7A 3RJGA 4I2AA 4JOUA 2ZHBA 4CE6A 1S3XA 1B99A 5KQ8A 4BRGA 1LKYA 1X3MA 3HRGA 3U8XA 5KG6A 5J2AA 1U2VB 3I5AA 5CA5A 2DFLA 1KHVA 4I29A 1X9WA 2KSOB 5LL6d 3P38A 7ICJA 2WF9A 3CIMA 4GKKF 2HQ3A 2VDHA 3DRSA 3VESA 2QMXA 3K17A 1GXUA 5HJXA 3LDSA 2A0FB 3I55N 2BX6A 2VASA 2BJ9A 2U1AA 3DRRB 2PO4A 4IDKB 9ICSA 4X2BA 3R9PA 3V7LA 4F92B 4CF1A 1QAYA 2DRDA 4PXEA 2QLTA 3DLLL 5HMWA 3W1YC 4FL9A 3FGVA 3ICLA 1X5TA 5F8HA 5T41A 5JRTA 4OPHA 3GR0A 3MN6A 4WKYA 4RQ2A 2HK3A 4KRFA 4R5PA 4EHUA 3HJVA 4CM0A 4J9OA 2OD4A 1ZXIA 5KL8B 1ZM9A 1HW9A 3J7YI 2EFOA 1KD1T 2CQ0A 2JNJA 2E8MA 1UVLA 5IWAF 2UUTA 3OTEA 1L7PA 2WVEA 4LC9B 4A59A 3IS9A 1S5ZA 4C8LA 1C1CA 3CJSA 4IH6A 3GDQA 5AKIA 1D4XA 2R7UA 2ZD1B 4TYAA 2MQNA 2MQPA 3R7NB 2YQEA 3DXSX 3DXKB 4A46A 3ISNC 1JLBA 4X4OA 2FY8A 4WE1A 5D8HB 4BACA 2CNOB 2Z4PA 1N0UA 2MQLA 3AOAA 3OTBA 4ZA1A 1GFWB 1N32F 2UXCJ 3MCAB 2ZJQQ 1SL0A 1SJFA 1TAMA 4WZMA 2FXUA 1ZQBA 5F1XA 4Q8FA 1ZQ1C 3UN2A 3QESA 3LANA 3QNWB 3QLHA 4H4MA 1GNKA 3T19A 3QERA 2HEKA 2UXBF 2QA4G 4YB7A 1Q7LB 3OXFA 1VQMS 4ZTFA 2ZZMA 4OYOA 4X62K 4U7BA 4LZGA 2P9UA 1J27A 2FZCB 1JLBB 5ALIA 3F0NA 3U7JA 2EZXA 1HBOB 3OUYA 4Y2IA 2LDYA 4RLEA 4FOIA 3K57A 5ALLA 4YXJA 3E51A 3VQ7A 1BHNA 1KQKA 2P9LA 4C1NI 3ZYYX 1R0AB 5KNIA 5ALVA 2KI2A 4CO1A 4OQJA 5K14A 2LEBA 2VJ4A 3R3TA 4Y65A 2AZ3A 3UWTA 1C6VA 3UDLA 1KN6A 4CERA 4Y00A 1U0SA 3NOGA 2A10A 2QI2A 4HHHA 2HURA 2E29A 1NJZA 2CQPA 4FJJA 3DDNA 4AF1A 3DU6A 4RNMA 3DLKB 3ED5A 3NGTA 1U1KA 3ZSVA 3H4BA 4KGXB 4ERDA 2VIXA 4UAUA 1NB2A 1KLMA 4ZP6A 5HROB 4PEOA 1RXVA 3T1YF 1A9NB 1Z00A 3FLCO 2KHOA 5LXRA 3NCQA 2CJQA 2BJ8A 2D0CA 4C8OA 4CIEA 1WSVA 1FNMA 3VV2B 3BM7A 3W8GA 2O3DA 2RKIA 2AD9A 3ATUA 3THYB 5E2QA 4OLOA 2F9TA 2V51B 3HW8A 4ZN1A 5ADXA 4O5CA 2WC9A 2I5HA 3LOUA 5KFUA 2QLXA 2WB1C 4MFBB 5AXLA 1I94F 4Y2CA 4KHMA 2HW3A 1RDAA 1N0VC 1SIZA 2BKPA 2O8EB 5CHIA 3VTIA 8ICRA 1U2RA 4JI1J 4H8KA 3ITHA 1KQSM 3QJLA 2MUTB 1XMOK 2CWKA 3OTOF 2JC1A 3O3HA 4OJHA 3IWXA 3D6MB 3SQ1A 3AVNA 3LDNA 5ETTA 1M5KC 4K25A 3K8WA 3IRWP 1KWMA 4KN7A 4DU8A 1WSRA 3P45B 4PCQA 4JRPA 2FVPA 2IGIA 2M2BA 3T5LA 3NVMA 2K4IA 4IFEA 4LQ3A 4RWWA 4ZLLA 2HVEA 4OKEA 3W2VB 5KG1A 3HHDA 1UFKA 4BG9A 2Z58B 4DB3A 2IBOA 3MECA 2YKOA 4WXWA 4AYBF 4KTZA 4OCZA 3TA1A 3KLGA 2V69A 5LXYA 3OL9A 4RQ3A 1HWIA 2PFQA 1T9TA 3DNCA 7ICLA 1U2FA 4NWIA 2YNFB 1L7NA 2F1HA 4AUKA 3GB0A 5MLCV 3H40A 1Q18A 2RDIA 4B1VA 4A8XA 1WYGA 3VOVA 3A8YA 1Q95G 1IBMJ 1PYOB 2GMHA 3UXOA 3BO2A 3ENVA 4I4BA 2X1AA 2IIRA 5AE3A 4ED0A 4FXDA 3H3NO 2RILA 5K8NA 1ZQRA 3H25A 8ICNA 2QTWA 4JK7A 5D4OA 3FRZA 1IBLF 3ZT0A 1G15A 4BG8A 5KQDA 4B1YB 3S41A 3TZZA 2HS3A 4Y2XA 3KLHA 2D3UA 4ICAA 3LPUA 4RO0A 3QT6A 3TJAA 2FHOB 4UZBA 3TA2A 3SAFA 3SJHA 2O8BB 3BB5A 4F26A 4WTYA 3CB4A 2CDRB 3JB9k 1YTYA 2NZ4A 4KPCA 3DOMB 3B8AX 5T7LB 4PG8A 4M6WB 4DHYA 2F3JA 3AA5X 3IDHA 1FKPB 4CLPA 4I2DA 3LP3A 3ZETB 2B8PA 3MAAB 1Q3UA 3L3UA 5GMDA 2I38A 3CCQN 4DSEA 4NV0A 4NASA 2RH3A 4K0KK 4MLEA 3SR6A 5BRHA 2DR9A 5B08A 2ZXHA 2YX1A 4C3KA 3EGNA 3G71S 4CZGA 1TUGB 5A6PA 2QLBB 2GWKA 1NOMA 2MYFA 3CNHA 3BV8A 4Y2TA 1J5EJ 4ANDA 4CHOA 1JLFB 2ZBQA 5KFRA 5CZXA 1S72N 3R1LA 4C0BA 3ZDBA 2GGPA 5KFVA 1MWYA 3ENHA 4CJQA 4U95A 3KHRA 4LBPA 3CD6S 1ESVA 5ALUA 1RT2B 3L7UA 2Z56B 3C15A 5GAEU 5F0WA 4PZOA 3J7YP 1TV6B 3AD7C 1YTAA 3MEGB 4AYBC 1H7WA 3CRXA 3KK3A 3VEYA 3MPWA 1SI9A 2PFDA 1R0BG 2HHHF 2H54B 3VGSA 1X2IA 3RB6A 1L8OA 2ZH8A 3SJJA 3NGUA 2YPYA 4F25A 5D4NA 3GU3A 1SQGA 2B4UA 1WSFA 4M5NA 4M3XA 2HHWA 3E01B 2J5AA 4LD0A 1GTHA 3BQ0A 1UW4A 2CJYB 4BRHA 4E98A 1F2GA 3ISDA 1LKYB 5E33A 1UWAA 5A8WB 1FKAF 4ECYA 4F7VA 1ZD3A 3M05A 4IO1A 1FFUA 3RRGA 5H9FJ 4JK9A 4CO0A 4DV2K 1IV8A 1EHWA 4BWMA 3FZHA 3JTOA 2AYBA 2E5IA 1A76A 1HD0A 3W8PA 3DXMB 5AM5A 4C4WA 3I8DA 1YI2S 3QBXA 2VFTA 3M8QB 4QZHA 5JTIA 1QLNA 2QRRA 4O55A 7AT1B 4I2HA 2WF6A 3GPAA 4AXIA 2I1RA 3IP4B 3THVA 8ICJA 1JXVA 3MBYA 3CC4N 4N77A 1PK1B 3OYJA 2RRAA 2JFKA 3HM8A 1PKUA 5LOQA 3WXKA 5AICA 4FVMA 4CLZA 5IS2A 3G10A 2C2KB 4PA1A 1CC7A 1ITPA 1B9DA 1RYRA 4R25A 3G25A 8ICEA 3HFVA 2KK0A 4M3ZA 1YRXA 1TV6A 3SZ2A 1GXTA 4IOAQ 1IM4A 1HKAA 4DX5A 2CPFA 5AQYA 1V9PA 1EZZB 3EZWA 1UEKA 3J7AN 2CRLA 1FXLA 2M52A 3CCTA 3EM1A 2CQBA 3K59A 3M6UA 4ANEA 2GX8A 4EX6A 4CH0S 4J8FA 3V7KA 4QR2A 3EZ5A 4CGJA 4NLOA 4B3RJ 2X7IA 3TWZA 2RF2A 4E7JA 1G6BA 5D4PA 4TUSA 1FWPA 4LF8F 1ZQMA 2B4PA 1NOYA 4PKGA 1F1BB 4NI2B 2JH3A 1ZD5A 4UTGA 2HGLA 4JI1F 3JPSA 4GC7A 4IS7A 3AMZA 9ICCA 1R89A 2GMLA 3MWPA 4WFAQ 3MDFA 4YOWA 2QB1A 3ZZRA 2L9WA 4MFCA 1O0PA 4RW9B 1Q7YT 1RT5A 8ATCB 2KVQE 4M7YA 3CCMN 4JYAJ 2BE2B 3HPGA 1JB0C 3CD6N 2FDNA 4KC5A 3GZ7A 2XEXA 1S9EA 4G1QA 1TZ0A 3FQLA 3T1YJ 1WI6A 3W66A 3PKYA 1O13A 2CQHA 1HQEB 4FK4A 1S0OA 4YG2A 1IR0A 2RHSB 2QLFB 2J0WA 3IO1A 4WK3A 4CHYA 4YNQA 3CJ5A 1F0MA 4DX8H 4HUFA 4DPTA 4QR0A 1EETA 2DGUA 1HJOA 2F7TA 1ITGA 4DX7A 2MGZB 1DOQA 2G0IA 1S6QB 1IBCB 2DD8S 3HSGA 1TR0A 2RN2A 2IA0A 3TO8A 4QWEA 3CWJA 1SKSA 1NI3A 4W90B 2J7KA 1S49A 3MM8A 4W5QA 1X5SA 2E1AA 4O4RA 5C15A 5AQZA 2HSTA 5B66U 1WD6A 1KP6A 3BDPA 1YITN 1AZSB 3P4IA 1HNVA 2CKWA 2CRXA 3DGPB 3NCPA 3OR2A 1HA1A 3RB4A 2CZVC 5JUMA 4J9QA 4IG0A 5KFHA 3N6LA 3L95X 2FHJD 3EWAA 4G3IA 4TUQA 2UXBJ 2P9PA 2B3TB 3CJKA 3ZSYA 3TQEA 4DOAA 1YZ6A 2AXTU 4R5PB 4PYAA 2M8DB 1YBTA 1N32J 1NGAA 4XH1A 4XH5A 5J8YA 3TTCA 3VZIA 1C1AA 3T5KA 2FTRA 3TUJC 1N5YB 4CRJA 2P5OA 1F9EB 3RYLA 2IJRA 3LPEA 4J37A 3CNQP 4C7YA 2HFUA 2K06A 3C46A 2AYEA 3W64A 4WU3A 5HNKA 4OPJA 4GKKK 3VQEA 1RA6A 2QGFB 4FKXA 4X64K 2AJ1A 2PXIA 2FC9A 1U6ZA 1K5OA 5GAHP 3TAPA 5J0OA 4B3SJ 1SQFA 2OMLA 4FPAA 2I7PA 2LFVA 5J0YA 1WEZA 2YX7A 1WNEA 4GO7X 1TUYA 4RQ0A 2BOAA 2D6FC 1ZQCA 3GTYX 4IO8A 3OBIA 4AHRA 2I6XA 1Y9OA 4EAHD 5AQUA 3BF3A 4F4XA 1NK0A 5AFUH 4BRKA 4XAKA 5KOWA 3NAEA 4JNEA 5F3XB 1L3SA 2FJVA 2IVPA 1HPZA 1YIJS 5HRSA 4J2DA 3W9HA 3F5EA 5LSOA 1EIYB 2WMMA 1RU2A 4DR1F 4IR9A 1TL3B 3WZ0A 4N76A 1DTQA 1JKHA 5ETKA 1KVJA 1PIEA 2HNDB 2R42A 5AQLA 4K5RA 9ICAA 1ZBIA 1MWMA 1HL6A 1KLMB 4OX9J 5ALHA 2IM0A 3VCBA 1NDKA 1TYQA 2H5IB 4B9SA 3ZEUB 2W2NP 1A0OB 5ETMA 1CULB 3OTQA 4QR1A 3Q7BA 3Q8RB 4JD2B 3KJQB 4UB2A 1HQUA 2UUBF 1K8AO 1HUOA 1W9HA 4OHWA 2DXEA 4A8YA 4FYWB 3OW2R 3MGVA 1HMVB 5ALJA 2KO1A 1VHXA 3CC7N 2AF6A 1N34J 4DUYK 5E3QA 1QQNA 4JB3A 1VSEA 4CZFA 5HMMA 4K4XA 2JFDA 4O5BA 3G0ZA 1HR0F 3SLCA 4J9VA 3NAIA 1S4FA 3K58A 2BW7A 2H9ZA 4PUOB 1RGVA 1NJYA 2A1JB 1T3OA 3NASA 5EXWA 3E9LA 4X65J 5HP1A 2XS5A 3FE1A 4DR6J 2P9SA 3JAMU 4Z4CA 3QNNA 2MEWA 4K4ZA 4A8SA 1T11A 3IXQA 2XS2A 3BEGB 2BYCA 5B0DA 2O5DA 3QQCD 1HYSB 2UU9F 4NXMK 2NRVA 4KLTA 1SJ4P 3CC7S 2KDOA 5AXKA 5B0EA 2D0AA 4IFYB 2CA9A 4YOXA 1ATSA 1GO3F 2AEFA 2KHDA 3GLJA 1DK2A 4BRLA 2R8KA 1S9GB 4OZ1A 3MR6A 2C3YA 1Y0HA 3NAHA 1J2MA 2HBJA 1VRUA 3VEOA 3WKCA 2WHEA 2BJEA 5HP4A 5HJYA 1WI8A 3MAQA 1Y10A 4P7TA 8ICTA 4DWIA 1P1LA 3BSCA 2RHFA 2DGXA 1IQZA 2RHQB 2W43A 5AQIA 4GVEA 1KQQA 5J2CA 4M3RA 1NO8A 1B4SA 1QVGR 3BGRA 4QAGA 2HHHJ 1YIJN 2AJ4A 3BO4A 1IBLK 5AQHA 3C6HA 4MKAA 4KX5A 2W4CA 3MGJA 4JI4K 2XULA 3UIQA 1ZC6A 1O1WA 5FROA 2CH5A 1N5XA 1B3TA 5FPDA 1U6BA 3AXMA 3S3NA 2DITA 2GS8A 1P8ZA 1NPPA 1OY6A 1N5QA 2W55A 2GNKA 4JUZA 2VUGA 2RDDA 1HMVA 4H0TB 3BZKA 3PFOA 5AKJA 1GXLA 3DLHA 2XSFA 4KAIA 2JH1A 1G7CB 1L3TA 5C25B 1LKZA 2C3PA 2VQFJ 2ACMA 2D0OA 5HK4A 1RBLA 4PKDB 3OYKA 3I76A 3M6ZA 2Q0UA 2H3QA 4R66A 3IM8A 5KPRA 1JMTA 3AUOA 5ALYA 3O2IA 2UP1A 3JSMA 7ICVA 3GU0A 3RJEA 1RG6A 4K4SA 2RNEA 3IHQB 3LZIA 4QNLA 4DTXA 4RL1A 3VALA 1QCKA 2ISPA 4J2EA 2LEAA 2DVIA 4I6WA 1RZTA 3ETOA 4RBTA 4OZ2A 2R7WA 2KFYA 3VMFB 3VQAA 2UUBJ 2F4VK 3GJQB 3SNNA 2CPRA 3FR0A 1PC4A 5BYSA 3J81j 3PMNA 2GJ2A 1IWAA 1UPHA 4IOXA 1UFWA 4IDHA 4JHDA 2ZOMA 1BD6A 1XC3A 1NLKL 2VFSA 3RH5A 1REGX 3D6HB 2BGWA 2DXDA 2ZOFA 4RQ4A 3SBGA 3L4IA 4DUZF 4MQ3A 4FP9A 4YD1A 2J6TA 4M9LA 4Z6EA 3TAGA 4EO8A 4D3HA 3KD3A 3VGVA 4ZJLA 4RZRA 4ECRA 3KK1B 2NRHA 4Z6FA 4JV5J 3QU7A 2KM8C 1VBXA 1ACMB 3ZEUA 3N4WA 3AA2A 1YX2A 4DQRA 3U1NA 3ZTQA 2PC6A 1D8LA 2ZJQL 3O9RA 2HQGA 3A5MC 2VQEF 3DN9A 2IOCA 1JMSA 4IQWA 3EUNA 4ED1A 3QT5A 4V19J 2LVWA 4NYOA 1IG6A 2JLFA 3GWCA 3MWTA 4EU0A 4FK0A 3HWTA 1UJ6A 2ZBPA 2EKNA 4CDGA 2VD3A 4Y2VA 3ZNUA 4FYVB 2OJ3A 1SCJB 2Y1JA 2LXUA 1AT1B 5ALPA 3SCLE 2VG6B 1RT7A 1RTJA 5J0XA 1JRPA 2MU2A 3SBTA 1NSKL 2ZGZA 2XGPA 3I0RB 2CG4A 1KDHA 4ZVPB 2ZUBA 2EFQA 1N36J 2CPZA 4CF5A 4G1PA 3NRBA 4BXOB 4CBUA 3RRHA 4LREA 2HWTA 2ASDA 4FVCA 4UB3A 1NK4A 3MCMA 1P27B 3EEQA 2OPPA 2P66A 4C6AA 4ZOSA 3AVBA 5L8RC 5AQPA 1U4BA 4GV9A 1WC5A 4FJKA 4GV3A 1N33J 2PI4A 2CJXB 2FE9A 5DG9A 4C11A 1WHVA 1DRGA 3AH6A 3UPFA 2ZIUB 5E7OB 3M30B 2VANA 5CZVA 5G0RA 1KC8T 2ZVSA 3TADA 3KFUF 2PAVA 2OZMA 4BBYA 2ZWOA 1HHTP 4I6MA 3ULEA 1C0TB 2JEGA 1LWEA 3GSDA 3I87A 3VEXA 2DNOA 4Q0BB 2D1CA 5IC4B 1IKXA 5DBAA 2Q6BA 1V5VA 5M1NA 1DTTA 4AXJA 5J2FA 1RT1A 5KRTA 1UVNA 1NDLA 1BU6O 4PGYA 4GXIA 4JN4A 2E66A 2CAJA 1U8WA 5KTQA 1ZQFA 3RJKA 1TP7A 4DV3J 1V4SA 1J97A 3ZZ0A 4P2SA 1QDUB 5MLCQ 1N8RT 2A1BA 2FD2A 2OHDA 3NTUA 4H0XB 4H4MB 3NY0A 3DXBA 4CEOA 4Y28C 1VHFA 4FJHA 1Q8IA 1ZAWA 3GCWP 2VQFK 3FZFA 2P8IA 1AZSA 4MFFA 1X9SA 1T7PA 4ZIVA 5AKXA 2F9WA 1Q1KA 1COOA 2FF3B 2KHCA 4LR9A 1E4GT 2KRBA 4RW7A 4UAZA 4CBWA 1XC9A 4NOHA 3DM2A 2C2OB 3IG1B 3IUCA 4GV6A 1FCAA 4HH1A 3M6GA 4OYZA 5IM0B 1VSFA 4EEKA 1XWLA 3O1LA 3W2WB 1UAXA 2DIVA 3PRDA 4FWQA 5B0FA 4RTFD 2HF3A 1YLXA 3E66A 4NRUA 2F8KA 1U24A 1FO1A 1KDNA 2PI5A 1JCEA 2FVCA 4C3LA 3TX8A 4DCOB 3K4GA 4B3TF 4K2XA 1D9AA 3D2SA 1F5CA 3UMBA 1APSA 4AHCA 1FJGK 4IQVA 3U26A 3R8YA 2HZAA 4L74A 3QWUA 3C6TB 3CCVS 4NI2A 2YB1A 4CFBA 2HVDA 1S1TA 1NK8A 4K42A 3TAMB 2YNFA 4LF8J 1A5WA 3MF5A 3QMQA 4P2MA 3WXLA 4RNOA 4NLDA 2BCUA 5BR8F 2OTLS 9ICRA 4YOYA 3RBXA 2WW4A 4A8QA 1Z1BA 4HEA9 3OYMA 3GIJA 3M2RB 2PGCA 1O03A 1S1XB 2OKQA 5AI4A 2O8EA 4MKBA 4YFKA 3I33A 3MR5A 2ESEA 2L41A 3E1YA 1CJUB 3TX0A 4QJVA 1K73O 2KVIA 2V67A 4Z6DA 4BRIA 5BYRA 4TSXA 4A8EA 3SQGA 3D1HA 3S9HA 1KAXA 3LUYA 3DLJA 4ZVSB 2OTLN 4V19S 1XQIA 1NU4A 1Q86T 1MWKA 5H1SQ 2RS8A 4HT7A 1RTDA 4J9MA 1E6VB 2OP5A 2WVFA 2UUAF 2BQRA 4DTSA 1XSLA 4EBEA 4CHQA 3UFCX 5ALNA 4FJLA 3R5GA 4ZHRA 1VQ6S 5AI5A 1EXQA 5KG7A 4OHZA 2FY1A 3U6FA 4G65A 2RUSA 4KYZA 1QE1B 1YJVA 2BKOA 3KKRA 3F2KA 3CJTA 4CHPA 1HWKA 1U1MA 3MCSA 3OTOK 3THYA 2HMXA 3CDUA 2HVZA 5EOYA 1B92A 3Q8SB 4CF9A 2KKHA 5D4BA 1YQHA 2GW8A 3SEIA 2ASYA 2JWKA 4FJ5A 2NV3A 4F02A 1J2NA 2V2ZA 2NSCA 3VQ5A 1K1SA 1S76D 1Y5IB 2K1RB 4AL5A 4W98A 4DTJA 1JLCB 1X3NA 4EMDA 7ICIA 4AHUA 1VQ8N 4FW1A 3R5AA 3K5LA 4A5AA 4M5LA 3LDLA 2RKIB 1HKCA 1S6QA 4LUBA 3M9OB 3Q8MA 4IYQA 4ZP7A 3HZ6A 2QYGA 2E20A 3FSIA 1UJ4A 5KFTA 1O08A 3SCIE 4C8ZA 1SAZA 1FJGF 2A18A 4Y0FA 3CJ1A 2CPIA 2GELA 1C0GA 3CEDA 8ICUA 5ALDA 1BA0A 3TAFA 3IG1A 5CYQB 4LBIA 1NMEB 3QEIA 3J7A1 2VWKA 5CD4H 2KD1A 1T9WA 3EDQB 3KK2A 4J03A 4CLUA 1ZQKA 1HIYA 3BQ7A 4R8UA 4JI8K 4F5PA 9ICXA 3D6RA 2MJNA 4YB5A 2FUG9 3IBWA 4PXBA 4FZNA 2KN7A 4I28A 4JKFA 3SDEB 1NRKA 3W5XA 3OYHA 2KEYA 2N7YA 1LW0A 3CT9A 3VZHA 3R2DJ 4AHSA 2KXNB 2RRNA 4CNYA 4Y2UA 4KO0B 4PKHA 3L7OA 1RAFB 4U67Q 3PIOL 2E8OA 4DFPA 2FHMA 3KD1E 2YKMA 1PZNA 3NNCA 2NO5A 2EANA 3RJMB 3G9CA 1LWFA 3E58A 9ICLA 2W9CB 2M5YA 3QLHB 3O9QA 1VK3A 5HLFA 4A5BA 2JZBB 4HTIA 3L9ZA 4JI8F 5LSLA 4ZLJA 1JLEB 2QWMA 2IHNA 1ZQEA 2UVUA 2BA9A 1HI0P 3ZDEA 2B9XA 3EVWA 1MC8A 4UW9A 4I0WA 4JKHA 3B78A 1RT4A 2ZNZA 2YJFA 1XTZA 4NEYA 4WFNQ 1PG5B 1U2VA 5T7BA 5J2KA 3DXKA 1VC6A 1KEJA 3KLVA 5B0CA 2LKZA 4NLGA 3S1TA 1R7IA 2E8NA 3I32A 3CMAN 1NSPA 2DRAA 3G6YA 5F2RA 4USIA 5AQOA 5AZJB 3L6QA 4IJAA 1FFVA 2DF4B 4Z6CA 4DPOA 1S0VA 5AQSA 3C6UB 3TACB 2IM2A 2EH9A 3PRVA 4F5NA 2V9KA 5KFKA 1RM6C 1FNXH 2OGUA 3EL2A 3SK3A 4JI6F 5HL7Q 3L4PA 4I7FB 5LMUF 4X4NA 3DLGA 3N01A 1M0SA 4B8AB 4FZYA 5DQIA 4BWJA 3B6OA 5F8IA 3HP6A 2UXCK 1ZQAA 2QK9A 2IOHA 1U45A 4M5JA 3M8YA 1R8AA 2R8HA 3IV6A 4USWA 1SUQA 4MT1A 1NG9A 3WDOA 1S77D 3T3FA 3NH2A 5DMRA 4C23A 9ICPA 3DLEB 3WKBA 3R5DA 4ISGA 5KAIU 2OD6A 4RQ6A 2GUPA 2H4YB 3AVHA 2X1GA 5D78A 4GXKA 1KKXA 4NLPA 5J0UA 5KGWA 2CN1A 2OXOA 1UAWA 2BUNA 4GKJK 1AW0A 3R3LA 2WRMA 5KT5A 3GIRA 2W2PP 4PQUB 4OZ0A 4YMOA 2XMTA 3CMEN 4CJRA 4QZFA 1LOTB 1R27B 4OHXA 2Z1JA 4DTNA 4KGZB 1JL1A 4RCHA 4DPWA 2XO6A 3BREA 4J9RA 3ETMA 5AE1A 3QEWA 4O3NA 1U7LA 2NCKL 3UM9A 1RT4B 2YMQA 4I67A 2BANB 2XB2D 4Z4IA 1S1WA 2G5IB 4WWSA 4Y3CA 4EYIB 2M9KA 2MHNA 4X4SA 3AJ2A 1FDNA 1BWFO 4M9NA 1OWXA 1KVCA 4K4YA 1IVZA 4F5QA 2XNQA 3MD3A 4HVZA 1TKZB 4PL7A 3LAKA 3AD8C 5CCMA 1JROA 4P7VA 4URSA 3FUYA 4F0HA 2B51A 3RTVA 4BR0A 4UB8U 4QS9A 4PJ0U 3A12A 5C25A 3VC8A 4UY85 3C8YA 1FXRA 2DK2A 3TSQA 1PVPA 4X4QA 2ZUCA 2A2DA 3H8SA 4FS1A 3N7SC 1X9JA 3AU2A 2W9AA 4R0EA 3L2RA 5KFIA 3O08A 4KBOA 4RT3A 3F44A 1K6YA 4E7LA 1ZJMA 1PYTA 4WP3A 1T05A 1KOHA 1ZTWA 5M1OA 4QZGA 1DXSA 3UCZP 5JVGL 2PMWA 2W24A 2E4LA 4D3GA 2ZJRQ 3MXIA 3SSRA 1A6LA 5AQWA 3FEZA 1H74A 1VLOA 4BR9A 1RB0A 4DOZA 1D9DA 3TYTA 2JLGA 1NDPA 3BO3A 2K8CB 2AV5A 2IS3A 1Q82O 1VBZA 3O1BA 3MCPA 2KVCA 2FBXA 2EK6A 4FWMA 3Q7CA 1T02A 2KXHA 4RPYA 3C16B 5ALTA 3MM6B 2RSQA 4HI1A 3I0RA 3JQJA 3O5TB 3J81Y 2VBWA 1BPDA 1WOOA 3OVAA 4HACA 1OH5A 1SB6A 2F1JA 1WEYA 2KH9A 4JS4A 3B82A 2E8AA 2DR7A 4GXJA 3BSNA 2XYGB 3I1YA 2YMMA 5J2PB 4HTLA 5AQNA 1DRZA 3FCVA 4PABA 3KVGA 2VJVA 5B0GA 2PD1A 5DM7Q 2BCRA 2FJXA 4ZPAA 2HHUA 1YJWS 5F8JA 3NRZA 2E5GA 2AGOA 3AO5A 1BA1A 3UE2A 5FIIA 2J76E 1LFPA 4OGCA 1S1UB 1SB3C 1LAWA 3A8EA 4UASA 3G96A 2A3JA 4LFAK 3TPQA 5C2DA 4CJVA 1T9UA 3BZCA 2H3VA 4H5NA 2JX2A 2CNNB 3QE9Y 5IIJA 2OI2A 4I9LA 4ISEA 3WK8A 1WSHA 4CZCA 5E3AA 2PFUA 4PYDA 3GFHA 1COKA 4DV7F 4DR2J 1YAGA 3VF2A 3CCVN 1VBYA 5LM7E 2ZTEA 4BRFA 4HL9A 4NCGA 4P72A 2HFNA 1L3VA 1WF0A 4IG3A 2XIDA 1XR6A 4KY3A 1ASWA 4CYUA 4RQ7A 3DOKB 3OYIA 4OI4A 4BC9A 3CFPA 3C2MA 2D0BA 4EI2A 1ZS6A 3MTJA 5GVQA 1S10A 2KZZA 2CQ2A 1YDLA 4KH4A 2R18A 1Q5VA 4XA5A 2BJ7A 1FEEA 3V5RA 3GG1A 5HROA 3NOCA 4AHTA 1UHUA 3EXYA 3CDWA 2HDOA 4P4MA 3THWB 5A2QY 1PBAA 2UXDF 5EHHA 1JK9B 4M9HA 5E0OA 4LF4K 2FGCA 4IQXA 5KFOA 2O67A 3IFEA 2KXFA 4YCXA 3M6KA 3DLGB 4KLUA 1HX1A 4HWIA 3C1ZA 1D1UA 4AM7A 4CGHA 3DGVA 4MJKA 3QSYB 1SVDA 2Q36A 1RWUA 4QYZJ 4WFAL 5AT1B 5DKWA 2VC1A 3HFZB 3EPGA 4OPAA 4M3YA 4HT5A 1SZHA 3AA4A 2I5JB 3M8WA 2ZH1A 3I31A 1ED1A 2IMWP 3FGUA 4B3TK 3CJ8A 1ZAVA 5ETPA 1J53A 4FOEA 2IYGA 1RWPB 3B54A 1BPEA 3DOLB 3U1MA 2RAQA 2E9RX 3HVAA 1IKWA 4CJ5A 4DV5J 1KAYA 2D3ZA 2YKNA 3J80U 4LRBA 3WNHA 2BPCA 4DCPB 2DNGA 2OTJN 4QZAA 1GMWD 3I8BA 1AROP 4ZCMA 3AM9A 4DCHA 3WC2A 4O8UA 1NAQA 2QW9A 3UN5A 2YWWA 5I42B 2HMIA 4JKCA 3NF6A 1PCAA 3WQTA 2P2CB 3F2BA 4OGEA 5ALMA 1YJNS 4NJ8A 3KZIU 3WUHA 2XHCA 3PKMA 1MMLA 1WLJA 1GX5A 4FJ7A 4MO5A 4WJBA 1QH9A 2QX0A 3WK6A 3BF1A 4Y2QA 3C2KA 3M32A 4YXMA 3AL0B 2ZIWB 1RTZA 4US8A 2WB1D 1DJ0A 2GFFA 2BXJA 3UKUB 1RNHA 5KPTA 3TFRA 3LGHA 4PG7A 1F21A 5HP1B 3ZTOA 5CCLA 1N63A 4FZLA 1Z4NA 5BXIA 4RQ8A 3HZEA 4HTJA 1ZQPA 3A8IA 2LYAA 2DKOB 5LJWA 4AILC 3H90A 1FE0A 2P9GA 5J2MA 8ICVA 1X6IA 2EWSA 4C7QA 1VR6A 3V6DA 3S7RA 2KN4A 3MR2A 1PVRA 1OYEA 1HYSA 1YTUA 3VAIA 3ILIA 2EZYA 2F1FA 4F67A 3SBMA 7ICOA 3FEYB 2K8AA 2IOFK 3N28A 5BOMA 1VAZA 3HLUA 3VQCA 3QO9B 4RWXA 5D0RA 4BCAA 1S9GA 2DHGA 5FLXU 3SQOP 3OTDA 2Y0SD 1ULRA 8ICPA 5I42A 5CXTA 4X84A 1EKSA 3SQIA 1S97A 1ZA1B 2IMOA 4Z4HA 1MROA 4WQ4A 3D6JA 2XY5A 1X0FA 2YNIB 1EETB 2EC2A 3GV5B 3HT0A 5J1NA 3KWGA 1IBKJ 2NRWA 3DEEA 4LF7F 2G5HB 1Q5YA 4FLTA 3QIPA 4NLSA 3T5JA 3O4WA 3R6GB 4DL7A 2V7YA 4LF6J 4LF4F 4YS2A 2LHTA 2VCPA 2MRLA 2ZZTA 3R27A 3AVIA 2PKEA 2QJ3A 3MEKA 3H4DA 2BMBA 1J5OA 3MX5A 4BDYA 1UETA 2IPOB 2CVEA 2VFRA 5A6WA 3V9SA 1JJ2M 2F4VJ 2UUBK 1TKTB 1BOTO 2Y9HA 1D0EA 1WDTA 4ECVA 4GVBB 3AVGA 1YHQS 2KE7A 1HRHA 2BACA 9ICQA 1GMUA 1X4FA 2RT3A 3BPDA 4CLTA 1K0TA 2HFOA 1XK8A 3FBCA 2X1BA 3AVJA 1W26A 4KKOB 4ELVA 8ICWA 2WF5A 4WFZA 4NM2A 3H0PA 2J7UA 1JJCB 3QIDA 4N47A 4U7UD 4KT0C 5JICA 3N97B 3GBTA 1CLQA 2XCPA 1SXLA 4LIRA 3QUTA 2I8EA 4FYYB 4KQZA 3V6KA 1VSJA 4PHDA 9ICIA 2LCWA 3E9PA 3M8QA 2VKZG 3KLEA 2DY9A 1N54B 4XH4A 4PKIA 4JI6K 2W25A 2E5SA 4DV2F 1EWRA 4X4RA 3KG1A 1QVFR 9ICGA 4IO9L 3PEHA 5BN9A 1SV5B 4NRTA 2AT1B 3UCUP 2R7YA 4LRAA 1TGOA 2K3IA 3OR2B 3OYCA 4GLXA 1T3NA 1YZ7A 4S0MA 3UD5A 3RWUA 2NYIA 4MTPA 4WFBL 3OLBA 4BJQA 1X31C 3PDNA 1XU4A 5AKYA 4ILHA 2RIJA 3CJ9A 1KSPA 5HMZA 1YJRA 3GMGA 2DNQA 1S0NA 5B0BA 4DV7J 4DKWA 1N5SA 4WYBA 1SQKA 5KFYA 1VQ4S 1NZPA 3IP0A 4CFCA 3GFZA 1FFWB 4ZCKA 5K9FA 5KAFU 3D28A 3KZXA 3EVOA 2W42A 1N5YA 3H2UB 2J8SA 1YJUA 3C65A 2AMCB 1WCLA 2IDEA 4H0VB 1IKYA 2V4QA 2WAQD 4ELTA 2ZC3A 4ZVQB 4U7UK 3NCRA 1MU2B 2DBYA 2A1AA 3CDEA 4LSNB 2KLAA 3LP0B 5C2GA 2Q3PA 1WSEA 3TADC 3EJMA 1S6OA 1PO6A 2YHBA 4PL2A 1NNLA 5EDWA 2Y1IA 1BVSA 5K14B 3SMVA 4IG0B 1N36F 4BR7A 5DRKA 2Z2ZA 3A5OC 4JI5F 4JWMA 4O5KA 2WCXA 2YVSA 3C3LA 4IC9A 4KB1A 8ICBA 4FWPA 4EP5A 3SUQA 3AD9C 4IRCA 3PW7A 1BQXA 3BKUA 4DR3F 4BGAA 3MMAB 4PHTX 1OH7A 4WF9Q 1S1UA 3SMPA 2Q6CA 4FJNA 3MR7A 2F9JA 3MM6A 1ZRNA 2G09A 1SIWB 1SKRA 2F9DA 3LGMA 3OA9A 1UEUA 3OHAA 4YR2A 2HCFA 2RF2B 2Y0SF 3OS2A 2J6UA 3U9DA 5EGYA 3D67A 1IH7A 2ADBA 2YX6A 3BYRA 1FKPA 2VODA 5HANA 3BGUA 3AOCA 3EZUA 1AFIA 3IM9A 5CYMB 1HBNA 4M7XA 3HKWA 4NZ0A 1NKBA 2E7WA 4KMUA 3G6XA 3P3DA 3GDXA 4I2GA 1BGXT 1IKVB 1JLQB 1T95A 3C5FA 2CZ4A 3HI0A 3R6MA 4HR2A 2EC0A 3ZZPA 1WF2A 4RW6B 3W65A 4E8UA 1S9EB 3VF4A 1MQ2A 3AT1B 3UI3A 1VS3A 2D0PA 1NSQA 1VQ8S 2HF4A 3GJTB 3HO1A 3IRXB 3PUFA 4UAYA 8ICSA 1B9FA 3BJYA 2ZJAA 2CJKA 2FSKA 2HWIA 3HHEA 2GOLA 4JI5J 4KPYA 4H0OA 4LF5F 2I9GA 3TP2A 4MHVA 4NCAA 3BDEA 3VQTA 4DSLA 2ROEA 4BREA 3BQ2A 4M1KA 2DFHA 1U0HA 1XBWA 1NPRA 4LF9J 4O5EA 3MUMP 7ICQA 4DV4F 4ZCLA 1NLVA 4M63A 4UQGA 4N56A 2E5LK 2W8LA 4NLQA 4W5RA 4WK1A 1GEHA 2R9LA 1ZQSA 4UOHA 1PK3A 5IT9Y 4MK8A 4JHDB 1GLJO 5DO2A 1N56A 4KLGA 2HAIA 2Z1HA 2A3VA 1FFGB 2GHPA 3MEDB 4KKOA 4NE9C 3BS9A 4CD1A 1JWWA 5KFMA 4K2JA 1GOAA 3CCEN 1KOOA 3ZDAA 4RUBA 1UL3A 2DHSA 5GADU 2RQ4A 4B1XB 3CJCA 4KR0B 3O9TA 1GT8A 2UV8A 3VF6A 1ZBFA 5DGBA 3FFKB 2JV3A 3RJHA 2P9NB 4OI1A 1Q8BA 4KE5A 4Z2XA 4YD2A 1LWCA 1NBEB 2P5GA 3PG9A 4YY3K 4NO7A 3RJFA 1N33K 2YHXA 1WAJA 4UUXA 3ETRA 2LQJA 4UBCA 4CM2A 3QEBZ 1NHKL 5AQTA 3QB0A 2DQNB 3QNMA 2MKCA 1XMOF 4QIWC 3MCOA 1P6TA 4QIVA 5C24A 1UCVA 1C4CA 1QHAA 4DLGA 1R0CB 1EWQA 1FRMA 1IJEB 2W9BB 5GIPA 3CO9A 1CJKB 3Q8LA 5BPLA 4YORA 3FMBA 5HRPA 5ALWA 4KX3A 2UXBK 3OVSA 1HLWA 1XMQF 4L72B 2R2SA 1TKXB 2W2OP 4KFBA 1FFSB 1D3WA 1Z4OA 4BQZA 3JSYA 4L73A 1NSAA 3UKRA 2G2OA 3K7RA 5A8KA 3WT0A 1BUXA 2WOMA 4RBUA 3IMXA 4JV2A 3AVMA 1ZBUA 3VPZA 4KITB 3SAHA 1XSNA 4OYXA 1HBMB 3MMCB 2H3ZA 2Q0RA 1FNOA 1K8AT 3QYYA 4RW8A 4BUGA 5A0LA 4DG1A 3QZ8A 2ATLA 4BY9C 1U04A 1V3RA 1P9QC 1RPLA 2R7TA 2HQIA 1KN5A 3JTNA 4ICLA 2E9TA 2M4MA 1RK8A 3HSTB 3BGOP 1C0MA 2W7OA 4F50A 3DDKA 2VFUA 2DBBA 2R7XA 1K9MT 2GCFA 2YQ3A 9RUBA 2ZIXB 3ALRA 5J0TA 3OPXA 1S5JA 3MUTP 4NLXA 4IFYA 3TANA 1WKLA 2PEHA 2AP1A 1OPZA 3AAWB 2B6AA 2NRXA 2VG5B 1JALA 4BE1A 3P5BP 3F9KA 2JEIA 4UAVA 1S6PB 4F5OA 3CTRA 3I4PA 1M5OC 1XERA 4QS8A 8ICQA 2F2AB 1WC4A 2MZ1A 5DQHA 3SV3A 4YB6A 2ISOA 7ICRA 1Q82T 1L3UA 3JPPA 3MPVA 5AI8A 3IBFB 3N4QA 1NUEA 1PYSB 3RF9A 3NVYA 3TVZA 4QZ8A 4H03B 1HNXK 5C0YA 2OPQB 3C16A 2JRSA 2F5GA 2PMZD 4E1MA 4M04A 3CCSN 2M7SA 4QPTA 1OPIA 1HBUB 3VQ8A 3FFIA 4GW6A 1VQKN 5CZ1A 2JVOA 1D8ZA 4LH4A 4KH1B 3TW0A 2IM3A 4DJBA 2LA4A 2VKRA 2L3MA 3MMAA 4ACOA 2KHQA 1ZBSA 1XUPO 2Z0GA 1L6NA 3QEPA 3NVKA 1NEEA 3OYNA 2XLIA 3NS6A 2XQCA 1T05B 5L46A 4NYNA 3HVWA 3OHBA 4WZQA 3AQEA 2VQEK 4OL8A 2M70A 2FHKA 2XHWA 2XO7A 2ZBIA 4KLDA 1EB0A 5ETLA 2VKQA 2LU2A 2F8LA 3J81U 3ZX3A 2EBGA 1M5VC 3RSEB 2XWXA 1NGJA 4E7IA 4ZHRB 1HIWA 2DNZA 1XNRF 2AHOB 2PN6A 3F73A 4I2CA 5DDOC 3MPYA 1TKZA 4ZPBA 2HWHA 3HL8A 5D3GB 4TLRA 3OLAA 2WSCC 4OJ3A 3UMCA 3ISBA 4R79A 2HHXA 2O8CA 2XGQA 3W3DA 3MUVP 1X4HA 1WG1A 5DS7A 3D7SB 4FM1A 4DOBA 3CM5A 2W3SA 2HOFA 4TVAB 4B3RK 5F9NA 5L1IA 3ZX2A 3DOKA 3AV9A 4IEIA 1HBMA 1OJ4A 4CLWA 2CADA 3DDHA 4DV5F 4IOCL 2VHGA 5EU7A 1LWXA 5AQFA 4W92B 1NPKA 3BSAA 1I3OB 3WKDA 3OYLA 1YT3A 5HATA 1KBUA 4CK2A 3TA0A 3H46O 2K8BB 4DZDA 1H2TZ 5ETOA 4DMNA 1RWVB 4CTAB 1C20A 1LQ9A 3BKFA 5ALXA 3IAM9 2V4RA 3VWSA 2HPUA 2D3OR 2MSNA 4C0OC 3AQOA 2DTUA 2FPHX 2W9MA 2ZDPA 3MEEB 3J8AA 2FYXA 1QQCA 3KBBA 2HOIA 3MX2A 3FBBA 5J0RA 3O0FA 2VWBA 3BH6B 2CXYA 2VA8A 2A6OA 1SKUB 5J2QA 3GR1A 3I56S 4PL8A 4WF9L 1UVIA 3WX8A 1A5XA 5KFPA 2HHTA 2EHGA 1UVJA 1FIQA 5FPEA 3IRXA 3DLBA 1SXEA 2PEBA 2W2QP 4A57A 3L3VA 1PAUB 2JR5A 3I9ZA 1CXUA 3PHEA 2QL9B 3Q23A 2R7RA 4DR7J 1WUAA 2ZXIA 2XLKA 1HBOA 3OUYB 2AX0A 2DNYA 1U2CA 4BVOA 5MAOA 3QGIA 3LO3A 3TVYA 3BH7B 5L39A 4LJMA 1U1QA 3LP2B 2B7BB 3EGVA 3IG8A 2MZTA 1TUVA 1IBMK 2JH7A 2XZTB 5JLFA 4OD0A 2R2RA 2Y8YA 1Q0NA 3FBEA 3RW6A 4X62J 3MABA 3D5MA 1CC8A 3IRUA 4UB4A 1PAEX 4R8UB 2UXCF 2E2OA 2C2DA 3VAMA 4LSZB 3SSQA 2GQ2A 3H42A 1B7FA 5FPNA 3M8SA 4C8KA 1NOZA 2Y9UA 4LF5K 1HPMA 3NS5A 5BN8A 1VQ5S 2EFGA 5I3QA 1W2BR 1Z19A 4Y2SA 2V8PA 3B6BA 3V6JA 2IY5B 4CVNE 2AQ0A 1ASUA 1VQKS 4MIBA 3A3NB 1IG8A 1T03A 2I2YA 3O3LA 3MAAA 2LI6A 2J9CA 4ID8A 3KUEA 2E3TA 4WYLA 4OYPA 2MA1A 5EY4A 1W25A 1C0TA 1JJHA 1HW8A 2NR0A 4EENA 4WQ5A 4N41A 4RJVA 2XBPA 2PFPA 1T9YA 2DGOA 4DV3F 2Y0SC 3T69A 2ASMA 2PMHA 2IDLA 1YRUA 3DMJA 2XS7A 3PFEA 5D0HA 2IVMA 1TUUA 2RP5A 2FBYA 3CPWR 2QWOA 1N36K 1KC8O 1EO1A 2RRBA 5E3CA 1TELA 2KZMA 2JZ5A 2IRYA 4NMXA 3R8EA 3PCOB 3AOBA 3WHIA 2U2FA 1V97A 2WAQF 2ZH3A 4GKKJ 2VJUA 4UARA 2ZC4A 2VYPA 1MU2A 3G4SN 2O8BA 2YHAA 2A1SA 2G2ZA 4HH0A 2ODGA 2XYHB 5AI6A 4KI6A 3ZZOA 4O44B 2GJIA 3D45A 1S99A 5AM0A 1H0HB 4Q43A 2F8TA 1NGCA 3KUGA 2O4IA 2R7QA 4C97A 1VFJA 3NKYA 2Z2YB 4Q0BA 2X6NA 1VQ4N 4H5WA 4I69A 3MM7B 4M45A 4JI5K 4JD2A 1TFRA 3TEGA 4CE9A 3EW9A 1N62A 4CFDA 5J2BA 4P0PA 4U8VA 1ZPWX 3OVNA 4L8RB 2P6TA 3W63A 2B4OA 4PXCA 3HRDD 1Z3EB 1E6VA 1ZA2B 3IBPA 2MKJA 2N3LA 2BM1A 2CQGA 4R0JA 4LFBK 5TKWA 3GG4A 3VETA 1GOCA 4QZCA 3WXMB 2F63A 4XIUA 2GAHC 2F3NA 1NNDA 5KT2A 3LW5C 3THXB 1VQ6N 2F8SA 2H1YA 1FXXA 5EVZA 2BJ1A 5KFFA 1SL2A 2FLLA 3MDQA 4USKA 1BCMA 3D2FB 2J9DE 3N4MB 1LNQA 1QJHA 2HKEA 1F3VA 2HRTA 4FNIA 4BLGA 3A1YG 2EXUA 1X40A 2CPDA 1Q81T 5GAGU 3SQ4A 4M3UA 3BGFA 2YY6A 2F4VF 3D0GE 1KTQA 9ICUA 2ZBCA 2O1PA 2AGQA 2GIRA 2V4JB 2ERRA 3AO1A 4DTMA 4DUZJ 1XNRK 2HS0A 4C8MA 2YQ0A 4RNFA 5FPMA 1LFWA 3HKZD 3RZAA 1XEZA 1RTHB 5KFBA 2PBDA 4LF4J 2FI1A 3M8PB 4M0AA 4B9LA 1SUQB 4OMFG 1VMBA 4CGZA 1B7YB 4CJSA 7ICGA 1NGHA 1ZBHA 1F5AA 4OV6A 2OM6A 3QGPA 2CPJA 2YPZA 2P9CA 4Y2YA 4EZ6A 1EQ0A 4PY5A 3PNIA 4BRQA 3CC2N 5KT4A 1U25A 1RDCA 3HD1A 1UP1A 2VPWB 4RW7B 5BYQA 2IFXA 4QIFA 3OPKA 4KHPK 4A47A 3MDAA 2CNLB 3BSOA 1OVQA 4GIBA 1FEHA 2VBYA 3MEDA 2K7KA 2AYMA 1YWXA 5ALGA 4CLSA 1ZZFA 4OLBA 1TTHB 4ZOHC 3ILJA 4OIXA 3TZXA 2D7SA 5AZJA 1HNIB 1N8RO 3PX4A 1KNZA 2EAOA 3DMJB 7ICHA 2KIVA 3P83D 3AVAA 2FSNA 4F4WA 4H0YB 5AK3A 3GP9A 1O8BA 3CC2S 2I7NA 2E6LA 4UOCA 4USAA 2AJQA 4PRFA 2GIQA 2Q0ZX 3TZYA 1UPPA 3SCXA 3PX0A 1FTRA 5GTHU 4O0IA 4CJPA 3FFIB 4E3SA 2EEYA 2FC8A 4LF2A 4QOZB 4YDXA 4JI6J 4H4KA 3EKUA 2Z30B 5J0SA 1GMVA 4TNOA 3QIOA 3LALA 4JI7K 4OX8A 4DR6F 1ZZNA 1OIAA 1FJEB 4X65F 2Q1LA 5J0PA 4KHRA 2W9CA 5DZ6A 1ZQYA 1RHKB 3BBBA 3LP0A 2YCHA 3OTCA 3WKEA 1WSJA 1H7XA 3J7ZT 4BC5A 3L2UA 4YN4A 1SIJA 4RR5A 4KLLA 1VOMA 5CYQA 5AQVA 1ZQZA 1WBBA 3RMCA 3HKZC 2P9UB 4WFYA 4NZ7A 3OL8A 3P6YC 3VGMA 2XTJP 4GMKA 3O4NA 2MZSA 2CXEA 1HD1A 1IUJA 4K0KF 4PPZA 2M0NA 4L75A 3CXCR 3D3BJ 2DNKA 5F0XA 1HR0K 4ILJA 1VQYA 5J2JA 3HOTA 3K0SA 3DHXA 3RAMA 2G1DA 1RT6B 3CCMS 4QQBA 1B43A 4ED6A 4KRWA 4UUWA 2P9SB 4MK9A 4P71A 5U47A 4ETZA 4LSLA 1JJ2R 4MF8A 2G8KA 3TR5A 2OWOA 2MLXA 1VDHA 2DR8A 3MDCA 2IHMA 1XR7A 4QIWF 2OYQA 3QGHA 1HNXJ 5F8MA 5BRDA 2FHJA 2GHWA 2H5EA 2FLNA 1N5TA 2OPPB 2D8CA 1GLCG 3THPA 2W9BA 7ICSA 3ZXWA 3OVBA 4Y2KA 2DEIA 1Y3KA 5KG2A 3RGIA 5HMLA 2ZZNA 3H8WA 2RQ5A 2ZQBA 2VH7A 5CD4A 3LYSA 1C4AA 4YMEA 2K3KA 4M5DA 4DV0F 1CLFA 3HF5A 4ECXA 8ICGA 2IA6A 3PACA 3RUBL 3ZDDA 2D5RA 2XCAA 2OTJS 4CEAA 3L09A 1DQ9A 2C2ZB 3QJJA 2DB1A 2LQ9A 1TAQA 5I3UA 5KG4A 4L3KA 2E1MC 4ZVTB 5EUHA 4EBDA 1SPBP 4BRCA 4CJFA 2VOPA 3FCWA 2KHVA 3OW2M 1HEKA 1D5AA 5AM1A 4YQWA 1FD8A 3O9UA 2D9OA 4ES3A 2WTFA 3HX9A 1TL7A 1Y11A 2E5JA 2PE8A 3OJUA 1S6UA 4NXNF 3MMBB 4EWTA 4OX9F 2MKKA 5AKLA 3LVVA 2BKNA 2W54A 1IJFB 4NL9C 4X66F 3R2CJ 3H1QA 1QZ5A 4WP8A 4JKDA 5AK6A 3KHHA 1FJ7A 3NF9A 3QATA 4ED5A 4DPYA 3C28A 4H4OB 1HUZA 5IILA 2BHNA 1ZQNA 1R6VA 3QUCA 2J8AA 1XI1A 1CJUA 4UT4A 2UXDK 1PUZA 1KR4A 4ZCIA 4P2HA 2KP7A 2BZ2A 2VFVA 2VZ9A 2E2PA 2WB4A 1U1PA 4KH0B 3TABA 3LQVA 5H9EK 1A7GE 3DCAA 2W1BA 4CJWA 3H8YA 3CDAA 4M5GA 1X66A 2MKHA 1NNEA 4ED4A 1VQPS 3KWMA 1RWNB 3A0IX 7ICNA 4QW8A 1R8CA 4O3QA 3ICXA 4KIAA 3LF0A 1RCOB 2K2PA 2XSJB 5HQLA 4IZ9A 1DLOB 1OUQA 2P9PB 3R97A 1AB8A 5FDLA 3P96A 3AVCA 3CJ7A 3DYAA 1SH2A 2F96A 1VLBA 2NXJA 4WQ4C 3QUQA 4CF3A 4MKYA 3G86A 1P8GA 3ZD9A 1XMBA 8ICAA 2HFZA 4ISFA 3RR7A 4IRDA 2ZHOA 4GNIA 3K1ZA 3CYMA 5C42A 3NNAA 5KT6A 1DHMA 1DQ8A 2HLTA 1FRXA 1RILA 1W97L 2ZD1A 4CZLA 3Q24A 1DT9A 1H2UX 3ZSRA 2E1EA 1VRTB 3H8JA 1C1BA 4B1ZA 3NBPB 4DR4J 2BZFA 2QFJA 3ZO7A 4B3TJ 3KNGA 1HYZA 2G06A 5BPNA 3H0LB 4M3WA 1MDUB 2DCLA 2QO3A 1HNZK 9ICNA 1WCNA 1TMMA 2Q79A 4DF4A 4DZ6A 1VRUB 3QIPB 1RGIA 2UVVA 1VSKA 1KW4A 4KLIA 4B6JA 2OELA 1X8DA 2R8GA 1VQNS 3R9LA 4PG6A 3CJKB 5L9XA 5IT9U 5IQ6A 5AHXA 2KYXA 4UB1A 4MFAA 2E1FA 3CW2C 3BN7A 2GX9A 2DUYA 3NVWA 3PW2A 2FGOA 3EE9A 4RPZA 4NMLA 1F9HA 3CJBA 2G07A 2XWYA 4OJPA 1TVAA 1SXDA 3HHLD 5AI9A 5GINA 5KL1B 9ICHA 3PV8A 4K8ZA 4ALZA 3LWLA 3VTHA 5AZIB 4CZJA 1A5VA 3S6JA 2PA3A 3FC4A 2Z8QA 4C9DA 1CZ9A 4CGGA 2JGAA 3P5TL 4RKUC 1SV0C 3CCJS 5JMVA 4DQSA 4OZNA 3VAGA 2K4EA 5M1PA 4DL0C 1T03B 4PWWA 7ICKA 5AKKA 4ZH4A 5B5EU 4FWLA 3WK4A 4DR3K 2MZJA 3G6VA 2YHYA 4FLXA 4PGQA 4JBCA 2BRKA 3GE1A 2QKQA 2A41A 5J2HA 3PYEA 1P9YA 2BDPA 4F0MA 3TOQA 5AXMA 2N7CA 1JLAB 2LQ5A 2Q3SA 3CP8A 2RLTA 1ILYA 2GO7A 3C14B 3B4MA 1PK1A 4AL7A 1Z05A 1WHXA 5FDLB 2BJ3A 4RW8B 2L9DA 3C6AA 4DFMA 4LR8A 5TISU 4B1WB 3LZJA 4JV0A 3KHYA 3EGZA 4P0QB 1FKOB 4IL6U 2ZUGA 1FDBA 2W40A 1JXEA 4MIWA 4DSKA 5AM3A 2E1PA 4AHVA 4JKBA 3RMBA 3AARA 3H08A 2ZTCA 2RJZA 1J5OB 2KG5A 3Q8QB 3JAMY 5A8RB 2IM1A 1S9FA 5J8YC 4X66K 3MECB 3SFGA 4X64J 5M1QA 3PO4A 2F7VA 1BDGA 1Q53A 2VQEJ 4FCYA