1L3SA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*G)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3sA01
2FLPA 1T03A 4PGYA 1NJYA 4GC7A 4ED3A 3CYMA 2QKBA 1HPZA 4M3RA 4Q5VA 1FK9A 3PV8A 3SUQA 5KTQA 3TR8A 4RU9A 2W9AA 3JPSA 1XC9A 3PY8A 1MSWD 4RW4A 3JPNA 5L1KA 3QEXA 3I0SA 2O4GA 4FW1A 3M8SA 1XO1A 2KN7A 2W8LA 4FS2A 4KLEA 2XY5A 4EYHB 4UQGA 3PX6A 4KV8A 3RJFA 3TAQA 2P5GA 3AVBA 3BQ1A 1KSPA 4LSLA 4IKFA 5DBAA 4QZAA 3SQ0A 3MECA 3H8WA 3ULDA 2BQRA 5J29A 4AH9A 1HQUA 4DSEA 3LWMA 3TAFA 2KFNA 3SCXA 4KTZA 3OYMA 4ED7A 4CGDA 1RPLA 9ICLA 3GV7B 4CF2A 5J2QA 5EWFA 8ICTA 4IBNA 5FROA 1VSFA 4H4MA 3ZSVA 4G1QA 3WNHA 5J0RA 2BHNA 8ICKA 4O4GA 4PQUA 3QETA 3K59A 1T8EA 3RAXA 2BCRA 2PI4A 4DSLA 4EEYA 9ICMA 4J2BA 3ZCMA 3S3MA 4FW2A 5C42A 2KZMA 3RR7A 4M42A 1ZQKA 3B0YA 1VSMA 3NE6A 1IM4A 1X9MA 3UQ0A 3MXJA 4CGFA 2XO7A 3ASMA 2P66A 3AVAA 3OYIA 5KFBA 1CEZA 4MFCA 8ICLA 1TFRA 4M3YA 1K6YA 1DLOA 1U49A 3HWTA 2ZQBA 4DFKA 1G15A 4DSKA 3PMNA 1U04A 3C2KA 2MUTB 1SKSA 4EBEA 1RTDA 4PWDA 4KMUA 1C0UA 5HRSA 1I3AA 3GV5B 1Y88A 5KFNA 4FJIA 8ICFA 1BQNA 2MUTA 3NGIA 2P6UA 5KG7A 5J2JA 4CGJA 1LAWA 1L3VA 3L3UA 1WAJA 2HNDA 3MEEA 1TK5A 1NK9A 3V6DA 1R0AA 4DEZA 4M9HA 3AO4A 1YTAA 2BE2A 2B21A 4Y1DA 3L8BA 1ZQUA 1LAVA 1S9FA 1A77A 1RT5A 4I7FA 4RPZA 1QTMA 4NXZA 4J9QA 1BIZA 4K8ZA 3AA3A 5DMRA 4FLZA 5L1JA 1EX4A 4I2DA 3KHRA 3LAMA 5DLGA 3KD1E 3V7KA 1LW2A 4DQQA 1C1BA 5C25A 2D0BA 3MXMA 5J2AA 1SL1A 2KFZA 3O4QA 1X1PA 5KFOA 1MU2A 4W5QA 4MFFA 4QWCA 3OYLA 3ZT0A 3VA3A 3AA4A 4H8KA 1TGOA 3ZT1A 4KO0A 4JWNA 8ICVA 1T05A 2HHWA 3LPUA 4IRCA 4Z4HA 5J2PA 3DI6A 1CXQA 4LH5A 4DOAA 4RG8A 3OS0A 2F8SA 1O1WA 3T5HA 2HVIA 4C8OA 1S1UA 1JL2A 4PY5A 5J2MA 2H5XA 4M9GA 2G8UA 5DG9A 3UPQA 4KLJA 1SL0A 3NGDA 4CJ3A 4GC6A 1QS4A 4NYNA 2HW3A 2DFHA 2W8KA 3Q8QB 2Z1IA 3HP6A 1XHZA 3M8RA 1K1SA 4NY8A 2ISOA 2VWKA 1RXVA 4DO9A 3ITHA 3V9XA 1HJPA 2D5RA 1RYRA 3DLHA 4CJRA 4I2BA 2FC0A 4NCAA 3O3FA 4FYDA 4CFDA 4DTRA 2C2DA 2G8HA 5KFAA 4E0DA 2PXIA 1D9DA 4QWBA 3JSMA 1REVA 3MR3A 4N56A 5EWGA 3C1ZA 3RRHA 4P4MA 4O9MA 1IKYA 4EP5A 3SI6A 3ISNC 4KLLA 4IFVA 4NLGA 1JLAA 3CQ8A 5HNKA 2HB5A 4L8RB 4FJGA 3QLHA 3VN5A 3BQ0A 3VQEA 1MQ3A 4YD1A 2BCVA 5KRSA 2BANA 4CK3A 4YNQA 2D0AA 5IILA 3EPIA 3QIPA 1SZPA 2AJQA 4DMNA 4NM1A 3MR2A 2OPSA 2WONA 4CGIA 4BDPA 4YR0A 4P2HA 2R8GA 4RW9A 2A1JB 4F4WA 3B6PA 1TAUA 4DQIA 1GOBA 4B9UA 3DLKA 4OVLA 3AVNA 2G8WA 3CFPA 2NRWA 7ICUA 5E41A 2F96A 2A1JA 3V7JA 3DLEA 4M45A 1ZQDA 4CEOA 2X6NA 2IC3A 3MEGA 2XY7A 1IXRA 4PHEA 4K4HA 9ICXA 3KLEA 5L1LA 4NLZA 2BQ3A 4QWDA 2ATQA 4FLTA 4CF9A 2ASDA 3E2EA 3GIIA 1BPZA 1ASVA 1NJWA 3IM1A 1EXNA 3DLRA 4M2YA 3HL8A 3RB0A 3CFRA 1SL2A 2BCSA 1NOMA 3HJFA 1KFDA 3GIJA 9ICFA 3DYAA 5KFKA 3NTUA 9ICEA 5KFMA 4DG1A 2PFNA 1LV5A 4O3QA 4TSXA 4GXIA 2VA2A 4YMNA 3NFAA 3JPOA 4CEBA 4RW7A 3L2QA 3IHQB 5HP1A 3U3YA 2AU0A 8ICBA 3VQQA 4B8CA 4CEAA 8ICXA 4DFJA 2JEJA 3QEIA 1NJXA 1Q9YA 2LSNA 2J6SA 4E3SA 1WSEA 1QHTA 3NF9A 2I1QA 2LYHA 4KAZA 1KFSA 1NOZA 4QZ9A 1BCMA 4B9SA 1RT4A 4R5PA 1BPDA 5CYQA 4ECSA 4CJVA 2RDIA 3LZJA 3Q8LA 4BXOB 3P1GA 5IIJA 3RAQA 1ZQMA 5KFVA 4E7IA 5DBCA 5EWEA 4OLBA 3H4BA 1D8YA 4EBDA 1CLQA 2JEIA 5FRMA 1RBRA 4BXOA 4I9QA 3NF6A 4F50A 3OJSA 1U47A 3VQ4A 4E7LA 1VRUA 3PVXA 3H4DA 3K5OA 1TKDA 1NOYA 1T7PA 2V4RA 2P1JA 4RQ7A 3QO9A 4O3PA 4CF0A 1J5OA 4CEFA 3C2LA 1EP4A 1QSLA 1UT5A 4CERA 3HO1A 2DTUA 4UAWA 3VQPA 2ZUDA 3BDPA 1BI4B 2NRZA 3M9NB 2BQUA 1WSHA 3LP1A 5J2IA 3K5LA 3MBYA 3G0ZA 4OKKA 4DL7A 5KFDA 5DDYA 1A5XA 8ICQA 2FPMA 2Z1HA 5J0YA 5KT7A 3ZT3A 1NK0A 1ZYQA 4JLHA 1D8LA 3DRSA 4WE1A 3KHHA 4ED0A 1QSSA 2FLLA 4RQ8A 4O44A 2X74A 3KHLA 1RZTA 5DK5A 5CP2A 4QZEA 2BR0A 1BISA 3AVGA 3H08A 7ICMA 1RT3A 1JXEA 4KLQA 4FVMA 4Q44A 4ECQA 4CJWA 1ZQRA 5IIOA 5J2GA 2R8HA 1VSDA 2XCPA 3V9SA 5HMLA 3OVNA 4CJEA 3V81A 5D3GA 1LW0A 4XUSA 4RQ4A 4PGXA 3Q8MA 1TV9A 2GV9A 1NK7A 3M8QA 2PFQA 1B43A 3OYBA 1HUOA 2OYQA 1BVSA 1VSIA 3MR5A 3ZSOA 3EY1A 3HP9A 3OYJA 2YNIA 1WNSA 4CEZA 9ICUA 1BL3A 1ZQSA 3QZ8A 4OKJA 4ZHRA 5KFTA 5C5JA 4DTUA 1LWCA 4O3OA 3ZDEA 8ICCA 3DMJA 3RMAA 4YN4A 5KFRA 2Z1GA 3RB3A 3OYHA 5CA7A 2J6TA 8ICAA 4AHCA 3HYFA 4LZDA 3V9WA 8ICRA 8ICUA 2XGQA 9ICPA 2KZ3A 1ITGA 1KDHA 1BPXA 4B3OA 2Q3SA 4UB4A 4I2GA 1RT6A 2I9GA 1HJRA 1XSLA 4KLIA 1BHLA 2BDPA 1X2IA 4FBUA 8ICWA 2IHMA 4P4PA 4GXKA 3NGYA 3QEVA 4F3OA 2UVUA 2FBXA 4KB0A 3L3VA 2RDJA 3K4GA 2YHAA 1QLNA 4LSNA 2PZSA 4R8UB 1S0MA 4M9JA 1BQMA 4Q0BA 4KRFA 4CEDA 4HUGA 2WTFA 4F8RA 4DF4A 3QINA 3LANA 2OA8A 4KLTA 4F5RA 2ALZA 4YD2A 4R8UA 5KG5A 5JUMA 1VSKA 5TZVA 4W5TA 2JZBB 2Y1IA 1RBUA 4Q8FA 4KN7A 2FPLA 3ISDA 2AGOA 3PW4A 4W5OA 3ZSRA 4YVZA 5KFEA 4O3RA 2OZSA 4LZGA 7ICSA 1NKBA 3V4IA 3NDKA 3UIQA 4TQSA 5HLFA 4FM2A 3AO2A 1MC8A 2JZBA 3KJVA 3LAKA 5EU7A 2ZJAA 1DTTA 4KHYA 4RQ0A 1ZQEA 4Q43A 3NBPA 3PR5B 3QNOA 4RQ2A 1WCLA 1KLMA 9ICRA 4TQRA 2HHQA 3BGRA 9ICJA 4B8AB 2XC9A 1BIUA 1W9HA 2BCUA 4O55A 3MEDA 1S6QA 3OS1A 3G6YA 4BDYA 8ICMA 1PZNA 3MABA 1X9SA 5DKWA 1ZQQA 1TK0A 5KGWA 2QKKA 3OHAA 1S0NA 4FLVA 3B0XA 1NK5A 5J0TA 3TQ1A 4DSIA 4E89A 4QZHA 3CFOA 1IH7A 4RQ3A 5DLFA 4PH5A 4QW9A 4YFKA 2QK9A 8ICOA 8ICYA 4KLOA 7ICGA 1YVUA 1ZBUA 4DU1A 4EZ6A 4Z4GA 4TUPA 5KRTA 3M9MB 2ZTDA 1ZQAA 3LDAA 4PHDA 4I28A 3V6KA 1FKPA 4M0AA 5I42A 3EWAA 2HHVA 9ICOA 5KG3A 3RRGA 3KTQA 3PX0A 1DTQA 1LWFA 4AHVA 4J9LA 4HTUA 3SV4A 4ZH4A 2W9MA 2IAJA 3C23A 5DQIA 4NM2A 7ICLA 3AO1A 4IG0A 4CJLA 1B9DA 4O3SA 1JLFA 2FBYA 3DM2A 4O5BA 3V1QA 3TFSA 1RTJA 4F2RA 3HVTA 3UXOA 7ICFA 4DQPA 5SWMA 1UOCA 5KG2A 4MF2A 4F2SA 4BGDA 3ZSZA 4JV1A 4GW6A 5DB6A 4J9SA 3DLGA 1S1VA 2V4QA 3KLHA 3SYZA 3K5NA 1S9EA 3ORYA 3I8DA 5BPCA 1UT8A 4CFAA 2P51A 5DGBA 1ZETA 2VG6A 2DPJA 2I5JA 3OYFA 4DL6A 1ZBLA 4CIFA 2ASLA 3KK2A 4ECRA 3RR8A 1RYSA 1S1XA 2W9BB 4CJ4A 1QQCA 5KFSA 3KHGA 1S0VA 3K57A 5DG8A 3GIMA 3KLFA 1SV5A 3ALYA 2ZUBA 3V1RA 3PO5A 4W5RA 1B9FA 4M3TA 4I2FA 4CJFA 4F4ZA 2W9BA 3WNFA 2IMWP 1XS9D 5J2KA 4ICLA 2PY5A 1ZQHA 1A5VA 3NH1A 5KFFA 4RUCA 5KFQA 4KITB 9ICAA 4BACA 4JRQA 4OKEA 4RT3A 2XY6A 1C6VA 4OPJA 4QWAA 2Q0ZX 4W5NA 4YG2A 4YMOA 5DQHA 3SQ2A 3DRPA 3MDAA 2ZJ8A 3AA2A 1C1CA 4JWMA 3HPHA 2HHTA 4FJNA 1MQ2A 4Z6DA 4CGHA 1JKHA 2PFPA 4DS4A 4ZTJA 2B5JA 3ZD8A 4RQ6A 8ICIA 5J2BA 3RJJA 4ECVA 4FJJA 2IS3A 1ZQLA 2JEFA 2R8JA 4I2PA 1LWEA 2RKIA 3UXNA 3TARA 4AHUA 2BPCA 2V9WA 4ECTA 3C95A 4IQWA 5J0XA 3QE9Y 3RMDA 7ICRA 3KKRA 1LB2B 1J9AA 4CIGA 5D4BA 5KI6A 4DQRA 3V72A 3A2FA 1T4GA 3SUOA 2AGQA 4FLXA 1C1AA 5J2HA 4J9MA 1C0TA 4O5EA 4FM0A 5C24A 1BPEA 4F4XA 1KVCA 4CJQA 4IG3A 2HMIA 3LALA 3QEWA 8ICSA 1RTIA 4JV2A 1N6QA 4J2EA 4G3IA 2DFFA 1S10A 3C5GA 1NKCA 1WLJA 1BPBA 4QZDA 3VQ8A 2AQ0A 4DSJA 2JGUA 3SV3A 2R8KA 4P4OA 3LDSA 1TL1A 1S97A 3GV8B 3OS2A 5HBMA 4CF1A 4ED8A 3DLBA 5DDMA 1ZQWA 3K5MA 2JLEA 3CG7A 4HCCA 1TV6A 4NCBA 8ICJA 4KKOA 4OGEA 1ASWA 3GQCA 4YP3A 4I2IA 7ICQA 4CHPA 3I0RA 1U48A 1NK6A 4KHQA 2FMQA 1BCOA 1ZQNA 1HYVA 4QAGA 2F8TA 1C0MA 4ID5A 5HRPA 4DTJA 2IGIA 3GIKA 3VQCA 3QERA 4E7KA 1WSFA 2ZTEA 4F4KA 4N47A 3KLIA 2VG7A 3VQ6A 5K14A 3SUNA 5CZ1A 2BGWA 5D46A 4ECYA 4CESA 1XI1A 4UB5A 1XHXA 2W42A 4I29A 2AGPA 1TK8A 4KLUA 4JS4A 5J2FA 1S77D 2M9NA 1HYSA 2IA6A 4JRPA 2DY4A 5CZ2A 7ICVA 4FM1A 1JIHA 4UB3A 2NUBA 4FK4A 4FJLA 3K58A 5FRNA 3PR4A 9ICVA 4O0IA 1ZQPA 4KLSA 4DOBA 1U45A 3TABA 5KFHA 3RMCA 1UWBA 8ICHA 4ED6A 2RPIA 4FJXA 2F1HA 4AILC 4FBTA 4PA1A 4FZYA 3VQ7A 4RNOA 4QOZB 3ZDAA 4KHSA 3NGZA 9ICBA 1D9FA 1I39A 1YTUA 1RILA 3N4MB 3KK1A 5BOLA 3PNCA 1KVAA 4PHPA 3EPGA 2AQ4A 4ECZA 5KG0A 3T19A 5J2NA 4IQUA 5IINA 3RJIA 3PX4A 4R63A 3ZDDA 3PO4A 4Q8EA 2ETJA 4KPYA 3T5JA 2IHNA 4KLFA 3MGHA 1XWLA 4UBBA 5KFLA 4CGGA 4KLDA 4BE1A 2J6UA 4FS1A 2X78A 4CJKA 3F73A 3RMBA 3AVFA 4FJ7A 4Q45A 3JYTA 9ICHA 5HHHA 4AHTA 4M41A 4UAZA 3TWHA 2OPPA 5KFXA 4MQ3A 4FZZA 3HK2A 4RQ1A 3EW9A 4UBCA 4ED2A 4EBCA 2WOMA 1WSIA 2G8KA 3TAEA 4B9VA 3RTVA 2B4JA 4CK2A 5J0PA 3HM9A 4B9TA 3ZDCA 4IQVA 4YR2A 1S76D 1CZBA 1BI4A 2DPIA 1UA0A 1Z3EB 9ICCA 2Z1JA 4B08A 2FBVA 2UVVA 5DQGA 1SUQA 1A76A 4MEXA 1RDDA 1KLNA 2FPKA 4YFUA 3RH5A 3GFKB 4DWIA 3RBEA 3DOLA 3O3HA 9ICIA 3OYDA 4OPKA 3IG1A 1L3UA 4TUQA 2C28A 3H7IA 1IKWA 2G8IA 4RW8A 4BE0A 7ICPA 3AU6A 5CB1A 2JEGA 7ICHA 1JX4A 3MDCA 1NK8A 4GXJA 3THVA 2UVWA 1ZQTA 1JL1A 4M9NA 1S1TA 4C8NA 7ICIA 4KN4A 4IR9A 1DGSA 2YV0X 4E19A 3QZ7A 4F93B 4RPXA 3SPZA 3Q8KA 4M04A 4O5CA 1RBTA 3C5FA 2VG5A 3SQ1A 1Z25A 5J2CA 5KG6A 4HYKA 3FFIA 3UXPA 3S3OA 4YCXA 2ZTCA 3RJKA 1JLEA 4BWMA 5KFGA 1QSYA 1B92A 4PUOA 3JPQA 1N56A 1FXXA 1BGXT 2YKMA 1QE1A 4IRKA 1VSEA 5HRNA 2P6RA 4DSFA 2OPQA 3SUPA 3AU2A 2ZD1A 4FLWA 4ZTFA 5BOMA 3O4NA 4IRDA 3HX0A 3AUOA 4Y1CA 3PW7A 1V9PA 4Z4EA 4X5VA 3GDXA 3OYGA 3QEPA 3T5KA 4QCLA 4I2AA 4YMMA 1JN3A 4RNMA 3H40A 4KREA 4M3WA 4DL5A 2BPFA 5F9LA 4Z0UA 4DL2A 1NJZA 3D0PA 1KEJA 3JPPA 3AA5X 2MAXA 3PMLA 5D49A 4BDZA 1HRHA 2R7YA 4C8KA 1GOCA 2IOCA 4J9PA 4ECWA 3LZIA 5HRRA 5KT2A 4CE9A 3AV9A 3V6HA 2VA3A 3OYEA 3PW0A 9ICGA 2NRTA 3HT3A 5KFJA 2R8IA 5FDLA 2ZE2A 3NAEA 3VA0A 4QZBA 4HCBA 3AVMA 1SKWA 4AHSA 1FKOA 3Q8RB 1JLCA 1N5YA 4RUAA 4F5QA 3LK9A 1RNHA 3QESA 3P5JA 5J2EA 1ZQBA 4F5NA 3ETLA 3HXMA 9ICSA 4N76A 3TAMA 3NF7A 3VQBA 4ID1A 5J0QA 4KTWA 3C1YA 1ZQIA 1ZBHA 1XSNA 4ELUA 5J0OA 1RDBA 4FCYA 3EZ5A 3K75D 1RTHA 3DOKA 4Z4CA 1VSJA 2NRXA 4DTPA 4UAYA 5DG7A 4KB1A 3LPTA 1ASUA 3AVIA 2BGGA 3E01A 2ZJ5A 2YKNA 5CHGA 2PI5A 4DS5A 5CJ7A 2HVHA 1L5UA 3LWLA 1ZQJA 3AVKA 1JXBA 2KTQA 4I2HA 3HW8A 3ZSYA 3QNNA 4HUEA 1ZBFA 1TVRA 4FJHA 5DBBA 4QW8A 4K4GA 1TL3A 3UQ2A 3C94A 5KFIA 8ICZA 3RH4A 3ZSXA 4CJSA 4IR1A 2BPGA 4CHYA 7ICEA 3H8JA 1J54A 2DFEA 2X6SA 4J2DA 3RWUA 3G6XA 4I2QA 3RH6A 1COOA 5JS2A 4HVJA 1HMVA 4M3ZA 3ZDBA 5SZTA 4YR3A 1SKRA 1S1WA 4TUSA 3WNEA 7ICKA 4CCHA 4FLYA 2E4LA 2FMSA 4CECA 1AROP 4RT2A 5KGXA 2YNHA 3AVJA 1S9GA 4F5OA 3TI0A 3G6VA 5J2DA 2BCQA 3P83D 3OGUA 4EYIB 1JLGA 4J2AA 4OJRA 4KI4A 4KHNA 5JS1A 5IIKA 4K4IA 2PFOA 1H38A 4ELTA 3VQDA 4KLGA 9ICKA 1J53A 3ISCA 5CYMA 3JPTA 4I9LA 5CY4A 2C22A 4OGCA 3MGIA 5J1EA 5L1IA 4FJ5A 4TURA 4PGQA 4F5PA 3Q8PB 3BJYA 9ICQA 4CJTA 4E1MA 3AO5A 3LP3A 4C8MA 2FBTA 3HPGA 4EP4A 3V9ZA 4M9LA 4CFCA 3KLGA 1DOQA 3CM6A 4DLEA 4NYFA 4Z4IA 1C7YA 7ICTA 4F92B 4DOCA 5CWRA 3VQ5A 4F91B 1ZQOA 3B6OA 4CHOA 5F9NA 4M3UA 4O3NA 4B9MA 1TKZA 2D0CA 4XRHA 3MFIA 5HP4A 8ICNA 4LH4A 5KFUA 4O0JA 3HVRA 3U3GA 4FLUA 5I3UA 4O5KA 2VANA 3D45A 9ICTA 5J0UA 1RDAA 4J9RA 4CIEA 2HHSA 8ICEA 2EHGA 2HHUA 3OYNA 2KQ2A 2HNYA 5DGAA 3LP2A 2EX3A 3O3GA 4CEQA 1UAXA 1NKEA 2YNFA 3F9KA 5DB8A 1JMSA 4PHAA 3V7LA 4J9OA 4H4OA 4N5SA 2XY8A 3SPYA 4M3XA 2ASJA 2XHBA 4ELVA 3OYCA 4HHTA 1IO2A 4N41A 3M9OB 3NH2A 3OYKA 2HNZA 4HUFA 4IQTA 3AVLA 3HSTB 4F3TA 1KVBA 3NCIA 4QZIA 1TKTA 1ZQGA 2RN2A 3RBDA 3SJJA 1L3TA 4KFBA 3M8PA 3RJHA 3OJUA 4KLHA 1XSPA 1ZQZA 2KW4A 2VA8A 3OYAA 3U6FA 4RQ5A 4DU3A 4FJ9A 3DRRA 1UA1A 1JXLA 5HROA 2HHXA 4BE2A 1Q9XA 1BPYA 1KRPA 1HNVA 4PPXA 1WCNA 4I2JA 5CR0A 3TFRA 2YHBA 4CHZA 4KHWA 4CF8A 2O4IA 3H8SA 3HPOA 3SI8A 4R64A 4KI6A 1RBVA 4E7HA 3MFHA 1CZ9A 1WN7A 9ICWA 3FDSA 2G8VA 4NCGA 4IDKA 2VWJA 1ZQVA 4FJMA 2BKEA 2G8FA 5KFYA 4MF8A 2DFLA 2GBZA 3NF8A 4B9LA 1EETA 3T3FA 1JLQA 1X9WA 5KG4A 5KT4A 4YXMA 1CUKA 5KFPA 3T5LA 3ZSWA 2P5OA 2F1IA 4CJPA 3ZSQA 3QEAZ 1TAQA 3KD5E 4F4YA 8ICGA 4DTMA 1RT2A 4OLAA 5KFCA 2FLNA 4LY7A 4MEYA 5KT5A 3RB4A 2IBKA 1EXQA 1VRTA 5KFWA 1IKVA 3L2UA 3TANA 2PYJA 4GMJB 7ICOA 3VQAA 1K1QA 4J9KA 2W9CB 4GLXA 1RBSA 5KT3A 4RW6A 3SQ4A 3JPRA 7ICNA 5IIMA 4YQWA 3OSNA 4CJ5A 5KG1A 4Z6CA 3QEBZ 1WSGA 3ISBA 4R65A 4Z4FA 2W9CA 2GUIA 3KKSA 3S9HA 4RNNA 2ISPA 3EYZA 4I2EA 8ICPA 4QZ8A 1U4BA 1WAFA 3PW2A 3TAPA 3AVHA 4CFBA 1KCFA 1S6PA 9ICNA 2YNGA 4E7JA 3L2RA 4FJ8A 3FYHA 3OSPA 3AO3A 4JV0A 2ITGA 4RZRA 4GVMA 1HNIA 4NLNA 2KZZA 3MAQA 5L9XA 3AVCA 1VK0A 4LVSA 3C6UA 4BWJA 5T7BA 4I27A 2QXFA 4DTSA 2A1RA 3NH0A 1D5AA 1W0HA 4KTQA 4DF8A 1KFTA 4CHNA 4C8LA 4CJUA 3C2MA 4K8XA 3IAYA 4Z6FA 4FJKA 1Y97A 3MXIA 2OPRA 3ZT2A 4DFMA 4JS5A 4Z6EA 1Z00B 2XGPA 3L2WA 4MFBA 2OZMA 2E6LA 3G10A 4YXJA 4E1NA 4DTXA 3PW5A 2ZUCA 2NRVA 1S5JA 4FK2A 3BQ2A 1RXWA 1U9LA 3OY9A 4DL3A 3Q8SB 4CK1A 4XA5A 3K2PA 3OHBA 5J0WA 1Z00A 1ZQYA 1ZQCA 2B6AA 4J9NA 3QIOA 2ATLA 4FO6A 4EZ9A 5KFZA 3V1OA 3WNGA 5J0SA 5DB9A 3VQ9A 4JK1A 1GOAA 1TKXA 4QZCA 3SZ2A 4AHRA 1HUZA 1L3SA 4M6WB 4CEEA 3T1AA 7ICJA 2IDOA 1B22A 4FK0A 1RDCA 4DTOA 3ZT4A 1NK4A 2RF2A 4R66A 2GWSA 1XU4A 1CXUA 4CHQA 3ZD9A 4QZFA 1JLBA 4M6WA 3KIOA 1ZQFA 1Z26A 4ECUA 2C2EA 5HHIA 3NHGA 1HQEA 4MFAA 1F21A 3N97B 1ZJMA 1IG9A 5IIIA 4QZGA 5EOZA 2XCAA 3CM5A 4JUZA 3MR6A 1KTQA 4ECXA 1EKEA 4FZXC 1WSJA 4B9NA 5HMMA 5KT6A 2Y1JA 3C21A 2XRIA 3IRXA 3V9UA 3BQTA 1S0OA 3TAGA 1Q8IA 4DQSA 1RT1A 4ED1A 1A5WA 3RB6A 1VSHA 2UVRA 4UB1A 4XIUA 3LP0A 2FMPA 2OWOA 1ZBIA 3L2VA 2F1JA 2A1SA 4M47A 4KLMA 3RJGA 5DB7A 4DL4A 4FXDA 3SNNA 3V6JA 3PUFA 3GILA 1IKXA 1T3NA 1RCHA 1TVAA 3C6TA 1VSLA 1ZQXA 4RPYA 1HYZA 2E6MA 4NLKA 3KK3A 4I2CA 1RT7A 3S3NA 3RJEA 4DFPA 1YT3A 4KHUA 4DTNA 1ZJNA 4DU4A 4QWEA 4IFYA 2C2RA 4LD0A 4UB2A 2PYLA 3IS9A 4XQ8A 4DLGA 1N48A
chains in the Genus database with same CATH superfamily
2FJ6A 1IR0A 2GQQA 3PRVA 3P49B 4AFFA 1UJ4A 5KTQA 3TR8A 1NGFA 1RBOB 3JPSA 2BZ2A 5GADP 4ID8A 5IT9O 2F44A 4LSLB 4FW1A 3M8SA 1B4SA 2EFNA 3TVYA 2VWBA 2HQGA 2UXBJ 5G5GA 1U02A 4EYHB 3FEYB 4FWLA 3RJFA 1VFJA 2V2VA 5JTIA 3W8GA 2CWXA 2F8HA 2NLWA 2CPZA 5DBAA 4H0VB 3LDPA 3EDRB 1FTCA 3J7AP 4EUVA 3H8WA 3TYTA 1VQ6S 5EY4A 2P9GA 3WHIA 1Z2ZA 2XMUA 3M6VA 3NCQA 4H4MB 5AI4A 3TAFA 2OFHX 2KEYA 2D8CA 5ITHA 2KFNA 2BUNA 4KTZA 3OYMA 3TUPA 2OTJN 4YOWA 3MPDA 3ULHA 4UATA 2GX9A 4CLFA 3R2CJ 4CNYA 2G5HB 5EWFA 2E8PA 1SB6A 5FROA 1F44A 1ZM2A 4BRIA 1E4GT 2H3IA 4LFAJ 5K8MA 5J0RA 3R6GB 3QETA 2P9IB 4X65J 4O5FA 1ESVA 2PMZC 2BCRA 4Y0FA 3H5YA 2PFUA 2DNZA 1FRIA 4FW2A 2A41A 1ZQKA 2E3TA 3B0YA 2EK1A 3UQ0A 2AP1A 5BR8F 1RI7A 3ASMA 2QWOA 1U6ZA 2QSWA 3SR6A 8ICLA 2E44A 1J2MA 1DLOA 1U49A 2HGNA 1N32J 3WQTA 1GXLA 4F7VA 3BUZB 4DFKA 2K8BB 2DO0A 2MZ1A 4DQ8A 3WC0A 2E9RX 4KX3A 1SKSA 2Q0RA 3H98A 5DETA 1C0UA 3MEEB 5HRSA 2PE8A 3V6DB 1R0AB 3GG0A 1XQSC 5AXKA 2XTJP 3B8AX 2GCFA 3TJAA 5G0RB 5J2JA 2DGVA 3DLGB 1HD1A 3A5LC 3C6HA 3L3UA 4Z7YA 1PBUA 4GVBB 3D6FB 4WCEQ 4DEZA 1X5OA 1FD2A 4PEOA 4ETXA 3EMTA 1Y00A 1ZQUA 4MIWA 2P9NA 2BJDA 1HR0K 3I55N 4I7FA 1S12A 4RPZA 4NXZA 2GO8A 2XYPB 3F2CA 4HHJA 2GIFA 2KXFA 4YOYA 1EX4A 5EHHA 2DXEA 3EZUA 1RABB 3X3UA 3PIPQ 3NCRA 2KHQA 4RNHA 1XNSA 1T05B 4USKA 2MHNA 3KMSA 3VEYA 1C1BA 5C25A 3O9SA 3MXMA 2QKQA 2E5JA 4U7UD 1MU2A 4W5QA 3OYLA 3EE3A 5J2MB 1VQ8N 4KBIA 3C14B 3RF9A 4Z4HA 5J2PA 1DFDA 4G1PA 3RBXA 4LH5A 4DOAA 1OQ3A 1Q3UA 1W7AA 2RMLA 2A1AA 1O1WA 4P2XA 1S1UA 2CDRB 4PY5A 3TU5A 5HR7A 3UPQA 3P96A 3NGDA 2V8HA 2QL5B 3FGVA 3FJ2A 1ATNA 3FCVA 1K1SA 1M1KT 3M4XA 2VWKA 3R1LA 4DO9A 3ITHA 1H0HB 4GV3A 4RWTA 2NS1B 2VH7A 3KVGA 4PG4A 2F8MA 4NCAA 3O3FA 1ELOA 4UOHA 2G8HA 4OZNA 3CF5L 1D9DA 3I56N 2IVOA 2L9NA 5EWGA 5DDRC 3QLHB 2RAQA 2H51B 4IDHA 2LLZA 1ZTWA 5K8NA 1WHWA 4IFVA 4NLGA 3BS9A 5HNKA 2R7SA 3CC4S 1HW8A 2W4DA 2IVFB 4HAIA 2FHMA 4YD1A 2DK2A 5C2FA 5KRSA 4ZVQB 5HAOA 4CK3A 3QQCD 2D0AA 2V9KA 3TEGA 2OD6A 4CGIA 4BDPA 2R8GA 1SZHA 1SCJB 1AUSL 4HHHA 4LBIA 2AEMA 4RW9A 2BE7D 4M63A 4F4WA 3DLEB 4B3RK 5EOYA 3B6PA 2IDLA 3UN3A 1RWUA 2G8WA 2RHFA 3OL8A 2NREA 4NOHA 3NCPA 1PVRA 3NMAA 5E41A 4JI5K 2PSZA 1BO5O 2ZEJA 2Y8WA 1BWVA 2PT0A 3H7HB 4URQU 1YRUA 1Z05A 2IC3A 3MEGA 4ES3A 2E8OA 2E9ZA 1EQ0A 4K4HA 2EAPA 2WRMA 1UEVA 2PO4A 5L1LA 5IOLA 4FKYA 2MQQA 4ZPVR 4URSA 2ATQA 3W64A 3GYGA 5IT0A 2DNQA 4Y0WA 1BPZA 4DR5K 3UKRB 2HBJA 3DYAB 3VPZA 4OX7A 4NWIA 5AE2A 1HKAA 2M88A 3JQMA 2VIHA 3GU0A 1KFDA 2QFJA 1CI4A 5KFKA 1GNKA 3UVJB 1RDFA 1VI7A 1HIWA 2Y1LB 2PFNA 3MTKA 1LV5A 2ZNZA 4YMNA 3NFAA 1YKWA 3U3YA 1HA1A 1UEKA 3C6AA 1NPPA 1QJHA 3B4MA 4JI0F 2WW4A 3DRXA 2LSNA 2E1FA 2WTUA 4E3SA 3U7JA 2DHXA 2V2ZA 1RT4A 3BREA 1BPDA 1U6BA 5CYQA 3I5AA 1PC4A 3VCBA 4ECSA 1RZMA 2RDIA 3JSYA 1U0HB 3JAMU 2F65A 2LU2A 3P1GA 5IIJA 3HRDD 4IOBA 4LRAA 5DBCA 1RQLA 4OLBA 2MHEA 1CLQA 1S57A 4OI6A 4BXOA 4FF4A 1KAXA 4MO5A 1Z4NA 4PYDA 4DKWA 2N7CA 3VQ4A 3KZXA 3CETA 1B64A 3K5OA 1T7PA 4NRUA 4O3PA 4OZ1A 3GWCA 5KPZA 1J5OA 4WWSA 3LP1B 3QWPA 4A61A 1WG5A 2HS3A 2A2DA 4CERA 2Q0UA 5HL7Q 3CC7N 3W0LA 4IO9L 3DC2A 2HI0A 1SXEA 1ZA1B 1SWWA 3FZHA 3DXKB 5JU5A 2ZXIA 2BQUA 1WSHA 1VDVA 4ZN1A 3G0ZA 2MGZB 4O44B 5AQTA 5KFDA 1URJA 2ESEA 1P7DA 3GFZA 1IJJA 3J7A1 1TUUA 8ICQA 2Z1HA 2H48B 2DGZA 5KT7A 5AI5A 2QEXN 3M2VA 4JLHA 1D8LA 1WHVA 2EBGA 3DRSA 4KGMA 1VQ7N 5D3GB 1OH6A 2XZWA 1SJ3P 5BR8K 4IXCA 5KPRA 3D54A 4NLUA 4K4ZA 3ZTOA 2LFVA 4KAIA 1X0FA 4BY9C 1HBUA 4NV0A 4J91A 3SFUA 3OHRA 4FVMA 2Y9HA 1VK8A 4Q44A 1S5LU 5IIOA 3L4QA 4I64A 5BPNA 3OVNA 1S7IA 4PGXA 1Y10A 3BF3A 1PK3A 1NK7A 2B9EA 3M8QA 5C12A 2HPUA 1TYQB 2E7XA 4U8YA 4ZPDA 2YNIA 4OPHA 4ZPBA 2W11A 1DZ5A 3MM9B 1BL3A 3QZ8A 4C1NI 1RQNA 2ROGA 1FJEB 3ZDEA 8ICCA 3DMJA 1HWJA 1NNDA 2Z1GA 3Q83A 4P0PB 2FDRA 4JMUA 2NUUG 2CPHA 2CPXA 1FXLA 3HYFA 1VQYA 1YIJS 2EXUA 3WK4A 4B1UB 3M6XA 9ICPA 1NEEA 2RQCA 3I96A 2YWGA 2E9TA 3VCDA 2IM1A 3WK7A 1UTAA 1ZQ1C 1RT6A 2V8PA 3V2UC 2I9GA 4CF5A 3CCVN 2QXLA 1BHLA 2BDPA 4Q0BB 1Z19A 4WK1A 3T9NA 4P4PA 2W2PP 2XSFA 4A8MP 3NGYA 3QEVA 5AQWA 2UVUA 2RHKA 4BROA 4K42A 2RDJA 4HHUA 3THYA 3F9MA 3Q8UA 2AKWB 3AM9A 1XUPO 4KRFA 3P38A 4C11B 3MMAB 2A40A 4F8RA 4DF4A 4DV5F 3CNQP 5A2QU 2GHVC 2ALZA 2DGOA 2UYTA 4ISFA 4R8UA 5JUMA 5AQSA 5HLFB 5TZVA 2JZBB 3IR5B 1U1LA 4KN7A 2QO3A 3N28A 3CCSN 2LA4A 3RU0A 2ZZMA 3MCNA 3ZSRA 3CCQN 3PDNA 4O3RA 2HDOA 7ICSA 3V4IA 4K4VA 3NDKA 3CCLN 1NNLA 3U9DA 4GKJF 2I2YA 5L46A 4RKUC 1WHYA 2KKPA 4K25A 2J7WA 4IUFA 1U2VB 4AYBD 3NRWA 2MTLA 1OH5A 1XMQF 1S6QB 4Q43A 1F1BB 2F3NA 5ALLA 4RQ2A 1KLMA 2RU9A 1PVPA 2E20A 4WU3A 2HHQA 3DCAA 3FEZA 2ZM6F 4M5DA 4YY3J 1HBMA 3MEDA 3I9ZA 3E9LA 3VVTA 1PZNA 3MABA 1QCKA 1FEEA 2MB0B 1UAWA 1TK0A 2Y0BB 3MN5A 1S3XA 4XAKA 4FZMA 3HVAA 4FLVA 3B0XA 5J0TA 3TQ1A 3LDOA 5AIAA 5BR9A 1XMBA 1TL7B 1UVNA 3CJQA 1RU2A 1LWFB 2QK9A 8ICOA 4PHTX 8ICYA 2H5IB 4RJVA 3KJQB 1YG0A 1NJIT 1TL3B 1S72S 1ZQAA 4ZS6A 3PLAA 3LDAA 3DM2B 1UJ6A 1YHQN 2HHVA 3N4WA 1F9FA 3KTQA 3PX0A 2R7VA 1B0XA 2QGFB 4HTUA 1VBZA 3BSNA 1RA6A 1EKSA 1B3TA 4WBFA 3T1HJ 4O3SA 3V1QA 2BKNA 4HI2A 1RU1A 4KGXB 4YS2A 4F2RA 2A5XA 4XTTA 4BRAA 1IM6A 5H1SV 1WELA 1J5EJ 4MF2A 1E6VB 2UXCF 3CCUS 1T9UA 1X4CA 2W4PA 1FJ7A 4BGDA 4BC3A 3LA0A 3MM5B 3CPEA 1Y64A 1QM9A 2CGKA 4NPOA 1NGHA 1S1VA 1CJVA 4WYWA 1O8BA 3J80O 2ZIUA 3WX8A 1UKUA 4TY9A 4DV4F 5DM7Q 4X4UA 4AM6A 2COLA 2PMHA 3ADAC 5LXRA 2DPJA 4CP5A 4M5GA 2E8AA 3OYFA 4FOEA 1EX8A 2JHEA 3KK2A 3HTVA 2HAIA 3DN9A 4ECRA 4C8YA 1FJCA 1S1XA 5AQGA 5KFSA 4YOTA 1BC6A 5DG8A 4DV0F 3ALYA 3V1RA 2EVZA 3PO5A 3NVYA 1B9FA 1FXRA 4F4ZA 4JI0K 1EZZB 1JJHA 2W9BA 2DNRA 3GJTB 3Q8VA 3WNFA 2IMWP 1XS9D 1U8SA 3ET6A 3W1YC 4WU2A 4EAHD 4RUCA 3ZEUB 4NLOA 4KITB 3ILIA 3ZZPA 3FMBA 2DHAA 1K73T 2FD2A 2BRLA 3PJWA 3VZHA 1C6VA 3QUTA 1UWAA 2GV1A 4B3SJ 4W5NA 5HQLA 5GINA 4YMOA 3DRPA 2EZXA 2ZJ8A 3CDUA 3X1LB 5IV4A 1KONA 2GA7A 3HPHA 4WQ5C 3QT5A 2HCFA 3GJQB 3TQEA 2M5YA 4P7VA 2BH1A 1JKHA 2J9DA 2P9SB 2FZCB 2PFPA 1PIEA 1Q95G 2QMUB 1VLOA 3BB5A 1QAYA 3HI0A 4DX8H 5ETSA 3RJJA 1NGAA 2E5SA 3MCAB 1IR1A 2KL8A 4MYTA 4C0OC 2JEFA 4I2PA 2RKIA 3TARA 1GX5A 4EO8A 4ECTA 2F3JA 4IQWA 4FWKA 4HACA 3KKRA 3OTDA 4CIGA 4IG3B 2HMIB 3JS9A 5ETOA 2WSFC 1ATRA 3VAHA 2E88A 5A8RA 3AOBA 2AGQA 1C1AA 2C3UA 4J9MA 1C0TA 4FWRA 4KYZA 5C24A 5LJWA 3CMAS 3MN9A 2GJ2A 2AEJA 2H3VA 1WI8A 2AEFA 4JV2A 3NAIA 1WC5A 2ZOFA 3EZOA 3C5GA 4DUYJ 1T3QA 2XG8A 3KMQA 5AKEA 4CYUB 2JGUA 5AQZA 2JL9A 2R8KA 5AQFA 1TL1A 1S97A 1P9YA 4CF1A 3DLBA 2WMMA 4OZ0A 3F2KA 1X4FA 4HCCA 4KKOA 3GQCA 4S0MA 1KVJA 3LPYA 4YP3A 4R0JA 3CJ4A 3W2WA 2RILA 5IXUA 4CHPA 3N7SC 3G4SN 1T44A 4J9VA 1FD8A 1BCOA 2NQPA 5DRKA 4B3TF 4F0MA 3VGKA 2NO4A 4KH6A 3GIKA 2D74B 3HHLC 4ACOA 3UE2A 2Q97A 3J7YU 4M7XA 4F4KA 5H9FK 3VF4A 4CH0S 5K14A 2V4JB 3AQPA 3W9IA 4ECYA 3AMZA 4A57A 4YOEA 4NZ0A 3H25A 3HHNB 4G6VB 4I69A 1XR7A 2UU9J 2AGPA 4KHMA 3DOMB 3N7RC 3DWLA 1RAFB 4JYAJ 2BX6A 4LF1A 4JRPA 3MM6B 2BKPA 5CZ2A 2JHDA 2G09A 3A3OB 4FJLA 4KH1B 4KLSA 5AFUA 3W9HA 1J2NA 1IBMF 4ISGA 4MDBA 1YJNS 3NS1A 2JH3A 1RK8A 1MWMA 3D5MA 3W2VB 4B1YB 3KK1B 2F1HA 3A0HU 5H2FU 2UV8A 4AILC 3A0BU 1O6XA 4W90B 4RNOA 4PA1A 3ZDAA 3OL9A 4QOZB 4YEAA 3POTA 4DCJB 3IWNC 1YTUA 4Y2VA 2HBQB 2R7WA 4WZQA 1CS4A 1NH8A 4DV5K 5BOLA 1RWWB 4DPTA 1KVAA 1LNQA 2E5IA 2XICA 2V67A 4LIRA 5GMKa 2VBZA 4OHZA 1I94J 4B3MF 5FD1A 2ZIWB 3RJIA 4R63A 4KPYA 1QQ5A 1RJJA 1EARA 2QL9B 4C23A 1XNQJ 1VDHA 1W2IA 3AVFA 2UUBF 2HK3A 1BD6A 4GKJK 2MXYA 4DPYA 1HBNA 1CG2A 4AE5A 4BRPA 1X5TA 3NGSA 4FZZA 3HK2A 4WKRA 1XMQK 2VONA 1X4EA 4UBCA 5F8LA 4ED2A 3PZPA 3DXMA 5LSLA 2WOMA 4LRCA 2GIQA 3W60A 2Z0GA 4CK2A 2VC0A 2ZM6K 5AKYA 4CIOA 4BUGA 4JI7F 4B9TA 3ZDCA 3MX5A 1RE1B 4IQVA 4YR2A 3H2LA 3C7NB 3ZZTA 4UY8T 5ALXA 4YDUA 3CJSA 4DZ6A 9ICCA 3VESA 3M1FA 3IG1B 4H5NA 1BUPA 2B56A 3H45C 1SUQA 1TFWA 1S79A 4CZMA 2R2SA 4ZVPB 1Y4ZB 3AAWB 2FPKA 4RBTA 4DWIA 1KOHA 3RBEA 4Y2KA 2YKAA 2L9WA 1JWWA 4CBWA 2C28A 3IRWP 2UUAF 2YKPA 3M1VA 5LOQA 1K0VA 3AU6A 2DF4B 7ICHA 3HOTA 4DV2J 1NK8A 5F41A 3K17A 4GXJA 4OYWA 2UVWA 4PJ0U 5IS2A 3CCRS 1S1TA 3KUHA 7FDRA 1JLEB 3OUYA 2VB6A 4IC9A 2G06A 3EL2A 3BS5B 1QD1A 1IR2A 1XMOJ 4E19A 2FHKA 4F93B 3BO2A 4YB6A 3Q8KA 4M04A 2UUCJ 3IWLA 1RBTA 4PL1A 3SQ1A 2VFTA 2R7OA 3S3OA 4YCXA 1QAJA 3JPQA 2UXCK 1FXXA 4M5NA 1CLFA 2YPZA 2E1EA 3QGGA 1WC0A 2YJEA 1VSEA 3EKSA 4DSFA 4BRLA 2OPQA 1V97A 2AYGA 4EWTA 5BOMA 1AFJA 4HTLA 4C6AA 4DV6J 4X5VA 3C2PA 4DV4K 4PG5A 2KV2A 1YVNA 2CQGA 4LREA 3AA8A 3HSJA 4I2AA 4RNMA 3H40A 2BPFA 4UASA 4P74A 3AD7C 3UCZP 5AQIA 2CIMA 1RFQA 5BXIA 1V9OA 2D3DA 1N60A 5F1XA 3AA5X 5CAAA 4BDZA 2ZE2B 2WB1F 4DV0K 1QQNA 2VYPA 2R7YA 1FERA 4KBOA 3MAAB 4J9PA 5HRRA 2F8EX 3WT0A 2XMAA 3OYEA 4CBUA 2UZAA 9ICGA 4CO3A 3HT3A 5FDLA 3KBBA 3NAEA 5E79U 5E7OB 4QZBA 1RADB 4UF4A 5K4LA 4HCBA 3E0FA 2KVQE 1FKOA 3Q8RB 3ZZRA 4A62A 3BN7A 1K8KB 5H9EK 2R7XA 1M6YA 3P5JA 2GVDB 5J2EA 3FSIA 4HH1A 1S4EA 2VOOA 3H42A 4DFDA 1RTHB 2JWNA 3HXMA 4JKBA 4O4GB 9ICSA 3DOKB 1SZ2A 5EX3A 2P5VA 2YJFA 3C1YA 2J9EA 5C42B 3N4QA 3N0VA 4NWBA 4ELUA 3TZZA 5J0OA 4LF4F 1RDBA 5KQ8A 4FCYA 1KR4A 2AZ3A 3TX8A 3NLCA 1OXJA 5DG7A 3AXMA 1V6HA 4OZLA 2C3YA 3CGIA 4IEIA 3HHDA 3E01A 2ZJ5A 2V51B 4U95A 3CQYA 4Y3CA 3HI9A 3AVKA 1PK1A 3ZSYA 3HW8A 1I51B 3V5RA 4HUEA 1X60A 2WC9A 1IVZA 3UQ2A 2ASMA 3TTCA 1WJ9A 1P27B 4GO5X 2UUTA 2ADCA 3H8JA 5U47A 3CI5A 5AI9A 2B43A 4I2QA 4JI3J 4XDCA 4X4TA 1HMVA 1S9GB 4M3ZA 2HG4A 2YY3A 3MOZA 1KTVA 3GIRA 5JLFA 4LVNP 1S1WA 4TUSA 3FRYA 3WNEA 2E1YA 1IJFB 2GAHC 5RUBA 3ENOA 1V4TA 1UVJA 3QT6A 4CGZA 2QRRA 1KDNA 3ZETA 3CJTA 2DKOB 3HKZD 1Q16B 5AQVA 3B4DA 1HIYA 2BCQA 3C8YA 5LJ5Y 2V69A 2MSNA 1JLGA 4OJRA 1FA0A 4W98A 1Y9OA 5A76A 2XZDB 2HKEA 4K4IA 1X4BA 4B3TK 2CQPA 3PIPL 3M6ZA 1ZM3A 4RTFD 2GC8A 2CJQA 2CXEA 3D2EA 5ALSA 1J53A 4KH5A 4KSEB 4OJGA 3KLGB 3D66A 4KO0B 4L3NA 3MGIA 2ZIXB 5J1EA 4FJ5A 2HFZA 4LFCF 4IO1A 4F5PA 4ALZA 3VALA 1G1XA 1VOMA 3BJYA 9ICQA 1FEHA 2WVFA 4E1MA 3J7ZT 3AO5A 3LP3A 3CJKB 2XI2A 4CE6A 1GFWB 3CM6A 3VTHA 4DLEA 2RRAA 3TA0A 3PSTA 7ICTA 3NXZA 3P5BP 2ZH9A 3IBWA 3MWTA 1R7IA 2J8SA 2HQDA 2X1GA 4CHOA 4OJ5A 4DHVA 3CC2N 1UPMB 3CDAA 1IBMK 2ZBCA 1NZPA 1PYSB 2EBEA 4B1ZA 3U3GA 2W41A 5I3UA 4FPRA 1RGIA 4BVPA 2HNYB 3OL6A 2Z4PA 3G8QA 1TUVA 1N54B 1LVHA 4CO2A 3O2IA 4H4OB 2EHGA 3J81j 4B3MK 2MY7A 3R5CA 5DGAA 5AM1A 1VQMN 3O3GA 2CRXA 4OHXA 4JKAA 5AQPA 4IL6U 2OTJS 3BZKA 5AM3A 3NMRA 3E58A 5ALMA 5CHCB 1YUWA 4WIIA 3C3LA 5FIIA 2HNZB 3BZCA 2AMCB 2XY8A 1Q18A 2UUBK 3IWXA 2Q36A 5ALFA 2H3EB 4ELVA 1HNXF 2GMLA 4KFBB 4DV3F 2J0WA 4N41A 3UN5A 4HUFA 4IQTA 3DRRB 1RWOB 2LMRA 2RN2A 3SCKE 2EZYA 2ZC4A 4PWUA 4YOUA 4LVOP 1G2EA 3M8PA 3RJHA 1X7VA 2ZVIA 3WBZA 4JI7K 3W65A 3JSBA 1VQON 1XSPA 1PAEX 3H5UA 2KW4A 4K59A 3N5BA 2RQ4A 1F3VA 2XMWA 4CLKA 3QUCA 2DCUB 4F3QA 4RQ5A 1VQPS 4BR0A 5HROA 3VGLA 3THWB 3IG8A 2D69A 4JI5J 1HNVA 4AQYF 3PXGa 4P75A 1WKKA 4D3GA 2DNKA 3B54A 3PSIA 5CR0A 4JBCA 1F6TA 3TFRA 4LF6F 2CJ9A 3DDHA 4CF8A 4CHZA 2V8GA 4E2FB 2CN1A 1N5VA 4MLEA 1SC1B 2UUAK 1RBVA 3N79A 4KE5A 3MFHA 3F2DA 5M1PA 2F9TA 3ZTPA 1VQKS 2CQHA 2BKOA 2G8VA 4NCGA 4IDKA 4DR5J 1SQGA 3H8YA 1NGEA 3D0IE 3OTOJ 2GBZA 1XN9A 3T3FA 1JLQA 5KG4A 2FJXA 5KFPA 4ZK7M 3M6KA 2F1IA 1RCOB 4OYBA 1IN0A 2OSRA 1B70B 4CJPA 4RW6B 3KD5E 1ZXOA 3DLLQ 1WEYA 4DTMA 2PN6A 4OLAA 4V19J 2FLNA 2F5GA 4MEYA 3GPAA 2NLXA 5KT5A 3MTJA 1EXQA 5KFWA 3AJ1A 2PYJA 4GMJB 7ICOA 1FDNA 1IQZA 4GLXA 3VAIA 3SQ4A 2HOQA 3JPRA 1OSDA 3R27A 5IIMA 2FGCA 5HMYA 3RYLA 4A8SA 5KG1A 1VQ8S 4WJ3B 2BV3A 1GH8A 4QS9A 3C29A 4GRSA 1RAHB 3O9RA 2QWMA 1G6BA 4RNNA 2R2TA 1NZAA 4IJAA 3UI3A 2N1RA 4QZ8A 1U4BA 2CQ3A 4K4XA 3AVHA 3TW0A 3F44A 4X4OA 4E7JA 3L2RA 4NO7A 3OSPA 2OUGA 4RZRA 2R18A 4GVMA 4MKBA 4NLNA 3LH2S 4X62F 4CO5A 3WX4A 2OPRB 4ERDA 3AVCA 1VK0A 3H0MB 4LVSA 3F56A 2QXFA 1U0SA 4MFBB 3CP8A 4OHWA 2W2OP 2LEPA 3R9PA 1UW4A 3GJRB 4KTQA 4CHNA 1PCAA 3C2MA 5AFUH 1Q53A 2ZWOA 4K8XA 3IAYA 2O8CB 3NS6A 5AT1B 2HRUA 3PHTA 4DFMA 4Z37A 2XGPA 2OZMA 3G10A 4YXJA 2B6AB 2LP4A 4OI0A 4DTXA 3TA1A 1S5JA 4FK2A 1RXWA 4LF9F 2C3PA 1T11A 4Y2QA 1T94A 3OPKA 3WK5A 3BR8A 4CLTA 4EZ9A 3CJ8A 3NOCA 1RP5A 3V1OA 3WNGA 2W2QP 2M52A 4LF4K 3VQ9A 2LKZA 3SZ2A 1L3SA 7ICJA 2EI5A 5IFMA 1MWKA 1VK3A 3PACA 2Y9TA 2GJIA 3J81Y 5E26A 3QPIA 4PXCA 1EJ7L 1UFWA 2GWSA 4HT5A 1XU4A 1CXUA 4CHQA 5BR8J 3L95X 1NCLA 4I56A 4BRCA 3IRXB 1ZQFA 2LPEA 1FE0A 4ECUA 3H6EA 1RDRA 2CNNB 2KO1A 3BM7A 2YQ3A 4WJBA 3KFUF 4I1TA 3CM5A 3E1YA 3OTCA 1QQMA 1KTQA 4FZXC 3QRPA 2Y1JA 3C21A 1Y0HA 1LWCB 3V9UA 2XMVA 4DX5A 3E9PA 4DQSA 9ATCB 2ALYB 2AJ4A 3RB6A 2DNOA 4UB1A 1ZRMA 1O51A 3O3LA 1H2VZ 1FRXA 2EW9A 3SNNA 3H5XA 3KKAC 3HX9A 3PUFA 3IGNA 2YX6A 2ZIVA 4IFYB 5DDQC 3BY5A 3K7RA 4RPYA 2K4IA 2E6MA 3QJPA 4CDIA 3KK3A 1Q82O 5AQNA 1RT7A 3DEEA 3RJEA 1P1TA 4DFPA 3FZLA 2QN6B 2W7OA 4A8KA 4LD0A 3OFEA 3JTPA 2MKJA 4P0QA 3EX7B 4UB2A 4YOXA 2PYLA 3W62A 5K20B 3TP2A 3LWMA 2BRKA 3ZX0A 4PGYA 1NJYA 2QKBA 3WKDA 1HPZA 2DHHA 3PV8A 3ICXA 4RUBA 3OQ2A 3ICLA 2LXFA 5L1KA 2RU3A 3I0SA 2O4GA 1DQAA 4LFCK 2FSKA 2CQ4A 4IEEA 4HT7A 1HX1A 2H4WB 2W8LA 1BA1A 2V63A 4FS2A 4KLEA 4CTAA 4UQGA 4KV8A 5GAGU 4OMFG 2OIHA 3QB0A 3GP9A 3TAQA 3H0RB 1WKLA 4IKFA 1F5AA 3H59A 3SQ0A 1DTTB 3NUQA 3PFEA 2P9KA 5AXMA 2BQRA 2M9KA 1NGDA 4AXIA 5J29A 2CPRA 4AH9A 2DB1A 3K2YA 1HQUA 1V3ZA 1RAIB 3CCMN 2Q31A 9ICLA 3BKTA 4PL7A 2GNKA 1Z4OA 2G0JA 4OZ2A 4KHRA 4C1NK 5B0GA 3CC4N 4C97A 2Y0SD 4UAUA 4G1QA 4KB7A 4PQUA 4TLQA 3R5BA 3RAXA 1GLJO 2LU1A 2GZOA 2W24A 4EEYA 2O67A 2O01C 2HQFA 1D09B 2KZMA 1TUGB 3CC7S 1RSCA 1DLOB 1IM4A 3MXJA 2ODGA 4CGFA 3L4PA 2D3OR 3ENWA 4AF1A 1I5OB 3DGVA 1L6NA 1GO3F 3AVAA 2DRBA 3CWJA 1CEZA 4MFCA 3KG4A 4KPCA 1ZBSA 1HNXK 1TFRA 4DV3K 1C0UB 4M3YA 1RB0A 2Z2MA 2GMJA 4K5SA 2QEXS 1X3NA 1JLFB 1VQ7S 2JSXA 4XH4A 3LTOA 1U04A 4FNHA 3MEKA 3L3FX 3UD3P 4KMUA 4NB4A 1TFYA 3QJLA 1Y88A 5KFNA 4BC7A 2I7PA 3FGUA 2A6MA 2MUTA 3NGIA 1BG3A 4JN4A 2D3UA 2P9NB 4AQYK 1OH7A 4CGJA 4D3HA 4OJ6A 3TADA 4I7FB 2W55A 2EAMA 1S59A 4XK8C 4M9HA 1Q86O 2DR9A 4LF6K 1YTAA 2BE2A 2B21A 1J97A 2MQ8A 4BX9C 3L8BA 3BO4A 1S9FA 5KAKA 3R3TA 4N8OA 1CQMA 1A77A 1RT5A 3FBCA 1QTMA 1UL3A 1BIZA 4K8ZA 4QPXA 1C1BB 5C25B 1J2VA 2XYGB 3AA3A 2B4PA 1CULA 2OEHA 1MU2B 5DMRA 3KHRA 5GAEU 1HHTP 5CZXA 3KNGA 3V7KA 3IM9A 1LW2A 4DQQA 1C2PA 3KLFB 2WW8A 3G9CA 3C65A 1X1PA 1F9HA 5KFOA 1S1UB 4MFFA 2CNKB 5HJYA 3CCVS 1EAYC 4KGKA 2ZH7A 2CA9A 4H8KA 1TGOA 4ISEA 4JWNA 1XJWB 4JI6F 2D6FC 4GV6A 3I9V9 3D0HE 2MLZA 1Q8LA 3WIUA 3QU4A 2KXNB 2F8SA 3SAHA 5B5EU 2HVIA 5AQRA 4JI0J 1OH8A 3D2NA 2ZDOA 3IBFB 4M9GA 2G8UA 5DG9A 4ICAA 2BJEA 5EGYA 3QX7A 2EFOA 4ZA1A 3ITHB 2FVSA 1IBLJ 4GC6A 4USVA 4A2AA 2E5HA 2HW3A 2E2QA 3WKEA 2DFHA 4NYOA 2HZCA 1WG8A 5E3RA 3E8OA 4I4BA 4CH7A 4ZPTR 2DY9A 3V9XA 3CCSS 1FI4A 1RYRA 5A6PA 1SC6A 3CCQS 4I2BA 2FC0A 5D0EA 2KG1A 3GFXA 4IFVB 2C2DA 4E0DA 4C7ZA 3JSMA 1XK8A 1REVA 3TUZC 4N56A 3S41A 4X62K 1VBYA 4GIBA 1NMEB 1IKYA 3KDNA 4DR2F 4EP5A 1JLAA 3V4MA 3CCZA 3L7PA 3MDQA 4RW9B 3BF4A 4IOAQ 3VQEA 3U4LA 2B0CA 2XSJA 1GAOA 3QIPA 3M30A 3TJ8A 4DMNA 1SC4B 2CH5A 2OPSA 3MR2A 2WONA 4H5TA 4P2HA 4AL6A 2BUPA 5LJVA 4LF9K 2YMLA 3K1ZA 3UCGA 1TAUA 1GOBA 3OW2M 1DEJA 4Z2XA 2H9ZA 2QYGA 3MEGB 4OVLA 2NRWA 3TWZA 1WBBA 5AKKA 3LPEA 3QGIA 2WAQD 4NLRA 1IWAA 1QZ5A 3V7JA 4CI6A 4M45A 4BBYA 2M0NA 4CEOA 2Z7JA 2ZUGA 4GO7X 1YHQS 5E3QA 1IXRA 3RSEA 9ICXA 3KLEA 4NLZA 2H4YB 4QWDA 3KD3A 2VPZB 3EM1A 4CF9A 3E2EA 4LT6A 4QR2A 4DV1F 1VGYA 1KQSM 1N88A 3NRBA 1NJWA 3HL8A 1LEOA 4DZDA 4CF3A 4NYPA 3SSSA 2H5JB 1D4XA 4EX6A 4Y2UA 5IC4B 3GIJA 1V5VA 2G2YA 3VF0B 4L75A 4ANEA 3AY9A 1FF2A 2V68A 3ENAA 5CXTA 4O3QA 1P1LA 2QV6A 1OJ4A 3DDIA 4GXIA 4NJ8A 5H9FJ 2JZ5A 2Q6BA 4WTYA 3B8HA 4CEBA 4RW7A 3ID6A 4X4QA 4DN9A 2XZTB 8ICBA 1J6ZA 3VQQA 4B8CA 2IBOA 8ICXA 2HWTA 3NWGA 1T6CA 5GAEI 4BR7A 2BM1A 3IRUA 2JEJA 3J8AA 3GZ7A 5CYQB 1W97L 3CCEN 4LJMA 4LF7F 1P8GA 1YXQA 5B0DA 2I1QA 1QQ7A 4KAZA 1NOZA 1VQLN 4QZ9A 2FC9A 4I6MA 5FPNA 4KIAA 4R5PA 3T7ZA 4BJQA 2VGMA 2FZGB 5AM0A 1PYOB 2QB0A 2GFFA 4ZP8A 2RS2A 4BXOB 5AICA 3O4WA 4USAA 1ZQMA 4IYQA 2MA1A 4PZNA 1HD0A 2XM3A 4EBDA 3IG5A 4C80A 2DNYA 2XB2D 4DV5J 1ZAWA 1RBRA 3G2XA 1R0CB 2KOBA 3VV2B 4DR3F 3HFVA 1J5OB 4F50A 1U47A 2I6WA 1VRUA 1AA1B 3H4DA 1TKDA 1WKJA 2D0OA 2V4RA 3AGKA 3QU7A 4ZP7A 3IN5A 4TXSA 3CE8A 2DL0A 1VLBA 2FJWA 4K2JA 2WSCC 1GTHA 3MMJA 2A1BA 1RTZA 4GKJJ 2XVTA 2YH0A 1EP4A 5ADXA 3QGPA 1VC5A 1XMQJ 4UAWA 5FLXO 2ZUDA 3UDLA 3A5OC 4IO9Q 2N3LA 1BI4B 3M2VB 3K0SA 5IWAF 5J2IA 4CNQA 3NGKA 4O0NA 4OKKA 2ZM6J 2ZH2A 2XIDA 2BOPA 3NNAA 1VQ4S 3FVYA 2ASYA 1HBUB 3P4UB 1JCFA 3H3OB 2ZVSA 3ZT3A 3FRZA 4WE1A 1S72N 3KHHA 4ED0A 1QSSA 3AXKA 3H1QA 3HFZB 3ISND 2AYBA 3EVMA 3KHLA 4A46A 2JWKA 1RZTA 5DK5A 4QZEA 5J8YA 3M8QB 3H08A 7ICMA 5L38A 4K7QA 2EG1A 3CDBA 2KJ5A 2YNIB 4HLBA 3V81A 2CUYA 3W61A 1LW0A 3NAHA 4BCAA 5LMUF 2GVZA 2GV9A 2M2BA 3R7NB 3OYBA 3CCUN 1BVSA 3DMJB 1VSIA 4H0PA 4BG9A 2ASPA 3MR5A 3EY1A 4RBVA 2NV3A 3RGIA 3ZC4A 4P10A 1IUJA 3TA2A 4F67A 3D6HB 1ZQSA 4OKJA 4ZHRA 2HBKA 3ZX3A 1SQEA 3GMGA 2OJ3A 4BQLA 3WZ0A 3G8SA 3G4SS 1W26A 1RT6B 3OYHA 5JVHL 5CA7A 1F60B 3UFCX 2BM0A 2OXOA 1JNZB 4ATNA 3TTFA 3VQTA 2W6LA 1TTHB 5GIPA 1SVDA 4J8FA 2KZ3A 1TAMA 2RVJA 4WYBA 4WXOA 1KDHA 1RGVA 2A6OA 2Q3SA 3CERA 3THYB 3O1LA 4R25A 1X2IA 4FBUA 8ICWA 2IHMA 1P9QC 2MJUA 4F3OA 4DV4J 2GELA 2HWIA 4KB0A 4MMOA 2FJEB 3NS5A 3K4GA 2YHAA 2KM8C 4R8UB 1S0MA 1DGJA 4FZNA 3VGMA 2BE9B 2JMGA 4LF8F 2WTFA 3I31A 3OLBA 3LANA 3R7BB 3IM8A 2L5YA 5ALDA 4WIQA 3OBYA 3ZZZA 3V4IB 3K9JA 3JTNA 2HAFA 4JI6K 1WG4A 1T6DA 4W5TA 3ZI4A 2J9CA 4Q8FA 3A5NC 2FPLA 4L76A 4W5OA 5C2DA 4YVZA 4M5LA 1KLMB 2I5HA 4A5AA 2BACA 3UIQA 4KH0B 4U6PA 4TQSA 2M0GB 4FM2A 3KJVA 4M5DB 1SH2A 2GWKA 1HBMB 3MEDB 4O3MA 4RQ0A 3NBPA 3BGUA 3HULA 3PR5B 3LO3A 3O5BA 2EFQA 5H9EJ 5BYSA 3EXYA 2YB1A 3QYYA 2HIYA 3L6QA 9ICJA 2RSQA 3VETA 4B8AB 1BIUA 3A0IX 3O6QA 4O55A 2IJNA 3OS1A 2ZHOA 2CQBA 5DKWA 1AW0A 2GAGC 2KYZA 2EANA 1NB7A 1H98A 3NG8A 2Z8QA 4DR2K 5CD4A 1K8AO 3O9UA 3WXLA 3CMES 1NB2A 2MQPA 4CD1A 2DXFA 4RQ3A 2DJWA 2POKA 4PH5A 4YFKA 4TY8A 1R59O 5AQLA 1ZBUA 4EZ6A 2HQIA 3M9MB 2ZTDA 1WDTA 1P90A 3V6KA 1FKPA 4JOUA 4M0AA 1N36F 3EWAA 3BR9A 1XO0A 2DH9A 1DTQA 1RHJB 2IOFK 3SV4A 5K9FA 4ZH4A 3AH6A 4QIGA 5DQIA 5CH7B 4CJLA 1B9DA 8RUCA 2LQ9A 1QTNB 3QRRA 4O5BA 1N4LA 4PKHA 1F0XA 4NX9A 2GIRA 5ETPA 1FFVA 4USIA 2EQYA 1S1VB 3AAPA 3UXOA 7ICFA 1CJVB 3JQKA 4JHDA 4DQPA 4PG7A 1UOCA 1YJ7A 2K8GA 2ZIUB 1YSJA 3ZSZA 4JV1A 2HYIB 5G0RA 1SJ1A 1S49A 3DLGA 3RJMB 3KLHA 4NLQA 4GVBA 4DPUA 3TR5A 4NZ7A 3KK2B 2RNEA 3K5NA 4DV1K 2MSTA 3I8DA 1S1XB 1TQLA 4CLPA 4JNEA 1OWXA 3BPSP 5AQXA 2Q79A 2P51A 5DGBA 1RAAB 2JH1A 2KJVA 3BBFA 1U2FA 2IVNA 4F26A 2O3DA 3CD0A 4CIFA 1VHIA 1HFEL 4M8LA 1JUDA 2W9BB 3D2QA 3SAGA 1L3KA 3ENHA 3FZBA 3ET6B 2HVEA 3GYNA 2Z56B 2OLWA 3GIMA 2XHWA 4OI3A 2ZUBA 4M3TA 4CJFA 1IV8A 4ICLA 4PXBA 2V6AA 3DRPB 3C14A 1ZQHA 1VQSA 4LF7K 2R9LA 5HQMA 4BACA 1R6VA 4ZPCA 5D0GA 1W25A 4RBUA 4QWAA 2A6AA 2Q0ZX 2W3SA 2IM2A 1EWQA 2EFVA 1JKHB 2ZWHA 3FZFA 5DQHA 1IBMJ 2KSOA 3MDAA 3KXDA 4JWMA 4Z6DA 4I2PB 2RKIB 4ZTJA 1HWIA 2F9WA 4QPTA 3BF1A 1VIXA 2KDOA 4FJJA 4HACB 4DR3K 3O8WA 1ZQLA 4B3MJ 2IIHA 2BPCA 5A8RB 4RLEA 5EE0A 1NMNA 1DARA 1C0TB 5AI0A 4NZ6A 2J8AA 2YHYA 3QE9Y 1W2BR 2KB2A 2MZRA 5JVGL 5CA5A 1J9AA 1B7FA 1E3MA 2B7CB 3JAMY 3V72A 2UUBJ 4H03B 3L9ZA 1R8CA 4DX7A 5J2HA 3AD8C 5L39A 4FM0A 2O6KA 4OJHA 4F4XA 1KVCA 3U8XA 3KNAA 2DO4A 3LALA 3QEWA 5IWAK 8ICSA 1TL1B 3BV8A 2EDUA 2H3ZA 2PMZD 1SS6A 4NL9C 1OY9A 4G3IA 4JI7J 2DFFA 5AQHA 3D6TB 1NWKA 3F0NA 1NKCA 2BYCA 1BPBA 4QZDA 3A13A 4KKOB 4QOTA 3ED5A 3VQ8A 2QARA 1RHKB 3SV3A 3H1VX 3W2WB 1NDPA 1LFPA 3I33A 2BXJA 2KXHA 5HBMA 4ED8A 4N77A 5A0YA 4DUZF 3CCRN 2JLEA 2JVOA 5HR6A 3CG7A 4NCBA 5AR0A 3SQOP 8ICJA 3H2UB 1FNOA 2GTDA 3I28A 3S1TA 2UUAJ 3F5TA 3I0RA 1OKJA 1H6KX 3CO9A 5LMUK 2FMQA 5K14B 1NHVA 4K0KF 4DV7F 5EE1A 1YLXA 4MDAA 2OHDA 4ID5A 3QERA 1SWVA 4EEKA 1WSFA 4L3QA 2ZTEA 4GKKF 2GEMA 1JJ4A 3H8MA 1K9MO 4OJ3A 3C46A 2VG7A 3W5YA 3VQ6A 4BR2A 3LM2A 3P39A 4HVZA 5D46A 7AT1B 1TL5A 4CESA 4C4RA 4UB5A 4IH5A 2W42A 1NNEA 1IG6A 3T6JA 2PMWA 3H0PA 3DHXA 1S77D 4QIWD 1HYSA 2MZJA 2C42A 4OLOA 2QLFB 5KNIA 1JIHA 1WYGA 4UUWA 1JALA 4UB3A 5FRNA 2FGOA 3PR4A 4O0IA 1U45A 3POTB 4DN0A 5KFHA 4IO8A 1UWBA 1S48A 1CS4B 4ED6A 1MROA 1W7WA 5A0LA 3CJ9A 4FBTA 2MY8A 1ILYA 1RHQB 5LSOA 3VQ7A 1WUDA 2P8IA 4KHSA 9ICBA 3MM7A 1IBCB 5T7LB 1KP6A 4OL8A 4LF8K 1SBRA 2RQ5A 3H20A 4PHPA 4EHUA 2OI2A 2YX7A 2ZZNA 1H73A 4ANDA 3CC2S 3QFPA 1TR0A 1YGYA 2JDJA 2LDIA 1PILA 3T19A 4C4SA 1HBNB 4YB1P 3M8ZA 3PO4A 3G82A 1A6SA 3CT9A 4A2BA 4LFBJ 5E3CA 1B4FA 1HKBA 4CGGA 1XWLA 4UBBA 5KFLA 2X78A 3DXMB 4CJKA 1U8WA 3F73A 3RMBA 2NYVA 4M1KA 1BY9A 3WKAA 1W2BM 2A42A 4UAZA 2OPPA 4MQ3A 1IV0A 3EW9A 1CJKA 3CD5A 2WUSA 1VQMS 2G8KA 3TAEA 2IFXA 3FUYA 4B9VA 4QS8A 4TU9A 2FJBB 2OHFA 5FPMA 5J0PA 1SUQB 4WFNQ 4B3RF 2IVYA 1S76D 3M6WA 2DPIA 1UA0A 1Z3EB 4MK7A 2FBVA 4IH7A 3M1VB 4MEXA 4LF4J 4WK3A 1KLNA 4DCHA 2WK4A 1QH9A 3K5PA 3RH5A 3GFKB 2KP7A 3O3HA 2HHHF 3OYDA 1KL9A 1FX2A 3N4PA 2HMPA 1S1TB 2KI2A 4RW8A 3OUYB 5ADXH 2FYXA 2FF6A 2G2ZA 2W7AA 6FD1A 1N0VC 2V2QA 2AX1A 4WQ4C 1N36K 1ZQTA 3K8VA 2HS4A 3QU9A 3D1HA 1NG9A 4FOIA 4JKCA 4NXNF 2AZ1A 2VBYA 5HOOA 1LXJA 1DGSA 2YV0X 3D4JA 4RPXA 4C7YA 1XERA 4JI8J 5DZ7A 1CC7A 4RWXA 2VG5A 2OPQB 3IFRA 3DAWA 2DIUA 5J2CA 3F2BA 2CPIA 4ANCA 3FFIA 1F9EB 3RUBL 4QS7A 2QZ8A 3RJKA 1QSYA 1B92A 1BGXT 4NYZA 4JKEA 1NGCA 2BTFA 5HN0A 2JFKA 4IRKA 4IS7A 2XNQA 2KT5A 1RDUA 4L74A 3EE9A 2A0FB 2YX1A 4FLWA 1E6YA 2RD5C 4ZTFA 2LCWA 4IRDA 3HX0A 4OZ5A 2I7NA 4Y1CA 4OLPA 2OTLN 4FYYB 1HUXA 3ENBA 3NMUA 3OYGA 3T5KA 4QCLA 2KNJA 4F72A 4QNLA 3SCIE 2CH6A 1LKYA 1JJCB 3K89A 2UXDF 4M3WA 4DL5A 2B8QA 5F9LA 8AT1B 3SXLA 4BRHA 1NJZA 3WXIA 3MF5A 1YTYA 2KIVA 2MZSA 3PMLA 4BRFA 5FDLB 1HRHA 5AZIA 4PAAA 3BGFA 4C8KA 3SBTA 2YBVA 2IOCA 4PCQA 4ECWA 4LFCJ 5KT2A 1FO1A 2MKIA 4H5RA 4CE9A 1FKOB 1NU0A 3PW0A 1LOUA 3OTQA 2VIXA 4J7CA 1S6UA 2RQMA 1U6FA 3AVMA 3G6EN 3U1LA 1SKWA 2BABA 2ZDPA 1N5YA 3IC1A 2WB1C 4PR6A 3E3XA 4RUAA 2PKEA 5IM0A 2LXIA 2CQ0A 1S8OA 3CCWA 5BN9A 4N76A 4FZVA 3TAMA 2GWJA 3CJCA 3OBIA 3WK9A 5GAHU 1X6JA 5J1NA 1KQFB 2PD1A 3LW5C 2MMYA 5EVZA 3ZO7A 2DEJA 4ZJLA 2DKZA 3E01B 3K75D 2IIRA 3SMPA 4Z4CA 2HOFA 5D15A 2N82B 4UAYA 1PK1B 5E5NA 4KB1A 4N8NA 3LPTA 2ZBIA 4YUDA 2YKNA 5E0OA 4ILMA 3J80Y 3VMFB 4DS5A 3UDEA 1L5UA 1ZQJA 2QB1A 3WEEA 1HLWA 1RTDB 2O5DA 1VQPN 1HNXJ 4OYXA 3QNNA 4DV3J 4I2QB 2NO5A 4FJHA 3DHWC 1GMWD 1HMVB 1TL3A 4NLBA 4FNIA 4EX7A 1BQNB 7ICEA 2DFEA 1K0TA 1DRZA 4J2DA 2G5IB 3RWUA 3MPVA 3G6XA 3RH6A 1COOA 2VHGA 2ZITA 5CD4H 3ZDBA 5SZTA 1WUAA 4CH1A 1VQKN 1MW7A 7ICKA 4UY85 1B7YB 1FHTA 1BWEA 2E4LA 1JLGB 2RRBA 3MN7A 4AQYJ 3ZNJ1 5KGXA 2F63A 1DRGA 4DUZK 3ELHA 1N34F 1ATSA 2EG2A 4FP9A 3G6VA 4LF6J 1VISA 2M7SA 3D2EB 3OGUA 3KDOA 4J2AA 5AIBA 2J0SD 1ZD3A 4KI4A 4KHNA 2KKVA 3FK4A 5J1EB 4K0KK 4M7YA 1H38A 3VGTA 4DV7K 2ACYA 1KQQA 4QR1A 4WFAL 3ISCA 2QE5A 4GKKK 1HKGA 1X5SA 3D6MB 4I9LA 4YHHJ 2ZBPA 5L1IA 4TURA 3IP4B 4GFJA 2YB4A 3QNMA 2O66A 1F2HA 2NPIA 3HPGA 5BRDA 5ELZA 1JRPA 4M9LA 3IAS9 1DOQA 1RG6A 4Z4IA 1C7YA 1Q79A 4LQ3A 3VQ5A 3R9LA 2HMXA 2M8DB 2XMKA 2YMQA 5I3UB 2GLEA 2EK6A 3LDQA 5LY3A 4ZJOA 4YMEA 4B9MA 1PYTA 4OI4A 2O8BA 5I4MA 2D0CA 1ZTTA 3UMGA 5HP4A 8ICNA 2QT7A 5KFUA 3CCJS 5EUHA 1EO1A 4B6JA 4X64F 4YY3F 2WFAA 1QVGR 4NLSA 1WC4A 3HVRA 1Y5NB 4H4KC 4FLUA 4B17A 4XH5A 5AQQA 1UFLA 2VANA 3D45A 1G3OA 2IA0A 4CIEA 2ZJRQ 3VF6A 2KKZA 2HHUA 4WQ5A 1KQGB 4OJPA 3OYNA 3ZTQA 4WFYA 4RL1A 4CBXA 3CCMS 2JH7A 3LP2A 3BKUA 4X62J 4A59A 1YAGA 5ALJA 3WKBA 2CNOB 5ALNA 5GAHI 5F8JA 1X4DA 4P6QA 3FBBA 2B6GA 3RZAA 4N5SA 4GNIA 4UW9A 3HMJG 3ULEB 4CZGA 2OMOA 2I6XA 4IOAL 1NSPA 1OYEA 2ASJA 2E2OA 4J9UE 1IO2A 4DPWA 1BNOA 3NH2A 4L72B 3AQFA 2F9DA 5HROB 1TKTA 2APOA 4BR4A 1ZQGA 1HNVB 1T02A 3SJJA 1YI2S 1L3TA 4LF9J 1J5EF 3R7SB 4KLHA 3OTEA 4NI2A 4FWQA 1D8ZA 1APSA 2VA8A 3CHWA 3LVVA 1ECWA 4FJ9A 1UA1A 1JXLA 4LF2A 1BPYA 1C20A 1PC5A 1RISA 1CSJA 2YWHA 1H1VA 4PPXA 4I2JA 4NCGB 1N33F 3GOIA 2W1BA 2YHBA 3UW1A 2O4IA 4YORA 3HPOA 2XMMA 2HHHK 4R64A 4KI6A 3OXGA 1JLQB 1MDUB 2VDIA 2YWKA 2FB0A 4P73A 2IOFA 3KJFB 4K4UA 2Q4TA 9ICWA 1BU6O 4LQ9A 1NGGA 3MWPA 3EJMA 4IQXA 1ZQVA 3SFGA 4FJMA 2HBZB 1XR6A 4ES2A 3JAMO 3FQLA 2A10A 4MF8A 3EWGA 5HJXA 4B9LA 1RAOA 4NXNK 3L0QA 1X9WA 2Z2YB 4MIBA 3SBGA 2K89A 1CVJA 4CZFA 3CRXA 3PRBA 4X66F 2P5OA 4FVUA 5LMNJ 2CFXA 3PM9A 1VCTA 1SJRA 2OYYA 4A8WA 4X4RA 4F4YA 2FPHX 3VAMA 2U2FA 4LY7A 1XIQA 3HHLA 3FZ2A 2IBKA 1M90O 3GCXP 2G13A 5DM6L 3MGVA 1K1QA 1VQ5N 1LXNA 4ZLPA 5AQJA 1HNWF 4FFDA 3BYPA 3QSYB 1GLAG 2WBNA 1WSGA 5MLCV 1SV0C 3DRYA 2W9CA 2GUIA 4BC5A 4PG6A 4DCOB 3S9HA 2RLTA 4V19X 1Q5YA 2UXDK 2VU5A 1PJ7A 2ISPA 2GQCA 4I2EA 8ICPA 4C9DA 2CZ4A 5D8HB 2E1PA 1WAFA 3PW2A 3TAPA 3OT9A 4K50A 3CJBA 2ZJPL 1KCFA 1S6PA 2I0XA 1XTZA 2F8KA 1HWUA 4HDHA 2HBMA 4JV0A 2DNNA 1NDLA 2IM0A 5ETTA 1JJ2R 2KZZA 2YX8A 2HFUA 1A7GE 3QO9B 3VZIA 4BWJA 3D1OA 1NBWA 5BYQA 2Z30B 2JRSA 4C7QA 1KFTA 1UHUA 4C8LA 1IG8A 4CJUA 2BBEA 3TSUA 1FRLA 5KOXA 2HVDA 4QIFA 3MXIA 2AP6A 2E7WA 4ETZA 2R2RA 2PIIA 2E6LA 1SJQA 5ETRA 4C4TA 2XNRA 4E1NA 2DR5A 5JICA 2NRVA 1Q81O 1NGIA 4J03A 2HWHA 2H3FA 4F4AA 4NLVA 2KYXA 1YQHA 3Q8SB 4CZIA 4XA5A 4DR4F 3OR1A 5D0HA 5J0WA 5G5HA 2PEBA 1Z00A 1UETA 1X5PA 4BGAA 5E84A 4LF5J 2E1RA 2WHOA 4I6WA 4ZCKA 4J9NA 4H5WA 3VR1A 4ILLA 2E5LJ 4OV1A 1WC6A 5J0SA 3I87A 4JK1A 1HUZA 3C0BA 2WF9A 4CEEA 4CLLA 3Q24A 2O8EA 1RDCA 4DTOA 3ZT4A 2FIUA 2MJNA 3R2DJ 5I9EB 4R66A 4YDDB 2V52B 3KIOA 5ETVA 3UDCA 5LJ3Y 3PJ9A 2C2EA 4XPCA 5HMWA 4MFAA 3CQXA 3KZBA 4LMZA 5F0UA 4OJOA 5EOZA 2VC1A 4ECXA 1SJFA 1SXDA 2AYEA 1WSJA 2VGNA 5KT6A 3GTYX 4OX9F 5GAHP 5A2QO 2ZIVB 1RAEB 3NVMA 4ED1A 1VSHA 3U9ZA 5DDPC 2ITMA 4XIUA 3CEDA 1ZBIA 3KK3B 1RT7B 1U09A 2CNLB 4HTIA 3FNNA 4M47A 5ALQA 4KLMA 4Y2JA 3GILA 1T3NA 4P0QB 1TVAA 3C6TA 4ZIVA 1HYZA 1N34K 3W3DA 3CD7A 2M4MA 2CQ2A 4Y6IA 2HSZA 4JI2F 3G96A 1ZJNA 3K0JA 5DJBA 4JKGA 2C3MA 4ZMMA 4FSVA 3IS9A 3I0SB 3HHLD 4DLGA 2FLPA 1KKHA 1HNZF 4GC7A 4ED3A 4CTAB 3CCES 1DY3A 4JEPA 3OLAA 2AW0A 1FK9A 4KV8B 3SUQA 3OR2A 3M6UA 3PRDA 4Z94A 3PY8A 3ZTRA 4RW4A 1M5HA 3EGZA 1OVYA 1VQLS 2K2PA 3AEVA 1WC3A 1WF0A 3PJXA 1JJ2M 1NSAA 2P9KB 5GTHU 3SMVA 3BSOA 2XY5A 2G0IA 3PX6A 2AIRB 1HQUB 4JI6J 3R5DA 1AB8A 4IOCQ 2O1PA 3A8JA 3J81U 2SXLA 4QZAA 3MECA 3ULDA 1U1NA 2KJWA 2RB7A 1XEZA 3HSGA 2G08A 3CTRA 2LKYA 4X4VA 4G1QB 4YY3K 4X64K 4PQUB 4ED7A 2AWZA 4NLWA 1FTRA 3QDKA 1ZAXA 3QMQA 1AZSA 3BKFA 1ZOLA 5J2QA 4CD3A 8ICTA 4IBNA 2B4OA 3M7DA 2WF7A 1EIYB 4ZLJA 3ZSVA 1VQ9N 3WNHA 2BHNA 4O4GA 2MQNA 3K59A 2IVMA 2Q66A 2IMOA 9ICMA 4J2BA 3S3MA 4AM7A 3T6BA 5C42A 3Q2TC 1T9TA 4NLTA 4M42A 1VSMA 1FRHA 1RWXB 1X9MA 2YHXA 4AT1B 3FQKA 4DR2J 2Y1RI 2XO7A 1N2XA 1BMQB 2H54B 1YITN 3MWBA 3R1HA 3OYIA 2NXEA 2CVEA 4WP3A 4IJNA 2F4VF 1RHUB 2D9PA 2ZC3A 1Z1VA 3H90A 2W01A 2ZQBA 1G15A 1R0BG 3UE5A 3MPUB 3BBBA 1GLBG 3PMNA 3C2KA 2MUTB 4EBEA 4PWDA 4BRQA 1J5EK 1I3AA 4OZJA 4USMA 3GV5B 2G1HA 3CXCR 4FPIA 4FJIA 3EICA 4L6V3 2BE2B 5FP0A 3K9KA 2VFSA 2K06A 2P6UA 3WXKA 1FNXH 2G07A 1L3VA 1RT5B 2HNDA 1TK5A 3DDKA 3UN2A 2K7KA 1N33K 1M5SA 2GHWA 1CULB 3AO4A 4CLYA 4Y1DA 2ZH6A 5EXWA 2OANA 3A3NB 1M5OC 1LW2B 4BC9A 2V0NA 4FLZA 4FKXA 1S7HA 3LAMA 1RWKB 5HATA 4ZVEA 3P45B 3I4PA 1FRMA 2D0BA 4X66K 5J2AA 2KFZA 3O4QA 5B66U 3VA3A 2GGPA 3AA4A 3R97A 3ZT1A 2GUPA 2JJ4D 4I68A 3IAM9 4KO0A 3TNVA 8ICVA 4JI4F 3LPUA 4IRCA 2Y3YA 3DI6A 1SPBP 1C4AA 1SIJA 1UPHA 3T5HA 1D9AA 3IBPA 3A4TA 2H5XA 1VBXA 1BLUA 3MMBA 4PG8A 2LQBA 3UPFA 2J9DE 1HNWK 3L4BC 4CJ3A 4LF7J 3MMCA 3A8KA 2HLUA 4MK8A 3KLVA 2RS8A 2YI1A 3OVSA 3Q8QB 3AARA 4CM0A 2ISOA 1REVB 2KRRA 2L08A 5J1PA 3R6MA 2I9SA 4A4JA 2W04A 1HJPA 1FDBA 3DLHA 1N61A 4CJRA 2VKQA 1IKYB 1DBDA 5KFAA 3GB0A 3MZIA 2PXIA 4QWBA 4Y2RA 4TKTA 3MR3A 2E8NA 1JNRB 4O4RA 3C1ZA 1ULRA 3UMCA 2H3GX 1SJ4P 2XSJB 1JROA 3QIPB 3M30B 3ISNC 4LSZB 1X6IA 2NSBA 4DR3J 1QZ6A 3CQ8A 2OPSB 2WONB 1HWKA 3EUB2 3B78A 2HB5A 4L8RB 4FJGA 3HZ6A 3FAHA 1GEHA 3N6MA 2BCVA 4DPOA 2BANA 4YNQA 3P4IA 2ZH1A 3HSCA 3C66A 1SZPA 5A8WA 5HVFA 4YR0A 2VODA 2PFDA 5BYRA 3DJCA 2Y9UA 1PSDA 5LL6Z 1VQ4N 2WVEA 2CPJA 2Z2ZA 4Y2PA 1IIPA 3VGSA 4JI3F 4DQIA 1KBUA 4DR4K 3DLKA 3B82A 4ZIWA 3VOVA 2HGMA 8ATCB 3T69A 3RSEB 3CFPA 2HFVA 3M2UA 3KLEB 2GO7A 7ICUA