1L3SA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*G)-3'
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1l3sA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1l3sA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1l3sA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1l3sA01
9ICOA 4KI4A 4HYKA 4ECYA 4FM0A 1ZBHA 2EHGA 3RJEA 4F4XA 4HCCA 2O4GA 3GFKB 3GV8B 2XRIA 2ASJA 4W5QA 5J2HA 4Z6CA 4DTRA 4F5PA 1Z00A 1ZQTA 3WNGA 3KD5E 2V4RA 1VSIA 4Q44A 4IG0A 5HROA 1XSNA 4IDKA 4M3YA 7ICGA 1NK9A 4H4OA 2HMIA 2BQRA 1QSLA 1BPXA 3CG7A 8ICHA 1ASUA 4DOCA 3ORYA 1IXRA 3K5OA 4F8RA 3HT3A 3ZT2A 2D0AA 3VQEA 1DGSA 3RR8A 2VG5A 3ZT1A 2GUIA 4GXKA 2B5JA 2RF2A 4O5BA 4FJKA 8ICZA 4YD2A 3B0XA 4KHWA 5KG0A 4I2JA 2W8LA 1A76A 2F1JA 1IKXA 3PUFA 3VQAA 3NH0A 3GIKA 8ICIA 3AO4A 3AVAA 9ICTA 1RT1A 3CM6A 5HNKA 7ICRA 1L3TA 3DLBA 3PX4A 3OYDA 3NH2A 4RZRA 4UB5A 4DL6A 1FKPA 5J0YA 1RXVA 1C0UA 4CK1A 4FK2A 4F5QA 3MFIA 3D45A 1Q9XA 3RTVA 2PFOA 1N5YA 3AUOA 2JEJA 4KMUA 4NYFA 1TVAA 4K8XA 5DDMA 2QKBA 1WN7A 3VQ7A 3DRRA 3TANA 2XCAA 5DBCA 3V6HA 1GOCA 2ZQBA 1WSFA 4I9QA 3M8QA 3VQCA 1JL2A 4FJ9A 1RTIA 2X78A 5IIOA 5L9XA 1X9WA 2R8IA 1V9PA 3ZDAA 2MAXA 3ZT4A 1FXXA 4F4KA 2OA8A 2JLEA 2PFPA 1IG9A 2HHXA 3OSPA 3V6DA 2F96A 1VSKA 4KLMA 1LW0A 4Z6EA 5C42A 2Q0ZX 1Q8IA 4JRPA 4FK4A 5KFKA 1MSWD 1S9EA 3IHQB 2KW4A 2DY4A 1UWBA 1ZBFA 4UAZA 4CJKA 5KFFA 2JEIA 1YT3A 4FO6A 5CY4A 4BXOB 1KSPA 5SZTA 3HPOA 4YNQA 1NJYA 4OKEA 3HWTA 3KK1A 2FLNA 2FC0A 1JLBA 3EWAA 4O5KA 4RQ3A 4FZXC 9ICUA 2Y1JA 2ISPA 2OWOA 3SUNA 4UB3A 4E7JA 3L2RA 4IQUA 3GIIA 2RKIA 8ICVA 4DTJA 3SI8A 4RQ6A 4L8RB 5KFRA 5HP4A 1VSLA 4DFJA 2ZTCA 1CUKA 4EZ9A 4QZBA 1IM4A 7ICSA 3A2FA 3K58A 4XUSA 2BGGA 3RH5A 1N48A 1X1PA 5J0RA 1ZQLA 2RDJA 3ZDDA 4EZ6A 4NCAA 5KFPA 4ZTJA 1H38A 5KFCA 2BCQA 4DSIA 1WNSA 3D0PA 4N41A 2P66A 1RT3A 1BQMA 3QEIA 1JX4A 3NDKA 2ALZA 2E4LA 1L3VA 2BCSA 2O4IA 3RMDA 1BPBA 4PGXA 1NK4A 1IH7A 8ICXA 4YVZA 2PYJA 7ICQA 4FM1A 5KT4A 4UAWA 5J2PA 2GV9A 3KTQA 4AHRA 4FJXA 3H40A 3V9ZA 4CHNA 4M9GA 3VQPA 3V9WA 3C2MA 4DFMA 4ECQA 3CM5A 2B21A 1KTQA 1L3SA 4FW2A 2G8VA 4O55A 1ZQPA 5KFAA 3ZSVA 3O4QA 1REVA 3NTUA 1FK9A 3T5KA 5KFEA 2OPRA 4J9LA 5KG5A 3PO4A 3MEDA 4CGFA 4ICLA 3KHHA 4PHAA 3AVMA 4CIEA 4DFKA 3QERA 4NLKA 2QXFA 4IQVA 4IRKA 3LK9A 2NRTA 4PY5A 2FPKA 2AGOA 2BCVA 3JPOA 3V1QA 3H8WA 9ICCA 4NXZA 3BQTA 3RMBA 3E01A 3UXPA 3MAQA 3Q8KA 3U6FA 4QWCA 4KTZA 3H8SA 3RH4A 4X5VA 5C24A 2JEGA 3V81A 5K14A 2A1SA 3CFRA 4TQRA 1VSFA 2ZD1A 3S3OA 3RBEA 3AVLA 8ICMA 4DS5A 4LH5A 2F8SA 1RT2A 1R0AA 2G8IA 4RQ0A 3JPRA 5CYMA 1HNVA 4O3OA 4DSEA 3GILA 3SQ4A 4RW7A 3RH6A 4CF2A 5J2JA 4J2EA 5HRNA 3HYFA 5BOLA 2ATQA 5HHIA 3SQ1A 7ICJA 5KG6A 2G8HA 3MR5A 2FPMA 4W5OA 1MC8A 5HMMA 1HUZA 3P83D 3MGHA 1TK0A 3AVIA 1BGXT 1MQ3A 4RG8A 4K8ZA 2FBTA 3K5NA 1SL1A 2PYLA 3V9SA 5C25A 1EXNA 4KFBA 4Z4HA 1J53A 3L8BA 3OS2A 3ZDEA 4F4WA 2OZMA 4Z4FA 3EPGA 4KLLA 3DOLA 1ZQJA 4TUPA 4FJLA 1KFDA 4ZHRA 1ZQOA 3LDAA 2LYHA 4QZFA 4BWJA 1T03A 5KG2A 3NH1A 3ZSZA 3QETA 5J2AA 4B9NA 1JKHA 2XCPA 3WNFA 4UQGA 2VA8A 1TVRA 3SYZA 4HUFA 2JZBA 2KFNA 4J2AA 1CLQA 4KLDA 3B6OA 3T19A 3L2QA 5J2MA 3TAPA 2F1HA 1S0MA 4ECZA 1JLQA 2C2DA 4CIFA 2X6NA 1NK7A 2PFQA 1CXQA 3KLHA 2ZJ5A 1J54A 4Q0BA 4CFBA 4M04A 4IQTA 1NKCA 4KITB 4I29A 2C22A 5KFQA 5DMRA 3OYLA 4FJGA 4CHOA 2H5XA 3AO2A 1BPZA 3EYZA 2ASLA 2HVHA 4KTWA 5J0UA 3DLRA 1TV6A 1VSDA 3SQ0A 5FRNA 2KZ3A 4I2PA 7ICTA 2FMSA 2BPGA 4OKKA 5L1IA 4FXDA 4KLGA 4FLXA 5KT6A 4RW4A 9ICEA 1RT5A 3OYBA 2IHNA 3WNHA 3SI6A 2R7YA 4O3QA 2JEFA 4R63A 2YKNA 4FS2A 1U48A 5IIMA 3SJJA 2FBYA 5DB9A 5KFVA 3WNEA 4J9PA 4YG2A 4CCHA 3MXIA 4RQ2A 3VQ9A 2NRWA 5DQIA 2DFEA 1O1WA 1U49A 4M9LA 3JPQA 3ZT0A 1N6QA 5HLFA 1TAUA 4M3RA 4Z4CA 3ISCA 4B9UA 4ECTA 5KFSA 1I39A 4E1NA 5F9LA 2ZTDA 4F5RA 1EXQA 4EP4A 4UB4A 5HP1A 4MF2A 4EBEA 1RT7A 1DTQA 4ECVA 3UXNA 3K5MA 1ZQYA 3V7KA 4MF8A 4CEAA 3C2KA 3M9NB 4QOZB 3MR6A 3P1GA 3SPYA 5KFJA 3GV5B 4RUCA 3SUOA 3TQ1A 4KLSA 5EOZA 3AVNA 5DG8A 4M45A 3SQ2A 4IFYA 5EWEA 4GXJA 2XHBA 2VWJA 1NOZA 3OYGA 3LPTA 4JLHA 2A1RA 2ZUBA 4FJJA 4Z6FA 5KFHA 3QZ7A 3BGRA 1RNHA 1A5VA 4CIGA 8ICAA 5HRRA 4FVMA 1RYSA 4F4YA 1A77A 4ID1A 3LP1A 4FLTA 3TWHA 5KFTA 1BISA 3PMNA 2RN2A 1AROP 3T5HA 3SNNA 2HHVA 8ICQA 2D0CA 3S3NA 1KCFA 2HVIA 2ITGA 1S0OA 3ZCMA 2BE2A 1W0HA 4R64A 1BI4B 2AGPA 3RB4A 2PI4A 3SPZA 5J0XA 1RYRA 1K1SA 4PH5A 4DEZA 2AJQA 5HRPA 4KV8A 1J5OA 4CHYA 4TUQA 3RB3A 1C0MA 1RTJA 4F5NA 4QZ9A 1RTDA 4HHTA 1QLNA 2BCUA 3GDXA 2VG6A 2X74A 4W5NA 1EP4A 1RCHA 2P1JA 2HNYA 4I2CA 1S10A 3S9HA 2IMWP 4KPYA 1QTMA 5CB1A 3HM9A 1X9MA 1TL3A 1RDDA 1S1XA 1ASVA 3PW4A 4DTMA 4QZ8A 5KFDA 1NK0A 2FBVA 2V9WA 1RBUA 4YD1A 1S9FA 1CXUA 3V6JA 3NCIA 1HQUA 4PHPA 3VQQA 1B9DA 4R66A 4I2FA 4DSJA 4O5CA 4FK0A 4KKOA 4UBCA 3QNOA 5C5JA 2J6TA 3MECA 4J9OA 4CF9A 1ZQAA 3OYEA 1S1TA 4ECRA 1KVCA 5KFIA 4EBCA 3PVXA 3PY8A 2IS3A 4E7KA 4CJSA 3JPNA 4CK2A 3UIQA 2J6UA 5J0SA 8ICPA 4CJ3A 4HUEA 1BIZA 5IILA 5KG3A 1ZYQA 4DSLA 9ICPA 4CGHA 4I2HA 5KFYA 1U47A 1BL3A 4TSXA 1HYZA 1RPLA 2Q3SA 4XIUA 4R5PA 4QW9A 1J9AA 3O4NA 4DL3A 4CK3A 9ICMA 3LALA 1RXWA 3QEPA 1TAQA 4CGJA 3ETLA 1NKEA 9ICXA 4M47A 1KFTA 3LP0A 3OHBA 8ICYA 4AH9A 5KG7A 3G6XA 1HMVA 3ZSQA 5CR0A 2EX3A 4OPJA 3IM1A 4NLZA 5I42A 5J2GA 4F93B 3SZ2A 5DG7A 4LD0A 4RQ4A 9ICBA 4DQRA 3CQ8A 1JIHA 4KHYA 5KFUA 8ICWA 5FROA 4DMNA 3QESA 3CYMA 7ICPA 1WSEA 2HNZA 3MFHA 2OPQA 3TABA 2BKEA 5J2IA 5KFLA 4RW9A 1TKDA 1MQ2A 1SUQA 3MXMA 4ED1A 4EBDA 2PFNA 4QWAA 4IRCA 2YNHA 4F92B 3OS1A 4CGGA 5D4BA 2IGIA 8ICNA 1UOCA 3OYNA 4G3IA 3NF9A 1YTAA 1HQEA 2P5GA 4MFFA 3QEVA 8ICJA 4LSNA 1SKSA 2DFFA 4E3SA 4WE1A 4B9MA 4BDYA 4C8NA 2W9BA 2I1QA 4M3WA 4YR0A 4Y1CA 1EETA 3OY9A 4BACA 4FLYA 1TV9A 3ALYA 3FFIA 4UBBA 4LH4A 1SZPA 2P5OA 2BR0A 4BE1A 4CERA 2YHBA 3NE6A 2JGUA 1NJZA 4DG1A 5DBAA 2QKKA 4F3OA 7ICUA 2G8FA 4M41A 5J1EA 9ICHA 1K1QA 4OJRA 9ICKA 4C8KA 4E19A 5DB8A 4NCBA 1GOBA 4CJTA 2W9CA 4ZTFA 4YR3A 5CZ1A 5DB6A 4FJ8A 3GQCA 4CJRA 5DQHA 4YMMA 4DQQA 3UXOA 3DMJA 4W5TA 3QO9A 4FJMA 2KZMA 2I9GA 3ZSWA 4CJ5A 5KFXA 5KGWA 3DRPA 4BWMA 3QIPA 4GXIA 1T8EA 4B8AB 1C1AA 1LWFA 3HVTA 8ICUA 3VQDA 2A1JA 4CEFA 4RW6A 5D3GA 4DU4A 3MR2A 2WONA 5KFNA 1WSIA 3ZSOA 3GIMA 9ICWA 1TGOA 4M3UA 2KQ2A 4JV1A 3F73A 3UPQA 4B9SA 4CJPA 3L2WA 1LWCA 4KHSA 4GC7A 4M2YA 2BPFA 3HPGA 4FJHA 1HYVA 2VWKA 3TAGA 4B3OA 3RJJA 4ZH4A 1U45A 1ZQKA 4J2BA 3HL8A 4N76A 5KFZA 3EW9A 4AILC 3KKRA 5KG4A 3T1AA 4ECSA 4DU1A 4IKFA 2YKMA 4DF4A 3HP6A 8ICRA 4YXMA 5DB7A 4E89A 3TARA 2C2EA 2W8KA 4JV2A 4Z0UA 3HX0A 4F2RA 1CZBA 4HVJA 4PQUA 1S9GA 3BQ1A 3L2UA 3RMAA 4O3NA 4I2DA 3K75D 4RQ5A 4YFUA 5CWRA 1K6YA 2OPSA 3NGZA 7ICEA 4ELUA 1CZ9A 4ED2A 1DOQA 1RBRA 3QIOA 4CFCA 3JPSA 1RZTA 5J0QA 1D9FA 2DFLA 3KLGA 1Z3EB 4LZGA 3OYJA 1RBTA 2QK9A 3HK2A 3TI0A 3AO1A 2KTQA 3ITHA 7ICLA 4GMJB 4FLWA 1BCOA 3Q8RB 5J0TA 2YHAA 1RDCA 2D5RA 5KT5A 3QEWA 9ICNA 5HRSA 9ICVA 1SV5A 5FRMA 3RB6A 3FDSA 4JV0A 3IG1A 4J9SA 4P4PA 4F91B 3V72A 2PI5A 2Z1IA 4DS4A 4C8LA 4E0DA 4CEZA 4PA1A 5CA7A 5J0WA 4CJWA 4FLVA 3MR3A 3EZ5A 3T5LA 4IR1A 3AVGA 2AGQA 1VSHA 3KHRA 7ICHA 3RAXA 4NY8A 3VQ8A 3MDAA 3VQ6A 9ICIA 3G6VA 1S6PA 3ZSRA 4OGEA 3OS0A 5J2EA 1C0TA 4M3TA 3DLKA 3AA5X 8ICGA 3LAMA 3EPIA 2W9AA 2R8HA 4DTUA 1ZQFA 3UQ0A 1ZBIA 4B9VA 4CFDA 4UAYA 3K2PA 1LAVA 1T05A 1JLCA 1WSGA 4KLFA 4JK1A 4CJQA 5KT3A 1XHZA 1QQCA 5J2QA 4CHZA 3DRSA 7ICOA 4EEYA 3C2LA 2HHQA 3P5JA 2IOCA 3OYMA 2G8UA 3C1YA 2NRZA 9ICAA 3C94A 1B43A 2XGPA 2NRXA 3SUQA 4IG3A 3LP2A 1VSEA 4NM1A 1VRTA 3QNNA 1D9DA 1RILA 1GOAA 3RMCA 1B22A 3LPUA 2IBKA 4TURA 4J9RA 5J2FA 4EYIB 5HMLA 4Z4IA 3OYKA 1N56A 4J9KA 5CHGA 3RBDA 4FZYA 1KFSA 1BPYA 1QSSA 3AVBA 1XS9D 4Q8EA 3TAMA 3MDCA 2RPIA 2P6RA 4ED3A 4AHCA 1ZQCA 1IKYA 2UVRA 2G8WA 3L3UA 2VG7A 4YFKA 2RDIA 5KFGA 4EYHB 7ICKA 4KHUA 4AHTA 1CEZA 3N97B 1S6QA 1WSHA 1LW2A 4O3RA 1W9HA 1BQNA 8ICFA 2J6SA 1F21A 8ICLA 1QSYA 3THVA 1NOMA 1UA1A 3OJSA 3H7IA 3AVFA 4AHSA 1BCMA 1I3AA 4RNOA 3QEXA 2ZE2A 1ZQMA 4Y1DA 1HYSA 5KGXA 4RT3A 3HPHA 4RNNA 4KLHA 5DQGA 5E41A 3AVHA 4DQSA 3OYHA 1EX4A 4C8MA 4ID5A 3LZJA 3QINA 1ZQGA 1C6VA 1DTTA 2MUTA 5J0OA 1B9FA 5J2DA 4KAZA 3QE9Y 4BE2A 3AVKA 2NUBA 1A5XA 3VN5A 4QWDA 9ICFA 3C95A 4QZEA 3C23A 3V6KA 2P51A 3MGIA 1WCNA 4KTQA 5L1KA 5D46A 4RNMA 4DFPA 4JS4A 3JYTA 1RDBA 2P6UA 3ULDA 3HVRA 4DLEA 4TUSA 2FLLA 4Q45A 3K59A 1S77D 3B0YA 3HW8A 1HRHA 1U04A 4QZCA 3PW2A 4MFAA 1L3UA 3U3GA 4CJUA 3IRXA 4I2QA 1S0NA 2FPLA 4LVSA 3DI6A 2W9BB 2XGQA 4ECWA 1T3NA 4F5OA 2PXIA 4I2AA 3TR8A 5J2NA 4I2GA 1S97A 4I2IA 5L1LA 2IC3A 1S1WA 1WAFA 4UB1A 3BDPA 4NYNA 1JLAA 3UQ2A 1LWEA 4BGDA 4O0IA 4B9LA 1ZQEA 3S3MA 3DOKA 3KJVA 3VA0A 4P4MA 4CE9A 4M9JA 1T7PA 3NF7A 3V4IA 2JZBB 1JMSA 4I2EA 4KLQA 4CJLA 3NF8A 4R8UA 5F9NA 4M0AA 4QZHA 4MFBA 2BQ3A 2W9MA 3F9KA 2HNDA 2ZJ8A 4K4HA 5DBBA 3H4BA 4CHPA 4KN4A 1TK5A 2R8KA 2FMPA 2X6SA 1ASWA 3V1RA 4ED7A 3ZDCA 1IKVA 3KKSA 1XU4A 1RDAA 4ECUA 4C8OA 1Z26A 1NK6A 5J2KA 1JN3A 4P4OA 3OYIA 3B6PA 1KLMA 2OZSA 3OYFA 4RW8A 5KI6A 3NGDA 4JS5A 2D0BA 5KT7A 4H8KA 2YNGA 4YXJA 4JWNA 1XHXA 4DL5A 2ATLA 4DOBA 5DG9A 2XO7A 1NJWA 5HHHA 2B4JA 5DGBA 4GW6A 2HHUA 2NRVA 3KHLA 4PUOA 3LANA 5I3UA 1Z00B 4CEEA 4KREA 1HJRA 3PX6A 1VRUA 4OLAA 1ZQIA 2OYQA 1ZBLA 3BQ0A 4DWIA 4DL2A 3V7JA 2AU0A 8ICBA 4QCLA 4YQWA 4F3TA 4FBUA 4IBNA 4R65A 4DQIA 4CEDA 4DTPA 4I27A 1JLFA 2BPCA 4HTUA 1ZQXA 4PPXA 2Z1GA 4CECA 1XSLA 1B92A 3L2VA 3M8SA 4GC6A 3MEGA 3C6TA 4NM2A 4YP3A 4QWEA 4OGCA 3NBPA 5IINA 1TKXA 4FM2A 4JRQA 1C7YA 3Q8SB 5CYQA 3N4MB 2VA2A 9ICQA 2I5JA 3AV9A 3RJHA 1KVBA 4CFAA 2C28A 1JXBA 3Q8QB 3C5GA 2Z1HA 4XQ8A 4B8CA 3JSMA 4QZGA 3JPPA 8ICTA 1IKWA 4P2HA 3AA2A 4ED6A 4CESA 2W9CB 4O44A 4F4ZA 2C2RA 1JL1A 5D49A 1FKOA 4CGIA 4PHEA 2BANA 2KN7A 2IA6A 2YNFA 4ED0A 1TK8A 1RBSA 3I0SA 1D8LA 3K4GA 3DLEA 4M6WA 4FS1A 2ASDA 4RUAA 1XC9A 4NCGA 3RJKA 3I8DA 4FJ7A 4RPXA 3TAEA 2HW3A 1ZQHA 4KLOA 1T4GA 3M9MB 1L5UA 3JPTA 1JXEA 4J9QA 8ICEA 4CJEA 5DGAA 2PY5A 1UAXA 3DYAA 2DFHA 3E2EA 4PHDA 4QAGA 1KLNA 5FDLA 2ZUDA 3T3FA 3GV7B 3NFAA 5JS2A 3SCXA 7ICVA 2WTFA 3RAQA 4M9NA 3CFOA 1Y88A 3SV4A 8ICKA 3OYAA 1WLJA 2F1IA 4CF8A 2YV0X 1TKTA 3MBYA 1ZQDA 5EU7A 4O0JA 4Q43A 2E6MA 3GIJA 3PNCA 4CEBA 4KHQA 4ED8A 3VQBA 1XSPA 4IR9A 4HCBA 4F50A 3RRHA 1X9SA 3MEEA 1JLGA 2UVUA 2HHSA 1TKZA 2W42A 2R8JA 4M6WB 3CFPA 3NGIA 4OPKA 4H4MA 1RTHA 4J9MA 1LV5A 5KRSA 1NK8A 3HSTB 4FYDA 4O3PA 4E7LA 5CP2A 1JXLA 4DTXA 2ZUCA 2G8KA 4K4IA 1ZQUA 3RJFA 8ICSA 3AO5A 4CJFA 4M3ZA 1ZJNA 3H8JA 4TQSA 5KFMA 5CZ2A 3O3GA 3VQ5A 5IIKA 3TFRA 3M8PA 4FBTA 4DSKA 1SKWA 3V9UA 1YTUA 4FJNA 1RBVA 3Q8LA 4G1QA 5BOMA 5JUMA 1S1UA 5TZVA 2MUTB 1QS4A 5IIJA 3ZSYA 1A5WA 2FBXA 3IS9A 3M8RA 4MFCA 3HP9A 2YNIA 3G6YA 3O3FA 8ICCA 3H08A 5EWGA 4BDZA 5L1JA 3AO3A 3V9XA 4KLTA 1ZBUA 5KT2A 4KB1A 3RR7A 4DTNA 3RB0A 3VA3A 2OPPA 1U4BA 4YN4A 3AA4A 3KIOA 4PWDA 3O3HA 4O3SA 4CGDA 2DPJA 3QEBZ 2V4QA 2IDOA 4ECXA 5SWMA 2XC9A 4DLGA 4DF8A 4Z4EA 3C21A 1HPZA 4Q5VA 3HJFA 1LB2B 1C1CA 1IO2A 4Z4GA 4CEQA 1MU2A 4DOAA 4N47A 1QHTA 3IAYA 3PR5B 3KLEA 4F2SA 2HHTA 2A1JB 1Z25A 4MEXA 4CJ4A 1VSJA 4DTSA 3LZIA 9ICJA 1JLEA 2BGWA 1NOYA 3HO1A 5T7BA 1S0VA 2ETJA 3KK2A 1X2IA 4FJ5A 4RQ1A 3C5FA 1Y97A 3Q8PB 4N5SA 5KRTA 1ITGA 4BXOA 5KTQA 3PR4A 3AA3A 4KRFA 2UVVA 4FLUA 3PW5A 3OVNA 3M9OB 2IAJA 4I7FA 1COOA 2HHWA 1ZQWA 4M9HA 4YMOA 5HBMA 2ZJAA 4RPYA 4KHNA 4UB2A 2R8GA 1ZQSA 3G10A 4QZAA 4FW1A 1WCLA 1NJXA 4JUZA 7ICFA 9ICSA 4FJIA 4RQ8A 1ZQZA 3KLFA 1SKRA 3NHGA 2BQUA 3RJIA 3DLHA 3H4DA 3K57A 4E7HA 1SL0A 1ZETA 1ZJMA 4RPZA 4J9NA 1BHLA 4AHUA 4QWBA 4QW8A 1WSJA 2XY6A 4M3XA 3ZDBA 2E6LA 2LSNA 5KG1A 5J2CA 4CF0A 3DLGA 4Q8FA 7ICNA 3PMLA 2VA3A 3MXJA 3NGYA 1XO1A 3OHAA 3FYHA 2AQ4A 2GWSA 3ISDA 4O9MA 4XA5A 4ELVA 3KK3A 1BVSA 7ICMA 2BDPA 4FCYA 1BPEA 2DPIA 4MQ3A 1C1BA 1EKEA 1DLOA 4O5EA 4HUGA 7ICIA 3OYCA 3OSNA 4GLXA 3RRGA 1XWLA 3QEAZ 4OKJA 1S76D 1HJPA 2ZTEA 3V1OA 3SV3A 4I28A 3DM2A 2VANA 4BE0A 5BPCA 1TL1A 3TFSA 1S1VA 3K5LA 1VK0A 2XY8A 4LZDA 2AQ0A 2BHNA 3C1ZA 3MABA 5DKWA 3ZD8A 1NKBA 2XY7A 5DLGA 3LWLA 1YVUA 4CHQA 4LSLA 5DLFA 3OGUA 4KI6A 3PO5A 4Z6DA 3ISNC 4PGQA 5J29A 3AVCA 1Q9YA 4OVLA 4J2DA 4YCXA 3Q8MA 4RT2A 2Y1IA 1ZQRA 3RJGA 4KLIA 2UVWA 3AU6A 5KFOA 1UA0A 5J0PA 3AVJA 4R8UB 3C6UA 4B08A 1D5AA 4RQ7A 2PZSA 3KD1E 1ZQVA 4MEYA 2M9NA 4FZZA 5KFBA 4IFVA 4IRDA 3BQ2A 2XY5A 1RT6A 3LAKA 3ZSXA 4E7IA 1UT5A 3U3YA 1ZQBA 4GVMA 4OLBA 4FLZA 3ISBA 3AU2A 3PX0A 1VSMA 1WAJA 3KLIA 4XRHA 3PW7A 9ICRA 2BCRA 3HXMA 3LWMA 1KDHA 4NLGA 1S5JA 2ISOA 4B9TA 2GBZA 4DTOA 2HB5A 4CJVA 1TFRA 9ICLA 3ZD9A 2FMQA 3OJUA 4YMNA 1G15A 4KO0A 3KHGA 4LY7A 1RT4A 4KLUA 4K4GA 4DL4A 4KLJA 4BDPA 5J2BA 3TAQA 4KLEA 3VQ4A 4KB0A 3V7LA 3ASMA 5EWFA 1KRPA 4ELTA 9ICGA 3NF6A 2KZZA 3EY1A 2B6AA 3LDSA 3PW0A 1D8YA 2F8TA 4W5RA 8ICOA 4O4GA 5JS1A 3QLHA 1U9LA 4QZDA 3RWUA 1HUOA 4DSFA 1KVAA 4I2BA 5IIIA 5KFWA 4YR2A 4RU9A 4EP5A 1BIUA 2DTUA 3G0ZA 2WOMA 3PV8A 3TAFA 5CJ7A 4CEOA 4DL7A 4JWMA 1BPDA 1UT8A 3L3VA 1XI1A 3SUPA 1KEJA 4QZIA 2FLPA 3T5JA 1PZNA 4I9LA 4DO9A 4DQPA 3ZT3A 4M42A 1ZQQA 1NK5A 1ZQNA 3BJYA 4N56A 4NLNA 4KN7A 1BI4A 4IQWA 1HNIA 4DU3A 2Z1JA 3NAEA 3LP3A 2KFZA 3I0RA 4CF1A 4E1MA 5DK5A 1LAWA 1SL2A 5DDYA 2IHMA 4PGYA 1QE1A 4AHVA 3QZ8A
chains in the Genus database with same CATH superfamily
4HYKA 4ECYA 3L7PA 3RJEA 3R2DJ 2A0FB 2O4GA 4F71A 3GV8B 4BHQA 2P8IA 3UKUA 4W5QA 4Z6CA 1KAZA 2PN6A 4NXNK 1Z00A 1FE0A 2V50A 3WNGA 3H3OB 4QR1A 4Q44A 2MKKA 2YQEA 1NK9A 3HFKA 3RJMB 4UT4A 2N82B 4K4VA 3DLEB 1NGHA 4BC3A 3L4QA 1HBNB 2M0GB 3ORYA 4K50A 4IEIA 2IDLA 5E3PA 1IXRA 4WZMA 1U2CA 2D0AA 3QATA 1DGSA 1N62A 3RR8A 3OR1B 4O5BA 1TUUA 8ICZA 5IZHA 1HLUA 5ETQA 4I6MB 4KBOA 1M1KT 3UCGA 4WP8A 4WFBL 2MKJA 2W8LA 3F2CA 1PJ6A 1A76A 2F1JA 2MSNA 2QLBB 1RU1A 2YMLA 4BR2A 2KHOA 4L3NA 4HTJA 2YWHA 4B3RF 1IXKA 2RU3A 1L3TA 3NNAA 2M5YA 3VHQA 2UP1A 3THTA 5K8MA 4RZRA 2LCWA 1XQSC 2V9KA 5BREA 1F9FA 3NCQA 4JOUA 3D45A 1N5YA 1N52B 3HSGA 2BJ1A 2B9XA 3VGSA 5DDMA 3KG4A 1LCUA 1WN7A 1KBRA 3TANA 2HLUA 4JI8J 2FJAB 4H4MB 1S12A 4GMKA 2ZQBA 1NSPA 3CXCR 3M6XA 4I9QA 3DRPB 2WVBA 3AQFA 2X1FA 4X64F 3ZDAA 3IFEA 1NGEA 3BYPA 2HAIA 3I4PA 2WBRA 4F4KA 3TUJC 2JLEA 2B4UA 2PFPA 2V2ZA 5IFMA 1IG9A 4NEZA 3QDKA 1VSKA 3DKDA 2E29A 1Q8IA 2LFVA 3H5XA 3CP8A 2BZ2A 3IHQB 1SXLA 4ZHRB 3UVJB 2QA4G 5ALOA 1ZBFA 3OTOF 4JI2K 1NLVA 2QN6B 2JEIA 3T1HK 1ZD3A 3R6LB 1FEHA 4KX5A 1KSPA 3QBXA 2XMUA 3DGPA 5LSOA 2HBJA 2M2BA 1M5HA 2A10A 3EZOA 2FC0A 1NB2A 3CT9A 1RDUA 4CO5A 2YPZA 2EAOA 2NQPA 3SBTA 4K41A 2X51A 4P71A 3L2RA 4E7JA 2DRAA 1S1XB 1UVKA 1B7FA 4FZNA 2RKIA 5SUHA 4PYAA 3MX2A 5LY3A 5HP4A 3WK6A 4DFJA 5F0UA 2YMPA 4EZ9A 3NL0A 4HTLA 4IXCA 4KY3A 4QZBA 2KEYA 1HUXA 1ZM3A 5CQGA 4OFZA 5IC4B 1R43A 3RH5A 1N48A 1B3TA 1ZQLA 2NLWA 4NCAA 4C3KA 5C42B 4DV0F 5C2GA 4DSIA 3D0PA 2P66A 1RT3A 2GV1A 3SBGA 3TW0A 2FJBB 1HBUA 1JLAB 1LWEB 2QV6A 1L3VA 2O4IA 2RQMA 3BQ7A 3RMDA 3POTB 8ICXA 1FDNA 4IDHA 2VBXA 3ONQA 5HI7A 3FSYA 1EP4B 5AZJA 2Z2ZA 4FWOA 2UUAF 3GCXP 1E4FT 3T1YK 2ZIWA 2EK1A 4FJXA 3H40A 3G87A 4L3QA 2Q1LA 4ISGA 3EICA 1KTQA 1L3SA 1EQMA 4TKTA 5AKYA 2NZTA 4O55A 3D1OA 1CI4A 2EKNA 5IT9U 5A8RB 2FSNA 3V4MA 3NTUA 3NVVA 3BSAA 2JC0A 3PYGA 1HX1A 5ALIA 3HKWA 4PHAA 1SJ1A 1AZSA 4I6MA 4AYBD 2GX9A 4CIEA 3DV9A 3QERA 2HK3A 3TX0A 3H8YA 1X4FA 3C15B 1M1GA 2GJFA 3LK9A 4OZLA 2NUHA 2AGOA 3KZIU 1HHTP 3H8WA 4NXZA 2OTJN 3E01A 3Q8KA 1BU6O 2HQDA 1TTHB 2VU5A 2JEGA 4OV6A 1N36F 3AXKA 4K5RA 2CQPA 2HF3A 2EDUA 3OVSA 3O08A 3RBEA 3AVLA 3BF1A 3PACA 3WEEA 2RRBA 2IFXA 2V69A 4RQ0A 4NL5A 1QQ7A 5IC6B 4DPYA 3KZXA 2Q3PA 4DSEA 3GILA 3OXFA 1VQPN 5J2JA 5HRNA 1OY9A 2YB1A 3HYFA 2HFOA 2ATQA 3AL0B 4AM7A 3IR7B 2N4CA 5HHIA 2H3GX 2FPMA 4W5OA 3T79A 1D4XA 3MGHA 4C9DA 3I5CA 5HOOA 2UYTA 1SL1A 4Z4HA 3J81O 2OZMA 3RU0A 3L3CA 4KLLA 2HS0A 3DOLA 3FFIB 3TEHB 4TUPA 4MDAA 2RHFA 4LFBF 1RGIA 1FTCA 3N9UC 2CG4A 4ZHRA 1ZQOA 2QMWA 1N0UA 2OIHA 2LEBA 1F5AA 1T03A 5KG2A 3ZSZA 2B4PA 3QETA 5J2AA 2H51B 1XR6A 4ANDA 4UQGA 1SVDA 5DJBA 2HS3A 3SYZA 5KQ8A 4X62K 2LEAA 2JZBA 3M2UB 3BSNA 5AQZA 5BRHA 3QPIA 4J2AA 1CLQA 2AT1B 4CZMA 2F1HA 4ECZA 4X66F 2X6NA 1VISA 4RQNA 4EO8A 1NK7A 1TL3B 1CJUA 3BN7A 2ZJ5A 4M04A 1K8KA 5B0CA 5ETSA 1HQUB 5DMRA 3OYLA 4USAA 5GINA 1FX2A 4FJGA 4CHOA 4CO4A 4A59A 3AO2A 2ADBA 5ALPA 1BPZA 5BYQA 3EYZA 2ZBRA 5J0UA 3DLRA 3N28A 1TV6A 3SQ0A 2HHPA 1J6ZA 3MM8B 2H3IA 1VQMS 4BQLA 1AUSL 1ZZNA 2P6SA 2AD9A 4BGAA 4US8A 3D7EO 1JLCB 4P7TA 2AYEA 1G1XA 2JRSA 1FEEA 3ITHB 3MURP 2KK0A 1RT5A 4PYDA 2POKA 1N54B 2C3YA 3TADC 3SI6A 3HDSA 4U7UK 2N4DA 2B0CA 4O3QA 1CULB 3OFEA 3OR2B 5IIMA 3SJJA 2FBYA 5DB9A 4IG0B 4IH7A 4K43A 3MXIA 4RQ2A 4LF1A 2NRWA 5DQIA 3VQ9A 1Y5IB 4I67A 4IEEA 4M9LA 1XMQK 3ZT0A 5HLFA 3A8KA 3ISCA 5CRXA 3ZTOA 4ECTA 3BY5A 2ZTDA 2RQKA 1JRPA 3MN6A 3BR9A 1EXQA 2I9SA 3B8AX 4UB4A 4LIWA 2EKYA 2RLTA 1YJTA 3K5MA 3V7KA 5G0RB 4CEAA 3M8PB 3SEOA 1YJ9N 3MR6A 3P1GA 4ZPWR 3EJMA 3U27A 2MMYA 1QZ6A 2P5VA 4CTAB 4L76A 3AVNA 4JB3A 2VCPA 1NMEB 3SQ2A 1NBEB 2H4WB 2XHBA 3LGNA 3FZHA 4CO2A 1BNOA 3AN1A 2ZUBA 3LP2B 2C2ZB 2IM0A 4CIGA 1A5VA 3H5UA 4DV3J 2HQ3A 4XH5A 1WSRA 3UE5A 1A77A 3LP1A 4FLTA 1NAQA 1T9YA 3PMNA 4LF8K 3A5MC 1AROP 4R25A 3T5HA 2HHVA 2HQIA 2LXIA 4ZK7M 4DUZF 1TE2A 5G5HA 2ZUGA 1VRQC 3TSPA 3IFRA 2AGPA 4WQ4C 2ASPA 3IBPA 1F44A 1DK3A 4J03A 1WG5A 3RB4A 3SPZA 1O6XA 4PH5A 4DEZA 5A8WA 3PTWA 1DRGA 6AT1B 1JJ4A 2D41A 4HHTA 2KHVA 3MGJA 2BCUA 3A0BU 4WYBA 4UW2A 1F5CA 2VG6A 2Y1LB 4XEIA 4W5NA 1RCHA 2BOAA 4OYWA 3PYDA 2OP5A 5ETVA 3FBFA 2P1JA 1WBDA 4I2CA 3U9ZA 3GSDA 4KPYA 3S9HA 3UB5A 5CB1A 1X9MA 2G06A 1TL3A 3JAMU 4B3MJ 3QWPA 5FIIA 3AY9A 3ZEUB 2RJZA 2FBVA 2V9WA 3M8QB 1RBUA 5AQWA 3LP0B 1HQUA 4RWWA 4K42A 3VQQA 1H2VZ 5BR9A 1EO1A 4R66A 2A2CA 1XNQK 1FI4A 4O5CA 3RFAA 3D6MB 1Q3UA 3JAMO 2DBBA 3G96A 4FK0A 4MKBA 4UBCA 3KG1A 2GC8A 1KEKA 5C5JA 3R5JB 1V38A 3MECA 4CF9A 1HIWA 2YWWA 1VC5A 2YJEA 4BRKA 4EBCA 5J2NB 1IQZA 1YX2A 2IS3A 4CJSA 3HT0A 1AQ6A 8ICPA 4JHDB 4CJ3A 3R27A 1S1UB 4BVPA 5KG3A 9ICPA 3D68A 1QTNB 2QKQA 3M32B 3CJSA 4DPOA 5AQMA 1UCVA 1TUGB 1U47A 1HYZA 2Q3SA 2YMQA 2DR6A 1FRLA 4CK3A 1KTVA 1HI8A 1RXWA 3SFGA 2DNMA 1RGVA 3DRRB 4CNYA 4CGJA 5TKWA 4LFBK 2ZH9A 2CQIA 2NLXA 1SI9A 1RB0A 1NPRA 1KQSR 5JLHA 3VETA 4YY3K 4NMXA 2A3JA 5D15A 1KL9A 1WACA 1WTBA 4DV6K 4CLWA 1MWQA 1CG2A 1MU2B 5DM6Q 3O3LA 2ZBIA 4OLOA 4OPJA 2CZVC 1JROA 3SZ2A 2ODGA 4K4TA 4OJHA 2XEXA 1JIHA 1A6SA 2Y0SC 1JNRB 4KHYA 5EVZA 4DMNA 3QESA 3CYMA 1S1WB 1SQKA 2HNZA 4NLSA 2VGNA 1C4AA 3QICA 2KO1A 1WELA 3TABA 2BKEA 5J2IA 1RSCA 5I3UB 1TKDA 2O8CB 5J2MB 1WTFA 2IMOA 1BUPA 4ED1A 2O8EA 4EBDA 2F8KA 1RT2B 5LT5A 2YNHA 3K9KA 3A4TA 3OS1A 5D4BA 4LRFA 3VTIA 1RWKB 1SB3C 1REVB 1S79A 1RQ0A 4NLYA 4CNQA 4J91A 4ZP7A 2ASOA 2W1BA 2KKVA 2P5GA 1LQ9A 1QM9A 2X3GA 3IKMA 4LSNA 2RQ5A 3CB4A 1BWEA 1SKSA 2DFFA 2QRRA 2FTRA 3DLKB 3CO9A 2DJWA 1WEXA 3UI3A 4M3WA 1EETA 4FLYA 1VQSA 4QJFB 4C4WA 4UBBA 2LXFA 1SZPA 2Y0SF 2Y8YA 4BE1A 4CERA 2YHBA 1NJZA 1W26A 4ZVRB 5CR4A 4YDDB 2JDJA 5J1EA 1K1QA 4E19A 5HVFA 4XDDA 3QLHB 4CJTA 5B0DA 4ZTFA 5DB6A 2DKZA 1PJ5A 4JKGA 4CJRA 4UASA 3IV6A 5KAFU 4DQQA 3UXOA 1WOSA 3DMJA 4GV6A 1YJNN 1Z2ZA 1CRXA 3ZEUA 5HJYA 4NXMF 4CH1A 1FJCA 2BXJA 1ITPA 4X4PA 3ZSWA 4CJ5A 5HR6A 3SK3A 3GIRA 1T8EA 1RWUA 4RQMA 3OUYB 1F3VA 2OMLA 3MEKA 2NO5A 4CF4A 5CXTA 3FGVA 4KC5A 4CJPA 5LJ5Y 5AKZA 2HYIB 4M5NA 4RLEA 3HPGA 4B3OA 1XN9A 1GLDG 2E5LF 2IIRA 2F8MA 5AXMA 3KJNB 5KFZA 3D6RA 3EW9A 3CETA 4V1Ak 4TLQA 4URSA 4MMOA 2ZH5A 3R1LA 3J81j 3H7HB 5IWAJ 3DDKA 3QRRA 2LMIA 4IKFA 2CGLA 1PC4A 3SIPB 3U7JA 5AJ3K 5AQKA 3TTCA 4I6YA 3G4SS 3NNCA 4JI1F 2W8KA 4JV2A 1RQLA 3CO0P 4Z0UA 1NMNA 3I96A 3HX0A 2EWHA 1A9NB 1VQ5N 4H0OA 1KQGB 1S9GA 3BQ1A 3IA0A 3RMAA 3DNCA 5E5NA 5AJ3J 1S8OA 3WC0A 1VLBA 3UMGA 4RQ5A 2GS8A 3M1VA 2H3VA 1NWKA 2Y8WA 1GXLA 3C6TB 4KFBB 4ZJQA 4ELUA 4CZIA 4ED2A 4FWSA 3G82B 3FZBA 2LMRA 3OTCA 1RADB 2NYVA 3QIOA 3VAHA 2DFLA 3UFCX 3KLGA 3OYJA 3OT9A 1RBTA 2QK9A 1VQNS 3AO1A 3IBFB 1IIPA 4RW4B 1N34J 3F9MA 3Q8RB 1RDCA 4NOHA 2J4RA 3FK4A 4QS9A 1YITN 5HRSA 2R4FA 2F3JA 2M52A 2XICA 2CPJA 3GYNA 2XI3A 5AM2A 1TUWA 4JV0A 3UDEA 3WKCA 4F91B 4C8LA 2WOMB 4CEZA 3BGRB 4PA1A 4CJWA 5LJVA 2GJ2A 1XTZA 2AGQA 1YRXA 2V8VA 3SQOP 3ULEA 2G1DA 1KOHA 2AXTU 3MDAA 2CPYA 1R31A 2VL1A 2FJWA 3LDNA 1S6PA 2K3IA 3I76A 1ZOTA 3ET6A 4BRCA 2FC9A 1C0TA 2E66A 3DLKA 1Y64A 3IRXB 3HD2A 4AQYJ 3EPIA 2W9AA 5DZ6A 2R8HA 3CJ8A 3UQ0A 1JNZB 2YY6A 4BRQA 3AXMA 4UAYA 3Q8VA 3KD3A 1T05A 1WSGA 4KLFA 4BRMA 3BGLA 2KIVA 1RAEB 2G1HA 2Q36A 1FJGF 4U7UD 3S6EA 3KG0A 2F8HA 3DRSA 7ICOA 2KL8A 2EANA 3MCMA 2HHQA 1MWMA 1E6YA 4XDCA 2DNZA 4PKHA 4A62A 4H5NA 2NRZA 9ICAA 1B43A 2XGPA 2MQMA 1TL7B 4JKDA 3I33A 4EI2A 3ZZUA 3EGWB 1RAFB 3QNNA 1D9DA 3PG9A 1GOAA 3QSYB 4CW7B 3RMCA 1O8BA 4WCEQ 2KSOA 3LPUA 5D4NA 2Z4PA 3OL8A 4X65K 3H6EA 4PHTX 2DY1A 5HMLA 4J9KA 3SSRA 1R3NA 2V8DA 1FVQA 3D67A 1Q79A 1QSSA 3AVBA 1WG1A 1IBLK 3TAMA 1WC5A 3QUBA 2C2OB 2RPIA 4OX9J 4X62F 2YCHA 4HVZA 2UVRA 3CCES 3FZFA 3L3UA 2G8WA 2VG7A 3JB9k 4AM6A 4GO7X 1H98A 7ICKA 2JSXA 4H0PA 2FPHX 4KHUA 4AHTA 1S6QA 3N97B 3VWSA 2DXDA 5AZJB 2VBYA 1WSHA 3BUZB 1SIJA 1EZZB 1UFLA 6FD1A 3KJFB 4X4QA 3EWGA 1BQNA 4WP9A 4NI2A 3VAFA 1VYAA 3M05A 3W0LA 4DV6J 8ICLA 1QSYA 4YY3J 4CIOA 4JYAK 4Z2XA 2L41A 4UOFA 3W1YC 3H3NO 3E9LA 2WB1D 3M1VB 5KAIU 5AI4A 4RNOA 4DUYK 4LRDA 1KC8O 4LQ3A 2ZE2A 4X64J 3H90A 4QIWD 4LR7A 1HYSA 1VQ6N 4EX7A 1X4EA 2Z2LA 5KGXA 4RT3A 5ETRA 5DDRC 5AI9A 5B0GA 1EX4A 3QINA 3QU9A 2IJNA 3I6PA 2O3DA 2ZGYA 2VOOA 1WI8A 3VOVA 1ATSA 4QWDA 1HWIA 1VOMA 4QZEA 1LEOA 3C23A 2P51A 3QU7A 3MGIA 4IC9A 4JS4A 2P6UA 1HKGA 4NLDA 3GFXA 3MCSA 1N6QB 1OJ4A 5CZVA 2IJFA 2MSSA 1KKXA 1S77D 2D0OA 3TZZA 1U04A 5JVHQ 4DV4J 4B3RJ 1WKJA 2DNYA 2KXFA 4Y2IA 3KNAA 2WK4A 1L3UA 5CD4H 3U3GA 2X1GA 3IRXA 2M8HA 3DI6A 2FF6A 2W9BB 1PC5A 4LF7K 3QUCA 4V19S 2UUCK 3WIUA 2OANA 4X4OA 3U4LA 3CCRN 3KKAC 2MXYA 3KUEA 1FKPB 1FDBA 3V4IA 3NF7A 2JZBB 1CC7A 4BC2A 1JMSA 3VZHA 3W2WA 3AJ1A 2VYPA 5A76A 3C6UB 2HGMA 2O67A 3E3XA 3OBWA 4BROA 2KU7A 2ZJPQ 4M0AA 2ZJ8A 2MZQA 1RHRB 4KN4A 2FMPA 3MM9B 1K8KB 1VK8A 2DNKA 1QVGM 4MIBA 3GR0A 1N5SA 4WFBQ 4BRFA 1IKVA 3DOMA 4ZPCA 3KKSA 4Z7CA 1XU4A 5JTIA 4NLVA 4ECUA 4C8OA 2MHNA 2MQNA 5ALNA 1MWYA 1SIWB 3MD1A 3GU0A 4P4OA 2GGPB 5KI6A 1FHTA 4H8KA 2YNGA 2Q4TA 4JWNA 4HLBA 1H0HB 3MTJA 4DL5A 1JB0C 3LM9A 1QE1B 4DOBA 3SCIE 5DG9A 4M63A 5H9FJ 2MZJA 3HSZA 1ZPWX 4Y2XA 3VEYA 1FFVA 3ZZTA 4ZPAA 1YAGA 3KHLA 1VR6A 4PXBA 3IS9B 3CC7N 3LANA 4OJ3A 2A42A 1Z00B 5B0FA 3PX6A 2FJVA 4XPEA 1EARA 1DAXA 2WF8A 3BF4A 4OHVA 3JQJA 1NSQA 1WI6A 2B0GA 4YOUA 4LSZB 4O5FA 2ILYA 4EFHA 1RHJB 4YQWA 4F3TA 3QB0A 4DQIA 4CEDA 4NLBA 1SIZA 1F9EB 2MZSA 1IQTA 2I7NA 2WHOA 2ZH1A 4RWXA 2Z56B 2JH1A 3MEGA 4A8WA 1Z1ZA 4KO0B 4WFAL 2PD1A 4K2XA 2H3QA 2CWKA 3PZPA 2OXOA 1OYDA 1P27B 1LWCB 3Q8SB 4DKWA 4UUXA 4UY8T 2B6AB 1MMDA 3H5SA 2YVSA 3JTOA 2ZIVB 3QFHA 2Z1HA 4XQ8A 1UWAA 1XC3A 3WUHA 2GH1A 8ICTA 1RBAA 4ED6A 4BRLA 3AOAA 4JN4A 1HNWK 2HKEA 4CZJA 1JL1A 1FKOA 2BANA 5CCLA 4ED0A 1RBSA 3K4GA 4FS1A 2ASDA 1XC9A 1U1OA 1YRTA 2WVEA 3UE2A 3VGKA 1UPPA 2L3MA 1IUJA 3M9MB 1L5UA 2QLWA 4UB8U 4TLRA 1NGCA 1XMOF 4MK9A 4P6QA 3DYAA 1N33F 2ZZTA 1RDWX 4U7CA 1D8BA 3GV7B 3I5AA 4EUVA 5JS2A 3SCXA 4IOAL 4OZ1A 4M9NA 2DNHA 4LF7F 3CFOA 8ICKA 5B5EU 4KHPJ 4CF8A 2VB6A 4WTYA 1T0TV 5LXRA 3V81B 2XNQA 1TKTA 5RUBA 3QT7A 3MBYA 1ZQDA 5EU7A 1GLLO 3WK7A 2E6MA 2EAMA 2HWHA 3G71S 5DO2A 1QVFR 3N4PA 2GHPA 4HCBA 3K8WA 2CYYA 1JLGA 1ATNA 3CFPA 4M6WB 3NGIA 4OPKA 2XMTA 4YMEA 3TVKA 2JVOA 5KNIA 7FDRA 4O3MA 4WFAQ 3VGUA 3AQOA 2OFGX 4LFBJ 3L5KA 3A8YA 3LVVA 1S1VB 3UNYA 2ZZMA 4MO4A 1ZQUA 3RJFA 2FC8A 3EN9A 4OHZA 3AO5A 4GY2B 5BN8A 3GBTA 1X0PA 1CJKB 2MLZA 3O3GA 3CWJA 4ZMMA 4DR3J 4LF6J 2ZM6F 3FMWA 5JUMA 3J81Y 1S1UA 3SCLE 5IIJA 3POTA 2HQGA 3IS9A 2O8BB 3M8RA 4MFCA 1WOOA 4RTFD 3G6YA 1CC8A 4BDZA 3I5BA 1QUVA 4KIAA 1U4BA 1XNQJ 2DHSA 3KIOA 4CLYA 3O3HA 3AA9A 3QXGA 2Z30B 2DPJA 3F44A 5CEHA 2V4QA 2XC9A 4DLGA 5ALDA 4Z4EA 1HARA 3QIPB 3HJFA 3AD7C 4Z4GA 3J7YI 1MU2A 3W3DA 2CXYA 1H72C 2AJ4A 4XH4A 2FJXA 4UUWA 4MIWA 1Z25A 4CJ4A 5D3GB 4GO5X 2HHHK 9ICJA 2BGWA 5TISU 3L7OA 5T7BA 4DR5J 2DR8A 2AH5A 2KVSA 5LXYA 4B1UB 1D9AA 2KLAA 5BR8K 1UFWA 4LUBA 2B3TB 1I3OB 5EDWA 2CUYA 4ILRA 4Z7YA 4N5SA 2FHMA 4US9A 3B4DA 2OUGA 1U6BA 2OEJA 1CSJA 1OSCA 2HOEA 5D4OA 4ILHA 3PW5A 3M9OB 4I7FA 4IQXA 1COOA 4DR7K 2VODA 2E2NA 1ZQWA 4YMOA 3M7DA 4KHNA 1H2TZ 1VRTB 3B9JA 4OQJA 4JUZA 2YKPA 1HR0K 4FJIA 4RQ8A 1ZQZA 3KDOA 3KLFA 3O5TB 4DV3K 4P2XA 2NYHA 4DR6K 1FXDA 3H4DA 2RU9A 1ZETA 4NZ7A 3D2FB 1BA1A 3PKYA 4WTOB 1GNKA 4OX8A 4KAIA 4RPZA 1SZ2A 5LSRA 1Q7LB 3TADA 1WSJA 5LL6Z 2XY6A 1XMOK 3M4XA 1PJ7A 4M3XA 2B56A 1OH6A 1WC4A 3ULHA 4JD2A 1UVIA 3DLGA 2YHXA 5ALEA 7ICNA 1N4LA 2IVNA 3SDEB 2VA3A 3FBEA 3GYGA 3MXJA 1MROB 2EBEA 3NGYA 1T9TA 3OHAA 3ISDA 3M2UA 3UCZP 1YJ7A 4O9MA 3BEGB 3IG8A 2HFUA 1CJVB 2QMUB 3PDNA 2BDPA 4FNHA 5AQFA 4FZLA 2GIRA 2YX8A 1JLGB 3H45C 1DLOA 4O5EA 4IFVB 4MN4C 7ICIA 3T6JA 1YDLA 3RRGA 3QEAZ 4OMFG 3DWLA 1UEKA 3RG6A 3AGRA 3DFEA 2E5JA 1ZRMA 2VJ5A 2YWKA 4LVNP 5ALSA 4I28A 2U2FA 3TFSA 1S1VA 1APSA 3WK8A 2GAGC 2V4JB 3C1ZA 3MABA 1U25A 1C0GA 2VJ4A 2XY7A 1NKBA 1YVUA 2ZBPA 4OHWA 1DK2A 1H3DA 5K8NA 4KI6A 4YB1P 3ISNC 4C8YA 4PGQA 4JI4J 3NS7B 4QJVA 4OVLA 2E8AA 2XMMA 4RT2A 1NMDA 3ALRA 3VGLA 3AU6A 3BS5A 2OYYA 2E8MA 5GAEI 4CP5A 2QM1A 1UA0A 4A8MP 5J0PA 3TUZC 2ITMA 4R8UB 3WU2U 4B08A 3J7YU 4DX8H 3KD1E 4ZOSA 1ZQVA 5KFBA 1AUDA 4OI6A 4CLZA 2ZJRL 3MHYA 5E84A 2F40A 1UT5A 1Q78A 4I68A 3C19A 1NDCA 3U3YA 4DV1J 4LF8F 5FPDA 1TP7A 3PX0A 2M8DB 1VSMA 2GHWA 1CJTB 1WAJA 4C3LA 4XRHA 3PW7A 1HA1A 3JTPA 2VD3A 3J80O 2E88A 2PKEA 1S5JA 2GBZA 2ISOA 4B9TA 3OVAA 2P9SB 4DTOA 2R9LA 2HSZA 3UN3A 4CJVA 3JS6A 1TFRA 9ICLA 1PAEX 2YBVA 3G82A 2BM1A 1GXUA 3N4QA 1S1TB 3ENQA 3KHGA 5AKXA 4LY7A 1URJA 4KLUA 2J0QD 4DL4A 2XG8A 4KLJA 4BDPA 3TAQA 3VQ4A 3D0GE 1IJEB 2I5HA 3AQEA 1N61A 1IKYB 2HOQA 1QQ5A 1QJHA 1Z05A 4C6AA 4JI5K 2WFAA 2K4EA 3SENA 3PW0A 1S59A 3C14B 3DOKB 1VCTA 1UJ5A 5C24B 1RA6A 1NG9A 2MA1A 2QWMA 2BE7D 4C48A 5AQOA 1HUOA 4DSFA 2K06A 4ZN3A 2L9DA 4BRNA 3G2XA 1RWNB 2AKWB 3QO9B 5ALMA 5DDOC 2WOMA 2XYGB 5ALVA 4CEOA 3BGUA 3OL9A 3CVKA 1P9QC 1UT8A 3SUPA 3X3UA 3O6QA 2W54A 2NXEA 3HVTB 5F0WA 3IAS9 4ZPDA 1ZM9A 2Y1RI 2MY8A 3I87A 4JI6F 2UV8A 3ILIA 4DU3A 1IM6A 2E1YA 4A57A 4ID8A 3I0RA 5AQLA 4R0JA 4CF1A 4JD2B 4E1MA 4WJ3B 4KHPF 5DK5A 5DDYA 3NY0A 4DPUA 3SCKE 1EQ0A 4H5VA 2WSEC 1VIXA 1NNDA 3AAQA 2EHGA 2CQ1A 4PCQA 3K0SA 3G8TA 2ASJA 4DTRA 4F5PA 1NZAA 3WZ0A 4JK7A 2DR7A 4OD0A 5ALGA 4AE5A 1VSIA 5HL7Q 2HBZB 1S6OA 1Y4ZB 4Y2YA 7ICGA 1R8AA 3PRVA 3RGIA 1T02A 2DGTA 1QSLA 4QIWC 1BPXA 2UV8G 3LO3A 2WVFA 3G9CA 8ICHA 4DOCA 3FCVA 2YY3A 5EX0A 5AI6A 4C80A 3K5OA 4F8RA 5D78A 4YOEA 4GXKA 4YD2A 3B0XA 2WBMA 4WE1B 2NZCA 1OY8A 1RP5A 3VQAA 3GIKA 8ICIA 4DUTA 4R0EA 4RL1A 2JJ4D 3FCWA 3CM6A 2IC3B 4ZA1A 2HGNA 4F04B 3AJDA 3DLBA 5AQGA 4CLLA 1M5OC 4A5BA 3VQSA 3NH2A 3CEDA 1VQON 5F8IA 4UB5A 1TQLA 5AKGA 3NWGA 5J0YA 2FHJA 3UKUB 1JJ2R 4CK1A 4FK2A 4F5QA 4DR1J 1Q9XA 3O9RA 3NP5A 2BJ8A 2J7KA 2JEJA 3WK9A 4KMUA 4C0OC 4NYFA 1TVAA 2W4CA 4H54A 2FY8A 2UXCJ 2NYIA 3DRRA 2G09A 5DBCA 4TU7A 1HBNA 2PFFB 1WC3A 2XZTB 4FJ9A 4YEAA 1RTIA 2P9GA 2D6FC 2X78A 5AZIA 3J7A1 4CBUA 1X9WA 4OO1J 1V9PA 1C1CB 2AX0A 2CDQA 2HVDA 3QUQA 4DR4J 4OX6A 4ERDA 1KW4A 3KLEB 1XNQF 2OA8A 3I82A 3NVYA 2LA6A 4K4XA 3OSPA 2CQCA 3V6DA 4KLMA 1MW7A 2DY9A 4Z6EA 3I4HX 4LBIA 2Q0ZX 1HWUA 4FK4A 2CDRB 2MKCA 3TTDA 2KW4A 3OQ2A 1GTEA 4UAZA 4JNEA 2QW9A 3BH7B 2MZRA 4PL8A 1NUEA 3MUMP 3HPOA 3PIPQ 1YZ7A 5L8RC 3HWTA 3WIVA 3KK1A 3EWAA 4O5KA 4FZXC 9ICUA 5AICA 1VDHA 4JI6K 3SUNA 2ZC3A 1N33J 1NSKL 2CJAA 3M8WA 1OQ3A 2WAQC 4RQ6A 2Y0BB 4WFYA 4L8RB 5KFRA 1VSLA 4FP9A 2GO8A 3R6GB 3HRGA 2ZTCA 3GE9A 4FZMA 5JMNA 3CUNA 5EY4A 3K58A 4LF4J 5ALXA 4XUSA 1N60A 2BGGA 2ZNYA 3ICXA 1SZHA 1P8GA 3DI6B 1KBUA 5KFPA 4ZTJA 5KFCA 4OYMA 1RAIB 5ETMA 2V34A 1HI1A 1FT8A 1JX4A 4EAHD 5AM4A 3A8IA 5FLXY 2E4LA 2X3DA 5EN1A 3G4SN 1L8LA 1BPBA 4PGXA 3VF4A 1IH7A 2PYJA 2YX1A 1RYUA 5ALRA 4FM1A 3H2UB 4OL8A 2Z2YB 4YUDA 3NASA 4A4JA 2VQFF 3KK7A 3IUCA 5FLXU 2GV9A 2W6KA 4LT6A 1NPPA 3KTQA 3KWGA 3SEIA 3A5LC 4KSEB 3Q86A 5AQTA 3V9ZA 2E9ZA 4LBHA 4DFMA 2ZIXB 5EE0A 3CM5A 4B9QA 2RKIB 4FW2A 1B0TA 2G8VA 4N8NA 1YUWA 1OWXA 4WXWA 2HMXA 2G5HB 4DR3F 3CJ0A 3W5ZA 2YX7A 1X66A 1FK9A 3T5KA 2QL9B 3TA1A 3SSQA 4CGFA 4ANEA 5IOLA 4TXSA 4NLKA 1EHWA 1FFSB 3X1LB 2DCLA 5E3AA 2EQYA 4PY5A 4FXVA 2HLTA 2EFGA 1HBUB 2XLIA 9ICCA 1G6BA 3RMBA 4LF6K 1TAMA 3NWRA 2A6OA 2LYBA 3H8SA 3NMAA 3IO1A 3CDBA 5GADP 3UQSA 2FYXA 1NBWA 2P9UB 1FIQA 2F8SA 3JPRA 5F0XA 5JXSA 2DGSA 4DCJB 2HRTA 4FO0A 1XK8A 2C3MA 3CCEN 3CIZA 3RH6A 4J2EA 3TZYA 5BOLA 3MR5A 3KLIB 1MC8A 5GAHP 3P83D 4CO1A 4GVBB 1MQ3A 3SFUA 4DMZA 4H5RA 4RG8A 3HD1A 3MDQA 5ETLA 2LKYA 5C25A 4KFBA 4X62J 2V94A 3L8BA 2FGOA 3NGRA 2NR0A 3ZDEA 4F4WA 4JI2F 4Z4FA 5DM7Q 2JMGA 2G4BA 1GLJO 3CJ7A 2UU9F 1ZQJA 1P1TA 3FVYA 4NLTA 1KFDA 2P9NA 2DO4A 3S6JA 2GJIA 5GIOA 2YWFA 4X66K 3AEVA 5LJ3Y 2VA8A 1DARA 3MAAB 4ZVGA 4G9BA 3E9PA 4D3HA 2KFNA 3S8SA 3OD2A 2W3SA 3TAPA 3FZLA 4NYOA 4E1JA 4CIFA 3PYFA 4DOZA 4USVA 2PFQA 2HQCA 2VZ9A 1CXQA 1T11A 3KLHA 1J54A 2R18A 4IQTA 5M1NA 3VTHA 2KKHA 3R5DA 4KITB 4TN2A 2LQ9A 2OH2A 2HZAA 2KB2A 4B02A 2R3VA 5LM7E 4F25A 1W2BM 2ASLA 3SBMA 4KTWA 1FESA 5FRNA 3DXBA 2QLXA 2KZ3A 1R0BG 3U1LA 2IRYA 2FMSA 2BPGA 3NS1A 4AXJA 3P4UB 5I9EB 3AD9C 2A41A 2HRUA 2BKNA 2ZWOA 2UUBJ 3HSJA 3WNHA 4EO6A 3IP0A 2R7YA 3CERA 2JEFA 3WHIA 4R63A 4IH5A 4FS2A 2WFBA 2HHHF 2YKMB 2IOHA 5KFVA 2G0IA 3C46A 3T9NA 2G0JA 1L6NA 2LQJA 1R6VA 1U6FA 4DV4F 1SS6A 3CF5Q 2BBEA 5AQPA 5HQLA 1UKUA 5F9LA 5E3CA 1GLFO 2FZGB 3C16B 3I9ZA 3NGSA 4EBEA 1RT7A 2A2DA 1TL4A 4ECVA 4U9RA 4GKJF 4BC5A 3NBPB 2D3OR 1K73O 1O51A 3QJJA 4MF8A 3MM5A 3C2KA 4QOZB 4CZLA 2KKPA 3GV5B 4RUCA 2F9JA 3M5RA 2VG7B 4QPXA 3N7RC 1A7GE 1RBOB 4IS7A 2BKPA 1OKJA 3D9BA 1KD1T 4O8KA 3O9TA 3QU4A 5D0RA 3WXJA 1NDPA 1S49A 1Q81T 5EWEA 2BJ7A 4GXJA 4USKA 3GJSB 3PKMA 3LPTA 4WK3A 4EHUA 4OPAA 2I38A 4DX6A 3BP8A 4IG3B 4H5TA 4OYXA 3CPWM 4HWIA 2G5IB 2BABA 1OPZA 1S5LU 3TWHA 1X4CA 1BISA 4NO7A 2WHEA 3KFWX 1KD1O 3H42A 2D0CA 2ZDOA 2HBLA 2P6TA 2RIJA 5H1SQ 1KCFA 2HVIA 2YX4A 5C25B 1QY7A 3DC2A 1K0VA 2ZE2B 2L9NA 3UN2A 4ZCKA 3K1RB 1X6JA 2CZ4A 4KGZB 1K1SA 2QLJB 1W2IA 5HRPA 2AYMA 5K8OA 4CHYA 3TZWA 5AXNA 1RTJA 1SGGA 4QZ9A 1PCAA 3IGNA 5HMZA 5MAOA 4BS2A 2PMZC 2QO3A 3JS9A 3QYPA 4PKGA 1R7IA 3BZCA 1NZ8A 1LK7A 3M8YA 1U02A 2BMBA 2D69A 2IMWP 1WSVA 3P4IA 4DR4F 1K73T 5K4LA 4CZEA 2QWQA 3Q24A 5F8NA 3ZTPA 1U8SA 1S1XA 1NK0A 2VONA 1O0PA 4YD1A 4U67L 3TNVA 1IG8A 2OGUA 3WK5A 1GXTA 1O5JA 3UD5A 1L7OA 4P74A 3WKDA 2Z7JA 4I2FA 3EKSA 3EXCX 4DR1K 2Y0SD 3CCTA 2J6TA 3TVYA 4NPOA 4J9OA 2E44A 4ECRA 1NJIT 3ZNUA 2DGQA 1WORA 4HT7A 2CJQA 2PA3A 3QUTA 3UIQA 2J6UA 5J0SA 4HUEA 5IILA 4BR5A 2NPIA 3OFGA 4CLKA 4CGHA 2ZH7A 4I2HA 1LOUA 1PVPA 3JSMB 1PK1A 1RPLA 1U2RA 1IBLF 4DB3A 2E5LJ 3P45B 4R5PA 2ES6A 3D66A 2OPPB 4Y2TA 3A1YG 1TAQA 3MM9A 3ETLA 1VGYA 2NXCA 1KFTA 2CQ0A 3LP0A 3P96A 3EX7B 5HQMA 4FVUA 4NLUA 1T95A 5A8RA 3O6WA 2ZOFA 1MLAA 3C16A 1U0SA 4BVOA 3CC2S 5FJ4A 3ZSQA 2RH3A 2EX3A 2YN4A 1UEUA 2E5HA 2KVCA 4NLZA 2H54B 5J2GA 5I42A 4F93B 2F7TA 3ZYYX 2RNEA 1YITS 1E4GT 3BBFA 1MA9B 2C1EB 3MCOA 4E8UA 4DJBA 5KFUA 2X7IA 2JWNA 1KONA 1WSEA 4PKIA 1YJVA 3MFHA 1HW8A 2HAFA 4ZJLA 4OX9K 3WKAA 2BDUA 1TFWA 5AI8A 4ES1A 1BE4A 5LMNJ 3NRZA 4RW9A 4IOBA 4BR4A 2MTLA 5K8PA 4F9OA 1MQ2A 1J5EK 2UUAJ 5J8YA 1LW2B 1FRMA 4RUBA 4X4TA 1P7DA 3BS7A 4FYXB 4ITSA 4RNFA 1WWHA 3N79A 4OI0A 2CQBA 4ZVQB 5THWA 3BO3A 2CFXA 3QRPA 2G2ZA 1RXOB 5E3RA 5GADU 3HHLC 4MFFA 2W7AA 8ICJA 3BGOP 4E3SA 2CPRA 4BDYA 4C8NA 2FHKA 2O6KA 4YR0A 4BACA 5AK4A 3ZZRA 1X9JA 3DOLB 3FFIA 3ALYA 4AL6A 2YQ3A 5ALFA 1KHVA 3NE6A 2JGUA 4EFAC 3QMLA 2DTJA 7ICUA 3BO4A 1MMLA 2IVFB 4DN0A 2KXHA 1VQ9S 2MQ8A 4FKYA 3CQYA 4ILGB 3RUBL 4C8KA 5DB8A 5GTHU 3FEZA 1GOBA 4NLWA 3ZZ0A 3G71N 2BVZA 4QS7A 1D8ZA 5FPEA 3A3OB 5CZ1A 4FJ8A 1TUVA 4O4RA 4HDGA 3E1YA 3A12A 4JI8F 3QO9A 4FJMA 5F1XA 2KZMA 3R3TA 3W9JA 2QARA 5KFXA 1HW9A 4JI3K 4WK1A 1YVFA 4DCCA 1HPZB 1L3KA 2ZHOA 1NDLA 1N5TA 3HVTA 3GFZA 1WHYA 1YJRA 1CVJA 4UW9A 1VHIA 4CLUA 2A1JA 4CEFA 3DYAB 3RYLA 3J8AA 2WONA 3CJ3A 1VQOS 2QWNA 5KFNA 3EDRB 1WSIA 1ZOLA 5I4MA 5AE2A 1HWLA 1GX6A 4JV1A 3S7RA 4KE5A 4QIGA 3F73A 3UPQA 4B9SA 1VBZA 3L2WA 3VESA 4M2YA 1T03B 3EUB2 2BPFA 2MLYA 1HYVA 2VWKA 1VBYA 4A46A 4LRCA 4BRDA 1HEKA 4J2BA 3BGFA 1I94K 4EMDA 3KKRA 5KG4A 4NLCA 4DZ6A 4ECSA 4DU1A 4ZVUB 2DHXA 4LFCK 3MM6B 2F77X 2FUG9 3E8OA 3H59A 2F63A 4PQUA 1J27A 1X6IA 3L2UA 1G7CB 2CIMA 4P10A 4I2DA 4QBUA 3K75D 1RISA 4DCOB 4U6PA 5IT9Y 2GZOA 2HPUA 2RT3A 2E8NA 4DV0J 7ICEA 2A6AA 1FXRA 2MZTA 1CJKA 4U67Q 1SQGA 2NZ4A 3NKYA 5H9FK 2KT2A 3FBBA 5J0QA 5G0RA 4P2SA 3R8EA 3HK2A 1BQMB 2D3O1 4Q2MA 1UL3A 4OZJA 3ITHA 4B1ZA 3EGNA 4CTAA 3MCNA 2D5RA 3QEWA 3C7NB 9ICNA 3VMFB 1PAUB 2IM3A 1SV5A 3G8SA 5FRMA 3FDSA 1TMJA 3IG1A 4J9SA 3LF0A 4OI1A 1BLUA 4P4PA 3V72A 2KJ5A 2K8GA 1UTAA 5L1MA 3PSPA 2DWQA 1NGDA 5J0WA 4FLVA 3T5LA 4IR1A 5A6PA 2EFVA 1VSHA 7ICHA 3RAXA 1VQMN 2CNOB 2DRDA 2IBOA 1HKAA 5C10A 3KNGA 2FQQB 3H1QA 1QD1A 4M3TA 3AA5X 1V9OA 3BSCA 2X1AA 2PFDA 4DTUA 2ZNZA 3OTOJ 3THYA 2DUYA 1HWJA 1LAVA 5EGYA 1MN7A 4DR7F 2DPNA 2P9CA 3SD7A 4DR5K 2JVRA 4JI4K 5F3TA 2DGWA 4K59A 4CHZA 2IRXA 4ZS6A 4EEYA 3C2LA 2VG6B 2PC6A 1Q7YT 2C3UA 2YKNB 2GTDA 3TPQA 5ALQA 3C94A 4I7FB 4Z37A 2R7UA 4LF4K 3PFOA 4NYZA 2HMIB 3LP2A 2CQGA 2DB1A 1VRTA 2QA2A 1HNZK 2NO4A 5G5GA 2IBKA 4J9RA 4BRPA 3CCSN 4UQTA 5J2FA 3OYKA 2LQ8A 5A8KB 1N56A 2D0PA 3RBDA 3ET6B 5ETTA 4FZYA 3AQPA 3ID8A 1P90A 4WWSA 4K7QA 2FLOA 1R8PA 3ENOA 1HI0P 4Q8EA 3IRUA 1D09B 1SJ3P 3KLVA 1S4FA 1SJRA 5CAAA 5T14A 4C7QA 2R2SA 3I1YA 2DQNB 4ED3A 1WF1A 1ZQCA 4G1QB 1X4GA 1H2UX 2DH8A 4USUA 4A8SA 2OPQB 1T9WA 1HD1A 1CEZA 3CJ9A 3J80U 1XNRF 2IRUA 1EKRA 4Y2VA 4YOVA 3QJPA 5AQRA 4O3RA 4KHRA 3J7ZO 2ZDPA 2MKYA 8ICFA 1VQ5S 1NHVA 1LK5A 1I1GA 2PMZD 2CH5A 1MWKA 1AXQA 3C2PA 1UA1A 3OJSA 1BMQB 3I9V9 3KVGA 3H7IA 3M1FA 1JLFB 4CF3A 1BCMA 1M0SA 2YQ0A 1DZ5A 3CJ2A 2HVZA 5IQ6A 3R9PA 1HBMB 3P5BP 2LBOA 1RWVB 3US5A 1AYEA 1ZQMA 3HHDA 2B9WA 5IS2A 4PWUA 3VEWA 1X31C 3VF2A 4KLHA 5DQGA 5E41A 1KQQA 4DQSA 1V3SA 1UPMB 2LA4A 3OYHA 3LZJA 1ZQGA 3QMQA 1C6VA 2MUTA 2PE8A 4RKUC 1B9FA 5J2DA 1FO4A 2YXLA 3AVKA 1HFEL 1F3FA 2NUBA 3FZ2A 9ICFA 4Y34A 1RAAB 3C95A 2LP4A 4NE9C 1V5VA 3VVTA 4KTQA 3RF9A 1URNA 3ED5A 2CADA 2K60A 3R3LA 4K0KK 2HI0A 1BQNB 4CBXA 3AARA 4A8EA 3WQUA 1CS4B 4DLEA 5U47A 1BO5O 4ZVHA 4Q45A 4CNZA 3K59A 3LYSA 4IO9Q 4FYWB 3NGKA 1JJHA 4F67A 1KHWA 4MFAA 1RZMA 3F0NA 4CJUA 4RW6B 2GFFA 4FSVA 4LSNB 5HP1B 2MKHA 1OYEA 2UXBJ 3D2EB 4NA3A 3V2UC 3D0HE 1T3NA 4C1NI 2PXIA 2JOQA 3TP2A 4I2AA 3C66A 4I2GA 1S1WA 5B0EA 4NYNA 3DLJA 2E20A 4KB7A 3UQ2A 2HNZB 5BXIA 2Z2MA 2P2CB 5AR0A 2R7XA 2ZH8A 1N63A 1HKBA 4DR3K 3S3MA 3DOKA 2C3OA 2HWIA 2K7KA 1ZBSA 2YWEA 3KKAA 2OI2A 2CGJA 4CE9A 4M9JA 1T7PA 2HOIA 3K2YA 1Z19A 2O8EB 4CJLA 3I28A 3R7NB 4QZHA 4MFBA 4EENA 3H2VE 2YB4A 3GOIA 5DBBA 3H4BA 4DV1F 1TK5A 2R8KA 4LF8J 3HJVA 3MX5A 2DT9A 1BHNA 1ASWA 5B66U 2CJKA 2GQ2A 3ZDCA 1V4TA 1U1KA 4PABA 4ZVOB 1QAYA 2VFSA 1C20A 1Z26A 3GR1A 1G2EA 4LRAA 2XNRA 1FVSA 1JN3A 2QWLA 2VKQA 2OPSB 4FWPA 5KPRA 4GKJK 3LTOA 2V6AA 1KLMA 4JS5A 2RP5A 2DKXA 2D0BA 1MMNA 3CIMA 3WT0A 2O8FA 3G8QA 4YXJA 4Z94A 1XHXA 2OKQA 2I1RA 4NLPA 4OI3A 2ATLA 5DDPC 2H5JB 5HHHA 4BCAA 4ZLLA 4FWQA 2O1PA 3W66A 2PSZA 3VALA 4A8KA 2ZM6J 5GMKa 3PSIA 2UXDJ 4CEEA 3OA9A 4W4MA 4M5KA 3CJCA 2BACA 1RUSA 3AJ2A 2IM1A 5E2QA 2OYQA 4X84A 1ZBLA 1PILA 4C3MA 3DMJB 3VEOA 4OJGA 3TA2A 4DL2A 3MUVP 2RD5C 8ICBA 3W3SA 3EM1A 1RHKB 2WUSA 3AM9A 2E3TA 3CD6S 4DTPA 1JLFA 2ZZNA 4PPXA 4CECA 5KL1B 5B0BA 1QQMA 2YH0A 1EX8A 3C6TA 3GZFA 2RRDA 2C3PA 3NBPA 4G6VB 5E26A 1TKXA 2AYBA 2IVOA 3KLGB 2AHOB 2J9EA 2VA2A 9ICQA 3UPFA 1KVBA 4CFAA 2I7PA 3DDHA 2BUPA 4OPHA 4GV9A 2WW8A 4B8CA 3JPPA 2QA4N 4ZVTB 1IKWA 3N6MA 4P2HA 2W9CB 1JLQB 1X4BA 4F4ZA 2OELA 4CZCA 5LMUK 1QAJA 4CGIA 4JKHA 4RO0A 5D0HA 2YNFA 1D8LA 4NCGA 4RUAA 1FD2A 5JRTA 4RPXA 3TAEA 4ZLJA 1ZQHA 4KLOA 4M5LA 4KX3A 4RBVA 3CHWA 4QIVA 1NB7A 1WF2A 4I6WA 2FD2A 3QGIA 1IR1A 3GYXB 1WDTA 3DDNA 4OJOA 4KR0B 3BZQA 3D1QA 4QAGA 4G9ZA 3E58A 2CNLB 2ZUDA 3VAJA 3PEHA 1Q8KA 3LPEA 5ETNA 1L7PA 2WTFA 2D9OA 2GELA 1Y88A 3WKEA 1VQ4N 3ILLA 3OYAA 1IN0A 1YJNS 5HR7A 3DXKA 4IYQA 1JJCB 1BD6A 2W6LA 1CZAN 4DR1F 5EOYA 4O0JA 4Q43A 3GIJA 2W41A 2H5IB 3KK1B 1HPMA 4ED8A 2V8PA 4IDKB 4F50A 1KVKA 1X9SA 1LVHA 2FDNA 2BANB 3K0JA 2UVUA 1K47A 2W42A 2KJWA 5DM6L 2LHTA 4K4UA 4YB6A 1RTHA 2OMOA 1OS5A 3RW7A 4OHYA 2ZGZA 1NK8A 1B0PA 3HTVA 1KOOA 4RBUA 2KJ9A 2O8DB 4ZIWA 1XEZA 1R27B 4DTXA 4EHTA 8ICSA 3GWCA 3I31A 4CJFA 3E9OA 1IJJA 3A5NC 1WD6A 3BF3A 5KFMA 2R7QA 5ETOA 4BRAA 4GFJA 4J90A 3VQ5A 5IIKA 1VBXA 1HLWA 3VAKA 4DSKA 2QXLA 4MJKA 4YHHJ 4FJNA 1RBVA 4MKAA 5IXUA 1IR2A 4Y2AA 5TZVA 1QS4A 1VC6A 3ZO7A 3ZSYA 2E5IA 1A5WA 3M3ZA 2KD1A 1B4FA 3TSUA 3HP9A 2YNIA 3MOJB 8ICCA 2CGKA 3WC2A 5EWGA 3BR8A 3AO3A 1ZBUA 5L39A 3MMVA 2QL5B 4B3RK 2OPPA 2ZJQL 1J2VA 2Z57B 4UZBA 1RT6B 2KP7A 4JKAA 1DBDA 1OQ6A 4TYAA 3O1BA 4JKCA 4CGDA 3SCJE 4CZKA 3QEBZ 1QDUB 2XYHB 2A3VA 5A6WA 3ETOA 4ECXA 3P6YC 2DITA 4EWTA 4DOAA 1X9XA 1LWFB 5GAGU 1QHTA 4KH0B 3PR5B 3OR1A 1XR5A 4NLQA 1ULRA 3F2BA 2HHTA 3CDUA 2V5HG 3WXMB 4MEXA 1HD0A 3A3PB 3B6BA 5I42B 1VSJA 4DTSA 1NXIA 4ZLPA 2BE9B 1NOYA 1SWVA 2CG8A 3CJQA 4PXEA 3HO1A 3L9ZA 4IJNA 3R1XA 4XK8C 1FKAF 1J5OB 3KK2A 1X2IA 5AK6A 2M7SA 4MTPA 4LF5K 3Q8PB 5KRTA 4BXOA 5L46A 1ZTWA 3WBZA 3KDNA 3HI9A 1JLBB 3KYLA 1ZD4A 1ZBTA 2R7OA 4G65A 3OVNA 3MMJA 4NI2B 4MH8A 2R2TA 2YNFB 2J7UA 1VQNN 2ZJAA 4UB2A 2IM2A 2NXJA 3G10A 4QZAA 1NJXA 7ICFA 2VASA 2IVPA 1SKRA 2BQUA 3CCQN 1Z2LA 3ENBA 2CPIA 5GAGP 2GLEA 1TUYA 3NVMA 1XIQA 3CJBA 1GT8A 4PEOA 4J9NA 3LUYA 2J0SD 4Y0FA 2V51B 3RBZA 2RUGA 1SQEA 2IHR1 2KMDA 3N7PD 2F7VA 2E1CA 2LSNA 1ACMB 5KG1A 3HHEA 2XZDB 4X4UA 4JYAF 5GAHU 4IOCL 3SR6A 2ZJQQ 3F5AA 5CE3A 1F5SA 4DCPB 3QT5A 3DGPB 1DHMA 2E2QA 4Y2MA 4Y2UA 2C2MB 1BPEA 4NLXA 4QZVB 4MQ3A 4J8FA 4CI6A 3PHEA 1N34F 2A19A 4FZVA 1HJPA 3NUQA 2XLJA 1K9MO 2HQFA 1YJWN 3SV3A 1AFJA 4BRHA 3DM2A 3BKTA 1C2PA 1TL1A 3ZTQA 3K5LA 2XY8A 2AQ0A 3UD4P 3VV2B 4EELA 3W63A 5AIBA 5DLGA 2GGPA 2W25A 3GG1A 4LR8A 2E1EA 3U02A 1RT3B 2LU1A 3QRQA 1SC1B 3FR0A 5CD4A 3PYEA 1DTTB 2JGAA 2Y1IA 3GLJA 2ZD1B 1WOPA 1T94A 1ATRA 2G2OA 1CJVA 2IVYA 2W40A 3AVJA 4FWNA 3C6UA 2MRLA 2VBWA 1RFQA 3TKAA 2XQCA 4MEYA 2ZIWB 3MM6A 4IFVA 4IRDA 3BQ2A 2XY5A 1RT6A 2FDRA 5AJ3F 4C4TA 5BN9A 2HDOA 4USHA 1ZQBA 4GVMA 4OLBA 1CQMA 1FDDA 2A6MA 9ICRA 1RQNA 1IBKF 2FJ6A 1KDHA 4NLGA 2N3LA 3MAHA 4M63C 5T41A 2QG9B 3W8PA 2UXCF 2HB5A 3VEXA 2GA7A 5ADXA 4NA1A 3LM2A 1N5XA 4KO0A 1T3QA 5IWAF 3C15A 4YB7A 4J9UE 5J2BA 1YF5L 4G1IA 3FAHA 3V7LA 2XHCA 4OJ5A 1KRPA 4ELTA 4ILJA 1N34K 3HM8A 2NRRA 2GMJA 3NF6A 4UF4A 2K8BB 2KZZA 3EY1A 1HJOA 2B6AA 4BR9A 1D8YA 3KJVB 2OSQA 2HIQA 5A0YA 3VENA 3V5RA 2ZF5O 4DR2J 2YTCA 5KFWA 2DKOB 3A3NB 3CJAA 2VWBA 4RU9A 4EP5A 2J76E 1FKOB 4M5MA 3G0ZA 4PWWA 3O1LA 3TAFA 2E9RX 4JWMA 4YOWA 2GVDA 1BPDA 1W7WA 4CWBA 5GMEA 3WXIA 3PLAA 4P75A 1KEJA 2DEJA 3T5JA 3ZZZA 1XMQF 4NWBA 3ISND 1VBKA 1Q7YO 1V5IB 4N56A 2IDEA 1XBWA 4IQWA 1HNIA 1Y10A 2Z1JA 4I2PB 4F72A 2PT0A 2KFZA 3GZ7A 3GU3A 4Y6IA 4B1XB 4PGYA 1RTJB 4KGKA 2XSFA 1HNXJ 4BQZA 1ZBHA 4FM0A 1DXSA 2ZIVA 5AK5A 4HCCA 3C6AA 3ZNJ1 3UDCA 3GFKB 2XRIA 5J2HA 4X65F 3EE9A 1UVJA 1B0XA 2AWZA 1ZQTA 3KD5E 3NVWA 3A8JA 3KWMA 4WCEL 5HROA 1QH9A 1MG7A 2HIYA 4AQYF 1R8CA 4PWDB 4H4OA 4BJQA 2HMIA 2BQRA 3M30B 3TQEA 1BC6A 1U1RA 1CJUB 4DU7A 4DV5F 3W2VB 3DHWC 1ASUA 2VPYB 5E33A 3CMEN 1BA0A 2VG5A 3ZT1A 2GUIA 2B5JA 2RF2A 4FJKA 2B4OA 4KHWA 1B4SA 2LYAA 2D9PA 4LF5J 3NH0A 4K5SA 4TNOA 4XTTA 3AO4A 4AT1B 9ICTA 4CE6A 3UCUP 3CRXA 5HNKA 1S57A 5B0AA 1WC0A 1BQXA 1VQPS 3PX4A 1NM1A 3J81U 5K14B 3O2IA 4DXLA 4CLSA 3NCRA 1C0UA 2E2OA 1EWQA 4Y3CA 1BG3A 2O8BA 1YSJA 4ILMA 3H8MA 1NLKL 2PFOA 4X64K 3AUOA 2DNOA 4FDFA 5CZXA 3TUPA 4K8XA 5BPLA 2ZHBA 4IOXA 3VQ7A 4PZNA 2XCAA 4WFNL 2D74B 1GOCA 3CPWR 3S1TA 4DU8A 3NCPA 4USWA 4JYAJ 3VQCA 3UNGC 4IZ9A 4P0PA 4K4SA 4ETXA 1GQEA 1VQKN 1GLAG 2MAXA 2F8LA 4CLFA 5ALUA 4BLGA 1LOTB 4GKKF 1KQSM 1FRHA 1WEYA 3R7BB 2HHXA 3PNIA 2F96A 1UW4A 4NLRA 3R8YA 1T9VA 1LW0A 3QX7A 3K17A 1MSWD 4UY8O 4AF1A 3D6FB 2XO6A 4CJKA 1YT3A 5KFFA 4FO6A 4M94A 5CY4A 4QPTA 1YI2S 4OKEA 5MLCQ 3C29A 5ALKA 3W62A 4RQ3A 1SC6A 3BKFA 2Y1JA 2ISPA 2EH9A 4UB3A 1O13A 2APOA 4IQUA 3GIIA 4DTJA 1SBRA 1TR0A 3SXLA 3WX8A 1N33K 2BZFA 1CUKA 2QFJA 2F4VF 3GL1A 1JQGA 2BRKA 4ZVSB 3EL2A 1TU0B 1YGYA 7ICSA 3TR5A 1VMBA 3A2FA 5K5MA 1RDRA 1K5OA 2ALYB 3ADAC 1X1PA 5BPMA 5J0RA 1QHAA 3FC4A 3IDHA 4EZ6A 2OO4A 2BCQA 2Y3YA 2LU2A 2R7TA 5JJBA 2CPEA 5KOXA 2HFVA 4K2JA 4UB6U 4N41A 2QYCA 3SJHA 1RBLA 2PEHA 3QEIA 3NDKA 2ALZA 2BCSA 2QB0B 3CSKA 2HVEA 2QB1A 1NK4A 2A18A 3MPWA 5KT4A 3CC7S 3I55S 1UFKA 5J2PA 2JR5A 2H5EA 3FFKB 2JH3A 5AKEA 4MK7A 4CHNA 2DYAA 4M9GA 4CO3A 3V9WA 3C2MA 1DLOB 3UO0A 3KWIA 1GX5A 4OYOA 3W2VA 1Q3VA 2I0XA 4JI8K 2Q2RA 1ZQPA 2QLFB 2RAQA 2Q1NA 3T7ZA 2M0NA 3LH2S 5KFAA 2VPZB 3ZSVA 1HMVB 4B3MK 4J9LA 3L4PA 5KG5A 3MEDA 5H1SV 4ICLA 3KHHA 3JSBA 4RJVA 1EAYC 2RE2A 3AVMA 2VF3A 3D6JA 1BNPA 2WONB 1KLMB 5HMYA 3AOCA 1M5VC 4R79A 1Y3KA 1RT4B 1JLEB 1PYOB 1V85A 3M2VB 5T7LA 1RWPB 2FPKA 5EE1A 2O8FB 1V3RA 2BCVA 3LGHA 3OHRA 3DLGB 1HNXK 4P72A 3DJCA 3BQTA 1O08A 3MAQA 3OTOK 3CMAS 4KTZA 4X5VA 3IMQJ 5ETKA 2W04A 5K14A 1RK8A 3M32A 1ZXOA 3VR1A 3C6HA 3ZC4A 3ENVA 5HK4A 8ICMA 2F4VK 4LH5A 3GJQB 4OV1A 1R0AA 2G8IA 5CYMA 3Q8YA 3FKBA