2KHQA

Solution nmr structure of a phage integrase ssp1947 fragment 59-159 from staphylococcus saprophyticus, northeast structural genomics consortium target syr103b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
MITFADYFYQWYEVNKLPHVSESTKRHYESAYKHIKDHFRHKLLKDIKRTEYQKFLNEYGLTHSYETIRKLNSYIRNAFDDAIHEGYVIKNPTYKAELHASVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of a phage integrase SSP1947 fragment 59-159 from Staphylococcus saprophyticus
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
molecule tags Dna binding protein
molecule keywords Integrase
total genus 36
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2khqA01
2KKPA 2KKVA 1Z19A 1F44A 2KJ5A 1PVQA 3MGVA 4A8EA 1PVPA 3C28A 2CRXA 2KEYA 1CRXA 1Q3VA 3CRXA 1DRGA 5CRXA 1OUQA 3NRWA 1P7DA 2KJ8A 3LYSA 1A0PA 1PVRA 3C29A 1NZBA 2KJ9A 1Z1BA 1Q3UA 1MA7A 1KBUA 2HOIA 4CRXA 2HOFA 2OXOA 4ACOA 2A3VA 2KIWA 1XO0A 1XNSA 2KOBA 2KHQA 2KD1A 2KHVA
chains in the Genus database with same CATH superfamily
5ALWA 4O5EA 4M47A 2KV2A 5KT4A 4I29A 3UMGA 2KZ3A 1RM6C 5J2KA 2C28A 4O3SA 3PW2A 1IXRA 3QXGA 3UM9A 2BCSA 1Z4NA 4I2HA 1ZQDA 2AGOA 1F44A 4USAA 5AKZA 5KT3A 3SR6A 4DFPA 1X9XA 2F2AB 1QCKA 3RBEA 5ALSA 3PMNA 9ICXA 1ZQRA 3KFUF 1DXSA 2WB1F 2BQ3A 1TK0A 3ISDA 5KG7A 2DUYA 2VA8A 1KRPA 3ZDCA 1RDFA 1J2MA 1L3VA 3RB6A 2RDIA 3CYMA 1XO1A 2XCAA 5HR7A 4RQ2A 3CRXA 4RNMA 2XVTA 4DSLA 4Y2JA 4DFMA 3NRZA 2B21A 5AKKA 1DGJA 5D46A 4YG2A 4PH5A 2PFNA 2J6TA 2MU2A 4FZNA 3H8MA 2FLPA 1N61A 3F2BA 5ALLA 3BZCA 4JK1A 4Z6DA 5AIBA 2P6RA 2KMDA 2FMPA 1NK9A 2PMZC 2ZIWA 1X66A 2XI9A 5CP2A 3WK7A 1Z3EB 3HRDD 2QARA 1ZQOA 1SV0C 5AM5A 1SKSA 3RJFA 2LHTA 4EEYA 1QQ5A 2K8CB 4DOCA 3B0XA 1IG6A 3H0LB 2JR5A 2AXTU 2ZIVA 5J0YA 1BPEA 5A0LA 4F4ZA 4KN7A 5E79U 3T5KA 4JV1A 4KX3A 3KZXA 2HOFA 2W3SA 4YCXA 5KFGA 5AM3A 2KIWA 1L7OA 8ICHA 5CB1A 5ALTA 3GFKB 2N1RA 2IOFA 2XGQA 4DQSA 3L5KA 2W04A 3ZD8A 1S0NA 3TANA 2KK0A 1L7NA 3SAFA 4B9TA 1N48A 4CCHA 2ASJA 4O9MA 9ICAA 3F5AA 5DQHA 1UCVA 5KFVA 3SAHA 3F2DA 5KG2A 3UQ0A 4EZ9A 3UMBA 4R65A 4G9BA 1PZNA 3MBYA 2BGWA 4I2AA 1AROP 1T4GA 2HBMA 3I76A 3RB3A 4J9MA 4PL2A 1MA7A 4ECYA 3TACB 4UB1A 4BUGA 2DBYA 3WK5A 4P0PB 2F1JA 2GH1A 3GDXA 2KVSA 2W3RA 5J2FA 1ZQPA 4HYKA 5AK3A 5CHGA 3JPNA 4RPZA 2ZTCA 2PI5A 3SV4A 1N2XA 5J0PA 1TAMA 4BJQA 2H5XA 3D6JA 2YN4A 3VCBA 3MGHA 4DO9A 4ELTA 3BDPA 4Q45A 3NVWA 9ICRA 1RG6A 3LVVA 5IINA 3M9OB 1CUKA 4GFJA 5JUMA 3C1YA 2DKZA 1WWUA 3V6KA 4TUQA 5ALHA 3RJGA 1BVSA 4B9UA 3HJEA 1WCNA 1TKDA 2YY6A 5CA7A 4M6WB 2F8LA 3L4PA 4KLOA 3KKAC 4DEZA 3UXPA 5GTIU 2HBLA 2D6FC 3PNCA 5AK5A 1A6SA 8ICEA 3TARA 5DDMA 2KSOB 1N5XA 3H8WA 4UATA 1TK8A 1TK5A 2BPCA 3I28A 5AKYA 4R63A 3R9KA 5TZVA 3ZDDA 2EAOA 5ALNA 4NL9A 4I2BA 4Y2TA 4O3NA 2QLTA 2I5HA 4J03A 4DQQA 2GLEA 2NO4A 4EZ6A 3M8RA 2MAXA 3QUQA 4I2FA 4UAZA 5DB9A 1SWWA 5H2FU 4UB5A 2HBJA 2LM1A 5KAFU 5F9LA 3TFSA 4QWEA 1UQVA 2LMRA 2W9AA 2XCPA 4QW8A 9ICBA 2GWSA 4ED0A 4Z6EA 2AQ4A 4P4OA 3WKCA 1ZQZA 4TQSA 4B9NA 2XY5A 1CI4A 1NKEA 5C0YA 4EYHB 2HSZA 4M2YA 2XY7A 2EQYA 1K5OA 1S5LU 2RQ5A 4NLNA 3F2CA 5F3XB 4YXJA 4KLLA 2QKQA 3QU7A 5HMLA 4YR3A 4I2IA 1KQQA 5KFBA 4NXZA 2AU0A 4YD1A 5KL1B 3D2SA 5KFKA 2HHXA 1M6YA 5AICA 8ICBA 4DF8A 1OUQA 1PK1B 2JEGA 1A0PA 1ZQYA 3GIJA 2D3DA 1NZPA 1ZQCA 4BXOA 5L1JA 1JXLA 1S0VA 4R66A 4ECZA 5KT6A 5CJ7A 5AM4A 2LI6A 4NM2A 3UMCA 2G5IB 2KG5A 2IOFK 2KE7A 2WHEA 2AJQA 2JEIA 3OHAA 8ICMA 1UA1A 2UVVA 1URJA 1X6IA 3LYSA 4MHVA 1SGGA 5KFYA 4YMNA 2JZBA 5IIKA 3JPSA 7ICSA 2WAQC 2ASDA 4US8A 2YMLA 1N60A 1X2IA 2MA1A 3KHLA 1Z00A 4Q43A 3HT3A 2P35A 2P6UA 2KSOA 3RFAA 5ALFA 1B4FA 2PFQA 3MDCA 2ASLA 8ICAA 1HEKA 2AQ0A 4YVZA 1NZBA 1KSPA 1COOA 2BCVA 4ECUA 4ED8A 1X6JA 4P4PA 4JV2A 2KIVA 2KKVA 1SWVA 5J2IA 4M0AA 2H3FA 4PZOA 1ZQAA 8ICOA 3KTQA 5ALJA 4GLXA 4PL1A 5DKWA 2K89A 3PX4A 3T5LA 4F4KA 2KHVA 3D2NA 3PX0A 2LBOA 2VJ5A 1QSYA 4XQ8A 2ZG6A 4M9LA 1KFDA 3QUTA 3T79A 3RRGA 4PGQA 5HP4A 3WK6A 4J9RA 3WU2U 4I27A 1JRPA 8ICGA 3NTUA 1N5WA 2RHFA 4LJXA 1XO0A 3SEIA 5KFXA 8ICKA 2R8HA 5FP0A 4ECTA 4UB4A 3LDAA 1JALA 2YMQA 2FJ6A 4IL6U 4YXMA 3SENA 2W9MA 4BXOB 2V4QA 4FS1A 3SQIA 3K1RB 4TUPA 1RZTA 1NK0A 4FZMA 2KN7A 3RR8A 3PO5A 4J9OA 2JH7A 3L3FX 1UT5A 2E3TA 3ALRA 3IG5A 1RXWA 5KFIA 3WKEA 4EBCA 3UXNA 4F5PA 4OJOA 3K4GA 4B9SA 2GO7A 3IP4B 1NNLA 3EW9A 2CPRA 3RH4A 3NVYA 3M6ZA 2XY6A 1ZQIA 1L8OA 3PX6A 3IRUA 4GC7A 4RUAA 1T3NA 1ZETA 2K4HA 2C2DA 5HMMA 1RQNA 2P66A 2EZZA 4QW9A 3RJKA 2E8PA 1RQLA 1XC9A 2Y1JA 3MR6A 7ICMA 3IM1A 3RF9A 1NJZA 4DLGA 3MABA 5KG4A 3LWLA 1B22A 2R18A 2HHTA 1L3TA 2YB1A 5ALPA 1L7PA 3TADA 3BQTA 3I1YA 2RDJA 1PVRA 2AH5A 4M9JA 2PI4A 1S0MA 1BPXA 4DSFA 4J9KA 1FO4A 3MGVA 3EUB2 4KLDA 3TADC 5JRTA 5DQGA 4F4YA 2XO7A 2F3NA 2EAMA 4QZAA 3ISBA 1OW5A 5ALZA 7ICGA 2B0CA 2FPKA 5KFOA 2ZTDA 1BPZA 2ISOA 1D8YA 5AI5A 2HHVA 7ICHA 5KFLA 4RUCA 2NRWA 5L1IA 3O0FA 1C20A 3RJIA 3QU9A 1DK3A 5KFTA 2HOQA 3GIKA 3SZ2A 3GQCA 4P0PA 1BPBA 2JEJA 4DSKA 1EXNA 2DGZA 2I6XA 4RQ5A 4NLKA 9ICVA 1ZJMA 3HWTA 7ICKA 2OCEA 1V38A 1SV0A 5EE1A 1KLNA 1PK1A 4OO1J 2ISPA 4IR1A 4F4XA 4TURA 4XRHA 4F5NA 4I2CA 3BJYA 5DG8A 5HR6A 3JPRA 2NRTA 3CP8A 1TFRA 3PV8A 3OHBA 1A76A 1NK5A 1ZQSA 3A0BU 4UAVA 3ED5A 2FLNA 5DBAA 4B9VA 5DLGA 3Q8MA 4RNNA 5KG5A 2F44A 7ICQA 7ICLA 4KMUA 4NWIA 3KOOA 4KLGA 2UVRA 4F5OA 1U49A 1OXJA 2R8IA 4F71A 3QU2A 4TUSA 4BDPA 3SAGA 1RYRA 4BGDA 1L3SA 3GILA 2C2EA 2FI1A 4UAWA 8ICTA 5J2CA 3GU3A 5J0XA 1VLBA 2QB1A 2DPIA 2DPJA 1V97A 5F9NA 2C2RA 8ICWA 4KLTA 4ICAA 5J0RA 4NLCA 1FEZA 2HVIA 4F8RA 2W43A 4PHAA 1UT8A 3SMVA 1XU4A 4Y2PA 1SB3C 2W7OA 2KD1A 4RQ1A 4NJ8A 4PHEA 4KN4A 2E8MA 3J81j 4C8LA 1SZHA 4DL4A 1FFVA 2ZIUB 4YR0A 1JX4A 1RPLA 8ICJA 3E2EA 1NJYA 9ICMA 2H3VA 4GXJA 2KJ9A 3KHGA 1XWLA 4ECSA 5BPCA 4E0DA 5KFQA 4DL2A 4O3RA 1U9LA 3MR2A 2EZXA 2I1QA 1ZQXA 5J29A 4UAUA 1QSSA 1DRGA 4RT2A 3NRWA 4UBCA 4O3PA 2KJ8A 3G6XA 2NV3A 2XIDA 3MC1A 3AN1A 4F93B 4YMMA 4C4TA 3QUBA 3MR5A 1LV5A 4P0QB 2WB1C 1X9SA 4CE6A 1T94A 3HPOA 2JV3A 3H8JA 4NLZA 1X9MA 2HMXA 8ICNA 3QU4A 3WKBA 5J2GA 4QZFA 2EZYA 2Z7JA 3ICXA 3QYPA 2XICA 2W9CA 1GO3F 4X5VA 1S8OA 3B0YA 3C23A 3T5JA 3OSPA 5AI6A 5IIOA 3CW2C 2BR0A 2CN1A 1KTQA 3RJJA 2W55A 2R8JA 3Q8SB 2JZBB 2EH9A 2ZJ8A 3PSTA 4CF3A 1DGSA 4DSIA 2PKEA 3LK9A 1K1QA 3MDAA 5IIIA 1PVPA 3N7PD 4KLQA 5KFEA 5J2JA 4Y2UA 3Q8QB 5J2EA 1XSNA 5KFSA 2VJ4A 3AUOA 2AGQA 5KFMA 5KFHA 4EELA 4OD0A 3N97B 1WWVA 1JN3A 3H7IA 4CRXA 4DWIA 2KJ5A 2F1HA 4DL6A 1L6NA 3EPIA 2FLLA 5KT5A 1L5UA 2QB0B 2DFLA 1RXVA 4US9A 3OJSA 3AM9A 3TQ1A 2PFPA 3RBDA 4KITB 4FFDA 4JB3A 4O3OA 1XS9D 4I2EA 2G0AA 3PZPA 4FS2A 4KLMA 1ZQUA 1XSLA 2H3ZA 1NOMA 4ELUA 2O6KA 3LVWA 1YT3A 5AM1A 4OJ5A 5KFFA 4JWNA 4QWAA 4KLUA 2HBKA 4GC6A 2NRZA 9ICNA 3QZ7A 2KP7A 4FBTA 4QWBA 1S10A 2UVWA 4KLSA 5IILA 2LYHA 3HKZC 1MC8A 3V7JA 3AQEA 5AK6A 2I9GA 3Q8KA 1JIHA 1XSPA 2IHNA 2G5HB 2K4PA 3C21A 1MN8A 3H0MB 5G5GA 1SIJA 7ICRA 1KDHA 2OHFA 4R8UA 4GXIA 4RQ4A 5KTQA 1VDVA 1NK8A 4C4SA 4DLEA 9ICQA 1ZQMA 5ALRA 2IBKA 4ACOA 3PSFA 4NV0A 4IQVA 5K4LA 1L3UA 4IQWA 4UB2A 4QIWC 3MR3A 2JHDA 3RB0A 5EE9A 9ICOA 1PUZA 1DOQA 2AHOB 1Q3VA 3JPTA 1P7DA 4KLHA 4YP3A 4CDGA 5L1MA 1B0XA 5AKXA 4EYIB 3BS5B 2WF7A 9ICKA 3M9NB 3EWAA 5ALXA 2HVHA 1IIPA 4YR2A 4IRKA 4R64A 4I2GA 3AQFA 3KHRA 4J9QA 4FBUA 3RJEA 2KVCA 4NLGA 1HJPA 1HUOA 5DGBA 5ALMA 5L9XA 3K1ZA 2VA3A 4KTQA 3C1ZA 1TV9A 2YMMA 3ONNA 2KHQA 4Y2VA 1TVAA 3WKAA 1PVQA 3EPGA 1UA0A 5IIMA 3RR7A 1X40A 4Y2SA 2VIXA 2KZMA 3OSNA 1ZQ1C 2OWOA 4XA5A 1F5SA 1ZRNA 3UQ2A 3VC8A 2G06A 5ALEA 5J0WA 3GZFA 4O3QA 3SD7A 2YTUA 4Y2RA 1BNPA 4DCCA 9ICEA 2NO5A 1S97A 4OJ6A 5C5JA 3QE9Y 2G07A 3M7DA 4HAIA 2IMWP 2ES6A 1HUZA 1D8LA 3AU2A 4Q8EA 3FYHA 2YB4A 4EEKA 4G3IA 3E0FA 2FDRA 2W11A 5JU5A 5JTIA 3H0RB 2W03A 2ZIUA 2BCUA 3QUCA 2A1AA 3OJUA 1ZRMA 1ZQJA 3GV7B 2F8KA 4DOAA 5AI8A 1COKA 2L5YA 3AEVA 2FE9A 4RQ7A 5ALKA 2WF5A 2ODGA 2IA6A 2FPMA 5ALOA 4DF4A 2LYAA 4JV0A 1KEJA 1KL9A 3Q8RB 4DSJA 2IOHA 2Y9UA 3TI0A 2LPEA 2G08A 9ICWA 1BPDA 5L1KA 7ICIA 3PW5A 1D9DA 4F5RA 2E5SA 3H4DA 2H3QA 2DL0A 3G6YA 4DFDA 7ICNA 5KT2A 1N56A 2LM4A 4ED7A 1Z1VA 4R8UB 4DFJA 5KFCA 4RQ8A 3PR4A 2NYVA 4Z6FA 4K4HA 3QZ8A 1K1SA 8ICRA 1IM4A 3NUQA 3D2QA 5J2AA 5ALYA 1NK6A 5KL8B 1ZQLA 1Z4OA 2BZFA 4I28A 3KKAA 2WFAA 4F3OA 3OGUA 3IV6A 3M9MB 5BOMA 1MQ2A 8ICXA 1NKBA 1ZD3A 1ZQKA 2FMSA 3BQ0A 3RTVA 3ZDBA 2KZZA 3GIMA 4Y2QA 4DS4A 4CGZA 3WK8A 4F50A 3DDHA 1JMSA 1ZQWA 3ZI4A 5AKLA 1JXEA 2ZIXA 2VKQA 4PHPA 2B6GA 5D49A 2K8BB 1KKXA 2ZUDA 4NM1A 1ZQEA 4LVSA 4F92B 3S6JA 4K4IA 2BHNA 3UPQA 2OYYA 1ZOLA 1UHUA 2KFZA 8ICVA 2J6UA 3EZ5A 1KBUA 2Q4TA 1NJXA 2W9BB 2K60A 4QZ9A 3TFRA 1LVHA 3T5HA 4YD2A 3PSPA 4UW9A 1MQ3A 3TAPA 8ICFA 8ICLA 4IS7A 2R8GA 3IN5A 3K75D 1LKYB 4YMOA 5KG0A 2HDOA 4RPXA 2RP5A 3RB4A 4QIWF 4RPYA 4F91B 3BQ1A 4MFFA 2WF8A 5DB6A 4BWJA 4PHDA 4ECRA 4RU9A 2F77X 2ALZA 2JH1A 3IHQB 2D8CA 5AKHA 5KT7A 4TQRA 4F5QA 1ZQNA 1BPYA 2JGAA 2EDUA 2BDPA 5ALVA 4YFKA 2OXOA 1A77A 2W9CB 5AM2A 4ZH4A 3TKAA 1N62A 4MFCA 4MFAA 3FM9A 1SKWA 5KFUA 2E1EA 3SYZA 2HHSA 4MEXA 5EE0A 9ICCA 1JUDA 1U4BA 2FPLA 5TISU 2OM6A 4DQRA 1ZYQA 5HHIA 1Y88A 5EOZA 5KG3A 2KKPA 5B66U 3U26A 2RRDA 5ALQA 7ICUA 4DOBA 5DBBA 5KG6A 5AHXA 4UAYA 4ECVA 9ICSA 5ALDA 1RYUA 2HOIA 4M9NA 3ZDEA 2A1JA 4KMOB 1ED1A 1XNSA 1SKRA 4ECWA 5KAIU 1H38A 4YN4A 9ICUA 2KICA 1KW4A 4RQ0A 4JUZA 4B9MA 4PZNA 2R8KA 4KLIA 2HHWA 3IG8A 1J97A 2JEFA 2JXJA 1V9PA 4UASA 3N4MB 2W9BA 2PFOA 3THVA 3UXOA 5DB7A 9ICGA 4KLJA 2UVUA 4O3MA 8ICIA 3HP6A 3GV5B 2PXIA 4KLEA 7ICFA 2ZUCA 1LKYA 3MGIA 4C8OA 2LYBA 2H3IA 9ICTA 3WKDA 4QZHA 3GIIA 3DEEA 1U47A 2J6SA 3ISCA 2LKYA 1JROA 5GTHU 1O03A 3GV8B 4ED3A 3JPPA 2KFNA 3V72A 3M6KA 4DSEA 5AM0A 3RAQA 3KZIU 4XUSA 2M0NA 1KFTA 4OCZA 5EWFA 5KFAA 4JMUA 1FIQA 5AI4A 5HNKA 4DS5A 1Q3UA 4P2HA 2YMPA 2BPGA 5AKIA 4MF2A 3FC4A 1SL1A 3WK9A 4PPXA 3NASA 5AIAA 3PW7A 4O5KA 5D4BA 3NVVA 5CEHA 1WYGA 3BS5A 3JPQA 4RNOA 3PW4A 4K4GA 1O08A 1U48A 2ZTEA 5J0TA 3TAQA 9ICIA 4UB8U 4FO6A 8ICUA 1Z19A 3HW8A 4RQ6A 1DK2A 1UPHA 4J9NA 4LZDA 1RYSA 4PGXA 3AMZA 1QQ6A 4Y2XA 3SV3A 5KFNA 1BGXT 4NL9C 4OJPA 3KD3A 4BWMA 5BOLA 5CWRA 4RT3A 3AL0B 7ICJA 4EX6A 1WCLA 3ETLA 3N7SC 4OJLA 4Y2YA 1KFSA 3PR5B 3ZDAA 4C0ZA 1CRXA 1ZQGA 5IIJA 4ELVA 1L7MA 1SL0A 1U45A 1B43A 1NKCA 3T3FA 4ZOHC 5DQIA 5J0OA 2BQUA 4F2RA 3QEAZ 4O0IA 2KOBA 9ICJA 2NRVA 4C4RA 4NY8A 3C5FA 9ICPA 3RH5A 5J2HA 2KEYA 5ALUA 2KTQA 3KBBA 3N7RC 3F5EA 4J9SA 2Y1IA 2MUTB 3PY8A 2K4IA 2KNJA 2PMZF 5KFZA 2IHMA 3QEBZ 4M04A 1T3QA 5J0QA 3RJHA 4EBEA 3BS7A 3EYZA 4PGYA 4JWMA 1S9FA 1TAUA 4I2DA 3A0HU 3CNHA 5DB8A 3FDSA 4DL5A 5B5EU 4DFKA 1L8LA 1Z00B 5CR0A 1J2NA 4F4WA 4NLBA 1QQ7A 3Q8PB 4QZDA 4YQWA 5ALGA 1SL2A 1QTMA 7ICPA 5T14A 1FFUA 1ZQTA 5DBCA 1V85A 3PW0A 4C7YA 2W8KA 4M9GA 1ZJNA 1WG8A 4UB3A 4U6PA 5DGAA 4C8KA 4QNLA 5AKEA 1ZQBA 5KFPA 3G6VA 3SI8A 8ICQA 3RH6A 5AKGA 4F72A 4EBDA 1QLNA 4KLFA 3JPOA 1TE2A 3ETRA 2WTFA 2BKEA 3QNMA 4QZBA 1AQ6A 4A8EA 2VA2A 4QZCA 2BDUA 1X9WA 2E8OA 3ZD9A 4Z6CA 2HW3A 5AI9A 5EWEA 1ECWA 8ICZA 4DQIA 3KHHA 2XC9A 4C7ZA 1Z1BA 3MFIA 3FAHA 2WAQF 3BZKA 4PJ0U 5G5HA 4IQUA 2G09A 2JMGA 3V7KA 4M9HA 2E1FA 2ZIXB 3QU5A 4EENA 4I2JA 2A1JB 3V6HA 4F2SA 4QWCA 2HI0A 4AYBC 4IRCA 5CRXA 2NRXA 2JRZA 5EE3A 2BQRA 9ICLA 4WJ3B 1Q8KA 2RLTA 3PMLA 3F53A 4B9LA 3PSIA 4QZGA 3C5GA 2K8AA 2EANA 3H8SA 5EWGA 1S76D 3DV9A 3HILA 2W54A 2HCFA 4B6JA 1ZD5A 3IDWA 5KFWA 4EX7A 1Q46A 4M6WA 1S0OA 4QZIA 2Y9TA 4C8NA 2QARB 4FZLA 2MUTA 9ICHA 3RRHA 5AK4A 4AYBF 2HHUA 3C2LA 8ICYA 4ED6A 4DL7A 5KNIA 3AU6A 7ICVA 2W8LA 2VANA 3M1YA 3ORYA 4UB6U 2ESEA 2ZIVB 4IRDA 4QWDA 4GIBA 1ZD4A 3C2MA 2XGPA 2DF4B 3C28A 2W7PA 4UBBA 3E58A 2F1IA 1ZQFA 1QH9A 2MRLA 4C8MA 1C7YA 4RZRA 7ICTA 3WK4A 5DLFA 7ICEA 2K4EA 4UQGA 4MEYA 3RAXA 1S77D 2BCRA 1ZQVA 2A3VA 2Y0SC 1HIWA 1SZPA 3B9JA 5J2BA 5J2DA 2DKXA 2QB0A 4CF5A 1QSLA 2ZXIA 4IR9A 4IQTA 4ECQA 3LWMA 4GXKA 1SXDA 1ZD2P 3V7LA 2MSNA 3N28A 2EAPA 2ZUBA 2CXYA 3H4BA 2V9WA 1ZQHA 5J0UA 1NK4A 4IC9A 5DG7A 1NJWA 3PO4A 3NGDA 2AGPA 1SXEA 3MFHA 2YX8A 5J0SA 2OEHA 1X42A 2Q0ZX 4C80A 2DWQA 1JI7A 1WUDA 1NK7A 1F0MA 2BCQA 4CF4A 4BX9C 3BQ2A 4ECXA 2ATLA 2ZJ5A 3Q8LA 2C22A 3M8SA 4QJFB 1D9FA 3HX0A 4KX5A 2Y0SF 2FMQA 3OTQA 3C2KA 2A19A 2V4RA 2ZXHA 4RQMA 4Q44A 5J8YC 5ALIA 4Q8FA 5DG9A 5J8YA 1SV4A 4J9PA 2OH2A 1ZQQA 3C29A 1BNOA 3HKZF 4UARA 4J9LA 4QZ8A 3QX7A 4ED1A 1T8EA 4AP9A 1KN5A 4QZEA 4FE3A 2E8NA 3PVXA 1MSWD 3V6JA 1IV8A 1NI3A 2GOLA 1LB2B 3NVZA 2YQEA 5KFRA 1YZ7A 8ICPA 3NS1A 5L1LA 4RQ3A 2ZJAA 5AI0A 2ZIWB 1N63A 1T7PA 1ZXIA 1YZ6A 4RQNA 4P0QA 3H40A 4ED2A 9ICFA 3OPXA 4DQPA 8ICSA 4DL3A 2F76X 1PK3A 5KFDA 2BPFA 7ICOA 4MF8A 5KFJA 1TAQA 2CRXA 8ICCA 4O5CA 4U7CA 1VJ5A 2DQNB 1CEZA 5KG1A 2HHQA 5AKJA 5HHHA 2M9NA 5DDYA 2WF9A 4LZGA 4CNQA 2WF6A 1D8BA 4P4MA 3BQ7A
chains in the Genus database with same CATH topology
2JMGA 4OJ6A 2YX8A 2K8CB 2LBOA 2E1FA 2G5HB 2VJ5A 2ZIXB 3M6KA 3LVVA 3H0MB 4NWIA 5KL1B 2E1EA 2G07A 3D2SA 2ZG6A 3M7DA 2R18A 2Z7JA 3H0LB 4GFJA 2KEYA 4CGZA 3ICXA 4AYBC 3T79A 2YB1A 2KV2A 2M0NA 2XICA 3F5EA 3N7RC 1GO3F 1OUQA 5CRXA 1WUDA 2YB4A 2ZIVA 4JMUA 1A0PA 4WJ3B 2K4IA 2KNJA 2PMZF 3E0FA 1PVRA 5A0LA 3F53A 2ZIXA 3PSIA 4BX9C 3SAGA 1Q3UA 2OM6A 2F8LA 3H0RB 2K8AA 3KZXA 4KX3A 2HOFA 2VKQA 4ACOA 3PSFA 2CN1A 2RHFA 4NV0A 2K8BB 2W03A 4QJFB 1XO0A 2KIWA 2HBLA 2ZIUA 2D6FC 4KX5A 2KKPA 2Y0SF 3PSTA 3GU3A 1F44A 2G5IB 4QIWC 2RRDA 1A6SA 3MGVA 2JHDA 1PVPA 2ZXHA 3N7PD 2N1RA 4ICAA 1Q3VA 2OYYA 2W04A 2LYAA 4FZLA 4NLCA 1P7DA 1URJA 3LYSA 2F2AB 4CDGA 3SQIA 2OH2A 4AYBF 3C29A 3SAFA 3HKZF 4NLBA 2G09A 4FZMA 2HOIA 1KBUA 2VJ4A 2Q4TA 3SMVA 3F5AA 2WAQC 2WB1F 3KFUF 2G08A 2JH7A 3L3FX 4FE3A 4KMOB 1ED1A 3ALRA 3IG5A 5T14A 2E5SA 2W7OA 2KD1A 3PSPA 1XNSA 4CRXA 2H3QA 2ZIVB 2MA1A 1Z19A 2KJ5A 3SAHA 1L6NA 3O0FA 3F2DA 1UPHA 2DF4B 3CYMA 2GOLA 1IIPA 3C28A 3IN5A 2W7PA 4OJOA 3RFAA 5HR7A 2HBJA 2HOQA 3IP4B 3CRXA 4P0PA 2KICA 2RP5A 2XVTA 1SZHA 3AQFA 4QIWF 4U6PA 2MRLA 2CPRA 2ZIUB 4QNLA 2DGZA 1HEKA 2ZIWB 3IG8A 3M6ZA 4OJPA 1NZBA 2G0AA 2HBMA 3PZPA 2KVCA 2H3VA 2KJ9A 2K4EA 1MA7A 4PL2A 3K1ZA 4FZNA 3AL0B 4P0QA 2A3VA 2Y0SC 4BUGA 3F2BA 3NUQA 4P0PB 1HIWA 3ONNA 4OO1J 3OPXA 2GH1A 2KHQA 2H3ZA 3D2QA 2K4HA 4O3MA 3N7SC 4OJLA 2KKVA 2F77X 2F76X 1PVQA 5KL8B 5C0YA 3LVWA 1YT3A 4A8EA 4C0ZA 2JH1A 2CRXA 2H3FA 2LYBA 2ZXIA 2BDUA 2H3IA 4OJ5A 1CRXA 2PMZC 1DRGA 3NRWA 2HBKA 2VIXA 2KJ8A 2ZIWA 3F2CA 3DEEA 1TAMA 1ECWA 2NV3A 1ZQ1C 2JGAA 2XI9A 2XIDA 2DQNB 4BJQA 4U7CA 5HR6A 2LKYA 3VC8A 2G06A 1Z1BA 3CP8A 4P0QB 3GZFA 3RF9A 2WAQF 2OXOA 2WB1C 4IC9A 4PL1A 3VCBA 1T94A 2K89A 3HKZC 1D8BA 2HMXA 2KOBA 3AQEA 2KHVA 2LHTA 3D2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKP A;  2KKV A;  1Z19 A;  1F44 A;  2KJ5 A;  1PVQ A;  3MGV A;  4A8E A;  1PVP A;  3C28 A;  2CRX A;  2KEY A;  1CRX A;  1Q3V A;  3CRX A;  1DRG A;  5CRX A;  1OUQ A;  3NRW A;  1P7D A;  2KJ8 A;  3LYS A;  1A0P A;  1PVR A;  3C29 A;  1NZB A;  2KJ9 A;  1Z1B A;  1Q3U A;  1MA7 A;  1KBU A;  2HOI A;  4CRX A;  2HOF A;  2OXO A;  4ACO A;  2A3V A;  2KIW A;  1XO0 A;  1XNS A;  2KOB A;  2KHQ A;  2KD1 A;  2KHV A; 
#chains in the Genus database with same CATH topology
 5ALW A;  4O5E A;  4M47 A;  2KV2 A;  5KT4 A;  4I29 A;  3UMG A;  2KZ3 A;  1RM6 C;  5J2K A;  2C28 A;  4O3S A;  3PW2 A;  1IXR A;  3QXG A;  3UM9 A;  2BCS A;  1Z4N A;  4I2H A;  1ZQD A;  2AGO A;  1F44 A;  4USA A;  5AKZ A;  5KT3 A;  3SR6 A;  4DFP A;  1X9X A;  2F2A B;  1QCK A;  3RBE A;  5ALS A;  3PMN A;  9ICX A;  1ZQR A;  3KFU F;  1DXS A;  2WB1 F;  2BQ3 A;  1TK0 A;  3ISD A;  5KG7 A;  2DUY A;  2VA8 A;  1KRP A;  3ZDC A;  1RDF A;  1J2M A;  1L3V A;  3RB6 A;  2RDI A;  3CYM A;  1XO1 A;  2XCA A;  5HR7 A;  4RQ2 A;  3CRX A;  4RNM A;  2XVT A;  4DSL A;  4Y2J A;  4DFM A;  3NRZ A;  2B21 A;  5AKK A;  1DGJ A;  5D46 A;  4YG2 A;  4PH5 A;  2PFN A;  2J6T A;  2MU2 A;  4FZN A;  3H8M A;  2FLP A;  1N61 A;  3F2B A;  5ALL A;  3BZC A;  4JK1 A;  4Z6D A;  5AIB A;  2P6R A;  2KMD A;  2FMP A;  1NK9 A;  2PMZ C;  2ZIW A;  1X66 A;  2XI9 A;  5CP2 A;  3WK7 A;  1Z3E B;  3HRD D;  2QAR A;  1ZQO A;  1SV0 C;  5AM5 A;  1SKS A;  3RJF A;  2LHT A;  4EEY A;  1QQ5 A;  2K8C B;  4DOC A;  3B0X A;  1IG6 A;  3H0L B;  2JR5 A;  2AXT U;  2ZIV A;  5J0Y A;  1BPE A;  5A0L A;  4F4Z A;  4KN7 A;  5E79 U;  3T5K A;  4JV1 A;  4KX3 A;  3KZX A;  2HOF A;  2W3S A;  4YCX A;  5KFG A;  5AM3 A;  2KIW A;  1L7O A;  8ICH A;  5CB1 A;  5ALT A;  3GFK B;  2N1R A;  2IOF A;  2XGQ A;  4DQS A;  3L5K A;  2W04 A;  3ZD8 A;  1S0N A;  3TAN A;  2KK0 A;  1L7N A;  3SAF A;  4B9T A;  1N48 A;  4CCH A;  2ASJ A;  4O9M A;  9ICA A;  3F5A A;  5DQH A;  1UCV A;  5KFV A;  3SAH A;  3F2D A;  5KG2 A;  3UQ0 A;  4EZ9 A;  3UMB A;  4R65 A;  4G9B A;  1PZN A;  3MBY A;  2BGW A;  4I2A A;  1ARO P;  1T4G A;  2HBM A;  3I76 A;  3RB3 A;  4J9M A;  4PL2 A;  1MA7 A;  4ECY A;  3TAC B;  4UB1 A;  4BUG A;  2DBY A;  3WK5 A;  4P0P B;  2F1J A;  2GH1 A;  3GDX A;  2KVS A;  2W3R A;  5J2F A;  1ZQP A;  4HYK A;  5AK3 A;  5CHG A;  3JPN A;  4RPZ A;  2ZTC A;  2PI5 A;  3SV4 A;  1N2X A;  5J0P A;  1TAM A;  4BJQ A;  2H5X A;  3D6J A;  2YN4 A;  3VCB A;  3MGH A;  4DO9 A;  4ELT A;  3BDP A;  4Q45 A;  3NVW A;  9ICR A;  1RG6 A;  3LVV A;  5IIN A;  3M9O B;  1CUK A;  4GFJ A;  5JUM A;  3C1Y A;  2DKZ A;  1WWU A;  3V6K A;  4TUQ A;  5ALH A;  3RJG A;  1BVS A;  4B9U A;  3HJE A;  1WCN A;  1TKD A;  2YY6 A;  5CA7 A;  4M6W B;  2F8L A;  3L4P A;  4KLO A;  3KKA C;  4DEZ A;  3UXP A;  5GTI U;  2HBL A;  2D6F C;  3PNC A;  5AK5 A;  1A6S A;  8ICE A;  3TAR A;  5DDM A;  2KSO B;  1N5X A;  3H8W A;  4UAT A;  1TK8 A;  1TK5 A;  2BPC A;  3I28 A;  5AKY A;  4R63 A;  3R9K A;  5TZV A;  3ZDD A;  2EAO A;  5ALN A;  4NL9 A;  4I2B A;  4Y2T A;  4O3N A;  2QLT A;  2I5H A;  4J03 A;  4DQQ A;  2GLE A;  2NO4 A;  4EZ6 A;  3M8R A;  2MAX A;  3QUQ A;  4I2F A;  4UAZ A;  5DB9 A;  1SWW A;  5H2F U;  4UB5 A;  2HBJ A;  2LM1 A;  5KAF U;  5F9L A;  3TFS A;  4QWE A;  1UQV A;  2LMR A;  2W9A A;  2XCP A;  4QW8 A;  9ICB A;  2GWS A;  4ED0 A;  4Z6E A;  2AQ4 A;  4P4O A;  3WKC A;  1ZQZ A;  4TQS A;  4B9N A;  2XY5 A;  1CI4 A;  1NKE A;  5C0Y A;  4EYH B;  2HSZ A;  4M2Y A;  2XY7 A;  2EQY A;  1K5O A;  1S5L U;  2RQ5 A;  4NLN A;  3F2C A;  5F3X B;  4YXJ A;  4KLL A;  2QKQ A;  3QU7 A;  5HML A;  4YR3 A;  4I2I A;  1KQQ A;  5KFB A;  4NXZ A;  2AU0 A;  4YD1 A;  5KL1 B;  3D2S A;  5KFK A;  2HHX A;  1M6Y A;  5AIC A;  8ICB A;  4DF8 A;  1OUQ A;  1PK1 B;  2JEG A;  1A0P A;  1ZQY A;  3GIJ A;  2D3D A;  1NZP A;  1ZQC A;  4BXO A;  5L1J A;  1JXL A;  1S0V A;  4R66 A;  4ECZ A;  5KT6 A;  5CJ7 A;  5AM4 A;  2LI6 A;  4NM2 A;  3UMC A;  2G5I B;  2KG5 A;  2IOF K;  2KE7 A;  2WHE A;  2AJQ A;  2JEI A;  3OHA A;  8ICM A;  1UA1 A;  2UVV A;  1URJ A;  1X6I A;  3LYS A;  4MHV A;  1SGG A;  5KFY A;  4YMN A;  2JZB A;  5IIK A;  3JPS A;  7ICS A;  2WAQ C;  2ASD A;  4US8 A;  2YML A;  1N60 A;  1X2I A;  2MA1 A;  3KHL A;  1Z00 A;  4Q43 A;  3HT3 A;  2P35 A;  2P6U A;  2KSO A;  3RFA A;  5ALF A;  1B4F A;  2PFQ A;  3MDC A;  2ASL A;  8ICA A;  1HEK A;  2AQ0 A;  4YVZ A;  1NZB A;  1KSP A;  1COO A;  2BCV A;  4ECU A;  4ED8 A;  1X6J A;  4P4P A;  4JV2 A;  2KIV A;  2KKV A;  1SWV A;  5J2I A;  4M0A A;  2H3F A;  4PZO A;  1ZQA A;  8ICO A;  3KTQ A;  5ALJ A;  4GLX A;  4PL1 A;  5DKW A;  2K89 A;  3PX4 A;  3T5L A;  4F4K A;  2KHV A;  3D2N A;  3PX0 A;  2LBO A;  2VJ5 A;  1QSY A;  4XQ8 A;  2ZG6 A;  4M9L A;  1KFD A;  3QUT A;  3T79 A;  3RRG A;  4PGQ A;  5HP4 A;  3WK6 A;  4J9R A;  3WU2 U;  4I27 A;  1JRP A;  8ICG A;  3NTU A;  1N5W A;  2RHF A;  4LJX A;  1XO0 A;  3SEI A;  5KFX A;  8ICK A;  2R8H A;  5FP0 A;  4ECT A;  4UB4 A;  3LDA A;  1JAL A;  2YMQ A;  2FJ6 A;  4IL6 U;  4YXM A;  3SEN A;  2W9M A;  4BXO B;  2V4Q A;  4FS1 A;  3SQI A;  3K1R B;  4TUP A;  1RZT A;  1NK0 A;  4FZM A;  2KN7 A;  3RR8 A;  3PO5 A;  4J9O A;  2JH7 A;  3L3F X;  1UT5 A;  2E3T A;  3ALR A;  3IG5 A;  1RXW A;  5KFI A;  3WKE A;  4EBC A;  3UXN A;  4F5P A;  4OJO A;  3K4G A;  4B9S A;  2GO7 A;  3IP4 B;  1NNL A;  3EW9 A;  2CPR A;  3RH4 A;  3NVY A;  3M6Z A;  2XY6 A;  1ZQI A;  1L8O A;  3PX6 A;  3IRU A;  4GC7 A;  4RUA A;  1T3N A;  1ZET A;  2K4H A;  2C2D A;  5HMM A;  1RQN A;  2P66 A;  2EZZ A;  4QW9 A;  3RJK A;  2E8P A;  1RQL A;  1XC9 A;  2Y1J A;  3MR6 A;  7ICM A;  3IM1 A;  3RF9 A;  1NJZ A;  4DLG A;  3MAB A;  5KG4 A;  3LWL A;  1B22 A;  2R18 A;  2HHT A;  1L3T A;  2YB1 A;  5ALP A;  1L7P A;  3TAD A;  3BQT A;  3I1Y A;  2RDJ A;  1PVR A;  2AH5 A;  4M9J A;  2PI4 A;  1S0M A;  1BPX A;  4DSF A;  4J9K A;  1FO4 A;  3MGV A;  3EUB 2;  4KLD A;  3TAD C;  5JRT A;  5DQG A;  4F4Y A;  2XO7 A;  2F3N A;  2EAM A;  4QZA A;  3ISB A;  1OW5 A;  5ALZ A;  7ICG A;  2B0C A;  2FPK A;  5KFO A;  2ZTD A;  1BPZ A;  2ISO A;  1D8Y A;  5AI5 A;  2HHV A;  7ICH A;  5KFL A;  4RUC A;  2NRW A;  5L1I A;  3O0F A;  1C20 A;  3RJI A;  3QU9 A;  1DK3 A;  5KFT A;  2HOQ A;  3GIK A;  3SZ2 A;  3GQC A;  4P0P A;  1BPB A;  2JEJ A;  4DSK A;  1EXN A;  2DGZ A;  2I6X A;  4RQ5 A;  4NLK A;  9ICV A;  1ZJM A;  3HWT A;  7ICK A;  2OCE A;  1V38 A;  1SV0 A;  5EE1 A;  1KLN A;  1PK1 A;  4OO1 J;  2ISP A;  4IR1 A;  4F4X A;  4TUR A;  4XRH A;  4F5N A;  4I2C A;  3BJY A;  5DG8 A;  5HR6 A;  3JPR A;  2NRT A;  3CP8 A;  1TFR A;  3PV8 A;  3OHB A;  1A76 A;  1NK5 A;  1ZQS A;  3A0B U;  4UAV A;  3ED5 A;  2FLN A;  5DBA A;  4B9V A;  5DLG A;  3Q8M A;  4RNN A;  5KG5 A;  2F44 A;  7ICQ A;  7ICL A;  4KMU A;  4NWI A;  3KOO A;  4KLG A;  2UVR A;  4F5O A;  1U49 A;  1OXJ A;  2R8I A;  4F71 A;  3QU2 A;  4TUS A;  4BDP A;  3SAG A;  1RYR A;  4BGD A;  1L3S A;  3GIL A;  2C2E A;  2FI1 A;  4UAW A;  8ICT A;  5J2C A;  3GU3 A;  5J0X A;  1VLB A;  2QB1 A;  2DPI A;  2DPJ A;  1V97 A;  5F9N A;  2C2R A;  8ICW A;  4KLT A;  4ICA A;  5J0R A;  4NLC A;  1FEZ A;  2HVI A;  4F8R A;  2W43 A;  4PHA A;  1UT8 A;  3SMV A;  1XU4 A;  4Y2P A;  1SB3 C;  2W7O A;  2KD1 A;  4RQ1 A;  4NJ8 A;  4PHE A;  4KN4 A;  2E8M A;  3J81 j;  4C8L A;  1SZH A;  4DL4 A;  1FFV A;  2ZIU B;  4YR0 A;  1JX4 A;  1RPL A;  8ICJ A;  3E2E A;  1NJY A;  9ICM A;  2H3V A;  4GXJ A;  2KJ9 A;  3KHG A;  1XWL A;  4ECS A;  5BPC A;  4E0D A;  5KFQ A;  4DL2 A;  4O3R A;  1U9L A;  3MR2 A;  2EZX A;  2I1Q A;  1ZQX A;  5J29 A;  4UAU A;  1QSS A;  1DRG A;  4RT2 A;  3NRW A;  4UBC A;  4O3P A;  2KJ8 A;  3G6X A;  2NV3 A;  2XID A;  3MC1 A;  3AN1 A;  4F93 B;  4YMM A;  4C4T A;  3QUB A;  3MR5 A;  1LV5 A;  4P0Q B;  2WB1 C;  1X9S A;  4CE6 A;  1T94 A;  3HPO A;  2JV3 A;  3H8J A;  4NLZ A;  1X9M A;  2HMX A;  8ICN A;  3QU4 A;  3WKB A;  5J2G A;  4QZF A;  2EZY A;  2Z7J A;  3ICX A;  3QYP A;  2XIC A;  2W9C A;  1GO3 F;  4X5V A;  1S8O A;  3B0Y A;  3C23 A;  3T5J A;  3OSP A;  5AI6 A;  5IIO A;  3CW2 C;  2BR0 A;  2CN1 A;  1KTQ A;  3RJJ A;  2W55 A;  2R8J A;  3Q8S B;  2JZB B;  2EH9 A;  2ZJ8 A;  3PST A;  4CF3 A;  1DGS A;  4DSI A;  2PKE A;  3LK9 A;  1K1Q A;  3MDA A;  5III A;  1PVP A;  3N7P D;  4KLQ A;  5KFE A;  5J2J A;  4Y2U A;  3Q8Q B;  5J2E A;  1XSN A;  5KFS A;  2VJ4 A;  3AUO A;  2AGQ A;  5KFM A;  5KFH A;  4EEL A;  4OD0 A;  3N97 B;  1WWV A;  1JN3 A;  3H7I A;  4CRX A;  4DWI A;  2KJ5 A;  2F1H A;  4DL6 A;  1L6N A;  3EPI A;  2FLL A;  5KT5 A;  1L5U A;  2QB0 B;  2DFL A;  1RXV A;  4US9 A;  3OJS A;  3AM9 A;  3TQ1 A;  2PFP A;  3RBD A;  4KIT B;  4FFD A;  4JB3 A;  4O3O A;  1XS9 D;  4I2E A;  2G0A A;  3PZP A;  4FS2 A;  4KLM A;  1ZQU A;  1XSL A;  2H3Z A;  1NOM A;  4ELU A;  2O6K A;  3LVW A;  1YT3 A;  5AM1 A;  4OJ5 A;  5KFF A;  4JWN A;  4QWA A;  4KLU A;  2HBK A;  4GC6 A;  2NRZ A;  9ICN A;  3QZ7 A;  2KP7 A;  4FBT A;  4QWB A;  1S10 A;  2UVW A;  4KLS A;  5IIL A;  2LYH A;  3HKZ C;  1MC8 A;  3V7J A;  3AQE A;  5AK6 A;  2I9G A;  3Q8K A;  1JIH A;  1XSP A;  2IHN A;  2G5H B;  2K4P A;  3C21 A;  1MN8 A;  3H0M B;  5G5G A;  1SIJ A;  7ICR A;  1KDH A;  2OHF A;  4R8U A;  4GXI A;  4RQ4 A;  5KTQ A;  1VDV A;  1NK8 A;  4C4S A;  4DLE A;  9ICQ A;  1ZQM A;  5ALR A;  2IBK A;  4ACO A;  3PSF A;  4NV0 A;  4IQV A;  5K4L A;  1L3U A;  4IQW A;  4UB2 A;  4QIW C;  3MR3 A;  2JHD A;  3RB0 A;  5EE9 A;  9ICO A;  1PUZ A;  1DOQ A;  2AHO B;  1Q3V A;  3JPT A;  1P7D A;  4KLH A;  4YP3 A;  4CDG A;  5L1M A;  1B0X A;  5AKX A;  4EYI B;  3BS5 B;  2WF7 A;  9ICK A;  3M9N B;  3EWA A;  5ALX A;  2HVH A;  1IIP A;  4YR2 A;  4IRK A;  4R64 A;  4I2G A;  3AQF A;  3KHR A;  4J9Q A;  4FBU A;  3RJE A;  2KVC A;  4NLG A;  1HJP A;  1HUO A;  5DGB A;  5ALM A;  5L9X A;  3K1Z A;  2VA3 A;  4KTQ A;  3C1Z A;  1TV9 A;  2YMM A;  3ONN A;  2KHQ A;  4Y2V A;  1TVA A;  3WKA A;  1PVQ A;  3EPG A;  1UA0 A;  5IIM A;  3RR7 A;  1X40 A;  4Y2S A;  2VIX A;  2KZM A;  3OSN A;  1ZQ1 C;  2OWO A;  4XA5 A;  1F5S A;  1ZRN A;  3UQ2 A;  3VC8 A;  2G06 A;  5ALE A;  5J0W A;  3GZF A;  4O3Q A;  3SD7 A;  2YTU A;  4Y2R A;  1BNP A;  4DCC A;  9ICE A;  2NO5 A;  1S97 A;  4OJ6 A;  5C5J A;  3QE9 Y;  2G07 A;  3M7D A;  4HAI A;  2IMW P;  2ES6 A;  1HUZ A;  1D8L A;  3AU2 A;  4Q8E A;  3FYH A;  2YB4 A;  4EEK A;  4G3I A;  3E0F A;  2FDR A;  2W11 A;  5JU5 A;  5JTI A;  3H0R B;  2W03 A;  2ZIU A;  2BCU A;  3QUC A;  2A1A A;  3OJU A;  1ZRM A;  1ZQJ A;  3GV7 B;  2F8K A;  4DOA A;  5AI8 A;  1COK A;  2L5Y A;  3AEV A;  2FE9 A;  4RQ7 A;  5ALK A;  2WF5 A;  2ODG A;  2IA6 A;  2FPM A;  5ALO A;  4DF4 A;  2LYA A;  4JV0 A;  1KEJ A;  1KL9 A;  3Q8R B;  4DSJ A;  2IOH A;  2Y9U A;  3TI0 A;  2LPE A;  2G08 A;  9ICW A;  1BPD A;  5L1K A;  7ICI A;  3PW5 A;  1D9D A;  4F5R A;  2E5S A;  3H4D A;  2H3Q A;  2DL0 A;  3G6Y A;  4DFD A;  7ICN A;  5KT2 A;  1N56 A;  2LM4 A;  4ED7 A;  1Z1V A;  4R8U B;  4DFJ A;  5KFC A;  4RQ8 A;  3PR4 A;  2NYV A;  4Z6F A;  4K4H A;  3QZ8 A;  1K1S A;  8ICR A;  1IM4 A;  3NUQ A;  3D2Q A;  5J2A A;  5ALY A;  1NK6 A;  5KL8 B;  1ZQL A;  1Z4O A;  2BZF A;  4I28 A;  3KKA A;  2WFA A;  4F3O A;  3OGU A;  3IV6 A;  3M9M B;  5BOM A;  1MQ2 A;  8ICX A;  1NKB A;  1ZD3 A;  1ZQK A;  2FMS A;  3BQ0 A;  3RTV A;  3ZDB A;  2KZZ A;  3GIM A;  4Y2Q A;  4DS4 A;  4CGZ A;  3WK8 A;  4F50 A;  3DDH A;  1JMS A;  1ZQW A;  3ZI4 A;  5AKL A;  1JXE A;  2ZIX A;  2VKQ A;  4PHP A;  2B6G A;  5D49 A;  2K8B B;  1KKX A;  2ZUD A;  4NM1 A;  1ZQE A;  4LVS A;  4F92 B;  3S6J A;  4K4I A;  2BHN A;  3UPQ A;  2OYY A;  1ZOL A;  1UHU A;  2KFZ A;  8ICV A;  2J6U A;  3EZ5 A;  1KBU A;  2Q4T A;  1NJX A;  2W9B B;  2K60 A;  4QZ9 A;  3TFR A;  1LVH A;  3T5H A;  4YD2 A;  3PSP A;  4UW9 A;  1MQ3 A;  3TAP A;  8ICF A;  8ICL A;  4IS7 A;  2R8G A;  3IN5 A;  3K75 D;  1LKY B;  4YMO A;  5KG0 A;  2HDO A;  4RPX A;  2RP5 A;  3RB4 A;  4QIW F;  4RPY A;  4F91 B;  3BQ1 A;  4MFF A;  2WF8 A;  5DB6 A;  4BWJ A;  4PHD A;  4ECR A;  4RU9 A;  2F77 X;  2ALZ A;  2JH1 A;  3IHQ B;  2D8C A;  5AKH A;  5KT7 A;  4TQR A;  4F5Q A;  1ZQN A;  1BPY A;  2JGA A;  2EDU A;  2BDP A;  5ALV A;  4YFK A;  2OXO A;  1A77 A;  2W9C B;  5AM2 A;  4ZH4 A;  3TKA A;  1N62 A;  4MFC A;  4MFA A;  3FM9 A;  1SKW A;  5KFU A;  2E1E A;  3SYZ A;  2HHS A;  4MEX A;  5EE0 A;  9ICC A;  1JUD A;  1U4B A;  2FPL A;  5TIS U;  2OM6 A;  4DQR A;  1ZYQ A;  5HHI A;  1Y88 A;  5EOZ A;  5KG3 A;  2KKP A;  5B66 U;  3U26 A;  2RRD A;  5ALQ A;  7ICU A;  4DOB A;  5DBB A;  5KG6 A;  5AHX A;  4UAY A;  4ECV A;  9ICS A;  5ALD A;  1RYU A;  2HOI A;  4M9N A;  3ZDE A;  2A1J A;  4KMO B;  1ED1 A;  1XNS A;  1SKR A;  4ECW A;  5KAI U;  1H38 A;  4YN4 A;  9ICU A;  2KIC A;  1KW4 A;  4RQ0 A;  4JUZ A;  4B9M A;  4PZN A;  2R8K A;  4KLI A;  2HHW A;  3IG8 A;  1J97 A;  2JEF A;  2JXJ A;  1V9P A;  4UAS A;  3N4M B;  2W9B A;  2PFO A;  3THV A;  3UXO A;  5DB7 A;  9ICG A;  4KLJ A;  2UVU A;  4O3M A;  8ICI A;  3HP6 A;  3GV5 B;  2PXI A;  4KLE A;  7ICF A;  2ZUC A;  1LKY A;  3MGI A;  4C8O A;  2LYB A;  2H3I A;  9ICT A;  3WKD A;  4QZH A;  3GII A;  3DEE A;  1U47 A;  2J6S A;  3ISC A;  2LKY A;  1JRO A;  5GTH U;  1O03 A;  3GV8 B;  4ED3 A;  3JPP A;  2KFN A;  3V72 A;  3M6K A;  4DSE A;  5AM0 A;  3RAQ A;  3KZI U;  4XUS A;  2M0N A;  1KFT A;  4OCZ A;  5EWF A;  5KFA A;  4JMU A;  1FIQ A;  5AI4 A;  5HNK A;  4DS5 A;  1Q3U A;  4P2H A;  2YMP A;  2BPG A;  5AKI A;  4MF2 A;  3FC4 A;  1SL1 A;  3WK9 A;  4PPX A;  3NAS A;  5AIA A;  3PW7 A;  4O5K A;  5D4B A;  3NVV A;  5CEH A;  1WYG A;  3BS5 A;  3JPQ A;  4RNO A;  3PW4 A;  4K4G A;  1O08 A;  1U48 A;  2ZTE A;  5J0T A;  3TAQ A;  9ICI A;  4UB8 U;  4FO6 A;  8ICU A;  1Z19 A;  3HW8 A;  4RQ6 A;  1DK2 A;  1UPH A;  4J9N A;  4LZD A;  1RYS A;  4PGX A;  3AMZ A;  1QQ6 A;  4Y2X A;  3SV3 A;  5KFN A;  1BGX T;  4NL9 C;  4OJP A;  3KD3 A;  4BWM A;  5BOL A;  5CWR A;  4RT3 A;  3AL0 B;  7ICJ A;  4EX6 A;  1WCL A;  3ETL A;  3N7S C;  4OJL A;  4Y2Y A;  1KFS A;  3PR5 B;  3ZDA A;  4C0Z A;  1CRX A;  1ZQG A;  5IIJ A;  4ELV A;  1L7M A;  1SL0 A;  1U45 A;  1B43 A;  1NKC A;  3T3F A;  4ZOH C;  5DQI A;  5J0O A;  2BQU A;  4F2R A;  3QEA Z;  4O0I A;  2KOB A;  9ICJ A;  2NRV A;  4C4R A;  4NY8 A;  3C5F A;  9ICP A;  3RH5 A;  5J2H A;  2KEY A;  5ALU A;  2KTQ A;  3KBB A;  3N7R C;  3F5E A;  4J9S A;  2Y1I A;  2MUT B;  3PY8 A;  2K4I A;  2KNJ A;  2PMZ F;  5KFZ A;  2IHM A;  3QEB Z;  4M04 A;  1T3Q A;  5J0Q A;  3RJH A;  4EBE A;  3BS7 A;  3EYZ A;  4PGY A;  4JWM A;  1S9F A;  1TAU A;  4I2D A;  3A0H U;  3CNH A;  5DB8 A;  3FDS A;  4DL5 A;  5B5E U;  4DFK A;  1L8L A;  1Z00 B;  5CR0 A;  1J2N A;  4F4W A;  4NLB A;  1QQ7 A;  3Q8P B;  4QZD A;  4YQW A;  5ALG A;  1SL2 A;  1QTM A;  7ICP A;  5T14 A;  1FFU A;  1ZQT A;  5DBC A;  1V85 A;  3PW0 A;  4C7Y A;  2W8K A;  4M9G A;  1ZJN A;  1WG8 A;  4UB3 A;  4U6P A;  5DGA A;  4C8K A;  4QNL A;  5AKE A;  1ZQB A;  5KFP A;  3G6V A;  3SI8 A;  8ICQ A;  3RH6 A;  5AKG A;  4F72 A;  4EBD A;  1QLN A;  4KLF A;  3JPO A;  1TE2 A;  3ETR A;  2WTF A;  2BKE A;  3QNM A;  4QZB A;  1AQ6 A;  4A8E A;  2VA2 A;  4QZC A;  2BDU A;  1X9W A;  2E8O A;  3ZD9 A;  4Z6C A;  2HW3 A;  5AI9 A;  5EWE A;  1ECW A;  8ICZ A;  4DQI A;  3KHH A;  2XC9 A;  4C7Z A;  1Z1B A;  3MFI A;  3FAH A;  2WAQ F;  3BZK A;  4PJ0 U;  5G5H A;  4IQU A;  2G09 A;  2JMG A;  3V7K A;  4M9H A;  2E1F A;  2ZIX B;  3QU5 A;  4EEN A;  4I2J A;  2A1J B;  3V6H A;  4F2S A;  4QWC A;  2HI0 A;  4AYB C;  4IRC A;  5CRX A;  2NRX A;  2JRZ A;  5EE3 A;  2BQR A;  9ICL A;  4WJ3 B;  1Q8K A;  2RLT A;  3PML A;  3F53 A;  4B9L A;  3PSI A;  4QZG A;  3C5G A;  2K8A A;  2EAN A;  3H8S A;  5EWG A;  1S76 D;  3DV9 A;  3HIL A;  2W54 A;  2HCF A;  4B6J A;  1ZD5 A;  3IDW A;  5KFW A;  4EX7 A;  1Q46 A;  4M6W A;  1S0O A;  4QZI A;  2Y9T A;  4C8N A;  2QAR B;  4FZL A;  2MUT A;  9ICH A;  3RRH A;  5AK4 A;  4AYB F;  2HHU A;  3C2L A;  8ICY A;  4ED6 A;  4DL7 A;  5KNI A;  3AU6 A;  7ICV A;  2W8L A;  2VAN A;  3M1Y A;  3ORY A;  4UB6 U;  2ESE A;  2ZIV B;  4IRD A;  4QWD A;  4GIB A;  1ZD4 A;  3C2M A;  2XGP A;  2DF4 B;  3C28 A;  2W7P A;  4UBB A;  3E58 A;  2F1I A;  1ZQF A;  1QH9 A;  2MRL A;  4C8M A;  1C7Y A;  4RZR A;  7ICT A;  3WK4 A;  5DLF A;  7ICE A;  2K4E A;  4UQG A;  4MEY A;  3RAX A;  1S77 D;  2BCR A;  1ZQV A;  2A3V A;  2Y0S C;  1HIW A;  1SZP A;  3B9J A;  5J2B A;  5J2D A;  2DKX A;  2QB0 A;  4CF5 A;  1QSL A;  2ZXI A;  4IR9 A;  4IQT A;  4ECQ A;  3LWM A;  4GXK A;  1SXD A;  1ZD2 P;  3V7L A;  2MSN A;  3N28 A;  2EAP A;  2ZUB A;  2CXY A;  3H4B A;  2V9W A;  1ZQH A;  5J0U A;  1NK4 A;  4IC9 A;  5DG7 A;  1NJW A;  3PO4 A;  3NGD A;  2AGP A;  1SXE A;  3MFH A;  2YX8 A;  5J0S A;  2OEH A;  1X42 A;  2Q0Z X;  4C80 A;  2DWQ A;  1JI7 A;  1WUD A;  1NK7 A;  1F0M A;  2BCQ A;  4CF4 A;  4BX9 C;  3BQ2 A;  4ECX A;  2ATL A;  2ZJ5 A;  3Q8L A;  2C22 A;  3M8S A;  4QJF B;  1D9F A;  3HX0 A;  4KX5 A;  2Y0S F;  2FMQ A;  3OTQ A;  3C2K A;  2A19 A;  2V4R A;  2ZXH A;  4RQM A;  4Q44 A;  5J8Y C;  5ALI A;  4Q8F A;  5DG9 A;  5J8Y A;  1SV4 A;  4J9P A;  2OH2 A;  1ZQQ A;  3C29 A;  1BNO A;  3HKZ F;  4UAR A;  4J9L A;  4QZ8 A;  3QX7 A;  4ED1 A;  1T8E A;  4AP9 A;  1KN5 A;  4QZE A;  4FE3 A;  2E8N A;  3PVX A;  1MSW D;  3V6J A;  1IV8 A;  1NI3 A;  2GOL A;  1LB2 B;  3NVZ A;  2YQE A;  5KFR A;  1YZ7 A;  8ICP A;  3NS1 A;  5L1L A;  4RQ3 A;  2ZJA A;  5AI0 A;  2ZIW B;  1N63 A;  1T7P A;  1ZXI A;  1YZ6 A;  4RQN A;  4P0Q A;  3H40 A;  4ED2 A;  9ICF A;  3OPX A;  4DQP A;  8ICS A;  4DL3 A;  2F76 X;  1PK3 A;  5KFD A;  2BPF A;  7ICO A;  4MF8 A;  5KFJ A;  1TAQ A;  2CRX A;  8ICC A;  4O5C A;  4U7C A;  1VJ5 A;  2DQN B;  1CEZ A;  5KG1 A;  2HHQ A;  5AKJ A;  5HHH A;  2M9N A;  5DDY A;  2WF9 A;  4LZG A;  4CNQ A;  2WF6 A;  1D8B A;  4P4M A;  3BQ7 A; 
#chains in the Genus database with same CATH homology
 2JMG A;  4OJ6 A;  2YX8 A;  2K8C B;  2LBO A;  2E1F A;  2G5H B;  2VJ5 A;  2ZIX B;  3M6K A;  3LVV A;  3H0M B;  4NWI A;  5KL1 B;  2E1E A;  2G07 A;  3D2S A;  2ZG6 A;  3M7D A;  2R18 A;  2Z7J A;  3H0L B;  4GFJ A;  2KEY A;  4CGZ A;  3ICX A;  4AYB C;  3T79 A;  2YB1 A;  2KV2 A;  2M0N A;  2XIC A;  3F5E A;  3N7R C;  1GO3 F;  1OUQ A;  5CRX A;  1WUD A;  2YB4 A;  2ZIV A;  4JMU A;  1A0P A;  4WJ3 B;  2K4I A;  2KNJ A;  2PMZ F;  3E0F A;  1PVR A;  5A0L A;  3F53 A;  2ZIX A;  3PSI A;  4BX9 C;  3SAG A;  1Q3U A;  2OM6 A;  2F8L A;  3H0R B;  2K8A A;  3KZX A;  4KX3 A;  2HOF A;  2VKQ A;  4ACO A;  3PSF A;  2CN1 A;  2RHF A;  4NV0 A;  2K8B B;  2W03 A;  4QJF B;  1XO0 A;  2KIW A;  2HBL A;  2ZIU A;  2D6F C;  4KX5 A;  2KKP A;  2Y0S F;  3PST A;  3GU3 A;  1F44 A;  2G5I B;  4QIW C;  2RRD A;  1A6S A;  3MGV A;  2JHD A;  1PVP A;  2ZXH A;  3N7P D;  2N1R A;  4ICA A;  1Q3V A;  2OYY A;  2W04 A;  2LYA A;  4FZL A;  4NLC A;  1P7D A;  1URJ A;  3LYS A;  2F2A B;  4CDG A;  3SQI A;  2OH2 A;  4AYB F;  3C29 A;  3SAF A;  3HKZ F;  4NLB A;  2G09 A;  4FZM A;  2HOI A;  1KBU A;  2VJ4 A;  2Q4T A;  3SMV A;  3F5A A;  2WAQ C;  2WB1 F;  3KFU F;  2G08 A;  2JH7 A;  3L3F X;  4FE3 A;  4KMO B;  1ED1 A;  3ALR A;  3IG5 A;  5T14 A;  2E5S A;  2W7O A;  2KD1 A;  3PSP A;  1XNS A;  4CRX A;  2H3Q A;  2ZIV B;  2MA1 A;  1Z19 A;  2KJ5 A;  3SAH A;  1L6N A;  3O0F A;  3F2D A;  1UPH A;  2DF4 B;  3CYM A;  2GOL A;  1IIP A;  3C28 A;  3IN5 A;  2W7P A;  4OJO A;  3RFA A;  5HR7 A;  2HBJ A;  2HOQ A;  3IP4 B;  3CRX A;  4P0P A;  2KIC A;  2RP5 A;  2XVT A;  1SZH A;  3AQF A;  4QIW F;  4U6P A;  2MRL A;  2CPR A;  2ZIU B;  4QNL A;  2DGZ A;  1HEK A;  2ZIW B;  3IG8 A;  3M6Z A;  4OJP A;  1NZB A;  2G0A A;  2HBM A;  3PZP A;  2KVC A;  2H3V A;  2KJ9 A;  2K4E A;  1MA7 A;  4PL2 A;  3K1Z A;  4FZN A;  3AL0 B;  4P0Q A;  2A3V A;  2Y0S C;  4BUG A;  3F2B A;  3NUQ A;  4P0P B;  1HIW A;  3ONN A;  4OO1 J;  3OPX A;  2GH1 A;  2KHQ A;  2H3Z A;  3D2Q A;  2K4H A;  4O3M A;  3N7S C;  4OJL A;  2KKV A;  2F77 X;  2F76 X;  1PVQ A;  5KL8 B;  5C0Y A;  3LVW A;  1YT3 A;  4A8E A;  4C0Z A;  2JH1 A;  2CRX A;  2H3F A;  2LYB A;  2ZXI A;  2BDU A;  2H3I A;  4OJ5 A;  1CRX A;  2PMZ C;  1DRG A;  3NRW A;  2HBK A;  2VIX A;  2KJ8 A;  2ZIW A;  3F2C A;  3DEE A;  1TAM A;  1ECW A;  2NV3 A;  1ZQ1 C;  2JGA A;  2XI9 A;  2XID A;  2DQN B;  4BJQ A;  4U7C A;  5HR6 A;  2LKY A;  3VC8 A;  2G06 A;  1Z1B A;  3CP8 A;  4P0Q B;  3GZF A;  3RF9 A;  2WAQ F;  2OXO A;  2WB1 C;  4IC9 A;  4PL1 A;  3VCB A;  1T94 A;  2K89 A;  3HKZ C;  1D8B A;  2HMX A;  2KOB A;  3AQE A;  2KHV A;  2LHT A;  3D2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...