2KHQA

Solution nmr structure of a phage integrase ssp1947 fragment 59-159 from staphylococcus saprophyticus, northeast structural genomics consortium target syr103b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
MITFADYFYQWYEVNKLPHVSESTKRHYESAYKHIKDHFRHKLLKDIKRTEYQKFLNEYGLTHSYETIRKLNSYIRNAFDDAIHEGYVIKNPTYKAELHASVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Integrase
publication title Solution NMR structure of a phage integrase SSP1947 fragment 59-159 from Staphylococcus saprophyticus
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
total genus 36
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2khqA01
1Q3UA 1P7DA 1CRXA 1DRGA 3NRWA 1NZBA 2KKPA 3C29A 3C28A 1KBUA 2KHQA 2KJ9A 1Q3VA 2KJ8A 1OUQA 1Z1BA 2OXOA 2KIWA 2HOIA 3MGVA 1XO0A 1PVRA 2KD1A 2CRXA 1PVQA 2KKVA 2HOFA 5CRXA 4A8EA 4CRXA 2KJ5A 4ACOA 1PVPA 2A3VA 1XNSA 3CRXA 3LYSA 2KEYA 2KOBA 1Z19A 2KHVA 1MA7A 1A0PA 1F44A
chains in the Genus database with same CATH superfamily
3MC1A 9ICKA 4KLFA 1XU4A 3EPGA 1SGGA 4NLCA 5IIIA 4ED7A 8ICKA 5DBCA 9ICWA 1PK1A 5EWEA 5DBBA 3G6YA 1NK9A 4I2HA 2HHWA 1CUKA 3IDWA 3NS1A 5F9LA 5DG9A 1KLNA 1A77A 1COOA 2P6RA 4BX9C 2XC9A 1A0PA 3CNHA 3LWLA 3GDXA 1SL1A 1DK2A 4NJ8A 1KFSA 1M6YA 2ZUDA 4HYKA 4O5KA 2WAQF 3TARA 1KFTA 4GC6A 3QNMA 1JALA 2G5IB 1ZQAA 1BPDA 1X66A 2PMZF 3RFAA 4J03A 4ED1A 2ZUCA 1XNSA 2YQEA 4YR3A 2MA1A 4BDPA 5H2FU 5AI4A 3ZDAA 9ICVA 3WKAA 2QARA 2KN7A 2BGWA 5J8YA 4JK1A 1N5XA 4K4HA 4PHEA 2HBLA 4QNLA 1NK6A 3Q8SB 3MDCA 7ICMA 1RDFA 5ALNA 5KT4A 5J0YA 1XSNA 5J0WA 3M9OB 4Y2UA 4YP3A 3HKZC 2XO7A 3L4PA 2W54A 3DV9A 2Y0SF 4KITB 3OPXA 3SI8A 4DEZA 2EZZA 2FPMA 3LDAA 5L1KA 1Z00B 3N97B 5AM4A 4DQQA 3H40A 2YMPA 1WUDA 2W9BA 5EE9A 4PHAA 2AQ4A 2XICA 2KNJA 4YQWA 2V4QA 1QSSA 3UM9A 3V7LA 5DG7A 1X6IA 2CN1A 1TK0A 2AGQA 5KFXA 5BOMA 2W9CA 2G0AA 4YVZA 3NRWA 3V6HA 5ALSA 3RB4A 2FLPA 2DFLA 4OD0A 4NM1A 4R63A 4MFAA 2R8HA 3F5AA 2N1RA 5J0SA 2H3ZA 5HP4A 2KKVA 4EBEA 5DKWA 1NJZA 5J2IA 3RJIA 2BPGA 1S97A 4Y2JA 4M9JA 1V85A 2JEGA 7ICSA 2VA3A 8ICUA 3TANA 2LKYA 3E58A 4ED8A 2V9WA 1SB3C 4IQUA 3ISDA 3H4BA 4ELTA 4RUCA 2NO4A 8ICZA 4PHPA 4UB4A 2G5HB 3M8RA 4YN4A 3M6KA 2HBJA 3Q8PB 4BXOA 1JUDA 1YZ6A 5BOLA 1U48A 4UB1A 2XI9A 3FM9A 4DFJA 2GWSA 3A0BU 2QB1A 3C23A 2W43A 4DS4A 2M9NA 2A1JA 3RBEA 5DDYA 3TKAA 1B43A 3QU7A 1KTQA 1LKYB 1S0VA 1PUZA 3MABA 3SZ2A 2ZG6A 5J2KA 9ICRA 2HHQA 2IOHA 1MA7A 2BQUA 1ZYQA 8ICCA 5DG8A 3QUCA 5KFLA 4KLEA 3J81j 2HI0A 5L1JA 1X2IA 9ICBA 4FE3A 4TUPA 4RPZA 1Z00A 1RQNA 4KMOB 3UQ0A 1N48A 1XO0A 2FMQA 4Z6EA 4Y2YA 1B0XA 3NGDA 2HHVA 4CRXA 1IG6A 1ZQBA 3CYMA 4PH5A 5ALRA 3SV4A 1UT5A 4C8LA 1T7PA 1F44A 3I76A 2BKEA 4YFKA 3BQ1A 1T8EA 3HPOA 5JTIA 3RB3A 4MF8A 3EWAA 4O3SA 2F8LA 4UAWA 3F2BA 1SL2A 4B9UA 1ZD5A 4I2IA 3WK8A 2JZBB 8ICHA 3NUQA 3ICXA 3QUBA 4CNQA 5KFEA 3Q8KA 4AYBC 1ZJMA 5KFJA 2H3QA 3N28A 3PO4A 2HCFA 2IHMA 3SEIA 2F1JA 3ZDEA 4QZAA 3H8JA 5CR0A 4U7CA 4DQSA 4XQ8A 5KFIA 4LVSA 5DDMA 4DSIA 3H4DA 3V72A 3RAXA 2KE7A 2AXTU 1MC8A 9ICUA 2DPJA 2BCQA 4FS2A 3MGHA 2G06A 5IINA 2VANA 1RYSA 4YR0A 5IIMA 3SD7A 4IQWA 4Q8EA 2ZTDA 2WTFA 2MAXA 2YY6A 3Q8RB 1ZRNA 3BZKA 2L5YA 1DGJA 7ICHA 1NK0A 2HHTA 3GIIA 4YXMA 4NL9A 3T79A 5CA7A 5KFWA 2DGZA 1KDHA 4O9MA 2QLTA 1SV0A 4Y2RA 4ED0A 5HMMA 1L7NA 4NLKA 3GV7B 5GTIU 3ZDCA 1YT3A 2F76X 3IRUA 4M47A 4O3PA 4IC9A 2KG5A 2OWOA 3H8MA 3C2MA 1URJA 2C28A 1TKDA 4O5EA 2WF6A 1U9LA 4O3RA 8ICTA 1PK3A 8ICIA 1ZQWA 2KZMA 5KT7A 2E8MA 1CI4A 2BCUA 5EE1A 1HEKA 3M9MB 1WYGA 1TV9A 5AI6A 9ICAA 3IN5A 2YTUA 5KG3A 4B9VA 4IS7A 4RT2A 3EYZA 5F9NA 3QU2A 2IHNA 3C5FA 4M6WB 3AUOA 2FLNA 4US9A 4DLGA 2CPRA 4NLBA 4R64A 1ZJNA 3K4GA 2IOFK 4YR2A 4Y2SA 3WKDA 3JPRA 8ICAA 3C2KA 5BPCA 4Q43A 2Q4TA 3K1RB 4DSKA 4UAZA 3NVYA 4KLTA 2ES6A 4JV2A 1ZQPA 1MN8A 1COKA 2RHFA 5B66U 3KBBA 5KFVA 3F53A 7ICOA 1PZNA 3PY8A 4EENA 2XY6A 4RQ4A 9ICJA 1TFRA 8ICGA 2H3IA 5AICA 1X40A 5HMLA 1ECWA 3RJGA 3RRHA 3NVVA 7ICUA 2FLLA 4ECSA 2RQ5A 5K4LA 2NYVA 3NASA 4C0ZA 4DL6A 4GXJA 2W3RA 1F5SA 1SXDA 1BPYA 3PX4A 2QKQA 3F2CA 4UBBA 4I2JA 1SL0A 5DLFA 9ICSA 3RR8A 4JB3A 2ASJA 4Y2XA 2WB1F 2DPIA 2LHTA 3GILA 5CP2A 1ZQVA 4WJ3B 5DB9A 3SAFA 1DGSA 7ICQA 4UB3A 2MUTA 4EBCA 1KL9A 3WU2U 1NI3A 3KTQA 4CE6A 4FZNA 5IIKA 2JR5A 5HHHA 5KFZA 2W7PA 1U45A 2UVVA 4J9NA 1KEJA 4F5RA 1S5LU 4XA5A 2LMRA 5DB6A 3RH4A 4Z6DA 2F2AB 3TAQA 2E3TA 1SXEA 1ZETA 2PFNA 4MEYA 4IQVA 2NRWA 2P35A 3M8SA 3ZDDA 1QH9A 1X9XA 2BQ3A 4JMUA 4YMOA 3Q8MA 4FS1A 4BWJA 1SKRA 2RLTA 9ICMA 1ZQGA 4F4KA 4UAUA 1B22A 3JPNA 3KD3A 1P7DA 5TZVA 4DL7A 3KFUF 1K5OA 3BS5B 3U26A 4UB5A 4DL2A 1NJWA 3MGVA 4BWMA 4IR9A 4PZOA 5AK3A 2W55A 3C1ZA 3HRDD 1UA0A 1PVPA 2AH5A 4E0DA 1XSPA 2JV3A 1BVSA 3E2EA 4NLZA 2WAQC 3C2LA 2XCAA 2ZJ5A 9ICFA 8ICBA 5ALKA 1JMSA 2PMZC 4QJFB 2ZTCA 4RT3A 2Y1IA 5C5JA 1K1SA 4Q8FA 4YMMA 3M7DA 5HR7A 4FBUA 3QE9Y 3KHHA 3AL0B 4O3QA 2YN4A 4UQGA 4DS5A 7ICVA 3TACB 1OUQA 1Z1BA 4I28A 4BJQA 1X9MA 2Y0SC 2J6UA 4M9GA 2HOFA 7ICLA 2LBOA 4X5VA 2Y9UA 4QZCA 4R66A 2F1IA 3FAHA 2QB0A 3AU2A 1H38A 1HIWA 2B0CA 2KHVA 2F77X 1ZQKA 2ZIWB 2PFOA 5AKKA 1UA1A 3JPOA 4NXZA 1L5UA 4RUAA 2XGQA 2W04A 4UAYA 5KT2A 4QZDA 4QIWF 5KG0A 2FI1A 1ZD3A 5AK4A 2DQNB 1LB2B 9ICGA 2BCSA 2NO5A 3QXGA 4P4OA 1L7OA 5EWGA 1N2XA 2NRVA 2WHEA 4NV0A 3TFSA 5CEHA 4RQ0A 4F72A 1ZQRA 4ECXA 3RJEA 3VC8A 3AQEA 2E1FA 4ELUA 1IV8A 3I1YA 1NK7A 3RH6A 2KV2A 2E8NA 3SYZA 4GFJA 3BS5A 5AM0A 4P0QB 2UVUA 2A1AA 1SWVA 1UHUA 4UATA 1CRXA 4K4GA 3QYPA 4QZIA 4PGQA 3BQ7A 5KFSA 5J0OA 2LYBA 4I29A 3WKEA 1MSWD 1KN5A 4B9SA 8ICMA 4RNNA 5C0YA 9ICEA 2E8PA 2VKQA 3PSFA 1TK5A 4M9NA 3PW7A 3T5KA 1V97A 1NK4A 1S0MA 9ICXA 3SAHA 2YB1A 2G08A 4DCCA 5EE3A 4EZ6A 3IP4B 5AKJA 1FO4A 3L5KA 1PVQA 2JEFA 4F5OA 3UPQA 1RYUA 4EYHB 5J0XA 3RF9A 1LVHA 4ACOA 2ZIXB 2E1EA 2KOBA 4MF2A 2LYHA 1RQLA 4FO6A 3KHLA 4GC7A 2KTQA 4DSLA 1C20A 3TADC 2NRZA 3V6JA 2DBYA 2FDRA 5CWRA 3QX7A 1N5WA 2ZJ8A 4EEYA 5KT6A 2JGAA 4F50A 2KSOB 2KZZA 3JPQA 3T3FA 3BQ0A 4B9TA 4DO9A 1U49A 2KFNA 5KL8B 5DB7A 4DSEA 3PO5A 2ZXHA 5KG4A 4IRCA 2VIXA 5G5HA 4I2EA 4PGYA 1ZOLA 1QTMA 7ICFA 2ZIVB 3CRXA 1ZQTA 5L1MA 2IBKA 9ICIA 1X6JA 2EDUA 4F4ZA 1J2NA 4P0QA 5ALIA 4ED6A 4KLQA 3K1ZA 2W11A 1S76D 4KLLA 3PW0A 5ALTA 3QUTA 4EYIB 4YG2A 4OJOA 2HMXA 5D4BA 5J0QA 1L6NA 5CJ7A 4B9LA 3NVWA 3KZXA 4PPXA 1WG8A 3ZD8A 1ZD2P 2AGOA 3BJYA 5AKLA 1QQ6A 3HX0A 4F2SA 1X9SA 3EPIA 4NWIA 4B9NA 3C21A 5AM5A 3GV8B 4YMNA 1L3TA 1O08A 1D9FA 4KX3A 3AEVA 5D49A 5HNKA 4ECYA 3ORYA 4RZRA 2RRDA 1DK3A 2XY5A 4NLGA 2NRTA 2H3FA 1T3NA 8ICSA 2ISOA 3D6JA 3VCBA 3GV5B 3KZIU 4GIBA 1ZQCA 2ZIXA 2IOFA 1RPLA 1UPHA 4TQSA 3SENA 1SKSA 4G3IA 4QWDA 3RAQA 3UXNA 5KFGA 1Z4OA 3OSPA 1RG6A 2ZTEA 3I28A 3PV8A 5B5EU 2OHFA 1NZBA 4M9LA 2OYYA 5KFKA 3GU3A 3RJKA 4DLEA 8ICXA 4R8UB 4J9RA 5KG2A 5KL1B 4PGXA 3MR5A 2J6TA 5KG1A 1MQ2A 1LKYA 2I1QA 5J0UA 3QEBZ 1Q3UA 4C4RA 3MBYA 4PL2A 1KBUA 1NK5A 4DF4A 2BCVA 1Z3EB 3GIKA 5KG6A 5FP0A 3M6ZA 4HAIA 4DFMA 2KIVA 2Q0ZX 7ICJA 1ZQZA 4I2FA 2AJQA 4J9OA 7ICGA 3UXPA 4AP9A 3ALRA 4CDGA 1ZQLA 1OXJA 4DQRA 2DKXA 1NOMA 1VJ5A 4J9SA 3KKAA 5J8YC 4UB2A 5F3XB 3EZ5A 1SIJA 7ICRA 2OEHA 4K4IA 4YD2A 4Y2TA 1TAQA 2DF4B 8ICVA 2K8AA 2EZXA 2C2RA 4DWIA 2LPEA 5AHXA 1N60A 3PX6A 2BQRA 2VA8A 2WF7A 2XCPA 4Z6FA 2JZBA 3OJSA 4J9MA 2KJ8A 4QZGA 2KVCA 2HOIA 2JH7A 3PMNA 2D3DA 2OH2A 1L7PA 4JUZA 4UASA 2P66A 4BUGA 4F93B 2WB1C 1T94A 2D8CA 1BNPA 4RQ6A 2WF8A 4CF3A 5KFAA 2WF5A 2EAMA 5ALEA 9ICOA 5J2GA 5AM2A 2NRXA 3TI0A 2H5XA 3OTQA 5AM3A 1N61A 4KMUA 4QZ8A 3K75D 1WCNA 2KMDA 1JN3A 3M9NB 2LI6A 2ASLA 2JH1A 3JPSA 1Z19A 4F2RA 1WWUA 4QZEA 4Y2VA 4CCHA 5ALYA 3RJHA 4IRDA 4M04A 2HBKA 5JU5A 2R8IA 1RYRA 3H0LB 2K8BB 3UMBA 3ONNA 1TAUA 4P0PB 1IIPA 5AK5A 5DBAA 1O03A 4ED2A 4MEXA 4I2GA 8ICFA 3S6JA 9ICCA 4TQRA 1S77D 1IM4A 5JUMA 1F0MA 4C7YA 1S9FA 5HR6A 1GO3F 3G6XA 4KLOA 4JWMA 1V38A 5AKEA 5DB8A 2AHOB 2HW3A 1L3UA 4DFKA 4QZFA 7ICTA 1Q3VA 4UB6U 1T3QA 2E5SA 3QZ7A 5KFCA 4P2HA 4UBCA 2JHDA 3C5GA 5DQGA 3Q8LA 4EELA 4RQNA 4YXJA 3DEEA 4F5QA 3BQTA 5TISU 2B6GA 2XVTA 4M6WA 2A19A 1ZQXA 4MFCA 3RB0A 1QSLA 3WK6A 4C8MA 2GH1A 1KRPA 3OHBA 1S8OA 1TE2A 4NLNA 1SKWA 1N63A 1JXLA 2BDPA 4RQ1A 2Y1JA 2ZXIA 4DOBA 2LM4A 3GFKB 2HBMA 4QW9A 8ICWA 2FMSA 1ZQMA 2K4EA 3PSPA 5KFHA 3HW8A 4DFPA 1SWWA 1T4GA 1Q46A 1SV4A 5GTHU 2QARB 1ZRMA 5J2EA 5ALXA 4USAA 2KP7A 2I5HA 4Z6CA 4DL3A 1D8YA 1ED1A 2F44A 4JV1A 4QIWC 8ICJA 4DFDA 1JI7A 4J9LA 4PZNA 3N7PD 3ISCA 2PXIA 4P0PA 1WCLA 5AKGA 5AIAA 1BGXT 4UW9A 2LM1A 4OJLA 1JX4A 2CRXA 2HHUA 3UXOA 4QWEA 1NZPA 4J9QA 2KJ5A 5ALMA 1K1QA 4F92B 4O3NA 5DGBA 2W9BB 5E79U 2WF9A 3OHAA 2YB4A 2I6XA 3MDAA 5A0LA 4U6PA 2YMMA 1NNLA 5KT3A 1CEZA 5ALPA 2PI4A 1ZQDA 4NL9C 4TURA 3NVZA 2FMPA 3IG5A 4LZDA 2W9CB 4Q45A 1JROA 3E0FA 5KFYA 2ISPA 1RM6C 1SV0C 2K8CB 1NKBA 1NJXA 4F71A 3D2NA 4QZBA 5AI8A 2XIDA 1KFDA 1ZD4A 3RBDA 3QU4A 2K89A 1DXSA 5KFDA 4C4TA 5DGAA 5KTQA 3KKAC 4DL4A 1MQ3A 5EWFA 4OCZA 2BPCA 2FPLA 5ALZA 2W8LA 2R8KA 3GIMA 2MSNA 2KVSA 3QUQA 4OJ6A 3N4MB 5IILA 2R8GA 2AU0A 1NK8A 5J29A 4BXOB 1QQ7A 3THVA 1B4FA 5J2HA 2FE9A 1KSPA 1TAMA 4RPXA 2W9MA 1N62A 4C4SA 2AQ0A 4LZGA 4R65A 2VJ4A 5J2FA 4FFDA 4QZ9A 5KG7A 1S0OA 1TK8A 5L1IA 3WK9A 3ETRA 4JWNA 1A76A 5AKHA 5L1LA 2A1JB 4Q44A 1X9WA 4KLHA 3WK5A 2XY7A 3MR2A 3PR5B 3ZDBA 3PSTA 5AKIA 9ICLA 3RR7A 5J2CA 1FFUA 3IG8A 5KFBA 1QLNA 2ZJAA 1ZQEA 4M2YA 2KHQA 5AIBA 4J9KA 2BCRA 4KLGA 1Z4NA 2JEIA 4ED3A 1ZQYA 2KZ3A 4RQ2A 3RJFA 4GXKA 2HVIA 3CP8A 4RQ8A 1UQVA 5KFOA 3PX0A 3LVVA 5AKZA 4XUSA 1KKXA 3IM1A 4EX7A 2XGPA 5AKXA 2V4RA 4P4PA 8ICRA 4OJ5A 5KT5A 5ALWA 3OJUA 3WK4A 4F5PA 2DKZA 2I9GA 8ICEA 3RRGA 5ALOA 5KG5A 5KFTA 1VLBA 5ALJA 1JXEA 5ALFA 3AMZA 3B0YA 2O6KA 8ICOA 2EH9A 3L3FX 2HOQA 4DOAA 2H3VA 8ICPA 3JPTA 3NRZA 2ZIWA 4RQ7A 1V9PA 2K4PA 2W8KA 5J2DA 1J2MA 5J2BA 2PFPA 4TUSA 1QCKA 4RQMA 4ECVA 4PHDA 8ICQA 2HHSA 4DL5A 2BZFA 3T5JA 3HKZF 1D8LA 2EAPA 4RNMA 1RXWA 4CF4A 4C80A 1A6SA 2HVHA 3F2DA 3PZPA 4KN7A 2G07A 4J9PA 3B9JA 5KFPA 2DUYA 1HJPA 4F5NA 2HHXA 4ZH4A 1XSLA 1ZXIA 4G9BA 1N56A 5DLGA 3ETLA 4IL6U 9ICQA 3AQFA 3C1YA 4ECQA 4I2CA 4KLDA 2VJ5A 2YMQA 2GO7A 2RDIA 2EZYA 3OGUA 5CB1A 2K4HA 1RXVA 4RPYA 4LJXA 2B21A 5AK6A 2R8JA 1X42A 3AN1A 2ZUBA 3C28A 2C2DA 9ICHA 2KK0A 3WK7A 4BGDA 3BZCA 2OM6A 5AM1A 4IR1A 4PL1A 4RQ3A 3GQCA 1BPEA 3Q8QB 1J97A 5AI0A 1C7YA 1FFVA 3BDPA 1BNOA 3V7JA 3TAPA 3SR6A 2Y9TA 5KNIA 3C29A 1ZQFA 1ZQQA 2MU2A 5D46A 4JV0A 3G6VA 4TUQA 4ECUA 5DQIA 1BPZA 2VA2A 1RZTA 2F1HA 4F8RA 4UAVA 1KQQA 3A0HU 4FZLA 1L8LA 5L9XA 1XS9D 2PI5A 2JXJA 1FIQA 1NKCA 4UB8U 4FBTA 5KFQA 4ECWA 4KN4A 1OW5A 5J0RA 2ATLA 4C8OA 4FZMA 2KSOA 2OCEA 3BS7A 4RQ5A 2J6SA 4O5CA 2ZIUB 2FJ6A 1L3SA 2E8OA 1ZQHA 3QU9A 3IV6A 1Z1VA 3PMLA 2JEJA 2LYAA 3IHQB 2ZIVA 1L3VA 3EW9A 3O0FA 4ELVA 3ZD9A 3MFHA 5T14A 3RTVA 3UQ2A 5JRTA 8ICLA 3NTUA 4IRKA 3FDSA 7ICIA 4KLIA 4RU9A 2KEYA 4EBDA 8ICYA 3HJEA 2UVRA 4QWBA 3LWMA 5ALHA 1DRGA 2GLEA 2C22A 7ICPA 5KAIU 4AYBF 4DSJA 4O3MA 4ZOHC 4Y2PA 1LV5A 2GOLA 7ICNA 2KD1A 3RB6A 3RJJA 5CRXA 4OJPA 3HP6A 3PSIA 4EX6A 1D8BA 5KFNA 1WWVA 4C8NA 3PW4A 1HUOA 4DSFA 1ZQJA 5KFFA 1U4BA 3SQIA 4M0AA 4NY8A 3OSNA 2KJ9A 1UCVA 2CXYA 8ICNA 2IMWP 3HT3A 2ASDA 2MUTB 3DDHA 3N7SC 2BHNA 4DF8A 1XO1A 4GXIA 4KTQA 1QSYA 7ICEA 1KW4A 2G09A 5J0TA 3RH5A 2F3NA 3D2SA 2W7OA 5J2JA 3HILA 1ZQUA 3UMCA 4F4YA 1DOQA 2YMLA 3SAGA 2JRZA 2R18A 3PW5A 3BQ2A 9ICTA 5ALLA 4KLUA 1SZHA 3WKCA 1AQ6A 4R8UA 2M0NA 3SMVA 5KFMA 2DL0A 2ZIUA 3GIJA 5ALVA 4GLXA 2PKEA 4F4XA 4F91B 4KLMA 9ICNA 3EUB2 4IQTA 3FYHA 4ECRA 4YCXA 4B6JA 3H0RB 2K4IA 4CF5A 5IIOA 2ESEA 2A3VA 1BPXA 1NJYA 4ICAA 4CGZA 5CHGA 5AI9A 1U47A 4I2BA 4Y2QA 3MFIA 5EE0A 1Q8KA 2C2EA 3KHGA 5ALGA 3PVXA 4KLJA 1UT8A 2K60A 4DQIA 4ECTA 4F3OA 5AI5A 4RNOA 3V7KA 3T5HA 1NKEA 5DQHA 4NM2A 1ZQIA 3D2QA 1AROP 3PNCA 2IA6A 2BR0A 5KFRA 1XWLA 3R9KA 1QQ5A 1Y88A 4O3OA 2KKPA 3TADA 3KOOA 1JIHA 2YX8A 4I2DA 3ED5A 3V6KA 4C8KA 4C7ZA 2MRLA 1EXNA 4B9MA 1S0NA 2KFZA 2RP5A 2BDUA 1BPBA 2FPKA 1ZQSA 4I27A 4M9HA 3KHRA 2EANA 2ODGA 3B0XA 1PK1B 2ALZA 2HDOA 4KX5A 1XC9A 3JPPA 3MGIA 4QZHA 7ICKA 2QB0B 2D6FC 1TVAA 1PVRA 1HUZA 4KLSA 3CW2C 2KICA 3N7RC 2NV3A 2P6UA 4XRHA 3HWTA 1L7MA 5ALQA 1D9DA 1VDVA 4EZ9A 3MR6A 4QWCA 3PW2A 2W3SA 3WKBA 5EOZA 3H8SA 4OO1J 1ZQ1C 1ZQOA 3H8WA 2KIWA 4ECZA 5J0PA 3FC4A 2AGPA 1FEZA 5J2AA 3PR4A 5G5GA 2UVWA 3M1YA 1L8OA 3UMGA 2HSZA 2JMGA 4PJ0U 1S10A 4YD1A 2Z7JA 1SZPA 3AM9A 4EEKA 4QW8A 2W9AA 3H0MB 3SV3A 3LK9A 2EAOA 4O0IA 2BPFA 3QEAZ 3MR3A 2WFAA 4DOCA 3LYSA 4MHVA 5AKYA 3QU5A 3TQ1A 3F5EA 2W03A 2PFQA 4DQPA 4P4MA 9ICPA 2DWQA 4I2AA 4F4WA 3T5LA 1JRPA 4QWAA 3QZ8A 5HHIA 3GZFA 2OXOA 4UARA 3TFRA 2RDJA 5ALDA 5KAFU 2F8KA 4A8EA 5ALUA 3H7IA 4MFFA 3ISBA 1IXRA 5KFUA 5IIJA 2EQYA 1YZ7A 3ZI4A 3LVWA 4US8A 3AU6A 1ZQNA
chains in the Genus database with same CATH topology
1TAMA 1Q3UA 3HKZF 1CRXA 3NRWA 2K4EA 3PSPA 4PL2A 1KBUA 4NLCA 1URJA 4KX5A 1A6SA 4P0QA 1F44A 2PMZC 2VJ4A 4QJFB 3F2DA 3SAGA 3PZPA 2WB1F 2R18A 4FZMA 2D6FC 2LYBA 2F8LA 2LHTA 3F5AA 3K1ZA 1PVRA 2N1RA 2HBKA 2KICA 3F2BA 2H3ZA 4WJ3B 2KKVA 3M6ZA 2G07A 2NV3A 3N7RC 3SAFA 5C0YA 4OJOA 2HMXA 2ZIUB 3H0LB 3M7DA 5HR7A 2VKQA 1HEKA 3ICXA 2K8BB 1SZHA 3NUQA 3ONNA 3PSFA 4P0PB 1IIPA 3AL0B 1L6NA 4AYBC 1ED1A 3ALRA 4CDGA 3KZXA 3PSTA 2LKYA 4BX9C 4QIWC 2H3QA 1A0PA 2M0NA 3SMVA 3IG8A 3IN5A 4FZNA 2ZIUA 3SAHA 3N7PD 4OO1J 1ZQ1C 2KHQA 2LYAA 2YB1A 2G5HB 2G08A 2ZIVA 4NWIA 1Z1BA 3AQFA 1OUQA 4P0PA 3M6KA 2HBJA 2KIWA 4BJQA 3IP4B 2WAQF 2Y0SC 4OJLA 3O0FA 2CRXA 4U7CA 1PVQA 2DF4B 2G5IB 2VJ5A 2W7PA 5T14A 2HOFA 2LBOA 4KX3A 5HR6A 2PMZF 2KJ5A 2K4IA 2XI9A 1GO3F 2K8AA 3CP8A 3H0RB 3RF9A 4ACOA 2ZIXB 3RFAA 2A3VA 1XNSA 2CPRA 2K4HA 2RRDA 4ICAA 4CGZA 2E1EA 2KEYA 2MA1A 2KOBA 4NLBA 1HIWA 2JMGA 2H3FA 2KHVA 2F77X 2ZIWB 3LVVA 3VCBA 2YB4A 2F2AB 1DRGA 2ZIXA 5A0LA 2Q4TA 2Z7JA 4U6PA 3C28A 1Q3VA 2G06A 2KJ8A 2W04A 4AYBF 4O3MA 2E5SA 2HBLA 4QNLA 2KVCA 4OJ5A 3H0MB 4QIWF 2HOIA 2RHFA 2GOLA 2OM6A 1UPHA 3IG5A 2JH7A 2KD1A 2DQNB 4JMUA 3F53A 2OH2A 5CRXA 4OJPA 3PSIA 2JHDA 3E0FA 3HKZC 4PL1A 2ZG6A 1D8BA 4BUGA 3D2QA 4NV0A 2JGAA 2K8CB 2Y0SF 3LYSA 3D2NA 3OPXA 2XIDA 2WB1C 1T94A 2H3IA 3DEEA 1MA7A 3F5EA 2W03A 3SQIA 1ECWA 2K89A 1P7DA 3VC8A 3AQEA 1NZBA 2KKPA 3C29A 1WUDA 2KJ9A 2OYYA 2XVTA 2HOQA 3GU3A 3GZFA 2OXOA 2YX8A 3L3FX 5KL8B 2ZXHA 2E1FA 3T79A 3KFUF 4FE3A 2H3VA 4KMOB 2GH1A 2VIXA 3MGVA 1XO0A 4C0ZA 2ZIWA 3N7SC 2DGZA 2MRLA 2XICA 2KNJA 4A8EA 2KV2A 4CRXA 5KL1B 2RP5A 2BDUA 4OJ6A 3CYMA 2G09A 4GFJA 1PVPA 2ZIVB 2CN1A 3CRXA 4P0QB 2JH1A 4FZLA 2ZXIA 1YT3A 3F2CA 1Z19A 3D2SA 2F76X 2HBMA 2W7OA 3LVWA 2WAQC 4IC9A 2G0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3U A;  1P7D A;  1CRX A;  1DRG A;  3NRW A;  1NZB A;  2KKP A;  3C29 A;  3C28 A;  1KBU A;  2KHQ A;  2KJ9 A;  1Q3V A;  2KJ8 A;  1OUQ A;  1Z1B A;  2OXO A;  2KIW A;  2HOI A;  3MGV A;  1XO0 A;  1PVR A;  2KD1 A;  2CRX A;  1PVQ A;  2KKV A;  2HOF A;  5CRX A;  4A8E A;  4CRX A;  2KJ5 A;  4ACO A;  1PVP A;  2A3V A;  1XNS A;  3CRX A;  3LYS A;  2KEY A;  2KOB A;  1Z19 A;  2KHV A;  1MA7 A;  1A0P A;  1F44 A; 
#chains in the Genus database with same CATH topology
 3MC1 A;  9ICK A;  4KLF A;  1XU4 A;  3EPG A;  1SGG A;  4NLC A;  5III A;  4ED7 A;  8ICK A;  5DBC A;  9ICW A;  1PK1 A;  5EWE A;  5DBB A;  3G6Y A;  1NK9 A;  4I2H A;  2HHW A;  1CUK A;  3IDW A;  3NS1 A;  5F9L A;  5DG9 A;  1KLN A;  1A77 A;  1COO A;  2P6R A;  4BX9 C;  2XC9 A;  1A0P A;  3CNH A;  3LWL A;  3GDX A;  1SL1 A;  1DK2 A;  4NJ8 A;  1KFS A;  1M6Y A;  2ZUD A;  4HYK A;  4O5K A;  2WAQ F;  3TAR A;  1KFT A;  4GC6 A;  3QNM A;  1JAL A;  2G5I B;  1ZQA A;  1BPD A;  1X66 A;  2PMZ F;  3RFA A;  4J03 A;  4ED1 A;  2ZUC A;  1XNS A;  2YQE A;  4YR3 A;  2MA1 A;  4BDP A;  5H2F U;  5AI4 A;  3ZDA A;  9ICV A;  3WKA A;  2QAR A;  2KN7 A;  2BGW A;  5J8Y A;  4JK1 A;  1N5X A;  4K4H A;  4PHE A;  2HBL A;  4QNL A;  1NK6 A;  3Q8S B;  3MDC A;  7ICM A;  1RDF A;  5ALN A;  5KT4 A;  5J0Y A;  1XSN A;  5J0W A;  3M9O B;  4Y2U A;  4YP3 A;  3HKZ C;  2XO7 A;  3L4P A;  2W54 A;  3DV9 A;  2Y0S F;  4KIT B;  3OPX A;  3SI8 A;  4DEZ A;  2EZZ A;  2FPM A;  3LDA A;  5L1K A;  1Z00 B;  3N97 B;  5AM4 A;  4DQQ A;  3H40 A;  2YMP A;  1WUD A;  2W9B A;  5EE9 A;  4PHA A;  2AQ4 A;  2XIC A;  2KNJ A;  4YQW A;  2V4Q A;  1QSS A;  3UM9 A;  3V7L A;  5DG7 A;  1X6I A;  2CN1 A;  1TK0 A;  2AGQ A;  5KFX A;  5BOM A;  2W9C A;  2G0A A;  4YVZ A;  3NRW A;  3V6H A;  5ALS A;  3RB4 A;  2FLP A;  2DFL A;  4OD0 A;  4NM1 A;  4R63 A;  4MFA A;  2R8H A;  3F5A A;  2N1R A;  5J0S A;  2H3Z A;  5HP4 A;  2KKV A;  4EBE A;  5DKW A;  1NJZ A;  5J2I A;  3RJI A;  2BPG A;  1S97 A;  4Y2J A;  4M9J A;  1V85 A;  2JEG A;  7ICS A;  2VA3 A;  8ICU A;  3TAN A;  2LKY A;  3E58 A;  4ED8 A;  2V9W A;  1SB3 C;  4IQU A;  3ISD A;  3H4B A;  4ELT A;  4RUC A;  2NO4 A;  8ICZ A;  4PHP A;  4UB4 A;  2G5H B;  3M8R A;  4YN4 A;  3M6K A;  2HBJ A;  3Q8P B;  4BXO A;  1JUD A;  1YZ6 A;  5BOL A;  1U48 A;  4UB1 A;  2XI9 A;  3FM9 A;  4DFJ A;  2GWS A;  3A0B U;  2QB1 A;  3C23 A;  2W43 A;  4DS4 A;  2M9N A;  2A1J A;  3RBE A;  5DDY A;  3TKA A;  1B43 A;  3QU7 A;  1KTQ A;  1LKY B;  1S0V A;  1PUZ A;  3MAB A;  3SZ2 A;  2ZG6 A;  5J2K A;  9ICR A;  2HHQ A;  2IOH A;  1MA7 A;  2BQU A;  1ZYQ A;  8ICC A;  5DG8 A;  3QUC A;  5KFL A;  4KLE A;  3J81 j;  2HI0 A;  5L1J A;  1X2I A;  9ICB A;  4FE3 A;  4TUP A;  4RPZ A;  1Z00 A;  1RQN A;  4KMO B;  3UQ0 A;  1N48 A;  1XO0 A;  2FMQ A;  4Z6E A;  4Y2Y A;  1B0X A;  3NGD A;  2HHV A;  4CRX A;  1IG6 A;  1ZQB A;  3CYM A;  4PH5 A;  5ALR A;  3SV4 A;  1UT5 A;  4C8L A;  1T7P A;  1F44 A;  3I76 A;  2BKE A;  4YFK A;  3BQ1 A;  1T8E A;  3HPO A;  5JTI A;  3RB3 A;  4MF8 A;  3EWA A;  4O3S A;  2F8L A;  4UAW A;  3F2B A;  1SL2 A;  4B9U A;  1ZD5 A;  4I2I A;  3WK8 A;  2JZB B;  8ICH A;  3NUQ A;  3ICX A;  3QUB A;  4CNQ A;  5KFE A;  3Q8K A;  4AYB C;  1ZJM A;  5KFJ A;  2H3Q A;  3N28 A;  3PO4 A;  2HCF A;  2IHM A;  3SEI A;  2F1J A;  3ZDE A;  4QZA A;  3H8J A;  5CR0 A;  4U7C A;  4DQS A;  4XQ8 A;  5KFI A;  4LVS A;  5DDM A;  4DSI A;  3H4D A;  3V72 A;  3RAX A;  2KE7 A;  2AXT U;  1MC8 A;  9ICU A;  2DPJ A;  2BCQ A;  4FS2 A;  3MGH A;  2G06 A;  5IIN A;  2VAN A;  1RYS A;  4YR0 A;  5IIM A;  3SD7 A;  4IQW A;  4Q8E A;  2ZTD A;  2WTF A;  2MAX A;  2YY6 A;  3Q8R B;  1ZRN A;  3BZK A;  2L5Y A;  1DGJ A;  7ICH A;  1NK0 A;  2HHT A;  3GII A;  4YXM A;  4NL9 A;  3T79 A;  5CA7 A;  5KFW A;  2DGZ A;  1KDH A;  4O9M A;  2QLT A;  1SV0 A;  4Y2R A;  4ED0 A;  5HMM A;  1L7N A;  4NLK A;  3GV7 B;  5GTI U;  3ZDC A;  1YT3 A;  2F76 X;  3IRU A;  4M47 A;  4O3P A;  4IC9 A;  2KG5 A;  2OWO A;  3H8M A;  3C2M A;  1URJ A;  2C28 A;  1TKD A;  4O5E A;  2WF6 A;  1U9L A;  4O3R A;  8ICT A;  1PK3 A;  8ICI A;  1ZQW A;  2KZM A;  5KT7 A;  2E8M A;  1CI4 A;  2BCU A;  5EE1 A;  1HEK A;  3M9M B;  1WYG A;  1TV9 A;  5AI6 A;  9ICA A;  3IN5 A;  2YTU A;  5KG3 A;  4B9V A;  4IS7 A;  4RT2 A;  3EYZ A;  5F9N A;  3QU2 A;  2IHN A;  3C5F A;  4M6W B;  3AUO A;  2FLN A;  4US9 A;  4DLG A;  2CPR A;  4NLB A;  4R64 A;  1ZJN A;  3K4G A;  2IOF K;  4YR2 A;  4Y2S A;  3WKD A;  3JPR A;  8ICA A;  3C2K A;  5BPC A;  4Q43 A;  2Q4T A;  3K1R B;  4DSK A;  4UAZ A;  3NVY A;  4KLT A;  2ES6 A;  4JV2 A;  1ZQP A;  1MN8 A;  1COK A;  2RHF A;  5B66 U;  3KBB A;  5KFV A;  3F53 A;  7ICO A;  1PZN A;  3PY8 A;  4EEN A;  2XY6 A;  4RQ4 A;  9ICJ A;  1TFR A;  8ICG A;  2H3I A;  5AIC A;  1X40 A;  5HML A;  1ECW A;  3RJG A;  3RRH A;  3NVV A;  7ICU A;  2FLL A;  4ECS A;  2RQ5 A;  5K4L A;  2NYV A;  3NAS A;  4C0Z A;  4DL6 A;  4GXJ A;  2W3R A;  1F5S A;  1SXD A;  1BPY A;  3PX4 A;  2QKQ A;  3F2C A;  4UBB A;  4I2J A;  1SL0 A;  5DLF A;  9ICS A;  3RR8 A;  4JB3 A;  2ASJ A;  4Y2X A;  2WB1 F;  2DPI A;  2LHT A;  3GIL A;  5CP2 A;  1ZQV A;  4WJ3 B;  5DB9 A;  3SAF A;  1DGS A;  7ICQ A;  4UB3 A;  2MUT A;  4EBC A;  1KL9 A;  3WU2 U;  1NI3 A;  3KTQ A;  4CE6 A;  4FZN A;  5IIK A;  2JR5 A;  5HHH A;  5KFZ A;  2W7P A;  1U45 A;  2UVV A;  4J9N A;  1KEJ A;  4F5R A;  1S5L U;  4XA5 A;  2LMR A;  5DB6 A;  3RH4 A;  4Z6D A;  2F2A B;  3TAQ A;  2E3T A;  1SXE A;  1ZET A;  2PFN A;  4MEY A;  4IQV A;  2NRW A;  2P35 A;  3M8S A;  3ZDD A;  1QH9 A;  1X9X A;  2BQ3 A;  4JMU A;  4YMO A;  3Q8M A;  4FS1 A;  4BWJ A;  1SKR A;  2RLT A;  9ICM A;  1ZQG A;  4F4K A;  4UAU A;  1B22 A;  3JPN A;  3KD3 A;  1P7D A;  5TZV A;  4DL7 A;  3KFU F;  1K5O A;  3BS5 B;  3U26 A;  4UB5 A;  4DL2 A;  1NJW A;  3MGV A;  4BWM A;  4IR9 A;  4PZO A;  5AK3 A;  2W55 A;  3C1Z A;  3HRD D;  1UA0 A;  1PVP A;  2AH5 A;  4E0D A;  1XSP A;  2JV3 A;  1BVS A;  3E2E A;  4NLZ A;  2WAQ C;  3C2L A;  2XCA A;  2ZJ5 A;  9ICF A;  8ICB A;  5ALK A;  1JMS A;  2PMZ C;  4QJF B;  2ZTC A;  4RT3 A;  2Y1I A;  5C5J A;  1K1S A;  4Q8F A;  4YMM A;  3M7D A;  5HR7 A;  4FBU A;  3QE9 Y;  3KHH A;  3AL0 B;  4O3Q A;  2YN4 A;  4UQG A;  4DS5 A;  7ICV A;  3TAC B;  1OUQ A;  1Z1B A;  4I28 A;  4BJQ A;  1X9M A;  2Y0S C;  2J6U A;  4M9G A;  2HOF A;  7ICL A;  2LBO A;  4X5V A;  2Y9U A;  4QZC A;  4R66 A;  2F1I A;  3FAH A;  2QB0 A;  3AU2 A;  1H38 A;  1HIW A;  2B0C A;  2KHV A;  2F77 X;  1ZQK A;  2ZIW B;  2PFO A;  5AKK A;  1UA1 A;  3JPO A;  4NXZ A;  1L5U A;  4RUA A;  2XGQ A;  2W04 A;  4UAY A;  5KT2 A;  4QZD A;  4QIW F;  5KG0 A;  2FI1 A;  1ZD3 A;  5AK4 A;  2DQN B;  1LB2 B;  9ICG A;  2BCS A;  2NO5 A;  3QXG A;  4P4O A;  1L7O A;  5EWG A;  1N2X A;  2NRV A;  2WHE A;  4NV0 A;  3TFS A;  5CEH A;  4RQ0 A;  4F72 A;  1ZQR A;  4ECX A;  3RJE A;  3VC8 A;  3AQE A;  2E1F A;  4ELU A;  1IV8 A;  3I1Y A;  1NK7 A;  3RH6 A;  2KV2 A;  2E8N A;  3SYZ A;  4GFJ A;  3BS5 A;  5AM0 A;  4P0Q B;  2UVU A;  2A1A A;  1SWV A;  1UHU A;  4UAT A;  1CRX A;  4K4G A;  3QYP A;  4QZI A;  4PGQ A;  3BQ7 A;  5KFS A;  5J0O A;  2LYB A;  4I29 A;  3WKE A;  1MSW D;  1KN5 A;  4B9S A;  8ICM A;  4RNN A;  5C0Y A;  9ICE A;  2E8P A;  2VKQ A;  3PSF A;  1TK5 A;  4M9N A;  3PW7 A;  3T5K A;  1V97 A;  1NK4 A;  1S0M A;  9ICX A;  3SAH A;  2YB1 A;  2G08 A;  4DCC A;  5EE3 A;  4EZ6 A;  3IP4 B;  5AKJ A;  1FO4 A;  3L5K A;  1PVQ A;  2JEF A;  4F5O A;  3UPQ A;  1RYU A;  4EYH B;  5J0X A;  3RF9 A;  1LVH A;  4ACO A;  2ZIX B;  2E1E A;  2KOB A;  4MF2 A;  2LYH A;  1RQL A;  4FO6 A;  3KHL A;  4GC7 A;  2KTQ A;  4DSL A;  1C20 A;  3TAD C;  2NRZ A;  3V6J A;  2DBY A;  2FDR A;  5CWR A;  3QX7 A;  1N5W A;  2ZJ8 A;  4EEY A;  5KT6 A;  2JGA A;  4F50 A;  2KSO B;  2KZZ A;  3JPQ A;  3T3F A;  3BQ0 A;  4B9T A;  4DO9 A;  1U49 A;  2KFN A;  5KL8 B;  5DB7 A;  4DSE A;  3PO5 A;  2ZXH A;  5KG4 A;  4IRC A;  2VIX A;  5G5H A;  4I2E A;  4PGY A;  1ZOL A;  1QTM A;  7ICF A;  2ZIV B;  3CRX A;  1ZQT A;  5L1M A;  2IBK A;  9ICI A;  1X6J A;  2EDU A;  4F4Z A;  1J2N A;  4P0Q A;  5ALI A;  4ED6 A;  4KLQ A;  3K1Z A;  2W11 A;  1S76 D;  4KLL A;  3PW0 A;  5ALT A;  3QUT A;  4EYI B;  4YG2 A;  4OJO A;  2HMX A;  5D4B A;  5J0Q A;  1L6N A;  5CJ7 A;  4B9L A;  3NVW A;  3KZX A;  4PPX A;  1WG8 A;  3ZD8 A;  1ZD2 P;  2AGO A;  3BJY A;  5AKL A;  1QQ6 A;  3HX0 A;  4F2S A;  1X9S A;  3EPI A;  4NWI A;  4B9N A;  3C21 A;  5AM5 A;  3GV8 B;  4YMN A;  1L3T A;  1O08 A;  1D9F A;  4KX3 A;  3AEV A;  5D49 A;  5HNK A;  4ECY A;  3ORY A;  4RZR A;  2RRD A;  1DK3 A;  2XY5 A;  4NLG A;  2NRT A;  2H3F A;  1T3N A;  8ICS A;  2ISO A;  3D6J A;  3VCB A;  3GV5 B;  3KZI U;  4GIB A;  1ZQC A;  2ZIX A;  2IOF A;  1RPL A;  1UPH A;  4TQS A;  3SEN A;  1SKS A;  4G3I A;  4QWD A;  3RAQ A;  3UXN A;  5KFG A;  1Z4O A;  3OSP A;  1RG6 A;  2ZTE A;  3I28 A;  3PV8 A;  5B5E U;  2OHF A;  1NZB A;  4M9L A;  2OYY A;  5KFK A;  3GU3 A;  3RJK A;  4DLE A;  8ICX A;  4R8U B;  4J9R A;  5KG2 A;  5KL1 B;  4PGX A;  3MR5 A;  2J6T A;  5KG1 A;  1MQ2 A;  1LKY A;  2I1Q A;  5J0U A;  3QEB Z;  1Q3U A;  4C4R A;  3MBY A;  4PL2 A;  1KBU A;  1NK5 A;  4DF4 A;  2BCV A;  1Z3E B;  3GIK A;  5KG6 A;  5FP0 A;  3M6Z A;  4HAI A;  4DFM A;  2KIV A;  2Q0Z X;  7ICJ A;  1ZQZ A;  4I2F A;  2AJQ A;  4J9O A;  7ICG A;  3UXP A;  4AP9 A;  3ALR A;  4CDG A;  1ZQL A;  1OXJ A;  4DQR A;  2DKX A;  1NOM A;  1VJ5 A;  4J9S A;  3KKA A;  5J8Y C;  4UB2 A;  5F3X B;  3EZ5 A;  1SIJ A;  7ICR A;  2OEH A;  4K4I A;  4YD2 A;  4Y2T A;  1TAQ A;  2DF4 B;  8ICV A;  2K8A A;  2EZX A;  2C2R A;  4DWI A;  2LPE A;  5AHX A;  1N60 A;  3PX6 A;  2BQR A;  2VA8 A;  2WF7 A;  2XCP A;  4Z6F A;  2JZB A;  3OJS A;  4J9M A;  2KJ8 A;  4QZG A;  2KVC A;  2HOI A;  2JH7 A;  3PMN A;  2D3D A;  2OH2 A;  1L7P A;  4JUZ A;  4UAS A;  2P66 A;  4BUG A;  4F93 B;  2WB1 C;  1T94 A;  2D8C A;  1BNP A;  4RQ6 A;  2WF8 A;  4CF3 A;  5KFA A;  2WF5 A;  2EAM A;  5ALE A;  9ICO A;  5J2G A;  5AM2 A;  2NRX A;  3TI0 A;  2H5X A;  3OTQ A;  5AM3 A;  1N61 A;  4KMU A;  4QZ8 A;  3K75 D;  1WCN A;  2KMD A;  1JN3 A;  3M9N B;  2LI6 A;  2ASL A;  2JH1 A;  3JPS A;  1Z19 A;  4F2R A;  1WWU A;  4QZE A;  4Y2V A;  4CCH A;  5ALY A;  3RJH A;  4IRD A;  4M04 A;  2HBK A;  5JU5 A;  2R8I A;  1RYR A;  3H0L B;  2K8B B;  3UMB A;  3ONN A;  1TAU A;  4P0P B;  1IIP A;  5AK5 A;  5DBA A;  1O03 A;  4ED2 A;  4MEX A;  4I2G A;  8ICF A;  3S6J A;  9ICC A;  4TQR A;  1S77 D;  1IM4 A;  5JUM A;  1F0M A;  4C7Y A;  1S9F A;  5HR6 A;  1GO3 F;  3G6X A;  4KLO A;  4JWM A;  1V38 A;  5AKE A;  5DB8 A;  2AHO B;  2HW3 A;  1L3U A;  4DFK A;  4QZF A;  7ICT A;  1Q3V A;  4UB6 U;  1T3Q A;  2E5S A;  3QZ7 A;  5KFC A;  4P2H A;  4UBC A;  2JHD A;  3C5G A;  5DQG A;  3Q8L A;  4EEL A;  4RQN A;  4YXJ A;  3DEE A;  4F5Q A;  3BQT A;  5TIS U;  2B6G A;  2XVT A;  4M6W A;  2A19 A;  1ZQX A;  4MFC A;  3RB0 A;  1QSL A;  3WK6 A;  4C8M A;  2GH1 A;  1KRP A;  3OHB A;  1S8O A;  1TE2 A;  4NLN A;  1SKW A;  1N63 A;  1JXL A;  2BDP A;  4RQ1 A;  2Y1J A;  2ZXI A;  4DOB A;  2LM4 A;  3GFK B;  2HBM A;  4QW9 A;  8ICW A;  2FMS A;  1ZQM A;  2K4E A;  3PSP A;  5KFH A;  3HW8 A;  4DFP A;  1SWW A;  1T4G A;  1Q46 A;  1SV4 A;  5GTH U;  2QAR B;  1ZRM A;  5J2E A;  5ALX A;  4USA A;  2KP7 A;  2I5H A;  4Z6C A;  4DL3 A;  1D8Y A;  1ED1 A;  2F44 A;  4JV1 A;  4QIW C;  8ICJ A;  4DFD A;  1JI7 A;  4J9L A;  4PZN A;  3N7P D;  3ISC A;  2PXI A;  4P0P A;  1WCL A;  5AKG A;  5AIA A;  1BGX T;  4UW9 A;  2LM1 A;  4OJL A;  1JX4 A;  2CRX A;  2HHU A;  3UXO A;  4QWE A;  1NZP A;  4J9Q A;  2KJ5 A;  5ALM A;  1K1Q A;  4F92 B;  4O3N A;  5DGB A;  2W9B B;  5E79 U;  2WF9 A;  3OHA A;  2YB4 A;  2I6X A;  3MDA A;  5A0L A;  4U6P A;  2YMM A;  1NNL A;  5KT3 A;  1CEZ A;  5ALP A;  2PI4 A;  1ZQD A;  4NL9 C;  4TUR A;  3NVZ A;  2FMP A;  3IG5 A;  4LZD A;  2W9C B;  4Q45 A;  1JRO A;  3E0F A;  5KFY A;  2ISP A;  1RM6 C;  1SV0 C;  2K8C B;  1NKB A;  1NJX A;  4F71 A;  3D2N A;  4QZB A;  5AI8 A;  2XID A;  1KFD A;  1ZD4 A;  3RBD A;  3QU4 A;  2K89 A;  1DXS A;  5KFD A;  4C4T A;  5DGA A;  5KTQ A;  3KKA C;  4DL4 A;  1MQ3 A;  5EWF A;  4OCZ A;  2BPC A;  2FPL A;  5ALZ A;  2W8L A;  2R8K A;  3GIM A;  2MSN A;  2KVS A;  3QUQ A;  4OJ6 A;  3N4M B;  5IIL A;  2R8G A;  2AU0 A;  1NK8 A;  5J29 A;  4BXO B;  1QQ7 A;  3THV A;  1B4F A;  5J2H A;  2FE9 A;  1KSP A;  1TAM A;  4RPX A;  2W9M A;  1N62 A;  4C4S A;  2AQ0 A;  4LZG A;  4R65 A;  2VJ4 A;  5J2F A;  4FFD A;  4QZ9 A;  5KG7 A;  1S0O A;  1TK8 A;  5L1I A;  3WK9 A;  3ETR A;  4JWN A;  1A76 A;  5AKH A;  5L1L A;  2A1J B;  4Q44 A;  1X9W A;  4KLH A;  3WK5 A;  2XY7 A;  3MR2 A;  3PR5 B;  3ZDB A;  3PST A;  5AKI A;  9ICL A;  3RR7 A;  5J2C A;  1FFU A;  3IG8 A;  5KFB A;  1QLN A;  2ZJA A;  1ZQE A;  4M2Y A;  2KHQ A;  5AIB A;  4J9K A;  2BCR A;  4KLG A;  1Z4N A;  2JEI A;  4ED3 A;  1ZQY A;  2KZ3 A;  4RQ2 A;  3RJF A;  4GXK A;  2HVI A;  3CP8 A;  4RQ8 A;  1UQV A;  5KFO A;  3PX0 A;  3LVV A;  5AKZ A;  4XUS A;  1KKX A;  3IM1 A;  4EX7 A;  2XGP A;  5AKX A;  2V4R A;  4P4P A;  8ICR A;  4OJ5 A;  5KT5 A;  5ALW A;  3OJU A;  3WK4 A;  4F5P A;  2DKZ A;  2I9G A;  8ICE A;  3RRG A;  5ALO A;  5KG5 A;  5KFT A;  1VLB A;  5ALJ A;  1JXE A;  5ALF A;  3AMZ A;  3B0Y A;  2O6K A;  8ICO A;  2EH9 A;  3L3F X;  2HOQ A;  4DOA A;  2H3V A;  8ICP A;  3JPT A;  3NRZ A;  2ZIW A;  4RQ7 A;  1V9P A;  2K4P A;  2W8K A;  5J2D A;  1J2M A;  5J2B A;  2PFP A;  4TUS A;  1QCK A;  4RQM A;  4ECV A;  4PHD A;  8ICQ A;  2HHS A;  4DL5 A;  2BZF A;  3T5J A;  3HKZ F;  1D8L A;  2EAP A;  4RNM A;  1RXW A;  4CF4 A;  4C80 A;  1A6S A;  2HVH A;  3F2D A;  3PZP A;  4KN7 A;  2G07 A;  4J9P A;  3B9J A;  5KFP A;  2DUY A;  1HJP A;  4F5N A;  2HHX A;  4ZH4 A;  1XSL A;  1ZXI A;  4G9B A;  1N56 A;  5DLG A;  3ETL A;  4IL6 U;  9ICQ A;  3AQF A;  3C1Y A;  4ECQ A;  4I2C A;  4KLD A;  2VJ5 A;  2YMQ A;  2GO7 A;  2RDI A;  2EZY A;  3OGU A;  5CB1 A;  2K4H A;  1RXV A;  4RPY A;  4LJX A;  2B21 A;  5AK6 A;  2R8J A;  1X42 A;  3AN1 A;  2ZUB A;  3C28 A;  2C2D A;  9ICH A;  2KK0 A;  3WK7 A;  4BGD A;  3BZC A;  2OM6 A;  5AM1 A;  4IR1 A;  4PL1 A;  4RQ3 A;  3GQC A;  1BPE A;  3Q8Q B;  1J97 A;  5AI0 A;  1C7Y A;  1FFV A;  3BDP A;  1BNO A;  3V7J A;  3TAP A;  3SR6 A;  2Y9T A;  5KNI A;  3C29 A;  1ZQF A;  1ZQQ A;  2MU2 A;  5D46 A;  4JV0 A;  3G6V A;  4TUQ A;  4ECU A;  5DQI A;  1BPZ A;  2VA2 A;  1RZT A;  2F1H A;  4F8R A;  4UAV A;  1KQQ A;  3A0H U;  4FZL A;  1L8L A;  5L9X A;  1XS9 D;  2PI5 A;  2JXJ A;  1FIQ A;  1NKC A;  4UB8 U;  4FBT A;  5KFQ A;  4ECW A;  4KN4 A;  1OW5 A;  5J0R A;  2ATL A;  4C8O A;  4FZM A;  2KSO A;  2OCE A;  3BS7 A;  4RQ5 A;  2J6S A;  4O5C A;  2ZIU B;  2FJ6 A;  1L3S A;  2E8O A;  1ZQH A;  3QU9 A;  3IV6 A;  1Z1V A;  3PML A;  2JEJ A;  2LYA A;  3IHQ B;  2ZIV A;  1L3V A;  3EW9 A;  3O0F A;  4ELV A;  3ZD9 A;  3MFH A;  5T14 A;  3RTV A;  3UQ2 A;  5JRT A;  8ICL A;  3NTU A;  4IRK A;  3FDS A;  7ICI A;  4KLI A;  4RU9 A;  2KEY A;  4EBD A;  8ICY A;  3HJE A;  2UVR A;  4QWB A;  3LWM A;  5ALH A;  1DRG A;  2GLE A;  2C22 A;  7ICP A;  5KAI U;  4AYB F;  4DSJ A;  4O3M A;  4ZOH C;  4Y2P A;  1LV5 A;  2GOL A;  7ICN A;  2KD1 A;  3RB6 A;  3RJJ A;  5CRX A;  4OJP A;  3HP6 A;  3PSI A;  4EX6 A;  1D8B A;  5KFN A;  1WWV A;  4C8N A;  3PW4 A;  1HUO A;  4DSF A;  1ZQJ A;  5KFF A;  1U4B A;  3SQI A;  4M0A A;  4NY8 A;  3OSN A;  2KJ9 A;  1UCV A;  2CXY A;  8ICN A;  2IMW P;  3HT3 A;  2ASD A;  2MUT B;  3DDH A;  3N7S C;  2BHN A;  4DF8 A;  1XO1 A;  4GXI A;  4KTQ A;  1QSY A;  7ICE A;  1KW4 A;  2G09 A;  5J0T A;  3RH5 A;  2F3N A;  3D2S A;  2W7O A;  5J2J A;  3HIL A;  1ZQU A;  3UMC A;  4F4Y A;  1DOQ A;  2YML A;  3SAG A;  2JRZ A;  2R18 A;  3PW5 A;  3BQ2 A;  9ICT A;  5ALL A;  4KLU A;  1SZH A;  3WKC A;  1AQ6 A;  4R8U A;  2M0N A;  3SMV A;  5KFM A;  2DL0 A;  2ZIU A;  3GIJ A;  5ALV A;  4GLX A;  2PKE A;  4F4X A;  4F91 B;  4KLM A;  9ICN A;  3EUB 2;  4IQT A;  3FYH A;  4ECR A;  4YCX A;  4B6J A;  3H0R B;  2K4I A;  4CF5 A;  5IIO A;  2ESE A;  2A3V A;  1BPX A;  1NJY A;  4ICA A;  4CGZ A;  5CHG A;  5AI9 A;  1U47 A;  4I2B A;  4Y2Q A;  3MFI A;  5EE0 A;  1Q8K A;  2C2E A;  3KHG A;  5ALG A;  3PVX A;  4KLJ A;  1UT8 A;  2K60 A;  4DQI A;  4ECT A;  4F3O A;  5AI5 A;  4RNO A;  3V7K A;  3T5H A;  1NKE A;  5DQH A;  4NM2 A;  1ZQI A;  3D2Q A;  1ARO P;  3PNC A;  2IA6 A;  2BR0 A;  5KFR A;  1XWL A;  3R9K A;  1QQ5 A;  1Y88 A;  4O3O A;  2KKP A;  3TAD A;  3KOO A;  1JIH A;  2YX8 A;  4I2D A;  3ED5 A;  3V6K A;  4C8K A;  4C7Z A;  2MRL A;  1EXN A;  4B9M A;  1S0N A;  2KFZ A;  2RP5 A;  2BDU A;  1BPB A;  2FPK A;  1ZQS A;  4I27 A;  4M9H A;  3KHR A;  2EAN A;  2ODG A;  3B0X A;  1PK1 B;  2ALZ A;  2HDO A;  4KX5 A;  1XC9 A;  3JPP A;  3MGI A;  4QZH A;  7ICK A;  2QB0 B;  2D6F C;  1TVA A;  1PVR A;  1HUZ A;  4KLS A;  3CW2 C;  2KIC A;  3N7R C;  2NV3 A;  2P6U A;  4XRH A;  3HWT A;  1L7M A;  5ALQ A;  1D9D A;  1VDV A;  4EZ9 A;  3MR6 A;  4QWC A;  3PW2 A;  2W3S A;  3WKB A;  5EOZ A;  3H8S A;  4OO1 J;  1ZQ1 C;  1ZQO A;  3H8W A;  2KIW A;  4ECZ A;  5J0P A;  3FC4 A;  2AGP A;  1FEZ A;  5J2A A;  3PR4 A;  5G5G A;  2UVW A;  3M1Y A;  1L8O A;  3UMG A;  2HSZ A;  2JMG A;  4PJ0 U;  1S10 A;  4YD1 A;  2Z7J A;  1SZP A;  3AM9 A;  4EEK A;  4QW8 A;  2W9A A;  3H0M B;  3SV3 A;  3LK9 A;  2EAO A;  4O0I A;  2BPF A;  3QEA Z;  3MR3 A;  2WFA A;  4DOC A;  3LYS A;  4MHV A;  5AKY A;  3QU5 A;  3TQ1 A;  3F5E A;  2W03 A;  2PFQ A;  4DQP A;  4P4M A;  9ICP A;  2DWQ A;  4I2A A;  4F4W A;  3T5L A;  1JRP A;  4QWA A;  3QZ8 A;  5HHI A;  3GZF A;  2OXO A;  4UAR A;  3TFR A;  2RDJ A;  5ALD A;  5KAF U;  2F8K A;  4A8E A;  5ALU A;  3H7I A;  4MFF A;  3ISB A;  1IXR A;  5KFU A;  5IIJ A;  2EQY A;  1YZ7 A;  3ZI4 A;  3LVW A;  4US8 A;  3AU6 A;  1ZQN A; 
#chains in the Genus database with same CATH homology
 1TAM A;  1Q3U A;  3HKZ F;  1CRX A;  3NRW A;  2K4E A;  3PSP A;  4PL2 A;  1KBU A;  4NLC A;  1URJ A;  4KX5 A;  1A6S A;  4P0Q A;  1F44 A;  2PMZ C;  2VJ4 A;  4QJF B;  3F2D A;  3SAG A;  3PZP A;  2WB1 F;  2R18 A;  4FZM A;  2D6F C;  2LYB A;  2F8L A;  2LHT A;  3F5A A;  3K1Z A;  1PVR A;  2N1R A;  2HBK A;  2KIC A;  3F2B A;  2H3Z A;  4WJ3 B;  2KKV A;  3M6Z A;  2G07 A;  2NV3 A;  3N7R C;  3SAF A;  5C0Y A;  4OJO A;  2HMX A;  2ZIU B;  3H0L B;  3M7D A;  5HR7 A;  2VKQ A;  1HEK A;  3ICX A;  2K8B B;  1SZH A;  3NUQ A;  3ONN A;  3PSF A;  4P0P B;  1IIP A;  3AL0 B;  1L6N A;  4AYB C;  1ED1 A;  3ALR A;  4CDG A;  3KZX A;  3PST A;  2LKY A;  4BX9 C;  4QIW C;  2H3Q A;  1A0P A;  2M0N A;  3SMV A;  3IG8 A;  3IN5 A;  4FZN A;  2ZIU A;  3SAH A;  3N7P D;  4OO1 J;  1ZQ1 C;  2KHQ A;  2LYA A;  2YB1 A;  2G5H B;  2G08 A;  2ZIV A;  4NWI A;  1Z1B A;  3AQF A;  1OUQ A;  4P0P A;  3M6K A;  2HBJ A;  2KIW A;  4BJQ A;  3IP4 B;  2WAQ F;  2Y0S C;  4OJL A;  3O0F A;  2CRX A;  4U7C A;  1PVQ A;  2DF4 B;  2G5I B;  2VJ5 A;  2W7P A;  5T14 A;  2HOF A;  2LBO A;  4KX3 A;  5HR6 A;  2PMZ F;  2KJ5 A;  2K4I A;  2XI9 A;  1GO3 F;  2K8A A;  3CP8 A;  3H0R B;  3RF9 A;  4ACO A;  2ZIX B;  3RFA A;  2A3V A;  1XNS A;  2CPR A;  2K4H A;  2RRD A;  4ICA A;  4CGZ A;  2E1E A;  2KEY A;  2MA1 A;  2KOB A;  4NLB A;  1HIW A;  2JMG A;  2H3F A;  2KHV A;  2F77 X;  2ZIW B;  3LVV A;  3VCB A;  2YB4 A;  2F2A B;  1DRG A;  2ZIX A;  5A0L A;  2Q4T A;  2Z7J A;  4U6P A;  3C28 A;  1Q3V A;  2G06 A;  2KJ8 A;  2W04 A;  4AYB F;  4O3M A;  2E5S A;  2HBL A;  4QNL A;  2KVC A;  4OJ5 A;  3H0M B;  4QIW F;  2HOI A;  2RHF A;  2GOL A;  2OM6 A;  1UPH A;  3IG5 A;  2JH7 A;  2KD1 A;  2DQN B;  4JMU A;  3F53 A;  2OH2 A;  5CRX A;  4OJP A;  3PSI A;  2JHD A;  3E0F A;  3HKZ C;  4PL1 A;  2ZG6 A;  1D8B A;  4BUG A;  3D2Q A;  4NV0 A;  2JGA A;  2K8C B;  2Y0S F;  3LYS A;  3D2N A;  3OPX A;  2XID A;  2WB1 C;  1T94 A;  2H3I A;  3DEE A;  1MA7 A;  3F5E A;  2W03 A;  3SQI A;  1ECW A;  2K89 A;  1P7D A;  3VC8 A;  3AQE A;  1NZB A;  2KKP A;  3C29 A;  1WUD A;  2KJ9 A;  2OYY A;  2XVT A;  2HOQ A;  3GU3 A;  3GZF A;  2OXO A;  2YX8 A;  3L3F X;  5KL8 B;  2ZXH A;  2E1F A;  3T79 A;  3KFU F;  4FE3 A;  2H3V A;  4KMO B;  2GH1 A;  2VIX A;  3MGV A;  1XO0 A;  4C0Z A;  2ZIW A;  3N7S C;  2DGZ A;  2MRL A;  2XIC A;  2KNJ A;  4A8E A;  2KV2 A;  4CRX A;  5KL1 B;  2RP5 A;  2BDU A;  4OJ6 A;  3CYM A;  2G09 A;  4GFJ A;  1PVP A;  2ZIV B;  2CN1 A;  3CRX A;  4P0Q B;  2JH1 A;  4FZL A;  2ZXI A;  1YT3 A;  3F2C A;  1Z19 A;  3D2S A;  2F76 X;  2HBM A;  2W7O A;  3LVW A;  2WAQ C;  4IC9 A;  2G0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...