2KHQA

Solution nmr structure of a phage integrase ssp1947 fragment 59-159 from staphylococcus saprophyticus, northeast structural genomics consortium target syr103b
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
MITFADYFYQWYEVNKLPHVSESTKRHYESAYKHIKDHFRHKLLKDIKRTEYQKFLNEYGLTHSYETIRKLNSYIRNAFDDAIHEGYVIKNPTYKAELHASVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Solution NMR structure of a phage integrase SSP1947 fragment 59-159 from Staphylococcus saprophyticus
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
molecule tags Dna binding protein
total genus 36
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14659 Phage_int_SAM_3 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2khqA01
2KEYA 1CRXA 4ACOA 3MGVA 2KKVA 2KOBA 2KJ9A 3C29A 1XO0A 3CRXA 2KIWA 4CRXA 1XNSA 2OXOA 1KBUA 1NZBA 1P7DA 5CRXA 1Q3VA 1DRGA 1PVRA 1MA7A 2HOIA 1Z19A 1Z1BA 2KKPA 2HOFA 3LYSA 3C28A 1PVQA 1PVPA 3NRWA 2A3VA 1F44A 2CRXA 1A0PA 1Q3UA 2KHVA 1OUQA 2KJ8A 2KD1A 2KHQA 4A8EA 2KJ5A
chains in the Genus database with same CATH superfamily
1L6NA 4EX7A 2WAQC 3C21A 5KFRA 4US9A 2MUTB 2ZJ8A 2ZXHA 2NRTA 5ALNA 3OGUA 4C8NA 2ASJA 3KTQA 3MR2A 5KFIA 1ZQGA 4R8UA 1D9DA 2VA2A 4Z6FA 4B9MA 5AKLA 3RJKA 2JEIA 5AKEA 1B0XA 5AHXA 4YFKA 4M9GA 5KFJA 4Z6CA 1SL0A 8ICMA 1O03A 1S0NA 3CYMA 3TAPA 1TAMA 5KG2A 4F4ZA 3T5JA 1ZQLA 2OHFA 4Q8EA 5G5GA 1Z4NA 5KG1A 3LVWA 1QSLA 2VKQA 3SYZA 1ZQRA 4J9RA 4I2IA 2KJ5A 2F44A 4F5RA 3PSTA 2ESEA 1B22A 5TISU 3ZDCA 4F91B 2HOIA 1VJ5A 4RT3A 3H8WA 3A0HU 1L5UA 4F93B 5AM0A 4M04A 1NKBA 1WG8A 1X66A 7ICNA 3KZXA 4F5QA 2K8CB 8ICAA 4G9BA 3BJYA 4NLGA 3DV9A 2FLNA 2Q0ZX 4RPXA 1X6JA 4BX9C 1Z1VA 5CA7A 1JXLA 1S0MA 2DF4B 4F71A 3KFUF 4RQ1A 8ICKA 4I2BA 4LVSA 4XUSA 9ICIA 3WK6A 3TI0A 4RUCA 2W3RA 5KFUA 5ALTA 1RXVA 2PI5A 3NTUA 1NKEA 4QZIA 3PW7A 3NVWA 3BS5A 4KLTA 1NNLA 5GTIU 3SV4A 1COKA 3HKZF 4Y2PA 3BS7A 9ICUA 4NXZA 3RFAA 4KITB 4RZRA 4RNNA 3C23A 2KOBA 3KHGA 2KN7A 3M9NB 1QCKA 2C2EA 3C1ZA 4UAYA 2JEGA 3SENA 1UQVA 1MA7A 4Y2VA 3UMGA 3HX0A 2DL0A 1QQ7A 4DEZA 4OJLA 4PH5A 4QZEA 5J8YA 4J03A 1S0OA 2KE7A 3IM1A 1JN3A 2W55A 1OXJA 3MR6A 5KFEA 3IP4B 4KLQA 1NKCA 5DBBA 5KFOA 3AU2A 3LVVA 2R8HA 4AYBF 2NRZA 2LYBA 3GV7B 3SD7A 3ORYA 3PR4A 2DWQA 7ICGA 4KLJA 4DOBA 2F1HA 3KD3A 3Q8LA 8ICGA 2E8OA 5KAIU 1N56A 2A1JB 4DSFA 4J9MA 4DQIA 4CF3A 1WYGA 4YR3A 1LB2B 1NK0A 5JTIA 3IG8A 5ALVA 4ED2A 1S77D 2H3QA 4QWBA 2AGOA 1B4FA 4EEYA 4C7ZA 1L7NA 2EDUA 2XICA 1X2IA 3UXNA 4YN4A 4OJ5A 2AGPA 4DL5A 4BDPA 2OCEA 4DFJA 9ICHA 1DOQA 1L8OA 4DL6A 3OSPA 3RJEA 1CI4A 1SL1A 1NOMA 4Y2TA 3HWTA 1TFRA 4Y2XA 5D4BA 2W9BA 2QB1A 1SZHA 4JUZA 2YB1A 5DQHA 3WK7A 1BNOA 5HMLA 3WKCA 3RTVA 1O08A 4A8EA 5KFSA 5AI6A 5AKIA 1A76A 5AM2A 2BCQA 2ES6A 4C80A 1LVHA 3Q8QB 1BPEA 4K4HA 5ALSA 2RP5A 3AN1A 4UBBA 2ZIXA 4GXKA 2E8NA 1X9WA 4O9MA 2QB0A 2W9CA 1N2XA 3V7KA 3OSNA 8ICWA 4BXOB 7ICIA 1KKXA 5EE3A 2EANA 3JPRA 5KFCA 1TVAA 4DFMA 9ICQA 3JPTA 1X9SA 2MA1A 4ECWA 2HHSA 5CRXA 5ALDA 2D3DA 4F4YA 1LKYA 5EE0A 2ZG6A 2H3FA 2RHFA 2MU2A 3PVXA 2G06A 3OHBA 1SWVA 2BQ3A 2W03A 4ECRA 3U26A 5HNKA 3RRHA 4KLSA 4MEYA 3WKEA 2OEHA 7ICUA 4MFFA 2HOFA 1PK1A 1NK7A 5DGBA 5DB8A 5BOMA 3F2CA 2E1FA 4NJ8A 4K4GA 4PHAA 4CGZA 5J0YA 3E58A 1KFSA 2KJ9A 4CRXA 4DLGA 3HT3A 2KG5A 2PFNA 1ECWA 1TAUA 9ICXA 4F3OA 5EE9A 4DFKA 9ICTA 2B6GA 4F50A 5HHHA 4DOCA 3UPQA 1NZPA 4JV0A 4Y2RA 3T5LA 2HOQA 4ED0A 2BR0A 2LYAA 3UQ2A 4M6WA 2YTUA 1IV8A 3CNHA 5DG7A 1J97A 4QZHA 7ICPA 1KN5A 3AL0B 1JX4A 4ED3A 4I29A 2BCRA 1KTQA 3RJJA 7ICSA 4PHPA 4P4OA 5F9NA 2KEYA 1F0MA 5KT6A 3ED5A 5J0UA 1D9FA 3PSFA 8ICRA 4DQSA 4IQUA 4YG2A 4YR2A 4JWNA 4CF4A 4M2YA 5CR0A 3HW8A 5IILA 3WKDA 3VCBA 4YD1A 5AICA 5J2JA 3RF9A 3NVVA 2EZXA 1XS9D 3TADA 3SAHA 3MR3A 4OCZA 2YMMA 4ECQA 5ALPA 1Z1BA 2VA3A 8ICEA 5KG4A 3LYSA 2Y0SC 3UXOA 4PL2A 9ICAA 4KMUA 2UVVA 2HCFA 3DDHA 4RNMA 3O0FA 3HRDD 3MGVA 3JPOA 2G08A 2W7OA 2V4QA 3BZCA 5KFAA 1VDVA 4MEXA 4KLDA 2KICA 8ICYA 1NK5A 5IIJA 4MHVA 3NS1A 4I2DA 3PX4A 2QLTA 3BQ7A 3D2SA 2R8GA 3E2EA 4O3OA 2W43A 4KN4A 3ZDBA 5ALYA 4DFPA 2HBLA 1QQ5A 2ZXIA 4US8A 4QWAA 3AM9A 1TK5A 1ZQDA 3RR8A 2IOFA 5AK4A 5DBCA 4PGXA 3SZ2A 4GXJA 1RXWA 5KFKA 1KDHA 5IIIA 4EX6A 5BPCA 2KFNA 4R8UB 1Z00A 1BPYA 2BCVA 2JEJA 5HMMA 5KL1B 3RBDA 1DGJA 2EZZA 4F5PA 1ZQQA 1V97A 2ASLA 2C22A 1N63A 2BQRA 2GH1A 3ZD8A 4P0PA 1V38A 1NZBA 4LZGA 4KLLA 3NGDA 4Y2UA 2OM6A 1KW4A 4DQPA 1QSSA 4EBDA 4FS1A 3MDAA 4B9SA 1IG6A 5ALQA 2CRXA 3RJHA 4EELA 1RYRA 1UHUA 4ED6A 4O3NA 4TURA 1CRXA 9ICKA 2NO4A 5DQGA 3Q8RB 1L3UA 2LHTA 2DQNB 3UM9A 4EEKA 2XY6A 1RYSA 2XIDA 1AQ6A 9ICVA 3IDWA 4JV1A 2KIVA 5J0RA 5AKGA 2OWOA 4BUGA 2K8AA 4FZMA 5AKXA 1ZQHA 2P35A 2YQEA 2VIXA 3RBEA 3T5KA 5FP0A 1T4GA 1XWLA 4M47A 2HHXA 3KHHA 4EYHB 2EH9A 1MN8A 3NVYA 3TFRA 2C2DA 1Q8KA 2WF9A 5AKHA 2JMGA 4UB8U 3I76A 4EBEA 4GC7A 4DL4A 4R64A 4B9LA 1BPXA 2XCAA 2XCPA 3N97B 2PMZF 2RLTA 4NLCA 4YMMA 4ECYA 2KSOA 3NVZA 5B66U 8ICPA 1ZD5A 2K89A 3BS5B 2KFZA 4F92B 4JMUA 3MGHA 4DF8A 2A1AA 1SXDA 4DOAA 2HVIA 1ZQ1C 5J0XA 4MFAA 2R8JA 4O0IA 2PI4A 4B9NA 2PXIA 2KZMA 2JH1A 3IG5A 4YXMA 5DKWA 4R63A 4C0ZA 4O5KA 2LBOA 4P0QA 2JR5A 4XA5A 5J2CA 2AJQA 3KZIU 4M9JA 5AI5A 8ICTA 5L1KA 3V72A 3M1YA 5ALHA 3QUTA 3T5HA 1PZNA 2VJ4A 2V4RA 4ACOA 3M9OB 3PO5A 2BPCA 3F5EA 2FMPA 1HUZA 3SAGA 4RPZA 4NL9C 4RUAA 5K4LA 2E8MA 1B43A 3B0XA 4RQ4A 3FAHA 1COOA 2FPMA 3C5FA 2NO5A 2HI0A 3QZ8A 4DSKA 1KL9A 4DF4A 4EENA 4UAZA 1N61A 4PHEA 2Y0SF 4NV0A 1P7DA 5KFWA 3N4MB 1PVRA 3H4DA 1S97A 1DXSA 3OTQA 4QZBA 3M8SA 4RQ5A 1FIQA 1NJXA 4JV2A 1L3VA 3EUB2 3PX0A 1IIPA 3JPQA 3C2KA 3FDSA 1SV0A 5CJ7A 4EZ6A 1ZQYA 1ZQXA 4R65A 3ICXA 2IBKA 4DQQA 2WF8A 3KKAA 5KT4A 4Q44A 1ZQMA 4IRDA 4F4XA 2P6RA 4UB2A 2DKZA 2ZJAA 4QIWC 4B6JA 5EWEA 8ICBA 5AI4A 5L1MA 3KHRA 4UB4A 4DL2A 7ICQA 3BQTA 4UAUA 4WJ3B 2G0AA 5DG9A 3QNMA 2B21A 2GO7A 4LJXA 1C20A 1ZQAA 1UT8A 2BPGA 2KKVA 1IM4A 4M0AA 1ZD2P 2ZIUB 2ZTDA 1ZQPA 2AGQA 7ICMA 4QZAA 2ZIXB 3SI8A 3QX7A 3I28A 1RG6A 4JWMA 1NK4A 5AI9A 2QB0B 2MUTA 8ICHA 8ICVA 3RR7A 3N7PD 2HDOA 4NLKA 1Q46A 3SMVA 1RPLA 4Q45A 3PW4A 2BDPA 3EZ5A 2KP7A 4FBTA 2DUYA 4P4PA 1FO4A 1LKYB 2XY5A 2HSZA 3AMZA 5ALZA 1Z4OA 4EYIB 5CP2A 4PGQA 3Q8MA 4DL7A 4PGYA 5CB1A 5KT2A 4QZGA 3QUQA 4IQTA 2IOFK 2UVWA 4DSIA 3Q8KA 4UBCA 1XO0A 4KLEA 2NYVA 1U48A 1SWWA 1NK9A 3TKAA 5KFYA 1UPHA 2NV3A 5F9LA 4F72A 3MABA 5E79U 2BCUA 1JUDA 4NLBA 3NUQA 3H0RB 2C28A 2HHUA 3WK5A 4GXIA 5AIAA 1T8EA 2XGPA 4C8KA 2KMDA 2BKEA 3VC8A 3TACB 2R8IA 2E1EA 4ELVA 3ISCA 4GLXA 3V6KA 4DS4A 4UARA 2ZIWA 4O3QA 4DO9A 1H38A 2IOHA 2WAQF 4RPYA 2V9WA 5AIBA 4IQVA 4PPXA 5F3XB 2KV2A 2ZUDA 1ZQCA 1TAQA 4FO6A 2FPLA 1MQ3A 2F1IA 2Q4TA 4DLEA 2WFAA 4RQ7A 2UVRA 4FZNA 4IRCA 2VA8A 9ICNA 4HAIA 1F5SA 1ZQWA 2GLEA 2LYHA 4I2EA 4DSJA 2KVSA 3KBBA 2F8LA 1ZQKA 4ED1A 5ALKA 3V6JA 2EZYA 2LKYA 4TQRA 1ZD3A 3T3FA 4KN7A 3MDCA 1WWUA 3WU2U 5HR7A 3ETLA 2F3NA 3IRUA 1S5LU 3PX6A 4I2GA 4MFCA 3ISBA 2HMXA 4NM2A 4YD2A 4Y2SA 3C29A 1KEJA 3OPXA 4F5NA 1ZRNA 3LK9A 5L9XA 1QLNA 2CXYA 1ZJMA 1T3NA 1Z3EB 1ZRMA 4KLMA 2E3TA 3D2NA 2PKEA 5ALOA 5DG8A 1T3QA 4FE3A 2YMLA 1SL2A 2E8PA 4C8MA 8ICFA 2OYYA 3C1YA 1KQQA 1OUQA 1YZ7A 3H0LB 3TADC 1U4BA 5ALEA 1S8OA 2JHDA 2DPJA 7ICLA 5H2FU 3BQ1A 2A1JA 3TQ1A 3A0BU 1FFUA 5KFBA 3QYPA 5KTQA 4RQ2A 3RJFA 1JROA 4F2RA 1M6YA 3NRWA 1WUDA 1F44A 5KT5A 4C8LA 2W9MA 3K4GA 1TE2A 4RT2A 2K8BB 4QIWF 8ICOA 2HBJA 3MGIA 2KHQA 4IC9A 4I28A 3C5GA 9ICMA 7ICHA 1NK6A 5CHGA 3UQ0A 3QU7A 2IA6A 3ETRA 5J0WA 4PL1A 1ZJNA 5AM4A 5L1JA 4FS2A 2BGWA 1ZQVA 1Z00B 1PVPA 3NRZA 1SZPA 3AQEA 2I9GA 1SKSA 2HBKA 3PW5A 2RDJA 2LI6A 4F4WA 2HHWA 4KLUA 4BWMA 4Z6DA 4YR0A 4R66A 4UW9A 3DEEA 3JPNA 3IN5A 4YVZA 4O5CA 3D6JA 4G3IA 5A0LA 1PK3A 3QU4A 3MFIA 4DFDA 1X6IA 4CNQA 2YN4A 4UATA 2Y9UA 1NJWA 2Y1JA 1UA1A 2YMQA 5AI0A 4ZOHC 3AUOA 4I2CA 1RDFA 5KFHA 4O5EA 1X40A 1DRGA 2WB1C 5J0TA 2KK0A 2PFPA 3FM9A 1RQNA 1KRPA 1Q3UA 4XQ8A 2KJ8A 8ICIA 3AQFA 2D8CA 1SKWA 5CWRA 4Q43A 4UAVA 7ICJA 3RAXA 2ALZA 4GIBA 3QE9Y 2ZIVB 3QUBA 4C4SA 1ZQJA 2GOLA 2FJ6A 3M9MB 1DK3A 2K4PA 3H8MA 5IIMA 1JXEA 2HHTA 2ISPA 2NRVA 2W7PA 1C7YA 7ICTA 4QZ8A 1TKDA 2AXTU 1KLNA 8ICSA 5KFDA 3PW0A 3PO4A 4IR9A 4KLIA 2LM4A 2J6SA 3M6ZA 2GWSA 2VJ5A 2BHNA 2PFOA 3L5KA 1NI3A 2FLLA 2KD1A 3QU9A 1QQ6A 1L7MA 3IHQB 3SAFA 4PHDA 2KIWA 2Y1IA 2R18A 2OXOA 2JGAA 4P0QB 2K4IA 5HR6A 4JK1A 1ZYQA 2F76X 5DB7A 3KOOA 4IQWA 3T79A 2UVUA 2VANA 1PVQA 1ZQSA 3ISDA 5D49A 4QWEA 5AKJA 5KG3A 3NASA 2J6UA 1URJA 4J9NA 2G5IB 2AQ4A 4CE6A 4YMNA 5KFNA 4C8OA 1S0VA 2MSNA 3RJGA 4QJFB 1CEZA 1A6SA 1NJYA 1A77A 5AM5A 2EQYA 1N5WA 2FE9A 4M9NA 4QZDA 4AYBC 1ZQZA 2AHOB 2ZUBA 1QSYA 1V85A 3C2LA 4KLHA 3PZPA 4IL6U 3EYZA 3OJSA 2RQ5A 2KKPA 2IMWP 4DWIA 1JALA 1U47A 3WK4A 2QARA 4OJ6A 2XGQA 1U9LA 8ICCA 3K75D 3MC1A 1N5XA 2I1QA 2BCSA 5J2BA 1MSWD 2G09A 2F77X 4QZCA 5KFQA 5EWFA 3Q8PB 4P4MA 2F8KA 1S9FA 4I2FA 4UB1A 3KKAC 4IRKA 4EBCA 3J81j 3GIIA 2JRZA 3GFKB 4I2JA 4NY8A 3CRXA 1BVSA 2JV3A 3V7LA 1TK8A 2BPFA 7ICFA 3EW9A 4ECVA 5HHIA 9ICSA 2O6KA 4QW9A 7ICRA 4YQWA 3QXGA 4ECZA 3TANA 4YMOA 2CPRA 4DCCA 3JPSA 4RQMA 9ICEA 3EPGA 4FBUA 2F1JA 3SR6A 1XC9A 7ICEA 4QWCA 3D2QA 1SV4A 2KVCA 5IINA 2H3VA 3SV3A 5J29A 5HP4A 1KFTA 1X42A 4FZLA 3PSIA 3MR5A 5J8YC 9ICBA 4MF2A 2WB1F 3QZ7A 4YCXA 3EWAA 5ALRA 4UB3A 4O3MA 4KMOB 4O3SA 4RQ6A 1ZQFA 5CEHA 4PZNA 3G6VA 2HW3A 4YXJA 4YP3A 3OHAA 2JZBA 3F2DA 3QUCA 3HILA 2XI9A 5IIKA 1Y88A 8ICNA 2FMQA 1BGXT 5KG0A 4LZDA 3ALRA 4M9LA 2I6XA 1ZQBA 5JRTA 4QZFA 4ICAA 4RQNA 4J9QA 2K4HA 3H7IA 1RM6C 1V9PA 5KNIA 4ELUA 8ICLA 2ZIWB 3V6HA 4MF8A 2W9BB 4USAA 4OD0A 9ICWA 2DGZA 4RU9A 7ICKA 5KFGA 9ICFA 1JMSA 1PUZA 3RJIA 1HEKA 2AQ0A 3IV6A 1U45A 9ICCA 4EZ9A 2C2RA 3LDAA 3R9KA 5DB6A 1SXEA 2CN1A 3H0MB 2WF7A 3OJUA 3PR5B 3MBYA 4ECTA 2BQUA 1EXNA 3M7DA 2M0NA 5KFFA 1J2MA 5J0PA 2W9CB 1RQLA 4BJQA 4KLFA 5KG7A 1K1SA 2ZJ5A 2H3IA 3PMLA 1WCNA 3N28A 3HP6A 2AH5A 4NL9A 2WF6A 5J2EA 1BPZA 2RDIA 4UASA 9ICGA 5J2DA 2EAPA 3QU5A 5ALIA 2ISOA 5J2KA 2Z7JA 5TZVA 5ALLA 4C4RA 1D8LA 3H4BA 2YY6A 4TQSA 4ECSA 1ZQNA 1ZOLA 5GTHU 1ZETA 3RH4A 1DK2A 1IXRA 4XRHA 3N7SC 1PK1B 1U49A 5J2GA 1Z19A 5AM1A 2F2AB 4KLGA 4IR1A 2B0CA 5J0QA 4C7YA 1JRPA 4ECUA 5ALWA 2KTQA 3Q8SB 1D8YA 9ICOA 4RQ8A 2IHMA 1K1QA 5KT3A 2WTFA 3M6KA 2ASDA 2KZZA 1L7PA 1FEZA 1UT5A 1VLBA 4UB6U 4J9OA 4GFJA 5BOLA 5J2HA 4CF5A 3CP8A 2K60A 2KHVA 2D6FC 3ZI4A 4I2AA 2G07A 3PMNA 4J9LA 4M6WB 2AU0A 5EWGA 3GU3A 3E0FA 2ATLA 4RQ0A 1N62A 1JI7A 2YX8A 3L4PA 5AKKA 4DSEA 1XSPA 3TFSA 2H3ZA 2KNJA 2OH2A 4BGDA 7ICVA 5EOZA 3PSPA 2L5YA 5KFVA 2KZ3A 2RRDA 3GV5B 5J2FA 2W8LA 3GDXA 4NLNA 1OW5A 2DFLA 4UB5A 3FYHA 4QW8A 3ZDAA 4Y2QA 4J9SA 1WWVA 5D46A 3UMBA 4X5VA 1Q3VA 2ZIUA 8ICZA 2W3SA 3THVA 2HVHA 4K4IA 5ALJA 5T14A 2M9NA 9ICJA 1WCLA 4P2HA 4KTQA 1BPDA 3K1RB 4JB3A 5KFPA 1UA0A 4I27A 3QEAZ 3GV8B 1FFVA 3G6YA 4NLZA 4Y2JA 1XO1A 1S10A 3JPPA 4F2SA 1DGSA 2I5HA 2XC9A 1LV5A 5DQIA 4M9HA 5KG6A 1HIWA 4RQ3A 1TV9A 4B9VA 4O3RA 5ALFA 3LWMA 3BDPA 4B9TA 1L3SA 2MRLA 8ICXA 4ED7A 5AKZA 3FC4A 5DLFA 3C2MA 1MC8A 2W9AA 3TAQA 2YB4A 1QTMA 9ICLA 1SIJA 3RB6A 2EAMA 2LMRA 4FFDA 5IIOA 2PMZC 1MQ2A 1YZ6A 1D8BA 2NRWA 5G5HA 2JH7A 5ALMA 1XSNA 5KG5A 5J0SA 5KFXA 4QZ9A 1ZQTA 5J2IA 4F8RA 5ALGA 2LM1A 4ED8A 2ZUCA 5DBAA 7ICOA 4P0PB 3RB3A 3GQCA 2N1RA 5KFZA 3QEBZ 3I1YA 4F5OA 1T7PA 4J9KA 4CCHA 4Z6EA 5DB9A 4U7CA 4GC6A 9ICRA 3V7JA 4C4TA 3C28A 9ICPA 3UMCA 1L7OA 2XY7A 3RAQA 1KFDA 4CDGA 2NRXA 3GZFA 4F4KA 4ECXA 5DGAA 2BDUA 5DDYA 3BZKA 4AP9A 4BXOA 4U6PA 3QU2A 3EPIA 3H8JA 1NJZA 1GO3F 1ZD4A 3GIJA 2R8KA 4TUSA 2ODGA 2W8KA 1HJPA 3RB4A 1ED1A 2DKXA 2QKQA 3WK8A 1XU4A 2MAXA 2J6TA 3RRGA 4NM1A 5AM3A 3GILA 3WK9A 3F53A 3B0YA 5AK6A 4I2HA 1ZQEA 4UQGA 2DPIA 5JU5A 4ZH4A 3RH6A 3B9JA 4KX5A 4IS7A 2JEFA 4E0DA 2HHVA 2P66A 1N48A 3H8SA 4TUQA 2WHEA 1BPBA 5KT7A 3ZDEA 3TARA 2K4EA 1X9XA 5AK5A 2QARB 5C0YA 1J2NA 1KSPA 1ZQUA 2W04A 2KSOB 4DL3A 1X9MA 4RNOA 2H5XA 4DS5A 5AK3A 4B9UA 4Y2YA 5KFMA 3BQ2A 4PZOA 3RB0A 4DSLA 1TK0A 1CUKA 2EAOA 3ZD9A 1RZTA 1RYUA 2HHQA 3PNCA 4NWIA 5EE1A 5AKYA 5C5JA 1ZQOA 4TUPA 2FPKA 3PW2A 3CW2C 4J9PA 3G6XA 5L1IA 2WF5A 3N7RC 5B5EU 3SEIA 3BQ0A 3HKZC 4Q8FA 1QH9A 5DLGA 1L8LA 1L3TA 3S6JA 2E5SA 4PJ0U 4KX3A 4UAWA 2A3VA 3ZDDA 3RH5A 5AI8A 2BZFA 5JUMA 3MFHA 4QNLA 3PY8A 3HPOA 5J2AA 5L1LA 4O3PA 1HUOA 2W54A 1ZQIA 1S76D 3F5AA 1ZXIA 1KBUA 3PV8A 3GIMA 1JIHA 5DDMA 2ZTEA 3K1ZA 1XSLA 1YT3A 1NK8A 4HYKA 4OJPA 2DBYA 3AU6A 2FI1A 1N60A 5KFLA 1T94A 1A0PA 2JXJA 4OO1J 5ALUA 5KAFU 2ZTCA 1SGGA 1XNSA 2W11A 2FDRA 2HBMA 3AEVA 2JZBB 3WKAA 3KHLA 3L3FX 2FMSA 3M8RA 2XVTA 3GIKA 3WKBA 2Y9TA 3HJEA 1K5OA 3SQIA 8ICQA 1UCVA 4BWJA 2FLPA 1AROP 5KFTA 3LWLA 8ICUA 3ONNA 4OJOA 5KL8B 1SKRA 4ELTA 3H40A 3F2BA 4QWDA 5J0OA 4KLOA 2A19A 8ICJA 2LPEA 2ZIVA 2G5HB 1BNPA 2IHNA 1SB3C 2P6UA 2XO7A 1SV0C 5ALXA 2PFQA 3UXPA 2YMPA 4DQRA
chains in the Genus database with same CATH topology
4AYBC 4OJ5A 4CGZA 1L6NA 2H3IA 2G5IB 3MGVA 2KJ9A 3C29A 1XO0A 3N7RC 2G08A 2Y0SF 4P0PB 2W7OA 2WAQC 4CRXA 2N1RA 3HKZC 3OPXA 4NV0A 1ECWA 3D2QA 1P7DA 1UPHA 1Q3VA 2NV3A 1DRGA 2KVCA 1PVRA 2ZIUA 2WB1C 2KICA 2E5SA 3D2NA 2H3VA 4U7CA 4KX3A 3C28A 2A3VA 4FE3A 2JMGA 2ZXHA 1SZHA 4QJFB 1A6SA 4FZLA 4CDGA 5T14A 3PSIA 2YB1A 2Z7JA 3GZFA 3H0RB 3NUQA 3HKZF 2OYYA 4NLBA 4QNLA 1Q3UA 1IIPA 3RFAA 2KJ8A 1OUQA 3D2SA 3H0LB 2BDUA 2PMZF 2WB1F 3ICXA 2KOBA 3AQFA 4A8EA 2HOQA 2JHDA 3VC8A 2HBLA 4NLCA 2LYAA 4O3MA 4KMOB 2E1EA 2ZXIA 4U6PA 3F5AA 1KBUA 3PZPA 4QIWC 1GO3F 3N7SC 2K89A 2ZIVB 3CYMA 1YT3A 3K1ZA 1Z19A 1MA7A 2F2AB 1TAMA 3AL0B 2KKPA 2ZIWA 2RP5A 4OJPA 3F2DA 4WJ3B 2GOLA 2G0AA 3NRWA 1WUDA 1ED1A 2ZIXA 2XI9A 4JMUA 1F44A 1T94A 4OJLA 2WAQF 3LVWA 1A0PA 3ALRA 2K8BB 4QIWF 2VKQA 2HBJA 1ZQ1C 2KHQA 5KL1B 4OO1J 1HIWA 3F53A 4IC9A 2KJ5A 2KV2A 2KEYA 4ICAA 4OJ6A 2W7PA 2KKVA 3PSTA 2K4HA 3M6KA 3PSFA 2JH1A 3IG5A 2GH1A 1XNSA 2MA1A 2G09A 2F77X 2ZIUB 1NZBA 2HBMA 2VIXA 2ZIWB 4P0PA 2Q4TA 3IP4B 2MRLA 5CRXA 4KX5A 4C0ZA 4PL1A 2HOIA 4GFJA 2OM6A 2ZIXB 2LBOA 3L3FX 4FZNA 4P0QA 3LVVA 2XVTA 4AYBF 3M6ZA 1PVPA 2VJ5A 3VCBA 2ZG6A 2LYBA 2H3FA 3AQEA 3SQIA 3N7PD 2K4EA 3CP8A 2DGZA 2RHFA 5C0YA 2HBKA 2CRXA 2KHVA 3RF9A 2D6FC 2YB4A 2G06A 2KD1A 2F8LA 2G07A 3ONNA 2W04A 3KZXA 4OJOA 3SMVA 2K8CB 5KL8B 1HEKA 2VJ4A 4ACOA 1CRXA 3F2BA 2W03A 3F5EA 3SAFA 2LKYA 3CRXA 2KIWA 2R18A 3SAHA 3SAGA 3GU3A 2OXOA 2LHTA 2DQNB 3DEEA 3E0FA 2JGAA 4P0QB 3IN5A 4BX9C 2K4IA 5HR6A 5HR7A 2CN1A 2PMZC 2F76X 2XIDA 3H0MB 2YX8A 3IG8A 1D8BA 5A0LA 1Z1BA 3T79A 2HOFA 2JH7A 2ZIVA 2G5HB 2DF4B 2H3QA 3LYSA 1PVQA 3KFUF 2Y0SC 2H3ZA 2M0NA 3M7DA 2KNJA 3F2CA 4PL2A 2OH2A 4NWIA 2CPRA 3PSPA 4BUGA 2E1FA 2K8AA 2XICA 4FZMA 4BJQA 3O0FA 2HMXA 2RRDA 1URJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEY A;  1CRX A;  4ACO A;  3MGV A;  2KKV A;  2KOB A;  2KJ9 A;  3C29 A;  1XO0 A;  3CRX A;  2KIW A;  4CRX A;  1XNS A;  2OXO A;  1KBU A;  1NZB A;  1P7D A;  5CRX A;  1Q3V A;  1DRG A;  1PVR A;  1MA7 A;  2HOI A;  1Z19 A;  1Z1B A;  2KKP A;  2HOF A;  3LYS A;  3C28 A;  1PVQ A;  1PVP A;  3NRW A;  2A3V A;  1F44 A;  2CRX A;  1A0P A;  1Q3U A;  2KHV A;  1OUQ A;  2KJ8 A;  2KD1 A;  2KHQ A;  4A8E A;  2KJ5 A; 
#chains in the Genus database with same CATH topology
 1L6N A;  4EX7 A;  2WAQ C;  3C21 A;  5KFR A;  4US9 A;  2MUT B;  2ZJ8 A;  2ZXH A;  2NRT A;  5ALN A;  3OGU A;  4C8N A;  2ASJ A;  3KTQ A;  3MR2 A;  5KFI A;  1ZQG A;  4R8U A;  1D9D A;  2VA2 A;  4Z6F A;  4B9M A;  5AKL A;  3RJK A;  2JEI A;  5AKE A;  1B0X A;  5AHX A;  4YFK A;  4M9G A;  5KFJ A;  4Z6C A;  1SL0 A;  8ICM A;  1O03 A;  1S0N A;  3CYM A;  3TAP A;  1TAM A;  5KG2 A;  4F4Z A;  3T5J A;  1ZQL A;  2OHF A;  4Q8E A;  5G5G A;  1Z4N A;  5KG1 A;  3LVW A;  1QSL A;  2VKQ A;  3SYZ A;  1ZQR A;  4J9R A;  4I2I A;  2KJ5 A;  2F44 A;  4F5R A;  3PST A;  2ESE A;  1B22 A;  5TIS U;  3ZDC A;  4F91 B;  2HOI A;  1VJ5 A;  4RT3 A;  3H8W A;  3A0H U;  1L5U A;  4F93 B;  5AM0 A;  4M04 A;  1NKB A;  1WG8 A;  1X66 A;  7ICN A;  3KZX A;  4F5Q A;  2K8C B;  8ICA A;  4G9B A;  3BJY A;  4NLG A;  3DV9 A;  2FLN A;  2Q0Z X;  4RPX A;  1X6J A;  4BX9 C;  1Z1V A;  5CA7 A;  1JXL A;  1S0M A;  2DF4 B;  4F71 A;  3KFU F;  4RQ1 A;  8ICK A;  4I2B A;  4LVS A;  4XUS A;  9ICI A;  3WK6 A;  3TI0 A;  4RUC A;  2W3R A;  5KFU A;  5ALT A;  1RXV A;  2PI5 A;  3NTU A;  1NKE A;  4QZI A;  3PW7 A;  3NVW A;  3BS5 A;  4KLT A;  1NNL A;  5GTI U;  3SV4 A;  1COK A;  3HKZ F;  4Y2P A;  3BS7 A;  9ICU A;  4NXZ A;  3RFA A;  4KIT B;  4RZR A;  4RNN A;  3C23 A;  2KOB A;  3KHG A;  2KN7 A;  3M9N B;  1QCK A;  2C2E A;  3C1Z A;  4UAY A;  2JEG A;  3SEN A;  1UQV A;  1MA7 A;  4Y2V A;  3UMG A;  3HX0 A;  2DL0 A;  1QQ7 A;  4DEZ A;  4OJL A;  4PH5 A;  4QZE A;  5J8Y A;  4J03 A;  1S0O A;  2KE7 A;  3IM1 A;  1JN3 A;  2W55 A;  1OXJ A;  3MR6 A;  5KFE A;  3IP4 B;  4KLQ A;  1NKC A;  5DBB A;  5KFO A;  3AU2 A;  3LVV A;  2R8H A;  4AYB F;  2NRZ A;  2LYB A;  3GV7 B;  3SD7 A;  3ORY A;  3PR4 A;  2DWQ A;  7ICG A;  4KLJ A;  4DOB A;  2F1H A;  3KD3 A;  3Q8L A;  8ICG A;  2E8O A;  5KAI U;  1N56 A;  2A1J B;  4DSF A;  4J9M A;  4DQI A;  4CF3 A;  1WYG A;  4YR3 A;  1LB2 B;  1NK0 A;  5JTI A;  3IG8 A;  5ALV A;  4ED2 A;  1S77 D;  2H3Q A;  4QWB A;  2AGO A;  1B4F A;  4EEY A;  4C7Z A;  1L7N A;  2EDU A;  2XIC A;  1X2I A;  3UXN A;  4YN4 A;  4OJ5 A;  2AGP A;  4DL5 A;  4BDP A;  2OCE A;  4DFJ A;  9ICH A;  1DOQ A;  1L8O A;  4DL6 A;  3OSP A;  3RJE A;  1CI4 A;  1SL1 A;  1NOM A;  4Y2T A;  3HWT A;  1TFR A;  4Y2X A;  5D4B A;  2W9B A;  2QB1 A;  1SZH A;  4JUZ A;  2YB1 A;  5DQH A;  3WK7 A;  1BNO A;  5HML A;  3WKC A;  3RTV A;  1O08 A;  4A8E A;  5KFS A;  5AI6 A;  5AKI A;  1A76 A;  5AM2 A;  2BCQ A;  2ES6 A;  4C80 A;  1LVH A;  3Q8Q B;  1BPE A;  4K4H A;  5ALS A;  2RP5 A;  3AN1 A;  4UBB A;  2ZIX A;  4GXK A;  2E8N A;  1X9W A;  4O9M A;  2QB0 A;  2W9C A;  1N2X A;  3V7K A;  3OSN A;  8ICW A;  4BXO B;  7ICI A;  1KKX A;  5EE3 A;  2EAN A;  3JPR A;  5KFC A;  1TVA A;  4DFM A;  9ICQ A;  3JPT A;  1X9S A;  2MA1 A;  4ECW A;  2HHS A;  5CRX A;  5ALD A;  2D3D A;  4F4Y A;  1LKY A;  5EE0 A;  2ZG6 A;  2H3F A;  2RHF A;  2MU2 A;  3PVX A;  2G06 A;  3OHB A;  1SWV A;  2BQ3 A;  2W03 A;  4ECR A;  3U26 A;  5HNK A;  3RRH A;  4KLS A;  4MEY A;  3WKE A;  2OEH A;  7ICU A;  4MFF A;  2HOF A;  1PK1 A;  1NK7 A;  5DGB A;  5DB8 A;  5BOM A;  3F2C A;  2E1F A;  4NJ8 A;  4K4G A;  4PHA A;  4CGZ A;  5J0Y A;  3E58 A;  1KFS A;  2KJ9 A;  4CRX A;  4DLG A;  3HT3 A;  2KG5 A;  2PFN A;  1ECW A;  1TAU A;  9ICX A;  4F3O A;  5EE9 A;  4DFK A;  9ICT A;  2B6G A;  4F50 A;  5HHH A;  4DOC A;  3UPQ A;  1NZP A;  4JV0 A;  4Y2R A;  3T5L A;  2HOQ A;  4ED0 A;  2BR0 A;  2LYA A;  3UQ2 A;  4M6W A;  2YTU A;  1IV8 A;  3CNH A;  5DG7 A;  1J97 A;  4QZH A;  7ICP A;  1KN5 A;  3AL0 B;  1JX4 A;  4ED3 A;  4I29 A;  2BCR A;  1KTQ A;  3RJJ A;  7ICS A;  4PHP A;  4P4O A;  5F9N A;  2KEY A;  1F0M A;  5KT6 A;  3ED5 A;  5J0U A;  1D9F A;  3PSF A;  8ICR A;  4DQS A;  4IQU A;  4YG2 A;  4YR2 A;  4JWN A;  4CF4 A;  4M2Y A;  5CR0 A;  3HW8 A;  5IIL A;  3WKD A;  3VCB A;  4YD1 A;  5AIC A;  5J2J A;  3RF9 A;  3NVV A;  2EZX A;  1XS9 D;  3TAD A;  3SAH A;  3MR3 A;  4OCZ A;  2YMM A;  4ECQ A;  5ALP A;  1Z1B A;  2VA3 A;  8ICE A;  5KG4 A;  3LYS A;  2Y0S C;  3UXO A;  4PL2 A;  9ICA A;  4KMU A;  2UVV A;  2HCF A;  3DDH A;  4RNM A;  3O0F A;  3HRD D;  3MGV A;  3JPO A;  2G08 A;  2W7O A;  2V4Q A;  3BZC A;  5KFA A;  1VDV A;  4MEX A;  4KLD A;  2KIC A;  8ICY A;  1NK5 A;  5IIJ A;  4MHV A;  3NS1 A;  4I2D A;  3PX4 A;  2QLT A;  3BQ7 A;  3D2S A;  2R8G A;  3E2E A;  4O3O A;  2W43 A;  4KN4 A;  3ZDB A;  5ALY A;  4DFP A;  2HBL A;  1QQ5 A;  2ZXI A;  4US8 A;  4QWA A;  3AM9 A;  1TK5 A;  1ZQD A;  3RR8 A;  2IOF A;  5AK4 A;  5DBC A;  4PGX A;  3SZ2 A;  4GXJ A;  1RXW A;  5KFK A;  1KDH A;  5III A;  4EX6 A;  5BPC A;  2KFN A;  4R8U B;  1Z00 A;  1BPY A;  2BCV A;  2JEJ A;  5HMM A;  5KL1 B;  3RBD A;  1DGJ A;  2EZZ A;  4F5P A;  1ZQQ A;  1V97 A;  2ASL A;  2C22 A;  1N63 A;  2BQR A;  2GH1 A;  3ZD8 A;  4P0P A;  1V38 A;  1NZB A;  4LZG A;  4KLL A;  3NGD A;  4Y2U A;  2OM6 A;  1KW4 A;  4DQP A;  1QSS A;  4EBD A;  4FS1 A;  3MDA A;  4B9S A;  1IG6 A;  5ALQ A;  2CRX A;  3RJH A;  4EEL A;  1RYR A;  1UHU A;  4ED6 A;  4O3N A;  4TUR A;  1CRX A;  9ICK A;  2NO4 A;  5DQG A;  3Q8R B;  1L3U A;  2LHT A;  2DQN B;  3UM9 A;  4EEK A;  2XY6 A;  1RYS A;  2XID A;  1AQ6 A;  9ICV A;  3IDW A;  4JV1 A;  2KIV A;  5J0R A;  5AKG A;  2OWO A;  4BUG A;  2K8A A;  4FZM A;  5AKX A;  1ZQH A;  2P35 A;  2YQE A;  2VIX A;  3RBE A;  3T5K A;  5FP0 A;  1T4G A;  1XWL A;  4M47 A;  2HHX A;  3KHH A;  4EYH B;  2EH9 A;  1MN8 A;  3NVY A;  3TFR A;  2C2D A;  1Q8K A;  2WF9 A;  5AKH A;  2JMG A;  4UB8 U;  3I76 A;  4EBE A;  4GC7 A;  4DL4 A;  4R64 A;  4B9L A;  1BPX A;  2XCA A;  2XCP A;  3N97 B;  2PMZ F;  2RLT A;  4NLC A;  4YMM A;  4ECY A;  2KSO A;  3NVZ A;  5B66 U;  8ICP A;  1ZD5 A;  2K89 A;  3BS5 B;  2KFZ A;  4F92 B;  4JMU A;  3MGH A;  4DF8 A;  2A1A A;  1SXD A;  4DOA A;  2HVI A;  1ZQ1 C;  5J0X A;  4MFA A;  2R8J A;  4O0I A;  2PI4 A;  4B9N A;  2PXI A;  2KZM A;  2JH1 A;  3IG5 A;  4YXM A;  5DKW A;  4R63 A;  4C0Z A;  4O5K A;  2LBO A;  4P0Q A;  2JR5 A;  4XA5 A;  5J2C A;  2AJQ A;  3KZI U;  4M9J A;  5AI5 A;  8ICT A;  5L1K A;  3V72 A;  3M1Y A;  5ALH A;  3QUT A;  3T5H A;  1PZN A;  2VJ4 A;  2V4R A;  4ACO A;  3M9O B;  3PO5 A;  2BPC A;  3F5E A;  2FMP A;  1HUZ A;  3SAG A;  4RPZ A;  4NL9 C;  4RUA A;  5K4L A;  2E8M A;  1B43 A;  3B0X A;  4RQ4 A;  3FAH A;  1COO A;  2FPM A;  3C5F A;  2NO5 A;  2HI0 A;  3QZ8 A;  4DSK A;  1KL9 A;  4DF4 A;  4EEN A;  4UAZ A;  1N61 A;  4PHE A;  2Y0S F;  4NV0 A;  1P7D A;  5KFW A;  3N4M B;  1PVR A;  3H4D A;  1S97 A;  1DXS A;  3OTQ A;  4QZB A;  3M8S A;  4RQ5 A;  1FIQ A;  1NJX A;  4JV2 A;  1L3V A;  3EUB 2;  3PX0 A;  1IIP A;  3JPQ A;  3C2K A;  3FDS A;  1SV0 A;  5CJ7 A;  4EZ6 A;  1ZQY A;  1ZQX A;  4R65 A;  3ICX A;  2IBK A;  4DQQ A;  2WF8 A;  3KKA A;  5KT4 A;  4Q44 A;  1ZQM A;  4IRD A;  4F4X A;  2P6R A;  4UB2 A;  2DKZ A;  2ZJA A;  4QIW C;  4B6J A;  5EWE A;  8ICB A;  5AI4 A;  5L1M A;  3KHR A;  4UB4 A;  4DL2 A;  7ICQ A;  3BQT A;  4UAU A;  4WJ3 B;  2G0A A;  5DG9 A;  3QNM A;  2B21 A;  2GO7 A;  4LJX A;  1C20 A;  1ZQA A;  1UT8 A;  2BPG A;  2KKV A;  1IM4 A;  4M0A A;  1ZD2 P;  2ZIU B;  2ZTD A;  1ZQP A;  2AGQ A;  7ICM A;  4QZA A;  2ZIX B;  3SI8 A;  3QX7 A;  3I28 A;  1RG6 A;  4JWM A;  1NK4 A;  5AI9 A;  2QB0 B;  2MUT A;  8ICH A;  8ICV A;  3RR7 A;  3N7P D;  2HDO A;  4NLK A;  1Q46 A;  3SMV A;  1RPL A;  4Q45 A;  3PW4 A;  2BDP A;  3EZ5 A;  2KP7 A;  4FBT A;  2DUY A;  4P4P A;  1FO4 A;  1LKY B;  2XY5 A;  2HSZ A;  3AMZ A;  5ALZ A;  1Z4O A;  4EYI B;  5CP2 A;  4PGQ A;  3Q8M A;  4DL7 A;  4PGY A;  5CB1 A;  5KT2 A;  4QZG A;  3QUQ A;  4IQT A;  2IOF K;  2UVW A;  4DSI A;  3Q8K A;  4UBC A;  1XO0 A;  4KLE A;  2NYV A;  1U48 A;  1SWW A;  1NK9 A;  3TKA A;  5KFY A;  1UPH A;  2NV3 A;  5F9L A;  4F72 A;  3MAB A;  5E79 U;  2BCU A;  1JUD A;  4NLB A;  3NUQ A;  3H0R B;  2C28 A;  2HHU A;  3WK5 A;  4GXI A;  5AIA A;  1T8E A;  2XGP A;  4C8K A;  2KMD A;  2BKE A;  3VC8 A;  3TAC B;  2R8I A;  2E1E A;  4ELV A;  3ISC A;  4GLX A;  3V6K A;  4DS4 A;  4UAR A;  2ZIW A;  4O3Q A;  4DO9 A;  1H38 A;  2IOH A;  2WAQ F;  4RPY A;  2V9W A;  5AIB A;  4IQV A;  4PPX A;  5F3X B;  2KV2 A;  2ZUD A;  1ZQC A;  1TAQ A;  4FO6 A;  2FPL A;  1MQ3 A;  2F1I A;  2Q4T A;  4DLE A;  2WFA A;  4RQ7 A;  2UVR A;  4FZN A;  4IRC A;  2VA8 A;  9ICN A;  4HAI A;  1F5S A;  1ZQW A;  2GLE A;  2LYH A;  4I2E A;  4DSJ A;  2KVS A;  3KBB A;  2F8L A;  1ZQK A;  4ED1 A;  5ALK A;  3V6J A;  2EZY A;  2LKY A;  4TQR A;  1ZD3 A;  3T3F A;  4KN7 A;  3MDC A;  1WWU A;  3WU2 U;  5HR7 A;  3ETL A;  2F3N A;  3IRU A;  1S5L U;  3PX6 A;  4I2G A;  4MFC A;  3ISB A;  2HMX A;  4NM2 A;  4YD2 A;  4Y2S A;  3C29 A;  1KEJ A;  3OPX A;  4F5N A;  1ZRN A;  3LK9 A;  5L9X A;  1QLN A;  2CXY A;  1ZJM A;  1T3N A;  1Z3E B;  1ZRM A;  4KLM A;  2E3T A;  3D2N A;  2PKE A;  5ALO A;  5DG8 A;  1T3Q A;  4FE3 A;  2YML A;  1SL2 A;  2E8P A;  4C8M A;  8ICF A;  2OYY A;  3C1Y A;  1KQQ A;  1OUQ A;  1YZ7 A;  3H0L B;  3TAD C;  1U4B A;  5ALE A;  1S8O A;  2JHD A;  2DPJ A;  7ICL A;  5H2F U;  3BQ1 A;  2A1J A;  3TQ1 A;  3A0B U;  1FFU A;  5KFB A;  3QYP A;  5KTQ A;  4RQ2 A;  3RJF A;  1JRO A;  4F2R A;  1M6Y A;  3NRW A;  1WUD A;  1F44 A;  5KT5 A;  4C8L A;  2W9M A;  3K4G A;  1TE2 A;  4RT2 A;  2K8B B;  4QIW F;  8ICO A;  2HBJ A;  3MGI A;  2KHQ A;  4IC9 A;  4I28 A;  3C5G A;  9ICM A;  7ICH A;  1NK6 A;  5CHG A;  3UQ0 A;  3QU7 A;  2IA6 A;  3ETR A;  5J0W A;  4PL1 A;  1ZJN A;  5AM4 A;  5L1J A;  4FS2 A;  2BGW A;  1ZQV A;  1Z00 B;  1PVP A;  3NRZ A;  1SZP A;  3AQE A;  2I9G A;  1SKS A;  2HBK A;  3PW5 A;  2RDJ A;  2LI6 A;  4F4W A;  2HHW A;  4KLU A;  4BWM A;  4Z6D A;  4YR0 A;  4R66 A;  4UW9 A;  3DEE A;  3JPN A;  3IN5 A;  4YVZ A;  4O5C A;  3D6J A;  4G3I A;  5A0L A;  1PK3 A;  3QU4 A;  3MFI A;  4DFD A;  1X6I A;  4CNQ A;  2YN4 A;  4UAT A;  2Y9U A;  1NJW A;  2Y1J A;  1UA1 A;  2YMQ A;  5AI0 A;  4ZOH C;  3AUO A;  4I2C A;  1RDF A;  5KFH A;  4O5E A;  1X40 A;  1DRG A;  2WB1 C;  5J0T A;  2KK0 A;  2PFP A;  3FM9 A;  1RQN A;  1KRP A;  1Q3U A;  4XQ8 A;  2KJ8 A;  8ICI A;  3AQF A;  2D8C A;  1SKW A;  5CWR A;  4Q43 A;  4UAV A;  7ICJ A;  3RAX A;  2ALZ A;  4GIB A;  3QE9 Y;  2ZIV B;  3QUB A;  4C4S A;  1ZQJ A;  2GOL A;  2FJ6 A;  3M9M B;  1DK3 A;  2K4P A;  3H8M A;  5IIM A;  1JXE A;  2HHT A;  2ISP A;  2NRV A;  2W7P A;  1C7Y A;  7ICT A;  4QZ8 A;  1TKD A;  2AXT U;  1KLN A;  8ICS A;  5KFD A;  3PW0 A;  3PO4 A;  4IR9 A;  4KLI A;  2LM4 A;  2J6S A;  3M6Z A;  2GWS A;  2VJ5 A;  2BHN A;  2PFO A;  3L5K A;  1NI3 A;  2FLL A;  2KD1 A;  3QU9 A;  1QQ6 A;  1L7M A;  3IHQ B;  3SAF A;  4PHD A;  2KIW A;  2Y1I A;  2R18 A;  2OXO A;  2JGA A;  4P0Q B;  2K4I A;  5HR6 A;  4JK1 A;  1ZYQ A;  2F76 X;  5DB7 A;  3KOO A;  4IQW A;  3T79 A;  2UVU A;  2VAN A;  1PVQ A;  1ZQS A;  3ISD A;  5D49 A;  4QWE A;  5AKJ A;  5KG3 A;  3NAS A;  2J6U A;  1URJ A;  4J9N A;  2G5I B;  2AQ4 A;  4CE6 A;  4YMN A;  5KFN A;  4C8O A;  1S0V A;  2MSN A;  3RJG A;  4QJF B;  1CEZ A;  1A6S A;  1NJY A;  1A77 A;  5AM5 A;  2EQY A;  1N5W A;  2FE9 A;  4M9N A;  4QZD A;  4AYB C;  1ZQZ A;  2AHO B;  2ZUB A;  1QSY A;  1V85 A;  3C2L A;  4KLH A;  3PZP A;  4IL6 U;  3EYZ A;  3OJS A;  2RQ5 A;  2KKP A;  2IMW P;  4DWI A;  1JAL A;  1U47 A;  3WK4 A;  2QAR A;  4OJ6 A;  2XGQ A;  1U9L A;  8ICC A;  3K75 D;  3MC1 A;  1N5X A;  2I1Q A;  2BCS A;  5J2B A;  1MSW D;  2G09 A;  2F77 X;  4QZC A;  5KFQ A;  5EWF A;  3Q8P B;  4P4M A;  2F8K A;  1S9F A;  4I2F A;  4UB1 A;  3KKA C;  4IRK A;  4EBC A;  3J81 j;  3GII A;  2JRZ A;  3GFK B;  4I2J A;  4NY8 A;  3CRX A;  1BVS A;  2JV3 A;  3V7L A;  1TK8 A;  2BPF A;  7ICF A;  3EW9 A;  4ECV A;  5HHI A;  9ICS A;  2O6K A;  4QW9 A;  7ICR A;  4YQW A;  3QXG A;  4ECZ A;  3TAN A;  4YMO A;  2CPR A;  4DCC A;  3JPS A;  4RQM A;  9ICE A;  3EPG A;  4FBU A;  2F1J A;  3SR6 A;  1XC9 A;  7ICE A;  4QWC A;  3D2Q A;  1SV4 A;  2KVC A;  5IIN A;  2H3V A;  3SV3 A;  5J29 A;  5HP4 A;  1KFT A;  1X42 A;  4FZL A;  3PSI A;  3MR5 A;  5J8Y C;  9ICB A;  4MF2 A;  2WB1 F;  3QZ7 A;  4YCX A;  3EWA A;  5ALR A;  4UB3 A;  4O3M A;  4KMO B;  4O3S A;  4RQ6 A;  1ZQF A;  5CEH A;  4PZN A;  3G6V A;  2HW3 A;  4YXJ A;  4YP3 A;  3OHA A;  2JZB A;  3F2D A;  3QUC A;  3HIL A;  2XI9 A;  5IIK A;  1Y88 A;  8ICN A;  2FMQ A;  1BGX T;  5KG0 A;  4LZD A;  3ALR A;  4M9L A;  2I6X A;  1ZQB A;  5JRT A;  4QZF A;  4ICA A;  4RQN A;  4J9Q A;  2K4H A;  3H7I A;  1RM6 C;  1V9P A;  5KNI A;  4ELU A;  8ICL A;  2ZIW B;  3V6H A;  4MF8 A;  2W9B B;  4USA A;  4OD0 A;  9ICW A;  2DGZ A;  4RU9 A;  7ICK A;  5KFG A;  9ICF A;  1JMS A;  1PUZ A;  3RJI A;  1HEK A;  2AQ0 A;  3IV6 A;  1U45 A;  9ICC A;  4EZ9 A;  2C2R A;  3LDA A;  3R9K A;  5DB6 A;  1SXE A;  2CN1 A;  3H0M B;  2WF7 A;  3OJU A;  3PR5 B;  3MBY A;  4ECT A;  2BQU A;  1EXN A;  3M7D A;  2M0N A;  5KFF A;  1J2M A;  5J0P A;  2W9C B;  1RQL A;  4BJQ A;  4KLF A;  5KG7 A;  1K1S A;  2ZJ5 A;  2H3I A;  3PML A;  1WCN A;  3N28 A;  3HP6 A;  2AH5 A;  4NL9 A;  2WF6 A;  5J2E A;  1BPZ A;  2RDI A;  4UAS A;  9ICG A;  5J2D A;  2EAP A;  3QU5 A;  5ALI A;  2ISO A;  5J2K A;  2Z7J A;  5TZV A;  5ALL A;  4C4R A;  1D8L A;  3H4B A;  2YY6 A;  4TQS A;  4ECS A;  1ZQN A;  1ZOL A;  5GTH U;  1ZET A;  3RH4 A;  1DK2 A;  1IXR A;  4XRH A;  3N7S C;  1PK1 B;  1U49 A;  5J2G A;  1Z19 A;  5AM1 A;  2F2A B;  4KLG A;  4IR1 A;  2B0C A;  5J0Q A;  4C7Y A;  1JRP A;  4ECU A;  5ALW A;  2KTQ A;  3Q8S B;  1D8Y A;  9ICO A;  4RQ8 A;  2IHM A;  1K1Q A;  5KT3 A;  2WTF A;  3M6K A;  2ASD A;  2KZZ A;  1L7P A;  1FEZ A;  1UT5 A;  1VLB A;  4UB6 U;  4J9O A;  4GFJ A;  5BOL A;  5J2H A;  4CF5 A;  3CP8 A;  2K60 A;  2KHV A;  2D6F C;  3ZI4 A;  4I2A A;  2G07 A;  3PMN A;  4J9L A;  4M6W B;  2AU0 A;  5EWG A;  3GU3 A;  3E0F A;  2ATL A;  4RQ0 A;  1N62 A;  1JI7 A;  2YX8 A;  3L4P A;  5AKK A;  4DSE A;  1XSP A;  3TFS A;  2H3Z A;  2KNJ A;  2OH2 A;  4BGD A;  7ICV A;  5EOZ A;  3PSP A;  2L5Y A;  5KFV A;  2KZ3 A;  2RRD A;  3GV5 B;  5J2F A;  2W8L A;  3GDX A;  4NLN A;  1OW5 A;  2DFL A;  4UB5 A;  3FYH A;  4QW8 A;  3ZDA A;  4Y2Q A;  4J9S A;  1WWV A;  5D46 A;  3UMB A;  4X5V A;  1Q3V A;  2ZIU A;  8ICZ A;  2W3S A;  3THV A;  2HVH A;  4K4I A;  5ALJ A;  5T14 A;  2M9N A;  9ICJ A;  1WCL A;  4P2H A;  4KTQ A;  1BPD A;  3K1R B;  4JB3 A;  5KFP A;  1UA0 A;  4I27 A;  3QEA Z;  3GV8 B;  1FFV A;  3G6Y A;  4NLZ A;  4Y2J A;  1XO1 A;  1S10 A;  3JPP A;  4F2S A;  1DGS A;  2I5H A;  2XC9 A;  1LV5 A;  5DQI A;  4M9H A;  5KG6 A;  1HIW A;  4RQ3 A;  1TV9 A;  4B9V A;  4O3R A;  5ALF A;  3LWM A;  3BDP A;  4B9T A;  1L3S A;  2MRL A;  8ICX A;  4ED7 A;  5AKZ A;  3FC4 A;  5DLF A;  3C2M A;  1MC8 A;  2W9A A;  3TAQ A;  2YB4 A;  1QTM A;  9ICL A;  1SIJ A;  3RB6 A;  2EAM A;  2LMR A;  4FFD A;  5IIO A;  2PMZ C;  1MQ2 A;  1YZ6 A;  1D8B A;  2NRW A;  5G5H A;  2JH7 A;  5ALM A;  1XSN A;  5KG5 A;  5J0S A;  5KFX A;  4QZ9 A;  1ZQT A;  5J2I A;  4F8R A;  5ALG A;  2LM1 A;  4ED8 A;  2ZUC A;  5DBA A;  7ICO A;  4P0P B;  3RB3 A;  3GQC A;  2N1R A;  5KFZ A;  3QEB Z;  3I1Y A;  4F5O A;  1T7P A;  4J9K A;  4CCH A;  4Z6E A;  5DB9 A;  4U7C A;  4GC6 A;  9ICR A;  3V7J A;  4C4T A;  3C28 A;  9ICP A;  3UMC A;  1L7O A;  2XY7 A;  3RAQ A;  1KFD A;  4CDG A;  2NRX A;  3GZF A;  4F4K A;  4ECX A;  5DGA A;  2BDU A;  5DDY A;  3BZK A;  4AP9 A;  4BXO A;  4U6P A;  3QU2 A;  3EPI A;  3H8J A;  1NJZ A;  1GO3 F;  1ZD4 A;  3GIJ A;  2R8K A;  4TUS A;  2ODG A;  2W8K A;  1HJP A;  3RB4 A;  1ED1 A;  2DKX A;  2QKQ A;  3WK8 A;  1XU4 A;  2MAX A;  2J6T A;  3RRG A;  4NM1 A;  5AM3 A;  3GIL A;  3WK9 A;  3F53 A;  3B0Y A;  5AK6 A;  4I2H A;  1ZQE A;  4UQG A;  2DPI A;  5JU5 A;  4ZH4 A;  3RH6 A;  3B9J A;  4KX5 A;  4IS7 A;  2JEF A;  4E0D A;  2HHV A;  2P66 A;  1N48 A;  3H8S A;  4TUQ A;  2WHE A;  1BPB A;  5KT7 A;  3ZDE A;  3TAR A;  2K4E A;  1X9X A;  5AK5 A;  2QAR B;  5C0Y A;  1J2N A;  1KSP A;  1ZQU A;  2W04 A;  2KSO B;  4DL3 A;  1X9M A;  4RNO A;  2H5X A;  4DS5 A;  5AK3 A;  4B9U A;  4Y2Y A;  5KFM A;  3BQ2 A;  4PZO A;  3RB0 A;  4DSL A;  1TK0 A;  1CUK A;  2EAO A;  3ZD9 A;  1RZT A;  1RYU A;  2HHQ A;  3PNC A;  4NWI A;  5EE1 A;  5AKY A;  5C5J A;  1ZQO A;  4TUP A;  2FPK A;  3PW2 A;  3CW2 C;  4J9P A;  3G6X A;  5L1I A;  2WF5 A;  3N7R C;  5B5E U;  3SEI A;  3BQ0 A;  3HKZ C;  4Q8F A;  1QH9 A;  5DLG A;  1L8L A;  1L3T A;  3S6J A;  2E5S A;  4PJ0 U;  4KX3 A;  4UAW A;  2A3V A;  3ZDD A;  3RH5 A;  5AI8 A;  2BZF A;  5JUM A;  3MFH A;  4QNL A;  3PY8 A;  3HPO A;  5J2A A;  5L1L A;  4O3P A;  1HUO A;  2W54 A;  1ZQI A;  1S76 D;  3F5A A;  1ZXI A;  1KBU A;  3PV8 A;  3GIM A;  1JIH A;  5DDM A;  2ZTE A;  3K1Z A;  1XSL A;  1YT3 A;  1NK8 A;  4HYK A;  4OJP A;  2DBY A;  3AU6 A;  2FI1 A;  1N60 A;  5KFL A;  1T94 A;  1A0P A;  2JXJ A;  4OO1 J;  5ALU A;  5KAF U;  2ZTC A;  1SGG A;  1XNS A;  2W11 A;  2FDR A;  2HBM A;  3AEV A;  2JZB B;  3WKA A;  3KHL A;  3L3F X;  2FMS A;  3M8R A;  2XVT A;  3GIK A;  3WKB A;  2Y9T A;  3HJE A;  1K5O A;  3SQI A;  8ICQ A;  1UCV A;  4BWJ A;  2FLP A;  1ARO P;  5KFT A;  3LWL A;  8ICU A;  3ONN A;  4OJO A;  5KL8 B;  1SKR A;  4ELT A;  3H40 A;  3F2B A;  4QWD A;  5J0O A;  4KLO A;  2A19 A;  8ICJ A;  2LPE A;  2ZIV A;  2G5H B;  1BNP A;  2IHN A;  1SB3 C;  2P6U A;  2XO7 A;  1SV0 C;  5ALX A;  2PFQ A;  3UXP A;  2YMP A;  4DQR A; 
#chains in the Genus database with same CATH homology
 4AYB C;  4OJ5 A;  4CGZ A;  1L6N A;  2H3I A;  2G5I B;  3MGV A;  2KJ9 A;  3C29 A;  1XO0 A;  3N7R C;  2G08 A;  2Y0S F;  4P0P B;  2W7O A;  2WAQ C;  4CRX A;  2N1R A;  3HKZ C;  3OPX A;  4NV0 A;  1ECW A;  3D2Q A;  1P7D A;  1UPH A;  1Q3V A;  2NV3 A;  1DRG A;  2KVC A;  1PVR A;  2ZIU A;  2WB1 C;  2KIC A;  2E5S A;  3D2N A;  2H3V A;  4U7C A;  4KX3 A;  3C28 A;  2A3V A;  4FE3 A;  2JMG A;  2ZXH A;  1SZH A;  4QJF B;  1A6S A;  4FZL A;  4CDG A;  5T14 A;  3PSI A;  2YB1 A;  2Z7J A;  3GZF A;  3H0R B;  3NUQ A;  3HKZ F;  2OYY A;  4NLB A;  4QNL A;  1Q3U A;  1IIP A;  3RFA A;  2KJ8 A;  1OUQ A;  3D2S A;  3H0L B;  2BDU A;  2PMZ F;  2WB1 F;  3ICX A;  2KOB A;  3AQF A;  4A8E A;  2HOQ A;  2JHD A;  3VC8 A;  2HBL A;  4NLC A;  2LYA A;  4O3M A;  4KMO B;  2E1E A;  2ZXI A;  4U6P A;  3F5A A;  1KBU A;  3PZP A;  4QIW C;  1GO3 F;  3N7S C;  2K89 A;  2ZIV B;  3CYM A;  1YT3 A;  3K1Z A;  1Z19 A;  1MA7 A;  2F2A B;  1TAM A;  3AL0 B;  2KKP A;  2ZIW A;  2RP5 A;  4OJP A;  3F2D A;  4WJ3 B;  2GOL A;  2G0A A;  3NRW A;  1WUD A;  1ED1 A;  2ZIX A;  2XI9 A;  4JMU A;  1F44 A;  1T94 A;  4OJL A;  2WAQ F;  3LVW A;  1A0P A;  3ALR A;  2K8B B;  4QIW F;  2VKQ A;  2HBJ A;  1ZQ1 C;  2KHQ A;  5KL1 B;  4OO1 J;  1HIW A;  3F53 A;  4IC9 A;  2KJ5 A;  2KV2 A;  2KEY A;  4ICA A;  4OJ6 A;  2W7P A;  2KKV A;  3PST A;  2K4H A;  3M6K A;  3PSF A;  2JH1 A;  3IG5 A;  2GH1 A;  1XNS A;  2MA1 A;  2G09 A;  2F77 X;  2ZIU B;  1NZB A;  2HBM A;  2VIX A;  2ZIW B;  4P0P A;  2Q4T A;  3IP4 B;  2MRL A;  5CRX A;  4KX5 A;  4C0Z A;  4PL1 A;  2HOI A;  4GFJ A;  2OM6 A;  2ZIX B;  2LBO A;  3L3F X;  4FZN A;  4P0Q A;  3LVV A;  2XVT A;  4AYB F;  3M6Z A;  1PVP A;  2VJ5 A;  3VCB A;  2ZG6 A;  2LYB A;  2H3F A;  3AQE A;  3SQI A;  3N7P D;  2K4E A;  3CP8 A;  2DGZ A;  2RHF A;  5C0Y A;  2HBK A;  2CRX A;  2KHV A;  3RF9 A;  2D6F C;  2YB4 A;  2G06 A;  2KD1 A;  2F8L A;  2G07 A;  3ONN A;  2W04 A;  3KZX A;  4OJO A;  3SMV A;  2K8C B;  5KL8 B;  1HEK A;  2VJ4 A;  4ACO A;  1CRX A;  3F2B A;  2W03 A;  3F5E A;  3SAF A;  2LKY A;  3CRX A;  2KIW A;  2R18 A;  3SAH A;  3SAG A;  3GU3 A;  2OXO A;  2LHT A;  2DQN B;  3DEE A;  3E0F A;  2JGA A;  4P0Q B;  3IN5 A;  4BX9 C;  2K4I A;  5HR6 A;  5HR7 A;  2CN1 A;  2PMZ C;  2F76 X;  2XID A;  3H0M B;  2YX8 A;  3IG8 A;  1D8B A;  5A0L A;  1Z1B A;  3T79 A;  2HOF A;  2JH7 A;  2ZIV A;  2G5H B;  2DF4 B;  2H3Q A;  3LYS A;  1PVQ A;  3KFU F;  2Y0S C;  2H3Z A;  2M0N A;  3M7D A;  2KNJ A;  3F2C A;  4PL2 A;  2OH2 A;  4NWI A;  2CPR A;  3PSP A;  4BUG A;  2E1F A;  2K8A A;  2XIC A;  4FZM A;  4BJQ A;  3O0F A;  2HMX A;  2RRD A;  1URJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...