3D2NA

Crystal structure of mbnl1 tandem zinc finger 1 and 2 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
TKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding, rna binding protein
molecule keywords Muscleblind-like protein 1
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2nA00
2E5SA 3D2SA 3D2QA 3D2NA
chains in the Genus database with same CATH superfamily
3PW2A 2VIXA 2H3ZA 3L4PA 3GQCA 4UAYA 1S0OA 2JEIA 3IP4B 3C5GA 3DDHA 1T3QA 2HHWA 9ICCA 1KFTA 5ALDA 3N28A 4RNMA 3IG8A 4P4MA 5CHGA 5J0OA 3RH4A 1T4GA 4F93B 4O3QA 1J97A 1L3VA 4RUAA 5AI0A 4CF3A 4M0AA 5KFYA 3C23A 4CRXA 1O08A 4EX7A 5L1LA 3V7KA 4Y2QA 2RDJA 1PVRA 4YD2A 2FPLA 4PL1A 3H0LB 2A1AA 4PHEA 2A1JA 3MDAA 9ICMA 1T7PA 1ZQHA 5KG7A 3UM9A 2HW3A 2YMLA 2FI1A 2HHSA 2EH9A 4B9LA 5AK4A 4C80A 5AM5A 3NVVA 4GIBA 1D8YA 1ZQXA 3EYZA 5KG5A 3CNHA 1EXNA 1S5LU 1SV0C 2YN4A 3A0BU 4TURA 2IA6A 2NO5A 2HVIA 2XIDA 2UVUA 3C21A 4O3MA 3Q8QB 4NJ8A 2H3QA 2F8KA 1NKBA 2XGQA 1N60A 3ZDBA 4KLEA 4RZRA 1NKEA 4X5VA 2BR0A 2NYVA 3MGVA 8ICRA 2BCVA 3HW8A 5ALQA 4C0ZA 2WAQF 3M9MB 4JK1A 4YXJA 1S0VA 3SAGA 1TAQA 5J0YA 3ZDEA 3JPQA 3HP6A 1CUKA 2M9NA 2W9CB 3TARA 5ALWA 4UB1A 2EANA 4I2CA 2WB1C 1ZQKA 9ICOA 5KFKA 4CNQA 3GIMA 3IHQB 1ZQTA 1DOQA 2DPJA 1WUDA 3IG5A 7ICKA 3ETRA 4YMOA 3AUOA 2XY7A 1Q8KA 5EWEA 4IQVA 2V4RA 1J2NA 4Q43A 1F0MA 2ZUBA 5KFBA 4GXKA 1RYRA 5GTIU 4DO9A 5ALRA 1Z4NA 4PGQA 2K8AA 4CE6A 4J03A 3LDAA 4ED7A 5ALVA 4PHDA 4GC6A 4M04A 3I28A 4PGYA 4MFAA 4PZOA 4B9TA 3V6JA 4J9PA 1FFVA 2NV3A 3C28A 8ICXA 4RT3A 1RPLA 3LWMA 4I2AA 4G3IA 4M9HA 2KV2A 3B0YA 3BQ1A 3F53A 4RUCA 1T94A 4RQMA 4ECWA 4BGDA 1B0XA 8ICFA 8ICEA 3OSPA 8ICKA 5AI5A 2NRTA 3ZDAA 1JXLA 4P0QB 2HHXA 2F2AB 5EE0A 1FO4A 5CB1A 3HPOA 4KLFA 1SKSA 2W04A 4XRHA 1TKDA 4TUQA 5DBCA 5ALHA 1S10A 3BS7A 2JH7A 4QZAA 2H3FA 5AICA 2P6UA 3K1RB 3PMLA 2PI5A 4RQ2A 2H3IA 4DOAA 4YN4A 2ZIXA 4QWEA 2HHVA 4KTQA 1L7OA 3PMNA 4PZNA 1NZBA 3MC1A 2FJ6A 2P6RA 3CP8A 3EZ5A 4C8OA 5J2JA 5ALOA 2PI4A 1PVPA 1N61A 3QXGA 4IRDA 3CYMA 4J9QA 4KLIA 4RQ7A 3PZPA 1NK7A 4KLUA 5J2IA 3AL0B 5ALYA 2EAMA 5AM3A 3T5LA 2FLLA 4M6WA 4RQ8A 3DV9A 3RAQA 4MHVA 3MR6A 1L7PA 5KFZA 1K1SA 4EZ6A 3MFIA 3JPSA 2ES6A 5J0RA 3QYPA 1YT3A 3AQFA 3QU9A 2DF4B 7ICIA 4F2RA 5K4LA 4DL7A 2G5HB 1UA1A 5B66U 3SENA 4PHAA 4PPXA 3RR8A 1PZNA 4YFKA 4RQ6A 2P35A 5KG3A 5KFOA 5IIIA 2XICA 2IOFK 2P66A 2W9MA 5KT7A 2K8BB 1S77D 8ICOA 3PSFA 2MRLA 1DXSA 4XQ8A 3FDSA 4Q8EA 4ZOHC 3MGHA 2LM1A 1A76A 1HEKA 2W11A 5AM2A 4QZBA 2EAPA 4C4TA 2MUTA 3F2BA 2HMXA 5T14A 5ALTA 1L8OA 2ZUCA 1N5XA 4Q44A 4NLCA 1ZQFA 3BQ7A 3T5JA 3SQIA 1NI3A 4EX6A 3IV6A 4YG2A 2XCPA 3NTUA 7ICQA 2IHMA 4F5RA 2KK0A 3V6HA 4MEXA 2UVWA 5JRTA 4R8UB 1KW4A 5DGBA 5KFHA 2K89A 2DBYA 2DWQA 1ZQYA 1BPBA 4F72A 4USAA 5AM4A 2EZYA 4M47A 1Z00B 3SAFA 2PXIA 2ALZA 9ICRA 1K1QA 4Y2VA 2HOIA 5EE1A 4UB2A 2KHVA 7ICTA 2F44A 3RBEA 3OHBA 9ICHA 1NJXA 5BOMA 4FO6A 1SXEA 3QU4A 4JV1A 2B0CA 1XS9D 2R8KA 8ICBA 3QZ8A 1D9DA 5CR0A 4JV0A 5F3XB 5AKKA 5J0PA 3K1ZA 3PR4A 5L1IA 3JPNA 2ISOA 2KICA 5J8YC 3NGDA 3N7RC 1JRPA 4UB8U 3D2NA 2HI0A 1MQ3A 3MABA 2GWSA 2K4HA 3G6YA 4DFDA 4ED2A 1ZQEA 4FZLA 3H7IA 4R64A 4QWBA 4MF8A 5J2KA 3EWAA 2WF7A 2ESEA 2EZZA 8ICVA 4QW8A 1NJZA 3O0FA 2IOFA 8ICUA 1QSLA 5TZVA 4C4SA 2LYAA 2C2DA 1KFSA 4O3NA 4DCCA 3F5AA 4ECTA 3PW5A 2F76X 4XUSA 5J2FA 1ZD5A 4O3OA 5KFPA 4ELTA 2XY6A 1FEZA 2FLNA 3THVA 2RDIA 4RPZA 2WFAA 2G0AA 2IMWP 2NRZA 4DQPA 7ICPA 1FIQA 5DBAA 2C22A 4J9SA 2G06A 2ZIWA 4ED1A 2E8OA 5AKXA 4WJ3B 2PMZF 5KFGA 3A0HU 1UPHA 3TFSA 1WYGA 5HP4A 4F2SA 1RQLA 1U9LA 1IG6A 2KD1A 4C7ZA 5IIMA 4US9A 3RAXA 8ICQA 1NK0A 3HKZC 4JUZA 9ICVA 5EE9A 3M6ZA 9ICIA 2KJ5A 5DDMA 4DL6A 4QZIA 4EBEA 2JEFA 3PO5A 4B9SA 3PW0A 2JR5A 5HHIA 2DGZA 4JWNA 5ALZA 4F5OA 5EOZA 3KKAC 4RNOA 4ICAA 2KJ8A 7ICVA 2QKQA 9ICWA 5J2EA 4AYBC 1BPEA 4QWDA 1UA0A 2YQEA 2F8LA 4DQQA 3D2QA 2L5YA 1Z3EB 4B9UA 1L7NA 2ZJ5A 2FPMA 1ZQGA 1KRPA 3KFUF 5KFFA 9ICTA 3SMVA 3ICXA 4KX5A 3V7JA 2F1JA 3H8MA 2ATLA 9ICAA 3LYSA 3HT3A 2R8IA 2PFNA 3PSIA 3MBYA 4EYIB 1S0NA 1UCVA 4UB6U 1Q3VA 4ED3A 1PK3A 1ZQLA 2E3TA 1LVHA 3GZFA 3GIIA 3V72A 5E79U 4QWAA 2KG5A 4KMOB 4DL5A 2PFOA 2Q4TA 3MDCA 4ECQA 1RXWA 2VA8A 4I29A 2KVCA 2W9CA 3KKAA 4NL9C 4FZMA 3DEEA 2H3VA 1NJYA 2O6KA 3GDXA 4UAWA 5J2BA 1CI4A 4J9KA 3PW7A 3ZD8A 3F5EA 4JB3A 5EWGA 1MC8A 4FE3A 1KFDA 2ISPA 5KG2A 3M1YA 5G5GA 4MFFA 1ZQBA 5AK6A 3PSPA 1SB3C 1SZHA 5AI9A 4DLEA 1TVAA 2XO7A 1L3TA 1VDVA 4O0IA 3BQTA 1KEJA 5D49A 2Y0SF 3C1YA 1ZQAA 3WKAA 4M2YA 2ZIWB 2BCSA 2NRXA 2PFQA 1X9WA 3PV8A 2OWOA 8ICWA 3IM1A 2DKXA 1WCLA 2LPEA 3SV4A 1NK6A 2HBJA 1SL2A 2KZMA 2G08A 5ALGA 4YVZA 3M8RA 4YR3A 4O3RA 1HUZA 8ICTA 3E2EA 1ZQRA 5CEHA 1GO3F 9ICLA 2PMZC 5KG1A 1V38A 4JV2A 1XU4A 1ZQMA 4PGXA 1AQ6A 2C2EA 4P0QA 3UQ2A 4IL6U 2XVTA 1IV8A 4Z6EA 2Y9UA 3R9KA 3OHAA 3AEVA 8ICIA 5KFAA 1TK0A 3MGIA 2QARA 2A3VA 5IIJA 4TQSA 5KFNA 1UT8A 7ICNA 8ICMA 4DS4A 2JHDA 3AU6A 4CCHA 4AP9A 2BDPA 4NLBA 1BGXT 5ALKA 2K4EA 2LKYA 2NO4A 7ICEA 3VCBA 4PH5A 4ZH4A 3PW4A 4DL3A 3T79A 2MA1A 4KLOA 1RG6A 1ZD4A 2LBOA 2ZTEA 2R18A 3OSNA 2FMPA 3FM9A 7ICHA 1SV0A 1L7MA 4OJ6A 3V6KA 2KEYA 4DF8A 2KFZA 4GXJA 3H4BA 4J9MA 1X2IA 2OHFA 2ZTDA 2W8KA 2W55A 5KFEA 2BPGA 3Q8RB 4ECRA 1F44A 3SD7A 1N62A 3TKAA 3QZ7A 2AGQA 4C4RA 4KLQA 9ICNA 3K4GA 2HCFA 4YMNA 3ZDDA 9ICGA 4DSLA 9ICUA 5AIAA 2ZJ8A 4UAUA 4DQRA 2WHEA 9ICXA 2KVSA 4Z6CA 1BNOA 3Q8MA 5KT6A 4TQRA 1X42A 4DSKA 1MA7A 4BUGA 5KFCA 5HMLA 2VJ5A 3SI8A 4M9NA 4OCZA 2JV3A 3KHGA 3H40A 3UMCA 1Z1BA 1N48A 8ICGA 3RJFA 2ODGA 4F8RA 4DSFA 3EUB2 3M7DA 4Y2SA 1KSPA 3RJHA 4DLGA 4UAVA 4IQTA 2WF9A 3TAPA 4LVSA 2KZ3A 3WKEA 4DSIA 4DS5A 4DFKA 5DQIA 3H4DA 2CN1A 5J0QA 2BKEA 3PR5B 3MR2A 2AQ0A 2LI6A 1WWVA 2LYBA 1SKWA 1TV9A 5KAIU 3SR6A 4I28A 3QX7A 1TAUA 2QARB 2E8PA 5FP0A 8ICSA 4KITB 3RRHA 3GFKB 3WK6A 3KHLA 3TQ1A 3PNCA 8ICAA 2FDRA 2QB1A 3QUCA 5AI4A 4QZFA 2E8MA 4R8UA 2AQ4A 4P2HA 3IN5A 5ALEA 1SGGA 3RF9A 5DG9A 3BZCA 5JU5A 3L5KA 5J2GA 5CWRA 4QZ8A 2ZG6A 5HHHA 1Z00A 3KD3A 4Y2UA 5DDYA 3TI0A 5AKZA 4HYKA 1OUQA 4RQ4A 3WK8A 1DK2A 5AIBA 1NK8A 1ZQNA 5KFMA 4F4KA 5AKEA 3RH6A 2KJ9A 5J0SA 3IRUA 1JN3A 3PO4A 4FBTA 4EEYA 1S97A 4CF4A 4ECXA 2WAQC 2KIWA 4C8LA 3B0XA 2J6UA 2KSOB 4ACOA 3SAHA 3FAHA 2XI9A 4KLHA 2XC9A 1VLBA 1X66A 3G6VA 3C5FA 2W7OA 1MQ2A 2BPFA 1Z19A 5TISU 2VJ4A 3OJUA 2BQUA 1TAMA 1NK9A 1ZXIA 4I27A 7ICUA 3NVWA 2CRXA 5HNKA 1QTMA 1ZQUA 2KHQA 1S0MA 2R8GA 4I2IA 3VC8A 4QZHA 3RB3A 4K4GA 5KFVA 2WF6A 1S76D 2RHFA 3RR7A 5DQGA 4YQWA 1ZD3A 5DG8A 4RU9A 3OPXA 4NLZA 5JUMA 4F71A 2WF5A 4C8MA 1RYUA 3RTVA 2OCEA 3I1YA 5L9XA 2BQ3A 3GV8B 3JPOA 5DB8A 2KP7A 5G5HA 1TK5A 1QQ5A 3BS5B 3GV7B 2MAXA 2E8NA 5KNIA 2BHNA 1NZPA 5KTQA 3UMBA 4YMMA 1YZ7A 2E5SA 3AN1A 5AK3A 3TFRA 1BPYA 3I76A 5J2HA 4CF5A 2D6FC 2I6XA 2NRWA 2HBMA 3WK9A 1A6SA 1V85A 5C5JA 2ZXHA 1RXVA 5ALSA 4DFMA 2HVHA 1ZQIA 1KBUA 2HHTA 5DKWA 2AHOB 1RZTA 1XC9A 5A0LA 2FLPA 2BDUA 2WF8A 5ALJA 4C8NA 4DFPA 4EZ9A 2AU0A 5GTHU 3LK9A 3BDPA 2AGPA 3RB4A 5DB7A 2ZUDA 2FPKA 1V9PA 3M9NB 1UT5A 3RRGA 5J29A 1XWLA 2EDUA 5KFDA 7ICLA 4P0PA 3L3FX 3H8WA 3ONNA 1ZQ1C 4UW9A 4J9OA 1WCNA 4DSJA 4EEKA 4IR9A 1B43A 4F4XA 4NXZA 1U47A 1B4FA 2BGWA 2DUYA 3ISBA 3QEBZ 1N63A 1RQNA 1U49A 4BJQA 4UQGA 2OM6A 2F3NA 5AKLA 2YMMA 1ZQSA 2Y1IA 2KKPA 4FFDA 3AU2A 2LHTA 3ED5A 5KL1B 4Y2JA 3M6KA 4KLTA 4O5EA 2MU2A 5J2AA 5DG7A 1ZJNA 3V7LA 2W7PA 2GH1A 5J8YA 9ICFA 4EBDA 2W03A 3UXPA 2GLEA 1KLNA 4RQ1A 1C20A 1UHUA 4LZDA 1JMSA 5KFQA 4ECYA 3QU5A 4Y2XA 2BCUA 1XSLA 1IIPA 3NASA 3KZIU 3OTQA 3HWTA 4F92B 4B9NA 2OH2A 8ICHA 1X40A 2C2RA 4EBCA 4ECZA 3UXOA 5EWFA 4TUPA 4US8A 4ECSA 1WWUA 4OO1J 2IBKA 1O03A 4EELA 2ASDA 2W3RA 3KBBA 1ZQQA 3ZD9A 8ICPA 1U4BA 2YMPA 4DWIA 1DGJA 5KG4A 1Q46A 2JEJA 3U26A 4GLXA 1B22A 5KFRA 1KTQA 2RRDA 4MEYA 4U7CA 3OJSA 1DGSA 5HMMA 4TUSA 5J2CA 2KN7A 3HJEA 1JUDA 3RJGA 5HR7A 2QB0A 5KT5A 3HILA 3BZKA 4BXOB 1NOMA 4JWMA 1LB2B 3RJKA 4UB4A 5IILA 1J2MA 7ICGA 3NRWA 2B21A 3C1ZA 5CRXA 1XO0A 3E58A 5D4BA 4P0PB 2EZXA 4CDGA 1COOA 1SKRA 2MSNA 1K5OA 4FS2A 3RFAA 2VA2A 4PJ0U 4P4OA 2V4QA 5L1JA 2BZFA 4O9MA 1SWWA 3J81j 1X6JA 2KKVA 5KAFU 4M9LA 1N2XA 2EAOA 2W9BB 1ZQOA 2AGOA 2DQNB 1SL0A 1JIHA 4UASA 2OXOA 1Z4OA 3QU2A 4B9MA 1TK8A 3RJEA 5JTIA 4BDPA 1ZRMA 2YTUA 4DOCA 1U48A 1S8OA 3LVVA 1QSSA 4ECUA 1OXJA 5AHXA 3H8SA 3RH5A 4Y2TA 7ICSA 3H8JA 4O5CA 1QCKA 1ZOLA 3MFHA 4DQSA 9ICPA 1LV5A 4F4WA 5AK5A 4F50A 2PFPA 8ICNA 4KMUA 2G5IB 3RB0A 1A77A 4M9GA 2BCQA 2A19A 4NL9A 5KFWA 5IIKA 1ZYQA 4DOBA 2HOFA 1T3NA 4C7YA 3S6JA 4NLGA 2GOLA 4OD0A 5ALLA 9ICBA 4ED0A 3ETLA 5AI8A 1X9MA 2CPRA 4KN7A 1MN8A 2UVVA 4QW9A 1L3UA 4F4YA 3NS1A 5BOLA 2FMQA 1KDHA 1KL9A 3PY8A 5KT4A 1SV4A 2KOBA 4EYHB 4UBBA 1V97A 5DB9A 1SXDA 5CA7A 4DEZA 2N1RA 7ICRA 1SIJA 2QB0B 9ICJA 1H38A 3GIKA 3BQ2A 4YD1A 2AJQA 5ALIA 3LVWA 1F5SA 5BPCA 5ALXA 4ECVA 5ALFA 2V9WA 1BPDA 3WK4A 1TE2A 2M0NA 1AROP 2ZIUB 5KFUA 4G9BA 5AKIA 2PKEA 4YR0A 2HBKA 2NRVA 2RLTA 2ASJA 4F5PA 3N7SC 2AXTU 1OW5A 1IM4A 3ISDA 4PHPA 4E0DA 4K4IA 1SL1A 4DF4A 4HAIA 1HUOA 3TANA 1PVQA 1BVSA 3K75D 4DQIA 2IOHA 5AKJA 4NY8A 4ELVA 2BCRA 5C0YA 1N56A 2K4PA 1L3SA 2R8HA 5KFJA 1UQVA 4QZEA 2KSOA 4I2FA 1QQ7A 2KE7A 3UXNA 2E1EA 7ICJA 4UBCA 5KFIA 4MF2A 3TACB 4UATA 4NLNA 2UVRA 4Q8FA 4QZGA 4KLGA 7ICMA 2I1QA 4ELUA 3QUQA 5J0WA 1BNPA 1PUZA 5DLGA 2XCAA 8ICZA 2KIVA 1CEZA 3GILA 2Z7JA 2CXYA 1DRGA 3ALRA 1N5WA 5KG0A 2LMRA 1SWVA 4RQ5A 4QZCA 3AMZA 2B6GA 3T3FA 4QIWF 2Y0SC 3GV5B 4I2HA 3KTQA 1KQQA 3BS5A 2JRZA 3Q8SB 5ALNA 3KZXA 1ZQVA 1X9SA 1Y88A 1VJ5A 2HDOA 2BPCA 1BPXA 1JROA 2A1JB 5DGAA 2JH1A 3FC4A 2DKZA 4P4PA 1ZETA 5D46A 5IIOA 4YP3A 7ICOA 1D8LA 4CGZA 2LYHA 1ZQDA 5CP2A 4OJ5A 3GU3A 2JXJA 5AM0A 1U45A 2VANA 5B5EU 4LJXA 3UPQA 1PK1A 3SYZA 2ASLA 3SZ2A 4KLJA 2W9AA 4KLDA 4NLKA 3H0RB 3JPRA 1RM6C 4C8KA 9ICSA 4F5QA 5KFSA 1S9FA 3CW2C 3WK5A 2VKQA 1C7YA 2K4IA 4DSEA 2Y1JA 3T5HA 4QJFB 4YCXA 2E1FA 4Z6DA 1COKA 2VA3A 3QEAZ 9ICQA 4KN4A 5J0UA 2DPIA 1XNSA 1L8LA 3MR5A 2KZZA 3SEIA 3KHRA 2HSZA 3WU2U 2JZBA 4Y2YA 5L1MA 4OJPA 4BWJA 1CRXA 1T8EA 2I9GA 5H2FU 1SZPA 2K8CB 3NVZA 4IQUA 2KTQA 4KX3A 1RDFA 5KT3A 2HHUA 4KLSA 3JPPA 5DB6A 8ICLA 3EW9A 3QUTA 1ZQZA 2W8LA 2K60A 4LZGA 2H5XA 4F5NA 1NNLA 2D3DA 1L6NA 2KNJA 4IR1A 4UB3A 3N7PD 5KL8B 1XO1A 3QNMA 3GIJA 4GC7A 4ED8A 3PX6A 3KHHA 1ZD2P 1ZQPA 1URJA 1QLNA 1ZRNA 1JALA 3Q8KA 3N4MB 4RPXA 2EQYA 2JMGA 4Q45A 4NM1A 3QUBA 9ICEA 3BQ0A 2YB4A 4I2DA 1X9XA 2JGAA 4QIWC 5AKGA 4R65A 2RP5A 2W43A 4IRKA 3E0FA 1NKCA 3C2LA 4QNLA 1ZQJA 4O3PA 2OEHA 3C2MA 3HKZF 2Y9TA 4FS1A 3LWLA 3H0MB 1NK5A 1MSWD 2D8CA 3WK7A 3QU7A 3RJIA 1NJWA 3IDWA 4RNNA 4J9LA 1P7DA 3PSTA 1PK1B 2FE9A 5AI6A 5AKYA 1LKYA 4J9NA 3RBDA 5ALMA 5ALPA 1RYSA 4DL2A 2G09A 2YX8A 4JMUA 4AYBF 3F2DA 3AQEA 1YZ6A 2W54A 2OYYA 4NM2A 4UB5A 4PL2A 4R63A 2F1HA 2J6TA 2HHQA 4UARA 1DK3A 4O3SA 2ZIXB 3ISCA 4OJLA 3BJYA 4F3OA 2YB1A 4BXOA 3HX0A 2ZIVA 4R66A 4QWCA 1L5UA 4FBUA 4Y2PA 3WKBA 2G07A 3EPIA 2AH5A 4U6PA 2JZBB 2Q0ZX 2ZXIA 3D6JA 4ED6A 2WTFA 3Q8LA 2BQRA 1HJPA 3PX0A 4OJOA 3SV3A 4MFCA 4NV0A 1HIWA 3UMGA 4QZDA 5KFLA 2LM4A 4I2GA 8ICCA 5DBBA 3ZDCA 8ICYA 1BPZA 4Y2RA 4RQNA 4M6WB 2YY6A 4FZNA 2KFNA 9ICKA 2W9BA 3N97B 4RQ3A 2RQ5A 2ZTCA 1XSPA 3TAQA 5ALUA 1JX4A 3TADC 1ECWA 2DL0A 4UAZA 1D9FA 3ORYA 4YXMA 4QZ9A 2F1IA 2W3SA 4O5KA 4F4ZA 3KOOA 4A8EA 4J9RA 5J0TA 3RJJA 5DLFA 5IINA 4I2BA 7ICFA 1FFUA 1JXEA 2YMQA 3T5KA 2HBLA 4YR2A 3CRXA 3EPGA 3NRZA 4I2JA 2KMDA 2I5HA 1QH9A 4IC9A 2FMSA 8ICJA 5F9NA 2IHNA 5KT2A 4KLLA 3NUQA 5J2DA 1NK4A 5AM1A 5DQHA 2MUTB 4B9VA 3M8SA 3PVXA 4B6JA 5HR6A 3TADA 4RPYA 1KN5A 5L1KA 3NVYA 1LKYB 1Z1VA 4XA5A 4EENA 3ZI4A 4BWMA 4Z6FA 3JPTA 3M9OB 4BX9C 3C29A 4DL4A 4K4HA 1JI7A 3C2KA 4IRCA 3OGUA 3B9JA 2QLTA 3FYHA 5KFTA 1ZQCA 4DFJA 3RB6A 1M6YA 1IXRA 5EE3A 1D8BA 3WKDA 4RQ0A 3QE9Y 4GFJA 1WG8A 2ZIVB 1X6IA 3D2SA 1TFRA 2J6SA 3AM9A 2ZIUA 3UQ0A 4RT2A 2XY5A 1ZJMA 1QSYA 4IQWA 3HRDD 1ED1A 4F91B 3PX4A 4GXIA 3Q8PB 2DFLA 2GO7A 5KFXA 1QQ6A 3G6XA 2HOQA 3WKCA 1KKXA 2R8JA 2XGPA 5AKHA 2JEGA 4M9JA 4I2EA 4KLMA 3F2CA 1XSNA 2ZJAA 2WB1F 5KG6A 1Q3UA 5J0XA 5CJ7A 5F9LA 4IS7A 3MR3A 4NWIA 1ZQWA 1A0PA 2C28A 2F77X
chains in the Genus database with same CATH topology
1TAMA 3PSIA 2VIXA 2G09A 2W04A 2H3ZA 2HOFA 2RRDA 2K8BB 3MGVA 4U7CA 3IP4B 3O0FA 3PSFA 1Q3VA 2YX8A 2A3VA 4JMUA 2GOLA 2MRLA 4AYBF 1XNSA 3F2DA 3AQEA 3GZFA 3NUQA 2CRXA 4C0ZA 2LYAA 2WAQF 2KHQA 2OYYA 1HEKA 4KMOB 2JH7A 4OJPA 3VC8A 3SAGA 3F5AA 2CPRA 2H3FA 1CRXA 4P0PA 5HR7A 2JHDA 3IG8A 4PL2A 3F2BA 3L3FX 2CN1A 2HMXA 2Q4TA 1ZQ1C 3ONNA 5HR6A 5T14A 2H3IA 2F76X 2RHFA 2K8CB 2Z7JA 2ZIXB 4OJLA 2LYBA 3ALRA 1DRGA 4NLCA 4NLBA 2YB1A 3OPXA 4KX3A 2KVCA 2ZIXA 3SQIA 2K4EA 2ZIVA 4FZMA 2WB1C 2LKYA 4BX9C 3C29A 2KOBA 3DEEA 4QIWF 2Y0SC 3VCBA 2H3VA 3NRWA 2G0AA 4CRXA 2G07A 3T79A 4BJQA 4U6PA 2OM6A 2MA1A 1WUDA 3IG5A 1XO0A 5CRXA 1NZBA 2ZXIA 2N1RA 2LBOA 2R18A 2KKPA 4P0PB 3F5EA 2G06A 2ZIWA 4CDGA 1L6NA 2KNJA 2K89A 4FE3A 4WJ3B 2PMZF 2LHTA 2E5SA 3CP8A 3N7PD 1PVRA 5KL8B 3IN5A 3KZXA 1D8BA 4OJOA 1UPHA 3LVWA 3RF9A 4OJ6A 4NV0A 2KEYA 4GFJA 3RFAA 5KL1B 1PVPA 1HIWA 3M6KA 4PL1A 3CYMA 2ZIVB 3H0LB 3D2SA 2JH1A 2K8AA 1URJA 1SZHA 3PSPA 2KD1A 3PZPA 3SAFA 2M0NA 2ZG6A 2ZIUB 2Y0SF 2KKVA 3HKZC 2W7PA 2HOIA 2D6FC 3AL0B 2GH1A 2ZIUA 4CGZA 1F44A 2W03A 2JMGA 2KHVA 2HBKA 4FZNA 2ZIWB 3M6ZA 4OJ5A 1ED1A 2KJ5A 2HBMA 1OUQA 2YB4A 2DQNB 3GU3A 3N7SC 1A6SA 2OXOA 2NV3A 3C28A 2HOQA 2ZXHA 1IIPA 2DGZA 2JGAA 1ECWA 2KJ9A 2KV2A 4QIWC 2RP5A 3F53A 1PVQA 3K1ZA 2HBJA 1YT3A 1T94A 1KBUA 3LVVA 3E0FA 4ICAA 2KJ8A 2G08A 3AQFA 3F2CA 5A0LA 4AYBC 2BDUA 2DF4B 4QNLA 2XIDA 3H0RB 2WB1F 2WAQC 1MA7A 2KIWA 4BUGA 2F8LA 4O3MA 2KICA 5C0YA 3D2QA 4A8EA 1GO3F 3N7RC 3HKZF 1Q3UA 4OO1J 2VJ5A 2G5HB 2PMZC 3D2NA 3H0MB 3KFUF 2H3QA 4ACOA 3SAHA 2VKQA 3SMVA 3ICXA 2K4HA 2HBLA 2XI9A 2K4IA 4KX5A 4P0QB 2E1EA 4FZLA 2G5IB 1Z1BA 4NWIA 1A0PA 3CRXA 4QJFB 2F2AB 4P0QA 1P7DA 3PSTA 2E1FA 2XVTA 2W7OA 1Z19A 3M7DA 2VJ4A 4IC9A 2OH2A 3LYSA 2XICA 2F77X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5S A;  3D2S A;  3D2Q A;  3D2N A; 
#chains in the Genus database with same CATH topology
 3PW2 A;  2VIX A;  2H3Z A;  3L4P A;  3GQC A;  4UAY A;  1S0O A;  2JEI A;  3IP4 B;  3C5G A;  3DDH A;  1T3Q A;  2HHW A;  9ICC A;  1KFT A;  5ALD A;  3N28 A;  4RNM A;  3IG8 A;  4P4M A;  5CHG A;  5J0O A;  3RH4 A;  1T4G A;  4F93 B;  4O3Q A;  1J97 A;  1L3V A;  4RUA A;  5AI0 A;  4CF3 A;  4M0A A;  5KFY A;  3C23 A;  4CRX A;  1O08 A;  4EX7 A;  5L1L A;  3V7K A;  4Y2Q A;  2RDJ A;  1PVR A;  4YD2 A;  2FPL A;  4PL1 A;  3H0L B;  2A1A A;  4PHE A;  2A1J A;  3MDA A;  9ICM A;  1T7P A;  1ZQH A;  5KG7 A;  3UM9 A;  2HW3 A;  2YML A;  2FI1 A;  2HHS A;  2EH9 A;  4B9L A;  5AK4 A;  4C80 A;  5AM5 A;  3NVV A;  4GIB A;  1D8Y A;  1ZQX A;  3EYZ A;  5KG5 A;  3CNH A;  1EXN A;  1S5L U;  1SV0 C;  2YN4 A;  3A0B U;  4TUR A;  2IA6 A;  2NO5 A;  2HVI A;  2XID A;  2UVU A;  3C21 A;  4O3M A;  3Q8Q B;  4NJ8 A;  2H3Q A;  2F8K A;  1NKB A;  2XGQ A;  1N60 A;  3ZDB A;  4KLE A;  4RZR A;  1NKE A;  4X5V A;  2BR0 A;  2NYV A;  3MGV A;  8ICR A;  2BCV A;  3HW8 A;  5ALQ A;  4C0Z A;  2WAQ F;  3M9M B;  4JK1 A;  4YXJ A;  1S0V A;  3SAG A;  1TAQ A;  5J0Y A;  3ZDE A;  3JPQ A;  3HP6 A;  1CUK A;  2M9N A;  2W9C B;  3TAR A;  5ALW A;  4UB1 A;  2EAN A;  4I2C A;  2WB1 C;  1ZQK A;  9ICO A;  5KFK A;  4CNQ A;  3GIM A;  3IHQ B;  1ZQT A;  1DOQ A;  2DPJ A;  1WUD A;  3IG5 A;  7ICK A;  3ETR A;  4YMO A;  3AUO A;  2XY7 A;  1Q8K A;  5EWE A;  4IQV A;  2V4R A;  1J2N A;  4Q43 A;  1F0M A;  2ZUB A;  5KFB A;  4GXK A;  1RYR A;  5GTI U;  4DO9 A;  5ALR A;  1Z4N A;  4PGQ A;  2K8A A;  4CE6 A;  4J03 A;  3LDA A;  4ED7 A;  5ALV A;  4PHD A;  4GC6 A;  4M04 A;  3I28 A;  4PGY A;  4MFA A;  4PZO A;  4B9T A;  3V6J A;  4J9P A;  1FFV A;  2NV3 A;  3C28 A;  8ICX A;  4RT3 A;  1RPL A;  3LWM A;  4I2A A;  4G3I A;  4M9H A;  2KV2 A;  3B0Y A;  3BQ1 A;  3F53 A;  4RUC A;  1T94 A;  4RQM A;  4ECW A;  4BGD A;  1B0X A;  8ICF A;  8ICE A;  3OSP A;  8ICK A;  5AI5 A;  2NRT A;  3ZDA A;  1JXL A;  4P0Q B;  2HHX A;  2F2A B;  5EE0 A;  1FO4 A;  5CB1 A;  3HPO A;  4KLF A;  1SKS A;  2W04 A;  4XRH A;  1TKD A;  4TUQ A;  5DBC A;  5ALH A;  1S10 A;  3BS7 A;  2JH7 A;  4QZA A;  2H3F A;  5AIC A;  2P6U A;  3K1R B;  3PML A;  2PI5 A;  4RQ2 A;  2H3I A;  4DOA A;  4YN4 A;  2ZIX A;  4QWE A;  2HHV A;  4KTQ A;  1L7O A;  3PMN A;  4PZN A;  1NZB A;  3MC1 A;  2FJ6 A;  2P6R A;  3CP8 A;  3EZ5 A;  4C8O A;  5J2J A;  5ALO A;  2PI4 A;  1PVP A;  1N61 A;  3QXG A;  4IRD A;  3CYM A;  4J9Q A;  4KLI A;  4RQ7 A;  3PZP A;  1NK7 A;  4KLU A;  5J2I A;  3AL0 B;  5ALY A;  2EAM A;  5AM3 A;  3T5L A;  2FLL A;  4M6W A;  4RQ8 A;  3DV9 A;  3RAQ A;  4MHV A;  3MR6 A;  1L7P A;  5KFZ A;  1K1S A;  4EZ6 A;  3MFI A;  3JPS A;  2ES6 A;  5J0R A;  3QYP A;  1YT3 A;  3AQF A;  3QU9 A;  2DF4 B;  7ICI A;  4F2R A;  5K4L A;  4DL7 A;  2G5H B;  1UA1 A;  5B66 U;  3SEN A;  4PHA A;  4PPX A;  3RR8 A;  1PZN A;  4YFK A;  4RQ6 A;  2P35 A;  5KG3 A;  5KFO A;  5III A;  2XIC A;  2IOF K;  2P66 A;  2W9M A;  5KT7 A;  2K8B B;  1S77 D;  8ICO A;  3PSF A;  2MRL A;  1DXS A;  4XQ8 A;  3FDS A;  4Q8E A;  4ZOH C;  3MGH A;  2LM1 A;  1A76 A;  1HEK A;  2W11 A;  5AM2 A;  4QZB A;  2EAP A;  4C4T A;  2MUT A;  3F2B A;  2HMX A;  5T14 A;  5ALT A;  1L8O A;  2ZUC A;  1N5X A;  4Q44 A;  4NLC A;  1ZQF A;  3BQ7 A;  3T5J A;  3SQI A;  1NI3 A;  4EX6 A;  3IV6 A;  4YG2 A;  2XCP A;  3NTU A;  7ICQ A;  2IHM A;  4F5R A;  2KK0 A;  3V6H A;  4MEX A;  2UVW A;  5JRT A;  4R8U B;  1KW4 A;  5DGB A;  5KFH A;  2K89 A;  2DBY A;  2DWQ A;  1ZQY A;  1BPB A;  4F72 A;  4USA A;  5AM4 A;  2EZY A;  4M47 A;  1Z00 B;  3SAF A;  2PXI A;  2ALZ A;  9ICR A;  1K1Q A;  4Y2V A;  2HOI A;  5EE1 A;  4UB2 A;  2KHV A;  7ICT A;  2F44 A;  3RBE A;  3OHB A;  9ICH A;  1NJX A;  5BOM A;  4FO6 A;  1SXE A;  3QU4 A;  4JV1 A;  2B0C A;  1XS9 D;  2R8K A;  8ICB A;  3QZ8 A;  1D9D A;  5CR0 A;  4JV0 A;  5F3X B;  5AKK A;  5J0P A;  3K1Z A;  3PR4 A;  5L1I A;  3JPN A;  2ISO A;  2KIC A;  5J8Y C;  3NGD A;  3N7R C;  1JRP A;  4UB8 U;  3D2N A;  2HI0 A;  1MQ3 A;  3MAB A;  2GWS A;  2K4H A;  3G6Y A;  4DFD A;  4ED2 A;  1ZQE A;  4FZL A;  3H7I A;  4R64 A;  4QWB A;  4MF8 A;  5J2K A;  3EWA A;  2WF7 A;  2ESE A;  2EZZ A;  8ICV A;  4QW8 A;  1NJZ A;  3O0F A;  2IOF A;  8ICU A;  1QSL A;  5TZV A;  4C4S A;  2LYA A;  2C2D A;  1KFS A;  4O3N A;  4DCC A;  3F5A A;  4ECT A;  3PW5 A;  2F76 X;  4XUS A;  5J2F A;  1ZD5 A;  4O3O A;  5KFP A;  4ELT A;  2XY6 A;  1FEZ A;  2FLN A;  3THV A;  2RDI A;  4RPZ A;  2WFA A;  2G0A A;  2IMW P;  2NRZ A;  4DQP A;  7ICP A;  1FIQ A;  5DBA A;  2C22 A;  4J9S A;  2G06 A;  2ZIW A;  4ED1 A;  2E8O A;  5AKX A;  4WJ3 B;  2PMZ F;  5KFG A;  3A0H U;  1UPH A;  3TFS A;  1WYG A;  5HP4 A;  4F2S A;  1RQL A;  1U9L A;  1IG6 A;  2KD1 A;  4C7Z A;  5IIM A;  4US9 A;  3RAX A;  8ICQ A;  1NK0 A;  3HKZ C;  4JUZ A;  9ICV A;  5EE9 A;  3M6Z A;  9ICI A;  2KJ5 A;  5DDM A;  4DL6 A;  4QZI A;  4EBE A;  2JEF A;  3PO5 A;  4B9S A;  3PW0 A;  2JR5 A;  5HHI A;  2DGZ A;  4JWN A;  5ALZ A;  4F5O A;  5EOZ A;  3KKA C;  4RNO A;  4ICA A;  2KJ8 A;  7ICV A;  2QKQ A;  9ICW A;  5J2E A;  4AYB C;  1BPE A;  4QWD A;  1UA0 A;  2YQE A;  2F8L A;  4DQQ A;  3D2Q A;  2L5Y A;  1Z3E B;  4B9U A;  1L7N A;  2ZJ5 A;  2FPM A;  1ZQG A;  1KRP A;  3KFU F;  5KFF A;  9ICT A;  3SMV A;  3ICX A;  4KX5 A;  3V7J A;  2F1J A;  3H8M A;  2ATL A;  9ICA A;  3LYS A;  3HT3 A;  2R8I A;  2PFN A;  3PSI A;  3MBY A;  4EYI B;  1S0N A;  1UCV A;  4UB6 U;  1Q3V A;  4ED3 A;  1PK3 A;  1ZQL A;  2E3T A;  1LVH A;  3GZF A;  3GII A;  3V72 A;  5E79 U;  4QWA A;  2KG5 A;  4KMO B;  4DL5 A;  2PFO A;  2Q4T A;  3MDC A;  4ECQ A;  1RXW A;  2VA8 A;  4I29 A;  2KVC A;  2W9C A;  3KKA A;  4NL9 C;  4FZM A;  3DEE A;  2H3V A;  1NJY A;  2O6K A;  3GDX A;  4UAW A;  5J2B A;  1CI4 A;  4J9K A;  3PW7 A;  3ZD8 A;  3F5E A;  4JB3 A;  5EWG A;  1MC8 A;  4FE3 A;  1KFD A;  2ISP A;  5KG2 A;  3M1Y A;  5G5G A;  4MFF A;  1ZQB A;  5AK6 A;  3PSP A;  1SB3 C;  1SZH A;  5AI9 A;  4DLE A;  1TVA A;  2XO7 A;  1L3T A;  1VDV A;  4O0I A;  3BQT A;  1KEJ A;  5D49 A;  2Y0S F;  3C1Y A;  1ZQA A;  3WKA A;  4M2Y A;  2ZIW B;  2BCS A;  2NRX A;  2PFQ A;  1X9W A;  3PV8 A;  2OWO A;  8ICW A;  3IM1 A;  2DKX A;  1WCL A;  2LPE A;  3SV4 A;  1NK6 A;  2HBJ A;  1SL2 A;  2KZM A;  2G08 A;  5ALG A;  4YVZ A;  3M8R A;  4YR3 A;  4O3R A;  1HUZ A;  8ICT A;  3E2E A;  1ZQR A;  5CEH A;  1GO3 F;  9ICL A;  2PMZ C;  5KG1 A;  1V38 A;  4JV2 A;  1XU4 A;  1ZQM A;  4PGX A;  1AQ6 A;  2C2E A;  4P0Q A;  3UQ2 A;  4IL6 U;  2XVT A;  1IV8 A;  4Z6E A;  2Y9U A;  3R9K A;  3OHA A;  3AEV A;  8ICI A;  5KFA A;  1TK0 A;  3MGI A;  2QAR A;  2A3V A;  5IIJ A;  4TQS A;  5KFN A;  1UT8 A;  7ICN A;  8ICM A;  4DS4 A;  2JHD A;  3AU6 A;  4CCH A;  4AP9 A;  2BDP A;  4NLB A;  1BGX T;  5ALK A;  2K4E A;  2LKY A;  2NO4 A;  7ICE A;  3VCB A;  4PH5 A;  4ZH4 A;  3PW4 A;  4DL3 A;  3T79 A;  2MA1 A;  4KLO A;  1RG6 A;  1ZD4 A;  2LBO A;  2ZTE A;  2R18 A;  3OSN A;  2FMP A;  3FM9 A;  7ICH A;  1SV0 A;  1L7M A;  4OJ6 A;  3V6K A;  2KEY A;  4DF8 A;  2KFZ A;  4GXJ A;  3H4B A;  4J9M A;  1X2I A;  2OHF A;  2ZTD A;  2W8K A;  2W55 A;  5KFE A;  2BPG A;  3Q8R B;  4ECR A;  1F44 A;  3SD7 A;  1N62 A;  3TKA A;  3QZ7 A;  2AGQ A;  4C4R A;  4KLQ A;  9ICN A;  3K4G A;  2HCF A;  4YMN A;  3ZDD A;  9ICG A;  4DSL A;  9ICU A;  5AIA A;  2ZJ8 A;  4UAU A;  4DQR A;  2WHE A;  9ICX A;  2KVS A;  4Z6C A;  1BNO A;  3Q8M A;  5KT6 A;  4TQR A;  1X42 A;  4DSK A;  1MA7 A;  4BUG A;  5KFC A;  5HML A;  2VJ5 A;  3SI8 A;  4M9N A;  4OCZ A;  2JV3 A;  3KHG A;  3H40 A;  3UMC A;  1Z1B A;  1N48 A;  8ICG A;  3RJF A;  2ODG A;  4F8R A;  4DSF A;  3EUB 2;  3M7D A;  4Y2S A;  1KSP A;  3RJH A;  4DLG A;  4UAV A;  4IQT A;  2WF9 A;  3TAP A;  4LVS A;  2KZ3 A;  3WKE A;  4DSI A;  4DS5 A;  4DFK A;  5DQI A;  3H4D A;  2CN1 A;  5J0Q A;  2BKE A;  3PR5 B;  3MR2 A;  2AQ0 A;  2LI6 A;  1WWV A;  2LYB A;  1SKW A;  1TV9 A;  5KAI U;  3SR6 A;  4I28 A;  3QX7 A;  1TAU A;  2QAR B;  2E8P A;  5FP0 A;  8ICS A;  4KIT B;  3RRH A;  3GFK B;  3WK6 A;  3KHL A;  3TQ1 A;  3PNC A;  8ICA A;  2FDR A;  2QB1 A;  3QUC A;  5AI4 A;  4QZF A;  2E8M A;  4R8U A;  2AQ4 A;  4P2H A;  3IN5 A;  5ALE A;  1SGG A;  3RF9 A;  5DG9 A;  3BZC A;  5JU5 A;  3L5K A;  5J2G A;  5CWR A;  4QZ8 A;  2ZG6 A;  5HHH A;  1Z00 A;  3KD3 A;  4Y2U A;  5DDY A;  3TI0 A;  5AKZ A;  4HYK A;  1OUQ A;  4RQ4 A;  3WK8 A;  1DK2 A;  5AIB A;  1NK8 A;  1ZQN A;  5KFM A;  4F4K A;  5AKE A;  3RH6 A;  2KJ9 A;  5J0S A;  3IRU A;  1JN3 A;  3PO4 A;  4FBT A;  4EEY A;  1S97 A;  4CF4 A;  4ECX A;  2WAQ C;  2KIW A;  4C8L A;  3B0X A;  2J6U A;  2KSO B;  4ACO A;  3SAH A;  3FAH A;  2XI9 A;  4KLH A;  2XC9 A;  1VLB A;  1X66 A;  3G6V A;  3C5F A;  2W7O A;  1MQ2 A;  2BPF A;  1Z19 A;  5TIS U;  2VJ4 A;  3OJU A;  2BQU A;  1TAM A;  1NK9 A;  1ZXI A;  4I27 A;  7ICU A;  3NVW A;  2CRX A;  5HNK A;  1QTM A;  1ZQU A;  2KHQ A;  1S0M A;  2R8G A;  4I2I A;  3VC8 A;  4QZH A;  3RB3 A;  4K4G A;  5KFV A;  2WF6 A;  1S76 D;  2RHF A;  3RR7 A;  5DQG A;  4YQW A;  1ZD3 A;  5DG8 A;  4RU9 A;  3OPX A;  4NLZ A;  5JUM A;  4F71 A;  2WF5 A;  4C8M A;  1RYU A;  3RTV A;  2OCE A;  3I1Y A;  5L9X A;  2BQ3 A;  3GV8 B;  3JPO A;  5DB8 A;  2KP7 A;  5G5H A;  1TK5 A;  1QQ5 A;  3BS5 B;  3GV7 B;  2MAX A;  2E8N A;  5KNI A;  2BHN A;  1NZP A;  5KTQ A;  3UMB A;  4YMM A;  1YZ7 A;  2E5S A;  3AN1 A;  5AK3 A;  3TFR A;  1BPY A;  3I76 A;  5J2H A;  4CF5 A;  2D6F C;  2I6X A;  2NRW A;  2HBM A;  3WK9 A;  1A6S A;  1V85 A;  5C5J A;  2ZXH A;  1RXV A;  5ALS A;  4DFM A;  2HVH A;  1ZQI A;  1KBU A;  2HHT A;  5DKW A;  2AHO B;  1RZT A;  1XC9 A;  5A0L A;  2FLP A;  2BDU A;  2WF8 A;  5ALJ A;  4C8N A;  4DFP A;  4EZ9 A;  2AU0 A;  5GTH U;  3LK9 A;  3BDP A;  2AGP A;  3RB4 A;  5DB7 A;  2ZUD A;  2FPK A;  1V9P A;  3M9N B;  1UT5 A;  3RRG A;  5J29 A;  1XWL A;  2EDU A;  5KFD A;  7ICL A;  4P0P A;  3L3F X;  3H8W A;  3ONN A;  1ZQ1 C;  4UW9 A;  4J9O A;  1WCN A;  4DSJ A;  4EEK A;  4IR9 A;  1B43 A;  4F4X A;  4NXZ A;  1U47 A;  1B4F A;  2BGW A;  2DUY A;  3ISB A;  3QEB Z;  1N63 A;  1RQN A;  1U49 A;  4BJQ A;  4UQG A;  2OM6 A;  2F3N A;  5AKL A;  2YMM A;  1ZQS A;  2Y1I A;  2KKP A;  4FFD A;  3AU2 A;  2LHT A;  3ED5 A;  5KL1 B;  4Y2J A;  3M6K A;  4KLT A;  4O5E A;  2MU2 A;  5J2A A;  5DG7 A;  1ZJN A;  3V7L A;  2W7P A;  2GH1 A;  5J8Y A;  9ICF A;  4EBD A;  2W03 A;  3UXP A;  2GLE A;  1KLN A;  4RQ1 A;  1C20 A;  1UHU A;  4LZD A;  1JMS A;  5KFQ A;  4ECY A;  3QU5 A;  4Y2X A;  2BCU A;  1XSL A;  1IIP A;  3NAS A;  3KZI U;  3OTQ A;  3HWT A;  4F92 B;  4B9N A;  2OH2 A;  8ICH A;  1X40 A;  2C2R A;  4EBC A;  4ECZ A;  3UXO A;  5EWF A;  4TUP A;  4US8 A;  4ECS A;  1WWU A;  4OO1 J;  2IBK A;  1O03 A;  4EEL A;  2ASD A;  2W3R A;  3KBB A;  1ZQQ A;  3ZD9 A;  8ICP A;  1U4B A;  2YMP A;  4DWI A;  1DGJ A;  5KG4 A;  1Q46 A;  2JEJ A;  3U26 A;  4GLX A;  1B22 A;  5KFR A;  1KTQ A;  2RRD A;  4MEY A;  4U7C A;  3OJS A;  1DGS A;  5HMM A;  4TUS A;  5J2C A;  2KN7 A;  3HJE A;  1JUD A;  3RJG A;  5HR7 A;  2QB0 A;  5KT5 A;  3HIL A;  3BZK A;  4BXO B;  1NOM A;  4JWM A;  1LB2 B;  3RJK A;  4UB4 A;  5IIL A;  1J2M A;  7ICG A;  3NRW A;  2B21 A;  3C1Z A;  5CRX A;  1XO0 A;  3E58 A;  5D4B A;  4P0P B;  2EZX A;  4CDG A;  1COO A;  1SKR A;  2MSN A;  1K5O A;  4FS2 A;  3RFA A;  2VA2 A;  4PJ0 U;  4P4O A;  2V4Q A;  5L1J A;  2BZF A;  4O9M A;  1SWW A;  3J81 j;  1X6J A;  2KKV A;  5KAF U;  4M9L A;  1N2X A;  2EAO A;  2W9B B;  1ZQO A;  2AGO A;  2DQN B;  1SL0 A;  1JIH A;  4UAS A;  2OXO A;  1Z4O A;  3QU2 A;  4B9M A;  1TK8 A;  3RJE A;  5JTI A;  4BDP A;  1ZRM A;  2YTU A;  4DOC A;  1U48 A;  1S8O A;  3LVV A;  1QSS A;  4ECU A;  1OXJ A;  5AHX A;  3H8S A;  3RH5 A;  4Y2T A;  7ICS A;  3H8J A;  4O5C A;  1QCK A;  1ZOL A;  3MFH A;  4DQS A;  9ICP A;  1LV5 A;  4F4W A;  5AK5 A;  4F50 A;  2PFP A;  8ICN A;  4KMU A;  2G5I B;  3RB0 A;  1A77 A;  4M9G A;  2BCQ A;  2A19 A;  4NL9 A;  5KFW A;  5IIK A;  1ZYQ A;  4DOB A;  2HOF A;  1T3N A;  4C7Y A;  3S6J A;  4NLG A;  2GOL A;  4OD0 A;  5ALL A;  9ICB A;  4ED0 A;  3ETL A;  5AI8 A;  1X9M A;  2CPR A;  4KN7 A;  1MN8 A;  2UVV A;  4QW9 A;  1L3U A;  4F4Y A;  3NS1 A;  5BOL A;  2FMQ A;  1KDH A;  1KL9 A;  3PY8 A;  5KT4 A;  1SV4 A;  2KOB A;  4EYH B;  4UBB A;  1V97 A;  5DB9 A;  1SXD A;  5CA7 A;  4DEZ A;  2N1R A;  7ICR A;  1SIJ A;  2QB0 B;  9ICJ A;  1H38 A;  3GIK A;  3BQ2 A;  4YD1 A;  2AJQ A;  5ALI A;  3LVW A;  1F5S A;  5BPC A;  5ALX A;  4ECV A;  5ALF A;  2V9W A;  1BPD A;  3WK4 A;  1TE2 A;  2M0N A;  1ARO P;  2ZIU B;  5KFU A;  4G9B A;  5AKI A;  2PKE A;  4YR0 A;  2HBK A;  2NRV A;  2RLT A;  2ASJ A;  4F5P A;  3N7S C;  2AXT U;  1OW5 A;  1IM4 A;  3ISD A;  4PHP A;  4E0D A;  4K4I A;  1SL1 A;  4DF4 A;  4HAI A;  1HUO A;  3TAN A;  1PVQ A;  1BVS A;  3K75 D;  4DQI A;  2IOH A;  5AKJ A;  4NY8 A;  4ELV A;  2BCR A;  5C0Y A;  1N56 A;  2K4P A;  1L3S A;  2R8H A;  5KFJ A;  1UQV A;  4QZE A;  2KSO A;  4I2F A;  1QQ7 A;  2KE7 A;  3UXN A;  2E1E A;  7ICJ A;  4UBC A;  5KFI A;  4MF2 A;  3TAC B;  4UAT A;  4NLN A;  2UVR A;  4Q8F A;  4QZG A;  4KLG A;  7ICM A;  2I1Q A;  4ELU A;  3QUQ A;  5J0W A;  1BNP A;  1PUZ A;  5DLG A;  2XCA A;  8ICZ A;  2KIV A;  1CEZ A;  3GIL A;  2Z7J A;  2CXY A;  1DRG A;  3ALR A;  1N5W A;  5KG0 A;  2LMR A;  1SWV A;  4RQ5 A;  4QZC A;  3AMZ A;  2B6G A;  3T3F A;  4QIW F;  2Y0S C;  3GV5 B;  4I2H A;  3KTQ A;  1KQQ A;  3BS5 A;  2JRZ A;  3Q8S B;  5ALN A;  3KZX A;  1ZQV A;  1X9S A;  1Y88 A;  1VJ5 A;  2HDO A;  2BPC A;  1BPX A;  1JRO A;  2A1J B;  5DGA A;  2JH1 A;  3FC4 A;  2DKZ A;  4P4P A;  1ZET A;  5D46 A;  5IIO A;  4YP3 A;  7ICO A;  1D8L A;  4CGZ A;  2LYH A;  1ZQD A;  5CP2 A;  4OJ5 A;  3GU3 A;  2JXJ A;  5AM0 A;  1U45 A;  2VAN A;  5B5E U;  4LJX A;  3UPQ A;  1PK1 A;  3SYZ A;  2ASL A;  3SZ2 A;  4KLJ A;  2W9A A;  4KLD A;  4NLK A;  3H0R B;  3JPR A;  1RM6 C;  4C8K A;  9ICS A;  4F5Q A;  5KFS A;  1S9F A;  3CW2 C;  3WK5 A;  2VKQ A;  1C7Y A;  2K4I A;  4DSE A;  2Y1J A;  3T5H A;  4QJF B;  4YCX A;  2E1F A;  4Z6D A;  1COK A;  2VA3 A;  3QEA Z;  9ICQ A;  4KN4 A;  5J0U A;  2DPI A;  1XNS A;  1L8L A;  3MR5 A;  2KZZ A;  3SEI A;  3KHR A;  2HSZ A;  3WU2 U;  2JZB A;  4Y2Y A;  5L1M A;  4OJP A;  4BWJ A;  1CRX A;  1T8E A;  2I9G A;  5H2F U;  1SZP A;  2K8C B;  3NVZ A;  4IQU A;  2KTQ A;  4KX3 A;  1RDF A;  5KT3 A;  2HHU A;  4KLS A;  3JPP A;  5DB6 A;  8ICL A;  3EW9 A;  3QUT A;  1ZQZ A;  2W8L A;  2K60 A;  4LZG A;  2H5X A;  4F5N A;  1NNL A;  2D3D A;  1L6N A;  2KNJ A;  4IR1 A;  4UB3 A;  3N7P D;  5KL8 B;  1XO1 A;  3QNM A;  3GIJ A;  4GC7 A;  4ED8 A;  3PX6 A;  3KHH A;  1ZD2 P;  1ZQP A;  1URJ A;  1QLN A;  1ZRN A;  1JAL A;  3Q8K A;  3N4M B;  4RPX A;  2EQY A;  2JMG A;  4Q45 A;  4NM1 A;  3QUB A;  9ICE A;  3BQ0 A;  2YB4 A;  4I2D A;  1X9X A;  2JGA A;  4QIW C;  5AKG A;  4R65 A;  2RP5 A;  2W43 A;  4IRK A;  3E0F A;  1NKC A;  3C2L A;  4QNL A;  1ZQJ A;  4O3P A;  2OEH A;  3C2M A;  3HKZ F;  2Y9T A;  4FS1 A;  3LWL A;  3H0M B;  1NK5 A;  1MSW D;  2D8C A;  3WK7 A;  3QU7 A;  3RJI A;  1NJW A;  3IDW A;  4RNN A;  4J9L A;  1P7D A;  3PST A;  1PK1 B;  2FE9 A;  5AI6 A;  5AKY A;  1LKY A;  4J9N A;  3RBD A;  5ALM A;  5ALP A;  1RYS A;  4DL2 A;  2G09 A;  2YX8 A;  4JMU A;  4AYB F;  3F2D A;  3AQE A;  1YZ6 A;  2W54 A;  2OYY A;  4NM2 A;  4UB5 A;  4PL2 A;  4R63 A;  2F1H A;  2J6T A;  2HHQ A;  4UAR A;  1DK3 A;  4O3S A;  2ZIX B;  3ISC A;  4OJL A;  3BJY A;  4F3O A;  2YB1 A;  4BXO A;  3HX0 A;  2ZIV A;  4R66 A;  4QWC A;  1L5U A;  4FBU A;  4Y2P A;  3WKB A;  2G07 A;  3EPI A;  2AH5 A;  4U6P A;  2JZB B;  2Q0Z X;  2ZXI A;  3D6J A;  4ED6 A;  2WTF A;  3Q8L A;  2BQR A;  1HJP A;  3PX0 A;  4OJO A;  3SV3 A;  4MFC A;  4NV0 A;  1HIW A;  3UMG A;  4QZD A;  5KFL A;  2LM4 A;  4I2G A;  8ICC A;  5DBB A;  3ZDC A;  8ICY A;  1BPZ A;  4Y2R A;  4RQN A;  4M6W B;  2YY6 A;  4FZN A;  2KFN A;  9ICK A;  2W9B A;  3N97 B;  4RQ3 A;  2RQ5 A;  2ZTC A;  1XSP A;  3TAQ A;  5ALU A;  1JX4 A;  3TAD C;  1ECW A;  2DL0 A;  4UAZ A;  1D9F A;  3ORY A;  4YXM A;  4QZ9 A;  2F1I A;  2W3S A;  4O5K A;  4F4Z A;  3KOO A;  4A8E A;  4J9R A;  5J0T A;  3RJJ A;  5DLF A;  5IIN A;  4I2B A;  7ICF A;  1FFU A;  1JXE A;  2YMQ A;  3T5K A;  2HBL A;  4YR2 A;  3CRX A;  3EPG A;  3NRZ A;  4I2J A;  2KMD A;  2I5H A;  1QH9 A;  4IC9 A;  2FMS A;  8ICJ A;  5F9N A;  2IHN A;  5KT2 A;  4KLL A;  3NUQ A;  5J2D A;  1NK4 A;  5AM1 A;  5DQH A;  2MUT B;  4B9V A;  3M8S A;  3PVX A;  4B6J A;  5HR6 A;  3TAD A;  4RPY A;  1KN5 A;  5L1K A;  3NVY A;  1LKY B;  1Z1V A;  4XA5 A;  4EEN A;  3ZI4 A;  4BWM A;  4Z6F A;  3JPT A;  3M9O B;  4BX9 C;  3C29 A;  4DL4 A;  4K4H A;  1JI7 A;  3C2K A;  4IRC A;  3OGU A;  3B9J A;  2QLT A;  3FYH A;  5KFT A;  1ZQC A;  4DFJ A;  3RB6 A;  1M6Y A;  1IXR A;  5EE3 A;  1D8B A;  3WKD A;  4RQ0 A;  3QE9 Y;  4GFJ A;  1WG8 A;  2ZIV B;  1X6I A;  3D2S A;  1TFR A;  2J6S A;  3AM9 A;  2ZIU A;  3UQ0 A;  4RT2 A;  2XY5 A;  1ZJM A;  1QSY A;  4IQW A;  3HRD D;  1ED1 A;  4F91 B;  3PX4 A;  4GXI A;  3Q8P B;  2DFL A;  2GO7 A;  5KFX A;  1QQ6 A;  3G6X A;  2HOQ A;  3WKC A;  1KKX A;  2R8J A;  2XGP A;  5AKH A;  2JEG A;  4M9J A;  4I2E A;  4KLM A;  3F2C A;  1XSN A;  2ZJA A;  2WB1 F;  5KG6 A;  1Q3U A;  5J0X A;  5CJ7 A;  5F9L A;  4IS7 A;  3MR3 A;  4NWI A;  1ZQW A;  1A0P A;  2C28 A;  2F77 X; 
#chains in the Genus database with same CATH homology
 1TAM A;  3PSI A;  2VIX A;  2G09 A;  2W04 A;  2H3Z A;  2HOF A;  2RRD A;  2K8B B;  3MGV A;  4U7C A;  3IP4 B;  3O0F A;  3PSF A;  1Q3V A;  2YX8 A;  2A3V A;  4JMU A;  2GOL A;  2MRL A;  4AYB F;  1XNS A;  3F2D A;  3AQE A;  3GZF A;  3NUQ A;  2CRX A;  4C0Z A;  2LYA A;  2WAQ F;  2KHQ A;  2OYY A;  1HEK A;  4KMO B;  2JH7 A;  4OJP A;  3VC8 A;  3SAG A;  3F5A A;  2CPR A;  2H3F A;  1CRX A;  4P0P A;  5HR7 A;  2JHD A;  3IG8 A;  4PL2 A;  3F2B A;  3L3F X;  2CN1 A;  2HMX A;  2Q4T A;  1ZQ1 C;  3ONN A;  5HR6 A;  5T14 A;  2H3I A;  2F76 X;  2RHF A;  2K8C B;  2Z7J A;  2ZIX B;  4OJL A;  2LYB A;  3ALR A;  1DRG A;  4NLC A;  4NLB A;  2YB1 A;  3OPX A;  4KX3 A;  2KVC A;  2ZIX A;  3SQI A;  2K4E A;  2ZIV A;  4FZM A;  2WB1 C;  2LKY A;  4BX9 C;  3C29 A;  2KOB A;  3DEE A;  4QIW F;  2Y0S C;  3VCB A;  2H3V A;  3NRW A;  2G0A A;  4CRX A;  2G07 A;  3T79 A;  4BJQ A;  4U6P A;  2OM6 A;  2MA1 A;  1WUD A;  3IG5 A;  1XO0 A;  5CRX A;  1NZB A;  2ZXI A;  2N1R A;  2LBO A;  2R18 A;  2KKP A;  4P0P B;  3F5E A;  2G06 A;  2ZIW A;  4CDG A;  1L6N A;  2KNJ A;  2K89 A;  4FE3 A;  4WJ3 B;  2PMZ F;  2LHT A;  2E5S A;  3CP8 A;  3N7P D;  1PVR A;  5KL8 B;  3IN5 A;  3KZX A;  1D8B A;  4OJO A;  1UPH A;  3LVW A;  3RF9 A;  4OJ6 A;  4NV0 A;  2KEY A;  4GFJ A;  3RFA A;  5KL1 B;  1PVP A;  1HIW A;  3M6K A;  4PL1 A;  3CYM A;  2ZIV B;  3H0L B;  3D2S A;  2JH1 A;  2K8A A;  1URJ A;  1SZH A;  3PSP A;  2KD1 A;  3PZP A;  3SAF A;  2M0N A;  2ZG6 A;  2ZIU B;  2Y0S F;  2KKV A;  3HKZ C;  2W7P A;  2HOI A;  2D6F C;  3AL0 B;  2GH1 A;  2ZIU A;  4CGZ A;  1F44 A;  2W03 A;  2JMG A;  2KHV A;  2HBK A;  4FZN A;  2ZIW B;  3M6Z A;  4OJ5 A;  1ED1 A;  2KJ5 A;  2HBM A;  1OUQ A;  2YB4 A;  2DQN B;  3GU3 A;  3N7S C;  1A6S A;  2OXO A;  2NV3 A;  3C28 A;  2HOQ A;  2ZXH A;  1IIP A;  2DGZ A;  2JGA A;  1ECW A;  2KJ9 A;  2KV2 A;  4QIW C;  2RP5 A;  3F53 A;  1PVQ A;  3K1Z A;  2HBJ A;  1YT3 A;  1T94 A;  1KBU A;  3LVV A;  3E0F A;  4ICA A;  2KJ8 A;  2G08 A;  3AQF A;  3F2C A;  5A0L A;  4AYB C;  2BDU A;  2DF4 B;  4QNL A;  2XID A;  3H0R B;  2WB1 F;  2WAQ C;  1MA7 A;  2KIW A;  4BUG A;  2F8L A;  4O3M A;  2KIC A;  5C0Y A;  3D2Q A;  4A8E A;  1GO3 F;  3N7R C;  3HKZ F;  1Q3U A;  4OO1 J;  2VJ5 A;  2G5H B;  2PMZ C;  3D2N A;  3H0M B;  3KFU F;  2H3Q A;  4ACO A;  3SAH A;  2VKQ A;  3SMV A;  3ICX A;  2K4H A;  2HBL A;  2XI9 A;  2K4I A;  4KX5 A;  4P0Q B;  2E1E A;  4FZL A;  2G5I B;  1Z1B A;  4NWI A;  1A0P A;  3CRX A;  4QJF B;  2F2A B;  4P0Q A;  1P7D A;  3PST A;  2E1F A;  2XVT A;  2W7O A;  1Z19 A;  3M7D A;  2VJ4 A;  4IC9 A;  2OH2 A;  3LYS A;  2XIC A;  2F77 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...