3D2NA

Crystal structure of mbnl1 tandem zinc finger 1 and 2 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
b'TKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muscleblind-like protein 1
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, rna binding protein
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2nA00
3D2SA 3D2NA 3D2QA 2E5SA
chains in the Genus database with same CATH superfamily
2PI5A 2XGPA 5AKYA 2BHNA 3HKZC 2KE7A 3N28A 4UAZA 4M9JA 2WFAA 5L1LA 3TADC 4QZ9A 1XWLA 5AKXA 1N60A 9ICIA 4P0QA 5DG9A 1X9SA 1S8OA 2NV3A 4C8LA 4TUQA 4OJLA 2CPRA 1L5UA 1N2XA 2H3QA 4DFJA 4F91B 2AGPA 2LKYA 4MFCA 2FPMA 3GU3A 3Q8PB 4US8A 5DQIA 1NJWA 5IILA 4MFAA 1SZPA 3C5FA 3PW0A 3LK9A 4YD2A 2ZG6A 4X5VA 2J6SA 3H8MA 4PGQA 4UB6U 4YN4A 1KN5A 2DGZA 9ICMA 5CB1A 4I2IA 2W9AA 4RNMA 1T3QA 5DDYA 4PHDA 2JHDA 2G06A 4YXMA 1SKSA 2KVCA 5GTHU 1D9DA 3AQFA 1MN8A 2RLTA 4Y2JA 3ONNA 3O0FA 4KLUA 3MR5A 2IBKA 3NVWA 2JGAA 4ACOA 3QZ8A 5ALOA 2A1JA 1ZQVA 2F44A 8ICJA 3TQ1A 4QZHA 1S0MA 1BVSA 3IM1A 3E2EA 3F5AA 4O5CA 2B0CA 3QU2A 1SGGA 5E79U 8ICAA 2HDOA 1ZQUA 2C2EA 2XY5A 4UQGA 2D6FC 3SI8A 2F76X 1UHUA 5AM1A 4NM1A 1DOQA 1QSSA 4I2EA 2ZTEA 3GIMA 3RJHA 1XNSA 3RJFA 1O08A 4DCCA 4Q43A 4P0PA 2ISPA 3CYMA 1SV4A 2N1RA 4Y2SA 2KNJA 7ICPA 4F71A 4DSLA 3M6KA 4NJ8A 4JV1A 3T5KA 3WKDA 2WF6A 2BKEA 5IIIA 1IIPA 4UB2A 4G3IA 2F2AB 4RT3A 5J0WA 4GXIA 2ASJA 4O3OA 1RM6C 5KG7A 4K4HA 2LYBA 1ZQXA 1NKCA 3HX0A 4F5OA 1Z4NA 1ZQDA 2KD1A 4ICAA 1ZD2P 3C5GA 1KFDA 9ICJA 3ZD9A 4ECTA 3UQ0A 4J03A 2NRXA 5AKHA 2ZJAA 2M0NA 2ISOA 3MR2A 1KKXA 2EZXA 1NK8A 5KG6A 3BQTA 4FZNA 2ATLA 3FYHA 1L7NA 4USAA 4F4KA 4HYKA 2RDJA 3C2KA 4ECXA 2QB1A 3C23A 1J2NA 3LDAA 2LPEA 4CNQA 7ICQA 7ICGA 5J2EA 1U4BA 1ZQLA 2E3TA 8ICKA 4NL9A 1YZ7A 3C1ZA 3HPOA 2KFZA 2KVSA 5EE0A 4F93B 2PKEA 2ZTDA 4PHEA 5AKGA 3MDAA 2FJ6A 3G6YA 3VCBA 3LVVA 4U6PA 1B43A 4RZRA 7ICMA 3H0RB 4TQSA 2HBJA 4F72A 3EW9A 4K4IA 1BPDA 1UA1A 3M9MB 1DK3A 3PO4A 2OEHA 5KAIU 4RNOA 5J8YC 4OCZA 3M8RA 5AM2A 2F77X 2KJ8A 5ALGA 2KICA 2BCSA 4QZGA 5AKZA 1ZD5A 9ICSA 3RBDA 8ICMA 5ALUA 2IOFA 2JH1A 1NKBA 4GFJA 4EX7A 3L4PA 3QEBZ 4KTQA 3IG5A 5AM4A 2Y9TA 3ETLA 3C29A 9ICCA 4BUGA 4RNNA 1T94A 4YMMA 5B66U 2B6GA 5AM5A 1T4GA 4O3NA 5J2HA 4CF4A 3GV8B 5EWFA 4JK1A 3OJUA 3RJEA 3PSFA 5KFYA 2ES6A 5AIBA 4RQ2A 4KLHA 2PFPA 4J9SA 4KLFA 1U47A 5ALSA 8ICGA 4EELA 4AYBF 4CE6A 4UARA 2LYAA 8ICIA 3ISBA 5ALJA 4ED8A 4QW9A 3GDXA 3ISCA 5JU5A 3PNCA 3QU7A 1AROP 5KAFU 4QZBA 7ICSA 1Z00B 2YB4A 3QUBA 2ZIXA 2XICA 5KFVA 4YR0A 1SL0A 3H40A 3C2LA 5DQHA 2R8GA 2NRTA 3LWMA 1J97A 5AK5A 3T5LA 4M6WB 3F5EA 3NRZA 5C0YA 1S77D 1ZXIA 5EOZA 3UXOA 4CF5A 2HOIA 3V6KA 1UPHA 2B21A 3PSPA 3RTVA 3NTUA 2HHVA 1WYGA 3V72A 4ECUA 1N62A 4PJ0U 2NRZA 2VIXA 3D2SA 3G6XA 1PK1A 2DQNB 4I2CA 4US9A 4F5PA 3UMGA 1N61A 4IC9A 1PUZA 3ZI4A 3AEVA 5L1MA 2Y1IA 1L3VA 9ICGA 2XO7A 4O3RA 2AXTU 1L7MA 3SAHA 3RJJA 1X2IA 3BQ7A 2LM1A 4I2GA 3SYZA 2DF4B 3K1ZA 2BPFA 4I29A 1N63A 4DOCA 3GFKB 1SWVA 2PMZC 5ALLA 3RAQA 3DEEA 3TADA 4EENA 2G5HB 2IOHA 1F0MA 9ICRA 3CRXA 4UAYA 1Z1BA 5DQGA 3L5KA 2H5XA 1S97A 3MDCA 5HR6A 1GO3F 1F5SA 3EWAA 1KFTA 4WJ3B 3RB4A 5D49A 1MQ3A 9ICLA 3B0YA 4DSKA 3V7KA 2H3IA 4YD1A 4I28A 2HHUA 2DFLA 2ZIWB 2KTQA 4M47A 4NLGA 3D2QA 1PK3A 3OSPA 2MUTB 4OJ6A 3C1YA 1ZOLA 2W8KA 4KLGA 5AK3A 2VKQA 1WWVA 9ICHA 4FZMA 4DQSA 3HILA 1SKWA 1ZD4A 3LWLA 4F4WA 3H4DA 4ED1A 5AK4A 2D8CA 3QUTA 2XIDA 1KW4A 1JROA 2JH7A 3RH5A 4DSJA 7ICIA 2FPLA 2V4RA 3A0BU 5AKIA 5IIKA 5EWEA 7ICFA 4ECRA 2OYYA 4KX5A 3MR3A 1NZBA 1ZQOA 1KFSA 4B9MA 3OPXA 4DS5A 2V4QA 4ED7A 4J9QA 1ZJMA 8ICRA 3M7DA 3ZDAA 3WKBA 4QW8A 2YMQA 5JRTA 1DRGA 2HHSA 2OWOA 5D46A 3MBYA 1ZQAA 4R63A 1ZRMA 4KLIA 1MA7A 4NLKA 9ICFA 4M9GA 2FLNA 2YMLA 3RB6A 1ZD3A 4RT2A 2DKZA 4M04A 4DSIA 4F2RA 5DB7A 1B4FA 2FLLA 2W3RA 1KEJA 3QUQA 4LJXA 4RQ4A 1V85A 3KFUF 2W9CA 2KZ3A 3SD7A 4DFDA 4Z6FA 9ICKA 3AUOA 4PHPA 4Z6EA 2G09A 3KBBA 2WF8A 5ALRA 3QNMA 3I1YA 3KTQA 2JZBB 4FS2A 2K60A 3SQIA 4JWNA 2AJQA 1TK0A 4Y2PA 4BGDA 2EQYA 9ICWA 3UMBA 3GV7B 2KG5A 5KFIA 2Q4TA 3WKEA 4DEZA 2H3FA 4DFKA 2PMZF 4JMUA 7ICKA 2H3VA 5AI6A 5DB6A 1L8OA 4ED0A 2IA6A 4KN7A 5KFWA 1Z19A 3ED5A 1NK5A 1S10A 3CW2C 4U7CA 1L3TA 3ZDDA 3THVA 2C22A 1X40A 1KDHA 5TZVA 3H7IA 2JXJA 4XRHA 3QEAZ 2LHTA 3AU2A 4DSFA 1DGJA 4G9BA 3TARA 4I2FA 3G6VA 2WF5A 2XC9A 4J9RA 4RUAA 4NY8A 2VA3A 3ZD8A 2BQUA 1ZYQA 3BQ0A 5KT4A 1LVHA 5KFFA 1IG6A 1D8BA 2C2DA 1U49A 3H8JA 3GIKA 2Q0ZX 4BXOB 1RXWA 2DWQA 1XU4A 3BZKA 4B6JA 1QQ7A 5J8YA 4KMUA 1NK0A 1L7OA 5KG2A 4R8UA 1BNPA 4DWIA 7ICVA 1HIWA 2W9BA 4GC6A 2IHMA 5DBAA 1WG8A 3KZIU 4YR3A 2YTUA 2K8CB 5AIAA 4BDPA 1B0XA 2KEYA 2KSOB 2JRZA 5AK6A 5KFBA 9ICAA 5KFLA 4IRKA 5KFTA 5HNKA 5DLFA 1D8YA 3PY8A 2VA2A 3PO5A 3RJIA 2FMQA 2FE9A 3NS1A 2LBOA 4IQWA 5FP0A 4C8OA 4BWMA 1F44A 2KHQA 3MABA 5J0PA 4BJQA 9ICUA 5D4BA 8ICPA 1CI4A 5L1KA 1NJYA 4O3PA 4ECSA 1WWUA 3TFSA 4C7ZA 3M6ZA 3AMZA 4UBBA 4YFKA 2KIWA 2ZXIA 4YMNA 2RRDA 5KTQA 1RPLA 2R8IA 1UA0A 3K75D 1K5OA 1J2MA 5KFUA 4OJOA 2WF7A 3U26A 3A0HU 5JTIA 3RF9A 2E8PA 2A3VA 1JN3A 3I76A 2NRWA 1TKDA 1YZ6A 1SIJA 2W7OA 2KJ5A 4J9LA 3D2NA 4DFMA 4NLNA 1NK6A 5AM0A 4MEXA 3UXNA 2ZUBA 2ZIUA 5KNIA 1FO4A 4PGXA 4FZLA 4YP3A 9ICPA 4KLSA 1ZQQA 1UCVA 4UATA 4IRDA 2C2RA 1DGSA 4AP9A 2AQ0A 1S5LU 2DPIA 3E0FA 5AI0A 9ICQA 1UT5A 2PFNA 4B9TA 2KN7A 1JALA 1L3SA 4Y2XA 4B9VA 4DL3A 5J2IA 4QWAA 8ICEA 2HHXA 8ICLA 3NGDA 3PV8A 3RB0A 5ALIA 2WHEA 4RQ1A 5KL8B 5AM3A 2E1EA 5B5EU 4UB8U 3HKZF 5KG3A 2ESEA 3PW4A 5KG5A 5KFNA 2EH9A 1RDFA 1T7PA 1URJA 2G08A 3QU9A 1HJPA 2CN1A 4C8NA 4PGYA 4ED6A 1ZQIA 4XQ8A 5BOMA 3PVXA 3MFHA 1X9MA 3S6JA 1CEZA 3PX0A 3KKAC 1K1SA 2DBYA 4KLTA 2F8KA 3JPTA 1NNLA 2XGQA 1Q46A 3OGUA 2OHFA 5J2CA 2OM6A 4M6WA 5KT5A 1MSWD 2KKVA 3F2CA 3WK7A 5JUMA 8ICBA 2PI4A 4PZNA 8ICTA 5K4LA 8ICWA 4GXKA 4KLDA 2KJ9A 2QB0B 4HAIA 4RQ5A 2E5SA 3OHBA 9ICOA 1JRPA 3OTQA 1FFUA 2EANA 2BCQA 1ZQTA 3V6JA 4PH5A 2UVUA 1QLNA 2L5YA 2I6XA 4P4PA 3OSNA 1T8EA 1PVPA 7ICLA 4P0PB 2IHNA 2K8BB 2E8NA 4RUCA 4QIWC 1Z4OA 5HHHA 1JXLA 3BDPA 3GIIA 1L6NA 1BPEA 4Y2RA 2FMSA 2HMXA 2J6UA 4DLGA 1DXSA 2R18A 5ALVA 1NOMA 4F5QA 3SZ2A 4ELUA 2W04A 4EZ6A 1ZQYA 2PXIA 2E8MA 1PZNA 3L3FX 1TK8A 4IR1A 5KFZA 2BCUA 1TFRA 3V7JA 1BPBA 1ZQHA 5DG8A 4FE3A 2W43A 3PW5A 5DB9A 4ECYA 5AKKA 3AL0B 2Z7JA 2ZIWA 5AI4A 5G5HA 1SXDA 2HOQA 1KSPA 5EWGA 2LYHA 3UMCA 2XY6A 1RYUA 5ALNA 4R66A 3BS5B 3WK5A 1SL2A 4MHVA 2GWSA 4I2HA 3QXGA 4FS1A 2ASDA 4OJPA 3ZDBA 3ZDCA 1U48A 5BOLA 3H8SA 1NI3A 1K1QA 3HWTA 3WK4A 5J0RA 1ZQBA 5ALEA 5T14A 1XSPA 3I28A 1RQLA 3PW7A 2VA8A 4DS4A 4QWDA 1UQVA 2G0AA 4UAUA 5L9XA 3T5HA 5AKLA 1LKYB 4B9SA 5TISU 1JXEA 2O6KA 2CRXA 5KG4A 1S0NA 4EBCA 3TAQA 7ICOA 3KZXA 5AHXA 4NLCA 4DF4A 1BPYA 1O03A 2W8LA 1S9FA 2R8HA 4MF2A 1A6SA 2KOBA 5CR0A 3BQ1A 2UVWA 5J2BA 1JX4A 2W9MA 1BGXT 1X42A 4QJFB 5EE1A 4TURA 1N48A 5IIMA 3DDHA 4TUSA 5F3XB 3MGIA 3E58A 1QQ5A 2F8LA 4O3SA 3PSTA 3IN5A 4C80A 4PPXA 2KHVA 2HSZA 3NASA 4LVSA 4QIWF 3K4GA 4Z6CA 2QARB 5CHGA 5L1IA 1FIQA 5EE9A 2JZBA 4RQ8A 1SV0C 1RZTA 3IP4B 4GC7A 3WK9A 1A77A 2MAXA 5C5JA 2Y1JA 2BR0A 2ZIXB 3QUCA 4IQTA 1UT8A 2KK0A 5KL1B 3MR6A 2FMPA 2I9GA 3H8WA 2NYVA 3TANA 1JIHA 3CP8A 1ED1A 4KN4A 2UVVA 2YB1A 2AHOB 4IQUA 5HMLA 4FFDA 2WB1C 4C8KA 2BGWA 2JEJA 4ECWA 4KLLA 3MGVA 3AN1A 1CUKA 4Y2UA 4PHAA 4MFFA 1WCNA 3F53A 2ZTCA 2EAOA 1X6JA 2HOFA 3HJEA 2BCVA 3NVVA 2BPGA 5J0UA 5KFRA 4OO1J 4ZH4A 3IG8A 1RQNA 3H0MB 1QTMA 2AU0A 3AU6A 2F1IA 5CEHA 3F2DA 1ZJNA 2VJ4A 3Q8KA 5CWRA 4ECVA 4ZOHC 2NO4A 3FDSA 1QQ6A 2F1JA 4BXOA 2Y0SC 2KP7A 3HW8A 3QU4A 5KFKA 4IRCA 5KG1A 5DGAA 4LZGA 3PX6A 1ZETA 1RXVA 4F4XA 3JPPA 1XSLA 5AKJA 5KT3A 3SV3A 8ICCA 3Q8QB 1NK7A 2MU2A 3PMLA 8ICYA 8ICVA 3JPRA 2GH1A 5ALHA 4QZFA 3C21A 1X9XA 2GO7A 2KZZA 4C4TA 1JUDA 2P35A 3VC8A 4J9NA 3RRGA 2CXYA 2K8AA 4JV2A 3V6HA 2KZMA 3V7LA 3QX7A 4IS7A 5DLGA 1L3UA 2EDUA 4EYHB 3C2MA 3OJSA 3N7RC 1N56A 3KKAA 5HR7A 5AICA 9ICXA 2ASLA 3OHAA 4NLBA 2HW3A 2ZUCA 3HT3A 4I2JA 7ICJA 4CCHA 2AGOA 3BS7A 1C20A 2RP5A 3QZ7A 2DUYA 3Q8LA 5F9LA 4EYIB 1HUOA 1NKEA 2EZZA 5KFQA 4O9MA 1KL9A 3ORYA 2BCRA 1Q3VA 1IXRA 1VJ5A 3KOOA 4M2YA 4DO9A 8ICNA 3D6JA 4NM2A 4YCXA 3RBEA 4FBUA 1VDVA 4ED2A 1NK9A 5A0LA 4RQ0A 2RHFA 4PZOA 2WB1F 3M8SA 3K1RB 3T5JA 2JEGA 1QSLA 4QWEA 3SV4A 5KFJA 2FI1A 3TAPA 2XI9A 2ALZA 1KRPA 1SZHA 3MC1A 5J0OA 3H4BA 2HBMA 4RQ7A 4Y2TA 1OUQA 5F9NA 1ZQFA 7ICUA 4O5KA 2W9CB 4QZAA 3PZPA 1Q3UA 1IM4A 1Z1VA 4RPYA 9ICNA 5J2KA 4KX3A 1COKA 4EEYA 4Q8EA 4DL2A 2P6UA 2P6RA 4YG2A 4UASA 4YQWA 5DGBA 1HUZA 3N7SC 2HVIA 2F3NA 4M9NA 1PVRA 2Y0SF 3WK8A 2OH2A 4KITB 5DKWA 3KD3A 1SWWA 3CNHA 4QZEA 3NVZA 4Y2QA 4BWJA 4EX6A 5GTIU 1NJXA 3SEIA 3Q8SB 2YY6A 4DFPA 4C7YA 4Z6DA 1ZQKA 7ICNA 4QZ8A 8ICHA 4JUZA 3EZ5A 2WTFA 2QB0A 3N4MB 1RG6A 2I5HA 4F4ZA 5ALKA 1V9PA 1T3NA 5KFCA 1FFVA 3BZCA 3M9OB 2H3ZA 3QE9Y 2ZIVB 8ICOA 2K4PA 4TQRA 3GQCA 5AKEA 4UAVA 5AI9A 4CGZA 5KFGA 8ICXA 2JEFA 2LM4A 1QCKA 4AYBC 2LI6A 2I1QA 4JB3A 2EAMA 4A8EA 3B9JA 3TFRA 9ICBA 5EE3A 4P0QB 4PL2A 1HEKA 5IINA 2FDRA 3JPOA 4F4YA 1Q8KA 1QH9A 4DQQA 2BDPA 4JV0A 3J81j 4R8UB 5DDMA 2KV2A 1S76D 1TAQA 3IV6A 1H38A 1DK2A 5KFMA 2W9BB 4CF3A 1C7YA 5KFAA 1B22A 1XSNA 3ISDA 9ICEA 5HMMA 5DB8A 4LZDA 3PSIA 5KT6A 4RQ3A 1TAUA 3SENA 3RR8A 5ALFA 2K4EA 1Z00A 4Y2VA 4EEKA 5J29A 5DG7A 2IOFK 2JEIA 2AH5A 2OXOA 3AM9A 5J2FA 2VJ5A 3GILA 2PFQA 1D9FA 2BDUA 5CA7A 4ED3A 5ALZA 4B9LA 3KHGA 1SV0A 2A1JB 3BS5A 2BQRA 2RQ5A 3KHRA 1X66A 2AGQA 1ZRNA 2G07A 3EPIA 3T79A 3RJKA 8ICFA 4O0IA 3RH4A 1RYSA 4TUPA 1ZQCA 8ICSA 2ZJ8A 1ECWA 3UPQA 2RDIA 4YVZA 4P4OA 4NXZA 5ALMA 4KLMA 5G5GA 3ICXA 2W3SA 1KQQA 1BPXA 1CRXA 2YMMA 1KTQA 2W11A 4DL5A 4I2AA 1LKYA 4EBEA 3R9KA 2QLTA 2KFNA 1X6IA 2MA1A 4F2SA 5KFPA 4C0ZA 2HVHA 3RJGA 4DSEA 2HHQA 2HBKA 2W03A 2DKXA 2Y9UA 2ZIUB 4C8MA 3SR6A 5BPCA 3C28A 2K4IA 5ALPA 2LMRA 4GXJA 1L8LA 3LVWA 5CP2A 5J2JA 1V38A 4DQPA 5KFEA 4YR2A 1IV8A 1ZQPA 4EZ9A 4NV0A 2EZYA 3UXPA 4I2BA 5ALYA 2R8KA 1M6YA 2BQ3A 2XCAA 2ODGA 4Q45A 4IQVA 5KT2A 4Y2YA 3WK6A 2QKQA 3QU5A 4KMOB 3HRDD 5J2GA 5ALTA 2MSNA 7ICEA 2J6TA 2XCPA 4M9LA 4O3QA 2FLPA 2BZFA 1V97A 2QARA 2JR5A 5HHIA 2MUTA 4QNLA 4KLOA 2C28A 4UB3A 4J9KA 3QYPA 3JPSA 5J0SA 1TAMA 4K4GA 1EXNA 4QZIA 1NZPA 3NRWA 3PR5B 3RR7A 2IMWP 4DF8A 4CRXA 2YQEA 4NWIA 4RQNA 4UB5A 4Q8FA 7ICHA 2PFOA 1ZQGA 1VLBA 4B9UA 2G5IB 2D3DA 1SXEA 1ZQZA 2ZXHA 2M9NA 4ECQA 2AQ4A 4UB1A 3LYSA 4F5NA 4B9NA 2R8JA 1Z3EB 2MRLA 3RRHA 1XO1A 2HHWA 3JPQA 1LB2B 3ZDEA 4O3MA 2XY7A 3RFAA 4F8RA 3KHLA 2WAQC 4QWBA 5J0XA 4F92B 4J9OA 3RAXA 5CRXA 3F2BA 1FEZA 1ZQRA 3FM9A 4R65A 2JV3A 4EBDA 3Q8MA 4DOBA 5KT7A 4KLEA 1LV5A 4UAWA 5DBBA 4UBCA 1ZQWA 1ZQJA 4DL6A 4FBTA 2YMPA 3PX4A 1BNOA 4DL7A 1TVAA 4QZCA 4DLEA 2HCFA 2E8OA 5KFDA 4RPXA 4RU9A 1TK5A 1JI7A 4MEYA 4O5EA 3TI0A 4GLXA 1A0PA 1ZQSA 3PR4A 4I27A 4C4RA 3HP6A 3RB3A 7ICRA 1XC9A 1BPZA 1RYRA 2KMDA 2GLEA 5KG0A 1ZQEA 3UM9A 3NUQA 5J0TA 2YN4A 1ZQ1C 9ICTA 4Q44A 3JPNA 1N5XA 4GIBA 4DL4A 5AI5A 8ICZA 1COOA 5CJ7A 1YT3A 4RPZA 4NL9C 4OD0A 1NJZA 1QSYA 2KIVA 4E0DA 3RH6A 2EAPA 4YMOA 5DBCA 2F1HA 5ALDA 4DOAA 3M1YA 4OJ5A 3AQEA 8ICQA 2DPJA 9ICVA 3IDWA 4ELTA 3ALRA 1KLNA 3IRUA 5ALQA 4QWCA 1P7DA 5L1JA 2VANA 1N5WA 3EYZA 1JMSA 3MGHA 4DQRA 3DV9A 4XA5A 4ECZA 1U9LA 1SL1A 2ZUDA 1PK1B 3Q8RB 4F50A 4IR9A 3N7PD 4UB4A 1SKRA 1X9WA 3BJYA 2A1AA 4CDGA 5KFSA 5ALWA 2V9WA 2K4HA 5H2FU 2ZJ5A 3SAFA 2HI0A 3H0LB 4P4MA 5KFHA 3WU2U 2XVTA 3FAHA 3B0XA 1KBUA 3FC4A 3GV5B 1MQ2A 3IHQB 3MFIA 4JWMA 1S0VA 1NK4A 3PMNA 3KHHA 5J0QA 1U45A 2K89A 5HP4A 2UVRA 1Y88A 4F5RA 4NLZA 2HHTA 5J2DA 3EUB2 2W55A 1XO0A 5J0YA 4RQMA 4C4SA 4I2DA 2KSOA 1OXJA 5KFXA 1SB3C 3ETRA 5J2AA 4R64A 1OW5A 1TV9A 3SMVA 2WAQF 3NVYA 3UQ2A 2E1FA 2GOLA 8ICUA 2W54A 3M9NB 1ZQMA 3BQ2A 4DQIA 7ICTA 4XUSA 1TE2A 2OCEA 1MC8A 3TACB 2HBLA 4BX9C 1S0OA 3WKCA 4MF8A 4J9PA 2KKPA 4KLQA 4RQ6A 2JMGA 4YXJA 1WCLA 2BPCA 2P66A 4M0AA 4PL1A 1L7PA 4UW9A 1D8LA 4M9HA 3PW2A 4KLJA 3WKAA 3N97B 5KFOA 4F3OA 5ALXA 5IIOA 2WF9A 4FO6A 2FPKA 4J9MA 1A76A 3GZFA 3TKAA 2YX8A 1PVQA 2NO5A 5IIJA 2A19A 3EPGA 4IL6U 4P2HA 3GIJA 3SAGA 3T3FA 2DL0A 4QZDA 1XS9D 4ELVA 2NRVA 5AI8A 1ZQNA 2ZIVA 1WUDA 1AQ6A 2W7PA
chains in the Genus database with same CATH topology
1OUQA 2Z7JA 2ZIWA 3H0RB 3M6ZA 4NV0A 2HBJA 1Z19A 2VIXA 3D2SA 2KIWA 3HKZC 3PZPA 4U7CA 2GH1A 3IP4B 1Q3UA 4P0PA 2DQNB 3CYMA 2N1RA 2KNJA 2ZXIA 2HOQA 2RRDA 2OM6A 3M6KA 4KX3A 2KKVA 2OYYA 2ZIXB 3F2CA 2K89A 4KX5A 1NZBA 4IC9A 3PSIA 5KL1B 2F77X 2KJ8A 3VC8A 2LHTA 3OPXA 2KICA 4P0QA 2K8AA 4OJOA 1IIPA 2K4EA 2NV3A 4KMOB 3AL0B 3N7SC 2KJ9A 1XO0A 4OJPA 2JH1A 2F2AB 3M7DA 4GFJA 1PVRA 2Y0SF 3RF9A 4OJLA 2OH2A 2CPRA 1A0PA 2H3QA 3CP8A 1ED1A 3IG5A 2E5SA 2YB1A 3SAHA 2OXOA 1DRGA 3C29A 2A3VA 2VJ5A 2LYBA 2WB1C 3SMVA 3N7RC 2WAQF 4QNLA 4BUGA 2LKYA 5T14A 1D8BA 2BDUA 5HR7A 1T94A 2E1FA 2GOLA 3NUQA 1MA7A 1ZQ1C 1TAMA 3MGVA 2DF4B 3GU3A 3K1ZA 2W7OA 2KJ5A 2KD1A 2G0AA 3D2NA 4ICAA 4NLBA 3PSFA 2ZG6A 2HBLA 1YT3A 2G07A 2PMZC 2ZIUA 3F53A 3NRWA 4BX9C 3T79A 2DGZA 3DEEA 2HOFA 2W7PA 2KKPA 4CRXA 2G5HB 4FZLA 1PVPA 2RP5A 4NWIA 4P0PB 2K8BB 4QIWC 3CRXA 2JHDA 4AYBF 2G06A 2JMGA 4OO1J 2LYAA 1Z1BA 1ECWA 2CRXA 2KVCA 4OJ5A 2D6FC 2HOIA 1L6NA 3IG8A 3KFUF 3H0MB 3AQEA 2M0NA 4PL1A 3E0FA 1GO3F 5HR6A 3AQFA 1HIWA 3KZXA 3ICXA 1Q3VA 3ONNA 4WJ3B 3ALRA 2G5IB 3F2DA 2HMXA 3O0FA 4NLCA 4FZNA 2ZXHA 2YB4A 1P7DA 2H3ZA 2JGAA 2R18A 2VJ4A 4ACOA 2G09A 1A6SA 2K8CB 2ZIVB 2ZIXA 2KOBA 2KEYA 2XICA 1CRXA 3LYSA 2H3IA 2ZIWB 5KL8B 4CGZA 2W04A 2MRLA 3GZFA 3D2QA 5A0LA 3SQIA 2RHFA 2YX8A 4OJ6A 2Y0SC 2E1EA 2MA1A 3F5AA 3N7PD 4AYBC 3HKZF 1PVQA 2WB1F 2VKQA 3L3FX 4QJFB 4C0ZA 4A8EA 4O3MA 4CDGA 1URJA 3RFAA 3F5EA 2LBOA 5C0YA 2G08A 2WAQC 2K4HA 4FZMA 2CN1A 2XI9A 1F44A 4P0QB 2HBKA 2W03A 3SAFA 2KHQA 4PL2A 1HEKA 2Q4TA 2ZIUB 1SZHA 2H3FA 3H0LB 3SAGA 2F76X 3C28A 5CRXA 4FE3A 3F2BA 3VCBA 1UPHA 2F8LA 2K4IA 2PMZF 3PSPA 4JMUA 2XVTA 3PSTA 3IN5A 3LVWA 1KBUA 2KHVA 2HBMA 4BJQA 2H3VA 3LVVA 1XNSA 2ZIVA 1WUDA 2XIDA 2KV2A 4U6PA 4QIWF 2JH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2S A;  3D2N A;  3D2Q A;  2E5S A; 
#chains in the Genus database with same CATH topology
 2PI5 A;  2XGP A;  5AKY A;  2BHN A;  3HKZ C;  2KE7 A;  3N28 A;  4UAZ A;  4M9J A;  2WFA A;  5L1L A;  3TAD C;  4QZ9 A;  1XWL A;  5AKX A;  1N60 A;  9ICI A;  4P0Q A;  5DG9 A;  1X9S A;  1S8O A;  2NV3 A;  4C8L A;  4TUQ A;  4OJL A;  2CPR A;  1L5U A;  1N2X A;  2H3Q A;  4DFJ A;  4F91 B;  2AGP A;  2LKY A;  4MFC A;  2FPM A;  3GU3 A;  3Q8P B;  4US8 A;  5DQI A;  1NJW A;  5IIL A;  4MFA A;  1SZP A;  3C5F A;  3PW0 A;  3LK9 A;  4YD2 A;  2ZG6 A;  4X5V A;  2J6S A;  3H8M A;  4PGQ A;  4UB6 U;  4YN4 A;  1KN5 A;  2DGZ A;  9ICM A;  5CB1 A;  4I2I A;  2W9A A;  4RNM A;  1T3Q A;  5DDY A;  4PHD A;  2JHD A;  2G06 A;  4YXM A;  1SKS A;  2KVC A;  5GTH U;  1D9D A;  3AQF A;  1MN8 A;  2RLT A;  4Y2J A;  3ONN A;  3O0F A;  4KLU A;  3MR5 A;  2IBK A;  3NVW A;  2JGA A;  4ACO A;  3QZ8 A;  5ALO A;  2A1J A;  1ZQV A;  2F44 A;  8ICJ A;  3TQ1 A;  4QZH A;  1S0M A;  1BVS A;  3IM1 A;  3E2E A;  3F5A A;  4O5C A;  2B0C A;  3QU2 A;  1SGG A;  5E79 U;  8ICA A;  2HDO A;  1ZQU A;  2C2E A;  2XY5 A;  4UQG A;  2D6F C;  3SI8 A;  2F76 X;  1UHU A;  5AM1 A;  4NM1 A;  1DOQ A;  1QSS A;  4I2E A;  2ZTE A;  3GIM A;  3RJH A;  1XNS A;  3RJF A;  1O08 A;  4DCC A;  4Q43 A;  4P0P A;  2ISP A;  3CYM A;  1SV4 A;  2N1R A;  4Y2S A;  2KNJ A;  7ICP A;  4F71 A;  4DSL A;  3M6K A;  4NJ8 A;  4JV1 A;  3T5K A;  3WKD A;  2WF6 A;  2BKE A;  5III A;  1IIP A;  4UB2 A;  4G3I A;  2F2A B;  4RT3 A;  5J0W A;  4GXI A;  2ASJ A;  4O3O A;  1RM6 C;  5KG7 A;  4K4H A;  2LYB A;  1ZQX A;  1NKC A;  3HX0 A;  4F5O A;  1Z4N A;  1ZQD A;  2KD1 A;  4ICA A;  1ZD2 P;  3C5G A;  1KFD A;  9ICJ A;  3ZD9 A;  4ECT A;  3UQ0 A;  4J03 A;  2NRX A;  5AKH A;  2ZJA A;  2M0N A;  2ISO A;  3MR2 A;  1KKX A;  2EZX A;  1NK8 A;  5KG6 A;  3BQT A;  4FZN A;  2ATL A;  3FYH A;  1L7N A;  4USA A;  4F4K A;  4HYK A;  2RDJ A;  3C2K A;  4ECX A;  2QB1 A;  3C23 A;  1J2N A;  3LDA A;  2LPE A;  4CNQ A;  7ICQ A;  7ICG A;  5J2E A;  1U4B A;  1ZQL A;  2E3T A;  8ICK A;  4NL9 A;  1YZ7 A;  3C1Z A;  3HPO A;  2KFZ A;  2KVS A;  5EE0 A;  4F93 B;  2PKE A;  2ZTD A;  4PHE A;  5AKG A;  3MDA A;  2FJ6 A;  3G6Y A;  3VCB A;  3LVV A;  4U6P A;  1B43 A;  4RZR A;  7ICM A;  3H0R B;  4TQS A;  2HBJ A;  4F72 A;  3EW9 A;  4K4I A;  1BPD A;  1UA1 A;  3M9M B;  1DK3 A;  3PO4 A;  2OEH A;  5KAI U;  4RNO A;  5J8Y C;  4OCZ A;  3M8R A;  5AM2 A;  2F77 X;  2KJ8 A;  5ALG A;  2KIC A;  2BCS A;  4QZG A;  5AKZ A;  1ZD5 A;  9ICS A;  3RBD A;  8ICM A;  5ALU A;  2IOF A;  2JH1 A;  1NKB A;  4GFJ A;  4EX7 A;  3L4P A;  3QEB Z;  4KTQ A;  3IG5 A;  5AM4 A;  2Y9T A;  3ETL A;  3C29 A;  9ICC A;  4BUG A;  4RNN A;  1T94 A;  4YMM A;  5B66 U;  2B6G A;  5AM5 A;  1T4G A;  4O3N A;  5J2H A;  4CF4 A;  3GV8 B;  5EWF A;  4JK1 A;  3OJU A;  3RJE A;  3PSF A;  5KFY A;  2ES6 A;  5AIB A;  4RQ2 A;  4KLH A;  2PFP A;  4J9S A;  4KLF A;  1U47 A;  5ALS A;  8ICG A;  4EEL A;  4AYB F;  4CE6 A;  4UAR A;  2LYA A;  8ICI A;  3ISB A;  5ALJ A;  4ED8 A;  4QW9 A;  3GDX A;  3ISC A;  5JU5 A;  3PNC A;  3QU7 A;  1ARO P;  5KAF U;  4QZB A;  7ICS A;  1Z00 B;  2YB4 A;  3QUB A;  2ZIX A;  2XIC A;  5KFV A;  4YR0 A;  1SL0 A;  3H40 A;  3C2L A;  5DQH A;  2R8G A;  2NRT A;  3LWM A;  1J97 A;  5AK5 A;  3T5L A;  4M6W B;  3F5E A;  3NRZ A;  5C0Y A;  1S77 D;  1ZXI A;  5EOZ A;  3UXO A;  4CF5 A;  2HOI A;  3V6K A;  1UPH A;  2B21 A;  3PSP A;  3RTV A;  3NTU A;  2HHV A;  1WYG A;  3V72 A;  4ECU A;  1N62 A;  4PJ0 U;  2NRZ A;  2VIX A;  3D2S A;  3G6X A;  1PK1 A;  2DQN B;  4I2C A;  4US9 A;  4F5P A;  3UMG A;  1N61 A;  4IC9 A;  1PUZ A;  3ZI4 A;  3AEV A;  5L1M A;  2Y1I A;  1L3V A;  9ICG A;  2XO7 A;  4O3R A;  2AXT U;  1L7M A;  3SAH A;  3RJJ A;  1X2I A;  3BQ7 A;  2LM1 A;  4I2G A;  3SYZ A;  2DF4 B;  3K1Z A;  2BPF A;  4I29 A;  1N63 A;  4DOC A;  3GFK B;  1SWV A;  2PMZ C;  5ALL A;  3RAQ A;  3DEE A;  3TAD A;  4EEN A;  2G5H B;  2IOH A;  1F0M A;  9ICR A;  3CRX A;  4UAY A;  1Z1B A;  5DQG A;  3L5K A;  2H5X A;  1S97 A;  3MDC A;  5HR6 A;  1GO3 F;  1F5S A;  3EWA A;  1KFT A;  4WJ3 B;  3RB4 A;  5D49 A;  1MQ3 A;  9ICL A;  3B0Y A;  4DSK A;  3V7K A;  2H3I A;  4YD1 A;  4I28 A;  2HHU A;  2DFL A;  2ZIW B;  2KTQ A;  4M47 A;  4NLG A;  3D2Q A;  1PK3 A;  3OSP A;  2MUT B;  4OJ6 A;  3C1Y A;  1ZOL A;  2W8K A;  4KLG A;  5AK3 A;  2VKQ A;  1WWV A;  9ICH A;  4FZM A;  4DQS A;  3HIL A;  1SKW A;  1ZD4 A;  3LWL A;  4F4W A;  3H4D A;  4ED1 A;  5AK4 A;  2D8C A;  3QUT A;  2XID A;  1KW4 A;  1JRO A;  2JH7 A;  3RH5 A;  4DSJ A;  7ICI A;  2FPL A;  2V4R A;  3A0B U;  5AKI A;  5IIK A;  5EWE A;  7ICF A;  4ECR A;  2OYY A;  4KX5 A;  3MR3 A;  1NZB A;  1ZQO A;  1KFS A;  4B9M A;  3OPX A;  4DS5 A;  2V4Q A;  4ED7 A;  4J9Q A;  1ZJM A;  8ICR A;  3M7D A;  3ZDA A;  3WKB A;  4QW8 A;  2YMQ A;  5JRT A;  1DRG A;  2HHS A;  2OWO A;  5D46 A;  3MBY A;  1ZQA A;  4R63 A;  1ZRM A;  4KLI A;  1MA7 A;  4NLK A;  9ICF A;  4M9G A;  2FLN A;  2YML A;  3RB6 A;  1ZD3 A;  4RT2 A;  2DKZ A;  4M04 A;  4DSI A;  4F2R A;  5DB7 A;  1B4F A;  2FLL A;  2W3R A;  1KEJ A;  3QUQ A;  4LJX A;  4RQ4 A;  1V85 A;  3KFU F;  2W9C A;  2KZ3 A;  3SD7 A;  4DFD A;  4Z6F A;  9ICK A;  3AUO A;  4PHP A;  4Z6E A;  2G09 A;  3KBB A;  2WF8 A;  5ALR A;  3QNM A;  3I1Y A;  3KTQ A;  2JZB B;  4FS2 A;  2K60 A;  3SQI A;  4JWN A;  2AJQ A;  1TK0 A;  4Y2P A;  4BGD A;  2EQY A;  9ICW A;  3UMB A;  3GV7 B;  2KG5 A;  5KFI A;  2Q4T A;  3WKE A;  4DEZ A;  2H3F A;  4DFK A;  2PMZ F;  4JMU A;  7ICK A;  2H3V A;  5AI6 A;  5DB6 A;  1L8O A;  4ED0 A;  2IA6 A;  4KN7 A;  5KFW A;  1Z19 A;  3ED5 A;  1NK5 A;  1S10 A;  3CW2 C;  4U7C A;  1L3T A;  3ZDD A;  3THV A;  2C22 A;  1X40 A;  1KDH A;  5TZV A;  3H7I A;  2JXJ A;  4XRH A;  3QEA Z;  2LHT A;  3AU2 A;  4DSF A;  1DGJ A;  4G9B A;  3TAR A;  4I2F A;  3G6V A;  2WF5 A;  2XC9 A;  4J9R A;  4RUA A;  4NY8 A;  2VA3 A;  3ZD8 A;  2BQU A;  1ZYQ A;  3BQ0 A;  5KT4 A;  1LVH A;  5KFF A;  1IG6 A;  1D8B A;  2C2D A;  1U49 A;  3H8J A;  3GIK A;  2Q0Z X;  4BXO B;  1RXW A;  2DWQ A;  1XU4 A;  3BZK A;  4B6J A;  1QQ7 A;  5J8Y A;  4KMU A;  1NK0 A;  1L7O A;  5KG2 A;  4R8U A;  1BNP A;  4DWI A;  7ICV A;  1HIW A;  2W9B A;  4GC6 A;  2IHM A;  5DBA A;  1WG8 A;  3KZI U;  4YR3 A;  2YTU A;  2K8C B;  5AIA A;  4BDP A;  1B0X A;  2KEY A;  2KSO B;  2JRZ A;  5AK6 A;  5KFB A;  9ICA A;  5KFL A;  4IRK A;  5KFT A;  5HNK A;  5DLF A;  1D8Y A;  3PY8 A;  2VA2 A;  3PO5 A;  3RJI A;  2FMQ A;  2FE9 A;  3NS1 A;  2LBO A;  4IQW A;  5FP0 A;  4C8O A;  4BWM A;  1F44 A;  2KHQ A;  3MAB A;  5J0P A;  4BJQ A;  9ICU A;  5D4B A;  8ICP A;  1CI4 A;  5L1K A;  1NJY A;  4O3P A;  4ECS A;  1WWU A;  3TFS A;  4C7Z A;  3M6Z A;  3AMZ A;  4UBB A;  4YFK A;  2KIW A;  2ZXI A;  4YMN A;  2RRD A;  5KTQ A;  1RPL A;  2R8I A;  1UA0 A;  3K75 D;  1K5O A;  1J2M A;  5KFU A;  4OJO A;  2WF7 A;  3U26 A;  3A0H U;  5JTI A;  3RF9 A;  2E8P A;  2A3V A;  1JN3 A;  3I76 A;  2NRW A;  1TKD A;  1YZ6 A;  1SIJ A;  2W7O A;  2KJ5 A;  4J9L A;  3D2N A;  4DFM A;  4NLN A;  1NK6 A;  5AM0 A;  4MEX A;  3UXN A;  2ZUB A;  2ZIU A;  5KNI A;  1FO4 A;  4PGX A;  4FZL A;  4YP3 A;  9ICP A;  4KLS A;  1ZQQ A;  1UCV A;  4UAT A;  4IRD A;  2C2R A;  1DGS A;  4AP9 A;  2AQ0 A;  1S5L U;  2DPI A;  3E0F A;  5AI0 A;  9ICQ A;  1UT5 A;  2PFN A;  4B9T A;  2KN7 A;  1JAL A;  1L3S A;  4Y2X A;  4B9V A;  4DL3 A;  5J2I A;  4QWA A;  8ICE A;  2HHX A;  8ICL A;  3NGD A;  3PV8 A;  3RB0 A;  5ALI A;  2WHE A;  4RQ1 A;  5KL8 B;  5AM3 A;  2E1E A;  5B5E U;  4UB8 U;  3HKZ F;  5KG3 A;  2ESE A;  3PW4 A;  5KG5 A;  5KFN A;  2EH9 A;  1RDF A;  1T7P A;  1URJ A;  2G08 A;  3QU9 A;  1HJP A;  2CN1 A;  4C8N A;  4PGY A;  4ED6 A;  1ZQI A;  4XQ8 A;  5BOM A;  3PVX A;  3MFH A;  1X9M A;  3S6J A;  1CEZ A;  3PX0 A;  3KKA C;  1K1S A;  2DBY A;  4KLT A;  2F8K A;  3JPT A;  1NNL A;  2XGQ A;  1Q46 A;  3OGU A;  2OHF A;  5J2C A;  2OM6 A;  4M6W A;  5KT5 A;  1MSW D;  2KKV A;  3F2C A;  3WK7 A;  5JUM A;  8ICB A;  2PI4 A;  4PZN A;  8ICT A;  5K4L A;  8ICW A;  4GXK A;  4KLD A;  2KJ9 A;  2QB0 B;  4HAI A;  4RQ5 A;  2E5S A;  3OHB A;  9ICO A;  1JRP A;  3OTQ A;  1FFU A;  2EAN A;  2BCQ A;  1ZQT A;  3V6J A;  4PH5 A;  2UVU A;  1QLN A;  2L5Y A;  2I6X A;  4P4P A;  3OSN A;  1T8E A;  1PVP A;  7ICL A;  4P0P B;  2IHN A;  2K8B B;  2E8N A;  4RUC A;  4QIW C;  1Z4O A;  5HHH A;  1JXL A;  3BDP A;  3GII A;  1L6N A;  1BPE A;  4Y2R A;  2FMS A;  2HMX A;  2J6U A;  4DLG A;  1DXS A;  2R18 A;  5ALV A;  1NOM A;  4F5Q A;  3SZ2 A;  4ELU A;  2W04 A;  4EZ6 A;  1ZQY A;  2PXI A;  2E8M A;  1PZN A;  3L3F X;  1TK8 A;  4IR1 A;  5KFZ A;  2BCU A;  1TFR A;  3V7J A;  1BPB A;  1ZQH A;  5DG8 A;  4FE3 A;  2W43 A;  3PW5 A;  5DB9 A;  4ECY A;  5AKK A;  3AL0 B;  2Z7J A;  2ZIW A;  5AI4 A;  5G5H A;  1SXD A;  2HOQ A;  1KSP A;  5EWG A;  2LYH A;  3UMC A;  2XY6 A;  1RYU A;  5ALN A;  4R66 A;  3BS5 B;  3WK5 A;  1SL2 A;  4MHV A;  2GWS A;  4I2H A;  3QXG A;  4FS1 A;  2ASD A;  4OJP A;  3ZDB A;  3ZDC A;  1U48 A;  5BOL A;  3H8S A;  1NI3 A;  1K1Q A;  3HWT A;  3WK4 A;  5J0R A;  1ZQB A;  5ALE A;  5T14 A;  1XSP A;  3I28 A;  1RQL A;  3PW7 A;  2VA8 A;  4DS4 A;  4QWD A;  1UQV A;  2G0A A;  4UAU A;  5L9X A;  3T5H A;  5AKL A;  1LKY B;  4B9S A;  5TIS U;  1JXE A;  2O6K A;  2CRX A;  5KG4 A;  1S0N A;  4EBC A;  3TAQ A;  7ICO A;  3KZX A;  5AHX A;  4NLC A;  4DF4 A;  1BPY A;  1O03 A;  2W8L A;  1S9F A;  2R8H A;  4MF2 A;  1A6S A;  2KOB A;  5CR0 A;  3BQ1 A;  2UVW A;  5J2B A;  1JX4 A;  2W9M A;  1BGX T;  1X42 A;  4QJF B;  5EE1 A;  4TUR A;  1N48 A;  5IIM A;  3DDH A;  4TUS A;  5F3X B;  3MGI A;  3E58 A;  1QQ5 A;  2F8L A;  4O3S A;  3PST A;  3IN5 A;  4C80 A;  4PPX A;  2KHV A;  2HSZ A;  3NAS A;  4LVS A;  4QIW F;  3K4G A;  4Z6C A;  2QAR B;  5CHG A;  5L1I A;  1FIQ A;  5EE9 A;  2JZB A;  4RQ8 A;  1SV0 C;  1RZT A;  3IP4 B;  4GC7 A;  3WK9 A;  1A77 A;  2MAX A;  5C5J A;  2Y1J A;  2BR0 A;  2ZIX B;  3QUC A;  4IQT A;  1UT8 A;  2KK0 A;  5KL1 B;  3MR6 A;  2FMP A;  2I9G A;  3H8W A;  2NYV A;  3TAN A;  1JIH A;  3CP8 A;  1ED1 A;  4KN4 A;  2UVV A;  2YB1 A;  2AHO B;  4IQU A;  5HML A;  4FFD A;  2WB1 C;  4C8K A;  2BGW A;  2JEJ A;  4ECW A;  4KLL A;  3MGV A;  3AN1 A;  1CUK A;  4Y2U A;  4PHA A;  4MFF A;  1WCN A;  3F53 A;  2ZTC A;  2EAO A;  1X6J A;  2HOF A;  3HJE A;  2BCV A;  3NVV A;  2BPG A;  5J0U A;  5KFR A;  4OO1 J;  4ZH4 A;  3IG8 A;  1RQN A;  3H0M B;  1QTM A;  2AU0 A;  3AU6 A;  2F1I A;  5CEH A;  3F2D A;  1ZJN A;  2VJ4 A;  3Q8K A;  5CWR A;  4ECV A;  4ZOH C;  2NO4 A;  3FDS A;  1QQ6 A;  2F1J A;  4BXO A;  2Y0S C;  2KP7 A;  3HW8 A;  3QU4 A;  5KFK A;  4IRC A;  5KG1 A;  5DGA A;  4LZG A;  3PX6 A;  1ZET A;  1RXV A;  4F4X A;  3JPP A;  1XSL A;  5AKJ A;  5KT3 A;  3SV3 A;  8ICC A;  3Q8Q B;  1NK7 A;  2MU2 A;  3PML A;  8ICY A;  8ICV A;  3JPR A;  2GH1 A;  5ALH A;  4QZF A;  3C21 A;  1X9X A;  2GO7 A;  2KZZ A;  4C4T A;  1JUD A;  2P35 A;  3VC8 A;  4J9N A;  3RRG A;  2CXY A;  2K8A A;  4JV2 A;  3V6H A;  2KZM A;  3V7L A;  3QX7 A;  4IS7 A;  5DLG A;  1L3U A;  2EDU A;  4EYH B;  3C2M A;  3OJS A;  3N7R C;  1N56 A;  3KKA A;  5HR7 A;  5AIC A;  9ICX A;  2ASL A;  3OHA A;  4NLB A;  2HW3 A;  2ZUC A;  3HT3 A;  4I2J A;  7ICJ A;  4CCH A;  2AGO A;  3BS7 A;  1C20 A;  2RP5 A;  3QZ7 A;  2DUY A;  3Q8L A;  5F9L A;  4EYI B;  1HUO A;  1NKE A;  2EZZ A;  5KFQ A;  4O9M A;  1KL9 A;  3ORY A;  2BCR A;  1Q3V A;  1IXR A;  1VJ5 A;  3KOO A;  4M2Y A;  4DO9 A;  8ICN A;  3D6J A;  4NM2 A;  4YCX A;  3RBE A;  4FBU A;  1VDV A;  4ED2 A;  1NK9 A;  5A0L A;  4RQ0 A;  2RHF A;  4PZO A;  2WB1 F;  3M8S A;  3K1R B;  3T5J A;  2JEG A;  1QSL A;  4QWE A;  3SV4 A;  5KFJ A;  2FI1 A;  3TAP A;  2XI9 A;  2ALZ A;  1KRP A;  1SZH A;  3MC1 A;  5J0O A;  3H4B A;  2HBM A;  4RQ7 A;  4Y2T A;  1OUQ A;  5F9N A;  1ZQF A;  7ICU A;  4O5K A;  2W9C B;  4QZA A;  3PZP A;  1Q3U A;  1IM4 A;  1Z1V A;  4RPY A;  9ICN A;  5J2K A;  4KX3 A;  1COK A;  4EEY A;  4Q8E A;  4DL2 A;  2P6U A;  2P6R A;  4YG2 A;  4UAS A;  4YQW A;  5DGB A;  1HUZ A;  3N7S C;  2HVI A;  2F3N A;  4M9N A;  1PVR A;  2Y0S F;  3WK8 A;  2OH2 A;  4KIT B;  5DKW A;  3KD3 A;  1SWW A;  3CNH A;  4QZE A;  3NVZ A;  4Y2Q A;  4BWJ A;  4EX6 A;  5GTI U;  1NJX A;  3SEI A;  3Q8S B;  2YY6 A;  4DFP A;  4C7Y A;  4Z6D A;  1ZQK A;  7ICN A;  4QZ8 A;  8ICH A;  4JUZ A;  3EZ5 A;  2WTF A;  2QB0 A;  3N4M B;  1RG6 A;  2I5H A;  4F4Z A;  5ALK A;  1V9P A;  1T3N A;  5KFC A;  1FFV A;  3BZC A;  3M9O B;  2H3Z A;  3QE9 Y;  2ZIV B;  8ICO A;  2K4P A;  4TQR A;  3GQC A;  5AKE A;  4UAV A;  5AI9 A;  4CGZ A;  5KFG A;  8ICX A;  2JEF A;  2LM4 A;  1QCK A;  4AYB C;  2LI6 A;  2I1Q A;  4JB3 A;  2EAM A;  4A8E A;  3B9J A;  3TFR A;  9ICB A;  5EE3 A;  4P0Q B;  4PL2 A;  1HEK A;  5IIN A;  2FDR A;  3JPO A;  4F4Y A;  1Q8K A;  1QH9 A;  4DQQ A;  2BDP A;  4JV0 A;  3J81 j;  4R8U B;  5DDM A;  2KV2 A;  1S76 D;  1TAQ A;  3IV6 A;  1H38 A;  1DK2 A;  5KFM A;  2W9B B;  4CF3 A;  1C7Y A;  5KFA A;  1B22 A;  1XSN A;  3ISD A;  9ICE A;  5HMM A;  5DB8 A;  4LZD A;  3PSI A;  5KT6 A;  4RQ3 A;  1TAU A;  3SEN A;  3RR8 A;  5ALF A;  2K4E A;  1Z00 A;  4Y2V A;  4EEK A;  5J29 A;  5DG7 A;  2IOF K;  2JEI A;  2AH5 A;  2OXO A;  3AM9 A;  5J2F A;  2VJ5 A;  3GIL A;  2PFQ A;  1D9F A;  2BDU A;  5CA7 A;  4ED3 A;  5ALZ A;  4B9L A;  3KHG A;  1SV0 A;  2A1J B;  3BS5 A;  2BQR A;  2RQ5 A;  3KHR A;  1X66 A;  2AGQ A;  1ZRN A;  2G07 A;  3EPI A;  3T79 A;  3RJK A;  8ICF A;  4O0I A;  3RH4 A;  1RYS A;  4TUP A;  1ZQC A;  8ICS A;  2ZJ8 A;  1ECW A;  3UPQ A;  2RDI A;  4YVZ A;  4P4O A;  4NXZ A;  5ALM A;  4KLM A;  5G5G A;  3ICX A;  2W3S A;  1KQQ A;  1BPX A;  1CRX A;  2YMM A;  1KTQ A;  2W11 A;  4DL5 A;  4I2A A;  1LKY A;  4EBE A;  3R9K A;  2QLT A;  2KFN A;  1X6I A;  2MA1 A;  4F2S A;  5KFP A;  4C0Z A;  2HVH A;  3RJG A;  4DSE A;  2HHQ A;  2HBK A;  2W03 A;  2DKX A;  2Y9U A;  2ZIU B;  4C8M A;  3SR6 A;  5BPC A;  3C28 A;  2K4I A;  5ALP A;  2LMR A;  4GXJ A;  1L8L A;  3LVW A;  5CP2 A;  5J2J A;  1V38 A;  4DQP A;  5KFE A;  4YR2 A;  1IV8 A;  1ZQP A;  4EZ9 A;  4NV0 A;  2EZY A;  3UXP A;  4I2B A;  5ALY A;  2R8K A;  1M6Y A;  2BQ3 A;  2XCA A;  2ODG A;  4Q45 A;  4IQV A;  5KT2 A;  4Y2Y A;  3WK6 A;  2QKQ A;  3QU5 A;  4KMO B;  3HRD D;  5J2G A;  5ALT A;  2MSN A;  7ICE A;  2J6T A;  2XCP A;  4M9L A;  4O3Q A;  2FLP A;  2BZF A;  1V97 A;  2QAR A;  2JR5 A;  5HHI A;  2MUT A;  4QNL A;  4KLO A;  2C28 A;  4UB3 A;  4J9K A;  3QYP A;  3JPS A;  5J0S A;  1TAM A;  4K4G A;  1EXN A;  4QZI A;  1NZP A;  3NRW A;  3PR5 B;  3RR7 A;  2IMW P;  4DF8 A;  4CRX A;  2YQE A;  4NWI A;  4RQN A;  4UB5 A;  4Q8F A;  7ICH A;  2PFO A;  1ZQG A;  1VLB A;  4B9U A;  2G5I B;  2D3D A;  1SXE A;  1ZQZ A;  2ZXH A;  2M9N A;  4ECQ A;  2AQ4 A;  4UB1 A;  3LYS A;  4F5N A;  4B9N A;  2R8J A;  1Z3E B;  2MRL A;  3RRH A;  1XO1 A;  2HHW A;  3JPQ A;  1LB2 B;  3ZDE A;  4O3M A;  2XY7 A;  3RFA A;  4F8R A;  3KHL A;  2WAQ C;  4QWB A;  5J0X A;  4F92 B;  4J9O A;  3RAX A;  5CRX A;  3F2B A;  1FEZ A;  1ZQR A;  3FM9 A;  4R65 A;  2JV3 A;  4EBD A;  3Q8M A;  4DOB A;  5KT7 A;  4KLE A;  1LV5 A;  4UAW A;  5DBB A;  4UBC A;  1ZQW A;  1ZQJ A;  4DL6 A;  4FBT A;  2YMP A;  3PX4 A;  1BNO A;  4DL7 A;  1TVA A;  4QZC A;  4DLE A;  2HCF A;  2E8O A;  5KFD A;  4RPX A;  4RU9 A;  1TK5 A;  1JI7 A;  4MEY A;  4O5E A;  3TI0 A;  4GLX A;  1A0P A;  1ZQS A;  3PR4 A;  4I27 A;  4C4R A;  3HP6 A;  3RB3 A;  7ICR A;  1XC9 A;  1BPZ A;  1RYR A;  2KMD A;  2GLE A;  5KG0 A;  1ZQE A;  3UM9 A;  3NUQ A;  5J0T A;  2YN4 A;  1ZQ1 C;  9ICT A;  4Q44 A;  3JPN A;  1N5X A;  4GIB A;  4DL4 A;  5AI5 A;  8ICZ A;  1COO A;  5CJ7 A;  1YT3 A;  4RPZ A;  4NL9 C;  4OD0 A;  1NJZ A;  1QSY A;  2KIV A;  4E0D A;  3RH6 A;  2EAP A;  4YMO A;  5DBC A;  2F1H A;  5ALD A;  4DOA A;  3M1Y A;  4OJ5 A;  3AQE A;  8ICQ A;  2DPJ A;  9ICV A;  3IDW A;  4ELT A;  3ALR A;  1KLN A;  3IRU A;  5ALQ A;  4QWC A;  1P7D A;  5L1J A;  2VAN A;  1N5W A;  3EYZ A;  1JMS A;  3MGH A;  4DQR A;  3DV9 A;  4XA5 A;  4ECZ A;  1U9L A;  1SL1 A;  2ZUD A;  1PK1 B;  3Q8R B;  4F50 A;  4IR9 A;  3N7P D;  4UB4 A;  1SKR A;  1X9W A;  3BJY A;  2A1A A;  4CDG A;  5KFS A;  5ALW A;  2V9W A;  2K4H A;  5H2F U;  2ZJ5 A;  3SAF A;  2HI0 A;  3H0L B;  4P4M A;  5KFH A;  3WU2 U;  2XVT A;  3FAH A;  3B0X A;  1KBU A;  3FC4 A;  3GV5 B;  1MQ2 A;  3IHQ B;  3MFI A;  4JWM A;  1S0V A;  1NK4 A;  3PMN A;  3KHH A;  5J0Q A;  1U45 A;  2K89 A;  5HP4 A;  2UVR A;  1Y88 A;  4F5R A;  4NLZ A;  2HHT A;  5J2D A;  3EUB 2;  2W55 A;  1XO0 A;  5J0Y A;  4RQM A;  4C4S A;  4I2D A;  2KSO A;  1OXJ A;  5KFX A;  1SB3 C;  3ETR A;  5J2A A;  4R64 A;  1OW5 A;  1TV9 A;  3SMV A;  2WAQ F;  3NVY A;  3UQ2 A;  2E1F A;  2GOL A;  8ICU A;  2W54 A;  3M9N B;  1ZQM A;  3BQ2 A;  4DQI A;  7ICT A;  4XUS A;  1TE2 A;  2OCE A;  1MC8 A;  3TAC B;  2HBL A;  4BX9 C;  1S0O A;  3WKC A;  4MF8 A;  4J9P A;  2KKP A;  4KLQ A;  4RQ6 A;  2JMG A;  4YXJ A;  1WCL A;  2BPC A;  2P66 A;  4M0A A;  4PL1 A;  1L7P A;  4UW9 A;  1D8L A;  4M9H A;  3PW2 A;  4KLJ A;  3WKA A;  3N97 B;  5KFO A;  4F3O A;  5ALX A;  5IIO A;  2WF9 A;  4FO6 A;  2FPK A;  4J9M A;  1A76 A;  3GZF A;  3TKA A;  2YX8 A;  1PVQ A;  2NO5 A;  5IIJ A;  2A19 A;  3EPG A;  4IL6 U;  4P2H A;  3GIJ A;  3SAG A;  3T3F A;  2DL0 A;  4QZD A;  1XS9 D;  4ELV A;  2NRV A;  5AI8 A;  1ZQN A;  2ZIV A;  1WUD A;  1AQ6 A;  2W7P A; 
#chains in the Genus database with same CATH homology
 1OUQ A;  2Z7J A;  2ZIW A;  3H0R B;  3M6Z A;  4NV0 A;  2HBJ A;  1Z19 A;  2VIX A;  3D2S A;  2KIW A;  3HKZ C;  3PZP A;  4U7C A;  2GH1 A;  3IP4 B;  1Q3U A;  4P0P A;  2DQN B;  3CYM A;  2N1R A;  2KNJ A;  2ZXI A;  2HOQ A;  2RRD A;  2OM6 A;  3M6K A;  4KX3 A;  2KKV A;  2OYY A;  2ZIX B;  3F2C A;  2K89 A;  4KX5 A;  1NZB A;  4IC9 A;  3PSI A;  5KL1 B;  2F77 X;  2KJ8 A;  3VC8 A;  2LHT A;  3OPX A;  2KIC A;  4P0Q A;  2K8A A;  4OJO A;  1IIP A;  2K4E A;  2NV3 A;  4KMO B;  3AL0 B;  3N7S C;  2KJ9 A;  1XO0 A;  4OJP A;  2JH1 A;  2F2A B;  3M7D A;  4GFJ A;  1PVR A;  2Y0S F;  3RF9 A;  4OJL A;  2OH2 A;  2CPR A;  1A0P A;  2H3Q A;  3CP8 A;  1ED1 A;  3IG5 A;  2E5S A;  2YB1 A;  3SAH A;  2OXO A;  1DRG A;  3C29 A;  2A3V A;  2VJ5 A;  2LYB A;  2WB1 C;  3SMV A;  3N7R C;  2WAQ F;  4QNL A;  4BUG A;  2LKY A;  5T14 A;  1D8B A;  2BDU A;  5HR7 A;  1T94 A;  2E1F A;  2GOL A;  3NUQ A;  1MA7 A;  1ZQ1 C;  1TAM A;  3MGV A;  2DF4 B;  3GU3 A;  3K1Z A;  2W7O A;  2KJ5 A;  2KD1 A;  2G0A A;  3D2N A;  4ICA A;  4NLB A;  3PSF A;  2ZG6 A;  2HBL A;  1YT3 A;  2G07 A;  2PMZ C;  2ZIU A;  3F53 A;  3NRW A;  4BX9 C;  3T79 A;  2DGZ A;  3DEE A;  2HOF A;  2W7P A;  2KKP A;  4CRX A;  2G5H B;  4FZL A;  1PVP A;  2RP5 A;  4NWI A;  4P0P B;  2K8B B;  4QIW C;  3CRX A;  2JHD A;  4AYB F;  2G06 A;  2JMG A;  4OO1 J;  2LYA A;  1Z1B A;  1ECW A;  2CRX A;  2KVC A;  4OJ5 A;  2D6F C;  2HOI A;  1L6N A;  3IG8 A;  3KFU F;  3H0M B;  3AQE A;  2M0N A;  4PL1 A;  3E0F A;  1GO3 F;  5HR6 A;  3AQF A;  1HIW A;  3KZX A;  3ICX A;  1Q3V A;  3ONN A;  4WJ3 B;  3ALR A;  2G5I B;  3F2D A;  2HMX A;  3O0F A;  4NLC A;  4FZN A;  2ZXH A;  2YB4 A;  1P7D A;  2H3Z A;  2JGA A;  2R18 A;  2VJ4 A;  4ACO A;  2G09 A;  1A6S A;  2K8C B;  2ZIV B;  2ZIX A;  2KOB A;  2KEY A;  2XIC A;  1CRX A;  3LYS A;  2H3I A;  2ZIW B;  5KL8 B;  4CGZ A;  2W04 A;  2MRL A;  3GZF A;  3D2Q A;  5A0L A;  3SQI A;  2RHF A;  2YX8 A;  4OJ6 A;  2Y0S C;  2E1E A;  2MA1 A;  3F5A A;  3N7P D;  4AYB C;  3HKZ F;  1PVQ A;  2WB1 F;  2VKQ A;  3L3F X;  4QJF B;  4C0Z A;  4A8E A;  4O3M A;  4CDG A;  1URJ A;  3RFA A;  3F5E A;  2LBO A;  5C0Y A;  2G08 A;  2WAQ C;  2K4H A;  4FZM A;  2CN1 A;  2XI9 A;  1F44 A;  4P0Q B;  2HBK A;  2W03 A;  3SAF A;  2KHQ A;  4PL2 A;  1HEK A;  2Q4T A;  2ZIU B;  1SZH A;  2H3F A;  3H0L B;  3SAG A;  2F76 X;  3C28 A;  5CRX A;  4FE3 A;  3F2B A;  3VCB A;  1UPH A;  2F8L A;  2K4I A;  2PMZ F;  3PSP A;  4JMU A;  2XVT A;  3PST A;  3IN5 A;  3LVW A;  1KBU A;  2KHV A;  2HBM A;  4BJQ A;  2H3V A;  3LVV A;  1XNS A;  2ZIV A;  1WUD A;  2XID A;  2KV2 A;  4U6P A;  4QIW F;  2JH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...