3D2NA

Crystal structure of mbnl1 tandem zinc finger 1 and 2 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
TKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muscleblind-like protein 1
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, rna binding protein
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2nA00
3D2NA 2E5SA 3D2QA 3D2SA
chains in the Genus database with same CATH superfamily
3ISCA 3CNHA 3NTUA 2BDUA 3MR3A 2HBMA 5J2AA 3N7PD 3S6JA 1V9PA 1T7PA 1ZQDA 3TADC 2HSZA 4F5PA 3E58A 2QKQA 3IV6A 4DL3A 1S0NA 1H38A 4B9UA 1IG6A 3ISBA 2HBLA 5CWRA 3EPGA 1IXRA 3PNCA 4RT2A 2EANA 3WU2U 4K4GA 3HRDD 2YN4A 5AK6A 5AM4A 4JWNA 4J9KA 2BCQA 8ICSA 2JXJA 3B0YA 3UPQA 2KN7A 4FS2A 4QJFB 2W54A 4TUPA 3RJEA 2EZYA 5DG8A 4FS1A 3EWAA 1T3NA 1ZQJA 3WKDA 4JV1A 4RQ5A 3QU5A 2V9WA 3N97B 1KQQA 3AN1A 3RH6A 1NJZA 3WK9A 7ICFA 3RJGA 2Y1JA 4ED0A 1KFTA 3PSPA 2R8IA 1QH9A 3GV5B 1FFVA 5KTQA 5AI9A 1LKYA 3SEIA 1X9WA 1K1SA 1L3TA 3AQFA 4CNQA 7ICLA 2ALZA 1X9XA 4RQ1A 2G0AA 2KE7A 5KFKA 4YVZA 2KSOA 4DSEA 1SL0A 3IHQB 3B9JA 4K4HA 3V7LA 4O3NA 4QZ8A 5ALLA 5BOLA 5ALMA 2JEIA 1WWUA 4DOCA 4P4PA 2FPLA 2E3TA 1TAUA 4JV0A 2A1AA 3IN5A 3C2LA 2KP7A 1ZXIA 1TVAA 1L5UA 3T5HA 4DSKA 2R8GA 2DUYA 3SAHA 4C4SA 4QW8A 4P4MA 7ICGA 3Q8LA 5DB8A 4O5KA 4AYBF 3KFUF 1RYRA 3QXGA 1HUZA 2WHEA 9ICEA 5AKLA 9ICCA 9ICUA 1IV8A 5IIKA 2JGAA 1URJA 2PI4A 4DSIA 3MDAA 4RQ0A 1S5LU 1RZTA 3RRHA 1ECWA 1KRPA 1RQNA 3RH5A 3LVVA 2HHUA 3FDSA 3KTQA 4J03A 4Z6CA 4UAVA 3JPPA 4RT3A 4FZNA 5E79U 1KKXA 3M6KA 2BHNA 4F4WA 2HI0A 2UVRA 5ALJA 5KG7A 5AHXA 1X6JA 2KKPA 1KDHA 4RZRA 4EYIB 1DK2A 4ELTA 4QIWC 4ECSA 4I29A 4KLOA 4F5QA 1N5XA 2BCRA 2BPFA 9ICHA 4DL5A 3JPQA 5J8YC 5HNKA 3IG5A 1RYSA 4EZ6A 3RB3A 1S0MA 5DBCA 5J0WA 4DL7A 4F71A 5ALWA 4US8A 1EXNA 4KLGA 1T4GA 3C21A 5DLGA 1ZD2P 1RG6A 4MEXA 1SZPA 2EZZA 2XGPA 5F9LA 5CHGA 5DQGA 3C5GA 3SD7A 3T5JA 4IRDA 1ZD3A 1ZQRA 1KEJA 1TFRA 3H0LB 4ECUA 3OHAA 2VIXA 4KX3A 5ALDA 4MF8A 5DGAA 4B9NA 2LYAA 1S77D 4EX7A 4UB1A 1Q8KA 3GDXA 5KFCA 4UAUA 1XU4A 3H8JA 2ZIWA 3UMCA 3V7JA 3WKEA 4F4ZA 3PMLA 3F5AA 5AM3A 4M6WB 4QZDA 3TANA 3SQIA 1M6YA 4DL4A 5BPCA 4Q8EA 2VA2A 2UVVA 4FZLA 4PJ0U 5KFYA 4Q8FA 7ICEA 4LJXA 1ZQVA 1D8BA 2BZFA 3C23A 8ICOA 5KFXA 3M8SA 2F44A 2MRLA 4DFKA 4RQ8A 1PK1B 2Y0SC 2DKZA 4EBCA 5HR7A 3NS1A 4R65A 3TFRA 5AI4A 2RQ5A 5AM0A 3WK4A 4I2HA 3MABA 1CI4A 1SV0C 2RHFA 4QWCA 1LB2B 3MC1A 3C2MA 1L8OA 4DQIA 3RJFA 2ZIUA 2W3RA 8ICBA 3L3FX 1MSWD 3IRUA 1OW5A 4Y2XA 4UATA 5KL8B 2MUTA 5KT6A 4DQSA 1ZQOA 2HBJA 5ALGA 7ICOA 2D8CA 4Q45A 3OSPA 8ICKA 2E5SA 3RBEA 1PVPA 3WKAA 5HHIA 5L1JA 8ICMA 1NZPA 9ICMA 2IHMA 4DLEA 3T79A 5IIIA 1T8EA 1NJXA 5KFAA 3BZCA 4NL9A 1PVQA 3KZIU 1N60A 5KG5A 3HT3A 4F72A 3KHLA 4DSLA 1SB3C 9ICWA 2AGOA 2GH1A 3V6KA 5EWFA 5DQIA 1WCLA 2ZUDA 4YP3A 4YQWA 9ICTA 2LBOA 5IINA 2G09A 2GO7A 1PZNA 2YQEA 5EE3A 4ED2A 2PFNA 4KITB 4EENA 5J29A 4B9LA 2Q4TA 4DL6A 2ZIXA 3GV7B 4EBEA 3NUQA 1LKYB 1NK9A 1MA7A 1F44A 3H0RB 3F5EA 3SZ2A 2W7PA 3QUQA 3IP4B 4I2FA 5KFBA 4M04A 2DF4B 5KAFU 5J2DA 9ICBA 2KSOB 4I2AA 3OSNA 2P66A 2KZ3A 3M9NB 1ZQNA 3PY8A 4KLDA 5KL1B 3DDHA 4PPXA 3ICXA 5ALQA 1ZQHA 3IG8A 3JPSA 4O3SA 3V6JA 5EWEA 9ICIA 5ALFA 4RPXA 3OJSA 4MHVA 4Y2YA 5K4LA 2AH5A 4Y2QA 5JUMA 8ICEA 2VANA 2WF5A 3G6VA 3QEBZ 4LZGA 4YD1A 3ISDA 4IQUA 2HCFA 3PMNA 2EQYA 1L8LA 4FFDA 2W03A 5KNIA 2XCAA 3C2KA 4C8LA 4IR1A 4QIWF 8ICVA 8ICZA 2AU0A 2YMQA 3KD3A 4IS7A 3HPOA 2BPCA 3C28A 4UAZA 3GILA 3HILA 1ZQEA 5DB6A 3EPIA 4WJ3B 4OJ5A 1S10A 7ICIA 3K1ZA 1ZYQA 5ALTA 2JHDA 1GO3F 2NO4A 2FI1A 8ICYA 4DEZA 2B21A 4Q43A 5L9XA 5TZVA 3T3FA 5B5EU 5EE9A 2DKXA 5KFQA 3I76A 4UAYA 3PW4A 2NRZA 1XO0A 1ZD4A 1SL2A 2YMMA 3SV3A 3H8WA 5TISU 4ECQA 2DPIA 1HJPA 3PX6A 4GC6A 5AIBA 4O0IA 4UB3A 1Z19A 4KLMA 1A6SA 3RJIA 2W9AA 4B9VA 3QUCA 3Q8SB 4DF4A 2E8PA 5KFNA 2HOIA 2ZXHA 2K89A 1A0PA 1X66A 1CRXA 4O9MA 3HX0A 4FZMA 4NLCA 1SZHA 4DS5A 3KHGA 3TARA 1L3UA 1RQLA 2NRTA 3T5KA 5AKHA 3O0FA 2Y0SF 4IRKA 2M0NA 1UHUA 4BWMA 5EE1A 1UT8A 1D9DA 2NV3A 1C7YA 4ZOHC 1NZBA 1S8OA 4ZH4A 4CF4A 5BOMA 2PFOA 2BKEA 5T14A 2ZIWB 5HMMA 4YFKA 4KN4A 2ZG6A 4F8RA 2BQ3A 5IILA 1T94A 3LVWA 3SR6A 3AUOA 4ICAA 5C5JA 1J2NA 4BX9C 2ZJ8A 1X40A 2FDRA 2YB1A 4I2JA 5GTIU 9ICPA 5CA7A 5KFZA 1NJWA 2P6UA 2FE9A 4DOAA 3N28A 1UA0A 4EZ9A 1TK0A 2ESEA 3TFSA 1RXWA 1ZQYA 4LZDA 3PVXA 3NRZA 3V72A 9ICKA 4TUSA 3V7KA 1Q3UA 5KFVA 2KV2A 1N56A 4US9A 2HHXA 4F4YA 2RLTA 3ZDDA 5L1KA 2YMPA 4DSJA 2FMPA 5DDMA 2ZIUB 5AM2A 5H2FU 4M9NA 1SKWA 1JI7A 3RBDA 4UW9A 3LK9A 3AU6A 2C2EA 4QZGA 3UQ2A 2MUTB 5KT2A 1ZQFA 3C1YA 4YMMA 9ICJA 1KBUA 7ICKA 8ICCA 5ALXA 3AQEA 3C29A 8ICUA 4GC7A 1Z00A 5ALPA 1QLNA 1JMSA 3A0HU 7ICVA 3PSFA 5KG1A 3NGDA 1O08A 8ICPA 1HEKA 2M9NA 3BZKA 2KOBA 1ZQSA 3ONNA 2KICA 1RYUA 3V6HA 2XO7A 2NRXA 3PR4A 2WB1C 4NM2A 4PGYA 2ODGA 3RFAA 3TKAA 3D2NA 1BPDA 5J2KA 3J81j 4F92B 3ETLA 1DGSA 1U4BA 7ICMA 1Z3EB 2KEYA 4KLUA 2ZTDA 1J97A 4I28A 5AM1A 1SKRA 1QQ6A 2JV3A 4ACOA 1NK6A 4PHAA 1UQVA 1X9SA 1FFUA 1TAMA 2DFLA 4TUQA 3HWTA 5CJ7A 2FPMA 4O3QA 2RDIA 2OCEA 2F77X 3CRXA 1B0XA 3BQ2A 4RNMA 1ZQIA 2ZIXB 4YR0A 2W9MA 3PZPA 5AK3A 2HHQA 4LVSA 3NASA 1NKEA 5AKIA 4RUAA 5J2CA 4CRXA 1SWVA 2A3VA 2W7OA 2E8OA 4C80A 3I1YA 5HP4A 1RPLA 4JMUA 1L7PA 4OD0A 1WCNA 5J0OA 5J0UA 3RTVA 2HHVA 1BPEA 3PO4A 4YXMA 4P0PB 3B0XA 3SMVA 2BQUA 2CN1A 1Q46A 2ASDA 4ED8A 4J9MA 2Y9TA 3ZDAA 4DCCA 4EYHB 2MSNA 3FC4A 4ELUA 2VA3A 4HYKA 2H3VA 4F5OA 3GQCA 1L3VA 1QSSA 2J6UA 3Q8PB 4GXKA 1JN3A 3JPNA 3LWMA 3EYZA 3D2QA 4FBUA 4FBTA 2LYBA 1NJYA 4CF5A 3IDWA 2XVTA 4J9PA 5J2GA 5A0LA 1A77A 1ZQMA 2FLNA 4PZNA 9ICGA 2KIVA 4I2BA 4CGZA 4DFMA 3AL0B 4TURA 1FEZA 4RQ6A 5AIAA 9ICFA 3BQ1A 4ELVA 2BGWA 2L5YA 2K60A 1KN5A 2DPJA 1ZQKA 2NO5A 4M9HA 2PXIA 3RF9A 4KLEA 3F2CA 2ES6A 2G06A 1KL9A 3H8MA 4USAA 5KFFA 3HW8A 3TAQA 1L6NA 5KFJA 2VJ4A 5J2EA 4J9QA 3N4MB 3ZDBA 3HJEA 8ICXA 4MF2A 1TK8A 2IOFK 4QWBA 3KKAC 2GWSA 4EX6A 3GIJA 2KJ9A 1VDVA 3RR7A 4IC9A 2FMSA 4PL1A 2DGZA 2ISPA 4IQTA 1X42A 2A19A 1ZOLA 2QB0A 4QZIA 3JPRA 1N61A 3BS5B 2MA1A 3F2BA 3RAQA 1FIQA 1CEZA 4Y2UA 5AK4A 4NXZA 3C5FA 4NY8A 1QSLA 2KJ5A 8ICGA 2KD1A 1ZJNA 4I27A 4O5EA 1NKBA 1QQ7A 3H4DA 5F9NA 3Q8RB 2RP5A 2XGQA 9ICSA 1RDFA 1L3SA 4RQ4A 1MQ2A 2QB1A 1AQ6A 4JUZA 3KBBA 4YMNA 1CUKA 3ED5A 5CRXA 2OH2A 2KHQA 2HHSA 1MQ3A 3QZ8A 8ICNA 3WKBA 1ZQCA 5IIMA 4XA5A 5KFDA 4KMOB 4EEYA 1O03A 4P4OA 3BQ7A 2F76X 4NLBA 3OHBA 4ECVA 1NOMA 2KK0A 2KFZA 1F0MA 3NVZA 4UB6U 3KHHA 2KVSA 1SXEA 1BPZA 4O3MA 1Z4NA 4NV0A 5EWGA 4DFDA 2WB1F 4K4IA 4BXOA 1DGJA 4DL2A 1DK3A 5KFWA 3SAGA 2ZUCA 3ALRA 2JH1A 3MFIA 2K8BB 5ALZA 1YZ6A 2KIWA 4GFJA 5D46A 3NRWA 3PSTA 1DRGA 2E8NA 3QU9A 3G6YA 1L7OA 4C7ZA 5AI6A 4RQ2A 3UXNA 1Z00B 3ZI4A 4I2GA 2XY6A 4KLSA 3UQ0A 4B6JA 3WK7A 4Y2RA 5JRTA 4KLFA 2YY6A 7ICTA 5KFPA 3F2DA 2W9CA 4DWIA 4OJ6A 3TADA 5KFOA 4R63A 1NK7A 2H3ZA 2BCSA 5KFTA 2JH7A 3H40A 3QEAZ 2W9BA 2Z7JA 5AI8A 5KT4A 4Y2PA 4FE3A 3QU4A 7ICQA 1WUDA 3DEEA 4EELA 4GLXA 1SIJA 1ZQXA 3SYZA 4DLGA 4DO9A 5FP0A 2AHOB 2MU2A 1PVRA 1S76D 1Z1BA 4ECZA 2WAQC 2UVWA 3Q8MA 1BPYA 8ICQA 1ZRMA 2IMWP 2FLPA 4UB5A 9ICOA 4IQVA 3PX0A 2R8HA 3TAPA 7ICSA 1T3QA 8ICJA 3GIKA 2K8CB 4ECRA 4RNOA 3M1YA 2IBKA 2QARA 1XNSA 1ZQLA 4P0PA 4M47A 2IHNA 5J2BA 3IM1A 5KFUA 2BCUA 5J0YA 2K4HA 4PHEA 2AXTU 4I2CA 1NI3A 4YR3A 1ZQGA 2FPKA 2D3DA 2F8KA 2FMQA 2LMRA 2V4QA 1BPXA 1NK5A 4YN4A 2P35A 4C8KA 1KLNA 4Y2SA 4M9LA 2GLEA 2JZBA 3QU2A 1ZQQA 4PZOA 4J9OA 2KNJA 2ASJA 4NLNA 5HMLA 3C1ZA 1XSLA 4QNLA 5AICA 1U45A 4MFCA 3WK6A 4UB8U 4BGDA 4UB4A 5F3XB 5CP2A 1P7DA 4QWAA 2JRZA 3QUBA 5KG6A 3CW2C 1Z1VA 2KZZA 2FJ6A 3G6XA 4DS4A 2N1RA 1ZD5A 2I1QA 2IOFA 4Z6FA 2YX8A 4RPYA 3D6JA 3BQTA 9ICXA 4FO6A 4Q44A 5AKGA 2JEGA 3RB0A 1ZQAA 5J0PA 1ZQUA 5KFHA 2KFNA 2YTUA 4XUSA 3FM9A 1COKA 2EAPA 3DV9A 3LYSA 5IIOA 3NVWA 4NJ8A 1ED1A 4ECWA 1V97A 3QYPA 3AEVA 2WF7A 5KFSA 3E2EA 2F3NA 2KG5A 3K1RB 4QZCA 2ZJ5A 3T5LA 1KTQA 2D6FC 1XO1A 3BS5A 2LPEA 5J0SA 3SAFA 3QU7A 5EOZA 7ICJA 2CPRA 2AQ0A 1N2XA 5HHHA 2XC9A 3RJHA 7ICRA 3EW9A 2HOFA 2MAXA 3LWLA 8ICTA 5J8YA 5D4BA 5ALRA 1JALA 2QB0B 3L5KA 4KLJA 3UM9A 2WTFA 5KFGA 4RU9A 4NM1A 1FO4A 2GOLA 1V85A 1KW4A 3SI8A 4JK1A 2HBKA 1XSPA 4F91B 3UXPA 3F53A 4O3RA 3OPXA 2A1JA 2KKVA 4GXIA 4ECYA 3MGVA 5HR6A 5ALSA 7ICNA 3SENA 1D8YA 3BQ0A 4QZAA 1COOA 2XY7A 8ICAA 5AKZA 3BDPA 2ATLA 1OUQA 4AP9A 1ZQZA 2XICA 8ICHA 4J9SA 4RPZA 3AU2A 1WWVA 1KSPA 2WFAA 5ALKA 3K75D 4NL9C 4P2HA 4DQRA 1B43A 4M9GA 2C2RA 5KG4A 4P0QA 3UXOA 3QNMA 3EUB2 4B9MA 1U9LA 2BQRA 4BXOB 5B66U 4ED1A 2HMXA 1KFSA 2ZTEA 2OWOA 2UVUA 4O3OA 2J6TA 7ICHA 4F50A 4U7CA 2I5HA 1JUDA 5DQHA 1F5SA 3GFKB 9ICVA 2H3FA 2W3SA 4QW9A 1QCKA 2XIDA 5AI0A 2HOQA 3RH4A 3D2SA 1SV0A 3RR8A 2G07A 2DBYA 2C22A 3H8SA 5J0QA 4QWDA 4J9RA 4KLHA 4IL6U 4KMUA 5CEHA 4PGQA 5DBAA 1MC8A 2WAQF 1B22A 1X2IA 5J2HA 1N48A 1JROA 2KJ8A 3PSIA 2KTQA 2HDOA 4QZ9A 1X6IA 4BJQA 3THVA 2W04A 1SWWA 4DFPA 2W9CB 4DQQA 1VLBA 5G5GA 3H0MB 1S9FA 1TV9A 1Q3VA 2Y1IA 5DKWA 2W9BB 5ALYA 3TQ1A 4MFAA 4F2SA 4TQSA 4YXJA 5J0RA 2YMLA 4QZHA 4CE6A 3HP6A 1BPBA 1BNOA 1JRPA 2F1IA 3N7RC 2WF6A 5KFLA 2LM4A 1JXEA 2PMZC 1D8LA 3R9KA 4F4KA 5DGBA 5AKXA 2AQ4A 5KT3A 1OXJA 3ZDCA 1XS9D 2QARB 1Y88A 4ECXA 5L1MA 1IM4A 4PH5A 3MR2A 3RB6A 2HVHA 3PO5A 4IRCA 5DG9A 4R8UA 5C0YA 3QZ7A 2ZJAA 2NYVA 4RQ3A 1NK0A 5IIJA 5J2FA 1JIHA 3NVYA 1NK4A 3MFHA 7ICUA 4Y2JA 3N7SC 1ZQ1C 3L4PA 3RAXA 2IA6A 1RM6C 2JZBB 2PFPA 1K1QA 3MDCA 3PW2A 2EZXA 2OM6A 2I9GA 1J2MA 4BDPA 4UBBA 2KVCA 1NNLA 1XWLA 1HIWA 2BCVA 4KLQA 2NRVA 2W55A 2PI5A 2YB4A 1HUOA 1JX4A 1DOQA 5GTHU 1BVSA 4XQ8A 2G08A 3ZD8A 2P6RA 1NK8A 4O3PA 4X5VA 4KLTA 4OJLA 4ECTA 4ED3A 3AM9A 3SV4A 2R8JA 3A0BU 3UMBA 4U6PA 3OJUA 5ALHA 4C8NA 2F8LA 3JPTA 2RRDA 2XCPA 1SL1A 2VA8A 5DG7A 2K4IA 3TACB 2KZMA 3HKZC 5ALVA 3MR6A 2EDUA 3FYHA 2B0CA 4C8MA 5J0TA 3QUTA 3OTQA 2F2AB 4EEKA 3MGHA 2G5IB 4Z6DA 1XC9A 5ALUA 4F3OA 1BNPA 2LYHA 3RJKA 1SGGA 4KLIA 3TI0A 2NRWA 1S0OA 2H3QA 4M0AA 4CF3A 4NLGA 1WG8A 2ZIVA 4PL2A 5AM5A 3WKCA 4JV2A 5EE0A 3M9OB 3M7DA 4YCXA 1TK5A 5CR0A 2F1JA 2VJ5A 5D49A 4TQRA 1D9FA 4I2DA 3GZFA 7ICPA 5JTIA 3KHRA 3JPOA 2AGQA 4E0DA 5KFMA 4G9BA 3RJJA 3PW7A 4GXJA 3K4GA 2DQNB 5ALIA 2A1JB 2IOHA 4UQGA 4YR2A 4QZBA 9ICLA 1U48A 2W43A 5KFEA 2C2DA 3GV8B 4IR9A 4XRHA 2XY5A 1N5WA 2W8LA 3BS7A 1LV5A 4C0ZA 3AMZA 2ZTCA 4C4RA 2Q0ZX 1ZQPA 1C20A 3GIIA 3OGUA 4DSFA 1YT3A 1Z4OA 5ALNA 3KZXA 3PW5A 3EZ5A 5KG2A 9ICNA 1UCVA 4UASA 2WF8A 2B6GA 4P0QB 2QLTA 4F5NA 4C8OA 3I28A 4B9TA 5J2JA 2FLLA 2ZUBA 5DB9A 2PKEA 2EH9A 1ZJMA 5KFIA 4UAWA 3U26A 2LM1A 4OJOA 3VC8A 4JWMA 2LKYA 5J0XA 2BDPA 4KTQA 3ORYA 2Y9UA 1UT5A 2G5HB 1QSYA 2OYYA 3PV8A 4M2YA 8ICWA 3GIMA 4CDGA 4DQPA 1L7NA 2E8MA 4R64A 2H5XA 3UMGA 4R66A 3RRGA 2PMZF 4QWEA 2BPGA 1A76A 4G3IA 3VCBA 3MBYA 2HVIA 2F1HA 1SV4A 3WK5A 4I2EA 3PR5B 2W11A 4IQWA 2ZXIA 4NWIA 1TAQA 5AKYA 4C7YA 3E0FA 4DFJA 4RNNA 4DF8A 4O5CA 4NLKA 2PFQA 1ZETA 8ICFA 3KOOA 1X9MA 5ALEA 5DB7A 4BWJA 3M6ZA 1KFDA 5J2IA 2R18A 4RQNA 4BUGA 4F5RA 5DDYA 1SKSA 2ISOA 1QTMA 3WK8A 5L1IA 5JU5A 2OHFA 4MEYA 1RXVA 4EBDA 1ZQTA 3QX7A 4RUCA 3CYMA 3H7IA 1N62A 4R8UB 9ICRA 4OCZA 4F93B 2K8AA 4F2RA 1S97A 4B9SA 5L1LA 1S0VA 1PUZA 2KHVA 4DOBA 4RQMA 2W8KA 1NKCA 2J6SA 4M9JA 5DLFA 4MFFA 3BJYA 2E1FA 3ZDEA 4OO1J 4HAIA 2I6XA 3M8RA 1IIPA 3Q8QB 4ED7A 1U47A 2RDJA 3H4BA 4AYBC 2OXOA 2AGPA 3HKZF 1UPHA 4UB2A 1AROP 3Q8KA 3M9MB 2K4EA 1JXLA 3LDAA 4Y2TA 4RQ7A 5AKKA 5DBBA 4PHDA 2EAOA 4JB3A 5ALOA 2XI9A 2VKQA 5AKJA 5KAIU 1QQ5A 1TE2A 2KMDA 4GIBA 5KFRA 2LHTA 2JR5A 3FAHA 5CB1A 2K4PA 4I2IA 2HW3A 5AKEA 2O6KA 2ASLA 2JEFA 2OEHA 1TKDA 8ICIA 9ICAA 2LI6A 1N63A 5AI5A 1DXSA 2R8KA 4KN7A 4QZEA 2CXYA 3NVVA 3ETRA 4KX5A 4Z6EA 4PGXA 4F4XA 2V4RA 4YMOA 3PW0A 2JMGA 2JEJA 2EAMA 5KG0A 3MGIA 4QZFA 2DWQA 2H3IA 1L7MA 3CP8A 5KT7A 4C4TA 4CCHA 8ICLA 4YG2A 1PK3A 3RB4A 1MN8A 2E1EA 1VJ5A 9ICQA 4M6WA 8ICRA 1B4FA 5G5HA 4KLLA 1K5OA 2ZIVB 5KG3A 1XSNA 4OJPA 2HHWA 3ZD9A 1BGXT 1V38A 2HHTA 4J9LA 1WYGA 3GU3A 4YD2A 3KKAA 1ZQBA 1YZ7A 4NLZA 1PK1A 3MR5A 2BR0A 3PX4A 1ZRNA 4UARA 2CRXA 4UBCA 3QE9Y 2DL0A 1SXDA 4Y2VA 2C28A 2AJQA 1LVHA 4A8EA 1ZQWA 1UA1A 2WF9A 1U49A 4ED6A 5AK5A 4PHPA 5KT5A 4J9NA
chains in the Genus database with same CATH topology
2CPRA 4ICAA 4AYBC 1TAMA 2VIXA 3RF9A 2XI9A 2VKQA 4KX3A 4BX9C 2ZXIA 2BDUA 2OM6A 3SAHA 2G07A 4OJ5A 4WJ3B 2YB1A 4NWIA 2HBMA 4NV0A 2KVCA 3K1ZA 4O3MA 3F2CA 3N7PD 2HOFA 2LYAA 1HIWA 2F77X 2G06A 2K4HA 2WB1F 3CRXA 2JHDA 1GO3F 3E0FA 1PVQA 2DQNB 2LHTA 2WAQF 4AYBF 3SAGA 3KFUF 2YB4A 2ZIXB 3ALRA 2JH1A 2K8BB 1L6NA 3PZPA 2KJ8A 3PSIA 2G08A 2KIWA 2VJ4A 2ZIWA 4GFJA 4BJQA 3NRWA 3PSTA 2W04A 2JGAA 1DRGA 1URJA 3F5AA 2GH1A 3M6ZA 3SAFA 4CRXA 4OJLA 2GOLA 2HBLA 1XO0A 2R18A 1ECWA 2KNJA 2A3VA 2LBOA 1Q3UA 2W7OA 2G09A 4BUGA 3H0MB 2KV2A 3LVVA 3SQIA 4C0ZA 2KJ9A 2HBKA 4FZLA 1Q3VA 4IC9A 4QNLA 4KX5A 3F53A 4JMUA 4U6PA 4PL1A 2DGZA 2JMGA 3OPXA 2KKVA 4FZNA 2Q4TA 1D8BA 2ZIXA 2ZIUB 1YT3A 3NUQA 2F8LA 3M6KA 1Z19A 1MA7A 3KZXA 2MA1A 3F2BA 1F44A 2H3IA 3CP8A 3MGVA 4P0PB 3SMVA 5HR6A 1A6SA 2RRDA 2CN1A 3F5EA 3CYMA 3H0RB 2MRLA 1P7DA 2W7PA 3IP4B 2KKPA 4P0QB 4QJFB 2K4IA 2Y0SC 2E1EA 3F2DA 2DF4B 2HOIA 2K8AA 3HKZC 5HR7A 4OJ6A 2KJ5A 2ZIVB 3N7RC 2ZXHA 2H3VA 2PMZC 2KD1A 4QIWC 2K89A 4OJPA 1A0PA 2H3ZA 2N1RA 1OUQA 1KBUA 4OJOA 3AQEA 3C29A 2JH7A 3VC8A 1CRXA 2XICA 2KHVA 2RHFA 5KL1B 3PSPA 2F2AB 3D2QA 4FZMA 2LYBA 2LKYA 2RP5A 2Z7JA 3ICXA 2YX8A 3PSFA 3GU3A 4NLCA 2G5IB 4FE3A 2E1FA 2XVTA 3IG8A 4OO1J 2ZIUA 1SZHA 1HEKA 2KOBA 5A0LA 3AQFA 1WUDA 3DEEA 3ONNA 2G5HB 2KICA 3IG5A 3L3FX 4CGZA 1IIPA 2H3QA 2OYYA 4P0QA 3AL0B 2G0AA 2WB1C 5C0YA 5KL8B 2CRXA 1PVRA 3O0FA 4CDGA 2Y0SF 1Z1BA 5CRXA 2M0NA 2WAQC 3LYSA 3RFAA 2OXOA 2ZIVA 2HMXA 2W03A 3HKZF 4PL2A 3D2NA 2OH2A 2NV3A 2HBJA 1NZBA 1UPHA 2KHQA 2PMZF 1ED1A 4QIWF 4A8EA 2K8CB 2E5SA 3M7DA 2K4EA 5T14A 1PVPA 2VJ5A 2ZIWB 4U7CA 2KEYA 3N7SC 2ZG6A 4KMOB 3VCBA 3GZFA 1ZQ1C 2D6FC 1XNSA 2H3FA 3C28A 3IN5A 2XIDA 3T79A 1T94A 4P0PA 4NLBA 2F76X 3H0LB 4ACOA 3LVWA 2HOQA 3D2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2N A;  2E5S A;  3D2Q A;  3D2S A; 
#chains in the Genus database with same CATH topology
 3ISC A;  3CNH A;  3NTU A;  2BDU A;  3MR3 A;  2HBM A;  5J2A A;  3N7P D;  3S6J A;  1V9P A;  1T7P A;  1ZQD A;  3TAD C;  2HSZ A;  4F5P A;  3E58 A;  2QKQ A;  3IV6 A;  4DL3 A;  1S0N A;  1H38 A;  4B9U A;  1IG6 A;  3ISB A;  2HBL A;  5CWR A;  3EPG A;  1IXR A;  3PNC A;  4RT2 A;  2EAN A;  3WU2 U;  4K4G A;  3HRD D;  2YN4 A;  5AK6 A;  5AM4 A;  4JWN A;  4J9K A;  2BCQ A;  8ICS A;  2JXJ A;  3B0Y A;  3UPQ A;  2KN7 A;  4FS2 A;  4QJF B;  2W54 A;  4TUP A;  3RJE A;  2EZY A;  5DG8 A;  4FS1 A;  3EWA A;  1T3N A;  1ZQJ A;  3WKD A;  4JV1 A;  4RQ5 A;  3QU5 A;  2V9W A;  3N97 B;  1KQQ A;  3AN1 A;  3RH6 A;  1NJZ A;  3WK9 A;  7ICF A;  3RJG A;  2Y1J A;  4ED0 A;  1KFT A;  3PSP A;  2R8I A;  1QH9 A;  3GV5 B;  1FFV A;  5KTQ A;  5AI9 A;  1LKY A;  3SEI A;  1X9W A;  1K1S A;  1L3T A;  3AQF A;  4CNQ A;  7ICL A;  2ALZ A;  1X9X A;  4RQ1 A;  2G0A A;  2KE7 A;  5KFK A;  4YVZ A;  2KSO A;  4DSE A;  1SL0 A;  3IHQ B;  3B9J A;  4K4H A;  3V7L A;  4O3N A;  4QZ8 A;  5ALL A;  5BOL A;  5ALM A;  2JEI A;  1WWU A;  4DOC A;  4P4P A;  2FPL A;  2E3T A;  1TAU A;  4JV0 A;  2A1A A;  3IN5 A;  3C2L A;  2KP7 A;  1ZXI A;  1TVA A;  1L5U A;  3T5H A;  4DSK A;  2R8G A;  2DUY A;  3SAH A;  4C4S A;  4QW8 A;  4P4M A;  7ICG A;  3Q8L A;  5DB8 A;  4O5K A;  4AYB F;  3KFU F;  1RYR A;  3QXG A;  1HUZ A;  2WHE A;  9ICE A;  5AKL A;  9ICC A;  9ICU A;  1IV8 A;  5IIK A;  2JGA A;  1URJ A;  2PI4 A;  4DSI A;  3MDA A;  4RQ0 A;  1S5L U;  1RZT A;  3RRH A;  1ECW A;  1KRP A;  1RQN A;  3RH5 A;  3LVV A;  2HHU A;  3FDS A;  3KTQ A;  4J03 A;  4Z6C A;  4UAV A;  3JPP A;  4RT3 A;  4FZN A;  5E79 U;  1KKX A;  3M6K A;  2BHN A;  4F4W A;  2HI0 A;  2UVR A;  5ALJ A;  5KG7 A;  5AHX A;  1X6J A;  2KKP A;  1KDH A;  4RZR A;  4EYI B;  1DK2 A;  4ELT A;  4QIW C;  4ECS A;  4I29 A;  4KLO A;  4F5Q A;  1N5X A;  2BCR A;  2BPF A;  9ICH A;  4DL5 A;  3JPQ A;  5J8Y C;  5HNK A;  3IG5 A;  1RYS A;  4EZ6 A;  3RB3 A;  1S0M A;  5DBC A;  5J0W A;  4DL7 A;  4F71 A;  5ALW A;  4US8 A;  1EXN A;  4KLG A;  1T4G A;  3C21 A;  5DLG A;  1ZD2 P;  1RG6 A;  4MEX A;  1SZP A;  2EZZ A;  2XGP A;  5F9L A;  5CHG A;  5DQG A;  3C5G A;  3SD7 A;  3T5J A;  4IRD A;  1ZD3 A;  1ZQR A;  1KEJ A;  1TFR A;  3H0L B;  4ECU A;  3OHA A;  2VIX A;  4KX3 A;  5ALD A;  4MF8 A;  5DGA A;  4B9N A;  2LYA A;  1S77 D;  4EX7 A;  4UB1 A;  1Q8K A;  3GDX A;  5KFC A;  4UAU A;  1XU4 A;  3H8J A;  2ZIW A;  3UMC A;  3V7J A;  3WKE A;  4F4Z A;  3PML A;  3F5A A;  5AM3 A;  4M6W B;  4QZD A;  3TAN A;  3SQI A;  1M6Y A;  4DL4 A;  5BPC A;  4Q8E A;  2VA2 A;  2UVV A;  4FZL A;  4PJ0 U;  5KFY A;  4Q8F A;  7ICE A;  4LJX A;  1ZQV A;  1D8B A;  2BZF A;  3C23 A;  8ICO A;  5KFX A;  3M8S A;  2F44 A;  2MRL A;  4DFK A;  4RQ8 A;  1PK1 B;  2Y0S C;  2DKZ A;  4EBC A;  5HR7 A;  3NS1 A;  4R65 A;  3TFR A;  5AI4 A;  2RQ5 A;  5AM0 A;  3WK4 A;  4I2H A;  3MAB A;  1CI4 A;  1SV0 C;  2RHF A;  4QWC A;  1LB2 B;  3MC1 A;  3C2M A;  1L8O A;  4DQI A;  3RJF A;  2ZIU A;  2W3R A;  8ICB A;  3L3F X;  1MSW D;  3IRU A;  1OW5 A;  4Y2X A;  4UAT A;  5KL8 B;  2MUT A;  5KT6 A;  4DQS A;  1ZQO A;  2HBJ A;  5ALG A;  7ICO A;  2D8C A;  4Q45 A;  3OSP A;  8ICK A;  2E5S A;  3RBE A;  1PVP A;  3WKA A;  5HHI A;  5L1J A;  8ICM A;  1NZP A;  9ICM A;  2IHM A;  4DLE A;  3T79 A;  5III A;  1T8E A;  1NJX A;  5KFA A;  3BZC A;  4NL9 A;  1PVQ A;  3KZI U;  1N60 A;  5KG5 A;  3HT3 A;  4F72 A;  3KHL A;  4DSL A;  1SB3 C;  9ICW A;  2AGO A;  2GH1 A;  3V6K A;  5EWF A;  5DQI A;  1WCL A;  2ZUD A;  4YP3 A;  4YQW A;  9ICT A;  2LBO A;  5IIN A;  2G09 A;  2GO7 A;  1PZN A;  2YQE A;  5EE3 A;  4ED2 A;  2PFN A;  4KIT B;  4EEN A;  5J29 A;  4B9L A;  2Q4T A;  4DL6 A;  2ZIX A;  3GV7 B;  4EBE A;  3NUQ A;  1LKY B;  1NK9 A;  1MA7 A;  1F44 A;  3H0R B;  3F5E A;  3SZ2 A;  2W7P A;  3QUQ A;  3IP4 B;  4I2F A;  5KFB A;  4M04 A;  2DF4 B;  5KAF U;  5J2D A;  9ICB A;  2KSO B;  4I2A A;  3OSN A;  2P66 A;  2KZ3 A;  3M9N B;  1ZQN A;  3PY8 A;  4KLD A;  5KL1 B;  3DDH A;  4PPX A;  3ICX A;  5ALQ A;  1ZQH A;  3IG8 A;  3JPS A;  4O3S A;  3V6J A;  5EWE A;  9ICI A;  5ALF A;  4RPX A;  3OJS A;  4MHV A;  4Y2Y A;  5K4L A;  2AH5 A;  4Y2Q A;  5JUM A;  8ICE A;  2VAN A;  2WF5 A;  3G6V A;  3QEB Z;  4LZG A;  4YD1 A;  3ISD A;  4IQU A;  2HCF A;  3PMN A;  2EQY A;  1L8L A;  4FFD A;  2W03 A;  5KNI A;  2XCA A;  3C2K A;  4C8L A;  4IR1 A;  4QIW F;  8ICV A;  8ICZ A;  2AU0 A;  2YMQ A;  3KD3 A;  4IS7 A;  3HPO A;  2BPC A;  3C28 A;  4UAZ A;  3GIL A;  3HIL A;  1ZQE A;  5DB6 A;  3EPI A;  4WJ3 B;  4OJ5 A;  1S10 A;  7ICI A;  3K1Z A;  1ZYQ A;  5ALT A;  2JHD A;  1GO3 F;  2NO4 A;  2FI1 A;  8ICY A;  4DEZ A;  2B21 A;  4Q43 A;  5L9X A;  5TZV A;  3T3F A;  5B5E U;  5EE9 A;  2DKX A;  5KFQ A;  3I76 A;  4UAY A;  3PW4 A;  2NRZ A;  1XO0 A;  1ZD4 A;  1SL2 A;  2YMM A;  3SV3 A;  3H8W A;  5TIS U;  4ECQ A;  2DPI A;  1HJP A;  3PX6 A;  4GC6 A;  5AIB A;  4O0I A;  4UB3 A;  1Z19 A;  4KLM A;  1A6S A;  3RJI A;  2W9A A;  4B9V A;  3QUC A;  3Q8S B;  4DF4 A;  2E8P A;  5KFN A;  2HOI A;  2ZXH A;  2K89 A;  1A0P A;  1X66 A;  1CRX A;  4O9M A;  3HX0 A;  4FZM A;  4NLC A;  1SZH A;  4DS5 A;  3KHG A;  3TAR A;  1L3U A;  1RQL A;  2NRT A;  3T5K A;  5AKH A;  3O0F A;  2Y0S F;  4IRK A;  2M0N A;  1UHU A;  4BWM A;  5EE1 A;  1UT8 A;  1D9D A;  2NV3 A;  1C7Y A;  4ZOH C;  1NZB A;  1S8O A;  4ZH4 A;  4CF4 A;  5BOM A;  2PFO A;  2BKE A;  5T14 A;  2ZIW B;  5HMM A;  4YFK A;  4KN4 A;  2ZG6 A;  4F8R A;  2BQ3 A;  5IIL A;  1T94 A;  3LVW A;  3SR6 A;  3AUO A;  4ICA A;  5C5J A;  1J2N A;  4BX9 C;  2ZJ8 A;  1X40 A;  2FDR A;  2YB1 A;  4I2J A;  5GTI U;  9ICP A;  5CA7 A;  5KFZ A;  1NJW A;  2P6U A;  2FE9 A;  4DOA A;  3N28 A;  1UA0 A;  4EZ9 A;  1TK0 A;  2ESE A;  3TFS A;  1RXW A;  1ZQY A;  4LZD A;  3PVX A;  3NRZ A;  3V72 A;  9ICK A;  4TUS A;  3V7K A;  1Q3U A;  5KFV A;  2KV2 A;  1N56 A;  4US9 A;  2HHX A;  4F4Y A;  2RLT A;  3ZDD A;  5L1K A;  2YMP A;  4DSJ A;  2FMP A;  5DDM A;  2ZIU B;  5AM2 A;  5H2F U;  4M9N A;  1SKW A;  1JI7 A;  3RBD A;  4UW9 A;  3LK9 A;  3AU6 A;  2C2E A;  4QZG A;  3UQ2 A;  2MUT B;  5KT2 A;  1ZQF A;  3C1Y A;  4YMM A;  9ICJ A;  1KBU A;  7ICK A;  8ICC A;  5ALX A;  3AQE A;  3C29 A;  8ICU A;  4GC7 A;  1Z00 A;  5ALP A;  1QLN A;  1JMS A;  3A0H U;  7ICV A;  3PSF A;  5KG1 A;  3NGD A;  1O08 A;  8ICP A;  1HEK A;  2M9N A;  3BZK A;  2KOB A;  1ZQS A;  3ONN A;  2KIC A;  1RYU A;  3V6H A;  2XO7 A;  2NRX A;  3PR4 A;  2WB1 C;  4NM2 A;  4PGY A;  2ODG A;  3RFA A;  3TKA A;  3D2N A;  1BPD A;  5J2K A;  3J81 j;  4F92 B;  3ETL A;  1DGS A;  1U4B A;  7ICM A;  1Z3E B;  2KEY A;  4KLU A;  2ZTD A;  1J97 A;  4I28 A;  5AM1 A;  1SKR A;  1QQ6 A;  2JV3 A;  4ACO A;  1NK6 A;  4PHA A;  1UQV A;  1X9S A;  1FFU A;  1TAM A;  2DFL A;  4TUQ A;  3HWT A;  5CJ7 A;  2FPM A;  4O3Q A;  2RDI A;  2OCE A;  2F77 X;  3CRX A;  1B0X A;  3BQ2 A;  4RNM A;  1ZQI A;  2ZIX B;  4YR0 A;  2W9M A;  3PZP A;  5AK3 A;  2HHQ A;  4LVS A;  3NAS A;  1NKE A;  5AKI A;  4RUA A;  5J2C A;  4CRX A;  1SWV A;  2A3V A;  2W7O A;  2E8O A;  4C80 A;  3I1Y A;  5HP4 A;  1RPL A;  4JMU A;  1L7P A;  4OD0 A;  1WCN A;  5J0O A;  5J0U A;  3RTV A;  2HHV A;  1BPE A;  3PO4 A;  4YXM A;  4P0P B;  3B0X A;  3SMV A;  2BQU A;  2CN1 A;  1Q46 A;  2ASD A;  4ED8 A;  4J9M A;  2Y9T A;  3ZDA A;  4DCC A;  4EYH B;  2MSN A;  3FC4 A;  4ELU A;  2VA3 A;  4HYK A;  2H3V A;  4F5O A;  3GQC A;  1L3V A;  1QSS A;  2J6U A;  3Q8P B;  4GXK A;  1JN3 A;  3JPN A;  3LWM A;  3EYZ A;  3D2Q A;  4FBU A;  4FBT A;  2LYB A;  1NJY A;  4CF5 A;  3IDW A;  2XVT A;  4J9P A;  5J2G A;  5A0L A;  1A77 A;  1ZQM A;  2FLN A;  4PZN A;  9ICG A;  2KIV A;  4I2B A;  4CGZ A;  4DFM A;  3AL0 B;  4TUR A;  1FEZ A;  4RQ6 A;  5AIA A;  9ICF A;  3BQ1 A;  4ELV A;  2BGW A;  2L5Y A;  2K60 A;  1KN5 A;  2DPJ A;  1ZQK A;  2NO5 A;  4M9H A;  2PXI A;  3RF9 A;  4KLE A;  3F2C A;  2ES6 A;  2G06 A;  1KL9 A;  3H8M A;  4USA A;  5KFF A;  3HW8 A;  3TAQ A;  1L6N A;  5KFJ A;  2VJ4 A;  5J2E A;  4J9Q A;  3N4M B;  3ZDB A;  3HJE A;  8ICX A;  4MF2 A;  1TK8 A;  2IOF K;  4QWB A;  3KKA C;  2GWS A;  4EX6 A;  3GIJ A;  2KJ9 A;  1VDV A;  3RR7 A;  4IC9 A;  2FMS A;  4PL1 A;  2DGZ A;  2ISP A;  4IQT A;  1X42 A;  2A19 A;  1ZOL A;  2QB0 A;  4QZI A;  3JPR A;  1N61 A;  3BS5 B;  2MA1 A;  3F2B A;  3RAQ A;  1FIQ A;  1CEZ A;  4Y2U A;  5AK4 A;  4NXZ A;  3C5F A;  4NY8 A;  1QSL A;  2KJ5 A;  8ICG A;  2KD1 A;  1ZJN A;  4I27 A;  4O5E A;  1NKB A;  1QQ7 A;  3H4D A;  5F9N A;  3Q8R B;  2RP5 A;  2XGQ A;  9ICS A;  1RDF A;  1L3S A;  4RQ4 A;  1MQ2 A;  2QB1 A;  1AQ6 A;  4JUZ A;  3KBB A;  4YMN A;  1CUK A;  3ED5 A;  5CRX A;  2OH2 A;  2KHQ A;  2HHS A;  1MQ3 A;  3QZ8 A;  8ICN A;  3WKB A;  1ZQC A;  5IIM A;  4XA5 A;  5KFD A;  4KMO B;  4EEY A;  1O03 A;  4P4O A;  3BQ7 A;  2F76 X;  4NLB A;  3OHB A;  4ECV A;  1NOM A;  2KK0 A;  2KFZ A;  1F0M A;  3NVZ A;  4UB6 U;  3KHH A;  2KVS A;  1SXE A;  1BPZ A;  4O3M A;  1Z4N A;  4NV0 A;  5EWG A;  4DFD A;  2WB1 F;  4K4I A;  4BXO A;  1DGJ A;  4DL2 A;  1DK3 A;  5KFW A;  3SAG A;  2ZUC A;  3ALR A;  2JH1 A;  3MFI A;  2K8B B;  5ALZ A;  1YZ6 A;  2KIW A;  4GFJ A;  5D46 A;  3NRW A;  3PST A;  1DRG A;  2E8N A;  3QU9 A;  3G6Y A;  1L7O A;  4C7Z A;  5AI6 A;  4RQ2 A;  3UXN A;  1Z00 B;  3ZI4 A;  4I2G A;  2XY6 A;  4KLS A;  3UQ0 A;  4B6J A;  3WK7 A;  4Y2R A;  5JRT A;  4KLF A;  2YY6 A;  7ICT A;  5KFP A;  3F2D A;  2W9C A;  4DWI A;  4OJ6 A;  3TAD A;  5KFO A;  4R63 A;  1NK7 A;  2H3Z A;  2BCS A;  5KFT A;  2JH7 A;  3H40 A;  3QEA Z;  2W9B A;  2Z7J A;  5AI8 A;  5KT4 A;  4Y2P A;  4FE3 A;  3QU4 A;  7ICQ A;  1WUD A;  3DEE A;  4EEL A;  4GLX A;  1SIJ A;  1ZQX A;  3SYZ A;  4DLG A;  4DO9 A;  5FP0 A;  2AHO B;  2MU2 A;  1PVR A;  1S76 D;  1Z1B A;  4ECZ A;  2WAQ C;  2UVW A;  3Q8M A;  1BPY A;  8ICQ A;  1ZRM A;  2IMW P;  2FLP A;  4UB5 A;  9ICO A;  4IQV A;  3PX0 A;  2R8H A;  3TAP A;  7ICS A;  1T3Q A;  8ICJ A;  3GIK A;  2K8C B;  4ECR A;  4RNO A;  3M1Y A;  2IBK A;  2QAR A;  1XNS A;  1ZQL A;  4P0P A;  4M47 A;  2IHN A;  5J2B A;  3IM1 A;  5KFU A;  2BCU A;  5J0Y A;  2K4H A;  4PHE A;  2AXT U;  4I2C A;  1NI3 A;  4YR3 A;  1ZQG A;  2FPK A;  2D3D A;  2F8K A;  2FMQ A;  2LMR A;  2V4Q A;  1BPX A;  1NK5 A;  4YN4 A;  2P35 A;  4C8K A;  1KLN A;  4Y2S A;  4M9L A;  2GLE A;  2JZB A;  3QU2 A;  1ZQQ A;  4PZO A;  4J9O A;  2KNJ A;  2ASJ A;  4NLN A;  5HML A;  3C1Z A;  1XSL A;  4QNL A;  5AIC A;  1U45 A;  4MFC A;  3WK6 A;  4UB8 U;  4BGD A;  4UB4 A;  5F3X B;  5CP2 A;  1P7D A;  4QWA A;  2JRZ A;  3QUB A;  5KG6 A;  3CW2 C;  1Z1V A;  2KZZ A;  2FJ6 A;  3G6X A;  4DS4 A;  2N1R A;  1ZD5 A;  2I1Q A;  2IOF A;  4Z6F A;  2YX8 A;  4RPY A;  3D6J A;  3BQT A;  9ICX A;  4FO6 A;  4Q44 A;  5AKG A;  2JEG A;  3RB0 A;  1ZQA A;  5J0P A;  1ZQU A;  5KFH A;  2KFN A;  2YTU A;  4XUS A;  3FM9 A;  1COK A;  2EAP A;  3DV9 A;  3LYS A;  5IIO A;  3NVW A;  4NJ8 A;  1ED1 A;  4ECW A;  1V97 A;  3QYP A;  3AEV A;  2WF7 A;  5KFS A;  3E2E A;  2F3N A;  2KG5 A;  3K1R B;  4QZC A;  2ZJ5 A;  3T5L A;  1KTQ A;  2D6F C;  1XO1 A;  3BS5 A;  2LPE A;  5J0S A;  3SAF A;  3QU7 A;  5EOZ A;  7ICJ A;  2CPR A;  2AQ0 A;  1N2X A;  5HHH A;  2XC9 A;  3RJH A;  7ICR A;  3EW9 A;  2HOF A;  2MAX A;  3LWL A;  8ICT A;  5J8Y A;  5D4B A;  5ALR A;  1JAL A;  2QB0 B;  3L5K A;  4KLJ A;  3UM9 A;  2WTF A;  5KFG A;  4RU9 A;  4NM1 A;  1FO4 A;  2GOL A;  1V85 A;  1KW4 A;  3SI8 A;  4JK1 A;  2HBK A;  1XSP A;  4F91 B;  3UXP A;  3F53 A;  4O3R A;  3OPX A;  2A1J A;  2KKV A;  4GXI A;  4ECY A;  3MGV A;  5HR6 A;  5ALS A;  7ICN A;  3SEN A;  1D8Y A;  3BQ0 A;  4QZA A;  1COO A;  2XY7 A;  8ICA A;  5AKZ A;  3BDP A;  2ATL A;  1OUQ A;  4AP9 A;  1ZQZ A;  2XIC A;  8ICH A;  4J9S A;  4RPZ A;  3AU2 A;  1WWV A;  1KSP A;  2WFA A;  5ALK A;  3K75 D;  4NL9 C;  4P2H A;  4DQR A;  1B43 A;  4M9G A;  2C2R A;  5KG4 A;  4P0Q A;  3UXO A;  3QNM A;  3EUB 2;  4B9M A;  1U9L A;  2BQR A;  4BXO B;  5B66 U;  4ED1 A;  2HMX A;  1KFS A;  2ZTE A;  2OWO A;  2UVU A;  4O3O A;  2J6T A;  7ICH A;  4F50 A;  4U7C A;  2I5H A;  1JUD A;  5DQH A;  1F5S A;  3GFK B;  9ICV A;  2H3F A;  2W3S A;  4QW9 A;  1QCK A;  2XID A;  5AI0 A;  2HOQ A;  3RH4 A;  3D2S A;  1SV0 A;  3RR8 A;  2G07 A;  2DBY A;  2C22 A;  3H8S A;  5J0Q A;  4QWD A;  4J9R A;  4KLH A;  4IL6 U;  4KMU A;  5CEH A;  4PGQ A;  5DBA A;  1MC8 A;  2WAQ F;  1B22 A;  1X2I A;  5J2H A;  1N48 A;  1JRO A;  2KJ8 A;  3PSI A;  2KTQ A;  2HDO A;  4QZ9 A;  1X6I A;  4BJQ A;  3THV A;  2W04 A;  1SWW A;  4DFP A;  2W9C B;  4DQQ A;  1VLB A;  5G5G A;  3H0M B;  1S9F A;  1TV9 A;  1Q3V A;  2Y1I A;  5DKW A;  2W9B B;  5ALY A;  3TQ1 A;  4MFA A;  4F2S A;  4TQS A;  4YXJ A;  5J0R A;  2YML A;  4QZH A;  4CE6 A;  3HP6 A;  1BPB A;  1BNO A;  1JRP A;  2F1I A;  3N7R C;  2WF6 A;  5KFL A;  2LM4 A;  1JXE A;  2PMZ C;  1D8L A;  3R9K A;  4F4K A;  5DGB A;  5AKX A;  2AQ4 A;  5KT3 A;  1OXJ A;  3ZDC A;  1XS9 D;  2QAR B;  1Y88 A;  4ECX A;  5L1M A;  1IM4 A;  4PH5 A;  3MR2 A;  3RB6 A;  2HVH A;  3PO5 A;  4IRC A;  5DG9 A;  4R8U A;  5C0Y A;  3QZ7 A;  2ZJA A;  2NYV A;  4RQ3 A;  1NK0 A;  5IIJ A;  5J2F A;  1JIH A;  3NVY A;  1NK4 A;  3MFH A;  7ICU A;  4Y2J A;  3N7S C;  1ZQ1 C;  3L4P A;  3RAX A;  2IA6 A;  1RM6 C;  2JZB B;  2PFP A;  1K1Q A;  3MDC A;  3PW2 A;  2EZX A;  2OM6 A;  2I9G A;  1J2M A;  4BDP A;  4UBB A;  2KVC A;  1NNL A;  1XWL A;  1HIW A;  2BCV A;  4KLQ A;  2NRV A;  2W55 A;  2PI5 A;  2YB4 A;  1HUO A;  1JX4 A;  1DOQ A;  5GTH U;  1BVS A;  4XQ8 A;  2G08 A;  3ZD8 A;  2P6R A;  1NK8 A;  4O3P A;  4X5V A;  4KLT A;  4OJL A;  4ECT A;  4ED3 A;  3AM9 A;  3SV4 A;  2R8J A;  3A0B U;  3UMB A;  4U6P A;  3OJU A;  5ALH A;  4C8N A;  2F8L A;  3JPT A;  2RRD A;  2XCP A;  1SL1 A;  2VA8 A;  5DG7 A;  2K4I A;  3TAC B;  2KZM A;  3HKZ C;  5ALV A;  3MR6 A;  2EDU A;  3FYH A;  2B0C A;  4C8M A;  5J0T A;  3QUT A;  3OTQ A;  2F2A B;  4EEK A;  3MGH A;  2G5I B;  4Z6D A;  1XC9 A;  5ALU A;  4F3O A;  1BNP A;  2LYH A;  3RJK A;  1SGG A;  4KLI A;  3TI0 A;  2NRW A;  1S0O A;  2H3Q A;  4M0A A;  4CF3 A;  4NLG A;  1WG8 A;  2ZIV A;  4PL2 A;  5AM5 A;  3WKC A;  4JV2 A;  5EE0 A;  3M9O B;  3M7D A;  4YCX A;  1TK5 A;  5CR0 A;  2F1J A;  2VJ5 A;  5D49 A;  4TQR A;  1D9F A;  4I2D A;  3GZF A;  7ICP A;  5JTI A;  3KHR A;  3JPO A;  2AGQ A;  4E0D A;  5KFM A;  4G9B A;  3RJJ A;  3PW7 A;  4GXJ A;  3K4G A;  2DQN B;  5ALI A;  2A1J B;  2IOH A;  4UQG A;  4YR2 A;  4QZB A;  9ICL A;  1U48 A;  2W43 A;  5KFE A;  2C2D A;  3GV8 B;  4IR9 A;  4XRH A;  2XY5 A;  1N5W A;  2W8L A;  3BS7 A;  1LV5 A;  4C0Z A;  3AMZ A;  2ZTC A;  4C4R A;  2Q0Z X;  1ZQP A;  1C20 A;  3GII A;  3OGU A;  4DSF A;  1YT3 A;  1Z4O A;  5ALN A;  3KZX A;  3PW5 A;  3EZ5 A;  5KG2 A;  9ICN A;  1UCV A;  4UAS A;  2WF8 A;  2B6G A;  4P0Q B;  2QLT A;  4F5N A;  4C8O A;  3I28 A;  4B9T A;  5J2J A;  2FLL A;  2ZUB A;  5DB9 A;  2PKE A;  2EH9 A;  1ZJM A;  5KFI A;  4UAW A;  3U26 A;  2LM1 A;  4OJO A;  3VC8 A;  4JWM A;  2LKY A;  5J0X A;  2BDP A;  4KTQ A;  3ORY A;  2Y9U A;  1UT5 A;  2G5H B;  1QSY A;  2OYY A;  3PV8 A;  4M2Y A;  8ICW A;  3GIM A;  4CDG A;  4DQP A;  1L7N A;  2E8M A;  4R64 A;  2H5X A;  3UMG A;  4R66 A;  3RRG A;  2PMZ F;  4QWE A;  2BPG A;  1A76 A;  4G3I A;  3VCB A;  3MBY A;  2HVI A;  2F1H A;  1SV4 A;  3WK5 A;  4I2E A;  3PR5 B;  2W11 A;  4IQW A;  2ZXI A;  4NWI A;  1TAQ A;  5AKY A;  4C7Y A;  3E0F A;  4DFJ A;  4RNN A;  4DF8 A;  4O5C A;  4NLK A;  2PFQ A;  1ZET A;  8ICF A;  3KOO A;  1X9M A;  5ALE A;  5DB7 A;  4BWJ A;  3M6Z A;  1KFD A;  5J2I A;  2R18 A;  4RQN A;  4BUG A;  4F5R A;  5DDY A;  1SKS A;  2ISO A;  1QTM A;  3WK8 A;  5L1I A;  5JU5 A;  2OHF A;  4MEY A;  1RXV A;  4EBD A;  1ZQT A;  3QX7 A;  4RUC A;  3CYM A;  3H7I A;  1N62 A;  4R8U B;  9ICR A;  4OCZ A;  4F93 B;  2K8A A;  4F2R A;  1S97 A;  4B9S A;  5L1L A;  1S0V A;  1PUZ A;  2KHV A;  4DOB A;  4RQM A;  2W8K A;  1NKC A;  2J6S A;  4M9J A;  5DLF A;  4MFF A;  3BJY A;  2E1F A;  3ZDE A;  4OO1 J;  4HAI A;  2I6X A;  3M8R A;  1IIP A;  3Q8Q B;  4ED7 A;  1U47 A;  2RDJ A;  3H4B A;  4AYB C;  2OXO A;  2AGP A;  3HKZ F;  1UPH A;  4UB2 A;  1ARO P;  3Q8K A;  3M9M B;  2K4E A;  1JXL A;  3LDA A;  4Y2T A;  4RQ7 A;  5AKK A;  5DBB A;  4PHD A;  2EAO A;  4JB3 A;  5ALO A;  2XI9 A;  2VKQ A;  5AKJ A;  5KAI U;  1QQ5 A;  1TE2 A;  2KMD A;  4GIB A;  5KFR A;  2LHT A;  2JR5 A;  3FAH A;  5CB1 A;  2K4P A;  4I2I A;  2HW3 A;  5AKE A;  2O6K A;  2ASL A;  2JEF A;  2OEH A;  1TKD A;  8ICI A;  9ICA A;  2LI6 A;  1N63 A;  5AI5 A;  1DXS A;  2R8K A;  4KN7 A;  4QZE A;  2CXY A;  3NVV A;  3ETR A;  4KX5 A;  4Z6E A;  4PGX A;  4F4X A;  2V4R A;  4YMO A;  3PW0 A;  2JMG A;  2JEJ A;  2EAM A;  5KG0 A;  3MGI A;  4QZF A;  2DWQ A;  2H3I A;  1L7M A;  3CP8 A;  5KT7 A;  4C4T A;  4CCH A;  8ICL A;  4YG2 A;  1PK3 A;  3RB4 A;  1MN8 A;  2E1E A;  1VJ5 A;  9ICQ A;  4M6W A;  8ICR A;  1B4F A;  5G5H A;  4KLL A;  1K5O A;  2ZIV B;  5KG3 A;  1XSN A;  4OJP A;  2HHW A;  3ZD9 A;  1BGX T;  1V38 A;  2HHT A;  4J9L A;  1WYG A;  3GU3 A;  4YD2 A;  3KKA A;  1ZQB A;  1YZ7 A;  4NLZ A;  1PK1 A;  3MR5 A;  2BR0 A;  3PX4 A;  1ZRN A;  4UAR A;  2CRX A;  4UBC A;  3QE9 Y;  2DL0 A;  1SXD A;  4Y2V A;  2C28 A;  2AJQ A;  1LVH A;  4A8E A;  1ZQW A;  1UA1 A;  2WF9 A;  1U49 A;  4ED6 A;  5AK5 A;  4PHP A;  5KT5 A;  4J9N A; 
#chains in the Genus database with same CATH homology
 2CPR A;  4ICA A;  4AYB C;  1TAM A;  2VIX A;  3RF9 A;  2XI9 A;  2VKQ A;  4KX3 A;  4BX9 C;  2ZXI A;  2BDU A;  2OM6 A;  3SAH A;  2G07 A;  4OJ5 A;  4WJ3 B;  2YB1 A;  4NWI A;  2HBM A;  4NV0 A;  2KVC A;  3K1Z A;  4O3M A;  3F2C A;  3N7P D;  2HOF A;  2LYA A;  1HIW A;  2F77 X;  2G06 A;  2K4H A;  2WB1 F;  3CRX A;  2JHD A;  1GO3 F;  3E0F A;  1PVQ A;  2DQN B;  2LHT A;  2WAQ F;  4AYB F;  3SAG A;  3KFU F;  2YB4 A;  2ZIX B;  3ALR A;  2JH1 A;  2K8B B;  1L6N A;  3PZP A;  2KJ8 A;  3PSI A;  2G08 A;  2KIW A;  2VJ4 A;  2ZIW A;  4GFJ A;  4BJQ A;  3NRW A;  3PST A;  2W04 A;  2JGA A;  1DRG A;  1URJ A;  3F5A A;  2GH1 A;  3M6Z A;  3SAF A;  4CRX A;  4OJL A;  2GOL A;  2HBL A;  1XO0 A;  2R18 A;  1ECW A;  2KNJ A;  2A3V A;  2LBO A;  1Q3U A;  2W7O A;  2G09 A;  4BUG A;  3H0M B;  2KV2 A;  3LVV A;  3SQI A;  4C0Z A;  2KJ9 A;  2HBK A;  4FZL A;  1Q3V A;  4IC9 A;  4QNL A;  4KX5 A;  3F53 A;  4JMU A;  4U6P A;  4PL1 A;  2DGZ A;  2JMG A;  3OPX A;  2KKV A;  4FZN A;  2Q4T A;  1D8B A;  2ZIX A;  2ZIU B;  1YT3 A;  3NUQ A;  2F8L A;  3M6K A;  1Z19 A;  1MA7 A;  3KZX A;  2MA1 A;  3F2B A;  1F44 A;  2H3I A;  3CP8 A;  3MGV A;  4P0P B;  3SMV A;  5HR6 A;  1A6S A;  2RRD A;  2CN1 A;  3F5E A;  3CYM A;  3H0R B;  2MRL A;  1P7D A;  2W7P A;  3IP4 B;  2KKP A;  4P0Q B;  4QJF B;  2K4I A;  2Y0S C;  2E1E A;  3F2D A;  2DF4 B;  2HOI A;  2K8A A;  3HKZ C;  5HR7 A;  4OJ6 A;  2KJ5 A;  2ZIV B;  3N7R C;  2ZXH A;  2H3V A;  2PMZ C;  2KD1 A;  4QIW C;  2K89 A;  4OJP A;  1A0P A;  2H3Z A;  2N1R A;  1OUQ A;  1KBU A;  4OJO A;  3AQE A;  3C29 A;  2JH7 A;  3VC8 A;  1CRX A;  2XIC A;  2KHV A;  2RHF A;  5KL1 B;  3PSP A;  2F2A B;  3D2Q A;  4FZM A;  2LYB A;  2LKY A;  2RP5 A;  2Z7J A;  3ICX A;  2YX8 A;  3PSF A;  3GU3 A;  4NLC A;  2G5I B;  4FE3 A;  2E1F A;  2XVT A;  3IG8 A;  4OO1 J;  2ZIU A;  1SZH A;  1HEK A;  2KOB A;  5A0L A;  3AQF A;  1WUD A;  3DEE A;  3ONN A;  2G5H B;  2KIC A;  3IG5 A;  3L3F X;  4CGZ A;  1IIP A;  2H3Q A;  2OYY A;  4P0Q A;  3AL0 B;  2G0A A;  2WB1 C;  5C0Y A;  5KL8 B;  2CRX A;  1PVR A;  3O0F A;  4CDG A;  2Y0S F;  1Z1B A;  5CRX A;  2M0N A;  2WAQ C;  3LYS A;  3RFA A;  2OXO A;  2ZIV A;  2HMX A;  2W03 A;  3HKZ F;  4PL2 A;  3D2N A;  2OH2 A;  2NV3 A;  2HBJ A;  1NZB A;  1UPH A;  2KHQ A;  2PMZ F;  1ED1 A;  4QIW F;  4A8E A;  2K8C B;  2E5S A;  3M7D A;  2K4E A;  5T14 A;  1PVP A;  2VJ5 A;  2ZIW B;  4U7C A;  2KEY A;  3N7S C;  2ZG6 A;  4KMO B;  3VCB A;  3GZF A;  1ZQ1 C;  2D6F C;  1XNS A;  2H3F A;  3C28 A;  3IN5 A;  2XID A;  3T79 A;  1T94 A;  4P0P A;  4NLB A;  2F76 X;  3H0L B;  4ACO A;  3LVW A;  2HOQ A;  3D2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...