3D2NA

Crystal structure of mbnl1 tandem zinc finger 1 and 2 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
TKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding, rna binding protein
molecule keywords Muscleblind-like protein 1
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2008-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2nA00
2E5SA 3D2NA 3D2QA 3D2SA
chains in the Genus database with same CATH superfamily
5KFDA 5DB8A 4F91B 3PX4A 3L3FX 4KLLA 1SXEA 2B6GA 4KLOA 4OJ6A 4PHEA 2GLEA 2E1EA 4UB6U 4ECUA 3ZDBA 3QX7A 2K8BB 1Z00B 5KG0A 5DBBA 1NK0A 2Y1JA 3JPNA 4QW9A 2DWQA 1JN3A 1ZQKA 4K4HA 3OSPA 3BQ2A 4PGXA 4GC7A 4RQMA 3C29A 4XRHA 2E5SA 4XUSA 4O9MA 4DSIA 4GXIA 4DLGA 5AKKA 4YD2A 5KT5A 2ZJAA 3NUQA 5D4BA 5J2FA 3EZ5A 1S77D 2PFOA 4P0PB 3N7PD 5KG1A 2EZYA 5BPCA 3M1YA 3C2KA 5J2IA 5HMLA 5ALZA 2XI9A 2WAQC 2YMPA 3TI0A 1ZJMA 3V7KA 1BPZA 3C2LA 2OWOA 3OHAA 1DXSA 1NOMA 2HI0A 3KKAA 2M9NA 1RYRA 2A1AA 5KFCA 3RB3A 2QKQA 1NJXA 1S0NA 1BPXA 3V7JA 4J9LA 5KFRA 3OHBA 3RB0A 5ALNA 4FE3A 1B43A 5DGAA 4EYHB 4KLJA 4QWEA 2DQNB 3F5AA 3RRHA 1X2IA 2JGAA 3WKDA 3ZD8A 1QCKA 3UMCA 4RPXA 4KLHA 4PHAA 3QE9Y 2HHXA 2JMGA 4QWCA 1BNPA 9ICNA 4OJLA 4DQQA 4UW9A 4F4ZA 4KLFA 2DUYA 3K4GA 1FFUA 1KLNA 2KN7A 2H3VA 4F5OA 3RFAA 2W9BB 1ZETA 1PVRA 4P4MA 1V38A 2C2DA 5DB9A 9ICEA 2RLTA 1AQ6A 1ZD4A 1N63A 4GXKA 9ICTA 2Y9TA 3MFHA 2KZ3A 2JV3A 4XQ8A 1WWVA 2FI1A 2XY5A 2ZXIA 2F1JA 1NJYA 2PI4A 4EZ6A 4I2EA 9ICMA 5AK6A 5J0XA 1NNLA 4ECTA 4YG2A 2E1FA 9ICJA 3N97B 1IXRA 3AMZA 1FIQA 1U45A 2ASJA 4NY8A 3H4DA 2DPJA 2PKEA 3JPSA 3HT3A 1KFTA 4DEZA 3E0FA 5J0RA 3HPOA 3KFUF 4KLMA 2R8HA 2ZIUA 4Y2RA 5AK5A 1UPHA 2F1HA 2R8GA 4UATA 5DKWA 2FE9A 1JRPA 5KFPA 4DLEA 5KT7A 3GIIA 4QZBA 3NTUA 7ICTA 2IMWP 5J2BA 5J2HA 3BQ7A 4FBUA 3AM9A 3VCBA 4NLZA 3HKZC 1V85A 3QZ7A 2RDIA 4PL2A 7ICJA 2B21A 2P66A 5J0PA 3WK4A 4YR3A 5KFZA 1SB3C 4J03A 1JXEA 4P0QA 4ZOHC 3KHHA 1ZQGA 1D8LA 1L5UA 3PO4A 1RQNA 4F4XA 4DSFA 2VA3A 4Z6FA 3QU9A 4C4SA 5JU5A 2EAOA 2P35A 4OCZA 5KFVA 4UAZA 4P4OA 2D6FC 3KTQA 3B9JA 4QZFA 2KJ9A 2FLNA 1SV0A 3RR7A 5AKXA 4I28A 1EXNA 3EPIA 4F5RA 2LYAA 2XCPA 2ZIWB 1D9DA 1U9LA 5ALQA 2VA8A 5J8YC 1XS9D 3OSNA 1IM4A 4ECSA 3UQ0A 1Q46A 4DFJA 1QQ5A 2HHSA 2VANA 5KG7A 3RJJA 4O3SA 2CXYA 2ALZA 1DOQA 4C4RA 4IC9A 5ALLA 2ZJ5A 2HHWA 1J2NA 2BPCA 3IM1A 1N56A 4Q43A 5KL1B 4YFKA 1OUQA 3NVWA 4G9BA 2C22A 2E8OA 4TURA 2YB4A 1PK1A 5EE1A 3LWLA 9ICVA 3ED5A 2G5IB 2BDPA 1LV5A 5J2DA 1HUOA 1ZQAA 4FZMA 4RT3A 2HDOA 4QZEA 1COKA 4GLXA 7ICPA 9ICUA 4ED6A 1MQ3A 2QLTA 2RQ5A 1SV4A 4IQUA 1D9FA 2ZTCA 3GIJA 1RYSA 4ED1A 4DQSA 4MFAA 5KFSA 5KFBA 3PV8A 4EX6A 1X6IA 2R8IA 5DG9A 4NWIA 1SXDA 4Y2VA 4JUZA 3UQ2A 3PX6A 2W7PA 2KZZA 2V4QA 2OM6A 4RUAA 8ICCA 4I2FA 8ICPA 1K1QA 5AHXA 5ALSA 2CPRA 3TARA 3QNMA 4B9UA 1L8LA 4O3MA 5KFKA 2V4RA 4NJ8A 4GXJA 3LYSA 4J9RA 7ICGA 9ICWA 1S5LU 5AK3A 5DLFA 4DQRA 2WF8A 2KIVA 3WKEA 5DG8A 2VIXA 3QYPA 7ICNA 1TAQA 3SAGA 4Z6EA 3BQ0A 4YQWA 3DDHA 4I2CA 5AI8A 4WJ3B 1V9PA 5IIIA 3FC4A 3IG8A 3N4MB 1QH9A 1XO0A 1T7PA 3PSPA 5HNKA 4C8MA 1TK8A 5KFOA 1TK5A 2DL0A 4QJFB 3RAXA 2D3DA 1PUZA 2XC9A 3D6JA 4UQGA 3MFIA 4F5QA 5L1KA 4IQWA 1ZQOA 9ICIA 2Q0ZX 2KJ8A 4J9KA 3DEEA 3ZD9A 4KN4A 3H8WA 5KFJA 4UAWA 3MR6A 4P0PA 3RJIA 2FPKA 2QARB 1NK4A 1Z1VA 1KTQA 4FS1A 1MQ2A 3GDXA 1S0OA 4C8OA 4BWJA 1ZD3A 4F93B 1L7OA 2KHVA 5DG7A 1Q8KA 2NRZA 1UA0A 2W3SA 2JH7A 8ICGA 5K4LA 2VA2A 5ALWA 3ISBA 1ZRMA 2BQ3A 3BDPA 4UB2A 2JEFA 2JXJA 3QUTA 4PGQA 3J81j 4ACOA 2IBKA 4LZDA 4NV0A 5AICA 3I76A 3M9OB 1BGXT 4YN4A 1ZQSA 8ICBA 3C5FA 2ZIXB 2NRVA 2LMRA 5ALVA 2YMLA 4NLCA 2JZBA 2ZG6A 9ICBA 7ICRA 3HJEA 5KFYA 1BPYA 3M8SA 4U7CA 3TFRA 2HCFA 1NI3A 4M9NA 7ICVA 1ZD2P 4DFDA 4ELVA 4RT2A 2KOBA 4YVZA 3KHLA 4RNOA 2EH9A 1H38A 1X9SA 2W8KA 2R8KA 4LZGA 3RJKA 4X5VA 5AI9A 2LYHA 1URJA 9ICKA 5EE3A 5KFWA 3PW5A 2EAPA 8ICHA 3UXNA 5ALOA 2YQEA 3G6VA 1HEKA 4CRXA 1ZQLA 2AJQA 2AHOB 4I2IA 1A0PA 3BJYA 1TFRA 2WB1F 5KT6A 4EX7A 8ICIA 3BS5B 4QZIA 3H40A 2E8PA 3H8MA 2OH2A 9ICRA 4M0AA 4YXJA 3SEIA 2KD1A 4RQ0A 4YP3A 5J2EA 1N2XA 1WG8A 5J0UA 4PL1A 5AKIA 2BZFA 2R18A 4UAUA 2DKZA 4NM1A 1NKCA 5KFIA 3HWTA 8ICTA 2G07A 1CRXA 3FM9A 2KK0A 2EZZA 3TAPA 3LVWA 1L8OA 3NASA 5CWRA 1NK8A 3PSIA 1ZQFA 1C20A 5CRXA 4TQSA 1ZQJA 2CN1A 2F1IA 4KLDA 4J9QA 1ZQRA 1ZQTA 1Z19A 4QZCA 4ECVA 2W9BA 4M9HA 3PW4A 4E0DA 2YMQA 4NLKA 4DL5A 3WU2U 3M9NB 5ALRA 2XGPA 4Y2PA 5DLGA 3M8RA 3LWMA 4MEXA 1TE2A 3ISCA 3PMNA 4KN7A 1NKBA 1KSPA 1SGGA 4MHVA 4ELTA 5KFXA 4RQ3A 3OTQA 1L3VA 4QWBA 4Y2SA 4IR9A 2ZTEA 3PR4A 2IOFK 3H0LB 5KT4A 3HRDD 3DV9A 3MDCA 2AGPA 2PFNA 1C7YA 4J9NA 2MRLA 4FZLA 1PZNA 4BXOB 1RPLA 7ICIA 2PMZF 3TFSA 2Y0SC 4QZ9A 3SI8A 4K4GA 4RU9A 2MSNA 2I9GA 3RJHA 4JWMA 1B22A 5B66U 4DOAA 2Y9UA 7ICKA 9ICSA 4BDPA 1ZQWA 3MBYA 5KG5A 1UA1A 3CRXA 1K1SA 4ECYA 3ICXA 1N62A 5DBAA 4IL6U 1L3UA 3V6KA 1Z00A 9ICHA 1T8EA 1UCVA 3BQ1A 2L5YA 5AI5A 4F4YA 1WYGA 4ECRA 1KFSA 5AKEA 4YXMA 4J9PA 1KN5A 1NJWA 8ICJA 3Q8PB 5KFLA 5AM5A 5KTQA 1TVAA 2NRWA 4RQ5A 9ICCA 4KLSA 3RH4A 1Y88A 3ZDAA 1ED1A 4J9MA 2UVUA 2GH1A 5J0QA 4YR0A 4UB4A 4NL9C 2HOIA 4P4PA 2FMSA 3SAHA 1IG6A 5KFFA 4JWNA 1ZQUA 2HHQA 5DGBA 1NKEA 1BPEA 2PMZC 5JRTA 3CNHA 1T94A 4K4IA 4RZRA 4TUPA 2N1RA 5ALMA 3PZPA 5EWGA 5DDMA 1WWUA 2BQRA 2P6UA 3TAQA 1U48A 3TKAA 2AU0A 1SWVA 9ICOA 3QU7A 5AI4A 4DQIA 2E3TA 4KX5A 8ICEA 5ALUA 2NO5A 2EZXA 1MSWD 5D49A 5F9NA 2ZUDA 2C2EA 4FBTA 4Y2YA 4YMMA 3EWAA 2HVHA 7ICUA 4PHDA 2HVIA 2VJ5A 2A1JB 1X40A 5ALEA 4EZ9A 4F8RA 1SKRA 2V9WA 3L4PA 3K1ZA 2C28A 5DQIA 2LM1A 3Q8RB 3WK6A 9ICGA 4NLNA 2NRXA 3QUCA 4EEKA 4DS5A 2J6UA 5GTHU 1JUDA 3KBBA 2ZIVB 4JK1A 4MFFA 5C0YA 4O5KA 4M04A 4NL9A 2WHEA 3TACB 3FYHA 1ZQZA 3H7IA 2O6KA 5AI6A 4KMUA 2I5HA 4O3OA 4C0ZA 1HIWA 3MGHA 4FFDA 4I29A 1KEJA 1K5OA 2UVVA 1KFDA 5L9XA 3KOOA 2HOQA 3PSTA 2C2RA 4J9SA 2A19A 3SAFA 2XY6A 4US9A 2LM4A 3RBEA 9ICLA 2RP5A 2IA6A 3AL0B 1RQLA 4P0QB 1N60A 3H8SA 1ZQYA 2P6RA 2KG5A 2BCQA 2BKEA 5EE0A 1J2MA 8ICVA 4ED2A 2WAQF 3IRUA 1OW5A 7ICFA 5AIAA 3F2BA 1IV8A 4Z6CA 4C80A 3QEAZ 2BPGA 4UAVA 2FPLA 3GV5B 4RQ1A 5J0TA 2D8CA 1NZBA 1ZQXA 4A8EA 4B9VA 2K89A 1N48A 2F8LA 4B9LA 3HKZF 4KLTA 8ICZA 1S97A 1D8YA 1DK2A 1X9XA 3F53A 2F77X 3H4BA 1ZQPA 1L6NA 2ASLA 1XWLA 4HYKA 3WKCA 1F0MA 4UASA 1TKDA 4PZOA 5IIJA 2ISOA 2AQ4A 3RJFA 5J0YA 4BJQA 4QNLA 4DCCA 2YY6A 5HP4A 2KVCA 3SENA 4RUCA 2XICA 1RXWA 2CRXA 3AQEA 4BX9C 5T14A 3NRWA 3RH5A 2WB1C 1NK5A 4RQ4A 1Z3EB 4DFKA 1ZD5A 2KV2A 4NM2A 3EYZA 3OPXA 4YD1A 3UMGA 2K4EA 2K4HA 3CW2C 4M6WA 2EDUA 2ZIUB 5J0WA 2AGQA 2ZJ8A 1L7PA 3C2MA 4PJ0U 5AKLA 3IV6A 2IHMA 2KKPA 3JPQA 3E2EA 4O3QA 2KIWA 1VDVA 1BPBA 2ODGA 2XIDA 4UB3A 7ICOA 1HJPA 1OXJA 4UAYA 4DWIA 4OO1J 2A1JA 3QUQA 4ED0A 2WF5A 1QSLA 4RQ8A 3ZDDA 1WCLA 2ZTDA 3AQFA 3M6KA 5EWFA 3RH6A 2JR5A 2W8LA 1DGSA 4R64A 4PHPA 2QB0A 5FP0A 2LI6A 2FLLA 1Z1BA 3SYZA 1X9MA 5J0SA 1TV9A 2HBJA 3V6HA 5ALXA 4KMOB 1B4FA 2K4IA 5TZVA 2E8NA 3I1YA 3PW7A 2KP7A 4NLGA 4O5CA 1VLBA 1X42A 2RRDA 4I2HA 9ICPA 4NLBA 2DBYA 5ALPA 2HW3A 2E8MA 4RQNA 4KTQA 2KFNA 3TADA 4UB8U 2XCAA 4DSJA 5ALGA 4BGDA 2BGWA 2JH1A 2LPEA 3VC8A 2WF9A 2FMQA 1ZQBA 2ES6A 1LKYB 1JROA 4KLQA 2MUTA 4ECQA 4F4KA 4JV0A 2F44A 4O5EA 4G3IA 1CI4A 2H3ZA 3JPTA 5KG6A 3GILA 3WKAA 3ZDCA 2H3QA 5AM3A 5KT2A 4CF4A 1PVQA 3WK5A 1ZQCA 5DB6A 5E79U 2XGQA 3KHGA 1TAMA 1DGJA 1ZXIA 4EENA 3KZIU 5L1MA 4I27A 2H3IA 1RG6A 2GOLA 2ASDA 1XC9A 1ZYQA 5J0OA 4JV1A 1RXVA 2HBKA 4ECXA 5J2JA 3T5LA 5AKJA 4QZDA 1COOA 2DF4B 5G5HA 3QZ8A 4QZGA 4CDGA 1XSPA 5G5GA 1SZHA 5JTIA 1QQ7A 3PSFA 8ICKA 3D2QA 3GFKB 2UVWA 4USAA 4Y2JA 1X6JA 2KZMA 3SD7A 1LB2B 4RQ2A 3GQCA 2KKVA 5AKHA 3L5KA 5KFHA 3UXPA 1N61A 1PK3A 4CCHA 2PFQA 4O0IA 4O3RA 7ICEA 1XSNA 5KFQA 4FO6A 3B0YA 4OJPA 3LK9A 1GO3F 1X9WA 4C4TA 3NVZA 3THVA 4DSLA 1S0MA 3AN1A 2QB0B 3ONNA 3G6YA 4DOCA 3H0RB 3T5HA 4DS4A 3A0HU 1JMSA 5IIOA 4JMUA 4GIBA 2FLPA 9ICQA 4QW8A 5L1JA 2W3RA 4F92B 2W7OA 3SQIA 1Z4NA 8ICWA 9ICFA 2HHTA 2J6SA 7ICSA 3ORYA 3IN5A 2ESEA 3FAHA 4AYBF 2XY7A 3TANA 2ZUBA 2JZBB 2K8CB 2YTUA 4US8A 2HMXA 1ZOLA 3JPRA 4OD0A 4F4WA 3WK9A 5A0LA 2G08A 4CNQA 2KTQA 1N5XA 2JRZA 2IOFA 2EAMA 2I1QA 4I2BA 1NK9A 3MR5A 5HHHA 2F2AB 2MA1A 1D8BA 2I6XA 3AUOA 4F2SA 3N7RC 2HBLA 4DL6A 4B9SA 3D2NA 1ZQEA 1Q3VA 4I2JA 4KLIA 2R8JA 3H0MB 5B5EU 2DKXA 9ICAA 2JHDA 3UMBA 8ICYA 9ICXA 1XNSA 3FDSA 4R8UB 1S76D 1DRGA 4C8NA 1JALA 2W9AA 3JPOA 1A76A 2ISPA 2Z7JA 3M7DA 1F5SA 2K4PA 4QZHA 3UXOA 1SL2A 2HSZA 4UB1A 4QWAA 8ICOA 4F71A 4FS2A 4LVSA 3GV7B 4YMOA 3GZFA 2BCVA 4F3OA 2NV3A 3RF9A 3KHRA 4ZH4A 4R66A 3QUBA 2G09A 4C8KA 4AYBC 2KSOA 5TISU 2UVRA 5ALDA 2FMPA 5KAFU 3MDAA 1JI7A 4TUSA 3EW9A 1RZTA 4IRDA 4NXZA 5DBCA 4QZ8A 1L3TA 8ICAA 2RHFA 2ZIXA 4PPXA 7ICQA 4Y2QA 4Q8EA 3HILA 1LKYA 2KHQA 2WF6A 5ALHA 5CB1A 5KFNA 5J2AA 1ZQDA 4DL4A 2WTFA 3C1YA 1Q3UA 4U6PA 1SL0A 3F5EA 1KQQA 1MN8A 4Q8FA 5IILA 2IOHA 4OJ5A 5IINA 3V6JA 4KITB 5EOZA 1PVPA 5KFTA 4M9GA 3WKBA 2RDJA 5CP2A 5J8YA 4ED3A 2JEIA 1XSLA 2KICA 3O0FA 3RR8A 2GWSA 2BQUA 3IP4B 1ZQQA 3I28A 2ZXHA 1ZQIA 3D2SA 1SV0C 3QXGA 4BUGA 2HOFA 4DF8A 2PI5A 3ZI4A 4O3PA 1QLNA 3C21A 3K1RB 1X66A 2YMMA 5KG4A 3Q8SB 4KX3A 2W43A 1BNOA 3MGVA 1ZRNA 3F2CA 1U4BA 1SKWA 4Y2XA 1QQ6A 3NVYA 2LYBA 3G6XA 2IHNA 3T5JA 3ZDEA 1VJ5A 8ICNA 4IS7A 5GTIU 4F72A 8ICUA 1Z4OA 5KFAA 4XA5A 4F5PA 4M2YA 4QIWF 2BDUA 3MC1A 4EYIB 4ECWA 1CUKA 2W11A 4DFPA 1FEZA 4I2AA 4IR1A 4MFCA 8ICFA 2BR0A 5KFUA 4CF5A 2OXOA 4RPZA 3RTVA 5ALJA 1P7DA 2AH5A 1XU4A 5F3XB 3PY8A 3SZ2A 3GIKA 4R8UA 3OJSA 3PO5A 1SKSA 1PK1B 4ED7A 7ICLA 4DQPA 8ICXA 2MU2A 5BOMA 1ZQMA 2H5XA 2OHFA 4Q45A 2KJ5A 3KD3A 4I2DA 1KDHA 1NK6A 4LJXA 2PFPA 1QSSA 3RRGA 2W9MA 3UM9A 2JEGA 2ZIWA 3MABA 4B9NA 4CF3A 4TQRA 3IG5A 1UQVA 3PX0A 3OJUA 2JEJA 5AM0A 4UBBA 4M9LA 2XO7A 2G0AA 4J9OA 4R65A 2NO4A 4EELA 4Y2TA 4CE6A 4M47A 5KL8B 2HHUA 2FJ6A 4ELUA 3K75D 4IRCA 1SIJA 4IRKA 3RB4A 1O08A 2DPIA 3EUB2 3V7LA 1HUZA 2OYYA 3KZXA 4ICAA 4RQ7A 1KRPA 5DB7A 2B0CA 5DQHA 3GU3A 5DQGA 5EWEA 5CJ7A 2MUTB 1S0VA 4MF2A 4KLUA 1MC8A 1ZQVA 4C7ZA 3SMVA 1F44A 4F5NA 3BZKA 2KMDA 3UPQA 4DOBA 4CGZA 1JXLA 4OJOA 3JPPA 1WCNA 3QU5A 2YX8A 4AP9A 4RQ6A 3IDWA 4IQTA 2AXTU 1QTMA 2NRTA 4JV2A 4DF4A 1L3SA 3IHQB 2KNJA 1O03A 1SZPA 1UT5A 4M6WB 1T3NA 3ETRA 5AKZA 5ALKA 3H8JA 4QIWC 4HAIA 4DO9A 3RAQA 3C5GA 1KL9A 3KKAC 2BPFA 5D46A 5F9LA 2H3FA 1WUDA 3M9MB 1YZ7A 5L1IA 3R9KA 1YT3A 4FZNA 1TK0A 3BS5A 2HBMA 4PH5A 4DL3A 5KAIU 3SV4A 5CA7A 5KNIA 3PW2A 3ETLA 3OGUA 3PMLA 5AIBA 1YZ6A 5AM4A 2LBOA 4PGYA 2AGOA 1FO4A 4UARA 1NZPA 2BHNA 2BCRA 3S6JA 2W04A 3HP6A 1V97A 1NK7A 1J97A 2F8KA 2W03A 2VJ4A 5AKGA 3Q8KA 4EEYA 4I2GA 4YR2A 4B9TA 2KEYA 4MF8A 3SV3A 1ZQ1C 2FPMA 2XVTA 5KG2A 3PVXA 5J29A 2KE7A 1KW4A 2K60A 3Q8MA 3NS1A 5KFEA 1U47A 1LVHA 2YN4A 8ICMA 3HW8A 8ICLA 3NRZA 4KLEA 3EPGA 2VKQA 3QU2A 3TQ1A 4KLGA 4TUQA 4UB5A 1JX4A 2G06A 2FDRA 5DDYA 4B6JA 3TADC 4O3NA 5J2KA 2DGZA 8ICQA 2OEHA 2EANA 5EE9A 2ZUCA 1A6SA 3RBDA 4DFMA 1U49A 5HMMA 2WFAA 4RNNA 2WF7A 4JB3A 2K8AA 2ATLA 5ALYA 3NGDA 3C1ZA 3E58A 5CEHA 4DSEA 1T3QA 2M0NA 5C5JA 5CR0A 3ALRA 2QARA 2G5HB 2QB1A 4EBDA 5ALFA 1BPDA 4QZAA 7ICHA 3WK8A 5KT3A 2BCSA 1SL1A 1A77A 3V72A 3PNCA 3AEVA 2J6TA 3AU2A 3N28A 4R63A 5AKYA 4UBCA 4DL2A 4RPYA 3Q8LA 4F2RA 2W9CB 3LDAA 5BOLA 4B9MA 1QSYA 2OCEA 3NVVA 2A3VA 1S10A 1ZQHA 4Z6DA 5HHIA 3A0BU 2Q4TA 3WK7A 1KKXA 2Y1IA 2KSOB 3U26A 3T5KA 3LVVA 4EBCA 5KFMA 5H2FU 2Y0SF 2YB1A 1RYUA 1XO1A 3RJGA 1IIPA 2F3NA 5AI0A 5KFGA 5AM2A 1KBUA 2HHVA 5JUMA 2ZIVA 1NJZA 1ZQNA 2W54A 3C28A 3MR3A 3RB6A 3SR6A 1CEZA 1L7NA 5ALTA 3BS7A 3BQTA 5ALIA 4M9JA 5J2GA 3B0XA 4GFJA 4PZNA 3ISDA 1RM6C 2LHTA 4ECZA 2LKYA 3RJEA 2KVSA 5IIKA 1B0XA 1JIHA 1S8OA 5HR6A 1SWWA 1ECWA 1M6YA 5KG3A 4ED8A 3GV8B 3MR2A 3T79A 5AM1A 3N7SC 1N5WA 4QWDA 4DL7A 1BVSA 1RDFA 3MGIA 4GC6A 8ICSA 1ZJNA 2BCUA 3QEBZ 2GO7A 2AQ0A 1FFVA 5L1LA 1TAUA 1T4GA 5IIMA 4MEYA 4RNMA 2DFLA 1UT8A 5CHGA 2PXIA 1S9FA 2F76X 5J2CA 1MA7A 4IQVA 2NYVA 4C8LA 7ICMA 1L7MA 4YMNA 4F50A 3BZCA 5AK4A 4YCXA 3T3FA 2W55A 2MAXA 4BXOA 4DSKA 8ICRA 3CP8A 3CYMA 4P2HA 4Y2UA 5HR7A 4EBEA 3AU6A 3C23A 3HX0A 4C7YA 2KFZA 1DK3A 4BWMA 3PW0A 1UHUA 3GIMA 4Q44A 3Q8QB 2W9CA 3M6ZA 2EQYA 1AROP 3F2DA 3PR5B 3QU4A
chains in the Genus database with same CATH topology
4P0PA 2MRLA 3ONNA 4FZLA 3H0RB 3F53A 2F77X 2G09A 2PMZF 2RRDA 3L3FX 2LYBA 4NLBA 3C28A 3GU3A 4AYBC 4OJ6A 1L6NA 2Y0SC 2WB1F 2KHVA 4P0QA 2E1EA 4JMUA 2H3VA 2VKQA 3RFAA 2VJ5A 2JH1A 2K8BB 1Q3UA 2JH7A 3VC8A 4NWIA 1PVRA 2G06A 4QIWF 3SMVA 1F44A 2BDUA 2RHFA 2ZIXA 3K1ZA 2W7PA 4BJQA 2OH2A 2DGZA 4QNLA 4GFJA 2W7OA 4OJOA 3SQIA 4CGZA 2LHTA 2OM6A 2D6FC 2LKYA 3CRXA 2KD1A 1A6SA 2YX8A 2KJ9A 3ICXA 2KVCA 2KHQA 3IN5A 2CPRA 2CRXA 2XICA 3AQEA 2H3ZA 4BX9C 5T14A 3NRWA 3C29A 2WB1C 2OXOA 4AYBF 2E5SA 4PL1A 2KNJA 2ZIVB 2R18A 2KV2A 4O3MA 5HR6A 1P7DA 2K8CB 1ECWA 2H3QA 2K8AA 2HMXA 2ZXIA 2G07A 4ACOA 4U6PA 3F5EA 4NV0A 1CRXA 5C0YA 3LYSA 5A0LA 2LYAA 4QIWC 3NUQA 3T79A 2ZIWB 3OPXA 1PVQA 2M0NA 2G08A 3N7SC 3LVWA 1TAMA 2E1FA 2K4EA 3ALRA 3N7PD 4P0PB 2G5HB 3PSIA 4OJ5A 2H3IA 2K4HA 5CRXA 4OJLA 2GOLA 4C0ZA 2H3FA 1WUDA 2CN1A 2ZIXB 1HIWA 2XI9A 2ZIUB 1YT3A 1PVPA 4FZNA 2WAQC 1Z19A 2VIXA 2HBKA 4NLCA 2HBMA 2F2AB 2MA1A 2KJ5A 2HOQA 2ZG6A 1D8BA 3PSTA 4IC9A 3SAGA 2DF4B 2KKPA 4CDGA 3SAFA 3E0FA 1ED1A 3N7RC 1SZHA 2GH1A 3KFUF 2HBLA 2KICA 5KL1B 3D2NA 2ZIUA 4WJ3B 2KIWA 2RP5A 3PSFA 1Q3VA 2ZIWA 3O0FA 2HOIA 3AL0B 1OUQA 4P0QB 1UPHA 2LBOA 3D2QA 3SAHA 2XIDA 2F76X 3IG8A 4U7CA 1MA7A 1XO0A 3IP4B 3IG5A 3PSPA 2YB4A 3H0MB 2A3VA 2JHDA 2ZXHA 4QJFB 2KKVA 2G0AA 1XNSA 4OO1J 2W04A 2WAQF 3D2SA 2KOBA 4FE3A 4BUGA 1DRGA 2G5IB 3F2BA 2W03A 2VJ4A 2HOFA 2PMZC 2Q4TA 3RF9A 1T94A 3AQFA 3CP8A 3CYMA 4FZMA 3M6KA 1URJA 3LVVA 5HR7A 2DQNB 2N1RA 3F5AA 2Z7JA 2Y0SF 3M7DA 4OJPA 5KL8B 1NZBA 2YB1A 2JGAA 2KEYA 4A8EA 1ZQ1C 3PZPA 1IIPA 3VCBA 2KJ8A 2K89A 1GO3F 2XVTA 3H0LB 3HKZC 4KX3A 2F8LA 1Z1BA 3HKZF 1KBUA 1HEKA 3DEEA 4CRXA 2HBJA 3F2DA 4PL2A 2JMGA 2ZIVA 3M6ZA 3MGVA 4KMOB 3F2CA 2K4IA 2OYYA 3KZXA 3GZFA 4ICAA 2NV3A 4KX5A 1A0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5S A;  3D2N A;  3D2Q A;  3D2S A; 
#chains in the Genus database with same CATH topology
 5KFD A;  5DB8 A;  4F91 B;  3PX4 A;  3L3F X;  4KLL A;  1SXE A;  2B6G A;  4KLO A;  4OJ6 A;  4PHE A;  2GLE A;  2E1E A;  4UB6 U;  4ECU A;  3ZDB A;  3QX7 A;  2K8B B;  1Z00 B;  5KG0 A;  5DBB A;  1NK0 A;  2Y1J A;  3JPN A;  4QW9 A;  2DWQ A;  1JN3 A;  1ZQK A;  4K4H A;  3OSP A;  3BQ2 A;  4PGX A;  4GC7 A;  4RQM A;  3C29 A;  4XRH A;  2E5S A;  4XUS A;  4O9M A;  4DSI A;  4GXI A;  4DLG A;  5AKK A;  4YD2 A;  5KT5 A;  2ZJA A;  3NUQ A;  5D4B A;  5J2F A;  3EZ5 A;  1S77 D;  2PFO A;  4P0P B;  3N7P D;  5KG1 A;  2EZY A;  5BPC A;  3M1Y A;  3C2K A;  5J2I A;  5HML A;  5ALZ A;  2XI9 A;  2WAQ C;  2YMP A;  3TI0 A;  1ZJM A;  3V7K A;  1BPZ A;  3C2L A;  2OWO A;  3OHA A;  1DXS A;  1NOM A;  2HI0 A;  3KKA A;  2M9N A;  1RYR A;  2A1A A;  5KFC A;  3RB3 A;  2QKQ A;  1NJX A;  1S0N A;  1BPX A;  3V7J A;  4J9L A;  5KFR A;  3OHB A;  3RB0 A;  5ALN A;  4FE3 A;  1B43 A;  5DGA A;  4EYH B;  4KLJ A;  4QWE A;  2DQN B;  3F5A A;  3RRH A;  1X2I A;  2JGA A;  3WKD A;  3ZD8 A;  1QCK A;  3UMC A;  4RPX A;  4KLH A;  4PHA A;  3QE9 Y;  2HHX A;  2JMG A;  4QWC A;  1BNP A;  9ICN A;  4OJL A;  4DQQ A;  4UW9 A;  4F4Z A;  4KLF A;  2DUY A;  3K4G A;  1FFU A;  1KLN A;  2KN7 A;  2H3V A;  4F5O A;  3RFA A;  2W9B B;  1ZET A;  1PVR A;  4P4M A;  1V38 A;  2C2D A;  5DB9 A;  9ICE A;  2RLT A;  1AQ6 A;  1ZD4 A;  1N63 A;  4GXK A;  9ICT A;  2Y9T A;  3MFH A;  2KZ3 A;  2JV3 A;  4XQ8 A;  1WWV A;  2FI1 A;  2XY5 A;  2ZXI A;  2F1J A;  1NJY A;  2PI4 A;  4EZ6 A;  4I2E A;  9ICM A;  5AK6 A;  5J0X A;  1NNL A;  4ECT A;  4YG2 A;  2E1F A;  9ICJ A;  3N97 B;  1IXR A;  3AMZ A;  1FIQ A;  1U45 A;  2ASJ A;  4NY8 A;  3H4D A;  2DPJ A;  2PKE A;  3JPS A;  3HT3 A;  1KFT A;  4DEZ A;  3E0F A;  5J0R A;  3HPO A;  3KFU F;  4KLM A;  2R8H A;  2ZIU A;  4Y2R A;  5AK5 A;  1UPH A;  2F1H A;  2R8G A;  4UAT A;  5DKW A;  2FE9 A;  1JRP A;  5KFP A;  4DLE A;  5KT7 A;  3GII A;  4QZB A;  3NTU A;  7ICT A;  2IMW P;  5J2B A;  5J2H A;  3BQ7 A;  4FBU A;  3AM9 A;  3VCB A;  4NLZ A;  3HKZ C;  1V85 A;  3QZ7 A;  2RDI A;  4PL2 A;  7ICJ A;  2B21 A;  2P66 A;  5J0P A;  3WK4 A;  4YR3 A;  5KFZ A;  1SB3 C;  4J03 A;  1JXE A;  4P0Q A;  4ZOH C;  3KHH A;  1ZQG A;  1D8L A;  1L5U A;  3PO4 A;  1RQN A;  4F4X A;  4DSF A;  2VA3 A;  4Z6F A;  3QU9 A;  4C4S A;  5JU5 A;  2EAO A;  2P35 A;  4OCZ A;  5KFV A;  4UAZ A;  4P4O A;  2D6F C;  3KTQ A;  3B9J A;  4QZF A;  2KJ9 A;  2FLN A;  1SV0 A;  3RR7 A;  5AKX A;  4I28 A;  1EXN A;  3EPI A;  4F5R A;  2LYA A;  2XCP A;  2ZIW B;  1D9D A;  1U9L A;  5ALQ A;  2VA8 A;  5J8Y C;  1XS9 D;  3OSN A;  1IM4 A;  4ECS A;  3UQ0 A;  1Q46 A;  4DFJ A;  1QQ5 A;  2HHS A;  2VAN A;  5KG7 A;  3RJJ A;  4O3S A;  2CXY A;  2ALZ A;  1DOQ A;  4C4R A;  4IC9 A;  5ALL A;  2ZJ5 A;  2HHW A;  1J2N A;  2BPC A;  3IM1 A;  1N56 A;  4Q43 A;  5KL1 B;  4YFK A;  1OUQ A;  3NVW A;  4G9B A;  2C22 A;  2E8O A;  4TUR A;  2YB4 A;  1PK1 A;  5EE1 A;  3LWL A;  9ICV A;  3ED5 A;  2G5I B;  2BDP A;  1LV5 A;  5J2D A;  1HUO A;  1ZQA A;  4FZM A;  4RT3 A;  2HDO A;  4QZE A;  1COK A;  4GLX A;  7ICP A;  9ICU A;  4ED6 A;  1MQ3 A;  2QLT A;  2RQ5 A;  1SV4 A;  4IQU A;  1D9F A;  2ZTC A;  3GIJ A;  1RYS A;  4ED1 A;  4DQS A;  4MFA A;  5KFS A;  5KFB A;  3PV8 A;  4EX6 A;  1X6I A;  2R8I A;  5DG9 A;  4NWI A;  1SXD A;  4Y2V A;  4JUZ A;  3UQ2 A;  3PX6 A;  2W7P A;  2KZZ A;  2V4Q A;  2OM6 A;  4RUA A;  8ICC A;  4I2F A;  8ICP A;  1K1Q A;  5AHX A;  5ALS A;  2CPR A;  3TAR A;  3QNM A;  4B9U A;  1L8L A;  4O3M A;  5KFK A;  2V4R A;  4NJ8 A;  4GXJ A;  3LYS A;  4J9R A;  7ICG A;  9ICW A;  1S5L U;  5AK3 A;  5DLF A;  4DQR A;  2WF8 A;  2KIV A;  3WKE A;  5DG8 A;  2VIX A;  3QYP A;  7ICN A;  1TAQ A;  3SAG A;  4Z6E A;  3BQ0 A;  4YQW A;  3DDH A;  4I2C A;  5AI8 A;  4WJ3 B;  1V9P A;  5III A;  3FC4 A;  3IG8 A;  3N4M B;  1QH9 A;  1XO0 A;  1T7P A;  3PSP A;  5HNK A;  4C8M A;  1TK8 A;  5KFO A;  1TK5 A;  2DL0 A;  4QJF B;  3RAX A;  2D3D A;  1PUZ A;  2XC9 A;  3D6J A;  4UQG A;  3MFI A;  4F5Q A;  5L1K A;  4IQW A;  1ZQO A;  9ICI A;  2Q0Z X;  2KJ8 A;  4J9K A;  3DEE A;  3ZD9 A;  4KN4 A;  3H8W A;  5KFJ A;  4UAW A;  3MR6 A;  4P0P A;  3RJI A;  2FPK A;  2QAR B;  1NK4 A;  1Z1V A;  1KTQ A;  4FS1 A;  1MQ2 A;  3GDX A;  1S0O A;  4C8O A;  4BWJ A;  1ZD3 A;  4F93 B;  1L7O A;  2KHV A;  5DG7 A;  1Q8K A;  2NRZ A;  1UA0 A;  2W3S A;  2JH7 A;  8ICG A;  5K4L A;  2VA2 A;  5ALW A;  3ISB A;  1ZRM A;  2BQ3 A;  3BDP A;  4UB2 A;  2JEF A;  2JXJ A;  3QUT A;  4PGQ A;  3J81 j;  4ACO A;  2IBK A;  4LZD A;  4NV0 A;  5AIC A;  3I76 A;  3M9O B;  1BGX T;  4YN4 A;  1ZQS A;  8ICB A;  3C5F A;  2ZIX B;  2NRV A;  2LMR A;  5ALV A;  2YML A;  4NLC A;  2JZB A;  2ZG6 A;  9ICB A;  7ICR A;  3HJE A;  5KFY A;  1BPY A;  3M8S A;  4U7C A;  3TFR A;  2HCF A;  1NI3 A;  4M9N A;  7ICV A;  1ZD2 P;  4DFD A;  4ELV A;  4RT2 A;  2KOB A;  4YVZ A;  3KHL A;  4RNO A;  2EH9 A;  1H38 A;  1X9S A;  2W8K A;  2R8K A;  4LZG A;  3RJK A;  4X5V A;  5AI9 A;  2LYH A;  1URJ A;  9ICK A;  5EE3 A;  5KFW A;  3PW5 A;  2EAP A;  8ICH A;  3UXN A;  5ALO A;  2YQE A;  3G6V A;  1HEK A;  4CRX A;  1ZQL A;  2AJQ A;  2AHO B;  4I2I A;  1A0P A;  3BJY A;  1TFR A;  2WB1 F;  5KT6 A;  4EX7 A;  8ICI A;  3BS5 B;  4QZI A;  3H40 A;  2E8P A;  3H8M A;  2OH2 A;  9ICR A;  4M0A A;  4YXJ A;  3SEI A;  2KD1 A;  4RQ0 A;  4YP3 A;  5J2E A;  1N2X A;  1WG8 A;  5J0U A;  4PL1 A;  5AKI A;  2BZF A;  2R18 A;  4UAU A;  2DKZ A;  4NM1 A;  1NKC A;  5KFI A;  3HWT A;  8ICT A;  2G07 A;  1CRX A;  3FM9 A;  2KK0 A;  2EZZ A;  3TAP A;  3LVW A;  1L8O A;  3NAS A;  5CWR A;  1NK8 A;  3PSI A;  1ZQF A;  1C20 A;  5CRX A;  4TQS A;  1ZQJ A;  2CN1 A;  2F1I A;  4KLD A;  4J9Q A;  1ZQR A;  1ZQT A;  1Z19 A;  4QZC A;  4ECV A;  2W9B A;  4M9H A;  3PW4 A;  4E0D A;  2YMQ A;  4NLK A;  4DL5 A;  3WU2 U;  3M9N B;  5ALR A;  2XGP A;  4Y2P A;  5DLG A;  3M8R A;  3LWM A;  4MEX A;  1TE2 A;  3ISC A;  3PMN A;  4KN7 A;  1NKB A;  1KSP A;  1SGG A;  4MHV A;  4ELT A;  5KFX A;  4RQ3 A;  3OTQ A;  1L3V A;  4QWB A;  4Y2S A;  4IR9 A;  2ZTE A;  3PR4 A;  2IOF K;  3H0L B;  5KT4 A;  3HRD D;  3DV9 A;  3MDC A;  2AGP A;  2PFN A;  1C7Y A;  4J9N A;  2MRL A;  4FZL A;  1PZN A;  4BXO B;  1RPL A;  7ICI A;  2PMZ F;  3TFS A;  2Y0S C;  4QZ9 A;  3SI8 A;  4K4G A;  4RU9 A;  2MSN A;  2I9G A;  3RJH A;  4JWM A;  1B22 A;  5B66 U;  4DOA A;  2Y9U A;  7ICK A;  9ICS A;  4BDP A;  1ZQW A;  3MBY A;  5KG5 A;  1UA1 A;  3CRX A;  1K1S A;  4ECY A;  3ICX A;  1N62 A;  5DBA A;  4IL6 U;  1L3U A;  3V6K A;  1Z00 A;  9ICH A;  1T8E A;  1UCV A;  3BQ1 A;  2L5Y A;  5AI5 A;  4F4Y A;  1WYG A;  4ECR A;  1KFS A;  5AKE A;  4YXM A;  4J9P A;  1KN5 A;  1NJW A;  8ICJ A;  3Q8P B;  5KFL A;  5AM5 A;  5KTQ A;  1TVA A;  2NRW A;  4RQ5 A;  9ICC A;  4KLS A;  3RH4 A;  1Y88 A;  3ZDA A;  1ED1 A;  4J9M A;  2UVU A;  2GH1 A;  5J0Q A;  4YR0 A;  4UB4 A;  4NL9 C;  2HOI A;  4P4P A;  2FMS A;  3SAH A;  1IG6 A;  5KFF A;  4JWN A;  1ZQU A;  2HHQ A;  5DGB A;  1NKE A;  1BPE A;  2PMZ C;  5JRT A;  3CNH A;  1T94 A;  4K4I A;  4RZR A;  4TUP A;  2N1R A;  5ALM A;  3PZP A;  5EWG A;  5DDM A;  1WWU A;  2BQR A;  2P6U A;  3TAQ A;  1U48 A;  3TKA A;  2AU0 A;  1SWV A;  9ICO A;  3QU7 A;  5AI4 A;  4DQI A;  2E3T A;  4KX5 A;  8ICE A;  5ALU A;  2NO5 A;  2EZX A;  1MSW D;  5D49 A;  5F9N A;  2ZUD A;  2C2E A;  4FBT A;  4Y2Y A;  4YMM A;  3EWA A;  2HVH A;  7ICU A;  4PHD A;  2HVI A;  2VJ5 A;  2A1J B;  1X40 A;  5ALE A;  4EZ9 A;  4F8R A;  1SKR A;  2V9W A;  3L4P A;  3K1Z A;  2C28 A;  5DQI A;  2LM1 A;  3Q8R B;  3WK6 A;  9ICG A;  4NLN A;  2NRX A;  3QUC A;  4EEK A;  4DS5 A;  2J6U A;  5GTH U;  1JUD A;  3KBB A;  2ZIV B;  4JK1 A;  4MFF A;  5C0Y A;  4O5K A;  4M04 A;  4NL9 A;  2WHE A;  3TAC B;  3FYH A;  1ZQZ A;  3H7I A;  2O6K A;  5AI6 A;  4KMU A;  2I5H A;  4O3O A;  4C0Z A;  1HIW A;  3MGH A;  4FFD A;  4I29 A;  1KEJ A;  1K5O A;  2UVV A;  1KFD A;  5L9X A;  3KOO A;  2HOQ A;  3PST A;  2C2R A;  4J9S A;  2A19 A;  3SAF A;  2XY6 A;  4US9 A;  2LM4 A;  3RBE A;  9ICL A;  2RP5 A;  2IA6 A;  3AL0 B;  1RQL A;  4P0Q B;  1N60 A;  3H8S A;  1ZQY A;  2P6R A;  2KG5 A;  2BCQ A;  2BKE A;  5EE0 A;  1J2M A;  8ICV A;  4ED2 A;  2WAQ F;  3IRU A;  1OW5 A;  7ICF A;  5AIA A;  3F2B A;  1IV8 A;  4Z6C A;  4C80 A;  3QEA Z;  2BPG A;  4UAV A;  2FPL A;  3GV5 B;  4RQ1 A;  5J0T A;  2D8C A;  1NZB A;  1ZQX A;  4A8E A;  4B9V A;  2K89 A;  1N48 A;  2F8L A;  4B9L A;  3HKZ F;  4KLT A;  8ICZ A;  1S97 A;  1D8Y A;  1DK2 A;  1X9X A;  3F53 A;  2F77 X;  3H4B A;  1ZQP A;  1L6N A;  2ASL A;  1XWL A;  4HYK A;  3WKC A;  1F0M A;  4UAS A;  1TKD A;  4PZO A;  5IIJ A;  2ISO A;  2AQ4 A;  3RJF A;  5J0Y A;  4BJQ A;  4QNL A;  4DCC A;  2YY6 A;  5HP4 A;  2KVC A;  3SEN A;  4RUC A;  2XIC A;  1RXW A;  2CRX A;  3AQE A;  4BX9 C;  5T14 A;  3NRW A;  3RH5 A;  2WB1 C;  1NK5 A;  4RQ4 A;  1Z3E B;  4DFK A;  1ZD5 A;  2KV2 A;  4NM2 A;  3EYZ A;  3OPX A;  4YD1 A;  3UMG A;  2K4E A;  2K4H A;  3CW2 C;  4M6W A;  2EDU A;  2ZIU B;  5J0W A;  2AGQ A;  2ZJ8 A;  1L7P A;  3C2M A;  4PJ0 U;  5AKL A;  3IV6 A;  2IHM A;  2KKP A;  3JPQ A;  3E2E A;  4O3Q A;  2KIW A;  1VDV A;  1BPB A;  2ODG A;  2XID A;  4UB3 A;  7ICO A;  1HJP A;  1OXJ A;  4UAY A;  4DWI A;  4OO1 J;  2A1J A;  3QUQ A;  4ED0 A;  2WF5 A;  1QSL A;  4RQ8 A;  3ZDD A;  1WCL A;  2ZTD A;  3AQF A;  3M6K A;  5EWF A;  3RH6 A;  2JR5 A;  2W8L A;  1DGS A;  4R64 A;  4PHP A;  2QB0 A;  5FP0 A;  2LI6 A;  2FLL A;  1Z1B A;  3SYZ A;  1X9M A;  5J0S A;  1TV9 A;  2HBJ A;  3V6H A;  5ALX A;  4KMO B;  1B4F A;  2K4I A;  5TZV A;  2E8N A;  3I1Y A;  3PW7 A;  2KP7 A;  4NLG A;  4O5C A;  1VLB A;  1X42 A;  2RRD A;  4I2H A;  9ICP A;  4NLB A;  2DBY A;  5ALP A;  2HW3 A;  2E8M A;  4RQN A;  4KTQ A;  2KFN A;  3TAD A;  4UB8 U;  2XCA A;  4DSJ A;  5ALG A;  4BGD A;  2BGW A;  2JH1 A;  2LPE A;  3VC8 A;  2WF9 A;  2FMQ A;  1ZQB A;  2ES6 A;  1LKY B;  1JRO A;  4KLQ A;  2MUT A;  4ECQ A;  4F4K A;  4JV0 A;  2F44 A;  4O5E A;  4G3I A;  1CI4 A;  2H3Z A;  3JPT A;  5KG6 A;  3GIL A;  3WKA A;  3ZDC A;  2H3Q A;  5AM3 A;  5KT2 A;  4CF4 A;  1PVQ A;  3WK5 A;  1ZQC A;  5DB6 A;  5E79 U;  2XGQ A;  3KHG A;  1TAM A;  1DGJ A;  1ZXI A;  4EEN A;  3KZI U;  5L1M A;  4I27 A;  2H3I A;  1RG6 A;  2GOL A;  2ASD A;  1XC9 A;  1ZYQ A;  5J0O A;  4JV1 A;  1RXV A;  2HBK A;  4ECX A;  5J2J A;  3T5L A;  5AKJ A;  4QZD A;  1COO A;  2DF4 B;  5G5H A;  3QZ8 A;  4QZG A;  4CDG A;  1XSP A;  5G5G A;  1SZH A;  5JTI A;  1QQ7 A;  3PSF A;  8ICK A;  3D2Q A;  3GFK B;  2UVW A;  4USA A;  4Y2J A;  1X6J A;  2KZM A;  3SD7 A;  1LB2 B;  4RQ2 A;  3GQC A;  2KKV A;  5AKH A;  3L5K A;  5KFH A;  3UXP A;  1N61 A;  1PK3 A;  4CCH A;  2PFQ A;  4O0I A;  4O3R A;  7ICE A;  1XSN A;  5KFQ A;  4FO6 A;  3B0Y A;  4OJP A;  3LK9 A;  1GO3 F;  1X9W A;  4C4T A;  3NVZ A;  3THV A;  4DSL A;  1S0M A;  3AN1 A;  2QB0 B;  3ONN A;  3G6Y A;  4DOC A;  3H0R B;  3T5H A;  4DS4 A;  3A0H U;  1JMS A;  5IIO A;  4JMU A;  4GIB A;  2FLP A;  9ICQ A;  4QW8 A;  5L1J A;  2W3R A;  4F92 B;  2W7O A;  3SQI A;  1Z4N A;  8ICW A;  9ICF A;  2HHT A;  2J6S A;  7ICS A;  3ORY A;  3IN5 A;  2ESE A;  3FAH A;  4AYB F;  2XY7 A;  3TAN A;  2ZUB A;  2JZB B;  2K8C B;  2YTU A;  4US8 A;  2HMX A;  1ZOL A;  3JPR A;  4OD0 A;  4F4W A;  3WK9 A;  5A0L A;  2G08 A;  4CNQ A;  2KTQ A;  1N5X A;  2JRZ A;  2IOF A;  2EAM A;  2I1Q A;  4I2B A;  1NK9 A;  3MR5 A;  5HHH A;  2F2A B;  2MA1 A;  1D8B A;  2I6X A;  3AUO A;  4F2S A;  3N7R C;  2HBL A;  4DL6 A;  4B9S A;  3D2N A;  1ZQE A;  1Q3V A;  4I2J A;  4KLI A;  2R8J A;  3H0M B;  5B5E U;  2DKX A;  9ICA A;  2JHD A;  3UMB A;  8ICY A;  9ICX A;  1XNS A;  3FDS A;  4R8U B;  1S76 D;  1DRG A;  4C8N A;  1JAL A;  2W9A A;  3JPO A;  1A76 A;  2ISP A;  2Z7J A;  3M7D A;  1F5S A;  2K4P A;  4QZH A;  3UXO A;  1SL2 A;  2HSZ A;  4UB1 A;  4QWA A;  8ICO A;  4F71 A;  4FS2 A;  4LVS A;  3GV7 B;  4YMO A;  3GZF A;  2BCV A;  4F3O A;  2NV3 A;  3RF9 A;  3KHR A;  4ZH4 A;  4R66 A;  3QUB A;  2G09 A;  4C8K A;  4AYB C;  2KSO A;  5TIS U;  2UVR A;  5ALD A;  2FMP A;  5KAF U;  3MDA A;  1JI7 A;  4TUS A;  3EW9 A;  1RZT A;  4IRD A;  4NXZ A;  5DBC A;  4QZ8 A;  1L3T A;  8ICA A;  2RHF A;  2ZIX A;  4PPX A;  7ICQ A;  4Y2Q A;  4Q8E A;  3HIL A;  1LKY A;  2KHQ A;  2WF6 A;  5ALH A;  5CB1 A;  5KFN A;  5J2A A;  1ZQD A;  4DL4 A;  2WTF A;  3C1Y A;  1Q3U A;  4U6P A;  1SL0 A;  3F5E A;  1KQQ A;  1MN8 A;  4Q8F A;  5IIL A;  2IOH A;  4OJ5 A;  5IIN A;  3V6J A;  4KIT B;  5EOZ A;  1PVP A;  5KFT A;  4M9G A;  3WKB A;  2RDJ A;  5CP2 A;  5J8Y A;  4ED3 A;  2JEI A;  1XSL A;  2KIC A;  3O0F A;  3RR8 A;  2GWS A;  2BQU A;  3IP4 B;  1ZQQ A;  3I28 A;  2ZXH A;  1ZQI A;  3D2S A;  1SV0 C;  3QXG A;  4BUG A;  2HOF A;  4DF8 A;  2PI5 A;  3ZI4 A;  4O3P A;  1QLN A;  3C21 A;  3K1R B;  1X66 A;  2YMM A;  5KG4 A;  3Q8S B;  4KX3 A;  2W43 A;  1BNO A;  3MGV A;  1ZRN A;  3F2C A;  1U4B A;  1SKW A;  4Y2X A;  1QQ6 A;  3NVY A;  2LYB A;  3G6X A;  2IHN A;  3T5J A;  3ZDE A;  1VJ5 A;  8ICN A;  4IS7 A;  5GTI U;  4F72 A;  8ICU A;  1Z4O A;  5KFA A;  4XA5 A;  4F5P A;  4M2Y A;  4QIW F;  2BDU A;  3MC1 A;  4EYI B;  4ECW A;  1CUK A;  2W11 A;  4DFP A;  1FEZ A;  4I2A A;  4IR1 A;  4MFC A;  8ICF A;  2BR0 A;  5KFU A;  4CF5 A;  2OXO A;  4RPZ A;  3RTV A;  5ALJ A;  1P7D A;  2AH5 A;  1XU4 A;  5F3X B;  3PY8 A;  3SZ2 A;  3GIK A;  4R8U A;  3OJS A;  3PO5 A;  1SKS A;  1PK1 B;  4ED7 A;  7ICL A;  4DQP A;  8ICX A;  2MU2 A;  5BOM A;  1ZQM A;  2H5X A;  2OHF A;  4Q45 A;  2KJ5 A;  3KD3 A;  4I2D A;  1KDH A;  1NK6 A;  4LJX A;  2PFP A;  1QSS A;  3RRG A;  2W9M A;  3UM9 A;  2JEG A;  2ZIW A;  3MAB A;  4B9N A;  4CF3 A;  4TQR A;  3IG5 A;  1UQV A;  3PX0 A;  3OJU A;  2JEJ A;  5AM0 A;  4UBB A;  4M9L A;  2XO7 A;  2G0A A;  4J9O A;  4R65 A;  2NO4 A;  4EEL A;  4Y2T A;  4CE6 A;  4M47 A;  5KL8 B;  2HHU A;  2FJ6 A;  4ELU A;  3K75 D;  4IRC A;  1SIJ A;  4IRK A;  3RB4 A;  1O08 A;  2DPI A;  3EUB 2;  3V7L A;  1HUZ A;  2OYY A;  3KZX A;  4ICA A;  4RQ7 A;  1KRP A;  5DB7 A;  2B0C A;  5DQH A;  3GU3 A;  5DQG A;  5EWE A;  5CJ7 A;  2MUT B;  1S0V A;  4MF2 A;  4KLU A;  1MC8 A;  1ZQV A;  4C7Z A;  3SMV A;  1F44 A;  4F5N A;  3BZK A;  2KMD A;  3UPQ A;  4DOB A;  4CGZ A;  1JXL A;  4OJO A;  3JPP A;  1WCN A;  3QU5 A;  2YX8 A;  4AP9 A;  4RQ6 A;  3IDW A;  4IQT A;  2AXT U;  1QTM A;  2NRT A;  4JV2 A;  4DF4 A;  1L3S A;  3IHQ B;  2KNJ A;  1O03 A;  1SZP A;  1UT5 A;  4M6W B;  1T3N A;  3ETR A;  5AKZ A;  5ALK A;  3H8J A;  4QIW C;  4HAI A;  4DO9 A;  3RAQ A;  3C5G A;  1KL9 A;  3KKA C;  2BPF A;  5D46 A;  5F9L A;  2H3F A;  1WUD A;  3M9M B;  1YZ7 A;  5L1I A;  3R9K A;  1YT3 A;  4FZN A;  1TK0 A;  3BS5 A;  2HBM A;  4PH5 A;  4DL3 A;  5KAI U;  3SV4 A;  5CA7 A;  5KNI A;  3PW2 A;  3ETL A;  3OGU A;  3PML A;  5AIB A;  1YZ6 A;  5AM4 A;  2LBO A;  4PGY A;  2AGO A;  1FO4 A;  4UAR A;  1NZP A;  2BHN A;  2BCR A;  3S6J A;  2W04 A;  3HP6 A;  1V97 A;  1NK7 A;  1J97 A;  2F8K A;  2W03 A;  2VJ4 A;  5AKG A;  3Q8K A;  4EEY A;  4I2G A;  4YR2 A;  4B9T A;  2KEY A;  4MF8 A;  3SV3 A;  1ZQ1 C;  2FPM A;  2XVT A;  5KG2 A;  3PVX A;  5J29 A;  2KE7 A;  1KW4 A;  2K60 A;  3Q8M A;  3NS1 A;  5KFE A;  1U47 A;  1LVH A;  2YN4 A;  8ICM A;  3HW8 A;  8ICL A;  3NRZ A;  4KLE A;  3EPG A;  2VKQ A;  3QU2 A;  3TQ1 A;  4KLG A;  4TUQ A;  4UB5 A;  1JX4 A;  2G06 A;  2FDR A;  5DDY A;  4B6J A;  3TAD C;  4O3N A;  5J2K A;  2DGZ A;  8ICQ A;  2OEH A;  2EAN A;  5EE9 A;  2ZUC A;  1A6S A;  3RBD A;  4DFM A;  1U49 A;  5HMM A;  2WFA A;  4RNN A;  2WF7 A;  4JB3 A;  2K8A A;  2ATL A;  5ALY A;  3NGD A;  3C1Z A;  3E58 A;  5CEH A;  4DSE A;  1T3Q A;  2M0N A;  5C5J A;  5CR0 A;  3ALR A;  2QAR A;  2G5H B;  2QB1 A;  4EBD A;  5ALF A;  1BPD A;  4QZA A;  7ICH A;  3WK8 A;  5KT3 A;  2BCS A;  1SL1 A;  1A77 A;  3V72 A;  3PNC A;  3AEV A;  2J6T A;  3AU2 A;  3N28 A;  4R63 A;  5AKY A;  4UBC A;  4DL2 A;  4RPY A;  3Q8L A;  4F2R A;  2W9C B;  3LDA A;  5BOL A;  4B9M A;  1QSY A;  2OCE A;  3NVV A;  2A3V A;  1S10 A;  1ZQH A;  4Z6D A;  5HHI A;  3A0B U;  2Q4T A;  3WK7 A;  1KKX A;  2Y1I A;  2KSO B;  3U26 A;  3T5K A;  3LVV A;  4EBC A;  5KFM A;  5H2F U;  2Y0S F;  2YB1 A;  1RYU A;  1XO1 A;  3RJG A;  1IIP A;  2F3N A;  5AI0 A;  5KFG A;  5AM2 A;  1KBU A;  2HHV A;  5JUM A;  2ZIV A;  1NJZ A;  1ZQN A;  2W54 A;  3C28 A;  3MR3 A;  3RB6 A;  3SR6 A;  1CEZ A;  1L7N A;  5ALT A;  3BS7 A;  3BQT A;  5ALI A;  4M9J A;  5J2G A;  3B0X A;  4GFJ A;  4PZN A;  3ISD A;  1RM6 C;  2LHT A;  4ECZ A;  2LKY A;  3RJE A;  2KVS A;  5IIK A;  1B0X A;  1JIH A;  1S8O A;  5HR6 A;  1SWW A;  1ECW A;  1M6Y A;  5KG3 A;  4ED8 A;  3GV8 B;  3MR2 A;  3T79 A;  5AM1 A;  3N7S C;  1N5W A;  4QWD A;  4DL7 A;  1BVS A;  1RDF A;  3MGI A;  4GC6 A;  8ICS A;  1ZJN A;  2BCU A;  3QEB Z;  2GO7 A;  2AQ0 A;  1FFV A;  5L1L A;  1TAU A;  1T4G A;  5IIM A;  4MEY A;  4RNM A;  2DFL A;  1UT8 A;  5CHG A;  2PXI A;  1S9F A;  2F76 X;  5J2C A;  1MA7 A;  4IQV A;  2NYV A;  4C8L A;  7ICM A;  1L7M A;  4YMN A;  4F50 A;  3BZC A;  5AK4 A;  4YCX A;  3T3F A;  2W55 A;  2MAX A;  4BXO A;  4DSK A;  8ICR A;  3CP8 A;  3CYM A;  4P2H A;  4Y2U A;  5HR7 A;  4EBE A;  3AU6 A;  3C23 A;  3HX0 A;  4C7Y A;  2KFZ A;  1DK3 A;  4BWM A;  3PW0 A;  1UHU A;  3GIM A;  4Q44 A;  3Q8Q B;  2W9C A;  3M6Z A;  2EQY A;  1ARO P;  3F2D A;  3PR5 B;  3QU4 A; 
#chains in the Genus database with same CATH homology
 4P0P A;  2MRL A;  3ONN A;  4FZL A;  3H0R B;  3F53 A;  2F77 X;  2G09 A;  2PMZ F;  2RRD A;  3L3F X;  2LYB A;  4NLB A;  3C28 A;  3GU3 A;  4AYB C;  4OJ6 A;  1L6N A;  2Y0S C;  2WB1 F;  2KHV A;  4P0Q A;  2E1E A;  4JMU A;  2H3V A;  2VKQ A;  3RFA A;  2VJ5 A;  2JH1 A;  2K8B B;  1Q3U A;  2JH7 A;  3VC8 A;  4NWI A;  1PVR A;  2G06 A;  4QIW F;  3SMV A;  1F44 A;  2BDU A;  2RHF A;  2ZIX A;  3K1Z A;  2W7P A;  4BJQ A;  2OH2 A;  2DGZ A;  4QNL A;  4GFJ A;  2W7O A;  4OJO A;  3SQI A;  4CGZ A;  2LHT A;  2OM6 A;  2D6F C;  2LKY A;  3CRX A;  2KD1 A;  1A6S A;  2YX8 A;  2KJ9 A;  3ICX A;  2KVC A;  2KHQ A;  3IN5 A;  2CPR A;  2CRX A;  2XIC A;  3AQE A;  2H3Z A;  4BX9 C;  5T14 A;  3NRW A;  3C29 A;  2WB1 C;  2OXO A;  4AYB F;  2E5S A;  4PL1 A;  2KNJ A;  2ZIV B;  2R18 A;  2KV2 A;  4O3M A;  5HR6 A;  1P7D A;  2K8C B;  1ECW A;  2H3Q A;  2K8A A;  2HMX A;  2ZXI A;  2G07 A;  4ACO A;  4U6P A;  3F5E A;  4NV0 A;  1CRX A;  5C0Y A;  3LYS A;  5A0L A;  2LYA A;  4QIW C;  3NUQ A;  3T79 A;  2ZIW B;  3OPX A;  1PVQ A;  2M0N A;  2G08 A;  3N7S C;  3LVW A;  1TAM A;  2E1F A;  2K4E A;  3ALR A;  3N7P D;  4P0P B;  2G5H B;  3PSI A;  4OJ5 A;  2H3I A;  2K4H A;  5CRX A;  4OJL A;  2GOL A;  4C0Z A;  2H3F A;  1WUD A;  2CN1 A;  2ZIX B;  1HIW A;  2XI9 A;  2ZIU B;  1YT3 A;  1PVP A;  4FZN A;  2WAQ C;  1Z19 A;  2VIX A;  2HBK A;  4NLC A;  2HBM A;  2F2A B;  2MA1 A;  2KJ5 A;  2HOQ A;  2ZG6 A;  1D8B A;  3PST A;  4IC9 A;  3SAG A;  2DF4 B;  2KKP A;  4CDG A;  3SAF A;  3E0F A;  1ED1 A;  3N7R C;  1SZH A;  2GH1 A;  3KFU F;  2HBL A;  2KIC A;  5KL1 B;  3D2N A;  2ZIU A;  4WJ3 B;  2KIW A;  2RP5 A;  3PSF A;  1Q3V A;  2ZIW A;  3O0F A;  2HOI A;  3AL0 B;  1OUQ A;  4P0Q B;  1UPH A;  2LBO A;  3D2Q A;  3SAH A;  2XID A;  2F76 X;  3IG8 A;  4U7C A;  1MA7 A;  1XO0 A;  3IP4 B;  3IG5 A;  3PSP A;  2YB4 A;  3H0M B;  2A3V A;  2JHD A;  2ZXH A;  4QJF B;  2KKV A;  2G0A A;  1XNS A;  4OO1 J;  2W04 A;  2WAQ F;  3D2S A;  2KOB A;  4FE3 A;  4BUG A;  1DRG A;  2G5I B;  3F2B A;  2W03 A;  2VJ4 A;  2HOF A;  2PMZ C;  2Q4T A;  3RF9 A;  1T94 A;  3AQF A;  3CP8 A;  3CYM A;  4FZM A;  3M6K A;  1URJ A;  3LVV A;  5HR7 A;  2DQN B;  2N1R A;  3F5A A;  2Z7J A;  2Y0S F;  3M7D A;  4OJP A;  5KL8 B;  1NZB A;  2YB1 A;  2JGA A;  2KEY A;  4A8E A;  1ZQ1 C;  3PZP A;  1IIP A;  3VCB A;  2KJ8 A;  2K89 A;  1GO3 F;  2XVT A;  3H0L B;  3HKZ C;  4KX3 A;  2F8L A;  1Z1B A;  3HKZ F;  1KBU A;  1HEK A;  3DEE A;  4CRX A;  2HBJ A;  3F2D A;  4PL2 A;  2JMG A;  2ZIV A;  3M6Z A;  3MGV A;  4KMO B;  3F2C A;  2K4I A;  2OYY A;  3KZX A;  3GZF A;  4ICA A;  2NV3 A;  4KX5 A;  1A0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...