1B0XA

The crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
FSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (EPHA4 RECEPTOR TYROSINE KINASE)
publication title The crystal structure of an Eph receptor SAM domain reveals a mechanism for modular dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 23
structure length 72
sequence length 72
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1998-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1b0xA00
2ES6A 3BQ7A 4PZOA 5J8YC 1UCVA 1X9XA 1JI7A 3TACB 1SV0C 1LKYA 4NL9A 2DL0A 1LKYB 2KE7A 2KIVA 3IDWA 5JU5A 2Y9TA 4IS7A 2D8CA 3KKAA 4RQMA 1PK1B 2LPEA 4NL9C 3SENA 1OW5A 2EAPA 5JRTA 3HILA 4RQNA 2KSOA 2QB0A 2K60A 2LMRA 1PK3A 1Z1VA 2DKXA 2KSOB 1X40A 2JV3A 1SGGA 3KKAC 4MHVA 2E8PA 1KW4A 2EANA 2DKZA 2L5YA 1COKA 2FE9A 3TADA 3H8MA 2F3NA 1SV4A 1UQVA 2QARA 1WWUA 2EAOA 5KNIA 2K4PA 2QKQA 2E8OA 1X66A 2QB0B 1SXDA 1WWVA 2D3DA 2GLEA 1F0MA 3BS5A 1B4FA 1V38A 1SXEA 3BS7A 1V85A 1OXJA 5JTIA 1DXSA 2F8KA 2QARB 2EAMA 5L1MA 2ESEA 3TADC 2E8NA 2KG5A 5J8YA 1B0XA 2E8MA 2YTUA 2B6GA 2Y9UA 2QB1A 3K1RB 1RG6A 3SEIA 4PZNA 5F3XB 2F44A 1PK1A 4NJ8A 1SV0A 2KMDA 3BS5B
chains in the Genus database with same CATH superfamily
2IHMA 4C0ZA 4RUCA 2HBJA 5E79U 1CI4A 2B0CA 1TV9A 5KT2A 2YMLA 4QZCA 3MABA 4ED3A 2KHVA 1X9WA 4K4HA 4KMOB 2ZUCA 1NK5A 1ZOLA 4C8KA 3TKAA 5KG4A 3S6JA 3BQTA 4ECTA 3TAQA 2IMWP 4BX9C 4EZ9A 1H38A 3V7KA 4RQMA 3PW5A 3N28A 3F5EA 2G07A 2AGQA 4EELA 2QB0A 2K60A 4PPXA 4A8EA 4O3SA 5J0UA 3GU3A 4EBDA 8ICAA 4LVSA 4NLBA 4MHVA 3M9NB 5D46A 4KX3A 2AXTU 3HP6A 5KG5A 1QSSA 1COKA 9ICOA 5AM3A 1UQVA 5AKEA 5DBBA 4EYIB 1TFRA 3GFKB 1SIJA 4UATA 4CGZA 3PX0A 3RB0A 4Y2SA 1TVAA 5KT7A 1JN3A 5KFIA 1JX4A 1IV8A 1WWVA 3ZDAA 1F5SA 5ALFA 4EBCA 5ALPA 5H2FU 1BNOA 5AI4A 1ZQRA 4R63A 5KFUA 1BGXT 4QNLA 2ASDA 3M9OB 1V85A 2BR0A 4ED0A 3R9KA 4M6WA 2E8NA 2ZXIA 1VLBA 3KZIU 4I2EA 2WFAA 4C80A 3PNCA 3BQ0A 4ECXA 4ED8A 3UM9A 4QZAA 4IQTA 4J9NA 4BGDA 5F3XB 4Q44A 2F44A 1SV0A 5ALOA 3NTUA 1A0PA 3QNMA 3RR8A 5HHIA 1UA1A 4KLSA 3ZDEA 3V7JA 2NRWA 4RNOA 9ICIA 1NK8A 4ECUA 5AKXA 4OD0A 3OSPA 4O3QA 1KBUA 3QXGA 1Z00B 5KFXA 4KLTA 1KLNA 2W9CB 9ICHA 2IOFK 5KG6A 5DB7A 4B9UA 2HVIA 5AI9A 4ELUA 3KKAA 5KFHA 9ICTA 3D6JA 1MN8A 5DBAA 3KTQA 2W9BB 2KSOA 4RNNA 3RRGA 1SKWA 4KLOA 4UBCA 3IHQB 3QEBZ 3DEEA 1BVSA 1NI3A 1KEJA 5ALRA 5KFNA 3PVXA 5DQHA 4MF8A 3ZD8A 5KG0A 3H8SA 4UB6U 4UB2A 5J2IA 2WF5A 2JRZA 4RT3A 3MR6A 4DFMA 2FJ6A 1OUQA 2QB0B 4USAA 4I2IA 2XC9A 4DL2A 3B0YA 2KTQA 3NS1A 3GV5B 3H4DA 4FE3A 5F9NA 4P4MA 2HHQA 9ICBA 4M9NA 3HX0A 4I2FA 4MFAA 2PFPA 2ZG6A 9ICRA 4CF3A 2UVRA 2H3VA 3RFAA 5KFZA 5J0TA 2I1QA 2YMQA 3QU5A 5J8YA 1IXRA 5G5HA 3PSTA 2R8KA 4DCCA 5BOMA 2HOQA 4PHEA 8ICXA 2OYYA 4C7YA 2WF6A 8ICOA 8ICHA 2G06A 1QQ5A 2RRDA 4IR1A 2FLNA 4O0IA 1KL9A 2KJ8A 4R64A 1LVHA 3WK5A 4PHAA 5J0RA 2K8BB 4F4KA 2OEHA 9ICAA 4RPXA 2LYAA 3QZ8A 4IRDA 1ZQXA 1JROA 4B9LA 3QU2A 5J0PA 2KZZA 4JMUA 3IP4B 2KICA 7ICGA 4FO6A 7ICTA 1PUZA 3Q8PB 2J6SA 8ICMA 5ALSA 1L8OA 1DGSA 3MR2A 5ALMA 1C20A 1KRPA 1ZQBA 3IM1A 1AROP 2O6KA 1ZQSA 3M6ZA 1KSPA 2W7PA 2R8JA 4EX7A 1S97A 4PHPA 8ICQA 4ED2A 1TAQA 1ZJNA 2I9GA 3C29A 4BXOB 3PZPA 5AKKA 1QQ7A 1SV4A 3QYPA 4TURA 3ORYA 1RPLA 4M9LA 3TAPA 2C2RA 1X9MA 1ZQQA 5J2DA 2FPMA 4JWMA 7ICOA 2ASLA 4OO1J 4BJQA 2GLEA 4DS4A 5DB8A 2HBMA 4UAVA 8ICWA 5KFTA 2OH2A 2IBKA 3SZ2A 1SXEA 3OTQA 3OHBA 1JXEA 3M9MB 4CF5A 4KLDA 3EW9A 5DBCA 2ISPA 4MFFA 3MR3A 3N4MB 2V9WA 2XY6A 2IOHA 1KDHA 3KHRA 3PO4A 2Y1JA 2W8LA 1KFSA 2KMDA 3Q8QB 4Y2VA 5CRXA 2PFNA 3L5KA 1N62A 2DF4B 2KD1A 1JI7A 4HAIA 3RJJA 8ICGA 3PX4A 3K4GA 4UARA 1NKEA 1WG8A 1LKYA 5AHXA 3V72A 7ICEA 2PI5A 3NGDA 4ED6A 4F2SA 2AHOB 4RNMA 3HWTA 1JALA 3NVYA 4I2DA 4DQSA 3SENA 4C4SA 9ICWA 3EPGA 1SWVA 2ASJA 3IG8A 4KLEA 1IIPA 4BWMA 4ED1A 4KLJA 3PMLA 1ZQHA 1SZPA 4F2RA 2EANA 2DKZA 2L5YA 2K89A 4FS2A 1TK0A 3NASA 2W03A 2YMMA 5ALXA 5AKJA 5KFOA 3SYZA 2ZXHA 1KFDA 5EWGA 3ZDCA 7ICPA 4FBUA 1PZNA 1TK5A 1RM6C 1L7OA 1Z1BA 4Z6DA 2F77X 1SXDA 2ZJ5A 7ICUA 4Y2TA 4NM1A 5KT6A 2W9MA 4YN4A 3SV3A 5J0WA 1DGJA 5ALKA 4DLGA 5EE3A 2R8HA 4OCZA 4I2CA 4EBEA 2MUTB 3BS7A 3TANA 3WKDA 8ICSA 3KD3A 2UVUA 5B66U 4B9NA 1Z4NA 1L7NA 5JTIA 5J0XA 1NJYA 1UT8A 1S8OA 2P6UA 3M6KA 4QZIA 3NVVA 3WK7A 1J97A 2RHFA 5KFDA 1NJZA 4HYKA 2W11A 3FM9A 2QB1A 4KLQA 4IQVA 8ICZA 4CCHA 3G6VA 5J0OA 4PGQA 4ZH4A 4RQ3A 3IRUA 2NRXA 5ALNA 1MQ2A 9ICCA 1NNLA 1Q46A 4ICAA 1RXWA 3C2KA 2OM6A 3C1YA 4OJLA 5IILA 2BHNA 4J9RA 1MSWD 2GWSA 5ALEA 5KG1A 4WJ3B 1QSYA 5C5JA 2VKQA 4I29A 4Y2JA 2AJQA 3H0RB 1X2IA 1ZD3A 5J2FA 4PGYA 2OWOA 3QU9A 1A76A 3ICXA 1S10A 4C8NA 1KW4A 1X9SA 2H5XA 2H3ZA 5AKIA 4C4RA 4P0QA 1L3VA 2FMPA 2QARA 1WWUA 5ALGA 3L4PA 4MF2A 3I76A 2QKQA 4QZGA 2OCEA 8ICBA 4NLNA 4OJPA 1ZQCA 2WF8A 3JPPA 4I2AA 4UB4A 3MC1A 2JMGA 3J81j 1UA0A 1U9LA 4YG2A 2KJ5A 3NRWA 5G5GA 1JUDA 2DUYA 1OXJA 5AI5A 4DSJA 1DXSA 4QZHA 5IIMA 4J9KA 5GTHU 3RH6A 5ALTA 8ICUA 2GOLA 2ZIVB 1JXLA 9ICVA 4GXKA 1Q8KA 2VA2A 4IC9A 1F44A 3HRDD 1U49A 5KFEA 1ZD5A 1IM4A 1RXVA 1RQLA 1ZD2P 3K75D 5CB1A 1S9FA 2HSZA 1LB2B 3LWLA 4MFCA 3PX6A 1LV5A 3H8WA 2EH9A 1PVPA 2CN1A 3DDHA 2RLTA 1HUZA 3GDXA 2JEJA 2G09A 3ONNA 4JV2A 1X6IA 4DQQA 5EWFA 2WTFA 3GIMA 3H4BA 4IS7A 5DDYA 2W9BA 1S77D 1NZBA 4YMOA 5ALQA 2WAQF 3RAQA 3HILA 4GFJA 1NJXA 4RPZA 4KTQA 1SB3C 2BZFA 2NYVA 5DDMA 3T3FA 4PJ0U 3ZDDA 1ZXIA 4UB3A 4NLZA 3Q8LA 7ICFA 1S0NA 1L6NA 3GIKA 3UMBA 5J2AA 8ICCA 5ALYA 3LYSA 1FIQA 4EEYA 3BZCA 2BPCA 3TI0A 2FMQA 2F1IA 5KFQA 1F0MA 4ECVA 5AIBA 4RT2A 2I5HA 2DGZA 3JPRA 1T3NA 3PY8A 4P0QB 2F8KA 5AK4A 2QARB 2XCAA 3UMGA 5EE0A 5AIAA 2YQEA 3KHLA 4O5KA 3TARA 2HVHA 3PO5A 4U7CA 5HHHA 4UQGA 4JB3A 4JWNA 1D8LA 4NLCA 1T7PA 4DQIA 2AH5A 3TACB 3RF9A 4DSLA 4Y2QA 4NM2A 4NL9A 3WK4A 2V4QA 5EOZA 2JZBB 1PVRA 2MA1A 2LYBA 2KNJA 5AI6A 9ICUA 2HHSA 2ATLA 4R8UA 5C0YA 3MBYA 4M9GA 5JRTA 1RYSA 4PGXA 2OXOA 2HMXA 5AM0A 1GO3F 3IN5A 5KFGA 2FDRA 4B9TA 4BXOA 3ETLA 2JH7A 3FAHA 1NJWA 5ALJA 3BZKA 3SQIA 4QZFA 3I1YA 1ZRNA 2OHFA 4ZOHC 2PFQA 2JH1A 2LYHA 1X66A 1FEZA 8ICVA 4ACOA 3EWAA 2EZXA 2HBLA 5ALWA 4RQ5A 3M8RA 5KFCA 2KOBA 3FC4A 1QH9A 5L9XA 1T4GA 2KVCA 4G3IA 1XU4A 1V9PA 4EZ6A 1V38A 5A0LA 4I2JA 1S0MA 2IHNA 3EYZA 4OJOA 4ECWA 3I28A 5AI8A 8ICEA 1IG6A 1NKBA 2GO7A 5KL1B 2WF9A 3RB4A 5KFVA 4I2BA 3HPOA 4NWIA 4GIBA 2G5IB 3RR7A 4DSFA 2B6GA 1N5XA 5ALIA 3E0FA 1ZQKA 3A0HU 3RJHA 1BPBA 1PK1A 3H0MB 5HNKA 1ZQAA 4PZOA 3IV6A 4F92B 2C2DA 3HKZC 1XNSA 1T8EA 4DL7A 1ZQ1C 4MEYA 4PHDA 3PSIA 2FMSA 4IR9A 4DF4A 3MGIA 2KFNA 1S5LU 3V7LA 2G5HB 2KKPA 5J2JA 3WK6A 3RRHA 3O0FA 1JIHA 4G9BA 4GXJA 4UAZA 1L3TA 4DF8A 2JEGA 1J2MA 1ZQVA 1SGGA 3B9JA 4RQ8A 2XVTA 2NO5A 3ZI4A 1ZQOA 3HKZF 3RTVA 3KOOA 3B0XA 4QW8A 5J0YA 2ZJAA 5CWRA 4F4YA 1NK7A 5KFLA 4R8UB 5KFPA 1SL1A 3WKBA 2K4PA 5KG7A 3BQ2A 1TK8A 3VCBA 2E8OA 2D6FC 4J9LA 2R8GA 1SWWA 4XRHA 2D3DA 4FZNA 4ELVA 2FI1A 3BS5A 2YY6A 2MUTA 3TFSA 4TUPA 4O3MA 2NO4A 4RZRA 1ZQUA 2BDPA 3AEVA 2BQ3A 1ZQNA 4Y2YA 4F4ZA 2C2EA 4CDGA 2HDOA 3MGVA 4DO9A 4LZDA 3G6YA 3CRXA 1B0XA 2F76X 3RH5A 1URJA 5AM4A 9ICLA 2N1RA 3T5LA 5IIIA 4PZNA 3QUTA 1N56A 1FO4A 2R18A 3PR5B 1CEZA 2ES6A 3GIJA 1X9XA 1PVQA 4ELTA 1NKCA 1ZETA 5D49A 4Q45A 1MQ3A 4TUSA 4P0PB 4YP3A 5KFFA 2LHTA 3CYMA 3RJKA 4RQ7A 4IRCA 1U48A 3RB6A 2D8CA 5L1JA 4RUAA 4UAYA 5L1LA 1D9FA 3WKCA 1PK1B 4KMUA 1ZQEA 4DSIA 5HR7A 3LWMA 1O03A 7ICKA 1WYGA 5CP2A 2VA8A 4JK1A 3QU7A 5F9LA 4K4GA 3ISBA 5KG2A 3AL0B 1BNPA 5J2CA 2FE9A 4UW9A 1ZQLA 4GC7A 1Z19A 4ED7A 3E2EA 1ZD4A 5CHGA 3SMVA 1ZJMA 4M9HA 3WU2U 3ZD9A 2VANA 2BPFA 4UB8U 4PL2A 2KFZA 4YXJA 2P66A 4YVZA 4NXZA 4XUSA 5L1KA 2HOIA 5ALHA 3QZ7A 1S0OA 9ICFA 2HI0A 2W3SA 1L7PA 3D2SA 2ZIVA 2KN7A 3RJEA 2KIWA 5ALLA 2H3FA 5J29A 2KG5A 8ICYA 2YB1A 3UQ2A 4CE6A 2YMPA 4M0AA 2Y9UA 2MAXA 8ICIA 4UAUA 1B22A 3BS5B 4ECSA 8ICPA 5L1IA 1N61A 4C8OA 2VJ4A 1ZQTA 4UBBA 1HUOA 4US8A 3F2DA 2DPJA 1XO1A 8ICLA 5DB6A 1SV0C 2K4EA 1NZPA 2KZMA 2KE7A 4KLFA 1NK4A 4FS1A 3M8SA 4E0DA 3EPIA 3PW2A 4ECZA 4QZ9A 3PMNA 2LPEA 4F72A 5KAIU 2C22A 1L3UA 4KLGA 1U45A 1KKXA 3QE9Y 1RYUA 2LKYA 1D8YA 3KKAC 5DG7A 3UMCA 3DV9A 1DRGA 1P7DA 9ICKA 4DL4A 4ECYA 1XSLA 4F50A 4MEXA 5IIJA 5CR0A 3CNHA 4DQRA 3N97B 4QJFB 4GC6A 2KEYA 4B9MA 3CW2C 2EAOA 5J2GA 3F2BA 4Y2UA 1J2NA 2Q4TA 2XI9A 3KZXA 2VJ5A 1ECWA 3PV8A 4YFKA 2BQRA 2LM1A 4C8LA 3AMZA 3BJYA 3MDCA 3AQFA 4I27A 2A1JB 2MU2A 2JGAA 3AU6A 4KLMA 4JV0A 4DSEA 3H0LB 3MGHA 2NRVA 4KN4A 3TADC 2ISOA 3RJFA 4FFDA 4BDPA 3GIIA 3AN1A 5J2HA 3SR6A 4XA5A 2ZIXA 2P35A 3QUCA 1C7YA 1D9DA 3K1ZA 5J8YC 1BPYA 1KFTA 5TISU 3LK9A 1KQQA 1UCVA 3UXOA 3SAHA 1TKDA 5IIKA 5AKZA 4YCXA 4M47A 2JZBA 2EDUA 3WKAA 1NK6A 3SAFA 3TQ1A 2K8AA 3QU4A 4OJ5A 4F4XA 4Z6FA 5DGBA 3THVA 3QUBA 5CA7A 3KHHA 4KITB 2W8KA 1U4BA 4QIWC 2EAPA 2W54A 1BPXA 3PSFA 5AICA 4BWJA 4RQ1A 1X40A 9ICGA 2JV3A 2ZUBA 3BDPA 5EWEA 3ZDBA 4C4TA 1ZQIA 4QZDA 1BPZA 4F5PA 4KLIA 3AUOA 3U26A 2AGPA 2ZIUB 2Y1IA 3Q8SB 3OJSA 5K4LA 3PW4A 2HHTA 4PH5A 4F4WA 2M9NA 1T3QA 5ALDA 1ZQFA 4QIWF 2ZTDA 3KFUF 5KT5A 8ICTA 4DL5A 5CEHA 3F53A 4DWIA 5AKHA 1YZ7A 5KFAA 4TQSA 4C7ZA 3CP8A 3JPSA 2BCQA 4O3RA 4B6JA 2PI4A 2ZJ8A 2EAMA 2KV2A 2AGOA 1DK3A 4UB5A 4P4OA 5KL8B 2HHWA 1RG6A 3C28A 1Z3EB 3MFIA 2ZIWB 4O3PA 1Y88A 3V6KA 4LZGA 1A6SA 5DGAA 1L5UA 1SZHA 2IA6A 2WB1C 4EX6A 3C2LA 9ICNA 4QWCA 2R8IA 2M0NA 1ZRMA 5AK5A 4X5VA 1KTQA 5KG3A 4DOAA 3IDWA 3N7PD 3H7IA 4I2GA 4I2HA 1EXNA 2ZIXB 5J2KA 2YB4A 5IIOA 4EYHB 1T94A 1XSNA 3C1ZA 1OW5A 4QWEA 4RQNA 1K5OA 5AI0A 5DG9A 1A77A 5AK6A 1PK3A 4F91B 4GXIA 2MRLA 3FYHA 1JRPA 1K1QA 2K8CB 2AQ4A 4ECRA 1UT5A 2WB1F 2EQYA 4AYBC 4IQWA 2YN4A 3BQ1A 2JR5A 1ZYQA 3GILA 4DSKA 4TQRA 1QLNA 4QW9A 2E1EA 4AP9A 4QZBA 2IOFA 3UXPA 5KNIA 2Y0SC 3WK9A 2DPIA 3L3FX 2E5SA 2B21A 2GH1A 2PFOA 5ALUA 2LI6A 1NK0A 3EZ5A 1RZTA 3WKEA 1TAUA 4O3OA 3TFRA 2Z7JA 7ICHA 3C21A 4FZLA 4Y2XA 1XSPA 4QZEA 3V6JA 5BOLA 8ICNA 3M7DA 2E1FA 4AYBF 1TAMA 2F1JA 1D8BA 2A19A 4RQ0A 4DOCA 5KTQA 4KX5A 2Q0ZX 3C5FA 1B43A 8ICRA 2Y0SF 2V4RA 2E8MA 2YTUA 4QWBA 3ISDA 4JUZA 4KN7A 2KKVA 1QCKA 1ZQYA 5DKWA 4P0PA 4KLLA 2EZYA 2YX8A 3AU2A 4XQ8A 4QZ8A 1CUKA 5KFMA 2HHUA 8ICJA 3N7RC 2QLTA 3UQ0A 2KP7A 2HW3A 1ZQJA 8ICFA 3KBBA 1N60A 4O5CA 4NV0A 1Z1VA 4CF4A 5J2EA 4QWAA 5KFSA 2XCPA 1WCLA 2C28A 4O9MA 2VIXA 2CRXA 3RJGA 2E8PA 1XC9A 4DS5A 4YD2A 3HJEA 1ZQDA 3TADA 1WCNA 3H8MA 2F3NA 1S76D 4UAWA 3OSNA 2RQ5A 1BPDA 3OHAA 5KAFU 2FLLA 5DLGA 3GV8B 4F5QA 5T14A 1CRXA 5DQIA 2RDIA 1XS9D 1B4FA 2PXIA 3JPOA 5BPCA 5FP0A 2K4IA 2FLPA 4M9JA 2KVSA 2JHDA 4UB1A 2J6UA 4F5RA 4R65A 2ESEA 2ODGA 1Q3VA 1O08A 4YR3A 3H40A 1XO0A 5HP4A 4M6WB 4Y2RA 3HW8A 1N2XA 4Z6EA 2AQ0A 3NVWA 1K1SA 4O5EA 4NLKA 3PSPA 4IQUA 5ALZA 4F5NA 3UPQA 4F8RA 1Q3UA 5KFRA 2J6TA 4FBTA 3OGUA 3C5GA 2UVWA 2VA3A 3FDSA 2F2AB 1S0VA 4DOBA 7ICSA 3RAXA 3RH4A 4BUGA 1NOMA 4ECQA 5EE9A 2BCVA 1YT3A 4DLEA 2H3QA 2Y9TA 3WK8A 2DFLA 2JEIA 1NK9A 4EENA 3V6HA 2LMRA 4DQPA 9ICEA 2DKXA 1X42A 1ED1A 2KSOB 4U6PA 1DK2A 5GTIU 4F5OA 3ALRA 3T79A 5AKGA 3RBDA 1WUDA 3RBEA 3RB3A 3E58A 2LBOA 3RJIA 4US9A 7ICLA 3PR4A 4DFDA 1VDVA 2DBYA 2LM4A 2BCRA 1AQ6A 5AM1A 5B5EU 2A1AA 4Q8EA 1U47A 5KFJA 4YXMA 3LVWA 2PKEA 2XY7A 2A1JA 2FPLA 2BDUA 3LDAA 2HCFA 2KJ9A 2BGWA 5D4BA 1FFUA 4YR2A 3LVVA 1RDFA 5IINA 3MDAA 4RQ4A 2JEFA 2P6RA 3F5AA 5HR6A 2BCSA 3GQCA 4UASA 5HMLA 1MC8A 2ZTCA 1ZQGA 2F1HA 3ED5A 1HIWA 3K1RB 4C8MA 2XO7A 3HT3A 4EEKA 4B9SA 3JPQA 4B9VA 3G6XA 3T5JA 2H3IA 1FFVA 3SAGA 3QX7A 2XGQA 3BQ7A 5DG8A 5J0QA 2HOFA 3Q8RB 2XGPA 1RYRA 5DQGA 1QSLA 4R66A 4RQ2A 3T5HA 5EE1A 1JMSA 1QQ6A 3D2QA 3ISCA 3Q8MA 4QWDA 2AU0A 4IRKA 1N48A 2DL0A 3NUQA 3JPTA 4PL1A 4K4IA 5AKLA 4I28A 1RQNA 4DEZA 3D2NA 3AQEA 4NLGA 1COOA 4NY8A 5AM5A 2ZUDA 4J9PA 4LJXA 2FPKA 4NL9C 5ALVA 2CPRA 4DFPA 7ICIA 1N63A 1V97A 2RP5A 2KZ3A 2NV3A 1L7MA 1ZQWA 1Z4OA 2ZIUA 2PMZC 3A0BU 4YR0A 1UPHA 2F8LA 2MSNA 9ICSA 3GV7B 5KFYA 4DL3A 1SKRA 2HHVA 4Q8FA 7ICRA 4IL6U 5AM2A 2NRZA 2BQUA 3H8JA 2BPGA 3NVZA 4P4PA 3NRZA 2W04A 2K4HA 4DFJA 2PMZF 3JPNA 1L8LA 3QEAZ 2G0AA 5L1MA 5JUMA 4TUQA 3PW7A 4CRXA 4JV1A 4M2YA 2CXYA 1HEKA 4O3NA 4DL6A 8ICKA 2I6XA 1X6JA 2ZIWA 2ALZA 7ICJA 3EUB2 9ICMA 4Y2PA 1SL2A 1UHUA 3F2CA 1BPEA 1TE2A 3M1YA 3MR5A 4F3OA 2ZTEA 1XWLA 2HBKA 2W55A 2DQNB 4CNQA 7ICMA 5DLFA 2W3RA 4F71A 5J0SA 1ZQMA 3ETRA 1LKYB 2KK0A 2KHQA 2XICA 2G08A 2KIVA 4DFKA 5AK3A 2DWQA 9ICQA 5JU5A 1L3SA 3VC8A 3C23A 5HMMA 3C2MA 4KLUA 2W43A 5KT4A 2E3TA 7ICNA 1ZQZA 3QUQA 5KT3A 3OJUA 5DB9A 9ICPA 2JXJA 4RQ6A 4RU9A 9ICXA 2A3VA 4J9MA 4GLXA 4M04A 3IG5A 4J9OA 1MA7A 2UVVA 2XIDA 3SD7A 4J03A 3T5KA 3KHGA 7ICQA 1SKSA 1ZQPA 4Q43A 1YZ6A 5TZVA 4F93B 1KN5A 1QTMA 2WHEA 1N5WA 3N7SC 4YMNA 3MFHA 2WF7A 2HHXA 2WAQC 3SI8A 2W7OA 2RDJA 5AKYA 3Q8KA 4P2HA 1HJPA 4J9QA 1VJ5A 2EZZA 2XY5A 4KLHA 4YMMA 3AM9A 5KFKA 1Z00A 3PW0A 3GZFA 9ICJA 2NRTA 4YQWA 5KFBA 4J9SA 2W9CA 4FZMA 2BKEA 2BCUA 1M6YA 4YD1A 5J2BA 4OJ6A 4Z6CA 3SV4A 5CJ7A 2W9AA 3SEIA 3OPXA 1DOQA 7ICVA 4NJ8A 5KFWA 4RPYA 1SL0A 3UXNA
chains in the Genus database with same CATH topology
2ES6A 3BQ7A 4PZOA 5J8YC 1UCVA 1X9XA 1JI7A 3TACB 1SV0C 1LKYA 4NL9A 2DL0A 1LKYB 2KE7A 2KIVA 3IDWA 5JU5A 2Y9TA 4IS7A 2D8CA 3KKAA 4RQMA 1PK1B 2LPEA 4NL9C 3SENA 1OW5A 2EAPA 5JRTA 3HILA 4RQNA 2KSOA 2QB0A 2K60A 2LMRA 1PK3A 1Z1VA 2DKXA 2KSOB 1X40A 2JV3A 1SGGA 3KKAC 4MHVA 2E8PA 1KW4A 2EANA 2DKZA 2L5YA 1COKA 2FE9A 3TADA 3H8MA 2F3NA 1SV4A 1UQVA 2QARA 1WWUA 2EAOA 5KNIA 2K4PA 2QKQA 2E8OA 1X66A 2QB0B 1SXDA 1WWVA 2D3DA 2GLEA 1F0MA 3BS5A 1B4FA 1V38A 1SXEA 3BS7A 1V85A 1OXJA 5JTIA 1DXSA 2F8KA 2QARB 2EAMA 5L1MA 2ESEA 3TADC 2E8NA 2KG5A 5J8YA 1B0XA 2E8MA 2YTUA 2B6GA 2Y9UA 2QB1A 3K1RB 1RG6A 3SEIA 4PZNA 5F3XB 2F44A 1PK1A 4NJ8A 1SV0A 2KMDA 3BS5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ES6 A;  3BQ7 A;  4PZO A;  5J8Y C;  1UCV A;  1X9X A;  1JI7 A;  3TAC B;  1SV0 C;  1LKY A;  4NL9 A;  2DL0 A;  1LKY B;  2KE7 A;  2KIV A;  3IDW A;  5JU5 A;  2Y9T A;  4IS7 A;  2D8C A;  3KKA A;  4RQM A;  1PK1 B;  2LPE A;  4NL9 C;  3SEN A;  1OW5 A;  2EAP A;  5JRT A;  3HIL A;  4RQN A;  2KSO A;  2QB0 A;  2K60 A;  2LMR A;  1PK3 A;  1Z1V A;  2DKX A;  2KSO B;  1X40 A;  2JV3 A;  1SGG A;  3KKA C;  4MHV A;  2E8P A;  1KW4 A;  2EAN A;  2DKZ A;  2L5Y A;  1COK A;  2FE9 A;  3TAD A;  3H8M A;  2F3N A;  1SV4 A;  1UQV A;  2QAR A;  1WWU A;  2EAO A;  5KNI A;  2K4P A;  2QKQ A;  2E8O A;  1X66 A;  2QB0 B;  1SXD A;  1WWV A;  2D3D A;  2GLE A;  1F0M A;  3BS5 A;  1B4F A;  1V38 A;  1SXE A;  3BS7 A;  1V85 A;  1OXJ A;  5JTI A;  1DXS A;  2F8K A;  2QAR B;  2EAM A;  5L1M A;  2ESE A;  3TAD C;  2E8N A;  2KG5 A;  5J8Y A;  1B0X A;  2E8M A;  2YTU A;  2B6G A;  2Y9U A;  2QB1 A;  3K1R B;  1RG6 A;  3SEI A;  4PZN A;  5F3X B;  2F44 A;  1PK1 A;  4NJ8 A;  1SV0 A;  2KMD A;  3BS5 B; 
#chains in the Genus database with same CATH topology
 2IHM A;  4C0Z A;  4RUC A;  2HBJ A;  5E79 U;  1CI4 A;  2B0C A;  1TV9 A;  5KT2 A;  2YML A;  4QZC A;  3MAB A;  4ED3 A;  2KHV A;  1X9W A;  4K4H A;  4KMO B;  2ZUC A;  1NK5 A;  1ZOL A;  4C8K A;  3TKA A;  5KG4 A;  3S6J A;  3BQT A;  4ECT A;  3TAQ A;  2IMW P;  4BX9 C;  4EZ9 A;  1H38 A;  3V7K A;  4RQM A;  3PW5 A;  3N28 A;  3F5E A;  2G07 A;  2AGQ A;  4EEL A;  2QB0 A;  2K60 A;  4PPX A;  4A8E A;  4O3S A;  5J0U A;  3GU3 A;  4EBD A;  8ICA A;  4LVS A;  4NLB A;  4MHV A;  3M9N B;  5D46 A;  4KX3 A;  2AXT U;  3HP6 A;  5KG5 A;  1QSS A;  1COK A;  9ICO A;  5AM3 A;  1UQV A;  5AKE A;  5DBB A;  4EYI B;  1TFR A;  3GFK B;  1SIJ A;  4UAT A;  4CGZ A;  3PX0 A;  3RB0 A;  4Y2S A;  1TVA A;  5KT7 A;  1JN3 A;  5KFI A;  1JX4 A;  1IV8 A;  1WWV A;  3ZDA A;  1F5S A;  5ALF A;  4EBC A;  5ALP A;  5H2F U;  1BNO A;  5AI4 A;  1ZQR A;  4R63 A;  5KFU A;  1BGX T;  4QNL A;  2ASD A;  3M9O B;  1V85 A;  2BR0 A;  4ED0 A;  3R9K A;  4M6W A;  2E8N A;  2ZXI A;  1VLB A;  3KZI U;  4I2E A;  2WFA A;  4C80 A;  3PNC A;  3BQ0 A;  4ECX A;  4ED8 A;  3UM9 A;  4QZA A;  4IQT A;  4J9N A;  4BGD A;  5F3X B;  4Q44 A;  2F44 A;  1SV0 A;  5ALO A;  3NTU A;  1A0P A;  3QNM A;  3RR8 A;  5HHI A;  1UA1 A;  4KLS A;  3ZDE A;  3V7J A;  2NRW A;  4RNO A;  9ICI A;  1NK8 A;  4ECU A;  5AKX A;  4OD0 A;  3OSP A;  4O3Q A;  1KBU A;  3QXG A;  1Z00 B;  5KFX A;  4KLT A;  1KLN A;  2W9C B;  9ICH A;  2IOF K;  5KG6 A;  5DB7 A;  4B9U A;  2HVI A;  5AI9 A;  4ELU A;  3KKA A;  5KFH A;  9ICT A;  3D6J A;  1MN8 A;  5DBA A;  3KTQ A;  2W9B B;  2KSO A;  4RNN A;  3RRG A;  1SKW A;  4KLO A;  4UBC A;  3IHQ B;  3QEB Z;  3DEE A;  1BVS A;  1NI3 A;  1KEJ A;  5ALR A;  5KFN A;  3PVX A;  5DQH A;  4MF8 A;  3ZD8 A;  5KG0 A;  3H8S A;  4UB6 U;  4UB2 A;  5J2I A;  2WF5 A;  2JRZ A;  4RT3 A;  3MR6 A;  4DFM A;  2FJ6 A;  1OUQ A;  2QB0 B;  4USA A;  4I2I A;  2XC9 A;  4DL2 A;  3B0Y A;  2KTQ A;  3NS1 A;  3GV5 B;  3H4D A;  4FE3 A;  5F9N A;  4P4M A;  2HHQ A;  9ICB A;  4M9N A;  3HX0 A;  4I2F A;  4MFA A;  2PFP A;  2ZG6 A;  9ICR A;  4CF3 A;  2UVR A;  2H3V A;  3RFA A;  5KFZ A;  5J0T A;  2I1Q A;  2YMQ A;  3QU5 A;  5J8Y A;  1IXR A;  5G5H A;  3PST A;  2R8K A;  4DCC A;  5BOM A;  2HOQ A;  4PHE A;  8ICX A;  2OYY A;  4C7Y A;  2WF6 A;  8ICO A;  8ICH A;  2G06 A;  1QQ5 A;  2RRD A;  4IR1 A;  2FLN A;  4O0I A;  1KL9 A;  2KJ8 A;  4R64 A;  1LVH A;  3WK5 A;  4PHA A;  5J0R A;  2K8B B;  4F4K A;  2OEH A;  9ICA A;  4RPX A;  2LYA A;  3QZ8 A;  4IRD A;  1ZQX A;  1JRO A;  4B9L A;  3QU2 A;  5J0P A;  2KZZ A;  4JMU A;  3IP4 B;  2KIC A;  7ICG A;  4FO6 A;  7ICT A;  1PUZ A;  3Q8P B;  2J6S A;  8ICM A;  5ALS A;  1L8O A;  1DGS A;  3MR2 A;  5ALM A;  1C20 A;  1KRP A;  1ZQB A;  3IM1 A;  1ARO P;  2O6K A;  1ZQS A;  3M6Z A;  1KSP A;  2W7P A;  2R8J A;  4EX7 A;  1S97 A;  4PHP A;  8ICQ A;  4ED2 A;  1TAQ A;  1ZJN A;  2I9G A;  3C29 A;  4BXO B;  3PZP A;  5AKK A;  1QQ7 A;  1SV4 A;  3QYP A;  4TUR A;  3ORY A;  1RPL A;  4M9L A;  3TAP A;  2C2R A;  1X9M A;  1ZQQ A;  5J2D A;  2FPM A;  4JWM A;  7ICO A;  2ASL A;  4OO1 J;  4BJQ A;  2GLE A;  4DS4 A;  5DB8 A;  2HBM A;  4UAV A;  8ICW A;  5KFT A;  2OH2 A;  2IBK A;  3SZ2 A;  1SXE A;  3OTQ A;  3OHB A;  1JXE A;  3M9M B;  4CF5 A;  4KLD A;  3EW9 A;  5DBC A;  2ISP A;  4MFF A;  3MR3 A;  3N4M B;  2V9W A;  2XY6 A;  2IOH A;  1KDH A;  3KHR A;  3PO4 A;  2Y1J A;  2W8L A;  1KFS A;  2KMD A;  3Q8Q B;  4Y2V A;  5CRX A;  2PFN A;  3L5K A;  1N62 A;  2DF4 B;  2KD1 A;  1JI7 A;  4HAI A;  3RJJ A;  8ICG A;  3PX4 A;  3K4G A;  4UAR A;  1NKE A;  1WG8 A;  1LKY A;  5AHX A;  3V72 A;  7ICE A;  2PI5 A;  3NGD A;  4ED6 A;  4F2S A;  2AHO B;  4RNM A;  3HWT A;  1JAL A;  3NVY A;  4I2D A;  4DQS A;  3SEN A;  4C4S A;  9ICW A;  3EPG A;  1SWV A;  2ASJ A;  3IG8 A;  4KLE A;  1IIP A;  4BWM A;  4ED1 A;  4KLJ A;  3PML A;  1ZQH A;  1SZP A;  4F2R A;  2EAN A;  2DKZ A;  2L5Y A;  2K89 A;  4FS2 A;  1TK0 A;  3NAS A;  2W03 A;  2YMM A;  5ALX A;  5AKJ A;  5KFO A;  3SYZ A;  2ZXH A;  1KFD A;  5EWG A;  3ZDC A;  7ICP A;  4FBU A;  1PZN A;  1TK5 A;  1RM6 C;  1L7O A;  1Z1B A;  4Z6D A;  2F77 X;  1SXD A;  2ZJ5 A;  7ICU A;  4Y2T A;  4NM1 A;  5KT6 A;  2W9M A;  4YN4 A;  3SV3 A;  5J0W A;  1DGJ A;  5ALK A;  4DLG A;  5EE3 A;  2R8H A;  4OCZ A;  4I2C A;  4EBE A;  2MUT B;  3BS7 A;  3TAN A;  3WKD A;  8ICS A;  3KD3 A;  2UVU A;  5B66 U;  4B9N A;  1Z4N A;  1L7N A;  5JTI A;  5J0X A;  1NJY A;  1UT8 A;  1S8O A;  2P6U A;  3M6K A;  4QZI A;  3NVV A;  3WK7 A;  1J97 A;  2RHF A;  5KFD A;  1NJZ A;  4HYK A;  2W11 A;  3FM9 A;  2QB1 A;  4KLQ A;  4IQV A;  8ICZ A;  4CCH A;  3G6V A;  5J0O A;  4PGQ A;  4ZH4 A;  4RQ3 A;  3IRU A;  2NRX A;  5ALN A;  1MQ2 A;  9ICC A;  1NNL A;  1Q46 A;  4ICA A;  1RXW A;  3C2K A;  2OM6 A;  3C1Y A;  4OJL A;  5IIL A;  2BHN A;  4J9R A;  1MSW D;  2GWS A;  5ALE A;  5KG1 A;  4WJ3 B;  1QSY A;  5C5J A;  2VKQ A;  4I29 A;  4Y2J A;  2AJQ A;  3H0R B;  1X2I A;  1ZD3 A;  5J2F A;  4PGY A;  2OWO A;  3QU9 A;  1A76 A;  3ICX A;  1S10 A;  4C8N A;  1KW4 A;  1X9S A;  2H5X A;  2H3Z A;  5AKI A;  4C4R A;  4P0Q A;  1L3V A;  2FMP A;  2QAR A;  1WWU A;  5ALG A;  3L4P A;  4MF2 A;  3I76 A;  2QKQ A;  4QZG A;  2OCE A;  8ICB A;  4NLN A;  4OJP A;  1ZQC A;  2WF8 A;  3JPP A;  4I2A A;  4UB4 A;  3MC1 A;  2JMG A;  3J81 j;  1UA0 A;  1U9L A;  4YG2 A;  2KJ5 A;  3NRW A;  5G5G A;  1JUD A;  2DUY A;  1OXJ A;  5AI5 A;  4DSJ A;  1DXS A;  4QZH A;  5IIM A;  4J9K A;  5GTH U;  3RH6 A;  5ALT A;  8ICU A;  2GOL A;  2ZIV B;  1JXL A;  9ICV A;  4GXK A;  1Q8K A;  2VA2 A;  4IC9 A;  1F44 A;  3HRD D;  1U49 A;  5KFE A;  1ZD5 A;  1IM4 A;  1RXV A;  1RQL A;  1ZD2 P;  3K75 D;  5CB1 A;  1S9F A;  2HSZ A;  1LB2 B;  3LWL A;  4MFC A;  3PX6 A;  1LV5 A;  3H8W A;  2EH9 A;  1PVP A;  2CN1 A;  3DDH A;  2RLT A;  1HUZ A;  3GDX A;  2JEJ A;  2G09 A;  3ONN A;  4JV2 A;  1X6I A;  4DQQ A;  5EWF A;  2WTF A;  3GIM A;  3H4B A;  4IS7 A;  5DDY A;  2W9B A;  1S77 D;  1NZB A;  4YMO A;  5ALQ A;  2WAQ F;  3RAQ A;  3HIL A;  4GFJ A;  1NJX A;  4RPZ A;  4KTQ A;  1SB3 C;  2BZF A;  2NYV A;  5DDM A;  3T3F A;  4PJ0 U;  3ZDD A;  1ZXI A;  4UB3 A;  4NLZ A;  3Q8L A;  7ICF A;  1S0N A;  1L6N A;  3GIK A;  3UMB A;  5J2A A;  8ICC A;  5ALY A;  3LYS A;  1FIQ A;  4EEY A;  3BZC A;  2BPC A;  3TI0 A;  2FMQ A;  2F1I A;  5KFQ A;  1F0M A;  4ECV A;  5AIB A;  4RT2 A;  2I5H A;  2DGZ A;  3JPR A;  1T3N A;  3PY8 A;  4P0Q B;  2F8K A;  5AK4 A;  2QAR B;  2XCA A;  3UMG A;  5EE0 A;  5AIA A;  2YQE A;  3KHL A;  4O5K A;  3TAR A;  2HVH A;  3PO5 A;  4U7C A;  5HHH A;  4UQG A;  4JB3 A;  4JWN A;  1D8L A;  4NLC A;  1T7P A;  4DQI A;  2AH5 A;  3TAC B;  3RF9 A;  4DSL A;  4Y2Q A;  4NM2 A;  4NL9 A;  3WK4 A;  2V4Q A;  5EOZ A;  2JZB B;  1PVR A;  2MA1 A;  2LYB A;  2KNJ A;  5AI6 A;  9ICU A;  2HHS A;  2ATL A;  4R8U A;  5C0Y A;  3MBY A;  4M9G A;  5JRT A;  1RYS A;  4PGX A;  2OXO A;  2HMX A;  5AM0 A;  1GO3 F;  3IN5 A;  5KFG A;  2FDR A;  4B9T A;  4BXO A;  3ETL A;  2JH7 A;  3FAH A;  1NJW A;  5ALJ A;  3BZK A;  3SQI A;  4QZF A;  3I1Y A;  1ZRN A;  2OHF A;  4ZOH C;  2PFQ A;  2JH1 A;  2LYH A;  1X66 A;  1FEZ A;  8ICV A;  4ACO A;  3EWA A;  2EZX A;  2HBL A;  5ALW A;  4RQ5 A;  3M8R A;  5KFC A;  2KOB A;  3FC4 A;  1QH9 A;  5L9X A;  1T4G A;  2KVC A;  4G3I A;  1XU4 A;  1V9P A;  4EZ6 A;  1V38 A;  5A0L A;  4I2J A;  1S0M A;  2IHN A;  3EYZ A;  4OJO A;  4ECW A;  3I28 A;  5AI8 A;  8ICE A;  1IG6 A;  1NKB A;  2GO7 A;  5KL1 B;  2WF9 A;  3RB4 A;  5KFV A;  4I2B A;  3HPO A;  4NWI A;  4GIB A;  2G5I B;  3RR7 A;  4DSF A;  2B6G A;  1N5X A;  5ALI A;  3E0F A;  1ZQK A;  3A0H U;  3RJH A;  1BPB A;  1PK1 A;  3H0M B;  5HNK A;  1ZQA A;  4PZO A;  3IV6 A;  4F92 B;  2C2D A;  3HKZ C;  1XNS A;  1T8E A;  4DL7 A;  1ZQ1 C;  4MEY A;  4PHD A;  3PSI A;  2FMS A;  4IR9 A;  4DF4 A;  3MGI A;  2KFN A;  1S5L U;  3V7L A;  2G5H B;  2KKP A;  5J2J A;  3WK6 A;  3RRH A;  3O0F A;  1JIH A;  4G9B A;  4GXJ A;  4UAZ A;  1L3T A;  4DF8 A;  2JEG A;  1J2M A;  1ZQV A;  1SGG A;  3B9J A;  4RQ8 A;  2XVT A;  2NO5 A;  3ZI4 A;  1ZQO A;  3HKZ F;  3RTV A;  3KOO A;  3B0X A;  4QW8 A;  5J0Y A;  2ZJA A;  5CWR A;  4F4Y A;  1NK7 A;  5KFL A;  4R8U B;  5KFP A;  1SL1 A;  3WKB A;  2K4P A;  5KG7 A;  3BQ2 A;  1TK8 A;  3VCB A;  2E8O A;  2D6F C;  4J9L A;  2R8G A;  1SWW A;  4XRH A;  2D3D A;  4FZN A;  4ELV A;  2FI1 A;  3BS5 A;  2YY6 A;  2MUT A;  3TFS A;  4TUP A;  4O3M A;  2NO4 A;  4RZR A;  1ZQU A;  2BDP A;  3AEV A;  2BQ3 A;  1ZQN A;  4Y2Y A;  4F4Z A;  2C2E A;  4CDG A;  2HDO A;  3MGV A;  4DO9 A;  4LZD A;  3G6Y A;  3CRX A;  1B0X A;  2F76 X;  3RH5 A;  1URJ A;  5AM4 A;  9ICL A;  2N1R A;  3T5L A;  5III A;  4PZN A;  3QUT A;  1N56 A;  1FO4 A;  2R18 A;  3PR5 B;  1CEZ A;  2ES6 A;  3GIJ A;  1X9X A;  1PVQ A;  4ELT A;  1NKC A;  1ZET A;  5D49 A;  4Q45 A;  1MQ3 A;  4TUS A;  4P0P B;  4YP3 A;  5KFF A;  2LHT A;  3CYM A;  3RJK A;  4RQ7 A;  4IRC A;  1U48 A;  3RB6 A;  2D8C A;  5L1J A;  4RUA A;  4UAY A;  5L1L A;  1D9F A;  3WKC A;  1PK1 B;  4KMU A;  1ZQE A;  4DSI A;  5HR7 A;  3LWM A;  1O03 A;  7ICK A;  1WYG A;  5CP2 A;  2VA8 A;  4JK1 A;  3QU7 A;  5F9L A;  4K4G A;  3ISB A;  5KG2 A;  3AL0 B;  1BNP A;  5J2C A;  2FE9 A;  4UW9 A;  1ZQL A;  4GC7 A;  1Z19 A;  4ED7 A;  3E2E A;  1ZD4 A;  5CHG A;  3SMV A;  1ZJM A;  4M9H A;  3WU2 U;  3ZD9 A;  2VAN A;  2BPF A;  4UB8 U;  4PL2 A;  2KFZ A;  4YXJ A;  2P66 A;  4YVZ A;  4NXZ A;  4XUS A;  5L1K A;  2HOI A;  5ALH A;  3QZ7 A;  1S0O A;  9ICF A;  2HI0 A;  2W3S A;  1L7P A;  3D2S A;  2ZIV A;  2KN7 A;  3RJE A;  2KIW A;  5ALL A;  2H3F A;  5J29 A;  2KG5 A;  8ICY A;  2YB1 A;  3UQ2 A;  4CE6 A;  2YMP A;  4M0A A;  2Y9U A;  2MAX A;  8ICI A;  4UAU A;  1B22 A;  3BS5 B;  4ECS A;  8ICP A;  5L1I A;  1N61 A;  4C8O A;  2VJ4 A;  1ZQT A;  4UBB A;  1HUO A;  4US8 A;  3F2D A;  2DPJ A;  1XO1 A;  8ICL A;  5DB6 A;  1SV0 C;  2K4E A;  1NZP A;  2KZM A;  2KE7 A;  4KLF A;  1NK4 A;  4FS1 A;  3M8S A;  4E0D A;  3EPI A;  3PW2 A;  4ECZ A;  4QZ9 A;  3PMN A;  2LPE A;  4F72 A;  5KAI U;  2C22 A;  1L3U A;  4KLG A;  1U45 A;  1KKX A;  3QE9 Y;  1RYU A;  2LKY A;  1D8Y A;  3KKA C;  5DG7 A;  3UMC A;  3DV9 A;  1DRG A;  1P7D A;  9ICK A;  4DL4 A;  4ECY A;  1XSL A;  4F50 A;  4MEX A;  5IIJ A;  5CR0 A;  3CNH A;  4DQR A;  3N97 B;  4QJF B;  4GC6 A;  2KEY A;  4B9M A;  3CW2 C;  2EAO A;  5J2G A;  3F2B A;  4Y2U A;  1J2N A;  2Q4T A;  2XI9 A;  3KZX A;  2VJ5 A;  1ECW A;  3PV8 A;  4YFK A;  2BQR A;  2LM1 A;  4C8L A;  3AMZ A;  3BJY A;  3MDC A;  3AQF A;  4I27 A;  2A1J B;  2MU2 A;  2JGA A;  3AU6 A;  4KLM A;  4JV0 A;  4DSE A;  3H0L B;  3MGH A;  2NRV A;  4KN4 A;  3TAD C;  2ISO A;  3RJF A;  4FFD A;  4BDP A;  3GII A;  3AN1 A;  5J2H A;  3SR6 A;  4XA5 A;  2ZIX A;  2P35 A;  3QUC A;  1C7Y A;  1D9D A;  3K1Z A;  5J8Y C;  1BPY A;  1KFT A;  5TIS U;  3LK9 A;  1KQQ A;  1UCV A;  3UXO A;  3SAH A;  1TKD A;  5IIK A;  5AKZ A;  4YCX A;  4M47 A;  2JZB A;  2EDU A;  3WKA A;  1NK6 A;  3SAF A;  3TQ1 A;  2K8A A;  3QU4 A;  4OJ5 A;  4F4X A;  4Z6F A;  5DGB A;  3THV A;  3QUB A;  5CA7 A;  3KHH A;  4KIT B;  2W8K A;  1U4B A;  4QIW C;  2EAP A;  2W54 A;  1BPX A;  3PSF A;  5AIC A;  4BWJ A;  4RQ1 A;  1X40 A;  9ICG A;  2JV3 A;  2ZUB A;  3BDP A;  5EWE A;  3ZDB A;  4C4T A;  1ZQI A;  4QZD A;  1BPZ A;  4F5P A;  4KLI A;  3AUO A;  3U26 A;  2AGP A;  2ZIU B;  2Y1I A;  3Q8S B;  3OJS A;  5K4L A;  3PW4 A;  2HHT A;  4PH5 A;  4F4W A;  2M9N A;  1T3Q A;  5ALD A;  1ZQF A;  4QIW F;  2ZTD A;  3KFU F;  5KT5 A;  8ICT A;  4DL5 A;  5CEH A;  3F53 A;  4DWI A;  5AKH A;  1YZ7 A;  5KFA A;  4TQS A;  4C7Z A;  3CP8 A;  3JPS A;  2BCQ A;  4O3R A;  4B6J A;  2PI4 A;  2ZJ8 A;  2EAM A;  2KV2 A;  2AGO A;  1DK3 A;  4UB5 A;  4P4O A;  5KL8 B;  2HHW A;  1RG6 A;  3C28 A;  1Z3E B;  3MFI A;  2ZIW B;  4O3P A;  1Y88 A;  3V6K A;  4LZG A;  1A6S A;  5DGA A;  1L5U A;  1SZH A;  2IA6 A;  2WB1 C;  4EX6 A;  3C2L A;  9ICN A;  4QWC A;  2R8I A;  2M0N A;  1ZRM A;  5AK5 A;  4X5V A;  1KTQ A;  5KG3 A;  4DOA A;  3IDW A;  3N7P D;  3H7I A;  4I2G A;  4I2H A;  1EXN A;  2ZIX B;  5J2K A;  2YB4 A;  5IIO A;  4EYH B;  1T94 A;  1XSN A;  3C1Z A;  1OW5 A;  4QWE A;  4RQN A;  1K5O A;  5AI0 A;  5DG9 A;  1A77 A;  5AK6 A;  1PK3 A;  4F91 B;  4GXI A;  2MRL A;  3FYH A;  1JRP A;  1K1Q A;  2K8C B;  2AQ4 A;  4ECR A;  1UT5 A;  2WB1 F;  2EQY A;  4AYB C;  4IQW A;  2YN4 A;  3BQ1 A;  2JR5 A;  1ZYQ A;  3GIL A;  4DSK A;  4TQR A;  1QLN A;  4QW9 A;  2E1E A;  4AP9 A;  4QZB A;  2IOF A;  3UXP A;  5KNI A;  2Y0S C;  3WK9 A;  2DPI A;  3L3F X;  2E5S A;  2B21 A;  2GH1 A;  2PFO A;  5ALU A;  2LI6 A;  1NK0 A;  3EZ5 A;  1RZT A;  3WKE A;  1TAU A;  4O3O A;  3TFR A;  2Z7J A;  7ICH A;  3C21 A;  4FZL A;  4Y2X A;  1XSP A;  4QZE A;  3V6J A;  5BOL A;  8ICN A;  3M7D A;  2E1F A;  4AYB F;  1TAM A;  2F1J A;  1D8B A;  2A19 A;  4RQ0 A;  4DOC A;  5KTQ A;  4KX5 A;  2Q0Z X;  3C5F A;  1B43 A;  8ICR A;  2Y0S F;  2V4R A;  2E8M A;  2YTU A;  4QWB A;  3ISD A;  4JUZ A;  4KN7 A;  2KKV A;  1QCK A;  1ZQY A;  5DKW A;  4P0P A;  4KLL A;  2EZY A;  2YX8 A;  3AU2 A;  4XQ8 A;  4QZ8 A;  1CUK A;  5KFM A;  2HHU A;  8ICJ A;  3N7R C;  2QLT A;  3UQ0 A;  2KP7 A;  2HW3 A;  1ZQJ A;  8ICF A;  3KBB A;  1N60 A;  4O5C A;  4NV0 A;  1Z1V A;  4CF4 A;  5J2E A;  4QWA A;  5KFS A;  2XCP A;  1WCL A;  2C28 A;  4O9M A;  2VIX A;  2CRX A;  3RJG A;  2E8P A;  1XC9 A;  4DS5 A;  4YD2 A;  3HJE A;  1ZQD A;  3TAD A;  1WCN A;  3H8M A;  2F3N A;  1S76 D;  4UAW A;  3OSN A;  2RQ5 A;  1BPD A;  3OHA A;  5KAF U;  2FLL A;  5DLG A;  3GV8 B;  4F5Q A;  5T14 A;  1CRX A;  5DQI A;  2RDI A;  1XS9 D;  1B4F A;  2PXI A;  3JPO A;  5BPC A;  5FP0 A;  2K4I A;  2FLP A;  4M9J A;  2KVS A;  2JHD A;  4UB1 A;  2J6U A;  4F5R A;  4R65 A;  2ESE A;  2ODG A;  1Q3V A;  1O08 A;  4YR3 A;  3H40 A;  1XO0 A;  5HP4 A;  4M6W B;  4Y2R A;  3HW8 A;  1N2X A;  4Z6E A;  2AQ0 A;  3NVW A;  1K1S A;  4O5E A;  4NLK A;  3PSP A;  4IQU A;  5ALZ A;  4F5N A;  3UPQ A;  4F8R A;  1Q3U A;  5KFR A;  2J6T A;  4FBT A;  3OGU A;  3C5G A;  2UVW A;  2VA3 A;  3FDS A;  2F2A B;  1S0V A;  4DOB A;  7ICS A;  3RAX A;  3RH4 A;  4BUG A;  1NOM A;  4ECQ A;  5EE9 A;  2BCV A;  1YT3 A;  4DLE A;  2H3Q A;  2Y9T A;  3WK8 A;  2DFL A;  2JEI A;  1NK9 A;  4EEN A;  3V6H A;  2LMR A;  4DQP A;  9ICE A;  2DKX A;  1X42 A;  1ED1 A;  2KSO B;  4U6P A;  1DK2 A;  5GTI U;  4F5O A;  3ALR A;  3T79 A;  5AKG A;  3RBD A;  1WUD A;  3RBE A;  3RB3 A;  3E58 A;  2LBO A;  3RJI A;  4US9 A;  7ICL A;  3PR4 A;  4DFD A;  1VDV A;  2DBY A;  2LM4 A;  2BCR A;  1AQ6 A;  5AM1 A;  5B5E U;  2A1A A;  4Q8E A;  1U47 A;  5KFJ A;  4YXM A;  3LVW A;  2PKE A;  2XY7 A;  2A1J A;  2FPL A;  2BDU A;  3LDA A;  2HCF A;  2KJ9 A;  2BGW A;  5D4B A;  1FFU A;  4YR2 A;  3LVV A;  1RDF A;  5IIN A;  3MDA A;  4RQ4 A;  2JEF A;  2P6R A;  3F5A A;  5HR6 A;  2BCS A;  3GQC A;  4UAS A;  5HML A;  1MC8 A;  2ZTC A;  1ZQG A;  2F1H A;  3ED5 A;  1HIW A;  3K1R B;  4C8M A;  2XO7 A;  3HT3 A;  4EEK A;  4B9S A;  3JPQ A;  4B9V A;  3G6X A;  3T5J A;  2H3I A;  1FFV A;  3SAG A;  3QX7 A;  2XGQ A;  3BQ7 A;  5DG8 A;  5J0Q A;  2HOF A;  3Q8R B;  2XGP A;  1RYR A;  5DQG A;  1QSL A;  4R66 A;  4RQ2 A;  3T5H A;  5EE1 A;  1JMS A;  1QQ6 A;  3D2Q A;  3ISC A;  3Q8M A;  4QWD A;  2AU0 A;  4IRK A;  1N48 A;  2DL0 A;  3NUQ A;  3JPT A;  4PL1 A;  4K4I A;  5AKL A;  4I28 A;  1RQN A;  4DEZ A;  3D2N A;  3AQE A;  4NLG A;  1COO A;  4NY8 A;  5AM5 A;  2ZUD A;  4J9P A;  4LJX A;  2FPK A;  4NL9 C;  5ALV A;  2CPR A;  4DFP A;  7ICI A;  1N63 A;  1V97 A;  2RP5 A;  2KZ3 A;  2NV3 A;  1L7M A;  1ZQW A;  1Z4O A;  2ZIU A;  2PMZ C;  3A0B U;  4YR0 A;  1UPH A;  2F8L A;  2MSN A;  9ICS A;  3GV7 B;  5KFY A;  4DL3 A;  1SKR A;  2HHV A;  4Q8F A;  7ICR A;  4IL6 U;  5AM2 A;  2NRZ A;  2BQU A;  3H8J A;  2BPG A;  3NVZ A;  4P4P A;  3NRZ A;  2W04 A;  2K4H A;  4DFJ A;  2PMZ F;  3JPN A;  1L8L A;  3QEA Z;  2G0A A;  5L1M A;  5JUM A;  4TUQ A;  3PW7 A;  4CRX A;  4JV1 A;  4M2Y A;  2CXY A;  1HEK A;  4O3N A;  4DL6 A;  8ICK A;  2I6X A;  1X6J A;  2ZIW A;  2ALZ A;  7ICJ A;  3EUB 2;  9ICM A;  4Y2P A;  1SL2 A;  1UHU A;  3F2C A;  1BPE A;  1TE2 A;  3M1Y A;  3MR5 A;  4F3O A;  2ZTE A;  1XWL A;  2HBK A;  2W55 A;  2DQN B;  4CNQ A;  7ICM A;  5DLF A;  2W3R A;  4F71 A;  5J0S A;  1ZQM A;  3ETR A;  1LKY B;  2KK0 A;  2KHQ A;  2XIC A;  2G08 A;  2KIV A;  4DFK A;  5AK3 A;  2DWQ A;  9ICQ A;  5JU5 A;  1L3S A;  3VC8 A;  3C23 A;  5HMM A;  3C2M A;  4KLU A;  2W43 A;  5KT4 A;  2E3T A;  7ICN A;  1ZQZ A;  3QUQ A;  5KT3 A;  3OJU A;  5DB9 A;  9ICP A;  2JXJ A;  4RQ6 A;  4RU9 A;  9ICX A;  2A3V A;  4J9M A;  4GLX A;  4M04 A;  3IG5 A;  4J9O A;  1MA7 A;  2UVV A;  2XID A;  3SD7 A;  4J03 A;  3T5K A;  3KHG A;  7ICQ A;  1SKS A;  1ZQP A;  4Q43 A;  1YZ6 A;  5TZV A;  4F93 B;  1KN5 A;  1QTM A;  2WHE A;  1N5W A;  3N7S C;  4YMN A;  3MFH A;  2WF7 A;  2HHX A;  2WAQ C;  3SI8 A;  2W7O A;  2RDJ A;  5AKY A;  3Q8K A;  4P2H A;  1HJP A;  4J9Q A;  1VJ5 A;  2EZZ A;  2XY5 A;  4KLH A;  4YMM A;  3AM9 A;  5KFK A;  1Z00 A;  3PW0 A;  3GZF A;  9ICJ A;  2NRT A;  4YQW A;  5KFB A;  4J9S A;  2W9C A;  4FZM A;  2BKE A;  2BCU A;  1M6Y A;  4YD1 A;  5J2B A;  4OJ6 A;  4Z6C A;  3SV4 A;  5CJ7 A;  2W9A A;  3SEI A;  3OPX A;  1DOQ A;  7ICV A;  4NJ8 A;  5KFW A;  4RPY A;  1SL0 A;  3UXN A; 
#chains in the Genus database with same CATH homology
 2ES6 A;  3BQ7 A;  4PZO A;  5J8Y C;  1UCV A;  1X9X A;  1JI7 A;  3TAC B;  1SV0 C;  1LKY A;  4NL9 A;  2DL0 A;  1LKY B;  2KE7 A;  2KIV A;  3IDW A;  5JU5 A;  2Y9T A;  4IS7 A;  2D8C A;  3KKA A;  4RQM A;  1PK1 B;  2LPE A;  4NL9 C;  3SEN A;  1OW5 A;  2EAP A;  5JRT A;  3HIL A;  4RQN A;  2KSO A;  2QB0 A;  2K60 A;  2LMR A;  1PK3 A;  1Z1V A;  2DKX A;  2KSO B;  1X40 A;  2JV3 A;  1SGG A;  3KKA C;  4MHV A;  2E8P A;  1KW4 A;  2EAN A;  2DKZ A;  2L5Y A;  1COK A;  2FE9 A;  3TAD A;  3H8M A;  2F3N A;  1SV4 A;  1UQV A;  2QAR A;  1WWU A;  2EAO A;  5KNI A;  2K4P A;  2QKQ A;  2E8O A;  1X66 A;  2QB0 B;  1SXD A;  1WWV A;  2D3D A;  2GLE A;  1F0M A;  3BS5 A;  1B4F A;  1V38 A;  1SXE A;  3BS7 A;  1V85 A;  1OXJ A;  5JTI A;  1DXS A;  2F8K A;  2QAR B;  2EAM A;  5L1M A;  2ESE A;  3TAD C;  2E8N A;  2KG5 A;  5J8Y A;  1B0X A;  2E8M A;  2YTU A;  2B6G A;  2Y9U A;  2QB1 A;  3K1R B;  1RG6 A;  3SEI A;  4PZN A;  5F3X B;  2F44 A;  1PK1 A;  4NJ8 A;  1SV0 A;  2KMD A;  3BS5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...