1B0XA

The crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
FSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTEIN (EPHA4 RECEPTOR TYROSINE KINASE)
publication title The crystal structure of an Eph receptor SAM domain reveals a mechanism for modular dimerization.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 72
sequence length 72
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1998-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1b0xA00
4NL9C 3SEIA 2F44A 5JU5A 3BS5A 3HILA 1Z1VA 2EAPA 1SGGA 2D3DA 2B6GA 1UCVA 1SV4A 3K1RB 4RQNA 1SXEA 2ES6A 1PK1B 2F3NA 2KIVA 4NJ8A 2L5YA 4IS7A 2YTUA 2QB0A 2ESEA 1COKA 2KSOB 1PK1A 1OW5A 2E8OA 1F0MA 1LKYB 2KMDA 2K4PA 1WWVA 4PZOA 1UQVA 1JI7A 3TACB 3BS7A 1SV0A 2KSOA 5L1MA 2LPEA 1B0XA 1RG6A 3IDWA 3KKAC 2D8CA 2EAMA 2KE7A 2Y9TA 2EANA 3KKAA 2E8PA 1SV0C 1V85A 1PK3A 5J8YA 1X40A 1DXSA 4MHVA 4PZNA 1LKYA 2QKQA 3TADA 2KG5A 2F8KA 3BS5B 1KW4A 2QB1A 2QARB 2DL0A 2FE9A 2LMRA 2E8NA 3H8MA 2E8MA 5JTIA 1OXJA 2GLEA 5J8YC 2Y9UA 1B4FA 2QARA 4RQMA 1V38A 4NL9A 3SENA 3TADC 1X9XA 1WWUA 1SXDA 3BQ7A 2K60A 2DKXA 2QB0B 2DKZA 1X66A 5F3XB 5KNIA 5JRTA 2JV3A 2EAOA
chains in the Genus database with same CATH superfamily
4NL9C 4M9GA 3KHLA 5AI9A 2G09A 1T3NA 4YMOA 1XO0A 2JEFA 2K4EA 5J2DA 1Z19A 3K1RB 5J0SA 3RB3A 2K8BB 2F76X 4ECUA 1J2MA 2WFAA 3RJKA 4PH5A 4QJFB 2MUTA 4F92B 5BPCA 3IG5A 9ICAA 9ICVA 5KFIA 5CRXA 1ZQPA 3PX0A 3GU3A 5DBAA 3LVWA 4RQ3A 1ZQQA 2ISPA 4DQRA 2ZIUB 4UB5A 4K4GA 2I5HA 4YMMA 3OSPA 3QU4A 1N62A 5AM5A 1DRGA 4F8RA 4AYBC 2F8LA 3SAHA 2DUYA 2ODGA 4M9LA 3HW8A 2FLNA 7ICHA 1X6JA 4KX5A 1NK4A 3KFUF 5KFOA 1KFTA 5KG6A 4DFPA 2XC9A 1ZQKA 5B66U 5J8YA 4Y2YA 4IC9A 3UXPA 4PZNA 3UXNA 2PFNA 4CCHA 4ICAA 7ICRA 3D6JA 5J2IA 5ALJA 7ICKA 4JV2A 1F44A 2JH1A 5AHXA 3EYZA 3RJHA 1KN5A 2G5HB 2JGAA 4F4ZA 4JWMA 4CNQA 5DDYA 4ACOA 2R8IA 1D9FA 1WWUA 1X2IA 4P0PB 4QZFA 3F2DA 2AH5A 4C8KA 2HBJA 4IRCA 4BXOB 4M9NA 3SEIA 1SZHA 1NOMA 1Z1VA 2DF4B 3C1ZA 1XC9A 3HJEA 1L8OA 2XGQA 4DWIA 4MFFA 2ES6A 4Y2XA 2W9CA 3UQ2A 4EYIB 1Y88A 4YD1A 3TANA 1DK3A 4IS7A 2YTUA 2WF5A 2FLLA 5KFMA 2KEYA 5AKXA 2E8OA 5EE3A 1T7PA 3RJGA 1WWVA 5AKGA 4PZOA 3F2BA 3EUB2 2ZJ5A 4PPXA 4DO9A 5J2KA 4GIBA 3ONNA 4TUPA 9ICHA 3MDAA 3IDWA 1NJZA 2K8AA 1SKRA 5DLGA 2WB1F 2Y9TA 9ICQA 2HBMA 4ECRA 7ICIA 3F53A 4GC6A 2W8KA 3NGDA 1A76A 1ZQJA 4NY8A 3TFSA 3VCBA 2QB1A 5TISU 4F4KA 2DL0A 5DB6A 3FM9A 1ZQZA 2ASLA 2A3VA 3TFRA 4XQ8A 3EPIA 4DFKA 2HHTA 4G3IA 2NRTA 2ASDA 4KLGA 4RPXA 2PKEA 2ZJ8A 2CXYA 4ED3A 9ICNA 5KFXA 2AQ0A 1V97A 2DKZA 4J03A 4TUSA 1NNLA 1N56A 4FZLA 2F44A 1XNSA 2ASJA 4Y2TA 4IQVA 5KT2A 1NK5A 4EX6A 2EZXA 1NK0A 2PI4A 4C8OA 3HWTA 2HOFA 4IR9A 5K4LA 2YY6A 4KMOB 5ALUA 3GDXA 2W9BA 1WUDA 3RH6A 1N5XA 4C8NA 1XSLA 9ICTA 4IR1A 5DGBA 5KFYA 3SAGA 2EQYA 1JXEA 2BQ3A 4RNOA 8ICRA 2CPRA 3OGUA 2HHWA 5EE1A 2IOFA 7ICJA 3B0XA 2VA8A 4GXIA 5AKKA 4MFAA 2KVSA 8ICMA 3QUCA 4CGZA 4PHPA 3K4GA 9ICXA 8ICUA 7ICSA 3KKAC 1RZTA 2H3QA 2BHNA 5HHIA 1MQ3A 4XRHA 2YN4A 2G06A 3LWLA 3JPSA 3H40A 2E3TA 1ZYQA 5HMMA 5AIBA 2IBKA 1S77D 4Q43A 1KFSA 1UHUA 1PVPA 3UPQA 2WF6A 3KZXA 4RQ5A 1ZRMA 4PJ0U 3GIMA 5KT3A 1QQ5A 2PI5A 3D2NA 2K8CB 2EZZA 4NV0A 3MFIA 2V9WA 4QWBA 4UQGA 1DK2A 2HVIA 3RAXA 5J2JA 2HHSA 1L5UA 3KHRA 2DKXA 2OHFA 2I9GA 2W03A 7ICQA 5AI0A 1C20A 1FFUA 2RDJA 2FI1A 5F9NA 5F3XB 3JPPA 3PV8A 1TKDA 2VANA 2KN7A 2OCEA 5L9XA 4YXMA 5HHHA 2YB1A 2W9BB 4YMNA 1S9FA 3GQCA 4BX9C 3WKBA 4BJQA 1ZQUA 4C80A 1FFVA 3HRDD 2OM6A 1ZQMA 5C0YA 1IG6A 3M9MB 2WF8A 3EW9A 4QW9A 2ZTCA 1IV8A 5ALLA 2KVCA 5KTQA 3RRHA 4AP9A 4RT2A 4FBUA 4OCZA 1ZQYA 2ZIXB 5KFCA 4RZRA 3N7SC 3NVWA 1FO4A 1HUOA 4FS1A 5J0YA 4QZHA 3HT3A 1RPLA 1ZQXA 3UMBA 8ICYA 8ICIA 1RXWA 4QWDA 2P6UA 1YZ7A 1U45A 9ICRA 3PSPA 3ISCA 4DFMA 2P66A 2ZXIA 3AQFA 3G6VA 1MQ2A 1MA7A 4UAZA 4YP3A 2XO7A 2LBOA 5DGAA 2ZTEA 1DOQA 3SV4A 2RDIA 4ECWA 3LDAA 4GXJA 4O3SA 2J6TA 4ECZA 4F71A 4RQMA 1SKWA 3EWAA 5IIOA 1SL1A 4U7CA 1S76D 3SR6A 1FIQA 4I2HA 2MRLA 3Q8MA 3WK6A 3GV5B 4DQQA 2LHTA 5KFLA 5ALTA 4YD2A 3IP4B 5KT4A 4RU9A 2HHVA 4KN4A 5IIIA 2FPLA 4UBBA 3ICXA 3RFAA 4F5NA 1ZQRA 2G5IB 2OYYA 2IHMA 2BPFA 3BQ1A 4KLUA 1PK3A 9ICJA 4KN7A 4WJ3B 1BVSA 2WF9A 4I2DA 4M0AA 5AKYA 1TK5A 1Z1BA 4RQ8A 4ED1A 2OEHA 4RQNA 2IOFK 2YMQA 1T3QA 2KFNA 4QZAA 2W43A 3QZ7A 5H2FU 1O08A 3U26A 4EENA 1PK1A 2ZIWA 2D6FC 3NRWA 5ALXA 4Z6CA 2LM4A 4DQSA 1A77A 3WK8A 3JPOA 5L1MA 2JRZA 4F50A 4QZ9A 3ZD8A 2OXOA 4EBDA 1B0XA 2F77X 2ATLA 5J2AA 4Y2JA 4PHAA 3FC4A 5DLFA 1XO1A 5DG8A 2C28A 2Y1IA 5E79U 5KFFA 1DXSA 4GLXA 4CRXA 1A6SA 4FBTA 1RQNA 4BWJA 2KKVA 1ZJNA 3VC8A 1KW4A 1SZPA 4C4SA 2QLTA 5AI6A 2VJ5A 1SIJA 2HVHA 2YMMA 4P4MA 5ALNA 3UXOA 2KP7A 3T5LA 3MR2A 4EZ9A 4F3OA 4BGDA 3L4PA 3RAQA 3Q8RB 2KZMA 3B0YA 2K60A 3PSFA 3Q8SB 8ICAA 2QB0B 4DL3A 1U4BA 1A0PA 2IHNA 1P7DA 2WTFA 4QZEA 2V4RA 2GH1A 3WK9A 1L3SA 3JPQA 3MGVA 3BZKA 4DL5A 3QXGA 3ETRA 4ECXA 1H38A 3IM1A 1X6IA 1B22A 3IG8A 2LI6A 3FYHA 4IRDA 7ICFA 2NO4A 1BPYA 4PGXA 3OJUA 1ZD2P 1PK1B 2MAXA 3IV6A 2ZIWB 2F3NA 2KKPA 1JX4A 1QLNA 4NJ8A 2JZBB 3NASA 4O3RA 5L1IA 2FMPA 2ZUBA 4P0PA 1SWVA 1Z4NA 3H8WA 2WAQC 9ICBA 1JI7A 3N97B 4MFCA 4ED7A 1SV0A 4ECQA 3PMLA 4BXOA 4F4XA 4DEZA 4RT3A 4F4WA 4PL2A 3BZCA 1S0MA 2CN1A 5AM4A 3OHAA 3MBYA 4EBCA 1ZQOA 8ICPA 3ZD9A 3RB4A 2NYVA 2A19A 3PX4A 5EE0A 3RTVA 4NLNA 5AK3A 1ZQCA 3AEVA 2DFLA 1ZXIA 3TADA 3V7JA 1NKCA 1T8EA 4ELVA 2E8NA 4YFKA 3SQIA 4UAVA 1ZQVA 4MEXA 1NJWA 1V38A 1NZPA 4C7ZA 8ICWA 3HPOA 1ZQIA 9ICCA 4QZCA 2OH2A 3BQ7A 9ICLA 3RR8A 5J2EA 1NKEA 4I2AA 1QQ7A 3QU7A 3ISDA 5KFRA 4UB8U 4GC7A 1KEJA 4DL6A 4M47A 2VIXA 5DBCA 8ICTA 2BCVA 3LK9A 2XVTA 2DGZA 1Q3VA 5DKWA 5AM0A 1RYSA 2PMZC 3CNHA 3JPTA 1MC8A 9ICWA 1SXEA 4RQ7A 3V7LA 3M8SA 3RBDA 5KFEA 2KJ5A 2YB4A 8ICSA 1ZD4A 5CR0A 4IRKA 2W3RA 3RRGA 4TQRA 2ESEA 2MU2A 2DPJA 2AGPA 4I2FA 2A1JB 3NUQA 5ALRA 1LKYB 4TURA 3NVVA 1KRPA 1J97A 4CF4A 4X5VA 3TACB 3C21A 2IMWP 3IN5A 2W8LA 4KLHA 4QIWC 1ECWA 4MF2A 2YQEA 1NI3A 5ALHA 4YR2A 5EOZA 3HKZC 2Y0SF 1L7MA 5L1KA 4Y2RA 2W55A 2NV3A 3M7DA 2XGPA 3BDPA 4Z6FA 4O9MA 5KFPA 5DB9A 1FEZA 1L3VA 3RB0A 2HW3A 2QKQA 3H0LB 7ICVA 4M9HA 4YVZA 4KMUA 4DOBA 2DBYA 1HIWA 1ZQSA 3B9JA 3D2SA 1L6NA 5J2HA 2W04A 5KT7A 2H3IA 1S0VA 3ZDBA 3SENA 2UVRA 1B43A 5ALQA 4DOCA 1SB3C 4A8EA 4F93B 5ALZA 3O0FA 1NK6A 3HX0A 4GXKA 4NXZA 2V4QA 3T79A 4OJLA 4F91B 4LVSA 3SMVA 5AKHA 3WU2U 1Q8KA 2ISOA 4YR3A 5JU5A 2Y1JA 1QCKA 3HILA 4DQPA 1LVHA 4YR0A 3JPNA 4RQ1A 1PZNA 5KFNA 2KICA 4I2CA 5KFGA 7ICPA 4AYBF 4F5PA 4CF3A 1X42A 4P2HA 3THVA 2KZ3A 1IXRA 3RBEA 3DV9A 4Y2UA 1ZQNA 2AGQA 5EWFA 5AKIA 4CDGA 4J9SA 4E0DA 1QH9A 4OD0A 3M9OB 2BQUA 7ICUA 3MR3A 2BCSA 5AM1A 9ICPA 1L7OA 4YXJA 2DPIA 2IA6A 1BGXT 1BNOA 4RUCA 1Q3UA 2P35A 4EEKA 1JALA 2ZG6A 1UPHA 4KLJA 3QUQA 1UT5A 8ICCA 4UB2A 2EH9A 4F72A 3Q8LA 2E1EA 2I1QA 8ICQA 5A0LA 3KHGA 4ECYA 3MC1A 4C4TA 2W11A 1QQ6A 2ZIXA 2NO5A 5J0QA 2HCFA 2LMRA 5B5EU 1N61A 2Z7JA 4B9TA 3CP8A 1OXJA 3KZIU 5JTIA 2GO7A 4TUQA 4NL9A 2HBLA 3RJEA 3N7RC 1PVRA 3GV8B 1NK8A 3BQ0A 4GFJA 2NRVA 3ZDEA 1HEKA 4KITB 4O3NA 4UARA 1N2XA 2F1HA 4JK1A 2RP5A 1D9DA 2AHOB 4DFJA 1N48A 2JV3A 2LM1A 3OJSA 2EAOA 3H0RB 2BR0A 2FDRA 4KLDA 2HI0A 5EE9A 2KV2A 3UQ0A 1JUDA 2RHFA 4J9MA 1L8LA 1SKSA 1TAMA 2JEGA 2W7OA 4Y2PA 4PHDA 4IL6U 3DEEA 3G6YA 2R8GA 3SZ2A 1AQ6A 3TAQA 5ALSA 5J29A 3OHBA 4Z6EA 7ICTA 3KD3A 4NLGA 5HNKA 4Y2VA 4OJ6A 3AN1A 4NWIA 3MGHA 4B9VA 4CE6A 4RQ6A 7ICLA 3WK7A 5BOMA 1RG6A 8ICJA 1JIHA 1T94A 2BGWA 1UA0A 5ALMA 3C2KA 1AROP 3LYSA 4Q8EA 2JMGA 3N7PD 1ZQFA 1BNPA 2M0NA 1RM6C 4LJXA 3WK4A 3I28A 1TAQA 5KL8B 3RJIA 5T14A 4RPZA 4C4RA 1L3UA 5GTHU 1N60A 2H3FA 4DSJA 2F8KA 2XY6A 3MABA 3LWMA 3H8MA 1S97A 3PW2A 4F5OA 5J8YC 2JHDA 2NRWA 1U49A 5J0WA 3SV3A 1ZQGA 4F5QA 4FE3A 4FS2A 3V6HA 4DL4A 1OUQA 2KD1A 4C7YA 5CB1A 4ED0A 4F4YA 2C2DA 4USAA 3C23A 8ICKA 3TI0A 2XCPA 4MF8A 4I27A 4IQWA 4C0ZA 3RJFA 2FJ6A 4NLZA 3GV7B 3AM9A 5AIAA 5JUMA 3Q8PB 1IIPA 1XSNA 2PFPA 4P4OA 5DBBA 4YCXA 5BOLA 4UBCA 5KFBA 3BQTA 3GIIA 2NRXA 5KG1A 4KLSA 1JROA 3PVXA 2QB0A 3PSIA 9ICOA 4EBEA 4C8MA 5IILA 3QU5A 3PR4A 7ICMA 2K4PA 4ECVA 3SAFA 3ETLA 4J9OA 4IQTA 1PVQA 3OSNA 2LPEA 4NLKA 3FDSA 5J2CA 1TV9A 2GOLA 2XY5A 5G5HA 1YZ6A 4DCCA 4R8UB 5AI8A 4DL2A 4FFDA 5L1JA 1NKBA 2B21A 4UW9A 3H7IA 9ICKA 2JZBA 3H8JA 4LZDA 1HJPA 4FZMA 3T5JA 3BS5B 3CW2C 3M8RA 3KHHA 1ZQDA 5AK6A 5IINA 5KG7A 4RUAA 5DG9A 2Y9UA 2HMXA 2QARA 3AU2A 4JWNA 2GWSA 5KFWA 4IQUA 4LZGA 3SD7A 1ZETA 4RPYA 2BCRA 4UAWA 3RR7A 4DSIA 2H5XA 2KTQA 2ZJAA 2DWQA 5KFHA 4NM1A 2KHVA 3MGIA 1XWLA 4Z6DA 2XY7A 4Y2SA 3AQEA 3BJYA 2B0CA 4FO6A 3NVZA 2CRXA 8ICXA 1ED1A 1RQLA 2VJ4A 2KIWA 2P6RA 1OW5A 1F0MA 1U9LA 4ECTA 4M2YA 1JXLA 2AU0A 4R65A 3C1YA 3ZDAA 4R66A 3T5KA 1ZD3A 4KLEA 4KLOA 4BWMA 3GIKA 4O3PA 4K4HA 1F5SA 3CYMA 2KZZA 1V85A 3WK5A 3MDCA 2AGOA 5KFSA 3PW7A 2A1JA 1ZQHA 4I2BA 1LKYA 4B9NA 1Z4OA 3S6JA 2G07A 1N5WA 2QARB 1X9WA 1JMSA 1TFRA 2WB1C 5GTIU 8ICNA 5CP2A 3NTUA 3QUBA 4NLCA 1NJXA 2RQ5A 5KFJA 1SL2A 3QNMA 5J0TA 1WCNA 3PW5A 3CRXA 2XICA 1SXDA 5DQHA 3PO4A 4OJPA 4RQ4A 3EZ5A 1Z00B 4B9UA 4DSKA 4UB6U 5KG5A 1S5LU 1X66A 2W9MA 2M9NA 4DS5A 1X9MA 9ICFA 1BPBA 2YMLA 4F2RA 1LB2B 4QZBA 5KFAA 4ED6A 2EAPA 1COOA 3WKDA 3KOOA 2F2AB 1QSYA 3WKEA 4PL1A 4UB3A 5AKEA 5D4BA 1TVAA 3L3FX 2BCUA 5ALVA 2ZUCA 1DGSA 4J9PA 2BDUA 4MEYA 2BCQA 2W54A 2C2EA 4HAIA 4I29A 2KMDA 3ISBA 9ICGA 3H4DA 3PO5A 1SWWA 5AM3A 4RQ0A 1NJYA 5ALWA 3ZDCA 2KSOA 3NS1A 3AU6A 3AL0B 3M1YA 1CUKA 4F5RA 2ZUDA 5AKLA 5DG7A 4O5EA 3MFHA 2K4IA 2H3VA 1TAUA 2KE7A 5J0OA 5KT5A 1KLNA 4KLIA 5HP4A 2E8PA 1HUZA 1WG8A 2DQNB 4US9A 3NVYA 1RXVA 3QEAZ 9ICSA 4ELTA 1D8YA 3C29A 7ICOA 4XUSA 3R9KA 3RH5A 2FE9A 2BPCA 5AICA 2FMQA 2E8MA 3PY8A 2K4HA 2YMPA 5AI5A 4DF8A 8ICFA 3M6ZA 3QYPA 3UMCA 5J0PA 1V9PA 2MUTB 5ALDA 4B9LA 5KFDA 8ICHA 5DB7A 4PHEA 4B9MA 3F2CA 2A1AA 3K1ZA 4ELUA 3PSTA 3GIJA 3GILA 3QX7A 9ICEA 3DDHA 5DDMA 5JRTA 3F5AA 2E1FA 2KK0A 2FPKA 4YQWA 1S8OA 4Q44A 5J0RA 3WKAA 1TK0A 2YX8A 1SGGA 2WAQF 4DSEA 8ICBA 1UT8A 4PGQA 3RJJA 3RB6A 5J2GA 4KLFA 3NRZA 1ZJMA 1NK9A 1T4GA 2KIVA 4C8LA 2KFZA 2K89A 2ZTDA 3M6KA 4RNNA 2HHQA 2KSOB 2LYBA 4UAYA 5AK4A 1IM4A 2MA1A 1BPDA 2G08A 2VKQA 3UMGA 4UASA 2HOQA 2XIDA 2PFOA 2HOIA 4DL7A 3C5FA 4DS4A 3T3FA 1KQQA 1TE2A 2UVUA 2JH7A 4O3OA 5CJ7A 9ICIA 3A0BU 4Y2QA 7ICGA 5KT6A 1X40A 3SYZA 2JEJA 3F5EA 4ECSA 2LYAA 1D8LA 4J9LA 1K1QA 4YG2A 3UM9A 4RNMA 4QZIA 5KFQA 1KSPA 1KDHA 1L7NA 8ICVA 1B4FA 3J81j 1J2NA 2W9AA 2W9CB 1ZQBA 1ZOLA 3JPRA 8ICLA 2PMZF 3TKAA 2BDPA 2OWOA 4I2IA 4EZ6A 4ZOHC 3ORYA 2KJ9A 4QWCA 4XA5A 4US8A 5KFVA 4FZNA 2AXTU 2EDUA 2XCAA 4OJOA 8ICGA 2D3DA 5AK5A 2R18A 5KAFU 4J9QA 5AM2A 1YT3A 1ZD5A 1C7YA 2F1IA 5CA7A 1TK8A 2BKEA 1Q46A 5CWRA 4O0IA 4UB1A 4KTQA 2N1RA 4QIWF 4J9RA 1K1SA 5C5JA 4NLBA 4DLEA 3TQ1A 4EELA 1Z3EB 2H3ZA 3HKZF 5ALEA 1COKA 2NRZA 3V6KA 1NZBA 1CI4A 5D46A 4YN4A 1KTQA 1O03A 3BS7A 1S0OA 2JR5A 4JB3A 1XS9D 1NK7A 1ZQAA 4I28A 4ED2A 3PMNA 1DGJA 5CEHA 5ALFA 5DQGA 1RDFA 1M6YA 3LVVA 3ALRA 2KOBA 1SV0C 2XI9A 3OPXA 3SI8A 4M9JA 5ALIA 4JMUA 4EX7A 3ED5A 5ALPA 3KTQA 5HR6A 3C5GA 3TARA 1U48A 3PNCA 3E58A 1BPEA 2ZIVA 3BQ2A 3QZ8A 3ZDDA 3PW0A 2RLTA 5DB8A 1XSPA 5AKZA 1N63A 1L3TA 5J0UA 3RH4A 4EEYA 3TADC 1X9XA 4R8UA 2AJQA 3OTQA 5ALOA 2KNJA 3C2LA 3E2EA 5AKJA 3I1YA 1LV5A 3N28A 2RRDA 3IRUA 2KJ8A 2LYHA 5DQIA 4DF4A 3TAPA 4QZ8A 2O6KA 3BS5A 5KFKA 3N4MB 1L7PA 4OO1J 4J9KA 1BPZA 2Q4TA 1UCVA 2W3SA 5ALGA 1ZQ1C 3ZI4A 4DLGA 4I2GA 4M6WA 3Q8KA 5KFTA 4F2SA 2VA3A 5J2BA 1UA1A 8ICOA 1KKXA 4JUZA 3QEBZ 3GFKB 2J6SA 4ED8A 1UQVA 5CHGA 3IHQB 1X9SA 4DOAA 5EWEA 1KBUA 1KL9A 3PW4A 1ZQWA 5FP0A 3WKCA 3EPGA 1ZQLA 4BDPA 3QUTA 5J2FA 3V72A 3Q8QB 4B9SA 7ICNA 2D8CA 2EAMA 1ZRNA 3H0MB 1VLBA 1VDVA 4QWAA 3V7KA 2EANA 4BUGA 2F1JA 4KX3A 4DQIA 1MSWD 1D8BA 2FMSA 2BZFA 4P0QA 1PUZA 4I2EA 1ZQEA 5EWGA 2R8HA 3I76A 1ZQTA 2ZIVB 5D49A 5KG0A 1RYRA 3HP6A 1WCLA 3L5KA 3GZFA 5AI4A 4QZGA 4TQSA 3PR5B 2G0AA 2UVVA 5KG4A 2I6XA 4R64A 2HHUA 1K5OA 1JRPA 5F9LA 4I2JA 4QZDA 2LKYA 4O3QA 2MSNA 1SL0A 1RYUA 5IIKA 1KFDA 5KL1B 4KLMA 5KG2A 4HYKA 5KFZA 4RQ2A 5ALYA 4P4PA 3MR5A 4PGYA 4EYHB 5L1LA 8ICEA 4ZH4A 3D2QA 4JV0A 1URJA 4KLTA 4DFDA 2B6GA 4G9BA 4M6WB 3QU9A 1SV4A 3H4BA 4NM2A 1WYGA 4Q45A 4O5CA 1QSLA 3MR6A 2PXIA 2R8KA 2EZYA 5HMLA 3A0HU 3H8SA 3K75D 2L5YA 5KFUA 1U47A 1Z00A 4OJ5A 4KLLA 2AQ4A 3RF9A 5KG3A 1MN8A 3V6JA 3T5HA 2JEIA 3C2MA 2FLPA 3KBBA 1XU4A 4QWEA 4K4IA 2UVWA 9ICMA 2ZIUA 1GO3F 3E0FA 4KLQA 2VA2A 2E5SA 2HDOA 4DSLA 2Q0ZX 4DSFA 2IOHA 4J9NA 4QW8A 1S10A 4JV1A 2HHXA 4M04A 3G6XA 7ICEA 2FPMA 4UB4A 3QU2A 5TZVA 4P0QB 2C2RA 4UATA 5KAIU 3KKAA 4Q8FA 2WF7A 8ICZA 1BPXA 9ICUA 5IIMA 2WHEA 2PFQA 1CRXA 3M9NB 4MHVA 3PZPA 1S0NA 5ALKA 2ZXHA 1QTMA 4O3MA 2KG5A 3QE9Y 4UAUA 2J6UA 4B6JA 1VJ5A 2Y0SC 3C28A 4R63A 3PX6A 1EXNA 5HR7A 4CF5A 3FAHA 2GLEA 2HSZA 2BQRA 2R8JA 1QSSA 4O5KA 4QNLA 2W7PA 2JXJA 3AUOA 5G5GA 5IIJA 4U6PA 2ALZA 2BPGA 2HBKA 5J0XA 3AMZA 5KNIA 2C22A 1JN3A 2KHQA 1CEZA
chains in the Genus database with same CATH topology
4NL9C 3SEIA 2F44A 5JU5A 3BS5A 3HILA 1Z1VA 2EAPA 1SGGA 2D3DA 2B6GA 1UCVA 1SV4A 3K1RB 4RQNA 1SXEA 2ES6A 1PK1B 2F3NA 2KIVA 4NJ8A 2L5YA 4IS7A 2YTUA 2QB0A 2ESEA 1COKA 2KSOB 1PK1A 1OW5A 2E8OA 1F0MA 1LKYB 2KMDA 2K4PA 1WWVA 4PZOA 1UQVA 1JI7A 3TACB 3BS7A 1SV0A 2KSOA 5L1MA 2LPEA 1B0XA 1RG6A 3IDWA 3KKAC 2D8CA 2EAMA 2KE7A 2Y9TA 2EANA 3KKAA 2E8PA 1SV0C 1V85A 1PK3A 5J8YA 1X40A 1DXSA 4MHVA 4PZNA 1LKYA 2QKQA 3TADA 2KG5A 2F8KA 3BS5B 1KW4A 2QB1A 2QARB 2DL0A 2FE9A 2LMRA 2E8NA 3H8MA 2E8MA 5JTIA 1OXJA 2GLEA 5J8YC 2Y9UA 1B4FA 2QARA 4RQMA 1V38A 4NL9A 3SENA 3TADC 1X9XA 1WWUA 1SXDA 3BQ7A 2K60A 2DKXA 2QB0B 2DKZA 1X66A 5F3XB 5KNIA 5JRTA 2JV3A 2EAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL9 C;  3SEI A;  2F44 A;  5JU5 A;  3BS5 A;  3HIL A;  1Z1V A;  2EAP A;  1SGG A;  2D3D A;  2B6G A;  1UCV A;  1SV4 A;  3K1R B;  4RQN A;  1SXE A;  2ES6 A;  1PK1 B;  2F3N A;  2KIV A;  4NJ8 A;  2L5Y A;  4IS7 A;  2YTU A;  2QB0 A;  2ESE A;  1COK A;  2KSO B;  1PK1 A;  1OW5 A;  2E8O A;  1F0M A;  1LKY B;  2KMD A;  2K4P A;  1WWV A;  4PZO A;  1UQV A;  1JI7 A;  3TAC B;  3BS7 A;  1SV0 A;  2KSO A;  5L1M A;  2LPE A;  1B0X A;  1RG6 A;  3IDW A;  3KKA C;  2D8C A;  2EAM A;  2KE7 A;  2Y9T A;  2EAN A;  3KKA A;  2E8P A;  1SV0 C;  1V85 A;  1PK3 A;  5J8Y A;  1X40 A;  1DXS A;  4MHV A;  4PZN A;  1LKY A;  2QKQ A;  3TAD A;  2KG5 A;  2F8K A;  3BS5 B;  1KW4 A;  2QB1 A;  2QAR B;  2DL0 A;  2FE9 A;  2LMR A;  2E8N A;  3H8M A;  2E8M A;  5JTI A;  1OXJ A;  2GLE A;  5J8Y C;  2Y9U A;  1B4F A;  2QAR A;  4RQM A;  1V38 A;  4NL9 A;  3SEN A;  3TAD C;  1X9X A;  1WWU A;  1SXD A;  3BQ7 A;  2K60 A;  2DKX A;  2QB0 B;  2DKZ A;  1X66 A;  5F3X B;  5KNI A;  5JRT A;  2JV3 A;  2EAO A; 
#chains in the Genus database with same CATH topology
 4NL9 C;  4M9G A;  3KHL A;  5AI9 A;  2G09 A;  1T3N A;  4YMO A;  1XO0 A;  2JEF A;  2K4E A;  5J2D A;  1Z19 A;  3K1R B;  5J0S A;  3RB3 A;  2K8B B;  2F76 X;  4ECU A;  1J2M A;  2WFA A;  3RJK A;  4PH5 A;  4QJF B;  2MUT A;  4F92 B;  5BPC A;  3IG5 A;  9ICA A;  9ICV A;  5KFI A;  5CRX A;  1ZQP A;  3PX0 A;  3GU3 A;  5DBA A;  3LVW A;  4RQ3 A;  1ZQQ A;  2ISP A;  4DQR A;  2ZIU B;  4UB5 A;  4K4G A;  2I5H A;  4YMM A;  3OSP A;  3QU4 A;  1N62 A;  5AM5 A;  1DRG A;  4F8R A;  4AYB C;  2F8L A;  3SAH A;  2DUY A;  2ODG A;  4M9L A;  3HW8 A;  2FLN A;  7ICH A;  1X6J A;  4KX5 A;  1NK4 A;  3KFU F;  5KFO A;  1KFT A;  5KG6 A;  4DFP A;  2XC9 A;  1ZQK A;  5B66 U;  5J8Y A;  4Y2Y A;  4IC9 A;  3UXP A;  4PZN A;  3UXN A;  2PFN A;  4CCH A;  4ICA A;  7ICR A;  3D6J A;  5J2I A;  5ALJ A;  7ICK A;  4JV2 A;  1F44 A;  2JH1 A;  5AHX A;  3EYZ A;  3RJH A;  1KN5 A;  2G5H B;  2JGA A;  4F4Z A;  4JWM A;  4CNQ A;  5DDY A;  4ACO A;  2R8I A;  1D9F A;  1WWU A;  1X2I A;  4P0P B;  4QZF A;  3F2D A;  2AH5 A;  4C8K A;  2HBJ A;  4IRC A;  4BXO B;  4M9N A;  3SEI A;  1SZH A;  1NOM A;  1Z1V A;  2DF4 B;  3C1Z A;  1XC9 A;  3HJE A;  1L8O A;  2XGQ A;  4DWI A;  4MFF A;  2ES6 A;  4Y2X A;  2W9C A;  3UQ2 A;  4EYI B;  1Y88 A;  4YD1 A;  3TAN A;  1DK3 A;  4IS7 A;  2YTU A;  2WF5 A;  2FLL A;  5KFM A;  2KEY A;  5AKX A;  2E8O A;  5EE3 A;  1T7P A;  3RJG A;  1WWV A;  5AKG A;  4PZO A;  3F2B A;  3EUB 2;  2ZJ5 A;  4PPX A;  4DO9 A;  5J2K A;  4GIB A;  3ONN A;  4TUP A;  9ICH A;  3MDA A;  3IDW A;  1NJZ A;  2K8A A;  1SKR A;  5DLG A;  2WB1 F;  2Y9T A;  9ICQ A;  2HBM A;  4ECR A;  7ICI A;  3F53 A;  4GC6 A;  2W8K A;  3NGD A;  1A76 A;  1ZQJ A;  4NY8 A;  3TFS A;  3VCB A;  2QB1 A;  5TIS U;  4F4K A;  2DL0 A;  5DB6 A;  3FM9 A;  1ZQZ A;  2ASL A;  2A3V A;  3TFR A;  4XQ8 A;  3EPI A;  4DFK A;  2HHT A;  4G3I A;  2NRT A;  2ASD A;  4KLG A;  4RPX A;  2PKE A;  2ZJ8 A;  2CXY A;  4ED3 A;  9ICN A;  5KFX A;  2AQ0 A;  1V97 A;  2DKZ A;  4J03 A;  4TUS A;  1NNL A;  1N56 A;  4FZL A;  2F44 A;  1XNS A;  2ASJ A;  4Y2T A;  4IQV A;  5KT2 A;  1NK5 A;  4EX6 A;  2EZX A;  1NK0 A;  2PI4 A;  4C8O A;  3HWT A;  2HOF A;  4IR9 A;  5K4L A;  2YY6 A;  4KMO B;  5ALU A;  3GDX A;  2W9B A;  1WUD A;  3RH6 A;  1N5X A;  4C8N A;  1XSL A;  9ICT A;  4IR1 A;  5DGB A;  5KFY A;  3SAG A;  2EQY A;  1JXE A;  2BQ3 A;  4RNO A;  8ICR A;  2CPR A;  3OGU A;  2HHW A;  5EE1 A;  2IOF A;  7ICJ A;  3B0X A;  2VA8 A;  4GXI A;  5AKK A;  4MFA A;  2KVS A;  8ICM A;  3QUC A;  4CGZ A;  4PHP A;  3K4G A;  9ICX A;  8ICU A;  7ICS A;  3KKA C;  1RZT A;  2H3Q A;  2BHN A;  5HHI A;  1MQ3 A;  4XRH A;  2YN4 A;  2G06 A;  3LWL A;  3JPS A;  3H40 A;  2E3T A;  1ZYQ A;  5HMM A;  5AIB A;  2IBK A;  1S77 D;  4Q43 A;  1KFS A;  1UHU A;  1PVP A;  3UPQ A;  2WF6 A;  3KZX A;  4RQ5 A;  1ZRM A;  4PJ0 U;  3GIM A;  5KT3 A;  1QQ5 A;  2PI5 A;  3D2N A;  2K8C B;  2EZZ A;  4NV0 A;  3MFI A;  2V9W A;  4QWB A;  4UQG A;  1DK2 A;  2HVI A;  3RAX A;  5J2J A;  2HHS A;  1L5U A;  3KHR A;  2DKX A;  2OHF A;  2I9G A;  2W03 A;  7ICQ A;  5AI0 A;  1C20 A;  1FFU A;  2RDJ A;  2FI1 A;  5F9N A;  5F3X B;  3JPP A;  3PV8 A;  1TKD A;  2VAN A;  2KN7 A;  2OCE A;  5L9X A;  4YXM A;  5HHH A;  2YB1 A;  2W9B B;  4YMN A;  1S9F A;  3GQC A;  4BX9 C;  3WKB A;  4BJQ A;  1ZQU A;  4C80 A;  1FFV A;  3HRD D;  2OM6 A;  1ZQM A;  5C0Y A;  1IG6 A;  3M9M B;  2WF8 A;  3EW9 A;  4QW9 A;  2ZTC A;  1IV8 A;  5ALL A;  2KVC A;  5KTQ A;  3RRH A;  4AP9 A;  4RT2 A;  4FBU A;  4OCZ A;  1ZQY A;  2ZIX B;  5KFC A;  4RZR A;  3N7S C;  3NVW A;  1FO4 A;  1HUO A;  4FS1 A;  5J0Y A;  4QZH A;  3HT3 A;  1RPL A;  1ZQX A;  3UMB A;  8ICY A;  8ICI A;  1RXW A;  4QWD A;  2P6U A;  1YZ7 A;  1U45 A;  9ICR A;  3PSP A;  3ISC A;  4DFM A;  2P66 A;  2ZXI A;  3AQF A;  3G6V A;  1MQ2 A;  1MA7 A;  4UAZ A;  4YP3 A;  2XO7 A;  2LBO A;  5DGA A;  2ZTE A;  1DOQ A;  3SV4 A;  2RDI A;  4ECW A;  3LDA A;  4GXJ A;  4O3S A;  2J6T A;  4ECZ A;  4F71 A;  4RQM A;  1SKW A;  3EWA A;  5IIO A;  1SL1 A;  4U7C A;  1S76 D;  3SR6 A;  1FIQ A;  4I2H A;  2MRL A;  3Q8M A;  3WK6 A;  3GV5 B;  4DQQ A;  2LHT A;  5KFL A;  5ALT A;  4YD2 A;  3IP4 B;  5KT4 A;  4RU9 A;  2HHV A;  4KN4 A;  5III A;  2FPL A;  4UBB A;  3ICX A;  3RFA A;  4F5N A;  1ZQR A;  2G5I B;  2OYY A;  2IHM A;  2BPF A;  3BQ1 A;  4KLU A;  1PK3 A;  9ICJ A;  4KN7 A;  4WJ3 B;  1BVS A;  2WF9 A;  4I2D A;  4M0A A;  5AKY A;  1TK5 A;  1Z1B A;  4RQ8 A;  4ED1 A;  2OEH A;  4RQN A;  2IOF K;  2YMQ A;  1T3Q A;  2KFN A;  4QZA A;  2W43 A;  3QZ7 A;  5H2F U;  1O08 A;  3U26 A;  4EEN A;  1PK1 A;  2ZIW A;  2D6F C;  3NRW A;  5ALX A;  4Z6C A;  2LM4 A;  4DQS A;  1A77 A;  3WK8 A;  3JPO A;  5L1M A;  2JRZ A;  4F50 A;  4QZ9 A;  3ZD8 A;  2OXO A;  4EBD A;  1B0X A;  2F77 X;  2ATL A;  5J2A A;  4Y2J A;  4PHA A;  3FC4 A;  5DLF A;  1XO1 A;  5DG8 A;  2C28 A;  2Y1I A;  5E79 U;  5KFF A;  1DXS A;  4GLX A;  4CRX A;  1A6S A;  4FBT A;  1RQN A;  4BWJ A;  2KKV A;  1ZJN A;  3VC8 A;  1KW4 A;  1SZP A;  4C4S A;  2QLT A;  5AI6 A;  2VJ5 A;  1SIJ A;  2HVH A;  2YMM A;  4P4M A;  5ALN A;  3UXO A;  2KP7 A;  3T5L A;  3MR2 A;  4EZ9 A;  4F3O A;  4BGD A;  3L4P A;  3RAQ A;  3Q8R B;  2KZM A;  3B0Y A;  2K60 A;  3PSF A;  3Q8S B;  8ICA A;  2QB0 B;  4DL3 A;  1U4B A;  1A0P A;  2IHN A;  1P7D A;  2WTF A;  4QZE A;  2V4R A;  2GH1 A;  3WK9 A;  1L3S A;  3JPQ A;  3MGV A;  3BZK A;  4DL5 A;  3QXG A;  3ETR A;  4ECX A;  1H38 A;  3IM1 A;  1X6I A;  1B22 A;  3IG8 A;  2LI6 A;  3FYH A;  4IRD A;  7ICF A;  2NO4 A;  1BPY A;  4PGX A;  3OJU A;  1ZD2 P;  1PK1 B;  2MAX A;  3IV6 A;  2ZIW B;  2F3N A;  2KKP A;  1JX4 A;  1QLN A;  4NJ8 A;  2JZB B;  3NAS A;  4O3R A;  5L1I A;  2FMP A;  2ZUB A;  4P0P A;  1SWV A;  1Z4N A;  3H8W A;  2WAQ C;  9ICB A;  1JI7 A;  3N97 B;  4MFC A;  4ED7 A;  1SV0 A;  4ECQ A;  3PML A;  4BXO A;  4F4X A;  4DEZ A;  4RT3 A;  4F4W A;  4PL2 A;  3BZC A;  1S0M A;  2CN1 A;  5AM4 A;  3OHA A;  3MBY A;  4EBC A;  1ZQO A;  8ICP A;  3ZD9 A;  3RB4 A;  2NYV A;  2A19 A;  3PX4 A;  5EE0 A;  3RTV A;  4NLN A;  5AK3 A;  1ZQC A;  3AEV A;  2DFL A;  1ZXI A;  3TAD A;  3V7J A;  1NKC A;  1T8E A;  4ELV A;  2E8N A;  4YFK A;  3SQI A;  4UAV A;  1ZQV A;  4MEX A;  1NJW A;  1V38 A;  1NZP A;  4C7Z A;  8ICW A;  3HPO A;  1ZQI A;  9ICC A;  4QZC A;  2OH2 A;  3BQ7 A;  9ICL A;  3RR8 A;  5J2E A;  1NKE A;  4I2A A;  1QQ7 A;  3QU7 A;  3ISD A;  5KFR A;  4UB8 U;  4GC7 A;  1KEJ A;  4DL6 A;  4M47 A;  2VIX A;  5DBC A;  8ICT A;  2BCV A;  3LK9 A;  2XVT A;  2DGZ A;  1Q3V A;  5DKW A;  5AM0 A;  1RYS A;  2PMZ C;  3CNH A;  3JPT A;  1MC8 A;  9ICW A;  1SXE A;  4RQ7 A;  3V7L A;  3M8S A;  3RBD A;  5KFE A;  2KJ5 A;  2YB4 A;  8ICS A;  1ZD4 A;  5CR0 A;  4IRK A;  2W3R A;  3RRG A;  4TQR A;  2ESE A;  2MU2 A;  2DPJ A;  2AGP A;  4I2F A;  2A1J B;  3NUQ A;  5ALR A;  1LKY B;  4TUR A;  3NVV A;  1KRP A;  1J97 A;  4CF4 A;  4X5V A;  3TAC B;  3C21 A;  2IMW P;  3IN5 A;  2W8L A;  4KLH A;  4QIW C;  1ECW A;  4MF2 A;  2YQE A;  1NI3 A;  5ALH A;  4YR2 A;  5EOZ A;  3HKZ C;  2Y0S F;  1L7M A;  5L1K A;  4Y2R A;  2W55 A;  2NV3 A;  3M7D A;  2XGP A;  3BDP A;  4Z6F A;  4O9M A;  5KFP A;  5DB9 A;  1FEZ A;  1L3V A;  3RB0 A;  2HW3 A;  2QKQ A;  3H0L B;  7ICV A;  4M9H A;  4YVZ A;  4KMU A;  4DOB A;  2DBY A;  1HIW A;  1ZQS A;  3B9J A;  3D2S A;  1L6N A;  5J2H A;  2W04 A;  5KT7 A;  2H3I A;  1S0V A;  3ZDB A;  3SEN A;  2UVR A;  1B43 A;  5ALQ A;  4DOC A;  1SB3 C;  4A8E A;  4F93 B;  5ALZ A;  3O0F A;  1NK6 A;  3HX0 A;  4GXK A;  4NXZ A;  2V4Q A;  3T79 A;  4OJL A;  4F91 B;  4LVS A;  3SMV A;  5AKH A;  3WU2 U;  1Q8K A;  2ISO A;  4YR3 A;  5JU5 A;  2Y1J A;  1QCK A;  3HIL A;  4DQP A;  1LVH A;  4YR0 A;  3JPN A;  4RQ1 A;  1PZN A;  5KFN A;  2KIC A;  4I2C A;  5KFG A;  7ICP A;  4AYB F;  4F5P A;  4CF3 A;  1X42 A;  4P2H A;  3THV A;  2KZ3 A;  1IXR A;  3RBE A;  3DV9 A;  4Y2U A;  1ZQN A;  2AGQ A;  5EWF A;  5AKI A;  4CDG A;  4J9S A;  4E0D A;  1QH9 A;  4OD0 A;  3M9O B;  2BQU A;  7ICU A;  3MR3 A;  2BCS A;  5AM1 A;  9ICP A;  1L7O A;  4YXJ A;  2DPI A;  2IA6 A;  1BGX T;  1BNO A;  4RUC A;  1Q3U A;  2P35 A;  4EEK A;  1JAL A;  2ZG6 A;  1UPH A;  4KLJ A;  3QUQ A;  1UT5 A;  8ICC A;  4UB2 A;  2EH9 A;  4F72 A;  3Q8L A;  2E1E A;  2I1Q A;  8ICQ A;  5A0L A;  3KHG A;  4ECY A;  3MC1 A;  4C4T A;  2W11 A;  1QQ6 A;  2ZIX A;  2NO5 A;  5J0Q A;  2HCF A;  2LMR A;  5B5E U;  1N61 A;  2Z7J A;  4B9T A;  3CP8 A;  1OXJ A;  3KZI U;  5JTI A;  2GO7 A;  4TUQ A;  4NL9 A;  2HBL A;  3RJE A;  3N7R C;  1PVR A;  3GV8 B;  1NK8 A;  3BQ0 A;  4GFJ A;  2NRV A;  3ZDE A;  1HEK A;  4KIT B;  4O3N A;  4UAR A;  1N2X A;  2F1H A;  4JK1 A;  2RP5 A;  1D9D A;  2AHO B;  4DFJ A;  1N48 A;  2JV3 A;  2LM1 A;  3OJS A;  2EAO A;  3H0R B;  2BR0 A;  2FDR A;  4KLD A;  2HI0 A;  5EE9 A;  2KV2 A;  3UQ0 A;  1JUD A;  2RHF A;  4J9M A;  1L8L A;  1SKS A;  1TAM A;  2JEG A;  2W7O A;  4Y2P A;  4PHD A;  4IL6 U;  3DEE A;  3G6Y A;  2R8G A;  3SZ2 A;  1AQ6 A;  3TAQ A;  5ALS A;  5J29 A;  3OHB A;  4Z6E A;  7ICT A;  3KD3 A;  4NLG A;  5HNK A;  4Y2V A;  4OJ6 A;  3AN1 A;  4NWI A;  3MGH A;  4B9V A;  4CE6 A;  4RQ6 A;  7ICL A;  3WK7 A;  5BOM A;  1RG6 A;  8ICJ A;  1JIH A;  1T94 A;  2BGW A;  1UA0 A;  5ALM A;  3C2K A;  1ARO P;  3LYS A;  4Q8E A;  2JMG A;  3N7P D;  1ZQF A;  1BNP A;  2M0N A;  1RM6 C;  4LJX A;  3WK4 A;  3I28 A;  1TAQ A;  5KL8 B;  3RJI A;  5T14 A;  4RPZ A;  4C4R A;  1L3U A;  5GTH U;  1N60 A;  2H3F A;  4DSJ A;  2F8K A;  2XY6 A;  3MAB A;  3LWM A;  3H8M A;  1S97 A;  3PW2 A;  4F5O A;  5J8Y C;  2JHD A;  2NRW A;  1U49 A;  5J0W A;  3SV3 A;  1ZQG A;  4F5Q A;  4FE3 A;  4FS2 A;  3V6H A;  4DL4 A;  1OUQ A;  2KD1 A;  4C7Y A;  5CB1 A;  4ED0 A;  4F4Y A;  2C2D A;  4USA A;  3C23 A;  8ICK A;  3TI0 A;  2XCP A;  4MF8 A;  4I27 A;  4IQW A;  4C0Z A;  3RJF A;  2FJ6 A;  4NLZ A;  3GV7 B;  3AM9 A;  5AIA A;  5JUM A;  3Q8P B;  1IIP A;  1XSN A;  2PFP A;  4P4O A;  5DBB A;  4YCX A;  5BOL A;  4UBC A;  5KFB A;  3BQT A;  3GII A;  2NRX A;  5KG1 A;  4KLS A;  1JRO A;  3PVX A;  2QB0 A;  3PSI A;  9ICO A;  4EBE A;  4C8M A;  5IIL A;  3QU5 A;  3PR4 A;  7ICM A;  2K4P A;  4ECV A;  3SAF A;  3ETL A;  4J9O A;  4IQT A;  1PVQ A;  3OSN A;  2LPE A;  4NLK A;  3FDS A;  5J2C A;  1TV9 A;  2GOL A;  2XY5 A;  5G5H A;  1YZ6 A;  4DCC A;  4R8U B;  5AI8 A;  4DL2 A;  4FFD A;  5L1J A;  1NKB A;  2B21 A;  4UW9 A;  3H7I A;  9ICK A;  2JZB A;  3H8J A;  4LZD A;  1HJP A;  4FZM A;  3T5J A;  3BS5 B;  3CW2 C;  3M8R A;  3KHH A;  1ZQD A;  5AK6 A;  5IIN A;  5KG7 A;  4RUA A;  5DG9 A;  2Y9U A;  2HMX A;  2QAR A;  3AU2 A;  4JWN A;  2GWS A;  5KFW A;  4IQU A;  4LZG A;  3SD7 A;  1ZET A;  4RPY A;  2BCR A;  4UAW A;  3RR7 A;  4DSI A;  2H5X A;  2KTQ A;  2ZJA A;  2DWQ A;  5KFH A;  4NM1 A;  2KHV A;  3MGI A;  1XWL A;  4Z6D A;  2XY7 A;  4Y2S A;  3AQE A;  3BJY A;  2B0C A;  4FO6 A;  3NVZ A;  2CRX A;  8ICX A;  1ED1 A;  1RQL A;  2VJ4 A;  2KIW A;  2P6R A;  1OW5 A;  1F0M A;  1U9L A;  4ECT A;  4M2Y A;  1JXL A;  2AU0 A;  4R65 A;  3C1Y A;  3ZDA A;  4R66 A;  3T5K A;  1ZD3 A;  4KLE A;  4KLO A;  4BWM A;  3GIK A;  4O3P A;  4K4H A;  1F5S A;  3CYM A;  2KZZ A;  1V85 A;  3WK5 A;  3MDC A;  2AGO A;  5KFS A;  3PW7 A;  2A1J A;  1ZQH A;  4I2B A;  1LKY A;  4B9N A;  1Z4O A;  3S6J A;  2G07 A;  1N5W A;  2QAR B;  1X9W A;  1JMS A;  1TFR A;  2WB1 C;  5GTI U;  8ICN A;  5CP2 A;  3NTU A;  3QUB A;  4NLC A;  1NJX A;  2RQ5 A;  5KFJ A;  1SL2 A;  3QNM A;  5J0T A;  1WCN A;  3PW5 A;  3CRX A;  2XIC A;  1SXD A;  5DQH A;  3PO4 A;  4OJP A;  4RQ4 A;  3EZ5 A;  1Z00 B;  4B9U A;  4DSK A;  4UB6 U;  5KG5 A;  1S5L U;  1X66 A;  2W9M A;  2M9N A;  4DS5 A;  1X9M A;  9ICF A;  1BPB A;  2YML A;  4F2R A;  1LB2 B;  4QZB A;  5KFA A;  4ED6 A;  2EAP A;  1COO A;  3WKD A;  3KOO A;  2F2A B;  1QSY A;  3WKE A;  4PL1 A;  4UB3 A;  5AKE A;  5D4B A;  1TVA A;  3L3F X;  2BCU A;  5ALV A;  2ZUC A;  1DGS A;  4J9P A;  2BDU A;  4MEY A;  2BCQ A;  2W54 A;  2C2E A;  4HAI A;  4I29 A;  2KMD A;  3ISB A;  9ICG A;  3H4D A;  3PO5 A;  1SWW A;  5AM3 A;  4RQ0 A;  1NJY A;  5ALW A;  3ZDC A;  2KSO A;  3NS1 A;  3AU6 A;  3AL0 B;  3M1Y A;  1CUK A;  4F5R A;  2ZUD A;  5AKL A;  5DG7 A;  4O5E A;  3MFH A;  2K4I A;  2H3V A;  1TAU A;  2KE7 A;  5J0O A;  5KT5 A;  1KLN A;  4KLI A;  5HP4 A;  2E8P A;  1HUZ A;  1WG8 A;  2DQN B;  4US9 A;  3NVY A;  1RXV A;  3QEA Z;  9ICS A;  4ELT A;  1D8Y A;  3C29 A;  7ICO A;  4XUS A;  3R9K A;  3RH5 A;  2FE9 A;  2BPC A;  5AIC A;  2FMQ A;  2E8M A;  3PY8 A;  2K4H A;  2YMP A;  5AI5 A;  4DF8 A;  8ICF A;  3M6Z A;  3QYP A;  3UMC A;  5J0P A;  1V9P A;  2MUT B;  5ALD A;  4B9L A;  5KFD A;  8ICH A;  5DB7 A;  4PHE A;  4B9M A;  3F2C A;  2A1A A;  3K1Z A;  4ELU A;  3PST A;  3GIJ A;  3GIL A;  3QX7 A;  9ICE A;  3DDH A;  5DDM A;  5JRT A;  3F5A A;  2E1F A;  2KK0 A;  2FPK A;  4YQW A;  1S8O A;  4Q44 A;  5J0R A;  3WKA A;  1TK0 A;  2YX8 A;  1SGG A;  2WAQ F;  4DSE A;  8ICB A;  1UT8 A;  4PGQ A;  3RJJ A;  3RB6 A;  5J2G A;  4KLF A;  3NRZ A;  1ZJM A;  1NK9 A;  1T4G A;  2KIV A;  4C8L A;  2KFZ A;  2K89 A;  2ZTD A;  3M6K A;  4RNN A;  2HHQ A;  2KSO B;  2LYB A;  4UAY A;  5AK4 A;  1IM4 A;  2MA1 A;  1BPD A;  2G08 A;  2VKQ A;  3UMG A;  4UAS A;  2HOQ A;  2XID A;  2PFO A;  2HOI A;  4DL7 A;  3C5F A;  4DS4 A;  3T3F A;  1KQQ A;  1TE2 A;  2UVU A;  2JH7 A;  4O3O A;  5CJ7 A;  9ICI A;  3A0B U;  4Y2Q A;  7ICG A;  5KT6 A;  1X40 A;  3SYZ A;  2JEJ A;  3F5E A;  4ECS A;  2LYA A;  1D8L A;  4J9L A;  1K1Q A;  4YG2 A;  3UM9 A;  4RNM A;  4QZI A;  5KFQ A;  1KSP A;  1KDH A;  1L7N A;  8ICV A;  1B4F A;  3J81 j;  1J2N A;  2W9A A;  2W9C B;  1ZQB A;  1ZOL A;  3JPR A;  8ICL A;  2PMZ F;  3TKA A;  2BDP A;  2OWO A;  4I2I A;  4EZ6 A;  4ZOH C;  3ORY A;  2KJ9 A;  4QWC A;  4XA5 A;  4US8 A;  5KFV A;  4FZN A;  2AXT U;  2EDU A;  2XCA A;  4OJO A;  8ICG A;  2D3D A;  5AK5 A;  2R18 A;  5KAF U;  4J9Q A;  5AM2 A;  1YT3 A;  1ZD5 A;  1C7Y A;  2F1I A;  5CA7 A;  1TK8 A;  2BKE A;  1Q46 A;  5CWR A;  4O0I A;  4UB1 A;  4KTQ A;  2N1R A;  4QIW F;  4J9R A;  1K1S A;  5C5J A;  4NLB A;  4DLE A;  3TQ1 A;  4EEL A;  1Z3E B;  2H3Z A;  3HKZ F;  5ALE A;  1COK A;  2NRZ A;  3V6K A;  1NZB A;  1CI4 A;  5D46 A;  4YN4 A;  1KTQ A;  1O03 A;  3BS7 A;  1S0O A;  2JR5 A;  4JB3 A;  1XS9 D;  1NK7 A;  1ZQA A;  4I28 A;  4ED2 A;  3PMN A;  1DGJ A;  5CEH A;  5ALF A;  5DQG A;  1RDF A;  1M6Y A;  3LVV A;  3ALR A;  2KOB A;  1SV0 C;  2XI9 A;  3OPX A;  3SI8 A;  4M9J A;  5ALI A;  4JMU A;  4EX7 A;  3ED5 A;  5ALP A;  3KTQ A;  5HR6 A;  3C5G A;  3TAR A;  1U48 A;  3PNC A;  3E58 A;  1BPE A;  2ZIV A;  3BQ2 A;  3QZ8 A;  3ZDD A;  3PW0 A;  2RLT A;  5DB8 A;  1XSP A;  5AKZ A;  1N63 A;  1L3T A;  5J0U A;  3RH4 A;  4EEY A;  3TAD C;  1X9X A;  4R8U A;  2AJQ A;  3OTQ A;  5ALO A;  2KNJ A;  3C2L A;  3E2E A;  5AKJ A;  3I1Y A;  1LV5 A;  3N28 A;  2RRD A;  3IRU A;  2KJ8 A;  2LYH A;  5DQI A;  4DF4 A;  3TAP A;  4QZ8 A;  2O6K A;  3BS5 A;  5KFK A;  3N4M B;  1L7P A;  4OO1 J;  4J9K A;  1BPZ A;  2Q4T A;  1UCV A;  2W3S A;  5ALG A;  1ZQ1 C;  3ZI4 A;  4DLG A;  4I2G A;  4M6W A;  3Q8K A;  5KFT A;  4F2S A;  2VA3 A;  5J2B A;  1UA1 A;  8ICO A;  1KKX A;  4JUZ A;  3QEB Z;  3GFK B;  2J6S A;  4ED8 A;  1UQV A;  5CHG A;  3IHQ B;  1X9S A;  4DOA A;  5EWE A;  1KBU A;  1KL9 A;  3PW4 A;  1ZQW A;  5FP0 A;  3WKC A;  3EPG A;  1ZQL A;  4BDP A;  3QUT A;  5J2F A;  3V72 A;  3Q8Q B;  4B9S A;  7ICN A;  2D8C A;  2EAM A;  1ZRN A;  3H0M B;  1VLB A;  1VDV A;  4QWA A;  3V7K A;  2EAN A;  4BUG A;  2F1J A;  4KX3 A;  4DQI A;  1MSW D;  1D8B A;  2FMS A;  2BZF A;  4P0Q A;  1PUZ A;  4I2E A;  1ZQE A;  5EWG A;  2R8H A;  3I76 A;  1ZQT A;  2ZIV B;  5D49 A;  5KG0 A;  1RYR A;  3HP6 A;  1WCL A;  3L5K A;  3GZF A;  5AI4 A;  4QZG A;  4TQS A;  3PR5 B;  2G0A A;  2UVV A;  5KG4 A;  2I6X A;  4R64 A;  2HHU A;  1K5O A;  1JRP A;  5F9L A;  4I2J A;  4QZD A;  2LKY A;  4O3Q A;  2MSN A;  1SL0 A;  1RYU A;  5IIK A;  1KFD A;  5KL1 B;  4KLM A;  5KG2 A;  4HYK A;  5KFZ A;  4RQ2 A;  5ALY A;  4P4P A;  3MR5 A;  4PGY A;  4EYH B;  5L1L A;  8ICE A;  4ZH4 A;  3D2Q A;  4JV0 A;  1URJ A;  4KLT A;  4DFD A;  2B6G A;  4G9B A;  4M6W B;  3QU9 A;  1SV4 A;  3H4B A;  4NM2 A;  1WYG A;  4Q45 A;  4O5C A;  1QSL A;  3MR6 A;  2PXI A;  2R8K A;  2EZY A;  5HML A;  3A0H U;  3H8S A;  3K75 D;  2L5Y A;  5KFU A;  1U47 A;  1Z00 A;  4OJ5 A;  4KLL A;  2AQ4 A;  3RF9 A;  5KG3 A;  1MN8 A;  3V6J A;  3T5H A;  2JEI A;  3C2M A;  2FLP A;  3KBB A;  1XU4 A;  4QWE A;  4K4I A;  2UVW A;  9ICM A;  2ZIU A;  1GO3 F;  3E0F A;  4KLQ A;  2VA2 A;  2E5S A;  2HDO A;  4DSL A;  2Q0Z X;  4DSF A;  2IOH A;  4J9N A;  4QW8 A;  1S10 A;  4JV1 A;  2HHX A;  4M04 A;  3G6X A;  7ICE A;  2FPM A;  4UB4 A;  3QU2 A;  5TZV A;  4P0Q B;  2C2R A;  4UAT A;  5KAI U;  3KKA A;  4Q8F A;  2WF7 A;  8ICZ A;  1BPX A;  9ICU A;  5IIM A;  2WHE A;  2PFQ A;  1CRX A;  3M9N B;  4MHV A;  3PZP A;  1S0N A;  5ALK A;  2ZXH A;  1QTM A;  4O3M A;  2KG5 A;  3QE9 Y;  4UAU A;  2J6U A;  4B6J A;  1VJ5 A;  2Y0S C;  3C28 A;  4R63 A;  3PX6 A;  1EXN A;  5HR7 A;  4CF5 A;  3FAH A;  2GLE A;  2HSZ A;  2BQR A;  2R8J A;  1QSS A;  4O5K A;  4QNL A;  2W7P A;  2JXJ A;  3AUO A;  5G5G A;  5IIJ A;  4U6P A;  2ALZ A;  2BPG A;  2HBK A;  5J0X A;  3AMZ A;  5KNI A;  2C22 A;  1JN3 A;  2KHQ A;  1CEZ A; 
#chains in the Genus database with same CATH homology
 4NL9 C;  3SEI A;  2F44 A;  5JU5 A;  3BS5 A;  3HIL A;  1Z1V A;  2EAP A;  1SGG A;  2D3D A;  2B6G A;  1UCV A;  1SV4 A;  3K1R B;  4RQN A;  1SXE A;  2ES6 A;  1PK1 B;  2F3N A;  2KIV A;  4NJ8 A;  2L5Y A;  4IS7 A;  2YTU A;  2QB0 A;  2ESE A;  1COK A;  2KSO B;  1PK1 A;  1OW5 A;  2E8O A;  1F0M A;  1LKY B;  2KMD A;  2K4P A;  1WWV A;  4PZO A;  1UQV A;  1JI7 A;  3TAC B;  3BS7 A;  1SV0 A;  2KSO A;  5L1M A;  2LPE A;  1B0X A;  1RG6 A;  3IDW A;  3KKA C;  2D8C A;  2EAM A;  2KE7 A;  2Y9T A;  2EAN A;  3KKA A;  2E8P A;  1SV0 C;  1V85 A;  1PK3 A;  5J8Y A;  1X40 A;  1DXS A;  4MHV A;  4PZN A;  1LKY A;  2QKQ A;  3TAD A;  2KG5 A;  2F8K A;  3BS5 B;  1KW4 A;  2QB1 A;  2QAR B;  2DL0 A;  2FE9 A;  2LMR A;  2E8N A;  3H8M A;  2E8M A;  5JTI A;  1OXJ A;  2GLE A;  5J8Y C;  2Y9U A;  1B4F A;  2QAR A;  4RQM A;  1V38 A;  4NL9 A;  3SEN A;  3TAD C;  1X9X A;  1WWU A;  1SXD A;  3BQ7 A;  2K60 A;  2DKX A;  2QB0 B;  2DKZ A;  1X66 A;  5F3X B;  5KNI A;  5JRT A;  2JV3 A;  2EAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...