1B0XA

The crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
FSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of an Eph receptor SAM domain reveals a mechanism for modular dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords PROTEIN (EPHA4 RECEPTOR TYROSINE KINASE)
total genus 23
structure length 72
sequence length 72
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1998-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1b0xA00
1SV4A 1SXEA 1RG6A 1X40A 1X9XA 1JI7A 2JV3A 1COKA 3BS5A 2K4PA 2E8MA 2Y9TA 1SV0C 1OW5A 3TADC 4IS7A 5JRTA 4RQNA 1LKYB 2EAPA 2LPEA 1B0XA 2K60A 3K1RB 2YTUA 2E8OA 2DL0A 1SV0A 1PK1B 4NL9C 1DXSA 1LKYA 3SENA 2D8CA 2L5YA 3BS5B 3SEIA 1F0MA 1PK1A 1SXDA 4PZOA 2KSOA 1B4FA 1Z1VA 1PK3A 1SGGA 2QARA 4MHVA 3KKAA 1V38A 1OXJA 2LMRA 3BS7A 5L1MA 2QB1A 2ES6A 5J8YC 2DKZA 3IDWA 1KW4A 3BQ7A 2KIVA 4NJ8A 2F3NA 2EAMA 2DKXA 4RQMA 1UCVA 1WWUA 1WWVA 2E8PA 5JU5A 5JTIA 2EAOA 2FE9A 2KE7A 1X66A 2KMDA 3H8MA 5F3XB 3HILA 2B6GA 2E8NA 1UQVA 2EANA 2D3DA 2F44A 3TADA 2QB0A 2F8KA 5J8YA 2QKQA 2QARB 1V85A 4PZNA 4NL9A 2KG5A 2KSOB 3TACB 2ESEA 5KNIA 2QB0B 2Y9UA 2GLEA 3KKAC
chains in the Genus database with same CATH superfamily
3ONNA 4PL1A 2H3QA 2Y9TA 3OPXA 2ZIUA 5KFWA 3MDCA 4DL6A 5J2DA 2E1EA 3F2BA 1XO1A 3ZD9A 3LDAA 4KMOB 2ZG6A 4F92B 1Z3EB 1X6JA 4NL9C 4DS5A 1H38A 4PHEA 2L5YA 2CN1A 4EENA 1PZNA 4RU9A 1L3VA 4IR9A 1F44A 1ZQPA 3GV8B 1Z1VA 2HHUA 3HT3A 3KZXA 1SWWA 1L7MA 2JRZA 1CEZA 5KFPA 1V38A 3HKZC 4TUQA 1ZQ1C 1D8BA 2A1AA 4XQ8A 5L1IA 4QIWC 3WKCA 4QZGA 1VJ5A 5AM4A 9ICOA 2BQUA 1ZQZA 3IDWA 4JWMA 1A77A 4BUGA 2BQRA 4UAZA 3WKEA 4QWCA 1ZQVA 2VA3A 1XC9A 2E8PA 3C1ZA 2IA6A 3MR2A 4DQPA 2NRWA 3ORYA 1NK4A 3PSPA 2F1JA 2MRLA 2D3DA 1FFUA 5ALVA 2QLTA 4RQ7A 2DBYA 2FMQA 4FE3A 4QWBA 4AYBF 2BQ3A 2QARB 3V6HA 1IIPA 2YB4A 3E0FA 5TISU 4F4KA 2UVVA 4ECRA 4FZNA 2JGAA 2KD1A 5J2FA 1SXEA 5ALGA 1XS9D 2JV3A 4YD1A 2E8MA 1NKBA 2IBKA 2Y1JA 3IRUA 2KFZA 4CRXA 5AM2A 4LVSA 1MN8A 1DRGA 1J2MA 2W04A 2BPGA 1WCNA 3D6JA 2YTUA 5DQGA 1XWLA 4EBDA 4YN4A 4EYHB 3ZDDA 1F0MA 4KN4A 5G5GA 4DSFA 1D8LA 8ICYA 4O3QA 8ICEA 4ICAA 4RQ1A 1S0MA 1KDHA 4HAIA 8ICHA 5ALEA 2KP7A 8ICKA 4P0QA 1SZPA 5IIIA 2WB1F 2QB1A 2ES6A 4DOBA 4KX3A 4ZOHC 4M6WB 2HI0A 2LM4A 2MSNA 3BQ7A 1RQNA 2VJ4A 4BGDA 1X6IA 1WWUA 1WWVA 4ELTA 2CXYA 7ICLA 4GXIA 2P6RA 1ZXIA 2FE9A 3GIIA 5IIOA 2W55A 2JEFA 3UMCA 3J81j 3WKBA 1NOMA 2MUTB 2ZJAA 1ZQFA 1T3QA 3M9OB 2ZUDA 1SKWA 3UQ2A 9ICUA 4G9BA 1F5SA 4GIBA 1L8LA 5J2IA 4DQSA 9ICRA 5HP4A 5KFRA 1EXNA 2PKEA 3K4GA 1N48A 3KHGA 3M6KA 2ISPA 3QEBZ 3C23A 1WG8A 1MC8A 4C80A 2BDUA 1QLNA 3CRXA 1UPHA 2E5SA 5DGBA 4YMMA 4GXJA 4U7CA 4DCCA 2Z7JA 4C7ZA 3SV3A 4KLLA 1Y88A 1ZJMA 3QU4A 4GC7A 5ALLA 5KTQA 2ZXHA 2R8HA 5KFMA 3MGVA 2KKVA 5ALKA 1Z00B 4O5CA 1HEKA 1KSPA 4O3MA 2R8IA 4CE6A 5J0YA 3K75D 5IINA 2XY6A 3MR3A 8ICFA 1LV5A 1WUDA 3KKAA 1HUOA 2W9MA 3LWMA 3BS7A 2OXOA 3EPGA 5KT6A 4GXKA 3N7PD 2JR5A 8ICWA 2UVUA 2KKPA 3RB6A 2FLPA 2E1FA 1ZOLA 2G5IB 4DQRA 2NO4A 5J2GA 1X66A 2H3IA 3T5HA 1QSSA 2B6GA 2LHTA 7ICTA 2YMLA 2EANA 3TADA 2KJ9A 4DQQA 5BOLA 5ALJA 2ZJ5A 2QKQA 2C28A 4EBEA 2DPIA 5KT7A 3CYMA 2W7PA 3RH6A 3ISCA 2HVIA 2KEYA 5ALPA 2PFNA 1KLNA 2WFAA 2BHNA 3Q8PB 1C7YA 3AEVA 3H0LB 1S8OA 3IG8A 2PMZF 3RRHA 3Q8MA 1XSPA 1RYSA 5A0LA 1OW5A 5HR6A 1T3NA 5FP0A 5J2CA 7ICUA 3WKAA 4TQSA 4NLNA 5HR7A 4O0IA 3PZPA 5KFYA 4R8UA 2NRXA 2EAPA 1X9WA 1T4GA 2LPEA 1B0XA 1L7PA 5ALQA 1Q8KA 3GIMA 1QSYA 4KLGA 2RHFA 3RJIA 1ZQNA 4UB8U 2VJ5A 4F4XA 1KFTA 5KG1A 3BJYA 2HW3A 3SZ2A 1J97A 2ZIWB 4MHVA 2BGWA 1BGXT 2YMQA 3JPNA 2IOFK 4KLHA 3JPQA 3CW2C 2ZIUB 3QU2A 3CP8A 3PX6A 2ZIVA 4Q45A 1DK3A 1BPDA 5L1LA 2PFQA 4QZDA 4CDGA 3ALRA 1SL1A 3WK7A 5AIBA 4J9OA 4Y2QA 3OSPA 1U48A 1ZQEA 4UB5A 2G08A 3WK5A 5J0RA 3EYZA 4YVZA 5JTIA 4UB6U 1ZQSA 3AQEA 3B9JA 4UB2A 5ALXA 4OJLA 5CP2A 4I2BA 9ICMA 3HKZF 1DOQA 2WF6A 4R66A 1FEZA 3EZ5A 4BXOB 2HOIA 4C4RA 3DEEA 1URJA 2F8LA 2VKQA 7ICEA 4OJ5A 3AMZA 4J9MA 8ICQA 5KFJA 1TK8A 1U47A 5DQHA 4QW8A 2UVWA 2ESEA 4C8OA 4UAVA 5AKXA 4NLCA 1S0NA 3F2CA 3QU5A 5J0QA 3FYHA 2LKYA 4EELA 1NK6A 4I2GA 3N7SC 2K4PA 4DL2A 9ICVA 1SV0C 3PW0A 3Q8KA 2HBLA 2MAXA 5L9XA 3ETLA 1A0PA 1ZQLA 9ICPA 2WF5A 2ZTEA 4ED2A 3SAHA 3L4PA 3QUTA 5ALMA 1NJWA 2I9GA 1TV9A 1ZRNA 1RXWA 2WHEA 4ECQA 8ICLA 2KVSA 2KZ3A 3RBEA 4QNLA 2EQYA 3F2DA 3ZDBA 4QZIA 3V72A 3TAPA 1HJPA 2J6TA 2W03A 1OXJA 4UB3A 2KJ8A 3A0BU 3KD3A 5HMLA 2YQEA 5J8YC 5KFKA 3THVA 5AI8A 5DB8A 5AM0A 1T94A 4EEYA 1KW4A 5J0SA 2H3VA 4B9TA 1Z00A 2EZYA 5DG8A 3L5KA 4DEZA 4ECWA 1KQQA 1N56A 3QU7A 9ICKA 3I76A 1ZQYA 5DLFA 2FJ6A 4KLFA 1CI4A 4Y2UA 5DDMA 3GV5B 3H40A 4I2DA 3MGHA 1UQVA 1XU4A 1NK0A 9ICWA 4CF4A 4Z6FA 2XY5A 2BCRA 2HHWA 2K4EA 4RPZA 3RJJA 2PXIA 5AK3A 7ICVA 4DO9A 4BDPA 2K8CB 1JMSA 4NL9A 2I1QA 5EOZA 1U4BA 7ICIA 4MEXA 3ZI4A 3AL0B 3KKAC 4CCHA 4C0ZA 5J2HA 9ICCA 3DDHA 3PSFA 4Q8FA 2LI6A 3T3FA 3RR8A 1COKA 8ICCA 5CRXA 5KFHA 3RH5A 4M9JA 4NM2A 4UASA 4USAA 4IS7A 2W3SA 9ICGA 3FAHA 4ECYA 3F53A 2XY7A 5J2BA 1TFRA 3DV9A 3UMBA 2W7OA 1SV0A 4PHPA 3SR6A 2JH7A 1S9FA 1KBUA 4FZLA 3TKAA 4DFPA 5K4LA 3SENA 2D8CA 4F2RA 2P6UA 2LYHA 4FS1A 1MQ2A 1ED1A 3WK6A 5HHHA 4Z6EA 3WK8A 3M9NB 4IR1A 3QZ8A 1O03A 2K4IA 4BJQA 8ICZA 4FFDA 3KZIU 1IM4A 4QWEA 3RH4A 4I2AA 4NLBA 4O5EA 4PHAA 2W43A 4DFKA 2DKZA 2IHMA 2R8GA 1NK7A 3BQ0A 4IC9A 5ALHA 5EWEA 4TURA 2YMPA 2WAQC 1UCVA 2JH1A 4P0PA 1TK0A 3OJSA 2RP5A 5DB9A 3Q8SB 2BDPA 3Q8RB 3ISDA 1QQ5A 3RBDA 2W9CB 3SMVA 2W9BB 3N97B 4PL2A 5F3XB 4GFJA 1O08A 1ZQQA 3T5KA 5KG0A 2Q4TA 1PVRA 2E8NA 5GTHU 5ALNA 3KFUF 3LVWA 2ZXIA 3BQ1A 1TAUA 2HMXA 4ED8A 5J8YA 5CA7A 4DQIA 1X9MA 4KLJA 1D8YA 7ICRA 5BPCA 2BCSA 2BCUA 5AHXA 1V85A 5KFCA 3QE9Y 2KG5A 2KSOB 1KTQA 5EE3A 1TE2A 1QQ7A 1YZ7A 2XI9A 3FM9A 2EZZA 1ZYQA 2VA2A 4C4SA 1ZQHA 3AU6A 3RR7A 4DSJA 4OJ6A 1PVQA 9ICBA 2PFPA 1FO4A 2HVHA 4QZFA 4DF8A 5GTIU 7ICPA 3T5LA 2C2EA 1NK8A 2HBMA 4YQWA 1T8EA 2F2AB 4PGXA 4YMOA 3AN1A 3OTQA 4RNMA 4MF2A 3KBBA 5ALRA 5AK5A 1S77D 1DXSA 3V7JA 4ED3A 3B0XA 5KAFU 4I27A 3HWTA 3EWAA 1U49A 1L8OA 2VA8A 4IQTA 2IMWP 3M8RA 4O3SA 3BQ2A 3C2KA 4Y2SA 4ED0A 2KV2A 3PO5A 2IOFA 5KG3A 3TI0A 1VLBA 5AI6A 4F50A 3E2EA 4OO1J 4Q8EA 1KN5A 1RDFA 8ICXA 5KT3A 5J0OA 3PV8A 2WB1C 4I29A 3PR4A 3RAXA 4RNNA 5KL8B 4KLUA 3MABA 4F72A 4F2SA 1HIWA 2A3VA 4F71A 4DSLA 3H4BA 5J0XA 3R9KA 1U9LA 4I2JA 1ZQBA 2V4RA 1L3SA 1BPZA 5B66U 4YXJA 2DGZA 2WF8A 3QYPA 4ECTA 2GLEA 3I28A 9ICLA 2K8AA 1BPYA 1BVSA 2IOHA 4R8UB 3M6ZA 4C8KA 2HHVA 2FLNA 1NK9A 3S6JA 4M9HA 5AI4A 3NASA 1MA7A 4US9A 4M9GA 3K1RB 2AGOA 5DDYA 1SWVA 5CB1A 2E3TA 1S5LU 3C28A 2NV3A 4XUSA 4YR2A 2K8BB 2XO7A 2MA1A 1LKYA 5KFAA 3KHRA 5J2AA 3TFRA 1QH9A 1MSWD 2HHQA 2M9NA 1ZD3A 3ZDEA 1ZQJA 2AHOB 2JZBB 2ZIVB 1IXRA 3QU9A 5AI9A 5KFGA 4RQ0A 2P66A 4NLZA 1LB2B 3WU2U 3PMLA 3M9MB 2LMRA 3QUQA 2XGQA 2MU2A 9ICHA 2PI5A 2CPRA 4JV1A 3IM1A 2FPKA 1XNSA 2OYYA 3TARA 4QZCA 2DPJA 5AK4A 3PW5A 1XO0A 4C4TA 4ECXA 4RQ3A 2DWQA 2YMMA 5G5HA 1ZQOA 4KLMA 1RZTA 2XVTA 2YX8A 5KFIA 7ICHA 3OJUA 2ASDA 2KHVA 1AROP 4QWDA 3AM9A 5ALUA 5E79U 1NKCA 8ICMA 2F1HA 3GIJA 2HBJA 1FIQA 3M1YA 1DGSA 4CF3A 4ED7A 4UARA 1ZD5A 2ZIXA 2W3RA 2C2DA 1NK5A 4K4IA 3HW8A 2JHDA 1HUZA 2LM1A 1RQLA 4LZGA 4XRHA 4ECVA 1ZQGA 1SV4A 2RDIA 3UPQA 3F5EA 2ZUBA 3C5FA 1TAQA 5ALOA 5EE0A 1ZQUA 4RT3A 2DQNB 3RJGA 1FFVA 3TADC 1SKRA 4KLTA 3H8WA 2NO5A 4UBCA 2DUYA 3JPTA 2PMZC 5DBAA 2B0CA 2D6FC 5KFNA 4P0QB 4TUPA 1L3UA 4NLKA 2RRDA 1JN3A 2VANA 3TQ1A 3MFHA 3RJFA 9ICQA 1CRXA 3T5JA 4QWAA 5J0UA 1BPXA 3BZCA 2FDRA 2KK0A 3C29A 1MQ3A 5J0TA 1U45A 4QZBA 2B21A 4J9KA 1M6YA 8ICBA 3GU3A 3O0FA 4EX7A 4F3OA 5B5EU 4KLOA 4IRDA 4FBTA 2OH2A 3JPRA 5C5JA 3GQCA 1Z19A 3L3FX 1ZQAA 2PFOA 4IRKA 4Z6CA 4Y2YA 4DFDA 5D46A 2AGQA 3V6KA 8ICTA 2BR0A 3F5AA 9ICTA 4CGZA 5DB7A 4ACOA 2ZUCA 4O3NA 4JUZA 2KTQA 1KKXA 2JEIA 1KFDA 5DKWA 5KT5A 4NM1A 4JV0A 3TACB 5HNKA 3EUB2 2HHTA 2BPCA 2RQ5A 2QB0B 3ZDCA 2Y9UA 2XIDA 3NTUA 4B9VA 4B9LA 4I2EA 3T79A 1RYRA 2G0AA 1QSLA 4YR3A 4JMUA 3ICXA 2Q0ZX 3RJHA 2ZIXB 2W9BA 3QUCA 4O3OA 1UA1A 3C2MA 2VIXA 1S0VA 3CNHA 4YXMA 5AIAA 4RUAA 1B43A 5DG7A 4GC6A 2FMPA 1QTMA 3KOOA 5L1KA 1SKSA 4ECUA 2KNJA 3G6XA 3NVWA 5AKHA 2QARA 4OD0A 5DB6A 4RPXA 2W8KA 4C8NA 5ALDA 5J0WA 5CEHA 4J03A 1JROA 4OCZA 2H3FA 5F9LA 5ALTA 3ETRA 2KFNA 4RQ6A 4U6PA 5ALZA 1RXVA 2A1JB 1ZRMA 1NI3A 5BOMA 4P2HA 3TAQA 3A0HU 1BNOA 1TVAA 9ICSA 2EAMA 2P35A 2F77X 4F5QA 3PW2A 3B0YA 3GILA 2BCVA 3PSIA 2ZTDA 1SIJA 3D2SA 3VCBA 4ZH4A 2OEHA 4ED6A 1YZ6A 5KG6A 4P4PA 1WYGA 3PNCA 3Q8LA 1JIHA 2GH1A 3TANA 3QEAZ 2ASJA 4M9LA 3UM9A 2JEGA 3MBYA 3BDPA 1NZBA 2KVCA 1XSNA 1Q46A 2OHFA 3U26A 4PZNA 3G6YA 1YT3A 4F91B 4AP9A 4EBCA 2I5HA 5DLGA 2FPLA 3V7KA 1X40A 5DBBA 3H8SA 2DF4B 4F8RA 1NJXA 1L7NA 4NXZA 3RB3A 2KOBA 3PO4A 4US8A 2V9WA 4DL3A 1RYUA 3N28A 5AM3A 2HBKA 3RF9A 2GO7A 3HP6A 1OUQA 4FS2A 4RQNA 4Y2RA 3UXPA 2MUTA 4UB1A 1L5UA 1JRPA 3I1YA 2WF7A 4KMUA 2OM6A 2M0NA 3ED5A 8ICOA 4KLSA 8ICIA 5AI5A 4PZOA 2Y1IA 2KSOA 3RAQA 4M9NA 4CF5A 4O3PA 1PK3A 1K1QA 4EX6A 5KFEA 1SGGA 5KFDA 4DLEA 4KX5A 3JPSA 5ALFA 3UXNA 1RPLA 2UVRA 5IIJA 2DFLA 4B9UA 2G09A 3K1ZA 3IG5A 4MF8A 1K5OA 1D9DA 7ICFA 4YMNA 4NJ8A 4DS4A 2DKXA 4UQGA 3JPPA 4J9RA 2EAOA 2HOQA 4M6WA 1ZQCA 2XGPA 3KTQA 4KN7A 3H8MA 1X2IA 4TUSA 5AI0A 4YP3A 5EWFA 1IV8A 4G3IA 3IHQB 4MEYA 3PW7A 2G5HB 8ICPA 1DK2A 1TK5A 4I2CA 5CR0A 3NVVA 1XSLA 7ICNA 2C2RA 4QZEA 3GFKB 4X5VA 5KL1B 4OJPA 1X42A 4J9QA 5AKEA 3ZD8A 4JV2A 3Q8QB 4KITB 1K1SA 1SL0A 1Z1BA 9ICNA 4I2FA 4F5OA 9ICEA 3EPIA 3LWLA 5KFQA 2HDOA 1N63A 1LKYB 5F9NA 1UHUA 2AQ0A 2NRVA 2W54A 2E8OA 2YY6A 1N61A 4BXOA 1Z4NA 3MR6A 4DL5A 2A1JA 1PK1A 5KFVA 4JK1A 2W11A 4PPXA 1JALA 1NZPA 3IP4B 4MFCA 4DSKA 2KJ5A 4NWIA 4JB3A 1KL9A 1J2NA 2JMGA 5KFTA 1DGJA 4YD2A 4DL4A 4DLGA 4BWMA 4UW9A 3C21A 1ZD4A 4J9NA 1KEJA 1ZQDA 4MFFA 7ICOA 2F3NA 1QCKA 5KFBA 2BCQA 2H5XA 4QIWF 2FPMA 3ISBA 2AQ4A 1A76A 1N62A 4PHDA 1JX4A 3PR5B 5IILA 3IV6A 5HMMA 2GWSA 3SAFA 1JUDA 1SB3C 2F44A 4K4GA 3PVXA 3QUBA 5AM5A 1Q3UA 3SQIA 3H0RB 4YCXA 4RNOA 5J2KA 2ZJ8A 3UXOA 4Y2XA 1BPBA 3WK4A 3WKDA 4KLEA 1V9PA 3RB4A 3QNMA 4M04A 4M2YA 2K89A 1V97A 1NJZA 7ICKA 2WF9A 2KN7A 3PW4A 7ICJA 2OWOA 1WCLA 5KG5A 3D2QA 4P4MA 4AYBC 3N4MB 2O6KA 4A8EA 7ICQA 5L1JA 4K4HA 1BNPA 3NRZA 5C0YA 9ICIA 4NLGA 2HSZA 5J0PA 2KZMA 2DL0A 4R63A 5AK6A 1PK1B 2F76X 4IL6U 3MDAA 2LYBA 3MC1A 5HHIA 4OJOA 4KTQA 4P4OA 8ICNA 1B4FA 1RM6C 1SL2A 3QZ7A 5DGAA 3H7IA 9ICFA 4DL7A 1L6NA 1IG6A 3RFAA 1Q3VA 8ICUA 2FMSA 1VDVA 5L1MA 2NYVA 3SV4A 3NS1A 4RQMA 1T7PA 5ALWA 1PVPA 1B22A 4F4WA 5JU5A 1L7OA 4MFAA 2EDUA 3GV7B 4XA5A 1NNLA 2KE7A 4R65A 3KHLA 3NGDA 2R8KA 4ECZA 3AUOA 2NRTA 3BQTA 2QB0A 1ZETA 4C8MA 3OHAA 1SZHA 4J9SA 2XCAA 5TZVA 4J9LA 2IHNA 4F5RA 3RJKA 4B9MA 8ICGA 3RRGA 4BWJA 2ATLA 1S10A 1KFSA 1X9XA 3HX0A 4RQ2A 1Z4OA 4ED1A 2G07A 5AM1A 1LVHA 5DQIA 1S76D 5KFLA 3NUQA 3SD7A 4EZ9A 2KZZA 2GOLA 5KG7A 3RB0A 3OGUA 2C22A 4RQ4A 2FI1A 4Y2JA 4RUCA 4EZ6A 2KICA 2NRZA 4IQWA 4F4ZA 1A6SA 4DSIA 1SXDA 4GLXA 8ICRA 4QZAA 2LBOA 5DBCA 4E0DA 4EYIB 2ALZA 5CJ7A 5D49A 3MGIA 3RTVA 3FC4A 4KLQA 3NRWA 5KAIU 2N1RA 3H8JA 5CWRA 3V6JA 4DOAA 4QW9A 3NVYA 2HHXA 3JPOA 4TQRA 5DG9A 4KLIA 4UBBA 4DSEA 3EW9A 8ICSA 2H3ZA 5KG2A 2HCFA 3HILA 4F5NA 4QZHA 2RLTA 5KFFA 2KHQA 1S97A 2HHSA 4J9PA 4YR0A 5KT4A 2A19A 5KG4A 3KHHA 3RJEA 3PX4A 2G06A 5J2JA 5AKKA 2YN4A 3PSTA 1ZQWA 4EEKA 7ICSA 4DF4A 2ISOA 5H2FU 5KFXA 2ZIWA 3C1YA 1NJYA 4RQ8A 1RG6A 4DWIA 3PMNA 1JI7A 3G6VA 1TKDA 9ICJA 4B6JA 3BS5A 3VC8A 2Y0SC 3V7LA 2CRXA 2AH5A 4UAYA 4C8LA 5JRTA 4UAUA 1ZD2P 1COOA 1JXEA 1ECWA 2W8LA 4IQVA 3H4DA 2Y0SF 3N7RC 1TAMA 4O9MA 7ICMA 2BKEA 2WTFA 5ALIA 2W9AA 4F4YA 3UQ0A 4DOCA 9ICXA 1N2XA 4ELUA 4FZMA 4Y2VA 1KRPA 4JWNA 3OHBA 4M47A 3M8SA 2JZBA 1ZQRA 2I6XA 3LYSA 1ZQKA 4I2IA 1BPEA 4B9NA 3IN5A 8ICAA 3GDXA 3SI8A 4LJXA 4I28A 3AU2A 2XICA 4FBUA 2OCEA 3D2NA 3C2LA 4P0PB 1ZQMA 4BX9C 2K4HA 4O5KA 4NV0A 4RT2A 3FDSA 3M7DA 2KMDA 3H0MB 4DFMA 3E58A 5AKJA 4Z6DA 5KFZA 5ALYA 3MFIA 2J6SA 2AXTU 1GO3F 4O3RA 5AKLA 4HYKA 2F8KA 5J29A 2XCPA 3BZKA 1PUZA 2WAQF 3HJEA 4Q44A 4YG2A 4PH5A 2BZFA 3LK9A 4Y2PA 2AJQA 5KFSA 5KNIA 2JEJA 5IIMA 4IQUA 4RZRA 3UMGA 4PGQA 4KLDA 4Y2TA 2LYAA 3AQFA 1X9SA 2AU0A 3LVVA 5CHGA 1N5WA 4PGYA 4Q43A 5T14A 5EE1A 2F1IA 1P7DA 4QZ8A 1ZQXA 4F5PA 4M0AA 1N60A 4ECSA 1UA0A 2JXJA 4B9SA 2K60A 5J2EA 1L3TA 2J6UA 5IIKA 8ICJA 4I2HA 2R8JA 4RQ5A 3HPOA 5KFOA 9ICAA 2RDJA 4QZ9A 8ICVA 1QQ6A 3BS5B 3SEIA 3GZFA 2KIWA 2HOFA 3NVZA 2W9CA 4PJ0U 1N5XA 3C5GA 2ZTCA 2V4QA 1D9FA 2ODGA 3ZDAA 3QXGA 5AKYA 4NY8A 1NKEA 2FLLA 3PX0A 3TFSA 5D4BA 1JXLA 4R64A 3SAGA 4FO6A 5AICA 2BPFA 4UATA 1UT8A 4CNQA 4ELVA 4LZDA 2R18A 3OSNA 2PI4A 4UAWA 5AKZA 2ASLA 4F93B 5KT2A 2KIVA 4WJ3B 4RPYA 2EZXA 3MR5A 4YFKA 5AKGA 4UB4A 2EH9A 1S0OA 5AKIA 1CUKA 1AQ6A 1ZQTA 1ZJNA 4C7YA 5JUMA 5KFUA 4QJFB 4IRCA 1UT5A 3SYZA 1ZQIA 2YB1A 3WK9A 2AGPA 5EWGA 1C20A 5ALSA 2XC9A 5EE9A 3GIKA 3PY8A 3HRDD 7ICGA 4DFJA 3QX7A
chains in the Genus database with same CATH topology
1SV4A 1SXEA 1RG6A 1X40A 1X9XA 1JI7A 2JV3A 1COKA 3BS5A 2K4PA 2E8MA 2Y9TA 1SV0C 1OW5A 3TADC 4IS7A 5JRTA 4RQNA 1LKYB 2EAPA 2LPEA 1B0XA 2K60A 3K1RB 2YTUA 2E8OA 2DL0A 1SV0A 1PK1B 4NL9C 1DXSA 1LKYA 3SENA 2D8CA 2L5YA 3BS5B 3SEIA 1F0MA 1PK1A 1SXDA 4PZOA 2KSOA 1B4FA 1Z1VA 1PK3A 1SGGA 2QARA 4MHVA 3KKAA 1V38A 1OXJA 2LMRA 3BS7A 5L1MA 2QB1A 2ES6A 5J8YC 2DKZA 3IDWA 1KW4A 3BQ7A 2KIVA 4NJ8A 2F3NA 2EAMA 2DKXA 4RQMA 1UCVA 1WWUA 1WWVA 2E8PA 5JU5A 5JTIA 2EAOA 2FE9A 2KE7A 1X66A 2KMDA 3H8MA 5F3XB 3HILA 2B6GA 2E8NA 1UQVA 2EANA 2D3DA 2F44A 3TADA 2QB0A 2F8KA 5J8YA 2QKQA 2QARB 1V85A 4PZNA 4NL9A 2KG5A 2KSOB 3TACB 2ESEA 5KNIA 2QB0B 2Y9UA 2GLEA 3KKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV4 A;  1SXE A;  1RG6 A;  1X40 A;  1X9X A;  1JI7 A;  2JV3 A;  1COK A;  3BS5 A;  2K4P A;  2E8M A;  2Y9T A;  1SV0 C;  1OW5 A;  3TAD C;  4IS7 A;  5JRT A;  4RQN A;  1LKY B;  2EAP A;  2LPE A;  1B0X A;  2K60 A;  3K1R B;  2YTU A;  2E8O A;  2DL0 A;  1SV0 A;  1PK1 B;  4NL9 C;  1DXS A;  1LKY A;  3SEN A;  2D8C A;  2L5Y A;  3BS5 B;  3SEI A;  1F0M A;  1PK1 A;  1SXD A;  4PZO A;  2KSO A;  1B4F A;  1Z1V A;  1PK3 A;  1SGG A;  2QAR A;  4MHV A;  3KKA A;  1V38 A;  1OXJ A;  2LMR A;  3BS7 A;  5L1M A;  2QB1 A;  2ES6 A;  5J8Y C;  2DKZ A;  3IDW A;  1KW4 A;  3BQ7 A;  2KIV A;  4NJ8 A;  2F3N A;  2EAM A;  2DKX A;  4RQM A;  1UCV A;  1WWU A;  1WWV A;  2E8P A;  5JU5 A;  5JTI A;  2EAO A;  2FE9 A;  2KE7 A;  1X66 A;  2KMD A;  3H8M A;  5F3X B;  3HIL A;  2B6G A;  2E8N A;  1UQV A;  2EAN A;  2D3D A;  2F44 A;  3TAD A;  2QB0 A;  2F8K A;  5J8Y A;  2QKQ A;  2QAR B;  1V85 A;  4PZN A;  4NL9 A;  2KG5 A;  2KSO B;  3TAC B;  2ESE A;  5KNI A;  2QB0 B;  2Y9U A;  2GLE A;  3KKA C; 
#chains in the Genus database with same CATH topology
 3ONN A;  4PL1 A;  2H3Q A;  2Y9T A;  3OPX A;  2ZIU A;  5KFW A;  3MDC A;  4DL6 A;  5J2D A;  2E1E A;  3F2B A;  1XO1 A;  3ZD9 A;  3LDA A;  4KMO B;  2ZG6 A;  4F92 B;  1Z3E B;  1X6J A;  4NL9 C;  4DS5 A;  1H38 A;  4PHE A;  2L5Y A;  2CN1 A;  4EEN A;  1PZN A;  4RU9 A;  1L3V A;  4IR9 A;  1F44 A;  1ZQP A;  3GV8 B;  1Z1V A;  2HHU A;  3HT3 A;  3KZX A;  1SWW A;  1L7M A;  2JRZ A;  1CEZ A;  5KFP A;  1V38 A;  3HKZ C;  4TUQ A;  1ZQ1 C;  1D8B A;  2A1A A;  4XQ8 A;  5L1I A;  4QIW C;  3WKC A;  4QZG A;  1VJ5 A;  5AM4 A;  9ICO A;  2BQU A;  1ZQZ A;  3IDW A;  4JWM A;  1A77 A;  4BUG A;  2BQR A;  4UAZ A;  3WKE A;  4QWC A;  1ZQV A;  2VA3 A;  1XC9 A;  2E8P A;  3C1Z A;  2IA6 A;  3MR2 A;  4DQP A;  2NRW A;  3ORY A;  1NK4 A;  3PSP A;  2F1J A;  2MRL A;  2D3D A;  1FFU A;  5ALV A;  2QLT A;  4RQ7 A;  2DBY A;  2FMQ A;  4FE3 A;  4QWB A;  4AYB F;  2BQ3 A;  2QAR B;  3V6H A;  1IIP A;  2YB4 A;  3E0F A;  5TIS U;  4F4K A;  2UVV A;  4ECR A;  4FZN A;  2JGA A;  2KD1 A;  5J2F A;  1SXE A;  5ALG A;  1XS9 D;  2JV3 A;  4YD1 A;  2E8M A;  1NKB A;  2IBK A;  2Y1J A;  3IRU A;  2KFZ A;  4CRX A;  5AM2 A;  4LVS A;  1MN8 A;  1DRG A;  1J2M A;  2W04 A;  2BPG A;  1WCN A;  3D6J A;  2YTU A;  5DQG A;  1XWL A;  4EBD A;  4YN4 A;  4EYH B;  3ZDD A;  1F0M A;  4KN4 A;  5G5G A;  4DSF A;  1D8L A;  8ICY A;  4O3Q A;  8ICE A;  4ICA A;  4RQ1 A;  1S0M A;  1KDH A;  4HAI A;  8ICH A;  5ALE A;  2KP7 A;  8ICK A;  4P0Q A;  1SZP A;  5III A;  2WB1 F;  2QB1 A;  2ES6 A;  4DOB A;  4KX3 A;  4ZOH C;  4M6W B;  2HI0 A;  2LM4 A;  2MSN A;  3BQ7 A;  1RQN A;  2VJ4 A;  4BGD A;  1X6I A;  1WWU A;  1WWV A;  4ELT A;  2CXY A;  7ICL A;  4GXI A;  2P6R A;  1ZXI A;  2FE9 A;  3GII A;  5IIO A;  2W55 A;  2JEF A;  3UMC A;  3J81 j;  3WKB A;  1NOM A;  2MUT B;  2ZJA A;  1ZQF A;  1T3Q A;  3M9O B;  2ZUD A;  1SKW A;  3UQ2 A;  9ICU A;  4G9B A;  1F5S A;  4GIB A;  1L8L A;  5J2I A;  4DQS A;  9ICR A;  5HP4 A;  5KFR A;  1EXN A;  2PKE A;  3K4G A;  1N48 A;  3KHG A;  3M6K A;  2ISP A;  3QEB Z;  3C23 A;  1WG8 A;  1MC8 A;  4C80 A;  2BDU A;  1QLN A;  3CRX A;  1UPH A;  2E5S A;  5DGB A;  4YMM A;  4GXJ A;  4U7C A;  4DCC A;  2Z7J A;  4C7Z A;  3SV3 A;  4KLL A;  1Y88 A;  1ZJM A;  3QU4 A;  4GC7 A;  5ALL A;  5KTQ A;  2ZXH A;  2R8H A;  5KFM A;  3MGV A;  2KKV A;  5ALK A;  1Z00 B;  4O5C A;  1HEK A;  1KSP A;  4O3M A;  2R8I A;  4CE6 A;  5J0Y A;  3K75 D;  5IIN A;  2XY6 A;  3MR3 A;  8ICF A;  1LV5 A;  1WUD A;  3KKA A;  1HUO A;  2W9M A;  3LWM A;  3BS7 A;  2OXO A;  3EPG A;  5KT6 A;  4GXK A;  3N7P D;  2JR5 A;  8ICW A;  2UVU A;  2KKP A;  3RB6 A;  2FLP A;  2E1F A;  1ZOL A;  2G5I B;  4DQR A;  2NO4 A;  5J2G A;  1X66 A;  2H3I A;  3T5H A;  1QSS A;  2B6G A;  2LHT A;  7ICT A;  2YML A;  2EAN A;  3TAD A;  2KJ9 A;  4DQQ A;  5BOL A;  5ALJ A;  2ZJ5 A;  2QKQ A;  2C28 A;  4EBE A;  2DPI A;  5KT7 A;  3CYM A;  2W7P A;  3RH6 A;  3ISC A;  2HVI A;  2KEY A;  5ALP A;  2PFN A;  1KLN A;  2WFA A;  2BHN A;  3Q8P B;  1C7Y A;  3AEV A;  3H0L B;  1S8O A;  3IG8 A;  2PMZ F;  3RRH A;  3Q8M A;  1XSP A;  1RYS A;  5A0L A;  1OW5 A;  5HR6 A;  1T3N A;  5FP0 A;  5J2C A;  7ICU A;  3WKA A;  4TQS A;  4NLN A;  5HR7 A;  4O0I A;  3PZP A;  5KFY A;  4R8U A;  2NRX A;  2EAP A;  1X9W A;  1T4G A;  2LPE A;  1B0X A;  1L7P A;  5ALQ A;  1Q8K A;  3GIM A;  1QSY A;  4KLG A;  2RHF A;  3RJI A;  1ZQN A;  4UB8 U;  2VJ5 A;  4F4X A;  1KFT A;  5KG1 A;  3BJY A;  2HW3 A;  3SZ2 A;  1J97 A;  2ZIW B;  4MHV A;  2BGW A;  1BGX T;  2YMQ A;  3JPN A;  2IOF K;  4KLH A;  3JPQ A;  3CW2 C;  2ZIU B;  3QU2 A;  3CP8 A;  3PX6 A;  2ZIV A;  4Q45 A;  1DK3 A;  1BPD A;  5L1L A;  2PFQ A;  4QZD A;  4CDG A;  3ALR A;  1SL1 A;  3WK7 A;  5AIB A;  4J9O A;  4Y2Q A;  3OSP A;  1U48 A;  1ZQE A;  4UB5 A;  2G08 A;  3WK5 A;  5J0R A;  3EYZ A;  4YVZ A;  5JTI A;  4UB6 U;  1ZQS A;  3AQE A;  3B9J A;  4UB2 A;  5ALX A;  4OJL A;  5CP2 A;  4I2B A;  9ICM A;  3HKZ F;  1DOQ A;  2WF6 A;  4R66 A;  1FEZ A;  3EZ5 A;  4BXO B;  2HOI A;  4C4R A;  3DEE A;  1URJ A;  2F8L A;  2VKQ A;  7ICE A;  4OJ5 A;  3AMZ A;  4J9M A;  8ICQ A;  5KFJ A;  1TK8 A;  1U47 A;  5DQH A;  4QW8 A;  2UVW A;  2ESE A;  4C8O A;  4UAV A;  5AKX A;  4NLC A;  1S0N A;  3F2C A;  3QU5 A;  5J0Q A;  3FYH A;  2LKY A;  4EEL A;  1NK6 A;  4I2G A;  3N7S C;  2K4P A;  4DL2 A;  9ICV A;  1SV0 C;  3PW0 A;  3Q8K A;  2HBL A;  2MAX A;  5L9X A;  3ETL A;  1A0P A;  1ZQL A;  9ICP A;  2WF5 A;  2ZTE A;  4ED2 A;  3SAH A;  3L4P A;  3QUT A;  5ALM A;  1NJW A;  2I9G A;  1TV9 A;  1ZRN A;  1RXW A;  2WHE A;  4ECQ A;  8ICL A;  2KVS A;  2KZ3 A;  3RBE A;  4QNL A;  2EQY A;  3F2D A;  3ZDB A;  4QZI A;  3V72 A;  3TAP A;  1HJP A;  2J6T A;  2W03 A;  1OXJ A;  4UB3 A;  2KJ8 A;  3A0B U;  3KD3 A;  5HML A;  2YQE A;  5J8Y C;  5KFK A;  3THV A;  5AI8 A;  5DB8 A;  5AM0 A;  1T94 A;  4EEY A;  1KW4 A;  5J0S A;  2H3V A;  4B9T A;  1Z00 A;  2EZY A;  5DG8 A;  3L5K A;  4DEZ A;  4ECW A;  1KQQ A;  1N56 A;  3QU7 A;  9ICK A;  3I76 A;  1ZQY A;  5DLF A;  2FJ6 A;  4KLF A;  1CI4 A;  4Y2U A;  5DDM A;  3GV5 B;  3H40 A;  4I2D A;  3MGH A;  1UQV A;  1XU4 A;  1NK0 A;  9ICW A;  4CF4 A;  4Z6F A;  2XY5 A;  2BCR A;  2HHW A;  2K4E A;  4RPZ A;  3RJJ A;  2PXI A;  5AK3 A;  7ICV A;  4DO9 A;  4BDP A;  2K8C B;  1JMS A;  4NL9 A;  2I1Q A;  5EOZ A;  1U4B A;  7ICI A;  4MEX A;  3ZI4 A;  3AL0 B;  3KKA C;  4CCH A;  4C0Z A;  5J2H A;  9ICC A;  3DDH A;  3PSF A;  4Q8F A;  2LI6 A;  3T3F A;  3RR8 A;  1COK A;  8ICC A;  5CRX A;  5KFH A;  3RH5 A;  4M9J A;  4NM2 A;  4UAS A;  4USA A;  4IS7 A;  2W3S A;  9ICG A;  3FAH A;  4ECY A;  3F53 A;  2XY7 A;  5J2B A;  1TFR A;  3DV9 A;  3UMB A;  2W7O A;  1SV0 A;  4PHP A;  3SR6 A;  2JH7 A;  1S9F A;  1KBU A;  4FZL A;  3TKA A;  4DFP A;  5K4L A;  3SEN A;  2D8C A;  4F2R A;  2P6U A;  2LYH A;  4FS1 A;  1MQ2 A;  1ED1 A;  3WK6 A;  5HHH A;  4Z6E A;  3WK8 A;  3M9N B;  4IR1 A;  3QZ8 A;  1O03 A;  2K4I A;  4BJQ A;  8ICZ A;  4FFD A;  3KZI U;  1IM4 A;  4QWE A;  3RH4 A;  4I2A A;  4NLB A;  4O5E A;  4PHA A;  2W43 A;  4DFK A;  2DKZ A;  2IHM A;  2R8G A;  1NK7 A;  3BQ0 A;  4IC9 A;  5ALH A;  5EWE A;  4TUR A;  2YMP A;  2WAQ C;  1UCV A;  2JH1 A;  4P0P A;  1TK0 A;  3OJS A;  2RP5 A;  5DB9 A;  3Q8S B;  2BDP A;  3Q8R B;  3ISD A;  1QQ5 A;  3RBD A;  2W9C B;  3SMV A;  2W9B B;  3N97 B;  4PL2 A;  5F3X B;  4GFJ A;  1O08 A;  1ZQQ A;  3T5K A;  5KG0 A;  2Q4T A;  1PVR A;  2E8N A;  5GTH U;  5ALN A;  3KFU F;  3LVW A;  2ZXI A;  3BQ1 A;  1TAU A;  2HMX A;  4ED8 A;  5J8Y A;  5CA7 A;  4DQI A;  1X9M A;  4KLJ A;  1D8Y A;  7ICR A;  5BPC A;  2BCS A;  2BCU A;  5AHX A;  1V85 A;  5KFC A;  3QE9 Y;  2KG5 A;  2KSO B;  1KTQ A;  5EE3 A;  1TE2 A;  1QQ7 A;  1YZ7 A;  2XI9 A;  3FM9 A;  2EZZ A;  1ZYQ A;  2VA2 A;  4C4S A;  1ZQH A;  3AU6 A;  3RR7 A;  4DSJ A;  4OJ6 A;  1PVQ A;  9ICB A;  2PFP A;  1FO4 A;  2HVH A;  4QZF A;  4DF8 A;  5GTI U;  7ICP A;  3T5L A;  2C2E A;  1NK8 A;  2HBM A;  4YQW A;  1T8E A;  2F2A B;  4PGX A;  4YMO A;  3AN1 A;  3OTQ A;  4RNM A;  4MF2 A;  3KBB A;  5ALR A;  5AK5 A;  1S77 D;  1DXS A;  3V7J A;  4ED3 A;  3B0X A;  5KAF U;  4I27 A;  3HWT A;  3EWA A;  1U49 A;  1L8O A;  2VA8 A;  4IQT A;  2IMW P;  3M8R A;  4O3S A;  3BQ2 A;  3C2K A;  4Y2S A;  4ED0 A;  2KV2 A;  3PO5 A;  2IOF A;  5KG3 A;  3TI0 A;  1VLB A;  5AI6 A;  4F50 A;  3E2E A;  4OO1 J;  4Q8E A;  1KN5 A;  1RDF A;  8ICX A;  5KT3 A;  5J0O A;  3PV8 A;  2WB1 C;  4I29 A;  3PR4 A;  3RAX A;  4RNN A;  5KL8 B;  4KLU A;  3MAB A;  4F72 A;  4F2S A;  1HIW A;  2A3V A;  4F71 A;  4DSL A;  3H4B A;  5J0X A;  3R9K A;  1U9L A;  4I2J A;  1ZQB A;  2V4R A;  1L3S A;  1BPZ A;  5B66 U;  4YXJ A;  2DGZ A;  2WF8 A;  3QYP A;  4ECT A;  2GLE A;  3I28 A;  9ICL A;  2K8A A;  1BPY A;  1BVS A;  2IOH A;  4R8U B;  3M6Z A;  4C8K A;  2HHV A;  2FLN A;  1NK9 A;  3S6J A;  4M9H A;  5AI4 A;  3NAS A;  1MA7 A;  4US9 A;  4M9G A;  3K1R B;  2AGO A;  5DDY A;  1SWV A;  5CB1 A;  2E3T A;  1S5L U;  3C28 A;  2NV3 A;  4XUS A;  4YR2 A;  2K8B B;  2XO7 A;  2MA1 A;  1LKY A;  5KFA A;  3KHR A;  5J2A A;  3TFR A;  1QH9 A;  1MSW D;  2HHQ A;  2M9N A;  1ZD3 A;  3ZDE A;  1ZQJ A;  2AHO B;  2JZB B;  2ZIV B;  1IXR A;  3QU9 A;  5AI9 A;  5KFG A;  4RQ0 A;  2P66 A;  4NLZ A;  1LB2 B;  3WU2 U;  3PML A;  3M9M B;  2LMR A;  3QUQ A;  2XGQ A;  2MU2 A;  9ICH A;  2PI5 A;  2CPR A;  4JV1 A;  3IM1 A;  2FPK A;  1XNS A;  2OYY A;  3TAR A;  4QZC A;  2DPJ A;  5AK4 A;  3PW5 A;  1XO0 A;  4C4T A;  4ECX A;  4RQ3 A;  2DWQ A;  2YMM A;  5G5H A;  1ZQO A;  4KLM A;  1RZT A;  2XVT A;  2YX8 A;  5KFI A;  7ICH A;  3OJU A;  2ASD A;  2KHV A;  1ARO P;  4QWD A;  3AM9 A;  5ALU A;  5E79 U;  1NKC A;  8ICM A;  2F1H A;  3GIJ A;  2HBJ A;  1FIQ A;  3M1Y A;  1DGS A;  4CF3 A;  4ED7 A;  4UAR A;  1ZD5 A;  2ZIX A;  2W3R A;  2C2D A;  1NK5 A;  4K4I A;  3HW8 A;  2JHD A;  1HUZ A;  2LM1 A;  1RQL A;  4LZG A;  4XRH A;  4ECV A;  1ZQG A;  1SV4 A;  2RDI A;  3UPQ A;  3F5E A;  2ZUB A;  3C5F A;  1TAQ A;  5ALO A;  5EE0 A;  1ZQU A;  4RT3 A;  2DQN B;  3RJG A;  1FFV A;  3TAD C;  1SKR A;  4KLT A;  3H8W A;  2NO5 A;  4UBC A;  2DUY A;  3JPT A;  2PMZ C;  5DBA A;  2B0C A;  2D6F C;  5KFN A;  4P0Q B;  4TUP A;  1L3U A;  4NLK A;  2RRD A;  1JN3 A;  2VAN A;  3TQ1 A;  3MFH A;  3RJF A;  9ICQ A;  1CRX A;  3T5J A;  4QWA A;  5J0U A;  1BPX A;  3BZC A;  2FDR A;  2KK0 A;  3C29 A;  1MQ3 A;  5J0T A;  1U45 A;  4QZB A;  2B21 A;  4J9K A;  1M6Y A;  8ICB A;  3GU3 A;  3O0F A;  4EX7 A;  4F3O A;  5B5E U;  4KLO A;  4IRD A;  4FBT A;  2OH2 A;  3JPR A;  5C5J A;  3GQC A;  1Z19 A;  3L3F X;  1ZQA A;  2PFO A;  4IRK A;  4Z6C A;  4Y2Y A;  4DFD A;  5D46 A;  2AGQ A;  3V6K A;  8ICT A;  2BR0 A;  3F5A A;  9ICT A;  4CGZ A;  5DB7 A;  4ACO A;  2ZUC A;  4O3N A;  4JUZ A;  2KTQ A;  1KKX A;  2JEI A;  1KFD A;  5DKW A;  5KT5 A;  4NM1 A;  4JV0 A;  3TAC B;  5HNK A;  3EUB 2;  2HHT A;  2BPC A;  2RQ5 A;  2QB0 B;  3ZDC A;  2Y9U A;  2XID A;  3NTU A;  4B9V A;  4B9L A;  4I2E A;  3T79 A;  1RYR A;  2G0A A;  1QSL A;  4YR3 A;  4JMU A;  3ICX A;  2Q0Z X;  3RJH A;  2ZIX B;  2W9B A;  3QUC A;  4O3O A;  1UA1 A;  3C2M A;  2VIX A;  1S0V A;  3CNH A;  4YXM A;  5AIA A;  4RUA A;  1B43 A;  5DG7 A;  4GC6 A;  2FMP A;  1QTM A;  3KOO A;  5L1K A;  1SKS A;  4ECU A;  2KNJ A;  3G6X A;  3NVW A;  5AKH A;  2QAR A;  4OD0 A;  5DB6 A;  4RPX A;  2W8K A;  4C8N A;  5ALD A;  5J0W A;  5CEH A;  4J03 A;  1JRO A;  4OCZ A;  2H3F A;  5F9L A;  5ALT A;  3ETR A;  2KFN A;  4RQ6 A;  4U6P A;  5ALZ A;  1RXV A;  2A1J B;  1ZRM A;  1NI3 A;  5BOM A;  4P2H A;  3TAQ A;  3A0H U;  1BNO A;  1TVA A;  9ICS A;  2EAM A;  2P35 A;  2F77 X;  4F5Q A;  3PW2 A;  3B0Y A;  3GIL A;  2BCV A;  3PSI A;  2ZTD A;  1SIJ A;  3D2S A;  3VCB A;  4ZH4 A;  2OEH A;  4ED6 A;  1YZ6 A;  5KG6 A;  4P4P A;  1WYG A;  3PNC A;  3Q8L A;  1JIH A;  2GH1 A;  3TAN A;  3QEA Z;  2ASJ A;  4M9L A;  3UM9 A;  2JEG A;  3MBY A;  3BDP A;  1NZB A;  2KVC A;  1XSN A;  1Q46 A;  2OHF A;  3U26 A;  4PZN A;  3G6Y A;  1YT3 A;  4F91 B;  4AP9 A;  4EBC A;  2I5H A;  5DLG A;  2FPL A;  3V7K A;  1X40 A;  5DBB A;  3H8S A;  2DF4 B;  4F8R A;  1NJX A;  1L7N A;  4NXZ A;  3RB3 A;  2KOB A;  3PO4 A;  4US8 A;  2V9W A;  4DL3 A;  1RYU A;  3N28 A;  5AM3 A;  2HBK A;  3RF9 A;  2GO7 A;  3HP6 A;  1OUQ A;  4FS2 A;  4RQN A;  4Y2R A;  3UXP A;  2MUT A;  4UB1 A;  1L5U A;  1JRP A;  3I1Y A;  2WF7 A;  4KMU A;  2OM6 A;  2M0N A;  3ED5 A;  8ICO A;  4KLS A;  8ICI A;  5AI5 A;  4PZO A;  2Y1I A;  2KSO A;  3RAQ A;  4M9N A;  4CF5 A;  4O3P A;  1PK3 A;  1K1Q A;  4EX6 A;  5KFE A;  1SGG A;  5KFD A;  4DLE A;  4KX5 A;  3JPS A;  5ALF A;  3UXN A;  1RPL A;  2UVR A;  5IIJ A;  2DFL A;  4B9U A;  2G09 A;  3K1Z A;  3IG5 A;  4MF8 A;  1K5O A;  1D9D A;  7ICF A;  4YMN A;  4NJ8 A;  4DS4 A;  2DKX A;  4UQG A;  3JPP A;  4J9R A;  2EAO A;  2HOQ A;  4M6W A;  1ZQC A;  2XGP A;  3KTQ A;  4KN7 A;  3H8M A;  1X2I A;  4TUS A;  5AI0 A;  4YP3 A;  5EWF A;  1IV8 A;  4G3I A;  3IHQ B;  4MEY A;  3PW7 A;  2G5H B;  8ICP A;  1DK2 A;  1TK5 A;  4I2C A;  5CR0 A;  3NVV A;  1XSL A;  7ICN A;  2C2R A;  4QZE A;  3GFK B;  4X5V A;  5KL1 B;  4OJP A;  1X42 A;  4J9Q A;  5AKE A;  3ZD8 A;  4JV2 A;  3Q8Q B;  4KIT B;  1K1S A;  1SL0 A;  1Z1B A;  9ICN A;  4I2F A;  4F5O A;  9ICE A;  3EPI A;  3LWL A;  5KFQ A;  2HDO A;  1N63 A;  1LKY B;  5F9N A;  1UHU A;  2AQ0 A;  2NRV A;  2W54 A;  2E8O A;  2YY6 A;  1N61 A;  4BXO A;  1Z4N A;  3MR6 A;  4DL5 A;  2A1J A;  1PK1 A;  5KFV A;  4JK1 A;  2W11 A;  4PPX A;  1JAL A;  1NZP A;  3IP4 B;  4MFC A;  4DSK A;  2KJ5 A;  4NWI A;  4JB3 A;  1KL9 A;  1J2N A;  2JMG A;  5KFT A;  1DGJ A;  4YD2 A;  4DL4 A;  4DLG A;  4BWM A;  4UW9 A;  3C21 A;  1ZD4 A;  4J9N A;  1KEJ A;  1ZQD A;  4MFF A;  7ICO A;  2F3N A;  1QCK A;  5KFB A;  2BCQ A;  2H5X A;  4QIW F;  2FPM A;  3ISB A;  2AQ4 A;  1A76 A;  1N62 A;  4PHD A;  1JX4 A;  3PR5 B;  5IIL A;  3IV6 A;  5HMM A;  2GWS A;  3SAF A;  1JUD A;  1SB3 C;  2F44 A;  4K4G A;  3PVX A;  3QUB A;  5AM5 A;  1Q3U A;  3SQI A;  3H0R B;  4YCX A;  4RNO A;  5J2K A;  2ZJ8 A;  3UXO A;  4Y2X A;  1BPB A;  3WK4 A;  3WKD A;  4KLE A;  1V9P A;  3RB4 A;  3QNM A;  4M04 A;  4M2Y A;  2K89 A;  1V97 A;  1NJZ A;  7ICK A;  2WF9 A;  2KN7 A;  3PW4 A;  7ICJ A;  2OWO A;  1WCL A;  5KG5 A;  3D2Q A;  4P4M A;  4AYB C;  3N4M B;  2O6K A;  4A8E A;  7ICQ A;  5L1J A;  4K4H A;  1BNP A;  3NRZ A;  5C0Y A;  9ICI A;  4NLG A;  2HSZ A;  5J0P A;  2KZM A;  2DL0 A;  4R63 A;  5AK6 A;  1PK1 B;  2F76 X;  4IL6 U;  3MDA A;  2LYB A;  3MC1 A;  5HHI A;  4OJO A;  4KTQ A;  4P4O A;  8ICN A;  1B4F A;  1RM6 C;  1SL2 A;  3QZ7 A;  5DGA A;  3H7I A;  9ICF A;  4DL7 A;  1L6N A;  1IG6 A;  3RFA A;  1Q3V A;  8ICU A;  2FMS A;  1VDV A;  5L1M A;  2NYV A;  3SV4 A;  3NS1 A;  4RQM A;  1T7P A;  5ALW A;  1PVP A;  1B22 A;  4F4W A;  5JU5 A;  1L7O A;  4MFA A;  2EDU A;  3GV7 B;  4XA5 A;  1NNL A;  2KE7 A;  4R65 A;  3KHL A;  3NGD A;  2R8K A;  4ECZ A;  3AUO A;  2NRT A;  3BQT A;  2QB0 A;  1ZET A;  4C8M A;  3OHA A;  1SZH A;  4J9S A;  2XCA A;  5TZV A;  4J9L A;  2IHN A;  4F5R A;  3RJK A;  4B9M A;  8ICG A;  3RRG A;  4BWJ A;  2ATL A;  1S10 A;  1KFS A;  1X9X A;  3HX0 A;  4RQ2 A;  1Z4O A;  4ED1 A;  2G07 A;  5AM1 A;  1LVH A;  5DQI A;  1S76 D;  5KFL A;  3NUQ A;  3SD7 A;  4EZ9 A;  2KZZ A;  2GOL A;  5KG7 A;  3RB0 A;  3OGU A;  2C22 A;  4RQ4 A;  2FI1 A;  4Y2J A;  4RUC A;  4EZ6 A;  2KIC A;  2NRZ A;  4IQW A;  4F4Z A;  1A6S A;  4DSI A;  1SXD A;  4GLX A;  8ICR A;  4QZA A;  2LBO A;  5DBC A;  4E0D A;  4EYI B;  2ALZ A;  5CJ7 A;  5D49 A;  3MGI A;  3RTV A;  3FC4 A;  4KLQ A;  3NRW A;  5KAI U;  2N1R A;  3H8J A;  5CWR A;  3V6J A;  4DOA A;  4QW9 A;  3NVY A;  2HHX A;  3JPO A;  4TQR A;  5DG9 A;  4KLI A;  4UBB A;  4DSE A;  3EW9 A;  8ICS A;  2H3Z A;  5KG2 A;  2HCF A;  3HIL A;  4F5N A;  4QZH A;  2RLT A;  5KFF A;  2KHQ A;  1S97 A;  2HHS A;  4J9P A;  4YR0 A;  5KT4 A;  2A19 A;  5KG4 A;  3KHH A;  3RJE A;  3PX4 A;  2G06 A;  5J2J A;  5AKK A;  2YN4 A;  3PST A;  1ZQW A;  4EEK A;  7ICS A;  4DF4 A;  2ISO A;  5H2F U;  5KFX A;  2ZIW A;  3C1Y A;  1NJY A;  4RQ8 A;  1RG6 A;  4DWI A;  3PMN A;  1JI7 A;  3G6V A;  1TKD A;  9ICJ A;  4B6J A;  3BS5 A;  3VC8 A;  2Y0S C;  3V7L A;  2CRX A;  2AH5 A;  4UAY A;  4C8L A;  5JRT A;  4UAU A;  1ZD2 P;  1COO A;  1JXE A;  1ECW A;  2W8L A;  4IQV A;  3H4D A;  2Y0S F;  3N7R C;  1TAM A;  4O9M A;  7ICM A;  2BKE A;  2WTF A;  5ALI A;  2W9A A;  4F4Y A;  3UQ0 A;  4DOC A;  9ICX A;  1N2X A;  4ELU A;  4FZM A;  4Y2V A;  1KRP A;  4JWN A;  3OHB A;  4M47 A;  3M8S A;  2JZB A;  1ZQR A;  2I6X A;  3LYS A;  1ZQK A;  4I2I A;  1BPE A;  4B9N A;  3IN5 A;  8ICA A;  3GDX A;  3SI8 A;  4LJX A;  4I28 A;  3AU2 A;  2XIC A;  4FBU A;  2OCE A;  3D2N A;  3C2L A;  4P0P B;  1ZQM A;  4BX9 C;  2K4H A;  4O5K A;  4NV0 A;  4RT2 A;  3FDS A;  3M7D A;  2KMD A;  3H0M B;  4DFM A;  3E58 A;  5AKJ A;  4Z6D A;  5KFZ A;  5ALY A;  3MFI A;  2J6S A;  2AXT U;  1GO3 F;  4O3R A;  5AKL A;  4HYK A;  2F8K A;  5J29 A;  2XCP A;  3BZK A;  1PUZ A;  2WAQ F;  3HJE A;  4Q44 A;  4YG2 A;  4PH5 A;  2BZF A;  3LK9 A;  4Y2P A;  2AJQ A;  5KFS A;  5KNI A;  2JEJ A;  5IIM A;  4IQU A;  4RZR A;  3UMG A;  4PGQ A;  4KLD A;  4Y2T A;  2LYA A;  3AQF A;  1X9S A;  2AU0 A;  3LVV A;  5CHG A;  1N5W A;  4PGY A;  4Q43 A;  5T14 A;  5EE1 A;  2F1I A;  1P7D A;  4QZ8 A;  1ZQX A;  4F5P A;  4M0A A;  1N60 A;  4ECS A;  1UA0 A;  2JXJ A;  4B9S A;  2K60 A;  5J2E A;  1L3T A;  2J6U A;  5IIK A;  8ICJ A;  4I2H A;  2R8J A;  4RQ5 A;  3HPO A;  5KFO A;  9ICA A;  2RDJ A;  4QZ9 A;  8ICV A;  1QQ6 A;  3BS5 B;  3SEI A;  3GZF A;  2KIW A;  2HOF A;  3NVZ A;  2W9C A;  4PJ0 U;  1N5X A;  3C5G A;  2ZTC A;  2V4Q A;  1D9F A;  2ODG A;  3ZDA A;  3QXG A;  5AKY A;  4NY8 A;  1NKE A;  2FLL A;  3PX0 A;  3TFS A;  5D4B A;  1JXL A;  4R64 A;  3SAG A;  4FO6 A;  5AIC A;  2BPF A;  4UAT A;  1UT8 A;  4CNQ A;  4ELV A;  4LZD A;  2R18 A;  3OSN A;  2PI4 A;  4UAW A;  5AKZ A;  2ASL A;  4F93 B;  5KT2 A;  2KIV A;  4WJ3 B;  4RPY A;  2EZX A;  3MR5 A;  4YFK A;  5AKG A;  4UB4 A;  2EH9 A;  1S0O A;  5AKI A;  1CUK A;  1AQ6 A;  1ZQT A;  1ZJN A;  4C7Y A;  5JUM A;  5KFU A;  4QJF B;  4IRC A;  1UT5 A;  3SYZ A;  1ZQI A;  2YB1 A;  3WK9 A;  2AGP A;  5EWG A;  1C20 A;  5ALS A;  2XC9 A;  5EE9 A;  3GIK A;  3PY8 A;  3HRD D;  7ICG A;  4DFJ A;  3QX7 A; 
#chains in the Genus database with same CATH homology
 1SV4 A;  1SXE A;  1RG6 A;  1X40 A;  1X9X A;  1JI7 A;  2JV3 A;  1COK A;  3BS5 A;  2K4P A;  2E8M A;  2Y9T A;  1SV0 C;  1OW5 A;  3TAD C;  4IS7 A;  5JRT A;  4RQN A;  1LKY B;  2EAP A;  2LPE A;  1B0X A;  2K60 A;  3K1R B;  2YTU A;  2E8O A;  2DL0 A;  1SV0 A;  1PK1 B;  4NL9 C;  1DXS A;  1LKY A;  3SEN A;  2D8C A;  2L5Y A;  3BS5 B;  3SEI A;  1F0M A;  1PK1 A;  1SXD A;  4PZO A;  2KSO A;  1B4F A;  1Z1V A;  1PK3 A;  1SGG A;  2QAR A;  4MHV A;  3KKA A;  1V38 A;  1OXJ A;  2LMR A;  3BS7 A;  5L1M A;  2QB1 A;  2ES6 A;  5J8Y C;  2DKZ A;  3IDW A;  1KW4 A;  3BQ7 A;  2KIV A;  4NJ8 A;  2F3N A;  2EAM A;  2DKX A;  4RQM A;  1UCV A;  1WWU A;  1WWV A;  2E8P A;  5JU5 A;  5JTI A;  2EAO A;  2FE9 A;  2KE7 A;  1X66 A;  2KMD A;  3H8M A;  5F3X B;  3HIL A;  2B6G A;  2E8N A;  1UQV A;  2EAN A;  2D3D A;  2F44 A;  3TAD A;  2QB0 A;  2F8K A;  5J8Y A;  2QKQ A;  2QAR B;  1V85 A;  4PZN A;  4NL9 A;  2KG5 A;  2KSO B;  3TAC B;  2ESE A;  5KNI A;  2QB0 B;  2Y9U A;  2GLE A;  3KKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...