3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords PF00702 domain protein
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
2FEAA 1JUDA 3L0BA 2O2XA 2YJ5A 1Z5GA 4BEWA 3L1VA 3E58A 4EX6A 5ALYA 2HF2A 4KYTA 4DWOA 2EATA 5AKIA 4HAIA 3FPSA 1YS9A 3KD3A 2G07A 2OBBA 4DW8A 3I1YA 3HLTA 3M1YA 4BKMA 3D6JA 3L7YA 2D2VA 1AQ6A 4DCCA 4Y2RA 3L5KA 1TE2A 4XOUA 5ALUA 1WVIA 5AKHA 3QXGA 1CR6A 4RETA 1Z4LA 1Z5UA 2AUTA 3NIWA 4YIHA 2HO4A 2B1QA 3A1DA 3ZX4A 1U2SA 1WZCA 2RAVA 4J03A 3AR5A 4MUMA 2P69A 2YJ4A 1T5TA 5AW1A 3ZI4A 3AR3A 2WF8A 3ET5A 3N8GA 4L57A 3QNMA 3ZWDA 3ONNA 3E84A 1NRWA 2AGVA 3OCXA 4UAVA 5AM3A 5AW9A 2YY6A 2MSNA 3CNHA 5AI9A 2HCFA 1TJ3A 2AH5A 4KNVA 3N07A 4L6AA 3DNPA 4YH1A 2BDUA 4NABA 4Y2YA 3UMCA 5AVWA 3P96A 2X4DA 5AVUA 5ALPA 3FGOA 3OTQA 3U7EB 4KNWA 5E0OA 5AK5A 4C4RA 3ZX5A 5ALHA 2RBKA 2W11A 4QQFA 3ZTYA 3W5BA 3EWIA 2C8KA 4JB3A 5AKXA 5AW4A 4Y2XA 3ZWKA 3ZVMA 1EK2A 2PKEA 1Z4PX 1O03A 3A3YA 3MMZA 3UM9A 2FPSA 1KYTA 5ALEA 3DDHA 5FP0A 4EENA 3B9BA 3ZU6A 1TA0A 3I76A 4UU0A 5ALNA 1L7PA 4J2TA 2GO7A 3SLRA 3AR4A 2B8EA 4UW9A 3QU9A 4UMFA 1L6RA 5AVQA 5AM2A 2WFAA 3QGMA 2FPUA 4F71A 2B8JA 5A3RA 3FM9A 3RFUA 1U7OA 3A1CA 3S6JA 1CQZA 1U7PA 1T5SA 2O9JA 2ZOSA 2FPRA 5AKLA 3ET4A 2CFRA 3OCVA 3QUTA 3SF0A 3OPXA 3ZVNA 4YCNA 3GYGA 2ZXEA 1RQNA 3WK9A 3AR7A 3N1UA 4UM7A 5T41A 5AM4A 4C4SA 2Q4TA 3IJ5A 3ED5A 3QX7A 4DFDA 4OHFA 3U7HB 1RMYA 2JAWA 1RLTA 3IB6A 3NALA 3TLMA 4I9FA 2G80A 4ZEWA 2JAOA 3L0YA 4IFTA 2YMQA 5A3QA 2YMLA 3UMGA 2MU1A 4EZEA 3MC1A 2RARA 4Y2VA 4Y2SA 3U26A 1U2TA 5AVTA 4MWOA 4Y2JA 5AW5A 1ZOLA 2QLTA 5AK3A 4Y2QA 2WF7A 1MH9A 3PGLA 3WK7A 4KX3A 4CNQA 1SWWA 2HSZA 3VAYA 1SWVA 4HGPA 5ALVA 3OCYA 2R8EA 3BWVA 4EEKA 4YGYA 5AW8A 1J97A 3R9KA 3EPRA 2FUEA 1Z4QA 2CN1A 3AR9A 4H1WA 4UAUA 4B6JA 5ALMA 3MN1A 5AKJA 2G1AA 1VFPA 2RB5A 4Y2TA 3OCZA 4HYTA 1L7OA 2BDEA 1QH9A 5AKZA 3PDWA 3F9RA 5AIAA 4BX3A 2Q5EA 2IA5A 2YJ6A 4UASA 2FPXA 5A3SA 2JGAA 2Q4RA 2ZBFA 3EF0A 1ZRNA 4BNDB 4GXTA 5AW0A 4UARA 3N28A 4YCLA 2QYHA 3ZTWA 3FPBA 1RLOA 1XP5A 4I9GA 1TJ4A 5AVXA 2IOFK 1RMTA 2FDRA 5ALTA 3WK8A 3M9LA 3B8EA 2W4MA 3AR6A 5AI8A 2WF5A 3L8HA 3NAMA 5AESA 1RPZA 1ZS9A 2I6XA 3QU4A 3WKEA 3QU2A 4FFDA 2IYEA 5AI0A 5AKEA 3QU5A 2NO4A 4L6CA 4GIBA 4XQ0A 3KZXA 2ZBGA 1RQLA 1J8DA 2YN4A 3OCWA 4QJBA 3W5AA 2I54A 1S8OA 1Z4OA 5AVVA 5ALGA 2C8LA 3ESQA 1L8OA 3WKBA 5IT0A 2DQSA 1L7NA 1ZJJA 3NRJA 5ALQA 4PNHA 2IOHA 2EAUA 2FUCA 5AK4A 1U02A 2I55A 3ZVLA 1Z4JA 1Q91A 2R8XA 4YIKA 1QQ7A 2MU2A 2NYVA 3J7TA 5AW2A 1Y8AA 5AK6A 2AMYA 3BA6A 5AW7A 5AVRA 1LVHA 2GHTA 3DV9A 1L7MA 2OA0A 3R09A 2G06A 3EF1A 3QLEA 3SKXA 1L8LA 4F72A 2YMMA 1N8NA 2HDOA 1TJ5A 2ZBDA 2HF7A 3OCUA 4JDPA 4AP9A 2PR7A 1RC8A 5AI6A 3NASA 3QYPA 5AIBA 3N5KA 2YFYA 4BEVA 4UMEA 3FVVA 4AS3A 1FEZA 1Z4MA 4E88A 2VKQA 5AVSA 4YCMA 4BX0A 4NV0A 3RF6A 5ALIA 1RLMA 2YJ3A 1ZRMA 1F5SA 2HX1A 5AM5A 1XVIA 2GMWA 3WGUA 1RDFA 2G09A 3ZUPA 1RMQA 2CFSA 2OYCA 1S2OA 2FI1A 3K1ZA 5AKGA 1RKQA 1Z88A 1K1EA 3E81A 1X42A 4BYGA 4HGQA 3QUCA 3WKCA 2P11A 3R4CA 4Y2PA 2P27A 2BY4A 3PCTA 4UATA 3WK5A 4Y3UA 1RRCA 3U13A 3HYCA 5IT4A 3L0CA 5ALSA 3ESRA 4HGRA 2WHEA 2R8YA 5AKKA 3I28A 4CF3A 5IS2A 3QUBA 2G08A 4BBJA 5AVZA 3SHQA 3WGVA 2B30A 1Z4NA 4G9BA 4OCZA 2IOFA 1QYIA 3KDPA 5ALRA 4C4TA 3AR2A 3KC2A 4FE3A 3WKDA 2HEGA 3L1UA 2WF9A 2JARA 1NF2A 3WK6A 4NFLA 1ZD5A 3B9RA 4UMVA 1YV9A 5ALLA 5ALJA 5AVYA 3W5DA 3U7GA 1YNSA 5ALZA 4OFZA 5AM1A 4BNDA 1YDFA 1ZD2P 5AI4A 5ALKA 4XE5A 3SMVA 3L8EA 1YJ5A 3NUQA 3CZ4A 4EX7A 3MPOA 1SU4A 4IG4A 1EK1A 1LTQA 3FZQA 2GFHA 3WK4A 2C88A 2C4NA 2I7DA 3ZW7A 3A1EA 3U7FB 2PQ0A 4HGNA 3L8FA 2YMPA 3NANA 2JAUA 4G63A 1IWOA 5ALXA 4CF5A 4BX2A 2W43A 1WPGA 5ALOA 2ODAA 5ALDA 1T9ZA 1N9KA 4UM5A 4KN8A 2CFTA 4XPZA 1XPJA 3SD7A 4CF4A 3AR8A 3U19A 1QQ6A 2EARA 1PW5A 2NO5A 4ZEXA 3WKAA 2WF6A 2B82A 2FPWA 2C9MA 1VJ5A 3UMBA 4KX5A 4OD0A 4O8CA 2WM8A 3QUQA 2HHLA 1YMQA 1WR8A 4AS2A 2ZG6A 2GHQA 1ZD4A 1RKUA 3W5CA 1Z4IA 1Q92A 4ZEVA 1ZD3A 3IRUA 4NAVA 3SKYA 3KBBA 5JJBA 4UMDA 2I33A 2I34A 5AW3A 4RESA 3E8MA 5AHXA 1VJRA 5AKYA 5AICA 5ALFA 5AW6A 2B0CA 3PGVA 1QQ5A 1O08A 2P9JA 3KOOA 3I6BA 4Y2UA 1RKVA 3QU7A 2R8ZA 2G0AA 2ZBEA 2OM6A 2HI0A 1NNLA 2HOQA 4UU1A 5ALWA 4EELA 2B1RA 4FYPA 4HGOA 5AI5A 4NWIA 4CE6A 1Z4KA 2YBDA 5AM0A 3DAOA 3L8GA
chains in the Genus database with same CATH superfamily
1A7AA 3W1WA 4RHEA 3X2FA 2CSUA 3NQ41 1ZEMA 2ZIXB 4H15A 4HX9A 4LZOA 5DCWA 3GLQA 1UWCA 2FWJA 1V5WA 1RZUA 3EXG2 2ZRBA 3JQ9C 4YTEA 1P74A 4E33A 4YAGA 3OQHA 2ODNA 1Z8FA 3EVGA 2UXCB 1FNDA 1ADYA 4CW7A 1ZUIA 4UD2A 1UBJS 2CNBA 2TMDA 2RGGA 3THOA 5JDCC 3BHNA 3L41A 1B2LA 2Y66A 2B1GA 4Z7QB 5A03A 2BKUA 5EMJA 3DVAA 2OO5A 1NOJA 4AYXA 3K71B 1WAMA 3U7IA 5A5DA 3RAQA 5JAMA 1W5TA 1YU9A 2Y99A 2WJJA 4P4SB 1LW6E 3EDYA 4FR5A 4TXHA 3WIUA 1Z4LA 1T0UA 2P9GA 4R5MA 4NECA 3RS3A 1ZISA 3Q85A 4PSCA 2JFGA 4W5JA 3RLIA 3PITA 4FKMA 2W6MA 4M9HA 3QFHA 2QN1A 3C14C 3ESBA 4HX5A 3W8EA 2ZRNA 3ZY5A 3ZQ6A 1P9WA 4LYYA 1KSGA 4YRJA 4ZZ0A 3LGAA 1C0KA 3BZWA 3A9TA 2KB0A 5TQVA 3WIVA 5HR7A 2HSWA 3O1JC 4IOKA 4FILA 9ICCA 1H0HA 1XRRA 2GGSA 3EAGA 5JXHA 1K2WA 1T9BA 1ECPA 1OZGA 2WP0A 3K4PA 2V74B 1UMCB 5JPDA 1DRKA 2ZANA 1MT0A 3PUJA 4RZIA 1JWBB 3ESXA 1J2YA 4DQDA 5KREA 1W85B 4L2IA 3RFCA 4C0KA 1HO3A 1H2XA 5DLDA 3HSSA 1NY5A 1I3OA 3HN2A 3MGGA 3LUGA 4L6AA 4ZK6A 1AKEA 3KQMA 1VCIA 1BQEA 3MILA 2J0UB 2LXNA 1CUXA 2BFBA 2AG1A 2FG6C 1W85A 1IZYA 2JGDB 2Z2ZA 3EQ8A 3GLHB 4BXOA 2WW8A 3I1FA 3IBFA 4FMDB 4UC0A 5CT8A 5DNWA 1LDYA 5DNDA 1XXHA 2B2NA 1OFUX 3I45A 3C2MA 1L8QA 3RR2A 1DDGA 4E5NA 3IRVA 3QHPA 4L5CA 2B4RO 1R88A 1I2CA 2QVCA 4KKXB 4L8FA 2Q8NA 4ZYTA 2VNKA 4CIVA 3NOXA 1ZWKA 3CR7A 4D4IA 5DNVA 1NC3A 3OH8A 4KQJA 3RYIA 3I9V6 4CKYA 1RP7A 3OX2A 3X3HA 3PYLA 1EK2A 3NG1A 2BBTA 5TXGA 1M75A 1O03A 8ICBA 3R3VA 5J63A 4Q6WA 5IK2D 1KRPA 4WBNA 4M22A 4PCVA 1G8GA 1ORTA 3JZMA 2D13A 3ZU6A 3GB9A 2E1EA 1PUZA 1YR2A 2JGDA 2I3GA 1VJDA 1E92A 4TVBA 3RIYA 2OD7A 2IH5A 2AQKA 4X85A 1ZETA 1PVOA 1KE2A 5GGXA 2I6FA 2HFJA 2QDKA 1A9XB 4M6WA 4OH1A 2ET6A 4COKA 5KU7A 2J6SA 3I2JA 3VPCA 2IW1A 2DR3A 2EFCB 2MTBA 3BAZA 4G1CA 4D4KA 4AB1A 5T8KA 1RHUA 1Y7TA 1JLRA 5FD8A 2NSDA 1G21A 3RJJA 2GCOB 5LA6F 4JSYA 3TTSA 2CLFB 4J0FA 4BFUA 1RNLA 4QOSA 5KQGA 1Z7WA 3FOWA 3UWDA 3HBFA 4X91A 2JGFA 4UHBA 4A5OA 4DPLA 5GONA 2X1HA 4H0CA 1RQPA 2PMDA 3HM9A 3S6JA 3COSA 1U3WA 3TMAA 3A6GA 4FTWA 1Q3VA 4MYSA 4A6XA 2Y1KA 4X20A 1O58A 2HHCA 8ICQA 2JBAA 2YXDA 2CK3A 2DR0A 3D3WA 4Q7QA 4AQYB 4DUYB 3PSAA 2K2WA 3T3NA 1YAHA 3DB1A 2W7PA 1L5OA 1NXWA 5DBFA 5JRTA 3T3EA 3W2GA 4BGDA 1E7SA 1NXPA 1PR0A 2E5WA 4LYHA 3VKUA 1GY8A 1Z5WA 1Z6QA 2CLIB 2EZ4A 2CE2X 4FI3C 3MVEA 4LOJA 4XQ8A 2HHUA 2R7MA 4AJPA 2HFKA 5IKPA 1RKBA 2D1YA 4O4LF 2VPTA 2XTJA 4AROA 3AIIA 2TRSB 3WFJA 1KDVA 3AP2A 5JTTA 4EG8A 3TDKA 4DF8A 1I0LA 3PY8A 2F3UA 4UM7A 3EVFA 4I6JA 5EWJB 1EU1A 1Z73A 3JWPA 3FDZA 4OHFA 2MUTB 3LWMA 2HMVA 4D9FA 4E5KA 1OXTA 1QCYA 2B4QA 2F64A 5BSVA 2BRUC 3IQWA 1Z47A 1O0CA 1TQ6A 5E7QA 3G6XA 4QEKA 4YP7A 1AGPA 1RM0A 2N3ZA 3SXUA 1K75A 4JGBA 2JVIA 1QPGA 5CNKA 3RM3A 1M2OA 5L45A 4PPYA 4GRDA 4RHYA 3LJKA 4YCBA 3VV3A 2ZAMA 4QW9A 4DLKA 3PBKA 4QIWC 4KO4S 1EFPB 4MQ4A 3E9DA 4UTOA 2E5LB 3HQ4O 1CF4A 2Z8YA 4H08A 1CCWA 4F8EA 1M7BA 5KDOA 3UXPA 3C8DA 1X80B 2HK8A 3RRYA 1FP1D 2F00A 3HB1A 5B53A 1JLHA 1LTKA 4LRSB 4MRRA 1GR0A 1V43A 2AD5A 2X3UA 2ZQ5A 5TVKA 3A9SA 1R6TA 3P94A 3RRJA 2KN7A 5LYJF 5LZ9A 4P58A 5A6SB 3TLEA 3UT5A 5F9NA 5BSGA 2QLTA 4PRYA 3HPRA 3ANTA 4NCXA 4DRXB 3LRPA 3VKFA 2YCBA 2QTAA 2E4UA 4MUBA 3RT7A 2KJQA 4QUKA 1EAYA 1ZQIA 2DPYA 3WB2A 5J2KA 2KE5A 1WNFA 4L8VA 1QSGA 1QIGA 2Q1WA 1MG0A 3PNSA 2Q3FA 4FMCB 5HCIA 2WWXA 2ACWA 2WJVA 4DYHA 1L5QA 2JAXA 3CIFA 3HU2A 3GI1A 2YUTA 3R3ZA 3CR8A 4MJ7A 4RK1A 3RHFA 4EG7A 4YCSA 1PNOA 1RJ9A 2CMDA 1AM4D 3KOYA 3LRXA 4MLZA 4UFNA 5AW8A 5LOVF 3NATA 3D6TB 3HB0A 3F7TA 4J0CA 3VRHA 4LDNA 2O5RA 3A28A 5BSKA 3WRWA 3MD9A 2RRDA 3H1PA 1T2DA 2Y0SC 2OOKA 2Q1UA 1YH3A 4GMGA 4JC8A 4RU1A 2B20A 4ZOEA 3W5SA 4B9AA 4CJXA 3EX7C 4IKOA 4Y1RB 1D8LA 5FBQB 4EYKA 3KKAA 5FYQA 2X4IA 4DMUB 3TX6A 4C3ZA 1Z0JA 1U65A 4E5YA 1DBIA 1F6BA 5AIAA 4XVUA 1MIHA 3NORA 5CH3A 2KJ9A 3E7DA 4C7ZA 3NC4A 5GAJA 2GN1A 1RTTA 1K2VN 2VHXA 4KO3S 4BNVA 3NBYC 4OAQA 3HJAA 3O75A 4I2IA 4U7TB 1AO0A 4YUYA 1OV4A 2E8NA 1IG3A 2WV9A 3SSOA 3T4XA 3UG6A 1W36B 4RBNA 2A9VA 1XL0A 1C1DB 1OBCA 2W9CB 3GLRA 4IJWA 2VXYA 3AZPA 3IJPA 4XWYA 3KT0A 1JN3A 4AMZA 4G24A 4AN1A 3QXXA 5I4BA 2SCUA 5BSRA 1OIXA 2AW3A 2J08A 5EP4A 4R71A 5KHAA 4BEBA 3KQHA 5IVDA 4TLCA 1LNQA 4G5GA 2AS0A 4BRZA 3AL2A 1XDWA 4LSGA 2DHEA 3VV2A 1ISMA 1C50A 1RI5A 3AOEA 3M9LA 5I3CA 2E37A 2FG5A 3RB3A 3B8EA 4UBOA 1V8ZA 2Q9AA 2FLNA 2SKDA 2YHAA 3JQDA 1HGXA 3MTIA 4LJSA 3EUAA 5EZYB 3R8CA 1KPGA 3ZHXA 4FHZA 1GNSA 3QE0A 2IYEA 4ZQFA 4EA9A 3L1KA 2RJOA 1IXZA 2XUGA 1I1OA 2XA1A 1JFVA 3SICE 2P2LA 2RDMA 4FP9A 4AQDA 3WRVA 1VSBA 1YRHA 4QZEA 3GH3A 1JI7A 1DXHA 2RSLA 5DCYA 3RSGA 8OHMA 3GA0A 1E64A 2XNDD 3E3NA 3ISDA 3JQFA 3KHRA 3OCWA 2W0SA 3QFRA 3QWBA 4QOEA 5IU6A 2OO7A 3I8XA 4L8YA 3D43A 5LM3A 1G20E 1Y8QB 4DQSA 3ESQA 4BO9A 3H7AA 3SV3A 3SC2A 1GG9A 3M8KA 3NHUA 4L50A 2C0CA 4K9RA 4MVJA 4R8MA 3UWMA 4N12A 1H9CA 1G9TA 4KRGA 4LK2A 3DPUA 3JQ8B 1Y8RA 4IQ4A 4ASUD 4DE5A 1L4KA 1L5ZA 1P0MA 2VK2A 4DIUA 3IA7A 4EECA 2DCMA 1SXGA 4RHTA 3WLLA 2OCXA 2BL4A 2LNDA 1NVVR 4EG1A 1PO7A 4LZWA 2J09A 3LT2A 1E2UA 2JLBA 4GGOA 5FI0B 2CUNA 2OKGA 3TZCA 4ZIRB 1QQ7A 3NWEA 2WJIA 4HNVA 1ESNA 5KSZA 2P6RA 4UBJA 5AK6A 4ZYUA 3I2GA 2DFDA 2I2DA 4QIHA 2WKSA 1R4ZA 2WB1F 3QY9A 3BEDA 3OM9A 4JLKA 3P2IA 4OXIA 3BCRA 4YJ2F 3VKHA 2OGUA 3Q3VA 1XJCA 3Q4GA 1T9GS 3KQTA 5BN5A 4GPZA 3BFXA 2KICA 4XD7D 5HM6A 3DMHA 9ICQA 3A0HU 1RWBA 1ZCFA 2B7LA 4K81B 2FX5A 2ON6A 1YR3A 4O2BA 4IV8A 2H2DA 5DRTA 1ODFA 2XDQB 2FSGA 4YAWA 3DZJA 4AJKA 5A06A 1L4FA 2VSQA 1JX4A 4BEVA 4CMCA 4O3SA 5FPPA 2Y9TA 4RZXA 2AMVA 4PSVA 4IIYA 2HA0A 1FEZA 3GGSA 5KJFA 3D2BA 2KEYA 1C0IA 5K6AA 1SIJA 2AOXA 3ORRA 5I4KA 3RJKA 1I7NA 2O2HA 5B66U 1LV8A 1U4NA 3BSSA 3PHHA 3C3KA 4OU4A 3I9MA 3KVYA 2OLKA 4V0LA 4CMJA 5FA8A 1NVTA 3L8YA 1H6CA 4OQYA 3ZW9A 3DF9A 4MRNA 2WNIA 4RDHA 4DFJA 2XIQA 3ZUPA 2JIDA 3L9WA 5T6BA 3BE4A 1ONSA 3G8DA 3RJMA 1QLWA 1GRRA 1BSVA 4DMRA 3AJRA 4TTVA 1EA7A 4PZAA 4D4JA 1BJRE 1FYFA 1D4ZA 1H1LB 2DG2A 3CRMA 3EZ5A 3MWEA 4ZO6A 5DM4A 1YK0A 3KZ1E 1K1EA 2MSEB 3QWAA 5F77A 2XX3A 5LQKA 3S7ZA 3KT3A 2VF7A 4PLGA 4E21A 5DPMA 4NATA 1KEPA 2FXIA 3HLYA 1OLXB 3MJ4A 1T15A 3QPCA 3UB2A 3AL3A 5E4TA 1KI3A 2KLBA 2P27A 2X6TA 3Q3CA 2BY4A 3Q3GE 4PG4A 3R76A 3T7SA 2XYVA 4JENA 5KS2A 5B3JC 3RH0A 3L46A 3RTBA 4HUQA 2Z2JA 4IJKA 4WNIA 5IS2A 3DONA 1E3JA 9ICPA 5FL7D 4GP7A 3TZBA 3ZI7A 5EQJB 1E1KA 8ICMA 2JNWA 1CQJA 3BGOS 4IDHA 4CMKA 4XJVA 3CZ5A 3KDPA 2V7BA 3OJLA 2Z3VA 3BWXA 3HL4A 4I1VA 4I3HA 1WW3A 3EFOB 3P0EA 4YJGA 3WYAA 2QXUA 4PR0A 2PD3A 5I7VA 2LD4A 3L1UA 4M8NE 1X8JA 1V2GA 3BRQA 3LQ1A 3HDJA 2E1FA 1BHO1 1QPZA 3U7HB 5C7OO 4YR2A 3IHTA 4YJFB 4J16C 4MV4A 1T2EA 1E1QA 3RJTA 1M7HA 2XGOA 1WXQA 1R7RA 2TMKA 4ZCTA 5AR1A 1KVUA 5CT9A 1OR8A 1U1GA 2HHTA 1IPEA 3E0QA 3PEUA 4QT0A 3A9VA 2DKFA 4BQQA 1RADA 4KE8A 1QX4A 1LK7A 3SMVA 1T8YA 3C7KA 3HKEA 3OMXA 3PNLA 4JQZA 3RV3A 4P2BA 4Q3DA 5COQA 3M6LA 2JIBA 3RC8A 3EFOA 1ZCZA 2YHSA 4JBLA 3I64A 1T6NA 3MUEA 4LXTA 4RANA 4TTQA 5DW0A 4BCDA 4CLHA 1DBPA 4D3ZA 2AA3A 2ZWIA 4XSVA 5JBNA 3H4DA 1EK1A 5DEIA 4J91A 2NTVA 3HBAA 4ZT5A 4YR9A 2EJWA 4BFZA 4X65B 4Q4AA 2QYSA 1F0PA 4TUYB 5CLHA 1ZOIA 1Z1BA 4LFCB 3REGA 4P81A 3TX2A 2W5UA 2O8CB 2NSJA 4L22A 1FFGA 4GPAA 4OB6A 3T06B 1NHWA 2YWJA 3L8FA 1NXOA 1EGQA 2VCEA 3DVLA 3MCZA 1ZVKA 1EM8B 3FAKA 4FYKA 4I55F 4L27A 2I71A 4ND2A 2CMKA 1QM5A 1O94C 4HEA6 2A19A 1H2EA 2VJCA 1U2GC 1FNCA 4IV5A 4K28A 4LDZA 1Y3DE 3H2GA 5J2JA 4K0KB 1OY1A 1MFPA 2VC2B 1S6YA 5TY0A 1YL7A 2WVGA 3HNOA 2K8BB 3PC6A 3INTA 3HXLA 5TPZA 4OGWA 2IY7A 4GQAA 1ZGAA 1Q7BA 4OSOA 1I4DD 1RXCA 2F3QA 3P1JA 2G82A 1TL7C 1X70A 1F7VA 1V7ZA 4A8TA 5B7NA 5IZCA 4D0SA 4M98A 2DT8A 2OHOA 4R64A 3NHWA 3JQGA 1QOQB 2WF6A 3OP4A 3UAVA 3BC1A 1IE3A 9ICNA 1TW3A 2HQRA 1VJ5A 1U1DA 3UMBA 2WJ6A 3NHFA 1J2TA 4N7JA 1QHHA 4RFSB 5IBRA 5JNVA 2N0SA 4BVEA 2UUCB 1FB5A 4WV3A 4J0QA 2WSSD 4JK3A 3UOWA 3ZGOA 4DVJA 1YMQA 4LZLA 5JZBA 4HLUC 4MW9A 2WDZA 1QKJA 4DL9A 5JHHB 4I9NA 3WAKA 5EXDA 4FO6A 1SL1A 2ZRPA 3RKUA 4LF7B 1XF1A 3MCUA 4NAVA 2B5OA 2GZRA 2CLMB 3ZWNA 4OLJA 4XYGA 4ICIA 4UMDA 4KVZA 5LJIA 5AW3A 2BP7B 4ECTA 2KZZA 5K0CA 4ECZA 2PRSA 1NKTA 7ICPA 2AHRA 1NURA 2BCJQ 3CZCA 2X9GA 1L4HA 3HADA 2XNCA 3SFTA 4M0AA 1O08A 2RH5A 2NOAA 3L4EA 4PPGA 2NV6A 4S35A 4JEUA 3ROFA 6PFKA 3B6KA 3L02A 3LT4A 1CDZA 4M1MA 4WK0B 2TECE 1FFHA 1TKAA 3DHWC 1IL0A 3RTAA 2ZPTX 2PGAA 2BGTA 1WLYA 1JMSA 2X0NA 3LY9A 4OSPA 4F6RA 1R5NA 1E99A 2Z09A 1MLDA 4WY2A 1T2FA 2RGXA 5JXWA 2YYAA 4NYJR 1BWPA 1YRAA 4WQMA 4Y98A 4YI5A 5IF9A 5K0EA 3DHVA 4FQ5A 1VB3A 3L1JA 3UG7A 2JZBA 4MHTA 1EGAA 5KFMA 1NYTA 5J2DA 1YA4A 3RSZA 3S2YA 4ZHSA 2IX3A 1PUIA 2YHBA 4CKWA 4HGYA 3ESDA 5FWXA 4C7OB 1IN1A 4P0QA 4FINA 5EMHA 3VH2A 4A82A 1YO6A 1QZUA 2D3DA 1XTZA 5HKOA 1ZGJA 1SB3C 1RC0A 3GP5A 3H18A 5GONB 5C1DA 1ODKA 4ZGWA 3AV3A 3MFHA 3NYWA 4I55B 2EZZA 5C3UA 1PAUA 1V4NA 1YS9A 4MA4A 2D6FA 3C6XA 1W6UA 4HLNA 3FIUA 1D7OA 2OQIA 3UA3A 5JASA 1JH8A 2C22A 2YYZA 2Z30A 2VHEA 4JLPA 4OJMX 4S1NA 4RA9B 4FFVA 3RABA 4KLOA 1CQIA 2CZCA 2W37A 3EXG1 2H00A 2PUJA 3QKSA 1F4PA 1GZ3A 1THMA 2XR1A 4A1FA 2RGRA 1N3YA 3OZAA 3A1WA 4NIMA 4TM7A 5M34A 4OJKA 4C3UA 3UOAB 4HUTA 3LK6A 4EW3A 2OV8A 1UBNA 2A84A 3C6KA 5AHKA 4AF8A 3ZY2A 3AUSA 1GYRA 2ADOA 3BJIC 3LPMA 2WAAA 3EDQA 4UHKA 5IARA 2FZLA 4WK2B 3VDMA 2Q4OA 1WCIA 4DG9A 5BV1A 1H1DA 5BMVB 1O7JA 2HCJB 5ILQA 3OQIA 1YULA 1YOVB 2DH5A 4LJ7A 1NJFA 1O9GA 4RQUA 4X1KB 1GU0A 4QPCA 4MDFA 1T8RA 3DDUA 3L1IA 3MIIA 4JZYA 4PV7A 1I30A 3IP3A 3WIDA 1MEEA 2FK7A 5KFXA 4DL3A 3RH5A 1MORA 2ZB4A 1ZKDA 3C97A 4HWOA 4BMVA 1ZLYA 4EY6A 4GPBA 1JU3A 4ARZB 2ODBA 1E77A 1ES9A 2AEMA 1D2GA 1JKFA 4OV6B 4H18A 4ZVUA 3BG5A 3RSQA 4ER3A 1QRTA 4RCVA 4MS1B 1RZRA 3LLCA 2GCEA 2KIWA 2IODA 5IXJA 3JD2A 2OVFA 1CB0A 3LPCA 3W6ZA 4O3PA 2BSXA 1ORRA 4S1OA 2A3RA 1L3TA 3FLEA 4MB2A 2GR9A 1F48A 2H2AA 5IP5A 3VMFA 1HIWA 4OHMA 3JPPA 2YIJA 4ALLA 5M04A 2NT3A 1UWKA 1O5OA 1Z37A 4P2GA 5CFMA 4C2TA 1NF9A 1SKAA 4P3NA 3VDQA 4JOQA 3LUBA 3LFHA 3VC3A 1F3LA 4TYMA 2R18A 4GZ6A 4ZRNA 4QWWA 3RK4A 2PXCA 1UEXC 3RGGA 4RULA 4NH0A 3H5WA 2HYDA 2F8SA 4D44A 3DFMA 2FKNA 3L7JA 1RRVA 5D49A 2FP4A 1ZI8A 1BAPA 1Q6ZA 4OKSA 2ASEA 3SBXA 1L7PA 3RB6A 2XB6A 4JJKA 3G6YA 3L6OO 1PF7E 1ONOA 1TQ2A 4UB4A 4RK4A 1L8AA 1V11B 4HP8A 5BT8A 1RZVA 4U6SA 2NO0A 4X90A 3IVRA 2X0EA 4RM2A 5A2GA 4YPOA 5JG7A 4B47A 4O4JB 4UQOA 3V8EA 3T1TA 4FE7A 4N41A 4HAXA 1QZZA 1XK6A 1ZUD1 4EPXA 5IHXA 4FD3A 3CKLA 2JLYA 2ERYA 3PX3A 1FPMA 1M8PA 3R8FA 2ORIA 4FHDA 4F93B 4YN4A 3IP8A 5KKNB 3EIWA 2IHNA 3IDWA 2O9JA 1HT3A 1CUBA 3WDKA 2OHFA 2ZJ4A 1TTPB 4IIUA 3G9QA 4RHXA 4QPNA 2FWAA 3KALA 3ZHOA 5ADVA 1EWKA 4LWPA 4AMGA 5KYKA 1YB7A 2R0QC 2WU3A 3AEKA 4O4HB 1T0PA 2ES4A 1U3FA 2Q1TA 2VUUA 4U2BA 5C5DA 1UPTA 3BS4A 3E9QA 4YMNA 4R1QA 2HJ9A 2QE6A 1PJCA 4MRMA 1OVGA 4GKBA 1SO8A 1A5ZA 3PUVA 1Z00A 2VDKB 1N2JA 2CSXA 4UNQA 1GPJA 1MAHA 2HOIA 1IJFA 4LOAA 1SMKA 4ZA2A 4AFNA 2ZXEA 3MCAA 3HR7A 2XCOA 5HHHA 4EMSA 3HP6A 1R6UA 1R4AA 4YLYA 1ADGA 3BB4A 2BE7A 1VIAA 4PFKA 3P97A 3UHFA 2C0QA 3B3JA 2H06A 4FBLA 4I1UA 3ME5A 2XVXA 4YO8A 1JEYA 1XPUA 4O3NA 5E0KB 1CZUA 1STOA 2K7FA 3RBAA 2CXSA 5EJAA 4NLZA 3IB6A 3IH5A 3C3CA 2NP6A 3HI6A 2BFPA 2IRWA 1M2HA 1C3OB 3CLUD 5CH8A 3GJ3A 4ARVA 2XBUA 3T1VA 2YL2A 1E63A 1JYSA 1CY0A 2FMKA 5J2CA 2JBAB 3CGWA 2OHHA 2JAOA 1R0BA 4MKGA 1HE2A 2Q3CA 3MNFA 2VHTA 4KDRA 1NBEA 3SQLA 4LXIA 1VG9B 4EJ6A 1B3RA 4RQ7A 4CKCA 4X41A 1XBTA 4RAQA 1UPAA 4EK9A 4EYSA 4DL2A 1EHIA 5MN4A 1QH0A 3E5RA 8ICSA 1G0NA 3V8RA 2CJFA 1H05A 1YMUA 1ZI6A 4E0BA 4BNTA 1SXJC 3QRWA 4MFFA 2UYYA 5AVTA 4FVTA 3IMFA 2Q2QA 5KFGA 3CZ9A 3AVYA 3JX9A 9ICBA 1NSYA 2PZ8A 2Q62A 4UE2A 4ADSG 4L07A 2XCRB 2F8LA 3MUFA 4L8GA 1O6FA 1X1AA 1ZZEA 1GNLA 1VMEA 4L4YA 1Y3FE 5A62A 3JD1A 3OE1A 1HT2E 2IYFA 4RD6A 1YTUA 4N3BA 1KQGA 4IIJB 4L4ZA 2F9LA 4M9NA 4MIEA 4J75A 1BROA 3OCYA 3OY7A 4QT4A 1X7WB 4MQMA 4LY0A 2XAUA 2YTUA 5C7IO 1FRQA 1XMJA 2QMOA 2CNOA 1PGJA 1Q0UA 2V7EA 3LSYA 4J7XA 5KI6A 4IDNA 4F5PA 3BBPA 3C8UA 4G0OA 2GM3A 4QRIA 4H1WA 4R63A 1S89A 1E20A 1UFRA 3N74A 3OHMA 2UVRA 1VFPA 5EE9A 3ECAA 3CXUA 1DXQA 2H7CA 2HEIA 4NC9A 3SLRA 1U63A 4B79A 4IUDS 4NCHA 1C2YA 1X1SA 2WJGA 2FX3A 3CZQA 4B7CA 1IXRC 1G19A 2FZGA 1XTJA 1EWQA 3Q8XB 1KDTA 3ZCSA 4EEYA 1PJSA 2LE0A 3G0BA 2J6IA 3LT5A 3NW9A 4IF6A 3TJZA 1MX9A 3OWOA 3BS5B 1RTKA 2QD1A 3EMBA 1YI0A 3SYLA 1RZRD 3TACB 2Q5QA 4KV7A 3FCOA 7ICKA 5EP1A 1CEEA 3BIOA 2VH5R 3S70A 3QTTA 1E6MA 1M54A 1P5ZB 1X8KA 1YJ8A 2OC4A 3IUJA 4I3GA 2NVWA 4U7FA 5DDIP 1J00A 1L6NA 4IGIA 4PWZA 3E1SA 1KI2A 3E7WA 1GRQA 3FMOB 2GPSA 2NNWB 2PM8A 5AVXA 3I6MA 1IB6A 2Q8PA 4MEJA 3WDSA 5L3QB 2FDRA 1QIIA 4MF2A 1WDKA 5L8VA 1X2BA 3AR6A 4DMFA 3F5AA 1G5IA 5FA5A 2WHXA 4PYIA 3ZWYA 3OFND 5IDWA 4IIHA 2QUAA 3QU2A 4J3FA 4FFMA 2C7PA 5AI0A 1XD9A 4ZVRA 3TD2A 1J39A 4A0RA 1U7DA 3OF2A 2NZ2A 5J0QA 1J99A 2R00A 3OJWA 3KQVA 2VIIA 4BMCA 4IR1A 1SXJA 2IEDA 4B2PA 8ICAA 1B00A 2YN4A 3GGPA 4DMHA 1DLJA 1PZFA 2ORED 2ATVA 5BNFA 3TADC 5J5VA 3VMMA 5CLFA 3L49A 3OTIA 4ETIA 4U9HS 5CUQA 2NU9B 1TIPA 3REQA 2A1IA 1QLNA 2APJA 3NKVA 2AW5A 4GQIA 3UQ0A 3T52A 3W8DA 4ERNA 2QZJA 3RG2A 1E1CA 1NVKA 4LJRA 3ZDCA 1TKCA 4ROSA 1PS9A 3F2VA 1Z5ZA 4K9PA 3D8HA 2SCUB 3T1NA 1CUEA 5AK4A 1FUIA 3A3PA 3KP1A 2X9LA 4HATA 1E7QA 5BWMA 2ZDHA 2ZIXA 3GV0A 3OE7D 3LPDA 4FIZA 4TTAA 1KNQA 1X0VA 4BZXA 2HHXA 1D2EA 4WFKA 2XDYA 2DAPA 3KJIA 4DQXA 8ICPA 4A73A 5CA0F 2MT9A 3FTDA 2XWBF 3DLTA 1WXWA 2VA2A 1E4VA 2OZEA 4V2IA 2VSNA 2GAAA 1W2WB 3O0DA 4B3MB 5EERA 4WK4B 5A6SA 5CLQA 4DWOA 3V33A 5L3ZA 1A8HA 1DP4A 1EPUA 1SBIA 1DC3A 2JLSA 5DBEX 3KIPA 1O95D 2C5BA 3WYNA 4DC0A 1JLMA 2HDOA 1ISJA 5H8WA 1P17A 5IFLA 4JLSA 4JYPA 5IKOA 4WN3A 4W7SA 5JNLA 1N0WA 5TT0A 5DG7A 3CBQA 1WMDA 4LN1A 5KO2A 3D2CA 2PGDA 3Q2KA 3ZCQA 1A5SB 2QBYA 3LBFA 1R0XA 3EAQA 3GLIB 5EPOA 1BPBA 2AC4A 4RT3A 1DWPA 9ICWA 2RIRA 2XPCA 4KZPA 4DXAA 2ZJYA 4PLPA 2QX8A 3VTFA 1OH8A 2EP8A 1DMRA 2BEVA 2QW0X 5IUJC 3NLLA 5KU1A 2EXXA 2GVDC 1W1IA 2AZDA 1FFEA 2BHRA 4QICA 4ZOBA 3D4IA 3SZGA 5CFPA 3V8NA 5AM5A 3A58B 3DLCA 5DFAA 3RUPA 4KO1S 1N92A 4MFCA 5B4UA 4MTLA 1M76A 4FXOA 5F7ZA 1ZM3A 1W1UA 4G8CA 1E3QA 1S2OA 2XMZA 5KUTA 3ILHA 2VT6A 5DULA 1PFKA 1DTSA 5IXYA 4K88A 1ZGZA 3ZWMA 2G5IB 2QENA 3GLIA 1W73A 1EIWA 1ZA2A 2NXWA 1H0SA 3FRHA 2P9QA 3R40A 2XUFA 1IRXA 4H31A 3JPTA 4BQSA 5FH9A 1JE0A 5CVTA 3V7KA 1DRGA 5D6OA 4DCGA 1PDVA 3IEIA 4LS3A 4LUCA 4NENA 3EW9A 1N6NA 3H4TA 3Q88A 1YJBA 2UDPA 3HCRA 1GDHA 1YZNA 2EP7A 4DL6A 5KVAA 4IOJA 4OA5A 4DCPA 2KD1A 1FS6A 5KHOC 4MKRA 1HNNA 3NONA 4NZMA 1WUTA 3ICPA 3ILYA 2QTHA 4G9BA 5FR2A 1G21B 4M9XA 2QTLA 1G4AE 5E1OA 1L6IA 1UBLS 4C4TA 3I9FA 4RZ2A 3UGQA 2R11A 3AOGA 3O2QB 1L1EA 2IVZA 2WD7B 3V1KA 1MNAA 1B4FA 5J0TA 2R8IA 1I9GA 2XBLA 4AY3A 1WD5A 5LZ4A 2HT1A 4BFCA 2Y0PA 2F1RA 3A7DA 2W2QA 4YAKA 3BH7A 3M6VA 3PWZA 4HZUA 5FJJA 1CF9A 2BBWA 4ITUA 4M87A 4CU5A 3W5DA 3ER9A 5L3SA 4Z4FA 4PLZA 1LDBA 2EW2A 4F2DA 2VP2A 4NX2A 2O8DA 1GJRA 1NC1A 2J3IA 1TU0A 1WVMA 3FWNA 4N3GA 2W7TA 3R7AA 1FMLA 1VDMA 5MGNA 3P7MA 2BEUA 2JJ1A 3D1VA 3ULKA 4C7XA 2W42A 2E7ZA 3CH6A 3KT8A 3N9IA 1YGPA 2DH6A 4TQAA 2KWIA 5GY7A 4CCYA 1PK3A 4EJ0A 2EWMA 4LMAA 3MPOA 4ATNA 1IEQA 3IUYA 1SU4A 3BF8A 4O5OA 2FWPA 2HW8A 1G2OA 2WG1A 9MHTA 4B6RA 4PEVA 2EJVA 2CCJA 2HF8A 2OO3A 1G7SA 3IDFA 4EB3A 2I7DA 4FQ8A 3ZW7A 3BKWA 4HNHA 5B1EA 2KKPA 1SXJE 3TAPA 1J49A 1D4AA 2PLWA 1CZLA 3PEVA 3C7TA 2KVCA 3V7YA 1JHUA 1EFPA 2NPFA 5E6SA 3BD7A 4TQUS 3C7DB 1XU9A 2R7NA 3FMGA 4HLCA 1HJPA 1FFAA 2CYCA 2IC5A 2OV4A 5I01A 1ZAKA 1CZNA 1OMOA 3WWCA 1QOZA 4XA5A 2QTVB 4DV5B 2WIJA 1HNZB 5EJ5A 3RUAA 3DMTA 3GWGA 3QPDA 2V7XA 3OPVA 1I8TA 2KE7A 1YXMA 2X14A 4LJLA 3DVQX 1K92A 1XYGA 1Y3BE 1MGOA 2HN9A 2VK1A 4C04A 1TVKB 4DC9A 5CLJA 1GN9A 2I6UA 3P9IA 5C0YA 5FF9A 3U19A 3CX7A 4JY7A 4ZARA 5K3DA 5JARA 1IB0A 3KV3O 3RC9A 4EPTA 1KIMA 3RT1A 5EVJA 9ICSA 1N2CB 5LUAA 3I5YA 1QP8A 2MSCB 5I7RA 2FPWA 4XJXA 3U61B 4BDPA 1AZTA 2FQ1A 4JLVA 2AC7A 5KFYA 5DGAA 2WM8A 3K5WA 5CM2Z 1EUQA 2G1JA 2P0AA 4KLHA 1E5TA 1P1HA 3LP8A 4Z4HA 5HKKA 2R8HA 2GKOA 1QE5A 3IT2A 3OC0A 1AGXA 1NNUA 2PQ6A 5A3JA 3AY0A 5G53C 1ZQOA 5C8XA 1BZYA 1EGMB 2XRFA 1XAGA 1PBTA 3C4QA 4H1HA 3UUWA 4URUR 2Q4DA 2FLVA 1HTTA 3RRMA 1E2FA 1M67A 2I99A 3K94A 2R6R1 4EFKA 2KM1A 4F9FA 3K0BA 1GKUB 4B9UA 1FUUA 4IDAA 3KOOA 2AJ8A 1UBMS 1XFAA 2P6OA 3DVRX 3QNWA 4N18A 1ZJ5A 5E4JA 2H1SA 2SKEA 1QANA 5JD3A 1Q3TA 1U8XX 2O20A 1B8PA 1B8UA 2A9OA 3FFWA 4FNGA 4ID3A 4PGGA 3H9UA 2H1RA 4KQKA 3RLFA 5CFZA 4H9GA 1NX6A 4NYMQ 3JWHA 5TMDA 2OD2A 3C6MA 1FLDA 5TPWA 4C87A 4L28A 2FQXA 4LRXA 4U7WA 2D7CA 3SE0A 2ZXIA 3DEAA 3PGA1 4YMUA 4M99A 3NHLA 1V9LA 4J8PA 5FORA 4AULA 1S4QA 3MWYW 4B4VA 4JUBA 4D9JA 1B8OA 5AJTA 5I7HA 1CY7A 3MHTA 3AI2A 5EMNA 2P35A 4DREA 2O2EA 4JBNA 2FMFA 5AUPB 5K45A 4MJ3A 2Z9CA 4I4IA 3F2BA 2B6NA 1GTMA 2GCGA 1U49A 1GFWA 2ZI3A 2P7IA 2Q1YA 2GBGA 4B3RB 4F5QA 5JEEA 2JIPA 4LCBA 2WMNB 3DT6A 1QG0A 3E53A 3B78A 1LCIA 2I67A 3FPEA 3L1VA 3LDUA 1O94A 3O26A 4L76A 3PDJA 1FQWA 5JLAA 3MQFA 4WL0A 4XPIA 4E4YA 4ML3A 2DB3A 2UVWA 1W5BA 4HAIA 3DZIA 2R8GA 4E32A 3KD3A 5CEFA 2PUFA 2R1TB 1W35A 2V6JA 7ICGA 3AEUA 1YQEA 1B16A 1D4OA 3BERA 5BR1A 1GUYA 3QQ5A 3PX4A 1RU3A 2AOUB 2XKKA 1AQ6A 3NXSA 2VAMA 4DCCA 4QREA 3IKLA 1TAHA 3AP3A 4QJ3A 1W44A 2GD1O 1M2EA 4Z3DA 3TR5A 5JZ9A 5GWXA 2XRYA 3THWB 1V85A 4LJ5A 5K9ZA 4JYZA 3H8SA 4W5QA 2JJ2A 2BCVA 2PT9A 4F5OA 5IJAA 4O29A 3AKDA 3R9XA 3AF5A 1CKEA 1XAJA 1NM5A 2ZWAA 3DMYA 1T5TA 2Y1GA 3EEIA 2DUNA 4RSRA 4KYUA 3AVPA 2FK8A 3FMVA 1GWNA 2IIBA 3G13A 1R9MA 3N8GA 4G1MB 4RZQA 2MJLA 1ARZA 3LOUA 4RD2A 9ABPA 4YMSA 3HHPA 1ZQPA 3SQXA 3OZUA 1OROA 4ARBA 4BMPB 3VX4A 1AKUA 4PSAA 3H5NA 4W1QA 5INTA 1QONA 1IPHA 1C9KA 5GGYA 1UJBA 3I0MA 4DQQA 4PGMA 3ICXA 2P2YA 3ZS9A 2Z43A 5BR8B 3OD5A 4NH4A 3KTDA 1DJLA 1CZRA 1J56A 1SGWA 1B1AA 4ZPXA 3S2GA 2JCXA 1V3QE 1JSCA 5JYEA 7ICVA 2G8LA 3FSRA 1WHSB 3DXFA 4MVJI 3JYQA 3GGCA 3MHPA 3E22A 3TCXB 3FPKA 4IDPA 1P8AA 4C4RA 2BMFA 2X42A 3ODGA 2H3VA 3FDSA 1PL0A 1P2UA 5GM1A 1QUFA 2CBGA 4K4GA 1L3SA 1NJ2A 1PP4A 2DPMA 4QRHA 2OORA 2PUTA 1TYAE 3GJQA 3QXJA 4PFQA 5E3HA 2O8BB 4ELUA 2FWMX 4GFDA 4Z0TA 4DJEC 2VATA 1X3SA 1KFTA 1G8KA 3A3NA 1IM2A 3O2SB 1H5UA 3PL5A 4TM8A 4A0SA 5JIBA 3DFZA 3DPSA 3AUAA 5DM2A 2Q9CA 3GBSA 1TUBA 4JSRA 4RIIA 3V46A 3A3YA 1Z36A 2HLDA 2I3BA 4MPRA 4YCJA 1C8VB 4EG5A 1JHRA 1H38A 4ZC1A 4EENA 1E4EB 2XYPA 5M5BA 2D6FC 1VHWA 2IZ5A 2GBPA 1UK7A 4H7PA 3W4IA 4UB3A 2XOKD 3LQYA 1FU7A 1YVRA 3E03A 3EWSA 3U37A 2VYQA 5EJ8A 1I36A 1ZXBA 3BL6A 5LLSA 2VAPA 2E9SA 2C9YA 1QHNA 3DGFC 5EIEA 3T9FA 2KJ8A 3ZD6A 3M2TA 1UUFA 1IY8A 4M86A 1PR5A 5IJ9B 1BE1A 3EC1A 2CL0X 3U4HA 4EQ6B 3MQ2A 1Z08A 4XSHA 5KG0A 4CN8A 4RNMA 1WCV1 1CQZA 3GP3A 4Z1OA 2UZ1A 3O1HB 5CX1A 5H5JA 3SX0A 4D8UA 4BJ3A 1M0EA 3QV2A 2BGGA 2BDPA 4PN3A 4DR4B 2IYWA 2Q2WA 5K03A 5DW3A 5DWQA 4CFZA 4G81A 3T5TA 5AKLA 3GARA 3C98A 5C37A 3B1YA 3GIDA 5A4DA 2R6CA 2PFNA 3CSUA 5FRDA 2NZWA 6REQA 4JIMA 1U2DC 1N5KA 5CA1B 4QJFB 2VBGA 2FDCA 3MFYA 3SHOA 1Z5VA 2BLLA 1P1JA 5CW1A 4JV5B 3SVLA 1U11A 2C1EA 1UKZA 1L7RA 1EEHA 1EQUA 2Y1FA 3DHEA 1CY2A 1JR3A 1HKHA 1OWLA 1T10A 1B3BA 1U6KA 2HRDA 1QGAA 2PTHA 4W82A 2I4RA 5JZSA 3ZLJA 1UJ2A 5CDYA 4YONB 3A14A 1N6LA 7ICNA 2F1JA 4C4SA 1TLFA 3K9HA 3QX7A 2GNAA 1YRLA 4BMDA 3MYYA 4EKEA 4YXJA 3U6KA 2WJPA 3SYMA 1UT5A 3EBPA 5H80A 1HT1E 3BIXA 4QYXA 3QSYA 3KXIA 3L9XA 1RMYA 2WOOA 3C41J 1A71A 4X6UA 2DBRA 3WL6A 2XI4A 4BO4A 5DNCA 1VG8A 1FVOA 2GWSA 2F17A 1WB9A 3QLUC 2VTBA 4Q9AA 5EJGA 4YWJA 1JIUA 4R9NA 1SIOA 3ABSB 4BOYA 4CM4B 3OZEA 1EZZA 3DWIA 5DXAA 2F4VB 3CNEA 1DKMA 3FY4A 2IU3A 3AF3A 4MCHA 1F9EA 3VR0A 1VHLA 3AFMA 4W63A 4DNOA 3NIGB 1AQJA 4NM2A 1R8QA 2IUYA 2XVAA 4EKIA 3HKZC 1G9SA 2OMKA 4GSLA 3LXUX 4LY6A 4ZVNA 3HBMA 5TR9A 1PL6A 4IIEA 2QUHA 5U1PA 4TVSA 1AMUA 1CVRA 1KDOA 4MRMB 4Y2SA 2XMRA 3RH6A 4PAGA 3V1LA 1JRPA 4FM9A 2C4TA 3KSMA 2YINC 1C4XA 1UKVY 4FDMA 3DKRA 1DIHA 4PO9A 1G291 4RELA 2JGKA 4X1YB 4JI6B 4ILKA 1NQOA 2IF2A 2RG1A 2XGGA 4IRXA 3IBSA 4LYAA 1IN4A 3NIDB 4L7VA 4N4AA 3W6OA 8ICCA 4RY9A 3BWYA 3PQ3A 3PQDA 5BV2P 3CKMA 3MXOA 3BMOA 4TLLB 4M0DA 3ZOKA 2J7PA 3EDRA 2CV1A 3R3SA 3ELUA 3Q6IA 2C77A 1KAQA 1U28A 1Y1QA 2IITA 4KI7A 1N4AA 4BBAA 3WMWA 4KFRA 2R4TA 2PTGA 4AP5A 1SHLA 5C4MA 2OFFA 1NULA 3BORA 4RTQA 5KYXA 2QRLA 2HR1A 2IYLD 4W5RA 1SKWA 3AERA 2ZAGA 1ENPA 1OPXA 2C61A 2PZAA 2W93A 3DHNA 2O7VA 3O93A 4KQ6A 2IZOA 2PZFA 4TUPA 4DL7A 4TTIA 4AO8A 4F96A 2GXSA 2O23A 3KSUA 4KB5A 1KEKA 3IG8A 1O57A 4BB9A 1L7OA 1X2IA 3G17A 1AV6A 3DUWA 3AI1A 1LNZA 4EL0A 1NU6A 2VAWA 3OKCA 1T8TA 1OT3A 1WXXA 5HF8A 5ITWA 4JCCA 4J49A 2H4ZA 4B9VA 1MIOA 2TMGA 3GZ4A 3WB0A 2JG3A 3D31A 3MUOA 3FPHA 4KHZA 2ZXUA 1NX9A 1N6OA 2QGFA 4HN4B 2KHZA 1QIMA 1F20A 3RYIB 9ICXA 3HLKA 2XUHA 4J4TA 2ZUEA 1M72A 4MKHA 3LA6A 4JJ4A 4HJRA 4JOBA 1L5LA 4BNDB 3K9FC 1UM8A 5DIFA 2HMTA 5KSPA 3N28A 2HV8A 1HRDA 1C7IA 4JOSA 1XP5A 2IDMA 3WJ2A 4D3YA 2BKLA 3GRRA 4B6QA 1I4LD 2WE7A 5CIQA 1AK1A 3T9EA 4EGAA 3BE6A 1L4MA 3TBFA 3NRCA 4UTNA 5F33A 4A0FA 2V1UA 4F4IA 2L0XA 4J94A 3O84A 2EFEB 2ZB8A 2CVHA 1G5QA 4QKQA 2WIKA 1NRIA 3T0GA 4C4ZA 2JI9A 5GJWC 1ISPA 2YZ7A 1Z00B 4Z8XA 5HJ7A 2KS6A 3K09A 1UDXA 1Y6QA 3GFRA 1V3VA 4J0IA 4R8LA 5B2ZA 4R2MA 3JV7A 3MT0A 4V2UA 2CLHB 3QMWA 2KJ5A 3ZHVA 3I42A 4B9SA 5TEVA 4ESVA 1NBMD 2XGSA 1L4UA 3WG9A 1KY3A 2CT8A 4R68A 4IIGA 5AVVA 4R1LA 3FVQA 3D1JA 3L0SA 1E9BA 3T4EA 3AL0B 4BNZA 2O6KA 1KZ9A 3B5IA 1ZJJA 5CD1A 1K8XB 5KVQA 4I2HA 2QV7A 4LZNA 2P4HX 1J7JA 1BEZA 1IAQA 1Y8CA 5KCZA 1JDUA 3PQFA 3CE9A 4Y1FA 2W9MA 2CXTA 4GLJA 4G4GA 4CKWB 4C7OA 2O1SA 4E5MA 3IAHA 1N1MA 1QWSA 3OLZA 4N40A 3QG1A 4D81A 4AY2A 3CPJB 3UK7A 4DWIA 2QMEA 2PXAA 2PE5A 3ND8A 4YRDA 4FDVA 3PD0A 4RLQA 1Y8AA 2AMYA 1ZL0A 2VF2A 4HF7A 1NQAO 1EWVA 1KJ9A 2QLJA 4FNAA 1LVHA 4NVRA 5H0IA 2AEJA 2A4KA 1Q3UA 4QFBA 4CCYB 2GWHA 1NMQA 3L7KA 4C0XA 3AMZA 1PJQA 2MINA 1LLQA 2ADMA 3T7KA 4TT3A 3A6KA 1Z0ZA 3EF1A 2J46A 4JX8A 1ICIA 4X5OA 5BSMA 5LQSA 1JZQA 1KOFA 5EE0A 5CM9C 4KE9A 5IM4A 2A5LA 3UATA 1LVUA 1P4JA 2GARA 4AP9A 1T9DA 4ED8A 3OI7A 1NKVA 5EZYF 7ICOA 5BPFA 2J9XB 1N7GA 3GO4A 2JL1A 3JQAA 4RA6A 2AFRA 3IYLW 4REQB 2MSDB 3SXUB 4U7DA 5EXPA 4BWMA 1CYEA 2AN5A 2ESEA 1XZ8A 2FN8A 3I9OA 1I1QB 2FR1A 3QX8A 3SZMA 4BX0A 1KYYA 3QVOA 1YDHA 4MS1A 5DISB 3I01M 2B3DA 5E9WA 1BRTA 4AYTA 2D5IA 3PXBA 3UJ9A 2FMQA 5HQTA 2R00C 2BSQA 3SY8A 4IMRA 3EUFA 3RVKA 3ZPXA 3RQIA 2WYVA 4Y30A 3A9RA 1I4OA 1TIKA 3JAWA 1VXRA 1BMFA 2BFCB 1L7AA 4C5BA 3I09A 2RC5A 4HXFB 1SKYB 5AOCA 3TQRA 3ZDZB 2GAOA 4A2CA 1WXIA 4C0ZA 4KLRA 4OP3A 1PQWA 1M2VA 3C3DA 4ZVLA 3ZHRA 1JKMA 2JI6A 4OO1J 7ICLA 3DBLA 3JZIA 3NVDA 1NW7A 1BXRA 3KJQA 2Y1CA 4I81A 4NF2A 4G1VA 1E5VA 4FYXA 4HH1A 4HQLA 3NT2A 4QA9A 1O95C 4IS7A 2CL7X 4G5XA 3PCTA 5F5LA 4D96A 4MQ6A 4X3PA 3WK5A 1RRCA 4O4JF 4BO2A 3TB4A 3DBLB 3GJ5A 5K3AA 4XX0B 1MW8X 1LC3A 2YC4C 1APBA 1O89A 3G1TA 5F7XA 3S2ZA 3C6QA 2DM6A 1P2BA 1JW9B 3BFKA 4NDNE 4ABYA 1K7CA 1CDDA 4Q16A 3GNTA 2C1XA 1N3IA 1DRUA 4ZPJA 2O2YA 3NM5A 3PNCA 1NFQA 1YC2A 5KYVA 4QWBA 3RIEA 4X95A 2D62A 2PUWA 4F91B 3VJMA 4BV2A 2E2WA 3QMPA 3RSFA 3PTAA 4EG6A 3Q8KA 4QPJC 1LF0A 2YYYA 4QGSA 2ISOA 1ZH6A 2HD4A 3BJZA 4HLDA 4A7PA 4CTNA 3L7LA 2WF9A 1XKLA 3I9KA 4ZALA 4UBIA 2BUBA 5F2NA 3WK6A 4M1ZA 4WBNB 3WGKA 4F4CA 1A7JA 3HH8A 3H0CA 2JW5A 3PHIA 3LC1O 1PFQA 3AVOA 2H51A 2P3LA 1JNYA 4QARA 5DX0A 5AOVA 4BP3A 4QWDA 3OUZA 1J2EA 4KIFA 4QDZA 4INAA 1ENYA 2KMDA 3U7GA 1U90A 4JLOA 1RXEA 1YZ3A 5ETJA 1LNSA 2C4KA 2W9CA 2W2KA 4GQBA 3OJOA 2VBCA 5LQMA 3GCZA 1X9HA 2W8BB 4EB0A 3F8SA 1C9EA 1G42A 1VMIA 2R4UA 2KPOA 1YJ5A 3KYCB 1TPZA 3R6TA 3TZ6A 2R97A 1BIFA 4QBGB 1ZICA 4HJXA 1GEGA 3CZ4A 3EIHA 4CM6A 1RZTA 3AWDA 3CW2C 1WZUA 5KYNA 1RP1A 1PZEA 2QRGA 2NUAA 4IKPA 4YALA 4PVDA 4OXXA 4BO3A 2GFHA 4AXBA 1DEKA 3G89A 3JQPA 2SECE 3DV0B 5H1YA 5REQB 2DXIA 5DTJA 4LXGA 3IV6A 5DOZA 4FKZA 4PU0A 4R65A 2X3FA 2HHSA 1U3TA 3PNOA 3VAAA 3GBVA 4LCEA 4WSOA 3RD5A 4YMOA 1I3KA 1PIWA 5DM60 3LPAA 3NDBB 3THXB 5DBGA 2PMCA 1Y5NA 4I50A 4MRPA 3HDGA 2BC9A 3H99A 4J1NA 4II7A 4QG3A 3SC2B 3VZRA 4MZDA 1CUYA 3ODPA 1GCUA 3C3WA 2NG1A 2Z2KA 2N75A 4URYR 2H1WA 3FR7A 4P82A 1NW8A 4Q7JB 4LISA 1FBNA 1XA0A 5E9JA 1HL7A 2R44A 2C7OA 3HBNA 1JLKA 2I65A 1K6XA 3SS7X 1XN4A 5CWRA 1BO6A 2JVJA 4IDFA 1B73A 2WJ3A 4L16A 1QUEA 1ZK4A 5FFNA 4ARAA 1ZD8A 3MTAA 1T3GA 1XC7A 4AY4A 4ER0A 1BE0A 1EVKA 5J59A 2I6QA 4YROA 1V96A 3WB9A 2XO7A 1VOTA 3PB3A 3QKTA 4IQVA 1TU4A 2PFQA 2RQ5A 1YE5A 5BUSA 4IQUA 2R5NA 4AI6A 2FU5C 3DDZX 3MJEA 5FR1A 2KK0A 3RI3A 1JQBA 1UAYA 1Z5PA 5A05A 4QDXA 2IYQA 2I9KA 1RPNA 2Z9DA 5H3LA 4BZPA 1DTWA 5I47A 4M3NA 1C0PA 3GILA 1RWOA 2ZBPA 3NWBA 2AD1A 4W7IA 5I8PA 3SHTA 3G2LA 4BEJA 1O0BA 3GLTA 3OAAD 1Y9EA 4WLUA 3U60B 5BMVF 3DOFA 3M6XA 4LI0A 4U5QA 3EGOA 4KJZA 5E6UB 1WWUA 3LU1A 1WP4A 4L9RA 1OVMA 3LYLA 2R4QA 4OM8A 3VZQA 1G41A 1SL0A 4GVLA 1Q7TA 4HFRA 5HE9A 5BN4B 2Q9BA 4EFMA 3QU7A 2R8ZA 3KELA 3O3CA 3NHYA 3ZNOA 1ND5A 2OM6A 1CY8A 5T7BA 3NAQA 3F78A 2H1FA 3F6CA 3LIPA 4HNGA 4ZT3A 3I62A 5KSYA 5ALWA 1AVTA 1JYFA 4Q1CA 1DIOB 5G40A 1VPDA 5IC5A 5AI5A 1RRFA 2CL6X 2C7BA 4RT2A 4LNAA 2KQUA 1I2MA 1KKMA 1VKZA 1A50B 1Z5OA 4RVHA 4NBTA 2OXEA 4ZTBA 1T2UA 2H3HA 4KQIA 5FBRB 2XCAA 3OX3A 4F4FA 1KPIA 1Q1ZA 3M4JA 1RBZA 3PHGA 4K8OA 5DEOA 2L2QA 5EHGA 1MSWD 3UAWA 3VYWA 3VOAA 1UADA 1SKSA 1QH8B 2D1TA 2RC6A 3C3BA 4YJ2B 2AFIB 4J43A 1PJLA 2HF2A 2XZOA 4F46A 1G7TA 4AD8A 3L92A 3UMFA 2JH8A 3FPSA 1YJXA 3GHYA 3ZKWB 5A7FA 3DZDA 1G6HA 2IEBA 2VF5X 5E1DA 2IOYA 1AQIA 1MZVA 1PEKE 3KYJB 4GOOD 3M1YA 1YE3A 3LO5A 4DW8A 2RHTA 3WLKX 2QX7A 4AYWA 3IAM1 4UOQA 2QMUA 4JITA 3UT0A 3I2FA 1U7XA 2BH2A 4XUSA 5CEHA 4HDSA 1SU8A 4XOUA 4OYRA 3JPYA 3GLFE 3CEAA 1K4MA 1L5WA 4OHRA 2WWYA 1JMKC 4FCTA 4B3FX 2H2FA 3WOHA 5CITA 2HO4A 2QP4A 4WX2B 2NVUB 3T0IA 3VPHA 5CAEA 2OV1A 4UVIA 3V8VA 4I3FA 4EFLA 5LMCA 1DKQA 3ZY4A 3Q8QB 1IUNA 2L5YA 1H85A 3UPQA 1JDPA 2FZWA 3AJAA 1XAIA 4BZQA 2YRWA 3CCFA 3JWIA 3M6UA 2YFQA 2QTZA 3HDQA 3NIFB 3MJTA 2FEOA 3P9NA 4AMVA 2W9AA 4DQ0A 1WM1A 4F4UA 2C07A 9ICVA 2ZS9A 4XIGS 5HX7A 4DYDA 4EJFA 1U0RA 5K0GA 3CO0S 2HMAA 1EH5A 3TQQA 3TVDA 4EJSC 1BC5A 2OCBA 1PJ4A 2KMLA 3BT7A 2B7BA 1U9IC 2WSLA 1WRBA 3CC8A 3DO8A 4XX1A 4INPA 3RUCA 1Q50A 4ODIA 4E2XA 4ED1A 2YY5A 3QM1A 4QAJA 2UYQA 2XTMA 3DNPA 1FK8A 1YZKA 2RH8A 4JC0A 1HEIA 4NABA 4DOCA 1Y4SA 2UUPA 4ARSA 3LDAA 3OHSX 1P45A 1E8NA 3AESB 1TFUA 4N01A 3UQ2A 2QHXA 3TIXB 4US9A 2LPMA 1KI7A 2I2WA 4UDOA 5F5XA 3A70A 1XN1A 3DEFA 4XWAA 1ZW6A 1XQWA 1UMKA 1WCNA 3ZGXA 1O54A 1FVXA 1T9HA 4Y1GA 3MCWA 4ZI3A 1WD7A 3OICA 1KL9A 3DSRA 2X8AA 3OZ7A 3MYRA 3R6GA 3R5HA 4DA7A 5CB4F 3EWNA 4JHLA 3LQKA 3MTDA 1R0SA 2Q0SA 1RPAA 3QBJA 5FP0A 5KT4A 2BUCA 4YRBA 1EXDA 4OQNA 3S2SA 1EDBA 2O3JA 2JH1A 2ZIAA 4WW0A 3WWDA 4RFSA 4DF4A 4I2EA 3Q87B 1Z0IA 3KL2A 3DC7A 2GO7A 2O3SA 4QFMA 2HLHA 5F73A 1CZOA 4KXXA 3GLGA 2PUCA 4QOIA 4O5CA 1KYIA 1L8XA 1WVGA 1GV1A 2COKA 3AKCA 4OAOA 3HTXA 4UCQA 1G6Q1 2ASJA 2RGAA 2CWWA 3KT6A 2HPVA 1XIVA 4HEJA 4ALJA 3DFFA 5AT1A 1NU8A 3QGMA 2DECA 3TXYA 2C97A 3VYUB 2Q8QA 4NY8A 5DX1A 3T5KA 5GIOE 4Z1MA 5A4IS 3A26A 3RYCA 3JRWA 4CLOA 1XDUA 4QTYA 2AB0A 1GQFA 5SYNA 3WGQA 4NAUA 3UENA 1FUKA 3IAM6 3VSAA 4DLVA 2IK8A 3VH3A 1XD8A 3NTLA 5LP6A 3LKBA 4QZFA 3MWEB 1Z7BA 2N9UA 4QOGA 1S01A 1DRJA 4XI9A 1IONA 3KB2A 4FHEA 4YXFA 1TVEA 1YJAA 4TN1A 4D5EA 2EBHX 2ES6A 5FNZA 4IAOA 4WJLA 3FAHA 1M34B 4EI8A 5LQCA 4G0YA 3W9YA 4YCNA 3MTJA 4ZYXA 1YZFA 1EKXA 1IM4A 4KL8S 4NFHA 3VM6A 1Q0RA 1YKSA 3CURA 4GNRA 2Q4TA 1SKMA 3QTLA 1Y3AA 2AV6A 1XNQB 1O1YA 2GFIA 2V65A 3W2HA 3UK0A 4FZJA 3WLOA 2KHVA 4X8OA 3VCBA 1UDBA 1LFAA 2QYTA 1PVPA 3NALA 4WNCA 1R4NB 2JJ2D 3R5XA 4TV8B 1LB2B 4B73A 3OFVA 1P9OA 2ZSDA 2GZSA 2ODWA 4J9VA 4TL8A 4X94A 2ZYUX 3GFQA 3H2IA 3GFSA 3EMKA 2R751 3U7QB 1FFXA 3OIUA 2LI6A 2IHTA 4BVJA 1SKQA 2NACA 3PQCA 2MU1A 4DOMA 2ZI7A 3IEKA 4JD5A 3QP9A 2OCDA 4N0EA 4R9SA 1DOAA 1PNRA 2HW3A 3GY0A 3OIVA 3KOXA 2CDRA 4HY3A 5IH3A 1L5MA 2RFLA 1NZFA 3I83A 5DP2A 4A03A 1T0JB 4GBED 1XWFA 4H59A 5KVCA 2WHPB 3AEXA 3NAGA 1Q15A 3BQTA 3N97B 2A0UA 2QGZA 3I4CA 1UL1X 1LSSA 1Y34E 2YVLA 2ZCUA 3HKEB 4RQ6A 3QBTA 4RMGA 4TZTA 3HDTA 2PUEA 1PFUA 3EGXB 3BWDD 3DZFA 1UZAA 4XR9A 1GG2A 3W5HA 4RJ2A 4RSMA 2YJNA 3RTEA 2Q5CA 3DFKA 3G0DA 3W9UA 1YDWA 4AQ7A 3H5OA 4ZQIA 8ICVA 4PHEA 3EIEA 4M7PA 3W34A 2I3DA 3KR1A 3D3KA 4MYTA 5E6SB 5FPKA 3QVGA 3VZDA 3T5LA 1Z4QA 2ECPA 2GLTA 5LBIA 3TG2A 3J81A 2CDCA 3D6FA 3RBXA 1L5YA 5AKJA 4BU0A 3F6EX 1XELA 3T5HA 2NZJA 4KGZA 4N9QA 4CG3A 4HYTA 1G8FA 1W0KD 2GJ4A 3VSBA 3HX0A 5JSFA 2X0KA 3EXHA 3V9PA 2JLVA 4AJOA 4GC5A 1W4CA 2H3FA 4DFMA 2NRZA 1RAHA 2CFCA 1EZ4A 3BXHA 1N2BA 3F9RA 9GPBA 1YS7A 4Q66C 2H4FA 2QORA 4LHEA 3VO9A 1WCXA 5C4IA 1V6SA 1KFCB 4MQUA 3DDCA 2VJDA 4D4LA 4HLUA 3DKPA 3U7JA 5A3SA 1NQVA 4FOPA 3EISA 3EF0A 3KWLA 2HSJA 5TDHA 1A3CA 1MENA 1PZXA 4FOSA 4C01A 5KFNA 1OI7A 3SNHA 1E0AA 1B14A 1RYEA 3D59A 4B3DA 4GU5A 3PR4A 3Q7IA 5M3BA 2QPLA 1EAMA 2PFGA 4ECAA 5IIMA 5IG2A 1KO1A 5KTSA 4XWWA 4N5IX 1P7DA 5E2AA 1E6WA 4G89A 1E62A 4DF3A 2GNOA 4TMXA 4I4NA 5KTQA 4R83A 4HOYA 1QZXA 1IG0A 3MF4A 3FX2A 2D2IA 1A1SA 1OA1A 3HB9A 1EXMA 3LXRA 2JK1A 3OIGA 2DVMA 3ORQA 4FGUA 4P1ZA 3T7JA 2WUVA 2Q2OA 3O3NB 4Q3NA 2OPHA 4BVLA 4C29A 5ABPA 1MH1A 1Z9BA 4KNYA 5ADUS 1SEPA 4DLEA 1ACMA 1I3LA 2RHFA 3DBRA 1U0EA 4JUCA 3W6UA 4XQ0A 3PW0A 3AJ9A 1USVA 2NTJA 4NBNA 1G0OA 3PD1A 3RVRA 4WFJA 4CEIA 1GAXA 2P90A 1XZPA 1HZZC 1PQPA 3FDXA 4CWAA 4KK3A 1CRLA 5BOLA 4UBBA 3SBEA 4YAOA 3UJPA 1I5OA 4BX9C 4DC1A 3ZDXB 5LMZA 4F4YA 3E2MA 3AHGA 1YCGA 3DMNA 4EBFA 5DBBA 4XUCA 2I1QA 2DPJA 1BA2A 1A95A 1UK6A 3H9EO 4I8DA 1RPJA 4ZCPA 3RVNA 5JS6A 2QT9A 1ISFA 5G41A 1GRNA 2XOXA 4ICAA 2OBNA 4BKRA 2GH1A 4F6LA 3CV3A 5BWNA 1GQQA 2YICA 2PGOA 3CT6A 5ARDA 3SYNA 1U0TA 2Q6IA 2GM5A 3M3DA 3TAUA 1V7QA 4CM9D 4N48A 5FTLA 5DI3B 5DBAA 3D0OA 4HVTA 3WGJA 4CEIB 1SG0A 1ZNWA 2O7SA 3J7TA 3TXXA 2JKZA 4HNSA 3OP1A 4MP8A 4E11A 2B7CA 2WSBA 1R16A 4A2PA 1FY2A 5K4LA 3I9V1 5E79U 3NVMB 4JKIA 3TLCA 1G59A 4NLCA 3FCXA 2HWWA 3CCBA 3GVPA 4GSKA 1ZJNA 3HRIA 4R8VA 3C3JA 4YMGA 5BP7A 2LIVA 4TKLA 3DE0X 2XUKA 4FFOA 4I4TF 4MO2A 4X3OA 4ECSA 3IAS1 4ZYZA 1ZQSA 3G82C 3GCWA 5IPFA 2P3QA 4MWSA 4NBVA 4RVFA 2CUZA 3S2FA 3ZNQA 3VO1A 2QVYX 2H4JA 1GUAA 5G0UA 1JKIA 3RK0A 3VOBA 3DULA 4UTXA 2XXAA 1WULS 4LVUA 4LXUA 3U3JA 2C78A 4PXSA 4LDJA 4CR6A 5IYZF 1KY5A 3UJ3X 3P0HA 5LIRA 1FDWA 4YT5A 5IYZB 4QZ8A 4BX8A 1DBWA 1E89A 3HN6A 3RAXA 1M8KA 2CEKA 2J0EA 3FUTA 5DTRA 1ZIOA 5BO5A 1JH9A 2FRVA 1AU9A 3E22B 3N2IA 2ATXA 2W2PA 3P0FA 1ZRMA 4MB6A 1F5SA 3EE6A 2WR8A 3CHYA 4U00A 1P7PA 2C2WA 3SF8B 1PKXA 4IMIB 4JI0B 5ICEA 5JSZB 3EQ2A 4BNWA 4U2CA 3HCFA 3Q2IA 2B5VA 2YW2A 1CI4A 2PX0A 4IHQA 5JROA 3CU5A 5JCJD 2ZSIA 4CN9A 4DV3B 5HILA 4ARUA 4N5MA 1G4HA 4MZXA 1J2JA 2C3MA 5EJ2A 4BYGA 1N33B 3BJYA 2ZT8A 3CPEA 4WADA 4TTTS 5JR3A 1NVFA 5DQGA 1DGQA 3FBTA 4DLGA 1OZAA 2RHDA 1VL8A 2Q49A 4IIJA 5K1ZA 4TX1A 2PFSA 3L0CA 1J8FA 3ESRA 4QU0A 4AL4A 5IT4A 3PD7A 1PV4A 2DFLA 1K89A 1ID1A 1L7EA 3QUBA 2JFWA 3DE6X 1AT1A 1N3LA 3N2ZB 4JAVC 4NBSA 3SP1A 4B81A 4BZZA 2EF1A 5BXQC 5KYWA 4JK1A 3OIFA 1BKYA 4MUYA 1PT6A 2H4YA 1U47A 1QAOA 1VE5A 2HV9A 4RHFA 3A4LA 4DEYA 2ZBQA 3PKZA 4HAVA 1T4CB 5CJPA 5B1HA 1MOZA 1S0VA 2WICA 1RZ3A 3MW8A 3WGHA 2B69A 3N0VA 3JQ6A 4GZ3A 4RYLA 1OUQA 2NYUA 1L4LA 3CX3A 5KQPA 4G0VA 1KKUA 2BIFA 4KQ2A 2IFTA 1XNJA 2MMCA 4MIYA 4L4SA 4IHKA 4YO7A 1OJLA 1BPDA 4AYBF 3ZVRA 1Z12A 4W5OA 3H9GA 4H7JA 1SKUA 3LL4A 4W5HA 5DYIA 8ATCA 4YHHB 2FB9A 4UAYA 4IJUA 1F2TA 1X0XA 1WMAA 1COWD 2JFFA 4YV7A 4IJ6A 1IHPA 5KFLA 3EGCA 1ZQXA 2VWPA 3GWZA 3LCJA 3WTCA 4DUGD 3TJMA 2H7YA 4RDXA 1GITA 1YC5A 1E66A 3EARA 1BA3A 5I7EA 1T9KA 5GV7A 3FOCA 1QHEA 4Q39A 2AOWA 2O14A 2PT5A 3ADKA 3LC7O 4ZOAA 4RXUA 4BJ6A 5EJEA 1IMJA 4P7JA 4UVEA 4G5FA 2RH9B 3FZQA 3KR2A 5K8IA 4Q9JA 1SM4A 1XAHA 3GAFA 3OSUA 2EAPA 4CTJA 5HW0A 4D46A 5A0LA 1JYEA 4PC3A 5EWEA 3VC8A 1RIIA 1I3CA 5FTWA 4DO9A 2PZJA 3U40A 1ZQLA 2WD8A 2R8BA 1G20A 2AKEA 2BTEA 1PV1A 1GUZA 3NANA 2YXNA 1RJDA 3SAGA 1IWOA 1UBKS 1LK0A 4CF5A 3STYA 2XH8A 2ZU0C 2Z5FA 1N5MA 4B4UA 1JSXA 2OEHA 1UPUA 3K1AB 3C70A 2UZ3A 2VWGA 1SUSA 3IODA 1N0VC 1EUYA 4PRLA 2QTGA 3Q9SA 1PYDA 3LOQA 4LQLA 3C3XA 3CZPA 3QF4B 1UC5B 2CFTA 4JU9A 1ZBDA 2O1EA 3KHSA 4N3NA 4NG4A 1JEYB 2DLNA 3AR8A 4K0RA 1TM3E 1C8LA 1J2RA 1VE7A 1L5HB 1MB3A 1T5OA 4PXAA 5HQJA 3H1FA 4F5YA 3T7DA 5EY5B 1XK7A 4KXQA 2OO5C 2ARKA 3NB0A 4LC9A 5DHUA 1ZMXA 3F7OA 1I6WA 4RDIA 3DVAB 3K6RA 1L5HA 1AXGA 1TEXA 4WBNF 1CF2O 3JWJA 3KKQA 4KAJA 4KWTA 1OOEA 4H7KA 4DY4A 5IMSA 3ETEA 1N9GA 3H7IA 1DGJA 3FYUB 4X0EA 1QV9A 2A9JA 4NSNA 2XXJA 2OV3A 4LY9A 4PLFA 3T4UA 5CXXA 4DKJA 4PL1A 1ZD3A 4DSIA 3KFUF 1NVMB 3H42B 1FTSA 3I04A 4ND8B 4QSMA 5CB0A 1I5EA 3TKAA 5DHRA 3ANLA 3SFVA 5ISMA 1AHIA 4RH1A 4K1LA 4ZTZB 2HDHA 4UHCA 1JEJA 2C54A 1SULA 5D3MB 4ZVQA 3DWFA 4JS0A 5AICA 5THQA 3CPSA 5JSZA 3RRGA 1NW9B 2A0XA 4RIHA 2ZIFA 3MCVA 5KAIU 4YRQA 3W3AD 3SI8A 2G40A 2NVOA 2PRKA 3EDMA 3WYCA 5K4GA 1IFXA 3LHIA 5GZ3A 2GN8A 1MIOB 1U31A 3IDAA 5A6VA 3GA5A 1CVLA 4GXKA 4E2ZA 5I7FA 4C4YA 4B4KA 4XLLA 3R41A 4ND5A 1KE1A 4JR0A 3GFKB 1F8GA 3JPNA 1SCNE 3K4HA 4MGHA 4MDHA 2JHDA 2XKJE 1F0KA 3NM4A 3U3DA 2J0QA 2X8BA 3CY6A 4LQCA 4C2AA 1CS0B 2ZS7A 3ETJA 3F3MA 4KWIA 3SYRA 3LCVB 1OFTA 3ICCA 3ZIAA 2OORC 4EPVA 1YZVA 2Q7XA 3G5TA 4YH1A 4JUZA 4V39A 2GBFA 3USES 3NWPA 4HWSA 4O2BB 2HAEA 5JZMA 1KJJA 4GM1A 3RASA 2YJ5A 2HYIC 3HGTA 1GD1O 3RGWS 1BX1A 2UVQA 1T26A 1UPXA 3OT1A 4NLLA 2BDTA 4TTSA 2YQEA 2IIPA 2QA5A 4IIFA 2RGUA 4S24A 5DYYA 3TTUA 4BUJA 2GJ8A 3TFOA 2IBSA 4JMLA 1H5QA 3G0OA 1DINA 1RM6C 2AVDA 4L4UA 2GZAA 3C3MA 4J2OA 4BWJA 1Z0AA 2XEDA 4WK6A 1ZCBA 4RY0A 2CJXA 4PHGA 5T6MA 1Y37A 3V9AA 2O8EB 5ER9A 3L82B 2OHJA 1CR6A 2CVPA 4RETA 3H05A 3F90A 4UU8A 3E3AA 5F7OA 4TMTA 4EB6A 1I3NA 2NUTB 3EPGA 3H5AA 4W5TA 5GIPE 4DFPA 3TDMA 3BHJA 4OLHA 3GUYA 1I4WA 1SCAA 1WMEA 2CXOA 3WZMA 3GZFA 2AUMA 2XTNA 3R24A 4DKXA 1QJ4A 2WU0A 3HYSA 1HURA 1OLXA 1T6XA 2YDYA 1YDEA 2XOEA 4HXYA 2V58A 4C8OA 3V42A 4C0AC 5BR7A 1XA3A 1VPWA 2KVSA 3JVEA 1V97A 4QNLA 3HU1A 2EGUA 3GHHA 4Q9IA 4RC9A 1XLVA 2G7ZA 4UB8U 1N6HA 3WI7A 2DETA 4AIRA 4FHGA 4Q19A 5AM3A 1DJPA 4C06A 2B0JA 3HZRA 1Z15A 2MSNA 1ZK1A 1VE3A 4J7CA 1E9EA 4KGVA 3WOVA 5L9AA 1GTG1 4RTMA 2VH1A 2VH2A 4R2LA 1O77A 1O9HA 4P2HA 3AM9A 5KG1A 1T1GA 8ICLA 2ZGVA 3UO8B 3DZHA 4D9MA 5B58C 4F4JA 1E2PA 4MCJA 1SHKA 4N03A 4W6QA 3OTQA 1Y5MA 1P4RA 3PUZA 1QYRA 2PGJA 3PHJA 5C31A 1X19A 3MR2A 2Q5IA 2RBKA 2YV3A 3O8LA 1U0SY 1LKZA 3ZTYA 3R0QA 3W5BA 1Z3EB 3DOCA 4G8BA 4P54A 5AKXA 4EBEA 2NV0A 5AW4A 4U6PA 2QU7A 4X3CA 2EQYA 1E8MA 4YS6A 3ANYB 3ZR4B 1LRKA 4JI3B 2EL7A 1GQSA 1VA5A 1AX9A 2CHUA 1YUMA 2WYUA 5FXMA 1EXVA 3H19A 1MQ9A 5J40A 2FFBA 3FYUC 3IAS6 3N2GB 2HUNA 2M2IA 4MV0A 3GQCA 2DERA 3EVZA 1J9ZA 1TA0A 4P32A 3C8MA 5HF6A 1F5NA 1MBZA 1O2DA 2AJCA 2HSEA 3PSFA 3UT5B 4RJKA 3CFYA 4BWVA 2QTFA 3WAJA 1WZNA 3OX4A 1A88A 1OPRA 1PGNA 2YRFA 3RIMA 1T8EA 1JBQA 1WNTA 3V1YA 2R7KA 2ZE8A 1OF1A 1NI4B 3AJEA 2YFKA 4UUPA 4WGGA 5AM2A 3NC1C 2QAGB 5AVQA 1ECFA 1VL0A 3UAYA 2FPUA 3N76A 1W9MA 2B8JA 1NPTO 1SCJA 3MGCA 3Q9NA 3U9TA 2IH2A 4MV3A 3N2KB 2QB0B 1CR1A 2FF7A 4I6EA 3TD6A 2RONA 4PANA 1W30A 5CFNA 2GBLC 1HETA 3HCAA 4ENWA 3LC2O 4ME6A 4FJ1A 3RB4A 1FFWA 5L51A 2OFPA 3F7MA 3R9WA 1XLTC 2JH3A 4RFVA 2A1TS 1IUOA 4HDNB 1AS3A 4DCTA 5F98A 4XYLA 4ZYYA 3SX4A 3MFIA 3QPWA 1ZOSA 3CVUA 1UXJA 1E32A 1X86B 2DBQA 3BWMA 2NTEA 3GH1A 1NUQA 4QXQA 1HG1A 4GNKA 3VX3A 2XITA 3SYTA 4D8WA 5IF3A 1DT3A 4PL2A 3GYGA 5I6DA 1YFJA 4TLBA 4N5LA 2O0LA 1HV8A 4B8YA 5T41A 4LE0A 1R15A 4EG3A 1ZQTA 1ULBA 1WV1A 2GF9A 3DT8A 3AVWA 1KMHA 4KXFB 5ILGA 1OREA 2A0KA 3O4JA 3SVZA 1SZHA 1KI6A 1ZVMA 4ZQGA 1XT6A 3OZFA 2BKVA 5JXJA 4IZOA 2V4RA 3BULA 4MV6A 5BW6B 3SJBA 3RYCB 3EPPA 2Y1XA 2IY9A 1AIPA 1N2ZA 5L4NA 1DPFA 1UPBA 2H29A 3KUKA 4WLEA 2PRJA 3ZDQA 4XB1A 2F3RA 3T3OA 2HA7A 1BPYA 1K98A 3DEEA 3M9NB 1NRJB 2ZROA 2NUTA 4J7UA 2F76X 1N61A 4Y2HA 1NQTA 3ORYA 1ZXXA 4D9EA 4EH1A 3AILA 1GPDG 3FSGD 1R6AA 1FDIA 1I0ZA 5B7GA 4Q5IA 2A57A 2R8RA 4QBHA 3SMQA 5E4YA 4DPKA 2ECKA 4EY4A 1EJBA 3IVMA 1NI3A 1P5RA 2OH2A 3D2LA 3KJEA 4HK4A 1PK9A 4P4LA 5FBKA 3X1WA 4BQPA 5IWAB 4A15A 1QMPA 1SBZA 1W8IA 3IHQB 1GUDA 1ZI9A 2WWGA 3JWGA 3LX5A 5J47A 4IGFA 2Y9MB 2VT3A 2VNSA 2X13A 5H83A 3O83A 1IHOA 3N5CA 4TS3A 3JALB 2C2DA 1XEAA 4EEKA 2CLDX 4IX1A 5ELXA 1J9EA 3UUGA 4G56A 1EVLA 1K0FA 4AZ3B 1LV5A 3N0TA 2CNNA 3TL3A 3H6KA 3UN1A 3H97A 1DG1G 4UAUA 3FZYA 3IPLA 3ZHBA 1RYZA 1VE1A 3CEHA 1Z8DA 4LZJA 4HLQB 5L1LA 5IT9A 4BASA 3MAAC 1YU6A 3HJBA 4NYJQ 4RV9A 1M1XB 1M8JA 1QX3A 1V5GA 3FB4A 4G5RA 5JNWA 5JH7B 3G6KA 1J5PA 4F9EA 4DV1B 1HA3A 1C1HA 2G9QA 4HBZA 1SG6A 4MKZA 2BT4A 3UW3A 5AWFC 4WESA 4Z4CA 2X76A 3K9LA 1TI7A 3TGWA 1LPSA 3NTQA 1UBHS 3NTOA 2WTBA 2R6JA 2ZAYA 4GPTA 1XPRA 4BQEA 1GXSB 3EXAA 3ZXSA 1LFDB 2QRJA 2DGDA 2FFQA 2FLPA 2C96A 3TAHA 4ELVA 4KODA 4YP6A 4QWAA 3ZS8A 5CEJA 5K01A 4B31A 3CXRA 2HMUA 3MRSA 3MWLA 4QUDA 4ZZ2A 1GHTA 1YOVA 3TUJC 3BRCA 1MMFB 2EGHA 2O2ZA 1RPLA 4I5GA 4G4IA 2GFQA 2FHSA 3BD6A 4RPXA 3Q41A 5B3KA 3T0FA 5LDDC 2XY6A 2PAFA 1NAHA 5JAUA 4YPFA 3L4KA 4G8JA 1JSLA 1P1KA 3DCNA 3G7SA 3V7FA 1BEEA 4S12A 1V2HE 4CMIB