3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords PF00702 domain protein
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
3ET4A 4NWIA 4F71A 1RLMA 3L8GA 1L7OA 2G06A 3AR6A 4UMFA 4YCNA 2IOFK 3DV9A 2ZBGA 1X42A 1CQZA 4KX5A 2G09A 5AI6A 2ODAA 2GFHA 4Y2TA 3QU2A 2WFAA 1WPGA 1Z4OA 2BDUA 3W5AA 2I54A 3KZXA 1AQ6A 3M9LA 5AKEA 4IFTA 5AK4A 2HF2A 5AVRA 2P27A 2C9MA 1TJ3A 4AS3A 3WK5A 3QXGA 5AW3A 3CNHA 1WR8A 3DAOA 3PGLA 3MC1A 4IG4A 1PW5A 1RMYA 3E81A 3EPRA 3E8MA 4KNVA 3OPXA 4HAIA 2YJ6A 1KYTA 3DNPA 3BA6A 3N8GA 3NALA 4Y2YA 5AKKA 2YJ4A 2ZOSA 5AKHA 3L8EA 3WGUA 4EZEA 5AVSA 3U7GA 1FEZA 1L7MA 2GMWA 4RETA 2R8XA 1Z4QA 1XP5A 2CFRA 2I55A 3TLMA 1LVHA 5AVUA 3QU5A 3S6JA 4ZEWA 1YV9A 3AR3A 5AKJA 1RQNA 1K1EA 1NNLA 5AI9A 3QUTA 4QJBA 3L0BA 3NASA 2JAOA 3KDPA 5ALOA 2FPUA 3QUQA 2WF5A 4J2TA 5AKIA 3ZTYA 1Z4JA 3WKAA 2CFSA 2G08A 5AM0A 4AP9A 3SKYA 3ESRA 1N8NA 1RC8A 5AI4A 5AK3A 2D2VA 1NF2A 5AVWA 3IB6A 1RQLA 1VJRA 2WHEA 3AR7A 3R9KA 3ZWDA 3A3YA 5AW9A 5AVXA 1JUDA 3WK9A 3ZVNA 1VJ5A 2HOQA 4CF5A 1Z88A 2RAVA 3U7FB 3A1CA 3N1UA 3NAMA 1Z4IA 4OHFA 3U7EB 3EF1A 4KNWA 3BWVA 2RBKA 4OFZA 5AM1A 3E84A 3OCVA 2Q4RA 1Q92A 5A3QA 3W5BA 5AHXA 2VKQA 1L7PA 4F72A 4BX3A 1QYIA 3N5KA 1RKVA 1L7NA 4Y2XA 3B9BA 1ZD4A 3GYGA 4AS2A 5AW1A 1SU4A 3AR9A 4UMDA 2QLTA 4HGPA 4YIHA 4CE6A 3W5DA 5ALKA 2C88A 4Y2SA 3WGVA 5AM5A 3L8HA 5AKLA 2DQSA 5AVQA 1EK2A 3L1VA 2FUEA 1YJ5A 3I6BA 4YCLA 4L57A 4Y2VA 3I28A 5AM2A 2C8LA 5ALJA 3OCXA 4EX7A 2FPSA 4NABA 5AM4A 4Y2QA 5IS2A 4Y2PA 3VAYA 2MSNA 5AK6A 4NV0A 2ZBFA 2FDRA 2HI0A 3NUQA 3KD3A 5ALNA 1YMQA 3ESQA 3ZX5A 4BNDA 1YDFA 3WK8A 3SF0A 1U7OA 2JAWA 3ZWKA 3R4CA 5JJBA 4YCMA 3R09A 4UASA 1S8OA 2HHLA 3CZ4A 4KN8A 1RPZA 3E58A 3FPSA 2FEAA 1QQ7A 3ED5A 4G9BA 2R8EA 4MUMA 4BKMA 5AW6A 3ZX4A 3UMGA 2NO5A 4HGNA 4XE5A 5ALXA 2I7DA 3NIWA 2IA5A 3I1YA 4UAVA 2P9JA 2ZG6A 1U02A 4UATA 5ALHA 2HDOA 1F5SA 1TJ4A 2EARA 3A1EA 3HYCA 2HSZA 3FPBA 3QYPA 4C4RA 3ZUPA 3J7TA 4G63A 3NRJA 5AK5A 3QU4A 1U2SA 2JAUA 3PGVA 5ALVA 3L7YA 1S2OA 1ZJJA 2CN1A 1ZRNA 3UMBA 4DW8A 4ZEVA 1Z4KA 1Q91A 4FE3A 2B1RA 2OA0A 2YY6A 2QYHA 3WKEA 2B30A 4Y2JA 5AVZA 4CF3A 4C4TA 2JARA 3QLEA 3U19A 1ZD5A 4QQFA 1J97A 1LTQA 5AI0A 3A1DA 3FGOA 2IOHA 3L1UA 3U7HB 2WF9A 5ALLA 3FZQA 4UMEA 3WK6A 5AKZA 4HYTA 1VFPA 3QU9A 4L6CA 1L6RA 4YH1A 4PNHA 3U13A 5IT0A 3AR4A 4O8CA 3DDHA 3AR5A 3OCYA 5ALUA 2P69A 5AIAA 3UM9A 2PKEA 1ZD2P 1RKUA 3MN1A 5FP0A 1IWOA 1T5TA 3AR8A 4RESA 5ALPA 3QX7A 3IJ5A 2NO4A 3ZVLA 1Z4LA 4Y3UA 5AESA 5ALTA 2YMLA 1RMTA 1ZS9A 4OD0A 2G07A 4CNQA 5ALMA 1RMQA 4DWOA 4UU0A 2YMMA 4BX0A 2FPRA 2P11A 1ZRMA 2WF6A 2AUTA 1WVIA 3WK4A 1RKQA 2X4DA 4YIKA 1RLTA 4HGQA 4DFDA 3WK7A 1ZD3A 5A3RA 5A3SA 3EWIA 4B6JA 4L6AA 3SKXA 5AI5A 5ALSA 4I9GA 4OCZA 5AVVA 1T9ZA 3B9RA 4EELA 1ZOLA 2B8JA 1U2TA 2R8ZA 3K1ZA 3RF6A 3L0YA 1J8DA 4UM5A 3PDWA 5ALRA 2WF8A 3M1YA 3ZW7A 4UARA 3OTQA 1QH9A 1QQ5A 1L8LA 1RDFA 4HGRA 2WM8A 5AKYA 1RRCA 3U26A 2B1QA 2FPXA 4C4SA 3SD7A 2JGAA 5ALWA 2PR7A 3EF0A 2I34A 3OCUA 5T41A 3L5KA 2YFYA 2W4MA 2AH5A 1YNSA 4UW9A 2GHQA 3P96A 3KC2A 5AIBA 4BBJA 2Q5EA 4BEWA 4DCCA 3I76A 3QGMA 2OYCA 3OCWA 3WKDA 3FM9A 4GIBA 5AI8A 4KYTA 3AR2A 5AVYA 5ALDA 5AVTA 5AKXA 5ALGA 3QUCA 5AKGA 4MWOA 2YN4A 5ALFA 2EAUA 4BX2A 2G80A 3SLRA 3MMZA 1YS9A 2C4NA 1EK1A 2B82A 4UAUA 2HF7A 4EEKA 1Z5GA 2HEGA 4XQ0A 3SMVA 1U7PA 2YJ3A 2OBBA 3ZTWA 5ALYA 1SWWA 4XOUA 3QU7A 1SWVA 2HX1A 2WF7A 4FFDA 1T5SA 2C8KA 2HCFA 5ALQA 3L0CA 4GXTA 2Q4TA 2GO7A 2B8EA 2I33A 2R8YA 3L8FA 3MPOA 2G1AA 5AM3A 4UMVA 5AW8A 2AMYA 2BY4A 3ONNA 2B0CA 3N28A 3W5CA 3UMCA 4UU1A 1Z5UA 4KX3A 1Z4PX 4NFLA 2RB5A 1Z4NA 1TE2A 4HGOA 3B8EA 2HO4A 2NYVA 2W11A 5AW4A 1N9KA 2RARA 3KBBA 5ALIA 2MU1A 4NAVA 2MU2A 4FYPA 5AW5A 3WKCA 2W43A 1RLOA 2GHTA 2FUCA 3FVVA 1O03A 1Z4MA 5IT4A 3ZVMA 2I6XA 4CF4A 3IRUA 2YMQA 1XPJA 2OM6A 4E88A 3WKBA 2FPWA 4JDPA 4BNDB 3NANA 2CFTA 3HLTA 2G0AA 3KOOA 3OCZA 3ET5A 1MH9A 1O08A 5AW7A 3N07A 4Y2RA 4UM7A 3QUBA 4H1WA 2YMPA 4YGYA 4EX6A 4XPZA 2EATA 1XVIA 3QNMA 2BDEA 2ZBEA 4Y2UA 5ALEA 3ZI4A 1NRWA 4I9FA 3F9RA 1QQ6A 1Y8AA 5AW2A 5AW0A 1TA0A 1WZCA 3RFUA 5ALZA 4BEVA 3PCTA 2IOFA 1L8OA 2ZXEA 4EENA 2PQ0A 3SHQA 4JB3A 4ZEXA 1TJ5A 2O2XA 4J03A 5AICA 1CR6A 4BYGA 2YJ5A 2FI1A 3ZU6A 2AGVA 3D6JA 2ZBDA 2O9JA 5E0OA 2YBDA 2IYEA
chains in the Genus database with same CATH superfamily
3SZGA 2AYXA 2IHMA 1GEEA 1NJ1A 2Z2KA 4HSGA 1Y4SA 3IXMA 1AXGA 2SKEA 2YHAA 2BCVA 3PXXA 2F3QA 4BN4A 4MWEA 3L05A 1X42A 1RWXA 3P2IA 3RVMA 1PNRA 4OJ6A 1DTSA 4RLHA 3H4IA 1RQXA 4KK3A 3VDNB 2YHIA 4GLBA 4Y2TA 1AURA 2W2KB 4CMKA 3F46A 4V38A 2B3TA 3U09A 2NUAA 2XI9A 5EIBD 1QHIA 4WOCA 1A6SA 2QN6A 3AFGA 5F52A 3ZGXA 1EP1B 4P4SB 4TYYA 3F71A 4W7SA 4MINA 4H7PA 1TEXA 1V8DA 1ODLA 3A36A 4WEQA 3RJJA 4E12A 3TKYA 3V4FA 2PMFA 3TANA 3KE8A 3LQYA 4OM8A 1RAIA 2UZ0A 2XIDA 5AVRA 1CP2A 4IIUA 4AKIA 2HW8A 1XHLA 3OQJA 4FB5A 4F8JA 1R4AA 9ICRA 1JHOA 2HHJA 1ZJWA 1Y88A 4J94A 2FX3A 2GAIA 1PEDA 2HBJA 3EXIA 3R6WA 3NGMA 4L4RA 4TXJA 5EAIA 2BGWA 1FQJA 3DOJA 3R7LA 4D25A 5DM4A 3CW2C 1DV2A 5EXXA 3R9IA 5IU6A 2ZS7A 2QY9A 3IHQB 1DG3A 4NKRA 2H7VA 5EFZA 2Q4BA 4ZVNA 3Q8PB 2P6MA 1KQOA 4GICA 4IHJF 1G1AA 4MP3A 1IDOA 3REGA 4CEJB 1Z19A 1LX6A 2A9QA 4YB8A 4JLKA 5SY4A 3GFRA 4CL2A 4IH9A 1TLLA 2R8XA 3KHUA 2VA9A 3B12A 2WKPA 1ZC4A 5HFAA 3A3NA 2A7XA 3ZU3A 5AQ1A 4EBCA 2Z5LA 3R20A 1Y7PA 2JLCA 1VZ3A 3DCJA 1X14A 1NL3A 4X3CA 5KFUA 1ZJMA 2RGBA 1SV0A 1DJQA 2XTAA 3KYCB 2BI4A 1P1HA 4FNOA 3BSFA 4EG6A 3LUDA 5FWXA 1E2MA 3NOQA 4Q0MA 2FMKA 4O8ZA 2IY7A 5BSFA 4RH3A 5JV5A 4KLNA 4CMHA 1HDZA 2DUJA 3EZFA 1T0HB 2QL7A 4LK2A 2UZ1A 3W8RA 2AD1A 2ON6A 4L7QA 3GFFA 4PIPA 2ZRFA 5J2UF 1XZHA 4HY3A 1XRMA 1CUGA 1YBVA 3WJ7A 5DHAA 2H00A 1KJWA 2ZRPA 2FSVC 3IE2A 3JYPA 3AGPA 1E2QA 1DRKA 2O06A 4BNNA 2IPMA 4D0SA 4D0NA 1HKUA 1F4PA 4N39A 4YMTA 4MR9B 5FLYA 1JP7A 2OUIA 3S1SA 2FUNB 2P9EA 5HP4A 4AP9A 4S1PA 4WTOA 1A8SA 5BR8B 4JKIA 2OENG 4MYHA 3MRTA 4RKEA 9ICXA 2YNMD 3QKUA 3DO8A 1WP9A 5IJ9A 1NVEA 2R6FA 3IB6A 3BMOA 3PY8A 1WEHA 3JPNA 4KI7A 2JVIA 1JHRA 3F9CA 1RADA 4FP9A 3TUIC 3EDQA 4ZKDA 1OH8A 4DSTA 4DF4A 1YQEA 2PFKA 3L6RA 3VBCA 5LYJF 2HMVA 1P18A 2C9DA 4JGBA 1LBEA 1XP8A 4KKXB 4OYLA 2XY7A 1K68A 3HDGA 3OUZA 1KEJA 4JMUA 4R69A 4OFWA 4P80A 5KQGA 5L51A 3UMMA 4TX1A 2CW5A 4BVBA 3C2LA 2D5AA 1EZ4A 4A26A 3VVBA 1GPLA 3GNTA 1N8TA 4IRXA 1X1SA 1CY7A 4X90A 3RVLA 4O2AF 4XVQA 2WILA 4CI0B 1XNSA 1YK1A 2P3LA 1NDQA 1GGEA 1M8PA 3CS3A 1A8PA 3LECA 4QJIA 4PVDA 1SOUA 2CFCA 3ILVA 3O26A 5JH7B 3HCCA 7ICSA 4GHWA 3RAPR 4R8SA 2ZUTA 3KKAC 3KEGA 5F5XA 2P2LA 1FU4A 2YFQA 1DE0A 3D6NB 1A77A 3DHYA 3KQMA 1VTKA 4OM7A 4RIEA 3T3HA 3U31A 5FBVB 5AHXA 4LRTB 2D2FA 9ICNA 2R65A 3HCAA 1GPKA 4BE4A 2FDXA 1U4BA 1E2UA 1RYUA 1CFJA 2H5JA 5CH3A 1IBMB 1LRLA 1CY0A 3I53A 4L2IB 2AQ4A 1PV2A 2ORIA 3E48A 3KQTA 4OQMA 1RI5A 4V0OA 6Q21A 2PSJA 2Q5HA 3MD9A 4BFLA 3OZIA 1EFRD 1SKMA 1D2RA 4DQQA 2OBLA 3PD0A 4RFLA 1USVA 3UZUA 1XZBA 1ZUIA 3PJRA 3GNLA 3PC6A 4JK1A 1OU4A 4TQSA 2B83A 2ZSAA 5ALKA 1P1JA 3ABRB 5I8PA 4EG4A 4MVJG 4MV1A 3W9SA 4EW3A 4DUYB 4RCYA 4OI4A 1E5XA 4IMPA 4LHSA 2AC4A 3L6CA 1KKXA 2QJWA 3GR6A 2R6GA 3A58B 3L0OA 3ZD7A 3OP1A 3BMQA 1AS3A 4L1KA 2KJ9A 1ZN2A 1Z83A 3A3PA 2GNAA 1ORTA 1E5VA 1EBUA 1ZK4A 2I2XB 4J9LA 1J09A 4PL1A 3DTVA 4LJYA 3PPWA 5CVVA 2QX9A 3PR4A 1JSXA 5AUQA 3SQDA 4GC7A 1JBKA 3TD6A 4BV8A 1BPBA 1IN7A 3IM1A 3HWRA 4L5IA 3DFMA 4KPGA 3IUNA 5KYUB 4EI2A 2DR2A 2IP1A 5FUMA 4KUEA 2FTKE 1BE8A 3OQBA 4JIMA 2W6JA 4RXTA 1FRFS 3RKUA 1FFHA 1ZCAA 4ACOA 5EZYF 2ZQ5A 4TLCA 4C0JA 2HMUA 3PC3A 4YDRA 1TPZA 2RAUA 2CDAA 3OUUA 4EG0A 2XKAA 4QZIA 3ZXUB 2QZ9A 4YCMA 2AUMA 3CLTC 1DT3A 3KEMA 3PVCA 4LE0A 4WOPA 2SHKA 1QB7A 4YCJA 2FEAA 4AURA 1DEKA 4JOCA 3C2MA 3SFZA 3FWZA 5IAOA 2R1ZA 1T1RA 4MRMB 3AUAA 3UMGA 1NT4A 2F59A 1G5FA 1FLDA 1GUZA 1TZMA 2JEYA 4UVEA 5TB5A 1FP1D 3V7YA 4D8YA 3NJ8A 1VP3A 3HDHA 3EH2A 3F4BA 5KQLA 1FUYB 4K4IA 3DTTA 4CQMB 3TTWA 1SIWA 5LLSA 3UXEA 1ZKMA 4JLDA 5JNWA 4OQPA 4C4RA 3WSWA 3M5CA 2O0HA 4IMIB 4E11A 1U2SA 3TGLA 3ZHBA 2KHZA 3D6AA 4HLCA 4AJKA 5KNBA 5IJAA 3ZCSA 3TR5A 2XSZA 3HCNA 1Q91A 3R5JA 5F9HA 1QLHA 3ORFA 2WWIA 5DBHX 1QJCA 1GCOA 4ZANA 5LNK1 2VHWA 1DBQA 1KKLA 4HB4A 2LPMA 1II8A 3OETA 1EYZA 1ES9A 3CUTA 1USWA 3JQBC 3KWFA 3VJRA 3OMLA 4UD6A 2IH5A 3QLEA 4DEYA 1ZD5A 4P53A 3VGJA 2EW2A 3FH0A 3GIWA 2DUWA 4TKLA 3ZDDA 3M3HA 2IEYA 3SBDA 2OV6A 2H92A 4YMHA 3I73A 1W85B 4IR9A 9ICPA 1THTA 1Z6QA 3K9QO 4YRTA 3T5MA 5CX1B 2WBLC 2XXJA 3D0QA 4KLDA 1NP7A 5JRDS 1H3NA 3C28A 1M6HA 2NVWA 3EFHA 4CBVA 1XMJA 4TV9A 4WAUA 3V7KA 1HDIA 3GVIA 3ESDA 2G36A 2AFHA 4JOSA 4ND8A 4TT8A 5DTEA 4D92A 2JMGA 5KT5A 5JS2A 4E5YA 2VA8A 4F3TA 3UJ9A 2VJMB 4UBNA 2A35A 1L5GB 1ULZA 4RFSA 4UOZA 3R7WB 4XWAA 2P9ZA 4O4LA 3RS5A 2FWBA 4KN5A 3IUEA 3HCEA 3F49S 1ZD2P 1V11A 3ZIDA 2F8MA 4QHYA 5EE9A 1FSZA 4ZQIA 4CM4A 4HNTA 4DV7B 4FMCB 1V35A 3FHOA 3RE1A 4AF6A 4B3CA 5L6LB 3R9XB 5DG7A 1XWLA 5CCEA 1ICIA 1KFDA 1W2HA 1X7YA 3LNTA 2KG5A 4GVXA 4DARA 2WTUA 2FJ6A 1O2DA 1Q19A 1GCIA 1GTZA 1Z0JA 5I9BA 2DBQA 1E3IA 1UWLA 3JARB 4H0NA 3EEOA 5HCNA 1SHJA 1K5DA 3ZLUA 3QEOA 3GMIA 2LBOA 1KMIY 1RI4A 4GOLD 4AKHA 1PR4A 2NRXA 1HLFA 4GBGA 4WWHA 5H7XA 1X9GA 5IWCA 4E15A 3DEHA 4KN9S 2P11A 2Z5GA 3I9MA 1FYDA 4MS4B 1THGA 4G1FA 3ACBA 4NR0A 4LDZA 1ZJ5A 1ODKA 5HUQA 2J3QA 3WRYC 2I9PA 3ISBA 1NXTA 3IERA 4D97A 2VN8A 3VGPA 4GPD1 4Q05A 2ZETA 2NZJA 3V1TC 3SC2B 1CI4A 3AM3A 4LF7B 4MQEB 3MHTA 2E1FA 1NVUQ 2AIRA 4JWMA 2D1RA 2LZ0A 2ZUSA 3CWCA 1XA4A 3KFUF 3DEIA 3Q3CA 4NCBA 1DFGA 1YQGA 4YRZA 2P90A 3FHJA 2HQBA 2GXSA 4C0QC 4V0RA 2DEUA 3WWPA 1XFAA 2QE7D 2V9CA 5T14A 1ATIA 1GDDA 2PFGA 2QX4A 3I4CA 1YDMA 4AT1A 2ZSEA 1EM8A 1Z2DA 3GLRA 5C5DA 2CK3A 1F1JA 4EELA 1K88A 1QH1B 1G20E 2QMZA 3UB2A 1LQ2A 3PQ3A 4F1JA 3GDHA 2BRUC 2BKVA 4YHBA 4AJNA 3H8WA 2I3AA 3BFJA 4K88A 4QTYA 3LYLA 1GPNA 3QSYA 2W7PA 4G56A 3OM0A 3D3WB 4PG7A 4WECA 2HBKA 3C6YA 1N5RA 2BDTA 3Q88A 1NE2A 1J8DA 3W6PA 5K09A 4NXZA 3WBFA 3DKIA 4C4ZA 3GUHA 3KZCA 4W1RA 5EMNA 3IBYA 3TTXA 1V8ZA 5B57C 3FVQA 3PSFA 1WCXA 1ZNYA 2F1HA 3M1YA 1W1IA 3N87A 2OXOA 4ZALA 1E3SA 1SXQA 2BSAA 3KB1A 1OH5A 1DIAA 5J0XA 3TB4A 3GGDA 1YFKA 2JI6A 2C2WA 3I32A 5FUVA 5T57A 3WL4A 3U44A 2B1QA 3S8YA 2NQ8A 5J2CA 2PNFA 1ZY2A 2G17A 3BHIA 4G09A 2E0IA 2QUAA 4KSYA 1UFRA 4TRMA 2JKVA 3BJYA 3EF0A 4WXRA 2XE6A 3OCUA 1L9KA 4HDAA 1IC6A 1W35A 5KYGA 1YT3A 2WP0A 3PQ7A 3M6KA 4IEEA 3GAFA 3ZWPA 3T5JA 1U0EA 3L5KA 2FU5C 4GPBA 1KDYA 2OXIA 3CURA 1X8LA 3AB8A 1P80A 1CUCA 2OCLA 4UW9A 5CW1A 3VXKA 4EMUA 4ERNA 3GLFA 2ZM5A 3B48A 1Y8QB 3OZUA 5T4EA 3RU2A 4IQ4A 3GA0A 3O83A 4JGIA 5C35A 4TWAA 3ZDZB 1PNQA 2VG8A 2RHGB 2CNWD 2I8CA 2UYQA 2VHQA 3OIVA 4K9QA 4O2LA 4MFFA 5DI9A 2OXTA 3I1FA 5C0OE 1NBWB 13PKA 1Z8HA 3B20A 4G41A 5AKXA 3EXHB 5AKGA 1PWXA 2VJOA 4V0SA 4G1MB 4DZRA 3R8FA 1VE6A 1LSUA 4U8GA 4BX2A 1F06A 3T5GA 4QGFA 5DRYA 3SAGA 1DCKA 1NQVA 2DFVA 1V5FA 3I39X 3LPLA 1L7AA 4REQB 1NJ8A 3HHPA 5G4KB 3E15A 2RHBA 3NKVA 4L4YA 2Y4NA 3UGTA 4UAUA 1V39A 4FBUA 1TO2E 2FZKA 2YICA 3F7TA 2D13A 4KQKA 4R63A 5B1HA 1JDBC 3MB5A 2Q45A 4MP6A 2G67A 4DY6A 1QFZA 4J3FA 5AOAA 1OX4B 1Z13A 3A4TA 2GAOA 3HBNA 1SVOA 2D06A 4MRPA 3ZZ1A 3NJRA 3ZE6A 4MI1A 1NMEA 4Y30A 1RBMA 3OZDA 2DH5A 2Z1MA 3QEMA 2V6IA 3EIEA 3BB4A 4QA9A 1KL9A 2FX2A 4B3MB 1ZVKA 1YBFA 5KFVA 4KYVA 4QWDA 3NBMA 3FHTA 2BBOA 4UU8A 1KNQA 5AJWA 5KG3A 2QARA 1GT6A 4OGWA 3IURA 3TL2A 1U1EA 1GWNA 5HZGA 4C0XA 1HSOA 4XOIA 3WGNA 1U2DC 1E4OA 3LKDA 5LZ2A 4M9CA 2PXCA 3FUVA 2H2GA 5ESXA 3U4MA 1NXWA 1XO0A 1NVMB 3KOZA 4QUJA 3X1ZA 2A30A 4QNNA 4MQ5A 5I9LA 3H4DA 2XNSA 3BS4A 1G7RA 4DIMA 3DFIA 4GLOA 1LKZA 3UUGA 5GVSA 1IBRA 4PCUA 4RF3A 3DE7X 4IIFA 4EVRA 1GLVA 1QC5A 2YYSA 5DIZA 2WJHA 1Y6ZA 1W4ZA 3B8EA 5HRAA 2HO4A 3P97A 1I9GA 1JLSA 2QEQA 5AW4A 3NBXX 3KBBA 1S3SA 1SIBE 5AJHA 1U2GA 1BGWA 1I7QB 4B3BA 2GM4A 5LA6F 2C4KA 2RGUA 1KE2A 1N2CA 3WKCA 5DGIA 3KT3A 4LOLA 5D86A 4K2HA 3T5CA 3KAJA 4TQRA 1RPTA 2FLPA 3B1XA 3HSYA 1B3BA 3F6CA 3FMIA 4NY8A 4FT2A 4XPIA 1QGZA 4URFA 4O4JA 4IXTA 1TB4A 2JKZA 2PT5A 2EG9A 5T6BA 3AJ9A 5CDSA 1JXMA 1SKUA 1PFUA 1WZNA 2D1FA 2ETVA 3FNGA 1K8RA 1JSZA 3H9JA 4N4AA 4R66A 4U7DA 4QGBA 2I4NA 1M34B 5E4YA 1HT1E 4F91B 1K98A 2B9VA 2NZWA 2HRDA 2OPBA 2PMBA 2YMPA 3RRFA 3VU3A 16PKA 4PGAA 5JSQA 1C1DB 4W1PA 3STHA 3G6XA 2X8LA 1P6UA 3PDCA 1L4MA 1DARA 4PRYA 5CCDA 3SQOA 5JSZB 4P3YA 4RGBA 1RYZA 2W00A 2C04A 3GBSA 1PFYA 2PMWB 4EJSC 3GFPA 3LQ2A 4XM2A 4IHAA 1X86B 1Q3VA 4ND2A 2VSNA 5C5IA 5DTQA 2C7GA 2VAVA 4HXFB 2Z8XA 4J0GA 5GIOE 3KOWA 4BMNA 4Y6OA 1U0TA 8ICMA 3QVKA 4LISA 3U4QB 2X5NA 1NYLA 2ZSIA 2HPVA 1NJYA 1HH4A 1O95A 2HQRA 4NZPA 5KCMA 2PQ0A 4B9NA 2CK3D 3TNJA 5JCZA 2GK4A 3N2EA 5ESDA 4KLSA 2GD0A 3PUXA 1K6MA 4ZCPA 5F1PA 4CM8A 521PA 2RDIA 5AXDA 4KXWA 2QAGA 3CE6A 1T1GA 3KRTA 1V4NA 1F1BA 5THXA 1U98A 1XTPA 1E2LA 3NVYA 2PL5A 1LRKA 2QIOA 1FUKA 1O0SA 2XMQA 1N78A 3MHPA 5EIBC 3WB9A 4EOGA 1EWYA 3L8GA 1KRHA 4QEKA 5HKKD 4LCJA 2DFNA 3ENZA 2IOFK 2Q6VA 4JT8A 3RADC 1NXPA 1NRXA 2CBZA 2PQ2A 1YZUA 4ZVLA 2ZYAA 2PUGA 3ZS9A 3B70A 4V24A 1KOLA 3IEVA 2VUSA 3LL4A 4UB6U 4DDTA 1E2EA 4X3PA 2JG3A 1NYTA 1IK6A 1KIAA 1PWYE 2CMHA 3CNBA 3GEDA 3Q3HA 1Q11A 4BFXA 5LQMA 3AKZA 4UB1A 1VCHA 2E4XA 4ZCSA 4CCYA 4CLHA 4HN9A 5C46F 3VJKA 3SC3A 1I4WA 3X1KA 4DPKA 1E7YA 5DEIA 2JFPA 2W2LD 3NIGB 3F98A 4ZEMA 4INOA 1EM6A 3F90A 4BJ1A 3IAHA 3NDRA 5CVDA 3OZEA 5THQA 2ZSBA 2XUDA 5FWAA 4QTXA 4D44A 4Q3EA 1BU8A 1YC2A 4KLMA 1CR4A 4MK4A 3QXGA 1WCLA 1LXCA 3VTFA 5CLJA 3TQ1A 1OPRA 2WDZA 2KWIA 8ICGA 5GJWC 3E81A 3FNFA 1ZMXA 3KKLA 5HRUA 3JQQA 3HUEA 2P1DA 5DBFA 3SR3A 1SU8A 4Y6QA 1E2KA 2XE4A 3AEKB 1HBJA 4ZYZA 3F7OA 2FA9A 3NHBA 4FMCF 2VDNB 2Y8EA 1LDYA 1TM4E 3JD3A 2H1WA 3FPFA 3QEKA 1E1MA 2F1KA 4P33A 5CH8A 5BQPA 3A26A 3FWNA 5F3DA 1SY7A 2HBLA 3RR8A 4O4IA 3TSAA 2JHFA 3KYBA 4FZRA 3BZCA 5A6VA 5K3OA 1CQPA 3T9EA 4ENRA 2VPYA 2HLDD 3IEKA 1ORDA 3LYHA 5KVVA 2FW1A 2C97A 1N2SA 2KV2A 3N0RA 3O4RA 4LXHA 5JE8A 3RJZA 3MJEA 5FOQA 3JSXA 3OWOA 3Q5DA 3QFTA 1PS8A 4JUFA 3QVGB 1EINA 4M1KA 2W6MA 4JLBA 4YLEA 2UUCB 1E9FA 2O3RA 1NQAO 3O3OB 4YAUA 2CDRA 2I9KA 2GEJA 1QCZA 1RTKA 1T5DX 3SSAA 4LTNA 4AX8A 2YV4A 3F3YA 2PUHA 4J9QA 1RVDA 2MJLA 2BQUA 3QHAA 4L95C 5HF6A 1DXQA 3IIMA 5ILOA 2BFAA 3C7KA 4I5EA 3UC5A 2MHCA 1OROA 3JQAA 1M0EA 3LSYA 4MH0R 2BC9A 1QNFA 4OGFA 5FLEX 2ONZA 4FQ7A 1GAWA 3ROEA 2FLLA 3WKAA 1W0JD 5C5EA 3O8LA 3ISJA 5KWIA 4Z3OA 3TLBA 4P83A 3GN2A 2OLKA 1WPRA 1Y34E 2C61A 2R4QA 1OX6A 3H5AA 1IIPA 4FGUA 5KFWA 5HFJA 3L6OO 3WY9A 2XGSA 3E53A 3FTEA 1ZJNA 1DBRA 1H1LB 1XDSA 2EX0A 3U3KA 2WAQC 4DEXA 5CBPB 4C30A 4EVQA 4O3OA 4A36A 1F0NA 4X91A 3W4KA 2BCGY 2ZAGA 1T5LA 1Z62A 5JAQA 4L0DA 3KYIB 2AV6A 3T7DA 1SVKA 2NX2A 3R9KA 4HEA6 4M3NA 3W2FA 2CY0A 3BQNB 4ZYWA 1V96A 2HCRA 3ZWYA 1NVVQ 1KI8A 1JMKC 2RG7A 3UJ3X 3WFIA 4GYWA 4QUAA 2O5CA 3NUZA 1ZA1A 3KO8A 3NFRA 1M5TA 4JBNA 3HDJA 2ZEJA 3TAXA 3IQZA 1L7BA 1X9SA 2YYAA 1MPTA 3AY6A 4HPWA 4L4XA 1DEHA 5JFGA 2XYPA 4XUDA 3HU1A 3E84A 4PYOA 2D7CA 3HU2A 4R1MA 7GPBA 2IEDA 1RCFA 1W1WA 2JEZA 3NBZC 4KB5A 2GUWA 2UVPB 1LZLA 4TM7A 3AETB 4GP9A 1HDYA 5BQ3A 1YT5A 1TK5A 2GF9A 3FYUA 3GXBA 3RYFB 3UJ6A 3WO0A 3A1SA 3H11B 3ABQB 1L7NA 1TA9A 4RTMA 4EPTA 3JQ9A 2BP7A 2QTVB 4F5WA 1JX4A 3NHMA 4G5RA 3QOFA 4NJEB 3LGXA 4RVNA 1PE0A 1LVUA 2JEOA 2HF9A 3RKSA 4D4GA 1NLUA 4PGFA 4I99A 2IU3A 3A9UA 4W7HA 4X6UA 1NZBA 1N2OA 1ZGAA 4OU5A 4ETWA 1YQ9A 4BVHA 4DPMA 2ES4A 3WC4A 1GKLA 1B0PA 3IOEA 3P0FA 1UXOA 1UODA 3HDVA 3D1LA 4M89A 3VSEA 3EWSA 1OZAA 1U3UA 3KFVA 1ULSA 3L8HA 1N6RA 1IHOA 3Q5EA 1P0PA 2PWAA 5FI5A 4KLZA 2OHXA 3ILSA 1NZPA 2CXOA 3SNKA 3ST7A 1XTTA 3D8UA 3VV2A 2PXXA 4XUEA 2C4WA 2NUTB 1C3JA 4U9HS 2EFHB 4RK1A 4IGFA 4E03A 1E1CA 1VBKA 4WJ3B 1YTUA 3WGTA 1R7RA 2D59A 1FJHA 5EGNA 1QH8A 4R1NA 1XAGA 1ZMRA 4PY2A 3U49A 2ZUVA 1J1IA 4XB6B 1SUSA 3V3KA 2FDRA 2W6ID 3GT4A 1GHTA 2CXNA 2X22A 3EGXB 2H16A 2I4LA 2ANCA 3PITA 5CVEA 3SCZA 2PZBA 3ODPA 2HB6A 4J0IA 1JG6A 1Y5MA 5F9MA 1P4JA 3CLUC 1PFWA 2IWHA 1N0IA 1P75A 1BKYA 4DB2A 2PU5A 1A4XA 1W93A 4OHBA 5LLTA 4TN1A 3QPAA 1C9EA 1SCDA 2GCOB 4PHGA 1PJ3A 1XZEA 3QVTA 1DI0A 3BREA 1U8AA 1S8OA 4NYMR 3UFXB 1XCLA 1XCGB 4LGCA 1VLHA 1H6DA 2H1LA 1A4RA 2QRGA 3FNQA 4PTZA 3JPQA 1TJYA 2A3NA 4C7YA 2AN1A 4QAJA 3SF8A 2H1RA 5C7LO 1QQ7A 2OV8A 5HQTA 2Z98A 1MRSA 4RPLA 3VC8A 3FZYA 4A9AA 4QC2A 4HAXA 1UBLS 4DSIA 3FOWA 1DHRA 1EX9A 5F12A 5K1ZA 4DL3A 4EG8A 1OZFA 5JAZA 1RYEA 1G59A 3K8OE 1N1EA 3PNVA 2RIRA 2WNSA 1NSTA 3OZTA 4ZTUB 4UAWA 2F8LA 1XQ9A 1Z2PX 1AZWA 3G59A 3HYCA 1J9ZA 1T4CB 1XDBA 2EKPA 3FPBA 3HYNA 3KJIA 3ZUPA 1XZJA 4I4LA 1N2XA 5E7JA 4Q18A 5K6RA 4HK4A 3NIFB 2JAUA 2Q9AA 3NP7A 5M34A 4IMRA 1DL5A 4LF5B 2IEIA 1YBMA 1ZJJA 3KYDA 3KT6A 3PSAA 2V98A 1E3QA 1YHYA 5EIWA 3TNFA 4C80A 2EOAA 2WE7A 5B4VA 3HJFA 2GA9A 5E6RA 2RK6A 5CT9A 4AJ2A 1U5BB 4PGGA 4DRXA 2B4QA 4CF3A 4DMMA 2CD7A 5KUTA 4KLIA 4Q4JB 2H6EA 4RJLA 4HTFB 1OXTA 4F60A 5IF3A 3AOGA 3PDHA 3OGUA 5ERYA 5JU6A 1HQKA 4MKHA 4EJ2A 5F9FA 2MINA 2BPOA 2Q21A 1EIWA 5HDBB 3CLKA 1UAAA 1I7DA 2B20A 3VU8A 3ENWA 2WF9A 3QMPA 5KNCH 1OWPA 1KFBB 1YCFA 4ZDJA 2Q5CA 2P9HA 4ZRNA 4BQNA 3QU9A 1P2GA 2C29D 2RGGA 1LH0A 2FZVA 1WW2A 5F35A 3O31A 1SBHA 1W44A 3EZNA 3UM9A 4Q1BA 1FJ2A 3KXPA 2VNAA 4JJ7A 4QXOA 3PU6A 5HVNA 5LN1A 2FMQA 1IHYA 5NULA 3OPYI 2WHRA 4CM8B 5EHZA 4R51A 5I51A 4UE2A 2NPFA 2IXBA 3WLRA 4CGYA 5TF0A 4ZO9A 3QX7A 3LC2O 1IM8A 4YONB 1QMGA 1YVEI 2FCAA 3MMSA 2A1TR 3FPGA 1ZU5A 3GF4A 4MYUA 3A1WA 5AESA 1ESDA 1I36A 1KRWA 3MT0A 5TF4A 4AZWA 3ND9A 4O2RA 4CNQA 3GCGA 4MW6A 5KYNA 1TTHA 2Q9BA 4F38A 4LF8B 3E6AA 3NYWA 2F4VB 4MWSA 2QX6A 5DASA 4ZVQA 1CZNA 2YYZA 3CKMA 5CNMA 3HCOA 2RH4A 4USAA 1OC4A 1PUIA 1BE6A 2YB4A 1OU0A 1WS6A 4H18A 4WSOA 4HR7A 3LYAA 3HGMA 2OILA 5EN4A 5FPTA 5ILGA 4IRCA 5FA8A 2ACVA 1HYHA 2F4NA 2HO5A 3GMSA 3RUIA 4EPYA 4HNAB 1GRQA 2XE7A 3H0MB 2VWPA 3CZPA 4XB2A 4M55A 4X6XA 1YDHA 1ZN9A 3F97A 2KBFA 4JVMA 1D8YA 3QM1A 3DMGA 4I9GA 3A06A 3B6ZA 3AIKA 3DL7A 3KKKA 3PT5A 1S76D 1RYDA 2WC1A 4J0HA 3T7JA 4AZTA 5AVVA 3HB0A 4KXXA 2ZM6B 2UYOA 5FOXA 5BR7A 4A8JA 2OEHA 2FZCA 1NLMA 2ZZKA 3KV3O 5E8RA 1H2XA 3FOZA 1UOOA 4WLOA 3MRXA 4PQRA 5TPWA 5JQWA 4FLEA 5AK0A 1US8B 3L6DA 4PCVA 4C04A 1V9CA 2QQ0A 2WIJA 2Y0PA 3V4ZA 4P34A 2Q1SA 3KLOA 4IM7A 1RKXA 4PZUA 5K0CA 4M1WA 3AIMA 1ZW1A 4DIKA 1O9HA 1R5JA 3T7TA 2GK7A 2OOKA 2BW0A 5A7FA 5FT9A 1KEWA 1DEXA 1LW7A 3AYZB 3GPIA 1NM5A 2I3BA 2V0NA 2OHFA 4MGKR 2HA4A 4N5LA 3BK7A 4MV9A 1K1SA 5JARA 5AKYA 3A14A 3KALA 5B1IA 3T9BA 3GV0A 2JDID 4ASUA 2J9XB 4R8UA 1Y1RA 1MO5A 2V4QA 1WB6A 3MA0A 4HVAA 4KBYA 4UHHA 3L8DA 4MYTA 3HVHA 3TOCA 1I2CA 1L5ZA 3NXSA 4HN4B 3JWJA 4FKZA 4OAOA 3ZHXA 5I7SA 5JNLA 5EWGA 4J49A 3G1WA 3JQFA 4JN6B 5BWLA 2A0UA 3WRVA 4YMNA 2H18A 3EF3A 5IAKA 1C29B 1HOTA 4OK6A 4XWOA 1K4KA 1PUZA 3PXGA 2BFEA 4N8DA 4RD6A 2XI4A 4KV7A 4DZTA 4F4HA 2O7RA 3OIFA 4FS1A 1YIDA 2VR1A 3ZNOA 1LBQA 2Q5EA 1KO7A 2A5YB 1IY9A 5CXXA 2FPLA 1JAHA 2H57A 4ER6A 1ODCA 1K08A 3UJAA 3PF9A 1TAHA 2DLNA 2K7ZA 3GDFA 4XVHA 1SPBS 4R16A 1UPXA 1SHTX 1CV2A 5CUQA 1GKUB 3I2YX 3OD5A 3R3SA 4IH1A 1COOA 5EINA 2JV3A 5B30A 3TGWA 4JROA 2EAUA 3LVQE 4B2PA 1MTOA 3E23A 1ZUD1 4M9RA 3ABSB 4RSRA 3QA3E 5SZJA 3EQ2A 3PHGA 3SZOA 3JVVA 3QW2A 4IS2A 5H16A 4WKCA 2C1XA 3TUZC 1GFIA 1P74A 2PKRA 4B85A 2VBCA 1X38A 1FTYA 9GPBA 3EBOA 1ZHOA 2FGKA 2WHPA 4FGSA 4XYGA 4AMZA 5FPHA 2NUPB 3G5MA 1QOQB 1T6XA 2VIXA 5TGTA 3EPLA 4CM5A 1SELA 4RNCA 8ICFA 4KE6A 5P8WA 3IUSA 1MAUA 2IHBA 1E1NA 2DQKA 2J9RA 2VQ3A 5FUWA 5IDXA 2GCPA 5HJ7A 4OBBA 1T9KA 3DT9A 4FK8A 1CF9A 3IHLA 1NBEA 1RWPA 4RQ2A 5TY0A 3L8FA 4RTPA 3OAAA 4D0RA 1DLJA 2G28A 3VOBA 2EX1A 4XAQA 5BN4B 4B4KA 3WRWA 3FOCA 5E2AA 3CNNA 1WZ2A 3DBRB 2V5VA 4NP6A 4RUKA 3ZV3A 4RVOA 3TECE 7ICNA 3OQVA 1G20B 5EIAA 3TMKA 2R96A 1Z5UA 3KLBA 2E18A 4ZEOA 1F2DA 1ZISA 3A4IA 2R8HA 1GXSB 1Z0SA 2A0FA 2HDWA 4L74A 2IBKA 1YC5A 3O91A 5C51B 4L5JA 4OLFA 5EP3A 3RR7A 3GELA 3CF6R 4LYYA 4Q3LA 4PQYA 3VDQA 3C5VA 4MR8B 1GDHA 1H2ZA 1W8DA 5GONF 4TMYA 2MU2A 1Z35A 2XMRA 3TFQA 3RK1A 4ZJZA 5BRJA 4JAVC 2IYYA 5P21A 1NC1A 1XSPA 2OQRA 1LV5A 1FW6A 4UUAA 4IH4A 4ZYLA 1PGQA 2BWJA 3J81j 5L1LA 1IM5A 2O48X 4QUKA 4X8MA 1E9SA 3PFBA 1EWTA 2FHSA 2Y9PB 5BPFA 4Q1EA 3BBPA 1Z45A 3MGVA 4HWGA 1ODFA 4IQ0A 4WZBB 3VPDA 3NANA 3MF4A 5KDLA 3RFAA 1V5IA 3Q6MA 5K05A 5L95A 2AG5A 2J9GA 3JQ7B 3KOOA 1I3NA 3KPVA 3S40A 1X7WA 3FCEA 4NPCA 2FRXA 1O08A 2C0CA 3JATA 3V7UA 2UZ3A 5AW7A 2O8CA 3N07A 4UPVA 2ZREA 1BMFA 2ESRA 1R0XA 1DINA 2FJPA 3QKRA 4INJA 3EUFA 4C0BA 3LPAA 4JXXA 3W7VA 1UAGA 4DFJA 4LTDA 2H3EA 1QTIA 3ME5A 3UTDA 2Q3EA 1W5FA 2JZBB 1U3TA 3VUFA 4Y2UA 4E07A 1YWGO 1RHJA 5FX2A 1JQBA 1BN6A 2IDKA 2QI9C 2PV7A 4I9FA 4I08A 3ZJUA 4MOWA 2OCKA 2ZQZA 4V0LA 1ZQJA 1TEVA 1FLVA 3E9DA 2Z4SA 3IILA 3QZ8A 2GVDC 2CFOA 4GNRA 2DHDA 1K3FA 2EWWA 1JG4A 2BFBA 2CZGA 3MM4A 4JLNA 1AZSC 4JL8A 4PC3A 4QOEA 4RD4A 5LBUA 3AVUA 3I9OA 2NU9B 4MUJA 1SVLA 4JB3A 3DMNA 4IWNA 4A8JB 5JU5A 4S1WA 4L02A 1QR6A 3FWYA 3HKZF 3I0MA 2VHXA 5BMVB 3EVGA 3MWJA 3LPCA 2O54A 3GGPA 3K9WA 4NAHA 1LWOA 3PRHA 1Q0QA 1TGVA 2QNRA 4I1YA 4PPYA 3FRJA 4OI1A 1M2NA 3IP5A 3ZU6A 3G0HA 1W25A 4KSCA 3ZHCA 1O1YA 4G5YA 1TW2A 1DOZA 2SKDA 3WL3A 1S5LU 2OK7A 1KN5A 1PGOA 4ENWA 5J29A 2AGPA 1JB9A 4RTSA 3BF8A 1O97D 1ODJA 2CLFB 4MKRA 1UANA 5TJHA 5L6MB 3LLUA 2Y1KA 4MQFB 2DKXA 1VI5A 4M0LA 1UPAA 2VSFA 1E5DA 1FLNA 1SOAA 1FS4A 4DL5A 4K81B 5DTJA 2B36A 2X0NA 3UB4A 3CINA 4JVLA 2H1FA 1OW5A 3GMDA 3RB8A 4RK4A 3SAJA 4MFAA 2DU8A 3LZCA 4D42A 2B61A 3H7AA 1C7FA 1SCAA 4K6CA 3QFSA 3TOVA 1LEHA 2HSJA 3W9UA 3W5AA 3ENNA 1JT9A 4CN8A 3TXYA 3RYTC 4DIBA 1C3VA 1ZG3A 1DIOB 2EBHX 5F73A 2XUAA 4NXMB 4GE3A 2QVCA 2C9MA 4B3TB 1RVV1 1DWPA 1W19A 2QMHA 4ENUA 4L5CA 1EH5A 1MC1A 2WRZA 4RZHA 3DZCA 4NARA 3N70A 2HC9A 3QPBA 2XZLA 4K1XA 3C8MA 2VYND 4DR7B 1ZQWA 1W75A 2EDCA 4ESOA 1GCUA 2ZTLA 4OG2A 2FMUA 3HCPA 4X1YA 4EYKA 1M8GA 1T2FA 1HYEA 1S2IA 3T95A 1DC8A 3RTBA 1KDHA 2H4XA 1KP9A 1VLBA 1UT6A 3QVLA 1VLLA 5HIJA 2VRCD 2VHJA 2D6FA 5EJ2A 4YR2A 3AMVA 3KSDO 4YUYA 5SICE 3O8OB 4LZDA 4XTCS 3SNHA 4Q3DA 2CFRA 4R01A 4F85A 5IKEA 4U6PA 1R6VA 1ML4A 3IOBA 4KXYA 1Z82A 4ZO6A 2V4RA 1C30A 4I3GA 5AVUA 1YASA 2BGTA 1BN7A 4ZAXA 3M6ZA 4EHIA 5IKMA 2R1TA 3UGQA 3OEWA 1YS7A 5IVDA 1RQNA 3RBEA 1BU5A 1OGJA 4MR7B 2GJKA 4D9JA 2W71A 2FMFA 4F4IA 2H5IA 3H2IA 721PA 3PPIA 5IXYA 2QBYB 2EDAA 3DEAA 2SKCA 3KQPA 4K9KA 4PYKA 4R98A 1MC4A 4BNZA 9ICQA 1F8FA 2ZE5A 3T0FA 5HCIA 2OHIA 3ZBPA 3JASA 4FBMA 4LVCA 4JC5A 5HX7A 1H0HA 5AKIA 1JDUA 3AYXB 1X1BA 3H9EO 5BNFA 4J3NA 1JU9A 3K2IA 2IUUA 3UK2A 1XT6A 4OJPA 5AXAA 3FI0A 1D4OA 2ZCJA 4C8LA 2G1JA 4RVGA 4HDMA 2HA0A 4BPRA 1SVUA 1Z6XA 2IUFA 4EVSA 1UT8A 1X13A 3BDAA 1WOMA 2XT9A 3M82A 2D2VA 4Y1GA 1QIHA 4M0CA 1B0UA 4PG6A 2ZWAA 4J0DA 5EP1A 1S10A 3KDSE 3VI4B 3BX1A 2QTNA 5EERA 3RV4A 1VHTA 2XMGA 1DQPA 3OFND 1T0JB 1P7DA 4G4JA 5CK5A 5J4VA 1LQUA 2ZSDA 3O74A 4JZYA 4IL6U 2C5AA 2REXB 3EZ7A 3NEJA 3QQ5A 1M74A 4W5HA 4BMOB 1OIWA 4GYYA 2IX9A 1CUFA 3F47A 6CHYA 3P9ZA 2EG5A 1WTCA 1CE8B 2HSEA 4ARCA 4RL4A 2VK1A 1DVRA 4IC9A 3DW3X 4X61A 3CU5A 2HTFA 1OV4A 4KO8A 4MGIR 1W52X 4B3GA 4C07A 2HRQA 2VATA 3BD6A 2WAXA 1NIPA 2G1UA 1Y9EA 3ICWA 4A16A 3Q3JB 4QSMA 9ICGA 4UM8B 2YV5A 4OFZA 1RS0A 1WHTB 3IX7A 3RVQA 3X1JA 2GZMA 1YRBA 2Q4RA 4A27A 2V9PA 3I9V6 4PPFA 1EP9A 1XWFA 1DELA 1I10A 2XDQA 3BXXA 3GIKA 4J1TA 4WY5A 5JZMA 4ELUA 1M1YA 1T9GS 1ZVJA 5TVGA 3ASUA 3RU3A 4TV8B 3P9YA 4IUCS 5E6SB 5FD8A 4QDKA 1RRFA 2C8JA 2F1OA 1RQ7A 5B55A 3HO6A 4M54A 4POOA 2FUG6 3VTKA 3INTA 4ECEA 5CP8A 4PG5A 2ODBA 3OFVA 2GN8A 3GZNB 5NLLA 1MJHA 4YRNA 1E0JA 4ED0A 4E1VA 3IYLW 5HM6A 4W9RA 1GQFA 1J21A 3T1NA 4YP3A 2AFHE 4MGZR 5EJ4A 1VKHA 5CNKA 1MJGA 2HA7A 4KLFA 1J9GA 1W1UA 2R25B 4P8RA 2NSHA 5L7WA 2DQSA 2XUFA 4D8TA 2YRFA 4NL9A 5KX5A 3P9RA 1W88A 4YN4A 2Q29A 3AI3A 3BFPA 4HDSB 3I6BA 4L57A 4Y2VA 2I7TA 5BN3B 2CYAA 5CLIA 3DXFA 4KZKA 4NICA 1T4BA 3O0FA 3KHSA 3L7DA 4LJRA 4F8EA 5MN5A 2HPAA 3NI2A 1KORA 1D2CA 4H1UA 5JTIA 4RDCA 3VC2A 2OHGA 3U16A 2CC2A 1UPHA 3OQNA 3FDSA 2FRDC 2RFLA 9ICOA 2ZTUA 1X70A 4LK3A 1A9QA 4MIKA 2WICA 1XTSA 3WADA 3KUUA 1Y4AE 2XCUA 2NU6A 3H1EA 2DYKA 2ZWPA 2EFCB 2W93A 2JIMA 1BMFD 4HHEA 3WJAA 3K4HA 3WYNA 5JNRA 1H6AA 2C4TA 3ESCA 2W9MA 2DFKB 2E9SA 4G0PA 3SJBA 3LDGA 4B32A 4Q4HA 2B1JA 4PQEA 3ZWKA 8LDHA 4RZUA 3GVCA 4FYIA 4IBOA 3Q2KA 2B6HA 4O4JF 4D4JA 5JW6A 3R3JA 2IYSA 2I7XA 3OU6A 5E8JA 3T3OA 5FIUA 1FFWA 4BO3A 5K4LA 3CJRA 2B78A 4E3ZA 3IBCA 1L8XA 3AKYA 1G18A 4HGNA 1SMKA 5T67A 1Z5PA 3BMCA 3NIWA 2AMVA 4P2GA 4O4HA 3CTPA 4UAVA 4JHLA 4Z1MA 2OCDA 8ICEA 3C85A 3P2EA 2C9YA 4Y1RA 1I9CA 3NM5A 4WZZA 4JI0B 2ZJ1A 4K40A 3WP0A 3J7TA 3GHYA 3ZUGA 5DYTA 3AK4A 4L9AA 3PGA1 4QZ8A 4U6QA 5AK5A 4TS9A 3UAYA 1XFDA 3BG5A 4QIWF 3OSPA 3BWEA 1YDEA 3K72B 1PSZA 4QJFB 1BCSA 2R7LA 4YT4A 4KACA 3IVMA 3O4VA 4DADA 1B42A 1E96A 1NVAA 1XRJA 2FWRA 3DE4X 5GZ6A 3GP3A 4CT5A 3FLEA 3DBLA 5DK6A 5E1DA 3W79A 3N7TA 2NLOA 4UBCA 3FBWA 2DT8A 4OJYA 3JZDA 4E5KA 1RFLA 1ABFA 4QXQA 1N8KA 5AI0A 1J22A 1DAGA 2VJBA 3A6FA 5CIYA 2G1PA 1N5XA 1DX6A 2OO5C 4Y9UA 3H5VA 1UQUA 3L7NA 1A8UA 3H9CA 1V7QA 4HXGA 1D8BA 1C3EA 2L17A 3EXFB 3F7MA 4HEQA 4TXLA 3VFDA 4ACAA 2KEYA 2J3JA 5F1YA 4TZ6A 4PR0A 5J1SB 3AF1A 3HU5A 2FFHA 3MT8A 4UAJA 3FOEC 4BKRA 1L6RA 1EXWA 1YR7A 2CXTA 2JHCA 2WWFA 5CW2A 1JHZA 4LJ7A 3WNZA 1V1RB 4NBVA 3GFVA 3DDHA 1QZUA 4LYAA 2PZAA 1QZXA 1V7CA 1QORA 3PCXA 5AIAA 1P5HA 2YHIB 3P0RA 5TMBA 3KKAA 1HLDA 1NJGA 1NI5A 2WIFA 3ZE7A 4R2XA 3EDCA 3N53A 2R5WA 2CPRA 4YWHA 1Z7GA 4IKPA 4TRRA 4YAFA 1FFCA 1UBCA 3UEOA 2F3PA 5L1JA 1ZESA 3A6DA 1E1DA 3C45A 3AR8A 4RESA 5JPCA 1DAPA 1U4OA 2ZT8A 4ND6A 2K4PA 4F2DA 4OYRA 4XA5A 3W9YA 4UVHA 4F4DA 5ITZA 4HUQA 1NKTA 1VZ2A 4ECRA 1AKNA 1UJ4A 5A4KA 1P2SA 4WFIA 4C06A 1TLFA 4FZ5A 1SD1A 2BFDB 3DMTA 1BGXT 4KDEA 4DHEA 5AUPB 4RTKA 2Q07A 3G8YA 4Z4IA 4UU0A 1YQDA 1ORIA 1IPHA 5F4ZA 2V7TA 3DYVA 5EE0A 2BONA 2QK4A 2VSOA 3KSBC 2P67A 1H5NA 1X74A 2ZCVA 1PNOA 2C2EA 3D7LA 3JWPA 3GPCA 4IFBA 5C81A 1GN9A 3PMNA 1CJVC 4ND7A 4J7UA 3IP6A 5B1SA 1M5RA 3DPSA 2JA2A 3HSKA 3RAGA 1LF5A 4L8YA 4NG4A 3OLQA 3ANNA 3W77A 1UBJS 3UOAB 1USGA 4CEJA 4QTUB 5HUHA 4GWLA 3VOAA 1E9EA 1D4FA 2P7HA 2AEMA 4BWYA 1XD2A 1CJMA 5A7HA 4AVYA 3SQNA 1VMDA 4H3HB 1T9ZA 2XUJA 4BJ3A 4HATA 4ECZA 5ADWA 1GTRA 4IQVA 1BGVA 3MILA 3KT8A 1XUOA 1WCNA 2FQQA 2Y66A 3B51X 4BO7A 5HKAA 5EJ5A 4CL0A 3WQRA 1KJYA 3QH4A 1DPFA 1XSEA 2FW7A 1R0SA 3PS9A 3TLKA 1GT91 3OD1A 2BR3A 1OHHD 3RJ5A 3ZYCA 4DNQA 4MVCA 3N2NA 3MDCA 1L3UA 2PGDA 3LM8A 5DDYA 3DZHA 1JJAA 2JI4A 3FZNA 3H0CA 3D0OA 4GBED 3D2AA 4PINA 3ITDA 2JEJA 3NV7A 2GZ3A 3W0LB 3O1IC 5BVHA 3E9NA 4GS5A 3VJLA 3GG9A 2ECOA 1N5DA 3KWMA 5CAEB 4ESVA 1HDOA 1OXUA 1RWMA 1RRCA 3AT1A 1WJGA 2WSBA 5G1NA 3SDZA 3CIOA 1K8QA 3VR4D 3JALA 4JH0A 2F17A 3MCTA 4QTZA 4D6YA 1KERA 3AJDA 4J9OA 1YHZA 2BKUA 4GBMA 1MMFB 4AG6A 2R00A 2CNNA 4DMLA 3LW7A 4H2DA 3SEFA 2O57A 4Q66C 3N6XA 5FO1A 4IUDS 4QBKA 2QUIA 1FVOA 2RGXA 2KKPA 3PTLA 2HDNB 3OE7D 2HIAA 4EMBA 3B3AA 4E08A 2BCUA 3KOUA 1A72A 1XX6A 3CRZA 2HHVA 2Z09A 1J4AA 3GRCA 3IELA 3QGMA 4MVJM 4O2AB 1K7FB 4X60A 3EPJA 2H3IA 3G5TA 5MFPA 1BHO1 2F55A 3P71T 1UDAA 2NSJA 1I94B 3LVVA 4BNWA 3QNUA 1YULA 1M0TA 5AJXA 4DAEA 3FYSA 1I80A 3OQIA 5JSYA 4QW8A 1WCIA 5DFAA 3WG9A 3WGZA 8ICWA 1FIQA 4YFKA 1WMBA 1XZAA 3O8BA 1KQPA 3R23A 4IDOA 3C1OA 1K7CA 1N6KA 3EJ6A 3V7JA 1W9MA 1VCIA 3ZHQA 1LLUA 2HF7A 5KFRA 2CL0X 3KUKA 4TUQA 1GLGA 4Y6PA 1UQTA 1WP4A 2YL2A 3IVXA 3AU8A 1AUPA 1UCFA 5DEOA 1PR3A 1ZGJA 3BL6A 5B3KA 2FPIA 2H7CA 3AHDA 2YXNA 1UEJA 1B93A 1CUAA 1FNCA 2EQBA 3I4LA 3MELA 2L0XA 4NNPA 1Y6RA 4PLHA 3TI7A 3TR6A 3VSDA 4C3VA 4EY8A 1W0JA 1UAYA 1IWPB 5KAIU 1XMPA 2O05A 2P3QA 2PGJA 2XTMA 4JQYA 1QONA 2XGGA 5FNVA 5LMNB 1Y3AA 2OO3A 2VC2B 2ZIWA 3GLVA 3I34X 3EC7A 3N7UA 4YLGA 1XZIA 2CXUA 3HSSA 621PA 3L4PA 3FD8A 1HL7A 3MPOA 4NYIQ 2VAMA 2HCJB 3EGEA 3FTDA 4NONA 5INTA 1BS9A 2OYYA 1BOOA 2HMAA 2WOOA 2WTNA 2FW0A 4RBNA 2GZ1A 2R6DA 2VUHB 3WLTA 5AW8A 1A8IA 3U0BA 2CV2A 4MHSA 2BY4A 3BDVA 2KOBA 2CNBA 4NL9C 2RI0A 5EG5A 2EKQA 2BHNA 1IK4A 2NSDA 1SQ5A 2Q0XA 2WAAA 4RPKA 5GP1A 4W5RA 3BSSA 2EAMA 4M49A 3TINA 3KCQA 2YVLA 3PNPA 3OIGA 1TD1A 2QV7A 4KQHA 3KFXA 3R5HA 4TMKA 4BQSA 3HP4A 3JQRA 3BJIC 1D5CA 5DCUA 3VNSA 4DGSA 1BMTA 3JS5A 1D0SA 1E1KA 2WW8A 3TUJC 1EQAA 1EQ2A 4UBMA 2QENA 3I5XA 3PF8A 2XB9A 3H0EA 3NT2A 1RLOA 4UVDA 4WJKB 2KIVA 4NYIR 4YUXA 4ZCRA 2REOA 3ZVMA 2GCEA 4CF4A 8ICIA 4CKBB 1P62B 2RBGA 1ABBA 4KO3S 3WKBA 1U0JA 2O0LA 3H0KA 3ADDA 4YCSA 1XRLA 1AMNA 3GV7B 1GKYA 1JSRA 2QNIA 4IDHA 4LOKA 1JI0A 4UCXA 5AJYA 4X71A 2MR5A 4MRMA 1V3VA 5T3UA 4UAGA 1GUYA 2H5XA 3EY4A 1IU9A 4I5IA 1JLRA 2ONYA 3F5AA 4V2IA 1P73A 4Y18A 2JAHA 5IN4A 3MBKA 1ORWA 2R4TA 3PD1A 1J8FA 1E8NA 1ZSYA 2DKFA 2EATA 2KHQA 5JT1A 4OHYA 4C5AA 3H1AA 4J4BA 4CL3A 1WE2A 4B7CA 3RIGA 1NKVA 1U0RA 4I28A 2EKZA 1EPUA 4CFSA 3EPKA 4BGUA 4P0PB 1KDVA 2YWDA 1MJ5A 2WP8J 5JRZA 1NUSA 1RHKA 2GS9A 1OJ7A 2PD4A 1QQ6A 4QREA 2CHFA 4C7OB 5EWEA 3FFXA 3ZIAD 1GYPA 4IQGA 3L7BA 2OT3B 2VF5X 5AOBA 2JHAA 2XO7A 1X0VA 4PVCA 4BNJA 1U1IA 3TL3A 4LHEA 1NP6A 3UJBA 3WGYA 4WLNA 4PGHA 4PGMA 2PFPA 3L02A 3SYNA 1B2RA 5ECGC 5JS1A 1C2TA 3KTAB 3T9FA 3OPYA 3MBOA 3FVRA 4JB2A 4ZZIA 2ZXIA 2O2DA 1OYYA 3Q8LA 3ZXIA 5BVGB 3DT6A 2R2GA 4E51A 1G6KA 1MQ9A 5BOSA 2ZVJA 1UZLA 4YJKA 1G5QA 1NXSA 4B47A 2Z2IA 3FX2A 2ZBDA 1B76A 4EFDA 1S2NA 2YBDA 2AFHB 4NLLA 2MUTA 4GXKA 4ITUA 3UHJA 5KTQA 1NR7A 3CH4B 5C5JA 2J48A 3F96A 3M4XA 4II2A 4O4LB 3R7WA 5KPJA 3GFGA 2JPDA 4D1YA 2JF0A 3LXXA 1OI2A 3S70A 3CSUA 3TG8A 2KM1A 4MVJI 2GFHA 1R9MA 3ILHA 4TT3D 1X7YB 4Q6BA 2OCBA 1VHWA 4W8GA 4CF7A 4FILA 3QHPA 5TQ0A 1SB3C 5BV8A 9ICCA 5A0VA 1RZ3A 3AOEA 1UKVY 1WPGA 1JHDA 4LFCB 3BWDD 1NW6A 1Q44A 5DBIA 1OH7A 2XVZA 2F77X 1SKSA 1MRZA 1ANKA 1WXDA 2GJ8A 2W8BA 2H4WA 3BL5A 2WNHA 3DE1X 4OIMA 4X7RA 5AVOA 4D7AA 1DG9A 2AG6A 4QG7A 3TW8B 5BV2P 5C52B 1KVRA 3IC5A 4MWDA 1NMYA 2P27A 4EUNA 1LI7A 1ZH4A 4G4GA 2Y9UA 2VBFA 3MTIA 4ID3A 4M0DA 4X3OA 3H4BA 1FRQA 2Y76A 2R5NA 5GOZA 1IUOA 5H81A 1FDUA 4PZ9A 4K9MA 3DAOA 4KR3A 1RRGA 3H84A 4JI2B 1XEAA 3C7CB 1LJUA 3ND5A 1R6UA 4MKXA 4K6KA 4XWGA 4CPDA 421PA 1UJ2A 3GL9A 3HHEA 3TE6A 5KKCA 2YJ6A 3JPOA 3DNPA 2VYVD 5D01A 2FLKA 3EXG2 4QBHA 3VHLB 3N8GA 4PJ0U 3OSZA 3GI1A 3DVAB 5AVSA 5KFAA 3QV2A 1BW9B 2HNKA 4WXHA 2FDCA 3NS1A 5A4JA 2DERA 2PSHA 5KKAA 2HU7A 1Z56C 3E5HA 3WLEA 1SXJA 3TQSA 4QICA 1A5TA 3Q9UA 4RMJA 5J4HA 1UMCB 2AOTB 5DW3A 5CFPA 1Q1ZA 1ZQVA 2OTCA 3D7MA 3LOPA 4A1OA 4V0KA 5A03A 3Q3GE 3QEAZ 2G40A 3T38A 3QOYA 1BTOA 1YS1X 2NYRA 3BZWA 3H87A 1KMHA 3KB8A 3PNKA 4L0CA 3AR3A 5T8KA 3V8NA 3WYAA 5BXQC 5FOWA 1PNTA 1E18A 1K1EA 3VR5D 2X19A 1NNLA 1NNUA 1UBHS 4O6VA 1I3LA 1A9XA 3QUTA 4BEBA 4QJBA 5KFCA 1SL2A 1VBMA 3LT5A 4HLNA 4D9GA 1RT9A 4ZAFA 2Q28A 4WNAB 4F3NA 3C1TA 3O3MB 3ZR4B 3GLIE 2E48A 5BYBA 2C7QA 4NLNA 4QOFA 2FPUA 3QUQA 2IDZA 1VE9A 1OLSA 2IITA 3G49A 4E14A 4F3RA 4W5NA 1O77A 3VU9B 3DG9A 5HW0A 1CZKA 1T3GA 4RHCA 4W9NC 4OK3A 1UBMS 2VT3A 4YPFA 2C58A 1GNVA 4ZYXA 1U7UA 2XAUA 2LYHA 5HE9A 2I66A 2WDPA 3IBGA 5ILQA 1Z8FA 4Q16A 1VJRA 4MV5A 3VR0A 3COJA 1YAJA 2ACWA 4I6EA 4AMVA 4ZI3A 3WLLA 3CEAA 3KHKA 4F56A 4S35A 5CFMA 3WMEA 3UWOA 3PEVA 1YB4A 2Y1IA 4OXRA 4MAFA 4BFZA 2WWWA 1U0HC 2BI8A 4QNRA 4Z0HO 3VPXA 2ZIFA 3I09A 4RABA 3EVTA 3UO8B 2KE5A 5EP2A 3P2JA 1SK9A 4ZVSA 1GZ6A 1H8HA 1AS0A 1TM3E 1AOXA 2RDMA 1LDNA 4N7MA 1FCJA 3ZKWA 4B84A 4OI0A 3PWKA 3TZHA 1TKRA 2J7PD 2XY6A 2HU2A 4TUYB 3FROA 1ILWA 1VSTA 3QVMA 2H54A 2CHQA 1Y98A 4OP3A 3UTCA 5CXSA 3U4AA 3ZEIA 1AHIA 2PY6A 4CV3A 4D56A 4HMPA 4IIDA 4EF4A 2P9YA 2XMSA 4HNUA 3DKRA 4X8HA 3RFCA 1U9IA 1LPAB 5E3JA 1JKMA 1I4EB 1CVRA 3ENKA 4CMEC 4ZHQF 1I4DD 3PP8A 1J2JA 2B2XA 1QK5A 1WHSA 3FAZA 4HQKA 4EQ6B 3IV6A 3QVXA 3RARA 1J0XO 1FXWF 3DO5A 3GAAA 3QEMB 4UPEA 3FYUC 2V97A 1A04A 2EZXA 1Y1KE 1Z26A 3UOGA 9ICKA 2PT6A 3SYTA 5CDUA 1KDPA 1X6JA 1ZJ4A 4KEAA 4FWBA 3HI6A 4UMDA 4K0KB 2RGCA 5CRIA 5D49A 1GPJA 3CZRA 2R5FA 4PIVA 4B45A 1JEYB 1JGTA 1H22A 2CLLB 3CNEA 2R6CA 2W83A 2QN8A 4MWZA 2QN7A 5U4XA 3RROA 2X3FA 3GFQA 3OECA 5L7YA 2GEUA 2NQTA 1MUUA 2ZI5A 3FPLA 2O8BA 4TV9F 3W1EA 2YHUA 4H1HA 3TIVA 4E22A 3LWMA 2WWHA 1JWBB 3O92A 4KJXA 4L73A 4IIVA 4DZZA 1EK2A 1UH5A 2NN3C 1U7ZA 1P77A 3LTNC 4REOA 3PQ5A 4PGQA 1B00A 5ARCA 4LF6B 4Q8EA 1G8YA 1KK0A 4E2YA 2F3NA 5CFOA 3OCXA 3A9TA 3AC0A 5GVRA 4RXMA 1TUIA 1U3VA 1AV7A 2JFXA 4OL9A 4QOJA 1ZAYA 1KFCB 2NADA 3ABZA 1KVUA 3FYDA 3GC6A 1S2LA 3MBIA 2HIHA 4FNMA 2BF4A 3TF5A 5IS2A 1ZQYA 3NH6A 2BGGA 1H0RA 2MSNA 1LTKA 4TZ0A 5AK6A 4RVSA 4NV0A 4Q24A 4INAA 3MGCA 5E95A 3UCFA 3VVMA 2A92A 4CEHB 1CNMA 1MOPA 2OZLA 4NENB 2VJAA 3FJOA 2VDUE 5EZ5A 1O8BA 4A0SA 4LZZA 2GFQA 2XRYA 1RPNA 4UJ5A 1P5JA 1SCIA 3FSRA 2BCEA 2B92A 3EW9A 1QHFA 1EG7A 4Z7QB 3H1FA 2PKWA 5JASA 1G5PA 4DR4B 3IUBA 5LL6P 1WDMA 2P2GA 1E62A 3BGOS 4LMBA 1JMYA 1BHSA 3ROKA 1KY5A 3LS2A 4PSVA 1QKKA 5DN9A 1PZFA 1T2AA 2FG7C 3IQEA 3MTDA 3TSOA 2EJTA 5KTYA 5JXGA 1HUQA 4JITA 2A9OA 4LNAA 4MCJA 1IN4A 4AROA 3DOUA 1YDGA 4IR7A 4BFYA 2K4IA 4HVLA 5AW6A 4MKGA 3UXOA 1ZQKA 2ILTA 2Z4TA 3F53A 2AL7A 4IDCA 1VCOA 2W2TA 2IXFA 2C4HA 1ZQ1A 1ZITA 3F6BX 1JA1A 4FFLA 2NAFA 3TVTA 5KHOC 3D1VA 4P32A 4ABYA 2RGDA 3PVZA 4ZK6A 2Q6OA 3KAQA 4F5OA 1A50B 4HDKA 3S8MA 2H85A 3ZOZA 3AIIA 2A59A 3T79A 4BVAA 3C4QA 1T0UA 4MYRA 1O94A 4RMHA 5B7QA 5CEHA 1RZVA 1RSZA 2JW5A 3F5DA 3I37X 5IMSA 5C53B 4UKDA 4MUGA 1DGQA 2FMPA 4JU9A 1XOIA 1LFDB 1WDKA 1N7GA 2AKEA 1DUSA 2O8FA 3CMCO 1KHHA 4QQFA 8ICVA 1T8YA 4AZ0B 4Q37A 3CZAA 1ZNQO 4RTQA 1U31A 5EESA 3KOYA 3T3MB 1ITZA 2DPLA 5ULLA 3SYZA 3A1DA 3FGOA 4G8CA 5JS8A 1QZTA 3JWIA 3OIUA 4X66B 2OAP1 2OGWA 1SGGA 2Z7JA 2BE9A 2HW3A 1HLPA 3OMXA 2XB2A 3H04A 4HYTA 3MFIA 1PJZA 1KKUA 1OASA 1XVAA 1Z28A 2BF7A 2IT1A 1DTWB 3BD9A 1XTZA 3BGSA 1G8AA 3HKDA 4DG8A 1DJMA 1UJBA 1IULA 3WOHA 5SV2A 1FFDA 4WFJA 2HWYA 2YZ2A 2P69A 4F2GA 2PZJA 2CXYA 3E5MA 2XV1A 1FRVA 3EXEA 4C1BA 4XGNA 4MHTA 4QO8A 4OV6B 2VP0A 1NU8A 1BWQA 1SEPA 1CR0A 1N4AA 2W9XA 3AEYA 5TX7A 4NCJA 2X1LA 2BFMA 3EG9A 2H4ZA 2HWWA 3IJ5A 3LUPA 4X44A 4EA6A 4LDQA 3WLKX 5KFNA 3ZVLA 1GZDA 4AIRA 4BMDA 3D8TA 1J0DA 1E79D 3WL8A 4BCBA 5ALTA 4MS1A 3WGGA 4I5GA 1PO7A 4KQXA 2D8AA 2ZRNA 3QFRA 4FMPA 5ES3A 3OESA 4U7HA 4S04A 1VHQA 1LA2A 1X8XA 1WCYA 2BFCA 2DR3A 5IIIA 1HE1C 4AN1A 1YH3A 2FPRA 1E6MA 3OO0A 4DMRA 5BURA 4YHHB 1ZRMA 3K1RB 2Q7DA 1R16A 3A6EA 2VTEA 2CDBA 4X93A 4Y2GA 2FGJA 2FEOA 1KTQA 3EISA 3KP1A 1VE3A 1ZQZA 1P4RA 1VGVA 3TDMA 4Y6SA 2FE9A 1I5OA 3Q8SB 3OX2A 3EYWA 1TKAA 3UCXA 1D1PA 1M8FA 2IPOA 3GOQA 3OLYA 4L6IA 3HBFA 1JS1X 1NX9A 1GFSA 4MQMA 3TN7A 4PW0A 3A70A 1QKJA 1TL7C 2WYVA 4YFYA 5J2TB 1D2EA 1TUEA 2IE0A 3C15C 4LVNA 1S02A 2J6CA 5KJCA 2XGPA 1XC7A 2FOXA 2YQ4A 3RSLA 4YJHA 4DUGD 3R6DA 5GM2A 1C41A 3K0FA 2IV3A 2JBAB 4O3PA 3R5TA 4R3NA 1CEYA 2YXDA 2X2FA 3WBBA 1ECWA 3NDPA 1QIEA 4O02B 3ELWA 2JZNA 1ZL2A 2FMXA 4EFMA 2QMUA 2ZITA 2WM3A 3PXUA 4Y7DA 3UAVA 1Y7LA 5IILA 1XEXB 1MQ3A 4UVGA 2K4HA 1N63A 4XEUA 4NEQA 3G9ZA 2OFXA 4LWOA 5H3CA 2W54A 5HILA 2QG6A 2ZIGA 2BJVA 1IB0A 4KAJA 5CTAA 4JLSA 1N7IA 2F43B 3PDWA 3JXEA 2GJSA 4KQGA 1SC6A 2X8JB 3CCCA 4MW0A 5ALRA 5AP9A 9ICUA 1YUBA 1QCKA 3C41J 3CF0A 3I6QA 1B6GA 3P9QA 3ZW7A 5C9ZA 3G2NA 3GLIA 3OTQA 4HKTA 1T9CA 1USKA 2YIDA 3D2LA 2B4TO 3E8XA 5JLJA 2WFMA 3HKZC 1Y0BA 3CTMA 2R00C 4A3SA 4WKPA 4RULA 1C0KA 2QVZX 5EXEA 3U7QB 1U5CA 2IYXA 5GQSA 1UBUS 2JGAA 2WJIA 1OWMA 2CNOA 1AKWA 4CJXA 3C1YA 1CUBA 1KS2A 2PGOA 3DVSX 3OQPA 1HPLA 1J2RA 1RHMA 4OVKA 5KNBD 1Q5PA 1XLTC 3K5HA 3I83A 3DV0B 4YJDA 5LYJA 1Q21A 2P2DA 3W1VA 3ZE2B 4YREA 5KEIA 2AJ8A 3M4ZA 1YZQA 3Q11A 5JMPA 3SEIA 1S3IA 3H9GA 1XMOB 3HJGA 5G41A 3EGOA 1SV4A 5DNAA 1IY2A 4H1VA 2ZYVX 5AIBA 5DWVA 4RK6A 4PYIA 5EL0A 1Q57A 1L8AA 2OB2A 1WMAA 3E7FA 4KDFA 4UUMA 4M9SA 4FZ3A 3B2QA 4B8ZA 3K2BA 3KQQA 4B6QA 3T5BA 3I5YA 4JVOA 3KXDA 5KC9A 1G3RA 5WRFA 4J0EA 1A2OA 5B3AA 1DT5A 1E1LA 3O5AA 3IEIA 1C4KA 1PT9A 5JBIA 3NB0A 3H5IA 3MMZA 1FQOA 1HNXB 3IP7A 3W3ZB 1YS9A 3EPIA 3R3WA 1Q1NA 3HXMA 1FP4A 1V26A 3JAWA 3ZDQA 4DQ0A 3FYUB 3BTUA 4J9KA 1J1UA 2GR9A 3DCYA 1VBNA 3K8ZA 4Q8FA 3INGA 3LGAA 1A3CA 1RAGA 1S4QA 1XU7A 4JBYA 5DM60 4DQVA 1K7EB 1V37A 2XUZA 3SX2A 4HV4A 1HFKA 1VG9B 4NJMA 5LSAA 1BMDA 4TKVA 3OTWA 4QQRA 4MI6A 2P3OA 4F2HA 4FFDA 1MEOA 2WJGA 3NTVA 2HMSA 4ARSA 2C7OA 3GUYA 4KH0A 3CKKA 2Q4TA 2Y3IA 4QPDA 1KYYA 1RJGA 1YB7A 4HDRA 1H8EA 4UAYA 3A27A 5EZYB 5GV8A 4IQUA 2E3TA 5J8YC 5J0YA 1CY6A 4GMXA 4UNQA 4WPGA 1EHYA 1O9BA 1YVRA 2RHWA 2YV1A 3KJFA 3WLHA 5IUJC 3GZFA 2JATA 1S9DA 1JDSA 3C0KA 1O57A 4QWCA 5DBAA 2A1TS 2VOJA 1HC7A 5JJLA 2UKDA 3TI9A 5F7OA 4P9NA 1E5TA 1UJCA 1B22A 3AEZA 3CG4A 4M8SA 5JYDA 1Z4NA 3SLKA 3GO4A 1ZBDA 4I8DA 5A0TA 3P2OA 1A4UA 5GADl 4I2AA 1ISRA 3ELBA 1Z5NA 5LQAA 2X42A 2AXNA 3KWJA 3O7MA 4NBWA 3U3DA 1W87A 5I8ZA 5GJBA 1PQUA 1NJ2A 4C8OA 2FFQA 2PS1A 1G21E 5J0SA 4NAVA 1EFVB 9ICEA 3ELUA 1WM1A 2QSZA 3GJSA 3Q7IA 2BFPA 4EH1A 1UBTS 4G9EA 1A71A 2PRJA 3PB3A 2HQOA 2N0SA 2WZBA 4J0CA 4JP1A 2Q0QA 5TMEA 1ZOPA 3D81A 1F44A 1TRHA 2DPMA 2Q5JA 4FHCA 4OJNA 1Q15A 4QQKA 4WLEA 5CYFA 2IYUA 3RHTA 3SN6A 4D9FA 3OKFA 3KT0A 3ZJVA 4NU8X 4BNDB 3EVNA 3SVZA 4NSNA 2XWPA 3U1TA 1VB3A 5KYYA 2H9AA 4DIUA 1TK2A 2AWOA 1LGYA 5HJ2A 3AI2A 4BQQA 1YXMA 2RH5A 3C39A 3DKPA 2OM2A 3F78A 2PYIA 3RUEA 4CKEB 1PJSA 4Z3KA 2KJ5A 4RSGA 2IXDA 1KJIA 3OZ7A 4MKIA 3QV1A 4Y2RA 3QBVA 3QVOA 4KREA 4YAKA 5K2MA 1ULBA 3HKCB 4R1LA 3H0RB 4ZU1X 4G1VA 1PJLA 4FI3F 1NFQA 1SIOA 4XPZA 1KJ8A 1IQRA 3TPZA 5G0SA 1TJNA 1L4NA 3DNMA 3W8FA 2C5SA 4J9UE 2XJ4A 3OWHA 4HQ0A 4QO7A 1E7MA 2R2AA 5D6OA 2I3GA 4J7CA 4EB6A 3AHEA 1SG0A 1TK9A 1CUXA 4RQMA 4AMBA 1LB1B 3DBVO 4JYAB 2VWGA 4ZGBA 4NCXA 2O2ZA 5JQGF 4KRGA 2J0EA 1I33A 2FLNA 4NFYA 1YVDA 3MR2A 2GKSA 1M72A 4B7XA 4HRXA 4MRSA 4IUYA 1B41A 2D5IA 4EY7A 3WBJA 4C2BA 5ERXA 2YXEA 3AEQA 4C9BA 3RYCB 3C14C 2HQ1A 4NBNA 3MWEB 2X5OA 3GQBA 4BY9E 1Y9AA 2OZPA 3N0WA 1S7CA 2YZMA 3VNRA 1L7XA 2O2XA 4GEKA 1V4VA 1AS2A 1BSVA 1EQUA 2ZKLA 5AICA 4R5HA 4I2BA 3CLRD 3CCBA 2BTQB 3V3TA 3HBLA 2J0SA 2IYLD 3WWOA 3DXYA 1KEKA 2G72A 2WU0A 4GSKA 5KG7A 1E69A 2QD4A 5ECYA 4K9NA 3OIWA 3PVXA 1IPFA 2A94A 3UK7A 2WT9A 3DP9A 2D62A 2ZLBA 4ED9A 4L3OA 4JFAA 4RZQA 5FQOA 1XZGA 4RYLA 3AR6A 3WU2U 2YQEA 4JT2A 1OWLA 4WMLA 4ZOEA 3D5EA 1I7SB 4U7CA 2CLKB 1JLKA 4O3RA 1JDJA 1Y3IA 4EL0A 3MJDA 5COQA 5D87A 1MFZA 4P4SA 2J6TA 3HJRA 3OEEA 4U2GA 3GGJA 4JLPA 3RUDA 1EVLA 2JFFA 2ONJA 2WAQF 2HLHA 6YASA 3DZDA 2BDUA 3EH1A 1RYHA 1F9AA 3PXEA 4QHSA 4RGVA 1AQ6A 5IJ0B 2HJHA 4PHFA 4WNYA 5BSKA 3DZGA 3MS2A 2GBIA 1KZ4A 5D5PA 5I7EA 1CG6A 5JIBA 5THKA 2B8NA 1DIBA 4TRJA 3WMWA 5DT2A 2HF2A 5EMHA 3IBTA 5ICFA 3VR1A 4YCXA 4DUGA 7REQA 4S3MA 2ERYA 2C95A 4D8WA 2C2KA 1Y1PA 2F3RA 4AG5A 1SC4A 5DDIP 1KJZA 1C2YA 3GVXA 3QXCA 4NOMA 4X1KB 4B46A 1PR9A 4PYRA 1SC1A 3DXZA 3SXUA 1ZOIA 2ZAIA 1BXZA 4AB1A 1DWOA 1HRKA 5AHOA 2XEDA 3PUKA 4EFKA 1EFPB 5KTKA 1URPA 3T7CA 5ADUS 2PG3A 2O0JA 1R6DA 1UPUA 3G7SA 4H27A 1VLJA 4IDDA 1M7GA 1ESEA 1AQIA 1NATA 3ELYA 4J90A 4ZI7B 1XYGA 2OR3A 2W2OA 1J2TA 2JLWA 1NN1A 2IHJA 1K75A 2K2QB 5GMOA 1UM9B 4LWQA 1D07A 2UUBB 3NP9A 1KR2A 5GJCA 5FWXB 1YE5A 4WEOA 1RI3A 1F2VA 2M32A 3NHAA 1JVSA 1XQ1A 2IIQA 1BYUA 2PKQP 3IAS1 3NW9A 4R2HA 2ASDA 3SV3A 2UZ1B 2WVHA 3Q40A 4B87A 5BWCA 3ZE9A 5KKNB 1JIJA 1N6PA 2FZ5A 2GGSA 3H3FA 5K8JB 2DY1A 2HJRA 2AVDA 3TAUA 3NASA 2B5WA 4Y7CA 4H15A 2V3CC 3E5NA 4FE4A 2LCQA 1DIGA 1QLWA 5ALOA 1U2PA 1SA0B 3EIWA 3RJFA 5EP4A 1E3LA 2WF5A 3WL5A 2NZ2A 1TGYA 4QVIA 2HK7A 3G79A 4TLEA 3P2KA 3IAAA 1IUPA 4UCWA 3E1SA 2X9VA 1DJOA 3NXKA 2ZTSA 1GILA 2KZMA 4GSYA 3ZV6A 2Y92A 4YJGA 5L4LA 5AI4A 3KYJB 5AK3A 3E7DA 2BGKA 4C78A 1VIDA 4YP7A 1FFAA 5KTSA 1SULA 4PXYA 1AO0A 1PWZA 1EE1A 2NZYA 1KNXA 2E8NA 1Y6QA 5ICGA 4F3KA 2UVVA 5A6SB 1D03A 3SFTA 4I14A 1ZVVA 4RD3A 3O03A 2IHYA 4GKVA 3ZNPA 1E2PA 4MHVA 1K5PA 1XTUA 4FGZA 5IC5A 3WX0A 1Q8KA 2FG5A 2YWGA 5EWJA 1ZVMA 1NFRA 4K05A 5DX0A 1U48A 4K3UA 4OLHA 1P8JA 4TMTA 1DB3A 1BE1A 1CY1A 1BA2A 1JIKA 1GTL1 2F6RA 1GTJ1 3CLSD 1CJKC 1RXSA 4IG9A 2XOEA 4JR2A 5A0FA 4BOYA 1KI1A 1RQPA 4RZ3A 3PTAA 3AJ8A 4CM1A 2Y68A 4ZT6A 3OSNA 1FB5A 3LA6A 1T2DA 5IC4A 4B7UA 3RWMB 3SJUA 3PXBA 3ESYA 3EGIA 4JUDX 4V1CA 1M54A 3M81A 5J1TB 2WHQA 1AKMA 3NS7A 1MJGM 1OREA 1JFSA 3OZAA 5EUBA 4Q7LA 3W5BA 1L3VA 1U1DA 4N54A 3W2IA 4I3HA 4G89A 1V85A 3LLSA 2PKYX 5K3FA 3OO1A 3QKWA 3TQHA 1U4NA 4DM7A 2F48A 1XU4A 3H3XA 5FUYA 1NBOA 5JDIA 2C3OA 3EEIA 3K09C 1KHTA 2ZSUA 3FHLA 5IAAA 3V4LA 4AAYA 5JCJA 3FNEA 3EUEA 4H31A 1YQWA 3GRFA 4NOJA 2FP4B 1ZQUA 1B8NA 3ICCA 4R9RA 4ZQBA 1QIGA 3ZTTA 3FZGA 4E7PA 1JB1A 4K6MA 3W5DA 3I5UA 1SCUB 4H59A 4FHGA 1WSBA 3R7BA 3GA5A 1MX3A 3WGVA 1F3OA 4FT4A 1ONOA 4B6PA 3ER8A 4KQWA 1FDSA 4BC0A 2CRXA 3A3KA 1PEAA 1W5EA 3CPJB 3ZCVA 4XA8A 2DWPA 3FWKA 3AHFA 1JRPA 4I55F 2EH9A 1DKLA 4QBIA 4EZBA 1QQAA 1BE0A 3HUDA 4XEHA 2IA6A 2HBZA 1EK5A 3D02A 2FSGA 3IUPA 3KR2A 1C4OA 2J87A 4I4TB 2IS4A 2GJAA 4FYKA 1YONA 2R86A 4NABA 3ZDXB 2Z56A 3EX7C 2HT1A 2YW9A 1O6CA 3KPYA 2NO6A 2G4VA 1B4FA 4OKNA 2GUGA 3RFXA 3N59A 3PLNA 3WWDA 3CLTD 3IV7A 3NUQA 3KKQA 1E3DA 1PWEA 3C5CA 2B9EA 3VR4H 1P7PA 4X00A 1YQQA 3N2GB 3ZX5A 4FSHA 3K8YA 5ENZA 4I0WB 2BPGA 1BFUA 1YDFA 4WINA 3V9AA 1JXEA 3W8DA 3B7PA 4DWVA 3MUEA 2R9VA 3U1VA 1MHTA 4D4HA 4ZO8A 2GBFA 2HHLA 2I1QA 2PLWA 3M6VA 3ZC3A 3OF2A 1DAFA 5HE8A 4CETA 4NI5A 5KFJA 3C1AA 4BKMA 2ATIA 2C5EA 1W5TA 2H5LA 3W5UA 5KYXA 2X0DA 5CJ2A 4QOSA 1GL9B 2I7DA 3RIXA 1RM0A 1EESA 2IA5A 4UFNA 4DKJA 1U49A 5FLKA 2DHQA 3I2HA 3RU7A 1JQAA 4YFVA 3DOEA 3VA7A