3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords PF00702 domain protein
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
4BKMA 2FPUA 2GO7A 4BX2A 3OCZA 1Z4MA 4I9FA 2C8KA 4E88A 5AM4A 2GHTA 3AR3A 1L6RA 5ALJA 2O9JA 3AR9A 2EATA 3RF6A 2HI0A 2I54A 5AVZA 1Z4JA 4QQFA 3ZW7A 2ZBDA 4XQ0A 2CFTA 4DFDA 4Y2UA 2AUTA 4JB3A 5AKJA 4CF4A 5ALSA 4EX6A 1RKUA 2G06A 2G80A 1MH9A 3R9KA 2P27A 5AVSA 2MU1A 2MSNA 3DDHA 3L0CA 2WF9A 3DAOA 3OCXA 5AVYA 5ALZA 4YCLA 3U19A 5ALPA 2HX1A 2ZG6A 3GYGA 3I6BA 3OCUA 2I34A 5IT0A 1J97A 1ZD4A 2JARA 3L5KA 5ALKA 3U7EB 5ALOA 2G0AA 1KYTA 4L57A 5AVUA 4EELA 5ALIA 1RQNA 1Z5UA 1YDFA 5ALYA 3WKCA 3MC1A 1S2OA 1F5SA 2WF6A 3I1YA 2G1AA 1TE2A 4C4SA 5AKHA 3U13A 2WF5A 2ZBEA 2AGVA 2R8ZA 1RKVA 2NO4A 3FPSA 1X42A 2DQSA 5A3SA 3AR5A 3A1CA 2ZOSA 3CNHA 4BEVA 3ZU6A 1ZOLA 5ALTA 5ALUA 3ZX5A 1CR6A 2YMQA 2JAUA 3OCWA 1U2SA 4EEKA 1Z88A 4HGNA 4CF5A 3E84A 3QNMA 2G09A 5ALNA 3ESQA 5AW9A 2JAOA 1L7OA 3E58A 3QU5A 3MPOA 1U2TA 3MN1A 4GXTA 1N9KA 4F72A 2Q5EA 2QYHA 3F9RA 5AI9A 4HYTA 3WKEA 5IT4A 2YFYA 3FPBA 3MMZA 4OD0A 4FYPA 3AR4A 3QLEA 4XPZA 4C4TA 3EWIA 1RDFA 1QQ5A 2ZXEA 4ZEXA 5AW7A 1VFPA 2D2VA 3WK6A 3E8MA 3L1VA 4UAUA 4Y3UA 2W11A 4YGYA 2YJ5A 4UM5A 5AW5A 1O03A 3D6JA 2AH5A 4Y2PA 3EF0A 1Z4NA 3OCYA 4Y2QA 5AW1A 4QJBA 3CZ4A 2YJ3A 3A1EA 3W5BA 1ZS9A 3SLRA 5AESA 5AI5A 1VJ5A 2FPXA 1S8OA 3KOOA 1N8NA 4KN8A 3WK5A 4UW9A 1T5TA 4RETA 2BDUA 5ALVA 4DW8A 3KD3A 1XVIA 2YMMA 2I6XA 3L0YA 4NV0A 4UU0A 4EZEA 3SKXA 5AVTA 3QUBA 3FGOA 5ALEA 3ZWKA 3SHQA 3L7YA 2YJ4A 1ZD3A 5AM2A 2R8XA 4Y2VA 4IFTA 4Y2RA 3PDWA 5AKXA 4J2TA 1FEZA 4OHFA 3QU9A 5ALMA 4Y2JA 4YIKA 1L8LA 3KC2A 1YS9A 3PCTA 2IA5A 4BNDA 4Y2SA 1Z4OA 4UARA 1K1EA 1TJ5A 3QUCA 4HGOA 3ZTYA 3M1YA 4G63A 4UMVA 2IYEA 5AKIA 4DCCA 3N8GA 3W5CA 5AK3A 1RKQA 2P69A 1XPJA 5A3RA 1RMTA 5AVRA 3ZUPA 2X4DA 2GMWA 4YIHA 3ZX4A 4OCZA 3B9RA 2G07A 5AHXA 1SWVA 4FFDA 3AR7A 3K1ZA 3U7HB 2EARA 4AS3A 3NALA 2NYVA 1SU4A 5ALLA 1O08A 3WKAA 3FM9A 3U26A 3BWVA 2WM8A 3NUQA 4CF3A 4KX3A 4RESA 1NNLA 1WR8A 1ZD2P 3KBBA 4YCMA 3FVVA 3FZQA 5FP0A 3NIWA 1SWWA 4NABA 2BY4A 5T41A 4B6JA 4HGPA 3N5KA 5ALWA 3WK8A 4J03A 3ONNA 2RARA 1RLOA 3P96A 2CFRA 4PNHA 1NRWA 1RLMA 5AW3A 1Y8AA 2YMLA 5ALXA 4ZEWA 2HOQA 3QXGA 2CN1A 5AM5A 1U02A 1Q91A 3UMGA 4NAVA 5AI8A 5AKLA 4BBJA 4FE3A 3UMBA 3ZI4A 4HAIA 3M9LA 3QU2A 2C88A 3I76A 5AM0A 2FPSA 2OBBA 4MWOA 4OFZA 4Y2TA 2PKEA 4F71A 5E0OA 3KZXA 5AW6A 5ALHA 5ALFA 2ZBGA 5AVQA 3HYCA 2RBKA 4UMDA 2YJ6A 4BX3A 3QUTA 4YH1A 4CE6A 2HSZA 3NRJA 3QU4A 3L0BA 2CFSA 5AW2A 1L7MA 3I28A 3QGMA 1RMYA 1VJRA 2YBDA 4CNQA 2WF7A 2ODAA 3QUQA 3B8EA 5AKKA 4KNVA 4ZEVA 2R8YA 1J8DA 3PGVA 2FPWA 5AKYA 2YY6A 4KYTA 2HHLA 4UM7A 2B82A 3UMCA 3L8EA 3IB6A 2RB5A 2W43A 4XE5A 1TA0A 4UATA 3DNPA 1QQ7A 4UASA 3TLMA 5AM1A 5AW0A 1Q92A 3SMVA 1EK1A 3HLTA 1ZJJA 3QYPA 3ZWDA 5AK6A 4KX5A 2B0CA 4L6AA 2PR7A 2FI1A 5AI0A 3NASA 1RLTA 1CQZA 3ZTWA 2AMYA 5AKGA 2B8JA 2HCFA 2W4MA 5AI6A 2FDRA 2WF8A 1L8OA 2ZBFA 1WVIA 3U7GA 3R09A 2YN4A 4HGQA 3WGUA 5AVXA 5AW8A 1YV9A 4MUMA 4NWIA 3A1DA 2FPRA 3OCVA 1IWOA 3L8GA 2Q4TA 2BDEA 2HEGA 2B1QA 4I9GA 3KDPA 3UM9A 4BNDB 2YMPA 1RRCA 3R4CA 3OPXA 1ZRNA 5ALGA 1XP5A 5IS2A 4AP9A 2FUEA 1NF2A 3E81A 2I7DA 3AR2A 4BX0A 3QX7A 3WKDA 1Z5GA 1YJ5A 2GHQA 2HF2A 2C9MA 3WK4A 1LVHA 3ET4A 2B8EA 2MU2A 1T9ZA 2HDOA 1RC8A 3QU7A 1QQ6A 5ALRA 4NFLA 2EAUA 5JJBA 3ZVLA 2B30A 4HGRA 2HF7A 2IOFK 5AIBA 3PGLA 1T5SA 2FUCA 3ED5A 1RPZA 3AR6A 3B9BA 5AKEA 3WK7A 4O8CA 1Z4LA 4UU1A 5AVVA 5AW4A 3RFUA 2GFHA 2VKQA 3SKYA 5AK4A 2OYCA 2OM6A 1RQLA 1EK2A 1QH9A 5AIAA 3WGVA 2JGAA 3SF0A 4H1WA 4YCNA 5A3QA 2I55A 2Q4RA 3L1UA 1PW5A 4XOUA 2C8LA 4C4RA 3N1UA 2P11A 4G9BA 5AI4A 2IOHA 5ALDA 4GIBA 1ZD5A 2B1RA 2QLTA 3A3YA 3VAYA 3ZVNA 3W5DA 4UMEA 5AKZA 4IG4A 3L8HA 3EF1A 1YNSA 1Z4QA 2HO4A 3AR8A 1WZCA 3J7TA 3N28A 1ZRMA 2IOFA 3SD7A 2NO5A 1Z4PX 3IJ5A 2P9JA 2C4NA 4EX7A 1L7NA 3L8FA 2O2XA 2PQ0A 2WHEA 2R8EA 5ALQA 3ESRA 3W5AA 1QYIA 1L7PA 3EPRA 3IRUA 1Z4IA 2WFAA 4UMFA 3U7FB 4AS2A 3OTQA 1TJ3A 1WPGA 1Z4KA 3ZVMA 1TJ4A 4L6CA 4DWOA 4EENA 5AICA 3WK9A 4BEWA 3N07A 3BA6A 3NANA 3ET5A 4UAVA 1YMQA 1U7OA 5AK5A 4KNWA 2RAVA 1RMQA 4BYGA 2I33A 2OA0A 2JAWA 3DV9A 4JDPA 5AVWA 2G08A 4Y2XA 1U7PA 1LTQA 3NAMA 2FEAA 5AM3A 1AQ6A 1JUDA 4Y2YA 3S6JA 3WKBA
chains in the Genus database with same CATH superfamily
4DQPA 2X6QA 2BQUA 5JTTA 4KLGA 3COJA 2J3IA 3I8SA 3M4ZA 2IBMA 4EY6A 5BMOA 5DJ5A 5EMMA 3ND8A 5F21A 3R9KA 4M6WA 1MAWA 2XCPA 4A1FA 1I1OA 4BV9A 3CUUA 1QQBA 4LNUA 4U7CA 1B6TA 1X1EA 3LE8A 1DRWA 2ZPAA 5J2TB 3SQDA 3EPKA 2FEWB 4E08A 3PY8A 4RJKA 1GRCA 3ANLA 1XTBA 3OC0A 4E31A 2QR5A 2C1ZA 5CA7A 1ULSA 4AO6A 3HUDA 1NMYA 2HOIA 3IOMA 4AC9A 4XCQA 3LGAA 3DCYA 5CFOA 4RY2A 3EA5A 4LJ6A 2ZI3A 4OXNA 3SHFA 1XRJA 5JYDA 4BB9A 3EK2A 2Z6VA 3IHWA 1OX4A 2EAOA 1JLLA 4B47A 4UFNA 3A0BU 3FLAA 5CNMA 2XHZA 3AONB 4Q24A 3RRYA 2F1KA 3VDNB 3BRWD 4E22A 1ZQEA 3MQ2A 1TJYA 2J6CA 3FGOA 1B74A 5CW2A 1C8LA 3CO5A 1EDBA 3A1SA 4G41A 1N0IA 2FN7A 2SHKA 3TL6A 2KVCA 3LMKA 1IVYA 2FZEA 3JQFA 3ZTYA 2JLUA 3NBKA 4PFQA 1XDGA 1TCVA 4HNRA 4TTTS 4MYDA 2C78A 3OTWA 3AUFA 8ICAA 1P8JA 1XVVA 4R65A 2DJIA 3SZ3A 2HNBA 2W8BB 1XSPA 4RELA 4PG8A 2XOXA 3SE7A 5KOJB 1Z8HA 2FH5B 1YRWA 3NWEA 2XGMA 5K9ZA 1GLNA 1T4MA 1UM9B 5CJ2A 1NX9A 2QRVB 3SVZA 3WNDA 2BQRA 4BRSA 4Q05A 4HUQB 2QL9A 2C2EA 1U90A 1FZTA 5F9NA 2ZR9A 3CWZA 2I5HA 4K87A 4MP3A 4KGZA 1E3JA 1XO1A 4A8JA 2WEKA 2FSPA 3LG2A 4U2DA 1RP1A 1XZGA 3OFSA 4YJ3F 2AXQA 3KVYA 1SVMA 3B3GA 4ZXPA 4JOQA 4DLBA 3T4XA 4U2GA 3TZKA 1KWKA 3FNGA 4ZOBA 4K9QA 3WQQA 4LW8A 3UG7A 4U5XA 3SJAA 3KXKA 3IDOA 3M4JA 3HG7A 4KE6A 2GEVA 4PLVA 3AQFA 2BUAA 3NM4A 2FV8A 3B5EA 1H4SA 4AP5A 2AMYA 5THQA 2FSIA 4RUKA 5LYYA 2BZ0A 2KV2A 1FFHA 2MSCB 2FLWA 2O23A 2FPIA 3O0DA 5FUMA 4JODA 3RABA 2K2QB 4XJTA 3FDZA 3R9IA 1BC5A 4TZ6A 2XKAA 3L43A 3R5HA 1Y6ZA 2C4HA 1GG8A 3PFBA 4JX9A 1US8B 4KR9A 1WMEA 3VHQA 4WK0B 2ZAGA 1KJ8A 4AJ9A 2FEKA 8ATCA 2OMEA 5IM4F 3WDMA 1CJBA 2AK3A 3MR5A 2ZI9A 1AGRA 3ONVA 2Q5JA 1U11A 2O6KA 1X1CA 1DO8A 4PG4A 4KLUA 1PFVA 2G1JA 3WV4A 3BTUA 3WNQA 1YFKA 2R60A 2C97A 1PW5A 3I6QA 4S2UA 5C35A 3BWBA 4A8HA 2XLBA 1G38A 5LQDA 1H2XA 4OBEA 2W6ID 3NWOA 1I0ZA 4KQ2A 3OHPA 3BH7A 1EIZA 4M9QA 2OCDA 2RG1A 2QORA 2DLNA 4JEHA 1PUJA 2YRXA 2V4MA 2QTGA 1M34A 5CP8A 2Q9AA 5JY6A 3ZKAA 4MXDA 4BEWA 3SCZA 1YKGA 2HCJB 3FDFA 3FTDA 3FOWA 1DQNA 1CSEE 1EFPB 1NYRA 1VXOA 2DR3A 1PTKA 1YU9A 4MGYR 3DEIA 4DSJA 4GR9A 4C05A 1Q95A 5HKOA 4XR4A 3QPVA 2AK2A 1LKYA 2XA9A 4KH1A 4PNZA 4E03A 4HOYA 3WOHA 1WOYA 2JBWA 4JL8A 4N1AA 3AL3A 3U7QA 1YL5A 1IEVA 4KLOA 1SQ5A 4GL4A 3EW9A 5CP2A 4KMMA 3NUZA 5JRZA 4E0DA 1FLDA 2GXSA 1T29A 5DDIP 3VKHA 3GCGA 4O0MA 1OFIA 3IILA 5BVGB 2X0IA 5AJXA 2P0EA 3FWZA 2G9UA 4J07A 3OSPA 1GDHA 3HYLA 4RZHA 3TQOA 4WZBA 2IHKA 4KTTE 5CD9A 2KVSA 4BEVA 2ON6A 3AXSA 4QODA 2W2MA 4URZR 1GWNA 5K51A 2Q8QA 2FNAA 1XQWA 1E3DA 1Z1BA 3WLPA 3KLPX 3DMGA 4PYMA 1UXIA 3HXTA 4US2R 2QRJA 1OI7A 3PQ8A 1ZH6A 5KHOC 1P7ZA 3FRJA 5TLSA 4HYKA 1GL7A 2C59A 5A0VA 4RTKA 4TN5A 4Y98A 2BGIA 5LD2B 4IHKA 4O4IA 5TJ9A 4JA0A 4DM3A 3NHJA 5A4MS 4UCXA 1NLFA 1SVWA 4K1LA 4EDFA 1E6UA 5C1IA 4L72A 5KT3A 4XGIA 3CZPA 2JFYA 2VUUA 4K7JA 1QRSA 2VPIA 4GXQA 5EJIA 4UTNA 5CT6A 2BM1A 2VA8A 5H3CA 1X7WB 1W9MA 4B4DA 2HK8A 3W2IA 2VHQA 3ZN2A 4UMVA 3H7AA 2OV3A 3WGOA 3U60B 4YA6A 3R0XA 4B7UA 4AM8A 4PAQA 4IHAA 2WM8A 2RLTA 3SLKA 3PQ4A 2GF2A 4TYMA 3CNBA 3TS1A 2YFHA 1NRWA 2RGDA 5CBPA 4XCXA 5SZIA 4RJIA 5JOQA 3ZZUA 4AUNA 3MDCA 3TVTA 5ALFA 8AT1A 4FKZA 1BHSA 1XSEA 3EODA 2H31A 1F5NA 2FF5A 1TTTA 4CNQA 2SKCA 3HCRA 2H48A 2MT9A 8ICNA 2H8KA 4DWIA 2RB5A 3R8XA 3W8FA 2NACA 5EJFA 3SGLA 2WMNB 2BUCA 3D3KA 2V4ZA 1G16A 3KKKA 2ZIWB 3NS1A 5LA6B 3WRYC 1GGHA 1C1YA 8ICCA 1X77A 3TVYA 5A1TA 4TVOA 2ZJZA 1I33A 3RSLA 5TQ2A 1RXWA 5CFQA 2MYNA 2VAWA 9LDTA 1JYFA 5FJIA 3ON5A 2IYVA 1ZC3A 1DO0A 2D5LA 3GIDA 1MDFA 4J1SA 4RPIA 3OPYI 3CPSA 2CXHA 3D5EA 3VA7A 1BOOA 1KQQA 3AEUB 1XRRA 4ZDWA 3HP7A 4IIXA 4JMUA 4FZMA 1ZL0A 1YZUA 1T25A 3NHMA 4Q4HB 3WK7A 2O2HA 1N1EA 7YASA 2ODWA 4EPXA 2O2SA 1SCJA 1KMHB 1XI2A 1SC1A 1E5DA 4E21A 4NLKA 1Q16A 1LF0A 2OEHA 1H0SA 5ALDA 4DJFC 1EH5A 3C39A 1TUGA 5I8PA 3MTEA 1L5YA 4E5NA 2HW3A 1KVUA 4KQEA 2P3QA 1JDSA 3U62A 2RGUA 3OZEA 4JSYA 3DEZA 4HLUC 3C4JA 3SR6A 3WK9A 4DV5B 5BMVB 2FR8A 1OGIA 4XWOA 2E1EA 2AOVA 2H6EA 4L5YA 1HNXB 4MEYA 1E2IA 1QYCA 5B36A 2IUSA 2XUHA 3DTNA 2Q9UA 2XYGA 3QMPA 1UMCA 5DCLA 3P19A 3P9CA 5M29A 1W5AA 2BEWB 1EP2B 2BT4A 2X5NA 2QM8A 4N65A 2QIPA 2FSVC 4DLUA 1YR6A 2Q50A 3CN7A 4YRNA 1ZG3A 3AVUA 2OMKA 4I2CA 5LJIA 3Q8PB 3HVRA 4M8KA 4EEZA 1PR3A 4UBIA 4YQYA 4GXKA 1DBQA 4YP3A 3W6NA 4HN4B 3AC0A 1ZIYA 1D1PA 2OSVA 1JE1A 4BMVA 4HK4A 3RB4A 4QXOA 1PYOA 2VO1A 5L45A 3UO8B 1RE0A 2K4IA 3DULA 1HT2E 3DCJA 1H2FA 1JLMA 4B40A 1SHLA 1P0QA 5IC4A 1EIWA 5I4KA 2Y1GA 1KERA 3W8RA 1FXUA 3CF4G 3I2KA 4QZIA 4XLTA 3HYRA 1M2VA 4Z2YA 1VL0A 2ZPTX 3BF7A 4F4WA 4ED1A 5JHHB 4MKGA 4C76A 1PWYE 2DRIA 2VF2A 4NV0A 5AVTA 3OIDA 1VKRA 4WA7A 1HUOA 2YX1A 1H8HD 2BW0A 4MNTA 4F5DA 2KWIA 1O54A 3F98A 3QV1A 3CWCA 4I2EA 4IR9A 1I7QB 3THYB 3AJRA 1K1EA 4UNQA 4E5MA 2J9GA 5HHHA 2ZCUA 1ZJWA 4DUZB 1KZ7B 2IHUA 5FV4A 2WPDD 4QPJC 1H5UA 5JMTA 3IS3A 4PYNA 4EG6A 5BUCA 3GJ3A 2XEXA 3RUFA 2QL6A 4AZ3A 1KN5A 3I0NA 1Q0SA 1B00A 1OTYA 3BMXA 2GCIA 3NVZA 4P5PA 4J0DA 1NM5C 1E98A 1P7CA 4EGJA 3RS4A 1SA0B 1RTTA 2WFMA 4ENTA 2C5GA 3VR0A 4WN3A 2GRUA 2IPXA 2LNDA 5DB4A 2HBRA 1TAGA 4FI3F 3N2IA 1R4AA 5JLJA 2QU8A 2DLCX 1UPCA 4OHBA 2WAQC 4C0KA 1N3BA 4Q18A 2PPLA 3GELA 4HTFB 5IJXA 4ZAGA 1IIRA 1WOMA 3T95A 1BJRE 1Z25A 3AFIA 4KMUA 5LQNA 1E4VA 1TK9A 5DNEA 4YUAA 5JCOC 4IIUA 1JNYA 3BN3A 3OT1A 4PAOA 2DWOA 1G3QA 1PRYA 1D8YA 1CDZA 2F17A 4IJUA 5DBGA 4HR7A 2JKZA 1AQJA 1I3KA 4EG4A 5CA0B 5J2EA 2YINC 2RH8A 3TFWA 1SB9A 2WMOB 3GIWA 1CUAA 4G1EB 4H4CA 1RAGA 1JQ5A 3VPCA 4NF2A 1U5CA 3D2NA 2AXPA 3ZQUA 3ICPA 4RXUA 2E4UA 1ZNYA 1ACJA 1YJ5A 1P7WA 5G0SA 1NBAA 4NFLA 3E6AA 4PWZA 4LTNA 1J33A 1BMFD 4PNPA 2VIXA 1YS4A 3DBLA 2HSDA 4D74A 4Q4JB 1WWKA 2XB4A 4ODIA 2G6TA 3O91A 5BN3B 4TKVB 3NDIA 13PKA 1YIOA 4HAYA 3BE8A 1JZQA 1VL5A 3HHPA 3LO5A 5IUJC 2HZBA 1XQ9A 4WQMA 5EJ8A 1KO1A 1COOA 2XMGA 1YQUA 3A6FA 4TLDA 4RPYA 2BHTA 4ENRA 4H1HA 3CRVA 1M1XB 3NTOA 3VHRA 5IT9A 4U9IS 4PTYA 3KL2A 1B0UA 4H1VA 2IYNA 5EIEA 2CCJA 3LX5A 1C14A 4BFTA 2AC2A 1TEXA 2J3KA 6REQB 2WKQA 3BFVA 3B3QA 4NC9A 3WB2A 3TLCA 3UQYS 4S05A 4P0TA 3KTAB 4RXTA 4FHGA 4HXYA 1R4MB 3U7IA 3SS7X 4QIHA 4I55F 2HSJA 1OXJA 2BLLA 1G5RA 3SF8A 2FPPA 3NC4A 3TWOA 2IJGX 1CQJA 1UPXA 3CNQS 2PSFA 4ZVQA 4L4ZA 5CVVA 2L5YA 1KO7A 3LCCA 4DQ0A 1D7OA 3PVXA 2JFFA 3RBEA 4WBNB 1E69A 1DI0A 2F1RA 4Z6EA 1LQTA 2VPPA 3IUQA 3T4PA 4GECA 2YOHA 3V8NA 1WXIA 4MCJA 5HKLA 3EGOA 3DKRA 4QT4A 2WKSA 3T3GA 5IVDA 3A1EA 2O8DB 2VKTA 1G7TA 2ZRHA 5SYAA 3WGQA 5AVJA 3PHBE 4FMCF 3RFVA 5BO5A 1AM4D 3AETA 1YE5A 5TX7A 4GWKA 1R5OA 4Y2RA 4OO3A 1EUYA 3IQEA 3ESCA 5IF3A 5K3AA 3D7MA 3ADKA 3VO2A 4AJLA 4O2AF 4WJ3B 3H2SA 1GFZA 4A23A 4LSWA 5IIJA 5C1OA 3LUFA 1ZQWA 1AS2A 3AUAA 1KI8A 3ZZ0A 2GA9A 1GARA 1KEPA 1GFWA 2ECKA 1P0IA 3F7NA 3WRWA 5FFFA 1H2AS 1EUZA 7ICJA 1MJNA 1PVPA 3B20A 2GJAA 3V3KA 2NU7B 1BXRA 4I1OA 5DM0A 4RVNA 3C6BA 3GLIE 5B1DA 3N7TA 2F62A 5A06A 1DT3A 3JU3A 5ULLA 5LOVA 4JQYA 1AKRA 5AW6A 5KNBH 1C50A 1V3TA 1JH8A 4RYLA 1G3IA 5JVDF 2WYHA 1YUNA 2BQ3A 1C9YA 2H2FA 2WUEA 4Q7JB 3O9MA 4N82A 2IS1A 3LP8A 1L5OA 4RADA 4JR1A 2A35A 3OLCX 4BNFA 2HJ9A 1SXJE 2JC3A 4Y6LA 5KG1A 1SVUA 2VLBA 3PF9A 1B8VA 1EE2A 1ZEJA 1GAWA 4BTEA 1PJ2A 3PW7A 1IJEA 1IBSA 2JJMA 2B9EA 2ZVJA 2B2NA 3OM1A 1FS5A 3H11B 3F3YA 4F92B 4PCLA 3SYRA 2HA2A 1M1YB 3O83A 3AI7A 5J0UA 4H7JA 1X66A 4H0CA 2YV1A 2WMDA 1DCTA 2HLPA 4RY8A 3DZIA 1XJWA 5FR1A 1AKMA 5D85A 4LFBB 2AQ4A 3CZ5A 2Y4NA 4JAVC 4L5AA 2H7XA 4GP7A 3PZPA 4U5QA 5BPCA 2IXTA 1VKZA 3REOA 2ZM6B 2O5EA 2TSYB 4OMCA 4JUZA 1NKTA 1BA2A 4I1PA 5LMCA 1BWRA 1XLUA 4M86A 1IDN1 3RR8A 4I2AA 2VJ4A 3C4VA 4DZTA 4JIGA 1E1KA 3HS3A 5EWEA 2IF0A 4MKZA 1UK7A 4E32A 2E5LB 2X8AA 1XYGA 3SFZA 4FYHA 2HMWA 3JQBC 5M34A 2CNKA 2B92A 4C0AC 1H2ZA 4C4RA 3GPCA 3NT5A 3C43A 3SLGA 2W6CX 2EERA 3E82A 4OQLA 4P8RA 5JHGB 4ZRDA 2PQ0A 3IEMA 5CFRA 2JIPA 1YBMA 4M9CA 3FMFA 1D1QA 2AMVA 4RK7A 1QKKA 4CM7A 5J0OA 4E1BA 3LQ1A 4GMFA 4OXKA 3ZR4B 4B34A 1TADA 4JLKA 3KEOA 1NI5A 3HMKA 5CRXA 1JG2A 5C8YF 4UUPA 3GBPA 4TM8A 3S3TA 4A0SA 1RACA 1Y1LA 3BFXA 1YBAA 3GZ4A 3M3HA 1ZQNA 2CMHA 3OE4A 2A0KA 2NYRA 2PKWA 2V9ZA 3TUIC 3LLCA 1GTVA 2VK8A 3GGGA 3KEGA 5KINB 2BKVA 2Q1SA 4Z0TA 1JIQA 4IPTA 2OP0A 3A3OA 1VGVA 2Y9UA 4LXHA 4UBCA 3PPWA 1XTTA 1VA5A 4YR3A 1A95A 3UATA 1GZHB 4KGXA 3OKCA 4ZQBA 3PDIA 2P6MA 1T2NA 1X70A 4HDKB 1NF3A 4ZIRA 3KSZO 5DG9A 4B85A 5C1PA 3D6UA 2W9CB 2GAIA 1JEAA 1DQYA 1QZUA 4NPHA 3WLFA 4PYKA 1KYVA 1SU6A 1E1CA 4HQRA 2F8SA 1WG8A 4N7JA 3RR2A 1JX4A 4TKMA 1Z39A 2D1YA 1Y9EA 3I32A 1L5HB 5BSHA 4J0IA 2H65A 5CAEB 4BE7B 1E1QA 2DE0X 1JYEA 2WWRA 4XDYA 4L4YA 4YXFA 4YS6A 2GF0A 4AJEA 2IELA 3MWGA 4JOCA 2RK6A 2QUBA 1KP3A 2G1KA 1WUHS 3BOSA 3VDMA 4RTQA 5FL3A 2OY0A 4P0QA 3QOYA 4FC6A 3F5DA 5ICMA 3LQ4A 4WA8A 2ZRDA 3SEZA 1G6HA 4PZPA 1EPUA 5KFKA 3RNLA 3TZEA 4YJDA 3QH4A 1OW5A 1RFLA 1DX6A 2GCEA 3V8VA 3RHTA 2GRAA 3DLIA 4RIGA 1AQUA 1ZQQA 3KWMA 3ODGA 3R2JA 4MWZA 4LQDA 3H5IA 4J0EA 2ZE5A 5FUYA 2HJHA 2YASA 4B1FA 2RAUA 2X1LA 4KTQA 4ND2A 4CF3A 5KTSA 4D4LA 2EL9A 1WR8A 4JXXA 2WKRA 3SJ7A 3W2HA 3NWPA 2AL7A 5T41A 1YSCA 1L3SA 2D5IA 1EDDA 3QWIA 3WWZA 2NLOA 1KYXA 4FOPA 3O8RA 2RP5A 1QG4A 4JVNA 1PX0A 2XXAA 2HHTA 3A9CA 1KQNA 2XGJA 2F77X 3H1FA 1UWVA 3Q4GA 2CZCA 4LF6B 1LSJA 1Y3AA 3RFCA 2XI9A 2V1XA 3AB8A 3EMKA 2WD8A 1ZQFA 2UUAB 4MCHA 4DA4A 3JALB 3OHBA 4JU8A 1W2HA 5CHGA 1GG2A 2D4HA 3H40A 4DRZA 4XE5A 1UC9A 1W5SA 2AV6A 2V0CA 2R6R1 4BO1A 1I3MA 1K6MA 1SFRA 2QVCA 3TADA 5J23A 3HKEB 2CDRA 4V0RA 5B7NA 4WFIA 3KCNA 3TX6A 3PC3A 2INGX 1UBMS 4DBVO 2CB0A 3RM3A 5K4AA 2JASA 1JXOA 2WIBA 3IUMA 1QHEA 3E3MA 2ZIGA 4I2BA 4TTJA 3IXQA 4EKDA 4LJXA 4GBED 5AUPB 3I4CA 4RQ3A 2EBUA 1F44A 1PDWA 1X7XB 3PGMA 1KNXA 4A36A 4N41A 3EIOA 4FFLA 2JA1A 4D3DA 4DSOA 5FOTA 2F3QA 3V2IA 2LMRA 4LJ8A 3A2LA 4QU0A 4C7KA 4BMYA 2R5WA 2ZDGA 3CR3C 4JV2A 1JVNA 1BKSB 1YCFA 2XZDA 4GBGA 2JZCA 4FMBB 4GNKA 4G84A 3ZWCA 5IF9A 3FWHA 3KHHA 2VQ3A 2XXBA 5JH7F 4LRYA 2YHSA 3C5CA 1FSGA 3BGWA 3RC7A 4ERXA 2YHIB 4DRXA 4U1RA 1M2OB 1WPGA 4DF3A 1XPRA 4UFOA 4LRWA 3EYWA 4P35A 5B6PA 5KU7A 3E5RA 4OHMA 2PYZA 1QX4A 3CP8A 4EMSA 2RAVA 5IDVA 5KYUA 6Q21A 1Q57A 1Q6ZA 1QIIA 1LI4A 1EFCA 4MW0A 1DEAA 3OM9A 2XI4A 3F9CA 4MDEA 3RVJA 5CT9A 3LWBA 2GWSA 3LQKA 3HRHA 2ZCVA 5ALJA 2GBLA 1IK4A 3SZRA 4RDXA 2J0EA 3A6DA 2H3FA 1PU2A 4FSHA 1W36C 5ALSA 3IB3A 5JXJA 1IFXA 5CCBA 4N49A 1OF1A 1AURA 1KWGA 3EVEA 2KJ8A 2Q5LA 1JLSA 1AKQA 3REGA 4ECSA 5FPPA 5B7GA 4RA6B 4P4LA 4J3FA 5K8UA 4QXRA 1MZPA 2FPMA 2J5QA 5JRJA 5CH5A 5TMEA 4E2FA 1M6VB 3GCXA 4TQGA 3S44A 3UCEA 3DBHB 1IEXA 3T4EA 1XU9A 1Z36A 2W2XA 2J9RA 1ZUIA 4LF7B 3RJEA 3IE0A 4DFKA 2JVJA 3VNRA 2JAOA 1QFSA 2HUNA 1U2TA 2IHJA 2N46A 3DC2A 1I3NA 2ISPA 3HFJA 1FDTA 4YMMA 4WK2B 5JXWA 3I9FA 2HFKA 4QICA 1VFPA 5K8IA 3OLYA 3AWIA 1YRAA 5IFLA 5ICFA 1S4QA 4GZ6A 4NDNE 1G20A 1G5TA 3TJMA 5HP4A 5C52B 4MA5A 3F78A 2EX1A 1W30A 3VX4A 5K0FA 2JXJA 3H4VA 5JU5A 1JR3E 1PGQA 3SYLA 3ILVA 4M46A 2Y1DA 4XB6B 1Z38A 2CLLB 3FYUC 1TYZA 4C0SA 3JQRA 1QGZA 1CY2A 1ZGAA 1J2RA 3ZJVA 1E7SA 3TZ6A 4BY9E 2REQA 3D8BA 3QWHA 4ND8A 1NLYA 2QWXA 5A3RA 4LHZA 3FWKA 4RHFA 2C9CA 1RSZA 4O3RA 2VNAA 1XKTA 4RTRA 3TEMA 2XB6A 3Q6MA 2A9PA 2JB9A 3DHEA 4HGPA 2EG9A 1RHRA 2R6ZA 3VV2A 3B2QA 4KR6A 5HILA 2E85A 3AHIA 2JRLA 2JCGA 4EHJA 4WEOA 4CQJA 1RLJA 3DT6A 2QP9X 4HH3C 3U9TA 3I76A 5IUNC 1ZP6A 3U4QA 5B53A 3KNZA 5E4JA 2FWBA 3AY0A 4ARUA 2PX2A 3VZSA 1VDZA 1D04A 1FUYB 3D4IA 2JZNA 5EWJB 3JCZA 2WAAA 4NZPA 4F11A 2XAUA 1JZSA 1P0CA 1PK1A 1X1RA 2Q9BA 4XCVA 1FFBA 3ZCTA 2OXRA 2OHFA 1NVTA 1OD6A 4MIEA 1MSWD 4DC9A 1YJQA 1EFKA 3QNUA 2YVLA 3O38A 5IIIA 4U7DA 3T9AA 3MRVA 3LV8A 1VL6A 2J30A 4W1PA 5FTKA 4PF1A 2ISQA 4Y2GA 4OLFA 4UE2A 2B1QA 3CONA 3EMBA 2XUOA 3GGJA 2WD7A 1OYYA 1FA9A 4OK5A 1KFKB 4XJXA 2E82A 4N3BA 5JFTA 3AEYA 3JASA 4A5OA 3KJFA 4NXNB 1ORIA 3IPXA 3RBXA 2WWYA 4RV9A 4AURA 2I1LA 1FQOA 2Z2YA 1T7PA 2FF7A 4S35A 2G17A 4PVDA 4WOJA 3ZHXA 3BK2A 1MN8A 3T1YB 1ZM9A 1U1EA 4UUMA 1YIDA 2G5IB 4JC5A 3S40A 1XGKA 2PMFA 3PHHA 3K94A 1DJPA 2XQIA 1ZESA 3O1IC 1R0SA 1SOVA 1P7PA 2PMCA 3H3JA 3IR7A 1XS9D 4KEAA 4Q39A 1F0YA 3WLNA 2JVKA 2ODBA 4BO6A 2E1RA 4B48A 1HEYA 5CB4F 4P7FA 3HTXA 2PL5A 3K0BA 4X3PA 3SN6A 2FWRA 3EJ6A 2R79A 4JVSB 4J9MA 3KWJA 3AUSA 1BE0A 3D5QA 2VL7A 4OHZA 3U81A 4LHVA 4DR1B 1JEYA 1Z4JA 2C95A 1TO6A 2XNHA 1RKUA 3O1HB 2V7PA 3W4JA 1H0RA 2I34A 3HEMA 1XAIA 2GN4A 4W1QA 4XSHA 5HQJA 2G0AA 4QYWA 3Q2IA 1E6EA 2YJGA 4ZMRA 1K27A 3UT6A 4KLQA 3JATA 1KDVA 4P4SA 5ITVA 4QNLA 3TLBA 5F73A 4BIIA 2IW1A 3FPKA 4KLMA 4XUEA 2DQ4A 3N0RA 1OXBB 4GPD1 4I50A 3FTPA 4LDQA 1BO6A 2LHTA 2P68A 3F8TA 1G9SA 4RDIA 3D43A 5IBCA 4DWWA 1W7AA 2OZVA 2GK3A 3TE6A 3X1XA 4XUCA 5E6SA 3V34A 3NLLA 4YRTA 1YQQA 2XCLA 3LT4A 1B93A 5KSWB 5I7AA 2KK0A 4CKYA 5HPYB 3Q3EA 4BBPA 5FTLA 1XUOA 4A73A 5AESA 2AI2A 2QAGB 1TZBA 2WJ3A 1NC3A 1X74A 3MERA 3GRVA 4MV8A 4NOLA 3T9BA 3JQPA 3NPAA 3G3EA 3RYFA 1OZGA 1CDEA 5MDHA 3UTDA 2ZIUA 3ZWKA 4ED0A 4A6PA 5FFNA 5BOSB 1P77A 3G2QA 4YV0A 2IEBA 1GNSA 3GHHA 2P7IA 2GLXA 1Z6TA 4WSOA 2HK6A 1KKMA 3NCTA 4D9FA 4G63A 4KLZA 1RD4A 1AMNA 1U6JA 3VC2A 5E9JA 1B22A 1MIOA 2GXQA 4DHEA 4DIKA 5TISU 1GU1A 3F73A 4HAXA 2EYUA 1NC1A 5EQFA 3K1AA 1YD7A 1AZWA 4NCXA 3E9EA 3ED1A 5KYGA 1F2UB 1IK6A 1CUVA 2NZVG 3ORHA 1TQ6A 5AQ1A 3MB8A 3BJEA 1CEXA 1NKEA 1EG2A 1EX9A 2FWNA 3GVPA 3UV7A 4HAIA 4NJMA 3FVTA 1JHQA 1ZPDA 4OJTA 3OEWA 4EAQA 4QUHA 3OBIA 3UJ6A 4LGVA 4NJEA 2QZJA 2XUAA 2GLUA 1X15A 2PUFA 3JPOA 3PLRA 2VCEA 4FXPA 3HWX1 3BG5A 1PUZA 2DTEA 4MA4A 5F9HA 1J8DA 2BR0A 2OHOA 1I2MA 2P30A 2FQWA 2FDCA 4MGEA 2I5PO 4G25A 5DGIA 3R0ZA 1X1AA 1OA0A 1T24A 3UKDA 1OBOA 4Q1DA 3H4TA 3WC4A 4KACA 2LYHA 4D02A 1PQUA 2WYIA 521PA 4A8PA 1YDHA 3SZMA 1X9GA 1DJQA 5F9MA 1MLDA 2FZLA 1HYEA 3D2SA 1PFGA 3FBGA 3R3WA 2J08A 3PFHA 4MRVA 4ILEA 2VPYA 3M81A 2EJUA 1FNNA 2RHTA 4KU4A 3Q8RB 4PO1A 1EJBA 5JSZB 4CKBB 1KY2A 3BL8A 2YV5A 1QIKA 2J67A 5CFZA 4JC4A 3UUGA 1ACMA 4ZT5A 2B30A 4RZRA 4KIFA 4OL0A 4RT3A 2KSOB 1M8GA 2VI5A 1J2YA 1K2VN 2HHCA 1YTUA 1ZETA 3DAGA 5HBRA 5K4GA 1LU9A 1LY1A 4WFJA 1AHNA 4XH9B 3Q41A 1ADGA 2PRKA 3SNKA 3RSQA 4YECA 4JCCA 4OLJA 3DEKA 3L7LA 4N54A 3RC8A 1XEWY 5KREA 4DV6B 4J94A 2BTOA 4JHXA 1QDEA 4RQ8A 2JLQA 1ZSVA 5EE9A 1Y1SA 1PHRA 3L7AA 2OORC 2PM8A 4Q4CA 4DR5B 2K89A 4L6CA 4OFXA 3MINA 5DN9A 1OIXA 5JTIA 5B5SA 2ZSAA 1K4MA 1WHSA 4H3HB 1OVMA 4URYR 4AKSA 1JXQA 1NNUA 3O82A 1CIVA 1JEJA 3MJSA 1BMTA 1LBQA 4FFNA 4OREX 1UC5B 1L6RA 3ADCA 3MJCA 2KSQA 4IDNA 2ZB4A 3I5UA 1N5MA 2JFPA 4AP6A 5BPFA 3DGEC 1S1MA 3TMKA 4U3JB 3TTXA 1RW4A 1ZR2A 2C8VA 9ICVA 1RAEA 3BDPA 1H4QA 4I5DA 4ICAA 4Q8FA 1YJ8A 1YHNA 4PZZA 2Q8PA 1CS0B 2Q41A 4TL9A 3TBFA 1ZVMA 4KGVA 1XZBA 4AZ0A 1WMDA 1JEDA 2W8LA 2ZYDA 2AF4C 3ZU2A 2IX9A 1RPLA 2DZDA 4OFBA 4PIPA 4EBCA 5AW9A 3NAZA 1T5BA 3WHLA 3OU7A 4G1VA 4PYLA 3URMA 3TIFA 2Q6KA 4HYTA 4RPZA 3T5LA 4HRVA 4X91A 2OXIA 3DNFA 3WFZA 4M1EA 2X9VA 1JHVA 2HWUA 3HKDB 1TVEA 1MA3A 2CDAA 2DU8A 4JEUA 5DNYB 1XDDA 4X41A 3KOXA 1Z73A 3RSCA 3INRA 1ZS9A 3WGGA 4PHEA 1ZYUA 2OZLB 2Q0XA 1LLUA 1GTJ1 4PFKA 2WAQF 1NUAA 2M32A 4I4TB 4NPAA 3UPDA 4GFDA 1PHPA 1IHPA 4M88A 3WTCA 4CV0A 1SXDA 3IESA 3AKYA 4NEQA 4ZZ0A 5CYOA 1A9XB 2CT8A 1C9MA 1B4DA 1NMSA 2YXDA 2JLCA 2HQ1A 4PWYA 2B2XA 4DOAA 3GFSA 2B4AA 2AG5A 5C3MA 4GLBA 4OGWA 4AN4A 4RPHA 1FYVA 2V4RA 2MSEB 4OOFA 3OE5A 1UC8A 2XE8A 1KIMA 1KSGA 3IUJA 3K31A 4OX9B 2A94A 1TJNA 1OV4A 1MABA 3K0HA 1K2WA 1U02A 3PSHA 1I2BA 1MW9X 4NP6A 2C88A 4DV3B 4C3ZA 2GOYA 4ALJA 4FINA 4F86A 4PCUA 1QNLA 3QVUA 1YA8A 4R68A 5JXGA 2Y0SF 3VJRA 1E1QD 4D4JA 3GLQA 2YWGA 5ICSA 4X92A 2A0FA 5FIUA 5DLEA 2HF8A 4OP3A 2NU9A 1IPHA 4NRDA 3NAGA 2GETA 2WTFA 3IP1A 1P4RA 4HH1A 2RKOA 2BFBB 5IVIA 4EZ9A 4F1KA 5AKGA 1B1CA 3UH1A 2ZBFA 1O96B 1RZUA 2NRWA 2AJ8A 3PQFA 1T6XA 1NTOA 5FUVA 3KOUA 1RRVA 1T4CB 1XX6A 2E8MA 2WAOA 4F9GA 4CDNA 2Z1MA 1OBVA 4RS3A 2ONCA 3LCMA 1JNXX 5KUTA 2FMQA 2I3DA 3WZ2A 5AFSA 5BYAA 4KDFA 3WGLA 3WKDA 2GAJA 2A5DA 7ADHA 2J6HA 5JJBA 2B4YA 4C8OA 2VTVA 1NVGA 2RC6A 5C4IA 2WUFA 4WLOA 4KV9A 2J0VA 3EXAA 1S3SA 3ZDXB 2DGZA 1XRSB 4JLBA 3H1TA 3BIJA 3BTOA 3V1MA 3BZCA 1E32A 3ICWA 1D1SA 2FUG1 1RQ2A 2PX6A 4F60A 3SD7A 3UWPA 2LDBA 3MWDB 2YQEA 3UFBA 1HYBA 2VP2A 2OYSA 2F00A 2X7HA 4GYJA 5LP6F 2ILTA 4NU5A 1KYZA 4MJ7A 1YZQA 1NVVR 1OSNA 5DHSA 3UZUA 4UAVA 3NDRA 4OQPA 2GK7A 3ETLA 3HO1A 1MEJA 4M98A 3W8NA 4K9DA 3V8QA 3PQ6A 1XXHB 2YXEA 3A27A 2H1CA 2ODNA 2NV2B 4F91B 4REOA 5IN5A 1XNSA 1UDCA 1DBSA 1K7EB 2VNHA 3C16C 3K6RA 1WNFA 2BGGA 3HGTA 2BLNA 3WLHA 4US1R 5IBQA 5BNFA 1HQDA 2QX6A 4JWKA 3ROFA 3PICA 4E13A 5DB6A 5ALYA 1E89A 3G2JA 5BV2P 4N03A 1P29A 5FUBA 4UD2A 8ICBA 1U1GA 4LS3A 1Z19A 4CLHA 1XZFA 1Q17A 1SG0A 2CPRA 1EFUA 1R5NA 4J29A 1JIVA 1XN4A 3GDHA 1HEKA 2O8VA 2G09A 1Y1QA 4MWBA 4NQRA 3CZQA 3C8DA 4QVIA 3B1XA 4F2GA 4RV5A 3RYCA 3BHJA 4CL3A 4MW4A 2ALZA 5F76A 3W7AA 1SQSA 1KSHA 3O6VA 4YGYA 1SKRA 5F9FA 3VNSA 2ODPA 5J63A 2H00A 1K6XA 5CDTA 3L0IB 1Y3CE 2OV4A 2ATCA 1D0VA 2VP6A 3GBVA 4RETA 2CHEA 1DNPA 4CTNA 4ZHQB 4C3VA 3IEIA 3VOAA 4P82A 2CL6X 3BL5A 3H5NA 3JQEA 5HXAA 1JDPA 3O4HA 2H4HA 3MFHA 3BSYA 3QG1A 1GL6A 5B1YA 5ALMA 3H3FA 4ZV7A 1FMFA 5KT5A 1HUQA 1KDHA 4REQB 4ZU1X 1NL3A 3CH5A 4FJ1A 1U0TA 4FGUA 4ZK2A 3RF7A 4B35A 3WAKA 5CCEA 5EJ6A 3ZUPA 2BFFA 3G6YA 4CMIA 4HWSA 2A8YA 3BILA 3NUQA 4O2BB 1LLFA 4E5KA 3D6MA 4NU0A 3QBVA 2W2QA 1KETA 2ID7A 5KFMA 1KE2A 2Y9TA 3IUNA 3PHLA 4O1IA 2Y0BA 1OAOC 3QMVA 3H5AA 2NZWA 3P9NA 3AUXA 5AI8A 5TXGA 2C94A 1CUWA 4OAQA 3HVUA 3U3MA 2RGNA 3T3FA 3ZGZA 3DV2A 2XDWA 4R2XA 3GJ0A 4BX3A 4YRZA 1W2GA 1ZGGA 4WEQA 3IV6A 2OCPA 2YVKA 4TX1A 3V48A 1KAQA 5JDIC 2NT4A 3FYCA 3T61A 2YY6A 1IM2A 3RC3A 5EOZA 1R9NA 3AEXA 3HLTA 4ED6A 3D3NA 4MKFA 4JLWA 5ARBA 3MAAC 1LC0A 4X7MA 2TMKA 4JR0A 4WVFA 5NULA 4C2AA 3TE7A 3U7GA 3F6EX 1PSZA 3NHFA 4FN4A 4YXMA 4GM1A 2A92A 2UZAA 3IP5A 1K75A 1F6WA 4BMDA 5LBUA 4QNMA 3PUHA 2C7OA 1IAVA 2B4RO 1PYDA 3FDXA 3KD2A 5CK4A 5D01A 3PC8A 3WIUA 2GD2A 4FZNA 1IBRA 2C98A 4QZHA 3DWGA 3ET4A 3ZG6A 4Y6RA 4ZVNA 5IAJA 4KQ6A 3AZPA 3ZWWA 4RGQA 4WOBA 1CZOA 1TCAA 3ORFA 4QTXA 2XWPA 2F67A 1FP1D 3P0IA 2WDPA 3IP7A 4TKUB 5TR9A 1HTTA 4Z3KA 1KOFA 4PLPA 4GOKA 2QG4A 1PWZA 5DRTA 4EECA 5L3QB 3JPRA 1WP4A 2ZJ1A 1O1YA 3FRHA 1NYLA 1XMSA 3GDGA 1VE6A 4KLCA 3ABIA 1J2NA 1MIHA 1WRBA 2HCTA 3K6JA 5J0TA 1GG5A 2Q3HA 4UMFA 1ZNZA 3DE6X 4CTKA 4LMRA 3A70A 2O1WA 3LHKA 3BXOA 1CUBA 5CLHA 2RGBA 3RTGA 2I33A 2VDUE 3ND7A 4V0ME 3DE3X 4R40A 1SCBA 3VKFA 1L8AA 1OT5A 4P80A 2YY7A 4H7PA 4MUBA 3VR4A 4ZOHC 5C5CA 1KMQA 2XYQA 4Y2UA 4EH1A 2OFXA 1NV9A 1NZPA 1CUYA 1D2HA 1FDUA 4J9UE 2PT5A 5CDFA 3JAWB 1SIJA 3KTOA 4YRJA 2DR0A 4ILKA 2MUTA 2CLFB 4DT1A 2ZVQX 2DETA 4LEIA 3RRHA 4MINA 4HQ0A 2R6FA 3WDSA 2PJZA 1XP8A 2QN3A 2PIDA 1D6JA 4YMVA 4MEJA 1SZHA 2ZI6A 3T6KA 3EDMA 4OI2A 3EGXB 4K4HA 5ECGC 4JBIA 3DV0B 2V59A 1IHOA 1TK5A 2HNAA 3OM0A 2NZ8A 1N5RA 3AR4A 3I6ZA 1J42A 4WZAB 4MW9A 4QIWC 2I8AA 1GQYA 4G2NA 4XFJA 3KYCA 1AU9A 2REBA 4XB1A 3ENZA 1ZD9A 1N8NA 4QHSA 2WNHA 2HK7A 3T7DA 4KFCA 5F5LA 1N6LA 3DDOA 4I2GA 4IIJB 1R8XA 2QE6A 3D8RA 1Z26A 1FU8A 3FCOA 4QU8A 1Y5RA 4IFTA 2YZKA 1SGWA 1CY1A 2QN9A 3GIJA 1D6SA 1I14A 1TI7A 2IA5A 5DGDA 3UC9A 1XDUA 2PH5A 2ECPA 3Q8MA 4DCCA 2I99A 2RHRA 1RRPA 5T4HA 1LBHA 3AEQA 3IQZA 4HKTA 1KPGA 5L6LB 4H77A 4FBMA 1N9ZA 4X20A 4Z6FA 1GGVA 5H80A 3GIIA 1XIVA 3OZBA 3D8TA 5GGYA 1UCVA 4CBVA 2GPNA 4XWYA 3WBBA 3RJIA 3K96A 1UAYA 1R8QA 4HWPA 2FLKA 2M9NA 1C3EA 1N77A 5ABPA 2QSJA 1G8AA 2CYCA 3C1OA 5BRAA 1DELA 2Y0SC 2PJRA 3M9LA 1FJ2A 5DM2A 3EXFB 1LPAB 2O8FB 2LWIA 2JV3A 3CV3A 3AUJB 2JFBA 5CFMA 5J58A 5DTRA 1PTJA 5KS2A 2CBZA 1TRKA 1NN1A 4C14A 5IBPA 5IKPA 1M1YE 4RKRA 4J7AA 3DPIA 4RF3A 4KVZA 3N76A 1MQ2A 2GKSA 2WJVA 2ESEA 2VNIA 3BS4A 5CW1A 1CEEA 1DGSA 9ICWA 5DTEA 5GONF 1ZQBA 4RKWA 5AJWA 7ICRA 1E2BA 4XKJA 3KT3A 2REOA 5LXTB 3MFYA 1ST2A 1MJGA 3M82A 4A9AA 1VP3A 4CM9A 1LPNA 2BCUA 4BDPA 1DAIA 3OCVA 1ZQGA 3P1JA 3UNXA 1DOZA 4TZKA 4GOLD 4UHHA 5HGXA 3A7DA 4FBTA 1RRCA 1GQFA 3NORA 3HLYA 3PRJA 2WV7A 4OMUA 1YBFA 4Y0VA 4PU0A 3PE6A 4M0FA 4M1WA 2GHQA 2WFLA 1EINA 1XZPA 4KK3A 3C3XA 3C2MA 4EHDA 1ZEMA 1R6DA 2KE7A 3LWLA 2ZWOA 1JI0A 2EZZA 1JFLA 1GKIA 1AV7A 2P40A 3UHAA 5LWHA 3G8DA 3UJDA 1IIBA 2IS4A 4RFSB 2V74B 2VBFA 2AMFA 5LP6C 1QP8A 2HJRA 4HI0E 3D2BA 3L0ZA 2BZ1A 4OHVA 2Y1IA 1IZ9A 1G19A 3OECA 1NF9A 3P0RA 5EKTA 1WZNA 5I45A 3FMVA 2R8EA 2PLNA 3ASZA 2RFLA 1D8LA 4GFJA 3L3FX 3T41A 4Q15A 2XADA 2PUWA 3E0QA 3C0KA 5E4YA 1YRYE 1ZR4A 4MVJP 3VVBA 1DINA 1HNNA 1V1RA 2JS7A 2RHMA 2VSOA 1TAQA 4QX6A 1TRHA 2Z2ZA 4F6CA 4PM4A 4C2UA 2PQ2A 1HFJA 4EPRA 2OO5C 5KKCA 4MVJH 1TYBE 5C5IA 1ZCAA 3AR3A 2BIFA 4CMGA 3H4DA 1N4DA 5CMLA 4A2WA 3MABA 5BSMA 5FTNA 4B83A 5AXCA 2JH9A 1A8SA 4KPFC 1KK3A 3N8KA 1VRVA 2P27A 1X13A 3NVDA 4ZO4A 3ROTA 3O8OA 3EVDA 3VR5A 2VJNA 2QMZA 2HPZA 5JASA 1RQ7A 1YB1A 3Q9SA 2AI3A 2X0JA 4AYWA 4K6GA 5B1EA 3QKUA 3F4KA 5LYJB 1YB7A 1BW9B 1I0LA 3PUVA 4DNPA 1QVWA 1IOZA 4RWEA 3ZWXA 4C9BA 2QPLA 4Z4CA 2O8EB 5E7MA 5EJAA 4B33A 8ICGA 1PDOA 4YVZA 4QREA 3LK9A 2ZT7A 5KC8A 2VN8A 3SSOA 5DLGA 4JL6A 2I0FA 4C4AA 4Q48A 4R2KA 4C80A 4RLFA 3VSCA 1G7RA 3EGCA 4X6YA 2J3HA 3EXHB 2V3WA 5AW1A 1T15A 1Q22A 2Z4TA 1BRMA 3M1IA 1X9XA 2DWCA 3QLUA 1Z2OX 4MHVA 2QUKA 1WZ2A 4IWYA 3OICA 3KD3A 1NY5A 3PD1A 4K03A 4Y6GB 2ZZKA 1NMZA 5I9SA 1YR3A 1ZD3A 1X9IA 1EEXB 8ICHA 4V2UA 2IZZA 2HMUA 3X0DA 3IP6A 5LNK1 4LSZA 4BO2A 2J7PA 4KH0A 2VJDA 1DKOA 3FLMA 4GR5A 1R9GA 5FUQA 1JQEA 3X1ZA 5AP9A 1TT7A 4BEBA 3CW2C 4DR6B 1XQVA 3OQOA 4P7KA 4E07A 4IRKA 2H92A 3CY6A 1AHHA 4B6JA 2PT6A 3EE6A 4XAQA 2EAPA 1KVTA 2FUKA 4NS4A 1YK1A 2DKXA 5ALXA 2FXIA 4F84A 4INZA 4EVSA 1XMIA 1CUFA 1WKVA 2GRJA 4MUFA 4NMLA 4HMPA 3ABOB 3KDSE 1MX1A 1CR4A 4QWDA 4JP3A 2BFPA 5GJVC 4K46A 2A4KA 1RBYA 4RGYA 3GLFA 3U44B 3VRHA 2GPTA 2B8NA 3L4JA 2HHLA 3WLOA 3F6BX 1OI2A 2WTMA 1UK8A 3LYSA 4M7RA 1AA6A 3KT0A 3F8SA 2VWHA 1X7YA 2C5HA 4IQVA 3JQ7B 1EBUA 1PJRA 1OHHA 2WTAA 4ZJUA 2FETA 1F2TB 1QZXA 4YRPA 4C0XA 3OQHA 3V46A 1NVDA 2Y99A 2QIOA 4TYNA 2GN1A 4LWZA 1N56A 2QTFA 3ENNA 3GLUA 2UYQA 3OOJA 3ETNA 3ISCA 3C8ZA 3QEOA 1UDAA 3PYMA 3KB8A 5J43A 2PWZA 2DHDA 4Q44A 2I80A 3IODA 4TLLB 4YTEA 5JJCA 4PSUA 2RGWA 2AOTA 4J0GA 2BPFA 3WSWA 4CN9A 3HV0A 2CZQA 5EZSA 4QOFA 1OLSB 2IE8A 3QM1A 4R51A 4G5FA 5KX5F 1IY8A 1PAUA 2MYPA 3DMDA 4ZI7F 4RVFA 4DSZA 2OK7A 3RWMB 5HZGA 1E20A 1SELA 5KNCH 3UWOA 3WB9A 1JQ3A 2QAJA 1CLEA 1HDZA 1RJFA 3LOPA 2WFAA 2OD7A 4ZJPA 2NO7A 4QBKA 1GPYA 1GAEO 3I8OA 1Z7BA 2OB2A 1I2ZA 2XMZA 4DLZA 1Z3EB 4KNWA 2GPWA 3SC2B 4FZJA 9ICEA 4Q6BA 3GLGA 3L1JA 3ZGYA 4KGDA 2C7RA 4RZQA 5LQCA 3BQNB 2ZJBA 3C6QA 1Q1QA 4MUJA 2EHDA 1ECFA 5D86A 4TV8A 2PU7A 3RF6A 4NJOA 1QO9A 9ICNA 1XZ8A 4GDMA 3WVNA 3V2HA 1PNRA 3HJNA 4D57A 3EDCA 4HGYA 1MQAA 1QSSA 2GZ3A 5KJFA 4UNRA 2HX1A 3HYTA 5FI5A 2Q1XA 2FLPA 1KYTA 4HAOA 3W8EA 4MGKR 4QZVA 3RYHA 3VX3A 1CDDA 4F3NA 4AMBA 5KFIA 4DUGA 5K0GA 3KP1A 1S0OA 1LLCA 1X8XA 1V16A 1AVTA 3VO9A 2E3JA 2WNIA 2AEJA 4MEXA 1S3IA 2AFIB 3GLKA 3DVQX 5IT4A 2P75A 1ODSA 2QTRA 4CCWA 3DAYA 4OJMX 2YY5A 3R6LA 2TMGA 4P86A 1TUBA 4ZEXA 1N6KA 3GPBA 4JOSA 2I2FA 1T13A 2IX3A 1BCSA 4I5FA 4X1IB 5FHRA 3W5BA 5E1DA 4LMAA 4CEHA 4QBHA 3L7BA 1P72A 1RXCA 3P7MA 1PEDA 3DQZA 4IQ8A 4WXPA 1SK8A 3IKMB 1RPTA 1RYRA 5KTTA 3UXPA 3A11A 3EZYA 4C1BA 3T7KA 5JARA 2ROQA 3MTDA 1KI1A 4G36A 3AQIA 3SP1A 2V0GA 2FRVA 3JWGA 5BOVA 5B2ZA 2BSQA 3VPXA 2CXXA 4HNAB 4IWNA 1KTIA 3FYTA 2R18A 2I6TA 1UKAA 1DMSA 4RCZA 3ONNA 1RLOA 4BQOA 4YK7A 4QUGA 2C96A 2IU3A 2XE6A 3TD6A 1KZ9A 3F5FA 3H5VA 1R3DA 5AKLA 5IEBA 2WZBA 3DB1A 3AVPA 3KOMA 5CTAA 1A8PA 1RJ9B 2HT1A 3S7ZA 1YI1A 2ZSIA 1PV4A 3CF0A 3QUTA 1GZ4A 3UIEA 3OSUA 3OPMA 1FMCA 1UQRA 1XEXA 2JI6A 1BE1A 1NPDA 2D62A 4WCDA 1D4OA 2HV9A 2OHJA 2DQZA 4KPEC 4Q93A 8ADHA 3INGA 2GCPA 1C3JA 1D2AA 3LFHA 5INTA 4FSXA 4GLFA 5DM60 3AYXB 1OPRA 3VZPA 4EHIA 4D4MA 3UMVA 3KQPA 4BMOB 4FK8A 4R84A 1RKBA 1XMQB 3EUFA 2BONA 1AY0A 1WULS 5EWLB 1IBCA 4A91A 1HF3A 4ELTA 5CCXA 4IJVA 1UANA 3QTBA 1WYGA 1A82A 3F4BA 2B69A 3QVXA 2HJGA 3KKLA 4RQBA 1W1IA 1A9ZA 1NN5A 5FA8A 2H4YA 3QX7A 1V95A 4UVIA 1DWUA 3F6RA 5IDQA 2VOEA 1NXXA 3HO6A 3TQRA 1H5NA 3G5UA 4AQYB 1DAFA 1L0BA 2WHYA 3FTNA 4YN3A 1JMKC 2QD1A 1AGPA 4ZQFA 2Q3MA 1TX4B 1H9CA 1T3QA 2PHZA 2Y1OA 2R6CA 2Z1NA 2VUTA 4ARVA 1U9YA 5BOMA 1Z6YA 4K81B 1S0UA 2UAGA 3DEFA 3F7OA 1R74A 2TS1A 3TN7A 2R2GA 3RE1A 4PXAA 3CH7A 4FMDB 3DXFA 5THXA 4ZCRA 4UUAA 4JNKA 3SYKA 2GLTA 3T5AA 4YJKA 3ZZMA 1JHPA 3TB4A 3KQYA 5IYZB 4L8VA 2OAGA 4ARZA 1CUJA 4WKNA 4R1MA 3GPDG 4H59A 3JD4A 5DGAA 1ULZA 4TZ0A 3QUSA 1J5XA 3IIIA 4YHBA 1OAAA 2JZBA 4P3OA 1BSVA 3KKEA 1Q46A 3ZDAA 2PX5A 2NAPA 1QV7A 3E3OA 3WQRA 2R25B 2HZ7A 3RU2A 3LW8A 4ZAFA 3IERA 2VJMA 3IIJA 2Y4OA 1BXGA 1G3UA 1QG0A 4FW8A 4GT1A 2G70A 2FZCA 1LQ2A 3VU1A 1SCQA 4EYKA 4W5TA 3U3DA 2QLBA 2G1AA 3AU6A 3GZNB 2NNWB 3QMMA 2ZBEA 4FDLA 2ZJ5A 3A6HA 2BGWA 3NHRA 3VPDA 1BE8A 4EYOA 2AUMA 3ZDZB 2FUG6 3GEMA 3FPCA 4ES6A 3NHUA 4D7AA 1ADJA 1M2GA 2H1OA 5DNAA 3E61A 2F3NA 2JCBA 4X6XA 3MN1A 1K9SA 3FYHA 4IJ5A 5EZ5A 2J3MA 2ZUDA 1QWSA 5ELXA 4WXRA 3GAMA 3IMEA 4WOKA 2HSGA 1Z83A 8ICLA 1C7FA 1T9DA 1A5TA 3D6JA 2G9QA 2ANBA 4ECVA 1RXYA 1ZQKA 1GQSA 1VMKA 1A9YA 4B6RA 1T9HA 2CMGA 2YB1A 1D8AA 4DLNA 4GPZA 2PU5A 1CP2A 3E23A 2LBPA 5L4SA 4D8WA 5G3YA 1PZXA 5KHLB 1P31A 1PNQA 4Y9SA 1FYXA 1DC8A 1KVQA 3FB1A 3BQ7A 4QUBA 3DE2X 2O6LA 3WYEA 2PY6A 2I4LA 3PI6A 3GLSA 3QKRA 4HAVA 2R8XA 2BGTA 2Q5IA 5IIKA 1SH7A 1CBUA 1J99A 4QOJA 3VR4D 3FI9A 4M8NE 2R6HA 2RMKA 2Q46A 4R0VA 1HUZA 3IVCA 4BB6A 4G97A 3STVA 3TDKA 3PUYA 4TRJA 1SOWA 1K1SA 1VGRA 1U2PA 4WZZA 5CD1A 1DXSA 1SEPA 1FUIA 4HVCA 2R11A 5CXSA 1DC3A 5LLSA 1Y6GA 4LX0A 4ER3A 2IUEA 3EOBI 1CRPA 3DZJA 2C5AA 3AR7A 4LRUA 4AN1A 1UBRS 3PVSA 4KFTA 3HDQA 3MUFA 4RM2A 2IE0A 2F7SA 2P8JA 3NMUF 1TYDE 1WDMA 5TGDA 1Q14A 3NGXA 1V35A 4ENPA 1KTQA 3N0VA 1N32B 1SOMA 1S01A 2FPSA 4F71A 1USVA 5DX1A 5HTKA 2XMRA 3O31A 3EMVA 4OAOA 4ZYUA 4V3BA 2VTKA 1EXWA 3OUZA 2ATVA 1KAMA 3HDGA 2A1JA 1CG6A 2JGDB 4Q3NA 4PGHA 2I7XA 2P67A 4EGFA 2GPAA 2BFEA 4UASA 3ZW8A 1Q77A 4J1NA 4CMEC 2XVAA 4BV2A 1NLMA 5I6DA 4BO4A 2EQBA 1LUAA 3DFIA 2HBZA 1F48A 1MAHA 3R09A 1QJ4A 3PZBA 3EPJA 2RAPA 3GJRA 1KRWA 1ENYA 2CLHB 2A67A 5H16A 5G0UA 8ICMA 5GQSA 4MS3A 3IFSA 1WTCA 1LZLA 2HBYA 4NENA 4YO7A 4QG7A 4BX0A 3VTKA 1UZLA 3QE2A 3QP9A 1XQ6A 3LC7O 3VKUA 1LK0A 2G36A 3K9CA 1H6AA 4HGRA 4FZ3A 2IOFK 4JROA 4JYCA 5DLYA 4NR0A 2DPHA 4JV0A 1GYRA 2J0QA 5I5EA 4Z0PA 3LVFO 2OV6A 5AJTA 3HNRA 2BMDA 3H8VA 3A31A 3UYLA 5KWVA 2KJ9A 2EZ8A 1PP4A 2AE2A 4IFIA 3OEEA 3GZFA 1Y7HA 4F2HA 9ICFA 1GFSA 5CVUA 1K5PA 4X84A 5KTKA 4O08A 1EM8A 3HK2A 2KIVA 4EX7A 4P0PB 4O4IF 2PJUA 1MC5A 3RGWS 4F3RA 1GR0A 3Q0IA 3ZV6A 1SVNA 2OBLA 3HWRA 1JXLA 3C3MA 4Q43A 1IONA 5F52A 4JVMA 4P93A 4XIIA 1WDKA 1B7GO 1WZIA 2VWQA 2HO5A 2YJTD 2W6MA 4A6EA 5DW3A 7REQB 4FJ2A 3RG8A 4E88A 2HBMA 3KKZA 2WAXA 4PR3A 4CM9D 3QFFA 4B7AA 3OPQA 4QQFA 5JADA 9ICPA 1IM5A 3H2ZA 2X13A 4P08A 4PZ9A 1EA7A 5CUQA 5KC9A 3HXOA 4ZVKA 2CDBA 4Z9AA 3R5SA 1N9GA 5HEKA 3NBFA 4G56A 3B9PA 2Z0MA 1WTAA 4IEIA 3WLRA 4RQ2A 1TTPB 3DLCA 2EX4A 4DQKA 3UAYA 1U7HA 4DJJA 2ZSBA 2ZAOA 4ENSA 3JQGA 2BGJA 5DG8A 1R0XA 4FFPA 4N5DA 4ZEMA 2HRRA 2ZYUX 1ORDA 3IURA 3LQFA 4W6QA 5ITZB 4F2DA 3LKDA 1UHUA 5JANA 3EDQA 4US9A 5BN4A 4BP1A 2JCYA 4NS1A 2D2EA 1P33A 4XLZA 2MDTA 4A6DA 1ST3A 5DDMA 5EKUA 1Z37A 2FX3A 4B3XA 5J2CA 1TT5B 4ZYLA 4JGIA 5HIJA 5K3SA 1M6NA 1U2ZA 2VEDA 1CETA 5IJ9B 1QHHA 5C7YA 4RKEA 1KR5A 1V97A 1WV1A 4DL4A 4WT7A 1UCFA 5CTJA 1Q2UA 4MI6A 1HTWA 1ZQYA 1JLRA 4PX5A 3BCSA 4RQ1A 3I2HA 1J90A 4EHNA 2DBRA 2IKQA 3AP3A 3BH0A 3AF6A 3U16A 2ZFUA 4OIMA 3CVYA 4F21A 1JR6A 2AXEA 1PFUA 3RAQA 1MAVA 2XY7A 1NJ6A 1XR3A 3H2JA 3WIBA 1CEQA 3PPYA 1IBMB 1OWMA 3VR5D 1KHTA 4BTVA 4K6KA 5FWDA 2AJDA 1NBEA 2PUBA 4EB8A 3EVGA 4W7IA 1NMEA 3NP9A 2A5FA 4RSRA 4AX4A 5J5AA 1NMXA 1KEKA 5CEEA 1I9CA 5F77A 4O2LA 4ESVA 4YT5A 4LZPA 1Z29A 2WWTA 3IT2A 4L9SA 2GJ8A 2CN1A 5HR5A 3OT4A 4AKEA 2Z3WA 4QWCA 5I7RA 4G09A 2EH9A 1ZH2A 3IMCA 5CNIA 4P5EA 3LUAA 2R6DA 3FF4A 2AU0A 3OI7A 1X1TA 5CEHA 4ZH4A 2P5SA 4LV6A 3IHTA 3EUEA 3PL1A 1M1NA 3S1AA 3L0BA 2FW6A 4G8JA 4GO1A 5T4FA 1IWBB 4TKLA 2L18A 4K28A 1BG6A 5LIPA 3DD5A 4YT8A 4CLOA 1SXGA 1OT3A 3KOWA 4BFVA 1IN6A 1JE0A 1SL0A 1F20A 4L6AA 5EERA 4NY1A 4LHEA 3G8YA 3SI7A 2VBGA 1XDSA 1ZAKA 2IVZA 2ZU6A 1YO6A 1H69A 3ZLVA 3OQMA 1GT6A 2ZB2A 3JZAA 5ECWA 2HDWA 4L9RA 3UA4A 1DOQA 3C97A 1TEVA 2F4NA 2HEGA 1AB6A 3IDSA 2J7PD 2G4CA 4EKNB 2GTPA 4WXEA 4ZN6A 1CNEA 3UW1A 4M47A 2Q7XA 1DBVO 1ZQXA 1OIVA 3SIPA 1EVKA 1E2JA 1LVHA 2DFKB 2JBAA 4LCBA 3KFXA 4PGYA 2I3GA 5JSKA 3NS7A 3GT3A 4LJ7A 1HBJA 5KG2A 4TLBA 1A1VA 2I3BA 1NPTO 1A1SA 2EDCA 1GCIA 4LY0A 3A6KA 4Q4AA 1W4RA 2VDOB 1CR1A 3TSAA 4YRKA 8ICPA 3EDOA 3TQSA 4NV3A 1T1GA 1R2QA 3B53X 3OZTA 5DEOA 1GTZA 2PS0A 2B1GA 1EUCB 4PPQA 3PLNA 3UK2A 1T8YA 1YS2X 5E38A 2CCGA 4FOSA 1U4OA 3ZNNA 4DSLA 3EG9B 3SHTA 2PX3A 5EWGA 1ZKDA 1MRSA 4QE3A 3JQFC 3KM0A 1P17A 4JT8A 5KFUA 4QIWF 4JB8A 4ED9A 1PWHA 1WJGA 3RIXA 4QVKA 5KFTA 1HOTA 4LBYA 4CUZA 3SC6A 4L8WB 1C81A 1P45A 1FTQA 1OHHD 2O50A 2WA1A 2QLNA 3H19A 3KUKA 3AMZA 4OJPA 1TKRA 4YAFA 4YJGB 2IWRA 1EXDA 3M34A 1J97A 1ZK2A 1SCUB 5F35A 2W9MA 2ZATA 4A8JC 1YCGA 3W6UA 3L5KA 2VYCA 2QI9F 1J4AA 3N3AC 3ZWMA 3M6XA 1VBKA 4ED8A 2G8NA 5D51S 3RH4A 3P5SA 4C0JA 4FIZA 1P4HA 4FS1A 4RO0A 3NX4A 4HDCA 2IYLD 2J0UA 2W37A 3B85A 3PNPA 3DTVA 1SVOA 1KJYA 4F72A 3F9RA 3ROKA 3ABRB 3V55A 3IHKA 2HPVA 2QYSA 1T2AA 2O52A 3FCYA 4ZYZA 4FT4A 4V02A 5TDHA 1E8NA 1L5SA 3KCQA 2OP1A 2FRDA 3PEUA 3NKLA 5C7IO 2QTVA 3RVQA 4WKCA 3SAGA 1QTQA 2O2DA 1DXQA 5IJWA 1EUDA 1QH0A 1LDNA 4MSUA 4HAZA 4B4KA 2EFCB 3DMPA 2QTWB 4EF4A 3RJ5A 2KZMA 1Y37A 3DEHA 2QQ5A 4WKPA 2AR9A 1AC5A 421PA 3SEFA 4LSGA 4GEGA 2AQ8A 2F3RA 1TM4E 4DREA 3M6WA 4OK3A 3ZZTA 2A88A 3I92A 3L07A 2AHOA 5I51A 3MBOA 3BZUA 4ZOAA 1AQYA 3IP9A 4AIRA 1J0EA 1O6GA 4N6NA 4J43A 1AE1A 3K8QA 1H2HA 2Y1XA 2Z3ZA 3AFNA 1ZJYA 2DPMA 4AF8A 2WVAA 3Q6IA 3ZV4A 4CRXA 4LFCB 4R5MA 2EJTA 5A9SA 5JJ5A 4ML3A 1FFWA 2HRZA 4FTWA 1ED1A 3SS9X 3A1VA 2ZI5A 5TB5A 4DUGD 3MJDA 4JB2A 4YJFB 5CGQB 4ACAA 4NHEA 1JALA 3UMBA 4NTZA 3OTGA 1SBZA 1JA0A 2JLBA 1O94A 2IEGA 1V6AA 2QZPA 2YDXA 3FBTA 1VTKA 3ESZA 1BVHA 1XQYA 3HSYA 4EFDA 3UXHA 1JEOA 1HA3A 1ZGHA 1IBLB 2QMOA 1MT0A 4C6TB 3WOVA 4FBLA 1BD4A 2CL5A 2XMPA 4ZEVA 1R3UA 1MB3A 1ETUA 4LHXA 1AUVA 1ZY2A 4FFOA 3IMGA 1CS4C 1E7RA 2XW6A 4AMGA 5D8DA 2IY7A 1TW3A 1X3LA 1M7GA 4CT5A 1TKDA 5JY1A 2VPXA 1D8BA 4R31A 2X1MA 1Y6JA 3PNMA 1SUCA 7AT1A 2GN8A 1S0NA 4PXYA 4LFAB 3HJUA 1D7AA 5ER6A 3CLRD 2E5SA 4MMXB 4PICA 4TV9B 4PRYA 3T3OA 4EPWA 2P2NA 3IKLA 3VMFA 1XLTA 2VTBA 3GVHA 1NXQA 3ASYA 1NJSA 1R37A 1HDEA 4BVEA 2QE7A 4KLSA 2GJSA 5DNVA 3F3MA 5CFNA 4AUMA 1B4FA 1Y4UA 1BS2A 3OFKA 4PS0A 3TNFA 1HV8A 4RD2A 1NKVA 4RQMA 3ZCUA 4NCAA 4GUDA 4E15A 3NRCA 3ZV3A 4ZOEA 2WTEA 1BGVA 1GUFA 3L8FA 3R41A 3VYTB 3PIRA 3EGWA 1X9HA 1QYIA 4D42A 1K88A 4FLFA 3EFOA 3BD6A 2YWEA 1B43A 4JYBA 1Y5MA 3DAHA 2JAWA 5G4KA 4LGCA 1AGNA 3MTAA 4WJLA 5E4FA 1K68A 1M83A 3EPIA 4EG0A 3QPBA 4PAGA 4F50A 4BBAA 1AB5A 4ABYA 4B73A 2ID8A 4HN9A 3HB9A 4DY6A 5CITA 3EC2A 2O8CA 3VI4B 4DEVA 5LL6P 1QYWA 5IVPA 2D74A 3OF5A 5KT2A 1XCLA 2I29A 3JARB 1ISGA 2WYWA 3CF2A 3UT5A 2Q5HA 3AT1A 4YDRA 4CQLA 4BBZA 3GBSA 4LOAA 4MLDA 4UQLA 2QTCA 1Q7BA 2J87A 5A03A 1V7PC 5MGBA 2LDXA 4KN6A 4WZAE 1K63A 3G8CA 4JI0B 5LOVF 4LJ9A 5F5NA 2YMQA 1ZA2A 1WWUA 1ECPA 2VCYA 1JEQA 2G3YA 5L3RA 3SM9A 1KDTA 1N9KA 3OESA 5C0YA 1CZHA 3LH5A 3CN9A 3Q12A 3KFUF 1RQGA 4HQ6A 3R3UA 3C28A 3DL2A 3ITEA 4KDEA 2BTQA 3IDZA 1OI3A 3G7NA 5C31A 1KSFX 1E7WA 821PA 4YRIA 2OQ2A 5A7GA 2BR3A 1UQUA 3D59A 1PSDA 1YQXA 2E6KA 1IIPA 2YBEA 2D1FA 1EGQA 2J4FA 2A1AA 2FDXA 1U3FA 3AFHA 2CE2X 2FJPA 4MH0R 3RB0A 2I67A 3FG9A 4JDUA 4MWCA 3K15A 3JR3A 4I4IA 1MV5A 2QUZA 1C9DB 1LFDB 3C14C 4YFYA 1XD9A 3OZCA 1DT5A 2JGFA 2FZ5A 3QMWA 1N57A 3T52A 4FBUA 3FKQA 3ZX4A 2BJWA 3ISJA 3ZWBA 4BAZA 3K0CA 3NALA 2O2CA 2PGAA 3U26A 5HYVA 1U80A 4JJ8A 1KBUA 2VRCA 3ZLJA 3NH6A 3TANA 3QFCA 3MQFA 4DIUA 3NRBA 4B6GA 3PR2B 5I5GA 4O8ZA 2G8LA 3JX9A 4G4IA 4Q1AA 3VPBA 4P81A 2QPOA 4X97A 2FR8C 2B35A 2QRZA 3GV0A 4AY2A 2VQ6A 4WNAA 2VA2A 4X7BA 4MUHA 3CQ9A 1RADA 5ESRA 3R7BA 1GM5A 1L5KA 1Z0JA 4GOOD 3LC2O 1JHAA 1VSBA 5K6TA 1YI0A 1N60A 2JD1A 3KHUA 3LKZA 2ZRFA 1A7JA 4PAWA 2ODAA 1JHDA 4YP5A 4UM7A 4V1CB 2Y1JA 4NM2A 1A96A 4JKIA 1ZHHA 4F6RB 4LKRA 2BI8A 1NK9A 2ZJYA 4ZOLF 2JEJA 4JBLA 3C5HA 3M6IA 4DTIA 2W98A 5DYIA 1L3CA 4GAEA 3VC1A 4MQFA 4K0KB 2QUJA 5A6SB 2W6PA 1GR1A 3RS2A 1B8NA 3O4GA 2OV1A 4JWNA 1JFSA 1OBFO 4HAWA 2CK3A 1GITA 1IWOA 2JK0A 1XU4A 3RH6A 2G67A 3UM9A 1HM5A 4MI3A 1Z75A 1V48A 2VHEA 5EZYB 5KKNB 3R6TA 4PLFA 1XD2B 1VA4A 3WQHA 2P78A 1KY4A 3U9LA 2H7VA 4CL0A 3C3WA 3IAHA 1TUIA 3V6KA 1FVHA 4E14A 5HUHA 3IPYA 4QFDA 1FRZA 3TIGA 2FPKA 4IOKA 4DS5A 5DPMA 2BCSA 3PJDA 5IC5A 4HWTA 3SXPA 3MTJA 4RD1A 1YACA 4DL5A 2VDVE 3E5HA 5CA1B 1OYWA 1V0JA 3VVLA 1PT8A 3T9DA 4RE5A 1UMBA 3D0RA 2B1RA 2J4CA 2J3DA 5EVCA 3HCDA 1P2TA 3U4IA 3FETA 3M6VA 4DBLE 3MJVA 2XLCA 3AOEA 2H9IA 2IMWP 1FE8A 2P9JA 5U9CA 1SD1A 3W5AA 4TZTA 3T7CA 4HS9A 4NECA 1Z4IA 4RJLA 1T2DA 1W4CA 3DS8A 1NVEA 1M67A 3TXXA 3EZ5A 5FD8A 3T3NA 3RRMA 4CLEA 4GZLA 1E58A 1TQDA 3BSFA 2LW7A 2CY0A 1UINA 3G0HA 3UJBA 1PVOA 4HG2A 2I1WA 3KU1A 5LQMA 3L77A 3M9MB 4YJHB 3CRW1 1IJFA 3ZE0B 5SY6A 3PX2A 4P2GA 2PUJA 3Q85A 1UEXC 3IGFA 1TZMA 5EJEA 3COSA 2YYZA 4P54A 2G5CA 1RI4A 1FSZA 1UBCA 5EQDA 2QI9C 1T10A 5DBFA 4WW0A 3ZXSA 5ARDA 3L46A 4ZCPA 3DOFA 4NBUA 1ABBA 1DWQA 3PEFA 3FFWA 1IHYA 1NLZA 3CYMA 4IO0A 2IYPA 2XUDA 5LSAA 4E3ZA 3JPNA 2ORED 2AGVA 4U63A 3KKMA 3JV7A 4QZ8A 2M2IA 4S1OA 2XV1A 1WUTA 2JLRA 2W54A 1Z5PA 3JZFA 3B1JA 5JYEA 4CEJB 3D2QA 4J9PA 3HZHA 3OEED 1IZZA 2UZIR 1GUZA 1UM8A 4MPPA 4F5ZA 4L5BA 4E4YA 5EP3A 1Z74A 4LPSA 3NPMA 4UAUA 4YLEA 5E8RA 4LE0A 1R9JA 1RYYA 3IYLW 3AY6A 3CYFA 2R1TA 121PA 3SNHA 4UCFA 5KDOA 4Z4FA 3ZHQA 3K75D 1NPYA 1E0KA 3CZCA 4N6OA 2GJKA 2UUBB 3IBGA 4BKUA 3DFUA 1PEKE 3WZMA 4D2IA 2FEPA 4AYBC 3BS5A 1V9PA 3NOOA 4MLZA 3SKXA 3RKSA 5ENDA 4DXDA 1N3IA 5FX2A 3U3KA 3P2EA 4LGMA 2X1VA 3OE1A 3NEAA 1DIRA 2N1BA 2IITA 4DA7A 5HW0A 3G7UA 3RJHA 3B70A 3A28A 1VE1A 2C7QA 4WOPA 4GI7A 4LMBA 1ORTA 4UXJA 1SV0A 1N75A 1POWA 2G83A 1G55A 3ZQJA 3GOQA 1PTJC 1Y9ZA 4LOKA 4H7KA 4M37A 3SX4A 2CFOA 2BELA 2JAXA 1ECBA 4D3XA 5A0LA 3QXHA 1O6BA 5NLLA 2QTMA 4Z6CA 1H3FA 4NBKA 4D79A 5FWXA 4QNNA 3B2EA 3WV5A 4YQFA 3PNLA 2JRZA 3ES9A 5KOHA 3QFTA 2XGOA 3R3ZA 1DG9A 1TD1A 2AZXA 3HCEA 1PK3A 4C43A 2PJDA 4NCBA 2ZULA 1PJBA 4IM7A 2XZOA 5CLGA 1HTBA 2V45A 2FHPA 1I4WA 7MHTA 3KZVA 1KW4A 3NT4A 2HLHA 1W6RA 2W8KA 3GJ5A 4CFYA 1JJAA 5JRTA 5B58T 3F2DA 2X86A 3I6IA 2IZ0A 2DKFA 5AJZA 4X95A 5C7LO 2DT8A 3KT8A 2BEKA 4P31A 5DK6A 4GRDA 3HJTA 3CPJB 1U0HC 1YQ9A 2VTDA 1OXMA 3H9GA 1ZBQA 3GJZA 5KFXA 5JFOA 3GROA 2EZUA 5EUMA 3DOOA 2AMJA 4FONA 1FUUA 1HE1C 2IVFA 2XOKA 2ZITA 1P7VA 1PWXA 1AKYA 2XNSA 2JKYA 2W2OA 2KQUA 1KFBB 1I1NA 4B7CA 1IRXA 2YCBA 1QIEA 3ETEA 3E2EA 4LWOA 1LH0A 4LWPA 3DP9A 4DLPA 1MX3A 1EZ1A 2BBSA 2JIRA 3N7PD 3GFTA 5AUNB 3GEIA 2EKZA 1QCZA 4BN5A 3PR5B 3E35A 2QBYB 1GPUA 2RHHA 2D5BA 3MJHA 2QLJA 3H4BA 5EWFA 1PWEA 4Q01A 4HPXB 1P5FA 1AT1A 4RHUA 2ATLA 3EH1A 3FOZA 4ALIA 2YOGA 3EA4A 4K9NA 2P9ZA 1SHUX 4LG1A 1LTQA 3MHTA 3D81A 4RQ5A 4Z0HO 1JAYA 2PLFA 2ZJ2A 2YWFA 3H97A 3PG5A 4B3SB 1N2XA 3Q3CA 4JBXA 1T0HB 1ZQIA 3ISTA 4JXZA 3MCTA 5EUCA 2Y1FA 3FCCA 1DJLA 3WISA 3QHQA 3A2MA 4EL0A 1U7TA 1QTMA 2DTXA 3ND6A 2B21A 1CNFA 1FY2A 2JD2A 2OBYA 1C1XA 3CVUA 2CVHA 1QLJA 5LZ2A 2AFIE 4PTLA 2E4XA 3CNNA 3WXMA 2HXSA 1RQXA 3FJYA 5PGMA 2EQ5A 4OQDA 5KFLA 2WF6A 4R9SA 2DHEA 3N05A 3OX1A 4IW3B 3ZBUA 4NXZA 4YD2A 3JZMA 2RJOA 1U2RA 1NNI1 4NZNA 3GYBA 3OBBA 3TLGA 1FVXA 3SWWA 2G25A 4RLQA 4CQMB 1DB3A 4U7WA 3A3KA 5T6BA 1LI5A 1QSGA 3TPCA 2EQAA 4X63A 3ZEAA 2EL7A 2WU3A 1OGJA 4GU5A 2WJGA 4ZCSA 2YJ3A 1T4DA 1D8TA 4YXWA 4JP1A 4NY8A 1CZLA 1QLNA 1AUQA 1TECE 4E0BA 1RHUA 2DUJA 2P1ZA 2AZTA 4F46A 3S1SA 3PNBA 1A88A 2XY4A 2NVUB 1HJPA 1MDBA 1RQRA 2C3YA 3L7YA 5DBAA 1PL6A 4Q00A 4KWTA 1LD3A 4UTRA 2BCJQ 4YUXA 1E9SA 1ZITA 1D9XA 2B5VA 1C8BA 3V00A 1E2PA 2H1IA 5JMPA 5JALA 4MICA 2HCRA 4O1MA 1LQUA 3CH6A 1YR8A 4O4HA 1KH2A 3A6LA 3MMNA 1Q8KA 2X4DA 2BFOA 1N5OX 4AROA 2VJ5A 4O4LA 5CWRA 1E60A 1ES9A 5D3MA 4KE7A 1W85B 5CHEA 2NZYA 2AI1A 3TIVA 1CT9A 4MO9A 5HHIA 4Q9DA 1SXPA 2OXOA 1JAHA 5EIFA 1Y98A 5L51A 3AJ8A 3F2BA 5COQA 1GGJA 2CBXA 3SDZA 1XLVA 2Y27A 3P0HA 3DZCA 2NZXA 4RHXA 2VANA 3DTVD 4DQQA 3QKSA 2ZYHA 2H2IA 1T35A 4KI0A 3BWDD 1LV5A 3UXOA 3T1TA 4FWTA 3KR0A 5FA5A 1R6XA 4GLLA 2MSLA 5TGZA 3GD7A 2FMXA 5FOSA 3NQ41 4L4XA 1S7CA 3BXXA 5FNVA 2PYIA 1AF7A 1EBFA 1HC7A 3O8DA 4AXBA 4FFMA 1BEZA 3W6OA 1MVOA 4MP8A 4KBGA 3O1LA 1KK0A 1Z8DA 5EMKA 5U1PA 3RBZA 3SZOA 1X9MA 4KRYA 2WA2A 3ZKWB 1KYQA 4UJ5A 2DMRA 2DTDA 1E9FA 4LZZA 3DDSA 3CBGA 2HUPA 2Y3IA 1QKJA 1PV2A 5AHKA 5EQTA 3CT6A 1V5FA 3OY7A 1W46A 3R7LA 4AU1A 2OTCA 2MU2A 3L0PA 2GZMA 2WHPA 5CT4A 3NKVA 1E3QA 3Q7TA 2ZUEA 1LNSA 5J3JA 3A6JA 4JVLA 5JPCA 3IIMA 5BSGA 1RQLA 1J2EA 3DMNA 2FE9A 4GM4A 3D6TB 1IXSB 1FIUA 5FNZA 1IE3A 1E2DA 1DFGA 4OXRA 3I01A 3MLBA 3PUXA 5SYM