3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords PF00702 domain protein
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
2RAVA 3ZVLA 4UAUA 3WKEA 2I6XA 5AI5A 3GYGA 3W5AA 3NUQA 5AW0A 3QU7A 4L6AA 1RRCA 3N5KA 1KYTA 4CF4A 1N8NA 4BX3A 5IT4A 1J97A 3E81A 2FPXA 5ALQA 1VFPA 3EPRA 2B1RA 3ZWDA 2IOFK 3L0BA 5AW6A 3IRUA 5ALGA 3L8HA 5AM1A 1U7OA 4KX5A 1U02A 1SU4A 3ZUPA 5AKGA 2AMYA 2GHTA 4Y2PA 5AKKA 4OFZA 3HYCA 4UMDA 4UMVA 5AKJA 2FPUA 1SWWA 1AQ6A 4FFDA 4EENA 2PQ0A 5ALUA 5AM5A 4XE5A 3MMZA 4O8CA 3S6JA 1Q91A 4GXTA 2WF5A 5AESA 2CFTA 4BEVA 2B0CA 1Z4QA 3ZWKA 3R4CA 4YIKA 4UASA 4HYTA 1Z4NA 1FEZA 5AKYA 4YH1A 3ED5A 3AR2A 2ZXEA 4Y2UA 5AI6A 1Z4MA 3I6BA 4YCMA 3DDHA 1NNLA 3OCWA 1RLMA 3FPBA 1O08A 1EK2A 2YJ4A 2OYCA 3E58A 1U7PA 2IYEA 3WGUA 4B6JA 2JAUA 4JB3A 3OCZA 2ZG6A 3FVVA 4MWOA 4NWIA 3ZX4A 4BBJA 4NV0A 2PR7A 5AKHA 5ALEA 1Y8AA 1Z5UA 2YJ5A 4UW9A 5ALXA 2RB5A 3PDWA 3QU4A 5ALRA 3W5BA 2WF7A 5AW1A 4KYTA 3OCYA 4Y2XA 5AHXA 3CZ4A 3AR7A 1Z5GA 3L1UA 3SMVA 1WZCA 4Y2SA 3OPXA 4QQFA 5ALKA 4YCLA 3FM9A 3L8GA 1S8OA 5AVXA 4DCCA 4E88A 1ZRNA 4OD0A 4CE6A 5AI4A 4KN8A 3U7FB 3WKCA 3FGOA 1RQLA 4NAVA 3IB6A 2NYVA 1QH9A 3N8GA 3EF1A 4JDPA 4XOUA 4HGQA 4Y2RA 3WK9A 5AI9A 3R09A 1U2SA 5ALTA 1CQZA 1QQ6A 1QYIA 1RQNA 3BWVA 4F72A 5A3QA 2C8KA 3BA6A 4F71A 1L8LA 2I34A 1Q92A 2Q5EA 4DW8A 4MUMA 3I76A 5ALHA 5AM4A 5AVWA 1CR6A 2B1QA 4UMEA 1RDFA 2ZBFA 1L7MA 1ZD2P 3L7YA 2YJ6A 3U13A 3QXGA 2C8LA 4Y2YA 3QU5A 5AK4A 2WFAA 3L8EA 2I55A 1RLTA 5AVYA 2EATA 3WK5A 2VKQA 5AW2A 4Y3UA 3RF6A 4J03A 5ALMA 3UM9A 4HAIA 3ZVMA 2BDEA 4QJBA 4BYGA 2I54A 1O03A 2G0AA 3N07A 4CF5A 3QX7A 2O2XA 3IJ5A 2RBKA 3NALA 5AKLA 5ALVA 2W4MA 2B30A 3KDPA 5ALSA 1PW5A 4UATA 1WR8A 2YBDA 4CNQA 3QGMA 3B9RA 1ZOLA 4L57A 1ZRMA 4HGPA 3PGLA 2HX1A 3A3YA 4OCZA 1YDFA 1NF2A 4XQ0A 1YNSA 5AVRA 3I28A 2R8XA 1ZD4A 2HI0A 3DAOA 2Q4RA 1L8OA 5T41A 4DFDA 3A1CA 3NAMA 2IOFA 2JARA 2YMQA 1YS9A 1N9KA 3QUQA 3WKAA 1L7NA 3QU9A 4UU0A 2FPWA 2WF6A 1Z4JA 4ZEWA 3N1UA 2B8EA 2I33A 5AW8A 4HGNA 1T9ZA 1WVIA 5AM0A 2R8EA 3DNPA 2B8JA 1WPGA 3KOOA 4C4TA 2OM6A 1J8DA 3F9RA 5JJBA 1Z88A 3MPOA 5AIAA 4KX3A 4BEWA 3NIWA 2HOQA 4EELA 3UMGA 2WM8A 3QU2A 1SWVA 2G08A 2W11A 2JAOA 1RMQA 5A3RA 3WGVA 4BKMA 5ALZA 5ALLA 3U7HB 2IA5A 3KC2A 3OCXA 2YJ3A 2P11A 3HLTA 2HF2A 3KZXA 4YIHA 4L6CA 2HF7A 3U19A 4NABA 3WK8A 1ZS9A 1Z4LA 5AK3A 5ALNA 5AK5A 1X42A 3FZQA 3SKYA 3EWIA 3PCTA 4Y2VA 5AKZA 4YGYA 5AW5A 3SF0A 3ZTYA 2HDOA 2JAWA 3PGVA 2MU1A 2FEAA 4BX0A 1ZD5A 1L7PA 2ZBEA 3WKBA 1QQ7A 3QUCA 3ESQA 3ONNA 4PNHA 3ZVNA 2AGVA 4HGRA 2G09A 4BX2A 1ZJJA 1RC8A 2YN4A 2BDUA 1Z4OA 5AM2A 4GIBA 1MH9A 3ET5A 1JUDA 3ET4A 5A3SA 5ALDA 3L5KA 2OA0A 2X4DA 2YY6A 2YFYA 3J7TA 2C88A 2GO7A 4UM7A 3SKXA 3ZI4A 2CN1A 3KD3A 5ALFA 2GFHA 2HHLA 2Q4TA 4YCNA 3AR5A 3E8MA 2ZOSA 4DWOA 3WK7A 2ZBDA 4C4SA 2C9MA 5AK6A 3AR6A 4UMFA 2WF8A 1RMTA 2C4NA 5ALIA 1T5SA 4EEKA 4HGOA 4G9BA 2FPSA 2P27A 2BY4A 4C4RA 5AI8A 3TLMA 3D6JA 5AW3A 1TA0A 3B9BA 3NASA 3QUTA 5ALOA 3MC1A 1RLOA 1YMQA 2IOHA 2P69A 2R8YA 1XPJA 3EF0A 4J2TA 3WKDA 5AIBA 5AVSA 1U2TA 5AW9A 4IG4A 4UAVA 4OHFA 4I9GA 1VJRA 5AW4A 4Y2QA 3QNMA 1S2OA 3CNHA 4CF3A 2FDRA 2AH5A 1T5TA 1Z4KA 4RESA 1TJ4A 2FPRA 3A1EA 2HSZA 5FP0A 4RETA 2FI1A 3DV9A 5AM3A 3OCVA 3ZX5A 1TJ3A 3NRJA 5IT0A 4ZEVA 5AKIA 5AKXA 4Y2TA 2I7DA 4UU1A 3SHQA 4KNVA 3WK6A 3QYPA 4BNDB 2ODAA 4XPZA 3N28A 5AVZA 3RFUA 3SD7A 3U26A 2FUCA 4IFTA 3M1YA 2FUEA 5E0OA 4KNWA 2QLTA 2B82A 4Y2JA 3I1YA 2O9JA 2W43A 2WHEA 2ZBGA 1EK1A 5ALWA 2P9JA 2JGAA 3SLRA 2GHQA 3U7GA 1RPZA 2HO4A 2R8ZA 3OCUA 3AR9A 1F5SA 1RKVA 2YMLA 5AVVA 1TJ5A 2DQSA 1Z4IA 4AP9A 3UMCA 2NO5A 2CFRA 2GMWA 4AS3A 1RMYA 2G1AA 1TE2A 3QUBA 1LVHA 3W5DA 1RKQA 1XVIA 3B8EA 2OBBA 3M9LA 5AI0A 1L6RA 3E84A 3ZU6A 1IWOA 1K1EA 4H1WA 5ALYA 1L7OA 1YJ5A 3QLEA 2HEGA 1VJ5A 4UARA 3NANA 2NO4A 5AVQA 2RARA 2PKEA 2CFSA 4AS2A 1QQ5A 3ZW7A 1RKUA 1NRWA 2EAUA 2WF9A 3U7EB 3W5CA 3AR4A 4UM5A 3R9KA 2G07A 3A1DA 2MU2A 4G63A 4EX6A 4EZEA 3MN1A 4EX7A 5AW7A 4I9FA 2HCFA 5AVUA 5AKEA 3AR3A 2G80A 1XP5A 3VAYA 3L1VA 3ZTWA 5ALJA 5AVTA 3ESRA 4NFLA 2QYHA 4BNDA 1LTQA 4FE3A 3UMBA 1Z4PX 2EARA 5ALPA 3L0CA 3WK4A 3K1ZA 2YMPA 1YV9A 3L0YA 2D2VA 2AUTA 2YMMA 3KBBA 3AR8A 4FYPA 2MSNA 5IS2A 3P96A 3L8FA 4ZEXA 5AICA 3OTQA 1ZD3A 2G06A 3FPSA
chains in the Genus database with same CATH superfamily
1QH1B 3IPXA 2QI9C 3DKVA 3HA5A 4MQLA 4I8XA 3CLSC 3TZLA 3BQ0A 2BUCA 2ZTCA 3CRVA 1GSOA 4BVAA 2P78A 1R8SA 4M87A 1ZQJA 4EJSC 4CF6A 4G5QA 4OFXA 4F5OA 2XGQA 4CIWA 2O7VA 3MT9A 4WQMA 3OOSA 4AKHA 4DS4A 4B6GA 1N0IA 1TYAE 4W9NC 4BMVA 4TT3D 2DKZA 1XEXB 3UJCA 4Q16A 1BXRA 2FPXA 3R8CA 4F3YA 5HQTA 1Z00B 2R6ZA 3C7KA 4HY3A 5CB4A 3ZWDA 2A57A 1LI5A 4KPGA 1TB4A 3OKFA 3HWTA 3GEBA 3LLSA 4ARIA 2MSWA 4KOAA 2G6BA 4IHAA 2HBMA 3O1IC 2O1WA 5B6IA 4I4TA 4IHJB 1EEXB 5HGJA 4LMBA 1HDIA 4RGYA 4MJXA 5AKGA 1DEOA 2A1JB 4KDCA 1F2DA 3OTGA 1E69A 2CHUA 4LNHA 2NYUA 3OC6A 4RVNA 5MHTA 1P2TA 2QIPA 5ESWA 4IZ6A 3IODA 4WZZA 4E3WA 2CXYA 3S28A 2HYIC 2HLHA 2PPLA 3SQIA 1SZJG 4P0QB 1W5BA 3EXEB 1CS0A 1D6SA 2J6UA 2GT1A 4DSJA 1B4FA 2YTUA 1KI6B 1P7YA 2HF8A 2YXNA 4Y2HA 4FGSA 4V02A 2WFLB 3IEVA 4NLGA 3BCRA 4COKA 3QF4B 3S1SA 3EJ6A 1WZ2A 1TQ8A 4W1QA 1TZ2A 2W9CB 4WKBA 5DBOA 2JAPA 1BIFA 2KZZA 4YUVA 5HM6A 2PS1A 1E2LA 2OZLB 4H77A 5THKA 2B20A 3IDSA 1SG6A 2EOAA 1H65A 3EDQA 4LE2A 1W46A 1K0UA 4NY1A 4UUOA 4F92B 4UASA 1DJPA 4P86A 5AKYA 2XMBA 4B9VA 1GADO 4ZO8A 2VBIA 4MIOA 4F4YA 3GRCA 1LW6E 3N74A 1F9EA 2Y66A 4LHYA 1O87A 5KYXB 1DRWA 4IDEA 5FTWA 2BGIA 3ZCXA 5LQJA 5A4DA 1DUIA 1ADBA 4PLGA 5G1PA 4QICA 4FS8A 1JX6A 1JAYA 4ZGGA 1FDIA 3FAHA 1EK5A 1OHHD 3QPVA 2ZJAA 3PNBA 1EGMB 3WMRA 4KAAA 1KFTA 1TD9A 4H7KA 2R87A 1EFRA 3D4IA 5HFJA 2AOVA 3EPPA 5JBQA 4OGWA 2NG1A 2OFOA 3D2SA 3HGTA 1JKMA 5JZOA 4F5YA 2PR7A 4TXNA 5EUMA 5ALEA 1OBHA 2IRWA 4AG5A 1Y8AA 3Q72A 2F17A 4K3UA 4B3MB 2OGSA 5JQGB 1YMUA 1Y4AE 4QELA 2WVHA 5EAIA 2DPMA 2FSIA 3MTGA 5AP9A 5FPTA 5IKEA 1TU4A 2G9VA 5EHNA 3SK0A 3ZZMA 5AQ1A 3UUWA 3MS4A 4ER6A 3AFNA 1D03A 2DZDA 4PYMA 1S5PA 5EZ6B 2QMHA 1KIFA 5EE3A 2WYWA 3QOWA 3E9RA 4HB4A 3AHJA 4NZMA 2XDYA 3AN1A 1L4HA 3CLVA 2I67A 5AOCA 4AKTA 5KNLA 3HSYA 2G9ZA 2PGOA 2QVYX 4S0XA 5IYZB 1YE8A 5JZVA 4DJDC 5DIFA 5DX8A 1I0IA 3MWLA 1F2TB 3MWYW 1PYOA 3IHWA 1QO0A 2Z56A 5DB8A 4OU4A 4BVJA 5C1OA 3EA5A 4XFJA 1Z28A 4G9GA 4X24A 4NE7A 3QPCA 2X14A 4IXNA 3DTNA 5KWIA 3FOAA 3WLEA 5J63A 3LGAA 1UJBA 5D46A 3H1GA 1QFYA 4WADA 3R09A 3UT6A 2MMGA 2YHIB 1ENYA 2VA8A 1DUVG 2QRZA 4CLOB 5IAOA 3TLBA 1QYIA 6YASA 4WFQA 5HHIA 2BFCB 2Q50A 4DF8A 4NOJA 5DX1A 4YFVA 3ZKAA 1U9JA 1KKLA 1CR6A 1OZGA 2NTNA 3I9LA 3L7NA 4JK3A 4PW0A 1R6DA 2BI8A 3SQDA 1AXGA 1UBCA 4WIAA 3V7LA 1QAQA 3O9ZA 4PQEA 3EIHA 2OPHA 3THXA 1WYGA 4I4TF 5D01A 4P92A 3PUJA 5DQHA 1BEUB 4FBTA 2W4IA 1O54A 5JO0A 7ICMA 5IKXA 2B3TA 1QANA 3ORQA 1JQJC 1PE0A 1HORA 1AD2A 4J6EA 5HZMA 4BFWA 2JGNA 3BQNB 4Y3UA 1B0XA 1S9DA 2F3QA 3RI3A 3IBSA 3QX8A 3WRVA 3ZHTA 2R68A 4PLCA 4RF3A 5FPYA 3UJPA 4DLTA 4NV1A 1CWUA 3PW5A 2PUTA 1FA9A 1Q3VA 1ZVQA 2XNKA 4HAIA 4NJEA 2AQ4A 2EG5A 1Q8KA 2AOUB 3VI3B 4RQ7A 1PZNA 1WUDA 5ETJA 1N4AA 3HLYA 3E0FA 4JGBA 3ZBPA 1PDVA 1LBHA 1YOVB 1V96A 4UDOA 3ITEA 4PYOA 4DRXB 3BTUA 2QN2A 4URHA 4LXUA 5CT5A 1K0FA 4AD8A 3KDPA 1U6KA 1SU8A 2WJJA 4DLEA 3GLHB 5CT9A 5EE5B 1Y4ZA 4HPJB 2GH1A 3OOJA 5EQTA 3S68A 3HI4A 3A9RA 5F9NA 4AZ0B 4F4FA 5FWYA 2O8FB 5FI0B 2XCLA 2QUHA 3IE2A 3IUNA 4D4JA 2FEXA 4WCFC 4V0KA 2QRKA 4C78A 2WZBA 4OCZA 5ITWA 5EHIA 1LBSA 3KKPA 1COKA 3MF4A 5AVRA 1ISSA 5MFPA 3MT7A 4CQMA 4V0SA 5J2UB 3ZCQA 5T7BA 4HMPA 1G1MA 1WJGA 1WOMA 1L8OA 4NEHB 5CUQA 1GPNA 1NMEA 1XN1A 2ATXA 2C84A 3NXSA 3H1PA 4KAFA 1U8AA 2Z95A 2X2PA 4D9NA 4UM9B 1MX9A 4IJMA 3H0CA 3O74A 1WXQA 4L9AA 1O8CA 2A9KA 2VJLA 2IX9A 3FCOA 4ZXPA 4E08A 1MX5A 5G53C 3B2NA 1D4ZA 2ZIVB 4KOEC 4JP1A 5DBGA 3W34A 5LKRA 4LA4A 4TQSA 2QGNA 3E05A 5LDGA 2M6SA 3UXHA 2HNAA 4LJRA 4G6ZA 1QPBA 1JXLA 3EZ9A 2BC9A 1E7QA 3W6NA 3UG6A 1ZXXA 1F12A 4G8BA 1XZJA 2B8JA 2OOSA 3D2AA 3GG9A 1G98A 1E7MA 4JVNA 2OM6A 2FHPA 2FLLA 1MVLA 1TW2A 1UPBA 3JD1A 2PL3A 3SI7A 3ECCA 1GUBA 2JGIA 4YRTA 3SIWA 4D9JA 5A5EA 4D26A 2C8VA 2G82A 4Q7QA 2W9CA 3CS3A 4B46A 4BQQA 3KXKA 3VC8A 2P1DA 1INLA 3CZQA 3HB7A 4YRDA 4GMHA 5DK4A 4AIRA 4ZWNA 3HEBA 5KJ1A 3OM9A 4LHSA 2CLDX 1PUXA 5CJPA 4Z3KA 1L5RA 5KHAA 5T8KA 4MF8A 3VNVA 3A0RB 1HSOA 4N8EA 2XUJA 5DDIP 4CKEA 3Q3GE 4YD1A 2W5UA 3LECA 3JAWA 2IIVA 5ALZA 5ALLA 1XNGA 1XVTA 3GL9A 1OLXA 1P31A 1YZ3A 2BD0A 2PKWA 1H3NA 3EGOA 2WG1A 4LAFA 1X9WA 4L4YA 1EKXA 1XCJA 2VP3A 2H1SA 4QBFA 5E9QA 1QLHA 3VH3A 1WB6A 1DIRA 4AWAA 2P11A 4V2IA 5DEIA 4BVHA 5KL8B 3GLHE 1AUXA 4PGQA 2D59A 1KXZA 2WR8A 1ZQSA 1N5RA 4OAOA 4QTUB 1ZS9A 5I8ZA 1FY2A 1P1FA 1QE0A 5ALNA 2IV7A 1IBRA 3REGA 4QRHA 1XX6A 3KOUA 3ENQA 1UR5A 3T38A 2MJLA 2PRKA 1Y3BE 2XPCA 2ZRAA 5DI3A 3QF7A 3OM0A 2C2MA 5F77A 1ZQRA 3FOCA 1J24A 5K4AA 2ZYTX 4R3WA 3RKRA 4ZVRA 4PZUA 2HDOA 2JAWA 2XOXA 5L3SB 2VP4A 2VNJA 1XZBA 1U4OA 3DNFA 1G20E 4XLLA 4DQLA 3M8KA 4ENWA 5JQGA 4L7QA 1NF3A 2C78A 1VLMA 2NM0A 4JCOA 5DULA 3T3EA 2E0IA 1RXEA 3B36A 1O7JA 4CUZA 2QX7A 2BKEA 3FSEA 2FSSA 2FFQA 4WZAB 2VDUE 3WGYA 4LY0A 1EINA 1ZCZA 2H3FA 3PPVA 3DT8A 3I3OA 4TKVB 3WWEA 1IAVA 2QD1A 4EKDA 2VQFB 4JOCA 4P4OA 1VSBA 3WNCA 3V3TA 1Y8QA 4KACA 1NJYA 2YUTA 2QXTA 2VHXA 2YIDA 2XVYA 3DEFA 4B83A 4O6VA 3WOVA 3EBOA 4NYMR 2QN3A 4WBNB 4R8UB 2ZREA 4RGQA 5CXXA 2VXCA 1SV0C 1GRCA 1B0AA 3GEDA 3ED1A 3JCZA 3A28A 4LHXA 3F2BA 2X0JA 2Y0CA 2C7OA 4CUKA 2QBYA 3M89A 3UGJA 4MGEA 1DAMA 4QM6A 1Y5RA 1OH7A 3AEQA 3FNBA 4IS2A 3VVLA 4YFYA 3I5YA 1BWRA 5KOJB 3ZHOA 1Z07A 2FR0A 4M1YA 2I2XB 2X9VA 1L1QA 3ZI4A 3VZRA 2Q4BA 3ETEA 1GA1A 4ZCPA 3KT3A 1DS6A 3KD3A 4G1BA 4LYGA 1ZMRA 1E1LA 4N82A 3R7LA 2J9ZB 4JEUA 3VZDA 1H85A 5DH9A 1ZPDA 3GV0A 1FFEA 3E8MA 2CYCA 2VA2A 3OM1A 4C8NA 4CXMA 2R8RA 1EZ1A 1XQVA 4PF1A 3IDWA 4OB7A 2CNWD 3EARA 2IIPA 1ARZA 3HWX1 2X7HA 3SP1A 2C5LA 3RC2A 1P72A 2KD1A 2JFQA 3ISBA 3E3AA 4EB6B 1VPTA 4XUGB 1WCXA 3B51X 4MWCA 1XL1A 3HMQA 1F8XA 5TS3A 1F48A 1CUHA 4UFNA 4EVSA 1E1RA 2NU6A 1AS0A 3H13A 3PV0A 1VL2A 2NU8A 4PICA 5JYEA 3ITNA 1J0CA 3OQHA 4OMUA 2F3TA 1XWWA 3SSOA 5GGYA 1C7EA 2HA7A 3STXA 2FQQA 4CMIA 4EY7A 3Q3VA 1XKXA 3C5VA 4WJ3B 1DWQA 4BVBA 1QYDA 2ID7A 2OCYC 2ECFA 1T36A 2E1RA 2LP4Y 2XMGA 3ZKWB 4D5GA 2X0FA 3K70D 3ACBA 2H5EA 4MICA 1AMNA 5SZHB 3KUDA 4DYVA 1KO5A 2R8IA 3W4JA 4C7OA 3DZKA 3SSAA 2KV2A 5BN1A 2OGWA 2Q5CA 3CG0A 4YACA 2R751 4NE9A 1H8HA 3EWNA 4P93A 2BCQA 1MQAA 3HXMA 4I08A 3VKVA 4Q1EA 1SQSA 2BFEB 2FK7A 4K7JA 1IXYA 4EUFA 1YI8A 2PXXA 4WD3A 4F9EA 1E9EA 1JG7A 1PJAA 4MKXA 1OBFO 5E2IA 3GNLA 5T3YA 5I4IA 5ERGB 3AF0A 3RAJA 1EVKA 1ZK0A 1QR2A 3WYAA 1VCNA 2Y0DA 2ODBA 3AF3A 2WNSA 4YLEA 3CUUA 4DBLE 3NRJA 1OJ7A 3IOEA 3ANXA 4R98A 3N2GA 5IM4A 3D59A 1NZJA 3WXBA 4HZUA 4JVMA 3IEUA 3ZNQA 3ZD7A 4X7BA 4KO3S 4TT8A 2O8CB 1U1IA 4EPTA 1VPEA 1TEXA 4BNDB 1UUFA 2P1RA 4P83A 1BDBA 4AXXA 3OLCX 2V3CC 3TOZA 5B5EU 3DYVA 4BNFA 5KNCD 2Y27A 5J4KA 4PSKA 1G5RA 3HV2A 3QYJA 4JC5A 3M4JA 4MW2A 4XGRA 1KZ7B 2FMHA 1RE1A 2KMDA 2VIXA 1W4BA 4KQIA 1V11B 1SXEA 4ZCLA 1A8PA 1II8B 3BGOS 1GCOA 1DKOA 4R8MA 1CY1A 1FL9A 4V03A 5IVHA 4C2BA 2GHQA 3VHRA 4Q39A 4RSMA 4CLOA 2VIIA 1EUDA 2R8ZA 3R2JA 1RKVA 1E9RA 3SV3A 1LBEA 1YDEA 2EIHA 2GERA 1RAFA 1TJ5A 3FNGA 3CZRA 2Z2JA 3OWHA 1LPSA 1BHQ1 1RWVA 2BQUA 1VJTA 3MFYA 3VZQA 5JYBA 1LVGA 3HDTA 4AS3A 3D3NA 1TDJA 2Y2VA 4H4EA 4RTRA 4RDHA 1Q5PA 1UAYA 4F2WA 4BP1A 1VIVA 2IV2X 4B7UA 4KITB 5LA6A 5TT0A 3W5DA 1YC5A 4TTTS 2OBBA 4W5OA 2OHHA 2GJ9A 4KBFA 4WN9B 1NSFA 4JLPA 3ADOA 1HURA 1K27A 4H1WA 4EUKA 2B36A 1QBGA 1FNCA 3IV9A 3OZ7A 1YDHA 4KQ6A 5F52A 3A9TA 3QE3A 3B60A 1U9IC 1WHTA 4UARA 2EFGA 4J1QA 4RWZA 2IV3A 1DKUA 4QZ9A 1ZM7A 3OJSA 4F5DA 1I2DA 1YR7A 4IXWA 4OU5A 3WBKA 4ENVA 5C51B 5CAEA 3T7RA 4E0BA 1HNZB 1YRYE 3FZEA 3ROGA 1UJ4A 2QT0A 4LGMA 3OBBA 1NRWA 3ZYZA 2NOAA 3HVKA 3GVCA 3BQTA 1C1DB 3ZUGA 2H18A 4CCSA 5G0SA 2UVVA 3L5OA 3GQBB 3GRUA 2E4YA 3OHMA 3FWKA 4MTCA 4BC1A 1ZFNA 3U5ZB 4ZOAA 2AZXA 3ZDYB 4B3IA 1FVOA 5CP8A 1NKSA 3R5XA 1J99A 1SUSA 4X97A 5L9XA 2J3LA 3VZSA 4B43A 3BL5A 4KI7A 4XJTA 1UBJS 2FUKA 1EAYA 2WYHA 2HJWA 5EE9A 2QDKA 3D7LA 3HYNA 4LW8A 4R8SA 4WY8A 5DNVA 1L4LA 4LSWA 4NBRA 1U81A 1D0IA 4M0AA 3X1YA 4PZ9A 5HKBA 1KY5A 2JD1A 5TJHA 2IUYA 4YYEA 3R5SA 2JFXA 5BVGB 1TK8A 1HUOA 1B8NA 2GZAA 4TS9A 1JJAA 1DV2A 5KYYB 4IOLA 1KI2A 3V7YA 5BMVF 3NAZA 4UHEA 4M0CA 2V59A 1FS5A 1OXKB 2CNKA 2KQUA 3PW4A 4O2AB 4ELUA 2CNBA 1RM5A 3AERB 3KJQA 4FNGA 5KFRA 3F7NA 4XIFA 2CE2X 5A9RA 3K15A 3F1LA 2NTVA 3F5SA 1IQ0A 3EZGA 1W59A 3TD2A 2OCAA 3NGMA 3W5SA 4IQ8A 2CB9A 3ROFA 2YXBA 3JQFC 3R77A 4FCCA 5CEFA 4RY2A 2O5VA 3EK2A 4Z6EA 1LQUA 1WDKA 1NNUA 2P4HX 3S2EA 1P4AA 5BRNA 3C1TA 2Y68A 1LNQA 2N47A 5F4ZA 3I4FA 1T2DA 4DLUA 4U8GA 4DCGA 1ZHHA 4F4CA 5KBYA 3ILVA 1UK8A 3P0HA 3FH0A 1YZUA 4ZP1A 1IPEA 5DCYA 2PFOA 2M9NA 3SENA 1KYYA 1NC1A 2AU0A 1P61B 3B6EA 2HA0A 2HWXA 3MUEA 3CW9A 4KK4A 2G67A 4PHGA 2PFQA 2VDRB 4BX3A 2O19A 1NK4A 9ICPA 2WA2A 4KB5A 5DBCA 4TROA 3O82A 1DAEA 4FE4A 2R2AA 4YG2A 1CJCA 3ZC3A 4OJTA 1VSVA 1SUIA 1EFVA 4HDAA 4I5IA 1S8AA 4ITRC 4Y67A 5CT6A 1U7OA 3RVDA 4YMHA 4KLCA 3M6ZA 4WKOA 4DV3B 1JG2A 3R1IA 3ZDQA 2Q2QA 2YL2A 1QORA 4S2EA 4IIJB 3PV8A 2E8OA 1ORIA 5TJ9A 3RB0A 4ZOQI 4GFDA 4EJSB 1DAGA 3O83A 1A77A 3B20A 3K0EA 3K1YA 2C96A 1BFKA 3P4UA 3JRXA 3QA3E 3RC3A 2YV1A 4IIEA 1XEFA 4TL7A 4EEYA 1UJ6A 4LF4B 2ZVPX 1SBIA 3H5VA 4HQLA 2R5NA 2VNHA 4N3AA 3B9PA 2YCBA 3CIOA 4JLOA 4QQ8A 2IXFA 3HKZC 3ZLBA 3DLHA 1PWYE 3H1AA 3W79A 1MF7A 3H5OA 4I2HA 1TUGA 3NVWA 1S77D 2ZDHA 1VRWA 3LC2O 4QFBA 4JI7B 2BZ0A 5CFZA 1ABFA 4NS4A 3IIIA 3UPQA 1DKPA 3SC2B 1KSPA 2VJQA 3R4CA 3GEEA 1EDOA 1UBTS 4PGMA 1IIPA 2A14A 4L5BA 3GA0A 5B3JA 1UDAA 2BQRA 3QE4A 5B3AA 3V9PA 3WHPA 1GCAA 2XGJA 2A1TS 1SC4A 4ZT2A 1A9XA 3AMVA 3RIMA 3O8RA 2O3RA 1GZ5A 1AHNA 1U8XX 1KFSA 2VHUA 4Y1FA 2AFHA 3W6ZA 4G0NA 4J4TA 4PSCA 3ZS9A 3KFVA 2C2HA 1SV0A 2KLHA 2JATA 5JOQA 4B6JA 5JARA 1WZEA 1XC7A 2Q3CA 2XUQA 4JB3A 1L1FA 1XVVA 2BFDA 7ICUA 1NNSA 1E7YA 2AK3A 3D2CA 3E9QA 4O0LA 4ZEMA 1ESEA 4NV0A 2HWUA 1NI4B 4U39A 2YJ5A 4C0HA 4RPJA 1SK9A 1WEKA 3AH8A 1CE8B 3L6RA 1JXOA 2FPMA 5KAIU 4LVUA 1X66A 3QU4A 4YK7A 3VC2A 4AI6A 4P3XA 4CEJA 3OCYA 4CEIA 1KRPA 1IN5A 1XZ8A 2A84A 2I29A 4JK1A 1D8BA 1TO6A 1KEJA 1TAUA 2JL1A 3ANSA 5DB4A 4DDTA 5LWQA 1N2CA 4H7EA 4TYQA 4W9MC 1RRKA 5IIIA 2IXDA 1T3ZA 1G6KA 1M2WA 2Y9PB 3D6VA 3GA5A 3L8GA 3HB5X 3Q2IA 1BPYA 4M36A 3RU3A 3U39A 4YWJA 1QSYA 1ATZA 3K1JA 5B66U 1CEZA 2WT8A 4PZPA 2NSJA 1U7XA 4G1CA 2OAGA 2PGNA 1QCYA 5BQFA 4XOUA 3E5NA 4XX0B 1T8RA 4HDQB 4JKIA 4M86A 3CRRA 1QWSA 3O38A 2NU7B 3CMMA 4OTZA 2Z4RA 1MQ2A 4XUSA 4JUZA 3BE5A 3CJRA 4HGQA 2HHWA 5EUQB 4B71A 4YRNA 1NBIA 1NNI1 2I3BA 2DR0A 2IYAA 3JQQA 4YD2A 3IR7A 4V1CA 2PJRA 4C7JA 2MA1A 3DHWC 5E95A 3QUAA 4CKWB 3EXFB 1I9CA 1RT9A 2V7BA 3FPKA 3D8RA 3WYGA 4CMEA 5E6UA 1MO4A 4PBTA 1GNRA 1T5LA 3P5BA 1GUFA 1NA5A 5JADA 4ESVA 1W2HA 1ADFA 2CVZA 2DHQA 3PFBA 1L7MA 4UMEA 4DIBA 1G9XA 4A2PA 1E2GA 1RXCA 3MTBA 2XUGA 4RD6A 4D3DA 5KWVA 2ATIA 3DDWA 1XLTA 2WWXA 2J30A 2D5LA 4BO2A 3BS5B 3H9GA 4DR3B 1NBEA 2ZYGA 2B4YA 5FV4A 2Y1JA 2C4WA 2DT8A 2W0SA 3PQ4A 3R5FA 3RF6A 4BE4A 3K5WA 5U9CA 3GPLA 4B9AA 3GN1A 4WPGA 1P6XA 4RK0A 1X74A 5E1DA 4X0EA 5GY7A 3EC2A 2EKLA 4M0LA 4QJIA 4QFDA 5JCPA 1U3CA 5KYNA 5E1OA 1U1EA 2AJDA 2BFPA 1TKBA 2D8AA 4LDJA 3IURA 4OMFG 1R7RA 4XA8A 4FI3F 3OQMA 4TSFA 2QW0X 4MYUA 1R37A 4RC9A 1PQWA 4IVRA 4NMXB 5F3WB 3R7AA 4D9KA 2GQ0A 5JEEA 5ALVA 3EGVA 1HTWA 1F4LA 1FUIA 4A73A 4BQSA 1EPUA 1WU8A 4KTTE 1MRNA 1A5BB 1DTSA 2WC1A 2BWJA 1N2OA 5GONA 4A0GA 2YBDA 5E4YA 3AXTA 1X86B 4N7JA 1SPXA 1AK2A 2XO7A 1ZQTA 3RABA 1DC5A 2G5PA 2HJHA 2LGJA 3IMKA 4JQOA 1B0ZA 4ER0A 2EZ9A 1E5TA 4EI2A 5JZMA 3NTLA 2IXGA 4A91A 1YDFA 2XRMA 3H3XA 4D9FA 1NF2A 3QPAA 4C5AA 1JHXA 2BCUA 2GLEA 1OR8A 2ADFA 2PH5A 2BKVA 3ILXA 4U6NA 4RHTA 4FONA 4XUCA 2MWMA 1U0FA 3KKLA 4K9RA 5LQMA 2K7FA 3HZHA 2ZYHA 5J9FA 1UXKA 1PJQA 1O8BA 3RREA 4BMZA 3RSZA 3DAOA 3GLFE 1WQ1R 3KHRA 4HWGA 5FA6A 4ZCMA 2XCAA 2B7LA 2Z2IA 1JZTA 3ZNOA 1ZQMA 3C3YA 1WKBA 2CFOA 3HCRA 3EGWA 5H4GA 3G8YA 5BVHB 2D3DA 2OILA 1WEHA 4D1YA 3VOSA 3GIWA 2JARA 5LXTF 2HSJA 3P9SA 4WKGA 5CH3A 2P9TA 3UHFA 2QX4A 4B2YA 4OI0A 1L7NA 1XTBA 3MGGA 4UPVA 5CB4F 4AO7A 5GINE 1M2EA 4Z53A 5C81A 4IIFA 3V1TC 5JMPA 2E89A 2VATA 3UAVA 4BVFA 5B36A 2LHTA 4I2GA 3RRHA 2VTDA 5HRAA 1HR0B 1IUPA 2C7RA 4WAUA 3V6MA 1RIIA 2B1JA 3PXXA 2ZUUA 4EUSA 4C07A 3DNPA 4OUDA 1GG9A 3H86A 3I2KA 3ND7A 3O4RA 4DUZB 1A9PA 3QIAA 2Y71A 5KFQA 1VKRA 2XNDD 5EN4A 2QTVB 3RCBA 1UMCA 1DNPA 3T4PA 2ODQA 1EE2A 3TCKA 1X13A 3K6RA 3LC1O 3OF5A 5G40A 3UJ8A 4EG6A 3H9EO 5BV8A 4PLTA 3KETA 1UDXA 1YFZA 1VRVA 1B4DA 2A7QA 2WABA 4IDHA 1ZYUA 4NJOA 3LO8A 4HR7A 4R6XA 1Q16A 3T3GA 1FK8A 3UXOA 1HUZA 2D13A 2OV2A 3S0JA 1GAXA 8MHTA 1X19A 1E9BA 3EZ6A 2EKDA 1GLNA 3Q2KA 4U3JB 3U7HB 2HJGA 1MW8X 1E3DA 2GNAA 1CG6A 3OIDA 3HCWA 2QZJA 3K6KA 3V6LA 4ZHQB 1HDOA 2N3ZA 3TVDA 4BN5A 4OXXA 5FKJA 4EUNA 1FXWA 2B99A 1FOEB 5DF1A 4QUDA 4AYWA 5FJIA 3ZE8A 4ESHA 5TC4A 2G1PA 4DR6B 4N3GA 1JAIA 3I09A 2C5FA 4TQUS 2HBRA 1YGPA 1CETA 4QAJA 2KNJA 5F1PA 2ALJA 2PGJA 2OWOA 4MVYA 2QT1A 3HP1A 2W98A 4YGYA 1YS7A 5AW5A 4L8VA 3SF0A 3ZY3A 3HJRA 2VAWA 4N48A 1F9AA 2PTHA 3HKBA 1GO2A 4NCXA 5A5VA 2LR0A 3X2FA 2CZCA 1Z0FA 1E4VA 4EG7A 1G19A 4X00A 3WZ2A 4CVNA 3GMTA 4EVIA 3M9MB 3OQJA 3RHTA 1JIVA 3ZJ5A 4GGOA 4HAOA 2RE8A 3W8EA 4ND2A 2QYTA 2ZYWX 5BUQA 3CUYA 3H4VA 1HYEA 3AJEA 4FYJA 4J0KA 2B6GA 4YR0A 3ZD9A 4G5OA 2G9RA 1J5PA 4LC0A 2KSOA 1WMSA 5I7EA 1ZSYA 3OESA 2C2GA 3IPYA 4W7IA 2H2AA 4LVNA 2AXQA 1ULUA 4A1OA 4IDBA 4J0JA 4TTIA 3B2EA 3Q9SA 4OFWA 1Z0AA 3SS7X 1WMDA 3W0LB 4F46A 1QG4A 3DXFA 2IZ0A 5GM1A 4XX0A 3U3KA 1EXDA 3JTMA 2WWIA 3DKPA 1R9JA 3K7EA 2VTVA 4MRAA 4CCYB 1ESZA 4ALIA 4HBZA 1Z39A 2OTCA 1A7JA 1JQKA 4N6NA 2RJOA 5IC5A 3J81A 2Y9MB 2YFYA 1NVUQ 2HUNA 2DKOA 3WQQA 2IELA 3BD9A 1XZHA 4J3JA 3TCXB 2B98A 3GFBA 3PIRA 4ZKDA 4UEOA 3UQZA 1FF9A 1EVIA 2XY7A 1WXDA 2GFHA 2XV1A 3H1EA 4JEHA 5FA5A 3K5HA 3SU8A 1J8QA 2GUWA 1ZA1A 4NBSA 1BQ3A 5A6SA 5D84A 4XJVA 5EHZA 1RYBA 4MUJA 5REQB 3ZZ0A 1T8YA 3LZCA 4JT4A 3RE1A 2QSZA 4QU5A 2YOHA 5F2NA 1G8SA 3BIWA 3ROKA 4A10A 4S05A 1WA5A 3EXHA 4QA9A 1XVAA 3HU1A 4Z7NB 1NATA 1Q2UA 3K30A 1NMZA 1NXWA 4QPZA 3D7MA 5KVVA 1K2VN 1NMYA 3T99A 3GGJA 2XCPA 1Q1BA 2QTLA 2Z57A 3T1TA 1NW6A 1PR4A 1E96A 1RLOA 3ZGNA 2R1UA 3BCSA 2RMKA 2PAAA 2E4ZA 2ZSHA 3ILSA 2OV4A 3QBVA 3BWCA 4GI7A 4AF8A 3WKDA 2V55B 5IU6A 1U2TA 1GU0A 4OO1J 3D2LA 4YUAA 4EQ6A 4B74A 5BWMA 2I2AA 4CM1A 4BB0A 4CGZA 2P2CA 3QEOA 1E79D 4MW4A 2J3IA 5JTUA 3COJA 5D6OA 4KLSA 1E1NA 2QIOA 3N58A 1CP3A 2G25A 4LGCA 5IMBA 2A78A 3R5HA 3PIDA 2ZP1A 3VV2A 4F38A 5JS7A 4QM7A 4QREA 1A5AB 3L7JA 3OD1A 1JTEA 3MWDB 1B93A 1GP2A 3LH5A 4PO8A 2XY6A 2FZLA 2AKAB 2J9GA 1ZVVA 2PMZF 2PBFA 1X1BA 4MEBA 3X1ZA 1LSJA 2OYYA 1GAWA 3VMFA 1UXOA 2RDIA 3EXG2 3RD5A 1WOYA 1LZKA 2GYVA 3GROA 5CA0F 3KTQA 1S2MA 1DEHA 1TCUA 4YMWA 1XJ0A 2HJ9A 2K2WA 3AXSA 3V8RA 3C28A 1GTVA 1M2VB 3BG5A 1G6HA 1JRLA 2CKDA 3ZDXB 3WJ2A 3EE6A 1KEKA 1GYPA 5D1HA 5IZCC 3H8JA 4DCJA 2CXOA 2QG4A 1X7YA 4R64A 3K0BA 4K81B 4TXHA 2LPMA 1NQTA 1UFRA 3I1IA 4FYYA 3IO5A 3Q41A 4RS3A 4G4GA 5GM2A 3ZDFA 1I3OA 2PUAA 1U3WA 4RX1A 1A71A 2B69A 2G04A 1P80A 2O57A 2OV1A 1DTWA 1XZPA 1AA6A 4MUBA 3SYKA 1E1DA 1SEPA 2XOKA 3GAFA 2R62A 3DVRX 2WE8A 5H9VA 3T3HA 4K9SA 1U4SA 2CFCA 5EOZA 2ZEJA 1WWKA 2OCKA 3N2EA 3PHGA 1CY6A 1G18A 1HT1E 1PK8A 3R8FA 1UM8A 5EUCA 2HO4A 5E38A 5BYBA 3B6MA 1NKTA 1SO8A 2P2YA 5EPOA 4IIVA 3M49A 4DM3A 2VZ0A 1GOTA 1IEWA 1Y3IA 1NOIA 3VO8A 4EJ6A 1HDRA 1UDBA 2C2ZA 4LEIA 2Y99A 2FLPA 2GGSA 4AJ2A 4KRFA 2H6EA 5KVAA 3IMEA 1XZCA 3QVKA 5A4AA 1ZITA 5EZ5A 1RLJA 1DQYA 1NV9A 3OJLA 4AKEA 3TB4A 4BGUA 5A2QA 1ZA2A 1P29A 2GASA 3HDYA 3EDCA 2H1HA 2PNFA 3T9EA 3SJAA 1RJ9B 3EIEA 4GOOD 2VSOA 3AUAA 4I1IA 1IXRC 1QE3A 2ZRMA 3F3MA 2H0QA 1U11A 2J9RA 1YL5A 1IM5A 1EP1B 3ID6C 2L42A 2VCYA 3QLEA 4MQ4A 3LCVB 2I6QA 3HA3A 3R7NA 3NANA 4A6PA 8ICGA 2FPOA 3C3JA 4YRSA 1BXGB 4IV0A 4MYCA 4QXQA 4MI6A 1QQ5A 2YINC 5M7EA 1XRLA 2A58A 2QAJA 3THWB 4WVLA 3JYPA 4U8HA 5BOMA 4UE3S 5TVGA 4LGVA 3VC3A 3F73A 1RJFA 3C8ZA 4HDNB 2HSGA 3BEOA 4UM5A 2WHXA 1E2MA 5C8XA 4YJ2A 2HEIA 4YPVA 3VX4A 4FW9A 4WFIA 3MJRA 1R8JA 4CCHA 1QG2A 5JVDF 3PR1A 5FBVB 3DW1X 4K6HA 5AKEA 2J33A 2QJOA 4QIWF 3T5JA 1DZIA 1M6VA 5J2HA 2IE8A 3E9NA 3UHOA 4W5NA 4ZT5A 4RVHA 2RHOA 1YA4A 3PNOA 3RSHA 2EP8A 1GKIA 2R2GA 3W8DA 4QBGB 3BZKA 4DTCA 4X60A 4CLEA 2CV1A 4DABA 1S8FA 2NQ2C 4WCVA 3X1WA 2AXTU 5CVDA 4JJZA 3W1EA 2E49A 3P0JA 2J0SA 3WLKX 5JAMA 1AU9A 4DSOA 1HYGA 4ZO7A 2H9AA 4GP7A 5FWNA 1K5PA 3T7AA 3PR3A 2AF3C 4LISA 2ILVA 4HAVA 4IVQA 4MWGA 2NQTA 1JA1A 3PC8A 2VWHA 2G88A 1EJ2A 4Y9SA 1L5ZA 4PIVA 5TXGA 3WL3A 2AB0A 4XOIA 1ZJ6A 1B2RA 4MA5A 3WLOA 1E59A 1KJ9A 4C7YA 3RC1A 1ZOPA 2WB4A 4LZZA 1M7GA 1JJFA 1RXYA 2VF2A 4AO6A 1PJLA 1N0UA 3KSMA 4DEVA 2QSJA 2MT9A 2WWGA 3ZDRA 2FPKA 2O3QA 4PLHA 1CJUC 2DWCA 3ZV3A 5KDDA 4PYRA 2I9PA 2G5IB 4GXNA 5KT4A 2V54A 4B6PA 4JV5B 2I7CA 2YWFA 5IXSA 1ID1A 1O2DA 1EK6A 2AZ4A 2QB1A 3KOZA 3NNNA 2ZRPA 3N5KA 4AMUA 1H0RA 5ILGA 5IT4A 2HNKA 5THXA 4Q48A 4J9RA 1TMOA 2JBAB 1A5ZA 3HFGA 3UFBA 1XLWA 3EPRA 4PHAA 3IQDB 2EJUA 2FZKA 3MPUA 4UUNA 3TNLA 1NFQA 5JJCA 5BW6B 4MH0R 4URYR 5AHRA 4NNJA 2WJAA 3KWMA 1QYCA 4AJJA 1LEHA 4AJKA 5JQWA 2M9MA 3L8HA 1VA5A 4CIDA 4F97A 2RK3A 3ORSA 1EM8B 5JSHA 2NO1A 4MDYA 1W1IA 2J9FA 3JQAB 4L5IA 5IUJC 4JZYA 3IV6A 4R1QA 4L22A 2VKTA 2V9CA 1VHQA 2ID9A 4RULA 1RHJA 2ZIGA 1J25A 1FRNA 3BTSA 4INZA 4PXAA 3GUHA 1OPRA 3EZYA 4UMDA 1DKLA 1YTUA 4Y6LA 2UVQA 4B6EA 1AURA 1JWBB 1NRXA 4GNRA 1XHLA 1PF7E 4FFDA 1Y33E 3E5RA 3JD4A 2P4EA 5K3OA 3CH7A 2R7NA 3OJEA 4L5JA 4PRLA 3PTLA 1MH1A 2VDLB 3ORFA 3IULA 3HPQA 3Q1KA 2QN7A 2JLAA 2WI8A 4HWPA 1Q50A 1VI2A 2OB2A 4RT3A 5G4LA 4MITA 4MV4A 2ECKA 4X6UA 1ILEA 2I8LA 3A1UA 3IAAA 4UUBA 821PA 1XELA 2V9ZA 4AF7A 2OL4A 3FCEA 3H5WA 3NR2A 3NHSA 4NBWA 2QRMA 4PQFA 4OGLA 2D06A 2FLKA 3AEZA 5IDQA 4YR3A 1KPGA 4N4AA 4KIGA 3KKZA 3DMPA 1VM6A 1SD1A 2W8KA 2AX4A 1FVHA 4NI5A 2OYCA 1GRNA 1CJSA 2FMUA 5JSYA 1JEYB 1B41A 1DCFA 1UIMA 1DIGA 1NYLA 2AN9A 2JJMA 3PWTA 1SUDA 1U2ZA 4G1VA 1D5CA 4YQFA 1QHYA 4PL1A 2UU9B 1WZUA 1FUYB 3GJ6A 1YZNA 3R7SA 4TV8B 4II2A 3OOYA 2I5HA 4ARBA 4BJQA 1IONA 1PVPA 4ZRMA 3CYMA 1E4YA 2BSXA 2PKXA 3ZV5A 1EDBA 1P0QA 3WZMA 3KNZA 4EPXA 3ZHYA 1FMTA 3GDGA 8ICNA 3GT0A 3PRYA 4K03A 3UXEA 1JH8A 3OG9A 4NATA 5G0TA 1WX1A 1F8FA 2IDZA 3D3QA 3NP7A 1K9VF 4UNIA 3AESA 3JQ7B 1IJEA 4B2IA 1IAQA 2H4HA 1CJKC 3MSXA 1SCNE 5FCDA 1OWPA 1Z15A 4FJ0A 4Q15A 3WL7A 3TR6A 1EH5A 4I1PA 2IF0A 1SIUA 4C14A 4KR0A 3I8XA 4D42A 4Y2SA 1RPAA 2Y4NA 1UAAA 2DBYA 1OX5A 5PGMA 5JHGB 5KOHA 1NXVA 2HRDA 2XCTB 2Z98A 3RJGA 4R1PA 4CYMA 4B3SB 1P2VA 9ICKA 4B6QA 4BRSA 3OHPA 1K3UB 2F3PA 2KB0A 1WWUA 1J1IA 1HDCA 2QP3A 1C0KA 3H2BA 2J41A 1BRMA 3I9FA 3WYDA 3NNSA 1FRZA 4POAA 4M76B 4GZLA 5DU2A 1GA6A 2QMQA 2VPPA 3HP7A 3MQFA 2XQKA 3OF2A 1ZGZA 4MR9A 4B3TB 3HFSA 2FZ4A 2QVGA 3ZHSA 1QAMA 1GQRA 3EC1A 3NHYA 3B78A 3H9JA 1H4SA 1U80A 2ZANA 4NARA 3ZHBA 1CQZA 3TRIA 1DRVA 4Q45A 1R5JA 4UHHA 5KFGA 2HMSA 2WJ4A 5EYPB 3IAM6 5C5DA 4QXMA 2ZZMA 4K05A 5LQUA 1X94A 1IG6A 5ICGA 2B1QA 2AUNA 2BM8A 2QNRA 2C9ZA 3O8QB 4TSFD 5ESXA 5J3JA 2XIJA 4KLGA 1FDOA 5EZSA 2HRCA 3EVNA 3GUCA 2C8LA 1UMKA 2JKZA 4J7CA 4MGKR 3BQ1A 1D6JA 4PEVA 5F64A 3QIVA 5T67A 1JQDA 2DBRA 4YAWA 2FR8A 4K88A 4RA9A 4AAYA 4D9EA 1KZYC 1RAGA 2ZVDA 4R05A 2WIKA 3G1TA 1ZH2A 3HRIA 1Z5VA 4QASA 3T3FA 2PUEA 4GECA 1B16A 2XZPA 4D3FA 3QX9A 4IZHA 4WK2B 2IBSA 4Q4LA 2ZE8A 4J03A 1U0LA 3WIDA 2VT2A 4EFMA 1GPJA 4MP3A 1E99A 4DLWA 2JH1A 1DJLA 4V0NA 1WD5A 4M0DA 5G1NA 5FHQA 5T14A 1XXHE 3CN7A 1RG6A 2WPDA 1UBOS 2JFPA 2Z1NA 2P9FA 2PSDA 4FFLA 1PZEA 5ECGC 4LCJA 4DZRA 4GGPA 4F4JA 4UTVA 4F2PA 1G8AA 2MSDB 5C52B 4LV6A 5K8IA 1RVDA 4PAQA 1WAMA 4Z3DA 3H7AA 3U1BA 3L4KA 5LDHA 1UZUA 2PH7A 3A9WA 4B76A 4ZVQA 4D9GA 3GLFB 3HJEA 4HRYA 5KVSA 3QVMA 1ZIPA 2AHOB 4ILEA 3ST7A 4WMLA 1OI4A 3OUUA 4K9QA 3OZXA 5BMVA 3LLUA 3JWHA 5FB3A 1XZKA 4Z0TA 4WK4B 1XU4A 3SXUA 1JQEA 2V74B 4C0QC 4MMYB 4JR0A 1ZRSA 5FWXA 5K0EA 1YK1A 3AI1A 3QHQA 1OYOA 1TK3A 3UBTA 2W6MA 3MM4A 3C1ZA 2IJGX 2I76A 2VP5A 3WL4A 2UUCB 1MV8A 2J9XB 3CWQA 1ZQUA 5EP4A 3DCYA 5FUVA 4UJ3A 1F06A 4YXMA 1ZM3A 2YQ4A 2AE2A 3A1WA 1F0KA 4C0XA 3QTBA 1ZD4A 1QH8A 1JEJA 4EDHA 2ASVA 4X3PA 2Q4RA 4D2IA 4CHGA 3TACB 3Q8PB 3AB3A 3DCJA 3PC4A 1ZG3A 2XAAA 4IJVA 3ORHA 2QRVA 1UBEA 2EGUA 4XFDA 1O95A 2TMGA 3OPQA 4NU6A 2NAFA 1E9VA 1YI1A 3FMGA 3FSJX 3EPGA 4W4TA 4X8LA 4AJOA 1U2GA 5KX5B 1N9KA 3MDCA 3FFTA 2BMVA 1RM3A 4L8FA 2G1JA 3REQB 1I4WA 4YGXB 3G0DA 2LXNA 3THRA 3SDZA 1LFAA 3ON5A 4M1TA 4XVRA 5G3ZA 4F5ZA 2PCJA 2Y3IA 5B55A 4M0MA 4FFOA 4C8KA 4IXMA 2WIFA 4CODB 1VXOA 1R5NA 2MYPA 2PLAA 2RHTA 3DEAA 3DV0A 3DDNA 3W90A 2A67A 4DLZA 5KT6A 4DJJA 2CSUA 3A7DA 1GPDG 1KFDA 3AL0B 2RQ5A 4W8GA 1H4VB 5DXJA 5EZQA 3TLAA 2VJ5A 4LJ4A 1QP4A 1IZYA 3NIWA 2A92A 3RS5A 2A1IA 3VYUB 3FPJA 1CC1S 1RLIA 3DPUA 5DTJA 2W11A 3U09A 2CL0X 2JAOA 5DHUA 4KLEA 1U31A 2ZXHA 2VF7A 1MVNA 1AKRA 3I1FA 2XMRA 1T3QA 3QEBZ 2ALZA 1BU5A 1UKEA 1T9GS 3L8ZA 4AY3A 4BEJA 1DGSA 3PC2A 1KMHB 4K1LA 1EB8A 4ZAFA 2W6ZA 2BKLA 3VO1A 2IGTA 3PQCA 3HVRA 2V1XA 2XNJA 3L02A 7ICEA 1MLDA 3NUGA 4JNCA 3G6KA 1UMBB 5ERXA 3Q7EA 2FMXA 4PR0A 1D09A 2CMKA 3K32A 2X0NA 1CQIB 3GDHA 1Z6GA 1ZC3A 2DPGA 4GX1A 5H4HA 4PVCA 4DWVA 4JI2B 1EP2B 2J4CA 4GLXA 2PJZA 3PUXA 2CLSA 5KNCA 3VKUA 10MHA 3OE4A 4EDFA 4J9VA 6Q21A 4LMAA 4LBVA 4CLXA 5ICSA 1SKMA 3DT6A 3MCTA 3SLGA 1WCLA 2XB6A 1UJ5A 2H4ZA 3L7MA 1W5AA 5BR7A 5IJ9B 1W96A 2DFVA 4HB0A 1YR2A 4QODA 5KOYA 1CDZA 3WNDA 4Q9DA 3WO0A 1E9SA 2ZBEA 4LF6B 1IUOA 1BEEA 3RQIA 4ONEA 2F6RA 4PNHA 1JQ3A 3LI2A 3ZWAA 2FWPA 2JK0A 4CR8A 3ISTA 1ZRHA 4ZI7B 4KUEA 5A03A 2KI5A 4M9UA 4W1RA 2B1IA 3T3OA 1RM6C 2BSAA 3EVBA 5KU1A 3PEFA 5DK6A 1ZQ1A 3Q0EA 2DFKB 2EANA 2V0CA 4FEYA 4KLZA 4LC9A 1Z6AA 3EQ9A 4PGFA 4UXHA 1FO4A 4XDYA 4YO7A 2Z09A 2WWVD 4EM6A 4DT1B 1YRBA 1OY1A 5FPHA 1I2BA 1HEUA 2V7QD 5DVZA 2XWQA 3ZJTA 1KQOA 3PF8A 4FZ5A 4M8LA 1KOFA 3LPAA 2HRZA 5HE8A 3UF0A 4ZDIA 2REBA 1S5LU 4R65A 5K3FB 4J0FA 4MWSA 5C34B 3KSDO 3TZCA 1R12A 4F3RA 1S96A 3L5KA 3GDXA 2IPOA 5DIZA 4IC9A 1CUGA 1PT8A 3C39A 3EH2A 4RK7A 4UTXA 2H65A 5K3DA 3V7UA 2BI7A 2P75A 2HWYA 4EHIA 3GLIB 1K8XB 4BFLA 2GO7A 4IDGA 2BJWA 5KTTA 3DUFB 1BVHA 3NKLA 1NVAA 4JI8B 4YCJA 1D9ZA 3LRPA 4NZPA 3ER9A 2GAJA 4D9MA 5LOVA 3RBDA 4E09A 1Y4UA 3H0MB 3L8DA 5JXIA 3C7TA 4LYDA 4O4IA 3BFKA 5JPIA 3GT3A 1CFJA 1SC9A 4L8GA 2QEQA 1UFQA 3WGTA 3PEWA 3U3RA 4U7PB 1NM5A 2LYHA 1F2UB 4FXPA 1E7RA 4ZYUA 1UBSB 2OQIA 3COYA 3WRYA 2UUAB 2GBFA 3TM5A 1HLPA 3OAAD 4Z3OA 3CLRD 5FADA 3PUYA 3BHMA 4M2LA 5J2CA 1ESDA 3QUTA 3ZDEA 5IC4A 1SBZA 1NN5A 2WTNA 4IGFA 2P2ZA 5DX0A 2GM5A 2M1XA 2NNLD 2WYIA 4KE6A 1XPRA 4EPVA 1EFAA 4UTZA 1KFEB 2GBIA 3CRW1 3ZU3A 2QSUA 4J4HA 4ZALA 3TX2A 4J2TA 1KVRA 1X6IA 2IIBA 3UT5B 3R20A 1DV1A 4F04A 3I4LA 2RH8A 3HWRA 2HPAA 4I5FA 4MQ6A 4ELTA 1HT3A 1BVRA 1YR6A 2QMYA 2FWNA 3L8YA 4MUAA 4OHFA 4YO8A 4OI1A 3TNDA 5LB4A 3FNHA 1BQ4A 1Y9DA 2JI4A 2QW1A 3DDSA 2WIJA 1PFUA 3CNHA 1WSAA 2H1LA 2HSDA 2QG6A 4F4KA 3OCJA 3V8QA 2I1WA 2JCSA 3SQLA 2QYSA 2QRJA 3RVKA 3QOFA 2DUUA 1AB6A 3MR3A 3DE2X 1P0IA 5ED0A 1FRVA 1IG0A 4DFPA 1ZNXA 3MCWA 3NHMA 2V3VA 3QKRA 2A8YA 4YRQA 3RT1A 1DB3A 1QH8B 2JR5A 3KYBA 4I2FA 3RB6A 2DUNA 1LCIA 5CYFA 5HKLA 2WAMA 5CLGA 1FDRA 3RUFA 2NSHA 5DE3A 1G8KA 1M1NB 4BYMA 5AKXA 1OAAA 1FQJA 3R75A 1N6PA 1AQIA 4IIJF 1R9MA 4QQNA 3V1YA 3EEQA 2BRUC 5JRDS 1U0HC 5EZYA 4BNLA 2VJNA 5JT1A 3U61B 3BF7A 1SKYE 4LC1A 3REQA 3UWMA 3VKFA 4UUMA 1LF0A 1WKVA 3V72A 3FFWA 1OH5A 1AGNA 1T9HA 1GDTA 1JPVA 1NUPA 3EIFA 4J0HA 2W8LA 3O0FA 1VPDA 5KQRA 2Q6KA 2IU3A 2BN4A 4AQ7A 4JYBA 4WOKA 1QTNA 1THGA 3IC5A 4TX1A 3VMMA 2DSTA 2ZUWA 2VR1A 3IAFA 3PXUA 1J5XA 1SRQA 1S0OA 2W43A 3ZI0A 2ZBGA 1CUKA 4QZHA 3T9AA 4B7AA 4A3SA 4ALLA 4E2ZA 3I9OA 1U8UA 2H0AA 1ZN8A 2BBWA 3X2EA 1HX7A 3DL0A 2J3HA 3GZNB 2V6GA 4PPNA 1KYQA 5AVVA 1WXEA 1N48A 4AP9A 3OX4A 2PQ6A 2W6PA 4CM8B 2INGX 4GKAA 4UZFA 5K0SA 2O0JA 3WXMA 1CUJA 2QAGC 3EULA 6NULA 3VTZA 3EOAI 4PHTA 4M7OA 4H0FA 1D07A 4XSGA 1XVIA 3HNPA 3M9LA 2J5RA 3DEZA 3SEIA 1VXRA 1RACA 3IJEB 3MCVA 3NJRA 3T5DA 3PNVA 1JDVA 1ULHA 5DLDA 1YBFA 3FIJA 4FJ1A 2VDQB 1EP9A 1RE0A 2IYZA 3GDOA 3MJCA 3T1OA 4ZC8A 2IU6A 3IMFA 4J9NA 1QGOA 1V38A 2HD4A 3LDFA 4Y6SA 3UJNA 1QJCA 3P26A 3KKOA 4XD7A 5JV5A 4TOIA 5DCLA 1YFLA 2P0EA 2XQFA 3D1VA 3EXEA 4MTLA 2AUMA 1JKJA 4KQCA 1T9BA 4W7SA 1B76A 1M0SA 1MR3F 5AJZA 1HDYA 3QWHA 4FPXA 4JWKA 2BT4A 4X8OA 3UTCA 3BT7A 1H0SA 4B31A 3ZVRA 1C7YA 1H9AA 2XCQA 4L0QA 3TXAA 1JBQA 3RF9A 4DMMA 3AVTA 4HLUA 2KPOA 2UXBB 1G2PA 1U7TA 1IB0A 5DRTA 2WMOB 1USVA 4ZIRB 4LRYA 1CR1A 5B58C 4M54A 5JEDA 3VC7A 1K7CA 2O50A 4AY5A 1CYEA 5L1MA 2C95A 2F62A 1L6NA 1KQQA 1E2JA 3GUVA 3BJRA 4GPTA 1GVHA 4AG6A 5JYDA 5JSUA 1N6RA 3AIKA 3GRVA 3JQBC 3QPDA 1AN9A 4WXEA 3OO0A 1NV8A 2E3TA 1GXSB 2P9QA 2YB4A 2V4ZA 4XQ9A 1U65A 5A7GA 3SE0A 4DT1A 1DMSA 4CBVA 4YV2A 3TB6A 1IBSA 1Z4PX 4TSRA 3CONA 3A4LA 1KDHA 3IKJA 3X1DA 5DWDA 3WZLA 2YMMA 3KBBA 1FS4A 2D0PB 2NUAA 4RLHA 1M1YB 3HWWA 3T52A 1H2FA 1XNRB 1WV1A 2J31A 4BLQA 3GLIA 1C7JA 1XD2A 4YRMA 2ENWA 2RP5A 3UQ0A 2PLRA 4IEIA 4R2WA 4DUPA 4HLDA 4PC6A 4L16A 8ICHA 3K1RB 3VR2A 3KZIU 3OJUA 4UD2A 2IHVA 5ANRB 5FTMA 5IINA 2RBGA 3ROZA 3FN4A 3QVVA 4QJ5A 1TUIA 4GHWA 1SVMA 3A4NA 1OROA 1AT1A 1EB9A 1ZNZA 2OFXA 3G0IA 3PLAE 1EIWA 1ZQAA 3E0QA 2FN7A 3JS5A 3KB8A 1J97A 1ODSA 1RFLA 1Z2EA 2JBWA 3AEKB 4GPAA 5CEHA 3IESA 2W83A 4JSTA 4P3NA 4XSHA 3THSA 4EA7A 5KFWA 2B4TO 2DBQA 3E2PA 3QLVC 4L8WB 1LD3A 1F2TA 1VYUA 5A4KA 3KR0A 1WCIB 2W6JD 2D6FA 4AS1A 5IILA 2PTGA 4L6IA 3RNLA 3LPCA 3L0OA 4LBWA 5H68A 3VX3A 3ZXYA 5IASA 4U4AA 3O2QB 4WKCA 1K5GA 4BIMA 2XGSA 4KO8A 1HE2A 4DL6A 1DARA 1ZQYA 4B2LA 4W5WA 2I8AA 2YHIA 3EIXA 1NONA 3PMLA 1RHKA 3SX2A 8ICMA 1VHJA 2O4UX 2BFCA 1ZVKA 3N3AC 3UK0A 3D8BA 2CMFA 5IAAA 1O94C 2A9FA 4FIZA 3S55A 3T8YA 1DXYA 3QA9A 5HRCA 3ESCA 2CB0A 4FBGA 6AT1A 2Z6VA 4PNPA 4M1EA 4LX0A 4MR7B 2J7PD 1Z73A 3TR0A 1EXVA 5SZJA 3VPDA 5I4KA 2OXTA 5FNVA 2ZWPA 1EMDA 3RRZA 4MVJF 4BEVA 1CQPA 2CJPA 3S2UA 4NLZA 3CH5A 5E79U 2UVWA 2HYDA 4HYTA 4ZAGA 4IOJA 2J6BA 4EKGA 2DQKA 3AM4A 1E4EA 1QP0A 3MWEA 3M6LA 1N9GA 2IHJA 4IQGA 2XMSA 1PBNA 1KO8A 5KFZA 4IO0A 3TE7A 2RC6A 4AX4A 1SXIA 2C1EA 1Q14A 4G1EB 1JECA 2P9GA 2FE9A 3SM3A 3PSFA 2BGMA 2PBLA 4Q00A 3TN7A 4NL9A 1SXJD 1M8GA 1W30A 2GJAA 5EP2A 2WTFA 4N5IX 3N86A 2Y1WA 4HVLA 1E3QA 2WZQA 2PZAA 3CUEF 1FFDA 5EWJA 1J42A 1K66A 1T2UA 2GTIA 2JAUA 4GXKA 2ORYA 3WFJA 4F8JA 3AJ9A 4ED0A 3LUBA 4I4LA 5A0LA 2HY7A 3E15A 4JD5A 2AN5A 2Q3JA 3QFFA 4GI1A 3D3WB 4P3KA 4RJIA 4Y1EA 3OSZA 2JIDA 3FAKA 1ADYA 4IPTA 5KAMA 5BWBA 4UW9A 4NY8A 2XNHA 5KG2A 4DA0A 5IJWA 3RB4A 5TT1A 1MG5A 1SIOA 4CIVA 3PDWA 3W5BA 2EX1A 2J0VA 3D54D 4PZEA 1ZESA 4EPRA 1PKXA 2P77A 2ZTHA 4GZ5A 4ND4A 1YZYA 3JPRA 2WW8A 2QUZA 3WWDA 2NRZA 1QHFA 1P2FA 4HFMA 5HS6A 4IUCS 4OGGA 5KO2A 5ALKA 3M6FA 3N7RC 2EG9A 4RENA 3KK0A 1NBWB 2J7KA 2NWQA 3IP3A 1DO8A 4N7RA 3GUYA 2WAXA 5I9SA 4FZRA 1PL6A 4TMKA 1T8SA 3UNXA 4E88A 2R6HA 2YHSA 1HMPA 3VISA 1NK9A 3MJEA 1UOPA 4BO6A 1KDRA 5JCJD 1JHDA 1QYVA 3BMQB 5J1SB 4LHZA 4NFHA 4HAWA 1WXXA 3B70A 3N8GA 2NVOA 1K88A 1XTVA 2R25B 3HGQA 2GCOA 8ICIA 2NLOA 2H4FA 3EW9A 3V80A 3H3FA 4PL2A 1TPYA 5LP6A 4B3CA 4QT4A 3INTA 4DG5A 1QQ6A 3MELA 4LDRA 1J0AA 2A5JA 3RJHA 1TVCA 1ADJA 2H1RA 3AY3A 4ITVA 4NHEA 2Q6VA 3P32A 4BQFA 1H6AA 6REQB 4PZDA 5EMHA 4EFKA 5D51S 3BK1A 1KTIA 3HFJA 4JXKA 3A6KA 3BFJA 4ZZ1A 3DKRA 3EZLA 1EJ6A 3CPJB 4ZKEA 1YUBA 5NLLA 5KFOA 5AK4A 3AF6A 4F3NA 3BHJA 3AHEA 1L4KA 1U6JA 4YA6A 2HL6A 5JY6A 5DLQC 3SVZA 3NHRA 4HQRA 3ADDA 4ZJUA 3TW8A 4BTLA 1SG9A 2DGZA 5ALMA 3U62A 4GE3A 1RJWA 3JRNA 2VDJA 5LZ5A 1TCAA 5BWOA 2VHCA 1NN0A 2VSXA 3HBFA 3PB3A 4RPLA 5P8WA 3GLGA 1SB8A 3WGZA 1DFIA 1EGVB 2GVZC 4KQKA 3SS9X 1JDTA 1XTIA 2C5GA 3GJXC 3O3CA 3LVQE 2G0AA 1SB9A 3EAGA 5EMLA 4CI9A 1QFMA 3BIJA 1XRMA 3BWXA 1QNFA 3BD6A 3W5JA 2RBKA 3BBLA 3D02A 4I2DA 4XASA 2W4MA 3OPYB 4R84A 4Z6CA 1LTKA 3EZ5A 3EQZA 1LVUA 4PC3A 4YRBA 4BRZA 3C2MA 3G0HA 2WB1C 5JRTA 2YY5A 2NPOA 3G6WA 2A5GA 3RUHA 4F8EA 3AJ8A 3MNFA 4NNOA 4PLFA 2NZ8A 5LQKA 4L57A 1DLJA 1Q22A 2R85A 1C3EA 1YDMA 5FO1A 3WV5A 4KRYA 4CMHA 4EA6A 1QF6A 2VF8A 1PVDA 1NJ8A 2GO1A 3FCCA 4MLPA 3JQGB 2SKEA 2W2MA 3SG0A 1G7TA 4JJ8A 1A50B 1IQUA 2Q2VA 3M4XA 3D6UA 4M21A 2D1FA 2ZTVA 4X1YB 4DSUA 4WKPA 2PD4A 1HOTA 3T9FA 1PWZA 4CWAA 2XWBF 3D0KA 1BJTA 3IBFA 4KQMA 4A5SA 5JXJA 4HGZA 1JR4A 1PK1B 3GD7A 1G55A 5F33A 3NDBB 1VE1A 1UC4B 1PG2A 2V7TA 2XVAA 2YYSA 4GC5A 3AP3A 1ZXIA 1KIMA 4M1MA 3W4IA 3WIOA 1LPOA 2IEAA 5BN4A 3LTNC 3I2IA 1VE7A 2GPYA 1O4WA 4RA6B 4HRAA 5M2QA 1PS0A 3NH6A 1MT3A 1FMJA 3OI7A 4RTNA 4HWKA 5CCDA 1FNDA 2FPWA 1HQKA 4FBMA 1YT3A 2L5YA 1CY0A 2BHLA 1JEOA 4M3NA 5CVEA 3S1LA 4QZAA 4NM1A 4ISCA 2JGKA 3NVAA 3VHLB 3HDGA 3AEQB 5AM0A 1G3QA 3EFOA 2H5XA 1YQTA 3JASA 3E22A 1KU6A 5J2TA 3LUHA 2NRTA 3Q3CA 3KOOA 8ICKA 1UZNA 1QMPA 2A9VA 3DQZA 3ELWA 3HVHA 4MHSA 1PI3A 5CGQB 4A8JB 4D3ZA 1N7JA 3GN2A 1NPDA 5DTMA 1CDOA 5KYKA 4PTLA 5C3MA 3BAZA 4GMGA 2X19A 3H2HA 2D6FC 1RYZA 3ROPA 3RU9A 3QXCA 2YBEA 3CUWA 4F2SA 1WW2A 4BEWA 2FN9A 8ICEA 1JU3A 1P4JA 3K9WA 4IR7A 4GMFA 4KAXA 3T12A 1PHRA 2XTJA 1R0XA 3K9NA 2X2OA 2XUFA 3OJXA 3UEOA 1OTYA 4QZDA 2VRCD 5C46F 1N9GB 2Z9DA 8ICAA 1FW8A 1LW7A 1XTRA 3RRXA 2DHEA 4ODIA 4JQSA 5KFDA 2BHTA 1YJCA 3A6HA 3B1KA 1VP9A 4DJTA 2GEFA 2OV6A 5E3JA 4D0LB 1E3SA 1A9ZA 5C32A 4MUNA 2LE0A 1JKXA 4Q4AB 4A26A 5L9AA 4YIHA 3N87A 1ED1A 4L6CA 4MV0A 2PKQO 2ZJ0A 2WWYA 4NCAA 4I66A 2C3PA 1VCOA 2RHFA 2EZ4A 2NO9A 2IC5A 1EA5A 2EJCA 3DE0X 3FZQA 3R6TA 1VMDA 4UBJA 3TRDA 5K8JB 1WMFA 5CT4A 3TSOA 1Z6PA 4AYBC 5LL6P 3G2PA 4J16A 4E46A 1RI5A 3KAQA 3ICPA 3R9IA 1DKQA 3O8DA 2P9ZA 1Z16A 2PWBA 5CFOA 3KQTA 4YDQA 2QRUA 2OCDA 1R4ZA 2FWIA 2V5VA 4Q4HA 3SR3A 5CTAA 3VHQA 2QNBA 4Y9DA 3WKBA 3HRKA 5ITZA 5LMUB 3FOWA 4FOSA 3HNOA 1JLMA 3ONNA 3GJ7A 3FF4A 3H8VA 5HP4A 1N57A 3VU1A 2IUFA 2GLTA 1BKYA 3RBAA 4CLRB 4YR9A 2ZI9A 1SCUA 2LCQA 3QWIA 1H23A 2BGTA 4G85A 5K2MA 4RGVA 2JHPA 4DREA 4EL0A 5F7OA 3R0ZA 2QK4A 3A0HU 2MAXA 1X3SA 2VHYA 1K98A 4LKOA 1DZ3A 1KXJA 1M0WA 3NBUA 1VLQA 3ND8A 4F60A 4QYXA 3VYRB 5JH7A 1GIAA 4IX9A 3IPRA 1PAUA 3UN1A 4ZYXA 2I3DA 1KFBB 1TAGA 2ACWA 4YRFA 3GFFA 1SU7A 4PJ0U 3DFMA 2GEJA 4EHJA 2FMPA 3PVXA 1KYZA 3KFUF 1VCHA 1R2QA 2VQDA 2ZYVX 3DWIA 1RADA 1TYZA 4PS0A 2UYYA 4QGGA 1G5FA 4OMCA 5K51A 4NYIQ 2DQYA 4CGYA 2LV8A 1XCMA 2MSCB 1YZHA 4F5QA 3D5QA 5ENVA 4ZI5A 3BKXA 1P81A 1D1PA 3HJUA 1W29A 2Y1IA 4G3XA 2ABWA 1Q95A 4R9RA 5BWCA 2EDCA 3FNRA 1P6QA 2F3UA 2AQ8A 2HHLA 1II8A 5HMLA 3HUDA 1UT8A 4HNGA 4W8OA 1Z8HA 2EHDA 3T06B 4BNYA 4Z54A 3H2IA 3NCHA 3SJCA 3TUJC 3LUGA 3OF3A 2X40A 2ZOSA 2Q46A 4JQCA 3U0VA 1Z0DA 4OP2A 3ZDZB 3ZZUA 5IXYA 2DE0X 3KFXA 5AUOB 1RC1A 2IEGA 3LKBA 1X7WB 3RYCA 1KY4A 3QKTA 4OATA 4C4ZA 2WM3A 3FTCA 1P9RA 2C4NA 2AKEA 3MVEA 4YJFA 4G9BA 1U7DA 2E2WA 2FPSA 4AU1A 2R4UA 1PFVA 3LFTA 2PKCA 5KFBA 5LA6B 2IT1A 2GXUA 3AKCA 3LIPA 4U1RA 3OU2A 3FC4A 1VCIA 4UB4A 1LX7A 3D8UA 2O48X 1ZN2A 3HWSA 1UANA 1IATA 1BPXA 1IRIA 1W73A 1TTHA 2YJTD 2WIGA 5JD5A 3KT0A 4PYLA 5F1KA 2ZYRA 2IW3A 3U16A 4HX5A 5E9WA 3ZJVA 1MZPA 2BKXA 4L15A 2OUIA 4NOMA 4C2AA 5AW9A 1WVGA 4OOEA 1GTSA 1OZHA 5FOVA 3W4KA 4RSRA 3DFFA 1VBNA 2EZUA 3LVWA 1MO3A 4QXOA 3P9CA 3C2LA 5CNKA 4H1HA 4FX2A 2V9PA 4O4HF 1YFJA 4GU5A 5HKOA 2ZT5A 1G6Q1 4X7MA 1S2OA 3OX1A 4NCHA 1D0SA 4D6YA 1CRZA 1I94B 3A2KA 3Q7PA 1GM5A 2JCXA 4CKCB 2DPXA 1JFFA 5IK2A 5FP0A 1FXUA 3CTMA 2P7IA 1TT7A 2JZBA 3JPWA 3RSCA 3A14A 4BLTA 1PTJA 4Y6QA 3SAJA 2RHWA 3F5EA 4F6LA 4O4LF 3QV1A 2IQ5A 4NE2A 4CG0A 3E0XA 1KEVA 2HHQA 1JS1X 1JG1A 1GGEA 3A4IA 3TFSA 2BCSA 3GRAA 4RQUA 1UFKA 1OYYA 2I78A 3A2MA 3NDJA 3PGKA 3FOEC 1DIOB 2QUJA 3PS9A 3WLFA 3ODGA 2MSKA 2LKDA 3BFVA 4C5BA 5JDCC 3U5TA 2WTMA 4KPYA 3VH4A 4KREA 4O9MA 2IYNA 4EYIB 1L4YA 3BM5A 3LCJA 4LNAA 4ZD6A 5U4QA 1FVFA 3OEWA 3LXXA 3PVZA 2PSEA 3WC4A 2ODAA 1QVVA 2HRBA 7ICIA 2OD2A 3BYZA 2BRUA 3ESXA 4NG4A 4LQCA 2ZBUA 4O2AA 8ICYA 3VSDA 2XDWA 5HILA 1VIDA 3QXXA 3N7PD 2CXHA 3I37X 4PAWA 4RQ0A 4HZIA 2B82A 1XMPA 2AJLI 2Z5LA 1P4SA 3AFHA 3BTOA 3D31A 4OIFA 5G0VA 3T0FA 4TL6A 4B84A 4F4DA 5AJYA 3OJFA 4GMKA 4KIWA 1F3LA 4Q5IA 5HDBB 2IS4A 3O75A 2KK0A 5FV7A 4D4HA 3GR6A 3ELUA 3CEMA 4OXIA 4UAJA 2JV3A 2DTXA 2ORVA 3RYIA 1F0YA 2AKYA 1GNPA 3OCUA 3TUZC 2BKAA 5KL1B 2O2YA 3KUKA 1PFYA 3HBAA 4GM0A 4U7WA 5E4JA 5A5DA 1CHNA 5JFGA 3T5AA 1JN0A 1CUVA 2GA9A 2GNPA 3B89A 3OE1A 2C92A 3MD0A 2VPIA 4NS1A 3QEJA 2AE1A 2X9GA 3D3JA 3FE2A 4I6JA 1RKQA 2BISA 4L5YA 2CE7A 3JAWB 4LVCA 2QRHA 4S1TA 3B8EA 4C0AC 2PDAA 3QVLA 3SVLA 2D5CA 3MHPA 4F2DA 1M3SA 1OLXB 1SU6A 2W3RA 2I8CA 3G8BA 4XR4A 3T61A 1EFVB 4OQNA 1YAJA 4MW1A 9ATCA 4C29A 1TYBE 4Q21A 1L7OA 2CXRA 3G82C 2HEGA 3P52A 1F0PA 1S1MA 3U4AA 1OFTA 1RRVA 4DLVA 1O5IA 3ABQB 3I9MA 4JUBA 2AG1A 1Z25A 2W6ID 3M6KA 2Q4OA 3AL3A 1VGVA 3IAS6 4HKTA 4MS1B 3V55A 2JLXA 4JI0B 3WSWA 1K75A 4PO1A 5GOTA 4BLVA 1JFSA 1PL0A 1E3LA 3JQFA 4OUKX 4DL9A 1RZ3A 4HFRA 1GPUA 3GLSA 4G63A 1TVAA 2BMAA 3WI7A 3MABA 2XVZA 4B4VA 3EPKA 4ZAYA 4HBGA 2IS1A 1QDEA 2FZ5A 1I36A 1F20A 1FB5A 2JS7A 2R6R1 3B5JA 3KHTA 4WZAA 4OKSA 4A6XA 1D6MA 3LKVA 3SJZA 4E5YA 2C82A 3NLLA 5KSYA 4CLRA 1XP5A 1Q7TA 5DTIA 5EGSA 1XWFA 3W7VA 3LSTA 2JJ2D 4RZIA 4E1BA 2RD2A 1PO7A 1WSBA 1G8MA 2HU7A 3GMDA 5EVJA 3RSLA 3ZV6A 2DPLA 2ZSEA 4B9LA 3CO5A 5CHYA 3BZWA 1LTQA 1E6MA 4YI3A 5EJIA 2PEYA 3EYWA 1DIHA 1XI2A 3A70A 4IGAA 1PRYA 5EHGA 2GJ4A 3AR8A 2OV8A 3UH0A 5T5QA 1Y9JA 3ZEAA 2ASLA 2NZXA 3GCZA 5H81A 5L7WA 4WESA 3UW1A 5CLJA 3Q3EA 4X9XA 2UZAA 3F8WA 5A4JA 5IBQA 2VEOA 3AQEA 4UCQA 3NQ41 1FMLA 1J0EA 4I14A 1KBOA 4K8OA 4ZQHA 1Y8ZA 3WGLA 3O4FA 1TTQB 5CLLA 3OFJA 3LPLA 1LI4A 4MKGA 2DF4B 2I6XA 1QHNA 5CH8A 3IAXA 1O0SA 2BMEA 1AQJA 4I55F 3QEKA 2KFNA 2WMDA 5AW0A 3QU7A 1DQSA 2I2FA 1DG3A 3OQOA 3H8SA 3OFNA 4L3VA 4RSHA 3DWFA 4WSOA 3F7MA 3K9CA 2HIAA 1BXRB 1AQUA 1OBVA 1R0KA 4IFEA 1OXUA 3C15C 1X7WA 4Z4QA 2PXAA 2J4DA 3KR9A 1JVSA 5P21A 2X77A 1VFPA 3ZHVA 2XZOA 3TK1A 4G09A 4QW8A 4YRKA 5C1BA 3K09A 3CLRC 1D7OA 1E2HA 2H7CA 2UZ0A 1MDBA 2AOWA 3IHKA 3PUZA 1U04A 1WXHA 4DOAA 4PLYA 5JS8A 1S2LA 1CRQA 1VLJA 4R2MA 5KTNA 4OQ4A 1T8UA 3ZUPA 3AUXA 2VRNA 4I28A 4G0QA 1Q44A 4Y6RA 3FKSD 4JU9A 2Z2XA 3BF8A 3D43A 3OIWA 3KSUA 2CJXA 3LYSA 3OIVA 3VKWA 2Q7DA 5EHQA 1ZQPA 1A7KA 2PLWA 3K05A 3NATA 5KYUB 3BQ7A 1P5ZB 2OK7A 3PFKA 3PIIA 1Y81A 2OO3A 3QXHA 1RP1A 4DA8A 3LGXA 5HOQA 2AFHE 4LHWA 1X1EA 4JU8A 2Q7OE 5ALUA 3UK7A 1DXQA 2XKBA 3WGHA 1YR3A 1ZX1A 1PK3A 1T9DA 2VK2A 4JI1B 1T5BA 2NT4A 5EIBD 1WXWA 4QATA 4AY2A 3HPOA 2JZBB 4JR2A 3TF5A 2H5IA 1DWOA 4WJZA 3U3ZA 2XZLA 3NWJA 2HWWA 2V4MA 2ZDQA 1GDDA 2OV3A 2Z4SA 4DIOA 5GTDA 4Q43A 4X84A 1C4KA 2XOEA 3D3EA 3FOFC 5K3AA 5H80A 2JGDA 3DHEA 1IPFA 5D4BA 1I6WA 4X93A 2QVZX 1Y63A 4D41A 5JDIC 5B4VA 3T3IA 3EFEA 1TIKA 4FS3A 8GPBA 3MRXA 5DN9A 3EBPA 5BNFA 3SHWA 2WM2A 5EWFA 2ZJZA 1V95A 3DVAB 3DXXA 4EF6A 3AZOA 4MGIR 3CNLA 2ZTDA 1YZKA 3KB2A 1ZH4A 2ZR7A 4C05A 4DSNA 3WWZA 3ZTTA 1CUFA 2W93A 3QQ5A 2K87A 1KI8A 5LR6A 1Z13A 2Y0PA 1VHLA 3QWAA 3TOVA 4ERXA 4DWIA 1GTL1 2C9YA 2GOYA 3CZPA 4IMRA 1V11A 4QHTA 3T1QA 2OLJA 2HN9A 5ALRA 3FRIA 1SMKA 1IXKA 3DOIA 5A62A 5GZ3A 5FI1B 3TGWA 1HQCA 1KEZA 1T6BY 3AM5A 3LKDA 4FR0A 3U0BA 4IMJB 1YR8A 4LX8A 2GZDA 2P5UA 3G5MA 4XM0A 5H82A 5KNCH 2C9BA 1ZJYA 3OPXA 5B5SA 4QG3A 4GP9A 2DT5A 4YB8A 1D9XA 1OUQA 1Y6RA 3TAQA 1S8OA 4MW6A 1QH0A 3GFRA 3ICXA 2HMUA 3H05A 2HOFA 4P4SA 2DCMA 1E3WB 3A1VA 3FYUB 2H29A 5A0VA 1CVLA 3DZGA 5K0GA 3VYTB 2ZXIA 2NYVA 4WLOA 1XJ5A 5DWVA 1HOXA 3BE6A 4OHUA 4D02A 1QH9A 5SYNA 4JDPA 2IYUA 4EI9A 3KHLA 4QUEA 1J39A 4NM2A 2VYFA 2W9XA 5EKTA 4I1SA 5AWFC 2UYOA 1Y9AA 4O5KA 3D0QA 2W03A 5A7HA 3GZTB 2VA3A 4R68A 2ZR0A 3GLQA 4RNOA 1IEQA 2VDWB 4UBIA 1DJQA 3K9BA 4XQCA 2NP7A 2I34A 3V1UA 1EHYA 1Z7EA 2OMEA 1Y5IA 4OREX 4LZPA 5AM4A 1SUEA 1RDFA 5FTJA 3LHKA 1JBEA 3MXOA 3VAZA 4ES6A 1I4LD 3A3PA 2IHKA 3SBDA 2N46A 5L3QA 4EFLA 1ZLYA 3KG2A 3KD2A 5C5CA 4XSVA 2P90A 3TE6A 1T4BA 5LYJB 2R1VB 1JI0A 3K20A 2FRXA 1W36C 4RKRA 3DW3X 1S3SA 1Y7TA 4Q19A 1IV8A 3RVSA 5J4HA 2H3EA 4ZQBA 1IMJA 2XYRA 2GRAA 5FOWA 4FDMA 4QVIA 4OYLA 3V1NA 2X4LA 4RVDA 4YYZA 3M0EA 1XUOA 4CIXA 4RORA 1I5OA 4YMSA 1MO5A 2GN1A 2KJ5A 5H3LA 3BRWA 1NZFA 4O0MA 4MRVA 4BYGA 5CYGA 4BO8A 5KTRA 2DWPA 4I5EA 4EY8A 4JA2A 3RS9A 1QU2A 2PFNA 2JB9A 5IVKA 3HDHA 3ESBA 1IVYA 1KOGA 5EWEA 1C2TA 3GJZA 3FAZA 2ST1A 3OTIA 4JROA 4RPCA 5C31A 4K9OA 2DHCA 5BR8B 3R3VA 1W44A 3RGGA 3I2JA 4GO1A 3NTQA 4M1WA 4BZXA 4QVKA 3DOJA 2IPNA 2KEYA 3O0TA 4INJA 1FE8A 4BO9A 2A3NA 1JWLA 1AXRA 3HO6A 3TAPA 1BPEA 2WYUA 1ZU4A 2ZIFA 3GLVA 2ZSBA 3I01A 3PEUA 2XHEA 5L8VA 1QDUA 2WJIA 3KJXA 1ZRMA 3AW8A 4M1KA 3LMKA 4IQ4A 5CLFA 1U5BB 3OQIA 1O0BA 1K8RA 4MRSA 5IW8A 3C3MA 3H5LA 4DV7B 2EBUA 2R6DA 4R5MA 2YZMA 3A3NA 4JHLA 3V8MA 4B1FA 4BEBA 1ZK2A 3TGPA 3AHIA 2XRZA 3H2ZA 3C7DB 4HNQA 5COBA 3F8TA 1JBKA 3BB4A 3LT4A 3WBFA 4IEEA 3IQIX 4K4HA 1CVRA 2NSYA 3FUCA 1IC6A 3R44A 4Q7KA 1NJSA 4IF6A 4B82A 2H3HA 1VI6A 1MPXA 4NYMQ 1PEAA 2E5LB 4RZUA 1FYDA 5T41A 4USAA 3F5MA 2XMCA 4KWCA 1XQXA 2YMQA 3V33A 5JD4A 4MI1A 5IJZA 4J07A 2LCIA 3KEFA 1Q7EA 1PSWA 4DNPA 3USCS 4UU0A 1XTSA 3VZCA 3ITDA 2DPYA 3MTJA 5KC9A 4TZ6A 1X1CA 4CCAA 4R9VA 1IOLA 1XXLA 2JPDA 2X7XA 2XGGA 4I1RA 5G3YA 1QLNA 3ZE2B