3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF00702 domain protein
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
1VJRA 2B1RA 2IOFK 2OBBA 3FVVA 2IOFA 1RKQA 2ZBFA 1XPJA 2WF6A 5AVWA 3ZX4A 2R8ZA 4BKMA 2WF7A 4BX3A 1Z4OA 3R09A 5AVTA 2YBDA 3AR9A 3A3YA 1T5SA 2CFTA 1PW5A 1O08A 2AGVA 2CFRA 4MWOA 3NUQA 5AK3A 1RQNA 5AM5A 2W43A 3EWIA 2MU1A 1Z88A 5AW6A 3U7GA 4JDPA 5AM1A 1NRWA 2P9JA 5T41A 3ZI4A 3A1EA 2X4DA 4DWOA 1U7OA 4HYTA 1L8OA 4BBJA 2FPWA 5AVQA 4KN8A 3RFUA 2ZBGA 3ONNA 4KNWA 4YIHA 3OPXA 1K1EA 3FPBA 4G63A 3OCZA 5AI0A 3L8GA 3WKEA 3CZ4A 3KD3A 5AKKA 5FP0A 5ALVA 1N8NA 1YS9A 4Y2RA 1RC8A 5AM2A 5AKLA 1L7OA 1LTQA 2I55A 3NRJA 3I76A 3AR6A 3DNPA 2MU2A 3ESRA 4OCZA 4Y2VA 2CN1A 1XVIA 4C4SA 5AVSA 3AR7A 4UMDA 2ZXEA 4HAIA 3CNHA 3J7TA 4G9BA 3NALA 3ZU6A 2C9MA 3E81A 3QXGA 1TJ4A 2HCFA 3IB6A 2G09A 3M9LA 3OCYA 5IT4A 5ALYA 4BYGA 3FPSA 3SMVA 3I1YA 4UARA 5AKGA 1Z4KA 3KOOA 1WZCA 3ZWDA 2IOHA 4BNDA 3W5AA 4C4RA 2W4MA 4Y2UA 5ALPA 2GFHA 3BA6A 1X42A 1ZS9A 2GHTA 2YJ6A 2QLTA 2FPXA 1AQ6A 3OCVA 2WF8A 5AVUA 3N1UA 2QYHA 4OFZA 3W5DA 3ZWKA 4NFLA 3L8HA 1J97A 4O8CA 1T5TA 2B8EA 5AM3A 3UMCA 3VAYA 5ALEA 3UMBA 2RARA 3N8GA 5AVXA 2YY6A 1YV9A 2IA5A 4HGNA 5A3RA 2BDEA 3L8EA 3I28A 5AM4A 3ZTWA 1VJ5A 3OTQA 4EZEA 4HGOA 3UM9A 3N07A 3B8EA 1Z4LA 4Y2YA 2WF5A 1Z4IA 4J03A 3N5KA 2FUCA 2Q5EA 2O9JA 3OCWA 1L7MA 2B0CA 2FPSA 1RMYA 1IWOA 3SKYA 5ALIA 2HF2A 2HO4A 3FGOA 4UM7A 2ZBEA 3ZTYA 4PNHA 2P27A 4AP9A 2FEAA 4EENA 2ZOSA 3AR5A 1RDFA 2G80A 4ZEWA 5ALFA 2BY4A 2JAOA 1TJ5A 2YMLA 2C4NA 5ALXA 2HHLA 4EX7A 3U19A 4XPZA 3QYPA 2B30A 5E0OA 2R8EA 4GIBA 1U02A 1RQLA 3UMGA 1U2TA 3AR2A 5A3QA 1L7NA 1WPGA 2AMYA 5AI9A 1RLTA 3NIWA 1ZD5A 3E58A 4JB3A 2I6XA 3U7HB 2GMWA 4RETA 5AW1A 1Z4NA 1Z5UA 3WKCA 4NABA 3HLTA 3AR3A 3AR4A 4DCCA 2ZBDA 2YMQA 5AW9A 2G06A 1MH9A 1ZJJA 4QJBA 3QUCA 1U7PA 2FI1A 5ALWA 1L8LA 4KNVA 3P96A 2OYCA 3QUQA 3IRUA 4NAVA 4EELA 5AVYA 3WK5A 4UMEA 2FDRA 5ALNA 2AH5A 3I6BA 2ZG6A 5AK6A 2BDUA 1L6RA 3QNMA 1Z4JA 2PR7A 3L5KA 3DAOA 1EK2A 3KZXA 4BX0A 3SF0A 4UMVA 2O2XA 2HI0A 4UATA 5AKYA 3A1DA 4YCLA 3K1ZA 5AW7A 4YGYA 1ZRNA 3QX7A 1RKUA 3MMZA 1Z4PX 1QH9A 4IG4A 5ALHA 1TE2A 1Q91A 5ALLA 3L0BA 3L1VA 1T9ZA 5ALTA 3DV9A 4C4TA 3KBBA 3KDPA 1RMQA 3B9BA 2HF7A 2FPUA 3NAMA 4UM5A 4EX6A 4YIKA 2C8KA 3RF6A 4ZEVA 4Y2JA 1N9KA 2OA0A 4QQFA 1NF2A 5AESA 5ALGA 1NNLA 3WGUA 5AKJA 2JARA 2PQ0A 2YMMA 2WM8A 5ALMA 1TJ3A 2D2VA 2YJ5A 3E8MA 1LVHA 3DDHA 4E88A 5AKZA 1KYTA 2B8JA 3EF1A 3ESQA 4CF5A 3GYGA 1Q92A 3IJ5A 1QYIA 1Z4MA 4Y2XA 3QLEA 2AUTA 5JJBA 3HYCA 3F9RA 1F5SA 2HSZA 1RKVA 4B6JA 4HGRA 2B1QA 3MN1A 1QQ7A 3B9RA 5AICA 3PGLA 1SU4A 1TA0A 5AW5A 5AKEA 5AVVA 2GO7A 2YJ3A 1WR8A 3M1YA 4L6CA 1ZD3A 3WK4A 2B82A 1U2SA 4YCNA 4BEWA 4OD0A 2FUEA 4OHFA 1YNSA 3QUBA 3NANA 4NWIA 3W5BA 2NO5A 4CE6A 4BNDB 4CF4A 1JUDA 2DQSA 3ET4A 4J2TA 4HGPA 3QU4A 4UW9A 1Y8AA 3QU7A 4Y2SA 1YDFA 3R9KA 4AS2A 2WHEA 3WK8A 3AR8A 3EF0A 5ALZA 2IYEA 4EEKA 3WK7A 3QU9A 3W5CA 4UAUA 1SWWA 3E84A 3WKDA 2G08A 1WVIA 5ALDA 2C8LA 5AI8A 4XE5A 4KYTA 4XQ0A 5AHXA 3SHQA 3ZX5A 2VKQA 2FPRA 2C88A 5AW2A 2CFSA 1O03A 2G0AA 2I33A 3TLMA 4F72A 3D6JA 5AI6A 3N28A 4UU0A 5AVZA 5AI5A 4KX5A 1RLMA 2EATA 2MSNA 4NV0A 5AM0A 2PKEA 1ZD4A 3PDWA 2WFAA 4F71A 4I9FA 1S2OA 1J8DA 2R8XA 1RLOA 4RESA 4I9GA 4YH1A 4L57A 3ET5A 2Q4TA 2RBKA 2YFYA 5IT0A 4Y2PA 4UMFA 4XOUA 4IFTA 2JAWA 3QU2A 2YN4A 3SLRA 5AIAA 2WF9A 4Y3UA 4MUMA 5IS2A 5ALJA 4DFDA 2P69A 4YCMA 5ALQA 3OCXA 5AIBA 2HOQA 3A1CA 3MPOA 1S8OA 2EARA 2JGAA 2NO4A 4FE3A 3U26A 1YMQA 4HGQA 3L8FA 5ALUA 1YJ5A 2W11A 2G07A 3QU5A 2Q4RA 2YJ4A 4BX2A 1VFPA 3KC2A 3ED5A 5AKHA 3FZQA 3WK9A 3QUTA 1RMTA 3L0CA 5ALRA 2I54A 2OM6A 1QQ6A 4DW8A 2I7DA 3PGVA 2P11A 3SD7A 4BEVA 5ALSA 5AW0A 4UU1A 4CNQA 2R8YA 3MC1A 2NYVA 3ZVMA 1FEZA 2HX1A 4FFDA 3ZVNA 2YMPA 3EPRA 3ZUPA 1ZD2P 3U7FB 3WK6A 1RPZA 3NASA 2JAUA 1EK1A 1CQZA 1ZRMA 2HEGA 3L0YA 2G1AA 4Y2QA 3S6JA 3ZW7A 5AK5A 4UASA 4FYPA 2RAVA 4UAVA 1SWVA 3BWVA 3WKBA 3U13A 3FM9A 4KX3A 1ZOLA 5AK4A 2RB5A 3WGVA 5AW3A 3U7EB 2HDOA 1XP5A 4L6AA 4Y2TA 5AKXA 3PCTA 3R4CA 3QGMA 1CR6A 3ZVLA 1Z4QA 1RRCA 1L7PA 3L7YA 4GXTA 3L1UA 4ZEXA 3OCUA 5AKIA 4H1WA 2GHQA 3SKXA 5AI4A 5ALOA 4CF3A 4AS3A 2I34A 3WKAA 2EAUA 5AVRA 5AW8A 1QQ5A 5ALKA 1Z5GA 2ODAA 5A3SA 5AW4A
chains in the Genus database with same CATH superfamily
1BCRB 3WRYC 1INLA 3HFRA 2WSMA 2XSZA 4CQLB 5AUOB 3HCCA 4ZVRA 1PEYA 4J94A 3GT3A 3AYZB 2Z8YA 3KT6A 1R1DA 2P9BA 2XB2A 1RYBA 3IKMB 2Y8EA 1ISGA 5F4BA 1OXBB 2PKRA 5AKLA 1GO3F 4OFXA 2CB9A 2Z7JA 1KSGA 3H2YA 4TMKA 1FTGA 2WSLA 2H29A 3FUWA 3T5HA 3HXPA 1T8UA 3TOZA 4P83A 1E7QA 1Q1GA 4EL0A 2BHNA 4EBCA 4C4AA 3WJ2A 2BM9A 3R0JA 4B6EA 1XB2A 4C29A 4ZN6A 4B7CA 4F92B 3CV3A 1EWRA 2OO5C 1FP7A 4RMHA 8ICEA 1AY0A 2WJ4A 1YIOA 1K8QA 4F4XA 5FNVB 4ZICA 1L4BA 1P5HA 4F4CA 2C92A 4JLBA 4R2MA 1JSXA 2UYHA 2Y77A 1FMJA 1QTQA 4C89A 1CX9B 4CLXA 1QLHA 5KJ6A 1JQ3A 1VC2A 1K63A 3CLRC 3K4QA 1E9EA 4U7DA 5D5PA 3MD0A 4ZREA 4QRDA 3E9YA 5KFQA 3ZN2A 4XPIA 4L8WB 4D2IA 4IIFA 3E58A 3B2EA 3DE4X 4BYMA 3TANA 1Z4NA 5BQFA 2X5NA 2EZYA 3D8SA 2AXTU 4ED9A 1N7IA 3WGMA 5HF9A 4EFDA 2F48A 3NQ41 5B2ZA 4CQJA 3P96A 4MJXA 1G55A 3IRUA 1MAHA 2ZQYA 1L7VC 2CXHA 3KL2A 1LLDA 3UAYA 2Q2QA 4NATA 4K03A 1FVHA 2VJBA 5K0ZA 2ACKA 5J0SA 1P0CA 2DKXA 1E7YA 1TQ4A 1Q91A 1A8UA 3A9SA 3KQVA 1O4WA 3DDCA 3JVVA 4LCJA 2ZZNA 3IJEB 1VFNA 5F35A 3R3JA 3JPSA 5HKBA 4BIIA 5FV7A 1KKUA 2P90A 2A9OA 1GTJ1 3IJ5A 2FN8A 2VIIA 3GNSA 3BS5A 3GJRA 1SIBE 2KEYA 1O2DA 1W73A 4JFAA 2VAMA 2P9CA 4Q1EA 3HU2A 2AGQA 3U1TA 2X2FA 4QU5A 4A0HA 2E89A 2PGIA 1T13A 3MNFA 1PBNA 1ZC3A 3IMCA 2IYRA 2P1ZA 2GEKA 2I33A 2XXJA 2RRDA 5DHAA 3EVNA 1RAFA 3KZNA 2FW9A 3UJ3X 2QN3A 1CT9A 2MSNA 1J5PA 5KFNA 3K09C 2O52A 3M4NA 2RG1A 3PY8A 3NYWA 4B40A 2I4LA 4BMNA 1YR2A 2PG3A 4MMYB 3QU2A 2BEUB 1KVQA 4NAHA 1SKUA 2RGEA 3BS7A 1L4YA 3CEPB 3P9YA 1KQFA 5BV1A 1OHHA 3I34X 4BX2A 2O2JA 4RGVA 3AM1A 4IIUA 4YV7A 5CEEA 1AN0A 1BJTA 4UVDA 2AJQA 3PGVA 3V6LA 4NXZA 4PPQA 1ODSA 3T8YA 2QD1A 4V02A 1OBFO 1D03A 4PHTA 5KYWB 1XLUA 2I4IA 1PR2A 2KPOA 1SKBA 4NBUA 3W2TA 2LXNA 3H8JA 1P9RA 2NO6A 4NE7A 2QG9A 3IT2A 4GWGA 2Q7XA 1MO3A 2X3UA 5KYKA 1YBHA 1HO3A 2ZRDA 1QS0A 2QBYA 2H1LA 4AWBA 5DPMA 1D6NA 5KWEA 2ZRAA 2QR3A 3IR7A 3PCTA 1MO6A 4G4SO 1ND6A 4HNGA 3KHRA 4P5EA 4HQLA 3AFGA 1XMVA 3JQEA 4KXMA 2Z0MA 3UB2A 2A8YA 1G59A 3UQZA 1G2OA 2EIHA 3S5UA 1VPVA 2P2ZA 2OHFA 3NHPA 3HZZA 2X40A 3AW8A 4KNYA 3R40A 3ROQA 4MEXA 1EJBA 8ICRA 1QOZA 3LUKA 2GOLA 1L5ZA 1HFKA 1VMDA 1SUWA 4YDHB 3DF9A 5IIIA 2V7EA 3K9GA 1YRBA 1H5QA 3EGDB 2GPAA 4KN8A 4EYGA 1UJNA 1LEHA 1RWMA 3JQ6A 3PFKA 1YSCA 1U1GA 3HO6A 3FPKA 3C2LA 2JFFA 2XR1A 2Q99A 4BNNA 2QZSA 3V1TC 4HFRA 4KBFA 2H3VA 4YRIA 3COVA 5BN3B 4L50A 1IHDA 3K16A 1WDTA 3C7TA 3QWAA 2HCFA 2XYQA 5KPDA 4E2FA 3VZCA 1QF6A 2WVAA 2K89A 3RYFA 1E1RD 3BZWA 4LC0A 4NY1A 3BJIC 3I32A 2P4HX 2VSNA 1TQHA 1A04A 3Q2OA 4DQIA 3K72B 4LYHA 2O2GA 4RZHA 2XNCA 3DW3X 4CLRA 4HGOA 4YRQA 1Z4LA 3DHVA 1Z7EA 1XAIA 3OESA 1YR8A 1NVEA 1ACJA 3QE4A 1UFRA 1NZJA 2KWIA 5MGNA 1CB7A 1RTKA 3RVLA 2QX6A 3KOYA 4TLEA 2Z1MA 4MVJA 1UH5A 1ACLA 1L7XA 3EH2A 5ITWA 1SVIA 4UB2A 5C5EA 3FVQA 3RJGA 1JLKA 5IEBA 1GNTA 1ECWA 4MLZA 1YZHA 2OV3A 3QVJA 3NRCA 4LV6A 1YDEA 5KPJA 1Z37A 4E2WA 2WYOA 3GLGB 4KL8S 2QVYX 4IH9A 4HHEA 3ROMA 2I3AA 3QNMA 4X85A 3DD1A 4C7XA 1N6NA 3G0BA 1GUYA 5J2UF 2GFIA 1ITZA 1L5HB 5L3SB 2A5YB 4FKMA 1P1RA 4DJDC 1QLWA 3GFRA 3LF2A 4KLNA 4BNHA 1Q7BA 3RUCA 2CLLB 2NG1A 5FORA 1JHDA 1URPA 4X65B 3I6ZA 3K30A 4KR6A 2WY2D 2AXQA 1AZWA 2D1YA 1WMAA 4OXRA 3QX8A 2H2IA 3MHPA 1QYCA 2FSHA 4MEYA 1QFXA 3HKBA 4FBTA 2WWVD 5IDYA 3T5JA 4R1LA 2QMUA 1ULUA 5T4BA 4DR1B 1Z08A 3AJDA 5FOUA 3TLEA 3RVNA 4YCNA 4G5OA 1C0IA 4AN1A 2Z8YM 1ZGZA 5K8CA 3PNVA 9ICKA 4UB8U 4PZCA 1F4PA 3AR8A 1K98A 2D5AA 1Z0UA 3R3HA 3ZLBA 5BNWA 2I1LA 3F3SA 3D31A 1MC1A 3W7BA 4UAGA 2VJMA 2CUZA 1IAVA 3TDMA 3MJEA 3DMTA 1TT5A 4OHVA 5KFTA 5E7JA 4LXTA 2G5IB 4F5EA 4RESA 2BKEA 4LKOA 2CGEA 2PBLA 1MGPA 1B2LA 1NE7A 2OXRA 2PUTA 2JFBA 1DIBA 1L9KA 1FFSA 5HK8A 3EE6A 3LFTA 3DVAB 1USVA 4PZYA 4GPEA 4NXMB 2IELA 1JHAA 3MC1A 4L7QA 3DOEA 3EVEA 2VJYA 1N2JA 3IV9A 5HR7A 2P5SA 3BH6A 2Y71A 1R5OA 2WWYA 5FOWA 4XGQA 2QE7A 4Z9XA 3FCOA 1E8NA 3WHLA 2AZXA 2FR8C 3L79A 1XTVA 1DC4A 3RBZA 4ZC8A 5E9AA 1KJYA 4EFMA 3QLUC 4KQEA 3D2BA 5BURA 4RTLA 1IOZA 1N2EA 1AUOA 3TXAA 4O3PA 1U8UA 4KN7A 3SBOA 5KG0A 4KLOA 2BF7A 3TVYA 3RJMA 1IOLA 1X7ZA 5K0GA 4AS3A 2W9BB 1XHLA 1EM6A 4GC5A 1SXEA 2HU2A 2R1VA 1NRJB 4A1FA 3UENA 4ND5A 2J1LA 3QA9A 5HZHA 1KEEB 3MF4A 1ZJ6A 3ZGLA 5FULA 3VPDA 3RVOA 1OLUA 2PGJA 4OXKA 4EVIA 1WQ1R 3ORRA 5FYQA 1G19A 2I4OA 1DCTA 2RI0A 4DXHA 1LRKA 2EP5A 4HYTA 1T10A 5JS2A 3OY7A 2C0PA 4CYMA 5B58C 1ULTA 1QHSA 3MWGA 1AKVA 2WG1A 2WVHA 1SFRA 3S1SA 4C4SA 2CUKA 1XL1A 3CLSD 4YJ2B 4X20A 2C9MA 2ES4A 2GEVA 3UIEA 4YJ3F 4P6VF 1IXRA 4C5AA 1XZMA 3BXZA 4DSAA 4KYIB 3CNEA 1MN6A 2P91A 2Q27A 4F5NA 2XDQA 4LJXA 3TUZC 3OX4A 4HLDA 1Q74A 1J97A 5M2QA 4YMWA 4LZLA 5K3FA 1E1DA 3R7BA 1L7AA 3B2QA 5A3RA 3CGGA 2FZ5A 1L6IA 4HB0A 3DVRX 1KSJA 5K4HA 2HF2A 4QBHA 1JFVA 3VNSA 4I6GA 3H17A 3EOZA 3KHUA 1ODKA 1I5OA 1JAHA 2BFPA 2EHJA 4TV9B 1H8EA 5T7BA 3L43A 4HVCA 2H31A 3MIIA 3SJCA 3TE6A 3ZHVA 1GAEO 2UZIR 1KQQA 5BMVB 1N8TA 3UJ7A 3I12A 4BO4A 2EP8A 3NWJA 3UT0A 1QAQA 3B7GA 4JP2A 5JXHA 1L1QA 1AIPA 3RRYA 1PTJA 2OMKA 1OH5A 3PITA 1YGPA 1AE1A 1F60A 4NECA 2EWWA 4FJ0A 1PJAA 1OC2A 4JSTA 5KDLA 1NSFA 2O2XA 2X1HA 4M60A 2H85A 4ZV9A 2YYYA 1N32B 4D0NA 3UWPA 4E5NA 2YXBA 2NUTB 4LHWA 1COZA 5TPZA 4JXKA 4YAOA 3KPJA 5G0SA 1Q3KA 3R0ZA 4O4JF 3DEAA 1A2OA 1FQOA 2UZ4A 3S70A 3W5IA 5JWRA 5KWJA 2Z3ZA 3NAZA 1QYIA 5HKAA 1EMDA 1DKUA 1Q20A 2GEBA 1C80A 3OLXA 4Z53A 1P0MA 2RHOA 3G2NA 2YX8A 1ZNZA 1RU3A 2OGSA 3RUHA 3GZTB 1PWZA 3A9RA 2XUOA 4CFYA 1HURA 3JSAA 4X6XA 1X7WA 1RW4A 3OF5A 2QTHA 2HCJB 3BKWA 3UQ2A 3WP0A 3LJKA 1GDHA 5LKAA 1QOQB 1NC1A 4UAUA 3GIIA 3LK9A 3TRDA 2HBLA 4L07A 4UUAA 3U0VA 5AFSA 1J8VA 4OB7A 4WCFB 3SF8B 2J45A 2YTZA 4RTOA 2QAGB 3RYCA 1KXZA 5F9HA 2GERA 3HI6A 3ZH9B 1AD2A 1CKEA 1WRBA 4CG1A 4UMFA 1KFCB 3GLVA 1OYOA 3VHRA 4C43A 1IZ0A 2KSOA 5DLQC 3FZEA 2GM5A 2RGNC 2Y0BA 5ALUA 3UKDA 1QV9A 3D4BA 3DKIA 3LQYA 5EE1A 1YRAA 4RENA 3OIGA 3R9IA 3HN6A 4JBLA 2PANA 3E18A 1RRVA 3R6WA 3TLGA 3CR7A 3HWRA 2ZLBA 1PNRA 3UY4A 3FCSB 2A1TS 2CYCA 3H4IA 1SHUX 4QNMA 2IPAB 5LMUB 2YMPA 4BLOA 3HJFA 4C7VA 2AFVA 2I4NA 3UUGA 2II6A 1VECA 1GPLA 4XQ8A 4MVJM 2NO7A 4PN3A 5DK4A 3SBXA 5TV2A 4Z1MD 3U4IA 3MGVA 1CUVA 1W25A 4DMUB 4U7GA 4MV8A 3FPFA 4IIJA 5A7GA 4WY2A 1JR3D 2W98A 2BDTA 4UHHA 4PO8A 2I34A 4P4SB 4UPDA 4L8VA 4X8HA 1BX0A 2FV8A 4N41A 3KPYA 1FIUA 1IHUA 1ORRA 1XC7A 2VHYA 2CMKA 2FCRA 1L5VA 1ZISA 1Q1AA 2ZUCA 5CLGA 1GXSA 1ZBQA 4GLLA 2EKDA 2JCVA 1HEKA 3DMHA 4NAUA 4N18A 1XEXA 4ETIA 3A1EA 2I6QA 3BIOA 3SZ2A 1N75A 5IANA 4AY2A 1HDCA 4B9LA 2JFWA 2R2GA 1U8XX 4XM1A 4HDSB 4DS4A 3P2MA 4U8HA 1T3TA 1OLSB 1Z73A 3K9QO 3ITEA 1E2UA 2KICA 1MB4A 5FHQA 2JGMA 9LDBA 3OZDA 3ETHA 5TGTA 3AQEA 2MA1A 2FRDA 2TS1A 1ZQWA 4R2HA 1SXDA 3MINA 2QRGA 4HNUA 1FSSA 2CC2A 4L9AA 3HP4A 3UCEA 3ZY2A 2OECA 3W2GA 2W6JD 3LO5A 4CTNA 4XDZA 4E33A 4ZRMA 4BJQA 1J99A 1NQ5A 5G4LA 4WCFC 1G7TA 1MX9A 2IHTA 4RKYA 1V9PA 3SV3A 4N3CA 4MMXB 3A3NA 5J8YC 3QKRA 1RI4A 3KQLA 1OOEA 3WYFA 1M0WA 2XF2A 4BNIA 1DXYA 3T41A 3ZCXA 5CXQA 2A1JA 4GI1A 3TZEA 1GADO 4B7AA 2H3QA 3A1TA 2RIPA 1R0ZA 4KUGA 4NABA 3FMPB 1PDWA 1YDWA 2F59A 4P31A 4CKBB 2QI9C 2QZ9A 2PSSA 1OLOA 2JLQA 4Q4CA 1K6XA 4OQMA 3BMNA 3UJAA 4ZVUA 2G5CA 5DNCA 1E5XA 5J4HA 4F2WA 1RCTE 4NX2A 3H5WA 1JQAA 3PQEA 1HORA 2BMWA 1ZRNA 3QX7A 1RKUA 4QUGA 4LXYA 1II8A 4HJXA 4TLBA 2DPYA 4TS3A 1P4GA 2MUTB 3GV8B 4Q18A 1VA5A 2VRCA 4KPUB 3WICA 4C22A 2GZDA 2ZIWA 1ISFA 1B6SA 2VF7A 4MV1A 4PGXA 1V1MB 5A4AA 2ATIA 2X9GA 2QJRA 1NBHA 1DK3A 4YBZA 13PKA 4UFNA 2KFZA 3T4PA 1DTWA 3COYA 3ADDA 2GZAA 2XGMA 3ZYCA 2H4HA 2YS7A 4EJ6A 2C9CA 1DX4A 1D3AA 4IQ0A 2GXSA 3FOFC 3EUAA 2H5LA 3SNKA 3PGKA 5FEMA 3E35A 4QG7A 3CWCA 3ZLVA 1RCFA 2W6OA 2W2XA 4D6YA 2GKSA 5B57C 3TG2A 2Z9DA 3IAS6 4ZOLF 3HXMA 2R6ZA 2XRZA 1BN7A 4HTAA 5AUNB 4YAWA 5LN1A 2EVWX 2WYHA 2O2ZA 3VYTB 1XIVA 7ICEA 3TG8A 4DWVA 3SLGA 1WMEA 3PC8A 4Y6LA 4QHSA 3KM0A 2PX0A 1O96A 3FYSA 2G7ZA 2AQ4A 3Q0IA 4TWBA 1F6DA 3G2JA 1N78A 4I08A 1DKQA 1J9GA 4PG7A 1LFAA 4U7PB 1SRQA 3WLMA 2KFNA 3NHSA 4AN4A 2C3PA 2X0RA 1SBTA 1Y9EA 4LJKA 1DS6A 2CE7A 1P7PA 4QEKA 1Z2NX 5HTKA 2W6PA 5E6UA 5GVRA 2RB5A 4H4DA 1NOMA 4J9LA 1V9SA 1XP5A 1WXIA 4F21A 4ECWA 2K4IA 3I9OA 4GOMD 3CE6A 1G5QA 3SKXA 3X2FA 1G16A 2JEGA 4TMVA 3WWDA 3R77A 2V4RA 5J0YA 3LGAA 5LDDC 2NX2A 4ZEOA 1UKVY 1J25A 4H6VA 3HVKA 4MVJI 4YMIA 4NNJA 5K3DA 1U7WA 1LKYB 4YRMA 2AXNA 2HQBA 4HY3A 5LLSA 2EZ9A 2ES6A 4OU5A 4CKCA 3T52A 3PNLA 4J6FA 2B2XA 2QP3A 3K35A 4PQYA 2XMRA 5GIPE 3QELA 4MYSA 5F7ZA 5AI0A 5FP0A 1SBZA 4IDPA 1E4EB 4X1IB 2YWFA 1JZQA 1COWA 2C4VA 1RXIA 4GXJA 1F12A 4HDKB 3CISA 3E9ZA 1X9MA 3QKSB 3ICCA 3G0OA 1WBJB 2FKNA 5ENVA 1CVIA 1GSOA 3HCNA 3EPGA 5L4LA 2WYUA 3ZHSA 3N8GA 2OO3A 1W5EA 3QYJA 4AJPA 2VF4X 5EWFA 3L92A 1R64A 1PQUA 3OUTA 3DPUA 4BS9A 1AK2A 5KB3A 3JZMA 4IL5A 1KMHA 3WWCA 5CPBA 5F5NA 2M1ZA 5KKCA 1FDUA 3IMFA 2ZBPA 1Z83A 3KL4A 3R0VA 5AI9A 2ZTLA 3BXEA 4EA6A 2P3LA 5LJLA 1H5NA 4TV8B 3IAUA 3Q7PA 3NS1A 4RADA 1QGED 1LVUA 1WMFA 4WINA 4QZAA 1M2EA 5FUYA 3N9IA 1IN4A 3UJ6A 3BKXA 2HRCA 4ZYLA 4JGBA 2A94A 4OREX 2C9ZA 3MCTA 2KKPA 1RLJA 2HIHA 4HD8A 3PUJA 3GQBA 4YP1A 1J9ZA 2Q8PA 1GRCA 4QZFA 3SAJA 2GARA 2R6GA 4LXGA 1VBMA 3OOJA 5HF8A 4MRMB 1I7PA 3AUUA 4C3VA 4X9XA 1XZCA 4YGYA 2QTTA 4KIJA 1VCHA 5B4VA 2CNDA 4IG4A 1X8JA 2Q1YA 1M6NA 3NO4A 1U6IA 1XDSA 5HXAA 3ON5A 2A1UB 3S1AA 5I6DA 1PI3A 4N39A 1DEOA 1WXWA 2PAAA 3EGCA 4ED7A 4CXMA 5I8WA 5CGQB 2GWSA 2MSDB 5KJFA 5LYJF 4WA8A 5C4MA 2C83A 1QHFA 3ADKA 1NUUA 4PHHA 2BMDA 4H6WA 4BFWA 3W5BA 3WY9A 4QNRA 3L7LA 4YWJA 2C5FA 3BEDA 4JQZA 2AW5A 2Q3MA 4ELTA 5FRDA 2FP4B 5JQGF 1U1FA 2DGZA 3PFWO 4ZU1X 5LYYA 5DTQA 3PDIA 1M6HA 3TSCA 2OE2A 3LRTA 4M1MA 1Y6FA 5EMNA 5CFZA 5CP2A 3ZXUB 5L3VA 2IHJA 3LIPA 3IBCA 4EGSA 4OMUA 3HWTA 1DV2A 4KHZA 3RB6A 3WYNA 5M34A 4GKBA 3T3MB 5EZQA 1PJ2A 4BMCA 1XU9A 5KG4A 1ILEA 3D5QA 4MQBA 1RI1A 1TXGA 3OJOA 3T7IA 2IYPA 3KSDO 2I2BA 1OX4B 3ZS8A 3FDXA 1PZGA 3PA8A 1LV7A 4F60A 2G6TA 2NU8A 3FKSA 3ZGXA 4CTJA 5J2UB 1A71A 1X1BA 5BUQA 4R9VA 3I9V6 4UCXA 4UXIA 1IBRA 1C7JA 3EIQA 1MUUA 1KK2A 2V4UA 4OHUA 4D0SA 1DI0A 1IBCA 2JA1A 4EJ2A 2C78A 4XVUA 1EE2A 4Y2HA 5JPIA 4JB2A 2JCGA 2FW7A 5GAJA 1WU7A 2HJ9A 3E1GA 4FCWA 2O7RA 3GARA 3MJSA 3W8FA 3T5MA 4BLTA 4G97A 2HNBA 1IY8A 8AT1A 4FXPA 1PQYA 1PT8A 4H15A 4AN0A 2BFEA 4C6TB 3V3TA 1M10A 3OD1A 2IU6A 4GD3Q 2AG8A 4KCGA 1G9TA 4U39A 1VHWA 2B7CA 1NOJA 2RGWA 3HJEA 1IPEA 3BICA 1HEIA 2MRLA 5LUBA 1A0OA 3SQDA 3LVFO 3MUOA 5K2OA 4DLWA 3PC7A 2UDPA 1RKQA 1YMUA 1CF4A 3AF2A 2ZBFA 4FUTA 3OU7A 4B09A 2CKMA 2Y9TA 1BU8A 4TPKA 3CYMA 3HYTA 3CQ9A 1T5SA 4Z0TA 1ISIA 5KYYB 1GUZA 5EZYF 5TQVA 2VQ6A 4ZVLA 2M6KA 2FW0A 5CVCA 5SZJA 2JFHA 2OBYA 1MMFB 1MB9A 2J3LA 1NJWA 5KREA 1YJCA 5EP3A 1XTTA 5CNJA 2OV4A 1XDBA 3ISTA 1LF5A 3L8GA 3VUEA 2GRUA 3L41A 4B43A 1HT0A 1J22A 1AQYA 4Q9IA 1EFKA 5CK5A 1XDGA 3UANA 5JC1A 2AIRA 1PEDA 3AHEA 2O5CA 1FFUA 3GL9A 4J0HA 1L5MA 1MXHA 2Q0ZX 2HWXA 4L6IA 4YRSA 1VI6A 1WZCA 4C4RA 2I3GA 2WIBA 4JJKA 9ICMA 2O0KA 1W75A 3LDGA 1U81A 3JQ7B 3R9XB 1ZR4A 1QGYA 1NNI1 1T8TA 4PYNA 4QUKA 1NVFA 3AEXA 4O5KA 3AL3A 4LJ9A 3SKVA 1PWEA 5FJIA 3IPRA 3ILSA 3AM5A 4B81A 4CLOA 5JSZA 5ALIA 3P9IA 3OFKA 5DNEA 2JZBB 3FCYA 3IRVA 4FYMA 5T6BA 3BHNA 3V32A 1T29A 3TZQA 1ZQTA 3GLUA 2GHRA 1PAUA 4I2AA 3IT0A 1WXFA 2VFAA 3NB0A 4C05A 2B9EA 1KH3A 4WZAE 1FDVA 1GARA 5JS6A 2HIAA 2NMVA 4HSEA 1JLSA 4ZH4A 3SVZA 2CL0X 3EVCA 4PL1A 4KDFA 5F3XB 1ZHHA 3U31A 4O9MA 1ZJJA 1C4XA 1I3LA 5PNTA 4XH9B 4RK0A 4MDFA 2XVAA 5BT8A 3QWFA 4MWCA 2Z6QA 1QK3A 3CONA 2QHXA 1NDUA 4BBPA 2B3TA 2XYVA 2DF4B 3TNJA 2REQA 1G7CA 3PNQA 4JN6B 2C2DA 3HRHA 4F9FA 2OCKA 3R0QA 3RS2A 3I9V1 3PQ5A 2IU4A 4YJ3B 5F2NA 1H38A 3WLPA 3E2EA 2DECA 5CB4A 3LLMA 3PJEA 4LZAA 4LW8A 5DLPA 3RBDA 2ZVDA 4QOEA 1XS9D 1GNQA 3EF1A 3Q85A 1KQNA 4BV3A 3PXEA 3AETA 3DVLA 4DG8A 3RABA 1P7WA 3C6BA 2XTNA 1GTL1 4II2A 4BIMA 1UIMA 2O07A 4WQMA 1J2RA 4FOPA 4F8EA 3L7DA 3LV8A 2FQYA 3MILA 5CFOA 2Y1EA 2BL4A 1NNEA 3SJAA 1Z1VA 2GPNA 3ZY5A 2FX2A 5JJ5A 3ZU4A 2QN2A 3Q0TA 1JPUA 4CMEC 1NX9A 3KYIB 4IS3A 4OGWA 3QBTA 2HPZA 5L53A 2GPJA 3LL4A 3VVBA 4EL5A 2ZJYA 3IHWA 1JHXA 5EKXA 2BCVA 4G8CA 1E1QD 1QANA 5IH3A 5BMVF 4YDRA 2WWGA 4R7TA 1WWUA 4P36A 3LM8A 4DLAA 3B82A 4M0LA 4YMSA 2P4UA 3PFGA 5AKHA 1DGQA 2YWEA 3CPJB 1M34A 3R7WA 2QSYA 4DDWA 3DEYX 3O73A 3A0RB 2JGKA 4O4JB 1I6KA 2JH3A 4PCAA 2HRDA 2FH5B 3K2EA 1ZR2A 3IXQA 4C0JA 2FDXA 3RJ5A 3HDHA 3I0NA 1I80A 3K9LA 5HFJA 3D4PA 4N49A 3HV0A 1KE1A 3FUUA 4CKZA 3TARA 1C4WA 2NUPB 4KAFA 4OQZA 5G1NA 1X40A 3GJ5A 4X54A 1M6EX 2O0MA 3OP1A 2KG5A 3CEHA 3HX0A 5ELMA 2DKZA 1E4OA 3WZ2A 1CFZA 2QU7A 4HP8A 3M6VA 5L51A 4DB4A 2AJ8A 4IVRA 1PGJA 1WP9A 2BZGA 2GUGA 2HIGA 4KO4S 3HSSA 1M1YB 3ZJUA 2FA9A 3DTYA 2ZJ0A 2M1XA 2QXUA 1I10A 2JEFA 4CUKA 5EJAA 5FPYA 2ODWA 1Y9DA 3IUBA 1QJ4A 4KAXA 1WEHA 1SHJA 1VLBA 3OWOA 2EKQA 4F1WA 3NUQA 2YQ4A 4UDOA 1ESCA 5SYMA 4IHJA 3SHWA 1CJCA 3H9CA 1K1EA 5BSFA 3LCUA 1TIPA 3KD3A 2YWDA 1TFUA 4B1FA 4K7JA 4MRRA 3QSYA 4D43A 4CIVA 1EJ0A 1EP2B 1E98A 5DBIA 4OQQA 1TYDE 1D4FA 1GZ3A 2BUAA 1C9DB 3VFDA 2HBRA 1GU7A 3SYRA 1FDRA 1QIEA 3D7NA 1ZS9A 4O1MA 4RQ3A 4ITVA 4QWEA 3MWDB 2XCIA 2NPFA 3CKLA 3C15C 1NJ6A 3SSMA 1JHMA 2EX1A 1CC1S 1Z4IA 1WDLA 2XADA 1EX1A 5CP8A 1E79D 3AM3A 4DNPA 3REQB 4MEBA 4IVPA 4DLGA 3BD8A 2IIBA 4UVGA 2R8IA 3M49A 3C48A 2VDVE 3KKPA 3NV7A 2AOTA 4FIDA 2EX4A 2QUJA 3UB4A 1RYNA 4PBSA 4QJ4A 1KDHA 4FC7A 2LDXA 5FLEX 1SCBA 1W2WB 2XUAA 4GIBA 3ZQ4A 4PAWA 3CUSA 1XHEA 2OFWA 1R6TA 2YBEA 3CLKA 4MUEA 1KY4A 1H4SA 3HLTA 3RADC 4MW1A 5JAZA 5J4VA 1JKFA 1U7PA 2B36A 3HDVA 1JWBB 4HNRA 2LYAA 1OWNA 1VCOA 4MR9B 1YB2A 2EC5A 5IJAA 3PD1A 1Z4JA 2XITA 3IIKA 1C1XA 4G1EB 4WKBA 1DDOA 2G77B 1NG9A 1C8VB 2H1RA 3AF4A 4N9WA 4C0WA 1ZQNA 3C3BA 3VR5H 5AESA 4YAKA 2W6CX 4PRYA 3A1VA 2R00C 3C45A 2CRXA 1X1SA 3TMKA 1CE8B 2EDAA 1LDGA 1WDWB 4EVSA 2CLOB 2HV8A 3RH0A 4B48A 3LDFA 4R6WA 2GO7A 4LZDA 4K8RB 1VG0B 3ZJ4A 1SUDA 1X66A 4UU8A 4JB0A 1MBZA 4QWBA 1WCXA 4IHAA 3AQIA 1PT9A 1ZXLA 1YS2X 5KT5A 3WNBA 5IILA 1J8QA 4RFSA 1DAEA 2IVZA 1NP7A 4AKTA 3GNLA 4B9TA 4RU1A 4M22A 1THMA 4DSZA 1SGWA 2CD7A 4CCYA 5IAAA 4DHWA 5E1BA 4U9HS 2D1FA 3C5VA 1AS2A 1ODIA 1PEAA 3UXEA 2OZVA 4DT1A 2C2YA 1C14A 1JG2A 1DQYA 2IGBA 1Y6ZA 4W8HA 3N8NA 4N3AA 3SEZA 3BH7A 4WLUA 4OJKA 3STXA 3KHHA 1HMPA 3IDAA 1J0DA 2MWMA 5L95A 1CJKC 1ZJ5A 1FS6A 3KB8A 1VFPA 3F2IA 3QZUA 4QTTB 1V8DA 1P73A 1Z6YA 3FFTA 3KEMA 1KORA 3JVEA 2OC9A 2OM6A 2RIRA 9ICSA 4MDHA 1EB9A 2QN8A 1X80A 4QZHA 1TKDA 1KARA 2Y4OA 3M33A 1U0TA 2O1WA 3ENZA 1JP7A 1XJCA 1V11A 4K4GA 3OURA 3VR2A 4EEZA 3TEFA 3H2JA 2G9VA 5BOLA 3ZW7A 4Y1FA 2NVUB 4MF8A 3VAAA 3A4YA 4KWEA 2ONZA 5JAMA 2EZTA 3BXFA 5FI3A 1R3UA 4MMZB 3EXEA 1M2HA 1XF9A 1B2RA 1CF9A 1JG4A 3R2JA 3H4VA 4IRCA 4ECQA 2NVOA 1VLHA 1RRCA 4KQHA 4YJFB 4OJOA 5AKIA 1AOXA 3K1TA 4CF3A 3JPWA 5A9TA 3CLSC 4C8MA 4P58A 3W06A 4ZOLB 1SQGA 1LPPA 1TRHA 5A02A 3WQQA 3R24A 2H4XA 3EEFA 3ND7A 1XO1A 3DS8A 4ARCA 1Q7GA 1HE2A 1CUJA 2FZCA 2EGGA 1K3UB 2Q0HA 2E55A 4O08A 3I58A 4ANFA 5E8RA 3BHMA 4BGIA 3HI4A 4R6XA 2D13A 4KBYA 4JK1A 2BH9A 4X24A 5BW5A 2R79A 2JIZD 3GD5A 1LDBA 1A9XB 2ZUUA 2ZQ5A 4HUJA 1DRWA 5JR3A 1W59A 4EUNA 1TK2A 3L0IB 4ZMRA 4J9RA 3RE1A 3OBBA 2XCRB 1NU6A 1G8YA 4AWXA 2A3NA 4BLVA 3BZUA 4KVZA 5CVTA 2W8LA 2ZSHA 2YJ6A 5EQTA 2HLDA 3LLUA 1BMDA 4TS1A 1FFHA 4JAVC 4FBLA 4R7GA 1FFYA 3ANLA 4EKNB 3OZRA 1IZYA 4QRHA 1IDOA 2BYTA 4XGKA 3CCCA 4EUSA 5AVKA 1GA1A 5HRAA 4R9SA 1FY2A 4YV2A 4F46A 3OEYA 4YASA 3LRXA 4DKJA 1SB8A 3FWPA 4AKHA 3VR3D 2DR3A 4M1KA 3MBOA 4YT2A 5IIMA 1Z68A 5E0OA 5HCUA 3K5HA 4HEA1 4BVFA 4UCWA 4LV8B 4NBNA 1S0NA 2BFOA 5DBFA 5EKUA 2L19A 4ECXA 4KRYA 2QZJA 2J0QA 1LLQA 3MJDA 3KO8A 2SCUA 1EA5A 4OHKA 4PHPA 3GEGA 1UMCA 5KNCD 2ZJFA 2I6FA 4KQMA 2DUYA 2XECA 4DMHA 4P53A 2I2CA 4D57A 1ODCA 3VR4D 1JQDA 2HV9A 5GONF 1P19A 3LCVB 4X91A 2JHDA 3I0MA 2FK8A 4NPAA 1ZGAA 2GLUA 2ZJ5A 3QKIA 2OHVA 1D8LA 2AEFA 3QFCA 5BOSA 5CVVA 1YWGO 1QHGA 1I5EA 4RTRA 3C16C 3FAKA 3F47A 1G0NA 1I4LD 4NMHA 3UHAA 3IFSA 2WTUA 1E2GA 2P77A 4P92A 1CQXA 1IWBB 2JC3A 2ZJ2A 1NT4A 1SIUA 2OBLA 2ZIEA 3OKAA 1P5RA 2B7LA 1BPBA 3BQMB 3KYDA 2SICE 2EYUA 2J3QA 3NW9A 3DBOB 1BWSA 2Q45A 5H80A 4JEUA 3Q8LA 5FPKA 1PFWA 2FE1A 1X3SA 2KJ8A 4KI0A 4ZZ2A 3R1IA 2ZM5A 5JDCC 5EUQB 3B0XA 5MFZA 5JRJA 4RD1A 1Z36A 1HL3A 5TPWB 2OR3A 2FSVC 4HXFB 2G1PA 3EPLA 2D8AA 5LQUA 4PRKA 4M8IA 2OVFA 1N2CB 3UC5A 4R66A 4TV8F 4P3KA 3QVSA 4M53A 3TLCA 3ZE7A 5DN6D 3AOEA 4FZJA 1TJNA 4GXIA 2PK3A 1BEUB 1M75A 3ED5A 5HIMA 2ZPAA 3GRPA 1EVIA 2Y2UA 1IN1A 2DKNA 4CMCA 3R0XA 2VJPA 3KZMA 1QG2A 4KLAA 1SG0A 2M6LA 3OJCA 4FQ7A 3V2HA 3AFMA 4FFDA 4XWGA 4B3XA 2R65A 3KK0A 1CJTC 2I6GA 1UQVA 5LYJB 3ESXA 1O0SA 5P8WA 4XIJA 3BQ7A 3GNQA 4LI0A 5A2GA 4EYIB 5E8JA 4E0BA 3FM9A 3KR2A 2OEHA 1ZM3A 4I4LA 2XWSA 2XKAA 421PA 2VPIA 3M8RA 2F3RA 2CNOA 1ATZA 4Q5IA 3BL6A 4JWMA 5JQGB 3Q15C 1YDMA 1GPWB 1WE2A 3A28A 4RPYA 2WBLC 3WYDA 1NBME 1DCMA 2R96A 1IIPA 1ML4A 5BWBA 1DUVG 3PGMA 3DTVB 1R4MB 4B3SB 4BP9A 4GQAA 3W6NA 1G8HA 1EVZA 4B4UA 3LLSA 3G1TA 1G20A 4AURA 4CKEB 3NRBA 3F0TA 2F44A 4QFCA 1OH6A 3ZHZA 2OHJA 2W43A 4P0PA 3GI1A 4DSFA 1U6JA 5BWCA 3VTFA 5DP1A 4G2TA 3I9KA 5ITVA 1CUSA 2NXJA 2X4DA 3V7KA 4BGUA 5AVQA 4S05A 4HDNA 4ND7A 4AUMA 4PX3A 4JCCA 4G26A 3WHKA 5LWHA 5LD2B 3QVXA 4ZI7F 1I4WA 4QODA 2D8CA 4I4TF 5B1SA 1JKJA 2XE7A 3DDUA 4JKYA 5F12A 4I2CA 2IY8A 4NZPA 4FB5A 1Y6QA 2G1JA 1JEEA 2CXQA 2WICA 5D51S 1JFRA 2KTQA 2HUPA 3PXBA 4OFZA 4ELUA 3F67A 1EDZA 1LFDB 2ZI4A 4GZMA 1WV1A 1O77A 4LPKA 4YUWA 1X87A 3CLHA 3FHTA 3K2BA 4H4CA 2FETA 4I8IA 2FUKA 1V35A 3D7MA 3EK2A 2GPWA 1OZAA 3U17A 4GI2A 1NK8A 1OXMA 3ISVA 3M9MB 2WWXA 1FYEA 4LXXA 1XYVA 4F5PA 4G4GA 3H0RB 3E22A 4H0CA 3OM9A 1L5GB 3OTGA 1DVRA 4FE7A 2AOXA 3M4YA 4D4LA 4Q1VA 3IAHA 5EZYB 3U7HB 1XTSA 1NZBA 1E3EA 4B6SA 1V7PC 3OZTA 1N6OA 3HP6A 4KQFA 1R8YA 4F45A 1KI6A 2VJAA 3U81A 3GGOA 4EELA 3CGWA 3V2IA 3IE0A 1P1IA 4MX8A 4YXJA 3WR5A 2HK8A 3FJ1A 4J76A 4Q44A 5A0VA 4I1RA 3EGWA 4YPVA 1QG6A 3QOYA 5ICFA 2Q2OA 1Y4DE 1Z7BA 4BMSA 1I2MA 1ODFA 4RK1A 1PGOA 2ZYSA 1R6AA 1UBRS 1M2GA 3DEFA 4EX6A 3H6KA 1P75A 3D4OA 1K6EA 4HWPA 1NOIA 3BJEA 2VJDA 2FB9A 5GTHU 1X1QA 1U3CA 1ONOA 5ANRB 5FX2A 3U3KA 2Q1SA 1ISRA 4XIYA 1N5JA 4Y2XA 4ED1A 2QJOA 2VTEA 1MAAA 5DT2A 4GUAA 3IEPA 3F9RA 3TIFA 4XVCA 2A19A 4ZJZA 2R62A 3H3JA 4EQ6A 3TAXA 1JKIA 3Q12A 4TQSA 2BEWB 5CIYA 1D9FA 1PFUA 2QMYA 4PPGA 1Z2PX 5G1PA 3EOAI 1M0TA 2C8VA 2F76X 5C8VA 3JQGA 3K1AA 3LH5A 2CVPA 3FVTA 1NVWQ 1H3EA 2OBFA 4YAIA 2PIDA 2NUBA 3Q7SA 5CFQA 4DPLA 3I2KA 3TN7A 5BSVA 2EW8A 3V9PA 3HZOA 2VK8A 4C7BA 1MRSA 5LD2C 2ANBA 9ICEA 4JNKA 4B85A 1E99A 2G82A 1I9CA 2R9VA 5FLKA 1JYFA 4ECTA 4BO8A 8ICVA 1EU1A 5IUNC 2X8JB 2ZXHA 2QRKA 5JSQA 3T94A 1Z07A 2RHJA 4ZCTA 4QGAA 4J9MA 4W82A 3INRA 2PUFA 3GCGA 2O5RA 2R8HA 4G65A 1SG9A 5B2EA 5BWLA 4QDJA 2FWRA 3RVBA 1BHJA 5K8UA 1ZN2A 4URXR 3CUVA 4HSGA 2J9GA 2WWRA 1PVDA 3ZIAD 3QLJA 5MN5A 1MR3F 3K0FA 3JVDA 3ICPA 4C7MA 1BE1A 4R68A 5FWYB 2BQUA 2JDIA 8ATCA 2A1AA 4EJSB 4ECAA 4FSXA 2YZKA 3QVMA 1TVKB 2JAUA 1R2QA 3H2GA 4Q43A 4OFWA 1T8WA 4RCVA 4MRPA 2C5SA 1SIWA 2NTJA 1OSNA 2K7FA 1PT5A 3BPSA 1USIA 3KBOA 1ZQSA 3UHFA 2XZLA 3M3DA 2BR4A 4OK3A 3I05A 3HGQA 4NOJA 4IPTA 2OENG 3EXFA 3RRXA 3O03A 3I9FA 1VL0A 3TW8B 3RTCA 5IUJC 3VC8A 8ICCA 3VR6D 3WMEA 1T0PA 3AZQA 2JFPA 2Y6VA 2GJ8A 1S0OA 1T9GR 2JG3A 2EZUA 3AY6A 2RJOA 5C1BA 2VBGA 3MR5A 2DL0A 1D7OA 3NHBA 2QJWA 3D8UA 1EHIA 1LCIA 1YH3A 4I1YA 5JYBA 1JIVA 1A9SA 3LF1A 3F5AA 4KW7A 1LJUA 2Q5LA 1CZRA 3NEYA 1F5NA 4IQFA 3VX4A 4B4OA 4YFVA 3KKZA 3O9MA 1T1JA 3NATA 4NQRA 4C4OA 4QZIA 4UHCA 2UUCB 1V38A 4G89A 1F2VA 3HTXA 5ALVA 1QM5A 3PR4A 2P3QA 3FCXA 1Z2CA 3JAKA 2ZR9A 3SBDA 1Z63A 4O3FA 2GPBA 3L6CA 4BFTA 1W88B 3WTBA 3Q9SA 3IB6A 1IUOA 3WL7A 2F77X 5J4KA 5GTDA 4Z6CA 1SBYA 1ECBA 2XKJE 4Q1FA 3WOVA 2AKYA 5KSYA 1SUEA 5L7TA 2XNDA 3N53A 2GHTA 3V1LA 3K53A 1T4BA 1E6KA 4ESVA 2LR0A 3WO1A 3GEIA 4I5EA 2ZRLA 3KG2A 4RGBA 4Z8YA 1DQNA 5D6OA 5BNTA 2RSLA 2GN1A 1P7VA 2KZZA 4CGZA 1ZSYA 2EOAA 3KSRA 3BFPA 5FNZA 2ANCA 1ZM2A 4AS1A 1OXJA 5J0PA 5B6JA 1RI2A 5IJXA 3QWHA 3ENQA 4BNWA 4M8NE 4I5FA 1FQWA 3AR5A 4CU5A 1S4QA 3O74A 4ZEWA 5K20A 3MXOA 2YMLA 1IJKA 4J29A 4QOHA 3UXNA 3LQ4A 2VHWA 4QFDA 1RXCA 1VE9A 5DBEX 4AZ0A 3NJ8A 1PYGA 5IJ9A 4G07A 2AEMA 4EJFA 3WRXA 5TARA 1WA5A 4EZ6A 1NUHA 2W7OA 1X19A 1E58A 4HPXB 5J43A 4Z4GA 5TVGA 1M6VA 3LT4A 1R0YA 1TZ2A 1MIOB 1WHSB 1XD2B 3HUFA 4I19A 3DC2A 4G84A 2CEAA 1V3QE 1C5KA 2IX3A 1H1LA 4EJSC 4NAVA 3VNBA 1NUPA 4RNNA 4HQNA 3S8EA 2R6R1 3DB1A 5DBHX 1E2IA 3CR8A 1VRWA 3GLHB 3R41A 1UM9B 1DOQA 2E48A 3MMSA 1XMOB 5F7OA 3ULKA 2IHNA 5JJIA 3VYRB 5EQJB 4NRDA 3WLRA 1QO0A 2AS0A 2ZP1A 5DTJA 1JZSA 3JR3A 5DLDA 4FOLA 3WSWA 3FRJA 5CYOA 3FWZA 3CY6A 1IJEA 2RGAA 1M8JA 1D4AA 4ZVMA 5KVVA 1UXHA 2HBZA 1WW8A 5FLXA 5HHIA 4ZT2A 4D8XA 4JP1A 4BB0A 1P3Y1 1OIWA 2TRSB 3EAQA 1ILWA 1K8ZB 3T15A 5BUZA 5A3JA 4DARA 3PI6A 3DYIA 1TO2E 4FFOA 4NFSA 1M0EA 3GAMA 1NUAA 1TM4E 1G2PA 3L8MA 2R60A 3VZQA 2YINC 4FP9A 4RAOA 2G8NA 3LX8A 3GEHA 3D4IA 1T6NA 3WDSA 3HGMA 2P8SA 1EEHA 2JAWA 4IFTA 1CUHA 4X45A 5BUCA 4PTYA 2OB2A 5GJWC 3RSQA 3DHWC 1I24A 1DXHA 5AIBA 4QJFB 1UDXA 3IBSA 2BBWA 3JYPA 5TJ9A 1NXOA 3PP8A 2WJHA 4GOND 4C2AA 1WQ4A 4UXHA 1K4KA 3JPYA 2HA3A 4IVQA 1T0HB 4LV5B 1YOVB 4JLPA 1H2ZA 3PHLA 1E7SA 1X9IA 3G8AA 2HK6A 1BGWA 5DVZA 1U0LA 3Q3JB 1N5XA 3E9RA 4F9TA 2JZOA 3DYBA 1JBEA 4DV2B 3MFQA 3CURA 4AJLA 3BK7A 5CH3A 2YQEA 1V5WA 2FLKA 2ID4A 1RWQA 4XWAA 4IDQA 1BMFD 1Z1BA 1W93A 4GXRA 2UVDA 1QIJA 1NWHA 2IS1A 1XQVA 2A59A 2YJZA 3DT6A 4IIBA 5BN4B 3RV4A 1ZVQA 1ZSVA 5EI5A 1YZGA 4DIUA 4JR2A 1RWVA 3B48A 1UPAA 2ZB4A 2JLVA 3IMGA 1R0CA 1XMJA 3B8HA 5LQJA 2N3ZA 4JWTA 2WT8A 4YJKA 2R5WA 4HH3C 2BMJA 3G5TA 3MFYA 3LUCA 5TEVA 1Z88A 5FFMA 4ALNA 4F4FA 3C7DB 3CX8A 3L0DA 3PWZA 3SCZA 4BQNA 4C0KA 3N6RA 1RWBA 4YCXA 4K9NA 4A73A 1KDVA 3CSUA 4ZHQF 4GX0A 2IZ0A 2NP7A 4RQTA 4FZNA 1N0IA 3USCS 2XE4A 4XA8A 4IJ5A 1T36A 1BXRB 4RZUA 3VSCA 5DISB 3PW2A 2B69A 5K05A 3BM5A 3PL5A 2ONYA 2SKDA 2VK1A 1RAHA 4D25A 3OLVA 2JBWA 4IEIA 3N7SC 3BZKA 4CKWB 4N1AA 4ENVA 1ORIA 4C5BA 1XCGB 3N1UA 4WVLA 5EE5B 2JFGA 3WYEA 5LQNA 2RARA 4L8FA 2OP0A 2ZWIA 3ONEA 1KJIA 5KNBH 1G6Q1 2GTIA 2N1MA 4JXXA 4RQNA 3A58B 5I8ZA 3HPQA 2OBNA 4C5CA 6YASA 5C3UA 5ADWA 4R1UA 4MYTA 3PTAA 2C28A 3TXYA 6ADHA 2DR0A 4ED2A 1T8PA 3PIDA 3E61A 4ZA2A 1S7CA 1B0ZA 1R12A 4IRKA 2QE7D 3FPHA 1JN0A 1U7HA 3H0KA 1HV8A 3PDUA 4FN4A 4EHIA 1XX6A 4KWHA 2I5PO 3H5IA 4DSTA 1P9OA 1YS4A 3S7ZA 5CR0A 1X6VA 5MDHA 4ZVSA 3SX0A 1KU0A 4P4NA 5K0BA 3SJZA 1D1PA 4BVHA 2DG2A 3DDOA 3OQOA 2F9MA 4GVLA 4TWIA 3AKDA 1UKBA 3K1ZA 3EFHA 3WLLA 1KGSA 3ND5A 3CH5A 2I71A 2G4CA 4ERNA 4RUAA 4L08A 3H1BA 4M88A 1PUZA 5KNLA 4E88A 3QLEA 3EZ6A 2DYKA 1AKQA 4EW1A 1EFPA 4WXYB 3K0SA 5DYGA 4DDKA 1J2MA 4YUXA 3WIOA 1SUSA 1I4EB 3WDLA 1XFDA 1VMEA 2ZB3A 2NM0A 1MHTA 4MIYA 3D3NA 3UT5B 1LVGA 3F97A 4EPYA 2AFHE 3KUXA 1EGHA 5DNDA 3BMQA 4QGBA 4LVOA 3W1VA 2HF9A 1G41A 4RVSA 2G63A 1YHZA 1COKA 4J9SA 2W9XA 1HDRA 4W9MC 5IK2A 4ZT3A 4WDRA 2ZRMA 4YPFA 2J6SA 1TUEA 4YT4A 3SNHA 5HIAA 5GONB 3GN2A 2KS6A 3F8TA 3S2ZA 2QMOA 1SQ5A 4Q0MA 3QZ7A 1S0UA 2AQ0A 2UUPA 4B6GA 1EWQA 4G5YA 2X1MA 1C81A 4WI1A 1KMIY 3CKYA 4L7VA 5ICGA 1NVXQ 3AQFA 3MLAA 1WP4A 5E4TA 1G63A 4CV3A 2NTEA 3UK7A 4TMWA 2EZ4A 1PYOA 4E5MA 1SNYA 4K1XA 4HWOA 2R6FA 1MN8A 3ASVA 2JMGA 2DOKA 3H2IA 3IEUA 2OGWA 1NNSA 3OCUA 5EEGA 1BFUA 5TPZD 4DF4A 2ZSBA 1E6UA 1Y9AA 2JRLA 3LA8A 1N6RA 5I8PA 1UIRA 1E2LA 1A8HA 5EXTA 3VOSA 5K6AC 3ROZA 4BX9C 1ZSNA 1Z4OA 4Z4HA 1FJXA 3Q8MA 1CJVC 3RAXA 3OKPA 2FQXA 3HJRA 3MDAA 1QU2A 3HS3A 2W37A 3LPCA 4XOIA 3JPPA 1U49A 1RE1A 2XYPA 4PR3A 4A7PA 2TSYB 4P32A 3GQCA 4C2UA 1PWXA 2GT1A 1ISMA 3ZGNA 1YZYA 5B1IA 1WZIA 3SHFA 1M1XB 2C96A 4P4LA 2QMEA 1RM0A 3VA7A 4FOTA 3HRKA 2XGPA 4RZSA 1UK6A 4AY5A 2A4KA 2B1JA 2FOIA 1ZMBA 1KDOA 3ZXSA 1D2CA 2AFRA 1SKRA 1GOTA 1O7JA 5I9BA 4JFRA 2Q1WA 3SX2A 2QYHA 1ADYA 1ZOSA 1Y6RA 3RK1A 4I14A 1G8MA 5FUVA 5KVAA 4HYKA 2M9MA 5JRTA 1WUHS 1R3DA 3L1IA 16PKA 3M6ZA 1FXWA 1XN4A 2YYAA 4PWZA 3I6QA 1KEUA 4TTJA 1WULS 3K94A 2P7HA 1VKHA 4FZLA 1I3NA 4ZVTA 3F73A 1N6LA 4J6EA 2ZBEA 3W78A 1E9VA 3PNPA 3F71A 3S3TA 1LBSA 1HUQA 2PLNA 4MIEA 4EX7A 2N46A 3DCYA 3AHDA 4JT8A 5HRUA 5IINA 4BRZA 3MUFA 2H3EA 5ICMA 2PGXA 1HNWB 4NOMA 1UAAA 3RB3A 4IIDA 4UD2A 5AR1A 4D97A 1A7UA 1YTLA 4FYYA 2J4DA 3IIJA 1Q1QA 1L5YA 3N7UA 1XZGA 2XF8A 3RFVA 1XDZA 2DHDA 1AXGA 2E2WA 1SKQA 4O0IA 1SQSA 3A4MA 3VHQA 1UZMA 1TIKA 4GMXA 4ZI7B 3CMCO 4UB3A 5KDOA 1EFRD 4XB6B 2D6FA 3CRRA 4I4TB 2O3SA 2WHXA 1B8NA 1VPLA 3WO0A 1J00A 5FLYA 3L82B 1FXUA 4ND8A 4ACOA 3DAHA 1C9YA 1N9KA 4DAEA 4HQRA 2RDMA 3PNOA 4ARBA 2VWPA 3D1JA 1W52X 5CW1A 3MWEB 5HFAA 2XZPA 4EIWA 4CG0A 3T5CA 3PFHA 4R3UC 4LRXA 2G0TA 4B6JA 4EPXA 2AFIB 2IYYA 2WWFA 1QYRA 5EJ6A 2EF1A 1U8FO 2FSIA 1YK1A 4RA6A 3B9QA 5EPUA 4DA0A 4RK7A 4U8GA 4X7MA 5FCDA 2JAPA 2O59A 5IBQA 3OE4A 5DW0A 1CPYA 3GEBA 3OKCA 3QKTA 3DOHA 5HQ3A 1SEPA 4M9ZA 2OK7A 3HB9A 5ALDA 2FZKA 4HFJA 5EHIA 5GZ3A 1ZQHA 3GJYA 3QWBA 4DUPA 2WP8J 1N2GA 4MS4A 3PRKE 4K40A 4KLHA 1NBWB 3GZNA 4I2GA 1ZZGA 4TSKA 3MHTA 1WTAA 3GCZA 1OZHA 1GRRA 3KKKA 2VHEA 2I65A 1KDPA 2DLCX 3H16A 3RIHA 2V3CC 3B12A 2XCPA 4Z6DA 1Z00B 2HRRA 3OBIA 3TX6A 3U4CA 4R1MA 4YCAA 3KTOA 4PGFA 1NT2A 4QBFA 1FYVA 4XZ3A 5CGZA 3TL2A 5DI3A 1KOJA 4P86A 4MS1B 4TT8A 5ULLA 3DL4A 3NNDA 2Q3LA 3CH6A 4JVMA 3RRGA 4LISA 2X13A 2D0DA 4R1OA 3HCOA 1TF2A 4D9IA 3P94A 3WKBA 3O93A 1TW3A 3X1YA 2ZIUA 2O3TA 1N2OA 4JOQA 3UAOA 1ADGA 1W46A 2GA9A 1EFAA 2QG4A 4JBYA 1B43A 2KHZA 3HL0A 4FQ8A 1XSLA 2ILTA 1ADFA 2VCEA 1T26A 4FHEA 2JI6A 2PO7A 3NR2A 5HSGA 4PZZA 1LRLA 4Y6OA 1JIKA 4RPCA 4NK5A 2XNJA 2JEZA 3JD4A 5JS7A 4EY5A 2X7JA 4H77A 5H81A 4I1SA 4I46A 4E08A 1RJWA 1SZCA 3QE2A 3IPAA 3EWIA 1H69A 5G1OA 2W6IA 2HSWA 1PUXA 1D1SA 3W5SA 3B0YA 2CB0A 5DULA 5JLJA 1QTNA 3ONNA 5ES4B 3FPBA 3OCCA 1PG0A 1P7DA 5CA0A 2NVWA 1T2NA 1TUBB 3MJCA 3I53A 3FLEA 2AXEA 3PW4A 2LPEA 3SWWA 4LXUA 5TMDA 3X0DA 4MGIR 3BDPA 1D9XA 1V9CA 4DUGD 2X9QA 1FFCA 4QUIA 1ZIDA 2GWHA 2MT9A 3EEIA 2AC4A 4BXOB 1OFUA 5A5FA 1MQSA 5L40A 2YNMD 1XA4A 4DM7A 2JR5A 1XZJA 2BP7B 2IHVA 1I7SB 5A0TA 4LWOA 3THYA 3CB2A 3CPEA 1KI2A 4P33A 4HLUA 5FIUA 5JTTA 3SK0A 3BD9A 3M9XA 1AMUA 1OASA 3RGWS 1A5SB 2R751 2B0JA 3HBFA 4UM7A 4R64A 4MQEB 4UD6A 4JITA 3IURA 4GS5A 4XDGA 3VPGA 4L0MA 1L1EA 3M3HA 3HBNA 4AQ7A 1DX6A 4KFRA 4NDAA 3MGCA 4BFUA 1KTQA 3HLKA 1BHQ1 2W93A 4TUYA 2G06A 5AJHA 2EBUA 2A9FA 3UMFA 1TC1A 3L04A 5J9FA 5JASA 4XGIA 2BELA 4G1MB 4FFBA 1XNJA 2V9ZA 3VC7A 1RHQA 2NO9A 1JJVA 3GGGA 2OWDA 5IHPA 4JC8A 3BJZA 3H7AA 2FX3A 2OGUA 4AF6A 3IUJA 4P4MA 4RL6A 1Z4PX 1ZUWA 3L0BA 3K8YA 2UKDA 3Q6NA 2BTQA 3RT7A 2C2XA 3NPAA 1GA6A 1QCKA 1Y81A 2C4KA 4J1TC 2RGYA 1U6KA 3C2KA 2E1RA 2JFZA 1R9NA 4HNAA 5HS4A 1VKJA 1PZHA 3M1YA 3OZAA 7ICVA 5FDFA 4J9OA 4C4PA 1DO8A 2ZWVA 4IMJB 1COWD 3UW1A 1BEEA 5KQGA 3N59A 1IY1A 1U5AA 5U1PA 4KRGA 3HUUA 1MVNA 3WK8A 3NVMB 5CFLA 2VTBB 3WXBA 1P4SA 1A1VA 2C8LA 2UVWA 2WFLB 1V95A 2VKQA 4TTRA 5CT8A 1QR2A 3OZSA 3N28A 1CUZA 4BZQA 3Q98A 1UZNA 4XTRA 1YL6A 3PA6A 1W4CA 1VKZA 3UAZA 1XCLA 4BY9E 3DBHB 4JVLA 2VHTA 3L05A 4AY6A 3I8OA 1TEZA 1H3NA 3WJ7A 2PZEA 3OG9A 2P5TB 3RUPA 3WGTA 1E61A 4FHDA 2E49A 1C8LA 4B87A 4DE5A 4KLZA 3N0WA 1ZY2A 1QDEA 3F3KA 5KIAA 2O14A 4ITRC 1X1RA 4JYMA 1TZBA 2CXPA 2PHZA 1K7YA 2XTZA 3WLEA 2IMWP 2OGZA 2K8CB 4OJYA 2BV3A 2J9RA 4ER7A 5FXMA 4ZO4A 1JA0A 3FMFA 1XCMA 4KJXA 1SULA 4IR7A 3TRJA 3O4IA 1V71A 4IP0A 1NWCA 4V2UA 1A1SA 3RJHA 2X3YA 1WIWA 4RKRA 1EFVB 1E4YA 1K27A 4YV1A 4BV9A 2ZJ3A 4X1YB 1IN8A 4BBZA 5DB6A 3NTLA 2MIIA 3LPAA 2W6QA 3N39C 3JATA 2RHWA 1VIAA 5EJ5A 4RY9A 3LBHA 2X14A 3LWZA 3IG5A 2P6OA 2Z5LA 1R5BA 4NBRA 2XZOA 1ZL0A 3A37A 3FIJA 1LLFA 2VZEA 4QOGA 4WBXC 5KU7A 1KMQA 2VP4A 1NV9A 3TFQA 3PS9A 4J1SA 1DJLA 1RQ2A 1GO2A 1BE6A 9ICLA 4Y2RA 3AR6A 1ZRHA 4DMKA 3DV0A 3FOWA 4RHXA 5CB8A 2OORA 3G8DA 3DTTA 4BMOB 3U7QB 5TC4A 3TW6A 5DLYA 4L73A 1JAIA 3P9NA 2G76A 5GY7A 2BFDB 3ASZA 4MVCA 3TLAA 2NSLA 2OCBA 3N2EA 1HRKA 3DO6A 1QH0A 4B6RA 4DC1A 2ENUA 1ZA1A 3GUCA 3M4XA 3FKSD 4RNOA 2GO1A 4DB2A 1KVSA 3MGAA 4BP1A 1A9QA 1XNGA 5CWRA 1N2IA 4XD7A 1AB6A 4KO1S 4KR0A 4Y2GA 2QQFA 2Y0PA 4FYIA 3ZCRA 4JMPA 1T3HA 2V03A 4JV0A 2ZYRA 2PLAA 1IYZA 2P2SA 1NIPA 2ZRCA 1F8UA 2DHRA 1GNPA 1NURA 4HEA6 3UMGA 3JQRA 3CZRA 4J75A 1P44A 5EIBD 4OBEA 5BSRA 5TDHA 3QM1A 3H2SA 3WDKA 4ZAWA 1AO0A 1MRZA 2OCEA 5JWHA 4JH0A 2PWBA 3ZNPA 5F1KA 3SFVA 4LHXA 3BTSA 4LA4A 4ZHQB 1YA6A 2ET6A 5IN4A 4CBVA 2RK3A 1O94A 2R6CA 5IVKA 3Q9UA 3L5KA 5KTSA 2G17A 4NG4A 3TD6A 4KH1A 2QZPA 2FGJA 2R8OA 1U3WA 1EFDN 4F6RA 1DT3A 4CGYA 2QQ5A 2JA2A 1DO0A 4ICIA 4RPJA 2G5PA 2J3DA 1Q21A 2QT1A 1OGJA 3O1HB 2D2VA 8ICPA 4HT3B 2DY0A 4CF5A 4ZZIA 4OQPA 3KR0A 4GBJA 2Z30A 4EGAA 2BW0A 5AO9A 3TE7A 4ISCA 2CCGA 3TDNA 1JG1A 5DMHA 2ATXA 2P66A 4I28A 3EVBA 3SR4A 3Q3GE 2WLSA 3O47A 5FI1B 2VQ3A 3L6OO 2Y6UA 4RNCA 3KHLA 1SUFA 4Y30A 4IIEA 4Z3DA 4RJIA 1BDHA 1DOZA 4OQLA 4JV5B 1I2ZA 5JYEA 4K4IA 1LBIA 5KG3A 5JCJA 3ODPA 1FLDA 2JBHA 3PQFA 3UGJA 4GX5A 3FC4A 4K88A 1XVLA 3RASA 3FI0A 3H1EA 1E9DA 3O4JA 4YCDA 2EFYA 3JVUA 1Y8CA 3M9NB 1P1BA 3ZWQA 3JQDA 3QF4B 1ZQKA 3L7OA 2WILA 2IPXA 4PQRA 2DH6A 1Y3CE 3MT0A 3FZGA 4JLVA 2GKOA 4C0LA 3PC2A 1ZQIA 4MOWA 4PC1A 3M2PA 1NVTA 3RYIB 4BKUA 1YQXA 3DCNA 4F5DA 3QUTA 2I54A 3HPOA 4NJMA 2HUNA 1OGIA 4N0QA 4CM9D 1ID1A 3K6SA 4WXEA 1P7ZA 4J4BA 4X7RA 4BTVA 4O29A 2FFBA 1OVGA 1VZ2A 2ON6A 3IQEA 1CZLA 2HPHA 3B3AA 3BWYA 4OBXA 2GYYA 1NZPA 4MP8A 5B7PA 4WZAA 1ZGJA 3PSIA 1YRLA 3OMWA 1PQ4A 1Y33E 3OE7A 4BVBA 4BNXA 1NQXA 3FNQA 2JNWA 3NBKA 5E4FA 4D81A 5L3QA 5IFLA 1CTQA 4QUAA 1JE1A 4PZNA 3DOJA 1PTKA 3QUAA 2PQ6A 3H13A 4OKNA 4HDAA 4G56A 1WS6A 4GAEA 1Z5OA 2CFRA 4E3WA 3S81A 1CUWA 3UYKA 2C31A 2OFXA 4ZO7A 1CIVA 3HKCB 3A6LA 2EDCA 4GPZA 3PUXA 2CHVA 1B6RA 3HFJA 1FMFA 3CRXA 1U2GC 2MINA 3SQXA 1RM4A 3PLRA 4RHEA 3L7NA 4F9GA 3E23A 4REMA 2PNJA 3ZWMA 3IHLA 1PUIA 1TV9A 5ECGC 2IYFA 1NBIA 1AS0A 3F1LA 4GEGA 3BB4A 1XQWA 3Q7IA 4O1IA 5KTNA 4LDPA 2IOHA 5J2FA 4DGQA 4EFNA 1D1QA 1XV5A 2QVXX 3BTUA 3WHPA 1DKMA 4HDRA 1XNRB 3KU1A 4RT2A 3CMMA 2QZ4A 2Q4DA 4NU8X 4US8A 3FOEC 5KU1A 2J4FA 2QUHA 5DYTA 2ZULA 3S0JA 4MLDA 4QZDA 2C4WA 1CR0A 1JJAA 1GUFA 1RPJA 5FQNA 4ZCLA 1RHRA 3TGLA 1V1RB 3PYMA 3D0QA 4ZYXA 1ZQ1A 2KI5A 3PXDA 1RNLA 1JXEA 3MOGA 2DE0X 2OV1A 4KFTA 1W5BA 1X7XA 3OPVA 2BHLA 4KVAA 2E5WA 3QENA 3SHVA 1BVHA 1FRFS 4ZYUA 1FW6A 4RQ0A 4DDUA 1BXKA 1HE8B 4UQLA 3WBBA 2EF0A 2CYAA 3W2FA 4GFJA 2BGUA 3QUCA 2FZVA 2IZ6A 3AVTA 2A0KA 4GC9A 3MIZA 4IYRA 4BOYA 5MHTA 2ZG6A 1BKDR 2H57A 2VHZA 1XAHA 2NYRA 2FZWA 3MPUA 5LOVF 1KIFA 3JQBA 5FOQA 4Q4AB 1RHMA 3SG0A 3JPTA 2QYTA 2X8BA 1Y34E 3A36A 5HGXA 3VPBA 1Q50A 4N01A 8ICFA 2PKXA 4G5HA 5IM4F 4C08A 1XXHE 2VATA 1A2KC 5F1OA 3WJ1A 4L4YA 2QL9A 5TVKA 2QB0B 1P2SA 3RWOA 3V1KA 5TQ2A 4BL5A 1KRXA 2GASA 4AZTA 1IMOA 1G18A 2MSLA 5A5DA 1GGHA 4U9UA 2KJ9A 5D5HA 5JROA 8MHTA 4QOIA 1SPBS 5JZMA 5K0NA 2HCTA 5IZCC 4KYUA 4WT7A 1FRVA 3SDZA 5HQJA 3B51X 2JLCA 5KSWB 1P3DA 2YW2A 4ZYZA 3DWIA 4DS3A 4L2IA 4CFSA 1ID8A 2F3PA 2VJNA 2C88A 5JSHA 2R3SA 4OGKA 3SYZA 2O8DB 3O7WA 1JFTA 2VYQA 3PJDA 1PF7E 3RKSA 2O3UA 1GSAA 3V8VA 2YRXA 1HDEA 4MVJG 1KYWA 3L8CA 1Z0FA 3WLIA 4RNDB 4RTSA 2YFYA 1DIRA 4Y3UA 2JCYA 3SI8A 1NI5A 4NENB 1WVGA 4CF7A 9ICIA 1UEXC 4X7BA 2JGAA 1ENZA 1FJHA 4U2BA 1CQIA 5B4UA 2Q2VA 4C14A 3GJ7A 1L8AA 4IOMA 5F3DA 4G1UC 4OA5A 3A4NA 1ZD9A 1F8FA 3D1LA 3SD7A 1W4RA 3LBAA 3D2LA 2Y66A 3RC3A 2FJ6A 3W6OA 3NVKI 5D6NA 3U3RA 3GFSA 2V1UA 3IBGA 4YDQA 4Z0NA 1FEZA 2HX1A 4NK4A 3A2LA 2IH2A 3M7IA 4KXUA 4ODIA 1AS3A 4RQ7A 3PEWA 3H8VA 3N2KB 4FGUA 2QRHA 5AK5A 2XE8A 3HY4A 4EG8A 3CBQA 1NQAO 2DPLA 5ESDA 1LNSA 4DRXA 1F4VA 3AB8A 1HZJA 3OY2A 1E20A 2VPZA 4DQXA 2OZEA 2Z9CA 2F67A 1B93A 5JH7F 3UXYA 4MULA 2IPNA 3N0XA 1KZGB 3WS7A 2J48A 1DGJA 1ENPA 2XV1A 1M2OA 3DMTC 1DZIA 1CK4A 1VJGA 3IA7A 1NVGA 5AVTA 1FMLA 3TAUA 1DRVA 1Z16A 3OC0A 3IP1A 2JFQA 1KP2A 4L15A 3RUAA 4Q3KA 5GOTA 1T2FA 2CV2A 2ILVA 1UBGA 4NS1A 3T1OA 1XN1A 2HJSA 5C1OA 1YNOA 4HUQB 1E5LA 3VO2A 1K7CA 1XCOA 3OEHA 5T6MA 2ETXA 5PGMA 1M1ZA 3GCWA 4HQ0A 2IVFA 2ZWAA 3JARA 3SJUA 4YDSA 4FYKA 1I7NA 4CQNA 3DEHA 2XSZD 5C5IA 3QI7A 2Z5VA 1ML3A 3KKAA 2EJUA 1XTIA 1JEJA 3A6ZA 2WHPB 4H35A 1XTKA 4O2AF 5DHQA 4DA6A 1P2VA 4BMVA 4AYXA 2F55A 2QTFA 4X8OA 3H5OA 1LI4A 3KPVA 4G3IA 2FJUA 4Y1RB 1MPTA 2TYSB 1XKQA 3AUXA 2Z2YA 3WQHA 2BCRA 2HN9A 3ZTYA 4AKIA 4TWZA 4R05A 3ND6A 1NA5A 1GR0A 4UVIA 2A67A 1R9MA 3RU3A 1NPTO 1YBFA 4V24A 1MX3A 4ZDJA 4DUYB 4BQRA 3P4YA 1YGYA 4WKOA 5KYXB 1QVZA 1YL7A 1IDN1 4QO7A 2Z2ZA 2BKLA 2ZR8A 2R6AA 5KQRA 4R54A 2PCLA 3UAVA 3LXMA 1IJFA 4WFJA 1C3OA 4GKJB 5C7YA 3BT7A 4NHOA 3CO5A 2I2WA 2CKDA 4YRZA 5J5VA 1IXRC 2EKBA 1STOA 5G41A 4QELA 2IEYA 3AHGA 3ZE1B 4LJ5A 3U2QA 2PZGA 1O6CA 2HTFA 1UJ4A 2PSJA 2H06A 5TQ0B 3DZGA 2VH1A 4YO8A 3DXXA 5JBQA 5HKKA 4D4GA 1ZOOA 2JZCA 4QVKA 1NMEA 1RKVA 2QGFA 3VKVA 3TD9A 2V0GA 3WV5A 3BC1A 4L6CA 1GVHA 4JYCA 1JHPA 3L1KA 1SOUA 2QVGA 1D8YA 2JLYA 4MQMA 1CP3A 4K81B 5AVOA 4UOZA 4R63A 4EJ0A 4U00A 2J0UB 5LDGA 3D59A 3HBMA 1P62B 2HPAA 1EKXA 1E2MA 3LVWA 5ICSA 1YVRA 1ZLXA 5A3VA 2BZFA 2JJMA 2R8XA 4RF5A 4TLCA 4EHBA 1PTJC 4I5DA 3MTJA 4YI5A 3TVDA 2XB9A 3U7JA 4C07A 2WE8A 2A9RA 3GD7A 2VHCA 2ZU0C 3CWQA 2PKYX 2OAQ1 1MJFA 4BE7B 3HT3A 5CDFE 4Q7LA 3C85A 3E7DA 5BN1A 3IT1A 1EP3B 2WG2A 2XAAA 5JATA 1Y3BE 4H18A 1QBKC 1RXSA 1T9BA 3P97A 3T1YB 5JPCA 3CT4A 1V5FA 4EG1A 1O57A 2FPGB 3PUWA 4I2BA 1IG0A 4W5TA 1LS1A 4GSYA 3TACB 3PB3A 1V8PA 2FYTA 2WNIA 4M8KA 5AJXA 1V8ZA 2GJ9A 4R8LA 1XSNA 4RH1A 1KE2A 2JIMA 4AFNA 2KVCA 2GAAA 3A10A 3TUJC 2L5YA 2CXSA 1OHHD 2UYYA 3O4FA 2WINI 4PYJA 4UVHA 1KXJA 2CFCA 1VP9A 3WP1B 4WNAA 1RYFA 4CMJA 5LNK6 1YA4A 1UPFA 4RF2A 4MR8B 5G53C 2B1RA 3PV0A 2B37A 1J70A 1XKTA 2Y1CA 2GH1A 1Y8RB 2WNHA 3R09A 3KDSE 2WV7A 1YFLA 2IIPA 3B1FA 3SI7A 1DINA 5DDIP 5F2EA 4LRTB 3FKJA 2H7VA 4DV6B 4AJNA 1GZ4A 3JS5A 4DTIA 4UB5A 2O19A 2IW3A 4D5EA 3WKEA 1Q2XA 1E1MA 1D0SA 3O95A 2PFOA 1HC7A 2OZLB 5H8WA 1GFWA 2DWQA 1KJQA 1HUOA 1RIIA 1PJSA 3UJCA 1W1UA 2HRBA 3FFXA 5BT9A 3OJWA 4HH0A 4BU1A 4BWYA 4MPRA 2GSWA 2H00A 3DKRA 1WUIS 1SVLA 3IIMA 1DEHA 5FWDA 1WHTB 5JECA 3BVPA 2J3JA 1JJFA 3EZXA 3I39X 3SZ3A 4U1RA 4BWFB 4U6PA 3Q10A 4R0MA 3FE2A 5ECDA 4A0FA 3AINA 3VAYA 2JLXA 1YZ3A 1FW8A 2FVXA 3RSZA 1Q1ZA 1CERA 2FN4A 7REQB 2QN7A 3FAHA 1W0KA 3RT1A 4GVXA 4ZYVA 4K9RA 4Q03A 1F0NA 3W1WA 3PEEA 2AZDA 4N4AA 2ZFUA 4AP9A 2EAPA 3H0EA 2BUBA 2DBVO 4AVYA 3GEMA 3QVKA 2XXAB 2QTNA 3PHCA 4H3VA 4N0MA 2AWNA 3GT4A 1UBHS 4NFHA 4RZ3A 1SA0B 4QD3A 3UH1A 4ZAZA 2CUTA 2C61A 4PM4A 4B2LA 2YOGA 3JVIA 3VPFA 1SXJE 4HWTA 5D86A 2PD6A 4OGGA 1WZUA 4MROA 3L9XA 3BWMA 3IULA 4UUQA 4E21A 3R8CA 2YV2A 1LZLA 4R3WA 1H9AA 3ENKA 2CNNA 4PQGA 3FYDA 5KZMB 3R5HA 4OQYA 4ZZ3A 3HYSA 3ZE6A 2W2VA 4RY0A 1KDZA 3TPCA 1JXLA 3EGXB 3AZPA 3P4XA 1HT1E 2BEJA 5DGIA 5DGCA 1TQ6A 1OBOA 3VRHA 8ICKA 3I62A 2FPUA 4MVJD 3PVCA 1RYSA 2ZAOA 4Y2JA 1PS0A 4RKFA 2VYFA 2VPXA 2QM8A 3FPAA 3NHFA 3KSBC 4LKRA 4Q15A 1W5FA 3I9NA 2PEYA 2WM8A 2BGIA 1DARA 1OPRA 1HETA 3DE6X 1AF7A 4EY3A 4MUYA 1NBMA 1SXGA 2IQ5A 1X9GA 1ZH8A 5AVVA 3DVQX 1A6SA 2G1KA 4DR5B 4OUDA 2C7GA 1M2JA 4PSDA 3BX1A 1H0SA 2X5XA 3BDIA 2BCSA 2JAQA 1XEFA 1V26A 3K0BA 1JT2A 3GWZA 5CX1A 4L0CA 5DKFA 3VU9B 5LNK1 5CHYA 3O2SB 4F5WA 2BKUA 4UZSA 5T64A 5CVJA 2VYCA 4JJ7A 4UU0A 1XOIA 5F3RA 2EEZA 3P9SA 1LQUA 1LK0A 4YMMA 3CF4A 2AC7A 4ISBA 2Y1XA 3U4QA 1ST3A 1JRLA 2H63A 2GJSA 4Z8XA 1F6WA 1CUUA 1NUTA 1U8TA 2RHFA 2E8MA 2KHVA 4I4IA 4U2FA 4OJ5A 5LJIA 2ZPUA 4RXTA 4PLWA 3UV6A 4CMHA 5L1LA 1F17A 2ONJA 2QE6A 2WD7A 3PLAE 1BMTA 1T91A 5DG7A 3WK9A 1O0BA 1OW3B 2R2AA 4F4JA 1R8JA 4CV0A 3EX7C 3OT4A 2CLHB 4FB4A 2HXYA 2XB8A 3N7TA 2JGFA 1G8GA 2PJZA 3QXSA 1MENA 3ZGYA 2ORVA 1QDUA 2H17A 3ELUA 3T4EA 3RODA 3CPSA 1BMQA 1ECPA 1CW2B 2BTEA 1OUMA 2CJFA 1OILA 1U7ZA 1NVUQ 4FONA 3S27A 1H4TA 1UK8A 5EJGA 2X76A 4ZJPA 2ZATA 4BWGA 2IS6A 3R20A 4PX9A 3P2JA 3LHSA 1U2ZA 3IQDB 4DCTA 2M98A 2JV3A 1G4UR 3NLLA 1H0RA 5ALKA 5U4XA 2GYWA 1VJRA 3GA7A 3UVEA 1LSOA 3OZEA 4C78A 3ID6C 4E6PA 3MWKA 1W85B 2YNMC 3AEQB 2I99A 5BR4A 5GJBA 1GEEA 3MYRA 1J33A 1JV2B 4CIAA 1SCNE 1JQBA 1X77A 3OM8A 521PA 3PC8C 2QAJA 3N2NA 3ESAA 4AUEA 2FGKA 5BXYA 4DQPA 4EI2A 4NZZA 4L4XA 5LZ7A 2Z3WA 4DM3A 3CNBA 2QMZA 4FBGA 5DYWA 4B3BA 3GU3A 1QF7A 3OTIA 4MI1A 4KE7A 5M3BA 3VDXA 2C3UA 5SY4A 2DH5A 5A2QA 2OQVA 3FCUB 5IMBA 1OIVA 4LVUA 5DGXA 2GJ4A 2XRFA 3CW8X 3A11A 4M0CA 3IOCA 2DUMA 5TB5A 1GTMA 3SVLA 4URVR 2POCA 2BSAA 4XLLA 2XGJA 2WW8A 4USAA 1OUQA 3DAPA 3CB4A 3B9PA 2DC1A 3FSEA 3KJIA 3T7DA 3VC2A 1QRUA 1FFGA 2P79A 1RKBA 2H1VA 2FXIA 5G4KA 4X63A 1T3NA 1NE2A 3A9CA 3OFNA 1R0LA 2ZSIA 5GJVC 4N8EA 3STHA 4OEHA 2Y4NA 3EVAA 1WUDA 4OJLA 4RCZA 1GQQA 3M6LA 1SC1A 2YX1A 1RJ9A 5J2JA 1TIBA 4GXKA 4LE1A 4LNAA 3WKCA 5KTKA 4B0PA 5LR6A 3SHTA 4EAAA 2LI6A 2C77A 2RDIA 4LUCA 2FSPA 1JLMA 4PGAA 3I45A 3BD7A 3TWOA 4WFIA 2G04A 1YZ7A 3K0AA 4BUCA 1ZH4A 4MVJF 5THXA 2BZ1A 2VHQA 4AY3A 4GXNA 5D46A 1US8B 3NAGA 5AJYA 1JHYA 1U5CA 1RYZA 2DVMA 3IHQB 1H8ED 1YCGA 4MUIA 1N9GA 1U48A 2JLBA 5ADUS 1VLQA 5EUMA 4CM4A 5K99A 1G8SA 2PX6A 3FYUA 3P9PA