3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF00702 domain protein
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
5ALXA 5AK4A 2O2XA 3AR5A 1T9ZA 2WF9A 4BX3A 4AS3A 1Z5GA 5A3RA 4Y2TA 3SKXA 3P96A 4NWIA 2RB5A 2HSZA 2G80A 4CF5A 5AW9A 1K1EA 5ALDA 5ALLA 3U7GA 2IOHA 2B30A 3ZX5A 2CFSA 2R8YA 3KC2A 2C9MA 5AI5A 5ALFA 4CNQA 4ZEWA 1CQZA 2RAVA 3SKYA 3W5CA 5AW2A 3QUTA 1O03A 5ALSA 2AMYA 2FUCA 4NABA 4BX0A 5ALMA 3QX7A 2B1RA 5ALUA 1J97A 2GFHA 4YIKA 1L6RA 1X42A 5ALZA 4JDPA 2OA0A 4BYGA 1L7MA 3BWVA 3GYGA 3ZWKA 4KX3A 2BY4A 1Z4LA 1EK1A 3QYPA 1SU4A 4NAVA 3A3YA 5AVYA 4EENA 1ZD4A 4L57A 1Z4OA 2YJ3A 2HO4A 5AW4A 3ET4A 2I55A 2FPXA 4DCCA 4UM7A 3MC1A 4C4SA 3NASA 1XVIA 2YBDA 3WK7A 2HF7A 3ZWDA 3QNMA 2X4DA 3AR2A 4HGRA 3WGUA 4Y2JA 5ALIA 4ZEXA 3ZUPA 1L7NA 3L1VA 2W11A 3FVVA 5AW5A 3SD7A 3KOOA 4UATA 1N8NA 4E88A 5AM5A 3ONNA 3I6BA 4KNWA 3B9BA 1Z4NA 2JAOA 2C8KA 4J2TA 4Y2QA 3N1UA 4GXTA 5AVTA 3U7EB 3S6JA 4MWOA 3QUBA 3QU2A 2OYCA 4IFTA 2WM8A 2O9JA 3EF0A 4C4TA 4UW9A 5ALOA 3U7FB 2IOFK 3OCZA 4Y2UA 2PQ0A 3PDWA 2AH5A 4FE3A 1U2TA 1ZS9A 2NO5A 2W4MA 1WZCA 3PGLA 3R09A 4UU1A 3EF1A 5AVXA 1LVHA 4MUMA 5AW3A 2Q4RA 3WK9A 3U13A 3OTQA 4CE6A 2R8ZA 2YMQA 4Y2VA 1RC8A 2JARA 3E8MA 2W43A 3OCVA 2YMMA 5A3SA 5AKYA 3UMCA 4DW8A 1QH9A 2B0CA 2YMLA 1TJ5A 1WPGA 3ED5A 3QXGA 2G1AA 1S8OA 1ZRNA 3QU4A 1KYTA 2AGVA 2FPUA 5AW6A 4KN8A 1U2SA 3L8GA 4UAUA 4AS2A 1ZD3A 4O8CA 2YJ5A 3K1ZA 3CNHA 1RKVA 2R8XA 1RQNA 1O08A 2YJ6A 3EWIA 2WF5A 1QQ5A 1L7PA 3E81A 2ZOSA 5AVSA 1MH9A 1L8OA 2CFTA 2QYHA 3BA6A 3QGMA 5AI8A 4HAIA 4BKMA 2YY6A 3AR3A 3B9RA 2GMWA 3AR7A 4G63A 2C4NA 2ZBEA 2WHEA 1VJ5A 1RLMA 1Z4MA 4HYTA 5IT0A 4ZEVA 4UAVA 2NO4A 2I7DA 1ZD2P 4BNDB 3TLMA 4EZEA 5A3QA 5AHXA 2WFAA 5AM4A 3ZTWA 2D2VA 1Z4KA 2WF8A 2B8EA 5AW7A 3L0YA 4YCMA 4AP9A 3L8FA 2B1QA 3OCUA 4QQFA 3OCXA 1RKUA 4Y2RA 2GHTA 4BNDA 2I34A 3AR6A 3NRJA 3I76A 3UM9A 1U7OA 2R8EA 2YMPA 2ZBFA 5FP0A 1Z4JA 5IS2A 1RMYA 2RARA 5AM1A 1TA0A 4KYTA 4CF3A 2RBKA 5AKZA 1Z4PX 4BBJA 2MU2A 3WGVA 3ZTYA 5ALPA 3E84A 3ZW7A 1U7PA 3ET5A 3VAYA 5AM2A 1VJRA 3L5KA 3D6JA 4HGNA 1YS9A 4Y2PA 3UMGA 2NYVA 4UMEA 4BEVA 3AR9A 5E0OA 2PKEA 1YV9A 2I54A 4YCLA 2EAUA 2FEAA 4YIHA 3B8EA 3OPXA 1VFPA 4H1WA 3F9RA 3L8EA 3RFUA 4HGPA 1N9KA 1T5TA 1SWVA 5AVUA 4FFDA 2QLTA 1TJ3A 3QUQA 4DWOA 5AI0A 3SHQA 2ZBDA 1YDFA 3WKCA 4EELA 1QQ6A 4F71A 1NRWA 3MMZA 1LTQA 3FPSA 3AR8A 4UM5A 2G09A 3WKEA 2FPRA 3WK8A 3N07A 1PW5A 1ZD5A 3ZU6A 5AK6A 1RRCA 2Q4TA 2AUTA 4CF4A 2FUEA 5AW0A 1L8LA 2DQSA 4UMDA 5AKJA 1ZJJA 1RLTA 2HDOA 4PNHA 2HI0A 1RQLA 3PCTA 2WF6A 3QLEA 4EX6A 1YMQA 2BDUA 3MN1A 1T5SA 5AI4A 2ODAA 5AW8A 3A1CA 2EATA 3WK5A 1RPZA 5ALHA 2C88A 1QYIA 3ZX4A 3QUCA 1NF2A 5AVZA 5JJBA 1WR8A 3NALA 2JAUA 2B82A 3E58A 4Y2YA 4JB3A 3U19A 3ZI4A 4OFZA 3L0BA 2GO7A 2ZXEA 2CN1A 4UASA 4HGOA 1XP5A 4XE5A 1IWOA 2VKQA 4YGYA 2FPWA 1SWWA 1NNLA 1FEZA 2P69A 3ESRA 5ALQA 2G07A 4KX5A 2YFYA 4UU0A 5AK5A 4DFDA 1RKQA 5ALKA 2P9JA 3QU7A 1CR6A 3L0CA 3OCWA 3U7HB 5IT4A 5AKXA 1RDFA 5AM0A 5AKLA 4Y2SA 2IYEA 4UMFA 4XOUA 3KZXA 2C8LA 4NFLA 3EPRA 3FZQA 4BEWA 3N28A 1L7OA 1ZRMA 5AIBA 3OCYA 1TJ4A 2P27A 4L6CA 4UMVA 4KNVA 3DDHA 4QJBA 3SLRA 3DAOA 5AVQA 1YNSA 1JUDA 3FGOA 2ZBGA 2B8JA 5ALEA 1WVIA 3NANA 3L7YA 2YJ4A 4YH1A 3PGVA 4RETA 2MU1A 3M9LA 4NV0A 1RMTA 1EK2A 4J03A 1AQ6A 3AR4A 4FYPA 3KBBA 4RESA 4G9BA 3W5AA 4BX2A 3R4CA 3IRUA 1Q92A 3W5BA 5AI9A 3U26A 4F72A 1Z4QA 2GHQA 3FM9A 5T41A 5AKGA 5ALTA 1RLOA 3QU5A 5ALWA 3IB6A 2BDEA 4I9FA 3N5KA 2MSNA 4OD0A 4L6AA 2ZG6A 3NIWA 1J8DA 5AICA 3SF0A 4XPZA 2IOFA 2HCFA 3DNPA 5AVVA 2JGAA 3A1DA 4Y2XA 3ZVMA 4C4RA 4OCZA 5AVWA 3W5DA 5ALRA 4Y3UA 2PR7A 1XPJA 3HLTA 2YN4A 1ZOLA 5AESA 1U02A 3I1YA 3WKDA 1RMQA 3L8HA 2G06A 2HX1A 3NAMA 5AM3A 3SMVA 3WK4A 3I28A 2FI1A 3L1UA 1F5SA 4B6JA 2FPSA 2OM6A 4YCNA 1Z88A 3RF6A 2JAWA 4XQ0A 2EARA 3QU9A 2CFRA 3J7TA 3WK6A 4UARA 3UMBA 2HHLA 5AKHA 1Z5UA 1Y8AA 5AIAA 5ALNA 2IA5A 3ESQA 1Q91A 3N8GA 3M1YA 5ALJA 5AKKA 3DV9A 3A1EA 4EEKA 1TE2A 5AK3A 2I33A 2I6XA 5ALYA 2WF7A 5AKEA 4HGQA 4I9GA 3HYCA 4GIBA 3NUQA 2HEGA 3MPOA 2FDRA 2Q5EA 3IJ5A 3FPBA 2HF2A 2OBBA 1YJ5A 5AKIA 3WKAA 3KD3A 3KDPA 3WKBA 3ZVNA 2G0AA 5ALGA 1S2OA 1QQ7A 5AI6A 4OHFA 5AVRA 4IG4A 5ALVA 2HOQA 3ZVLA 2G08A 3CZ4A 5AW1A 3R9KA 2P11A 4EX7A 1Z4IA
chains in the Genus database with same CATH superfamily
1ZD8A 1F17A 5I6DA 2GDZA 2HSWA 1ODIA 1GEGA 4W5HA 2E9SA 2G77B 5EXXA 4DWWA 2PANA 4UVEA 1N7HA 3RYCB 4JJ7A 2WTEA 2DVMA 1IDOA 5DW3A 3LSYA 4LK3A 1VRVA 3I6YA 3RUFA 4I1YA 2RD2A 3EBOA 3DB2A 2WP8J 1G19A 5KQPA 2IUYA 1WCIB 3MM4A 3AKCA 4G5QA 2HHHB 3ZWDA 5AOAA 1YDMA 4HLNA 1EIWA 1W5FA 4U8HA 1R0KA 1UIMA 1JEYB 4E6PA 4LV5B 4RK0A 4BWGA 1ZKMA 3S99A 3DW3X 3R9IA 3FVTA 1XZ8A 4B45A 1VB5A 2O14A 5HCIA 2F3TA 4OXRA 1LKZA 4QU8A 1D1TA 5CR9A 3KRTA 4OBWA 2AA3A 5KO2A 1CJCA 2AFIA 3PJEA 5DN6A 5HK9A 2ODPA 3PO4A 1MABA 1SPBS 2RDMA 2FQWA 4G8CA 3HO8A 4DIOA 4IHJB 5CP8A 3UT5B 4QUDA 3MPUA 1FVFA 3MXOA 3PT9A 4R7GA 5HJEA 3AEXA 2P3LA 3GFTA 3VSEA 3PNBA 2Y0SF 5AI8A 9ICOA 3OZEA 1PNRA 5CX4A 1UFOA 2X42A 2WILA 1KOFA 2WUGA 4J0HA 3HV0A 1XU9A 1P29A 1YAJA 4YJ3B 2Z6AA 3LTEA 2BFOA 3DZHA 3KEMA 1QAQA 4I3HA 1SXHA 4AT1A 3VNRA 3NKVA 3ZS8A 3SDBA 3STVA 5GTHU 5DGCA 1MAVA 3AEQB 2J9FB 5I48A 1N7JA 4UUMA 3I5UA 3CUTA 4DSNA 3TARA 1YS4A 3HY4A 3FYTA 4YHBA 1OBOA 2PS9A 4DQVA 3EUAA 5K0EA 2PFKA 2G09A 1N63A 7REQA 4ZK6A 4LISA 5D3MA 2NGRA 5BPCA 2AUTA 1Z0IA 3EDMA 4TRJA 1L5ZA 2J5KA 3EBPA 3K5WA 1JR4A 2NZJA 2BMDA 3MFHA 4R2KA 2DUMA 1NJFA 1TXGA 1WR8A 1AXEA 1REQB 1DAHA 3FAHA 4DCMA 3RIYA 2OZPA 3PQ7A 3KL4A 1NI5A 4OF4A 1C2TA 2E5LB 2OZEA 5C8YF 2ZBRA 1UXOA 5JDCA 2VUIB 5AJTA 4FE7A 2ZBUA 1BFKA 2XMGA 2F1IA 1U8UA 1UZLA 3HKCB 4C5AA 2WUEA 2IH5A 3CUSA 4YEDA 1X1EA 2Q07A 3O3NB 4BRSA 1W96A 1N0IA 1N2GA 5BQOA 4G0NA 4I55B 1NJSA 3C6QA 4I50B 1GPWB 3W3AD 1X87A 5DYWA 1H05A 3FMFA 4L9SA 2AXTU 4BZZA 3ROQA 4GI1A 4IZIA 2HSJA 5BSGA 3EPJA 1DELA 4MQ4A 4LXGA 4RULA 4MA0A 3N9IA 1WKBA 4IRDA 4RQMA 4RIIA 4RK7A 5F5NA 9ICWA 1Y3BE 2W70A 3CF4A 4F6LA 1KVUA 4RZHA 2FPGB 1E5TA 3BAFA 4MAAA 2JIDA 3SXUB 1T1RA 1H1TA 3U39A 1Z8HA 2XCOA 4RPKA 4RQ6A 4EK9A 3LUPA 5KHAA 4XVHA 4XFKA 3U4GA 3PUKA 3SVTA 2C2YA 5YASA 1GNSA 3ESQA 2RDJA 1UIRA 5D3KA 5JRTA 1DQYA 3PPXA 2JLVA 4GVPA 4JX9A 2Q8QA 3UTDA 3HLKA 5J58A 2ZWIA 4IYJA 3BSSA 1QAMA 4Q39A 3B1KA 4G5YA 3WKBA 3IRVA 5L3QA 2SECE 3NS1A 3VR3D 2J07A 1BGWA 1JEOA 4J0IA 2QTRA 3A6DA 1B22A 4B76A 1Q46A 5U9CA 3UAOA 4TLMB 1QR6A 1C3VA 3TVYA 4TVSA 2PK3A 5DDMA 4IW3B 1EIZA 4D3FA 1KRPA 5E8RA 4IJKA 4IPTA 1WUJS 5J8YC 2BKLA 1KFEB 3BWVA 3IBCA 1XQYA 4KO4S 1H3EA 5GOTA 5MF6A 3RUCA 1PEKE 1YIOA 3PW2A 1W30A 2E82A 4C0LA 2QMYA 2WB1C 3EVBA 3JYPA 4DQQA 1WQ3A 5B2FA 5TEWA 4KFSA 3IMKA 3QKTA 4DEZA 2WG2A 5A5EA 3RVQA 2Y77A 4MS4B 4EKYA 2EL7A 3JQ6A 4OSPA 4ZHQA 4EZIA 4DLSA 2PXIA 3EF0A 4BJQA 2JEJA 2A1JA 4BYMA 3UAZA 4MW9A 3MS4A 3MDCA 5EJ9A 2V6JA 5LQUA 3GJ4A 4F8JA 1O0SA 4TL6A 1XJ0A 2INGX 2ZRIA 1A9QA 3WJ1A 2OFPA 4DVJA 1WPGA 5E6RA 1TMKA 3NCHA 4E13A 3ESDA 3IO3A 2DF8A 2FPOA 1IBKB 2G9VA 4QA9A 5DMXA 5BOMA 2ZBPA 3F2VA 5GGXA 4MIYA 1FW6A 5DN9A 5KU7A 1HYBA 1YIDA 3TI0A 4XYGA 1JDNA 3MG9A 4H3KB 3NUGA 3B7WA 5TIIA 2A14A 3OTIA 4UCXA 2ZRMA 1IJBA 4NONA 2ZS9A 1C3EA 3UT0A 3UJPA 4QQFA 4KGDA 3MOSA 2YWBA 3CNBA 4R41A 3ND6A 1THMA 3PLAE 4ZWNA 4QWCA 1U49A 1TA0A 4CYMA 4YK7A 4E11A 2TMGA 5DBCA 2Q5FA 1KEEB 2ZPAA 4Q1FA 3HWX1 1NW8A 2MA1A 1S0UA 3UH0A 1TKBA 2B9EA 3OPXA 3WL5A 1T2FA 1AS3A 1KY2A 3ZCXA 2E48A 4R81A 4H7PA 3RT7A 3M3HA 4L85A 1QQ6A 1Y1PA 2ZT8A 3B3AA 4B5KA 2PYIA 5CA1A 2XOKD 1E9RA 4C6TB 2FUEA 4NENB 4R9NA 4GZMA 2L42A 3VUFA 3MINA 1U3UA 3QKSA 5CLGA 1ULHA 2AN9A 1GKUB 1QDEA 4TUYF 4KWCA 1SWWA 5HWSA 2WJGA 1W36D 1Q0UA 1QXSA 3HL0A 1QWOA 5JZOA 4N0DA 5IT4A 3VV3A 4ZCTA 2IYEA 4A0SA 3O8QB 1SCUB 1W88A 4XDYA 1EXMA 4TTVA 1DAFA 1U0SY 2I67A 4LQ4A 3E9ZA 2O4UX 5DLYA 2FUG6 1L5RA 5H1YA 1AROP 3IUMA 1RRMA 4EMSA 5IASA 2DKNA 2QL9A 5LUAA 3X43A 4ALLA 4ZVOA 6REQB 2OAEA 3EPHA 5KCZA 4ENWA 1TYBE 2H17A 2WR8A 3DLPX 5L7YA 5HEKA 3C7DB 4QDTA 1SKWA 4ZVSA 3V97A 1E3SA 4L76A 4N8EA 5LQAA 5IDQA 5AVWA 4I2VA 1RACA 1E7MA 3WMEA 1Z0UA 2O1XA 2MSWA 2D3DA 1BCRB 1IXRC 2X1MA 4NK4A 2GDJA 3K0BA 3GR6A 4LS3A 3RH6A 4QOHA 2QPTA 2HJ9A 1PZGA 3T99A 3OC6A 2QMEA 1OA1A 1FP4A 2ZYAA 4OHXA 1LXCA 3LHDA 2I80A 2JD2A 4OYYA 3VSCA 1TPZA 2YFHA 1BZYA 1E5QA 4XVCA 1RQ2A 3T9CA 3EW7A 4R66A 1DAIA 1O7JA 5C4MA 4KKVA 5JRJA 3CNQS 4IG4A 3BS5A 4KG7A 5KX5B 3LOPA 2ZLBA 3AHEA 5IDYA 1R9MA 1VGVA 4EB0A 4JASB 1SGWA 2XWQA 1U3FA 2A0KA 4G5OA 4LJSA 2BQUA 3GAMA 4QASA 2WOJA 1XQ9A 1LDYA 4BB5A 2AW3A 4CQMB 3D2BA 4LY6A 4HAUA 1PX0A 4GAEA 5ALZA 2RHRA 3MEQA 3WRXC 1NBAA 3IP3A 1FP1D 5JNSA 2C9CA 2G5CA 4JD5A 2JIRA 2G6TA 1YSCA 3AEKB 3FNHA 3BSFA 2F90A 3ZCUA 3OGUA 3G5TA 1SIJA 5IHPA 2Y1EA 4JROA 1Z7BA 2R66A 1DLIA 5DX1A 1N1GA 2XMCA 3JQ7B 4YP6A 5AM5A 1QDLB 2X5OA 1T9GR 7ICPA 3K6SA 3AUTA 3AETA 4PYOA 4BV2A 1M66A 4G67A 3G8DA 3DOFA 2Y1LA 3QEMA 1W34A 3QLUC 4YAKA 2QRLA 2FCRA 3OEED 4ALNA 2TMKA 4G2TA 3KL2A 2QRQA 2OKGA 3AY7A 2PY6A 2NZ8A 2WAAA 2QUZA 1DAPA 3R7DA 3DONA 3A9SA 4Q1AA 2P5SA 1VE1A 3OEHD 4NLBA 1E1RD 3FRIA 4AXXA 3DBRB 2VI5A 4H27A 1WO8A 3P19A 3G5AA 3ANLA 4PQYA 3WL4A 4D9IA 1W85A 3K31A 2LP4Y 1UUFA 4DCTA 5L9XA 5EKDA 3AR7A 1OV4A 3MJRA 2R7MA 3S2FA 5C0YA 1RYBA 2ETVA 4RUAA 4F38A 1SL1A 4D0SA 2PXAA 1YRLA 1EK5A 4HK4A 1A95A 4P6VF 1T5BA 5FP0A 5F9NA 2B83A 2FMKA 1E6EA 3HN2A 1T9GS 3VVMA 5LJIA 2GEKA 4Q3BA 1M1XB 3IO5A 2NO0A 2XZDA 1Q3UA 1UJ4A 4PO8A 3D6JA 3OLVA 3PR2B 3TNYA 5J2AA 2A94A 1NV8A 4LWPA 2QVCA 1VFPA 4R7ZA 1FVXA 3EQ8A 3KVYA 1VL6A 5T8KA 1NT2A 2IKSA 3IJPA 2HAEA 1CWUA 5KFCA 3FUTA 4DM7A 4NU5A 1ISSA 2VYFA 3W5SA 4HN4B 1YKFA 2BCSA 2WSLA 4BVLA 2FEOA 1JXAA 2FZKA 1TZ2A 3FWPA 2PJUA 4D8TA 3PJDA 1TU4A 1J22A 4F4CA 4JQCA 3HN7A 4JC5A 3PNOA 3UGQA 4E7PA 2UXBB 1GA1A 3LP8A 4LDPA 1WAMA 4JQOA 3LWBA 3D3JA 1XX6A 4FTWA 3U7HB 1BEZA 2VP9A 5C7LO 2I78A 4DWVA 4RTQA 1V45E 4JLVA 5J2TF 2UUOA 4CFZA 1CUJA 5ICGA 2IP1A 3TEFA 1PR5A 4CLDA 3WQSB 1L9KA 4L9RA 3SHOA 2B2CA 5FH9A 2PKQO 1OFHA 1DNPA 3PX7A 2P9ZA 2VJQA 3PGVA 3QY0A 1F8YA 3T3FA 1QQAA 3ES9A 4TQUS 2ZBQA 4PW0A 3TI7A 3MZ0A 2FMSA 3M1IA 4Q4AA 4E0DA 4DCSA 3CRRA 1MJFA 5CVUA 2K60A 3G68A 5KFVA 1IN7A 2RK3A 3HGQA 2H0QA 4X7RA 4O3OA 4B3RB 3JALB 3JQGB 2QDXA 1AIPA 4F2GA 2MRLA 4WN9A 1B4DA 5FL7A 2HFKA 2GAFA 2DU8A 1O2DA 2V0NA 2EARA 2EKBA 3IUNA 2DFTA 3NEYA 3FZEA 1XCGB 1XMPA 4YROA 3VR5A 3K73O 5A6VA 2W0SA 1ORRA 3Q87B 5K0NA 3CT4A 3W4IA 1DBSA 4R2WA 1A5TA 3NUQA 2HWYA 1OQAA 2IBMA 3CPJB 5FTWA 4EI9A 3EEIA 2W90A 5IZ4A 4M9XA 4XDGA 4IJWA 4F84A 3MWKA 1IHOA 1M2HA 1I13A 4EEXA 4G3XA 4WEQA 1YQ9A 5DULA 1J9ZA 2GEUA 1KAEA 4E5DA 1ST3A 5AWFC 3U7GA 3HO1A 1AMNA 2VJMB 4FLFA 3K0SA 4JUCA 4CKYA 5KFIA 3KKNA 2HXYA 4J1SA 3IAS6 2A0YA 1H5UA 3GLGA 3ZDQA 3DEZA 2ZRAA 1FMLA 4NARA 3JQFC 3HJNA 2OO3A 3GROA 3H5VA 3G2JA 3DNFA 2QTVB 4ID3A 2NUPA 5JQGB 4EKNB 2GCEA 2H4FA 4LJXA 2AQ0A 4IDFA 1AS0A 3LT5A 4ZJUA 5GJVC 5GADl 3Q9UA 5KG1A 4QUIA 1ZJ4A 4HS9A 3ZUGA 5JZBA 2BBOA 1K6EA 5F77A 3SZLA 3ONVA 2V96A 2W2KB 2X8WA 2YXDA 5UKDA 1WZ2A 2FZ5A 5KWIA 3BORA 3AHJA 3EC7A 2Q5QA 3D5EA 4E2FA 4RQTA 4EYEA 5TB5A 1C7EA 3OFVA 1B3BA 1LI5A 4UOEA 5EP4A 5CA1F 1FFWA 3NHPA 1E1QA 3ANSA 3L3FX 1XXHE 3VU0A 4KN8A 4QKQA 3VAAA 2A86A 5IJXA 2J48A 4DBLE 4NJ8A 3R5TA 3AQ4A 3NNSA 3BKWA 4ZI7B 1KPGA 1JILA 5D86A 3TKLA 1GR1A 2C5HA 3J80A 4C8LA 3TJMA 5LZ9A 1X9MA 3PU6A 1ECGA 4JDUA 4F3OA 2KPOA 2DQKA 3LX5A 4XQ8A 4WK0B 1JT9A 5B58C 1D6SA 1ZGZA 4L51A 1UK9A 2FMFA 1D8TA 5AFSA 2VUSA 4P4SA 5FUQA 2XOEA 4US2R 4HWRA 1L5UA 5JAQA 3C7KA 4QOSA 1JMYA 3LLVA 3SJBA 1V48A 4Q93A 4Z54A 1MVLA 4ELTA 4IQVA 1CS4C 2W9XA 2X8JA 4Q44A 3G8CA 3MSXA 3MF4A 1XQVA 3B3GA 1PS8A 4ESHA 2QTHA 1NRXA 4WLEA 3OM1A 4UBLA 3PSIA 4QYMA 1CY0A 4FGWA 3MMZA 2PL1A 5BNZA 4HZUB 3OICA 4JEHA 1DRVA 1EM6A 5F4BA 5KFXA 2IV7A 2Z8YA 1NBME 4BO3A 4QSMA 1RYYA 4E6EA 4F2DA 2RG7A 4IDNA 2KFZA 4EX6A 3LUKA 5LUBA 1QFXA 3FUVA 5FOVA 2OL4A 2TS1A 5D5HA 1QOZA 1MC4A 2NO6A 3GFGA 5J63A 2GRJA 1DOAA 2FGJA 1CY6A 1MZPA 3U1BA 5CB0A 1OUMA 5GIOE 3IXQA 3ZEAA 4G8BA 5H2FU 3EQ2A 4G6ZA 3GP3A 5BR1A 1TTPB 2P6NA 3W5JA 3O1JC 5BMVB 2V7QD 1DCKA 1BIFA 3N28A 1XBTA 3F4BA 2F3UA 2R8KA 4MKZA 1L4MA 5CD9A 4YFVA 4OA5A 1K1QA 2AFHB 2QZ9A 1E9CA 3U44B 2P5YA 2FWJA 2R8PA 2YJ4A 3DLAA 1EBFA 5FDFA 9ICHA 1EZZA 1PVQA 4LGYA 4BJ6A 1Z16A 2AJLI 5H9VA 1VL5A 5ALWA 1B0ZA 4MHVA 2BZSA 5JCOC 3UOGA 1NG9A 1E7YA 3RS9A 1G8YA 1FUKA 4RQ8A 3R6TA 1PNTA 4KOEC 2IRWA 1NJZA 2HWUA 1WZEA 2BRUA 1O95D 5IULC 3WA7A 5CUQA 3EGDA 3KETA 4KTQA 1MT0A 4IIYA 1I94B 3ZGNA 2VJNA 1F44A 3MCVA 4XYMA 1OE0A 2VN8A 4MUYA 2IIVA 3FPGA 2F59A 4AKTA 1HY3A 4MUFA 1TVCA 1PJRA 1T0BA 1Y81A 4BB0A 7GPBA 3OCCA 3L4PA 1INLA 3EULA 4BJ1A 1AHHA 1QLHA 2BGKA 1RI1A 3X2SA 1Y8QA 1TO2E 4Q1VA 4AUKA 3KYJB 2RGDA 4WNIA 1IM8A 2IDKA 5I7WA 4JY7A 3G0BA 2ES4A 3HCDA 3FNEA 2RHTA 3IEMA 3DGEC 2X2OA 2C97A 1Y5MA 3HVRA 4X64B 2I3ZA 3EX7C 2HPHA 3WP0A 3LPMA 3K53A 4FD2A 5BV1A 2DFLA 3GZ4A 3G1WA 3V8QA 3NORA 1ZL0A 1NWHA 3ZC3A 1M1YA 2Y99A 3R5JA 4BNKA 2X0JA 1V4BA 2H57A 3U4QB 4IHQA 3S8MA 3IOBA 4IDHA 1P4HA 1SG6A 5K8JB 3DNMA 1Z6YA 3K1AB 2GN1A 3TLCA 4BVBA 3MC1A 4UTZA 4CIAA 3COPA 5FUBA 3CLSC 2EDAA 4XD7A 4B4VA 4EYOA 4KQIA 3ABSB 3IAEA 4OI1A 1XHFA 4J2TA 3CNOA 3MD9A 5KL8B 5FBWB 4DARA 3VYTB 3E3LA 4XKJA 2AVDA 3ICEA 2GBCA 3INRA 4DDUA 2XMZA 4KR2A 2YKGA 4Z0HO 5TXGA 1T4BA 5LU9A 2XWSA 2PM8A 4GKVA 5FOSA 4EAQA 5BNWA 3F2CA 4EY8A 1ZMRA 2LRHA 4F4UA 1KYQA 2N9UA 5AYVA 2I7VA 3VX3A 1ZL2A 1X80B 3I2HA 2P65A 1MU0A 4OH1A 4LJLA 3G2OA 3ZWOA 4OP3A 1OWPA 5DNAA 4YUWA 5K3FA 3LI2A 2PI4A 1XOIA 2WT9A 2H1IA 1FTSA 1MDBA 1U9LA 1F06A 1NBHA 3BTUA 4RNOA 2PGOA 4DLPA 4CWAA 5E8JA 3SXJA 4C8OA 1DO2A 4FDTA 1IQUA 2NUBA 2CHFA 5EZ5A 4B2LA 4F8YA 3OZVA 3AI2A 2VNKA 3NPAA 1CJBA 2GBPA 1WLSA 3WAGA 2OAQ1 2Z4SA 1L4EA 5JPDA 2HUNA 1T8WA 3RBEA 3MHTA 2HIGA 3WAKA 4QLAA 4OXNA 4O1MA 2NACA 5A1TA 1U0OC 3HP7A 3AX6A 3RUHA 2ISPA 4QU9A 3PUXA 2HLPA 1SHUX 3EXIA 4UM9B 4HGNA 4OUDA 1YUBA 2WJAA 2OBXA 4BMXA 4UAGA 1IL0A 1FX1A 3TADC 1SC4A 2D74A 4ECEA 2PSJA 1PNVA 2W6JD 3HKBB 1QK3A 1TJ3A 4IGKA 2YY7A 2PEZA 2NOAA 1IUPA 4CMIA 2E37A 1N57A 4NHOA 2B5OA 4NS4A 1FTWA 4AU1A 4FR0A 3ZCPA 4H18A 5IC6A 4YYEA 3RYHB 5JS2A 1EGVB 8ICAA 2W58A 1QSLA 1U1DA 2DWPA 4DF3A 3ZHCA 2IUTA 1NF2A 3E9DA 1C7QA 2KMLA 5BSRA 3L7NA 4DEXA 2OWDA 1IBRA 3QVLA 3NHWA 4LMPA 2P3QA 4KPYA 5DZSA 5IP5A 4ZICA 3D7MA 1JG3A 2ANCA 4UXJA 1WETA 4HLCA 1LFAA 1HL3A 1SBTA 2XZTA 4XUDA 2W2VA 2IA6A 3Q8PB 2OXFA 4D92A 4F5QA 2CL5A 1PFWA 5JVDF 2WUFA 4R1NA 3MGGA 2EJBA 4ZO4A 1HSZA 1SHLA 1R5NA 1P45A 3ZLVA 1ZOOA 2XB6A 4QDUA 5GM2A 1SXGA 3QPAA 1ZCJA 4FHZA 1QM5A 4N40A 5BQ5A 4LVNA 3HU1A 2IXBA 1RM4A 3U26A 5GINE 2RH4A 2JI4A 4V0RA 1YR9A 4YVZA 2EKDA 5BW6B 3ZWPA 3DAGA 4F92B 2JAQA 4OD0A 1MB4A 1GN9A 1LI4A 3E1GA 2XCQA 5LR6A 4PLCA 4HNAA 3T3IA 3BE5A 4BAUA 2H4ZA 3LYSA 1V5WA 3BICA 3L07A 3DXYA 4RL4A 3VR4H 1P31A 1C30B 2AEFA 3A6LA 4BNMA 2RIPA 3TEJA 3KLOA 1JHOA 2YQZA 2R4UA 3BJYA 3KDAA 3OX1A 2JCSA 3F5AA 5IJ9A 3PX4A 3IM1A 3Q7PA 5KFDA 3OZFA 1BWQA 4I14A 1C2YA 3DKPA 1GGVA 2XI9A 3VZQA 4HGQA 2CLOB 3MQ4A 3KQVA 4V0KA 2W6MA 1MGPA 1IBMB 4KQCA 1Q7TA 4Z6EA 3PITA 4C7OA 4QIWC 3QM1A 4CG1A 8ICCA 1KI6B 2BV3A 1YS1X 1E3JA 4DL6A 3ZX5A 4B6OA 4BWVA 3SKYA 4CM9D 2ZSEA 4XVRA 5BWLA 2VHEA 1GADO 1E18A 2NRXA 2L69A 1IAQA 3GUVA 1E6KA 3V00A 3DE7X 4DO9A 3KKZA 1XZMA 3AUUA 1SKSA 2P7HA 1P1CA 3ZKWB 3IFSA 3THWA 2XXAA 2C4VA 3I5XA 3CH5A 3LQKA 4FN5A 2OXOA 3V2UA 3GWGA 2MWMA 1S8FA 1ZMBA 1UBRS 3RUIA 5BQXA 5DBEX 5LYJF 2C8KA 1G21B 1QKJA 3BDVA 1UK6A 2YUTA 1RFLA 1W1IA 4C29A 2H7YA 4B79A 4C4YA 3R3HA 2VJOA 1S2GA 4PZAA 2ECKA 1I2ZA 3D5TA 4FOOA 4MR9B 4ZC1A 3FMVA 4EJSA 2ZIUA 1XRRA 3F9IA 5I7EA 5KIAA 2V0GA 4EUFA 1SUBA 2DQZA 1V6SA 3KT8A 3VKVA 4L4SA 2EZYA 3EAGA 4MMYB 3PNMA 2QJWA 2UUCB 2OCBA 3I62A 4TSKA 2SBTA 5KZMB 3TLGB 1IEWA 1E5XA 4MAFA 1WXDA 2YC2C 1NZPA 2Z5GA 4M0MA 2JK0A 3N2ZB 3MUNA 3IP9A 2QD1A 5E6SA 1Z5PA 2V45A 3GNSA 1CQXA 2BHLA 4KP7A 3R74A 3VSAA 1NQTA 2H2GA 1MORA 2VKTA 4DUZB 4G5SA 5MFZA 5IVDA 2EW1A 3ELDA 1A9RA 4M55A 5KOJB 2I8LA 1E7WA 3GFVA 3UAVA 2FLVA 4QEKA 2EWVA 3MAAC 2ILVA 3RO7A 5KVAA 2EZ9A 3A9WA 4MPTA 1YQTA 3PUYA 1ODTC 3ZU3A 3GN1A 3A6ZA 4QDZA 2AVNA 1MT3A 5JSHA 3GPCA 1PYGA 2JZCA 1SURA 5TARA 3ZCTA 1JLRA 3RVMA 4CR8A 5ADWA 2I3DA 4CCYA 2QUIA 2P6PA 1CNEA 1LPOA 1PR2A 3O7WA 4YVFA 2YQEA 4GPAA 1ZQVA 1QGYA 3RSHA 2GJ9A 4RGQA 5K09A 3FSGD 4B0PA 1DKUA 1Q1GA 4UZSA 3ICXA 1D9FA 3I9V6 1WQ1R 5AVZA 3EB9A 3DTTA 2JLUA 3BWEA 3SYMA 3L0BA 4R8LA 4CKEA 5FV4A 1L7VC 5G5HA 3EFEA 3LDFA 4HRVA 1JHVA 3ZWNA 3D7RA 6PFKA 3FGZA 1R6XA 2PLAA 1FXUA 4Z4CA 1RM6C 2KI5A 2WOOA 4XJXA 4IVPA 3ZI0A 1BPEA 2M32A 1OHHA 2DETA 1TT7A 4MS1A 4O2AF 2O0HA 2BCUA 5EP1A 3TOSA 5EYPA 4UMVA 3G23A 4MZDA 5BN1A 1GD1O 4MUKA 4MLZA 1F9EA 4PHDA 4OVKA 3QBTA 5DI9A 1KSGA 4IFIA 2XXJA 4NV0A 1P1KA 3D3KA 3WLOA 3I1JA 2EFHB 3X3HA 3IEVA 3R76A 1L5MA 3MTAA 4G9BA 4P0QB 2HEIA 4RWEA 2GM3A 2GZMA 4ZVTA 1J8VA 3KSBC 4EEYA 5C3MA 1JAHA 4HNUA 3S1AB 2QLJA 4BFYA 4RHCA 1I3LA 1TZMA 4IVRA 5G3YA 2B92A 1VYUA 3NQ41 3LVQE 3ZDYB 1PVDA 5K8VA 4XA5A 3CCFA 1Y8RA 4Z3KA 3U9TA 4X3OA 4RCZA 3T7TA 3KYDA 2O3QA 2C7QA 2V7XA 4MWDA 1USUA 3IVCA 5CFNA 3EZ9A 3BB1A 1EDEA 4NLKA 1BOFA 2FJUA 1P3DA 2XYPA 5GIPE 3JW8A 2HMYB 1GZSA 3HKZF 1IHDA 3UG6A 4Q19A 4ATNA 4ZOCA 4POOA 4FIDA 2DBVO 2LE0A 2AK3A 1N6KA 3F0TA 1CVIA 1DFHA 5B5SA 3RIGA 2CXHA 2IE0A 1BYUA 3I1FA 5HDBB 1DL5A 2QB0A 1HTTA 1CRZA 1V5FA 1P33A 4NZZA 1RE1A 5JI2E 4WZZA 4MVJF 4I46A 5U4QA 1KZ6A 2QAGC 3I3SR 3I4LA 1KOJA 1PP4A 4TV8F 1UBTS 1KF0A 5BXQC 1I0LA 2G9UA 1IY2A 2W8BB 2C7RA 3ZY5A 2B98A 1QRTA 1OWOA 2PGJA 4JP1A 3U9LA 1GVNB 3H11A 4MUNA 5REQA 4IZ6A 4S12A 1J8MF 1S76D 3AL2A 4GUDA 4FE3A 3GFPA 2NO5A 2Q6LA 1NQVA 2XYQA 2ZSUA 5E2BA 5A2QA 5B4TA 2BFMA 3PXEA 4Q6WA 2X58A 5AHOA 3A06A 2R11A 3BIOA 3JQ8A 4QULA 4L50A 4JU9A 3FAZA 3GCXA 1N1DA 3TRJA 1L4KA 1F0NA 4FCWA 1EXNA 3FB1A 3VOSA 2ZAYA 3U49A 2B34A 1E32A 3KWLA 3TX2A 4AW9A 4LVUA 5CTAA 3SZUA 4DT1A 4O3PA 1EDBA 4HWGA 4R1TA 1VJ5A 1Z4MA 1OGIA 1SVOA 4LF7B 2DPYA 4AUNA 2BHNA 1Y7TA 3I9FA 1PV2A 5D5PA 1QHGA 3IP6A 3LIIA 1V1RA 2OXEA 3KS9A 2ZTVA 2K89A 1L8QA 5DT2A 4AO6A 4HLQB 2OO7A 5DXJA 3CR8A 4BNWA 4P3OA 1X6JA 4P5PA 3AFIA 1WDMA 4CCWA 1M34E 3OSNA 3JTMA 3RRMA 2HHAA 4ZJYA 2JANA 1E77A 2LKCA 5G0SA 1GVHA 3G6VA 3QUQA 1HT2E 2BKUA 3IL2A 1K6IA 1OAOC 2CXSA 3CWCA 3R3UA 2EP8A 3CSUA 3VZBA 2DPGA 3UUFA 5LIRA 2XNDD 2HQ1A 1YFKA 3ZXYA 2F3NA 2AJBA 5KSPA 5CYPA 5AKJA 3G82C 1RLTA 4HWKA 4C4ZA 3UYKA 3C4VA 2GN0A 4ONEA 2QPLA 5AI4A 4YX9A 5FLXA 8ADHA 2VIXA 2R4QA 1JNXX 4UB1A 1GTRA 4D57A 1D9DA 3BXPA 2F7SA 3MTJA 1URJA 5TQJA 5B4UA 1Q5PA 1A7JA 1QFZA 4UNPA 3N74A 4JJGA 2PMWB 5KOHB 1SBCA 2W3SA 3BB4A 2QM3A 3O8OB 4D4GA 5J3JA 4FU0A 5CGZA 2GK3A 5ILQA 2ROQA 2FSFA 2PV7A 3LCVB 4Z2AA 1CZUA 2C2RA 3SE7A 4BLWA 4LFAB 1VKNA 3A04A 1ZJYA 2J9GA 3R8FA 4GO1A 4RVNA 4D3SA 4DZTA 3WRYC 2ANBA 2JDIA 2D5LA 3G2MA 4WSOA 4EZ9A 4YH1A 4OA8A 1KAMA 3NGMA 4MX8A 5AHWA 2Q2OA 4G0QA 2O8BA 3PPYA 2O8FB 2DSNA 2X7JA 3MB5A 1EZ1A 3TLXA 2RJOA 1L5YA 2Z9CA 1G4UR 4MVJG 4UTPA 4C06A 2JFOA 4JHLA 1O4VA 2D6FC 2OSVA 5AVVA 2JGAA 4OYLA 3A4VA 4DKXA 4DEVA 4G1VA 3BGOS 1V7CA 4ENRA 3ISTA 4BLTA 2CCJA 3QG5A 3VV2A 3HBNA 3G2IA 3OT1B 2JA1A 2WA1A 1Z88A 4WCDA 3PGMA 3LXUX 4MO9A 4DIEA 4CUJA 3Q3JB 1EWYA 5HR5A 3DMTA 5SY9A 3QZ7A 1TO1E 3AHCA 4IX9A 1ZW6A 1IIBA 3TW0A 3DL4A 4EYKA 3HR4A 1CQWA 4R54A 1SBHA 1K75A 4N18A 3SEAA 3HYCA 1VSUA 1X7WA 3WGKA 2X4IA 3CLUC 4KXNA 1QGED 3KDPA 1E2MA 2HMXA 3O03A 1SVWA 5HF5A 2X14A 4YR7A 4Q9LA 4B8WA 2HVHA 3ITNA 4OUKX 3HBLA 1XMIA 1H6CA 4BLRA 2OUKA 4PE5B 1ZOPA 4R1PA 4FEYA 1B00A 4QBFA 1O97C 4RQUA 4PZOA 4AZWA 1DHRA 8ICEA 2H9AA 2X3FA 2VH5R 2V7EA 3DV0B 1ONOA 5EUCA 1TK3A 2EQAA 2NIPA 1ZSVA 4OFBA 4X0EA 5CPBA 4RQAA 5J0QA 1NP6A 4JXZA 3BE4A 2O1SA 4TMVA 4DQKA 2Z8ZA 4B3SB 2EP5A 4UM7A 1EVIA 3CYFA 2IVFA 2BF7A 1G9XA 1G3MA 4NMMA 1V3TA 3O8BA 1C1DA 5JZSA 1RYDA 3KZVA 3UGTA 2OYCA 5LOVA 3Q85A 3OQ1A 1A6SA 3PQ4A 2FJ6A 1K8YB 4KFUA 1EJ6A 1F8UA 1GSIA 1VKRA 1ZVKA 5KQRA 4UU1A 2AU0A 1BE6A 3QLJA 2ZRBA 3JASA 4NQZA 4O3QA 3JZMA 2PWBA 3JPOA 2Q0ZX 2OMKA 4X1YB 4TRRA 2PBLA 3W06A 3M9XA 1DXQA 1K4MA 1KQOA 9LDTA 5JDIA 3U37A 1BPXA 4XLLA 3FBWA 1WZIA 1E60A 3UMMA 4FJ2A 1T2UA 5E79U 3NVKI 4XUSA 1EDOA 3NHLA 4X8MA 2OV3A 5CP2A 2PQ6A 3FWYA 2MDTA 1RKXA 2Q1SA 4Q3LA 5H16A 3STXA 3TQIA 1JF8A 4HVCA 4EYQA 2ZRGA 2IZ7A 1O6FA 4IRKA 4R69A 5HTKA 4NBVA 3ER8A 4MVWA 3PNCA 5DG8A 5CA7A 3MUEA 3NRJA 2PUFA 1M2OB 1NE2A 1UM9A 4ZEOA 1CV2A 2H5EA 3C8MA 2GM9A 1OZAA 5HCNA 4B6QA 3B60A 3BWYA 1THTA 1TUEA 4Z51A 2VYND 4GZ5A 4PY2A 1R64A 4HH1A 3DOHA 3ZGYA 3VPXA 5A4MS 1VIYA 1SBQA 4F4HA 4R63A 4HWSA 4M37A 5EL0A 3ETJA 1OIXA 1U0FA 4MRRA 4LOJA 3BB3A 3M7DA 3LP5A 2G04A 5CMLA 2C99A 2HGSA 1Z2OX 4JOBA 1SC3A 3EFOB 2RI1A 4DA9A 2PH3A 4O2BB 1EDDA 1Z68A 1LLFA 3VBCA 1QGUB 3OTHA 2EATA 4ZYYA 3OZXA 1U0GA 4D0RA 4N9WA 4O3NA 2KSOB 3FFWA 5CG2A 4JQYA 1UXJA 1WOMA 3Q8KA 3K9LA 2HDNB 4PYRA 5D8DA 3SZOA 4G4SO 2VJ4A 1ZNWA 5J2TA 2CHQA 5KG3A 2ASEA 2BTQA 5DGBA 3RS7A 3UW3A 4NXZA 5IBRA 1E20A 2R18A 3R3JA 3EAQA 3THXB 3EVZA 1DQPA 1ZXLA 9ICNA 3GELA 4C04A 4FWIB 4FNAA 1ODJA 2PGXA 4BTLA 2DUUA 5ED4A 1UKVY 1FE8A 1KMHA 1SUSA 4OP2A 2AXQA 2NZUG 1VP9A 3CX4A 5IVHA 2PD6A 1R6AA 1MN6A 3KM0A 1VA4A 2ACEA 4OMUA 1XTVA 3BMNB 1JTFA 3DNPA 1N25A 3FIJA 4C4RA 5K4LA 2QSZA 6GPBA 1MAAA 1S3IA 9ICAA 1Z1VA 5F7XA 1NY5A 3KZMA 4UNQA 5CNIA 4FI3F 5DVZA 2O6KA 2OD2A 4QWMA 4DLTA 5DYNA 3ZKAA 9ICVA 4B83A 3T5KA 5D6OA 2XYGA 5AKHA 1E7RA 3FLMA 2IA5A 2RGWA 2QB5A 3VDQA 3PB3A 2QNRA 5JLAA 4INZA 3G7UA 4AKGA 2WF7A 3PEFA 1DBRA 3UMJA 4CTNA 5DGDA 4DXDA 4MWEA 1KXZA 9MHTA 2PZMA 2KZ3A 4QEDA 2RAFA 3T5PA 1NN3A 4RZ3A 1CLEA 2BKEA 3B9QA 1KFCB 1OW5A 2JGKA 3DT6A 1A8UA 3FI0A 1Q20A 4BNGA 5GY7A 5KQGA 1I4EB 4HVAA 2BEJA 3TQCA 2VJPA 1P1FA 3I9NA 5KHLB 4PO3X 4NOMA 1L6RA 1X42A 4O4LB 3AI1A 2RHBA 2Z95A 4AF7A 2XH8A 1Y89A 5IF3A 5J0SA 1PIWA 1RVDA 1WHTA 3KQKA 1ZI6A 2JRLA 1EX7A 1KNQA 5G40A 4PLTA 2PJRA 4YUVA 3F4LA 5EHIA 3DLIA 4B7UA 4E1AA 5I5EA 4CLOB 4NZYA 2ZU6A 2G8NA 1E2JA 3KXLA 4KREA 2CXXA 2E21A 3H97A 3LFUA 4UC0A 3NIDB 3KXKA 3ROZA 1FP6A 4LZOA 3UOAB 1RTTA 1BW9B 4YN3A 5KTYA 2HJSA 4DF4A 2I4IA 3JVIA 3WIDA 3AV0B 1FDOA 2NSDA 1WU8A 2V4QA 1U48A 2FZLA 1R66A 3OFJA 2LPEA 5HHIA 2P40A 1KJQA 5CTJA 1THGA 1QU3A 4N7BA 3ELBA 3ZV3A 2V1XA 3D8RA 3NWPA 4C05A 5KTTA 2OV8A 4PX5A 3AP3A 1EG2A 1K9SA 2IUUA 2JGDB 4N49A 1QH8A 1Z63A 1RPJA 1QIGA 2WD8A 1QH1A 4W8HA 4NZNA 1P2UA 1RJDA 1UXKA 5JS1A 4I9UA 1TAUA 3FPEA 4BNDB 4QYWA 3W5IA 3SN6A 3CEHA 2E4VA 4UREA 1IN8A 1AV6A 2H16A 4CF7A 4NOLA 1JYEA 2YMPA 2CCKA 4RDCA 3CO0S 4XLZA 2RGEA 1Z0ZA 5AUQA 2XITA 4B3BA 4RE6A 521PA 2JKVA 4PZDA 2ZRFA 4XCXA 1F0YA 1QRUA 3ROGA 5ALPA 2Y3IA 4ARVA 4WACA 3VZPA 4E5SA 3F7MA 1JJ7A 2CKDA 1FTYA 1W7AA 2JI7A 2IX3A 3JQAB 3AL0C 2FRDC 2MAXA 3I0ZA 2RGNA 4PSVA 2ZKIA 1GAEO 1US8B 1RHKA 4ZJPA 4OHZA 2FG5A 1W49A 3FR8A 4AZ0B 2GO1A 3HNRA 2Z8YM 4QYIA 1VJ0A 4B9MA 5SZIA 2R8JA 1RQLA 2IODA 3HMKA 3ZK7A 4JIGA 4UUQA 1R18A 1YWGO 1XNHA 3OPYA 4UHCA 2V3VA 2YW2A 2JGMA 3E1SA 5JEDA 2XCTB 4ZU6X 3N7AA 4O4IF 2X6TA 3QXSA 3DFZA 4JYAB 1XDZA 2WE8A 1R74A 4ECRA 2WIGA 4MLPA 3AESB 2ZIAA 4CQMD 1G60A 2H2FA 3MA0A 2BGWA 2IHYA 3RREA 3AG5A 1PJQA 4PC6A 3HN6A 4Y8VA 4QBKA 3OPQA 1BVYF 3CLSD 4DSFA 1R50A 4O4HB 2HCBA 1E3MA 1L5HB 3C98A 4NJMB 3ISJA 1N5DA 3RIMA 2IEDA 2AE2A 3M49A 3KAKA 4GWKA 4IQUA 1QX4A 5DDIP 5T4EA 2QVLA 1JQBA 3SM9A 3UFXB 5A9SA 4R1UA 2REXB 3JU3A 5I7OA 2GKSA 4UBKA 5D51S 1J2UA 5K6RA 4QZEA 4YRZA 1PWZA 1VMDA 1NASA 1ZRHA 3FDXA 3CPSA 3RFVA 4H6VA 3W90A 5I9TA 3L4SO 3SLKA 2MYPA 3REGA 4US1R 4WDQA 4JN6B 5MFPA 5EZSA 1NF9A 5LOVF 3IR7A 4ND8B 1UKEA 3EIWA 1QHHA 4MV8A 2BEUA 3HR8A 2RGAA 1NLFA 2BMAA 4JFRA 5AOBA 3UMVA 4R9SA 1YZGA 2CHUA 4OK6A 1ZO8A 3IC5A 1HFEL 4MP6A 4L7VA 4NPHA 1TM2A 1Q0LA 1K5PA 2YICA 1JX4A 5IK2D 1I3CA 4PQFA 4K1LA 1BXRA 3O94A 4KYUA 3PQ3A 5AH0A 2XA9A 1H2ZA 2NXCA 5ALMA 2VUHB 4QZBA 1ZA2A 2VDUE 4H16A 3VDMA 5I7HA 2JFPA 3H0CA 2JFFA 3EARA 4IY1A 1O3YA 2PZJA 2L82A 3WO0A 3G0CA 3WLPA 3GZNA 3QNMA 1QVVA 1M54A 3WGUA 4H15A 4ZXPA 3AUSA 4UHFA 3HFRA 2R1VA 3OQVA 5M5BA 4YQYA 2FPIA 4LSGA 1BSVA 3S55A 4ZGBA 3KAQA 5FUVA 1V8DA 3S6JA 3DEHA 4RHXA 4KO2S 4QPPA 4UW9A 2W93A 3GIIA 1Y5NA 4UB5A 2DL0A 5CDTA 3HM9A 1ZS9A 1HUZA 1T6XA 4RQ2A 4D79A 1LK0A 2J3LA 3GEHA 3NW9A 2V58A 2JPDA 2FSIA 2RB4A 2PMZF 1T9HA 1XLTA 4HB0A 3V1NA 1C0IA 3UK0A 3R6LA 4RF5A 1R00A 4O4JF 5K1ZA 4EG6A 5KFEA 4QGFA 2F17A 1QQ5A 3ZCVA 3IN5A 3GP5A 1GPYA 4PZNA 5ENZA 1KJNA 1LB1B 4XYEA 3SR3A 3UCXA 2VL7A 1RLMA 3DO5A 4TWJA 4XFDA 1MHTA 3F47A 2HN9A 3IODA 2X77A 2JZBB 3QI2A 2YWDA 4D9EA 1QRDA 3V55A 1U2GC 1VECA 4PAWA 2JFNA 2P0YA 4RK4A 1LQTA 1YGPA 4KPUB 3ZJ5A 2VF2A 4X20A 4F6RB 1CY7A 5JO0A 3IE2A 4O2RA 4IP0A 4H35A 2J4DA 5BYBA 1OXTA 1KAOA 1G63A 1NRWA 2UUBB 2OCDA 3RT9A 3FOFC 3ZU6A 3CIOA 2BQ3A 2E4WA 3K0KA 3CZ9A 1FDIA 1RBZA 3A8TA 5B6PA 1C1YA 1FP7A 3K0CC 4PPYA 4D9FA 3EGCA 2BTOA 1NUAA 3KQTA 4M98A 1KJIA 1HTBA 1E4EB 2FW1A 4L3WA 1I3KA 4MDYA 3EDOA 3LA8A 5JVDA 1QBKC 3E2MA 4EH1A 2WJZB 2HLDA 3ZDEA 2QPAA 4UMFA 1M6HA 1SCAA 5A05A 4KMRA 1L7OA 1V3VA 4TQ9A 3K70B 3O8RA 1OLXB 2GNAA 3KJZA 1YR6A 2HY7A 1U1GA 4LMAA 3LFHA 4JBNA 3NATA 4B3DA 3E3NA 4KLJA 2YW9A 1OI3A 4O8ZA 3NJ8A 1XTPA 4D0NA 2JJQA 2A1AA 1QV6A 3VSDA 2YDYA 5EESA 2QX4A 4L72A 4DMUB 3K9BA 2O0KA 4BPBA 1R27A 3CLRC 3LOUA 4OQXA 4RNCA 1Q1BA 2BF4A 3WXMA 3J7TA 3OD5A 4L5BA 2GPYA 1V5EA 1KYWA 3WG9A 3N8GA 3T3GA 3IPXA 3Q2OA 1JS1X 3VU1A 3MWDA 2NYRA 5IXYA 2H3HA 1HK7A 3VTAA 3C39A 4FJ1A 4OHPA 5FBLB 3IDZA 4Z7OB 3MPOA 4ECVA 4F4WA 4X41A 5JD3A 3W9UA 4AQDA 5DKFA 2E4ZA 3I2GA 5C8VA 1KEUA 1Z4IA 3W6PA 3GFFA 4BRWA 4Z99A 4YV0A 4DREA 2H4XA 3WWDA 3LBFA 4G0WA 3ABIA 1C9NA 2AFIE 3G6WA 1M6WA 5LFAA 4NEQA 3GHYA 3M6LA 1YCHA 2BM0A 4URYR 4AQYB 4EYIB 1NZBA 3CZMA 3E5NA 1UBKS 4DLGA 1X6VA 2QVZX 3RKRA 2ZCJA 3AMVA 3ZWKA 1R0WA 4I5EA 5EMNA 3QYPA 4K9KA 4CV2A 2PUBA 2B1JA 1TADA 1MW9X 5LYJA 1SD2A 3ZHVA 3QUAA 3T1NA 2NPIA 1DX6A 3WYBA 2P8SA 3E2EA 4WVLA 4JR0A 3OD1A 3SYKA 3GJRA 4KI0A 2QARA 1CY1A 4IS7A 2WMDA 5LZ8A 4O59O 1EFVA 4ROTA 2PUAA 1E8MA 4YMVA 4MWOA 1W9MA 3HU3A 1KI3A 3GRKA 5DCLA 1NK9A 1T8EA 3KKLA 2Q1TA 2I2FA 1XHLA 1TGYA 5EKTA 1Z19A 2Z0MA 5B3LA 4R05A 3IIMA 2LBPA 2C2MA 3ZQUA 3N8NA 2DHQA 2OBMA 3E61A 4MFFA 2VZ9A 1BS1A 3MJCA 3CZCA 1S8AA 1U2SA 2DRIA 1PR0A 2BCQA 3WGZA 4OXKA 1V2HE 4RVDA 4WGGA 1IM5A 1GY8A 1ULUA 4I2NA 1H2AS 4G63A 5DFAA 3LUGA 2XVZA 3HYSA 4MYCA 3L4BC 4X93A 1X1SA 4RTSA 4FILA 3F6YA 4XVUA 3QG1A 1PS9A 3TOZA 4MEJA 5CLJA 4XIIA 4ZT3A 4EGFA 2C4UA 4M2YA 2B69A 2PX0A 3V46A 5HE9A 5KOIA 4LF5B 4ZIRB 4CEIB 4GC9A 4RVGA 1UHUA 5GOZA 4MEBA 2J6IA 4BKPA 1Y5LA 3NHAA 1X1TA 1UDCA 5C4IA 1TUBB 2FX5A 3JPNA 4URVR 2WV9A 1RWMA 5FO0A 5CBPA 4M8NE 3DDCA 4XYBA 1QHEA 4U00A 4ZI5A 4N65A 4JS0A 2B78A 1UWKA 2DGZA 2PZ8A 2AYZA 1ZK1A 4F8EA 3ZHYA 5KG6A 2WJJA 4XWAA 3RR7A 4WZBA 4UULA 4DR4B 5DLFA 1USKA 1N2XA 1N2CA 1I6LA 3J7AC 3E15A 5BXYA 4DNOA 5G0UA 3MOIA 3RAXA 2CW5A 3GU3A 3O8CA 3L2OB 1Q0RA 2ZM6B 3ENKA 2QTAA 1OU4A 2WBLC 3UATA 1MO2A 4ZQBA 4O2AA 4ED2A 3S7TA 4MARA 4LYFA 5FUYA 3F6SA 3WWCA 2AD5A 5BWCA 2P4HX 5CIWA 9ICTA 4LC0A 3BREA 4EVQA 5JSZB 1J8QA 3KPYA 3JWPA 2PGLA 2HMTA 3EXHA 3MFIA 5TX7A 4C1NA 4GZ3A 3H0EA 2ZBGA 4GQIA 5FEMA 2WFZA 2PZFA 3T5CA 2NYUA 4GGOA 3BILA 2A8YA 2J3HA 3LP6A 1ZVQA 2GGSA 4XYLA 2PMEA 3LM8A 1GUZA 4ZPJA 3FDJA 1TTHA 3SF0A 4W9MC 1W59A 2QB1A 5L51A 3KHLA 2JASA 5DQHA 3K7EA 4F5ZA 3UV7A 5B1EA 4RUKA 3GEMA 5AESA 2VRCD 1LA2A 1PVVA 4PWYA 2ZRPA 2P2YA 3NPMA 2I6UA 2HDWA 4PS1A 5IILA 4DS3A 1PL8A 4C0SA 1L8AA 2YR0A 4GFJA 3O7MA 2F67A 3UJBA 1DFIA 2AC7A 3MFQA 5EI5A 4J9VA 3Q88A 4QNNA 3FTQA 3IJ5A 3U7QB 4KO8A 1GLVA 1ECCA 5CG1A 5ALXA 2W83A 1P1BA 2OXRA 5A3RA 2B8TA 4HQRA 4S1TA 3C4JA 4CHTA 2D2XA 3D8TA 2ZROA 4PYQA 9ICIA 1GSOA 1SVKA 7ICGA 5HUJA 1ECLA 2C9YA 3PSTA 2MUTB 3IBGA 4MVJA 3MJSA 2VUUA 4TV8A 4AJ9A 4BYGA 1TK9A 3DL2A 4IJMA 2XNCA 1I3MA 3UHJA 3ZBQA 3EF3A 2XRZA 1CUBA 2JHDA 1FUIA 1KS2A 2E1PA 4W1SA 1RZRD 3WYGA 1U9ZA 2XDYA 1DJMA 1ML3A 4R8UB 1ZCAA 2PZGA 2X5KO 3WOVA 3MMPA 2YWGA 1L4YA 2C2HA 3EQ9A 2P7IA 5CD1A 3KFXA 3HI6A 3VTFA 3ISVA 2A35A 3JPYA 1TIBA 1KO5A 5ICMA 4NLGA 3DYVA 3HNPA 3EF1A 2FDCA 3KPVA 1YT3A 3WK9A 1GG9A 1G9TA 1EVQA 2YXBA 2QYOA 2VJKA 4JUFA 4I4NA 2VQEB 3HC7A 1XNSA 3VR6D 5TLSA 2IYUA 3CBQA 2AGVA 3PXUA 4ER5A 3V8RA 2ZAOA 3CRQA 5CK4A 2PRYA 1VXOA 1QLNA 2WF5A 1RPAA 2VHUA 3NOXA 4Y9SA 1K5OA 1DG9A 3DMYA 4ACOA 1UBLS 1I7SB 2BYTA 4ZEVA 5AXDA 4KMSA 4EB6B 2E8PA 4DNFA 3JARB 3OJSA 3MD0A 2WM3A 2OGTA 4FNOA 5DBFA 7ICNA 1W44A 3NHJA 3KZOA 3AI3A 1RI5A 1OGJA 2E4YA 3H2ZA 3TBKA 4DL3A 5A9TA 1YFLA 1AU9A 2O3UA 3M4ZA 3HCBA 4NZOA 3V1MA 4YUZA 4B3HA 1N3BA 4EHIA 5SICE 4A8JA 4DVGA 5JTUA 2FMTA 3GA5A 5CNJA 2VYVA 3CNEA 1UAYA 1XWFA 2J3MA 2QLBA 3A3OA 5LWHA 4N3NA 1PZXA 1XDUA 4COKA 1YHNA 4YJ2F 3JVDA 3WLLA 1TK0A 4ARSA 2WWRA 4I2AA 3CLUD 2WKSA 2XCRB 5AW0A 1U80A 1F14A 2ALJA 5LBIA 4L9AA 3MTGA 5KT5A 1YE8A 1M0SA 2O6HA 3R75A 1J1UA 4FOSA 4BMZA 2WKPA 2C5LA 1GG2A 1O97D 2JV3A 2FETA 1D09A 4NR0A 4QBIA 3CLKA 3D1VA 3IQWA 1R8YA 1C7RA 3PE3A 5ALKA 3I8OA 4B35A 2BSQA 1JR2A 1YA4A 1H8EA 1RDFA 5K5EA 2F76X 5JCJD 4GMDA 3FZQA 5AIBA 2LCFA 3GEEA 1EFAA 1UANA 1R5OA 2XD4A 3JAMA 1JQKA 5KVQA 3NANA 3A05A 3VU9B 5M04A 1C81A 4RPZA 3K70C 4A5SA 4B34A 4IIXA 4BX2A 4L5IA 4P5EA 1NVFA 1USGA 1W2WB 4DV0B 2YHUA 4YD1A 4H77A 5CA0A 5DSXA 4RY2A 3A1DA 4RDXA 2WKRA 4LY0A 5ALRA 4C2AA 4WNYA 1M2EA 4ITVA 1Q1NA 2GFIA 3FTEA 3AN1A 2WMNB 1A8PA 4I9HA 4QBHA 1YS2X 4KO3S 1T1GA 2QEQA 4UARA 5C7OO 3BERA 4DDTA 1OI2A 3NH6A 1MRZA 1TLFA 1PJSA 2W2PA 3EZ7A 3H1AA 4O0IA 5EJAA 2VT7A 3NGDA 4BCBA 1KFDA 4EBFA 8ICWA 2JAPA 3ORSA 3WGLA 1VPWA 5KNLA 2WEKA 5JI3E 2HNAA 2PPLA 1ZH2A 2ERXA 1QQ7A 1Z12A 2I6FA 2BEVB 3SSOA 4MS3B 2IUFA 4CLEA 1BPZA 4WXEA 4HAWA 4MGZR 3E4DA 3NTXA 5A2GA 3O83A 1PHPA 5IEJA 3TZCA 2C9MA 3R40A 2ESEA 3FF4A 1ZQ9A 5FWDA 1LV5A 3T3DA 5KSZA 3NBXX 5JRDS 1NJGA 3AKDA 5JIBA 3SC2A 1NZJA 2FW0A 4AI6A 1BHO1 1V5GA 1SB3C 4YN4A 2PBFA 3INTA 4XFJA 4Z86A 4ACAA 2W6ZA 2NUAB 5HCUA 3EUWA 5TMDA 5DWQA 2FPXA 1ZC4A 1E96A 4PGGA 2CNWD 4G4JA 4RM3A 2B20A 3P52A 3KTFA 4JBXA 5CIQA 1I2CA 4GRIA 4M87A 3ENNA 4F2RA 2XCAA 2IS4A 5TY0A 4X91A 1CZRA 4HXGA 5AVTA 1IMJA 4JNKA 1GGHA 4E22A 4YR2A 2P6UA 4IIEA 4YCAA 3EISA 4NSNA 1ECJA 2BPFA 4NJEB 4AZSA 4K03A 2JGJA 3ZNQA 4CKBB 1TRKA 2ZSKA 1OVMA 3C6YA 4DUPA 1CP2A 4FB4A 3EQZA 1T6ZA 4RTKA 3SYRA 4ECZA 1N4AA 2V54A 4NYIR 5JYEA 1ENPA 4EG8A 2MYTA 2Z2ZA 3C4QA 1OBHA 4XEUA 2QM7A 3QU4A 4N3AA 2JIQA 1ZNZA 3R7WA 2W55A 1A4IA 2AG6A 3Q8LA 3R77A 1SUWA 1P7DA 2TRSB 1DAOA 3N2LA 3T9FA 1JFFA 5FF9A 3VKGA 1KAGA 2HRCA 3EBLA 2FMIA 3CRMA 1SHZA 3DOIA 5JAOA 3FYHA 3QWBA 4KWTA 4CQLA 4MKHA 3E18A 3T4EA 5DP1A 1WD5A 1KJ9A 1G20B 5H5JA 1YJCA 4D3ZA 4A6EA 1IOLA 2A57A 3C2MA 3OM8A 4BFXA 3JD3A 3UOWA 3ME5A 5KNBD 1GZVA 4A8PA 3QF7A 2IW1A 4B4OA 5AM2A 1QHNA 1SNYA 1PVRA 4LMBA 2KP7A 3N2IA 4GX2A 4J6EA 4KW7A 1N9KA 3OECA 3AJ9A 3CX7A 3KVRA 4W9NC 2IYNA 5K6AC 4MEXA 1Y1TA 4LDZA 2ATLA 3HJTA 1NOJA 2PZKA 1N6RA 1QK4A 2R6GA 4UCFA 3N07A 1NM5A 1JQJC 1K7YA 1NF3A 2ZQZA 4QG7A 1T15A 2KEYA 2IY8A 1KPHA 3P2MA 1LPNA 1Q83A 1AJEA 3Q40A 1A4UA 3TMYA 3GC6A 3GG2A 4GX5A 1UMKA 1Q1ZA 4NM1A 2PJDA 1FZTA 3LYHA 5F33A 2JIZD 4LRXA 3FIUA 2G07A 7ICVA 3Q5DA 1Z8NA 3OCWA 4RJ2A 3IBTA 4EKGA 4QGHA 3U3OA 3EYAA 3OE7D 2HL6A 1DG3A 1ZIYA 4W5NA 4QVIA 1QTRA 2COUA 3I53A 4WKCA 1NVWQ 2W2LA 1HH4A 4I0WB 4S2EA 2FR8A 2AFVA 2ZUUA 5A04A 1P0QA 2YWEA 1TA9A 2UVWA 1YR2A 3KG2A 3THOA 5JYDA 2ZUEA 1E1CB 3S70A 3ALRA 1HQYE 2E8OA 4JLDA 4MUJA 4PICA 4YYZA 3DC2A 4IS3A 4DABA 3ZLBA 4IXWA 5HFAA 1SKQA 1X94A 1Z73A 2CNNA 5DF1A 4DB2A 1QMPA 3NVMB 2Z08A 3GLGE 1KFKB 4Y6GB 1RRKA 4ARZA 4JH0A 2DR0A 2IXTA 4P4TA 1J07A 2PUHA 3G9UA 2JH1A 5HKLA 4JXKA 4U7FA 4N6OA 4ZC8A 3DULA 3GLFB 3GWZA 3BL8A 1Q16A 3JR3A 1IJEA 4KJXA 2Q99A 3H4IA 4Z0TA 4RU1A 2IPOA 4J76A 1FLNA 3KWJA 4ZO8A 4YLEA 4LTDA 3URMA 2JD1A 4Z9FA 1B1CA 1MCZA 4HUTA 2ZP1A 1BJTA 1H66A 4DLRA 1BX1A 3CTPA 3TSCA 4ZYUA 1SIWA 3V1KA 1BWSA 5KFYA 4PHHA 2DH6A 4GE0A 2F1RA 5C4GB 4JYBA 4JA0A 4R0NA 1ZNYA 2ZE5A 1NVVR 1GCOA 5KYYA 4Z1MD 4R2LA 1DEKA 4KPEC 1L1FA 3OZSA 5BR7A 3ET4A 3L6UA 2CMDA 4NBLA 4NU0A 1QZTA 2GXUA 4Q82A 5TGZA 4CLXA 2WZQA 5TPZD 1OYYA 4F86A 3SEFA 4MRMA 5CDGA 3QFHA 1IU9A 5B7NA 4FBMA 3IOEA 1WW8A 4EI7A 2R1UA 4QZVA 2VPYA 4GP7A 3KQYA 4E3ZA 2YQ4A 4FYXA 3CRZA 2UKDA 4EYSA 2EV9A 2UDPA 1ZH8A 2SCUA 2XE7A 4HB4A 3QYAA 1OA0A 4CTMA 2G0NA 1QH9A 2C7BA 1PFVA 4Q1EA 4ZYLA 3HILA 2F43A 1HQKA 4FOTA 1YI1A 3WB1A 1EE9A 3QJ5A 3FD8A 5LA6A 4G01B 5JAMA 4G9GA 2J3EA 5B36A 4B3CA 2UUPA 2PUDA 1XEWX 3WQBA 4UEKA 2CL0X 4M1TA 4G1BA 1MGOA 3GNQA 4KR0A 3BZUA 3JR7A 3ZQ4A 2QM0A 2FMUA 4F3KA 4GOOD 3GEIA 2CXNA 2EBFX 4FS2A 4IIJB 3G2QA 1NC3A 1CE8B 5AJVB 4RVHA 4ND5A 4FOLA 4LCJA 4R01A 3I8XA 4LDAA 2GZ1A 3UMSA 1UJCA 3ZXUB 1YRWA 2GN6A 3IUPA 4EECA 3NO4A 1E4YA 2A7QA 1MTZA 4RF3A 1YOVA 2PX5A 3ODPA 4K9QA 1A8IA 2I3AA 2P9CA 2ODEA 3EDYA 1HT3A 1R3DA 1MNAA 1XNRB 1NKTA 1QIFA 3D4LA 4W1QA 1HIWA 1D2MA 2MJLA 1U3VA 3SIWA 2R8GA 1N8KA 3AW9A 3WKCA 3M2TA 1QHYA 2VT2A 5CA0F 1ZD5A 1O57A 3OUZA 4WQMA 5I5GA 2PVSA 4RSRA 1LRKA 2FH5B 3FX2A 3GDHA 3UJNA 1RXYA 1UKCA 1L4UA 4R6WA 4IUDS 1GQQA 2PRSA 4EA9A 4O4IA 2C5AA 3VC8A 3GOQA 4BHTA 1JZTA 4YP5A 1FRNA 3HZZA 2R5WA 2P2SA 4DFDA 2X19A 2F77X 3V4OA 4Y1RA 2XNKA 2RI0A 3NP7A 2GN2A 2YHIB 3ONDA 3FC4A 4XOUA 4RJLA 3RHTA 4DGSA 1QIMA 5BRJA 4MPPA 1WP9A 1ZQMA 1W25A 3N2GA 4DQUA 4JENA 4O33A 4AJLA 5KFJA 1J0XO 1H42A 4AJIA 1K7FB 2JJMA 1Y3DE 3F3SA 2WIDA 2XA1A 4AJ4A 3ICVA 3NEJA 3C41J 2GETA 2OHHA 4TUSA 3KCQA 4KRYA 3IB6A 1Q7BA 4L6AA 3E9CA 1SA0B 3GGJA 3RD5A 1MX3A 4KLFA 3CVXA 1K6JA 2RONA 1Y37A 3CMMA 1M1YE 3QVUA 4NE7A 3NYWA 1K4YA 5I9BA 1GAJA 4EFLA 5CVJA 2IYRA 4EIWA 4BL5A 1Q3TA 2QN3A 1JXLA 1XKQA 4XRRA 3BD6A 1A77A 3V4ZA 3H9CA 5A0LA 1SUAA 2R8IA 3B53X 4YONB 4TKUA 4FX2A 1E2BA 4P7KA 2ET6A 1GZ5A 4K5QA 4UHHA 4DQSA 5A6SB 2OBBA 2YX1A 1JZQA 3W4KA 4K6CA 5FWXA 2I7XA 3QE9Y 2QRUA 1GAWA 1SD1A 1H8HA 3K4HA 2OOSA 2J6BA 3KJEA 3SV4A 3KZIU 1V9PA 2WSSA 4OBEA 1FFXB 3KEFA 3K9NA 3UXEA 2ZS7A 1OWMA 4Q34A 2GARA 2DBYA 3EZ6A 1IQPA 2Y0CA 1BEUB 2NU7B 2JRCA 4L4XA 4NEHB 2EDUA 4OQPA 3SHTA 3IV7A 1Y4UA 1B0PA 3HBJA 3EEQA 1PVPA 2BPGA 4GPBA 1JKJA 4OL9A 4DWIA 4EY4A 1YIAA 5F76A 3MJFA 4ZVKA 1KFBB 4DLYA 3AR2A 4WH0A 1M2VA 5TQ2B 1T4CB 4DLLA 2W11A 4BMVA 5ARBA 1N36B 4X66B 2CGEA 5LMNB 1YZLA 3I6ZA 1DQNA 4PPXA 4DCNA 3BH7A 5I7RA 3FMPB 4V0OA 1X9XA 3USCS 3RQSA 3MJDA 4PBTA 1KS9A 1FFHA 4R2MA 3N0RA 4BY9E 2W4MA 3L1HA 3C2QA 4JR1A 4LVCA 3EVGA 3TS1A 3MS7A 2AQ4A 1P9LA 1AA9A 3ANTA 2F3RA 2UYOA 1TEZA 2VDPB 3SVLA 4O4JA 1Z6ZA 2ST1A 1UMCB 5FFFA 3OP1A 2KB0A 1P1RA 1KYTA 3WLRA 3ZJYA 2L0XA 4NNJA 3ZGVA 2XMDA 2PZLA 4DG8A 3RTBA 1S01A 5KFAA 4IBOA 4LUCA 3FY4A 4RDIA 4RMHA 1JR3D 2GPNA 4R3WA 3UXNA 3D2LA 4NCNA 4W1PA 3SP1A 3F3YA 4WLUA 1G8HA 1AUQA 3Q10A 2AOUA 4MV7A 5JMTA 4FGSA 1X3SA 4DR6B 3OCUA 1G3QA 1UK7A 1S5LU 3GARA 4DRYA 4XSVA 4USAA 4KSYA 3VH4A 1JYFA 3R0JA 4QJIA 5F7JA 4M99A 4BMNA 4M1OA 5JAHA 2PFPA 3USZA 3CLRD 2DH5A 3G2HA 8MHTA 1NKCA 3QEJA 1EHIA 4NG5A 2R6JA 4RLSA 1LPSA 3LBIA 4JVMA 1F3OA 3K2QA 3TG2A 3EC2A 1VBNA 3MXTA 2NSHA 5HM8A 4CXMA 1XDDA 5J2IA 3BQ0A 1HNNA 1MX1A 1CUZA 2V7WA 5F3WB 2D06A 4DGQA 2PSSA 2H3FA 3R9XA 3CZPA 4BBPA 3PHLA 1XP5A 4PR3A 4Y6QA 2YS6A 1TD9A 4KN9S 3PQCA 5EJ2A 4P08A 5D1HA 5EWJB 4EPRA 2WJ3A 3F8SA 2H8GA 3EFBA 2BCGY 2EJTA 2G76A 3TAQA 4D7AA 1SXJA 1UR5A 1H9BA 3TZ6A 1N0HA 3DLTA 4L6CA 1FU7A 3HUDA 4EY6A 4KAJA 4JUAA 1CUAA 3DP9A 5A5VA 4MROA 1GYRA 4KODA 1YK0A 3I2YX 4NY1A 4ZARA 1VHLA 3MWJA 1QO9A 3GLHB 1U0LA 1MV8A 2FMXA 9ICMA 3BMQB 2H31A 5IDVA 5C81A 2HTFA 2KJ9A 3T0FA 2NXNA 2GFQA 4V1CB 1GLNA 3I30X 5BWBA 3C3YA 3A26A 2EEPA 2F64A 3TR5A 5IYZB 4GT1A 2FSPA 1OLSB 1L5KA 1E6WA 2PT7A 1RHUA 1MG5A 3P97A 1GSHA 3EEOA 2H85A 1EFPB 2NP7A 3I1IA 4HDKB 4ON9A 5ANRB 4OHRA 2B6NA 2RAUA 1BS2A 2QRPA 1NR7A 2VA2A 3RC2A 4QAQA 4KK4A 1VHQA 1SQFA 2GZ3A 1JROA 4GOND 4N5LA 5ALVA 4ISBA 4JJEA 2WYWA 1A72A 4MMZB 4JVNA 3ZWBA 1EP1B 2G80A 4P36A 1YF3A 5LA6F 2QZPA 1F2UB 4GE3A 3HEMA 5LM3A 5B7GA 1A9TA 1O87A 1XEXA 2C00A 3FTNA 1UODA 2X9QA 3AHIA 1FLVA 4FXPA 2VVTA 2B36A 3A4TA 3IEKA 1J90A 4UJ3A 3H84A 5BRAA 4PHEA 1S1CA 1DXYA 2HMWA 5ADUS 1S3SA 2JC3A 2CHGA 4BCCA 4V3CA 3JQAD 5IBQA 3TMAA 1B3RA 1AKEA 2X4DA 2JI6A 3ZYZA 3PQFA 4M04A 1VHDA 4QRHA 4MYTA 2HQOA 4TVBA 1SIOA 1ZQLA 2GRUA 4FT4A 3M6FA 1Z3EB 2QSJA 3ZE1B 4GZ6A 4P4PA 1F20A 5LWQA 5ECWA 3K0HA 5U1PA 2O9JA 1KEJA 4KQ6A 1J7KA 3H8JA 1Z6GA 3NWBA 4IFBA 2P5TB 3WLSA 2EP7A 1FNSA 1KEWA 2A5FA 3NHBA 1DARA 4Z6FA 3P1JA 1JI0A 3D8BA 2PDAA 2UVPB 5F98A 4HB2A 4Q05A 3ND9A 3F1KA 4DRXA 4NRDA 4LYYA 5IZCC 1NULA 3O4FA 3IAUA 2V4UA 3LWZA 4HAIA 2H3VA 4OJKA 1KW4A 5HBRA 2ZDHA 3TTTA 2ZULA 1JN3A 5CRIA 3HBAA 1NUUA 3RBVA 1OX4B 3LRXA 2ZYGA 4FFLA 5AHXA 2FK8A 4W4TA 3FKSD 1QF9A 5F4ZA 3V1YA 3K92A 3CW8X 4XGIA 3CKKA 4MW0A 4F4FA 1T36A 4A9AA 5HZKA 4NC9A 3NU1A 4RO0A 6ADHA 2PKCA 1MFZA 1PVOA 3WYEA 5DBAA 4YQEA 3CT6A 1D04A 4MGIR 1T3TA 3D1LA 3WWZA 3F9RA 1CUFA 3SR6A 2YWRA 2O8DB 4U1RA 5LP6B 1UPXA 1XRPA 4P3YA 3BA1A 2V7GA 5EUMA 1YDFA 1UEJA 1XVAA 3PGA1 4LZNA 1CNFA 1YCDA 1XA0A 3HBFA 2AJQA 3X1MA 3QPUA 3MTBA 3RHSA 4DMFA 3DBLA 3L6BA 3PFGA 5J2HA 1ZQHA 4NL9C 1M67A 2H11A 1Z2DA 4QUGA 1EYZA 2Z9DA 2VPPA 4LOLA 5IARA 2HBJA 1QX3A 3AUOA 4U2EA 1F2TA 5AUPB 1H0KA 1N48A 2ZSHA 2G7ZA 1OIVA 3UHFA 1JFTA 4IMJB 5ALQA 3A6GA 2A3RA 2E1EA 4MV4A 1FQKA 4KSBA 4XARA 1YGYA 5GV7A 3OBIA 2C2GA 1LX7A 2EOAA 3L7AA 4YP9A 2X2EA 2XOXA 2IV2X 3PIDA 1HOXA 3QXJA 4NBTA 2PRZA 2DT5A 1CZHA 2FG7C 4U3JB 1C9DB 3CMCO 5EE0A 5G0VA 3FDZB 1B43A 3SDZA 1A50B 5BN3B 3CVWA 3HNOA 1SV0C 4QAJA 3JQBC 1JE1A 5HK8A 4MIOA 3RASA 1GYPA 1A9OA 1QE5A 1PWXA 5HKAA 2J6HA 4CHGA 2FZWA 1BOOA 3I05A 4IDBA 3E7FA 2P4QA 5L4NA 3EPGA 4H0CA 1CF4A 5DH9A 1KJWA 2WIKA 4HDMB 4PC2A 1T2NA 2IV3A 3M6WA 3UV6A 1RPLA 5C5JA 1BD4A 5KTOA 4DR3B 2ZWAA 5LSAA 4C7VA 3GVPA 4M22A 5FI5A 4AZ3B 3H3JA 3Q8QB 3LPNA 4O5KA 2NZYA 1XTIA 2O2YA 5JJ5A 4X97A 5J2KA 5A4JA 1ZLXA 3OAAA 3Q15C 1HDEA 4LHEA 4LXIA 4IGIA 2KK0A 3RH5A 1T35A 3TQ1A 4MDEA 4DTCA 2D0IA 4DNXA 2K2WA 1KFTA 2WJWA 4MW4A 4OKNA 3U80A 3EIOA 2FQ1A 1KE1A 4X44A 3RVLA 9ICJA 5L3SA 2IDMA 4QHYA 1L6NA 2QVXX 5A4FS 1U1IA 4P4GA 4LBWA 1YDWA 1E9DA 3KJHA 1QTNA 4D3XA 3N76A 4MVJM 3A37A 1U2DA 5E4YA 4MWZA 2H4YA 3RVSA 2ZJ2A 1PR3A 2YV2A 5KQMA 4KVGA 4D80A 3NRCA 4X6LA 1II8B 2AG8A 2Y71A 1E9SA 1RLJA 1ZITA 4IO0A 4RMGA 5JXWA 4A23A 4FNMA 1UZNA 4R0MA 1ZYUA 5IM4A 2D7JA 3ADDA 1JI7A 4J49A 4QZFA 3LBYA 1K08A 1GRVA 1XKLA 3V1LA 1U2TA 3M6ZA 2R00C 3KJFA 3ZN2A 4PHCA 1KK2A 2JFXA 5H02A 5CX1A 4TT3D 3HBMA 4BX9C 1MIOB 2YVLA 4OAPA 2YMLA 3ZY2A 2VH2A 3KTAA 4OQNA 4CFSA 5I47A 5A7HA 1NOKA 2OZVA 3QY9A 2CVPA 2WVJA 3E81A 4M7PA 1C1XA 9ICPA 3U16A 1G1MA 4LJ9A 5KNCD 5HQ3B 3K70D 3GD7A 1L4LA 3NWEA 4Q01A 1J25A 5CFMA 1ORVA 1WWUA 3LD9A 3IIJA 3R5HA 5L1JA 3KSAC 2GH1A 2VHQA 3ORFA 1V71A 1TC1A 8ICGA 8ICKA 1FIUA 3T7KA 5I7FA 4OHVA 3OHBA 3KTDA 2VF8A 3L4KA 3EEFA 1ZM7A 2H48A 8GPBA 3P2EA 3M6IA 4OIMA 2AKEA 1QB8A 4KNYA 2IZZA 3KEOA 4WERA 2KHQA 2VEDA 3CS3A 2OCGA 4YMGA 1ZQTA 1F0PA 2CD7A 2XDQA 4YJ2A 4G1EB 4ZP1A 1XFDA 3KJIA 5EWGA 4QJ3A 2V3WA 2VSFA 3D7LA 1E6LA 1G5QA 2QRVB 4N0EA 4M3NA 2HPVA 1FTQA 4KHZA 2GCNA 4FBTA 4ZYVA 3FFTA 3Q8WA 3UXPA 2YIJA 3O0TA 2OEPA 2FF5A 2C92A 2GF9A 4Y98A 5CB8A 1R5BA 3L1IA 3NJRA 4BGDA 5CM8B 3ICCA 3M1LA 4DLVA 3VR5H 2P1RA 2KE7A 2J3DA 3ZI7A 3TZBA 3OT5A 4UTVA 3DEJA 1CR6A 1XMOB 4B6GA 1TQ6A 1V9LA 4H4DA 4FW9A 3MSCA 3HSKA 2H59A 2EQ5A 4RKRA 3QLTA 3VHXA 1YQDA 1AQIA 5KFHA 1EK2A 4LJKA 2GD0A 3VISA 1X2EA 4GL2A 1AE1A 1QR2A 5ALTA 3TLBA 2R3SA 2VLBA 3Q1KA 2GCGA 4IQWA 1LLDA 2IU4A 1V41E 2JHCA 2IU0A 3CWQA 1GRQA 2G8LA 1K3FA 1VHJA 2R6CA 2OCKA 3COJA 4V0NA 2FSHA 1SKAA 4RGVA 5B2ZA 1MHPA 4G24A 4NQRA 1LPBB 1BA2A 3M81A 4EUKA 2WD7A 4I8IA 2FHSA 1UFKA 1NHGA 2FG6C 3OQIA 1N4DA 3T7SA 1UFQA 3P20A 1D5CA 4JOQA 2ZCVA 4B44A 1R7RA 3EMBA 1EFLA 1GQFA 5CB4F 4HDSA 4U6QA 3T7CA 4RNNA 1VSQA 4M38A 4PO9A 4L75A 1YL6A 2MSLA 1TQ4A 2AX4A 4LBZA 3P9KA 4DCUA 1E3IA 4GBMA 1JLLA 2RFLA 1Z0AA 1OXVA 4RQ4A 3G9ZA 3VCBA 2W8LA 4GBJA 1Q0QA 3A1TA 2Y1JA 5G1PA 2PWYA 2OZLA 4NECA 4CMEC 4UE2A 3WNZA 1KYIA 1IHUA 3QKRA 4I4IA 1HA3A 1WMEA 4YRDA 4IIHA 4LNUB 4HWPA 1ECFA 1SGGA 1NXXA 3QEBZ 4EBCA 1SB8A 3ADOA 1KFSA 2I1LA 1LBQA 3QE2A 3L9XA 5JHGB 3JATB 4IDQA 4J1TA 4RGYA 3HCAA 2PV0A 4E88A 1NPDA 3ZD9A 2OV6A 3H2BA 4DCPA 2XZLA 4OLJA 5EHQA 1Y34E 4WCFB 4LZPA 1JVNA 4TM8A 2IOFK 1E5DA 3JVUA 1HEKA 4L4YA 4Q4LA 2OXCA 1WSWA 3F5SA 3EZNA 3PNYA 1H2EA 3P0HA 3FOBA 3KVOA 4EUHA 2BZ1A 3E8MA 3FYUB 1SBZA 4Z9YA 1A27A 4OGKA 1M6NA 5I4CA 4NZPA 1QOQB 3WGGA 1GUFA 2J3KA 3BRWD 4HH3C 4DMHA 4DOBA 2YOGA 1MH9A 3BA6A 4GYKA 3PMLA 2IPAB 3B9RA 1AXGA 1USWA 1WB5A 4YJHA 5BSMA 5EP3A 2B8EA 1JMSA 4WPGA 4ZO7A 1D5WA 2Z5FA 4QZCA 1PDOA 3JQEA 1QTIA 1J2EA 4JI4B 1VYVA 3QNUA 5GM1A 3NBUA 4H0NA 3PNVA 3QE3A 1PD0A 2O4CA 3VYWA 1XA4A 1JHMA 3RFTA 5I4BA 3KAJA 2YZ2A 4KEAA 1OX5A 5JS7A 1PUIA 4GKKB 1GNTA 2YZNA 5T6BA 4LA4A 2AMVA 4LZJA 3M0EA 4TUPA 1ANKA 5E38A 4A1OA 2HHJA 3EQ6A 1E3QA 3D5QA 5FA8A 2VTBB 1T5TA 4ACBA 5JWOA 1VJ1A 1G3RA 3OX3A 2MMCA 3NTUA 1J99A 4O63O 3EIQA 2Q8NA 4D4JA 3OETA 1U94A 4FHGA 2OFFA 4LXXA 4C87A 2PMDA 1LBEA 5CLFA 1URPA 1TIKA 2PUTA 2ZR9A 4IF6A 3RSOA 1P2GA 3H8MA 2CEAA 1L5OA 4UXIA 4R1MA 4CV0A 3I01A 2ABWA 2IQIA 1LW6E 4EG3A 3H86A 2O52A 3NP9A 4KPFC 1Z6PA 2X8AA 3GUZA 4GICA 2CJYA 4Q7EA 4B71A 4LDQA 4AMBA 3GLQA 2GJSA 2JEOA 3PX6A