3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
b'MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF00702 domain protein
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
2CFSA 2HHLA 4YCMA 4AS3A 4Y2QA 1PW5A 2WF6A 1RKVA 2HF7A 5AIAA 5ALFA 3AR6A 2CFTA 5AKGA 3QX7A 3F9RA 4KN8A 4QJBA 3RF6A 4Y2SA 2X4DA 3L8HA 1Z4LA 2NYVA 4Y2TA 4Y2UA 4UU1A 3CNHA 2FPXA 3N28A 5AVXA 4KX5A 3OPXA 2YMQA 4CF4A 5AVQA 1NF2A 1QYIA 5AVWA 5AI4A 2OBBA 3B9RA 4HGNA 5AVUA 3GYGA 1KYTA 3QUCA 3M1YA 5AKKA 3ZI4A 3OCWA 4G9BA 1TE2A 1RMQA 3R9KA 5ALYA 1CR6A 2G0AA 1RMYA 3E8MA 4ZEVA 1Z4MA 2NO4A 2IA5A 2C4NA 2RAVA 2PKEA 1K1EA 1YNSA 2G09A 4BKMA 4FE3A 5A3QA 4Y2VA 4JB3A 2P69A 1FEZA 2B8JA 4L6CA 4XOUA 5E0OA 2FPSA 2B1RA 1Z4KA 3B8EA 5ALTA 1RMTA 5AVSA 4AP9A 2R8YA 2WF5A 3ZTWA 4HGOA 3L1UA 4OD0A 1U7PA 2PR7A 3W5BA 5AW0A 3W5AA 4EEKA 2FUCA 4I9FA 1IWOA 3SKYA 1QH9A 4RETA 5FP0A 4UATA 3I1YA 4Y2XA 5AVYA 5AW1A 4UMDA 2AH5A 3ONNA 2ZXEA 3ZW7A 2FPUA 3QGMA 3L5KA 4AS2A 1O03A 4EZEA 3WK8A 1TJ3A 5ALSA 1TA0A 5AK6A 3FGOA 4XE5A 4FYPA 2AGVA 3EPRA 3QNMA 5ALJA 4J2TA 5ALHA 5ALLA 5AW3A 3QUTA 2ODAA 4XPZA 2WF9A 4DW8A 3UMBA 4HGRA 2JAWA 5ALUA 2MU1A 2AMYA 5ALWA 2W43A 3SHQA 5AKYA 3N1UA 3OCXA 4OHFA 3ZWKA 1ZD2P 2GHQA 2B0CA 3ESRA 4YGYA 3K1ZA 5IT0A 2CN1A 2RBKA 2Q4TA 5ALOA 2Q4RA 3KBBA 1YJ5A 3W5DA 4UAUA 4MWOA 2B8EA 1T9ZA 4L6AA 4OCZA 4RESA 1U7OA 2WF8A 4CF5A 2IOHA 4C4SA 4PNHA 1ZS9A 2C9MA 4YCNA 4MUMA 3EF0A 2QYHA 3NUQA 1N9KA 2YJ5A 5ALIA 1L7OA 2JARA 2JAUA 1VJ5A 2R8XA 3ZWDA 3DAOA 4EELA 4EENA 3ET4A 3SD7A 3AR7A 1EK2A 4KYTA 5T41A 4BBJA 4E88A 1Z5UA 2OA0A 3OCYA 2IOFK 4Y2JA 3BA6A 3E84A 2P27A 4UARA 4Y2RA 2YMPA 1XP5A 4ZEXA 5ALGA 1VFPA 5AKXA 3QU7A 3QU2A 2GMWA 2C8KA 2ZBEA 1F5SA 2WM8A 3PGVA 2FUEA 1Z4PX 4CE6A 1YMQA 2I33A 3U19A 1Q92A 3AR2A 5JJBA 2HF2A 2C8LA 2G1AA 4BEWA 4BX2A 3L0CA 4DFDA 1L7MA 3QU4A 2Q5EA 3AR3A 5AM0A 3A1CA 1MH9A 4YH1A 5ALZA 3EWIA 2QLTA 4I9GA 3UM9A 4UU0A 3AR5A 3SLRA 3D6JA 4DCCA 2OYCA 3R4CA 2ZG6A 5AKHA 2P9JA 2OM6A 1ZD5A 2FDRA 5ALEA 3EF1A 1U2TA 2G06A 2BDUA 4L57A 4NV0A 1LVHA 4BX0A 4YCLA 3QUQA 4UASA 4F72A 1EK1A 3QU9A 1L7NA 1QQ5A 2I7DA 4F71A 3P96A 2ZBFA 5IS2A 4B6JA 3KOOA 4BEVA 3ZX4A 1RKQA 3PDWA 3WKBA 4G63A 2IYEA 5AI0A 2BDEA 4HYTA 4NFLA 4C4RA 4EX6A 5AK5A 1U02A 3L8EA 5AI8A 1TJ4A 1WVIA 3KD3A 3WK6A 4UMEA 2MU2A 4BX3A 5AKIA 2G08A 5AW8A 3UMGA 3UMCA 1ZJJA 1RQNA 1L8OA 3WK7A 5ALVA 2YFYA 3ZVMA 3E58A 1ZRNA 3CZ4A 2HO4A 3ZVLA 4UMFA 2CFRA 3L7YA 4EX7A 5AM4A 4BNDA 3I76A 5AM2A 5AHXA 3OCVA 3NALA 2YJ4A 2YJ3A 1ZOLA 1U2SA 3FVVA 4UMVA 3L8FA 2P11A 3KC2A 3VAYA 2GFHA 2AUTA 3KZXA 1J97A 5AIBA 4J03A 3WKAA 5AK4A 2HOQA 5AW5A 3QUBA 2EARA 5AVVA 2PQ0A 5AKLA 3S6JA 2I54A 4GIBA 2FI1A 2GHTA 2YY6A 1JUDA 3ED5A 5AKJA 1RLMA 2RARA 5AW7A 5ALXA 1WR8A 5ALQA 2B1QA 5AW4A 1SWVA 1QQ6A 3FPSA 4HAIA 1RKUA 4YIKA 3OCZA 3J7TA 5AICA 3ZX5A 3KDPA 2WF7A 2WFAA 4DWOA 3R09A 5A3RA 2YJ6A 2I6XA 5AVTA 2VKQA 3MPOA 5AM5A 3U26A 3HYCA 1Z4QA 1YS9A 3WGVA 4CNQA 2D2VA 2RB5A 3IRUA 2C88A 5AM1A 2R8EA 3WK9A 3MN1A 2FPWA 5AKZA 2ZBGA 3ZVNA 4UM5A 2JAOA 1TJ5A 5ALDA 2WHEA 1RRCA 3E81A 4HGQA 2BY4A 3SKXA 3ZUPA 1L7PA 2YN4A 4O8CA 1Z4IA 4C4TA 5AI5A 1Q91A 1SWWA 2HX1A 3I28A 2I34A 5ALRA 1YV9A 2O2XA 3M9LA 4UM7A 1RLTA 4H1WA 3HLTA 4YIHA 4GXTA 5AESA 3A1EA 2G80A 2HCFA 2HEGA 1QQ7A 3MMZA 3W5CA 2G07A 2W11A 4NWIA 4Y3UA 1LTQA 3WKCA 1WPGA 3DV9A 1ZD3A 5ALKA 5AVZA 4Y2PA 4CF3A 4FFDA 1X42A 4IG4A 3WKDA 1XVIA 1Z4NA 3DNPA 3L0BA 3N07A 1Z4JA 1RQLA 3L8GA 4BNDB 3IJ5A 1AQ6A 1L6RA 3U7FB 5A3SA 1ZRMA 3ET5A 3N5KA 1XPJA 5AW9A 3QLEA 1YDFA 1WZCA 5AW6A 2IOFA 4UW9A 4KX3A 2EATA 1Z4OA 3N8GA 3B9BA 1Y8AA 3QXGA 1S2OA 2B30A 2R8ZA 5AI9A 3NASA 4JDPA 3ZU6A 2B82A 3AR4A 1N8NA 3U7HB 4HGPA 1ZD4A 5ALPA 4ZEWA 2ZBDA 4NAVA 3U13A 3SF0A 3U7EB 1VJRA 5AKEA 3WK4A 5AI6A 1RC8A 4XQ0A 3A3YA 3WK5A 3L0YA 4BYGA 3RFUA 2DQSA 4QQFA 3AR8A 5ALMA 1NNLA 3BWVA 4UAVA 3A1DA 3NIWA 3TLMA 3NAMA 3MC1A 2GO7A 1O08A 3WKEA 1NRWA 3PGLA 4NABA 2NO5A 5AW2A 3U7GA 5IT4A 3FM9A 5AVRA 5AK3A 2YMMA 3ZTYA 3I6BA 2JGAA 5ALNA 2O9JA 4KNVA 1S8OA 3FZQA 2FPRA 1J8DA 3ESQA 1T5TA 1RPZA 2HI0A 4Y2YA 3SMVA 3L1VA 2I55A 3NANA 3OTQA 2HSZA 3QU5A 3PCTA 2W4MA 2EAUA 1T5SA 3WGUA 3IB6A 5AM3A 4KNWA 4IFTA 1Z5GA 2MSNA 3QYPA 2YBDA 2FEAA 1CQZA 1Z88A 4OFZA 3OCUA 3AR9A 1SU4A 2ZOSA 2YMLA 3DDHA 1RLOA 3FPBA 1RDFA 1L8LA 2HDOA 3NRJA
chains in the Genus database with same CATH superfamily
1UR5A 1WXWA 4BO4A 1TU3A 3AR6A 1ZCFA 3NO4A 3MOGA 1XD9A 4Y2TA 3FVTA 4M1YA 3BF7A 4M37A 3EGWA 1YSCA 3AH8A 4PVCA 2VC2B 3Q5GA 1FLNA 3VPBA 4TTVA 5KKAA 1NSYA 2BZFA 3PUIA 5JRJA 4DOBA 1L7DA 4YRLA 1GLVA 1V45E 1BU5A 5EGSA 4HSGA 4RVCA 1PVVA 3PRHA 3EYAA 5AP9A 1LQTA 4DC9A 5B4TA 7REQA 1ZQIA 3NG1A 2EV9A 2GDJA 3PSFA 5BR7A 4MWBA 2DFDA 2CWDA 1FNMA 3PRKE 4KR2A 1N2IA 2D0OB 1FW6A 5EXPA 5JXWA 1CPYA 3TSAA 1HZZA 3TIIA 3LH5A 2X7XA 4C6HA 4C3OB 3DAGA 4Q47A 3RVQA 1NK8A 2REOA 1CW2B 1PGPA 3RUPA 2UZIR 5FBRB 1KO1A 4R8MA 4LFBB 2HDHA 3PNCA 5IAKA 1Y37A 4HEQA 4GX2A 3LZDA 2WRZA 3TW6A 2JPDA 3BL5A 1Q1GA 2GEKA 4WIAA 1MO4A 5ICMA 1WLYA 4DF8A 2F3RA 3EUAA 4LDRA 3TRIA 4KOAA 1NSFA 3VKVA 2VP3A 4E88A 4Q37A 3WWDA 1X1QA 3PNVA 1B8OA 4FKMA 4JA2A 1DBVO 4DLLA 1LBQA 4JV0A 1YXMA 3ZHZA 2H31A 3B5EA 1MB0A 1N8SA 3IBSA 3AONB 2IWHA 1M9NA 1A2BA 4ZC1A 2Z5GA 3D6JA 2OYCA 3ZV6A 2HLPA 1T94A 3VR5H 3VO8A 1EK1A 2WU8A 4PYNA 2XE6A 2P75A 5D49A 2GQ0A 1YZTA 4B7UA 2JJ1D 1VG1A 3BJMA 3E9RA 3PDWA 2ZRPA 3TSZA 4CKYA 2SNIE 4TL9A 4NEQA 4KLLA 1B8NA 5JS1A 3ZCSA 5AKIA 1RYYA 1WCWA 2CXRA 4OYLA 1UJ4A 3IN5A 5F23A 2PXXA 1I2ZA 4BMOB 3A70A 3WICA 1X66A 2M9NA 2YIMA 1HSOA 4YR0A 3A4VA 4D41A 3GV5B 2G8LA 1SIBE 1GP2A 3HDTA 3DDNA 1AN0A 4YO8A 3ASZA 1JUDA 4JQSA 4XJTA 4BNFA 1QLNA 3ACBA 5LIRA 3EAFA 5JSYA 3RHZA 3QVJA 4EZ9A 3DEJA 1X7XB 2Q50A 4R8RA 3FDXA 2BFDA 4U9HS 1GCAA 2PS9A 5LMNB 2DH5A 1V35A 3SZ2A 1O87A 3GDHA 2X8JB 4EMSA 5EZ5A 4LMAA 4UJ3A 1DV2A 1YV9A 3HS3A 3KSBC 4D42A 4HAVA 3QFFA 1NBME 2DBRA 2Z6UA 2EZ4A 1UMDB 3UTCA 1S0VA 1T9HA 4ZKDA 1HMPA 4DUYB 2BFFA 5JJIA 2P5SA 1CERA 1ETUA 2YZ7A 1L7VC 4DR4B 1ZIOA 1DMSA 3KYBA 4TWAA 5HUHA 2EFYA 2J5XA 2XSZD 3R7NA 3DVAB 4RABA 3KJHA 2DBQA 4P0PB 2JFVA 5B2ZA 4RSGA 1KGDA 2BPGA 2OEPA 4JP8A 4P1ZA 5HMMA 1QHGA 3UAGA 2FCRA 5GP1A 1T25A 3QZ8A 3GZNB 2UXDB 3T3FA 2BMWA 1UWKA 3WB9A 4R63A 1E1LA 2PV0A 2W22A 3MJTA 4HAYA 5DIFA 3ODPA 1G9XA 3KUKA 2CF5A 4TWRA 1FYXA 3WB1A 2KJQA 3GGCA 3O7MA 1VGQA 1U28A 5KFWA 4V1CB 3U3DA 2P6NA 2WWIA 4H08A 1JBEA 4DEYA 2PUFA 2AOWA 1R27A 2C2XA 1E0JA 4OH1A 3OZDA 2WWXA 3ZJUA 1PDVA 1XZMA 2DR0A 1GUYA 2VK1A 3L8YA 1Z33A 4HQOA 2AOVA 4PLZA 5IW8A 4QUGA 4EM6A 3LY5A 3QHAA 2YNMD 1PG5A 1PGJA 4MFFA 5I5GA 1JWLA 2DPYA 3ILHA 1OBVA 2HU5A 4NH0A 5G5GA 4DCUA 1NN3A 2ZRJA 1H69A 3ZCVA 2IZ6A 1UBMS 4ZV4A 2CLMB 3MDCA 3HYLA 1Y7LA 3O4RA 3TTWA 3LDFA 3FI9A 3G0DA 2EX4A 4DNXA 1FU7A 2R86A 3ABRB 3U3XA 3HNPA 2RC5A 4C2TA 1VJ1A 2VJAA 3CH7A 5I8PA 1YT5A 4A8JA 4B44A 1KYVA 1FFDA 4IDDA 2ZI9A 4UVHA 5HKKD 2Q99A 4I55A 1GILA 2K87A 3CR8A 4HNAB 4J0JA 4LN1A 1F7VA 3I52A 4D0LB 1CR4A 3BRSA 4LI3X 1Y1SA 2CLFB 4MRAA 5ALOA 3LIPA 3I2GA 4IQ8A 4ARBA 1NC1A 1V48A 2C8JA 3ESYA 16PKA 1ACLA 2R44A 2ZAMA 1QIHA 4Q1FA 2EF0A 4DR2B 4K5QA 4MV4A 3K9CA 3A37A 4RQ6A 3C5CA 2ADOA 2HK7A 3DVQX 1PWHA 2VJ5A 4Z0NA 4CF7A 3OM9A 2PWBA 2G6TA 1R2QA 4OLAA 4DCCA 2WYVA 1P1CA 3CX7A 4BQQA 2DSTA 2OGUA 9ICUA 4EDFA 4GOND 4R1TA 3I04A 1Q7RA 3T95A 5JVDB 2C92A 3Q8RB 1YC2A 1LNQA 2JCBA 2ZTSA 1Z0JA 2BTQA 4IHQA 3SKVA 2N46A 2BYTA 2XY5A 1ZW1A 3GH1A 3OJXA 4RTJA 5TQ2B 1X77A 5L7YA 3V5NA 2J5KA 1T9AA 4R98A 4ON9A 1S2LA 2Q46A 3UQZA 4A0RA 2PRZA 2CBZA 1LV8A 4MR7B 4FQ8A 1TW2A 3EC2A 2WQZA 3ABQB 2HK8A 1XJQA 5JO9A 3C23A 2I29A 4GLXA 4J7AA 4KN4A 2A19A 3GPBA 2PGNA 2DTXA 4HWTA 2ZRNA 1S10A 2ZT6A 3IIIA 4JASB 2WJIA 1FUYB 3AP2A 1A76A 1XHLA 3WSTA 1NUTA 3V1LA 2OCEA 3KPVA 3U4QB 2LR0A 3OZAA 2OY0A 2OFPA 2OYYA 2W04A 4E09A 4B6QA 1YRHA 1KMMA 2QAGA 2FWIA 2LTAA 4AZ0B 2VJBA 1YOVB 3FR7A 1S2MA 3ECAA 5BN3B 3HGTA 4MZDA 4HMQA 1FS6A 4A0GA 4Q4LA 3TDKA 5HQ3B 4YJ3B 5JBNA 3ZD7A 1P0MA 4Z9FA 3AFGA 4RQ5A 1XVTA 5FBZA 5D1HA 3GXBA 5C34B 3QJGA 5A3SA 3FCEA 3M9MB 4JJ4A 4YRSA 2R97A 4A8EA 4W9MC 1W35A 3LFHA 2QRJA 2RJNA 3R3HA 4JYCA 4AJ4A 4RY0A 2OV8A 2OCAA 4IBOA 2JLYA 4MW9A 2NZ2A 3AL0C 3N2EA 1HI9A 4G81A 3AMVA 3G85A 3EODA 9ICJA 2M2IA 1ZGZA 3HUFA 2B20A 1ZVMA 3GT7A 4UVGA 4YROA 1YB2A 1KI1A 2W98A 2UUCB 4IDGA 5FTWA 3C85A 1JYFA 1AM4D 1RFGE 3IVGA 3AB8A 4Q66C 4YUWA 5KYUA 1LBIA 4MROA 2AJBA 3C14C 4AUMA 4KLQA 1TKRA 2Q07A 4W8OA 4AJJA 1DG3A 1ONNA 1IG0A 3RSZA 2ZU0C 1MLDA 4AKIA 2IYOA 3IALA 4S05A 1POXA 4FYMA 4KWHA 3QW2A 2GTPA 3I8SA 3SV3A 3JQCA 1M2JA 4JJAA 4F96A 3OH8A 4NH4A 1YQQA 2HLDA 1G4HA 2EJCA 2FQ1A 2ISPA 1H4VB 1NYTA 5EIWA 4LNHA 5KNBA 5J8YA 3GJ3A 2AZTA 2I5PO 1RMYA 3O4JA 7ICTA 4Z49A 1E1CB 4NEGA 1XLTC 1FDVA 7ICUA 3UNXA 4IIJF 3SM9A 5KQLA 2ZJ2A 1SV4A 4CR6A 3RAQA 3VH1A 4GMDA 1ZQWA 4W1SA 1E6MA 9ICSA 2LWIA 4OIFA 3SQMA 3P9PA 1P7VA 5TT0A 5FOXA 4A2WA 1DWPA 3IDWA 4RNCA 2NO7A 1YF3A 4C2UA 2O2EA 4NXNB 3GJRA 3PC8A 4QUIA 2DPMA 2OGWA 1SAYA 4RACA 3MCWA 2WV7A 2GLXA 3IM1A 4OMFG 3H5TA 3FGZA 5GPBA 4FD2A 2IYNA 5E38A 1SVKA 4HAUA 5KTNA 4EHHA 1JZQA 3VNUA 5G5HA 3ZIAD 5NULA 1NNI1 4V0KA 2R8XA 4CEHB 3ECCA 2O05A 4U2BA 1GZDA 3Q1KA 3C7CB 3OFJA 2G9UA 5KYVA 4DIMA 4KQCA 3ZGYA 2F8LA 4H27A 1G55A 1TM5E 3OHAA 2OG1A 2JRZA 3DC7A 1EZ1A 4TL8A 1L5LA 1T2UA 1E7QA 1AV7A 4RYLA 5FI3A 2BKVA 1QKIA 2VNJA 1EVZA 1C7ZA 3CRMA 4H15A 2XB2A 2QMYA 5EZYA 1E1RD 1UQRA 2JMGA 2QGZA 1JHPA 1GKUB 4FU0A 4CMKA 3S8YA 3RPEA 1POWA 1I7PA 1OTXA 2P6OA 4ZAWA 2D2IA 4MUHA 2H5XA 1CDEA 4MICA 1T34A 4LY0A 4QC2A 4X1KB 1UL1X 1EWVA 3TFSA 1UAAA 2WYOA 2ODEA 5JAMA 1J0DA 4DC1A 4EQ6A 2FPPB 4BQOA 3TQTA 4L5BA 4IOKA 5LP6C 2B99A 4O4JB 3GRCA 3I72A 1D3AA 5T67A 1MX9A 3I5XA 4O3OA 1HE2A 5AIBA 2ZPAA 3STYA 4QYIA 3RSLA 2ONCA 1ZQDA 3F96A 3IQXA 4BDSA 3RVDA 4Y6GB 4L8LA 1YE8A 2DKNA 4DLRA 2ZUDA 1V1JA 1P2VA 1IM8A 1E5LA 3OTGA 2PT7A 2XD9A 5CK4A 4JYZA 1VE3A 4CJXA 1XKXA 2IE0A 2A9KA 5B5EU 2IHKA 3PMNA 1W4BA 2VDLB 3N4MB 1O57A 1F9AA 1UK8A 4YHBA 1JHDA 1YHNA 2OLKA 5EY5B 3R8FA 4GHWA 4EBBA 4GKAA 2O6HA 2QT9A 3EMDA 1VE9A 1Z2OX 2R5FA 3A9CA 1HPLA 2J6SA 3O21A 1MQSA 4BWMA 5EQTA 4WZBE 1QF6A 1P0CA 4X5OA 4J8PA 1NP3A 1KH1A 4A23A 1GADO 5CFPA 4BB0A 2BGRA 1K97A 3IULA 4L02A 5T6MA 3OFVA 3BTOA 2JHFA 3UWPA 4ZQBA 3D6TB 3V6KA 4V2UA 3B85A 1YQUA 2YC2C 1T91A 1RC1A 1T5TA 3L1VA 1NXTA 2H1WA 4AO7A 3WGUA 3KB1A 1MD9A 2GEVA 5SY9A 1VZ2A 1WV1A 1GA1A 2MSNA 1X80A 521PA 4GMXA 1I10A 2PCJA 3B9JA 4Q9LA 5AXDA 5CB6A 3W3AD 2QX9A 3COPA 2WKRA 4AKEA 1NI4A 5KSYA 2R1TB 1C20A 2CB0A 4Q7QA 3I53A 1TM7E 1IY1A 2AHOA 4YRMA 2PSHA 1IBLB 5LA6A 5JS7A 5J2BA 2HO5A 1E3QA 4MQ5A 3H2KA 1IIBA 1I4OA 5DGAA 2OD7A 3FVQA 3WWPA 2O2YA 1XX6A 4PS1A 2O5EA 1Q21A 1ZONA 4DJDC 4FE4A 2W2MA 2JH7A 4KGZA 4D2IA 4DOCA 1AQJA 3AESB 2K8AA 3L6DA 1KJQA 4NZYA 3H4TA 1ZI8A 4BP1A 3TZBA 2B7LA 4OD0A 3JALA 3W5AA 721PA 1JA9A 4XQCA 5JCXA 4FZLA 1O8CA 1YL7A 2UVDA 1VLBA 3NVVA 1DX6A 1RCFA 2BFCB 4CFZA 1RPTA 3OZSA 1GUAA 4OV6B 1DQSA 2A3RA 5CX4A 2WJPA 4URWR 4BNTA 4I81A 3UA3A 4LGYA 4DW8A 5AOBA 2VATA 3NBMA 4M87A 5EERA 2HL6A 4R31A 1N2HA 1A4IA 2R62A 4MW2A 2R6CA 4MWOA 5GONA 1LDEA 2GPJA 3R3XA 3FNFA 2RGUA 4BQNA 2O2DA 4QWDA 4K4HA 2XZOA 2W58A 3ZWDA 5DI9A 4ZMRA 1MO6A 1XVAA 5JNWA 4ZOQI 2XE7A 2KVCA 3DQZA 5JPCA 4FDLA 4D74A 2ZBEA 1H2HA 4F04A 3MM4A 4Z7JA 2QMZA 3Q12A 1C7IA 3T5MA 3VYVA 3DZKA 1E2NA 3KDAA 1QPBA 4WECA 4EI7A 3OZRA 3V7LA 1Q3UA 2IS4A 2ZK7A 4L16A 1EFVA 1QZ3A 5KFKA 3QM1A 4ZDWA 4XVRA 3PUKA 4KHZA 3RASA 2NRWA 1WP4A 4C5AA 3FYSA 3K2QA 3F2BA 3CINA 1ZLXA 4G41A 1XZNA 2O7SA 1ZXXA 4NAHA 2EKLA 3OQNA 4DT1A 4RMHA 4G85A 3H17A 2WT4A 4PG5A 2DGZA 2GZRA 4BNDA 2ODNA 2IH5A 1UK9A 5F4BA 4DXHA 3NVMB 4Y18A 5HJEA 2OHVA 2G76A 1VXRA 2IIQA 4IHJB 2RARA 3BM5A 3QX8A 4EPTA 2M9MA 5CYFA 2QSUA 1M54A 4ZZ2A 1UWVA 2CHFA 4JUDX 4N1AA 3UFXB 2OQ2A 5CCEA 2C0PA 1TIPA 1J2MA 3HB1A 4QA9A 4WNIA 3SG0A 4BJ5A 4C0JA 3W2TA 3TX6A 1Y3DE 3AQEA 2H85A 5ESDA 4L74A 2H5LA 4OGWA 4MI6A 1QVRA 1VE1A 3OOSA 3PX2A 3RUDA 2F48A 4D9MA 4KFSA 2XRMA 5K4LA 1T6XA 3T34A 3SS7X 1QO0D 2A3NA 2I2XB 5EVJA 3KB2A 3RJJA 4TKZA 3QLEA 1YDFA 1COKA 2J87A 2NYAA 4AQ7A 3OQ6A 1CVIA 3CIOA 1CF2O 1WUKS 2WIJA 3R7WB 3P5BA 1WXHA 4R8UA 4GM1A 4J0CA 1C1DA 1OA1A 3SF0A 3ICVA 2GZMA 4E5PA 4O4IF 3SBOA 1JKMA 2CXNA 5DOZA 2FLPA 5KHAA 1MJHA 2IT1A 3U7GA 5D2CA 1UDAA 4M9RA 2R8PA 3ZGOA 5J2UF 4RVGA 4PINA 1FTNA 6NULA 2MOKA 3FUCA 3H04A 3OMLA 1VLQA 5F1YA 3RF7A 4WJLA 1SOWA 3HT3A 1SRRA 4X63A 4N6GA 3OE4A 1JLKA 3GILA 4DLUA 1U8XX 3GF4A 3AJAA 2WJ6A 4RLQA 1T1GA 5KFIA 1SOUA 1I1QB 4OTZA 3C5EA 2VJOA 4RFSB 2D2EA 1UXIA 3SNHA 1UBJS 1ODTC 4MVJD 3V4OA 5AKGA 3RJZA 3K9GA 4Y0NA 1JT9A 3DVSX 4RTSA 4KQGA 1ZH6A 2ECKA 1QNLA 3LKBA 3NV7A 4V0OA 2PJDA 3WIVA 3D3WA 2F2AB 5K20A 4DJEC 3DSRA 2A1TS 2IGTA 2YUIA 1Z83A 3PI7A 1U0TA 2VZEA 3GL9A 1CEXA 4X91A 3SZ3A 4Y0AA 3O2SB 3VPSA 5J2EA 1ISGA 4AMBA 5KNDA 4U1RA 4ESVA 3GV7B 1M0TA 1RBZA 4DXAA 5G4LA 5FOVA 3BCHA 2CEAA 2XYGA 3DLCA 3VTZA 1LSSA 3HXTA 2ZYUX 3IBGA 4WY8A 4HFRA 5FLKA 9ABPA 5JH7A 3EWAA 4IFBA 3ROTA 3MABA 2PKXA 3QLUA 4D8XA 3SE0A 3R9IA 1IN1A 1XZEA 4WJZA 2VP6A 2OZKA 4L4RA 4GPZA 4OY3A 4JCCA 3IOMA 1IHYA 1WOYA 4TS9A 2FW7A 1T9ZA 3I9KA 1UKEA 8ICPA 4CM4B 4HNRA 1ATZA 2QVGA 3DHEA 3T7RA 2PKWA 1R6UA 4Z9XA 4ECWA 4ZMSA 1Q19A 2DQNB 4EGAA 4TQ9A 2BT4A 4JKIA 3WRYA 1CE8A 3ZLBA 3KQYA 2XTJA 5KQMA 2D6FA 3U39A 2AD1A 2C28A 1V9CA 3P9RA 1RYBA 3G5TA 1ZQKA 3RTDA 3NYQA 4AQYB 4PYIA 5CDTA 1S2GA 3PF9A 3T5TA 4A1FA 4FMCB 3MFYA 4P9NA 2PGLA 3T5PA 3WHIA 5BMVB 4YDQA 1OFGA 1TADA 4XUEA 3MXOA 1IXRC 3VZSA 3KPJA 2B34A 2E4UA 4BBAA 1JTVA 5AVJA 1Y9ZA 1Z6XA 3UMGA 1CRPA 2A9OA 4U39A 1PLJA 1J5XA 3LLCA 4Q7JB 2B4AA 3ZVLA 4DNPA 4G3IA 2LXNA 2MJLA 1PQPA 4KW7A 2IX3A 1G21E 2N42A 4DQQA 4DCOA 4RVUA 2OO3A 1JPJA 3W2IA 2V0NA 4BY9E 1DXOA 3BDIA 3I05A 4IZ6A 4MGYR 3ZY5A 1Q3VA 2VHWA 2SECE 1HDGO 3KLMX 3ZK8A 3ZI7A 3SENA 3TGPA 2POQX 1J9EA 4CQLB 1XMSA 3IRUA 4ME6A 5FQNA 4F4KA 3BMQA 4C78A 3MYYA 3F6YA 3IHTA 4YJDA 3UXHA 4ZVRA 4MUEA 1RBMA 3DT8A 2YQ4A 1ZQMA 5J2HA 4NM2A 3O31A 3WQSB 3D5TA 4P34A 3T9DA 3W7VA 1TQ2A 1JFVA 1DJNA 3WL6A 3FUUA 1QSSA 2FG7C 3AM4A 1U2PA 4AP5A 3B3AA 1HK7A 2OHFA 1NQXA 2JFHA 3BWYA 1LZKA 2BSAA 4R5MA 5CLIA 3B51X 3ZNNA 1ZRMA 2BKEA 4KN6A 1NURA 4HZIA 2XDWA 3RBEA 2B9VA 1S2OA 5CLQA 4ZEWA 1AGXA 1A04A 4BKRA 2I8AA 4XQ0A 1MOPA 4YJ2A 4Y6LA 3QFCA 4QYMA 1Z29A 1Z17A 3NRZA 1U98A 4PCLA 3F4LA 3N7RC 2BI4A 1N36B 3ABSB 3MLAA 4H6PA 4XLZA 4QDOA 4RPCA 4LQ4A 8MHTA 3BDAA 4EKDA 3IPRA 4YCCA 3LTEA 1MAVA 1Z38A 1AXGA 1ORRA 5CM2Z 3GFGA 4NHEA 3DPSA 5AJHA 1VE5A 4IQ0A 4U9IS 4C7XA 3TAUA 3K9WA 3CTPA 1YCGA 1YUBA 3E9YA 3B6JA 2WKWA 1TQ6A 4CIBA 4ZN6A 3NHLA 4RF2A 4R5HA 3FAKA 4Q15A 4EYSA 1SKWA 3UWSA 1F8GA 1GL7A 1O94C 5C7LO 5J5CA 5CYPA 3BTVA 1VLHA 2FMXA 4NL4H 4U6NA 2H0QA 5GGYA 4RNOA 1EWTA 1ZMRA 3E05A 4V0NA 2VHZA 2IXDA 2ZSJA 2IHVA 1G60A 4FMBB 2JAHA 4BLVA 1JQLB 3KSMA 3ZZTA 4RZSA 5IFKA 3B3FA 2PKEA 3WJ7A 2F44A 4YJFB 3CB2A 2XWPA 1BGWA 4KRXA 3DKVA 4EY8A 4RWEA 3LT4A 4LVUA 1WSBA 4F8YA 2NVOA 4EBCA 5CXSA 1YGYA 2R8YA 1F20A 3RRFA 3HWX1 2A78A 3BRWD 3P9XA 3BJYA 3DAHA 4ZOBA 4WBNA 2HHHB 4BVBA 2WSSA 4O2RA 1JHAA 3GLGA 4J4BA 4U2FA 1Q50A 1W25A 2IF2A 1T6ZA 1C8KA 1CR1A 1W93A 1J5PA 3JZIA 5AHWA 4TKVB 2O8VA 1KZHA 3PGJA 2B94A 1G5TA 3GFTA 3GX1A 4FO6A 4YDHB 2C04A 5CVUA 2O20A 1W88B 4WI1A 2X1HA 2PL5A 2G7ZA 3WFZA 4B8ZA 4HZUA 5ALIA 3MWYW 3SVTA 2Y1IA 4ND3A 3PGA1 3RFCA 4G1CA 4EHDA 4BQIA 1M6VB 3TDMA 3RHSA 2NU6A 4BRUA 4JFRA 1F7UA 3IP4B 3EPKA 5IAOA 3I09A 3GRZA 1QAQA 5LSAA 2DHCA 1U2DC 3HCBA 3QELA 2D5CA 3T8YA 3BB3A 4DXDA 3NWPA 2J3LA 4F6RB 4HMOA 1I1OA 3GAFA 3NQ41 2LYAA 5CJ2A 1K68A 1CY7A 3O1HB 2AJQA 3FD8A 5ANRB 2E4WA 3KU1A 4LJSA 5CM8B 3AUJB 4QFBA 4CXMA 2PUWA 1W46A 4G63A 1XRLA 4IHAA 2HK9A 2FJPA 2Q4DA 3GJ4A 2QXTA 3ROQA 4DLKA 3CVVA 2CDNA 3PUVA 5TPWB 3R8XA 3RK4A 2O1SA 1OFUA 2XITA 1Z2CA 3IDQA 2I99A 1GJRA 3U3RA 3I76A 1NJGA 2GM5A 2LCIA 1F1BA 3GRAA 10MHA 3JW8A 1WXQA 1AQYA 1S76D 1UK6A 4DQXA 3SK0A 4PHGA 3OUUA 3KETA 4U6SA 1XN4A 3D9QX 1JHVA 4DLYA 3K0CA 4CIAA 1BMFA 5JUMA 3AU9A 2FFHA 3U61B 4OHBA 2HWYA 4HWSA 5B7GA 3T99A 2AIRA 2H4JA 5K0SA 4BUGA 2QJTA 3ZPXA 3D7KA 3HXOA 1VPWA 4NOJA 3OEWA 1I14A 4NCKA 4DF3A 1N2BA 3K0BA 1I3OA 3MT7A 5B1DA 1VSQA 4MR9B 3TR5A 3WKDA 3GGDA 4IGKA 5DK6A 3LLSA 1UCVA 1KJZA 1UKVY 4H18A 1WXEA 2WBLC 4IH9A 2IZ0A 5CVVA 3TJRA 5GAJA 4OM7A 3AINA 1PYDA 5EJ8A 1L4MA 1ZK2A 4HT3B 2D13A 1YTLA 3RROA 3KKZA 1RC8A 1R6XA 5I51A 1AXRA 5JMTA 4JBIA 5A9SA 4EITA 2D5AA 1N0IA 3KSAC 2XYPA 2YINC 1SL1A 3SR6A 4KH1A 3LUGA 2QS9A 5C1OA 2IZZA 1NTRA 1SEPA 2F8SA 1ZBQA 4F4WA 3AB7A 1OH6A 2CLIB 3ESQA 1YBHA 4QGBA 1U2GA 1QRUA 1AS2A 2BW0A 1OXBB 1IYZA 2GBIA 1H2RS 3REFA 3OETA 4BASA 4BB6A 3LAWA 3RK0A 3O3NB 1Z3IX 1IXKA 4R7TA 1NQUA 3TIFA 1KC1A 2Q3FA 1YJ8A 4ZIRB 2OAQ1 3E70C 4JL6A 4ZCTA 3IVRA 4C7JA 4QODA 1XXLA 2R68A 1UPBA 3UXOA 9ICFA 5TSDA 5AVQA 2BZ1A 4LHSA 5I48A 2C78A 3A2KA 1CZLA 1E2QA 2V5AA 3HA2A 3P8ZA 2H18A 2RP5A 5EWLA 3U4AA 1SHZA 4Q24A 1J8YF 3AU6A 1Z1BA 3AOGA 4MTCA 3CP8A 4R84A 5CA7A 1UDRA 1M8PA 3C4QA 4QO8A 3VSDA 5EWEA 4X00A 3WLNA 5DM70 2FPUA 5ITZA 2IKSA 4KRYA 3L4PA 2GK6A 4WLEA 2PS3A 4IV0A 4B46A 4OGLA 1C2YA 1D2GA 3U80A 3ISCA 4FLEA 4E5KA 4XR9A 4IDQA 3TSWA 3TADC 3LBNA 3DLAA 1F2DA 3CV3A 2VYVD 4BDTA 1BTOA 1WUJS 3BDVA 3TYXA 2E18A 1N8KA 4I2NA 5TF4A 4DSJA 1E3EA 1G8HA 1IN7A 2OQIA 5I4KA 4HLUA 2XZLA 3EF0A 2ZB4A 3LJKA 5LQRA 1WB6A 4WERA 2PSJA 3WMGA 2OAGA 5HDQA 1ZMTA 5J4LA 1FP2A 4L5AA 3O9MA 5ABPA 2YQEA 5TMDA 5F9FA 1X74A 5LDGA 2NM0A 3OZ7A 3ITDA 1C3VA 2SICE 4LFAB 5AM0A 1JR6A 3KHGA 2JJMA 2QR3A 2ZYIA 4NS1A 4WZAA 1U6JA 1CUFA 3LW7A 4FZRA 3DOFA 8ICXA 3BICA 4ZVLA 1H3EA 1T8EA 1BDJA 4BO1A 3R76A 5H7XA 1I9GA 4FDMA 2M32A 4NFLA 2MSKA 3R5SA 4A82A 1T43A 4LBYA 1TPZA 1WVIA 1UQTA 3ZW8A 1ODJA 3V00A 3U4DA 3GB9A 4OHZA 2Q3EA 1VSBA 1DBWA 1NI3A 2J31A 2ZXFA 3KQLA 3QY0A 4E2ZA 2EP5A 1XCMA 3DUFB 3MGCA 2BQ3A 2DWPA 2TMYA 2OYSA 4ASUA 4C08A 3M3PA 1BJRE 2JFBA 3J7TA 3C6KA 3O3MB 1MFZA 1IULA 4R65A 5H1YA 2FKAA 1VHQA 4HLCA 3B6ZA 3JVUA 3MMPA 1MRNA 3E53A 1TJ5A 4BX9C 4GI5A 1Z0IA 5J47A 5SV2A 2B6GA 1XKQA 3UH0A 1NJXA 5AOCA 2IEYA 3EULA 4WKNA 3D8SA 1T4DA 1G8AA 2ZE5A 1HKUA 4NYIR 3QE2A 1XWWA 1KEZA 5J2JA 5I01A 1RRMA 5AUPB 1PK1A 2PLWA 1JDUA 1QK5A 5G0VA 4RIEA 3M6AA 1G63A 4XZ3A 2HBYA 2J33A 4LJLA 1UXGA 1P2BA 4GX1A 1LJ8A 2EERA 4DUZB 3N0WA 2AVDA 1W75A 3VMMA 3KUCA 1D5CA 4WW0A 1GL3A 3TCNA 4LHVA 4O4LB 2I3ZA 5BSMA 4LX8A 2PLFA 1FQJA 4C88A 5C35A 4XJVA 1A8QA 2RG7A 1U31A 1PDOA 4KFCA 3BJRA 1BNOA 4F4IA 4E6EA 3PHJA 3JPTA 3MTBA 3LQQA 1LD3A 5I8WA 2DKZA 5DDMA 5FOSA 2Y4OA 3RGGA 1IBCA 1ZQJA 1W48A 4ARIA 3KUUA 3WRXA 2FY8A 3K9LA 3WWCA 3X1DA 2YS7A 4HAZA 1FQOA 1MIHA 4RNNA 2V3CC 1C41A 1LDBA 2O07A 3LOUA 3OP4A 2EFJA 1T8YA 2NYRA 1O4WA 4CIYA 2GCGA 2I03A 1Q14A 3ZHSA 4BLQA 4WXHA 1JQJC 4DSIA 2OHJA 2EHJA 3UK7A 1JIQA 3P20A 5HJ2A 1PZNA 4JYPA 4GLFA 1RM4A 2J3DA 4D0GA 3E3OA 4J49A 1OXVA 2ATIA 5HHIA 3EIFA 4GOXA 3HJRA 4A1OA 1FYEA 3UV7A 2PUDA 2V3WA 3V1UA 1NONA 5CR0A 4UB6U 5IPFA 2BDPA 2H17A 4C6TB 2NP6A 2OD2A 1GSOA 4F9FA 1KDYA 3L06A 1XI2A 3OZXA 5A9RA 4HBZA 1OB2A 1ULHA 1IZ8A 5K0BA 4FBMA 4PAOA 2DOKA 2I6QA 4QZGA 4EHLA 4D9FA 3R4VA 3HVKA 2BFMA 3TBKA 4FYPA 5FNVA 4Q9KA 1ZIXA 2WF9A 2PPVA 3AHEA 1KS9A 2D1YA 4C8NA 2A4MA 3HDHA 4COKA 1A2KC 1M1YE 1TEZA 1MB9A 1ZS9A 4AUKA 3ABOB 3GCXA 4Z4CA 4K7JA 4POAA 3Q85A 1ZQ1A 2IIVA 1CEQA 5DP1A 1N5LA 4BFSA 5DLQC 2H4XA 1OZAA 1MDFA 7ICRA 2O19A 4ZEXA 2R4TA 4AZ3B 1XK6A 2JBAA 2RHCA 1DOAA 1R6TA 1ABBA 4H59A 2IP1A 2YH2A 3HB0A 1FSGA 5F2NA 2BJWA 5KVCA 3THYB 1ZEJA 4I9GA 1YVUA 2D54A 4RLFA 1P7DA 2PMDA 5CTJA 2EC5A 3L3FX 5FTLA 1DX4A 4CUZA 1R4MB 3S44A 2JVIA 1BRMA 2NO9A 1XZHA 3L5OA 4DUPA 4MPJA 1E3WB 2WVAA 1ZUNA 4JCOA 2V7PA 3ZTTA 4BV2A 4CM9D 2XLCA 1J70A 5JMWA 3OM1A 2KKVA 3HHEA 1FP4A 4TQAA 3LT1A 4L27A 4KLHA 1CQIA 2RAFA 4CCWA 4XDZA 1NVVR 1G7CA 4U02A 1QSLA 2F90A 5AHXA 3G2NA 1Y1PA 1GKKA 1BKYA 1ZUD1 2JL1A 2PG3A 5FWNA 3KEQA 3OHMA 1EINA 2QQ5A 4UTXA 1KAEA 3JPRA 4QDZA 4UDYX 3MZ0A 1PR5A 5HFJA 1ED1A 2W3RA 3H9JA 2IXEA 2VSYA 1Y3IA 4JP2A 2X9NA 1NLMA 4TMZA 3RARA 3AXSA 1L5ZA 5D86A 3DOOA 2R8EA 2WKPA 3MUFA 3MRXA 3DEYX 3PB3A 5C46F 3V34A 5GTHU 3NWBA 5J29A 3GV0A 1II8B 4U2CA 3RTGA 3M9LA 3VR2A 5A03A 4C2BA 5JZVA 2UZ1B 1E1QD 5IZCA 5ITSA 2VFAA 1U0JA 5AMXA 2Q5OA 2V5VA 3K94A 1SIJA 3W0LB 4C0HA 2V7UA 1KKLA 3UWOA 4QGSA 1A0PA 1HTTA 4BNWA 1PUXA 2FFBA 3NT4A 1X7YA 4DRXB 3TW8A 1QYCA 3OP1A 4PG6A 3DQQA 3GNLA 1CX9B 1QM5A 2CLOB 4D9BA 4F2GA 4QASA 2W6MA 3NIWA 2V97A 4L76A 3AT1A 4MDEA 4F5DA 5FUXA 3OIUA 2ZPTX 2X8WA 1OLXB 4HYEA 5KS2A 3AZPA 4IF4A 4JI0B 2AI1A 4ZT2A 4N41A 2Z5LA 4CKWA 1R64A 2C54A 4EO4A 1KFKB 8ICFA 1TK5A 2XCTB 3F46A 3MJVA 1UPHA 2OEHA 1Y3BE 1IRXA 5D3KA 1ZH0A 2PZEA 4B3CA 1KZYC 2B5OA 3PBKA 4BQRA 4R3WA 3RAGA 2WOJA 4KMUA 1EUCA 2J3MA 4FXPA 3K9BA 4LF6B 3H05A 2GD0A 5F3DA 4KE6A 4XGNA 3VBEA 4Q1AA 2ORED 4BGIA 1YE3A 2CNBA 1WO8A 3QVOA 1D7OA 3VZPA 1EDZA 2XYQA 2VRNA 2RBEA 4WZBB 3C2LA 4GXJA 4NCHA 2IDZA 1JR3A 3R44A 1XF9A 2ROQA 5H16A 2XKBA 1VMIA 4OI0A 5CFQA 1ZL2A 4JUFA 4GEGA 2YVLA 1NLUA 2J3QA 2COEA 4IFEA 5BR1A 3ISTA 1GYQA 1C2TA 4XM2A 4KIUA 4EEKA 3LK7A 3C3PA 1U8ZA 5EWMA 2ESEA 3AKDA 2NAPA 2PAFA 2Y93A 3TN7A 1KO7A 3QGMA 3T94A 2C3MA 4LSMA 2DUWA 3ON5A 3EPRA 4MRMB 5E4TA 4XPZA 1ONSA 4GR5A 2EYQA 1FOEB 2PU7A 4ESEA 3FOEC 5LJIA 2QV0A 4ESHA 3ZGZA 4JGBA 3EEFA 4RD0A 1G2PA 5JG7A 2Q3JA 3DO6A 1SUPA 4XWGA 1B3RA 1H8HA 2NV6A 2PM8A 3CVOA 5I9NA 1B42A 4J9MA 2WZCA 3DOEA 1G5PA 4KV9A 3U0BA 3AKEA 4G65A 5KYWB 3QIVA 8ICKA 2ZZMA 2B3DA 4YRPA 5C9ZA 3DD1A 4KFUA 1HYHA 3ONVA 4EJ2A 3VU0A 1ZXLA 3R4CA 4ZZ1A 1SZJG 3A2LA 3ZJTA 5AHRA 3O8LA 1PDWA 5FIUA 3NAZA 3T3IA 4AI6A 2NSHA 4WV3A 3JQ9A 2O1EA 4O2AA 4BNKA 3GQBB 4HPXB 4Y9SA 1UJ6A 3I9V6 4GW3A 1MA3A 1S89A 4LVOA 4XTCS 2DKOA 2ODPA 4LKRA 3AW8A 4D4KA 1MF7A 4RQ3A 5B4VA 4DG8A 5TVGA 3CNBA 5FNZA 4R40A 4EMUA 3RUFA 4B81A 2I8CA 1GRVA 3JQ7B 1DAIA 4H60A 4UUAA 3CVYA 2NNLD 1G4UR 3M2PA 1TLTA 1ZCJA 3NWOA 5T7BA 1KC3A 2O23A 4I14A 4MEYA 1NVWQ 4EZ6A 4L8WB 2G28A 3DBLB 5B1YA 5DI3A 1JKJB 1J2EA 3AY6A 1TK3A 5FJIA 4BFTA 4M9XA 5A5FA 4BWGA 3SKXA 1XWIA 1QTIA 3AFHA 3V1KA 4DIOA 5DX1A 2ZTUA 2C0QA 2D62A 1UM9A 3ANYB 3GD5A 1KQ3A 4XLTA 2BBWA 4F4ZA 3TVTA 2BEWA 4KYIB 2Q3DA 4JLNA 2I4LA 3WGGA 1SG0A 3KZOA 2ISCA 3IT1A 1XQYA 3IJ5A 2XA2A 1IVSA 4ZCMA 3UJ8A 3DHYA 4BAZA 4XH9B 5EIOA 3HR4A 1U0FA 3BGOS 4ECAA 1BCSB 2MSDB 1JTEA 2PWZA 3DOJA 1PK9A 5E79U 2C8VA 4ZCSA 1V97A 4CZ2A 2K4EA 1L5HA 5LQNA 2W48A 3HSKA 1GA6A 4QQFA 1YQGA 3H0MB 3V48A 4US9A 1RYZA 2OC4A 5KFYA 2WHPA 4E7PA 1D5WA 4GKBA 1SV0C 1HZJA 4J3NA 3DHWC 3OJ0A 1LK0A 1T1IA 1JLHA 3ME5A 3U3MA 4TYMA 2WIBA 4N3CA 1IUOA 5LP1A 2ZTVA 4P3XA 3U9LA 1PVDA 1FX0A 2P5UA 4MWTA 3MJEA 1W85A 2A1IA 3ZWVA 2H57A 1BSVA 1X14A 4F85A 1L0BA 3PDJA 4YCMA 5E7JA 3C3AA 2C2RA 4BKOA 4HKTA 1S0OA 3EVAA 3VDRA 5DXFA 2QRQA 2FEKA 1HQKA 1DOZA 3AF4A 2O0JA 4X7MA 2HUNA 3EW9A 2NZWA 5IKMA 3B9RA 3CTMA 3EXHC 4RT2A 4O4HA 3RVKA 4EA8A 1P73A 2ZYDA 3LY9A 5DGDA 1BEZA 2KEYA 2Q45A 4HRYA 1JG2A 3EOBI 5JQWA 1K3FA 2OK7A 2XB9A 1Y5RA 3UCEA 3PUJA 1BS1A 4TV8A 3ZEIA 2XUGA 1M72A 3OLQA 1SBIA 3RYHB 1N5XA 4EJMA 1OY1A 3TTSA 2B9EA 3I1IA 4E5YA 1Z3CA 3OE7A 2JJQA 1ZMOA 3ST7A 4GWLA 5AK0A 1TMKA 3KR1A 3H40A 4TVOA 3RHFA 2ZIEA 3O4VA 2IYZA 4D0NA 2ZWMA 4Z51A 1ECBA 1K7SN 4OK6A 2KV2A 3L9WA 4K9DA 3IE2A 4OQLA 5KNIA 2KSOA 2AK3A 4JJ7A 2KNJA 3LIIA 1IM5A 3GRUA 1SXPA 1DO0A 4M0LA 1ZA2A 5ADWA 2I4MA 2QW1A 4I0WB 1W96A 5PGMA 4BO5A 3DZBA 1VSUA 3W79A 1F3LA 1ZITA 3M6KA 3ZDYB 2C4VA 2IEGA 2ZJ4A 1XP5A 3O8DA 3AWIA 5FUWA 2GGSA 2PGXA 3BMCB 5IKXA 4I4TA 1WDMA 3ADKA 3TACB 2V98A 1C7FA 3U9TA 2BGNA 3O0DA 1G6HA 2JD1A 3GUVA 4NDZA 1FBNA 1ZD5A 5BN4A 4XRHA 1XAGA 1S0UA 4NI5A 5SZHB 5HJ7A 1UP6A 1U3CA 1NY6A 4JSTA 3HNOA 1D8LA 3OHBA 3WYEA 3L7IA 4DQDA 5L45A 2J9GA 4A4DA 3Q9NA 5DKFA 5KNBH 2EOAA 4KLFA 3W05A 1DQZA 4M99A 4K9QA 5JQGF 3A6PC 5AW8A 2NV2B 2QTAA 1F6BA 3EVBA 2I66A 3LQRA 1WS6A 1OBCA 3EW7A 5DRTA 2Q6OA 5HWSA 2F3TA 4OXQA 3ECSA 3FOZA 4DIDA 1TK8A 1NBMD 5BQXA 1XYGA 5CDFA 4X8MA 4KLTA 1JA0A 2P4UA 1T1SA 2I0FA 3UKDA 3RT9A 1C3EA 2Q8NA 1NYLA 5CNIA 4L5IA 1MJGM 1Y4DE 4JI5B 2HJGA 4LZZA 4QGAA 3EB9A 3KTOA 2WZQA 3SICE 5D6NA 5KG3A 5AM5A 3T0FA 3H0KA 4ILKA 2VYNA 3X2FA 1JXLA 1F3OA 1G8JA 3JRWA 1IVYA 1KDHA 3ND5A 4B79A 2PKRA 3K1TA 3P9NA 8ATCA 4E3ZA 4LS3A 3DMFA 4Z3KA 2R0QC 2I34A 5DHQA 5CRXA 3FTCA 4S35A 2PX6A 1M0EA 1A9TA 4JI3B 4CF3A 5K3DA 5KDLA 1F2TA 3GFQA 4R9RA 2ZR7A 4M0FA 3DE7X 4MAMA 3PNQA 5KCMA 3KSRA 3N8GA 4OQFA 5DGBA 2DPXA 1SUAA 5HUJA 2CBXA 4WOBA 2AXEA 2I65A 2QVZX 121PA 2ZBDA 1PX2A 2FB9A 3U13A 2BKLA 4Z5XA 2BGTA 3IFSA 4CYMA 1W0CA 4O6VA 1I0ZA 1G21B 4YC7A 2AW5A 1KVTA 5AW2A 2NO5A 3M6IA 1XMQB 5E4FA 2W2TA 1T3NA 5CVTA 3ZDXB 1SKRA 1JHQA 3SIPA 1OI3A 1XA0A 4EFMA 4C4ZA 3A6LA 2AZDA 3GLQA 2RDMA 3RC3A 2H7CA 5B3LA 2A6PA 3GJTA 5KFFA 4ZU1X 2CL0X 3EIUA 3F4BA 4FOOA 4NRDA 3MTQA 1MC5A 2GZAA 3OECA 2BTOA 4CV3A 1DADA 1OAOA 2J08A 3L1HA 3BB1A 3PLRA 2EIHA 1BXRA 3T7IA 1UDXA 3WGKA 1SQ5A 4C7YA 1IDOA 1X8KA 1HDOA 2BSXA 1Z8DA 2ZDQA 2QE7D 2ZB8A 4KGXA 5AI4A 1KPHA 5LUBA 2YHIB 4B6RA 5FEUA 1KQPA 2PFPA 2HHTA 1T9GR 3NBQA 4XRRA 3EZXA 3STTA 3OJWA 4AJHA 2P91A 2OV4A 3VH2A 3PD0A 1FMJA 4ODIA 2XCUA 1Z6GA 3WGHA 4NYMR 4KIGA 3DAFA 2NXEA 4CTNA 1TAUA 4L6IA 5J63A 3E9NA 4UPDA 2XT6A 5GV8A 1Z4KA 4ZDIA 1PL7A 2Y05A 5FPQA 1G20A 1ZQNA 3CH6A 3NW9A 4GXQA 4P4GA 1IK6A 3G5AA 1EFRA 3MELA 5AW1A 3ZW7A 3T5CA 5ILOA 1DVRA 2QBYB 2LIVA 2VDMB 4CR8A 1F2UA 4LVSA 3COJA 5INTA 3BIXA 5A1TA 2OBFA 2W0MA 1UBKS 2QRZA 2JANA 3I0MA 2QHXA 2V54A 5ALWA 2IU4A 4NMWA 1E98A 3K1AB 1V5EA 1T2DA 1MABA 4ZV9A 4U7JA 5FUBA 4GVPA 4DG5A 1CDDA 1LSOA 4W5RA 4OCZA 4HJXA 3VR0A 1X9WA 3KCQA 3WU2U 1X1AA 5DYGA 1L7OA 3HL4A 2D74A 1Y8CA 2I8LA 3R0QA 2YMPA 1FS5A 2E6KA 3G0OA 1E79D 2XUPA 3LHKA 3OO0A 3RANA 2A2ZA 4U3JB 3I32A 3PFGA 1ACMA 5JS2A 4MFAA 5IYZF 1Z56C 1H0SA 4E11A 3SXUB 4MV7A 5IWAB 5CDHA 2XB6A 4JV2A 1YL5A 4UU0A 4XA5A 1XGKA 2AMVA 4F7WA 2AF4C 2O50A 3IX7A 3GOHA 3V4SA 1M2EA 4WT7A 3UJNA 1NSTA 2JH8A 4PAWA 3G0BA 1ONBA 2VAXA 2EX0A 3PSAA 3FLMA 5IM4A 4RK0A 2EEPA 2QI9F 3FOCA 5IXSA 4BNNA 3EFOA 3EASA 1U0BB 4KNYA 4YJGB 3H1BA 1TCVA 3ANXA 2ENUA 3SYLA 1GNVA 1QRTA 4GICA 5C31A 4LA4A 1UBUS 3VAYA 4NPCA 1QFMA 3WKAA 2O06A 3K96A 3B3GA 3AKYA 3O94A 2XEXA 1QH8B 1EA5A 3ZHYA 2FEWB 2VT3A 3TTXA 3B1WA 1KJYA 4RDIA 2K4HA 1UKYA 4MR8A 1I94B 5D3MA 3KV1A 1KP9A 3TLGB 5JXJA 2C88A 1J49A 3E7PA 3ZVNA 4B3RB 4HWKA 2ADFA 5EIFA 1L3CA 3C29A 5ALRA 1FFYA 4ZT6A 1EE1A 1LVUA 4ZTZB 4PNZA 1BN6A 1QMPA 3UQYS 5B5SA 1DRWA 4I1PA 1IMJA 2WTFA 3ZCXA 3RR7A 3EJWA 3PDHA 4NENA 2YS6A 4GUDA 2EKQA 1YFLA 3T3HA 2F1IA 4I4CA 4DV7B 3VXKA 4CFYA 5KTTA 2CL6X 2VF7A 3K0AB 2P0EA 1GEGA 3FVWA 3HBAA 4YXJA 1T0HB 1K8ZB 4R1PA 2Z9DA 4D1YA 3EZFA 1E2LA 1EXWA 4KXLA 4D8UA 2GSDA 1ESMA 1ZGGA 5KG2A 4NOMA 1IE3A 3HK2A 2PWYA 1T4CB 3QVWA 3X1MA 2PX5A 3UK6A 5FXMA 4NSNA 1RXEA 3EUWA 2H1HA 2O0LA 3EXIA 1KOJA 2F43B 4QW9A 2E4XA 2EP8A 1UJNA 5L40A 2V7BA 3S29A 2XCIA 2GK3A 1FDRA 2WAQF 2KD1A 1K6EA 2R7KA 4Q7MB 2YY7A 1JAXA 1XJCA 3SJBA 2DHQA 1V4NA 2IHJA 1L5OA 2PMCA 2GN8A 4PLCA 1C50A 4DF4A 3G13A 3KYDB 4XM0A 4EW2A 3F8SA 4BXOB 4OHUA 3UW1A 2IK8A 2O8CB 1SU4A 1Y3AA 4R71A 3FPJA 5NLLA 2BMEA 2JG3A 3V9PA 2HRCA 4MUNA 2GWRA 2Y0PA 1SCJA 5J4YA 3F9RA 4Q12A 2Z2JA 2RIRA 2IA6A 5DM4A 3ZV7A 1Z73A 2GKSA 1AKNA 1BPYA 3SF8B 5AOVA 3AL3A 2HSEA 4TZ0A 4UBCA 5TMPA 2WVJA 2VDJA 2XGJA 1ZA1A 3SX0A 2NO4A 3D81A 4UREA 2WSYB 3O92A 1T2EA 2G09A 4J7UA 4MRVA 2PD4A 2HHAA 4FS3A 2XHZA 2JI9A 1AROP 4Y9TA 1Y1RA 1LI5A 4Y2XA 4ZPXA 5GIOE 7ICSA 4PYKA 1XVLA 4DBZA 1AKEA 5B3JA 2QL7A 4O2BF 5I5EA 3DDCA 3WLRA 1KEEB 3Q8QB 4RTKA 4K88A 3EYWA 5CIYA 2JEGA 1CJTC 1UDWA 4MHTA 4OP2A 2QLMA 1ZIPA 2ZYRA 1WG8A 2XO7A 4TTAA 1B73A 4F1JA 4WFIA 2ZIVB 4GM0A 1D2HA 5C37A 2DU8A 3RS9A 3UMYA 3K8YA 1YZVA 2NPFA 5LLDA 4MV0A 4S0XA 4EELA 4EJSC 3DE1X 3AR7A 3NC4A 3C15C 4R83A 5CJ7A 1XRQA 2OOSA 4FEAA 1O54A 3L6UA 1SRQA 4K6KA 4FMPA 1JP7A 1CQXA 4GH5A 3QWFA 1MH9A 3H4BA 1ZO8A 5D4BA 2AV6A 1ADBA 4K1LA 8ICVA 3A4NA 2JLZA 5CP2A 2D0PB 1O0BA 1KSPA 5EUBA 1JI0A 3LVFO 5F1OA 1N7HA 3A0BU 5G4KA 2KICA 2IYEA 2HUPA 3WB0A 4F5NA 3URKA 4W6ZA 3IPLA 4EHJA 1TT5A 2D7DA 2IBTA 2PYIA 4LPKA 4ENWA 4LOHA 4KC0A 5KNDH 4EUNA 4JLUA 4NBSA 4TS4A 2VXYA 4EX7A 3F5AA 1XQ1A 5FLYA 3WO1A 5BURA 4TURA 1XJ5A 3VZBA 4G23A 4B9EA 4EARA 3G6KA 3O82A 2RAPA 2DR2A 2BCEA 3CCCA 5UKDA 2GT1A 1WV0A 4OQMA 1FZTA 5K3EA 2V6GA 3IV7A 4ZHQF 5AFSA 3ROGA 1BA3A 4B6SA 4HDRA 3FMIA 3MSCA 4MUKA 1C9EA 5LC1A 1AK9A 1JDSA 3FKSA 3GXOA 1V7ZA 3T79A 5F2EA 5JZOA 4OOEA 4ZYYA 3RTCA 5IDYA 5BV1A 3FPHA 1JG3A 1E9RA 2DPGA 3VOSA 4EYHB 2HHCA 4Y3UA 4YUVA 4OJLA 3URMA 4MS3A 1CD5A 1PHRA 1XDBA 2I4TA 2Y66A 1ZJMA 3LQ2A 2EJVA 3LGSA 3F2VA 1EFLA 4QREA 4I2EA 3QVGB 3EZ7A 2JIZA 1CUEA 2Q0HA 4FK8A 1G18A 4DNFA 4ZGWA 2FZWA 3DBRB 3RAXA 5IHPA 3HDQA 2BGJA 1SOAA 3KJQA 3NYRA 4I1SA 4ARZA 2C2EA 5EXSA 3UB4A 2XUKA 5EKDA 3OI7A 2ZLBA 1M76A 1ZQVA 4OHRA 1QAOA 1N75A 1LPMA 2X41A 3IA2A 4QG3A 5ADHA 3DBOB 3GMSA 4UNSA 2WPNA 3PCTA 3D3EA 5BOLA 3EDQA 2WMDA 2X3YA 2VEOA 4JJ6A 3KB6A 5DCWA 4O25A 2A8YA 2HHLA 1DL5A 3X1XA 1S4MA 3U5ZB 5HX7A 5KOJB 3GJ6A 1F2VA 3DTVB 1DE0A 821PA 1DTSA 4F60A 3IG8A 1NE2A 2Q0QA 3EBLA 1TM1E 3E48A 4OP1A 2FMKA 1G5QA 3H8MA 1SQFA 3NX4A 3DMDA 1LF5A 2WAYA 3UKOA 5BPHA 4F4YA 3ICXA 4JR2A 1MFPA 5CX1A 5IXYA 5ICGA 4U9UA 1PR3A 1SKUA 3BXGA 1SCQA 2H1FA 3UXYA 4RJKA 2EQBA 3NCHA 4FGJA 4K9PA 4CN9A 2WIFA 4RAOA 4MGIR 2VHQA 3K70B 3AM9A 4QUDA 5B3KA 1NASA 3J81j 1M2GA 2CVFA 4EDHA 5IJ0B 4UHBA 4GLBA 2ZYTX 1JEJA 1U3TA 3FCOA 2CV2A 2IV2X 2NGRA 1NW9B 2AXNA 2Q29A 2QDXA 2MMCA 5CLHA 1Q3HA 2OCLA 4ZCLA 2ARKA 3PKZA 4ECXA 5KAMA 4US0R 1N9KA 1VPLA 3QTLA 2C7GA 3SD7A 4UCWA 1AY0A 1VA4A 2WHQA 4JQOA 3NTUA 2WM8A 1PI3A 4E32A 1UT6A 1VP9A 2FJ0A 3MG9A 3AR2A 4JXXA 2Y1KA 5DG7A 3V6JA 3NTRA 4CKCB 2WJJA 3FTPA 1V4BA 2C2YA 2Y9UA 1XSNA 3L07A 3ROMA 4UZSA 1XNSA 3QPWA 2JK1A 3KPUA 3CZAA 3M6ZA 2BLLA 3LX4A 1KYZA 4KRGA 1JEQB 1P45A 2VRWA 4X54A 3RC2A 1G59A 5TC4A 1MJNA 3FCAA 2J45A 4HYTA 2CFCA 4Q16A 2IXGA 4XUGB 3GROA 3T9CA 4BNZA 1ZM2A 3AMZA 2EFGA 4JUIA 4WY2A 4FR5A 2FUNB 4E1BA 1G2OA 4I1YA 3CBGA 5EUCA 1ZOLA 1NU6A 4UMVA 1SL0A 1VYVA 1FPMA 1K8XB 1M1YB 3DS8A 3IMFA 4PC6A 4DCNA 5AOAA 2DL0A 1FSSA 4HTFB 4ED2A 2OZLA 2WMOB 2VBGA 3PYMA 5FFMA 2X5OA 4CDMA 2D8CA 2L19A 2A3VA 5J0WA 2GBGA 3L43A 2Z58A 3GVHA 5E9QA 3HABA 4KXYA 1X7GA 5KX5B 1WRBA 3MINA 4I28A 1U7WA 2XVTA 2YN4A 4C0SA 2WTUA 1OBOA 1NKSA 4KR7A 1N60A 3INNA 5JPIA 2IVFA 4DREA 4GC9A 1AKWA 1UADA 2JFFA 1AZWA 1UH5A 2G70A 2D3TA 2QXUA 2XVYA 2GBCA 2QK4A 3DE5X 3LOQA 5CA1B 1E0KA 5KBYA 1MX1A 1JI3A 3B7PA 4TWIA 3TRJA 5K3FA 1NZBA 3ZQ4A 1BS9A 1G2IA 5TJHA 3C7DB 3N70A 1GFZA 3ZGVA 1MT3A 3KTAB 1CCWA 2WG1A 1ESZA 4Q3EA 5J3JA 2XXAA 1Q8KA 3GIIA 2EKPA 3FYCA 5ITWA 3E5HA 4MRNA 4X71A 3H75A 2WTXA 5EJAA 5EZ6B 1JIKA 4LK2A 3IHLA 4URFA 2C58A 2W2QA 2V9PA 3R7SA 1LSUA 2EGHA 2HIGA 3F6RA 1J22A 4F46A 1TQ8A 2LNDA 5D1NA 4N9WA 1KQGA 2B5VA 3S1AA 3RS4A 1OXKB 4AFNA 3BOSA 1TEVA 2NVUB 4DYDA 5HF9A 3MRVA 3C8HA 1O6FA 1NXOA 1WB4A 2O8BA 4UB3A 3V8VA 4LDPA 1V41E 4BO7A 1UBEA 2X7HA 3RQIA 3LRPA 1KMNA 3AQ4A 1QVVA 3ZXYA 2ZCUA 1OUMA 2J6UA 4KVFA 5HKAA 4DZRA 1KU6A 1E4EA 4O3NA 3UHOA 4DJJA 3OKFA 2EKZA 3QFRA 4JC0A 3AIIA 1Q0LA 4KDFA 1X9GA 1TTQB 3RODA 3RC8A 1PEKE 4RELA 2O8DA 4UM9B 3V3KA 3FKQA 4GKKB 5KC9A 4GLLA 5FPTA 2IYQA 1FNDA 3CR3C 4J43A 1RAHA 4GAEA 1MN8A 4OJTA 4C4XA 3E0FA 3HJNA 1WP9A 4NYJR 2VK4A 4MSUA 1N5MA 2AMFA 3LP5A 1JHMA 2JIDA 4OSPA 2WWHA 2WT9A 2CCJA 1KAHA 1PNRA 5HS6A 5J43A 1I0LA 2VHEA 9ICIA 3FWPA 3UMBA 1IOLA 1M2VA 4ZGGA 1JJFA 3QKSB 5FO1A 2HA4A 4ZYZA 5DTMA 1Z7BA 4TYPA 3FMOB 1BRTA 4BEJA 3E9QA 2CUKA 4DFMA 1MTZA 1Q16A 4RESA 4V0QA 4JYAB 3AI1A 5GJBA 2PMBA 5DLGA 5CAEB 5LQKA 5B1HA 3OEHD 2J0VA 3HI6A 2OH2A 1R4NA 3AVOA 2V6BA 4B40A 2DYKA 1MQ3A 3JQBC 1OE0A 3LCJA 4AXBA 2VQSA 4TTTS 2XNHA 8ICIA 3EGOA 4JAVC 4KOEC 4L0MA 3HACA 1E7SA 3II6X 1X15A 1QX3A 2FDRA 4KLNA 4YB8A 1SJ9A 4TLMB 2XCLA 3QX3A 3OVMA 4C9BA 3RADC 1QO7A 3CRXA 4NZOA 4S1WA 1C7JA 2D1TA 1PJ2A 3VHXB 2YCBA 2NSLA 4C7MA 3QXXA 5IXJA 2AOUB 3UYKA 3VCBA 4UVDA 4M1MA 1U3UA 4IIXA 4QWWA 2XWJI 6REQA 2Z08A 3ODGA 2CUTA 1U2ZA 2PAAA 3G2IA 1QKKA 5CK5A 4J9RA 2O57A 4P33A 5F52A 1BKSB 1XD2B 1XL1A 3OHPA 1JXAA 4F92B 4RYDA 3UAZA 5LKRA 3QUBA 1EX1A 3AF1A 5F78A 2DBYA 2EF1A 3NBFA 3E1GA 3OX4A 4FNOA 1P2UA 5JFOA 3O1JC 5I7WA 3T1TA 1RKUA 1IOZA 4PG7A 3B52X 3WRWA 4F06A 3RB4A 3DDWA 2KLBA 2OAEA 5HF6A 3E4DA 2ETVA 2E85A 3HKZC 3H1EA 2BF4A 1MNQA 3P52A 3SSOA 3LVVA 4HDQB 1UIRA 4TMFA 3HXMA 3BHIA 3GEEA 1K88A 2ZFUA 3QKUA 3RYIB 3COVA 4QSMA 4B2PA 1U1FA 1PZEA 1YAJA 2AN5A 1OXMA 2UYYA 4X62B 1KK3A 1O6CA 4Y2PA 2R7AA 4O0LA 3OIFA 1Q57A 4G0YA 3TQOA 1YS2X 1E18A 1RWXA 5G53C 1R0YA 2YHAA 1ZWKA 1EAMA 1XMJA 1M6WA 2QL6A 2NUPB 4XWYA 1ZQSA 2OP1A 4P82A 5KT7A 3NASA 2AVNA 4G5FA 3ZY3A 2P7IA 1R5JA 3VPFA 3TVYA 3SSMA 2GERA 3MTAA 4HAWA 5FL3A 4JUAA 4KQEA 4RWZA 4HFNA 4YONB 3T9EA 2WUDA 3GT4A 4A8HA 1OH8A 2IY9A 2BVNA 5AVRA 3DZFA 4A27A 3RB0A 4QICA 1J5EB 3W8FA 1XRNA 2ECOA 3CXRA 1LXCA 3R7AA 2ORVA 2M1ZA 1J8DA 2PEYA 1D8AA 3T5LA 4HQLA 1FDIA 5FYDA 4HAXA 4D6PA 4JL8A 3NH9A 3ANNA 2CE2X 2F59A 3UGQA 4PGHA 2PJRA 3RIHA 4M54A 2AT1A 1X8XA 4G4JA 1F8UA 3TZKA 5H3LA 1EVJA 4INAA 2PRKA 3VNAA 2FRVA 1E5QA 1O96A 1GPUA 2M6RA 3SJUA 9LDBA 2J3IA 4NBWA 4I1VA 4AWBA 4Q0MA 2REBA 1JDVA 3IAAA 1WMEA 4UAJA 2R00A 1OI2A 2MYTA 1T7PA 1ND6A 1GVHA 5BYAA 2R1VA 1GSAA 2QYSA 4S2EA 5K51A 3PXGA 4P4TA 5L1JA 1U4NA 4HK4A 3CGGA 1BMTA 4BZXA 3HXQA 3BHMA 3DKKA 5K8TA 1PJQA 1DZIA 1JQBA 4PSVA 3C1UA 2OSVA 3C16C 4BN4A 2WD7B 4DS4A 2ZIWB 4E2XA 2ZXEA 1E2PA 2O7QA 4UUMA 3U0VA 1QFSA 2ZSKA 1VFNA 4RXUA 4MV3A 1XDZA 3IPYA 2EW8A 3NBKA 2Q0XA 2D00A 1NVEA 4L72A 2JFWA 1AF4A 4U5QA 3RC1A 4U8HA 3QKTA 3D6AA 1X2BA 3E4CA 3JQ8B 3BX1A 3QF4A 5F9NA 1AUPA 1UFOA 1H6DA 3TVDA 1TKAA 4LF7B 3I5AA 1R8XA 4UEKA 1GVNB 2QLLA 3WLAA 1DQPA 1QIMA 5EMLA 1THTA 1MAAA 1E6WA 3ZIDA 3IUYA 2X0FA 2OA0A 2DX7A 2AJTA 7MHTA 4R66A 1BW9B 1B1CA 3BQTA 3C74A 1J2UA 1PJTA 4PC2A 1IHPA 1T35A 3NRBA 5TEWA 4QEKA 3ZWAA 5IEBA 4W1QA 5KFPA 3S1SA 1DDGA 2QI9C 3OOWA 4HYKA 4P4PA 2IUTA 4KQ2A 4TUYA 1WM1A 3L1IA 1K5GA 4UQPA 2ILTA 3CEJA 2AFHA 3VPGA 5IJ9B 3SXPA 5IIJA 1OH5A 5IJWA 2YIJA 3THSA 4DTIA 5HOQA 5IMBA 3H3FA 1K86A 1GZ7A 2RKBA 3IP9A 3RBZA 4FDUA 5LM3A 4WUTA 5JS8A 4OFWA 3EEOA 2FWAA 2O3TA 2J07A 1YK1A 4RKEA 5HR7A 5EZSA 3UGKA 4EG4A 2DUMA 4Q5IA 2CZGA 4I2AA 1RS0A 1YBVA 1U5BA 3L0SA 4M9GA 4MWZA 1V9LA 3HU5A 1J97A 1WMFA 1FFGA 4NQZA 2VDPB 3PYXA 2GHTA 5FX2A 1VCHA 3T06B 2I2CA 4W7HA 4MWGA 5AW4A 4QZIA 4TN5A 2WF7A 3OX2A 5DN6D 1RI4A 4BE7B 1AUXA 2IUYA 5ALDA 1L4UA 4X1YB 1DJPA 4YO7A 2BRUC 4I5FA 3HM2A 2JH9A 4K9MA 1FUIA 4RQ1A 3BQ9A 5CFMA 1OX4A 1E69A 5DDIP 5KC8A 1DRKA 3B5IA 4ZQIA 3LPCA 3GVCA 1DT3A 4RV5A 5J1SB 4EY6A 2QTBA 2QTFA 3ZV3A 1ADYA 4DOAA 3R3SA 4WOCA 4KREA 2I7CA 3E82A 3GLHB 2JGDA 5I8ZA 4CHGA 5CA0F 1Z4NA 1H93A 3HUDA 1USUA 2IYRA 3CLKA 2E0IA 2XTMA 4MCJA 4OKSA 2VJQA 2I2FA 1IXSB 2W9CA 3BD6A 1E63A 3SPXA 2AMJA 1GCOA 4I66A 3G2PA 1AB6A 1QCDA 5DBBA 2FMIA 2V45A 2G67A 4DLAA 2JCSA 4MCIA 1USIA 4B9AA 1RPJA 1FFSA 5LIPA 2H1RA 3FGPA 2WAQC 4ANFA 4CLOB 2C00A 4UE2A 3CC8A 2PQ6A 2JCXA 4KIFA 5IT4A 3T7KA 1SCKA 2JFNA 3AEKA 5FR1A 4EGJA 1N4DA 5CT4A 5GADl 3MWFA 5LKAA 1E3IA 4B35A 3AJDA 1ORHA 4CIVA 4OB7A 3I01M 1EEHA 1TK2A 3HRKA 3KU4A 2WHYA 2FMTA 3ESDA 4JJIA 3FRIA 3QYPA 3CLSC 4P0QA 1RLIA 3OHSX 3AUYA 4YT2A 1TAMA 2O52A 5REQA 5EHNA 1VSVA 4PRYA 3CLHA 3HJAA 3UOAB 1ORWA 3FPCA 1U8TA 4CNBA 2FU5C 1Z4LA 2EGGA 3PFNA 3MR3A 4RQ8A 1DAFA 4E4TA 1B0AA 4LZPA 4CF6A 1IJKA 4OHMA 4BLSA 5KNCD 2RI0A 3H99A 3N3AC 2VUUA 3M4YA 1FC0A 2FXIA 1SB3C 3ZCRA 1Z12A 3DE6X 3I1JA 1Y6FA 3L92A 3W77A 1J6UA 4D3SA 5ICSA 3T0IA 4D5EA 3QEMA 4XFDA 3H9UA 3DR5A 2E5WA 4BNMA 1Y48E 4L6CA 2CVZA 3JATA 1G3QA 5BVGB 2MUTB 5EJGA 2HIAA 3W5BA 4BPRA 4JKOA 4KXFB 1JLSA 4F3CA 3I2YX 2P2DA 5BW4A 1ZQZA 1NFRA 2HMUA 2PT9A 3OQOA 4YCXA 5JIBA 1XA3A 3OA0A 3A6HA 3HG7A 3HO1A 4TZKA 3LX5A 4GF5A 3SWWA 1C3LA 4HLNA 3D8TA 1VHLA 2JASA 2XXBA 1V16B 2V7XA 3FMFA 1VKZA 5IUKC 2JLXA 4MUMA 2H3FA 4Q03A 4QWMA 1D1PA 4LJRA 5ES3A 4QRHA 3LS2A 4F3TA 3C87A 4UBMA 3DV2A 1WCIB 1VDVA 5L3SB 3O8QB 3MYRA 4QZHA 1TO1E 3CUVA 3REGA 3R3JA 5F35A 3RSCA 3BMOB 2ZJBA 4AM8A 2HM7A 1IXZA 1Y7TA 2L42A 4FWBA 2JVKA 1X1CA 2Q4EA 1WUTA 1SC6A 1N3LA 5IFLA 1U2TA 4CKEB 1GZVA 1FVOA 5FUMA 3LG2A 1TECE 2E4VA 2PH1A 3LC2O 2H54A 3OFNA 3TKYA 1EXMA 1T36A 3CVWA 3FLAA 2QP9X 4ZO8A 5M2QA 2RJOA 5LXTA 2PYDA 1SULA 3P4YA 5CCBA 3K3PA 3VKWA 2W42A 1MOQA 5ALVA 3THWB 3OURA 3FBWA 3DZHA 3DLTA 2J32A 2ZM6B 2MDTA 3CX6A 4REQB 1JFFB 3DTVD 3DVRX 1RYEA 3PIRA 4BNXA 2JEJA 3LMKA 1A8HA 2BFPA 2PO5A 4Q21A 1RYDA 2HXGA 3I34X 3H16A 2QVBA 4P2BA 4FYYA 4GBJA 1E3MA 5ALXA 1P9LA 3L93A 1DTWA 2YHBA 5CCXA 4B74A 3G7NA 4KTVE 3UQ2A 5H3CA 2X0KA 4HWOA 4HVLA 3DLIA 4DIKA 1WEKA 1J8FA 1QFXA 1JPUA 4XW2A 2UKDA 3W5JA 1BEUB 2HJVA 4GKJB 4MHVA 3RFTA 3CRVA 3CPJB 1QH1A 2PWPA 5DSXA 4ISBA 3RKUA 2RRDA 1RRCA 2W70A 3KVYA 3E8XA 4RE6A 4M7OA 2K89A 3AVXA 3O73A 2HWWA 5CRIA 4QARA 3R6GA 2YWXA 1V3TA 5HKBA 5CPFA 4GI1A 1XRMA 2ST1A 1NK5A 1RM3A 3MNFA 1L7EA 1EGQA 3RB8A 3TLXA 1NJ8A 3LCRA 3K70D 3CZPA 2FV8A 4OJYA 2BD0A 1PIWA 3QEBZ 1E64A 4XVHA 2QB0A 2EATA 4ZI7F 3PC2A 4FC7A 2HMSA 1YDGA 2ATEA 4ZCRA 4PFJA 2P2LA 2YTZA 3DWGA 2PLRA 5HG0A 2V4UA 4O3PA 4ZAFA 3TGLA 2P6RA 1R00A 4KR6A 5ED0A 1KY5A 2RH4A 1US8B 4OX9B 4NS4A 1N2SA 4ND2A 5HRUA 4IW3B 2GCIA 4TWJA 3UWKA 3GN1A 2WLTA 1P9RA 2PMKA 2E5SA 4YAFA 4RXTA 5GY7A 3LHDA 3AV3A 3OTQA 1BFDA 4BO6A 5KTQA 2VJCA 9ICBA 4L9SA 2ALJA 3LBFA 1K7FB 1BA2A 1ZLYA 3QQPA 4LZJA 2AX3A 3GQCA 1T9CA 4DDKA 2B83A 2B69A 3PEEA 2G04A 3LRXA 2FZCA 2BKAA 1IATA 3NHUA 4GGMX 1O95A 1SZCA 1X1EA 3ZXSA 4FSHA 1B6SA 4KWIA 1P33A 3WADA 4LGCA 1OLUB 2OGTA 4JVLA 1O58A 3U49A 2JGIA 1DEXA 2MMGA 1T13A 1ZH2A 4PNEA 4WKGA 4C04A 5AJZA 1U0EA 4J9QA 2WLSA 1AC5A 4B6EA 4L78A 2XT9A 3UJAA 1Q17A 2YV4A 4ID9A 5THQA 2P69A 5AWFC 2A1TR 3GLHE 1KFBB 4B48A 1NK0A 5CB0A 1G9TA 2V65A 1NJ5A 4EHNA 2WF5A 3DDSA 4DV2B 4DIUA 2A9VA 4X8OA 1SCUA 2FUCA 4KTTE 1LUAA 4MDHA 1KOLA 2C97A 1UWLA 2I1QA 1ZPDA 1VBFA 2CY0A 3SGLA 1Y5LA 4GRIA 3ANSA 2P2ZA 5AUOB 4BX8A 4L5CA 3D5QA 4D3DA 5B1EA 4OG2A 4GPEA 1SVSA 1KETA 3A3NA 1KJ9A 4EGSA 2G36A 2XNKA 2IUUA 4S1OA 4MI1A 4M6WB 5LYYA 4RHEA 1AMNA 2BGKA 1NLFA 4FYVA 5L9XA 2XE4A 3CLVA 3I4LA 3D0OA 4BFZA 2XGMA 5HM8A 3U09A 4I2CA 3RWMB 2A88A 4OB8A 4BVFA 3ESCA 1TFUA 4A6XA 1P4HA 5LYJB 2QROA 4DWIA 3NEAA 5I9SA 3R3UA 1VCOA 3T5AA 1N1MA 3A6ZA 3A1NA 1GRNA 3BF8A 1GNPA 9ICEA 1L7MA 2P9ZA 1EVIA 4FFBB 5LMZA 3HKZF 4UBLA 3IAM6 4G4IA 1H5QA 1X6IA 3JD4A 4ELUA 1H4TA 1EM6A 4G01B 1C7RA 3QU9A 2Y2VA 3T1HB 1ZQYA 1PGNA 5EHGA 4UTRA 1ZVQA 3TD9A 4MAAA 2BSQA 1ISJA 3ANMA 3VH3A 2P90A 4LAFA 5TV2A 5EWGA 3WK6A 3X1JA 4LSZA 9ICWA 4HUQA 4KXUA 2JRCA 1PU2A 1RP7A 4KO4S 2GBLC 3T9AA 4UMFA 4X6YA 1KBZA 1YR8A 3QG5A 1KP2A 5H4GA 5HUQA 2YV2A 2JDID 2K4PA 4PGGA 2HHUA 3VPDA 4ZT3A 3TZEA 5M34A 4D43A 2OP0A 2QRNA 3RVPA 2VA8A 4HB4A 3PHGA 4UM9D 2FPWA 1GV0A 1CY2A 5IBRA 4CMHA 1USGA 3MS4A 2ZS7A 1S8NA 4LZOA 2EZTA 4QWBA 2DF8A 3TI0A 4D0RA 4KLCA 2VF8A 1NWCA 1CDZA 2BCQA 3OJCA 4M9SA 1XSLA 3AHFA 3WBFA 4EF4A 3Q0EA 2GM3A 1KN5A 3MLBA 1OIXA 2HRZA 2NZXA 3JSAA 5A5GA 3Q7TA 3KZNA 5F3WB 2YRFA 4L8YA 3U7QB 4UW9A 3G8DA 3VR5D 3W1VA 1UBLS 1R0XA 1DXHA 3N8HA 3ZD6A 5BUQA 1FX1A 2OWEA 1O89A 5K0GA 1CYDA 4HADA 4HOYA 4V24A 1SKAA 1N5RA 2HU7A 1LS1A 3UXEA 2J7PA 4PBSA 4MP3A 4CMIA 1UMKA 3T3DA 4WGFA 2NZYA 5BMOA 5JLAA 3F5FA 4J9LA 4BTVA 2CT8A 3GLUA 2Q0SA 4ENVA 3THRA 2BQRA 5F1KA 3VR4A 3EEIA 4YAJA 3ZK7A 3AEUB 4JGIA 2GPAA 3TDNA 3D2LA 3U3KA 1HWYA 1TVCA 3VNRA 3KKAA 3FB4A 1A4XA 2FLLA 1H1LB 1SHLA 3AVVA 1ZZGA 3GGSA 4CV0A 1GPLA 3KQMA 1MN6A 2PT5A 4BQPA 3GJ7A 2B6HA 3QEAZ 4B4DA 4B4KA 2NYVA 1NMYA 1DDIA 2NIPA 4H2DA 5TPZD 5KSWB 3TQ1A 1WU8A 4E15A 2QUJA 1ECPA 1RHMA 4GKVA 3UT5A 3DUWA 3RAPR 5FADA 3HJCA 1QLHA 4DSTA 1Y8QA 4LZWA 4R3NA 3EK2A 2J3HA 5C5JA 5F21A 1ZQGA 3DEKA 1DTEA 3L8DA 1A9SA 3NIFB 3KTDA 1U1DA 2VH5R 3V97A 4JZYA 2Y1FA 1CUBA 1QS0B 4PF1A 1FNBA 3BXOA 2JZNA 2P2CA 1FNSA 3M70A 3CKMA 3K6SA 1HL7A 2W8ZA 2AH5A 3KJNA 2XRFA 3IG5A 8ICYA 1T8RA 1XWLA 1SUBA 4CKXA 2AEMA 1X1SA 2I2AA 1E2GA 2QTLA 2V6JA 2H5IA 1NKBA 1KL9A 4HLDA 3D4LA 5KMGA 2PMZC 4PWZA 3PWTA 4KLUA 4AMUA 3REQB 4N49A 2A33A 2X9GA 5JC8A 1YBFA 2QYHA 2JARA 3AYZB 1OWMA 3Q8XB 2WWWA 2O8EB 3ESAA 4MB6A 3ZBUA 5CIQA 3PFKA 3VR3A 4IH1A 5ALGA 1VFPA 7ICPA 4DRYA 4HX9A 4JJ8A 3RVNA 1QV7A 2J9XB 1URPA 3ZS8A 3KXKA 4QXMA 4RQTA 3FWYA 2I67A 3W6OA 4M38A 3AERB 2KG5A 5J2KA 1DBIA 2XVXA 5B53A 1QHNA 2W9BB 1KK2A 3GR6A 1Z1VA 3GYBA 1AHNA 4F97A 2F76X 1QPGA 3M81A 4TSFD 4UB2A 4WXYB 4DHWA 1J0EA 1C5KA 1ZQRA 1SU8A 2HW3A 5TE9A 1HEYA 3CE9A 3RYCB 4W9NA 3WNBA 2I5HA 2EJUA 4M76B 2II6A 3PXAA 5BQFA 5JFTA 4JFAA 4O3RA 2YWRA 2OBMA 3PPWA 5DNVA 1K8YB 2DPIA 2Y1XA 1BHQ1 1U0SY 1VL2A 3NKVA 3QEKA 3G8BA 4DS5A 4FFSA 3M5DA 3N76A 3RFFA 3OC6A 1G16A 2IZ5A 3V4RA 1IN5A 4K8OA 1Z4QA 2RGGA 2BPOA 3QVTA 3VR4H 1WXFA 3EOAI 2G5TA 1B8UA 1KK0A 2MWMA 2QY6A 4N12A 4MPPA 1CUHA 3OSPA 3ICOA 3AJ8A 1KRPA 3KKMA 2YOGA 1U1IA 2GCOA 1HT1E 4GPBA 1E8DA 3JARA 2M0NA 2OLEA 1Z5OA 1A98A 3N2IA 1HNZB 4ZGBA 5EI5A 2PQMA 1J2YA 1USKA 4MHOA 5JJCA 5L4LA 4PGXA 1ENOA 5LL6P 3D0QA 4IMIB 4N03A 1GU0A 5EJ4A 3AKZA 2YTUA 2PR2A 3E2IA 4FYHA 4MWSA 1TEHA 4Q3KA 1IONA 3B2NA 2R8RA 2B30A 1Z6ZA 2CMGA 4J16A 5J0QA 2EGUA 4GDMA 4ND6A 3FSGA 5F5XA 3BQ1A 4RADA 1YMVA 2ZSIA 3PX3A 1KTIA 4A0FA 1E3JA 1NJFA 5BXYA