3U26A

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords PF00702 domain protein
total genus 85
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3u26A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3u26A01
2WF8A 4MUMA 4OCZA 1Q92A 1WVIA 5ALJA 1QQ5A 2IYEA 5ALKA 1T9ZA 1U2SA 2WFAA 3R4CA 2HF2A 1ZD4A 1VJRA 5ALOA 4C4TA 3OTQA 2G08A 2QLTA 3FPBA 2FUCA 2B8JA 2BDUA 1U7PA 3RF6A 3AR4A 3I6BA 2NO4A 2B30A 4YCMA 3E84A 5ALYA 2ZBFA 3PCTA 1F5SA 3OCVA 4KNVA 3A1CA 4UMDA 1VJ5A 3FM9A 2YJ5A 4HGNA 3UMBA 3QU4A 4G9BA 2YFYA 3M1YA 3KC2A 3PGVA 2I7DA 3ZTYA 3L0YA 5ALZA 5AW7A 4UMVA 3E58A 3M9LA 3CNHA 2R8ZA 2OA0A 2MSNA 4UASA 1Z5GA 5AKZA 2G07A 1Z88A 3NALA 4CE6A 4JB3A 4KYTA 1VFPA 3WGVA 4BX0A 4Y3UA 2X4DA 3NIWA 3U7HB 3UMGA 2WF6A 3IRUA 1Z4LA 1XPJA 3L7YA 5AW1A 3U7GA 4EEKA 4EELA 3L8EA 3UM9A 3L0CA 5AW5A 1YMQA 3AR7A 4Y2UA 5AIAA 3KBBA 3ZUPA 3KDPA 2B82A 3KD3A 4UW9A 3W5AA 5ALSA 1RLMA 2IOFA 5AKIA 3QX7A 4C4RA 3DAOA 4UM5A 5ALLA 5AW3A 5AVSA 2RB5A 3QNMA 2C8KA 1N9KA 5AK3A 2WM8A 2I54A 3ZVLA 2YMLA 3TLMA 4IG4A 4Y2TA 3B8EA 4BX3A 3AR2A 3KZXA 1RLTA 5ALPA 4YGYA 1RPZA 1ZRNA 2R8EA 3N07A 3I1YA 1QQ6A 2ZG6A 5AM0A 2YBDA 1FEZA 1WR8A 5AKYA 2GFHA 4Y2YA 1S8OA 1NNLA 1ZD5A 4KX5A 2YJ6A 3L5KA 3EF0A 2YY6A 3FGOA 5AW6A 2I34A 1YDFA 4XE5A 5AW2A 2C88A 2EARA 2CFSA 3PDWA 4DCCA 1RKVA 2G80A 3QGMA 2O2XA 1WZCA 3SF0A 3W5CA 3IJ5A 3OCWA 1L8OA 1Z4JA 2MU1A 1YJ5A 3L8HA 5AKXA 4CF3A 5T41A 3OCUA 3U7EB 1RMQA 1XVIA 5ALGA 4J2TA 2AH5A 4HGOA 1SWVA 5ALXA 2RARA 2OM6A 1CQZA 1QYIA 1SWWA 3S6JA 5ALDA 3IB6A 2JAUA 1EK1A 1O08A 3QUCA 2R8XA 4I9FA 2FPUA 2B0CA 2CFRA 2FEAA 3ZVNA 3QU9A 4BNDA 2Q4TA 1YV9A 2W4MA 3SHQA 2FPRA 2WHEA 3ZU6A 1N8NA 3PGLA 3OCXA 2JAWA 5ALWA 5ALUA 2WF5A 2P69A 5A3SA 4HGRA 5AESA 5IS2A 1WPGA 1NF2A 5AVUA 4DWOA 4YCNA 2YJ4A 4NWIA 3WKCA 3J7TA 1U7OA 5AW9A 5AKLA 3B9RA 2B1RA 3K1ZA 3QU2A 3ED5A 4CF5A 4RETA 1RKUA 3FPSA 4HYTA 2ODAA 4EX6A 2YMPA 1L7PA 2AGVA 2FPXA 3ZVMA 1ZS9A 3WKBA 2HO4A 2YN4A 2I55A 5JJBA 2P11A 5AM2A 2EAUA 2B1QA 1U2TA 2FUEA 1U02A 5A3QA 2YJ3A 4B6JA 4FE3A 3WK8A 1RRCA 4L6AA 1T5SA 5AI0A 5AKHA 2EATA 4UAUA 3NRJA 1XP5A 2WF7A 4AS3A 3QU7A 5ALVA 2VKQA 2PR7A 2HCFA 4EZEA 5IT4A 4ZEVA 3A3YA 3WK4A 3QXGA 4ZEXA 3QU5A 3DV9A 4YCLA 3NAMA 3FZQA 3L1VA 4YIHA 5AK4A 4Y2XA 5AIBA 1Z4MA 5AVVA 2C8LA 5AI6A 1RMYA 4DFDA 2B8EA 2GHQA 3L8GA 4YIKA 4ZEWA 4AP9A 3F9RA 2JGAA 3SD7A 5AVTA 1KYTA 2IOFK 1ZJJA 4KX3A 5AI8A 3ESQA 4MWOA 4NFLA 3L0BA 1NRWA 1YNSA 4HGQA 3U7FB 3QUBA 3MC1A 3ESRA 2ZBGA 3BA6A 3MPOA 1RMTA 3P96A 2YMQA 5AM3A 2JAOA 5AI5A 3SKYA 1CR6A 2FI1A 2P9JA 3N28A 5ALIA 1EK2A 1Q91A 5AW8A 2NYVA 2YMMA 4QQFA 2MU2A 2DQSA 3ZW7A 5ALHA 1K1EA 1LTQA 1TE2A 4J03A 1L7OA 3U13A 3WK6A 3ONNA 2G1AA 1RQNA 2RBKA 3WGUA 4NV0A 2PKEA 1TJ5A 3N5KA 4AS2A 3WKEA 1L7MA 5AVQA 2ZOSA 3R9KA 1TJ4A 2HHLA 2FDRA 3D6JA 3L8FA 3ET4A 5AKEA 2JARA 5AW0A 3QUTA 3SMVA 4DW8A 1TJ3A 3WK5A 1PW5A 3DDHA 1X42A 4Y2PA 1RQLA 2HF7A 4BEVA 5AKKA 5AK5A 4XQ0A 4UU1A 2P27A 1QQ7A 3QUQA 2GO7A 5E0OA 3OPXA 4I9GA 4F71A 2W43A 4UAVA 5ALMA 1L8LA 3EF1A 5ALQA 4Y2QA 5AVWA 3I76A 4NABA 3W5BA 5AKGA 1SU4A 4NAVA 2GHTA 2HEGA 5AM1A 3I28A 2FPWA 4JDPA 4E88A 5AVYA 2W11A 2G0AA 2Q5EA 5ALRA 4BYGA 3DNPA 3EWIA 4PNHA 4UATA 4IFTA 3CZ4A 3KOOA 3AR5A 4FYPA 4GIBA 2BDEA 1QH9A 4HAIA 3QYPA 3RFUA 3VAYA 4Y2JA 4BKMA 4YH1A 3NASA 3ET5A 5AVRA 2OYCA 4Y2VA 2CFTA 4FFDA 2CN1A 1ZRMA 3AR6A 4OHFA 3ZTWA 2Q4RA 4UMEA 1LVHA 2BY4A 2RAVA 3WKAA 2G06A 4KN8A 3AR9A 4EX7A 3E8MA 4UM7A 2HI0A 4OD0A 5AI4A 1AQ6A 4UARA 4BNDB 3BWVA 1J97A 3WKDA 1YS9A 1ZOLA 2NO5A 2HX1A 2C9MA 1Y8AA 3EPRA 2O9JA 1Z4NA 2AMYA 1O03A 5AI9A 3W5DA 4UU0A 2G09A 3OCZA 2QYHA 3AR3A 4H1WA 2I6XA 3E81A 2GMWA 3ZX4A 5AM4A 4KNWA 2ZXEA 4BBJA 2HDOA 1RKQA 1Z4IA 4O8CA 5AKJA 3A1EA 4QJBA 4XPZA 3GYGA 4EENA 5AK6A 1JUDA 4L6CA 2IOHA 3A1DA 5AW4A 4UMFA 2D2VA 5ALNA 4CF4A 1Z4QA 4G63A 2HSZA 3HYCA 1L7NA 2AUTA 2I33A 3NANA 4XOUA 5AVXA 1MH9A 5IT0A 2HOQA 1TA0A 1Z4PX 2R8YA 3UMCA 1Z5UA 3R09A 4Y2SA 4BX2A 5AICA 5A3RA 3B9BA 3FVVA 5ALTA 3U19A 2FPSA 4RESA 1RLOA 3QLEA 5ALFA 1ZD2P 3MN1A 3WK7A 3SKXA 3SLRA 2OBBA 1T5TA 3HLTA 1L6RA 1IWOA 3ZI4A 3NUQA 3N8GA 1Z4OA 3ZWKA 4BEWA 5AM5A 3MMZA 3ZWDA 2WF9A 1J8DA 4HGPA 4F72A 3N1UA 1S2OA 3ZX5A 1ZD3A 4C4SA 2PQ0A 4GXTA 2ZBEA 5AVZA 3L1UA 4CNQA 1RDFA 1RC8A 4L57A 3OCYA 2ZBDA 5FP0A 3WK9A 1Z4KA 3U26A 5ALEA 5AHXA 2IA5A 2C4NA 4OFZA 3AR8A 4Y2RA
chains in the Genus database with same CATH superfamily
1V1JA 1AHNA 3KXDA 4M1MA 2JIRA 4ECYA 3OTOB 4B9MA 4FBTA 1HLGA 1V71A 4PCLA 5ALJA 3SZRA 1FLDA 1G6OA 2QENA 3WL3A 4IDAA 1QQ5A 4Q1DA 1J7KA 2BBWA 1KVRA 1Q1ZA 4MRNA 1DL5A 1HYQA 1T9ZA 3R4CA 3Q87B 1YB5A 2QTVA 3K6KA 4R7GA 4NH0A 3HKEA 1GTG1 3RYHB 3P2JA 1K7SN 1Y4DE 4EDHA 3QEMA 1GZDA 1CI4A 1XU4A 1T4BA 2AOVA 1QYWA 3GQBA 1U5AA 4AJEA 3ESDA 1H0HA 4Z0PA 1ENYA 2XWBF 2W7TA 3QMMA 3HN6A 4NAUA 3RVKA 4DLSA 2ZYTX 3R5FA 2HBMA 4DQLA 2PFQA 5ITSA 4EF5A 3H2GA 5EXSA 2GJSA 5IULC 4JB0A 1A5SB 3HW8A 3C3BA 2GM4A 3WTCA 1G17A 4OHMA 2DPMA 2IEZA 3HWWA 4J0DA 1COOA 4L95C 1DDGA 4E31A 1Y3HA 1K5PA 2VDRB 3PGVA 3PUJA 4KMSA 2ZJ5A 1KSGA 1N32B 2JVKA 3M4XA 2WMNB 5EJMA 2XRZA 1HDZA 3CF0A 4XYMA 1WXEA 1XLWA 5EJ6A 4CKZA 1FJXA 1HDYA 1A6SA 3IHKA 3M9WA 4ISBA 3MYRA 4IIHA 4BP8A 4BNGA 3FRJA 5CA7A 2XOKA 4YAEA 2XQIA 3E9MA 3T0IA 3V6MA 2GOLA 1ZA1A 2DUJA 4UTRA 1AKEA 4CIAA 3AKCA 1CDZA 2QN6A 1C2YA 2QBYB 4ABTA 5IRCD 2WC1A 3IDSA 4XZ3A 4G4SP 3FDIA 3MG9A 1VSQA 1YDWA 2EFGA 4WY2A 3EG9A 1GZHB 1QDEA 3QY9A 3HCDA 4YP5A 2XGOA 4KR0A 2NRVA 4RJ2A 3TRDA 2XCRB 4WKOA 1ZR4A 5I45A 1F12A 3QZ7A 4I8XA 1D6MA 5ECDA 2H1WA 4LEIA 4ZGBA 1Q57A 5DU2A 1GWNA 3WDLA 5HX7A 5BXYA 1QFJA 3HP4A 1Q1QA 2F4NA 5KFZA 3B6KA 4JVLA 2GD6A 2DQNB 1BW9A 1KTVA 1WQ1R 2Q5JA 2XUFA 1B3BA 3PV0A 2DVMA 4ZCSA 3OSNA 4X8HA 4BJ1A 4UAYA 4EB8A 4NXMB 4Y18A 3EDRA 5TQ0A 1NUPA 4F93B 4Q24A 3ITKA 2FEMA 3JZAA 5KFNA 2NSJA 3SF8B 1RLMA 2A5LA 3PP8A 4CGYA 4OUDB 4HO1X 5DHAA 2BCVA 4MVYA 1JPNA 4C4RA 1KJWA 1W4CA 2NRZA 1LPOA 1KZ9A 1T1IA 1WCYA 3LQKA 1N2CA 1N9KA 4YUAA 2CVOA 5G40A 2WM8A 4JFRA 4KODA 1J1IA 1SU7A 4MOWA 3SNHA 3UN1A 1XXLA 1XPRA 4K4HA 3DOIA 4BX3A 1DG9A 1SBQA 1NZBA 3NW9A 3PFGA 4KAFA 4F4YA 2VPTA 5F7ZA 4MZDA 6YASA 4DGSA 1RADA 1W25A 3LT0A 3GLFA 3NETA 2ZIZA 4PSUA 3Q2OA 1L3BA 3AV0B 5D3QA 3E9YA 1HOXA 2CNDA 2R8EA 4YCDA 3TOZA 4UTPA 1YS4A 5BN4B 1RHJA 2A5DA 3K72B 5EQDA 2BEVA 3WSTA 4CKBB 1C0PA 1WR8A 5EZYA 1ZICA 4MV4A 4F8EA 2HOFA 4FONA 3VH3A 4S0XA 2G04A 1SIUA 4WFJA 3DA8A 2AHOB 1K88A 1X9HA 2FSSA 3RTAA 4Z1MD 6REQB 1PIWA 3WYNA 1H8HA 1AURA 5B4TA 1JHYA 4EUHA 2I1QA 3JVIA 4MGEA 2DKFA 1NJSA 1OMOA 3KYIB 4PO1A 2E0IA 1A9QA 2YWGA 3IQFA 5DP2A 4D9EA 2D8AA 3V55A 1W44A 2CSUA 3FTQA 4J9KA 3QSGA 3JVUA 1M54A 1SXJA 5CU7A 2ID8A 4WZBA 5BOMA 2RGRA 1U1CA 4G0PA 4RU1A 3JPRA 1Z06A 1DOAA 4L22A 3HPQA 3UFXA 4DO9A 5CX1A 1YRAA 3T7DA 1JFTA 1QO0A 2W8BA 2VNHA 4MGZR 4B2PA 3Q0EA 1G5RA 2IXDA 4D43A 4IJKA 2HWWA 4J7CA 2HLPA 4AKGA 3MWDB 1QFZA 2W6OA 2G17A 1JIVA 2R62A 3CIFA 4MA5A 2Q3CA 3C6BA 3KAKA 1PK1A 1FRVA 4G97A 2I3ZA 1E8NA 4FJ2A 4NZYA 4U02A 4Z5XA 4PLWA 1SHJA 4MR8B 2R8GA 2BI8A 3D81A 4RZUA 1QYIA 1MV8A 2XJ4A 2WQZA 2C4MA 1WHTA 1OX4A 4O5AA 4OAPA 2DKZA 3PENA 1OU0A 3OP4A 4ND1A 5EMNA 2DPIA 2R8KA 2YWRA 4JP2A 1FP7A 1KHHA 1VE9A 1JN0A 1NM5A 1N0VC 2C4HA 2QPLA 3N58A 4QXMA 4GZ5A 4BVEA 3G9QA 4OUKX 1MJFA 4KLGA 1N48A 1W2HA 3GVPA 4ALMA 2WYOA 1H9CA 2B0CA 5CNJA 4C9BA 3HR8A 2P8SA 4ER5A 2GLUA 4PAMA 4ESVA 3ZVNA 2V4ZA 3CIOA 1KIAA 4QKQA 4FOPA 3I8XA 2G0NA 3FKSD 7ICPA 3AFGA 4QQRA 2OO5A 3A8TA 2DC1A 1KJ9A 2FLVA 3PIIA 4LNUA 5J40A 4S1NA 4LZLA 4XGIA 5KTPA 2QVCA 2BM1A 3AOGA 1CS0A 4XUCA 5DGIA 4BRUA 2EGGA 1N2GA 2OFFA 4BAUA 2Q45A 3NFRA 3PPVA 5AXBA 4I2NA 3HWSA 5T3YA 3SEAA 4A2PA 2VATA 3JU3A 4DSZA 3BJIC 1Z56C 2QP4A 3HXKA 4LV8B 2HHSA 1LJLA 2MCFA 2HMTA 3CEJA 4TWBA 5FX2A 3O0FA 1YIOA 2HMVA 2P1RA 4Z4GA 2Q9BA 3OQJA 2BGUA 1ZR2A 3QNWA 4OXIA 4MEAA 4MUJA 1SCIA 1QGED 3RKRA 4D42A 3RJGA 3D0KA 4MVJD 4JV0A 4ZO7A 4JKOA 3WRWA 3K1ZA 3KM0A 4TSKA 2ENWA 3L0IB 3QBJA 5KT6A 2PO5A 4FYJA 1I6MA 3ED5A 1Y9ZA 2HXSA 4RETA 5J2UB 1N75A 1W36D 4YV7A 5HKOA 3FCSB 1HEKA 3SZGA 2PEZA 1EM8B 2VXYA 3AILA 4IVRA 1OT3A 3D7LA 2Q6VA 1FJ2A 4MQUA 1BXRA 2LW7A 4TPKA 4WECA 5FPYA 2NRXA 3HS3A 1HT0A 3HCNA 4YAGA 3TS1A 3DV0B 1TZJA 1V7PC 5HJ7A 1ZIPA 3FNIA 1W8DA 4N7BA 2X0FA 1AKNA 2EHDA 2R8BA 3A2LA 3D7MA 3I23A 2Q1WA 5CVVA 3RV4A 4BLQA 1X2BA 1DV2A 3KQUA 1JXLA 3GEDA 3PQDA 5E8RA 3M5DA 4H0NA 5GV7A 1QHNA 2UXDB 3EBPA 5IYZB 1KQOA 4KLIA 4AZSA 3HA2A 3DLBA 4Q3OA 1M72A 5DGXA 3MRSA 2E82A 2O6LA 1E8DA 3V97A 4ETMA 5FPHA 3SDZA 5IVPA 2J31A 1SM4A 4YC7A 3RSLA 4ZT6A 3IAS6 5KYWB 5L7YA 5IAKA 5J4HA 3SYLA 1CZLA 1E89A 3FPCA 4M47A 1G9XA 2IP4A 1SU8A 2IXGA 3GOQA 3NBAA 5CPBA 5CT5A 1YT3A 2OB2A 4NS4A 1X9WA 5D8DA 1AT1A 1NJ5A 2E8OA 2DBVO 4O8ZA 4B3XA 5IM4A 2JKYA 1QBGA 3ZZ1A 1B76A 1AGRA 4C20A 3ETRA 3P9YA 5T8KC 3LQFA 2P7HA 2CJFA 5CLQA 2C54A 8ABPA 1VHWA 1R4MB 4X7BA 2PKQP 1NY6A 2F17A 2I4LA 3FZQA 5AK4A 4DSLA 1V5FA 2L42A 3OP1A 4MRMA 4E0DA 2XVZA 2D06A 5E4JA 4WUVA 1R66A 1FFWA 3WXMA 3FETA 2V6IA 4KWHA 1WDWB 2Q4DA 1N6IA 1T8TA 2IYWA 3I3OA 4F84A 1DZIA 4KDFA 5HA5A 1ADYA 2NU8A 3T9BA 1GKKA 3WYEA 4ZICA 2BSQA 1ZQ1C 2E1FA 3F9RA 2ZRIA 1EWKA 1MOPA 3MINB 3N8IA 4DSUA 4ZHQB 1GA1A 1XNHA 3ZD8A 2BTQB 4Q6WA 1G3MA 4P0QA 1C8BA 1DQPA 1U3GA 5DIZA 9ICVA 4ZVNA 3SLKA 3ROGA 3GD7A 4Q4CA 1E6MA 3MJSA 2R7AA 1MORA 1T36B 1WB6A 1XRNA 2FK8A 3U3DA 3UCFA 3U4QB 4NM2A 5L4SA 3MUNA 5KG4A 1LBQA 3LV8A 3MDCA 5THXA 3OIWA 4LMAA 3D2AA 3EFOB 3WL8A 1C5KA 2PA0A 2XE6A 3VYSB 4HNGA 5HM8A 1HFJA 4Z51A 1VGVA 1Q6ZA 4YMNA 1S10A 1CY7A 1XCLA 1GM5A 1JLHA 3Q88A 1CS4C 2DTXA 2GM3A 2WU8A 3CTMA 3R3YA 4PZPA 4YG2A 1P1RA 4DF8A 1JS1X 1V43A 1JAIA 2PMKA 2Q5CA 3EQ8A 2YUIA 1XZNA 3NGXA 1SOAA 3CGGA 3NNSA 5KTOA 1WZEA 2JAOA 1DRUA 3DGEC 3L6UA 4QJ5A 3SMQA 5EHXA 3MABA 2AK3A 2YQZA 5ESWA 1YOVA 5FJJA 3KQNA 1O6FA 1RW4A 3F6SA 4MV7A 2VYNA 3W79A 5ALIA 1A7UA 1I32A 2D0IA 2JFZA 3NB0A 4XOIA 5IDQA 1BJTA 1Z6PA 1T9KA 2WG2A 2XCLA 5KT5A 2GASA 3M83A 4QYXA 1JRPA 4AZTA 3UMFA 5JWHA 2A9QA 1AMUA 4JSYA 3THYA 2CXRA 3O3MB 3TO5A 2G82A 5TLSA 3LG2A 3GLHB 1ES9A 3L4KA 4NV0A 2DX7A 4BLTA 1U49A 1R7RA 1NTRA 1TJ5A 2EFJA 4PFSA 1NBWB 1E7RA 4EFNA 3KHHA 2G5CA 4HUJA 1EVLA 4K3UA 5DEOA 3BIOA 1G19A 4NF2A 4LECA 5DTEA 2W9BA 3PFWO 3FMPB 1ID1A 1EB9A 3CEMA 4BKRA 3RUCA 2NU7A 3D6JA 4P3XA 2QW0X 2IY7A 4RDXA 1J21A 4WZZA 3QUTA 4Z9YA 4M89A 1JFFB 1QIDA 4U00A 4EJSB 1H2EA 1P7YA 2C5FA 2YFKA 4RVNA 4QEDA 5ECWA 4E15A 3SWWA 4HDMB 2Z1NA 3H1AA 2FRXA 3BSYA 4M83A 4L6IA 4YQEA 5LXTF 1BE0A 4Y2PA 1NVMB 4WKBA 3I45A 4BCCA 1LB1B 2HZ7A 4AY5A 2WVGA 3CNEA 5AK5A 1FDOA 3S55A 1NKSA 4LBYA 5A03A 1G5HA 2AW3A 2FFAA 1MG5A 4NLNA 3HFGA 5E3IA 1YF3A 4EIWA 1EFDN 1JI3A 4NULA 3S81A 1QQAA 4I55F 2VCYA 1HNWB 3TI7A 2GF0A 1U1GA 2G40A 3D02A 3RH6A 1YO6A 3GF4A 3HYRA 5PGMA 3KHRA 2B9VA 5LDHA 4DF4A 5F9LA 1QK4A 1T94A 1VJGA 4HG2A 5BYAA 2RHTA 1C2TA 3WZ2A 3AUKA 1XRLA 1P9RA 1B2RA 2H4YA 3LVFO 4E5VA 1ZW1A 1JIXA 2H4WA 3ENVA 3QV2A 4FFLA 4GKKB 5KYTA 1GJRA 3PUZA 1QMGA 2CE2X 4YP6A 4A0FA 2HPZA 2XTAA 1ENZA 1BMFA 3RYFA 1I1OA 3ND7A 2W11A 2KSOB 2Q5EA 3EJ6A 1JH9A 4KXFB 4PNHA 3OOSA 4IFTA 5DFAA 4AWBA 3CZ4A 4E33A 3PNBA 3MMNA 2O2CA 4L2IB 2Y9TA 3OPYI 1GGVA 3OJCA 2J6HA 4FYPA 4OI1A 5IT9A 4CKWA 2EZ9A 3Q2IA 5EWGA 1V8FA 9ICWA 3IT0A 8ICHA 3ZWXA 4F8YA 1EVJA 3BZKA 3N76A 3EXHC 2QX6A 5BSFA 1N4DA 2QY9A 3N6XA 2V4QA 1T1EA 4LW8A 4W6ZA 2KYRA 5F4BA 2M9MA 5EWMB 2PZAA 1E2IA 1GADO 1PHRA 4KJZA 4UMEA 5HPYB 5CLLA 3DWIA 1NQVA 4RWZA 2QTNA 3K0HA 2M2IA 1GTL1 4LHEA 1GKYA 1UXKA 2QQ0A 3FPKA 3ICOA 3VR5H 4WASA 4AM8A 3CRW1 4LZNA 4BB0A 2Z2JA 3L6BA 4JJ4A 2QMEA 5BVHB 2GDZA 2X0RA 3TR6A 1ZUIA 1X6IA 3FMFA 3JWIA 1M34B 2XMDA 4IDQA 4BNDB 5K6TA 3CH4B 4X1IA 2OLEA 2SICE 4GNKA 1ICEA 1OBCA 1AO3A 3PITA 2QAJA 3CW8X 4WAUA 5ES4B 4KN6A 3UAYA 1MRNA 1IB0A 1V8OA 1X8JA 4C6TB 4MFFA 1TUBB 3BTSA 5DLPA 1MEJA 2ISPA 4MRRA 3RSZA 3KQPA 3BAFA 5B7PA 2A0XA 3NEPX 1M2VB 9ICSA 1E63A 2O20A 2PMBA 2X8JB 2Q3LA 3HBLA 3LCMA 3LYHA 4NX2A 1L5RA 3SOZA 3WWZA 4E09A 5I7SA 5F2OA 2VA3A 1E69A 3GRCA 5CPFA 4NZ9A 4ZIRA 2GLXA 3BTUA 1NXTA 2O5EA 1ZXIA 1NVDA 2COEA 4X3OA 5CHGA 1LBSA 1E9DA 3R74A 3ZK8A 3OJ0A 4EYIB 2NO1A 3CNQS 2HDOA 2DBYA 1BVYF 1PT9A 3GXOA 4HEJA 5BSRA 4YV1A 2EZXA 3DZCA 3PXDA 3T06B 3WFIA 4XPZA 3CFYA 4OUDA 1L4MA 4FJ0A 1QS0B 2D4HA 1C9NA 2BGNA 2H2DA 4JUIA 5B1EA 2C22A 4AQ7A 3IO3A 4TS3A 3VO2A 3EVAA 1SUDA 2ODGA 4D02A 5BMVA 2ET6A 2OGTA 2XI9A 3PE4A 1Z4QA 4L8FA 2NU6B 1OPRA 1UP7A 2BGJA 4F04A 2XXAB 1ZRHA 2ZUEA 1NYTA 3ROZA 2ZSAA 3IVMA 2FJPA 3BL6A 1Z5UA 5B3JC 3KQSA 4FYYA 3UOGA 4DR3B 2EKQA 2WTMA 3U3RA 1J2JA 1TPZA 4I1UA 3H11A 4ZXPA 4B8YA 5FULA 3FYHA 1I94B 3F2CA 2A0UA 3ADKA 2I1VB 4KQEA 3I09A 3TW0A 4O4IB 4W82A 5LUBA 4EO4A 1QO0D 1VZ3A 3SLRA 4C03A 5JMWA 3PX7A 1NW4A 2WV7A 3BCRA 1C20A 5TT0A 1U0SY 4RBNA 4DLZA 4DL5A 5A4DA 2GN8A 4LYDA 2EP7A 1KJQA 2ON6A 4AX4A 3N87A 1JTVA 3PJEA 3E05A 2QJFA 3HBFA 4CODB 1I01A 4PSKA 3DAYA 1UBJS 1V3TA 3NVDA 2G77B 2RGAA 2Y1OA 4J16C 4EA7A 5HYVA 2P6UA 3GRAA 1S2OA 1J1ZA 3GJ6A 1DAOA 3RUFA 3NAQA 4RF5A 1G8FA 5A7HA 3T94A 2PH5A 2GEBA 3RYTC 3HJCA 2IHZA 1JR3D 1K68A 1NG9A 1Q95A 5KTQA 3PUYA 4BZWA 4X3PA 4R01A 3ZHQA 4PGHA 4PVDA 1BPYA 4GP6A 2KFZA 1MN8A 1XZHA 3AF1A 5A9SB 3NVVA 2C2ZA 2JBWA 4IIJA 1Z8HA 3X1YA 1E0KA 4XJVA 1UPCA 4OGKA 1OAOA 1V45E 2RI6A 3W3AA 2CF6A 3HN2A 4FZRA 1Q92A 5EIWA 3W04A 1OX6A 4XUSA 4IDGA 5C34B 5U4QA 4O25A 5GTDA 4EVRA 5BOLA 3BS5B 5CEJA 2ZSEA 3KSZO 2WFAA 1H6BA 4YR2A 3DD5A 4LDRA 4PLPA 1BCRB 4Y9RA 2VF5X 3OQOA 3Q8XB 4RTMA 5ALOA 2ZW9A 3FOWA 4WACA 4AMGA 3HJHA 4DMMA 5K3EA 3T1OA 1OWNA 2O54A 2ACWA 2QS9A 4BBZA 1NZFA 1C9DB 4ZEOA 3RB4A 1WD7A 1IU9A 1YR2A 3FWZA 1I5EA 2UVDA 5B6IA 5FWYB 2UZ1A 1BD3A 2HB6A 2WJ4A 8MHTA 4KNVA 1SIJA 2EZZA 1Z22A 2H7VA 4XD7D 3U81A 3X44A 1Q50A 2Q1SA 2Q46A 2QROA 3JZMA 1X8KA 4O4LB 3ANNA 1W4BA 3JTMA 1UAYA 2IU3A 4RXUA 1DAFA 4QA9A 1EE1A 4X1KA 1Z75A 3ISVA 1NIJA 2ENUA 2JGRA 2AQHA 3KC2A 4B84A 2QX7A 3DTVD 1MAHA 3JVEA 1U9JA 1V8DA 1XTVA 3BB1A 4OIMA 5ALZA 3SFVA 4BVLA 4DRXA 3OJUA 5AW7A 1XXHB 3PVXA 2Z57A 3G02A 4RA9B 2C92A 4JI5B 1U2RA 1NYRA 3ANLA 1SKRA 1DADA 1IQUA 4OL0A 3QK7A 2VH2A 4RF2A 5DO9A 4ZJYA 2HLHA 4Q7QA 1DGQA 1JQAA 2FH5B 2Y71A 3F8SA 3ND8A 3QHAA 3E7FA 2OBMA 3EOAI 3I0ZA 5FFFA 3PX3A 1W581 3TLAA 3ZIUA 1SUCA 4R41A 4JVMA 4KUGA 1XUOA 2UVWA 1NL3A 1GXSA 2YYYA 5KFMA 4NJEA 3RT1A 2BI7A 1W5AA 4RFVA 3G2IA 3AM4A 1UCVA 5DI3B 3UK2A 3C87A 5BMVF 3OCJA 1DKMA 2DQYA 3EVCA 4BTVA 4IRCA 1GEEA 5JISA 1OIXA 1BMDA 1H0KA 4ZU6X 4OMCA 4FN4A 4ZAZA 3ZWPA 1VIDA 5K7SA 1Z74A 3GX1A 3ZY5A 2VOEA 1FDWA 1KI6A 2WSIA 1HJPA 4ZDKA 5C81A 2TECE 4DDTA 1Z5WA 3A7EA 4RQ2A 5DHSA 4JI1B 1PTJA 2IDKA 3O8OA 1RZRA 1KR2A 2DKXA 3R40A 3TQRA 5EIFA 4ARCA 2H3IA 1NUUA 2BZFA 1TLFA 4JC5A 2AYYA 2VP9A 3WIEA 2WQ6A 2B4KA 4XIYA 1ZGAA 5CITA 2EF0A 3TTVA 3PXEA 3RHSA 5KTSA 4XUEA 5J0YA 4US0R 1XCBA 2EX1A 5TGDA 3VC3A 1KEKA 4EH1A 1SCUB 2Y6UA 3F98A 5ENVA 3COZA 3QG5A 4WCFB 3FAKA 2IXFA 4KAAA 1NQWA 4RDIA 3OO0A 1DG3A 3BFPA 1M6EX 4MGIR 3JR3A 4JLPA 3P5SA 2JH8A 3QWHA 4PO9A 2IA6A 4WADA 3U80A 5MN6A 1I24A 3KUDA 4GOLD 4TTPA 3E9ZA 2V7EA 3HEBA 1P77A 3BK1A 3OFNA 4L5JA 2WIFA 4C4AA 3DLHA 1HURA 1Z7YA 2HMSA 2XMGA 4K1LA 4O2LA 5LOVF 1BQEA 3IYLW 2MR6A 2CXSA 4M8SA 3OUTA 1SELA 2JGDB 3DL7A 3AL2A 3MFHA 1C4KA 1F2UA 4KYVA 4UHJA 1K7FB 3SZOA 3TTTA 1H3FA 1D4ZA 3L92A 5GVSA 3LA8A 4WOPA 4REOA 4J9UE 5LQKA 1VMKA 2Q3BA 1ZFNA 3DMYA 2C82A 3AINA 3VM6A 5L3SB 3R2JA 1VMDA 4DLLA 1W4RA 4M7PA 3R75A 2ALJA 2ZR8A 3MJHA 3CVYA 2KP7A 2MIIA 1HQCA 1Z2PX 4Q39A 5LZ2A 3TRIA 1JIIA 3LYLA 5HVNA 1PLJA 2FLNA 3I04A 4QHYA 4RQ6A 1YJBA 3VR6D 2X0JA 1BDMA 1FSZA 3CN7A 3DZDA 3F4KA 4LE1A 1X66A 3A9CA 3A0BU 4PGAA 4PM4A 4R1OA 4RK0A 5HR6A 3MWGA 4W1QA 4HXEB 3KQKA 3HUTA 1KLNA 3MTQA 3OCUA 4C29A 2HNKA 1TK2A 2KIVA 3PSHA 5KNCA 1XT6A 3EEYA 3NVAA 1EWYA 1KA9H 4J9RA 2HU8A 1I14A 4PIMA 2PMCA 4RACA 1NVWQ 4XVRA 4B6PA 1J8QA 2FW8A 1M76A 1O5IA 4HYKA 4FU0A 2KZZA 1E7WA 2Z6AA 2PUGA 3JZFA 4P0TA 1UK8A 1KE1A 3H2KA 1QF6A 1XIVA 2FZEA 1NM5C 4H4CA 5FIUA 3TD2A 3QUCA 2B8NA 2EH9A 4TKVA 3C5VA 3K6SB 4YXWD 3I01A 3UYKA 3LWLA 2P68A 3GCZA 4HDMA 1WMDA 5SYAA 1IPEA 4NESA 3NJ8A 3ZHVA 4U7WA 5F76A 1T3GA 2F3SA 2Q4TA 3KTQA 3DOCA 4HEHA 1DEAA 4N6GA 1T4DA 5I7EA 1NQAO 3IE0A 1CYDA 3FOCA 3M1AA 2AFHE 3L6EA 4KGVA 5I4BA 5IJZA 4HZUB 5FTWA 3G85A 3G6KA 1NJWA 2I2WA 4IXDA 1J0EA 4Z6DA 1KAQA 3FNHA 2WF5A 2P69A 3O9VA 4US8A 3MJVA 4OB7A 2PX3A 3WOVA 4Q1VA 2OECA 2H3FA 3VHXB 4JC4A 1WHSB 1AQIA 4DIBA 3Q1KA 3DZFA 3GEGA 1VCNA 1LNZA 1YI1A 3ISCA 8ICOA 2X1LA 3A4VA 1T26A 4KK3A 4TL7A 1ZCZA 4IRXA 3S2FA 2UVQA 4TKUA 5K09A 2B35A 2YXLA 4FE7A 5CRIA 5H0IA 4KR7A 3LC1O 2X8LA 5EHIA 1ZWLA 4FZVA 4A8HA 4FEYA 2RH9B 3RADC 1MQ3A 2NUPB 5K6AA 1I80A 1JXMA 4IUDS 4J3FA 3EGCA 1Z00A 3KV3O 4EZEA 2RHOA 2UDPA 5E2IA 1ZIYA 1L7PA 2P6NA 4DBVO 3SC6A 4OHWA 1LRLA 1L6NA 4XD7A 4X91A 4ZV9A 3AVUA 3GQCA 1HT3A 1ZS9A 2X58A 3VISA 4V0QA 4GC6A 2P9QA 3F90A 1YVDA 4UULA 1AUOA 1R3DA 1JDJA 2OHHA 5KEIA 2VSFA 4ZT4A 2FWAA 1WSWA 3E82A 4J76A 1O97D 3O9MA 3WISA 2ZJZA 3ZCRA 2H3ZA 2ODTX 4TKZA 1TK8A 1U02A 1GP2A 1VLBA 4DS4A 1D8AA 1JECA 3FXAA 3LT4A 1IQPA 5U9CA 1IEXA 1UBSB 3FUTA 3BKXA 4BUJA 1XP5A 4GE3A 4FEEA 4RWEA 2PTGA 1Y0BA 3D6NB 1PFUA 3D8NA 1UT6A 1OCEA 2DQZA 4TKLA 3KAJA 1XJQA 1RWNA 3PXXA 3LBAA 1WP9A 3K70D 4C43A 4X93A 3A3YA 4F5RA 1R0RE 4E4TA 3KFVA 3HBNA 1SL2A 1XROA 2OV4A 4Q7MB 1H8ED 2J1LA 1YAJA 2VZLA 4K6CA 4MS4A 4NXNB 2YB4A 5KOIA 2IU4A 3LLVA 5EMLA 2YDYA 1XJ0A 2YVKA 5TQVA 1AHIA 2GN4A 2AF3C 2H7CA 4Y2GA 3HP6A 5LPNA 1Y4UA 2Y1JA 4DFDA 3IT2A 4XARA 5JPDA 2XLCA 3SX0A 2ZREA 2ZJBA 2C7RA 3KTFA 2Q07A 4ENUA 4YLYA 3MGCA 2QTZA 1CULC 2VEDA 3TJZA 1X86B 5L4LA 2E37A 2A5YB 2G7MC 4A6XA 4RHCA 4CDNA 4Q0MA 4Y6PA 3ZLUA 2JHGA 4B4WA 2XEDA 5AI8A 4GI7A 3INRA 3ESQA 3RPEA 4NNJA 1SVUA 2AMJA 3RAJA 3TFOA 3G0OA 3MTJA 4GFDA 1JG4A 2GLEA 2FQYA 3V34A 5BMVB 4E4YA 4PRLA 4KXLA 4B6EA 2I2FA 2NU6A 1OZGA 2VDOB 3K92A 4Q21A 1ID8A 8ICJA 4RSMA 2VP5A 4RZQA 3ZI7A 4TOIA 3IBTA 5BQ5A 3ZYZA 2PSEA 1BMFD 2VQDA 2ZSJA 3KT6A 3VKHA 4NU8X 3QPWA 3SKYA 1KOGA 4QPCA 1OI4A 3ENKA 1T8YA 4ACAA 3I8SA 2I4IA 2Z8ZA 3AERA 2AWOA 3A05A 4L07A 2YQ5A 4HDAA 4G0YA 3MLBA 2JA2A 3KQMA 2BPGA 2PLAA 3JQQA 4IQUA 2CLIB 4O4IA 4QQFA 2Q2WA 2CLSA 5AOCA 3NVKI 5ALHA 1K1EA 1QAMA 2FN3A 4DDHA 1LV7A 2NYRA 1ZEMA 2G1AA 4RY0A 2C7BA 4AJLA 5HF9A 2PKEA 1EJ6A 3FR8A 3QSYA 4IIEA 4HL6A 3L79A 1U3UA 4DCSA 4RH1A 4ZN6A 3VC2A 3R9KA 1TJ4A 2K8CB 1Y1PA 1YL6A 3IEXA 1OXBB 4RT2A 2CK3A 3KPVA 3NI2A 3VDRA 4BQRA 1KEUA 5AKEA 3H75A 4YMIA 1XDZA 4LNUB 1ZISA 3DOEA 1UDWA 3SIWA 1BE1A 1X1QA 1MO4A 4RXMA 4L15A 1AGNA 4BE4A 2WE8A 5KVAA 5BYKA 4XCVA 3ZV5A 1INLA 2EKPA 4QU0A 1OXVA 5H9VA 3WGOA 3DOOA 5LP1A 3WP0A 4IHKA 2YXDA 3CF2A 1YR1A 3IA7A 1EQUA 5D2CA 3DO8A 2EKDA 3VSDA 2AG8A 3Q0TA 3RREA 4KLNA 3WLIA 1G5QA 1UXOA 3FIUA 4YMOA 2IUFA 1R4NA 2ZB2A 5CCDA 3DAFA 5LXTA 5ALMA 1YFZA 2BEWA 3O74A 2Q1UA 1QIFA 4HFJA 1UC8A 3A58B 4NFYA 2C9ZA 3EGVA 4ZYYA 5KHLB 5AKGA 2XGPA 2BONA 3FFAA 5E9JA 3C4VA 1UZNA 1P91A 4EKDA 2CPRA 1YZQA 5ELXA 3QF4A 3O3NB 4KTVE 1GPUA 4JOCA 2QVXX 4EKIA 3ZQ6A 2WFMA 2W2KB 3WRXA 2XCTB 4MQEA 5C0YA 2A3RA 3EWIA 5FQOA 3SSOA 5GP1A 5DB8A 3AIKA 4LZWA 2PSDA 3OJOA 2H0QA 2X9QA 1Z8FA 4J2HA 2OZLA 4LYAA 1ESZA 2UVPA 3WGQA 2ZCVA 1G42A 1BRTA 3K0FA 4NCKA 1PJZA 2FPPA 2IP1A 4RKRA 3RDPA 3BRQA 1UBKS 2PAFA 4LC1A 4Z9AA 4IEEA 2L82A 4LY3A 2HQRA 1XK7A 1U3TA 4RQNA 2AI2A 2RHCA 2X8BA 1YDHA 5IT5A 3HUDA 4DUGA 4MKZA 3CG0A 1XXHA 3PGXA 4ZI3A 4GQIA 3GEBA 3EQ2A 4QBTA 5CWRA 3CURA 2I29A 4IXMA 3SJ7A 5A2GA 1PEKE 1Y8QA 3NIFB 3VR3A 5A5GA 5TZVA 3W8DA 1ZQKA 4PHDA 1UJMA 1ZQMA 1W5EA 3L46A 4W9NC 5JDIA 1SQSA 1CZKA 2CHGA 2X42A 3LD9A 3UMVA 3VZCA 4MRMB 1ZOLA 1ZJ4A 4UEOA 4JWNA 4NSNA 3EH1A 2JL1A 4PPGA 4XGQA 1U2ZA 1WXQA 1HY3A 4YQZA 3EMBA 2QAGC 5TQJA 3S1LA 1MC1A 4CV0A 4DEXA 2WLTA 1QYVA 1M0WA 4WGGA 5AI9A 4DADA 3K4GA 2QKYA 2XRFA 3HE3A 4WUTA 4WW0A 3VQTA 2I2CA 2DY1A 2QNRA 1KZ4A 2WWGA 1CEYA 2CE7A 2E5FA 1OPXA 2XKAA 2XDWA 4K28A 4U0JA 3O83A 5HMMA 4LQ4A 4R31A 2B7BA 5EXEA 4RW0A 3LFUA 2QN3A 2R6HA 1JIJA 4D9HA 2QW8A 1JXAA 1XRRA 1QXSA 5T3UA 5AKJA 2DR2A 1FTQA 2GBLA 1MJ5A 1VTKA 3NO4A 3P9XA 4RK1A 2QRVB 3AL3A 3KE9A 1T1JA 1ELOA 4G5OA 4TUYB 4D9BA 5AUOB 1BVUA 5J0XA 1DARA 2I4RA 3O8BA 4Z0HO 1EHCA 4HJXA 4NL4H 1FMTA 4YEDA 3H16A 3RABA 1P8AA 3THOA 1U1FA 2DPYA 1QKJA 1M0SA 4PPYA 4RMNA 4YFYA 5HG0A 1IC6A 4D97A 2P2LA 3AESB 1J23A 3PX2A 4R9NA 4E14A 4GM1A 5FUYA 1KOFA 3MGIA 1PWXA 4Z54A 4WCFC 1B8OA 2VSXA 2PL1A 3AMVA 3E61A 4Q02A 5LYJA 3X1WA 5CFOA 1T29A 4J7XA 1II9A 2ASJA 1PUIA 3GLHA 3VYTB 5BV7A 3K9FC 2I91A 4LDPA 1HNNA 2IS1A 1FP6A 3GJXC 1QX3A 2O48X 3G23A 4ZHSA 3MA0A 4OYRA 1JV2B 2KSQA 3ZHOA 4JS0A 1GLNA 2QLNA 4MUNA 5H1YA 3RR7A 3NUQA 3CUWA 4BYMA 2JG3A 3K3PA 1LV5A 1BJRE 3T9EA 3S1AA 2CEKA 2X2OA 3RG2A 3C98A 2BT4A 3VH2A 4QDUA 2FG6C 5AM5A 3GDXA 2IYZA 1C8KA 3OIFA 3MMZA 2Q7OE 2JLCA 3TAUA 3PL5A 3F5QA 4AC9A 1IVNA 2JHDA 1CV2A 4F72A 3NH6A 4RF3A 4ZGWA 5CTAA 5KVCA 3UMSA 1IPHA 1BVSA 1ZUNA 3A1VA 4DCGA 4LF4B 5FPQA 2ZGVA 3T5TA 3OMXA 1ZU4A 4RJIA 4J0QA 5G02A 1T4MA 2H1FA 2ZDGA 4PLTA 4DG9A 3GDFA 3LUKA 1XCMA 2KOBA 1G6HA 2JBHA 2CYBA 3CYMA 1SKMA 5GJBA 2JGIA 1L4LA 1Q0QA 1WZ2A 4FM9A 4H60A 4BNMA 1ODFA 4OFZA 4E7PA 5A1TA 5JS1A 4JEIA 4MLPA 4WZAE 4J9LA 4LJKA 3JAWA 1BO6A 1GVNB 5LQAA 3KFUF 2DM6A 2HA7A 4KR3A 1I1NA 4OJLA 1ZD1A 3GVHA 3BILA 4O63O 5T5QA 1B26A 1GN9A 4GZMA 3QBDA 2VYVA 3V4RA 4OXQA 1GZSA 1VKHA 2V59A 1ZSYA 3FPBA 4E6PA 1ADBA 3NTRA 2OORC 4IUCS 4M0PA 4KLAA 2BGLA 2WDPA 4JJFA 1WY7A 1M8FA 5I6DA 3AR4A 3UV3A 1X38A 3GT7A 1KR5A 3C7KA 4GC7A 1PWYE 2B30A 3IHWA 1B0XA 3LQQA 4QDJA 3ROFA 1NZPA 2ZBFA 1WXGA 1KFBB 1ST3A 3OCVA 4EFLA 1J5PA 3IP6A 3IX7A 1JRLA 2P2YA 1XEAA 2VP6A 1SKYB 3MK31 2JDIA 8ICNA 2HK8A 1MZPA 1R3UA 3R24A 4R2IA 3G13A 1W4LA 4EHLA 1J5EB 4TYWA 1KQFA 4G9GA 2FPGA 2ECPA 4FJ1A 3N7SC 2V4MA 4NTZA 5DH9A 2I99A 3BMXA 3D4LA 3T9AA 3DEHA 5IEJA 1U9IC 3NGLA 3C8HA 1TT7A 4EJ6A 1FBTA 1QJ4A 2WTXA 4OH1A 1V9LA 1A4RA 4YRTA 3ZWWA 1ETUA 4C8MA 4DSAA 5JJ5A 3W5JA 4G89A 5LQDA 2D6FA 1YASA 2H5LA 3PNCA 3T4EA 4LFCB 2O3SA 4LPSA 4TURA 3FZYA 3PNKA 2NVUA 3PQ7A 3QFFA 4EYQA 3U5ZB 1ULTA 5DTMA 3PQCA 1AK2A 2X7XA 1FXWA 4ZVKA 5L40A 2DKNA 5FPPA 4ZYLA 4N5NA 4C2BA 4PZEA 4DQPA 4IS3A 4JASB 3ZLVA 2K4PA 1KGSA 2C28A 1FYFA 3L7LA 4D8YA 4L4XA 3U7HB 4MW4A 4MCJA 3UJ9A 2ILTA 2QMUA 4KRXA 1C50A 4KMRA 1Z4LA 5FOQA 1OTXA 3RFFA 1DE0A 1COZA 3FKSA 1XBTA 4YP7A 3AF3A 1Q7EA 2J87A 2JCGA 4MUBA 4WNAB 4OHCA 4IHJB 2O2YA 1QPGA 2LYBA 5BSUA 4J9VA 3DFZA 3JYPA 5LQRA 3SR0A 2GYWA 1P4AA 5AIAA 3BORA 1LI7A 1FY2A 1TD1A 5ILQA 2CLOB 4ZWNA 4LXXA 2E4UA 3RVSA 2YX8A 1N0UA 1ETHA 1P2GA 1M8JA 2PX6A 3PJRA 5CG2A 3TOCA 3FI0A 2A5GA 5FTMA 1LDYA 4R66A 1HDRA 4EB6B 3DDSA 1DCTA 3FA2A 3VJLA 4EL5A 2HYIC 1ACMA 1QK5A 1Z0UA 2RHWA 3B5EA 1FLVA 5EJ2A 5LOVA 1UMBA 3GAMA 4IS7A 1E5XA 4POAA 4YRKA 3I2KA 4C01A 1QFYA 1W5BA 4HVTA 1IRIA 4X85A 1BHSA 1O96A 2I54A 4M99A 5ITWA 5C8YA 1BPXA 1FCJA 1GHTA 3LA6A 3SS8A 1PFWA 4GMKA 4BJHB 5D3MA 4ZPJA 2EFYA 1YRQA 2XICA 4J1NA 5ALPA 3NDRA 4MRPA 4EJ2A 1Z2EA 3NHBA 1T9DA 3D5QA 1E0JA 3KU1A 2EFDB 2F1OA 3VVMA 4F2PA 4ZDJA 2ZITA 5BPFA 5AM0A 2HVHA 3GDWA 4EITA 4YX9A 1DPFA 2I2BA 1SGWA 2DPLA 5JFTA 1MB3A 2GEKA 1JBEA 3JR7A 4MTLA 1O5OA 2GT1A 4XVQA 5FWXA 3RTCA 2RQ5A 3WB1A 5KOJA 1Y5RA 2LVBA 3FSEA 3BWDD 1XZJA 4KX5A 3NX4A 4GXNA 3TSOA 5E0KB 3U3MA 1X7YA 5D6NA 2PWYA 4Z1MA 4M04A 5AW6A 1C29B 1TNDA 4FXPA 2XMRA 1WKVA 2I34A 4YROA 3PFNA 3UJ8A 3GPDG 1UJ6A 2R7MA 3E9QA 3L05A 4QD3A 3RFCA 1ISRA 1T2NA 4O33A 4PZCA 1ZI8A 3SE7A 4H3KB 1D07A 4EUEA 1QPBA 1XTKA 4LHZA 1RXUA 5C3MA 5TV2A 1LPAB 4G1MB 4YWJA 4B3CA 1COKA 1AMNA 1EPUA 2YVQA 3W5CA 4MF2A 5KFDA 2O8VA 1OVGA 1DAIA 5DQIA 2H8GA 4I8DA 4QYIB 5HOQA 1CEZA 1UADA 3Q98A 4GBED 2XF2A 9ICPA 1FDSA 1J9EA 1XAGA 3FPGA 3V8VA 5LN1A 5DK6A 2QKQA 4G2TA 4J2TA 2AH5A 1MVOA 2B92A 3VTKA 3X1MA 3ZWBA 2DFVA 3V8PA 5FNVA 2OCIA 1YA6A 4IVPA 4P4UA 2NMVA 2GM5A 2AB0A 1XVAA 5EJ4A 3PW4A 1HORA 1R88A 4E21A 2GD1O 3SAHA 4O4JA 4D56A 5HGXA 5JZOA 3OZGA 1A77A 3AEQB 4Z8YA 4IUYA 2GCIA 4RK4A 1R0LA 4JK1A 5CFZA 3W34A 1W2GA 3TPZA 2IYRA 1U1EA 3UQYS 3X1JA 5ICGA 3QU9A 2W6ID 3ETNA 4EG4A 4Y1FA 5A7FA 2D2XA 1GL9B 3G6YA 1Z34A 5DCYA 1GPWB 2UZ1B 3UHAA 1RPTA 1T3LA 5KFYA 1X1AA 4RVDA 2P6OA 1C1XA 2WSLA 3PQ4A 3UGQA 4IOJA 5JQGA 3FWNA 3WLLA 1ZVQA 1O4VA 2BEUB 1KDRA 1XWIA 4EMBA 5HK9A 3RAXA 1GFIA 2XE8A 2MOKA 2KJ9A 3WWDA 1KRWA 3S99A 4BWMA 2M6SA 1S4MA 2IIBA 1E1YA 1DBWA 4DV3B 5LNK6 2BEWB 4IQTA 5HFNA 2H1SA 4G65A 1LY1A 1PDOA 1B43A 3KZCA 1S7CA 4B6QA 5BYJA 2AZTA 3GJ7A 2C9BA 3TADC 2HU2A 1Y82A 4NOJA 4KQMA 5JUWA 4O5CA 3QU2A 3TZCA 2H9IA 3IDAA 1VI2A 1RKUA 2QD1A 4FHCA 3ZHYA 1EG7A 1ISGA 1DQRA 2HJ9A 4CM1A 4WESA 5KFPA 3HJEA 5AQEA 1MRZA 4NJEB 2XB2A 4ARIA 4GC5A 5E6SA 1RABA 2VTEA 4OHYA 1OLSB 2UVPB 3AVPA 3DL0A 2H16A 3B6JA 4G1FA 5CK4A 4RMHA 1HDIA 4XWYA 2XY6A 2FLPA 5DASA 1IN7A 2ZIXA 1I7LA 4KLMA 1Z28A 3RQIA 2VK4A 4M1TA 5LD2C 4AY6A 3KTOA 5SYNA 3QOFA 1L4NA 1ZXBA 2PUWA 1LX6A 2HHXA 2XY4A 3N6VA 4FMDF 3IVAA 1NNSA 4IEFB 2Q1XA 4XYGA 4F4DA 1U2TA 3SJUA 3O8OB 4MVJE 3D4OA 3DPUA 1CB7A 2A3VA 2AWNA 2IYUA 2DZDA 2BCSA 1HSZA 4YHBA 4QPNA 1W48A 9ICXA 2RK4A 1NKVA 2R4UA 4YJ3B 3NHMA 3NGDA 2KFNA 1PUXA 5LB4A 2GEJA 2PD6A 4RV4A 1HTBA 4BMDA 4P6VF 3TLBA 2WZBA 4F5EA 3QPUA 2B8WA 4DNXA 1PJ2A 4W5HA 2YY7A 2V8OA 5KT4A 3TAXA 4KXNA 4G26A 2W6IA 2FZ4A 3QJYA 1KI1A 5EZ5A 3VYUB 3D31A 4AS1A 2HMAA 1ZINA 2GZDA 4M0LA 4TWJA 3L1VA 1VIVA 4ILEA 1JI7A 4QNMA 5ISMA 3T34A 1AGXA 1UZAA 2QORA 2DHCA 1DUIA 1XD9A 4DPLA 1RMYA 1XF9A 1ZXXA 3L4EA 2WT8A 2C5BA 1IIRA 2EJCA 3L1HA 5DIFA 3KKMA 4M1WA 5IVKA 1CP2A 2JGAA 1S8FA 1ZY2A 2AIRA 3AQ4A 2JIZA 3PHHA 1A8UA 3LMKA 2WHQA 1JJAA 4L4RA 2O0HA 4KMOA 5JAOA 3N9IA 3D3KA 3R5HA 6ADHA 4BXOB 3QW2A 2RRDA 4Q05A 8OHMA 2YZNA 2HT1A 1IG0A 2W4QA 4TUYA 2A0WA 1RWVA 2AZDA 1K8XB 2ZU6A 4AKTA 3CT4A 4YMVA 2O0MA 5KWIA 4WA8A 2XTNA 2ZJ0A 3CF6R 1ODIA 1CYEA 1THMA 1Q7RA 3VPDA 1SB3C 2HBYA 3G1TA 1PHPA 4XJXA 2QZ4A 1NVTA 4LYFA 4S1TA 3UYLA 3F2VA 5A4MS 3ZG6A 4J6FA 1SCJA 2CHFA 5G0VA 1V8BA 1OXSC 3NHSA 3W5HA 4JQZA 5EHNA 4ZJZA 2I9KA 4LAFA 4D41A 3HYLA 3QP9A 3NCHA 1X7DA 1FSPA 2JLAA 3A27A 4KOEC 4J16A 4JQYA 4OHKA 1IY9A 1VBFA 2JFGA 2VXCA 3INGA 1T5IA 2Q7XA 3DNMA 3GQVA 1KYZA 5KFBA 4R8UA 3S4YA 1KO7A 3MCVA 2D13A 3A1FA 3V6LA 4AUEA 1YDEA 5IFLA 2MU2A 3E9CA 9ICMA 2AKAB 1WAMA 2X13A 3F7TA 5EMKA 3GFVA 4LBVA 2WE7A 4V24A 3UTDA 1SN7A 2I5PO 4P35A 3WYAA 3NHLA 4MQ5A 2XT6A 4C78A 3LKBA 1QRTA 1HUZA 2DF8A 3M5PA 4TQ9A 2GK7A 1EUDB 2W6PA 2HTFA 1CEEA 4IV0A 4BNTA 1L7MA 3RJTA 3FOZA 2O8BA 1G6Q1 4ID3A 3QXSA 621PA 1KI9A 4E5UA 4D4KA 1NVVR 4Q12A 4CYMA 4DB2A 1QNLA 5SZIA 3AEUA 4YJKA 1AXRA 2X1HA 3UAGA 1ZONA 1EAYA 4IHAA 3MFIA 3GAAA 1Q7BA 3M4YA 4UKDA 1TJ3A 4DV4B 4G0ZA 3Q6NA 2ZKIA 5KYGA 2IUYA 3IH5A 5CYPA 1C0KA 2G9ZA 3LF2A 3UO8B 1QTRA 1X42A 1RAFA 1QNFA 2JLBA 2QN1A 5AKKA 1KOLA 1R9GA 1LH0A 1T8RA 5HKKA 3DP9A 1TO2E 4H4DA 3STXA 1DRWA 4O0IA 1P7DA 4I4NA 4TX1A 3DG9A 4NU6A 4EZ9A 1TVKA 1U1DA 2VAPA 5LBUA 4DLKA 5CFNA 4ARVA 3IHLA 1PN3A 3OOYA 3VPXA 4BJ3A 4OXNA 4JEHA 2AJDA 5J2GA 4MVJG 2OHFA 5KAPA 3QV1A 4KIGA 4OBBA 4GOOD 4CLRA 3RAEC 3K2BA 1QGUB 3GJTA 1B15A 5CFMA 1P8JA 1UFRA 1Z25A 3HBJA 1SQ6A 2W2NA 3F97A 4UBOA 5BSVA 3FG9A 5J8YC 4NAVA 4M7RA 1G1MA 3TH5A 3NOQA 2P2ZA 1RWPA 2QJOA 3EEQA 3Q3GE 3Q85A 1CY2A 4FDAA 4QZFA 3UMRA 5CM2Z 5B2ZA 4D4MA 5HQ3B 4E88A 5LC1A 4UNRA 2G0AA 1TZMA 3NATA 3RRMA 3VI3B 3GU3A 3VSCA 4ZYXA 5L4NA 4ZDWA 4YRMA 1A2QA 2GUGA 4GVLA 1O95D 1ZQXA 3GUZA 1OYWA 1TC2A 5TISU 4QFMA 1N5KA 4R16A 4MB6A 4DV6B 3BHMA 4MW9A 2FSVA 1FQKA 2WKQA 3EEIA 3D2LA 1WVMA 4UHKA 3IV6A 4PRKA 5IVDA 1DJLA 5FADA 5JJIA 4CPDA 3DMRA 3VAYA 2EC5A 4Y2JA 3W0LB 1KC1A 1E0AA 2VRCA 1WPQA 1Y1LA 2RDMA 3UT6A 1HXHA 4R71A 4PF1A 1NDHA 2IF2A 2XQVA 2WWTA 1U3DA 3HKDA 4ZU3A 5KOYA 1RI4A 3DB2A 1XO0A 3ZTWA 1R4AA 2OFWA 1Q7CA 1QIEA 5IINA 3SC4A 1W52X 2K6GA 2OGWA 4P7JA 3OVMA 4DAEA 4C14A 2QAIA 3RFVA 4AYBC 5F3DA 2PMZF 1RBYA 1E4YA 2P3LA 4AZVA 1KI2A 4DA8A 1J42A 1LK0A 4QEZA 5BWOA 4GLBA 1JEYB 4UARA 3B3QA 1OH8A 4JJKA 5JSZB 2REBA 3OEHD 5K5EA 2N46A 4IFIA 4UVEA 3EC1A 2NO5A 3JQDA 4P31A 3RC7A 1LSOA 4J0JA 4NFHA 4YDQA 2VYVD 3UAWA 2RIPA 4G09A 2Z95A 4IC9A 2NIPA 1NPYA 2AHRA 4P53A 5EUCA 2ZCUA 1NMZA 1V5WA 2JW5A 3GUHA 4KV7A 1U8UA 3W6PA 4JI0B 4YCXA 3BAZA 3PQEA 4F9FA 4DR5B 3EY4A 4BY9E 3F5EA 3K8QA 2A6PA 3KEMA 5DHUA 2BKLA 4EG8A 1OREA 1TM4E 2L5YA 1CQJA 2AFIB 4BRZA 5DQGA 1T6ZA 4HWKA 4DQVA 1V1RB 3RJKA 2O5RA 2AGOA 1X7GA 2EW1A 4S2EA 4QUEA 4CI0B 3AF5A 1UC5B 1TT5A 2W71A 2WP8J 3H19A 2PLFA 2I4NA 2P4QA 4EENA 4XRHA 1Y63A 3F74A 3L43A 2GPBA 3L8ZA 2IOHA 3NU1A 2WKPA 3O4RA 2RFLA 5FL7A 2YWJA 4ZVPA 2NUAB 3JV7A 4M0CA 3LHFA 2A14A 4MGHA 4I28A 4G63A 2HSZA 3P9IA 4G0QA 3PX0A 4F8RA 5LZ5A 2XHZA 4YO8A 2CYCA 3B48A 3ILSA 3UOWA 2XIDA 3WAJA 2VP4A 1VPVA 1AM4D 2KLBA 2MT9A 1X9XA 1NT2A 1Q6YA 2VAXA 3AKEA 4GKVA 5BVGB 2JHCA 1SKUA 3G8AA 4H9GA 4MRAA 1JAXA 2O50A 1D6NA 2K2QB 3B2QA 4LE2A 5T4HA 4BX2A 2HR1A 3FVVA 2OGSA 1CZRA 2RHHA 1YAHA 3C3MA 4D81A 3G59A 2HSDA 5CVUA 3QKTA 5JEDA 2FUG1 1F1JA 1OXTA 5K4GA 3U7IA 1JYEA 3TW8A 4QXRA 5JCJD 3VCBA 3A3NA 1PK8A 3GJ5A 3R7LA 1N5LA 5C1DA 2KHVA 1MOQA 2PSFA 1Y7TA 3DDOA 2ONJA 1Y3BE 4EJSC 3EUAA 4EKGA 2WF9A 2WTEA 4DMUB 1U6KA 3COPA 4H6PA 5EIOA 5FXMA 1LX7A 4HQFA 4P3OA 2ZR7A 4B5LA 5I47A 3GBVA 4ED8A 3V2GA 4TWAA 1S5PA 4FFVA 4NC9A 3L1UA 1BGWA 2OHOA 4NK4A 1DIHA 4KREA 2WWIA 4PN7A 1LPBB 1KBQA 2FUNB 2UZIR 4IR7A 2RGWA 3HBMA 4EGSA 1T25A 3GHHA 5EJ5A 4C3ZA 1J90A 4D9KA 1E59A 1ONBA 5AUPB 4YAOA 4F1WA 4KIJA 3UCEA 1C7RA 4CQLA 4TLDA 1HKUA 3UQ0A 1SZDA 3BXEA 4MICA 1H42A 3RNOA 4OU5A 4ATNA 2IELA 4B32A 4WFKA 1GTSA 2QN7A 1Q3KA 3ZGXA 3TZKA 3T3DA 2P6RA 4GXRA 3ZE2B 4YUWA 3AXSA 3RC8A 3HNOA 5EFOA 3KQTA 4RGBA 5KREA 3RRXA 4PQGA 3IV7A 2QTHA 4NG5A 1NJXA 4MXDA 4FEAA 5DVZA 3TKLA 3NHWA 2WSSD 1BPEA 3S5UA 4E5DA 1A8PA 1RJ9B 4J3NA 2B7LA 2EYQA 2OORA 3LZ6A 3JXEA 3O90A 3CSDA 3VR3D 4MNTA 3GIIA 4HX9A 4LMPA 2R5FA 3MWKA 2PH7A 4PO8A 4U2KA 4ARZA 5CDHA 4CTOA 2B6GA 1KNQA 3QWIA 1Q7GA 1QCYA 3NH9A 3PRHA 3U3JA 4EBBA 4RTJA 3H5RA 1MAWA 3T5JA 4B7CA 3ICCA 2CMFA 3QTLA 2WAYA 2ZSHA 3TAHA 5IAGA 4PN3A 5HTKA 4HGNA 4YV2A 4GS5A 1F20A 2HGSA 4D8XA 1QTMA 4EMTA 4MKFA 4I4CA 3CEHA 4UPVA 4QYMA 1FP2A 4R51A 1ECCA 3ZE9A 4JIGA 3RVPA 1R8YA 4I6JA 4FE4A 2J9YB 4JLDA 4IG9A 2JFUA 1OFGA 3FDZB 4WXHA 3OZRA 3CLRD 4OFBA 2LMRA 4UMVA 1C1HA 4P84A 3ETHA 2HCTA 4XEUA 2PKQO 2R8ZA 2HRBA 2OZVA 4Y1GA 1E62A 1JBQA 3EFHA 4GI2A 4OX9B 4N0MA 4MYTA 2WJIA 3AYZB 1V5IA 2WWRA 4OAOA 2NACA 1NVEA 3FLBA 1TTTA 5DTIA 2H4XA 2EVWX 4TVOA 4MLDA 1NHWA 4UU7A 1MB0A 2DB3A 2CMDA 4ALNA 4NLCA 5DM0A 4L0CA 2K89A 3O4VA 4UNIA 2Q8QA 1ZL2A 2G9UA 3QVWA 5DNAA 4F4CA 5LD2B 3T5HA 4HF7A 4WCVA 4NG4A 3O4IA 4PGFA 2E1PA 2RKOA 1VPEA 3RBVA 1NXOA 1SBIA 3WWYA 4GECA 1C0IA 2XODA 1H6CA 3C7CB 3MMSA 3AR7A 2V6BA 4JELA 5AW5A 2ZTLA 2FRVA 5JASA 1NN1A 1Q16A 4G23A 5J2KA 2BPOA 1KKMA 3ESAA 3BIWA 4RD0A 1A4XA 5LU8A 4BO2A 2CLEB 3EODA 4UBNA 1Q22A 4Z99A 3R7SA 1XQ9A 4A15A 2G5PA 1T8WA 4BQSA 3V7NA 1JHUA 1AY0A 3F3YA 1Y1KE 4Z7OB 5HSGA 2ARKA 3B3JA 1RU3A 2H08A 2P78A 2XV1A 1UWCA 2VP0A 2OYSA 2BFWA 2O8CB 2IE0A 1FJGB 3C23A 4A92A 4Z9BA 1MA3A 4L5AA 1CEXA 4S05A 4FOLA 2YMLA 1KHTA 2K7ZA 3I2FA 2HBRA 3O8DA 3AR2A 3F3SA 3JQAA 2OHVA 4KUHA 1FXWF 1MT0A 1WDTA 4UDYX 5FA5A 5A5FA 4TV9A 5TF0A 4YP1A 1O94A 1TUEA 1QOZA 2Y0DA 4CT4B 1ZRNA 5IZCA 3ZGLA 1P4RA 3MGBA 5K9ZA 4JUZA 1YS1X 3F2DA 2HBKA 1L5GB 3UUFA 3VPGA 4NPAA 2GUWA 2Q0XA 5L1IA 2C1EA 1X94A 1YZYA 3P94A 4Y0NA 4WWHA 2OKCA 5D84A 4OQFA 3FHJA 2QP3A 3OLYA 4Z53A 4G1UC 5DB6A 2DERA 4O5KA 2JFWA 2ZRLA 1YZ7A 2KM1A 3AWIA 2LPMA 2OCAA 3D2CA 5CA0B 4AUNA 4I2CA 5CM8B 5L1JA 4AMBA 3BZBA 5LNK1 1QX4A 1P0CA 1VG9B 4NCBA 3R3JA 2V7VA 1R15A 1A1VA 1GUYA 1UZMA 4RHUA 2VYCA 1YHZA 2EBWA 4F4IA 4E22A 5KFVA 3RARA 2FV8A 3EFEA 2Q4OA 2QVZX 1PSZA 1UT8A 3E0XA 1A71A 3OZXA 2VHJA 3L8HA 2XC9A 5CH5A 4CM7A 3RK0A 3IJEB 5SYMA 1RR6A 3DL2A 1L7AA 3LLUA 2PT6A 2HA4A 4RDCA 5ENDA 3ZH9B 3TQIA 1PKEA 5FWAA 4F21A 5JROA 5JRTA 2ISOA 2O2DA 4W5RA 4WSOA 1YULA 4P3NA 5EI5A 1IRXA 1M6NA 4CTJA 1T0BA 1Q0SA 3SSAA 3SQLA 3CNOA 1T0JB 1ANKA 3PLRA 2DULA 4QIHA 5IIJA 1AKMA 4W7HA 1O97C 3M5WA 1G7SA 1VIMA 9ICEA 2R25B 4BDPA 1ESNA 2IIQA 5LA6B 2OK7A 3TNLA 1IZ8A 5KG7A 2DJIA 2F62A 4QYTA 1LA2A 1WW8A 3A04A 4OYHA 2VUHB 4P4SA 3PC4A 5EWJA 1FNCA 2FPRA 5E38A 3V8QA 2C77A 1O58A 1SCNE 2JBAA 1JDBC 4XVUA 2VRCD 5KNBH 4R8KA 4EFKA 1LKYB 1R9JA 1LS1A 3C24A 2QLFA 3K2EA 4JBGA 4RO0A 5IS2A 4YY3B 2NUTA 1X0XA 4ZI7B 2W04A 3A3KA 4R9UC 4B4KA 3HDQA 1SBHA 3LO8A 1AQUA 1WB5A 3EIHA 2PX2A 3HI4A 4UVHA 4XSVA 1JT9A 1E1RD 2JEOA 4YCNA 2WJ3A 2GYYA 3VTZA 4YPVA 3HDYA 4D80A 1N61A 3NCTA 3C1OA 2VKTA 3VX4A 3WKCA 1QG0A 1T2VA 2GAIA 2XYQA 1XTIA 4MO2A 5KO2A 1LXCA 1TRKA 1ZL0A 3PUXA 3KLPX 4DFJA 1K98A 2B1RA 4KQ1A 3OH8A 5B64A 4G0WA 2XE4A 1AKRA 1L5SA 3DE5X 2AL7A 4MVJF 4AZWA 3IDWA 5LZ9A 1NLUA 2AD5A 5J2JA 2GZHA 4TLLB 3OHAA 1YMVA 1BPDA 2JCYA 4PZZA 4KBFA 4HN2A 4JX8A 1NVKA 4BVAA 4BKUA 3C15C 4EGJA 4DDWA 3V1MA 4W9NA 3H86A 2HREA 1T2FA 3KOWA 3PD1A 3MJDA 1JMVA 1XHLA 1ZGHA 1J8MF 2CHQA 2LWIA 3WKBA 2B83A 4HQNA 4FC6A 4U7PB 5B3LA 4BV9A 2HUPA 1G3IA 4FOTA 1DBRA 5E1DA 1NK9A 3OLZA 4GWLA 3AUOA 4NLKA 2PWBA 3LBYA 4JKYA 4L9AA 3WJ1A 4DIKA 1OIVA 3OSPA 1T24A 3D8RA 3R7AA 3CJTA 5JAZA 3RYCB 2ZE8A 4MYUA 3SYNA 3WVNA 4AJHA 2CVPA 3S2SA 3W06A 4K6KA 1CKEA 1J9ZA 1I7SB 3NQ41 1WPXA 1IV8A 3C3WA 3HJGA 3X1KA 4M7OA 4ZCIA 4X0EA 2O0JA 5KFIA 4H1UA 1XP8A 3UH1A 3W1EA 4DDMA 4ZFNA 2BQUA 4GYKA 2Y2VA 9ICJA 4QQ8A 3ACCA 3NYQA 5AOAA 5CCXA 3AVWA 3RKSA 1AHHA 2W98A 3IOYA 1IIBA 5IAOA 5JADA 1R74A 3RE1A 3DPIA 4N5DA 4OGGA 4QNNA 3BMNA 1QHXA 4XGRA 4C0AC 5AVVA 3HCWA 4O2RA 4W1RA 5LP6F 1KRPA 2J3MA 3LYSA 5J0RA 2QUKA 4PYKA 3P0RA 1KYYA 1U3WA 4I2AA 1KY5A 1YU9A 2X9LA 3CZPA 4QICA 5HKKD 1QDLB 1GGMA 1QGYA 2PRKA 2XMBA 5MFZA 3GFKB 4DKJA 1VL0A 2ZI7A 4XX0A 4ZODA 2PU7A 4XWKA 1SPBS 1MJGA 3Q3EA 1PR1A 3K9QO 4J0IA 4QOSA 3VNBA 1NRXA 4DNOA 1JZTA 4IOLA 4ZH4A 2QD2A 1XLVA 2Y3IA 1GPYA 3I32A 3KB6A 4I08A 5E1MA 3UPDA 4KVGA 4JP8A 1QHGA 3KSRA 3DZIA 3UG6A 1A9XB 4JJZA 3WC4A 2QRNA 2C9YA 5JHHB 2EZ8A 1ZQRA 1X8XA 2O7RA 3FIJA 5DGBA 1ODLA 1OHHD 3AHIA 3OICA 5HJEA 5F9MA 1ZVJA 2QBYA 1OAKA 2HH9A 4PZAA 4XM1A 5JU5A 1W96A 4DHWA 2EP5A 2VBGA 4DVGA 5AFSA 3D2BA 1DBPA 3I62A 5EIHA 3KR9A 1ORHA 3I42A 4WZBB 2KJ5A 3C0KA 3O0TA 3C6MA 4DPKA 3C3PA 2XI4A 4OATA 1FFBA 2QSJA 4CIBA 4PEVA 1VL2A 1CUXA 1JKIA 4NAHA 4HAYA 3I3SR 3C2KA 4ED1A 4JLAA 3IDOA 1EZZA 1R6TA 1RBQA 3L8YA 1JPUA 2FMHA 3ZW7A 3AM5A 1VE6A 1TLTA 3G1UA 1Z0SA 3OPVA 2YNMD 1NWCA 2PYIA 4NMLA 4PC1A 4TTVA 4WLOA 3UMJA 1RC0A 3G88A 4Z3DA 2IHJA 2VT6A 4F85A 3GB9A 5J0QA 3L04A 1SEVA 3BB3A 2OAGA 4PHHA 3W4KA 1ODJA 3EW9A 3KZNA 3E2MA 4EAQA 3WWCA 3AYXB 2XLBA 3DMHA 1ZVKA 5I7UA 4EVIA 1NW7A 1SVOA 3FNRA 3C5WP 3ET4A 2AUNA 4INJA 4OU4A 2DSNA 3L8MA 3EZFA 3GUCA 2BFEB 1XN4A 4ECSA 1ECJA 4AUKA 4CKCB 2GARA 1Y8CA 3H9UA 3AY3A 2PI4A 2ZIFA 2VNJA 4P38A 3OZSA 1RQLA 4BEVA 1YK1A 4QOFA 2IS2A 5IVIA 4YFVA 3BQTA 4UU1A 4Y30A 4XR9A 4E5SA 2OP0A 4GPEA 1DNPA 1EFPA 2NLOA 1T8EA 1Q0UA 1PBNA 3E7PA 3ONVA 4CCYA 2LIVA 2Q5FA 2J6SA 3FUXA 1BNCA 1P7CA 3L49A 5J4VA 4CTMA 2PGLA 4G5FA 4CKYA 5B1SA 3IBCA 3DT8A 3OHPA 2IGBA 2ZKLA 3BMCB 1KDPA 5JCZA 3HILA 2IMWP 2VHYA 2YWHA 3JQEA 5JTTA 1A9ZA 1JROA 2F2AB 3I76A 3MCZA 4PBSA 3V6HA 1P19A 1J06A 3RS8A 1WA5A 421PA 1XTSA 3H2YA 7ADHA 1BNOA 3IMGA 1UK9A 3QENA 4ZZ3A 3HZRA 4H3VA 4BIIA 1Z7WA 1I7DA 4AW9A 1OLSA 1U90A 1OF1A 4BFWA 1BXGA 2WJ6A 3X1ZA 3ZOKA 2Y05A 1CSEE 3DEYX 3UFXB 2W2VA 1U2QA 2JEZA 2IEGA 4QO8A 3OQMA 4K9NA 3FVTA 3AR5A 5JXGA 3UUGA 4JJGA 1GAWA 2O2GA 5FBZA 3CO0S 3PR2B 3TZ6A 3NHJA 3PDUA 5CR0A 1BE8A 3GWGA 3L7IA 1SQGA 2IHYA 3WLPA 4UB8U 1TTPB 3DV0A 4NBKA 3R0XA 4RZRA 3COVA 4GWGA 3GMSA 2OYCA 5K99A 3PIDA 4WXRA 4BVHA 5IXSA 3DOUA 2QP9X 3OPYB 2J07A 5DMHA 3DEIA 3T0GA 2N9UA 3RLFA 2VHQA 2VI5A 4ICAA 4X44A 1KBOA 1JFVA 4WL0A 4BN5A 4TUPA 2WM3A 3DDNA 3HMKA 5B58C 3DNFA 2ISQA 3BE4A 4X92A 1IHDA 3ZDFA 4CMGA 1YVPA 2HJHA 1O9HA 2JIBA 2RHRA 3LQRA 4CG2A 5KYWA 3O26A 1QIJA 1CF4A 3GRRA 2HY7A 4PYIA 1XAIA 1K4YA 4O0LA 1IZZA 1Z83A 2PFOA 2FSPA 2GRJA 3EPRA 3D2SA 4DNFA 4ZGGA 4UB6U 4LWZA 3C6YA 2OKGA 1CUZA 2V6MA 2ZEJA 3B52X 3PUWA 4NZZA 4BGUA 4DCOA 5F9NA 4FFPA 3JWHA 1KMCA 1GCGA 4O4JF 4K1XA 5DM60 4UTOA 2OXOA 1KWGA 3B6ZA 3NORA 3QZUA 2YV2A 3C7AA 5EHQA 2PD4A 3E81A 4WBXC 1N7HA 1G2OA 2DFKB 1UANA 3FSGD 4XXHA 1M6WA 1EP2B 1FTGA 1Z5VA 1PJSA 4ZOCA 2OLKA 2XUJA 1Z2NX 1DOQA 2XAAA 4YASA 2IS4A 3AVQA 2BFCB 4QJBA 3P9PA 1WPRA 3ALRA 4IZHA 4RIGA 2JDID 3L9WA 3ZS8A 4BO6A 2DUWA 3E23A 2GKSA 1MOSA 4CLOB 1ZP6A 5BVHA 1KS2A 1NPTO 4PL1A 1ADGA 2P9YA 4JUAA 4NATA 1J8YF 1IXRA 2XSZA 3WB0A 1K2WA 1H22A 3FOBA 4QTYA 1KDOA 2DQ4A 4M21A 4YJ3F 1PL0A 2IU0A 3ZZTA 3KLNA 4G5HA 1E58A 1OFUX 4NBTA 2QOEA 3AZPA 3H2ZA 3VGJA 2A0YA 5CB4F 4RCZA 2KPOA 3B9PA 3QKRA 5FOXA 3KTDA 4MFCA 2FMPA 1Z4PX 3SAGA 3FUCA 3GLQA 1VSTA 3M49A 3OEEA 4K88A 4PLCA 2JIDA 5SY4A 4DV0B 4WEOA 5EKXA 3EVNA 3D0RA 5EXXA 2CV1A 4I2GA 1M7HA 2ZUBA 3L4PA 1EHIA 1E1CA 3PZRA 4KPUA 5KT3A 3EW7A 3BIJA 5EWLA 2C2EA 4Z49A 1KBZA 1P2UA 2O8BB 4R0NA 1EFKA 4IQWA 1XA4A 1R4ZA 3OQPA 3AU9A 2Y1IA 1VYHA 4PG5A 1EGMB 1IBCA 1TFUA 2BN4A 1YH3A 3R8FA 2HBLA 4JR0A 3AW8A 2ZVJA 2XR1A 4N12A 3BZWA 5EEGA 2NPOA 3SIXA 4DCMA 2YC4C 2ILVA 3EA4A 3LUCA 3OOJA 4OHBA 4X1YB 4BEWA 1E9EA 3W5VA 1T2DA 2JJ8A 4NHEA 4N8EA 3ZWDA 1P31A 3CZ9A 3HFJA 4IX1A 4WRRA 4XTRA 1TYBE 2RHGB 2ECKA 3O2NA 2XRMA 1Z0JA 3DQQA 4QAQA 4TXNA 1SCBA 4YRRA 2PQ0A 3Q8QB 3STTA 3GEEA 5DDYA 4NNPA 4NYJR 1CY4A 2G6TA 2V97A 1CJMA 3FBWA 4EQZA 3J81k 2C3OA 4ND2A 1X9SA 2A9OA 4G3IA 3HCPA 2ONYA 2EYUA 4L8VA 2P5SA 3NP7A 3WK9A 1NLMA 3JW8A 3SBDA 3QXXA 3ZWMA 5DZSA 16PKA 1ZN8A 3CHYA 4CLHA 1KY3A 1GFZA 5EQTA 2VSQA 3WX0A 4WHMA 1HPLA 2FWMX 3I73A 4TUQA 3HO6A 4AX8A 1HG1A 2BDTA 3MS4A 3PWKA 4MUMA 4KLQA 5HCIA 1KSJA 1RBMA 2DAPA 2Q3JA 3H4TA 2GPSA 1ZEJA 2BGIA 4W5OA 1KSHA 4NS1A 4JJ8A 5IP5A 1E1RA 5FYQA 3KKNA 3N8DA 4NI5A 3VNAA 1VJRA 4AP5A 3NIDB 2CRXA 4JT8A 2WUGA 3WWOA 1I7NA 3EGOA 3OY2A 2AJCA 4LOKA 2BDUA 3A4MA 1BOFA 3JALA 1JNXX 4IRMA 4MTCA 3QX3A 2XVMA 1YOVB 1O6BA 4K9KA 3Q8MA 2ODNA 3T7IA 1ZLXA 2J5XA 3E84A 3PCTA 3TANA 1F5SA 5CEEA 4X20B 4X7RA 4FMCF 2YJGA 3E2IA 2X0EA 5FI5A 5K0SA 2M1ZA 3FAZA 4X90A 4MGYR 4RJLA 2V6GA 4FMPA 4Q6BA 1R5NA 4YT8A 3VKVA 3HXMA 4MVCA 2MHCA 1LZKA 4G9BA 1E1LA 1K5GA 1OJ7A 2YFYA 4RX1A 4E5MA 1NYQA 4OMDA 4CUZA 1PZGA 2Q62A 3SZ2A 4P54A 3VPBA 5JSFA 2C58A 3O93A 4YRPA 2G4VA 4BLSA 4BB9A 1K8QA 4D5GA 3SDSA 2B2XA 2WB1C 2NU7B 2VPZA 2RGBA 3H83A 3VSBA 4F0JA 3U16A 2REXB 3ZKWA 1Q3VA 2O1WA 5EQFA 4DLYA 5BQ3A 5DTJA 3E5NA 9GPBA 4Q7KA 4RQ1A 2ETXA 3GJQA 3NTXA 4IQFA 1SNYA 3R5JA 2I2DA 5HNKA 4MUHA 2KIWA 2PRZA 3KFLA 1HE3A 5EKUA 4ZQGA 5KYVA 4CL3A 3ZNPA 3OQBA 4MJXA 4PAWA 4DIFA 3W8RA 2QSZA 1XKXA 3C85A 3I9JA 4LGMA 1K86A 1V6CA 2PI5A 3AEYA 5EJIA 3SYRA 3TTSA 3UK7A 3ZCSA 1FFDA 1HNXB 1GZUA 4LXGA 1EBFA 3O8LA 1Y6FA 5E1BA 5FEMA 4AD8A 1VFNA 3F73A 1KJNA 4JWMA 2RHMA 3D4NA 4JYZA 1C8VB 1PBTA 4PAGA 3LIPA 3PVSA 4H08A 4NEGA 4Y2UA 3U9TA 3G2KA 4WCDA 4WBNB 4MARA 4TYQA 3G5TA 4OYYA 1Y34E 3M82A 4Q1BA 3VYRB 2JHAA 3H1EA 1CUUA 1O94D 3IDFA 3CKMA 4MWEA 2GPJA 1YACA 3K9CA 4DL3A 3G6XA 1ZG3A 2CXYA 5H9WA 5DHPA 1TAMA 3A6GA 5ENZA 3ZXUB 3KV1A 3GP3A 1L8AA 1E6CA 1X1RA 3AB8A 4I1VA 5E4YA 3T3MB 1TK9A 4LWPA 2BGWA 3VFDA 2OGZA 1CJKC 3D4BA 3PJGA 4MWGA 2H7YA 5TSDA 1GR1A 2OCXA 3UQZA 4L7VA 4LRYA 1G5PA 4DIEA 4KZKA 1JVSA 3AUYA 3NVMB 2XXAA 4UHEA 3KHSA 1ZNYA 2NYAA 3AY7A 1TMGE 1SV4A 4KO2S 4BEBA 2RKWA 3JQ8A 3VDNB 1F0NA 1XB2A 2H2IA 3IKJA 4C06A 1L5WA 2JFQA 1XWLA 3U7RA 5J2TA 4N5MA 5LJLA 4HDRA 2I22A 2Z5FA 2R48A 3NWBA 5KWSA 3DCJA 1FNNA 5CLGA 3D4IA 4GM0A 3F8TA 3QBVA 3WMFA 5GINE 3P2IA 4F50A 1OX4B 3PUIA 3OQVA 1SU6A 1QCCA 5KNIA 4UQGA 1ZQTA 2LKDA 1T34A 1HSOA 3RJFA 2PO7A 2YY6A 2QDXA 1AKUA 1YUBA 1U8YA 3TQ1A 3N97B 2FZ5A 3N0WA 3MWYW 1V1MB 1QHHA 2QRPA 1GAXA 2CFSA 2GBGA 3CISA 5E1OA 1GR0A 1CRWG 2FX2A 1RIFA 4DCCA 2HWKA 1K8RA 2WILA 5GJWC 4EYSA 4HXGA 1W4AA 3HXTA 4BNWA 4XRGA 2OBYA 1MGPA 2P9ZA 2GXUA 4FGKA 2X8JA 2BSAA 2BELA 4OI0A 2G9VA 2FWPA 2C7VA 2NAFA 2VO1A 4A0GA 1L8OA 4IRDA 2JFNA 2ZYWX 3GRZA 3JQ9C 1GCAA 3UK6A 4ZIRB 3LDAA 4MK4A 5CD1A 4ZC8A 3CKLA 1JQEA 3EWAA 2XMZA 1L3SA 4X5OA 1RMQA 1QZUA 3N74A 5LIPA 3AJ9A 1QGZA 3EB9A 3JZIA 3LBNA 4N8SA 4NONA 4YMSA 5BQPA 1R2QA 1SXIA 3ZQUA 2XA9A 2OM6A 3B1FA 1CQZA 3OMLA 3TD6A 4CQJA 3PYXA 4HCJA 4II3A 3FYUB 7REQA 4A36A 2DMRA 3I39X 4TRNA 4LJXA 3AJRA 5DHFA 1JU4A 4LXTA 1BHJA 2DHDA 1CR4A 2NZ2A 2JLXA 4UTVA 4XI9A 4KP7A 1D9DA 4D99A 2VR1A 3DZBA 1Q1NA 1FU8A 4G0XA 2ODWA 3ENWA 1MX3A 1J2RA 3OC6A 2AOXA 3H0EA 4OQZA 3C2QA 3MGAA 4HNSA 4PU0A 4URWR 3WSVA 1LLUA 2FVXA 3QFRA 4ND4A 4RTRA 4L8YA 3BDVA 3LOUA 4WEQA 4KFSA 1EK0A 4JNKA 4EKEA 2XBMA 3VTAA 3HKZC 2Q28A 1KMMA 4QQKA 1K1SA 2YVLA 2QJWA 4TMVA 4AZ0A 1NN0A 1V7CA 2Q0ZX 5AHKA 4F6CA 2WSSA 5MHTA 1RQXA 3ZJYA 5JSKA 4YFKA 3NM4A 3OM9A 4RQMA 3BICA 1EI9A 1G3UA 2PL5A 1WCV1 1Q12A 3SU8A 2R8JA 1XZPA 2NV6A 3UB4A 5A4IS 3K8YA 2NZUG 8ICUA 3OTWA 1UMKA 3BWCA 4H7DA 3DZJA 1EU1A 3GJRA 4BQNA 3K70C 2JRLA 3TR5A 5AKLA 2BKUA 4U7FA 1VCOA 4UAZA 3MGKA 3WB2A 5CYGA 5TVGA 3RS5A 1PVPA 4MVJI 4BMSA 1BN7A 3IOCA 3BCHA 1J2YA 3HO8A 1UFKA 3GZ4A 3KUUA 2DLNA 4GOMD 1ZQVA 4ZI7F 4X95A 4MYRA 4HYTA 2AQ0A 3R9IA 3WLJA 1SC3A 5DBEX 2YMPA 4MUAA 2HFKA 5GZ6A 4CLXA 1RQ2A 1N0WA 1R5BA 4FR2A 4IWNA 1VLMA 2Q2QA 1Z5PA 1YB2A 1H8EA 2GCOB 2X0KA 4YQWA 4RK5A 2XIQA 5IM4F 4MEYA 3R5KA 5JJBA 1FU4A 2P11A 1BXKA 4KLLA 1Y4SA 4L27A 2EAUA 5EP1A 3TIGA 3HKBA