5EE1A

Crystal structure of osychf1 at ph 7.85
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
373
structure length
363
Chain Sequence
b'RPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRHAGEGLGNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 115
structure length 363
sequence length 373
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee1A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee1A01
4I1SA 1YQTA 5FOTA 4AYXA 3IO3A 1G6OA 4WZAE 1W4RA 4M2LA 3FMIA 2AFHE 1SVOA 2XEXA 3QF4A 3QKSB 1RVDA 4TYPA 2C03A 1S3SA 2QZ4A 3NVVA 2FNAA 1HA3A 1WRBA 1U98A 2JIZD 2OG2A 2VP4A 3W5JA 1OFTA 4QG7A 3NC0C 2PX0A 2WQYB 2ZYUX 1DGJA 3P26A 3HPQA 3P4XA 3ZIAA 5AJZA 2XJ9A 2QBYA 3IKJA 2NPIA 1ODFA 1NYQA 2VSOA 3AVTA 4HAWA 4X8HA 1S8FA 5IK2D 4R2IA 1NN1A 3KTAA 1WGKA 4OI4A 3IHWA 5HKKA 1YQ4B 2ZI7A 4L8GA 4P0TA 2GAAA 1J8MF 1VCMA 3OIWA 4OJQA 4LRWA 2OXRA 1OHHA 3AE3B 4ERNA 4O0MA 1GNQA 3A1SA 3G82C 3QKSA 2TMKA 4B74A 1PUTA 1V8CA 2FSIA 2REBA 1T6NA 4NYJQ 4Q7MB 3HYRA 4BFSA 3IBYA 3KB1A 1C9KA 3NDPA 1GAJA 2WSSA 1YQ3B 1Q1QA 1KK0A 1VDZA 4E5UA 2X2FA 2RHMA 1UKVY 1XXHA 4BLTA 4JVSB 2R6GA 2RGGA 3CPEA 4OHXA 4MITA 3QXCA 4HATA 3R8CA 2AN9A 1W36B 3OHMA 1MV5A 1NVXQ 4EFNA 5BN4A 2DFTA 1MO3A 1CJVC 1KI7A 2G1JA 5K8UA 4CEJA 4DIEA 2RHDA 4GP6A 4A92A 2ZSEA 1KO4A 3P63A 3BIID 3HVZA 5KDLA 2IUSA 3AF1A 1XXHE 1NY5A 3GLFB 3FHTA 5A5GA 2QMHA 4FW9A 4UKDA 2AWNA 5KPDA 1N6LA 2H7VA 3AF3A 3LVRE 1CJTC 1M2OB 2GA8A 2GBLC 2PBRA 1SXJA 1HH4A 2ZE8A 5H70A 2CCKA 2ZTSA 3AB3A 821PA 5C4GB 3KFXA 3TUJC 1E2JA 1GIAA 5EXSA 3Q7PA 1EGAA 2YV5A 1OKKD 1U90A 3HWSA 5FPHA 2Q3HA 2R6FA 3CNOA 4OHWA 3PEWA 1UAAA 2IYZA 4MYTA 4XD7A 3MWJA 5G3YA 4BEJA 2AL7A 1AGPA 2CJOA 2PEZA 2CNWD 5CB8A 4JT2A 3EA5A 2GAOA 4TTPA 2WMOB 4JL8A 4ZPXA 2W2TA 3NVZA 1AK2A 1JEDA 1SXJE 1IY1A 3RS4A 1I4TD 1YU9A 1W0KA 2QEQA 4Q00A 3I73A 3LX8A 1E2KA 3IQXA 1L6VA 3GJ5A 3W9YA 1SKYB 2NQ2C 2SHKA 4RJLA 2HUPA 2WOJA 1FMJA 2VP0A 4P33A 2DHRA 5SZIA 4BLOA 3VHXA 3GJ4A 1KKMA 2BMDA 2B92A 2FU5C 621PA 3PENA 3U4QA 2HCJB 1RWSA 5GXGB 1GFIA 2R2AA 2WAYA 4FCWA 3EIQA 1ANKA 1XTKA 4Q02A 4D4MA 3SOPA 1QG4A 2BS2B 4JL6A 1N6PA 4Q48A 4JIMA 2H89B 2DR3A 2KMMA 2HYDA 3L0PA 3TW4A 4AD8A 2RGXA 4Q7KA 1GNRA 1FL9A 2XSZA 4Q7LA 4OI1A 3U3JA 3AVUA 2BBWA 4M1WA 3ND8A 2F1JA 5IHPA 5JI3E 1W46A 2JLSA 4B3CA 3GJ3A 5JSZB 1WBBA 4GMXA 4QHSA 2RKOA 1VYTA 2HLDD 4UNQA 1Z0AA 1KK3A 1U9IA 1E9DA 3LH5A 4XTRA 2ZQ5A 4GZMA 4PSKA 3FKQA 2Q21A 3ABVB 2VO1A 1WRIA 2R8RA 3A4LA 3CRMA 4TQ9A 3U3KA 3VR6A 3VKGA 2DCUA 1KMQA 2IF2A 1GZSA 3O8RA 4KBFA 4DEXA 1OPXA 3JZMA 4LYJA 3QOFA 5DHFA 5CK5A 2FJUA 3Q85A 1LF0A 3QG1A 4A15A 4HDQB 5DI3B 4C0HA 1OH7A 1ZRHA 5FI0B 3CF6R 3MD0A 2JJ2D 4QHTA 4LSGA 3QXHA 3AV0B 2I4IA 1E4YA 1SVIA 1P2VA 2YZ2A 3AKEA 2WKRA 4JVLA 2B76B 2FZLA 2V4ZA 4KLNA 3RRNA 5KYKA 1CEEA 4C2TA 3QEJA 4A4DA 2C95A 5LD2B 5EE0A 1NSTA 4DLTA 3B1ZA 4B33A 1N2CE 2V55B 5FOXA 3KL4A 4DLSA 1TMKA 2QE7D 1U0HC 4MDEA 3AVXA 2F7SA 1JPNA 5CJ2A 5L3VA 4US1R 3W9CB 2WKPA 1TF7A 5DI3A 2NO1A 1SVWA 5B57C 2CL0X 3RVBA 3P1MA 2ZRAA 2WWFA 4OKSA 1SXJC 2GXAA 5AJXA 1V43A 1EFRD 3I8XA 3QVUA 4QBIA 5LBIA 5LB2A 3MCAA 1OIXA 3SEAA 4HUTA 5KSOA 1Z5ZA 2QMUA 5FPSA 1FNMA 2EFDB 3IIKA 4IVRA 1W48A 1QOAA 2QIEB 4CIDA 3AECB 4JX1C 4CT5A 1H8EA 3AQ4A 2JLZA 3LO5A 3KKOA 2IYYA 2FA9A 4V0OA 2QQEA 2A5JA 2IBMA 3LLUA 1P72A 1FXAA 4NYJR 5G3ZA 4PAOA 3CF0A 5KSPA 1EFTA 3EPHA 4RD2A 4KX6B 4C3ZA 3W6PA 2CLDX 4AYTA 1KI1A 4RD6A 2E87A 3FB4A 2V7QA 2G0TA 1Z0FA 2GETA 2F9LA 2J0UB 3FDIA 1VPLA 2FFQA 4RD4A 4RKFA 4USAA 5FR1A 3B1VA 3BIFA 4A36A 2R62A 4JKYA 3CRW1 2NMVA 1SVLA 4AG6A 2OHFA 1N5XA 3AEFB 1KIMA 1HEIA 1UDWA 1PDXA 2K22A 2EFGA 1ZNWA 2O0HA 3W90A 2R6DA 2CVHA 3L0IB 3BH7A 4V0NA 3A37A 2MMGA 1SVKA 3U61B 5DN6D 4B76A 1NJFA 5FOUA 1ZNXA 2EVWX 1MH1A 3W8NA 1VMAA 5DISB 1XPOA 1MO4A 4NMMA 4URXR 1JECA 2C78A 3K9GA 3D6TB 4CVNA 5GADl 2J0UA 2GEDA 4H9GA 2FG5A 1ZIPA 1GL9B 2P67A 3AE5B 2ZM5A 1QVAA 4G5OA 5FUWA 4RVCA 1QBKC 4TMZA 5C2JB 3RHFA 3PG5A 1R6BX 2QSYA 1G7CA 1PLKA 1FX0B 5FTMA 1AS3A 4PPFA 3A36A 3T5DA 3I3SR 4B2IA 3MLEA 3BB1A 1ZD1A 1S9HA 2HCBA 2WDVB 4LX0A 3SJAA 3REFA 5JS7A 1G3UA 5LDDC 1H8HD 1PLJA 3ZVNA 1ZP6A 5SZKB 1ZCAA 2C99A 2QGNA 3TK1A 5EXXA 1XEWY 4OK6A 1XLOA 3RWOA 4I81A 2CMKA 1G8GA 2WWHA 4QOSA 4GL2A 3B60A 2G88A 2ODWA 1UEJA 4JZKA 1HE1C 4AIIA 1TEVA 4QM6A 4PC6A 2Q9AA 5G5GA 2WMNB 2ZJBA 4IDHA 3PR1A 4FINA 4XH9B 1N6RA 3WY9A 2ASEA 5K8IA 3CH5A 4TWZA 2QA5A 2DWOA 4Q1AA 4YDHB 3SU8A 2G1EA 4Q4JB 4RD0A 4FCTA 5JRJA 1PZNA 2ZSBA 4BE7B 2DFLA 3L2OB 5CYPA 4M1SA 1XLNA 3AH7A 3CW2A 4HZIA 4UJ3A 2C98A 5CYOA 3D7MA 2G3YA 3U7GA 1X8LA 3TLXA 2HJVA 2VA8A 4YMTA 1OFFA 3TSWA 1T9HA 4MRRA 5KUTA 2IS6A 5EZ6B 3HJNA 1CBUA 1TADA 4TTQA 2EFHB 3R9IA 1FRDA 1IN8A 3RS0A 1NMYA 3HR8A 3KDSE 1KI4A 3T06B 2ZITA 2IYVA 4IOJA 3EARA 4HYYA 3X1WA 1P5ZB 1G3RA 5EXTA 5TB5A 1BMFA 1NKSA 2WIAA 3I92A 3Q3JB 3B85A 4Q4JA 4W5HA 5EZ5A 3T5GA 2IS1A 2BHRA 5KU1A 2HT1A 1XJ0A 3RYTC 1EWRA 1S4QA 1W5TA 4KHZA 2ZJYA 4WAUA 2OBNA 2W58A 3TKLA 4ARZB 5JS8A 3LNCA 3LX5A 4B71A 3BK7A 3DO6A 4Z1MD 4KFSA 4PO8A 4DB2A 1AZSC 1QRAA 1NG1A 3O8DA 1GNPA 1KAOA 2CCJA 521PA 4LOAA 2AKAB 4Q1FA 1COWA 4C0QC 5E3HA 3QJYA 2C5LA 1T3SA 4BQSA 4PC1A 4BASA 1G9XA 1II0A 1WP9A 1A1VA 3GLHB 3LA6A 2PMKA 5JCZA 3AUYA 3K53A 4QBHA 2MSCB 1VTKA 2OESA 2Q9BA 1S0UA 5TDHA 4WXPA 2HXSA 5FR2A 2GK6A 2MJ3A 1QOGA 2DY1A 3C15C 4ARZA 1NBMA 4GDFA 3CH4B 2RH5A 2CL7X 1ZM3A 3LWNA 3UIEA 1QHIA 2J5XA 2XNDA 4B3BA 1FPMA 1CP2A 3PFIA 5JFGA 4HLCA 1J7BA 3P27A 4KO8A 1VG9B 1FUUA 2H17A 1TQ6A 2PCLA 5B30A 1KOFA 5G40A 2K9XA 4ITKA 2Z0MA 1SQ5A 3PUYA 3GLHA 1GTVA 3SQWA 1A5TA 3SR0A 4C2UA 5BN5A 3DOFA 2A5GA 4AI6A 1E4VA 1Z6YA 1SVSA 2VTKA 4I4LA 1N6IA 4RZ2A 3V9PA 3PEYA 1VDVA 1C1YA 1KO5A 1WQ1R 2WJYA 3K70B 3GJ8A 3PUXA 3KKPA 4MGZR 3EASA 1FOEB 2ZRGA 3KKQA 4B3DA 2MSDB 1R0WA 3NWJA 3OEED 1OH5A 3EC1A 1R5OA 1AS0A 2ERYA 2JGNA 3CX7A 3F3YA 4M9QA 4OQLA 3T34A 1LS1A 2HEIA 4TL8A 2J7KA 2GESA 1AQYA 3QF7A 4ESHA 4JL5A 3DDCA 4GPTA 1HT1E 4OQFA 2JIZA 1FRRA 1G5PA 3CONA 3GEIA 4PX9A 4F38A 3LAWA 1E32A 5GJCA 4A0GA 4HZUA 2ONKA 5EE3A 4MRNA 1ZIOA 2NOAA 5EP2A 1RRGA 1UKEA 4NL4H 3VR9B 4G3XA 4HB0A 4MUAA 4MYHA 4DLWA 1RRFA 2I1QA 1G7RA 3Q5DA 4EPWA 3OF5A 1IHUA 5TARA 1M7BA 3QI2A 5IDVA 1RFLA 1Z8FA 2JLXA 1KI6B 3K9LA 4DCSA 3EIEA 5CK4A 1RYFA 1OXXK 3TQCA 2BBOA 2QPTA 2C04A 1N62A 1N3BA 2W0SA 3PVSA 1QG2A 3NBFA 3LXXA 4A0RA 3ADDA 1A2KC 2QM7A 2O8DB 2JCSA 4M8NE 1K5DA 4PSAA 4RZ3A 5LPNA 3PITA 2BOVA 5HR5A 1UWMA 1TEXA 3Q5EA 2O8FB 1ZM9A 3NXSA 3WBKA 4O2LA 1CR4A 2VHQA 4URUR 4ZI2A 4LJ9A 1ZU5A 4DRZA 5FUXA 4TQUS 2Q0HA 4A8JC 4ZV4A 4B6FA 3NEYA 1GM5A 4C7OB 2XXAB 4QHYA 2JA1A 3PXGA 1SVMA 4PXAA 4FIDA 3WMGA 1KSJA 1KJYA 1XWIA 4YXWA 1CTQA 4OJKA 1G5TA 3PEUA 3D3QA 4MYCA 5CJPA 3U7EB 4J0QA 1OW3B 4KXFB 3C5CA 1L0VB 1FFUA 1D5CA 4LBVA 4PFSA 4EKDA 3U6BA 1KYIA 2GXQA 4DDUA 4R9UC 4TSFA 2XTZA 3EG5A 4HDCA 2Q6TA 2O8DA 2FGJA 1P7CA 1Z06A 2P5SA 3UATA 4P3YA 4B48A 1GL6A 2ZYVX 3FKSD 3KFVA 2IYLD 5SZHB 4OK5A 2RGEA 2O8FA 3OIUA 5FI1B 2A2ZA 3QXXA 1TTTA 2B8WA 1UM8A 1X3SA 2J87A 2Q9CA 2ZI9A 4B73A 1E3MA 1ZUIA 3B5JA 3CM0A 2YJTD 2FEOA 4L15A 2XXAA 3B1WA 1OFUX 4BEBA 3NBYC 4LV6A 2AX5A 4MRPA 1I7HA 1X8JA 3IBGA 4TL7A 4C0BA 1FFVA 4YTMB 4X8OA 4QJ5A 4Z8XA 2YWFA 3OE7D 3EUB2 2ZU0C 1LW7A 3AF0A 1ZAKA 3NVAA 2K5PA 2CK3D 3X1YA 3KQLA 3U7FB 3AEBB 1E9MA 5G53C 3DEFA 1N0VC 3W8RA 2OSBA 5AJWA 4MA4A 3HR7A 3NTUA 5J4HA 1DAGA 2OO7A 4PSVA 5L3RA 4HI0E 3LW7A 2Q3MA 3QKRB 2WP9B 3BFKA 3D8BA 1IJEA 4JSTA 4RCYA 2IUUA 1IM2A 1RYHA 2GJ9A 2OEPA 2NZJA 1R5BA 2ZJ8A 1VHLA 2UZ3A 3K1JA 4Q18A 1FMLA 1JQJC 1KDRA 4MRSA 1UBCA 4C80A 1A7JA 3ZZ0A 1U0JA 3TAHA 2IWRA 3TH5A 3THWB 2GZDA 4M4SA 1QHYA 1NY6A 2ZRLA 4S2EA 3U7HB 1E99A 1GRRA 2QPOA 3H4MA 2ZAOA 1E2QA 1E2FA 3Q72A 3DZDA 3AEDB 3IGFA 5TMPA 2FGKA 1AS2A 1G7SA 1U99A 2JAQA 4HAXA 3RRYA 4B6EA 4KVAA 5FOVA 3K0CA 1TL7C 5DGXA 3AGPA 2ZRIA 3K70C 2XX3A 1EWQA 2ZUCA 1ZXIA 4MKGA 2HLDA 3AEAB 1QHHA 4BFTA 3KJIA 1Z6TA 2WWIA 3C41J 5FUYA 4M1KA 3B9PA 4A2PA 8OHMA 4XWKA 1T8UA 2A5DA 1SULA 2IK8A 2BS3B 4N6EB 3EW9A 2A78A 1HUQA 4I1VA 1QHNA 1P6XA 4FI3C 1JXMA 1UFQA 1XCPA 4M22A 4D0LB 1AJEA 3C8UA 4OHYA 1J90A 1B9RA 2ZRJA 5H92C 2WM9B 3CIOA 1GKUB 3RLFA 1ZJ6A 2JJ2A 5ELXA 5FTLA 4PR0A 2CEAA 5JWRA 1ZD8A 4N59A 3NRZA 3ETLA 1GRNA 2WWXA 1L4UA 3ONWA 3VKWA 5L8VA 3ZDQA 1F48A 3DKVA 5GVRA 3AE7B 5EP3A 3VMFA 2JQRB 2ACZB 1AIPA 4K8OA 4WZ6A 1PV4A 3PQCA 3GFTA 1PFDA 1NJGA 2KAJA 1FIQA 1VG8A 4NCHA 5AUNB 1YJ5A 4F4IA 1W2HA 3WHKA 4ZCIA 4HLUA 4EAQA 1T5IA 2D2EA 1KJWA 1DARA 2Q5WD 2WPDA 1ZNZA 5FBVB 3AP1A 2J7PD 5A0FA 1WDTA 2IXFA 3AVPA 4JLNA 2XJ4A 4QC2A 1OYYA 5MPOA 3RRMA 3VX4A 1XX6A 4DKXA 1S1CA 4DCTA 4YT0B 4ZIRA 1EFRA 3K09A 4Q9KA 4DT1A 1XMVA 2V54A 4D4LA 3CNLA 3B13B 1ZP0B 1SF0A 2LKCA 1E79A 3PIRA 4NDZA 3REGA 4KITB 1XMSA 3K9HA 4HSEA 4NONA 3T12A 4XOIA 2FWRA 4XWOA 1VCNA 4GSYA 5JWHA 2IYXA 2FE4A 3B7GA 1Q22A 5FPTA 1CR0A 1GUAA 3UMRA 3ZQJA 1Z63A 2IT1A 1CIPA 3L43A 1WYGA 4X8LA 3U6KA 3JVUA 4DHEA 4IRUB 3ZVMA 1Q3HA 3B82A 4AG5A 2V8OA 4KYUA 2YINC 4HAUA 1AKEA 3Q9LA 5KNBA 4YXDB 1JI0A 4DXAA 3MRSA 3L0OA 4Q19A 4LC1A 1Z22A 3RABA 3RANA 1NIJA 1M7GA 3AV8A 2H57A 4C9BA 2IXGA 2VHTA 3BOSA 2CXXA 1G8FA 1YR7A 2C9CA 1XMJA 1DAFA 1LV7A 1DE0A 3CNNA 2OBLA 1W7AA 1E96A 1TX4B 4ESVA 4QXAA 4BFVA 3V4FA 3H84A 3GEEA 1OSNA 2WTUA 4C7YA 3LLMA 4DCNA 1PUJA 4LV8B 2JLYA 2W83A 3THOA 4PC3A 3T1QA 2A30A 2WWWA 1R2QA 1R4AA 3E70C 3K0CC 1LB1B 3SQXA 1XD2B 4BUJA 4D25A 3KZ1E 5DN6A 4TTRA 1FO4A 2ZR0A 2AXPA 3A58B 3SC3A 5J47A 2QM8A 3ZH9B 2ERXA 1CJKC 4OK3A 4QGAA 1WXQA 5JZVA 2RGNC 3FYHA 4IFBA 3CF2A 4ZHOA 1E6CA 1F5NA 1QHSA 1E2NA 3O8BA 2CHGA 3J81k 5H8WA 3L82B 1P75A 1VYUA 1A82A 1CRQA 3GJXC 3BERA 1DAEA 4A6XA 2WS3B 2ZJ2A 4ASUD 2WLBA 1ESMA 2E9SA 1VYVA 4BZQA 1JPJA 2IYQA 3KUCA 2IF0A 1H8HA 4IFEA 4Q9IA 1FUKA 2ZREA 2YOHA 3CX6A 3HU3A 5BYKA 3GPLA 2QRNA 4LJ6A 2GJSA 2H88B 2JDID 4W9MC 2E1RA 4TT3D 5E95A 3BGWA 2AWOA 1ZD9A 3CBQA 4ON9A 2BIFA 2Z4SA 1QF9A 4QBFA 2VLIA 2OAP1 5FL7A 5KOYA 3WYFA 2P3SA 3KWLA 3AVVA 4Q5IA 4DZZA 3TUZC 2C96A 3NH6A 4JYBA 1M34E 2CVFA 1JRPA 2LWIA 3GLFA 4Q4AB 4BFUA 5CDFA 1XLQA 3ZVRA 2W6JA 1TJEA 2QMOA 3GJ7A 3TSOA 3K09C 1IN7A 1KZ7B 4OYHA 2REXB 3E5HA 3QNUA 1WE2A 4YSXB 1GP2A 1VJKA 1KTVA 1DEKA 1F2TB 3LBHA 4JLMA 4LPKA 3B2EA 3OFND 4V0KA 4BFYA 4LBWA 1YZGA 1OIWA 2WKQA 4E09A 3THXB 5JCPA 3X1ZA 3IILA 1MABB 1OQRA 4BPBA 3BE4A 2FH5B 3GJ0A 1QHXA 2YNMA 2Z5FA 3I62A 3GLFE 3FFAA 2WDQB 2IYSA 1O3YA 3CKLA 3CX8A 5CDFE 2C9OA 3RAPR 1T0HB 4Q4AA 3AN1A 4US8A 5FPYA 1KSFX 4BFWA 5HTKA 2JLWA 1N6NA 2VH5R 4YMWA 5AR1A 3CLVA 3AVQA 2ATXA 4Z1MA 1YJJA 2AKYA 2ZAMA 4A0HA 3ZD7A 1RPZA 1Z08A 1X8KA 2J0SA 5G5HA 5BXQC 2BJVA 3U44B 1F2TA 2QTVB 2O0JA 1R0XA 1DBSA 1G4AE 1W49A 2WU2B 4YTNB 4D2IA 1DAKA 2GF0A 3EXAA 3L8ZA 3WYAA 3THXA 4A9AA 2BBSA 3P4YA 4YC7A 1CR1A 2UZIR 2GRJA 1KO8A 4LHXA 1OT3A 3GFPA 3M6AA 4N3NA 2OLKA 1MABA 3QVVA 4KFUA 3NKVA 5L3QB 3AEGB 2QP4A 3OAAD 4LC0A 3ZS9A 1WBDA 2FN4A 4US0R 2FBWB 3PV0A 4CRWB 3C7KA 1KDPA 2AK3A 2N46A 1KDOA 2QT0A 1NNEA 4JJKA 4D4JA 4EPRA 3KJGA 1DTSA 2GK7A 1N63A 1L4YA 1UJ2A 2XOKA 4PPGA 4LBZA 3IEVA 5CLQA 1SKYE 2M19A 3AE8B 2A5FA 4KFTA 2IS2A 4FWIB 3HP1A 1CF4A 1YKSA 4ZI3A 4BGDA 5JSZA 4AKHA 3U44A 1FTSA 4KU4A 4BLPA 2PEYA 3HRDD 4P31A 4MRVA 2J59A 2F9MA 3B78A 1XBTA 4B3FX 2OFWA 4UXJA 1HQCA 4KI0A 1SIJA 5L3QA 4Q1EA 4OL0A 1XRJA 2ANBA 1E2DA 2RMKA 4OQMA 5JLJA 3AP3A 2BC9A 3NG1A 1ZNYA 2ZSDA 5F3WB 2ZRHA 4JLDA 3ZJYA 3EZ6A 2P0EA 5H68A 1G3MA 1G3IA 4O2RA 4LTUA 3AP2A 5E7JA 3KQHA 1DS6A 3I72A 1RW4A 1GPXA 1A2BA 2ZRMA 1E1RD 2GHIA 4KODA 4OQNA 2O8CB 3U3RA 1HE8B 3B1XA 4L4UA 1W36C 2J41A 3WCQA 2ZIAA 1JEEA 1NLYA 2A7QA 1S96A 5DLQC 2G9NA 4DLYA 1NMXA 4G1UC 3THYB 2IYTA 1G64A 1OB5A 1N0UA 4BZPA 3PO0A 1XTJA 1ZMXA 4XTCS 1Q57A 4KSCA 1FQKA 3VR1A 4NYIQ 2L52A 4LUCA 4LGMA 3VX3A 5JI2E 2ODNA 3ZVLA 3ZQ6A 1EX7A 3GMTA 1W47A 4DSTA 4YTPB 3QQ5A 3GEHA 3H2YA 4POAA 4MGIR 3CWIA 2NO0A 1OIVA 4XWAA 2NG1A 1JALA 4ITRC 1GAQB 1G8HA 3SJCA 1KO1A 4XJXA 5JEEA 2GJ8A 4O3MA 2QP9X 4LI0A 4LHYA 2WV9A 1AM4D 2GKSA 5CLLA 2GJAA 3QE0A 5BQ5A 1L6UA 3SR6A 1RJ9B 4G5QA 3UANA 2D74A 3OEHD 2G0NA 2OCPA 1I4LD 4IVPA 4CDGA 1YR8A 4U7DA 1A4RA 1TU4A 3FTQA 3IPYA 3MG9A 1UBGA 4HUQB 4IDOA 2YYZA 3QBTA 2WDRB 4LYFA 1S3GA 2FX3A 4D80A 5KSZA 1P73A 1QHGA 3ZIAD 4AWXA 1LNZA 2PT7A 3SFVA 2JX5A 5F9HA 1D6JA 2GEVA 4V02A 3RRZA 3M1IA 1XPUA 1XD8A 2ORVA 4E07A 2ZI6A 5HKKD 2H16A 4IOKA 1E1QD 2IA5A 2QAJA 3JVVA 1SB3C 4I99A 4LZZA 4Q1BA 1RJ9A 4EPVA 1A70A 3VRBB 2VQSA 4M21A 1CKEA 2XAUA 2FPLA 1GG2A 4LHVA 1U9IC 4UNPA 1T91A 2G6BA 3IPXA 4Y0AA 1MO6A 5DYIA 1G291 2PIAA 4D26A 3SFZA 3SE0A 4HUQA 4CEHB 2QG6A 3UK6A 3QXSA 4QM7A 2C2HA 3QBVA 4DLRA 5KPJA 5E7IA 4HAVA 1XLPA 1U81A 2QORA 5CB6A 1JR3A 2OCBA 4P4TA 2QAGB 2VSXA 3SI7A 4TLAA 2F43B 2RAPA 1G20E 1IJFA 3AEEB 2GDJA 4TMVA 3ZYYX 3F5FA 3GP8A 1LVGA 1ZC4A 4FMCF 2V3CC 3HU2A 1PJRA 4GBMA 4RY2A 3CRRA 4I1UA 4U5XA 3GFOA 4ZKEA 1KMHB 3RNLA 4DUGA 3VR4A 2LEKA 1O87A 3CR8A 5M04A 3AUXA 2RCNA 3PEVA 4BZXA 4UNNA 5AUPB 1UEIA 2JEOA 1JR3E 1U2RA 3IIJA 1H65A 1FX0A 2W6ID 3NH9A 1Z07A 4D81A 1D9XA 1E9RA 3S1AB 1NKTA 4P32A 1SXJD 1JXOA 4CYMA 4TYWA 2R6CA 4JT4A 2ZANA 2RB4A 3AF4A 4CF7A 2O8EB 2IHYA 1ZC3A 3BWDD 4LJ8A 4JYCA 4PHFA 1P9NA 1R5NA 5LD2C 1P60A 1QOFA 4NHOA 1WWTA 2W55A 4LJ4A 1KMHA 3LB8C 1T3LA 1K6MA 3R8FA 2AXNA 2EYUA 1KSHA 1OV4A 3WMEA 2ZRDA 4OHZA 1Z28A 3ZS8A 4B2LA 2JJ1A 5CIWA 3EZFA 3VFDA 1T0JB 4IW3B 2OAQ1 4LPSA 1TF5A 1Z3IX 1HY3A 4NU0A 2AR7A 1ONBA 1KY2A 3VR2A 1P2TA 2GXUA 1XCGB 2P5TB 1DPFA 4WXRA 5KSYA 3FGNA 2DB3A 5J4VA 1L7VC 3HU1A 2O8EA 4WQMA 4N58A 3MAAC 3IDQA 4QNMA 1JNYA 1XO3A 2MJDA 1V5WA 4NH0A 5CM9C 1LTQA 2VHCA 4MYUA 2W3RA 1NN0A 2HV8A 1KSGA 4DDTA 2KE5A 2C8VA 3LXFA 4U02A 4OQXA 1YHNA 2P2LA 2WSMA 1LF5A 3I8SA 2FEMA 2IWHA 5H1YA 1W4BA 4MKFA 3AVWA 2WVJA 1SHKA 2DYKA 1NG9A 2YWGA 3KX2A 5FOSA 1IUEA 1WCV1 2ZVQX 2NPFA 5BN3A 2IL1A 3OZXA 4B2PA 3WNDA 2C9YA 5J4LA 3ICQB 2OZEA 3K0SA 2EFEB 1QT9A 3IO5A 3VNUA 1S9DA 3RSLA 4PC2A 3P4SB 4R2HA 3R9WA 3SYNA 3QEOA 2PJZA 1N6HA 1SGWA 1XZPA 3BBPA 1DG3A 4RCZA 1JROA 1G1MA 2QI9C 2X2EA 4EPYA 3PJRA 3DMNA 5HPYB 1BH2A 2EFCB 4DLUA 1NN3A 3BJIC 1Q44A 4HB4A 4QGFA 1DO2A 5JWOA 1Z6GA 1IAQA 4B75A 4JLPA 1DADA 4NYIR 1RFKA 3X2SA 5H8YE 1NBME 4M9XA 4E22A 1TQ4A 2ZE6A 4FMDF 1ELOA 1DAHA 3DL0A 4XVUA 2REOA 3H1TA 2ZJZA 3UMSA 3SBEA 2FOLA 1LFDB 3ASYA 1P2SA 6Q21A 2KSQA 2LKDA 4V0LA 4EJSB 2NTYC 5AUKA 3K8YA 3KB2A 2GZHA 3ASZA 3I32A 5TXGA 2F1HA 4KAXA 1UDXA 4GP7A 2H18A 2ODEA 3F8TA 3GLHE 1HT2E 4A2QA 3QPUA 4O25A 2ATVA 1ZVQA 3A4NA 5BYJA 1DOAA 1T8TA 2NGRA 4ZCMA 1IONA 1LY1A 4LV5B 1FZQA 3K0AB 4D6PA 1L2TA 1DELA 1U8ZA 5FUVA 1OXSC 1CZPA 3A6PC 3TQFA 4NTZA 1S2MA 1EXMA 1TF2A 5IK2A 4DEYA 4B34A 1IBRA 3BXZA 2BS4B 2JLQA 4D4KA 1IXZA 1JAHA 2GCNA 3C16C 1OH6A 3VTKA 3KKNA 3FFBA 3VKHA 2W00A 1H8ED 4P4SB 3TR5A 4DCUA 3E1SA 2IUTA 3NHAA 4H1VA 4FCVA 2D7CA 2GZAA 1Z0JA 1CXZA 4HDOB 3DZ8A 4AKIA 4Q47A 3KXKA 1YZTA 1E9AA 2BBTA 4GOJA 1F2UB 1NEKB 2EW1A 1G7TA 2V7QD 1CJMA 2ZE5A 2HTME 4UXIA 2IX3A 3GCGA 2NIPA 4GZLA 2HYIC 2H92A 2GVDC 1KI6A 2EQBA 3MJHA 4V0MA 4ZDJA 2UVQA 4JVMA 3DMDA 2CE7A 2L0XA 3T15A 3TUIC 2EU8A 1VG1A 3BS4A 4CZ2A 2WWYA 5TVKA 1OXUA 1Z47A 1M6NA 2P6NA 3RDPA 1AA9A 4PHGA 4D0GA 1AQUA 2X19A 2QSZA 4G01B 4Q9JA 3EX7C 1EFHA 1RKBA 4M1OA 4FD2A 5JJIA 4M9ZA 5IT5A 4TN1A 1NENB 1NF3A 5G41A 3I5XA 4TLEA 3LQQA 1F2UA 4CW7A 4CGZA 1XTSA 1JQLB 1NLZA 5AK0A 4C7OA 2OFXA 2NO6A 3UG7A 4CEIB 1II9A 1Z2AA 1DOIA 1OKKA 2CJWB 1CS4C 4Q1DA 1LS6A 5JMTA 3TVTA 1BS1A 3LV8A 4L9SA 4V03A 1CRPA 2XITA 3LVQE 5C4MA 1N60A 2PLRA 1E7PB 3AKDA 2HXYA 2BMJA 2CNWA 2X8AA 3NEJA 4UQOA 4WVFA 1TKYA 4B32A 3T61A 4AYWA 4PPNA 2GVZC 3VAAA 4WW0A 2ZS8A 1TNDA 1QZXA 3B1YA 1ZUD2 4BLSA 4DSOA 1E2IA 2VF7A 2EKIA 4FMCB 4RKEA 4IDIA 3AE9B 1E0KA 4Q4HB 1CJEA 2IEZA 2CCGA 5J5CA 1E69A 1XCMA 2ZR9A 1GL7A 3FMFA 1M8PA 1ROEA 2GTPA 1QVRA 2CLSA 3AKCA 2D62A 1BYUA 2BWJA 4CEIA 1US8B 1DVRA 2ZETA 2CJWA 3SYLA 4URZR 3KJHA 1C4OA 3W5IA 2VP2A 1ZUHA 1Y3AA 4JBXA 4MQBA 4C0KA 3OIVA 4XSGA 5EE1A 4TYQA 4QNRA 1R7SA 4R98A 4QGGA 2OCAA 3AB5A 4JWSC 2G77B 4QJ3A 3N5CA 4LHZA 3QKRA 1RRPA 1E9BA 2B21A 4HB3A 4WA7A 1G21E 2D2FA 1TKGA 4WZBE 4IDNA 5AUQA 3QSYA 121PA 1HYQA 1OQQA 4G5GA 5JHHB 2GEUA 1MRSA 4IOMA 1CJUC 1NVVQ 3V4RA 3THWA 3CR7A 1J7AA 1UF9A 3A1WA 3DKPA 5E7MA 1BMFD 4A2WA 1QF6A 4CT4B 1RIFA 221PA 2D4HA 1D2NA 4Q01A 3GLIB 2IEYA 2PVGC 2BV3A 3SFDB 5A4JA 1J70A 3PCRB 3GLGB 3DM5A 4JKIA 1IOZA 3ZD6A 1E0AA 3AE6B 3U2QA 1OLOA 2BM0A 1JBKA 1BKDR 2ORIA 1NSFA 2ZI5A 3BB3A 4DVGA 2DFKB 1D8TA 2B8TA 5GJWC 2IYUA 4IXMA 1II8B 4LWZA 1COWD 5JBQA 4LY6A 5B64A 1G3QA 1OFHA 2QPAA 1VKJA 2ONJA 2FV8A 4K46A 1ZUNB 1D9ZA 4Z54A 2QE7A 3EA0A 3WRXC 3FC4A 3X1XA 3SFEB 4NCIA 1TAGA 5CM8B 2WBLC 4NZYA 1KF6B 2WIBA 2GBLA 1R0ZA 3CRVA 1UBEA 4XVQA 4YDSA 4M1MA 4XIGS 3NC1C 4JJZA 3GLGA 2AK2A 1P62B 3ZYCA 1GRQA 1VG0B 2IC5A 4Q1CA 4G5SA 5DNYB 3RS2A 1XTIA 4DJTA 2N0SB 1NP6A 1II8A 2D06A 1AYFA 2FFHA 1J2JA 1R7RA 2VP5A 5DH9A 4TZ0A 2WHXA 2ZPTX 3W5VB 2WU5B 1GILA 3MMPA 4PQYA 2CLCX 3VHLB 3UG6A 2F55A 5C1BA 2Y5CA 2EYQA 4K81B 2BMEA 3ZLJA 3TBKA 4OI2A 1OXTA 1XB2A 1XP8A 3B9QA 5FBRB 2QROA 1FM0D 3FAHA 1NYRA 1P61B 4ILEA 5B2ZA 1W2GA 5HZHA 3PUZA 1R8QA 1ZM7A 2YOFA 4FMBB 2PMDA 3SDZA 3TMKA 4YQFA 3BB4A 1ZU4A 4JLVA 4EPXA 3NIBA 1G19A 2L83A 4JLJA 1QDEA 1XF9A 2V6IA 1G16A 3OEHA 1N5WA 4IEEA 3T1VA 4C0LA 3R7WB 2ZRBA 1DOXA 1SZPA 3SZRA 2YWEA 2P6RA 3CPHA 3KJEA 4IOLA 1XTQA 5HCIA 5DHAA 1TYGB 4GOXA 3RC3A 4FN5A 1M74A 4X8MA 4IHQA 3RPFC 4KV9A 5JHGB 1XXHB 2CHVA 5IRCD 2O5VA 3NVYA 4Z8YA 1Q1EA 2H5EA 2OT3B 2VYFA 2ZJOA 1ZW6A 1KKLA 1X86B 1U94A 4IDQA 3K70D 4URYR 1E9FA 2I3BA 2ZROA 2HJGA 3QENA 2LCFA 1JQ4A 2OV2A 2QT1A 1E1QA 1G41A 1KRHA 3FVQA 4PQRA 2W0MA 1PLLA 4CEJB 3LXRA 4PHTA 2FMXA 2QJLA 4M53A 4MGYR 1XJCA 4AY2A 3R7WA 2JATA 2QMEA 1E2MA 1GKIA 1FP7A 4DLVA 3WHLA 1KJZA 4YSYB 4AKEA 1I2DA 2EWWA 2PKOA 4RZXA 1E2HA 2RGAA 2Z83A 4M0LA 3WRYC 1SKQA 4JSYA 721PA 1GVNB 3K0FB 3MGCA 2KBFA 4PPQA 4IEIA 3RSOA 2NZ8A 2BDTA 4YLGA 1AKYA 2MSEB 1SXJB 1XD2A 4EQ6B 3LDAA 4W7SA 2GNOA 4PO9A 4TMXA 2YC4C 1TUIA 4KLZA 4F91B 4DLZA 1JW9D 1AWDA 4YXWD 1N61A 4BLRA 4HB2A 2VIIA 1FP6A 2XGJA 2WJVA 5C3JB 2ZVPX 1G17A 1X6VA 3TVDA 1KI8A 2MH7A 5CIQA 3QUSA 1DAMA 1KO7A 4HLUC 1TKEA 4N0DA 4TSFD 3WNBA 2OBMA 1J7CA 3K0FA 4QFMA 3I5YA 2W6IA 3NBZC 4KYIB 1K8RA 2HDNB 2O0KA 2OM2A 3LQRA 5J40A 2YVUA 1VIAA 3EZ2A 1Q12A 1JWAD 3M0EA 2DWQA 4BFXA 3B6EA 4Z51A 3TJZA 2VP6A 3AVYA 3SYKA 4EQ6A 1YZLA 2I1VB 2ZU6A 1OB2A 3ADCA 4ZDIA 1IN5A 1F3OA 3EPLA 2FSGA 2F1RA 3WXMA 2B7BA 4EFMA 3G0HA 1DG1G 4R7ZA 4MKHA 1G6HA 3U4QB 5AWFC 4PTLA 1X1SA 2GXSA 2RGDA 4DLXA 3QPVA 4NKRA 4GT1A 5D3QA 1ZOYB 1RYJA 1NVVR 1XDBA 3B2GA 4FXCA 3Q7QA 2QQ0A 1W0JD 3FMPB 4N1AA 4B3GA 5FBWB 3L8YA 4DDVA 2KB0A 3UXMA 1ZYUA 4WWMA 2WZQA 5FPKA 4B35A 2FDCA 3GQBA 2GF9A 2BEJA 4LYAA 2NO7A 1MKYA 1EK0A 3FHCB 3B2FA 4NYMQ 4TQAA 4JLOA 3VRAB 3W3AA 5JJLA 2X1VA 1YVDA 1E9EA 1KAGA 2ZRNA 3KXIA 3OESA 4DSNA 3TGPA 3FPAA 4NCJA 4A1FA 3IHLA 3HPRA 4R71A 3AH8A 3FMOB 4Q7JB 2W3SA 1W1WA 3KUDA 2BMFA 3MSXA 4GMDA 1YZNA 2J3EA 1WB9A 1XTRA 1KI9A 4URWR 1XFAA 2FFAA 3MWKA 1G8YA 1VCOA 4MDFA 1XEXB 1YR6A 3C5HA 1IQPA 1JAIA 3K0EA 2A9KA 5KDDA 3C14C 4LJ7A 2V1UA 1Z0KA 1DAIA 4H1UA 3AE2B 3FOZA 2OLJA 1DO0A 2QN6A 2AX4A 2KI5A 4OBEA 4AKGA 4IKEA 1KHTA 2PT5A 3A1VA 3N2IA 4ZOHC 4C7ZA 2XB4A 4LJ5A 3VR3A 2BEKA 4JLKA 1E94E 1F60A 2FSHA 5TV2A 4F4JA 4BECA 1UKZA 5AJYA 2X77A 3U3OA 3HYTA 1KI2A 3PUWA 1M7HA 2R65A 3TAUA 4TLDA 3Q8XB 1P4SA 5EJEA 1XJQA 5F9FA 1XEXA 4DBLC 2R6AA 2BM1A 4W5WA 4I1OA 4ZHPA 1E98A 1EFCA 1Q1ZA 3OEEA 1VECA 4YMUA 2PVOD 1UBFA 1VIYA 1XEFA 2KJQA 5HCNA 2IYRA 3D31A 5P21A 5TY0A 3MJRA 3DHWC 4B47A 3BORA 5DE3A 4ACAA 2YKGA 3O8CA 2Z43A 2BKUA 2WPDD 5KHOC 4YSZB 1HURA 1EX6A 1D2MA 2VBCA 4LBYA 4L5BA 2VRWA 2ZS7A 3SN6A 3TR0A 2FZ4A 4BRWA 4PAMA 1YZUA 1NRJB 2CE2X 4RD1A 2GWHA 1Y63A 4DC9A 5KO2A 2VL7A 1J8YF 3WBJA 3MFYA 1E79D 1AGRA 4II7A 3AMZA 1GWNA 4JLBA 1FW6A 3GD7A 4WOPA 3THYA 5KTYA 3WP0A 5EE9A 2M56B 5GJVC 1JWBD 3I61A 1L8QA 4D0NA 3AVOA 1Z29A 1PUIA 1WF3A 4QJ4A 3CRQA 3U60B 1E0ZA 2P6UA 4PO1A 2ZSFA 2CHQA 1J99A 1RM6C 2R9VA 4JBWA 3SBDA 3EPJA 4JLAA 4OI0A 4QKQA 1XEWX 1OH8A 2YC2C 1EWYC 3EZ9A 4LDJA 4JWUC 1P3JA 3QKUA 3ZZUA 5HE8A 4MGKR 4N0EA 1OHHD 2N42A 1WMSA 3SHWA 1B23P 2JASA 4HRSA 1BYIA 3AM9A 2WSSD 3CO5A 1UADA 2JLVA 1DOYA 1W44A 3BFVA 1N5IA 2K5UA 2JLRA 1GDDA 2KBEA 3O47A 5D3MB 3I1FA 3CIRB 2ZYTX 3PUVA 3L0SA 3ZGXA 3EWSA 1KGDA 3AGQA 2YHSA 3CWZA 3F0TA 3FKSA 3AKYA 2ZS9A 4Q9HA 3QPWA 3TRFA 3ECCA 4US2R 3E2IA 4NCNA 1E2GA 1AN0A 3LD9A 2DPXA 3P4RB 1NIPA 5FTJA 3TE6A 4BLQA 5CITA 3N2EA 1TQ2A 3EPKA 2ZI4A 2PZFA 4DB4A 1EESA 3BD9A 2DWPA 2PZGA 2CL6X 3MWLA 4UXHA 3UMFA 1MR3F 2E3TA 1CR2A 2C77A 3CUEF 1XU4A 3G5UA 3OE7A 5B58C 2YOGA 1L5PA 2CK3A 4CEHA 4Q03A 5D3MA 1W4AA 2Y8EA 1KZGB 5FOWA 3MWYW 2D7DA 2BCGY 1NLFA 4GOKA 4M9SA 4YMVA 1QLBB 5AUOB 3CZQA 4PANA 1FQJA 2OCYC 2QUZA 3M4YA 4NCKA 2J45A 4Q9LA 1T3QA 2PJRA 1NI3A 2QAGA 2YWHA 1W36D 4OHVA 1FMAD 1YJIA 2J1LA 3WMFA 1TQDA 3NBXX 2F43A 2RGBA 1W5SA 1E6EB 4PZZA 1KY3A 4NYMR 2ZR7A 5FL7D 2H8KA 3FWYA 1SHZA 2FFBA 5UKDA 2IYWA 1RRCA 4XD7D 5EP4A 3QIAA 2XTMA 1G8PA 1CULC 1PVOA 1FNNA 5JJKA 3KQUA 1IXRC 1VLBA 2ANCA 2OXCA 1EFUA 3V00A 3BFXA 2HF9A 3S1AA 2W6JD 3ICEA 1W0KD 4QGHA 1P9RA 1BOFA 3W3ZB 3LBIA 3NVWA 1KNXA 4BFZA 5FBLB 1R8SA 2F3RA 4A8JB 1N0WA 1ZM4A 3RWMB 4JMPA 4ZCLA 3ADBA 2XZPA 5GVSA 4HROA 1MRNA 1N6OA 4M1TA 2ZRFA 1F0ZA 2GCOB 5E4FA 2ZXUA 3EC2A 3IQWA 3RS3A 3LRPA 4U00A 1YZKA 4KBGA 3LFUA 2IS4A 4L16A 3KQNA 2WJGA 1U8AA 4QL3A 1R10A 1HV8A 4TL6A 5EE5B 2P65A 1P2UA 4AC9A 2QY9A 3SHFA 2UKDA 3LY5A 2QTHA 1N5LA 2PL3A 1AZTA 5FL3A 4TYYA 4URVR 3A1TA 1NVWQ 2XSZD 4GRAA 4LJYA 1JJVA 5JECA 1VHTA 2ZJ5A 4A8JA 2H1LA 1N5KA 3FE2A 3LBNA 1KNQA 2VSFA 1R0YA 4W5JA 4BRUA 4RFSB 3BH6A 1G5RA 4B3XA 2GCOA 3CB4A 4UNRA 4F92B 5IF9A 3OIYA 5LB4A 3JZAA 4DCVA 2BKEA 2ECKA 4JBYA 3VR5A 4ACBA 3B8HA 3IIMA 2XB2A 1Q21A 3NDBB 4S35A 5EQTA 2A3RA 3R9XA 2PX3A 1ZBDA 3RS7A 1QOBA 1E0JA 2J7PA 4NP6A 4PZYA 2QRZA 3A1UA 2XOKD 1TU3A 1IY0A 1YR9A 2QNRA 2ZUDA 1Z83A 1Z0DA 2PZEA 3SJBA 5L3SB 4RSGA 4P6VF 1IY2A 2AFIE 2B7CA 4IXNA 4ABYA 4RFVA 1V97A 1UPTA 3BRWD 4WBSA 3P4QB 3X1DA 2O52A 2ZE7A 1E10A 1FXIA 4M1YA 4B44A 2QENA 4E03A 3RC8A 2BT6A 3MUFA 3SNHA 2BVNA 3QKTA 4EDHA 5J4KA 4RFSA 1E9CA 2OE2A 3QG5A 1U0LA 4TL9A 4A82A 4C0AC 4L9WA 3W5UB 1OFIA 5FFMA 3EZ7A 2BCJQ 2D3WA 4EPTA 4LHWA 5F2EA 1I4DD 2ODBA 3IUYA 4HAZA 4LCBA 4HZUB 3WP1B 4US9A 2FPMA 3WNCA 2PCJA 2FSFA 1XZQA 4ZKDA 3CZPA 3P1JA 5L3SA 3P32A 1KDTA 1YZQA 1G4UR 3FHOA 1T5LA 4TMTA 2N1BA 2EWVA 1VCIA 2DFNA 2QAGC 4ZO4A 3TIFA 3TNFA 5J4YA 3CWQA 4XVRA 2O8BB 4EJSA 2G83A 4G0NA 3LW8A 5KNDA 4MKIA 4F4CA 4LJAA 1E2PA 3B9JA 1WA5A 2OFOA 2VPPA 3BH0A 3QXJA 4MH0R 2QP3A 5JRZA 2VHJA 4TMKA 4F7WA 2AD1A 3DVLA 4NE2A 4C4PA 1I2MA 3K0AA 1XPRA 3CPJB 1GOTA 4TMWA 4DSUA 1JJ7A 2F1IA 1FTNA 5FTKA 4GNKA 2FPKA 1P9WA 3KXLA 4IVQA 2ORWA 1CLUA 4IDPA 1ESNA 1OJLA 4KSBA 3UKDA 2HF8A 2Q3FA 1OF1A 2O8BA 2ZEJA 1U8YA 4G5RA 4HEJA 4C30A 1J7KA 2FF7A 421PA 3AEZA 4PQFA 3TSZA 1NVUQ 4D82A 5EUMA 1RE0A 3H86A 5GJBA 4PAQA 4XSHA 2XZOA 2ZSAA 1XMIA 4RZUA 3DM9B 4P4SA 4B43A 2RGCA 1E2EA 3IEUA 2WAXA 1Z6XA 2WWGA 3QY0A 4ASUA 3A8TA 1NMZA 2WJJA 1IN4A 1S1MA 2W54A 1E2LA 4KJZA 2QTFA 2PH1A 4HLQB 1FFHA 5K8TA 2G1KA 2XNSA 4EIWA 3AE4B 1Q3TA 1Z0IA 4PHHA 2CBZA 2JDIA 3AM1A 4TT3A 3DWMA 1ZM2A 1IXSB 4V0ME 2IHBA 3NHBA 1OYWA 2KWIA 1E9SA 4UJ5A 5JEDA 3K9NA 1BO6A 5K8LA 3I4LA 5ANRB 4EUNA 3ZZTA 4GFDA 3HUIA 2IW3A 1JR3D 4PC7A 3W6OA 2WICA 3P4PB 3L4PA 5HZKA 4EFLA 2GCPA 2F6RA 3W6NA 1YE8A 2A5YB 1X1RA 2XZLA 4DDWA 1ZCBA 5EUQB 4HAYA 3EWAA 3OFNA 4DUGD 2PLFA 2MMCA 2XTNA 4NPHA 1MOZA 2ZI3A 4TLCA 1Z2CA 3EAQA 1RZ3A 4ZDWA 2W2XA 1W0JA 3VQTA 4PZLA 2Z4RA 1K5GA 2QU8A 5EP1A 5BWMA 1N6KA 4FWTA 4GI7A 5DYGA 1W4CA 2WOOA 4YONB 1N5JA 4BWYA 2V9PA 5KNCA 2ZYWX 4Q4HA 2J0QA 4DWJA 2CU3A 1T3HA 3VU9B 2QGZA 2V6JA 3U3MA 1G18A 1N25A 3KQKA 4EJSC 3U5ZB 1YRAA 1KK1A 1QHHB 3DPUA 4DIDA 1UKYA 3T1TA 1NVID 2IXEA 1US8A 2VHUA 3T1OA 4Q4LA 1JR6A 2OILA 4TLBA 3SS8A 2CJNA 1E0SA 4TZ6A 3DWGC 4JVNA 3OAAA 2JJ1D 2OUKA 2J46A 5C18A 4RD3A 1OXVA 2ZRCA 4Q66C 3W34A 1Q20A 2J0VA 5BW8A 4YMSA 2QL6A 1HQYE 3T35A 3UWKA 2GILA 1IN6A 1NL3A 1XD9A 2VF8A 3BAFA 4WIAA 1Q0UA 1KFYB 5SZJA 1GKYA 4F93B 1TPZA 3VU9A 1Z6AA 5HE9A 4AK9A 1M1YE 2ZJAA 3H0KA 5KDOA 5DI9A 4C0JA 1T4GA 2B6HA 2W2VA 1OE0A 2RGNA 2F3TA 1B0UA 1Q1BA 2WJHA 2ZUBA 5EXPA 4ZDKA 4IJMA 3EIHA 3BC1A 1JB1A 2V1XA 4LYHA 4LK2A 4KVGA 2J9RA 3GJ6A 2NO9A 4QBGB 4KFRA 2ZRPA 3KKMA 5FBQB 1ZINA 3SJZA 1YRBA 5DIFA 4KCGA 4TYNA 1ETUA 5FH9A 2Z6VA 3R20A 3GLIA 3NS1A 3A4MA 2GJKA 1D2EA 1NBMD 2R44A 4ZIRB 4P4UA 3RS5A 4DT1B 1TUEA 2DBYA 1KK2A 5F98A 2MJEA 1E1RA 3P20A 1GSIA 3AE1B 3ND9A 2WJIA 3WYGA 2O8CA 2XNDD 4MUBA 4NBSA 3UPUA 1NN5A 5AJVB 1HTWA 1XNJA 3C4JA 2ZRKA 4A6PA 1GITA 3HDTA 5DSZA 1CU1A 5AUIA 3UWOA 4Y0VA 3TW8B 3QF4B 1RC8A 1MO5A 2BJWA 4QRHA 3AF2A 3ETRA 5DO9A 2AD5A 3VNVA 3N70A 4A0FA 4UNSA 2VP9A 5FTNA 3GLIE 4FMDB 2JJ8A 1MT0A 5C46F 3ADKA 2HT6A 1F6BA 3GLGE 2QBYB 2CDNA 4FXPA 4HLDA 4JS0A 1EG7A 4Q21A 5C2TB 2VEDA 1KI3A 3DOEA 4AURA 3KTAB 2JLUA 2AHOA 1BIFA 4C0SA 3VR8B
chains in the Genus database with same CATH superfamily
1G6OA 2A59A 1S3SA 3I0NA 2ID9A 1QH0A 4I5IA 1OFTA 3I42A 1J06A 1QCDA 3RADC 4MHTA 1H0KA 3TOZA 1XA3A 2AQ3B 4OI4A 1TK3A 1T5TA 3OIWA 3WWYA 4IWOA 1OHHA 5F9NA 2JPDA 4YT4A 5BUSA 3EC8A 1O9BA 1KK0A 1UXKA 5H3LA 1IAVA 1ZQDA 1QO0D 5L1IA 5T8KA 1AF7A 4TV8B 4FYPA 3SEFA 4M0PA 4JCCA 4OJMX 1DKPA 1YS9A 2G1JA 4GOND 3TINA 4CEJA 1D2GA 3KYJB 2YWXA 3KHRA 2FW7A 3KUKA 2RGFA 1XXHE 1NWHA 3AK4A 2C9BA 3NXKA 3AF3A 3HXMA 4O8CA 3Q7PA 4H7JA 1OKKD 4GLFA 4L7VA 2IYZA 2CF6A 5EVCA 2PEZA 1CHNA 4ZPXA 1QONA 4M0EA 2IOFK 1I4TD 2ZJ4A 3UJAA 1DT5A 1IXKA 2X4LA 3K5PA 2ZJFA 1AV7A 3H2GA 1KKMA 2B92A 4XGQA 4EHFA 2G25A 1MAUA 5JU5A 1ZA2A 2FR8A 3OVMA 4D6XA 3OQMA 1N6PA 3PYXA 4XX5A 1GNRA 5K05A 4OI1A 2PU5A 2IJ0A 4NARA 4ENRA 2IZ5A 4GVLA 2IHVA 2E1FA 5ICCA 3HM9A 3O8RA 3TNYA 5THKA 3EPIA 1ZRHA 3D4BA 2DULA 1GAWA 2BPFA 2NYVA 1EP2B 3P9IA 5A0VA 1BJRE 2HIHA 4O4LF 1Y88A 2BZ0A 4AECA 1AKUA 3QH4A 5JCOA 3H3FA 1YQWA 2KWUB 3RYHB 3HS3A 4HN2A 3MFIA 4G81A 3W9CB 4BZZA 5TJ9A 3STUA 2NO1A 4X7PA 5F2KA 2WWFA 1SXGA 2B78A 5LB2A 2C8JA 3RJGA 4BO3A 1OX6A 1VHQA 4OHRA 5EIEA 2LD4A 3HKBA 4PY2A 1YNOA 5EFZA 3RBZA 1JU3A 1SAYA 1I24A 3X44A 4JBGA 1NZPA 4EHAA 5LBTA 1P2FA 4MH8A 2DPYA 4UB1A 2R751 2R62A 5EMLA 3G49A 1JKIA 2GN6A 1DRUA 4CV0A 1UDWA 4R1OA 3KOUA 3BVPA 4FNAA 1WPRA 1RP7A 1ZQHA 3NBKA 3PLVA 4URXR 2C78A 4OG2A 1ZONA 3TCKA 5EQFA 1JQKA 4QTYA 2DUWA 2ZB7A 3C5EA 4GKVA 5I9IA 4H7IA 2QGNA 1BQEA 1TEVA 4QM6A 2C9ZA 2BKAA 2Q9AA 1XF1A 4XH9B 1N6RA 2RKWA 4KR2A 2QYOA 1PZNA 2A9RA 4BE7B 2Q50A 2YJGA 4INOA 2UZ4A 3AH7A 5EL0A 2YY7A 4YRQA 3RS0A 1VC2A 1NMYA 3BZCA 1CUYA 1WMBA 3T06B 2WU8A 3B70A 2PKRA 4DHWA 3EARA 3I92A 3BULA 3C3XA 1W5TA 3PGMA 3K75D 4KFSA 4DHJD 3M2PA 2BPCA 1ZXBA 2YZKA 5BSUA 1C1DA 2E8NA 1MB3A 3QJYA 4IRCA 2PGNA 3ZCTA 4XI9A 4UVIA 2GZ2A 1NVDA 1M66A 3NR2A 3OC0A 4FEYA 1D4FA 2OKCA 3FROA 3MQ4A 3N2GB 2Q2NA 3SR0A 4F4FA 2DBVO 3T7TA 3MWGA 4NBTA 3T5HA 3WIVA 4H60A 3NWJA 5I5GA 1VE3A 4X54A 1AQYA 3DDCA 5CHYA 2OPHA 4FSHA 3A3YA 1MUUA 1IQRA 2O2VA 3QSGA 1E8DA 1Y89A 4K8RB 4M8NA 2BEWB 1UPCA 4L8YA 1M7BA 3N7TA 1BPYA 2XEWA 1TCAA 1VPEA 5JJBA 2CDCA 2ZCUA 2DLNA 4CKYA 2OXFA 2QDKA 3ZWPA 2SKCA 4ZI2A 2W8BB 1U1EA 1I6LA 4EI9A 1U3UA 2F44A 3KVYA 3RUAA 3HCDA 1V39A 3RG8A 4BHTA 2XQKA 1FPQA 2QN1A 2OWOA 4TN5A 4EY3A 4OW0A 2H3VA 3RVSA 1G21B 1REQB 1ZUIA 2FEOA 2YHIA 3DUWA 1NQWA 3KJZA 1T7PA 1X8JA 2UYHA 4OHKA 3T94A 2WYWA 3WK5A 1AZWA 3PGVA 2F9FA 3ERCA 3PSAA 1DAGA 1YKGA 3CSDA 1E6LA 2VJYA 1UP6A 3MINB 3CVWA 1R5BA 1Z37A 5A4AA 4MRSA 1T3TA 3ZZ0A 1SBNE 2OEHA 4E1VA 5JJCA 1MENA 1FA9A 5GWXA 2FGKA 3RC9A 3G9UA 3O4HA 5ALQA 2DX5B 2XCRB 4ESOA 1B0XA 3ZLVA 4HCPB 2PX8A 3F5QA 1ISPA 3UJDA 4C88A 2DGZA 4BIMA 5BO5A 1OQYA 1ZD8A 1TLTA 1USUA 5BYRA 3U1VA 3S8MA 4NF2A 3AX6A 1G63A 1K0FA 4E3WA 2JQRB 3GOHA 5F52A 3VSEA 1PV4A 2REQB 2VRCA 3DE5X 1JWBB 3DXXA 2Q1TA 4KMOA 2O7NA 4LF7B 1L5UA 4EW2A 3T3MB 3IJEB 3GFGA 5GINE 4RLHA 1N32B 3VXWA 3OMWA 1J0AA 2BSQA 4XOIA 1DKLA 3SK0A 3KV3O 5JWHA 1ZXLA 3ED5A 5FPTA 2Q7OE 2GYWA 4KYUA 3TQIA 4UTRA 3C3BA 1EAMA 2IXGA 3BOSA 4NLLA 4UDOA 3PV1A 3W8DA 3CZ9A 3V4FA 4G84A 4WZZA 3HH8A 2NZUG 4J9UE 3IUPA 2A30A 3RVPA 4BUJA 1FE8A 5DN6A 4PV7A 1YR1A 5A5FA 2QM8A 2YXDA 1TAHA 3ZH9B 3UJ3X 4IQTA 4BNIA 3C2MA 2WMYA 1JQAA 1SU4A 3UGTA 3IMCA 1F2RI 4D8UA 1B73A 3EGEA 4X3CA 3SS7X 5MN6A 1OYOA 2PGAA 1Q84A 3U16A 5BYKA 1N3LA 3D4NA 5BOLA 4ZRPA 4RS4A 3RNFC 2KK8A 4IX9A 1JRPA 3AYZB 4UBJA 4EHJA 3GLFA 3IBTA 2Q5CA 2Q6OA 3DDWA 1PR3A 4L4SA 4JL9A 2JC3A 3ZHCA 3CINA 4JLMA 2FEWB 4HPWA 1OIWA 3BG5A 4R7GA 5JCPA 3IILA 1MABB 4CHGA 3B9RA 2Z5FA 4EHIA 3EWIA 1KSFX 4BNDA 3MW8A 1WUTA 3COZA 1C7RA 2R8ZA 2GH1A 4CMGA 1T4CB 4JI7B 5L1KA 3NYQA 4KFUA 2TECE 5IAAC 1IDOA 3PV0A 3DCIA 3DEIA 2X22A 3FETA 4PPGA 1UJ2A 3D8HA 4RFLA 4R2KA 4PWZA 2AA3A 2Y1FA 1FTSA 4MRVA 4ND8B 2X3UA 3PF9A 2OFWA 4IQGA 4KI0A 1SC6A 2C5HA 4K88A 4FDUA 5GIOE 2H3EA 4LTUA 1A04A 3SEIA 1A72A 1YJCA 4QXOA 2PQMA 1QTNA 3NNSA 3BX1A 3GMDA 4TTTS 3BCHA 3JRWA 1V85A 5DPMA 1OB5A 2K89A 1K92A 3S8EA 1W47A 3USCS 5K3AA 2J31A 2HHWA 4HDNB 2HRCA 1WZUA 2HF7A 3GLRA 2GJAA 3HUFA 4G5QA 3DOCA 2OCPA 4YT2A 4CDGA 3ZW7A 1ZHHA 4U7DA 4YMLA 1A4RA 3AETA 3H5OA 2FPGA 1TM3E 5GM1A 4O2AF 2GEVA 3P9KA 3M1IA 3ORFA 2H5JA 3K6JA 2ZI6A 4PYMA 2UYCA 5DCYA 4WOCA 1G2OA 6LDHA 4LZZA 1JI7A 4QDOA 1T91A 4Z3OA 4FGJA 1Z73A 3WFZA 3SE0A 4TKNA 2HIGA 5E7IA 3FCSB 1P4GA 2HU8A 1ZK4A 4ICIA 2J52A 3VR4H 4ZMBA 3EA4A 4IFTA 5ILGA 5A6SA 1PJRA 4GBMA 4LNIA 2J3LA 3RVRA 5TZVA 1JBQA 4BZXA 4P34A 3IIJA 3PSFA 1BMDA 1P81A 2QLNA 4JT4A 5KC9A 4QYSA 5I4CA 2DKOA 1IOWA 2AXNA 2EYUA 1N2SA 2ZRDA 3N75A 6ABPA 2WFLA 2P2CA 3HT3A 4BOSC 1UZLA 1U5CA 4N03A 3ZV7A 4DV7B 4U2GA 3QWAA 1YOVB 4UREA 1Q7RA 3EUFA 4GUAA 3Q3JA 4L0CA 4WCFA 4JP8A 4G86A 4PG4A 1S76D 4DAOA 1THMA 3R9WA 1OFGA 5L95C 3PD1A 3BBPA 4RCZA 1UXOA 3IX7A 1NXQA 3SNKA 1W85A 3D9QX 4J2HA 1DV2A 2QQGA 4H7DA 5H8YE 1G9TA 1NZBA 3VTFA 2KO3A 3MOIA 4UAGA 3F8TA 3GLHE 3OC6A 1TEZA 5LQRA 3FCYA 1HI9A 1RWQA 5HKLA 1WJNA 5JO9A 1N5DA 3HUEA 5KFTA 4NTZA 4ERXA 4BJ1A 4J6IA 3O3MB 4TXNA 2BS4B 1KLNA 1NUUA 3S5JA 2VVTA 5C3UA 3E3OA 4X5OA 5I6DA 1M8KA 2DP4E 3AONB 3TEXA 2BF4A 4H1VA 4J0JA 1QO0A 4F4HA 2EKLA 1XGKA 3RROA 1MHHE 2BBTA 3L7JA 4U2FA 1D8YA 3ND6A 3EGCA 1Z2NX 1EX1A 1SKBA 3TUIC 5TVKA 2P6NA 1D2CA 3OJXA 4M1OA 1USKA 3Q69A 1KE2A 2OORA 4B6SA 3FNRA 4TVKA 3LHKA 3DTNA 2H5IA 4DA9A 4GLXA 3VPDA 1OKKA 1LS6A 1PTKA 2RPVA 5I7WA 4ZT5A 1ESFA 3OX3A 1PT8A 4UVDA 3UAOA 4FADA 1TZBA 2OBYA 1EJ0A 1U8FO 4KG7A 3AJDA 1VPWA 2QEJC 2GTPA 2UYQA 1BYUA 5JAIA 3UHAA 3W5IA 3UAGA 3N2ZB 3WE7A 2WFAA 1ZZEA 4BV2A 3OHSX 4A7PA 4DWIA 5JZEB 3QKRA 4NJ7A 2WR8A 1TFRA 5LOVA 2JAOA 3FUWA 2M0XA 4IGEA 5EAIA 3L6OO 3NHFA 4KMUA 4HMPA 4UPDA 2I2XB 3GLSA 2OVFA 2D4HA 2QN9A 1MU0A 4A16A 4NMHA 1I4RA 2P9EA 1II8B 5JBQA 1QM5A 4R2WA 4X66B 3KYCA 3OQJA 3X1XA 3OF3A 2VZLA 2Y1DA 3TD9A 4R3DA 2G8NA 4H3HB 1CUXA 5LP1A 4PR3A 4TZ0A 4DSJA 4AZ3B 3K1YA 2R5WA 3VHLB 1OWNA 4EVSA 3ZE0B 3HACA 3IYLW 2FEKA 1N5RA 3RGWS 1OTYA 2Z56A 1WZCA 1H2BA 2A0YA 3WAOA 5FDFA 5AKHA 3GWGA 4GRIA 3CPHA 2QRUA 1JJFA 1XTQA 1KEEA 2IPOA 3B6KA 1XXHB 2AOVA 4ZVMA 2OT3B 2H3ZA 1D9DA 1PLLA 5FQOA 4RY0A 4YBRA 4MGYR 2EIXA 4ZT6A 4UU7A 3SZUA 1U0TA 2D2VA 3ZZMA 4D8VA 1F6WA 4MVJD 1ORDA 3MSCA 4LNOA 3R77A 4IEIA 2P3LA 2V58A 1SBHA 3H1UA 2LGYA 1PSWA 3UFXB 3SVLA 1L2NA 2VS1A 4DLZA 1Y8QA 4M7PA 4GDLB 1UBQA 1W9HA 3I5YA 4JAVC 2VDWB 1C30A 2ZBUA 3ENQA 1FJ2A 3L6EA 5JY6A 5A0TA 2L82A 5I45A 4LTMA 3SYKA 4ZDIA 2B1QA 3FI0A 5B53A 2WHRA 4B3JA 1ZQXA 3NHUA 1DRWA 3KHUA 4MKZA 4UCXA 4RZSA 5E8JA 2JK1A 2QQ0A 2C3UA 1FDWA 3BZUA 3ZV3A 2B1JA 3K1AB 4NYMQ 1ZG3A 1CRWG 3GFQA 2ECFA 3BMQA 2RH9B 2VDMB 3BICA 5HZGA 4HXFB 4LI3X 1QHEA 2LGJA 2ZTEA 4IIBA 3TRIA 4MDFA 2BZGA 4A0SA 1DAIA 3L7NA 1IC6A 2R6JA 3M5WA 5JPIA 2H29A 5A5VA 2PT5A 3F9RA 3W1SA 4WLOA 5DVZA 2FSHA 5E6SB 5J2CA 1E5DA 3UJNA 3GFSA 4GPEA 3DV9A 3EY4A 2I4RA 1UBFA 3A2KA 2I65A 3E84A 5ICEA 4B47A 4DUZB 1TV9A 1EX6A 1B1ZA 4LBYA 1PYDA 1HDRA 3N97B 4RX1A 5A9RA 1KTKA 5AW9A 3DVSX 3F2VA 4X6XA 2PPLA 2BKXA 1TT7A 2QRQA 4FEEA 1BEEA 3GB9A 4JK3A 4D6YA 2ONYA 1TPYA 4OI0A 1YMUA 4MWTA 1FVHA 1K7CA 4DDGD 4YXJA 3UAVA 4RPXA 4UB8U 5D3MB 2YHSA 9ATCA 2O8VA 2DAFA 3EUWA 3F78A 3P4RB 4BLQA 2DPLA 6PFKA 3PQ7A 4YH1A 3BD9A 3IQIX 5TRTA 4FS1A 2OECA 1NQVA 3PTLA 3AR3A 4Q03A 4LW8A 1R0SA 3RF9A 2P69A 3M4YA 3PQDA 2J45A 3O8NA 1NI3A 3Q10A 1M54A 1FMAD 2J1LA 1DFIA 1PK1A 3UXNA 5E1MA 2QYTA 3TLKA 3KE8A 3LGXA 4UASA 4M9UA 5UKDA 4NEQA 1YOBA 2OHIA 3RJZA 2O5RA 2BGLA 2KFKA 3ILXA 5EMMA 2Y76A 1SKMA 1R8SA 1EA7A 3HY6A 2YJ5A 3IQWA 1XCOA 1GN8A 2WJGA 3BDVA 3QX8A 1H85A 3LY5A 2XSZD 4GRAA 4LJYA 2AU0A 3GJRA 1PJ2A 1ZS9A 1RQ7A 5IBRA 3OG9A 5F2NA 3IIMA 3MGGA 3NDBB 5HS6A 2KT7A 5BXYA 2YHBA 1ZQIA 4P6VF 4GM0A 3NAMA 1IEWA 5KMGA 1S2LA 1V97A 2DQKA 2EKDA 4MV1A 4E03A 3L4BC 3GVIA 3OPVA 3V6CB 1T15A 4UVGA 4EG7A 2FPMA 4GKJB 5JFTA 1E59A 1A9OA 4UNIA 1TVMA 2O8BB 3L0WB 1O94A 1WMAA 3LW8A 3RFAA 4MKIA 1WA5A 3P9XA 4YXMA 2AJLI 4C0XA 1CHDA 3MILA 1QQ7A 1OJLA 1WUHS 1OF1A 3AEZA 1EGHA 1NVUQ 1NLMA 4PAQA 4ENQA 5CA1F 1Y3IA 4XSHA 2UAGA 4U0JA 1RP1A 3RAEC 2JR5A 3M9NB 2HBLA 5B66U 1TS4A 3UHPA 4YCAA 3JZDA 1KYVA 2MR5A 4PLGA 4V0ME 1I4WA 5B5SA 4QXPA 2RK4A 2GAFA 4NM1A 2ZT8A 4Z99A 1AO0A 2PMFA 4EUNA 1MVNA 1P0MA 1FRNA 3LCVB 2M1XA 4IGFA 4W9RA 3L40A 1YE8A 2D1RA 5TISU 4NOMA 2JD2A 1ZCBA 2H8GA 4YUYA 4K6MA 5DNWA 5J0WA 3A31A 2AI2A 3EFBA 3VPSA 4M9CA 1J2NA 4KPUB 1N6KA 2PV0A 1GCIA 3VZBA 4IRKA 3D2BA 4U7HA 2V9PA 1T0PA 3U3MA 2AYXA 1CJSA 1VBNA 3MBOA 1NVID 3F47A 2C4MA 2VHUA 1WXVA 1AA6A 1CUFA 2WXLA 1TIKA 1AUXA 4HMOA 1WZNA 3L01A 5C18A 1OXVA 2A1TR 4Q66C 2XVXA 1JHYA 1H94A 4Y2VA 1HQYE 4CTOA 5JQGA 2A33A 9ICIA 3VU9A 4AK9A 1G6KA 5B2EA 5KDOA 2BDEA 3PVZA 1MFWA 4H6PA 2LIVA 3NDIA 1XQWA 3AEXA 3L6UA 4QBGB 4KCGA 4ZGGA 3DB1A 4ETIA 1K5PA 4ZIRB 4P4UA 2Q5FA 2CFTA 5C7IO 5ALXA 9ICKA 5AJVB 1EVIA 1HC7A 3HDTA 4WZAA 2AD5A 5KEIA 1Y3FE 3M89A 4EHNA 2CZGA 4CKWB 3QITA 1EG7A 3FSRA 2AHOA 5FUBA 5AHWA 1JAYA 1U0OC 1P7WA 2PE6B 5IN4A 2PKYX 1ZKHA 4DV2B 4RENA 1Q83A 5D5PA 2M6KA 1H66A 4TOIA 1I6KA 1DGJA 3P26A 2Y4OA 1YL5A 1WE6A 2XJ9A 2JV3A 3LBFA 3RRJA 4X8HA 3SOZA 1L5YA 3AE3B 2NMQA 4XQ9A 1V8OA 4GUDA 4BUCA 2BMWA 1W6RA 3P2MA 2WYIA 4F5YA 2ON6A 2CVPA 3TRJA 2R6GA 4MITA 3BD8A 3LYYA 1XZDA 1O8CA 2KLHA 2QIPA 4GYYA 3DT6A 3DNFA 1CZNA 1E66A 1S5LU 3LP8A 5BNZA 4JJIA 4DKJA 1Z1VA 1YVRA 4UKDA 5M34A 3QU9A 7ICRA 2PBRA 5EIBD 4C4YA 4QIHA 2EAPA 3FW1A 2BGKA 1BFUA 2YTUA 4RIIA 1EGAA 1ZR2A 3DTVD 4CMEA 4RBNA 3K96A 2QE6A 5KOIA 4DQSA 1AK2A 3ZJ4A 3MT0A 3ZDTA 4AMYA 2JAPA 5AXDA 3M8KA 1E2KA 1L6VA 2O3TA 2KHVA 4O3PA 4BLOA 2DHRA 4UBKA 1BNPA 1ANKA 4OX9Y 4B83A 2O54A 1FL9A 3PA6A 1JFRA 3U3JA 1A5AB 5HF9A 1SCBA 1WBBA 2ZIGA 1BDHA 2H1IA 1SV0A 2D3DA 1BVHA 4UE6A 5AKXA 1E9DA 3KG2A 3ABVB 3CRMA 2EKEC 3VR6A 1H5UA 4DEXA 4D8TA 1O7JA 4AJNA 8ICQA 3TW0A 3V42A 2I4IA 1UMKA 1Q6ZA 5I8PA 3CURA 3C6YA 1CEEA 2K4HA 3QEJA 3OM0A 1C8BA 3SQDA 4I55A 1R6DA 2CYAA 3GEPA 4DLTA 3EBLA 5AZFA 1U0HC 2XKJE 1Z7YA 3DT8A 1FTGA 1SQ0A 3RVBA 2ZRAA 3SD7A 1JLLB 5I9MA 1I7PA 2Z2ZA 1TKBA 3DMYA 3M6IA 4H0NA 3FDZA 3UEOA 1QVZA 3AQ4A 2FA9A 5JARA 1A8IA 4NYJR 3HKEB 4TQ0A 1EFTA 4GG1A 5AEKB 3FVRA 4DSAA 1AO3A 2CXPA 3FR8A 1VPLA 3PPAA 3H2JA 1HEIA 4BVGA 3D2LA 4UMDA 2WJZB 5K6AC 2IELA 1MO2A 1CQIA 2XYVA 2AGOA 2EVWX 3DMFA 3WS7A 1CEQA 4RGQA 4RKWA 2VDQB 4BGUA 3R3SA 1U6KA 4TMZA 1AHPA 3UUEA 5HUHA 4NC9A 3REFA 1H8HD 1ZCAA 3ZUPA 2XT9A 4CLOB 1FB5A 4M0CA 1JHAA 3J81A 2XCIA 3PLAE 2QRLA 4XYBA 3C6QA 3OIGA 2H9YA 3K5IA 1T2EA 1DC4A 3RIXA 1ULHA 3RJ5A 2ZSBA 3IM1A 2GB1A 3C3MA 4MW9A 4QZVA 2G3YA 3TSWA 5BMIA 3HJNA 1OXJA 1CBUA 2MSWA 3HR8A 9ICAA 1JG3A 1K6JA 5BWBA 4GEKA 1WHSA 3LFHA 1SEPA 2WQ7A 2GK4A 5D5HA 4MMYB 1S4QA 2F3QA 3EZNA 2D0OB 3VJLA 3EBPA 4TURA 2C5LA 3HCEA 1SIUA 1A1VA 1XLVA 3GLHB 5FFFA 3GDGA 3LLSA 1KXZA 3BCSA 5FR2A 4YCBA 2ZRQA 1C1YB 1ZM3A 2XNDA 4NBRA 3JXEA 1ICIA 2QD3A 4ZAZA 3M7DA 1I8TA 1X1CA 5CHEA 3G68A 4ITKA 2Z0MA 4DV3B 2DF4B 4GLLA 2CZQA 2OKGA 2VTKA 1B3BA 3MPOA 3PP8A 1K2WA 4LX8A 1AS0A 4DXHA 2DPGA 2VHWA 4ESHA 4W5TA 1SRRA 2VA3A 4OQFA 4YV7A 1UA0A 4J07A 4GX2A 3L4JA 1RXUA 3VO8A 3LAWA 5GJCA 4MV6A 1UKEA 2X58A 3O8QB 4HB0A 4X84A 1SUEA 3LTNC 5EKSA 2WK1A 2HOFA 5DBBA 3Q5DA 1XAGA 2D11A 3K9LA 4J75A 4J1QA 5HSGA 2IEBA 5CK4A 5JNSA 3RIMA 3TQCA 2VYVA 3JYNA 4UDYX 3MWDA 4HG2A 3PKJA 2Y1EA 1TS5A 1NK9A 3L17A 1A2KC 2QM7A 3OUUA 3NWOA 5FPQA 3DAOA 3Q5EA 2B94A 3M9LA 3KH0A 1E92A 1PWHA 4MLDA 4ANUA 4B6FA 4AQ7A 1JLRA 2Q1SA 1GG8A 3PEUA 1OW3B 3RZFA 2WU4A 3GOQA 3G0IA 1V9PA 1WHTA 3V34A 4Y2XA 1X3SA 1E3MA 3ER8A 2NV3A 3NBYC 1I7HA 3KDPA 1TKRA 3KRTA 4V2UA 3E0QA 3EF3A 4ZQGA 4HYQA 4K9RA 5FO0A 3D8BA 1UXGA 2IUUA 1RYHA 4FBJB 3ZK8A 5HI1A 1XZKA 2PZKA 1ZKDA 3TKYA 2XWSA 2QPOA 5CTJA 4BO0A 1GD1O 1U4NA 2N9UA 1N7JA 2ILTA 2YQ4A 4N9QA 4YR3A 4R8VA 4E7OA 2V45A 3KD3A 1B6TA 1VXOA 1LWOA 1FP4A 4FFLA 1AHNA 2FNJB 7ICVA 1VA4A 4BMOB 1XCPA 4OHYA 2IQIA 2FZWA 3AU9A 5J58A 4EF5A 3EFEA 1DMRA 5INTA 2MAXA 4RQ0A 3QA8A 1CJCA 4AB1A 4TROA 1UPXA 4J1SA 4K9DA 2VANA 2HF2A 1AIPA 2HSDA 4WFIA 3VR5D 4DM3A 5TJHA 3PQCA 5LA6B 1PFDA 5KFQA 2CXHA 4EAQA 1COOA 4RPIA 3M3PA 4F3NA 5MPOA 1J21A 1S1CA 4F97A 4L3WA 2KN5A 1YA6A 2V54A 1I1NA 3NEPX 4DIOA 5T57A 4LNNA 3T12A 9MHTA 1ZCZA 2IT1A 4Q4CA 1A9PA 3JVUA 3BWUD 2HHQA 3QX9A 3NV9A 1RCUA 3MRSA 5IH7A 1KS9A 5KNDD 4WADA 4XGIA 1E96A 3V6EB 3PW0A 4C00A 3Q14C 4RHYA 4RV9A 5HIMA 3THOA 3CT6A 2Y0SF 1G66A 4D25A 3KUCB 3AI1A 3MBYA 1SXPA 4U2BA 3WLIA 5LMUB 3LBYA 1BDBA 3PEFA 1WRDB 2RGNC 3CF2A 3O4VA 2GNAA 5BSVA 3W77A 2Y77A 5BSMA 4G1EB 2VG8A 4HMQA 4UEKA 5LIRA 1Q0LA 1ZQKA 2DC1A 1LPAB 3EZGA 3MT9A 1V7QA 2VPYA 2BCRA 4JZYA 4S17A 1D1PA 2VLIA 5FBZA 3K5WA 1ET9A 4R1PA 4A8TA 3NH6A 1N36B 5H02A 1NVAA 3Q3FA 2AN3A 1M9NA 2HHJA 4RTLA 1YZGA 1U9ZA 4JV5B 2GEBA 2CHXA 1QHXA 3ZV5A 5CDFE 4Q4AA 1BNCA 5IXYA 3F3SA 4B3IA 5FD8A 1NM5A 2VH5R 1BD4A 4BFLA 3FKJA 3Q4GA 4GRDA 3WYAA 3RAXA 3P4YA 2GRJA 3M6AA 3RSQA 3OAAD 4U7WA 4NLGA 5JDCA 2QSDA 3RUFA 3C7KA 4ECXA 2QT0A 1NNEA 4CUJA 3GV7B 2WG1A 3UQ2A 4KFTA 1OGJA 4FWIB 4UEWA 1YKSA 1NUHA 3N4MB 2PEYA 1F8FA 2SNIE 3IODA 2RAVA 1D5ZC 2NR2A 4MDKE 4JLDA 1U2QA 4AJ9A 3URMA 3EY9A 3KQHA 2CNLA 3RQSA 3NAZA 1PHPA 2IYTA 3FYUB 1N0UA 2DZIA 1JVSA 1QX3A 3VR1A 3GG2A 4EUHA 3KJFA 4CQMB 1O0CA 1K1QA 5G1PA 1PGAA 1MQ2A 3QQ5A 3GEHA 3ANXA 5CT4A 2WXFA 4D0RA 1H2RS 3BTOA 2JFZA 3M34A 5CLLA 5BQ5A 1HDIA 5DK4A 1RJ9B 2IIQA 3H4BA 3GZNI 2ZBDA 1UJMA 3NASA 1WMDA 4TV9A 1UKAA 4XQGA 1OY1A 2QVCA 3LWZA 4LYFA 4KLIA 2BGIA 1P73A 1T2VA 1XT6A 4IJ5A 3EDRA 1E1YA 1GAQA 2YS6A 2JT4B 2H11A 4IOKA 2IA5A 4QQKA 3DFFA 3KSBC 4LHVA 2GN0A 4WQOB 4HGRA 1SPBS 1WD7A 2V9HA 2G4VA 3IHQB 2I2YA 2X9LA 4G0WA 5CHVC 2QORA 1W8DA 2QAGB 4RQMA 3KU1A 4X0EA 1G20E 1KMHB 4TWRA 1HTTA 5F7XA 5M04A 1O5IA 1U2RA 3UI3A 1D9XA 1NNI1 3A0HU 1V71A 1JXOA 4MKRA 3ZWYA 3AF4A 2D10A 4KWCA 1ZR4A 2OR3A 3MS7A 1KSHA 3VFDA 4H4EA 3CNBA 1Y6GA 4FFWA 3RUDA 1BXKA 1NN0A 1FFYA 2HMXA 3DLPX 4MKFA 3H1GA 5HK9A 2J42A 5DQHA 1YJQA 3K2BA 3WNDA 5F9LA 3K0SA 1T6ZA 3VNUA 4DBZA 2D1TA 2YS7A 2QI9C 2X2EA 1L5LA 1XMPA 5ESDA 2PAFA 1QUFA 4IGAA 4E22A 3A9VA 3Q6BA 1ELOA 4FMDF 2LKDA 4V0LA 3UTCA 2GZRA 1UDXA 1QOPB 4MVYA 2COKA 3QPUA 1OASA 1QIHA 4MVXA 1T8TA 1PNRA 3O92A 2X9NA 3T4PA 3QLVA 1S2MA 2ASJA 3RYFB 1WSWA 1QRTA 2B37A 3EEBA 3TNDA 3C16C 1C41A 1MEEA 2W98A 4J7AA 1L3SA 1CXZA 4HY3A 4Z2AA 1N57A 1KEPA 2ONQA 4X7RA 5KFBA 3MJHA 5EKDA 1WBJB 4HQFA 3JQEA 4MS4A 1JIJA 5CEJA 3ELYA 4ROTA 1TVEA 5JJIA 2BRUA 4IS3A 2HSZA 3BQ1A 4BP3A 5LQKA 1H1LB 1H22A 2HA7A 2L0FA 1WGYA 2CFCA 3KO8A 2GVZC 3NV7A 4DSOA 4FMCB 3JWPA 4NJEA 2IEZA 4YXFA 4GGOA 2EQYA 4TV3A 1E69A 2ZR9A 3ZWCA 2QLFA 4BB5A 1DVRA 1ZUHA 1NDHA 3NZSA 3BF8A 2XK5B 4Z7QB 1E9BA 2FWAA 4HB3A 3KP1A 4K9QA 1EFLA 121PA 2Z57A 2I3AA 1MIOB 1SK8A 1YHYA 1A2QA 1ST2A 1WKBA 1BMFD 3B36A 5BQOA 1QF6A 5A3RA 5FWYB 3EAGA 3GBSA 4C2BA 1TLLA 3LZDA 4WBXC 3AE6B 1PGPA 4H17A 9ICJA 4IXMA 1I4PA 4BPRA 4K46A 1BHO1 1L8LA 1C1HA 1C9MA 4IRXA 1SEVA 4NZYA 3JAWB 1BU8A 2PMCA 2VA9A 4K2AA 4M1MA 3JPQA 5IJ9B 1DC8A 2HI0A 1R7RA 4C4VA 2XY5A 4PGAA 3UG6A 2IMWP 2N7EA 5DEOA 2WD7B 2JIOA 2G5TA 4IUCS 3NHPA 2W2OA 1EDZA 2YOFA 2HEGA 1CNEA 1OPRA 5JD6A 2HMUA 1QIFA 1B4DA 2KMDA 3V7YA 5AW1A 1P7VA 3RPFC 4Z8YA 2H5EA 2I3BA 2D13A 2FQYA 3A3OA 1RBZA 4GR9A 3PF8A 4CE6A 3GVCA 4FJYA 2EWWA 4IH1A 4M7OA 2RGAA 3DD5A 2Z83A 1TRHA 5H3HA 1GSHA 2ZEQA 3LDAA 1CQZA 2HWUA 4WASA 4BJ3A 1KYZA 3ESQA 1Q1NA 1JW9D 2J5RA 4FIZA 2WJVA 3H0MB 4QFMA 4D4GA 4KYIB 5IJAA 3PNVA 8ICSA 3KQPA 5K8JB 2VP6A 2J4DA 1T5DX 2C8LA 3DOIA 1BPZA 4QUGA 4LOLA 4OYYA 5ENVA 4RA6B 1E7MA 1LZKA 3RC7A 3RODA 3L7CA 2KG5A 2O14A 2YHUA 4FHEA 4WJQA 3W3AH 4UW9A 2IV7A 4DDVA 4XFKA 2FDCA 4TQAA 4N6GA 1MQ8B 2JJYA 1WE7A 4MVWA 1KAGA 3U13A 3PTAA 4Z6FA 4GMDA 1P2GA 4RTRA 5NULA 3AUTA 2VRRB 4JIOU 4DQVA 3HIZA 5KAFU 1OTRB 4LJ7A 5CEEA 1CUVA 2GBGA 5A3SA 3H18A 5HM8A 3NQ41 1KHTA 2XB4A 5K3OA 2BEKA 5TV2A 1V16A 4C5AA 2HHVA 2TMYA 1N3YA 4YJHB 3RTEA 4HH4A 5I4KA 5AM4A 1JWLA 2YY5A 4I1OA 5C8ZA 3R2IA 4ANXA 1XEFA 1ZK2A 4AJOA 4N41A 2H1CA 4P86A 4A73A 1Y7LA 1HURA 3NJ4A 1D2MA 3NT4A 1KQNA 4BRWA 4R0MA 2YDXA 1W73A 4PBRA 1E1DA 1LLFA 3A6LA 3S2AA 4Q3OA 3M6FA 4B3HA 2BM9A 2ZJ6A 5EE9A 3OMXA 2IHZA 1Z29A 4F96A 3OE4A 1WF3A 5H3CA 2DRIA 4CF5A 5D01A 3RYTA 2PHZA 4ALMA 4FOSA 1XMQB 1LBSA 2C42A 1RYEA 4N8DA 5K0BA 4GVXA 4RDCA 2JFQA 1GDDA 2KBEA 5IASA 3C70A 3D7RA 3CUYA 3EWSA 4KN6A 3N8IA 5CVTA 2CBXA 5BQ3A 2QTMA 3FSGD 1DQRA 5DHUA 3EPKA 5KFNA 3AIOA 4MI6A 2FUG1