5EE1A

Crystal structure of osychf1 at ph 7.85
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
373
structure length
363
Chain Sequence
RPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRHAGEGLGNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 115
structure length 363
sequence length 373
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee1A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee1A01
4D4KA 1GRRA 4KO8A 3VU9B 2WLBA 2GCOB 4AKGA 2CL7X 1E99A 3AKDA 3OE7A 3CRMA 3CX6A 4TQUS 4ZHPA 4C7YA 3PITA 3NVWA 5GXGB 2OM2A 3ZVLA 1M34E 4PAOA 4HAZA 3KKPA 2X8AA 2FFAA 2G77B 2UVQA 3MMPA 1KY2A 3AEGB 2B76B 2WICA 3CPJB 1Z3IX 4DXAA 1XTJA 4DC9A 3AVWA 2BBTA 2D62A 1FL9A 1X3SA 2E9SA 3ND9A 2ODNA 2BJWA 2B7BA 3I1FA 4DEXA 3VR2A 2R8RA 4LC0A 4NZYA 4L9WA 2YWGA 4DRZA 8OHMA 5LPNA 2VPPA 2O0KA 2V54A 2OZEA 3K0FB 4FMDF 4DCVA 3I8XA 4AKIA 4LHVA 5JRZA 3BC1A 1T8UA 3DWGC 1LNZA 2VH5R 3FKQA 3PEUA 4UKDA 4A2WA 1JRPA 3U6KA 4Q4HA 2QMOA 1SVIA 3FMIA 4A0GA 4Q5IA 2J7KA 2QG6A 2VL7A 3H1TA 2CK3D 5H70A 5GVRA 3T1OA 1GL7A 1P61B 4QM7A 2HDNB 1T4GA 3A58B 2MJEA 3AEBB 1ZUNB 1DAFA 1FX0A 1CBUA 3AH7A 5GJCA 3GJ8A 1ZUIA 3QG1A 2QPOA 4W9MC 4DCSA 5TVKA 3M6AA 2DHRA 4QHYA 2YNMA 4QL3A 1OXXK 2J0UB 1G4UR 1YE8A 2WJJA 3SI7A 1TYGB 1KY3A 4B34A 1KI8A 5TARA 2VTKA 1OPXA 4ZCIA 2W3SA 3EAQA 4N6EB 1FTSA 4LBYA 3GLFA 3GEIA 3PUVA 2O8FB 3K9LA 4FMCF 2N42A 2IYTA 4DSUA 1N63A 4GZMA 2Z5FA 1JR3D 3HU2A 4B6FA 3GLGE 3THXA 1MH1A 1NIJA 2PVGC 1UF9A 4YXWA 3T15A 2QA5A 3WYAA 4QBFA 4B47A 1ZM7A 1JQJC 2FA9A 4D4MA 2HYIC 4EPYA 3IUYA 1U0LA 1TKGA 1E0AA 5AUOB 2OBNA 1DOYA 4BZXA 1FMLA 3LB8C 1JECA 1H65A 1KDPA 2FGKA 4LBVA 2AXPA 1KI6A 1KFYB 3SFZA 2QNRA 4QOSA 5GJVC 4ASUD 2J0QA 2K5UA 3IHLA 4H9GA 4USAA 1XEXA 2IYSA 2RCNA 5FUWA 2RGGA 3BIID 1SVSA 5F9FA 3P1MA 4ASUA 1W7AA 3W5VB 4ZI2A 3GFTA 3VR6A 1YR6A 4I99A 4B73A 1NLZA 2RGAA 3QNUA 2CE7A 1OJLA 1COWD 4B33A 2L0XA 4P6VF 3HYTA 1SZPA 1D8TA 4G5QA 4KODA 4QHTA 4MKHA 4C80A 4Q1DA 4LGMA 1E0SA 2AWNA 4OK5A 5K8LA 1COWA 1KO1A 4Q7LA 2XZLA 1RZ3A 1GZSA 2FSGA 1RRGA 3WMGA 2VP6A 1QF6A 3OFNA 1E69A 1E9SA 4E5UA 3E1SA 1FQJA 4NYIQ 1WQ1R 2I1VB 3FE2A 2HYDA 5EUQB 4PQYA 1F2TB 3CKLA 1Q21A 1IBRA 1YJ5A 1FFVA 4IW3B 5EUMA 5FOXA 1SVMA 1KK2A 2W00A 2CJOA 1A2KC 1TUIA 1Z63A 1CR2A 4Y0AA 4WW0A 1E4YA 3CNOA 5JCZA 4NPHA 4C0QC 2IXGA 3TMKA 4BEJA 2AD1A 1CJVC 2X1VA 3MWLA 2F3TA 3EZ9A 5L3VA 1G8GA 1HURA 4DCTA 3K8YA 2R6GA 2OEPA 4AG5A 2BJVA 2ZI4A 1VG1A 4Q7KA 1F3OA 5AR1A 1IN4A 3D31A 5IF9A 1ZNYA 3GLFE 1ZD1A 1XTIA 3P1JA 3FFAA 2CBZA 4IHQA 1FW6A 3BFXA 2ORWA 1MABB 4AD8A 5B30A 2ZSEA 4BGDA 1XX6A 4EJSA 2BKUA 1Z8FA 2RGNA 2R6DA 4LJ7A 3NXSA 4NCHA 3OHMA 1T3SA 2QP9X 4I1UA 1VYVA 3T5DA 1OIVA 3T1TA 1X8LA 2QBYB 3MRSA 1ZUHA 4NYMQ 3W8NA 3GEEA 5EE5B 1WWTA 3AV0B 2RH5A 4BQSA 3EZ7A 1W36D 4CGZA 1J7CA 4YDHB 2AK3A 1L8QA 5FPTA 1LTQA 4PANA 1RE0A 1UJ2A 5TDHA 1EFUA 3SJZA 4EJSC 3VRBB 2QTVB 2XJ9A 3B1WA 4TTPA 1TL7C 1XJCA 5FTLA 1M7HA 2QMEA 4KHZA 4IDNA 3NDBB 4QBHA 3SDZA 2FV8A 4M1YA 3W3AA 1T5LA 3K70B 3THWA 3MWYW 1YR8A 2BMEA 4LC1A 3QKUA 2FF7A 4M8NE 4A9AA 3AM9A 2VRWA 4I4LA 2NO1A 1GAQB 3ONWA 1XMJA 1FMAD 1W36C 2JQRB 1N6PA 4EAQA 1Q3HA 3IPXA 4PPGA 3TLXA 1EESA 1E2PA 1J70A 1YZGA 2P2LA 1MO5A 3DZ8A 1ZNZA 3AE7B 2P0EA 3K0AB 3R7WB 3L0PA 4DIEA 2PLFA 3C7KA 3PXGA 1GKYA 3P4XA 5JI3E 4KVGA 4RJLA 4RKFA 4QM6A 1S1MA 3BRWD 1U9IA 3TSOA 3EZ2A 4NYJQ 3IBGA 4PC1A 3CH5A 4BE7B 4QKQA 4Q02A 5DHAA 4O3MA 5C1BA 5DI3A 3EA5A 4IXNA 3ZZ0A 2CLCX 1RC8A 4MRRA 3WRXC 2JIZD 1WB9A 2GCPA 2VF8A 2A5DA 1U0HC 3CF0A 3M4YA 3W34A 4B74A 2CCJA 1CLUA 2C95A 1YZUA 2FBWB 2ZRDA 4M4SA 4S2EA 2JIZA 4C2UA 2BHRA 2GVZC 4G5SA 4RZUA 4CW7A 1KO4A 2UZIR 3HWSA 1G19A 1VECA 2DBYA 1ZD8A 2VBCA 2WHXA 4JLJA 4CEJA 2HLDD 3AE8B 3VR9B 5FOVA 1S9DA 4D2IA 1FRDA 3BAFA 3BB4A 3R9IA 5AWFC 2GZAA 4BFYA 2G1EA 4Z8YA 4B3CA 4CEHB 2HLDA 5EE3A 2P3SA 1E4VA 2QP4A 3WXMA 3U61B 1R7SA 1X8KA 2WJIA 1DG3A 1F60A 1WA5A 2ZRLA 2ZRPA 2GXUA 1BO6A 1IOZA 3F8TA 1QOAA 2O0HA 2KAJA 3LX5A 2ZROA 1DAEA 3SS8A 5M04A 2WJYA 2A78A 2ZI9A 3U5ZB 2F9LA 3W6NA 3AVVA 5HE9A 5BQ5A 1KSGA 4LJ5A 1Z07A 2OE2A 1LF0A 2DCUA 3TW4A 4C0AC 5G41A 2OBLA 3QF4A 1G7RA 1R0ZA 4UXHA 4UNQA 1U94A 3ZQJA 4GRAA 1IUEA 5J47A 4IJMA 2O8CB 2HTME 1NVWQ 4PHHA 3GLHB 4DSNA 5KO2A 2R62A 1PDXA 2JASA 3E2IA 1HT1E 1TQDA 2IYLD 4QJ3A 3PJRA 1KZGB 2QORA 3EIEA 2G3YA 4Q66C 2R2AA 1RVDA 3BB1A 4TSFA 2IK8A 2QZ4A 4QBGB 4ARZB 1NN3A 1NG1A 3LD9A 4MRSA 4LHXA 4TL9A 2VEDA 2VSXA 4E22A 2PLRA 3AF3A 4K46A 2ZEJA 3UMRA 4QGAA 4UXJA 2Z4RA 2QQ0A 2J5XA 1UBFA 4TN1A 5B57C 2WIAA 4IDIA 4KFRA 2H16A 4QG7A 1O87A 3L43A 1CF4A 1E2NA 1IJEA 1ELOA 3LXRA 1TJEA 2KBFA 2B8WA 4HSEA 1S2MA 1YJIA 1PJRA 1GNPA 4W5JA 1JXOA 2JJ1D 1OYYA 2CHQA 5FL3A 4KX6B 4Q1BA 3TE6A 1RRCA 3A37A 2F9MA 4LUCA 1E9FA 1X8JA 1SVOA 1Z0KA 4DLUA 4GBMA 4D0LB 1OH8A 3REGA 2JJ1A 2WVJA 2OCPA 3WHLA 3B13B 1E0ZA 2IUSA 2XSZD 1RFKA 2ERXA 3FOZA 1WXQA 4MITA 2FG5A 1CJUC 2J3EA 1CR1A 4H1UA 3QSYA 2BEJA 2XSZA 1FRRA 4PFSA 5J40A 4JVNA 3RSOA 1S96A 4YMSA 3WBJA 2F1RA 1DE0A 1SKYE 3MLEA 4G1UC 4UNPA 1YQ3B 3OEHD 4MQBA 2WQYB 2JAQA 5B64A 4KLZA 3B60A 4HB2A 1HYQA 2ZJAA 3OAAD 4HLQB 4YC7A 1S3GA 5FR1A 3AH8A 2PL3A 3SFDB 3OEHA 1SB3C 5JCPA 3BFKA 2AD5A 3WBKA 2QSZA 1N6IA 3GFOA 1TQ4A 1Z6YA 1XPRA 4DVGA 4AC9A 5FFMA 1P2UA 1P9RA 1T3LA 4JVSB 2XITA 4U00A 5TB5A 3QPUA 4YTNB 3LW7A 5H1YA 1VDVA 1DVRA 3EPJA 1PUJA 2QE7D 3U3OA 3M1IA 3D7MA 1NJGA 4B2IA 3B2GA 3QKTA 3LNCA 4E09A 3O8BA 1YZNA 1CJMA 2PT5A 2GESA 1G21E 4P32A 1JALA 3NBZC 4TLDA 2ZRIA 4ZKDA 2YINC 3GPLA 2PCLA 5D3MB 5DH9A 2NOAA 2QE7A 4B48A 4BLRA 4B35A 1VG0B 5JECA 1PV4A 3UANA 4CIDA 4ITRC 4MH0R 1D6JA 3FMFA 3RANA 4LYFA 5HE8A 4KFUA 3TUJC 1X86B 4JLPA 3AF4A 2BT6A 3AE1B 2JLVA 3Q72A 1QVRA 4K8OA 1QG2A 2EWWA 2IS4A 3ZD6A 2EFGA 3VRAB 1MO4A 2OILA 2EKIA 3CUEF 5AUNB 3SC3A 4N1AA 2JLUA 1W4BA 1Z28A 5BYJA 1LS1A 3SQXA 4JLNA 4US0R 4FWIB 1ANKA 1G3UA 5KHOC 1ZP6A 2DFLA 1UBEA 4HDQB 1VTKA 1L0VB 1OFIA 4N59A 1E2DA 1FUUA 1UFQA 3FTQA 2WJGA 3DO6A 3NDPA 3TW8B 4DB4A 2REXB 4BFVA 1QHHB 1E0KA 2Z6VA 3GJ6A 4PPNA 3EIHA 2ZIAA 2VF7A 2YHSA 2J0SA 3DM9B 1GL6A 4L4UA 1P5ZB 1J7BA 3ETLA 2V6IA 3QBTA 4YSXB 2A7QA 1CKEA 4I1SA 4XIGS 5JHHB 3GJXC 1L2TA 4V0LA 4P31A 3ZGXA 4RD0A 1JEEA 4L5BA 1DS6A 4BUJA 2YOGA 1CR4A 1E7PB 1V8CA 5GJWC 2ZJ2A 4S35A 4BLTA 4UJ3A 2WDVB 2FNAA 4FI3C 4HUQA 3DMNA 5H68A 2MMCA 4DCNA 1I4LD 3RS0A 4P4SA 3KDSE 4EPTA 4ZIRA 5HPYB 4Q00A 3MUFA 4P33A 4O2RA 3M0EA 5KYKA 3VR3A 3K0SA 1KKLA 2AKAB 4HZUB 1S3SA 3IO3A 5KSZA 3ADBA 1SGWA 2V55B 4F4JA 1G7TA 1U90A 3VNVA 5P21A 4FCVA 2G0TA 1N5IA 4RD3A 1HA3A 4I1VA 3LQQA 2D74A 3AGPA 2YV5A 4XWAA 2F3RA 2PMDA 1N62A 3BFVA 4FMDB 2WWFA 4DCUA 4JBYA 3RLFA 4IVPA 4DLSA 5TMPA 5KNCA 1ROEA 1DBSA 4XWOA 1YU9A 1IN8A 2Q3MA 2AX4A 4YSYB 4MKFA 1DG1G 1VYUA 2JJ2D 4QNMA 3PIRA 3QKRA 2ZAOA 5JFGA 4HAXA 2W6ID 3SBDA 1XEWY 1OB2A 3I61A 3NG1A 3UG6A 1AKEA 1E98A 2FSFA 2JJ2A 5JWOA 4JKYA 3SJBA 2H89B 2W6IA 3C5CA 4O0MA 3EUB2 4MDEA 4YSZB 1WMSA 4EQ6B 4LJ8A 1OH6A 3AVUA 5H8YE 3G5UA 2K9XA 3LA6A 4LHZA 3B9PA 4HZIA 1ZM4A 3TVDA 1XNJA 3U44B 2CLDX 2J45A 3O8RA 2OXCA 2Q6TA 5L3QA 3AP2A 1E2EA 1IY0A 2AWOA 4OHVA 3FMOB 2JLYA 1PLJA 1XXHA 2H5EA 3AB3A 1NYQA 5C4MA 4LCBA 5TV2A 2ZRAA 3B1XA 4EFLA 4WBSA 5HCNA 1Q20A 1B0UA 1QOFA 4FMCB 5JRJA 2FU5C 5H92C 4C0LA 4NYIR 1PZNA 1TF7A 2FDCA 1WDTA 2ZS9A 3F3YA 3VKGA 1D9ZA 3R9WA 1P60A 3AKCA 1Z5ZA 4KLNA 2BS2B 1VLBA 121PA 1R10A 2GXSA 1BH2A 3QKSB 2A30A 3LFUA 3LX8A 3DHWC 3KKNA 5L8VA 1ONBA 2W0MA 2W58A 4DZZA 1DOXA 3ZVMA 1SVWA 2JLRA 4OQNA 1CIPA 1OFFA 3QBVA 4CYMA 1N5WA 4R71A 5BW8A 3JVVA 3LQRA 4KSCA 4B43A 4TZ6A 4YTMB 2Q21A 4O2LA 2QROA 1KF6B 2EVWX 3U3JA 3IKJA 1YQTA 2QM8A 1II8A 2WAXA 5CDFA 1ZVQA 2IT1A 3PCRB 1BYIA 3S1AA 5LD2B 3GP8A 2XTMA 4M1OA 2GEVA 4C0HA 3QVUA 1VYTA 2VP5A 1R7RA 1XEWX 4US1R 4WXPA 4XVQA 4PAMA 1UEIA 3SE0A 2ZSBA 2IYQA 2IHYA 4LV6A 1QHIA 3SBEA 5JSZB 1CEEA 1NKTA 1E3MA 4WWMA 1XZQA 5KTYA 3AE6B 2M56B 1SXJD 3C14C 4BFTA 4Q4LA 5BN5A 1I4TD 1HV8A 1XFAA 3F5FA 2P65A 1Q1BA 4M21A 4KYIB 3H86A 3Q85A 1PUTA 1IXSB 2W83A 4PPQA 4H1VA 5JJKA 2IWRA 1XXHE 2OSBA 2VHTA 1C1YA 2BMFA 3QE0A 4Z1MA 4A6PA 1GDDA 1QHGA 3AP1A 4URYR 5FI1B 1DAGA 3CPEA 2JGNA 2RGXA 1E2JA 4B71A 4JLMA 3UMSA 3VR1A 1XLPA 4TYQA 1XD8A 3JZMA 2P5SA 2N46A 3TIFA 5IRCD 721PA 4URZR 3IILA 2AL7A 4KCGA 1KZ7B 4MUAA 3B8HA 3NHBA 1T0JB 3P4PB 3EZ6A 1J90A 1N61A 3REFA 4UNNA 3GD7A 4JVLA 621PA 1OIXA 1UKVY 4C9BA 1W49A 2D4HA 1OXSC 3RNLA 1G4AE 2WU5B 4FIDA 4YXDB 4DLTA 2OCYC 1OB5A 4Q4AB 1XD2B 4B6EA 1KI4A 3AF1A 4A15A 4MRVA 4TYPA 2WSMA 3PUZA 1R5NA 3DKVA 5EXXA 1SVLA 4RFVA 3X1YA 3TGPA 1UKZA 1XO3A 1VCNA 2RMKA 2YYZA 4ZV4A 1GFIA 4DT1B 1FZQA 1ZNWA 2HJVA 1CS4C 5L3SA 1A1VA 1W48A 2K22A 1F2UB 1E96A 4JSYA 4XD7D 2CU3A 3B9QA 2CE2X 2SHKA 2WWHA 1OQQA 3SNHA 3FHCB 4DEYA 3THYA 3MAAC 2G1KA 4XD7A 5HZKA 1K6MA 1AKYA 1JXMA 3IQWA 2NQ2C 3FHTA 2PMKA 2FEMA 4LPSA 4NCNA 4F4IA 2ZUDA 2XXAB 5EXPA 2ZVPX 4AI6A 1G8FA 2H88B 3LH5A 3TKLA 1ZC3A 1G18A 5GJBA 3C8UA 3UK6A 3DOEA 4GOJA 4PR0A 2QQEA 2VHJA 4YMWA 1KI9A 4CT4B 3SQWA 4D0NA 5JEEA 2KMMA 2CXXA 1NN1A 2J0UA 3RRZA 4EUNA 5CM8B 2HV8A 4D4JA 3KXLA 5B58C 1MV5A 3IPYA 3RC3A 1TU3A 3X1ZA 1PUIA 2H17A 1EFHA 5AK0A 4DLXA 2W2VA 2OO7A 4LJ9A 2JCSA 1C9KA 1EWRA 1OYWA 2GJKA 4FCWA 4PHFA 4MKGA 3CRVA 2E87A 5C4GB 3TAUA 1GP2A 1UKYA 5F2EA 4IFEA 4NKRA 2REBA 1E1QD 3T61A 3GLGB 1QT9A 1N25A 1EXMA 4MRNA 3VFDA 1RYHA 3AEEB 3B1VA 1E9CA 2CK3A 4RD2A 2HCBA 4LYHA 4ACBA 1RPZA 1M74A 1E1QA 1GL9B 4Q01A 4V0ME 4IOMA 4B32A 4C0JA 4HB3A 2IC5A 4M1KA 3AVYA 3LVQE 3SOPA 3K1JA 1T6NA 5EXSA 3PVSA 4AKHA 3NEYA 4TMKA 1B23P 4K81B 1TF5A 3T34A 3O8DA 1VPLA 2MSCB 4A0FA 3PEVA 4QRHA 3CNLA 1XCMA 4LI0A 5FBQB 4DLRA 1GSIA 4LHWA 1QOGA 1E2GA 2AR7A 3CO5A 4XSGA 4EPVA 2QL6A 2AFIE 2H7VA 1ZM9A 3QPVA 3RS5A 1J7KA 2GHIA 5CLQA 3BS4A 2QENA 4JLOA 1LY1A 2ZRFA 2G0NA 1JR3A 3W3ZB 3WP0A 2WAYA 3VHLB 4FCTA 2MMGA 2DY1A 4RCZA 2GAOA 4N58A 5JBQA 1VKJA 1AGRA 2VQSA 2MSEB 1NY6A 3H2YA 3UPUA 2OAQ1 1G41A 1DO2A 4Q4HB 2V9PA 3PEWA 2CJNA 3CPHA 2Q3FA 5KDLA 3H84A 5EP3A 4HATA 3QI2A 4KV9A 5LDDC 4U02A 2H1LA 2R6FA 3BGWA 2KJQA 1AZSC 1L4UA 1OH5A 4CF7A 2C99A 4LJAA 4AURA 3QVVA 2QI9C 5HTKA 1JQLB 1IM2A 3JVUA 4Q9IA 3KB1A 3DEFA 2Q0HA 2I4IA 2ZJZA 4OKSA 3NRZA 4C3ZA 3MFYA 4WAUA 2W2TA 2XAUA 1KJZA 3MSXA 3AM1A 4W7SA 4M9SA 5J4VA 2FN4A 1F0ZA 2ORVA 4WZAE 4EIWA 3GLFB 1X1RA 1U98A 3U6BA 2DWPA 3A1SA 2BM0A 1E0JA 1LB1B 1NBMD 2IXFA 3HRDD 4EKDA 3CBQA 3LBIA 1UM8A 1SHZA 2NO9A 3THXB 4CRWB 2CDNA 1NBMA 3F0TA 3HR8A 4JL5A 1Z2AA 4A6XA 1CJKC 4PZYA 1P9NA 1R0YA 5E7MA 3QG5A 1JWAD 4GNKA 4TYNA 2JLSA 4EDHA 4TLEA 2ZPTX 4WOPA 1KI6B 3EW9A 1W47A 4N3NA 2ZRJA 4BRWA 3SYLA 2OFWA 4OQLA 3CNNA 2NZ8A 1XEXB 3EC1A 1S0UA 4HDCA 1VCMA 1XJQA 4Q1EA 4ZKEA 2NO6A 2XOKD 4C4PA 4TMXA 5IDVA 2NO0A 3K70D 4PSVA 1DOIA 2OFOA 3KZ1E 2BIFA 5KU1A 2O52A 4ZCLA 4HUTA 1A4RA 3MG9A 1HQYE 4Q9LA 3WYGA 4GOKA 1GNQA 1Z22A 2NGRA 1RYJA 1JR3E 3V4FA 2M19A 1YR7A 4D0GA 5FOSA 3ZVRA 2VA8A 4G5OA 3IEVA 2ERYA 4LOAA 1FFHA 3BWDD 1VJKA 2XTNA 3MCAA 3CB4A 2NG1A 1QHXA 4ZI3A 3ETRA 1VHLA 2JDID 4XVRA 4Q7JB 3FB4A 2Y8EA 2YOFA 3ND8A 1FXIA 1G291 1JI0A 1GNRA 1XTKA 3B5JA 4TTQA 2RGNC 4RY2A 1UBCA 4MYTA 2Y5CA 2ZJ8A 3AGQA 2CJWB 3KQUA 4RD1A 1QHNA 1HE1C 2ZJOA 4TLCA 4GI7A 3T5GA 2QN6A 1KK0A 3BOSA 3C41J 3C4JA 3PO0A 4B3GA 4KFTA 4Q48A 2ORIA 1UAAA 1BMFD 1XTQA 2J0VA 1E2QA 1Z6AA 4HEJA 5KSPA 5IK2D 1OT3A 3K53A 3QIAA 2QMUA 1W0JD 2PH1A 2RGBA 1I2DA 3SEAA 4ACAA 1BMFA 5JI2E 1E2MA 1E9RA 1OH7A 1OIWA 1W0JA 3PEYA 1HQCA 2DPXA 4EJSB 1GAJA 2FFQA 4QGGA 2IF2A 1GKIA 2F1IA 4GSYA 3CW2A 2ZYTX 4KBFA 1UKEA 1Y63A 1CRPA 1EWYC 2KI5A 1FUKA 1DAKA 1NBME 1NG9A 2Q5WD 2EFHB 3KUDA 3PFIA 5CIQA 2P5TB 1ZJ6A 4D6PA 4MGKR 1VCIA 1UADA 2QY9A 2VIIA 4QJ5A 3NKVA 1N60A 2AN9A 1G6HA 1G3MA 3FFBA 1DPFA 4ZO4A 4JL8A 4C0BA 5A4JA 3CRRA 4XTCS 4D25A 3NBXX 2EU8A 1AS2A 1W36B 1WE2A 1HEIA 4PHTA 1KDRA 1RJ9A 5FH9A 3RYTC 4ABYA 3GLIA 5HCIA 3RSLA 4OHYA 2BS3B 4EPWA 4BASA 3IEUA 4LYJA 1JROA 3K0CA 4ITKA 2ZRNA 1T9HA 5FBWB 1U9IC 4DLVA 3THWB 2JLWA 2QAJA 1JJVA 1XWIA 4CEIA 3W9YA 4CT5A 4C30A 3TQFA 2GETA 3VR4A 1OW3B 1XDBA 4HAWA 4NL4H 2ZRGA 1QBKC 5HZHA 1MRSA 1K5DA 1G9XA 2GJ8A 521PA 2DR3A 1S1CA 2KWIA 1G5RA 4DDTA 2HEIA 4GMXA 3KQHA 3ADDA 4XVUA 1N5KA 3KWLA 1ZXIA 2VP2A 4HB4A 4LJ4A 3B2EA 1P2VA 3I5YA 1Z0DA 3TR0A 1HY3A 4IDHA 4MA4A 4KFSA 3AE4B 1N0WA 1QHYA 2A5JA 2YWHA 3EZFA 2GAAA 2X2EA 4ZCMA 1FP6A 4U7DA 1LS6A 1OXVA 2KBEA 1KDOA 5DI3B 1WCV1 5CYPA 2G83A 4TT3D 1W46A 3OIVA 3SFVA 1ZAKA 3EASA 3RDPA 2FPMA 1YQ4B 2V3CC 3HDTA 4TT3A 2EW1A 5C2JB 1TKYA 5J4LA 3SHWA 2XB2A 3QXCA 2PT7A 4Y0VA 4A0RA 1LFDB 4U5XA 1W4CA 2VP9A 1FP7A 3BB3A 4Q1AA 1FMJA 3BJIC 2GK7A 2ZU6A 2EFDB 1BOFA 5EP4A 1XZPA 2J46A 2W2XA 1W4AA 5HR5A 2O8DA 1QG4A 5EP1A 4AYXA 1W1WA 2PX0A 2DYKA 2ZRBA 2ZSAA 4KYUA 4ERNA 2ZAMA 4AYWA 1M1YE 2W55A 2GDJA 2NO7A 1SKYB 2P6UA 1DAHA 2QTFA 2G6BA 3P20A 4IDPA 4YQFA 1NVXQ 2AKYA 3P4YA 1DTSA 5TY0A 4JX1C 3RWOA 3AKYA 1T3QA 4G0NA 1N0UA 4V0OA 4JVMA 2HF8A 1XLQA 1OFHA 4YMTA 3OIWA 1ETUA 421PA 3GFPA 4TYWA 1ZCAA 1RWSA 2XGJA 3GLIE 4IEEA 3KX2A 2C9YA 3BH7A 4ESVA 5FPYA 1XCPA 3PUWA 1BKDR 1N6NA 4QHSA 3ZDQA 5DNYB 4EFMA 2C8VA 5JS7A 1TKEA 2FEOA 2QPTA 3ZYYX 2N1BA 3X1WA 3BORA 1AQYA 3U60B 3PR1A 2J9RA 4RZ2A 1G3RA 3KJEA 4II7A 4DDWA 5KSYA 5DE3A 1E2FA 2QSYA 2QEQA 1XLNA 2JATA 3A4NA 1FPMA 3OAAA 4FW9A 4OHXA 4TMVA 1D2MA 3A4MA 4G5GA 4A92A 2WJVA 1E6CA 4LYAA 2VLIA 2WMNB 3W6PA 2NIPA 4QNRA 2EWVA 1Z2CA 4M1SA 4HI0E 2F1HA 1M2OB 2VHQA 2CCGA 2LEKA 2VSFA 3FKSD 4OQMA 4Q21A 1KMHA 3NS1A 1KAGA 5FBVB 2I1QA 3VQTA 5AUPB 1E32A 1YR9A 2OFXA 4NONA 3FKSA 3RC8A 1CULC 4PSAA 3U7HB 1NVID 1J2JA 4M1WA 1N6LA 3ASYA 4TTRA 4YLGA 4ZDIA 2BCGY 2FOLA 1GG2A 4US2R 1G3QA 3NH6A 4IOLA 1GIAA 4JKIA 5G53C 1YRAA 2ZVQX 4HAUA 4GP6A 4NCIA 1NF3A 2H8KA 3BIFA 3T1VA 4A8JA 3ZVNA 4M9QA 2WWYA 2HJGA 4X8LA 2W6JD 3ZH9B 3T12A 4QJ4A 1M7GA 4IVRA 3J81k 2BDTA 4Q9HA 4F7WA 4UNRA 2C2HA 4DLZA 3SR0A 3CRW1 2W6JA 1AK2A 4LK2A 2ANBA 2ANCA 4RCYA 2ZI3A 4OJKA 2ZR0A 1IHUA 3V00A 2CL0X 3KQKA 3U7FB 4GPTA 1KK1A 1XMSA 4TL8A 5KNDA 3KQNA 4PZLA 5FI0B 4ZDWA 1E2IA 4Q7MB 3HU3A 3VNUA 3LXXA 4HZUA 4QBIA 1KI1A 3RS4A 2J41A 1ZP0B 5AUIA 4MRPA 1L6VA 2C5LA 4UNSA 1P75A 4AY2A 3Q5EA 4A8JC 2VHUA 3KFVA 3HPQA 2ZYUX 4PO8A 1KJWA 3A1TA 1US8A 5SZHB 3BD9A 1U8ZA 5K8IA 4LHYA 3LVRE 3EPKA 4M0LA 5LBIA 2WJHA 1DAMA 1AJEA 2L83A 4JBWA 5CLLA 2XEXA 3A36A 3N2EA 4JS0A 2B6HA 1NLYA 3TVTA 1CU1A 1E1RD 1VG9B 5AJXA 1F5NA 3IHWA 4F38A 2CHVA 4N0DA 1MRNA 2ASEA 4TYYA 3LV8A 4Q4JB 3OEED 1TU4A 3DOFA 4P4UA 1IXZA 1E1RA 1R5BA 2RHDA 2ZQ5A 1N5XA 1DGJA 3AVPA 4NE2A 4LPKA 3IGFA 3OEEA 1XRJA 4PC6A 3I3SR 2J87A 3AE2B 3I8SA 3A6PC 3BH0A 3A1WA 3NVZA 3A8TA 3B1ZA 4R2HA 2G88A 2C9OA 2A2ZA 2Z4SA 1Z0IA 1AYFA 1G8HA 3Q7QA 4JLBA 4LDJA 2QJLA 2WWIA 4BFWA 4PX9A 3U2QA 1A2BA 1VHTA 3U4QA 3N2IA 1Z06A 5JHGB 2FPLA 2WWWA 2RB4A 1U2RA 1JAHA 2ZTSA 3QPWA 3UG7A 1G64A 4ZOHC 3B85A 3TUZC 1N3BA 1ZRHA 4JIMA 1XTRA 3CWZA 1EK0A 2ZXUA 3B6EA 2DFTA 2FZ4A 4LTUA 3B82A 4CVNA 5KPJA 2ZE7A 3KXIA 1R0WA 2RGDA 1P62B 2CMKA 2GXQA 2ATVA 1R8QA 5CM9C 1JB1A 2FWRA 2R65A 4HLDA 4L15A 2WKRA 1WF3A 3R8CA 3KKOA 3W5IA 3P63A 2YC4C 1EGAA 3GEHA 2BBWA 2C77A 3CF6R 2OT3B 1G6OA 2DB3A 2Z43A 1D9XA 4HUQB 3QKSA 3SJAA 2LCFA 5E7IA 1VDZA 3FC4A 4ZIRB 1XD9A 3U3MA 4M1MA 2QTHA 3NVVA 2IS6A 2IEYA 2HT6A 2ZANA 5G40A 3AV8A 3TSWA 1R4AA 3CZQA 2ONJA 1TEXA 5B2ZA 1IY1A 3HJNA 2GILA 2REOA 4W5WA 3ZYCA 1XU4A 1JW9D 3SU8A 1HE8B 1OFUX 2Z83A 3PG5A 5FOWA 2E3TA 3HU1A 3KUCA 2ZE8A 1FOEB 3QOFA 1G5TA 3LWNA 4B3BA 3GMTA 3ASZA 3AMZA 1E6EB 4FD2A 1I2MA 3ZZUA 4QXAA 4V03A 3DL0A 5AJZA 1Q3TA 4C7ZA 5KPDA 3L8YA 4DHEA 1W0KD 1TTTA 1L5PA 5K8TA 4XOIA 1KSHA 2IWHA 4DBLC 4DDUA 3QKRB 2GVDC 2R6CA 4ILEA 4RFSA 1WYGA 1Q1QA 2C78A 2MJ3A 2BCJQ 2O8EA 1W0KA 3CWIA 1F48A 2KE5A 2ZS7A 3KTAA 3Q9LA 3IIKA 4M9XA 4B3FX 3VKWA 1ESMA 4Q19A 1K5GA 3TSZA 3QUSA 1TQ6A 3TAHA 1I4DD 1VCOA 2P67A 1II9A 1VIAA 3I92A 4JMPA 3B2FA 2P6RA 3IBYA 2OCAA 3AUYA 1PFDA 3X1XA 3VR5A 6Q21A 4OHZA 2IS1A 1OXUA 4X8HA 3Q8XB 2L52A 1Z08A 5L3QB 1RM6C 1QZXA 2EYQA 2FFHA 1NP6A 4C2TA 2B8TA 1Q57A 1XXHB 3VAAA 1AM4D 5J5CA 2BMJA 3K9GA 1KIMA 2F43A 5FTMA 2ZUCA 3JZAA 3QF7A 2ONKA 3QEJA 4PTLA 3P4RB 3AF0A 1G8PA 4NCKA 3UKDA 2O8BA 1TAGA 2XX3A 2YOHA 2QAGA 4IKEA 5SZKB 5UKDA 3W5UB 4PO9A 4NCJA 1E10A 3KL4A 2GJAA 3OF5A 1J8MF 3EA0A 3PQCA 5JJIA 1KO7A 1R5OA 1SXJA 1N6OA 1E2KA 1P2SA 3AB5A 1Z83A 2ZJ5A 1LVGA 2WOOA 1XPOA 1RIFA 2WWGA 5G3YA 2P6NA 3CLVA 4F91B 3EWAA 3ZIAD 3EX7C 3MJRA 2RKOA 4YDSA 2AFHE 3T06B 1BS1A 3ZIAA 4GZLA 5FBRB 2XNDD 2BM1A 3TQCA 2QAGC 4ZPXA 1T3HA 2A9KA 2IYUA 3TNFA 5SZIA 2OLJA 2XTZA 4HROA 2GCOA 2W54A 3K9HA 3VU9A 4WQMA 1SXJC 4TQ9A 4BZPA 1NVVQ 1CJTC 5LB4A 1II8B 5JZVA 3RABA 1YJJA 2QRZA 4LBZA 3S1AB 4L8GA 4RZ3A 1GKUB 3ZS9A 2Q9BA 2QP3A 5JWHA 1FQKA 2JLXA 1FIQA 2MSDB 2ACZB 2DFNA 4JWSC 3NIBA 3UWOA 2HUPA 1GPXA 1ZIOA 5IHPA 3TH5A 3IDQA 3CONA 3CX7A 1P2TA 2R6AA 4I81A 1ZC4A 1NSFA 2B21A 2PEYA 5JEDA 5FOTA 5CK5A 4R7ZA 2QUZA 3MJHA 3K0FA 5AUKA 4JJKA 1KO5A 3I32A 2R9VA 5CDFE 2NZJA 1W2GA 1NMZA 2C9CA 4YONB 1NI3A 4IXMA 3EIQA 3AP3A 1ZNXA 3VR8B 221PA 4DDVA 3Q5DA 2ZYVX 1NN5A 1J99A 1U8YA 1N2CE 2D2EA 4JT2A 2QGZA 2OV2A 2AX5A 4US9A 1KI7A 1IN7A 4OK6A 1FO4A 4B3DA 1AQUA 4GMDA 2AK2A 4GL2A 1YHNA 3VKHA 4IDOA 3EPLA 3NBYC 1GITA 3KKMA 1Q0UA 1KYIA 5MPOA 1AS3A 1SXJE 3EPHA 4P4TA 4C7OB 3NTUA 3VHXA 5DYGA 2QGNA 3GJ5A 1F6BA 5FTJA 1N0VC 2XB4A 5EXTA 1KK3A 3PUYA 1KMQA 4FWTA 3UIEA 3AVXA 3E70C 3OIUA 3T1QA 3T35A 2O8FA 3QXXA 3LLUA 3NC0C 1WP9A 3RRYA 4IVQA 2FMXA 2J59A 3GQBA 3OESA 5EP2A 2H18A 2WSSD 3TK1A 3ZZTA 4A0HA 5CK4A 3N5CA 1G5PA 2ZR9A 3RS7A 1JJ7A 3B7GA 3W9CB 5L3SB 1CRQA 1E9AA 3AQ4A 2WSSA 1FNMA 2ZITA 1A70A 3QENA 4HRSA 2IF0A 5A5GA 1S4QA 1CJEA 1O3YA 1WBDA 2IW3A 2O5VA 2Q3HA 1KTVA 4OQXA 5HKKD 3THYB 1E2HA 3HYRA 4US8A 2HF9A 3FHOA 3WNDA 3LY5A 3BXZA 4MGZR 2PEZA 5HKKA 3D8BA 4PSKA 5AUQA 4HLCA 5DIFA 1G8YA 4CDGA 2F6RA 4JL6A 1EFTA 5C2TB 1Q44A 2FFBA 1G1MA 3WMEA 3P4SB 3RS3A 3AVTA 4PC2A 5ANRB 1CXZA 1Z0AA 1OSNA 2HT1A 4Q03A 4R9UC 4XWKA 5EQTA 1FTNA 2GEDA 1NJFA 3LDAA 3L0IB 2EQBA 2QU8A 2ZRKA 1KAOA 4BWYA 3P27A 4G01B 4WIAA 4DIDA 1F2TA 4YXWD 3D3QA 5GVSA 4JBXA 4A1FA 3DPUA 4M1TA 2GWHA 4LV5B 2D7DA 3ZQ6A 1N5JA 3RHFA 1N6KA 2X19A 4AIIA 2ZRMA 2BS4B 4URXR 2G1JA 4Z8XA 3U7GA 1FX0B 2ZETA 1L6UA 1RKBA 1G20E 1ZOYB 3FAHA 1VG8A 4NU0A 4R2IA 2ZRHA 4HYYA 1JQ4A 1JEDA 4RVCA 4OL0A 2YZ2A 5ELXA 4BPBA 1ZYUA 4F4CA 3QJYA 4DB2A 1V5WA 1A82A 1TMKA 2GZHA 1ZW6A 1EG7A 2EFEB 4QFMA 2IYXA 2RAPA 2UZ3A 4LZZA 4UXIA 1YZTA 2ATXA 2UKDA 4OYHA 1U8AA 2VSOA 4HLUA 3AN1A 4PC7A 2WDQB 5FUVA 2QRNA 1MABA 3RS2A 1ZD9A 3SHFA 5FPKA 2IS2A 3SYNA 2VP0A 3H4MA 5LB2A 4BEBA 3K9NA 4D82A 1YVDA 3I62A 4A82A 2IHBA 4RD6A 4XSHA 1WBBA 2GTPA 4DUGD 4DLWA 3DWMA 2QBYA 1NVUQ 3OFND 2VYFA 3HP1A 4P3YA 2IX3A 2ZYWX 3G82C 5GADl 2BBSA 1AA9A 4DUGA 1IY2A 4LV8B 3AECB 2CVFA 5AJVB 1HH4A 5CITA 4HLUC 3DM5A 4TZ0A 1Z29A 2IUUA 2CCKA 4JSTA 4M22A 4JT4A 3AVQA 1P9WA 1P6XA 4BLOA 4EFNA 1TNDA 5A0FA 1FNNA 1SVKA 4DWJA 2PJRA 1KGDA 2BC9A 2CJWA 4Q9JA 1DADA 5CJPA 2XOKA 3CRQA 3ZLJA 2GCNA 3X2SA 4OI4A 3GCGA 5E7JA 2MH7A 4ON9A 5L3RA 4N0EA 1NN0A 3I72A 1UDXA 4OJQA 3ECCA 3VX3A 3W6OA 1ODFA 3TR5A 5BN4A 1YZQA 4V0NA 5G5GA 4B2PA 4OHWA 4OK3A 1OV4A 1NL3A 3L4PA 3GJ3A 4FINA 1W5TA 4NMMA 3QXJA 3K0AA 3A4LA 2V4ZA 3R7WA 1ZU4A 2QM7A 5C18A 1ZUD2 4B44A 2JDIA 3K70C 1H8ED 3BE4A 4GFDA 2GF9A 2OCBA 4JLDA 1QRAA 2OUKA 3RAPR 4MYUA 3ADKA 2O0JA 4KSBA 1M7BA 1N6HA 2D2FA 2RHMA 1H8EA 1M6NA 3AVOA 1QF9A 1DO0A 3ADCA 1KSFX 2FZLA 2ZM5A 1E79D 1NSTA 2D06A 3HPRA 2ZS8A 2C98A 1W5SA 3P32A 3B1YA 3GJ4A 3DMDA 2I3BA 2R44A 1E9DA 1L7VC 1E79A 1KSJA 2VP4A 4BFUA 4MUBA 2H57A 2ZREA 5IK2A 1S9HA 1G7SA 3U3RA 1TPZA 2IYRA 3WP1B 2FJUA 2C96A 5KUTA 2C04A 4QC2A 1XLOA 2ZR7A 2NMVA 1G7CA 1WRIA 3THOA 2YC2C 3QXHA 4LY6A 1W44A 2GK6A 5EE0A 1G16A 1MOZA 1OHHD 1AIPA 2FH5B 4CEHA 2HXSA 3W8RA 3EARA 2ZSDA 1JR6A 2QMHA 2PBRA 5FPHA 1OHHA 2EYUA 2NPFA 2GXAA 3AE5B 4Z51A 2B92A 4PXAA 3VX4A 5EE1A 1M8PA 5FBLB 2IYVA 4AWXA 3RWMB 2BEKA 5JJLA 2F1JA 4P0TA 4NDZA 4B76A 1SULA 1XCGB 3LW8A 3ZD7A 3QEOA 3B78A 2QPAA 4PPFA 1ZMXA 4D4LA 5DN6D 4Q18A 4A36A 3ICEA 5C46F 2O8CA 1U0JA 1AGPA 3Q3JB 1NNEA 3AEAB 2LWIA 2ZU0C 3GLHA 3IIJA 5DN6A 5F98A 3H0KA 4XTRA 4B3XA 3GJ7A 1N6RA 3GJ0A 4NBSA 4ARZA 5KOYA 1ZCBA 4X8MA 2WS3B 3C15C 3RPFC 2N0SB 1GOTA 2KB0A 2BVNA 4MYHA 2DWQA 4W5HA 1QOBA 2IYWA 3R8FA 5G5HA 1KI3A 1PLLA 1MR3F 1KOFA 5FR2A 3K0CC 4JLKA 1N5LA 2GBLA 2GJSA 1Y3AA 4G5RA 3WYFA 1NIPA 3NWJA 1E9MA 1XP8A 2D7CA 1Z6XA 1OQRA 1IXRC 3SR6A 1QHSA 1WGKA 1J8YF 3HVZA 3FMPB 4IDQA 2OG2A 1OLOA 3V4RA 2YKGA 3OZXA 2MJDA 1E9BA 1Q22A 4UJ5A 1T8TA 1UPTA 3PUXA 4IOJA 1AWDA 1NY5A 1PLKA 3AEFB 5DSZA 3AE3B 1KDTA 4PZZA 4LRWA 1E9EA 1RFLA 1T0HB 1P72A 1U81A 2GBLC 3NBFA 4J0QA 1RJ9B 4LSGA 4RKEA 3UATA 4TLAA 1W4RA 3GLIB 3IO5A 1A5TA 2WWXA 4I1OA 3WY9A 4D26A 2GKSA 1PVOA 4CEJB 2X2FA 1KHTA 4TSFD 4L16A 1FM0D 1P3JA 4CEIB 4MGIR 4WXRA 3AEZA 3KJHA 3C5HA 2A5FA 5DGXA 2BOVA 4B75A 4FN5A 1TX4B 4PAQA 2OHFA 5DISB 1MO6A 1RRFA 1X1SA 2V1UA 3KB2A 1XMIA 5J4HA 1P73A 5DYIA 2F55A 1YKSA 2WIBA 1YZKA 1II0A 1KO8A 1Z0FA 3KJIA 2ZUBA 3VMFA 3ZS8A 1WRBA 4FXCA 2IUTA 3QF4B 3P4QB 1Q1ZA 4AG6A 2XJ4A 2WP9B 3TUIC 5JS8A 1JAIA 4AK9A 1V97A 3GLHE 3CZPA 3R20A 4PO1A 5D3MA 4QGFA 1SIJA 2YJTD 2ZJYA 1OKKD 5KSOA 3L2OB 4WZBE 4BFXA 2ZSFA 4GP7A 1NVVR 3NHAA 1XF9A 1BYUA 1U99A 2JX5A 4LJ6A 1QLBB 3CIRB 2ZRCA 4OI2A 1OKKA 4BZQA 1GTVA 4AYTA 1KNQA 1CZPA 5FTKA 3HUIA 4OQFA 4RSGA 5SZJA 4JYCA 1OE0A 2WV9A 4KITB 4GT1A 1SKQA 4YMVA 1UBGA 5FUXA 3WCQA 1HT2E 1IN6A 3LBHA 2O8DB 5AJYA 1R2QA 2FSIA 2ZE5A 1EFRD 3V9PA 1KKMA 3VTKA 2VO1A 2PZGA 4A2QA 3WRYC 3LLMA 3FYHA 3NVAA 4DJTA 4PQFA 1TUEA 2OXRA 1EFRA 2PJZA 1QDEA 2G9NA 3DVLA 3UWKA 3TJZA 5FL7D 2GZDA 1I7HA 4IRUB 2PIAA 2V7QD 1JPNA 1QHHA 2GEUA 1XTSA 4POAA 4F93B 1IJFA 1E94E 4LWZA 4TMTA 2QT1A 2A3RA 3WMFA 4ESHA 1B9RA 4EPXA 2K5PA 2ZJBA 5FL7A 2KSQA 4MGYR 2V7QA 1W2HA 4FMBB 2FX3A 1GUAA 4NTZA 5DLQC 2GJ9A 5JMTA 2RGCA 3PENA 1NKSA 4URWR 2V6JA 4URUR 3RRMA 1SHKA 1VIYA 2IYZA 4MKIA 4TQAA 3AUXA 2W3RA 5FUYA 5BXQC 5KDOA 2AHOA 2A5YB 3IQXA 3SZRA 3SN6A 1IAQA 4KBGA 2CVHA 5EJEA 1Z47A 3WNCA 4Q4JA 4X8OA 1XJ0A 4JYBA 2ZI7A 2WPDD 3P26A 4DSOA 1E2LA 3NVYA 1EX7A 1EWQA 4JWUC 2YVUA 4D81A 3CM0A 4M53A 3BH6A 2ODBA 4LX0A 3LO5A 2WPDA 4KU4A 1FXAA 4M9ZA 4WVFA 5D3QA 5BWMA 5AJWA 1SF0A 4V0KA 1TQ2A 2Q9AA 3PV0A 2XZOA 4GDFA 1CTQA 1MT0A 1G3IA 1IONA 3FVQA 1D2NA 2BMDA 1RW4A 1DEKA 3SYKA 5CIWA 4RD4A 1K8RA 1KMHB 4IOKA 1ZU5A 1NEKB 3DDCA 3NH9A 4TWZA 3IIMA 3W5JA 3C16C 2PX3A 4FXPA 1AS0A 2ZI6A 3HR7A 4DKXA 4MDFA 3U7EB 1IN5A 3L82B 2FSHA 3MWKA 4KXFB 4WA7A 4DLYA 1NLFA 3KXKA 5CB8A 1HUQA 4NH0A 4HB0A 1D5CA 3FGNA 2JA1A 2W0SA 4ZDJA 1TEVA 2LKDA 3K09A 4A8JB 2DFKB 1KI2A 1Z6TA 3MD0A 4EQ6A 3KQLA 3R9XA 3WHKA 1YZLA 1CR0A 3TRFA 4L9SA 1UEJA 3UMFA 1GILA 3A1UA 4D80A 4MYCA 3U44A 3EXAA 5IT5A 3G0HA 2WU2B 2QT0A 3MGCA 4XJXA 4ZHOA 3K0EA 2XZPA 1FFUA 1GVNB 4TLBA 4KAXA 3CIOA 3LRPA 2BWJA 2GRJA 2ODEA 3K09C 2LKCA 1D2EA 2PZEA 4TMZA 5FOUA 2FGJA 1US8B 4PQRA 2JJ8A 2ECKA 1UDWA 1SQ5A 3N70A 5EZ6B 1ZM3A 3I4LA 5BYKA 3QXSA 5TXGA 4YT0B 3LBNA 1QVAA 4R98A 3B9JA 4WZ6A 3TBKA 1TF2A 3ZJYA 4JLVA 4Q1FA 4TL6A 2IEZA 5CYOA 3AE9B 2PCJA 2AXNA 3CR7A 2B7CA 1NRJB 3ICQB 1KRHA 4P4SB 3L0OA 4Z54A 2VHCA 4DSTA 1P7CA 3KFXA 3I73A 3BERA 1JNYA 3X1DA 2PKOA 4ZDKA 2NTYC 5J4YA 1EX6A 5JLJA 4NP6A 4KI0A 1ZIPA 1AZTA 5FTNA 3A1VA 1Z6GA 5BN3A 2WTUA 4KVAA 3AKEA 3Q7PA 1UWMA 4LJYA 1XBTA 1EFCA 4HAVA 2EFCB 3SJCA 2Z0MA 4O25A 3U4QB 4A2PA 3E5HA 3ABVB 2HXYA 5CB6A 2J7PD 4C0SA 3O8CA 5C3JB 4TL7A 4A4DA 2H92A 3QY0A 1HTWA 2YWFA 4GOXA 2J7PA 5J4KA 1OXTA 5JSZA 3BBPA 1LW7A 5F9HA 1BIFA 1RYFA 1A7JA 1LV7A 1ZINA 2GNOA 2NPIA 1TADA 4Q47A 3FPAA 3KKQA 2ZI5A 5K8UA 3EWSA 2V1XA 2CNWD 2Q9CA 5LD2C 1VMAA 4BFZA 3DZDA 2F7SA 4UQOA 1ZM2A 2A5GA 3CH4B 4AKEA 2WDRB 2CNWA 3NEJA 4BECA 4OI0A 1KNXA 3CWQA 2V8OA 2IBMA 4NHOA 1C4OA 4IEIA 3EG5A 4TMWA 3AEDB 4B2LA 1JBKA 4OBEA 4V02A 1T91A 2E1RA 2D3WA 4JLAA 3AF2A 5E4FA 1ESNA 1G17A 4BLPA 5H8WA 1Q1EA 3CR8A 2CHGA 5EZ5A 4XH9B 4M2LA 1R6BX 1X6VA 4JJZA 4EPRA 3CX8A 2YWEA 3LXFA 4YTPB 4E07A 2FE4A 3QQ5A 4JZKA 2WM9B 5E3HA 1H8HD 3U3KA 4CZ2A 1IQPA 1MKYA 4IFBA 2OAP1 3BK7A 3RRNA 1L4YA 4G3XA 2OLKA 1GM5A 3FWYA 1GWNA 1H8HA 3D6TB 4NYMR 2WMOB 5KDDA 3SFEB 2X77A 5E95A 3RVBA 4Q4AA 2QIEB 1XD2A 4RFSB 5G3ZA 2O8EB 4PHGA 1OF1A 2JEOA 4F92B 3KTAB 5DHFA 3NC1C 4KJZA 1XB2A 5FPSA 4BLQA 2DWOA 2IYYA 3I5XA 2TMKA 1JPJA 3L0SA 2BV3A 2XNDA 4DT1A 4YMUA 3MWJA 1T5IA 2GF0A 4E03A 2PZFA 2OESA 4HDOB 1DOAA 2ODWA 2XNSA 4Q9KA 5CJ2A 4Z1MD 1F2UA 2CEAA 1R0XA 2BKEA 3EC2A 2IXEA 1NMYA 4LBWA 3L8ZA 1CP2A 3WNBA 1R8SA 2CLSA 1RRPA 1JWBD 2F43B 2OBMA 2IL1A 2WBLC 3LAWA 2XXAA 5DI9A 2RGEA 3CF2A 2JLQA 1YRBA 5EE9A 2IA5A 4Q1CA 1NMXA 4BLSA 2O8BB 2C03A 4URVR 2QAGB 3KJGA 1AN0A 4BFSA 5JWRA 4V0MA 1V43A 3DKPA 1XMVA 4C0KA 1DAIA 4C7OA 2WZQA 1OFTA 1MO3A 1SXJB 2CL6X 3OIYA 3FDIA 2PVOD 1DELA 5DO9A 3UXMA 2BBOA 4QGHA 4RZXA 1ZBDA 2GA8A 2WKPA 2ZE6A 2HCJB 1NENB 1GRNA 3O47A 4NYJR 821PA 2J1LA 1S8FA 5KNBA 4OI1A 2WOJA 1Q12A 2JLZA 5F3WB 4HAYA 1NYRA 1GRQA 1P4SA 1LF5A 3W90A 4BRUA 1XEFA 1XPUA 2WKQA 1J7AA 2FPKA 3OE7D 4PC3A 1KJYA 3GLGA 1Z0JA 1DARA
chains in the Genus database with same CATH superfamily
1NW8A 4UU0A 1X7YA 1ZK3A 1PBTA 3I12A 2UVQA 3RIEA 5ECGC 4DC9A 2RJNA 3CVXA 4P8RA 1YCFA 3LPCA 1SCNE 4RH6A 1JV2B 3LIPA 4IILA 3DS8A 3HVRA 5JRZA 4ZZIA 3DWGC 4ND3A 4JGGA 3GGJA 3SQIA 4NBTA 1X7WA 3TLZA 1ZJYA 3NORA 5GVRA 1L4DB 1GAEO 4UU1A 3ZWOA 1E8DA 5ADHA 1CQZA 3QYFA 3AUSA 4QL3A 1OXXK 1PK3A 1A98A 4WFIA 1R88A 1J06A 1MC8A 1L0BA 4FX2A 3DW3X 4EPTA 1PU2A 4GWGA 3T0IA 4LZOA 3WQRA 1COKA 2BZ1A 3GK3A 1X1TA 1XEXA 3A9KB 2IYSA 5JAZA 1ZICA 4G8BA 3P1MA 4M0DA 3UQZA 1P77A 1OJLA 2J6TA 4XCQA 3HRKA 3J80A 2H48A 2FQQA 3ZD8A 3JQEA 3WLHA 3RCBA 1CCWA 1RZ3A 3Q9NA 1E9SA 4GM4A 2I1VB 2P77A 1Q5WB 3KT6A 1RR6A 1YJ5A 4D6YA 5J18A 3SI8A 1SVMA 2O3QA 1JQKA 3TM4A 1A2KC 4ZXPA 4OQEA 4NPHA 2MU1A 4R7TA 2ZI4A 3D31A 4YV0A 4ES6A 3FFAA 2ORWA 3EMDA 2Q7DA 2OCIA 4QTYA 3NXSA 2DWUA 2XA1A 5AW8A 3COZA 4GC7A 3PW5A 1J00A 2JZNA 2RH5A 1BFKA 3TLJA 4QYMA 3AFOA 2VK8A 3DT9A 4K3VA 5KG6A 4QBHA 2FV8A 4OV6B 3AUKA 1K08A 3T3HA 4PG8A 3ZCUA 5K0GA 3LUDA 4F6CA 1FYFA 4F56A 5K2OA 1TUBA 2EH9A 1MO5A 1T8SA 1ZNZA 2P0EA 3L0PA 3C7KA 5E2BA 3HCFA 2XB9A 1Z74A 4PC1A 4NPCA 4B74A 4HAOA 3LSYA 3A4TA 3DMHA 3H5TA 2ZCCA 3AM3A 5IBCA 4NLCA 5KG7A 4D2IA 2CRXA 4LA4A 4Z8YA 5DDIP 3GL9A 5EJ2A 2Q1TA 2L69A 5IP4D 5J2UA 4CETA 3ORSA 2VOJA 3DE6X 1ZLYA 1KSGA 2V7BA 3L7IA 1LF0A 3TW4A 1MO2A 1OGJA 2V59A 3ZJ4A 4F85A 2Y1GA 4MRMB 2JASA 1F2RI 5LXTB 3Q7SA 1TS2A 4PYRA 3RD2A 1PL7A 1NN3A 4MRSA 2R4TA 4E22A 2PFNA 4RXTA 3NC4A 1RNLA 1FVHA 1GFSA 3Q2KA 4GMVA 3TQQA 4UE6A 2QVYX 4GXRA 3E5MA 1Z00A 2FG5A 5HWSA 2V4MA 5J40A 1S96A 4WFJA 4YMSA 2I62A 3CO0S 2Y1LA 3KWFA 2UZ0A 1S3GA 1WW3A 1PI3A 4INAA 2MIIA 2Z3VA 3IQHX 4LNUA 4JVSB 3TZLA 3U3OA 1UBJS 2C5HA 5HIMA 3KVYA 5FNVA 4CIDA 2K2WA 2Y0SC 4MH0R 1HDOA 2ZVNA 2WWTA 3AF4A 2BT6A 1AKTA 3MQ4A 1GPBA 4J2TA 2KJ6A 1VLHA 3GU3A 3ZNNA 4FWIB 1G3UA 4O8ZA 2DFLA 1LD3A 1OFIA 3GNLA 2DKNA 2R4UA 2YW2A 4L4UA 2G9QA 4XQCA 4ALIA 3GJXC 3DZFA 5GJWC 3RROA 3L84A 1NJ5A 4YR7A 5KYUA 1I4LD 4B9KA 4CFSA 4BGEA 3ILYA 2V55B 3MBOA 3R24A 5P21A 1N2BA 4R2JA 4YAUA 1YNTE 2GYYA 1PTJC 2OEHA 1X7GA 4OBBA 4L95C 5IYZB 4IL6U 1W5FA 4RTPA 5COBA 2W6NA 3PTZA 3GVCA 2ZJ6A 5C7LO 4BFLA 2Q2OA 3K5HA 1Y1RA 2J45A 4TUYF 4H77A 3AJDA 2J0KA 1K7CA 1NYQA 1GNLA 3B1XA 4TKLA 1B0UA 4HGNA 3SYZA 2NZ2A 4LZPA 1YKFA 3L4BC 5E0KB 4RL6A 2B6NA 3AKCA 1VLBA 3NAGA 4EKYA 1C9YA 3CJQA 4BCBA 4FNMA 1OTXA 2PSFA 5F7ZA 4QEKA 5BN3B 1REQB 3E35A 2EANA 3R7BA 3RV4A 3WL6A 4OU4A 3IUBA 3CRNA 4LDTB 2OP1A 4HQNA 2ZSBA 4LV6A 5JSZB 4CKBA 1C4WA 3UT5A 4ANFA 2LKYA 5BN5A 3EECA 3AHFA 1Q1BA 3M70A 1Z2DA 3GHHA 4PR3A 3HTXA 4KTVE 3TTWA 2YXLA 4EHJA 5ALWA 4XEHA 2DJIA 2ICIA 5E6RB 5EJFA 4TYQA 1DUVG 3TIFA 3W4JA 4Q4CA 4HAIA 1I35A 3PNPA 3AR6A 5DQGA 1EXDA 4Z4EA 3DAHA 4YFVA 3SHQA 1JIQA 5JFOA 1OB5A 1KI4A 2C2XA 2XW6A 3IELA 2VJNA 1SBBB 4WGFA 3AYXB 1NZPA 2EQYA 1R8XA 2MR6A 4MHOA 1F4LA 1SC3A 1A1VA 3U09A 2PPLA 2OHHA 3LC1O 2Q2VA 4M54A 4LTNA 3ISTA 2FEMA 2KANA 1KH3A 2IBTA 4NQRA 2H88B 1G18A 3VSEA 1K66A 3F8WA 4YASA 3ZU5A 1TU3A 3TAUA 2IEBA 3P45A 1WDKA 1E3WB 3SICE 1XQQA 1JAXA 1T25A 3KQPA 2LVQA 4AKHA 3NEYA 4YVFA 4A0FA 4YCMA 1XRSB 1GSIA 4XR9A 4EPVA 5PNTA 3KAQA 4WKNA 5C7OO 4M7WA 1TIPA 2IPLA 2P7IA 3REOA 1EINA 2DY1A 3DAFA 2IU6A 2G5HB 4IIYA 1W29A 3MQFA 4CIXA 3VZSA 1AZSC 2XOEA 3VDRA 3C48A 1UC9A 4TUQA 2QI9C 1GO3F 3JVUA 1NZJA 3IPLA 3EVGA 1C8BA 3O2SB 2XAUA 4OXKA 4IXDA 1G42A 1SZJG 3L18A 3MJSA 1U98A 4BBNF 1S7CA 3A1SA 4N5LA 4NBUA 3U4MA 3H2ZA 3V3KA 4YAIA 5AVXA 3I2IA 4V24A 5E7MA 3V1NA 1UMCA 5JDIA 5LYJA 4WOPA 4TYNA 4N3NA 3DHNA 2VWHA 3K9QO 4CCWA 4G50A 1ECGA 5K9ZA 3EC1A 3M2PA 1L5QA 3LZDA 1OBHA 4TMXA 4PZUA 2D5IA 2ID8A 2C54A 3E05A 1U6IA 1B6RA 2NGRA 1GPNA 2GZ1A 3PX6A 2JRHA 1CUSA 3VV3A 3PQEA 1P1JA 5HFJA 3S1SA 5CB1A 2ZJ7A 2D6FC 1KLNA 4RDCA 1J0GA 2MTBA 2QN6A 4YMNA 3EIOA 2RI0A 1NF8A 4OLAA 1Q95A 2WIJA 1MQAA 3I6IA 4B6RA 2VIXA 1Q17A 3HJHA 4LAFA 3DVRX 3DDWA 1XROA 3HA7A 3EVFA 3BXGA 5T4BA 4MGKR 3F3KA 4PRYA 4ZAGA 5BV8A 4IWPA 1WJ6A 2A19A 4IO0A 1XQVA 2R8OA 2FR1A 3VR4D 2BFOA 1K9VF 3W9YA 2G5PA 1C4KA 3BS5B 1WVIA 5EKDA 4DTCA 5EKUA 2W70A 2GUWA 1QVZA 4QUIA 2CV1A 3F5AA 2JEYA 2FZVA 1JHMA 1U2GA 4NY1A 1XOIA 5ARDA 3SFVA 5HKOA 1KDZA 1MEOA 3HDTA 3UJ9A 2FHPA 4EB3A 3ZDDA 4K3UA 3L3BA 4I5FA 2ZAMA 1M1YE 1GKLA 3N8NA 3P4YA 5LA6F 4EF5A 2ZXEA 2L00B 4JVMA 2HF8A 1SL1A 3L1UA 1OLUB 1RC0A 3KX2A 1YQQA 2C9YA 4NAWA 2QLTA 1EXVA 4FS8A 1HG0A 3ZDQA 1EEHA 1YRWA 3DEYX 3QX8A 4HQ6A 2XCAA 2J9RA 4H3HB 2WZBA 1BGXT 1JDUA 1CG6A 4UEJA 1QGYA 3LL7A 4EGJA 3J9CA 1QANA 4DLNA 5DMXA 1EFKA 1PO7A 4LDQA 3F7NA 4DBVO 2XDQB 1GT91 4TTAA 5KFXA 4IGAA 4UPDA 5KG2A 1LPAB 3BIFA 2K60A 1FU8A 3ZH9B 1WV0A 4F4ZA 1CNEA 2Q5JA 1C3EA 3CRW1 5JY1A 4LK2A 2WNMA 3M6FA 2ANCA 3ZTWA 3ZE8A 4PZLA 2A3NA 3LXXA 4F4FA 3CEAA 2H3IA 1FJGB 2KDBA 2CGEA 3A4IA 3N3BC 2WJHA 4PAGA 5F3DA 4D8YA 4PYKA 2CHVA 2ZB4A 4TYYA 1WFYA 3EMVA 3UJAA 1N5XA 2QJRA 1OTYA 2ZUVA 3IAFA 3KYCB 4EUFA 5B5SA 2PD6A 3LFHA 4P58A 3A1WA 3HLYA 3NVZA 5IM4A 1IK4A 4MWTA 2W9BB 2QJLA 3U2QA 5I7OA 1JAHA 2N7DA 5I7UA 1KEVA 1ZRHA 3TQRA 4ICIA 4DC1A 1SC1A 3EXHA 3PS6A 5CM9C 3PREA 3LX6A 2O2DA 2DB3A 4BBPA 4MEXA 3IUQA 2VT6A 4CKWB 1M3SA 4Z5XA 4YRRA 3H5NA 5TZVA 2J9ZB 1TQHA 3AU2A 4YCNA 2LIPA 1OFUX 5H9VA 4GOLD 3ZY5A 2QUBA 4CQMA 3U0VA 2AYZA 1RYDA 4Q6BA 1TTTA 3G0BA 8ICEA 9ABPA 3ITEA 2WD7B 1KTQA 3CEJA 1PIWA 2DVMA 5JZBA 3Q9LA 5I9SA 3MRVA 1ZQTA 4DOAA 3X1XA 5ALGA 2OCGA 1X77A 2Q5FA 3PVZA 3AQFA 3B89A 4YMIA 5KQPA 4L5CA 1ZJ5A 5FQNA 2QAGA 2W2QA 4LZJA 3F96A 3W06A 8ICVA 3VNSA 2J9GA 1SPXA 1T5BA 4AFNA 4YRMA 1N6OA 1X8XA 2CHUA 2TECE 2I6GA 4L2YA 2AHRA 2DPHA 2EEPA 2BM1A 5TS3A 3N8DA 1T3HA 1KPGA 1ZVMA 2CY0A 1GGKA 4BC1A 1ZH6A 4JELA 1ZDMA 2I4OA 2HW8A 1Y9JA 3F90A 5TGZA 2JLXA 4R83A 1Z3EB 3QTBA 2LI5A 1N2JA 3CLSD 3R3MA 2BVCA 1VRVA 4ZJZA 3JPTA 4I81A 4MQ6A 3H1EA 3SZMA 2AJTA 3RYFA 1Y9AA 1VKOA 5CDFE 3TEJA 5D7GA 1D4FA 5TRTA 3ILSA 1ZNXA 2VWPA 2QNIA 3ZQKA 5KHLB 1I2AA 3OO1A 2FZEA 4X20A 3C3XA 4OK6A 1JNXX 3ZCPA 1C0EA 3VKHA 5A2GA 1NYTA 1KYIA 1N6ZA 5CX3A 2FCNA 3LPNA 5EPEA 4FWTA 3UIEA 2V5AA 5ELMA 3LLUA 2ZATA 2A0UA 3N3AC 3UJ7A 2J59A 4JI0B 5EP2A 3N5KA 3UMBA 3G9TA 1QIEA 1RFGE 3I39X 3RS7A 1XZNA 3ZBUA 3I6MA 1XQYA 3N0RA 1FXSA 2H3HA 3JS5A 3HM3A 4QU9A 1GGEA 2Z7JA 4MW6A 1NXWA 4BVUC 5BORA 2HJSA 3ZIDA 4ZI7A 1WMDA 1U2DA 2QTAA 3AVTA 3KEGA 2WUDA 1Z0AA 2XH8A 3GUUA 1A0PA 3G1UA 2P40A 4WZAB 2E4AA 1NJYA 3HEAA 4A1FA 4B9SA 1FX0B 3PHHA 5DK4A 1J0CA 4OYRA 4PIVA 3RT7A 4MGIE 3O8LA 5ELXA 3TECE 4DSEA 3RC9A 3VU1A 5J2TF 3AN1A 3OJ0A 1MABA 3H4MA 1Z5NA 5H83A 1W5BA 3KELA 5KTMA 4J9OA 2QBYA 3OFND 3RVDA 3PZPA 4DUGA 2EDUA 1EE1A 5KTOA 5AJVB 5DNDA 4QQKA 1COZA 4B6JA 3EZ5A 4WCVA 4GU5A 1XNQB 1NN0A 1QGAA 4C6TB 2RR9A 2XVMA 4M9RA 1SAYA 4FINA 4P5DA 5CHWA 4B6GA 3QXJA 3GV5B 3R7WA 5BSTA 5KFNA 1OAKA 1QFMA 1WLYA 4I2VA 3BQ9A 3W1SC 1SKUA 5TNXA 3MRXA 2DQKA 3Q8AA 2I3BA 4KQGA 2P9JA 3GB9A 3IAAA 2FQXA 2QK4A 2D54A 3SDBA 5EE0A 2I7TA 1SE9A 4YP3A 5KFVA 2YXPX 1GB1A 4GHWA 3D02A 4GPAA 4YQZA 2WHPA 4E2XA 2D7JA 2KACA 5I5EA 5I9IA 3TADA 3B78A 2NU8B 4BWFB 4HWPA 2H2HA 2R00C 5TQ0A 3M8KA 5AW5A 4FLFA 1HEUA 4M6WB 3GJ7A 2DJ5A 2PI5A 5AM5A 4PG4A 1ZQJA 1A6SA 3F9CA 3R8FA 9ICOA 4JFRA 1NKCA 4JLKA 5K1ZA 4KTTE 2NMQA 1A8PA 4OIFA 4AN4A 3UJPA 4WFKA 5FTWA 1NY5A 1PLKA 3IDFA 1WNFA 3GCWA 1SG6A 2XKBA 1W96A 3R0XA 4R0VA 3SBOA 3FJ1A 1MAUA 5CVEA 4TM8A 4EEKA 2EL7A 4ER0A 4Z9FA 2OHFA 5DISB 3VUWA 3WFIA 3I2HA 5J2BA 4CTNA 1Z0FA 3EEBA 3MFGA 5GV7A 1OTRB 3ZE7A 3OZGA 1VA5A 2I54A 1B8UA 2ZIGA 3WIMA 5FUXA 1U4OA 1HT2E 3A1EA 1IN6A 5KWEA 1EFRD 2F8SA 3SE7A 1QDEA 1GZ6A 4K03A 3LKVA 3H0CA 4KR9A 3L4EA 3T9FA 1PZFA 1T9ZA 3KM0A 5H7XA 1EM6A 1RPLA 5KDOA 4LNKA 1AKRA 2JBAB 3P5BA 2X5NA 4IR1A 2JH8A 5C3MA 3KPVA 1GG9A 3WMXA 2GBGA 1O97D 4M53A 3BXXA 2VJPA 3C28A 3D43A 4FHJA 3DZKA 3FVQA 1OOEA 1KMHB 3OCJA 2XTJA 3OGUA 3GPBA 3C16C 3M4ZA 4MWGA 3KXKA 3ZXSA 1HUQA 2BPSA 1ZZEA 4Q37A 2LKDA 3FWZA 3X2FA 4ANVA 3PT5A 5KYNA 4BN5A 5JE8A 3TF5A 3GN2A 4NBVA 3ESDA 4ZVUA 4LFAB 4PQRA 4NLGA 4P2GA 4WZ6A 1TF2A 3AE9B 2WWRA 4NF2A 1NRJB 3SNKA 3I73A 1VZ3A 4ZDKA 1U04A 4WJOA 3N6RA 2MA1A 4O4LB 4KI0A 1ZGGA 2WM2A 3N7PD 1I3NA 5LZ5A 4I2EA 3JWHA 3GFKB 1KS2A 4R5HA 2D1RA 1A76A 1PR4A 3M5PA 3VQIA 5A6SB 5J2FA 1JU3A 1DWUA 1I1NA 4P35A 1WQ4A 1SIWA 5LSAA 1V3TA 2V3WA 1GTG1 2CNWD 2NPOA 3RHSA 2ATEA 4BECA 2GFQA 2ONQA 1X80A 4NHOA 1C4OA 3FZQA 1QOQB 3F67A 3WLJA 4GVXA 5IF3A 9LDTA 1C3XA 2UXDB 2KVCA 4EPRA 2JIOA 3KZNA 1RAGA 4KO4S 1Z4QA 4ALMA 2G4CA 1M34A 3Q8CA 2YY7A 2O8EB 3NJ8A 2IYYA 1JQ5A 2B69A 2ETVA 3WL5A 3MELA 3QFRA 1GDTA 3EK2A 2C7RA 1JWBD 3DWFA 4NLZA 2IA5A 3WICA 4B80A 5J63A 1YIOA 4C7OA 3S44A 1MO3A 3LECA 3FYTA 1LJLA 5AW0A 3RR2A 4QAYA 3DQQA 3EWIA 1NENB 4LJRA 2QB5A 4C6RA 4I2JA 1QQTA 4HCJA 4P7KA 1NYRA 3W90A 1V80A 4A0SA 3L0DA 4UAYA 2D2VA 4KN7A 4BNYA 2OM2A 2G77B 4ROTA 2GYWA 5DNWA 5EY5B 2G06A 5AEKB 1T24A 2A67A 2BJWA 5JXJA 2SEBD 2PGNA 2HEGA 4YP1A 2R8RA 4CIWA 1IIRA 2IOYA 5FEMA 3HG7A 3V4OA 3SAJA 4JDPA 3KR0A 4Y7CA 4I2GA 1BCRB 1CVIA 3ZXUB 1ZUNB 1DAFA 3LKBA 4EA7A 1O95C 4QHYA 2WJJA 7YASA 1KY3A 2P0AA 1ZQOA 4ZHQF 3ZHBA 1FFGA 4N6EB 1ZPDA 2WSBA 1UDRA 1U7UA 4KR0A 2BEUA 1R6TA 1WB4A 1CWUA 1CI4A 1ZQ1A 1TIBA 3PYXA 3WLQA 1ZRMA 3WQHA 1ZM7A 3QELB 1JKJA 5DXJA 4WV3A 4AG3A 1DQZA 5HS4A 3UA3A 4Y2TA 3LB8C 4JWTA 4YT4A 1KI6A 2DRIA 4BKPA 1ZY2A 3V33A 2PL5A 4KGVA 1W7AA 4Q8EA 1Q11A 1E77A 3T4XA 4ECRA 3D2SA 2WC1A 4KODA 3DT8A 1J8VA 2WU3A 1K5OA 8ICCA 2VP6A 2IOFK 2BKLA 1QE0A 1ISSA 3Q8QB 3TZEA 2CB0A 3OF2A 3I5MA 3CVJA 3TMKA 2PTLA 1TI7A 4MVXA 2F3TA 1SCJA 3MR5A 1TE2A 4MJ7A 1F3OA 1NTOA 1ECBA 1GPWB 5IF9A 3TSYA 5EJMA 5F5LA 2BFPA 3ROQA 2BKUA 2RGNA 4JSRA 2L18A 4KIGA 3HN2A 3OHMA 1XQXA 2X5XA 2HMXA 4LDRA 5B1DA 4MKZA 1CQPA 3GEEA 3C3CA 1W36D 4RMJA 1NKBA 1A04A 3AV3A 3HC7A 5TDHA 4AJNA 1TL7C 2QMEA 1TZJA 3MGKA 3UWDA 1DRJA 3AUAA 1I5EA 4E51A 2VBIA 1I10A 3QPCA 2WTNA 4EAQA 3R3SA 5ICEA 1QTNA 4CM4A 3AE7B 1RSZA 4G25A 3DMFA 1KEZA 1BGVA 2VOEA 1U9IA 3D7LA 1YVUA 3FPSA 3MW8A 1QLJA 2VF8A 2A5DA 1MD9A 3TD2A 1CLUA 1D1SA 3BD6A 4FKZA 2V3VA 1JXLA 2I38A 1KO4A 3T3FA 2R8BA 4NE9A 2WIGA 1WETA 1H38A 3GPCA 1UXOA 1OLSB 2G1EA 4BYGA 5LOVF 2IKSA 1DG3A 1R00A 3IT3A 3K20A 1QOAA 3S2IA 2Y76A 3K7EA 3D7NA 3C1UA 3ZU3A 4C0AC 2LGDA 3SX2A 3U5TA 4UNQA 4ANWA 2E8NA 5KFDA 1G21A 2H52A 4WDQA 2R62A 3CF6E 3CXUA 1NSYA 3BD8A 1T5HX 1RRKA 1N2GA 4MAMA 2J5XA 4BMYA 3K4PA 1BVHA 5FK9C 4B6QA 2FLVA 3WIDA 4D9CA 3AUJB 3WZLA 1KWGA 4LUCA 3ER6A 3O31A 1NBEA 2P27A 3OJXA 2I4NA 4PFSA 1TKAA 1W8DA 4DO9A 1FYWA 4KWCA 1AK1A 2PL3A 4ER6A 5JH7B 2XWJI 3GLVA 2IO3B 1P9RA 1RWQA 4MUXA 4U00A 4XCVA 3HXQA 3PGA1 1HDEA 4B2IA 2Q0SA 1FYXA 3FMVA 4WNCA 2X4LA 1PYGA 2QE7A 4IL5A 3NUGA 3SC2B 1UJ5A 4BNTA 4ECAA 1H2EA 1YZYA 3RANA 1OREA 4LYFA 4XGIA 1LW6E 2GO1A 1WRDB 3VZCA 9ICGA 5JFTA 3Q72A 1F4VA 5AKXA 4DSFA 4Y2XA 2R8PA 5AUNB 4D9KA 4ETWA 5LLIA 1L0VB 4N59A 2WJGA 1GR1A 2REXB 3UFBA 1MEEA 3QI7A 3GV7B 3PHGA 2LGYA 1D4OA 1U3VA 3C6ZA 1JN3A 2GS9A 3P9PA 5BVGA 1CKEA 1CY1A 1VJ5A 4NNJA 1PW5A 3MOGA 1KBUA 3LPAA 1TIKA 1TK0A 2AHOB 4UJ3A 4JIOU 1EDDA 4YRCA 2KLGA 1MQ3A 4U7CA 1XYYA 4P33A 3OLMD 3AMVA 2EMTA 1KKLA 2H06A 2AKAB 4J1QA 4HZUB 2EEZA 1XZ8A 3VO1A 4F4JA 1WEKA 2CHXA 2AS0A 1RCFA 1UOEA 4KAAA 4DLSA 1RYBA 3ULKA 4MR9A 1IN8A 4NULA 1Z0UA 1A8QA 4IJKA 2ZAOA 4YVZA 2R5FA 2BLLA 3UG6A 3RVJA 2KKCA 3HJTA 3SJBA 3MTEA 5FJIA 1T2UA 3TVDA 3F3SA 5BOMA 4Q3KA 3O8RA 3U4IA 4K4HA 4MZDA 4F3TA 3QE9Y 4FS1A 1MP0A 4P0QB 3B6IA 1XCJA 5DNCA 2ASQA 3S2GA 1D9ZA 1UZLA 4LDAA 3EOAI 121PA 1QCKA 1Z26A 3LUCA 3S81A 1CSEE 2W0MA 3I6ZA 1JHAA 2W58A 1L4FA 1H2XA 1Y4SA 1V4VA 1UWKA 4O2LA 3JSVA 1E1LA 5CDFA 2IT1A 3PCRB 3S1AA 4QXQA 2BP7A 4EVRA 4NM1A 3IV9A 4X7BA 1JYFA 3T0FA 2VP5A 4KXXA 1NBHA 3FILA 5AKEA 3D2QA 9ICNA 1GCGA 3C14C 1M1XB 1XFAA 1QG6A 1JWLA 1SZHA 4Z86A 2WJ3A 1H94A 1DLIA 3QP9A 1QHGA 3DP7A 1V5GA 3CPEA 4J9MA 2Q50A 4ZC1A 3P9XA 4M47A 5EIBD 1TO2E 3IN5A 3NYIA 3GMSA 1VLMA 3NHBA 4D9HA 2V3PA 2RP5A 2Y0SF 2A58A 4IJ6A 4KLLA 5KTRA 2OZPA 1M8KA 4MSUA 1VCNA 2YYZA 4JP3A 3ZGLA 1GFIA 4DT1B 4FJYA 4QYWA 2J4DA 3U31A 2XOXA 5EWJB 3LQ4A 1E96A 1B16A 1LX6A 2XNHA 4KQMA 1J2EA 2XGSA 2XY6A 5C5EA 5E2IA 4EJMA 3GYBA 1UIRA 5BWCA 3GT3A 4ECUA 1PKEA 2KMMA 5EQJB 2YMMA 2D5BA 2HM7A 1KU6A 3HA2A 3RC3A 5AK0A 3P2MA 4FCWA 5IASA 4L6CA 1KKXA 4MRNA 5IABA 1NDDA 1E1QA 4IOMA 3C6KA 4OB6A 1IATA 2JZBA 4LHWA 2LHEA 2AOUB 4DMKA 4JJ4A 1C3OA 3QPVA 4BNJA 5GP1A 4YCXA 4WGGA 2WAYA 3BJEA 3RZFA 2B20A 3H2YA 3GZJA 4P81A 3SM3A 1Q84A 3TD9A 2PZAA 3D4OA 1L7QA 2W9NA 4YCSA 1UMBA 2IBIB 3OKCA 1UXIA 1T8PA 3LCJA 3G8YA 4MXDA 2BWFA 5JJ5A 3MSXA 5J4VA 2J5RA 2XZDA 3E7PA 2BM0A 4LVSA 1FCJA 4CRWB 1HQKA 4YN3A 3T54A 3HR8A 1BMDA 1Y5IA 1MIHA 1CW2B 3IKTA 2NZ8A 1LTHR 4PSVA 4FJ0A 2O52A 1J19A 4HNUA 2YX1A 2R751 2VA8A 5CRXA 1KY4A 2GEFA 4OBXA 4LGVA 5LYYA 3ETRA 2BHTA 1GGFA 3HDYA 1UBCA 5FCDA 1TVMA 1ZN7A 2VBFA 3LCVB 4FOSA 3HY3A 1RTTA 4C14A 4LGYA 2OO5C 4B3GA 3CNQS 4YRLA 4KKJA 2JFNA 4W9LA 2MOKA 3K53A 3SEAA 3HFRA 4DMUB 7MHTA 2JRCA 3SV4A 2BQUA 4JQZA 3SQLA 5AXAA 5DGBA 4WNIA 1Q1AA 1VFNA 3VPAA 2EFHB 2JK0A 3NRCA 1PNQA 1I51A 3EFEA 1WXFA 3PZ8A 3QKIA 4MVJI 5F1OA 2ZIFA 4PHTA 3MCZA 4R8UA 1LPBB 4EPWA 1OGIA 4BASA 2P66A 3K0CA 2ZB2A 4OCZA 5HSGA 4WWPA 2Z8YA 1IXRA 2WZCA 1PS8A 4S1NA 4HEHA 1X7DA 3L54A 1S1CA 1G5RA 1BRMA 3JALA 3TINA 4BJ1A 2V9HA 4C29A 4IDHA 1QFXA 1D8BA 3C97A 4I9UA 2EFJA 1K68A 3H3FA 5CW2A 4DMRA 1KOTA 5K8VA 1YQ4B 2H4JA 3ZG6A 2ZBFA 3M82A 3R5XA 1X92A 1SJ9A 1QV7A 3OJSA 1W4AA 1QG4A 1JXAA 3EZLA 3W3AH 2P6UA 4JV0A 3IB3A 1DTSA 1ZCFA 4IV5A 2UVRA 3SJUA 2KZRA 2XGJA 3EAGA 2CMGA 4AW9A 3IG5A 1BW9A 2JK1A 5DASA 3BGIA 3EE6A 2A5UA 2OOBB 4RM9A 1AQYA 3L06A 1HEKA 3GGSA 5ILOA 2NLOA 1XRRA 1SB8A 5F1PA 1B3RA 2CBGA 2JATA 1CUCA 2JCXA 3MWGA 4K9RA 3PSPA 4OVVA 3EUFA 1YULA 4TM7A 2XMRA 1EBUA 1VC2A 1GYQA 4Y1FA 4ROSA 4AL4A 4RIEA 3S2FA 4LEIA 3UV6A 2W6JA 1AK2A 3G6VA 3KCNA 5AM1A 4YR3A 3JYOA 1IHUA 2C7HA 1AX9A 1ZP0B 2C4TA 3OCYA 2X0FA 4GAEA 1W1IA 3RI7C 4HQFA 5EN4A 5IJAA 4JBWA 4YFKA 1CNFA 3A36A 4RPLA 2P4SA 1DQYA 1F5NA 3HADA 5HFAA 1ODCA 3KHTA 3E48A 4G5XA 5EJ8A 1WGYA 4LDJA 4PX9A 5A5DA 1TVEA 3L17A 4BQEA 5K4AA 3B85A 3FWPA 2ZE7A 3KXIA 5IN4A 2P9GA 2FWRA 4DDGD 1NW7A 3LPLA 1M2NA 4YN4A 4N40A 1E6LA 4ZJPA 3DV0B 2B2XA 3OTIA 3OJFA 5B7PA 5I9LA 4YLYA 3MB8A 3LT2A 3QZUA 4CQMD 5CH8A 2QTBA 4ZAXA 1Z4PX 4F1JA 4V03A 2OLEA 4ZP1A 3CRZA 1F8UA 4DBLC 4I0WB 2SNIE 2MJ3A 3DL4A 3KTAA 1XWWA 1N36B 5IARA 4NJMB 3OZWA 1M0SA 2I6XA 2GSWA 4LY3A 4IMPA 5HVNA 2TMGA 3F49S 3A31A 3TPCA 3PY8A 2EP5A 4R69A 2ONKA 2ZPYA 4PTLA 4G11A 2V6BA 4CIBA 1TAGA 2EX1A 5T4FA 4NCJA 4KGDA 3EA0A 1R5OA 1SXJA 4IUBS 1LSOA 5GIPE 3WDLA 4TKVB 3EYZA 4YDSA 4F4UA 1EP9A 5CP2A 2V7XA 3TFWA 4L5JA 4EBDA 4N5DA 2PE9A 3HSKA 3OT5A 3WSWA 3NEAA 1YB1A 5LP6A 1U7OA 4JGBA 2MSDB 5D5HA 1TZOA 4JWSC 3PE4A 4IY1A 3P5SA 1P2TA 4YQWA 3TR6A 5BSRA 1XRMA 4CG2A 1UKBA 1QE5A 1LWOA 2W2NA 3PXAA 5EMMA 3Q5DA 1TRKA 1DHTA 3H1AA 2R7AA 4BKSA 1GOZA 1Q0SA 4RK5A 2PAFA 2J3DA 3ZI0A 4FDAA 4DPLA 4NL9A 1QVWA 3FFTA 3UUFA 4PSUA 1G20A 2B2NA 1EZ4A 3VHXA 4OHRA 4IR7A 4E5KA 1CEQA 4KQ2A 2ECPA 5DG7A 3QXXA 4X3OA 3D3WA 2PFKA 2XI9A 2ZR9A 4U8HA 1WCLA 2C29D 4B9LA 1CJEA 1YB6A 3V4ZA 3THYB 1KRWA 2Q8PA 5KYWA 3Q3IA 1STOA 4RA9A 5CXQA 3D8BA 3CZ4A 4CDGA 4MDKE 1EFTA 4M0PA 1NUHA 4PU0A 3TVYA 4R9UC 4DQLA 1XC9A 3C3AA 1QZZA 7ICVA 1EWTA 1YR1A 3HKDA 3BMQB 4DN6A 2MSWA 4ZAVA 4GPD1 4CYEA 2AXQA 1JQBA 3FAHA 4CMAA 1XSNA 1YZTA 1N9ZA 1X1CA 2Q28A 2UV8A 3I9OA 4PC7A 3FBTA 3RS2A 5CPFA 2D0IA 2G40A 3ONEA 4MW7A 4XSHA 4DUGD 1CIVA 3LX4A 3ETJA 3ROTA 3OZTA 5A5FA 1JSCA 3TI7A 1TKBA 3LY9A 3T1YB 3UH1A 4P3OA 4HLUC 5KFCA 2AW3A 3K0HA 1J8FA 1ISNA 4RE6A 2VATA 2O59A 2YJ4A 4GZ5A 2VAPA 3LE8A 5E7JA 2MH7A 4N0EA 3BY4B 1P3Y1 3ML1A 4NBLA 4HK4A 2IE0A 1ODFA 4F8JA 3S99A 5EWLB 4CG1A 1I24A 3A4LA 1Y3CE 3L77A 1ZU4A 3MCVA 4B44A 2X0KA 4G0MA 3QEAZ 4DQUA 2OV3A 3JYNA 1UPBA 1DWPA 1H8EA 1FNCA 4BU0A 1ZD3A 2DPLA 1VJDA 3SAGA 4AOFA 1SV0A 5AW6A 3SEBA 4LKOA 2JFOA 1EJBA 1RPNA 2D59A 5IK2A 1JWMD 3H2KA 1SELA 4W9NC 4J0FA 3QXHA 5AM2A 1M5UA 2XB8A 3KSBC 1EUZA 2HKIA 1U28C 4Z51A 3DBHA 3L49A 1OCEA 3TQOA 3HVDA 4QG3A 3U4CA 5CJJA 2C94A 4JI1B 1JDSA 2P6MA 1UH6A 4LMAA 4ARAA 3DQVA 3HBLA 1HNXB 3AHDA 1U1GA 2PKCA 3A10A 4ISCA 4LNAA 5DBHX 4Z2YA 5JBIA 2N4FA 3WNVA 3NM4A 1KSPA 2HHSA 1WGKA 4EG0A 3PXEA 4F4KA 3PTAA 1G0OA 2Q3DA 4HNAB 4CG0A 5KT2A 2GBLC 2WWXA 1WWUA 2YHIB 2CHZA 2JHDA 4IGFA 3L9XA 4AM8A 1VPDA 2A5FA 1ISIA 2PI4A 2PFQA 4PAQA 4PT5A 5BWOA 3C8DA 2ZYAA 5DYIA 1GU0A 1MH9A 5GONA