5EE1A

Crystal structure of osychf1 at ph 7.85
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
373
structure length
363
Chain Sequence
RPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRHAGEGLGNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 115
structure length 363
sequence length 373
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee1A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee1A01
1Z0JA 2A5GA 2DHRA 3LXRA 4N58A 5F98A 1YVDA 1RYJA 5SZHB 3RS7A 1GUAA 3VU9A 4LJAA 4AC9A 4AG5A 4DDUA 4UNPA 5F3WB 2FG5A 2ZU0C 4IJMA 1NVID 4MGIR 4TL9A 4U7DA 3HUIA 1U9IA 1WP9A 2JASA 4A2WA 3BD9A 4ZIRA 3KB2A 4JSTA 3VAAA 2VP0A 2WPDA 2DFLA 1YZNA 3EPJA 2ODEA 4C80A 2DR3A 1ZC4A 2HLDD 1UKZA 3S1AB 1ODFA 1QHGA 3ZQ6A 4CW7A 1J7AA 1E1QD 1E10A 4UNQA 1OV4A 2V54A 4BWYA 3WNBA 3H4MA 1E2FA 2BJWA 4PHHA 4ARZA 1MV5A 2J7PA 2PJZA 2J59A 3HRDD 1OFUX 2WWXA 1JNYA 2J45A 2W6IA 1SHKA 2D2EA 5AUKA 1SVIA 4QL3A 3QXJA 3K0CA 1CJUC 3SQWA 2ZJAA 5H8WA 2RHMA 2P6UA 4XSHA 4O0MA 1GNPA 1LB1B 2QTFA 3BJIC 4OQFA 1XDBA 1X86B 2FPMA 3B85A 4DCNA 1ZVQA 2CHVA 2CNWD 3V00A 5CB6A 3KB1A 2ZRPA 3CKLA 4ZDKA 2J0QA 3SJZA 1CU1A 3TNFA 2YHSA 2UVQA 4QJ3A 4C30A 2IF2A 1UJ2A 4RCYA 3U7GA 4QRHA 2ORVA 1U0LA 1XJQA 4KXFB 3JVUA 3PEWA 3FAHA 3EPKA 3RWOA 1JAHA 1D6JA 1XRJA 3KXLA 3B8HA 2WAXA 1XEWX 2WZQA 3OFNA 1G6OA 1GL6A 3BIFA 3LAWA 4LK2A 3W6NA 3AVXA 1NP6A 2ORWA 3PV0A 3GD7A 4LV6A 3Q5DA 1J99A 1F2UB 1RVDA 3B6EA 4RZ3A 2ANCA 5JS8A 3K0AA 3B2FA 3IHWA 2IYSA 3EC1A 1W0KD 3PEUA 1VYVA 3FMIA 1P2VA 1RRGA 3U2QA 4DLRA 4DWJA 2LCFA 3R7WA 3AKDA 1ZUHA 2W0SA 2PEYA 2W2XA 1E94E 4IRUB 4DHEA 5FOXA 3IBYA 2W3RA 3PFIA 2J0SA 1YZGA 3DMDA 5EXTA 2Z4SA 3AE4B 1AM4D 1ZM7A 4IW3B 5EE5B 4JL6A 3KXIA 1NLYA 4GP7A 1HV8A 1W48A 4D4LA 3RS3A 4IEIA 2AFHE 3KKPA 4V0OA 1BIFA 1XMJA 1G291 3AVTA 4NYIQ 5SZJA 1TMKA 5EJEA 2NO6A 5FBRB 5CIWA 1KSHA 5C4GB 4TLDA 3GJ8A 1NF3A 1EG7A 1E1RD 2G3YA 4HLUA 4BZQA 2DWPA 3NC0C 5JCZA 5KPJA 4OK6A 4DUGD 4MA4A 1TQDA 3BIID 3A1SA 2ZI7A 1OB2A 5JEDA 1KZGB 4HLQB 2RGXA 2KMMA 2RGCA 3KJHA 4DRZA 4H1UA 2EFEB 3AUYA 4KVGA 2C2HA 1A2BA 1XWIA 2VO1A 2ZUDA 3VNVA 5KNDA 2IXGA 1KI6B 3AEGB 2WAYA 2E9SA 5C4MA 5TMPA 1IJEA 2ZITA 2WJIA 4C0HA 1E79D 2DCUA 2J41A 2ZR9A 4LHYA 5FH9A 1JEDA 3GLIB 2Q3HA 5FTKA 4BE7B 2BM0A 4MYCA 2DFKB 4TLEA 4QHSA 1KJZA 3RS0A 1VG9B 4PPNA 1FRRA 2WLBA 4URUR 2WIAA 1VG0B 3ADKA 1RYFA 2PMKA 3KQNA 1FXIA 3Q7QA 4Q48A 3AVPA 4B47A 4JIMA 4WBSA 2HF9A 4OI2A 5DHAA 1VG8A 5UKDA 1S4QA 4TMVA 1FQJA 5JCPA 2BMEA 2YC4C 3QG1A 3TW8B 2GF0A 4MKFA 4IVPA 2Q9BA 1E9SA 3THXB 2ZI3A 1T3QA 3N70A 3BWDD 2JLQA 1SVMA 3QE0A 1QOBA 4UQOA 4URVR 2UZ3A 2GJAA 3HP1A 1FW6A 1SXJA 2ZREA 2YWFA 3KUCA 3OIUA 2ZI6A 4Q1DA 4R71A 2Q3FA 3ZS8A 3FHTA 3KQKA 4TYWA 4M1OA 2R6DA 5FOWA 5J4LA 2F1IA 3GCGA 2ZJOA 1SHZA 5FBWB 4E5UA 1KMQA 4CEHB 1SULA 3ZD7A 4BLPA 1XEXA 1BYUA 1QG4A 1KIMA 3P1JA 2PLRA 4PHGA 4US1R 3CWIA 1U2RA 2QMUA 2WJGA 1YZTA 1ZU5A 4WOPA 2ZANA 4OI4A 1KMHA 3I61A 4OKSA 2CL6X 2H16A 1V43A 2WVJA 3RABA 3SS8A 4US2R 2DFNA 1VKJA 2K22A 1DGJA 1KNXA 3BOSA 3JVVA 4ZDIA 4ZDJA 3CR7A 3TUIC 1P9WA 4IEEA 3ICEA 2MSDB 621PA 2J1LA 2W6JA 4JBXA 5AK0A 3WMEA 3QXCA 4A2PA 3GLFB 1SVWA 1KOFA 4DLXA 2IS4A 2JJ2A 3ND9A 4RD1A 3RNLA 3C4JA 1OSNA 4JT2A 2HUPA 2YOHA 1W36B 1GL9B 3UMRA 1KDRA 4A9AA 3BB3A 3NBZC 3AE5B 1T8UA 3KKOA 5FR1A 1ZAKA 4LWZA 2ZE7A 4O3MA 4D0GA 2HT1A 2PKOA 1E9RA 1NSTA 4UNSA 4URYR 4N6EB 3OF5A 2JLUA 2QUZA 2Z83A 4HB2A 2ZRKA 2K5PA 4MQBA 4E09A 4B2IA 1NMZA 3DVLA 3KZ1E 3LA6A 4Q1BA 4V0ME 1IQPA 121PA 4ZIRB 3KKNA 1JJ7A 4LBVA 5GADl 5FTNA 3W3AA 3SR0A 3ZD6A 1Z0FA 3UPUA 1AS0A 2A3RA 2YWHA 2MJEA 4N1AA 4XSGA 1IXSB 4D0NA 3QPUA 3W5VB 4ARZB 1JEEA 1FNMA 2A5YB 4A0HA 5JEEA 4M1TA 5IHPA 3SE0A 3SEAA 2ZETA 4A15A 3R8FA 1FMLA 2NTYC 2WSSA 3L43A 3TGPA 1BYIA 2CDNA 4LJ8A 3LQQA 2F9MA 3ASYA 3NDPA 5BWMA 5GJCA 1RZ3A 3PXGA 1OYYA 1S2MA 1UPTA 2FZLA 3LW7A 4WA7A 4URXR 4YMWA 2O8EA 2VLIA 1P6XA 4NYJR 5LDDC 1VYTA 4PANA 4AKGA 4QBGB 2HTME 4F93B 4Y0AA 4NHOA 2RAPA 5G41A 1DARA 3SDZA 4FXCA 4Q9KA 1JPNA 4NU0A 3HU2A 4LPKA 2AFIE 1ZJ6A 1E0ZA 1GKYA 3LW8A 3U61B 2PX0A 3B13B 3VNUA 4ZKEA 4E03A 4X8MA 3LO5A 4TMXA 2YWGA 5DE3A 2DY1A 2PT5A 1TU3A 1ZNYA 3FKQA 1GKIA 3K0AB 1RWSA 2P67A 1NVVQ 4JVSB 1E2KA 4MYHA 3SBDA 2PZFA 3RAPR 5C3JB 4RZXA 3A6PC 4Q9HA 2GJKA 2V7QA 5ELXA 3RHFA 2ZYTX 1U8ZA 5AJZA 1M8PA 1KO7A 1P2TA 4C7ZA 4XWAA 2GRJA 4XWOA 4G3XA 3CUEF 3VRAB 3SJBA 4G5RA 4YTNB 1S3SA 4EJSB 1Q1QA 2P6RA 3PUYA 1E9MA 1JR3D 1Q1EA 1YZKA 4PZLA 2VHCA 1EFRD 4HAUA 3QNUA 4UJ3A 5DGXA 1W36D 4HZIA 4FMCF 4XVQA 3WXMA 5ANRB 3P4PB 4X8LA 3LVQE 2NIPA 2SHKA 3EZ6A 2BMJA 4G5OA 1I2MA 1CRQA 4KHZA 1UKYA 1M6NA 1QLBB 1PUIA 3B1VA 4RFVA 4Q4AA 3C14C 1IAQA 1FFHA 1U81A 3J81k 4MKGA 1Q3TA 2V1UA 1Q1ZA 2QMHA 4M8NE 2HCBA 1XMVA 3AN1A 1G7CA 4QOSA 4V0KA 2ODWA 2ZSBA 1OH8A 5FOUA 3L4PA 2RKOA 2WP9B 1KKMA 4G5QA 3DKPA 4LYHA 1TUEA 2C9CA 1WQ1R 2V9PA 4N0DA 4BLQA 4O25A 3RVBA 2WPDD 4NCKA 1EK0A 3D8BA 4N0EA 1LS6A 3TLXA 2PVGC 1J90A 2QP4A 2ZYUX 3LB8C 3WYAA 4B75A 1BS1A 4A82A 2O8FA 1YR8A 2E87A 4HRSA 2Z5FA 4MKHA 1Z0DA 2RHDA 3W6PA 3THWA 1K8RA 2WJHA 2J7PD 2QNRA 1GTVA 2RMKA 2IUSA 2JJ1A 2W6ID 4MRVA 4F91B 4JWSC 2ATXA 3AP1A 2PCLA 4IVQA 3AEAB 1M2OB 1RRCA 1H65A 4KU4A 1ZU4A 3AH8A 5H92C 3BERA 4AG6A 1E4VA 4EQ6A 1DAMA 1KI4A 4ABYA 4V02A 3WYFA 1GNRA 3AE7B 1CR1A 1TKYA 1R8QA 1F60A 1KK0A 3N2EA 3ZZTA 1P5ZB 4PQYA 1PDXA 2VSXA 3I4LA 1SXJB 4EUNA 4EFNA 2JLZA 1E98A 2OG2A 2QTHA 4M1SA 3RWMB 4AYWA 1TL7C 5KOYA 3AVYA 2I4IA 1Z47A 1W4AA 1X8LA 2W83A 3OFND 3GEIA 4QBIA 4XVUA 2Z4RA 2V3CC 1TF5A 2WHXA 1E7PB 1LNZA 2FPLA 3E5HA 4OBEA 2IEYA 4BFZA 4W9MC 4MYUA 1D8TA 1XEXB 3GJ5A 3PITA 2XNDA 3RS4A 2FSIA 3CF2A 4MGZR 5CB8A 2VEDA 5KDOA 3A4MA 1ZNZA 3W8RA 4KFSA 2D74A 2CCGA 5JECA 1AQUA 2A2ZA 2PH1A 2IHBA 4B3XA 4NCHA 1NG1A 5KU1A 4KBGA 3CX8A 3FGNA 3DWGC 2XSZA 4D0LB 2BV3A 3A37A 1KK3A 1GSIA 4JX1C 2ZPTX 1ZBDA 2WQYB 1NLFA 2AD1A 2QTVB 2ZQ5A 3AVOA 3DO6A 5FI0B 2QPOA 4CGZA 2ODNA 2CL0X 1KK1A 1S9DA 2WWWA 1IN5A 3H0KA 5IRCD 1G64A 2BMDA 1G9XA 2CCKA 4HAZA 1Q0UA 4C7YA 4C0AC 4XWKA 3ND8A 2PJRA 1HT2E 2YYZA 1GOTA 1W49A 4BEBA 4HLDA 4D4MA 4G1UC 5FUXA 3F0TA 3VQTA 3UANA 1C9KA 1T5IA 3X2SA 3LFUA 4Q9JA 1GZSA 4RZUA 2YV5A 1E2PA 4F38A 1FXAA 4JYCA 2EYQA 4YQFA 4C0BA 4P32A 4XD7A 1FL9A 4BZPA 1E0KA 2F3TA 3BFXA 3UK6A 1G6HA 3OZXA 1OYWA 2JATA 3PVSA 1US8A 1N6PA 2LKDA 5EP3A 2CHQA 2QA5A 1UBGA 2JJ8A 3AKEA 3VHLB 2H8KA 1KY3A 3C41J 2FGKA 3DM5A 1MO4A 2ZS8A 3P4XA 3BK7A 1GIAA 5BQ5A 4UKDA 1IUEA 2EFHB 2XJ4A 3B1WA 1WCV1 3T06B 3CF0A 4AIIA 4I81A 1Z2AA 5KPDA 4OHYA 3KL4A 1U8AA 5B2ZA 2DWOA 2WJJA 3QXXA 1MOZA 2WDVB 1DOAA 3L82B 3TSWA 2ONKA 2OBLA 2QAGC 5JBQA 3G0HA 2ZSDA 2JGNA 3A8TA 1P2UA 4JLNA 4Q1CA 3W5IA 4X8OA 1RFLA 2FZ4A 4DIDA 3CONA 2O8EB 3FHCB 4WIAA 1KAOA 4HI0E 1N62A 2OESA 1YKSA 4JJKA 2EFDB 2HXYA 4XOIA 2OBMA 2VTKA 1OLOA 3AF2A 4QXAA 5CJ2A 5GXGB 2BKEA 3OIWA 4QGAA 2BEJA 4YSZB 1P9RA 3Q8XB 5BN5A 1SXJD 3ASZA 2ZR7A 2IBMA 4JVNA 3W6OA 1JW9D 2VP9A 1OT3A 3BFVA 2B21A 3LLMA 5TDHA 3SC3A 3NS1A 4ZCMA 4TZ6A 4RY2A 2IYVA 1LVGA 3KJEA 4BZXA 2ZE5A 4DKXA 2WICA 4GZLA 2QG6A 1VCOA 3EZFA 2NQ2C 2Q3MA 4YLGA 4GP6A 2GXSA 2FDCA 4M1KA 5J4YA 2QRZA 3NBFA 1R10A 4YMVA 3NHBA 2EWWA 1IY1A 3UMFA 3LV8A 5H70A 2I3BA 5EP4A 1H8EA 2ZROA 2OM2A 3U44B 2XB2A 2W6JD 4D80A 4GOJA 5JI3E 2VPPA 2JJ2D 3IIMA 1B0UA 3SNHA 4B2PA 4AYTA 3KFVA 1UFQA 5CM8B 4LYFA 2J3EA 3GLIA 5CDFA 1EWYC 2C5LA 2FGJA 1QHXA 4DB4A 5G53C 3DZ8A 1YZLA 2JLYA 2ODBA 1E6EB 4YXDB 4Q4AB 5LD2C 5FOTA 2R6FA 3A1TA 3T5GA 1B9RA 3U6KA 1A4RA 1YJIA 1G8YA 4JBWA 1UBEA 1ONBA 1YQTA 4URWR 2CHGA 3CX7A 2P2LA 3DHWC 3KUDA 2VF7A 5HZHA 3TQFA 1NBMA 2CCJA 4HAXA 2QBYB 4L4UA 3AE1B 5GJWC 5DYIA 2WKQA 5E7IA 2WM9B 4OJKA 5BW8A 3EZ2A 1S9HA 4JBYA 1QOFA 1JAIA 1Z0AA 4QHYA 5DI3A 3I62A 2O8FB 2F9LA 3B7GA 2OO7A 3QKUA 4C3ZA 4DLYA 3GJ7A 3THWB 4A6XA 2ZRLA 3CPEA 1HE1C 3F5FA 1RE0A 1WE2A 2JLWA 2RGEA 4ACBA 4DJTA 2EQBA 3RDPA 5HR5A 1N63A 1VMAA 4ZOHC 2ZJ8A 4QGGA 4ZV4A 2WSSD 4I1VA 2DPXA 3Q9LA 4IOMA 4DC9A 2IWHA 4CYMA 3PUWA 3T12A 3TUZC 1ZXIA 1E2MA 3BBPA 5E4FA 4CEHA 3ONWA 1E2DA 2UZIR 3K1JA 2ZS7A 3VKHA 3W5JA 4QC2A 1PLKA 3GJ4A 2IA5A 3SFEB 5EQTA 2D7DA 1MT0A 2IYZA 3VHXA 1IY2A 3TVDA 3ZZ0A 4I1OA 4Q47A 4HAVA 3FMPB 4JL5A 4LJ5A 1G16A 4G01B 1AWDA 2C9OA 1NMXA 4PC1A 2P65A 2IYXA 4HEJA 4MDEA 3D3QA 1VDZA 4KI0A 1DVRA 2W00A 4YDHB 3EWAA 1G8HA 4IDOA 4UXJA 4FCTA 4GNKA 4DCSA 5AWFC 1GNQA 1VYUA 2GJSA 5C2TB 2ERYA 3R9XA 4LUCA 1NI3A 2G77B 3CR8A 1P4SA 1SVLA 2B7CA 3I92A 2OV2A 2V7QD 2WDRB 3L8YA 1Q20A 1JPJA 1JXMA 4EPTA 1CF4A 5J40A 3I1FA 4QBFA 2A5JA 2NOAA 3SQXA 3B9PA 3UXMA 1OPXA 2HV8A 4C0SA 2IYRA 1XO3A 4FMDF 1M74A 2W2TA 1MRNA 4DLUA 1N6OA 4DLTA 4B43A 1OFIA 1TPZA 2Q6TA 2ZRGA 1AQYA 3CIOA 3LD9A 4GI7A 4KSBA 1E2JA 1D9XA 1W1WA 2QROA 1AZSC 2NZ8A 3BB1A 3O8CA 1OB5A 2BM1A 3D6TB 3R8CA 1XEFA 1GRRA 3PQCA 2GCOA 2R6AA 4KO8A 2XTZA 1MRSA 4LYAA 4EIWA 4PPFA 1ELOA 1CJEA 1CKEA 4H9GA 4W5HA 3HPRA 1L0VB 1VDVA 1O3YA 1D5CA 4WXRA 3CB4A 4CT5A 4EPVA 5BXQC 1NG9A 4ITRC 1NENB 1DAKA 3A1WA 2QL6A 1XBTA 2D2FA 4US0R 2AX5A 1Q57A 4Q1FA 5J47A 5TVKA 2OAQ1 3EXAA 4P4SB 3AE9B 1PJRA 3KX2A 1US8B 2RGAA 2ATVA 1WYGA 3FWYA 4OHVA 2GF9A 1IM2A 2FN4A 4I1SA 4FCVA 1UEJA 2ZE8A 3HVZA 4Q7LA 1NIPA 5KDLA 4Q01A 2QP3A 3BRWD 2PVOD 2JJ1D 5HE9A 3U3KA 4Z8XA 5CJPA 1ANKA 1TQ6A 3GEEA 5FPSA 1VCMA 3R9IA 3I8SA 2BBWA 4M1WA 1CBUA 1U0HC 3KJIA 4DLVA 4M9QA 3AM1A 3NH9A 4MRRA 3AH7A 1N0UA 2O52A 2JAQA 3K70C 4A36A 3K0SA 4EPWA 3ZVMA 2V6IA 1KI8A 3EA5A 1DO2A 1JRPA 1Y63A 3CO5A 4C7OA 3P4QB 2V55B 5G3ZA 2V6JA 4B71A 3AVWA 1E2IA 3CRQA 4GT1A 4DSTA 1T0HB 1W4BA 1HUQA 2WKPA 3NEYA 3SHWA 1JECA 3K9NA 3DL0A 4MRSA 3M4YA 2BBSA 4LY6A 3KDSE 1PUTA 5K8UA 2V1XA 5F2EA 3IILA 3VX4A 4B2LA 3NH6A 2WWGA 1NN1A 4EJSA 3BGWA 1R2QA 1ZUD2 2XJ9A 3U3OA 2XNDD 2KE5A 4I99A 3I32A 4CZ2A 3EC2A 1S96A 1TTTA 1KRHA 2B8TA 4PAOA 4PSKA 4HATA 5EE1A 4M9XA 1XU4A 4PZZA 4NMMA 3A4NA 3TSZA 3I5YA 2HEIA 3WRXC 3G5UA 4BGDA 2XSZD 2Y5CA 3L8ZA 4JWUC 4Z51A 1U90A 3UWOA 1Z2CA 2OZEA 1G1MA 4Q7JB 3TQCA 2WS3B 2QPTA 4LYJA 3C8UA 3EWSA 3SHFA 1PLLA 1XNJA 1BO6A 4GFDA 1N5LA 2YJTD 4JYBA 3SFZA 2QM8A 4RD6A 3ZDQA 2R44A 1FRDA 2REBA 5FPTA 3VTKA 2G88A 3CNLA 5L3QA 1W0JA 4PC2A 2QGZA 3KTAA 1R6BX 5DNYB 5HCNA 3AVVA 3BS4A 3THYB 1HTWA 4D26A 1RIFA 4BECA 4A0GA 1MKYA 1CJKC 2BMFA 4TMWA 1D9ZA 2R9VA 5FTMA 3U3JA 3PEYA 4Q1AA 1X1RA 3QF4A 4YXWA 1XZPA 1GFIA 4TL7A 1YJJA 1TQ4A 1YZQA 2X1VA 4UNNA 4F4IA 3EIEA 2QGNA 4IDPA 4ZI3A 1N25A 2IS6A 3NBYC 4XD7D 4AWXA 1OH7A 1XJ0A 5IF9A 2QJLA 1E0SA 5B64A 3IKJA 3LRPA 4QGFA 5D3MA 5D3QA 1TKEA 1E69A 4U5XA 4UXHA 3WHLA 3UG7A 5EUMA 4CRWB 3EIQA 4ZKDA 4KITB 1BKDR 3UWKA 4JS0A 3PG5A 4KCGA 5DI3B 2IS1A 4LBYA 4BQSA 4EAQA 4URZR 3U6BA 4HAWA 4PFSA 1LV7A 1KJYA 2FEMA 2OAP1 1DTSA 3RPFC 3TBKA 2XGJA 1J7CA 3AUXA 1ZCAA 1XTKA 1CJTC 3I73A 2QY9A 4GBMA 1FFVA 2VP4A 1Q3HA 5K8IA 4RD2A 1HURA 5DHFA 4S35A 1RFKA 2C95A 4TWZA 2BT6A 3SFDB 2FPKA 2AK2A 3P4SB 1I4TD 1JROA 3HYTA 4KFRA 2Q21A 4UJ5A 4PZYA 2FNAA 2NPIA 4YC7A 2WU2B 4RD0A 2BWJA 4ON9A 1MABA 2N1BA 1XCPA 4TTQA 1KNQA 2YNMA 1YRBA 1N6HA 1Z8FA 3VR1A 5JJLA 2CLCX 4AD8A 2GEDA 5GVRA 2OCBA 4B33A 1G19A 2Q9AA 1XCGB 5DIFA 1KJWA 3A36A 1WBDA 3PJRA 1OH6A 5AJYA 1N5WA 1XD2A 4EFMA 2ZIAA 1LTQA 4P33A 1GP2A 1E0AA 2ZSEA 1P73A 4V0MA 3EX7C 2QAGA 1QOAA 1W46A 4QJ4A 3EZ9A 1OXUA 2WWYA 3MLEA 2GNOA 2QI9C 3GFOA 1OIXA 1OFHA 1G5RA 3PUVA 5CYPA 1WXQA 2IYYA 2WOOA 2J9RA 1J70A 3Q7PA 4M2LA 5DSZA 1KF6B 1F48A 1Q22A 2VHJA 3QXHA 1CJVC 1E32A 1H8ED 2H5EA 5J4VA 4S2EA 1W7AA 1NN3A 2Z6VA 2H7VA 4YTMB 1QVRA 4L9SA 4RZ2A 2GEUA 3ETRA 5JZVA 2VP5A 2F7SA 4B35A 2REXB 4AI6A 3L0IB 2KI5A 1H8HD 1KO5A 3W90A 2FFHA 4GPTA 1OIVA 3WNCA 5FL7D 1W2GA 2A7QA 1Y3AA 2NO7A 1LF5A 1O87A 4HROA 4IDIA 3ZYYX 2BOVA 1EX7A 1II0A 1N2CE 2GCOB 3DM9B 4QG7A 1XTQA 2PCJA 1IBRA 2A9KA 4TMTA 2O0KA 5AUOB 4O2LA 1Z0IA 2A5FA 4V03A 4CIDA 5J4HA 1G3MA 2X2EA 4LHWA 2BHRA 2FE4A 2F6RA 2IYTA 2NG1A 1XMIA 1BOFA 3W9CB 3THOA 3EAQA 5EXXA 1EFTA 3WMFA 2ZRAA 2PL3A 3LY5A 3T15A 1IN7A 1FP7A 1NJGA 2MJDA 1PUJA 4M22A 2GHIA 1HYQA 3MCAA 2IX3A 1UM8A 3CWQA 1NBMD 4K81B 5FOSA 4C0LA 3HJNA 1KSFX 5JWRA 4PTLA 3U60B 4CEJA 2B8WA 2QORA 5DLQC 3LXFA 4PAQA 4C4PA 1OHHA 1P9NA 2WJVA 2XITA 1Z0KA 4IXMA 5BYJA 2OFWA 2ZM5A 4MYTA 4GL2A 3AF1A 2AWNA 1GVNB 2Q9CA 4HZUA 4LCBA 3QKRB 4P6VF 5TY0A 2OCYC 2QSZA 2RB4A 2ZUCA 2O8CA 2ZSFA 3CIRB 4NBSA 3M6AA 1NNEA 4BPBA 1MO6A 2PBRA 4IFBA 1EFCA 3CF6R 2IEZA 1FM0D 2FWRA 2CLSA 4NP6A 4RVCA 1VLBA 1K5DA 4C7OB 2Q0HA 4B34A 221PA 2ZS9A 5LB4A 1E99A 1XTSA 3CRRA 2HDNB 3LNCA 3REGA 5FBLB 4BFXA 1PVOA 1E0JA 4MITA 1LW7A 3U44A 3AB3A 2GXUA 2OFXA 1T3LA 1L2TA 3HWSA 3NHAA 1K5GA 1VIYA 3K53A 2BJVA 2W55A 1T9HA 3FFAA 5JFGA 4F92B 3E2IA 2YOFA 4B44A 2YKGA 3TAHA 3HR7A 1DAIA 3TE6A 1RC8A 4XH9B 2QPAA 3R9WA 3PEVA 3SFVA 4NZYA 4P0TA 1JQJC 3ZS9A 2VF8A 3QEOA 1Z3IX 3X1XA 3DDCA 4AURA 2OLKA 1JQ4A 2GBLC 1KKLA 2CXXA 4QKQA 4BFTA 1XXHE 3QUSA 4A8JC 3AE6B 5L3VA 1X1SA 1Z6YA 4A0RA 2RGBA 5L3QB 1ZNXA 4M4SA 4E07A 3KTAB 1N6LA 3IPYA 3CX6A 3X1YA 1KK2A 1T6NA 1WA5A 1YU9A 3SOPA 1VCNA 1ZUNB 2QBYA 1DS6A 5F9HA 1WGKA 1N6IA 4PQRA 3VKWA 4JLMA 3QF4B 1KI3A 1N0WA 3BE4A 4ILEA 4GOXA 1VHLA 2J0UB 4OI0A 4L8GA 2W0MA 1F2TA 2EVWX 5KSOA 1G4AE 4G0NA 3ADBA 1XX6A 4KLNA 4CVNA 2GILA 3KJGA 3FPAA 2FH5B 3AEEB 3CH5A 2QN6A 4BFUA 3WY9A 3NG1A 3ADCA 4A4DA 3X1DA 3GLHE 4M53A 4OYHA 4P4UA 5D3MB 4EPYA 2ZJ2A 3AF4A 2NZJA 1KY2A 4M9ZA 4US9A 4YTPB 2JLSA 3IHLA 4Y0VA 4NCJA 3W8NA 3AE8B 2K5UA 1NKSA 1HE8B 3IEUA 4M1YA 1ROEA 4JZKA 4XIGS 1KI9A 1YZUA 1IONA 3D7MA 5JS7A 1TKGA 2QQEA 3CW2A 4JSYA 4NTZA 2N46A 5CK5A 5JWOA 2JCSA 1QOGA 5LBIA 1XP8A 4NPHA 2QT0A 3UATA 4ESVA 1ZUIA 3ZIAA 1YR7A 1W47A 4DZZA 2XOKA 2B92A 1OQRA 1NIJA 2GA8A 3K0FB 4EKDA 5A5GA 3MWLA 1DELA 3VR5A 4CEIA 2QP9X 1NYQA 2E1RA 4IDQA 1MABB 5DO9A 4MKIA 3AGPA 1NY6A 5K8LA 1EGAA 2O5VA 1OE0A 1ZP6A 1IJFA 2JLRA 4I1UA 4Q1EA 1UKEA 4KJZA 3BAFA 1NKTA 1Q12A 2BBOA 3QKSA 2R65A 2IL1A 2CVFA 1AZTA 4TQAA 1RRPA 3U3RA 1TAGA 2JQRB 4Q7MB 1XD2B 3T61A 1N3BA 3VR4A 4Z54A 3GPLA 2KB0A 3BH0A 4LRWA 3T5DA 1P60A 4KYIB 2OILA 4L5BA 4OI1A 1W5TA 2FF7A 1KAGA 4LOAA 1XD9A 5EZ5A 3CLVA 2QAGB 2IW3A 1UKVY 3ZQJA 1SVSA 4Q9LA 5HE8A 1WB9A 5BN3A 4R98A 2ASEA 1F6BA 2C8VA 3AGQA 2Y8EA 2K9XA 2V8OA 2WMNB 1FMJA 5TXGA 1RKBA 2KJQA 3EUB2 2W58A 1OXXK 2VIIA 3CBQA 5C46F 2FOLA 5KDDA 4PC7A 2QMEA 1XTRA 4K46A 4GSYA 2OT3B 2VH5R 2XTMA 1E2LA 1E9BA 3DMNA 1CIPA 1UEIA 2O0JA 5FFMA 3TVTA 5B58C 5G3YA 1W0JD 2GJ9A 3TRFA 1SF0A 4P4SA 1R0WA 1FMAD 4A0FA 3WP1B 1BMFA 4KV9A 2QSYA 3W9YA 4ZI2A 2MSEB 2QU8A 3NEJA 3NTUA 3BFKA 2W3SA 3U7FB 2VHTA 4FW9A 4YXWD 1NVVR 1UBFA 3GLGE 2AWOA 5KSYA 3B1YA 1ZC3A 2ZTSA 4P3YA 1PZNA 2UKDA 2EKIA 3NVVA 1L6VA 2CMKA 1COWD 2P3SA 4D2IA 3PUXA 3NVYA 4NE2A 2QT1A 3CM0A 3V9PA 3CRW1 2C78A 4F7WA 3LH5A 3CRMA 1KDPA 2AN9A 2GXAA 3ETLA 2GAOA 4GMXA 2BCGY 3ZVRA 5J4KA 3GP8A 4W5WA 1S0UA 2R6GA 2ZR0A 3A1UA 2LEKA 3W34A 5E7MA 2QMOA 1A2KC 5FBVB 1N6RA 1QHYA 2J5XA 2ZRIA 3P20A 1R5BA 1G8PA 4M1MA 1ZM2A 4CEJB 1W4RA 1Q21A 5KUTA 3LVRE 5DH9A 4HDQB 1ZM3A 1G5TA 1TEXA 2WV9A 3SN6A 3CPJB 3IO5A 4HZUB 5P21A 3P27A 1XF9A 5L8VA 5LD2B 4BUJA 2VL7A 3NC1C 2XX3A 2O8CB 2G0TA 3IQXA 1UF9A 5HKKA 1G8GA 2OFOA 4PSAA 4N3NA 5SZKB 4HUQB 3AP3A 2G0NA 1OF1A 1T3SA 3H84A 4GOKA 3ZLJA 4ZCIA 1R0YA 4P31A 4LX0A 2GK6A 2ZVPX 3VMFA 1XZQA 2GVDC 2RCNA 2HF8A 3CRVA 3K0EA 3NIBA 1G7SA 1GDDA 3B1ZA 1B23P 2M56B 3RLFA 3MMPA 1VECA 1QHIA 3NBXX 3WMGA 1S8FA 3TR5A 4G5SA 3KQLA 2AXPA 3SYKA 1V97A 1WRBA 1ZM4A 1H8HA 2IF0A 3AB5A 2BDTA 4RSGA 2AXNA 4Z8YA 3WRYC 3FOZA 4D81A 3OAAA 3BORA 2GXQA 5FL7A 1FQKA 3AKYA 1MO5A 3THYA 1R7RA 2ZEJA 1P75A 2W2VA 5H8YE 3FKSA 1JWAD 5CK4A 3BH6A 821PA 4AYXA 1N5XA 2BKUA 3EARA 1NY5A 2AK3A 2XZLA 2IS2A 1F0ZA 2YC2C 3VX3A 2OHFA 4B3DA 1CTQA 3AEBB 1AGRA 4DCVA 5L3SA 2WDQB 1QRAA 2ZI4A 1KSGA 3ZVNA 1VTKA 2OLJA 3KXKA 3T35A 4BLSA 1A7JA 4TYNA 1I7HA 4WZAE 4DCTA 2R62A 2OBNA 4BRWA 3QBVA 4ACAA 5AUPB 2OUKA 4IXNA 2R2AA 3WYGA 4TT3A 3B60A 4JJZA 1ZIPA 3OEHA 4WAUA 2GJ8A 3IIJA 1Z5ZA 1ZMXA 4GZMA 5CM9C 1V5WA 2VSFA 3IQWA 1SGWA 2P5TB 1F2TB 1R0XA 5MPOA 4JLOA 1M34E 2GK7A 3LQRA 4M9SA 4IDHA 1GG2A 3VKGA 1GITA 1YJ5A 2GDJA 4DT1A 4C2UA 1OKKA 3AVQA 1YE8A 3A1VA 1GKUB 3K9HA 4OK3A 2V4ZA 1WWTA 1ZD1A 1AS2A 3AF3A 1R8SA 3M0EA 3TW4A 1CJMA 3RC8A 2F3RA 2N0SB 1G4UR 3FHOA 3ZYCA 1UDWA 1OH5A 3UMSA 1N5IA 3E70C 4OHZA 4PPQA 1OHHD 5E3HA 1KO8A 3QVVA 1TEVA 4JMPA 3AEFB 2WBLC 2JLVA 3L0OA 2YINC 3FC4A 1JXOA 4HDOB 4KX6B 2BS2B 1BH2A 2MMCA 4L9WA 5EP1A 4B3CA 4N59A 2YWEA 1Z6XA 2ERXA 3F3YA 2HJGA 4A2QA 1E4YA 3BXZA 2ACZB 1EESA 4QGHA 1EX6A 4FWIB 1L6UA 2GEVA 3E1SA 3GEHA 4CEIB 4C0JA 3LXXA 4USAA 4FINA 1NRJB 1IY0A 4MGKR 4GMDA 5DN6A 2IWRA 5KTYA 2NO0A 3HU1A 3QKSB 3FVQA 2PLFA 4LJ6A 3QG5A 4TSFA 3ICQB 1E9DA 1G3IA 1X8KA 4IDNA 3T1QA 3VR6A 1N60A 2EFGA 4WZ6A 2HT6A 2VBCA 4B3GA 1SVKA 4B48A 2ZXUA 1QHNA 1UAAA 2VA8A 3Q85A 1PFDA 3QY0A 3I5XA 1DOIA 3LX8A 5LPNA 4FIDA 5L3RA 1QG2A 3KQUA 4YMSA 3WCQA 4RJLA 3ZJYA 4YMUA 3P63A 2D62A 1KO4A 2QEQA 3AQ4A 3K70B 1UADA 1VIAA 1NN5A 4YSXB 5C2JB 5G5GA 2ZE6A 1R5OA 2WJYA 3GLGB 4KSCA 4LC0A 3AV0B 1TX4B 1U0JA 1OXSC 1T5LA 2IHYA 2O0HA 3GJXC 1G3UA 4K8OA 3GLFE 1FPMA 4TZ0A 1CP2A 2BS4B 1TQ2A 3RSOA 1UWMA 1CRPA 1W2HA 3KWLA 1G20E 2FFQA 3NVAA 5HZKA 1NMYA 1JR3E 3FTQA 4B6FA 1T4GA 3K9GA 4NYMR 5EP2A 4NH0A 2QRNA 4JLDA 3RRZA 1G21E 3NXSA 3GFTA 5KO2A 2BCJQ 3BC1A 5AUQA 1L7VC 2AR7A 3K09C 4JVMA 5JLJA 1VHTA 3EW9A 1XLNA 5JHGB 4LV8B 4BRUA 2HXSA 2PZEA 6Q21A 4B32A 4OJQA 4RD4A 1E9EA 2CK3A 3GFPA 3TK1A 2BIFA 3HR8A 3QKRA 3LBNA 4FWTA 2OXRA 3RYTC 4KODA 2HYIC 2GBLA 2ZAMA 4U00A 2JIZA 8OHMA 4C2TA 4YSYB 3QOFA 4W5JA 4A8JA 1G3QA 3HDTA 3MWYW 2GKSA 2KSQA 1WDTA 1XCMA 4PC6A 1RPZA 3I8XA 3V4FA 2OEPA 1TNDA 4OK5A 3H1TA 4US8A 5TB5A 1OQQA 3EIHA 1E9FA 1G41A 1FX0A 3EA0A 4PPGA 1SIJA 1WF3A 2CJWA 4GRAA 4Z1MA 2JEOA 4EPRA 5JI2E 3EPHA 1YRAA 1NN0A 1FNNA 3WBKA 1Q1BA 5EZ6B 3AECB 2ZSAA 1AA9A 4JKIA 3ZIAD 4Q4LA 4LHZA 1I4DD 2GZAA 2XOKD 1FTSA 4LJ9A 3NVZA 5JJIA 4HB4A 2G9NA 1VCIA 2QAJA 4BEJA 1KO1A 3U4QA 1HT1E 1Z83A 5JHHB 1TF2A 4L16A 1YR6A 4ASUA 5BN4A 4X8HA 3ABVB 5JWHA 4MUBA 3CZQA 5CYOA 4GDFA 3DKVA 3Q3JB 3NKVA 5G5HA 1TU4A 2EU8A 1R5NA 4CF7A 1E2QA 4BLRA 3MGCA 1E9CA 2QE7A 3P32A 2RH5A 4UNRA 3FYHA 1P61B 4TL6A 3L0SA 3QQ5A 2CE2X 1R0ZA 5HPYB 4NYJQ 2FFAA 1I2DA 2P5SA 4B76A 4QNMA 4FCWA 4BFWA 1VPLA 1ZOYB 4PO1A 4JLBA 2XZOA 1A82A 3N2IA 4U02A 3K70D 4XJXA 3QPVA 4YDSA 2VHUA 2F1HA 3B2GA 3B5JA 2L0XA 1GL7A 2RGNC 1J7KA 3QENA 4NCIA 1DOXA 3C5HA 2J0UA 4HSEA 4TYYA 3U7EB 4ERNA 3FB4A 2IC5A 1QF6A 3AKCA 1DG1G 1COWA 2G1KA 2G6BA 2HYDA 5L3SB 4LHXA 4Q9IA 2AX4A 3CZPA 4EPXA 3PIRA 3EG5A 5JSZA 1E9AA 1L4UA 1YR9A 2EW1A 3LX5A 3T1OA 1P7CA 3KKQA 3SYNA 2EFCB 1BMFD 1FTNA 2NGRA 1J8YF 3GJ6A 4TMKA 2CJOA 5FPKA 1EWQA 2NO9A 1TJEA 4HYYA 5IK2A 3LWNA 1KDOA 3U3MA 3NVWA 5KNCA 3CNOA 3RRYA 3AF0A 4DLSA 3DOFA 1EFUA 3QI2A 2C98A 2ZAOA 4Q21A 4TLAA 3JZMA 4BFVA 4ESHA 3B9JA 1ESNA 2ZRDA 3QXSA 4DT1B 2JX5A 2MJ3A 1ZCBA 1FFUA 3IGFA 3SYLA 1E2EA 1II8A 1ZNWA 5FR2A 3UIEA 3K0FA 2EWVA 5AJWA 1DAGA 1P62B 4OQNA 4LC1A 2ZYVX 5EE3A 2X8AA 2FBWB 2G1JA 2GAAA 2WWFA 4JLKA 4MH0R 1E2GA 5EE0A 3OEEA 4KBFA 4R2IA 3H2YA 2AL7A 1X8JA 1SB3C 4B3FX 2JDIA 3OIVA 4OHWA 1R4AA 2X19A 2OSBA 1UBCA 2C96A 4LHVA 1N61A 3KKMA 4PR0A 2O8BA 2GWHA 4FD2A 2O8DA 3TIFA 1DAHA 5CLLA 5HKKD 4LSGA 4L15A 1T91A 5H1YA 4FMCB 2E3TA 2B7BA 1NSFA 3AE3B 1E96A 2C03A 1RYHA 1JR6A 1JALA 5GJVC 4FMBB 3CPHA 1LS1A 3AE2B 1U98A 4JL8A 2CJNA 1SXJE 2C9YA 2FJUA 2IT1A 3RS5A 4NONA 1T0JB 2CLDX 1J8MF 2FSHA 2H17A 3AEDB 3L0PA 1F3OA 3HPQA 4DSOA 1AJEA 1XTIA 2ZRJA 1ZYUA 1IXRC 3X1WA 2IUTA 5FUWA 3WP0A 4JLVA 5C18A 5CITA 3A4LA 3P4RB 2C99A 2F43A 2MH7A 3IDQA 3MSXA 1G5PA 2CEAA 1DEKA 3OAAD 3W5UB 1GRNA 2OXCA 3ZH9B 1IN6A 5GVSA 3C15C 2H88B 2ORIA 4DIEA 2QQ0A 4Q7KA 4QFMA 2FU5C 1EXMA 3FKSD 2GVZC 2OCPA 3FMOB 4ITKA 1ZM9A 1HH4A 3QVUA 5FOVA 3LBIA 3VR3A 4AY2A 3VU9B 4CDGA 3GJ0A 1X3SA 4DLZA 4DXAA 4PO8A 1TYGB 4ZPXA 4AKEA 5B30A 4II7A 5K8TA 521PA 4IVRA 3SBEA 3EPLA 5CIQA 1KZ7B 2IYLD 4BASA 1NYRA 1Z06A 3G82C 3O8DA 3TH5A 1CR4A 2IXEA 2ZRNA 5EXSA 2F55A 2VHQA 1S1MA 2ZRFA 3NDBB 2CU3A 4H1VA 4PSVA 4Q4JA 3OE7D 5CLQA 1M1YE 3WHKA 1JWBD 4R2HA 2B76B 1Z6TA 4TT3D 1OFFA 3OEHD 4NYIR 5B57C 3QF7A 4LZZA 3B9QA 3FDIA 1DAEA 1MO3A 2I1VB 3K9LA 5KSPA 2N42A 4DBLC 2X2FA 3QBTA 4TQ9A 2XTNA 1AIPA 3GMTA 4ZCLA 3TJZA 3OIYA 2ZUBA 1OKKD 2VP6A 5IDVA 5KNBA 1W36C 4A8JB 1P2SA 5F9FA 4TLBA 3ADDA 2XAUA 2G1EA 5H68A 1C1YA 3H86A 3BB4A 5JMTA 1CZPA 1W44A 2A30A 3RRMA 4HUQA 3TR0A 5FBQB 5JRZA 1CR2A 1FX0B 1QHHA 3DOEA 4A1FA 2NMVA 1TF7A 1QHSA 1A70A 2CJWB 5AUIA 1U9IC 1VG1A 2QM7A 4LBZA 3V4RA 2ZJZA 4MRPA 1N6KA 1XXHA 2IXFA 2VRWA 1C4OA 4WVFA 2IUUA 4YT0B 4DEXA 2AKAB 2Z43A 4IFEA 4RFSA 4Q19A 4ZO4A 3QKTA 2NPFA 4BLTA 4DSUA 1AKYA 2WU5B 4E22A 4M0LA 3KFXA 5AJVB 1M7BA 4KFUA 3BH7A 3T1TA 3U4QB 2KBEA 1JQLB 3L2OB 4KFTA 1VJKA 4CT4B 4TLCA 3R7WB 2DWQA 2PT7A 4PQFA 3C16C 5DN6D 2ZI5A 3P1MA 3LDAA 4LJYA 5TV2A 1XPRA 1FOEB 1M7GA 3K0CC 3QPWA 1JBKA 2HJVA 3SZRA 2ECKA 1P72A 1GWNA 3C5CA 4J0QA 4TSFD 4TTPA 4D6PA 3EZ7A 3R20A 4Q18A 2RGGA 1GAJA 4HAYA 1CEEA 1NVUQ 2H92A 2ZU6A 4R7ZA 4V0NA 4D82A 1XEWY 721PA 4A92A 1IHUA 1SKQA 3EASA 1GILA 1CXZA 1W4CA 5FUYA 3VFDA 2D3WA 4PC3A 2QENA 3O47A 4DLWA 4F4CA 3FE2A 4D4KA 2D06A 4HLCA 4QBHA 3GLHA 1WRIA 2KWIA 2HLDA 1Z6GA 2CE7A 5AUNB 2B6HA 3SJAA 1AKEA 1E1QA 3IUYA 2PIAA 5FL3A 5A4JA 1N0VC 3MFYA 4HDCA 2XEXA 3RSLA 1DG3A 1OXTA 2Q5WD 2H18A 4FI3C 2ZJBA 1GPXA 1PV4A 2REOA 3TSOA 4C0QC 1XLPA 1R7SA 1AK2A 2QIEB 1D2MA 1L8QA 4LGMA 2IK8A 1EWRA 2IYQA 4R9UC 5JSZB 1HEIA 3B1XA 2CNWA 1CLUA 2D7CA 2LKCA 1G7TA 4RD3A 1FUUA 4WZBE 1F5NA 1SKYE 4NKRA 4W7SA 4WXPA 5LB2A 2XXAA 4TL8A 4OHXA 2H57A 3O8BA 1Z6AA 3KQHA 1Z63A 2WTUA 2WIBA 3K8YA 3LLUA 1L4YA 1XMSA 3B82A 5EXPA 4LV5B 2ZJ5A 4JKYA 4RKFA 4POAA 3WNDA 1JB1A 2CK3D 2PMDA 2P0EA 4F4JA 1DPFA 4AKIA 4EJSC 2KAJA 3RC3A 1DAFA 2JIZD 1HA3A 4HUTA 1GRQA 4DDVA 4BFSA 2DFTA 1ZINA 1II8B 4HLUC 1MH1A 2JLXA 4MDFA 1KTVA 4A6PA 2MSCB 4Q4HA 4B3BA 4LPSA 3DWMA 4PHTA 1W0KA 1Z28A 3TKLA 2M19A 2ZYWX 3N5CA 1NJFA 3QEJA 3RANA 3M1IA 3PR1A 1I4LD 1U94A 5KHOC 3I3SR 4UXIA 1S3GA 1OXVA 1KHTA 1RJ9A 1TADA 4Z1MD 2GCPA 4OQXA 5EE9A 4G5GA 1YQ4B 1IOZA 1ETUA 3HYRA 3K09A 4TN1A 4KAXA 2PZGA 4KLZA 1J2JA 2LWIA 3U5ZB 3ZZUA 3PO0A 2O8BB 3CWZA 3W3ZB 1YQ3B 2O8DB 3CNNA 1RRFA 1Z07A 4XTRA 1DADA 3MJHA 4QNRA 4DB2A 5FI1B 1P3JA 3WBJA 3MJRA 1AGPA 3D31A 3B2EA 4DDWA 2J0VA 1HY3A 2J7KA 4KVAA 1E1RA 2ZRHA 1KMHB 1Z22A 4QJ5A 4B6EA 4ASUD 5FTLA 3UG6A 2BS3B 2H89B 2DBYA 1HQCA 4DUGA 4WWMA 4C0KA 1SZPA 3GLGA 4LTUA 2L83A 1AYFA 2XNSA 1NEKB 3MUFA 4NDZA 4DSNA 2A5DA 5BYKA 2QE7D 3MWKA 4I4LA 3REFA 1KSJA 1A5TA 4TYPA 4ZHOA 1FZQA 4BFYA 1QF9A 4TQUS 2RGDA 2VSOA 3DZDA 2AD5A 3IBGA 1E79A 2F43B 3GJ3A 4FN5A 1RW4A 2X77A 4LBWA 2EYUA 2PEZA 3OHMA 5DYGA 2BC9A 2XZPA 1UDXA 4OQLA 4Q03A 3QSYA 3NRZA 1T3HA 3S1AA 3FFBA 4B73A 1IN4A 4DEYA 1ZIOA 3NWJA 2FV8A 3HU3A 1SXJC 5E95A 4P4TA 1KGDA 4NCNA 2AHOA 4D4JA 2GESA 1V8CA 1XTJA 1ZP0B 1G18A 2PX3A 1W5SA 2J46A 4TMZA 5KSZA 2I1QA 1NVWQ 2ZVQX 1M7HA 1J7BA 1PLJA 4ZDWA 3PENA 2CBZA 2Z0MA 2ZRBA 5HTKA 4OL0A 4DCUA 2GCNA 421PA 1II9A 2ZJYA 4BLOA 4Q4JB 1AN0A 1U8YA 5FPHA 1XLQA 1U99A 2FSFA 4PHFA 2TMKA 1OFTA 1DE0A 2FX3A 1QT9A 2CL7X 1G8FA 4RCZA 3RRNA 1DBSA 5C1BA 5IK2D 2DB3A 3DEFA 2ZI9A 1OIWA 3FMFA 3T1VA 5A0FA 2RGNA 2FA9A 4HB0A 1DO0A 5IT5A 2GZHA 5DISB 2GZDA 1T8TA 1KI1A 1WMSA 4JLPA 3OESA 1Q44A 4PO9A 1F2UA 3TMKA 3ZVLA 1CS4C 1JI0A 2BEKA 2JA1A 4JLJA 1E3MA 4WQMA 4XTCS 4M21A 2GTPA 4AK9A 3I72A 2VQSA 1QHHB 2WOJA 3OEED 5DI9A 4Q66C 2VYFA 4LJ7A 2CVHA 4MGYR 2P6NA 2WSMA 2JDID 2WWHA 3MAAC 4FMDB 1QDEA 1AS3A 1X6VA 1YHNA 3IIKA 4IKEA 1G7RA 5EUQB 5JJKA 4FXPA 1XXHB 1QZXA 2IYWA 4IHQA 2F1JA 2F1RA 4NYMQ 3PCRB 4RFSB 1LF0A 4WW0A 2BVNA 2VP2A 4QM6A 4B74A 3SJCA 5G40A 1G17A 1XLOA 3VR9B 4IOJA 3A58B 2BBTA 1FIQA 1FUKA 4O2RA 1WBBA 3VR2A 1NL3A 2OCAA 3P4YA 2C77A 4C9BA 2XB4A 2NO1A 3SI7A 3Q5EA 4LDJA 2H1LA 1ESMA 3U7HB 4JVLA 1Z08A 1N5KA 4DDTA 4JT4A 1XPUA 1KI2A 2ANBA 5JRJA 1ZW6A 4LI0A 4PAMA 4IOKA 1N6NA 3B78A 1KI6A 5FPYA 3SU8A 1KFYB 5GJBA 1ZD8A 2FEOA 4TTRA 1FP6A 2G83A 1FO4A 1MR3F 3GLHB 2A78A 2ZRCA 4IOLA 3OE7A 4V0LA 1SKYB 1A1VA 4Q02A 4YMTA 2ONJA 1E2HA 3CH4B 2KBFA 4JLAA 1XFAA 1LFDB 1E2NA 1D2NA 3AEZA 5KYKA 2C04A 2J87A 1KYIA 3MRSA 3AV8A 1OJLA 4MRNA 2MMGA 1S1CA 3PUZA 3DPUA 1ZRHA 2ZRMA 1KDTA 4KYUA 3AM9A 2W54A 1RM6C 2WWIA 3AP2A 3IPXA 1E6CA 4AKHA 5TARA 1Z29A 3T34A 5M04A 3LBHA 3GLIE 5CDFE 3IEVA 2WKRA 3QIAA 2FMXA 4NL4H 4QHTA 1ZD9A 3AMZA 3X1ZA 2XXAB 2OE2A 1XB2A 2WMOB 3THXA 3P26A 2HCJB 1K6MA 5E7JA 1TUIA 1G3RA 5J5CA 4DVGA 2YVUA 1DOYA 3GQBA 1CULC 3MWJA 4XVRA 1GM5A 1XD8A 2YZ2A 2L52A 4MUAA 4RKEA 1LY1A 1NLZA 3VRBB 2D4HA 1SQ5A 3C7KA 5HCIA 1N5JA 4LJ4A 4EFLA 1NBME 3TAUA 4Q4HB 3ZGXA 3ECCA 4EQ6B 2YOGA 3O8RA 1CR0A 1IN8A 2FSGA 2GETA 3F8TA 1QBKC 3MG9A 1XPOA 3VR8B 2QZ4A 1D2EA 1JJVA 1GAQB 1QVAA 4PXAA 1NVXQ 2FFBA 1EFHA 1RJ9B 1SVOA 5AJXA 4YONB 5AR1A 3SR6A 4ZHPA 3MD0A 3RS2A 3AVUA 1XJCA 4PX9A 1OW3B 4OQMA 3GLFA 3Q72A 4QM7A 4EDHA 1HQYE 2IYUA 5FTJA 4HB3A 1IXZA 3JZAA 1L5PA 3QJYA 5SZIA 2AKYA 1JR3A 4Q00A 4D25A 2R6CA 3IO3A 4TYQA 1EFRA 2R8RA 3TUJC 4Q5IA 5FUVA 2DYKA 3UKDA 1KI7A
chains in the Genus database with same CATH superfamily
1Q3KA 1P7DA 1NHGA 2IQIA 4KMOB 4UNPA 3L4SO 4H3KB 1U9IA 3E9DA 1WP9A 5KVCA 3KV3O 4QJIA 2VP0A 1NP7A 1N2EA 4C80A 1R9GA 4UB5A 4UNQA 1U4AA 3L04A 3W5VA 4JXZA 1L7YA 2GN2A 5ETJA 2P1DA 5DT9A 3QXJA 3SAJA 2G7MC 3JPWA 4ZT6A 2CMFA 1QYXA 2V5AA 1XR3A 3B85A 3L4BC 3WO0A 5C53B 2O14A 1RXYA 4XYEA 1QZ3A 5KWEA 4G9GA 3MR3A 4KLMA 4JJ7A 1QZUA 3ZHRA 4U0KA 3FAHA 3M9MB 1SNYA 4IIEA 2BUBA 4QOGA 4OM7A 1R8JA 4A2CA 1F2UB 1T5TA 4U2EA 3S2SA 1VL6A 3FMIA 1RRGA 4ZCSA 3AKDA 3UCFA 2H48A 2RGUA 3CUTA 2WZDA 5FOXA 2WHQA 1YZGA 2GYUA 4CV0A 5EE5B 4HWRA 4Y6OA 4YREA 3SK0A 3A1CA 3VTFA 4LSWA 1WZUA 1EG7A 1C3VA 2DUMA 1RWQA 5KPJA 1UUPA 2VO1A 2OGZA 1L6IA 1E79D 5FH9A 4QZ8A 2BP7A 1ZGUB 3I04A 3SXUB 2E8MA 1DBRA 2WLBA 4URUR 1CZOA 4EEZA 1YU6A 1BE6A 1SMKA 2RH8A 2WILA 4Y9RA 4O3RA 2YMPA 5UKDA 2FB9A 1VHWA 4A90A 3QG1A 2ZI3A 1L3IA 4FT2A 2ZUFA 1E2UA 1W9MA 2P40A 1KJTA 2UZ4A 2KHQA 3I2FA 4ZAZA 1KVSA 1SULA 1XEXA 2JFYA 4J43A 4HGQA 4ND8A 4ZK2A 3AJRA 3GFVA 1VKJA 4F5PA 1DGJA 1MG8A 1XOIA 2J6IA 5B36A 5LWQA 4ARIA 1WMHA 1F9JA 2G3QB 4NCAA 3BB3A 3I58A 4D0GA 5FBZA 5T4HA 2KLGA 5KYUB 4DUYB 2MQJA 3K9PB 3PRMB 1JI3A 2ZRKA 2YY6A 4F5OA 1NMZA 2PEAA 3SR0A 2XK5A 3EPIA 4DV5B 4FADA 4X45A 3JVZX 3HXOA 3A2LA 1S0OA 4A0HA 2XY5A 1Z2EA 2D0OB 1T1SA 3T9AA 1I4WA 3A9SA 2MUTA 4NYJR 4AKGA 3VOBA 3KFLA 3QU5A 3TOSA 5G41A 4Y2HA 5IU6A 2PA3A 5JJCA 4PH5A 3U61B 3LW8A 2WQ7A 1MX3A 4ZREA 1WBJB 1Q74A 4WGFA 1ZNYA 2ASDA 3RAPR 2HBLA 1N3IA 2HVHA 5J59A 5H4HA 1KO7A 2GRJA 3OD1A 4L28A 4XX1A 4OQYA 1WCYA 2O7SA 1V2HE 1Z18A 3UPDA 3LVQE 5LQMA 2XQFA 4R83A 2V5VA 2QN1A 1CRQA 1VZ3A 1S2DA 3O2NA 5EIOA 4G26A 3R3VA 4QOSA 2HQSA 1V9SA 3IP7A 2KWUB 3AR5A 4YALA 1L4FA 4NCKA 5KT7A 1EMDA 3UA4A 3N87A 3THWA 1Z0DA 4RY8A 4IJVA 1MEJA 4GKVA 4U6PA 3IIIA 1M2OB 1RRCA 5ITZA 3JRNA 4QOIA 3N58A 1KS9A 3L6OO 1KZ4A 1X7GA 4HR7A 3QWAA 4F9TA 2FPRA 1HZJA 1F60A 3AXTA 3VZDA 3AVYA 3Q40A 3GEIA 1UA1A 1FDTA 1M2VB 4P92A 1LDNA 2XWSA 3RAXA 2KSOA 3A4MA 1J2UA 4EG5A 2JK0A 2A2ZA 3OPYI 3A6DA 3CKYA 1KK3A 4JX1C 5B1IA 3FUTA 5DTJA 1IZYA 4DQPA 3V7JA 4OXRA 4REQA 4C7YA 3ND8A 2J3KA 3WI7A 3D8HA 4GWGA 4I6GA 1L4DB 3UK6A 4DLGA 1G6HA 2RCYA 1OGWA 1N4DA 2LIVA 2MHJA 2ISOA 3P4XA 4UKDA 5KPDA 3W1SA 5JO0A 2O4CA 1CQJA 2OBLA 4O5AA 5LP6B 4F2HA 3CW8X 3KETA 4RCOA 1QX3A 3FNRA 3MVEA 3TNDA 3VO8A 5CJ2A 2VBFA 3EGVA 1VDMA 3DTVB 5BN5A 1C7ZA 4YY3B 1JIIA 2IBMA 4FOLA 3NFYA 4IUDS 3PHBE 4X1IB 5IVDA 5J8YA 1H69A 2NQ2C 1FFBA 2JVKA 2QZZA 2R61A 1X80A 1Z5VA 1Z6ZA 2F76X 2J3DA 1ZN8A 1FS5A 2QM3A 1KBUA 3WIDA 4LCJA 3HM3A 4HJKA 3SNHA 5LYJB 2CS4A 2KHVA 3PE4A 3P9SA 4R1PA 4KXYA 2LHEA 3DEEA 5FLEX 3O3NB 1NBMA 1DCMA 2B4RO 3NBMA 5AW8A 2O8FB 3A9VA 4C3ZA 5FOQA 1RE0A 1PZXA 2Q99A 4YLYA 3MTEA 2CXTA 3OH8A 1YZVA 3Q9LA 1ZK3A 1NW8A 4QAQA 3DZIA 4I2AA 3ZY4A 1JUDA 4JROA 2J9ZB 3GJ4A 5EQTA 1RXCA 3L7AA 3PY8A 1AK1A 2K6DB 3MJ5A 3O03A 2FRDC 2WNMA 1DP4A 3BXEA 1SCQA 3L8YA 3LY9A 1SL0A 5J40A 4MEMA 4M8MA 4MI3A 4KDEA 4GUAA 2INDC 2V3VA 2W2NA 5KVVA 1G6KA 4KZKA 3BZWA 3GZNI 3Q2KA 1OB5A 3CG0A 1N78A 1X8XA 2FW1A 4OKNA 4H9GA 3WWEA 3RJGA 1D5CA 2IY7A 1AO3A 1KTKA 4O5CA 1J33A 1NZFA 3EXAA 1NOMA 3AX6A 4P4SB 2R8KA 3KX2A 4QT4A 2O59A 2J5BA 3ROEA 1BTOA 2V4IB 2PUEA 3WL5A 5E0KB 3BRWD 3LF1A 1E1CA 5A0TA 2P5UA 5CH5A 4JB3A 2FZ5A 4JQSA 2QZPA 2KKPA 5L1MA 1D6MA 3ODPA 4M9QA 3DLHA 1TZMA 3PSHA 2BQUA 2V55B 3E7FA 4DWFA 4TKNA 3GLRA 5HFJA 1RPJA 2WB2A 4NZOA 2GKOA 4M7WA 1YD7A 1Z0ZA 3L41A 3LM8A 3U1VA 1ZHFA 4LY6A 5EIEA 3HBLA 2RGFA 3F5AA 1XU4A 2X1HA 1NC3A 2G09A 4HLEA 3AUJB 3OZTA 1HPLA 2Z58A 2HTHA 1Z2CA 3UO8B 2DKOA 2QPTA 1A5RA 3OJ0A 3SFZA 3A10A 5FPTA 2EXXA 3CNLA 4NNOA 2E5LB 2FKNA 5SY6A 2GQ0A 4QUDA 2BMFA 5L9AA 3U3JA 2R9VA 2G5PA 1V5GA 5K3OA 2OD7A 2QGNA 5KFGA 1V6SA 1FYDA 4HWPA 1TE2A 2N1RA 3TO5A 4LLGM 4FOTA 5JH5C 4KCGA 1Z4IA 4I2EA 2XGJA 2GSDA 4DADA 3LP5A 4ND3A 4XUDA 4EBFA 2AK2A 2VNSA 3WFJA 1LGYA 3PQ4A 4H6PA 5KVSA 2OPHA 2GVNA 4KGRA 3LDFA 4BNYA 1PEKE 4GMHA 4H7JA 1AN8A 1TKDA 2JI8A 1N6HA 3VR1A 2EW2A 3WFIA 3GVPA 1HORA 3VR4H 3UB4A 1QOAA 1C30A 4RS3A 4C01A 4ED7A 2IY8A 4IXTA 1Z38A 3ZC3A 4U7PB 2AI3A 2QLLA 2DQ4A 3TI0A 4E0DA 4GSKA 1QVRA 5E1BA 3IKTA 2REXB 1H1DA 4HO1X 4K9RA 2NPTB 1IG3A 2FFHA 4LMAA 2C5SA 3B52X 4QG7A 3SSOA 1GPAA 3FWPA 4BUCA 1DIBA 4B5LA 2BHRA 1B2RA 4KX5A 2BPGA 1DC8A 1EP9A 2V9CA 5L45A 5FOSA 3V05A 2WHIA 1AZLA 4TV9A 3AEKB 3DLAA 3RIHA 2XO7A 4EGJA 1JDPA 5EMHA 1L8AA 3VMMA 3QLVA 4YCLA 3CIRB 1NNEA 4IFBA 1S6YA 3ZN2A 221PA 3REGA 1Q1AA 5DG7A 2NUPA 1GNVA 3QPBA 5A03A 1ULSA 3KUKA 4C76A 3D59A 2I1JA 2MBEA 2ZXEA 1FDUA 2I8AA 2O5CA 2O2HA 1PZEA 3DKKA 2Q0XA 3JY6A 3BS5B 2QB5A 4J9QA 3KE8A 4WIPA 3OU7A 1N6LA 2QE6A 1TAMA 1YU9A 3ONVA 1CQIB 2AJDA 3PI6A 1UKAA 1ORWA 2HCTA 1HX7A 1JXQA 1IHOA 2CNDA 1JMSA 2WXOA 4KLNA 1WWUA 4X92A 2HBRA 3M6ZA 1A8UA 3ODGA 4HVLA 3DBRA 1NJXA 1A71A 1DCFA 2GRIA 4KTQA 1KRWA 1BG6A 2C2WA 1JF8A 1DRGA 1L4LA 4J9NA 3RFUA 4IDQA 3CZ5A 3VV2A 4RJIA 3ENVA 3PDIA 3N74A 4MAAA 3HKZF 3M7DA 2OXFA 3ZHOA 5LZ7A 2WAMA 4EB6B 2I4TA 1F6BA 4L2IA 4PS7A 3R2IA 1FMJA 2QTNA 1V48A 1RKBA 4L0QA 2ASVA 4MEBA 3CNQS 1XCQL 1E2LA 4ND5A 3TANA 2O0JA 5B58C 2F3QA 4EY6A 1DWQA 4PE5B 3NTUA 2W3SA 4YCNA 2P7HA 3O4IA 1YR1A 4DLNA 1KH0A 2VSQA 3NONA 2RGWA 4DM4A 3ZW9A 2JFBA 4TUUA 3ZVRA 1Z34A 1UPFA 2ZRIA 3DHGC 3OCWA 2V1YA 3E2EA 2CMHA 3EVBA 3P27A 4N40A 5BUZA 1U6IA 3NC1C 1U2GC 3TNYA 1MFZA 4IQ0A 3PT2B 1ILEA 4ZH4A 1CS0B 1DBWA 4PYIA 4X3CA 1XQ6A 1LBTA 3CRVA 4BBAA 3IBTA 3QKIA 1SKUA 2I3ZA 1V97A 5JAMA 3IDAA 4KWEA 2PFQA 1ZOSA 3HVUA 3OAAA 1WUHS 4V39A 3ZJ5A 4C8KA 1VSQA 2XD9A 3FYTA 2ZDQA 1JXLA 5CGQB 2L82A 3EG9A 1F0ZA 1G59A 3DEAA 1V5IA 2PXHA 1VTKA 2ZJ1A 3NALA 5LN1A 4TYNA 4L1BA 4MS3B 2TSYB 4IICA 1T94A 3KG2A 3IA7A 2GJ8A 1C50A 5KFPA 1AKRA 5MPOA 4LS3A 1YJ5A 4KWTA 4ECYA 3NTLA 3T7KA 4P0PB 3FIJA 1MFWA 4OGGA 1M5TA 1N5IA 4ZANA 2WBLC 1ORVA 4MB0A 1JXOA 1T8RA 3BTSA 1D7OA 2X8JB 4A2QA 1YJCA 4MQUA 2C4WA 3H6KA 1CEXA 3GEHA 1AV6A 4GMDA 2IWRA 5F76A 3HU1A 4FC7A 1U28A 4IDNA 5K09A 5G0UA 3BFJA 2H9IA 1QHNA 2Q1UA 2KNBA 3SKYA 2VYND 1NVTA 3OMXA 1CEYA 3WGUA 5GONF 3WGTA 2IHYA 4J0EA 4BMCA 4DBLE 3K94A 3ETNA 1UWMA 3QM1A 4HYTA 3FJ1A 3LUCA 3PQ6A 3FYDA 4IGIA 4OBBA 1NF9A 1H5UA 3L0BA 4DRXA 5JHGB 4LNUB 2XT6A 3UI3A 3K3PA 5KTTA 2YZKA 5IYZA 1Z26A 5AZFA 1MIOB 1XF1A 3I8XA 4HNAB 5I7EA 4UEOA 1YZ3A 1YRAA 1JGTA 4B0MA 3KRTA 2O2DA 3G0GA 4EJFA 3H5VA 3PGJA 3S2YA 3ZUNA 2P8SA 1YZHA 2QAJA 3U4QA 3NV9A 1PGBA 4UTOA 1HFEL 3A2MA 3X2EA 5ICGA 3ABVB 1P0MA 5G5HA 5I4KA 4BLRA 4ZGBA 5T8IA 5K0NA 2CE2X 2B1JA 3ZNZB 1X0XA 1ZK1A 4QNMA 1E7YA 3HBFA 5EMJA 3TXYA 1A82A 1IK6A 3W1SC 1DBIA 4P4PA 2K6GA 2F1HA 1YDHA 2GBIA 2JBHA 3TSSA 3P9NA 3UMJA 3H83A 3EFOA 1NOJA 1P7CA 3ZEIA 2QRVA 1PR9A 1ZQOA 1LK5A 3GJ6A 2CJOA 3G68A 4KIKB 3LWNA 5B2FA 4N5NA 7ICHA 3B9JA 5J8YC 3IGFA 3GDOA 5FT9A 5EE3A 3M5PA 4JLKA 1UMCB 2EF0A 3E5NA 3SG0A 2F64A 2FVXA 4QPDA 3ZNOA 5J2UF 2OENG 3AE3B 5EJMA 2J48A 3RSCA 3Q8RB 1JALA 5T3YA 5LZ5A 1EU4A 3RIEA 4WNAB 4RTPA 3U13A 3ZLUA 2JZNA 2VZLA 2IT1A 2W8BB 4EX7A 3DFUA 2FSHA 4LOIA 3X1WA 1JLRA 3LCUA 4JLVA 5HGXA 2WVAA 1BUIC 3W5UB 3MS7A 5KG1A 1QIIA 4PGAA 2GVZC 3AIOA 5KWIA 1HH4A 3QFSA 4RQ7A 1FTGA 2D8AA 3VU9B 3L05A 5BORA 1YD8U 1WIWA 3SBEA 3O13A 4G4JA 2GPTA 3G82C 1QP7A 2IXEA 2DKZA 4AICA 2B76B 1QKJA 5B7NA 1C0EA 1I4GA 3QVGA 4X97A 2VP6A 4X66B 3N6XA 1YRQA 4OATA 3H97A 4B7CA 1BS2A 2JFZA 2V74B 1T4MA 1A70A 1PWYE 2JNWA 2RRDA 5AUIA 2ZW9A 1JFVA 1C4OA 1FFEA 5L83A 3KSBC 1MJGM 4ZO4A 3L7DA 1ZQVA 4JGBA 5J0RA 3EFUA 5CLJA 3AR9A 1EWTA 1RLMA 4LJYA 1SIUA 1N2BA 4DLKA 3M7IA 1ZQDA 2C00A 3C5CA 3EZ7A 3AEUB 4MX8A 1C4WA 3VOAA 1XTBA 1VZ2A 1KVRA 2E2WA 2CDAA 2CUKA 3AW9A 5BOSA 1XDGA 3U9LA 1I33A 4FI3C 4QX6A 4FR2A 4ZAWA 5KFXA 2BPCA 2WNIA 4GX5A 4R84A 1T2NA 8ICVA 1EFDN 4RQNA 2WHEA 3LUJA 5AK5A 1CLUA 1I6MA 1FUUA 3ZBPA 3E35A 1Z6AA 3KQHA 3IAEA 2IOHA 4JOQA 4AKIA 5HTOA 2XWBF 3ZY5A 5EZSA 2DGZA 4EYHB 4A6PA 1KEKA 3V7NA 1GTL1 2EX1A 5KHOC 3UY4A 2KNJA 4TPKA 4QLAA 1J24A 2YN0A 3D6AA 3PO4A 3GV7B 1LO5D 2FQYA 1C76A 4U7GA 3QJGA 4UB3A 3VSEA 1PR0A 3A0HU 1YE3A 4R8VA 3MJRA 3F6CA 2A1TR 1Z22A 4B6EA 3UG6A 1TY2A 2BS3B 3BDIA 1S3IA 1MQSA 5ARBA 1EG2A 3RUAA 1TM4E 1R5JA 1MHXA 3MWKA 3Q7SA 1A5TA 2ZTVA 4TYPA 4ZHOA 2OMKA 2ZJ0A 4OQLA 4Q03A 4GF5A 4IMIB 5KKCA 2SICE 4DXAB 2C7BA 3LUHA 3WKCA 5KG7A 2ZKIA 2QB1A 1HR0B 1F12A 4ECZA 2Q49A 4CFYA 4RV5A 3QWBA 3MJDA 2Y68A 3LY7A 2W2OA 1MN6A 5K0CA 2H1IA 2PY6A 3QEBZ 2R25B 2QZ9A 3ZWDA 4BO9A 2JA1A 3OCZA 3I72A 2XN9C 5EWFA 2F1JA 4PX3A 1YX5B 4X57B 2NUAA 4WBNF 3S40A 4G36A 3LZ6A 3BHMA 2Y27A 3E7DA 2W2LA 3CVVA 5J0SA 1WBBA 4DL2A 4B9VA 2JFWA 4IKPA 1E5LA 1XZKA 3IT1A 5GJBA 5AVJA 2DSTA 1MR3F 9ICPA 4IOLA 3I01M 2C2DA 3X23A 2GJ4A 3SQMA 1E18A 5DVZA 1IULA 3QLVC 4CN8A 1M0WA 5AI8A 3DPUA 2HHWA 5AOVA 5AM4A 2PWBA 2W54A 1OXBB 4PV7A 3HUEA 3RJFA 4CKYA 3BQ2A 5MFZA 4NL4H 4UATA 3RT1A 2XXAB 2BAGA 1I30A 1RIIA 1CULC 3M1YA 3T5CA 4DQOC 4FFPA 3AY3A 2IEDA 4M7PA 1WKVA 5D3ZA 4JLWA 2AS0A 2IYFA 4A8TA 3FBWA 4EFLA 5KYXA 3MTGA 3N8KA 5HKBA 2J31A 2YOGA 2XECA 2G4VA 2QZ4A 4AS1A 1GAQB 2GPYA 2WUVA 3HZOA 8MHTA 1SZJG 1J6UA 4C7BA 5AR1A 4NIMA 3O2SB 3NPAA 4LZPA 3DNMA 2BR4A 4GB9A 3Q3VA 3ERCA 3GT0A 5D01A 4W7HA 1EFRA 3M6XA 1EGVB 3TUJC 2PKWA 2FWJA 1XAJA 2YJGA 3EGXA 2ZU0C 4MGIR 3S70A 1IUNA 2GLSA 1E1LA 1Z13A 2YS7A 1Y98A 4IG4A 2WPDA 3EVEA 1J09A 3DZKA 1QHGA 2IODA 4F96A 2AHRA 2PJZA 3E5MA 2Y1WA 2G5IB 4O4IB 2QTFA 1JN0A 3AUTA 4IFIA 2C5EA 4TV8B 3UUGA 4RGQA 1RYZA 2IF2A 1HNNA 4DL7A 5SV2A 4RCYA 4OAPA 3BHNA 3RWOA 4S1NA 3UJ7A 1GL6A 1PK3A 3WADA 1YRWA 4IW0A 4K9DA 3RFAA 2Z6QA 2FPGB 1VYVA 4QNNA 2Y1CA 1AH2A 4DMRA 1ZUHA 2BYTA 2W3RA 1NBHA 1UKBA 5LKAA 1POWA 4N76A 4IEIA 3BMQB 2D1TA 3R41A 4WOCA 5DGDA 5FBRB 1U0GA 2BVCA 2HRBA 3BIID 3IJEB 3QMVA 1Z5NA 2KMMA 2RGXA 3TCKA 2BFFB 3ZTTA 1G42A 3H5AA 4IR9A 5K3CA 2WJIA 3VYVA 4ANVA 1JEDA 4UASA 2RPVA 3VU1A 4CRXA 4BE7B 2MINA 4O0LA 3HWWA 1T8SA 3RQSA 3W1YA 4YXJA 1KHHA 4JOCA 4Q48A 1NV9A 1NNLA 1KE1A 1VLHA 2HTEA 1ZQTA 3WJ2A 1VG8A 4N6GA 5KC9A 1F1JA 2C7GA 4J9UE 4LNIA 2XTAA 2JGDA 3KUCA 4JODA 3EIFA 4Q1DA 2PRJA 3X1MA 1WPGA 1G0NA 4Q7QA 1PBNA 4IWXA 2GYYA 4W9KA 4EG1A 5DB6A 4JAVC 1TVCA 3DL7A 4NOLA 4KV2A 1KOFA 1O6BA 4OJMX 4PGMA 4S0ZA 2YOHA 1LV8A 5EI5A 3VC1A 4BZZA 3UMRA 2VRCA 1G21B 2LJIA 3Q7TA 1Z7WA 2MP2A 4O3MA 4DS5A 1AMOA 5EIBD 1BFDA 3HGMA 2UVPB 3BTVA 1KA9H 4JK3A 4OQDA 3E9YA 2DQZA 1O7JA 2H2DA 3GOHA 4BJ6A 4LDNA 3TG2A 2W9BA 2XKKA 3V8EA 1FMLA 2NTYC 1LPPA 2AQ2B 4OP2A 5LDDC 1P6XA 4PRKA 5DHTA 5IBPA 3DCGA 4FXCA 2UXBB 1TKRA 3OQIA 4FEEA 4E03A 2JFXA 2PT5A 5LDHA 3K0AB 4QAJA 3Q8SB 2ZDGA 2NN3C 1KZ9A 5KREA 2XI9A 1QIGA 2Q3JA 2V7QA 3BE6A 2I4LA 2VDRB 2WM3A 3I9FA 4LF5B 1J2MA 2BB5A 4YAJA 2MA1A 1UT5A 4X8LA 3LQ2A 1M0SA 1Z82A 2PMBA 1SUBA 3TSAA 2ALJA 4FW8A 1YC2A 1Y3CE 3PWTA 3ZX4A 3DV2A 2NU7A 1EK0A 4JBLA 1T5BA 1YR8A 3F9RA 4UHCA 4GU5A 4MRVA 3KVOA 2ATXA 1RLTA 2YRWA 4R5HA 4D9GA 3I9KA 4DHJB 4JA0A 3DUFB 2XNCA 4WESA 4QWAA 1Q0TA 3TRJA 1EH5A 1D09A 3IQHX 1AZWA 5CRXA 3N2EA 4M1SA 1EJ6A 4XEHA 2EHJA 1XQXA 5DULA 1PG2A 4XGKA 2V3CC 3OJWA 3OQPA 3BXPA 1ZNZA 2NV2B 5JAZA 3L4BA 1CSEE 3AESB 1GNLA 4FN2A 2VNIA 2HNBA 4C5AA 2QVBA 3FGNA 2XSZA 3A37A 3V1KA 3PO5A 4TZTA 5DN9A 2UUBB 3H8WA 3GO4A 2HREA 1IN5A 5IRCD 3W05A 4FILA 3UWDA 1W49A 2NTEA 3ML9A 1I7NA 3RVNA 1ZETA 4ZCRA 2R85A 1E3JA 2WVGA 3NHFA 5KFCA 5KNDD 2RH9B 4KUGA 4MM3B 5EYPB 2JATA 3PDUA 4LNNA 2NADA 2KLCA 2JJ8A 1ND6A 4OXNA 2JSVX 3V6LA 4HX2A 2I62A 5CH3A 5CEFA 5JBQA 1TW3A 3EMBA 5C37A 3KT8A 4I19A 2WQ6A 4HEHA 3QQ8B 3JQ9A 1L4MA 2HEGA 2MCNB 5EEHA 4IWOA 4DILA 4HVBA 1K68A 1OLOA 1XWWA 3W6OA 1JW9D 4BKSD 4FSHA 1CUDA 2AW3A 1LRKA 2ZYGA 1YQEA 1BWQA 3CVYA 2GXSA 2WEKA 1R10A 4B6JA 3LT4A 2P0AA 3C5EA 3UVEA 1WZ3A 1IRXA 4BO1A 3E1KA 1Y56A 4OIFA 4BWJA 3GELA 3KFVA 3V8VA 2I66A 1WE7A 3UHAA 4J16C 2ES4A 1CDEA 1TLTA 4KGDA 4BXOA 3ABRB 2CHGA 3IVFA 1J1ZA 3U3DA 3W3AD 3OZRA 3I62A 3V8BA 1QOFA 1JAIA 3TZKA 3HJCA 2BLNA 3NORA 2R4QA 1N63A 4J75A 1CRZA 5KFHA 1MN8A 3K1JA 3K32A 1CNMA 1IZ9A 3VKHA 1KVQA 3U4DA 1R4MB 1VZ6A 3SFEB 2D7DA 2IYZA 1WX1A 1JIQA 3WRVA 2IYXA 4HEJA 1EU3A 4BN0A 4ZICA 1WHSB 4CM6A 5IVKA 4Z99A 3F7TA 2BFDB 2EMTA 2BISA 3R9XA 2NU6B 3R40A 1NI3A 4HV4A 1Y1LA 3TIGA 1UBUS 1ZOIA 3ZKJC 2P9BA 3WYEA 1XO3A 4NG5A 3ZIUA 3TZBA 4HWKA 1JLLA 5CBPB 2QVZX 2WU4A 3NZUA 2EZTA 4C4VA 4KPUB 3DDUA 4XWYA 3KR0A 4IGEA 5LMCA 2M0AA 3QWFA 4F50A 5CX1A 2RBGA 1KN5A 4US0R 3VGJA 1SIBE 3ZJTA 1DQRA 2IHKA 5KDLA 3HVZA 3MB5A 3RB8A 1NOKA 1TO6A 1O5TA 1TVKA 5HE9A 1ANKA 3N75A 2DENB 2JXTA 3AH7A 3M33A 4L5YA 4XCVA 4RVFA 2ZIXB 2W6CX 3FF4A 1ENOA 4ZYNA 4BOYA 1F1BA 3GNSA 4DL6A 3UXOA 1ZCJA 3OI7A 1W4BA 4CKBB 1ES9A 5JH7A 2EATA 1HETA 2H8GA 1MD9A 4MUNA 1RPNA 4EG0A 4K9LA 4UREA 2VTDA 3OLQA 3TEYA 3VJLA 5FUQA 1T8EA 2DZDA 4ZN6A 2RJOA 2O4UX 4CIAA 2DPYA 1ZQHA 1Z2PX 1ISIA 2F2TA 4FFMA 4EFOA 4YXWA 5FWYB 1MDFA 1N7HA 4AJJA 1H5NA 3NBYC 1ZD4A 1EVYA 1RBQA 1XJ0A 3IFSA 4B4KA 3QE3A 4QPCA 1DUVG 1I7SB 2DF4B 1TKEA 4KITB 5KTQA 4R1UA 1FNUA 1LFAA 4OCZA 5TQVA 3RN9C 4MZDA 1Q3HA 3LPMA 1LC0A 2Y1XA 3SF8B 1NPTO 1RFKA 1R3UA 2K0PA 4KFRA 1A5SB 5JSQA 4NPAA 1PNRA 1Z74A 1UH6A 4ON9A 4D3YA 1D2HA 4KXNA 4ZRJA 3OM9A 1H05A 4B79A 3H19A 4MO9A 5E6PA 5DIFA 1QLJA 2ZSEA 4DQLA 2KQSA 2F77X 1P73A 1NFQA 3L1UA 4CTJA 2I6TA 2QD3A 4HUJA 5TPWA 4U2GA 1Y4UA 4S2EA 4LZAA 1QTRA 1K5PA 3NT4A 4YRQA 2XW6A 5ALEA 1C8LA 4IDIA 3ZYYX 7MDHA 1QTMA 1KIFA 1II0A 5KIAA 5C0OE 2I3AA 3SXPA 2YVCA 3WDMA 4P4GA 3H1UA 3ZXVA 3JWPA 3TEMA 1BOFA 3M83A 3THOA 3BPSA 3AJ8A 3WMFA 2QZJA 5EFZA 5ISMA 5ECYA 2WUWE 3GVXA 5DLQC 3ONEA 5K3BA 2AWNA 1DIOB 2YH2A 4HAIA 5TY0A 5MHTA 1V80A 2Q3CA 1LSOA 4IRKA 1PR3A 3RSGA 4QAYA 3WB0A 5B1YA 1Y33E 4HCPB 3F4LA 1J0GA 4JMUA 2IX9A 3HKDA 4MS1B 2CY0A 2C88A 1H3NA 4OZAA 3VJMA 1I3LA 3U44A 1SK8A 2GXUA 2R8XA 2QRKA 1L2TA 4CU5A 3CLUC 3AUUA 2J0MA 1Y80A 2JT4B 3RVMA 4LKRA 2KMCA 3MDAA 4FGJA 3WKDA 3T7DA 2JI4A 1GPBA 4KLEA 1RZUA 4YP1A 3JW0X 1O96B 1TJ5A 4YMMA 1G1AA 2FRDA 4M4SA 3V1NA 1WA5A 2GRAA 4Z49A 4WFJA 5HHTA 1N0WA 2I2AA 5IJXA 3T3FA 2ZJ4A 4YAGA 2FLLA 4KN5A 2KFJA 2W2PA 1NNSA 2E4UA 1EZZA 5CMLA 1RBZA 4ZAFA 3JPYA 4K6HA 4YRDA 2OV8A 2G4SA 1FU8A 5JWOA 4C4SA 1DJPA 1K2WA 2DUJA 4J0JA 3UATA 5K2OA 1T43A 3D6FA 4I0WB 3C85A 4MUIA 1MABB 2EMSA 2QVYX 5CA0A 3EN0A 1R8XA 1ZP6A 4KJZA 4UDYX 4KO4S 2JQRB 2I8LA 3V46A 3WK9A 1H2FA 1SC4A 4MIYA 3RE1A 1WB9A 2LVQA 2ZPUA 4FLMA 4Z9AA 3EDMA 1H6AA 1XTRA 3QTLA 2XYRA 1E9BA 4PEVA 1RYDA 3W78A 1IOVA 3IQGX 5J5VA 4A0FA 5JR3A 3SAHA 1P5HA 2Q3DA 3U7FB 4UM9B 3B1YA 8ICZA 2AFIB 2ZB8A 1N9KA 2HHLA 1V3TA 4P3PA 1GKLA 2XQGA 1KR2A 4YMIA 3V9PA 4P58A 4QZGA 1RKQA 1QOPB 3D43A 1P19A 1ZWKA 2QMOA 2GO1A 3EBLA 2O6LA 2GX6A 5IAGA 2CLLB 3LT2A 3WK7A 3GL9A 3IV9A 2WX1A 4MIOA 5HG0A 2EQYA 4NQRA 4HUQB 2HRCA 4I14A 1PFVA 1T3SA 3TB6A 4LVUA 3F6YA 4LX0A 3MYRA 3U4MA 2JZCA 1C9FA 2II6A 2XIQA 3CRZA 4GIBA 1NLMA 3ZLVA 1D0IA 5EHGA 1FQKA 3AKYA 3KQ4A 4P53A 3N53A 2MAXA 2I6XA 4LJSA 1PD1A 5HF5A 2AWTA 4D44A 2OLJA 3BJRA 4WZAE 4DCTA 3AU2A 4WAUA 1FZTA 4Q15A 2VSFA 2PFKA 1DZIA 1MI0A 4CF4A 2A9JA 4F4XA 4RE5A 3AVQA 2ZIVA 3SEIA 2ZOSA 1GA6A 1IB6A 1G4UR 3UMSA 3LBAA 1F77A 5FUMA 3UHPA 1JT2A 4ZZIA 1UK9A 1NRXA 3R7AA 5KNBD 1O89A 3CPSA 3B3AA 4PYKA 1YS2X 4FINA 1R4ZA 3C74A 2NO0A 1LQBA 3ZDDA 4YT8A 3FVTA 3MC0B 1XZBA 3CN9A 3HA5A 1F2VA 2QTWB 4XM2A 2X22A 1GRCA 4LK3A 4WFKA 4KLOA 3C23A 1OGIA 3LOUA 3AQ4A 1CY8A 2QRPA 2IYOA 1R5OA 1YGYA 4R3UC 5ARDA 3ND7A 4TZ0A 5KOJB 1OXKB 4RHUA 3FTQA 4Z6EA 4LJLA 3GFTA 3G2QA 1GXSA 2GR9A 3TQOA 2B8EA 1XLNA 3LWDA 3K9WA 1UWKA 2ZAMA 3I9V6 3F6SA 3H65A 4RJKA 5F1PA 3L02A 3SSMA 2XUAA 2GPJA 2QDFA 1L9XA 1G41A 4IZIA 4TWBA 4DKJA 2R1UA 1FNNA 3T9CA 5K45A 2LGJA 4PBTA 1A0OA 4Q4LA 2Z7JA 4LHZA 1I4DD 5BVGB 3ENWA 1SCKA 2Q27A 1VCIA 3VR5D 1U8UA 2GK3A 4WPGA 3TLJA 2RIRA 1N5MA 4GLBA 1GQQA 4TKVB 4V0QA 2BSAA 1YT5A 5A06A 5B4TA 2I9KA 5F2OA 5K2MA 4DS3A 4FE7A 3RH0A 5IFKA 4B76A 3PLVA 3ZCRA 3MR6A 5CJJA 3DR3A 5KG6A 1V1PA 4XB1A 1DOXA 4MVJM 3TWOA 2J0UA 3AIKA 2G6BA 2OGUA 3JQ9C 4KH1A 2B4AA 1BMFD 2FE8A 4PIVA 2NGRA 2ZIWA 1TJEA 1RAGA 4XQEA 3K73O 2QL5A 3DOFA 1ZGAA 4K9KA 1E2EA 1ZNWA 2FN9A 1FYXA 2WWFA 2IH5A 5EE0A 3M6KA 3RASA 3DBOB 1W88A 5DNVA 1UBCA 3FNIA 3KKMA 1CK4A 4ZT7A 2MBHA 5LLSA 2C7NB 4RYLA 3PW4A 1WTAA 4Z2YA 3AE2B 3H7PA 4LHEA 2JGAA 3UXPA 1T0JB 2VTBB 1HNXB 5FPQA 4BFCA 2ALZA 2IUTA 1GT6A 3D7KA 2C99A 3ILVA 1U2GA 1DEKA 1RHRA 1P7VA 4GKBA 5JTTA 1JQBA 4DLZA 3QU2A 1TYGB 3DD5A 1GGHA 3EBPA 3B1FA 3AEXA 2VDUE 3NTQA 1ISHA 2VG8A 2F55A 3BJMA 1JYSA 3OE7D 2HRZA 2BGIA 3JSXA