5EE1A

Crystal structure of osychf1 at ph 7.85
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
373
structure length
363
Chain Sequence
RPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRHAGEGLGNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
total genus 115
structure length 363
sequence length 373
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee1A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee1A01
1IXRC 4HZIA 4M9SA 2Z83A 3CX7A 1VHTA 4KODA 1DAKA 3BFXA 1OHHA 3SFDB 4KX6B 2QY9A 2FEMA 2NGRA 4XVQA 5KPJA 3GMTA 4CEHB 4QFMA 2BV3A 1XEWX 5ANRB 1T8UA 3GLHB 3LNCA 4B3XA 1TQ4A 1VIYA 2REOA 2AXPA 2QU8A 1AYFA 1EWRA 3OAAD 3FGNA 4QG7A 5H8YE 3Q85A 1T3QA 1IJEA 4C0HA 1XP8A 3QXHA 4GL2A 1RRPA 1QOGA 3EWSA 2A2ZA 4Q02A 4OL0A 3AUYA 4IKEA 2W0SA 1ETUA 2PH1A 4O0MA 4UJ5A 3AEFB 2JATA 4POAA 1F48A 1ZP6A 4B3CA 3DWGC 5E7JA 4PQYA 4I81A 1XZQA 2DHRA 4LZZA 3DM9B 1GKIA 3ND9A 1G7SA 2IC5A 2DFKB 3FHOA 5UKDA 2IYZA 3T1QA 4F93B 3U7EB 1T3LA 1WDTA 3WRYC 4GBMA 4FWTA 2ZRJA 2DFLA 2Q3MA 4CDGA 5AJWA 3EC1A 2CDNA 2ZRAA 4F4JA 2M19A 2QPTA 2FF7A 4BFYA 2R6GA 4C0QC 3RAPR 2A9KA 1XEWY 2WJVA 1W36D 3WBJA 2ZSAA 2W6ID 3KJHA 1GL7A 1ZM2A 3IILA 1RJ9A 4M1OA 1MR3F 2WJYA 3LFUA 2C9OA 1N0UA 1UAAA 3AVQA 4OI2A 3K70C 2CXXA 2QTFA 3H1TA 3HPRA 1NKSA 1N0VC 1Z29A 2OXRA 2PT5A 3Q9LA 2R6AA 5CLLA 1E4YA 2GKSA 4W5WA 4B34A 1RJ9B 4P3YA 3GQBA 3P4RB 1F2UA 4GDFA 3KUCA 3R9XA 2UVQA 4EKDA 3DKPA 4HATA 2RGCA 4AY2A 2EU8A 1EGAA 4AG6A 4M4SA 3LV8A 4IW3B 4WZBE 5FR2A 4J0QA 1N5XA 4QGAA 4V0MA 5JFGA 2GAAA 5A4JA 1XTIA 2FFBA 2QAGB 4TN1A 4TLDA 3BAFA 5E4FA 4Q1AA 3ABVB 1EWQA 2YOHA 4DBLC 1CXZA 4E22A 1XFAA 4JT4A 2WMNB 2A30A 2CMKA 5JWHA 1H8EA 1JAIA 1GTVA 3AGQA 3GJ6A 1BYIA 3EA5A 4AG5A 2QMOA 3AE2B 4MYTA 3D31A 4DSTA 4EQ6A 1Z83A 1S9HA 2ZPTX 1XRJA 3LW7A 4JL5A 4GPTA 5AUNB 2H7VA 3OFND 1SXJB 2FH5B 2WJJA 3IGFA 2RCNA 4P4UA 3TUIC 1CJKC 2WJIA 5TARA 2P5TB 3U7FB 1R10A 2GWHA 5H8WA 3SBDA 2OHFA 2AFIE 2J5XA 1G16A 4PO1A 1ZD1A 3GLFB 1G7TA 2V7QA 4PPGA 4RVCA 4AK9A 1E2LA 4ZDJA 4ZV4A 1N5IA 2RGNA 2J7KA 3KKNA 2R6FA 4K8OA 2J41A 1T3SA 2PMDA 1U81A 3G0HA 5HE8A 5AUIA 4EPWA 2QTHA 3V4FA 1HT2E 1UWMA 3G5UA 1P73A 4K81B 3X1XA 1WCV1 1R0YA 3P63A 3W5UB 1RKBA 2ZUBA 4OQLA 4HB0A 2ZJBA 1EFTA 4H9GA 2WQYB 4F4IA 3W6OA 2WAXA 1Q44A 4C3ZA 3B5JA 4CZ2A 4XWAA 1IOZA 1XLPA 1G21E 2JLSA 3QBVA 1U94A 3W9CB 1X3SA 4PC3A 2ZRFA 2ZXUA 1VG1A 5CB8A 2JLYA 3P4XA 2NQ2C 2J0UA 5JS7A 2F43B 3AVOA 5H1YA 1OQQA 2QBYB 2WIAA 3H0KA 5G5HA 1YJ5A 4Q4HB 1EXMA 2ZSEA 4Q18A 4MKIA 2FGJA 1UM8A 2J45A 1F5NA 3EASA 4FXPA 1UBEA 5CB6A 2WAYA 1E9SA 4MKHA 3T34A 2L0XA 4B3DA 4MYUA 5ELXA 3D3QA 3BFKA 3AVYA 4B44A 1PLLA 2NMVA 4Q4JB 4HLUA 4XOIA 4QJ4A 1P2TA 5MPOA 1R6BX 3DM5A 2VP0A 3ICQB 2DWPA 4HYYA 1G8HA 4JSYA 1YR8A 3CZPA 1YR6A 3FOZA 3SBEA 1PZNA 4IOKA 3RC3A 4DZZA 4DVGA 4YXWA 1SVKA 2IYXA 2YYZA 5GADl 4A6XA 4WOPA 2IWHA 3A6PC 3RANA 3SJBA 2PLFA 1VCOA 2JCSA 3IBGA 3SQXA 2H57A 3IIMA 5E7IA 1SXJA 3MD0A 2GVZC 3HDTA 4B3GA 4G0NA 2IL1A 1GG2A 4RFVA 4V03A 5A5GA 5AJYA 1DAIA 5DISB 4FMCB 4EQ6B 4FWIB 3P4QB 4C7ZA 2QSYA 4CEIA 4CT4B 1KNXA 2MSCB 1AZSC 2R62A 4YSZB 3AEGB 2NO7A 4TL7A 3REGA 3RABA 1ZUHA 3ZYYX 3CF6R 4HAYA 4MKGA 1JNYA 4QHYA 4F38A 4LBZA 1B23P 4QC2A 1YZNA 4OI1A 3ZZTA 2PX0A 1HTWA 1W49A 1P3JA 1P9RA 3P1MA 1J90A 5KPDA 1OT3A 1ZD9A 4OBEA 3SDZA 5C18A 4QGGA 3BIID 3WP1B 5JCPA 3GJ7A 3A36A 1WB9A 1FIQA 1ZOYB 1IQPA 1U90A 3IHLA 3K0FB 1VDZA 2VHTA 1FFHA 1FP6A 3M6AA 3UG6A 4Q9LA 1JJ7A 2CLDX 1T91A 5FL7D 4QXAA 3EPLA 1MT0A 3EWAA 1FRRA 1WGKA 1XD8A 2ODNA 4OKSA 3TGPA 1VCIA 3LY5A 4OHWA 3CH4B 1UDWA 5CYPA 2ZAOA 2R8RA 3AKYA 2QMHA 3X1YA 1ZD8A 5AJZA 1Z2CA 5EQTA 2F6RA 2QTVB 3ADCA 4Q7LA 2JLQA 4XTRA 5J5CA 1CRPA 4JVMA 1RFLA 3GJ3A 1G4AE 2FU5C 1OB5A 2VQSA 2W6JA 4Q4JA 3BXZA 3W6PA 4ZOHC 2GDJA 4B74A 4EPXA 2QJLA 1YRBA 2DPXA 1SVOA 5KNCA 4FXCA 4TMVA 3RS3A 5KO2A 3UPUA 3SC3A 1YU9A 3TAHA 1HA3A 1IUEA 4AC9A 5L3QA 4QM7A 2GEUA 3ZVLA 3K0SA 1OE0A 4HAXA 4O2RA 2X77A 1ROEA 3Q5DA 4LX0A 5TV2A 2ZR7A 1TADA 2ZRNA 3VR2A 1WE2A 4RD3A 1DE0A 1UEJA 3AF3A 1G291 4KSBA 1JQ4A 1JJVA 1WXQA 2F7SA 1S1MA 1SKYE 3WMEA 1SKYB 1N6KA 3AF1A 1DGJA 2HXSA 2O8CA 3EX7C 4EDHA 1VCMA 3PUVA 3OE7D 2HV8A 1Z0DA 2WWGA 1TUEA 1GL6A 1WBDA 5JSZB 4ASUA 1FQKA 2EFDB 2EKIA 2AFHE 3WYFA 2V9PA 5EXPA 3BORA 1FRDA 2FZLA 2O8BB 2BEKA 1EFCA 1UKYA 2OILA 3QXJA 4Z8XA 4XWKA 1SVLA 2RGXA 3X1WA 4HAUA 3I92A 3IO3A 4Q01A 1AWDA 2C77A 2VSOA 3TQFA 1N5KA 3RSOA 4DSUA 2NZJA 3MJRA 1XJQA 5IHPA 3A1VA 4Q1FA 1Z0JA 1K5DA 2PMKA 5H68A 3HRDD 2FPMA 3AKDA 4PR0A 4RJLA 3U7HB 5IK2A 2D74A 1GL9B 4HAVA 3U3KA 1U0JA 4JWSC 2B6HA 4YXWD 2Q0HA 4BFUA 3QF4B 3K8YA 5FPSA 4TYNA 5AJVB 4LV6A 1CJEA 3MSXA 4OQNA 3SJZA 1TTTA 1FX0A 1BMFA 2ZYWX 1J7BA 3GLGA 2JLZA 2AXNA 3W5JA 1EFHA 1LS6A 4XVRA 4DSOA 4BZQA 4BECA 1OXSC 1E7PB 1T0JB 4C0BA 1II0A 4KLZA 4BFZA 5FOVA 2UZ3A 2ZJOA 1E2DA 1W0KA 2GF0A 3BFVA 4ZCIA 1KO5A 3VX3A 4WXPA 3RWMB 1ZUNB 2OFWA 4MYHA 3NBYC 3QXXA 1KKLA 2WTUA 1C4OA 2ZE6A 3CF2A 1KMQA 3DWMA 2ANBA 5DNYB 4PPFA 2CCJA 3L82B 5FFMA 4BFVA 4HUQA 4D82A 1TU3A 4PFSA 5AUKA 3B6EA 5LD2B 1E6EB 1N6PA 1ZXIA 5TXGA 4P33A 1OH6A 4DLSA 1CIPA 4DLRA 2YKGA 4TLCA 1KAGA 2VSFA 1KJWA 1XNJA 3LH5A 4E03A 3NDBB 1W36B 1US8B 4RFSA 3E5HA 4DT1A 3HU1A 2YOGA 4EFNA 4OQFA 5BN5A 4LWZA 1QOBA 1JAHA 5C2JB 2W54A 2IS4A 4Z1MD 4B75A 2QL6A 5JI3E 1Q1EA 3LRPA 1V8CA 2WS3B 1Z5ZA 3PCRB 2JJ2A 3PUWA 4LSGA 2HT1A 1D2EA 2HF8A 3A58B 5FUYA 1OIXA 1R8QA 2GK7A 2GJ9A 3N2IA 3UMSA 3THXB 4DB2A 1KSFX 3C41J 2BHRA 1PUTA 4JLOA 5FTMA 3L0OA 3B9JA 5LB4A 1ELOA 1YQTA 3KB1A 5B64A 1FW6A 4LJYA 3B2EA 3AVPA 1GOTA 1SVMA 2B8TA 5EXTA 2O8BA 5B30A 5KOYA 3U44B 2V6JA 2GJAA 5FPYA 4XSHA 5HE9A 1G1MA 2A7QA 1WP9A 3CPJB 3OEEA 4Q19A 3O8CA 2ACZB 4KFUA 4NCIA 621PA 4MDFA 4OHZA 1SHKA 2IYUA 3GLIB 3NRZA 3VR3A 3O8DA 4I1VA 3TSZA 2OZEA 2O0HA 3U4QB 5BW8A 4M1WA 3QKSA 2GEVA 5FOTA 4LJ5A 2FOLA 2ZUDA 1E2FA 3FMIA 3W6NA 1AQUA 1N3BA 2J7PD 4GT1A 2VYFA 2PIAA 3D6TB 4NHOA 1KI1A 3TBKA 1W46A 3CX8A 4MGIR 4NU0A 2H88B 4TMTA 3BWDD 4Q4AA 2RKOA 3K70B 4LTUA 3A37A 1ODFA 5L3QB 1P9NA 1H8ED 2ZREA 3TK1A 3NVAA 5BN3A 4IEEA 1E1QD 2G83A 3LVQE 4C7OB 1JPNA 1TF7A 1V43A 2G1EA 2J3EA 1QOFA 1Z22A 1GP2A 1T5IA 3MWYW 1E2PA 4BASA 3T35A 4DCSA 2VHCA 3M0EA 2VP6A 2WWHA 2ODEA 3UXMA 4LPSA 3OFNA 3L8ZA 1CJTC 4NCNA 1VG9B 3AF0A 2IF2A 1W4AA 2WWWA 1NVID 3EZ2A 2QGNA 4YLGA 2CHVA 1P2UA 5K8UA 4US1R 1VIAA 1IY2A 1TX4B 2VP4A 3CZQA 4TT3A 1D2MA 4B2IA 1SXJD 2CHGA 2QIEB 1U9IC 1NKTA 4KI0A 1XO3A 4DEYA 3SNHA 1UADA 4DIEA 3ICEA 5EXSA 4V0LA 5BWMA 2FNAA 2P65A 2VP5A 3MG9A 3PXGA 3UANA 1Z8FA 1A5TA 4B3FX 1II9A 1EESA 2GXAA 3RPFC 4Q9JA 3ZS8A 1OKKA 4GOKA 3BB3A 1L4YA 2GCNA 1NSTA 2NO1A 4N1AA 1KO4A 4BLTA 1ZIPA 1Q20A 2ZM5A 2XZOA 2ERXA 4FMCF 3U3RA 1UKVY 5EUQB 2Z43A 3CIOA 5DHAA 5TY0A 3W3ZB 3L4PA 1J8YF 4BZPA 2IW3A 2CLCX 4II7A 3K0AA 5B57C 3A8TA 1CR4A 1QVRA 1FNMA 2CE2X 4IDQA 4IOMA 1TJEA 4XSGA 5FOSA 3WMFA 5J4HA 4OQXA 4TTRA 3NVWA 2FEOA 2ZYTX 3DOFA 1CR0A 1E1RD 2ODWA 5GVSA 1KI9A 1VYTA 1XCGB 1MV5A 1TAGA 4LJ6A 4C2UA 1LNZA 1U0LA 2Z5FA 1I4TD 4JLDA 3FHTA 2QMUA 1ZAKA 1M7BA 3PFIA 2RGDA 2BMFA 2E87A 2WSMA 1BO6A 1W2HA 2JX5A 1AIPA 1WMSA 3LO5A 2OE2A 3U3JA 3HWSA 1UBCA 1DAHA 1NVVR 2KBFA 4IDPA 3ETLA 2HF9A 2IYYA 4URUR 1OPXA 2V6IA 4B48A 3VKHA 2LCFA 4JYCA 4RCZA 5JI2E 1W0JD 3WBKA 5IRCD 4BWYA 3RRZA 3SHWA 4QKQA 2CJOA 1N25A 3TUJC 2P2LA 2XTMA 1XEXB 2G1JA 1GILA 1FQJA 4M1SA 3BD9A 4ESHA 2ZE7A 3CWZA 2PL3A 3VHLB 3AMZA 121PA 4F4CA 2FN4A 2XTZA 1X86B 3F5FA 3TAUA 4W7SA 4X8OA 1DO2A 2RH5A 1DVRA 1MO6A 3RHFA 1Z3IX 2K5UA 4YT0B 2F9MA 3DMDA 1RFKA 1N61A 1LFDB 1W2GA 5FI0B 2OCYC 4TMWA 4CVNA 3U4QA 1NVUQ 4CT5A 3EUB2 3MGCA 2EFCB 3SJAA 3IQWA 1LS1A 3WMGA 1MO4A 1W4RA 3LDAA 4EUNA 1CRQA 1HURA 1KGDA 3S1AA 1MRNA 1RRFA 1KI8A 1X8JA 3U5ZB 4R98A 4KYIB 1LV7A 2WLBA 2J7PA 4DUGD 1H8HD 3FTQA 4G5QA 1DG3A 2GVDC 3ZYCA 5DO9A 4PX9A 4EFLA 2WDRB 3PENA 2RHDA 1VTKA 3CRVA 4BLOA 3FKSD 1FL9A 4G5GA 1P4SA 2YWHA 3K9LA 3A1UA 2HLDD 3WRXC 1I4LD 1GZSA 4QRHA 5CK5A 2WVJA 1TF2A 2GCOA 2QPAA 5FOWA 4HEJA 1J8MF 1OFTA 3ZLJA 2MSEB 4QGFA 3SYNA 2GJSA 4A4DA 2W3RA 2OG2A 1H65A 4IFBA 4C0KA 4TYYA 4QBFA 1E2JA 4U00A 4IVPA 4TLBA 1EK0A 1Z6AA 4DXAA 2QENA 4G1UC 4YSXB 4M22A 3QKRB 4UXHA 3HJNA 3QENA 4RY2A 1W4BA 4IVQA 4JSTA 4MH0R 1EX7A 4FN5A 3PEYA 4E09A 1OYYA 1YZGA 2RGAA 4LYFA 3ZVNA 4RSGA 2AL7A 1UPTA 2DCUA 4P31A 3THYB 2XOKA 3BRWD 2CNWA 4KHZA 4HB4A 3VMFA 2QBYA 4TZ6A 2WDQB 1AA9A 3BERA 3ECCA 3QJYA 3L0IB 4LYJA 1M1YE 1XMVA 2QE7D 3C16C 1XLQA 3QI2A 1ZNYA 1XEXA 3VRAB 1N5JA 1KDRA 2I3BA 1OXTA 1Q22A 1SGWA 2OUKA 5CIQA 2W2VA 1S9DA 5B58C 1AJEA 2J9RA 3GFOA 2XNDD 2QPOA 3GLIE 1BOFA 4HZUA 4AKEA 1XB2A 4P4SB 2GBLC 4PXAA 1WYGA 1HUQA 2DWOA 4Q7MB 2XXAA 1HH4A 1OJLA 4ARZA 3K9GA 2O8FB 2CJWB 4DLZA 2XB2A 4OI4A 4TYQA 4XD7A 2MH7A 4Q48A 1G7RA 1C9KA 1L4UA 1SVSA 2FFAA 3W8RA 4YXDB 2FE4A 4QHSA 1GIAA 3J81k 3FC4A 4GRAA 4OHVA 3KXLA 5J4KA 3F3YA 2VLIA 1QHNA 1U99A 5JZVA 3KDSE 1G20E 4KCGA 4BLSA 2GXUA 4IDOA 1II8A 2AKAB 5JJKA 3B2FA 3K0FA 3TLXA 2VHUA 4B76A 2PJRA 2ZSDA 4HLCA 4FMDB 1LTQA 3THOA 4L9SA 2ZJ5A 2RHMA 4NPHA 3IKJA 2HJGA 2X2FA 4ZDIA 3AEZA 4YC7A 2GILA 1XPOA 3F0TA 3T06B 3OEED 2MJEA 3FAHA 2ZSFA 3LXXA 3PIRA 4JLNA 3EPKA 3GEEA 5F3WB 2O0JA 2PBRA 1XTRA 3ND8A 1L6UA 3AN1A 1COWA 4BFSA 2L83A 1K5GA 2A78A 2IXGA 3A1TA 1JXMA 1UDXA 1K6MA 2D2FA 3A4NA 3VR8B 3AE1B 4NYJQ 4C9BA 1NP6A 1S0UA 3DHWC 4ERNA 4LBYA 4PZZA 3RLFA 3BB1A 2OBMA 2IX3A 2JGNA 4US2R 2EW1A 4UNQA 5JJLA 2IYVA 4MRSA 2MSDB 1NNEA 4JJKA 4WZAE 2VBCA 1UF9A 3TR0A 2CVHA 3QKTA 1ZUD2 1VCNA 2QUZA 2HXYA 2EVWX 2PX3A 3MCAA 2XXAB 2QRZA 5BXQC 1OHHD 3DVLA 1ZP0B 5CDFE 3ZQ6A 4EJSC 2VRWA 1GITA 2JJ1A 3BB4A 5AR1A 1NLYA 1N6NA 1L0VB 4G5SA 5EZ6B 4BLRA 5KNDA 3LQQA 1E79D 3AE4B 4M21A 3KB2A 3TR5A 3DZDA 5G53C 3FKSA 3KQUA 1SZPA 3KTAB 1DOXA 2ZJ8A 4PQRA 3SE0A 4ACAA 4QNMA 4LV5B 4RD2A 4KVAA 1E2EA 3SZRA 2PLRA 4Q4HA 2BBSA 2CK3D 3I8XA 4FCWA 4TL8A 1G3MA 2IUTA 5EUMA 3FMPB 1X8LA 4A36A 5CJ2A 1BS1A 3SYKA 4NDZA 5H70A 1XMJA 3SHFA 4L16A 2EQBA 2WPDD 1IJFA 4PSAA 5KSPA 3CH5A 2LWIA 1XTQA 3ASYA 1FM0D 4M8NE 5KSZA 1NSFA 1R5OA 2VO1A 5M04A 3AF2A 2O52A 2IF0A 1KOFA 4RFSB 2EYUA 3C5CA 3MWJA 1P62B 1AGPA 4Q9IA 4DLWA 1IN5A 1GNRA 1F2TB 1E1RA 1E0AA 1GAJA 2H89B 3DZ8A 5G41A 1RVDA 1OF1A 1XX6A 3GD7A 4EPYA 5FPHA 5F2EA 4ZIRA 3HP1A 4DCNA 4WAUA 3LX8A 3NIBA 4ILEA 4JLKA 3ASZA 1E4VA 4CW7A 1F0ZA 1BKDR 5FPTA 4BEBA 2AN9A 3UIEA 2JLVA 2IXFA 2Q6TA 1NIPA 2WWIA 1Z6XA 2PZGA 2GTPA 3M1IA 4IHQA 1W44A 1DADA 2XITA 2RGNC 2RMKA 3Q72A 5LPNA 2PT7A 3DDCA 1KO1A 1Q0UA 1SXJE 1M74A 4HUQB 4NMMA 4KSCA 3K70D 1E2HA 5CDFA 1KK1A 3R7WB 1YZQA 1N0WA 4DLYA 1HT1E 4KBFA 1WBBA 4ZHPA 1XF9A 2W6IA 1E69A 2R65A 2F1RA 2OBLA 4C0AC 1MO3A 2ZRLA 3I5XA 1UJ2A 4JLAA 4BRUA 4C80A 4JYBA 4X8HA 4NCJA 3ZZ0A 3BIFA 1NN1A 3DOEA 3ZGXA 4D0GA 4EPRA 2X1VA 3QPUA 2WBLC 1JXOA 1PFDA 4B73A 2QEQA 4QM6A 4MYCA 3U3MA 3NEJA 3QVUA 1W1WA 2YC4C 4CEJA 4G5RA 4QHTA 3CNNA 2NTYC 3LBHA 4IRUB 4QBIA 3CKLA 2CNWD 3I62A 1DG1G 1DTSA 1EG7A 1OIWA 3D8BA 2VPPA 2VEDA 3P32A 1IONA 1H8HA 1A1VA 4D25A 1KZGB 3R9IA 1L8QA 2X19A 4Q1BA 3KX2A 2GHIA 4YMTA 3KQNA 2GETA 2MMGA 4PAQA 2C78A 2JDIA 3WHLA 2ZRGA 1Z28A 2LKDA 4QJ3A 5C2TB 3DL0A 1DARA 1TNDA 5DSZA 3FE2A 2NG1A 2N0SB 1G41A 3KXKA 4QL3A 1AKYA 4PQFA 4LJ8A 4V0ME 2BS3B 2CCKA 3I8SA 4HLUC 3AE5B 2ZRHA 1P72A 5JEDA 3REFA 2KBEA 4V0KA 4D0NA 3LWNA 1XXHB 2W0MA 1VMAA 2V4ZA 2XGJA 4UNPA 1CJMA 1E79A 3QEJA 1N63A 3QXCA 2BJWA 5GXGB 1QG2A 2YV5A 4NH0A 4M1YA 5SZIA 2ZJYA 5AUOB 3NDPA 3TVTA 1G9XA 1E32A 4ZIRB 1GNPA 4WZ6A 1TU4A 1VPLA 1DPFA 4YTNB 3Q7QA 1CR2A 4RKFA 1V5WA 5EE9A 3PITA 1TEXA 421PA 1OLOA 2V54A 2ZRIA 1Q21A 2A5JA 3OIUA 4BE7B 4JKYA 5LB2A 1Z07A 2FA9A 1J99A 2BMDA 1Y3AA 2W6JD 2O8EA 1E2NA 1NN0A 1XDBA 2Q9CA 3SN6A 1NENB 3QF7A 2O8DB 4NYJR 4YMVA 5JBQA 1R7RA 2OAP1 2ZAMA 4KFSA 4LHYA 3MUFA 4O25A 4UXIA 2A5FA 4WW0A 1G3UA 3S1AB 2YVUA 5FTLA 1E99A 4HLQB 4BFWA 1KTVA 4Y0VA 1KZ7B 3OEHD 2XJ4A 2ZUCA 1KI4A 1FMJA 4P0TA 4HDQB 4Q00A 3CLVA 3QG1A 2VF8A 1G8PA 1E9EA 1LVGA 2QP4A 2GRJA 4FMBB 4ZO4A 4W5HA 1S4QA 4Q03A 3OHMA 4B47A 4A82A 5JS8A 3NEYA 4PANA 4TYPA 2W2XA 4GSYA 1WA5A 1UBGA 3CRMA 1FNNA 4F7WA 3VNUA 4NBSA 3NH9A 2A5GA 1V97A 3QKSB 3OE7A 4JBXA 4D2IA 2GF9A 3OESA 3ONWA 3U6BA 1NLFA 2W00A 2VP9A 2WU2B 5HTKA 2EWVA 2G0TA 1YZUA 2JASA 3NG1A 4U5XA 3L0PA 3CPHA 4YDHB 1E0ZA 3LB8C 3P4YA 4N3NA 4EAQA 5K8TA 1NY5A 2JJ1D 2QT1A 1VJKA 1MKYA 1IN4A 4LHXA 1QT9A 2JA1A 5FL7A 5CM8B 4D81A 1QG4A 2G1KA 1GRNA 4NKRA 1HEIA 1G3RA 2C9CA 2GAOA 2MMCA 2FGKA 2WP9B 4TMZA 3VR6A 2QSZA 2FMXA 1A82A 4Q21A 3QNUA 1KDTA 2H16A 2WWXA 4Q7JB 1E9CA 3IEUA 3SYLA 3OZXA 3MWLA 1OSNA 4JJZA 2BVNA 1OQRA 4MA4A 2PEZA 5KSYA 3QXSA 4WVFA 1QDEA 3BH7A 3LX5A 1TL7C 4LJ9A 2XX3A 521PA 2ZIAA 4R9UC 5J47A 1ZNWA 1G5RA 1VHLA 2WPDA 2D7CA 2GZAA 2R9VA 3LW8A 4DT1B 3FB4A 3ZVMA 2ASEA 4RZ2A 5L8VA 1VKJA 2BWJA 4LGMA 2W55A 3U2QA 4BUJA 4YONB 2ZS7A 2QAJA 3AEAB 4NCKA 1U8ZA 2IBMA 2WICA 5L3VA 3BBPA 4Q1DA 4C0LA 2QAGC 1HV8A 2B92A 1RYJA 4IDNA 4XTCS 1GNQA 2ZRMA 3N2EA 2CVFA 3IHWA 3H84A 1JEEA 3CBQA 3VFDA 5JEEA 4B43A 3K9NA 3UWKA 4M2LA 4JLVA 1P7CA 2ZSBA 3GJ0A 3T1TA 4AYWA 1PLKA 3MLEA 1OFFA 2HYDA 4TTPA 1JB1A 5KUTA 5DYGA 4USAA 4QBHA 3NH6A 1SVIA 3B60A 1YZTA 4XJXA 3VR1A 3W5IA 2J0QA 2XSZA 2BOVA 2IS6A 3AM9A 4URVR 2WZQA 4UNSA 2V3CC 3SFVA 5G40A 3QPWA 2AHOA 3CR8A 3AE3B 1NN5A 1BYUA 3VX4A 2JIZA 1AS2A 2CLSA 5HCIA 3ETRA 1BH2A 1JRPA 2IEYA 4M1MA 3CNOA 4I1OA 1EFRA 3IBYA 3NVZA 3TUZC 5DIFA 4L8GA 3MMPA 1GDDA 4B6FA 1OB2A 2FWRA 1XTKA 2QN6A 2HYIC 1ZJ6A 3E1SA 3TW4A 4N0DA 3C15C 2QA5A 3WNDA 4EPTA 1QHSA 1NL3A 2J87A 5IF9A 1WRIA 5L3RA 2CHQA 3EARA 4X8LA 3AF4A 5FPKA 1CBUA 1N2CE 2WDVB 3KZ1E 1W7AA 1U2RA 3H2YA 2IUUA 2BMJA 2KE5A 5FUXA 1I7HA 3Q3JB 1X1SA 2GZDA 1N6LA 2ZI6A 4TMKA 3TQCA 1GSIA 2C96A 5KSOA 2JLXA 4N6EB 2W2TA 1CKEA 3RWOA 1SULA 3K09C 2Z6VA 1HE8B 4GOXA 4HB2A 1KF6B 3KUDA 2W3SA 1G64A 2Z4RA 3LD9A 2BKUA 4Q66C 2IYWA 3FMOB 3V9PA 5KHOC 2IYTA 2C99A 1XPUA 3T61A 2ONKA 3ADKA 4KAXA 3WNCA 4RD6A 1OIVA 2NIPA 3Q7PA 1GFIA 2R6CA 1DBSA 5CLQA 3SFZA 1IN7A 4FCTA 1FZQA 5DYIA 4ABYA 1MH1A 2NZ8A 1MABB 4HSEA 4PHGA 1YE8A 4XWOA 4LPKA 4KLNA 3KJGA 5A0FA 1G17A 1RYFA 5E95A 4BFTA 3I61A 4C7OA 1KI6A 1IBRA 5G3YA 4ZCLA 1TEVA 2I1QA 2J0VA 1YVDA 3AB5A 5K8LA 2WSSD 3TIFA 2DY1A 1G6HA 4HDOB 3CX6A 1NG9A 4X8MA 3EG5A 3SI7A 1QVAA 4M9XA 2ZS8A 2ZQ5A 3QKUA 3P4SB 3PV0A 1XTSA 3C8UA 2REBA 2HT6A 1QHHA 2BCGY 2FSIA 4N0EA 2KMMA 2FV8A 2WIBA 5GJCA 3AE7B 3C7KA 1AK2A 2ERYA 1QHIA 3PUYA 1EFUA 1A2BA 2NO9A 3BC1A 4WBSA 4EPVA 3TNFA 2C03A 2XJ9A 3CRRA 2ZR0A 3QIAA 4ACBA 821PA 3B1XA 5HPYB 4URZR 1FFVA 1Z0IA 2AWNA 1B9RA 4OHYA 3LLMA 2RGBA 3HU2A 1P2VA 4OJKA 1X1RA 4Q1CA 2O0KA 3T1OA 3UATA 5JLJA 4DDWA 4DLVA 2NO0A 4MDEA 1U9IA 3FWYA 4B32A 2NPIA 4TYWA 4IFEA 2Z4SA 1R2QA 1DEKA 1AKEA 1B0UA 1G5PA 1KAOA 4TQAA 4A0FA 2ZITA 4DLXA 3HR8A 5KU1A 4PHFA 3B8HA 2WKRA 2EFGA 3KJEA 1GPXA 2O5VA 3NKVA 5JRZA 4O3MA 1QF9A 3UWOA 2JJ2D 3AVUA 5FBQB 1L6VA 2FJUA 2IS1A 4P6VF 3OIWA 2JQRB 5SZHB 1JQLB 5KDOA 3CM0A 1U98A 2N42A 3IIJA 1ZMXA 1P60A 3AKCA 4TQUS 3C5HA 3EPJA 5BYKA 4TZ0A 5BN4A 3B1YA 2CCGA 2OBNA 4GZLA 2J0SA 4AYXA 3Q8XB 3CR7A 2F9LA 1WF3A 1TQ6A 3DEFA 4ON9A 3CUEF 3UG7A 3RS7A 1KI2A 4QBGB 2GZHA 1M7HA 5K8IA 1P2SA 2YJTD 3AB3A 2OSBA 1ZM3A 3NVYA 2KB0A 1Z6TA 1HQCA 3OEHA 4KFRA 4AYTA 3QVVA 2P67A 5BQ5A 4A92A 1KJYA 1II8B 3U61B 2F1JA 4AKGA 1LF0A 3PEVA 4BLQA 2YHSA 1OH8A 2D3WA 5EP4A 2ORIA 4DKXA 2OAQ1 1U8YA 2OFOA 1JR3D 4TQ9A 3Q5EA 4C4PA 1IN6A 3P4PB 3SR6A 3EXAA 1XMIA 1P5ZB 2QROA 4GMDA 4BLPA 2AK3A 2NOAA 1E0JA 2XNSA 4TTQA 2DWQA 1ZM9A 2B8WA 2R6DA 2HDNB 2IYQA 3LA6A 3AM1A 1E6CA 1YJJA 3SS8A 4A8JB 2Q3FA 2G6BA 3O8RA 4DSNA 5SZKB 3WYGA 3AUXA 4KFTA 3A4LA 3MAAC 1L2TA 1VYUA 2ZVQX 2ZI9A 4FINA 2H5EA 2A5YB 2WJHA 2VP2A 4E07A 1ZU5A 2YWGA 3P26A 1IY0A 3AGPA 4FI3C 3AKEA 3RSLA 1YQ4B 2F3RA 1PJRA 4C7YA 3B85A 4OYHA 3I4LA 5EZ5A 2D62A 4B33A 5KNBA 1DAMA 1Y63A 4GFDA 1FUKA 2HLDA 3CRW1 1ZVQA 4B2LA 3TRFA 1L5PA 2ZYUX 2F3TA 4JS0A 1ESMA 2M56B 2AR7A 3EZ7A 2TMKA 1LF5A 2DBYA 3GFPA 3PVSA 2ZU6A 3N70A 1RRGA 3EZ6A 4MRRA 1OFHA 1M6NA 2HJVA 1N6IA 3CNLA 1GKYA 1XU4A 3ZS9A 4ZPXA 2WWFA 2G77B 2P6NA 4M9ZA 1JROA 3P27A 1XJ0A 1RE0A 1NRJB 2REXB 3FVQA 2WSSA 1YRAA 1YZKA 1Z0KA 1OFIA 1T3HA 2IA5A 4KV9A 3W8NA 1RRCA 2JLRA 4CYMA 1KY3A 2A3RA 2WHXA 1QHGA 3KQHA 3C4JA 4NYMR 1G18A 4FMDF 4UJ3A 1PDXA 4LJ4A 4CEJB 2E9SA 1N6RA 2ZI7A 3EIHA 4LRWA 4OHXA 2AWOA 4EFMA 2YINC 4QOSA 1KMHB 4WA7A 2LKCA 2FX3A 1IXZA 1E3MA 3VTKA 2V1XA 1UEIA 1OV4A 4UQOA 4L15A 1NVVQ 2W83A 4B35A 2QI9C 2G88A 1I2MA 1NJFA 2FFHA 5D3QA 5HR5A 2BBTA 1NG1A 4NE2A 1R7SA 3VKGA 4YMUA 1JALA 3K1JA 2BBOA 2C98A 2W58A 3OF5A 2XSZD 4DB4A 4ZKEA 4A15A 2PCLA 3A4MA 2QT0A 3EZFA 4I1UA 3CW2A 5JJIA 1SQ5A 4DDUA 4ITRC 4XIGS 4GOJA 1ZCBA 2PJZA 4N58A 4PPQA 3RS2A 3FDIA 4BPBA 2JIZD 3X1ZA 2BS4B 4JVNA 2P5SA 1JECA 1XBTA 1XCPA 1XTJA 3AH8A 5CM9C 2K9XA 1IN8A 2H18A 4GZMA 5FTNA 2IYSA 2V1UA 4BZXA 4D4LA 8OHMA 4LJAA 4F91B 4DEXA 4BFXA 2ATVA 3WNBA 1N5WA 1D5CA 4DDVA 3KFXA 4RZ3A 2Y5CA 4RD4A 4AWXA 1Z0AA 4Q7KA 1NN3A 2X8AA 3NHBA 3PEUA 5BYJA 1YKSA 3THWB 1JEDA 2BKEA 4LCBA 1NMZA 4I1SA 1JR3E 3RRNA 2GESA 1DS6A 1KJZA 1MABA 4IXMA 2F1IA 2BM0A 2KJQA 2IEZA 3PR1A 3ZIAD 1X8KA 2CEAA 1E9DA 3IQXA 2WV9A 3GCGA 5FTKA 1E9RA 2DFTA 4US8A 5JMTA 2XAUA 5L3SA 1E2GA 1P6XA 1IAQA 3QSYA 4TSFA 3QY0A 1CP2A 3FPAA 2EFEB 4BRWA 5D3MB 2BCJQ 3GEIA 3K9HA 1E9BA 1ZINA 4JLJA 3CRQA 4LUCA 3VU9B 5HZKA 2KSQA 3B1ZA 4DCVA 2CE7A 4L9WA 4I4LA 1CF4A 1RYHA 1XWIA 3JVUA 1F3OA 2XB4A 1PVOA 2QE7A 2J59A 3RC8A 1Q1ZA 1E0SA 1OYWA 2J46A 2ORWA 3LBIA 2CL0X 4JKIA 1NJGA 4KU4A 2YC2C 5EE0A 5DE3A 3VR5A 3U6KA 3NWJA 4UKDA 4D80A 3K0AB 4I99A 2IK8A 1IM2A 1K8RA 3HU3A 3FHCB 4IDHA 4ZHOA 4LHZA 2B76B 4M53A 4A0RA 2ECKA 1DOAA 2AKYA 1YR9A 2E3TA 1OH7A 2RGEA 4JVSB 4LJ7A 4PSVA 1G8GA 3IUYA 1SB3C 4YSYB 2JEOA 1WQ1R 3SFEB 1QLBB 4URYR 721PA 1E10A 4NONA 3BH6A 1J2JA 3VRBB 1XD9A 4MGZR 1NYQA 2ZRCA 3BOSA 2CL6X 4QGHA 5J4VA 5IDVA 3W90A 3VR4A 5DI3B 5LDDC 3AE8B 1ZIOA 1TUIA 4D26A 4C0JA 4NP6A 1ZM7A 2B21A 5C4GB 3A1SA 1KFYB 1XD2A 2ZS9A 4NL4H 2GXQA 1HE1C 1C1YA 3EW9A 4DLUA 4GI7A 2VSXA 4PZLA 3AV0B 5DN6A 4NZYA 3L2OB 2XEXA 2RGGA 1S3GA 4PHHA 3NVVA 3FMFA 3NC1C 5AUQA 3QEOA 2QAGA 4FW9A 2WM9B 1S1CA 5C3JB 2H8KA 3AEBB 3BH0A 1CS4C 3PQCA 3IDQA 4NTZA 2EWWA 4G01B 3GFTA 3GLFE 4MRNA 3KXIA 2I4IA 4B71A 1EWYC 4P32A 4A2QA 4JIMA 2Q9AA 2ZYVX 2IWRA 5JHGB 1E2MA 3U3OA 2OCAA 3VU9A 1Q12A 3ZVRA 1CULC 5FUVA 2A5DA 1Q1QA 3NC0C 1J7AA 2D4HA 4LYAA 2VHQA 2HEIA 1OH5A 4IDIA 2FDCA 2OM2A 3GJXC 2AX5A 1W48A 3O47A 4QNRA 5EP1A 4KYUA 2QQ0A 3RS4A 1A2KC 2ZRKA 4A0HA 4Z54A 3GPLA 4A2WA 4PHTA 4PC2A 2OEPA 1QRAA 3NBXX 4W5JA 4ASUD 1G4UR 3GLGE 2FZ4A 2KI5A 2IHBA 2WU5B 4DCUA 3F8TA 3CPEA 1HY3A 3HYTA 3JZMA 3I3SR 3GJ5A 4JBYA 2L52A 2GCOB 4IOLA 4TL9A 1ONBA 3ADBA 5F9FA 4D4KA 1CEEA 3AV8A 3DO6A 5EP3A 4ZCMA 1W5TA 4TL6A 1YR7A 1UFQA 3TJZA 3PO0A 1GRRA 5CYOA 4IEIA 2CBZA 2VF7A 4KVGA 1RPZA 3AEDB 3NHAA 5CIWA 3DMNA 1VYVA 2Z0MA 4ZI3A 1Z08A 1E9MA 3QQ5A 4WQMA 1KK2A 3TE6A 3PG5A 4WXRA 4XH9B 4AI6A 1RW4A 2P3SA 3P1JA 1NF3A 3NBFA 4G5OA 1QF6A 1AS3A 2P0EA 1FO4A 4KITB 1RM6C 1KRHA 2FPLA 1PUJA 1BMFD 3CWQA 4V02A 5GJVC 5AK0A 4DDTA 1S96A 2ZJAA 4MRPA 5CITA 2QNRA 3L43A 4HAWA 3TVDA 4C30A 2E1RA 4BQSA 4URXR 2C95A 4MKFA 5FBLB 1CJVC 1Z6GA 2JLUA 1J7KA 1W0KD 1W36C 2K22A 1TKYA 5DH9A 4LBWA 2BEJA 1KO8A 3EZ9A 4EJSA 1M8PA 3I72A 3PJRA 4F92B 4YMWA 1KSHA 2JDID 4LC0A 3WYAA 1R0XA 3KJIA 3W34A 3ZD7A 1YJIA 3ADDA 2PZFA 1Z47A 5DLQC 2CK3A 1R0WA 4IJMA 3EIEA 2FG5A 1ZNZA 1D9XA 1S3SA 1N6OA 4MITA 5J40A 1XLNA 4TLEA 2K5PA 1Q57A 2GJ8A 1E2QA 2NO6A 5FBWB 2WKPA 4OQMA 1J70A 1QOAA 1GAQB 2GK6A 2ONJA 1KSJA 3PUXA 1CJUC 2EYQA 3TW8B 4CEIB 4MGYR 4OK5A 3WHKA 2ODBA 3ZJYA 5HCNA 4BEJA 1ZW6A 1G3QA 3R8FA 4A8JC 3EC2A 1SKQA 2ZI4A 3EA0A 4QJ5A 1OXVA 4CGZA 3X1DA 4KJZA 1NMYA 3LXFA 3WXMA 3SQWA 1HQYE 1SHZA 1AS0A 1NMXA 1ANKA 4HUTA 2QM7A 2VTKA 1XXHA 3FFAA 2Q21A 4JLPA 4OK6A 3T1VA 2HCBA 4PC6A 1VLBA 1R5NA 1RWSA 1IXSB 2P6UA 1I4DD 3H86A 4JLBA 5DN6D 2ZVPX 2ANCA 5HKKA 3N5CA 3I32A 3SJCA 1P75A 3BGWA 1DAFA 4LHVA 2YNMA 2UZIR 3GLFA 2R2AA 2QM8A 2VL7A 4M0LA 3LLUA 4FIDA 3RVBA 2R44A 2ZU0C 2N46A 3B9QA 3HVZA 1JR6A 1AGRA 3KKQA 2C2HA 3E2IA 2HTME 1D8TA 4R7ZA 4FD2A 4OK3A 1UKZA 1BIFA 2C04A 2AD5A 2FSHA 4GMXA 4FCVA 1JPJA 1IHUA 2NPFA 1W5SA 1M2OB 1R5BA 4RZXA 1JWAD 4O2LA 1G19A 3CF0A 1TF5A 3TSWA 4S2EA 2BM1A 3GJ8A 1DO0A 2Y8EA 1ZNXA 2CJNA 2J0UB 4PAMA 1O87A 3HPQA 3RS5A 1NBME 4US0R 1KKMA 3AE6B 4UXJA 5AJXA 3PEWA 3KL4A 2IYLD 4HZUB 4LYHA 1E98A 1Z2AA 2GNOA 2PCJA 2V8OA 1U0HC 2ZEJA 4TLAA 3QG5A 4D0LB 1NYRA 1D9ZA 2FPKA 1TYGB 1CR1A 4HDCA 3ZIAA 4AIIA 4D4MA 5TDHA 4C0SA 3FKQA 4M9QA 1SXJC 1OXUA 3LQRA 6Q21A 5TMPA 4OI0A 1UBFA 4TSFD 3VR9B 1NBMA 1KYIA 2C5LA 1KIMA 3R20A 5GJWC 1KMHA 4DJTA 2OXCA 2OCPA 4PSKA 4B3BA 1SIJA 4M1KA 3RYTC 3SEAA 5L3SB 3ZZUA 5KDDA 4HROA 4LHWA 1NVWQ 1T8TA 5DGXA 1DOIA 3TKLA 4ZDWA 2H17A 2GCPA 2D2EA 3AQ4A 3AVXA 2VHJA 2ZI3A 3LBNA 1FFUA 1KK0A 3EIQA 5J4LA 3L0SA 1ZC4A 4PC7A 4MGKR 5F98A 2B7BA 3GLHA 5H92C 1ZM4A 1KHTA 5TVKA 1U8AA 4PTLA 2DFNA 4ZKDA 2ATXA 3BJIC 1NI3A 1EX6A 5EE1A 1XZPA 4IOJA 3IO5A 1ZU4A 1NIJA 4IVRA 2VH5R 4PZYA 5FOXA 4ARZB 2O8FA 1VDVA 1G3IA 1CTQA 2N1BA 4DC9A 3THXA 3CB4A 1RC8A 1R0ZA 2IUSA 4LBVA 4Z1MA 4KO8A 5EE3A 1A7JA 5IT5A 2P6RA 2FBWB 3THWA 1QHXA 2ZROA 3H4MA 1CU1A 1R4AA 1TMKA 1PV4A 2I1VB 4H1UA 4CEHA 5SZJA 1E2IA 1MRSA 1QHYA 1US8A 2VIIA 4M1TA 2X2EA 4K46A 2WWYA 2QZ4A 1MOZA 2BC9A 2IXEA 2YZ2A 1TQDA 2ZI5A 1M7GA 3MFYA 4MRVA 4CF7A 3OIYA 5IK2D 3THYA 3AVTA 3CIRB 1Q3TA 2BBWA 1FX0B 4HB3A 1UKEA 1ZRHA 1S2MA 1W0JA 2D7DA 4US9A 2XZPA 2MJ3A 1A70A 1XCMA 2F1HA 4Q4LA 1Q1BA 4B2PA 3ZQJA 3QE0A 4YTMB 1KI6B 2PVOD 3HUIA 1TQ2A 1KO7A 1N5LA 1FTSA 3GEHA 4LY6A 4OJQA 3FFBA 4EIWA 5FOUA 4DHEA 4UNNA 5CK4A 5HKKD 4WWMA 5TB5A 3X2SA 4RD1A 2AK2A 3DKVA 3CO5A 5C46F 4PAOA 5DHFA 4AURA 4R2IA 1J7CA 4C2TA 4AKHA 5FTJA 5E7MA 4DCTA 4A2PA 3T5DA 3W9YA 2F43A 3LAWA 4JL8A 1QBKC 1D2NA 5HZHA 3RNLA 1FTNA 5F9HA 1Q3HA 1PLJA 3O8BA 4IXNA 4JLMA 3T15A 3W3AA 3I73A 1T5LA 4P4TA 4JBWA 2OCBA 3P20A 3B7GA 3T5GA 3K09A 3TH5A 1R8SA 1N62A 2CU3A 3B82A 2RAPA 1Z63A 2OT3B 3OAAA 3G82C 1CZPA 5FBRB 5C4MA 3IEVA 4ITKA 1OFUX 3GJ4A 2OLKA 4LI0A 4R2HA 1DAEA 4Q47A 4URWR 4A1FA 4TT3D 1A4RA 1RIFA 1ZBDA 2SHKA 5JECA 5CJPA 4GP7A 1F2TA 2IS2A 5GJBA 4Q1EA 3SU8A 3KKOA 2V55B 1FMAD 2J1LA 1JQJC 2C8VA 4L5BA 4ZI2A 1VG0B 4NYIR 1KK3A 1T4GA 5JHHB 1KY2A 2FSGA 3IPYA 3GLHE 5DI3A 3ZH9B 4ESVA 5G3ZA 2MJDA 4LOAA 2DYKA 3BE4A 1LY1A 2QRNA 1OXXK 3VAAA 5FUWA 4H1VA 1FXAA 3B2GA 2WMOB 4EJSB 1ZCAA 4KBGA 1LB1B 3K0CC 3R7WA 2KAJA 2G0NA 3CWIA 2OFXA 2XOKD 3QPVA 4E5UA 3AP3A 4PPNA 1T0HB 4G3XA 2QGZA 3T12A 1LW7A 3QF4A 1NY6A 4HI0E 1ZYUA 2RB4A 2WOJA 3E70C 2F55A 1PUIA 3UKDA 5FH9A 3TMKA 3B78A 2OO7A 2G3YA 2XNDA 2ZJ2A 4LK2A 3AEEB 1S8FA 2BMEA 4Y0AA 1O3YA 1JI0A 3D7MA 1E1QA 2WKQA 4PC1A 1F60A 1E96A 4CRWB 2WJGA 1VECA 3C14C 1F2UB 2D06A 3KKMA 1FMLA 2FFQA 3U44A 5D3MA 1XMSA 2YOFA 2O8EB 3WCQA 2OV2A 1YQ3B 3AP1A 1ESNA 3IPXA 4RKEA 2CL7X 4YMSA 2ZTSA 1L7VC 4UNRA 2JJ8A 1M34E 2G9NA 1JW9D 2DR3A 4AKIA 2BDTA 1DOYA 1EFRD 1P61B 2BJVA 3MRSA 2ZRPA 1G8YA 3LVRE 1JBKA 3PUZA 4V0OA 2Q9BA 4L4UA 5EJEA 3SR0A 3AVWA 3AVVA 4DIDA 2O8CB 2AX4A 1AQYA 4TWZA 4ZDKA 3KFVA 3U60B 1TKGA 3WP0A 3HR7A 1W47A 3B9PA 1FP7A 2DB3A 2ZETA 1DAGA 3EPHA 1OKKD 1G6OA 1QHHB 3R8CA 4XVUA 1Z6YA 2OESA 1NVXQ 4RD0A 3VHXA 3VQTA 3V4RA 3RRMA 4Q5IA 4U02A 1GKUB 1E0KA 1G8FA 2B7CA 5B2ZA 1JR3A 2GEDA 4PO9A 4DUGA 3EAQA 1RZ3A 3K53A 4NCHA 1KNQA 4RZUA 1P9WA 3WY9A 3RRYA 2GBLA 1DELA 1Z0FA 3NBZC 4Q9HA 4HRSA 1AM4D 4WIAA 1KI3A 2GXSA 1G7CA 3HYRA 4YDSA 2O8DA 4HLDA 1E2KA 1X6VA 3UMRA 4A8JA 3MJHA 1E94E 2QMEA 1MO5A 2XTNA 5E3HA 2IHYA 3ZD6A 1G5TA 4NYMQ 4V0NA 4A0GA 4D6PA 5KDLA 4Z51A 5JCZA 1XXHE 4XD7D 3GLIA 5FI1B 2VA8A 2QP9X 1HYQA 1SF0A 1WRBA 3KWLA 2GA8A 3NXSA 4N59A 4LV8B 1AN0A 3AP2A 4GP6A 5EP2A 1FPMA 1NBMD 2ZE5A 1E9AA 2H92A 4AD8A 2V7QD 3GP8A 3MWKA 4Q9KA 5GVRA 1SVWA 3K0EA 4JMPA 4GNKA 4JZKA 2C9YA 2PVGC 2BS2B 4MUBA 5JRJA 5KYKA 3GLGB 4JL6A 3QOFA 3U7GA 2QP3A 2QG6A 2ZRBA 3AH7A 2XZLA 2YWEA 3BK7A 4A9AA 3IIKA 5LBIA 1KSGA 2PZEA 4JX1C 3SOPA 3UK6A 3VNVA 3NTUA 5G5GA 4CIDA 1FXIA 3TSOA 3ZDQA 2Q3HA 3QKRA 4YQFA 2Q5WD 3NS1A 4DRZA 4HAZA 1AZTA 3BS4A 3UMFA 5KTYA 5J4YA 1D6JA 2ZJZA 1N60A 2GJKA 2IYRA 2UKDA 4TMXA 2H1LA 3I1FA 2ZE8A 4Z8YA 1COWD 3KQLA 4BGDA 1TKEA 4R71A 3B1WA 2KWIA 3W5VB 1TPZA 4JVLA 1XPRA 3L8YA 1YZLA 3V00A 3FYHA 3R9WA 221PA 1FUUA 1KDPA 4A6PA 1NLZA 4D4JA 4DLTA 2QORA 5AWFC 2ZANA 1GWNA 5LD2C 1VG8A 1QZXA 2PKOA 4LC1A 2ZR9A 4U7DA 4W9MC 2IT1A 1N6HA 1ZUIA 3K0CA 5AUPB 5JSZA 1GM5A 1Z06A 3AECB 1XLOA 4YTPB 5JWRA 2JAQA 3DPUA 2HUPA 1IY1A 3QBTA 4MQBA 4JT2A 4KXFB 5P21A 5EE5B 2HCJB 3CONA 3QUSA 5EXXA 3LXRA 3AE9B 3KQKA 4S35A 4LDJA 1GUAA 4MUAA 1XEFA 1WWTA 1I2DA 4PO8A 5FL3A 1FOEB 1XJCA 1GRQA 1GVNB 3B13B 4NYIQ 4Q4AB 1KDOA 1T9HA 2OLJA 5DI9A 5FBVB 2CJWA 4JWUC 4RCYA 1NEKB 1XD2B 2QQEA 1YHNA 3RS0A 4B6EA 2BIFA 2ORVA 1ZC3A 1KI7A 2JLWA 3I5YA 2ZRDA 4P4SA 3KTAA 2LEKA 3M4YA 2BT6A 1T6NA 5JWOA 3VKWA 2EFHB 3JVVA 2FSFA 3RDPA 1F6BA 1W4CA 5C1BA 3KKPA 1JWBD 5FR1A 2AD1A 1E9FA 1CLUA 1OW3B 2YWFA 2WOOA 3OIVA 4DWJA 2PEYA 3A1WA 3B1VA 3JZAA
chains in the Genus database with same CATH superfamily
3IVGA 1C78A 3BFXA 3DBLA 1YS6A 1GXSB 1QYWA 2HNKA 2QY9A 4OHBA 3E3NA 1OVMA 3ZE7A 2WILA 2C5BA 1VL0A 4FFVA 1CUIA 5TMBA 4RF3A 2YEPB 1IBXA 4DL7A 3QXHA 4MEBA 3JQCA 1PO7A 1WSBA 3PNPA 1WVGA 4F3NA 4CLOB 2PKYX 4PYJA 3LHDA 2IYZA 4F93B 4CDRA 3U7EB 1YI1A 4WXMA 4B7XA 4F4JA 1KXJA 4LCJA 2M0AA 3IEKA 3SPXA 2W6ID 3SZGA 2VH1A 2OXRA 3Q9LA 4W5WA 2GKSA 5FUMA 3WLAA 2X0IA 3JQPA 2W2LD 3HLKA 2ECQA 4ZCSA 2K6GA 3HUUA 4M89A 1NVFA 3KAQA 2J3DA 1UK8A 1XNQB 4YJFA 4RTKA 5KQLA 4XARA 1IYZA 3EHEA 3BIJA 4ARIA 1IZ0A 2Y92A 3T4XA 5F52A 3FNFA 4P4UA 3U7FB 4ZANA 2GYYA 4EK9A 2PZMA 2QTRA 2CLMB 8ICSA 4AK9A 2J7KA 4B9KA 4JJEA 1OZHA 2YASA 2W22A 4CKBA 5LA6B 3V4FA 1WCV1 4GG1A 4F8JA 1Y0BA 3B5JA 3NHZA 3QBVA 4K1RB 3LPDA 3I9OA 4BJ6A 4BDPA 2PX8A 3CLSD 3Q8BA 1T6BY 1BOOA 1TM3E 4XX0A 2WAYA 1K6JA 2IBKA 2ZVNA 1YRQA 2PSFA 4W8HA 2YV1A 2R00A 2O6VA 3OX2A 4DREA 4B3HA 2Q8QA 2R68A 3RC3A 4CF6A 1A9YA 2G72A 1A27A 3TPZA 7ABPA 1SXJA 3HBJA 4H6VA 3LMKA 3MINA 4CT4B 2RMMA 3GEMA 2C7MB 1BKSB 3AEGB 5SYMA 2AJBA 3ZI7A 1Z13A 4MVJP 1OR8A 1N7HA 1PR4A 1P3JA 3P1MA 5FA8A 3OUUA 1NXXA 3QITA 4PO3X 4K6CA 3MP9A 4YFVA 2EHJA 2CLDX 1JV2B 1BXRB 2CLKB 5KTPA 3LTNC 3CH4B 1UDWA 1CHDA 3JVDA 3DD5A 1ZD8A 3ISTA 1KZ6A 1BT0A 1G4AE 1IMOA 1ED1A 3X0WA 4I2BA 1C4KA 3W6PA 4JNKA 5DM70 1GTRA 3NCHA 3DZBA 3K0SA 1OE0A 1QFZA 3SAJA 1WE2A 3AF3A 4HVBA 1C4CA 3AF1A 4UBJA 4KPUB 4BLWA 3H1BA 3PO4A 4K81A 4M0AA 2V9PA 1FRDA 3CLTC 4DA9A 1ZJNA 2XDYA 1MQSA 1QKKA 3HB1A 4FQ5A 3ZKJC 4LFBB 1I3MA 5A9RA 1JIVA 2WY2D 5K4HA 1SQSA 2R61A 2I6TA 4ZYWA 1IXRA 3KWVA 3A1VA 1QQ5A 2I78A 3G85A 2FPMA 1WRDB 4XWTA 4YXWD 1MC5A 4CGYA 4I8IA 3IVRA 2YJGA 3W5JA 1LS6A 2ZIUB 1T0JB 2ZJOA 4LOLA 2GF0A 4ZCIA 2XWBF 1KMQA 2ANBA 2FCNA 2FPIB 3LH5A 2ZP1A 4GEKA 4K9MA 4Q9DA 3PUIA 4EYGA 3FPEA 2BRUC 5DNVA 1JSRA 4E33A 3W1VA 1FDVA 5JI3E 3FH0A 5KFIA 4J2OA 1YQTA 3QVMA 5IAKA 5KOYA 3Q3NC 2E6UX 2J52A 3PB3A 2BW0A 1M2VA 3ZTTA 2AOUB 2JHDA 3T79A 3IT1A 2JH7A 4QWBA 4AZ3B 3W6NA 1TKDA 4WNAA 4IOIE 3D6TB 1KWGA 3KEMA 4BO3A 2J67A 3BWDD 5LMNB 2PVCA 4NR0A 2H65A 4NWIA 4QEDA 5L3QB 4NV1A 2QD3A 3N0RA 3NZUA 5E4JA 4TRJA 1ULZA 3ZE8A 1GP2A 3ZUPA 2NXNA 4C0WA 3DVAA 5CEEA 1SBIA 2P2GA 3L8ZA 4CHGA 2BGUA 4YLGA 5EWMB 4B8ZA 2BW2A 5TVGA 4Y6OA 4HEHA 3ICEA 5IO9A 3WE7A 2V0NA 4M37A 1Z8FA 3K8ZA 3P9IA 3R41A 5H59A 5A4DA 2Z95A 3G1UA 1S97A 4BV8A 4TLMB 5G02A 3QJGA 4BZPA 2ALJA 1D6MA 5EYPB 5B57C 5FOSA 1JA0A 1X7WA 2QAIA 4XSGA 1W85B 4OQXA 2DVMA 4LJ6A 1NONA 2E89A 1U0LA 2EQAA 2HQ1A 5EIWA 4C2UA 4M76B 2WFLB 1PVRA 1IK6A 1W2HA 2NS5A 4JT8A 3KQPA 4XYCA 3ESQA 2WWVD 3E84A 3PC2A 1XK6A 3FWZA 1OPXA 3RUIA 4B48A 1C1HA 1U1FA 1QAMA 2JBHA 3DMGA 4U6SA 1QHEA 3RRZA 2PA0A 3SHTA 2WQZA 1XEXB 2WHPB 1FVOA 3NO4A 3K4QA 3R5FA 1G0OA 4D8XA 2QX6A 5LXTB 4AYBF 3TGWA 4FBJB 1G42A 1W4RA 3HY6A 4EG8A 4JBIA 4C22A 2GCEA 4AP6A 4B3JA 1MRNA 2BTOA 3AM4A 1Z4MA 4R98A 2G9UA 1XQXA 3EUWA 1Y9ZA 3G9UA 2WDRB 4OLFA 3T3NA 1CUDA 2XW6A 1AMOA 3DXZA 1GZSA 4JSRA 3PMNA 1C3VA 1SBNE 1NK7A 2B4QA 5FAXA 3ZLJA 4QGFA 1WGGA 4NXNB 2P8SA 2HIAA 2H5LA 1JIHA 5M3BA 1VQ1A 4G1UC 4HMQA 3HJNA 1NMQA 4OBWA 1DX6A 1Y3DE 4TZ6A 2NRXA 4QQ8A 3GT3A 1XEXA 1L7RA 3QWHA 3Q8QB 1NK0A 2QDXA 3PT9A 2C7RA 1W93A 3F5QA 2XNDD 2VPQA 2MRPA 2XXAA 1UJ6A 5C7YA 3Q41A 2IDKA 3W8RA 4ARBA 3KXLA 3KDSE 1II8A 3GPIA 2QUHA 4IC7B 1BVHA 4LX8A 3OQBA 3BMQB 5F21A 3F0TA 1T0RC 2KEYA 4TMFA 4P2HA 1NDDA 3F1KA 1QH1B 3QLJA 4YRZA 3BWYA 3QLUC 4N03A 1SC4A 4C9BA 3OCXA 2EW1A 3GQBB 4BU0A 2IYVA 2QUZA 3MCAA 4IM0A 1DDOA 4JV5B 1I4OA 4JK3A 5ILOA 3DVLA 4EWLA 3H3XA 5IANA 1EG2A 3LQQA 4I29A 3MUEA 2WHQA 2W2MA 4KXQA 2Z58A 1BEUB 2WLSA 2ZBUA 5SICE 5EUMA 4UM5A 3VTAA 2EKEC 2PVSA 3R2JA 3K8QA 4FJZA 3PQ2A 4HRYA 4L16A 4HQFA 1WZIA 2QLFA 3RVSA 4HZGA 2GSDA 2O2CA 1R5OA 2O52A 4RFSB 2HHTA 2LRWA 4Q9IA 4X1KA 5HIMA 1ZQRA 1B16A 4QTZA 3S5JA 4EVSA 2WZCA 5LCXA 2XA2A 3HXPA 4ILEA 2NTTA 3KSZO 1BKDR 3ILVA 3T5KA 3OZAA 3G7UA 3LU1A 3QE3A 4KSCA 4I6GA 4XGIA 3IUQA 1C50A 2ILTA 1HT1E 3NMUF 2F1RA 2PLWA 4QZ8A 4B7UA 3C3CA 4P38A 1KTIA 2OZKA 1SBBB 4U2CA 2M9MA 3DV0A 3T5MA 4MS4B 3VHQA 5FADA 3LTEA 1UBJS 2LDXA 5LZ4A 2OGUA 3HVRA 1A8SA 2LXAA 4RF0A 1LI4A 2N7DA 2V4ZA 3UV3A 2W6ZA 1QG2A 1CQIB 2ODPA 2PWYA 4P34A 1YDFA 2K8CB 4B9VA 1TS5A 4MSQB 2P9TA 3PD0A 2ACWA 1QANA 5JMOA 2VCEA 4O3OA 4EHKA 3FOFC 2G06A 4PZAA 2W6JD 1N0IA 3W2TA 5KNCD 1GGJA 4LHYA 3ITNA 2EZZA 4EBDA 1YRLA 1Z62A 1U7PA 5DN9A 5KFQA 1SWWA 1F0KA 1NJSA 4Q03A 3OHMA 3NEYA 3GXBA 4R2XA 4DA6A 4J8PA 3EFUA 2ET6A 3LB8C 5TS2A 3PRHA 3HO1A 1IN4A 1C3JA 2LCQA 7MHTA 2BEVB 1CK1A 3AHGA 3CG0A 2L0TA 3P97A 1L4KA 1CERA 1ZHHA 1C9JA 3VR6A 5IIIA 1B0XA 4MUHA 4HVLA 3AHCA 1EXVA 2Z09A 2AQ2B 1MA7A 1OQRA 5CB0A 1WF9A 2HBLA 1GPMA 3LX5A 2Y5PA 4R9UC 4AM8A 4RZ2A 1VKJA 4HK2A 1W75A 3CSDA 1WD5A 3RSZA 4HY3A 2O07A 2Y2VA 2FOXA 1I0IA 4X6YA 5TQ0A 1M2FA 1YFJA 1AF4A 2MSWA 3KU1A 1XXLA 4I4TB 1Y5NA 3NAZA 2VI5A 5BMOA 3N75A 3WQHA 5KFAA 1PFQA 4FT2A 5KHQA 5G40A 4G67A 2DZKA 1BYUA 2G82A 1BFUA 2X0FA 1SBHA 1T3GA 4AMVA 4K4GA 1GTJ1 1NMSA 2AZXA 1WMBA 4DIOA 3QX8A 1EJBA 3EDQA 5KJFA 2QA5A 3GLQA 4EPTA 4AY3A 3JWIA 1W6RA 1QE3A 4LXXA 1CS0A 3RE1A 4MPTA 1RFAA 1K52A 2C2GA 2BYFA 2ZI6A 3VOSA 2ONYA 2VWHA 1M76A 1NW7A 4ZVTA 3P9CA 3SVLA 1NVDA 3E9NA 3AUUA 1ULUA 4CQLB 3M6LA 5C53B 5EFZA 3DPSA 1QKJA 9ICMA 3DE4X 1FFCA 4PW0A 2IP4A 3LM8A 5E6NA 4RUKA 1YVDA 3TIFA 1X7YA 4U7HA 3OPYB 2CMGA 3U1BA 3KQMA 3SQLA 4QTUB 1AK2A 1HQKA 4WBNA 3QIAA 3A9TA 3BG5A 1P2VA 3H99A 4WZBB 3KV1A 3QHQA 3T5HA 1RXUA 4IFIA 2WJ6A 4CLRB 4TKVA 1FRVA 5FHRA 3PR4A 1P1HA 1Z6QA 4D57A 5TPWB 3AR7A 5JSKA 1GZ5A 1SUCA 1FVXA 1RYSA 1OLXB 1Z3EB 4DRYA 3LF1A 5FA5A 5JDCC 3D8RA 1P2SA 1XI2A 1O0SA 4YQWA 2L3ZA 2KB0A 2YVQA 2F8SA 4QUHA 2AEFA 2YHSA 4FR0A 4M60A 1OH8A 2RARA 4EFOA 1R6VA 3NBMA 4RF5A 4TQ9A 7MDHA 2WB1F 4MUNA 2ABWA 1XMIA 1P5ZB 4OHOA 2H5JA 4UE3S 1ZM9A 2OPHA 2R6DA 2HDNB 1PJ8A 1U8XX 5GY7A 4JI0B 3BILA 3HADA 2DQ4A 4ZV7A 2PJHA 4FILA 2ZVQX 1KFEB 3VO9A 4UDYX 3P26A 4FI3C 4NLCA 5EZ5A 4N82A 3I2YX 2IHTA 2W2KB 4LDTB 3TRFA 5FHQA 2QN2A 5DB6A 1EFPA 1M6NA 2HJVA 4K9KA 3L79A 3GRCA 2P6NA 3P27A 4MH0E 3FHJA 3U40A 1YRAA 4NV3A 1YZKA 1OFIA 3WIUA 4CPDA 1FTGA 5A7GA 3RAEC 2PWBA 3QPDA 4LRWA 4OHXA 2QLMA 1Z4PX 4FBGA 1M2GA 3QX3A 5KVVA 4OP3A 4GR5A 4F5ZA 2W83A 4B35A 3ZI0A 2BBTA 3RVNA 4WN9B 5BN5B 1XMQB 3K0KA 4ZKEA 5KMGB 2DGDA 3F6PA 2RQ5A 1UDBA 1SIBE 2D0PB 2FP4A 2I6QA 3WNBA 3KFXA 3K30A 4NFLA 4BNLA 5LUAA 3M4XA 2WXKA 4DUYB 1HE2A 2PBFA 1SD2A 3ITKA 5D3MB 4EHHA 1RI5A 4JLJA 4AZVA 3FXAA 3GNSA 3H13A 2J59A 4AF7A 1OYWA 1TM1E 3DQPA 2CNOA 4UOQA 2CNDA 1J8CA 3NRCA 1BDIA 1F1JA 1QGED 2DWCA 2JEOA 5HUQA 3N2LA 1VSUA 5ALLA 3IA2A 5E9AA 4MGZR 3QQ8B 4BUGA 3EEBA 4LE0A 5J23A 4NP6A 4DR7B 1GNUA 2ZS9A 2GCIA 4RTRA 1M73E 4RNAA 1RACA 3DDOA 3S4YA 5CLIA 1GQ2A 3H9JA 3H0RB 3AXSA 5TPWA 1GA4A 4RTPA 3C19A 5FUVA 2CL5A 3NIWA 3KOMA 3FUCA 2OM2A 2BFWA 5KU7A 2A57A 5HCUA 4LJRA 1DINA 1I1NA 4WBNB 5A6SB 3DZFA 3GJ5A 5B7QA 4FCCA 2JRHA 5EWFA 4L76A 4BB5A 3NOXA 3AYXB 4ZXFA 1YT5A 4ZI3A 1Z08A 5DZSA 4Z7OB 3F5AA 2GUGA 3ZWBA 1DRWA 3W1WA 1TJYA 2FPLA 3PWSA 4GN1A 1TM2A 3ZCTA 4MRPA 1LNSA 5KOJA 5IJ9B 2C2DA 2KJ8A 3K0BA 3MSCA 2ZNVC 2V7UA 1L0BA 4BMZA 1YA8A 1S3SA 2W2OA 5CXQA 4M7PA 3P2EA 1E2QA 2NO6A 4PYNA 1QOAA 1TU0A 4UB2A 2OC4A 4OK5A 5T3UA 3CVYA 3S29A 1M66A 3BK2A 4AMYA 1W1UA 2RI1A 5IJ0A 2VDWA 1BJTA 2W6QA 4ND5A 2P6UA 4JLBA 4ODIA 4HH4A 1WI0A 1A96A 4BRSA 3HDJA 4WPGA 5ECGC 4DQSA 3VU8A 1EINA 1XZAA 1JR6A 3JSAA 1D8TA 2JK0A 3OM0A 1WX1A 1PRYA 1N3LA 2L0FA 4TQSA 1J06A 1UIMA 1TCUA 3U4GA 2KYWA 5J0PA 3GJ8A 1FXUA 2J0UB 4PAMA 2YYSA 5ALWA 4TVBA 4P0QB 4LQLA 4ZPJA 1UJMA 3YASA 1OXUA 4FZ3A 4LNOA 1WHTA 1P7WA 3N9IA 2XGPA 3W04A 1P91A 1SIJA 1H0SA 4PGYA 1ORRA 3DEHA 4EGAA 3UY4A 4HNQA 2B1QA 2MSNA 3RBEA 1NJYA 4MGKR 1M1YA 3GRYA 2BSXA 2KC1A 1SC6A 2MJLA 1LJUA 1PGBA 1PIWA 1E58A 4IVRA 3Q2IA 1SJED 5KWEA 2P9BA 2XXBA 3THXA 1QO9A 3LHKA 5KFJA 2RE8A 3V3KA 4G9EA 4EY7A 5SZJA 5DDIP 3ZHZA 2QZ4A 4CF7A 1X8XA 2YZ2A 4RL4A 3JASB 4KLSA 1U3GA 2VJPA 5B3KA 2VJQA 3ST7A 1C1YB 1CYDA 1A0PA 2Y1DA 1BX1A 1TS2A 2WNSA 1ZLYA 4JEUA 2C5FA 1N32B 5PGMA 5J0RA 3FFBA 3O38A 4KLQA 5CK4A 8ICIA 2NN3C 1XTPA 5C5IA 5F7ZA 5C3MA 3ADOA 1G2QA 1F1HA 2GAFA 5IA7A 3T15A 4BZAA 3MB8A 4JBWA 3P20A 2QL7A 1TCCA 2OLKA 1WXAA 4TT3D 4FZMA 2ZXIA 1PWHA 4ADSG 4MCAA 1KVTA 1NUQA 3EG9B 4LOAA 1NI2A 5BY2A 3TD2A 1U49A 5JMPA 1GRVA 1LB1B 2P8JA 3JW0X 1Q8KA 1SZHA 3ZG6A 2QGZA 5DBCA 2HV9A 5K0TA 3N7PD 4CR6A 3OD1A 1BMLC 2XNDA 1TOAA 4Y0AA 1FXTB 1T2NA 3KOXA 1TEZA 4F6RB 1YQ3B 4HH0A 2HTFA 3VISA 4UNRA 1QFSA 1M34E 1ZXLA 4M54A 3E2MA 4RPYA 3W1SA 3H6NA 3H8WA 4QWDA 3M5CA 2Q9BA 5EJEA 3L13A 4L6CA 2ASQA 2EAPA 2ZBVA 3PJGA 4UUAA 4DS5A 4XVUA 3RJEA 3MWFA 2AG1A 1IM4A 3V4RA 5JPIA 3F6CA 1A6SA 4JJ6A 4PO9A 3B51X 5K0FA 2JZNA 4MHVA 4H2DA 1NUHA 2HK6A 1JYEA 1MPTA 4WIAA 1AM4D 4Y2RA 5CIYA 4J4TA 4NPAA 4A8JA 1MO5A 1CUBA 3AMVA 3EXHA 2CFRA 4IVNA 4ZARA 4GP9A 2QP9X 3KWLA 2E8MA 1E1MA 2GA8A 4KTTE 4UOZA 4N59A 4G1MB 5DQIA 5ERXA 1GSHA 1I3CA 3M8RA 1T25A 5KYKA 2BGNA 4JL6A 3JTMA 4PYZA 1H9AA 1PI3A 4D3ZA 2YQZA 1JTVA 3VNVA 2J3IA 2Q3HA 3BF7A 4DRZA 4YIHA 4IH4A 2HPZA 4R0VA 3JYQA 2BGTA 1JE0A 1V39A 1MNQA 2ZBPA 4A26A 4IAOA 3NOOA 1P98A 4JB8A 4FS2A 1RWMA 3BDPA 3W5BA 4RLHA 5K4GA 3VC8A 2REQA 5BNWA 5JWRA 4EMUA 3PLRA 4MQBA 3VH4A 5IH7A 1UXHA 5JAHA 1THTA 5KX5F 1W59A 4YQZA 3BHNA 1K7SN 4IBOA 5HF6A 1A8PA 4GIVA 2YMLA 3MWDB 3IYLW 5IKMA 5DYTA 4GPEA 3J80A 2C9DA 1L0YB 5KX5B 2LXNA 2HMYB 3WLPA 1IXRC 2Z83A 4MEMA 2NV0A 4NZZA 5GINE 3MTEA 2IGGA 4G85A 1AXGA 1T3ZA 4EX6A 1TQ4A 5TSSA 1TFRA 3BWCA 3L1IA 2XLCA 4C0HA 1PK1A 1RRPA 3OFVA 4L2YA 2A2ZA 4CM6A 4CKCA 2W0SA 1RJWA 3PYLA 1IRIA 3BBLA 5J1TB 4BZZA 4I36A 3DLBA 1EB8A 1TYCA 1H2ZA 3GAFA 3WRYC 1KVQA 2DFLA 4RQ5A 2ZRAA 1CVIA 5G0WA 2FF7A 1G8JA 3IV7A 3SBOA 1BA3A 1GL7A 3IILA 3A31A 4NOJA 5EJ7A 3LFUA 4N47A 3JASA 3DFUA 1DG9A 3PR2B 1YNTE 3Q3OC 3PPXA 2XCSB 2W70A 2H4HA 1IBCA 1GPJA 1Y8ZA 4TN1A 2KFJA 1RLTA 2R87A 2BKRB 2IHZA 2GT1A 1BEEA 4GD3Q 2X38A 4FFLA 4BJQA 2P4QA 1KDZA 1S01A 2H7VA 3IGFA 1T8WA 1I7NA 2GRIA 2OHFA 2VJ4A 1IBKB 1PYOA 1F4PA 4K8OA 4GKAA 3C43A 4CLXA 3G0HA 2WMDA 3PXBA 3CH7A 3B0AA 1HT2E 4QZ9A 2VTBA 4D3YA 4JXXA 3OLYA 3OWXA 1G21E 4X91A 4A2CA 4FP9A 3GP3A 2JU6X 1SKBA 2P75A 2ZSEA 5D46A 3RR8A 3FB1A 3SV4A 1WUJS 3D7NA 3TJPA 1VMDA 1OFVA 2DUWA 1I80A 1Y7IA 3DM5A 4E2ZA 4RK0A 4Z7NB 3NVDA 4GZ3A 3L9XA 5KTRA 1ZL2A 4LHSA 2PUAA 3WA7A 1ML3A 4MUJA 2BCQA 2W6OA 1AUXA 1F2DA 5LWQA 4BO9A 2CW5A 3JY6A 2CFTA 4N3CA 4RFVA 3ZRCA 4WJOA 5CVVA 1HJPA 3P4QB 1QGAA 2MSCB 4M98A 3WB1A 3UQ0A 1J25A 2YJ3A 4RHEA 4QHYA 2FPWA 4FYMA 1TYAE 1C1XB 3SDZA 1PU2A 3UG6A 4PAGA 2W7PA 3EGDB 7ICFA 1PQPA 1NASA 4C00A 2CXYA 4GXRA 1WGKA 4KWEA 5J2GA 3OZ7A 1VCIA 1BPZA 5KHOA 2C2RA 2IIQA 2NUTB 2WHYA 4JFAA 4MJLA 4A91A 2WXLA 4ZTZB 2YMMA 3UWSA 3N76A 1XMOB 1QAQA 3D1JA 4QM7A 4Q43A 4MI9A 4HKZE 1B14A 4H08A 4JUFA 3RLIA 3RHSA 4BGIA 3SSAA 3LA8A 4G6ZA 2WWGA 3ANNA 5TNXA 3QWIA 1IY9A 5A1JA 7ICVA 3H2BA 1DC3A 2RGXA 3X1WA 3EJ6A 2HMSA 4EEKA 3M1AA 2XMSA 2IO0B 2AOTA 3O8NA 1PG5A 5IHPA 2Z1NA 2C7NB 4HAVA 1X0VA 3PNOA 1P2GA 2O2VA 1U4AA 3QHPA 1TTTA 4XYGA 1ORDA 1SG9A 2YNMC 5JY6A 1R16A 3AUSA 3R8BA 3LL4A 3RGGA 2NXCA 3C7AA 1U45A 1II0A 4DWIA 3H0MB 1W0KA 1KO5A 3VX3A 3DVRX 3NBYC 3CF2A 2XQIA 3GWZA 3DVSX 3FDFA 2HHWA 1J19A 2TSYB 2JFFA 3QAQA 5DMHA 3N8DA 5DPSA 4MV0A 1R8QA 3GI1A 3MPOA 3M6VA 4E2XA 4I55B 3DO5A 2H0RA 3LC2O 4Q19A 1WP9A 2VT6A 5CHYA 2IEDA 1VPDA 4X20A 4OHZA 3RB8A 1CV2A 4MWEA 2YY6A 4E7PA 3TBKA 3CX8A 5J0OA 1T4CB 4LTUA 2Q5LA 3IMCA 1TJ4A 2QLTA 4UHBA 2CNKA 4BECA 4UHFA 3GXOA 4G4GA 2BTQA 2ODEA 3OY2A 5IDWA 1E5LA 2J9FB 1NVID 1P2UA 3EC7A 3M49A 1IY2A 1KYVA 5GZ6A 3HSSA 3IR7A 3WJ7A 3HM3A 1LLUA 4KXYA 1E8MA 1NBIA 4BVHA 1EESA 4AX4A 4DQDA 3GOHA 1OI4A 3Q8MA 4UTXA 1Q20A 1GTG1 1QIHA 3V8NA 4ECYA 3SEQA 4L0CA 7REQB 3A26A 4OXNA 3T1YB 3GJYA 3DOFA 4Q8EA 3V72A 5DM2A 1MV5A 3I0NA 2Z5FA 4O3FA 2E87A 5EZYB 3VRHA 1SIOA 1DZIA 3KR2A 1VIDA 1HOTA 4IIJB 4DXDA 3MWEB 3VZBA 2Q07A 3DXFA 5BSTA 4EGQA 5I51A 3BD9A 3AMZA 4DM4A 4FGUA 1OWPA 3PKIA 1WB4A 1YTLA 1Z3IX 4MKXA 4YT0B 3TRHA 3KQQA 2NO5A 4CT5A 3GV5B 3UMJA 3P5SA 4EUNA 1CETA 3ZYCA 4NAWA 2LJ5A 3HVJA 2RBGA 4EFKA 4H7HA 2CF6A 1DX4A 4QZFA 4LSWA 1OFTA 3EEIA 3G02A 1CF2O 3RASA 3F47A 1PZXA 4YSXB 3JVEA 4GYJA 3LQYA 3PEYA 1SXPA 2WIJA 1M2WA 3V5NA 4AZ0B 3TB4A 3IDWA 1NAHA 3P5BA 2AW3A 4HZUA 4PXAA 4HNHA 1ZQLA 1FS5A 2CLEB 1GN9A 4NH4A 4QG3A 2CJWB 1Z2DA 5HX7A 2RDIA 3VFKA 2PS9A 3INGA 4KO2S 5GWXA 3T7RA 5FPPA 5DCNA 3ORFA 3GBVA 3K0FA 2VHUA 2Y9TA 4RQ8A 1XLTA 3MTJA 1H2EA 2N1VA 3FPSA 5BYSA 1JI7A 1E3SA 4DTIA 2HJGA 1USWA 3GEEA 1K75A 3TVYA 2IEAA 2PGJA 4HOYA 3K9FC 1PK1B 5AK4A 2BCEA 3B1FA 4NYJQ 3U39A 1D4BA 1LPNA 4RE6A 4FULA 1RZRA 3KM0A 1V6EA 2I03A 3AINA 3TLMA 1SUEA 1NKEA 4LQCA 5IBCA 3FUXA 2QC8A 1JG4A 4BP3A 4F3YA 4H0CA 1Z74A 3KQUA 1MEOA 1TVAA 3V6HA 5ELLA 4JI4B 4X57B 2L2QA 4MPDA 1WXMA 2K25A 4RGYA 1BFDA 3CN7A 1M8JA 1IJFA 3TWOA 4UPEA 1RJGA 4XGQA 4JZYA 1AGPA 1OLUA 3ACDA 3P2IA 4KGRA 3ZDRA 4KOAA 4KQEA 3UPQA 2J09A 1V2GA 3DZKA 4QWWA 5JAUA 5KTTA 2WX1A 4D0SA 2C3MA 3TDMA 2BCUA 1H2WA 2G8NA 3WGOA 4EGSA 1MG0A 5CX1B 4M0WA 4HUQB 1HT3A 5LMUB 1TAQA 1ND6A 2GZ1A 1CUYA 2W6IA 3JQDA 1WQ4A 3E1KA 1I2AA 1OA1A 3LUJA 4BRUA 3P42A 2Y9PB 1ADGA 4YR9A 2VRCA 1D4FA 4YRPA 3OLMD 1E7SA 3RYCB 4IHJA 4DE5A 2FHPA 4Y9UA 2UZAA 2CNWD 1YMQA 2BFCA 1M72A 3R9IA 4Q1BA 3KX2A 4MAFA 4DL5A 3PQ3A 2BI8A 3COWA 1Q6YA 3H7PB 4KKIA 3MGGA 1DARA 1ZI6A 2RRDA 1AKYA 2C7PA 1Q5PA 4ZEOA 1FP4B 3HO6A 4K5QA 4DG8A 3GEPA 4Q34A 1O4VA 4ENPA 3QLUA 4JKYA 2XZDA 5TPZD 3C6YA 1NENB 5FTLA 4OVUA 4FOOA 2A5FA 3CLRD 4BFWA 4HDQB 4CM9A 4F2GA 8ICFA 3KUCB 1LVGA 5LLTA 1RBZA 1H4QA 4BZWA 2JCXA 3BDAA 4PANA 2W2XA 1WA5A 3OM8A 2FPPB 4JBXA 3H5OA 1NLFA 1HTBA 2YHIA 5TT0A 4FBMA 1A98A 4QAJA 1JGTA 3LUAA 2J3MA 2QN8A 1TZMA 2ZAGA 1GRNA 3R6DA 2NRVA 3HSKA 4KACA 3MB5A 3ZU4A 1YMVA 3OQNA 5IT0A 4WVFA 4B0PA 4OO3A 1V80A 1VHLA 2JFYA 3U4HA 4F1WA 2BQUA 16PKA 2IKSA 2IBMA 2QAGC 3W6UA 4M9UA 2ZRMA 1F6DA 1NK5A 3CBQA 4DR1B 3QLVA 4B43A 2VS1A 1P7VA 3T0IA 3LLVA 4PG7A 2PRIA 2W8LA 1JMSA 3OP1A 1JG1A 2J9ZB 4MDYA 1S0VA 2L7RA 4U3JB 1RWVA 4XUCA 1AS2A 1GZVA 1QS0A 5GV8A 4F84A 4NNPA 3OIGA 1GDDA 4B6FA 1XNSA 3LCCA 4KLOA 2J87A 3ICXA 1QYCA 3EARA 1B74A 2KE5A 4RXUA 3DDZX 4RHYA 3RWOA 3CWCA 2CYBA 2BKUA 1N5OX 3H8SA 1J42A 3T61A 1R0KA 4Q82A 3ZXUB 1VOTA 1KKUA 2O2EA 2C22A 5BQXA 4ZCLA 1BPXA 1QB8A 3MM4A 2WE7A 2D54A 1MX9A 3NYRA 3L46A 1VXOA 2F2AB 1OGYA 3H11A 2C4NA 1Y7HA 1ZXBA 2V97A 3DE1X 4WBSA 4EPVA 1BPDA 1YUNA 8ICZA 4HDKA 1KL7A 4A5OA 3DFMA 3UATA 2X9NA 2HWKA 1T2UA 5D01A 4JDPA 4BWFB 3B8HA 4QYWA 3WAMA 5JRZA 2H1SA 5DKFA 5BWBA 3REQB 1ACMA 5K6AC 5AVZA 3I3TB 3OTWA 2C5EA 3AOEC 4FB4A 3FMGA 5HRUA 1DCKA 4C2AA 4RAQA 2HRZA 1EVYA 3U61B 1RAFA 2A5LA 1LF0A 3L4SO 3GN2A 2W48A 2VA3A 1KIFA 1P8JA 4M9LA 4BMXA 4MV6A 2C9WB 5AVTA 2PSDA 2YVAA 3ZUNA 2X0DA 2A9RA 3WYGA 1D4AA 3CU5A 3ZRFA 1IY0A 1PJRA 3MJVA 2DUNA 5H4HA 2DL0A 3U49A 4UTRA 2ICAA 1TYBE 1ENZA 2BSQA 2UZ0A 4XLTA 3PVSA 1OFHA 4AO8A 2VDWB 3HGMA 3Q3IA 3EFCA 1RE0A 4HYQA 3TM5A 1JFRA 3W5HA 3H8HA 2BFBA 3EMBA 5FRDA 6AT1A 1G18A 1GSOA 4CEJB 3ISBA 3NDJA 4MLDA 1VZ8A 4X3OA 1UEIA 4XW2A 3U4AA 2RDBC 1NU8A 4JEHA 3P4UA 4TYMA 4YMUA 2IU3A 2C98A 2Y1OA 3A4MA 2IY8A 3SKXA 5IP5A 3V7WA 2XEDA 4PPQA 1E6EA 1U5AA 2VYND 1XBTA 3ER6A 4QZCA 3E7XA 2BEWB 1J24A 2P2YA 3U4MA 3A9WA 3ZWOA 1FP4A 3WAPA 4TRRA 1DS6A 2RHTA 3PR1A 2XECA 3GCGA 3OQVA 5A2GA 5AKEA 1I4WA 3D8SA 5D8DA 4G4SP 4RPGA 4DUZB 5DV9A 4KGVA 2H51A 1EE1A 4AP9A 4G8JA 5DE3A 5KFWA 1MW8X 2NQ8A 4PNZA 4Z0NA 2KNBA 2X8WA 3RHZA 2H3EA 2AKYA 1OH7A 4EI7A 2DETA 5EHXA 2XUJA 2WTBA 1G21A 1AKRA 1QLBB 2QR2A 5DLEA 4J3NA 4ZEVA 3KBBA 1RAHA 1UCVA 4J9UE 4C0JA 1N7JA 4NL4H 3GFGA 2GM4A 5HUHA 3C5EA 2YXBA 2WM9B 3N6VA 4UAYA 3IDQA 3GLFE 4BFCA 2WB4A 2JH9A 5A7FA 5AKHA 2Y05A 1BE1A 4FHEA 1Q1QA 1BEZA 3NC0C 1LLFA 3URYA 3GJXC 2HGSA 4MV4A 4NXMB 4Z54A 1K08A 1K3UB 4XJTA 4UB4A 1J1ZA 2I7CA 3GPCA 3R3VA 1H2YA 2WABA 5LXHA 1CEEA 1DUVG 1XC7A 2IBTA 1PNRA 5DXFA 2AZDA 2O2XA 3BMXA 3FKYA 2WIGA 3QQ5A 4O0IA 4MUFA 1Q3VA 3W3AH 4KZCA 3PG5A 2A1TS 3URKA 4BNTA 3IAAA 4CL3A 4NI5A 3KOWA 2HA7A 3JYHA 2NW6A 2YWDA 1W0KD 1W36C 1QZTA 5TC4A 1Q1OA 3N8GA 2FAXA 3K4GA 1FUYB 1ZNZA 3DH0A 8ICMA 3LY8A 4E3CA 1BW9A 3SXUB 1CJUC 4IV5A 3N05A 4BEJA 1IWBB 4A8JC 3EC2A 5CEHA 2GAIA 3D5QA 2FCAA 2OHOA 1XXHA 1ZQEA 4OK6A 3OHPA 1R5NA 5TPZA 1Y6RA 3SJCA 3BGWA 3C48A 3NOBA 2QM8A 2IPKD 4KYVA 4AX8A 3L8MA 4AG3A