5EE1A

Crystal structure of osychf1 at ph 7.85
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
373
structure length
363
Chain Sequence
RPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRHAGEGLGNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 115
structure length 363
sequence length 373
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee1A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee1A01
3EA5A 1YZUA 3HP1A 1E1RD 1WDTA 3KJEA 2P6UA 1WCV1 3MJHA 1F0ZA 2A5FA 4KFRA 2CLCX 1D2MA 3ZVMA 2GA8A 4CEJA 3RABA 1ZNXA 2YC2C 3SBDA 1DAIA 1Z08A 2JJ8A 1Z07A 2Z4SA 2ATVA 3MGCA 2OILA 1N0VC 4DT1A 1DPFA 1TF5A 1PLJA 3NHAA 4Q1DA 1VTKA 4TTQA 5AUOB 4BPBA 5FTMA 2O8CB 4LHVA 2CMKA 1E79D 2ZJ8A 3VR8B 1II8A 1U94A 1FP6A 1KSHA 2AK3A 4NYIR 2J87A 2R6CA 2R6DA 3CX7A 4NPHA 5AJXA 1E9BA 3PUVA 1FW6A 2QAGC 1EG7A 4C0QC 3R8FA 5TDHA 2VF8A 3QKSA 3AF3A 3MWKA 1II0A 1DAEA 2FEOA 4JLMA 3EIEA 4OK3A 1DARA 3VAAA 4BRUA 1JAHA 5DI9A 2FFBA 5CYOA 2OAQ1 2W54A 4CEIA 2J0SA 4HRSA 1NN3A 3QE0A 1A2BA 2W0MA 3QF4A 4MYTA 5HKKD 3I3SR 3THWA 3O47A 1AM4D 3QKRA 2WJJA 1P9WA 1TU3A 5AUQA 2XXAB 2C04A 3EX7C 3X1ZA 4Q5IA 1W4CA 4YMTA 3FC4A 1I4TD 1DE0A 3EPLA 2IYQA 1CR0A 4Q4AA 3LX5A 1QHGA 1GFIA 2WOJA 3RANA 2W2VA 3RRMA 621PA 2IS2A 2F9MA 4LCBA 1Y3AA 2ZUBA 1ZCBA 1IXSB 2OV2A 5EXXA 1NRJB 2FFAA 4QHTA 4CDGA 5IK2D 4NCNA 1II8B 2ZRDA 4BFUA 2X19A 1CU1A 2BMDA 4MA4A 5DNYB 4GOJA 5DGXA 1G3IA 4EJSB 2XZPA 4RFSB 2OESA 1G9XA 4IOLA 3X1WA 5E7JA 4M1OA 4NCKA 4R2HA 1X8LA 2WBLC 4M1KA 1VLBA 2J3EA 4JS0A 4BLRA 4FD2A 2BM0A 2AK2A 3KKPA 4RZ2A 1GNQA 3EW9A 2XTMA 3QXCA 5DHAA 1ROEA 2PZEA 1YE8A 1ZD9A 4L5BA 2B8TA 4LPSA 1ZJ6A 1LV7A 2VEDA 3BBPA 3C7KA 1ZP0B 1IJEA 3BB3A 2ORIA 3SEAA 1UJ2A 5GJCA 3VNVA 4XD7D 1BH2A 2H92A 1E0KA 1N2CE 3EZ7A 2BBTA 1XTQA 4FCWA 5IHPA 2R62A 5FI0B 1J7AA 2F43B 4Q9HA 2A2ZA 3ASYA 5ELXA 1LFDB 2OO7A 3CUEF 4MITA 1RPZA 4C7ZA 1CJVC 5A5GA 4HAYA 1E1QD 3CRQA 2N42A 4WOPA 5EP3A 4UXHA 1IUEA 1KTVA 1X1RA 2R6GA 4DLXA 6Q21A 3OE7D 5IRCD 3G0HA 5KDLA 2OFXA 2D3WA 2IYSA 1S96A 4OI2A 4JVSB 3ADCA 5FTNA 2OBNA 4QBGB 3AVOA 3SR6A 4DVGA 5CYPA 1R4AA 1PDXA 1XJCA 2CDNA 2QUZA 2RGBA 2EFDB 3MD0A 1S3GA 2SHKA 3MWYW 3QG5A 3VHLB 1UDXA 1KI2A 1T0HB 4TMVA 3DPUA 4DCVA 1CS4C 1U2RA 4JX1C 4MDFA 1IM2A 1VMAA 3EZ6A 3FAHA 3HU3A 3LW8A 3Q3JB 1R2QA 1KO4A 5FUXA 4TQUS 5L3RA 3AVUA 3NC0C 3LFUA 2NZ8A 1Z83A 1OFTA 1FOEB 1IY0A 8OHMA 4ASUD 2XNDD 4DUGA 2UZIR 1E9AA 1KI6B 5CITA 4JVLA 4KBGA 5ANRB 1OH8A 1HE1C 3THOA 2C5LA 5FUWA 4LV8B 2CLSA 2P5SA 4PZZA 1SXJE 2G3YA 2DFTA 3Q7QA 1R7RA 3TVDA 5C18A 2ZJZA 3RWMB 3T1TA 2GAAA 4MQBA 1HEIA 1KI7A 1Q57A 1FPMA 3RRYA 4TN1A 2JIZD 2YJTD 4LHXA 5JWRA 3WCQA 3B5JA 1SXJD 2JLVA 2A30A 4OI4A 1R5NA 3S1AB 1Z47A 2REBA 4B44A 1JPNA 2ZR9A 1N6PA 1O87A 2BIFA 3SJCA 4RKEA 4B2IA 5KPJA 4IVPA 3ZQ6A 4HLQB 4Y0AA 1R0YA 1GOTA 4NYJQ 2QT1A 3GLHE 2GAOA 2GBLC 3TQFA 3U3RA 3DM5A 3GLHA 3PJRA 1IXZA 2QM7A 4K8OA 2PT7A 1ZU5A 2CHVA 3C8UA 2DR3A 4Q48A 2V1UA 5JRJA 3TK1A 3KTAA 3BE4A 1E0ZA 4OI0A 1WP9A 2GVDC 3VU9A 2OSBA 4C0BA 2NZJA 2WJHA 4QGAA 4HDQB 3ZZTA 3WNDA 1PUIA 1D9XA 1Q20A 3DZ8A 2CL7X 4ZI2A 5K8IA 2ZUCA 3MAAC 2QP4A 5CB8A 4LJ9A 3NXSA 1UM8A 3VR4A 3GFTA 1D2NA 5EP2A 2QAGA 2ZRNA 4MH0R 4ESHA 1E94E 2P3SA 4EPYA 5CB6A 5JEDA 3U2QA 3W8NA 2PLFA 1GKYA 1ZM2A 2EKIA 4YXWD 3I62A 2W55A 3LVRE 4Z8XA 4Q4JA 4IFBA 1SIJA 2ZJAA 2C77A 3QUSA 4EQ6A 1YR9A 4HZIA 1FX0A 4YXDB 1N6NA 2QU8A 2HT6A 1VG9B 1E69A 3FYHA 2HXYA 4OQMA 4RVCA 1E0JA 5JSZA 3PEUA 2WWYA 1XD9A 2JDIA 3I92A 3BD9A 5CJ2A 4BGDA 3O8RA 3BK7A 4GZLA 4B6EA 3M4YA 3T35A 3FWYA 5SZHB 1U99A 2QE7D 4B75A 3UWOA 2Z83A 4QFMA 2FGJA 5C1BA 4URZR 4F4IA 1IN7A 2QGZA 3EA0A 1FZQA 4YMVA 2M19A 1MRSA 1OV4A 2IXFA 3MFYA 5D3MB 1UAAA 3RPFC 1NVVQ 4QM7A 2B76B 3AKDA 4BLSA 1CRQA 5B2ZA 1P2SA 3FDIA 2GXSA 1M1YE 3KUDA 1NBME 3CW2A 3CNOA 4TYNA 1NBMA 4RD0A 1BKDR 1P6XA 2BDTA 3AV8A 1T8UA 2R6FA 2ONJA 3GEHA 3TSOA 2NQ2C 3PQCA 4QGGA 4LBZA 4Z51A 3RC8A 5CK4A 1L2TA 4Q18A 5KDDA 3IPXA 3RHFA 3VKWA 3PFIA 5GVRA 4U00A 5EP4A 5G3YA 1XF9A 1AN0A 2QL6A 3TNFA 2ZI9A 4DLTA 1UEJA 1P7CA 2FV8A 2O8FB 3QVVA 3BXZA 1AYFA 1W44A 3KJHA 1QHHA 1N5IA 3WMGA 1Z0FA 1KDRA 3ETLA 3EWSA 4L4UA 1GRNA 3CRMA 3RSOA 2YKGA 1F2UB 2MSEB 4TLEA 3PIRA 1XJ0A 2ZU6A 2ZJ2A 4HEJA 3B85A 3KJIA 1R8QA 1WF3A 2PL3A 1CEEA 1EFRD 2X8AA 1G291 3AEDB 1CTQA 2J0UA 3IQWA 3LBHA 4DDUA 5FPKA 2A7QA 4F4JA 2F7SA 4XJXA 1DVRA 3KKOA 3HPRA 2W6JA 4N1AA 2DWPA 1HY3A 3IKJA 1CIPA 3BIFA 1FM0D 1AS2A 1KMQA 1N5LA 2HDNB 4M9ZA 3R7WA 1E9MA 4DB4A 1E0SA 4DDWA 1E4YA 4JL6A 3LV8A 2H16A 3B6EA 1KAGA 2GJKA 3WBKA 1DAHA 4J0QA 1G20E 2O8BA 2H7VA 4JLDA 3FFAA 4R2IA 1US8B 4DKXA 1XRJA 3AE8B 1FTNA 2HXSA 2HCBA 3W5UB 4IJMA 2PVGC 5FTKA 1ZYUA 3IUYA 3REGA 4HDOB 2DCUA 3AP1A 2WM9B 1G4UR 1SGWA 4L16A 4OL0A 4QHYA 3U3OA 2ZXUA 2O8DB 2Q3MA 3CR8A 4QBFA 4NKRA 3MCAA 5H70A 5LBIA 3SJBA 3GJ5A 3SYKA 1D2EA 1I7HA 2CNWD 3CO5A 1ZIOA 2XITA 3GPLA 2V1XA 3K8YA 1ODFA 1SKQA 4OYHA 1RRPA 3CRRA 2IF2A 1UADA 3AE7B 3GJXC 3SHWA 2AN9A 1XD2B 3U7EB 2GILA 1VJKA 3TRFA 2IW3A 4LJYA 2Y5CA 4BFWA 3UWKA 2NPFA 5KPDA 3F5FA 3CX6A 1P75A 4Q1BA 1V8CA 4MGYR 4QBIA 1G3MA 3VR1A 3SOPA 3GP8A 1WXQA 1NMZA 2Z5FA 3DM9B 5EXSA 4Z1MA 3MMPA 4Q1AA 2GBLA 4LV6A 1ZW6A 4D0NA 3ZYYX 2J45A 2RGDA 2WSMA 4PHTA 3AVVA 5GADl 4MYCA 2CJWB 1NKTA 3B9QA 3A4MA 3IBYA 2CE2X 1LTQA 1VKJA 1WBDA 3LBIA 2DWQA 5HTKA 1FNNA 2NOAA 1KJWA 3NEYA 4HROA 1OFIA 2FN4A 3BORA 1FNMA 4ZDIA 4GMXA 3W6OA 3ICQB 4II7A 3GJ8A 3B1YA 2K5PA 2ASEA 4Q1FA 1G7TA 1FRDA 1M7HA 1MABA 4LPKA 3QEJA 4PO9A 4QNMA 1XU4A 3W5JA 4QKQA 1E2FA 1ELOA 1ZUHA 4MUAA 4KBFA 3OZXA 2OAP1 1YR6A 2JLYA 2P0EA 2F1RA 1S0UA 4FXCA 1S8FA 1XLQA 1W49A 2WKRA 4KSCA 2C95A 3AE4B 1Q0UA 3BRWD 1MO6A 1RWSA 3HJNA 3I32A 4GP7A 2BJVA 4F38A 4NBSA 2K9XA 3E5HA 3L82B 5DIFA 1VHLA 2ZSAA 3GLGA 1E10A 2RH5A 1AWDA 4NYJR 5DISB 4QHSA 4XSGA 5K8TA 4CT4B 2N46A 4MRVA 2HLDD 3W6NA 1IXRC 1P2VA 2OBMA 4HB3A 4B3DA 3G5UA 3NBFA 3QENA 1IOZA 4YSZB 1ZXIA 4KYUA 4XVUA 2QA5A 3A37A 5FL3A 1Q21A 3BH7A 421PA 4JLOA 4B73A 2MMCA 1OJLA 2H57A 3A6PC 3A1VA 4TMXA 2IBMA 3T5DA 3UMSA 2HT1A 1D9ZA 2HJVA 2C03A 1KI3A 4P32A 2WJIA 4PAQA 4HATA 4TL7A 3H84A 3RVBA 3ZS9A 2HF8A 4LDJA 4PC3A 5FOXA 3M0EA 4YQFA 3AVYA 2F3TA 4Q4LA 4KFSA 4P33A 1GTVA 2B7BA 2VHJA 2V9PA 1IHUA 4M1WA 1HYQA 4MYUA 1ZUNB 5FPTA 3THXA 3ZVLA 3RS5A 2NO9A 4DSTA 2W2XA 4HSEA 4YSYB 3WMEA 1XXHE 1QVRA 4HYYA 2QZ4A 2MH7A 4UNQA 1E7PB 1TQ2A 2OBLA 2FE4A 4ILEA 3OIWA 2DHRA 3MUFA 1TPZA 4B3XA 4PHFA 4DSOA 3GEEA 2FZ4A 1VYTA 2VA8A 1BYUA 1E2NA 5SZKB 2VSXA 1QT9A 4A2WA 2F55A 3I8SA 4TMWA 3T06B 1KSJA 1M8PA 1KY3A 4PZYA 2BT6A 1VHTA 4A2PA 4IXNA 5JFGA 2GF9A 3DKPA 4I81A 1NVWQ 1ZD1A 3GMTA 3PITA 3R8CA 3AH8A 1H8HD 3TR0A 1TUEA 3DEFA 4N3NA 121PA 1CZPA 2FG5A 3QXJA 3WRXC 3H2YA 4C80A 4A0FA 1NLYA 3L4PA 4P3YA 2BVNA 5CDFA 1PLKA 3KQNA 2FPMA 1GAQB 1F2TA 1NVVR 4HUQA 5JWOA 4CYMA 1UBGA 221PA 2L52A 4BFXA 4B35A 1FFVA 1E6EB 4JLBA 4KXFB 1LB1B 3LDAA 4I4LA 1KAOA 4MRNA 3WNCA 2MJDA 3T1QA 3GLFA 4CEHB 1WQ1R 2AWNA 3TR5A 1KO1A 2ZROA 1YR7A 1UDWA 5DHFA 5JI3E 3K0CC 4EDHA 1Q1QA 1E4VA 2JJ2D 3WYGA 3GJ6A 1WRIA 3D8BA 4M0LA 2WPDD 4BLPA 4ZKEA 2DY1A 3AF1A 2Q3FA 5L3QA 3FHOA 1Y63A 3NBYC 4LJ8A 1ANKA 1YHNA 4XTRA 2XSZD 4V0OA 3H4MA 5CM8B 1E6CA 3L0IB 4EPVA 1OB5A 2IYTA 1GL6A 1Z0JA 1E9SA 5EE9A 1G16A 1VCIA 2WMOB 1QOGA 1OHHA 3IBGA 2EQBA 4Q47A 4AYWA 3QPVA 4GT1A 2OHFA 2IL1A 1JR3D 3A8TA 4EIWA 4D81A 4PQYA 5FUVA 1OFFA 3CRW1 2CU3A 2O5VA 4IFEA 1PUTA 4PTLA 2ZS7A 4IEIA 1Q3HA 4X8OA 4HLCA 1F6BA 4U7DA 2J1LA 2GZAA 3L8ZA 2VQSA 2XOKD 1FMJA 4LJ5A 1G17A 1VDZA 3D7MA 4TLAA 3WP0A 3ZIAA 1R6BX 4LI0A 4N58A 1SVIA 4DCUA 4IHQA 1P2TA 3KXIA 2DFKB 3BFXA 4ZIRB 1TYGB 1TAGA 1UWMA 1J7KA 1ZP6A 2OFOA 1LY1A 4WZAE 1Z2CA 4JLVA 4FCTA 2DFNA 5EZ6B 5KYKA 1J7CA 5LD2C 1A5TA 3CF0A 3NVYA 1XEXA 2B7CA 2L0XA 4LK2A 4OHXA 2I1VB 1E2MA 1WWTA 2IYVA 2QTVB 3NBZC 5CIWA 2BHRA 1G5TA 1G5PA 4OHWA 2RMKA 5J4HA 2PMDA 2HCJB 3OAAA 2ZRAA 4C7OB 4P4SA 4POAA 1Q1ZA 2QAJA 4JLPA 2BBWA 2YNMA 2OEPA 1W0JA 1I2MA 4BFVA 4XWKA 3U4QA 4OK5A 3ZVNA 2PEYA 2ACZB 2EYQA 2OM2A 4Q7LA 4DDVA 5B30A 3CPEA 1MV5A 2XZLA 3PXGA 1RRGA 2IYUA 2DBYA 1E2QA 3FHCB 2VP0A 4MRSA 3ADKA 3NVWA 2H89B 1KSGA 2JX5A 2IYZA 3FB4A 4BE7B 4ESVA 3KQUA 5JJIA 5KSPA 3QVUA 4AIIA 4LWZA 1E2PA 4F91B 1U0LA 1XMVA 2IF0A 3BAFA 3VR6A 1G8HA 2C98A 2QMEA 3IPYA 2YOFA 2XB4A 1RIFA 1Z2AA 2VHUA 2VP4A 4RD4A 4KVGA 1RJ9B 5AUIA 5FBRB 4HAXA 2FWRA 1GM5A 4US0R 5AUNB 3QSYA 1KI4A 3HU1A 1BS1A 4XH9B 4I1VA 2JLWA 4IXMA 1NKSA 1YR8A 2IWHA 4TMTA 1NIPA 2D7CA 5DH9A 2EWWA 1L7VC 4NONA 3VNUA 2O8EB 1JJ7A 3T15A 2J7PA 1GVNB 3CZQA 2QIEB 2ZREA 3L0SA 1XLPA 2WWHA 3L43A 4G0NA 1G19A 5KSOA 1OYYA 1L5PA 2IHBA 1KY2A 1SXJC 3IQXA 5IDVA 1QZXA 1AZSC 4FMCB 3LD9A 1ZOYB 1TEXA 3E2IA 1WBBA 1SQ5A 1Q3TA 2FZLA 3KB1A 3BH0A 4LZZA 4O25A 4BZQA 1T5IA 2VHCA 3IIJA 4B32A 2ZRIA 2XB2A 2IYWA 2ZRPA 1G7RA 4D26A 2ZRGA 1PZNA 1CJKC 4NDZA 1C1YA 3QEOA 4C7YA 3K70D 1N6KA 2CL6X 3AV0B 4IVRA 4A82A 1OT3A 2CXXA 2VTKA 3BH6A 2X2FA 4O0MA 1A4RA 3AF0A 2JLXA 2ZJOA 5FOVA 1Z6AA 3DVLA 5EE0A 4HZUB 1JXMA 2VYFA 2VP6A 3K70B 2RGAA 2IYLD 2ERXA 2J46A 3OEEA 5P21A 5C4MA 1E79A 4C0HA 1RRCA 3ZH9B 4XSHA 4IDIA 3AEEB 4D0GA 3LH5A 1TQ6A 2FPLA 3BWDD 3SE0A 2GJ9A 3SC3A 4S35A 2YZ2A 2DWOA 3FKSA 4DB2A 4FIDA 3AQ4A 4JVMA 3K0EA 4RY2A 5FH9A 1N6RA 4PFSA 2MJ3A 2CLDX 1FQJA 1FXIA 4OKSA 3CKLA 3CLVA 2WQYB 2H8KA 2YHSA 5DI3B 4A8JC 3K0CA 4NE2A 1XPRA 1W36D 4V0ME 1QF9A 3Q85A 5K8UA 4V0NA 4HAWA 5E4FA 4Q7MB 4V0MA 4OHVA 3GLIB 2QEQA 4PO8A 2BOVA 2OE2A 5K8LA 1SVKA 3K0AB 1E9FA 5JMTA 4CGZA 1G8FA 5TB5A 5HKKA 1W36B 4E07A 1QHXA 3N70A 5G5HA 4LHWA 2IYYA 3F3YA 3EPHA 2OFWA 4JBWA 3Q8XB 5CJPA 1EESA 4EPXA 4DLUA 4IDHA 3VRBB 1X1SA 4LYHA 1PVOA 1RE0A 3JZMA 5C46F 1OSNA 4QM6A 3RWOA 4FCVA 4JZKA 1ZCAA 2QNRA 4B2PA 4CEJB 3U3JA 1EWRA 3RNLA 5KUTA 2FPKA 2GETA 4X8MA 1JR6A 3EPKA 2PJZA 2CJOA 1Z22A 5IK2A 3AVQA 1PV4A 3IIKA 5CIQA 3F0TA 1ZUIA 4DT1B 1S2MA 2JLQA 3VR3A 3QY0A 2CK3D 5JZVA 2FJUA 1SHKA 2X2EA 2XJ4A 1UBFA 3T1OA 3HPQA 1ESMA 4QJ4A 4Q4HA 3EARA 2A9KA 1J90A 3WY9A 2CJNA 1EK0A 2WWWA 1CKEA 3ONWA 3W6PA 5JJKA 1BMFA 1MOZA 4TT3D 3AECB 2BBSA 3QKSB 1YZKA 3U5ZB 2JJ1D 2V7QA 5LPNA 4AK9A 1CRPA 3W5VB 3P20A 3GQBA 1N0UA 2WWXA 3CWQA 5H92C 4IDNA 4IOMA 5HE8A 1OH6A 1CULC 4XD7A 2VP9A 4CEIB 2ERYA 1VG8A 4I1UA 1A82A 2HYIC 2AFIE 2YWHA 5EUQB 3VHXA 1FP7A 3QF4B 2XZOA 3P32A 4Q19A 4XIGS 1ZIPA 3AP3A 1GUAA 1KDTA 1S1CA 3B9PA 3THWB 1IQPA 1JXOA 2BMJA 4URUR 2LCFA 1VDVA 1RKBA 3QKRB 5B64A 5L3SA 1ZRHA 4PSKA 1KNXA 4QGHA 4AC9A 4Q1EA 5H8WA 2W2TA 4BECA 3NVAA 4JKIA 4G5SA 2EU8A 4LJ7A 1UBEA 2RGNC 3HUIA 4Q4AB 1IY2A 2NO0A 4Y0VA 1SVWA 1G8GA 2VPPA 3OIUA 3HR7A 5JWHA 3SZRA 2C9OA 1T8TA 4A92A 3BOSA 4RD3A 2QQ0A 4URVR 4CIDA 1S3SA 2D2FA 2QM8A 4C3ZA 1JJVA 1OF1A 3B1VA 3W34A 3PENA 4BFSA 4ZCMA 5LD2B 1GKIA 5LDDC 3ASZA 4JLJA 1OPXA 3RAPR 4F4CA 4OHZA 4B3FX 4LJ6A 4YMUA 4ASUA 2XNDA 4YDHB 4DC9A 1WA5A 2WU5B 521PA 1G21E 4OI1A 2D2EA 1HA3A 4FWIB 4ERNA 1TKYA 3C4JA 3CONA 1J7BA 4UJ5A 1E2EA 5KOYA 2PX0A 4TTPA 2GZHA 1D8TA 3KKNA 2FMXA 1L0VB 2IA5A 1CXZA 1ZU4A 1S4QA 2WLBA 2QMUA 2BS2B 3WMFA 1SXJA 2BM1A 2KSQA 1Z6YA 3WYFA 1CJMA 3V9PA 3RS2A 2WIAA 1T5LA 1OXVA 1TEVA 2GJAA 5DE3A 2FDCA 1EWQA 2MSCB 4GMDA 1E98A 1KI9A 2OCBA 1N62A 1S1MA 4GFDA 1SVOA 3TSWA 5JEEA 4W5JA 2QP9X 3PUXA 3KQLA 5DN6A 2Y8EA 1YJJA 2QJLA 2R9VA 3PEVA 2ZYUX 3B2EA 4DUGD 3I4LA 4M1SA 1NENB 1QOFA 1X6VA 4V0LA 4KX6B 2ZJBA 3TAHA 3U3KA 4WWMA 2IXEA 2XAUA 4DLSA 1XPUA 1EFCA 3AE9B 3AKCA 2HUPA 3ZZ0A 1I2DA 1HTWA 3FMOB 2ONKA 1KDOA 3KFXA 5EJEA 5J40A 2UZ3A 4TLBA 2AR7A 3CX8A 4A8JA 3KWLA 2RHDA 4MGZR 3NWJA 4C4PA 3NEJA 3IHLA 4JYBA 1DO0A 1JNYA 1E2GA 1JQ4A 5LB2A 2C8VA 2PH1A 3AF4A 2RB4A 2W3SA 3VKHA 4B2LA 3AE2B 3TIFA 4DWJA 3H86A 1GPXA 2ZS8A 1VYUA 1XEWX 3SR0A 3WHLA 5TY0A 1UKEA 4HLDA 1NSTA 1AGPA 1Z8FA 1DADA 3GLHB 3MRSA 2PBRA 1KOFA 2I4IA 4Q7KA 3QG1A 3WXMA 2A78A 4HAUA 5A4JA 2OG2A 3KTAB 1SF0A 5HCIA 3VU9B 4DLRA 1G6HA 2VBCA 1TQ4A 2G83A 1YQTA 4I1OA 2BKUA 5E7IA 2Q5WD 3K0FA 2W6ID 1HE8B 2G1JA 2GTPA 3EUB2 1P4SA 4JLAA 4EUNA 3K1JA 1Z63A 3I73A 4JWSC 2VHQA 1NI3A 3SFZA 2CCJA 2GK7A 4YTPB 3MLEA 4LV5B 4A8JB 1ZM9A 4IW3B 4F7WA 2QT0A 721PA 2C9CA 2VF7A 5LB4A 4D25A 2QAGB 5KNDA 3AH7A 1LS6A 2IS1A 4LBWA 4G5RA 1VPLA 4CF7A 3P63A 3AN1A 2DYKA 4I99A 3PR1A 3L2OB 1IAQA 1B9RA 2CEAA 2EWVA 4Q4JB 1QHNA 3RRZA 3JVVA 4K46A 1NMYA 2Z6VA 3TBKA 4ZOHC 4EQ6B 4AKEA 4ZV4A 1SHZA 4EFNA 3KZ1E 1FX0B 2Q9BA 4JBYA 2XTNA 5FOWA 1UBCA 4X8HA 1ZMXA 2ZRCA 5JSZB 4PC6A 5FR1A 4DHEA 2FA9A 1QG4A 1DOIA 1ZM3A 4M2LA 1OXUA 4NTZA 4IVQA 4Q03A 2PJRA 2F1HA 2ZAMA 1G7CA 1W0KA 1ZM4A 1OE0A 1BIFA 2RGNA 2FSFA 3W3ZB 3AGQA 1MKYA 4I1SA 2KB0A 4D0LB 1TF2A 2IC5A 2A5YB 5L8VA 3C14C 4M8NE 3VR5A 4B43A 1I4DD 1G8PA 4WQMA 1Q12A 4WBSA 1VIYA 3FGNA 1W5SA 2CL0X 4PR0A 1XO3A 2W58A 2I1QA 3AF2A 4JSTA 5FBLB 3TKLA 2QRNA 1P72A 2QQEA 3LLUA 3FMPB 1OIXA 2FSGA 2MMGA 3THYA 2IYXA 2IS6A 4FMDB 4LTUA 1KK1A 4ZDWA 4TLDA 2WOOA 1ZUD2 1HUQA 1J8MF 3EWAA 2R65A 4OQLA 3TJZA 4P4UA 1TX4B 4JLKA 2C9YA 1NEKB 2KBFA 2YWEA 1QOAA 1K5GA 5AK0A 4N0DA 4YLGA 3DMDA 3A4LA 1QHHB 2ATXA 1J8YF 2QI9C 2ZAOA 1KMHA 3FMFA 4TYQA 4KLNA 4BZPA 4E03A 4B3GA 4BWYA 4PAMA 2PZGA 4O2LA 5FBVB 5G5GA 4GPTA 2W6JD 2OXRA 3HVZA 1VIAA 4KJZA 1BOFA 1XX6A 3LRPA 4JT2A 3UPUA 4XVRA 2ZTSA 1OW3B 1ONBA 4P4TA 2J0UB 4KO8A 4Q02A 3CH5A 1G6OA 5IT5A 5FR2A 4N6EB 2QBYA 2GCNA 3L0PA 1QF6A 4U5XA 3ECCA 1G8YA 3R7WB 4KU4A 5BQ5A 4OHYA 2ODNA 2V4ZA 4G5OA 2NMVA 1NNEA 3NH6A 2BS3B 1CBUA 1SVSA 2O8BB 3RS7A 1YJIA 3CB4A 1R5BA 1YVDA 3P27A 1RFLA 1DG1G 1EFTA 1TKEA 2D7DA 1OYWA 4KHZA 1WYGA 1Z0DA 1E9RA 4YT0B 1BYIA 2OLKA 2D74A 3DOEA 4YTMB 2NO7A 3EZ2A 1E3MA 4FXPA 1DAMA 2PLRA 1NY5A 1NVUQ 2AL7A 4URYR 5EQTA 3RSLA 2HTME 2IK8A 2KJQA 1COWD 4D6PA 2B6HA 4M22A 1SVMA 1YQ3B 2EYUA 1MO4A 3HYRA 3K9NA 3AUYA 4C9BA 3CF2A 4KITB 5JHHB 1GRQA 1SVLA 2KAJA 5EE1A 3W5IA 1SKYB 1FMLA 4M21A 5BYKA 4UJ3A 2GF0A 4ZHOA 1TQDA 1KJYA 2PZFA 1XD8A 3QPUA 1U8YA 3B1XA 4NYMQ 1OKKD 5FPHA 5IF9A 2HF9A 4BFYA 1JALA 1U9IC 4BFZA 3ZQJA 5JJLA 2YYZA 1W47A 3PEWA 1R0ZA 2HLDA 5JI2E 5KTYA 3IEVA 2JLUA 3SBEA 1F48A 1AK2A 3EXAA 2E3TA 3TUIC 1DELA 4BZXA 1I4LD 3LVQE 3QF7A 1DG3A 2JGNA 2ZVPX 2D62A 3QKUA 4P0TA 1JRPA 4C0SA 3SQWA 4US1R 1MO5A 3FMIA 2ZRKA 5FOTA 3SS8A 4DDTA 1RC8A 2VO1A 3PCRB 1N63A 1XNJA 1W48A 2VSOA 1IN5A 2VLIA 3A4NA 1CJUC 3IHWA 3Q5DA 1N60A 2M56B 1MH1A 2FF7A 1HQYE 3SNHA 3NHBA 2WWGA 1MABB 3PG5A 4QGFA 1R0XA 1Z06A 3AE1B 2B92A 1KK0A 2BBOA 5FL7D 2FEMA 4KLZA 4N0EA 1MRNA 4DZZA 2OZEA 3CBQA 1DOXA 4C30A 5J4KA 1GP2A 2BV3A 2W0SA 1EGAA 4LJ4A 5KU1A 1DGJA 1N0WA 1A70A 3A1TA 2AKYA 4TQ9A 4G5GA 4R71A 1NN0A 1OFHA 5JBQA 4LYFA 4GSYA 1XXHA 4C2TA 2NG1A 3OIYA 1KI8A 5UKDA 3QQ5A 1H8EA 2ZQ5A 3WRYC 3QOFA 3GLGB 1NJGA 2G0TA 4KI0A 1ETUA 3CWZA 1XCPA 1KKMA 3J81k 2RGEA 5EZ5A 1H8HA 2F1IA 2XTZA 4P6VF 1XEWY 2WSSA 3EZFA 4HAVA 3SI7A 5BN3A 3KFVA 1TU4A 3U6KA 1JWBD 1CR1A 3O8DA 4TYWA 5EXTA 3ZZUA 4URWR 2NO6A 1YU9A 1SULA 3AUXA 1NJFA 1GRRA 3HU2A 3NH9A 5CM9C 3NVZA 3K9LA 1FMAD 1KKLA 4DIDA 2ODWA 2PX3A 1S9HA 4NHOA 4EPRA 1D5CA 4B3BA 4M9SA 2WU2B 1XDBA 1F3OA 2JASA 2ZE6A 2GNOA 4BRWA 5KNBA 2ZI6A 1QHYA 3UMFA 2ODBA 3K9GA 4LBYA 4TMKA 3N5CA 2ZE7A 3U44A 3THXB 3OFND 2H5EA 1GG2A 4LRWA 1DAKA 1JECA 1T3QA 2VL7A 4OQXA 3VTKA 1WMSA 5B58C 3BFKA 5F3WB 4JJZA 3X1DA 1E2HA 1JI0A 1VCNA 3ZGXA 2AXNA 5HZHA 1KDPA 3AKEA 1JR3E 1DAFA 4UXIA 1NG9A 1CLUA 5B57C 5J4YA 3W9YA 2ZYWX 1NIJA 3TSZA 1N6HA 1FFHA 4WA7A 3KKQA 3C15C 3NG1A 4BEJA 4V03A 4EJSC 1QBKC 5M04A 3KX2A 4ITRC 3CNLA 4C0AC 4LHZA 4A0RA 3QKTA 2AD5A 2A5DA 2RHMA 4HUQB 1F2TB 4TSFA 4WVFA 1TMKA 4YTNB 4HB2A 4M53A 2F1JA 3Q7PA 1IY1A 2ANCA 5MPOA 1GITA 2R6AA 4DLYA 3GLFB 1KO7A 4MRPA 5F98A 1HV8A 4DXAA 1E32A 1G64A 3L0OA 4ZCIA 4O3MA 3AEBB 4ITKA 2W00A 2RGXA 1DAGA 4E22A 2BC9A 5L3QB 3UG7A 1RYJA 1FL9A 1L4YA 1KNQA 2ZYTX 3LW7A 4A1FA 1XTKA 4CVNA 1CJEA 3MSXA 3OEHD 4PPQA 1Z3IX 2L83A 1U98A 3LBNA 4AG5A 1NF3A 1Z0AA 5G3ZA 2QPAA 1VYVA 2WVJA 4PPFA 2CHQA 3SDZA 4E5UA 1JROA 4BLOA 1XMJA 3P4SB 1E2DA 1L8QA 3RC3A 1E2JA 2ZR0A 3HWSA 5AJWA 3ZIAD 3WP1B 2Q9AA 4URXR 4YC7A 1W4RA 1U9IA 2Z0MA 4DIEA 3B1ZA 3VFDA 1TUIA 1UFQA 3AE6B 1NG1A 2P6RA 1G4AE 4MYHA 5E7MA 1ZBDA 2AD1A 2KBEA 1E0AA 1E9CA 1IN6A 4M9QA 4KODA 1QOBA 1E96A 3GD7A 4R7ZA 4MGKR 2P5TB 5JLJA 2GCOA 3VQTA 3MWJA 4AKGA 2QSYA 1XFAA 1JQLB 2DPXA 2R44A 3OAAD 2P65A 5FOSA 1XWIA 1T3LA 4WW0A 5JHGB 3FHTA 2V6JA 1XEXB 1W0JD 2DB3A 1W4BA 1UKYA 2BCGY 3P4XA 2J5XA 4RKFA 2V3CC 1BO6A 3CPJB 1OIWA 4HLUC 1GILA 1L4UA 4P4SB 1GZSA 1KSFX 2VP5A 3U4QB 2WHXA 2GEUA 3NBXX 3A36A 3KB2A 3NRZA 4AKIA 3E1SA 4RD1A 2I3BA 3ADDA 1R7SA 4RSGA 1IN4A 4RCZA 4TL9A 1XJQA 2K22A 1EFUA 3N2EA 4NMMA 4D82A 3R9XA 1V43A 1DEKA 4WIAA 4DLVA 2WDVB 5AR1A 1AKEA 4NYMR 5J47A 3P4PB 1U81A 2TMKA 4GI7A 1E1RA 1X3SA 1G7SA 4PC2A 4XVQA 3HR8A 2EFGA 1V5WA 5H68A 2X77A 3EC2A 2FSHA 1WE2A 2LKDA 3SN6A 5TVKA 2AX5A 4DBLC 5TMPA 2O8CA 4UXJA 3DO6A 1QHIA 3AEGB 2GESA 5DLQC 3FFBA 2J7PD 3FOZA 5SZJA 2ANBA 3GLIE 4TMZA 2W3RA 1P9NA 2ZS9A 1KZ7B 3WYAA 3RS3A 1N3BA 4LYJA 4DLZA 2QENA 2IHYA 1GL9B 3QIAA 3MWLA 2BS4B 2PT5A 1W4AA 3ZVRA 4IRUB 3AB3A 1KIMA 3CH4B 3NTUA 3LB8C 3H0KA 4IEEA 2REXB 4CT5A 3PEYA 2WMNB 4BEBA 5BW8A 2IUSA 1GNPA 4B76A 1OQQA 2H88B 1T3HA 2IWRA 1VG1A 4JBXA 5CK5A 5BYJA 3AE3B 2GCPA 4D4KA 2VH5R 3AVTA 2CVFA 4FINA 3KKMA 2XXAA 2HEIA 2D4HA 2ZRLA 2ZSBA 3RS0A 3UIEA 3U7FB 3AP2A 1GAJA 2ZANA 3B2GA 4JKYA 4HB0A 3SYLA 3T5GA 1NY6A 5TV2A 3VRAB 2C96A 4MGIR 3OEED 1YRAA 4RD6A 3SHFA 4E09A 3GJ4A 2QRZA 1QG2A 3GCGA 4UNPA 4KV9A 2CK3A 4RZXA 4UQOA 4EJSA 5JS7A 2K5UA 2VHTA 4RFSA 3FKSD 2WKPA 4B3CA 5BWMA 1AGRA 4BUJA 1ZC4A 1DS6A 2OCPA 2XNSA 2J9RA 3TQCA 4ABYA 3U6BA 4Q00A 2GK6A 2KWIA 3AVPA 4GZMA 4WZBE 1O3YA 5AWFC 821PA 4FWTA 3E70C 1VCOA 4TT3A 4AURA 2PVOD 2JJ1A 2AFHE 1XPOA 2YINC 4KAXA 4S2EA 3ND8A 4A9AA 1N6OA 1QDEA 2BJWA 4Q7JB 3MG9A 3OESA 4ZO4A 2WICA 1C4OA 4JJKA 2CHGA 2F43A 1JBKA 1FUUA 4UKDA 1Z6TA 4A0GA 3F8TA 4NP6A 1E2LA 5JRZA 3ZD6A 4TWZA 4YDSA 4GOKA 4PQRA 1L6UA 2WJVA 3AMZA 1EXMA 4PSAA 1Q1BA 4R98A 1LW7A 1M7BA 4Q1CA 1RYHA 4Q66C 2QTFA 1LF5A 3RS4A 4N59A 4KYIB 5L3VA 4KVAA 4KSBA 1E1QA 3K09C 2DFLA 5H8YE 1QHSA 1R5OA 3FKQA 4TQAA 5EXPA 3AB5A 4BLTA 4PZLA 3OE7A 4AYTA 4LYAA 1M6NA 1N61A 3I1FA 2VRWA 3B1WA 3CF6R 1A2KC 3BC1A 1M74A 3SFDB 4FI3C 4LC0A 1OH5A 5GJBA 4W5WA 1SB3C 3ND9A 1P61B 1R8SA 2ZE5A 1OXTA 4JLNA 1LVGA 3P4QB 1BMFD 3X1YA 4FMCF 3DHWC 2Q0HA 2NTYC 1HH4A 1XEFA 4IDPA 2V7QD 2N1BA 2ZSDA 2FH5B 4JMPA 3V4FA 2W83A 4Q4HB 5J5CA 1NYRA 4TLCA 2A3RA 2C78A 2VIIA 3A1WA 1W7AA 4L8GA 4DJTA 1KI6A 1P60A 4F93B 4TL8A 4DCTA 3EAQA 1B0UA 1E9EA 1XCMA 4LSGA 1ZNYA 2ZRMA 4ACAA 4FN5A 3K53A 1IONA 2ZRJA 4G5QA 1TNDA 4EAQA 4QC2A 4HLUA 1E2KA 1N5XA 1ZM7A 2QN6A 5FTLA 3BJIC 5C2JB 3TVTA 3R9IA 4RZ3A 1KFYB 1VECA 4XWAA 2FU5C 3S1AA 1T3SA 4HI0E 4LOAA 5SZIA 4MDEA 5L3SB 4GOXA 5JCZA 3SFVA 3TLXA 3IILA 3VMFA 1U0JA 4ON9A 2H1LA 5FOUA 3O8BA 5J4LA 5EUMA 2NPIA 4LHYA 2JIZA 2O0KA 1AJEA 2GJSA 4HB4A 2XGJA 1LNZA 1VCMA 2ZE8A 4NCIA 4W7SA 3PUYA 2V54A 1W5TA 3D6TB 4GRAA 2PKOA 1M2OB 1N5WA 2V8OA 3EG5A 3I8XA 1OIVA 3GEIA 4G3XA 1AIPA 1T9HA 3FTQA 1EWYC 4BQSA 4TZ0A 3GFPA 1ZNWA 2E87A 4JYCA 4PANA 4PX9A 1YZQA 3VR9B 2BCJQ 4R9UC 3TAUA 4GBMA 1Z28A 3P1MA 1NSFA 1G3UA 1GL7A 4GP6A 5GXGB 5EE5B 1N25A 3B8HA 3PUZA 1N5JA 3DKVA 2B8WA 4GL2A 2ZEJA 2ZI3A 3LQRA 3AVXA 4A4DA 3DDCA 1DTSA 3SU8A 3BS4A 4JVNA 2AX4A 3TW4A 4PHGA 4K81B 2ZSEA 3N2IA 1JQJC 4YMSA 3I72A 4FW9A 4OK6A 3P4RB 1U8AA 1GIAA 2VP2A 2O0JA 2GEVA 4IOJA 4Q01A 4B47A 2ZJYA 4UNNA 5FBWB 2GZDA 4NCJA 5H1YA 4YXWA 4JWUC 3VX4A 2OCYC 3L8YA 3AM1A 4DRZA 3X1XA 1SXJB 2WWFA 4DSUA 3CNNA 3U61B 1J2JA 3UXMA 3X2SA 3KDSE 2J7KA 1EX7A 1N6IA 4B48A 1JWAD 2E9SA 1PLLA 4A2QA 5DN6D 4KFTA 4M9XA 4PC7A 5FI1B 1FTSA 4NH0A 3LO5A 2YWFA 2GVZC 2MJEA 2PEZA 3NIBA 4MKIA 4P31A 1B23P 2WP9B 1A7JA 5HCNA 5D3MA 2ZRBA 2XEXA 2QE7A 3EPJA 5TXGA 3FE2A 4LC1A 1KYIA 2ORVA 4X8LA 2PIAA 2W6IA 2GWHA 2GXAA 3C5CA 3C5HA 4PAOA 4YMWA 5G40A 5KSYA 3AEAB 4A15A 2JAQA 4LX0A 4B74A 3ABVB 2C99A 4QNRA 2J41A 2G1EA 5FTJA 4XTCS 5HR5A 1YZGA 2G1KA 2GXUA 1CP2A 1KRHA 2WJYA 4DLWA 2F9LA 5KSZA 3IGFA 4HUTA 3AE5B 2BMFA 1AS3A 2KI5A 1W2GA 2IT1A 1OLOA 3D3QA 2WAYA 3KXKA 3BFVA 3OIVA 2O8FA 4FMBB 1YZLA 4D4LA 3U7HB 3ZS8A 2WDQB 2FFQA 1JAIA 4JSYA 3RDPA 5FUYA 2OUKA 3T1VA 4ZI3A 3ZLJA 3JVUA 1F2UA 4M1MA 4WAUA 4PXAA 2ZSFA 1XTIA 4EFLA 2GJ8A 2IYRA 2UVQA 3AVWA 3B2FA 4LUCA 2JDID 5G53C 3SQXA 1ZAKA 2FFHA 2ZU0C 3C16C 1P3JA 3B60A 5C4GB 5J4VA 4NL4H 3K09A 3V4RA 3QPWA 1WB9A 2BMEA 4ARZA 2GRJA 4H9GA 5FBQB 4OJKA 1EFRA 3SJZA 5C2TB 3CIRB 2AXPA 1AA9A 4GDFA 4V0KA 4KCGA 3B82A 3CZPA 4AI6A 4C0JA 3K0FB 1NMXA 1US8A 1E9DA 4US9A 4B34A 4QRHA 1NBMD 2REOA 1OXXK 1U8ZA 4RZUA 2BEKA 1KJZA 5AUKA 3FPAA 4L15A 5KHOC 3EASA 1X8KA 2HV8A 5EP1A 1XB2A 3GJ0A 4OQNA 4M1YA 2O8DA 1V97A 4TYPA 2BEJA 4UNSA 3TE6A 3DMNA 4KFUA 2HYDA 1HT2E 1TADA 3LQQA 3NDBB 1RZ3A 3DOFA 3LAWA 4C0LA 3KQHA 4OJQA 2J59A 3UG6A 4QG7A 3LLMA 2OXCA 5BN5A 2WTUA 1CR4A 1XD2A 2EFHB 4QBHA 5AJYA 3VX3A 3WBJA 4UNRA 3NC1C 2R8RA 2ZI4A 2A5JA 1UKZA 1W0KD 2CNWA 1K8RA 2ODEA 3I5YA 3HYTA 1GWNA 5DSZA 2ZYVX 3T34A 4ARZB 3W90A 5FFMA 2Q3HA 1KGDA 3V00A 3IIMA 3M6AA 1NVID 3I61A 4US8A 1II9A 2IXGA 2YOHA 1PJRA 1YRBA 3PUWA 1MR3F 1PUJA 1XTSA 3ZDQA 5AUPB 2QPTA 4D80A 4MKFA 3TMKA 2P67A 3LXRA 3ADBA 1YQ4B 1QVAA 2C2HA 1EFHA 1DOYA 3VR2A 2CJWA 1GDDA 3IO3A 5CLLA 2JEOA 5AJZA 4DEXA 2MSDB 3SYNA 1E2IA 3DL0A 1YKSA 3QI2A 2FBWB 3A58B 3W9CB 2GEDA 3A1UA 2YV5A 3BB1A 1D6JA 3BERA 4HDCA 3THYB 1G3RA 3PO0A 2GKSA 4Z8YA 4EFMA 5KDOA 4XOIA 3B13B 5F9HA 2G9NA 3R9WA 1FO4A 3OHMA 1U0HC 3NKVA 1SKYE 3GFOA 1FIQA 3Q9LA 1AZTA 5TARA 1MO3A 4M1TA 1COWA 4LJAA 2QPOA 3U3MA 1X8JA 4ZPXA 2O0HA 1KO5A 1GKUB 3H1TA 4RCYA 4AWXA 4XWOA 1X86B 1TTTA 1N6LA 5CLQA 1KMHB 3LWNA 4L9WA 2QY9A 1P2UA 1YZNA 3QJYA 4B33A 4ZCLA 3TW8B 3EC1A 4Q9KA 1CF4A 2PCJA 2A5GA 3T12A 1QRAA 1JEDA 1OKKA 1IN8A 1WRBA 2ZI7A 3LA6A 1CR2A 1NVXQ 2GXQA 1NP6A 3AEZA 4IDOA 4D2IA 2QBYB 1IBRA 1TL7C 4C2UA 4Z1MD 4TZ6A 1R0WA 1H65A 1FXAA 2D06A 5JECA 1WGKA 4WXPA 1DBSA 3RRNA 1ZC3A 4DEYA 3EIQA 1AKYA 2F6RA 1UKVY 3KQKA 4A36A 1Z6XA 2FNAA 3CM0A 4MRRA 5EE3A 2JLRA 2CVHA 1P9RA 1P73A 1HQCA 2B21A 4YONB 4W9MC 3JZAA 4D4JA 2QG6A 3G82C 3TUJC 4Z54A 4V02A 2EW1A 2RGCA 2N0SB 2UKDA 3SJAA 2R2AA 1KO8A 1XP8A 3AGPA 3CWIA 5FPSA 2AHOA 2OCAA 4WXRA 4CRWB 1TF7A 4JT4A 1U90A 2WV9A 3QBVA 2CCKA 5KNCA 4L9SA 1K5DA 3CR7A 5DYGA 4ZHPA 4TTRA 5F2EA 5FL7A 1T4GA 3SFEB 3W3AA 1XZPA 2V55B 3O8CA 4LY6A 2RGGA 4US2R 1AQYA 3GLGE 2KMMA 1EX6A 1W2HA 1XTRA 4CW7A 3U7GA 1ESNA 2WKQA 3QBTA 5DO9A 4AY2A 1FRRA 1YJ5A 3MJRA 4HAZA 2JA1A 4YSXB 3LXXA 1DO2A 4G1UC 1N5KA 4FMDF 4QOSA 4M4SA 3IO5A 2E1RA 2G77B 2IEYA 4B6FA 2QROA 2Q21A 3B78A 1RYFA 3KJGA 4QJ3A 4IOKA 4BLQA 1SZPA 1K6MA 2AWOA 3K70C 1RRFA 2IUTA 1AS0A 3HRDD 4PPGA 2IEZA 1G1MA 2CBZA 4NYIQ 4TYYA 1ZNZA 1LF0A 4DSNA 4Q9JA 2IS4A 4CEHA 2ZJ5A 4NU0A 3ZYCA 2P6NA 1C9KA 3IDQA 4JIMA 3UKDA 5E3HA 3RYTC 1FQKA 4NZYA 4EPWA 3BB4A 5F9FA 4EKDA 2JCSA 1GNRA 4U02A 2IX3A 1NN1A 4CZ2A 1XMSA 4DCNA 3CIOA 1S9DA 4PHHA 1NLFA 1TKGA 3KL4A 2ZVQX 3DZDA 1ZVQA 1ZINA 4AYXA 4Q21A 2QMHA 1XCGB 3OFNA 4OBEA 3W8RA 2ZRHA 1W36C 2JJ2A 2G0NA 5KO2A 2ZETA 1Z6GA 4ACBA 2YVUA 1GSIA 2WPDA 5D3QA 2WS3B 1H8ED 4BASA 3TUZC 4PQFA 1RM6C 1XTJA 1XMIA 2KE5A 3ICEA 2NO1A 1P62B 2JLSA 4USAA 3GJ7A 4ZDJA 1XBTA 3REFA 1G41A 2XSZA 1OH7A 1XXHB 1FUKA 1T91A 3B9JA 5DYIA 3LXFA 3CPHA 2WIBA 4BFTA 3UMRA 5CDFE 3K0SA 1UF9A 2WSSD 2BKEA 4Q9IA 3Q5EA 1KK3A 2WWIA 2CCGA 2ZI5A 2AKAB 1G3QA 2FOLA 5HPYB 2WAXA 1J99A 2F3RA 4WZ6A 2LKCA 3UATA 1NL3A 1G5RA 1JR3A 2G88A 2PCLA 3WHKA 3GLFE 4D4MA 1OQRA 1XZQA 3ZD7A 1RVDA 4QXAA 2XJ9A 3QXSA 2ZITA 4IKEA 1Q1EA 2OT3B 1W46A 4ZIRA 4AG6A 1RFKA 1TJEA 4C0KA 2QMOA 3VKGA 2PMKA 2YOGA 1CJTC 2XOKA 1JPJA 2X1VA 4AKHA 1JW9D 2Q9CA 2Q6TA 2QTHA 1JB1A 1KZGB 4IDQA 1A1VA 3P4YA 1MT0A 2CE7A 3HDTA 1XLNA 2YC4C 2LWIA 1F60A 2J0QA 1NN5A 1NLZA 4C7OA 4PPNA 5G41A 1Z5ZA 2OLJA 2RAPA 3R20A 3U44B 2JATA 4F92B 3M1IA 4NCHA 3UANA 2EFCB 2BWJA 1Q44A 3OEHA 4EPTA 1M34E 2JLZA 3TGPA 3DWGC 4AD8A 2GHIA 4PC1A 1HT1E 4RJLA 1M7GA 3RLFA 4B71A 1T6NA 1OHHD 5BN4A 1ZD8A 3NDPA 2LEKA 4H1UA 3QXXA 5C3JB 2ZPTX 3D31A 4H1VA 2ECKA 1Q22A 2ZR7A 5HE9A 5HZKA 2GDJA 3I5XA 3DWMA 3WNBA 1JEEA 3ETRA 1UPTA 4TSFD 2J0VA 4TL6A 2Z4RA 2NGRA 3IEUA 5FPYA 1RJ9A 5E95A 1KK2A 4GNKA 3OF5A 4MKHA 2QSZA 3AEFB 1R10A 2ZUDA 3TH5A 1J70A 2Z43A 2WZQA 5JS8A 1XLOA 2ZM5A 1OB2A 4ZDKA 1Z0KA 1OFUX 5GJVC 2H17A 5GVSA 1VG0B 1FFUA 1Z29A 1UEIA 4RD2A 4JL8A 4A6PA 5BXQC 2O8EA 2RCNA 1G18A 1KF6B 3FVQA 3PVSA 1IJFA 5AJVB 3Q72A 3A1SA 3EIHA 4LBVA 2VSFA 4O2RA 3P1JA 1OXSC 1PFDA 1P5ZB 4MUBA 3EZ9A 4QL3A 3AKYA 1E99A 3LY5A 1W1WA 3KUCA 4W5HA 5JCPA 2QP3A 2HJGA 4RFVA 3P26A 1RW4A 1KI1A 4MKGA 3QXHA 3B7GA 2G6BA 1YZTA 2YWGA 2RKOA 1KHTA 4QJ5A 4ZKDA 1HURA 1NYQA 1T0JB 2QGNA 1Z0IA 3AM9A 4PO1A 2FSIA 2IUUA 1DOAA 2ORWA 4G01B 5A0FA 3CRVA 4LGMA 3BIID 2WDRB 4HZUA 3BGWA 2EFEB 3LX8A 5GJWC 2XX3A 3PV0A 2GCOB 1QLBB 2JQRB 3ZJYA 2WJGA 4A6XA 3GJ3A 2ZRFA 3KXLA 2ZIAA 3K9HA 2NIPA 2V6IA 4A0HA 3C41J 1AQUA 1F5NA 5DI3A 3NVVA 1L6VA 4OQFA 3U60B 2EVWX 3GLIA 4JL5A 3LNCA 3K0AA 3NS1A 2FX3A 2O52A 2P2LA 2H18A 3QNUA 1LS1A 4Q9LA 3T61A 4DCSA 2FGKA 3UK6A 4PSVA 2QORA
chains in the Genus database with same CATH superfamily
4TTAA 3RVNA 5D7BA 2EELA 2E4VA 4CDRA 4MK4A 1F0ZA 2A5FA 3RABA 4LZNA 1Z35A 1BXZA 3DYVA 4AVYA 3N2YA 3UFBA 5BSGA 2OBXA 4EZ6A 2ZYHA 2A9OA 4HGPA 3D6NB 5AJXA 1IXKA 1ZQYA 1VKOA 4C0QC 1E7UA 3SMQA 3F7NA 4R1MA 2I8CA 3K6SB 4JUBA 1VJ0A 3DDWA 5EMKA 1UMCA 1KEZA 1RLFA 1JSXA 1HFEL 2L32A 2BFCA 1DC4A 2CHFA 2WJJA 2XXAB 4ZQBA 2VPXA 2IYQA 2FFAA 4H0NA 5IW8A 5DLGA 2JY6A 4I8XA 3B0YA 1RIIA 4DMFA 1G9XA 3PWKA 2J3EA 3O91A 5DM70 5LZ7A 3QXCA 3L0YA 1I7LA 1S2DA 3V60A 1HGXA 3ZNQA 1BH2A 4ZWNA 1EVZA 1ED1A 3UW1A 1IWOA 1IUEA 1F38A 1CY8A 1G2QA 3WIOA 2JKZA 1KGSA 4QBGB 3VZCA 1PDXA 2QUZA 3R5KA 1AW7A 4OGFA 5ELLA 3HEBA 4LYYA 1T0HB 5ADHA 2XMCA 2I2BA 3NYRA 2IOFA 1OFTA 4EO4A 1X9GA 1KI6B 3A6GA 3VSEA 3K1ZA 1YX6B 3LC0A 1OBHA 3BXXA 2HIMA 1Q57A 2PO5A 4Q45A 2G5PA 4H35A 2E8MA 4A8TA 5TMBA 3UICA 4AN0A 3DM5A 4K8OA 4Q48A 1A5AB 4OI0A 1SOAA 3UYKA 3KPJA 1WH3A 2G6TA 3KC2A 3TLGA 1P5RA 3J7TA 1FTGA 4MUNA 3WU2U 3WMXA 4WZZA 1D2NA 4CMGA 4I8IA 2IV3A 3FUWA 2NSLA 3LGAA 4BDPA 3R75A 4YXDB 5B4TA 4IWNA 2P1DA 5AW9A 1AX9A 2DX5B 2W11A 1YL7A 3BK7A 3N9IA 4B6EA 2WW8A 3VO2A 1ZQNA 4JR0A 4HYKA 4ACFA 3CEMA 4FE3A 1XJ5A 4FXOA 4KKJA 2JVKA 1MRSA 1XLUA 4QM7A 4YECA 3VDZA 2OCGA 1CEYA 4UB8U 5HKBA 3KWJA 1XYVA 3CNOA 3MGKA 2ATLA 5D7NA 1C9DB 1J2TA 3PQCA 3KQTA 1PEKE 4KDLB 2QL6A 4QWWA 3WQBA 1XA3A 1HEKA 1QHHA 3HB7A 3A9KB 1Z0FA 4N41A 3RASA 5CFNA 1WB4A 5BY2A 1SG6A 3IMEA 1GZ6A 1PW5A 2QR5A 2EQYA 3AEDB 1FDOA 5A4FS 4F4JA 3V1YA 3MJSA 2X5OA 3ETEA 3FXAA 3BG5A 3UQZA 1R6AA 2Z0DB 3C3KA 4AS2A 3FNGA 2C97A 3GYBA 4JCCA 2I22A 5AK3A 5KJFA 3GB1A 4AUEA 2HCBA 2ZXUA 5LBIA 3SV4A 1D2EA 1PFQA 1WPXA 4Z4EA 1OGIA 1XD2B 2GILA 2O3RA 2PXHA 3RC2A 3MC8A 3EGDB 4E74A 5KPDA 3CMMB 4QXPA 1Y1KE 2IHUA 3D6MA 1U6IA 2RJNA 1WXVA 2J45A 5D94A 4J03A 4LKRA 4KGSA 3LBIA 4YAIA 2BSAA 5KFCA 3LDGA 3RVLA 4GMXA 3GJ8A 3IG3A 1G7TA 2A9VA 1UPFA 2KJ5A 2YFHA 1T5BA 5H16A 4B6OA 4BN0A 5BRAA 1UBHS 2K0PA 2GZSA 3DGFC 4KXVA 3GLGA 1E3JA 2HRCA 4EK9A 3LYYA 2VAWA 3IAS6 3QENA 1IOZA 3ET5A 1ST3A 1R6DA 3BIOA 2MMCA 1FFAA 4NVRA 3PPXA 3V5NA 4D0RA 4JITA 1L8XA 4YIKA 2K4EA 1UMDB 1YJCA 3DDHA 1NW6A 3RS5A 2A1UA 2C83A 7MDHA 4TVKA 1CQWA 2V4UA 2XH8A 4JY7A 4FZ5A 4RQAA 3TSAA 4RNCA 3HA7A 1NK9A 1AN9A 1M66A 1KOLA 1H8HD 2BR5A 5CDFA 5HKAA 1F12A 5JWOA 2QAIA 5GONA 4BFXA 4YP5A 4MRNA 3WNCA 2OAGA 3IAXA 2P9JA 1YBVA 5I3CA 5GWXA 1T3TA 2WPDD 2VSYA 2XUIA 2MJLA 5JZ9A 3LOUA 5WRFA 1PQYA 2PKWA 5TS3A 3L0IB 3IELA 3OJLA 2IEIA 4CU2A 4KLIA 1QOGA 4F6RA 2QB1A 3T1YB 3H1GA 4W5QA 1KZYC 3E3OA 3ETCA 4Q12A 3WANA 1PFVA 5JTIA 1Q3HA 1UOQA 4HLCA 1PGPA 4OJMX 4I1PA 4ZYUA 2ID8A 1Z4PX 2LBPA 4LRTB 4NRDA 3IRVA 2E4AA 3HCAA 3BHIA 2XOKD 1FMJA 1E5QA 4IG4A 1NOKA 4IHQA 3TLAA 3QV1A 2ID4A 3U7ZA 3VFKA 4EZJA 3AY7A 3PTZA 4LK2A 3HZZA 2ZG6A 3FR8A 2Q28A 2BBWA 4BFVA 1W0JA 4OK5A 1BU8A 3BZCA 3I9NA 3HEAA 2EYQA 2JZZA 4DM3A 1F6WA 3NVWA 1TY2A 4EVQA 4Q4DA 2PUGA 2LHEA 3UB4A 2LYBA 4INPA 3SD5A 1RJ9B 3OZSA 4II2B 2IWHA 5DH9A 2C4MA 4XGRA 2Y9PB 1G9TA 1FSFA 4Y30A 4ZVNA 2CNLA 2B4YA 4G0NA 1LK0A 2C2WA 4KVFA 1LSSA 4N82A 2BP7A 4GM1A 3G6VA 4Y6RA 4HGYA 1MN8A 3NTOA 3CV3A 1FK8A 3GG2A 4B6PA 3I83A 1VJGA 5CVUA 1IEXA 3RVDA 4JUDX 1KAHA 1O4VA 4ND1A 4O0MA 2JLXA 1S8AA 4F5EA 5TISU 4G5HA 3PNBA 5TE9A 3AIOA 1J56A 3VJLA 4IDIA 3AEEB 2PWZA 3RREA 2A1JB 2DWOA 3N75A 1CZHA 4JVMA 2OG1A 2WB2A 1QZUA 2YHSA 2RP5A 1M0TA 3AQFA 4HAWA 2BOVA 3TIXB 3P9QA 2PQ0A 3NBQA 1U3FA 3F3YA 1TBEA 1JYEA 2HRRA 2WAOA 3PKZA 2PWBA 4R3UC 1A2OA 2ZSIA 4KR0A 3J81A 4PBSA 3RWOA 1Z4LA 1ZCAA 4OJ6A 1BE6A 4X8MA 5I6DA 3F0TA 2WXIA 2CK3D 2LM4A 3AR8A 1JZTA 1Y8ZA 2RJ3A 4JC5A 3NP9A 2HNKA 1CKEA 2C1EA 4E32A 2NO5A 1QE0A 5F1OA 4J6EA 2IPXA 2FF5A 1A82A 3VHXA 1FP7A 1L7MA 1XRPA 4ZYSA 2OZPA 3GZNB 3QKRB 3OLQA 2OV6A 3OWXA 4HWGA 5B12A 3NVAA 1U4BA 4X1KB 4MS3A 4Q4AB 3N20C 4Y0VA 1T36B 4JGHB 1E7RA 3AJRA 2RHWA 1T8TA 1YRQA 2I91A 2KVCA 4ME6A 3IBTA 3VPDA 1DC5A 3GIKA 1OILA 1SUFA 2F62A 4WFKA 5LZ2A 3ROTA 2ZJFA 3FDXA 4YRJA 2PX0A 1DEAA 5CURA 5J17A 2KX3A 3UO8B 2GASA 3DBOB 4PCAA 1DWQA 1U7PA 2BPOA 2E55A 3K2EA 4B4VA 3RS2A 3O95A 2V7VA 1IYZA 2FDCA 1GC6A 1JLLA 1SVOA 2HOQA 2QP9X 4K4IA 3ZUGA 3IHPC 3WLPA 1K6EA 2ZYUX 5KNCH 3GG9A 4DUGD 3I4LA 4IIUA 3UJPA 3WK4A 3BQ9A 3U3KA 5TQ2A 1QQTA 1I2DA 3FMOB 2VLBA 3PJFA 3JQ8A 4KE6A 5HF9A 5I47A 1A77A 3GCDA 3TL2A 2DZDA 1JNYA 3AW9A 3L4KA 1N78A 5F3RA 1AKMA 4UE3S 1F44A 3MK31 5D8DA 3CUTA 3AE2B 3TIFA 1GPXA 1DLJA 3OPYA 4MSUA 1H1DA 1O6FA 3L4JA 9ICWA 1QK3A 3KALA 3WXMA 2A78A 1DIAA 4HAUA 3Q8LA 3LBYA 2BSXA 3KWMA 4RTRA 4UM5A 4IIVA 3SFZA 4TWIA 2Z04A 4LTDA 1FFDA 3ZDDA 3MINB 5LB4A 3ZBTA 1TZ2A 4LBWA 6CHYA 3MMZA 5B1SA 5C5JA 4K46A 4EX7A 4XSVA 2FW8A 1OUQA 1UBCA 4RDXA 4CRXA 1E6MA 4EKGA 3QX1A 4XEHA 1W0KA 1T2DA 2N3ZA 2IC5A 1IH8A 5KYTA 1E8NA 2I1QA 4NCAA 1Z2PX 2Z2IA 2HDHA 4UHDA 2J4XA 1DC6A 1C76A 4JLWA 2F77X 1TX4B 4O5AA 5JH7F 4XIFA 1PYOA 3ANXA 3FVRA 3UPUA 3U0VA 4QQKA 4FFNA 4JQWC 3AHHA 1DOQA 1ISPA 1X1QA 1G8YA 1KFSA 3UYLA 3J7AC 3C8MA 4L7VA 3DFIA 2GI9A 1UJ6A 4UTNA 1Z5UA 1R5BA 2C7BA 4BNVA 1ZWLA 2I87A 3DOEA 2NO7A 3BMCB 4IZ6A 1U7TA 2HTME 2KJQA 4D6PA 1J8FA 1SVMA 4O5KA 1T6XA 2EKBA 4QPNA 1YZ6A 4NYMQ 1TB4A 4EGJA 1ONPA 1RLOA 1QANA 1BRTA 1UDBA 2VRNA 3Q3IA 4XUGB 3P94A 3SBEA 1A95A 3DBLI 1V1PB 5IPFA 4Q9DA 1H2RS 2VO1A 1NASA 2X3UA 3TM4A 3KVOA 1VLQA 4RLHA 1T0PA 4RUCA 3TI7A 3RBXA 3MWFA 2BBOA 1YCFA 2FEMA 2VXCA 5EWGA 4FYXA 4QYWA 1KWGA 2FN3A 3LTNC 1EK6A 1DBPA 3HBNA 1YVRA 4AQDA 5EI5A 1EJ6A 5KG6A 3OCUA 4PINA 5AD1A 2NYRA 1CB0A 3PYMA 4RL6A 2FETA 3ZE9A 1XDBA 1PUXA 5GOZA 1E9VA 4N03A 4YO7A 5B36A 4MMXB 1RPJA 2IW1A 3E2PA 4J0IA 3MFGA 1DAFA 4KZKA 4CM8A 4V03A 5AM4A 3PNSA 3A6DA 1NUUA 3QKTA 7ABPA 3ZCPA 3WAJA 3ANYB 3QKIA 4A7PA 5A9RA 1MAUA 3ZEAA 4NOKA 3GEGA 5DASA 2ANCA 1TZBA 3TOCA 3IMFA 1G2OA 2NXCA 5KFDA 1I4XA 3LSYA 1NP3A 3TX2A 2BC9A 4JEHA 3HP7A 3PIDA 4ZT6A 1Z3IX 1M8FA 2Q0QA 4XQ8A 2WVJA 3L8MA 1H8CA 3SDZA 3RWBA 1IBXB 2BYFA 1VKHA 2A3VA 4O6VA 2HSZA 4I19A 2DXIA 3LYHA 3RUCA 3P9NA 4FWBA 3TTSA 1G4AE 4E7OA 3WWEA 4FBTA 1JA9A 1YC5A 2O7NA 1DQPA 4ZAYA 1W4BA 2C82A 4IW0A 4K9NA 1NBIA 3M6WA 3V1TC 4Q43A 1L4UA 2IYEA 2W5UA 5C8ZA 1VB5A 3JQQA 5G1NA 2XVTA 1R7SA 4WTOA 4ASWC 1PQSA 1TT5A 2E2WA 2TMKA 3O73A 1EIWA 1PTJA 2JA2A 3LU1A 3AR5A 2HBYA 3RIHA 3GZJA 3IN5A 1MJFA 3I04A 3EWIA 4LISA 1KH3A 4R7TA 2WF5A 2F4VB 1SXIA 4IEEA 5KFXA 3ZQUA 1OQQA 4JFRA 1KZ1A 4JBXA 1FMTA 4D5GA 3RS0A 5K0JA 3EQ8A 1X39A 3X23A 2H3FA 4FDLA 5I9TA 3CINA 3FYSA 2C2EA 4DF8A 1J2NA 3HUTA 5BWMA 4ABYA 1KYTA 3QVOA 5AWFC 4EW6A 4QARA 3LKZA 1XPOA 4BWFB 2YINC 4JT9A 4ITVA 4JJKA 2B4TO 3ROKA 1W29A 4GOKA 1LW7A 5C8XA 5FWXA 3G17A 2AI3A 4P3NA 4KYIB 4UB6U 5U9CA 2I2WA 3IV6A 2A9PA 2Y3IA 3RD5A 4CM6A 3O9MA 5EPEA 4L4ZA 2HJSA 1TKBA 2PZMA 1KL7A 3AO0B 1NUTA 2N1BA 1CVRA 4FZLA 4V0SA 5J5CA 3H97A 4DYDA 1TE2A 3RO7A 3RYIB 4DJTA 2O6VD 4B09A 1XCMA 1MBZA 1O54A 1U2PA 2ZRJA 3KYCA 4U7TB 3PUKA 4L9RA 2O3SA 4PJ0U 3H4BA 4R64A 5J4LA 2H1LA 4E1VA 2GOWA 4LCDE 4RO0A 2GJSA 1DJPA 4EGQA 5EJ7A 5DK4A 4MV4A 1OIVA 2QTBA 3P19A 4CM9D 4DVJA 3UHJA 5AKIA 2ZI3A 3LYUA 3I1YA 3TJMA 1FNBA 2KNBA 1D8AA 3R4CA 4FW9A 4CV2A 2C00A 3KHRA 1BHQ1 2BGNA 3L8YA 3AM1A 4DRZA 3W78A 5J0WA 2V0CA 1JS1X 5I01A 4V38A 3EMBA 3RUDA 2QE6A 3T3MB 4DNQA 4UDOA 5KTMA 3TNLA 3H17A 5U4XA 2EP5A 2GXAA 2WU3A 4A15A 5COAA 4B74A 2LYHA 2G1KA 1EQUA 4NM2A 2SKDA 3AI2A 3AE5B 5ED0A 3IMCA 3D7RA 3I6BA 4NLNA 3U7HB 5LSAA 1SOMA 2LUOA 3IT4B 1JX6A 5ALMA 5DM4A 1J21A 1FYFA 3EC7A 3V6JA 5J4VA 3TGWA 4KQGA 1ZQJA 5C2TB 4WGGA 4JX9A 4GDFA 2OXIA 1SG0A 4HCJA 4MAAA 3A4YA 4F3OA 4GBGA 4PX3A 1KFJB 3GJ0A 3BIJA 3QV2A 2PDAA 4DR4B 3F2VA 4GECA 4C0LA 1QVWA 4FYJA 2WTUA 5JRDS 2HJ8A 4DCGA 1LKZA 4UCQA 3EXG1 3M6AA 3A04A 1TAQA 2YOHA 4MAFA 3CCBA 3L1JA 1CUSA 4MKFA 7ICSA 3NS8A 4DARA 4Q3CA 4J9SA 3OJOA 3DXXA 1XDUA 1AKNA 1U9YA 2Y1LA 4JI7B 4LZJA 3JYNA 4BVJA 4RA6A 3Q9LA 5KYWA 2ILVA 3U3MA 1X8JA 1X87A 4XPIA 4OO3A 1KO5A 3R0VA 1OXJA 5JJBA 1YZNA 3QJYA 3CLHA 5J0RA 3SLGA 1U80A 3H7SA 2XQFA 3IP6A 4JU9A 3TLKA 1IN8A 1WRBA 4L8FA 1M6HA 2ZWMA 3MEQA 4CHKA 3KSMA 4BO9A 4QBTA 1Z6XA 4FDUA 2Y99A 2JLRA 4C56C 2KZ3A 2VK2A 2X0JA 4KLAA 4K9OA 5IC5A 1XJWA 3SJAA 2O1WA 1SL2A 3LKBA 2XMBA 3L4BA 1LSOA 4GC7A 2LZ0A 4ZHPA 3KB6A 4F7ZA 1DAOA 4AFNA 2J6UA 4BGUA 2JL1A 1YJ5A 2J67A 3LXXA 1BMQA 2E1RA 2V59A 5B3LA 1C50A 2IEYA 3IPAA 1GGNA 4BLQA 3CZ5A 1AS0A 4LF9B 2YR0A 1GAQA 2WZDA 8ICOA 3OQPA 3Q8WA 3P5SA 2HU5A 4EPWA 3JQAA 5JC8A 3TDMA 3DZGA 1GNRA 4BKSD 3U7RA 1SUSA 1NLFA 3S27A 1VLHA 2O2CA 5DNEA 4AYXA 3A27A 3PC3A 3WQHA 2G0NA 2KKCA 1UXHA 1XQ9A 2VA2A 4FK8A 1T4CB 1C7YA 3UA3A 2WIBA 3DE0X 3E9QA 3Q5EA 3PV8A 3VTUA 3C6KA 7YASA 2F3RA 1XN4A 2Q5QA 2PCLA 1EUVB 1RBQA 4NXNB 4IIXA 3D2AA 4BVHA 4E11A 4DZTA 2VXYA 4D8XA 2W2KB 3RB6A 2FSSA 4K9QA 1FQWA 4CUKA 1C0PA 2FMFA 2I38A 4F92B 4JQSA 4EPTA 1E3IA 1ZD8A 5J8YC 4JUCA 3FPBA 3FBWA 4QDZA 2CNOA 1SCUB 4P7KA 1BD3A 2WZQA 3P0HA 1BN6A 1OFUX 5TQ0A 2WNIA 5IJZA 1XZDA 4C22A 5DM60 4QZHA 3PI6A 3W0LB 4MVJD 1BUIC 1R4ZA 2O19A 3RUIB 4MRAA 3R2IA 5ADWA 4KLMA 4MKGA 2X9GA 3KSUA 1NDUA 2I6FA 3OJ0A 2ZZNA 3OPVA 5A0FA 3CRVA 4B3TB 3THRA 4YXFA 2F8LA 3H1FA 4FN2A 3R2JA 3LX8A 3PV0A 1JEQA 3E0FA 3KT6A 3MT9A 4PH5A 3S2FA 3TXYA 3R3JA 3ZH2A 5EWFA 2FVYA 2ZTUA 1FJ2A 3S2IA 4PYOA 2O0MA 2WTMA 4ZRPA 3NS1A 2RH8A 3RNOA 3QNUA 3RF9A 4ARAA 2PFOA 2K6DB 1PG2A 4PSVA 4YCMA 2P9BA 2MCFA 1CF9A 2OILA 3NHAA 1UOPA 4EYKA 4Y2SA 1U94A 1KSHA 2O4UX 1OD6A 5KEIA 2AZXA 4RHCA 3QKSA 3H5OA 1II0A 1SXDA 2WZBA 3EFOB 3NHSA 2J0SA 3UQYS 3VHQA 3GGGA 1LA2A 2EANA 1M2VB 2RK6A 4PW0A 4OGGA 3WB2A 4BOSC 3KVVA 4YASA 2VQEB 2B20A 2XXJA 4DL7A 5KS2A 8ICKA 4IDCA 4LCBA 2ZUBA 2ZT8A 3EQ6A 4L8VA 4RC9A 4RFSB 5CJJA 3EFHA 1EG2A 4G8CA 1GTRA 2GWSA 1J23A 4R1LA 1XTUA 4RZ2A 2JRIB 3EW9A 1GNQA 1RQGA 5KOJB 2VZEA 4LPSA 2VEDA 3BBPA 1ZR4A 5BRNA 4FZVA 1ZMOA 2HQBA 4QYSA 2O05A 3WGJA 4B0EA 1ISMA 2F8KA 3CRQA 8ICPA 5DXFA 2GBPA 3HN6A 3OSPA 3C2KA 4ND5A 4KLJA 4P35A 3DT8A 2NVWA 4YS6A 4A27A 3VHLB 4BMNA 4AZ0A 1UDXA 5CXUA 3MMXA 4GU2A 1VQ1A 4NJ7A 1KZ6A 1UM9B 4HCPB 2MINA 1H5NA 3N2KB 4PLFA 3VC2A 4G56A 3JSVA 1D2RA 4CCAA 3OZWA 1PWEA 1UFRA 1PFWA 3H2BA 4A3PA 1O9BA 4KIKB 1PJ4A 2JIZD 3AR6A 1KDVA 3KT8A 4LDTB 3GP7A 1D6NA 2BIFA 4DSEA 3TQFA 4CG2A 2PMZC 1IXZA 1EJ0A 2PIDA 1JSCA 1WP9A 4BKRA 4GNRA 5JH7B 3ZK8A 2CL7X 3VYVA 2I54A 1NWCA 3GHHA 1NC1A 3U2QA 1FTWA 4BQNA 4DJEC 4DV1B 4EQ6A 4FCCA 4RK4A 2JZOA 3T1HB 4KN7A 3FWYA 4HH0A 3H8SA 1RRKA 4R16A 3KYDB 1SWWA 2GXSA 2C7HA 3ZU4A 1E8ZA 4D8TA 3TSOA 4EBDA 4A6QA 1L2TA 1SBHA 3HZOA 3GJZA 1SC4A 5IVKA 1HG1A 2ZI9A 2XCSB 4EENA 2IIVA 3RUPA 1T9BA 2P66A 2YKGA 1YIDA 1RYRA 2ZU6A 4D57A 3PS9A 3B85A 4Z2AA 2PS0A 2D2VA 3HRKA 2GDZA 4JOSA 4OLFA 5JOQA 3KKOA 2W6JA 1TQ8A 4RORA 1N5LA 1IC6A 4NPNA 4WMLA 2H16A 1KZHA 1H69A 1MAHA 1Q83A 2ONZA 3BZUA 1VE9A 4OL0A 1X9XA 5CTJA 1Z18A 7ICPA 4UBJA 3K8YA 5ERXA 1JCKB 2EP8A 5B2EA 4GWKA 3CX6A 1THTA 3V1UA 2XD9A 2CJWB 5REQA 5CLFA 1X40A 1RM4A 4LJPB 3F5AA 5I8WA 2MBOA 4AP9A 4WXHA 3HM3A 1Q3VA 1H05A 1UJCA 1BPXA 2CSXA 3C3MA 1SB8A 2ZPYA 2K9XA 3OU6A 3SJUA 1NJXA 2PT6A 2X14A 4W7HA 3UINB 4IQ4A 1MV8A 3BIXA 4ND8B 1UFOA 2V4QA 1P4HA 1KOJA 3CX3A 3EDRA 4JLOA 2H57A 4IAOA 2IBMA 1NVGA 1TM7E 2IU4A 4PAQA 4RZQA 4CMHA 1PR4A 1UBUS 4JJ7A 1ZUNB 4WRRA 4TKVA 4YN3A 1JWMD 4B87A 3R7QA 3EGIA 3OOEA 1VYTA 3QVXA 4CN9A 1G2IA 2VSXA 1FRNA 4CCYB 4WPGA 1JYFA 2XY4A 5CBPA 1EVIA 3NWPA 2FG5A 5HFYA 2FPXA 2FPMA 2LVBA 1UBGA 3I9V1 1UT8A 1LB1B 4WD3A 4OJYA 3FCSB 5LZ8A 5DHFA 3MTJA 3KAKA 4BV2A 1E4VA 3ZDYB 5TT1A 1A9SA 1QO9A 3COVA 2BMWA 4PGAA 1Y8QA 3UY4A 1IIBA 5AK5A 4PPXA 4X6XA 4DFMA 1TZOA 2I1JA 4OB8A 2ZIUA 2AYOB 3D8RA 1U45A 2J1LA 4MIEA 3TRHA 1E90A 1W5BA 5EG5A 1AGXA 3OOYA 3ZV5A 4YP3A 2NYAA 2DFNA 4BUZA 1J06A 2ESEA 3FFTA 4WAAA 1BD4A 2BHRA 1I4GA 4DS5A 2WTEA 2Z57A 4BJQA 1PBTA 3M8RA 2ERCA 3RJGA 1HPLA 2D1SA 2J3DA 3GEDA 2IYUA 3U7IA 1PNQA 1UFKA 1OX4B 4FHEA 3SVLA 4O4IF 4AJKA 4HGNA 2VS1A 3UAOA 3IVRA 1IRXA 2PD6A 1L7VC 4L8YA 4OJ5A 4ANUA 1LRLA 2QN2A 1X6IA 2I2CA 1ZN9A 3SICE 2H4JA 4FYKA 3LD9A 3E2IA 4DLBA 1JXQA 5JDCC 4EAAA 1N7HA 3H42B 2VTKA 2A0YA 1JDSA 1RWKA 1A4RA 3ESDA 3DVLA 3UPQA 1NZBA 5C4MA 3OEEA 1GTG1 1XXLA 3RBAA 2Y05A 1WFYA 3AI7A 3FKSA 3JR3A 2MA9B 3EIOA 2KDIA 1QF9A 5K8UA 2BGFA 3NRWA 1HLPA 4PO8A 1C8VB 1U63A 5K0SA 4IRKA 3FZNA 5JZOA 4NAWB 4MEJA 5CJPA 4BQRA 2OFPA 3EYZA 3AU4A 5DNDA 1ZYQA 3DOIA 2V4LA 3NOOA 2FPKA 2CJOA 1ORVA 3IIKA 4BMDA 3SAHA 4XLZA 4DM7A 2I3DA 1TYCA 5C80A 2P69A 2CJNA 2X9NA 3KXDA 3PE3A 4RNDB 2V7QA 3O2QB 3CWQA 4IDNA 3JR7A 4XD7A 4BZWA 4FZ3A 3Q88A 4P81A 4JUIA 1KVQA 4QUIA 2QTTA 4EY5A 1XG5A 3HUFA 2C2OA 1PTKA 3PDHA 3JD0A 4RD3A 1S3SA 1Z4MA 4K6CA 5LDDC 4L95C 3VVLA 4OX9Y 3Q2IA 1WA5A 4OXNA 4XI9A 1B8UA 4EM6A 9ICBA 1MENA 1DKLA 4DMUB 2QRVB 2FUEA 4MRMA 4YD2A 1Z3EB 4FUQA 4LIPD 4PWYA 1YFKA 1Y5IA 5KYVA 4D9JA 4RQ5A 3FCXA 4AT1A 1L5RA 1N2ZA 4DG9A 3JW8A 2DUYA 2EJCA 4HJGE 1J33A 1QOFA 3A4RA 2MU1A 2Q5EA 5F9LA 1KBQA 4N9QA 5L40A 3LA8A 5MN5A 4S0RA 4EQZA 3WJAA 3L5OA 4OVKA 4NLCA 3GDWA 2QD3A 5KC8A 3ZY4A 1UKEA 4MARA 3Q3NC 2FRVA 5CR0A 4LF7B 3IQDB 2FEXA 3N76A 4DLRA 3GE8C 2WUFA 2VBCA 3FBGA 5ALYA 1XZMA 2G1JA 1Z63A 1Y34E 2AJBA 4Q3OA 4C3VA 3Q41A 5D6OA 4QOGA 2VHYA 2E89A 5BR8B 1ZQ1C 5LP1A 4K0RA 2DMRA 2NU9A 4RPZA 3WBFA 4E31A 1VL2A 2FQ1A 1N5RA 1J9GA 4BGVA 5JSZB 1ADYA 1NW4A 2QZPA 3VC8A 4XDHA 2PPHA 4BQOA 5F7XA 2JMGA 1XZJA 4WY8A 2BF4A 3HH8A 1UZUA 4B9MA 3X1JA 5F23A 5KB3A 2OPBA 4NOJA 4REQA 3QUAA 2BCSA 4LTUA 2WILA 1FLAA 2WOOA 4EUSA 1LC3A 5CDSA 5I7WA 4UNIA 2XB9A 4IIGA 1Y1TA 5AQ1A 5K0ZA 3BULA 5IULC 5MGNA 4X84A 5FBVB 2E6KA 4MUEA 1N9GA 2ST1A 1O96B 3KSZO 2YZKA 5G4LA 1RWPA 3JQEA 3PRJA 1WMHA 1NQOA 1MJNA 2JGAA 3I9V6 1NY5A 1EGQA 4Z7NB 1MC1A 2FUG1 4WJPA 3CGWA 3MGIA 3GAZA 4MPDA 3BFJA 3IKLA 2P62A 3UGJA 4XWGA 2OWDA 5AJHA 3KEGA 3DHNA 4R8KA 1W47A 2I99A 1JQDA 4EFOA 1XIVA 3W4KA 3EXAA 5DYTA 1R37A 3TOZA 4KLCA 1A98A 1RC8A 2YJZA 1UXJA 4ZODA 4F4HA 3NJTA 3CGGA 3NHBA 3QLTA 3BT7A 4QGFA 4DE5A 2AUTA 2HHSA 3QHAA 1IG3A 1QHFA 3KOMA 4G1VA 4RFBA 1HDYA 2VQDA 4IUMB 1H8EA 5BOSA 2G0TA 1L6NA 1UKBA 4RVHA 4LCJA 4P53A 1FCJA 3SC4A 1KE2A 4IXTA 3FPJA 2ZFUA 3H6GA 5A4MS 3HJHA 3K9LA 2ONYA 1FRQA 4K2HA 4HG2A 4YRKA 5A6SA 2PBZA 4UQPA 4FYYA 4ZFNA 2AXNA 4LZAA 3PQ6A 3AEQA 3ZK9A 3DOOA 5T5QA 3ZHYA 3M9OB 2M6LA 5ES3A 1C9JA 1TTPB 4CKEB 3DEEA 3FROA 4ICIA 4YT8A 3QEAZ 1JLMA 2PW9A 5TQJA 1L5LA 4IYRA 3GDHA 4J6IA 2ZW0A 1E8DA 2H1CA 1IJKA 1FL9A 1L4YA 2ZTLA 5DOVA 2CVOA 4PLZA 3OEHD 4DJDC 4AG5A 1YCHA 5AVSA 3AZOA 1I6MA 1Y3IA 3CUVA 5HX7A 5CW2A 3DTVD 3A11A 4KPFC 4H17A 2O54A 5AKJA 4LFAB 4DIEA 4RX1A 5CA0A 4BAZA 1ZBDA 1EI9A 4B83A 4KDFA 4TPKA 2ACVA 2XVZA 2IVZA 1HNXB 3IB3A 3STXA 1S3SG 3FGPA 2J5XA 2UAGA 4M9UA 1Z2MA 4QXOA 2GEUA 5A4IS 3E1SA 5D87A 1V5IA 1YJQA 1IN4A 2EW2A 2PMEA 3FDSA 4NMMA 1QKZA 1AKEA 3G6KA 4GU5A 5CA1A 4CLRB 3GH3A 1RLTA 4UXJA 4I6LB 3MGHA 4ICVA 4UE6A 4ER3A 3CJRA 1REQA 3PR3A 3QIAA 1NRXA 4TROA 2GD0A 4ETMA 5IOIA 4MWGA 4IRUB 5GY7A 3K9BA 1UOOA 3L1KA 1KAQA 1NM5A 4D4KA 3Q6NA 4MUFA 4M9GA 2XVXA 2KQ7A 3EZNA 2AOTA 4FBMA 1W4ZA 4Q3BA 4IMJB 1J2UA 4NV0A 4D79A 3JX9A 4C4VB 2AN1A 1QV9A 3RG2A 1K92A 4A23A 3HKCB 4Q00A 4FWTA 4HKZE 5IIKA 4MVCA 1I2CA 5BSFA 2HF7A 1DEXA 5DDIP 2QTAA 3TQTA 5EAIA 1WXXA 5DGTA 1SUCA 3T3HA 1XTZA 3B1FA 3E0XA 1J4AA 3VTZA 1A8HA 3AMZA 4PL2A 1M7BA 2I4OA 2W6ZA 1CIJA 5EVJA 4LI3X 2J5RA 3RUEA 4YDRA 3OC0A 3I1FA 3VHTC 4C4OA 1PYGA 4QJBA 2HW8A 1LNSA 1OXTA 1NDDA 4EF5A 4MDHA 1BMDA 2QF7A 4YRSA 4OYLA 2X2PA 3C19A 1V39A 1ECWA 4GVPA 2UVWA 2AJQA 4LE0A 3K53A 1IONA 3BF8A 4YVFA 5DHUA 1G21A 3ZNID 2YHIB 1ZM7A 5KVCA 3HP4A 5ECWA 3UHFA 1BNPA 1WNFA 1I6WA 2D6FA 4GOXA 2P1RA 4JXZA 4ON9A 3OHSX 4C2AA 2AJDA 3BIWA 1R0SA 2ZE8A 2BEUB 1E1YA 1AIPA 1EWYC 3UUGA 2X41A 3GFPA 2LCQA 2BCJQ 1EXWA 1EU1A 3QEMB 2OHIA 1U2DC 3DE7X 3WYBA 4RZIA 1GIAA 3FB1A 2GEVA 2Z09A 3TQOA 2GZDA 1HRKA 2JZ3B 1Z4NA 1N5OX 2YBEA 4GDKA 4LNIA 1PGQA 3BFPA 4CMKA 1H2BA 1Z0UA 5JATA 1EAMA 2YXPX 5TXGA 2WIDA 2W6IA 4FW8A 2F3PA 3BE8A 2J41A 4OA5A 3E5NA 1QJ4A 1LI7A 1KRHA 2WJYA 5JSKA 1GB4A 1Z7YA 1PYDA 4J2OA 4P93A 3Q2OA 3HYCA 3ZS8A 1PG5A 4KLEA 3ILVA 3D2CA 1QLWA 3G9QA 2V7PA 2IYRA 2P9YA 2P3LA 3B2FA 4LUCA 2HU7A 2AEFA 2FUG6 5GIPE 4KXXA 4GIVA 2R1VB 5J0QA 1F4VA 4OZCA 1AQIA 5G2NA 4AI6A 3LOQA 1V8BA 3K0FB 4MQFB 2GFQA 2HMVA 1XKQA 1UZMA 3EASA 1RXVA 1DWUA 2DTDA 3H16A 4B9TA 3H1EA 1V8FA 2W6CX 4PRLA 3NC1C 4KMRA 2A5JA 4NJCA 2QSJA 5AVVA 3V00A 2PL9A 3ZLVA 1II9A 3ZDBA 5K3AA 5KQPA 5C52B 1U0OC 3VKUA 2WYIA 2QPTA 4XGIA 2A33A 3W5DA 2HEGA 1NOMA