5EE1A

Crystal structure of osychf1 at ph 7.85
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
373
structure length
363
Chain Sequence
RPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIAGLVRHAGEGLGNAFLSHIRAVDGIFHVLRAFEDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
total genus 115
structure length 363
sequence length 373
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee1A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee1A01
1IY1A 1FNNA 1W0KA 3KJEA 1CZPA 4LUCA 4JLBA 2W2TA 4MYCA 3UWKA 4KFUA 3WBKA 1OFUX 1ODFA 1QG4A 3T61A 1ZU4A 1PVOA 3GLFA 2ZRAA 1YQTA 1D2MA 4URUR 1OXSC 2ZS8A 3IILA 3K53A 2P5TB 1CJEA 3QF7A 2ZR7A 2XNSA 2GJ8A 5JEEA 4RZUA 4OKSA 2Q0HA 4AURA 1UBCA 3I73A 3ETLA 3MGCA 5EE0A 3GLFE 2WPDA 2ZSBA 4RFVA 1R5NA 3CX7A 4IVQA 4NPHA 4Q1BA 3RRZA 4DB4A 2E1RA 3ZVMA 1FUUA 5GXGB 2JJ1A 4QHTA 4HB2A 2QT1A 2IXEA 2QP3A 2YZ2A 6Q21A 1WQ1R 4DCUA 4LV5B 3WCQA 1YR9A 3LRPA 3HPRA 1AGPA 1QHGA 3EARA 2W6JA 3GFOA 1ZRHA 2BS3B 2GF0A 2OLJA 1VPLA 2RGGA 2PLFA 1TQ2A 1E2MA 1KI2A 2WJGA 1YZGA 2IEZA 3AE2B 3ND8A 2O8FB 4DCVA 1N6OA 3EW9A 1OSNA 3WNBA 4C0SA 1P72A 3GJ3A 3PEYA 2IXGA 2MMGA 5EXSA 5B2ZA 4IRUB 3W6OA 4BWYA 4ACAA 2QI9C 1F2UA 3HR7A 1OF1A 3IEUA 3N2EA 2QGNA 5FTNA 1LF0A 4DDUA 5CK4A 3AEGB 2BWJA 4JYCA 2QMOA 3EPLA 5HPYB 3B2FA 2AN9A 4BFXA 2XZLA 2IW3A 4LPKA 4V0ME 2IS4A 2B92A 4FI3C 2ZVPX 1BYIA 2ZRHA 1YRBA 2J0UA 1SHZA 1XJQA 3WRXC 1E1RA 3BIFA 1P2UA 2EFDB 4GOXA 5IT5A 3FVQA 2BC9A 4NYMQ 2XITA 3LX5A 4XWKA 4XJXA 3SYKA 1IN4A 2HUPA 1IAQA 4PQFA 4YTMB 4NH0A 2LEKA 4Q1AA 3FHOA 1XEWX 4NCNA 1KK3A 2GBLA 3ASZA 2LKDA 3CBQA 2FPMA 4N0DA 2CJOA 2RGDA 3U44B 5JI2E 2I4IA 3KJGA 1P2VA 3ASYA 3RS0A 4DLRA 2NO0A 3NEYA 3IEVA 2CJWB 4XTRA 1YU9A 2YJTD 4DLTA 4OL0A 3ZH9B 2DY1A 2FZ4A 2J0VA 2FA9A 3DM9B 1CJTC 2UVQA 2DWQA 3AN1A 3AGPA 4IOLA 2W6IA 1U8ZA 5B57C 1DAGA 1XZPA 1OKKA 1S96A 3I8XA 1DTSA 1D5CA 1SVIA 3KQKA 2VEDA 1E9CA 4D4KA 1QOAA 2GHIA 2R44A 4LHXA 3AE1B 4DC9A 2IEYA 1MOZA 1T5IA 1XTRA 3DKPA 4RZ2A 4C80A 5AUKA 4F93B 2Z6VA 2WDRB 3TSOA 1JPNA 1DPFA 1KO7A 2L0XA 2A5JA 3SNHA 4ZDJA 4HZIA 1S1CA 3TIFA 4FMBB 5FBWB 2W0MA 5EE3A 3RYTC 3AB5A 1WCV1 3B7GA 3QF4A 4MDEA 1E9FA 1OB2A 3DPUA 2CK3D 4TQUS 5KTYA 1KOFA 2QEQA 1Z63A 5A4JA 2QT0A 1NIJA 3KQHA 3KTAB 3W34A 4B75A 3CIOA 1AYFA 3T1QA 1N62A 2BBWA 2VL7A 1BOFA 1NLZA 3BAFA 1MO3A 1VG1A 1Z22A 3MWKA 4PQYA 2YINC 1NKTA 2W0SA 4B43A 1VTKA 3B1XA 1YZQA 2WHXA 2J7PD 3W8RA 2G88A 1YZKA 3A1SA 3J81k 3VR1A 2XOKA 2ZU0C 2KSQA 4A2PA 2QAGC 3TAUA 5DISB 1E6CA 2REXB 3THYA 3KJIA 2F6RA 1P6XA 5KUTA 4A2QA 1RYJA 2O8BB 3ZQJA 1TEVA 4PTLA 4USAA 1TAGA 3LVQE 3MAAC 4YDSA 1Z07A 3AE3B 5JMTA 2DHRA 1SVSA 4CDGA 4EDHA 4KBGA 2NGRA 3CRVA 1KI9A 3QXJA 5EP3A 3RSOA 3WNDA 3NBYC 1GITA 1UKEA 5FTKA 4NCKA 1XXHA 4KBFA 1VKJA 2PKOA 1FFUA 2VP4A 3K8YA 5FUXA 1KKMA 4KVAA 4B3XA 3CPEA 1NVID 4HZUB 1KI3A 3LW7A 1DADA 1GOTA 1KGDA 2AXPA 2HJGA 4XH9B 5JJKA 4LJ7A 1XTJA 5G5HA 1XDBA 1JB1A 2ZJYA 1SKYB 4XTCS 4I1UA 3U6KA 1K8RA 1KO4A 3V9PA 4UXIA 5FH9A 1FFVA 4HAUA 4TTQA 3KUCA 2IHYA 4ACBA 4LV6A 1XLOA 1KF6B 2YC4C 3QF4B 4IVPA 1QOGA 2PT7A 2IF0A 3ZVLA 1WA5A 1H8ED 2V9PA 3PVSA 4GBMA 1U81A 1ZCAA 2O0JA 3SR6A 3LNCA 3MSXA 4NYMR 4DLYA 2BS4B 2FWRA 4W9MC 1WE2A 4YTNB 5DNYB 5FPKA 2QU8A 1HT1E 2IHBA 2KBEA 3NBZC 2RH5A 2JA1A 3AVXA 3NBFA 3RC3A 3WY9A 3T1TA 2PBRA 2OEPA 4NE2A 3VR3A 3FMOB 3NHAA 1SHKA 2HXYA 3HJNA 3AVVA 1KNXA 1OXXK 3W3AA 2XTNA 3VMFA 4DIEA 4Z1MD 3C15C 3GJ4A 1BS1A 3OEHD 2QPTA 1JQ4A 1AQYA 1II8B 1VYUA 3RNLA 5K8LA 1KZ7B 4IDNA 4JIMA 2XXAA 1W0KD 2H88B 2FNAA 2JDIA 1KYIA 2D7CA 3AP3A 4OYHA 1DG3A 5SZKB 3U3KA 4F38A 1SXJB 2DB3A 3QUSA 1TUIA 2J0UB 3CWQA 3TAHA 2FFHA 3NVZA 2YYZA 3CH4B 3THXA 4LBZA 1COWA 2NPIA 1EXMA 4PZLA 1IJFA 2GJSA 3TSZA 3EPHA 3C41J 2BKEA 1QHIA 4C3ZA 5TDHA 1ZD8A 5LD2B 2VRWA 3QY0A 3X1ZA 5G3ZA 4AC9A 1WBDA 2N42A 3C5HA 1RIFA 3SFVA 3W9YA 3QXCA 3WRYC 4DLXA 4POAA 2XX3A 5FFMA 2ORIA 3I3SR 1LS1A 3AKYA 4JL5A 2ZI6A 1QVAA 1Q22A 4FINA 2UZIR 4FXCA 3WMEA 3I1FA 2RCNA 1CRPA 3WP1B 2ZI3A 5B58C 1IJEA 3O8DA 4TMXA 2B6HA 1GKYA 1J7AA 2PJRA 2FF7A 3KJHA 3AEAB 1VDZA 5KHOC 1RWSA 1FQKA 1L2TA 4O0MA 1T8TA 1G64A 4KITB 1WYGA 4CGZA 1XEFA 3K09C 2EW1A 3LW8A 3PUYA 1I2DA 1P2SA 2DWOA 3O8RA 3RPFC 4UNSA 1OXVA 3T35A 5EP2A 3PEVA 1QRAA 2YWEA 1ZUD2 1KSFX 1OE0A 1ZMXA 4RSGA 4MRVA 1A5TA 4LPSA 1KFYB 3NVAA 3GP8A 4L8GA 1XO3A 2CLSA 1Q57A 4AK9A 4US8A 4HAVA 3GEEA 4N0EA 1XB2A 2ODNA 5DI3A 2FPLA 1II9A 2ZRGA 3ZZ0A 1I4DD 1KKLA 2YNMA 3NC0C 2ZRJA 3GLHE 4EPVA 1UDXA 4MGKR 2BM1A 1QHYA 3QEJA 3TVTA 5C4MA 2OBLA 3U7EB 3FE2A 4PO8A 1C1YA 5HCIA 4RVCA 1ZNYA 2IXFA 2GAOA 4MRSA 2XB2A 1SF0A 3OEEA 1VHLA 4XIGS 4JS0A 2AKAB 4Q9JA 3LVRE 1J7KA 3AF0A 4UXHA 1HA3A 2ZANA 3GMTA 5CK5A 2Q21A 4M22A 2WKPA 4NP6A 3CM0A 4F4JA 3KWLA 2C96A 2OFWA 4UQOA 1RC8A 2F9LA 2NO9A 5JFGA 2CJNA 4P0TA 4BLOA 1II0A 3ZVNA 3W5VB 1A2BA 5J47A 3WHLA 2QP9X 3DMDA 5EE5B 1UEJA 3CR8A 2ZI9A 3SOPA 3K70B 2ZRFA 4MKHA 2GJKA 3P4QB 2ONKA 2ZQ5A 4Q1EA 5HE8A 1ZIPA 2ZRBA 4FMCB 3HPQA 5F9HA 3L0IB 3QKUA 4V0MA 3UIEA 1E4YA 1JR6A 2GVZC 4TT3A 1UBEA 2VP0A 2ONJA 1TF5A 1UKZA 1V97A 1W2HA 2C78A 4WZ6A 3QEOA 5DYIA 4TZ6A 2B7CA 5TMPA 1MRNA 4WZAE 5EE1A 1DS6A 2XTMA 3PUVA 4ZKEA 1GM5A 3OE7A 4LDJA 1X1RA 3AEZA 3B2EA 4C2UA 3EZ2A 4LX0A 2GCOA 4OQLA 3AE7B 3L2OB 1TQ6A 2YOHA 1EFHA 1LF5A 2XZPA 5AUQA 3BBPA 1KDTA 3QKRB 4QNRA 3EASA 2WSSD 3OIWA 4GMDA 4H1UA 1T91A 2GJ9A 2QMUA 4Q5IA 3E5HA 5CB6A 4HB3A 2HV8A 1VDVA 2QNRA 1ELOA 4B3FX 1UJ2A 4L16A 4OQXA 2P6UA 3HRDD 5FPHA 3TMKA 1JWAD 4QRHA 1ESNA 1VIYA 5FUVA 3QG5A 5KDOA 1RFKA 1E10A 4G1UC 4LCBA 4B6EA 4Z51A 5SZHB 4JL6A 4M4SA 3NC1C 1E32A 3GJ7A 2C8VA 2Y8EA 4P4SA 1J8YF 1JW9D 3AEDB 1HQCA 1MR3F 3SR0A 3GJ6A 2ZUDA 2GXAA 4A2WA 3U4QA 1RVDA 1E98A 1P62B 2ORVA 3C4JA 4X8OA 1KZGB 1P61B 1N3BA 2VHCA 4WOPA 5KYKA 1W36D 2R6FA 3VAAA 2J87A 1XMSA 1HQYE 5H8WA 1XLPA 5AJVB 3LV8A 1Z0KA 2ZREA 1XXHE 4IOMA 3NVWA 1N6IA 4M1WA 1FO4A 2GZHA 4DEYA 3U3MA 3AM1A 5IDVA 1F5NA 2ZJAA 3P20A 5BXQC 4DDWA 5LD2C 3W6NA 1RPZA 3IUYA 4PC6A 2WJYA 1Z47A 4EUNA 1CXZA 1E2LA 4EKDA 4CEJB 1Y3AA 3MJRA 1CJUC 1CJKC 1W47A 4JLDA 3BC1A 1MT0A 1KI1A 3ADKA 1TKEA 2GXUA 2P2LA 3AECB 1VYVA 4G3XA 5E95A 3R7WB 1SQ5A 1N6NA 1JJVA 3CPHA 2X8AA 1ZD1A 4PC1A 1L0VB 1SXJA 2C98A 4JLAA 2EFGA 5CM9C 3RLFA 3AV0B 1XTSA 2CCJA 3BJIC 3GCGA 5FTMA 1E9RA 5C3JB 4DVGA 2P6NA 4FCVA 3ZDQA 1RRCA 4LHVA 4L9WA 3P4SB 1G291 1TQDA 1GPXA 1DAFA 2AFIE 1S2MA 1JECA 5JRZA 4YSZB 1O87A 2WJJA 3SJCA 1NP6A 2N1BA 1F2TA 2ZM5A 3K0FB 2JLVA 4GZMA 4QFMA 4TLBA 3QI2A 1M7GA 3RWOA 5KOYA 3GJ0A 4P33A 4TQ9A 4O2RA 5FBVB 1XZQA 1W0JD 2N46A 1JXMA 3MMPA 1YJIA 1OIVA 4U5XA 4F7WA 4ZIRB 4JX1C 3AF3A 1Q20A 2ZITA 3EXAA 4N59A 3L4PA 1XCPA 4EPWA 4F4IA 4P31A 4KFRA 4TL8A 2ZUBA 5DSZA 1U0HC 3CO5A 3OZXA 3GJ8A 1ZUNB 5CITA 3I62A 3QQ5A 4P4UA 2ZE5A 3AE4B 4YSXB 3GLHB 1YHNA 4WAUA 3MG9A 2QRZA 2JJ1D 4KJZA 5BYJA 1JQJC 1KI4A 2HCJB 1GNRA 1Q1ZA 4DJTA 2X2FA 1E79D 1NVVR 2J3EA 4DCNA 4FD2A 4QBIA 4US9A 1XXHB 1QHHA 1R0WA 2PZGA 3LA6A 4LYJA 4JZKA 4BFVA 3FYHA 3P4RB 2QQEA 121PA 2NMVA 5FUYA 1NKSA 1N0WA 2DFLA 4PHTA 3QENA 4NZYA 2H8KA 1J70A 1Z2CA 4Q7LA 4B2PA 4LYAA 3AUYA 4HI0E 2R62A 4G01B 1KSGA 3AQ4A 2V6IA 1U9IC 4MKIA 1MO5A 1R8QA 2ZYTX 1ZP6A 3L0PA 1L6UA 4OI2A 4PSAA 3TJZA 1Z83A 3TSWA 1A1VA 1XTKA 1T5LA 2GK7A 3QJYA 3K70C 4IDQA 3PFIA 1FX0B 3QG1A 2HXSA 3G0HA 3O8BA 4TQAA 4Q7JB 3CONA 3X1YA 4EJSC 4EJSB 1GNQA 2O52A 2WWYA 2FG5A 3H4MA 1L6VA 1LY1A 1X1SA 2F3TA 4JKIA 4QJ4A 4LJ5A 4ZI2A 4G5QA 5SZIA 3UMFA 4CEHA 3AE6B 5HZKA 3IPXA 3LWNA 4MUBA 1YJ5A 4B48A 2BM0A 3GLGB 3NVVA 5IF9A 1SB3C 1FL9A 2IYWA 4M1SA 3K70D 5E7JA 3CWIA 4DUGA 3IGFA 5FOVA 4DCSA 2PZEA 4UXJA 4IJMA 2V4ZA 4DKXA 4D25A 1ZU5A 4D0LB 1JBKA 1DGJA 4PAQA 1OB5A 5EZ5A 5GJCA 4MDFA 5H92C 2WWHA 4FMDB 1QOFA 4Q4HB 1E7PB 3M6AA 3KFXA 2AK2A 2VP6A 5L3QB 4LGMA 1NG1A 3V00A 5JJIA 2IC5A 4M9XA 2W00A 1XBTA 4E5UA 2ECKA 3PUXA 5KPJA 3R9XA 5EUQB 3LXRA 2M56B 3AUXA 2ZSDA 2WTUA 2A5DA 2XNDA 1E2FA 2D06A 3T5GA 4RCZA 4ZIRA 2QUZA 2XNDD 4YMVA 2ZUCA 4L5BA 1T3SA 2ATXA 4QGFA 1KI6B 1ZC3A 2QBYB 2FPKA 3SJBA 5FBLB 1R0XA 2F1RA 2IK8A 1MRSA 2OE2A 2JLUA 4OI0A 2O5VA 621PA 2HTME 4Q4AB 5BN4A 1CKEA 5AJYA 3SBEA 3EIQA 3KX2A 1VJKA 1YJJA 4TL9A 4KI0A 2ODBA 5GJVC 1OH6A 4NHOA 4WBSA 1XNJA 3A37A 2FDCA 1HYQA 5DHAA 1TADA 2G77B 4YMTA 2FSFA 2FZLA 4E09A 2O8DA 1U94A 3SFZA 1Z5ZA 4HUQA 2ZJ2A 1G17A 3I5YA 4US0R 4DLSA 3PCRB 3RRYA 2WJHA 4DUGD 2WLBA 3LO5A 4HUTA 3CF0A 3MCAA 3EPJA 4YSYB 3S1AB 3VU9B 4C7OA 4XD7A 1ZXIA 3VX3A 2HF9A 5DN6D 5G41A 3LLMA 4GDFA 4AYWA 1GAQB 2G6BA 4QBFA 1OYWA 1G16A 4Q1DA 1XD2B 1EX6A 1E2PA 2F43A 2OZEA 4BEJA 4A4DA 1E2IA 3DOFA 2ZR0A 4OI1A 4OK6A 3SJAA 2KJQA 4HSEA 4EPRA 3B2GA 1NLYA 1AGRA 4N3NA 3AKEA 4MKGA 4GI7A 1QHXA 5JEDA 3U4QB 2K5UA 4BASA 5H8YE 1B9RA 3TLXA 2IYQA 1UF9A 4P4SB 4TTPA 4K81B 4A8JB 4F4CA 3NS1A 4OQMA 2H7VA 1WRIA 1HH4A 1Q1QA 2B8TA 4TLEA 3KB1A 2JLWA 2VO1A 4URZR 1SULA 2ATVA 3H2YA 4ZOHC 4PO9A 1N61A 5F98A 3D7MA 1G9XA 4AKHA 3FTQA 1QHNA 2KI5A 3AM9A 1SGWA 5LBIA 1XMJA 1UKVY 2FSGA 1JPJA 3DZDA 2W3RA 4TYQA 2ZI7A 3TBKA 5CYOA 3GLFB 5AJWA 2P3SA 2Z4SA 2JLSA 3T06B 3IBGA 3BFXA 1EG7A 3HDTA 2CU3A 1U8YA 2MSEB 1J99A 2WSMA 2QY9A 3P1MA 2REOA 3GFTA 2IT1A 4R7ZA 5ANRB 5BN5A 1ZM7A 2ZRKA 1NMZA 4MGIR 4S35A 1VCOA 2D2FA 4CVNA 1RYHA 2YWGA 1R8SA 2Z83A 3ETRA 1X8LA 4YXDB 4YMWA 2PCLA 2ZYWX 2GTPA 2GXSA 3Q3JB 5H1YA 2V1XA 3R9WA 2VF8A 3DMNA 1HURA 1OHHA 3ZS9A 4XWOA 4HLDA 2XJ4A 3C5CA 3NWJA 1IHUA 4YDHB 3VRAB 3HU3A 4KXFB 2OO7A 5TB5A 3LXXA 4E03A 2FX3A 1VCMA 4AIIA 5CB8A 2WWWA 2BMDA 3PR1A 5G3YA 5CIQA 4C0HA 3NIBA 1I7HA 4G0NA 3QOFA 4JLKA 1YR8A 3EA5A 3CRMA 5EUMA 421PA 4KCGA 2JASA 2P5SA 4W5HA 3T5DA 4BLTA 2BJVA 5E7MA 4FWIB 4JVSB 2CNWD 1EK0A 3G5UA 4GSYA 1YE8A 1RKBA 4B76A 1P9WA 2WJVA 2WDQB 1FTSA 1G1MA 1GL7A 2I3BA 4DXAA 1KTVA 3RSLA 3TW4A 5CLLA 2BKUA 1ZCBA 2AX5A 3AVYA 1TL7C 2PEZA 4B73A 1F48A 4X8MA 1ZVQA 4II7A 4O2LA 2O8DB 1ZP0B 3VR8B 1W49A 2C9OA 2DFKB 4OK3A 2WM9B 4RJLA 1KSHA 2X2EA 2WU5B 4TL7A 4TYPA 2CCGA 4NKRA 1EFUA 5KSOA 3K0CA 2K5PA 2IF2A 4Q9HA 4WXRA 1OFFA 4AKEA 1QLBB 1RJ9B 1YQ3B 5CM8B 2PMDA 3B9QA 2WICA 1E2GA 2GVDC 4M9QA 2ZR9A 2LCFA 4PPQA 4YMSA 2ZYVX 8OHMA 4Q9KA 5JHHB 4OHVA 1G18A 2EYUA 5AJZA 3W9CB 1E2KA 2QBYA 2P6RA 1R6BX 4FW9A 2EKIA 2GKSA 3VRBB 2FSIA 3D8BA 1L4UA 3QBTA 3FHTA 1ZM2A 1R0YA 4GL2A 2W2VA 3LH5A 4HB0A 2VSXA 4QL3A 1NL3A 4ARZA 1E2NA 1ZM9A 1F2TB 2GEDA 2PLRA 4MGYR 4Q18A 1KI8A 3GLIB 2J0SA 1KSJA 2YKGA 5JCPA 2WU2B 3X1DA 3AF4A 4TLCA 3BFKA 2WMNB 3SU8A 5JCZA 3KXIA 3FMPB 3F0TA 1NVXQ 4IDHA 5CJPA 4KU4A 3L0SA 3BFVA 1TUEA 4OHXA 4M9ZA 2BEKA 1EWRA 4F91B 4OBEA 4UNQA 5HCNA 1RRGA 1FFHA 3FPAA 1JXOA 4ZV4A 4PAOA 4U7DA 4D4LA 1WRBA 3CLVA 1OFTA 2AFHE 2E9SA 1QT9A 2HYIC 3C7KA 1IN5A 1R0ZA 5HKKD 3QXXA 3SQWA 4Y0VA 4AKIA 3ZZUA 2PIAA 4JKYA 4NYIR 2BJWA 1P9RA 1RRFA 3Q9LA 5GVRA 2OFOA 4LJ8A 2RGEA 4M8NE 4FXPA 3B1VA 1PLKA 4J0QA 1NF3A 1XFAA 1FXAA 4I1VA 5FOSA 2HJVA 3TNFA 3AV8A 3SQXA 2CVHA 1ZAKA 5FI1B 4OHZA 3QIAA 5BQ5A 4Z8XA 2WIAA 3CNLA 3FB4A 3QXSA 3LBIA 3EIEA 2J5XA 4LJ9A 3TVDA 4A6PA 4QBGB 5DHFA 1FQJA 1UFQA 4EIWA 3Q7PA 3LQRA 5AUIA 3BERA 1Z0IA 5CLQA 1W36C 1YQ4B 1YRAA 2A2ZA 1IXZA 4QBHA 3VR5A 3VR9B 2ZPTX 2IUUA 2J46A 2CLDX 3RABA 3W6PA 4LJ4A 4YTPB 2WWXA 3TE6A 3EZ6A 1MO6A 2ZE6A 4RD0A 1GKIA 2H18A 2VP2A 1A70A 1XWIA 4V02A 4B34A 1I4TD 1QHHB 4JSTA 4Z8YA 4A9AA 2J45A 4FCWA 3FFBA 3LQQA 1U98A 4YC7A 1TX4B 4KFSA 3IQWA 5BWMA 3P4XA 5J4KA 1SVMA 4BPBA 4U02A 1XPRA 2XB4A 1GWNA 2YV5A 3B1YA 4XSGA 2C04A 3WBJA 2OBNA 1ANKA 1D9ZA 1Z0JA 4V03A 2VQSA 4URXR 2G1JA 1ZNXA 1V5WA 5FTLA 2PCJA 1G3QA 1IOZA 3BGWA 3WP0A 4TMKA 3UXMA 3KB2A 1AKYA 1FNMA 1OIXA 3L8ZA 4Q4JA 3W5IA 3HP1A 1JEDA 3PUZA 4BGDA 3KQLA 2QE7D 5A5GA 3B78A 4NTZA 2VP9A 4LHYA 4WQMA 1WP9A 3BS4A 3F5FA 2B8WA 2NG1A 2ZJ5A 4IKEA 521PA 3ZYCA 2XGJA 1L7VC 4U00A 4HAYA 4XWAA 3W5JA 5FR2A 4ZDIA 4CEIB 2VSOA 1FMJA 4CIDA 2EQBA 4BZPA 3BD9A 2WSSA 2B76B 1OJLA 4C9BA 2IA5A 3P4PB 2G1EA 1XEXB 3CNOA 4AD8A 3BB3A 1AQUA 2V8OA 2CMKA 1G8FA 5EQTA 5FOUA 1WBBA 1KMHA 1DE0A 1FOEB 2AD5A 4M1YA 3FAHA 4WZBE 2NZ8A 2WAXA 3R7WA 1FXIA 4AG6A 3EWAA 3T1VA 4GPTA 4P6VF 1GDDA 4C2TA 4O25A 3UANA 3NKVA 2CE2X 1CULC 4DSUA 4IEEA 2OUKA 3WXMA 1OH5A 2H89B 2MH7A 3N70A 4ASUA 2HLDA 1FMAD 2JLRA 2BOVA 3THOA 1BMFA 2LWIA 3UWOA 2GNOA 1TYGB 2V55B 2YOFA 1NIPA 3WYFA 3B9JA 2VP5A 2NO7A 4HLQB 5LDDC 1NMYA 2HDNB 3KUDA 3UG6A 2D2EA 5DI3B 2VPPA 3OIYA 1NY5A 4HAWA 4C0JA 1Q21A 2JAQA 3E1SA 2AX4A 4JBXA 2WS3B 1JRPA 3FFAA 3NDPA 3OFNA 3VTKA 4LBVA 4E07A 2RGNC 1XLQA 2FE4A 4HLUC 3THWB 2MJ3A 3X1WA 1OFHA 3T15A 2Q5WD 2H17A 1NVUQ 4DSTA 1GVNB 1SZPA 1T3LA 4EFNA 3X1XA 4A1FA 1TMKA 5KSZA 4YONB 1W5TA 1Z28A 2GZDA 3KXLA 1Z08A 3L43A 5FI0B 4DLWA 1TKYA 5JECA 2BV3A 3ECCA 4KSBA 2EWVA 1LFDB 3BXZA 3IIMA 2V7QA 3IHWA 2C99A 4O3MA 4BFSA 3P63A 2IWHA 5FOWA 1NI3A 2OCBA 4JJKA 2GCPA 1ZINA 5DE3A 1ZW6A 4L9SA 4LJYA 3ZYYX 4OHWA 4ZKDA 1TQ4A 5IRCD 1R7RA 2F1JA 1CR1A 3RC8A 1VG8A 2IYZA 3R8FA 5F3WB 1BKDR 1G21E 4NYIQ 4PANA 4RD2A 4IDIA 3GEHA 1UDWA 4YXWA 3EIHA 3V4FA 1DEKA 1XMVA 5L3RA 2HEIA 5BYKA 1MABA 2AL7A 3GQBA 3TK1A 1F3OA 3DKVA 2P0EA 2QPOA 4A0FA 1BMFD 1R4AA 2CHGA 1UM8A 3AE9B 1N5WA 1W5SA 2PZFA 1EWYC 3U7FB 3K0SA 3C16C 4R2IA 2QENA 3SN6A 1PFDA 1E69A 2PL3A 2M19A 5AK0A 3AVWA 1XPOA 4BZXA 3M4YA 1FRDA 2JIZD 2ZJ8A 5HE9A 2VYFA 2Q9AA 3UG7A 4D4JA 4I99A 1PZNA 4LBYA 1N5XA 2WIBA 1G3MA 1G8YA 4DHEA 1FUKA 1ZD9A 1E4VA 4YQFA 3NDBB 2E3TA 4LZZA 2VBCA 5DN6A 5DIFA 2OV2A 1EWQA 1N60A 4Q4JB 4TZ0A 4A92A 4B44A 2J7KA 1JEEA 3EPKA 3MUFA 1QBKC 3CB4A 3JVVA 2ZRCA 4JT2A 4W5JA 3W8NA 4M9SA 4AKGA 2R6CA 2GILA 2AK3A 2ZJOA 2ZS9A 1N0VC 4UJ5A 1NN1A 1KO8A 1V8CA 2QIEB 3AEEB 2W3SA 1ZUIA 1RYFA 5JBQA 4WIAA 4MRRA 1US8B 3TGPA 1E2HA 2F1HA 2EYQA 3CH5A 2ODEA 1XCGB 2IYYA 2RGAA 3FWYA 4NCIA 1S0UA 4Q7MB 1LV7A 3RS3A 2CE7A 2BMEA 3L0OA 3MWJA 4D26A 1KJZA 1G4AE 1G7CA 2WKRA 4M1OA 4PHGA 3EA0A 4ZI3A 2FGKA 2IS2A 3P27A 2DFTA 1JR3E 1WGKA 3LAWA 1M34E 2A5YB 1T6NA 2G3YA 2CBZA 1US8A 2IUSA 4IEIA 3RDPA 1AKEA 4CF7A 2GRJA 4G5GA 1GKUB 3AE5B 4ESHA 1T9HA 4ITRC 4HLCA 1J2JA 1BYUA 2X1VA 5DLQC 4Q4LA 2ERYA 1JAHA 1OXUA 4A8JC 3OAAA 1AZSC 4GFDA 721PA 4XVQA 3RHFA 1SKQA 2W6ID 4EQ6B 2G0TA 3BOSA 4HDCA 1N6RA 3ZIAD 1ZM3A 3KKPA 2O8BA 3DDCA 5DYGA 2JLZA 1OV4A 4L15A 1CR2A 1RRPA 1R5BA 5JS8A 5FOXA 1E9DA 4MKFA 1GZSA 2QL6A 2CL7X 1N0UA 4JJZA 3IDQA 2JCSA 4OQNA 1GL9B 3AKCA 4D4MA 1DELA 1W2GA 4RFSB 1DAHA 3MWLA 4QC2A 1KO5A 2ODWA 3IIKA 4JLJA 3UKDA 3IBYA 1W4AA 2EFHB 4QGAA 4QNMA 2Z5FA 3UK6A 3WHKA 5KU1A 1YR7A 1DAIA 3KKNA 1CP2A 5FR1A 3VHXA 1DBSA 1X6VA 2QN6A 3CRQA 3RS4A 4RZXA 1N6KA 1J90A 3BK7A 1E0SA 2WBLC 2CLCX 1P3JA 2IYVA 4IXNA 4AYXA 3B13B 5JWHA 2A9KA 3K9GA 1XMIA 1E6EB 3DWMA 2V1UA 3QVUA 1P75A 2C9YA 2VH5R 1PJRA 4QG7A 3TH5A 1UEIA 4C0QC 3A8TA 2N0SB 1F60A 2GDJA 3B82A 1E2EA 2JQRB 3KZ1E 2JDID 4KVGA 1T3QA 4JWSC 4MRPA 1X8JA 2XSZD 4NYJR 4DZZA 3GLIE 1G4UR 2GAAA 2K22A 2NOAA 2UKDA 5C4GB 5TV2A 3C8UA 1FPMA 2ZSFA 4QGGA 3U3OA 2J41A 4ZCLA 1G41A 5KNCA 2QORA 1YZNA 4NMMA 2WWGA 2UZ3A 3K9NA 2RGCA 4EFMA 5JSZB 2V54A 4HLUA 1G7SA 1F6BA 4FN5A 3ZJYA 5L3SB 2ZIAA 3ZIAA 2WWFA 2WWIA 5A0FA 4EPYA 3I72A 1G7TA 1A82A 3EC2A 1B0UA 4BLPA 3U7GA 2QE7A 4QHYA 5AJXA 3Q5DA 1KK1A 3TUIC 4ABYA 4A82A 1TEXA 4YT0B 5JWOA 1DOYA 1ONBA 3H86A 1O3YA 3TUJC 1RM6C 1G19A 2F3RA 3BWDD 5AUPB 1JWBD 4MGZR 2OT3B 4M1TA 4E22A 1H8EA 2IYXA 3I92A 3O47A 4RD4A 1J8MF 3SEAA 2FGJA 2P65A 1E0ZA 3I4LA 4X8HA 2ZXUA 3HUIA 2V3CC 4B74A 1W48A 5FBQB 3RWMB 4FWTA 5GJWC 2R2AA 3K0AB 4G5SA 3UATA 1Q12A 1U9IA 1ZC4A 2G9NA 1P2TA 3TKLA 2VHTA 2ZTSA 1Z0FA 4D6PA 2Y5CA 4B47A 1G3IA 1KDPA 4XD7D 1DOIA 2KWIA 2SHKA 4MYHA 4ESVA 1A4RA 4IDOA 4Q9IA 2AD1A 2GZAA 3TR0A 2AWNA 2FH5B 2ANCA 4PAMA 2RMKA 1CR4A 3PG5A 4LK2A 1KAGA 4OJKA 1D9XA 1WWTA 3E2IA 2KMMA 4EQ6A 2V6JA 3OE7D 1KNQA 3BH7A 4UNPA 3OF5A 1KHTA 1KDRA 2BHRA 4S2EA 1ZJ6A 5SZJA 2NQ2C 1UWMA 2QSYA 4XOIA 4I81A 1T0JB 2R65A 1W7AA 3KTAA 2LKCA 1AS0A 2I1VB 2X77A 1HV8A 2H92A 2FJUA 1G8PA 2GESA 1VMAA 2VIIA 4TMVA 3ZLJA 2GK6A 4KSCA 4KO8A 5G53C 5L3VA 2GA8A 4JL8A 2QPAA 1G3RA 1NMXA 4LY6A 4V0LA 4JLVA 4FIDA 2BS2B 3VR2A 4GOKA 1DO0A 1NBMD 2FMXA 4C0BA 1FTNA 1SIJA 4AG5A 5KSYA 3EAQA 5KO2A 4PPNA 3OIUA 2CCKA 2EFEB 1EESA 2BMJA 3BH0A 3QBVA 4QGHA 1IN7A 3KL4A 4AI6A 3WNCA 2RAPA 4R9UC 4B71A 1RW4A 4GP7A 2O8CA 2DPXA 1H8HA 5LPNA 4BFYA 4QJ3A 3DWGC 3CRW1 2O8EB 3I61A 5C2JB 1XTQA 5E3HA 2HT1A 3B5JA 1XLNA 2CK3A 5GJBA 1P7CA 2KB0A 3NH6A 3HVZA 1NRJB 2WPDD 4BLRA 4DCTA 4GP6A 1D6JA 2CJWA 4WWMA 1E3MA 3PJRA 1UBGA 4ZPXA 3U44A 3GJ5A 4NONA 4LOAA 2ZS7A 4LSGA 2QRNA 3PQCA 4PPFA 3DVLA 1AM4D 2A3RA 4PR0A 3NRZA 1SVLA 1G5PA 2XOKD 1XD2A 4LI0A 3S1AA 3EX7C 2WKQA 1U90A 4GMXA 1XJCA 1NYQA 3H84A 1AS3A 4IFBA 4UNRA 3THXB 4ZO4A 3K0CC 3SBDA 2IS6A 4NDZA 3NBXX 1JNYA 2BIFA 3Q8XB 3LFUA 1JI0A 3OAAD 1JROA 4JMPA 1E0JA 4DDTA 1TPZA 3KXKA 2KE5A 5D3MA 5P21A 4C0AC 5KDLA 3W90A 1MO4A 2IWRA 4XVUA 3LY5A 1XP8A 1E0KA 1YVDA 1PLJA 1OFIA 1TF7A 2OAP1 2REBA 4PXAA 4PHHA 1NN0A 3FKQA 4Q7KA 2CXXA 3UPUA 1UPTA 1GP2A 2VLIA 4Y0AA 4RD6A 5CDFE 3CKLA 4DLUA 4Q47A 3ZD6A 1YZUA 3CX8A 5JSZA 3ZD7A 1Z8FA 2A78A 2DCUA 4HAZA 3PO0A 4KX6B 2OSBA 1Z0AA 1BO6A 2OESA 3PUWA 2AHOA 4RD3A 4URYR 3KFVA 4TLDA 4Q9LA 2JJ2A 2RGXA 3HYTA 1GNPA 2JIZA 4F92B 2O0HA 4LYFA 1W44A 4HDOB 2KAJA 1SVWA 4R2HA 5JS7A 5TARA 1E99A 3HR8A 2JLQA 2Q9CA 1G7RA 2Q3FA 1NEKB 4G5RA 4ZHPA 2VA8A 3ONWA 4BUJA 4QXAA 1N6PA 1CJVC 4M53A 5D3MB 1Z6TA 3SHWA 1VHTA 1EFRD 4Q66C 1SVKA 1RJ9A 1Q0UA 2FEOA 1WMSA 2ZYUX 4NL4H 4A0RA 2GXQA 2AR7A 3U60B 2GEUA 3FMIA 3PENA 2ZE7A 4PC7A 3T1OA 4Q4HA 1E2QA 1G5TA 1QVRA 2VHQA 2K9XA 2IUTA 1JR3A 4GOJA 1GSIA 1LVGA 5KNBA 2XSZA 1ZOYB 3N5CA 5J4VA 1KY3A 1K6MA 3REGA 2IYUA 2FFQA 3GEIA 3B9PA 4RFSA 4TYNA 4TSFA 5FOTA 1K5GA 2IYRA 2G0NA 2OCPA 4K8OA 1NVVQ 3TQCA 1CR0A 1MH1A 4G5OA 4URVR 2ZRIA 1GG2A 4DIDA 2YHSA 3NEJA 2O8EA 2RGNA 4RKEA 1F0ZA 5H70A 2QTVB 2O8CB 5C1BA 4Q1CA 3AB3A 5HKKA 4M21A 1Q1BA 1HE8B 5CYPA 4PQRA 3G82C 1GAJA 3MRSA 3ADBA 2ZRNA 1CF4A 4H1VA 2A30A 5EXXA 5FBRB 1CBUA 2JJ2D 4P3YA 1UAAA 5AUNB 3QSYA 1KK2A 4V0OA 1E2JA 1N6HA 4MQBA 4UNNA 1W46A 1VG0B 2ZE8A 1QHSA 5DI9A 4LBWA 4PFSA 3ICQB 1OHHD 1NJFA 2AXNA 1XU4A 4HB4A 3MLEA 2BBTA 1G8GA 1KIMA 2CVFA 5EXPA 4DBLC 3IQXA 4HYYA 3U2QA 3B85A 2PX0A 1UKYA 4D0NA 4LV8B 3D3QA 4PSVA 4DLVA 3RS2A 3F3YA 3AE8B 1SXJE 1UBFA 5B30A 3SYNA 1U99A 1L4YA 1N2CE 1KJWA 1Q44A 2QP4A 2F1IA 1R10A 1S1MA 2OILA 2NZJA 4CT5A 5KPDA 3B60A 5BW8A 2E87A 2ZSAA 4C0LA 2H57A 3FGNA 4UJ3A 3A1UA 1ZNZA 1E1RD 3WYGA 1ZYUA 2R8RA 1Q3HA 2XAUA 3OESA 1XX6A 2OBMA 1VIAA 2H1LA 3KKOA 1NENB 3W5UB 1LW7A 1SXJD 4KYUA 4TSFD 3T12A 2IYSA 3RVBA 1JJ7A 2IYTA 1G20E 2MMCA 4AWXA 4BECA 4EFLA 1J7CA 4ZHOA 2ORWA 4LYHA 2C03A 1TU3A 2ZJBA 1Q1EA 2YOGA 3L82B 2FEMA 4DWJA 3W3ZB 5C2TB 4OJQA 1VECA 1X3SA 3K0AA 1G8HA 2HT6A 5FL7D 1CIPA 3SS8A 3AP2A 3SYLA 4UKDA 2GJAA 4LRWA 3LXFA 1XCMA 3PEWA 2FBWB 4I1SA 5IK2A 1WB9A 2B21A 2ZROA 2WP9B 2QG6A 2GBLC 1WF3A 5M04A 3AH7A 3VU9A 2ZRLA 2Q9BA 3BB1A 4MUAA 3BORA 4CEJA 3I5XA 4BFUA 3R9IA 2J9RA 1AJEA 4MYTA 5JZVA 4RKFA 1F2UB 4W5WA 3U61B 4DT1A 5AR1A 3E70C 3X2SA 5C46F 5EXTA 1A7JA 3IIJA 3ZGXA 4Q4AA 3QKTA 1P9NA 4JT4A 4JSYA 2A7QA 5AUOB 3ADDA 1D8TA 1H8HD 4NYJQ 5DGXA 1E79A 1M1YE 2R6GA 1D2EA 1W36B 2Q3MA 3D6TB 5UKDA 1JAIA 1EX7A 1P60A 3ZS8A 3GLIA 1G6OA 1NN5A 2IX3A 2D3WA 2CL0X 4B33A 5JJLA 3SFDB 3AF2A 1VCIA 4BQSA 3VHLB 1XRJA 3RAPR 5JLJA 1KO1A 2OAQ1 1OQRA 3Q85A 4PC2A 3PV0A 4LJ6A 5TY0A 1EFRA 2F7SA 2WMOB 3SDZA 1E9AA 2QQ0A 2QM7A 4Q21A 1EFCA 1TJEA 2GETA 2ZRMA 1OH7A 5K8UA 3NXSA 5KDDA 3OHMA 3T34A 1ZBDA 2DBYA 1XJ0A 3EC1A 4IFEA 4BLQA 2PMKA 5E7IA 5FUWA 3OEHA 4B3CA 5J4LA 3VNVA 4C30A 2FOLA 4B2LA 2ZU6A 2PH1A 4DT1B 1Q3TA 3I8SA 3PEUA 4IOKA 4KFTA 2NPFA 3UMRA 5J4YA 3IPYA 4GT1A 4HZUA 3KKQA 4PZYA 1E9EA 4TYYA 4DSNA 3RANA 2WV9A 3FC4A 1NY6A 4XSHA 1ROEA 4BFTA 3IKJA 4GNKA 1DOXA 1AS2A 2FSHA 1MKYA 4NBSA 4D0GA 3MWYW 4A36A 1G3UA 1QG2A 2JGNA 2W55A 1A2KC 1KMHB 4LJAA 1RZ3A 4WA7A 2FFAA 1CTQA 1W4BA 4CT4B 1GL6A 1DARA 4LTUA 2IBMA 3CX6A 5FL3A 2QJLA 2ZAMA 4M2LA 5CDFA 4ASUD 1R7SA 4B3GA 4N58A 5JHGB 5JRJA 5EE9A 1U8AA 1VLBA 1X8KA 1YZLA 2VF7A 5HZHA 2BBSA 3TRFA 4QKQA 1E0AA 1TKGA 3RS7A 1RFLA 3ABVB 2HYDA 2DWPA 1K5DA 1IXSB 1OKKD 2ERXA 2ZSEA 2YC2C 4HEJA 3CF6R 3LX8A 4B2IA 1IONA 2AKYA 1X86B 2J59A 2QAGA 3QKSA 2XEXA 4BRUA 4IDPA 4CEIA 1NBME 4ERNA 4WW0A 1T8UA 5J4HA 5FTJA 4PO1A 4MH0R 2NO6A 1N5JA 4QHSA 3A58B 1EGAA 2W83A 3VQTA 1DOAA 1BH2A 1E9SA 3EZFA 1DVRA 4BFZA 1AWDA 2XJ9A 3K0EA 1HE1C 4ON9A 2OHFA 1Z0DA 2Z4RA 4PHFA 4V0KA 4D82A 1G6HA 1KMQA 2D4HA 1CJMA 3FHCB 2JJ8A 5EP4A 1KAOA 1N5IA 3AH8A 3SZRA 4GRAA 5EZ6B 5C18A 2JATA 2RHDA 4PPGA 5IHPA 4Z54A 1IQPA 1E94E 3FKSD 2WOJA 5ELXA 2PVGC 4Z1MA 3DO6A 3ZQ6A 3AGQA 4Q1FA 1R5OA 4Q48A 2ZJZA 3MJHA 2MJEA 3GLHA 3AEFB 3O8CA 1VYTA 2QZ4A 2CNWA 1IM2A 1CEEA 4US1R 3M1IA 1OIWA 2RHMA 3B1ZA 1NG9A 3LD9A 1HEIA 3AEBB 1XTIA 4DDVA 1PUTA 1JQLB 3QE0A 2JLXA 1FM0D 4V0NA 1DAEA 1Z2AA 1BIFA 2C2HA 1GTVA 2GWHA 2BCGY 2VTKA 5JI3E 1COWD 1QDEA 5KNDA 4KV9A 4DRZA 2L52A 4A8JA 2JX5A 2F55A 1N25A 5GADl 3VKHA 1P4SA 1OPXA 2EFCB 3M0EA 5E4FA 2WAYA 3IO3A 4P4TA 1CS4C 1E9BA 4C4PA 3AVOA 4I4LA 3CIRB 3CUEF 4TN1A 2OCAA 3A4NA 4HROA 2G1KA 3H1TA 1FIQA 2F43B 1MABB 2XTZA 1KRHA 2I1QA 1Y63A 2MSDB 1T3HA 2P67A 3DEFA 4TWZA 3VKGA 5B64A 2Q3HA 1OT3A 4QM7A 1LNZA 3P26A 4R71A 1SVOA 4ILEA 1GIAA 4IXMA 3SHFA 2WJIA 5D3QA 1RE0A 2QA5A 2ZAOA 4OI4A 4B3DA 3N2IA 5DO9A 2O0KA 2H16A 4PZZA 3U3RA 4JVMA 1NNEA 2OFXA 4PC3A 4B6FA 4TMZA 1GILA 1FZQA 1U2RA 1VG9B 3QXHA 4TMWA 2DR3A 5FPSA 4IVRA 3GFPA 5G5GA 3NG1A 2NTYC 3FKSA 2QMHA 2PEYA 3AVUA 4C7ZA 4RZ3A 1FP6A 2QAJA 4NCHA 1J7BA 2HF8A 3AF1A 2QTHA 3GPLA 3ND9A 2D7DA 4TMTA 4QM6A 2X19A 1C9KA 3EZ7A 4C0KA 1II8A 1OH8A 4CYMA 2FU5C 1Z6GA 2VHJA 2G83A 4IW3B 4CW7A 2J0QA 2IYLD 1LS6A 2QM8A 3MFYA 2WVJA 3IO5A 3SE0A 3NH9A 3THWA 4OHYA 3CRRA 5L3SA 4Q01A 1Z06A 2H5EA 2RGBA 3GLGE 5CJ2A 4JWUC 4M1KA 3TQFA 5IK2D 3OFND 1N63A 1KI6A 2ZVQX 3HU2A 3SC3A 1E2DA 2VHUA 2W2XA 2ZEJA 3JVUA 2KBFA 4HAXA 1E1QD 1W0JA 3DL0A 4JLNA 3AVQA 3RRMA 3ZZTA 5L3QA 3OEED 2IL1A 4CZ2A 1IY0A 4URWR 4H9GA 3CZQA 3F8TA 4KLNA 1Z6AA 2XZOA 1CU1A 5J40A 1CLUA 1IN6A 3TW8B 3LBHA 3A1TA 3QPWA 2R6AA 3C14C 4BE7B 2FN4A 1PV4A 3QKRA 5K8TA 4ITKA 1ETUA 2YWFA 3R8CA 4D2IA 5HR5A 3I32A 3CPJB 3NTUA 3Q5EA 4A0HA 1AIPA 4WVFA 3WMGA 2NO1A 3K9LA 4C7YA 3RRNA 1GRNA 3CNNA 4DLZA 4QJ5A 1TTTA 3LLUA 1NYRA 3SFEB 2ANBA 3REFA 3FDIA 2PT5A 4CEHB 3BH6A 1GRRA 1XD8A 2D62A 1AK2A 4I1OA 3ZVRA 2F9MA 2QAGB 3QKSB 1NSFA 2OG2A 4X8LA 3SJZA 4YXWD 1VCNA 1XEXA 2ZETA 4D80A 1SKYE 2BVNA 1MV5A 3PXGA 1EFTA 4AY2A 1S4QA 3KKMA 2A5FA 1NBMA 3DOEA 1ZM4A 4PX9A 3THYB 1FX0A 3LBNA 1M6NA 3BE4A 3NHBA 3AP1A 4LWZA 4DEXA 4EPXA 4JVLA 2QSZA 3ADCA 1HTWA 1LB1B 4LHZA 1AA9A 1FRRA 4Q02A 3HYRA 3EG5A 3U5ZB 2ASEA 2C9CA 4EPTA 1JR3D 1CRQA 1IXRC 4YLGA 1XD9A 3MD0A 2YWHA 2C77A 3VX4A 1PUJA 1QF6A 4LHWA 2IS1A 1I4LD 2J7PA 1KDOA 2Q6TA 3L8YA 2Z0MA 5EP1A 4ZCIA 1N5KA 3A4LA 3JZAA 3U7HB 5FPTA 3QPUA 2EWWA 4Q03A 1FMLA 1U0JA 3KQUA 1N6LA 1HT2E 1PDXA 3GJXC 2BT6A 1DG1G 1IBRA 3FOZA 2WOOA 1XPUA 1S9DA 2A5GA 5JWRA 3A6PC 4HATA 3VFDA 1JALA 4P32A 3VR4A 2JLYA 2R9VA 4BZQA 4ZCMA 5AWFC 3AVTA 3U6BA 3DZ8A 1GUAA 3VNUA 4US2R 4A6XA 4ZDKA 3Q72A 1U0LA 3CWZA 4M0LA 3H0KA 4NCJA 1OLOA 5DH9A 5H68A 1GFIA 1W4RA 1Z6YA 3VR6A 1AN0A 2OM2A 3QPVA 4MA4A 4CRWB 4N1AA 3V4RA 1P5ZB 1IY2A 4HRSA 3SI7A 4EAQA 4JVNA 3K0FA 2FFBA 4R98A 3QVVA 1S3SA 5FPYA 1T0HB 1HUQA 1D2NA 1M8PA 4B35A 4IOJA 1S3GA 4TT3D 4A0GA 1S8FA 2DFNA 2MSCB 1L5PA 2W6JD 3B8HA 1ZUHA 2EVWX 4XVRA 5EJEA 3HU1A 2VSFA 3EZ9A 2EU8A 3EWSA 2HLDD 4KAXA 2ZI5A 3DHWC 3UMSA 4FMDF 4PSKA 3TUZC 4YMUA 3A1WA 1OQQA 3B1WA 4NU0A 5L8VA 5TXGA 1DO2A 1N5LA 1T4GA 1QOBA 1AZTA 1XF9A 4BEBA 1NVWQ 4TLAA 2OLKA 2QTFA 4HUQB 4A15A 4FCTA 1H65A 4TYWA 5HTKA 221PA 4C7OB 1ESMA 5K8IA 2WDVB 2YVUA 4W7SA 4JLMA 4AYTA 1OYYA 1DAMA 4ZDWA 2CL6X 2TMKA 5CIWA 2XXAB 1R2QA 1QZXA 3BB4A 3TR5A 5BN3A 1ZIOA 2Z43A 3FMFA 4B32A 2OCYC 4OK5A 1E9MA 2BMFA 3BIID 3U3JA 3A4MA 2BCJQ 5FL7A 4DSOA 4B3BA 1DAKA 3IHLA 4OQFA 1W4CA 1WDTA 4TL6A 821PA 4LC1A 3RS5A 1FW6A 1QF9A 1SXJC 1NN3A 1ZNWA 1TNDA 3WMFA 3P4YA 1HY3A 2J1LA 3BRWD 3CZPA 4Q00A 2O8FA 4BRWA 4ARZB 1XEWY 2CHQA 3LDAA 1B23P 2CHVA 2OXRA 2ZRPA 2C5LA 2NIPA 4JBWA 3WYAA 3QNUA 1M74A 2B7BA 2GF9A 3NVYA 2RKOA 1C4OA 3A1VA 3B6EA 3CF2A 3PITA 1OW3B 5F9FA 4QOSA 2GEVA 3R20A 4N6EB 2FV8A 5MPOA 1YR6A 3HWSA 4Q19A 4HDQB 4DB2A 1KJYA 4M1MA 4D81A 3DM5A 4BFWA 5F2EA 2PX3A 4JLOA 2GCNA 4JBYA 3EUB2 1KI7A 1M7BA 4L4UA 1L8QA 2JEOA 2WQYB 3AMZA 5J5CA 5LB2A 3VKWA 1KK0A 1OXTA 3K1JA 2BBOA 1E96A 2C95A 1IUEA 2GCOB 2R6DA 3GD7A 2QGZA 1IN8A 1KY2A 1UADA 3PIRA 4WXPA 4K46A 1I2MA 3CR7A 2PVOD 4KLZA 1WXQA 3KDSE 5TVKA 3AVPA 1Z3IX 4KHZA 3P32A 2OXCA 3P1JA 1S9HA 1NSTA 3AKDA 1FP7A 2HCBA 2L83A 1YZTA 2W54A 1P73A 2CEAA 2V7QD 1M7HA 1NJGA 4RY2A 4EJSA 2BEJA 3GLGA 4MYUA 5LB4A 2W58A 3A36A 4RD1A 2MJDA 1PLLA 2DYKA 4TTRA 3K09A 5G40A 1NLFA 2D74A 2ZI4A 1W1WA 2CDNA 2AWOA 4MITA 3ICEA 1TU4A 4MRNA 4JLPA 2QMEA 4IHQA 4JYBA 4KODA 2QROA 3KQNA 1TF2A 4BLSA 2ACZB 1GRQA 1G5RA 1LTQA 1Z6XA 3JZMA 4KYIB 5KSPA 4GZLA 1V43A 2BDTA 2RB4A 2PJZA 3K9HA 3OIVA 3Q7QA 4FMCF 3CW2A 2ZRDA 3LB8C 1E1QA 1PUIA 1M2OB 4LC0A 4RCYA 1YKSA 2WZQA 5GVSA 3D31A 1Z29A
chains in the Genus database with same CATH superfamily
1A2QA 1SBZA 4V2UA 2XB6A 4EBBA 1BGXT 2ZS8A 5HTOA 5JEEA 3U5TA 4OKSA 3MGCA 3DFZA 2ZCCA 4BMXA 2NM0A 4CLRA 2W6JA 3BCSA 3M83A 4BMPB 2GF0A 1XRMA 4QUJA 3GIDA 1W88A 1H2ZA 1NU6A 1ZHOA 1YO6A 3O4FA 5CA1F 4JYCA 4OB7A 4ECAA 4JEMA 1Z16A 2QDXA 2HPZA 1I3OA 2K2QB 1Q74A 4NYMQ 3BJMA 1N2CA 1JQDA 3RAFC 2RGUA 2LKDA 3RRFA 2A9RA 2CJOA 2RGDA 4II2A 2YJTD 2UWQA 4WE3A 5EWJA 1XZFA 3P94A 3AN1A 1U8ZA 1GUFA 3EFUA 1N1GA 4ZWNA 3K92A 4GKBA 4F93B 1GTRA 1SCUA 2YN0A 4HPJB 1UP6A 5AM5A 3ECIA 3GFGA 3D7NA 4YAIA 5TQ0A 3KSUA 2I8LA 3RYTC 1E9FA 3SZLA 2CK3D 3DTTA 2W42A 1KOFA 4Q44A 4H4CA 4OHBA 1Z22A 2LBOA 2DSTA 5KG0A 1XMPA 3J81k 2REXB 1RHKA 4A2QA 4LX8A 4CF5A 3EECA 4PLTA 1DZIA 3GAAA 1GITA 3T3PB 4PE5B 4ND7A 2F8LA 1KKMA 3KOUA 1Z4JA 3TEFA 3RYIB 2J52A 2AXPA 4UUMA 1JQ5A 5IAAC 3A6FA 5F3DA 2GI9A 1FFVA 3GDFA 3W2TA 1DKPA 2VG8A 3CT6A 5JDCA 1CQWA 1FBTA 3HVDA 2CNDA 1MQ9A 3EFOA 2Q5FA 4HNGA 2B5OA 2AN5A 4G8DA 3ZV3A 2LHEA 5D84A 3S8MA 2PBRA 3BK2A 1GA6A 1I94B 4NBTA 2DQSA 3H97A 4MINA 3MCWA 2WXFA 4P1CC 4DGQA 1ATIA 4JIMA 1PIWA 4ND4A 1KYIA 3IG5A 1DG3A 3L3FX 1NMQA 4LXXA 2DB3A 3TAHA 1JIIA 2OWDA 3L4JA 4JEUA 2H31A 3MDCA 1IUOA 3RBAA 5LD2B 2RHHA 3BZWA 1UC4B 3V4ZA 3WRYC 1PW7A 1X1DA 4C4AA 2X5XA 4IBOA 1N2EA 3D8HA 4A26A 1L2TA 1XEFA 3INNA 4KWTA 3PWSA 1ZXLA 3RPFC 1Z3CA 2ENWA 4MVJH 3PEVA 2O2GA 3DV0B 4KDIC 2A59A 1UA0A 4US8A 2I87A 2W9CA 1CY2A 1XB2A 2ODNA 5FQOA 2PG3A 4DV6B 1YCHA 1KVRA 4G0ZA 4IWYA 3GRYA 3R74A 3TVTA 4YLEA 1K89A 3FNQA 1QNLA 3RYIA 2CV2A 3UA3A 1J0EA 1XQ1A 3DLPX 3IKMB 1Q15A 3IEKA 5HEKA 1YR2A 3WHLA 3DMDA 2QB1A 3ETDA 1ZMBA 4MKHA 4C20A 1PL7A 1ZIPA 2ZRBA 2CDCA 1JR6A 4ECEA 1X9HA 2B7CA 1PBTA 2XTMA 1WZEA 2GM5A 1IBLB 2B9VA 4OQLA 2R11A 2G8LA 3QFHA 2NO5A 4C7JA 3QBJA 1PDVA 3HEBA 3PRPB 4HQ0A 3WGGA 4GDLB 1VIYA 1GFSA 2H1IA 4C7BA 3PR3A 1H0SA 4OQ4A 4O1NA 4YVFA 1V37A 4X8OA 4AJJA 4LXTA 2QWXA 1XMSA 3HA7A 1PR9A 1W0CA 3F90A 2Z8YA 1IC6A 3WRVA 3JAWB 2ZJFA 1PO7A 1W47A 4OTZA 1TKEA 1EGVB 3TBLD 3C0KA 5GV8A 1SCQA 1N6NA 2IPXA 1AD2A 2E4XA 4IIGA 4RVFA 3UENA 2RK6A 3C3XA 4L78A 4LF9B 2DHCA 3FGOA 3CVYA 4CN9A 5ED4A 1PFGA 3GGCA 1ZL0A 1HFKA 1JEQB 3IP7A 4UBBA 2N46A 2YXDA 5JCJA 5KNCH 4RTPA 2AQIA 1I7QB 5K0CA 5DSZA 2K4HA 3A1QB 3JVDA 5CITA 2ZCBA 2M0AA 2QL5A 1XN1A 1YHNA 4WAUA 3F3MA 2NTTA 3C70A 1DOZA 2CXSA 1SCAA 2XGGA 1HEYA 3MCUA 1ONNA 1UPFA 4HI0E 2R62A 5LYJB 4G01B 4ZCTA 1KIFA 4BU1A 3BJEA 1CJBA 4EJSB 2WF7A 10MHA 2WWYA 1L6VA 2F3TA 4B9AA 3RT1A 1UIMA 1RYBA 3JPSA 2UVRA 4FFVA 4D5GA 2O5RA 2DWCA 2QDFA 2V3PA 2V4ZA 4MDFA 2D6FC 3F1KA 4ZPJA 2BZ1A 1HDEA 3KFXA 2KT7A 3NDRA 6GPBA 1KTQA 3JQ9A 4M9XA 2WHYA 3JSVB 3AUXA 4MV9A 4ZYVA 2C5LC 2BFFB 3GFBA 2AYOB 3E48A 2OE2A 1M33A 5CDHA 5DTQA 3VRHA 1XRLA 3EWIA 2ODBA 1C0LA 4XQ8A 2G77B 3KQ4A 2FSFA 2YYAA 3D2CA 2ZW1A 4AMZA 1TT7A 1HYHA 4GWKA 3T5PA 3ZGVA 2VDNB 4DUGD 3LK6A 2JFOA 4IWOA 5JYEA 3JAKB 3LRTA 5KFSA 4G07A 2QVBA 1K3TA 1U5AA 2A0FA 1LI4A 2ZR0A 4O3PA 4HQNA 4JBHA 1PZGA 3V9AA 4ZYLA 3U4QB 3NVKI 5TF0A 3TQOA 1A69A 1VMIA 1FFEA 2YVKA 2G09A 3R5HA 1HH4A 1JXAA 4HN4B 1C78A 4GQIA 4BKOA 4KN4A 2FSGA 3ZHZA 1L7MA 2QTLA 3TCAA 4OMUA 3C23A 2JLSA 2RI6A 4FN4A 2VP3A 3VJMA 1L1RA 1JVBA 2KO3A 3P71T 5CAEA 4YXDB 5FNVF 1ENFA 4BKTA 2V4RA 2YZGA 3R3WA 4HLDA 2YVQA 4N5IX 5BYRA 3ETNA 5FK9C 1HEUA 4NFLA 4EHAA 3GZNB 5G3YA 2VNIA 3WGNA 4F46A 2C8JA 2RI0A 1WJNA 1SE2A 3HCAA 3QJ5A 1V7CA 3EHEA 3CRMA 2D5AA 2Y76A 5EJ6A 4YMLA 5IDXA 3PXAA 3CYFA 4P0QB 1TE2A 1G1MA 3EH1A 1XSPA 2PEZA 1GUDA 1Y3IA 2ZK7A 4NJMA 2PWZA 1VSQA 2BCQA 3OPMA 2C7RA 3W2DA 2KZRA 4OQPA 1EVZA 1FFYA 3W9CB 4Q43A 2KFNA 4FW9A 1WU8A 2IHZA 1ZM2A 2JFFA 2AR0A 3GUZA 4B80A 3AF4A 3HJHA 4NJEB 3IC5A 3U62A 4DEVA 3N2GB 4FBUA 2VQFB 2H4FA 2F17A 1R0ZA 3NZSA 2CUTA 1D6NA 4DXDA 5IYZB 2R87A 4RTKA 5ENZA 2O6HA 1EFKA 4GS5A 4Z4CA 3LBIA 3VUFA 5DHFA 1H0RA 3LQRA 4ZT3A 2W82A 3OWXA 4NLBA 4TQRA 1B2RA 2R0QC 1J21A 1T43A 1OASA 1I4TD 3HKEA 2JH3A 1KAEA 1EIWA 4LEIA 3T3FA 3IQWA 2I22A 4QJFB 2PD6A 1V11B 1D9ZA 3EGXB 1XZEA 4PHEA 4V03A 1IOZA 3HM2A 3OOYA 1WZ2A 3PUZA 3LBAA 4TXMA 1EXNA 3B78A 3BS4A 1WP9A 2JWUA 4WOKA 4RT2A 4HAYA 2GPSA 3HS3A 2QW0X 4JFAA 4QWMA 4NHEA 1MTOA 4GXJA 1Z00B 1XEXB 4LYEA 1HF3A 4YTEA 3EIXA 2R8KA 1IWPB 1ZQSA 4YDRA 2ZIUA 3DT9A 1QH0A 1OLSB 3RFVA 2X2PA 2EP8A 2NS5A 4ZVKA 1Z18A 4CLOB 2AX4A 3B6IA 1CDEA 1YF3A 1LBQA 4WWPA 3OC6A 1J07A 1YQ9A 2GD1O 1IJBA 4ZQGA 3FDZB 4WBXC 1DRVA 1MC4A 3FILB 3DKIA 5ESXA 4MJLA 1KOJA 5FOWA 1U5CA 5A02A 4L4RA 4MDKE 1Z12A 1D8LA 2R85A 2ZIFA 4O4IA 3V4FA 3JY6A 3TK1A 1R4AA 4RJIA 4RIIA 3KVNA 2IBSA 2FW1A 3SN6A 1J2NA 1ZVMA 3AVWA 1SEBD 2ZVNA 3UC5A 4I7EA 1U63A 1UNSA 3MQFA 4R3UC 4I4TB 2FOXA 5DIFA 2I80A 2D5GA 1JWAB 5IKEA 3KOZA 1QLWA 3AR7A 4FHGA 3SD7A 3PSEB 4HNVA 3CH5A 3Q6MA 4Q7MB 1S0UA 2WWZA 4U7PB 5A1JA 4E0DA 3R3UA 4OZBA 1PGPA 3VTUA 2OGUA 4MA0A 2G28A 4RKQA 1ZQ9A 1IHDA 4OQYA 1PFKA 3PW0A 5L83A 1KP3A 2E6XA 4HDCA 4K28A 3ZIAD 5DLDA 5FDFA 3HM6X 4GW3A 3PSIA 1GZSA 3R5FA 1FPYA 3IP9A 1U28A 1A9RA 1DAHA 3TD6A 3BAZA 5I7UA 3R5KA 4KGDA 3GGSA 5FR1A 1OA1A 4ZYNA 3A14A 1RWKA 5TEWA 4HNAB 3GIMA 3K9GA 1A27A 3DWMA 1UL1X 5E0OA 3LYYA 4DV0B 1F60A 4DZZA 4YP7A 3IUJA 1XRPA 1WEKA 4YP1A 2IGGA 3TNJA 2E48A 5L3SB 1TCBA 3EC2A 1O89A 1NVEA 5AJXA 3UGJA 3H5LA 1T36A 2BEWB 4KE6A 4LJSA 3GEGA 5BW5A 1G38A 4C0XA 2F67A 1AK1A 2QTCA 2BUCA 3T5CA 1FIUA 2KC1A 3VHRA 3VUXA 4AWAA 4FWTA 3K0AB 3PDWA 1Q12A 4M8NA 5JOQA 3F2IA 4YQWA 2KWUB 2Y0BA 4G0YA 4Z9FA 4Q9IA 5IHXA 2A3NA 1D1QA 4FYXA 1BNCA 4EJ2A 1SMKA 1X77A 3GAMA 1UWMA 4P35A 1UOOA 4CLRB 4MM3A 4A55A 2X77A 3NVMB 5C81A 4TMVA 4MWBA 4UOZA 2OXEA 1LNSA 5D51S 2H06A 2Z8YM 1XI2A 2Y4NA 3L06A 5FJIA 2DHQA 5IAJA 1EESA 4KGSA 4XQ9A 5IG2A 2RONA 3WNCA 3OF2A 4M8KA 4Z2AA 5C2JB 1Q0WB 1R66A 2PS9A 1I6KA 4DCTA 3AI7A 2HBJA 4HCJA 1BFKA 3UXEA 3PD1A 3G13A 2PJUA 3GUYA 3PFHA 1I4WA 3NQ41 2Z2XA 4GSWA 4AWBA 2A14A 2R1VB 4IFBA 3QVGA 4ZO4A 4YRQA 1L0XB 3MWDB 3D0OA 2BIFA 5KYNA 2L69A 2WYVA 3KHLA 2AW5A 4WK0B 4ADSG 3LPAA 4U63A 2NBWB 1OFIA 1NN0A 1UPTA 3CKLA 2X3UA 1DCTA 1KEUA 3ZNPA 4KX6B 4HPWA 2H2AA 4K7JA 4EABA 4YUWA 3I4FA 3KXDA 4ED2A 2I66A 4R2HA 5JS7A 1E1DA 4IIYA 3TJRA 5EFZA 3THSA 1TLLA 4J3OD 2BZGA 6NULA 1XTPA 1H2XA 4A3PA 1RMQA 3U60B 4U2KA 5KJ1A 4ROTA 2FEPA 1QVRA 4FHZA 2VHQA 3KKLA 1QKIA 4B6WA 4QEKA 3U4IA 2SICE 3DL4A 2IYRA 1SXPA 2MU2A 2WE7A 5HKKA 2HIMA 4R9VA 3BN3A 1J2RA 3UPDA 3ADBA 4A16A 3BXHA 5F1PA 1JU3A 3AWIA 5AUNB 3Q3NC 1E2JA 4RAOA 3VR2D 4R9RA 2I38A 5DB4A 4ED9A 2BBTA 4HYYA 2O2DA 1F0MA 4YUVA 4F5DA 1P7FA 4YL8A 3D3QA 1XJ5A 2RC6A 1UBFA 2PK3A 3SYNA 3PK0A 1KJWA 3OO0A 1ZZGA 1HPLA 4R1SA 1S1MA 4I5FA 3IX7A 1COKA 4HXGA 3VR3D 3T7CA 3W9BA 5TLSA 2KVRA 4ZDVA 4AWXA 4ZHOA 1N1MA 4BE9A 2HT6A 5HUHA 1PKEA 4UKDA 3IBSA 4K9LA 3MQ4A 3CXRA 1ORDA 1M1XB 4AJ4A 2IOYA 1XQWA 1Y3CE 4CMAA 1EAMA 1WNFA 5EXTA 3DWIA 4JYMA 2Z2IA 4QU8A 7ICGA 1MOPA 3WIEA 2Q3MA 4PHCA 2KWDA 1GZ6A 2XE7A 4G1FA 1T8PA 3M5CA 3EGRA 5JJLA 1UBTS 2C2BA 4DL6A 4PC2A 5TY0A 3DJFA 4KQFA 1XJ0A 3EC1A 4YCCA 3DZCA 3PX6A 4GGQA 5CVTA 4IM0A 4ZO6A 4YRCA 5AJTA 1MKYA 4W6QA 1DC6A 4FFSA 2OHHA 4MH8A 3BM5A 2W37A 5CDFA 4MO9A 3GLRA 1VLBA 5I9MA 5J2EA 2BBSA 3TRFA 4BWJA 5DULA 3PHXB 2QAGA 4B4KA 1KBZA 3E56A 1RQRA 5IBPA 3A06A 1Y4DE 5F2NA 3RNEC 4J1TC 4J9SA 1DVRA 5DASA 4KLEA 1Z0SA 3PFBA 4V0KA 2D4HA 4ARIA 4G4SP 5JAMA 5AJUA 2PVGC 4HX9A 2JAWA 2XUFA 5DRTA 5DG8A 2QZ4A 3ONDA 4WSOA 1HLPA 1NF9A 5DYTA 4K81A 2PUVA 3B1ZA 5IANA 3AEBB 4BV8A 3IN5A 5GOTA 1R0KA 1GTVA 2BCGY 1CDDA 5JI3E 2QVLA 1X42A 1PWHA 4D7AA 5GADl 4UUPA 2NTEA 1UFOA 1BT0A 1R9JA 4I4NA 4TKMA 5ALSA 1CS4C 4OHKA 4KC0A 3UMMA 3AUJB 5KX5F 3LWMA 2IBTA 2B34A 3NOXA 2W43A 4P3OA 5JYDA 4UDYX 3GWZA 4WLNA 1MVLA 2WUGA 3KFLA 4OJ5A 4UMVA 3FOEC 1EUCA 1TGYA 3CLUD 4FC7A 2QHOA 1WGGA 3PKIA 1YI0A 4TMZA 4HGNA 3NG1A 3SYTA 4NLZA 3FYTA 4URKA 2OHIA 4UW9A 2HWKA 1MDBA 2H8GA 4G37A 3E7WA 2IYLD 5CDGA 1Z06A 1HFEL 1VPDA 4GIVA 3BQTA 1QP8A 2WU8A 2PFQA 1X7GA 3RRMA 1W0JA 3AVQA 4BBZA 1UBUS 4URWR 3CURA 5J40A 3HDQA 2I9PA 4B31A 1VRVA 3MBOA 7ICPA 4BIIA 3MIZA 1A2OA 5EJ4A 4WVFA 1MEOA 3RRNA 4DLZA 2B1RA 2H5JA 1T8SA 4MB0A 5DB6A 1MXFA 2WF5A 1WCIB 3WWDA 1RI3A 2V9ZA 3IMFA 1S4QA 1FX0A 2INCC 1YHZA 3U4GA 2DQNB 3FSGA 2QMZA 4MWSA 3G5LA 4G4SO 3S99A 4ILKA 3ZCQA 3A3YA 4U2GA 4DEZA 4KR3A 1CF9A 4PLGA 2GWRA 3GGDA 1YI1A 2FETA 3EXEA 3A6PC 3HM9A 4IKGA 3JSXA 4CHKA 1H3NA 2F44A 1P31A 4UMFA 2GKOA 4MA4A 1FMCA 5FI5A 2FPPB 3ERCA 4RJTA 2O2HA 3H83A 2BGWA 5CA1B 4TT3D 3UXNA 3LQ2A 1HE4A 3GROA 2DFNA 4N47A 2DERA 3TL5A 4BJQA 3HU1A 4WV3A 4HNUA 3A04A 1QQ5A 2RDGA 2V58A 3F3SA 2WT4A 2EGGA 1NQWA 5A6VA 3UV6A 1NVKA 2IDZA 2YHAA 2QTFA 3TX2A 1UJNA 2CV0A 1H65A 3TEXA 1E5XA 3HV2A 2NXNA 5EZYA 2TMKA 1QZXA 2FW9A 2CLEB 5HNKA 4PX5A 5HF6A 3BCRA 1IOLA 4HWRA 2GM9A 4B3BA 3HILA 4EYIB 2D07B 2OHOA 4B45A 2KHZA 4WINA 4MIOA 3D8RA 1RNLA 2Y9MB 3OEYA 4CIYA 3CF2A 4G41A 1Q50A 1N2IA 4HDQB 3DM5A 3BYZA 4O33A 1DNPA 4GU2A 1M7BA 1DKNA 2V7XA 5JVDA 2C4MA 1IUEA 3F2CA 3APDA 2XYVA 3DNMA 2YY5A 2QPLA 2XF8A 4LSZA 1Z82A 4L22A 4EZ6A 2OQRA 1G8JA 4OEHA 1P73A 1NJGA 4XJTA 2ZI4A 2VNJA 3OUUA 4MRNA 1UZLA 2DBZA 4KYIB 2LIVA 4GZLA 5CH3A 1M73E 2JRZA 2XT0A 4UDNA 1AXGA 1K9SA 4ZYWA 4WZBA 4BJ1A 3GRFA 2ZR7A 3DEKA 1WLSA 3L7YA 4FDVA 3NPAA 2W2LA 3UQAA 2X0KA 1VJ1A 3HWTA 3TW6A 2VYQA 3FDSA 4UB5A 2G76A 1ZRHA 4EUKA 3W4JA 1KEPA 2RGGA 1HRKA 3WV5A 2XTJA 1X7WB 2IXGA 5EXSA 2B6NA 3ED1A 3KW5B 2XK5B 2BWJA 2HB6A 3M82A 2H2HA 3TQHA 5IWCA 3ICPA 3O8NA 1V86A 4CV0A 3IVCA 2QILA 1JDTA 3HYNA 3LP8A 3PJFA 3VYSB 1E3TA 3TXAA 1M0WA 4L8WB 2Q1SA 2FA9A 4HR7A 5JZOA 1X13A 3AGPA 1FCJA 2D59A 4KGXA 2YUIA 1QOAA 2GHIA 3O2JA 1NW8A 2HMTA 1QGZA 2AEEA 1NKVA 3ACCA 3N74A 3T6KA 1L5NA 1XWFA 3FNIA 3GARA 1JIKA 1NVMB 5IM4A 3H9QA 5CXUA 1R4NA 1ULZA 3IUBA 3OPXA 1SBHA 2NPTB 3G0IA 3CIOA 1TBEA 2VL7A 4B43A 1B74A 2QYTA 3TRJA 4L9AA 2XOKA 2ZU0C 16PKA 5JZMA 4OW0A 1N9KA 1ZJZA 3HYSA 3PF9A 4K88A 5J3JA 4CMEC 4J7CA 2E8MA 1S0OA 3WAKA 3F46A 2VF2A 4NCKA 4I08A 3OBBA 5KG1A 2C60A 1P45A 1BCSB 1RHRA 5HUJA 2E4AA 4ZOEA 4XTCS 5EMKA 3FVVA 1KO4A 1CEXA 4HAUA 2XMQA 4REMA 3MF4A 5EGSA 1XU7A 4W5TA 3MSXA 3TFQA 1ZWLA 4LQ4A 4E46A 3TL6A 2ZWPA 3QWHA 1S5PA 4BP1A 1YDGA 1TKRA 4DAOA 3HPOA 3IAM1 2FPWA 5E6JA 1GY8A 3L0CA 2WFAA 3S44A 1SL2A 4EO9A 4NG4A 1WUYA 2RPVA 1KZ7B 4S3MA 1VKNA 2LUMA 3L5KA 2YZ7A 3FG9A 5KFYA 5FUMA 2I4MA 1HWYA 4GL4A 4F4ZA 2LXAA 1Z3EB 2KFKA 4JUDX 2XBUA 5CJ7A 3M62B 2XK5A 2CC2A 5FBZA 1OWNA 1TEHA 3A1CA 5CNKA 4UMDA 4EYGA 2Z1DA 1XZAA 3G7SA 2IODA 2NP7A 2C59A 2PXAA 4LNFA 4O2AB 5IKCM 3BMOA 4FXCA 2RCNA 3HA5A 4DF4A 1IB6A 4PG6A 1W94A 1T8TA 3PUYA 2DWOA 4UNSA 2CLLB 2VDWB 5EHXA 2GAIA 5IKXA 5JD5A 2WSIA 3GEEA 1WCNA 1OZGA 3NC0C 4K1LA 2BJHA 1AO0A 4KQ6A 1SC4A 3U7EB 4G85A 1C1YA 5J0YA 1Y8AA 3OKCA 1XVTA 4YLYA 4P0QA 5KMGA 4F3CA 3IBFA 5CK5A 3BEDA 3VCBA 4PAWA 4ESOA 5KFAA 1KFBB 2Q5EA 1U6JA 1MB9A 1NXSA 2Y1EA 4BPRA 5HE8A 3L0IB 2B8EA 1UBEA 1UKZA 2DUYA 5C5IA 5DG7A 5HGXA 3OE7A 3IT0A 1XLTC 2O3JA 1UBOS 1X1RA 5G4KB 2GLXA 3BWVA 3TMAA 2GJ9A 1AOXA 5LXIB 1PU2A 1CUHA 3O3NB 4W1PA 4L16A 2P6UA 2QRQA 4NLGA 4C88A 5KTMA 1PWYE 3D2AA 1J09A 5B3AA 4B6EA 5SZHB 1ZOPA 2C8VA 4P4SA 4KWHA 5CR9A 4RF5A 4V3BA 2WQ6A 4BX3A 1FDSA 4YMNA 4KXXA 3U4QA 1W36D 1YOVB 3ZGZA 3KUDB 3V2HA 1RC0A 4HNAA 1KYQA 5BXQC 5LD2C 5FUQA 4BZAA 4PXYA 3O4RA 4FDTA 1EJ2A 1MT0A 2GXUA 3LIIA 4MKRA 3Q8PB 1SQ5A 1JJVA 5CCDA 1F20A 4EYSA 3W3AD 1IRIA 5KG2A 1J1UA 2G06A 4CV1A 2WJJA 4TLBA 3QI2A 3RSSA 5LDGA 2CJFA 1MPXA 1F6WA 1OBOA 3GRKA 1AGXA 3OKFA 2IY8A 2CVOA 3EXAA 3DWEX 5IUNC 3CGGA 4XX0A 2ZUBA 3UAGA 4Y1FA 1JKIA 4OATA 3M9WA 6PFKA 4QBIA 2Z58A 3FYHA 4WCDA 3LQ1A 5DGDA 5KFWA 3EPPA 4PHTA 2DFLA 4PZAA 2PGNA 3HCPA 4IHJF 2HNKA 5CT9A 4B2PA 3ETGA 4LDQA 2IHUA 1WMHB 4ER6A 3HL4A 1FX0B 3UF0A 3ME5A 2M32A 2CMGA 2PUWA 1L6RA 3RVOA 3RF6A 4MQEA 4QJ4A 1RYEA 4ZI2A 5HZKA 3IBCA 1R0SA 3AZPA 1EIZA 3NCTA 5E7JA 4OZCA 5FOVA 1IU9A 1V96A 1R8XA 1MJ5A 4D25A 4YJ2F 4H0NA 2W6QA 1Z6QA 1RBZA 3AC0A 1L5MA 4G84A 3V00A 2P2DA 1K6IA 4X9XA 4BKQA 3AM4A 3FILA 4KQ9A 1ONPA 4C4TA 5JSYA 1YKGA 3A0UA 3WB0A 1PZMA 1TS2A 1R0XA 2IK8A 3VR5D 4E5YA 1GCGA 4FZMA 2DZIA 5JNSA 4KI0A 1OH6A 5I7HA 3Q1LA 3ZU5A 1Q91A 5ALEA 5CEHA 1TS3A 3R6WA 1W6RA 3DC7A 3ZKJC 3ZZ1A 2BQRA 4HUTA 5L1LA 3QWZB 3UJ8A 2O07A 1QPZA 3K2QA 1C8LA 1C4PA 1XLWA 4AYWA 2XE8A 1E6KA 3A31A 4KTQA 1E2PA 2JLAA 2G82A 3TZHA 3WQQA 3P52A 3Q8CA 2QM3A 1NPDA 2KD1A 2JXXA 2BP7B 3PE3A 4L8VA 3KB1A 4ZHSA 1T1EA 5KQRA 1LXCA 2ZI7A 4GWLA 8ABPA 3V62A 2M1ZA 5HCUA 3UHJA 2HOIA 1U8YA 4IYJA 1J42A 3RKRA 1WJUA 3AIKA 1MA0A 3H3FA 3Q3JB 3TDMA 3R9WA 4NQLB 3EIOA 1XYYA 3SC6A 1DGQA 2NZXA 3LVFO 3JWEA 4B40A 3KSMA 1CHDA 3NIBA 1J5PA 1U31A 13PKA 5E1OA 1IK4A 1ISMA 4Y98A 3LT1A 2CB9A 4GSYA 1P9WA 4TTAA 1FUIA 1QG0A 1KTVA 3RSLA 1TT5B 3T3NA 5IX8A 4Q24A 2KKPA 1OI7A 3B8EA 4HYQA 4OK3A 3RTDA 1K1QA 1KSHA 2X2EA 1NDHA 4PFQA 3OHSX 1KBUA 2UU9B 3RRJA 1PJ2A 4C8NA 4GD3Q 4R8SA 2EDUA 1XVUA 1O58A 1BS2A 3ZE8A 2P6RA 4QL3A 3M6UA 1NL3A 2ZBPA 3V6HA 1ZM9A 5GZ3A 2DR2A 1GG9A 1N2XA 3SU8A 2VJBA 5EL0A 3R66C 4CKWB 3PHHA 3GAZA 2NN3C 1YZFA 4D4LA 2Q1WA 1RZUA 3CLVA 4ZVSA 3QWIA 3SQWA 2GD2A 4ETIA 4I1VA 4WBNA 5ITVA 5EJ8A 2HJVA 1V1MA 4DCOA 3C19A 4Q3BA 4QYIA 3RB3A 1K7SN 2DX7A 4LJ9A 3FWNA 3S7TA 2A2ZA 4DQ0A 2XVAA 2IUUA 3W6PA 1O2DA 1F8XA 1UGMA 2WWXA 1D04A 2ZE6A 1QK4A 1E3IA 4WKBA 4J0FA 4I55F 4YS6A 2J45A 1VBNA 3FPJA 3AUAA 3QA8A 3VNAA 4I2HA 4REQA 5K0GA 4U02A 4FBTA 1LU9A 1NONA 4RGTA 3I9NA 1VMEA 1V5WA 3W05A 4M54A 4NTZA 2VP9A 3PA6A 2NG1A 4CEIB 1LTHR 2KG5A 4NLCA 3I2FA 3UWDA 2B25A 1G8FA 5KTNA 1FXIA 3BHIA 5JMWA 3TQSA 4RQ3A 3HXQA 3PY8A 2OUKA 1DCKA 3UC9A 4BB5A 3FROA 4KL8S 3LUJA 1R4ZA 2VPPA 1PFQA 3QW4B 2PMBA 4OFWA 1LVUA 3OY7A 1WUHS 1QFZA 1OI4A 4YUXA 3X1WA 3PDIA 1MSWD 1U0EA 4C03A 1TD9A 1IM4A 2OYCA 1C0IA 2IEDA 2V7QA 5KAFU 4WTOA 1RU3A 1O5OA 1E8WA 2J0KA 1P1BA 4OQQA 2KYRA 4YXWA 1U0BB 1JR2A 4RE6A 5KFCA 5ALLA 2HSZA 4JB8A 3WKBA 1XZCA 1JCKB 1PN3A 1N5WA 5CA7A 1M1NB 3U7FB 3K0SA 1EQAA 3MTGA 4A7PA 5JAUA 2R2OA 1SE3A 1H6BA 1UD7A 5C1DA 3HFJA 2E3TA 4CO7A 4R1LA 3O3CA 1X1QA 4H6VA 2O2CA 5AZHA 2IDJA 3NM5A 3DO8A 2W6NA 3WJ1A 1Y3HA 1ZUIA 4IIFA 1QK5A 5BV7A 1AKUA 3TGPA 1YVEI 2NSDA 1Z9BA 3BG5A 4C89A 1UUPA 1T9HA 1OWOA 4XVQA 1EXWA 2BONA 1E3QA 2KIWA 3H87A 4LZPA 5FV7A 4XWTA 2XCLA 2EEPA 4Q7EA 1JJFA 1DPGA 2X8WA 4MKFA 1WG8A 1HQRD 3K5HA 2AG8A 4GPAA 5LP6F 4ZREA 1ZD4A 3DDSA 1RRMA 1J90A 5I9NA 1EK1A 3K32A 2SKDA 2PMFA 1HBJA 4AUQC 1QRUA 2JQRB 1FSGA 2SKCA 4NYJR 3LQFA 2YQZA 2K8CB 1XLUA 3U3OA 4YCMA 3MXTA 2QORA 3TINA 5JSZB 3K9NA 4DRXB 9ICEA 4HLUA 4M98A 2DKZA 4ZH4A 3N9IA 2QD5A 5JDIC 3NP9A 4BY9E 3F78A 1O4WA 2BYFA 1VZ7A 5AOVA 2N7DA 3UQZA 2E37A 2WJZB 3RWMB 5GJWC 2XI4A 3ANLA 5IFKA 1ZGAA 2ZUTA 1EP1B 2PM8A 4IQFA 2DYOA 4PYLA 2MRLA 4U2BA 1J9GA 2ANCA 3GIKA 1CZRA 1EFVA 4WNCA 2C7QA 5LQJA 3VZBA 3PZBA 5HQTA 2JSVX 4FE4A 3Q2OA 1PFWA 4JOQA 4TV9F 1U4SA 1J1ZA 1T0JB 2R65A 1FYXA 1JHXA 4XE5A 1VIVA 3JX9A 1G8PA 3NIFB 2ATEA 5IIKA 5G02A 1C3XA 5G53C 4A10A 4OGKA 4BATA 3UUEA 5J8YC 4ZRJA 3NVDA 1V26A 2GAFA 3H3XA 2ZUFA 4PYQA 4K0KB 2KB0A 4C1NA 1KQOA 1JP7A 4J94A 4O02B 3U44A 1Z2NX 2QRNA 1JN0A 3QEMA 5EHGA 1FSPA 5C8YB 4PR0A 4K40A 4EKEA 5JPCA 3EX7C 4X3OA 3IAFA 2IS6A 4LWPA 4KJXA 1QQBA 4CKWA 4YAUA 3A0HU 2H2GA 1ZD5A 3ACBA 3NC4A 4Q7KA 2CXXA 2VLIA 3LTEA 2XRZA 5LN1A 2GN2A 2FN9A 1WGHA 3CSDA 4LNHA 3PO0A 4YAWA 4UVDA 4RD3A 4Q9LA 5IJXA 2RGXA 4HDMB 1M2VB 4AJ9A 1L3UA 4KK4A 4YT4A 2QXUA 3MYRA 5GWXA 5BOLA 3QSGA 4D43A 1CJVC 4N7MA 3PBKA 2C57A 2QXTA 2ZYUX 5IASA 4PC7A 2JPHA 4AY3A 4H7JA 3HJFA 1GPUA 2MU1A 4H18A 3EY4A 4NOLA 1NI2A 5ARBA 2AQ8A 2ZULA 5D2CA 1DHRA 4IJ5A 3WGMA 4RKEA 2BCUA 2QTVB 1SBIA 3UJHA 1NKCA 3KOXA 1UAGA 1VBMA 1NC3A 2XI9A 4DOBA 1U4AA 3O31A 1T6BX 1U1DA 4F3RA 1QHSA 3FSGD 5F2KA 2AXNA 2PT6A 4AG3A 4KE8A 1UKYA 5KTSA 4Y6SA 4JU8A 1SXJE 1OFVA 3CCCA 2QRJA 1D5ZC 3HBLA 2LM1A 2VPQA 4CLDA 1E3WB 4UFNA 2MMCA 4ICVA 2G71A 3N6RA 4UUAA 1HTTA 3WGHA 9ICHA 3JRNA 1E7YA 1LJUA 3U19A 4G9EA 2E5SA 3L8FA 3LXFA 3FVRA 3TRIA 1WB9A 5AKYA 1WF3A 4DWWA 2CVQA 3TDKA 4ER5A 2XICA 4C21A 4JT4A 4JSYA 3JQPA 1EYZA 3BSYA 4PYJA 3GE8C 4YH1A 4ZOLA 1VCIA 4R0VA 4J3NA 3U81A 3OFVA 3WIBA 1ZK1A 1FRVA 4LYDA 2D5IA 2GETA 4D0SA 4NJMB 2OCEA 2CW5A 3GL9A 4J9NA 1Q3TA 3MTIA 4KFTA 1ZGGA 1E9EA 4UTOA 2ERCA 4XYMA 3SQMA 2ISPA 5GONF 3FC4A 1NY6A 2IZ0A 3BA1A 4G8CA 4I2BA 1OTRB 3S0JA 4L08A 3L46A 4EY8A 4ACFA 4INAA 5GOZA 5ESRA 1W4BA 4LTUA 5LJIA 1J0XO 3TD9A 1TKGA 2AN3A 2KHQA 1C0EA 1VGVA 4BOSC 1VJ5A 3F6SA 2PPVA 5FRDA 3UGKA 1Y5NA 1X86B 2D0DA