2F44A

Crystal structure of the zinc-bound shank sam domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords SH3 and multiple ankyrin repeat domains 3
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f44A00
1SGGA 3HILA 2Y9UA 3TACB 2KSOA 3TADA 2FE9A 2F3NA 1B0XA 2KSOB 3BQ7A 2E8OA 2KE7A 2QB0A 2YTUA 2JV3A 2K60A 1KW4A 1B4FA 2QB0B 2EANA 2ES6A 5J8YA 1V38A 1WWVA 2QKQA 4RQMA 3SEIA 4NJ8A 1RG6A 1SXDA 2EAOA 3BS5B 2KG5A 2DKXA 1X9XA 1OW5A 1SXEA 1X40A 4RQNA 1UQVA 2QB1A 2KMDA 2B6GA 1X66A 5F3XB 2E8MA 2LPEA 2E8PA 2L5YA 1SV4A 2F44A 4MHVA 2Y9TA 2E8NA 3K1RB 3BS5A 1WWUA 3KKAC 2D8CA 1JI7A 4PZOA 1PK1A 1OXJA 2GLEA 3BS7A 2QARA 1F0MA 1PK1B 2QARB 4PZNA 5JU5A 1LKYB 1PK3A 2EAMA 1UCVA 2EAPA 2LMRA 3TADC 1Z1VA 5JTIA 1COKA 4NL9A 3KKAA 3IDWA 4NL9C 1DXSA 2F8KA 2DKZA 3H8MA 4IS7A 2KIVA 2D3DA 2DL0A 1V85A 2K4PA 3SENA 2ESEA 5J8YC 5L1MA 1SV0A 5JRTA 1LKYA 5KNIA 1SV0C
chains in the Genus database with same CATH superfamily
3KFUF 4F50A 1L6NA 1NK9A 1CUKA 9ICHA 2AGQA 3SMVA 3NVVA 3PO4A 3ZI4A 3D2NA 4ZH4A 2VJ5A 2A3VA 3BQ7A 4YXJA 4O3SA 2KE7A 2K89A 1QQ6A 1X9WA 2K4HA 2FLLA 3GV5B 2QB0B 1URJA 1L3TA 2E5SA 2FI1A 2FLNA 3I28A 4DQIA 2EANA 3N7SC 4RQMA 5BOLA 1S0MA 3NASA 1DGJA 1ZETA 5EWFA 3ALRA 4BXOB 4YXMA 1IV8A 5KFLA 4NLGA 1RXVA 2MA1A 5DBCA 9ICAA 4NLCA 2RRDA 3IN5A 3DDHA 5IIOA 5AI6A 4ECUA 1NI3A 5F3XB 2W54A 2EZZA 3FM9A 5GTHU 2F44A 3Q8LA 5CJ7A 1ZQCA 2Q0ZX 3H8WA 3UPQA 4ED1A 2HHXA 1NZBA 2HCFA 4DOAA 1ZQAA 1ZRMA 3BQ0A 2QARB 1IG6A 2VIXA 2AQ4A 4TUQA 3ISDA 3SV4A 2Y0SC 1ZQKA 2O6KA 1RQLA 1NK0A 3WK6A 4M9HA 5KT7A 1XS9D 1S0VA 2A1AA 5J0WA 4ECVA 5AK4A 2KZMA 3M8SA 3Q8MA 3PMNA 3RH4A 4GFJA 5ALVA 2M0NA 4RT3A 5EE1A 1Z3EB 2EDUA 4MF8A 2J6TA 1U45A 4I2EA 4PHPA 1S77D 2F3NA 2W55A 1B0XA 2KSOB 1ZD5A 3H4BA 4B9NA 1YT3A 5J2KA 4PHAA 2JV3A 1T94A 4DQRA 4KN7A 1SZPA 5AI0A 1IIPA 4MFFA 3IRUA 4LZDA 3JPNA 1V38A 3SAFA 3C5FA 3JPSA 4C8LA 2YMMA 9ICBA 4OJOA 3FC4A 5ALEA 4X5VA 3B9JA 4P4MA 1RQNA 3TFRA 4QZBA 3N4MB 4F91B 1U49A 4YR0A 2KN7A 2HBJA 1WG8A 5ALZA 1KN5A 2B6GA 5E79U 1Z1BA 4O3MA 1V9PA 1L7OA 4KLJA 2I1QA 4O3OA 5EOZA 4DL6A 2C2EA 3QNMA 1PVQA 4DSKA 2RDIA 4M47A 4MHVA 2YB1A 1S0NA 3TQ1A 1T8EA 2HSZA 3GIMA 1ZQYA 3PV8A 7ICJA 7ICRA 2BCQA 3QUCA 3SD7A 1Y88A 3ETRA 2F2AB 2M9NA 1JIHA 2C2DA 4ELTA 2XC9A 3RJEA 1A0PA 2MRLA 3H0MB 3G6VA 4PHDA 1ZJNA 4CF3A 4UBCA 2F8KA 2F8LA 2KD1A 3L5KA 3KHLA 1B22A 2AGOA 3U26A 3MDAA 2D6FC 4YMMA 1S0OA 4KLGA 5DQHA 4DS4A 1FFVA 8ICYA 3HJEA 2WFAA 3D6JA 2F1HA 2KNJA 4Y2RA 3UXPA 1NKEA 2NV3A 2HBLA 2XY5A 2VKQA 9ICJA 1JXEA 1KKXA 4RZRA 2WF6A 1ZQSA 3ZDCA 3TKAA 3PW4A 1JUDA 1SB3C 4QNLA 4UB3A 2EAOA 1OUQA 1CEZA 5KT2A 1QTMA 2ZIWB 2ZIXA 4R65A 1ZQIA 2G0AA 2LYHA 7ICTA 4RQNA 1UQVA 5AM5A 2UVRA 4NLBA 5KFBA 2KKVA 4QZCA 1TKDA 4UAWA 2LYAA 4USAA 3SYZA 3CRXA 3Q8RB 3VC8A 1KDHA 1ZYQA 2E8NA 3BS5A 2ZIUB 4QZHA 2A19A 3V7LA 4FZMA 4RQ1A 3T5LA 5AI5A 3CW2C 5KFZA 3MFIA 1X9SA 3NVYA 3PSPA 7ICHA 2VA8A 3TANA 2HHQA 3AQFA 2LMRA 5KFDA 2HBKA 3MR3A 1Z1VA 2LM1A 2RQ5A 3A0BU 4P0PB 2FDRA 9ICQA 2JEFA 3ZDDA 7ICIA 1DXSA 2HBMA 4ELUA 4MEYA 3PZPA 4DSEA 4KN4A 3EWAA 3RF9A 3PNCA 3PW7A 4ECWA 2YMQA 1IXRA 3V6JA 3RJJA 3G6XA 4C8KA 8ICMA 1SV0C 3H40A 2K8BB 3IG8A 4O0IA 4QIWC 5DG8A 8ICQA 1JN3A 2CRXA 3TADA 4YD2A 3RJIA 4PL2A 3FAHA 3GFKB 2W9BA 4DSFA 3ZDBA 9ICIA 4QZIA 5ALJA 1ZQEA 3EW9A 3F2BA 3TI0A 1U4BA 4IQWA 5EE3A 1RG6A 4F4YA 2PMZF 4PH5A 4O5KA 5ALGA 4DFJA 1XSNA 2H5XA 1NKBA 1DK3A 2HOIA 1NJXA 1T3QA 2XO7A 4QZ9A 2UVVA 9ICSA 4YR2A 4RQ7A 5DG9A 3HW8A 1ZQBA 9ICOA 2IHMA 4IC9A 4G9BA 1QQ5A 3JPRA 2YB4A 4ECXA 3C23A 1QQ7A 2DWQA 3RB6A 2XGQA 4GLXA 3KTQA 8ICNA 1JI7A 2FPLA 1BPYA 3RH6A 2HHUA 2XCAA 1N5WA 3RJHA 2W7PA 1T4GA 1S8OA 1O03A 1Z4OA 4CGZA 4DFKA 5B5EU 2BKEA 3I1YA 3IHQB 1Q46A 2IOHA 1S9FA 9ICLA 2KP7A 2J6SA 1NJZA 5L1JA 9ICMA 8ICHA 4UQGA 2DKZA 4EEYA 3RAQA 1N63A 3PY8A 4RQ6A 5AI4A 2D3DA 3SENA 1RZTA 2H3ZA 4Q8EA 5KNIA 1XWLA 4J9RA 1Z19A 4R8UB 5B66U 3T3FA 4DF8A 9ICTA 1ZQZA 2HDOA 3QU4A 2ZUDA 2JZBB 4MF2A 2W9CA 2ZIXB 1L3UA 3F53A 3Q8PB 5J0PA 4NV0A 8ICRA 5KG0A 1T7PA 3M7DA 5AI8A 1EXNA 1TV9A 3PMLA 2AU0A 2RP5A 3QEAZ 3H0LB 2XI9A 3BS5B 2BPGA 4DSLA 2MSNA 1ZQXA 2WHEA 1S10A 1COOA 5K4LA 1QSSA 1BPEA 3RB4A 4F71A 4NXZA 5CHGA 4J9NA 3KZIU 5HHIA 3LDAA 5ALXA 1RYSA 5HHHA 5ALOA 5DQGA 2YQEA 1SV4A 2C2RA 4RU9A 3K1RB 5HMLA 4Y2YA 8ICEA 5AI9A 2JH1A 3QZ7A 4RQ4A 4Y2SA 4QW9A 5L9XA 3JPTA 5ALDA 3SI8A 1NJWA 4MFCA 2AHOB 1C7YA 2OWOA 5D46A 2EAMA 3PX6A 4O5EA 1ZQPA 5AHXA 5JTIA 3AM9A 3THVA 5AKKA 1AQ6A 2ASJA 8ICSA 3HKZF 4BWMA 3QZ8A 5ALWA 4RQ8A 2P66A 4DQQA 3WKCA 1CRXA 4LJXA 3NRZA 1SV0A 5CB1A 3WKDA 3RBEA 1ZXIA 4J9PA 5CA7A 3CYMA 2G06A 2ZXHA 4IRDA 4ECZA 2W04A 4QWBA 1L3SA 2K60A 7ICFA 2W03A 5TZVA 4EZ6A 5KFSA 1J97A 4I28A 5DGAA 2ZIVA 1FO4A 1BNPA 4RNNA 2NRVA 3EPIA 5HR7A 3SEIA 5KFUA 4TUSA 2FLPA 3UM9A 2PFOA 2BQRA 4Y2JA 1ED1A 2KG5A 1X9XA 1UT8A 2R8IA 1SXEA 1PVPA 8ICPA 3RR7A 2WTFA 3V7KA 3HT3A 3EUB2 5ALNA 4EENA 2NO5A 1SL1A 3TFSA 3OTQA 3AU2A 4EBEA 5DKWA 5EE0A 4F72A 5KFOA 4KMUA 5DGBA 2VJ4A 3ONNA 1SL0A 2GLEA 2AH5A 2DPJA 3UXNA 2Y1IA 2IMWP 1MA7A 4QZ8A 3LK9A 3MC1A 4I2IA 4QZGA 4EX6A 1A76A 2KVSA 4U7CA 2XIDA 3TARA 2LKYA 2BCVA 5EE9A 1ZQLA 1BPXA 3MR5A 2A1JB 7ICNA 4Q45A 2P35A 4QJFB 5L1LA 4YVZA 2P6UA 1SWWA 2DUYA 2KICA 4C4TA 5J8YC 4UB2A 1MC8A 4UB8U 5D4BA 4PGYA 1VJ5A 5J2FA 3ISCA 4RQ3A 3TACB 4ECSA 3WK7A 2PI5A 5AKIA 3GV8B 5TISU 2JGAA 3BZKA 3B0XA 7ICSA 3KHGA 1F5SA 1ZD4A 3N7PD 4QWDA 3OSNA 4B9VA 2BZFA 3WU2U 7ICMA 1PVRA 4ECRA 3GV7B 1XSLA 8ICXA 4O3NA 2OH2A 2JMGA 4P2HA 2V9WA 1ZRNA 2KTQA 4UAVA 4JWMA 2KKPA 1BPBA 5J0TA 1BPZA 3H4DA 3SAHA 2EQYA 3NTUA 5KFFA 4RT2A 4TURA 4RQ2A 3RJGA 1ZQGA 5KT4A 2MU2A 5DDMA 5AM4A 1DGSA 8ICWA 1X2IA 9ICEA 3HX0A 1PK1A 1DRGA 3JPPA 5DB8A 4F5NA 2AJQA 1AROP 4I2CA 1KL9A 3C1ZA 2G08A 2C22A 2KFZA 2LM4A 3KHRA 4P0QB 1D8LA 4IR9A 3KKAA 1X6IA 2ZJAA 3RJFA 1C20A 2Y0SF 5DB6A 5KAIU 4FS2A 2I5HA 5FP0A 4DCCA 5L1MA 4Y2QA 2VANA 5IINA 1TAMA 4F4ZA 1ZQRA 1WCNA 5KFYA 3L4PA 4Z6EA 4YFKA 4TQSA 5J2DA 4I2JA 3KZXA 2YTUA 5J0XA 1NK5A 2IBKA 2DF4B 1A6SA 1V97A 2KOBA 1S5LU 3OJSA 4OJPA 3OSPA 5AKHA 2K8CB 3M9OB 1O08A 3RR8A 2MUTA 1SXDA 2WF9A 5ALQA 2N1RA 4KTQA 3SQIA 5KFEA 1ZQOA 7ICGA 1ZQJA 5KL8B 4HAIA 4I2AA 3OGUA 2BPFA 3PSTA 2HVIA 2R8GA 4OJ6A 3GIKA 2R8KA 1L7MA 1NJYA 2KJ5A 4EBCA 4O3QA 1ZJMA 4AP9A 3TAQA 7ICUA 3BQTA 4J9QA 2KIWA 4JV2A 4CRXA 4NWIA 3WK9A 1K1SA 2W9AA 4GC7A 1D9FA 2D8CA 4XA5A 3PVXA 8ICUA 4PZOA 3ORYA 3MGVA 1QLNA 3OJUA 3Q8KA 1N56A 4KLSA 1XSPA 5KT6A 2OEHA 5KFRA 9ICWA 5CP2A 2I6XA 3VCBA 4C7ZA 3NRWA 1SWVA 1ZQWA 4QWCA 2BQ3A 5J0RA 2BCRA 1SKWA 5T14A 1KLNA 4QW8A 3UQ2A 2WAQC 3C21A 4KX3A 3F5AA 4KLOA 1J2MA 3T5KA 4K4GA 1KFDA 2K4PA 5L1IA 2H3QA 4ED0A 2FMSA 5DBBA 2K4EA 2BGWA 7ICEA 4KLUA 5IIKA 3N28A 5J0OA 4OD0A 4YCXA 1MN8A 4CCHA 3ETLA 4Q44A 2XVTA 1DK2A 4CNQA 2W9MA 5KG3A 4C7YA 5BOMA 1N62A 2QKQA 2BDPA 3UMCA 2GH1A 5AKLA 1JMSA 4KMOB 4OJ5A 4PL1A 3QU2A 5ALKA 4F4WA 1B43A 3GU3A 1N2XA 4QZEA 4ED8A 2KHVA 1KFTA 1OW5A 3DV9A 1X40A 1JROA 4G3IA 2HW3A 5DLFA 4GXIA 4OJLA 1PUZA 8ICIA 4KLTA 5HP4A 1Z00A 4DL2A 1ZQQA 4O3RA 4UB1A 2E8PA 2L5YA 1U47A 3WK4A 5KFQA 4RNMA 1HIWA 2IHNA 4C4RA 2NRZA 1OXJA 5KFMA 2KHQA 1MSWD 3QXGA 5KFVA 2AGPA 3QE9Y 2I9GA 5AK5A 4ICAA 2H3VA 2Z7JA 4C0ZA 2IOFK 4KLQA 3ZD8A 3MDCA 4PGQA 2BCUA 4M9LA 3GZFA 4F2SA 4NL9C 4XRHA 5ALLA 4AYBC 1N5XA 1TK8A 2DL0A 2NRTA 3UMBA 5JRTA 2PXIA 3PR4A 1Q3VA 2UVUA 4E0DA 3M9MB 2RDJA 5DDYA 4B9UA 3MBYA 4C8NA 5ALHA 2HHWA 1BVSA 4B9SA 4UATA 3NGDA 2QB0A 5JUMA 4DWIA 4B9MA 1H38A 3SZ2A 4EYHB 2ZUCA 2XCPA 3D2QA 4QIWF 5J2AA 5AM0A 1WYGA 4UAUA 2ES6A 3ED5A 1CI4A 1FIQA 4J9MA 4UASA 5KFTA 2XGPA 1FFUA 1T3NA 3PO5A 2OXOA 4DL5A 1IM4A 9ICNA 3C2MA 4J9SA 2HOFA 3F5EA 4YG2A 4KLDA 2F1JA 4KITB 4YMOA 3PR5B 2VA3A 5ALIA 4MFAA 3CNHA 4F93B 4QWAA 3L3FX 1ZQTA 4LZGA 4DL3A 4Y2UA 1D9DA 3C1YA 9ICGA 5F9NA 4DQPA 2F1IA 2HI0A 1ZQHA 1UPHA 2G5HB 3OHBA 2KZZA 3HRDD 3M9NB 2CPRA 2QARA 5AIAA 3QYPA 3C29A 5J2EA 3C28A 4PZNA 8ICFA 3RJKA 4JB3A 1PK3A 3RB3A 5KFHA 5KG7A 1J2NA 2LBOA 4DSJA 3AL0B 4DLGA 2W43A 4RUAA 2WB1C 3WKAA 5DG7A 3LVVA 2ATLA 4UAZA 4RQ5A 1ZQVA 4Y2TA 3M1YA 3EPGA 1ZQFA 4UB5A 3MR2A 3V6KA 2XICA 2HMXA 1SGGA 1ECWA 1DOQA 1UHUA 2KSOA 1K5OA 4F2RA 4PPXA 2FE9A 5KG6A 3LVWA 4WJ3B 4KLFA 2UVWA 1Q3UA 5DB7A 2JEJA 1B4FA 3JPOA 2W9BB 2EZYA 3S6JA 3C5GA 4IQTA 5DB9A 1SKSA 4MEXA 1L5UA 1Z00B 1L8LA 2KVCA 5ALSA 2HHSA 1D8BA 2ASDA 4U6PA 2AXTU 3KHHA 2C28A 5KFWA 1S76D 4M04A 4F8RA 3ZDAA 4BDPA 8ICJA 1MQ3A 1L7PA 3RRGA 3KOOA 9ICFA 1KBUA 2EH9A 2IA6A 4NM2A 2CN1A 4DO9A 2R8JA 3GIIA 2HVHA 5KFCA 2E8MA 5IIJA 2LPEA 1KQQA 5AM1A 1HJPA 2PKEA 4J03A 3F2CA 4KLMA 1BNOA 2ISPA 2YMPA 1YZ6A 1X9MA 3CP8A 2LHTA 3A0HU 4UAYA 4YR3A 1ZQNA 2E1FA 9ICVA 1NK8A 4EEKA 1L3VA 3Q8SB 1L8OA 1BGXT 5KFJA 3UQ0A 4RPZA 5AKZA 4CF5A 4NL9A 5AKEA 5KT3A 3I76A 4XUSA 3MGIA 1JXLA 1ZQ1C 4Y2XA 1RDFA 3H8MA 5DQIA 5A0LA 1N61A 3V72A 1NK6A 1JRPA 1V85A 4US9A 5J2CA 4YP3A 1UA1A 3MABA 3QU5A 1K1QA 4Z6DA 3AQEA 2V4QA 7ICQA 2K4IA 4RPYA 2ODGA 3RRHA 3M6ZA 7ICVA 2GOLA 2R18A 2WF8A 2ZXIA 2HOQA 4BGDA 2E8OA 2NRWA 3E0FA 1KW4A 2W7OA 2W9CB 5KFIA 2ISOA 4BJQA 2ZJ8A 2EZXA 2BHNA 2W3SA 5J2HA 1HUZA 3BDPA 3ZDEA 1UA0A 3AMZA 3RBDA 3RB0A 2ZIWA 1NKCA 2OCEA 3RFAA 3RAXA 3V7JA 3UMGA 2W3RA 1XNSA 9ICPA 3K1ZA 2LYBA 4BWJA 4R64A 2QB1A 4I2HA 4BUGA 2FMPA 4EX7A 5DLGA 2B0CA 1X66A 5KG4A 2ZIUA 4PJ0U 4O5CA 4UARA 4CF4A 8ICZA 1RPLA 4I2GA 3HWTA 3OHAA 4F3OA 2FJ6A 4YQWA 4QZFA 3ICXA 5HR6A 3BQ1A 1L7NA 4IR1A 1TK0A 1FEZA 1M6YA 1U48A 1LVHA 2BR0A 2FPMA 4ECQA 8ICCA 3K4GA 2ASLA 3TADC 4P0PA 4R63A 5ALUA 3G6YA 3IG5A 5ALFA 5IILA 7ICKA 5AIBA 2KFNA 2ZTCA 3PSFA 3T5JA 4ED6A 4IS7A 4F5QA 2PFQA 2NYVA 2KIVA 2Y1JA 1TE2A 5KL1B 5IIMA 1KEJA 1LKYA 1KFSA 4DL4A 1WCLA 1TVAA 3HILA 2GO7A 4J9OA 4M6WA 2DQNB 1TAQA 5ALYA 4JUZA 4M0AA 4I27A 8ICKA 4RNOA 1VDVA 2KV2A 4C8OA 4KLEA 3AUOA 4I2DA 2FMQA 4DFDA 2F76X 4Y2VA 5BPCA 2ZIVB 4OO1J 3PW5A 2H3IA 4JV1A 1KTQA 3DEEA 1QSYA 1NZPA 5J2BA 3N97B 4R66A 2KJ9A 3JPQA 3M8RA 4NLKA 2J6UA 8ICTA 4NLNA 4F4KA 2JEIA 2BCSA 3HPOA 4ED3A 5ALMA 1U9LA 3AN1A 4M9JA 1LB2B 4UW9A 3F2DA 3KBBA 2DBYA 4EYIB 1ZD3A 5EWEA 4JMUA 2K8AA 5GTIU 3J81j 2DFLA 1ZD2P 2ZTDA 2Y9TA 3WK8A 4CDGA 4ECTA 1NK4A 1ZQMA 4RUCA 4FE3A 2OYYA 4M2YA 3RTVA 4PGXA 2G5IB 3T79A 1QSLA 4Y2PA 2EAPA 2VA2A 4DFMA 4KLLA 4QZDA 1ZQUA 4DF4A 2E3TA 5J29A 3PX4A 1XU4A 3QEBZ 3WKEA 1HEKA 4UB4A 1JX4A 5IIIA 2ESEA 4LVSA 1XO1A 5KFXA 2CXYA 4R8UA 1N48A 2Y9UA 2R8HA 2XY7A 2JZBA 5HMMA 3KD3A 1HUOA 1KRPA 3OPXA 2PMZC 3PSIA 4XQ8A 2XY6A 5KTQA 2G09A 4YD1A 4DL7A 5J8YA 3V6HA 4C8MA 2ZG6A 5KFKA 3MR6A 7ICOA 5EWGA 4NJ8A 4UBBA 3AU6A 4DOCA 4YN4A 4DOBA 1NNLA 1RM6C 4KLHA 1TFRA 2KJ8A 1KSPA 4DFPA 5HNKA 1QH9A 3EZ5A 5J0SA 4M9GA 3SR6A 3QX7A 8ICAA 4Q43A 3AEVA 4IQVA 5KFGA 3TAPA 7ICPA 3QUQA 4FZLA 4DEZA 1JALA 4JV0A 2KEYA 5KAFU 4FBUA 9ICCA 4IRKA 4I2BA 1WWUA 1XO0A 3EYZA 3NVZA 5KFAA 5J2JA 4QZAA 4GC6A 1Q8KA 2FPKA 2YN4A 4P4OA 3Q8QB 3GIJA 1PK1B 3T5HA 3RH5A 5ALRA 3H8JA 3HP6A 1LKYB 1RYUA 5KG1A 3K75D 5CWRA 4JK1A 2NO4A 5G5HA 3SV3A 4M6WB 3H0RB 8ICOA 4YMNA 5AKGA 4EZ9A 1SL2A 3B0YA 4Q8FA 2BDUA 3IDWA 1VLBA 4GIBA 4M9NA 2BPCA 1ZOLA 4O9MA 1SZHA 9ICUA 4F4XA 4P4PA 1WUDA 1F44A 2GWSA 3C2KA 4RPXA 5AK6A 1COKA 5J2IA 2QLTA 5C0YA 2PFNA 2ZTEA 8ICGA 5G5GA 5KG5A 1Z4NA 3GQCA 3QUTA 3ISBA 4B6JA 2WAQF 1NK7A 4I2FA 4A8EA 8ICLA 4Z6CA 4C80A 5C5JA 4J9LA 2JH7A 3NUQA 2ZJ5A 4K4IA 5AM3A 5AICA 2PI4A 2OM6A 4BX9C 4F92B 3R9KA 4DQSA 5ALTA 5ALPA 4C4SA 5CEHA 2MUTB 2HHTA 4RQ0A 5J0QA 5KFPA 2IOFA 4J9KA 3ZD9A 1RYRA 4NM1A 2KMDA 4ACOA 9ICRA 4CE6A 3BJYA 2W8KA 3FDSA 3NVWA 2WF7A 2KK0A 4FO6A 5KG2A 4BXOA 3BZCA 4QWEA 4TQRA 4B9LA 5J0UA 1P7DA 2YMLA 2YX8A 3H8SA 3IM1A 3LWMA 1F0MA 4KX5A 2V4RA 4F5OA 3QU9A 1PZNA 5AKJA 3FYHA 4NY8A 4OCZA 3HKZC 2YY6A 3PW2A 2HHVA 3BQ2A 5CR0A 1UCVA 2B21A 1XC9A 4ECYA 2A1JA 1A77A 2WF5A 9ICXA 3PX0A 2G07A 5L1KA 2JEGA 1QCKA 2ZUBA 2JHDA 4O3PA 2F77X 3E2EA 2KZ3A 3NS1A 3LWLA 2MAXA 1D8YA 4FZNA 5CRXA 3GILA 4F5RA 7ICLA 3UXOA 4F5PA 2AQ0A 3QU7A 4AYBF 1RXWA 3IV6A 1X42A 2JXJA 3WK5A 4IL6U 4DLEA 1X6JA 3WKBA 3MFHA 1NOMA 3PW0A 4ED7A 5F9LA 2W8LA 4ED2A 4ELVA 1WWVA 4ZOHC 2PFPA 1BPDA 4HYKA 1ZQDA 3E58A 2JR5A 2NRXA 3GDXA 3IP4B 8ICBA 5KT5A 2DKXA 4FFDA 1TAUA 1S97A 4KLIA 5J0YA 2OHFA 4Z6FA 5D49A 5AKYA 2W11A 1TK5A 4B9TA 9ICKA 2E1EA 8ICVA 2H3FA 4EELA 2JRZA 1MQ2A 3QUBA 4US8A 5AK3A 1YZ7A 2P6RA 4K4HA 3O0FA 5J2GA 3KKAC 3C2LA 2LI6A 5AM2A 3H7IA 2ALZA 3BS7A 1SKRA 1SIJA 2RHFA 4JWNA 3SAGA 5H2FU 4DSIA 4UB6U 5JU5A 1LV5A 4IRCA 4P0QA 4PHEA 1UT5A 3MGHA 3LYSA 4GXKA 4DS5A 4FS1A 3D2SA 5DBAA 1GO3F 5KFNA 3N7RC 3M6KA 4EBDA 2RLTA 1N60A 4GXJA 2BQUA 2DGZA 2Q4TA 2DPIA 4TUPA 4FBTA 2WB1F 4I29A 5AKXA 4IQUA 4NLZA
chains in the Genus database with same CATH topology
1SGGA 3HILA 2Y9UA 3TACB 2KSOA 3TADA 2FE9A 2F3NA 1B0XA 2KSOB 3BQ7A 2E8OA 2KE7A 2QB0A 2YTUA 2JV3A 2K60A 1KW4A 1B4FA 2QB0B 2EANA 2ES6A 5J8YA 1V38A 1WWVA 2QKQA 4RQMA 3SEIA 4NJ8A 1RG6A 1SXDA 2EAOA 3BS5B 2KG5A 2DKXA 1X9XA 1OW5A 1SXEA 1X40A 4RQNA 1UQVA 2QB1A 2KMDA 2B6GA 1X66A 5F3XB 2E8MA 2LPEA 2E8PA 2L5YA 1SV4A 2F44A 4MHVA 2Y9TA 2E8NA 3K1RB 3BS5A 1WWUA 3KKAC 2D8CA 1JI7A 4PZOA 1PK1A 1OXJA 2GLEA 3BS7A 2QARA 1F0MA 1PK1B 2QARB 4PZNA 5JU5A 1LKYB 1PK3A 2EAMA 1UCVA 2EAPA 2LMRA 3TADC 1Z1VA 5JTIA 1COKA 4NL9A 3KKAA 3IDWA 4NL9C 1DXSA 2F8KA 2DKZA 3H8MA 4IS7A 2KIVA 2D3DA 2DL0A 1V85A 2K4PA 3SENA 2ESEA 5J8YC 5L1MA 1SV0A 5JRTA 1LKYA 5KNIA 1SV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGG A;  3HIL A;  2Y9U A;  3TAC B;  2KSO A;  3TAD A;  2FE9 A;  2F3N A;  1B0X A;  2KSO B;  3BQ7 A;  2E8O A;  2KE7 A;  2QB0 A;  2YTU A;  2JV3 A;  2K60 A;  1KW4 A;  1B4F A;  2QB0 B;  2EAN A;  2ES6 A;  5J8Y A;  1V38 A;  1WWV A;  2QKQ A;  4RQM A;  3SEI A;  4NJ8 A;  1RG6 A;  1SXD A;  2EAO A;  3BS5 B;  2KG5 A;  2DKX A;  1X9X A;  1OW5 A;  1SXE A;  1X40 A;  4RQN A;  1UQV A;  2QB1 A;  2KMD A;  2B6G A;  1X66 A;  5F3X B;  2E8M A;  2LPE A;  2E8P A;  2L5Y A;  1SV4 A;  2F44 A;  4MHV A;  2Y9T A;  2E8N A;  3K1R B;  3BS5 A;  1WWU A;  3KKA C;  2D8C A;  1JI7 A;  4PZO A;  1PK1 A;  1OXJ A;  2GLE A;  3BS7 A;  2QAR A;  1F0M A;  1PK1 B;  2QAR B;  4PZN A;  5JU5 A;  1LKY B;  1PK3 A;  2EAM A;  1UCV A;  2EAP A;  2LMR A;  3TAD C;  1Z1V A;  5JTI A;  1COK A;  4NL9 A;  3KKA A;  3IDW A;  4NL9 C;  1DXS A;  2F8K A;  2DKZ A;  3H8M A;  4IS7 A;  2KIV A;  2D3D A;  2DL0 A;  1V85 A;  2K4P A;  3SEN A;  2ESE A;  5J8Y C;  5L1M A;  1SV0 A;  5JRT A;  1LKY A;  5KNI A;  1SV0 C; 
#chains in the Genus database with same CATH topology
 3KFU F;  4F50 A;  1L6N A;  1NK9 A;  1CUK A;  9ICH A;  2AGQ A;  3SMV A;  3NVV A;  3PO4 A;  3ZI4 A;  3D2N A;  4ZH4 A;  2VJ5 A;  2A3V A;  3BQ7 A;  4YXJ A;  4O3S A;  2KE7 A;  2K89 A;  1QQ6 A;  1X9W A;  2K4H A;  2FLL A;  3GV5 B;  2QB0 B;  1URJ A;  1L3T A;  2E5S A;  2FI1 A;  2FLN A;  3I28 A;  4DQI A;  2EAN A;  3N7S C;  4RQM A;  5BOL A;  1S0M A;  3NAS A;  1DGJ A;  1ZET A;  5EWF A;  3ALR A;  4BXO B;  4YXM A;  1IV8 A;  5KFL A;  4NLG A;  1RXV A;  2MA1 A;  5DBC A;  9ICA A;  4NLC A;  2RRD A;  3IN5 A;  3DDH A;  5IIO A;  5AI6 A;  4ECU A;  1NI3 A;  5F3X B;  2W54 A;  2EZZ A;  3FM9 A;  5GTH U;  2F44 A;  3Q8L A;  5CJ7 A;  1ZQC A;  2Q0Z X;  3H8W A;  3UPQ A;  4ED1 A;  2HHX A;  1NZB A;  2HCF A;  4DOA A;  1ZQA A;  1ZRM A;  3BQ0 A;  2QAR B;  1IG6 A;  2VIX A;  2AQ4 A;  4TUQ A;  3ISD A;  3SV4 A;  2Y0S C;  1ZQK A;  2O6K A;  1RQL A;  1NK0 A;  3WK6 A;  4M9H A;  5KT7 A;  1XS9 D;  1S0V A;  2A1A A;  5J0W A;  4ECV A;  5AK4 A;  2KZM A;  3M8S A;  3Q8M A;  3PMN A;  3RH4 A;  4GFJ A;  5ALV A;  2M0N A;  4RT3 A;  5EE1 A;  1Z3E B;  2EDU A;  4MF8 A;  2J6T A;  1U45 A;  4I2E A;  4PHP A;  1S77 D;  2F3N A;  2W55 A;  1B0X A;  2KSO B;  1ZD5 A;  3H4B A;  4B9N A;  1YT3 A;  5J2K A;  4PHA A;  2JV3 A;  1T94 A;  4DQR A;  4KN7 A;  1SZP A;  5AI0 A;  1IIP A;  4MFF A;  3IRU A;  4LZD A;  3JPN A;  1V38 A;  3SAF A;  3C5F A;  3JPS A;  4C8L A;  2YMM A;  9ICB A;  4OJO A;  3FC4 A;  5ALE A;  4X5V A;  3B9J A;  4P4M A;  1RQN A;  3TFR A;  4QZB A;  3N4M B;  4F91 B;  1U49 A;  4YR0 A;  2KN7 A;  2HBJ A;  1WG8 A;  5ALZ A;  1KN5 A;  2B6G A;  5E79 U;  1Z1B A;  4O3M A;  1V9P A;  1L7O A;  4KLJ A;  2I1Q A;  4O3O A;  5EOZ A;  4DL6 A;  2C2E A;  3QNM A;  1PVQ A;  4DSK A;  2RDI A;  4M47 A;  4MHV A;  2YB1 A;  1S0N A;  3TQ1 A;  1T8E A;  2HSZ A;  3GIM A;  1ZQY A;  3PV8 A;  7ICJ A;  7ICR A;  2BCQ A;  3QUC A;  3SD7 A;  1Y88 A;  3ETR A;  2F2A B;  2M9N A;  1JIH A;  2C2D A;  4ELT A;  2XC9 A;  3RJE A;  1A0P A;  2MRL A;  3H0M B;  3G6V A;  4PHD A;  1ZJN A;  4CF3 A;  4UBC A;  2F8K A;  2F8L A;  2KD1 A;  3L5K A;  3KHL A;  1B22 A;  2AGO A;  3U26 A;  3MDA A;  2D6F C;  4YMM A;  1S0O A;  4KLG A;  5DQH A;  4DS4 A;  1FFV A;  8ICY A;  3HJE A;  2WFA A;  3D6J A;  2F1H A;  2KNJ A;  4Y2R A;  3UXP A;  1NKE A;  2NV3 A;  2HBL A;  2XY5 A;  2VKQ A;  9ICJ A;  1JXE A;  1KKX A;  4RZR A;  2WF6 A;  1ZQS A;  3ZDC A;  3TKA A;  3PW4 A;  1JUD A;  1SB3 C;  4QNL A;  4UB3 A;  2EAO A;  1OUQ A;  1CEZ A;  5KT2 A;  1QTM A;  2ZIW B;  2ZIX A;  4R65 A;  1ZQI A;  2G0A A;  2LYH A;  7ICT A;  4RQN A;  1UQV A;  5AM5 A;  2UVR A;  4NLB A;  5KFB A;  2KKV A;  4QZC A;  1TKD A;  4UAW A;  2LYA A;  4USA A;  3SYZ A;  3CRX A;  3Q8R B;  3VC8 A;  1KDH A;  1ZYQ A;  2E8N A;  3BS5 A;  2ZIU B;  4QZH A;  2A19 A;  3V7L A;  4FZM A;  4RQ1 A;  3T5L A;  5AI5 A;  3CW2 C;  5KFZ A;  3MFI A;  1X9S A;  3NVY A;  3PSP A;  7ICH A;  2VA8 A;  3TAN A;  2HHQ A;  3AQF A;  2LMR A;  5KFD A;  2HBK A;  3MR3 A;  1Z1V A;  2LM1 A;  2RQ5 A;  3A0B U;  4P0P B;  2FDR A;  9ICQ A;  2JEF A;  3ZDD A;  7ICI A;  1DXS A;  2HBM A;  4ELU A;  4MEY A;  3PZP A;  4DSE A;  4KN4 A;  3EWA A;  3RF9 A;  3PNC A;  3PW7 A;  4ECW A;  2YMQ A;  1IXR A;  3V6J A;  3RJJ A;  3G6X A;  4C8K A;  8ICM A;  1SV0 C;  3H40 A;  2K8B B;  3IG8 A;  4O0I A;  4QIW C;  5DG8 A;  8ICQ A;  1JN3 A;  2CRX A;  3TAD A;  4YD2 A;  3RJI A;  4PL2 A;  3FAH A;  3GFK B;  2W9B A;  4DSF A;  3ZDB A;  9ICI A;  4QZI A;  5ALJ A;  1ZQE A;  3EW9 A;  3F2B A;  3TI0 A;  1U4B A;  4IQW A;  5EE3 A;  1RG6 A;  4F4Y A;  2PMZ F;  4PH5 A;  4O5K A;  5ALG A;  4DFJ A;  1XSN A;  2H5X A;  1NKB A;  1DK3 A;  2HOI A;  1NJX A;  1T3Q A;  2XO7 A;  4QZ9 A;  2UVV A;  9ICS A;  4YR2 A;  4RQ7 A;  5DG9 A;  3HW8 A;  1ZQB A;  9ICO A;  2IHM A;  4IC9 A;  4G9B A;  1QQ5 A;  3JPR A;  2YB4 A;  4ECX A;  3C23 A;  1QQ7 A;  2DWQ A;  3RB6 A;  2XGQ A;  4GLX A;  3KTQ A;  8ICN A;  1JI7 A;  2FPL A;  1BPY A;  3RH6 A;  2HHU A;  2XCA A;  1N5W A;  3RJH A;  2W7P A;  1T4G A;  1S8O A;  1O03 A;  1Z4O A;  4CGZ A;  4DFK A;  5B5E U;  2BKE A;  3I1Y A;  3IHQ B;  1Q46 A;  2IOH A;  1S9F A;  9ICL A;  2KP7 A;  2J6S A;  1NJZ A;  5L1J A;  9ICM A;  8ICH A;  4UQG A;  2DKZ A;  4EEY A;  3RAQ A;  1N63 A;  3PY8 A;  4RQ6 A;  5AI4 A;  2D3D A;  3SEN A;  1RZT A;  2H3Z A;  4Q8E A;  5KNI A;  1XWL A;  4J9R A;  1Z19 A;  4R8U B;  5B66 U;  3T3F A;  4DF8 A;  9ICT A;  1ZQZ A;  2HDO A;  3QU4 A;  2ZUD A;  2JZB B;  4MF2 A;  2W9C A;  2ZIX B;  1L3U A;  3F53 A;  3Q8P B;  5J0P A;  4NV0 A;  8ICR A;  5KG0 A;  1T7P A;  3M7D A;  5AI8 A;  1EXN A;  1TV9 A;  3PML A;  2AU0 A;  2RP5 A;  3QEA Z;  3H0L B;  2XI9 A;  3BS5 B;  2BPG A;  4DSL A;  2MSN A;  1ZQX A;  2WHE A;  1S10 A;  1COO A;  5K4L A;  1QSS A;  1BPE A;  3RB4 A;  4F71 A;  4NXZ A;  5CHG A;  4J9N A;  3KZI U;  5HHI A;  3LDA A;  5ALX A;  1RYS A;  5HHH A;  5ALO A;  5DQG A;  2YQE A;  1SV4 A;  2C2R A;  4RU9 A;  3K1R B;  5HML A;  4Y2Y A;  8ICE A;  5AI9 A;  2JH1 A;  3QZ7 A;  4RQ4 A;  4Y2S A;  4QW9 A;  5L9X A;  3JPT A;  5ALD A;  3SI8 A;  1NJW A;  4MFC A;  2AHO B;  1C7Y A;  2OWO A;  5D46 A;  2EAM A;  3PX6 A;  4O5E A;  1ZQP A;  5AHX A;  5JTI A;  3AM9 A;  3THV A;  5AKK A;  1AQ6 A;  2ASJ A;  8ICS A;  3HKZ F;  4BWM A;  3QZ8 A;  5ALW A;  4RQ8 A;  2P66 A;  4DQQ A;  3WKC A;  1CRX A;  4LJX A;  3NRZ A;  1SV0 A;  5CB1 A;  3WKD A;  3RBE A;  1ZXI A;  4J9P A;  5CA7 A;  3CYM A;  2G06 A;  2ZXH A;  4IRD A;  4ECZ A;  2W04 A;  4QWB A;  1L3S A;  2K60 A;  7ICF A;  2W03 A;  5TZV A;  4EZ6 A;  5KFS A;  1J97 A;  4I28 A;  5DGA A;  2ZIV A;  1FO4 A;  1BNP A;  4RNN A;  2NRV A;  3EPI A;  5HR7 A;  3SEI A;  5KFU A;  4TUS A;  2FLP A;  3UM9 A;  2PFO A;  2BQR A;  4Y2J A;  1ED1 A;  2KG5 A;  1X9X A;  1UT8 A;  2R8I A;  1SXE A;  1PVP A;  8ICP A;  3RR7 A;  2WTF A;  3V7K A;  3HT3 A;  3EUB 2;  5ALN A;  4EEN A;  2NO5 A;  1SL1 A;  3TFS A;  3OTQ A;  3AU2 A;  4EBE A;  5DKW A;  5EE0 A;  4F72 A;  5KFO A;  4KMU A;  5DGB A;  2VJ4 A;  3ONN A;  1SL0 A;  2GLE A;  2AH5 A;  2DPJ A;  3UXN A;  2Y1I A;  2IMW P;  1MA7 A;  4QZ8 A;  3LK9 A;  3MC1 A;  4I2I A;  4QZG A;  4EX6 A;  1A76 A;  2KVS A;  4U7C A;  2XID A;  3TAR A;  2LKY A;  2BCV A;  5EE9 A;  1ZQL A;  1BPX A;  3MR5 A;  2A1J B;  7ICN A;  4Q45 A;  2P35 A;  4QJF B;  5L1L A;  4YVZ A;  2P6U A;  1SWW A;  2DUY A;  2KIC A;  4C4T A;  5J8Y C;  4UB2 A;  1MC8 A;  4UB8 U;  5D4B A;  4PGY A;  1VJ5 A;  5J2F A;  3ISC A;  4RQ3 A;  3TAC B;  4ECS A;  3WK7 A;  2PI5 A;  5AKI A;  3GV8 B;  5TIS U;  2JGA A;  3BZK A;  3B0X A;  7ICS A;  3KHG A;  1F5S A;  1ZD4 A;  3N7P D;  4QWD A;  3OSN A;  4B9V A;  2BZF A;  3WU2 U;  7ICM A;  1PVR A;  4ECR A;  3GV7 B;  1XSL A;  8ICX A;  4O3N A;  2OH2 A;  2JMG A;  4P2H A;  2V9W A;  1ZRN A;  2KTQ A;  4UAV A;  4JWM A;  2KKP A;  1BPB A;  5J0T A;  1BPZ A;  3H4D A;  3SAH A;  2EQY A;  3NTU A;  5KFF A;  4RT2 A;  4TUR A;  4RQ2 A;  3RJG A;  1ZQG A;  5KT4 A;  2MU2 A;  5DDM A;  5AM4 A;  1DGS A;  8ICW A;  1X2I A;  9ICE A;  3HX0 A;  1PK1 A;  1DRG A;  3JPP A;  5DB8 A;  4F5N A;  2AJQ A;  1ARO P;  4I2C A;  1KL9 A;  3C1Z A;  2G08 A;  2C22 A;  2KFZ A;  2LM4 A;  3KHR A;  4P0Q B;  1D8L A;  4IR9 A;  3KKA A;  1X6I A;  2ZJA A;  3RJF A;  1C20 A;  2Y0S F;  5DB6 A;  5KAI U;  4FS2 A;  2I5H A;  5FP0 A;  4DCC A;  5L1M A;  4Y2Q A;  2VAN A;  5IIN A;  1TAM A;  4F4Z A;  1ZQR A;  1WCN A;  5KFY A;  3L4P A;  4Z6E A;  4YFK A;  4TQS A;  5J2D A;  4I2J A;  3KZX A;  2YTU A;  5J0X A;  1NK5 A;  2IBK A;  2DF4 B;  1A6S A;  1V97 A;  2KOB A;  1S5L U;  3OJS A;  4OJP A;  3OSP A;  5AKH A;  2K8C B;  3M9O B;  1O08 A;  3RR8 A;  2MUT A;  1SXD A;  2WF9 A;  5ALQ A;  2N1R A;  4KTQ A;  3SQI A;  5KFE A;  1ZQO A;  7ICG A;  1ZQJ A;  5KL8 B;  4HAI A;  4I2A A;  3OGU A;  2BPF A;  3PST A;  2HVI A;  2R8G A;  4OJ6 A;  3GIK A;  2R8K A;  1L7M A;  1NJY A;  2KJ5 A;  4EBC A;  4O3Q A;  1ZJM A;  4AP9 A;  3TAQ A;  7ICU A;  3BQT A;  4J9Q A;  2KIW A;  4JV2 A;  4CRX A;  4NWI A;  3WK9 A;  1K1S A;  2W9A A;  4GC7 A;  1D9F A;  2D8C A;  4XA5 A;  3PVX A;  8ICU A;  4PZO A;  3ORY A;  3MGV A;  1QLN A;  3OJU A;  3Q8K A;  1N56 A;  4KLS A;  1XSP A;  5KT6 A;  2OEH A;  5KFR A;  9ICW A;  5CP2 A;  2I6X A;  3VCB A;  4C7Z A;  3NRW A;  1SWV A;  1ZQW A;  4QWC A;  2BQ3 A;  5J0R A;  2BCR A;  1SKW A;  5T14 A;  1KLN A;  4QW8 A;  3UQ2 A;  2WAQ C;  3C21 A;  4KX3 A;  3F5A A;  4KLO A;  1J2M A;  3T5K A;  4K4G A;  1KFD A;  2K4P A;  5L1I A;  2H3Q A;  4ED0 A;  2FMS A;  5DBB A;  2K4E A;  2BGW A;  7ICE A;  4KLU A;  5IIK A;  3N28 A;  5J0O A;  4OD0 A;  4YCX A;  1MN8 A;  4CCH A;  3ETL A;  4Q44 A;  2XVT A;  1DK2 A;  4CNQ A;  2W9M A;  5KG3 A;  4C7Y A;  5BOM A;  1N62 A;  2QKQ A;  2BDP A;  3UMC A;  2GH1 A;  5AKL A;  1JMS A;  4KMO B;  4OJ5 A;  4PL1 A;  3QU2 A;  5ALK A;  4F4W A;  1B43 A;  3GU3 A;  1N2X A;  4QZE A;  4ED8 A;  2KHV A;  1KFT A;  1OW5 A;  3DV9 A;  1X40 A;  1JRO A;  4G3I A;  2HW3 A;  5DLF A;  4GXI A;  4OJL A;  1PUZ A;  8ICI A;  4KLT A;  5HP4 A;  1Z00 A;  4DL2 A;  1ZQQ A;  4O3R A;  4UB1 A;  2E8P A;  2L5Y A;  1U47 A;  3WK4 A;  5KFQ A;  4RNM A;  1HIW A;  2IHN A;  4C4R A;  2NRZ A;  1OXJ A;  5KFM A;  2KHQ A;  1MSW D;  3QXG A;  5KFV A;  2AGP A;  3QE9 Y;  2I9G A;  5AK5 A;  4ICA A;  2H3V A;  2Z7J A;  4C0Z A;  2IOF K;  4KLQ A;  3ZD8 A;  3MDC A;  4PGQ A;  2BCU A;  4M9L A;  3GZF A;  4F2S A;  4NL9 C;  4XRH A;  5ALL A;  4AYB C;  1N5X A;  1TK8 A;  2DL0 A;  2NRT A;  3UMB A;  5JRT A;  2PXI A;  3PR4 A;  1Q3V A;  2UVU A;  4E0D A;  3M9M B;  2RDJ A;  5DDY A;  4B9U A;  3MBY A;  4C8N A;  5ALH A;  2HHW A;  1BVS A;  4B9S A;  4UAT A;  3NGD A;  2QB0 A;  5JUM A;  4DWI A;  4B9M A;  1H38 A;  3SZ2 A;  4EYH B;  2ZUC A;  2XCP A;  3D2Q A;  4QIW F;  5J2A A;  5AM0 A;  1WYG A;  4UAU A;  2ES6 A;  3ED5 A;  1CI4 A;  1FIQ A;  4J9M A;  4UAS A;  5KFT A;  2XGP A;  1FFU A;  1T3N A;  3PO5 A;  2OXO A;  4DL5 A;  1IM4 A;  9ICN A;  3C2M A;  4J9S A;  2HOF A;  3F5E A;  4YG2 A;  4KLD A;  2F1J A;  4KIT B;  4YMO A;  3PR5 B;  2VA3 A;  5ALI A;  4MFA A;  3CNH A;  4F93 B;  4QWA A;  3L3F X;  1ZQT A;  4LZG A;  4DL3 A;  4Y2U A;  1D9D A;  3C1Y A;  9ICG A;  5F9N A;  4DQP A;  2F1I A;  2HI0 A;  1ZQH A;  1UPH A;  2G5H B;  3OHB A;  2KZZ A;  3HRD D;  3M9N B;  2CPR A;  2QAR A;  5AIA A;  3QYP A;  3C29 A;  5J2E A;  3C28 A;  4PZN A;  8ICF A;  3RJK A;  4JB3 A;  1PK3 A;  3RB3 A;  5KFH A;  5KG7 A;  1J2N A;  2LBO A;  4DSJ A;  3AL0 B;  4DLG A;  2W43 A;  4RUA A;  2WB1 C;  3WKA A;  5DG7 A;  3LVV A;  2ATL A;  4UAZ A;  4RQ5 A;  1ZQV A;  4Y2T A;  3M1Y A;  3EPG A;  1ZQF A;  4UB5 A;  3MR2 A;  3V6K A;  2XIC A;  2HMX A;  1SGG A;  1ECW A;  1DOQ A;  1UHU A;  2KSO A;  1K5O A;  4F2R A;  4PPX A;  2FE9 A;  5KG6 A;  3LVW A;  4WJ3 B;  4KLF A;  2UVW A;  1Q3U A;  5DB7 A;  2JEJ A;  1B4F A;  3JPO A;  2W9B B;  2EZY A;  3S6J A;  3C5G A;  4IQT A;  5DB9 A;  1SKS A;  4MEX A;  1L5U A;  1Z00 B;  1L8L A;  2KVC A;  5ALS A;  2HHS A;  1D8B A;  2ASD A;  4U6P A;  2AXT U;  3KHH A;  2C28 A;  5KFW A;  1S76 D;  4M04 A;  4F8R A;  3ZDA A;  4BDP A;  8ICJ A;  1MQ3 A;  1L7P A;  3RRG A;  3KOO A;  9ICF A;  1KBU A;  2EH9 A;  2IA6 A;  4NM2 A;  2CN1 A;  4DO9 A;  2R8J A;  3GII A;  2HVH A;  5KFC A;  2E8M A;  5IIJ A;  2LPE A;  1KQQ A;  5AM1 A;  1HJP A;  2PKE A;  4J03 A;  3F2C A;  4KLM A;  1BNO A;  2ISP A;  2YMP A;  1YZ6 A;  1X9M A;  3CP8 A;  2LHT A;  3A0H U;  4UAY A;  4YR3 A;  1ZQN A;  2E1F A;  9ICV A;  1NK8 A;  4EEK A;  1L3V A;  3Q8S B;  1L8O A;  1BGX T;  5KFJ A;  3UQ0 A;  4RPZ A;  5AKZ A;  4CF5 A;  4NL9 A;  5AKE A;  5KT3 A;  3I76 A;  4XUS A;  3MGI A;  1JXL A;  1ZQ1 C;  4Y2X A;  1RDF A;  3H8M A;  5DQI A;  5A0L A;  1N61 A;  3V72 A;  1NK6 A;  1JRP A;  1V85 A;  4US9 A;  5J2C A;  4YP3 A;  1UA1 A;  3MAB A;  3QU5 A;  1K1Q A;  4Z6D A;  3AQE A;  2V4Q A;  7ICQ A;  2K4I A;  4RPY A;  2ODG A;  3RRH A;  3M6Z A;  7ICV A;  2GOL A;  2R18 A;  2WF8 A;  2ZXI A;  2HOQ A;  4BGD A;  2E8O A;  2NRW A;  3E0F A;  1KW4 A;  2W7O A;  2W9C B;  5KFI A;  2ISO A;  4BJQ A;  2ZJ8 A;  2EZX A;  2BHN A;  2W3S A;  5J2H A;  1HUZ A;  3BDP A;  3ZDE A;  1UA0 A;  3AMZ A;  3RBD A;  3RB0 A;  2ZIW A;  1NKC A;  2OCE A;  3RFA A;  3RAX A;  3V7J A;  3UMG A;  2W3R A;  1XNS A;  9ICP A;  3K1Z A;  2LYB A;  4BWJ A;  4R64 A;  2QB1 A;  4I2H A;  4BUG A;  2FMP A;  4EX7 A;  5DLG A;  2B0C A;  1X66 A;  5KG4 A;  2ZIU A;  4PJ0 U;  4O5C A;  4UAR A;  4CF4 A;  8ICZ A;  1RPL A;  4I2G A;  3HWT A;  3OHA A;  4F3O A;  2FJ6 A;  4YQW A;  4QZF A;  3ICX A;  5HR6 A;  3BQ1 A;  1L7N A;  4IR1 A;  1TK0 A;  1FEZ A;  1M6Y A;  1U48 A;  1LVH A;  2BR0 A;  2FPM A;  4ECQ A;  8ICC A;  3K4G A;  2ASL A;  3TAD C;  4P0P A;  4R63 A;  5ALU A;  3G6Y A;  3IG5 A;  5ALF A;  5IIL A;  7ICK A;  5AIB A;  2KFN A;  2ZTC A;  3PSF A;  3T5J A;  4ED6 A;  4IS7 A;  4F5Q A;  2PFQ A;  2NYV A;  2KIV A;  2Y1J A;  1TE2 A;  5KL1 B;  5IIM A;  1KEJ A;  1LKY A;  1KFS A;  4DL4 A;  1WCL A;  1TVA A;  3HIL A;  2GO7 A;  4J9O A;  4M6W A;  2DQN B;  1TAQ A;  5ALY A;  4JUZ A;  4M0A A;  4I27 A;  8ICK A;  4RNO A;  1VDV A;  2KV2 A;  4C8O A;  4KLE A;  3AUO A;  4I2D A;  2FMQ A;  4DFD A;  2F76 X;  4Y2V A;  5BPC A;  2ZIV B;  4OO1 J;  3PW5 A;  2H3I A;  4JV1 A;  1KTQ A;  3DEE A;  1QSY A;  1NZP A;  5J2B A;  3N97 B;  4R66 A;  2KJ9 A;  3JPQ A;  3M8R A;  4NLK A;  2J6U A;  8ICT A;  4NLN A;  4F4K A;  2JEI A;  2BCS A;  3HPO A;  4ED3 A;  5ALM A;  1U9L A;  3AN1 A;  4M9J A;  1LB2 B;  4UW9 A;  3F2D A;  3KBB A;  2DBY A;  4EYI B;  1ZD3 A;  5EWE A;  4JMU A;  2K8A A;  5GTI U;  3J81 j;  2DFL A;  1ZD2 P;  2ZTD A;  2Y9T A;  3WK8 A;  4CDG A;  4ECT A;  1NK4 A;  1ZQM A;  4RUC A;  4FE3 A;  2OYY A;  4M2Y A;  3RTV A;  4PGX A;  2G5I B;  3T79 A;  1QSL A;  4Y2P A;  2EAP A;  2VA2 A;  4DFM A;  4KLL A;  4QZD A;  1ZQU A;  4DF4 A;  2E3T A;  5J29 A;  3PX4 A;  1XU4 A;  3QEB Z;  3WKE A;  1HEK A;  4UB4 A;  1JX4 A;  5III A;  2ESE A;  4LVS A;  1XO1 A;  5KFX A;  2CXY A;  4R8U A;  1N48 A;  2Y9U A;  2R8H A;  2XY7 A;  2JZB A;  5HMM A;  3KD3 A;  1HUO A;  1KRP A;  3OPX A;  2PMZ C;  3PSI A;  4XQ8 A;  2XY6 A;  5KTQ A;  2G09 A;  4YD1 A;  4DL7 A;  5J8Y A;  3V6H A;  4C8M A;  2ZG6 A;  5KFK A;  3MR6 A;  7ICO A;  5EWG A;  4NJ8 A;  4UBB A;  3AU6 A;  4DOC A;  4YN4 A;  4DOB A;  1NNL A;  1RM6 C;  4KLH A;  1TFR A;  2KJ8 A;  1KSP A;  4DFP A;  5HNK A;  1QH9 A;  3EZ5 A;  5J0S A;  4M9G A;  3SR6 A;  3QX7 A;  8ICA A;  4Q43 A;  3AEV A;  4IQV A;  5KFG A;  3TAP A;  7ICP A;  3QUQ A;  4FZL A;  4DEZ A;  1JAL A;  4JV0 A;  2KEY A;  5KAF U;  4FBU A;  9ICC A;  4IRK A;  4I2B A;  1WWU A;  1XO0 A;  3EYZ A;  3NVZ A;  5KFA A;  5J2J A;  4QZA A;  4GC6 A;  1Q8K A;  2FPK A;  2YN4 A;  4P4O A;  3Q8Q B;  3GIJ A;  1PK1 B;  3T5H A;  3RH5 A;  5ALR A;  3H8J A;  3HP6 A;  1LKY B;  1RYU A;  5KG1 A;  3K75 D;  5CWR A;  4JK1 A;  2NO4 A;  5G5H A;  3SV3 A;  4M6W B;  3H0R B;  8ICO A;  4YMN A;  5AKG A;  4EZ9 A;  1SL2 A;  3B0Y A;  4Q8F A;  2BDU A;  3IDW A;  1VLB A;  4GIB A;  4M9N A;  2BPC A;  1ZOL A;  4O9M A;  1SZH A;  9ICU A;  4F4X A;  4P4P A;  1WUD A;  1F44 A;  2GWS A;  3C2K A;  4RPX A;  5AK6 A;  1COK A;  5J2I A;  2QLT A;  5C0Y A;  2PFN A;  2ZTE A;  8ICG A;  5G5G A;  5KG5 A;  1Z4N A;  3GQC A;  3QUT A;  3ISB A;  4B6J A;  2WAQ F;  1NK7 A;  4I2F A;  4A8E A;  8ICL A;  4Z6C A;  4C80 A;  5C5J A;  4J9L A;  2JH7 A;  3NUQ A;  2ZJ5 A;  4K4I A;  5AM3 A;  5AIC A;  2PI4 A;  2OM6 A;  4BX9 C;  4F92 B;  3R9K A;  4DQS A;  5ALT A;  5ALP A;  4C4S A;  5CEH A;  2MUT B;  2HHT A;  4RQ0 A;  5J0Q A;  5KFP A;  2IOF A;  4J9K A;  3ZD9 A;  1RYR A;  4NM1 A;  2KMD A;  4ACO A;  9ICR A;  4CE6 A;  3BJY A;  2W8K A;  3FDS A;  3NVW A;  2WF7 A;  2KK0 A;  4FO6 A;  5KG2 A;  4BXO A;  3BZC A;  4QWE A;  4TQR A;  4B9L A;  5J0U A;  1P7D A;  2YML A;  2YX8 A;  3H8S A;  3IM1 A;  3LWM A;  1F0M A;  4KX5 A;  2V4R A;  4F5O A;  3QU9 A;  1PZN A;  5AKJ A;  3FYH A;  4NY8 A;  4OCZ A;  3HKZ C;  2YY6 A;  3PW2 A;  2HHV A;  3BQ2 A;  5CR0 A;  1UCV A;  2B21 A;  1XC9 A;  4ECY A;  2A1J A;  1A77 A;  2WF5 A;  9ICX A;  3PX0 A;  2G07 A;  5L1K A;  2JEG A;  1QCK A;  2ZUB A;  2JHD A;  4O3P A;  2F77 X;  3E2E A;  2KZ3 A;  3NS1 A;  3LWL A;  2MAX A;  1D8Y A;  4FZN A;  5CRX A;  3GIL A;  4F5R A;  7ICL A;  3UXO A;  4F5P A;  2AQ0 A;  3QU7 A;  4AYB F;  1RXW A;  3IV6 A;  1X42 A;  2JXJ A;  3WK5 A;  4IL6 U;  4DLE A;  1X6J A;  3WKB A;  3MFH A;  1NOM A;  3PW0 A;  4ED7 A;  5F9L A;  2W8L A;  4ED2 A;  4ELV A;  1WWV A;  4ZOH C;  2PFP A;  1BPD A;  4HYK A;  1ZQD A;  3E58 A;  2JR5 A;  2NRX A;  3GDX A;  3IP4 B;  8ICB A;  5KT5 A;  2DKX A;  4FFD A;  1TAU A;  1S97 A;  4KLI A;  5J0Y A;  2OHF A;  4Z6F A;  5D49 A;  5AKY A;  2W11 A;  1TK5 A;  4B9T A;  9ICK A;  2E1E A;  8ICV A;  2H3F A;  4EEL A;  2JRZ A;  1MQ2 A;  3QUB A;  4US8 A;  5AK3 A;  1YZ7 A;  2P6R A;  4K4H A;  3O0F A;  5J2G A;  3KKA C;  3C2L A;  2LI6 A;  5AM2 A;  3H7I A;  2ALZ A;  3BS7 A;  1SKR A;  1SIJ A;  2RHF A;  4JWN A;  3SAG A;  5H2F U;  4DSI A;  4UB6 U;  5JU5 A;  1LV5 A;  4IRC A;  4P0Q A;  4PHE A;  1UT5 A;  3MGH A;  3LYS A;  4GXK A;  4DS5 A;  4FS1 A;  3D2S A;  5DBA A;  1GO3 F;  5KFN A;  3N7R C;  3M6K A;  4EBD A;  2RLT A;  1N60 A;  4GXJ A;  2BQU A;  2DGZ A;  2Q4T A;  2DPI A;  4TUP A;  4FBT A;  2WB1 F;  4I29 A;  5AKX A;  4IQU A;  4NLZ A; 
#chains in the Genus database with same CATH homology
 1SGG A;  3HIL A;  2Y9U A;  3TAC B;  2KSO A;  3TAD A;  2FE9 A;  2F3N A;  1B0X A;  2KSO B;  3BQ7 A;  2E8O A;  2KE7 A;  2QB0 A;  2YTU A;  2JV3 A;  2K60 A;  1KW4 A;  1B4F A;  2QB0 B;  2EAN A;  2ES6 A;  5J8Y A;  1V38 A;  1WWV A;  2QKQ A;  4RQM A;  3SEI A;  4NJ8 A;  1RG6 A;  1SXD A;  2EAO A;  3BS5 B;  2KG5 A;  2DKX A;  1X9X A;  1OW5 A;  1SXE A;  1X40 A;  4RQN A;  1UQV A;  2QB1 A;  2KMD A;  2B6G A;  1X66 A;  5F3X B;  2E8M A;  2LPE A;  2E8P A;  2L5Y A;  1SV4 A;  2F44 A;  4MHV A;  2Y9T A;  2E8N A;  3K1R B;  3BS5 A;  1WWU A;  3KKA C;  2D8C A;  1JI7 A;  4PZO A;  1PK1 A;  1OXJ A;  2GLE A;  3BS7 A;  2QAR A;  1F0M A;  1PK1 B;  2QAR B;  4PZN A;  5JU5 A;  1LKY B;  1PK3 A;  2EAM A;  1UCV A;  2EAP A;  2LMR A;  3TAD C;  1Z1V A;  5JTI A;  1COK A;  4NL9 A;  3KKA A;  3IDW A;  4NL9 C;  1DXS A;  2F8K A;  2DKZ A;  3H8M A;  4IS7 A;  2KIV A;  2D3D A;  2DL0 A;  1V85 A;  2K4P A;  3SEN A;  2ESE A;  5J8Y C;  5L1M A;  1SV0 A;  5JRT A;  1LKY A;  5KNI A;  1SV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...