2F44A

Crystal structure of the zinc-bound shank sam domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 and multiple ankyrin repeat domains 3
molecule tags Structural protein
source organism Rattus norvegicus
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f44A00
3K1RB 2F3NA 2E8OA 3H8MA 5JRTA 2D8CA 4MHVA 4NL9A 1PK1A 5JTIA 1B0XA 1UCVA 2QKQA 2Y9UA 2KE7A 4PZOA 5JU5A 3BQ7A 3BS7A 5F3XB 3BS5A 1B4FA 2QB1A 2EAMA 2DL0A 2YTUA 4RQMA 3TADA 2KSOB 1SGGA 3SENA 2KIVA 1SV0C 2QB0B 1LKYA 2F44A 2KMDA 3BS5B 1DXSA 5J8YA 2EAPA 3IDWA 1OW5A 1SXEA 1X9XA 2Y9TA 3TACB 4IS7A 1PK3A 5KNIA 2JV3A 2LMRA 2E8NA 1X66A 1KW4A 1Z1VA 1OXJA 2D3DA 3HILA 1V85A 5L1MA 2DKXA 1PK1B 1F0MA 2ESEA 2KSOA 2L5YA 2E8MA 2DKZA 1COKA 1SXDA 1SV0A 2ES6A 2F8KA 2EAOA 2FE9A 1X40A 2E8PA 2B6GA 3SEIA 3KKAA 2GLEA 2LPEA 2K4PA 1WWVA 1V38A 2QARB 2K60A 1LKYB 1SV4A 5J8YC 4RQNA 4PZNA 2QARA 4NL9C 1WWUA 3KKAC 2EANA 1JI7A 3TADC 1RG6A 4NJ8A 1UQVA 2KG5A 2QB0A
chains in the Genus database with same CATH superfamily
4OJPA 2BKEA 3ORYA 3C1YA 3SAGA 8ICWA 3SR6A 2KN7A 2D8CA 3MABA 3EZ5A 1ZQHA 4M6WB 2WAQC 4CE6A 1B0XA 4O3QA 2WTFA 5AK3A 4QZ8A 3IHQB 4Y2JA 4DOAA 1NJZA 4DWIA 4DQIA 9ICVA 4DF8A 1SZPA 3RBEA 1DRGA 4ELUA 1FIQA 3KHLA 1SZHA 9ICMA 4O3NA 7ICJA 4RQMA 1S77D 5DBAA 2W8LA 2IHMA 1SV0C 1T94A 4NLBA 4GLXA 2BPGA 1Q46A 1ZQXA 3EUB2 1BNPA 1T4GA 3IDWA 5CWRA 5AKKA 3BZCA 1NNLA 1FO4A 4ECUA 1RXWA 2LBOA 4JWNA 2K4HA 7ICHA 2WF5A 2XVTA 2RP5A 4R64A 3HX0A 4XUSA 2NV3A 4RPZA 2ZJAA 3ICXA 4DQQA 3TFSA 2VA2A 1Q8KA 4QIWF 2HHTA 1S0VA 5GTHU 4RNNA 5KG2A 3GV7B 4QNLA 5AM2A 4KLEA 4YR3A 5HHIA 2LPEA 4JUZA 4EZ9A 3ISCA 4IQVA 5B5EU 2W9CB 4QWBA 3RJIA 3THVA 4PPXA 3WU2U 1TV9A 4RQNA 1ZQTA 5KG1A 4YXJA 5AIBA 2OHFA 3JPRA 2P66A 2R8GA 5KFLA 4CNQA 4MFAA 3OJSA 2LHTA 4BX9C 4UB2A 1TE2A 2AHOB 2JZBB 3CRXA 2ZJ5A 9ICIA 1RM6C 1UT8A 4Z6CA 3AU6A 5F9NA 8ICIA 1UCVA 2A1JA 5KT4A 3L4PA 3HP6A 4R8UA 9ICFA 1KL9A 1FEZA 3GILA 4LZDA 2HSZA 1L6NA 5DLGA 7ICFA 2FLPA 3ETLA 2KIWA 2H5XA 3V7LA 2F1HA 4RQ2A 3IRUA 2N1RA 1N48A 3R9KA 2OWOA 1BPEA 1HUOA 1KDHA 2C22A 1KEJA 3M8RA 4F4KA 2R8HA 4RT3A 4PH5A 2JV3A 3SZ2A 5EWEA 4ED8A 3NS1A 1F44A 2VA3A 1X9SA 4F4WA 4R8UB 4PGYA 4YR2A 1DK2A 3IM1A 3N7SC 4PHDA 4I2EA 2KK0A 2W3RA 1F0MA 4DLEA 4I2HA 2H3ZA 2Y1JA 2B6GA 2HCFA 4Q45A 3EPIA 4C8NA 4DO9A 2MUTB 3PNCA 4RQ8A 3RB3A 2F8LA 4DSIA 5DB9A 4ED7A 3H8WA 1SL0A 4UAVA 2YMPA 1DOQA 4UAZA 3LK9A 5AI4A 4F8RA 3WK5A 4NL9C 2W7PA 2UVWA 3TADC 1DGJA 5DQIA 2E1FA 4Y2QA 4ECVA 3SD7A 3BQ1A 5AI9A 2I5HA 4QZFA 2E8OA 4IQTA 5CHGA 2I1QA 2ZIUA 2RQ5A 1MN8A 3PX4A 3RAXA 3N4MB 1PVPA 4UAYA 2MUTA 5HMLA 4DCCA 1ZQBA 5ALSA 4Y2YA 1TVAA 1U9LA 4E0DA 2W03A 3SENA 2RDJA 4TURA 3T5KA 3BQ2A 5DQGA 3PO5A 3HWTA 3BS5B 5L1KA 2DGZA 3LYSA 5TZVA 5J0XA 5KNIA 4YN4A 4F72A 5KTQA 9ICXA 2B0CA 9ICKA 1UHUA 1A6SA 4P0QB 1L8OA 2KP7A 3TKAA 1U47A 2XCPA 3GV5B 1RYRA 4F4ZA 4AYBF 4IRCA 5KT3A 3NASA 4KTQA 3KZXA 2Q4TA 2E8PA 2JEFA 4KLTA 3SEIA 2KD1A 4F4XA 1S5LU 5EE1A 3QXGA 3MGHA 4I2JA 4DFKA 4EBDA 2GO7A 2RHFA 5ALJA 5AI8A 5KL1B 5J8YC 1SV4A 4DL4A 9ICTA 5A0LA 3HJEA 2PI4A 2AXTU 4KLDA 2K89A 5D4BA 2LM4A 2W04A 4EBCA 3RB4A 1ZQIA 3ED5A 2JMGA 7ICTA 5EE0A 2LYHA 4CF3A 2ZXIA 1S8OA 2G06A 3RAQA 5AKLA 2XGPA 1ZQYA 3CW2C 3QZ7A 4KMOB 4CGZA 5KT7A 1UA0A 1TK5A 5J0UA 2XO7A 5AK6A 5L1LA 2KIVA 1Z1BA 2KICA 4XQ8A 8ICGA 4F5QA 3GZFA 2AQ0A 4QZEA 2AGPA 2BGWA 2KKPA 3OTQA 2ZIWA 1XU4A 9ICJA 1F5SA 2ISOA 3DEEA 4O5KA 3MR3A 2GWSA 3ETRA 5KFZA 3A0BU 1OXJA 5H2FU 1QLNA 5CP2A 4DL6A 2ESEA 4B9UA 5DGBA 2CPRA 3WKDA 2HHSA 5L1IA 5KFTA 1JUDA 3RH4A 4KLQA 4EX7A 4P4MA 3PW7A 3PSTA 2K4PA 1N61A 4YP3A 2NRXA 4DQSA 4G3IA 3H0MB 1L7MA 8ICCA 2AQ4A 3MR2A 2IMWP 3FC4A 1TFRA 5AKXA 3FDSA 3B0YA 2ASDA 2VJ5A 1NK6A 4UASA 5L1JA 3QUTA 2ZIXA 2OM6A 4MEYA 1V97A 3WK6A 3KFUF 1SB3C 3SV3A 3H4DA 2E3TA 5D49A 1NK0A 4M9JA 4ACOA 5KG3A 3RJGA 7ICKA 1YT3A 2MAXA 4DOBA 1NKCA 3RJFA 3BQ7A 2KKVA 3V72A 5ALHA 2HHXA 4I2GA 5DG7A 4B9NA 3A0HU 1RZTA 2OCEA 2D6FC 3H0RB 5IIMA 2ZXHA 1SWWA 3GIKA 2F1IA 2G0AA 3PV8A 2HMXA 3NVZA 1PUZA 9ICWA 1OUQA 3F2CA 2DPIA 2HOQA 2XICA 4P2HA 9ICPA 2YN4A 4F2RA 1N62A 4IS7A 5KFAA 4RQ5A 2YY6A 3NRWA 1T8EA 5J2FA 2LM1A 1J2MA 4PHEA 1L7NA 1Z1VA 3F2DA 4RNOA 5KFUA 4UB5A 4DSKA 3T5JA 2JH7A 4YD2A 2HOIA 4C8KA 4KLSA 1BVSA 3C23A 3SV4A 1ZQOA 4OJOA 2FLLA 3ZDCA 5G5GA 4O3SA 1XNSA 7ICQA 2IOFA 4YQWA 3HT3A 5J0SA 2QLTA 4RPYA 2OH2A 4GXIA 1JXLA 4AYBC 3D2NA 1TAMA 3UXOA 5DDYA 3RJEA 9ICLA 4UQGA 4O5EA 5AHXA 1GO3F 4ECWA 3MDCA 2XY5A 3M6ZA 3C2KA 2QARB 1NK5A 1ZD5A 5DBCA 4Q8FA 2K8CB 2DF4B 4C4TA 1JN3A 1U49A 2IOHA 7ICSA 1JI7A 4F91B 1O03A 2ATLA 3G6VA 1BPXA 9ICBA 3H8SA 3SI8A 3K1RB 3I76A 3NVWA 2H3QA 1JIHA 4JK1A 4DSFA 3TARA 7ICMA 3D2SA 1RQLA 2ZIXB 8ICHA 2EZZA 1ZQFA 2HBLA 3TAQA 3Q8PB 5KG6A 4C80A 4C8LA 2BQ3A 1FFUA 4EZ6A 4J9NA 3QU7A 2WHEA 5AKIA 4QZCA 3FAHA 5KT2A 4HAIA 9ICHA 2DL0A 3MGVA 1ZQEA 2HHQA 2KJ9A 2FMSA 3ZDAA 5DDMA 4XRHA 5J8YA 5ALNA 3BJYA 5KG0A 2C28A 3Q8QB 8ICOA 2B21A 1XO1A 5ALFA 2E8NA 3V6HA 2A1AA 3Q8RB 3M1YA 5AKYA 3EWAA 2D3DA 4BXOA 3DDHA 5ALLA 3Q8MA 4DEZA 2A3VA 5J2AA 1K1SA 1COKA 5CEHA 3N97B 5IIKA 2HW3A 1XSNA 1ZXIA 4RNMA 3NRZA 3HKZC 9ICSA 1HEKA 3LVVA 2EZXA 2PKEA 4J03A 5KFWA 4QWEA 5J2EA 5IINA 3CNHA 2CRXA 2HI0A 1ZOLA 9ICNA 4RUAA 1L7OA 4NXZA 1NK7A 1BNOA 1C7YA 4BXOB 5J0QA 2ISPA 3RRGA 1S9FA 3E2EA 3EYZA 1QCKA 3KBBA 4U6PA 2I9GA 5EWGA 4NJ8A 4F93B 2F76X 2YB4A 3AQEA 1ZQCA 1V9PA 2W55A 3V7JA 3K75D 5JRTA 4TQSA 5KFGA 2YMMA 4P0PB 2WB1F 4I2BA 5HP4A 2FJ6A 4KMUA 2Y9UA 1HUZA 2KVSA 2KE7A 2JEGA 2OYYA 3BQTA 4IQUA 8ICSA 1ZQJA 5KFRA 3UXNA 4ED2A 3O0FA 3PW2A 1ZQMA 3PSFA 5E79U 2EAMA 3WKCA 3F2BA 5KFPA 5KAIU 3WK4A 4Q43A 4DS5A 1S0OA 3BDPA 2EAPA 4J9PA 3MGIA 1FFVA 5ALZA 2K4EA 1NZPA 5KG5A 3L5KA 1RQNA 3QX7A 2LMRA 4GIBA 1LVHA 7ICLA 4QZAA 2ZIVB 5KFOA 4DQRA 5ALXA 3H7IA 1RXVA 2HDOA 3D6JA 4I2CA 7ICGA 2MA1A 4RUCA 3V6JA 3HKZF 3QZ8A 1JX4A 8ICRA 4NLNA 1BPYA 1WUDA 1C20A 5BOLA 2HHUA 2FLNA 1ZD3A 2JHDA 4ICAA 4NLCA 2W43A 4K4IA 1MC8A 4Y2TA 2F1JA 2KHVA 4Z6EA 5ALDA 2XC9A 4DSJA 2KVCA 2RDIA 2VKQA 1N5WA 1NK9A 2BPFA 4I2FA 4ED6A 3B0XA 2OXOA 2KJ8A 5DG8A 1N56A 4ZOHC 4NM1A 4B9VA 1DGSA 2HOFA 4MHVA 1L3SA 4M9HA 3QEBZ 4AP9A 3QEAZ 1IIPA 1KQQA 4I2AA 1ZJNA 1SKSA 3RB0A 4USAA 2KZZA 2NO5A 8ICVA 1IV8A 4K4HA 5KFBA 2YTUA 1SGGA 2BPCA 4KLMA 5IIIA 5J0YA 2E5SA 8ICLA 1KFSA 1EXNA 3N28A 1UT5A 2LYAA 8ICBA 4TUSA 5AKEA 2ZJ8A 4CRXA 2NO4A 4YVZA 1HIWA 2PFQA 3GIJA 3LWMA 1KFTA 1ZYQA 3TFRA 2EQYA 2FI1A 2P35A 4B9LA 1O08A 4MFCA 1QQ7A 5ALEA 3UXPA 2JEIA 3H0LB 2DKXA 3RRHA 4RZRA 2JGAA 4EEKA 8ICFA 4F4YA 2DKZA 1H38A 4IQWA 3KHHA 2W9BB 4F71A 3OPXA 1J2NA 4BDPA 5EOZA 3PMLA 1KBUA 2ZTDA 3Q8KA 5DGAA 3TANA 4IR1A 5EE9A 4KX5A 2IA6A 4UAWA 4Q8EA 4M9LA 5J0WA 2KEYA 4PZNA 3NVYA 1ZD2P 1U45A 3ZDDA 4FBTA 2G5HB 1U4BA 1Z19A 5DG9A 2J6TA 4YMNA 4O3MA 1NI3A 4C0ZA 3OSNA 5KFQA 5KFYA 4DOCA 2JEJA 1CEZA 2IBKA 4KLUA 2M9NA 4QZ9A 4GXKA 4NL9A 2RLTA 5JTIA 1T3NA 4IL6U 2QKQA 2J6UA 4UBCA 1Z4NA 5D46A 2WB1C 3RTVA 4B9SA 4OJLA 1NJXA 2EDUA 4DSEA 1SIJA 3D2QA 5ALUA 2BR0A 3ALRA 2P6RA 3M9MB 3C21A 1NKEA 2KSOB 5ALQA 2ODGA 1X6JA 2QB0B 3MBYA 5CJ7A 1S76D 1AQ6A 1K1QA 5ALKA 1SXEA 3ZD8A 3UMCA 2YB1A 5KFKA 4F5PA 2EH9A 1SKRA 2FPLA 4CCHA 4YD1A 3NVVA 2ZTCA 9ICQA 1UPHA 1ZRNA 4Z6DA 2KHQA 3HILA 4QW9A 8ICMA 1SL2A 1RYUA 3EW9A 2CN1A 5AM5A 8ICTA 2BDUA 2HBKA 4C8MA 3JPOA 1ZQDA 4PL2A 4MFFA 4YXMA 1TK0A 2W9CA 1D8YA 1X40A 3T3FA 4YMOA 1ZQGA 2MU2A 4US8A 1WWVA 1HJPA 4KLGA 4P4OA 1TAUA 3F53A 8ICPA 4BUGA 4KLJA 7ICUA 2K60A 5C5JA 5KFCA 3U26A 2ZTEA 3TQ1A 1BPBA 4KLLA 1A76A 4LZGA 9ICAA 2YX8A 5G5HA 2XY7A 4EEYA 1UQVA 5TISU 3RFAA 5J29A 3PX0A 8ICEA 3PY8A 3VCBA 3M7DA 4M04A 1PZNA 5ALMA 3QU5A 3WK9A 4KLHA 4Y2RA 5HNKA 4GFJA 2LKYA 3KHRA 1L3UA 2NYVA 4CDGA 4I29A 1ZQSA 4Y2XA 4OO1J 1BPZA 1YZ7A 4X5VA 3TADA 3PSPA 9ICGA 3UQ2A 3K4GA 1ZJMA 4LVSA 2BHNA 2F44A 2KMDA 2PMZC 4YR0A 1TAQA 4MEXA 3N7RC 1X9XA 4US9A 3TACB 1ZQNA 1PK3A 3KZIU 1L5UA 1ECWA 5HR6A 5ALYA 4RQ3A 1X9MA 1KRPA 1RYSA 3GIMA 4KLOA 1V85A 4CF4A 3JPNA 3MR5A 1PK1B 3QNMA 3ONNA 3V6KA 1RPLA 4ECZA 5J2GA 3M8SA 1X9WA 5HR7A 4M2YA 4JB3A 4I28A 3IG5A 1LV5A 5ALPA 2OEHA 4GC6A 5KFIA 2AJQA 2KFZA 3DV9A 2BQUA 2W8KA 3HPOA 2EANA 5EWFA 4M9NA 4FO6A 8ICXA 2E1EA 3SAFA 4FBUA 2F2AB 2KTQA 3F5EA 3C5FA 4RQ7A 4EYIB 7ICIA 5KT5A 2ZIUB 4C4RA 1WG8A 1DK3A 3NUQA 4QZIA 4DFMA 3H4BA 3JPSA 4PZOA 2Y0SC 3BS7A 2DQNB 4JV2A 3FM9A 1KN5A 2H3IA 1ZQKA 2W7OA 5ALWA 3WKEA 1X2IA 2BZFA 4ECXA 1D8BA 3L3FX 3GIIA 1Z3EB 5ALTA 3RF9A 5KFNA 2GOLA 3ISDA 3AMZA 3IN5A 5L9XA 2P6UA 2KNJA 1KLNA 4QZBA 4KN4A 4J9QA 4F5NA 3M9OB 4QJFB 5AK5A 3ZI4A 3B9JA 1X66A 5AM1A 7ICEA 2HVIA 2FDRA 2O6KA 4ECRA 1ZQVA 1ZETA 2HHVA 1ZQQA 4RQ1A 1QTMA 2H3VA 4O3RA 4QW8A 4IC9A 3GFKB 2L5YA 2E8MA 3KD3A 2EAOA 3PZPA 4PHPA 4A8EA 1NK8A 5KAFU 4YFKA 1JALA 1JMSA 3QE9Y 1XS9D 2C2DA 2WF6A 1L7PA 4RU9A 4EELA 3AL0B 2ASLA 1LKYB 3GU3A 1MA7A 4BJQA 2PMZF 5IIOA 1X42A 4JV1A 4KN7A 5J0OA 2G5IB 4I27A 2DUYA 3QUBA 3OSPA 4P0PA 5AKJA 3PO4A 3LVWA 3EPGA 3C2LA 3RJJA 4BGDA 4UW9A 3CP8A 2Y0SF 4M6WA 3PVXA 2ZUBA 4C4SA 2YMLA 7ICOA 2NRVA 4BWJA 2QB1A 5KFJA 4GC7A 3C1ZA 1XSPA 2AGQA 2BDPA 3SQIA 1COOA 5KL8B 4UB6U 4JV0A 4ECSA 5ALIA 4ED3A 1DXSA 3WK8A 3HW8A 3UPQA 1L3TA 2BCUA 3PW0A 2UVUA 4PGXA 1ZQUA 3RR7A 8ICQA 5AI6A 4DLGA 5AM3A 2K4IA 1PVQA 1S0MA 3KOOA 1PVRA 3C2MA 3AEVA 2WAQF 4J9RA 4JWMA 5F9LA 2ZIWB 1AROP 3QUQA 1T7PA 4Y2VA 3PW5A 3QUCA 1BPDA 1Z00B 5AK4A 2ES6A 8ICUA 2LYBA 3OJUA 2FE9A 1IXRA 4YCXA 7ICRA 2LI6A 4YMMA 4LJXA 3PSIA 2DFLA 3OHBA 5AIAA 1TK8A 2K8AA 2ZUCA 3MR6A 4J9LA 1XWLA 3MFIA 2V4RA 3M6KA 1MQ2A 1N2XA 4PJ0U 3OHAA 3C5GA 3MDAA 3UMBA 4MF8A 4IR9A 2XIDA 4IRKA 4J9OA 2AGOA 1ZQLA 4RQ0A 2F3NA 4XA5A 1L3VA 2VJ4A 2AH5A 2JR5A 5KFVA 3S6JA 5J2KA 3RJHA 1SWVA 2C2RA 9ICCA 4J9MA 2JH1A 5KFEA 1SKWA 3PX6A 5DB6A 4EENA 2ZIVA 4F3OA 1URJA 1M6YA 4KLFA 4TUPA 1S0NA 1B4FA 8ICZA 4Y2PA 1CI4A 3RJKA 1D9FA 5J0PA 4M47A 3AU2A 2WFAA 5AKZA 4KITB 5FP0A 1Q3VA 1ZQAA 2M0NA 4YG2A 3ZDEA 4O3PA 4ED1A 1NJWA 3C28A 2ZUDA 2V4QA 5CA7A 5J2CA 2RRDA 9ICUA 1VLBA 3VC8A 5IILA 2BCRA 4JMUA 3FYHA 3RH5A 4F2SA 1JROA 4QWCA 2F8KA 3Q8LA 4B9MA 4DL7A 1K5OA 3KKAA 4EBEA 4HYKA 1NK4A 3TAPA 5J2IA 3NGDA 1D8LA 3WKBA 4FFDA 4DSLA 1L8LA 5CB1A 4FZMA 2GH1A 1D9DA 4WJ3B 3NTUA 3K1ZA 4P0QA 3KKAC 1XSLA 2KJ5A 4DF4A 3PW4A 5AKGA 3AUOA 5J2DA 3PMNA 4ECYA 1ZD4A 5J2JA 3T5LA 2YQEA 9ICOA 2C2EA 4Y2UA 2R8KA 4ZH4A 4J9KA 4K4GA 1PK1A 1KSPA 3PR5B 4UARA 4MF2A 4R65A 3QU4A 2FPMA 2VIXA 5F3XB 3BS5A 5EE3A 3RH6A 4DFPA 2G09A 3JPTA 1X6IA 4OCZA 1S10A 5KG4A 3SYZA 4NLKA 2PXIA 1XO0A 1KTQA 5DB7A 1N60A 2PFNA 4M9GA 3GV8B 2BCQA 2Q0ZX 4PGQA 4ELVA 3AQFA 2J6SA 1OW5A 4Z6FA 5DB8A 8ICAA 1QSLA 2NRWA 7ICPA 7ICNA 4DL5A 1IG6A 1WCNA 4UB1A 1UA1A 3RB6A 2W3SA 1KW4A 1ZQ1C 4EYHB 4P4PA 5T14A 2Z7JA 3UMGA 2BCSA 1ZQRA 4CF5A 2ZG6A 3T79A 1KFDA 3ISBA 2IOFK 4U7CA 4FS1A 5KFDA 1A0PA 3IV6A 2W9MA 5AICA 1WYGA 5HMMA 1WCLA 5KFHA 4QZHA 4G9BA 3C29A 2IHNA 2KZ3A 1IM4A 3LWLA 7ICVA 1V38A 1N63A 3H8JA 1VDVA 5ALVA 3KHGA 5BOMA 2Y1IA 1B43A 4IRDA 1NOMA 3WKAA 1J97A 5J0RA 4Q44A 4QZGA 2H3FA 3AM9A 4PL1A 4C7ZA 4O5CA 2FMPA 5AM4A 2QB0A 2XGQA 4RT2A 2KFNA 1KKXA 2FPKA 5KFSA 4TQRA 3H8MA 2V9WA 5AI5A 1S97A 4EX6A 2JXJA 4FE3A 3F5AA 1Q3UA 4NV0A 1Y88A 1ZQWA 4NM2A 5AKHA 5CRXA 1QSYA 3IG8A 3SAHA 5AM0A 8ICJA 2MSNA 5K4LA 3WK7A 4OJ6A 8ICNA 4QWAA 2G08A 5C0YA 4DFDA 1NZBA 1Z00A 3T5HA 5DKWA 1LKYA 4NLGA 1B22A 2HBMA 3UQ0A 3BZKA 3GQCA 2Y9TA 2DPJA 4R66A 2A1JB 4J9SA 2HVHA 4ECTA 3ZD9A 4QZDA 1XC9A 2JZBA 4GXJA 4DS4A 5L1MA 3G6YA 3V7KA 2KOBA 2KZMA 1LB2B 1JRPA 5J2BA 3UM9A 4F92B 3Q8SB 1MQ3A 4PHAA 4KLIA 5HHHA 4UB3A 2BQRA 3BQ0A 3E0FA 2XI9A 2ASJA 2R18A 1QH9A 5JUMA 4NWIA 1U48A 5KG7A 4ELTA 3JPQA 5J0TA 4RQ6A 1N5XA 2K8BB 4B6JA 1RDFA 1TKDA 2YMQA 4NY8A 5KT6A 1WWUA 3IP4B 1SL1A 2WF9A 5GTIU 4I2IA 2F77X 1ZQZA 4OJ5A 5ALRA 2W9AA 1RG6A 2MRLA 4UATA 3AN1A 2XCAA 4M0AA 2KG5A 1QQ6A 4RQ4A 5ALGA 8ICKA 4O9MA 4F5OA 3MC1A 3PR4A 5B66U 4DQPA 2PI5A 3E58A 4RPXA 1ZRMA 1YZ6A 3H40A 3SMVA 2DBYA 5DLFA 1NJYA 4I2DA 2G07A 4QIWC 1QSSA 1ZQPA 3QU9A 2NRTA 2R8IA 2A19A 5JU5A 2VANA 5CR0A 2FMQA 4B9TA 2EZYA 1Z4OA 1CUKA 5DBBA 2HBJA 2ALZA 4DFJA 1P7DA 3QU2A 2WF8A 4OD0A 4KX3A 1QQ5A 4DL3A 2KV2A 2W54A 4TUQA 5ALOA 4C8OA 2WF7A 1JXEA 3JPPA 2I6XA 4C7YA 1T3QA 3KTQA 2R8JA 3GDXA 2JRZA 5KFFA 5AI0A 9ICEA 1A77A 3G6XA 3I1YA 4UAUA 3HRDD 3J81j 2NRZA 3CYMA 2AU0A 4Y2SA 2W9BA 4NLZA 5J2HA 4DL2A 5KFXA 2PFOA 2KSOA 2DWQA 4F5RA 2PFPA 1MSWD 4O0IA 4FZNA 4FS2A 1SXDA 1CRXA 1SV0A 3M9NB 1NKBA 4UB8U 4F50A 4O3OA 1BGXT 4FZLA 4BWMA 2GLEA 2VA8A 1VJ5A 3RBDA 8ICYA 2BCVA 2W11A 3I28A 2HHWA 1ED1A 3QYPA 3MFHA 3ZDBA 3LDAA 5BPCA 3TI0A 4ED0A 2UVRA 2QARA 5IIJA 4ECQA 2CXYA 5KFMA 4R63A 9ICRA 3RR8A 4QWDA 3OGUA 2XY6A 4UB4A 2UVVA 4UBBA 5DQHA 3N7PD
chains in the Genus database with same CATH topology
3K1RB 2F3NA 2E8OA 3H8MA 5JRTA 2D8CA 4MHVA 4NL9A 1PK1A 5JTIA 1B0XA 1UCVA 2QKQA 2Y9UA 2KE7A 4PZOA 5JU5A 3BQ7A 3BS7A 5F3XB 3BS5A 1B4FA 2QB1A 2EAMA 2DL0A 2YTUA 4RQMA 3TADA 2KSOB 1SGGA 3SENA 2KIVA 1SV0C 2QB0B 1LKYA 2F44A 2KMDA 3BS5B 1DXSA 5J8YA 2EAPA 3IDWA 1OW5A 1SXEA 1X9XA 2Y9TA 3TACB 4IS7A 1PK3A 5KNIA 2JV3A 2LMRA 2E8NA 1X66A 1KW4A 1Z1VA 1OXJA 2D3DA 3HILA 1V85A 5L1MA 2DKXA 1PK1B 1F0MA 2ESEA 2KSOA 2L5YA 2E8MA 2DKZA 1COKA 1SXDA 1SV0A 2ES6A 2F8KA 2EAOA 2FE9A 1X40A 2E8PA 2B6GA 3SEIA 3KKAA 2GLEA 2LPEA 2K4PA 1WWVA 1V38A 2QARB 2K60A 1LKYB 1SV4A 5J8YC 4RQNA 4PZNA 2QARA 4NL9C 1WWUA 3KKAC 2EANA 1JI7A 3TADC 1RG6A 4NJ8A 1UQVA 2KG5A 2QB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1R B;  2F3N A;  2E8O A;  3H8M A;  5JRT A;  2D8C A;  4MHV A;  4NL9 A;  1PK1 A;  5JTI A;  1B0X A;  1UCV A;  2QKQ A;  2Y9U A;  2KE7 A;  4PZO A;  5JU5 A;  3BQ7 A;  3BS7 A;  5F3X B;  3BS5 A;  1B4F A;  2QB1 A;  2EAM A;  2DL0 A;  2YTU A;  4RQM A;  3TAD A;  2KSO B;  1SGG A;  3SEN A;  2KIV A;  1SV0 C;  2QB0 B;  1LKY A;  2F44 A;  2KMD A;  3BS5 B;  1DXS A;  5J8Y A;  2EAP A;  3IDW A;  1OW5 A;  1SXE A;  1X9X A;  2Y9T A;  3TAC B;  4IS7 A;  1PK3 A;  5KNI A;  2JV3 A;  2LMR A;  2E8N A;  1X66 A;  1KW4 A;  1Z1V A;  1OXJ A;  2D3D A;  3HIL A;  1V85 A;  5L1M A;  2DKX A;  1PK1 B;  1F0M A;  2ESE A;  2KSO A;  2L5Y A;  2E8M A;  2DKZ A;  1COK A;  1SXD A;  1SV0 A;  2ES6 A;  2F8K A;  2EAO A;  2FE9 A;  1X40 A;  2E8P A;  2B6G A;  3SEI A;  3KKA A;  2GLE A;  2LPE A;  2K4P A;  1WWV A;  1V38 A;  2QAR B;  2K60 A;  1LKY B;  1SV4 A;  5J8Y C;  4RQN A;  4PZN A;  2QAR A;  4NL9 C;  1WWU A;  3KKA C;  2EAN A;  1JI7 A;  3TAD C;  1RG6 A;  4NJ8 A;  1UQV A;  2KG5 A;  2QB0 A; 
#chains in the Genus database with same CATH topology
 4OJP A;  2BKE A;  3ORY A;  3C1Y A;  3SAG A;  8ICW A;  3SR6 A;  2KN7 A;  2D8C A;  3MAB A;  3EZ5 A;  1ZQH A;  4M6W B;  2WAQ C;  4CE6 A;  1B0X A;  4O3Q A;  2WTF A;  5AK3 A;  4QZ8 A;  3IHQ B;  4Y2J A;  4DOA A;  1NJZ A;  4DWI A;  4DQI A;  9ICV A;  4DF8 A;  1SZP A;  3RBE A;  1DRG A;  4ELU A;  1FIQ A;  3KHL A;  1SZH A;  9ICM A;  4O3N A;  7ICJ A;  4RQM A;  1S77 D;  5DBA A;  2W8L A;  2IHM A;  1SV0 C;  1T94 A;  4NLB A;  4GLX A;  2BPG A;  1Q46 A;  1ZQX A;  3EUB 2;  1BNP A;  1T4G A;  3IDW A;  5CWR A;  5AKK A;  3BZC A;  1NNL A;  1FO4 A;  4ECU A;  1RXW A;  2LBO A;  4JWN A;  2K4H A;  7ICH A;  2WF5 A;  2XVT A;  2RP5 A;  4R64 A;  3HX0 A;  4XUS A;  2NV3 A;  4RPZ A;  2ZJA A;  3ICX A;  4DQQ A;  3TFS A;  2VA2 A;  1Q8K A;  4QIW F;  2HHT A;  1S0V A;  5GTH U;  4RNN A;  5KG2 A;  3GV7 B;  4QNL A;  5AM2 A;  4KLE A;  4YR3 A;  5HHI A;  2LPE A;  4JUZ A;  4EZ9 A;  3ISC A;  4IQV A;  5B5E U;  2W9C B;  4QWB A;  3RJI A;  3THV A;  4PPX A;  3WU2 U;  1TV9 A;  4RQN A;  1ZQT A;  5KG1 A;  4YXJ A;  5AIB A;  2OHF A;  3JPR A;  2P66 A;  2R8G A;  5KFL A;  4CNQ A;  4MFA A;  3OJS A;  2LHT A;  4BX9 C;  4UB2 A;  1TE2 A;  2AHO B;  2JZB B;  3CRX A;  2ZJ5 A;  9ICI A;  1RM6 C;  1UT8 A;  4Z6C A;  3AU6 A;  5F9N A;  8ICI A;  1UCV A;  2A1J A;  5KT4 A;  3L4P A;  3HP6 A;  4R8U A;  9ICF A;  1KL9 A;  1FEZ A;  3GIL A;  4LZD A;  2HSZ A;  1L6N A;  5DLG A;  7ICF A;  2FLP A;  3ETL A;  2KIW A;  2H5X A;  3V7L A;  2F1H A;  4RQ2 A;  3IRU A;  2N1R A;  1N48 A;  3R9K A;  2OWO A;  1BPE A;  1HUO A;  1KDH A;  2C22 A;  1KEJ A;  3M8R A;  4F4K A;  2R8H A;  4RT3 A;  4PH5 A;  2JV3 A;  3SZ2 A;  5EWE A;  4ED8 A;  3NS1 A;  1F44 A;  2VA3 A;  1X9S A;  4F4W A;  4R8U B;  4PGY A;  4YR2 A;  1DK2 A;  3IM1 A;  3N7S C;  4PHD A;  4I2E A;  2KK0 A;  2W3R A;  1F0M A;  4DLE A;  4I2H A;  2H3Z A;  2Y1J A;  2B6G A;  2HCF A;  4Q45 A;  3EPI A;  4C8N A;  4DO9 A;  2MUT B;  3PNC A;  4RQ8 A;  3RB3 A;  2F8L A;  4DSI A;  5DB9 A;  4ED7 A;  3H8W A;  1SL0 A;  4UAV A;  2YMP A;  1DOQ A;  4UAZ A;  3LK9 A;  5AI4 A;  4F8R A;  3WK5 A;  4NL9 C;  2W7P A;  2UVW A;  3TAD C;  1DGJ A;  5DQI A;  2E1F A;  4Y2Q A;  4ECV A;  3SD7 A;  3BQ1 A;  5AI9 A;  2I5H A;  4QZF A;  2E8O A;  4IQT A;  5CHG A;  2I1Q A;  2ZIU A;  2RQ5 A;  1MN8 A;  3PX4 A;  3RAX A;  3N4M B;  1PVP A;  4UAY A;  2MUT A;  5HML A;  4DCC A;  1ZQB A;  5ALS A;  4Y2Y A;  1TVA A;  1U9L A;  4E0D A;  2W03 A;  3SEN A;  2RDJ A;  4TUR A;  3T5K A;  3BQ2 A;  5DQG A;  3PO5 A;  3HWT A;  3BS5 B;  5L1K A;  2DGZ A;  3LYS A;  5TZV A;  5J0X A;  5KNI A;  4YN4 A;  4F72 A;  5KTQ A;  9ICX A;  2B0C A;  9ICK A;  1UHU A;  1A6S A;  4P0Q B;  1L8O A;  2KP7 A;  3TKA A;  1U47 A;  2XCP A;  3GV5 B;  1RYR A;  4F4Z A;  4AYB F;  4IRC A;  5KT3 A;  3NAS A;  4KTQ A;  3KZX A;  2Q4T A;  2E8P A;  2JEF A;  4KLT A;  3SEI A;  2KD1 A;  4F4X A;  1S5L U;  5EE1 A;  3QXG A;  3MGH A;  4I2J A;  4DFK A;  4EBD A;  2GO7 A;  2RHF A;  5ALJ A;  5AI8 A;  5KL1 B;  5J8Y C;  1SV4 A;  4DL4 A;  9ICT A;  5A0L A;  3HJE A;  2PI4 A;  2AXT U;  4KLD A;  2K89 A;  5D4B A;  2LM4 A;  2W04 A;  4EBC A;  3RB4 A;  1ZQI A;  3ED5 A;  2JMG A;  7ICT A;  5EE0 A;  2LYH A;  4CF3 A;  2ZXI A;  1S8O A;  2G06 A;  3RAQ A;  5AKL A;  2XGP A;  1ZQY A;  3CW2 C;  3QZ7 A;  4KMO B;  4CGZ A;  5KT7 A;  1UA0 A;  1TK5 A;  5J0U A;  2XO7 A;  5AK6 A;  5L1L A;  2KIV A;  1Z1B A;  2KIC A;  4XQ8 A;  8ICG A;  4F5Q A;  3GZF A;  2AQ0 A;  4QZE A;  2AGP A;  2BGW A;  2KKP A;  3OTQ A;  2ZIW A;  1XU4 A;  9ICJ A;  1F5S A;  2ISO A;  3DEE A;  4O5K A;  3MR3 A;  2GWS A;  3ETR A;  5KFZ A;  3A0B U;  1OXJ A;  5H2F U;  1QLN A;  5CP2 A;  4DL6 A;  2ESE A;  4B9U A;  5DGB A;  2CPR A;  3WKD A;  2HHS A;  5L1I A;  5KFT A;  1JUD A;  3RH4 A;  4KLQ A;  4EX7 A;  4P4M A;  3PW7 A;  3PST A;  2K4P A;  1N61 A;  4YP3 A;  2NRX A;  4DQS A;  4G3I A;  3H0M B;  1L7M A;  8ICC A;  2AQ4 A;  3MR2 A;  2IMW P;  3FC4 A;  1TFR A;  5AKX A;  3FDS A;  3B0Y A;  2ASD A;  2VJ5 A;  1NK6 A;  4UAS A;  5L1J A;  3QUT A;  2ZIX A;  2OM6 A;  4MEY A;  1V97 A;  3WK6 A;  3KFU F;  1SB3 C;  3SV3 A;  3H4D A;  2E3T A;  5D49 A;  1NK0 A;  4M9J A;  4ACO A;  5KG3 A;  3RJG A;  7ICK A;  1YT3 A;  2MAX A;  4DOB A;  1NKC A;  3RJF A;  3BQ7 A;  2KKV A;  3V72 A;  5ALH A;  2HHX A;  4I2G A;  5DG7 A;  4B9N A;  3A0H U;  1RZT A;  2OCE A;  2D6F C;  3H0R B;  5IIM A;  2ZXH A;  1SWW A;  3GIK A;  2F1I A;  2G0A A;  3PV8 A;  2HMX A;  3NVZ A;  1PUZ A;  9ICW A;  1OUQ A;  3F2C A;  2DPI A;  2HOQ A;  2XIC A;  4P2H A;  9ICP A;  2YN4 A;  4F2R A;  1N62 A;  4IS7 A;  5KFA A;  4RQ5 A;  2YY6 A;  3NRW A;  1T8E A;  5J2F A;  2LM1 A;  1J2M A;  4PHE A;  1L7N A;  1Z1V A;  3F2D A;  4RNO A;  5KFU A;  4UB5 A;  4DSK A;  3T5J A;  2JH7 A;  4YD2 A;  2HOI A;  4C8K A;  4KLS A;  1BVS A;  3C23 A;  3SV4 A;  1ZQO A;  4OJO A;  2FLL A;  3ZDC A;  5G5G A;  4O3S A;  1XNS A;  7ICQ A;  2IOF A;  4YQW A;  3HT3 A;  5J0S A;  2QLT A;  4RPY A;  2OH2 A;  4GXI A;  1JXL A;  4AYB C;  3D2N A;  1TAM A;  3UXO A;  5DDY A;  3RJE A;  9ICL A;  4UQG A;  4O5E A;  5AHX A;  1GO3 F;  4ECW A;  3MDC A;  2XY5 A;  3M6Z A;  3C2K A;  2QAR B;  1NK5 A;  1ZD5 A;  5DBC A;  4Q8F A;  2K8C B;  2DF4 B;  4C4T A;  1JN3 A;  1U49 A;  2IOH A;  7ICS A;  1JI7 A;  4F91 B;  1O03 A;  2ATL A;  3G6V A;  1BPX A;  9ICB A;  3H8S A;  3SI8 A;  3K1R B;  3I76 A;  3NVW A;  2H3Q A;  1JIH A;  4JK1 A;  4DSF A;  3TAR A;  7ICM A;  3D2S A;  1RQL A;  2ZIX B;  8ICH A;  2EZZ A;  1ZQF A;  2HBL A;  3TAQ A;  3Q8P B;  5KG6 A;  4C80 A;  4C8L A;  2BQ3 A;  1FFU A;  4EZ6 A;  4J9N A;  3QU7 A;  2WHE A;  5AKI A;  4QZC A;  3FAH A;  5KT2 A;  4HAI A;  9ICH A;  2DL0 A;  3MGV A;  1ZQE A;  2HHQ A;  2KJ9 A;  2FMS A;  3ZDA A;  5DDM A;  4XRH A;  5J8Y A;  5ALN A;  3BJY A;  5KG0 A;  2C28 A;  3Q8Q B;  8ICO A;  2B21 A;  1XO1 A;  5ALF A;  2E8N A;  3V6H A;  2A1A A;  3Q8R B;  3M1Y A;  5AKY A;  3EWA A;  2D3D A;  4BXO A;  3DDH A;  5ALL A;  3Q8M A;  4DEZ A;  2A3V A;  5J2A A;  1K1S A;  1COK A;  5CEH A;  3N97 B;  5IIK A;  2HW3 A;  1XSN A;  1ZXI A;  4RNM A;  3NRZ A;  3HKZ C;  9ICS A;  1HEK A;  3LVV A;  2EZX A;  2PKE A;  4J03 A;  5KFW A;  4QWE A;  5J2E A;  5IIN A;  3CNH A;  2CRX A;  2HI0 A;  1ZOL A;  9ICN A;  4RUA A;  1L7O A;  4NXZ A;  1NK7 A;  1BNO A;  1C7Y A;  4BXO B;  5J0Q A;  2ISP A;  3RRG A;  1S9F A;  3E2E A;  3EYZ A;  1QCK A;  3KBB A;  4U6P A;  2I9G A;  5EWG A;  4NJ8 A;  4F93 B;  2F76 X;  2YB4 A;  3AQE A;  1ZQC A;  1V9P A;  2W55 A;  3V7J A;  3K75 D;  5JRT A;  4TQS A;  5KFG A;  2YMM A;  4P0P B;  2WB1 F;  4I2B A;  5HP4 A;  2FJ6 A;  4KMU A;  2Y9U A;  1HUZ A;  2KVS A;  2KE7 A;  2JEG A;  2OYY A;  3BQT A;  4IQU A;  8ICS A;  1ZQJ A;  5KFR A;  3UXN A;  4ED2 A;  3O0F A;  3PW2 A;  1ZQM A;  3PSF A;  5E79 U;  2EAM A;  3WKC A;  3F2B A;  5KFP A;  5KAI U;  3WK4 A;  4Q43 A;  4DS5 A;  1S0O A;  3BDP A;  2EAP A;  4J9P A;  3MGI A;  1FFV A;  5ALZ A;  2K4E A;  1NZP A;  5KG5 A;  3L5K A;  1RQN A;  3QX7 A;  2LMR A;  4GIB A;  1LVH A;  7ICL A;  4QZA A;  2ZIV B;  5KFO A;  4DQR A;  5ALX A;  3H7I A;  1RXV A;  2HDO A;  3D6J A;  4I2C A;  7ICG A;  2MA1 A;  4RUC A;  3V6J A;  3HKZ F;  3QZ8 A;  1JX4 A;  8ICR A;  4NLN A;  1BPY A;  1WUD A;  1C20 A;  5BOL A;  2HHU A;  2FLN A;  1ZD3 A;  2JHD A;  4ICA A;  4NLC A;  2W43 A;  4K4I A;  1MC8 A;  4Y2T A;  2F1J A;  2KHV A;  4Z6E A;  5ALD A;  2XC9 A;  4DSJ A;  2KVC A;  2RDI A;  2VKQ A;  1N5W A;  1NK9 A;  2BPF A;  4I2F A;  4ED6 A;  3B0X A;  2OXO A;  2KJ8 A;  5DG8 A;  1N56 A;  4ZOH C;  4NM1 A;  4B9V A;  1DGS A;  2HOF A;  4MHV A;  1L3S A;  4M9H A;  3QEB Z;  4AP9 A;  3QEA Z;  1IIP A;  1KQQ A;  4I2A A;  1ZJN A;  1SKS A;  3RB0 A;  4USA A;  2KZZ A;  2NO5 A;  8ICV A;  1IV8 A;  4K4H A;  5KFB A;  2YTU A;  1SGG A;  2BPC A;  4KLM A;  5III A;  5J0Y A;  2E5S A;  8ICL A;  1KFS A;  1EXN A;  3N28 A;  1UT5 A;  2LYA A;  8ICB A;  4TUS A;  5AKE A;  2ZJ8 A;  4CRX A;  2NO4 A;  4YVZ A;  1HIW A;  2PFQ A;  3GIJ A;  3LWM A;  1KFT A;  1ZYQ A;  3TFR A;  2EQY A;  2FI1 A;  2P35 A;  4B9L A;  1O08 A;  4MFC A;  1QQ7 A;  5ALE A;  3UXP A;  2JEI A;  3H0L B;  2DKX A;  3RRH A;  4RZR A;  2JGA A;  4EEK A;  8ICF A;  4F4Y A;  2DKZ A;  1H38 A;  4IQW A;  3KHH A;  2W9B B;  4F71 A;  3OPX A;  1J2N A;  4BDP A;  5EOZ A;  3PML A;  1KBU A;  2ZTD A;  3Q8K A;  5DGA A;  3TAN A;  4IR1 A;  5EE9 A;  4KX5 A;  2IA6 A;  4UAW A;  4Q8E A;  4M9L A;  5J0W A;  2KEY A;  4PZN A;  3NVY A;  1ZD2 P;  1U45 A;  3ZDD A;  4FBT A;  2G5H B;  1U4B A;  1Z19 A;  5DG9 A;  2J6T A;  4YMN A;  4O3M A;  1NI3 A;  4C0Z A;  3OSN A;  5KFQ A;  5KFY A;  4DOC A;  2JEJ A;  1CEZ A;  2IBK A;  4KLU A;  2M9N A;  4QZ9 A;  4GXK A;  4NL9 A;  2RLT A;  5JTI A;  1T3N A;  4IL6 U;  2QKQ A;  2J6U A;  4UBC A;  1Z4N A;  5D46 A;  2WB1 C;  3RTV A;  4B9S A;  4OJL A;  1NJX A;  2EDU A;  4DSE A;  1SIJ A;  3D2Q A;  5ALU A;  2BR0 A;  3ALR A;  2P6R A;  3M9M B;  3C21 A;  1NKE A;  2KSO B;  5ALQ A;  2ODG A;  1X6J A;  2QB0 B;  3MBY A;  5CJ7 A;  1S76 D;  1AQ6 A;  1K1Q A;  5ALK A;  1SXE A;  3ZD8 A;  3UMC A;  2YB1 A;  5KFK A;  4F5P A;  2EH9 A;  1SKR A;  2FPL A;  4CCH A;  4YD1 A;  3NVV A;  2ZTC A;  9ICQ A;  1UPH A;  1ZRN A;  4Z6D A;  2KHQ A;  3HIL A;  4QW9 A;  8ICM A;  1SL2 A;  1RYU A;  3EW9 A;  2CN1 A;  5AM5 A;  8ICT A;  2BDU A;  2HBK A;  4C8M A;  3JPO A;  1ZQD A;  4PL2 A;  4MFF A;  4YXM A;  1TK0 A;  2W9C A;  1D8Y A;  1X40 A;  3T3F A;  4YMO A;  1ZQG A;  2MU2 A;  4US8 A;  1WWV A;  1HJP A;  4KLG A;  4P4O A;  1TAU A;  3F53 A;  8ICP A;  4BUG A;  4KLJ A;  7ICU A;  2K60 A;  5C5J A;  5KFC A;  3U26 A;  2ZTE A;  3TQ1 A;  1BPB A;  4KLL A;  1A76 A;  4LZG A;  9ICA A;  2YX8 A;  5G5H A;  2XY7 A;  4EEY A;  1UQV A;  5TIS U;  3RFA A;  5J29 A;  3PX0 A;  8ICE A;  3PY8 A;  3VCB A;  3M7D A;  4M04 A;  1PZN A;  5ALM A;  3QU5 A;  3WK9 A;  4KLH A;  4Y2R A;  5HNK A;  4GFJ A;  2LKY A;  3KHR A;  1L3U A;  2NYV A;  4CDG A;  4I29 A;  1ZQS A;  4Y2X A;  4OO1 J;  1BPZ A;  1YZ7 A;  4X5V A;  3TAD A;  3PSP A;  9ICG A;  3UQ2 A;  3K4G A;  1ZJM A;  4LVS A;  2BHN A;  2F44 A;  2KMD A;  2PMZ C;  4YR0 A;  1TAQ A;  4MEX A;  3N7R C;  1X9X A;  4US9 A;  3TAC B;  1ZQN A;  1PK3 A;  3KZI U;  1L5U A;  1ECW A;  5HR6 A;  5ALY A;  4RQ3 A;  1X9M A;  1KRP A;  1RYS A;  3GIM A;  4KLO A;  1V85 A;  4CF4 A;  3JPN A;  3MR5 A;  1PK1 B;  3QNM A;  3ONN A;  3V6K A;  1RPL A;  4ECZ A;  5J2G A;  3M8S A;  1X9W A;  5HR7 A;  4M2Y A;  4JB3 A;  4I28 A;  3IG5 A;  1LV5 A;  5ALP A;  2OEH A;  4GC6 A;  5KFI A;  2AJQ A;  2KFZ A;  3DV9 A;  2BQU A;  2W8K A;  3HPO A;  2EAN A;  5EWF A;  4M9N A;  4FO6 A;  8ICX A;  2E1E A;  3SAF A;  4FBU A;  2F2A B;  2KTQ A;  3F5E A;  3C5F A;  4RQ7 A;  4EYI B;  7ICI A;  5KT5 A;  2ZIU B;  4C4R A;  1WG8 A;  1DK3 A;  3NUQ A;  4QZI A;  4DFM A;  3H4B A;  3JPS A;  4PZO A;  2Y0S C;  3BS7 A;  2DQN B;  4JV2 A;  3FM9 A;  1KN5 A;  2H3I A;  1ZQK A;  2W7O A;  5ALW A;  3WKE A;  1X2I A;  2BZF A;  4ECX A;  1D8B A;  3L3F X;  3GII A;  1Z3E B;  5ALT A;  3RF9 A;  5KFN A;  2GOL A;  3ISD A;  3AMZ A;  3IN5 A;  5L9X A;  2P6U A;  2KNJ A;  1KLN A;  4QZB A;  4KN4 A;  4J9Q A;  4F5N A;  3M9O B;  4QJF B;  5AK5 A;  3ZI4 A;  3B9J A;  1X66 A;  5AM1 A;  7ICE A;  2HVI A;  2FDR A;  2O6K A;  4ECR A;  1ZQV A;  1ZET A;  2HHV A;  1ZQQ A;  4RQ1 A;  1QTM A;  2H3V A;  4O3R A;  4QW8 A;  4IC9 A;  3GFK B;  2L5Y A;  2E8M A;  3KD3 A;  2EAO A;  3PZP A;  4PHP A;  4A8E A;  1NK8 A;  5KAF U;  4YFK A;  1JAL A;  1JMS A;  3QE9 Y;  1XS9 D;  2C2D A;  2WF6 A;  1L7P A;  4RU9 A;  4EEL A;  3AL0 B;  2ASL A;  1LKY B;  3GU3 A;  1MA7 A;  4BJQ A;  2PMZ F;  5IIO A;  1X42 A;  4JV1 A;  4KN7 A;  5J0O A;  2G5I B;  4I27 A;  2DUY A;  3QUB A;  3OSP A;  4P0P A;  5AKJ A;  3PO4 A;  3LVW A;  3EPG A;  3C2L A;  3RJJ A;  4BGD A;  4UW9 A;  3CP8 A;  2Y0S F;  4M6W A;  3PVX A;  2ZUB A;  4C4S A;  2YML A;  7ICO A;  2NRV A;  4BWJ A;  2QB1 A;  5KFJ A;  4GC7 A;  3C1Z A;  1XSP A;  2AGQ A;  2BDP A;  3SQI A;  1COO A;  5KL8 B;  4UB6 U;  4JV0 A;  4ECS A;  5ALI A;  4ED3 A;  1DXS A;  3WK8 A;  3HW8 A;  3UPQ A;  1L3T A;  2BCU A;  3PW0 A;  2UVU A;  4PGX A;  1ZQU A;  3RR7 A;  8ICQ A;  5AI6 A;  4DLG A;  5AM3 A;  2K4I A;  1PVQ A;  1S0M A;  3KOO A;  1PVR A;  3C2M A;  3AEV A;  2WAQ F;  4J9R A;  4JWM A;  5F9L A;  2ZIW B;  1ARO P;  3QUQ A;  1T7P A;  4Y2V A;  3PW5 A;  3QUC A;  1BPD A;  1Z00 B;  5AK4 A;  2ES6 A;  8ICU A;  2LYB A;  3OJU A;  2FE9 A;  1IXR A;  4YCX A;  7ICR A;  2LI6 A;  4YMM A;  4LJX A;  3PSI A;  2DFL A;  3OHB A;  5AIA A;  1TK8 A;  2K8A A;  2ZUC A;  3MR6 A;  4J9L A;  1XWL A;  3MFI A;  2V4R A;  3M6K A;  1MQ2 A;  1N2X A;  4PJ0 U;  3OHA A;  3C5G A;  3MDA A;  3UMB A;  4MF8 A;  4IR9 A;  2XID A;  4IRK A;  4J9O A;  2AGO A;  1ZQL A;  4RQ0 A;  2F3N A;  4XA5 A;  1L3V A;  2VJ4 A;  2AH5 A;  2JR5 A;  5KFV A;  3S6J A;  5J2K A;  3RJH A;  1SWV A;  2C2R A;  9ICC A;  4J9M A;  2JH1 A;  5KFE A;  1SKW A;  3PX6 A;  5DB6 A;  4EEN A;  2ZIV A;  4F3O A;  1URJ A;  1M6Y A;  4KLF A;  4TUP A;  1S0N A;  1B4F A;  8ICZ A;  4Y2P A;  1CI4 A;  3RJK A;  1D9F A;  5J0P A;  4M47 A;  3AU2 A;  2WFA A;  5AKZ A;  4KIT B;  5FP0 A;  1Q3V A;  1ZQA A;  2M0N A;  4YG2 A;  3ZDE A;  4O3P A;  4ED1 A;  1NJW A;  3C28 A;  2ZUD A;  2V4Q A;  5CA7 A;  5J2C A;  2RRD A;  9ICU A;  1VLB A;  3VC8 A;  5IIL A;  2BCR A;  4JMU A;  3FYH A;  3RH5 A;  4F2S A;  1JRO A;  4QWC A;  2F8K A;  3Q8L A;  4B9M A;  4DL7 A;  1K5O A;  3KKA A;  4EBE A;  4HYK A;  1NK4 A;  3TAP A;  5J2I A;  3NGD A;  1D8L A;  3WKB A;  4FFD A;  4DSL A;  1L8L A;  5CB1 A;  4FZM A;  2GH1 A;  1D9D A;  4WJ3 B;  3NTU A;  3K1Z A;  4P0Q A;  3KKA C;  1XSL A;  2KJ5 A;  4DF4 A;  3PW4 A;  5AKG A;  3AUO A;  5J2D A;  3PMN A;  4ECY A;  1ZD4 A;  5J2J A;  3T5L A;  2YQE A;  9ICO A;  2C2E A;  4Y2U A;  2R8K A;  4ZH4 A;  4J9K A;  4K4G A;  1PK1 A;  1KSP A;  3PR5 B;  4UAR A;  4MF2 A;  4R65 A;  3QU4 A;  2FPM A;  2VIX A;  5F3X B;  3BS5 A;  5EE3 A;  3RH6 A;  4DFP A;  2G09 A;  3JPT A;  1X6I A;  4OCZ A;  1S10 A;  5KG4 A;  3SYZ A;  4NLK A;  2PXI A;  1XO0 A;  1KTQ A;  5DB7 A;  1N60 A;  2PFN A;  4M9G A;  3GV8 B;  2BCQ A;  2Q0Z X;  4PGQ A;  4ELV A;  3AQF A;  2J6S A;  1OW5 A;  4Z6F A;  5DB8 A;  8ICA A;  1QSL A;  2NRW A;  7ICP A;  7ICN A;  4DL5 A;  1IG6 A;  1WCN A;  4UB1 A;  1UA1 A;  3RB6 A;  2W3S A;  1KW4 A;  1ZQ1 C;  4EYH B;  4P4P A;  5T14 A;  2Z7J A;  3UMG A;  2BCS A;  1ZQR A;  4CF5 A;  2ZG6 A;  3T79 A;  1KFD A;  3ISB A;  2IOF K;  4U7C A;  4FS1 A;  5KFD A;  1A0P A;  3IV6 A;  2W9M A;  5AIC A;  1WYG A;  5HMM A;  1WCL A;  5KFH A;  4QZH A;  4G9B A;  3C29 A;  2IHN A;  2KZ3 A;  1IM4 A;  3LWL A;  7ICV A;  1V38 A;  1N63 A;  3H8J A;  1VDV A;  5ALV A;  3KHG A;  5BOM A;  2Y1I A;  1B43 A;  4IRD A;  1NOM A;  3WKA A;  1J97 A;  5J0R A;  4Q44 A;  4QZG A;  2H3F A;  3AM9 A;  4PL1 A;  4C7Z A;  4O5C A;  2FMP A;  5AM4 A;  2QB0 A;  2XGQ A;  4RT2 A;  2KFN A;  1KKX A;  2FPK A;  5KFS A;  4TQR A;  3H8M A;  2V9W A;  5AI5 A;  1S97 A;  4EX6 A;  2JXJ A;  4FE3 A;  3F5A A;  1Q3U A;  4NV0 A;  1Y88 A;  1ZQW A;  4NM2 A;  5AKH A;  5CRX A;  1QSY A;  3IG8 A;  3SAH A;  5AM0 A;  8ICJ A;  2MSN A;  5K4L A;  3WK7 A;  4OJ6 A;  8ICN A;  4QWA A;  2G08 A;  5C0Y A;  4DFD A;  1NZB A;  1Z00 A;  3T5H A;  5DKW A;  1LKY A;  4NLG A;  1B22 A;  2HBM A;  3UQ0 A;  3BZK A;  3GQC A;  2Y9T A;  2DPJ A;  4R66 A;  2A1J B;  4J9S A;  2HVH A;  4ECT A;  3ZD9 A;  4QZD A;  1XC9 A;  2JZB A;  4GXJ A;  4DS4 A;  5L1M A;  3G6Y A;  3V7K A;  2KOB A;  2KZM A;  1LB2 B;  1JRP A;  5J2B A;  3UM9 A;  4F92 B;  3Q8S B;  1MQ3 A;  4PHA A;  4KLI A;  5HHH A;  4UB3 A;  2BQR A;  3BQ0 A;  3E0F A;  2XI9 A;  2ASJ A;  2R18 A;  1QH9 A;  5JUM A;  4NWI A;  1U48 A;  5KG7 A;  4ELT A;  3JPQ A;  5J0T A;  4RQ6 A;  1N5X A;  2K8B B;  4B6J A;  1RDF A;  1TKD A;  2YMQ A;  4NY8 A;  5KT6 A;  1WWU A;  3IP4 B;  1SL1 A;  2WF9 A;  5GTI U;  4I2I A;  2F77 X;  1ZQZ A;  4OJ5 A;  5ALR A;  2W9A A;  1RG6 A;  2MRL A;  4UAT A;  3AN1 A;  2XCA A;  4M0A A;  2KG5 A;  1QQ6 A;  4RQ4 A;  5ALG A;  8ICK A;  4O9M A;  4F5O A;  3MC1 A;  3PR4 A;  5B66 U;  4DQP A;  2PI5 A;  3E58 A;  4RPX A;  1ZRM A;  1YZ6 A;  3H40 A;  3SMV A;  2DBY A;  5DLF A;  1NJY A;  4I2D A;  2G07 A;  4QIW C;  1QSS A;  1ZQP A;  3QU9 A;  2NRT A;  2R8I A;  2A19 A;  5JU5 A;  2VAN A;  5CR0 A;  2FMQ A;  4B9T A;  2EZY A;  1Z4O A;  1CUK A;  5DBB A;  2HBJ A;  2ALZ A;  4DFJ A;  1P7D A;  3QU2 A;  2WF8 A;  4OD0 A;  4KX3 A;  1QQ5 A;  4DL3 A;  2KV2 A;  2W54 A;  4TUQ A;  5ALO A;  4C8O A;  2WF7 A;  1JXE A;  3JPP A;  2I6X A;  4C7Y A;  1T3Q A;  3KTQ A;  2R8J A;  3GDX A;  2JRZ A;  5KFF A;  5AI0 A;  9ICE A;  1A77 A;  3G6X A;  3I1Y A;  4UAU A;  3HRD D;  3J81 j;  2NRZ A;  3CYM A;  2AU0 A;  4Y2S A;  2W9B A;  4NLZ A;  5J2H A;  4DL2 A;  5KFX A;  2PFO A;  2KSO A;  2DWQ A;  4F5R A;  2PFP A;  1MSW D;  4O0I A;  4FZN A;  4FS2 A;  1SXD A;  1CRX A;  1SV0 A;  3M9N B;  1NKB A;  4UB8 U;  4F50 A;  4O3O A;  1BGX T;  4FZL A;  4BWM A;  2GLE A;  2VA8 A;  1VJ5 A;  3RBD A;  8ICY A;  2BCV A;  2W11 A;  3I28 A;  2HHW A;  1ED1 A;  3QYP A;  3MFH A;  3ZDB A;  3LDA A;  5BPC A;  3TI0 A;  4ED0 A;  2UVR A;  2QAR A;  5IIJ A;  4ECQ A;  2CXY A;  5KFM A;  4R63 A;  9ICR A;  3RR8 A;  4QWD A;  3OGU A;  2XY6 A;  4UB4 A;  2UVV A;  4UBB A;  5DQH A;  3N7P D; 
#chains in the Genus database with same CATH homology
 3K1R B;  2F3N A;  2E8O A;  3H8M A;  5JRT A;  2D8C A;  4MHV A;  4NL9 A;  1PK1 A;  5JTI A;  1B0X A;  1UCV A;  2QKQ A;  2Y9U A;  2KE7 A;  4PZO A;  5JU5 A;  3BQ7 A;  3BS7 A;  5F3X B;  3BS5 A;  1B4F A;  2QB1 A;  2EAM A;  2DL0 A;  2YTU A;  4RQM A;  3TAD A;  2KSO B;  1SGG A;  3SEN A;  2KIV A;  1SV0 C;  2QB0 B;  1LKY A;  2F44 A;  2KMD A;  3BS5 B;  1DXS A;  5J8Y A;  2EAP A;  3IDW A;  1OW5 A;  1SXE A;  1X9X A;  2Y9T A;  3TAC B;  4IS7 A;  1PK3 A;  5KNI A;  2JV3 A;  2LMR A;  2E8N A;  1X66 A;  1KW4 A;  1Z1V A;  1OXJ A;  2D3D A;  3HIL A;  1V85 A;  5L1M A;  2DKX A;  1PK1 B;  1F0M A;  2ESE A;  2KSO A;  2L5Y A;  2E8M A;  2DKZ A;  1COK A;  1SXD A;  1SV0 A;  2ES6 A;  2F8K A;  2EAO A;  2FE9 A;  1X40 A;  2E8P A;  2B6G A;  3SEI A;  3KKA A;  2GLE A;  2LPE A;  2K4P A;  1WWV A;  1V38 A;  2QAR B;  2K60 A;  1LKY B;  1SV4 A;  5J8Y C;  4RQN A;  4PZN A;  2QAR A;  4NL9 C;  1WWU A;  3KKA C;  2EAN A;  1JI7 A;  3TAD C;  1RG6 A;  4NJ8 A;  1UQV A;  2KG5 A;  2QB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...