2F44A

Crystal structure of the zinc-bound shank sam domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 and multiple ankyrin repeat domains 3
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f44A00
2DL0A 2KIVA 1COKA 1X66A 4PZOA 1V85A 5J8YA 1PK3A 3BQ7A 1F0MA 3KKAA 2ES6A 2EAMA 2QARB 2ESEA 1X9XA 5J8YC 3TACB 4MHVA 1RG6A 2DKZA 3H8MA 3IDWA 1UQVA 1SXEA 3KKAC 4PZNA 2K4PA 1UCVA 1SV0A 3SEIA 4IS7A 1SGGA 2E8PA 2L5YA 4RQMA 4RQNA 2E8OA 3TADA 5JTIA 5L1MA 2Y9UA 1SV0C 2QARA 4NL9A 5F3XB 2GLEA 5KNIA 1LKYB 2QKQA 4NJ8A 1SV4A 2B6GA 4NL9C 2LMRA 1V38A 2KG5A 1OW5A 2E8MA 2Y9TA 2LPEA 1Z1VA 2EAPA 1SXDA 2JV3A 1B0XA 2KE7A 2KSOB 1PK1B 3SENA 1JI7A 1X40A 1B4FA 2D3DA 2D8CA 1LKYA 2F8KA 3K1RB 2FE9A 2EAOA 2QB0B 1WWVA 2QB1A 2DKXA 3TADC 1OXJA 2KMDA 3BS5B 2F3NA 1WWUA 5JRTA 2K60A 1DXSA 2KSOA 1PK1A 2F44A 5JU5A 3BS7A 2QB0A 3HILA 1KW4A 2E8NA 2EANA 2YTUA 3BS5A
chains in the Genus database with same CATH superfamily
2RHFA 3WK6A 2KICA 2KIVA 1SKRA 3SAGA 5KFIA 4Y2PA 2E5SA 4GLXA 5ALJA 2WF9A 4Y2SA 9ICFA 2FMPA 2H3QA 4UQGA 4FZMA 5K4LA 3F2BA 2QLTA 4DEZA 1ZQQA 1NZBA 1SV0A 2ISPA 4CGZA 3ORYA 1H38A 2Y9UA 2HBKA 2PMZC 5F3XB 1D8LA 3CRXA 4DFJA 1RDFA 4CF3A 3QZ8A 3C21A 4JK1A 1D9FA 2B21A 4C8KA 3AQFA 1X2IA 3NVZA 3IRUA 2IA6A 3CP8A 5J2GA 4P4MA 4KLLA 1FIQA 1MC8A 3MFHA 3I1YA 5KFOA 1U4BA 3QU7A 4KLMA 1ZQRA 1Q3UA 2KV2A 2KHQA 1V9PA 1JN3A 1UT5A 3H40A 4Z6EA 1L7PA 2Q4TA 2LM1A 3QUQA 4R66A 1N5XA 4DWIA 2NO4A 4O9MA 3EUB2 3RAXA 2PFPA 4FZLA 4ECZA 7ICKA 3DDHA 3RJGA 5L1KA 4KLTA 2DWQA 4KLEA 2W8LA 1TK5A 3BQ0A 3H0RB 4JV2A 2BCQA 2HOIA 2LYBA 3A0HU 2XY7A 3EYZA 1KW4A 5KFAA 1DRGA 4IRDA 3RJHA 3OSNA 2I6XA 4P0QB 5DQHA 3LDAA 2ZIWA 2W9BA 5ALFA 2P66A 2OH2A 5HR7A 5KT7A 5KFSA 4ECWA 4O5KA 3JPTA 3LK9A 3TKAA 3PSFA 1Z1BA 2I9GA 2K8CB 8ICHA 3OJUA 3LWLA 1ZYQA 2FLNA 1ZD5A 2H5XA 5KG0A 2WB1F 3N7SC 5AM2A 4FS2A 3ZD8A 4M04A 1DOQA 2KNJA 1KFDA 4J9SA 4BUGA 1ZQOA 2QARA 4F93B 2J6UA 3NASA 5AK6A 4RPZA 2XI9A 3RBEA 5AK3A 2HDOA 1PZNA 4LJXA 4C4RA 2PFQA 2K4HA 3AQEA 5JUMA 2JZBA 1Y88A 1U48A 3F53A 4O3MA 5ALXA 1U45A 2V9WA 3PW7A 1JALA 4IQUA 5ALDA 1COOA 2KE7A 5DB9A 1NK6A 4YVZA 2D8CA 2VJ4A 8ICUA 3H0LB 2GO7A 2QB0B 5KG2A 4DS5A 3B0XA 2CXYA 2ZIXA 5ALIA 2HOFA 2D6FC 1ZQVA 1WWUA 1SZPA 5E79U 1TAQA 2R8JA 3M6KA 1MQ2A 3OTQA 5D4BA 3K4GA 5KT6A 3GIKA 1UPHA 5ALHA 1L7NA 2A19A 3WK4A 3K75D 2DPJA 3C1YA 2YTUA 3RJIA 7ICOA 3I28A 5KG7A 2F8LA 7ICHA 5IINA 1X66A 2ZJAA 5ALTA 1SIJA 4Z6CA 2H3VA 4I2GA 2WF5A 1MA7A 2G5HB 5HNKA 2VA3A 5ALUA 5EWFA 3D2NA 2PI5A 1DK3A 5KFPA 2AGPA 5DG9A 1X9MA 4QWAA 3HP6A 2Y0SF 1T3NA 1SXEA 2K4PA 7ICEA 3NVYA 8ICNA 2HHXA 2XGQA 4P2HA 2R8HA 4YR0A 4UW9A 4P4OA 7ICPA 1UHUA 4KLDA 2OM6A 1AQ6A 5L1MA 4UAWA 3R9KA 5J2EA 2NRTA 3IG8A 4R8UA 4OJ6A 2KZ3A 4PGYA 3C5FA 5ALVA 2Y1JA 1EXNA 4Y2UA 3BQ2A 5CA7A 3KHRA 4Z6DA 5CEHA 1ZQFA 2V4RA 4EYIB 3H8WA 2AGQA 2FMSA 3V7KA 4F50A 2W54A 1B4FA 5KT2A 1HUZA 4Y2QA 1Z00A 4Y2JA 5EOZA 4FS1A 2EDUA 3UM9A 3TADC 4GXIA 7ICNA 1SL2A 2MUTB 3V6HA 7ICRA 3Q8SB 1TV9A 3UXPA 3NVWA 1SKWA 4DSJA 2FPLA 4DSIA 5AIAA 5DDYA 2CRXA 8ICQA 4F5OA 2C2DA 3HPOA 4B9NA 1NK8A 4J9MA 3QXGA 3WKAA 1ZQSA 3UMGA 9ICAA 4F4KA 3CNHA 4PJ0U 3BS5A 4EEKA 3PSIA 5DB8A 4QZCA 2DPIA 1ECWA 5KG3A 1ED1A 5IILA 4DOBA 3HT3A 2HHUA 2UVRA 3GZFA 4M2YA 1X42A 3LVWA 1WUDA 4EX6A 4P0PB 4BX9C 2FI1A 4K4GA 3C2MA 5GTHU 5J0YA 5DBCA 4RT3A 5DB6A 2XY5A 2J6TA 3PY8A 4MEYA 3LWMA 5J2DA 4JMUA 4QZ9A 3SV4A 7ICSA 1CUKA 4QWEA 4QZIA 3RJKA 2AQ0A 1ZQZA 2W03A 2GLEA 4U6PA 3MFIA 4B9TA 5KNIA 2YMQA 5KG1A 2UVVA 4QZBA 4ZOHC 2ALZA 9ICLA 1NK0A 2GWSA 2GH1A 3MC1A 1KLNA 2RDIA 4DL2A 4CCHA 3ED5A 2W43A 4QWDA 3A0BU 5KFVA 2R18A 3ISDA 2W9CB 4YN4A 4RNNA 4PGXA 5DBBA 1U47A 3EZ5A 2HBLA 5KG4A 5C0YA 2ISOA 1NKCA 3M9OB 1S10A 5J0XA 3AU6A 5KFGA 9ICQA 8ICEA 5KFRA 3RR7A 3C23A 5B5EU 3MR2A 4ACOA 5IIMA 3LVVA 5JU5A 3TAQA 4TQSA 2RQ5A 4A8EA 4NLBA 2HW3A 3NRZA 4EYHB 3IG5A 3T5HA 2P35A 3IP4B 2LKYA 5ALSA 5H2FU 4BDPA 3KKAA 4FZNA 2KP7A 5KTQA 3M1YA 3GIJA 1F44A 3SEIA 1TFRA 4UB6U 5AKKA 4G9BA 3AL0B 2DBYA 5EWGA 5KFFA 5L1LA 1SV0C 4J9RA 2XC9A 2BQUA 4UB8U 3WKEA 5DLFA 4RU9A 2JEIA 3N7RC 2FPMA 5KFYA 1K5OA 1JRPA 2LBOA 4WJ3B 4F5RA 2OEHA 1ZQLA 3HKZC 4Y2RA 3PX0A 3HWTA 4I2HA 3NVVA 4B9UA 4KLJA 4DSKA 2K8AA 3SENA 4XRHA 2HBMA 4JUZA 4M0AA 2H3FA 5AKIA 3FM9A 2QB1A 4O5EA 4NXZA 1TK8A 2DGZA 4Q43A 2MRLA 2DF4B 4QNLA 4OJLA 1DXSA 4IR9A 2KK0A 1NKBA 2OHFA 1SZHA 2XO7A 2W9AA 2BQ3A 8ICAA 4XQ8A 2KIWA 2KJ9A 4QJFB 1NJZA 1URJA 4NWIA 2A1AA 3OJSA 3RB0A 4EBEA 3DV9A 2IHNA 2NRVA 3Q8RB 4C8NA 3MR6A 4PZOA 3RJFA 4P4PA 1YZ7A 1PK3A 3EPIA 4QWBA 4GFJA 3ZDDA 9ICKA 1X9XA 1L6NA 4QZAA 3WK5A 1Q46A 4MF2A 3PNCA 2JEJA 5AIBA 3H8MA 2HSZA 4BGDA 1KTQA 1BNPA 2H3IA 1ZQHA 2E8PA 2R8IA 2DFLA 2LYAA 3ISBA 2KZZA 3IHQB 4CNQA 2B0CA 4KN4A 3RB3A 5ALLA 5ALWA 4KX3A 3GDXA 5EE3A 2PXIA 5IIOA 4ICAA 4PPXA 1M6YA 3QEBZ 5KFNA 4PHPA 2EZXA 5L1JA 9ICXA 2JV3A 1KBUA 4CDGA 3D2SA 2F8KA 4JV0A 3K1RB 4QZEA 4F5PA 5KT3A 4FBUA 3KHLA 4QIWC 3QZ7A 4ELUA 4I2DA 7ICGA 2KTQA 2BDPA 3T79A 1ZQMA 9ICHA 4GXJA 2AH5A 3RH4A 8ICOA 3ISCA 1T8EA 2HOQA 2O6KA 3B0YA 4QW9A 4F4ZA 3ONNA 4RT2A 5J2AA 4PGQA 1ZQBA 1XU4A 2ZIWB 5AI4A 2W9BB 3HILA 2ATLA 2BPCA 4B9LA 3TI0A 4ECRA 3EPGA 4BWJA 2P6UA 5J8YA 3FAHA 1ZJMA 8ICZA 4OJOA 3N4MB 4GC7A 1KL9A 2K89A 2QARB 4M9JA 2XVTA 2ZIVA 1FEZA 4MHVA 7ICVA 4C80A 2YQEA 4I2AA 1LB2B 5FP0A 1ZD4A 3KOOA 4IS7A 3L4PA 3GIMA 4I2EA 4M9HA 3Q8MA 2JZBB 2VA2A 3UPQA 3KHHA 4I27A 3SQIA 2NRWA 2A3VA 2JR5A 2I1QA 4Q44A 4Y2TA 1ZQEA 2JEGA 2BGWA 3AEVA 2ZUBA 4DSFA 4QWCA 4NLCA 2RDJA 3QU2A 9ICGA 4B6JA 2KG5A 3G6VA 2ZIXB 7ICQA 3PX4A 4EBCA 1U9LA 4UBBA 2KJ8A 1NK7A 1B0XA 8ICBA 3RF9A 4C8OA 4F4WA 3OSPA 2EAOA 2CN1A 1NJYA 3SR6A 2LM4A 5KG5A 5KFHA 1VDVA 5TISU 1BNOA 2AHOB 1WG8A 2F1IA 1O03A 4M6WA 1NI3A 3SYZA 1KRPA 2WFAA 5KFUA 2VIXA 1D9DA 2JH1A 5DB7A 1ZRMA 3WU2U 5KT5A 1YZ6A 5AKXA 4F8RA 2IOFK 8ICYA 4C8MA 3H4DA 4YMOA 3NTUA 1ZQJA 4IL6U 2W11A 4J9OA 3PMLA 3UXNA 2YB1A 3O0FA 5EWEA 4C7ZA 4R8UB 5HP4A 2W9MA 2BCSA 1L3UA 1XSLA 1JROA 2F77X 4M9NA 5DBAA 9ICBA 4F71A 2K4IA 4BWMA 1QSYA 9ICSA 4DCCA 4HAIA 3SZ2A 3ICXA 4YXMA 4EENA 4FBTA 4C0ZA 4R63A 4OJPA 1HJPA 3J81j 3L5KA 4UARA 4GIBA 1KQQA 3KHGA 1Z00B 1DGSA 5KFMA 4DL7A 1NK5A 3TQ1A 3PSPA 4RPYA 3PSTA 4CF5A 4I2CA 1NZPA 1Z1VA 3NS1A 5D49A 3V7JA 2FMQA 1IG6A 3JPSA 2ASJA 5J0OA 1L3VA 1NNLA 4RQ0A 5AKHA 1BPYA 4DLGA 3MABA 2XCPA 2ZTCA 5DKWA 4UBCA 5D46A 1RZTA 9ICRA 5DG8A 1OUQA 4IQWA 1J2MA 3BS5B 4B9SA 3L3FX 5AI5A 4UB3A 4Y2XA 5ALPA 4RNMA 2V4QA 4K4IA 2JRZA 3M8RA 5DGAA 3HKZF 1S0VA 2YMPA 2KZMA 5HMLA 2EANA 1JXLA 2DL0A 1QQ5A 4DFPA 4CRXA 1V85A 1WYGA 2G07A 1ZOLA 8ICMA 1TKDA 2KVSA 5CHGA 2ES6A 4ECVA 2ESEA 2FLLA 1X9SA 1JX4A 8ICJA 4QZDA 3HW8A 4PL1A 1QH9A 2UVUA 7ICIA 2OCEA 2BCRA 3KKAC 4RUCA 4DO9A 5ALNA 2AU0A 2M0NA 5AM0A 5GTIU 4ED2A 2E8OA 3RTVA 4NLNA 3SI8A 1T3QA 5AI6A 5KT4A 4YMMA 9ICWA 5J2BA 4JWNA 5T14A 2JGAA 3WKDA 5KFBA 1AROP 2AXTU 4RQ6A 5KFLA 2B6GA 3QE9Y 2BR0A 1JUDA 2WAQF 4J9QA 2JXJA 4AYBC 1T7PA 8ICFA 3H8SA 2EZZA 5BOLA 4PHEA 1ZQGA 1KKXA 3BQTA 4NLKA 2NRXA 4FFDA 5KFCA 3F2DA 2DKXA 4NM2A 3WK8A 2MU2A 2F3NA 3HX0A 3GILA 3S6JA 2K60A 5J2CA 3C28A 4UB4A 2J6SA 8ICWA 5KAIU 2JMGA 1N56A 4FO6A 3QU4A 5TZVA 4Q45A 3D6JA 1N62A 1T94A 2KHVA 1C20A 1K1QA 5DDMA 4KLHA 4J03A 1YT3A 2PMZF 1TK0A 1U49A 2PFNA 4J9LA 2A1JB 1QQ6A 4ECQA 2ZJ5A 4NLGA 3V6KA 2EAMA 4DQIA 4ECUA 1VLBA 4IC9A 4ECTA 2Q0ZX 5G5GA 1NJXA 4KMUA 1K1SA 1FO4A 2XGPA 5L1IA 7ICMA 2LI6A 4KMOB 5F9LA 3JPPA 4F91B 2IOHA 1L7OA 4O3SA 2L5YA 1ZQCA 8ICRA 3TAPA 3HRDD 3TADA 2AQ4A 3RRGA 5AKJA 3MR5A 8ICGA 2F76X 3GIIA 1XSPA 3H0MB 1L3TA 5G5HA 1WCLA 5ALGA 1N48A 3KZXA 4EZ9A 4G3IA 3UQ2A 4EBDA 1SB3C 4M9LA 1Z4NA 2NYVA 4RNOA 1JMSA 1L3SA 4IRCA 1SXDA 3SV3A 1HIWA 2W8KA 2Y0SC 5KL8B 2G08A 4F5NA 2D3DA 3UXOA 3T5JA 7ICJA 1CEZA 3ZDCA 1S5LU 1PVQA 2XIDA 3KFUF 2W04A 2G09A 4DSEA 1ZQWA 2BCUA 1S8OA 4I2JA 5JRTA 2YMMA 5AI8A 2F44A 3QUTA 9ICTA 1UT8A 1N63A 3BDPA 3GV5B 3N28A 4J9NA 5AKLA 1QQ7A 1CRXA 2ZXIA 2BZFA 4MF8A 4JV1A 2ZIUB 2JH7A 4US8A 1SL1A 1O08A 1RYRA 3U26A 1XSNA 1XS9D 5J2IA 3OHAA 3OHBA 1A0PA 3VC8A 5ALEA 3H4BA 2WF7A 5DGBA 4DQSA 4M47A 3GU3A 3M6ZA 5J8YC 5DQGA 2KVCA 4F2SA 1PUZA 3DEEA 4C7YA 3AMZA 5L9XA 1JIHA 2NRZA 9ICVA 4IRKA 9ICOA 4LZDA 2C2RA 8ICIA 4U7CA 3M7DA 2AGOA 4F2RA 5ALRA 1ZXIA 3ZI4A 2IOFA 1TAMA 3SMVA 1CI4A 1J97A 1IV8A 3AM9A 2HHWA 4LZGA 3BZCA 4NL9A 5KFQA 9ICJA 4JWMA 4C4TA 2H3ZA 4E0DA 3MGIA 5ALMA 3PR5B 1BGXT 1NOMA 2XICA 4IQVA 3ZD9A 3AUOA 5AHXA 4KLFA 2ZG6A 4YXJA 2K8BB 4ECSA 1KSPA 1N61A 4C4SA 2EAPA 4UB2A 5AKEA 4ELVA 4UB1A 4C8LA 2EQYA 3RRHA 2OWOA 3QYPA 1LKYA 1X6IA 3AU2A 5KG6A 1B43A 1OXJA 2KMDA 2UVWA 3RH5A 2P6RA 5ALKA 2F1JA 5C5JA 4BXOA 2KSOA 1PK1A 3V7LA 2R8KA 4O3OA 2DUYA 3GQCA 2RLTA 3TARA 4CE6A 4QZGA 5CWRA 4J9PA 1N60A 2HVHA 1SKSA 4IQTA 2GOLA 2ZIVB 1FFVA 4R64A 3OPXA 4RZRA 4I29A 4O3RA 2WHEA 2YY6A 3H8JA 4QW8A 3PZPA 4DL4A 2RRDA 3OGUA 1F5SA 1Z4OA 4DLEA 1QTMA 1ZD3A 3G6YA 3ETLA 3NUQA 1X6JA 2KEYA 1HUOA 8ICXA 4UASA 2E3TA 4ZH4A 3TACB 1SWWA 1UQVA 9ICEA 1BVSA 2ZXHA 4O0IA 2VA8A 1RPLA 4MFAA 3ZDAA 5AM1A 1D8YA 1RM6C 4NM1A 2BPFA 5J0RA 1BPEA 1ZQAA 1XC9A 3F5EA 2ZUCA 1ZQDA 2C22A 1GO3F 3G6XA 1XNSA 2OXOA 4US9A 4OO1J 3M9NB 3QUBA 4YR3A 3FC4A 4RQ1A 4DQPA 3WK7A 2G0AA 1N5WA 5AM4A 8ICPA 1XWLA 3I76A 1ZQ1C 3T5LA 3PV8A 1S9FA 4I2BA 4R65A 3RR8A 3WKBA 4F4XA 2LPEA 4DS4A 2JEFA 8ICLA 5J0UA 4BJQA 3N97B 4M6WB 1X40A 2ZJ8A 4KN7A 4YD1A 1ZETA 2FE9A 5ALQA 2HHTA 4DL5A 5AM3A 4MFCA 2NO5A 4MFFA 2F1HA 4TURA 3JPQA 5KFEA 4YQWA 2ODGA 4UAZA 2Y1IA 4DF8A 1ZQYA 4K4HA 8ICSA 3AN1A 1RQNA 1IIPA 5AKYA 5HR6A 4KLUA 1WCNA 1MN8A 4PH5A 4QZ8A 2KD1A 4AYBF 4UAVA 5CRXA 3UMBA 5J0PA 3QU5A 4YFKA 5J2HA 2PKEA 3KTQA 2K4EA 3RB4A 3QNMA 1PVRA 3ZDBA 2FPKA 3SAFA 4EZ6A 3T5KA 3C29A 3BQ1A 2I5HA 1NKEA 3THVA 2C2EA 1Z3EB 5J29A 3K1ZA 4ED1A 4J9KA 3C1ZA 4RQ3A 7ICUA 5AM5A 3BZKA 4O3QA 3LYSA 4IR1A 4PZNA 4QZFA 5IIKA 2RP5A 3Q8QB 3F5AA 4P0QA 3WK9A 4RQ2A 3RJJA 5KAFU 4F92B 3EWAA 3Q8PB 4RQNA 4DFMA 4F72A 3NRWA 1N2XA 3Q8KA 4KTQA 2WTFA 1D8BA 2LHTA 3IV6A 1SL0A 2KJ5A 3TANA 4UATA 3RAQA 1QSSA 3FDSA 3ZDEA 3F2CA 4KLOA 4OJ5A 3JPRA 4B9MA 5EE0A 2HCFA 2E8MA 5J2FA 3MBYA 3V72A 1KDHA 3FYHA 1QCKA 4DL3A 4RUAA 1XO0A 2BPGA 3RJEA 2EH9A 3KD3A 4RQ4A 3D2QA 1JXEA 5A0LA 1C7YA 4YP3A 5CB1A 3MGHA 3JPNA 3QEAZ 2EZYA 5IIJA 1ZQXA 4OD0A 2ASLA 5BPCA 4DL6A 4PL2A 4NV0A 3T3FA 3PW2A 5DQIA 1BPZA 3B9JA 2BCVA 2R8GA 2E1FA 4DQRA 4I2IA 4Y2VA 1SWVA 3N7PD 3PVXA 2QB0A 2IMWP 2WF6A 4XA5A 2F2AB 4O5CA 2HHQA 2HMXA 1RYSA 1ZQTA 1COKA 4M9GA 2VJ5A 2KN7A 1A77A 3GV8B 5HMMA 4YD2A 4ECYA 3QX7A 9ICMA 8ICKA 3EW9A 4F5QA 1P7DA 4DFDA 4DOCA 1RG6A 2DKZA 4Q8FA 5KFJA 1NJWA 2G06A 2VANA 5BOMA 2HHSA 2BKEA 1NK4A 1MSWD 4USAA 9ICUA 4YCXA 2FLPA 5KFWA 4F3OA 2OYYA 1L7MA 5AI0A 2KOBA 2KFNA 4YMNA 4CF4A 4ED3A 5JTIA 4KX5A 2XCAA 2W3RA 4FE3A 5AK4A 2BHNA 4JB3A 1ZQNA 7ICLA 9ICNA 4RQ8A 4NJ8A 5HHIA 3PMNA 3TFRA 1NK9A 5J0SA 1L8OA 5J0QA 1ZD2P 2G5IB 2HI0A 2NV3A 4EX7A 4UB5A 5B66U 4ELTA 5DLGA 1ZQIA 3CW2C 4ED6A 1ZJNA 1KFSA 2W7PA 1PVPA 1HEKA 3V6JA 3IM1A 4GXKA 4UAYA 4EELA 2MAXA 5CP2A 2WF8A 5ALYA 5J2JA 4XUSA 4DQQA 3PW5A 2PFOA 4KITB 4NY8A 1MQ3A 3MGVA 1T4GA 1S0OA 2N1RA 3GFKB 3MR3A 2W55A 3RB6A 4QZHA 2M9NA 3HJEA 4TUQA 1S97A 4ECXA 2MUTA 1KEJA 4O3NA 5F9NA 4NLZA 2WB1C 1Q8KA 4ED8A 3ALRA 2JHDA 1ZRNA 2AJQA 4ED7A 5CR0A 2Z7JA 1B22A 4KLQA 3SAHA 5AKGA 3PO4A 1A6SA 4X5VA 3RBDA 5J2KA 2YN4A 2MA1A 2ZUDA 3IDWA 2YMLA 1UCVA 1S76D 1BPXA 4DF4A 3C2KA 3GV7B 7ICFA 1IM4A 2LYHA 1SGGA 4QIWF 2HHVA 4RQMA 2KKVA 4P0PA 1RQLA 7ICTA 2XY6A 3PW0A 4ED0A 1L5UA 4NL9C 4DFKA 4Q8EA 2KKPA 1L8LA 1V38A 3KBBA 3QU9A 5EE1A 4Y2YA 4AP9A 8ICVA 4TUPA 5ALOA 4DOAA 9ICPA 1X9WA 1BPBA 4KLIA 5CJ7A 2W3SA 1QLNA 1JI7A 3E2EA 2C28A 2MSNA 5DG7A 4TUSA 1WWVA 4TQRA 3PX6A 3E0FA 3SD7A 2IBKA 5AK5A 1A76A 1ZQUA 4RQ7A 4I2FA 1ZQKA 1S0MA 3C2LA 2W9CA 2ZTDA 2DQNB 2E8NA 2ZTEA 1J2NA 2A1JA 1QSLA 5J0WA 3RH6A 3M9MB 2CPRA 4B9VA 1RYUA 5KFZA 3UMCA 3Q8LA 3BQ7A 1F0MA 2HVIA 4LVSA 3RFAA 1S0NA 2ASDA 2KFZA 5KFTA 1DGJA 5AI9A 1LVHA 1TAUA 5AICA 4PHAA 4RQ5A 3UQ0A 1Z19A 1V97A 4HYKA 1UA1A 4O3PA 3WKCA 3JPOA 2BQRA 1DK2A 4MEXA 2HBJA 3IN5A 1BPDA 4KLSA 1XO1A 2VKQA 1RXWA 3NGDA 1KN5A 5KFDA 1LKYB 4DSLA 2QKQA 2PI4A 1Q3VA 3VCBA 1SV4A 3KZIU 2FDRA 3E58A 2LMRA 4EEYA 3TFSA 5KFXA 4YG2A 1ZQPA 3H7IA 1TE2A 3ETRA 4PHDA 1TVAA 1OW5A 4UAUA 5ALZA 3PO5A 2Y9TA 3BJYA 3PW4A 4BXOB 3QUCA 1LV5A 2KSOB 1PK1B 8ICCA 1RXVA 5J0TA 5KFKA 2YX8A 1FFUA 4Z6FA 2W7OA 4KLGA 5IIIA 9ICCA 9ICIA 8ICTA 3MDAA 5KL1B 4RPXA 5EE9A 5HHHA 1S77D 4GC6A 2FJ6A 3C5GA 3M8SA 1KFTA 4F4YA 4I28A 2E1EA 2BDUA 3CYMA 2IHMA 2ZIUA 3MDCA 2WAQC 2YB4A 3BS7A 4OCZA 1UA0A 1VJ5A 3PR4A 5AKZA 4YR2A 1IXRA
chains in the Genus database with same CATH topology
2DL0A 2KIVA 1COKA 1X66A 4PZOA 1V85A 5J8YA 1PK3A 3BQ7A 1F0MA 3KKAA 2ES6A 2EAMA 2QARB 2ESEA 1X9XA 5J8YC 3TACB 4MHVA 1RG6A 2DKZA 3H8MA 3IDWA 1UQVA 1SXEA 3KKAC 4PZNA 2K4PA 1UCVA 1SV0A 3SEIA 4IS7A 1SGGA 2E8PA 2L5YA 4RQMA 4RQNA 2E8OA 3TADA 5JTIA 5L1MA 2Y9UA 1SV0C 2QARA 4NL9A 5F3XB 2GLEA 5KNIA 1LKYB 2QKQA 4NJ8A 1SV4A 2B6GA 4NL9C 2LMRA 1V38A 2KG5A 1OW5A 2E8MA 2Y9TA 2LPEA 1Z1VA 2EAPA 1SXDA 2JV3A 1B0XA 2KE7A 2KSOB 1PK1B 3SENA 1JI7A 1X40A 1B4FA 2D3DA 2D8CA 1LKYA 2F8KA 3K1RB 2FE9A 2EAOA 2QB0B 1WWVA 2QB1A 2DKXA 3TADC 1OXJA 2KMDA 3BS5B 2F3NA 1WWUA 5JRTA 2K60A 1DXSA 2KSOA 1PK1A 2F44A 5JU5A 3BS7A 2QB0A 3HILA 1KW4A 2E8NA 2EANA 2YTUA 3BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL0 A;  2KIV A;  1COK A;  1X66 A;  4PZO A;  1V85 A;  5J8Y A;  1PK3 A;  3BQ7 A;  1F0M A;  3KKA A;  2ES6 A;  2EAM A;  2QAR B;  2ESE A;  1X9X A;  5J8Y C;  3TAC B;  4MHV A;  1RG6 A;  2DKZ A;  3H8M A;  3IDW A;  1UQV A;  1SXE A;  3KKA C;  4PZN A;  2K4P A;  1UCV A;  1SV0 A;  3SEI A;  4IS7 A;  1SGG A;  2E8P A;  2L5Y A;  4RQM A;  4RQN A;  2E8O A;  3TAD A;  5JTI A;  5L1M A;  2Y9U A;  1SV0 C;  2QAR A;  4NL9 A;  5F3X B;  2GLE A;  5KNI A;  1LKY B;  2QKQ A;  4NJ8 A;  1SV4 A;  2B6G A;  4NL9 C;  2LMR A;  1V38 A;  2KG5 A;  1OW5 A;  2E8M A;  2Y9T A;  2LPE A;  1Z1V A;  2EAP A;  1SXD A;  2JV3 A;  1B0X A;  2KE7 A;  2KSO B;  1PK1 B;  3SEN A;  1JI7 A;  1X40 A;  1B4F A;  2D3D A;  2D8C A;  1LKY A;  2F8K A;  3K1R B;  2FE9 A;  2EAO A;  2QB0 B;  1WWV A;  2QB1 A;  2DKX A;  3TAD C;  1OXJ A;  2KMD A;  3BS5 B;  2F3N A;  1WWU A;  5JRT A;  2K60 A;  1DXS A;  2KSO A;  1PK1 A;  2F44 A;  5JU5 A;  3BS7 A;  2QB0 A;  3HIL A;  1KW4 A;  2E8N A;  2EAN A;  2YTU A;  3BS5 A; 
#chains in the Genus database with same CATH topology
 2RHF A;  3WK6 A;  2KIC A;  2KIV A;  1SKR A;  3SAG A;  5KFI A;  4Y2P A;  2E5S A;  4GLX A;  5ALJ A;  2WF9 A;  4Y2S A;  9ICF A;  2FMP A;  2H3Q A;  4UQG A;  4FZM A;  5K4L A;  3F2B A;  2QLT A;  4DEZ A;  1ZQQ A;  1NZB A;  1SV0 A;  2ISP A;  4CGZ A;  3ORY A;  1H38 A;  2Y9U A;  2HBK A;  2PMZ C;  5F3X B;  1D8L A;  3CRX A;  4DFJ A;  1RDF A;  4CF3 A;  3QZ8 A;  3C21 A;  4JK1 A;  1D9F A;  2B21 A;  4C8K A;  3AQF A;  1X2I A;  3NVZ A;  3IRU A;  2IA6 A;  3CP8 A;  5J2G A;  4P4M A;  4KLL A;  1FIQ A;  1MC8 A;  3MFH A;  3I1Y A;  5KFO A;  1U4B A;  3QU7 A;  4KLM A;  1ZQR A;  1Q3U A;  2KV2 A;  2KHQ A;  1V9P A;  1JN3 A;  1UT5 A;  3H40 A;  4Z6E A;  1L7P A;  2Q4T A;  2LM1 A;  3QUQ A;  4R66 A;  1N5X A;  4DWI A;  2NO4 A;  4O9M A;  3EUB 2;  3RAX A;  2PFP A;  4FZL A;  4ECZ A;  7ICK A;  3DDH A;  3RJG A;  5L1K A;  4KLT A;  2DWQ A;  4KLE A;  2W8L A;  1TK5 A;  3BQ0 A;  3H0R B;  4JV2 A;  2BCQ A;  2HOI A;  2LYB A;  3A0H U;  2XY7 A;  3EYZ A;  1KW4 A;  5KFA A;  1DRG A;  4IRD A;  3RJH A;  3OSN A;  2I6X A;  4P0Q B;  5DQH A;  3LDA A;  2ZIW A;  2W9B A;  5ALF A;  2P66 A;  2OH2 A;  5HR7 A;  5KT7 A;  5KFS A;  4ECW A;  4O5K A;  3JPT A;  3LK9 A;  3TKA A;  3PSF A;  1Z1B A;  2I9G A;  2K8C B;  8ICH A;  3OJU A;  3LWL A;  1ZYQ A;  2FLN A;  1ZD5 A;  2H5X A;  5KG0 A;  2WB1 F;  3N7S C;  5AM2 A;  4FS2 A;  3ZD8 A;  4M04 A;  1DOQ A;  2KNJ A;  1KFD A;  4J9S A;  4BUG A;  1ZQO A;  2QAR A;  4F93 B;  2J6U A;  3NAS A;  5AK6 A;  4RPZ A;  2XI9 A;  3RBE A;  5AK3 A;  2HDO A;  1PZN A;  4LJX A;  4C4R A;  2PFQ A;  2K4H A;  3AQE A;  5JUM A;  2JZB A;  1Y88 A;  1U48 A;  3F53 A;  4O3M A;  5ALX A;  1U45 A;  2V9W A;  3PW7 A;  1JAL A;  4IQU A;  5ALD A;  1COO A;  2KE7 A;  5DB9 A;  1NK6 A;  4YVZ A;  2D8C A;  2VJ4 A;  8ICU A;  3H0L B;  2GO7 A;  2QB0 B;  5KG2 A;  4DS5 A;  3B0X A;  2CXY A;  2ZIX A;  5ALI A;  2HOF A;  2D6F C;  1ZQV A;  1WWU A;  1SZP A;  5E79 U;  1TAQ A;  2R8J A;  3M6K A;  1MQ2 A;  3OTQ A;  5D4B A;  3K4G A;  5KT6 A;  3GIK A;  1UPH A;  5ALH A;  1L7N A;  2A19 A;  3WK4 A;  3K75 D;  2DPJ A;  3C1Y A;  2YTU A;  3RJI A;  7ICO A;  3I28 A;  5KG7 A;  2F8L A;  7ICH A;  5IIN A;  1X66 A;  2ZJA A;  5ALT A;  1SIJ A;  4Z6C A;  2H3V A;  4I2G A;  2WF5 A;  1MA7 A;  2G5H B;  5HNK A;  2VA3 A;  5ALU A;  5EWF A;  3D2N A;  2PI5 A;  1DK3 A;  5KFP A;  2AGP A;  5DG9 A;  1X9M A;  4QWA A;  3HP6 A;  2Y0S F;  1T3N A;  1SXE A;  2K4P A;  7ICE A;  3NVY A;  8ICN A;  2HHX A;  2XGQ A;  4P2H A;  2R8H A;  4YR0 A;  4UW9 A;  4P4O A;  7ICP A;  1UHU A;  4KLD A;  2OM6 A;  1AQ6 A;  5L1M A;  4UAW A;  3R9K A;  5J2E A;  2NRT A;  3IG8 A;  4R8U A;  4OJ6 A;  2KZ3 A;  4PGY A;  3C5F A;  5ALV A;  2Y1J A;  1EXN A;  4Y2U A;  3BQ2 A;  5CA7 A;  3KHR A;  4Z6D A;  5CEH A;  1ZQF A;  2V4R A;  4EYI B;  3H8W A;  2AGQ A;  2FMS A;  3V7K A;  4F50 A;  2W54 A;  1B4F A;  5KT2 A;  1HUZ A;  4Y2Q A;  1Z00 A;  4Y2J A;  5EOZ A;  4FS1 A;  2EDU A;  3UM9 A;  3TAD C;  4GXI A;  7ICN A;  1SL2 A;  2MUT B;  3V6H A;  7ICR A;  3Q8S B;  1TV9 A;  3UXP A;  3NVW A;  1SKW A;  4DSJ A;  2FPL A;  4DSI A;  5AIA A;  5DDY A;  2CRX A;  8ICQ A;  4F5O A;  2C2D A;  3HPO A;  4B9N A;  1NK8 A;  4J9M A;  3QXG A;  3WKA A;  1ZQS A;  3UMG A;  9ICA A;  4F4K A;  3CNH A;  4PJ0 U;  3BS5 A;  4EEK A;  3PSI A;  5DB8 A;  4QZC A;  2DPI A;  1ECW A;  5KG3 A;  1ED1 A;  5IIL A;  4DOB A;  3HT3 A;  2HHU A;  2UVR A;  3GZF A;  4M2Y A;  1X42 A;  3LVW A;  1WUD A;  4EX6 A;  4P0P B;  4BX9 C;  2FI1 A;  4K4G A;  3C2M A;  5GTH U;  5J0Y A;  5DBC A;  4RT3 A;  5DB6 A;  2XY5 A;  2J6T A;  3PY8 A;  4MEY A;  3LWM A;  5J2D A;  4JMU A;  4QZ9 A;  3SV4 A;  7ICS A;  1CUK A;  4QWE A;  4QZI A;  3RJK A;  2AQ0 A;  1ZQZ A;  2W03 A;  2GLE A;  4U6P A;  3MFI A;  4B9T A;  5KNI A;  2YMQ A;  5KG1 A;  2UVV A;  4QZB A;  4ZOH C;  2ALZ A;  9ICL A;  1NK0 A;  2GWS A;  2GH1 A;  3MC1 A;  1KLN A;  2RDI A;  4DL2 A;  4CCH A;  3ED5 A;  2W43 A;  4QWD A;  3A0B U;  5KFV A;  2R18 A;  3ISD A;  2W9C B;  4YN4 A;  4RNN A;  4PGX A;  5DBB A;  1U47 A;  3EZ5 A;  2HBL A;  5KG4 A;  5C0Y A;  2ISO A;  1NKC A;  3M9O B;  1S10 A;  5J0X A;  3AU6 A;  5KFG A;  9ICQ A;  8ICE A;  5KFR A;  3RR7 A;  3C23 A;  5B5E U;  3MR2 A;  4ACO A;  5IIM A;  3LVV A;  5JU5 A;  3TAQ A;  4TQS A;  2RQ5 A;  4A8E A;  4NLB A;  2HW3 A;  3NRZ A;  4EYH B;  3IG5 A;  3T5H A;  2P35 A;  3IP4 B;  2LKY A;  5ALS A;  5H2F U;  4BDP A;  3KKA A;  4FZN A;  2KP7 A;  5KTQ A;  3M1Y A;  3GIJ A;  1F44 A;  3SEI A;  1TFR A;  4UB6 U;  5AKK A;  4G9B A;  3AL0 B;  2DBY A;  5EWG A;  5KFF A;  5L1L A;  1SV0 C;  4J9R A;  2XC9 A;  2BQU A;  4UB8 U;  3WKE A;  5DLF A;  4RU9 A;  2JEI A;  3N7R C;  2FPM A;  5KFY A;  1K5O A;  1JRP A;  2LBO A;  4WJ3 B;  4F5R A;  2OEH A;  1ZQL A;  3HKZ C;  4Y2R A;  3PX0 A;  3HWT A;  4I2H A;  3NVV A;  4B9U A;  4KLJ A;  4DSK A;  2K8A A;  3SEN A;  4XRH A;  2HBM A;  4JUZ A;  4M0A A;  2H3F A;  5AKI A;  3FM9 A;  2QB1 A;  4O5E A;  4NXZ A;  1TK8 A;  2DGZ A;  4Q43 A;  2MRL A;  2DF4 B;  4QNL A;  4OJL A;  1DXS A;  4IR9 A;  2KK0 A;  1NKB A;  2OHF A;  1SZH A;  2XO7 A;  2W9A A;  2BQ3 A;  8ICA A;  4XQ8 A;  2KIW A;  2KJ9 A;  4QJF B;  1NJZ A;  1URJ A;  4NWI A;  2A1A A;  3OJS A;  3RB0 A;  4EBE A;  3DV9 A;  2IHN A;  2NRV A;  3Q8R B;  4C8N A;  3MR6 A;  4PZO A;  3RJF A;  4P4P A;  1YZ7 A;  1PK3 A;  3EPI A;  4QWB A;  4GFJ A;  3ZDD A;  9ICK A;  1X9X A;  1L6N A;  4QZA A;  3WK5 A;  1Q46 A;  4MF2 A;  3PNC A;  2JEJ A;  5AIB A;  3H8M A;  2HSZ A;  4BGD A;  1KTQ A;  1BNP A;  2H3I A;  1ZQH A;  2E8P A;  2R8I A;  2DFL A;  2LYA A;  3ISB A;  2KZZ A;  3IHQ B;  4CNQ A;  2B0C A;  4KN4 A;  3RB3 A;  5ALL A;  5ALW A;  4KX3 A;  3GDX A;  5EE3 A;  2PXI A;  5IIO A;  4ICA A;  4PPX A;  1M6Y A;  3QEB Z;  5KFN A;  4PHP A;  2EZX A;  5L1J A;  9ICX A;  2JV3 A;  1KBU A;  4CDG A;  3D2S A;  2F8K A;  4JV0 A;  3K1R B;  4QZE A;  4F5P A;  5KT3 A;  4FBU A;  3KHL A;  4QIW C;  3QZ7 A;  4ELU A;  4I2D A;  7ICG A;  2KTQ A;  2BDP A;  3T79 A;  1ZQM A;  9ICH A;  4GXJ A;  2AH5 A;  3RH4 A;  8ICO A;  3ISC A;  1T8E A;  2HOQ A;  2O6K A;  3B0Y A;  4QW9 A;  4F4Z A;  3ONN A;  4RT2 A;  5J2A A;  4PGQ A;  1ZQB A;  1XU4 A;  2ZIW B;  5AI4 A;  2W9B B;  3HIL A;  2ATL A;  2BPC A;  4B9L A;  3TI0 A;  4ECR A;  3EPG A;  4BWJ A;  2P6U A;  5J8Y A;  3FAH A;  1ZJM A;  8ICZ A;  4OJO A;  3N4M B;  4GC7 A;  1KL9 A;  2K89 A;  2QAR B;  4M9J A;  2XVT A;  2ZIV A;  1FEZ A;  4MHV A;  7ICV A;  4C80 A;  2YQE A;  4I2A A;  1LB2 B;  5FP0 A;  1ZD4 A;  3KOO A;  4IS7 A;  3L4P A;  3GIM A;  4I2E A;  4M9H A;  3Q8M A;  2JZB B;  2VA2 A;  3UPQ A;  3KHH A;  4I27 A;  3SQI A;  2NRW A;  2A3V A;  2JR5 A;  2I1Q A;  4Q44 A;  4Y2T A;  1ZQE A;  2JEG A;  2BGW A;  3AEV A;  2ZUB A;  4DSF A;  4QWC A;  4NLC A;  2RDJ A;  3QU2 A;  9ICG A;  4B6J A;  2KG5 A;  3G6V A;  2ZIX B;  7ICQ A;  3PX4 A;  4EBC A;  1U9L A;  4UBB A;  2KJ8 A;  1NK7 A;  1B0X A;  8ICB A;  3RF9 A;  4C8O A;  4F4W A;  3OSP A;  2EAO A;  2CN1 A;  1NJY A;  3SR6 A;  2LM4 A;  5KG5 A;  5KFH A;  1VDV A;  5TIS U;  1BNO A;  2AHO B;  1WG8 A;  2F1I A;  1O03 A;  4M6W A;  1NI3 A;  3SYZ A;  1KRP A;  2WFA A;  5KFU A;  2VIX A;  1D9D A;  2JH1 A;  5DB7 A;  1ZRM A;  3WU2 U;  5KT5 A;  1YZ6 A;  5AKX A;  4F8R A;  2IOF K;  8ICY A;  4C8M A;  3H4D A;  4YMO A;  3NTU A;  1ZQJ A;  4IL6 U;  2W11 A;  4J9O A;  3PML A;  3UXN A;  2YB1 A;  3O0F A;  5EWE A;  4C7Z A;  4R8U B;  5HP4 A;  2W9M A;  2BCS A;  1L3U A;  1XSL A;  1JRO A;  2F77 X;  4M9N A;  5DBA A;  9ICB A;  4F71 A;  2K4I A;  4BWM A;  1QSY A;  9ICS A;  4DCC A;  4HAI A;  3SZ2 A;  3ICX A;  4YXM A;  4EEN A;  4FBT A;  4C0Z A;  4R63 A;  4OJP A;  1HJP A;  3J81 j;  3L5K A;  4UAR A;  4GIB A;  1KQQ A;  3KHG A;  1Z00 B;  1DGS A;  5KFM A;  4DL7 A;  1NK5 A;  3TQ1 A;  3PSP A;  4RPY A;  3PST A;  4CF5 A;  4I2C A;  1NZP A;  1Z1V A;  3NS1 A;  5D49 A;  3V7J A;  2FMQ A;  1IG6 A;  3JPS A;  2ASJ A;  5J0O A;  1L3V A;  1NNL A;  4RQ0 A;  5AKH A;  1BPY A;  4DLG A;  3MAB A;  2XCP A;  2ZTC A;  5DKW A;  4UBC A;  5D46 A;  1RZT A;  9ICR A;  5DG8 A;  1OUQ A;  4IQW A;  1J2M A;  3BS5 B;  4B9S A;  3L3F X;  5AI5 A;  4UB3 A;  4Y2X A;  5ALP A;  4RNM A;  2V4Q A;  4K4I A;  2JRZ A;  3M8R A;  5DGA A;  3HKZ F;  1S0V A;  2YMP A;  2KZM A;  5HML A;  2EAN A;  1JXL A;  2DL0 A;  1QQ5 A;  4DFP A;  4CRX A;  1V85 A;  1WYG A;  2G07 A;  1ZOL A;  8ICM A;  1TKD A;  2KVS A;  5CHG A;  2ES6 A;  4ECV A;  2ESE A;  2FLL A;  1X9S A;  1JX4 A;  8ICJ A;  4QZD A;  3HW8 A;  4PL1 A;  1QH9 A;  2UVU A;  7ICI A;  2OCE A;  2BCR A;  3KKA C;  4RUC A;  4DO9 A;  5ALN A;  2AU0 A;  2M0N A;  5AM0 A;  5GTI U;  4ED2 A;  2E8O A;  3RTV A;  4NLN A;  3SI8 A;  1T3Q A;  5AI6 A;  5KT4 A;  4YMM A;  9ICW A;  5J2B A;  4JWN A;  5T14 A;  2JGA A;  3WKD A;  5KFB A;  1ARO P;  2AXT U;  4RQ6 A;  5KFL A;  2B6G A;  3QE9 Y;  2BR0 A;  1JUD A;  2WAQ F;  4J9Q A;  2JXJ A;  4AYB C;  1T7P A;  8ICF A;  3H8S A;  2EZZ A;  5BOL A;  4PHE A;  1ZQG A;  1KKX A;  3BQT A;  4NLK A;  2NRX A;  4FFD A;  5KFC A;  3F2D A;  2DKX A;  4NM2 A;  3WK8 A;  2MU2 A;  2F3N A;  3HX0 A;  3GIL A;  3S6J A;  2K60 A;  5J2C A;  3C28 A;  4UB4 A;  2J6S A;  8ICW A;  5KAI U;  2JMG A;  1N56 A;  4FO6 A;  3QU4 A;  5TZV A;  4Q45 A;  3D6J A;  1N62 A;  1T94 A;  2KHV A;  1C20 A;  1K1Q A;  5DDM A;  4KLH A;  4J03 A;  1YT3 A;  2PMZ F;  1TK0 A;  1U49 A;  2PFN A;  4J9L A;  2A1J B;  1QQ6 A;  4ECQ A;  2ZJ5 A;  4NLG A;  3V6K A;  2EAM A;  4DQI A;  4ECU A;  1VLB A;  4IC9 A;  4ECT A;  2Q0Z X;  5G5G A;  1NJX A;  4KMU A;  1K1S A;  1FO4 A;  2XGP A;  5L1I A;  7ICM A;  2LI6 A;  4KMO B;  5F9L A;  3JPP A;  4F91 B;  2IOH A;  1L7O A;  4O3S A;  2L5Y A;  1ZQC A;  8ICR A;  3TAP A;  3HRD D;  3TAD A;  2AQ4 A;  3RRG A;  5AKJ A;  3MR5 A;  8ICG A;  2F76 X;  3GII A;  1XSP A;  3H0M B;  1L3T A;  5G5H A;  1WCL A;  5ALG A;  1N48 A;  3KZX A;  4EZ9 A;  4G3I A;  3UQ2 A;  4EBD A;  1SB3 C;  4M9L A;  1Z4N A;  2NYV A;  4RNO A;  1JMS A;  1L3S A;  4IRC A;  1SXD A;  3SV3 A;  1HIW A;  2W8K A;  2Y0S C;  5KL8 B;  2G08 A;  4F5N A;  2D3D A;  3UXO A;  3T5J A;  7ICJ A;  1CEZ A;  3ZDC A;  1S5L U;  1PVQ A;  2XID A;  3KFU F;  2W04 A;  2G09 A;  4DSE A;  1ZQW A;  2BCU A;  1S8O A;  4I2J A;  5JRT A;  2YMM A;  5AI8 A;  2F44 A;  3QUT A;  9ICT A;  1UT8 A;  1N63 A;  3BDP A;  3GV5 B;  3N28 A;  4J9N A;  5AKL A;  1QQ7 A;  1CRX A;  2ZXI A;  2BZF A;  4MF8 A;  4JV1 A;  2ZIU B;  2JH7 A;  4US8 A;  1SL1 A;  1O08 A;  1RYR A;  3U26 A;  1XSN A;  1XS9 D;  5J2I A;  3OHA A;  3OHB A;  1A0P A;  3VC8 A;  5ALE A;  3H4B A;  2WF7 A;  5DGB A;  4DQS A;  4M47 A;  3GU3 A;  3M6Z A;  5J8Y C;  5DQG A;  2KVC A;  4F2S A;  1PUZ A;  3DEE A;  4C7Y A;  3AMZ A;  5L9X A;  1JIH A;  2NRZ A;  9ICV A;  4IRK A;  9ICO A;  4LZD A;  2C2R A;  8ICI A;  4U7C A;  3M7D A;  2AGO A;  4F2R A;  5ALR A;  1ZXI A;  3ZI4 A;  2IOF A;  1TAM A;  3SMV A;  1CI4 A;  1J97 A;  1IV8 A;  3AM9 A;  2HHW A;  4LZG A;  3BZC A;  4NL9 A;  5KFQ A;  9ICJ A;  4JWM A;  4C4T A;  2H3Z A;  4E0D A;  3MGI A;  5ALM A;  3PR5 B;  1BGX T;  1NOM A;  2XIC A;  4IQV A;  3ZD9 A;  3AUO A;  5AHX A;  4KLF A;  2ZG6 A;  4YXJ A;  2K8B B;  4ECS A;  1KSP A;  1N61 A;  4C4S A;  2EAP A;  4UB2 A;  5AKE A;  4ELV A;  4UB1 A;  4C8L A;  2EQY A;  3RRH A;  2OWO A;  3QYP A;  1LKY A;  1X6I A;  3AU2 A;  5KG6 A;  1B43 A;  1OXJ A;  2KMD A;  2UVW A;  3RH5 A;  2P6R A;  5ALK A;  2F1J A;  5C5J A;  4BXO A;  2KSO A;  1PK1 A;  3V7L A;  2R8K A;  4O3O A;  2DUY A;  3GQC A;  2RLT A;  3TAR A;  4CE6 A;  4QZG A;  5CWR A;  4J9P A;  1N60 A;  2HVH A;  1SKS A;  4IQT A;  2GOL A;  2ZIV B;  1FFV A;  4R64 A;  3OPX A;  4RZR A;  4I29 A;  4O3R A;  2WHE A;  2YY6 A;  3H8J A;  4QW8 A;  3PZP A;  4DL4 A;  2RRD A;  3OGU A;  1F5S A;  1Z4O A;  4DLE A;  1QTM A;  1ZD3 A;  3G6Y A;  3ETL A;  3NUQ A;  1X6J A;  2KEY A;  1HUO A;  8ICX A;  4UAS A;  2E3T A;  4ZH4 A;  3TAC B;  1SWW A;  1UQV A;  9ICE A;  1BVS A;  2ZXH A;  4O0I A;  2VA8 A;  1RPL A;  4MFA A;  3ZDA A;  5AM1 A;  1D8Y A;  1RM6 C;  4NM1 A;  2BPF A;  5J0R A;  1BPE A;  1ZQA A;  1XC9 A;  3F5E A;  2ZUC A;  1ZQD A;  2C22 A;  1GO3 F;  3G6X A;  1XNS A;  2OXO A;  4US9 A;  4OO1 J;  3M9N B;  3QUB A;  4YR3 A;  3FC4 A;  4RQ1 A;  4DQP A;  3WK7 A;  2G0A A;  1N5W A;  5AM4 A;  8ICP A;  1XWL A;  3I76 A;  1ZQ1 C;  3T5L A;  3PV8 A;  1S9F A;  4I2B A;  4R65 A;  3RR8 A;  3WKB A;  4F4X A;  2LPE A;  4DS4 A;  2JEF A;  8ICL A;  5J0U A;  4BJQ A;  3N97 B;  4M6W B;  1X40 A;  2ZJ8 A;  4KN7 A;  4YD1 A;  1ZET A;  2FE9 A;  5ALQ A;  2HHT A;  4DL5 A;  5AM3 A;  4MFC A;  2NO5 A;  4MFF A;  2F1H A;  4TUR A;  3JPQ A;  5KFE A;  4YQW A;  2ODG A;  4UAZ A;  2Y1I A;  4DF8 A;  1ZQY A;  4K4H A;  8ICS A;  3AN1 A;  1RQN A;  1IIP A;  5AKY A;  5HR6 A;  4KLU A;  1WCN A;  1MN8 A;  4PH5 A;  4QZ8 A;  2KD1 A;  4AYB F;  4UAV A;  5CRX A;  3UMB A;  5J0P A;  3QU5 A;  4YFK A;  5J2H A;  2PKE A;  3KTQ A;  2K4E A;  3RB4 A;  3QNM A;  1PVR A;  3ZDB A;  2FPK A;  3SAF A;  4EZ6 A;  3T5K A;  3C29 A;  3BQ1 A;  2I5H A;  1NKE A;  3THV A;  2C2E A;  1Z3E B;  5J29 A;  3K1Z A;  4ED1 A;  4J9K A;  3C1Z A;  4RQ3 A;  7ICU A;  5AM5 A;  3BZK A;  4O3Q A;  3LYS A;  4IR1 A;  4PZN A;  4QZF A;  5IIK A;  2RP5 A;  3Q8Q B;  3F5A A;  4P0Q A;  3WK9 A;  4RQ2 A;  3RJJ A;  5KAF U;  4F92 B;  3EWA A;  3Q8P B;  4RQN A;  4DFM A;  4F72 A;  3NRW A;  1N2X A;  3Q8K A;  4KTQ A;  2WTF A;  1D8B A;  2LHT A;  3IV6 A;  1SL0 A;  2KJ5 A;  3TAN A;  4UAT A;  3RAQ A;  1QSS A;  3FDS A;  3ZDE A;  3F2C A;  4KLO A;  4OJ5 A;  3JPR A;  4B9M A;  5EE0 A;  2HCF A;  2E8M A;  5J2F A;  3MBY A;  3V72 A;  1KDH A;  3FYH A;  1QCK A;  4DL3 A;  4RUA A;  1XO0 A;  2BPG A;  3RJE A;  2EH9 A;  3KD3 A;  4RQ4 A;  3D2Q A;  1JXE A;  5A0L A;  1C7Y A;  4YP3 A;  5CB1 A;  3MGH A;  3JPN A;  3QEA Z;  2EZY A;  5IIJ A;  1ZQX A;  4OD0 A;  2ASL A;  5BPC A;  4DL6 A;  4PL2 A;  4NV0 A;  3T3F A;  3PW2 A;  5DQI A;  1BPZ A;  3B9J A;  2BCV A;  2R8G A;  2E1F A;  4DQR A;  4I2I A;  4Y2V A;  1SWV A;  3N7P D;  3PVX A;  2QB0 A;  2IMW P;  2WF6 A;  4XA5 A;  2F2A B;  4O5C A;  2HHQ A;  2HMX A;  1RYS A;  1ZQT A;  1COK A;  4M9G A;  2VJ5 A;  2KN7 A;  1A77 A;  3GV8 B;  5HMM A;  4YD2 A;  4ECY A;  3QX7 A;  9ICM A;  8ICK A;  3EW9 A;  4F5Q A;  1P7D A;  4DFD A;  4DOC A;  1RG6 A;  2DKZ A;  4Q8F A;  5KFJ A;  1NJW A;  2G06 A;  2VAN A;  5BOM A;  2HHS A;  2BKE A;  1NK4 A;  1MSW D;  4USA A;  9ICU A;  4YCX A;  2FLP A;  5KFW A;  4F3O A;  2OYY A;  1L7M A;  5AI0 A;  2KOB A;  2KFN A;  4YMN A;  4CF4 A;  4ED3 A;  5JTI A;  4KX5 A;  2XCA A;  2W3R A;  4FE3 A;  5AK4 A;  2BHN A;  4JB3 A;  1ZQN A;  7ICL A;  9ICN A;  4RQ8 A;  4NJ8 A;  5HHI A;  3PMN A;  3TFR A;  1NK9 A;  5J0S A;  1L8O A;  5J0Q A;  1ZD2 P;  2G5I B;  2HI0 A;  2NV3 A;  4EX7 A;  4UB5 A;  5B66 U;  4ELT A;  5DLG A;  1ZQI A;  3CW2 C;  4ED6 A;  1ZJN A;  1KFS A;  2W7P A;  1PVP A;  1HEK A;  3V6J A;  3IM1 A;  4GXK A;  4UAY A;  4EEL A;  2MAX A;  5CP2 A;  2WF8 A;  5ALY A;  5J2J A;  4XUS A;  4DQQ A;  3PW5 A;  2PFO A;  4KIT B;  4NY8 A;  1MQ3 A;  3MGV A;  1T4G A;  1S0O A;  2N1R A;  3GFK B;  3MR3 A;  2W55 A;  3RB6 A;  4QZH A;  2M9N A;  3HJE A;  4TUQ A;  1S97 A;  4ECX A;  2MUT A;  1KEJ A;  4O3N A;  5F9N A;  4NLZ A;  2WB1 C;  1Q8K A;  4ED8 A;  3ALR A;  2JHD A;  1ZRN A;  2AJQ A;  4ED7 A;  5CR0 A;  2Z7J A;  1B22 A;  4KLQ A;  3SAH A;  5AKG A;  3PO4 A;  1A6S A;  4X5V A;  3RBD A;  5J2K A;  2YN4 A;  2MA1 A;  2ZUD A;  3IDW A;  2YML A;  1UCV A;  1S76 D;  1BPX A;  4DF4 A;  3C2K A;  3GV7 B;  7ICF A;  1IM4 A;  2LYH A;  1SGG A;  4QIW F;  2HHV A;  4RQM A;  2KKV A;  4P0P A;  1RQL A;  7ICT A;  2XY6 A;  3PW0 A;  4ED0 A;  1L5U A;  4NL9 C;  4DFK A;  4Q8E A;  2KKP A;  1L8L A;  1V38 A;  3KBB A;  3QU9 A;  5EE1 A;  4Y2Y A;  4AP9 A;  8ICV A;  4TUP A;  5ALO A;  4DOA A;  9ICP A;  1X9W A;  1BPB A;  4KLI A;  5CJ7 A;  2W3S A;  1QLN A;  1JI7 A;  3E2E A;  2C28 A;  2MSN A;  5DG7 A;  4TUS A;  1WWV A;  4TQR A;  3PX6 A;  3E0F A;  3SD7 A;  2IBK A;  5AK5 A;  1A76 A;  1ZQU A;  4RQ7 A;  4I2F A;  1ZQK A;  1S0M A;  3C2L A;  2W9C A;  2ZTD A;  2DQN B;  2E8N A;  2ZTE A;  1J2N A;  2A1J A;  1QSL A;  5J0W A;  3RH6 A;  3M9M B;  2CPR A;  4B9V A;  1RYU A;  5KFZ A;  3UMC A;  3Q8L A;  3BQ7 A;  1F0M A;  2HVI A;  4LVS A;  3RFA A;  1S0N A;  2ASD A;  2KFZ A;  5KFT A;  1DGJ A;  5AI9 A;  1LVH A;  1TAU A;  5AIC A;  4PHA A;  4RQ5 A;  3UQ0 A;  1Z19 A;  1V97 A;  4HYK A;  1UA1 A;  4O3P A;  3WKC A;  3JPO A;  2BQR A;  1DK2 A;  4MEX A;  2HBJ A;  3IN5 A;  1BPD A;  4KLS A;  1XO1 A;  2VKQ A;  1RXW A;  3NGD A;  1KN5 A;  5KFD A;  1LKY B;  4DSL A;  2QKQ A;  2PI4 A;  1Q3V A;  3VCB A;  1SV4 A;  3KZI U;  2FDR A;  3E58 A;  2LMR A;  4EEY A;  3TFS A;  5KFX A;  4YG2 A;  1ZQP A;  3H7I A;  1TE2 A;  3ETR A;  4PHD A;  1TVA A;  1OW5 A;  4UAU A;  5ALZ A;  3PO5 A;  2Y9T A;  3BJY A;  3PW4 A;  4BXO B;  3QUC A;  1LV5 A;  2KSO B;  1PK1 B;  8ICC A;  1RXV A;  5J0T A;  5KFK A;  2YX8 A;  1FFU A;  4Z6F A;  2W7O A;  4KLG A;  5III A;  9ICC A;  9ICI A;  8ICT A;  3MDA A;  5KL1 B;  4RPX A;  5EE9 A;  5HHH A;  1S77 D;  4GC6 A;  2FJ6 A;  3C5G A;  3M8S A;  1KFT A;  4F4Y A;  4I28 A;  2E1E A;  2BDU A;  3CYM A;  2IHM A;  2ZIU A;  3MDC A;  2WAQ C;  2YB4 A;  3BS7 A;  4OCZ A;  1UA0 A;  1VJ5 A;  3PR4 A;  5AKZ A;  4YR2 A;  1IXR A; 
#chains in the Genus database with same CATH homology
 2DL0 A;  2KIV A;  1COK A;  1X66 A;  4PZO A;  1V85 A;  5J8Y A;  1PK3 A;  3BQ7 A;  1F0M A;  3KKA A;  2ES6 A;  2EAM A;  2QAR B;  2ESE A;  1X9X A;  5J8Y C;  3TAC B;  4MHV A;  1RG6 A;  2DKZ A;  3H8M A;  3IDW A;  1UQV A;  1SXE A;  3KKA C;  4PZN A;  2K4P A;  1UCV A;  1SV0 A;  3SEI A;  4IS7 A;  1SGG A;  2E8P A;  2L5Y A;  4RQM A;  4RQN A;  2E8O A;  3TAD A;  5JTI A;  5L1M A;  2Y9U A;  1SV0 C;  2QAR A;  4NL9 A;  5F3X B;  2GLE A;  5KNI A;  1LKY B;  2QKQ A;  4NJ8 A;  1SV4 A;  2B6G A;  4NL9 C;  2LMR A;  1V38 A;  2KG5 A;  1OW5 A;  2E8M A;  2Y9T A;  2LPE A;  1Z1V A;  2EAP A;  1SXD A;  2JV3 A;  1B0X A;  2KE7 A;  2KSO B;  1PK1 B;  3SEN A;  1JI7 A;  1X40 A;  1B4F A;  2D3D A;  2D8C A;  1LKY A;  2F8K A;  3K1R B;  2FE9 A;  2EAO A;  2QB0 B;  1WWV A;  2QB1 A;  2DKX A;  3TAD C;  1OXJ A;  2KMD A;  3BS5 B;  2F3N A;  1WWU A;  5JRT A;  2K60 A;  1DXS A;  2KSO A;  1PK1 A;  2F44 A;  5JU5 A;  3BS7 A;  2QB0 A;  3HIL A;  1KW4 A;  2E8N A;  2EAN A;  2YTU A;  3BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...