2F44A

Crystal structure of the zinc-bound shank sam domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords SH3 and multiple ankyrin repeat domains 3
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f44A00
2KE7A 1COKA 1LKYB 2K60A 2KSOA 2EAOA 1DXSA 1B0XA 4PZNA 1X9XA 3BS7A 1UQVA 1OXJA 2FE9A 2KG5A 2EANA 4MHVA 2KSOB 2ESEA 1V85A 1SXEA 2GLEA 3SEIA 4IS7A 2E8MA 2K4PA 4NL9C 2F44A 3BQ7A 2L5YA 2B6GA 2DKZA 1RG6A 2QB0A 1V38A 3IDWA 1WWUA 2JV3A 5KNIA 1OW5A 2E8NA 1SV0C 1SV0A 1PK3A 4PZOA 1PK1A 5F3XB 3TADC 2YTUA 2QB1A 1X40A 5J8YA 5J8YC 4NJ8A 1SGGA 3TACB 2D8CA 3TADA 2QKQA 1SV4A 1UCVA 2KIVA 2ES6A 4RQNA 2QARA 2EAPA 2KMDA 3H8MA 5JU5A 1SXDA 1JI7A 2F3NA 4NL9A 3BS5B 2D3DA 5JTIA 3KKAC 3K1RB 2E8PA 1KW4A 3BS5A 1X66A 3KKAA 3HILA 1PK1B 2EAMA 1WWVA 1Z1VA 3SENA 5JRTA 2LPEA 2LMRA 1F0MA 2QARB 2DL0A 1B4FA 2Y9TA 2QB0B 5L1MA 4RQMA 2DKXA 2Y9UA 2F8KA 1LKYA 2E8OA
chains in the Genus database with same CATH superfamily
3SQIA 1COKA 3GFKB 5HHHA 1UHUA 2ASDA 4YR2A 1XSLA 2VKQA 1OXJA 2HOIA 1AQ6A 3L3FX 5DDMA 5AHXA 2ZIXB 3GV5B 2K8CB 4YXMA 4RQ5A 3E2EA 2W9CA 1O08A 3OJSA 3MDAA 4UB5A 3QYPA 2CRXA 5AI0A 2HOFA 4F4XA 5IIKA 2B21A 3SZ2A 4NL9C 4UAZA 4NXZA 2ZIVA 5KFOA 3I1YA 1RG6A 3H8WA 4KLDA 3V6HA 1SWVA 3QU4A 4KN4A 5KFZA 4F71A 2AHOB 2W43A 5F3XB 2EQYA 1ZQAA 5L1KA 3WK8A 2JEIA 2M0NA 5J8YA 5ALQA 3M7DA 1XO0A 2D8CA 1HUZA 2FMPA 2HHQA 2E3TA 4JMUA 1LB2B 4M6WB 2XY7A 1FEZA 4NM1A 2LI6A 4NWIA 4JWNA 4NL9A 3PR4A 9ICEA 3O0FA 3RR7A 5CP2A 2MU2A 3C21A 3OHAA 1Q46A 1T4GA 4CE6A 4F50A 4KTQA 2EAMA 4P0PA 5JRTA 5J2KA 4PPXA 2YB1A 5ALUA 2KN7A 8ICQA 4QZ8A 4CF5A 3B9JA 2NRVA 4PL2A 3PX0A 4ED2A 4C0ZA 8ICWA 2HMXA 1F5SA 2K8AA 1Z4NA 5C5JA 1ZQUA 4YD2A 2PFPA 1NKBA 3BJYA 2NRWA 1BPDA 3AMZA 2RQ5A 3UMGA 3Q8RB 2GLEA 4IS7A 4NLGA 1T3NA 2B6GA 1JUDA 1S0VA 2PI5A 3QUCA 4P4MA 5ALKA 3H8SA 8ICIA 3ED5A 3UMCA 4IL6U 5HR7A 1DRGA 3PX4A 4QZBA 4FO6A 5AM0A 4ECQA 3PX6A 7ICSA 2FLPA 5E79U 3ZD9A 1SZPA 4UAVA 1S10A 3AQEA 2H3VA 3PW5A 3H8JA 1NK4A 9ICFA 3K75D 5J0RA 3DDHA 2LHTA 3RAQA 5KT6A 1KTQA 3F53A 1JROA 5AM3A 1KN5A 3WKAA 2PKEA 2V4QA 2K4EA 2FMQA 1LV5A 1NJYA 2H3IA 2RHFA 3BQ2A 3NVWA 4P2HA 4M9LA 4ECZA 4UB6U 4UB1A 2KP7A 3ONNA 3BS5B 4IQWA 3C28A 2W3SA 3ZDEA 5JTIA 3KKAC 5CJ7A 4RPZA 2WAQC 3SMVA 4YMMA 1KW4A 2AH5A 4QNLA 3V7KA 2C2DA 1Q3UA 2BPFA 4U7CA 7ICEA 2RLTA 4BXOB 1DOQA 4YCXA 4I2CA 2H5XA 1ZQWA 4Q8EA 2LMRA 4C8MA 1TV9A 1ZRMA 4I2HA 4EEYA 1JXLA 1L7PA 4C4TA 4ACOA 2HBLA 3AUOA 1UA0A 3N28A 1MA7A 3RB3A 4HYKA 1AROP 3PMLA 1EXNA 1Z00B 3H0LB 4UBCA 4NY8A 1B0XA 1L3VA 8ICGA 1ZOLA 4G3IA 5EWFA 4DS4A 5IIOA 3H0MB 2FPLA 1RYSA 3WKEA 1Z00A 5J0SA 2HVHA 3U26A 4C7ZA 3RTVA 2E8MA 8ICZA 4MEYA 2OCEA 3RJJA 5B66U 3FYHA 3IHQB 4ECUA 5KFBA 1SL0A 1BPZA 4RQ0A 5BPCA 1D9DA 1SV0C 1A6SA 3SAGA 2F1HA 5GTIU 2UVRA 4DLGA 1HIWA 2VA8A 3TFRA 3PMNA 4F5QA 3UQ2A 8ICRA 5HHIA 2P66A 1D9FA 1SV4A 2P6RA 3F2CA 2KZMA 1QLNA 2WAQF 1TFRA 8ICCA 4B9MA 4XRHA 2JMGA 2ZIUB 2KFZA 1TVAA 2E8PA 1NK7A 1Z19A 2MUTB 1T3QA 2Q0ZX 2D6FC 4DQPA 4Z6DA 9ICNA 5ALNA 3JPQA 2KIWA 2QARB 9ICAA 4TQSA 4TQRA 5CB1A 2FDRA 4FBTA 4RPXA 5KT2A 4MEXA 4F92B 2H3QA 5KTQA 5JUMA 3D6JA 5H2FU 5KL8B 1DXSA 5KG0A 4UARA 1SKRA 4KLUA 4I29A 1UQVA 4IR1A 2IOHA 7ICPA 1L3TA 2HHXA 3PY8A 5ALYA 3PZPA 1ZJMA 1X2IA 5KL1B 4J9RA 3AM9A 3RH5A 4B9TA 3BZCA 5AIBA 2QB0A 5BOLA 1WWUA 4DF4A 4PGYA 5DLFA 2JGAA 3GILA 4PHDA 2EDUA 1BVSA 2MA1A 5J2AA 3GIKA 3V72A 1XSNA 1FIQA 3M1YA 3H0RB 1KFDA 5AKYA 3AQFA 4OJ5A 5B5EU 1NOMA 8ICJA 3KFUF 2ES6A 3SI8A 3C29A 2O6KA 5AM1A 1F44A 4JV2A 3PSPA 5ALLA 3TARA 4O3PA 1LVHA 5AK5A 2W9MA 2IHMA 1QSSA 3KHLA 4QZ9A 1IIPA 1ZJNA 2ZJAA 5KFFA 2W7OA 2KJ8A 3SR6A 5L1IA 3CRXA 1A77A 2YN4A 4EYIB 1H38A 1S8OA 2YX8A 3CYMA 3RB6A 1TAQA 4O3RA 4GC7A 3JPPA 5L1LA 4K4HA 4QZHA 3SYZA 1L6NA 3QEAZ 1TAMA 3M9OB 3NASA 2W9CB 1UPHA 5KT4A 2UVUA 2DKXA 2F8KA 2FPKA 3ALRA 1NJWA 3UQ0A 2KSOA 2ZTCA 5AKEA 1XS9D 3TAQA 1L8OA 3C1ZA 3LYSA 2KICA 1NK0A 8ICLA 2ZTEA 5KFJA 7ICUA 4BWJA 5ALVA 9ICUA 3THVA 4Z6EA 2KSOB 3JPRA 3V6JA 2ESEA 1N56A 4QZGA 1Z4OA 2KK0A 3QUQA 4QZDA 3RJKA 3KTQA 1UA1A 2FI1A 7ICQA 4EYHB 4P4OA 1VJ5A 5ALTA 4EX6A 2FLNA 5J0YA 4FE3A 3A0HU 2JV3A 1OW5A 4PZOA 4DL7A 2AGOA 3G6XA 2FLLA 2IMWP 1JMSA 2F77X 2JHDA 4KN7A 4DQSA 5KAIU 1YT3A 2JR5A 3C5FA 2OM6A 7ICVA 2E5SA 4NLCA 4DOBA 4PGXA 5KFKA 4RQNA 2NRTA 3A0BU 2QARA 2BPGA 2EAPA 8ICMA 2FJ6A 3H8MA 3ORYA 2F1JA 4JWMA 2G5HB 2YMQA 4QWDA 3MDCA 5F9NA 2WF9A 5DGAA 2F8LA 4DL4A 4B6JA 3UM9A 1QQ6A 2NRZA 4QZCA 4CDGA 5KG6A 2JZBB 3AU6A 1X66A 4PHPA 9ICLA 4B9UA 4ECYA 5KFDA 3Q8SB 4FBUA 2EZZA 1ZQ1C 1RQNA 1ZD3A 5AK4A 2IOFA 4KMUA 4IRCA 3M6KA 1ZD2P 4Q45A 2ISPA 3OSNA 3HKZC 4JV1A 4Y2XA 3KZXA 5AK3A 1MC8A 2KE7A 3NRZA 1U9LA 5KAFU 8ICAA 3C2MA 3V7JA 1ZRNA 3FAHA 1MQ2A 4C4SA 3BS7A 4UW9A 1U4BA 4RUCA 5J2EA 2FE9A 5DQIA 3AL0B 1A76A 1BPYA 2EANA 4F5NA 4F4WA 1U49A 4JB3A 3SV3A 2BR0A 5AKLA 3F5EA 4PL1A 3SEIA 5HR6A 3JPOA 3ZDAA 4FZNA 5IIMA 3GQCA 5AI6A 7ICGA 1OUQA 2XICA 5KFIA 1RZTA 5D4BA 4R8UB 4ED7A 2BCUA 1TE2A 5KNIA 3OJUA 5HNKA 2WB1C 4J03A 2KD1A 1ZETA 1N63A 3I76A 1BNPA 2IBKA 2H3ZA 2CXYA 4KLSA 1SGGA 1ZQPA 5DBCA 4AP9A 2ATLA 1Q8KA 1UCVA 2KIVA 2FPMA 1CUKA 2KJ9A 1TK0A 3PO5A 4G9BA 1KRPA 1N48A 1X9SA 2KMDA 4C8OA 1Y88A 4TURA 4CF4A 5EE9A 4Q44A 4EBEA 1IXRA 5ALIA 5DQGA 9ICVA 9ICBA 4DLEA 1DK2A 2VJ5A 3SAFA 3PO4A 4LJXA 2YMLA 3V6KA 3T5KA 4ECSA 1N2XA 1ZQDA 3BS5A 4KLFA 4KMOB 4M2YA 4US8A 3WK9A 4FFDA 4DSLA 5DBAA 5J0QA 1RXWA 8ICEA 2V4RA 5AKJA 2HW3A 1K1SA 4Z6FA 5L1MA 2K8BB 3VCBA 2HDOA 2WHEA 3TANA 4YD1A 1SIJA 5ALHA 1U47A 3E58A 2BKEA 1KQQA 4X5VA 2ASLA 4F5OA 2XCPA 2XVTA 1KSPA 3MR2A 4IQVA 1FO4A 2K4PA 5AM2A 5J0UA 4TUSA 3IP4B 3RH6A 5AKZA 1B43A 4B9LA 2W3RA 1QSLA 2E8NA 2H3FA 5HMMA 2WF6A 5ALPA 4EEKA 4M9JA 2LBOA 1RM6C 7ICRA 2JZBA 5DG8A 4IQTA 4PHEA 4I2FA 2RDIA 2RDJA 2E1FA 4GXIA 4Y2SA 3AU2A 5AICA 4R66A 5DG7A 5AI8A 1MN8A 3HW8A 4KLEA 5ALRA 4I2BA 3IV6A 1KFTA 7ICMA 2K4HA 2KNJA 2JH1A 5DB8A 4JK1A 1TK5A 2BQ3A 1VLBA 4M0AA 5J0WA 5ALEA 4ELTA 2HVIA 3HJEA 4NLBA 1J2NA 3WK4A 4Y2UA 4ED3A 2F2AB 2G5IB 1T8EA 2ZIVB 7ICHA 4J9QA 3F2DA 4FZLA 2E8OA 2W7PA 4P0QB 4RT3A 1NZPA 2AJQA 2K89A 2ZJ5A 4IRKA 4RU9A 2HBJA 1TAUA 1KFSA 2KKPA 3H4DA 4GFJA 1S0OA 2JXJA 4A8EA 5KT5A 1ZQBA 5J2JA 1V97A 4YR3A 1YZ7A 2R18A 3PW2A 2VANA 5DB9A 3QUBA 5ALXA 3ISBA 3NTUA 2BCQA 1ZQJA 1SKSA 4Y2TA 2ASJA 2ZG6A 2ZUDA 8ICXA 2VIXA 3IDWA 3RR8A 5KFXA 5AKIA 4Y2YA 1CEZA 5CRXA 4R65A 1QCKA 3PR5B 2R8JA 2OEHA 3T5LA 1N5XA 4IRDA 4DSJA 1ZQNA 1ZQCA 2DGZA 5KG7A 2XCAA 2RRDA 4M9NA 2OWOA 1PVQA 5GTHU 3SD7A 2XY5A 3EWAA 3D2NA 2IA6A 4I2EA 1ZQLA 5KFRA 2W9BA 3PSIA 3JPSA 2DPIA 5C0YA 2JEFA 2AGPA 3GU3A 9ICJA 4Y2JA 2HHUA 1NI3A 1SKWA 3OHBA 2KV2A 1NJXA 2MSNA 4DCCA 3EYZA 5KFVA 2PFOA 4UAUA 5KFCA 5EE3A 5DB6A 2WF7A 4RQ4A 2WFAA 1ZD5A 2DWQA 5KG3A 2UVVA 1S97A 3J81j 2DQNB 4RQMA 4RQ8A 1YZ6A 2K60A 1DK3A 2I1QA 5J29A 4MFAA 4UB8U 4RQ7A 3LVVA 3HT3A 4FS1A 3WK5A 4KLLA 4DSFA 9ICQA 2KZ3A 1C20A 3N97B 7ICTA 2PFQA 1RDFA 4UAWA 4Y2RA 3BQ7A 5TZVA 3MGHA 3LVWA 1CI4A 2LYAA 1NNLA 5KFLA 4M04A 3ETLA 4RUAA 2PXIA 5KFWA 4DL2A 3RB0A 4ELVA 4DO9A 3RF9A 9ICPA 2AQ0A 1CRXA 2XC9A 1MSWD 3M9NB 3UXPA 3DEEA 5EWEA 1XC9A 4QWAA 2Z7JA 5G5GA 4OD0A 2KOBA 9ICKA 3M8RA 3F5AA 2WF5A 4Q43A 5AI9A 1K5OA 3GIMA 3EW9A 2AQ4A 1ZQYA 5DDYA 4C8NA 1ZQEA 4QIWF 8ICYA 1U48A 5JU5A 4DFMA 3M6ZA 5A0LA 2EZYA 2HHVA 2GO7A 1L7OA 2ZXIA 1HJPA 1WG8A 4DSKA 3TAPA 2OXOA 3H7IA 4NLZA 3TKAA 4QWBA 1NKEA 1UT8A 3GV8B 4IQUA 3K4GA 5L1JA 4KLOA 1ZQFA 4DF8A 1D8BA 3KOOA 5KFHA 3QE9Y 3HILA 5AKXA 2B0CA 3SAHA 5DQHA 4O0IA 4YVZA 5KFGA 2IOFK 1NK9A 4ECWA 4PJ0U 1RYRA 3HX0A 2ZTDA 3NRWA 1SB3C 8ICNA 4U6PA 3N7SC 5AM4A 1JRPA 1N62A 5J0TA 5ALGA 1NK8A 1LKYB 3PSFA 2VA2A 4GXJA 3N7RC 2KVSA 2W54A 2A1JB 1XO1A 4DFDA 1ZQGA 1A0PA 2W55A 3UPQA 3RJEA 3WKBA 4F2SA 5KFTA 3H4BA 5ALWA 3MBYA 2KHQA 4YMOA 2N1RA 3KBBA 4QJFB 1N5WA 4OJ6A 1NJZA 3ZDDA 2CPRA 1SL2A 1COOA 7ICFA 1O03A 4F4KA 2BDPA 1V9PA 4DL5A 5KT3A 4P0QA 4J9OA 3LWMA 1JX4A 1QQ7A 2Y1IA 5AIAA 2QB1A 1ECWA 4DSEA 3Q8KA 2BDUA 3I28A 1NK5A 5IIJA 3JPTA 2R8HA 4IC9A 4PGQA 5IIIA 4F4ZA 4EENA 8ICBA 2J6SA 4TUQA 3LDAA 1SXDA 5KG1A 3V7LA 4B9NA 4O5KA 1N61A 4DFJA 5ALSA 1WCNA 9ICOA 1T94A 2WF8A 2WB1F 1ZYQA 3KHGA 5L9XA 2JH7A 3IN5A 4J9PA 3SV4A 3SENA 2NO5A 8ICKA 3T5HA 2P35A 2J6UA 1S76D 4RPYA 4K4GA 5KG4A 2QB0B 2V9WA 3OPXA 3RBEA 2A19A 1ZQSA 3BQ1A 1WUDA 5J2HA 2OH2A 2K4IA 4PZNA 1S9FA 1Z1BA 2YQEA 7ICKA 4E0DA 2KVCA 4B9VA 4NLKA 5K4LA 3ZI4A 4Z6CA 3UMBA 4Q8FA 8ICHA 4EZ6A 1JALA 3Q8PB 4KITB 5KFNA 5HP4A 2L5YA 3MABA 1Z3EB 2FMSA 2DKZA 5J2IA 2ISOA 2VJ4A 3KHHA 2VA3A 4J9LA 1X40A 2ODGA 4NJ8A 5HMLA 4DOAA 4RQ6A 3T5JA 3GIJA 5AKGA 2KJ5A 1IM4A 1ZQTA 4CCHA 1FFVA 1URJA 4YXJA 3CW2C 1BPBA 1ZQIA 4HAIA 1N60A 2XIDA 2XI9A 5J0XA 3PSTA 7ICLA 3IG8A 3EUB2 5KFYA 3QU5A 2OYYA 1FFUA 1ZQRA 2OHFA 4YG2A 5DGBA 4C8KA 4UB3A 2LM4A 1TKDA 2HBMA 3B0XA 3IG5A 3NVVA 3QNMA 2W04A 2HI0A 4ED0A 1Z1VA 1KL9A 2E1EA 3QZ7A 3Q8LA 3FDSA 2DFLA 3AN1A 4O5EA 2ZJ8A 4J9NA 4ZOHC 1KDHA 3RH4A 4AYBC 3MGVA 4J9SA 3N7PD 1RPLA 3EZ5A 3RB4A 1S5LU 1ZQVA 3GV7B 2MUTA 2KTQA 4YN4A 5KG5A 5DBBA 1S0MA 4EBCA 4DQRA 3TFSA 4QZIA 1PVRA 1V85A 4BXOA 2G08A 2J6TA 3MC1A 4J9MA 4DOCA 4Y2QA 8ICUA 2I5HA 1HEKA 5CR0A 2HSZA 1ZQMA 4BDPA 3Q8QB 3WKCA 2JEGA 1V38A 3LWLA 3T3FA 4C4RA 3RFAA 2EH9A 2YMMA 3TI0A 2G07A 3HKZF 5ALDA 2C2EA 1S77D 1SWWA 3L4PA 2BCRA 3UXOA 3K1ZA 4I27A 1ZQOA 5IINA 2ZIWA 3TADA 1C7YA 2A1AA 5AI4A 5KFMA 3NGDA 1J2MA 4R63A 4I2JA 2W8LA 3RRHA 4KLIA 4XA5A 3RJIA 3TQ1A 3QX7A 4QW8A 2Y0SF 3M8SA 4YP3A 2AGQA 2D3DA 3G6YA 7ICNA 4ZH4A 1HUOA 3D2QA 4YMNA 1L3SA 3MR3A 5DKWA 4DFKA 4RQ1A 3MFIA 4KLJA 4UASA 4QWEA 3EPGA 3HWTA 1L8LA 4GXKA 4C7YA 2W03A 4O9MA 4F2RA 1X6IA 3BZKA 2LPEA 2MRLA 2DL0A 2Y9TA 1BPXA 3ISCA 5KT7A 8ICTA 4RQ2A 5AM5A 3R9KA 5AKKA 4GC6A 4QZEA 2Q4TA 1IG6A 4F5PA 2KZZA 1T7PA 4LZDA 4F4YA 2XGPA 1X9XA 2R8KA 5KFUA 1KKXA 4PH5A 2KG5A 4DL6A 3QU9A 2XO7A 1SXEA 4RNOA 2GOLA 3OSPA 9ICIA 1L7NA 2LYHA 3MFHA 3GIIA 1ZQKA 2KFNA 2F44A 1RYUA 3ISDA 4NV0A 2NO4A 1RXVA 4BUGA 5DG9A 4LZGA 1XNSA 4PHAA 1WYGA 5J0OA 4RNMA 4ECRA 4UATA 2QLTA 3WKDA 3RJGA 2ZXHA 1XU4A 3TACB 3IRUA 4M6WA 1BPEA 2MAXA 4YQWA 4OJOA 2M9NA 5J0PA 5CEHA 1Q3VA 3H40A 5KFSA 1ED1A 3FM9A 4Y2VA 3OTQA 2DUYA 4QW9A 3NVZA 4J9KA 3MR6A 3S6JA 2IHNA 3D2SA 3PW0A 1TK8A 4R64A 3FC4A 1XSPA 5J2DA 4O3QA 4M47A 4B9SA 3K1RB 4UBBA 2LM1A 3F2BA 2W9BB 3L5KA 2ZIUA 4AYBF 4DQQA 1SZHA 4OJLA 2R8IA 3BQ0A 1QQ5A 1WWVA 1KEJA 2C2RA 3WU2U 9ICHA 7ICJA 4NM2A 3PW7A 1PUZA 3QUTA 5AKHA 2NRXA 4ED6A 5DB7A 2JEJA 3M9MB 2C28A 1P7DA 3B0YA 5D46A 1SL1A 4RT2A 9ICWA 1LKYA 4C8LA 3KD3A 4DFPA 1NZBA 1ZQXA 2PI4A 5EWGA 4DS5A 1QTMA 5CWRA 4KLGA 2GWSA 9ICSA 8ICPA 2ZIXA 3BQTA 1ZQHA 2YB4A 5ALFA 1S0NA 2HHSA 1GO3F 3ZD8A 2BCVA 3UXNA 4FS2A 2W8KA 4F5RA 3ZDCA 4LVSA 5DLGA 4USAA 3HPOA 3PVXA 4KX3A 4M9HA 4UB4A 9ICGA 2XY6A 3BDPA 1J97A 1XWLA 5J8YC 3RBDA 1L5UA 4O3MA 4IR9A 4I2DA 3WK6A 2C22A 2HHTA 4F72A 5CHGA 9ICMA 2NYVA 2BQRA 2F1IA 5F9LA 5TISU 5KFEA 4ECTA 3QXGA 3ZDBA 1JI7A 1D8LA 5AI5A 1IV8A 4ELUA 3C5GA 2NV3A 4RNNA 2PMZC 4OJPA 2DPJA 4CGZA 2G0AA 4US9A 1WCLA 4GLXA 3C2KA 4EELA 5EOZA 1PK1B 2CN1A 4F8RA 2DF4B 2RP5A 8ICFA 2PMZF 9ICRA 2AU0A 1QSYA 5EE1A 1ZD4A 4YFKA 2HOQA 5ALZA 1JN3A 2ZUCA 3QEBZ 5EE0A 1PK3A 1X9MA 2HBKA 2Y0SC 4F91B 3KHRA 7ICIA 4UAYA 1BNOA 4OO1J 1X42A 4DQIA 5ALJA 2KHVA 4MF8A 4MHVA 4JUZA 5ALOA 2BHNA 1ZXIA 2G09A 3MR5A 9ICTA 3NVYA 4O3SA 5J2BA 4UQGA 3AEVA 2R8GA 2DBYA 4C80A 3DV9A 4DWIA 1PK1A 3TADC 3ETRA 3QU2A 2YTUA 3QU7A 4CNQA 1NKCA 4BGDA 2I9GA 2P6UA 4OCZA 4Y2PA 4KLQA 1B22A 3C23A 3CP8A 1JIHA 4XQ8A 4P4PA 2AXTU 2I6XA 3OGUA 2YY6A 2PFNA 2YMPA 1M6YA 4DL3A 1RQLA 2F3NA 4O3NA 2LYBA 4BWMA 1QH9A 5D49A 3HRDD 4RQ3A 4M9GA 3PNCA 4WJ3B 1JXEA 2EZXA 4NLNA 4EZ9A 4EBDA 4KLTA 2KKVA 5G5HA 1PVPA 8ICSA 3ICXA 2A3VA 3RRGA 4I2GA 1F0MA 4F93B 4BJQA 2G06A 4BX9C 3GDXA 4GIBA 2LKYA 4QWCA 2BCSA 3VC8A 4QIWC 2KEYA 3E0FA 3RJFA 3WK7A 3QZ8A 2A1JA 3NS1A 5BOMA 3G6VA 4EX7A 2EAOA 1L3UA 3LK9A 5J2CA 4YR0A 5KFQA 1U45A 4R8UA 4QZAA 2ALZA 4F3OA 9ICXA 2BQUA 1D8YA 4K4IA 4DEZA 5CA7A 2HCFA 1DGJA 4I2IA 5KFAA 4TUPA 5KFPA 4I2AA 2BPCA 2Y1JA 1KBUA 3RAXA 1VDVA 4ECVA 2XGQA 4ICAA 1ZQQA 2BGWA 3NUQA 3C2LA 1NK6A 3CNHA 4P0PB 1X6JA 1SV0A 4MFCA 5AK6A 4UB2A 5KG2A 1DGSA 4O3OA 2HHWA 4CRXA 5ALMA 4MF2A 8ICVA 2ZIWB 4ECXA 4ED1A 4DSIA 3MGIA 4ED8A 2QKQA 5FP0A 1BGXT 4JV0A 4I28A 4FZMA 8ICOA 4CF3A 9ICCA 3EPIA 1X9WA 3N4MB 5T14A 2W9AA 2JRZA 7ICOA 2W11A 1ZQZA 4KLMA 4QZFA 1PZNA 4RZRA 2WTFA 3IM1A 3HP6A 4XUSA 2F76X 5IILA 4KLHA 4MFFA 3GZFA 5J2GA 3JPNA 1MQ3A 3KZIU 2BZFA 3KKAA 1L7MA 3PV8A 2UVWA 3C1YA 2GH1A 3PW4A 3Q8MA 3T79A 4O5CA 1K1QA 4KX5A 1UT5A 3RJHA 1KLNA 1B4FA 5J2FA 2ZUBA 2Y9UA
chains in the Genus database with same CATH topology
2KE7A 1COKA 1LKYB 2K60A 2KSOA 2EAOA 1DXSA 1B0XA 4PZNA 1X9XA 3BS7A 1UQVA 1OXJA 2FE9A 2KG5A 2EANA 4MHVA 2KSOB 2ESEA 1V85A 1SXEA 2GLEA 3SEIA 4IS7A 2E8MA 2K4PA 4NL9C 2F44A 3BQ7A 2L5YA 2B6GA 2DKZA 1RG6A 2QB0A 1V38A 3IDWA 1WWUA 2JV3A 5KNIA 1OW5A 2E8NA 1SV0C 1SV0A 1PK3A 4PZOA 1PK1A 5F3XB 3TADC 2YTUA 2QB1A 1X40A 5J8YA 5J8YC 4NJ8A 1SGGA 3TACB 2D8CA 3TADA 2QKQA 1SV4A 1UCVA 2KIVA 2ES6A 4RQNA 2QARA 2EAPA 2KMDA 3H8MA 5JU5A 1SXDA 1JI7A 2F3NA 4NL9A 3BS5B 2D3DA 5JTIA 3KKAC 3K1RB 2E8PA 1KW4A 3BS5A 1X66A 3KKAA 3HILA 1PK1B 2EAMA 1WWVA 1Z1VA 3SENA 5JRTA 2LPEA 2LMRA 1F0MA 2QARB 2DL0A 1B4FA 2Y9TA 2QB0B 5L1MA 4RQMA 2DKXA 2Y9UA 2F8KA 1LKYA 2E8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE7 A;  1COK A;  1LKY B;  2K60 A;  2KSO A;  2EAO A;  1DXS A;  1B0X A;  4PZN A;  1X9X A;  3BS7 A;  1UQV A;  1OXJ A;  2FE9 A;  2KG5 A;  2EAN A;  4MHV A;  2KSO B;  2ESE A;  1V85 A;  1SXE A;  2GLE A;  3SEI A;  4IS7 A;  2E8M A;  2K4P A;  4NL9 C;  2F44 A;  3BQ7 A;  2L5Y A;  2B6G A;  2DKZ A;  1RG6 A;  2QB0 A;  1V38 A;  3IDW A;  1WWU A;  2JV3 A;  5KNI A;  1OW5 A;  2E8N A;  1SV0 C;  1SV0 A;  1PK3 A;  4PZO A;  1PK1 A;  5F3X B;  3TAD C;  2YTU A;  2QB1 A;  1X40 A;  5J8Y A;  5J8Y C;  4NJ8 A;  1SGG A;  3TAC B;  2D8C A;  3TAD A;  2QKQ A;  1SV4 A;  1UCV A;  2KIV A;  2ES6 A;  4RQN A;  2QAR A;  2EAP A;  2KMD A;  3H8M A;  5JU5 A;  1SXD A;  1JI7 A;  2F3N A;  4NL9 A;  3BS5 B;  2D3D A;  5JTI A;  3KKA C;  3K1R B;  2E8P A;  1KW4 A;  3BS5 A;  1X66 A;  3KKA A;  3HIL A;  1PK1 B;  2EAM A;  1WWV A;  1Z1V A;  3SEN A;  5JRT A;  2LPE A;  2LMR A;  1F0M A;  2QAR B;  2DL0 A;  1B4F A;  2Y9T A;  2QB0 B;  5L1M A;  4RQM A;  2DKX A;  2Y9U A;  2F8K A;  1LKY A;  2E8O A; 
#chains in the Genus database with same CATH topology
 3SQI A;  1COK A;  3GFK B;  5HHH A;  1UHU A;  2ASD A;  4YR2 A;  1XSL A;  2VKQ A;  1OXJ A;  2HOI A;  1AQ6 A;  3L3F X;  5DDM A;  5AHX A;  2ZIX B;  3GV5 B;  2K8C B;  4YXM A;  4RQ5 A;  3E2E A;  2W9C A;  1O08 A;  3OJS A;  3MDA A;  4UB5 A;  3QYP A;  2CRX A;  5AI0 A;  2HOF A;  4F4X A;  5IIK A;  2B21 A;  3SZ2 A;  4NL9 C;  4UAZ A;  4NXZ A;  2ZIV A;  5KFO A;  3I1Y A;  1RG6 A;  3H8W A;  4KLD A;  3V6H A;  1SWV A;  3QU4 A;  4KN4 A;  5KFZ A;  4F71 A;  2AHO B;  2W43 A;  5F3X B;  2EQY A;  1ZQA A;  5L1K A;  3WK8 A;  2JEI A;  2M0N A;  5J8Y A;  5ALQ A;  3M7D A;  1XO0 A;  2D8C A;  1HUZ A;  2FMP A;  2HHQ A;  2E3T A;  4JMU A;  1LB2 B;  4M6W B;  2XY7 A;  1FEZ A;  4NM1 A;  2LI6 A;  4NWI A;  4JWN A;  4NL9 A;  3PR4 A;  9ICE A;  3O0F A;  3RR7 A;  5CP2 A;  2MU2 A;  3C21 A;  3OHA A;  1Q46 A;  1T4G A;  4CE6 A;  4F50 A;  4KTQ A;  2EAM A;  4P0P A;  5JRT A;  5J2K A;  4PPX A;  2YB1 A;  5ALU A;  2KN7 A;  8ICQ A;  4QZ8 A;  4CF5 A;  3B9J A;  2NRV A;  4PL2 A;  3PX0 A;  4ED2 A;  4C0Z A;  8ICW A;  2HMX A;  1F5S A;  2K8A A;  1Z4N A;  5C5J A;  1ZQU A;  4YD2 A;  2PFP A;  1NKB A;  3BJY A;  2NRW A;  1BPD A;  3AMZ A;  2RQ5 A;  3UMG A;  3Q8R B;  2GLE A;  4IS7 A;  4NLG A;  1T3N A;  2B6G A;  1JUD A;  1S0V A;  2PI5 A;  3QUC A;  4P4M A;  5ALK A;  3H8S A;  8ICI A;  3ED5 A;  3UMC A;  4IL6 U;  5HR7 A;  1DRG A;  3PX4 A;  4QZB A;  4FO6 A;  5AM0 A;  4ECQ A;  3PX6 A;  7ICS A;  2FLP A;  5E79 U;  3ZD9 A;  1SZP A;  4UAV A;  1S10 A;  3AQE A;  2H3V A;  3PW5 A;  3H8J A;  1NK4 A;  9ICF A;  3K75 D;  5J0R A;  3DDH A;  2LHT A;  3RAQ A;  5KT6 A;  1KTQ A;  3F53 A;  1JRO A;  5AM3 A;  1KN5 A;  3WKA A;  2PKE A;  2V4Q A;  2K4E A;  2FMQ A;  1LV5 A;  1NJY A;  2H3I A;  2RHF A;  3BQ2 A;  3NVW A;  4P2H A;  4M9L A;  4ECZ A;  4UB6 U;  4UB1 A;  2KP7 A;  3ONN A;  3BS5 B;  4IQW A;  3C28 A;  2W3S A;  3ZDE A;  5JTI A;  3KKA C;  5CJ7 A;  4RPZ A;  2WAQ C;  3SMV A;  4YMM A;  1KW4 A;  2AH5 A;  4QNL A;  3V7K A;  2C2D A;  1Q3U A;  2BPF A;  4U7C A;  7ICE A;  2RLT A;  4BXO B;  1DOQ A;  4YCX A;  4I2C A;  2H5X A;  1ZQW A;  4Q8E A;  2LMR A;  4C8M A;  1TV9 A;  1ZRM A;  4I2H A;  4EEY A;  1JXL A;  1L7P A;  4C4T A;  4ACO A;  2HBL A;  3AUO A;  1UA0 A;  3N28 A;  1MA7 A;  3RB3 A;  4HYK A;  1ARO P;  3PML A;  1EXN A;  1Z00 B;  3H0L B;  4UBC A;  4NY8 A;  1B0X A;  1L3V A;  8ICG A;  1ZOL A;  4G3I A;  5EWF A;  4DS4 A;  5IIO A;  3H0M B;  2FPL A;  1RYS A;  3WKE A;  1Z00 A;  5J0S A;  2HVH A;  3U26 A;  4C7Z A;  3RTV A;  2E8M A;  8ICZ A;  4MEY A;  2OCE A;  3RJJ A;  5B66 U;  3FYH A;  3IHQ B;  4ECU A;  5KFB A;  1SL0 A;  1BPZ A;  4RQ0 A;  5BPC A;  1D9D A;  1SV0 C;  1A6S A;  3SAG A;  2F1H A;  5GTI U;  2UVR A;  4DLG A;  1HIW A;  2VA8 A;  3TFR A;  3PMN A;  4F5Q A;  3UQ2 A;  8ICR A;  5HHI A;  2P66 A;  1D9F A;  1SV4 A;  2P6R A;  3F2C A;  2KZM A;  1QLN A;  2WAQ F;  1TFR A;  8ICC A;  4B9M A;  4XRH A;  2JMG A;  2ZIU B;  2KFZ A;  1TVA A;  2E8P A;  1NK7 A;  1Z19 A;  2MUT B;  1T3Q A;  2Q0Z X;  2D6F C;  4DQP A;  4Z6D A;  9ICN A;  5ALN A;  3JPQ A;  2KIW A;  2QAR B;  9ICA A;  4TQS A;  4TQR A;  5CB1 A;  2FDR A;  4FBT A;  4RPX A;  5KT2 A;  4MEX A;  4F92 B;  2H3Q A;  5KTQ A;  5JUM A;  3D6J A;  5H2F U;  5KL8 B;  1DXS A;  5KG0 A;  4UAR A;  1SKR A;  4KLU A;  4I29 A;  1UQV A;  4IR1 A;  2IOH A;  7ICP A;  1L3T A;  2HHX A;  3PY8 A;  5ALY A;  3PZP A;  1ZJM A;  1X2I A;  5KL1 B;  4J9R A;  3AM9 A;  3RH5 A;  4B9T A;  3BZC A;  5AIB A;  2QB0 A;  5BOL A;  1WWU A;  4DF4 A;  4PGY A;  5DLF A;  2JGA A;  3GIL A;  4PHD A;  2EDU A;  1BVS A;  2MA1 A;  5J2A A;  3GIK A;  3V72 A;  1XSN A;  1FIQ A;  3M1Y A;  3H0R B;  1KFD A;  5AKY A;  3AQF A;  4OJ5 A;  5B5E U;  1NOM A;  8ICJ A;  3KFU F;  2ES6 A;  3SI8 A;  3C29 A;  2O6K A;  5AM1 A;  1F44 A;  4JV2 A;  3PSP A;  5ALL A;  3TAR A;  4O3P A;  1LVH A;  5AK5 A;  2W9M A;  2IHM A;  1QSS A;  3KHL A;  4QZ9 A;  1IIP A;  1ZJN A;  2ZJA A;  5KFF A;  2W7O A;  2KJ8 A;  3SR6 A;  5L1I A;  3CRX A;  1A77 A;  2YN4 A;  4EYI B;  1H38 A;  1S8O A;  2YX8 A;  3CYM A;  3RB6 A;  1TAQ A;  4O3R A;  4GC7 A;  3JPP A;  5L1L A;  4K4H A;  4QZH A;  3SYZ A;  1L6N A;  3QEA Z;  1TAM A;  3M9O B;  3NAS A;  2W9C B;  1UPH A;  5KT4 A;  2UVU A;  2DKX A;  2F8K A;  2FPK A;  3ALR A;  1NJW A;  3UQ0 A;  2KSO A;  2ZTC A;  5AKE A;  1XS9 D;  3TAQ A;  1L8O A;  3C1Z A;  3LYS A;  2KIC A;  1NK0 A;  8ICL A;  2ZTE A;  5KFJ A;  7ICU A;  4BWJ A;  5ALV A;  9ICU A;  3THV A;  4Z6E A;  2KSO B;  3JPR A;  3V6J A;  2ESE A;  1N56 A;  4QZG A;  1Z4O A;  2KK0 A;  3QUQ A;  4QZD A;  3RJK A;  3KTQ A;  1UA1 A;  2FI1 A;  7ICQ A;  4EYH B;  4P4O A;  1VJ5 A;  5ALT A;  4EX6 A;  2FLN A;  5J0Y A;  4FE3 A;  3A0H U;  2JV3 A;  1OW5 A;  4PZO A;  4DL7 A;  2AGO A;  3G6X A;  2FLL A;  2IMW P;  1JMS A;  2F77 X;  2JHD A;  4KN7 A;  4DQS A;  5KAI U;  1YT3 A;  2JR5 A;  3C5F A;  2OM6 A;  7ICV A;  2E5S A;  4NLC A;  4DOB A;  4PGX A;  5KFK A;  4RQN A;  2NRT A;  3A0B U;  2QAR A;  2BPG A;  2EAP A;  8ICM A;  2FJ6 A;  3H8M A;  3ORY A;  2F1J A;  4JWM A;  2G5H B;  2YMQ A;  4QWD A;  3MDC A;  5F9N A;  2WF9 A;  5DGA A;  2F8L A;  4DL4 A;  4B6J A;  3UM9 A;  1QQ6 A;  2NRZ A;  4QZC A;  4CDG A;  5KG6 A;  2JZB B;  3AU6 A;  1X66 A;  4PHP A;  9ICL A;  4B9U A;  4ECY A;  5KFD A;  3Q8S B;  4FBU A;  2EZZ A;  1ZQ1 C;  1RQN A;  1ZD3 A;  5AK4 A;  2IOF A;  4KMU A;  4IRC A;  3M6K A;  1ZD2 P;  4Q45 A;  2ISP A;  3OSN A;  3HKZ C;  4JV1 A;  4Y2X A;  3KZX A;  5AK3 A;  1MC8 A;  2KE7 A;  3NRZ A;  1U9L A;  5KAF U;  8ICA A;  3C2M A;  3V7J A;  1ZRN A;  3FAH A;  1MQ2 A;  4C4S A;  3BS7 A;  4UW9 A;  1U4B A;  4RUC A;  5J2E A;  2FE9 A;  5DQI A;  3AL0 B;  1A76 A;  1BPY A;  2EAN A;  4F5N A;  4F4W A;  1U49 A;  4JB3 A;  3SV3 A;  2BR0 A;  5AKL A;  3F5E A;  4PL1 A;  3SEI A;  5HR6 A;  3JPO A;  3ZDA A;  4FZN A;  5IIM A;  3GQC A;  5AI6 A;  7ICG A;  1OUQ A;  2XIC A;  5KFI A;  1RZT A;  5D4B A;  4R8U B;  4ED7 A;  2BCU A;  1TE2 A;  5KNI A;  3OJU A;  5HNK A;  2WB1 C;  4J03 A;  2KD1 A;  1ZET A;  1N63 A;  3I76 A;  1BNP A;  2IBK A;  2H3Z A;  2CXY A;  4KLS A;  1SGG A;  1ZQP A;  5DBC A;  4AP9 A;  2ATL A;  1Q8K A;  1UCV A;  2KIV A;  2FPM A;  1CUK A;  2KJ9 A;  1TK0 A;  3PO5 A;  4G9B A;  1KRP A;  1N48 A;  1X9S A;  2KMD A;  4C8O A;  1Y88 A;  4TUR A;  4CF4 A;  5EE9 A;  4Q44 A;  4EBE A;  1IXR A;  5ALI A;  5DQG A;  9ICV A;  9ICB A;  4DLE A;  1DK2 A;  2VJ5 A;  3SAF A;  3PO4 A;  4LJX A;  2YML A;  3V6K A;  3T5K A;  4ECS A;  1N2X A;  1ZQD A;  3BS5 A;  4KLF A;  4KMO B;  4M2Y A;  4US8 A;  3WK9 A;  4FFD A;  4DSL A;  5DBA A;  5J0Q A;  1RXW A;  8ICE A;  2V4R A;  5AKJ A;  2HW3 A;  1K1S A;  4Z6F A;  5L1M A;  2K8B B;  3VCB A;  2HDO A;  2WHE A;  3TAN A;  4YD1 A;  1SIJ A;  5ALH A;  1U47 A;  3E58 A;  2BKE A;  1KQQ A;  4X5V A;  2ASL A;  4F5O A;  2XCP A;  2XVT A;  1KSP A;  3MR2 A;  4IQV A;  1FO4 A;  2K4P A;  5AM2 A;  5J0U A;  4TUS A;  3IP4 B;  3RH6 A;  5AKZ A;  1B43 A;  4B9L A;  2W3R A;  1QSL A;  2E8N A;  2H3F A;  5HMM A;  2WF6 A;  5ALP A;  4EEK A;  4M9J A;  2LBO A;  1RM6 C;  7ICR A;  2JZB A;  5DG8 A;  4IQT A;  4PHE A;  4I2F A;  2RDI A;  2RDJ A;  2E1F A;  4GXI A;  4Y2S A;  3AU2 A;  5AIC A;  4R66 A;  5DG7 A;  5AI8 A;  1MN8 A;  3HW8 A;  4KLE A;  5ALR A;  4I2B A;  3IV6 A;  1KFT A;  7ICM A;  2K4H A;  2KNJ A;  2JH1 A;  5DB8 A;  4JK1 A;  1TK5 A;  2BQ3 A;  1VLB A;  4M0A A;  5J0W A;  5ALE A;  4ELT A;  2HVI A;  3HJE A;  4NLB A;  1J2N A;  3WK4 A;  4Y2U A;  4ED3 A;  2F2A B;  2G5I B;  1T8E A;  2ZIV B;  7ICH A;  4J9Q A;  3F2D A;  4FZL A;  2E8O A;  2W7P A;  4P0Q B;  4RT3 A;  1NZP A;  2AJQ A;  2K89 A;  2ZJ5 A;  4IRK A;  4RU9 A;  2HBJ A;  1TAU A;  1KFS A;  2KKP A;  3H4D A;  4GFJ A;  1S0O A;  2JXJ A;  4A8E A;  5KT5 A;  1ZQB A;  5J2J A;  1V97 A;  4YR3 A;  1YZ7 A;  2R18 A;  3PW2 A;  2VAN A;  5DB9 A;  3QUB A;  5ALX A;  3ISB A;  3NTU A;  2BCQ A;  1ZQJ A;  1SKS A;  4Y2T A;  2ASJ A;  2ZG6 A;  2ZUD A;  8ICX A;  2VIX A;  3IDW A;  3RR8 A;  5KFX A;  5AKI A;  4Y2Y A;  1CEZ A;  5CRX A;  4R65 A;  1QCK A;  3PR5 B;  2R8J A;  2OEH A;  3T5L A;  1N5X A;  4IRD A;  4DSJ A;  1ZQN A;  1ZQC A;  2DGZ A;  5KG7 A;  2XCA A;  2RRD A;  4M9N A;  2OWO A;  1PVQ A;  5GTH U;  3SD7 A;  2XY5 A;  3EWA A;  3D2N A;  2IA6 A;  4I2E A;  1ZQL A;  5KFR A;  2W9B A;  3PSI A;  3JPS A;  2DPI A;  5C0Y A;  2JEF A;  2AGP A;  3GU3 A;  9ICJ A;  4Y2J A;  2HHU A;  1NI3 A;  1SKW A;  3OHB A;  2KV2 A;  1NJX A;  2MSN A;  4DCC A;  3EYZ A;  5KFV A;  2PFO A;  4UAU A;  5KFC A;  5EE3 A;  5DB6 A;  2WF7 A;  4RQ4 A;  2WFA A;  1ZD5 A;  2DWQ A;  5KG3 A;  2UVV A;  1S97 A;  3J81 j;  2DQN B;  4RQM A;  4RQ8 A;  1YZ6 A;  2K60 A;  1DK3 A;  2I1Q A;  5J29 A;  4MFA A;  4UB8 U;  4RQ7 A;  3LVV A;  3HT3 A;  4FS1 A;  3WK5 A;  4KLL A;  4DSF A;  9ICQ A;  2KZ3 A;  1C20 A;  3N97 B;  7ICT A;  2PFQ A;  1RDF A;  4UAW A;  4Y2R A;  3BQ7 A;  5TZV A;  3MGH A;  3LVW A;  1CI4 A;  2LYA A;  1NNL A;  5KFL A;  4M04 A;  3ETL A;  4RUA A;  2PXI A;  5KFW A;  4DL2 A;  3RB0 A;  4ELV A;  4DO9 A;  3RF9 A;  9ICP A;  2AQ0 A;  1CRX A;  2XC9 A;  1MSW D;  3M9N B;  3UXP A;  3DEE A;  5EWE A;  1XC9 A;  4QWA A;  2Z7J A;  5G5G A;  4OD0 A;  2KOB A;  9ICK A;  3M8R A;  3F5A A;  2WF5 A;  4Q43 A;  5AI9 A;  1K5O A;  3GIM A;  3EW9 A;  2AQ4 A;  1ZQY A;  5DDY A;  4C8N A;  1ZQE A;  4QIW F;  8ICY A;  1U48 A;  5JU5 A;  4DFM A;  3M6Z A;  5A0L A;  2EZY A;  2HHV A;  2GO7 A;  1L7O A;  2ZXI A;  1HJP A;  1WG8 A;  4DSK A;  3TAP A;  2OXO A;  3H7I A;  4NLZ A;  3TKA A;  4QWB A;  1NKE A;  1UT8 A;  3GV8 B;  4IQU A;  3K4G A;  5L1J A;  4KLO A;  1ZQF A;  4DF8 A;  1D8B A;  3KOO A;  5KFH A;  3QE9 Y;  3HIL A;  5AKX A;  2B0C A;  3SAH A;  5DQH A;  4O0I A;  4YVZ A;  5KFG A;  2IOF K;  1NK9 A;  4ECW A;  4PJ0 U;  1RYR A;  3HX0 A;  2ZTD A;  3NRW A;  1SB3 C;  8ICN A;  4U6P A;  3N7S C;  5AM4 A;  1JRP A;  1N62 A;  5J0T A;  5ALG A;  1NK8 A;  1LKY B;  3PSF A;  2VA2 A;  4GXJ A;  3N7R C;  2KVS A;  2W54 A;  2A1J B;  1XO1 A;  4DFD A;  1ZQG A;  1A0P A;  2W55 A;  3UPQ A;  3RJE A;  3WKB A;  4F2S A;  5KFT A;  3H4B A;  5ALW A;  3MBY A;  2KHQ A;  4YMO A;  2N1R A;  3KBB A;  4QJF B;  1N5W A;  4OJ6 A;  1NJZ A;  3ZDD A;  2CPR A;  1SL2 A;  1COO A;  7ICF A;  1O03 A;  4F4K A;  2BDP A;  1V9P A;  4DL5 A;  5KT3 A;  4P0Q A;  4J9O A;  3LWM A;  1JX4 A;  1QQ7 A;  2Y1I A;  5AIA A;  2QB1 A;  1ECW A;  4DSE A;  3Q8K A;  2BDU A;  3I28 A;  1NK5 A;  5IIJ A;  3JPT A;  2R8H A;  4IC9 A;  4PGQ A;  5III A;  4F4Z A;  4EEN A;  8ICB A;  2J6S A;  4TUQ A;  3LDA A;  1SXD A;  5KG1 A;  3V7L A;  4B9N A;  4O5K A;  1N61 A;  4DFJ A;  5ALS A;  1WCN A;  9ICO A;  1T94 A;  2WF8 A;  2WB1 F;  1ZYQ A;  3KHG A;  5L9X A;  2JH7 A;  3IN5 A;  4J9P A;  3SV4 A;  3SEN A;  2NO5 A;  8ICK A;  3T5H A;  2P35 A;  2J6U A;  1S76 D;  4RPY A;  4K4G A;  5KG4 A;  2QB0 B;  2V9W A;  3OPX A;  3RBE A;  2A19 A;  1ZQS A;  3BQ1 A;  1WUD A;  5J2H A;  2OH2 A;  2K4I A;  4PZN A;  1S9F A;  1Z1B A;  2YQE A;  7ICK A;  4E0D A;  2KVC A;  4B9V A;  4NLK A;  5K4L A;  3ZI4 A;  4Z6C A;  3UMB A;  4Q8F A;  8ICH A;  4EZ6 A;  1JAL A;  3Q8P B;  4KIT B;  5KFN A;  5HP4 A;  2L5Y A;  3MAB A;  1Z3E B;  2FMS A;  2DKZ A;  5J2I A;  2ISO A;  2VJ4 A;  3KHH A;  2VA3 A;  4J9L A;  1X40 A;  2ODG A;  4NJ8 A;  5HML A;  4DOA A;  4RQ6 A;  3T5J A;  3GIJ A;  5AKG A;  2KJ5 A;  1IM4 A;  1ZQT A;  4CCH A;  1FFV A;  1URJ A;  4YXJ A;  3CW2 C;  1BPB A;  1ZQI A;  4HAI A;  1N60 A;  2XID A;  2XI9 A;  5J0X A;  3PST A;  7ICL A;  3IG8 A;  3EUB 2;  5KFY A;  3QU5 A;  2OYY A;  1FFU A;  1ZQR A;  2OHF A;  4YG2 A;  5DGB A;  4C8K A;  4UB3 A;  2LM4 A;  1TKD A;  2HBM A;  3B0X A;  3IG5 A;  3NVV A;  3QNM A;  2W04 A;  2HI0 A;  4ED0 A;  1Z1V A;  1KL9 A;  2E1E A;  3QZ7 A;  3Q8L A;  3FDS A;  2DFL A;  3AN1 A;  4O5E A;  2ZJ8 A;  4J9N A;  4ZOH C;  1KDH A;  3RH4 A;  4AYB C;  3MGV A;  4J9S A;  3N7P D;  1RPL A;  3EZ5 A;  3RB4 A;  1S5L U;  1ZQV A;  3GV7 B;  2MUT A;  2KTQ A;  4YN4 A;  5KG5 A;  5DBB A;  1S0M A;  4EBC A;  4DQR A;  3TFS A;  4QZI A;  1PVR A;  1V85 A;  4BXO A;  2G08 A;  2J6T A;  3MC1 A;  4J9M A;  4DOC A;  4Y2Q A;  8ICU A;  2I5H A;  1HEK A;  5CR0 A;  2HSZ A;  1ZQM A;  4BDP A;  3Q8Q B;  3WKC A;  2JEG A;  1V38 A;  3LWL A;  3T3F A;  4C4R A;  3RFA A;  2EH9 A;  2YMM A;  3TI0 A;  2G07 A;  3HKZ F;  5ALD A;  2C2E A;  1S77 D;  1SWW A;  3L4P A;  2BCR A;  3UXO A;  3K1Z A;  4I27 A;  1ZQO A;  5IIN A;  2ZIW A;  3TAD A;  1C7Y A;  2A1A A;  5AI4 A;  5KFM A;  3NGD A;  1J2M A;  4R63 A;  4I2J A;  2W8L A;  3RRH A;  4KLI A;  4XA5 A;  3RJI A;  3TQ1 A;  3QX7 A;  4QW8 A;  2Y0S F;  3M8S A;  4YP3 A;  2AGQ A;  2D3D A;  3G6Y A;  7ICN A;  4ZH4 A;  1HUO A;  3D2Q A;  4YMN A;  1L3S A;  3MR3 A;  5DKW A;  4DFK A;  4RQ1 A;  3MFI A;  4KLJ A;  4UAS A;  4QWE A;  3EPG A;  3HWT A;  1L8L A;  4GXK A;  4C7Y A;  2W03 A;  4O9M A;  4F2R A;  1X6I A;  3BZK A;  2LPE A;  2MRL A;  2DL0 A;  2Y9T A;  1BPX A;  3ISC A;  5KT7 A;  8ICT A;  4RQ2 A;  5AM5 A;  3R9K A;  5AKK A;  4GC6 A;  4QZE A;  2Q4T A;  1IG6 A;  4F5P A;  2KZZ A;  1T7P A;  4LZD A;  4F4Y A;  2XGP A;  1X9X A;  2R8K A;  5KFU A;  1KKX A;  4PH5 A;  2KG5 A;  4DL6 A;  3QU9 A;  2XO7 A;  1SXE A;  4RNO A;  2GOL A;  3OSP A;  9ICI A;  1L7N A;  2LYH A;  3MFH A;  3GII A;  1ZQK A;  2KFN A;  2F44 A;  1RYU A;  3ISD A;  4NV0 A;  2NO4 A;  1RXV A;  4BUG A;  5DG9 A;  4LZG A;  1XNS A;  4PHA A;  1WYG A;  5J0O A;  4RNM A;  4ECR A;  4UAT A;  2QLT A;  3WKD A;  3RJG A;  2ZXH A;  1XU4 A;  3TAC B;  3IRU A;  4M6W A;  1BPE A;  2MAX A;  4YQW A;  4OJO A;  2M9N A;  5J0P A;  5CEH A;  1Q3V A;  3H40 A;  5KFS A;  1ED1 A;  3FM9 A;  4Y2V A;  3OTQ A;  2DUY A;  4QW9 A;  3NVZ A;  4J9K A;  3MR6 A;  3S6J A;  2IHN A;  3D2S A;  3PW0 A;  1TK8 A;  4R64 A;  3FC4 A;  1XSP A;  5J2D A;  4O3Q A;  4M47 A;  4B9S A;  3K1R B;  4UBB A;  2LM1 A;  3F2B A;  2W9B B;  3L5K A;  2ZIU A;  4AYB F;  4DQQ A;  1SZH A;  4OJL A;  2R8I A;  3BQ0 A;  1QQ5 A;  1WWV A;  1KEJ A;  2C2R A;  3WU2 U;  9ICH A;  7ICJ A;  4NM2 A;  3PW7 A;  1PUZ A;  3QUT A;  5AKH A;  2NRX A;  4ED6 A;  5DB7 A;  2JEJ A;  3M9M B;  2C28 A;  1P7D A;  3B0Y A;  5D46 A;  1SL1 A;  4RT2 A;  9ICW A;  1LKY A;  4C8L A;  3KD3 A;  4DFP A;  1NZB A;  1ZQX A;  2PI4 A;  5EWG A;  4DS5 A;  1QTM A;  5CWR A;  4KLG A;  2GWS A;  9ICS A;  8ICP A;  2ZIX A;  3BQT A;  1ZQH A;  2YB4 A;  5ALF A;  1S0N A;  2HHS A;  1GO3 F;  3ZD8 A;  2BCV A;  3UXN A;  4FS2 A;  2W8K A;  4F5R A;  3ZDC A;  4LVS A;  5DLG A;  4USA A;  3HPO A;  3PVX A;  4KX3 A;  4M9H A;  4UB4 A;  9ICG A;  2XY6 A;  3BDP A;  1J97 A;  1XWL A;  5J8Y C;  3RBD A;  1L5U A;  4O3M A;  4IR9 A;  4I2D A;  3WK6 A;  2C22 A;  2HHT A;  4F72 A;  5CHG A;  9ICM A;  2NYV A;  2BQR A;  2F1I A;  5F9L A;  5TIS U;  5KFE A;  4ECT A;  3QXG A;  3ZDB A;  1JI7 A;  1D8L A;  5AI5 A;  1IV8 A;  4ELU A;  3C5G A;  2NV3 A;  4RNN A;  2PMZ C;  4OJP A;  2DPJ A;  4CGZ A;  2G0A A;  4US9 A;  1WCL A;  4GLX A;  3C2K A;  4EEL A;  5EOZ A;  1PK1 B;  2CN1 A;  4F8R A;  2DF4 B;  2RP5 A;  8ICF A;  2PMZ F;  9ICR A;  2AU0 A;  1QSY A;  5EE1 A;  1ZD4 A;  4YFK A;  2HOQ A;  5ALZ A;  1JN3 A;  2ZUC A;  3QEB Z;  5EE0 A;  1PK3 A;  1X9M A;  2HBK A;  2Y0S C;  4F91 B;  3KHR A;  7ICI A;  4UAY A;  1BNO A;  4OO1 J;  1X42 A;  4DQI A;  5ALJ A;  2KHV A;  4MF8 A;  4MHV A;  4JUZ A;  5ALO A;  2BHN A;  1ZXI A;  2G09 A;  3MR5 A;  9ICT A;  3NVY A;  4O3S A;  5J2B A;  4UQG A;  3AEV A;  2R8G A;  2DBY A;  4C80 A;  3DV9 A;  4DWI A;  1PK1 A;  3TAD C;  3ETR A;  3QU2 A;  2YTU A;  3QU7 A;  4CNQ A;  1NKC A;  4BGD A;  2I9G A;  2P6U A;  4OCZ A;  4Y2P A;  4KLQ A;  1B22 A;  3C23 A;  3CP8 A;  1JIH A;  4XQ8 A;  4P4P A;  2AXT U;  2I6X A;  3OGU A;  2YY6 A;  2PFN A;  2YMP A;  1M6Y A;  4DL3 A;  1RQL A;  2F3N A;  4O3N A;  2LYB A;  4BWM A;  1QH9 A;  5D49 A;  3HRD D;  4RQ3 A;  4M9G A;  3PNC A;  4WJ3 B;  1JXE A;  2EZX A;  4NLN A;  4EZ9 A;  4EBD A;  4KLT A;  2KKV A;  5G5H A;  1PVP A;  8ICS A;  3ICX A;  2A3V A;  3RRG A;  4I2G A;  1F0M A;  4F93 B;  4BJQ A;  2G06 A;  4BX9 C;  3GDX A;  4GIB A;  2LKY A;  4QWC A;  2BCS A;  3VC8 A;  4QIW C;  2KEY A;  3E0F A;  3RJF A;  3WK7 A;  3QZ8 A;  2A1J A;  3NS1 A;  5BOM A;  3G6V A;  4EX7 A;  2EAO A;  1L3U A;  3LK9 A;  5J2C A;  4YR0 A;  5KFQ A;  1U45 A;  4R8U A;  4QZA A;  2ALZ A;  4F3O A;  9ICX A;  2BQU A;  1D8Y A;  4K4I A;  4DEZ A;  5CA7 A;  2HCF A;  1DGJ A;  4I2I A;  5KFA A;  4TUP A;  5KFP A;  4I2A A;  2BPC A;  2Y1J A;  1KBU A;  3RAX A;  1VDV A;  4ECV A;  2XGQ A;  4ICA A;  1ZQQ A;  2BGW A;  3NUQ A;  3C2L A;  1NK6 A;  3CNH A;  4P0P B;  1X6J A;  1SV0 A;  4MFC A;  5AK6 A;  4UB2 A;  5KG2 A;  1DGS A;  4O3O A;  2HHW A;  4CRX A;  5ALM A;  4MF2 A;  8ICV A;  2ZIW B;  4ECX A;  4ED1 A;  4DSI A;  3MGI A;  4ED8 A;  2QKQ A;  5FP0 A;  1BGX T;  4JV0 A;  4I28 A;  4FZM A;  8ICO A;  4CF3 A;  9ICC A;  3EPI A;  1X9W A;  3N4M B;  5T14 A;  2W9A A;  2JRZ A;  7ICO A;  2W11 A;  1ZQZ A;  4KLM A;  4QZF A;  1PZN A;  4RZR A;  2WTF A;  3IM1 A;  3HP6 A;  4XUS A;  2F76 X;  5IIL A;  4KLH A;  4MFF A;  3GZF A;  5J2G A;  3JPN A;  1MQ3 A;  3KZI U;  2BZF A;  3KKA A;  1L7M A;  3PV8 A;  2UVW A;  3C1Y A;  2GH1 A;  3PW4 A;  3Q8M A;  3T79 A;  4O5C A;  1K1Q A;  4KX5 A;  1UT5 A;  3RJH A;  1KLN A;  1B4F A;  5J2F A;  2ZUB A;  2Y9U A; 
#chains in the Genus database with same CATH homology
 2KE7 A;  1COK A;  1LKY B;  2K60 A;  2KSO A;  2EAO A;  1DXS A;  1B0X A;  4PZN A;  1X9X A;  3BS7 A;  1UQV A;  1OXJ A;  2FE9 A;  2KG5 A;  2EAN A;  4MHV A;  2KSO B;  2ESE A;  1V85 A;  1SXE A;  2GLE A;  3SEI A;  4IS7 A;  2E8M A;  2K4P A;  4NL9 C;  2F44 A;  3BQ7 A;  2L5Y A;  2B6G A;  2DKZ A;  1RG6 A;  2QB0 A;  1V38 A;  3IDW A;  1WWU A;  2JV3 A;  5KNI A;  1OW5 A;  2E8N A;  1SV0 C;  1SV0 A;  1PK3 A;  4PZO A;  1PK1 A;  5F3X B;  3TAD C;  2YTU A;  2QB1 A;  1X40 A;  5J8Y A;  5J8Y C;  4NJ8 A;  1SGG A;  3TAC B;  2D8C A;  3TAD A;  2QKQ A;  1SV4 A;  1UCV A;  2KIV A;  2ES6 A;  4RQN A;  2QAR A;  2EAP A;  2KMD A;  3H8M A;  5JU5 A;  1SXD A;  1JI7 A;  2F3N A;  4NL9 A;  3BS5 B;  2D3D A;  5JTI A;  3KKA C;  3K1R B;  2E8P A;  1KW4 A;  3BS5 A;  1X66 A;  3KKA A;  3HIL A;  1PK1 B;  2EAM A;  1WWV A;  1Z1V A;  3SEN A;  5JRT A;  2LPE A;  2LMR A;  1F0M A;  2QAR B;  2DL0 A;  1B4F A;  2Y9T A;  2QB0 B;  5L1M A;  4RQM A;  2DKX A;  2Y9U A;  2F8K A;  1LKY A;  2E8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...