2F44A

Crystal structure of the zinc-bound shank sam domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords SH3 and multiple ankyrin repeat domains 3
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f44A00
4NJ8A 1X9XA 2EANA 3K1RB 5KNIA 3KKAC 2K60A 2B6GA 1V38A 2YTUA 5F3XB 1V85A 2GLEA 2E8NA 2ESEA 2KG5A 5JRTA 1SGGA 2DKXA 2KSOB 3IDWA 2F3NA 4IS7A 5JTIA 2QB0B 2E8PA 1PK1A 3TACB 1X66A 2L5YA 3TADC 1LKYB 1WWVA 2Y9TA 1SV0C 1PK3A 2ES6A 2LPEA 1F0MA 2QKQA 1B4FA 2KMDA 3TADA 5J8YC 3H8MA 2DL0A 3BS5B 2QB0A 1SXDA 1OXJA 3BQ7A 3HILA 4PZNA 1JI7A 3SEIA 3SENA 2K4PA 2EAPA 2D3DA 2F44A 2QARB 1SXEA 1UQVA 4NL9C 1X40A 4RQMA 2KE7A 2E8OA 4MHVA 2F8KA 2E8MA 2QARA 1OW5A 1WWUA 1Z1VA 5JU5A 2QB1A 5L1MA 3KKAA 2D8CA 1PK1B 2KSOA 1B0XA 4PZOA 4NL9A 2JV3A 2Y9UA 2DKZA 1SV4A 1SV0A 1KW4A 3BS7A 1UCVA 2EAOA 1RG6A 2FE9A 2LMRA 4RQNA 1LKYA 5J8YA 3BS5A 2KIVA 1COKA 2EAMA 1DXSA
chains in the Genus database with same CATH superfamily
2AJQA 2ZIUB 3JPQA 4TQRA 1KTQA 1U4BA 5ALJA 3UQ2A 3OHBA 2W03A 1VJ5A 1DK3A 2EQYA 2VKQA 3TAQA 2M0NA 4QZ8A 1ZQJA 3IV6A 4YXMA 4F5NA 2FMSA 8ICYA 2NO4A 3IRUA 3UXPA 5KTQA 1KFDA 1N60A 5KL1B 1QLNA 9ICIA 9ICUA 1ZQWA 4IRCA 5KFSA 1B4FA 3T5KA 3MR5A 1BPXA 1JXLA 2VA8A 4DCCA 1SWWA 4P4OA 1KFSA 1OXJA 1S0NA 4JB3A 4R63A 2ZJAA 1Z4OA 5ALLA 1T3QA 1RDFA 4RQMA 5C5JA 4UB4A 1KEJA 4Y2VA 5AM0A 4Y2TA 5EWGA 4FZLA 1TVAA 4KX5A 5AIBA 4ELVA 2IOHA 2W43A 4UB8U 1XU4A 3M8SA 2HOIA 4F92B 2EZYA 5J0UA 1JALA 1PK1B 5KT6A 4NM2A 3QEBZ 4K4IA 3U26A 1EXNA 2KHVA 3OPXA 1ZQIA 1TAUA 2DUYA 2WB1F 1TK0A 1MN8A 4B9UA 5ALVA 3GU3A 5ALDA 3N7SC 3GIKA 5KFTA 5AI0A 3NVZA 5AHXA 4OJ6A 4EYIB 3VC8A 4J9SA 4P4MA 2VIXA 4ECUA 4NJ8A 3R9KA 3ZD9A 5KFOA 3DEEA 4TUQA 4DSIA 5ALTA 2NRTA 3Q8PB 4XUSA 1Q46A 3SD7A 4FS2A 4ECXA 2F2AB 4F8RA 3SAFA 1Q3UA 2ISOA 3NGDA 8ICFA 3M6KA 4GIBA 3PW7A 4DWIA 3I28A 4CF3A 5J0YA 2WF9A 1WWVA 3C28A 2AH5A 2ES6A 4F71A 2KKVA 3WKBA 2YB1A 2KMDA 5HHHA 1Z3EB 4DFPA 4E0DA 4ECVA 4LZGA 4UBBA 4PGQA 3NVVA 3HILA 5J2HA 3Q8MA 4AP9A 9ICCA 9ICSA 1D8LA 3AEVA 5J2IA 3RF9A 4NLBA 5DB8A 3ZDBA 2FDRA 7ICHA 4Z6DA 3IN5A 2BCSA 5FP0A 4Y2UA 2A19A 3SQIA 4C4RA 4FBUA 3MGIA 1WCLA 2ASLA 2KIWA 4CE6A 2BHNA 4EENA 4DF8A 4QZHA 4TUPA 5IIJA 5AKJA 5KT3A 2H3VA 5AKZA 4UAYA 4YR2A 2G09A 3QUTA 2HCFA 2XY6A 1J2NA 2FLPA 5ALSA 2NRWA 3M8RA 3BS7A 1SKRA 4DOAA 2IMWP 3OGUA 5KFLA 1N61A 4ED1A 2BQUA 1RPLA 3PSIA 3F2CA 4O9MA 1DXSA 2KEYA 3G6VA 8ICNA 1MA7A 1VDVA 4KMUA 5KNIA 2BCQA 1ZQMA 4BX9C 4RQ4A 2PI5A 5B5EU 2HBMA 4I2HA 8ICCA 1IXRA 3ZDEA 1NNLA 4FZNA 4TQSA 4KLHA 3A0BU 4XA5A 2ESEA 4RZRA 3IDWA 1IG6A 3H8SA 5J2CA 2NO5A 3ZI4A 1ZQTA 1A77A 4K4GA 1L7MA 2G07A 1PK3A 1UA0A 3GDXA 4F50A 1Q8KA 4IQVA 2VJ4A 2P66A 5AM3A 4GXKA 2K4IA 4PZNA 4J9QA 4IR1A 1S77D 8ICZA 4RNNA 4O3NA 2A1JB 4UB2A 1RQNA 1B43A 3THVA 2HW3A 1QCKA 1K1QA 1SZPA 5B66U 1DK2A 8ICEA 2HBJA 3TI0A 4KLOA 4DFDA 9ICKA 1DRGA 4GXIA 2HHXA 3FDSA 4F2SA 1T7PA 3C2MA 2JEFA 2JH7A 4GFJA 2HI0A 3QNMA 2Y1IA 4KLFA 1K5OA 3PSTA 2DGZA 4IR9A 2HDOA 1A6SA 4ED2A 2ZXHA 4IQUA 5DB6A 2KSOA 2ODGA 2GO7A 5KFXA 4QWBA 5HR7A 1QSSA 3UM9A 3RTVA 1L3SA 4JV1A 1BGXT 5IIOA 4DEZA 1SV0A 1L7PA 3KOOA 4DFJA 2W55A 9ICHA 4X5VA 3ISDA 4RQNA 1LKYA 2ZUBA 1HUOA 3E2EA 1ZQZA 2BDUA 3L3FX 1L8LA 2E3TA 5DLGA 2AGOA 4I28A 2JEGA 3PR5B 1ZQVA 4AYBF 5DG7A 8ICAA 2ISPA 3A0HU 2E8NA 4PPXA 2PFOA 4R8UB 4MFCA 2K4EA 4LZDA 3RH5A 2UVUA 2YMQA 4RQ1A 9ICFA 2G08A 4DL6A 2XGQA 4DOCA 7ICLA 4UB1A 2W04A 2ZIWB 2PMZF 4M6WB 4DL7A 3MGHA 2QKQA 3QZ7A 3Q8RB 2DPJA 3BZKA 4ED0A 8ICSA 3GFKB 2BPGA 5AKIA 4I2AA 4C0ZA 2K4PA 3LDAA 4K4HA 5GTHU 1L8OA 3RJEA 3CW2C 5KFIA 4DL3A 1A0PA 1NI3A 2A1JA 4PJ0U 5L1JA 3QUBA 1PVQA 4O3QA 2E1EA 2XICA 4MHVA 3F5EA 1JN3A 5ALIA 2ATLA 3WKAA 5CRXA 4JWNA 2RRDA 3JPNA 3V7LA 3DV9A 2JEIA 3WKEA 1HJPA 1L7NA 2WF7A 2PMZC 2BGWA 1XO0A 4QW8A 3KHLA 2OCEA 4UATA 1NKCA 3PSFA 2KVSA 4RQ5A 1KW4A 3KZIU 5KG4A 4B6JA 3TANA 5AI6A 2EAOA 3QX7A 3QU2A 2LMRA 5KFRA 3WK7A 3KHRA 3T79A 2PXIA 4F4WA 1FFUA 4F5QA 1RM6C 2MA1A 4KLEA 3SR6A 2XY7A 5KAFU 4P0PB 3RRGA 4YN4A 5ALHA 1KL9A 4NLGA 3K75D 2W7OA 4RQ6A 3HPOA 5KFNA 2KK0A 4F4YA 2HVIA 5KFUA 4TURA 2A1AA 5KFAA 2KSOB 3KD3A 1ZQOA 1N2XA 1NJWA 4Y2XA 4P0PA 1ZQ1C 4DL5A 2XIDA 2E1FA 4R64A 2L5YA 2HMXA 1SKWA 2NRXA 2LPEA 4DQIA 2C28A 4F93B 3PW0A 1TAQA 2KZMA 5DQGA 2DL0A 5KG5A 4I29A 4PL2A 5ALKA 4P2HA 5DQIA 2F44A 3WK6A 4NL9C 4OJPA 5EE9A 5BPCA 1RQLA 2LM1A 2P6UA 2MAXA 1YZ6A 2BKEA 2WAQC 3AQEA 5KT7A 5L9XA 1Q3VA 4UB6U 3SYZA 4O3MA 4R66A 1NOMA 5AM2A 2ZTDA 4R65A 1S8OA 5EE3A 5KFYA 4B9NA 2NRZA 8ICXA 1ZQPA 1TKDA 5KFHA 1Y88A 2MSNA 2Y1JA 7ICIA 4UAVA 5AKYA 3IG8A 4C8MA 7ICMA 2DPIA 3KHHA 4RT2A 3JPPA 3OJUA 8ICRA 5CWRA 4DSLA 4EELA 5J0OA 4EBDA 5DB9A 4YMNA 4DLEA 3RR7A 3WK4A 2HHQA 1FEZA 2RDIA 4TUSA 2EZXA 3KHGA 5D49A 2ZJ8A 2J6SA 3LVWA 3HKZC 2A3VA 3C23A 4I2JA 3Q8KA 2W11A 5K4LA 4YR3A 1L3UA 2RP5A 5HNKA 3LVVA 2B6GA 7ICRA 3NS1A 4C7YA 3D6JA 2W54A 1RXVA 4KN7A 4QZFA 1L3TA 2ZIVB 3RH4A 3C29A 2W9CA 4IRDA 1XWLA 3TADC 5DGBA 4KX3A 1LKYB 4US9A 3RJHA 7ICVA 4NLCA 2Y9TA 3WK8A 1SV0C 3WKCA 4DQSA 2YQEA 2N1RA 5AM1A 4NY8A 4BWMA 3KZXA 3C5GA 1ZOLA 2DF4B 3UMBA 1ZJNA 4M0AA 1KN5A 4CDGA 4DQRA 2RLTA 3PMNA 5KFQA 2LYAA 4QZEA 2KHQA 3JPRA 4DQQA 4C8OA 3PY8A 2UVRA 5KFKA 4O5KA 2LM4A 4I2BA 3RJFA 4QZDA 3V6JA 3K4GA 2V4RA 1RYRA 1XS9D 1NK0A 1U9LA 4BDPA 4RQ3A 2MRLA 1QTMA 3F2BA 1ZQXA 3BQ0A 1RXWA 4I27A 3AQFA 2BZFA 4GLXA 1ZQRA 4CRXA 1XNSA 2JH1A 1FIQA 3PW2A 4FO6A 3QE9Y 2KIVA 1LB2B 2E5SA 2EAMA 9ICQA 4PGYA 2F1JA 1C20A 5AK6A 1UA1A 2GWSA 9ICTA 5BOLA 4BGDA 3C21A 5IIIA 3MR2A 2C2EA 2PFNA 5J2EA 5BOMA 2GLEA 3RB3A 4M9HA 4C8NA 4F91B 3NUQA 2FJ6A 5HP4A 3IP4B 1XSPA 4B9LA 2F3NA 4IS7A 2W3RA 2E8PA 7ICKA 5ALYA 2KD1A 4JV0A 4QWAA 7ICOA 3TQ1A 3WK9A 5EWFA 2CN1A 3F5AA 2WF6A 4DSJA 4DO9A 1WCNA 1F0MA 2LYHA 2Q4TA 2PFQA 4NM1A 1J2MA 1U49A 1HIWA 2VANA 3BQ7A 1DOQA 4UW9A 4EBEA 1CRXA 3BZCA 5L1KA 3O0FA 5ALRA 3MDAA 2ZTCA 7ICSA 3C5FA 4IC9A 3D2NA 4B9SA 1IM4A 3H0LB 4F3OA 3F53A 1KQQA 3RH6A 2BPCA 2IHNA 4YMOA 3ISCA 5A0LA 2F8KA 2E8MA 3M9OB 1NZBA 4ED7A 2JMGA 1TV9A 1N5WA 4IQWA 4I2DA 3KTQA 5KT2A 1ZD5A 1Z1VA 4EX6A 3CNHA 5DBBA 2WFAA 2W9BA 5IIKA 1SL0A 3N28A 2AHOB 4M6WA 1NKBA 3E0FA 2KNJA 5J2GA 2DKZA 2EZZA 2IOFA 4F4XA 1BPZA 4ZH4A 4XRHA 2ZIUA 3IM1A 1QSYA 1ZQCA 3GV7B 3BS5A 3LWMA 3EPGA 4KLLA 5J0SA 5GTIU 4IL6U 2I5HA 1U47A 4O3RA 3OHAA 3H8JA 2VA3A 4Q43A 4J9PA 3T5LA 4M2YA 9ICPA 4PHDA 1JUDA 2XY5A 2F1HA 2KV2A 3I1YA 2DBYA 2JXJA 2XI9A 4RNOA 8ICMA 5ALUA 4JWMA 1D8YA 4M9JA 4F4KA 1Z00A 3ONNA 4YR0A 1BPYA 2G0AA 3B0XA 2BCRA 3OJSA 2I1QA 3PMLA 4UASA 5J0PA 1KLNA 4KLSA 5ALOA 5ALPA 1D9FA 2KKPA 1S0OA 1VLBA 1Z1BA 9ICLA 4P0QB 2YMPA 2MU2A 1X6JA 1SXEA 1L3VA 4I2FA 4DFKA 1RYSA 1L5UA 2KZZA 3OSNA 4R8UA 4RU9A 4ECRA 4O3OA 2BPFA 2EH9A 3ZDAA 5KG0A 4FZMA 2ASDA 1PUZA 7ICFA 1CUKA 4FFDA 3N97B 5TISU 3I76A 1ZQDA 5AI5A 3RJJA 4MF8A 2XCAA 5DDYA 2XO7A 3PO5A 1RZTA 1B0XA 1SB3C 2JV3A 3PV8A 4F5OA 5KG1A 2B21A 5KAIU 3ALRA 2P6RA 4RPYA 3HP6A 5J2AA 1DGJA 4EX7A 2HBLA 2CRXA 2FPKA 4HAIA 1KKXA 1KDHA 3H7IA 4O5CA 4Z6EA 2KVCA 4B9TA 4KN4A 2YTUA 1A76A 1ZQBA 3FM9A 3PZPA 2R8IA 5J0QA 1UPHA 3C2LA 4Z6FA 1WYGA 4OJOA 4YFKA 5KFCA 5KG2A 4C7ZA 4RQ0A 4J9LA 1J97A 1Z19A 8ICLA 1JI7A 5AICA 2Y0SC 3Q8LA 5DBCA 2HBKA 3RFAA 1MQ2A 4CF5A 4QIWC 4U7CA 4NLNA 1DGSA 4YQWA 1XO1A 4QJFB 4LJXA 1KBUA 2W3SA 5KFPA 2K4HA 1D9DA 1ZQHA 5J2FA 2RQ5A 2W8LA 2ZJ5A 4QWDA 5D46A 3JPOA 3N4MB 1F44A 8ICPA 5KFEA 2BCVA 2OH2A 4DQPA 2DFLA 2QLTA 1BPEA 4MFFA 3AL0B 2Y9UA 1YZ7A 4YD1A 2RDJA 3PX4A 3C1ZA 3PX6A 2FE9A 2ZIWA 4KLDA 3H0MB 3SMVA 4KLUA 1URJA 1AQ6A 3TARA 4RQ8A 1X9WA 2NYVA 2Q0ZX 2W9BB 4G9BA 5KG6A 3T5HA 3TAPA 1ZQLA 4YVZA 1TAMA 2OWOA 5KFVA 1SGGA 1ZQKA 4OJLA 1ZRNA 2JRZA 3RJIA 2IOFK 2OHFA 4DSKA 2W7PA 5IINA 2FMPA 4UB5A 4ECTA 3QU4A 1TFRA 1SZHA 1P7DA 3PSPA 1ZQYA 3RAXA 3TADA 2UVVA 8ICJA 5L1LA 5DB7A 4ELUA 2Z7JA 1JMSA 4ICAA 3HJEA 2WF8A 5CHGA 2AU0A 3MR6A 3TKAA 1V9PA 3C2KA 5KT5A 4ED8A 1ZJMA 2EAPA 1NK6A 3MR3A 3EPIA 3WKDA 4RUAA 3QXGA 3UXOA 1S97A 2WTFA 1WG8A 4BUGA 4QIWF 8ICQA 3RR8A 2GOLA 4EYHB 2XCPA 5DQHA 3QYPA 5KFJA 4BWJA 7ICPA 5HMLA 4O3PA 1S76D 5AK4A 3GV5B 1O08A 8ICHA 4NL9A 3SZ2A 8ICBA 2H3QA 3BJYA 3E58A 1T4GA 4BXOA 3WK5A 5J0XA 4RQ7A 1TE2A 2YB4A 5C0YA 4GC6A 5H2FU 1ECWA 5J8YA 2V9WA 2KTQA 4UB3A 1LVHA 1QH9A 4KLQA 3PNCA 3VCBA 3M9NB 4G3IA 2C2RA 2AQ4A 4IRKA 2EANA 3K1RB 4PL1A 4FE3A 3M9MB 2KP7A 2AXTU 1LV5A 9ICGA 2MUTB 1BNOA 2ZUCA 1ED1A 2ZIXA 1JRPA 1ZD2P 4MEYA 2C22A 4PHAA 3V7JA 2J6TA 5J8YC 1RYUA 4KLMA 1S9FA 2JGAA 2OM6A 3SAHA 3DDHA 4Y2QA 3D2QA 1JIHA 5ALXA 2LI6A 5KL8B 1NK9A 3GIIA 3GIMA 3UQ0A 7ICTA 3V6HA 2JZBA 3EUB2 2UVWA 4GC7A 5KFMA 1OUQA 2DWQA 1N56A 3JPSA 4Q44A 4J9MA 1JXEA 2JZBB 1GO3F 3GQCA 5JUMA 9ICWA 2JEJA 3UMGA 3CRXA 2W9MA 4DF4A 4RQ2A 3MFIA 4BJQA 2LHTA 4UQGA 3Q8QB 4YG2A 1MSWD 4DLGA 3BDPA 5AKEA 2KOBA 1MQ3A 1UCVA 3T5JA 4M47A 9ICNA 1NKEA 3OTQA 2NV3A 8ICKA 4UAUA 1ZETA 2G5IB 2KZ3A 2HHSA 3MBYA 3NTUA 4RPXA 4M9NA 2WAQF 1CEZA 3M7DA 1ZQQA 2BCUA 4AYBC 2QB0B 4YP3A 4F72A 4JV2A 2BQ3A 4HYKA 3RJGA 4ELTA 3OSPA 4GXJA 4CF4A 1X2IA 3HRDD 9ICRA 4FS1A 2H3IA 3EZ5A 1BVSA 2J6UA 2K8CB 3QU7A 2EDUA 1ZQUA 5AKHA 4Q8FA 4F5RA 3SEIA 4RNMA 2IA6A 1K1SA 4F5PA 1U45A 4ED3A 1ZQAA 1C7YA 4KLIA 5KFZA 3B0YA 3NVWA 2RHFA 2PFPA 3SAGA 3H0RB 5TZVA 3H4DA 1BNPA 2KE7A 5CP2A 2ZTEA 5J29A 1N63A 2W8KA 1T8EA 5CEHA 5AI4A 2KFNA 2FMQA 4NLZA 5JU5A 1BPDA 4EZ6A 1Z00B 1L7OA 2XVTA 3GILA 2D8CA 5J0RA 4C4SA 5ALQA 1YT3A 3NRZA 4XQ8A 1N5XA 2R18A 4F2RA 4KMOB 3MGVA 3V72A 9ICMA 4PH5A 3G6YA 1SV4A 1O03A 1ZXIA 3PX0A 3MDCA 5HMMA 2KJ8A 4B9VA 9ICJA 3FAHA 2LKYA 4WJ3B 4US8A 4JMUA 5DG8A 1V38A 3NVYA 5F3XB 3RJKA 4UARA 1TK8A 2OEHA 2LYBA 2XC9A 2WF5A 2BDPA 4J9RA 5EE0A 3HX0A 3EW9A 5J0TA 3AU6A 1FO4A 2F8LA 3QEAZ 1ZYQA 4EEKA 3V6KA 3ICXA 7ICEA 3ISBA 1F5SA 4CNQA 2P35A 1NJXA 3H8MA 3BS5B 8ICWA 3AMZA 2BQRA 4ECQA 1HUZA 3KBBA 4C4TA 4CCHA 3LYSA 4BXOB 2FPMA 2H3FA 4P0QA 4QZGA 1X40A 4DFMA 2YY6A 2FLNA 3MC1A 5L1IA 1S5LU 4C8LA 5KFWA 5KFGA 5IILA 3GIJA 5J2KA 3PO4A 1S0VA 5F9NA 3PR4A 2QB1A 4ZOHC 4M04A 2YMLA 5KFFA 9ICVA 5L1MA 4QZCA 5AKLA 3M1YA 4RPZA 3T3FA 3SI8A 4OD0A 3RB4A 5KFDA 2R8HA 4DS5A 1XSLA 1NJZA 4M9GA 3RAQA 2AGPA 2K8AA 3AN1A 7ICNA 1PVRA 5HHIA 4MF2A 3BQTA 4UBCA 1RG6A 9ICXA 3CYMA 4LVSA 1BPBA 3RB6A 3ZDCA 1V97A 1X42A 1QSLA 1X9XA 1NK7A 4I2CA 4Q8EA 3AM9A 2HHUA 4NV0A 3H8WA 2H5XA 8ICOA 1UHUA 1ZD4A 7ICGA 3G6XA 5J0WA 1TK5A 4I2IA 3FC4A 3TFRA 4Z6CA 4Y2RA 2Y0SF 3HKZF 4ECSA 3BQ1A 5ALNA 4QZIA 1PK1A 1SL1A 3TACB 4B9MA 1ZQFA 1UT8A 2YMMA 3SV3A 2YN4A 3BQ2A 1U48A 4C8KA 5EE1A 4I2EA 1PZNA 4QWCA 2KJ9A 1S10A 3B9JA 4J9KA 4KITB 1IV8A 1NK5A 3MFHA 2WB1C 5ALWA 3EYZA 1HEKA 2K89A 4DL2A 2I9GA 4O3SA 1UQVA 2PI4A 3NASA 3TFSA 8ICTA 1X9MA 1XC9A 2HSZA 5T14A 3RB0A 2E8OA 5EOZA 5J2DA 5HR6A 5IIMA 1OW5A 4OCZA 1WWUA 4NLKA 1T3NA 1H38A 4C80A 4PHPA 1L6NA 2G5HB 4J9OA 1SL2A 3S6JA 4DSFA 5D4BA 3PVXA 3LK9A 5AI9A 3IG5A 3HWTA 5KG7A 4YXJA 2HOFA 3F2DA 4MEXA 8ICVA 3HT3A 3IHQB 1NK8A 4ED6A 1KRPA 2VJ5A 1COKA 2HVHA 1ZQSA 5AK3A 2CPRA 4Y2PA 3AU2A 2B0CA 3ED5A 2R8KA 2F77X 4I2GA 4DS4A 4M9LA 3KKAC 4Y2YA 2KJ5A 3WU2U 3C1YA 4YD2A 1QQ5A 2K60A 7ICUA 3RRHA 3ETRA 1V85A 2D6FC 5AI8A 2LBOA 5G5HA 4EZ9A 4MFAA 8ICGA 4DSEA 3PW5A 1JX4A 5JTIA 2K8BB 4P4PA 4QZ9A 4ECYA 1JROA 5DGAA 5DKWA 4NXZA 3H40A 2DQNB 2GH1A 1Z4NA 3N7PD 3ETLA 4YMMA 5AK5A 2W9CB 1T94A 7ICJA 4OO1J 1SWVA 4A8EA 1IIPA 2FPLA 5CA7A 2ZG6A 2MUTA 4U6PA 1N62A 1ZQGA 3K1ZA 4DL4A 5AIAA 1SKSA 5CB1A 2HHWA 2F1IA 9ICBA 3V7KA 3SENA 5KG3A 4KLJA 4J03A 2QARB 5AKKA 5E79U 4ACOA 2YX8A 4UAZA 1X6IA 5CJ7A 1FFVA 2ZIVA 4FBTA 4UAWA 3EWAA 3NRWA 3ORYA 2ZUDA 4CGZA 2OXOA 2XGPA 2QARA 1UT5A 4JUZA 3GV8B 1WUDA 4OJ5A 4JK1A 3ZD8A 3KKAA 3MABA 1QQ6A 4Q45A 4PGXA 4EBCA 8ICIA 2KN7A 3CP8A 5CR0A 3H4BA 2KICA 5F9LA 4PZOA 4YCXA 5J2JA 3QZ8A 2JHDA 1ZD3A 9ICOA 3L4PA 2CXYA 4IQTA 2R8JA 2HHVA 5EWEA 4EEYA 4O5EA 4KLTA 4NWIA 7ICQA 1N48A 1ZQNA 3FYHA 5DBAA 4PHEA 3RBEA 5ALGA 2C2DA 4DOBA 2ALZA 3Q8SB 1NZPA 2FI1A 3JPTA 3SV4A 1SIJA 5ALEA 3KFUF 4KLGA 1ZRMA 1NK4A 1QQ7A 2KG5A 5JRTA 2ASJA 2DKXA 4QWEA 5G5GA 4J9NA 1CI4A 2NRVA 3UMCA 1X66A 1COOA 2O6KA 5AM4A 4QW9A 4O0IA 2I6XA 1B22A 9ICAA 3QUQA 3J81j 9ICEA 3RBDA 4Y2JA 3HW8A 2HHTA 2IHMA 3M6ZA 5DG9A 2IBKA 2G06A 2QB0A 1SXDA 1MC8A 4ECWA 1PVPA 5KFBA 2FLLA 5DDMA 2D3DA 2W9AA 2KFZA 2VA2A 3ZDDA 4QNLA 2ZXIA 5AKXA 2OYYA 1M6YA 4ECZA 2H3ZA 2F76X 5AKGA 1KFTA 1KSPA 2PKEA 3UXNA 4QZBA 1AROP 2HOQA 3PW4A 4Y2SA 5ALZA 2AQ0A 1D8BA 2WHEA 2V4QA 1NJYA 1X9SA 3QU5A 5ALMA 3QUCA 3N7RC 3D2SA 5AM5A 1ZQEA 3AUOA 2M9NA 3QU9A 8ICUA 3UPQA 3LWLA 5ALFA 5J2BA 5DLFA 4RUCA 2R8GA 2AGQA 1XSNA 2BR0A 3L5KA 1S0MA 2ZIXB 4USAA 4KTQA 5KT4A 4F4ZA 4QZAA 2JR5A 4RT3A 3GZFA
chains in the Genus database with same CATH topology
4NJ8A 1X9XA 2EANA 3K1RB 5KNIA 3KKAC 2K60A 2B6GA 1V38A 2YTUA 5F3XB 1V85A 2GLEA 2E8NA 2ESEA 2KG5A 5JRTA 1SGGA 2DKXA 2KSOB 3IDWA 2F3NA 4IS7A 5JTIA 2QB0B 2E8PA 1PK1A 3TACB 1X66A 2L5YA 3TADC 1LKYB 1WWVA 2Y9TA 1SV0C 1PK3A 2ES6A 2LPEA 1F0MA 2QKQA 1B4FA 2KMDA 3TADA 5J8YC 3H8MA 2DL0A 3BS5B 2QB0A 1SXDA 1OXJA 3BQ7A 3HILA 4PZNA 1JI7A 3SEIA 3SENA 2K4PA 2EAPA 2D3DA 2F44A 2QARB 1SXEA 1UQVA 4NL9C 1X40A 4RQMA 2KE7A 2E8OA 4MHVA 2F8KA 2E8MA 2QARA 1OW5A 1WWUA 1Z1VA 5JU5A 2QB1A 5L1MA 3KKAA 2D8CA 1PK1B 2KSOA 1B0XA 4PZOA 4NL9A 2JV3A 2Y9UA 2DKZA 1SV4A 1SV0A 1KW4A 3BS7A 1UCVA 2EAOA 1RG6A 2FE9A 2LMRA 4RQNA 1LKYA 5J8YA 3BS5A 2KIVA 1COKA 2EAMA 1DXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ8 A;  1X9X A;  2EAN A;  3K1R B;  5KNI A;  3KKA C;  2K60 A;  2B6G A;  1V38 A;  2YTU A;  5F3X B;  1V85 A;  2GLE A;  2E8N A;  2ESE A;  2KG5 A;  5JRT A;  1SGG A;  2DKX A;  2KSO B;  3IDW A;  2F3N A;  4IS7 A;  5JTI A;  2QB0 B;  2E8P A;  1PK1 A;  3TAC B;  1X66 A;  2L5Y A;  3TAD C;  1LKY B;  1WWV A;  2Y9T A;  1SV0 C;  1PK3 A;  2ES6 A;  2LPE A;  1F0M A;  2QKQ A;  1B4F A;  2KMD A;  3TAD A;  5J8Y C;  3H8M A;  2DL0 A;  3BS5 B;  2QB0 A;  1SXD A;  1OXJ A;  3BQ7 A;  3HIL A;  4PZN A;  1JI7 A;  3SEI A;  3SEN A;  2K4P A;  2EAP A;  2D3D A;  2F44 A;  2QAR B;  1SXE A;  1UQV A;  4NL9 C;  1X40 A;  4RQM A;  2KE7 A;  2E8O A;  4MHV A;  2F8K A;  2E8M A;  2QAR A;  1OW5 A;  1WWU A;  1Z1V A;  5JU5 A;  2QB1 A;  5L1M A;  3KKA A;  2D8C A;  1PK1 B;  2KSO A;  1B0X A;  4PZO A;  4NL9 A;  2JV3 A;  2Y9U A;  2DKZ A;  1SV4 A;  1SV0 A;  1KW4 A;  3BS7 A;  1UCV A;  2EAO A;  1RG6 A;  2FE9 A;  2LMR A;  4RQN A;  1LKY A;  5J8Y A;  3BS5 A;  2KIV A;  1COK A;  2EAM A;  1DXS A; 
#chains in the Genus database with same CATH topology
 2AJQ A;  2ZIU B;  3JPQ A;  4TQR A;  1KTQ A;  1U4B A;  5ALJ A;  3UQ2 A;  3OHB A;  2W03 A;  1VJ5 A;  1DK3 A;  2EQY A;  2VKQ A;  3TAQ A;  2M0N A;  4QZ8 A;  1ZQJ A;  3IV6 A;  4YXM A;  4F5N A;  2FMS A;  8ICY A;  2NO4 A;  3IRU A;  3UXP A;  5KTQ A;  1KFD A;  1N60 A;  5KL1 B;  1QLN A;  9ICI A;  9ICU A;  1ZQW A;  4IRC A;  5KFS A;  1B4F A;  3T5K A;  3MR5 A;  1BPX A;  1JXL A;  2VA8 A;  4DCC A;  1SWW A;  4P4O A;  1KFS A;  1OXJ A;  1S0N A;  4JB3 A;  4R63 A;  2ZJA A;  1Z4O A;  5ALL A;  1T3Q A;  1RDF A;  4RQM A;  5C5J A;  4UB4 A;  1KEJ A;  4Y2V A;  5AM0 A;  4Y2T A;  5EWG A;  4FZL A;  1TVA A;  4KX5 A;  5AIB A;  4ELV A;  2IOH A;  2W43 A;  4UB8 U;  1XU4 A;  3M8S A;  2HOI A;  4F92 B;  2EZY A;  5J0U A;  1JAL A;  1PK1 B;  5KT6 A;  4NM2 A;  3QEB Z;  4K4I A;  3U26 A;  1EXN A;  2KHV A;  3OPX A;  1ZQI A;  1TAU A;  2DUY A;  2WB1 F;  1TK0 A;  1MN8 A;  4B9U A;  5ALV A;  3GU3 A;  5ALD A;  3N7S C;  3GIK A;  5KFT A;  5AI0 A;  3NVZ A;  5AHX A;  4OJ6 A;  4EYI B;  3VC8 A;  4J9S A;  4P4M A;  2VIX A;  4ECU A;  4NJ8 A;  3R9K A;  3ZD9 A;  5KFO A;  3DEE A;  4TUQ A;  4DSI A;  5ALT A;  2NRT A;  3Q8P B;  4XUS A;  1Q46 A;  3SD7 A;  4FS2 A;  4ECX A;  2F2A B;  4F8R A;  3SAF A;  1Q3U A;  2ISO A;  3NGD A;  8ICF A;  3M6K A;  4GIB A;  3PW7 A;  4DWI A;  3I28 A;  4CF3 A;  5J0Y A;  2WF9 A;  1WWV A;  3C28 A;  2AH5 A;  2ES6 A;  4F71 A;  2KKV A;  3WKB A;  2YB1 A;  2KMD A;  5HHH A;  1Z3E B;  4DFP A;  4E0D A;  4ECV A;  4LZG A;  4UBB A;  4PGQ A;  3NVV A;  3HIL A;  5J2H A;  3Q8M A;  4AP9 A;  9ICC A;  9ICS A;  1D8L A;  3AEV A;  5J2I A;  3RF9 A;  4NLB A;  5DB8 A;  3ZDB A;  2FDR A;  7ICH A;  4Z6D A;  3IN5 A;  2BCS A;  5FP0 A;  4Y2U A;  2A19 A;  3SQI A;  4C4R A;  4FBU A;  3MGI A;  1WCL A;  2ASL A;  2KIW A;  4CE6 A;  2BHN A;  4EEN A;  4DF8 A;  4QZH A;  4TUP A;  5IIJ A;  5AKJ A;  5KT3 A;  2H3V A;  5AKZ A;  4UAY A;  4YR2 A;  2G09 A;  3QUT A;  2HCF A;  2XY6 A;  1J2N A;  2FLP A;  5ALS A;  2NRW A;  3M8R A;  3BS7 A;  1SKR A;  4DOA A;  2IMW P;  3OGU A;  5KFL A;  1N61 A;  4ED1 A;  2BQU A;  1RPL A;  3PSI A;  3F2C A;  4O9M A;  1DXS A;  2KEY A;  3G6V A;  8ICN A;  1MA7 A;  1VDV A;  4KMU A;  5KNI A;  2BCQ A;  1ZQM A;  4BX9 C;  4RQ4 A;  2PI5 A;  5B5E U;  2HBM A;  4I2H A;  8ICC A;  1IXR A;  3ZDE A;  1NNL A;  4FZN A;  4TQS A;  4KLH A;  3A0B U;  4XA5 A;  2ESE A;  4RZR A;  3IDW A;  1IG6 A;  3H8S A;  5J2C A;  2NO5 A;  3ZI4 A;  1ZQT A;  1A77 A;  4K4G A;  1L7M A;  2G07 A;  1PK3 A;  1UA0 A;  3GDX A;  4F50 A;  1Q8K A;  4IQV A;  2VJ4 A;  2P66 A;  5AM3 A;  4GXK A;  2K4I A;  4PZN A;  4J9Q A;  4IR1 A;  1S77 D;  8ICZ A;  4RNN A;  4O3N A;  2A1J B;  4UB2 A;  1RQN A;  1B43 A;  3THV A;  2HW3 A;  1QCK A;  1K1Q A;  1SZP A;  5B66 U;  1DK2 A;  8ICE A;  2HBJ A;  3TI0 A;  4KLO A;  4DFD A;  9ICK A;  1DRG A;  4GXI A;  2HHX A;  3FDS A;  4F2S A;  1T7P A;  3C2M A;  2JEF A;  2JH7 A;  4GFJ A;  2HI0 A;  3QNM A;  2Y1I A;  4KLF A;  1K5O A;  3PST A;  2DGZ A;  4IR9 A;  2HDO A;  1A6S A;  4ED2 A;  2ZXH A;  4IQU A;  5DB6 A;  2KSO A;  2ODG A;  2GO7 A;  5KFX A;  4QWB A;  5HR7 A;  1QSS A;  3UM9 A;  3RTV A;  1L3S A;  4JV1 A;  1BGX T;  5IIO A;  4DEZ A;  1SV0 A;  1L7P A;  3KOO A;  4DFJ A;  2W55 A;  9ICH A;  4X5V A;  3ISD A;  4RQN A;  1LKY A;  2ZUB A;  1HUO A;  3E2E A;  1ZQZ A;  2BDU A;  3L3F X;  1L8L A;  2E3T A;  5DLG A;  2AGO A;  4I28 A;  2JEG A;  3PR5 B;  1ZQV A;  4AYB F;  5DG7 A;  8ICA A;  2ISP A;  3A0H U;  2E8N A;  4PPX A;  2PFO A;  4R8U B;  4MFC A;  2K4E A;  4LZD A;  3RH5 A;  2UVU A;  2YMQ A;  4RQ1 A;  9ICF A;  2G08 A;  4DL6 A;  2XGQ A;  4DOC A;  7ICL A;  4UB1 A;  2W04 A;  2ZIW B;  2PMZ F;  4M6W B;  4DL7 A;  3MGH A;  2QKQ A;  3QZ7 A;  3Q8R B;  2DPJ A;  3BZK A;  4ED0 A;  8ICS A;  3GFK B;  2BPG A;  5AKI A;  4I2A A;  4C0Z A;  2K4P A;  3LDA A;  4K4H A;  5GTH U;  1L8O A;  3RJE A;  3CW2 C;  5KFI A;  4DL3 A;  1A0P A;  1NI3 A;  2A1J A;  4PJ0 U;  5L1J A;  3QUB A;  1PVQ A;  4O3Q A;  2E1E A;  2XIC A;  4MHV A;  3F5E A;  1JN3 A;  5ALI A;  2ATL A;  3WKA A;  5CRX A;  4JWN A;  2RRD A;  3JPN A;  3V7L A;  3DV9 A;  2JEI A;  3WKE A;  1HJP A;  1L7N A;  2WF7 A;  2PMZ C;  2BGW A;  1XO0 A;  4QW8 A;  3KHL A;  2OCE A;  4UAT A;  1NKC A;  3PSF A;  2KVS A;  4RQ5 A;  1KW4 A;  3KZI U;  5KG4 A;  4B6J A;  3TAN A;  5AI6 A;  2EAO A;  3QX7 A;  3QU2 A;  2LMR A;  5KFR A;  3WK7 A;  3KHR A;  3T79 A;  2PXI A;  4F4W A;  1FFU A;  4F5Q A;  1RM6 C;  2MA1 A;  4KLE A;  3SR6 A;  2XY7 A;  5KAF U;  4P0P B;  3RRG A;  4YN4 A;  5ALH A;  1KL9 A;  4NLG A;  3K75 D;  2W7O A;  4RQ6 A;  3HPO A;  5KFN A;  2KK0 A;  4F4Y A;  2HVI A;  5KFU A;  4TUR A;  2A1A A;  5KFA A;  2KSO B;  3KD3 A;  1ZQO A;  1N2X A;  1NJW A;  4Y2X A;  4P0P A;  1ZQ1 C;  4DL5 A;  2XID A;  2E1F A;  4R64 A;  2L5Y A;  2HMX A;  1SKW A;  2NRX A;  2LPE A;  4DQI A;  2C28 A;  4F93 B;  3PW0 A;  1TAQ A;  2KZM A;  5DQG A;  2DL0 A;  5KG5 A;  4I29 A;  4PL2 A;  5ALK A;  4P2H A;  5DQI A;  2F44 A;  3WK6 A;  4NL9 C;  4OJP A;  5EE9 A;  5BPC A;  1RQL A;  2LM1 A;  2P6U A;  2MAX A;  1YZ6 A;  2BKE A;  2WAQ C;  3AQE A;  5KT7 A;  5L9X A;  1Q3V A;  4UB6 U;  3SYZ A;  4O3M A;  4R66 A;  1NOM A;  5AM2 A;  2ZTD A;  4R65 A;  1S8O A;  5EE3 A;  5KFY A;  4B9N A;  2NRZ A;  8ICX A;  1ZQP A;  1TKD A;  5KFH A;  1Y88 A;  2MSN A;  2Y1J A;  7ICI A;  4UAV A;  5AKY A;  3IG8 A;  4C8M A;  7ICM A;  2DPI A;  3KHH A;  4RT2 A;  3JPP A;  3OJU A;  8ICR A;  5CWR A;  4DSL A;  4EEL A;  5J0O A;  4EBD A;  5DB9 A;  4YMN A;  4DLE A;  3RR7 A;  3WK4 A;  2HHQ A;  1FEZ A;  2RDI A;  4TUS A;  2EZX A;  3KHG A;  5D49 A;  2ZJ8 A;  2J6S A;  3LVW A;  3HKZ C;  2A3V A;  3C23 A;  4I2J A;  3Q8K A;  2W11 A;  5K4L A;  4YR3 A;  1L3U A;  2RP5 A;  5HNK A;  3LVV A;  2B6G A;  7ICR A;  3NS1 A;  4C7Y A;  3D6J A;  2W54 A;  1RXV A;  4KN7 A;  4QZF A;  1L3T A;  2ZIV B;  3RH4 A;  3C29 A;  2W9C A;  4IRD A;  1XWL A;  3TAD C;  5DGB A;  4KX3 A;  1LKY B;  4US9 A;  3RJH A;  7ICV A;  4NLC A;  2Y9T A;  3WK8 A;  1SV0 C;  3WKC A;  4DQS A;  2YQE A;  2N1R A;  5AM1 A;  4NY8 A;  4BWM A;  3KZX A;  3C5G A;  1ZOL A;  2DF4 B;  3UMB A;  1ZJN A;  4M0A A;  1KN5 A;  4CDG A;  4DQR A;  2RLT A;  3PMN A;  5KFQ A;  2LYA A;  4QZE A;  2KHQ A;  3JPR A;  4DQQ A;  4C8O A;  3PY8 A;  2UVR A;  5KFK A;  4O5K A;  2LM4 A;  4I2B A;  3RJF A;  4QZD A;  3V6J A;  3K4G A;  2V4R A;  1RYR A;  1XS9 D;  1NK0 A;  1U9L A;  4BDP A;  4RQ3 A;  2MRL A;  1QTM A;  3F2B A;  1ZQX A;  3BQ0 A;  1RXW A;  4I27 A;  3AQF A;  2BZF A;  4GLX A;  1ZQR A;  4CRX A;  1XNS A;  2JH1 A;  1FIQ A;  3PW2 A;  4FO6 A;  3QE9 Y;  2KIV A;  1LB2 B;  2E5S A;  2EAM A;  9ICQ A;  4PGY A;  2F1J A;  1C20 A;  5AK6 A;  1UA1 A;  2GWS A;  9ICT A;  5BOL A;  4BGD A;  3C21 A;  5III A;  3MR2 A;  2C2E A;  2PFN A;  5J2E A;  5BOM A;  2GLE A;  3RB3 A;  4M9H A;  4C8N A;  4F91 B;  3NUQ A;  2FJ6 A;  5HP4 A;  3IP4 B;  1XSP A;  4B9L A;  2F3N A;  4IS7 A;  2W3R A;  2E8P A;  7ICK A;  5ALY A;  2KD1 A;  4JV0 A;  4QWA A;  7ICO A;  3TQ1 A;  3WK9 A;  5EWF A;  2CN1 A;  3F5A A;  2WF6 A;  4DSJ A;  4DO9 A;  1WCN A;  1F0M A;  2LYH A;  2Q4T A;  2PFQ A;  4NM1 A;  1J2M A;  1U49 A;  1HIW A;  2VAN A;  3BQ7 A;  1DOQ A;  4UW9 A;  4EBE A;  1CRX A;  3BZC A;  5L1K A;  3O0F A;  5ALR A;  3MDA A;  2ZTC A;  7ICS A;  3C5F A;  4IC9 A;  3D2N A;  4B9S A;  1IM4 A;  3H0L B;  4F3O A;  3F53 A;  1KQQ A;  3RH6 A;  2BPC A;  2IHN A;  4YMO A;  3ISC A;  5A0L A;  2F8K A;  2E8M A;  3M9O B;  1NZB A;  4ED7 A;  2JMG A;  1TV9 A;  1N5W A;  4IQW A;  4I2D A;  3KTQ A;  5KT2 A;  1ZD5 A;  1Z1V A;  4EX6 A;  3CNH A;  5DBB A;  2WFA A;  2W9B A;  5IIK A;  1SL0 A;  3N28 A;  2AHO B;  4M6W A;  1NKB A;  3E0F A;  2KNJ A;  5J2G A;  2DKZ A;  2EZZ A;  2IOF A;  4F4X A;  1BPZ A;  4ZH4 A;  4XRH A;  2ZIU A;  3IM1 A;  1QSY A;  1ZQC A;  3GV7 B;  3BS5 A;  3LWM A;  3EPG A;  4KLL A;  5J0S A;  5GTI U;  4IL6 U;  2I5H A;  1U47 A;  4O3R A;  3OHA A;  3H8J A;  2VA3 A;  4Q43 A;  4J9P A;  3T5L A;  4M2Y A;  9ICP A;  4PHD A;  1JUD A;  2XY5 A;  2F1H A;  2KV2 A;  3I1Y A;  2DBY A;  2JXJ A;  2XI9 A;  4RNO A;  8ICM A;  5ALU A;  4JWM A;  1D8Y A;  4M9J A;  4F4K A;  1Z00 A;  3ONN A;  4YR0 A;  1BPY A;  2G0A A;  3B0X A;  2BCR A;  3OJS A;  2I1Q A;  3PML A;  4UAS A;  5J0P A;  1KLN A;  4KLS A;  5ALO A;  5ALP A;  1D9F A;  2KKP A;  1S0O A;  1VLB A;  1Z1B A;  9ICL A;  4P0Q B;  2YMP A;  2MU2 A;  1X6J A;  1SXE A;  1L3V A;  4I2F A;  4DFK A;  1RYS A;  1L5U A;  2KZZ A;  3OSN A;  4R8U A;  4RU9 A;  4ECR A;  4O3O A;  2BPF A;  2EH9 A;  3ZDA A;  5KG0 A;  4FZM A;  2ASD A;  1PUZ A;  7ICF A;  1CUK A;  4FFD A;  3N97 B;  5TIS U;  3I76 A;  1ZQD A;  5AI5 A;  3RJJ A;  4MF8 A;  2XCA A;  5DDY A;  2XO7 A;  3PO5 A;  1RZT A;  1B0X A;  1SB3 C;  2JV3 A;  3PV8 A;  4F5O A;  5KG1 A;  2B21 A;  5KAI U;  3ALR A;  2P6R A;  4RPY A;  3HP6 A;  5J2A A;  1DGJ A;  4EX7 A;  2HBL A;  2CRX A;  2FPK A;  4HAI A;  1KKX A;  1KDH A;  3H7I A;  4O5C A;  4Z6E A;  2KVC A;  4B9T A;  4KN4 A;  2YTU A;  1A76 A;  1ZQB A;  3FM9 A;  3PZP A;  2R8I A;  5J0Q A;  1UPH A;  3C2L A;  4Z6F A;  1WYG A;  4OJO A;  4YFK A;  5KFC A;  5KG2 A;  4C7Z A;  4RQ0 A;  4J9L A;  1J97 A;  1Z19 A;  8ICL A;  1JI7 A;  5AIC A;  2Y0S C;  3Q8L A;  5DBC A;  2HBK A;  3RFA A;  1MQ2 A;  4CF5 A;  4QIW C;  4U7C A;  4NLN A;  1DGS A;  4YQW A;  1XO1 A;  4QJF B;  4LJX A;  1KBU A;  2W3S A;  5KFP A;  2K4H A;  1D9D A;  1ZQH A;  5J2F A;  2RQ5 A;  2W8L A;  2ZJ5 A;  4QWD A;  5D46 A;  3JPO A;  3N4M B;  1F44 A;  8ICP A;  5KFE A;  2BCV A;  2OH2 A;  4DQP A;  2DFL A;  2QLT A;  1BPE A;  4MFF A;  3AL0 B;  2Y9U A;  1YZ7 A;  4YD1 A;  2RDJ A;  3PX4 A;  3C1Z A;  3PX6 A;  2FE9 A;  2ZIW A;  4KLD A;  3H0M B;  3SMV A;  4KLU A;  1URJ A;  1AQ6 A;  3TAR A;  4RQ8 A;  1X9W A;  2NYV A;  2Q0Z X;  2W9B B;  4G9B A;  5KG6 A;  3T5H A;  3TAP A;  1ZQL A;  4YVZ A;  1TAM A;  2OWO A;  5KFV A;  1SGG A;  1ZQK A;  4OJL A;  1ZRN A;  2JRZ A;  3RJI A;  2IOF K;  2OHF A;  4DSK A;  2W7P A;  5IIN A;  2FMP A;  4UB5 A;  4ECT A;  3QU4 A;  1TFR A;  1SZH A;  1P7D A;  3PSP A;  1ZQY A;  3RAX A;  3TAD A;  2UVV A;  8ICJ A;  5L1L A;  5DB7 A;  4ELU A;  2Z7J A;  1JMS A;  4ICA A;  3HJE A;  2WF8 A;  5CHG A;  2AU0 A;  3MR6 A;  3TKA A;  1V9P A;  3C2K A;  5KT5 A;  4ED8 A;  1ZJM A;  2EAP A;  1NK6 A;  3MR3 A;  3EPI A;  3WKD A;  4RUA A;  3QXG A;  3UXO A;  1S97 A;  2WTF A;  1WG8 A;  4BUG A;  4QIW F;  8ICQ A;  3RR8 A;  2GOL A;  4EYH B;  2XCP A;  5DQH A;  3QYP A;  5KFJ A;  4BWJ A;  7ICP A;  5HML A;  4O3P A;  1S76 D;  5AK4 A;  3GV5 B;  1O08 A;  8ICH A;  4NL9 A;  3SZ2 A;  8ICB A;  2H3Q A;  3BJY A;  3E58 A;  1T4G A;  4BXO A;  3WK5 A;  5J0X A;  4RQ7 A;  1TE2 A;  2YB4 A;  5C0Y A;  4GC6 A;  5H2F U;  1ECW A;  5J8Y A;  2V9W A;  2KTQ A;  4UB3 A;  1LVH A;  1QH9 A;  4KLQ A;  3PNC A;  3VCB A;  3M9N B;  4G3I A;  2C2R A;  2AQ4 A;  4IRK A;  2EAN A;  3K1R B;  4PL1 A;  4FE3 A;  3M9M B;  2KP7 A;  2AXT U;  1LV5 A;  9ICG A;  2MUT B;  1BNO A;  2ZUC A;  1ED1 A;  2ZIX A;  1JRP A;  1ZD2 P;  4MEY A;  2C22 A;  4PHA A;  3V7J A;  2J6T A;  5J8Y C;  1RYU A;  4KLM A;  1S9F A;  2JGA A;  2OM6 A;  3SAH A;  3DDH A;  4Y2Q A;  3D2Q A;  1JIH A;  5ALX A;  2LI6 A;  5KL8 B;  1NK9 A;  3GII A;  3GIM A;  3UQ0 A;  7ICT A;  3V6H A;  2JZB A;  3EUB 2;  2UVW A;  4GC7 A;  5KFM A;  1OUQ A;  2DWQ A;  1N56 A;  3JPS A;  4Q44 A;  4J9M A;  1JXE A;  2JZB B;  1GO3 F;  3GQC A;  5JUM A;  9ICW A;  2JEJ A;  3UMG A;  3CRX A;  2W9M A;  4DF4 A;  4RQ2 A;  3MFI A;  4BJQ A;  2LHT A;  4UQG A;  3Q8Q B;  4YG2 A;  1MSW D;  4DLG A;  3BDP A;  5AKE A;  2KOB A;  1MQ3 A;  1UCV A;  3T5J A;  4M47 A;  9ICN A;  1NKE A;  3OTQ A;  2NV3 A;  8ICK A;  4UAU A;  1ZET A;  2G5I B;  2KZ3 A;  2HHS A;  3MBY A;  3NTU A;  4RPX A;  4M9N A;  2WAQ F;  1CEZ A;  3M7D A;  1ZQQ A;  2BCU A;  4AYB C;  2QB0 B;  4YP3 A;  4F72 A;  4JV2 A;  2BQ3 A;  4HYK A;  3RJG A;  4ELT A;  3OSP A;  4GXJ A;  4CF4 A;  1X2I A;  3HRD D;  9ICR A;  4FS1 A;  2H3I A;  3EZ5 A;  1BVS A;  2J6U A;  2K8C B;  3QU7 A;  2EDU A;  1ZQU A;  5AKH A;  4Q8F A;  4F5R A;  3SEI A;  4RNM A;  2IA6 A;  1K1S A;  4F5P A;  1U45 A;  4ED3 A;  1ZQA A;  1C7Y A;  4KLI A;  5KFZ A;  3B0Y A;  3NVW A;  2RHF A;  2PFP A;  3SAG A;  3H0R B;  5TZV A;  3H4D A;  1BNP A;  2KE7 A;  5CP2 A;  2ZTE A;  5J29 A;  1N63 A;  2W8K A;  1T8E A;  5CEH A;  5AI4 A;  2KFN A;  2FMQ A;  4NLZ A;  5JU5 A;  1BPD A;  4EZ6 A;  1Z00 B;  1L7O A;  2XVT A;  3GIL A;  2D8C A;  5J0R A;  4C4S A;  5ALQ A;  1YT3 A;  3NRZ A;  4XQ8 A;  1N5X A;  2R18 A;  4F2R A;  4KMO B;  3MGV A;  3V72 A;  9ICM A;  4PH5 A;  3G6Y A;  1SV4 A;  1O03 A;  1ZXI A;  3PX0 A;  3MDC A;  5HMM A;  2KJ8 A;  4B9V A;  9ICJ A;  3FAH A;  2LKY A;  4WJ3 B;  4US8 A;  4JMU A;  5DG8 A;  1V38 A;  3NVY A;  5F3X B;  3RJK A;  4UAR A;  1TK8 A;  2OEH A;  2LYB A;  2XC9 A;  2WF5 A;  2BDP A;  4J9R A;  5EE0 A;  3HX0 A;  3EW9 A;  5J0T A;  3AU6 A;  1FO4 A;  2F8L A;  3QEA Z;  1ZYQ A;  4EEK A;  3V6K A;  3ICX A;  7ICE A;  3ISB A;  1F5S A;  4CNQ A;  2P35 A;  1NJX A;  3H8M A;  3BS5 B;  8ICW A;  3AMZ A;  2BQR A;  4ECQ A;  1HUZ A;  3KBB A;  4C4T A;  4CCH A;  3LYS A;  4BXO B;  2FPM A;  2H3F A;  4P0Q A;  4QZG A;  1X40 A;  4DFM A;  2YY6 A;  2FLN A;  3MC1 A;  5L1I A;  1S5L U;  4C8L A;  5KFW A;  5KFG A;  5IIL A;  3GIJ A;  5J2K A;  3PO4 A;  1S0V A;  5F9N A;  3PR4 A;  2QB1 A;  4ZOH C;  4M04 A;  2YML A;  5KFF A;  9ICV A;  5L1M A;  4QZC A;  5AKL A;  3M1Y A;  4RPZ A;  3T3F A;  3SI8 A;  4OD0 A;  3RB4 A;  5KFD A;  2R8H A;  4DS5 A;  1XSL A;  1NJZ A;  4M9G A;  3RAQ A;  2AGP A;  2K8A A;  3AN1 A;  7ICN A;  1PVR A;  5HHI A;  4MF2 A;  3BQT A;  4UBC A;  1RG6 A;  9ICX A;  3CYM A;  4LVS A;  1BPB A;  3RB6 A;  3ZDC A;  1V97 A;  1X42 A;  1QSL A;  1X9X A;  1NK7 A;  4I2C A;  4Q8E A;  3AM9 A;  2HHU A;  4NV0 A;  3H8W A;  2H5X A;  8ICO A;  1UHU A;  1ZD4 A;  7ICG A;  3G6X A;  5J0W A;  1TK5 A;  4I2I A;  3FC4 A;  3TFR A;  4Z6C A;  4Y2R A;  2Y0S F;  3HKZ F;  4ECS A;  3BQ1 A;  5ALN A;  4QZI A;  1PK1 A;  1SL1 A;  3TAC B;  4B9M A;  1ZQF A;  1UT8 A;  2YMM A;  3SV3 A;  2YN4 A;  3BQ2 A;  1U48 A;  4C8K A;  5EE1 A;  4I2E A;  1PZN A;  4QWC A;  2KJ9 A;  1S10 A;  3B9J A;  4J9K A;  4KIT B;  1IV8 A;  1NK5 A;  3MFH A;  2WB1 C;  5ALW A;  3EYZ A;  1HEK A;  2K89 A;  4DL2 A;  2I9G A;  4O3S A;  1UQV A;  2PI4 A;  3NAS A;  3TFS A;  8ICT A;  1X9M A;  1XC9 A;  2HSZ A;  5T14 A;  3RB0 A;  2E8O A;  5EOZ A;  5J2D A;  5HR6 A;  5IIM A;  1OW5 A;  4OCZ A;  1WWU A;  4NLK A;  1T3N A;  1H38 A;  4C80 A;  4PHP A;  1L6N A;  2G5H B;  4J9O A;  1SL2 A;  3S6J A;  4DSF A;  5D4B A;  3PVX A;  3LK9 A;  5AI9 A;  3IG5 A;  3HWT A;  5KG7 A;  4YXJ A;  2HOF A;  3F2D A;  4MEX A;  8ICV A;  3HT3 A;  3IHQ B;  1NK8 A;  4ED6 A;  1KRP A;  2VJ5 A;  1COK A;  2HVH A;  1ZQS A;  5AK3 A;  2CPR A;  4Y2P A;  3AU2 A;  2B0C A;  3ED5 A;  2R8K A;  2F77 X;  4I2G A;  4DS4 A;  4M9L A;  3KKA C;  4Y2Y A;  2KJ5 A;  3WU2 U;  3C1Y A;  4YD2 A;  1QQ5 A;  2K60 A;  7ICU A;  3RRH A;  3ETR A;  1V85 A;  2D6F C;  5AI8 A;  2LBO A;  5G5H A;  4EZ9 A;  4MFA A;  8ICG A;  4DSE A;  3PW5 A;  1JX4 A;  5JTI A;  2K8B B;  4P4P A;  4QZ9 A;  4ECY A;  1JRO A;  5DGA A;  5DKW A;  4NXZ A;  3H40 A;  2DQN B;  2GH1 A;  1Z4N A;  3N7P D;  3ETL A;  4YMM A;  5AK5 A;  2W9C B;  1T94 A;  7ICJ A;  4OO1 J;  1SWV A;  4A8E A;  1IIP A;  2FPL A;  5CA7 A;  2ZG6 A;  2MUT A;  4U6P A;  1N62 A;  1ZQG A;  3K1Z A;  4DL4 A;  5AIA A;  1SKS A;  5CB1 A;  2HHW A;  2F1I A;  9ICB A;  3V7K A;  3SEN A;  5KG3 A;  4KLJ A;  4J03 A;  2QAR B;  5AKK A;  5E79 U;  4ACO A;  2YX8 A;  4UAZ A;  1X6I A;  5CJ7 A;  1FFV A;  2ZIV A;  4FBT A;  4UAW A;  3EWA A;  3NRW A;  3ORY A;  2ZUD A;  4CGZ A;  2OXO A;  2XGP A;  2QAR A;  1UT5 A;  4JUZ A;  3GV8 B;  1WUD A;  4OJ5 A;  4JK1 A;  3ZD8 A;  3KKA A;  3MAB A;  1QQ6 A;  4Q45 A;  4PGX A;  4EBC A;  8ICI A;  2KN7 A;  3CP8 A;  5CR0 A;  3H4B A;  2KIC A;  5F9L A;  4PZO A;  4YCX A;  5J2J A;  3QZ8 A;  2JHD A;  1ZD3 A;  9ICO A;  3L4P A;  2CXY A;  4IQT A;  2R8J A;  2HHV A;  5EWE A;  4EEY A;  4O5E A;  4KLT A;  4NWI A;  7ICQ A;  1N48 A;  1ZQN A;  3FYH A;  5DBA A;  4PHE A;  3RBE A;  5ALG A;  2C2D A;  4DOB A;  2ALZ A;  3Q8S B;  1NZP A;  2FI1 A;  3JPT A;  3SV4 A;  1SIJ A;  5ALE A;  3KFU F;  4KLG A;  1ZRM A;  1NK4 A;  1QQ7 A;  2KG5 A;  5JRT A;  2ASJ A;  2DKX A;  4QWE A;  5G5G A;  4J9N A;  1CI4 A;  2NRV A;  3UMC A;  1X66 A;  1COO A;  2O6K A;  5AM4 A;  4QW9 A;  4O0I A;  2I6X A;  1B22 A;  9ICA A;  3QUQ A;  3J81 j;  9ICE A;  3RBD A;  4Y2J A;  3HW8 A;  2HHT A;  2IHM A;  3M6Z A;  5DG9 A;  2IBK A;  2G06 A;  2QB0 A;  1SXD A;  1MC8 A;  4ECW A;  1PVP A;  5KFB A;  2FLL A;  5DDM A;  2D3D A;  2W9A A;  2KFZ A;  2VA2 A;  3ZDD A;  4QNL A;  2ZXI A;  5AKX A;  2OYY A;  1M6Y A;  4ECZ A;  2H3Z A;  2F76 X;  5AKG A;  1KFT A;  1KSP A;  2PKE A;  3UXN A;  4QZB A;  1ARO P;  2HOQ A;  3PW4 A;  4Y2S A;  5ALZ A;  2AQ0 A;  1D8B A;  2WHE A;  2V4Q A;  1NJY A;  1X9S A;  3QU5 A;  5ALM A;  3QUC A;  3N7R C;  3D2S A;  5AM5 A;  1ZQE A;  3AUO A;  2M9N A;  3QU9 A;  8ICU A;  3UPQ A;  3LWL A;  5ALF A;  5J2B A;  5DLF A;  4RUC A;  2R8G A;  2AGQ A;  1XSN A;  2BR0 A;  3L5K A;  1S0M A;  2ZIX B;  4USA A;  4KTQ A;  5KT4 A;  4F4Z A;  4QZA A;  2JR5 A;  4RT3 A;  3GZF A; 
#chains in the Genus database with same CATH homology
 4NJ8 A;  1X9X A;  2EAN A;  3K1R B;  5KNI A;  3KKA C;  2K60 A;  2B6G A;  1V38 A;  2YTU A;  5F3X B;  1V85 A;  2GLE A;  2E8N A;  2ESE A;  2KG5 A;  5JRT A;  1SGG A;  2DKX A;  2KSO B;  3IDW A;  2F3N A;  4IS7 A;  5JTI A;  2QB0 B;  2E8P A;  1PK1 A;  3TAC B;  1X66 A;  2L5Y A;  3TAD C;  1LKY B;  1WWV A;  2Y9T A;  1SV0 C;  1PK3 A;  2ES6 A;  2LPE A;  1F0M A;  2QKQ A;  1B4F A;  2KMD A;  3TAD A;  5J8Y C;  3H8M A;  2DL0 A;  3BS5 B;  2QB0 A;  1SXD A;  1OXJ A;  3BQ7 A;  3HIL A;  4PZN A;  1JI7 A;  3SEI A;  3SEN A;  2K4P A;  2EAP A;  2D3D A;  2F44 A;  2QAR B;  1SXE A;  1UQV A;  4NL9 C;  1X40 A;  4RQM A;  2KE7 A;  2E8O A;  4MHV A;  2F8K A;  2E8M A;  2QAR A;  1OW5 A;  1WWU A;  1Z1V A;  5JU5 A;  2QB1 A;  5L1M A;  3KKA A;  2D8C A;  1PK1 B;  2KSO A;  1B0X A;  4PZO A;  4NL9 A;  2JV3 A;  2Y9U A;  2DKZ A;  1SV4 A;  1SV0 A;  1KW4 A;  3BS7 A;  1UCV A;  2EAO A;  1RG6 A;  2FE9 A;  2LMR A;  4RQN A;  1LKY A;  5J8Y A;  3BS5 A;  2KIV A;  1COK A;  2EAM A;  1DXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...