2F44A

Crystal structure of the zinc-bound shank sam domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
MLQLWSKFDVGDWLESIHLGEHRDRFEDHEIEGAHLPALTKEDFVELGVTRVGHRENIERALRQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3 and multiple ankyrin repeat domains 3
publication title An architectural framework that may lie at the core of the postsynaptic density.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 23
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f44A00
5J8YC 1X40A 2QB1A 2QARB 2JV3A 1RG6A 2EAMA 2LMRA 1UQVA 3BS5B 1PK1A 1UCVA 3TADC 2EAPA 2KE7A 1WWUA 2GLEA 2DKZA 2K4PA 1PK1B 1SV0C 5JU5A 3HILA 2KMDA 1KW4A 1F0MA 4RQMA 1SXEA 1WWVA 2Y9UA 2QB0A 2KG5A 1PK3A 2QKQA 3KKAA 4NL9C 3BS7A 2YTUA 4PZNA 1SV4A 3BQ7A 1OXJA 2QB0B 1OW5A 2F3NA 4MHVA 5KNIA 1B4FA 2ESEA 4IS7A 5JTIA 3IDWA 2FE9A 1SGGA 2E8NA 2F44A 1V38A 1COKA 2DL0A 1X66A 2B6GA 2KSOA 5J8YA 2E8PA 2ES6A 3SENA 1X9XA 2KSOB 5JRTA 3TADA 3SEIA 1SXDA 2EAOA 2L5YA 2LPEA 1SV0A 3KKAC 2E8MA 2K60A 1DXSA 1B0XA 4PZOA 5F3XB 1LKYA 2Y9TA 2KIVA 4RQNA 2EANA 4NL9A 5L1MA 4NJ8A 1V85A 2F8KA 3H8MA 1LKYB 2D3DA 2E8OA 2D8CA 3K1RB 1JI7A 1Z1VA 2DKXA 2QARA 3BS5A 3TACB
chains in the Genus database with same CATH superfamily
2H3ZA 2JH7A 2ZG6A 2YQEA 4Z6FA 1J97A 3DEEA 4DLEA 2YMQA 2ZUDA 4A8EA 2XGPA 2HCFA 4QZEA 4F5PA 1UA0A 4E0DA 1Z4OA 1F0MA 5L1IA 1MQ3A 1SKRA 2HVIA 2LM1A 3IV6A 2C22A 3PX0A 4PZNA 9ICGA 4Y2JA 3GU3A 2P6UA 4ELUA 1ZQQA 4CGZA 4KX5A 2ZIWB 4YR3A 1TV9A 3JPTA 2J6TA 3AU6A 4KLJA 4CF4A 2MA1A 3GIJA 3ZDDA 2EDUA 5ALUA 1C20A 2N1RA 1BPEA 3Q8SB 3CNHA 2C28A 2G09A 4IC9A 1PUZA 2O6KA 4I29A 1DOQA 1X66A 1S77D 4RPYA 4ECTA 2B6GA 1JXEA 3QZ7A 4JWMA 4I2AA 5DBBA 3T5HA 9ICXA 4J9PA 8ICCA 3WKBA 3PX4A 1ZQDA 2YN4A 8ICOA 2P6RA 4I28A 5H2FU 8ICVA 2UVVA 5KFJA 5KG4A 2OXOA 1S0NA 1PZNA 3SV3A 2BDUA 2CN1A 3C2LA 2ZJ8A 2KIVA 3HKZF 2H5XA 3UM9A 2WTFA 4B9NA 4OJPA 3KHLA 2KOBA 4DS4A 1JI7A 1XS9D 3N28A 5KTQA 4NLNA 3TACB 2R8IA 3HJEA 1WCLA 4UW9A 4QZGA 4UAZA 5AKJA 2LMRA 2E3TA 1HUOA 1XO0A 4J9LA 5KG3A 1A0PA 1HEKA 5ALZA 5KG6A 2VANA 3IN5A 2LYAA 4RQ8A 2K8CB 2BCSA 3F5AA 4RQ4A 4DL5A 4R65A 1OXJA 2F3NA 5AIAA 2IHMA 1HUZA 2G07A 2CRXA 5J0XA 4P0QB 4GC7A 3E2EA 2KP7A 4HAIA 3D2SA 4DF4A 4DL3A 4PPXA 4MFCA 4GLXA 2V9WA 1JMSA 4KLHA 2PI4A 2DUYA 4ACOA 3U26A 4YMOA 5ALMA 8ICJA 5KFUA 4M9JA 3RH6A 3AN1A 1CEZA 3QUCA 5AK4A 2BPFA 1K5OA 4KLTA 2K89A 9ICIA 4TQRA 2PI5A 2UVUA 3R9KA 2XGQA 1TAMA 4BJQA 5ALSA 3QX7A 5B5EU 2DBYA 4QZDA 2NRVA 4EEKA 1MSWD 1U48A 1J2MA 1L7MA 2RP5A 5A0LA 5AKKA 3JPNA 2OEHA 2BPGA 3GIKA 1Z1VA 2MUTB 5TISU 4G9BA 3C2KA 4O3MA 2DFLA 2BCVA 4DSJA 5D49A 3HP6A 3PVXA 4M9GA 4F4XA 1N2XA 2KZZA 3H0LB 2BCQA 4K4GA 3RTVA 2PKEA 7ICRA 7ICVA 9ICOA 1RM6C 2BKEA 9ICMA 4YD2A 3MBYA 2W8LA 4ED8A 3MABA 5C0YA 1ZQWA 1QQ6A 2H3QA 5DB7A 3WK9A 3PSPA 1AQ6A 1NKCA 2OWOA 1URJA 7ICTA 2CPRA 3F2DA 2EH9A 4TUSA 4CE6A 2ZIUA 3RB0A 5J2DA 2PFOA 1T94A 2AJQA 4FBUA 4WJ3B 4B6JA 4B9TA 5KG0A 7ICFA 4PGXA 1QCKA 5J2EA 3KTQA 2VJ4A 5CHGA 2PFPA 1UT5A 3H8WA 1X9XA 2WAQC 4RQ6A 3MGIA 1FO4A 5AI8A 3V7JA 1RXVA 3C28A 1YT3A 4US9A 2BHNA 5AKGA 3F5EA 1T4GA 5BOMA 2ALZA 1X9WA 4RNNA 3JPOA 3H0RB 4FFDA 3TARA 1N5WA 2ZUBA 4QWDA 3Q8KA 5DGAA 4Y2QA 2DPJA 4J9QA 2KKVA 5KL8B 3PMLA 9ICBA 4IQVA 4P4MA 2A3VA 4KLIA 5KG5A 5D4BA 3WK7A 1FEZA 5J8YC 5DBCA 3SAFA 2W9BA 1JROA 4IRCA 2QB1A 1KEJA 1RG6A 5J2AA 3TI0A 2I1QA 5T14A 5L1LA 2VA2A 8ICFA 1PK1A 2LKYA 4QJFB 2GWSA 2FPLA 2KE7A 4ECWA 3HT3A 2HI0A 3QU5A 4DQPA 1ZD5A 4QZFA 3PSIA 5KFAA 1IG6A 5HMLA 2QKQA 4KLLA 1DGSA 4KTQA 3ZD8A 1D8YA 2HHTA 2MAXA 4RU9A 3DV9A 2HOFA 5BPCA 1LVHA 4Y2YA 4ZH4A 2YMPA 2W03A 4DQQA 4K4HA 5L9XA 2HHXA 1L8LA 1ZD3A 2AQ4A 4CF5A 3UQ2A 4M04A 4Q8FA 4B9LA 3Q8MA 4F4YA 2GOLA 2HHVA 4TUQA 2JEJA 4Q8EA 5ALPA 3B0XA 2QLTA 5KT6A 4EYHB 9ICRA 3PR5B 3F2BA 1CUKA 3UMGA 5CR0A 5E79U 8ICPA 1SV0A 8ICAA 3CRXA 7ICHA 3IM1A 5JUMA 2W7PA 1YZ7A 3JPPA 3OGUA 1TFRA 3MDAA 4C0ZA 4QW9A 3TQ1A 4C8LA 4JWNA 3KD3A 2D6FC 4Y2SA 5IIMA 3LVWA 2D3DA 4TUPA 2IHNA 4Q43A 7ICPA 1ZQEA 1BPZA 3NRWA 2IOFK 4F71A 3BS5A 2ZTEA 1XWLA 4DO9A 3OJUA 3OHAA 3C2MA 4F2SA 4DCCA 3GIIA 1ZRNA 2MUTA 4GFJA 4C4SA 4QZ8A 2ZXHA 5AICA 7ICOA 2Y0SC 1QQ7A 4F72A 3EPIA 4KLUA 3FDSA 1B22A 2KMDA 4BXOA 3PW5A 2I9GA 5KFYA 2RLTA 4NLZA 2MU2A 1X2IA 5L1JA 1RXWA 2FI1A 1SV4A 1UHUA 2C2DA 5HR7A 4NLCA 8ICIA 2HDOA 4O3OA 1ZXIA 2ZJ5A 9ICEA 4I27A 3RR7A 4Y2VA 4DFPA 4PHAA 4Y2PA 3V7KA 3E58A 5DLGA 2KICA 5KFRA 1SGGA 4YXJA 4Y2UA 3PW2A 4KLOA 3CP8A 5AI0A 2JGAA 4JV0A 3MR3A 2KHQA 2NO4A 3NVYA 4RQ0A 1XSNA 2W11A 2YMMA 2BCUA 3RH4A 4J03A 4I2GA 1L7OA 1ZQAA 3WKAA 3PSTA 3RJGA 3C1YA 4GXKA 5AM3A 2WF7A 3C1ZA 2F1HA 3ZDEA 1QSYA 1N56A 1LB2B 5ALDA 1ZQGA 2EAOA 4DL6A 3KKAC 4IR9A 5KFBA 2KD1A 2MRLA 5F3XB 2W54A 8ICHA 2OM6A 3QU9A 3WK6A 2G0AA 3RAQA 4DFKA 2IOFA 2W7OA 5ALVA 3AQFA 4QZBA 2RQ5A 1L3VA 2FLLA 4UB5A 5ALLA 5CJ7A 2ASJA 5DB9A 1DRGA 3Q8QB 2A1JB 5CB1A 5KFPA 3IG8A 4F4KA 1A77A 3AUOA 4BWMA 1MA7A 5KT5A 4F5RA 3TADC 1BNPA 3A0BU 5ALRA 1ZQSA 3G6YA 1ZJNA 4DEZA 1QSSA 4FZLA 2C2RA 3NUQA 4RT2A 2HW3A 3KZIU 3ZDCA 5L1KA 1V9PA 3Q8LA 4NLGA 4YXMA 4KLDA 4Q45A 9ICTA 2OYYA 3NRZA 2VA3A 3PSFA 4J9MA 2ESEA 4NY8A 8ICKA 5GTHU 2G06A 2F2AB 4IL6U 4U7CA 2XO7A 3GV5B 1ZQCA 3GFKB 1SL1A 2KSOA 1Z4NA 4YR0A 3GV8B 4I2DA 2ZIUB 1RQLA 5KT2A 3QYPA 2ZIVA 4PHPA 2KKPA 3UQ0A 1UPHA 5AI5A 2L5YA 2WFAA 3K1ZA 2W9MA 1Y88A 5J2GA 2K60A 5DG8A 8ICYA 1A6SA 4DFJA 2AGQA 4PZOA 2E1EA 3WK4A 2JZBA 1ZQ1C 8ICGA 4NV0A 2HOIA 2ZTCA 4NL9A 7ICGA 4RQ5A 1ZQHA 2BQ3A 3NVWA 2FPKA 3E0FA 4O9MA 3BQ0A 3H40A 1ZQNA 1ZQIA 3M9NB 3AEVA 1JUDA 4KLMA 2BR0A 2QARA 4UAYA 2AGPA 3V6KA 3EUB2 4EX6A 3UPQA 4ED1A 4UB1A 2R8JA 3UXOA 1Z1BA 3IRUA 9ICHA 8ICXA 1KQQA 2KJ5A 4UQGA 2W9BB 5KFGA 4QIWC 2XIDA 1PK1B 1GO3F 1NZPA 4ELTA 1TAQA 1NK8A 1ZD2P 4KLGA 2ISPA 3HRDD 2VA8A 3HX0A 2EZZA 3SZ2A 1TE2A 4QWAA 3UXPA 3RF9A 5J2JA 2BZFA 3BZCA 2FPMA 3JPQA 4GXJA 5KNIA 2BQRA 2R8KA 2RRDA 5F9NA 2RHFA 5J0RA 1EXNA 5KT4A 4RPZA 4C7ZA 3TKAA 1KTQA 1BPBA 4O3PA 3V6HA 1H38A 3O0FA 3WKEA 3T79A 2R18A 2HBJA 5EE0A 5JRTA 5DBAA 3GQCA 5FP0A 4C7YA 2WF6A 3PMNA 3SAHA 3EYZA 2WF5A 5AI6A 4PHEA 3MDCA 1JALA 5B66U 1MC8A 5DDYA 1MN8A 1B0XA 4GC6A 4O5KA 8ICNA 3N7PD 2PMZC 1LKYA 3QU4A 1ZQMA 4DOBA 4NJ8A 3KHRA 3H8MA 2UVRA 3SYZA 2ZXIA 2HHSA 3IP4B 1V97A 1JN3A 5CP2A 1N62A 3I1YA 2K4HA 4UB2A 4ECUA 1RZTA 3BS5B 4TQSA 2VJ5A 2HHUA 2IMWP 2KN7A 1ED1A 2W04A 3CYMA 4F5QA 4ICAA 3TAQA 1JIHA 3PW7A 5IILA 2A1JA 5JU5A 3Q8PB 1ZQYA 4AYBC 4RQMA 3KHGA 4M9LA 2QB0A 5G5GA 4FZNA 3ZI4A 3BS7A 3QUQA 4BXOB 9ICKA 2EQYA 4BDPA 4P4PA 3D2NA 5KFFA 4B9UA 5GTIU 4UAVA 3RH5A 3K75D 2J6SA 1KFDA 2Y1JA 3SAGA 4F2RA 3QXGA 2A19A 9ICCA 2CXYA 2WB1F 5CWRA 2I5HA 5HHIA 4GXIA 1XNSA 4QW8A 1ZD4A 3C5GA 4RZRA 4IR1A 3QEBZ 2FDRA 2JH1A 3EW9A 4OJ5A 1D8LA 1NK5A 5AKLA 3SEIA 4RQ7A 2KVCA 4KMOB 3M7DA 1B43A 1NK7A 1RQNA 2DPIA 2OHFA 1L3SA 3NVVA 3HWTA 1FFUA 4F5NA 2LI6A 1J2NA 1DK2A 2FMPA 3WK8A 4Y2TA 4RUAA 2VIXA 1KRPA 3IG5A 2XICA 3ALRA 4DS5A 4NLBA 2W9CA 4KITB 4ECVA 3T3FA 5AK5A 1ZQVA 1COOA 2DKXA 2NYVA 3NVZA 4P0PB 4JB3A 2NO5A 1K1SA 3HW8A 1D9DA 1S0MA 4M0AA 5HNKA 2Q4TA 3SQIA 3EWAA 4DL2A 5G5HA 3M6ZA 3THVA 1TAUA 3VC8A 3OJSA 2GLEA 1A76A 2HHQA 3HILA 2Y1IA 4EBDA 3OTQA 5C5JA 4UAWA 5TZVA 3BZKA 2J6UA 3FYHA 3GIMA 5KG7A 2HBLA 3HPOA 4YMMA 1U47A 9ICLA 2JHDA 3PW4A 2C2EA 1BPYA 4ED0A 1RPLA 3M8SA 4YP3A 3RR8A 8ICBA 3H7IA 4X5VA 1ZQZA 4MFAA 2ASDA 4DOCA 2WAQF 1ZQOA 2E8PA 1NJYA 5DDMA 3T5JA 3H4BA 2K4EA 2KSOB 3RB3A 5HR6A 4QWBA 4F4ZA 1CRXA 2V4RA 4EX7A 3JPRA 2KIWA 2E8MA 2HVHA 1BVSA 2ZIVB 1NJWA 1SWVA 2JR5A 1ZQXA 2W9AA 2HBMA 2F1JA 7ICUA 2EANA 2HMXA 3QZ8A 5KFTA 4XUSA 2F8KA 4FBTA 2JZBB 1F5SA 1M6YA 3QUBA 4IRDA 2ISOA 5J0YA 5AKEA 2D8CA 1KFSA 3N7SC 4KLEA 3H8SA 4RQ2A 2Q0ZX 3M9OB 5J29A 2QARB 2JV3A 1N63A 4DOAA 5ALEA 2JEFA 3L4PA 4QZCA 1Z19A 3RB4A 5F9LA 2XCAA 3A0HU 4DSKA 2G08A 4C8MA 4C8OA 1YZ6A 1QTMA 4OJ6A 4O3NA 1NOMA 1XO1A 3AL0B 4YFKA 2H3VA 1TKDA 4LZDA 5AM0A 1PK3A 4KLSA 3AU2A 4CNQA 5ALFA 7ICEA 5J0OA 5DQHA 5BOLA 3UMCA 2E1FA 3L5KA 4LZGA 3RB6A 5KT3A 3V7LA 3PZPA 4KN7A 2AU0A 1SKSA 3IDWA 2G5IB 5KFCA 2AGOA 3M6KA 1WG8A 3NS1A 4DLGA 2YB4A 4QNLA 5KFIA 2DL0A 3V72A 4UASA 1ZJMA 2FMQA 2KZ3A 2R8HA 2K8BB 5ALKA 2ES6A 4I2FA 8ICWA 1S97A 4O3RA 4EELA 9ICWA 4OJOA 2LM4A 3I76A 3C23A 5AKHA 3ISBA 4KLQA 1SXDA 5HMMA 1SB3C 3RRHA 2GO7A 5AKXA 1RYRA 2DQNB 2VKQA 2Y9TA 1ZQRA 3RJKA 2ATLA 4ECXA 8ICTA 2KVSA 1V85A 5KFQA 4DSEA 1LKYB 4RT3A 1WUDA 4DFDA 4DSFA 2PXIA 9ICAA 5J0QA 4XQ8A 1VJ5A 5AHXA 2V4QA 4EYIB 1X40A 5IIJA 1NK0A 1L3TA 7ICMA 4AP9A 3PO5A 4QZ9A 2JMGA 4JUZA 1SIJA 1UQVA 3GV7B 2Y0SF 3QEAZ 2M0NA 5EOZA 2EAPA 2BPCA 1L5UA 4P0PA 3F2CA 5EE9A 5J0UA 4M9HA 1BNOA 1SV0C 2P35A 4C4TA 4UB3A 2KFZA 4YR2A 1L8OA 4F3OA 4F91B 3EZ5A 2KJ8A 3MC1A 1S9FA 2WHEA 4ECSA 4J9NA 2OH2A 1O08A 3AM9A 3RFAA 1DGJA 2QB0B 3PO4A 4UBCA 2LYBA 1S76D 1IIPA 5HHHA 4CRXA 2P66A 3VCBA 5JTIA 2H3IA 1NI3A 3D6JA 3ETLA 2FLPA 4ED2A 4JV2A 1COKA 4MEXA 2M9NA 4GIBA 3RJHA 9ICUA 4PJ0U 4JV1A 5J0WA 5J0PA 2LHTA 3H8JA 3WKDA 2HSZA 4I2CA 4QWEA 8ICEA 4PL2A 3MR6A 4M6WA 2HHWA 2KEYA 1QLNA 5AKYA 5J0SA 4U6PA 7ICLA 3BQTA 3PY8A 2MSNA 2PFNA 4O5CA 1ZQFA 3N7RC 1L3UA 1KL9A 3ETRA 4I2JA 1NJXA 1JXLA 4YQWA 3HKZC 3KFUF 2W9CB 3C29A 4FS1A 8ICLA 2KTQA 1JX4A 1NZBA 7ICQA 4MF8A 4J9OA 1NKEA 1TK0A 2LBOA 5DQIA 4USAA 2XC9A 4BWJA 4NLKA 4Y2XA 4CDGA 1Q3VA 3RJJA 5DG7A 2G5HB 1XSPA 2LYHA 1NKBA 1FIQA 3OSNA 1WWVA 2KG5A 4YMNA 5AM1A 2YMLA 3MR5A 1U49A 1SZHA 3ISDA 4DQRA 3BQ7A 3TAPA 1S5LU 5AM2A 1ZYQA 1AROP 1FFVA 3F53A 2ZTDA 3MFIA 1B4FA 1Z00A 2W8KA 2E8NA 4EZ9A 3ZDBA 2XVTA 4Y2RA 5KFVA 2B0CA 3FAHA 1L7PA 5ALOA 5EWFA 3L3FX 5KFSA 4KMUA 3RRGA 4I2HA 3ZDAA 2NV3A 2IA6A 3OSPA 4Z6CA 4ED7A 3UMBA 5KG2A 2XY5A 1ZQUA 3PNCA 5AKIA 4C8NA 1N48A 3ZD9A 2ZIXA 4K4IA 4O3QA 1VDVA 1TK8A 4ED6A 4FO6A 2FMSA 1ZETA 4C8KA 1JRPA 5EE3A 5ALNA 2BDPA 3K1RB 2KHVA 4DQSA 3LK9A 5KFNA 1T3QA 1ZQKA 4J9SA 1KBUA 3AMZA 1RDFA 1S0OA 3M1YA 1ZQBA 8ICQA 2EAMA 2JRZA 1HIWA 3NASA 4QIWF 1UA1A 1UCVA 4UB8U 3D2QA 3MGVA 1NJZA 4M9NA 5CA7A 8ICUA 1X9MA 2EZYA 5KG1A 1U4BA 1IXRA 4F92B 4IRKA 1BGXT 2K4PA 4R8UA 4R66A 4Z6DA 4UAUA 5ALXA 1SXEA 5KFMA 1UT8A 3GILA 3RBEA 4EZ6A 4NL9C 1IM4A 2NRZA 5AKZA 4PGYA 4YCXA 1X42A 2WB1C 4YN4A 5CEHA 1OW5A 4DFMA 1BPDA 9ICJA 4EBEA 3JPSA 5DG9A 4DL4A 1CI4A 1WYGA 3LYSA 4C4RA 3T5LA 2IBKA 4PL1A 1OUQA 4NM1A 5KFHA 3Q8RB 1ZQPA 2JXJA 5KFOA 5J2FA 4QZAA 2KV2A 5KFKA 5J8YA 1RYUA 4RPXA 1Q3UA 4XA5A 2JEGA 2KJ9A 3DDHA 1TK5A 7ICNA 3RJIA 5ALQA 3K4GA 1ZQTA 2KFNA 2PMZF 5KL1B 4RNMA 4UATA 3MR2A 1S8OA 2Z7JA 5HP4A 1SL0A 3KZXA 1PVQA 4R63A 2YY6A 1U45A 2XI9A 2DGZA 4IQUA 3WKCA 4CF3A 2JEIA 5AK3A 3G6VA 4CCHA 3LWMA 9ICFA 8ICZA 4UB6U 3KHHA 2WF8A 1XSLA 1MQ2A 3WK5A 2NRWA 2AQ0A 2ODGA 1NK4A 2DWQA 7ICJA 4LJXA 1F44A 5DLFA 3OPXA 3RJFA 5D46A 3S6JA 3IHQB 2FLNA 5DKWA 3B0YA 3J81j 2BGWA 4AYBF 1PVRA 2YB1A 1QSLA 1Q46A 3T5KA 5ALHA 1KW4A 1NNLA 4BUGA 5KFZA 4FE3A 2ZIWA 4EEYA 2F76X 5KAIU 5AM5A 3N4MB 1QQ5A 3ICXA 7ICSA 9ICQA 4DSLA 5AK6A 4ED3A 1SKWA 4MHVA 1XC9A 4IS7A 5KFXA 5IIKA 4J9RA 2FE9A 1KSPA 5AI4A 4BX9C 1NK9A 1L6NA 3SI8A 5J2IA 1V38A 4XRHA 3GDXA 4JMUA 4PH5A 4M2YA 2R8GA 3CW2C 4RQ3A 1N5XA 4IQTA 4B9SA 3QU2A 3WU2U 1T8EA 3SENA 5KFEA 2DF4B 1KDHA 4MF2A 4OO1J 1D9FA 3NGDA 3BDPA 8ICSA 5KAFU 2K4IA 9ICVA 4O3SA 3KBBA 9ICNA 2W3SA 1ZRMA 4QZIA 1KKXA 2W43A 2KK0A 3C21A 4G3IA 3AQEA 2NRTA 4M6WB 5ALIA 1P7DA 2AH5A 4F50A 2OCEA 7ICKA 5IIOA 2PFQA 4KX3A 4ECRA 4O5EA 4KN4A 2E8OA 4MEYA 2W55A 5CRXA 5EWEA 8ICMA 4RNOA 5IINA 1KN5A 3M8RA 1DK3A 2XY7A 1WCNA 1O03A 3SV4A 4I2EA 4MFFA 1K1QA 2ASLA 3V6JA 5J2BA 3PV8A 5ALWA 2UVWA 1PVPA 2IOHA 3FC4A 3QNMA 3PR4A 5DB6A 1KFTA 2RDIA 9ICPA 3FM9A 1WWUA 3SR6A 4ELVA 3LDAA 4QZHA 5J2CA 5AIBA 1HJPA 2Y9UA 4LVSA 8ICRA 3QUTA 4EBCA 4RQ1A 3QE9Y 4OCZA 3KKAA 1ZQLA 5ALTA 2YTUA 5ALGA 2KZMA 3KOOA 4P0QA 2F77X 4OD0A 4O0IA 2W3RA 2F1IA 3PW0A 1X9SA 5J2HA 3EPGA 1ECWA 2E5SA 2YX8A 1U9LA 4ECYA 1C7YA 1BPXA 4DF8A 3BQ2A 1Z00B 3ED5A 2ZJAA 3SMVA 3I28A 3UXNA 4R64A 2XY6A 1TVAA 2GH1A 1D8BA 4EENA 3TADA 3MFHA 2K8AA 4P2HA 3BQ1A 4F5OA 4DQIA 1X6IA 4YD1A 2F8LA 2FJ6A 4C80A 4JK1A 4IQWA 1DXSA 4NWIA 5DB8A 1LV5A 2ZUCA 3RBDA 1T7PA 4RQNA 4B9MA 2HOQA 3GZFA 5L1MA 3ISCA 5KFDA 3N97B 4Q44A 3H0MB 2ZIXB 3MGHA 2NRXA 1RYSA 3RAXA 5AI9A 3LWLA 5ALYA 4QWCA 4NM2A 5J0TA 4ECZA 2AHOB 3LVVA 4M47A 2A1AA 4Z6EA 4BGDA 5KFWA 4DL7A 1N60A 2H3FA 4B9VA 3SD7A 1S0VA 4DSIA 3QU7A 4TURA 3B9JA 3G6XA 3H4DA 9ICSA 1Z3EB 2DKZA 4NXZA 1L7NA 3RJEA 2WF9A 1SWWA 1KLNA 4KLFA 1IV8A 4R8UB 5KT7A 1NK6A 2KNJA 4US8A 3ONNA 2HBKA 4F93B 4J9KA 1QH9A 1XU4A 4YG2A 1X6JA 4FS2A 1S10A 3TANA 5DGBA 2AXTU 3OHBA 5ALJA 4PHDA 2XCPA 3NTUA 4FZMA 4P4OA 7ICIA 4I2IA 4OJLA 2F44A 1ZOLA 4UARA 1SL2A 5K4LA 4ECQA 5IIIA 4PGQA 5EE1A 5J2KA 4ZOHC 1SZPA 3ORYA 1N61A 4UBBA 5DQGA 4RUCA 4YVZA 1Q8KA 2LPEA 1ZQJA 3C5FA 4HYKA 4UB4A 2I6XA 2EZXA 2RDJA 1T3NA 2BQUA 4I2BA 3TFSA 2B21A 3PX6A 5AM4A 3TFRA 4DWIA 3BJYA 5EWGA 5KFLA 4F8RA 1VLBA 3M9MB 2BCRA 4F4WA
chains in the Genus database with same CATH topology
5J8YC 1X40A 2QB1A 2QARB 2JV3A 1RG6A 2EAMA 2LMRA 1UQVA 3BS5B 1PK1A 1UCVA 3TADC 2EAPA 2KE7A 1WWUA 2GLEA 2DKZA 2K4PA 1PK1B 1SV0C 5JU5A 3HILA 2KMDA 1KW4A 1F0MA 4RQMA 1SXEA 1WWVA 2Y9UA 2QB0A 2KG5A 1PK3A 2QKQA 3KKAA 4NL9C 3BS7A 2YTUA 4PZNA 1SV4A 3BQ7A 1OXJA 2QB0B 1OW5A 2F3NA 4MHVA 5KNIA 1B4FA 2ESEA 4IS7A 5JTIA 3IDWA 2FE9A 1SGGA 2E8NA 2F44A 1V38A 1COKA 2DL0A 1X66A 2B6GA 2KSOA 5J8YA 2E8PA 2ES6A 3SENA 1X9XA 2KSOB 5JRTA 3TADA 3SEIA 1SXDA 2EAOA 2L5YA 2LPEA 1SV0A 3KKAC 2E8MA 2K60A 1DXSA 1B0XA 4PZOA 5F3XB 1LKYA 2Y9TA 2KIVA 4RQNA 2EANA 4NL9A 5L1MA 4NJ8A 1V85A 2F8KA 3H8MA 1LKYB 2D3DA 2E8OA 2D8CA 3K1RB 1JI7A 1Z1VA 2DKXA 2QARA 3BS5A 3TACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8Y C;  1X40 A;  2QB1 A;  2QAR B;  2JV3 A;  1RG6 A;  2EAM A;  2LMR A;  1UQV A;  3BS5 B;  1PK1 A;  1UCV A;  3TAD C;  2EAP A;  2KE7 A;  1WWU A;  2GLE A;  2DKZ A;  2K4P A;  1PK1 B;  1SV0 C;  5JU5 A;  3HIL A;  2KMD A;  1KW4 A;  1F0M A;  4RQM A;  1SXE A;  1WWV A;  2Y9U A;  2QB0 A;  2KG5 A;  1PK3 A;  2QKQ A;  3KKA A;  4NL9 C;  3BS7 A;  2YTU A;  4PZN A;  1SV4 A;  3BQ7 A;  1OXJ A;  2QB0 B;  1OW5 A;  2F3N A;  4MHV A;  5KNI A;  1B4F A;  2ESE A;  4IS7 A;  5JTI A;  3IDW A;  2FE9 A;  1SGG A;  2E8N A;  2F44 A;  1V38 A;  1COK A;  2DL0 A;  1X66 A;  2B6G A;  2KSO A;  5J8Y A;  2E8P A;  2ES6 A;  3SEN A;  1X9X A;  2KSO B;  5JRT A;  3TAD A;  3SEI A;  1SXD A;  2EAO A;  2L5Y A;  2LPE A;  1SV0 A;  3KKA C;  2E8M A;  2K60 A;  1DXS A;  1B0X A;  4PZO A;  5F3X B;  1LKY A;  2Y9T A;  2KIV A;  4RQN A;  2EAN A;  4NL9 A;  5L1M A;  4NJ8 A;  1V85 A;  2F8K A;  3H8M A;  1LKY B;  2D3D A;  2E8O A;  2D8C A;  3K1R B;  1JI7 A;  1Z1V A;  2DKX A;  2QAR A;  3BS5 A;  3TAC B; 
#chains in the Genus database with same CATH topology
 2H3Z A;  2JH7 A;  2ZG6 A;  2YQE A;  4Z6F A;  1J97 A;  3DEE A;  4DLE A;  2YMQ A;  2ZUD A;  4A8E A;  2XGP A;  2HCF A;  4QZE A;  4F5P A;  1UA0 A;  4E0D A;  1Z4O A;  1F0M A;  5L1I A;  1MQ3 A;  1SKR A;  2HVI A;  2LM1 A;  3IV6 A;  2C22 A;  3PX0 A;  4PZN A;  9ICG A;  4Y2J A;  3GU3 A;  2P6U A;  4ELU A;  1ZQQ A;  4CGZ A;  4KX5 A;  2ZIW B;  4YR3 A;  1TV9 A;  3JPT A;  2J6T A;  3AU6 A;  4KLJ A;  4CF4 A;  2MA1 A;  3GIJ A;  3ZDD A;  2EDU A;  5ALU A;  1C20 A;  2N1R A;  1BPE A;  3Q8S B;  3CNH A;  2C28 A;  2G09 A;  4IC9 A;  1PUZ A;  2O6K A;  4I29 A;  1DOQ A;  1X66 A;  1S77 D;  4RPY A;  4ECT A;  2B6G A;  1JXE A;  3QZ7 A;  4JWM A;  4I2A A;  5DBB A;  3T5H A;  9ICX A;  4J9P A;  8ICC A;  3WKB A;  3PX4 A;  1ZQD A;  2YN4 A;  8ICO A;  2P6R A;  4I28 A;  5H2F U;  8ICV A;  2UVV A;  5KFJ A;  5KG4 A;  2OXO A;  1S0N A;  1PZN A;  3SV3 A;  2BDU A;  2CN1 A;  3C2L A;  2ZJ8 A;  2KIV A;  3HKZ F;  2H5X A;  3UM9 A;  2WTF A;  4B9N A;  4OJP A;  3KHL A;  2KOB A;  4DS4 A;  1JI7 A;  1XS9 D;  3N28 A;  5KTQ A;  4NLN A;  3TAC B;  2R8I A;  3HJE A;  1WCL A;  4UW9 A;  4QZG A;  4UAZ A;  5AKJ A;  2LMR A;  2E3T A;  1HUO A;  1XO0 A;  4J9L A;  5KG3 A;  1A0P A;  1HEK A;  5ALZ A;  5KG6 A;  2VAN A;  3IN5 A;  2LYA A;  4RQ8 A;  2K8C B;  2BCS A;  3F5A A;  4RQ4 A;  4DL5 A;  4R65 A;  1OXJ A;  2F3N A;  5AIA A;  2IHM A;  1HUZ A;  2G07 A;  2CRX A;  5J0X A;  4P0Q B;  4GC7 A;  3E2E A;  2KP7 A;  4HAI A;  3D2S A;  4DF4 A;  4DL3 A;  4PPX A;  4MFC A;  4GLX A;  2V9W A;  1JMS A;  4KLH A;  2PI4 A;  2DUY A;  4ACO A;  3U26 A;  4YMO A;  5ALM A;  8ICJ A;  5KFU A;  4M9J A;  3RH6 A;  3AN1 A;  1CEZ A;  3QUC A;  5AK4 A;  2BPF A;  1K5O A;  4KLT A;  2K89 A;  9ICI A;  4TQR A;  2PI5 A;  2UVU A;  3R9K A;  2XGQ A;  1TAM A;  4BJQ A;  5ALS A;  3QX7 A;  5B5E U;  2DBY A;  4QZD A;  2NRV A;  4EEK A;  1MSW D;  1U48 A;  1J2M A;  1L7M A;  2RP5 A;  5A0L A;  5AKK A;  3JPN A;  2OEH A;  2BPG A;  3GIK A;  1Z1V A;  2MUT B;  5TIS U;  4G9B A;  3C2K A;  4O3M A;  2DFL A;  2BCV A;  4DSJ A;  5D49 A;  3HP6 A;  3PVX A;  4M9G A;  4F4X A;  1N2X A;  2KZZ A;  3H0L B;  2BCQ A;  4K4G A;  3RTV A;  2PKE A;  7ICR A;  7ICV A;  9ICO A;  1RM6 C;  2BKE A;  9ICM A;  4YD2 A;  3MBY A;  2W8L A;  4ED8 A;  3MAB A;  5C0Y A;  1ZQW A;  1QQ6 A;  2H3Q A;  5DB7 A;  3WK9 A;  3PSP A;  1AQ6 A;  1NKC A;  2OWO A;  1URJ A;  7ICT A;  2CPR A;  3F2D A;  2EH9 A;  4TUS A;  4CE6 A;  2ZIU A;  3RB0 A;  5J2D A;  2PFO A;  1T94 A;  2AJQ A;  4FBU A;  4WJ3 B;  4B6J A;  4B9T A;  5KG0 A;  7ICF A;  4PGX A;  1QCK A;  5J2E A;  3KTQ A;  2VJ4 A;  5CHG A;  2PFP A;  1UT5 A;  3H8W A;  1X9X A;  2WAQ C;  4RQ6 A;  3MGI A;  1FO4 A;  5AI8 A;  3V7J A;  1RXV A;  3C28 A;  1YT3 A;  4US9 A;  2BHN A;  5AKG A;  3F5E A;  1T4G A;  5BOM A;  2ALZ A;  1X9W A;  4RNN A;  3JPO A;  3H0R B;  4FFD A;  3TAR A;  1N5W A;  2ZUB A;  4QWD A;  3Q8K A;  5DGA A;  4Y2Q A;  2DPJ A;  4J9Q A;  2KKV A;  5KL8 B;  3PML A;  9ICB A;  4IQV A;  4P4M A;  2A3V A;  4KLI A;  5KG5 A;  5D4B A;  3WK7 A;  1FEZ A;  5J8Y C;  5DBC A;  3SAF A;  2W9B A;  1JRO A;  4IRC A;  2QB1 A;  1KEJ A;  1RG6 A;  5J2A A;  3TI0 A;  2I1Q A;  5T14 A;  5L1L A;  2VA2 A;  8ICF A;  1PK1 A;  2LKY A;  4QJF B;  2GWS A;  2FPL A;  2KE7 A;  4ECW A;  3HT3 A;  2HI0 A;  3QU5 A;  4DQP A;  1ZD5 A;  4QZF A;  3PSI A;  5KFA A;  1IG6 A;  5HML A;  2QKQ A;  4KLL A;  1DGS A;  4KTQ A;  3ZD8 A;  1D8Y A;  2HHT A;  2MAX A;  4RU9 A;  3DV9 A;  2HOF A;  5BPC A;  1LVH A;  4Y2Y A;  4ZH4 A;  2YMP A;  2W03 A;  4DQQ A;  4K4H A;  5L9X A;  2HHX A;  1L8L A;  1ZD3 A;  2AQ4 A;  4CF5 A;  3UQ2 A;  4M04 A;  4Q8F A;  4B9L A;  3Q8M A;  4F4Y A;  2GOL A;  2HHV A;  4TUQ A;  2JEJ A;  4Q8E A;  5ALP A;  3B0X A;  2QLT A;  5KT6 A;  4EYH B;  9ICR A;  3PR5 B;  3F2B A;  1CUK A;  3UMG A;  5CR0 A;  5E79 U;  8ICP A;  1SV0 A;  8ICA A;  3CRX A;  7ICH A;  3IM1 A;  5JUM A;  2W7P A;  1YZ7 A;  3JPP A;  3OGU A;  1TFR A;  3MDA A;  4C0Z A;  4QW9 A;  3TQ1 A;  4C8L A;  4JWN A;  3KD3 A;  2D6F C;  4Y2S A;  5IIM A;  3LVW A;  2D3D A;  4TUP A;  2IHN A;  4Q43 A;  7ICP A;  1ZQE A;  1BPZ A;  3NRW A;  2IOF K;  4F71 A;  3BS5 A;  2ZTE A;  1XWL A;  4DO9 A;  3OJU A;  3OHA A;  3C2M A;  4F2S A;  4DCC A;  3GII A;  1ZRN A;  2MUT A;  4GFJ A;  4C4S A;  4QZ8 A;  2ZXH A;  5AIC A;  7ICO A;  2Y0S C;  1QQ7 A;  4F72 A;  3EPI A;  4KLU A;  3FDS A;  1B22 A;  2KMD A;  4BXO A;  3PW5 A;  2I9G A;  5KFY A;  2RLT A;  4NLZ A;  2MU2 A;  1X2I A;  5L1J A;  1RXW A;  2FI1 A;  1SV4 A;  1UHU A;  2C2D A;  5HR7 A;  4NLC A;  8ICI A;  2HDO A;  4O3O A;  1ZXI A;  2ZJ5 A;  9ICE A;  4I27 A;  3RR7 A;  4Y2V A;  4DFP A;  4PHA A;  4Y2P A;  3V7K A;  3E58 A;  5DLG A;  2KIC A;  5KFR A;  1SGG A;  4YXJ A;  4Y2U A;  3PW2 A;  4KLO A;  3CP8 A;  5AI0 A;  2JGA A;  4JV0 A;  3MR3 A;  2KHQ A;  2NO4 A;  3NVY A;  4RQ0 A;  1XSN A;  2W11 A;  2YMM A;  2BCU A;  3RH4 A;  4J03 A;  4I2G A;  1L7O A;  1ZQA A;  3WKA A;  3PST A;  3RJG A;  3C1Y A;  4GXK A;  5AM3 A;  2WF7 A;  3C1Z A;  2F1H A;  3ZDE A;  1QSY A;  1N56 A;  1LB2 B;  5ALD A;  1ZQG A;  2EAO A;  4DL6 A;  3KKA C;  4IR9 A;  5KFB A;  2KD1 A;  2MRL A;  5F3X B;  2W54 A;  8ICH A;  2OM6 A;  3QU9 A;  3WK6 A;  2G0A A;  3RAQ A;  4DFK A;  2IOF A;  2W7O A;  5ALV A;  3AQF A;  4QZB A;  2RQ5 A;  1L3V A;  2FLL A;  4UB5 A;  5ALL A;  5CJ7 A;  2ASJ A;  5DB9 A;  1DRG A;  3Q8Q B;  2A1J B;  5CB1 A;  5KFP A;  3IG8 A;  4F4K A;  1A77 A;  3AUO A;  4BWM A;  1MA7 A;  5KT5 A;  4F5R A;  3TAD C;  1BNP A;  3A0B U;  5ALR A;  1ZQS A;  3G6Y A;  1ZJN A;  4DEZ A;  1QSS A;  4FZL A;  2C2R A;  3NUQ A;  4RT2 A;  2HW3 A;  3KZI U;  3ZDC A;  5L1K A;  1V9P A;  3Q8L A;  4NLG A;  4YXM A;  4KLD A;  4Q45 A;  9ICT A;  2OYY A;  3NRZ A;  2VA3 A;  3PSF A;  4J9M A;  2ESE A;  4NY8 A;  8ICK A;  5GTH U;  2G06 A;  2F2A B;  4IL6 U;  4U7C A;  2XO7 A;  3GV5 B;  1ZQC A;  3GFK B;  1SL1 A;  2KSO A;  1Z4N A;  4YR0 A;  3GV8 B;  4I2D A;  2ZIU B;  1RQL A;  5KT2 A;  3QYP A;  2ZIV A;  4PHP A;  2KKP A;  3UQ0 A;  1UPH A;  5AI5 A;  2L5Y A;  2WFA A;  3K1Z A;  2W9M A;  1Y88 A;  5J2G A;  2K60 A;  5DG8 A;  8ICY A;  1A6S A;  4DFJ A;  2AGQ A;  4PZO A;  2E1E A;  3WK4 A;  2JZB A;  1ZQ1 C;  8ICG A;  4NV0 A;  2HOI A;  2ZTC A;  4NL9 A;  7ICG A;  4RQ5 A;  1ZQH A;  2BQ3 A;  3NVW A;  2FPK A;  3E0F A;  4O9M A;  3BQ0 A;  3H40 A;  1ZQN A;  1ZQI A;  3M9N B;  3AEV A;  1JUD A;  4KLM A;  2BR0 A;  2QAR A;  4UAY A;  2AGP A;  3V6K A;  3EUB 2;  4EX6 A;  3UPQ A;  4ED1 A;  4UB1 A;  2R8J A;  3UXO A;  1Z1B A;  3IRU A;  9ICH A;  8ICX A;  1KQQ A;  2KJ5 A;  4UQG A;  2W9B B;  5KFG A;  4QIW C;  2XID A;  1PK1 B;  1GO3 F;  1NZP A;  4ELT A;  1TAQ A;  1NK8 A;  1ZD2 P;  4KLG A;  2ISP A;  3HRD D;  2VA8 A;  3HX0 A;  2EZZ A;  3SZ2 A;  1TE2 A;  4QWA A;  3UXP A;  3RF9 A;  5J2J A;  2BZF A;  3BZC A;  2FPM A;  3JPQ A;  4GXJ A;  5KNI A;  2BQR A;  2R8K A;  2RRD A;  5F9N A;  2RHF A;  5J0R A;  1EXN A;  5KT4 A;  4RPZ A;  4C7Z A;  3TKA A;  1KTQ A;  1BPB A;  4O3P A;  3V6H A;  1H38 A;  3O0F A;  3WKE A;  3T79 A;  2R18 A;  2HBJ A;  5EE0 A;  5JRT A;  5DBA A;  3GQC A;  5FP0 A;  4C7Y A;  2WF6 A;  3PMN A;  3SAH A;  3EYZ A;  2WF5 A;  5AI6 A;  4PHE A;  3MDC A;  1JAL A;  5B66 U;  1MC8 A;  5DDY A;  1MN8 A;  1B0X A;  4GC6 A;  4O5K A;  8ICN A;  3N7P D;  2PMZ C;  1LKY A;  3QU4 A;  1ZQM A;  4DOB A;  4NJ8 A;  3KHR A;  3H8M A;  2UVR A;  3SYZ A;  2ZXI A;  2HHS A;  3IP4 B;  1V97 A;  1JN3 A;  5CP2 A;  1N62 A;  3I1Y A;  2K4H A;  4UB2 A;  4ECU A;  1RZT A;  3BS5 B;  4TQS A;  2VJ5 A;  2HHU A;  2IMW P;  2KN7 A;  1ED1 A;  2W04 A;  3CYM A;  4F5Q A;  4ICA A;  3TAQ A;  1JIH A;  3PW7 A;  5IIL A;  2A1J A;  5JU5 A;  3Q8P B;  1ZQY A;  4AYB C;  4RQM A;  3KHG A;  4M9L A;  2QB0 A;  5G5G A;  4FZN A;  3ZI4 A;  3BS7 A;  3QUQ A;  4BXO B;  9ICK A;  2EQY A;  4BDP A;  4P4P A;  3D2N A;  5KFF A;  4B9U A;  5GTI U;  4UAV A;  3RH5 A;  3K75 D;  2J6S A;  1KFD A;  2Y1J A;  3SAG A;  4F2R A;  3QXG A;  2A19 A;  9ICC A;  2CXY A;  2WB1 F;  5CWR A;  2I5H A;  5HHI A;  4GXI A;  1XNS A;  4QW8 A;  1ZD4 A;  3C5G A;  4RZR A;  4IR1 A;  3QEB Z;  2FDR A;  2JH1 A;  3EW9 A;  4OJ5 A;  1D8L A;  1NK5 A;  5AKL A;  3SEI A;  4RQ7 A;  2KVC A;  4KMO B;  3M7D A;  1B43 A;  1NK7 A;  1RQN A;  2DPI A;  2OHF A;  1L3S A;  3NVV A;  3HWT A;  1FFU A;  4F5N A;  2LI6 A;  1J2N A;  1DK2 A;  2FMP A;  3WK8 A;  4Y2T A;  4RUA A;  2VIX A;  1KRP A;  3IG5 A;  2XIC A;  3ALR A;  4DS5 A;  4NLB A;  2W9C A;  4KIT B;  4ECV A;  3T3F A;  5AK5 A;  1ZQV A;  1COO A;  2DKX A;  2NYV A;  3NVZ A;  4P0P B;  4JB3 A;  2NO5 A;  1K1S A;  3HW8 A;  1D9D A;  1S0M A;  4M0A A;  5HNK A;  2Q4T A;  3SQI A;  3EWA A;  4DL2 A;  5G5H A;  3M6Z A;  3THV A;  1TAU A;  3VC8 A;  3OJS A;  2GLE A;  1A76 A;  2HHQ A;  3HIL A;  2Y1I A;  4EBD A;  3OTQ A;  5C5J A;  4UAW A;  5TZV A;  3BZK A;  2J6U A;  3FYH A;  3GIM A;  5KG7 A;  2HBL A;  3HPO A;  4YMM A;  1U47 A;  9ICL A;  2JHD A;  3PW4 A;  2C2E A;  1BPY A;  4ED0 A;  1RPL A;  3M8S A;  4YP3 A;  3RR8 A;  8ICB A;  3H7I A;  4X5V A;  1ZQZ A;  4MFA A;  2ASD A;  4DOC A;  2WAQ F;  1ZQO A;  2E8P A;  1NJY A;  5DDM A;  3T5J A;  3H4B A;  2K4E A;  2KSO B;  3RB3 A;  5HR6 A;  4QWB A;  4F4Z A;  1CRX A;  2V4R A;  4EX7 A;  3JPR A;  2KIW A;  2E8M A;  2HVH A;  1BVS A;  2ZIV B;  1NJW A;  1SWV A;  2JR5 A;  1ZQX A;  2W9A A;  2HBM A;  2F1J A;  7ICU A;  2EAN A;  2HMX A;  3QZ8 A;  5KFT A;  4XUS A;  2F8K A;  4FBT A;  2JZB B;  1F5S A;  1M6Y A;  3QUB A;  4IRD A;  2ISO A;  5J0Y A;  5AKE A;  2D8C A;  1KFS A;  3N7S C;  4KLE A;  3H8S A;  4RQ2 A;  2Q0Z X;  3M9O B;  5J29 A;  2QAR B;  2JV3 A;  1N63 A;  4DOA A;  5ALE A;  2JEF A;  3L4P A;  4QZC A;  1Z19 A;  3RB4 A;  5F9L A;  2XCA A;  3A0H U;  4DSK A;  2G08 A;  4C8M A;  4C8O A;  1YZ6 A;  1QTM A;  4OJ6 A;  4O3N A;  1NOM A;  1XO1 A;  3AL0 B;  4YFK A;  2H3V A;  1TKD A;  4LZD A;  5AM0 A;  1PK3 A;  4KLS A;  3AU2 A;  4CNQ A;  5ALF A;  7ICE A;  5J0O A;  5DQH A;  5BOL A;  3UMC A;  2E1F A;  3L5K A;  4LZG A;  3RB6 A;  5KT3 A;  3V7L A;  3PZP A;  4KN7 A;  2AU0 A;  1SKS A;  3IDW A;  2G5I B;  5KFC A;  2AGO A;  3M6K A;  1WG8 A;  3NS1 A;  4DLG A;  2YB4 A;  4QNL A;  5KFI A;  2DL0 A;  3V72 A;  4UAS A;  1ZJM A;  2FMQ A;  2KZ3 A;  2R8H A;  2K8B B;  5ALK A;  2ES6 A;  4I2F A;  8ICW A;  1S97 A;  4O3R A;  4EEL A;  9ICW A;  4OJO A;  2LM4 A;  3I76 A;  3C23 A;  5AKH A;  3ISB A;  4KLQ A;  1SXD A;  5HMM A;  1SB3 C;  3RRH A;  2GO7 A;  5AKX A;  1RYR A;  2DQN B;  2VKQ A;  2Y9T A;  1ZQR A;  3RJK A;  2ATL A;  4ECX A;  8ICT A;  2KVS A;  1V85 A;  5KFQ A;  4DSE A;  1LKY B;  4RT3 A;  1WUD A;  4DFD A;  4DSF A;  2PXI A;  9ICA A;  5J0Q A;  4XQ8 A;  1VJ5 A;  5AHX A;  2V4Q A;  4EYI B;  1X40 A;  5IIJ A;  1NK0 A;  1L3T A;  7ICM A;  4AP9 A;  3PO5 A;  4QZ9 A;  2JMG A;  4JUZ A;  1SIJ A;  1UQV A;  3GV7 B;  2Y0S F;  3QEA Z;  2M0N A;  5EOZ A;  2EAP A;  2BPC A;  1L5U A;  4P0P A;  3F2C A;  5EE9 A;  5J0U A;  4M9H A;  1BNO A;  1SV0 C;  2P35 A;  4C4T A;  4UB3 A;  2KFZ A;  4YR2 A;  1L8O A;  4F3O A;  4F91 B;  3EZ5 A;  2KJ8 A;  3MC1 A;  1S9F A;  2WHE A;  4ECS A;  4J9N A;  2OH2 A;  1O08 A;  3AM9 A;  3RFA A;  1DGJ A;  2QB0 B;  3PO4 A;  4UBC A;  2LYB A;  1S76 D;  1IIP A;  5HHH A;  4CRX A;  2P66 A;  3VCB A;  5JTI A;  2H3I A;  1NI3 A;  3D6J A;  3ETL A;  2FLP A;  4ED2 A;  4JV2 A;  1COK A;  4MEX A;  2M9N A;  4GIB A;  3RJH A;  9ICU A;  4PJ0 U;  4JV1 A;  5J0W A;  5J0P A;  2LHT A;  3H8J A;  3WKD A;  2HSZ A;  4I2C A;  4QWE A;  8ICE A;  4PL2 A;  3MR6 A;  4M6W A;  2HHW A;  2KEY A;  1QLN A;  5AKY A;  5J0S A;  4U6P A;  7ICL A;  3BQT A;  3PY8 A;  2MSN A;  2PFN A;  4O5C A;  1ZQF A;  3N7R C;  1L3U A;  1KL9 A;  3ETR A;  4I2J A;  1NJX A;  1JXL A;  4YQW A;  3HKZ C;  3KFU F;  2W9C B;  3C29 A;  4FS1 A;  8ICL A;  2KTQ A;  1JX4 A;  1NZB A;  7ICQ A;  4MF8 A;  4J9O A;  1NKE A;  1TK0 A;  2LBO A;  5DQI A;  4USA A;  2XC9 A;  4BWJ A;  4NLK A;  4Y2X A;  4CDG A;  1Q3V A;  3RJJ A;  5DG7 A;  2G5H B;  1XSP A;  2LYH A;  1NKB A;  1FIQ A;  3OSN A;  1WWV A;  2KG5 A;  4YMN A;  5AM1 A;  2YML A;  3MR5 A;  1U49 A;  1SZH A;  3ISD A;  4DQR A;  3BQ7 A;  3TAP A;  1S5L U;  5AM2 A;  1ZYQ A;  1ARO P;  1FFV A;  3F53 A;  2ZTD A;  3MFI A;  1B4F A;  1Z00 A;  2W8K A;  2E8N A;  4EZ9 A;  3ZDB A;  2XVT A;  4Y2R A;  5KFV A;  2B0C A;  3FAH A;  1L7P A;  5ALO A;  5EWF A;  3L3F X;  5KFS A;  4KMU A;  3RRG A;  4I2H A;  3ZDA A;  2NV3 A;  2IA6 A;  3OSP A;  4Z6C A;  4ED7 A;  3UMB A;  5KG2 A;  2XY5 A;  1ZQU A;  3PNC A;  5AKI A;  4C8N A;  1N48 A;  3ZD9 A;  2ZIX A;  4K4I A;  4O3Q A;  1VDV A;  1TK8 A;  4ED6 A;  4FO6 A;  2FMS A;  1ZET A;  4C8K A;  1JRP A;  5EE3 A;  5ALN A;  2BDP A;  3K1R B;  2KHV A;  4DQS A;  3LK9 A;  5KFN A;  1T3Q A;  1ZQK A;  4J9S A;  1KBU A;  3AMZ A;  1RDF A;  1S0O A;  3M1Y A;  1ZQB A;  8ICQ A;  2EAM A;  2JRZ A;  1HIW A;  3NAS A;  4QIW F;  1UA1 A;  1UCV A;  4UB8 U;  3D2Q A;  3MGV A;  1NJZ A;  4M9N A;  5CA7 A;  8ICU A;  1X9M A;  2EZY A;  5KG1 A;  1U4B A;  1IXR A;  4F92 B;  4IRK A;  1BGX T;  2K4P A;  4R8U A;  4R66 A;  4Z6D A;  4UAU A;  5ALX A;  1SXE A;  5KFM A;  1UT8 A;  3GIL A;  3RBE A;  4EZ6 A;  4NL9 C;  1IM4 A;  2NRZ A;  5AKZ A;  4PGY A;  4YCX A;  1X42 A;  2WB1 C;  4YN4 A;  5CEH A;  1OW5 A;  4DFM A;  1BPD A;  9ICJ A;  4EBE A;  3JPS A;  5DG9 A;  4DL4 A;  1CI4 A;  1WYG A;  3LYS A;  4C4R A;  3T5L A;  2IBK A;  4PL1 A;  1OUQ A;  4NM1 A;  5KFH A;  3Q8R B;  1ZQP A;  2JXJ A;  5KFO A;  5J2F A;  4QZA A;  2KV2 A;  5KFK A;  5J8Y A;  1RYU A;  4RPX A;  1Q3U A;  4XA5 A;  2JEG A;  2KJ9 A;  3DDH A;  1TK5 A;  7ICN A;  3RJI A;  5ALQ A;  3K4G A;  1ZQT A;  2KFN A;  2PMZ F;  5KL1 B;  4RNM A;  4UAT A;  3MR2 A;  1S8O A;  2Z7J A;  5HP4 A;  1SL0 A;  3KZX A;  1PVQ A;  4R63 A;  2YY6 A;  1U45 A;  2XI9 A;  2DGZ A;  4IQU A;  3WKC A;  4CF3 A;  2JEI A;  5AK3 A;  3G6V A;  4CCH A;  3LWM A;  9ICF A;  8ICZ A;  4UB6 U;  3KHH A;  2WF8 A;  1XSL A;  1MQ2 A;  3WK5 A;  2NRW A;  2AQ0 A;  2ODG A;  1NK4 A;  2DWQ A;  7ICJ A;  4LJX A;  1F44 A;  5DLF A;  3OPX A;  3RJF A;  5D46 A;  3S6J A;  3IHQ B;  2FLN A;  5DKW A;  3B0Y A;  3J81 j;  2BGW A;  4AYB F;  1PVR A;  2YB1 A;  1QSL A;  1Q46 A;  3T5K A;  5ALH A;  1KW4 A;  1NNL A;  4BUG A;  5KFZ A;  4FE3 A;  2ZIW A;  4EEY A;  2F76 X;  5KAI U;  5AM5 A;  3N4M B;  1QQ5 A;  3ICX A;  7ICS A;  9ICQ A;  4DSL A;  5AK6 A;  4ED3 A;  1SKW A;  4MHV A;  1XC9 A;  4IS7 A;  5KFX A;  5IIK A;  4J9R A;  2FE9 A;  1KSP A;  5AI4 A;  4BX9 C;  1NK9 A;  1L6N A;  3SI8 A;  5J2I A;  1V38 A;  4XRH A;  3GDX A;  4JMU A;  4PH5 A;  4M2Y A;  2R8G A;  3CW2 C;  4RQ3 A;  1N5X A;  4IQT A;  4B9S A;  3QU2 A;  3WU2 U;  1T8E A;  3SEN A;  5KFE A;  2DF4 B;  1KDH A;  4MF2 A;  4OO1 J;  1D9F A;  3NGD A;  3BDP A;  8ICS A;  5KAF U;  2K4I A;  9ICV A;  4O3S A;  3KBB A;  9ICN A;  2W3S A;  1ZRM A;  4QZI A;  1KKX A;  2W43 A;  2KK0 A;  3C21 A;  4G3I A;  3AQE A;  2NRT A;  4M6W B;  5ALI A;  1P7D A;  2AH5 A;  4F50 A;  2OCE A;  7ICK A;  5IIO A;  2PFQ A;  4KX3 A;  4ECR A;  4O5E A;  4KN4 A;  2E8O A;  4MEY A;  2W55 A;  5CRX A;  5EWE A;  8ICM A;  4RNO A;  5IIN A;  1KN5 A;  3M8R A;  1DK3 A;  2XY7 A;  1WCN A;  1O03 A;  3SV4 A;  4I2E A;  4MFF A;  1K1Q A;  2ASL A;  3V6J A;  5J2B A;  3PV8 A;  5ALW A;  2UVW A;  1PVP A;  2IOH A;  3FC4 A;  3QNM A;  3PR4 A;  5DB6 A;  1KFT A;  2RDI A;  9ICP A;  3FM9 A;  1WWU A;  3SR6 A;  4ELV A;  3LDA A;  4QZH A;  5J2C A;  5AIB A;  1HJP A;  2Y9U A;  4LVS A;  8ICR A;  3QUT A;  4EBC A;  4RQ1 A;  3QE9 Y;  4OCZ A;  3KKA A;  1ZQL A;  5ALT A;  2YTU A;  5ALG A;  2KZM A;  3KOO A;  4P0Q A;  2F77 X;  4OD0 A;  4O0I A;  2W3R A;  2F1I A;  3PW0 A;  1X9S A;  5J2H A;  3EPG A;  1ECW A;  2E5S A;  2YX8 A;  1U9L A;  4ECY A;  1C7Y A;  1BPX A;  4DF8 A;  3BQ2 A;  1Z00 B;  3ED5 A;  2ZJA A;  3SMV A;  3I28 A;  3UXN A;  4R64 A;  2XY6 A;  1TVA A;  2GH1 A;  1D8B A;  4EEN A;  3TAD A;  3MFH A;  2K8A A;  4P2H A;  3BQ1 A;  4F5O A;  4DQI A;  1X6I A;  4YD1 A;  2F8L A;  2FJ6 A;  4C80 A;  4JK1 A;  4IQW A;  1DXS A;  4NWI A;  5DB8 A;  1LV5 A;  2ZUC A;  3RBD A;  1T7P A;  4RQN A;  4B9M A;  2HOQ A;  3GZF A;  5L1M A;  3ISC A;  5KFD A;  3N97 B;  4Q44 A;  3H0M B;  2ZIX B;  3MGH A;  2NRX A;  1RYS A;  3RAX A;  5AI9 A;  3LWL A;  5ALY A;  4QWC A;  4NM2 A;  5J0T A;  4ECZ A;  2AHO B;  3LVV A;  4M47 A;  2A1A A;  4Z6E A;  4BGD A;  5KFW A;  4DL7 A;  1N60 A;  2H3F A;  4B9V A;  3SD7 A;  1S0V A;  4DSI A;  3QU7 A;  4TUR A;  3B9J A;  3G6X A;  3H4D A;  9ICS A;  1Z3E B;  2DKZ A;  4NXZ A;  1L7N A;  3RJE A;  2WF9 A;  1SWW A;  1KLN A;  4KLF A;  1IV8 A;  4R8U B;  5KT7 A;  1NK6 A;  2KNJ A;  4US8 A;  3ONN A;  2HBK A;  4F93 B;  4J9K A;  1QH9 A;  1XU4 A;  4YG2 A;  1X6J A;  4FS2 A;  1S10 A;  3TAN A;  5DGB A;  2AXT U;  3OHB A;  5ALJ A;  4PHD A;  2XCP A;  3NTU A;  4FZM A;  4P4O A;  7ICI A;  4I2I A;  4OJL A;  2F44 A;  1ZOL A;  4UAR A;  1SL2 A;  5K4L A;  4ECQ A;  5III A;  4PGQ A;  5EE1 A;  5J2K A;  4ZOH C;  1SZP A;  3ORY A;  1N61 A;  4UBB A;  5DQG A;  4RUC A;  4YVZ A;  1Q8K A;  2LPE A;  1ZQJ A;  3C5F A;  4HYK A;  4UB4 A;  2I6X A;  2EZX A;  2RDJ A;  1T3N A;  2BQU A;  4I2B A;  3TFS A;  2B21 A;  3PX6 A;  5AM4 A;  3TFR A;  4DWI A;  3BJY A;  5EWG A;  5KFL A;  4F8R A;  1VLB A;  3M9M B;  2BCR A;  4F4W A; 
#chains in the Genus database with same CATH homology
 5J8Y C;  1X40 A;  2QB1 A;  2QAR B;  2JV3 A;  1RG6 A;  2EAM A;  2LMR A;  1UQV A;  3BS5 B;  1PK1 A;  1UCV A;  3TAD C;  2EAP A;  2KE7 A;  1WWU A;  2GLE A;  2DKZ A;  2K4P A;  1PK1 B;  1SV0 C;  5JU5 A;  3HIL A;  2KMD A;  1KW4 A;  1F0M A;  4RQM A;  1SXE A;  1WWV A;  2Y9U A;  2QB0 A;  2KG5 A;  1PK3 A;  2QKQ A;  3KKA A;  4NL9 C;  3BS7 A;  2YTU A;  4PZN A;  1SV4 A;  3BQ7 A;  1OXJ A;  2QB0 B;  1OW5 A;  2F3N A;  4MHV A;  5KNI A;  1B4F A;  2ESE A;  4IS7 A;  5JTI A;  3IDW A;  2FE9 A;  1SGG A;  2E8N A;  2F44 A;  1V38 A;  1COK A;  2DL0 A;  1X66 A;  2B6G A;  2KSO A;  5J8Y A;  2E8P A;  2ES6 A;  3SEN A;  1X9X A;  2KSO B;  5JRT A;  3TAD A;  3SEI A;  1SXD A;  2EAO A;  2L5Y A;  2LPE A;  1SV0 A;  3KKA C;  2E8M A;  2K60 A;  1DXS A;  1B0X A;  4PZO A;  5F3X B;  1LKY A;  2Y9T A;  2KIV A;  4RQN A;  2EAN A;  4NL9 A;  5L1M A;  4NJ8 A;  1V85 A;  2F8K A;  3H8M A;  1LKY B;  2D3D A;  2E8O A;  2D8C A;  3K1R B;  1JI7 A;  1Z1V A;  2DKX A;  2QAR A;  3BS5 A;  3TAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...