2G5HB

Structure of trna-dependent amidotransferase gatcab
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
398
structure length
398
Chain Sequence
FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 119
structure length 398
sequence length 398
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5hB02
2DQNB 3KFUF 1ZQ1C 2G5IB 3AL0B 3H0MB 2F2AB 3H0RB 3H0LB 2D6FC 2G5HB 2DF4B 3IP4B 4WJ3B
chains in the Genus database with same CATH superfamily
4F72A 3WK9A 1J2MA 2XIDA 4J9MA 4O3PA 4QZAA 3QZ8A 4R65A 2KN7A 4Y2RA 2M9NA 4UB2A 2KK0A 3SZ2A 8ICAA 3MFIA 3VCBA 1L5UA 4US9A 3K4GA 4F92B 5D46A 5AK3A 2BCRA 2W3RA 5HMLA 2EAOA 4B9LA 4DL7A 2CRXA 5HMMA 4TURA 2RQ5A 3C5FA 8ICIA 3ISBA 4QZEA 4RNOA 2KD1A 5CR0A 2XC9A 4DWIA 2FLNA 3HP6A 2BQUA 1BPZA 7ICRA 1LV5A 4UB4A 2YMQA 3AU6A 9ICWA 3SR6A 3V7KA 3H0MB 1LB2B 1JXLA 1KFDA 4IQVA 3RJIA 2ODGA 4YFKA 5AM2A 1IV8A 2MA1A 4Y2PA 2OCEA 4PL1A 3UQ2A 2GOLA 3G6VA 2IHNA 3PR5B 3WK6A 4B9VA 1UQVA 3L4PA 3RH4A 4KLFA 1CEZA 3DDHA 1SB3C 2JH1A 2W43A 3CYMA 3ETRA 1ZQUA 8ICUA 4Z6DA 4O3NA 8ICPA 4O5KA 4AP9A 1X6IA 1Z1VA 3ONNA 2NV3A 4J9RA 2WF9A 2I9GA 2F76X 3PX4A 3QUBA 4UAUA 2O6KA 4RQ3A 4RQ6A 3ZDCA 1O08A 4J9PA 2PFOA 1Q3UA 1SV0C 1SZHA 4EYHB 2ZXHA 3HKZC 1KDHA 2ZIWA 1T4GA 4YR3A 2ZTEA 4IC9A 1NJZA 1FEZA 2DGZA 1NJWA 4QZ9A 4M6WB 2C22A 4Y2TA 3IN5A 3C1ZA 3SAFA 4EEKA 2AQ4A 4TUPA 8ICQA 3KOOA 1J2NA 4Q45A 4YR2A 8ICTA 3WKEA 3BJYA 1ZD4A 3KHRA 5EWGA 3I28A 2HHVA 2WB1C 5BOMA 2W9BA 3SQIA 3UXOA 3OHBA 5KG1A 2NYVA 1ZQRA 4BUGA 4J9SA 2KTQA 2DBYA 2P6UA 9ICLA 1KBUA 2OEHA 1KSPA 4F4YA 1L7OA 2B0CA 3TANA 2JZBB 3KZXA 3KZIU 2F8KA 3NUQA 1KTQA 1JI7A 3L3FX 1BPBA 3N28A 1PK3A 3V6HA 1DOQA 2F44A 5KFUA 5KFMA 3MBYA 2BQRA 5AM0A 4UBBA 2HCFA 5CP2A 4NY8A 1L3SA 1QH9A 1MSWD 3K75D 2FPKA 5L9XA 1UHUA 5AI9A 4YXJA 2D3DA 1U49A 4E0DA 1D9FA 4QJFB 5ALLA 5ALIA 3WK8A 2E1FA 1SGGA 4JB3A 2PFPA 3Q8LA 3NVYA 4LZGA 2ZIUA 4ED8A 2P35A 4DF4A 3GIIA 4O3QA 4DQRA 1XS9D 4PH5A 2F1IA 1Q46A 4FFDA 4MEYA 2EAPA 4OJ6A 2OXOA 3H8SA 5ALOA 4O3SA 3TFSA 1P7DA 2YMPA 2AU0A 4QNLA 3RBDA 1ZQAA 4OJPA 5J2IA 5AM3A 1WCLA 5J0YA 4CF5A 2KE7A 1ZYQA 1X9SA 2QB0B 5DLGA 3C2MA 1NZBA 4Y2XA 4P0QA 4PGYA 4OJOA 3IP4B 4JWNA 4LVSA 1D8BA 2BGWA 1OUQA 5KFVA 1ECWA 4RT2A 2BDPA 2BCQA 4WJ3B 1AROP 3EUB2 2FI1A 3GV8B 1VJ5A 1S10A 4Y2QA 4B9MA 2KICA 9ICJA 2KZZA 4FO6A 3BS5A 3NVWA 8ICWA 9ICOA 3JPNA 2FJ6A 3RAXA 4DQQA 3HKZF 3RBEA 5DGBA 2IA6A 1NNLA 2EAMA 2AH5A 2MAXA 1ZD3A 3BQ7A 1KFSA 1C20A 4DSEA 3E2EA 2UVWA 1Z1BA 2R18A 2AXTU 2B6GA 3V7LA 2ZG6A 1BPDA 5ALPA 5J0XA 5J0UA 1SV0A 3LVVA 5KG4A 4RZRA 1PVRA 1S9FA 3QUTA 2VIXA 3M7DA 4G3IA 4C4SA 2WB1F 2E1EA 3MR2A 1ZQIA 1KKXA 3HPOA 4DQPA 2FLLA 2RRDA 2J6SA 1N61A 1ZQWA 3FM9A 3NGDA 5GTHU 2WAQC 2IOFA 4ICAA 3RFAA 1LKYB 1ZQBA 4RUAA 3G6XA 7ICHA 4NJ8A 4DFKA 5ALEA 4YQWA 3TQ1A 2CPRA 3KKAC 2YTUA 4C7ZA 1XSPA 4KLHA 2FMPA 5IILA 4KLDA 1HEKA 3F2DA 7ICGA 5ALKA 3AM9A 4QZ8A 4F93B 1ZQOA 1X40A 1NKEA 5DBCA 2C2DA 3M9OB 4DL3A 3RJKA 3RJGA 4R64A 1ZRNA 4ECYA 4DSJA 5KFPA 3T3FA 1X2IA 1S8OA 2IBKA 2ZUBA 4C4RA 3F53A 4KMOB 3U26A 2OH2A 4C8LA 2VJ5A 1RYSA 7ICUA 2PFQA 4NLKA 2W7OA 1K1QA 2N1RA 5DBAA 4TQRA 4DSFA 2FE9A 2ESEA 3PX6A 2HHQA 4O9MA 3PW0A 3MDAA 5C5JA 2BPGA 4KLQA 4R63A 1UCVA 3KD3A 4ECWA 4RQ7A 1KLNA 5AI8A 5KFKA 3RH6A 3BZCA 2XVTA 3V6KA 5CA7A 4M04A 1J97A 3JPSA 4RPXA 2KHVA 5J2AA 4QZFA 2MRLA 2ZXIA 5KFJA 4PZNA 4P0PA 1JMSA 2KKVA 1JXEA 2W3SA 5AIAA 3UPQA 3PY8A 5D49A 1MC8A 2HDOA 3SENA 2VA2A 4KLMA 2W8KA 1NKCA 2IMWP 4O3OA 4F5NA 3ETLA 2JRZA 5ALHA 3WK4A 5KFXA 1B22A 2QARA 1NK6A 1TV9A 4KTQA 3QEAZ 4YMNA 4RUCA 4P0QB 2A1AA 2EZZA 5EWFA 3VC8A 3GDXA 4M9NA 4YP3A 4I2JA 4BWJA 3NVZA 4JK1A 3LVWA 7ICLA 2ES6A 3BQTA 4PHAA 1SL2A 2V9WA 1VDVA 3BQ2A 2QKQA 2QB1A 1DRGA 1FFUA 2WAQF 4UB8U 1BNOA 5J0PA 2BPFA 3QX7A 5GTIU 5ALWA 1DGJA 2C2RA 2ASLA 2G06A 1Z3EB 1SKRA 2UVRA 2KHQA 4DF8A 1L7PA 2K8CB 3GV7B 3RH5A 5ALRA 4XA5A 1K5OA 2AHOB 3MDCA 2CXYA 2D8CA 3I1YA 5J2BA 2OM6A 3Q8QB 4Z6CA 2H3VA 5T14A 1T7PA 4Q8EA 5J0WA 4G9BA 4QWCA 4C80A 5DQGA 1QSSA 3OTQA 1ZQPA 1LVHA 3C23A 4YD1A 2WHEA 5ALVA 1AQ6A 5KG5A 1L8LA 4JMUA 3DEEA 3MGIA 3N97B 1YZ6A 5JTIA 5KFSA 1WCNA 4DQSA 1T3NA 4EZ9A 3V6JA 2NO4A 4Z6EA 9ICAA 4J9LA 2UVVA 7ICMA 1SWVA 3M1YA 2W54A 4EBEA 3QU5A 4I2GA 2KZMA 4R66A 4C8OA 2G08A 4UBCA 4M9HA 2DF4B 2XGQA 3OJSA 1HUZA 1COKA 5J0QA 4LJXA 4ECXA 3Q8MA 3M6KA 5AM4A 1ZQFA 2DUYA 1YT3A 4IQWA 4DL4A 1IXRA 2YB4A 2KZ3A 2HOIA 2W8LA 1CRXA 1XC9A 2NRXA 4I28A 3F2CA 1RQLA 4RQMA 1O03A 2RDIA 2GWSA 1ZQHA 1N63A 1SIJA 5KG7A 3EYZA 1SKSA 1Z00A 3NTUA 4F4ZA 4CGZA 5IIMA 1JIHA 4BXOB 4ELUA 4TUSA 2ZIXA 9ICQA 2NRVA 4Y2UA 1NK4A 1F0MA 2HI0A 1MQ2A 2G0AA 4GIBA 1NK8A 7ICJA 1SL1A 1S97A 3RJHA 2XY7A 5KFFA 3PO4A 5AK6A 3E58A 1L6NA 4P4OA 5KFHA 1XWLA 2FPLA 5J2KA 4K4GA 1S5LU 1ZXIA 2LM1A 3AQEA 4CCHA 3TAPA 2KFNA 4YG2A 4IQUA 2V4QA 3H8MA 1ZOLA 4IR9A 3EPIA 1ZQMA 4KLSA 4FS1A 8ICMA 1COOA 1RXWA 7ICNA 4F5RA 2W9CA 9ICEA 4UB1A 4M2YA 5J2GA 1PK1A 7ICTA 5J2JA 9ICTA 2LKYA 1CUKA 2F2AB 3TARA 2ISPA 3PO5A 9ICKA 2E5SA 3BS7A 1ZQKA 2QARB 3Q8KA 4ACOA 2MUTA 1UA0A 5L1LA 2NRTA 5DB8A 3T5JA 1DGSA 4J9QA 3H0RB 2K8AA 1ZQYA 3K1RB 2HBMA 2ZUDA 2F77X 1PVQA 1XO0A 2HHUA 4DLEA 4O0IA 4PHPA 2DQNB 4UASA 5IIJA 4I2CA 8ICZA 7ICEA 5CHGA 1L3UA 4LZDA 4OJ5A 2HVIA 2W03A 5F9LA 3BZKA 5K4LA 4B9TA 4Y2SA 4M9LA 4KLOA 2KG5A 4RU9A 4PJ0U 5KTQA 4DQIA 4MEXA 1SWWA 4C7YA 2KJ5A 4UB6U 3TADA 4FZNA 5EE1A 5HNKA 2LYBA 8ICSA 4F4XA 2QLTA 2YQEA 2F1JA 4DFPA 2Q0ZX 5F9NA 2DWQA 3ZDDA 4CE6A 3HJEA 4UAWA 4NL9A 4I2IA 1OW5A 3IG8A 4DOBA 3ZDEA 1N48A 3IDWA 4GFJA 3H40A 2BCSA 5AHXA 2W55A 1TE2A 2OYYA 4JV2A 3SYZA 3NS1A 4Q44A 3D6JA 1RG6A 5CWRA 2I5HA 3UM9A 4EELA 5KFEA 4JUZA 4DS4A 2D6FC 4EBCA 4NWIA 2BPCA 2KKPA 2LM4A 3T5LA 4Y2YA 4RNMA 1JUDA 3T79A 4GLXA 4FZLA 4UAYA 1L7MA 3UXNA 1M6YA 4USAA 8ICEA 5J0OA 2PXIA 5AI0A 1NKBA 3PW7A 1X6JA 5KL8B 4O3MA 3B0YA 1A6SA 4US8A 2YMMA 1X66A 5DG9A 1KL9A 5KG3A 4CDGA 1U48A 9ICXA 1SZPA 2KSOA 2G5HB 3UXPA 4EBDA 2NO5A 5KFCA 2LI6A 4OCZA 4PL2A 4X5VA 1V85A 4NM1A 4DO9A 3FC4A 2KVCA 4PGQA 5L1KA 4ECUA 4M0AA 1MN8A 4QW8A 2AGOA 3QU9A 5KNIA 1S0MA 1V38A 2H3ZA 8ICJA 5ALFA 3UMBA 3ZI4A 3CP8A 2NRWA 4QZIA 3MABA 5HHIA 4U7CA 1V9PA 5G5HA 3SI8A 2JV3A 3C2LA 5KFDA 3C28A 4DL2A 3TFRA 8ICXA 3LK9A 2ALZA 9ICHA 1BGXT 5DQIA 1SXDA 4RQNA 3MC1A 2W9CB 3GU3A 3RB3A 7ICQA 1NJYA 5D4BA 4XQ8A 4GXIA 2YY6A 3WK7A 2GLEA 5IIKA 2R8JA 2I1QA 2FPMA 4C8MA 9ICNA 2XY5A 2KMDA 2HHSA 4RPYA 1B0XA 1F44A 4MFAA 3NRWA 2NRZA 1CI4A 5TISU 1TK5A 2ZIWB 4KX5A 4B9SA 5AM1A 8ICCA 5AM5A 5J2CA 1MQ3A 2AJQA 3OHAA 2WFAA 1B4FA 5KT7A 3MR6A 4ZH4A 3RF9A 4I27A 1ZQSA 4MHVA 4EX7A 4FBUA 4ELVA 3PSPA 3QU7A 4C8KA 2Y1IA 2W9BB 5KFQA 2XCPA 1RYUA 2XI9A 3M9MB 2A1JA 4I29A 1ZJMA 5AKKA 5JUMA 4M47A 1N62A 1ZRMA 2IOHA 5G5GA 7ICOA 3JPOA 4F2RA 3GFKB 4ED7A 7ICSA 3ISDA 5AKYA 1UT8A 4FZMA 3TKAA 1IM4A 8ICNA 5BPCA 5CB1A 2WF7A 4U6PA 2BZFA 1BPYA 3C1YA 8ICLA 1A76A 4YN4A 3PMLA 4R8UA 4P2HA 3AEVA 3HX0A 4QZGA 3K1ZA 5CRXA 1UT5A 2XCAA 2V4RA 5BOLA 4KN4A 3AUOA 2JEGA 2CN1A 2VKQA 5J0SA 1TVAA 2L5YA 2ZTCA 1V97A 2AGPA 3PW4A 2R8KA 4Q8FA 1C7YA 2DPJA 1SXEA 1XU4A 9ICPA 2ZIUB 3PR4A 3IG5A 3H0LB 5ALYA 5DGAA 1S0OA 3Q8RB 3FAHA 3H8WA 9ICVA 5KG6A 2KJ9A 5HP4A 1FIQA 4YD2A 1N5WA 2DKZA 2ASDA 1ZD2P 4DEZA 5DB6A 1D8LA 4OD0A 1RM6C 2R8IA 4EZ6A 2PMZC 4XRHA 3F5EA 4F3OA 3EW9A 3GIJA 4PZOA 3T5HA 4I2DA 4NXZA 1FO4A 2KJ8A 3N7PD 2AQ0A 2E8OA 4KLGA 3O0FA 2ZTDA 2JHDA 2P6RA 3QU2A 5DG8A 2PI5A 3SEIA 4QWEA 3ISCA 1XSLA 2G09A 3AU2A 4JV0A 5L1JA 2IOFK 3KHHA 4DS5A 2M0NA 1HJPA 4ECRA 9ICCA 1EXNA 1N2XA 4YVZA 2F1HA 4M6WA 4QIWC 2MSNA 5J29A 2VJ4A 3H8JA 2K4PA 1URJA 2B21A 3BS5B 3ZD8A 4F5PA 5KL1B 1N60A 5TZVA 3PSIA 5J8YA 1RQNA 2BCUA 4NV0A 4IRKA 4ED2A 9ICRA 5AKEA 4EENA 4MF2A 4J9NA 1IIPA 4J03A 3T5KA 3TACB 2XO7A 5AKJA 3D2NA 2DKXA 3QNMA 3ALRA 1XSNA 4F71A 1WUDA 2KNJA 2JZBA 3QUCA 1PVPA 2JEIA 5KFTA 8ICYA 4YXMA 3UMGA 4O3RA 5KFZA 4KLJA 4FBTA 1DK3A 3CW2C 4C8NA 2BKEA 3TADC 7ICKA 8ICKA 3A0HU 2BQ3A 3KHGA 2EANA 4QZHA 4I2FA 5AKIA 3RRGA 3AMZA 4RPZA 4DLGA 5AKZA 2FMSA 4NL9C 3SV4A 2WF5A 4DL5A 9ICBA 2F3NA 5CEHA 3R9KA 8ICGA 2W7PA 3PV8A 4F4KA 4M9GA 1SKWA 3GIKA 5L1MA 5FP0A 2DL0A 1QCKA 3F5AA 1H38A 3WU2U 3JPPA 3SAGA 8ICHA 4ECZA 3PZPA 1UPHA 1X42A 4I2AA 5KG0A 5J2EA 2A1JB 4QZDA 3B9JA 5ALZA 4KLLA 2HBLA 5KFYA 2HMXA 1S0VA 2VANA 5KG2A 1NK9A 4TUQA 1L3TA 3KBBA 2F8LA 4RQ1A 5HR7A 4BWMA 5J2DA 4F8RA 3TAQA 1NK0A 3C21A 4B6JA 4I2EA 2QB0A 4KITB 3FYHA 2JR5A 2JXJA 4K4HA 5C0YA 2Z7JA 5AK4A 3QXGA 2Y9TA 4R8UB 2KVSA 4QZCA 3QYPA 5AK5A 2VA8A 1MA7A 3B0XA 1T8EA 5B66U 2PMZF 5KFNA 4RQ4A 5EE3A 3QUQA 4B9NA 2YN4A 5HR6A 1BPEA 3SAHA 2K4HA 4RNNA 3PMNA 4IR1A 4UB3A 2KEYA 4NLGA 1S77D 5DLFA 4F91B 3RTVA 1L7NA 3C5GA 1ZQLA 1XO1A 4P0PB 2PI4A 3PNCA 3BQ1A 2LPEA 5KT6A 4QIWF 5KFAA 3AN1A 2KV2A 1YZ7A 3MR3A 1KN5A 2JEFA 3EPGA 4M9JA 4EYIB 2H3FA 2YX8A 2FMQA 5EE9A 3QU4A 2HBKA 3KHLA 1ZQTA 3ORYA 3D2SA 5ALMA 2JEJA 1RPLA 3KFUF 1U9LA 2Y0SC 1LKYA 5ALUA 4J9OA 2H5XA 3WKDA 2Y9UA 4FE3A 5ALTA 1QQ7A 3N4MB 2K8BB 5DBBA 1OXJA 3ZDBA 4P4MA 1KRPA 4DFDA 4C4TA 2OWOA 1RXVA 2LHTA 4OO1J 4ED6A 1JRPA 3LWLA 1ZQEA 3RJEA 1X9XA 2E8MA 2UVUA 5AKHA 4RQ5A 3M8SA 1QQ5A 2ASJA 2KIVA 2A19A 2LYHA 9ICMA 5H2FU 4BJQA 4J9KA 3THVA 1ZQGA 4IL6U 3OPXA 4DOCA 2LMRA 5ALXA 2E3TA 3GIMA 2K4IA 3PW5A 4DCCA 1DK2A 3N7RC 3DV9A 4KLTA 2FLPA 2WTFA 3RJFA 4F4WA 2ZJ5A 1Z4OA 4DL6A 3UQ0A 4RT3A 4EEYA 3CRXA 4OJLA 5ALGA 2HOFA 1U47A 2BDUA 3ED5A 5J2HA 4HYKA 4KLUA 3MFHA 5AKXA 9ICIA 4F2SA 3OGUA 1ZQ1C 5DKWA 4JV1A 3KTQA 4QWDA 3LDAA 4UW9A 5KFOA 2FDRA 2JMGA 4UARA 1XNSA 5AI4A 2WF8A 2XY6A 1S0NA 2HSZA 2KOBA 5JU5A 2E8NA 2PFNA 1ZQQA 1Z19A 3SV3A 5KFLA 1L8OA 3OSPA 4P4PA 3BDPA 5AI5A 4I2BA 4RQ2A 2BR0A 1PZNA 3PW2A 3ZD9A 2XGPA 5KFIA 9ICGA 2G5IB 1TFRA 3G6YA 3RR7A 3WKAA 5CJ7A 3QE9Y 5L1IA 5IIOA 5HHHA 5KT5A 1Z00B 5IIIA 5DB7A 2P66A 5A0LA 2ZIXB 2JGAA 1GO3F 3GILA 2G07A 3Q8SB 5EE0A 3UMCA 1ZQDA 5KT3A 5DB9A 3NASA 1PUZA 2ZUCA 4Q43A 3JPTA 3SD7A 5KAIU 2ZJ8A 4RQ8A 1DXSA 8ICRA 2KFZA 8ICFA 2YB1A 2RDJA 2ZIVA 3LYSA 4BGDA 3JPQA 2Y0SF 3IRUA 2HBJA 3H7IA 4Y2VA 1QSLA 5EOZA 3H4DA 2LBOA 1NZPA 4DSKA 5B5EU 4CRXA 3Q8PB 5J8YC 4NLZA 1JX4A 3GV5B 4YMOA 8ICOA 3HWTA 4GC7A 1UA1A 2HHTA 4KX3A 5KT2A 2PKEA 4KMUA 2DFLA 1QSYA 1PK1B 2Q4TA 5KFWA 2HVHA 1L3VA 2DPIA 3AQFA 4ZOHC 2W11A 4MF8A 5KAFU 2AGQA 1K1SA 4K4IA 5KT4A 1Z4NA 4YMMA 2W04A 1D9DA 4AYBC 2MUTB 1TAQA 5AKLA 2R8HA 1D8YA 1A77A 1ZD5A 4CF4A 4NM2A 4CNQA 2RHFA 3FDSA 5KFBA 3GQCA 4FS2A 3ICXA 5E79U 4BX9C 1SL0A 2HHWA 1N5XA 1Q3VA 1N56A 1QLNA 3RB4A 4O5EA 1ED1A 1NOMA 3H4BA 1HIWA 2ATLA 2H3IA 4NLCA 2MU2A 9ICUA 3QEBZ 2EQYA 3RAQA 2J6TA 4QWAA 3RRHA 1ZQCA 3NVVA 2C2EA 4PHDA 3SMVA 5J0TA 1WWUA 1ZQNA 4JWMA 4ELTA 4QWBA 4IRCA 1T94A 1T3QA 3BQ0A 2BCVA 3OSNA 7ICFA 3N7SC 4CF3A 2EZXA 1A0PA 2OHFA 2H3QA 4UB5A 5AI6A 2EDUA 4QZBA 4BXOA 2XICA 1NK7A 1WWVA 1VLBA 1KQQA 4KLEA 5IINA 3EWAA 4ECQA 4UATA 3OJUA 1WYGA 4DSLA 4ED3A 5J0RA 4DOAA 1ZETA 3RB0A 1ZJNA 3IHQB 5ALQA 3AL0B 3PX0A 8ICVA 2W9AA 1ZQJA 3HRDD 2A3VA 4MFFA 2K4EA 2KP7A 4ED0A 1RDFA 4KN7A 3EZ5A 2K89A 1FFVA 5ALNA 3S6JA 4NLNA 1NI3A 1S76D 2EH9A 3IV6A 1KFTA 2VA3A 1ZQZA 7ICPA 4TQSA 4QW9A 4ECVA 1ZQXA 3RB6A 5J2FA 1Q8KA 2JH7A 4DFMA 1NK5A 3M8RA 3WKCA 3J81j 3A0BU 7ICIA 5DG7A 3C29A 4F5OA 2HHXA 5KFRA 3PVXA 1JROA 4UAVA 3I76A 1F5SA 2C28A 1Y88A 2J6UA 1TKDA 5F3XB 5EWEA 1JN3A 4Z6FA 2LYAA 2KSOB 4A8EA 3V7JA 4ECTA 4MFCA 1QQ6A 4YR0A 3IM1A 4DSIA 4BDPA 4RQ0A 3D2QA 2I6XA 4PGXA 2K60A 3RJJA 4GC6A 3TI0A 4PPXA 3MGHA 4AYBF 3WK5A 1RYRA 5KFGA 4ED1A 1BNPA 1X9WA 1SV4A 4DFJA 2WF6A 2ZIVB 1X9MA 3E0FA 5AIBA 5DDMA 2HW3A 3MR5A 2GO7A 4F5QA 4Y2JA 7ICVA 5DQHA 3JPRA 4PHEA 1TAMA 2HOQA 1HUOA 4UQGA 2ZJAA 1TK8A 4B9UA 2EZYA 4UAZA 1RZTA 4I2HA 1BVSA 3HW8A 3C2KA 1KEJA 2RP5A 1U45A 4HAIA 4O5CA 3HT3A 1IG6A 4IQTA 1KW4A 1JALA 2Y1JA 3KKAA 3LWMA 1TK0A 9ICFA 2GH1A 3V72A 5ALDA 5ALSA 5ALJA 3F2BA 8ICBA 2KIWA 3L5KA 5JRTA 1NJXA 1QTMA 3NRZA 3M9NB 4NLBA 5AICA 4GXKA 1BPXA 9ICSA 4C0ZA 1U4BA 2IHMA 3QZ7A 1B43A 4ECSA 3M6ZA 4GXJA 2W9MA 4IS7A 4KLIA 4YCXA 3WKBA 2E8PA 2R8GA 2YMLA 3CNHA 1ZQVA 5DDYA 4XUSA 3ZDAA 2RLTA 2BHNA 3RR8A 4F50A 3MGVA 1WG8A 1TAUA 4EX6A 2ISOA 3PSFA 3PSTA 4IRDA 5AKGA 3HILA 3GZFA
chains in the Genus database with same CATH topology
2XIDA 2CPRA 1WUDA 3D2QA 3IN5A 2KNJA 3SAFA 4AYBF 1PVPA 1T94A 2ZIUB 5HR6A 1NZBA 1HEKA 3GU3A 3F2DA 2LKYA 2K4IA 3IG5A 2YB1A 4P0QA 2F2AB 3SAHA 4P0PA 2ZIVA 3H0LB 3N7SC 4OJOA 2K4HA 3IP4B 3N7RC 2D6FC 2E5SA 3LYSA 2G08A 1A0PA 4NWIA 4P0QB 2KKPA 4ACOA 3VCBA 2KEYA 2WB1C 2Y0SF 2ZIVB 2HBJA 2H3QA 3E0FA 3SQIA 1D8BA 2DF4B 3VC8A 2KJ9A 2LBOA 4P0PB 4BUGA 2XICA 3H0RB 1F44A 3NRWA 3M6KA 1OUQA 4CRXA 3T79A 2K8AA 2CRXA 1ECWA 2ZIWB 4QIWF 4FZLA 4KX5A 4OJLA 3CRXA 1YT3A 2HBMA 2HOFA 2F77X 4WJ3B 2BDUA 1KBUA 1PVQA 1XO0A 1TAMA 2HOQA 3LVWA 2YB4A 4KX3A 2KD1A 2KV2A 3F53A 2HOIA 2Q4TA 3KZXA 2W7PA 1CRXA 4KMOB 2DQNB 2KICA 2PMZC 1ZQ1C 3F2CA 2H3FA 3F5EA 2YX8A 3AQFA 3NUQA 3RF9A 3AL0B 2RP5A 5KL8B 3L3FX 2OH2A 3PSPA 4OJ5A 1DRGA 4O3MA 2VJ5A 3GZFA 1A6SA 2HBKA 2W04A 2WAQF 3F5AA 3H0MB 2KJ8A 4AYBC 3N7PD 2K4EA 2A3VA 2JMGA 3HKZF 4CDGA 1XNSA 3O0FA 2K89A 2W7OA 2JHDA 2XI9A 3SAGA 4CGZA 3D2SA 3PZPA 1UPHA 2G06A 2KOBA 2G5HB 2KHQA 2MA1A 2K8CB 2N1RA 2G09A 4PL1A 2ZIXA 2GOLA 4PL2A 1Z19A 2Y0SC 3KFUF 1Z1BA 2GH1A 2M0NA 2R18A 2HBLA 2JH7A 2G0AA 2ZG6A 2KVCA 2HMXA 2RHFA 3F2BA 2KIWA 2KJ5A 2F8LA 3LVVA 4QJFB 5HR7A 4FE3A 4FZMA 2E1FA 2JH1A 4FZNA 4QIWC 1PVRA 3CYMA 3C29A 4NLBA 3ICXA 2LYBA 2K8BB 2G5IB 2VJ4A 4BX9C 2OM6A 2VIXA 1URJA 4U6PA 3M7DA 2H3ZA 5KL1B 2ZIUA 2H3VA 2WB1F 4C0ZA 3ONNA 2NV3A 2E1EA 1Q3VA 3PSIA 3CP8A 5T14A 1L6NA 3M6ZA 2F76X 2LHTA 2XVTA 4NV0A 4OO1J 4U7CA 2RRDA 1ED1A 3AQEA 4OJ6A 5C0YA 2Z7JA 1HIWA 2KHVA 2LYAA 3K1ZA 4A8EA 1Q3UA 2H3IA 4NLCA 5CRXA 2OXOA 2MRLA 2ZXIA 3IG8A 1SZHA 2WAQC 5A0LA 2ZXHA 2ZIXB 2JGAA 4ICAA 1IIPA 1GO3F 3RFAA 4GFJA 2KKVA 3HKZC 3MGVA 1P7DA 1MA7A 2CN1A 2ZIWA 4QNLA 2VKQA 3C28A 4BJQA 4IC9A 2OYYA 2G07A 3D2NA 3PSTA 3PSFA 2PMZF 4JMUA 2DGZA 4OJPA 3DEEA 2W03A 3OPXA 3SMVA 3ALRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DQN B;  3KFU F;  1ZQ1 C;  2G5I B;  3AL0 B;  3H0M B;  2F2A B;  3H0R B;  3H0L B;  2D6F C;  2G5H B;  2DF4 B;  3IP4 B;  4WJ3 B; 
#chains in the Genus database with same CATH topology
 4F72 A;  3WK9 A;  1J2M A;  2XID A;  4J9M A;  4O3P A;  4QZA A;  3QZ8 A;  4R65 A;  2KN7 A;  4Y2R A;  2M9N A;  4UB2 A;  2KK0 A;  3SZ2 A;  8ICA A;  3MFI A;  3VCB A;  1L5U A;  4US9 A;  3K4G A;  4F92 B;  5D46 A;  5AK3 A;  2BCR A;  2W3R A;  5HML A;  2EAO A;  4B9L A;  4DL7 A;  2CRX A;  5HMM A;  4TUR A;  2RQ5 A;  3C5F A;  8ICI A;  3ISB A;  4QZE A;  4RNO A;  2KD1 A;  5CR0 A;  2XC9 A;  4DWI A;  2FLN A;  3HP6 A;  2BQU A;  1BPZ A;  7ICR A;  1LV5 A;  4UB4 A;  2YMQ A;  3AU6 A;  9ICW A;  3SR6 A;  3V7K A;  3H0M B;  1LB2 B;  1JXL A;  1KFD A;  4IQV A;  3RJI A;  2ODG A;  4YFK A;  5AM2 A;  1IV8 A;  2MA1 A;  4Y2P A;  2OCE A;  4PL1 A;  3UQ2 A;  2GOL A;  3G6V A;  2IHN A;  3PR5 B;  3WK6 A;  4B9V A;  1UQV A;  3L4P A;  3RH4 A;  4KLF A;  1CEZ A;  3DDH A;  1SB3 C;  2JH1 A;  2W43 A;  3CYM A;  3ETR A;  1ZQU A;  8ICU A;  4Z6D A;  4O3N A;  8ICP A;  4O5K A;  4AP9 A;  1X6I A;  1Z1V A;  3ONN A;  2NV3 A;  4J9R A;  2WF9 A;  2I9G A;  2F76 X;  3PX4 A;  3QUB A;  4UAU A;  2O6K A;  4RQ3 A;  4RQ6 A;  3ZDC A;  1O08 A;  4J9P A;  2PFO A;  1Q3U A;  1SV0 C;  1SZH A;  4EYH B;  2ZXH A;  3HKZ C;  1KDH A;  2ZIW A;  1T4G A;  4YR3 A;  2ZTE A;  4IC9 A;  1NJZ A;  1FEZ A;  2DGZ A;  1NJW A;  4QZ9 A;  4M6W B;  2C22 A;  4Y2T A;  3IN5 A;  3C1Z A;  3SAF A;  4EEK A;  2AQ4 A;  4TUP A;  8ICQ A;  3KOO A;  1J2N A;  4Q45 A;  4YR2 A;  8ICT A;  3WKE A;  3BJY A;  1ZD4 A;  3KHR A;  5EWG A;  3I28 A;  2HHV A;  2WB1 C;  5BOM A;  2W9B A;  3SQI A;  3UXO A;  3OHB A;  5KG1 A;  2NYV A;  1ZQR A;  4BUG A;  4J9S A;  2KTQ A;  2DBY A;  2P6U A;  9ICL A;  1KBU A;  2OEH A;  1KSP A;  4F4Y A;  1L7O A;  2B0C A;  3TAN A;  2JZB B;  3KZX A;  3KZI U;  2F8K A;  3NUQ A;  1KTQ A;  1JI7 A;  3L3F X;  1BPB A;  3N28 A;  1PK3 A;  3V6H A;  1DOQ A;  2F44 A;  5KFU A;  5KFM A;  3MBY A;  2BQR A;  5AM0 A;  4UBB A;  2HCF A;  5CP2 A;  4NY8 A;  1L3S A;  1QH9 A;  1MSW D;  3K75 D;  2FPK A;  5L9X A;  1UHU A;  5AI9 A;  4YXJ A;  2D3D A;  1U49 A;  4E0D A;  1D9F A;  4QJF B;  5ALL A;  5ALI A;  3WK8 A;  2E1F A;  1SGG A;  4JB3 A;  2PFP A;  3Q8L A;  3NVY A;  4LZG A;  2ZIU A;  4ED8 A;  2P35 A;  4DF4 A;  3GII A;  4O3Q A;  4DQR A;  1XS9 D;  4PH5 A;  2F1I A;  1Q46 A;  4FFD A;  4MEY A;  2EAP A;  4OJ6 A;  2OXO A;  3H8S A;  5ALO A;  4O3S A;  3TFS A;  1P7D A;  2YMP A;  2AU0 A;  4QNL A;  3RBD A;  1ZQA A;  4OJP A;  5J2I A;  5AM3 A;  1WCL A;  5J0Y A;  4CF5 A;  2KE7 A;  1ZYQ A;  1X9S A;  2QB0 B;  5DLG A;  3C2M A;  1NZB A;  4Y2X A;  4P0Q A;  4PGY A;  4OJO A;  3IP4 B;  4JWN A;  4LVS A;  1D8B A;  2BGW A;  1OUQ A;  5KFV A;  1ECW A;  4RT2 A;  2BDP A;  2BCQ A;  4WJ3 B;  1ARO P;  3EUB 2;  2FI1 A;  3GV8 B;  1VJ5 A;  1S10 A;  4Y2Q A;  4B9M A;  2KIC A;  9ICJ A;  2KZZ A;  4FO6 A;  3BS5 A;  3NVW A;  8ICW A;  9ICO A;  3JPN A;  2FJ6 A;  3RAX A;  4DQQ A;  3HKZ F;  3RBE A;  5DGB A;  2IA6 A;  1NNL A;  2EAM A;  2AH5 A;  2MAX A;  1ZD3 A;  3BQ7 A;  1KFS A;  1C20 A;  4DSE A;  3E2E A;  2UVW A;  1Z1B A;  2R18 A;  2AXT U;  2B6G A;  3V7L A;  2ZG6 A;  1BPD A;  5ALP A;  5J0X A;  5J0U A;  1SV0 A;  3LVV A;  5KG4 A;  4RZR A;  1PVR A;  1S9F A;  3QUT A;  2VIX A;  3M7D A;  4G3I A;  4C4S A;  2WB1 F;  2E1E A;  3MR2 A;  1ZQI A;  1KKX A;  3HPO A;  4DQP A;  2FLL A;  2RRD A;  2J6S A;  1N61 A;  1ZQW A;  3FM9 A;  3NGD A;  5GTH U;  2WAQ C;  2IOF A;  4ICA A;  3RFA A;  1LKY B;  1ZQB A;  4RUA A;  3G6X A;  7ICH A;  4NJ8 A;  4DFK A;  5ALE A;  4YQW A;  3TQ1 A;  2CPR A;  3KKA C;  2YTU A;  4C7Z A;  1XSP A;  4KLH A;  2FMP A;  5IIL A;  4KLD A;  1HEK A;  3F2D A;  7ICG A;  5ALK A;  3AM9 A;  4QZ8 A;  4F93 B;  1ZQO A;  1X40 A;  1NKE A;  5DBC A;  2C2D A;  3M9O B;  4DL3 A;  3RJK A;  3RJG A;  4R64 A;  1ZRN A;  4ECY A;  4DSJ A;  5KFP A;  3T3F A;  1X2I A;  1S8O A;  2IBK A;  2ZUB A;  4C4R A;  3F53 A;  4KMO B;  3U26 A;  2OH2 A;  4C8L A;  2VJ5 A;  1RYS A;  7ICU A;  2PFQ A;  4NLK A;  2W7O A;  1K1Q A;  2N1R A;  5DBA A;  4TQR A;  4DSF A;  2FE9 A;  2ESE A;  3PX6 A;  2HHQ A;  4O9M A;  3PW0 A;  3MDA A;  5C5J A;  2BPG A;  4KLQ A;  4R63 A;  1UCV A;  3KD3 A;  4ECW A;  4RQ7 A;  1KLN A;  5AI8 A;  5KFK A;  3RH6 A;  3BZC A;  2XVT A;  3V6K A;  5CA7 A;  4M04 A;  1J97 A;  3JPS A;  4RPX A;  2KHV A;  5J2A A;  4QZF A;  2MRL A;  2ZXI A;  5KFJ A;  4PZN A;  4P0P A;  1JMS A;  2KKV A;  1JXE A;  2W3S A;  5AIA A;  3UPQ A;  3PY8 A;  5D49 A;  1MC8 A;  2HDO A;  3SEN A;  2VA2 A;  4KLM A;  2W8K A;  1NKC A;  2IMW P;  4O3O A;  4F5N A;  3ETL A;  2JRZ A;  5ALH A;  3WK4 A;  5KFX A;  1B22 A;  2QAR A;  1NK6 A;  1TV9 A;  4KTQ A;  3QEA Z;  4YMN A;  4RUC A;  4P0Q B;  2A1A A;  2EZZ A;  5EWF A;  3VC8 A;  3GDX A;  4M9N A;  4YP3 A;  4I2J A;  4BWJ A;  3NVZ A;  4JK1 A;  3LVW A;  7ICL A;  2ES6 A;  3BQT A;  4PHA A;  1SL2 A;  2V9W A;  1VDV A;  3BQ2 A;  2QKQ A;  2QB1 A;  1DRG A;  1FFU A;  2WAQ F;  4UB8 U;  1BNO A;  5J0P A;  2BPF A;  3QX7 A;  5GTI U;  5ALW A;  1DGJ A;  2C2R A;  2ASL A;  2G06 A;  1Z3E B;  1SKR A;  2UVR A;  2KHQ A;  4DF8 A;  1L7P A;  2K8C B;  3GV7 B;  3RH5 A;  5ALR A;  4XA5 A;  1K5O A;  2AHO B;  3MDC A;  2CXY A;  2D8C A;  3I1Y A;  5J2B A;  2OM6 A;  3Q8Q B;  4Z6C A;  2H3V A;  5T14 A;  1T7P A;  4Q8E A;  5J0W A;  4G9B A;  4QWC A;  4C80 A;  5DQG A;  1QSS A;  3OTQ A;  1ZQP A;  1LVH A;  3C23 A;  4YD1 A;  2WHE A;  5ALV A;  1AQ6 A;  5KG5 A;  1L8L A;  4JMU A;  3DEE A;  3MGI A;  3N97 B;  1YZ6 A;  5JTI A;  5KFS A;  1WCN A;  4DQS A;  1T3N A;  4EZ9 A;  3V6J A;  2NO4 A;  4Z6E A;  9ICA A;  4J9L A;  2UVV A;  7ICM A;  1SWV A;  3M1Y A;  2W54 A;  4EBE A;  3QU5 A;  4I2G A;  2KZM A;  4R66 A;  4C8O A;  2G08 A;  4UBC A;  4M9H A;  2DF4 B;  2XGQ A;  3OJS A;  1HUZ A;  1COK A;  5J0Q A;  4LJX A;  4ECX A;  3Q8M A;  3M6K A;  5AM4 A;  1ZQF A;  2DUY A;  1YT3 A;  4IQW A;  4DL4 A;  1IXR A;  2YB4 A;  2KZ3 A;  2HOI A;  2W8L A;  1CRX A;  1XC9 A;  2NRX A;  4I28 A;  3F2C A;  1RQL A;  4RQM A;  1O03 A;  2RDI A;  2GWS A;  1ZQH A;  1N63 A;  1SIJ A;  5KG7 A;  3EYZ A;  1SKS A;  1Z00 A;  3NTU A;  4F4Z A;  4CGZ A;  5IIM A;  1JIH A;  4BXO B;  4ELU A;  4TUS A;  2ZIX A;  9ICQ A;  2NRV A;  4Y2U A;  1NK4 A;  1F0M A;  2HI0 A;  1MQ2 A;  2G0A A;  4GIB A;  1NK8 A;  7ICJ A;  1SL1 A;  1S97 A;  3RJH A;  2XY7 A;  5KFF A;  3PO4 A;  5AK6 A;  3E58 A;  1L6N A;  4P4O A;  5KFH A;  1XWL A;  2FPL A;  5J2K A;  4K4G A;  1S5L U;  1ZXI A;  2LM1 A;  3AQE A;  4CCH A;  3TAP A;  2KFN A;  4YG2 A;  4IQU A;  2V4Q A;  3H8M A;  1ZOL A;  4IR9 A;  3EPI A;  1ZQM A;  4KLS A;  4FS1 A;  8ICM A;  1COO A;  1RXW A;  7ICN A;  4F5R A;  2W9C A;  9ICE A;  4UB1 A;  4M2Y A;  5J2G A;  1PK1 A;  7ICT A;  5J2J A;  9ICT A;  2LKY A;  1CUK A;  2F2A B;  3TAR A;  2ISP A;  3PO5 A;  9ICK A;  2E5S A;  3BS7 A;  1ZQK A;  2QAR B;  3Q8K A;  4ACO A;  2MUT A;  1UA0 A;  5L1L A;  2NRT A;  5DB8 A;  3T5J A;  1DGS A;  4J9Q A;  3H0R B;  2K8A A;  1ZQY A;  3K1R B;  2HBM A;  2ZUD A;  2F77 X;  1PVQ A;  1XO0 A;  2HHU A;  4DLE A;  4O0I A;  4PHP A;  2DQN B;  4UAS A;  5IIJ A;  4I2C A;  8ICZ A;  7ICE A;  5CHG A;  1L3U A;  4LZD A;  4OJ5 A;  2HVI A;  2W03 A;  5F9L A;  3BZK A;  5K4L A;  4B9T A;  4Y2S A;  4M9L A;  4KLO A;  2KG5 A;  4RU9 A;  4PJ0 U;  5KTQ A;  4DQI A;  4MEX A;  1SWW A;  4C7Y A;  2KJ5 A;  4UB6 U;  3TAD A;  4FZN A;  5EE1 A;  5HNK A;  2LYB A;  8ICS A;  4F4X A;  2QLT A;  2YQE A;  2F1J A;  4DFP A;  2Q0Z X;  5F9N A;  2DWQ A;  3ZDD A;  4CE6 A;  3HJE A;  4UAW A;  4NL9 A;  4I2I A;  1OW5 A;  3IG8 A;  4DOB A;  3ZDE A;  1N48 A;  3IDW A;  4GFJ A;  3H40 A;  2BCS A;  5AHX A;  2W55 A;  1TE2 A;  2OYY A;  4JV2 A;  3SYZ A;  3NS1 A;  4Q44 A;  3D6J A;  1RG6 A;  5CWR A;  2I5H A;  3UM9 A;  4EEL A;  5KFE A;  4JUZ A;  4DS4 A;  2D6F C;  4EBC A;  4NWI A;  2BPC A;  2KKP A;  2LM4 A;  3T5L A;  4Y2Y A;  4RNM A;  1JUD A;  3T79 A;  4GLX A;  4FZL A;  4UAY A;  1L7M A;  3UXN A;  1M6Y A;  4USA A;  8ICE A;  5J0O A;  2PXI A;  5AI0 A;  1NKB A;  3PW7 A;  1X6J A;  5KL8 B;  4O3M A;  3B0Y A;  1A6S A;  4US8 A;  2YMM A;  1X66 A;  5DG9 A;  1KL9 A;  5KG3 A;  4CDG A;  1U48 A;  9ICX A;  1SZP A;  2KSO A;  2G5H B;  3UXP A;  4EBD A;  2NO5 A;  5KFC A;  2LI6 A;  4OCZ A;  4PL2 A;  4X5V A;  1V85 A;  4NM1 A;  4DO9 A;  3FC4 A;  2KVC A;  4PGQ A;  5L1K A;  4ECU A;  4M0A A;  1MN8 A;  4QW8 A;  2AGO A;  3QU9 A;  5KNI A;  1S0M A;  1V38 A;  2H3Z A;  8ICJ A;  5ALF A;  3UMB A;  3ZI4 A;  3CP8 A;  2NRW A;  4QZI A;  3MAB A;  5HHI A;  4U7C A;  1V9P A;  5G5H A;  3SI8 A;  2JV3 A;  3C2L A;  5KFD A;  3C28 A;  4DL2 A;  3TFR A;  8ICX A;  3LK9 A;  2ALZ A;  9ICH A;  1BGX T;  5DQI A;  1SXD A;  4RQN A;  3MC1 A;  2W9C B;  3GU3 A;  3RB3 A;  7ICQ A;  1NJY A;  5D4B A;  4XQ8 A;  4GXI A;  2YY6 A;  3WK7 A;  2GLE A;  5IIK A;  2R8J A;  2I1Q A;  2FPM A;  4C8M A;  9ICN A;  2XY5 A;  2KMD A;  2HHS A;  4RPY A;  1B0X A;  1F44 A;  4MFA A;  3NRW A;  2NRZ A;  1CI4 A;  5TIS U;  1TK5 A;  2ZIW B;  4KX5 A;  4B9S A;  5AM1 A;  8ICC A;  5AM5 A;  5J2C A;  1MQ3 A;  2AJQ A;  3OHA A;  2WFA A;  1B4F A;  5KT7 A;  3MR6 A;  4ZH4 A;  3RF9 A;  4I27 A;  1ZQS A;  4MHV A;  4EX7 A;  4FBU A;  4ELV A;  3PSP A;  3QU7 A;  4C8K A;  2Y1I A;  2W9B B;  5KFQ A;  2XCP A;  1RYU A;  2XI9 A;  3M9M B;  2A1J A;  4I29 A;  1ZJM A;  5AKK A;  5JUM A;  4M47 A;  1N62 A;  1ZRM A;  2IOH A;  5G5G A;  7ICO A;  3JPO A;  4F2R A;  3GFK B;  4ED7 A;  7ICS A;  3ISD A;  5AKY A;  1UT8 A;  4FZM A;  3TKA A;  1IM4 A;  8ICN A;  5BPC A;  5CB1 A;  2WF7 A;  4U6P A;  2BZF A;  1BPY A;  3C1Y A;  8ICL A;  1A76 A;  4YN4 A;  3PML A;  4R8U A;  4P2H A;  3AEV A;  3HX0 A;  4QZG A;  3K1Z A;  5CRX A;  1UT5 A;  2XCA A;  2V4R A;  5BOL A;  4KN4 A;  3AUO A;  2JEG A;  2CN1 A;  2VKQ A;  5J0S A;  1TVA A;  2L5Y A;  2ZTC A;  1V97 A;  2AGP A;  3PW4 A;  2R8K A;  4Q8F A;  1C7Y A;  2DPJ A;  1SXE A;  1XU4 A;  9ICP A;  2ZIU B;  3PR4 A;  3IG5 A;  3H0L B;  5ALY A;  5DGA A;  1S0O A;  3Q8R B;  3FAH A;  3H8W A;  9ICV A;  5KG6 A;  2KJ9 A;  5HP4 A;  1FIQ A;  4YD2 A;  1N5W A;  2DKZ A;  2ASD A;  1ZD2 P;  4DEZ A;  5DB6 A;  1D8L A;  4OD0 A;  1RM6 C;  2R8I A;  4EZ6 A;  2PMZ C;  4XRH A;  3F5E A;  4F3O A;  3EW9 A;  3GIJ A;  4PZO A;  3T5H A;  4I2D A;  4NXZ A;  1FO4 A;  2KJ8 A;  3N7P D;  2AQ0 A;  2E8O A;  4KLG A;  3O0F A;  2ZTD A;  2JHD A;  2P6R A;  3QU2 A;  5DG8 A;  2PI5 A;  3SEI A;  4QWE A;  3ISC A;  1XSL A;  2G09 A;  3AU2 A;  4JV0 A;  5L1J A;  2IOF K;  3KHH A;  4DS5 A;  2M0N A;  1HJP A;  4ECR A;  9ICC A;  1EXN A;  1N2X A;  4YVZ A;  2F1H A;  4M6W A;  4QIW C;  2MSN A;  5J29 A;  2VJ4 A;  3H8J A;  2K4P A;  1URJ A;  2B21 A;  3BS5 B;  3ZD8 A;  4F5P A;  5KL1 B;  1N60 A;  5TZV A;  3PSI A;  5J8Y A;  1RQN A;  2BCU A;  4NV0 A;  4IRK A;  4ED2 A;  9ICR A;  5AKE A;  4EEN A;  4MF2 A;  4J9N A;  1IIP A;  4J03 A;  3T5K A;  3TAC B;  2XO7 A;  5AKJ A;  3D2N A;  2DKX A;  3QNM A;  3ALR A;  1XSN A;  4F71 A;  1WUD A;  2KNJ A;  2JZB A;  3QUC A;  1PVP A;  2JEI A;  5KFT A;  8ICY A;  4YXM A;  3UMG A;  4O3R A;  5KFZ A;  4KLJ A;  4FBT A;  1DK3 A;  3CW2 C;  4C8N A;  2BKE A;  3TAD C;  7ICK A;  8ICK A;  3A0H U;  2BQ3 A;  3KHG A;  2EAN A;  4QZH A;  4I2F A;  5AKI A;  3RRG A;  3AMZ A;  4RPZ A;  4DLG A;  5AKZ A;  2FMS A;  4NL9 C;  3SV4 A;  2WF5 A;  4DL5 A;  9ICB A;  2F3N A;  5CEH A;  3R9K A;  8ICG A;  2W7P A;  3PV8 A;  4F4K A;  4M9G A;  1SKW A;  3GIK A;  5L1M A;  5FP0 A;  2DL0 A;  1QCK A;  3F5A A;  1H38 A;  3WU2 U;  3JPP A;  3SAG A;  8ICH A;  4ECZ A;  3PZP A;  1UPH A;  1X42 A;  4I2A A;  5KG0 A;  5J2E A;  2A1J B;  4QZD A;  3B9J A;  5ALZ A;  4KLL A;  2HBL A;  5KFY A;  2HMX A;  1S0V A;  2VAN A;  5KG2 A;  1NK9 A;  4TUQ A;  1L3T A;  3KBB A;  2F8L A;  4RQ1 A;  5HR7 A;  4BWM A;  5J2D A;  4F8R A;  3TAQ A;  1NK0 A;  3C21 A;  4B6J A;  4I2E A;  2QB0 A;  4KIT B;  3FYH A;  2JR5 A;  2JXJ A;  4K4H A;  5C0Y A;  2Z7J A;  5AK4 A;  3QXG A;  2Y9T A;  4R8U B;  2KVS A;  4QZC A;  3QYP A;  5AK5 A;  2VA8 A;  1MA7 A;  3B0X A;  1T8E A;  5B66 U;  2PMZ F;  5KFN A;  4RQ4 A;  5EE3 A;  3QUQ A;  4B9N A;  2YN4 A;  5HR6 A;  1BPE A;  3SAH A;  2K4H A;  4RNN A;  3PMN A;  4IR1 A;  4UB3 A;  2KEY A;  4NLG A;  1S77 D;  5DLF A;  4F91 B;  3RTV A;  1L7N A;  3C5G A;  1ZQL A;  1XO1 A;  4P0P B;  2PI4 A;  3PNC A;  3BQ1 A;  2LPE A;  5KT6 A;  4QIW F;  5KFA A;  3AN1 A;  2KV2 A;  1YZ7 A;  3MR3 A;  1KN5 A;  2JEF A;  3EPG A;  4M9J A;  4EYI B;  2H3F A;  2YX8 A;  2FMQ A;  5EE9 A;  3QU4 A;  2HBK A;  3KHL A;  1ZQT A;  3ORY A;  3D2S A;  5ALM A;  2JEJ A;  1RPL A;  3KFU F;  1U9L A;  2Y0S C;  1LKY A;  5ALU A;  4J9O A;  2H5X A;  3WKD A;  2Y9U A;  4FE3 A;  5ALT A;  1QQ7 A;  3N4M B;  2K8B B;  5DBB A;  1OXJ A;  3ZDB A;  4P4M A;  1KRP A;  4DFD A;  4C4T A;  2OWO A;  1RXV A;  2LHT A;  4OO1 J;  4ED6 A;  1JRP A;  3LWL A;  1ZQE A;  3RJE A;  1X9X A;  2E8M A;  2UVU A;  5AKH A;  4RQ5 A;  3M8S A;  1QQ5 A;  2ASJ A;  2KIV A;  2A19 A;  2LYH A;  9ICM A;  5H2F U;  4BJQ A;  4J9K A;  3THV A;  1ZQG A;  4IL6 U;  3OPX A;  4DOC A;  2LMR A;  5ALX A;  2E3T A;  3GIM A;  2K4I A;  3PW5 A;  4DCC A;  1DK2 A;  3N7R C;  3DV9 A;  4KLT A;  2FLP A;  2WTF A;  3RJF A;  4F4W A;  2ZJ5 A;  1Z4O A;  4DL6 A;  3UQ0 A;  4RT3 A;  4EEY A;  3CRX A;  4OJL A;  5ALG A;  2HOF A;  1U47 A;  2BDU A;  3ED5 A;  5J2H A;  4HYK A;  4KLU A;  3MFH A;  5AKX A;  9ICI A;  4F2S A;  3OGU A;  1ZQ1 C;  5DKW A;  4JV1 A;  3KTQ A;  4QWD A;  3LDA A;  4UW9 A;  5KFO A;  2FDR A;  2JMG A;  4UAR A;  1XNS A;  5AI4 A;  2WF8 A;  2XY6 A;  1S0N A;  2HSZ A;  2KOB A;  5JU5 A;  2E8N A;  2PFN A;  1ZQQ A;  1Z19 A;  3SV3 A;  5KFL A;  1L8O A;  3OSP A;  4P4P A;  3BDP A;  5AI5 A;  4I2B A;  4RQ2 A;  2BR0 A;  1PZN A;  3PW2 A;  3ZD9 A;  2XGP A;  5KFI A;  9ICG A;  2G5I B;  1TFR A;  3G6Y A;  3RR7 A;  3WKA A;  5CJ7 A;  3QE9 Y;  5L1I A;  5IIO A;  5HHH A;  5KT5 A;  1Z00 B;  5III A;  5DB7 A;  2P66 A;  5A0L A;  2ZIX B;  2JGA A;  1GO3 F;  3GIL A;  2G07 A;  3Q8S B;  5EE0 A;  3UMC A;  1ZQD A;  5KT3 A;  5DB9 A;  3NAS A;  1PUZ A;  2ZUC A;  4Q43 A;  3JPT A;  3SD7 A;  5KAI U;  2ZJ8 A;  4RQ8 A;  1DXS A;  8ICR A;  2KFZ A;  8ICF A;  2YB1 A;  2RDJ A;  2ZIV A;  3LYS A;  4BGD A;  3JPQ A;  2Y0S F;  3IRU A;  2HBJ A;  3H7I A;  4Y2V A;  1QSL A;  5EOZ A;  3H4D A;  2LBO A;  1NZP A;  4DSK A;  5B5E U;  4CRX A;  3Q8P B;  5J8Y C;  4NLZ A;  1JX4 A;  3GV5 B;  4YMO A;  8ICO A;  3HWT A;  4GC7 A;  1UA1 A;  2HHT A;  4KX3 A;  5KT2 A;  2PKE A;  4KMU A;  2DFL A;  1QSY A;  1PK1 B;  2Q4T A;  5KFW A;  2HVH A;  1L3V A;  2DPI A;  3AQF A;  4ZOH C;  2W11 A;  4MF8 A;  5KAF U;  2AGQ A;  1K1S A;  4K4I A;  5KT4 A;  1Z4N A;  4YMM A;  2W04 A;  1D9D A;  4AYB C;  2MUT B;  1TAQ A;  5AKL A;  2R8H A;  1D8Y A;  1A77 A;  1ZD5 A;  4CF4 A;  4NM2 A;  4CNQ A;  2RHF A;  3FDS A;  5KFB A;  3GQC A;  4FS2 A;  3ICX A;  5E79 U;  4BX9 C;  1SL0 A;  2HHW A;  1N5X A;  1Q3V A;  1N56 A;  1QLN A;  3RB4 A;  4O5E A;  1ED1 A;  1NOM A;  3H4B A;  1HIW A;  2ATL A;  2H3I A;  4NLC A;  2MU2 A;  9ICU A;  3QEB Z;  2EQY A;  3RAQ A;  2J6T A;  4QWA A;  3RRH A;  1ZQC A;  3NVV A;  2C2E A;  4PHD A;  3SMV A;  5J0T A;  1WWU A;  1ZQN A;  4JWM A;  4ELT A;  4QWB A;  4IRC A;  1T94 A;  1T3Q A;  3BQ0 A;  2BCV A;  3OSN A;  7ICF A;  3N7S C;  4CF3 A;  2EZX A;  1A0P A;  2OHF A;  2H3Q A;  4UB5 A;  5AI6 A;  2EDU A;  4QZB A;  4BXO A;  2XIC A;  1NK7 A;  1WWV A;  1VLB A;  1KQQ A;  4KLE A;  5IIN A;  3EWA A;  4ECQ A;  4UAT A;  3OJU A;  1WYG A;  4DSL A;  4ED3 A;  5J0R A;  4DOA A;  1ZET A;  3RB0 A;  1ZJN A;  3IHQ B;  5ALQ A;  3AL0 B;  3PX0 A;  8ICV A;  2W9A A;  1ZQJ A;  3HRD D;  2A3V A;  4MFF A;  2K4E A;  2KP7 A;  4ED0 A;  1RDF A;  4KN7 A;  3EZ5 A;  2K89 A;  1FFV A;  5ALN A;  3S6J A;  4NLN A;  1NI3 A;  1S76 D;  2EH9 A;  3IV6 A;  1KFT A;  2VA3 A;  1ZQZ A;  7ICP A;  4TQS A;  4QW9 A;  4ECV A;  1ZQX A;  3RB6 A;  5J2F A;  1Q8K A;  2JH7 A;  4DFM A;  1NK5 A;  3M8R A;  3WKC A;  3J81 j;  3A0B U;  7ICI A;  5DG7 A;  3C29 A;  4F5O A;  2HHX A;  5KFR A;  3PVX A;  1JRO A;  4UAV A;  3I76 A;  1F5S A;  2C28 A;  1Y88 A;  2J6U A;  1TKD A;  5F3X B;  5EWE A;  1JN3 A;  4Z6F A;  2LYA A;  2KSO B;  4A8E A;  3V7J A;  4ECT A;  4MFC A;  1QQ6 A;  4YR0 A;  3IM1 A;  4DSI A;  4BDP A;  4RQ0 A;  3D2Q A;  2I6X A;  4PGX A;  2K60 A;  3RJJ A;  4GC6 A;  3TI0 A;  4PPX A;  3MGH A;  4AYB F;  3WK5 A;  1RYR A;  5KFG A;  4ED1 A;  1BNP A;  1X9W A;  1SV4 A;  4DFJ A;  2WF6 A;  2ZIV B;  1X9M A;  3E0F A;  5AIB A;  5DDM A;  2HW3 A;  3MR5 A;  2GO7 A;  4F5Q A;  4Y2J A;  7ICV A;  5DQH A;  3JPR A;  4PHE A;  1TAM A;  2HOQ A;  1HUO A;  4UQG A;  2ZJA A;  1TK8 A;  4B9U A;  2EZY A;  4UAZ A;  1RZT A;  4I2H A;  1BVS A;  3HW8 A;  3C2K A;  1KEJ A;  2RP5 A;  1U45 A;  4HAI A;  4O5C A;  3HT3 A;  1IG6 A;  4IQT A;  1KW4 A;  1JAL A;  2Y1J A;  3KKA A;  3LWM A;  1TK0 A;  9ICF A;  2GH1 A;  3V72 A;  5ALD A;  5ALS A;  5ALJ A;  3F2B A;  8ICB A;  2KIW A;  3L5K A;  5JRT A;  1NJX A;  1QTM A;  3NRZ A;  3M9N B;  4NLB A;  5AIC A;  4GXK A;  1BPX A;  9ICS A;  4C0Z A;  1U4B A;  2IHM A;  3QZ7 A;  1B43 A;  4ECS A;  3M6Z A;  4GXJ A;  2W9M A;  4IS7 A;  4KLI A;  4YCX A;  3WKB A;  2E8P A;  2R8G A;  2YML A;  3CNH A;  1ZQV A;  5DDY A;  4XUS A;  3ZDA A;  2RLT A;  2BHN A;  3RR8 A;  4F50 A;  3MGV A;  1WG8 A;  1TAU A;  4EX6 A;  2ISO A;  3PSF A;  3PST A;  4IRD A;  5AKG A;  3HIL A;  3GZF A; 
#chains in the Genus database with same CATH homology
 2XID A;  2CPR A;  1WUD A;  3D2Q A;  3IN5 A;  2KNJ A;  3SAF A;  4AYB F;  1PVP A;  1T94 A;  2ZIU B;  5HR6 A;  1NZB A;  1HEK A;  3GU3 A;  3F2D A;  2LKY A;  2K4I A;  3IG5 A;  2YB1 A;  4P0Q A;  2F2A B;  3SAH A;  4P0P A;  2ZIV A;  3H0L B;  3N7S C;  4OJO A;  2K4H A;  3IP4 B;  3N7R C;  2D6F C;  2E5S A;  3LYS A;  2G08 A;  1A0P A;  4NWI A;  4P0Q B;  2KKP A;  4ACO A;  3VCB A;  2KEY A;  2WB1 C;  2Y0S F;  2ZIV B;  2HBJ A;  2H3Q A;  3E0F A;  3SQI A;  1D8B A;  2DF4 B;  3VC8 A;  2KJ9 A;  2LBO A;  4P0P B;  4BUG A;  2XIC A;  3H0R B;  1F44 A;  3NRW A;  3M6K A;  1OUQ A;  4CRX A;  3T79 A;  2K8A A;  2CRX A;  1ECW A;  2ZIW B;  4QIW F;  4FZL A;  4KX5 A;  4OJL A;  3CRX A;  1YT3 A;  2HBM A;  2HOF A;  2F77 X;  4WJ3 B;  2BDU A;  1KBU A;  1PVQ A;  1XO0 A;  1TAM A;  2HOQ A;  3LVW A;  2YB4 A;  4KX3 A;  2KD1 A;  2KV2 A;  3F53 A;  2HOI A;  2Q4T A;  3KZX A;  2W7P A;  1CRX A;  4KMO B;  2DQN B;  2KIC A;  2PMZ C;  1ZQ1 C;  3F2C A;  2H3F A;  3F5E A;  2YX8 A;  3AQF A;  3NUQ A;  3RF9 A;  3AL0 B;  2RP5 A;  5KL8 B;  3L3F X;  2OH2 A;  3PSP A;  4OJ5 A;  1DRG A;  4O3M A;  2VJ5 A;  3GZF A;  1A6S A;  2HBK A;  2W04 A;  2WAQ F;  3F5A A;  3H0M B;  2KJ8 A;  4AYB C;  3N7P D;  2K4E A;  2A3V A;  2JMG A;  3HKZ F;  4CDG A;  1XNS A;  3O0F A;  2K89 A;  2W7O A;  2JHD A;  2XI9 A;  3SAG A;  4CGZ A;  3D2S A;  3PZP A;  1UPH A;  2G06 A;  2KOB A;  2G5H B;  2KHQ A;  2MA1 A;  2K8C B;  2N1R A;  2G09 A;  4PL1 A;  2ZIX A;  2GOL A;  4PL2 A;  1Z19 A;  2Y0S C;  3KFU F;  1Z1B A;  2GH1 A;  2M0N A;  2R18 A;  2HBL A;  2JH7 A;  2G0A A;  2ZG6 A;  2KVC A;  2HMX A;  2RHF A;  3F2B A;  2KIW A;  2KJ5 A;  2F8L A;  3LVV A;  4QJF B;  5HR7 A;  4FE3 A;  4FZM A;  2E1F A;  2JH1 A;  4FZN A;  4QIW C;  1PVR A;  3CYM A;  3C29 A;  4NLB A;  3ICX A;  2LYB A;  2K8B B;  2G5I B;  2VJ4 A;  4BX9 C;  2OM6 A;  2VIX A;  1URJ A;  4U6P A;  3M7D A;  2H3Z A;  5KL1 B;  2ZIU A;  2H3V A;  2WB1 F;  4C0Z A;  3ONN A;  2NV3 A;  2E1E A;  1Q3V A;  3PSI A;  3CP8 A;  5T14 A;  1L6N A;  3M6Z A;  2F76 X;  2LHT A;  2XVT A;  4NV0 A;  4OO1 J;  4U7C A;  2RRD A;  1ED1 A;  3AQE A;  4OJ6 A;  5C0Y A;  2Z7J A;  1HIW A;  2KHV A;  2LYA A;  3K1Z A;  4A8E A;  1Q3U A;  2H3I A;  4NLC A;  5CRX A;  2OXO A;  2MRL A;  2ZXI A;  3IG8 A;  1SZH A;  2WAQ C;  5A0L A;  2ZXH A;  2ZIX B;  2JGA A;  4ICA A;  1IIP A;  1GO3 F;  3RFA A;  4GFJ A;  2KKV A;  3HKZ C;  3MGV A;  1P7D A;  1MA7 A;  2CN1 A;  2ZIW A;  4QNL A;  2VKQ A;  3C28 A;  4BJQ A;  4IC9 A;  2OYY A;  2G07 A;  3D2N A;  3PST A;  3PSF A;  2PMZ F;  4JMU A;  2DGZ A;  4OJP A;  3DEE A;  2W03 A;  3OPX A;  3SMV A;  3ALR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...