2G5HB

Structure of trna-dependent amidotransferase gatcab
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
398
structure length
398
Chain Sequence
FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITRLHMEEDAGKSTHKGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 119
structure length 398
sequence length 398
ec nomenclature
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02637 GatB_Yqey GatB domain
B PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2g5hB02
2G5HB 2DQNB 2D6FC 3KFUF 3H0RB 3H0LB 3IP4B 1ZQ1C 2DF4B 4WJ3B 2G5IB 2F2AB 3H0MB 3AL0B
chains in the Genus database with same CATH superfamily
2FPKA 2W55A 3H8MA 4F92B 4KLLA 2F1HA 1TVAA 2GH1A 2ATLA 1PVRA 1UCVA 2H5XA 5CRXA 1QQ5A 9ICJA 1KL9A 4R65A 1FFVA 2F77X 1VDVA 3UXPA 2OH2A 2NRWA 1Z1VA 4K4GA 3PR5B 4K4HA 4M04A 3L5KA 4CF3A 4KLDA 3WU2U 3DV9A 3RJEA 2PKEA 3IG5A 5J0XA 4PZOA 4OJ5A 4YG2A 1D9FA 2HHVA 2LM1A 2WF8A 2WB1C 3SENA 2VA2A 8ICVA 3QU9A 4YFKA 3PY8A 1FO4A 4RUAA 1TV9A 5ALOA 2Y1JA 8ICJA 4DL7A 4BGDA 1ZQIA 3V7JA 4DL5A 3N97B 3V6JA 5IILA 4UB5A 3PMNA 5L9XA 1FIQA 4RPZA 4QWCA 2C2EA 1UA1A 9ICCA 2R8IA 2B21A 4PHEA 3PR4A 5DG9A 2G0AA 5AM1A 3E0FA 2BZFA 2HOIA 2AJQA 3TARA 1RQLA 1ZQHA 4F5RA 5EWGA 3F2CA 3PSPA 3WKEA 5AI8A 3TI0A 2PXIA 3PO5A 2VANA 4Y2VA 3PMLA 4RU9A 5EE1A 1ZQEA 4MFCA 2KNJA 3WKAA 5KG2A 5CJ7A 5KT4A 4DL2A 1HJPA 1XS9D 3RJFA 1S10A 1BPXA 3GU3A 1D8LA 4DL3A 5J2IA 1SV0A 5KG6A 5AM2A 5DQGA 4DQQA 4TUPA 2AH5A 4J9LA 2LYBA 2LKYA 1XSLA 1ZQFA 3D2NA 4Q44A 9ICFA 4CF5A 2JH1A 4UB4A 1RYSA 2H3FA 3QU2A 1T8EA 4F5OA 3NVZA 2NRZA 4C8NA 4FE3A 3AQEA 7ICSA 1YT3A 2WF9A 3T5KA 2XI9A 4R63A 1B43A 4UB8U 5EE0A 4F2RA 1D9DA 3GV8B 2YMLA 1GO3F 2Q0ZX 4B9LA 2L5YA 1SZHA 4M0AA 2JZBA 1L7NA 3NVWA 3PW5A 1T3QA 4LZDA 2LM4A 5CEHA 7ICQA 2W03A 3TQ1A 5AKXA 1TAQA 5AM5A 3KHLA 2JH7A 4J03A 4O0IA 4RQNA 3RH6A 5L1MA 5DB9A 3KTQA 1IG6A 3JPSA 1SWVA 3JPQA 4ECSA 3MC1A 3GIKA 5AKLA 3I1YA 2J6UA 2ZIWA 2QLTA 2O6KA 1L6NA 2F8KA 4GC7A 4RPYA 2EZXA 2D8CA 3TFRA 2KOBA 4NL9A 5AI5A 3K75D 5J2BA 8ICNA 4RT3A 5KT3A 3F2BA 1DK2A 3TADC 5ALTA 3IHQB 4DS4A 2W9BB 4EX6A 1L7OA 2JHDA 4QZGA 2W8LA 1S97A 3ISCA 4FFDA 4CE6A 5IIIA 3RH5A 3M9OB 2WF7A 2P35A 3MGHA 4DFJA 3M1YA 3HRDD 3KBBA 1ZXIA 2CXYA 5AHXA 7ICJA 2IA6A 2EQYA 1JROA 2KHQA 4NLKA 4Y2YA 3HILA 2PFNA 4ICAA 2V4RA 4C8MA 1H38A 5ALRA 2C2DA 1JALA 2QARB 5F9NA 1TAMA 4I27A 2K8CB 5AKJA 5DKWA 4QIWF 3QEBZ 2KD1A 3QU7A 4WJ3B 5K4LA 4CGZA 3SR6A 4NLNA 3VCBA 4ED2A 3PNCA 4U6PA 4UAUA 1F44A 2I9GA 5HNKA 4I28A 3FC4A 4NLCA 4JB3A 2BQUA 2KP7A 4F4ZA 1ZJNA 2W9BA 2BKEA 4QZ9A 1ZRNA 4KLJA 1SL0A 8ICUA 5KT5A 1Q3UA 4MFFA 1ZQZA 2KEYA 2MUTB 2FMPA 8ICSA 2W11A 5DDMA 5AM0A 2UVUA 3HWTA 4F93B 5J2AA 5ALPA 4B9TA 3E58A 4RZRA 3JPPA 2LPEA 1S0NA 4J9OA 2EDUA 5DG7A 2QARA 4UQGA 1S0OA 2JEIA 2LBOA 1KLNA 2YMPA 2E8NA 2ZG6A 2I1QA 4AP9A 3EPGA 1Z00B 1TK8A 1JI7A 4XA5A 4P4PA 3RFAA 1U45A 2JEJA 5ALVA 5KG1A 3CRXA 7ICHA 1RG6A 1BPBA 2PFOA 2ZIUB 4F8RA 8ICZA 4P2HA 5KG7A 4O5CA 1YZ7A 3ZDDA 4KTQA 3RAXA 9ICVA 3EZ5A 5J0QA 2ODGA 3C5FA 1MSWD 1WCLA 4DSIA 1RDFA 2JMGA 5TZVA 5D46A 3KD3A 5GTIU 1ZQNA 1KSPA 5KG0A 1FEZA 1Z4OA 2MAXA 5DB7A 2MUTA 4UB2A 4FZLA 2V9WA 2KVSA 2NRVA 3F2DA 2GWSA 1SIJA 1RPLA 3NGDA 4F2SA 4Q8FA 3QUBA 4J9NA 1LKYB 5AKIA 1KRPA 2MRLA 2W9MA 2Y0SF 1ZQRA 1Q46A 3N4MB 4DQPA 5AM4A 1O03A 2XIDA 3WK9A 9ICKA 4NM2A 2W8KA 2HHSA 5J2FA 3EPIA 5J8YA 3OGUA 5C0YA 3ED5A 2H3QA 1Z00A 9ICUA 4YR2A 2G5IB 3OJSA 2H3ZA 2HHQA 5KFSA 3Q8LA 4YCXA 3C29A 4IL6U 3AEVA 1HUZA 1NKCA 3T5JA 1KKXA 5CWRA 3MR5A 4LVSA 4GC6A 2ZIUA 4FS2A 1NI3A 1WUDA 4K4IA 5AI9A 3IP4B 1ZQVA 4DF8A 1XSNA 3EW9A 2FMQA 3OHBA 3MABA 2YX8A 2FLPA 1WWUA 1ZQOA 4FS1A 2UVRA 1V97A 3GZFA 2F3NA 5T14A 5DB6A 3OSPA 4NLBA 2OXOA 5L1LA 2IBKA 4CNQA 4AYBC 5G5HA 4RUCA 4M2YA 3QNMA 3NS1A 5J0UA 8ICTA 2NRXA 3CYMA 3RB3A 3NTUA 1VJ5A 8ICBA 1LKYA 2XGPA 3PX6A 3FDSA 1QSLA 2G07A 3GIMA 5KFMA 1U47A 2DKXA 3LVVA 4ELTA 3MGIA 8ICXA 3SAGA 4C0ZA 4DFKA 3MR2A 5HMMA 2A3VA 1DGJA 8ICLA 1Z1BA 4I2CA 2ZXHA 4Y2JA 3PZPA 3C2KA 3TACB 1KBUA 2DBYA 1ZQBA 2VA3A 3C21A 2AQ4A 1QQ6A 2IOHA 1X40A 5DB8A 3LDAA 2XY7A 5ALWA 4YR3A 4Y2UA 1X6IA 3BQ7A 3Q8RB 3C28A 4DF4A 3RB4A 1SZPA 3NVYA 2OEHA 3D2SA 1NK5A 4QW8A 2PFQA 4RNOA 4CF4A 4ED7A 2QB1A 2VA8A 4MEXA 1NKEA 3V6KA 8ICFA 9ICLA 4IRDA 5CHGA 2IOFK 2LHTA 2RP5A 8ICQA 2VKQA 2KMDA 4F5PA 4BWJA 4DL4A 4M6WB 3MGVA 5DQIA 3MR6A 5D49A 4UB6U 3PW2A 3TAQA 3QUCA 3NASA 5IIKA 4UAZA 3JPNA 1BNOA 4RQ4A 2JEFA 1Q8KA 3GV5B 5JTIA 1DOQA 3I28A 3LK9A 4RQ1A 2JEGA 3QYPA 4B9VA 4C7YA 1BGXT 1DRGA 1COKA 1OXJA 5TISU 4UASA 3N7RC 4Q8EA 3C1YA 2CRXA 5ALIA 3PVXA 1PVPA 3RF9A 3DEEA 3V7LA 4J9MA 3Q8SB 2OWOA 1DGSA 2F1JA 5DBCA 9ICEA 1A6SA 5KFFA 3FAHA 4CDGA 1L8LA 2BQ3A 3OTQA 1B22A 4OCZA 3MDCA 1RXWA 3Q8PB 1LB2B 3K1RB 3RR8A 4UBCA 4EENA 4USAA 2KSOB 5HHIA 2F8LA 4NLGA 1KEJA 5KFXA 4KMOB 4IR9A 4IQWA 1V85A 4QZ8A 4C7ZA 3VC8A 3KOOA 3MFHA 1EXNA 3CW2C 4M6WA 5AK3A 5J0RA 2DUYA 3QX7A 3QXGA 2K4IA 3KKAA 4KLGA 3LYSA 2QB0B 1NK6A 4DFMA 4QZHA 2LYHA 3PW0A 3F5AA 4NV0A 1OUQA 1KQQA 2XCPA 2KK0A 5L1KA 5F9LA 1ZJMA 7ICTA 4DSLA 2UVVA 1L8OA 3J81j 2KZ3A 4Q43A 2EZYA 3C23A 7ICEA 2IHMA 2KN7A 4C4TA 3AU6A 4F71A 3SZ2A 5DQHA 4I2GA 5AIBA 4KLSA 1L7MA 4PL2A 1MC8A 2Z7JA 5EE9A 2LI6A 2W54A 4DEZA 1BPEA 4YVZA 5BOMA 3WK6A 1QH9A 4O3QA 1WCNA 4P0QB 4C8OA 2PMZC 3QU4A 4LZGA 4Y2XA 4A8EA 2F2AB 3KHRA 7ICMA 2DFLA 2ASLA 4ECYA 2HBJA 4F4YA 1UT5A 4UAVA 5AI4A 3UMGA 3M9MB 1U48A 5KT7A 4DS5A 2HW3A 4OJOA 4PHPA 2BCUA 2YQEA 4J9QA 5D4BA 4DSKA 2XY6A 2QB0A 5J0YA 3RTVA 1RQNA 4HAIA 4YD2A 1NZPA 1SV0C 2MU2A 3UXOA 4YMOA 4I2BA 5KL1B 2FLLA 3H7IA 5ALYA 1TK0A 1NOMA 1VLBA 2W43A 4C8LA 1A77A 2WFAA 4P4OA 5J0OA 4RQ8A 5ALLA 3JPTA 1ZQCA 3GFKB 3RJJA 1L3UA 4IQVA 4O3PA 5DDYA 3WKCA 2AQ0A 3MFIA 4NLZA 4ED1A 3BDPA 4R64A 5CR0A 4Y2RA 4TUQA 4ECXA 3TFSA 5ALXA 4Y2PA 5J2HA 3SAHA 4P0QA 4EBEA 5GTHU 3SV3A 4C8KA 1Q3VA 4O9MA 9ICGA 1KDHA 2AXTU 3N7PD 4J9PA 4DSJA 3M8RA 2JR5A 1X6JA 2P6UA 2H3VA 5G5GA 1C7YA 5CB1A 3Q8KA 5DG8A 2HSZA 5DBBA 3SD7A 2BHNA 2G09A 4M9HA 4DOBA 4UATA 2R8GA 3D2QA 4UBBA 1BVSA 1OW5A 5ALMA 9ICOA 3SV4A 3UPQA 3KHGA 2HHTA 9ICRA 3UMBA 4YQWA 2HMXA 2IMWP 4XQ8A 1TKDA 4MEYA 4UB1A 4ACOA 4BDPA 3QZ8A 5KFVA 4KN7A 5DBAA 1ECWA 2AGQA 4DSFA 1QTMA 1ZQSA 2WAQF 4RQ2A 5J0SA 4KLQA 4DLGA 4QWAA 4ELUA 5J2CA 4JUZA 1O08A 2A19A 3RBDA 3M7DA 4DQIA 5AK6A 9ICIA 4KLHA 2R18A 2R8HA 2HOFA 1J97A 4RQ3A 3GDXA 1ED1A 4QZIA 2ZIVB 3FM9A 3RRHA 4EYIB 2Q4TA 1ZD5A 3OJUA 2W7PA 4JV1A 1NK7A 1ZQJA 3DDHA 3PX4A 4ED6A 3GIJA 9ICXA 2W3RA 1JN3A 1AROP 4ECUA 1XO0A 5J0TA 2DF4B 4OJLA 4F4XA 1S0VA 7ICUA 4C4RA 4RQ7A 2VJ5A 5AI6A 3H8JA 5KFNA 2E8PA 1P7DA 5KFZA 4IS7A 2E8OA 3UMCA 3AU2A 3RH4A 1U4BA 4F3OA 3QU5A 2NV3A 2RDJA 4M9NA 2KG5A 4X5VA 8ICYA 4FZMA 4ECQA 2M0NA 5EOZA 3ZD8A 5KFEA 2E3TA 2GOLA 2JV3A 4YP3A 1NJZA 1N56A 1UHUA 3PX0A 1ZD2P 1U9LA 4LJXA 3ONNA 1NK0A 4Y2QA 2HHUA 2HHXA 4TUSA 5KFKA 9ICTA 2D6FC 1IM4A 4O3SA 2KKPA 2NRTA 4DO9A 2HVIA 1IIPA 3H0RB 5KFHA 3NVVA 2RHFA 2ZIVA 3ISDA 3UQ0A 5KFAA 2WB1F 1KTQA 2BPFA 2ZUBA 3RJHA 1A76A 3ZDBA 1QQ7A 3KZXA 4ED0A 3QZ7A 3EWAA 4G3IA 4IC9A 3H4DA 2I5HA 2XICA 2BDPA 1V38A 1ZOLA 2AGPA 2BR0A 4BXOB 3PV8A 3RR7A 5CP2A 5H2FU 1ZQWA 9ICQA 1C20A 5ALFA 5J2EA 2W9AA 2DKZA 5AI0A 2EZZA 1PVQA 3C2LA 4NWIA 4F72A 2Y9UA 2BGWA 1MN8A 8ICHA 4RQ5A 5ALDA 5KG5A 4RNNA 1RYUA 3MR3A 4I29A 2YMMA 7ICFA 3WK7A 5ALQA 7ICRA 1L7PA 1PK3A 8ICEA 3BS5B 4ZH4A 5J0WA 1RYRA 3SEIA 2E1FA 3UXNA 5ALGA 3SMVA 5KG3A 1S76D 2PMZF 2OM6A 2GLEA 3IDWA 5JUMA 5L1JA 1DK3A 1S5LU 9ICHA 4R66A 1ZQGA 2XVTA 4BXOA 4KLEA 4DFDA 1ZQYA 5J8YC 2HHWA 1K1QA 1SV4A 1UA0A 1X9SA 4M47A 3G6YA 3N7SC 4O3RA 4QWDA 5B5EU 1N2XA 4KX3A 3ZI4A 3BJYA 3OHAA 4EZ9A 1PUZA 1BPDA 2MSNA 2G08A 1HIWA 2F76X 1T94A 1AQ6A 3TKAA 4JWNA 2LMRA 2N1RA 4NM1A 3NRWA 3HW8A 4PHAA 2I6XA 2H3IA 5ALEA 4RQMA 1NK9A 4I2FA 5HHHA 5J2GA 3HPOA 2AU0A 1XWLA 5DLGA 4F5NA 1QSYA 1XC9A 1KW4A 3BS5A 3KFUF 1N62A 2KJ8A 1Z4NA 4GXJA 8ICPA 1LVHA 5E79U 1JRPA 4O5KA 2MA1A 4R8UB 4XUSA 3THVA 1X9WA 3PSFA 1IXRA 4PH5A 1X42A 5ALNA 5J29A 2C28A 2AGOA 2BCVA 3MBYA 1ZQTA 4EX7A 2KZMA 5AKKA 3SYZA 3NRZA 5J2JA 4DSEA 2IOFA 1KFSA 4YMMA 2RDIA 2KKVA 4M9LA 4IQTA 4Y2TA 4O3MA 5AICA 3RJIA 2K4HA 1N61A 4GFJA 3QUQA 2HBKA 2P6RA 5KFJA 4ECTA 3T5LA 3ZDCA 2PI5A 2ZUCA 3B0XA 4YD1A 5ALSA 4QIWC 5HR7A 2HCFA 1A0PA 4US9A 4Q45A 5FP0A 3AMZA 4IRKA 1F0MA 2KZZA 4ED8A 5ALUA 3G6VA 4IQUA 2XCAA 4F5QA 7ICGA 3IRUA 5KL8B 3H40A 2QKQA 4B6JA 1LV5A 4TQSA 5BPCA 1N63A 4MF2A 4BWMA 2VJ4A 2DGZA 3H0MB 4BUGA 5C5JA 5EE3A 4R8UA 1UPHA 2PI4A 1T4GA 2K8AA 1YZ6A 3AN1A 2HDOA 5ALJA 1ZQAA 2BCRA 3RB0A 4O3NA 5KFDA 4J9RA 3QUTA 4ELVA 4P4MA 2ZUDA 3C1ZA 5JRTA 4JK1A 3QE9Y 9ICNA 4FBTA 3WK8A 2W7OA 1JXLA 1MQ2A 2EAOA 1UQVA 2WF5A 2KIVA 4QZFA 5AIAA 4KLUA 2F1IA 2XC9A 3BQ0A 2BPGA 4DFPA 2FDRA 4QZEA 4DOAA 5L1IA 2E8MA 3H0LB 3IV6A 4TQRA 3BS7A 3M6ZA 4CRXA 1NJXA 2KHVA 1URJA 5KT6A 2A1JB 5KAIU 2ASDA 5J2KA 2XY5A 3NUQA 2UVWA 2JXJA 4XRHA 4F91B 1S0MA 7ICVA 4B9MA 1K5OA 5KFWA 5KFOA 2KFNA 1UT8A 3QEAZ 5KFUA 4GXIA 1Y88A 1K1SA 2K8BB 4KLFA 2G5HB 3FYHA 1ZQMA 5KAFU 1WG8A 3M9NB 2R8KA 2ZJAA 4PGYA 3KKAC 4ZOHC 1T7PA 3PW4A 3HKZC 4O5EA 3F53A 4F4KA 5J2DA 5KFPA 4QWEA 3WKDA 9ICMA 1XSPA 2WF6A 2FPLA 1NNLA 1ZD4A 4Z6FA 2Y0SC 5KFGA 4I2IA 3HT3A 3RB6A 1JMSA 4OD0A 4M9GA 2JZBB 2KSOA 5KFLA 2JRZA 5CA7A 4EYHB 5KFBA 1Z3EB 2DPIA 5AK5A 1WYGA 1F5SA 2KVCA 2W04A 2ZTCA 2DPJA 5A0LA 4CCHA 4UW9A 1MQ3A 8ICRA 2A1JA 3B9JA 4NXZA 2YMQA 4DOCA 3KZIU 2VIXA 2K4EA 1B4FA 2ZTDA 5KG4A 3RRGA 4DQSA 3OSNA 7ICNA 8ICKA 2ZIWB 4F4WA 2RLTA 3GILA 7ICKA 8ICMA 9ICWA 4QZBA 2ESEA 3O0FA 5IINA 4M9JA 1S9FA 4PHDA 3CP8A 3T5HA 4I2AA 1QCKA 4O3OA 5IIJA 2YN4A 1SGGA 2E1EA 4P0PB 3ORYA 2KICA 5ALKA 3WKBA 2KTQA 4B9SA 3AQFA 1NZBA 4GIBA 3EYZA 5DGAA 3N28A 2XO7A 1M6YA 4PPXA 5BOLA 4JV0A 9ICPA 1ZQXA 1JUDA 4UB3A 3B0YA 3I76A 4DCCA 2HBLA 2NO4A 1D8YA 4AYBF 1SKRA 4GXKA 4RT2A 2R8JA 1N60A 4KITB 4JWMA 1QLNA 2JGAA 4I2DA 3IM1A 5ALHA 3TADA 3RAQA 4YXMA 5B66U 4UARA 2ISOA 1SKWA 5J0PA 2AHOB 2NO5A 8ICCA 3JPRA 2IHNA 3V72A 2F44A 3HX0A 3HP6A 4EZ6A 2HI0A 4ECWA 3M6KA 4NL9C 2XGQA 4P0PA 3K1ZA 1U49A 1L5UA 3PW7A 1L3TA 4IRCA 2YB4A 3LVWA 4NY8A 3H8SA 2ZIXB 4KLIA 2KIWA 4F50A 3BZCA 4B9UA 9ICSA 2J6SA 2HBMA 3E2EA 4ECVA 1ZQPA 5IIOA 5AKHA 3ALRA 4EELA 5AKYA 4OO1J 2HVHA 3V6HA 1X9MA 1TFRA 2RRDA 3IG8A 3CNHA 4Z6DA 3RJGA 4OJ6A 2OYYA 4US8A 3G6XA 4EEYA 2ZXIA 1SXEA 4RNMA 1ZRMA 1ZQLA 3IN5A 4DQRA 4KLTA 2YY6A 4YR0A 3ETRA 4DWIA 3ZDEA 3K4GA 4EBCA 1T3NA 1CI4A 3LWLA 1DXSA 1WWVA 1COOA 4QZCA 4Z6CA 5KTQA 9ICAA 1NK4A 5HP4A 5KFYA 2Y1IA 1JXEA 3JPOA 1BNPA 8ICAA 7ICLA 2CPRA 1L3VA 4DL6A 2ZIXA 1ZQ1C 8ICGA 1HUOA 5AKZA 1RXVA 4RQ0A 2BCQA 3ETLA 3GIIA 4B9NA 3D6JA 1S8OA 1ZETA 4OJPA 4KMUA 1BPZA 5KFIA 1D8BA 4EBDA 3T79A 3ISBA 3AL0B 1PK1B 3BQ2A 1NJYA 2LYAA 3PSTA 2FLNA 3ZDAA 1ZD3A 2G06A 2ES6A 2CN1A 1QSSA 8ICOA 4KX5A 3AUOA 4FO6A 2FJ6A 4RPXA 1JX4A 1J2NA 3R9KA 3H8WA 4MFAA 1SB3C 3L3FX 3T3FA 4TURA 4UAYA 3AM9A 1SL1A 2RQ5A 4EEKA 2FPMA 3GV7B 2C22A 2FI1A 1ZQKA 5EWEA 4IR1A 2M9NA 2KJ5A 2Y9TA 4PZNA 4JV2A 3UM9A 4PJ0U 1SWWA 4YN4A 1Z19A 1NK8A 4QWBA 4PGQA 3GQCA 4KLOA 1ZQUA 1ZYQA 4JMUA 3LWMA 3HJEA 2W3SA 5DGBA 5KFCA 2ZJ5A 2W9CB 2K60A 2J6TA 1X2IA 4I2HA 3HKZF 2OCEA 4BJQA 2EANA 1RM6C 8ICWA 2GO7A 4ECRA 1L3SA 1BPYA 1PK1A 2EAPA 5HMLA 4U7CA 3RBEA 5KFRA 5AM3A 2A1AA 4Z6EA 1ZQQA 5F3XB 1XU4A 1TAUA 2KFZA 1KFDA 1NKBA 2ALZA 7ICIA 3F5EA 5DLFA 3OPXA 2B6GA 1TE2A 2D3DA 1SXDA 3MDAA 1N5XA 2K89A 2DL0A 5KT2A 1B0XA 3EUB2 2HOQA 4C80A 4J9KA 2BCSA 5JU5A 1KN5A 2EAMA 2KE7A 5KFTA 2K4PA 2BPCA 3Q8QB 4PGXA 1N5WA 2P66A 2V4QA 5KNIA 3TANA 1N48A 5IIMA 4QJFB 1S77D 3U26A 1JIHA 4PL1A 1KFTA 4KLMA 4GLXA 2W9CA 3BZKA 4MHVA 2BDUA 3PSIA 4RQ6A 3SI8A 4QZAA 3PO4A 1PZNA 1J2MA 3L4PA 9ICBA 5AKEA 4I2EA 8ICIA 3UQ2A 4Y2SA 3ZD9A 5EWFA 1V9PA 3BQ1A 3WK5A 2ASJA 3KHHA 1XO1A 4G9BA 2BQRA 4ECZA 2KV2A 3A0HU 5AKGA 2C2RA 1SL2A 1HEKA 1X66A 4ED3A 4E0DA 7ICPA 3SQIA 2FE9A 1RZTA 1CEZA 4MF8A 2NYVA 2ZTEA 3SAFA 2KJ9A 3ICXA 4I2JA 1MA7A 2WAQC 2DWQA 4KN4A 5HR6A 4QZDA 5KFQA 3V7KA 4NJ8A 4YXJA 3C5GA 1CRXA 2DQNB 4DLEA 2PFPA 1X9XA 3RJKA 2WHEA 1XNSA 4BX9C 5AK4A 1TK5A 5ALZA 2YTUA 1FFUA 4C4SA 2E5SA 1IV8A 2YB1A 1CUKA 4FBUA 3TAPA 3WK4A 4HYKA 1SKSA 2B0CA 2FMSA 2WTFA 3M8SA 4UAWA 3Q8MA 4FZNA 4QNLA 3H4BA 3C2MA 2ISPA 2OHFA 1NJWA 4J9SA 3S6JA 2ZJ8A 2EH9A 7ICOA 4QW9A 3BQTA 4YMNA 3A0BU 1ZQDA
chains in the Genus database with same CATH topology
2ZIWB 3LYSA 2H3ZA 4QJFB 3D2SA 4PL1A 1XO0A 2DF4B 2GH1A 3L3FX 2HBMA 3F5AA 4NV0A 4OJLA 3C29A 1OUQA 3O0FA 3PSFA 1PVRA 2BDUA 3CP8A 2VJ5A 3PSIA 4P0QA 3SAHA 3H0LB 2KOBA 5CRXA 3ALRA 1Q3VA 2ZIUA 2KNJA 1P7DA 3M6ZA 4CRXA 1WUDA 4OO1J 2KHVA 3N7PD 1URJA 2LHTA 3IP4B 2RP5A 3F2BA 2E1EA 2KJ5A 4P0PB 2VKQA 2NV3A 3NUQA 2F77X 2KICA 2RRDA 2H3VA 2YX8A 3IG8A 2KKVA 2LBOA 2JHDA 1Z19A 4FZMA 2M0NA 3GU3A 3MGVA 2OH2A 4O3MA 2ZG6A 4OJ6A 2G09A 2OYYA 2E1FA 2GOLA 3AQFA 2KV2A 4PL2A 3GZFA 2K4HA 4JMUA 2ZXIA 3SMVA 1NZBA 2Z7JA 4GFJA 5T14A 2LYBA 2HBKA 2LKYA 3D2QA 2PMZF 3ONNA 2OM6A 1HEKA 3RFAA 4NLBA 2OXOA 2K8BB 3D2NA 4AYBC 3IG5A 2G5HB 3IN5A 2JH1A 4KX5A 2H3FA 3SQIA 3CRXA 4P0QB 4OJ5A 4QIWC 5HR7A 3HKZF 2XVTA 2KHQA 2ZIUB 2PMZC 1A0PA 4BJQA 2WB1C 3SAFA 2KJ9A 3ICXA 2HMXA 3CYMA 1DRGA 1MA7A 2D6FC 4ICAA 4A8EA 2KKPA 4FE3A 2WAQC 3AQEA 2F2AB 1YT3A 2G07A 2HBLA 3HKZC 3N7RC 3F53A 1TAMA 4ACOA 1IIPA 3H0RB 3N7SC 2HBJA 4AYBF 4U7CA 2CRXA 2K8CB 1PVPA 3RF9A 2XI9A 3DEEA 4KX3A 2JMGA 2RHFA 2DQNB 2ZIVA 3LVVA 1CRXA 4QIWF 5KL8B 1ECWA 2JGAA 5HR6A 2KD1A 1A6SA 2WB1F 3SAGA 2G08A 1GO3F 4C0ZA 4WJ3B 1HIWA 4CDGA 2F76X 2CPRA 4CGZA 1T94A 2A3VA 2WAQF 2Y0SC 3PSPA 3KZXA 2ZIXA 4OJOA 2VJ4A 1SZHA 4BX9C 1Z1BA 1ZQ1C 2DGZA 3H0MB 3VCBA 1XNSA 4BUGA 4IC9A 4U6PA 2N1RA 4FZLA 3NRWA 1UPHA 2XICA 1F44A 2E5SA 2K8AA 3F5EA 2ZXHA 3F2DA 2YB1A 3PZPA 4OJPA 2H3IA 2W03A 3OPXA 3M7DA 1KBUA 4NLCA 1D8BA 2F8LA 2JH7A 5KL1B 3T79A 2MRLA 3AL0B 2K89A 2Y0SF 2HOQA 4KMOB 2KVCA 2W04A 4FZNA 5A0LA 2R18A 2HOFA 2LYAA 3M6KA 3PSTA 4QNLA 1ED1A 2XIDA 4P0PA 3K1ZA 2ZIVB 2G0AA 1PVQA 3E0FA 2VIXA 2Q4TA 3KFUF 2G06A 2HOIA 3VC8A 2K4EA 2YB4A 2W7PA 2CN1A 3LVWA 2KJ8A 1Q3UA 3C28A 2ZIWA 2ZIXB 4NWIA 2W7OA 5C0YA 3F2CA 2H3QA 2K4IA 1L6NA 2KIWA 2G5IB 2MA1A 2KEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5H B;  2DQN B;  2D6F C;  3KFU F;  3H0R B;  3H0L B;  3IP4 B;  1ZQ1 C;  2DF4 B;  4WJ3 B;  2G5I B;  2F2A B;  3H0M B;  3AL0 B; 
#chains in the Genus database with same CATH topology
 2FPK A;  2W55 A;  3H8M A;  4F92 B;  4KLL A;  2F1H A;  1TVA A;  2GH1 A;  2ATL A;  1PVR A;  1UCV A;  2H5X A;  5CRX A;  1QQ5 A;  9ICJ A;  1KL9 A;  4R65 A;  1FFV A;  2F77 X;  1VDV A;  3UXP A;  2OH2 A;  2NRW A;  1Z1V A;  4K4G A;  3PR5 B;  4K4H A;  4M04 A;  3L5K A;  4CF3 A;  4KLD A;  3WU2 U;  3DV9 A;  3RJE A;  2PKE A;  3IG5 A;  5J0X A;  4PZO A;  4OJ5 A;  4YG2 A;  1D9F A;  2HHV A;  2LM1 A;  2WF8 A;  2WB1 C;  3SEN A;  2VA2 A;  8ICV A;  3QU9 A;  4YFK A;  3PY8 A;  1FO4 A;  4RUA A;  1TV9 A;  5ALO A;  2Y1J A;  8ICJ A;  4DL7 A;  4BGD A;  1ZQI A;  3V7J A;  4DL5 A;  3N97 B;  3V6J A;  5IIL A;  4UB5 A;  3PMN A;  5L9X A;  1FIQ A;  4RPZ A;  4QWC A;  2C2E A;  1UA1 A;  9ICC A;  2R8I A;  2B21 A;  4PHE A;  3PR4 A;  5DG9 A;  2G0A A;  5AM1 A;  3E0F A;  2BZF A;  2HOI A;  2AJQ A;  3TAR A;  1RQL A;  1ZQH A;  4F5R A;  5EWG A;  3F2C A;  3PSP A;  3WKE A;  5AI8 A;  3TI0 A;  2PXI A;  3PO5 A;  2VAN A;  4Y2V A;  3PML A;  4RU9 A;  5EE1 A;  1ZQE A;  4MFC A;  2KNJ A;  3WKA A;  5KG2 A;  5CJ7 A;  5KT4 A;  4DL2 A;  1HJP A;  1XS9 D;  3RJF A;  1S10 A;  1BPX A;  3GU3 A;  1D8L A;  4DL3 A;  5J2I A;  1SV0 A;  5KG6 A;  5AM2 A;  5DQG A;  4DQQ A;  4TUP A;  2AH5 A;  4J9L A;  2LYB A;  2LKY A;  1XSL A;  1ZQF A;  3D2N A;  4Q44 A;  9ICF A;  4CF5 A;  2JH1 A;  4UB4 A;  1RYS A;  2H3F A;  3QU2 A;  1T8E A;  4F5O A;  3NVZ A;  2NRZ A;  4C8N A;  4FE3 A;  3AQE A;  7ICS A;  1YT3 A;  2WF9 A;  3T5K A;  2XI9 A;  4R63 A;  1B43 A;  4UB8 U;  5EE0 A;  4F2R A;  1D9D A;  3GV8 B;  2YML A;  1GO3 F;  2Q0Z X;  4B9L A;  2L5Y A;  1SZH A;  4M0A A;  2JZB A;  1L7N A;  3NVW A;  3PW5 A;  1T3Q A;  4LZD A;  2LM4 A;  5CEH A;  7ICQ A;  2W03 A;  3TQ1 A;  5AKX A;  1TAQ A;  5AM5 A;  3KHL A;  2JH7 A;  4J03 A;  4O0I A;  4RQN A;  3RH6 A;  5L1M A;  5DB9 A;  3KTQ A;  1IG6 A;  3JPS A;  1SWV A;  3JPQ A;  4ECS A;  3MC1 A;  3GIK A;  5AKL A;  3I1Y A;  2J6U A;  2ZIW A;  2QLT A;  2O6K A;  1L6N A;  2F8K A;  4GC7 A;  4RPY A;  2EZX A;  2D8C A;  3TFR A;  2KOB A;  4NL9 A;  5AI5 A;  3K75 D;  5J2B A;  8ICN A;  4RT3 A;  5KT3 A;  3F2B A;  1DK2 A;  3TAD C;  5ALT A;  3IHQ B;  4DS4 A;  2W9B B;  4EX6 A;  1L7O A;  2JHD A;  4QZG A;  2W8L A;  1S97 A;  3ISC A;  4FFD A;  4CE6 A;  5III A;  3RH5 A;  3M9O B;  2WF7 A;  2P35 A;  3MGH A;  4DFJ A;  3M1Y A;  3HRD D;  3KBB A;  1ZXI A;  2CXY A;  5AHX A;  7ICJ A;  2IA6 A;  2EQY A;  1JRO A;  2KHQ A;  4NLK A;  4Y2Y A;  3HIL A;  2PFN A;  4ICA A;  2V4R A;  4C8M A;  1H38 A;  5ALR A;  2C2D A;  1JAL A;  2QAR B;  5F9N A;  1TAM A;  4I27 A;  2K8C B;  5AKJ A;  5DKW A;  4QIW F;  3QEB Z;  2KD1 A;  3QU7 A;  4WJ3 B;  5K4L A;  4CGZ A;  3SR6 A;  4NLN A;  3VCB A;  4ED2 A;  3PNC A;  4U6P A;  4UAU A;  1F44 A;  2I9G A;  5HNK A;  4I28 A;  3FC4 A;  4NLC A;  4JB3 A;  2BQU A;  2KP7 A;  4F4Z A;  1ZJN A;  2W9B A;  2BKE A;  4QZ9 A;  1ZRN A;  4KLJ A;  1SL0 A;  8ICU A;  5KT5 A;  1Q3U A;  4MFF A;  1ZQZ A;  2KEY A;  2MUT B;  2FMP A;  8ICS A;  2W11 A;  5DDM A;  5AM0 A;  2UVU A;  3HWT A;  4F93 B;  5J2A A;  5ALP A;  4B9T A;  3E58 A;  4RZR A;  3JPP A;  2LPE A;  1S0N A;  4J9O A;  2EDU A;  5DG7 A;  2QAR A;  4UQG A;  1S0O A;  2JEI A;  2LBO A;  1KLN A;  2YMP A;  2E8N A;  2ZG6 A;  2I1Q A;  4AP9 A;  3EPG A;  1Z00 B;  1TK8 A;  1JI7 A;  4XA5 A;  4P4P A;  3RFA A;  1U45 A;  2JEJ A;  5ALV A;  5KG1 A;  3CRX A;  7ICH A;  1RG6 A;  1BPB A;  2PFO A;  2ZIU B;  4F8R A;  8ICZ A;  4P2H A;  5KG7 A;  4O5C A;  1YZ7 A;  3ZDD A;  4KTQ A;  3RAX A;  9ICV A;  3EZ5 A;  5J0Q A;  2ODG A;  3C5F A;  1MSW D;  1WCL A;  4DSI A;  1RDF A;  2JMG A;  5TZV A;  5D46 A;  3KD3 A;  5GTI U;  1ZQN A;  1KSP A;  5KG0 A;  1FEZ A;  1Z4O A;  2MAX A;  5DB7 A;  2MUT A;  4UB2 A;  4FZL A;  2V9W A;  2KVS A;  2NRV A;  3F2D A;  2GWS A;  1SIJ A;  1RPL A;  3NGD A;  4F2S A;  4Q8F A;  3QUB A;  4J9N A;  1LKY B;  5AKI A;  1KRP A;  2MRL A;  2W9M A;  2Y0S F;  1ZQR A;  1Q46 A;  3N4M B;  4DQP A;  5AM4 A;  1O03 A;  2XID A;  3WK9 A;  9ICK A;  4NM2 A;  2W8K A;  2HHS A;  5J2F A;  3EPI A;  5J8Y A;  3OGU A;  5C0Y A;  3ED5 A;  2H3Q A;  1Z00 A;  9ICU A;  4YR2 A;  2G5I B;  3OJS A;  2H3Z A;  2HHQ A;  5KFS A;  3Q8L A;  4YCX A;  3C29 A;  4IL6 U;  3AEV A;  1HUZ A;  1NKC A;  3T5J A;  1KKX A;  5CWR A;  3MR5 A;  4LVS A;  4GC6 A;  2ZIU A;  4FS2 A;  1NI3 A;  1WUD A;  4K4I A;  5AI9 A;  3IP4 B;  1ZQV A;  4DF8 A;  1XSN A;  3EW9 A;  2FMQ A;  3OHB A;  3MAB A;  2YX8 A;  2FLP A;  1WWU A;  1ZQO A;  4FS1 A;  2UVR A;  1V97 A;  3GZF A;  2F3N A;  5T14 A;  5DB6 A;  3OSP A;  4NLB A;  2OXO A;  5L1L A;  2IBK A;  4CNQ A;  4AYB C;  5G5H A;  4RUC A;  4M2Y A;  3QNM A;  3NS1 A;  5J0U A;  8ICT A;  2NRX A;  3CYM A;  3RB3 A;  3NTU A;  1VJ5 A;  8ICB A;  1LKY A;  2XGP A;  3PX6 A;  3FDS A;  1QSL A;  2G07 A;  3GIM A;  5KFM A;  1U47 A;  2DKX A;  3LVV A;  4ELT A;  3MGI A;  8ICX A;  3SAG A;  4C0Z A;  4DFK A;  3MR2 A;  5HMM A;  2A3V A;  1DGJ A;  8ICL A;  1Z1B A;  4I2C A;  2ZXH A;  4Y2J A;  3PZP A;  3C2K A;  3TAC B;  1KBU A;  2DBY A;  1ZQB A;  2VA3 A;  3C21 A;  2AQ4 A;  1QQ6 A;  2IOH A;  1X40 A;  5DB8 A;  3LDA A;  2XY7 A;  5ALW A;  4YR3 A;  4Y2U A;  1X6I A;  3BQ7 A;  3Q8R B;  3C28 A;  4DF4 A;  3RB4 A;  1SZP A;  3NVY A;  2OEH A;  3D2S A;  1NK5 A;  4QW8 A;  2PFQ A;  4RNO A;  4CF4 A;  4ED7 A;  2QB1 A;  2VA8 A;  4MEX A;  1NKE A;  3V6K A;  8ICF A;  9ICL A;  4IRD A;  5CHG A;  2IOF K;  2LHT A;  2RP5 A;  8ICQ A;  2VKQ A;  2KMD A;  4F5P A;  4BWJ A;  4DL4 A;  4M6W B;  3MGV A;  5DQI A;  3MR6 A;  5D49 A;  4UB6 U;  3PW2 A;  3TAQ A;  3QUC A;  3NAS A;  5IIK A;  4UAZ A;  3JPN A;  1BNO A;  4RQ4 A;  2JEF A;  1Q8K A;  3GV5 B;  5JTI A;  1DOQ A;  3I28 A;  3LK9 A;  4RQ1 A;  2JEG A;  3QYP A;  4B9V A;  4C7Y A;  1BGX T;  1DRG A;  1COK A;  1OXJ A;  5TIS U;  4UAS A;  3N7R C;  4Q8E A;  3C1Y A;  2CRX A;  5ALI A;  3PVX A;  1PVP A;  3RF9 A;  3DEE A;  3V7L A;  4J9M A;  3Q8S B;  2OWO A;  1DGS A;  2F1J A;  5DBC A;  9ICE A;  1A6S A;  5KFF A;  3FAH A;  4CDG A;  1L8L A;  2BQ3 A;  3OTQ A;  1B22 A;  4OCZ A;  3MDC A;  1RXW A;  3Q8P B;  1LB2 B;  3K1R B;  3RR8 A;  4UBC A;  4EEN A;  4USA A;  2KSO B;  5HHI A;  2F8L A;  4NLG A;  1KEJ A;  5KFX A;  4KMO B;  4IR9 A;  4IQW A;  1V85 A;  4QZ8 A;  4C7Z A;  3VC8 A;  3KOO A;  3MFH A;  1EXN A;  3CW2 C;  4M6W A;  5AK3 A;  5J0R A;  2DUY A;  3QX7 A;  3QXG A;  2K4I A;  3KKA A;  4KLG A;  3LYS A;  2QB0 B;  1NK6 A;  4DFM A;  4QZH A;  2LYH A;  3PW0 A;  3F5A A;  4NV0 A;  1OUQ A;  1KQQ A;  2XCP A;  2KK0 A;  5L1K A;  5F9L A;  1ZJM A;  7ICT A;  4DSL A;  2UVV A;  1L8O A;  3J81 j;  2KZ3 A;  4Q43 A;  2EZY A;  3C23 A;  7ICE A;  2IHM A;  2KN7 A;  4C4T A;  3AU6 A;  4F71 A;  3SZ2 A;  5DQH A;  4I2G A;  5AIB A;  4KLS A;  1L7M A;  4PL2 A;  1MC8 A;  2Z7J A;  5EE9 A;  2LI6 A;  2W54 A;  4DEZ A;  1BPE A;  4YVZ A;  5BOM A;  3WK6 A;  1QH9 A;  4O3Q A;  1WCN A;  4P0Q B;  4C8O A;  2PMZ C;  3QU4 A;  4LZG A;  4Y2X A;  4A8E A;  2F2A B;  3KHR A;  7ICM A;  2DFL A;  2ASL A;  4ECY A;  2HBJ A;  4F4Y A;  1UT5 A;  4UAV A;  5AI4 A;  3UMG A;  3M9M B;  1U48 A;  5KT7 A;  4DS5 A;  2HW3 A;  4OJO A;  4PHP A;  2BCU A;  2YQE A;  4J9Q A;  5D4B A;  4DSK A;  2XY6 A;  2QB0 A;  5J0Y A;  3RTV A;  1RQN A;  4HAI A;  4YD2 A;  1NZP A;  1SV0 C;  2MU2 A;  3UXO A;  4YMO A;  4I2B A;  5KL1 B;  2FLL A;  3H7I A;  5ALY A;  1TK0 A;  1NOM A;  1VLB A;  2W43 A;  4C8L A;  1A77 A;  2WFA A;  4P4O A;  5J0O A;  4RQ8 A;  5ALL A;  3JPT A;  1ZQC A;  3GFK B;  3RJJ A;  1L3U A;  4IQV A;  4O3P A;  5DDY A;  3WKC A;  2AQ0 A;  3MFI A;  4NLZ A;  4ED1 A;  3BDP A;  4R64 A;  5CR0 A;  4Y2R A;  4TUQ A;  4ECX A;  3TFS A;  5ALX A;  4Y2P A;  5J2H A;  3SAH A;  4P0Q A;  4EBE A;  5GTH U;  3SV3 A;  4C8K A;  1Q3V A;  4O9M A;  9ICG A;  1KDH A;  2AXT U;  3N7P D;  4J9P A;  4DSJ A;  3M8R A;  2JR5 A;  1X6J A;  2P6U A;  2H3V A;  5G5G A;  1C7Y A;  5CB1 A;  3Q8K A;  5DG8 A;  2HSZ A;  5DBB A;  3SD7 A;  2BHN A;  2G09 A;  4M9H A;  4DOB A;  4UAT A;  2R8G A;  3D2Q A;  4UBB A;  1BVS A;  1OW5 A;  5ALM A;  9ICO A;  3SV4 A;  3UPQ A;  3KHG A;  2HHT A;  9ICR A;  3UMB A;  4YQW A;  2HMX A;  2IMW P;  4XQ8 A;  1TKD A;  4MEY A;  4UB1 A;  4ACO A;  4BDP A;  3QZ8 A;  5KFV A;  4KN7 A;  5DBA A;  1ECW A;  2AGQ A;  4DSF A;  1QTM A;  1ZQS A;  2WAQ F;  4RQ2 A;  5J0S A;  4KLQ A;  4DLG A;  4QWA A;  4ELU A;  5J2C A;  4JUZ A;  1O08 A;  2A19 A;  3RBD A;  3M7D A;  4DQI A;  5AK6 A;  9ICI A;  4KLH A;  2R18 A;  2R8H A;  2HOF A;  1J97 A;  4RQ3 A;  3GDX A;  1ED1 A;  4QZI A;  2ZIV B;  3FM9 A;  3RRH A;  4EYI B;  2Q4T A;  1ZD5 A;  3OJU A;  2W7P A;  4JV1 A;  1NK7 A;  1ZQJ A;  3DDH A;  3PX4 A;  4ED6 A;  3GIJ A;  9ICX A;  2W3R A;  1JN3 A;  1ARO P;  4ECU A;  1XO0 A;  5J0T A;  2DF4 B;  4OJL A;  4F4X A;  1S0V A;  7ICU A;  4C4R A;  4RQ7 A;  2VJ5 A;  5AI6 A;  3H8J A;  5KFN A;  2E8P A;  1P7D A;  5KFZ A;  4IS7 A;  2E8O A;  3UMC A;  3AU2 A;  3RH4 A;  1U4B A;  4F3O A;  3QU5 A;  2NV3 A;  2RDJ A;  4M9N A;  2KG5 A;  4X5V A;  8ICY A;  4FZM A;  4ECQ A;  2M0N A;  5EOZ A;  3ZD8 A;  5KFE A;  2E3T A;  2GOL A;  2JV3 A;  4YP3 A;  1NJZ A;  1N56 A;  1UHU A;  3PX0 A;  1ZD2 P;  1U9L A;  4LJX A;  3ONN A;  1NK0 A;  4Y2Q A;  2HHU A;  2HHX A;  4TUS A;  5KFK A;  9ICT A;  2D6F C;  1IM4 A;  4O3S A;  2KKP A;  2NRT A;  4DO9 A;  2HVI A;  1IIP A;  3H0R B;  5KFH A;  3NVV A;  2RHF A;  2ZIV A;  3ISD A;  3UQ0 A;  5KFA A;  2WB1 F;  1KTQ A;  2BPF A;  2ZUB A;  3RJH A;  1A76 A;  3ZDB A;  1QQ7 A;  3KZX A;  4ED0 A;  3QZ7 A;  3EWA A;  4G3I A;  4IC9 A;  3H4D A;  2I5H A;  2XIC A;  2BDP A;  1V38 A;  1ZOL A;  2AGP A;  2BR0 A;  4BXO B;  3PV8 A;  3RR7 A;  5CP2 A;  5H2F U;  1ZQW A;  9ICQ A;  1C20 A;  5ALF A;  5J2E A;  2W9A A;  2DKZ A;  5AI0 A;  2EZZ A;  1PVQ A;  3C2L A;  4NWI A;  4F72 A;  2Y9U A;  2BGW A;  1MN8 A;  8ICH A;  4RQ5 A;  5ALD A;  5KG5 A;  4RNN A;  1RYU A;  3MR3 A;  4I29 A;  2YMM A;  7ICF A;  3WK7 A;  5ALQ A;  7ICR A;  1L7P A;  1PK3 A;  8ICE A;  3BS5 B;  4ZH4 A;  5J0W A;  1RYR A;  3SEI A;  2E1F A;  3UXN A;  5ALG A;  3SMV A;  5KG3 A;  1S76 D;  2PMZ F;  2OM6 A;  2GLE A;  3IDW A;  5JUM A;  5L1J A;  1DK3 A;  1S5L U;  9ICH A;  4R66 A;  1ZQG A;  2XVT A;  4BXO A;  4KLE A;  4DFD A;  1ZQY A;  5J8Y C;  2HHW A;  1K1Q A;  1SV4 A;  1UA0 A;  1X9S A;  4M47 A;  3G6Y A;  3N7S C;  4O3R A;  4QWD A;  5B5E U;  1N2X A;  4KX3 A;  3ZI4 A;  3BJY A;  3OHA A;  4EZ9 A;  1PUZ A;  1BPD A;  2MSN A;  2G08 A;  1HIW A;  2F76 X;  1T94 A;  1AQ6 A;  3TKA A;  4JWN A;  2LMR A;  2N1R A;  4NM1 A;  3NRW A;  3HW8 A;  4PHA A;  2I6X A;  2H3I A;  5ALE A;  4RQM A;  1NK9 A;  4I2F A;  5HHH A;  5J2G A;  3HPO A;  2AU0 A;  1XWL A;  5DLG A;  4F5N A;  1QSY A;  1XC9 A;  1KW4 A;  3BS5 A;  3KFU F;  1N62 A;  2KJ8 A;  1Z4N A;  4GXJ A;  8ICP A;  1LVH A;  5E79 U;  1JRP A;  4O5K A;  2MA1 A;  4R8U B;  4XUS A;  3THV A;  1X9W A;  3PSF A;  1IXR A;  4PH5 A;  1X42 A;  5ALN A;  5J29 A;  2C28 A;  2AGO A;  2BCV A;  3MBY A;  1ZQT A;  4EX7 A;  2KZM A;  5AKK A;  3SYZ A;  3NRZ A;  5J2J A;  4DSE A;  2IOF A;  1KFS A;  4YMM A;  2RDI A;  2KKV A;  4M9L A;  4IQT A;  4Y2T A;  4O3M A;  5AIC A;  3RJI A;  2K4H A;  1N61 A;  4GFJ A;  3QUQ A;  2HBK A;  2P6R A;  5KFJ A;  4ECT A;  3T5L A;  3ZDC A;  2PI5 A;  2ZUC A;  3B0X A;  4YD1 A;  5ALS A;  4QIW C;  5HR7 A;  2HCF A;  1A0P A;  4US9 A;  4Q45 A;  5FP0 A;  3AMZ A;  4IRK A;  1F0M A;  2KZZ A;  4ED8 A;  5ALU A;  3G6V A;  4IQU A;  2XCA A;  4F5Q A;  7ICG A;  3IRU A;  5KL8 B;  3H40 A;  2QKQ A;  4B6J A;  1LV5 A;  4TQS A;  5BPC A;  1N63 A;  4MF2 A;  4BWM A;  2VJ4 A;  2DGZ A;  3H0M B;  4BUG A;  5C5J A;  5EE3 A;  4R8U A;  1UPH A;  2PI4 A;  1T4G A;  2K8A A;  1YZ6 A;  3AN1 A;  2HDO A;  5ALJ A;  1ZQA A;  2BCR A;  3RB0 A;  4O3N A;  5KFD A;  4J9R A;  3QUT A;  4ELV A;  4P4M A;  2ZUD A;  3C1Z A;  5JRT A;  4JK1 A;  3QE9 Y;  9ICN A;  4FBT A;  3WK8 A;  2W7O A;  1JXL A;  1MQ2 A;  2EAO A;  1UQV A;  2WF5 A;  2KIV A;  4QZF A;  5AIA A;  4KLU A;  2F1I A;  2XC9 A;  3BQ0 A;  2BPG A;  4DFP A;  2FDR A;  4QZE A;  4DOA A;  5L1I A;  2E8M A;  3H0L B;  3IV6 A;  4TQR A;  3BS7 A;  3M6Z A;  4CRX A;  1NJX A;  2KHV A;  1URJ A;  5KT6 A;  2A1J B;  5KAI U;  2ASD A;  5J2K A;  2XY5 A;  3NUQ A;  2UVW A;  2JXJ A;  4XRH A;  4F91 B;  1S0M A;  7ICV A;  4B9M A;  1K5O A;  5KFW A;  5KFO A;  2KFN A;  1UT8 A;  3QEA Z;  5KFU A;  4GXI A;  1Y88 A;  1K1S A;  2K8B B;  4KLF A;  2G5H B;  3FYH A;  1ZQM A;  5KAF U;  1WG8 A;  3M9N B;  2R8K A;  2ZJA A;  4PGY A;  3KKA C;  4ZOH C;  1T7P A;  3PW4 A;  3HKZ C;  4O5E A;  3F53 A;  4F4K A;  5J2D A;  5KFP A;  4QWE A;  3WKD A;  9ICM A;  1XSP A;  2WF6 A;  2FPL A;  1NNL A;  1ZD4 A;  4Z6F A;  2Y0S C;  5KFG A;  4I2I A;  3HT3 A;  3RB6 A;  1JMS A;  4OD0 A;  4M9G A;  2JZB B;  2KSO A;  5KFL A;  2JRZ A;  5CA7 A;  4EYH B;  5KFB A;  1Z3E B;  2DPI A;  5AK5 A;  1WYG A;  1F5S A;  2KVC A;  2W04 A;  2ZTC A;  2DPJ A;  5A0L A;  4CCH A;  4UW9 A;  1MQ3 A;  8ICR A;  2A1J A;  3B9J A;  4NXZ A;  2YMQ A;  4DOC A;  3KZI U;  2VIX A;  2K4E A;  1B4F A;  2ZTD A;  5KG4 A;  3RRG A;  4DQS A;  3OSN A;  7ICN A;  8ICK A;  2ZIW B;  4F4W A;  2RLT A;  3GIL A;  7ICK A;  8ICM A;  9ICW A;  4QZB A;  2ESE A;  3O0F A;  5IIN A;  4M9J A;  1S9F A;  4PHD A;  3CP8 A;  3T5H A;  4I2A A;  1QCK A;  4O3O A;  5IIJ A;  2YN4 A;  1SGG A;  2E1E A;  4P0P B;  3ORY A;  2KIC A;  5ALK A;  3WKB A;  2KTQ A;  4B9S A;  3AQF A;  1NZB A;  4GIB A;  3EYZ A;  5DGA A;  3N28 A;  2XO7 A;  1M6Y A;  4PPX A;  5BOL A;  4JV0 A;  9ICP A;  1ZQX A;  1JUD A;  4UB3 A;  3B0Y A;  3I76 A;  4DCC A;  2HBL A;  2NO4 A;  1D8Y A;  4AYB F;  1SKR A;  4GXK A;  4RT2 A;  2R8J A;  1N60 A;  4KIT B;  4JWM A;  1QLN A;  2JGA A;  4I2D A;  3IM1 A;  5ALH A;  3TAD A;  3RAQ A;  4YXM A;  5B66 U;  4UAR A;  2ISO A;  1SKW A;  5J0P A;  2AHO B;  2NO5 A;  8ICC A;  3JPR A;  2IHN A;  3V72 A;  2F44 A;  3HX0 A;  3HP6 A;  4EZ6 A;  2HI0 A;  4ECW A;  3M6K A;  4NL9 C;  2XGQ A;  4P0P A;  3K1Z A;  1U49 A;  1L5U A;  3PW7 A;  1L3T A;  4IRC A;  2YB4 A;  3LVW A;  4NY8 A;  3H8S A;  2ZIX B;  4KLI A;  2KIW A;  4F50 A;  3BZC A;  4B9U A;  9ICS A;  2J6S A;  2HBM A;  3E2E A;  4ECV A;  1ZQP A;  5IIO A;  5AKH A;  3ALR A;  4EEL A;  5AKY A;  4OO1 J;  2HVH A;  3V6H A;  1X9M A;  1TFR A;  2RRD A;  3IG8 A;  3CNH A;  4Z6D A;  3RJG A;  4OJ6 A;  2OYY A;  4US8 A;  3G6X A;  4EEY A;  2ZXI A;  1SXE A;  4RNM A;  1ZRM A;  1ZQL A;  3IN5 A;  4DQR A;  4KLT A;  2YY6 A;  4YR0 A;  3ETR A;  4DWI A;  3ZDE A;  3K4G A;  4EBC A;  1T3N A;  1CI4 A;  3LWL A;  1DXS A;  1WWV A;  1COO A;  4QZC A;  4Z6C A;  5KTQ A;  9ICA A;  1NK4 A;  5HP4 A;  5KFY A;  2Y1I A;  1JXE A;  3JPO A;  1BNP A;  8ICA A;  7ICL A;  2CPR A;  1L3V A;  4DL6 A;  2ZIX A;  1ZQ1 C;  8ICG A;  1HUO A;  5AKZ A;  1RXV A;  4RQ0 A;  2BCQ A;  3ETL A;  3GII A;  4B9N A;  3D6J A;  1S8O A;  1ZET A;  4OJP A;  4KMU A;  1BPZ A;  5KFI A;  1D8B A;  4EBD A;  3T79 A;  3ISB A;  3AL0 B;  1PK1 B;  3BQ2 A;  1NJY A;  2LYA A;  3PST A;  2FLN A;  3ZDA A;  1ZD3 A;  2G06 A;  2ES6 A;  2CN1 A;  1QSS A;  8ICO A;  4KX5 A;  3AUO A;  4FO6 A;  2FJ6 A;  4RPX A;  1JX4 A;  1J2N A;  3R9K A;  3H8W A;  4MFA A;  1SB3 C;  3L3F X;  3T3F A;  4TUR A;  4UAY A;  3AM9 A;  1SL1 A;  2RQ5 A;  4EEK A;  2FPM A;  3GV7 B;  2C22 A;  2FI1 A;  1ZQK A;  5EWE A;  4IR1 A;  2M9N A;  2KJ5 A;  2Y9T A;  4PZN A;  4JV2 A;  3UM9 A;  4PJ0 U;  1SWW A;  4YN4 A;  1Z19 A;  1NK8 A;  4QWB A;  4PGQ A;  3GQC A;  4KLO A;  1ZQU A;  1ZYQ A;  4JMU A;  3LWM A;  3HJE A;  2W3S A;  5DGB A;  5KFC A;  2ZJ5 A;  2W9C B;  2K60 A;  2J6T A;  1X2I A;  4I2H A;  3HKZ F;  2OCE A;  4BJQ A;  2EAN A;  1RM6 C;  8ICW A;  2GO7 A;  4ECR A;  1L3S A;  1BPY A;  1PK1 A;  2EAP A;  5HML A;  4U7C A;  3RBE A;  5KFR A;  5AM3 A;  2A1A A;  4Z6E A;  1ZQQ A;  5F3X B;  1XU4 A;  1TAU A;  2KFZ A;  1KFD A;  1NKB A;  2ALZ A;  7ICI A;  3F5E A;  5DLF A;  3OPX A;  2B6G A;  1TE2 A;  2D3D A;  1SXD A;  3MDA A;  1N5X A;  2K89 A;  2DL0 A;  5KT2 A;  1B0X A;  3EUB 2;  2HOQ A;  4C80 A;  4J9K A;  2BCS A;  5JU5 A;  1KN5 A;  2EAM A;  2KE7 A;  5KFT A;  2K4P A;  2BPC A;  3Q8Q B;  4PGX A;  1N5W A;  2P66 A;  2V4Q A;  5KNI A;  3TAN A;  1N48 A;  5IIM A;  4QJF B;  1S77 D;  3U26 A;  1JIH A;  4PL1 A;  1KFT A;  4KLM A;  4GLX A;  2W9C A;  3BZK A;  4MHV A;  2BDU A;  3PSI A;  4RQ6 A;  3SI8 A;  4QZA A;  3PO4 A;  1PZN A;  1J2M A;  3L4P A;  9ICB A;  5AKE A;  4I2E A;  8ICI A;  3UQ2 A;  4Y2S A;  3ZD9 A;  5EWF A;  1V9P A;  3BQ1 A;  3WK5 A;  2ASJ A;  3KHH A;  1XO1 A;  4G9B A;  2BQR A;  4ECZ A;  2KV2 A;  3A0H U;  5AKG A;  2C2R A;  1SL2 A;  1HEK A;  1X66 A;  4ED3 A;  4E0D A;  7ICP A;  3SQI A;  2FE9 A;  1RZT A;  1CEZ A;  4MF8 A;  2NYV A;  2ZTE A;  3SAF A;  2KJ9 A;  3ICX A;  4I2J A;  1MA7 A;  2WAQ C;  2DWQ A;  4KN4 A;  5HR6 A;  4QZD A;  5KFQ A;  3V7K A;  4NJ8 A;  4YXJ A;  3C5G A;  1CRX A;  2DQN B;  4DLE A;  2PFP A;  1X9X A;  3RJK A;  2WHE A;  1XNS A;  4BX9 C;  5AK4 A;  1TK5 A;  5ALZ A;  2YTU A;  1FFU A;  4C4S A;  2E5S A;  1IV8 A;  2YB1 A;  1CUK A;  4FBU A;  3TAP A;  3WK4 A;  4HYK A;  1SKS A;  2B0C A;  2FMS A;  2WTF A;  3M8S A;  4UAW A;  3Q8M A;  4FZN A;  4QNL A;  3H4B A;  3C2M A;  2ISP A;  2OHF A;  1NJW A;  4J9S A;  3S6J A;  2ZJ8 A;  2EH9 A;  7ICO A;  4QW9 A;  3BQT A;  4YMN A;  3A0B U;  1ZQD A; 
#chains in the Genus database with same CATH homology
 2ZIW B;  3LYS A;  2H3Z A;  4QJF B;  3D2S A;  4PL1 A;  1XO0 A;  2DF4 B;  2GH1 A;  3L3F X;  2HBM A;  3F5A A;  4NV0 A;  4OJL A;  3C29 A;  1OUQ A;  3O0F A;  3PSF A;  1PVR A;  2BDU A;  3CP8 A;  2VJ5 A;  3PSI A;  4P0Q A;  3SAH A;  3H0L B;  2KOB A;  5CRX A;  3ALR A;  1Q3V A;  2ZIU A;  2KNJ A;  1P7D A;  3M6Z A;  4CRX A;  1WUD A;  4OO1 J;  2KHV A;  3N7P D;  1URJ A;  2LHT A;  3IP4 B;  2RP5 A;  3F2B A;  2E1E A;  2KJ5 A;  4P0P B;  2VKQ A;  2NV3 A;  3NUQ A;  2F77 X;  2KIC A;  2RRD A;  2H3V A;  2YX8 A;  3IG8 A;  2KKV A;  2LBO A;  2JHD A;  1Z19 A;  4FZM A;  2M0N A;  3GU3 A;  3MGV A;  2OH2 A;  4O3M A;  2ZG6 A;  4OJ6 A;  2G09 A;  2OYY A;  2E1F A;  2GOL A;  3AQF A;  2KV2 A;  4PL2 A;  3GZF A;  2K4H A;  4JMU A;  2ZXI A;  3SMV A;  1NZB A;  2Z7J A;  4GFJ A;  5T14 A;  2LYB A;  2HBK A;  2LKY A;  3D2Q A;  2PMZ F;  3ONN A;  2OM6 A;  1HEK A;  3RFA A;  4NLB A;  2OXO A;  2K8B B;  3D2N A;  4AYB C;  3IG5 A;  2G5H B;  3IN5 A;  2JH1 A;  4KX5 A;  2H3F A;  3SQI A;  3CRX A;  4P0Q B;  4OJ5 A;  4QIW C;  5HR7 A;  3HKZ F;  2XVT A;  2KHQ A;  2ZIU B;  2PMZ C;  1A0P A;  4BJQ A;  2WB1 C;  3SAF A;  2KJ9 A;  3ICX A;  2HMX A;  3CYM A;  1DRG A;  1MA7 A;  2D6F C;  4ICA A;  4A8E A;  2KKP A;  4FE3 A;  2WAQ C;  3AQE A;  2F2A B;  1YT3 A;  2G07 A;  2HBL A;  3HKZ C;  3N7R C;  3F53 A;  1TAM A;  4ACO A;  1IIP A;  3H0R B;  3N7S C;  2HBJ A;  4AYB F;  4U7C A;  2CRX A;  2K8C B;  1PVP A;  3RF9 A;  2XI9 A;  3DEE A;  4KX3 A;  2JMG A;  2RHF A;  2DQN B;  2ZIV A;  3LVV A;  1CRX A;  4QIW F;  5KL8 B;  1ECW A;  2JGA A;  5HR6 A;  2KD1 A;  1A6S A;  2WB1 F;  3SAG A;  2G08 A;  1GO3 F;  4C0Z A;  4WJ3 B;  1HIW A;  4CDG A;  2F76 X;  2CPR A;  4CGZ A;  1T94 A;  2A3V A;  2WAQ F;  2Y0S C;  3PSP A;  3KZX A;  2ZIX A;  4OJO A;  2VJ4 A;  1SZH A;  4BX9 C;  1Z1B A;  1ZQ1 C;  2DGZ A;  3H0M B;  3VCB A;  1XNS A;  4BUG A;  4IC9 A;  4U6P A;  2N1R A;  4FZL A;  3NRW A;  1UPH A;  2XIC A;  1F44 A;  2E5S A;  2K8A A;  3F5E A;  2ZXH A;  3F2D A;  2YB1 A;  3PZP A;  4OJP A;  2H3I A;  2W03 A;  3OPX A;  3M7D A;  1KBU A;  4NLC A;  1D8B A;  2F8L A;  2JH7 A;  5KL1 B;  3T79 A;  2MRL A;  3AL0 B;  2K89 A;  2Y0S F;  2HOQ A;  4KMO B;  2KVC A;  2W04 A;  4FZN A;  5A0L A;  2R18 A;  2HOF A;  2LYA A;  3M6K A;  3PST A;  4QNL A;  1ED1 A;  2XID A;  4P0P A;  3K1Z A;  2ZIV B;  2G0A A;  1PVQ A;  3E0F A;  2VIX A;  2Q4T A;  3KFU F;  2G06 A;  2HOI A;  3VC8 A;  2K4E A;  2YB4 A;  2W7P A;  2CN1 A;  3LVW A;  2KJ8 A;  1Q3U A;  3C28 A;  2ZIW A;  2ZIX B;  4NWI A;  2W7O A;  5C0Y A;  3F2C A;  2H3Q A;  2K4I A;  1L6N A;  2KIW A;  2G5I B;  2MA1 A;  2KEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...