4EZ6A

Bacillus dna polymerase i large fragment complex 1
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
580
structure length
549
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
total genus 192
structure length 549
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez6A01
2C2RA 1JXLA 2P6RA 3RJKA 2FLLA 3KK3A 4KTZA 2BQRA 4PHEA 1Z26A 5SWMA 3SV3A 2XY6A 3AVFA 4KITB 3C1ZA 3VQBA 4Z6EA 4CJWA 4EP4A 4QZ8A 3L3VA 4B9MA 1ZQFA 9ICPA 4Z4GA 2FBXA 3OYIA 2IGIA 1TAUA 5J2AA 3RTVA 4RNNA 2ZD1A 4O55A 8ICAA 1F21A 3T19A 2AQ4A 1QE1A 3VQDA 1ZQUA 3RRGA 2PYJA 2X6SA 2XY5A 3D45A 3CM6A 3RJFA 3OYLA 1Q9YA 2I1QA 1ZQOA 5KFOA 4YR0A 2DY4A 1TVAA 4ECVA 1Y97A 4Z0UA 4FZZA 3VQ9A 5DBCA 4FJNA 1XHZA 4R64A 2YNFA 1JL1A 3JPNA 2PFQA 2KN7A 4NY8A 4QZGA 2ALZA 4X5VA 4R65A 1S1XA 4F2RA 2P1JA 1BPXA 3V9SA 5JUMA 3LALA 1ZQZA 5KT3A 3T5KA 3O4QA 2I9GA 3QEVA 5J2DA 2ZTDA 5BOMA 1GOBA 2P5GA 5FRNA 1XO1A 3IHQB 1EETA 3DLGA 1BPEA 4FLUA 3ZDAA 1B43A 2VANA 3U6FA 1ASVA 1C1AA 4FJGA 3FFIA 4J9NA 3JPQA 4UB5A 4FJHA 3VQCA 4CHOA 3TAQA 4YMOA 1XU4A 3CFOA 1XHXA 2A1SA 3QEAZ 2IMWP 4DSKA 4DTUA 5HBMA 3H4DA 1WNSA 5KFHA 2VWKA 5HHIA 4QZCA 9ICBA 5J2PA 4F93B 3C2KA 4YQWA 4O3RA 4FM1A 2XO7A 3OY9A 3SV4A 4KLOA 3VA3A 3BDPA 4NCGA 4FZYA 4FJIA 4YCXA 4CJVA 9ICVA 1NKBA 3Q8SB 4CJTA 2R8KA 4PY5A 4DQQA 4QW9A 4F4ZA 4KLMA 5D49A 7ICVA 3TAMA 4I2PA 5L9XA 4YR3A 4BE0A 4B8AB 4R8UB 4BXOA 3HSTB 4LZGA 7ICJA 4FW1A 3P83D 3V6JA 4G1QA 4ELVA 4PQUA 4CF9A 5CZ1A 4ZHRA 4B8CA 2PI5A 2OA8A 3ZCMA 4H4OA 4YXMA 1KVBA 4M9LA 3QO9A 3RAQA 1EXNA 4KHYA 4Q8FA 9ICIA 3OYBA 3HPOA 4M9JA 3RBEA 4ED3A 3TR8A 4CJRA 1D8YA 4OVLA 1NJXA 9ICFA 2GUIA 4FJXA 1ZBLA 1HNVA 5KFCA 4IR1A 3KHLA 5D4BA 4I2EA 1BPBA 2BGWA 4Q0BA 3NGYA 1N56A 2KQ2A 5DMRA 5I3UA 2HMIA 1S97A 3QINA 2W9CB 4CEBA 1VSDA 8ICRA 4W5QA 3HO1A 4NXZA 4M2YA 4B9TA 4LH4A 5DB8A 2AJQA 1JX4A 4CIFA 5EU7A 1U4BA 3VQAA 4EBDA 2AGQA 3RBDA 4OKKA 4UAWA 5IIIA 4CIGA 3ZD8A 1IH7A 1WLJA 3RAXA 4M04A 3RB0A 1RDCA 1S5JA 5KFVA 1BISA 2KFNA 3H08A 3L2WA 1B92A 2C22A 2PZSA 3AVJA 1NOYA 4DO9A 3K5OA 5J0SA 1RDBA 3MBYA 3TFRA 3Q8MA 3K5MA 4N47A 5KG3A 1R0AA 4DS5A 4N56A 1RBVA 3GV5B 5KFDA 4IKFA 3AU2A 1IO2A 2UVRA 5KFLA 4J2AA 4FLZA 4J9MA 4Q43A 4FO6A 3ASMA 3LP0A 4M6WA 2HW3A 4MEYA 3ITHA 4OGCA 4IQWA 4J2EA 5EWFA 3UIQA 1LW0A 3PX0A 3CFPA 4MFBA 4CEZA 1S10A 1BHLA 3PW5A 4G3IA 3BQ2A 3E01A 3OJSA 1BIZA 5E41A 5KG1A 2ISOA 3K5NA 1L3TA 2OPPA 3HVRA 4NM2A 2XGQA 3ZD9A 4F4XA 2RPIA 4BE2A 2DFLA 2JZBA 1S1TA 5KG5A 1NJYA 4KLSA 4HUEA 3AVAA 5KT5A 1T7PA 4DSIA 3QESA 3OJUA 1UA0A 1NJWA 2ZTCA 5DLFA 1Q9XA 3M9NB 3MABA 1ZJNA 4Q8EA 3OYEA 1HUZA 1U04A 1N6QA 4RW4A 4QOZB 2HHUA 1ZYQA 4CF1A 1C0TA 4UB2A 2VA8A 4RPXA 8ICXA 5CR0A 3GV7B 4DFJA 5DBBA 4FLXA 1VK0A 2PYLA 2UVWA 3K57A 5KFNA 4DTRA 4H4MA 4P4OA 4KLIA 1D9DA 1TL3A 4ED7A 4UQGA 5KFSA 2Z1JA 3B6OA 4CEQA 5KFTA 4I9LA 3RMDA 4OJRA 1WSHA 3AVBA 2ZUDA 4CFBA 2HHTA 1MC8A 3CQ8A 9ICEA 5KG2A 4XQ8A 1RT7A 2P6UA 3GIKA 4ID1A 4Y1DA 4J9SA 5HLFA 4O3SA 4ZTJA 1VSLA 3RWUA 3PX4A 2D5RA 2ZJAA 1LV5A 2R8JA 4DU3A 3NF7A 3BQ0A 3JPTA 4FJLA 3BGRA 2DFEA 3AU6A 1S0MA 8ICCA 4RW9A 4ECWA 2HNYA 7ICRA 1S9GA 4KHWA 3SYZA 3L2UA 4C8LA 9ICCA 3JPOA 1B22A 4E7HA 4DL2A 3SI8A 3PW2A 1S1WA 2JGUA 3VQEA 4JS5A 1ZQXA 4QZBA 5IIKA 4CHPA 9ICSA 2P66A 4BDPA 2UVVA 3K4GA 1RTHA 3V1OA 3TI0A 4KV8A 2G8UA 1VSIA 4ECXA 3RH4A 2VWJA 4IR9A 2B5JA 3KKSA 3PNCA 5KFKA 2BANA 3UXOA 2V9WA 3AA3A 3QLHA 3KK2A 3F9KA 4YVZA 3L2RA 5DLGA 4Z6FA 4QWEA 3G6VA 4M45A 3MGHA 5J2MA 4Z4HA 4ZTFA 4DG1A 3ISNC 1I39A 3EWAA 4DTPA 3SPZA 2NRZA 2X6NA 4BACA 4KLDA 2ATLA 4LZDA 2KZMA 2W9MA 4TQRA 1NK4A 1RZTA 4CK2A 4OLAA 3AVHA 3LDAA 1HJPA 4NYFA 4M3TA 3VN5A 3QIPA 3PY8A 2H5XA 3ZT3A 4KTWA 3T5HA 2XGPA 5CY4A 1RPLA 3NTUA 2PFNA 4RT3A 4KLHA 3UXPA 1EX4A 3OYHA 2V4RA 5L1KA 1U9LA 1RT4A 4CJLA 2VG6A 2R8GA 8ICTA 3MR6A 3SCXA 3QIOA 1L3SA 1ZQPA 2A1JB 2JEJA 4EZ9A 4KHNA 2LYHA 1Z00B 3UQ0A 5TZVA 4ED6A 1SL0A 4ICLA 3AO3A 3HPHA 4CF2A 3QZ7A 9ICMA 1SKWA 3NGIA 4PGXA 4CERA 1EXQA 5KFGA 1ZQHA 5DGAA 4I2CA 1ZQQA 3ISDA 1JLCA 4QCLA 4DF4A 4CK1A 2DPIA 1HQEA 3SUPA 4F5RA 4IRCA 4I28A 1L5UA 2IAJA 3HP6A 5HNKA 4MFCA 1TGOA 5KT6A 3ZDDA 4FS1A 2HNZA 1JLFA 1JLAA 1Z25A 4AHVA 2FMQA 5KFAA 3GV8B 1LAVA 1S9FA 9ICTA 3KLHA 5CHGA 2IDOA 2KTQA 2FPKA 4KHUA 5L1LA 4CGGA 3V6KA 2J6TA 3VA0A 3GILA 1RDDA 4JK1A 4ID5A 8ICMA 3MDCA 3WNGA 3OYNA 2RDIA 4PGYA 2GWSA 1RTDA 4H8KA 2HHXA 4O44A 3OHBA 8ICSA 3ISBA 4EYIB 5HRRA 3I8DA 2A1RA 3RMAA 3SQ1A 3MR3A 2W9BB 4B9VA 1O1WA 1RTJA 8ICEA 3QNOA 3SI6A 2B21A 4FJJA 5J0TA 4KTQA 5J0WA 2FBVA 3B0YA 4RT2A 4F91B 2D0AA 3QEIA 4CJFA 3RJHA 8ICKA 3H8JA 4I2BA 3L2QA 4DL7A 2C2EA 1ZQCA 4CESA 2P5OA 4ED1A 3KLGA 3LAMA 2HHQA 5DQHA 3V4IA 4J9QA 1RYRA 4N41A 4DTMA 2ETJA 3RJJA 5K14A 1VRUA 2OPQA 4HTUA 4O3NA 1ZQWA 4E3SA 5F9LA 1J54A 2DTUA 4Y1CA 5C42A 2JEIA 4IBNA 4NYNA 1EP4A 5L1IA 4CEDA 4MFAA 3DM2A 4BGDA 4RG8A 3C23A 1HRHA 5FDLA 1L3UA 4BDYA 4O5EA 1JXBA 4DTJA 4DTXA 5SZTA 4E7LA 4OKJA 2NRTA 4GC7A 4R5PA 4DF8A 1ZQIA 2BCUA 4PHAA 1HUOA 2HHSA 3PO4A 1Z3EB 3AVGA 1S0VA 3G10A 5DKWA 4CGFA 5HRPA 4N76A 4DL4A 4ECUA 4J9RA 3G0ZA 3MFIA 1AROP 1X1PA 4FJ8A 4R63A 2NRWA 1TVRA 5KFQA 3GIMA 4E0DA 4AH9A 1DTTA 1ZQTA 5KFXA 4CF0A 3IRXA 4RZRA 1X9WA 4DL5A 4W5RA 2F8TA 4RQ2A 2F1JA 3WNHA 4BE1A 3EY1A 4P4PA 3KLIA 1W9HA 1SZPA 4DOBA 5KG0A 5J2IA 1A5WA 4CCHA 4TURA 2IOCA 3KD5E 3RB6A 2VG7A 4XUSA 4B3OA 1LB2B 4EP5A 4QZAA 2BR0A 1TFRA 3LPUA 3MDAA 3H4BA 1XSPA 2FPMA 3P1GA 3K58A 4CEEA 5KRSA 2NRVA 1T4GA 7ICTA 3AVCA 3GDXA 8ICQA 4YD2A 5DB9A 1DTQA 5KFYA 4DSJA 2R8IA 2C28A 4CFDA 1VSEA 3V1RA 4CGHA 5KFRA 5J0XA 4XA5A 1YTUA 3O4NA 4M3WA 3RMBA 1ZQDA 5J0PA 4M9HA 2I5JA 3DRSA 4TUSA 7ICLA 2BHNA 4CF8A 1Q8IA 2XY8A 3Q8LA 4F5OA 3PR4A 1KVAA 1ASWA 4KRFA 3LPTA 4MF2A 3RR7A 3SPYA 1TKZA 4DL6A 4KLJA 1X2IA 4IQTA 2O4IA 4RUCA 4AHSA 3TAEA 4DQSA 3DYAA 4C8MA 2Q0ZX 5EOZA 2ISPA 2OZMA 4Q44A 4K8XA 3V9WA 5KT7A 1ZQSA 5HRNA 4Q45A 4R8UA 4CEAA 3LP3A 4CJUA 4DU1A 1BQNA 1LAWA 2ZJ8A 2J6SA 2YV0X 2DFHA 3KHGA 3S3MA 3C6UA 3BQ1A 2BGGA 3DLKA 4BDZA 3O3GA 3AA5X 1D5AA 4UB4A 1DGSA 4FM2A 3MAQA 4JLHA 1MSWD 1IG9A 3C5GA 1K1SA 3ORYA 2XRIA 4HCBA 3EPIA 3M8QA 2IS3A 5J0QA 2FBYA 1TK8A 2W9AA 4EBCA 2ZE2A 5FROA 1SKRA 4KLQA 1T03A 2QKBA 1QHTA 3GQCA 2HHWA 1RTIA 7ICGA 1ZBUA 3F73A 3MXIA 3P5JA 4DSEA 3KLEA 8ICVA 1VRTA 2AQ0A 2B6AA 4F4WA 4M6WB 4YFKA 7ICPA 3MGIA 4UB3A 3HWTA 2BQ3A 4KFBA 4O4GA 1VSMA 5KFFA 5DDMA 4CE9A 4CJ3A 4TUQA 1IKXA 3RRHA 4CJKA 1SL2A 3HJFA 5D46A 4YP3A 4FS2A 2QK9A 4DL3A 4KLFA 4YR2A 5C24A 8ICZA 1NOMA 4FVMA 3V9UA 1TV9A 1FXXA 2DPJA 1ZBIA 2ITGA 4CIEA 1COOA 2KFZA 2UVUA 3AVMA 4ECQA 3CFRA 5KFEA 4CK3A 4B08A 3TAFA 4GXIA 3THVA 3AV9A 3PW7A 4LD0A 3HXMA 3ULDA 3I0SA 4UAZA 5JS2A 3VQ7A 2BKEA 1TKDA 9ICNA 3KK1A 4Z6DA 3NCIA 1A5XA 4M41A 1JIHA 1WCLA 4GXKA 1HYZA 3Q8KA 2E6LA 9ICRA 4CJ5A 3LANA 5DG7A 3AVIA 4QZIA 2BPCA 4ECSA 2IC3A 4Z6CA 2BCVA 4I2HA 4CHYA 4PGQA 4GMJB 2JLEA 5KRTA 4YFUA 1ZQJA 2GBZA 2W42A 7ICFA 4I2IA 5J2EA 5J2BA 4O3PA 4QWAA 5HP1A 3UQ2A 1WAFA 1KVCA 4UBCA 1REVA 4AHTA 1WSGA 5HMMA 2X78A 4KN7A 5DG8A 2HHVA 4KKOA 3ZSOA 4I7FA 5CYMA 3JPPA 3TARA 1U48A 4DSLA 8ICBA 1KCFA 4KLGA 1JLBA 1U49A 3ZT4A 4PH5A 2XCPA 3UPQA 5JS1A 3T3FA 5HHHA 3JPSA 5J0RA 4P4MA 4IRKA 2X74A 5DB7A 3NH2A 3KHHA 3IG1A 4RQ4A 3OS1A 8ICHA 5HP4A 4B9SA 4KREA 4C8KA 1TV6A 2FBTA 8ICLA 2W8KA 4OPJA 2XC9A 4RQ1A 1LWEA 4DSFA 3KIOA 5J2KA 5DQGA 3T5JA 4M0AA 1UA1A 1BCOA 5DK5A 5KGWA 1U47A 5J2QA 1BPDA 4M3XA 1KLNA 3ZSXA 2YNHA 3HP9A 3TAGA 4YG2A 1G15A 2IBKA 1DLOA 3AVKA 4Z4CA 4B9LA 1WN7A 2HNDA 3HYFA 3CM5A 4DEZA 4I9QA 4ECYA 1RYSA 4RQ0A 2DFFA 5D3GA 9ICLA 3MEDA 1ZQRA 4IG3A 3E2EA 3OS2A 2LSNA 4CGDA 4WE1A 4F2SA 4PWDA 2VA3A 4FK4A 3HW8A 3M9OB 4EBEA 2HVHA 1DOQA 4E7JA 3PW0A 4RUAA 1S0NA 4DFMA 1NJZA 1VSFA 2R7YA 4E7IA 1WAJA 4CHZA 3SQ4A 4RNOA 2YKNA 3KLFA 1XSNA 5KFBA 1TKXA 2ZUCA 3V72A 3G6YA 3SUOA 4HCCA 1XI1A 3K75D 4OKEA 3QEPA 5KG4A 1UT5A 5EWGA 1C1BA 3ZSQA 1FKOA 4UBBA 3HPGA 3DLHA 4IFYA 4FXDA 2Z1IA 3HX0A 2BCRA 1QSYA 1JLQA 1N48A 4KO0A 1ZJMA 3C95A 3PX6A 2YKMA 3V9ZA 3DLEA 3OYGA 1TKTA 3OS0A 4HVJA 2QKKA 1CXQA 9ICOA 4PPXA 5J0OA 5HROA 4ELUA 2EHGA 4CHNA 4GC6A 3ZDEA 4XIUA 3LAKA 3L8BA 4F4KA 4BWMA 3DI6A 1T05A 2W8LA 4F8RA 3V7KA 4DOAA 2IHMA 4O0IA 3WNFA 3B6PA 1JXEA 3C2LA 1XSLA 1VSKA 1RDAA 4YD1A 4NCAA 1Z00A 4CJPA 3T1AA 5IIMA 3NHGA 4RQ5A 8ICPA 2Y1JA 8ICIA 5J2GA 2G8VA 4HHTA 3D0PA 1UT8A 2FLPA 1BI4A 3ZSWA 5F9NA 4M3YA 1RBUA 8ICNA 5J2JA 1TAQA 3ZDBA 4GVMA 1SL1A 2Q3SA 4FW2A 1IM4A 2JEFA 3OYCA 2BPGA 2Z1GA 3PVXA 3MR2A 4IQVA 4DMNA 5CP2A 4NM1A 4JWNA 4M9NA 9ICXA 3AO2A 3QNNA 2FMSA 4RW6A 4E7KA 5KTQA 1T3NA 3K5LA 4B9NA 1BPZA 1A76A 4J9OA 3ETLA 3TANA 3RJIA 3B0XA 5DBAA 1MU2A 4E19A 3QE9Y 2KW4A 1ZBFA 2PI4A 1C0MA 3AO5A 4CJQA 3ZT2A 2C2DA 5J29A 1L3VA 2MUTA 2ATQA 1RXWA 4M42A 4RW7A 2NRXA 4F3OA 1WSFA 5J1EA 3VQ4A 4OPKA 1ZBHA 5C25A 4L8RB 3OYFA 2ZTEA 4LH5A 3LZJA 4K8ZA 5FRMA 1EKEA 3C21A 3V9XA 4KI6A 3OYJA 7ICUA 9ICGA 1NK8A 4XRHA 2HVIA 3MECA 8ICYA 1BPYA 1RT1A 2G8FA 2YHAA 9ICHA 4DOCA 4DU4A 5KI6A 5HMLA 1IKYA 9ICJA 3UXNA 3V6HA 4C8OA 3H8WA 5J0YA 2NUBA 3NAEA 4DQIA 3DLBA 3S9HA 5KFUA 1XS9D 2QXFA 3OYKA 2RF2A 3NGZA 4O5CA 4N5SA 3MXMA 7ICHA 1CLQA 2BQUA 1KFSA 1ZQAA 4KAZA 2ASDA 5IIJA 4PHPA 1T8EA 1RT6A 1CUKA 2KZZA 3NFAA 1S1UA 2E6MA 3V1QA 4HYKA 3IS9A 1S9EA 3M8SA 1CZ9A 3C5FA 5J2NA 1HNIA 4Z4FA 1ITGA 1A5VA 4QWBA 3NF8A 3DOLA 4FZXC 2KZ3A 2GV9A 3RB4A 2FMPA 4AHUA 3KTQA 5EWEA 1BCMA 1C1CA 3L3UA 3HK2A 5CWRA 3CG7A 2BCSA 1ZQGA 4M47A 2F1IA 4TQSA 3V6DA 4FJ9A 3PW4A 4E89A 4E1MA 5DDYA 1HPZA 3U3GA 4I2GA 3K2PA 3NE6A 1KFDA 4GXJA 3AA2A 3U3YA 4O3QA 3N4MB 4ED2A 4O3OA 5IILA 4AILC 4NLGA 1MQ3A 3QEBZ 2Y1IA 1HJRA 1SV5A 3ZSVA 4DTOA 1K6YA 5CJ7A 1QS4A 1UOCA 4YXJA 3EZ5A 3H8SA 9ICKA 3VQ6A 1KSPA 4I2JA 3I0RA 3LK9A 4DLGA 1KRPA 1XC9A 3EPGA 4BXOB 3SQ2A 2FPLA 4RQ3A 7ICQA 4F3TA 4M3RA 2PY5A 4QW8A 4B9UA 3O3FA 3OSPA 3QZ8A 4UAYA 2PXIA 4CJSA 1FK9A 5J2FA 2AGPA 3OGUA 7ICNA 4C8NA 1D9FA 2WONA 1RBSA 3NH1A 2M9NA 3EW9A 4KPYA 3TWHA 2OPSA 4RQ8A 4QAGA 1NK0A 3SUQA 4KLLA 1S77D 1QLNA 4O5KA 4ED0A 4NCBA 3SUNA 4KLEA 4CHQA 2BCQA 2IA6A 1KEJA 4GW6A 1ZQEA 1QSSA 1ASUA 1PZNA 3OSNA 3GFKB 4JRPA 1U45A 2OZSA 2YNIA 4I29A 3C6TA 1HMVA 4W5TA 3ZSZA 2F96A 1NK7A 1XWLA 4ELTA 1WCNA 4JV2A 4CEFA 4DWIA 1NKEA 2YHBA 3C94A 4IQUA 4F50A 1GOCA 1N5YA 9ICQA 4ECZA 4MEXA 3V7JA 5KFJA 3FDSA 4RPYA 2G8HA 4IG0A 4E1NA 4KB1A 4DQRA 3VQQA 3AVNA 7ICIA 3DOKA 2D0BA 5CYQA 4P2HA 2JEGA 4HUGA 3LWMA 1J53A 5KFIA 3DRPA 4RW8A 1SUQA 3S3NA 1CZBA 4FM0A 8ICGA 8ICOA 1YVUA 1MQ2A 1H38A 4FBUA 2OYQA 2G8IA 3M9MB 3T5LA 3TQ1A 4MF8A 2W9CA 1JL2A 2BDPA 4QWDA 2ASJA 4QZ9A 1YTAA 1J5OA 3RJGA 1HQUA 1RILA 1NK6A 5J2CA 1UWBA 3NBPA 3MR5A 1NKCA 2RN2A 1IKWA 1TK5A 2FC0A 5KG6A 4FLTA 4FK0A 3SZ2A 4AHRA 1JMSA 2JZBB 2ZQBA 4MFFA 4KLTA 5T7BA 4TUPA 1Y88A 5DG9A 3PO5A 5C5JA 3DMJA 1S1VA 4F4YA 3H40A 1JKHA 1JN3A 4KI4A 4QZEA 3HM9A 4J2DA 3LP2A 3NH0A 2AU0A 3PV8A 4RPZA 4CFCA 4O0JA 4IRDA 4W5OA 1K1QA 4AHCA 3ALYA 4F92B 7ICEA 4M3UA 2B4JA 3L2VA 4K4IA 3RJEA 4DLEA 5KFPA 2YNGA 1KTQA 3M8RA 4JUZA 2Z1HA 3OYMA 1C7YA 5DB6A 3Q8QB 2MAXA 5CZ2A 4ED8A 3SNNA 5KGXA 4YMNA 5IIOA 1ZETA 5KFMA 4PUOA 9ICUA 3TFSA 4OLBA 4J9KA 4EZ6A 2XCAA 4F5PA 4FBTA 1FKPA 3JPRA 1YT3A 3OHAA 3OVNA 2R8HA 4JV1A 3OYAA 1NK5A 2V4QA 3RB3A 1NOZA 4RQ6A 1V9PA 3DLRA 4EEYA 2AGOA 3QEXA 8ICWA 3JSMA 2P51A 3AO1A 4DTNA 3G6XA 3RH6A 4KHSA 4IDKA 3KJVA 4CJ4A 4JV0A 3ZT1A 4K4HA 9ICAA 5J2HA 4GLXA 3ISCA 4J9PA 4TSXA 1RBTA 4CGJA 5KT2A 3OYDA 8ICUA 4PA1A 2XY7A 5J0UA 2EX3A 3AO4A 4KN4A 1HYVA 1RCHA 1TK0A 3BQTA 3AUOA 3SQ0A 4RNMA 4KLUA 3O3HA 2BE2A 4YN4A 1A77A 3EYZA 4O9MA 2VG5A 4W5NA 1NK9A 4I2AA 1RNHA 1C6VA 3V7LA 2IHNA 2G8KA 3PR5B 1KFTA 1BVSA 3LDSA 8ICFA 2O4GA 4PHDA 5DQIA 5CA7A 4UB1A 7ICMA 4I2DA 1WSIA 4CGIA 3AVLA 3WNEA 4DTSA 1ZQMA 4NLKA 1WSJA 7ICSA 1X9MA 1ZQKA 1ZQVA 3Q8PB 3TABA 5L1JA 3QEWA 1QQCA 3Q8RB 4FJ7A 2RKIA 4CFAA 4MQ3A 2BPFA 2ZJ5A 4JWMA 3HL8A 3ZSRA 4LSNA 1S6PA 3NF6A 3C1YA 1SKSA 4F5QA 4J2BA 4Z4EA 1BL3A 1QSLA 3TAPA 1VSHA 4FK2A 3CYMA 4R66A 3KKRA 4QWCA 1J9AA 4ECTA 2ASLA 5KG7A 1LWFA 3VQ5A 3FYHA 1BGXT 3VQPA 2OWOA 3PUFA 1VSJA 4FJKA 1ZQBA 9ICWA 1RT3A 4DS4A 4FLYA 3NF9A 1CEZA 2F1HA 4LY7A 3MXJA 3S3OA 5CB1A 4DFPA 5HRSA 1KDHA 1GOAA 2VA2A 4OGEA 3H7IA 3K59A 3C2MA 3GIIA 4I27A 3PMLA 1S6QA 1KLMA 2ZUBA 4NLZA 7ICOA 4CECA 1JLEA 3LWLA 2XHBA 5I42A 1QTMA 4FYDA 1RXVA 4M9GA 4FCYA 1S0OA 3IAYA 1S76D 4RQ7A 2WTFA 8ICJA 1ZQLA 3NGDA 4IFVA 4KB0A 3IM1A 4O5BA 2G8WA 4FLVA 4JRQA 1X9SA 5KFZA 4DFKA 3DRRA 2A1JA 4CEOA 1BI4B 2OPRA 3MEEA 5BPCA 3PMNA 2PFPA 1UAXA 4M3ZA 1IXRA 4I2QA 2RDJA 3MFHA 3ZSYA 3RR8A 4QZHA 1IKVA 1LW2A 3RMCA 4FJ5A 1ZQNA 3RH5A 4F5NA 3LZIA 4QZFA 1RBRA 4LVSA 3KD1E 5KFWA 1HYSA 4CJEA 1CXUA 2D0CA 3JYTA 4KHQA 1W0HA 3QERA 3QETA 3M8PA 4J9LA 1C0UA 4RU9A 4YNQA 4Q5VA 4DQPA 4YMMA 4HUFA 2PFOA 4FJMA 1RT5A 4EYHB 3ZDCA 3MEGA 4I2FA 2FLNA 4ZH4A 5IINA 1TL1A 4KMUA 5DGBA 2MUTB 1B9DA 3HVTA 1BQMA 3A2FA 4NLNA 3SJJA 7ICKA 3VQ8A 1ZQYA 3KHRA 1B9FA 4K4GA 3AA4A 4QZDA 4BWJA 3BJYA 3GIJA 3NDKA 2WOMA 2F8SA 4Z4IA 1JLGA 3N97B 5BOLA 1BIUA 4FLWA 3ZT0A 3LP1A 5KT4A 4LSLA 4ECRA 4JS4A 2HB5A 2E4LA 1D8LA 3HT3A 2W9BA 3V81A 1LWCA 1WSEA 1I3AA 2J6UA 1RT2A
chains in the Genus database with same CATH superfamily
1JXLA 3LF0A 2YHYA 2GCFA 1Z26A 1O13A 3BO4A 5AQUA 3SV3A 2XY6A 2VFSA 1JROA 3JTOA 3AVFA 4KITB 4M5LA 3UN5A 1S1UB 3ONQA 5AFUH 2VBZA 4BR7A 3L3VA 4K4XA 4YOXA 2ZVIA 5J2NB 2UXCF 3KFUF 1XC3A 2WHEA 1N8RO 4RNNA 2HAFA 1QE1A 3JSBA 5IC6B 3VESA 2BJ8A 2QI2A 3D45A 3CM6A 3VF6A 2DHHA 2A6AA 3HM8A 1Q9YA 2DY4A 3KVGA 1UL3A 4FZZA 1Y0HA 5DBCA 1JI7A 4AYBC 3H3OB 1HPZB 3IRWP 2J8AA 4A5BA 2EVZA 1DGKN 3NGRA 2PFQA 4NY8A 4QZGA 1O08A 1HI0P 4F2RA 6AT1B 4BRKA 3V9SA 1FWKA 2NPFA 5JUMA 4JKEA 2HURA 3T5KA 1Q82O 4BHQA 2YKAA 2JJ4D 2I9GA 3QEVA 5AQLA 2ZTDA 1GOBA 5L8RC 2W4CA 2QKQA 5AI4A 1EETA 3DDHA 3UCUP 3H7HB 2XYGB 2GHPA 3OV7A 4G9BA 1B43A 2VANA 3U6FA 1C1AA 2Q97A 4ZDNA 3JPQA 2I38A 1QUPA 2YMLA 4ANEA 1NO8A 3P39A 2EKYA 3N0VA 3P96A 4QIGA 1K8AT 3CFOA 5AQOA 1Z4OA 1XHXA 2IMWP 4DSKA 1U2VB 3H4DA 4NEYA 2YN4A 4C0HA 3DRSB 3TU5A 5KFHA 9ICBA 3N9UC 1VQKN 4F93B 4K2XA 2XM3A 5IT9O 3HOSA 2YJFA 3LA0A 2NRHA 4YQWA 3H8YA 1DRGA 5BYSA 4FM1A 3KG4A 3NKYA 1P9YA 5CEHA 1FA0A 4FZYA 4FJIA 2FDNA 4YCXA 2WAQF 2RU9A 5JLHA 3UFCX 4AQYF 3EXYA 3CCUN 4PY5A 2MKYA 2BACA 4PZNA 2NLWA 3BGUA 3CJ8A 3TAMA 2JWNA 4QU7A 5L9XA 4YR3A 1S6UA 3HZGA 1NJIT 4ZPAA 2E2NA 2YNIB 4B8AB 3H45C 2ZBPA 4LZGA 7ICJA 4FW1A 2BV3A 4ELVA 2IM2A 4PQUA 4Z37A 4H5TA 4ZHRA 2G07A 2OM6A 4TY8B 4CF3A 3C7NB 2WW8A 2JFKA 3VEYA 4A8OA 1VBYA 2Z2YB 2CPIA 3QO9A 4C3MA 4CO1A 2DRBA 5F1XA 1S72N 2H54B 1Q81T 4KHYA 4Q8FA 9ICIA 4ZITA 4IH7A 1RAFB 4FPAA 3OYBA 3HPOA 3PSTA 4Q7AA 2GVZB 5ALNA 3M8QB 3G86A 4OVLA 3DRPB 5AQZA 2ILYA 3TSUA 2MEWA 1X8DA 4IR1A 3CRXA 3QX7A 3NGYA 3R7SB 4TN2A 4BRGA 2G1HA 3KLEB 4X66F 1PYSB 3KUGA 8ICRA 4ENOA 4DUZJ 2RS8A 4FVCA 3KDOA 1RG6A 4F7VA 3WQUA 1ZXIA 3T6JA 4LF5K 4CIFA 1RWPB 4KHMA 4F9OA 1U4BA 2QLXA 2AGQA 2R7SA 1SH0A 3FC9A 1PUZA 4UAWA 1NGBA 5IIIA 4G6VB 3W2WA 4K4VA 1SZ2A 3ZD8A 1KBUA 1IH7A 5JRTA 1WC3A 4USVA 5EXWA 4LF2A 3CD7A 2D1KA 2MTLA 5M2UA 2CNNB 2PZSA 2C22A 5C10A 2IVPA 4DO9A 1A7GE 1RK8A 2XI3A 3CC4S 3Q8MA 1TAMA 3BGOP 1CI4A 1R0AA 4C4TA 3CC2N 5E3PA 3BZKA 3NAHA 4IKFA 3AU2A 4M94A 1RLCL 3CJ5A 4J9MA 4FO6A 3H3NO 4FL9A 1RCXB 5EWFA 3FR0A 2CQPA 3CJSA 4CLWA 3CFPA 3U1LA 1YJNN 2CPEA 1NHKL 4BCAA 3PW5A 2DGZA 3E01A 4JI4J 2YNGB 5DDPC 3C14B 5U47A 1J27A 3HVRA 4CZLA 1VQ8S 4NM2A 3QDKA 1LOUA 4BE2A 2Q43A 4YOTA 2G0JA 3BGLA 4KLSA 4HUEA 3QESA 1NZPA 1C0FA 1UA0A 4WQ4A 2BJ7A 1N6QA 4RW4A 4IO9Q 2LHTA 1UZHA 1PKUA 2HHUA 3EL2A 4CZMA 2VA8A 3NOGA 3GV7B 4DFJA 1EAYC 1SWVA 5KAIU 4J8FA 3AH6A 4FLXA 2IDLA 1UVNA 2QA4N 4FVUA 1NDLA 4CBXA 2E5IA 2KJ9A 2QB0B 3GG1A 1TL3A 5AJ3J 1YVNA 4DUZF 5KFTA 3E3XA 2QSWA 3AVBA 3I4PA 3P5BP 1UJ5A 3W0LA 2P9IB 3CP8A 3CQ8A 3M1VB 2V34A 4O3SA 1LCUA 1VSLA 2QLWA 1KEKA 3BKUA 2R8JA 3FSYA 4DU3A 1YRXA 2HQCA 4XH4A 4M95A 3U1NA 1ZXOA 1S0MA 2GJ2A 1RA7A 1FWPA 1U8WA 3AD8C 4CW7B 3J80U 1NGDA 2V8PA 3IA0A 1UQVA 3B54A 4C8LA 1KQFB 1H7XA 1OYDA 2LXFA 5F0XA 4CYUB 3M1FA 2JGUA 3W60A 4JS5A 2XNQA 2QC3A 1ZBSA 2XQCA 4I69A 3A12A 4AFFA 4CHPA 3M2UB 5JTIA 4BX9C 1WHYA 1MROB 1S6PB 1GMVA 5BPNA 3TI0A 3CJ9A 4MN4C 1A0OB 4JI4F 2MZSA 2G8UA 2V0NA 2YKNB 3RH4A 2PA8D 3HI9A 4IR9A 2B5JA 1FJ7A 2A1BA 1CJKA 3AJDA 1CJVB 5DDOC 2BANA 3FMWA 3TX8A 1YZ7A 4F71A 5T14A 3ZX3A 2FB0A 2FHKA 3MGHA 4ZTFA 1V97A 4WK3A 4DG1A 3EWAA 3NL0A 3SPZA 4NZ7A 5J1PA 1NK4A 4X4OA 3AVHA 2B4VA 3R5DA 5IM0B 4OJGA 1HJPA 4B17A 5D6GA 2YHXA 4FOIA 3F41A 3VN5A 3THYB 3PY8A 3MCSA 1NWKA 5BPLA 5I42B 3SSSA 4KTWA 2QYGA 1T6CA 2ZZNA 3MM8A 3NTUA 4RT3A 3AAPA 5AM0A 1R8PA 1AZSB 3OYHA 5L1KA 1BA0A 2AW0A 3VGMA 2C2MB 5HO4A 5AJ3F 1CRXA 5LMNF 2VG6A 2R8GA 3QIOA 1L3SA 3ETMA 2A1JB 2JEJA 4EZ9A 4Y28C 3QNWB 1B64A 3K7RA 1L8OA 4ED6A 2D74B 1NB2A 3HPHA 1RWOB 1QZ5A 2M88A 1OH6A 2V94A 2I7PA 3NGIA 4UOFA 2DPNA 2J4RA 3SD7A 1EXQA 3QT5A 4XDDA 5ETTA 4ISEA 2MQ8A 3ISDA 2DPIA 4B3MJ 3VR1A 4IRCA 4I28A 4URSA 4IXCA 2IAJA 2C3OA 5HNKA 2IRUA 1CSJA 2E7VA 1SV0C 4Y0FA 1M1KT 1TL1B 4TYAA 2ZH2A 2FMQA 2F44A 4Y2MA 3TOQA 1S9FA 2ZVSA 1KAXA 4DR1J 1JALA 3CMEN 2IDOA 1OS5A 2QA1A 4KHUA 1BLUA 1YBTA 4CGGA 2PDAA 4OYPA 1RDDA 1Y64A 4JK1A 4M7YA 1WHVA 3OYNA 2WOMB 4DR5K 3D3CJ 2W1BA 2KB2A 1IV8A 1RTDA 3AAQA 8ATCB 3NCQA 1JLGB 2V8DA 4WP3A 2OO4A 4H8KA 1ZTTA 3C6AA 2HHXA 3QNMA 2A40A 3LP1B 3G25A 2HHHK 2E1FA 5A8KB 4ZVHA 1KQKA 5KOWA 4H5RA 2G0CA 3RMAA 2LMRA 4KBOA 3SQ1A 4B9VA 3PFEA 1RTJA 3I6PA 1LWCB 2HVZA 4PG6A 4OX7A 4H5VA 1RT1B 2DL0A 3SI6A 1YHQN 3K8VA 2UUCK 2YKQA 5J0TA 2KEYA 4AP9A 3G8QA 1NM2A 4RT2A 2AZ1A 2UUBJ 2EG1A 4L3NA 2D0AA 2K8BB 1AYEA 2FSKA 2DGOA 4DL7A 2P9EA 4CESA 3G82A 3KLGA 1RAAB 3SMVA 4J9QA 4ILJA 2DKZA 3P31A 4DTMA 2DITA 3IS9B 3RJJA 1VRUA 2OPQA 2MRLA 2RLTA 2QEXS 1FD2A 2DTUA 1M0SA 4TKTA 5GMDA 4M5IA 4IBNA 2XIDA 4CGZA 3G8SA 3HKZD 2XLKA 5L1IA 4ZK7M 3O9UA 3D2EB 1NGCA 2QARB 4BGDA 3DM2A 5FDLA 3HFVA 4H0OA 4BDYA 4UB6U 3FBEA 2OHFA 4DF8A 5C12A 3WUHA 1T3OA 2WB1D 3O6QA 1S0VA 5D0GA 5DKWA 3RF9A 1G6BA 1VS3A 4J9RA 3W5XA 3MFIA 1AROP 4FJ8A 2NRWA 4Z7YA 4FWRA 2CZ9A 2GOLA 5KFQA 4E0DA 4PYDA 3NS5A 4DR1F 3DXMB 1ZQTA 5JU5A 4P73A 2MHEA 3LQVA 3FFIB 1ZTWA 4W5RA 4ZOHC 1OVQA 3H6EA 2F1JA 2AHOB 2KK0A 3MUMP 4BE1A 2VQEK 3EY1A 4P4PA 1K73T 2EBGA 1OJ4A 4DOBA 5KG0A 5J2IA 4DN9A 5CZVA 1YJVA 3QUQA 2IOCA 3KD5E 2KKVA 1VOMA 1X3NA 4LVOP 2ZHOA 4B3OA 4A8YA 3E66A 1H2TZ 3B9JA 5F0WA 1ICEB 2X51A 3E9OA 2R2SA 4YD2A 1JUDA 2K8AA 3UN2A 2JDJA 3WKBA 2CXEA 2UUBF 3GPAA 5MAOA 4DU7A 2UYTA 1V4SA 1VQOS 4G1QB 4LR8A 2LI6A 1YTUA 5ALXA 2ADBA 2ZJRQ 4O4RA 1ZQDA 4M9HA 1YIJS 3DRSA 3L3CA 1WC6A 1KOHA 3MWTA 4OYWA 3G71N 3WK7A 3NRBA 4WYLA 2XY8A 3Q8LA 4F5OA 1ASWA 2IRYA 4MF2A 1YITN 2XYHB 3SPYA 2WMMA 2AD9A 4DL6A 1X2IA 4DBQA 4DV0K 4HHUA 4C11A 4FE3A 4RUCA 2GNKA 3TAEA 1Z4UA 2CJAA 2R18A 4DQSA 2QTDA 2GHVC 4EFHA 1IR2A 3O3LA 4BUGA 1B4SA 1RHKB 5I3UB 2ISPA 4Q44A 4K8XA 4QR0A 2U2FA 3LP3A 4CJUA 2D3ZA 2ZJ8A 3KHGA 1P9QC 2FPHX 4PPZA 4NZ6A 4AUKA 1EARA 2OEJA 4TY8A 4IUFA 5I9EB 2BGGA 3O3GA 3AA5X 3C7NA 1DGSA 1N0VC 1PVPA 5EE9A 1CJTA 1QH9A 2IIHA 4JLHA 4BS2A 3VMFB 1IG9A 1K1SA 4K7QA 2GVZA 3M8QA 2XSJA 1TL5A 3H90A 4KSEB 4P72A 3FBCA 2WSFC 1TUGB 2VIHA 3P5JA 4GV6A 1GNKA 3KLEA 2GO9A 1GXTA 1WOQA 3W5ZA 4F4WA 1H7WA 3QBCA 2YXLA 1HHTP 3THWB 4IO9L 3FCHA 2UUAK 1J5EK 5HMYA 5AKXA 2OSRA 5ETLA 2IMOA 2P9UA 5GVQA 4DB3A 4AXIA 5J8YC 5HMXA 4DL3A 5C24A 2YWEA 5H9FK 2O8EB 7FDRA 4CLSA 1YJ9N 2VKZG 2R42A 1P1TA 3NGUA 1COOA 2WZ1A 2NO5A 2KFZA 1OKJA 4DX7A 5KFEA 4BQLA 2HHPA 1U25A 4B08A 4GXIA 1F9HA 3AV9A 1Z05A 3PW7A 4LD0A 3SMSA 4OLOA 4DHVA 5CAAA 3MCOA 3N7PD 5M1KA 2V2ZA 2A1AA 1UETA 2XLJA 4WJ3B 1CBKA 2PMZC 2AEJA 3NCIA 1VQ7S 1F3VA 4IOBA 4HAIA 4GXKA 2CWXA 2B4OA 3NMUA 2EC2A 3D6MB 2MLZA 3LANA 4PG7A 2HEKA 3AJ1A 4Z6CA 4H4MB 5D0HA 1HWKA 2GWJA 3TPQA 4NA1A 2W42A 3U26A 2JLGA 3D4JA 2W01A 4U95A 4QWAA 1N36K 1X4GA 3R6LB 3UQ2A 3CXCR 2DGXA 1AXQA 2FJDB 3Q2SC 2KVCA 1FRHA 2X78A 4KN7A 1RYUA 5DG8A 1Z4NA 2HHVA 4M5GA 1YRUA 1Y3JA 8ICBA 1KCFA 2L41A 2ZIXB 4RW9B 3UDCA 4X4TA 3R7BB 4CD1A 3KOOA 3T3FA 1FRJA 3K9KA 5J0RA 4P4MA 2QB0A 3VGSA 2W04A 3CQXA 1EB0A 3OS1A 4OV1A 4KREA 4C8KA 2ZZTA 8ICLA 3KKAA 2ZXHA 4OPJA 3M1VA 3D7SB 4OQJA 4RQ1A 1LWEA 4DSFA 1RTHB 4PKDB 1U1PA 4GV9A 3T5JA 4RNFA 1BCOA 1BPDA 4PWWA 2Z4PA 1R6YA 2B9XA 2BTFA 3HP9A 3TAGA 2OXOA 4LSNB 1H74A 1ZH5A 5D4NA 3QRQA 3KFWX 4CWBA 1WN7A 2G2OA 3IWNC 3GG4A 3L09A 3QAEA 3FE1A 4I9QA 2JHDA 1H72C 3VAJA 2RDDA 2DFFA 5J2MB 1LWFB 2ZITA 4BRQA 4H0YB 3CCMS 1XR5A 3CCZA 2RHQB 3MEDA 4OI3A 3IFRA 5DO2A 2DVIA 3E2EA 1X0FA 2WBNA 4F2SA 1QVFR 3QIPB 5L9NA 5H9EK 2G4BA 1HUXA 4EBEA 4LRCA 3KZIU 4E7JA 1ZA2B 4RUAA 1HW9A 1MROA 4TLRA 2R7YA 5EX3A 1C2PA 5HVHA 4CHZA 3SQ4A 2YKNA 3L95X 2PGCA 1KLMB 5ALJA 2ZUCA 5ALKA 3CJAA 2KRRA 1CJVA 4OI4A 5CABA 2RILA 2ZFHA 5DDQC 1IN0A 1UAWA 4F3MA 4OKEA 3QEPA 4K50A 1UT5A 4M5NA 1Q1KA 1FKOA 3W9HA 2E2OA 2FF6A 4DUYJ 5B5EU 3BV8A 1HEKA 3C29A 2BCRA 1QSYA 3MEEB 4WJBA 1Q86T 5IM0A 4RU2A 1SC6A 2CH5A 3O1BA 1LW2B 2H5EA 3OYGA 4QIWD 4LF8K 3CI5A 4HVJA 3TEHB 4B02A 9ICOA 3OL7A 4WBFA 3H5YA 1AZSA 1JLFB 4XIUA 4BWMA 3DI6A 2W8LA 3V7KA 2IHMA 2MJNA 4J9VA 3WNFA 4YD1A 4NCAA 4YB7A 2HPUA 1Q78A 5ALQA 4RQ5A 5KQDA 1IQTA 5J2GA 2G8VA 4IQXA 1FFWB 1RBUA 4WK1A 4IS7A 3UE2A 1TAQA 1X40A 4YMEA 5D4PA 5JMNA 2GMLA 1M5PC 1SL1A 4BC3A 4KIAA 4P0PB 1QM9A 1H98A 2JEFA 4OZNA 5GAGU 3MR2A 4V19J 4LFAK 4K43A 5CP2A 2EC0A 1KC8O 3E9PA 4E7KA 4I0WA 5KTQA 2HKEA 2GX8A 4UW9A 2F76X 5ALWA 2MZ1A 2G5IB 1BPZA 4FKYA 1A76A 2XULA 3ETLA 5FIIA 4XAKA 3KMSA 1TUYA 5DBAA 2B7CB 4QS7A 4NB4A 3CWJA 4JKBA 3CJKB 3QE9Y 3V81B 1RJJA 1NHVA 5D4OA 1RU2A 3F5EA 5J29A 1L3VA 2MUTA 2W6KA 4RW7A 4NLPA 2NRXA 4F3OA 1TYQB 2YMMA 3ED5A 3VALA 3F5AA 4L8RB 4WZQA 2YX4A 4WIIA 3OYFA 2H65B 4MH8A 4OHVA 5AQSA 3TVKA 1YQHA 4DV1F 1BMQB 2VGNA 3C21A 4DUYF 2XS2A 4L73A 5C42B 3EE3A 4XRHA 3MECA 1N54B 3CJTA 1RT1A 1QY7A 2D4WA 9ICHA 4DOCA 2X1BA 5KI6A 3BS7A 2DGVA 5HMLA 4N77A 2YY6A 3N5FA 9ICJA 3KG1A 1RACB 2FZKB 1CZAN 4NA3A 3D1OA 3NAEA 2H3QA 4ZVUB 5KFUA 2LQJA 1ZAWA 3W9IA 3MDQA 2FJAB 2Z57B 3QSYB 4YEAA 3BS5B 7ICHA 5IT9Y 1UPPA 2ZDPA 4KAZA 5IIJA 3AFGA 5LSOA 1K44A 3NFAA 2IOFK 4HYKA 2ZUAA 3IS9A 1S9EA 1CZ9A 1RE1B 5G0RA 1SZHA 2FC8A 1HNIA 5F0UA 3T9ZA 4FZXC 2FMPA 3KTQA 3L3UA 2DEIA 3HK2A 1NNDA 5AI6A 2R7RA 2BCSA 2QWOA 3OFEA 1Q46A 4OHWA 2IA0A 2ZJRL 1VDVA 1ZAXA 1SQFA 5HBMB 5DDYA 1BWFO 4DV0J 3NE6A 1KFDA 3LVVA 2DR5A 2CGKA 3WXKA 3U3YA 3AA2A 3QJPA 2QLFB 4O3OA 4AILC 4ED4A 2DGUA 3QEBZ 3CNQP 1JWWA 3BS9A 3DXMA 3PG9A 3HILA 1DTQB 4L3QA 3H8SA 9ICKA 4C8ZA 2LYVA 3DOMA 3I1YA 1V4TA 4WU3A 2BBEA 4TLQA 1XC9A 3EPGA 2ZZMA 2CQHA 3TVZA 1S22A 5GAHU 1X4FA 1YAGA 2CFXA 3OTOJ 1RBAA 4NLTA 5KPZA 3QRRA 2NSCA 3OSPA 2WBMA 3WKEA 3QZ8A 2O67A 1DURA 4NL5A 1HBNB 3FKBA 2RRDA 2Q1NA 3IR7B 3ULEB 4DV5K 1EO1A 1S77D 2U1AA 2AP6A 4ED0A 4CHQA 2CYYA 2FYXA 3L7UA 2E1YA 1GAOA 2MMYA 1U45A 2N3OA 1N4LA 2VDIA 2FJVA 1XNRF 1YLXA 2KJWA 3C6TA 3OQ2A 1HMVA 2BKOA 4G1PA 1VK3A 4F0MA 4BR2A 1XWLA 4I6YA 1WCNA 2J8SA 2F77X 1XQSC 3C94A 5H1SQ 2JSXA 3N4PA 2W40A 4RPYA 4ZLJA 4ZCIA 5TKYA 4E1NA 2PMWA 1BQXA 1BUPA 3FGUA 3AVNA 1W2BM 4W90B 1E4FT 2H3ZA 4J5OA 3FC4A 3L3FX 4RW8A 3S3NA 4IJAA 4BGBA 1U0HB 4M5JA 1RI7A 1UPMB 2CVIA 1YVUA 5IWAJ 3SAFA 2OYQA 4B3RK 4L3KA 3CD0A 2HIQA 3FVYA 4QWDA 3NNHA 4OLPA 2IYGA 1O51A 5B09A 3M6VA 1VQKS 3RJGA 3GSIA 3A0BU 4BC4A 4WFXA 3ELHA 2OAUA 5AI8A 3CXCM 5K9FA 4ED5A 3QUBA 3MR5A 4HH0A 3TRGA 3VEWA 1TK5A 1H6KX 4DFDA 2DF4B 4F04B 2OPPB 3F2KA 5I4MA 4AHRA 2NV3A 2DHSA 3CCUS 2JZBB 2FSNA 2CQIA 3ISZA 2M52A 5C5JA 2G0AA 2I9SA 3NCPA 4CZFA 3OTOF 3S1TA 3R8YA 3H40A 4M63C 4JV5K 3GU0A 4KI4A 4J2DA 1Y5NB 1XMBA 2W43A 1FFSB 3IGNA 2BOAA 4RPZA 4H0VB 5E7OB 4O0JA 1XNSA 2O8EA 2Z0GA 4W5OA 1S72S 1VLBA 4GVEA 7ICEA 4K4IA 4Y2VA 2RMLA 3Q89A 5HP1B 4DR4J 4FPBA 1U6FA 4JUZA 2D9PA 4UY8T 4UY85 3OYMA 1C7YA 3C16A 2MAXA 2O01C 5CZ2A 1SQEA 2DUYA 3SNNA 1HFEL 1Y4ZB 3C15A 3D5MA 4NL9C 5JJBA 4KKOB 2BEFA 1F5AA 4GRSA 5KFMA 4PUOA 3O08A 2CH6A 2XCAA 5GINA 3SEOA 4F5PA 3JPRA 3OHAA 3OVNA 2R8HA 3M2RB 1TUWA 4JV1A 5E26A 1RWKB 1W25A 2Y3YA 4C80A 4U7BA 1QVFM 2YX8A 3T9NA 3QEXA 3AL0B 2P51A 2Z8QA 4DTNA 3QMLA 3RH6A 2OFGX 5IWAF 5H9EJ 4KHSA 1NMDA 1VQ9N 4CJ4A 3BBCA 4J9PA 2A5XA 4UARA 5C2GA 1RBTA 5KT2A 5J2QB 5AKZA 5LMUJ 3EKSA 2KFYA 2CPJA 4KN4A 1RCHA 1DLOB 1FRXA 1FDBA 3BQTA 1IG6A 2B4PA 3ZI4A 4JD2B 1A77A 3VCBA 4QU6A 2KHOA 4AF1A 4CLUA 5GAGI 2AXTU 2E8PA 3V7LA 2IHNA 3PR5B 1YJNS 5ADZA 4PL7A 2KKZA 3NS1A 2W2OP 3BPDA 1LOTB 8ICFA 3QLHB 1SPBP 3KK2B 5D3GB 7ICMA 1WSIA 4I2DA 2AJFE 5B0AA 5DM7Q 4DTSA 1ZQMA 4WE1B 4M7XA 2LP4A 1JJ2R 1X9MA 1ZQKA 4K25A 2OSQA 4YS2A 5L1JA 3H1VX 1QQCA 4BC2A 2WSCC 1XMQK 1RUSA 2VFRA 3G96A 4JWMA 3QYYA 5EX0A 4Y0WA 2VL1A 4LSNA 5GAGP 1SQGA 2WB4A 1VHFA 4Y2CA 1PIEA 3AAWB 3H42A 3IP0A 4MIAA 1QSLA 3RSEB 4RUHA 3WK8A 3L4QA 3TAPA 1T9TA 4DR4F 2APOA 3KKRA 4QWCA 4ECTA 1AA1B 1LWFA 3FYHA 3GBTA 3QT7A 2HGLA 1JLQB 2QA4S 5AQPA 4DV3J 4CLPA 3GJQB 9ICWA 3DV9A 1Q53A 4DS4A 4L74A 1MWMA 2YKMB 4FLYA 2BMBA 1CEZA 4LY7A 4CDIA 2KJ8A 2LYBA 2C2OB 3U9ZA 3S3OA 5CB1A 3AD7C 3FJ2A 3OR1B 1GOAA 2VPYB 3K59A 1KD1T 2D3DA 1IBKK 3S6EA 3DGVA 1KLMA 3HKZF 3IDHA 3LWLA 2XHBA 4M9GA 2WUSA 3IAYA 1S76D 2WTFA 4Y2SA 4U7CA 2YQ3A 4CO4A 2D3UA 2F8MA 4IFVA 3HSDA 3W8PA 4LR7A 3DDKA 2ABYA 1RDFA 2Y9HA 2PFDA 3I32A 2WB1F 3MEEA 2Y8WA 4P71A 2ZWHA 3I82A 4M3ZA 1NGEA 5LMUF 2PIIA 4HLBA 2E1EA 3ZSYA 1HI8A 2LBOA 1NPKA 2ZNYA 4QZHA 3D6TB 1IKVA 4PJ0U 2F4VK 1LW2A 2YWHA 3CJCA 4UQTA 2MQMA 2X1GA 1LXJA 4CJEA 2MQQA 3WX4A 2A41A 4P2XA 1U1RA 4KHQA 1W0HA 3QERA 2IRXA 4HTLA 3QETA 2VPWB 2ZBQA 2ZOGA 3KZBA 2OTJN 4YMMA 4QS9A 1HD0A 4DV7K 2YPZA 2FLNA 4JI1J 1X4AA 2CIMA 1Q81O 3BP8A 3U4LA 2XMJA 4DL0C 5DGBA 2BJEA 4NLNA 2GFFA 2OFHX 2LXIA 2LFVA 2G13A 1KQSR 1FFUA 4P0PA 3KHRA 4K4GA 3W62A 3ZX2A 4AT1B 5GAHI 3A8EA 3R8EA 4W4MA 4DV4J 4UUXA 1A0PA 4OYIA 4CI0B 5THWA 5E3QA 2DEJA 1U2RA 4USJC 1Q7YO 1DGJA 4DV3F 3UR0A 3KJQB 2IVFB 2M2BA 4NXMJ 3SENA 1FD8A 4LSLA 4X64F 4ECRA 1TMJA 1ZD3A 4JS4A 1EP4B 3CJKA 2W9BA 3V81A 2Q31A 3GYGA 1GMWA 2JGAA 3UPQA 1HKGA 1I3AA 2XMMA 2C2RA 4PHTX 2RF2B 2MZQA 3PYDA 3PYEA 1P7DA 3SCIE 2E44A 2F8LA 2EI5A 2NZTA 3BF3A 5GAHP 1JJ4A 4ISGA 1TYQA 2A3JA 4R5PB 2R9LA 5AZJB 4OIXA 1X4DA 4JI2K 4CJWA 2W03A 2EFOA 3D66A 1MN8A 4QZ8A 1KQQA 5F8NA 5HQLA 5A0YA 2IGIA 3RTVA 3R6GB 4O55A 1VCTA 1SXDA 3T19A 3VQDA 2I5HA 2AQ4A 1FIQA 1C1CB 5A8RA 3RBZA 4NE9C 5DDRC 2PYJA 2XY5A 4B1XB 1WJ9A 1WI8A 3ZLJA 1JQGA 2DHGA 2MGZB 1ZQOA 5KFOA 2ZH3A 3V6DB 4JK9A 1B0VA 4Z0UA 3VEZA 2H3EB 2KM8B 1PK1B 4FJNA 3THTA 1XHZA 4Y2JA 3ZZYA 3CMES 4R64A 3SAGA 2WTUA 3JPNA 2QIFA 4OMFG 3EZOA 2E1AA 2ALZA 3J7ZO 3VOVA 2ZM6K 1S1XA 1DQ9A 4BY9C 3HTVA 3LALA 5KT3A 2RJZA 4LF4K 4JI1F 3I56N 3CO0P 3R9KA 3P45B 2B8PA 2P5GA 5FRNA 1OVYA 1UCVA 2EQYA 5AICA 5JXSA 1YTYA 1HBUB 2QMXA 3EKUA 3PDNA 2AIRB 4WFZA 2YX1A 1PK3A 4DR2J 1YHQS 1VIOA 1VQMS 4KB7A 1XU4A 2KVSA 5DZ7A 2A1SA 2AYGA 4DTUA 5HBMA 4DV4F 3WQPA 5HHIA 3RBXA 3SSRA 2DGWA 3KUEA 4DV2J 1FK9B 3E8OA 2HK2A 4PAAA 3DC2A 4GVBB 3OY9A 1CS4B 4NXMF 1UVMA 3VA3A 2GGPB 2DR8A 1D1UA 2V50A 9ICVA 1NKBA 2G09A 3MCNA 4MHVA 1MNEA 2Q3PA 5D49A 2BJ3A 4IL6U 4LF9J 1Q8BA 1MW7A 4BE0A 3H0LB 3MOZA 1C4AA 4ZPTR 2WAQC 4R8UB 3V6JA 2ZOMA 3P4UB 4CF9A 1IR0A 1N5QA 4OI1A 1T6DA 2MKKA 2PI5A 2IDEA 4JKDA 4ILLA 2N1RA 1NB7A 3BUZB 4YXMA 3CERA 5BRHA 1KOOA 4LF7F 2JH1A 1SJ1A 3I31A 3R2CJ 3EZWA 4P75A 1HBNA 1VMBA 1OYEA 4C2MA 4M9JA 3ULEA 2MY8A 5CCLA 3TR8A 1HW8A 3MCPA 3UVJA 1SUQB 2W6LA 5KFCA 3KHLA 2YX6A 4AXJA 1RTIB 1VISA 2KQ2A 4JV5J 3ZYYX 4ZS6A 3M2VB 5G4DA 3IM8A 2HMIA 1S97A 3QINA 2W9CB 4CEBA 2GHWA 3HO1A 2NLXA 4NXZA 2W2QP 4B9TA 4LH4A 1K47A 1U1KA 5IZHA 2AJQA 3ZTPA 3AQPA 4KFBB 4NLVA 2YQ0A 1X9XA 1IKXB 2FJBB 4CLFA 2CQ2A 4H4KC 2ESEA 2K1RA 1UWBB 3NBPB 4CIGA 1Q3UA 1JCFA 3VENA 1IKWB 3C66A 1WLJA 1BU6O 1W2IA 1RDCA 4JK8A 2MY7A 1S5JA 2ACYA 2KFNA 4DR2F 3L2WA 1WSRA 4K4YA 1B92A 3PM9A 3FQKA 3H98A 3D2FB 1FTRA 1QQ7A 4X62K 5J0SA 4JMUA 4JI8F 3TFRA 3NGSA 2KN4A 4WQ5A 1F0MA 1QVGR 4DS5A 3MGJA 1NU4A 1RBVA 1X42A 3VWSA 4DV2F 1BDGA 3CDUA 1J2NA 1IO2A 2UVRA 5KFLA 4FLZA 4Q43A 4M6WA 2HW3A 1MWZA 4WFAQ 4JHDB 4MEYA 4ISFA 3FCVA 2MQOA 2F9TA 1RAJA 5CQGA 4R0EA 4H03B 1YITS 3Q8VA 4G3IA 3GZ7A 1ZM9A 3OJSA 1BIZA 5E41A 4USAA 2VQFJ 4LF9F 4K0KJ 2ODGA 2OPPA 3NVZA 5F8IA 5B0CA 3PRVA 2JZBA 1S1TA 2OIHA 1GLCG 5KG5A 4YOEA 1HWJA 2WCXA 4J7CA 2NUUG 4OJ6A 3G87A 1SC3B 2VASA 3WIUA 2OHDA 1NJWA 1U1NA 1M1KO 3MABA 3W5YA 3SQGB 1KN6A 5A0LA 3OYEA 1HUZA 4NLCA 4CF1A 3PRBA 3JTPA 3N79A 1C0TA 4UB2A 1JJ2M 2PT0A 4OJ3A 2YMQA 2MU2A 2F1FA 1VK0A 4ICAA 2UVWA 4CRJA 3K57A 1FW6A 3RGIA 4IDKB 4QIWF 5DM7L 3RVCA 5A76A 4CEQA 3RMDA 2UU9K 4CFBA 1WKJA 2NNWA 3MCMA 2QWMA 2HS4A 5JICA 9ICEA 3E0FA 4IOAQ 5AI9A 1RT7A 2P6UA 4GVLA 3AEVA 4Y1DA 2E20A 4ZTJA 4NMLA 1D9AA 3PX4A 5AKJA 2P9LB 4ZMMA 1LV5A 3BQ0A 1VHXA 3J8AA 3JPTA 1PVQA 4ZLNA 1HLUA 3M3ZA 1I5OB 2W4PA 5ETPA 4FF3A 2DFEA 4ECWA 4A47A 1GK8A 5HOOA 3ZEUA 4GKKJ 2IHR1 3PIOQ 4YHHK 4EHUA 1CG2A 3TQEA 3JPOA 4E7HA 1G99A 3NMAA 2KH9A 3CULA 3PW2A 3VQEA 1QUVA 4DPYA 3M32B 3VAHA 1ZQXA 1W26A 5IIKA 4ZP9A 2ROPA 9ICSA 5GADU 3QQCD 4YY3K 2J0XA 3V1OA 2H4WB 3WU2U 3S8SA 3KLFB 2VQFF 3HHNB 4K0KF 3F2CA 5IXUA 3PNCA 5KFKA 2W3RA 2V8GA 3L0QA 2A10A 1NPRA 3U02A 3OTDA 2Y0SD 5D78A 2RE2A 2UXBJ 2V9WA 1Y3KA 4MLHA 3DJCA 5C0YA 3QLHA 3KK2A 5DLGA 3G6VA 2HF3A 1Q95G 3MM6B 5HMWA 4M45A 4CJ7A 4Z4HA 4GKJK 2EFNA 2NRZA 2IVMA 2DNNA 2HRUA 1SV0A 4KLDA 5BREA 1FRLA 5HAOA 2HYIB 2A42A 4TQRA 1RZTA 1TL7B 4KO0B 1TP7A 4M3TA 2R7UA 3HT0A 1JLEB 3KWIA 2VGMA 4KHRA 3DCAA 5CY4A 1RPLA 3VEVA 2EKNA 4KLHA 2KVQE 2D9OA 3FM9A 2CQ4A 2D7SA 1BXNA 3MR6A 1X5OA 4Y2YA 4Y2TA 2VPZB 2B9WA 2OPRB 4KHNA 2LVWA 1KQSM 4X4SA 5TZVA 4I2QB 4UOHA 2FVSA 4N8NA 1SB6A 1OH5A 1SL0A 2G06A 4ICLA 3BYPA 2DO0A 1NPPA 2V69A 2FGCA 5K8OA 3QZ7A 3R6MA 1SKWA 3CMQA 4USTA 4ZIVA 2HGNA 3OR1A 2RRNA 4JI7J 2DJWA 4CERA 3NCRA 1EJ7L 4GO5X 4JBCA 3JYTB 2NXUA 1C0UB 1JXVA 1DRZA 4QCLA 4CK1A 4GKKF 3ETOA 3CPWR 1HBMA 1U7LA 4CLTA 1L5UA 2VBYA 2H5JB 4ZVQB 3HP6A 1COKA 4MFCA 3ZDDA 2HNZA 4FS1A 4ILRA 1H1VA 3THXB 4X65J 4PG4A 3GV8B 3M7DA 1LAVA 5CD4A 2YX7A 4NLBA 2CRXA 2W25A 9ICTA 2EK6A 3KLHA 5L1LA 5I3PA 3O1LA 1IJFB 2QYCA 2J6TA 4LUBA 3PSIA 1WC5A 4CNYA 1CC8A 4F0KA 1XR7A 1PBAA 1N2XA 2GWSA 4CTAA 4C0OC 3GIRA 4FXVA 4N7TA 5LXYA 2DNLA 3KG0A 2HRYA 2UXBF 4OX9K 2YKOA 2L9NA 2K4EA 3ISBA 4IYQA 1PGZA 2CNOB 3V5RA 5HRRA 3I8DA 2RUSA 3T1HK 4JB8B 4MYTA 2M8HA 1RT2B 3MMCA 5J0WA 1WC0A 1S12A 4Y2KA 3QEIA 1DQAA 3J7A1 2QTWA 3RJHA 1EWQA 3L7PA 2FD2A 3D0GE 1B7YB 4ED1A 3LDQA 2QM1A 4LF4J 3CETA 3N6NA 2DBYA 3FZLA 2EK1A 1VQ5N 1FNMA 1QE1B 1RLDA 4QR1A 1QJHA 2Q6CA 2ETJA 1ULRA 4OZ1A 4ZIWA 4HTUA 5F9LA 3BY5A 3UB5A 3C46A 3SBTA 3IRUA 5M1FA 2W7AA 3GR0A 4H5NA 1EP4A 2E2QA 4CEDA 3MWPA 4URGA 4JI7F 2LKYA 2NYIA 4GMKA 2EEYA 3IDWA 5SZTA 2VICA 4YB5A 1MDUB 4E7LA 3D2NA 3WK9A 2NRTA 1KDNA 3TVYA 4R5PA 4HDGA 3UNYA 1ZQIA 4M5DA 2BCUA 2P9CA 4R25A 3QU9A 5H1SV 3G10A 4JNEA 3CW2C 1BA1A 2FGOA 4DPOA 2E5SA 1X1PA 4R63A 3AQEA 2V63A 5GTHU 3JB9k 5LOQA 1W97L 4X65F 5CYJA 3T1YJ 3MM9B 3IR6B 2FJ6A 5FPMA 2YKPA 1R8BA 1DTTA 2NCKL 1IBLK 4NXNJ 5KFXA 1X7VA 1R59O 4CF0A 3IRXA 1UFLA 4RZRA 2DIUA 4F02A 4DL5A 2MGZA 2E66A 4ZPCA 3CCVS 1N34F 4RQ2A 2H3VA 3UDEA 1PK1A 1SIWB 3L4PA 1SZPA 4AE5A 2ZJQQ 2ZJPQ 4DCJB 2RNEA 2MPUA 2VH7A 1NEEA 4US8A 2VC0A 1VBKA 4QJVA 5K4LA 4DX8H 5AI0A 4OX8A 5D0RA 2OJ3A 2YJEA 3LPUA 1ZC6A 1XSPA 2FPMA 2IM0A 3K58A 1Y5IB 1GLJO 5ETKA 1LKYA 2DCLA 1T4GA 3TAMB 8ICQA 2H51B 2OPSB 5KFYA 2C28A 1HARA 5CD4H 1Q5YA 4C23A 1M1GA 2YBVA 5J0XA 1J97A 3K1RB 4ZHRB 4M3WA 4C0ZA 3KXDA 5J0PA 2EAOA 2I5JA 4TUSA 7ICLA 1FX4A 3DHXA 3QO9B 1F9FA 1KVAA 3NAIA 2YVSA 3LPTA 1YDLA 3RR7A 4BR9A 3OR2A 3O9QA 3VCDA 2PFUA 2O8DA 2VOOA 2NZ4A 4IG0B 1QDUB 4X62J 4JAXA 1T9WA 3D7EO 4I1TA 4DN0A 4RNHA 5CYQB 4FZVA 5E3CA 5HATA 3V9WA 4HI2A 3SXLA 5HRNA 1ZQSA 1N88A 4R8UA 4DU1A 4USHA 1LAWA 2J6SA 2DFHA 3TZWA 4FYWB 2KSOA 2GVDA 3C6UA 3UD4P 2A6MA 4BDZA 2UXDK 1VQ6N 4WFAL 3MURP 3W2WB 3T1YF 4V19X 4GY2B 4CT8A 3MAQA 4USUA 3H25A 3CCWA 4NXNF 1MMDA 4NYOA 1VRQC 1TK8A 2ZE2A 3O44A 4KLQA 1Y11A 5BJRA 5BR8K 2UV8A 2QKBA 1ED1A 4YN3B 1ILYA 2HHWA 1RTIA 1R0AB 7ICGA 3F73A 4DSEA 5EUHA 3M2VA 1VAZA 2DYAA 1S1VB 2J0WA 3D67A 1YBAA 3M6GA 5BPMA 2YQEA 1RAOA 4NLWA 4QPTA 3HWTA 3CJ0A 3PKYA 3IO1A 4KFBA 2QT7A 3LYSA 3R2DJ 3DLLQ 5DDMA 4CE9A 5FJ4A 4TUQA 1IKXA 1ZZFA 2GQ2A 5GADI 3OVAA 1N8RT 3LPEA 4WIQA 2BDUA 3MMBB 3KDNA 1QQ5A 2MZTA 3E01B 4FVMA 2E1ZA 2HBJA 3BN7A 3W1YC 1JMTA 1U6ZA 1CPZA 2XWXA 1TV9A 2AZ3A 1RHMB 2J9CA 3FBFA 1I6JA 1U2CA 4CIEA 2P9PB 4NI2A 2UVUA 2ROEA 4QZVB 3D2FA 4DMZA 2OP5A 3NS7B 4UAZA 1TELA 3SCKE 4C0BA 5A8WA 4IOAL 5E3RA 1N6QB 4RW4B 2V2QA 4OL8A 3GE1A 1B7FA 5GADP 5LT5A 4X2BA 4JHDA 2LECA 3U7JA 1V3RA 9ICRA 4K4UA 3NWRA 3S01A 3AVIA 5AQFA 4QZIA 1YXQA 4ECSA 5G5HA 1RT2A 4LF6J 3CJ3A 2BCVA 4I2HA 4K41A 4L6V3 4LBPA 2NSBA 2FE9A 4ALZA 3PIOL 1TL3B 2GBZA 3JSMB 1F5CA 7ICFA 5AK6A 5J2BA 2F9JA 2HF4A 3KJVB 1WAFA 4FWQA 2HWIA 2W7PA 4RJVA 3PKMA 3ZSOA 1HX1A 3JPPA 3UMBA 4BG9A 1U48A 1LWXA 1U49A 4IJNA 4KHPK 3N6LA 1HNWJ 5HHHA 4RWWA 2OUGA 3NWGA 3IG5A 2BW7A 2CJBA 4JI6K 1WBBA 1A6SA 1B0TA 2L3MA 2OD4A 1FVSA 4NRTA 8ICHA 4B9SA 4WP8A 3FZ2A 4DZ6A 4LFBK 4CF5A 3LGNA 2CPDA 3JSYA 5CRXA 2P9NA 2WVCA 3TADC 1GX6A 3HULA 2AYMA 3M05A 1HWIA 5DK5A 5KGWA 4M3XA 3BBBA 2B5JB 1VQPN 2YNHA 5ALPA 1CJKB 3A8JA 3TA1A 2FVCA 1G15A 2IBKA 2BANB 4Z4CA 3H0MB 3CM5A 3VAIA 1RYSA 2MHNA 3T69A 3ZZTA 1N62A 2CUYA 3C0BA 4LFCK 5AE3A 1IBMK 3QYPA 1L6NA 3WDOA 4Y65A 1RT3B 4IG3A 1SBRA 3RUBL 3HW8A 3QT8A 2ZG6A 5KAKA 4DFMA 1GMUA 3TJ9A 4LF6F 3IG8A 3OW2R 4FWSA 4RNOA 3KLFA 4PXEA 1XSNA 1S6QB 3PNIA 1PSDA 1WUDA 3PJXA 4LT6A 1WG8A 4JI0J 4JYAJ 3V72A 2VG6B 1RQLA 3IN5A 3G6YA 3NOCA 4EELA 1WWHA 3CQYA 4A46A 4PL1A 5HVFA 3KNAA 4UBBA 2GAGC 3IAM9 3M8YA 2LU2A 2N4CA 3DLHA 1XNQJ 3MM6A 4IFYA 4RTFD 1YJWN 3QBWA 1M90O 1TL7A 1N48A 4KO0A 1VQ9S 3A5NC 1FHTA 3C95A 3PX6A 3D2QA 1RA6A 5A2QU 3DLEA 4LRDA 1TKTA 2P6TA 2QKKA 2HS0A 3GL1A 5HROA 1HNWF 2IAJB 4GC6A 1HNXK 2V68A 4FWNA 3LAKA 3L8BA 5KOXA 2VCPA 1NGFA 5ALUA 1IIPA 2KG5A 4DOAA 4OI2A 1ZD4A 4IO8A 3NRZA 1RT5B 1HWUA 4OHYA 3BSCA 4FPRA 4WFNQ 2PMHA 5CHIA 1QAXA 4HHTA 2CQGA 1UT8A 3D0PA 2HSEB 1OSCA 6FDRA 4KJIA 1BI4A 3ZSWA 3AY0A 4EENA 1WHXA 5J2JA 1ZZNA 5BYRA 4GVMA 3ICLA 4FW2A 1IM4A 2AP1A 2DB1A 2ASPA 1UZDA 2RVJA 1QHAA 4B6JA 4BR5A 4IQVA 2RHKA 4NM1A 4G1IA 4M9NA 2RSQA 2FMSA 4ZPBA 1XMOJ 3FBBA 3MMVA 1SVDA 2EH9A 1KVJA 3HLUA 4MMOA 4MYUA 3THXA 5AK3A 4J9OA 3B0XA 5F41A 2E8NA 2Y9TA 2E9TA 1Q16B 1V3ZA 3MHYA 4DU8A 5C15A 1IUJA 2VFVA 2O1PA 3ISND 3MD1A 1O5JA 3D0IE 3W3SA 2KW4A 1ZBFA 1C0MA 3AO5A 2C2DA 1X31C 3CCQN 4RL1A 4KGKA 4Y6IA 3WXIA 3G82B 3KLGB 2VKQA 1VQLS 1C20A 3WXJA 2FIUA 4JI0F 4OPKA 4JYAF 5GAEU 1ZBHA 4U8VA 2I7NA 1SS6A 3VGVA 3R5JB 4FWMA 3LZJA 1KWMA 2IJNA 1SH2A 2OPQB 1XNQF 3EVOA 4USWA 1GO3F 2F9DA 7ICUA 3OYJA 3RU0A 2A18A 3L4BC 4PXCA 3DM2B 1U0SA 5FDLB 4DU4A 4A8MP 3IAS9 1IJJA 1IKYA 4JB3A 5DRKA 1DARA 5J0YA 3I28A 2ZJQL 5L39A 4DQIA 2ZJPL 4H54A 4QQBA 3DLBA 3BO3A 3AMZA 1XS9D 1MMNA 2QXFA 3GJTB 1BWVA 1WC1A 4N5SA 4R79A 2NYHA 2HLUA 1N33J 4G65A 4PHPA 1T8EA 4OZJA 1RT6A 3EWGA 3Q83A 2HBQB 4NPOA 2GO8A 4DR6K 4EHTA 1A5VA 3DLGB 2KZ3A 2OTJS 3RB4A 1BCMA 1TQLA 2RHFA 5CR4A 1YJTA 3GB0A 3PJWA 5ITHA 5AQRA 4B3SK 3CG7A 1ZQGA 2F1IA 4H0TB 2CKWA 3PW4A 1GTEA 3DKDA 4A4JA 3R5AA 4B3OB 2CG8A 2IM3A 3K2PA 1XMOF 2FSJA 1VFJA 3FK4A 3MM9A 2DH9A 1MQ3A 2Y1IA 1UVIA 3ZSVA 3UD3P 3UR3C 4YXJA 2V4JB 4KE5A 2XTJP 2AMCB 4IH5A 2E8OA 4MO4A 4P0QA 1ZRNA 5IFMA 4YB6A 3W7BA 3I0RA 3LK9A 4DLGA 1KRPA 4IZ9A 3VGKA 4BXOB 1X66A 2GS8A 2D0OA 3W3DA 4CZIA 2FPLA 4OCZA 1FTCA 2XYPB 4Q2MA 4DQ8A 3R27A 2P9SA 4F3TA 3JQKA 4M3RA 2E5LK 2PY5A 4QW8A 3DFEA 3O6WA 4B9UA 2QRRA 4NEZA 1OY8A 2AH5A 4C11B 3CCJN 3IBWA 4RBVA 4UAYA 4FXWA 4CJSA 3CE8A 4K8RA 4NLSA 2WONA 2WHOA 3OXLA 3EW9A 4KPYA 4A2BA 2OPSA 4RQ8A 4QAGA 3TX0A 4MO5A 1WACA 1AFJA 4FWLA 3UMCA 3AM9A 4O5KA 4USKA 2IA6A 5FLXU 1KEJA 2PN6A 1ZQEA 3TP2A 2ZIWA 1G4CA 1OQ6A 2YHWA 1N33F 2VJUA 2LYAA 3ZSZA 3DLLL 5AIBA 1CJTB 2IJRA 1NK7A 2QZ8A 1RBLA 1VC5A 1DKGD 1MA9B 4JV2A 2V7YA 1M6YA 3MF5A 1AQ6A 2AYEA 2XSJB 9ICQA 4ECZA 5K5MA 5KFJA 3FDSA 5TKWA 4WXWA 4DV6K 2G8HA 4IG0A 3DXSX 1VK8A 4DQRA 3I56S 1U6BA 1RFQA 5LJ3Y 2R7OA 5CYQA 3X3UA 4P2HA 5AKYA 5ETSA 4A8XA 4MKYA 2B9YA 2OANA 2FHJA 1FT8A 2EAMA 1KHVA 3P5TL 8ICGA 5HVGA 8ICOA 4PL2A 3LH2S 4FBUA 1HLWA 2G8IA 3T5LA 1EQMA 2P9UB 2XZTB 2BDPA 3A0IX 5C2DA 4E98A 4PQAA 5C24B 3LP0B 4O0NA 4HWIA 2ASJA 4QZ9A 1J5OA 3ITHB 2JH3A 2WVBA 1LW0B 2LDIA 2MLXA 2WF6A 4F25A 5EVZA 5TISU 5J2CA 1S7IA 1NKCA 1CULA 1U02A 3TSQA 2QLBB 2FC0A 5KG6A 4FWOA 4X84A 4DXLA 4EX7A 3WX8A 5AXNA 3SZ2A 2DNZA 1JMSA 2PMZF 2JFDA 4TUPA 5DG9A 2XLIA 2HZCA 1H2UX 3DMJA 1S1VA 3R1LA 3MN7A 4ZPWR 5AZIB 3HJEA 2Y0SF 3PHTA 1JN3A 4FF4A 4QZEA 2VJ5A 2YWGA 2KHVA 2D41A 3LP2A 3FZFA 4KHPJ 1MN9A 1WUAA 1XK8A 3MMBA 3OUYA 3POTA 4ZKAA 4CFCA 4DR7K 4Y34A 4FYVB 2E8MA 3B82A 4EMDA 4AHCA 1RM6C 2B51A 3QBXA 2P9PA 2B4JA 1VYAA 4UASA 2L08A 1T9YA 4LFBJ 2Z1HA 3Q8QB 1FO1A 4BGAA 2P8IA 3Q0AA 4EX6A 4N8OA 1ZETA 4RKUC 4K4ZA 5ALVA 3TFSA 2RQ4A 4OLBA 1SJQA 1M5VC 1DY3A 5HLFB 4CO3A 5GIOA 1VC0A 5IOLA 3VPZA 4OJHA 1HJOA 1YT3A 3HSCA 5HL7Q 2BABA 4JN4A 3BGRB 4DX5A 1XIQA 3OYAA 4LFCJ 1NK5A 2V4QA 3TR5A 2AJ1A 3DGPB 5F8MA 1S9GB 1IBMJ 4C4SA 5MLCQ 3DLRA 4UB8U 3JSMA 1FXRA 3AO1A 4BRAA 2LKZA 3BF4A 2WVEA 2KXFA 3VTIA 3OW2M 3KJVA 3MAAA 4CZGA 3ZT1A 4K4HA 1LWEB 1UW4A 3HZEA 2ERRA 9ICAA 5J2HA 1WOPA 3P8BB 1UFKA 1VI7A 4GLXA 2KXHA 4CGJA 4WYBA 1S79A 3OYDA 2N7YA 2CZ4A 2XY7A 2G1DA 4IC9A 2YWFA 3IGVA 2H5IB 1SB3C 1R43A 5GTIU 2JXJA 3ET6B 4KLUA 3QU7A 3O5BA 2BE2A 2XEXA 2ASMA 4YN4A 4JI5J 3EYZA 3IM9A 2XMWA 5K8NA 1OMSA 4I2AA 1J2MA 1FFGB 2N82B 3LL3A 4KH1B 1URRA 2LCWA 5AI5A 3LDSA 2HK3A 3HHEA 4PHDA 2RRBA 3MEDB 1EZZB 2JVRA 4CGIA 2NR0A 2OMOA 2CWKA 4WF9Q 3BREA 1S7HA 5CA5A 2JH7A 3Q8PB 3K89A 3L4IA 5KPTA 2EFVA 3D6FB 3Q8RB 3FZHA 3SJHA 2RKIA 4CFAA 3N28A 4MQ3A 3DRXA 2ZJ5A 4CBUA 1I94J 2Q79A 1X6IA 1Q8KA 1Z19A 2HRTA 1WORA 5GAEI 3OLAA 1N32J 4CT9A 2BVZA 3NF6A 2LQ5A 1VJ5A 1FKOB 3EE9A 2DH8A 1VSHA 2B7BB 4A48A 4LFBF 1RT4B 4ZVFA 1N5TA 3GONA 2OWOA 3PXGa 4WFNL 3O0FA 1FDDA 3GLJA 3KKAC 2EFPA 1RT3A 3NRWA 2HS3A 5CCMA 1GTHA 3BM7A 4RPFA 4DFPA 2Z2LA 5HRSA 3H46O 4EFAC 3DXKB 1VQYA 3ATUA 4LIRA 5GAEP 4OGEA 3H7IA 3C2MA 1F0XA 2L9DA 3QUTA 3EJMA 1S6QA 2WF9A 2ZUBA 3DI6B 1PJ7A 3TKAA 1JLCB 1HR0K 3CCEN 4WTYA 4K42A 1HQEB 1RXVA 4FCYA 2P9KA 3ZO7A 3MTJA 2QL5B 3VERA 4NRUA 5I3QA 3UW1A 1U8SA 2HFVA 4KB0A 1JLAB 2ITMA 2KKHA 4A61A 4FLVA 3HKZC 2VOPA 1S4EA 3DRRA 1HHSA 5BRFA 3WQTA 3M6KA 1UAXA 4LMZA 3N7SC 3K0JA 2RDJA 3Q22A 4TNOA 5KL1B 1U1LA 2VYPA 5KL8B 1APSA 3RMCA 4FJ5A 4JI5F 1ZQNA 3QUCA 3RH5A 4B3TJ 4F5NA 2WB1C 4QZFA 1U2FA 4LVSA 3KD1E 3H2VE 5KFWA 3HRGA 1HYSA 3FRYA 4Y2RA 2NYVA 3AY9A 4P7TA 4EIAA 2DNYA 4O44B 4DQPA 3J81j 3ILOA 4EYHB 1RT5A 3ZDCA 1VGYA 3MEGA 3D2WA 4I2FA 3AGRA 3C3LA 4ZH4A 5IINA 5AQTA 3A1YG 4KMUA 2MUTB 2DGTA 2FHOB 3HVTA 4RW7B 1I94F 3IBFB 2UXCK 1N5XA 2FVPA 7ICKA 1N32F 2BA9A 2JNJA 3VQ8A 2AJ4A 2MSTA 1PJ5A 3TZXA 1B9FA 3BYRA 4BVOA 1C0GA 5ALOA 3WZ0A 2F40A 1P6TA 5AM1A 1WD6A 2IYIA 2F8SA 4DUTA 2V8HA 2YB1A 3A8KA 3MECB 1NMEB 3UKUA 1GFWB 1VQMN 1T95A 5KT4A 2W11A 2HZVA 5B0DA 2OELA 4BC9A 3BEXA 4HHJA 1L7MA 3PYFA 2HI0A 4OI6A 2HB5A 4ZVGA 2E4LA 5AQWA 1D8LA 3QFPA 1K9MO 3I4HX 3A3NB 5F8GA 4CDGA 1RAEB 2Q36A 3AGKA 4FNHA 2FLLA 5G5GA 1FVQA 1FRIA 4E8UA 3JXOA 4OZLA 3KLVA 3C1ZA 4Z6EA 3RJMB 1D8ZA 1S9EB 2ZH4A 9ICPA 2NO4A 3OYIA 5G0RB 1HNIB 3UDVA 2MSNA 2K06A 3ZXWA 1SI9A 2ZD1A 1M5HA 3UE5A 3RJFA 3OYLA 5ALTA 2EG2A 2GQCA 3PIPQ 3MUTP 5HK4A 4DKWA 4ECVA 4RCHA 4B3TF 3VQ9A 2RUGA 3KLIB 2E5LJ 4B3MF 3N01A 3SIPB 2YNFA 3G4SN 1X4HA 3CJ1A 2KIVA 2NZCA 2KN7A 4PEOA 4AQYK 1NSAA 4X5VA 1XN9A 2VG7B 4Y2PA 2P1JA 1ZQZA 3HHKA 3JQMA 4RWXA 1OUQA 4KGZB 2LA6A 3O4QA 4PZVA 3P6YC 4EO8A 1DBDA 3DLGA 1SC1B 3DOMB 2MYFA 6FD1A 3ZX0A 1BPEA 4FLUA 3ZDAA 4CE6A 1ASVA 2NXEA 3W66A 5AXMA 4UB5A 2QGFB 4FJHA 4CHOA 3AQFA 4YMOA 3PFOA 2CJKA 4USMA 2CQBA 1Q5VA 1TUVA 5J2PA 4U96A 3C2KA 2HOFA 3LUYA 2GX9A 2HQDA 1QTNB 2VZ9A 4O3RA 3NVVA 5AKIA 2XO7A 3SV4A 4KLOA 2J7KA 1NZ8A 3BDPA 4NCGA 3WC0A 3Q8UA 4X66K 1RISA 4ZA1A 1VQ5S 3AODA 2DHXA 4CJVA 4Y2UA 2V4JA 5SUHA 3Q8SB 4C1NK 4CJTA 2R8KA 2DO4A 2B6GA 3TSPA 4LF5J 2ZC3A 1P90A 4I2PA 2C3PA 4PYAA 4BXOA 2D6FC 3C6TB 1HMVB 3P83D 5BN9A 1V3SA 2FY8A 4NYPA 3LOUA 2Y8YA 1WG5A 3GZFA 3OBWA 2OA8A 1O0PA 4MJKA 1KC8T 1GX5A 3R9PA 4ZPDA 1KVBA 3X1LB 3QJLA 1S4FA 2WF7A 4PKHA 3RAQA 1EXNA 3VF2A 3ZZRA 4FSVA 5LJWA 2XVTA 3QFHA 3RBEA 1YUWA 2W2MP 3A5LC 1Q3VA 4KQZA 4RW8B 3W9JA 2BYCA 1FJEB 3T6BA 1ZBLA 3IXQA 2HBRB 4CLLA 5D4BA 4IWVA 1BPBA 1IQZA 4Q0BA 4B9QA 1WKKA 3NMRA 4PWUA 1Z1VA 1VSDA 4W5QA 1AFIA 3GOIA 3FFKB 4M2YA 1B3TA 3TTFA 3BSAA 4DR7J 5DB8A 2LU1A 1HWLA 4I68A 2L5YA 5EU7A 3NS6A 2C2KB 3VQAA 2FXUA 4DX6A 1SIJA 4EBDA 2FQQB 3KWMA 3VVTA 4BC7A 3R5CA 5EE0A 4I6MA 3PEHA 2D3O1 2CJQA 4UOCA 3RB0A 1BISA 1HBOA 1HIYA 2VF3A 1NOYA 2W4DA 3K5OA 2CQ3A 1RDBA 4CBWA 4J03A 4FP9A 1BG3A 1Y5LB 2YCHA 1ZPVA 3GV5B 2F2AB 3KK1B 1SCJB 2KG0A 5KFDA 1DK2A 3I8BA 3BPSP 3ASMA 3LP0A 4OJPA 3ITHA 4ZJOA 4IQWA 2CPHA 1RHRB 1LW0A 4ER8A 4MFBA 1GLEG 4CEZA 3HX9A 2MZRA 4DUZK 2A3ZA 3E9LA 3HHLD 3SCJE 2ISOA 4LF5F 2ADCA 2KDOA 4MAKA 5ALYA 3C16B 4CP5A 5EHHA 2RPIA 3Q2TC 3GJSB 1K0VA 3C15B 1LFPA 5AM5A 3ZZOA 3OVSA 2I6XA 3D1QA 3KD3A 1W2BR 5KT5A 3AVAA 1T7PA 4PUOB 4NMXA 1ZQ1C 1NBEB 1ZM4A 2ZTCA 3KKFA 4HDHA 5AZIA 1S5ZA