4EZ6A

Bacillus dna polymerase i large fragment complex 1
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
580
structure length
549
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 192
structure length 549
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez6A01
3OYAA 1A5WA 4FZYA 3THVA 2XRIA 4CGIA 2R8GA 2KW4A 1NOYA 3U3YA 4CJWA 1Z00A 3GIMA 4CJEA 4UB3A 3HX0A 3KHHA 1KVCA 3O3FA 3HP6A 4FLXA 2GV9A 2IDOA 2F1JA 4CEZA 4CF0A 4NLZA 3S9HA 3RMDA 1NJWA 2JEJA 4DLGA 1WSJA 2PYJA 4YXMA 4QCLA 5J2JA 1NJXA 3KLFA 4RNMA 2C22A 1JIHA 3VQBA 1SKSA 4DL5A 3D45A 9ICBA 1LWFA 3RR7A 4DTPA 2XCAA 3BDPA 3ASMA 3S3NA 4ICLA 1CXQA 5J2KA 5DQGA 1ZETA 5KT7A 1TFRA 4M9GA 4F3OA 1U4BA 5FRNA 4YMOA 5J0PA 2Q0ZX 1IKYA 4HCCA 1EXQA 1S1XA 4Q8EA 4KITB 8ICFA 4KTWA 3JYTA 3BQ1A 2KTQA 5J2PA 3C5FA 5KFXA 2AGPA 5IIIA 1VSDA 2IGIA 3UQ2A 4FJ7A 4BACA 4IKFA 2BGGA 4R65A 1NK5A 2PZSA 3TFRA 1D5AA 2F1HA 3HT3A 2AQ0A 1J54A 3RAXA 1HNIA 5EWEA 1RDCA 3QZ7A 2W9MA 3LPTA 4YD2A 4UAWA 1LAVA 1F21A 1IM4A 5C5JA 1NK8A 4IDKA 5C25A 1XSNA 5J2NA 1JN3A 3I0SA 1WAFA 5IILA 2XHBA 4Z6CA 2ZUCA 4QW9A 2VWJA 4I2DA 3MDCA 2E6LA 3AA4A 4TSXA 4Q0BA 3L3VA 2ZTEA 4DTXA 1H38A 1C0UA 4O3SA 3C5GA 4DS5A 4I29A 3NH0A 1ZQSA 2P66A 4RNNA 1QSLA 4BDPA 4IQWA 4M47A 1FK9A 4E89A 4QOZB 1UA0A 8ICAA 3AO1A 5J2MA 4CIEA 3RMBA 1JLGA 4FBUA 4CFAA 9ICRA 1RILA 1RT2A 1ZQGA 3MGIA 5D46A 3Q8QB 2KFNA 1SL0A 1VSIA 1S9FA 3ZDDA 2P6UA 3CQ8A 1C1CA 4Z6DA 4W5QA 4M0AA 3DOKA 3RWUA 3NH2A 3SNNA 4RQ7A 4OLBA 3PNCA 3T5HA 4F5RA 4DL4A 3OHAA 3HPGA 1JLQA 9ICIA 2AQ4A 3MEDA 5DBBA 5DB8A 5J0OA 5L1LA 4FBTA 4FW2A 1EKEA 4FJHA 3EPIA 3NF6A 3AVJA 2R8JA 2B6AA 4C8NA 3K4GA 1Q9XA 3G6YA 1NJZA 5DLFA 5TZVA 4DO9A 2WOMA 1ZQNA 1GOAA 2KFZA 3M8SA 1BCOA 2GWSA 5KG0A 2DFFA 3UXNA 2W42A 5L1KA 1VRTA 5J2GA 4EEYA 4R5PA 3QO9A 3OVNA 1UOCA 4YQWA 9ICOA 5D49A 4G3IA 3UXOA 3JPOA 4ECXA 2D0BA 2RF2A 1S1VA 5KFPA 3KD1E 3O3GA 4BE0A 4RQ2A 4B8AB 2IHMA 2V4RA 4AHSA 4BWMA 1RCHA 3L2RA 5L9XA 3TQ1A 4QWDA 3JPPA 5KFIA 4RPYA 4KHYA 2FLNA 4CJFA 4F4WA 2RPIA 7ICPA 1KEJA 4BXOB 4RT3A 5KFSA 4EBDA 3SUPA 2PI4A 3QETA 1BPZA 1CXUA 5DB9A 4WE1A 4HTUA 4DSJA 4W5RA 5J0UA 9ICWA 1O1WA 1WAJA 3SQ4A 1ZQPA 2JLEA 2HW3A 1MC8A 4FM1A 4CEFA 3DLKA 1WCLA 1TL1A 1TKZA 4NM1A 2R8IA 3KKRA 2XO7A 4NCBA 3MXMA 4CFCA 4O5BA 3T5JA 3CG7A 3C21A 4W5TA 4O5EA 3ZDBA 4X5VA 1TAQA 5CP2A 4Z6EA 2C28A 1XS9D 9ICQA 4LZGA 1N6QA 4ELTA 2OPPA 4DSLA 1L3UA 4I2JA 1S97A 1RTHA 3OYCA 2O4GA 4J9KA 4LSLA 5EWGA 3HYFA 5KT2A 3TARA 4K8ZA 4CEAA 1KRPA 4Z0UA 2KZZA 3L2QA 5DDYA 4MFFA 3QEWA 3QESA 2M9NA 4FLVA 4KLFA 4W5NA 3KJVA 1ZBLA 4B9LA 4CEQA 5DB7A 3M9MB 4Z4IA 1JL2A 4CECA 4FJKA 1ZQMA 5J0TA 3IG1A 1ZQXA 4Q5VA 2BPCA 1HYSA 1ZQZA 4K4GA 5DG7A 9ICTA 2BE2A 4M3XA 4KLTA 2FBXA 3K5OA 4F3TA 1KFSA 3VA0A 3WNEA 5J2IA 4ZHRA 2HHVA 5HP1A 4JS5A 1CZ9A 3DLBA 3MDAA 4YP3A 1VSJA 3RRGA 3VQQA 4FW1A 4IG0A 3KHLA 5KFTA 4M04A 4DLEA 1TK5A 1ZQFA 2R7YA 3ISNC 1X9WA 4KRFA 3DLEA 1BHLA 3UQ0A 1VSLA 2F96A 2W9BB 5J2BA 3ORYA 5J2CA 9ICVA 4CGFA 3PV8A 5DBAA 3G0ZA 3MR5A 2HNYA 4CK2A 3G6VA 4F5PA 4KI6A 1U47A 4RU9A 1RNHA 3LZIA 3ZSRA 4CK3A 1RT7A 4KLJA 1RTDA 4AHRA 8ICTA 3UIQA 3DRSA 4KLUA 1WCNA 4J9SA 1C6VA 3PW7A 2BR0A 4AHCA 4J9MA 2PFOA 8ICRA 3VA3A 2HNDA 1YT3A 3LAKA 5J0YA 9ICSA 4GXJA 2XY7A 4DSIA 3CM6A 2MAXA 1RBTA 1ZQQA 4EYHB 2VG5A 4F50A 4OVLA 4RW8A 3CYMA 2F8SA 1LW0A 4C8KA 3PW5A 5EWFA 3BQTA 5J2AA 2HMIA 7ICLA 4MFAA 1QSSA 3OYFA 1QTMA 2JZBA 1L3SA 4C8LA 5L1JA 1BIZA 3V9UA 3F9KA 3KLHA 3RRHA 4CJLA 4DU3A 8ICQA 4ZTFA 4M3YA 1IH7A 1IG9A 3KIOA 4F8RA 3OSPA 5KT6A 3MBYA 4O9MA 3L3UA 4KAZA 4NYNA 2BCRA 4I9LA 3JSMA 7ICVA 4GMJB 3AA5X 1ZQUA 4O3NA 1SKWA 2RDJA 1AROP 3OYNA 1BI4B 4DQPA 3LK9A 2ISPA 4CIFA 1ZQWA 4M3ZA 2WONA 2QXFA 1VK0A 4OKKA 4RW7A 1WLJA 3C1YA 2PFPA 2YNIA 1BPBA 5CY4A 5KFHA 7ICOA 3OYKA 4QZIA 2DPIA 1U45A 8ICSA 4CFDA 2XGQA 2IC3A 8ICNA 4DS4A 4CGHA 3V7JA 3OSNA 4EP5A 3PX6A 4CF9A 3KHGA 9ICNA 4JV0A 2KZMA 3O3HA 4ECVA 1HJPA 4J2AA 5DLGA 2VG7A 5D3GA 4DTOA 5KFWA 2JEIA 4KHUA 3TAFA 2D0AA 4ED1A 2X6NA 4KLGA 1JLCA 5KFZA 2ZJ8A 1SL1A 2ZTDA 4TUQA 1ZQEA 4PGQA 4JRQA 2Z1GA 4IRDA 1NKEA 1Q8IA 1HUOA 3TAMA 2AGQA 4AHUA 3V4IA 2W8LA 3OYLA 2YNHA 3RJJA 5CZ2A 1HRHA 4LVSA 5DBCA 4GVMA 4OPJA 4ECQA 1Z3EB 2MUTA 2P1JA 3GIIA 3PX4A 5HRNA 5JS2A 1ZQOA 4CJKA 3QINA 1ZQJA 1BPXA 4QZHA 3OGUA 3AO4A 4DU1A 1QQCA 2KZ3A 1UT8A 2YKNA 4KTZA 1D9DA 5SZTA 2OZMA 2NRVA 4FXDA 4I2IA 4CEDA 1A77A 4QWAA 3C2KA 1S0MA 1K6YA 4FJ9A 3KLEA 2H5XA 7ICRA 2ZUBA 2GUIA 3QIPA 2V9WA 4RUCA 4DQIA 4M3TA 7ICMA 3DRPA 1B43A 2BGWA 4E7KA 7ICSA 4CGDA 5KFYA 1J9AA 1WSFA 4ECZA 1D9FA 4F2RA 3QZ8A 1T03A 4ELVA 1IO2A 2W9CA 4I2HA 4FCYA 4ED0A 4B3OA 4NM2A 4PY5A 4N76A 2NUBA 4QZGA 3V6JA 1JL1A 3GFKB 1D8LA 5KFGA 5IIMA 1WNSA 1XSLA 4C8MA 3SV4A 3ZSZA 4YG2A 2R8KA 2I5JA 2G8FA 4JV2A 5KFQA 1Y97A 1G15A 3C95A 5J2DA 4B9MA 3SQ1A 1S1WA 1KFTA 4FYDA 5KFOA 2G8HA 4J9PA 1ASVA 5CZ1A 2BKEA 2NRXA 2AGOA 3E2EA 2X74A 4QZAA 2W9BA 1S9EA 4KB0A 5IIKA 4M41A 5KG3A 9ICAA 3E01A 3ZSYA 3ZDEA 1BGXT 1BCMA 3LPUA 1BPYA 3VQ6A 3NGIA 3EWAA 3PW4A 3MEEA 2P5GA 5KI6A 3DLGA 3HSTB 4KLSA 3OYJA 1SV5A 2G8KA 4KREA 2FMPA 3TI0A 1LV5A 1PZNA 4EYIB 4FM0A 2A1JB 8ICEA 8ICJA 4KLLA 1ZBUA 4IFVA 4YN4A 3RH4A 4JV1A 4PHAA 4RNOA 2BCVA 3RJEA 1HYVA 2BPFA 4CEBA 4O55A 7ICQA 5C24A 4FLUA 4M45A 3QEVA 2PY5A 3SI8A 8ICOA 1MQ3A 8ICZA 1JXBA 1KLNA 1ZBFA 4M3RA 4I28A 5HNKA 3PO4A 3KTQA 4EZ9A 3L2UA 1BIUA 4GC7A 2W9AA 2YNGA 2IHNA 3IS9A 1MSWD 4Q44A 3S3MA 2IA6A 3ZD8A 1DOQA 2IOCA 3V9ZA 1TKTA 5KG5A 1WSEA 2GBZA 4RQ0A 3TANA 2BQRA 3VQDA 2UVWA 3SPYA 1S0OA 4CJ4A 4HHTA 1QE1A 4O5KA 7ICIA 4QZEA 4CHQA 3T5LA 1KVAA 5DG9A 1UA1A 3HP9A 2ZJAA 4CJVA 4ED3A 1ZBIA 3AVKA 2LYHA 4YVZA 1SL2A 4OGCA 3WNGA 1WSGA 3ZSVA 1BI4A 3RTVA 2BPGA 5DB6A 4FJ8A 2PFQA 4KHWA 2BHNA 1L5UA 1TKDA 4I27A 2JZBB 3V7KA 4F4YA 3VQAA 4B08A 4DL3A 3RR8A 3AO5A 1WSIA 1RYRA 3AO2A 4EBCA 3AVMA 5SWMA 2I9GA 4J2BA 2ZE2A 4PGYA 1HQEA 3HW8A 4QWEA 3GV5B 2ZJ5A 4FS1A 4KHSA 4O3PA 1FXXA 2PFNA 3LALA 5KFKA 3KKSA 3D0PA 3EPGA 3RB6A 2VA2A 3T1AA 1RPLA 7ICJA 4BE2A 4GW6A 3C1ZA 1B22A 2IMWP 4AH9A 1EXNA 1C1AA 3SJJA 4RG8A 2ATQA 3Q8LA 3B6OA 4H8KA 1DLOA 4FJ5A 3DOLA 1VSKA 4BDZA 3LWMA 4KI4A 2XCPA 1QLNA 3LDSA 1U04A 2PYLA 1XO1A 4HYKA 2FMSA 2Z1IA 4F4ZA 2EHGA 1EX4A 2XC9A 4MQ3A 4O3RA 1XHZA 4NXZA 1S1UA 4KMUA 5KFEA 2F8TA 4DWIA 3UXPA 3LP3A 5KTQA 4IQUA 4F93B 5KFDA 4UQGA 1T05A 5KFLA 3OYDA 5HHIA 3PW0A 4FO6A 3SCXA 5F9LA 5HLFA 2Y1IA 1CZBA 4YXJA 4J2DA 3NAEA 1KCFA 5HP4A 4BWJA 5KFNA 4PWDA 3KHRA 4XA5A 4MEXA 3AVFA 3AU2A 4E0DA 3OS1A 5DK5A 1HJRA 3BQ0A 5F9NA 1HQUA 2BCUA 3AVHA 1COOA 4LH5A 4B9UA 2RDIA 3T3FA 1W0HA 1RDBA 1KTQA 4RQ1A 3F73A 2NRTA 1ZQDA 2MUTB 1S0VA 5IINA 4DOCA 3S3OA 2W8KA 4IQVA 3AO3A 1YVUA 4CE9A 3TAQA 1NK7A 1R0AA 1IXRA 4Z4CA 2HHXA 2HB5A 3QNNA 1QSYA 3OYEA 4Q8FA 4F91B 1ZYQA 8ICHA 4QZ9A 2YHAA 4KLDA 2QK9A 3SQ2A 1ZQVA 1LAWA 3SQ0A 3L2VA 3PMLA 4DQSA 4DTNA 4QAGA 3V7LA 3MEGA 3O4QA 3IRXA 4CESA 3ULDA 1JXEA 3C2LA 4ELUA 1S76D 1IKWA 2ASJA 1TK8A 4B9NA 3HO1A 2W9CB 4TURA 8ICBA 4CJUA 3TWHA 5FRMA 5KFMA 4ID5A 9ICGA 1RBUA 3AA3A 9ICFA 3QEIA 1RDAA 4JWMA 4UBCA 3V9WA 1CEZA 1NOZA 4ECRA 3PVXA 1N5YA 4NCGA 1RT5A 4FK0A 4E1NA 3RB4A 3MR2A 1TVRA 4CF8A 4CGGA 4ED7A 3H8JA 3V81A 4KPYA 4TUSA 2A1JA 3GV7B 1HNVA 2QKKA 4ECYA 1JLEA 9ICEA 1BISA 8ICKA 3RJIA 9ICMA 2UVRA 4FLWA 1K1QA 1NJYA 4EP4A 5J1EA 3VQEA 5HMMA 3SYZA 3NH1A 3Q8MA 4DSFA 4ZTJA 2ETJA 2OYQA 1W9HA 1V9PA 2Y1JA 4FVMA 3Q8KA 4DFMA 1HYZA 4PHPA 4AHTA 3LWLA 1ZQLA 2AJQA 4XIUA 4KN7A 4PPXA 3MFIA 4N47A 2VWKA 3H7IA 1BQMA 3AVGA 4CJ5A 2FPLA 1T8EA 3K5NA 5HRRA 5CJ7A 2PI5A 4M42A 3ZSWA 2HNZA 4OLAA 2FBYA 2O4IA 2B4JA 2FC0A 3G10A 1REVA 3CFRA 1B92A 3K2PA 3C23A 1DTTA 4I2BA 5KRSA 2YKMA 3OJSA 2P51A 1CLQA 5CR0A 2HHUA 4CF1A 2IBKA 3FYHA 1JLAA 3Q8SB 1UWBA 1ZQYA 3LP2A 4DTMA 3H8SA 2VA8A 5J2EA 1BL3A 3TAGA 4I2QA 4DOAA 3VQ9A 4N5SA 2QKBA 2C2EA 3JPSA 4ECUA 4J9QA 4O4GA 3QEAZ 1RBSA 3HVRA 3ZT4A 4RT2A 4HUEA 4ECWA 1XC9A 3N4MB 2BQUA 2OZSA 4ECSA 3L8BA 4J9RA 5IIJA 3M9NB 3AVBA 3PUFA 1BPEA 2ZUDA 4QZFA 1RXVA 4RPXA 4PH5A 5HRPA 3JPQA 1CUKA 1I3AA 5J2QA 1I39A 3HL8A 2UVUA 3PR4A 3P5JA 2R8HA 4Q45A 4DF8A 3I8DA 3RBEA 1S5JA 4J9NA 1TL3A 1S6PA 4I2EA 3GV8B 4YR3A 2UVVA 1VRUA 4DU4A 2F1IA 4O44A 5BOLA 4F5NA 4BDYA 3ISDA 4HUFA 3LZJA 5DQIA 5BPCA 1RBVA 4CJRA 5DQHA 1ZQAA 5DGBA 4NYFA 4I7FA 4JS4A 3T5KA 1SUQA 3RJGA 1BPDA 3EW9A 3GILA 3P1GA 2ZD1A 4TQSA 4O3QA 4OPKA 3QERA 4M6WB 1ZQRA 3M8QA 4KTQA 4M3UA 3K59A 3OYIA 7ICFA 2E6MA 1KVBA 4CHNA 2OPRA 1HMVA 1UT5A 4KV8A 3AVIA 8ICPA 1Z25A 1YTUA 4Y1CA 1WN7A 3B0XA 4RQ3A 3K5MA 3QEPA 4TUPA 2JEFA 4YR2A 2KN7A 4DFJA 3RJFA 2A1SA 4E7LA 4CJ3A 4CEEA 3ZSOA 1Z26A 1ZBHA 3H40A 4QZBA 5EOZA 4YR0A 1RT3A 4O5CA 4CF2A 3V72A 1ZQHA 4CHOA 1A5XA 4QWCA 1UAXA 3LDAA 4RQ8A 5T7BA 4NLNA 4DL2A 1GOBA 4FJJA 1SKRA 3LAMA 4PA1A 4CERA 1U49A 2E4LA 3IM1A 2ASLA 3OYMA 3NF7A 3M8RA 1JKHA 4ID1A 4R64A 1RXWA 3AVCA 2DFLA 5FDLA 1S77D 4B9TA 3JPRA 2XY6A 4CJSA 3V6DA 3V1RA 1RYSA 2FBTA 8ICMA 4MEYA 4RW6A 1ITGA 4DQRA 4UAZA 3NE6A 4IG3A 4Z6FA 2BDPA 3K57A 2NRWA 3OJUA 4JLHA 5DMRA 9ICUA 3DI6A 2OPQA 3NGDA 8ICIA 3N97B 3ALYA 2G8UA 4YCXA 2HHTA 4CHPA 3V6HA 3RBDA 5KT3A 3NHGA 3K75D 5FROA 3PMNA 5I3UA 3IHQB 5HHHA 1ASWA 1MQ2A 9ICXA 4L8RB 1FKPA 4MFCA 3LP0A 1T7PA 3I0RA 4EBEA 1HUZA 8ICLA 3HM9A 3C6UA 3H8WA 3GQCA 4CCHA 1RZTA 1ZJMA 3HJFA 2P5OA 3VQPA 1JLBA 4P4PA 1NK4A 2YV0X 4HCBA 1X2IA 3QE9Y 2C2RA 4H4MA 1C7YA 4NCAA 3SUNA 3A2FA 9ICPA 4RW4A 2EX3A 1X9SA 1JMSA 3ZDAA 4K8XA 3AVAA 4FLYA 2YNFA 2JEGA 4OKJA 3SUOA 5HROA 3G6XA 3NCIA 1C0TA 3PR5B 4B8CA 4CEOA 3AA2A 2HHSA 1VSMA 3NF9A 3H4DA 1JXLA 4XRHA 1XI1A 1TV6A 3C94A 3ISCA 4GC6A 2NRZA 1ZQBA 1NK0A 3QEBZ 4R63A 4JK1A 5DKWA 4MF8A 3H4BA 3M9OB 4IRCA 4PQUA 2IAJA 3WNFA 5HRSA 1S6QA 5KFJA 5CB1A 9ICCA 2A1RA 9ICJA 3KK3A 4DTJA 1GOCA 1DGSA 4DFPA 2D0CA 4W5OA 4E3SA 9ICKA 3ZD9A 3QIOA 4F92B 3UPQA 3DYAA 4IBNA 4ED8A 4JRPA 3EY1A 5KGXA 4M3WA 4FZXC 5HBMA 4M9JA 4XQ8A 8ICVA 1A76A 5K14A 4KLOA 1DTQA 1EP4A 2FPMA 4YMNA 3BJYA 4ED6A 4R66A 4I2GA 1QHTA 3C2MA 4FZZA 4UB5A 3DMJA 3B0YA 3MABA 1NK6A 8ICGA 1MU2A 3U3GA 3HPHA 4QZCA 1RT6A 1XHXA 4DEZA 4PHDA 1TK0A 1VSFA 4DQQA 3JPTA 4IFYA 1U9LA 4K4IA 4DTUA 4M9HA 3SUQA 5HMLA 3EZ5A 4B9SA 4M2YA 4NLGA 4FK4A 4CGJA 4JWNA 1S9GA 3ETLA 3MXJA 2G8IA 4F4XA 5KFCA 5J0QA 1NK9A 4M6WA 4RW9A 3QEXA 4DMNA 4CFBA 5JUMA 4KLMA 3V1QA 3B6PA 2BCSA 3FDSA 1BVSA 2ZQBA 1JX4A 3RMCA 3PO5A 4I2FA 1N48A 4NY8A 3TAEA 3VQCA 1Y88A 3HWTA 4XUSA 3NDKA 3RH5A 4AHVA 4KFBA 3SZ2A 3C6TA 1TGOA 3VQ4A 4I9QA 3P83D 3ISBA 2HVHA 3HPOA 3K58A 1IKVA 2KQ2A 3MFHA 3JPNA 3ZT1A 4UB2A 4PUOA 2ATLA 4CJQA 4RPZA 1J5OA 3NTUA 4IR9A 2XY5A 3MGHA 4AILC 3BQ2A 1LWCA 4EZ6A 4I2PA 4KN4A 4DTSA 1XU4A 4FLTA 4CJTA 2FMQA 4UB1A 4GLXA 3RJHA 1RTIA 4M9NA 2V4QA 9ICHA 5KFFA 4J2EA 2DFEA 1TKXA 4C8OA 5I42A 4ZH4A 2G8VA 5KRTA 1ASUA 4J9OA 4OKEA 3LP1A 2VA3A 1S10A 2XY8A 4BGDA 3DM2A 5CHGA 3HK2A 2D5RA 4UBBA 5DG8A 3AU6A 3VQ7A 4DL6A 4FJLA 3FFIA 2DTUA 4Z4EA 2HHWA 3AVNA 2Z1JA 3RMAA 7ICTA 1WSHA 4R8UB 2FLPA 4F2SA 3CFPA 5CYQA 5J29A 3ZSXA 1SZPA 4YFKA 4IRKA 1X1PA 4KHNA 2OPSA 4Y1DA 5C42A 3T19A 3MECA 4KB1A 3PW2A 4FJXA 5KFAA 3KK1A 8ICYA 3EYZA 4LH4A 4HUGA 5KT5A 3GDXA 3RJKA 3RAQA 5J2FA 1LWEA 1J53A 1BQNA 4LZDA 3ITHA 1T3NA 4Z4FA 4J9LA 1T4GA 4E19A 4KKOA 3OS2A 3NGYA 2ITGA 4FJMA 1A5VA 1LB2B 3M8PA 2J6TA 2B21A 3WNHA 4P2HA 3VQ5A 4B9VA 4ECTA 1B9DA 3O4NA 4KLQA 1Z00B 5J0XA 2ISOA 2RN2A 2WTFA 1FKOA 3VN5A 4E7IA 7ICUA 1YTAA 4DTRA 3AUOA 3MR3A 4O0IA 1D8YA 4I2CA 1K1SA 3TAPA 3DLRA 3LANA 2BQ3A 1ZJNA 3KD5E 4KLHA 2Z1HA 5KG7A 4H4OA 1RTJA 4DSEA 2X78A 4PGXA 4DL7A 1S0NA 4YMMA 5L1IA 4DF4A 1ZQCA 1VSHA 3VQ8A 4QW8A 2RKIA 4CHYA 2DPJA 3MR6A 1B9FA 1U48A 4OJRA 4TQRA 5KFRA 4QZ8A 4MFBA 5J0WA 3NF8A 1RT4A 2ZTCA 3CFOA 3NGZA 2B5JA 5KFVA 4KLEA 9ICLA 4IQTA 4DFKA 7ICNA 4Z4GA 1ZQTA 1LW2A 3ZT2A 4CJPA 1RT1A 3K5LA 4YD1A 5KG2A 1IKXA 2XGPA 4KLIA 4FJNA 1ZQKA 2HVIA 8ICUA 2P6RA 4QWBA 2VG6A 4BE1A 3HVTA 5J0RA 3GIJA 5BOMA 2PXIA 1NKBA 3OYBA 3QNOA 4DSKA 1XWLA 3QLHA 1QS4A 1RBRA 2BCQA 5DDMA 4O0JA 8ICXA 4YNQA 1S1TA 3DRRA 4ED2A 4F5OA 3SI6A 1L3VA 2FPKA 3Q8PB 3ZDCA 4E7JA 2OWOA 3KLIA 3PY8A 1Q9YA 3SV3A 2AU0A 5KG1A 5CWRA 4IR1A 4UAYA 4I2AA 1XSPA 2G8WA 3HXMA 4DOBA 5KT4A 4LD0A 3KLGA 3KK2A 3OHBA 1ZQIA 3TFSA 5E41A 5KGWA 1HPZA 3U6FA 3OYGA 3IAYA 2DY4A 1TVAA 4RZRA 2C2DA 2J6UA 1C0MA 1TAUA 3AV9A 7ICHA 4PHEA 1RDDA 2IS3A 3MXIA 3ZCMA 5EU7A 2J6SA 8ICWA 2OA8A 2BANA 4E1MA 5KFBA 3TABA 4FLZA 3OY9A 4GXIA 1KDHA 2YHBA 7ICEA 3Q8RB 3V9SA 3V1OA 4FJIA 5JS1A 1TV9A 4UB4A 4FK2A 4HVJA 1X9MA 4CIGA 4QZDA 3BGRA 4FM2A 4CK1A 3L2WA 2FBVA 2ALZA 4RUAA 3OYHA 4FJGA 4JUZA 1VSEA 3RB0A 4KO0A 5CYMA 3RH6A 4P4MA 3AVLA 3MAQA 4FS2A 1L3TA 2Q3SA 3OS0A 3ZSQA 4CHZA 1KSPA 4F4KA 1KLMA 3SPZA 5KG4A 4YFUA 4BXOA 5IIOA 4Q43A 1N56A 5KG6A 3V6KA 4OGEA 4G1QA 2I1QA 4LY7A 4LSNA 3DLHA 2HHQA 1EETA 5D4BA 1NKCA 4R8UA 3CM5A 3PX0A 2X6SA 7ICKA 7ICGA 4K4HA 4DG1A 1KFDA 2VANA 3ZT0A 4RQ5A 5KFUA 2LSNA 2JGUA 4RQ6A 4F5QA 8ICCA 4M9LA 4Z4HA 3H08A 2DFHA 3V9XA 4E7HA 5DGAA 4O3OA 3RB3A 5CA7A 5J0SA 2FLLA 4GXKA 3TR8A 4P4OA 1NOMA 4MF2A 4NLKA 4N41A 4KHQA 4RQ4A 1JLFA 3NBPA 3NFAA 2ASDA 5J2HA 3ZT3A 4N56A 3GIKA 1C1BA
chains in the Genus database with same CATH superfamily
1WUAA 3FK4A 3KNAA 3QQCD 1TKZB 2XYHB 4F04B 1RGIA 2XRIA 5HVGA 1CRXA 3ET6B 4JBCA 4IJAA 1HPMA 2R8GA 4CJWA 1Z00A 3GIMA 4DI6A 5GAGP 4OJLA 4UB3A 2J76E 3HP6A 4FLXA 3D2EA 2EWSA 2IDOA 1J2VA 4FWOA 1IM6A 3K89A 4B3TF 4FZLA 2OPPB 2PYJA 2HS4A 3ULEA 2P9KA 2C22A 2DEIA 4DL5A 3QMQA 1U8SA 4B02A 5HQLA 3RR7A 4X4SA 3ZYYX 3BKTA 1S7HA 1RABB 5FRNA 1GLCG 4MIBA 1IKYA 1NB2A 4KTWA 2KTQA 3M4XA 5KFXA 1L7OA 1OY8A 2IJFA 3JQMA 1HYSB 1VSDA 3R1XA 4Y2PA 4FJ7A 4BACA 2I9SA 4O3MA 2OHFA 4ERDA 3PJ9A 4BC7A 2BOAA 1NH8A 4JKGB 1M90O 2K4HA 5HK4A 3EZUA 1N33K 3QWPA 5ETVA 4OZ0A 1J54A 4LF7F 1RTJB 3UDLA 2P9NA 4AL6A 1K8KA 3WKBA 3ENAA 3KZIU 2KD1A 3G8SA 5K4LA 1LAVA 1VQ4N 1IM4A 5C5JA 2ZWOA 3P5BP 5AJ3K 2ZBIA 3AAWB 1XSNA 2ZH7A 5J2NA 1K8AT 3EGZA 2CQCA 3TEGA 1WAFA 2XEXA 3QSIA 2XHBA 1U0HB 3ZZRA 2AT1B 4I2DA 4C4SA 1TL4A 3LQVA 1GO3F 4Q0BA 4WU3A 2ZTEA 4DV1K 4LF8J 4A8KA 4DS5A 3BH7B 3CO9A 2DNYA 4C2MA 1QSLA 1FK9A 4I56A 3TUJC 3M6GA 2V8DA 3MOZA 1WYGA 3C3LA 2JC1A 3CDWA 4UOGA 1DRGA 4QPTA 2FVCA 2VFRA 3B6BA 5D15A 1RT2A 1SB3C 4K0KK 3KUGA 1WF1A 1ZQGA 3MGIA 2UYTA 2HQFA 1VSIA 2E1MC 5GADI 5D8HB 2DXDA 1C1CA 3THWB 3Q8UA 5CHIA 4MO5A 3KLIB 1ILYA 4ENOA 3PNCA 3W3SA 3OHRA 4BREA 1NH7A 4TKTA 2OP5A 5M1FA 5E79U 3CCJN 1RQNA 3CULA 3WK5A 2KMDA 5L1LA 3JS9A 1WEXA 1EKEA 4FJHA 2HVZA 5EDWA 4PABA 2YH0A 1VFJA 3FCVA 3WXLA 3O9QA 2CQ1A 4C8NA 4DV4J 1NDKA 5LMNJ 3A8EA 5H9FJ 5TZVA 2MZTA 3ZX3A 1WC3A 4F9OA 1HKAA 1BCOA 3G71S 3I55S 2XI9A 2GELA 4LREA 1FRHA 2W6KA 5L1KA 4P73A 1CI4A 1VRTA 5J2GA 3HSJA 4R5PA 1A7GE 3WHIA 2Q79A 3K8WA 4DX7A 2J9EA 5A6PA 2Q0UA 4V19X 2HGLA 2VKQA 4G3IA 3T7ZA 1VAZA 3W62A 4WF9L 1ACMB 1S1VA 3O3GA 2LQ8A 1UFLA 4F26A 1S4EA 4UB8U 2V4RA 1U1OA 2YTCA 5JTIA 4KO0B 5CYMB 3JPPA 1XMOF 2CQDA 3MEKA 1A6LA 2YX6A 3EWGA 1KEJA 3IBPA 3MCOA 2PI4A 5HSPA 1CXUA 4ZCLA 3CQYA 4ZPTR 4QS8A 9ICWA 2B9WA 3QJLA 5LMUF 3I31A 4FM1A 1F5CA 3IBWA 2D7SA 1WCLA 4DG1B 2R8IA 2XO7A 4BROA 1FFWB 2K8BB 2MKJA 3M6UA 3TX8A 2OEHA 1TZ0A 4K41A 4W5TA 3ZDBA 4Z6EA 4UW2A 3F2KA 3TJ8A 2GMHA 9ICQA 1N6QA 4KAIA 3PSTA 1L3UA 1CG2A 2CQGA 1F5BA 1SZ2A 4KGKA 5BR9A 3HYFA 2EVZA 1QAIA 5KT2A 3RG6A 1FESA 4G6VB 2MDAA 4FYXB 1SGGA 1BXNA 5M1OA 1NLKL 2QMWA 1CJUA 4KLFA 3N7RC 2B4PA 3TWZA 3KJVA 4TY9A 4B9LA 4KIAA 1XNQF 4CEQA 3TA2A 5DB7A 1AZSA 1B99A 3M9MB 3HILA 5BYQA 1JL2A 4FJKA 1ZQMA 1ZQXA 1EARA 3GR0A 4JYAF 2HBQB 4K4GA 4BR7A 1UCVA 4KLTA 4WZQA 2RUGA 3VA0A 2E5JA 5J2IA 2HHVA 5AQMA 1FJGK 1CZ9A 3TEHB 4WFXA 3HFKA 1IIPA 4FW1A 2OFGX 2L9WA 3MHYA 5E3PA 2QIFA 1GFWB 1W2BR 4JB3A 3EL2A 3MCSA 5GAEI 1MG7A 2UXBJ 5AQFA 3S6JA 1X9WA 2DT9A 1YAGA 4KRFA 3DLEA 1BHLA 1WG4A 1P90A 5J2BA 9ICVA 5J2CA 4CGFA 2A40A 3KKFA 3QGPA 3JYTB 2RRDA 1KHVA 5AZJB 2HNYA 1R8BA 4KI6A 4RU9A 3B4MA 2RHSB 3AMZA 3DLGB 3DDIA 2F9TA 4CK3A 3R9LA 4PL8A 1NBWA 1RWVB 1RT7A 3W9JA 2UP1A 3G25A 2WHEA 2HBLA 3J7Z5 4Q2MA 5E5NA 3GG1A 4CO4A 3M7VA 4O5FA 4F0KA 8ICRA 2L08A 1A0OB 2HNDA 3JB9k 5J0YA 1P8GA 2G2OA 2XY7A 4DSIA 1NHVA 3J7YP 2IDEA 2MAXA 1RBTA 4I6AA 1NMDA 1NBEB 3THYB 2ITMA 1VQ7N 2F8SA 4OCZA 1YJ7A 4C8KA 5ETMA 2RSQA 3PW5A 1RDWX 1N88A 3ELHA 3OYFA 3FZBA 4C8LA 1BIZA 5G4DA 3V9UA 1YX2A 4C3KA 3RRHA 2WAQD 3U26A 4NLYA 1P27B 1TKTB 4MIWA 2RS8A 3AXMA 2ZJRQ 1DRZA 1Z1BA 1IG9A 2CPEA 3QU9A 5KT6A 3BN4A 3MBYA 1QQ6A 4JK8A 3O80A 4I9LA 3VCBA 3PCOB 3AAPA 4OHWA 1IJEB 1ZQUA 4ATNA 2B51A 3FSXA 3VENA 4WP3A 4L76A 1KAYA 1BI4B 1S79A 4CT9A 2LA4A 5BPLA 1YK9A 1H2UX 1WLJA 1F5AA 3G71N 1H73A 5K9FA 1S6OA 5KFHA 4QS9A 2DR7A 2Y9UA 2VGNA 3L7OA 2XGQA 2IC3A 5B09A 4DS4A 2VKZG 4OX9J 4NXNF 4EP5A 3PX6A 4LT6A 2KVQE 3MCAB 4YHHF 1GXUA 5DLGA 1U02A 2VG7A 4FWQA 2WFAA 4YS2A 2JEIA 4KHUA 4IYQA 1HBNB 3NKYA 5G5GA 5TISU 1F44A 4KLGA 2WOMB 2X6NA 3RZAA 3PKYA 5KFZA 2MLZA 3OW2M 3UWTA 2ZJ8A 5E3AA 4TU9A 4PGQA 3BGFA 2UU9K 1HUOA 3BBBA 3TAMA 1JJ2R 3V4IA 3RJJA 4YDUA 1HRHA 3MM9B 5DBCA 2HHHJ 3QFUA 5AQZA 1FI4A 1SQFA 3QT8A 3M30B 1U2RA 5HRNA 4P2SA 1S1UB 1ZQOA 3AH6A 3QINA 1ZQJA 2XZWA 4QZHA 2XSJA 4I4BA 3M6KA 3MTJA 4MLHA 1AB8A 2KZ3A 2VV5A 4KTZA 1C4CA 2ZKUA 1Z1VA 2NRVA 2DGWA 4I2IA 2ZFHA 3JXUA 2WRMA 4FJ9A 2ZM6F 4JI8F 2ZUBA 3QIPA 2DPNA 2YY6A 4AL7A 1Q82T 3WZ0A 4OHVA 2JJ4D 2KI2A 1Q86O 4PPZA 1B43A 2ILZA 4OZJA 1FJCA 3TSUA 7ICSA 5KFYA 1J9AA 2MKKA 4K43A 2VPYB 3KDOA 1OPIA 1TL1B 3QZ8A 1RCOB 4I2HA 3CJ5A 4H4KC 2RQ5A 2EI5A 1R0AB 3D7EO 4PY5A 4FF1A 2E9RX 3TADC 4QZGA 1S48A 1JL1A 5DM6Q 3M8ZA 1D8ZA 3SMZA 5IIMA 3ZTQA 1WNSA 2FYXA 2R8KA 5KQDA 4ZCIA 5KFQA 1FRLA 1HNXJ 1GLAG 1BNOA 3HFZB 2ADBA 2DO4A 1MA7A 2ESEA 3FC4A 1KFTA 4FYDA 3H0LB 5KFOA 1FDBA 1NM1A 5F0XA 2BKEA 2NRXA 4E1JA 1XNRK 4AYBC 1SC6A 4DQ8A 4IO9L 2X74A 1Z4NA 5B0BA 2CPYA 2O8CA 1VC5A 1V3ZA 4JI6F 5CCMA 3UNGC 1QZ6A 5E3RA 3E01A 3WC2A 1BGXT 2AJ2A 4KHPK 3AM9A 3GOIA 3MAAA 1KONA 4TY8B 4XO0A 3OYJA 2OSQA 4J7CA 1QUVA 4ZHRB 3TR5A 5C15A 2FJWA 2ZGZA 2H3EB 3F5EA 4XPCA 1FIQA 2ZBRA 4YY3J 4KLLA 3N4QA 1ZBUA 4IFVA 2V0NA 4UT4A 3RW6A 4IG0B 4H0VB 4RNOA 2HQGA 1FO1A 3RJEA 5J1EB 5ALDA 4WCEQ 4FLUA 3SI8A 1MQ3A 1WKLA 4C97A 2BRKA 1ZBFA 4EEKA 4Z7YA 2VH7A 3EVMA 3E9LA 4TNOA 4DPUA 1BIUA 4CF5A 1MWQA 3IS9A 4M5MA 3SCJE 3KG4A 1T02A 5K8PA 5CCLA 3ZD8A 4OYZA 5A8RB 1T9TA 4NLXA 3TANA 1JNRB 1VC0A 3VGMA 3VQDA 3G2XA 3EUNA 2Z8QA 4NLOA 4IH6A 2FHKA 2E5LF 1MDUB 1T3VA 5B7WA 2FLOA 4FYVB 1U26A 3T5LA 4M63C 5AE3A 4CJVA 4BJQA 1ZBIA 3AVKA 1SL2A 4OGCA 3CXCM 4K50A 2FJBB 2KRBA 4NO7A 3NVWA 5B0CA 1A0PA 1X4AA 2DGSA 1D09B 2CJ9A 4K4SA 4I27A 3V7KA 3VQAA 4B08A 1WEZA 1O03A 5I3PA 3TP2A 4M5LA 1VQ5S 3SCIE 4ZVRB 3AVMA 2ZJRL 4PGYA 4NLCA 4LRAA 1VYAA 4PG4A 3GV5B 3ZNJ1 2IJNA 1KXPA 4FKYA 4KHSA 5HR7A 5KFKA 5HR6A 2AYGA 3RB6A 4P9SA 3T1AA 2XIDA 4RO0A 2V5HG 1FT8A 1SIZA 4A57A 3JS6A 1EB0A 4BE2A 1LNQA 5GMEA 4WFBQ 3P39A 1EQYA 1B22A 2CVIA 2JHDA 1EXNA 1C1AA 3TKAA 2ATQA 2Q4TA 4LSZB 3IDHA 1XQIA 1DLOA 4H54A 3DOLA 4DHYA 1CQMA 2KLAA 2OFHX 4K4WA 4A8QA 1WUDA 4OJHA 1XHZA 3IAS9 3OFEA 2F8TA 2XICA 2VOPA 2ZC4A 2YXLA 3GE1A 2WVCA 3LP3A 3O1WA 1SUQB 2NXUA 5D3GB 2WHOA 5KFLA 1FFGB 4KH0B 3DXKA 1IR0A 2ZC3A 4J2DA 1WWHA 1UHUA 5HP4A 1S3XA 1WC0A 4YEAA 3BO2A 3WC0A 3G6EN 2CDRB 3BQ0A 3A0BU 1S5ZA 2YNHB 2BCUA 4NZ0A 4GV9A 4RWWA 3T3FA 4ZVSB 2FSJA 2K4PA 3VTIA 4OLPA 2HF3A 3I28A 3F73A 1ZQDA 4GO5X 2IRXA 1S0VA 5LSRA 2HVDA 5HOOA 2W8KA 3AO3A 4CE9A 2ZF5O 4CZKA 2KHQA 5C2FA 4OZ1A 1IXRA 4ZDNA 2HHXA 2QEXS 2HB5A 2YKNB 2Z2MA 4Q8FA 1L7PA 1ZYQA 8ICHA 2CPHA 1LKZA 2OTJS 3QU2A 3MR7A 2CQ3A 4R79A 1RU2A 2YHAA 2F8MA 3KLEB 3G82A 4URQU 4NEYA 4BRCA 3SQ2A 1ZQVA 1LAWA 2FI1A 4YOVA 5AQQA 4PG5A 1RHRB 1J5EJ 2E8OA 5ALOA 3DC2A 3VEOA 3QFPA 4DTNA 4QAGA 3MEGA 2JLFA 3RUBL 2HWTA 3M32A 5D0EA 4DCPB 4V19J 1JXEA 4BQLA 2P9SA 1T03B 4CLUA 2VASA 1S12A 4CJUA 5FRMA 3VVTA 4F0HA 9ICGA 3AA3A 5BRDA 2GGPB 3ZXWA 1CEZA 4ECRA 4BRDA 2KN4A 4NCGA 1ZA1B 1GAOA 4CF8A 2V52B 2MMYA 3SDEA 4CGGA 5B0GA 1RDRA 2I5JB 5L46A 2G13A 4ED7A 5J1NA 3H8JA 4KPYA 4TUSA 1HNVA 2QKKA 1JLEA 3KOOA 9ICEA 8ICKA 3M1YA 2B7CB 2UVRA 4X66K 1PUZA 4ANEA 5AI0A 4RNFA 3PHEA 3NCPA 5GAHU 5HMMA 3Q8MA 4DSFA 4ZTJA 2ETJA 2OYQA 1W9HA 2Y1JA 3PYDA 5ALQA 3AJ2A 1HR0K 1KW4A 1Q5VA 4JHDA 3TRGA 3C6UB 1BU6O 4AHTA 3UPFA 4PPXA 2QXLA 1JLBB 2KJ8A 3MM6B 3VQTA 3AVGA 3K5NA 5K5MA 3CE8A 4RW4B 4K4UA 1Z19A 4DB3A 2HNZA 4RU2A 2ZOGA 2CNKB 2OEJA 2B4JA 2FC0A 3G10A 2YNFB 2DJWA 1M5OC 5A0YA 3CJSA 3RJMB 3H0RB 2GHWA 1C0TB 5C24B 2YKMA 2P51A 3HKWA 5CR0A 2HHUA 3CTRA 3RVCA 5EE3A 3U8XA 1VMBA 5HVFA 4ANCA 1ZQYA 1DJ0A 4YOWA 3CJ4A 3TZYA 5A8KA 2LYBA 1RAFB 1SJRA 3LTOA 4JI5J 1MWYA 1Y5LB 2V9KA 3TAGA 2QJ3A 3IKMA 1AQ6A 3W2VA 2A2DA 4N5SA 3THTA 1RXOB 1VQ5N 4O4GA 5ALVA 3HVRA 3ZZYA 2BW2A 2OZSA 1QE1B 3KFUF 4ECSA 3P31A 4A8XA 1KD1O 3KK3B 5IIJA 2AJ1A 3M9NB 4NLTA 5AKLA 3AVBA 4BVOA 1BPEA 2ZUDA 3UDVA 4QZFA 5A2QY 4X4UA 1MWZA 3R5GA 1CUKA 3DDHA 2HSTA 4WPAA 3P5JA 2R8HA 3I8DA 1S5JA 2CGJA 4OI6A 1V5IB 2RQ4A 4NL9A 2ZDOA 1B7YB 5LJWA 2YWGA 4I2EA 5DO2A 2HFOA 4YR3A 1WC6A 4ILJA 2F1IA 1NNDA 4DR7F 2AZ1A 4HUFA 3LZJA 3K17A 5BPCA 4JD2A 5DQHA 2O67A 4LMZA 3CJ7A 4NYFA 4V1Ak 1FTRA 2QWNA 5HQ8A 1HL6A 1TFYA 1QY7A 1JCGA 3LF0A 3GILA 4LF8K 1GXLA 1IR2A 2ZD1A 4OPKA 4ETZA 4M6WB 3OTEA 7FDRA 3QFWA 1FE0A 4JI1J 2E9ZA 1SC1B 2PAVA 2DF4B 3OYIA 3KUEA 1ZRMA 1LKYB 1HI8A 2IVPA 3E9OA 2DRDA 4AXIA 2VDIA 4GKJJ 4KV8A 2FY1A 1R27B 3H42A 8ICPA 1Z25A 2J7KA 2J8SA 1HBOA 2JEFA 2CG4A 3UN3A 4WFNQ 1WB9A 3E1YA 1Q7LB 2G4BA 4CEEA 3ZSOA 2M70A 2EG1A 1ATNA 4DV3J 4BRPA 4KBOA 2IJRA 1A5XA 5HLFB 1IBKF 4RQ8A 1RTIB 4NLNA 4FJJA 1GOBA 2W3SA 1FKAF 2ZJPL 1TKXB 1HQUB 1IN0A 4B3SF 3JQJA 3TOQA 1N34F 1GMUA 4QR0A 3OR2A 2MTLA 4R64A 3AVCA 5FDLA 4C80A 1S77D 2EBEA 1WOQA 4DV4K 2QM1A 5LMNK 5H9FK 3QT6A 1LWXA 2D6FC 3JPRA 1TMMA 2MPUA 4CJSA 3SJHA 3Q8VA 1RYSA 5LSOA 3VEXA 8ICMA 4MEYA 2GIFA 4DR4F 3EE9A 5GAHI 4MMOA 3T6JA 1DT9A 1YBTA 4USHA 3VEVA 3NWRA 2ZXIA 3NCQA 2F4VJ 4JLHA 3CJTA 3AEVA 4A48A 5ALYA 9ICUA 4ED4A 2LP4A 4YCXA 1FRJA 2Z30B 2K60A 2DHGA 1S72S 2CZ4A 3K75D 2BJ9A 4YOEA 3EXYA 4G9ZA 1K73O 4X84A 1ASWA 4L8RB 1FKPA 4Y2XA 3HHLD 2V2VA 1U6BA 8ICLA 2KYXA 3GP9A 2WBRA 5F41A 2LXIA 3GQCA 1U2CA 5AQOA 1RT5B 2FJAB 5HATA 2P5OA 3VQPA 3ZZTA 3IMQJ 1TVRB 3M8PB 3FCHA 1NK4A 3QNWB 4CZJA 1VLYA 4NCAA 2D0PA 3A2FA 1AT1B 3V81B 2YWFA 2A6MA 2Z57B 3THPA 2Y1LB 2DYAA 1HLUA 4A2BA 1VDVA 2AEJA 1R8HA 2MJUA 3NCIA 2A1AA 2AEFA 1VGYA 2MLYA 4CEOA 1S7IA 2RNEA 2KM8C 2WC9A 5J8YC 2ZBPA 1JXLA 1HBUB 5KL8B 3D54A 2WF8A 3JTPA 4H4OB 4NRUA 3C94A 3OFFA 2HQCA 2BW7A 3CJCA 2YX1A 4PRFA 2NRZA 2EWHA 3QEBZ 4IO1A 4MLEA 2RQMA 3D9BA 4X4TA 2RKIB 3KWIA 5HVHA 3QU5A 4IRCA 1OPZA 3LH2S 5AT1B 9ICCA 3ETMA 2A1RA 1GOCA 1WKJA 2HCFA 4ICAA 2UV8A 1Y4ZB 3A3OB 4E3SA 1LW2B 1QUPA 1N62A 4IBNA 3DYAA 1YG0A 3BM7A 4JRPA 3EY1A 2FF3B 3NMAA 5KGXA 3EVOA 4L75A 1KOHA 3MMAA 4XQ8A 1N54B 8ICVA 1DTQA 4YMEA 2VODA 1KQFB 4C23A 2KE7A 4ED6A 2CWXA 4ZVQB 4W4MA 5AI8A 2ZG6A 2CYYA 2UXBK 1QHTA 3QLHB 5A6WA 2UXCF 2NUUG 3MPVA 4FZZA 8ICGA 5T14A 1YIJS 1FD2A 3BBCA 1DKGD 1TK0A 3JPTA 2QFIA 3SUQA 3ZZPA 1G4CA 2BJ3A 4ZVEA 5CD4A 4GVEA 4CGJA 1EIYB 5IFMA 3MXJA 4ZCMA 4LF9J 2E88A 3KMSA 4W98A 5M1QA 1VK8A 1GMWD 4RW9A 2GTDA 5KL1B 3KLGB 4CFBA 5JUMA 2FE9A 3KK2B 3A8JA 3ILLA 3GSDA 3CCMN 1KDNA 1BVSA 1S6PB 2JOQA 4LBIA 5B0AA 2HBKA 1JX4A 1VRUB 3RMCA 2YKPA 2K8GA 4CZGA 3TAEA 5E3CA 3Q83A 4DCHA 4YOXA 2KQ2A 2VQFK 3AGRA 4JKBA 1GXTA 4PZVA 4I7FB 4RPZA 4KHMA 1HNWJ 1UPHA 2XY5A 3NNAA 3MGHA 2HFVA 3BQ2A 2AIRB 4GRSA 4EZ6A 4OJ5A 4I2PA 1E6VB 4E98A 1VQPS 2HG4A 1NGEA 4LF2A 1YZ6A 3A5LC 9ICHA 1VR6A 1SPBP 1Z4UA 2U1AA 5ALKA 5I42A 2CDQA 2LFVA 2YQ0A 4J9OA 3D7SB 2AF6A 2W2OP 5F0WA 4RNHA 4U7UK 2VA3A 1JJHA 3WK7A 3DM2A 5AR0A 3BYRA 2D5RA 4UBBA 5ITHA 3VQ7A 1F9EB 4PKIA 1Q81O 4F7VA 2HLUA 2L9NA 3EEQA 1P6TA 7ICTA 1WSHA 1VIOA 3MMJA 2Z2LA 3MM8B 2HPUA 2E66A 4MKBA 5FD1A 3ZSXA 4OX9K 2GQCA 1S6UA 4YFKA 3I56S 3NASA 1X1PA 4CZFA 2Y0SC 4Y1DA 3K1RB 3TZXA 4PYAA 2D0OA 1TL5A 4WBFA 8ICYA 2KU7A 2EG2A 4HUGA 1UL3A 4BHQA 3GSIA 1Q7YT 1LWEA 2W24A 4LZDA 2FY8A 3NXZA 4J9LA 2C2ZB 3OS2A 3QGHA 2PMWA 2HHHK 3OBYA 4M5DB 2J7WA 3B82A 2J9DE 3W2WA 2OPQB 5J0XA 2B0GA 2DHAA 2RN2A 4V19S 1FKOA 2RH3A 2NQPA 3VN5A 7ICUA 2FHJD 4Y2MA 1YTAA 3UMGA 3CJQA 3J7A1 2BKOA 3AUOA 4EHTA 5FPNA 2XS2A 4OO1J 4O0IA 1PCAA 1D8YA 4I2CA 2F40A 5ALEA 4PL7A 1LOTB 3K1ZA 2LMRA 1VRQC 1H7WA 3KD5E 3LP0B 3D2QA 3WXKA 4CI0B 4UQTA 1URRA 3AD9C 3AT1B 3VGTA 4FSVA 2X78A 4DL7A 2LEAA 4A61A 5DDQC 3NRBA 4H4MB 3ENHA 2DRBA 1ZQCA 3K8VA 3VQ8A 3HRDD 4CHYA 1S1XB 2Q0RA 4NASA 4FWKA 1NPPA 2FC9A 5J0WA 1FE4A 2QL9B 3NF8A 1RT4A 2P2CB 4L73A 3GR1A 4KLEA 4DFKA 4YB7A 1RWWB 2X1BA 4N7TA 1RKJA 3ZT2A 4CJPA 1RT1A 2VFSA 3O4WA 2IOFA 3CC2S 2YWHA 3QWUA 1ZQKA 2HVIA 4QOTA 4C7YA 3KXDA 3OXLA 3DHWC 3OYBA 1RADB 3QNOA 2NCKL 4PQUB 4TLQA 2DGXA 1YWXA 1VBYA 1YTYA 5HMZA 1ZBSA 1YIJN 3U7JA 4HAIA 2H54B 3DRRA 1R43A 3MGVA 4F5OA 2FPKA 3W1YC 3Q8PB 3ZDCA 3OTCA 4E7JA 4ZS6A 2M9KA 5AM5A 3EZWA 4KQZA 5CWRA 3EGNA 4I2AA 1WTBA 1U2VB 2VICA 4DV7K 4YOYA 4YY3K 3OHBA 2V94A 1DQ8A 1HPZA 4FXVA 2OKQA 2HFSA 4UB6U 2ZIVB 1XMQF 4ZPWR 2W3RA 1TR0A 3D6TB 7ICHA 3SXLA 3GU0A 5ETNA 4U7UD 4DV5J 5GAGI 1HBMB 4NPOA 4X4QA 4CD3A 4U67Q 1TYQA 1KDHA 2BM1A 2HYIB 4OYOA 4DUYJ 1S9GB 1X4BA 3AN1A 1U1MA 4UB4A 2PA8D 4HVJA 3MM7B 2A6AA 4C0HA 4QZDA 4WP9A 3I5BA 4H5NA 1RBOB 4CK1A 2ZH9A 3R6GB 4C0BA 2VF3A 4M7YA 2ALZA 2ZUAA 4DR6J 4EIAA 1ZBTA 2VPXB 1ZH5A 3SCKE 3IV6A 3C6TB 3MAQA 5GMDA 2Q3SA 2H5IB 3OVAA 1KLMA 4Y2RA 5IIOA 4QYRA 4Q43A 1N56A 1X4CA 2Z4PA 2CPIA 5IWAF 4B1XB 3PXGa 2P9EA 2FDRA 1NKCA 3QAUA 3CC4S 3NNCA 2V7YA 3PX0A 3IWLA 7ICGA 4BRLA 2VIHA 3ZT0A 2FJEB 1RHKB 1IBMJ 2YI1A 2YX4A 8ICCA 1ICEB 1LVHA 3LP1B 1TUVA 3OXFA 3H08A 3G8QA 3ONNA 2R42A 4ZIVA 3V9XA 3PYGA 1PAUB 4MF2A 2WB1F 3GIRA 2RD5C 3R5AA 4ISEA 3NWGA 1JLFA 4Q7AA 1NZPA 5ALFA 5DM7Q 4NLRA 2MQOA 1PK1B 4FZYA 4NZ6A 1AFJA 4J91A 2GJIA 3HKZD 2MJNA 4WIQA 5AKHA 4ZVUB 3VGVA 1WD6A 2KW4A 4DR3K 3U3YA 5C42B 3MECB 3KHHA 3O3FA 2I5HA 2N3OA 3T1HK 1KBUA 1NJWA 4DLGA 4Y2IA 2YJFA 1WSJA 2IYGA 2Z2ZA 4QIWF 3NGRA 3L0QA 1ZPVA 4YXMA 5K8OA 4AL5A 5I9EB 9ATCB 2FF6A 4US8A 1N8RO 2XCAA 3BDPA 3SAHA 2DITA 1EHWA 1TFRA 1DARA 1NM2A 4YMOA 5J0PA 2EC0A 8ICFA 3DGPA 2CNOB 3FUYA 2RHKA 1SVDA 2KL8A 3C5FA 3WK8A 2IGIA 1MWMA 3EM1A 3MWBA 2RU3A 4R65A 2PZSA 1PG5B 2G0JA 4OYBA 3PJWA 2NRRA 3MPWA 2UUAF 1J5EK 2F1HA 2JWLA 1VQ9S 3BH6B 5ALRA 3HT3A 2GS8A 4ZVHA 2QTDA 2FHOB 4C4RA 2W6LA 1RDCA 2W9MA 1LXJA 3LPTA 1VLBA 2F9JA 3CF5L 1F21A 4IDKA 5C25A 2VCPA 2BE9B 1JN3A 3N9UC 5IILA 4NMXA 4MFBB 2ZUCA 4H5RA 2B5JB 3AA4A 2QWMA 3HZEA 2K8AA 1RTDB 4URGA 2XI2A 3DRSB 1C0UA 4ILRA 2R7OA 4ZN1A 3VV2B 4Y6IA 1QQ5A 1QQMA 4IQWA 4E89A 1UA0A 4LFBK 2V8VA 1BA1A 3AHPA 5L1MA 3EUB2 1M5HA 3CUNA 2HS3A 2DHSA 2X1GA 2V2ZA 1RAJA 1W7WA 4HVZA 1OYEA 1LW0B 5D46A 3W8GA 3Q8QB 1T9UA 2HRUA 3AGKA 1SL0A 4EX6A 1HNXF 2A18A 3ZDDA 2XG8A 2WCXA 3CQ8A 2PGCA 1S1TB 4XDCA 2XULA 4W5QA 4DPTA 1RFQA 4M0AA 1IJFB 3SQGA 3NH2A 3KLHB 4OLBA 3OTQA 1CQNA 3HHDA 3MPUB 2V8GA 1K9MT 4DBQA 3OLBA 1JLQA 9ICIA 1XQSC 3DCAA 4PL1A 1E6YA 1OH7A 2EW9A 5DB8A 4JKCA 5J0OA 4FBTA 4FW2A 3UN5A 2DGZA 4BC5A 4DPYA 3NF6A 2IVYA 4W92B 2R8JA 3H3NO 1FDNA 3PIOQ 3NMUA 3K4GA 1Q9XA 5DLFA 1RAHB 2P6TA 5AXKA 1GOAA 4X65F 2KFZA 3GG4A 2DNZA 2GWSA 2DFFA 4JI5K 1LOUA 1IBLF 2BANB 4OPHA 2QWLA 4L3NA 1UFWA 4EEYA 2OD4A 2ZWHA 5C0YA 1UOCA 4P72A 2P9IA 4YQWA 2XTJP 4WFAQ 3HOSA 1HA1A 4ECXA 4ER8A 1YJWN 2WK4A 2RF2A 3KD1E 4DZDA 4YOTA 2WZ1A 4BE0A 4RQ2A 2X1AA 1NI3A 3W0LA 4IOBA 1RCHA 1N5XA 1UVIA 2DXFA 4QWDA 4RPYA 2FLNA 2D1KA 2RPIA 3W9IA 3ZZ0A 1WHYA 1BWEA 4RT3A 4AT1B 4EBDA 4CIOA 1P8ZA 5M2UA 3NEKA 2HEKA 3BDEA 4LSNB 4WE1A 1EETB 4DCJB 2DR6A 3SQ4A 1GMVA 1N5SA 2HW3A 2XLKA 4NA2A 4CEFA 3DLKA 1XR7A 3D6MB 1TKZA 4NM1A 2R7TA 4Y2CA 2OI2A 4M7XA 4J5OA 3CP8A 2WMMA 2G1DA 4NA1A 3MXMA 3O1BA 4CFCA 1RK8A 4O5BA 3WEEB 3T5JA 3CG7A 3C21A 2G0IA 3ZETA 1RBAA 2NXJA 4H5TA 4CDIA 3J7YI 5LOQA 2W4DA 2RP5A 3AARA 3M3ZA 3GBTA 3LVVA 4MAKA 4KR0B 2OPPA 3H5YA 3IM8A 4JP8A 3EX7B 2AYBA 4IOCL 2F8EX 1O0PA 2DY1A 4J9KA 1V3SA 4LSLA 2WTUA 1I5OB 5EWGA 1NPRA 2JSXA 2CN1A 3BF4A 4KX5A 4CEAA 3VAHA 1KRPA 2D9OA 4BRAA 4CO3A 2F63A 4GKJK 2VQEF 3ONQA 3QESA 1RAGB 2K4EA 1QAXA 3ATUA 3U9DA 1HI1A 5AJ3J 4FNHA 5AKKA 3HHLA 3RBZA 1YJNN 4Z4IA 2HFZA 3HI9A 3GTYX 2RS2A 5J0TA 3D2EB 1J2MA 1HYSA 5DG7A 5BJRA 9ICTA 2BE2A 4DV3K 2FBXA 1Q78A 2LKYA 1T0TV 2LQJA 3A8KA 3OTOK 1HWIA 2F8KA 5F8MA 2LM4A 3ULEB 3A3NB 5HP1A 2R7SA 3PIPL 3MDAA 4YP3A 3VGKA 3RRGA 5AFUH 2ZHOA 1EZZB 1VQ9N 1S1WB 4DLEA 3AXKA 1XR6A 1ZQFA 2R7YA 3LDNA 2ES6A 2MY8A 2F96A 2DR8A 3D2FA 3PV8A 2B4VA 1TUGB 3MR5A 1ZXIA 2GVZA 1YKWA 4OYAA 1U47A 4H03B 1U0HA 1RNHA 5HMXA 2EANA 4DV6F 4IS7A 3J7ZO 1PC5A 4KLJA 2Z58B 4WWSA 3G8TA 4AHRA 4R25A 4KLUA 2LXUA 2JVRA 1VQSA 1SCJB 2UXCK 4JI4J 3CT9A 4LRDA 1AUDA 1BHNA 1VHXA 3AY0A 2PFOA 4QIGA 2P9NB 1YT3A 4NLPA 2OXOA 2FDNA 3ALRA 1K8KB 2OH2A 3OL6A 1HJOA 3UB5A 2HSZA 4EYHB 1ZQQA 3F9MA 4OVLA 4UW9A 2XMWA 3C14B 4I64A 5J2NB 2ZGYA 1F6TA 2YNGB 5J2AA 4N77A 4EUVA 1QTMA 4AP9A 2JZBA 1XNSA 5L1JA 5D6GA 5BN9A 3O5BA 3R9PA 1ZXOA 1IH7A 3NVVA 4LFAF 3H6EA 3R7NB 2NV3A 1PO6A 1FK9B 3KIOA 4F8RA 5K20B 2R4FA 4O9MA 3TA0A 1S4FA 4CDGA 4NYNA 1ZPWX 4IH5A 2QA4S 3AA5X 4O3NA 1SKWA 1RT2B 3OYNA 4NYZA 1GMWA 3KD3A 1ZQWA 2EXUA 1ZZFA 2WONA 2QXFA 3R2CJ 1C1CB 1V9OA 1UETA 3R1LA 5HMWA 2YNIA 1BPBA 2PFDA 4FO0A 1U45A 1RBLA 1W2BM 2IHR1 3CJAA 3OSNA 7FD1A 2BYCA 3D1HA 3P6YC 3NY0A 3R3LA 4JV0A 1SV0A 1VQLN 4J2AA 1T3QA 3O1LA 1WBBA 1U09A 5KFWA 4LIRA 4CW7B 5ALTA 3CRXA 1ATSA 2D0AA 4DV2F 2J5AA 3ISND 2ZIUA 1FFVA 1TP7A 3DXSX 1NKEA 1Q8IA 4B9QA 1VRTB 1NSKL 4R5PB 4LF4F 5BPMA 1BD6A 3H2LA 2JX2A 3HT0A 2WFBA 4FDFA 1RCXB 1NB7A 1UEKA 2P1JA 3GIIA 1NDPA 3Q0AA 1L7NA 2IOHA 2G5IB 3CO0P 4KRWA 1SB6A 3OGUA 3O2IA 2I1RA 4DU1A 4BBYA 1DAXA 4M8LA 4LF6J 1PVPA 3SR6A 4FXDA 1RYUA 3C2KA 2XBPA 4LF9K 1K6YA 4DHVA 5AI4A 1FJGJ 1U1PA 2V9WA 3A8YA 4RUCA 4AQYF 3LL3A 4OI1A 5AI9A 2BGWA 4E7KA 3D3CJ 3BSOA 3ILJA 1NZBA 2DXEA 4ELVA 1KQQA 1IO2A 2D3DA 2QC3A 4ED0A 5E7OB 3ZNUA 4B3OA 1KVJA 2BKNA 2NUBA 1HNWK 3TTCA 3QB0A 3T69A 3CJ1A 3AY9A 3KG0A 3NS1A 1WTFA 1N6QB 5KFGA 3BV8A 3ETOA 3FJ2A 2CNNB 1L7MA 4C8MA 1KC8T 3ZSZA 3E51A 4UUXA 1LQ9A 3CCLS 1MMNA 4BRGA 2FHJA 5J2DA 4NXMK 2CGLA 1C4AA 2I7PA 1ZM4A 3W64A 1U1NA 5F3XB 3W63A 4NLDA 4J9PA 4IOAQ 1CJUB 5CZ1A 1K0TA 2KVCA 5C2DA 4JI1F 1ZM2A 1NMEB 2ZNZA 5IIKA 9ICAA 1OQ3A 3ZSYA 1X4GA 3ZDEA 1BPYA 1M5KC 3QAEA 1N36F 3THXA 1T3OA 1NSAA 2MKIA 4B1VA 2CXYA 4I6MA 1JJ2M 3DLGA 3HSTB 4KJIA 1EQ0A 1PZNA 4EYIB 2KKVA 2A1JB 2HBJA 8ICEA 4K5RA 8ICJA 4OJ1A 2DNQA 5CEHA 4YN4A 3WQPA 3VR1A 2BCVA 4AD6A 1HYVA 2BPFA 2V2QA 2D8CA 2FQQB 4ZITA 2J8AA 1VOMA 4M45A 1L6NA 2IM0A 8ICOA 3DLEB 4ZK7M 2UZAA 2J9DA 4M3RA 4X4VA 3PO4A 3MTKA 1UZHA 4EZ9A 1REGX 4GC7A 2W9AA 2KG0A 2HNYB 2KXHA 5CRXA 3SMSA 4ZP8A 1MSWD 2V6AA 1SJ1A 3WU2U 3R7BB 5JVGQ 3S3MA 3C46A 2K8CB 1VQOS 2YB1A 1RT7B 2DNLA 1TKTA 1WSEA 1Q8BA 2GBZA 4ILLA 1BC6A 4RQ0A 2BQRA 2CADA 4DR2J 2XSFA 2WVDA 4HHTA 3DGVA 4O8KA 7ICIA 2O3DA 3IO1A 2K06A 3DDKA 3WUHA 1KVAA 5DG9A 1UA1A 2YKQA 2E1RA 3BUZB 5GAHP 2F4VF 3OUYA 3Q2SC 2LYHA 1QDUB 5CHCB 4DMZA 1WSGA 4P75A 1BI4A 2BPGA 4FJ8A 3LP2B 2GV1A 3BZQA 4ANDA 4KHWA 5AK6A 2HLTA 5ADXH 3W3DA 4YDDB 2MGZA 1X31C 3CDBA 5BRHA 4LR7A 3SBMA 5EE0A 2HBYB 3AO5A 3I32A 3C66A 1H6KX 4BS2A 4TLRA 1HNZF 3N0VA 3FSIA 1RYRA 3CIZA 3QFHA 4EBCA 2ZE2A 2HKEA 3O0FA 3IFRA 1RGVA 1HQEA 3FBBA 1NGCA 1FX2A 4LF5K 3O44A 2ZJ5A 2YKAA 5AXLA 3MMBA 4RWTA 3HHEA 4FE3A 3EPGA 4P2FA 2RHFA 1J27A 1TQLA 3DHXA 3M2RA 2Z56B 3CD6N 3IUCA 2IMWP 1TL3B 2EAMA 3BR9A 1IQZA 3SJJA 1KR4A 3HVAA 2A6OA 5G0RB 3B6OA 2AP6A 1U1RA 4BDZA 2BJDA 2XCPA 5ALHA 3LDSA 3D6HB 3MM9A 2WF6A 1V6HA 1XO1A 4HYKA 2IRYA 3TACB 2FMSA 2IC3B 2PIIA 2VJ5A 1I51B 2BUPA 3FEXB 4MK7A 3RFAA 4NXZA 1S1UA 4KMUA 3UXPA 3LDLA 2KHVA 2VG7B 1UQVA 4CGZA 3LPEA 3GFZA 1T05A 5AQHA 3PW0A 2E5HA 5F8JA 2YWKA 2Y1IA 1CZBA 3EZOA 3NAEA 2BJEA 1KCFA 1Z2LA 1B0XA 4BWJA 4GVLA 3M05A 3ULHA 4PWDA 3QRPA 4XA5A 4MEXA 3AVFA 3TAMB 3V4IB 1MMDA 3BPSP 3OTBA 3AVHA 1COOA 4LH5A 2PEBA 4OI2A 4NYPA 4DR5J 3N4WA 1S22A 1W0HA 4BX9C 4RQ1A 1X42A 2NRTA 1ED1A 3IBCB 4PWWA 4L72B 4MTPA 3NL0A 2FPHX 1Y7PA 1F2GA 2N82B 4DV5K 2XSJB 2H5JB 4OYWA 3POTA 1R0AA 3Q23A 1QZ5A 4Z4CA 5CZVA 3BBFA 4RL1A 2BRLA 4K4XA 4DUYK 4GKKK 2YVSA 1VHIA 4QZ9A 1N32F 2C3PA 3K9JA 2NO5A 1JCEA 4KLDA 3QIPB 1FCAA 2QK9A 5F8IA 1M1KT 3L2VA 4DQSA 3FZMA 1H0HB 3F5AA 1YF5L 2GEMA 2WVBA 3CCLN 3IRXA 2BTFA 4CESA 4RUBA 4WU2A 1D0EA 1QHAA 5GTIU 2LDIA 4ZPDA 3DXBA 1U6ZA 3CJ3A 3HO1A 2QWQA 3E9PA 3H5SA 1JALA 4ID5A 2HZAA 3U02A 1YJUA 9ICFA 2UUCJ 3R2DJ 3QEIA 2UUAK 4UBCA 2NRHA 3GJRB 3V9WA 2JFDA 1NOZA 3DNCA 4ILGB 1SV4A 1N5YA 2E2PA 2H51B 2CH5A 4JAXA 4TY8A 3RB4A 3MR2A 4I6YA 4CRXA 5IQQA 3HSDA 2V8HA 2YHXA 2RILA 4JI3F 3DI6B 4PPDA 3GV7B 3FE1A 1CJTA 2HAIA 3CCRS 3SEIA 1UPPA 1IBMK 5HJYA 4A8SA 1VQ8N 3QX7A 2ADCA 1NJYA 2OHDA 5J1EA 4CYUA 4NX9A 3NNHA 1J97A 3NP5A 1MN8A 2RAQA 2O8CB 2ZBCA 2XWYA 4DFMA 5AQJA 3E01B 2QG9B 2ZOFA 2ASMA 4LUBA 4PHPA 4XIUA 4WXOA 1ZQLA 2AJQA 3IR5B 4P0QA 4KN7A 5D4PA 3MFIA 5D78A 2JHEA 2MRLA 1T8EA 4X4RA 5HRRA 1NZ8A 1VQMS 1JROA 3M2VB 4TN2A 2PI5A 2QLXA 3ZSWA 2O4IA 3I9ZA 5LL6Z 1CSJA 4IFVB 2RRBA 3WKAA 3CFRA 1DTTA 2YX8A 2FJXA 2X3DA 4RUHA 4I2BA 4ED5A 1CZAN 3H2UB 5IM0A 2DHXA 2A1BA 2IBKA 2ABYA 2YPYA 3JTNA 4WQ5A 1O08A 1JLAA 2FGCA 4U9RA 4OJ3A 4DTMA 3IS9B 3I5CA 3PSPA 1BUXA 1BL3A 1PKUA 4OV6A 1ZD3A 4DOAA 2C2EA 3JPSA 4JV5F 2UUBJ 1RBSA 1PAEX 1FWKA 1R89A 4ECWA 2JXJA 2BQUA 3WIVA 2LU2A 4XPEA 3FBCA 3L8BA 4J9RA 2O8BA 1UCNA 2YHWA 4BR2A 3PUFA 1RXVA 4RPXA 4PH5A 3CSKA 2WB1D 2OM6A 3JPQA 2X51A 1I3AA 2GAGC 2GVDB 1I39A 2UVUA 3FQKA 1Q4RA 3N6NA 1DBDA 3H0PA 4Q45A 4ISFA 4ZN3A 5F3ZA 4KH4A 2P6SA 4OHXA 2CG8A 1X4HA 2HBZB 3UKUB 4F71A 2UVVA 3FM9A 1H2VZ 4B3TJ 4O44A 2HI0A 5L8RC 3ISDA 1HLWA 2LMIA 2ZJQL 1Q46A 3ZI4A 3T1YK 1KVIA 2E1EA 1ZQAA 5DGBA 4OX6A 4JS4A 2A3ZA 2FTRA 4QIWD 3T5KA 5F8HA 1SUQA 3D1QA 2KHOA 4HTIA 1CBKA 3EW9A 1B4FA 3P1GA 1SH3A 4NE9C 5EVZA 4F02A 4FVCA 3UVJA 3B8HA 4WF9Q 3M8QA 1WG5A 3SIPB 4EX7A 1X60A 4Y2JA 1DLOB 3DOLB 7ICFA 1B0PA 4CHNA 2MSNA 1HMVA 2VIXA 5AIBA 1HWUA 1IV8A 2H3QA 4KFBB 2EZXA 1OH8A 1I94F 1TUYA 3QJPA 4FPIA 3QEPA 4P2XA 2HZCA 3JSBA 3RJFA 2A1SA 2PMZC 1ZBHA 3H40A 4O5CA 5H1SQ 4CF2A 4BRIA 2CPDA 3DXKB 4CHOA 3UR0A 1X8DA 3PEJA 1UP1A 3LDAA 5T7BA 4DL2A 1SKRA 4GIBA 3LAMA 2GH1A 4PA1A 1NSPA 2D74B 2GW8A 1U49A 1RUSA 5C2GA 3AA9A 3KVGA 3OYMA 2K3KA 1RM6C 1JKHA 1ZZNA 2DFLA 2RHQB 1ZQ1C 4BR9A 2QI2A 2QKQA 4CBUA 3CEDA 1X4EA 3J81j 3CMAS 2ZH8A 3L5KA 4B9TA 2ZNYA 3TSPA 2NNWA 1DZ5A 3V6DA 5CYJA 3FFIB 1J2NA 1YJRA 3CJKA 2FBTA 4C1NI 5KAFU 1OW5A 2POKA 4MJKA 2DTJA 2E2OA 2KFYA 3NE6A 4DR1K 4IG3A 3AB2B 2BDPA 3L7UA 2NXEA 5F8NA 2NXCA 3G82B 2DGVA 1X5PA 3WXMB 2KT2A 4EHUA 3NGDA 8ICIA 2DBYA 3ALYA 3MEGB 3M32B 5H1SV 2OD6A 1Y00A 2HHTA 1QH9A 4CHPA 3V6HA 1B64A 2I6XA 1DY3A 5KT3A 3NHGA 3CCRN 4GV6A 1B3TA 5RUBA 2HGMA 2P9SB 5HHHA 2QTWA 2DKXA 4MFCA 1BQNB 2LKZA 2R3VA 2YCHA 4IZ9A 3I0RA 4EBEA 3ITHB 1HUZA 3HM9A 3C6UA 4WP8A 1UMJA 4CCHA 4DR6F 3GONA 2HQDA 3NGKA 4QJVA 1JLBA 3HHKA 5F2RA 2YV0X 4HCBA 1NXIA 3SDEB 1D9AA 4WTYA 2KKZA 3V2UC 1YBAA 4K4YA 2O8DB 4MN4C 4RW4A 4DUZF 1VQMN 1XERA 1HNVB 4BG9A 1T44A 1JMSA 3ZDAA 4DFDA 4K8XA 2YNFA 4OKJA 5AK3A 1NGHA 3G6XA 4DCCA 3QUTA 1C0TA 4TVAB 3E66A 2CPRA 2CKWA 3IA0A 5ETLA 2HHSA 1KQGB 2LBOA 1HWJA 3H4DA 1VJ5A 4WIIA 3NF9A 4JHDB 4RR5A 4XRHA 2W7AA 4PCQA 1TV6A 3HOTA 3ISCA 4M5KA 4GC6A 1F2HA 4YDUC 3VAIA 1RWPB 1NK0A 4FZVA 2Q97A 5M2PA 1GTEA 2AX0A 1KP6A 3GLJA 1XMOJ 1K0VA 2QWRA 3H4BA 2HNZB 2IAJA 5F8GA 1MNEA 3I82A 1CJVA 1X3MA 1H2TZ 5HRSA 2LCWA 4X62K 1GX5A 5A0YB 5BYRA 2OCEA 4OFZA 4RBUA 3KK3A 3QGIA 1ITPA 2YKMB 4KH5A 1YJ9S 4ILHA 4W5OA 3GFYA 3Q2TC 3UCUP 3QBWA 4O23A 4F92B 3UPQA 5LMUJ 3NS5A 3FZ2A 1IKXB 3SSSA 3TO8A 2BABA 2M4MA 5A8KB 2LECA 2QLTA 2UXDK 2LQBA 1A76A 4OLOA 4KLOA 2FPMA 1NGIA 2R9LA 3W2VB 1S57A 2BVZA 2HIQA 3TUPA 3WDOA 3C2MA 4O4GB 1Q0NA 4BG8A 3ZZOA 5AQNA 2EEYA 1WSRA 4UB5A 3U3GA 3HPHA 4QZCA 1VQNS 1WNEA 1VSFA 4DQQA 4IFYA 1U9LA 3QT5A 4M9HA 5HMLA 4B9SA 4NLGA 2MLXA 4KGMA 2KIVA 4F4XA 3S8SA 2G08A 5LY3A 2ZH5A 4M6WA 4JI0F 1WC5A 4JI4K 1XNQJ 3QEXA 3IC1A 5F8LA 3V1QA 4XH5A 3B6PA 2DGTA 2HMPA 3FDSA 5IT0A 1R6YA 3MAHA 1X5OA 4ZKAA 4JYAJ 4NI2A 2WF7A 3QBXA 3MK6A 1Y88A 2ZH2A 4XUSA 2KOBA 4MDAA 1HHSA 3C8YA 4K4ZA 2XMKA 2JH3A 3SZ2A 2HVHA 3HPOA 3K58A 4A2AA 1IKVA 2YX7A 1OVQA 4UB2A 4PUOA 2ATLA 2F9WA 4BUGA 1J5OA 4IR9A 3F5TA 2AMCB 4A5BA 2W11A 4KN4A 3D4JA 4LVNP 4FLTA 4UB1A 3KKAA 1RTIA 4JKHA 2V4QA 3UE2A 5KFFA 3OA9A 3Q7BA 3BGRB 4J2EA 2DFEA 1TKXA 4C8OA 1OO0B 2GHVC 4ZH4A 2G8VA 3OV7A 1ASUA 4X64F 3MWPA 3EGWB 4CH1A 3WT0A 1EO1A 1S10A 2I2YA 4BGDA 2O1PA 5H9EJ 4P0PB 4PR6A 2F76X 1DURA 3AJ1A 5DG8A 3AU6A 3N7PD 4B3MF 3DRXA 2DTUA 3J81U 2G2ZA 2Z1JA 2FLPA 3PRBA 2FVRA 2M8HA 3H5XA 5CYQA 5ADZA 2OTLS 5ALZA 3HVWA 1SZPA 2NSBA 3AQPA 2HOEA 3T19A 1GTHA 5IC4B 2VB6A 3JQKA 4FJXA 5FDLB 1JJCB 3OL8A 3KK1A 1VBZA 4C11B 3KOAA 2DRAA 5E3QA 1PBUA 5J2FA 2KIWA 2CRXA 3MURP 5DRKA 1T4GA 4E19A 4KKOA 1AA1B 3C7NA 2NXNA 4AYBF 1YI2S 5C12A 4ZOHC 2ITGA 3CCUS 1V4SA 4OIXA 1A5VA 1LB2B 3M8PA 1RWOB 4IO9Q 4P2HA 2NLWA 3L9ZA 3VQ5A 2FHMA 3C6AA 1B9DA 4KLQA 1D8BA 4P74A 2GIQA 3U1NA 4JI7K 4LF6K 3TJAA 3TAPA 4D3GA 1F3FA 1NHUA 2LI6A 3BS7A 2BM0A 3LANA 1WELA 1FKPB 1U1LA 1RWUA 1HBUA 4NXNJ 4H4OA 3DN9A 3TTDA 2I0XA 1YVNA 4PG7A 2HBRB 2D41A 4PGXA 3FEZA 3BGOP 1DFDA 4YMMA 3GB0A 1NLVA 3GPAA 5L1IA 4DF4A 1VSHA 4FZMA 4QW8A 2RKIA 3OBIA 4I69A 4CWBA 1B9FA 5DZ6A 3C28A 3CCWA 3PTWA 5KFRA 4HR2A 4USVA 1ZC6A 4BRHA 1OXJA 1T6CA 4EI2A 5BRFA 2ZTCA 3SCLE 1KKXA 3CCSS 1LW2A 3GJTB 3K5LA 4RTFD 2KJ5A 2XGPA 4FJNA 1S59A 3SBTA 3FGVA 5KQ8A 8ICUA 4EENA 4QWBA 2VG6A 2F9DA 3HVTA 3GIJA 4ZVGA 2VJUA 4O8UA 4ES1A 3J7AN 4S0MA 2MY7A 3QLHA 3BGLA 4LFCK 3I0SB 1N33F 1RBRA 1WHVA 3CCVS 4JI8J 2VQFJ 5DDMA 8ICXA 4YNQA 2XNRA 3SI6A 1L3VA 2XWXA 1SIWB 1VQNN 3UR3C 4RBVA 3SV3A 3D2WA 3DYAB 4QYZK 5AJ3F 3FZKA 4IR1A 2NZ4A 4W90B 1FERA 2E1ZA 2OGUA 3KLGA 2MHNA 3KK2A 3P3DA 4NWIA 5E41A 1DTQB 1RWMB 1IWAA 3OYGA 2DY4A 5SUHA 3TNVA 1TVAA 3Q24A 4DV1F 3C0BA 4RZRA 2C2OB 4FF4A 1X9XA 1OSDA 1V38A 4K4VA 3UMBA 2P9UA 5ETOA 1RDDA 5AZIA 3ZCMA 3BGUA 2OA8A 3J80U 5GMKa 4E1MA 3DOKB 1DEJA 5KFBA 3I55N 2H3GX 4EGLA 7ICEA 2IOFK 4K0KF 2CGKA 1JUDA 3V1OA 4FJIA 4BLGA 1GLBG 5AQRA 5JS1A 1TV9A 2LVWA 4RW9B 3R8EA 3UQSA 4DR2K 3MEDB 1X9MA 3ICXA 4JI6J 3GCWP 4DX8H 3L2WA 1UJ4A 1JQGA 2R18A 4OZNA 3WQUA 1Q86T 3T9NA 3W65A 5GVQA 3OYHA 5AQGA 3RB0A 4NLUA 2B6AB 1R0BG 4CNYA 1VBXA 2KJ9A 3AVLA 1VBKA 3OS0A 3ZSQA 2PC6A 5KG4A 1WBDA 4BXOA 2KT3A 4OGEA 4G1QA 3W5ZA 4USJC 3DLHA 4LY7A 2HHQA 2DKOB 3IBFB 2QW9A 5D0GA 4KC5A 5D4OA 2PBDA 1XJWB 2VBZA 2EDUA 2WBNA 3ATVA 3FSYA 4K4HA 4F3MA 3AOCA 2VANA 4M5IA 3H1VX 5I42B 2LSNA 5IZHA 2YY3A 3HF5A 2GJFA 3W7BA 4M9LA 4Z4HA 1WOPA 2CVEA 4MKAA 4E7HA 3DM2B 5DGAA 4O3OA 3RB3A 4A8YA 5CA7A 4OYMA 5J0SA 2VBXA 2R7VA 5TKWA 4P4OA 2Q6BA 3UM9A 4NLKA 4N41A 5AI5A 2Q31A 1DHMA 3NBPA 2DO0A 4YDXA 2YB4A 4N56A 2E5LJ 2XLJA 4BY9C 3OYAA 3GJQB 2YHYA 1A5WA 3E0FA 3SK3A 5IV3A 1YSJA 3H2VE 3RF9A 1IR1A 2G9OA 3D0GE 1TL7B 3K0JA 2ZIXA 5CZXA 4CJEA 4M95A 1KVCA 1QM9A 2HFNA 3KBBA 2DH9A 2E7WA 2F1JA 4CEZA 2CNLB 4IKAA 4NLZA 1F9FA 3RMDA 2JEJA 2IFXA 4WJ3B 3M1VB 5G5HA 1RTHB 3US5A 4QCLA 3R7SB 5J2JA 3KLFA 4RNMA 5JVHL 3OR1A 1JIHA 3VQBA 1SKSA 4NL9C 3H20A 4F0MA 2VHGA 1YITS 1LWFA 4DR5K 2P35A 4DTPA 3VGUA 4ICLA 2XI3A 3ENOA 2LQ5A 1CXQA 1ZETA 4M9GA 4F3OA 1U4BA 3J81O 3JTOA 3W2WB 4FWSA 1S1XA 3H90A 2HK2A 1SJFA 4KITB 5KAIU 1MMLA 3BQ1A 3IM9A 4MYTA 2H1YA 5J2PA 5IIIA 1VQKS 2MU2A 3NUQA 3PDNA 5BR8K 2L3MA 4JKEA 2FZKB 4CNQA 3AOBA 2BGGA 5H2FU 4JEPA 2GFFA 4B3RK 4DV7J 1K5OA 1S99A 2QFJA 3LUYA 1HNIA 3RAXA 3GU3A 5HAOA 4E2FB 2KV2A 5EWEA 2EKNA 1B70B 3ED5A 3NRWA 2CWKA 3ZX0A 2O5DA 4JK7A 2D69A 2GO8A 2KHDA 1SJ3P 2DNKA 4UAWA 2V4JB 1SQKA 1NK8A 4L6V3 3ZTRA 1FJGF 1QQNA 3R27A 1C0GA 4A8WA 2UUCK 3QT7A 2B56A 3AB4B 2DD8S 3K0SA 4QW9A 4JB8B 1RT4B 3CCVN 2VWJA 3CJ0A 3KK7A 3L3VA 4ISGA 2KNJA 2QL7B 3N5BA 1RT1B 2DH7A 5ALUA 4O3SA 3C5GA 3CQXA 4I29A 1ZQSA 4M47A 4QOZB 4DPXA 2BA9A 3MMCA 2KP7A 4H0PA 1SAZA 2XMVA 8ICAA 4QIFA 3AO1A 5J2MA 4CIEA 4DPWA 3QXGA 4IO8A 1JLGA 1GH8A 4FBUA 4CFAA 3Q22A 1RILA 1SWVA 2G07A 3N7SC 1S9FA 2P6UA 3DRRB 4XH1A 2IM3A 3M6VA 4RQ7A 1UWAA 1N0UA 3R3TA 3C15B 3OHAA 3HPGA 3WQTA 2AQ4A 3IP0A 5DBBA 1WC4A 1HPZB 4U8VA 2MZSA 4KBIA 2LQ9A 2HMXA 1PJ7A 3LDQA 1KOOA 2P5VA 2NO4A 2XB2D 2E2NA 2FIUA 5KG0A 5M1PA 1TUWA 3CC7S 2DNGA 1YRUA 3T9ZA 3T6BA 1TYQB 1NMNA 3IR6B 3LOUA 3QO9A 3VF6A 2V2KA 3OVNA 3DKDA 3EKSA 1RWKB 3L4QA 1NWKA 2UUBK 2QGFB 4DU7A 3TW0A 5AE1A 4DR3J 3DOMA 2D0BA 1N2XA 5KFPA 2DHHA 3MPYA 5ALPA 4MKVA 1ZOLA 1SXDA 3CCES 2MQNA 2IHMA 3T1HJ 4B8AB 3UW1A 1C0FA 5L9XA 3TQ1A 4A59A 5KFIA 4KHYA 3TA1A 4CJFA 4GV3A 2KM8B 1IG6A 2KT5A 7ICPA 3L3FX 1KLMB 4TXSA 2ZJPQ 5KFSA 5HMYA 4OZ5A 4O0NA 3VMFB 3SUPA 1BPZA 4W5RA 5J0UA 1EWRA 4JI2F 1O1WA 1WAJA 4CLTA 2JLEA 1MC8A 4B3TK 3J80O 1MWKA 2GC8A 4ZMMA 2UU9F 3G86A 4NCBA 2BMBA 3OL9A 5IT9U 3MM5B 2WAQC 4O5EA 2C28A 1TAQA 5CP2A 1TU0B 1WHXA 1VI7A 4EFAC 2AW0A 4BR4A 1BLUA 1XS9D 1OSCA 1X7VA 2RIJA 3KLVA 1WDDA 4I2JA 3C19A 1JLFB 4OL8A 3FQLA 4IOXA 4OI4A 3TARA 4K8ZA 5DJBA 2KZZA 4IQMA 2KHCA 5DDYA 1TUUA 4MFFA 2NYVA 4W5NA 1ZBLA 3M6ZA 3P8BB 4P10A 1S8OA 6FDRA 1Q8KA 5A8WA 4CECA 3IG1A 3EMTA 2HK3A 4Q5VA 3E3XA 4LF7K 3R5CA 3FZHA 2GX8A 4L3QA 3K5OA 1VQKN 4F3TA 3WNEA 5EX3A 2ODGA 4JS5A 1O5JA 3DLBA