4EZ6A

Bacillus dna polymerase i large fragment complex 1
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
580
structure length
549
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 192
structure length 549
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez6A01
1NK8A 3GILA 4W5TA 1G15A 4RU9A 4RUAA 3ZDCA 1ZQYA 1B9DA 2ZJ8A 3K57A 4JLHA 9ICOA 4N56A 3LALA 3ZT0A 1ZQNA 4FJ8A 5JS1A 3PX6A 4M04A 3RJIA 2IHMA 4CHOA 1LWCA 2P6RA 1CEZA 5DB8A 9ICUA 3K59A 4J9RA 1WSHA 4HTUA 4Y1DA 4FLZA 4BWMA 3KK2A 1VSMA 4FLYA 3K58A 5DDYA 4DL2A 1JXEA 2AJQA 5IILA 3TAGA 5J29A 3SZ2A 2Y1IA 2PYLA 1PZNA 4KLDA 3DLKA 3RAQA 4KLUA 1RBTA 5KG6A 7ICHA 4FXDA 4O0JA 4KRFA 4K4HA 1ZBFA 4RQ8A 3PW5A 4P4OA 4ELVA 4NCGA 2IAJA 2E6MA 4IG0A 4E7LA 4PUOA 2JEIA 9ICPA 1UA0A 4EYHB 4E89A 2HHXA 1KSPA 2V4RA 1U45A 2B4JA 1S1UA 4FM2A 3T5LA 3G6XA 1VK0A 1ZQXA 3OYDA 1UT5A 3SV4A 2XRIA 1S9FA 1ZQHA 3AO2A 4M45A 3FDSA 4ZH4A 4N47A 2XCPA 5KRTA 1S9GA 4M6WA 4EP5A 4M3UA 1N5YA 2R8IA 4OPKA 4QZFA 4TQSA 1GOCA 4Q5VA 5KT5A 4ECVA 4M6WB 1RT1A 5IIOA 3RR7A 5D3GA 3VQ7A 2W9AA 1NOZA 1SL0A 5DBBA 3JPQA 1ZQBA 4O3SA 1YVUA 4IDKA 4C8LA 4P4PA 2NRVA 4J9OA 9ICHA 4QZ9A 1HRHA 4Z4EA 4W5QA 3PMLA 1ZQIA 1IKXA 1TK8A 2BKEA 1B43A 2I1QA 1HYVA 4RW6A 1RYSA 3LPTA 5EWEA 1T05A 8ICNA 4TUSA 3C1ZA 4C8NA 1NKBA 3KKRA 4CGJA 3DRPA 5L1LA 3HYFA 4CIFA 3SYZA 4YXMA 3AVGA 2E4LA 5CR0A 2EX3A 4RQ5A 3NF9A 3HJFA 3K5LA 2XGQA 4DG1A 4DL5A 4YN4A 1RDDA 7ICKA 2F1JA 5C42A 3U6FA 3OYJA 5DQIA 4W5RA 4CJLA 4I29A 4RQ2A 4FLXA 1MSWD 3RMAA 3AA2A 3DLHA 4M2YA 8ICXA 4FBTA 4HYKA 5KFLA 3KJVA 3Q8QB 4QZBA 9ICQA 4KKOA 2O4IA 3ZT4A 4QZ8A 2D0AA 4M3YA 4OJRA 3SJJA 5HRSA 2IA6A 1KTQA 1HUZA 1WSEA 2DPIA 2AGQA 3JPNA 2R8JA 3V9XA 4DQRA 4JK1A 7ICMA 5KFZA 1XSLA 1S97A 4DF8A 4LD0A 4M9HA 4DQSA 1VSLA 4I2GA 5HMLA 4DSFA 4M9NA 1ZQAA 4M3WA 2RDJA 3GIMA 4DS5A 5FRMA 1ZJMA 2ASLA 2WOMA 3QETA 4DFJA 3TAEA 4MF2A 2G8KA 4HUFA 4Z4IA 1WAFA 1J9AA 2D0CA 2MUTB 2QKKA 2IBKA 5KFYA 1VRTA 4ED1A 9ICRA 2ATQA 4M41A 3OYFA 2G8UA 2HHQA 3MABA 4BE0A 1NK5A 3E01A 7ICTA 4E1MA 2RPIA 3GDXA 3LDAA 2HVHA 3AO5A 4OVLA 3GQCA 1KVAA 4OPJA 2XC9A 4DOCA 9ICLA 2PI5A 3C95A 3LZIA 5KFPA 5CA7A 5E41A 5D4BA 3V7LA 4AH9A 1SKSA 3T5KA 4RZRA 4CGDA 3QEXA 1JLGA 4ZTJA 3NGZA 2IDOA 4CIGA 1TFRA 3L2QA 4CE9A 4MFBA 2D5RA 4CGIA 3RMCA 4J9LA 4KLMA 3AA4A 4NLKA 4CJKA 3HVRA 2P1JA 4I2FA 1ZQQA 9ICEA 2ASDA 1XS9D 4UAWA 2FPKA 3L2VA 3G10A 3TR8A 4GC6A 4ZTFA 4NCBA 3ZT2A 1ZBUA 3KLEA 4BACA 4TQRA 3NF8A 3OS1A 1I39A 3O3FA 4FM0A 4UAZA 2HNZA 2NUBA 4Z6EA 1ZQSA 4QZAA 3CFOA 3P83D 3Q8SB 3HVTA 1K6YA 1TL1A 1ZQLA 3V72A 3RAXA 4X5VA 2ZTCA 5J0TA 4M0AA 4CHYA 4F2SA 4B9LA 4MEXA 1W0HA 2KQ2A 1UT8A 1TGOA 3S9HA 1RT3A 2YKMA 4IR9A 3RWUA 1F21A 1IM4A 2KN7A 5J2NA 4G1QA 4KHWA 8ICFA 1UOCA 4O5EA 7ICPA 4KTZA 2BCSA 3AVCA 2HHSA 4FJMA 3CM5A 4I7FA 3WNEA 4IG3A 3AVJA 7ICOA 1SUQA 4CF1A 7ICVA 7ICGA 4RQ7A 4UB5A 3Q8PB 4AHVA 4KMUA 4KLLA 2ZJ5A 4BXOB 4PA1A 5T7BA 4I2DA 3I8DA 2C2EA 3M8RA 1X9MA 1HJRA 1EP4A 3OSPA 2BQUA 1HPZA 2YNHA 4FJ9A 2HNDA 4E1NA 4ECQA 3M9OB 3LP3A 4DSJA 3QLHA 4M3TA 4NXZA 1JKHA 4JWNA 1BVSA 2VWKA 4RNMA 3LANA 4K8XA 3ZSZA 4PPXA 4IRCA 2XO7A 1K1SA 1DLOA 3OYEA 1DOQA 1XO1A 3P5JA 4KLOA 1LB2B 4KB1A 4FLWA 1RDBA 4BE1A 8ICTA 3UQ0A 1L5UA 4B3OA 3C6UA 1ZQPA 1XHXA 3S3OA 4GVMA 3VQBA 1C6VA 4OGCA 2BDPA 5DMRA 5KFNA 3JPOA 1S76D 2ZUCA 4F4KA 3UQ2A 4E7HA 8ICQA 1RT4A 5EWFA 3MXJA 3ZSYA 3PMNA 4O3QA 1JLBA 1T8EA 2DTUA 2BQRA 2JLEA 2OPQA 2ETJA 3BGRA 4O3NA 2ISOA 1RDCA 1JXLA 4QZIA 5C5JA 4RW4A 3DOLA 3RRHA 4KO0A 3RR8A 4I2PA 4KAZA 5IIJA 4R8UB 5KFEA 2F8TA 1C0UA 5DGBA 1ZQOA 1GOAA 4J2EA 3IHQB 4YQWA 3RJFA 5KGXA 1Q8IA 3RRGA 3AA5X 1L3VA 2FLLA 8ICUA 3ZCMA 3AVHA 8ICSA 1UAXA 2YHAA 2Z1JA 5J2QA 3GFKB 3L3UA 5J2BA 3Q8KA 1ZQRA 4KLQA 5KFIA 3BQ0A 5KG3A 1BPDA 3TAQA 1HUOA 7ICRA 2FBXA 3AVBA 5L1IA 2P6UA 4FJIA 5KG4A 4DL7A 2FBYA 4Z6CA 3TAFA 3OS2A 2PZSA 5J2FA 1B9FA 1VSFA 4F5RA 1T7PA 1FKOA 3JPPA 3AUOA 3BQ1A 2FMPA 4C8KA 5J0PA 1QSYA 3EPGA 3PW4A 1JL1A 3C6TA 5EU7A 4JRPA 4XQ8A 1NOYA 3VQEA 5HHHA 4QCLA 5J2PA 4CEAA 4NYFA 1XWLA 4BGDA 4RNOA 4LVSA 4DSKA 4K8ZA 1Y88A 3S3MA 4RG8A 1QLNA 3U3YA 4QAGA 3SI8A 5CZ1A 4B9VA 4W5OA 4O44A 9ICJA 4R66A 1BI4A 2AQ4A 1QS4A 3M8SA 1T4GA 1X2IA 4CEEA 2W8LA 5KG5A 2ZQBA 5KFTA 1WN7A 2BPFA 3TAMA 2Q3SA 3RBEA 1ZQZA 1RT2A 4B9UA 1KRPA 2YNIA 4IQUA 4J9SA 2J6UA 1TKDA 3OYBA 5KFUA 2A1SA 3DRRA 1REVA 1VSKA 1CXUA 2P5OA 5J2EA 1MQ3A 3O3GA 4KN7A 3EWAA 5C25A 4KFBA 1LV5A 2KFNA 3WNGA 4PGYA 2DPJA 4JV2A 2UVWA 3ORYA 3FFIA 2HNYA 3TWHA 4QWDA 2JGUA 1RT6A 8ICMA 4EZ6A 5KFJA 3ZT1A 2GV9A 4ED3A 3ZSOA 1A76A 3C2KA 2GWSA 4NYNA 4CF8A 1R0AA 4GXKA 3UXNA 5DLFA 4N41A 4QWEA 4FZZA 3NH2A 2FLPA 4DLGA 5IIIA 2QKBA 3ASMA 1IXRA 3T1AA 3LWMA 1YTUA 3V9WA 2DFHA 4JV0A 5EOZA 4R5PA 8ICBA 9ICMA 5KT7A 7ICEA 3QNNA 1NKEA 3RJJA 4DL4A 5I42A 1QSSA 2C2RA 3L8BA 3SUQA 1J5OA 4CEDA 4N76A 7ICJA 1NK4A 3CFRA 4KLEA 3MGHA 3QZ8A 4CJWA 5DG9A 3ITHA 1KVBA 3AO1A 3HW8A 3OYMA 3MFHA 2KTQA 1T3NA 3KIOA 2B21A 4M9LA 4UAYA 1S1TA 4FYDA 4ECZA 2JZBA 5KFDA 5KFGA 2Z1HA 3P1GA 2D0BA 1HNIA 8ICRA 4F4YA 2OPRA 3UIQA 1EETA 5KFMA 3NFAA 3VQ5A 4E7IA 1KLNA 2H5XA 4DF4A 3AVLA 4YFUA 3IS9A 1JLCA 1FK9A 1IH7A 1XSNA 2C28A 1ZJNA 3LP1A 2XHBA 1ZQGA 7ICFA 3RMBA 4FJGA 3E2EA 3V6HA 3K2PA 5KG0A 2JEGA 3T19A 4Q43A 3NHGA 3V9SA 3DRSA 4O4GA 4B9TA 4DTOA 3G0ZA 5J2DA 1KVCA 3MEEA 4TUQA 4CJ5A 4YR2A 4ID1A 2YKNA 2W9CA 4JV1A 2KW4A 4DTMA 5C24A 1NK7A 4NCAA 3KHGA 3RB3A 4KHQA 4CFCA 2XGPA 4O5CA 3HT3A 2DFFA 3V81A 4LH5A 4DTSA 3OSNA 4J9KA 4NLGA 5L1KA 1RCHA 3MXIA 4KLIA 1U47A 1HQEA 2PFQA 4CEQA 3AV9A 4CF2A 3H7IA 4F92B 4YFKA 5KFOA 3EY1A 3NGYA 4ED7A 2A1JB 2BCQA 4Q8EA 1NOMA 7ICQA 1CXQA 3DLEA 2O4GA 4RW7A 1KFSA 4KHUA 3K5NA 4CEBA 1JLQA 5HRRA 2BQ3A 4M47A 4KLFA 2G8IA 1ZQEA 8ICPA 2PFPA 2WONA 3HPOA 2BR0A 3OYKA 4DMNA 3OYIA 3SQ4A 5L9XA 5J0XA 4FK2A 3CG7A 3C94A 3HWTA 4HUGA 4DL3A 3RJKA 3SQ2A 4ED8A 1HMVA 5J2IA 2R8GA 4LSNA 3SUOA 1D9FA 1XC9A 5DG8A 3OHAA 2FBVA 4F4XA 1WCNA 3S3NA 5CP2A 3LAMA 7ICNA 2IHNA 3C21A 4ED2A 3EYZA 4XIUA 3ZDBA 5J0SA 1S9EA 3DYAA 4YCXA 5HNKA 2J6TA 4FW1A 9ICTA 2ASJA 2LYHA 1C7YA 2UVVA 1RT5A 5KT2A 3DLBA 3HSTB 2I5JA 5J0RA 2ISPA 1LAWA 1BL3A 4NLNA 4AILC 4CHPA 4IRKA 4RQ1A 4DOBA 3QE9Y 1Z00B 2ITGA 4OLBA 3KK3A 1TKXA 4FS1A 4Z4HA 3KD1E 4LY7A 4F3TA 3ZDDA 3VQ4A 2KZMA 1RBSA 4EYIB 3Q8MA 1TK0A 3MR5A 4KHSA 5DQGA 5BPCA 4KLGA 4M3RA 5L1JA 3PV8A 4I9QA 4PH5A 3AA3A 4RW8A 4FLVA 5J0YA 8ICWA 4UQGA 4DQPA 1SV5A 3VA0A 4KI6A 4F93B 3ETLA 3NBPA 4E3SA 2QXFA 3LAKA 4MF8A 5KFAA 4CJ3A 3DLRA 4QZEA 1LWFA 3TANA 3V9ZA 3UPQA 4CJPA 3T5JA 5KI6A 1S0MA 1JL2A 1C0TA 1Z3EB 4ECXA 3V7JA 1NKCA 1AROP 4QZGA 4I2BA 2IS3A 4MQ3A 3SNNA 4AHTA 2VANA 4DTRA 5DLGA 3ULDA 5KRSA 9ICBA 3JSMA 4IR1A 1I3AA 5DGAA 3PO5A 4CHNA 4O55A 3ZSXA 3QIPA 3PR5B 3GV8B 3KHHA 1BI4B 1VSIA 4DEZA 4J9QA 1VSHA 1BCMA 1L3SA 4O3RA 3CQ8A 3C5GA 2VWJA 3U3GA 4NM2A 4DFKA 3K5MA 5KGWA 3HK2A 3M9MB 1RT7A 1JIHA 1NJZA 8ICGA 4Z6DA 1C0MA 5J2CA 3OYGA 1KCFA 4PHPA 1BPYA 1YT3A 4FK0A 3VQCA 3AVNA 3RB4A 4LZGA 3ZD8A 3NCIA 4CCHA 3AVKA 4MFAA 3C5FA 3I0SA 1ZQDA 4RNNA 2Y1JA 5KFCA 3KHRA 4DO9A 4FVMA 3C23A 3RH4A 1FKPA 3V7KA 4DU3A 5CJ7A 4DSEA 3D45A 4RPZA 3H8SA 2VA2A 3FYHA 1S10A 1MU2A 4DTNA 4M3ZA 4YD1A 4CERA 2PYJA 3QESA 3AU2A 3ZSRA 3N97B 1IKWA 1RZTA 2G8WA 1U4BA 1BIUA 3EW9A 4KPYA 2A1JA 5KFQA 1VRUA 2XY8A 5FRNA 2ZTEA 4F8RA 7ICUA 1Z26A 2FPMA 3EZ5A 1RXWA 9ICIA 1RBVA 2F96A 4DQIA 3SQ1A 4FS2A 4HCCA 1IKYA 4ECRA 1TVRA 2Z1IA 4DTPA 2PFOA 5HRNA 3HL8A 4MFCA 4G3IA 9ICKA 3SUNA 4FJLA 3VA3A 2HHVA 4RW9A 4QW8A 4ECTA 3KD5E 1TV6A 2BE2A 4OKKA 1S1VA 3CM6A 4F4WA 4PGXA 2UVRA 4DU4A 2W8KA 2GUIA 1RPLA 1WSIA 2HW3A 4ECYA 1ZQJA 5IIKA 1RDAA 3DI6A 4NY8A 4DWIA 4KI4A 5KTQA 5DKWA 4DL6A 4CJQA 2BPGA 3L3VA 4KHYA 5KFWA 2R7YA 1RBRA 4ID5A 5TZVA 3NF7A 5FDLA 3H40A 4CGGA 1N6QA 8ICIA 5KT4A 4Z6FA 4DFPA 1Z00A 2IMWP 4R65A 4K4IA 5KT3A 3GIJA 2ZD1A 1HQUA 4CJTA 1TVAA 1U49A 4UB4A 1JX4A 3MR3A 1ZQWA 1KFDA 4KTWA 4HVJA 2G8VA 1N48A 4IBNA 4C8OA 3WNFA 2WTFA 1S0OA 5J0UA 3QZ7A 3UXOA 4CJUA 8ICVA 2C2DA 2W9MA 3LDSA 4AHRA 1QHTA 4CJSA 4I27A 4ICLA 1S1WA 3ZT3A 4O5BA 1U9LA 1TKZA 2PI4A 3BQTA 3RJEA 4J2BA 1N56A 4Q44A 8ICZA 3WNHA 2P51A 1BISA 2FMQA 4ELTA 1A5XA 2AGPA 2YNFA 3VQ9A 2IOCA 3IG1A 3HM9A 4I2EA 3PR4A 8ICHA 1X9SA 4CFDA 4KLHA 4XUSA 3OYLA 4RQ3A 9ICGA 1JLEA 2RF2A 1SZPA 3BJYA 3O4NA 3IRXA 1QQCA 3AU6A 1RTJA 4R64A 3MDAA 4UB1A 1Q9XA 3DOKA 1LW0A 4CJEA 4F3OA 4KN4A 2F1IA 3JPTA 3V1RA 3IM1A 2OWOA 3RTVA 4RPYA 1WCLA 3PNCA 2HHWA 4YMMA 1C1CA 1C1AA 2ZJAA 4F91B 3VQDA 3RJHA 2DFEA 5F9NA 3TFRA 8ICOA 3CFPA 3PX0A 3HXMA 4O3OA 1EXQA 3MEDA 3TARA 5IIMA 5I3UA 1NJYA 3QEPA 4KLSA 3NH1A 2F1HA 3G6VA 2VG7A 5DBAA 3NE6A 2LSNA 3AVFA 4E7KA 4H4OA 2F8SA 3B0YA 1BPXA 1D9DA 2J6SA 4Q8FA 3SV3A 1VSDA 7ICLA 1A5WA 4I28A 1LAVA 4YMOA 2W9BA 2FMSA 1NK0A 2OPSA 3MBYA 3M8QA 3AO4A 3MGIA 1XHZA 2P5GA 4B9MA 1HJPA 4DSLA 3QO9A 3MDCA 4CF9A 9ICFA 3BDPA 2HHUA 3MFIA 4J2DA 4YR3A 1RTIA 5KG1A 3KLFA 4M9JA 3V1QA 5JUMA 4CHZA 4DS4A 1NJWA 3HPHA 4B8CA 4BDZA 3BQ2A 4JRQA 1ZQFA 2BGGA 4Y1CA 4FZXC 2BCUA 1YTAA 4DTXA 3K5OA 5J2GA 4GC7A 1EKEA 3I0RA 3OVNA 2VA8A 4O9MA 3C2MA 4B08A 5KFFA 2Q0ZX 3F73A 4KLJA 3HP9A 3OYNA 1KFTA 4P2HA 1S6PA 4F4ZA 1T03A 4RUCA 3ZD9A 3NGDA 4KV8A 4LZDA 2MUTA 1D8LA 1KDHA 1GOBA 5DB9A 4EBDA 4M42A 1ASWA 2EHGA 3OJSA 4E19A 2AGOA 3PX4A 3ZSQA 4CK3A 4PWDA 3K75D 3MEGA 1L3TA 1CZBA 4UB3A 4KLTA 3QNOA 3SQ0A 3HPGA 4FO6A 1UWBA 3M9NB 5EWGA 5FROA 5CWRA 1B22A 3NH0A 2PY5A 4UB2A 2OA8A 5D46A 2X78A 5HBMA 1SL2A 2FC0A 3AVAA 1B92A 2M9NA 3ISDA 1ZETA 3PW2A 3TQ1A 2NRTA 4LH4A 2ZTDA 4I2HA 5BOMA 4Z4CA 2BCRA 3IAYA 3OHBA 3JPSA 4CGFA 4FK4A 1DTQA 4EEYA 5HLFA 2BANA 4PY5A 4CF0A 2ALZA 1K1QA 5KFVA 2BHNA 3AVMA 5HMMA 4Z4GA 4TSXA 1QTMA 1CUKA 1KEJA 4CJRA 2R8KA 3ISNC 4GXJA 3MR6A 4ECUA 1W9HA 2HHTA 1ZQCA 4AHUA 4FJNA 2FLNA 9ICVA 4FM1A 2NRZA 4RPXA 4DFMA 1IKVA 2G8FA 3ZSWA 1U48A 1XSPA 3SUPA 5HP1A 3TI0A 1ZBLA 2IC3A 2ZUBA 4FLTA 1LW2A 3KK1A 2JZBB 3LWLA 3NTUA 4M9GA 2HMIA 4KITB 2XY5A 3PW0A 3MXMA 4JS5A 2V4QA 3THVA 4CK1A 2YHBA 3KHLA 2AU0A 4F5PA 4BXOA 3ZDAA 2KZ3A 1ASVA 2JEFA 3O3HA 4MEYA 3MAQA 5KFHA 2V9WA 1NK9A 4DTUA 1S77D 5KFBA 2W9BB 3N4MB 4KB0A 1COOA 3VQPA 5DG7A 8ICKA 5CYMA 4J9NA 1JMSA 3QEVA 1TL3A 3PW7A 4XRHA 4QW9A 3VQQA 1A5VA 1ZQVA 1SKRA 2GBZA 5CY4A 4IFVA 2MAXA 4P4MA 4AHSA 4FJKA 4DLEA 4F5QA 4J9PA 3PO4A 1WNSA 1NK6A 1BCOA 2ATLA 5JS2A 1EXNA 2BPCA 4KTQA 5J2MA 3VQ6A 4MFFA 4ECSA 1RTHA 4EBEA 4NLZA 2FPLA 9ICAA 3NF6A 1BPEA 1ZYQA 1WSFA 2X6SA 2P66A 3PY8A 5CYQA 4QWBA 3GIIA 4PHAA 3PVXA 3B6OA 4OKEA 1O1WA 3GV7B 1Q9YA 3HP6A 4ECWA 5SZTA 2PFNA 4R8UA 5D49A 4F5OA 3V9UA 1QE1A 4LSLA 4N5SA 4E0DA 5F9LA 1MC8A 5KG2A 4JUZA 5CHGA 1FXXA 4RQ0A 4TUPA 2AQ0A 1SKWA 3SPYA 3NGIA 2IGIA 4QOZB 3O4QA 4FJ5A 4O0IA 4CEZA 3H8WA 2OYQA 1HYSA 4YP3A 4QZDA 1D8YA 2E6LA 1ZBHA 4CFBA 3LK9A 5BOLA 3DM2A 3DLGA 2VG5A 2OZSA 3G6YA 3LP2A 3Q8LA 3KTQA 4CJ4A 8ICJA 3V4IA 3VQ8A 3V6JA 4FJJA 2HB5A 4IQTA 5DDMA 8ICYA 4CECA 3H8JA 4OGEA 4ED6A 2NRXA 2QK9A 4L8RB 3F9KA 1BPZA 4CJFA 5HRPA 1BQNA 4HCBA 4F5NA 3QERA 4RT2A 5J1EA 1H38A 2ZE2A 2FBTA 5DK5A 1S0VA 1NJXA 4M3XA 3B6PA 1TAQA 1TK5A 2A1RA 4YVZA 5J2HA 1TKTA 4IQWA 3LZJA 1RTDA 5CB1A 4OLAA 1ZBIA 3AO3A 2HVIA 3RH5A 4H8KA 2Z1GA 3VN5A 3SCXA 5KFSA 2PXIA 4R63A 4J9MA 4YXJA 5KFRA 4FCYA 4PHEA 1RBUA 3QEWA 3OY9A 2YNGA 4TURA 1ASUA 7ICSA 3H4DA 3M8PA 3L2WA 2KZZA 3CYMA 3DMJA 3MR2A 3TAPA 3TFSA 4GLXA 4I2AA 3NDKA 4YG2A 3GIKA 4CIEA 1KLMA 3ISBA 3GV5B 3V1OA 9ICSA 1BPBA 4RQ4A 2XY6A 9ICNA 1U04A 3KLHA 2R8HA 1RNHA 3H4BA 1WSJA 4CHQA 3KLIA 1JLFA 4DSIA 4E7JA 5HHIA 3ZSVA 4F50A 3ZDEA 1S1XA 4PQUA 1BGXT 1ZQKA 1IG9A 2B6AA 3C1YA 2XY7A 5DBCA 2YV0X 1JN3A 3SPZA 2X6NA 4IQVA 1S5JA 3A2FA 1L3UA 3RB6A 3T5HA 1D5AA 4B8AB 1ZQMA 2RKIA 5KG7A 1SL1A 1V9PA 1ZQUA 3RB0A 5J2AA 5J2KA 8ICAA 1BQMA 4Z0UA 4B9NA 4FLUA 3H08A 2OPPA 4IFYA 5J2JA 4Q0BA 8ICLA 4IKFA 3PUFA 5KFXA 4CK2A 4GMJB 1VSJA 4FJXA 4BDPA 4FW2A 4RT3A 4QZCA 2JEJA 4EZ9A 2ZUDA 3KKSA 4FZYA 4KREA 1IO2A 5K14A 4Q45A 1JXBA 2X74A 4YR0A 4OKJA 2RN2A 1S0NA 3TABA 4FJ7A 4DOAA 2KFZA 1XI1A 2XCAA 3ISCA 3B0XA 4DQQA 4O5KA 3OGUA 2I9GA 4DTJA 1CZ9A 1JLAA 4I2IA 4F2RA 1TAUA 4ZHRA 9ICWA 3UXPA 5IINA 4YNQA 3K4GA 1ZQTA 3L2RA 3KLGA 3RBDA 5DQHA 4EP4A 1X1PA 4XA5A 2NRWA 4WE1A 5HP4A 1VSEA 2C22A 1BHLA 4K4GA 3Q8RB 1MQ2A 3LPUA 5SWMA 2VA3A 4W5NA 3QEIA 4JS4A 5DB7A 1HYZA 2B5JA 3C2LA 4I9LA 3OJUA 4KHNA 3QEBZ 4B9SA 4YD2A 4C8MA 4RQ6A 3JPRA 1DTTA 1Z25A 5CZ2A 4FJHA 4EBCA 2BCVA 3ALYA 1WAJA 1RYRA 4PHDA 1DGSA 4I2JA 4UBBA 4PGQA 4CGHA 2W42A 3T3FA 3LP0A 4CEOA 3RH6A 4BWJA 5J0QA 1HNVA 4I2QA 2BGWA 1LWEA 1Y97A 1QSLA 1J54A 3OYAA 1J53A 4ED0A 3AVIA 3V6KA 4GW6A 5KT6A 1UA1A 4H4MA 3RMDA 4AHCA 4HHTA 2W9CB 5J0WA 4FBUA 4HUEA 8ICCA 1C1BA 4J2AA 3QIOA 4CJVA 4YMNA 3MECA 3QINA 3HX0A 2DFLA 1XU4A 2VG6A 1RILA 4IRDA 4Z4FA 1RXVA 4CEFA 3V6DA 4CFAA 3SI6A 4UBCA 4BE2A 3HO1A 3JYTA 1BIZA 4GXIA 3QEAZ 3OYCA 4QWCA 4ELUA 3L2UA 2DY4A 3D0PA 5HROA 5KFKA 7ICIA 1ITGA 1WLJA 1S6QA 4CESA 2OZMA 4NM1A 2RDIA 4DU1A 1CLQA 2G8HA 9ICCA 1WSGA 4QWAA 3OYHA 4I2CA 5J0OA 8ICEA 1X9WA 1EX4A 4JWMA 3EPIA 3RJGA 4QZHA 3NAEA 4BDYA 3VQAA 3OS0A 9ICXA 2UVUA 1TV9A 1A77A 4O3PA 5DB6A
chains in the Genus database with same CATH superfamily
4M7XA 3GILA 4CLKA 3QFUA 5B0AA 4U67Q 4OO1J 4KAIA 2AWZA 4FXVA 2KVSA 4BRCA 2ZJ8A 3CCUN 1JNZB 4K2XA 4MN4C 1TUVA 2VJ4A 2KVIA 4EENA 2J9DA 4N56A 1ZQNA 5AXMA 3RJIA 1HQ2A 4DX7A 5I9EB 3M2VA 3OT9A 3K59A 4J9RA 4G9BA 4ZN1A 4I56A 5ADXA 2F9WA 3NVMA 4HTUA 4UASA 2WBRA 3DOLB 2HIYA 1A6LA 3K58A 3CJ9A 5FIIA 2AJQA 3UMGA 1WC1A 1NJIT 1NSQA 2KXHA 3QGPA 3PJXA 4ATNA 3SZ2A 1C1CB 5CR4A 4NPOA 4KLDA 2BJ9A 1NH7A 3VAIA 4ZPWR 3ENBA 5KG6A 1IN0A 2UXBJ 4D3HA 3IV6A 2LYVA 1S99A 4O0JA 5E3PA 4KRFA 3CCJS 2UZAA 1GLCG 4K0KF 5M2UA 3MURP 1RB0A 1IM6A 4RQ8A 2DK2A 2IAJA 4EYHB 2PIIA 1I5OB 1LEOA 4E89A 2HHXA 1I51B 1U45A 3DLJA 1OSDA 4LIWA 3G6XA 1VK0A 2H54B 2MY7A 3OYDA 3FNNA 3JTOA 1S9FA 5ETLA 1DLOB 1Q95G 1WORA 1R89A 2FJAB 4JI0F 4NLQA 5AXNA 4F3MA 5KRTA 3KBBA 2R7VA 3R7BB 2J7KA 3H2LA 4C11A 1N5YA 1SB6A 2M4MA 1HNWF 4PHTX 2J4RA 4TQSA 3K9JA 4WFBQ 5AM1A 5M1OA 2AYGA 3VQ7A 3LGNA 1M1GA 2LXFA 5DBBA 1ZM3A 4M5DA 4OZ1A 3JPQA 1ZQBA 3M2UB 3HI9A 4ITSA 2P8IA 5B8HA 2H9ZA 4HTIA 4RBTA 3AD7C 4LJMA 5H1SQ 2EXUA 2Y0SD 2X1BA 2BKEA 1YIJS 2A0FB 2I1QA 3BEXA 1N32K 2KH9A 2VFSA 4ZVFA 4DUZJ 3C1ZA 3SQIA 1VLYA 2W1BA 3AXMA 4PL2A 4U7BA 3U9ZA 2PN6A 5EX3A 2MTLA 3HHNB 3AVGA 1PSDA 1KBUA 2EX3A 3HJFA 3WK8A 1WOQA 4IL6U 2EZZA 3OTDA 2KJWA 2ZH1A 1EQ0A 1U0HB 2DHSA 2FYXA 2NXJA 2H65B 4I29A 1U09A 1KHWA 3K0JA 1OPIA 8ICXA 4FBTA 3Q8QB 9ICQA 3NGRA 3N9UC 2OPQB 3ZT4A 3BO4A 4R79A 4FKYA 5HRSA 2ROPA 1WBBA 1HUZA 2MKSA 3V9XA 3DRSB 2VGMA 4DQRA 2R3VA 5KFZA 1UMJA 2XYHB 1VSLA 5HMLA 1IKWB 3LPYA 4M9NA 1ZQAA 3B82A 1JUDA 2CJBA 2B8PA 4DS5A 2O8EA 4NV0A 5FRMA 2ZIXB 3HJEA 4C4SA 2ASLA 2KT5A 3LH2S 2WB1D 4KBOA 2NZ4A 5H1SV 2IBKA 5KFYA 4EX6A 1VRTA 4DR4K 4BRMA 3QWPA 1T9WA 2ATQA 4M41A 5M1KA 3KFUF 2G8UA 3BPDA 2KK0A 3E01A 2V7YA 4ZK7M 1Z4UA 3VGKA 1U1NA 4OVLA 5HQ8A 2E20A 2MHNA 2AYBA 1EIYB 1H73A 3C95A 3MK6A 2CXEA 3AODA 1K0TA 5F0UA 5D4BA 4F0KA 3VPZA 3T1HK 4JI7K 3BYPA 1CJKA 3QRRA 3UPFA 1RCOB 2XMTA 1FD8A 2VBYA 4CGDA 3M8WA 3MCSA 2R7WA 3M7DA 4ZTJA 3J81O 1HARA 2JC0A 3EICA 3L2QA 2NXUA 3CF5Q 4CE9A 1CJUA 3HSDA 2F44A 4CGIA 3TSQA 1T9TA 4NLKA 2QIFA 3UD4P 4CZKA 2WF5A 2RUSA 4KX5A 3HVRA 4CJKA 4I2FA 4H4KA 1RUSA 5A8WA 3GPAA 1D9AA 3E51A 2XI9A 1P9QC 3MCAB 4N77A 3CPWM 4ZTFA 3WKCA 3CMAN 1VQ8S 4LC9B 2A2CA 4GVEA 1A6SA 3CT9A 2L5YA 3M5RA 3BGLA 3CJQA 4XH1A 2F8MA 2LU1A 4HHHA 4DV2K 2CPHA 4QPTA 3I76A 4F2SA 4P2FA 4MEXA 1RTJB 1Q7YO 3M1VA 1JJ2R 2GX9A 3LM9A 3L7PA 1LW0B 5GVQA 3DXMA 5ALVA 2WW8A 5HQMA 3MZIA 4KHWA 3G86A 7ICPA 2HIQA 4KTZA 2BCSA 5IC4B 3IGNA 2O3DA 4X4SA 2P9KA 1M0SA 2QL5B 2FJVA 4XEIA 4FJMA 1I3OB 3VWSA 3EVWA 2KKVA 7ICOA 2G08A 1T6CA 2H1YA 3ONQA 3KOAA 1NDLA 2FVCA 3MEGB 3JQMA 4IO8A 2B9XA 1VJWA 1EWRA 1HKCA 3W2WA 4FL9A 4UB5A 4LF7K 3ZX3A 2ZJ5A 1TKZB 3M8RA 2KHOA 1KOOA 3CVKA 1QUPA 3R97A 3OSPA 2BQUA 2YNHA 4M63A 3QU4A 5EGYA 2CQCA 2JXJA 3QLHA 1VQ6N 2W4CA 4JK9A 3IM9A 4NXZA 1S5LU 2ZJQQ 1HD1A 3ONNA 2C1EB 1XUPO 5F8GA 3TTFA 3U26A 3ZSZA 1GLFO 3MM8B 4IRCA 2XO7A 2BW2A 3OR1B 3MN7A 3HOTA 4QIVA 1IBMK 2XB2D 1IJEB 1GX6A 1FFSB 1FT8A 3TOQA 1JXVA 1RDBA 4BE1A 3UQ0A 1YBTA 1L5UA 3C6UA 1Y00A 1ZQPA 3ICLA 2BDPA 3H5SA 4H5NA 2Q1LA 2NO4A 5JTIA 2F9DA 2LVWA 3SMZA 3AAPA 2K8BB 2DNRA 1VBYA 1T8EA 2HBLA 2ASOA 2BQRA 4LFCJ 3WX8A 3CCJN 1RDRA 3BGRA 1UJ6A 2OD4A 4HH1A 4K4XA 2D3O1 4QZIA 4ZVRB 3FKBA 2PAVA 4Y00A 9ATCB 1VYAA 1R59O 3TNVA 3RRHA 4KO0A 4KAZA 4R8UB 5KFEA 1WUDA 5IWAK 1C0UA 3IHQB 1H2VZ 2RHKA 4YQWA 1S72N 2CJQA 3G4SN 2D1CA 3F5TA 1Q8IA 1FTCA 1QZ6A 3HJVA 2MGZA 4ZVEA 4KH4A 3PKYA 3AA5X 2LEPA 3KNAA 8ICUA 1TUWA 3AVHA 8ICSA 5ALYA 2YHAA 3GFKB 1WHWA 1GH8A 3OXGA 5J2BA 1DTTB 1VBXA 3SR6A 1ZQRA 1VQOS 1Q5VA 2OHFA 3TAQA 3EL2A 1MA7A 2BACA 1EAYC 1RU2A 3AVBA 1RTDB 2P6UA 4OL8A 5AKYA 4C0ZA 4DL7A 2ATCB 4Z6CA 3UE5A 1IBKJ 5J2FA 2G13A 1RHUB 3BQ1A 1X40A 4JI8K 5J0PA 4UB6U 1SJFA 2QWOA 3PNIA 4WU2A 4JRPA 4XQ8A 1NOYA 2HHHK 3D5MA 2F3JA 1GLDG 4B9QA 5J2PA 4BGDA 4DSKA 4K8ZA 5AQKA 4PG6A 3LVWA 4C3MA 3HRGA 1QLNA 4DFDA 3FSXA 5M1PA 5AZJA 2OPSB 3IFRA 3EGVA 3H8YA 5CZ1A 2AEMA 2VG5B 9ICJA 2P9SB 3PIPL 1MMLA 4CTAB 4URQU 2KHVA 2MZ1A 5AM3A 3RYLA 3AAQA 4LBPA 1T4GA 3ELHA 4FWKA 3HRDD 2XSJA 3J81Y 5BRHA 2DHAA 4DV6K 1GMVA 4DR1J 2CGLA 2BPFA 1APSA 3TAMA 1ESVA 2YPYA 4QYZJ 3RBEA 1AQ6A 4DR5F 4B9UA 2YWHA 2YNIA 1NB2A 4LFBJ 2ASPA 5A8KA 4J9SA 2J6UA 3IWXA 4J03A 3OYBA 5KFUA 2ZXIA 4NYOA 2A1SA 3QUBA 1HL6A 4B3SJ 1REVA 3MM9B 1RWMB 5D8HB 5J2EA 2NV3A 1LXJA 1K73O 4KH0B 3DU5A 3PHTA 4ILJA 2W4DA 1RA6A 4KFBA 1U2FA 2UVWA 3M6GA 3KLEB 3ORYA 2HNYA 4W90B 4ED3A 4JI6K 5I3PA 4CF8A 4GXKA 3UXNA 5DLFA 1T9UA 4N41A 1M1KO 4FZZA 2FLPA 4DLGA 5IIIA 2HAFA 2QKBA 2DGTA 3ZTOA 4CO3A 1VHIA 3T1AA 4GKJK 3CGIA 3LWMA 1VRUB 3TAMB 2VL1A 3UVJA 4JV0A 3U4LA 9ICMA 4F72A 4DL4A 2FHKA 4L3QA 1QQ7A 1QSSA 2GIQA 3VGSA 4N76A 3AXKA 2OIHA 3AO1A 1B0VA 4DX5A 4DR1K 1KQQA 3KIOA 4Y28C 2B21A 4RWTA 4KGXB 4UAYA 3FZKA 2F63A 1TTHB 4LF6K 2GAHC 2G1HA 4ECZA 1UJ5A 2CQDA 1K8KB 2JZBA 1UETA 4ENOA 5IQQA 2GVDA 4PRFA 2EFVA 3SDEB 2D0BA 3P1GA 5AQMA 3D0GE 2ZH5A 1EETA 3R1LA 3NFAA 5AXKA 2H5XA 5F41A 3HOSA 2KI2A 3CWJA 4K4WA 3H2UB 4E1JA 4DN9A 4YY3F 1X5OA 2J0SD 1IH7A 2GWJA 1XSNA 1ZJNA 3MDFA 1B7FA 2XHBA 4ETXA 3EGWB 1ZQGA 7ICFA 2QZ8A 3RMBA 4FJGA 2YTUA 4JN4A 4RU2A 3K2PA 1IWGA 1Y0HA 2IRYA 4HTJA 2OH2A 5K9FA 1HPMA 1PC5A 1XK8A 3DRSA 4JI3K 3D28A 3GFHA 3G0ZA 1QTNB 4ZOHC 4ZCKA 3LA0A 4YR2A 1L7OA 2UUAJ 2YKNA 1B70B 2UU9K 4DTMA 2JHEA 2DWQA 4Y2IA 3KHGA 3RB3A 1AZSA 3BS7A 4KHQA 2FLOA 2KOBA 2KG0A 1NUEA 4AQYF 4JKHA 3V81A 3EDRB 5AQJA 1S6OA 4J9KA 2HQDA 1VQMS 1PYTA 4NLGA 5L1KA 2RE2A 3SLCA 2YH1A 2I7PA 2Z58B 2EAPA 3THXB 5KOXA 2CVEA 3DXSX 1HR0F 4YFKA 2YWEA 3TQEA 2Y9TA 3OUYA 3CD6S 1NOMA 3IMXA 7ICQA 1CXQA 1FXRA 1KFSA 2W24A 3K5NA 1R8PA 4BC9A 4M47A 2UV8A 5B66U 4PABA 4BROA 1ZQEA 4H0VB 2PFPA 4DV4K 2I38A 5GAGU 3UN2A 5C10A 1EX8A 1L3KA 3OYIA 3SQ4A 3AOCA 4FK2A 3QYPA 3C94A 3SQ2A 3NVYA 2E1FA 2V4JA 3K9KA 1AYEA 2VFUA 4WE1B 3D0HE 1FI4A 1FW6A 3S3NA 5CP2A 3C21A 5CAAA 3EYZA 4XIUA 3FK4A 5J0SA 2L9WA 3W0LA 2J6TA 3VGTA 2H5JB 5K5MA 3WIUA 1RT5A 2QMWA 3PYFA 5DM6L 2D3UA 2I5JA 5ALUA 1BL3A 4NLNA 4AILC 2HNDB 2CKWA 3QO9B 1FWKA 3FJ2A 3C2PA 3WC2A 1VQ6S 3Q2TC 2YWKA 3KD1E 1PJ6A 4TU8A 5AKLA 2L9DA 1NGFA 3ZDDA 4EYIB 3Q8MA 3W1YC 5K20B 5DQGA 4GO7X 2MZSA 5L1JA 4BQZA 4I9QA 1D0EA 2KB2A 1ZZFA 4UY85 2NPFA 4JKDA 2AEFA 3ETLA 5DS7A 3VF6A 1JMTA 2AKWB 3R5AA 2ZM6J 5KFAA 4CJ3A 3GFZA 1R31A 5F8NA 3P5BP 4OJ5A 4NZ0A 5MLCQ 4R25A 4QZEA 3ZFVA 3V9ZA 1FKAF 3UPQA 3T5JA 4CM2A 5KI6A 3I28A 1DKGD 1SZ2A 1NKCA 3SXLA 3I8BA 2D41A 4I2BA 3SNNA 2YWWA 4DTRA 3FMWA 1U1MA 3ULDA 2XHWA 5KRSA 5AKGA 3ISZA 1XTZA 5DGAA 1RT2B 3I4HX 4DPOA 1TMMA 4CHNA 1UWBB 2DGZA 3MMJA 3GOIA 1IG6A 1BI4B 4F4AA 2BXJA 5B09A 4P75A 5G4DA 4J9QA 1VSHA 4DV7J 5BYQA 1YF5L 3GMGA 5A76A 2E5LK 3ZZTA 3CQ8A 1JLGB 1VMBA 1Z1BA 4NM2A 3U3GA 1UAWA 2HQ3A 1NGBA 1XJWB 3NL0A 3HK2A 3EJMA 1S6PB 3WU2U 1NJZA 1O13A 3CMQA 1KCFA 1BPYA 1J2MA 4DV2F 4JI8F 4LR8A 1RYUA 4MFAA 2GZOA 2IVNA 1HI0P 4FNHA 5GTIU 2A3JA 2ZE2B 2P6TA 1FJGK 1QD1A 1IBLJ 4DUYK 3DOMA 3THYA 2W3RA 4MLHA 1U1QA 3MC1A 3IRWP 2FY1A 1WUUA 3UFCX 1QQNA 2K1RB 1VFJA 1MU2A 3BH6B 3OFFA 4M3ZA 4YD1A 4EU0A 1NZ8A 4G1PA 2MQ8A 2PYJA 1VK8A 3N97B 4LFBF 4OHWA 3BN4A 5EX0A 1U6FA 2NLXA 2G8WA 5CH7B 1YI2S 1BIUA 4H0PA 4LREA 3SCIE 1M1KT 3OFGA 4CD3A 5AJ3K 3ZEUA 5KFQA 1VRUA 4RW9B 2ZTEA 4DR5K 1EKRA 2WW4A 2CA9A 1LFWA 3OXLA 3N28A 3O0FA 1O03A 4LSLB 4DQIA 1DRGA 3NOCA 3MM5B 4WQ4A 1IKYA 2HSZA 3FAHA 2ZIWA 2IYIA 2L9NA 3HL8A 1HNWK 4FJLA 2CYYA 3VA3A 4IEEA 5F3ZA 3CJ3A 4RW9A 4P74A 3G87A 1NGIA 4QW8A 4YEAA 2ESEA 2EQYA 4H4KC 4OKKA 1PK3A 3BUZB 2FHMA 2B5JB 2GUIA 3SIPB 5KAKA 3PTWA 2HDOA 1P7DA 1U1OA 3A5OC 4ECYA 4IOXA 1ZQJA 4CE6A 4DWIA 1XNQJ 4KI4A 1HI1A 2H4YB 1AW0A 2FDNA 1HWIA 2QWRA 4CJQA 3LOUA 4PAAA 3QYYA 1HNWJ 1EJ7L 3IAM9 4OV6A 2R7YA 1RBRA 3RBZA 5FDLA 8ICIA 5GINA 2BVZA 3HKZF 2V0NA 5AT1B 4BC4A 2WB1C 1JJ2M 1Z00A 4R65A 4CQ1A 5LT5A 2F8LA 2VOPA 4USTA 4AF1A 2RSQA 3MCPA 1TVAA 1U49A 1T9YA 3MR3A 1ZQWA 4KTWA 1P27B 1MA9B 4C0BA 2WTFA 1HW9A 1X3NA 1NZAA 1JALA 4CJUA 8ICVA 2C2DA 1VCTA 1SC6A 4FOIA 1H0HB 2FJXA 2LFVA 2VDHA 3OBWA 1VOMA 4O5BA 4WWSA 1TKZA 2PI4A 1UW4A 1N56A 4Q44A 4WK1A 2P51A 1BISA 4ZPVR 5AFUH 1U0SA 2RLTA 1FDBA 2LXIA 4JAXA 1ZD3A 4I2EA 2LCWA 3FBFA 4JYAK 2OEMA 4E8UA 4K4VA 3P96A 5IT0A 1N32F 7FD1A 2DRDA 2W03A 3TZZA 1J5EF 2YX1A 1A0PA 4KLHA 1S48A 2P9CA 2UXDJ 1RHKB 4J9UE 2ZH9A 2J8AA 2ZH7A 1J2VA 3UI3A 1KNZA 1ED1A 2NNWA 3DOKA 5A2QO 2E5IA 3W9IA 3J7ZO 3PKMA 4KN4A 2FDRA 2ZKTA 4OFZA 2HMPA 2CPEA 4K4TA 4NX9A 2VQFK 4CH7A 1PIEA 2P9UB 5DDQC 1WCLA 4ZPAA 2BUPA 5AQLA 3W64A 4WIIA 5JVGL 1WEYA 1C1CA 1C1AA 4Y2AA 2HI0A 3AD9C 2FC9A 1UQVA 3RJHA 2ZJRL 2J9EA 5F9NA 3WEEB 4NI2B 4KO0B 4IFEA 2CWKA 4IWVA 2PDAA 1PGZA 3GL1A 8ICOA 3PX0A 1F3FA 2DEJA 2UXDK 4IFVB 1N32J 4K41A 5E33A 4K8RA 3MAAB 3IN5A 3L95X 1NJYA 2ZBCA 5I3UA 3QEPA 2A42A 1ROFA 3BSAA 4B1XB 4LRAA 2VZ9A 4PYDA 2LSNA 3AVFA 1D1UA 3U1MA 3GJQB 3B0YA 3O8WA 4NE9C 4Q8FA 5EE0A 1BE4A 1VSDA 7ICLA 1TU0B 2FMSA 1NK0A 1WTBA 2DISA 2KXFA 2AIRB 3MGIA 3HILA 3AO4A 2P5GA 4B9MA 3QT6A 4CF9A 3KG4A 2K3IA 4GKKK 1HR0J 5HMZA 3MFIA 4J2DA 4Z94A 1F1BB 4YR3A 5KG1A 2GJ2A 3KLFA 1VGYA 2VFRA 2XULA 2KVQE 3ETRA 3JAMO 2BGGA 4Y1CA 4DTXA 1D3WA 4GC7A 1EKEA 3C6HA 3C2MA 2OAUA 4B08A 3F73A 3JAMU 1WWVA 5AQYA 3BEGB 1WC3A 2HBMA 3TO8A 4ZPCA 2WBNA 1KFTA 1S6PA 4U96A 3NGDA 2QYGA 1ZPVA 1D8LA 4JP8A 2DEIA 3QNMA 2PFDA 4P10A 2OSQA 4GFJA 3HFKA 2EHGA 3OJSA 3KUEA 3M8QB 2AGOA 4E19A 1FESA 1NGJA 1CZBA 4DB3A 4JB8B 2F40A 1HHSA 3PFOA 1UWBA 2POKA 3M9NB 5FROA 3L4PA 3UCUP 2PY5A 3TADC 4UB2A 1SZHA 2X78A 5HBMA 4XPEA 2ITMA 1SL2A 2EANA 4RW4B 3D6FB 2M9NA 5LMNJ 1GO3F 5BYSA 4WYLA 4FXWA 2F9JA 2ZH2A 2BCRA 2FZKB 2HGNA 3BN7A 3Q8UA 1YI2N 4LQ3A 2DGUA 3FZMA 4BCAA 2AP6A 2RMLA 2VD3A 1O08A 2LBOA 2ALZA 3FM9A 1K1QA 1RGVA 4BS2A 2BHNA 5D0GA 4FF2A 1X9XA 4C7ZA 4U7UK 5B0CA 3CD6N 1KEJA 4HH0A 2R8KA 2CJ9A 1UCVA 4ECUA 3J80Y 3D2WA 2WF6A 3DNCA 1IKXB 4HLBA 3D2EB 4RPXA 1UVJA 5ITHA 2G8FA 3KLGB 5HMWA 1FHTA 4OMFG 4FKXA 1NSPA 3B8HA 1JLAB 5HP1A 3QX7A 4NLRA 2IC3A 5H9FJ 1D8BA 2GC8A 4KGVB 3OTEA 2W7AA 4H0YB 5AQSA 1VHFA 4KITB 1P1TA 3DDIA 2KO1A 2XY5A 1X4HA 3ILIA 4CK1A 3KHLA 3H45C 4NEYA 4MHVA 4B3TJ 2GEMA 3O3HA 4DR4F 3THWA 4CZFA 2WF7A 2NXCA 4MLEA 3MAHA 4AE5A 4PWUA 3N01A 5M2PA 3VQPA 5DG7A 2C3UA 8ICKA 1VAZA 4KH5A 4YOXA 2QA4N 1S1UB 1LOTB 3IBCB 2V4JB 1ZQVA 5LM7E 1IBLF 2HFOA 5J2NB 4IFVA 3EN9A 1NAQA 4GKJF 2ZIXA 1DZ5A 2N4DA 2QB0A 1TV6B 2ATLA 4JI0J 2AF6A 1EXNA 3VQ6A 2OKQA 2NREA 1RTHA 2GIFA 1BPEA 4MYTA 2UUCF 2X6SA 1N5VA 4QYRA 2IJNA 2LA4A 2I6XA 4PHAA 3IG5A 3QJPA 4OKEA 3GV7B 1N5SA 2F65A 1W7AA 4PZNA 4DR3K 2I5HA 3CQYA 1JLEB 3ZZOA 4A8YA 2EBEA 4LSLA 3GP9A 4E0DA 1SJ4P 3MWTA 1VQSA 2GFFA 5CHGA 4RQ0A 3SPYA 1G6BA 2IGIA 1YJRA 3LDLA 3O4QA 4DCCA 2NXEA 3VALA 4FJ5A 2E1AA 2OYQA 2RHSB 3ZEUB 2GO9A 5DM7Q 3FBBA 5KAIU 1ZBHA 4FWPA 2OZSA 2E2OA 4OD0A 3C6AA 4FYYB 2GOLA 2BM0A 1RAAB 3QGGA 3DKDA 5I4MA 4IQTA 3AT1B 4W98A 2C3OA 4FZVA 4MIAA 4ED6A 2IM2A 4L8RB 4ILMA 4YOUA 4HDGA 2XICA 5L46A 2HOEA 2R7RA 3R8YA 4YDUC 2VODA 5J1EA 4MIBA 1H38A 2ZE2A 5JVGQ 2A2DA 2Z2MA 4ILLA 5DK5A 1FF2A 5FDLB 2LKZA 1GMUA 1NJXA 4JEPA 2MQPA 1TAQA 4ISEA 3OTQA 5B0GA 3DGPA 5GIOA 1HBOB 4A8KA 4YVZA 5J2HA 3UE2A 3L4BC 1RTDA 3O80A 1RAJA 2V63A 2Z1GA 4AFFA 2B4UA 1SCJB 2GX8A 3SBMA 2O8FB 1RBUA 3QEWA 3OY9A 2YNGA 2RRNA 3M6KA 3C65A 2X51A 2DNNA 2ZGZA 3TAPA 3TFSA 4GLXA 3NDKA 1FXDA 4OHZA 2YWFA 4RNHA 1KLMA 3NCPA 3TACB 2EFOA 1YTYA 3V1OA 5G0RA 5H9EJ 1N36K 4PG8A 9ICNA 3KLHA 3TZWA 5ALSA 1FJGJ 2ZITA 2XHCA 4WF9Q 1WSJA 2BABA 4CHQA 3KLIA 1IBMJ 1U25A 1IKYB 3O9SA 5HHIA 3ATVA 4F50A 2VF3A 2ACYA 5C24B 4I2QB 1PO6A 1ZQKA 5RUBA 3IBFB 2ES6A 2B6AA 3C1YA 2XY7A 1IG9A 1BC6A 2YV0X 1T94A 3PFEA 2R2TA 2X6NA 1F0XA 1RCXB 3A2FA 1L3UA 1T3OA 4XAKA 3O9QA 5GAEI 2XMJA 3FBEA 5EVZA 3D6JA 5ALQA 1V9PA 1HA1A 5HK4A 3Q7BA 4HHJA 1IR2A 3FQLA 1PBAA 4JI1K 3F5AA 2YNIB 1WEXA 4PG5A 4QIEA 2KKHA 3VGLA 2DNZA 3DRPB 2LM4A 1Y4ZB 2KT3A 4Q0BA 5AZIA 1S6UA 2FJ6A 4EFHA 2W6KA 3OFHA 1U2CA 2AJ4A 4PL8A 2I9SA 2MDAA 2CJYB 4GMJB 2YNFB 4FJXA 3AA9A 2GA7A 2QX0A 3I5CA 5I3QA 4USHA 4WP8A 4JK8A 1IO2A 5D78A 3CC7N 4YR0A 3OL9A 4BQLA 3MCMA 2DH8A 3OL6A 4DQQA 3B0XA 2K4IA 3QDKA 5CXTA 2KXNB 4ZHRA 9ICWA 2L41A 3UXPA 5IINA 1NGGA 2UUBK 4YOYA 1P6TA 5E3AA 1CG2A 3E01B 2YXLA 1XMOJ 1RABB 1EARA 2CPXA 4EP4A 1X1PA 4XA5A 4KGMA 5AZIB 2NRWA 1VSEA 4P52A 2A6OA 3Q8RB 3SAGA 4JS4A 1XC3A 5CCLA 5DB7A 1KBRA 3BKUA 3FMBA 3LYSA 2ZHBA 3P45B 2HHHJ 3CJKA 2KHDA 2K4PA 3QEBZ 1YJWS 2JLFA 2F8KA 4C8MA 1Z25A 1DTTA 3MUTP 4BJQA 2BZFA 2BCVA 1RWPB 2J7WA 1RYRA 4PHDA 1DGSA 4TU7A 5JXSA 1YJ7A 3T3FA 2ABYA 3NGSA 3LP0A 5CYJA 1U7LA 4BY9C 4I2QA 3CW2C 4DL0C 3R7SB 5KOWA 4NYPA 1Y97A 1KAYA 3W63A 1J54A 5L8RC 3KK2B 2M3DA 1J53A 2BE9B 4OI2A 1RBLA 3WQTA 1IXKA 4XH5A 2EAOA 4HHTA 4FBUA 2KIVA 1WHVA 1CJVB 1OY6A 1W2BM 3QINA 4BC5A 2PMHA 3A0IX 5A8RA 1QAIA 3U02A 2ZJQL 2D7SA 1ZAWA 4IRDA 2KFYA 4IH7A 4Z4FA 2NYIA 4ZVTB 5JMNA 4BR7A 1B4SA 2FI1A 2RRBA 1RXVA 3A12A 4CEFA 3V6DA 3EX7B 4CFAA 4Y0WA 4FF1A 3VEZA 1CQNA 1WWUA 1OYEA 3VEWA 1ITGA 3D2NA 2QSFA 1S6QA 4NMLA 2RDIA 1LKZA 2PFFB 1WSGA 3ZZPA 1W7WA 2HBRB 5DO2A 2X3GA 4ZVPB 2JFDA 2OHDA 2KG1A 4B1UB 4FP9A 4QJVA 1N34F 4YUDA 3JYTB 3EPIA 2GMHA 4QZHA 3NAEA 5CRXA 3A0BU 1UCNA 1A77A 5AQZA 5DB6A 2K4EA 2HRTA 1NK8A 2RUGA 3F2KA 4YORA 2XIDA 1VQ9S 1YKWA 4A62A 2RHFA 3LALA 4A8OA 3PX6A 3OTOF 2CNNB 3I56S 2IHMA 2EFQA 3LGMA 3QT7A 4HI1A 5DB8A 1A7GE 1XMQF 4PUOB 3M4XA 4PG7A 4FLZA 4BWMA 1VSMA 1NSKL 3F44A 4ZLNA 4DL2A 4F3QA 4IQMA 3U9DA 3AQEA 2VFVA 4JI1F 3TX0A 2Y1IA 1U8WA 3B4MA 3UMBA 4S0MA 4DV1F 3RAQA 5HAOA 4KLUA 1RBTA 4NO7A 1NM1A 4DPYA 3NRZA 2BTFA 1S1XB 5EE3A 4K4HA 2LQ5A 3THPA 1H1VA 1RAEB 1NU0A 4KY3A 5D15A 4ANEA 4P4OA 1VIXA 3MPWA 3CIZA 2MSTA 1PG5B 2MKJA 9ICPA 4CF3A 3KZBA 2UXCJ 5ALJA 3FEYB 1KC8O 4M95A 3QBXA 2FJEB 2ZZNA 4NLBA 2O8BB 4IOBA 4NASA 3DRXA 3S1TA 4NLCA 4K0KJ 1S1WB 3KJNB 5HR7A 4X4UA 2V34A 1ZQHA 3AO2A 3F2BA 3LF0A 3R2CJ 3UKUB 2F8EX 2MY8A 2O8CB 1C4CA 1GLBG 4QZFA 4Q5VA 2WVCA 2KJ9A 3DRYA 1GNKA 1XEZA 1FRIA 4C11B 1N5YB 4M6WB 1ZAXA 3KMQA 2VQEF 2VQFF 2A6MA 3ENHA 2W9AA 1NOZA 1SL0A 2CDRB 2W11A 2IJRA 5E2QA 1KHVA 1HMVB 4C8LA 4P4PA 3UO0A 4FZMA 4OLPA 5HL7L 3D67A 1V6HA 2QARB 2GJIA 1IKXA 1TK8A 1U24A 2JX2A 1B43A 4DV3J 1T05A 5B0EA 8ICNA 4NCGB 1WOOA 2ZOGA 1PKUA 4C8NA 1NKBA 3IA0A 4LRCA 4OYPA 5L1LA 4B17A 5AE3A 2HGMA 3FEXB 4YXMA 4Y2KA 4DMZA 2OTLS 5CR0A 3N6MA 1KC8T 2AHOB 3K5LA 1VQPN 1BNPA 4YDDB 4YN4A 3HSJA 2V2ZA 5C0YA 7ICKA 5E79U 1SIZA 2G07A 3NNCA 1MSWD 2IM0A 3LDNA 3DLHA 1VQ8N 3BQ7A 3HLUA 2OTJS 4KKOA 1YZ7A 3BGRB 3UNYA 2NXNA 5HOOA 2HCFA 3OTOJ 2D0AA 4M3YA 1KTQA 2R8JA 2QL7B 3U1LA 7ICMA 5AKEA 4M9HA 3A8IA 4KH6A 4WFNQ 1U2RA 2V2VA 2MQNA 4YN3B 2HBQB 1Z4OA 2RDJA 3GIMA 2WSEC 2Q97A 4PKHA 1NNDA 3C6UB 1HWKA 3TAEA 2G8KA 1PJ7A 2NZCA 4Z4IA 1J9AA 4G65A 1M5SA 2MUTB 2YN4A 2CJXB 3VC8A 4ED1A 1EHWA 2IDEA 5HJXA 3CRXA 3HX9A 4OJ6A 3GSDA 4RUHA 5D4PA 1JNRB 2MHEA 3Q8VA 2UUBF 3I0SB 2ZUAA 4OIXA 3C29A 1L6NA 1S4FA 1WJ9A 2CPFA 3MMBB 2B7CB 1NXIA 4HL9A 3IDWA 2RPIA 5AQHA 3GDXA 3W3SA 3LDAA 2IPOB 2VKZG 2BEFA 4DHYA 4GRSA 4OPJA 1W25A 2WVBA 3SAHA 9ICLA 3PM9A 1JJCB 5AQNA 5ETRA 5EUHA 3LO3A 2RHQB 4F9OA 3HT0A 3RUBL 1SKSA 3T5KA 4CNQA 1PCAA 3NVVA 3S01A 1N8RO 3E66A 3VZHA 3NGTA 4Y3CA 3NGZA 1Z1VA 2IDOA 4TKTA 4JI3J 2D5RA 4YDUA 4YOTA 4F04B 2WAQC 3RMCA 2O8BA 2G1DA 2Y3YA 3S7RA 1SQGA 3ENWA 3KDNA 1PYOB 4JI2J 2ASDA 1RDUA 4UAWA 1T0TV 5EE9A 1X5SA 4JI6F 3L5KA 3Q23A 3G10A 2WVDA 3MAAA 4GC6A 3L2VA 1UEUA 2RU9A 5IT9O 2DHXA 4DUYJ 2AX1A 4NCBA 3ZT2A 1S57A 4TQRA 3NF8A 3EKUA 1KOHA 4QZVB 5D0RA 2DIVA 1ZQSA 4Z6EA 4QZAA 1OYDA 3H25A 2NSCA 4P71A 4DPXA 1RWNB 1ZQLA 3V72A 3RAXA 3TUZC 3A5LC 2RRAA 4X5VA 1BLUA 3NS6A 3CO0P 3UR0A 1TUUA 3DCAA 2GCFA 4RJVA 5F3XB 1UT8A 1TGOA 2BJ1A 3S9HA 2E5JA 1FA0A 4JI4F 3RWUA 3FVYA 1HBMA 1U1RA 4JKCA 5J2NA 4G1QA 2XSJB 2DNOA 2PSZA 5G0RB 4MDAA 4H0OA 3CM5A 3AVJA 1S3XA 7FDRA 3KLVA 4M94A 5AI4A 4UY8T 3ETOA 3CC2S 5JJBA 3SAFA 4AHVA 2QYCA 3QGHA 5T7BA 2IIRA 4I2DA 4FE3A 5EDWA 3M9OB 2V50A 1T3VA 3BF3A 4M3TA 5LMNF 2CPJA 1JKHA 2GQCA 4JWNA 1BVSA 2VWKA 1T44A 3LANA 2BJEA 5GADU 2U2FA 3OYEA 1UVIA 1DOQA 2F4VK 4DV0J 4CM0A 1IR1A 1BQNB 2I1RA 3K8VA 4KB1A 1I94J 4MT1A 1HIYA 4LF6J 3AFGA 1MROB 1XHXA 1YZ6A 3VQBA 3F53A 1C6VA 4OGCA 3GJTB 4A8WA 5DMRA 2OGUA 3FLCO 1RACB 2ZUCA 4F4KA 4E7HA 8ICQA 5IT9Y 2YHWA 2YX7A 2MPUA 4BRKA 3MXJA 5F0XA 1JLBA 2LQBA 2VBZA 3VZIA 2YBVA 3NWRA 3BS5B 2HLTA 2ETJA 1WI6A 4PCQA 3BH7B 5HVFA 1C0UB 5IM0B 5IWAF 1SPBP 4OV1A 3NY0A 1I94K 1N61A 4CZLA 4I2PA 2EBGA 4MKVA 2F8TA 3BGOP 3KWGA 4JOUA 2V8GA 5THWA 3RJFA 4J9VA 5KGXA 4BC3A 3RRGA 2KYXA 1NMDA 2FLLA 3UDEA 2E9ZA 2DITA 1UAXA 2Z1JA 1RWKB 2CZVC 1BOTO 2YNGB 3E0FA 1RHJB 1P8ZA 4QIWF 1CC8A 1VQ4S 3UD3P 1MU2B 2FF3B 4CLZA 1WSVA 3M32A 2V68A 2HLUA 1HUOA 4GKJJ 7ICRA 2FBXA 4FJIA 3EMTA 2N3LA 5KG4A 1RKJA 3HD1A 2GMJA 2C3PA 1NM2A 1UW9A 2FBYA 1IBCB 3TAFA 1NO8A 2PZSA 3MPDA 4A57A 2H3QA 1B9FA 5SUHA 3R3LA 5LMUF 5CZVA 3JPPA 3QB0A 2GHPA 1PUZA 2E8PA 4QOTA 3SDEA 5LSLA 2KJVA 3AGRA 1VQ5N 4UW9A 1JL1A 2LMIA 1UL3A 4NA3A 4B3TF 2O8CA 1MWMA 3S3MA 4WP9A 3KLFB 4KH1B 3L4QA 3NXZA 1R27B 3RZAA 3HDSA 3SI8A 1S59A 4PEOA 3K17A 1VQPS 4JI5J 1F5AA 5M1FA 3KWIA 5E3RA 1WBDA 3FRYA 1OWXA 2W8LA 4L73A 4JMUA 5KFTA 3DGVA 2IVPA 1E4FT 3BR8A 1WN7A 4YB6A 2OELA 3B8AX 3AB4B 1IV8A 1KRPA 3N4WA 3H0LB 3MEDB 4IQUA 1NBWA 2H3VA 1T9VA 3DRRA 5T14A 2ZBPA 4DU8A 2R42A 1VSKA 1CXUA 4CDGA 3RAMA 1MQ3A 3VV2B 3H7HB 3S8SA 1RAIB 3KJFB 2CNLB 1J97A 1RAFB 3ZZZA 5C25A 3CC4N 1Q3VA 4JV2A 2MLXA 3FFIA 3TWHA 1WNEA 2G2OA 3M1FA 2IFXA 2GV9A 4X66J 3C2KA 3PIPQ 1RWVB 7AT1B 3NH2A 3HTVA 3GU0A 1URJA 3P8BB 3ASMA 4RQNA 2QLTA 3KK7A 2L3MA 3VTHA 1SAZA 4V19X 3P3DA 1RDWX 3SFGA 2EG1A 8ICBA 2FHOB 3QFHA 1NKEA 4WTYA 2ASMA 3T79A 3C15A 3BBCA 4CEDA 5C15A 3MGHA 2K2PA 4YB1P 3ITHA 3W3DA 3OYMA 2HBJA 4M9LA 4DX8H 4EFAC 1C20A 1WD6A 2YWGA 3EE3A 3LGHA 3J7YU 3KK1B 5KFDA 5KFGA 3CJCA 3A8JA 2JL9A 1CULA 8ICRA 2MRLA 1FIQA 1H72C 1NRKA 2Y1LB 1ZRMA 1BUXA 1H98A 4C4WA 5C7PA 2WC9A 4AXIA 1DQ8A 4NXMK 3FGUA 2VPYB 4FWSA 3MMCB 4PKIA 3F9MA 3TUIC 4LF1A 1FK9A 4ZJQA 4LFAF 3LP1A 4DV6J 2Z2YB 4BGBA 1N8RT 3QJJA 3MGVA 2DL0A 3P39A 5KG0A 2JEGA 3T19A 1UVMA 3NHGA 1G99A 4WU3A 4UZCA 5CABA 4WFAL 4U67L 1SC3B 3SSRA 1TL5A 3MEEA 1V4TA 4ID1A 4JD2B 4C8YA 2KW4A 2M9KA 2O8DA 1CJVA 4M5MA 1RZMA 4CFCA 3HT3A 3DDHA 3PRVA 4LSZB 5ALEA 4OYXA 4DTSA 4Y65A 3OSNA 1X8DA 1U0HA 2HFZA 3K1RB 1RCHA 5C42B 3GYXB 4KLIA 1U47A 4CEQA 1UP1A 4CF2A 1Y5NB 2Q1NA 2QB1A 4XK8C 4F92B 1WYGA 1HBNA 1JLBB 2XNQA 3EY1A 2D69A 3NGYA 4ED7A 1DQ9A 2BCQA 4Q8EA 3CD7A 2P9PB 3DLEA 1YK9A 2O4GA 4JI0K 3CJRA 2ILZA 3EVMA 1GXUA 4CEBA 1VQ5S 2BQ3A 5HRRA 5FPMA 2HOIA 8ICPA 2W2OP 2WONA 3EO3A 3O8MA 2XTJP 1F9HA 4DX6A 5H9EK 4JI2K 4C2MA 5L9XA 5J0XA 2OFGX 1T03B 3CG7A 3HWTA 4DV3K 4DL3A 2APOA 1NSAA 2R8GA 5AK6A 4LSNA 2CAJA 2XLKA 3OHAA 2KSOB 5D3GB 1LNQA 1XMOK 2B9WA 1FJGF 1XNQK 4YCXA 2HFSA 2M0NA 1U1PA 1BMQB 1VK3A 1RT1B 4K2JA 2ASJA 3DLBA 5KT2A 1W97L 2CPZA 3C28A 2DY9A 5GAHI 2U1AA 4LF6F 3HSTB 4OI4A 5J0RA 2ISPA 1LAWA 2E1YA 5E5NA 4UOCA 1J5OB 3AQOA 3R7NB 2UXBK 4FS1A 5KAFU 3QU5A 1KAZA 4I7FB 1FVSA 3GR1A 5A8RB 1TK0A 2KZMA 4NL9A 3KKAC 4C4RA 5IQ6A 2EW9A 3C16B 1QQMA 2HPUA 3PV8A 4FLVA 1NEEA 5J0YA 4DQPA 3VQTA 1SV5A 3D2FA 4P2SA 4KI6A 1VJQA 4X62F 3ILLA 4E3SA 2BV3A 2CPIA 3OPXA 3LAKA 2QL9B 2KN4A 1SJ3P 2UUCJ 2HURA 2DGOA 1N33J 3DLRA 3CDEA 2WAQD 1S8OA 2VGNA 1LWFA 2W2PP 3IR5B 3TANA 2Z8QA 5KQ8A 1S0MA 2G5IB 5ALLA 3MMAB 4X4RA 4ISGA 2K8CB 4F0MA 2D4WA 3A4TA 4QZGA 2ROGA 3KLHB 2IS3A 4FSVA 4AHTA 2VANA 4RW8B 1VJ5A 3FZFA 2NO5A 4PL7A 1JJHA 4EELA 1OKJA 2YJEA 3FZ2A 3Q2SC 4PYAA 4O55A 1BXNA 4EUVA 4K59A 3QIPA 3PR5B 3D6HB 2F9TA 3CJ7A 2DY1A 2IA0A 4JV5J 4DEZA 4DV5F 3KKAA 2RE1A 2P9IA 3ZLJA 1KN6A 2CQGA 2VWJA 5HI7A 3F5EA 4GVBB 3EGZA 1ZXIA 4NA1A 1RT7A 1JIHA 8ICGA 2VASA 2RD5C 3TVZA 3AM9A 5KNIA 4PHPA 2A1AA 1YT3A 3TRGA 4FK0A 3TP2A 3VQCA 3RB4A 3N5BA 3ZD8A 4CCHA 3E3XA 4UTGA 4OCZA 1ZQDA 1HJOA 4LF5F 3KHRA 4NRTA 5HSPA 1HKAA 2AJ0A 4EWTA 3RH4A 3W2VB 5IXUA 2HQIA 2DHHA 2WK4A 4DSEA 3D45A 1GTHA 4NYZA 2A3ZA 4Y6IA 2JH7A 1S10A 3DAWA 1CVJA 4DTNA 1DK2A 4BR4A 3QESA 2VUGA 2VIHA 4CRJA 1HYSB 2ZC3A 3GYNA 3E9PA 2MMYA 1OJ4A 5E84A 4FDFA 4PKGA 1HX1A 1F60B 2B56A 2XZDB 3PRBA 5DZ7A 2NQPA 3H3OB 5AK3A 4CO0A 1FJCA 2AJ2A 1KXPA 2XY8A 1GXLA 3U27A 4TN2A 5FRNA 2CFXA 2HWIA 3MECB 1NLKL 7ICUA 4UARA 1RXWA 9ICIA 3HKZD 2EKYA 5DM6Q 3SQ1A 4HCCA 1R0AB 5A0YA 3CP8A 1VC6A 4ECRA 1TVRA 4DTPA 2OO4A 4DV5K 4F36A 3FFIB 3CJTA 4J8FA 2R7TA 2HHVA 2UUAK 1FRKA 1FNOA 4ECTA 1TL7B 3JS6A 3I1YA 4KRWA 3KD5E 4WKRA 4UAVA 3CM6A 3GWCA 5ALHA 2EPIA 4DU4A 3C46A 4C98A 4LR9A 2HW3A 4LF5K 2ZHAA 1YXQA 3DI6A 3VAGA 1ZM9A 3M6VA 1SQEA 5KTQA 4I4BA 5DKWA 2WVEA 4DL6A 2HKEA 4TNOA 3NKYA 3LP1B 3L3VA 4KHYA 2LLZA 1JI7A 1TL3B 2PC6A 4ID5A 5AI0A 1WKKA 3IO1A 3NF7A 2OP5A 4CGGA 3VGVA 3WXKA 1V3RA 3HZ6A 1IBMF 2JGAA 4DFPA 3CMAS 4N8OA 3NP5A 2IMWP 4HT7A 4UT4A 2LDIA 3GIJA 2ZD1A 4UB4A 1JX4A 1PYSB 3BDEA 1AFJA 3T41A 3CIPA 3RG6A 1N48A 4NLPA 3WNFA 3RJMB 1S0OA 2HS3A 4C3KA 3QZ7A 1FNXH 1F0MA 3W62A 4DR2J 2JWKA 3ITHB 2F7VA 2K4HA 4JBCA 4M5NA 4USIA 4QQBA 2ZVIA 4HAIA 4ICLA 1S1WA 3ZT3A 1UJ4A 2OD6A 3BQTA 1HNZK 3VETA 1UVLA 3WNHA 4ELTA 1A5XA 2YNFA 4MO4A 3IP0A 2A18A 3PR4A 1UFKA 3J80O 3IXQA 5FP0A 4J5OA 3CQXA 4WQ5C 5K8NA 3T1HJ 3ZTQA 3D3BJ 4I69A 5L39A 4DOZA 1SZPA 3BJYA 2WONB 3EGNA 3O4NA 4R64A 4O8KA 3GFYA 4B3RF 1Q9XA 3WIVA 3BREA 4F3OA 5CYQB 2F1IA 3V1RA 4DR2F 3UMCA 1KN5A 4I0WA 2XS7A 3OL7A 1REVB 3G2XA 2HOQA 1TL1B 2HHWA 4FF4A 4YMMA 2E5HA 4OHYA 2P9NB 2ZJAA 4F91B 1Y9OA 3CCSS 2V69A 2Q3PA 3TFRA 5LMNK 5EXWA 1ZD4A 4ER8A 2B51A 3L7UA 4TLQA 3ZZUA 1EXQA 3MEDA 3A5NC 4Y2YA 3TARA 1Q79A 5BR8K 1YWXA 1J2NA 4KLSA 3TADA 1BWEA 2QEXS 5LL6Z 2F1HA 2VDIA 3QRQA 2MA1A 4FN5A 3NE6A 3Q0AA 2F8SA 2BW7A 5BREA 2E1RA 1D9DA 2W43A 2WF9A 4J37A 1LAVA 4I28A 4O8UA 3PEJA 3MBYA 4OZ2A 2V2QA 1XHZA 1QHAA 3QO9A 3MDCA 3MD3A 5LOQA 9ICFA 2AYMA 4L76A 4PZVA 3R1XA 1B0XA 2KM8B 3GU3A 4ALZA 1RTIA 4M9JA 3V1QA 3HHLB 3O44A 2E2QA 1NJWA 1WF2A 1VQNN 1IR0A 4Z37A 4BDZA 4Z7CA 3K5OA 4QR0A 3IBWA 3J81j 3I0RA 3BZKA 1YITS 2BOAA 3QU2A 4PXDA 2NUUG 1FKOB 4CZCA 1S1TB 3PG9A 2EC0A 2YNHB 4P2HA 4ILRA 4X66K 4RUCA 2DO0A 3R27A 4LFCK 4NA2A 1KDHA 5DB9A 4M42A 3OW2R 2DO4A 3Q86A 3H59A 5J2QB 4PWDA 4CK3A 3K75D 1VC0A 2FY8A 2YKPA 4BC7A 2W04A 4UB3A 3OD2A 1N60A 3SQ0A 2VG7B 3HPGA 3TUJC 4FO6A 2E2NA 4OX7A 4BGAA 2HF4A 1UFLA 1SXDA 4L6V3 3JQKA 2ZIWB 4M5JA 2ADBA 3BB5A 1R8BA 5D46A 1TL4A 2E29A 4DUTA 4JI5F 1B92A 2LPEA 1KD1O 2VPWB 2DKZA 3PW2A 3TQ1A 2NRTA 2ZTDA 2FVPA 5BOMA 3MMAA 4Z4CA 1N5XA 3IP4B 4WCEQ 4EHUA 2ZH3A 4JI8J 2YKNB 4CGFA 3JPSA 2UUWA 3CD5A 5HLFA 2BANA 1YJ9S 4NL5A 2RILA 3QQCD 3S41A 2NR0A 4B3SF 3K7RA 2Q43A 1PILA 4ACOA 4Z4GA 4UUXA 1QTMA 1I6JA 2GO7A 4Y2CA 3NLCA 4C48A 1FRXA 3VEYA 1X9JA 2E7XA 4BR0A 4ZVGA 3MR6A 3JAMY 4NOHA 4BRLA 1Q78A 4FJNA 2Y1RI 2GS8A 4FM1A 1DHMA 2NRZA 5D4LA 1IKVA 3VAHA 1AXQA 4ICLB 5CYMB 3J81U 2KEYA 2BH1A 2OYYA 2N4CA 3TI0A 4OX9F 3FFKB 5BXIA 1LW2A 4UF4A 2HFNA 4Q2LA 2WB4A 2COLA 1GXTA 5DM7L 3PW0A 3THVA 4X4PA 5AICA 4BXOA 3SK3A 1YIJN 5LY3A 2H3GX 2P35A 1XNRF 4A46A 1SQFA 2G0JA 2W9BB 2F7TA 3UKUA 1RDFA 4DR6K 3N4MB 4P7VA 2OUGA 2FJBB 3J7YP 4JKEA 3QEVA 3K89A 1WUAA 3PW7A 4R5PB 2HHPA 2YX6A 4QIWC 1A5VA 1VI7A 2CADA 2Q79A 3S6JA 3Q8YA 4C7YA 1MN8A 4FFDA 4F02A 4NLOA 4AHSA 4F5QA 2M88A 3TYTA 4LF9F 4CYUB 1NK6A 1Q82T 5JS2A 4UUWA 2V7ZA 3DEEA 4KTQA 4RPFA 1VBKA 5HO4A 4NLZA 1DEJA 3ZX2A 2E1EA 2FPLA 2R7OA 1N36J 1WSFA 4WCEL 4DPWA 4USMA 1BU6O 2P66A 3DDKA 1I94F 3I87A 3G82A 2IYGA 3PVXA 2YKAA 4U95A 1Q9YA 5ALMA 3HP6A 5SZTA 2PFNA 2B9EA 2DXFA 1QE1A 3WX4A 4A8XA 4N5SA 2BRLA 5F1XA 2JSXA 5KG2A 4JUZA 2UXBF 1N62A 1SKWA 2NZTA 3NGIA 1NJIO 4QOZB 1IQTA 4O0IA 2QKQA 4CEZA 2B3TB 1S79A 4OYBA 4IS7A 1D8YA 4OHVA 4CFBA 3LK9A 2GNKA 3LW5C 3G8TA 3DM2A 3G9CA 2VU5A 1X6IA 3V6JA 4Z2XA 1RU1A 2QK9A 3NG8A 4DV1K 3N5FA 4K25A 3THTA 4PKDB 2AW0A 2FGOA 4CJFA 5HRPA 1XNSA 1BQNA 4FVCA 4F5NA 4RT2A 5LMUJ 2I2YA 3OTBA 3CF5L 1S0VA 1GFWB 3D3CJ 3D7EO 4X4OA 2P2CB 4AQYJ 4A8QA 4WTOB 1CI4A 2A1RA 3GJRB 4OYMA 3EVOA 3H3NO 3OBIA 5FLXU 5CB1A 4BRPA 1ZBIA 3OR2B 3AO3A 2HVIA 4H8KA 3O2IA 3VN5A 1O5JA 2IJFA 1XQSC 4BR5A 3GIRA 4J9MA 5KFRA 2BA9A 3W5YA 4X4TA 3M8PA 1ASUA 3NCRA 3H4DA 2H48B 3T7ZA 4YOWA 3CYMA 3DMJA 5AKIA 4I2AA 1NMEB 2FZGB 2VPZB 1W26A 4CIEA 3H90A 4KHPJ 3UVJB 1BPBA 4ES3A 3E8OA 2DGXA 1V4SA 2R8HA 1QVFM 3SFUA 2JVOA 4U7UD 2DGWA 1M5HA 1K5OA 1OPZA 3H0PA 1LWEB 4RUBA 4LF2A 3IRUA 4PQUA 1HNVB 1UVNA 3R1HA 1C0TB 2LYAA 1N34K 5DBCA 3DOKB 2YKOA 1XNQF 3RB6A 3QBWA 1NWKA 1WF1A 4KR0B 1YJNN 1ZA1B 3SENA 3H2VE 2XQCA 3SQOP 4DV6F 4FLUA 3H08A 2NLWA 3CMEN 1PK1A 5J1NA 3PSTA 3GCWP 4CO1A 2O67A 3D66A 5J2JA 2P9EA 2ZBQA 8ICLA 4OX9K 3M6UA 1Q1KA 5JMVA 3R8EA 5HJYA 1VSJA 4BDPA 4FW2A 4B6JA 2QEXN 2CH5A 2ZUDA 3KKSA 2MSSA 4OHXA 3CXCR 1EQMA 1HW8A 2DIUA 3JXUA 1WC0A 3WUHA 3KJQB 1HR0K 1S0NA 3ENOA 3NGUA 2XCAA 3ISCA 3OGUA 2I9GA 4O5KA 3M7VA 3RSEA 4YHHK 5ETTA 4DTJA 1CZ9A 4Y2MA 2HMIB 1JLAA 5HP1B 2MLZA 4DCOB 1LXNA 3K4GA 2ZNZA 3L2RA 5ETVA 5K14B 4NLSA 4I67A 4LFAJ 4WFAQ 4WE1A 4ED4A 3ICXA 5HP4A 4AYBC 1BHLA 3WZ0A 1MQ2A 3A0HU 3LPUA 5ALDA 2OXOA 1HYZA 2ZWPA 2KNJA 2B5JA 2QN6B 3C2LA 3W9JA 5TISU 4LF5J 2HK2A 5A2QY 1Q8BA 1BWFO 1M5KC 3BSOA 4B9SA 1RG6A 4YD2A 4RQ6A 3JPRA 5CZ2A 4FJHA 1NGHA 4EBCA 2EWSA 6FD1A 3QICA 4I2JA 3MI7X 2W42A 2YHYA 1S1VB 3UN5A 4CEOA 1HNVA 4NRUA 3PHEA 2BGWA 3A8EA 3IAS9 2Z56B 3ISND 1N0VC 1VQKN 2PEBA 4ZP8A 1Q7YT 3V6KA 3O6QA 2A6AA 3N79A 3TSPA 1TVRB 4DV7K 3B54A 2W9CB 1U1LA 5J0WA 2J0WA 1C1BA 3QIOA 5AJ3F 3KLIB 3MECA 3HX0A 2GW8A 2YB4A 1XU4A 5AE2A 1F2GA 2VG6A 1MWKA 3GDQA 2IVYA 1RBOB 4ES2A 3HCXA 1HNZJ 4WJBA 4PJ0U 4FPRA 4G6VB 3NS7B 2LDYA 3EZUA 4QYZK 4Y2TA 4QR2A 2KVCA 3UNGC 2OCEA 3VEOA 1R3NA 2OTLN 2EFGA 1CPZA 2VOOA 4USVA 4UBCA 4EIAA 3M8YA 4KPCA 4CNYA 1BIZA 3VEVA 1HIWA 3QXGA 1UHUA 2JV3A 3OR2A 3OYCA 4QWCA 4ELUA 3L2UA 1SC4B 2O01C 1YDLA 5HROA 4CLSA 5KFKA 1RHMB 2OZMA 2A5XA 4DU1A 4U8VA 2L08A 1BA0A 2X3DA 5CD4H 2QTDA 1SH0A 4AT1B 5EX5A 3BS9A 5CQGA 4IJAA 4CBXA 3D68A 3OXFA 3WT0A 2E88A 1EX4A 2D8CA 4JWMA 3EEQA 3RJGA 4BDYA 3SD7A 4DCPB 4FYVB 2Y0BB 3VQAA 3OS0A 2DUYA 9ICXA 1XNRK 4X65J 3GCXP 4O3PA 2HZCA 3G6EN 3DXKB 1HLWA 3CDUA 3FZBA 4RU9A 4RUAA 3ZDCA 1EKSA 3V6DB 1ZQYA 1B9DA 4JLHA 4X2BA 5I42B 2WZ1A 2KHQA 3MTJA 2E3TA 1LWCA 2P6RA 1CEZA 3UM9A 4ZLJA 4HHUA 1A9NB 1WWHA 4ZKAA 5F8JA 4Y1DA 3IMQJ 4TLRA 1HEKA 1RKIA 3D54A 4Y2QA 3KMSA 4WYWA 3GR0A 5DDYA 1Z05A 5AQIA 1SV4A 4JYAF 3TAGA 1J5EJ 4NZ6A 2JZ5A 5J29A 4X65F 1Y5LB 3BS5A 4ED5A 2ZBIA 3DLKA 2VHGA 1X4FA 3I55N 2BRKA 2G0CA 4M5GA 3VR1A 3SBGA 4J91A 3MEEB 1AB8A 3RVCA 1SJQA 1ZBFA 3PW5A 4ELVA 4NCGA 2E6MA 4IG0A 5FD1A 4E7LA 3FSIA 2JEIA 4PUOA 2GLEA 5ETKA 3ENVA 1KSPA 2V4RA 4B3OB 2B4JA 4FM2A 3SEOA 1QAXA 5FLXY 1Z1ZA 1SQKA 4BX9C 2R2SA 1RHRB 3MMCA 5HVHA 1RADB 2DPNA 1DK3A 4WPAA 2E1CA 1NHKL 1LKYB 2UU9J 4CTAA 3RW7A 1B7YB 4M45A 2XCPA 1JCFA 4P2XA 2UXDF 4M3UA 3AN1A 4M6WA 1YX2A 4P0QB 3JS9A 2WMMA 4EHTA 3TZYA 1ITPA 4RWXA 3VQSA 3W5ZA 4DZDA 4OPKA 1GOCA 2ZH8A 1FO4A 4NEZA 4ECVA 1RT1A 3FQKA 5D3GA 3CDAA 4ID8A 4ZCLA 4NXNK 1KP6A 1X3MA 4CIOA 4HVZA 3VVUA 4O3SA 4IDKA 1YVUA 3D2EA 2HSTA 4CF4A 1F9FA 1HRHA 4C4TA 4Z4EA 1N4LA 1FE4A 3I31A 4Y2XA 1ZQIA 5ETMA 5TKYA 4OJLA 6AT1B 1ZBTA 3HHDA 4URGA 1HYVA 4P6QA 1RYSA 3LPTA 5EWEA 2GO8A 3MGJA 3LL3A 3V5RA 2WOMB 4TUSA 2LA6A 4CGJA 3DRPA 3HYFA 4ANCA 3DLGB 5IV3A 2BE2B 2B4VA 2FXUA 1MW7A 3J7ZT 2FSNA 4RQ5A 3NF9A 1H74A 4NJ8A 3CETA 2XGQA 4JYAJ 2BJDA 4MO5A 3PIOL 4W5RA 2CQ2A 4CJLA 3AAWB 4RQ2A 2QW9A 4FLXA 4FPAA 4M2YA 1FTRA 5KFLA 2DT9A 4DPUA 3DJCA 5AKKA 2Z57B 4DR4J 5A0YB 2O4IA 4QZ8A 1RWUA 4OJRA 2B6GA 2IA6A 1YVNA 2DPIA 2E44A 2AGQA 3L9ZA 4JK1A 1XSLA 4LD0A 1S97A 2XNRA 2HMXA 5ALXA 4DQSA 4Y0FA 4CO2A 5E3CA 4BRFA 3N4PA 1P1LA 1ZA2B 3CI5A 1NCLA 5ETSA 3JTPA 1ZJMA 1O6XA 4QJFB 4DFJA 4MF2A 3QJLA 3WQPA 1RISA 4JI7J 4HUFA 4DUZF 2YHXA 3VAFA 4CBUA 2D9OA 4FPIA 4A2AA 3GONA 1Q53A 4NZ7A 9ICRA 3HULA 1TFYA 2MZQA 4MK8A 2HHQA 1FKPB 1Z2ZA 1X5PA 2C3YA 3CC2N 1TELA 3BR9A 4EMDA 1NK5A 1HNIB 5GAHP 1CQMA 7ICTA 4E1MA 2PO4A 2HVHA 3DDNA 2ODGA 3AO5A 1RXOB 1KVAA 3AY9A 2XC9A 3AOBA 5J1EB 4DOCA 2CQ1A 5KFPA 5CA7A 3H1VX 3TWZA 5E41A 1LK5A 3W8PA 3V7LA 4AH9A 5GAEP 3W2WB