4EZ6A

Bacillus dna polymerase i large fragment complex 1
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
580
structure length
549
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a High-fidelity DNA Polymerase
rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 192
structure length 549
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ez6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4ez6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ez6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ez6A01
3NGDA 1ZETA 3LPTA 3TI0A 1ZQEA 4ELTA 4G3IA 3DOLA 3AVIA 2ETJA 3THVA 2VA8A 2MUTB 4RQ3A 1RTHA 5KFDA 1BIUA 4CFBA 4M6WA 4E7KA 3IHQB 2XRIA 4O5BA 4DU4A 3L3VA 3LWMA 8ICXA 5JUMA 2QKBA 3MR3A 1WLJA 4J9QA 3IS9A 3PO4A 1Y97A 3C5FA 1A5WA 2GBZA 4LD0A 3K5MA 4DTOA 4M3YA 5EOZA 2HNYA 2ISOA 2C28A 4CJEA 5DBCA 2ASDA 1C0MA 3DLGA 1C1BA 1O1WA 5D4BA 3LP3A 4HVJA 4BDYA 4YXMA 3VQ9A 4DTJA 1XHZA 4C8NA 5BPCA 1RZTA 4B9MA 2BCSA 3MBYA 8ICOA 3VQ5A 5CWRA 3VQ8A 3L3UA 1RBTA 3ISCA 5DGBA 5CA7A 2ZD1A 4ZHRA 3UQ0A 3RJKA 3AVGA 3SQ0A 3RMCA 4C8OA 3RJGA 4M9JA 4DG1A 3AVLA 4NLGA 4HUFA 5DB6A 4KRFA 4QZIA 2QXFA 4ED0A 5KT4A 4DSKA 1B22A 9ICGA 2FMPA 4DEZA 2OPSA 2WTFA 3HW8A 1SL1A 3PX4A 1QLNA 4R63A 3KD1E 5HROA 4CHPA 1L3SA 4H4MA 4FBTA 8ICVA 4FJ5A 5BOLA 3DLRA 3EW9A 7ICPA 1TV6A 4J2DA 5HRNA 4KB1A 8ICQA 4YVZA 4UAWA 8ICAA 4OGCA 3PW0A 2X6NA 3ZD8A 4FJJA 2XHBA 3WNGA 1RTJA 4ID5A 4HCBA 4DQIA 4O55A 3AO4A 4DL7A 4CGDA 4XQ8A 4LVSA 3OYHA 1A76A 1U48A 4IQVA 2MAXA 4OLBA 4RQ4A 1BPDA 5KG4A 1RPLA 2PI5A 4O3OA 3GQCA 1GOCA 4CERA 1NK4A 2DFFA 8ICKA 4UQGA 4CK2A 3AVCA 7ICKA 4BE0A 1ZQVA 1XU4A 1WSHA 2EX3A 2YHAA 4YR2A 1IKXA 4FLXA 3PUFA 3NH2A 4PGYA 4RQ5A 3OYCA 2FMSA 4OGEA 4Z0UA 3SPZA 2W9AA 1UT5A 3OYBA 3AVAA 3OYJA 2XCPA 4B9TA 4RG8A 4EYHB 1NJXA 1KFSA 4I2PA 2M9NA 2R8KA 1NJWA 4FZZA 3C5GA 7ICHA 3K75D 3MDAA 5J0QA 3SI8A 3RH4A 1KFTA 3ZSXA 4Q0BA 4W5QA 3O3FA 4KLFA 1ZYQA 4FJLA 1FK9A 4KLOA 3V9UA 4ZH4A 2W9CB 8ICEA 1T4GA 2ZUCA 1JXEA 9ICLA 1ZQFA 3E2EA 4I2QA 5KG7A 3LPUA 4EBDA 1CXUA 4I28A 3TAQA 5KFJA 4P4PA 4FLZA 2J6TA 9ICHA 3H8SA 5CB1A 3DOKA 4RQ7A 4IRDA 8ICGA 4Z4FA 4LZGA 1KCFA 4RQ6A 4ED7A 4Z4HA 3RMAA 3OYKA 3C95A 1VK0A 3HK2A 4KKOA 4F8RA 5J29A 4UB4A 4IQTA 1RT5A 4M3WA 5CYQA 1D9FA 2ASLA 3IRXA 5FROA 2AGPA 2NRXA 1B43A 1BPZA 1S0VA 4DOCA 3SV4A 4M47A 1X2IA 4ED8A 4ELUA 1RBSA 1VSHA 4PY5A 1MSWD 4CF9A 4E89A 2AJQA 3ZT2A 3MFIA 5KT6A 1U49A 5C25A 1QS4A 4J9KA 3I0RA 3K5LA 3WNHA 1XSLA 2ZUDA 8ICFA 3FDSA 1HYZA 4FLWA 4DL4A 2KW4A 3ZT3A 3QE9Y 1CZBA 1RNHA 3G0ZA 5KFGA 4KHSA 1JLCA 3RJFA 5DG9A 2BCQA 3ZDDA 3NHGA 4KLQA 4M3UA 1LV5A 3AO1A 1BVSA 2BQ3A 1ZQHA 1I3AA 4E7LA 3N4MB 2P66A 4I2GA 5CY4A 5I3UA 4KHUA 1QTMA 4B9LA 4QZEA 4QWAA 1EETA 1Z3EB 3JSMA 9ICIA 5J2EA 1TKTA 4P2HA 2ZJ8A 3JPPA 4OKEA 1L3VA 5DG8A 4JRPA 3K59A 3FFIA 2RDIA 2HVIA 4E1MA 8ICYA 3H8JA 1SKRA 3KK1A 3CQ8A 5J0OA 2Z1GA 2BHNA 5DQIA 1LAWA 4B9UA 2PZSA 4NCAA 2AGQA 2AQ4A 1JXLA 1FXXA 3AV9A 4J9OA 1S0MA 5EWFA 3DRRA 2F1JA 2PFQA 1Q9XA 4JUZA 1ZJNA 4P4MA 4DQPA 2KZ3A 4LY7A 3V9XA 5KG1A 4DU3A 4J9LA 2BQRA 2PFPA 1BCOA 2UVRA 5CZ1A 4NM1A 2JZBB 4KN4A 1DTQA 3SJJA 4YN4A 4RZRA 1ZQAA 8ICLA 4CK3A 4FLUA 4PWDA 4TSXA 3OYAA 3TARA 2VANA 4FM1A 2G8KA 4M3ZA 3TAEA 1RT7A 1ZQLA 1TKXA 3KLHA 5D3GA 4MEYA 3C1YA 2IBKA 4W5NA 7ICJA 5DDYA 1WN7A 1YTAA 4LSNA 1ZQTA 1ZQQA 3ZDCA 3VQ7A 3O3GA 4F5NA 1MQ3A 4DSLA 3AO5A 5KFZA 2IS3A 3RB3A 4QW8A 1C0TA 2QKKA 4FJ7A 3WNFA 4NYFA 3S9HA 2OA8A 5KFNA 5KT3A 4KB0A 3RH6A 1ITGA 1Z25A 3SYZA 4DO9A 2HNZA 3B6PA 2AGOA 3ALYA 3QLHA 1SL2A 4B8CA 3GILA 2XGQA 2HMIA 3LP1A 4JV1A 2VWKA 3SUNA 4ECRA 3ZSZA 4H8KA 1NKEA 1LWCA 1NKBA 4DSIA 4AHSA 1NK6A 1RT2A 3QIOA 4QZCA 3GIMA 3OYEA 3VQQA 1TV9A 1KSPA 3OGUA 4M9NA 4QZBA 4F2SA 3PX0A 1IKWA 4F4ZA 3VA0A 1C1AA 4I2JA 1R0AA 2WOMA 4Z6CA 5HP1A 4YR0A 3GIIA 4R66A 1RYRA 2YKMA 2W9BA 4UBBA 1H38A 3IG1A 2RKIA 3C21A 3RRGA 4F5QA 5C5JA 4MFBA 5SWMA 3EZ5A 1UT8A 4I2HA 1UA1A 3S3MA 2ASJA 1HNIA 3P5JA 2AQ0A 2Q3SA 2FLLA 4M9HA 8ICSA 5IIOA 4OJRA 5FDLA 1XHXA 1FKOA 4IG0A 4XA5A 5HRPA 3VQ4A 4YG2A 3C6UA 4KFBA 1S77D 4I27A 8ICZA 3SZ2A 1KRPA 1BISA 4I2FA 5I42A 3ZSOA 4FJMA 3DLHA 3IM1A 4O4GA 1EXNA 5KFXA 8ICPA 2ATQA 2P5GA 3H4BA 3SQ4A 3C2KA 2E6MA 4F3TA 3HVTA 5KFIA 5DDMA 4IBNA 5J0PA 3RAQA 3NH0A 5KFQA 4GMJB 1NKCA 2RF2A 4RW8A 7ICIA 4NYNA 4ED1A 3TAPA 3HPGA 2FPKA 5J2BA 1NK0A 3B6OA 4BE1A 4DL3A 4BDZA 4W5TA 4R8UA 3O4QA 4DMNA 1N5YA 3KK3A 3ISBA 2IC3A 1TL1A 4B08A 1IKYA 4KLLA 4CEEA 3RH5A 3V6DA 2I5JA 1VRUA 4QZFA 1HNVA 1Q8IA 3MEDA 9ICAA 3K2PA 2YNHA 3M8SA 3HYFA 4ECVA 1J53A 5DK5A 3M9NB 4CCHA 3M8PA 4K4HA 3L2QA 1UAXA 1KTQA 5KFMA 2A1RA 4ED2A 1JX4A 2HB5A 3VQCA 4Q8FA 1VSDA 1S6QA 1GOBA 4J9SA 4KHNA 3SCXA 4R64A 4UAYA 3QEBZ 3OYIA 3UQ2A 4DTMA 3B0YA 4DFMA 1K1QA 4Z4EA 2BE2A 2I9GA 1CXQA 4JS4A 3RB4A 3OS0A 2DFHA 1TK5A 3Q8QB 1UWBA 2XC9A 2YNGA 3TWHA 3NF9A 3ZT1A 4EZ9A 1QE1A 3KD5E 1I39A 3N97B 1KVBA 2FPLA 4RUCA 3LP0A 4E19A 2YNFA 3P83D 1WCLA 2DY4A 4O5KA 4UAZA 3JPTA 5IINA 2ZJAA 2P6RA 8ICRA 3KLIA 3VQBA 4QWCA 3I0SA 4F5OA 4B8AB 1DGSA 1U45A 9ICWA 3GDXA 3L2VA 1S1UA 2YHBA 4CIFA 4F2RA 4PHPA 1KDHA 5K14A 5D49A 4RNMA 5J2NA 2GV9A 5D46A 4DS4A 2VA2A 1ZQGA 4PH5A 4RPXA 1S9GA 3VQ6A 2UVWA 4M45A 5HLFA 4AHRA 4C8KA 4BWJA 3Q8RB 4M0AA 3V9SA 3KKRA 5KFBA 4CF8A 1ZBFA 4FS2A 3NF8A 4M41A 3MXIA 3HO1A 1ASWA 3V81A 4DFJA 3MEGA 3H40A 4DOBA 4PA1A 3AA2A 3OYDA 4OLAA 1JLEA 3V7LA 3OSPA 4Q43A 1BHLA 4AHVA 7ICGA 2ZTEA 5JS1A 4TUQA 3T1AA 1T05A 4I2EA 3BGRA 4BACA 4DFPA 1Z00B 1L5UA 4KLTA 3K5NA 5KI6A 1S6PA 3MFHA 9ICBA 9ICVA 4F93B 4DQSA 4KTWA 3ZT4A 4ID1A 5DKWA 3OVNA 3OJUA 4BE2A 4MF8A 4LH5A 1ASVA 4CJSA 4FZXC 2DFLA 3EPGA 4CHZA 4E3SA 5CYMA 3SUOA 4HYKA 3V6HA 2BCRA 1KFDA 2BPCA 4EYIB 3TQ1A 4FM0A 4PHDA 5HRSA 4RQ8A 1W0HA 2Z1JA 8ICIA 5IIJA 4FJGA 5KT5A 4ZTFA 4NLZA 3RR8A 4J2EA 4KMUA 3AVKA 1IO2A 2E4LA 4CGJA 2VG5A 7ICMA 3T5JA 4RW4A 2BCVA 3OHAA 2O4GA 3Q8SB 2X74A 2B5JA 4FBUA 3AVBA 1ZQYA 3LDSA 4NCBA 5HMLA 4KHQA 4WE1A 4ECWA 3TAGA 2FMQA 4DSEA 4EZ6A 2FLNA 4CEFA 1ZQZA 3MDCA 4DL6A 1N56A 4M9LA 5HHHA 3RB0A 3ZSVA 4PUOA 3BQTA 4DOAA 3D0PA 4O5EA 1D8YA 4NLKA 3ORYA 1T03A 1RDCA 4CK1A 4BXOB 1NK5A 4CJLA 7ICEA 3VN5A 4J9MA 4F4WA 2XO7A 4NCGA 1F21A 1S10A 4IDKA 3HXMA 4Z4IA 1LW0A 2D0BA 2E6LA 4AH9A 4QWDA 1NOZA 4B9SA 1ZQOA 4ECQA 1JL1A 3QEXA 1HQEA 7ICQA 2X78A 3HT3A 5EWEA 5KG2A 1FKPA 4QWBA 5J2AA 4M04A 2ZE2A 1RXVA 1BIZA 3V1RA 5KGWA 3T19A 1IH7A 3JPNA 5HHIA 4J9RA 1Q9YA 1NOYA 7ICTA 3H7IA 2LSNA 2J6SA 4CEAA 5J2QA 4CE9A 4CF1A 4GW6A 1ZQCA 4DSFA 3V9WA 4E7HA 4E7IA 1D9DA 2HHXA 2F96A 4CJPA 2IHMA 3UXOA 3PMNA 5C24A 1ZQRA 2WONA 4CJ4A 5KFAA 4O3SA 3NF6A 5DB9A 2OZMA 3UIQA 1HPZA 1J5OA 1RDDA 3EY1A 1KVAA 4CJWA 2HHUA 4CJUA 2IGIA 1JL2A 3C2LA 4YR3A 2G8WA 1BI4A 7ICSA 4TQRA 5DB7A 1KLNA 3HM9A 3RAXA 2G8FA 1NK7A 4ED6A 2FBYA 3RJHA 4F50A 2ISPA 3GV7B 3LZJA 4UBCA 4F5PA 1HQUA 3C1ZA 4E1NA 5J0TA 2P1JA 1CLQA 4YD1A 4KV8A 2DTUA 3RJJA 4N47A 4B9NA 3OS2A 1EKEA 3O4NA 4ELVA 1HUZA 1YT3A 1SKWA 4UB5A 1JIHA 4K4GA 3SQ2A 3ITHA 1ZQNA 3NAEA 2PI4A 3AVHA 9ICRA 1KLMA 1IXRA 4DTNA 3DLKA 4MF2A 4DS5A 5EWGA 2ATLA 5KFCA 4RNOA 1TKDA 9ICCA 1X9WA 1V9PA 5L9XA 4RUAA 4FJXA 4FXDA 9ICKA 4ZTJA 4RPYA 3C2MA 3LAKA 9ICOA 4CFAA 2EHGA 5KFOA 4KLSA 3BQ0A 4MQ3A 3CM6A 2JEFA 9ICXA 3ZSYA 8ICUA 1X9SA 2W9BB 4QOZB 2KFNA 2XCAA 3QEAZ 2JEJA 1RT6A 3K58A 4IFYA 4FK0A 3RJIA 3CFOA 5EU7A 3TAFA 4FYDA 5J2FA 5KFFA 3SQ1A 4M9GA 1RDBA 1NK9A 4G1QA 3PW2A 4Q44A 2KZZA 1VSMA 4I9LA 4CF2A 3SPYA 3P1GA 1DOQA 3T3FA 4KLGA 8ICJA 4CGIA 4N41A 3OYMA 5KFYA 2H5XA 4O5CA 3HWTA 4FZYA 5KFWA 3SI6A 1HJRA 5IILA 4KITB 4UB1A 7ICRA 3F9KA 4K4IA 4DLEA 4I29A 4DU1A 3TAMA 1JKHA 2OPPA 5DBAA 3OY9A 3MR6A 1TVAA 4AHCA 3JPQA 2A1JB 1VSFA 4YD2A 3BQ1A 5HP4A 3AUOA 4XIUA 1T7PA 1NK8A 3LZIA 2C2DA 4FM2A 4YMMA 5KFVA 3PW7A 4JWNA 4RW9A 4QZGA 4M3TA 3ZDEA 4Z6FA 3OS1A 4FLVA 1ZQBA 1S1TA 5E41A 1D5AA 1D8LA 2HVHA 1SKSA 1XSPA 3OSNA 1N48A 1GOAA 4Y1CA 2HHQA 3M8RA 4FLYA 1VRTA 1REVA 1ZQKA 3PY8A 4Z4GA 4Y1DA 4MFCA 4OPKA 4O3PA 5L1KA 3KIOA 4DTPA 5CR0A 4F4YA 4KREA 2OPRA 1ZBIA 1A77A 3G6YA 3AO3A 3AU2A 3PW5A 4RQ1A 5DLGA 4PGXA 1TAUA 1ZQJA 4TURA 2DPIA 3RJEA 1RTIA 5J2KA 1WSJA 1VSKA 8ICHA 5CZ2A 4GC6A 5HBMA 1MC8A 9ICQA 5KGXA 5TZVA 3AA4A 4UB3A 2NRWA 8ICTA 3QEPA 3IAYA 2OPQA 1ZQXA 3ULDA 5FRNA 1JLQA 2JGUA 2B4JA 4CJ5A 4QZ9A 3PMLA 4FS1A 3HJFA 1TAQA 4BWMA 9ICNA 3UXPA 1RT3A 4ICLA 1J54A 3AU6A 1B9DA 4PGQA 4GXIA 1X1PA 1CZ9A 4JRQA 2AU0A 4JWMA 2FBVA 4BXOA 3K57A 1B9FA 2UVVA 3LDAA 4FJIA 2Y1JA 5L1LA 3AVJA 2BGGA 2JEIA 2RDJA 4CEQA 9ICFA 3MGIA 1NOMA 4YFKA 4QWEA 4HTUA 3KKSA 4O44A 1MQ2A 4CJKA 2RPIA 1LWEA 3BQ2A 4IR1A 2MUTA 4NXZA 3QNOA 3ISDA 2IMWP 5DGAA 4IRKA 3ASMA 2V4RA 8ICBA 4FJNA 1WAJA 2YNIA 4RW7A 2KQ2A 4RNNA 3S3NA 2OZSA 4XRHA 5KG3A 3AVNA 4AHTA 3HP6A 7ICVA 3Q8KA 9ICUA 5J2GA 4TUPA 2B21A 1BCMA 3G6XA 4DTXA 3KTQA 7ICNA 3V4IA 2BR0A 1VSLA 1U04A 2Z1IA 3Q8PB 2Y1IA 4K8ZA 3B0XA 5KRSA 3U3GA 1IM4A 2PFNA 3BJYA 4CGGA 3GV5B 3SUQA 1HUOA 3G10A 4F91B 3TFSA 4CHNA 4QCLA 2I1QA 2ALZA 4JV0A 4RQ0A 4YMNA 1BI4B 4R65A 5KT7A 3HP9A 3PR4A 2UVUA 2O4IA 2F1HA 1J9AA 4M6WB 2YKNA 1RILA 1JMSA 4N76A 3ZSWA 4CJ3A 1UOCA 4TQSA 5DQGA 5J2MA 3A2FA 3OYNA 4CFDA 9ICEA 1ZBHA 1JLBA 2F8TA 4DLGA 2JEGA 1YTUA 1QSSA 1EXQA 1Y88A 3O3HA 4ECTA 4IFVA 4DQQA 3CFRA 1U47A 4YCXA 1ZJMA 4KPYA 3RR7A 4PHEA 4KTQA 2D0CA 1RT4A 3L2RA 2HW3A 2YV0X 2BQUA 4FJ8A 3K5OA 3MXJA 4B9VA 3NDKA 4N5SA 3RTVA 2Q0ZX 4F4KA 4RW6A 3SNNA 1HJPA 4LZDA 1NJYA 4KAZA 4OVLA 4X5VA 3LANA 1T8EA 4CF0A 3UPQA 1ZQPA 3KJVA 4Q45A 4OPJA 1C0UA 4QAGA 1RBRA 4YQWA 3RRHA 1BPXA 4Q8EA 3QESA 1C6VA 2XY6A 5KFUA 4I7FA 4I2AA 7ICUA 3QEWA 3S3OA 4IKFA 5J2CA 4CEDA 5KFEA 4DTSA 4CGFA 3ETLA 5DMRA 4FK2A 8ICMA 3QEVA 4DQRA 2FBTA 3NBPA 3NFAA 2PFOA 3OJSA 1VSIA 3OYLA 4FO6A 3SUPA 4O3RA 2IAJA 5J2HA 3PW4A 1HRHA 1VSEA 2HNDA 3U3YA 3HL8A 1COOA 1S0NA 2ZQBA 1HMVA 4HCCA 3MAQA 2W9CA 5KT2A 5KFRA 3HVRA 1S1XA 4Z6EA 4GXKA 4E0DA 1DLOA 4CIGA 3G6VA 5DQHA 5J0SA 4YMOA 2W42A 1WSFA 3ZSQA 4K8XA 1L3UA 3HPOA 1G15A 4CECA 4CEBA 1SZPA 3MECA 4DL2A 2R8IA 1JXBA 3MGHA 1LWFA 3KLFA 2B6AA 1W9HA 5KFKA 3DM2A 5KTQA 3EPIA 4CJFA 1LB2B 1JLFA 1MU2A 3QINA 3LP2A 5IIKA 4LSLA 4KLHA 9ICPA 4QW9A 4MEXA 1S76D 1WSGA 3NE6A 3H8WA 4I2IA 9ICJA 1HYSA 1LW2A 3PNCA 2FBXA 4KTZA 4OKKA 4JS5A 1B92A 4M3XA 4AHUA 1RTDA 4P4OA 1AROP 1ZQWA 3CG7A 1KEJA 2HHWA 4I2DA 1X9MA 2BCUA 1QSLA 4RT3A 1BPEA 4YFUA 2IA6A 4MFFA 4O3QA 5KG0A 3T5HA 1XS9D 2ZUBA 3GV8B 3ZT0A 4DTUA 2W8LA 5L1JA 5J2DA 1C7YA 2BGWA 1CEZA 3MXMA 1XO1A 4FJ9A 5HNKA 3VQEA 3NGZA 4O3NA 2XY5A 2W8KA 3HSTB 9ICMA 4YP3A 3PX6A 5CHGA 1N6QA 2ZTCA 2R7YA 1BL3A 3PO5A 4F4XA 4KLEA 2PY5A 4FW1A 3QIPA 4R5PA 4ECSA 3V9ZA 4HUGA 5J2IA 8ICWA 4O0JA 4J2BA 1S1VA 5JS2A 4ECXA 4FJHA 1ZQDA 2HHVA 1EX4A 2P51A 5KFLA 3LK9A 4CIEA 2BKEA 3JPRA 4F92B 4ECUA 4Z6DA 3QZ8A 3V72A 3Q8MA 4F3OA 4GXJA 1SUQA 4KLJA 5HMMA 3AVFA 4Q5VA 3RBDA 2BANA 2P6UA 3V6KA 3KHLA 4KI4A 3V7JA 3PVXA 4EEYA 4KLUA 1S0OA 2GUIA 1ZQUA 3V7KA 3JPOA 4IQWA 2R8GA 4C8LA 4OKJA 3LALA 1RCHA 3EYZA 4DL5A 1S9EA 3M8QA 1IG9A 1XC9A 1VSJA 4FVMA 2XGPA 2R8JA 4PPXA 1BQMA 1BPBA 4CJRA 3QERA 1ZQMA 4RT2A 2BDPA 3ZCMA 3NCIA 1ZBUA 1ZBLA 4W5OA 4JV2A 2VG7A 4KLDA 4HHTA 1QQCA 3OYGA 2HHSA 4KLMA 3MEEA 3RMBA 4J9PA 3DMJA 5KG6A 2GWSA 9ICSA 5J0WA 5J0RA 5SZTA 1TVRA 2G8IA 2Z1HA 2ZJ5A 1T3NA 1UA0A 3CFPA 4DTRA 4KHYA 1SV5A 4QZDA 1S97A 3ZDBA 3VQAA 4BGDA 3QZ7A 5IIIA 1BGXT 4CHOA 1LAVA 3RBEA 2IHNA 3C6TA 2FLPA 2KFZA 4W5RA 5J0UA 3KLGA 4GVMA 3SV3A 2C22A 2BPFA 3H08A 4KN7A 4ECYA 2C2EA 1WAFA 2PYJA 3NF7A 2OYQA 3LWLA 2KN7A 4YNQA 3BDPA 1DTTA 2X6SA 1JN3A 3VQPA 2VG6A 3QEIA 2NRVA 4EBEA 2FC0A 1ASUA 1XSNA 4C8MA 5J0YA 3ZDAA 5KFHA 1TK8A 2QK9A 3L2UA 5J0XA 3AO2A 3RMDA 3TANA 4KO0A 4BDPA 4J9NA 2F1IA 4M42A 1WSIA 5CP2A 4TUSA 3TABA 2C2RA 3MABA 2W9MA 4EP5A 1JLAA 4CHQA 4I2BA 4KI6A 3C94A 4AILC 1WCNA 3DLBA 3GIJA 2NRZA 4J2AA 3Q8LA 7ICLA 1ZQSA 3KLEA 3QNNA 1QSYA 1BPYA 4RQ2A 2LYHA 5KFTA 3F73A 5KG5A 2RN2A 4FLTA 3JPSA 1HYVA 3AA5X 4JK1A 4ECZA 3CM5A 2P5OA 2G8UA 4O9MA 1BQNA 3VA3A 3NGYA 5F9NA 2PXIA 8ICCA 1TGOA 1QHTA 4GLXA 5DB8A 1IKVA 4FJKA 2F8SA 4F5RA 2NRTA 4CEOA 1WNSA 4IQUA 2OWOA 4DFKA 3DLEA 4NY8A 2IOCA 1Z00A 3M9MB 4IG3A 4QZ8A 4CEZA 1RBVA 1C1CA 5DBBA 3LAMA 3V1OA 9ICTA 3T5LA 4EP4A 4QZHA 4M2YA 3ISNC 4CHYA 4XUSA 1RDAA 3AA3A 3L8BA 1S5JA 5HRRA 4DF8A 3DRSA 2DPJA 3CYMA 3UXNA 1XWLA 5BOMA 4I9QA 4IR9A 3DYAA 2DFEA 4CJVA 3PV8A 4RPZA 4QZAA 3RWUA 4CJQA 2G8VA 2D5RA 2D0AA 1JLGA 3MR2A 1TL3A 3L2WA 4E7JA 2ZTDA 3EWAA 3NGIA 2R8HA 5DG7A 1RT1A 4KLIA 1RBUA 1PZNA 1XI1A 3ZD9A 3FYHA 3OHBA 3GFKB 3KHGA 3WNEA 4CGHA 2PYLA 1RXWA 1EP4A 5CJ7A 3E01A 4O0IA 3MR5A 7ICOA 3HPHA 2J6UA 3PR5B 4PHAA 4CESA 5J2PA 4CJTA 3V1QA 3DI6A 2IDOA 1U9LA 3T5KA 3QO9A 5DLFA 4DSJA 4FK4A 4NM2A 8ICNA 5T7BA 2FPMA 5KRTA 5L1IA 4MFAA 4LH4A 2XY8A 4Z4CA 2ITGA 1U4BA 3I8DA 1S9FA 3D45A 1TFRA 1RYSA 3KHRA 5F9LA 2NUBA 3ZSRA 3JYTA 2VA3A 4I2CA 3TR8A 3U6FA 1A5VA 5J2JA 2XY7A 5KFSA 4N56A 3QETA 3RB6A 3V6JA 7ICFA 1CUKA 2VWJA 2V9WA 4DF4A 3K4GA 3M9OB 1L3TA 1TKZA 1WSEA 4B3OA 1K6YA 1KVCA 1NJZA 4EBCA 5KFPA 4R8UB 4L8RB 5J1EA 1SL0A 2JLEA 4GC7A 2KZMA 4RU9A 3DRPA 1K1SA 4KHWA 2JZBA 5IIMA 4UB2A 4NLNA 2HHTA 3OYFA 3GIKA 2BPGA 4FW2A 3H4DA 4H4OA 1ZQIA 2A1JA 1Z26A 4CFCA 4ED3A 1TK0A 2G8HA 3KHHA 5C42A 3NH1A 4YXJA 3C23A 2KTQA 5FRMA 4FCYA 4HUEA 3TFRA 3HX0A 3NTUA 4M3RA 3AVMA 1YVUA 3KK2A 4PQUA 2A1SA 1A5XA 2V4QA 4DWIA 1S1WA 4IRCA 3VQDA 4JLHA
chains in the Genus database with same CATH superfamily
2CYYA 4DN0A 3NGDA 3LPTA 4B3RJ 5DM7L 1CJTA 2YKQA 4G3IA 2VBYA 1YBUA 3OR2A 1XMOF 4RQ3A 3D6FB 3NS7B 1BIUA 2JSXA 1X9XA 4KRWA 2UUBK 3UKRA 1SBRA 1JNZB 2QT7A 3NGUA 3LF0A 4B3SJ 3PO4A 3C5FA 5EOZA 4XH1A 4FZNA 2C28A 4K4UA 4M95A 3HJVA 4GKKF 3HRDD 2ASDA 3W64A 3LP3A 1NDLA 1NPKA 4YOVA 2Q43A 3VQ9A 2W03A 1RZTA 3AXMA 4WBFA 3L3UA 1WEYA 1CS4A 5CA7A 2ZD1A 1N5SA 3SQ0A 1YIJN 3RJGA 1MROA 5K14B 2YH0A 4DG1A 3FCVA 3AVLA 4NLGA 1PK1B 3CCES 4ED0A 4DSKA 2FMPA 2KEYA 3B8HA 3LPYA 5DDPC 1SL1A 1VRTB 3LGNA 3KD1E 1DEJA 2E7WA 1RWKB 1L3SA 2P2CB 7ICPA 2OPRB 3EICA 2OO4A 2M70A 1TUGB 4OHXA 4KB1A 4YVZA 8ICAA 3GJTB 4HTJA 2NZCA 4FJJA 2XHBA 3WNGA 4CZKA 2EZZA 4BRIA 1WOQA 2VQFK 3TKAA 4PQUB 2WSFC 3BO4A 2DNRA 1KQGB 2IY5B 1HBNB 1HNZK 2PFFB 2E8AA 1HBUA 2W7AA 2DCUB 3VV2B 3SSSA 3J8AA 1GOCA 3D7EO 3MF5A 2DFFA 3MMCA 4K25A 1SUQB 3OVAA 2CZ4A 3LDOA 4NYOA 4NZ6A 4YR2A 2YHAA 2ABYA 4FLXA 1SC1B 4A2AA 4RQ5A 2G08A 3EVWA 1APSA 3HULA 5KPTA 5AQQA 5JMVA 3SPZA 1UT5A 3D9BA 4CO4A 3AVAA 2XCPA 4RG8A 2G0CA 4I2PA 4A5AA 2M9NA 1NJWA 5H9EK 3C5GA 2DHSA 3OBYA 7ICHA 3MDAA 3CF5Q 3P3DA 4JI1J 3UPFA 1FTRA 2GIQA 1WORA 2F8EX 1KFTA 2IRXA 3Q8VA 4UAVA 4W5QA 2YX6A 3EDRB 4A8EA 4CYUA 1RWVB 1ZYQA 3G96A 1J2VA 3UM9A 2ACYA 3ILLA 1EHWA 4OHYA 5AI6A 2W9CB 4CZCA 2W40A 9ICLA 1F2GA 2R2TA 3AOCA 3V5RA 5KG7A 3JXUA 4EBDA 3GU0A 1CXUA 5KFJA 4FLZA 1NU0A 5E3CA 2DF4B 1CJVB 2DNMA 2J7KA 2BM1A 2JWKA 1FJCA 5BN9A 4Z4FA 3M6KA 1KCFA 4RQ6A 4HHHA 4MIBA 1FRMA 5GAHU 2J7UA 4CLLA 1RWWB 3WQUA 5M2PA 2MKJA 4IQTA 5CYQA 2KO1A 4ZCKA 2AGPA 2WHOA 3CJKB 3AAPA 2HQIA 1BPZA 2B43A 3CW2C 3MPUB 3NLCA 1TUWA 4IS7A 3BEGB 1WKLA 2VYPA 1KKXA 1MSWD 4JKGB 4CF9A 1NCLA 2HFNA 2AJQA 4E89A 3I4PA 5AQJA 4G9ZA 2AHOB 2HGLA 5C25A 3D67A 3AGKA 3PG9A 5AKYA 1FKAF 2ZHAA 1QS4A 1BXNA 5AQPA 1PK1A 1PVRA 3UE2A 2EBGA 3FDSA 2DGOA 3A8EA 2CN1A 2X3DA 2KKVA 4WIIA 1NNLA 3L3FX 2DNPA 1CZBA 3G0ZA 3F56A 5DM6L 5AIBA 2HNYB 3D7SB 3ZDDA 3D6JA 2WOMB 3ID6A 1OY9A 2DVIA 4J37A 3MWPA 4QYRA 1RYUA 2BQ3A 1T95A 4FL9A 3NP5A 1PVPA 4LSLB 4OMFG 2P9PB 5F0UA 5I3UA 2Y3YA 3A8JA 1UVMA 4B9LA 1JJ2M 1FFVA 5AKLA 3NGTA 4DR7J 3KMQA 3JSMA 2DD8S 5J2EA 2EFOA 4P2HA 2NV3A 1UHUA 3E58A 1IBKK 2HFUA 1GQEA 1RTIB 3K59A 2YB4A 4ISGA 1HA1A 2Q3PA 3A8IA 4JB8B 2VL1A 3B82A 8ICYA 1MMDA 3KFWX 1RAGB 2MYFA 5J0OA 3KK1A 3OPXA 1NLVA 5DQIA 2CQPA 5C10A 3LO3A 2MKYA 2XMVA 1RQLA 1JXLA 1TE2A 5IT0A 2XMMA 4J9OA 3NKYA 2AIRB 1S0MA 4OFZA 2O8FA 5L39A 4JUZA 4P4MA 3J80U 4K4YA 4DQPA 3V9XA 3KLHB 5KG1A 5HR7A 4F0MA 1HKAA 4DU3A 2BQRA 5CZ1A 4OJ3A 3OTOJ 2GWJA 3N4WA 5ALSA 2KSOA 2HYIB 1EWRA 2BJ8A 5H1SQ 2A42A 1GX6A 3B6BA 1MW7A 4PWDA 1I94K 2CQ0A 4YDXA 3MTKA 3NG8A 4FVUA 2HKEA 2RF2B 1EQYA 3QT8A 3WKAA 4FP9A 1WN7A 4LSNA 5ALEA 1ZQTA 1ZQQA 3MEKA 4WJBA 3VEOA 2OMLA 4DSLA 3CCQS 3AO5A 4JYAJ 1RLCL 2IS3A 4PL8A 1C0TA 3KXDA 3AA9A 1KVKA 1TP7A 3S9HA 2QA1A 2OA8A 3U1MA 3VQSA 5HO4A 5KFNA 1ZAXA 2YPYA 2H48B 4DR4K 1H2UX 5BYSA 3RH6A 1N36K 1NM2A 1K0VA 3ISZA 3W7BA 2YTUA 3QLHA 3R1HA 2RE1A 3KHYA 4B8CA 3GILA 4OZ5A 1DQAA 2PEBA 2FSNA 1YHQS 2EG2A 3M1FA 1OJ4A 2JRSA 3ZSZA 3MCMA 4AHSA 1R6VA 1NK6A 2AA4A 3ZZOA 1NO8A 1TYQB 3QFPA 2RT3A 4JKBA 4X66K 3RU0A 3D2EB 3VQQA 3R3TA 2YHWA 3OTOK 4P75A 1QAJA 4M9NA 3G82A 4F2SA 1IKWA 5LXRA 4WK1A 1R0AA 3HI0A 1N33J 1A6LA 4PKIA 1K9MT 1Q81O 2E8OA 4UBBA 1CJUB 1VHFA 2C1EB 3DGVA 1FVQA 2CQ2A 1RAFB 2BBEA 3BO2A 4H4KA 3M6XA 3BYPA 2J9CA 2FY8A 1PG5B 4F5QA 4IC9A 3EZ5A 4I2HA 4EX7A 2Q3SA 3O1WA 1V85A 2P9UA 2ZDPA 4X64K 5IIOA 4IUFA 1RXOB 3CCSN 4OJRA 1RE1B 4LRFA 4OYBA 2HSZA 1XHXA 3GFXA 1N32F 4IG0A 3CE8A 2E5LK 4Y2MA 3CCTA 4DPYA 4YB5A 3C6UA 2CUYA 4GVEA 1FF2A 1OH8A 4KFBA 5ETMA 4BRHA 2IAJB 2IHR1 1BISA 4I2FA 5I42A 2OMOA 4O4GA 5I9EB 4NASA 2V69A 3C2KA 4CJ7A 5DDMA 4KIAA 5D0GA 3UDEA 2CDQA 4M7YA 4GMJB 2D41A 1X31C 4ATNA 3J7YI 1U09A 2RF2A 1WC3A 3OTBA 5A2QU 7ICIA 5F1XA 2XZDB 4USAA 2V2QA 3H0MB 4R8UA 3O4QA 3BYRA 1N5YA 4DMNA 4WZMA 2CPIA 2EKNA 1MN8A 2E7XA 2MZSA 4KLLA 1F3VA 2DIUA 1FEZA 5KAKA 3CCWA 1HNZJ 1ICEB 3D2FA 4NA1A 1XC3A 2FYXA 4ECVA 2OI2A 4CCHA 3S8SA 4K4HA 1UAXA 4ED2A 4K4ZA 4N8NA 3QLHB 1YHQN 4Q8FA 3TR5A 2G09A 3SBGA 1RU1A 4HACB 3PCOB 3SCXA 5IFMA 1PIEA 3M8YA 3DRSB 1SJ4P 2CNNB 3QEBZ 4K7QA 4DTMA 3C28A 2F8MA 3EGNA 4DFMA 1K1QA 3GFYA 2XS2A 4MIAA 4JS4A 3F44A 2RJZA 1KHWA 1E3MA 3M7DA 4USUA 3JXOA 3OS0A 1NGFA 3ZNJ1 3TSQA 4X62K 4LFAF 3VGVA 1OO0B 1U0HA 1IVZA 2EI5A 2XC9A 2Z58B 3TWHA 5D4LA 2H3FA 1RAJA 2ZH8A 3ZTPA 3UNGC 2F1FA 3KD5E 4ID5B 5EE0A 2FPLA 3T6BA 2ZOMA 3P83D 1TUVA 4UAZA 1KQSM 4TU8A 4DV4F 5AK4A 2JFDA 2RQ4A 1IBMJ 2CRLA 4F5OA 1VLYA 3DI6B 1J27A 2F7VA 2FVQA 1S1UA 2YHBA 4USKA 2ZWHA 3O08A 1NZ8A 4F2RA 2HOEA 1KDHA 2OEKA 5D49A 4RNMA 1DHMA 3DXMB 2WSCC 2GV9A 3OXLA 4TLRA 2VA2A 4JBCA 4Y2YA 2XMAA 4PH5A 2Q4TA 4RPXA 1S9GA 3VQ6A 2RQ5A 1MWYA 2IVFB 4M45A 4LFAJ 5HLFA 3D6TB 3Q8RB 3V9SA 1SB3C 3JTNA 5KFBA 5U47A 2ASOA 5AQFA 1FWPA 4FS2A 7FDRA 1ZBFA 4DFJA 3MEGA 1GLBG 2AZ1A 3G86A 2PMZC 5FJ4A 1RKIA 1SJRA 1EAYC 4CDGA 1FRXA 1N5XA 4G1IA 1CC7A 3LDNA 1N0UA 3MM9A 2JL9A 3M1VB 3I82A 3UFCX 2ZTEA 5GAGP 3NGRA 3IFRA 2VKZG 3T1AA 3N6NA 2CQCA 4DFPA 1VQON 2ZIWB 2MA1A 1OW5A 5H2FU 4JV5K 3NVWA 3MFHA 3TA2A 4KYZA 5HBMB 3EGZA 1X66A 2YX1A 2VDIA 4BE2A 2NYVA 4LH5A 4CJSA 4FZXC 4LVNP 1UW4A 3BH6B 3I9ZA 4UAUA 3ATVA 3ULHA 4P73A 4HYKA 2M0NA 2BCRA 2BPCA 2UUTA 4EYIB 3TQ1A 4FM0A 4DV6K 4QYZK 2VPWB 2CFXA 1CQNA 2FDRA 1X5OA 1VBKA 3QYPA 3QBCA 3A12A 3B4MA 2Z1JA 4USTA 2PMWA 1NHKL 4RNFA 5IIJA 5KT5A 1JALA 3F53A 3FZLA 4J2EA 3H8MA 2NXUA 2DPNA 2HFSA 4CGJA 4LFCK 7ICMA 3T5JA 2DIVA 4DV1F 5EXWA 1VQPS 1SIWB 1N8RT 4X4VA 1UCVA 3IV6A 2B5JA 2DUYA 2R7WA 1X4AA 3UCUP 3LDSA 3PM9A 4NLVA 4WE1A 5C15A 4UQTA 3DC2A 3TAGA 4Z94A 1UVJA 4X4SA 2ES6A 1NMEB 1ZQZA 1VQMS 3PSPA 1U2RA 2VB6A 2FC8A 1IBKF 1KVJA 2ZH4A 2QL5B 1KHVA 1DBDA 2Q6BA 3MHYA 3ADAC 4Y28C 1VQYA 5HHHA 3D2SA 2JX2A 1EJ7L 1IG6A 3D5MA 4YOTA 1NSPA 1T9XA 5D3GB 3FGUA 3ORYA 2K1RA 2LQ8A 3C15A 1NK5A 1RAIB 1Y64A 5LSRA 3VN5A 4F4WA 1D1UA 3PYEA 4ZP9A 5ALNA 2YN4A 2VPXB 3CI5A 2HVDA 4AH9A 3DN9A 3F2DA 4X4NA 2APOA 2BZFA 1ZBTA 4ECQA 1JCFA 3DLGB 1HQEA 1MWQA 1P9QC 4NXMK 1MA7A 2P5VA 5KG2A 4QWBA 2FJAB 3B8AX 1YZ6A 1RGIA 1IH7A 4X84A 5HHIA 1F5BA 1LW0B 2QYGA 4PZVA 2D9PA 2LSNA 4K50A 2HBQB 3W1YC 1EQMA 1ZQCA 3OVSA 2EAPA 3FSIA 5LT5A 4K2XA 3PJ9A 5DS7A 1QVFR 1J6ZA 4MO4A 4OZLA 2XMWA 2DO0A 1N4LA 5HQLA 1N34F 2G2ZA 2IHMA 3PMNA 3BF4A 5LJ3Y 3MGVA 4QJVA 5KFAA 3CCLS 1TMMA 4KFBB 2H3QA 4Y00A 2ZFHA 2OZMA 3UMBA 4KH4A 3D2QA 4CJWA 5HVHA 4UB8U 1JL2A 3C2LA 4YR3A 3T6JA 3QX7A 4J7CA 2MSSA 4EMDA 1BI4A 4MMOA 7ICSA 1BQNB 4N7TA 2HWTA 5DB7A 3HLUA 3HM9A 4M5MA 1R0BG 3QGPA 4IWVA 2B9YA 5CQGA 5E3PA 3RJHA 4C8YA 2WCXA 3TOQA 3LZJA 2RRNA 2N82B 2WAQC 4ZVQB 4YD1A 2P9GA 1URNA 3OS2A 4O23A 1HUXA 4ELVA 3IBFB 3TNVA 4LF7F 4NXNK 2IJFA 4UB5A 2G4BA 4K4GA 3SQ2A 1ZQNA 3MM6B 4ALZA 4PG5A 4DG1B 2F9DA 3AVHA 1IXRA 2ZEJA 4DTNA 2KJWA 3HJEA 4MF2A 2P9KA 1PYTA 4JI6K 1F5CA 5AZIB 4NLOA 2NUHA 4RUAA 4FXDA 2KB2A 1YJ7A 3MPYA 4RPYA 2VJ4A 1S1TB 3LAKA 4HACA 1VQOS 1E6VB 4A47A 3JB9k 1XNRJ 2QB0A 1IBLF 4KLSA 4MQ3A 4MLEA 5AM4A 2WVCA 4DUZK 1X9SA 2W9BB 3F2BA 1LOTB 1VQMN 5ALDA 1JMTA 2V2KA 3RSEB 2DRDA 4J5OA 2BKNA 3CJRA 2DHHA 4FWPA 5ALKA 3HSJA 4JHDB 2Z30B 1HWJA 3SQ1A 3FCWA 3H5SA 3E1YA 4TXSA 4Q44A 4CF2A 3SPYA 3P1GA 1DOQA 1W2BM 4KT0C 1GMUA 3GG0A 2W41A 5CYJA 3A0IX 4WYWA 3OYMA 2GIRA 2I38A 2K8GA 1B0XA 4QS9A 3JAMO 1UP1A 1XMOK 2E7VA 3KVGA 2CPRA 5IILA 4KITB 2POKA 4UB1A 4CO3A 3TAMA 1X4GA 3QU4A 5J1EB 4WCEQ 3TTDA 3ENAA 2EAOA 2CWXA 5DBAA 1I94J 2KXFA 2YNHB 3C7NA 1C1BB 3FSXA 5E2QA 4AHCA 1YAGA 1VSFA 4YD2A 3BQ1A 4ZIWA 4OZ3A 2YKMB 2OSQA 2R3VA 1UETA 1UPMB 2X1GA 1NK8A 1N5TA 1OPIA 2C2DA 3UDVA 4YMMA 1U1OA 3PW7A 4JWNA 4QZGA 3CJ8A 4MKVA 3E51A 4Z6FA 4OHZA 1S1TA 5E41A 2BYCA 5AR0A 3MN7A 1SKSA 2E1CA 1GOAA 2EDUA 2E66A 3VETA 4IQXA 2I8EA 4ZLJA 3EUNA 5A8WA 1L8LA 3CCLN 4FYYB 2QLWA 2HRTA 3BZKA 2FB0A 2QIFA 1HI0P 5K5MA 1C0FA 3MD1A 3AJDA 2MRLA 2GNKA 3AU2A 1U6FA 1ZQJA 3ZZRA 1C2PA 5J2KA 3T1YK 8RUCA 2DNGA 3HRGA 1N6QB 4UASA 3R1LA 3I5AA 8ICHA 4P0PB 1KONA 5HBMA 5EOYA 1FXLA 4LIWA 2NCKL 3R6MA 3H5UA 4NXMJ 2NRWA 3IG1B 4AUKA 2OPQA 1B7YB 2JOQA 1ZQXA 3BGUA 3D66A 3U1LA 1HNZF 3TJ9A 3ONQA 3AGRA 3PMLA 2L08A 4ZPDA 4BWMA 2DCLA 9ICNA 2YQ3A 1RT3A 1LXNA 4ZA1A 4HHUA 2AX0A 3SXLA 4PGQA 1X6IA 4GXIA 3VCBA 4GKJJ 2ASYA 3G8QA 3GB0A 2AU0A 4JWMA 2FBVA 4LR8A 3Q7CA 3DCAA 2U2FA 3LDAA 1Q7LB 1XK8A 2DGQA 2Y1JA 2A3ZA 5EDWA 5L1LA 1YJ9N 3OR2B 1IN0A 1V5IB 4KY3A 5CAAA 1H2VZ 1NOMA 4YFKA 4XDDA 2DT9A 3KKSA 3JQMA 1MQ2A 3IUCA 4IOCQ 2RMLA 2E8MA 2ZOGA 3MPWA 1ZXOA 3A0BU 4NXZA 4KQZA 3VVUA 4NL9C 3W62A 2IMWP 3IBCB 5EX0A 2QO3A 3GYGA 4WU3A 1UQVA 1BQMB 4RNNA 1VGYA 2OZSA 3SMSA 4XRHA 4YN3B 1OH5A 4C0BA 4DV1K 3Q8KA 4RKUC 1QQ5A 3KLVA 1KLMB 4AM6A 3CPWM 4NEYA 4DV4J 3EE9A 7ICNA 3V4IA 1H73A 5DDRC 2Z1IA 4K8ZA 5MAOA 3U3GA 2RU3A 2PFNA 3EZWA 4LF2A 4L75A 4RCHA 2DGWA 4WP8A 1YI2S 1JLEB 1HUOA 1RT6B 4RQ0A 1OVYA 2ZIXB 2F1HA 1KOOA 1J9AA 4M6WB 3OTDA 1V4TA 2YKNA 4C97A 2ACMA 1JMSA 4N76A 3NVVA 1FE0A 4IOBA 3E66A 1L8OA 4TQSA 5TKYA 5J2MA 3A2FA 2FXUA 9ICEA 3NS6A 4DV1J 1JLBA 1UFKA 4A57A 1X4BA 1G7CB 1SQFA 3O4WA 1VJ5A 5HN0A 4LRDA 3TADC 4K42A 2EVZA 4IFVA 1UVKA 1K8AT 1S12A 1U47A 4PL1A 4YCXA 2VODA 2KFYA 5B09A 4C7YA 5DJBA 4KPYA 1GT8A 3RR7A 3SK3A 4GV3A 1LW2B 5K4LA 2YV0X 1IBMK 3MECB 4QS8A 3LM2A 3NDKA 3ZFVA 4N5SA 3RTVA 2PMZF 5M1NA 2ZJPQ 3RFAA 3MCPA 4LZDA 3MOJB 4KAZA 2K60A 2O8BA 1T8EA 3VC8A 3UPQA 3WXKA 4OPJA 2XS5A 3OA9A 3TZZA 3RRHA 1VRUB 2QC3A 4UOHA 1KQFB 4CVNE 3QESA 5CYQB 3N6MA 1H3DA 2K4PA 2PEHA 1X0FA 1G4CA 4I7FA 1RADB 4M7XA 4I2AA 4HI2A 4OQJA 4IKFA 3CMAN 1Y5NB 4CEDA 4OYOA 4CGFA 3SQIA 4FK2A 1QUVA 3SAHA 3QEVA 4DQRA 3IRUA 4A8XA 3NFAA 5E7OB 3FFKB 3SUPA 5KOWA 4B3TF 2HNDA 2ZJQL 3DRRB 3TZWA 2XSJA 2E5IA 1JJ2R 3MAQA 4IH7A 5KT2A 3FEZA 5KFRA 3O0FA 4CP5A 3THWA 2Q66A 4E0DA 1DLOA 4CD3A 3G6VA 3U7JA 3M2RA 4F72A 4Q7AA 3OUYB 1WSFA 1JB0C 3ZSQA 3H25A 3G2XA 3PYDA 3HPOA 1J2MA 1G15A 3ZTQA 1IV0A 2HBKA 4DL2A 2R8IA 5D0RA 2ADCA 4P10A 2K8BB 4CJFA 2RHQB 3WQTA 2EFPA 3NWGA 4I2IA 3HM8A 1NHVA 1WACA 3NCQA 1HYSA 3I76A 3CJTA 1KDNA 2UXCJ 4I6WA 5AM1A 2GS8A 4BRDA 3TSUA 2Y1RI 1B92A 2DNKA 3G4SN 4OJGA 5KL8B 2QX0A 4MTPA 2R7SA 2A18A 4I2DA 2VG6B 4A8FA 3C65A 1QSLA 4DOZA 2D3OR 5GINA 2A0FB 3CC7N 2E5SA 5KG0A 4HTLA 3DOMB 1Q46A 3W2WA 2OM6A 1XS9D 4WFAQ 5AZJA 2ZUBA 2HFVA 4EIAA 3BGOP 4BQLA 3MN9A 1C7YA 2AH5A 1TUYA 3HFVA 3TX0A 3FMWA 4WWSA 4FJ9A 3NGZA 2XY5A 2RILA 9ICMA 2VCPA 5F0XA 2CJYB 3AAWB 2ZTCA 2KHOA 5L38A 2DEJA 3QIPA 4R5PA 4ECSA 2D74B 5J2QB 4B17A 5J2IA 3NCRA 2AEMA 3IG5A 4O0JA 1UCNA 3DRXA 5JS2A 4QU6A 1XEZA 4FJHA 4QR1A 2BJDA 2HZCA 4EELA 3H90A 4RU2A 2CGKA 2P51A 2OD4A 3NS5A 2BKEA 2KNJA 4K8RA 1VAZA 4F92B 4Z6DA 3MD3A 3V72A 2KH9A 4FF4A 1RABB 1SUQA 1DFDA 2HEKA 4DMZA 4ES3A 3O3LA 2MPUA 3KHLA 3A1YG 4KI4A 3V7JA 4EEYA 4KLUA 2FVPA 2Q79A 1QQOA 2KKHA 1ZQUA 4UY85 2KYZA 1PC5A 4IQWA 4OKJA 4F67A 4N8OA 1YVNA 2QFIA 1JKHB 4Q2LA 2QARA 1IG9A 2VQEK 3M8PB 1Q7YO 2OHFA 1V3ZA 3E3XA 4NYPA 5IWAK 1FKPB 5AQHA 3ZCMA 5AKXA 3CDUA 2RQCA 2OJ3A 1NRKA 1K73O 2YJFA 1U1NA 4W5OA 4DR5J 4HHTA 4KLMA 3THXA 2XLIA 1T44A 5KG6A 2GWSA 2YXLA 1YK9A 1GTEA 1T3NA 1UA0A 3CFPA 2HF3A 4KHYA 1SV5A 4QZDA 3QZ7A 5IIIA 2EG1A 4CO0A 1JRPA 3C6TA 4A61A 2G1HA 3RZAA 1JCGA 5GADU 1V4SA 1PSDA 4GVMA 3QFWA 1VHXA 4DBQA 1X4DA 3O1LA 4KN7A 4KSEB 4K4XA 2B4UA 3KOOA 2JDJA 2OYQA 3CCVN 4NA3A 2CAJA 3P4UB 3BDPA 2C2OB 3GE9A 4X4UA 3VQPA 4DR2F 4LF7J 2OH2A 3L4BC 4PPDA 4EBEA 2QK9A 2EFNA 5AQIA 3OD2A 3C6UB 3TA0A 4CLSA 2P9SB 3TANA 2V8PA 3OTCA 3FRZA 4KO0A 4C11A 4BDPA 4J9NA 2UXBJ 4X4OA 5CP2A 1WSIA 2O3DA 3MABA 3E8OA 1VS3A 4KI6A 4CH1A 4AILC 1TQLA 5L1MA 2A1AA 3GIJA 5BYQA 2E1AA 2DQNB 2NRZA 3Q8LA 4J03A 5G5HA 7ICLA 1ZQSA 2MMYA 4DR2J 2FHMA 1HI1A 1BPYA 1RDRA 3UDLA 4QU7A 1GLCG 4RQ2A 5J1NA 2LYHA 5KFTA 1O6XA 1R0CB 2RNEA 4U8VA 2IJRA 4ECZA 3CM5A 1MROB 4OI6A 2MQNA 3HKWA 2B7CB 5GVQA 4CLTA 2ZJPL 2N1RA 3BN7A 3T79A 5CE3A 5BREA 1BA0A 3M2UA 1X40A 1TGOA 4GLXA 4FJKA 4YDUA 2ZC4A 3IN5A 1XR5A 1SIZA 4CEOA 4IQUA 2OWOA 3MEDB 1ZTTA 4DFKA 3HSGA 1FKOB 2MB0B 1Z00A 3M9MB 1TU0B 4B1XB 4EGLA 2HF4A 1C1CA 3TEGA 4NLUA 4PZOA 2WFBA 1RTHB 4IJNA 1R3NA 4BJQA 4G1QB 3ISNC 1B64A 4DR7K 4XUSA 4MO5A 5I4MA 3L8BA 1I5OB 4OI2A 3BEXA 3CYMA 3DYAA 3CJAA 2X51A 3PV8A 4RPZA 1N34J 3RWUA 2O8FB 1TAMA 2D5RA 1RJJA 3GWCA 2HGMA 4E7JA 3CCMS 1VMBA 2I5HA 1Y4ZB 2VBXA 4F04B 5J8YA 1B0VA 3OHBA 3MI7X 4K4WA 1ATRA 1MWMA 1SJ1A 4V19S 3WNEA 4PKDB 2VD3A 2PYLA 3RGIA 3HX9A 4P7TA 3GSDA 4BG9A 2WBNA 5T7LB 3MC1A 3IC1A 4WYLA 3PR5B 2GO7A 1YRUA 9RUBA 4CESA 5J2PA 1FWLA 4ZPAA 1U2VA 4FXVA 3T5KA 4MAKA 4NWBA 2XYPB 3M6WA 2R4FA 2H54B 6FD1A 3FZHA 2VU5A 3HHDA 2XWYA 1S9FA 3D45A 3KHRA 4LF4F 2FGCA 5A6PA 1HD1A 1A5VA 2ALYB 3O9QA 5LJ5Y 3SCKE 1CBKA 1AYEA 4RNHA 4B3TK 4JI4K 2LLZA 3BBCA 4DF4A 4BR2A 1HWKA 2GOLA 3M9OB 4QYZJ 4B1VA 1TKZA 5K9FA 4EU0A 4M5GA 1K6YA 2JXJA 2A6OA 3LM9A 4Y2XA 1MWKA 4LFAK 1RBAA 2V4JB 5A76A 2JLEA 3EUB2 3ELHA 1MDUB 3DRPA 1K1SA 4KHWA 3JTOA 1YKWA 4ITSA 2HHTA 3ZZYA 1N62A 4EUVA 3H4DA 4DCCA 3BUZB 3WKBA 1ZQIA 2A1JA 1VK3A 4OZJA 3T9ZA 4ED3A 5E3AA 4AL7A 5JLHA 2WF8A 2G5IB 1B99A 3P8BB 3OL8A 3KHHA 5C42A 1NB7A 2BUNA 3U02A 3IMXA 4MDBA 3C23A 2KTQA 2AMCB 4BRAA 2IM3A 3IDWA 4GKKJ 2PAVA 3AHPA 4FCYA 4IZ9A 5ALPA 1RHKB 3AVMA 2MQMA 4B3TJ 1SQEA 2WFAA 4IRCA 3UN2A 1B0TA 5CYMB 2VQFJ 4ELTA 3AVIA 1D09B 3THVA 1LQ9A 1RTHA 4U8YA 1PCAA 4CT9A 4Y2TA 2YX8A 4E7KA 3CJQA 1HNXJ 3IHQB 1QVGR 2XRIA 3MEGB 1RDFA 4IXCA 1ZM9A 3P5TL 1WLJA 2HZAA 4LD0A 4DTOA 2YWHA 4M3YA 3LP2B 3V81B 1CC8A 1Z6RA 3R2CJ 1ACMB 4ZVHA 4BDYA 2OPPB 4YXMA 3NS1A 3IRXB 2QYCA 4DDFA 4DTJA 1N0VC 4B9MA 4A8KA 2BCSA 3MEEB 1HMVB 5CWRA 3VQ8A 1U0SA 3LVVA 2HVZA 1RBTA 3ISCA 4ZHRA 3AVGA 4Y2JA 3KWMA 5AQLA 2BE7D 5DB6A 1RU2A 3BZCA 2CJAA 4KRFA 1B22A 2ERRA 2YQ0A 4DEZA 2IIHA 3ID8A 3BS5B 3PX4A 4R63A 3PHEA 4CHPA 2P35A 4H4MA 4FBTA 3HF5A 1VC6A 1QTNB 2WB1C 3I4HX 1P9YA 3NUQA 2CIMA 1OH6A 2HWHA 3HMJG 4YHHJ 1OSDA 3VGMA 3CCRS 4PXDA 2RRDA 4UAWA 3PW0A 3GFHA 4I0WA 3TUJC 2FI1A 1G6BA 1DK2A 1RTJA 2VV5A 4JI8F 2ZKTA 4DQIA 3AO4A 4ZVTB 4IO8A 2EFVA 4LVSA 3RW7A 4IQVA 2MAXA 1L7OA 4C3LA 3PZPA 3SFUA 1QQMA 1O08A 1RPLA 3NGKA 3S1TA 4OX9F 2UUCF 1TFYA 2JLGA 2E5HA 3HZGA 2PI5A 4O3OA 2GELA 5B0AA 4CW7B 2YX7A 4UQGA 2PIIA 3C16B 4BE0A 3CMQA 4WPAA 4QPXA 1J5EK 1ZQVA 4CWBA 2DEIA 2GMLA 3P38A 3J81j 3NH2A 4PGYA 1IBLJ 5M1PA 2M5YA 2GVZA 3N4PA 3AJ2A 2FMSA 3AD9C 1UVNA 2DGUA 3Q23A 3VAKA 3IR5B 2E2OA 5B08A 5EHHA 4IFEA 4M5JA 1NJXA 4UT4A 2R8KA 2QMUB 4BRMA 2RU9A 3F0NA 5J0QA 3N79A 3SI8A 1XIQA 5AFUH 4LF4J 1TL1B 3ZSXA 2YWWA 4Q0BA 2AXTU 1XO0A 3D2WA 1WF2A 3Q2SC 4KLFA 3AEVA 1FK9A 1QAXA 4KLOA 4WTYA 3MCOA 4ZH4A 4BRFA 8ICEA 3U9ZA 2KHDA 1SH2A 1VJWA 1JXEA 2CNLB 1VJQA 2GFFA 1ZQFA 4I2QA 4FN5A 1BOTO 3D3BJ 3C14A 3LPUA 3MMBB 2RQMA 5I3UB 2I1RA 9ICHA 2D3O1 4JI8K 4YHHF 5CB1A 4RQ7A 2C3OA 4IRDA 5HQ8A 4ED7A 2N3LA 3TSPA 4F7VA 3EM1A 3OYKA 1VK0A 3HK2A 1UW9A 1H74A 4KKOA 2ESEA 1RT5A 4OJ6A 2QV6A 4M3WA 1D9FA 5FP0A 3IRXA 2VPYB 1JI7A 5AHXA 4YS2A 1B43A 3IG8A 4LBHA 4DV0F 4M47A 1X2IA 2PE8A 4ED8A 2XZTB 1RBSA 4PY5A 2HLTA 3AAQA 4OLOA 4CTAA 1BWEA 1V6HA 1U49A 2CVEA 2Y8YA 4DR2K 4J9KA 2F9JA 4BREA 1NSAA 3I0RA 3K5LA 3CD0A 3E9LA 1XSLA 3DOMA 3VEVA 3WNHA 5HOOA 2DHAA 3B54A 1H6KX 4O4RA 1SQGA 2MY8A 1LEOA 1BNOA 2J76E 2YMPA 3CWJA 1ZZNA 3TEHB 3Q8UA 3J7A1 3WIUA 5AI4A 2MKKA 2BCQA 2W43A 4KLQA 4H5RA 1S49A 2F8HA 5FLXY 1HKBA 2OFGX 4PKHA 5BPNA 3AO1A 4JYAK 2AEJA 2XMJA 1I3AA 2ZVSA 2MJNA 3CJ0A 2EZXA 3OTQA 2IOHA 1I1GA 3GBTA 1NJIO 3TAMB 5BR8F 1Z05A 3R6LB 2OEJA 2KVQE 1TKTA 2ZJ8A 3QDKA 3BP8A 1DGJA 4USIA 1L3VA 2W25A 3FFIA 2H3GX 2F4FA 4A8QA 2ZUAA 5BYRA 5ALWA 5D0EA 4E1MA 5AKIA 1RQNA 3H8JA 3CQ8A 3QSIA 2Z1GA 1RT5B 4NCAA 1RISA 1V3RA 4XH4A 2CPJA 5ALIA 2Q1LA 1QZ5A 5IWAF 3QJLA 4KH1B 2F1JA 2WAQF 3IO1A 2QWOA 1ZJNA 2V4JA 1KN6A 4DR5K 2KZ3A 1YLXA 1KL9A 2PFPA 1BCOA 2UVRA 4OYAA 4NM1A 1VYAA 1WI6A 2FJWA 2UUAK 2QB1A 2LMIA 3PKYA 1ZQAA 2DITA 4H5WA 1VQ4S 3UN3A 5F8IA 1J5EJ 4TSXA 4I68A 3OYAA 3BGLA 3TARA 2O8CA 3IP4B 2VANA 2WONB 4FM1A 1SCJB 4X62F 3GOIA 3BKUA 1RT7A 1ZQLA 3KLHA 2LM4A 1VDVA 1CJUA 4MEYA 3LGHA 3C1YA 2IBKA 5K8PA 4WFXA 7ICJA 3GSIA 5ETPA 3RF9A 1YTAA 1YBAA 1IWAA 3VHQA 2VG7B 4JN4A 5KFZA 4JI3K 2W1BA 2FQQB 2PO4A 4LF5K 5T41A 4U96A 4FJ7A 1P1LA 1RB0A 2P9IA 1XN9A 3MM7A 4NYFA 5HL7L 5AM0A 1RT3B 3THXB 1GLLO 1S6QB 4WZQA 5AKGA 3WK4A 4KB0A 1ITGA 3CIMA 1Z25A 3KWGA 2XMKA 4EAHD 4A8OA 4JHDA 3B6PA 2AGOA 4NE9C 4NRUA 4NLQA 1HHSA 1S59A 3QT6A 3IMQJ 2XGQA 2HMIA 3LP1A 3OL6A 2VC1A 1FDDA 4URSA 2VWKA 2AP6A 4ECRA 3K9KA 1NKEA 3KZXA 1NKBA 1N32J 3H8YA 3SAGA 2DL0A 4Y2VA 2MEWA 2MHEA 4M5DA 2ZHBA 4ED5A 3MTJA 3QT5A 4LF9F 2ASPA 5B0EA 3WK6A 3PX0A 1T9UA 4F4ZA 1C1AA 3FZKA 4Z6CA 2BJ9A 5GIPA 4O8UA 2LEPA 1UEVA 1RYRA 3TO8A 2ZM6J 2HRYA 5L9NA 4WP9A 1D8BA 2B7BB 3VZHA 2Z4PA 2OXOA 5LJVA 2PFUA 5SWMA 1UT8A 5C25B 1U02A 5CD4H 3S3MA 5H9FJ 3WBZA 2E88A 2RRAA 4RTFD 4XO0A 4FFDA 1WC6A 4A8MP 2AQ0A 5A8KA 4DPXA 2CZ9A 4LFCJ 4M9HA 8ICSA 3WX4A 2DH9A 4KHPJ 3EVMA 5FDLA 2DR7A 1FKOA 1ZM3A 2HIQA 2L48A 4YG2A 2CQDA 2NZTA 1OYDA 5K8MA 3QFHA 1AFJA 4UZBA 1S77D 8ICZA 1KRPA 1NZPA 3ONNA 5KFXA 8ICPA 2ATQA 2P5GA 3H4BA 4AF1A 3J7YU 3ENVA 1NWKA 4F3TA 3KLIB 4LFCF 2XI3A 1ZRMA 3UE5A 2O8DB 5KFQA 1NKCA 3ENWA 2CQIA 2FPHX 3NNHA 1AUSL 4FWOA 4BVOA 3RYLA 4NL5A 2BTFA 1NK0A 5GAEP 2VIXA 4BE1A 4DL3A 3TTCA 1LKYA 1N60A 3KK3A 1R8CA 4I6AA 2G2YA 1TL1A 1IKYA 3RH5A 3V6DA 2DNHA 3H5XA 2HQ3A 3VGTA 1HFEL 2GIFA 4WFNL 5CHIA 1Q8IA 3K2PA 2GJIA 3UMGA 2YNHA 3M9NB 3M8PA 3C46A 2AP1A 3KK2B 1KTQA 5KFMA 4USMA 1A7GE 4RJVA 2NRHA 1SH3A 1S9GB 2HQDA 2HB5A 3VQCA 3D28A 1VSDA 4DV7F 1K8AO 1S6QA 2W3SA 2N7CA 3A0HU 4ILJA 2JNJA 1KR4A 3SENA 4KX5A 4R64A 2QL7B 4UAYA 1VBYA 4ZP6A 5JTIA 4NXMF 2HNDB 3HSZA 3RB4A 5HVGA 4BR7A 4NX9A 4P2FA 1MMNA 2VOOA 1TK5A 4DCOB 5ALTA 1DLOB 2NLXA 4FWLA 5B5EU 4BS2A 3NF9A 2XEXA 3EMTA 4I4BA 4LSNB 4NYZA 3MX2A 3ZT1A 5HP1B 5T14A 3EDQB 1I39A 4RUCA 2HZVA 3LDLA 8ATCB 3A8KA 4O5KA 2P6RA 3CRXA 1Y3KA 2F77X 3VQBA 4QWCA 1Q8BA 4GKJK 1WWUA 5E0OA 4F9OA 1WWHA 3QFUA 3DLLL 4UUXA 4Y2SA 3DMJB 5K14A 4DR1F 1RP5A 2V0NA 4KB7A 4RPFA 4PYAA 2ITMA 4E1JA 2ODGA 3KUHA 2JWLA 4KHPK 1YJWS 3OQ2A 2Q1NA 4AHRA 2CH5A 4C8KA 5AZJB 1NBEB 5HAOA 1MN9A 3FLCO 3M2RB 4CF8A 2FZGB 3LVWA 4OX9J 3NF8A 3MXIA 2QEXN 4Y65A 3LW5C 4Y0WA 4X66F 4P7VA 3UVJA 3H40A 4DOBA 4PA1A 4C48A 1FJ7A 2FHJA 3QMQA 3FAHA 3V7LA 3J7YP 4Q43A 3IS9B 1BHLA 1IG8A 2CJBA 2KT2A 1XNRK 7ICGA 5JS1A 1T05A 4DV5K 1R43A 3PYGA 3DXSX 2HFOA 2GQ2A 3ZC4A 2JH7A 3N9UC 1HBUB 2DK2A 1Z00B 2PKEA 1L5UA 2VOPA 4IOAL 4KLTA 3MK6A 3CHWA 1R89A 1G1XA 3KKFA 2D3ZA 5KI6A 1S6PA 1SV4A 9ICBA 2W4CA 3TJ8A 3JS9A 3M32B 5EE3A 4KTWA 2AWZA 3LA0A 2FE9A 3FBCA 3KKAA 2IPOB 3OVNA 2GV1A 1Z1ZA 4LFBF 4MF8A 1ASVA 2HBMA 4P74A 3OV7A 4PZNA 3H2UB 2B0CA 3V6HA 5HL7Q 1KFDA 4FWNA 1UKUA 3MGJA 5HRSA 1W0HA 2XSJB 4KH6A 3PRDA 4Z37A 1JXVA 8ICIA 5LSLA 1SGGA 2AJ2A 3CT9A 4X64F 4NLZA 2R7RA 1J5EF 4DR1K 5GAGU 5B0GA 3P49B 3EXCX 4R79A 2VG5A 4RW4A 3KLFB 2HPUA 2O4GA 1VHIA 3SD7A 3DDKA 3AVBA 4JI6J 5HMLA 3ZETA 1WTBA 4BG8A 2ZNZA 5IWAJ 4DSEA 2FLNA 3FZFA 2K4EA 3RBXA 2GVDB 2B9EA 2B9WA 4BC3A 1PGZA 1HWLA 4LMZA 1F1BB 2K3KA 3FJ2A 2RP5A 4PUOA 4OCZA 2VC0A 4O5EA 4A8WA 5B0CA 5AQSA 4NLKA 4FYVB 1RDCA 4CK1A 3CMEN 5IT4A 2DR6A 4BXOB 1FEHA 2ZKUA 7ICEA 2HHPA 3MN6A 4CJLA 4J9MA 4ZVSB 5LMUJ 4I6YA 2A2DA 1Q95G 2EWSA 1F21A 1FO1A 3HXMA 4Z4IA 4YMEA 2R2RA 2E6LA 4YOEA 4QWDA 2YCHA 3HTVA 4FF1A 1JROA 5F41A 4B9SA 3KUEA 3WDOA 4F36A 1D0EA 1WSVA 1JL1A 2P9NB 2FJ6A 7ICQA 3HT3A 1FKPA 4RUHA 1WWVA 2AJFE 2OELA 2VGNA 1BIZA 5KGWA 3T19A 4A48A 3JPNA 3W66A 4J9RA 2A3VA 4C4RA 2J6SA 1C4AA 5J2QA 5EUHA 2YMMA 3ZX2A 5AKZA 5GAGI 3GCWP 2QGFB 2N4DA 1OWXA 5M2RA 3CD7A 1D9DA 2MQLA 4LJMA 4BCAA 2WUSA 2F96A 4Y2UA 1YJRA 1IKXB 4MK7A 3LPEA 4CJPA 1SJQA 5C24A 3FZBA 4USJC 3IKMA 2H5JB 1Y11A 5M1QA 4C80A 2VJVA 3KG1A 2C2ZB 5HMXA 2J0WA 3SDEA 3UIQA 5F2RA 4ZPWR 2N4CA 1J5OA 2W7PA 4YB6A 1C4CA 1KVAA 1CSJA 4CJUA 4WE1B 2KU7A 1T9TA 5HLFB 2KICA 3GTYX 4GRSA 3QYYA 1T94A 5ALXA 2W2QP 3KK1B 3RAXA 1NK7A 1KWMA 4F50A 2ISPA 3C1ZA 5BRDA 3K17A 2GEMA 1CLQA 2RB7A 2DY1A 4PL2A 3SR6A 4ZIVA 3RJJA 4N47A 1UMJA 1EKEA 1GFWB 1XNQK 4MKAA 1FT8A 1YT3A 4DCHA 1SKWA 1AW0A 1JIHA 4KJIA 3KYLA 3NAEA 2PI4A 1KLMA 1NSKL 1G99A 1UTAA 4H54A 4ICLB 4DS5A 4YOXA 2E1PA 2BJEA 2QA4N 2R18A 3RW6A 4JD2A 1V9PA 1M5OC 1RT2B 3SQGB 4FJXA 1KKHA 5BN8A 2G0IA 5BR9A 9ICKA 2YBVA 2EPIA 1SZHA 2EHGA 2IRUA 3QUBA 3DNCA 8ICUA 4UB6U 2PGCA 3AOBA 2VFUA 2M4MA 1TUUA 1RT6A 4LF6K 3X3UA 3DM2B 3K58A 4ISEA 2NUUG 4FK0A 3ZX0A 2CJ9A 3IM8A 4JV5F 1GMWD 2FVCA 1UPHA 5F8NA 5D78A 5J2FA 4H4KC 3WZ0A 4M9GA 1NK9A 1P90A 4ACOA 1VK8A 3PW2A 2B0GA 4DR3J 1VSMA 2YJEA 5AJ3K 4C4TA 5AJ3J 3GG1A 2UU9F 3T3FA 3HDSA 3R7SB 5IT9Y 4KLGA 3ZI4A 8ICJA 3PSTA 3V4MA 4CE6A 1HNWK 2GW8A 3IBPA 4LRCA 3OL9A 2DXDA 3JSBA 2O8CB 2H65B 1JLGB 2IFXA 2HOFA 4I29A 1HLWA 2AJ1A 1JKHA 3CP8A 1M90O 3VALA 2OPPA 2W6KA 2ZM6K 3HSDA 5KQDA 3DRPB 3MR6A 5KPZA 3QICA 4RBTA 2L41A 2Q0RA 4DX7A 4NLSA 3AUOA 4OYPA 1B7FA 1R31A 3TX8A 3QUQA 3SMVA 1VQ5S 5C2FA 4Z2XA 1NGCA 5KFVA 3FC4A 4RW9A 4NLPA 2KVIA 2DJWA 3OS1A 4IEIA 1L6NA 4FKYA 3IA0A 2HVHA 2FZKB 3FM9A 1C0UB 1XSPA 5AFUA 2V67A 3AL0B 1N48A 1X3NA 4BC4A 1SH0A 2HHQA 4FLYA 4ILMA 2J7WA 5LOQA 1ZQKA 4Y1DA 2HMIB 3KIOA 4DTPA 2F2AB 1ELOA 2GTDA 2UV8A 5CA5A 1ZBIA 1A77A 2CADA 3G6YA 4M5LA 3CJ7A 1E6YB 3OFHA 5LMUF 3G4SS 4RQ1A 4PGXA 1S72S 4TURA 3RJEA 1RTIA 3FZ2A 2ZH3A 1P1TA 1ITPA 3VAGA 3S6EA 3CCJN 4JAXA 4GVBA 3R5CA 3AA4A 8ICTA 5AK6A 2QKQA 1M1GA 3IAYA 2LECA 3HILA 1M1HA 4C11B 2AX1A 4P9SA 2OANA 4UW2A 2JGUA 2W01A 3UW1A 4CJ5A 2A6AA 4H0XB 4QZ9A 1VFJA 1Q0NA 4MKYA 3HJFA 4ICLA 2CH6A 1J54A 1ZM4A 1SI9A 1B9DA 4HDHA 2ROGA 4CNQA 1X1PA 2Z2ZA 2HI0A 4PWWA 5AK5A 2FDNA 3TW0A 3WEEB 2UVVA 1HYSB 3PRVA 4WF9L 4BUGA 2BGGA 3MAAA 2W54A 1TVRB 3L7OA 3AB4B 1I51B 1I94F 1PK3A 3MGIA 2Z0GA 4QWEA 1L7PA 5AICA 4X4TA 1HHTP 2RH3A 1LK5A 4CJKA 1LWEA 3M2UB 4C98A 3BQ2A 3KJFB 2FHOB 2DNOA 2XICA 3QNOA 3HHNB 4F26A 4QNLA 3PFOA 4FJNA 5IXUA 2KN4A 1REGX 3CSKA 2R2UA 1WSRA 4A4JA 5KG3A 1U1RA 4WQ5C 1S9EB 4B1UB 4I2QB 2JFKA 3BZQA 2K89A 1QCKA 5J2GA 1BCMA 4WKRA 1UZDA 4C1NI 4CLKA 5M1FA 3QU7A 2DHGA 1NNEA 3RG6A 3Q8PB 2MLYA 2J8SA 3CCZA 1P8ZA 2XG8A 5GADI 2XYGB 4A46A 2GLEA 2V51B 4LF8J 4OYIA 2GHPA 1HW8A 4CGGA 2NSCA 2QSFA 3G10A 3TFSA 4OHVA 1S4EA 4LFBK 4CLUA 4U7BA 4DJBA 4R65A 5AI0A 3LH2S 2IRYA 2AD9A 4EWTA 3J81U 5ALZA 3UO0A 2MZTA 2XTJP 1WG4A 1VQNS 3G82B 4MIWA 2EAMA 2WF7A 1NDCA 4CFDA 3S6JA 5E33A 5D4OA 1ZBHA 1GAOA 2YMLA 5TKWA 2ZUGA 1QSSA 2DNYA 1KAYA 2HAIA 2QLXA 4C3KA 3GMGA 3CFRA 3BO3A 3O9UA 3B78A 2JZ5A 2X1AA 3OFFA 1ZJMA 1IR0A 2FJVA 2HSEB 3CEDA 4EHUA 2D0CA 3BF3A 5IC6B 2R7UA 4CF3A 4HH0A 2BZ2A 4I67A 2G5HB 1AA1B 5A0YA 3DU5A 3J81Y 4JI7K 2I5JB 3VMFB 2HBYB 1NJYA 1GLAG 5B7WA 1ZQPA 2V7ZA 5ALGA 4JI1F 4Q45A 1ZH5A 1HNVB 2WF9A 4F25A 2B3TB 1RBRA 4YQWA 1CJVA 2ZJQQ 4H5VA 5HR6A 5AK3A 2FSJA 4NLBA 5GADP 1HKCA 2WB1F 4DV3F 2X7IA 7ICUA 4JNEA 5J2CA 1VQ5N 1X6JA 2UXDJ 1HI8A 2XBPA 4K4VA 4MJKA 3KNGA 2IM0A 5DMRA 4AFFA 5GMDA 2FBTA 3NBPA 3OJSA 3OYLA 4FO6A 1QZ6A 2YQEA 1VSEA 1EZZB 4PABA 1S0NA 4OI0A 1NMDA 3E9OA 1X4FA 3WXMB 4Z6EA 3M6VA 3NVKA 1M90T 2DHXA 2WB1D 1X42A 1LXJA 1ILYA 3QIPB 1FXRA 5E3RA 1L3UA 4I69A 3GIRA 3OBWA 3BGFA 2XLJA 2IMOA 1JXBA 3VF4A 2WW4A 3THWB 3DM2A 5KTQA 2BJ1A 1YI2N 1DRZA 4BR5A 1JLFA 5C0YA 3LP2A 4LSLA 3R27A 4KLHA 4MEXA 2HQFA 4TU7A 2VHGA 3H8WA 4ZVGA 3LL3A 9ICJA 1LW2A 4NJ8A 1HQUB 4KTZA 4NI2A 5AXLA 4AHUA 3CO0P 3C15B 1M1KO 3UCGA 3CG7A 4G65A 1HBNA 3NASA 4YEAA 1S22A 2LXIA 1JK9B 3D0HE 5AE3A 5B66U 4M5HA 1HPZB 3LP1B 1R27B 1QJHA 4WJ3B 2XIDA 3UN5A 5HNKA 1IXKA 2UU9K 4DV3J 3HSTB 1FW6A 1N6QA 1AXQA 3FRYA 4DU8A 5DM7Q 4JYAF 2QTDA 4M5NA 4PL7A 3WQPA 4FW1A 3NMRA 4JK9A 1AQ6A 1GO3F 3V9ZA 5G0RA 2FF6A 2JR5A 3D0GE 8ICWA 1RBLA 4NZ7A 2Z2YB 4OV6A 3LDPA 1ZXIA 5ETSA 3M30B 2HS3A 2BKOA 4CIEA 4OYZA 3JPRA 4ECUA 2WZ1A 3QZ8A 4KC5A 3Q8MA 5BPLA 2YKNB 4KLJA 3I8BA 5HMMA 2Y9TA 4IDKB 2JC0A 5MLCV 5I3PA 3PVXA 2XWXA 3TVYA 3B4DA 1S0OA 4DR5F 4P52A 3SSRA 2LQBA 3MM9B 5AI9A 2GO9A 3V7KA 2XO6A 1NU4A 4C8LA 2HK3A 2XQCA 4DL5A 1EO1A 2H3VA 3KDNA 2QLBB 2CXEA 3QAEA 2F44A 2OLWA 3ZEUA 3NBPB 2XGPA 1Y00A 2WMMA 1BQMA 2MQOA 3UKRB 1BPBA 1UJ6A 2PC6A 4CJRA 2EBEA 1ZQMA 4EO6A 4RT2A 2BDPA 5IC4B 5CD4A 5LMNK 5ALVA 2NLWA 5GAHI 1HIYA 4Y6IA 2DTJA 2OYYA 4WXOA 5AXMA 2XM3A 1ZBUA 1TL4A 1AFIA 2R42A 2ZIUA 5BRHA 3FUYA 1UFLA 2VG7A 1T0TV 4KLDA 1QQCA 2FJXA 3DMJA 5J0WA 4CO5A 4XDCA 4E8UA 4L3NA 3KKAC 1TVRA 2G8IA 4JI3F 3F5TA 4JKDA 3FCHA 4U6PA 2Z1HA 3PIPQ 4DTRA 3QRRA 1S97A 4WK3A 4BGDA 1NGEA 3WHIA 2ZDOA 4QIWC 1LAVA 2EFGA 3RBEA 4DV2F 1K8KB 4U7CA 1T03B 4W5RA 5J0UA 4DV6J 1RI7A 4OJHA 4OYWA 3KLGA 1IJJA 2CGLA 3TVZA 2ZIVA 3DXKA 2C22A 2BPFA 3H08A 2Y0BB 3EL2A 1SWVA 1C1CB 1UWAA 1WAFA 4JI0J 2PYJA 2BE9B 1E6VA 4JI7J 3LWLA 3NAHA 3VEXA 3HHLC 2WF5A 2P6TA 1VQLN 1ASUA 4CH0S 3ZDAA 1TK8A 4LF9J 3OW2M 4H0TB 1T05B 3W0LA 3W5ZA 3AO2A 3RMDA 4U7UK 4DV2J 2F1IA 1RWNB 1F3FA 3P5BP 2D7SA 1VQKS 4IDHA 4KV8B 3TP2A 2GH1A 2W9MA 2DKOB 4EP5A 1R7IA 1GXTA 1E4FT 4US8A 4I2BA 1U8WA 1S8OA 3AARA 2G1DA 3CJ9A 2LEAA 1JJHA 2F40A 2QMWA 4Y2PA 1RAAB 4FOIA 3AD8C 4V1Ak 3LDQA 1X8DA 4JKGA 4LF6F 4GO5X 5BR8J 2W4DA 4H5NA 1RAEB 3J80Y 2IJNA 2RSQA 1IJEB 1FNMA 5J2PB 2R9LA 5FLXO 4M63A 4KH5A 4KH0B 3RBZA 8ICCA 5DB8A 1IKVA 2KD1A 2NRTA 4F71A 1WNSA 4P71A 1HBOB 3HVWA 4KBOA 3L95X 1PVQA 4WF9Q 1ZM2A 5DBBA 4FO0A 4O8KA 1HR0J 1HWUA 3W2WB 3MUVP 4C7ZA 1OS5A 2M88A 1SV5B 1TL3B 4YB1P 3G25A 2NYIA 3GJQB 1RDAA 1QQNA 4B1YB 4QIGA 1S5JA 3DRSA 2DPJA 3O9SA 2C3UA 4RBUA 3UXNA 2ZH7A 1Y9OA 2BX6A 1XMQJ 4CJVA 2KM8B 4CJQA 3FK4A 5KOXA 2G8VA 4YOUA 5GAHP 1KD1O 1URJA 1QHAA 3MR2A 1WOOA 5AKJA 3NGIA 4JI0K 2R8HA 2E8NA 3U27A 5DG7A 3K7RA 3UR0A 3K8WA 1PZNA 1XI1A 3A8YA 4NLXA 3AODA 4DZDA 2K06A 4CD1A 4A2BA 1EP4A 5CJ7A 3CPWR 2GUPA 3E01A 4QR0A 4X65F 4O0IA 3NEKA 1VQNN 1PILA 2J6UA 1RT7B 1OXJA 2DRBA 2V8GA 3R9KA 2EH9A 4FWSA 2UXBK 3V1QA 4B1ZA 3DI6A 2IDOA 1U9LA 4FK4A 2FHJD 3D3CJ 4NM2A 8ICNA 4ZKAA 2FPMA 1YG0A 5L1IA 3K89A 4MFAA 4MT1A 2LQ9A 4B3OB 1U4BA 4DR3F 1RYSA 5F9LA 3QJPA 3JYTA 2VA3A 2E5JA 3QXGA 1Y7PA 3CMES 1SQKA 1ESVA 1S6OA 3NAIA 2UUWA 5KFSA 1HARA 2LA4A 3QETA 3RB6A 1HQ2A 3V6JA 4QS7A 3AQEA 2ZWPA 3AY0A 4IOCL 4BHQA 1REVB 2BA9A 4U67L 2HBRB 4M63C 1L3TA 1WSEA 4ZN1A 2ZOFA 1NJZA 1GLDG 1F0XA 2OAUA 2KXNB 3VEZA 1FJEB 3TQEA 4RU9A 1X3MA 4OJPA 4ETZA 4CZEA 5HROB 2NXNA 3QB0A 5E5NA 3OYFA 3MX5A 2ROEA 2VIHA 1NHUA 2NS1B 3O8WA 4KGMA 1VQKN 5AQOA 3JSMB 3VVTA 4FZVA 4NLYA 2HK2A 3VGLA 4HUEA 3TFRA 4AQYK 4M3RA 4DV0K 3KK2A 2I7PA 4DWIA 3AQFA 2OD6A 3VQDA 5IQQA 4JLHA 2LQJA 5EX3A 3TI0A 1ZQEA 3ENBA 2RAQA 2P9LB 2ETJA 3FSYA 2VA8A 2MUTB 2CVIA 1ZOLA 4M6WA 2DY9A 4O5BA 4DU4A 2BJ3A 3L3VA 5E79U 3LWMA 8ICXA 2QKBA 3MR3A 3OFEA 4JD2B 3ICLA 4QOTA 3IS9A 1Y97A 1A5WA 2GBZA 2D4WA 1U8SA 2ISOA 5DBCA 1C1BA 2F63A 2QWPA 4HVJA 3LQVA 4DUYF 5BPCA 3N7SC 3MBYA 3GL1A 8ICOA 3BSCA 3VQ5A 5B0BA 5DGBA 1R6YA 1S1XB 4DR6K 2LHTA 3RJKA 5JVHL 4C8OA 1U6BA 4M9JA 3QPIA 4JB3A 4HUFA 4TU9A 2MQPA 4I6MB 4UOFA 4QZIA 1RA6A 1ZPVA 5KT4A 2YQ1A 1D4XA 4O44B 9ICGA 2YVSA 2WTFA 3BSOA 1SJFA 2D1CA 2IM2A 4HLBA 1YRXA 5CABA 1N32K 2KKPA 4O5FA 3VEYA 5AKKA 1RG6A 5ALHA 2O5DA 4FJ5A 5BOLA 3UD5A 3DLRA 3EW9A 1TV6A 4J2DA 4DR1J 5HRNA 1WF1A 8ICQA 3G8SA 1LFPA 4RUBA 4CLPA 3A5OC 1FERA 4D3HA 1U1PA 3ZD8A 1VRQC 3BSNA 3KJNB 3MM5B 5ADXA 3MUMP 2P9SA 3T69A 2ZWOA 4ID5A 2BRLA 4HCBA 4PG4A 2WBRA 1BDGA 4O55A 2AF6A 4DL7A 2HCFA 4CGDA 3POTB 2F4VJ 4XQ8A 2QEXS 3OYHA 1A76A 1P7DA 1U48A 4ZK7M 1VIOA 3MMVA 4B6JA 1SV0A 4OLBA 4RQ4A 4DUZJ 1KEKA 4ZVPB 2YI1A 1NPRA 1NK4A 4URQU 3U9DA 2KKZA 2ZIVB 8ICKA 4DV3K 4Y2QA 2NYHA 7ICKA 3K8VA 3P4IA 2Z2LA 1Q86T 1VR6A 2CPZA 2Q97A 3ZZPA 3W3DA 2E9TA 3PUFA 4G6VB 3D1HA 3D1QA 2MZRA 4OGEA 3MCNA 2W9AA 1L7NA 1YZ7A 3OYBA 2HDOA 4B9TA 1U24A 2F4VK 3V2UC 4EYHB 1NDPA 5FLXU 5JMNA 2R7XA 4FZZA 1IWGA 3H42A 1H1VA 2MTLA 4L74A 2H4YB 2JH1A 3ZXWA 4B3MF 2DR5A 1S72N 4Y2AA 4BBYA 4ZCIA 3O5TB 3O3FA 2L9WA 4FJLA 1AZSB 4FWMA 2A5XA 2CJKA 3CD6N 4OL8A 2JHDA 1T4GA 2UXCF 4FXWA 2ZUCA 5F3XB 2DNLA 3K1ZA 1PYOB 2H3IA 2P8IA 3CQXA 3CC4N 1KTVA 4M5IA 1Q8KA 2QM1A 1YSJA 1FJGJ 2B6GA 2J6TA 3IP0A 4YB7A 3NVYA 2BOAA 2PMHA 1Y3JA 3H8SA 3DOKA 4B3MJ 3MMAB 8ICGA 2W2PP 4LZGA 2WVEA 4LFBJ 3RMAA 1HNWF