2HDOA

Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
207
Chain Sequence
MTYQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTFPMAAEQAMTELGIAASEFDHFQAQYEDVMASHYDQIELYPGITSLFEQLPSELRLGIVTSQRRNELESGMRSYPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGMDPNADHQKVAHRFQKPLDILELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from Lactobacillus plantarum at 1.50 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Phosphoglycolate phosphatase
total genus 57
structure length 207
sequence length 207
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hdoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hdoA01
5ALLA 5FP0A 4ZEVA 2HDOA 5ALYA 3WKEA 3WK9A 4EEKA 5ALKA 1RPZA 2G0AA 5AHXA 2RARA 2WF6A 3QNMA 3K1ZA 2P11A 3HYCA 1L8LA 3SHQA 4GIBA 2G09A 4NV0A 3I28A 4HGQA 4JB3A 3QU2A 4Y2JA 3PGVA 5AVUA 1WR8A 1T5TA 3EPRA 3L8FA 3B8EA 3OCVA 3OCUA 5IS2A 1S2OA 1RKQA 2YBDA 3QUBA 2ZBGA 3OTQA 4EENA 1YS9A 4QJBA 1Z5UA 2O2XA 2ZXEA 3PDWA 4Y3UA 5AM0A 2I6XA 3OCWA 1ZRNA 3L8EA 3U13A 3AR7A 3I6BA 5AI5A 2RB5A 2I7DA 1T9ZA 4C4TA 4BEWA 5AM2A 3WK5A 2B0CA 1RKVA 4I9FA 4HGNA 2GMWA 4BNDA 1TJ3A 5ALIA 4C4RA 3N07A 3WKDA 3VAYA 5AI8A 1CR6A 4DCCA 1RQNA 5ALGA 3SD7A 3BWVA 4F72A 3N28A 5AW2A 2FPUA 3SLRA 3CNHA 2JAUA 1JUDA 5AK3A 4AS3A 4UASA 5AKJA 4UMEA 4BX2A 2GHTA 5AVWA 3NIWA 2AMYA 4CF3A 5AM3A 5T41A 2CFTA 4YIHA 4E88A 4O8CA 4CF4A 2G08A 3FPBA 3WK8A 2HHLA 3M1YA 5ALZA 4UM5A 5AVQA 1Z4MA 4QQFA 2RBKA 3W5AA 2GO7A 4RETA 1K1EA 5IT4A 2QLTA 2Q5EA 1PW5A 4YCNA 5ALVA 2AGVA 2GFHA 5ALQA 3NAMA 2C4NA 1RMTA 4CNQA 1YMQA 2FPXA 2HOQA 3A1EA 1F5SA 1WZCA 3WK7A 2PKEA 2D2VA 1Z4JA 2I34A 3ZWKA 5ALOA 3RF6A 3NRJA 1N9KA 3ZTWA 5AVXA 5AW0A 3KC2A 1VJ5A 3N1UA 4IG4A 1QQ5A 2HCFA 3L0YA 3ZVLA 3KD3A 1RDFA 3ZTYA 4BX3A 3E84A 5A3SA 2WFAA 3L8HA 1TJ5A 2C9MA 5AW6A 1L6RA 2YN4A 2IYEA 2FDRA 2NYVA 5AKKA 4UW9A 2R8XA 1ZRMA 5AI6A 2QYHA 1ZD3A 2AH5A 1QQ7A 2X4DA 2FPRA 5AKZA 3WKBA 3FZQA 5AW8A 5ALHA 3QYPA 4Y2UA 4UAVA 1Q91A 1MH9A 2ZG6A 2CFRA 3WK6A 1WVIA 1SU4A 2FPSA 3N5KA 4OFZA 3EF0A 3WGVA 4AS2A 4BEVA 1ZD5A 4YCLA 3E8MA 2ZBEA 1WPGA 3QU4A 2W11A 4Y2PA 3U7EB 3U7HB 2YMPA 1ZJJA 3NUQA 1SWVA 2IOFK 2BY4A 4KYTA 3L0CA 4UAUA 3ZX4A 3ZVMA 5AKLA 3QU9A 4EZEA 3U7GA 2O9JA 2WF9A 3L8GA 2I54A 2JAWA 2JARA 2PQ0A 4BX0A 1L7MA 2HX1A 3ZUPA 4NAVA 3CZ4A 3WK4A 4HGPA 3TLMA 5ALMA 2C8KA 2R8EA 2WHEA 4KNWA 3DV9A 1RC8A 3B9BA 1SWWA 2JGAA 5AM4A 4DWOA 2YJ5A 3DAOA 2IOHA 4KNVA 1U2SA 4OCZA 5AKYA 4Y2YA 4OD0A 2YMQA 1RMYA 2YJ6A 3NALA 3UMBA 2MSNA 2YFYA 4EELA 2B8EA 1Q92A 1RLTA 3A1CA 3HLTA 5A3QA 5AVSA 2IOFA 2B8JA 2OM6A 4BBJA 1XVIA 3GYGA 3D6JA 2YMLA 4CF5A 2I33A 5AKHA 1YJ5A 2G1AA 3OPXA 4CE6A 3QX7A 2DQSA 5ALWA 3SKXA 2B1RA 1L7NA 2RAVA 5ALPA 2OA0A 3FM9A 4XOUA 5AVTA 3EWIA 3W5BA 5A3RA 3OCXA 1Z4KA 4IFTA 4BKMA 4YIKA 3L1VA 4Y2RA 1RLMA 3ESRA 3ONNA 1TJ4A 2MU2A 5AKIA 2FPWA 1EK2A 4EX7A 1O08A 4BYGA 3BA6A 3ZVNA 1T5SA 3IRUA 1Z4NA 4EX6A 1YNSA 4XPZA 4NWIA 4NABA 1NNLA 1FEZA 1J97A 5ALJA 5ALEA 1Z4LA 2EAUA 3EF1A 3WKCA 4BNDB 5AESA 1Y8AA 4C4SA 4GXTA 2HSZA 3IJ5A 1S8OA 5IT0A 3ZWDA 1XPJA 1NF2A 3DNPA 4HAIA 2B1QA 2ZBFA 5AKXA 1J8DA 3ZX5A 3MMZA 1U7OA 4KX5A 2HEGA 4J03A 2EARA 4Y2XA 1QYIA 3AR2A 3ZW7A 4F71A 1EK1A 3N8GA 4L6AA 3ESQA 3MN1A 5AW9A 3J7TA 5AW7A 4RESA 3U7FB 1Z88A 3ET5A 3L0BA 3AR4A 5JJBA 4FYPA 3PCTA 4XQ0A 2WF5A 4G9BA 3QXGA 2HO4A 3A1DA 3RFUA 2R8ZA 4XE5A 3S6JA 2YJ4A 2YY6A 3B9RA 4HGRA 4MWOA 4OHFA 4UMDA 3AR3A 2R8YA 1IWOA 5AW4A 1TA0A 2FUCA 2MU1A 4YH1A 4Y2VA 3KDPA 2G80A 3I1YA 3L5KA 2P69A 3P96A 2EATA 5AKGA 5AK6A 4FE3A 3F9RA 1ZD2P 2Q4TA 5ALRA 1O03A 3L1UA 4JDPA 1VJRA 5ALFA 4KX3A 3UM9A 3MPOA 3I76A 3A3YA 3KOOA 1YV9A 4I9GA 4UMFA 3QUCA 2W43A 1RLOA 5AVZA 1Z4OA 2IA5A 2FI1A 2NO4A 5AVRA 2HF7A 5AI0A 2ZBDA 5ALDA 2YJ3A 1RMQA 5ALUA 5ALSA 3WGUA 4HGOA 3ED5A 2AUTA 4G63A 2I55A 1QH9A 1AQ6A 3WKAA 1N8NA 2P27A 3NASA 2G07A 2GHQA 3QU5A 4DFDA 1Z4QA 3FVVA 1L8OA 2OBBA 1Z4IA 1X42A 1LVHA 5ALNA 2WM8A 5AM5A 4J2TA 3AR6A 4UM7A 2NO5A 2VKQA 3E58A 2HI0A 3ZU6A 3U26A 4FFDA 2Q4RA 1YDFA 1ZS9A 4L6CA 2ZOSA 3SKYA 3SMVA 5AK5A 2PR7A 5AK4A 1XP5A 1TE2A 2YMMA 4HYTA 1U02A 2C8LA 2FUEA 3IB6A 3W5CA 3QLEA 2JAOA 3E81A 4DW8A 2C88A 1ZD4A 3KBBA 4ZEXA 5AM1A 3NANA 2BDUA 4Y2SA 2P9JA 4ZEWA 5AW1A 1L7PA 2ODAA 3OCYA 1U7PA 2CN1A 1Z5GA 2B30A 1U2TA 3QUTA 1RRCA 4Y2TA 3ZI4A 3ET4A 1ZOLA 3W5DA 5ALTA 3FPSA 3R9KA 3U19A 4B6JA 5E0OA 4AP9A 3DDHA 3R4CA 4H1WA 5AVVA 5AKEA 4UMVA 2OYCA 3M9LA 3QU7A 4KN8A 2WF7A 2W4MA 3UMCA 5AIBA 4L57A 3KZXA 2BDEA 1LTQA 2G06A 3QUQA 5AW3A 2WF8A 5AI9A 5AI4A 1Z4PX 4Y2QA 5AIAA 1L7OA 3MC1A 3OCZA 1VFPA 3PGLA 4NFLA 5AVYA 2FEAA 3QGMA 5AICA 3AR5A 4UU0A 3AR9A 4YGYA 3R09A 4YCMA 3L7YA 3AR8A 3FGOA 3UMGA 5AW5A 1CQZA 4UATA 1KYTA 1RKUA 4UU1A 1RQLA 4MUMA 2CFSA 3SF0A 5ALXA 4UARA 2HF2A 2B82A 1QQ6A 4PNHA 1NRWA
chains in the Genus database with same CATH superfamily
3RUDA 1BMFA 4YPOA 1MOQA 3M6XA 4RTMA 3WKEA 1FP4A 4HZUB 3UB2A 4W9RA 5ALKA 2H8GA 3UUFA 4NIMA 6PFKA 4DUZB 2HTFA 2YCLA 2G88A 3FWKA 1NM5C 3PHIA 5B1DA 1JAHA 1O97D 3MXTA 4FZJA 1BNPA 3TARA 2CJWA 3K1YA 2VDRB 4Q4AA 3T06B 5JS6A 2P9YA 3I92A 3JYOA 1BWSA 3VZCA 4YRJA 1SB9A 1F60A 3D8BA 3EZFA 4DDHA 1RZVA 2B7CA 4LSMA 3VTZA 3HKZC 3AFMA 3ETCA 4YR9A 5JO0A 4DF3A 3ZGVA 4FLEA 4KVGA 1WIWA 4G07A 1B43A 1TTQB 1BE1A 2VSYA 2EL9A 2W6MA 4TVKA 4KE6A 4EYSA 2YIJA 3X2SA 2N3ZA 4DXAA 3MTJA 2PQ6A 1XMSA 3IBTA 3IAHA 1EFPA 5JE8A 4Y6GB 2YV2A 4CMIA 2B98A 4X90A 4XW2A 5KAIU 1QG0A 3LDGA 1N3YA 4TWAA 1EDDA 3TIVA 4Z7OB 4R31A 2JFPA 2VT7A 5KOHB 4CIVA 3IERA 3GPLA 4ND6A 2W48A 2F90A 1OH7A 2P6UA 2GNAA 4OJPA 2NXJA 4UM8B 5DNAA 1YA8A 3HYNA 3GT3A 4PN3A 1RWQA 2VDNB 5EQDA 3TIXB 4YXJA 3R23A 3PU6A 4DJFC 4HMQA 1NTOA 1L4BA 2Z8ZA 3UJHA 4WX2B 2FPKA 4YCXA 2SCUB 2VDVE 3DO5A 3AYZB 3B1YA 1R7RA 3MTQA 4FE7A 3B6EA 4QJFB 2QKYA 1VKNA 3VPCA 3NH6A 1Z83A 1ZRNA 2G8LA 5DXJA 3UQYS 4N0MA 4NK4A 5HR6A 2P4EA 4MS4A 1CRLA 2J41A 2WLTA 4RH1A 3RS2A 1ZLXA 3KKQA 4E22A 3THWB 1PSWA 2AMVA 2IYOA 1G3MA 1EUCA 5JWRA 4UNRA 2WAAA 1E2IA 3FCOA 3DBOB 4LZLA 2FGKA 3PVXA 3RJKA 1F0YA 1HDCA 2IYYA 3AI1A 3TJRA 1YKFA 3TRHA 3UIEA 3PC6A 3VFDA 2GZMA 2ZTEA 2H4WA 3FTNA 3CKLA 4MS1B 4GAEA 4BO0A 1D1PA 1SL0A 1XCBA 5EZYF 4U9IS 1FTWA 3WKDA 3ICCA 4JOCA 4EMBA 4HNQA 4CLOB 3WNZA 5J2UB 3U3RA 1UOEA 2KWIA 4F72A 2GAIA 4MGIR 2FPIB 4RFVA 3CNHA 3KLOA 4C14A 1KH3A 1E7YA 2UUAB 4EBBA 4UASA 2HCJB 5T4HA 4L9WA 2Q29A 4O02B 3FD8A 1RKBA 1LI5A 2REOA 4MRMA 4DLEA 2R65A 3KKLA 2R8PA 1BEEA 3KOYA 4O4LF 2YB4A 2ORYA 4QU0A 1DQYA 2CNBA 3UYLA 1UR5A 1M5UA 1VMKA 5A5VA 1M10A 2D8AA 1XG5A 2GO1A 1Z2DA 2WIGA 5DHTA 5LJIA 3WK8A 2HN9A 5IIJA 1IAVA 3OZBA 4J76A 4YP1A 3KJQA 2G5CA 3D6AA 5H5JA 4NY1A 1Q0TA 2H1SA 5DMHA 1U4SA 3KBOA 3GCXA 3KFVA 5DLQC 3E22B 2QLTA 3OETA 3GIMA 4PHCA 5CWRA 4ZHSA 1KO5A 4M9JA 3ZD7A 1NSFA 2QORA 2V0CA 1HQYE 4AWBA 4BNWA 1QHYA 5DLGA 5GV7A 1NXPA 4MFAA 2AQ0A 3PGA1 4M49A 2CVZA 1QOQB 1CE8B 3SAHA 1JU9A 2XYPA 5CA1F 1P8AA 1A8QA 5LQKA 3BFJA 1QHHA 4NYJQ 3L92A 5IJAA 1NJGA 3K9LA 1SHZA 3G7UA 4G0ZA 4XX1A 3MTGA 3HJTA 1WA5A 1NUUA 1JH8A 2D5AA 2VUUA 4UEWA 5FNVF 2HJRA 1OE0A 1ZQNA 2WJPA 3IEPA 2VOEA 2YWJA 4GI5A 4JBIA 5H16A 4CM9D 4J43A 5I4BA 1DARA 5F1KA 3PR4A 1FW8A 1WLYA 2HCFA 3GZNA 1WDKA 1XVUA 3NS1A 1PLLA 3D0OA 3C8MA 3K4QA 4YG2A 1FRQA 5D4BA 1GG8A 3BFVA 3O73A 4M0KA 1D0IA 5DBFA 3ZHYA 2B4YA 1ZQUA 3QA9A 4BS9A 4I55F 3KQNA 3KUCA 4WVFA 3C3PA 3DMTC 3DHNA 3B1VA 3N6XA 3PI6A 3KKOA 2RHFA 3DVSX 1JILA 1VIMA 4M76B 2FMXA 5HYVA 2GPYA 5IFLA 2PLRA 2Q3FA 1W34A 3PL5A 4XLLA 1K4MA 4MVYA 5EJFA 3TNJA 5LQRA 4FGKA 1YNOA 3A2LA 4ZQEA 1C0PA 1Z62A 4H7FA 2P5TB 1C0KA 1KQOA 2D7CA 3AF4A 1OMOA 1T8UA 2BKAA 3I58A 4IEFB 2ZWIA 1PL8A 1K0FA 3FZQA 4GOMD 4NC9A 1Y48E 2VYVD 2WM9B 3IUEA 2H6EA 2WZCA 4P5DA 3DW1X 3E15A 1XP8A 4JHLA 1E1NA 2REBA 3LKVA 1CY8A 4OQFA 1NYTA 3TRDA 1P8JA 2JGMA 4P3XA 2EQYA 3EUFA 2DPIA 2J6CA 4HH1A 4YP7A 3RJTA 1TK8A 3TZCA 2WTUA 3SS8A 5KT3A 3GV8B 4NY8A 3VYRB 2B2NA 3SFVA 1KI4A 3IDOA 2ID7A 4KDFA 3LQRA 3C7DB 3QKIA 5IDQA 4BEBA 1IOLA 1NSTA 4FOSA 1I7DA 1K9SA 3PP8A 5DRTA 3H5VA 1ZQ1C 2GKSA 4CKBA 3R3JA 4EI7A 1L4UA 2C82A 2W2VA 1K89A 1X39A 2NN3C 3B82A 1X2IA 1SXJA 3P2YA 1NBMA 3Q12A 3ETRA 3RVRA 5ETJA 3WYDA 3VSDA 2OBMA 4DV3B 7ICIA 1T6NA 3D3EA 1TM2A 1DGJA 1NI5A 2HK7A 3OHSX 2BPGA 1HOTA 1QHEA 1J09A 3UBMA 3PUIA 3AM9A 5A4FS 4RHXA 4FR5A 1W44A 5EKDA 2EGUA 3WSVA 2P2SA 1P2DA 2G5TA 5LQNA 3RC9A 2GK4A 1ESMA 4LDZA 4ZVLA 1ZUIA 1QCKA 1WRBA 4CIAA 2QUZA 3QEAZ 4MW7A 3U6KA 4L73A 3MW8A 3MGHA 1HRDA 3HWSA 2RG7A 2J0EA 2JGAA 1K3UB 3AF3A 3L8YA 4JL6A 2RSLA 3FPKA 5BNTA 1FUIA 2XQFA 4CDNA 4D96A 1JDJA 1EEHA 1UZUA 1PR0A 3KV3O 3L7IA 3DLHA 1OFUX 1ZIDA 5EN4A 2QTZA 5JVDB 2X5OA 2KZ3A 4YUVA 3D6TB 2DHQA 5TGTA 1SG6A 4OMUA 4F2DA 2ZREA 1YOBA 1YUBA 2BFNA 1GG5A 1P7WA 5KAMA 5HHTA 3UXNA 2J32A 1Q2XA 1TUGA 2YJ6A 2X5JO 3KQPA 2FWMX 2VXBA 4GYYA 3U6BA 1G9TA 4HNUA 4QOEA 1SA0A 1X9IA 2JLBA 1OQAA 3ETGA 3MTDA 5BOSA 5ICGA 5IVHA 3PICA 3ZU3A 4Q05A 2V4UA 4R66A 2YINC 4H3KB 1EUZA 4OBWA 4BU1A 4BQFA 1E2EA 4RBNA 3BBPA 2X8JA 4QNNA 2PE5A 4R1UA 2ASLA 1NZFA 7ABPA 1L5ZA 2BE9A 2Y2VA 3OF5A 4UVIA 4F5YA 3A7DA 4KPEC 1KAHA 1FJHA 1YT3A 1QV6A 5BV7A 5JHHB 4J7UA 4DGSA 2AWOA 4CE6A 3AJDA 4V0QA 3WNDA 1UJ4A 3W1WA 5ALPA 3L6BA 3Q11A 4U0JA 1P9RA 4WHMA 4WRRA 3F9IA 4D98A 1AKEA 1HTTA 1I24A 1SU8A 2KM1A 2IZZA 3BK1A 3CF2A 3M89A 4XUSA 4HAOA 3NGXA 2L18A 3W8NA 1SVUA 2IIQA 1GFZA 3BXPA 2D0DA 3ROFA 4Z4IA 5JXJA 1C3XA 3R7DA 1C3JA 4FXOA 2AE1A 3BIWA 4PO9A 4QUJA 3BN3A 4MEXA 2EZXA 3ESRA 1L5GB 2H9AA 3DT9A 4ENSA 4D80A 3SJBA 4P34A 5GINE 2Z3VA 2XCSB 1YB7A 3HEBA 1MVLA 4BLUA 4Y7DA 5NULA 3BA6A 1NX9A 2IIBA 3VSCA 4IYRA 3OOSA 5DHUA 2ID4A 1HDZA 1OFVA 2O2EA 4RVSA 3KHTA 3IBFA 4WKBA 1OFGA 4HWTA 4BNXA 1TPZA 1WMDA 2EAUA 3EF1A 2XDWA 5CVDA 5JD3A 5TB5A 5LZ9A 1DXOA 3H2ZA 1FUYB 4FM9A 2IZ5A 4CRWB 4OJYA 4JI6B 4DUGD 2YXLA 1W96A 5FUYA 1KZ9A 2IYRA 2NZ2A 3LLSA 5I7SA 2Q1UA 3IJ5A 3INGA 3EVDA 1N8KA 1ESDA 4WSOA 4KLHA 1X74A 4K4HA 3HDHA 2ZIVA 3LJKA 3L77A 3PFHA 4LQLA 3NP7A 4P4MA 3C7KA 2NP6A 1SIWA 2CXQA 4YAJA 4C78A 5L9AA 3U9LA 1R27A 2WMOB 2YNMA 1MO5A 3SZLA 2C9OA 3MZ0A 3PYXA 4QT0A 3KYBA 3V4RA 5EWEA 1G5PA 1WTCA 1A4IA 1M7HA 1W49A 3EIWA 1I5EA 4JLNA 5HJ7A 1PNOA 1A2BA 2H9IA 4KLZA 3QWAA 2XA2A 1XZNA 2BR0A 1MDFA 4WVLA 2Y1OA 3OT5A 3UCEA 3X3HA 4ND7A 4DIMA 4DLBA 3P2KA 3SHVA 4IC9A 1O6BA 1T34A 4ICIA 5LXTF 1WW2A 3KEQA 1A96A 3IUNA 1OI7A 2X2FA 3NVDA 2FUKA 3ONEA 4XGIA 4EVRA 2WQ7A 4FOPA 4LZNA 2WB1F 1ZQEA 2NUTA 2H1IA 4PGYA 3TRFA 2Q6OA 2OK7A 1UJ5A 2GBLA 4JOSA 5KTNA 3RF9A 1L1EA 1DXSA 1AKMA 1KWKA 3N74A 5K09A 3GV5B 2HRZA 3M34A 4ZGGA 2J6HA 5AW4A 4CM5A 4FS2A 4MV6A 1Z5VA 3KZVA 4WJLA 4L0CA 1EYZA 1TX4B 3I1YA 1XU9A 3PITA 5CA0B 1K4KA 4CKCB 4IWXA 1MTOA 1PUJA 1BNCA 2ZS7A 1LUAA 3KTAA 5T8KC 2DOKA 4ZVMA 3UJCA 1G0NA 1M8KA 1KERA 5D84A 1DBQA 1FX1A 3L1UA 3KOWA 3EK2A 1DBPA 1Z8HA 4KX3A 1CY1A 2UYYA 3K0AA 4AZ3A 4ECAA 3W6OA 1E6UA 2W6ID 3MUFA 4CCWA 2J9XB 2PT7A 1WSBA 5CURA 4Q6WA 4N7JA 4WBNF 2HHSA 4L7VA 4DTIA 3KVNA 1I13A 1L7QA 3RU3A 4Z9BA 4C08A 4XUGB 3AJ9A 5F3RA 3V8QA 4D7AA 4Q1EA 3GT7A 3NTXA 5FI0B 1M34E 4X1IA 1ECJA 1IIBA 3P0HA 2AXEA 4RWEA 4UCFA 1TCUA 4RHTA 1MV5A 3JY6A 5AJUA 1C3VA 5ALDA 3VYTB 4KLGA 2VVTA 2QM7A 4J4TA 1WUKS 3DF7A 5IIIA 3G79A 1GQOA 4OY3A 4IEIA 5JS7A 1SZHA 2B25A 4L0QA 9ICFA 1Q15A 2Y3IA 5IVDA 1L0BA 1QKJA 1XQ9A 3G2JA 1QQBA 5KFHA 3AUJB 3AEXA 5C4IA 1Y8RB 2HUPA 2QY6A 5L4NA 2OGSA 5BNWA 1WBJB 1DCMA 1SB3C 3OZWA 4M98A 3Q7TA 1LK5A 3LC0A 2IP2A 2OAGA 3WLKX 4M46A 3QEMB 1XTUA 3N9IA 3U4HA 3SICE 3X2FA 2H7YA 4RK5A 5JVDA 2QRVB 4U6QA 4IHKA 4CFYA 5AJHA 1K6XA 5A1TA 5CEJA 3II6X 4O4LA 4J9OA 4QPNA 5DZSA 3D6FA 1FYEA 4FP9A 5EZ5A 2AQIA 1L5QA 3H8JA 4GLOA 3PKJA 4AFNA 4ZIRB 2R8HA 3CX3A 1B0XA 3Q40A 2OO5A 1X8JA 3B7PA 3NCHA 3IP5A 3WMRA 1ZBQA 1JI0A 2YOHA 4N9QA 3VC7A 3WIEA 4ED7A 2IYTA 1TOAA 1IDOA 3MS4A 1O94D 4PL2A 3VH1A 5KYUB 1G59A 2DMRA 4P5EA 1ZHOA 4FBUA 1JWBB 2P7HA 4PLPA 5DGAA 3C0KA 3UCFA 1N8TA 4E6PA 2I1QA 1E9CA 1XYYA 4QZVA 2MMCA 1MT0A 1YQTA 4N7RA 3RUFA 3SX2A 2NVWA 1YZ6A 2XNSA 1P33A 4B0OA 5FWYB 3AW8A 5E6RA 4OQYA 4KQCA 1SXGA 2VTEA 3SAFA 1D1SA 3WICA 2I2FA 3GJRA 1QOZA 2R2GA 2G04A 3TTWA 4DE5A 3QELA 2FN7A 2IHVA 1JQLB 1O95C 4XB2A 3R8XA 3K72B 1XZDA 4H0NA 5FBKA 2BDUA 1DMRA 3D2CA 4RMHA 1JKJA 2KE5A 3MUNA 5ERGB 4HT3B 3C16C 2D1RA 2PH5A 3C28A 2QTVB 3A3OA 2JV3A 2NIPA 1UEJA 4JSRA 3WHPA 1J1IA 2B7BA 4QDZA 3CBGA 3CX4A 3T1VA 5CIYA 2BHLA 3LA8A 3CVWA 3EOBI 4N8DA 5KOHA 3L7AA 2I6GA 3QUTA 3MTBA 3CINA 4MVJP 1NWHA 3BHJA 1R5OA 2AOVA 3L04A 4HUTA 5KG3A 3T7DA 1GCAA 4QVGA 2QAIA 1SB8A 1HEUA 1KP2A 3H1PA 3R9KA 3VX3A 4EW2A 1MX1A 2NSYA 1IHUA 4HN2A 5L1MA 1X38A 4TYQA 4IJ5A 4EHHA 4L0MA 4NLNA 2HVIA 2PD3A 2KN7A 2IX9A 4DSUA 1NLZA 5CYPA 2Y1JA 1YQUA 4L0DA 5KDLA 4JENA 1U7ZA 5MHTA 3ZGOA 4PTZA 3JXEA 5IFKA 1Z4PX 2AKAB 4RT3A 2C9CA 2C7QA 1VZ3A 1KDTA 2IU0A 3T99A 4TV8F 4D99A 2CUNA 4M1EA 2E1EA 4QM6A 2X1VA 1R0RE 9ABPA 5B6JA 3QGMA 1FDSA 4AMYA 3BWYA 1R4NB 4BQSA 5LKRA 2JLUA 1JHUA 2JIMA 3STHA 3STVA 3ZY3A 1ZUWA 4F8EA 2XTNA 4BFXA 3I61A 1NTRA 5KG4A 1YB2A 1OH6A 1SXJD 2IHKA 2G9QA 2XIQA 4HZIA 3K6SA 4IMRA 1JZTA 4UAYA 1JEOA 1UFVA 2DKFA 4DIKA 4M9SA 3MCUA 2W9CB 1E2UA 3PL1A 3PJRA 2QPOA 5GJBA 3T61A 3LWLA 2NTVA 2P4QA 3SSAA 1FJ2A 3AIKA 2HF2A 3MA0A 4PCLA 2AFHE 3LWNA 4RELA 2BQ3A 1GTL1 3SLGA 4OBXA 5B6IA 2Y05A 2B78A 2BBWA 4IFIA 3B3GA 4L9RA 5G0WA 4DCOA 1FMFA 4RKFA 1WLSA 2WFMA 3VO9A 3AL2A 1OUMA 1K7CA 1UPUA 3DPUA 5CB4B 4KXNA 4ITVA 5DU2A 5FPHA 1Z0KA 1D6JA 1D2CA 3C3KA 1JBEA 5JISA 3UPUA 3KQQA 5HG0A 4BJ3A 2BGWA 2WG0A 1GKUB 5B57C 2QMYA 4RV5A 3N2ZB 4FOLA 4OP2A 3LK6A 1ZVVA 4MW0A 2R6JA 4B9TA 1I10A 2WF6A 5DX0A 3BL8A 3MT7A 2O8FA 4URYR 1DNPA 3DKRA 1AGYA 1A0OA 1NMZA 5A4JA 5AQ1A 1JH9A 4QHTA 5DCWA 2N9UA 5DN6A 2GHRA 5JS1A 2PVCA 3DWGA 2OG1A 3EGCA 2IU4A 4JEUA 1XNRB 1M6VB 4MKFA 4LRYA 4B43A 3G5AA 3K2QA 1UKYA 3Q1KA 3GLTA 4EGJA 4YRFA 2OCPA 4H7PA 3UC9A 3B8EA 4IRXA 2FZVA 3O26A 2J33A 1V3TA 4J9SA 2XBUA 1FJGB 2BBTA 3RH5A 3DXXA 1Z07A 3LXXA 1A8HA 3WL3A 1V9LA 5CA0A 1C1XB 5KYVA 4QBHA 2UYHA 2RBGA 1RYSA 4BOYA 5JNTA 1KK2A 4QTYA 5KG0A 4EENA 1HUOA 1RCFA 3DG9A 4WH0A 5KHAA 4R2MA 2E48A 4LYFA 4XB6B 5JH7B 4DIUA 4WAUA 5F2EA 4BX9C 5HRCA 1J90A 2AMLA 3H8WA 5DOZA 5SV2A 1HORA 1YJXA 4LN1A 2PKCA 4RPHA 5FBHA 3U13A 4Z49A 1Q16A 1YAJA 1U3FA 5IANA 2CJWB 1MO2A 1U6KA 3KUUA 4QJ4A 1DQNA 5G02A 4EJ0A 1COOA 2Z8YA 3P0RA 2Q4OA 1R9JA 4I2GA 4OQDA 2ZAIA 2HA3A 4N5HX 1VG1A 3QWFA 4XKJA 3T7JA 1MIOB 2I2BA 1S8FA 1RKVA 3CWCA 3ENNA 2OO7A 3Q0TA 4TT3D 2AHOB 1K08A 4K2HA 1USGA 1NKVA 4TTTS 5DGIA 4CT4B 1VBMA 5A4AA 2XY4A 4OKNA 3OQ1A 4FR2A 4P58A 2REQA 3PUWA 4AT1A 2XOXA 2H3VA 2F3TA 1NQAO 1FXUA 1MOPA 2QAGC 5KJ6A 5BOSB 4KXVA 4BNKA 3BWVA 1QGOA 3OZCA 5AW2A 4LDPA 3W9UA 2A9VA 1MJNA 1E9VA 1WSDA 1W1IA 2C4UA 3ZHTA 5KKNB 4DLKA 3MGVA 1FB5A 4KE8A 3OQBA 4C04A 2PX5A 3N5CA 1ILWA 4TZ0A 1N77A 1IVYA 4CHTA 4UE6A 3AP1A 2CFTA 3HZOA 1IEWA 4DNQA 5J4VA 3LMKA 4ADSG 4OB7A 1NVFA 5FAXA 2G08A 5KT6A 1C9EA 3LECA 3M2PA 2HSDA 4O2AF 4E7OA 4Y0VA 4R8UA 2R00A 3WYBA 3V8PA 2RBKA 3M1LA 1OU0A 3MOGA 1E5XA 1GZ3A 1FTSA 3FPJA 1B2LA 1CUJA 4PPFA 3OWOA 4JGGA 1P61B 4M1ZA 2IWRA 2IBTA 1E62A 2FG5A 2AUNA 4RAQA 1CG6A 1KSPA 2XB8A 3PB3A 5E8JA 1TU3A 1YKSA 2PG3A 3A1EA 3PXAA 4K6OA 1D9ZA 1W4ZA 2WKWA 4TVBA 4WOCA 3VZSA 2E8MA 1Z4JA 4RA6B 4XVHA 1PX0A 3BZUA 1F4LA 1SBHA 3TQHA 3G6YA 1PZFA 4O5KA 4Z0TA 3NRJA 2QL7A 1BJRE 3K0HA 2QL6A 4KXMA 4F5NA 1OILA 2YUIA 4Q45A 3JZAA 4LXIA 3DAPA 4C0HA 1TTTA 4W9MC 5EHGA 1VL0A 1CU1A 3HLKA 1HUQA 1I9CA 5EWJB 3RSZA 2OQIA 3U4IA 4HYQA 1GVHA 4JYPA 4G65A 3DEAA 4I5FA 2PMDA 3RRNA 3V32A 3BIOA 1NBAA 1KZ7B 3PIIA 2ZTMA 4J0CA 3D1LA 5J2AA 1AKVA 4Y9DA 1RE0A 1KK3A 2EZ8A 1SULA 2HWUA 1I30A 1CETA 3A70A 2FN8A 4XYMA 4EI9A 3TM5A 4R3NA 3Q6NA 4MUYA 1FY2A 1CZHA 3TQRA 3NVWA 4DMLA 3QZUA 1VYVA 4K3VA 5CT9A 2QDKA 4BUGA 2QYHA 2XCPA 3ETHA 3KSDO 4FFSA 1Z6ZA 5J0QA 2ZSBA 2DVMA 3GRCA 4FOTA 3VR4H 5BRAA 4IDGA 2QRLA 2CNKA 2FPRA 2ZIAA 1A3CA 3QQPA 4PZUA 5EIBC 5JAMA 4J29A 1QYVA 1CFZA 4UUAA 5JZMA 4RQ2A 1XQVA 2E4ZA 3DBHA 3HP4A 5IAEA 4S1WA 5B7PA 4LBVA 1CE8A 1AQNA 3TQFA 1UK6A 1KDOA 3HDGA 3B1WA 1U5AA 3BXHA 4Z7JA 2ZI7A 3U7EB 3EZ6A 2IUTA 4M7OA 5T4EA 1YIOA 2P30A 1OZ0A 1SWVA 8ICMA 3MB8A 3LG2A 4GM4A 4S24A 2XWJI 1CWUA 2OFFA 2GI4A 3H2YA 3C1YA 5DLEA 2YIVX 5E1OA 4OJKA 4BB9A 4F9TA 2O7VA 2KE7A 4DW8A 5FBLB 1U1FA 3IQZA 5JU5A 4RVGA 4EZEA 1ZHHA 4B3XA 2Q8QA 1XHLA 4MCIA 4D5GA 1X7XA 5GP1A 1ADBA 3RVDA 1E9DA 3DXYA 4LHZA 4AU1A 3G02A 1DWPA 4PPQA 4NJMA 3CZ4A 1WKVA 4QBIA 1BVUA 1E9SA 3D3NA 3NYQA 4OHWA 3UAVA 5K8TA 2JBAB 4KMRA 5C52B 2D3WA 4GHWA 2I9GA 5M5BA 2ZRNA 3IPXA 3L0DA 3L40A 3NFYA 2VQFB 1G5HA 4YB8A 2ZS8A 3DC2A 4I81A 4CM1A 1SCAA 1SWWA 5CDFA 5JYEA 3DOUA 1VE5A 2VRCA 4HDSB 2OWOA 1GLNA 4JLOA 5AJZA 3E9MA 3VTAA 3VBEA 1Z12A 2M6RA 3V8MA 4XJXA 4XDGA 1IM4A 1U2SA 3LP8A 1YGPA 3NHJA 4ECSA 2O57A 3R0IA 2KSOB 4GLLA 3C3BA 3BKWA 1X9SA 1NXXA 2ENUA 3EODA 1OPXA 2F55A 2ECOA 2K87A 2P1RA 4ZT4A 4ZV7A 4D4MA 1D2HA 2ONKA 3GGPA 4HDCA 5A6VA 3UQ0A 5CX1B 5FOQA 4HWRA 4AD8A 3SSNA 4BQQA 3RC8A 4NJEB 3QF4B 1C9DB 4YMIA 2IY7A 5EE0A 4QJ5A 1VCIA 4CF5A 1XYVA 3LQYA 3MCZA 1I1NA 1JTVA 3KV1A 5DVZA 1H1LB 3F2IA 1AUVA 4C0SA 2QX7A 4JYAB 4QXPA 1TECE 4GP9A 3CNQS 3H65A 4QC2A 3UFXA 1QTMA 3ADCA 3E23A 2GF2A 4ZAZA 3R3XA 1M5TA 4UM9B 5J2TB 1DOZA 3IKMB 1USVA 5LZ8A 3RAQA 4RJ2A 1L8XA 4J9RA 4L6IA 5J43A 1USWA 4IFTA 4C7VA 3M33A 1KMQA 5KJ1A 4O0IA 2PT9A 2AFVA 4YUWA 4LXQA 2QZ4A 1QRDA 3VDNB 3HM9A 2Y4OA 3GJXC 3KCQA 1OWLA 4TLBA 4EO7A 4F60A 5IJXA 2B99A 2XF2A 3ZDAA 1U9YA 4KAAA 3SYTA 1OTYA 1SVOA 3IM1A 1E3TA 1BKYA 4D4JA 3UJ3X 5DM2A 4ASUA 2X40A 5F5XA 3JZIA 1L9KA 1MB9A 2KSQA 2FQYA 1E89A 3MWDB 2V96A 4ZC8A 3R7WB 3ITEA 2DYKA 1BYUA 3SDSA 2ZB4A 1ECLA 2ZRJA 4NEQA 3PX2A 3QWBA 1KXZA 3OZXA 4UHBA 6REQB 3FSRA 3T5CA 1J97A 1W85A 5ES4B 1X15A 2I78A 1LNSA 3A9WA 2NPIA 5DIZA 3G59A 4IHAA 1L5NA 1VI2A 3H40A 1VJGA 4C2BA 2PH1A 1CDDA 2NO1A 1GTG1 4C4SA 4TLEA 1Z8DA 4C8MA 1ZMBA 3V4VB 1BN6A 1YAHA 3WYEA 5HF9A 4C4OA 1JQBA 1TZ2A 1NF2A 3HB9A 3O95A 1OXXK 3QH4A 4IGIA 3DNPA 4URWR 2WA1A 3KB2A 4YMLA 2VSXA 2O6LA 1DFGA 2DPXA 4OLAA 3ZX5A 1WYGA 4M2YA 1DEHA 1M7BA 1OI3A 3KT0A 1QLHA 2H5LA 2J5QA 3OC0A 4KX5A 2ZT8A 3P19A 3Q4GA 1R6VA 2I2WA 1OXKB 1VLMA 4JQZA 1DCKA 4OFBA 5JD4A 2RGRA 2XEDA 3QSYA 1W5FA 2ISCA 2PKRA 3QVGB 5IXSA 5KINB 1TU0A 4KSYA 2PMZC 3THVA 2JGIA 2IHYA 2MSEB 2WK1A 1VLZA 1HF3A 4DSJA 2A14A 2K7ZA 1KOLA 3V5NA 1DQSA 4IIEA 3I64A 2CLHB 4OSOA 4EOGA 3WTCA 1L2TA 2IP4A 3IVRA 5SYNA 3VISA 3AR4A 3GDGA 1E6KA 4GICA 2P9HA 2GWHA 4FYPA 4AYXA 1P0IA 1G3IA 1QHFA 3N2YA 3NYWA 1P45A 2PMCA 3QELB 3CNEA 4MS4B 2I4RA 1CUXA 1KY3A 2BJVA 4QOHA 3EBOA 1GD1O 2P5UA 4LKOA 4UB6U 4MARA 1N6KA 4RVHA 5F12A 1MX5A 5EEGA 4FEGA 2RHBA 4YJ2F 5DP2A 1CPYA 4FYIA 2FUCA 3QE3A 4RE6A 1EUCB 1NLUA 2BI4A 2EFHB 4LHXA 2LIVA 3T3PB 1JKIA 4BNNA 1KMNA 3MJSA 5K3OA 4J1TC 1U65A 5DHPA 3S2UA 5AK6A 1QTNA 3B36A 3IS3A 1KU0A 1VL2A 2BCQA 3OE5A 3F7NA 4R8SA 4XB1A 5DNDA 3DE3X 2RIPA 1JHXA 3KELA 1ORDA 4RQUA 4W1RA 5FJIA 5GVSA 3G0BA 1AV6A 1SOUA 2GWRA 1VJRA 2OORC 1NV9A 2XGGA 1YJCA 3CCBA 3K31A 3UN1A 3HY3A 5B7NA 3U17A 4ZVNA 3OT1B 4QWBA 1AHIA 1HETA 1WSAA 2BMVA 3A3YA 3IQFA 1D0VA 4YV2A 1DKRA 5CD9A 2IJGX 3JARB 1F38A 1GTJ1 1FQJA 5E3HA 2YRFA 1KYZA 1Z4OA 1D5CA 2FVYA 2VT3A 1S2LA 3UOWA 2CDCA 2XRFA 5FWXA 3SZRA 4HF7A 1MW9X 4XRHA 2FFRA 3IOMA 3AKDA 3K8OE 4DM7A 3LIIA 3ITKA 4WK2B 1VDMA 4OSPA 3NBUA 3A6PC 3PNBA 1HY3A 3ZDCA 1FLVA 2BGIA 5ALSA 3A6ZA 1WUHS 5CM9C 5C8YA 2OHGA 3UA4A 2IWHA 5JNVA 3G7SA 1TUIA 3WQHA 1ONOA 5D1HA 1FQKA 2I55A 5DHFA 5TT1A 3STTA 3R0XA 3ECAA 2KZZA 4OHPA 1XF1A 3V3KA 1MVNA 3EZ7A 1J24A 4L78A 2GDZA 3DZKA 4DB4A 5KFSA 9ICTA 2ZJ5A 1TKBA 2X8WA 2X6RA 3O4GA 4M0CA 4HN4B 2GPNA 3LX6A 4FIDA 5AXDA 2LM4A 1PP4A 2OBBA 5KFOA 1CUCA 1Z4IA 2WD9A 3D59A 1LVHA 4PYRA 4ECQA 1WHTA 3PUXA 4JLWA 4M0MA 3O9ZA 3W2HA 4EHJA 5C53B 2GCIA 3N2GA 4KE7A 5KX5F 2NMVA 4G89A 3MGBA 4IUYA 1VI6A 4RC9A 4DR4B 2F3NA 2GEDA 2GD0A 3AV3A 3UXHA 1BCRB 1WWUA 3OX4A 4LS3A 5A6SA 3U26A 3TEMA 3R7LA 5CX1A 1BPEA 3KYDB 2PAFA 5JC8A 3TLJA 1WABA 2QUJA 4QJ3A 2BCGY 4L02A 1PWZA 4JT2A 1HT2E 2ZVJA 3RYFA 1B1CA 4CR6A 1P2BA 1XDBA 1NP6A 1XTPA 3CUVA 4BX8A 2HCRA 2QRQA 4MFCA 3K09C 1V7PC 1V16B 4YRNA 1T2DA 2W8BB 4NDNE 3BXXA 1G7TA 1J2NA 1EQAA 1ZQHA 3LP5A 3TAXA 3QKWA 1BRMA 2JH7A 5AM1A 1DADA 1K88A 1HT3A 1XDUA 1JJ7A 3KAPA 3LCCA 4IL5A 3VVLA 4QL3A 2OMKA 3IIJA 2ZW9A 4NL9C 5IJ9A 5C8YF 1US8A 1MA3A 1OXJA 4LYGA 4CGYA 4RXMA 5BMVA 2RHLA 5M7EA 3KPWA 4GVLA 1UT6A 1EH5A 2G5PA 3QYFA 5I7WA 4ZI7F 3T5AA 4PRLA 2N75A 5TSDA 4RPYA 4G26A 1RRCA 5BR4A 1VJ0A 2QT1A 2XITA 4MQ4A 2FEKA 1P44A 4IX1A 4WJZA 1B8NA 2OBYA 3RV3A 3SYMA 2WG1A 3KB6A 3VH3A 1HNWB 2XCUA 3KU4A 3ICOA 3UJNA 1WZIA 2GDJA 1DC4A 3IQDB 3NUGA 4US1R 4EFNA 2Y0SF 4PCUA 3RC2A 4MW4A 3CRVA 3R4VA 2AG5A 4Q03A 4TQSA 4L7QA 4LEIA 4IH9A 3V7NA 2OYCA 1JFFB 1Z2AA 2W7TA 3ANTA 4ANFA 2VA8A 2WF7A 5L1JA 2WUWE 1IATA 4IOJA 5C8ZA 3OIGA 1GUAA 3SM9A 4BB0A 5IT5A 1G5RA 3R9WA 4PHGA 3WGOA 1AS0A 1SUIA 1VRCA 1XTVA 2C07A 3E5NA 4P83A 1FC0A 4D82A 3MC1A 1DP4A 3SR0A 4WFQA 1LGYA 1TAHA 3FCXA 4Z6DA 2AMJA 4RJKA 1P29A 4TS4A 3AU8A 1UPBA 2AHOA 4R0NA 1J0AA 2JFFA 2RGCA 1IIRA 3AGPA 3LUPA 3BJZA 4P33A 3W3AH 4GDFA 2F00A 1JEQB 1DEXA 2XSZD 1DXQA 2YWXA 3EXEA 5LQUA 1EK6A 2VWPA 4I2DA 1VP9A 1I33A 2WV9A 4RLHA 3UJ7A 3F5QA 1SU7A 2XUFA 2NVBA 3E3AA 2FHSA 2GZRA 3NYIA 1G6HA 3N87A 1M6EX 4BIIA 8ATCA 4REOA 4H4EA 4MR7B 4ETNA 4L75A 5LP6B 4GLXA 4A1FA 3RR7A 1B8PA 1G98A 4LZDA 4QLAA 3PW7A 4P92A 4PY2A 2CCGA 4GM0A 4LX8A 1KTVA 4OYLA 5AVKA 3ND9A 2R5WA 3JD1A 1HDRA 3L8ZA 5KJCA 4KDRA 2XJ4A 3SC2B 3KKPA 5JCOC 2WTFA 3M6KA 2LYBA 1EHYA 4JJZA 2QTAA 4DT1A 2QVXX 1YC5A 5HRUA 1L1RA 4ZEVA 3NWBA 2DLDA 4P53A 3AKZA 4DQLA 2JIOA 5B2EA 2WABA 4QDKA 5DLFA 4LJ9A 2OCKA 3RK1A 3TOSA 5ENVA 4GKJB 1EDOA 2ASEA 1D1TA 4EY4A 1OR8A 1C9KA 2I7XA 5EJAA 3UGTA 4NU0A 2GZ1A 4F3NA 3R7BA 5LNK1 1JDVA 4QWDA 1TQ6A 1U3WA 2OLJA 4MRVA 4P7KA 2P11A 3WDKA 2JIZD 4JXXA 3DKKA 4EG0A 2Q49A 1O5IA 4GRIA 2R44A 2QL9A 5L53A 1JDBB 2J9YB 4RZ3A 4YRPA 4F04A 3KRTA 3H5RA 4GD3Q 4OGGA 5JFGA 5FYQA 5COAA 4NCKA 4O1IA 4NBSA 4ZQBA 4KXUA 4MW6A 3Q8LA 1L5LA 2RP5A 1G9XA 3EH2A 4AIIA 3Q5GA 2FWNA 2O3QA 1DRJA 2VP9A 3CVXA 2OXOA 1JX4A 1N6NA 5KFVA 1LV8A 2O5RA 1QAOA 1ZQSA 1PO7A 3LVFO 5I8ZA 5CFOA 3FR8A 2IHUA 3WBFA 3WWEA 5HZKA 2DC1A 4O2AA 1X9GA 5EC8A 5HQTA 1GGHA 3A3KA 1FZQA 2QTHA 3L0ZA 1QGUB 4I2VA 3PKIA 3TNFA 3NORA 1GPDG 2GYUA 3MJ4A 4FKZA 4HWSA 3TL2A 3SWWA 4PLVA 1N5MA 1GSAA 3TR5A 5I4CA 5FTLA 4MQ5A 1BU5A 2GYVA 1OIWA 3E35A 1PZNA 4RZSA 1NMXA 4PAQA 4GPIB 2I7DA 4EJFA 1EDBA 4FYXA 1MH1A 4OAPA 1E7QA 2GK6A 5JRTA 2DGZA 5KFIA 2OSBA 5EWLA 3ZN2A 5JIBA 4I50B 2XUAA 8ICIA 4NLBA 4U5QA 1SIJA 4J7XA 1MC5A 3WQBA 3DEJA 3WXMA 3IE1A 1TJ3A 3BJYA 1N7IA 3FROA 4CF7A 4UD2A 2WJZB 5C8YB 1NSYA 4HAXA 3TZLA 2RGNC 3RTEA 3HP6A 1Q3KA 5F2OA 2FW8A 3GFVA 5HKOA 1JJFA 3BXGA 3L0IB 1H6AA 3SLRA 4FD3A 1G42A 3U7GA 1MCZA 1KZ4A 1N5IA 1Q7EA 5ITZB 4B4WA 3QBJA 1F4VA 3SE0A 5IJ0B 1GNRA 1NT2A 4LYEA 3AZOA 1PL6A 1Y7HA 1MQAA 3G2NA 4KO2S 2PXXA 3DNFA 1FP1D 1TYBE 3P9RA 4OTZA 2Z6AA 1ECGA 5KTRA 3DGFC 3TADA 1Z82A 1RI1A 2IHTA 3FPBA 2XUQA 3NRCA 4GPD1 4O25A 2YDYA 3KWFA 4HUJA 3ZH9B 4RSMA 1R88A 1I4EB 1YR9A 4B3TB 1CNFA 1T91A 4TYYA 2BT4A 4PPGA 3FAHA 3C85A 4Q66C 4EG1A 1GSHA 1NV8A 4DNPA 2G9UA 3MFQA 3K16A 2NVOA 4ZU3A 4IKPA 5KO2A 5ALVA 1QTRA 2DHDA 1NK4A 3QZ8A 8ICSA 1WMAA 1GGJA 2KOBA 3UMYA 3E7WA 2BEKA 3MFIA 2H9YA 3X2EA 1NOKA 1UIRA 1W9HA 2R2AA 2QE6A 1W88B 2JDID 3R3VA 3H3FA 4FNMA 4JBNA 1EVZA 4JYCA 4KWTA 4JUFA 4WXHA 1KQNA 4AYTA 2HFKA 2DFDA 4XUDA 3SXUB 3M6AA 3BQNB 3H1AA 5JAUA 1NK7A 3QOWA 1ZGJA 1MB4A 3ZTWA 1DG1G 1XNQB 4KLLA 2PFOA 3ZHVA 4D6YA 5SZJA 3M9NB 4YMTA 2ZIZA 4HNGA 4YAIA 3PXGA 4BCCA 3FSGA 4Q47A 1MO4A 5HHHA 3M8SA 1DTWB 2AFHB 4IXWA 4X0EA 5HEKA 3PHLA 4PZLA 3HNOA 4RDHA 2CDAA 3ML1A 1HSZA 1YQQA 3OY7A 3RYHB 2E1RA 2NUAB 4L3OA 1FFDA 1RDFA 2P91A 3E84A 1O87A 2QD3A 3W2IA 1V8ZA 2HJHA 2JANA 2B1JA 2BFFA 2ODWA 1BFUA 1Q57A 4NMMA 5CIWA 4BCBA 3MLBA 4EPTA 2BKEA 5IASA 1VL5A 3HGQA 1UDAA 2R8XA 1N5DA 1XEWX 2EAOA 2D2EA 2VUIB 2QE7D 2HA6A 1V39A 3EF3A 1E2JA 1IQRA 3EXIA 2BFPA 2HNKA 4GR5A 3S28A 3UWSA 1FF9A 1GNPA 5EIBD 2AH5A 2X4DA 2YCBA 3DDCA 1KJWA 2HLHA 3PO5A 2NYAA 3JS5A 3K0KA 1UOOA 5KIAA 2ZYHA 4YAEA 3HB4X 4BN5A 2YBEA 4J0GA 2GILA 1NI4A 4J0EA 2YASA 4O4LB 4ICAA 1H4VB 1NUHA 3IDAA 3O84A 3N5KA 5KOYA 2VF8A 5IH7A 1L3CA 3EF0A 5J2HA 1QC5A 4JV5B 4ZV9A 4BEVA 2TYSB 3TBKA 4QDUA 3ZWOA 1PYOA 2GN8A 3K0BA 4P98A 4UHFA 4DR6B 3TS1A 4I2EA 3SP1A 4U2FA 5JALA 1T13A 3GN2A 4IQGA 4DSOA 2JBHA 1ZGHA 4CG2A 3F4LA 1Z73A 4M8SA 1HLGA 5F4BA 5DM60 3OEED 4HNAA 4NPHA 5D00A 4P31A 2F44A 4UQOA 3UW1A 5L3RA 5CFPA 4RIHA 1MC8A 1RRKA 4MPDA 2DUNA 1EHCA 1VBNA 4FDMA 2NZUG 2Q0QA 1ZQ9A 1NJYA 3ZCPA 1AUXA 1NT4A 4WOJA 3JAKB 2VRBA 3MT8A 3Q10A 4OHXA 4AY2A 1AS3A 5E9AA 2Q27A 3F5EA 1L4YA 1CIVA 1DPFA 1QE0A 2IS2A 1JLMA 2JRLA 1YDEA 1EFHA 2XMCA 2YNMD 1XQ1A 3ZD8A 5K3EA 4AG6A 5DCYA 1G2IA 2EERA 2JI8A 3CCFA 4DWOA 3MB5A 2IYVA 5J0SA 2PKWA 4HXFB 3NNSA 2C83A 4Z99A 2IOHA 1ZK1A 2PRKA 3JR7A 2QARA 5IC4A 1SKUA 5K0LA 4D6PA 1ZU4A 3FUTA 1PZEA 5G41A 3CEPB 4EFMA 2RK6A 1MNAA 2WV7A 1HFJA 3E61A 4J3NA 1U6JA 3GC6A 1R0CA 2M9NA 1NJZA 1HTBA 1DRUA 3TW0A 3CURA 4G0QA 3OZRA 3WRVA 2XMQA 1ZBDA 4EELA 1X80A 3PQ3A 4EDFA 5A0VA 2X7HA 4RPIA 4UUOA 5TV2A 5AVSA 4XD7D 2FPMA 2WWFA 4JSTA 1EE9A 4NXZA 1FMJA 4RCYA 4IH4A 1YSCA 4UXJA 3SBOA 3VNVA 3LYAA 4CYMA 3EPGA 4B6EA 2GA9A 2XNCA 3DTVD 1DT5A 3F47A 3MFYA 4WBXC 4WUVA 4FHCA 3TL3A 3TX6A 3IHKA 4NPAA 1E92A 1AO0A 4PXSA 1TLLA 2P3QA 2IS4A 5IKPA 1Y4ZA 4AY4A 2A86A 3OPXA 1U94A 2I2DA 5ALWA 2PSEA 3LI2A 4RPKA 2JI6A 5ECGC 3SG0A 3ERCA 2F43B 3CH5A 3T9DA 1HQKA 5DQIA 2HLPA 3DLPX 1NVBA 3EVEA 1U0SY 3N0XA 1GEGA 1XDZA 3EWIA 3OOHA 1E18A 3ICWA 4O33A 4IMJB 4M0LA 4I2BA 1OD6A 4G2NA 4K8OA 1EBBA 4DY6A 2V1UA 4LE0A 1A5SB 1IZ8A 1FUEA 1NYLA 4ENRA 1T94A 1ZKMA 4NMHA 5EIEA 3SLKA 5G0VA 5HBRA 5M29A 3EVBA 4D3XA 1IPEA 5HKKD 3PE4A 4YQWA 3ZEAA 4RK6A 1TO6A 2FN4A 3A06A 4IOKA 2K89A 1C8LA 2JL1A 3RC7A 2ZBVA 3K0AB 3ZUGA 4EPXA 4JEIA 4GPBA 4LKRA 5AUNB 2W4QA 1U3TA 2UKDA 3N8DA 4TS9A 4WW0A 2V9ZA 5BMVB 1QBGA 4PHTA 1XZQA 4ZT3A 1EKXA 2YS6A 3E18A 3HPQA 3NJ8A 1KH2A 3GY0A 3LQKA 3TGLA 1L5YA 8ICCA 1GUBA 1TEVA 1OC2A 1PQUA 1UBHS 2A30A 2FR8C 1Y5IA 1ULSA 2IYQA 3NHFA 1P6XA 4N3AA 3OJOA 2OHVA 4NV1A 1EVKA 2RCYA 2ZP1A 2QP9X 2QRKA 3GX1A 1ZISA 5FBQB 3X1WA 2P6NA 1KQGA 5DP1A 1XRQA 4HDNB 2IE8A 4QQRA 5A62A 1QIHA 4WFIA 3IP3A 4ZMBA 5DTQA 2AG1A 3K70C 4MRSA 3OTWA 4RXTA 3C3WA 2QWXA 4H6XA 3TXYA 4EG6A 3HL0A 5H80A 1C8VB 1ADJA 1WPRA 3HILA 1YMVA 3SQWA 1M72A 3WIDA 5AOCA 3V9PA 2QJFA 3GYBA 4C6RA 1LBSA 2R1VA 5JI2E 1P4HA 1WCLA 5ANRB 2ZSDA 3CSSA 1YB5A 1RWPA 4F71A 4FMCF 4K6MA 3BCRA 3RBAA 2F59A 3JQ9A 2LBPA 4P2BA 9ICEA 1AZSC 2ZQYA 3FB4A 4HEJA 5BOVA 2Q5CA 1K68A 1NBME 2VHUA 2VK1A 3PIRA 4G97A 4OJ5A 1LQUA 2WPNA 1GGKA 3GJSA 4LHSA 4AJ2A 2WF5A 2YIDA 2JFOA 1KRHA 1FFXA 1Z5PA 2CNWD 2RJNA 3BMQB 4NG5A 5HUHA 1KRXA 2Z6QA 5C18A 4KLFA 2XOKD 2Y67A 4U0KA 4Q43A 2ZIUB 4HVCA 3ZWVA 1P1IA 2E8NA 1IXRC 1B26A 1VXOA 2BZ0A 2DWQA 2RQ5A 1H8HA 1CV2A 2ERXA 1J2YA 4OHFA 5KFQA 4JV1A 3K96A 4JFAA 4K9RA 5UKDA 4ZOBA 5HQ3B 2BI7A 1TA4A 5K3SA 4GM1A 5B5EU 2UVDA 2HMSA 4MW2A 4XWGA 4TM7A 3OU6A 4LZPA 2IUUA 1QANA 3AEUA 4DR2B 1DIOB 4IINA 4IF4A 1ZYQA 4FE3A 1ISIA 3BZCA 3B13B 4FYMA 3SYRA 9ICLA 3GPBA 1O03A 4A26A 2HR1A 1FDTA 1HNNA 3FDIA 1E1RA 4IVPA 4PU0A 3MD9A 1KR2A 4Q18A 3REFA 5EGSA 4MYRA 2HMYB 3F4BA 4ED6A 5JPIA 3I5UA 1GL7A 3N2NA 1VBFA 3FRJA 4J0KA 3BMOA 4TLAA 4Y98A 5B1SA 4N0DA 4NESA 3AVYA 3NIBA 3BD7A 1CQXA 4S35A 3L79A 3ESDA 3GGCA 3RTAA 5AVRA 2R48A 3KQLA 1I6LA 1ZQAA 1QIJA 4LBWA 4NYMR 4YWJA 3E9CA 3MMPA 4ZXPA 2YJ3A 3HDJA 3VH2A 1Y7PA 4RQ4A 1KI9A 3E3OA 4RPZA 1GG2A 2B3TA 2R3SA 2ZDHA 3GBSA 4HFJA 2FPLA 4IDDA 5IYZF 3GA5A 1JSRA 2DPLA 2NO9A 2XA1A 3JQBA 4AF8A 3CR8A 1M8PA 4QWMA 3GZJA 3OPVA 2EZZA 4DOCA 1PGNA 3GP3A 3K8YA 2HSGA 1HYGA 4LSZA 3FHLA 5JI3E 1D4FA 3OHAA 3ASZA 1MAAA 4JP3A 2M6SA 4C22A 3PNLA 1K5PA 2HD4A 2GM9A 3C43A 1G8KA 3VPDA 2XI4A 2O5EA 2AZ4A 3HR8A 5IVIA 3V7WA 3RYCB 4NBVA 4ILKA 3RFAA 5C0OE 3FHCB 1V8PA 3OICA 1QGUA 1O0BA 5NLLA 2BGUA 5AM5A 2XUGA 3A6FA 3MQFA 4F93B 5SZHB 5JZOA 3EPLA 5DHAA 1AU9A 1V45E 1LSUA 2KB0A 2XLCA 5IUKC 3ZNNA 1GYPA 5AVJA 2IEBA 2G5HB 4U7GA 1MPTA 5ECYA 3N6VA 2NU6B 4M1MA 1JLLA 1Q1ZA 4MOWA 2PZLA 2J5RA 1P6QA 2I03A 4A91A 2AW3A 4M0PA 1E77A 3MHTA 4MMZB 4KRFA 4ZDKA 4DF8A 4YBRA 2C2YA 5B1EA 4U4AA 2C3PA 4HYKA 2AQKA 4A8HA 3IPAA 4OHZA 5BOLA 3H6KA 2A7QA 2GNPA 2JVJA 2PBRA 2Q4EA 3EFHA 2JAOA 2Q9UA 3NRWA 2W2MA 2ATLA 3OU2A 4TKUA 4CUZA 3OQMA 3KBBA 1CT9A 1QCYA 3GZ4A 4HTFB 1ULAA 4XQEA 4J0IA 5DJ5A 2IY8A 3TDKA 3EGXB 4LDNA 2DLCX 3GPCA 1RJ9B 2H4YA 3JPPA 3B52X 3OCYA 2JIBA 2WT9A 1W8IA 1N5JA 3E0QA 4WLNA 4YCAA 5DX1A 5TT0A 4PRYA 2XICA 2J9ZB 2QBYA 5CJ7A 4NFSA 1XSLA 4QUHA 3RTBA 1U31A 3LLVA 1NVTA 1THGA 5DNUA 4XFDA 4ND8A 3DFKA 1UC9A 3RQSA 2CYBA 3DEYX 4E51A 5JNWA 1C30B 2W6OA 4BVFA 4E15A 2PX8A 5CDTA 3UW3A 2QTGA 5LYJB 4P3YA 3IOCA 1N2CE 1PNVA 1YR3A 3OEWA 3P0FA 3ABIA 1L5HA 1MSWD 3NVMB 4ZCSA 2WU4A 4RF4A 1XCMA 1NZJA 3DWEX 1EFVB 4UD6A 3HPRA 1OWNA 3CW9A 1W46A 2BGRA 1T26A 1ZEJA 2D1QA 3PSAA 3T52A 2XRYA 4PONA 4CEHB 1KTQA 4GECA 4NI5A 5FTWA 3K75D 3FC4A 2AXTU 3NVKI 2VJNA 2G06A 5AW3A 4Q7JB 4I5GA 2PGIA 4PSUA 1V16A 1XEAA 1XL0A 2X9QA 2J5XA 5AIAA 2RAPA 1R9MA 2KK0A 1NVAA 1IRIA 2VJQA 2VC2B 4CCYA 5KQRA 1T1EA 3ZZ1A 1LKYA 2OV1A 5SYMA 4MUIA 3H9GA 1YOVA 2UZ0A 4YJHB 4DA6A 4EZIA 3LUCA 4JQCA 1JQAA 2GEBA 4OI4A 3M5CA 2FKNA 2I8CA 521PA 1VM6A 2P9GA 3M4NA 4IS2A 5FPSA 2QTLA 2TMGA 3HA7A 1EEXB 3FUWA 4CEHA 2GZSA 1J2UA 4MUMA 5C81A 2F1OA 4KO8A 1NM5A 2A4KA 1EESA 2KSOA 1GNVA 2QM0A 3PSIA 4UARA 1N9GA 2Z2KA 1O6FA 2Q5LA 3ND5A 3NNDA 4JJ4A 4KXFB 4OU5A 3SOPA 3V7YA 4F2WA 4V0ME 4IIHA 4C0QC 1QQ6A 5KL8B 2OFWA 4GZ3A 1WTAA 3E1GA 3NDPA 3KHLA 2CDRA 3SEQA 3V1LA 4Y18A 2O20A 4Q44A 4BNUA 2CZCA 1MENA 4D4GA 5LMZA 3DBLB 4EEKA 2GX6A 1WF6A 2R4QA 4MS3A 4ZPJA 5E2BA 1RI5A 4L51A 821PA 4MA5A 2AHRA 4LWZA 5L40A 3H6GA 4FI3C 4JA0A 4BQNA 4CMKA 3DHEA 3N2KA 1BAPA 4JJ7A 2XOKA 3A2MA 3OZDA 3UY4A 4D57A 3OJSA 3K5IA 3P1JA 4GLFA 5AHXA 2GEUA 4BDPA 3NIFB 1JFRA 5FR1A 3W8RA 3A4YA 4WY8A 4HNRA 2H07A 3VCBA 2A0UA 2IW3A 2JGDA 3ZHZA 5K2OA 1ISHA 3RASA 1X6VA 2P9EA 3DTYA 1BDJA 4TMTA 3BJEA 2IUSA 4GRDA 3CIFA 2VJ5A 3BTOA 1KXJA 5TRTA 4TUPA 5LUBA 3LLCA 1V0JA 1ZJMA 1U81A 2VZ0A 3H5WA 2RE8A 2D6FA 5AVOA 4DLTA 3WGKA 1GPUA 1KW4A 1NMEA 1X1DA 3RBEA 4RNDB 1Q83A 4JASB 3K9CA 3V4FA 1D09A 3HJGA 2HWYA 1P2UA 1RD4A 5TDHA 3RUHA 4IRMA 1ZOPA 3TL6A 3T38A 2NX2A 2ZPUA 3ADPA 4QU9A 3ZZUA 4DDVA 1T4GA 3V1MA 4CKWA 1YB1A 3SJUA 3NWPA 5IU6A 3WLFA 3WAJA 3IIIA 1BDMA 5HQJA 4FN4A 2I6XA 3N7PD 3SVZA 2IX3A 3L2OB 2IXFA 4ACBA 1RSZA 2DCMA 4N7MA 3VZRA 1UBNA 5E95A 2EBUA 2JGKA 2ROQA 3AOEC 4IJMA 2AQ8A 3L7LA 4V39A 1ISGA 4W6ZA 3I45A 2EQBA 4ITRC 4CUJA 4HP8A 1UK8A 4ZQCB 4OJ6A 2YN0A 3EE6A 4BX9A 1E2NA 2FJ6A 3BB3A 4DQVA 1P1CA 2EFDB 3GFQA 4YEDA 3GJYA 4BNTA 4EB6A 4FX2A 1M2WA 1E7SA 5J23A 4KKXB 4IM7A 1NE2A 2INGX 1IN1A 1CI4A 3IT2A 3MLAA 1ZR4A 3C1UA 2ERCA 4YALA 5G4LA 4MPRA 3SIRA 4D3ZA 5E2IA 4YP9A 1TEZA 4F5DA 2FPUA 1P7PA 4O3NA 3C7CB 3AFGA 2C59A 4JL8A 4DLSA 1JEYA 5EJ8A 3EVGA 4FQ8A 4I1SA 4PZZA 3V80A 4C4XA 4U7HA 3ZGXA 1GTRA 2IE0A 3R9XB 5DGDA 5B58C 2C7OA 4ARIA 4CF3A 2QENA 2W2OA 3D8RA 1E5QA 1W5EA 3C5CA 4ZD6A 4RTSA 4JGIA 3AHFA 3S68A 1Y6GA 4QZ9A 1FP6A 1TXGA 2QAGA 1R50A 1XDWA 3NAQA 2QRPA 4QE3A 3ROEA 5JZ9A 1LJLA 1CLEA 4U6PA 1YCHA 4WLFA 3QPAA 1GZUA 5DSTA 5IILA 3FWPA 2G5IB 2DF8A 1EPUA 3T34A 1OBHA 1IOWA 4R7ZA 1XZGA 2B20A 2VDQB 3W5AA 2ORVA 4GO1A 1H1DA 4HQRA 4KBGA 4RD0A 1LLQA 3WLLA 3VDQA 1CEYA 1H1TA 4HH3C 1XAIA 2GAFA 3U9TA 5BR7A 4IXNA 3L82B 5AOAA 4C1NA 4ZGWA 5L4SA 5EEHA 1EWTA 1IE3A 2P4UA 3M6ZA 1VB5A 3AEYA 1RAIA 1GPNA 3ZWKA 2ATXA 2W6PA 2WPDA 5CU7A 5JHGB 5KYNA 1BXKA 1F12A 3S3TA 1YZYA 2C57A 3JAMA 4H16A 1P5RA 1H93A 4L4YA 4R69A 2HU7A 3MUOA 4GOXA 1S0NA 2JS7A 4EBDA 2KJQA 5TLSA 2YQ5A 4Z4QA 1ECBA 1LQTA 2Q6IA 3JARA 4RAOA 1I2AA 3KD3A 3DP9A 1QYWA 1V7CA 1XZCA 2AGQA 4KXQA 4C4ZA 4GOKA 1KNQA 1KZGB 4I4LA 9ICVA 1DMSA 2H2DA 2QYSA 1PTKA 3AI2A 4KUHA 5EP4A 2C9MA 2REXB 3EY4A 3LXMA 3WO1A 1RYMA 4FCWA 4B4OA 2IZOA 2PL9A 2ZSJA 1K75A 4UW9A 3EEBA 2OXCA 3HYRA 4DMMA 1DGQA 4HAZA 4XWAA 3U62A 4YC7A 2Y8EA 1DLIA 3FB1A 1F7VA 5HS4A 2FWRA 4RHEA 4UUQA 9ICRA 2QLMA 2XCLA 4AN0A 3LC1O 5DBAA 2Y9PB 1GARA 1VPWA 2DWCA 1IWBB 3NDJA 1DTSA 4EITA 2IYZA 2SECE 2BSAA 1F8FA 2H1HA 4LJKA 1VLQA 1TVCA 1COZA 4IRKA 3UNXA 4A15A 1RM3A 3WK6A 2H3HA 2BKVA 3O8OA 5DBBA 3DLAA 2C9ZA 3B1JA 3IEMA 5CFMA 3GXOA 3IUMA 1K6MA 1IBLB 4MXDA 4E5SA 3ITDA 3RK0A 4ZYVA 2Q3EA 2ZRKA 2QPLA 1DJNA 3FTDA 3HDYA 3TK1A 4LVSA 3HBNA 2IOFK 5DDYA 4WESA 1UC8A 4KGDA 4XFJA 1D2GA 4Q34A 4LI0A 1X7HA 2DCUA 2EVWX 9ICHA 3V00A 1T1SA 4MWGA 4YHBA 3UUWA 4Q19A 2OQVA 3FVRA 3S2IA 2UVRA 1SBTA 4BLRA 5BN3B 5FWNA 1JIUA 4RW0A 1M2OB 2BTQB 3RRGA 1CW2B 1K8RA 2PPLA 3G9ZA 3R0QA 4JUCA 4AJJA 8ICTA 3D1VA 1IU9A 1SKYB 1AZLA 1ITZA 1XMVA 2W6CX 4HC4A 3SZMA 3ZWNA 5JSZA 4KHPB 3F3MA 5KVSA 2BJHA 3QJ5A 5KNCA 1RZTA 3KZOA 3F1KA 1DAKA 1FNNA 1IMJA 2JGDB 1JIIA 4BVBA 1J21A 1JHMA 1Y9AA 2B7LA 3L6OO 4H3HB 4XJVA 1KMMA 3SZGA 4J9NA 2I9PA 4U02A 1JIXA 2HBRA 5DDMA 4C07A 1A8IA 5CNJA 3WRYC 2GCOB 2NZYA 4M8KA 2I6SA 4EWLA 2VIXA 5LD2C 2H51A 1JL3A 2JEGA 1E2MA 3Q3IA 1FFCA 1QFJA 4C43A 4AROA 2A0WA 2LNDA 4FSDA 3RRZA 4Y0NA 4OCZA 3GLUA 3JAWA 2R8JA 1IVNA 2A59A 1Z45A 4DAEA 1VCHA 1H9AA 3GLHA 2ZXUA 2BYTA 2D7DA 4B3RB 5BMOA 1KE2A 3UK2A 3L7CA 1UODA 3QWHA 2BTEA 4V1CA 2JLVA 2E2WA 1VMDA 1RM6C 2ZCUA 2VQDA 5CHYA 1WL8A 2V58A 1Q0SA 3A1SA 3WLIA 4P2HA 4MGKR 5LOVF 4RULA 3K1TA 5FV4A 2Q2NA 2XNDD 4RK0A 4J9KA 2AN1A 2G71A 1JFLA 1O96A 1J0DA 3F8SA 3IT0A 3UG6A 4FD2A 4KNYA 1K7FB 4NK5A 4N8EA 2G6TA 3HUTA 4NLZA 5D5QA 1AKWA 1YJ5A 4CQMD 1RVV1 3CLTC 1M1YE 4DOAA 3MWKA 3WA7A 1YZUA 1V3QE 5BSHA 1J0BA 3IAUA 4IDBA 5JAZA 4CDMA 4YMUA 2PA0A 1XSEA 4FBMA 4HKTA 2ACEA 1HA3A 4K4GA 1NA5A 4UNIA 2J67A 5AVTA 3AIMA 3PENA 1Q0HA 2FPOA 2BEWA 4FFWA 3VUEA 3W5BA 1U47A 1Y98A 4C3ZA 4TLMB 2DJ5A 5DULA 2IQIA 4OL0A 2DUYA 2X3YA 1RC0A 1P7CA 1ZH6A 3EQ7A 1CRQA 4EQZA 5CAEA 4DUGA 5E8RA 3NHZA 2CC2A 2UVWA 3KJZA 5AT1A 1EK2A 3L5OA 3QVKA 2Q1TA 4DEYA 4BNLA 1Z1BA 1OJ7A 3UHJA 3W2EA 3HKDA 4BJ5A 5ABPA 3FRIA 1QUFA 3NTOA 4OK3A 4DSNA 5KOJA 2X14A 3OUTA 4KVFA 5C5EA 1NNLA 4TMZA 1KIAA 5JEEA 1BA2A 2ZXFA 3OO1A 1Z0IA 3VOBA 3MGCA 4NF2A 3MJDA 4OI1A 1UP7A 1SNYA 1U0LA 4HQKA 3T5TA 1QZXA 1WXFA 2JH1A 5DKWA 4IQFA 1I6WA 2QRNA 2ZJOA 4E0DA 5EE5B 3PLNA 3GMDA 2NV2B 3R6DA 3DZHA 3TXXA 2B1QA 4WDQA 4CF6A 2OBNA 2YHIB 4UNSA 1BZYA 2V6GA 2X9NA 1A7UA 2ZWPA 1V7ZA 1A2QA 2JGJA 1P0MA 5EWMB 4PTLA 1T9HA 4QDTA 5GGYA 2JIRA 1J5PA 1NUQA 2QX4A 4K88A 3WOHA 1KPGA 2D1FA 2WD7A 5FPQA 4YFYA 3U3DA 1RZUA 1KDPA 3A9UA 5CYGA 2WVHA 3C2KA 4DQSA 2XB6A 2UVUA 1LRLA 2J0UB 3I30X 2PTGA 1K63A 2B4KA 4D56A 5K03A 1BIFA 1KBUA 1YBMA 2PKQP 2QT0A 2HHJA 1B7GO 3HCBA 4EYHB 1DFHA 8ICLA 1FS6A 4QTUB 3VZBA 2DULA 3YASA 3T7TA 5A06A 4IP0A 4HRAA 1SKQA 2G83A 4CVNA 1ULHA 4C9BA 1UBSB 2BZGA 1OWMA 2HDHA 2VUTA 4HH4A 2YJZA 3UXPA 2DFLA 2VHCA 3GK3A 4JDUA 3ZVKA 2C4HA 4WCVA 3A9TA 5FBZA 3HB0A 2DKNA 3C3AA 3RTDA 1CKEA 2DECA 2PR2A 3EDMA 3P96A 5EQFA 4WA8A 1TI7A 3HLYA 2YH2A 3SIXA 4X61A 4RU9A 5CHGA 3G6KA 4MKIA 3PR1A 1I2BA 4YECA 3OJLA 4I2NA 4OHOA 4PRKA 4EEXA 5B37A 3A32A 1TT5B 1JEJA 2H92A 4O63O 3S7ZA 5DX8A 3UMFA 3VPSA 4DIOA 1JR3A 4YQFA 2V1XA 3W5UA 5K0GA 1US8B 1KJJA 3KOOA 1YV9A 1QFYA 3DONA 3EXFA 4K6GA 4AICA 4F4HA 3D1JA 4RDCA 1NAIA 1HMYA 4B2IA 2G76A 4L9AA 1KYXA 2AN5A 3FOAA 1ORTA 3I2IA 1LTKA 1M1ZA 1ZM2A 2YWCA 4WKCA 2FI1A 3F5SA 1PJAA 1KR5A 2HF7A 3QPBA 4FS1A 1V4VA 2X9LA 1Y34E 2XUOA 4KGZA 3GFTA 4R2KA 4US2R 3C5VA 1FA9A 1KYIA 1RMQA 2EIXA 4IV0A 2A1JB 1BXGA 3AY0A 5HUJA 3H9BA 1A8UA 2I80A 2P67A 3ANXA 2H1FA 1KYWA 1P60A 1VCOA 5DSXA 5FOUA 5BN5B 4DSAA 1ZC3A 1BS9A 3ND8A 1OA1A 3OIDA 1JNXX 3ACBA 4HX5A 1S7CA 1Q3UA 2P5YA 1Y7TA 5CA1B 2D2FA 3ESXA 1D7OA 3O75A 4QAJA 1XZEA 1E61A 1S0UA 4DFDA 1TIPA 2H4JA 1PR1A 2JC3A 4A8PA 4F7DA 3WJ7A 3DQQA 3CNNA 3HFRA 1X1CA 2QG4A 1TMGE 4MH0R 4PLCA 3GZTB 3GVIA 4DN6A 2LVBA 5JH7A 5KQSA 4IDHA 4CQMA 3I5YA 1HRKA 2V3WA 4J1NA 4X64B 3E0FA 3PRJA 3OZEA 4L3WA 1WP4A 3W7AA 1R6BX 1PI3A 1X3LA 2O3TA 3BQ1A 3IAFA 1ECWA 4PG4A 2O59A 1ZQOA 4AUEA 4PTYA 3AL0C 1X8XA 5ICSA 5BQPA 1RYUA 1C7JA 1UBCA 2ZJ1A 1EUDA 4AKEA 4OEHA 1KJYA 4EYKA 1Q14A 1EWQA 4G1UC 1DO2A 3T3HA 1GGFA 1F8YA 3RAFC 2PRZA 4HYTA 3H4BA 1QPZA 4LFAB 5FFNA 4LFBB 1LDEA 4F97A 1IH8A 2CXTA 4O0MA 3E81A 3GRAA 3OPYI 4HB3A 3FOBA 3W90A 1KE1A 5EMLA 3C6XA 3SFZA 4CKXA 2QX6A 4ZVPA 1V2GA 2F8MA 2IODA 2LR0A 1WCYA 3HNPA 2NTYC 5HBGA 1RJGA 2CLCX 1VKOA 4TOIA 2QTCA 1EUQA 3SAJA 2VJYA 1KJQA 1L7PA 2CMDA 4B3SB 4JUIA 4MVJH 4H18A 1Y9DA 2B9VA 3IVGA 3AERB 4YQEA 3PJFA 3DHVA 4EATA 3AP2A 3SS9X 1RXUA 2B30A 3FUVA 2BH2A 1SXHA 1ZCZA 4HB2A 5LD2B 2R47A 2GH1A 4ESHA 3UAGA 1ORRA 1BQ4A 3CRW1 4PXYA 1W6RA 4MMXB 4M2LA 4LWQA 1AN9A 1TYAE 1XZAA 4J1QA 4JFRA 2BM8A 3FPSA 4IQVA 1T5OA 5THQA 3S8MA 2GS9A 1AXGA 3K0FB 1TTPB 2C3MA 3R4CA 4ROSA 2SICE 2XO7A 3ZCXA 1DQZA 2E55A 2QMHA 3CSDA 2B2CA 7ICGA 4RJJA 3QU7A 1NMSA 5BV2P 4RJIA 1T5LA 1NGSA 3HJBA 3LY8A 3NW9A 4OYYA 5B5SA 4YVZA 3MFHA 1XXLA 3ISVA 1NPYA 3PJDA 4EZ6A 3AERA 2PANA 2UUBB 5AI4A 5KFTA 4QRIA 3IO5A 1YZNA 4FCCA 4ZYYA 4NFLA 5A1JA 3CT4A 3GGGA 4IAOA 2AX3A 3EIQA 3GFOA 1X8KA 5AICA 3VAAA 3CRRA 4O2BA 4RZUA 1XTIA 2X1HA 2XTAA 2ZUDA 4UTVA 3CZ9A 5FRDA 4RVNA 5K4LA 2ST1A 2VHJA 3NIDB 3P9QA 3K1AB 4XR9A 5IBRA 4K1LA 4B4VA 4DLGA 3A14A 1T8RA 1R0ZA 3BUSA 2YYAA 3LYHA 4TWJA 5IN5A 4BP1A 1PWXA 3T5DA 3TLYA 4ESOA 1G8MA 4OB8A 4RACA 5EVCA 1PF7E 3NBMA 3V6JA 2VJCA 4KLJA 3SC6A 1XRSB 1JP7A 1CTQA 2JFXA 4YJ3A 1SPXA 4D3SA 1C30A 1R18A 4ZJYA 2LV8A 3NDIA 3A6JA 1ZXXA 2VZ8A 3IBYA 1QH1B 5ADHA 2Z6VA 1TM5E 1QIFA 2GFQA 2IT1A 3OFND 5TQJA 5EFZA 5JCXA 4UULA 2NUPB 3L6CA 3EA5A 3BE8A 3O92A 4WKOA 3HBLA 1FDOA 1T1RA 1H5QA 3W7VA 4DM4A 4DC1A 2R97A 2RHMA 3UWDA 1RYDA 6AT1A 4DSTA 4G1MB 2M98A 3FJ1A 1AQIA 2DT8A 1X1QA 1N5XA 3P7MA 4Q3LA 4WL0A 5C2JB 5IMSA 4ZZ1A 4AQDA 4F84A 3CEJA 5KVQA 2ZKIA 3A0UA 1HE2A 5P8WA 1G2PA 3L7DA 4M0UA 1TGYA 4WNAA 4A8JC 1G2OA 2FRDA 4M4SA 2WPDD 1Z5OA 4MV9A 4MV7A 2NZXA 4BHTA 1OLUA 2RHOA 3ESYA 1EX1A 3L1KA 1HBJA 1CD5A 2GBFA 3U4DA 3DOHA 2Y2UA 3MRXA 4CMEA 1V8FA 2FVXA 2QZZA 2WT8A 3MS2A 5HCIA 5JFOA 5AVUA 1O94A 1NL3A 4KSCA 1BXRA 3ESBA 1W7AA 1GNLA 3CONA 2YZGA 3JSAA 3L8FA 3H4VA 5F33A 3VR1A 5H59A 3DAFA 3PFIA 1PR6A 3QXXA 1C3OA 5EZYA 1F3OA 1HL7A 3OCUA 3ZZTA 4EPRA 3DNMA 2C7VA 2AJCA 1S2OA 1RKQA 1W0KA 4K8RB 2KS6A 1NZPA 2HMXA 3WNCA 3BRCA 3QLVA 3RG2A 4PQFA 2ZBGA 1JAXA 2X6TA 4E94A 4RQ5A 3PY8A 4DWIA 3FTCA 3PQ4A 4AY5A 2ZJZA 1OLUB 5JR3A 4NVRA 3PDWA 1KOGA 2IA6A 2ZUBA 1DOAA 1KSFX 1Z0DA 2Z2JA 2ZYAA 3RJZA 1VE6A 3RRMA 4BWVA 3ER9A 2J4FA 2Q3MA 4RDXA 1E1MA 5T4BA 1VSTA 1LCIA 3EMKA 3MD0A 1PFVA 4O3RA 1A04A 1YZFA 1E58A 2JFZA 3PQCA 3CO5A 4MIOA 4LZGA 3N2KB 2JNWA 3ENZA 4TUSA 1ZQJA 3ZHCA 1Q0PA 2PS0A 4MDHA 4MO2A 1K97A 2OCLA 3DWFA 3DJFA 3O4VA 2KPOA 4MVJI 4C4TA 4H31A 2ZB2A 1C3OB 3MSCA 4E21A 5IP5A 3MOIA 4UOZA 3KSBC 4CCYB 1YVUA 2AG0A 5JMPA 3S2EA 1II8A 3C6ZA 3FCUB 3UH1A 1ZNZA 3IA2A 1Q1NA 4GOOD 2PWPA 2CHQA 2DGDA 3OSUA 4HEA1 4EEZA 1PS8A 3HA3A 3HUEA 1WU8A 1TQDA 2R8IA 1LQ2A 2VP4A 3BE5A 3ALRA 1C2TA 4MQFB 4AS3A 1TLTA 4BX2A 3SK0A 2VHZA 4WI1A 4PIPA 5FOTA 4DEVA 4M8NE 2AMYA 3UKJA 4KN7A 2O0HA 5BN5A 2J4CA 3QPVA 4U3JA 2XQJA 4PHHA 3PNVA 3ZWAA 4COOA 1W36C 1OX6A 4RSRA 3ZVRA 4BU0A 4C7OA 2Y9UA 1YUNA 2EJBA 3CKKA 3NT2A 4I2AA 2POQX 5IZCC 3KQKA 1LDNA 3GLIA 3JYNA 1RW4A 3GIWA 5G3YA 1PWEA 5J0TA 1KA9H 1Z6PA 3JQPA 5LQJA 3R3UA 5IT4A 1T8YA 5BWBA 2Q5EA 4DILA 4E14A 1S2DA 1Y1TA 4KTQA 3H0CA 5ALQA 3C2MA 3COVA 3NAMA 4RM2A 1JLRA 1Y80A 3BD9A 3BG5A 3HWWA 5CAEB 3LUBA 3S55A 1B4FA 221PA 2D2VA 1F51E 1L4KA 1RKXA 3K0EA 4TXMA 1CUYA 5BQ3A 2D5CA 3AY6A 4B7UA 5C0YA 1DKLA 4AMGA 4KZPA 3M6UA 5FPTA 3RE1A 4WBNB 1G3QA 2FB9A 2P2DA 2PIAA 4ECEA 1N9KA 3F2VA 4JV2A 4F12A 4TTJA 1FLAA 1WB5A 5MN6A 1QR2A 1UC4B 2AEMA 3I42A 1EAMA 2ZJ6A 4V3BA 1OOEA 8ICEA 2W5UA 3OF2A 4CEIB 4X3CA 1W73A 1T3TA 3I0ZA 5DGCA 5DW0A 3FPCA 2ORWA 2QXYA 2C95A 4MVJF 1FDRA 4YRCA 4DWJA 4IIJB 2GZAA 1N7GA 5HXAA 5IWAB 1GSIA 2CVHA 1TIKA 3SDBA 5A3SA 4FFVA 2CMHA 4HVLA 1LC0A 1O96B 1R9GA 1TJ5A 1JB9A 1A76A 4N3CA 3DYBA 3I8XA 4R65A 2F62A 4WKNA 2OEHA 1BFDA 5GQSA 5ITWA 2FDRA 3H0LB 3QOYA 4TT3A 4LRQA 2K2WA 5IG2A 2AUMA 1R9NA 2N42A 4MEAA 3TN7A 1J23A 3B5JA 1X1TA 4HEA6 3CX7A 2V6BA 2GR9A 3HCWA 4MWCA 4RABA 1AKQA 4P5PA 5FQOA 4F5EA 4OHRA 3PR3A 4MMYB 1E1QA 3GP5A 4MEYA 5BW8A 5BSFA 4DR7B 4EABA 4KRYA 4TVSA 1XWIA 1NKCA 2C2ZA 2ZUVA 3T7AA 1AROP 4DB2A 5JUMA 1PT9A 3AFIA 4YCBA 3RUAA 2YX8A 1JPJA 1U4NA 3PGKA 4PWYA 5EZ6B 5KYXB 2V55B 4IR7A 5ITSA 3QU4A 4X1KB 2QZPA 1U7TA 3VKFA 7AT1A 1HUZA 1FYFA 3W6NA 4QNRA 4R9VA 4KFRA 4AP6A 4O2BB 2VZLA 3IQEA 5HKLA 4D8XA 3GF4A 2EWVA 5D3KA 1Q7RA 3KYCA 5CLFA 3Q7IA 5HF8A 3SEAA 3L4JA 3GMIA 3I62A 3WBKA 2IFTA 4J2HA 4GC9A 4OV6B 5KSPA 1Y1QA 1COWA 1N1GA 3QY0A 1F2TB 1JHYA 3EY9A 3PK0A 8ICQA 4QOJA 5LZ7A 2DAPA 2PQ0A 2OAEA 3D4NA 4BX0A 1SC6A 3GCGA 5TEVA 1NKEA 3ZUPA 1SZJG 2BF7A 2OILA 3ZW9A 4DBVO 1MQ8B 3GLSA 1XRJA 3HL4A 1CDZA 1PFGA 3IVAA 4CMEC 3UANA 2C8KA 3K7EA 3V6KA 2ISPA 3AT1A 2IL1A 1NJSA 3A6KA 2QXUA 4U9HS 2JGNA 2WTAA 3W3AA 4A0GA 1ZRSA 4JY7A 5TE9A 3DVAA 4AJLA 4WN3A 1XE3A 1CZUA 5EZYB 4IJQA 4RCZA 4JI5B 4A2CA 1GTSA 4FZNA 3BH0A 1R6UA 4TYMA 1JQ3A 2RHDA 1DJPA 4FVTA 3QPDA 3O21A 1S9DA 5ICCA 4GL2A 1X13A 5KAFU 1ED1A 1KEWA 1QHHB 2AMFA 1RTKA 2H3ZA 3CLSD 4HWGA 4DMKA 3CPHA 3A6HA 1BFKA 4MW9A 5A71A 1PG2A 2FF5A 9LDBA 4JI0B 1H0SA 5TXGA 2RAUA 2MSNA 1C7ZA 2NGRA 4RF5A 3RFFA 3WB2A 4DA0A 3AN1A 3B3FA 5JUWA 1JA9A 3D7RA 4GZLA 3QVWA 4CM9A 2OWEA 3KETA 2FMSA 3ZOZA 3AG6A 1MABB 2NU7B 4OIFA 4TURA 1KFDA 1EJ6A 9ICCA 1WHTB 4D9IA 5CDSA 3KQWA 2PRJA 7ICLA 1X2BA 5AKHA 1IBCA 3L0PA 2BZFA 4BAGA 3EH1A 2FN9A 2YXBA 1L7EA 2BFEA