2HDOA

Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
207
Chain Sequence
MTYQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTFPMAAEQAMTELGIAASEFDHFQAQYEDVMASHYDQIELYPGITSLFEQLPSELRLGIVTSQRRNELESGMRSYPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGMDPNADHQKVAHRFQKPLDILELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphoglycolate phosphatase
publication title Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from Lactobacillus plantarum at 1.50 A resolution
rcsb
source organism Lactobacillus plantarum
total genus 57
structure length 207
sequence length 207
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hdoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hdoA01
3ZX4A 5AKEA 1Z5UA 3SLRA 2IOFA 3QYPA 2NYVA 3R4CA 2CFTA 1Z88A 1YS9A 5ALNA 4EX7A 3U13A 4Y2SA 1KYTA 2ZBGA 2HCFA 5ALZA 4FFDA 3PGLA 2B8JA 1U02A 4DWOA 2ZBEA 1U7PA 3QLEA 3QUCA 4UMVA 3OTQA 1VJRA 2RARA 2C9MA 2P27A 3QU2A 5A3RA 3ED5A 3ZUPA 2FPRA 5AKHA 1RPZA 3OCUA 4E88A 1CR6A 2YJ4A 2RB5A 2G80A 2ZG6A 5AVWA 3D6JA 2P69A 1RRCA 5AKLA 4CF4A 1XPJA 2EATA 4JB3A 4J2TA 3QUQA 5AI9A 2ODAA 2FPUA 2DQSA 3F9RA 1RLTA 2RAVA 5AVUA 2YMQA 2NO5A 5AI5A 3L0YA 4PNHA 3L8HA 3CNHA 2YJ5A 1FEZA 4KNWA 1TJ5A 1ZD3A 4MWOA 4C4SA 3KC2A 2HDOA 1RKQA 3MMZA 1YV9A 4L57A 3IB6A 2EAUA 5AKXA 1Q92A 3WGUA 1RLMA 4BX0A 3WKAA 4MUMA 1N8NA 1NNLA 2HEGA 2CN1A 4YIHA 1EK2A 5AICA 2YJ3A 1YMQA 2NO4A 1Z4LA 4UMFA 5AVRA 4O8CA 1L8LA 3WK6A 3WKDA 3FZQA 5ALOA 2AMYA 2GHQA 4UM7A 1L7MA 3E81A 5AIBA 3NUQA 2B1RA 3B8EA 1ZJJA 4JDPA 3QGMA 4HGPA 1SWWA 1QQ7A 3A1DA 2HSZA 3E58A 3QU5A 3AR5A 3DNPA 1N9KA 3ZTYA 3W5DA 4UU0A 1SWVA 5AK5A 2R8XA 4BKMA 5ALSA 5AM4A 4F72A 3MPOA 1S2OA 2R8YA 4XOUA 4DFDA 4L6AA 1T9ZA 2HO4A 2I54A 2ZBDA 2PR7A 3ZI4A 3U7FB 4FE3A 2AH5A 3L1UA 2IA5A 3BWVA 3OCYA 4OD0A 4YCMA 2YJ6A 3SD7A 4FYPA 1RMQA 1X42A 4EENA 5AW9A 1S8OA 3KDPA 1Q91A 4CE6A 1PW5A 5AVXA 3ZX5A 2W11A 2OM6A 1QQ6A 3OCWA 1T5SA 3A1CA 2GFHA 1Z4MA 3WKEA 3N07A 3SKYA 4ZEVA 3IRUA 5AW8A 4Y2JA 5AK6A 1O08A 1L7NA 5ALIA 3ONNA 2C8LA 3ET5A 2WF9A 2FUCA 3EWIA 3ESRA 1K1EA 4AS2A 1Y8AA 3I6BA 2QYHA 4GXTA 4CNQA 4YCLA 1Z4IA 3ZW7A 2MSNA 1NRWA 4EELA 3QUTA 4UAUA 2JARA 4Y2YA 1Z4NA 1RKUA 4OHFA 2YY6A 2FDRA 2FEAA 5A3SA 3PCTA 2GMWA 2EARA 4YGYA 3EF1A 4B6JA 3OCXA 5AI8A 2G06A 4RETA 4QJBA 3WK4A 5AKKA 4EEKA 3J7TA 3NANA 3ET4A 5AHXA 1RMTA 3DDHA 5E0OA 3DV9A 3I28A 5AIAA 2P9JA 3QU4A 4Y2UA 3L1VA 5AKYA 5ALDA 4C4TA 3I76A 3BA6A 3ZWDA 3RFUA 3ZTWA 3L8GA 3U19A 5ALUA 3QUBA 4G63A 1RDFA 1MH9A 3QU9A 3FGOA 4KYTA 1RMYA 1WZCA 3EF0A 3FVVA 5ALRA 4EX6A 1VFPA 4Y3UA 2B82A 1IWOA 1LVHA 2AGVA 4KNVA 4AP9A 2FUEA 3NASA 5ALVA 1RLOA 2BDUA 3AR3A 1QQ5A 2BY4A 5AW3A 4YCNA 3NAMA 2I7DA 3L8EA 2R8EA 4YIKA 2JAWA 5AW1A 4F71A 4UMDA 1TJ4A 2ZBFA 1ZD4A 4NABA 2Q5EA 5FP0A 3AR8A 3M9LA 2I34A 3R09A 2G0AA 2W4MA 1Z4KA 2YN4A 4QQFA 3L7YA 4I9GA 5ALMA 2YMMA 2G07A 4Y2XA 2HF2A 5AKJA 3WK9A 3PDWA 1L7PA 2D2VA 1ZD2P 4I9FA 4H1WA 2JAOA 4BNDA 5AW7A 5AKIA 2HHLA 3KZXA 3KD3A 2MU1A 4Y2PA 3OPXA 4HAIA 5ALKA 3B9BA 3N5KA 4Y2TA 3AR2A 2I6XA 4BX2A 1RC8A 1F5SA 5AM5A 2RBKA 4AS3A 3U7EB 3OCZA 3B9RA 5AM1A 1TA0A 3WK7A 1RKVA 3U7HB 3QX7A 4BNDB 3L0CA 2HX1A 3E8MA 3KOOA 2WFAA 3DAOA 4NFLA 4NV0A 3UMCA 5ALPA 2WHEA 4J03A 2WF7A 1Z4JA 3L0BA 4OCZA 3VAYA 3NALA 5ALTA 3NIWA 3W5AA 2Q4RA 2P11A 5JJBA 3FM9A 2VKQA 1ZRNA 3A3YA 4Y2RA 1ZS9A 1CQZA 1VJ5A 4OFZA 3PGVA 1JUDA 4UARA 1LTQA 2R8ZA 2I55A 2WM8A 1Z5GA 1L8OA 5AW5A 3L5KA 1RQNA 4C4RA 1U2SA 4UW9A 5AI6A 3N8GA 5AW0A 5AKGA 3AR4A 5IT0A 2C8KA 3FPBA 3W5BA 2HOQA 4YH1A 4BX3A 5AW6A 3UMGA 5ALQA 2WF6A 3ZVMA 3NRJA 2YMLA 2CFRA 3QNMA 1Z4PX 4KN8A 1ZOLA 2WF5A 1L7OA 5AK3A 2X4DA 3ZVLA 3GYGA 1YNSA 2OBBA 4DW8A 2CFSA 4CF3A 5ALEA 1J97A 4BYGA 2IOHA 5AVVA 3U7GA 1AQ6A 1QYIA 3WK8A 4Y2VA 4KX5A 3KBBA 5ALYA 5AI0A 5AESA 3SMVA 4IFTA 3QXGA 5AM2A 4XQ0A 2B8EA 1Z4OA 3N28A 5ALXA 1NF2A 4IG4A 2WF8A 5AM0A 1T5TA 3CZ4A 3OCVA 1ZRMA 1YJ5A 1XP5A 4CF5A 2HI0A 3K1ZA 5AI4A 3WK5A 4NAVA 5IT4A 1TJ3A 5T41A 5ALWA 1QH9A 4DCCA 4NWIA 4UU1A 2JGAA 2B30A 4BEWA 4HGNA 5AM3A 5AVTA 2GO7A 5AKZA 5AK4A 5ALHA 2YBDA 3AR6A 1U7OA 5AW4A 2PKEA 2G09A 3QU7A 2C88A 2Q4TA 5ALFA 4G9BA 4GIBA 2IOFK 2HF7A 3FPSA 3AR7A 3MC1A 1XVIA 2PQ0A 4KX3A 3ZVNA 3SKXA 4RESA 3ESQA 4UASA 4UAVA 1SU4A 4BEVA 5ALLA 1WR8A 2JAUA 4XE5A 2IYEA 3E84A 4HYTA 1U2TA 2G1AA 4L6CA 4XPZA 3HYCA 2AUTA 2C4NA 3TLMA 2MU2A 3A1EA 1YDFA 5IS2A 1WPGA 5AW2A 3WKBA 1EK1A 2FPWA 3S6JA 3U26A 4HGRA 3ZU6A 3N1UA 2I33A 1J8DA 2OA0A 2O9JA 2O2XA 2ZOSA 3SHQA 4UM5A 3ZWKA 3R9KA 2W43A 5AVYA 1O03A 5ALJA 1Z4QA 4BBJA 5A3QA 4Y2QA 5ALGA 3MN1A 3WGVA 2YFYA 3W5CA 3AR9A 3IJ5A 3HLTA 2YMPA 5AVSA 3UMBA 4HGOA 1L6RA 3M1YA 2G08A 3SF0A 2FPSA 3P96A 4ZEXA 1ZD5A 1TE2A 3EPRA 3UM9A 2GHTA 3RF6A 4HGQA 3I1YA 5AVQA 4UMEA 3L8FA 2FPXA 5AVZA 2FI1A 2ZXEA 2B1QA 3WKCA 2BDEA 2B0CA 1RQLA 2OYCA 4UATA 1WVIA 2QLTA 4EZEA 4ZEWA
chains in the Genus database with same CATH superfamily
1Z5UA 8MHTA 2ZRHA 4ZYWA 3ELUA 3L6DA 3UFXB 2RGDA 3QLEA 2NAFA 1RCUA 5DYGA 1MFZA 1NI4A 2G17A 4UVEA 2RC6A 3LSYA 3D02A 3W0LB 1VFNA 2KK0A 5MGBA 1NTOA 4ZALA 5HE8A 2JVKA 4BJ6A 5BXQC 1FTYA 1RT9A 3KC2A 7ICSA 3MMZA 4XH9B 2QN6A 4TWAA 3LLUA 5AHKA 4EZBA 1N8NA 4NYJQ 1BEUB 3OCCA 4IUBS 4I3HA 5C18A 2JH8A 1KY5A 2CL0X 4MCHA 5G0WA 2WJPA 1K6MA 2QD5A 2D8AA 1AZTA 2MSDB 1UBGA 1I13A 1NMXA 5TT1A 1SHUX 5HK8A 3BE4A 2WV7A 1M2OA 2ROQA 2P65A 5T6MA 3E82A 3FWHA 5HUJA 4FE3A 5K6TA 3L1UA 2OGWA 1T9DA 4UBLA 5AR1A 4ETMA 4DIFA 3FPFA 1R74A 3TO5A 1T1EA 3V6MA 5BMVF 3DP7A 1U1EA 1T0IA 4IQFA 3BXZA 3EYWA 1E64A 3ZK7A 1JHRA 2QL6A 3OQ1A 5JZMA 5KVSA 1X3SA 5AW8A 1G7TA 4X92A 4R8VA 1HT2E 4TXLA 2FUCA 3WSTA 1JAZA 1F2TB 1W4ZA 5HBGA 2X9NA 3ZC3A 1HLPA 1RKUA 3B5EA 2G72A 1JAYA 2P1ZA 4I8DA 1A4UA 1J0XO 1N75A 3ETHA 4DL7A 3J7TA 3R0IA 3NANA 4NZYA 2EBFX 4HF7A 2LKDA 3VV2A 3G2PA 4DL9A 3NGDA 3B1YA 5JS1A 4R98A 3TNYA 5ICSA 3KALA 2PGIA 2X5OA 3ZVRA 1B22A 4LDPA 2ZUFA 4OHCA 2J0SA 4PHDA 3CB2A 1T9AA 3R5XA 2H4FA 3RVKA 2JZBA 1EVQA 1Y3HA 1Q3HA 1JA0A 1IHOA 5KCMA 1IFXA 4GVLA 4D9KA 2JEGA 2IPAB 2AW5A 4MS4B 2H59A 7ICOA 4QFMA 5TGTA 3NBYC 2RHOA 3W9SA 3PX7A 3OEWA 4CM6A 2V9CA 1UOEA 2JCSA 3W05A 3DZKA 2E4XA 2OHIA 2W54A 3EEOA 1ZQAA 1Q22A 2XQJA 2XUDA 1X8LA 1JDUA 1RM6C 3PHLA 1JN0A 3O4VA 4IV0A 1CQZA 5IDVA 3LWDA 1CV2A 1XMOB 3K35A 4HNTA 4QBKA 2QP3A 2MINA 2ANBA 5AW0A 1C3OB 3EOZA 1XEAA 4OUDA 3JQAA 5DHQA 3LYAA 3QPAA 2ENWA 1WSDA 1L7EA 3O2JA 4GUDA 4J7AA 2HQRA 4P0TA 2OXIA 4G5HA 3HDYA 1AQNA 1NBIA 1NF2A 2CJWB 4U7GA 5EA2A 5LD2C 1E59A 1LRLA 4RHYA 3L7NA 4J0KA 1A2QA 4NWIA 3DAFA 3FB1A 3DF7A 1RW4A 3WO0A 4BV9A 3U61B 1EJ0A 1TTPB 4I2VA 1QH0A 3M5CA 2WJJA 2X7XA 3LLCA 3RBXA 1P1KA 4UOZA 4DSZA 3BA1A 2QAJA 3HKDA 3NEJA 5IXJA 3S8EA 1HQYE 3EG5A 3ZWCA 2I3ZA 4BZZA 3C7KA 4DS3A 3I8XA 1E79A 1DFIA 3BB1A 2ASJA 3ZU6A 3GDFA 3EN0A 4KPYA 3KDSE 4Z7NB 1M2EA 2QXYA 3EXHC 1XQ9A 2E5FA 4OLJA 2B34A 1U4SA 2H18A 1ORIA 2DJIA 2YMPA 4YFYA 3O73A 5L7WA 2BKAA 4MWGA 4DWJA 3QVVA 2YXBA 2FPXA 3EDQA 4BRWA 4UU8A 4H7KA 3TFRA 3OTOB 2BELA 4O63O 3NHUA 7ICNA 4ZI7B 1R18A 1R0LA 3GLSA 4J1NA 4QU8A 1DQRA 1U6IA 1B2LA 3UKOA 5ALZA 1SXPA 2B8JA 1NJFA 4ZGGA 1JH9A 1P1BA 2JBHA 2A59A 2PUJA 1J06A 1OX6A 1RPZA 2AK2A 4R8UB 1NC3A 4FYIA 1Z00B 4QTZA 2OLKA 3TJMA 3CONA 1SA0B 4G0PA 3PGKA 2K89A 5BXYA 2OZVA 1CUHA 1U3WA 4KODA 3ISVA 3ZD7A 2EZTA 5EJEA 3WBKA 1RM3A 4OBBA 4RPIA 5KB3A 5EESA 1T24A 4OK6A 4YUWA 3GLIE 3ND8A 1UJ4A 4O8CA 3UYLA 3JVIA 4OM7A 4IQ0A 3H86A 3EGVA 4MQFA 5HK9A 1YI1A 1PD1A 4WKNA 1T34A 4KQEA 3DDWA 4LTMA 4D3XA 4AO8A 4JMLA 3L4KA 3FHJA 4Q37A 3E9ZA 4DLRA 5H83A 5IZCC 1BN7A 2R47A 1QFMA 2V3WA 1RFGE 3E3LA 1V7QA 4YAEA 5JDIA 3O2SB 3CPHA 1WL8A 1C0LA 4JLJA 1B8PA 4RA9A 4F9EA 2Z04A 3GLGA 2R97A 3K15A 5KWSA 1RWPA 1D8AA 4KE6A 4RTRA 1ZJWA 5KKNB 3DWEX 4RYDA 3A6LA 4I3FA 2PJZA 1WUHS 1T8WA 1Y3AA 2Z3WA 5B1YA 4ZRNA 3FCEA 2P2CA 4D41A 1OD6A 2FOXA 3BM5A 5LZ7A 2CXHA 2ZT7A 3FKJA 5LZ9A 2J6SA 1UK6A 1I3KA 3R8XA 4ICAA 4YAWA 4YNBA 4RELA 1RMTA 2XUOA 5BUCA 1ZJYA 4ALJA 3K5PA 4NP6A 5EUCA 2QBYA 1G9TA 4RBNA 5JXIA 3CCCA 5BQXA 4FKMA 3I73A 4Q34A 3D5EA 1W5TA 4QO8A 1KDVA 4QXAA 2FKAA 3C3KA 4DA7A 4N3CA 4BP3A 1EP2B 3E2EA 3SVTA 1AGNA 2JHDA 5FCDA 2F4VB 4PHFA 4QQFA 5TRTA 3HYSA 3WNCA 4QOSA 1T4DA 4DV1B 1J2RA 3RSQA 1RIIA 3KELA 5L3VA 3WFZA 5A2QA 4UAWA 3JALB 2E2WA 1L5UA 3AGQA 2IOQA 5AM5A 1XQVA 1G8MA 4PC3A 4WECA 1UWKA 3QX7A 3P4XA 4J9LA 4D4IA 1KEVA 2FETA 1BTOA 2Y93A 2IYQA 1H4QA 3PY8A 2QW8A 2V7QA 3OJUA 2PX6A 3O84A 4ERNA 3AJEA 1GTZA 5DHUA 2WM8A 2A5YB 2OCPA 4MV6A 2A92A 1BMQA 1DEOA 4Q1CA 3SSAA 3TOVA 3K9FC 3CPJB 3TSYA 2W2LD 2V6JA 2BMFA 3OZAA 5UKDA 4F86A 3HADA 3HSSA 5F7OA 2CFSA 1NK8A 2FJPA 4J75A 1PNQA 4MV4A 4HVCA 5BQ5A 4KMUA 2J46A 3RC9A 4IG4A 1H5QA 1CR0A 4LRUA 1ORDA 2EERA 3GJXC 3D5TA 4WD3A 1EIZA 1JQJC 2BMEA 4BB5A 4PVDA 2Y0EA 3WP0A 2V58A 2J87A 3MBOA 4FB4A 3JQ7A 1PV4A 4JR0A 1T3SA 3VU8A 3IA2A 2P62A 4MV9A 3V9PA 3FAKA 2IHMA 2GZMA 2ZJBA 3R3JA 5JAHA 1QP4A 2H7VA 3ZY5A 4L8GA 1XRLA 2A8YA 2BEUA 5FPYA 2D3WA 4NM1A 5HTOA 3TR5A 1I4EB 4BGEA 2ZYTX 3L7JA 1V1JA 1FFEA 1P4JA 5TQ0B 3SNKA 4KPUB 3ZG6A 4TYNA 4W5RA 3IH5A 1UEIA 2L19A 2GZHA 4RLFA 1K7SN 5DGHA 1WW3A 1KBZA 3UGKA 3Q88A 5DM70 1JLLA 2AFHA 4J2OA 4II2A 1V1RB 2IH5A 5CIYA 1EDDA 4ZEWA 3OJFA 3GHHA 3EBOA 2YVLA 5C1PA 3QE4A 4HFJA 4CBVA 3K9BA 5ESXA 4R2JA 3H3JA 2WICA 3E9NA 1H2BA 1T9GS 3ZE9A 4BQOA 3OO1A 5BSKA 3PNQA 2FP3A 1OA0A 1Q0ZA 1RWWA 3L0DA 3SHTA 5FTNA 1MAAA 2AN5A 3E4DA 5FNVF 3M4ZA 121PA 3NYRA 2H0RA 1ECCA 3M5DA 2WSMA 1JU3A 1IIBA 5C5CA 1FPMA 3QWHA 3H5NA 3AWIA 1XSNA 3E70C 4O4HF 4LSWA 1GGKA 1KERA 2YMQA 3FWPA 3NS1A 2KZ3A 3KZVA 4HAXA 3RT7A 1AXGA 2YWEA 4ERXA 3UMFA 2C2OA 1D8BA 5DM2A 1X9SA 3U3DA 1Z4LA 1Q7RA 1D1SA 3PQDA 1FRNA 1Y4DE 3NRZA 1GGJA 3DNPA 2H2GA 4GI3A 3TXXA 2Z9DA 3NHFA 3TXYA 3N0TA 1MRZA 4JBWA 4C2BA 5DOZA 4BC0A 4ZOLF 4ZCMA 3FE2A 2PR7A 3DTYA 2IWHA 2DUNA 4ZO7A 4GPD1 4YJ3B 3SD7A 4E4RA 2L5YA 3ULKA 1K5DA 5EAIA 1S8OA 4DQQA 3GLFB 1WXQA 2UUCB 1OSNA 3NR2A 1UH5A 2M2IA 3QVGB 3SKYA 1OFGA 3IRUA 2X5XA 4TWJA 2EKLA 1SKYE 1K1EA 3MRTA 4UHCA 1CD5A 2W8BB 2FMFA 3TB4A 4WASA 1KEUA 2R0QC 2Z9CA 3LC0A 1GV1A 4ZCSA 2PRSA 1YR7A 3Q2KA 1WHSB 4IXMA 3B1WA 2WZBA 3H0KA 5COQA 1VMAA 1FSGA 2ECQA 1EMDA 1E3DA 3WRYC 3RKSA 2FK7A 5EHIA 4KLFA 4DYDA 1C7IA 1RMYA 3KLOA 3PSTA 3T9EA 2DYKA 1NR5A 4I9UA 2IUFA 4GLLA 4YRMA 1Z37A 4J0HA 3KOXA 1XDBA 1Q84A 3Q3IA 4DF8A 3R3VA 4GMFA 2PL9A 1ZD2P 1XMVA 3DEJA 1KH1A 1H8EA 4HP8A 3H5AA 1RP7A 4V3BA 2JMGA 2ERCA 3MLBA 2NVWA 3SQWA 4IIYA 3H0EA 3DFZA 1S2IA 1FW8A 4MIYA 1S76D 3G2NA 3VVCA 4HPJB 4IFIA 1ZS9A 3GRAA 3WIUA 3HP6A 2ZJ6A 1AKUA 2FSGA 2RAPA 3A4LA 4FZ3A 3KKAC 2A4KA 4GPIB 4MVCA 4PICA 4FKZA 4BUCA 4AQ7A 4GHWA 2I65A 2C7BA 1LK5A 1Z2CA 4BYGA 1SRRA 5IM4F 4TMWA 3U9SA 3FFAA 3JQFA 4WGFA 1F14A 3IBYA 5CTAA 8ICKA 1N1EA 1YZTA 3WNQA 1EX9A 2P30A 3LZCA 3DYIA 4N5LA 4KP7A 1PT9A 4IGKA 3O0FA 5KU7A 1KQGA 4Z6DA 4G9BA 2C2WA 1DDOA 2HPZA 3ICWA 3MGBA 1B4FA 2HK7A 1SKAA 1U9JA 3EIEA 2IYWA 5FT9A 2OBNA 4D44A 3OF2A 3HWTA 4OUKX 4DLPA 2WJIA 5GMOA 3DHYA 1IJEA 1G5IA 1HFJA 3WBJA 2GYUA 4YAGA 1E6UA 3PS9A 4CEJA 3COSA 1VL8A 2YFYA 2XLBA 3EPKA 1UXKA 1D5WA 2X77A 4CCYB 2CXPA 1M34B 3SR4A 4XRRA 5HRCA 4YMVA 2F1RA 2H8KA 3SZGA 1LW7A 1NJ8A 3HVKA 4GZMA 5ELMA 3AKYA 5LB4A 5ADHA 1TK5A 3X3HA 4HB0A 3BQMB 5CA1B 2PGDA 3RSSA 1XU4A 1Z6AA 1OF1A 1LPBB 2BM1A 2HCBA 2GWSA 3IVMA 4YREA 3QEAZ 2QTAA 3EXFA 2QD3A 5AKHA 2WTNA 1RM4A 4JC8A 3QYFA 5JO0A 4D9EA 1RYMA 4Y98A 3IS3A 3ZHSA 1BD3A 4XKJA 5CVUA 3VKGA 4W82A 2A5DA 2XVAA 4PZDA 3WISA 2LD4A 2ESEA 3BKWA 1CRXA 2BZGA 4C0XA 1KTQA 3KIPA 1BPBA 3DMTC 2H1LA 5KDLA 3EQZA 4IXNA 3C5HA 3MTIA 4C8LA 1OBCA 4HC4A 2BONA 4LE0A 3ZH9B 3K0FA 4KLCA 4MROA 4A23A 5DLFA 4HYYA 4UB5A 1KJZA 2KE5A 2O6KA 5KOHB 5A4JA 3N4MB 3NKFA 4F60A 4K7JA 3DG9A 5EKSA 4K0KB 3LVVA 1NPTO 3KQOA 4X8MA 4DCJA 5FPKA 4C80A 4LQDA 4JYZA 1L6IA 3ORFA 3EXIA 5CT5A 2YV1A 3EIUA 1GWNA 4RDIA 2OM6A 4Q8EA 3N07A 4DADA 4M9LA 4I81A 2PFOA 5C8DA 3OE1A 4ZYZA 5TMPA 3ES9A 1QP0A 2ZP1A 1J2UA 4UHHA 2QB0B 5LIPA 3RE1A 1OAKA 3AFMA 2GMWA 1GT6A 1SC1A 4D42A 1GG8A 3QKRB 1O94D 4QZGA 4DSJA 2CNOA 2V9WA 4FO6A 4OJ5A 2VWQA 2OHFA 3EGDA 3GUUA 5C80A 3KP1A 1CHDA 4R0VA 4FOOA 1NKBA 1NLYA 3OP4A 1OAAA 3IUNA 1L3SA 1WZCA 1KDPA 1U2QA 3X1WA 3KB1A 3JQBA 2CWWA 3C7AA 2CVFA 3DOFA 1RQGA 1IWPB 3KB8A 1JEAA 4LFAB 1XRRA 5IJ9B 3MTQA 2RG7A 3PDWA 1Q20A 4BNDA 2MSWA 1LZLA 4UDYX 2NU9B 5IAOA 4WRRA 5BMVB 4BN4A 1RC8A 3PR3A 5EWMA 4CQLB 2PPVA 4CEHA 2TECE 1NYQA 1W85A 4YYEA 3GT7A 4V1CA 9ICHA 3AMZA 2QIOA 1YC2A 3ZLTA 1HLDA 3V33A 4ZICA 3T5PA 4NNJA 2NGRA 1VE5A 2P9YA 1UP4A 2DTDA 5DXJA 3MR6A 2DFDA 1L3BA 2ZB4A 1W88B 2FUG6 3HPRA 4R7TA 3ZWMA 4OQZA 1RJ9B 3E4CA 4IH4A 2UVUA 1JG1A 4DMLA 1CQIB 4QYTA 4PN7A 1NT2A 3NTRA 1Y3FE 3TPFA 2CNWA 3HGTA 2OPBA 4WA7A 9ICQA 3GQCA 4R9RA 2MSEB 1J24A 3RUDA 2ZYGA 4X63A 3T3FA 1T5TA 4RUCA 1A50B 4MAMA 1U3GA 2VPTA 3VKWA 4NXNB 3HUDA 3PJRA 5IVPA 4FXOA 3WWOA 2QD1A 1TQ2A 2I91A 4BL5A 5BNWA 3FCOA 4H7FA 1ZEJA 1ANKA 4MRPA 2WPDA 3HL4A 5TE9A 4A16A 2XB2A 5DNYB 2VYQA 2WWIA 4EPTA 1B00A 3SAFA 4R8RA 4XPIA 5HUHA 2ZPUA 4XDYA 5T14A 3HZOA 1KO1A 4XE5A 4RHFA 3Q1KA 1D6SA 3MFIA 1X1AA 3F2DA 2WIAA 2VKTA 5IAJA 4DG5A 3GMSA 1U47A 3OM8A 1ACMA 2EFYA 3F4LA 1D1PA 4ZU3A 2JHCA 4A92A 1AUVA 1EK5A 3BFKA 1HMYA 1JT9A 4LYAA 4J1QA 5HP4A 3MDAA 2WD9A 3CZ5A 3PDJA 3O9ZA 5TGDA 1I7PA 4MEAA 3UAYA 1CR4A 4WINA 1XWFA 1V6SA 2ZBRA 4U6QA 4QNLA 3IERA 4PZZA 1UC4B 4N0MA 1OE0A 2HWYA 4EI2A 1M7BA 4HDMB 2IT1A 4KK4A 2VYVA 2W9CA 1R2QA 1QM5A 3VR5A 3T1NA 4LCEA 3TTXA 2O2DA 3KUUA 2JVIA 4YRLA 2F7SA 4MS3B 2RHDA 2XB8A 2QN3A 3GLKA 5BSMA 4JYBA 5IABA 5KFZA 3GZNB 2OQ2A 3WNDA 4EGAA 1PL7A 4R0MA 4KQJA 2G7ZA 5DMHA 1UK7A 1HUQA 4UBOA 3C29A 1U0NA 3FYSA 4OSOA 3T7DA 3G23A 3M0EA 1YZLA 3AESA 3PVSA 4EEXA 1Q1QA 3B8EA 2FVXA 4C06A 3N2NA 1QR2A 4G5FA 4MVJF 4Q9LA 2QRQA 5B2FA 4QU5A 5L8VA 5JNLA 1X7DA 1WB5A 4US2R 4P0PA 1PZHA 3D64A 4H4DA 2FPIB 1U7TA 1F5NA 1B0XA 4RK7A 4QWEA 5K3AA 5E3HA 2D00A 3DEIA 4W5QA 4XAQA 1PDOA 1PW7A 4ZYLA 4P92A 4DQLA 3FCXA 2IHNA 4P38A 1Q50A 3H5LA 1DG9A 2H3QA 4NHOA 2DLNA 2YOFA 2BZ0A 4RUKA 3HMQA 4QDKA 2BI4A 3HCBA 4CNQA 2AC4A 3V4SA 4PFQA 3UYKA 2ATXA 3KU4A 4DNOA 3VVMA 4EVIA 5LZ5A 3DDHA 1EB9A 3B7GA 3T1QA 3L8CA 1V26A 1W76A 4XX1A 3HCFA 3LDFA 2RB4A 4G56A 4QRDA 1GR0A 3DEYX 5DHPA 3CWZA 3TVYA 4G97A 1YB6A 3D8HA 4DJEC 3WDMA 1P73A 1ED1A 5LP6A 2H7YA 4OHPA 4ER5A 3QVUA 4A26A 2ORVA 2JPDA 2JAWA 3TFQA 5REQA 2G0AA 5EKTA 1SHTX 2V6GA 3Q6NA 5G4KB 1NLFA 3WIVA 1I94B 4LWZA 1NUUA 1CP3A 3RH0A 3KD3A 1I7SB 1TM4E 4ED9A 2K4HA 1AQJA 1N2GA 3QELA 4IF4A 4URHA 1E3EA 4NZMA 3ZHXA 3KWMA 4PLGA 2BE9A 5EZSA 4Z99A 2QTRA 4RA6B 1W0KA 4QWAA 4L6IA 1C80A 3C1AA 2Q41A 2BUAA 5B58C 2CDNA 3EK2A 2K87A 3VTFA 2A1AA 2HRZA 1ACLA 4MCAA 8ICZA 4N0EA 2C2RA 3QXJA 1OXTA 1I1OA 2O8EB 2LPEA 4BO2A 3EJ6A 3ELYA 3P0JA 1V85A 2FZ4A 4EAQA 2GDJA 2ZIWB 1T2AA 3AF2A 2WVJA 3DBLB 3F5DA 2VJPA 3V80A 2FYTA 3K6KA 3GNTA 2IQIA 3HVHA 1GVNB 2HHSA 2REOA 4GOKA 3AL0B 5LIRA 5AM2A 1XDZA 2OLJA 4M2LA 2VEOA 1W87A 2WSSA 3LOQA 2VH5R 3GRKA 4DCPA 3GCXA 4OKIA 1U3CA 1YQTA 4RS4A 1YOVB 1YKFA 1BDIA 4C0ZA 4Q7MB 2I9KA 3AUAA 4XCVA 3DBHA 3CRXA 5DU2A 3Q6IA 2Q8QA 3AUJB 1J42A 5H3LA 3Q8SB 3LXXA 3H4MA 1ZG3A 4TYYA 1LSOA 4NXZA 2Q5LA 3BD8A 5JRJA 3O4HA 2HC9A 2IVZA 1FFVA 3TN7A 2VJCA 3GUZA 4Q9NA 2BCJQ 1HWYA 2XRZA 5KQSA 5IBQA 3ADKA 721PA 1WKBA 3TVDA 5JAPA 1GZ5A 5C1BA 621PA 3U4DA 5CLQA 2O2ZA 4IL5A 1N1DA 4KLOA 2W9XA 1FX0B 3RSZA 4RTJA 3F5EA 4B4DA 1NY5A 2XODA 1UMBA 2XT6A 2AEEA 2P2DA 1FTSA 3ZWPA 5C8VA 3SENA 3LBHA 5IIOA 1DNPA 5TPZA 5K4HA 5GGXA 1AF7A 1M67A 3N8HA 2W6NA 4WSOA 3HXTA 2C9MA 4R1UA 2EX1A 3DW3X 5K3DA 4P2HA 3LK9A 3UAZA 4D9FA 3KQPA 3BRCA 5GV7A 3ODPA 4JB3A 1DKNA 4GO1A 1HX7A 4B3MB 4ILEA 1AK9A 4GC6A 5AI5A 4ZKEA 2VBFA 4K40A 2CJYA 1H2AS 3DGEC 2OE2A 1N60A 3MCTA 5ELLA 3T5DA 1R66A 2PGOA 5KFKA 1TK3A 4AYTA 4B85A 4O0LA 3K1YA 2DT5A 2WD7B 2XY4A 2PQ6A 2JH9A 4WZAE 3A7EA 4UFPA 4PRLA 4BVLA 2BN4A 4GMDA 3CC8A 1Y3IA 3U40A 1GNSA 4Q4AB 2V03A 2PN1A 4DBVO 4QIWC 2AUMA 2GFHA 3NKVA 3BMQB 4BO4A 3MZ0A 1T5DX 1ZQ9A 4NXMB 3PRHA 3TQQA 2HD4A 3WLJA 1ETUA 2VAVA 4K05A 3L49A 2IU6A 2RH8A 3QNWA 3NHLA 2QYHA 4L22A 2MSNA 5A5EA 2JKVA 4IIFA 2C92A 3UFBA 4RFSA 4L9AA 4P82A 2M9NA 4FOLA 2C7RA 1PZMA 4O4HB 2AI3A 1W4LA 3JQGB 2EFHB 4OK3A 4ZCIA 2EAPA 3N7AA 1K3FA 2NRWA 2OCYC 3MJCA 3TKAA 1UFOA 3BB4A 3EMBA 1Z0FA 2R6GA 3DTNA 4QPJC 3WB1A 5P21A 2CJXA 3JY6A 2Z5GA 3EDOA 2EW1A 4MKXA 3LLVA 1L5QA 1JLSA 4S12A 4KWTA 4GAEA 3I4CA 2QTHA 5AW1A 4N39A 3NIBA 1VYTA 2CV0A 2FGJA 2ZJ1A 2YN4A 2IEYA 4ZOLB 2J3QA 1XTUA 1IZ0A 3LIPA 5C37A 1LV8A 3Q2OA 4ALLA 4HL6A 3QP9A 2W6JD 3VR4H 5KC8A 4D99A 5HF8A 2W22A 2BKEA 4DA8A 3STHA 4JLOA 1VLBA 3VXKA 1YHYA 2WF7A 3THSA 4YBRA 2HBZA 2B4KA 2ONJA 4I1VA 4EYKA 2VZ8A 1MGOA 2NUPA 1G5RA 1JXAA 3KPJA 4WJ3B 3K0HA 3AM1A 4Z2AA 4HK4A 1IM8A 2PT7A 3WLSA 5A1JA 3UQYS 1XTTA 3DZDA 3GBPA 4HMQA 4K9NA 2YHAA 2QG6A 2DQ4A 2W2MA 2C59A 3FRHA 4PC1A 4CM4B 1MA3A 1N3BA 1DQZA 4OB6A 1YGYA 5DJ5A 3ZV5A 2ZSEA 3RJMA 4Q44A 1ZRMA 3FPLA 5DOVA 1DO8A 1I8TA 2YQ5A 3NV9A 2J7PA 1ISPA 2GAJA 3PFWO 1N9GB 3QE9Y 3EW7A 2O2HA 4R3UC 1IV8A 5AKZA 3H2GA 1DEXA 5TF4A 2I6GA 1A7AA 2AI1A 3S7ZA 4DRXA 4QYIA 4YMLA 2W70A 1GAJA 5MFPA 1ATIA 4CL0A 5K05A 3WOVA 3QJ5A 3V2GA 4E51A 3OA0A 4L6CA 4L08A 5JROA 1C4WA 3OHBA 1KR2A 1FZTA 2FPWA 2OB2A 5CFOA 3GLHB 1IN6A 5JZBA 4FOSA 3SZ3A 1H4SA 4HZGA 1Z83A 4YMSA 3SIRA 1Y7PA 3PFKA 5EHQA 2DTEA 5DX0A 1U7ZA 1ZVQA 4TTSA 2HWKA 1SKRA 1HFEL 1R0WA 5L95A 3DOUA 4QZBA 1TT5B 4XDHA 1QFYA 2OQIA 2GGSA 3GJTA 1HG0A 5JVDF 3HI6A 4NH0A 4ZRDA 4IIBA 1UMCB 2PLNA 2DBYA 1A97A 3L4BA 2LM1A 1GL3A 4QVGA 4HN9A 1P5JA 2J9YB 4ZJUA 4CUJA 4GP6A 3EVFA 1GPH1 2ZFUA 3WNZA 5EQTA 2ZEJA 3LFUA 2JIMA 1QR6A 1KJYA 4K9KA 2I99A 1RC0A 1MTOA 3LWNA 3E3AA 2XYRA 3M89A 4MMYB 2BFDA 1G6HA 3NNDA 4L02A 1MT3A 8ICMA 3UJ6A 1A2OA 3GEIA 2WAMA 4QOGA 2ZBQA 4BQNA 3QMMA 1G3UA 4OV6B 1W9MA 3CVUA 2ZRJA 5AKXA 4G24A 3TOXA 3CE6A 1UXHA 3ZQJA 1ZJMA 3UMVA 2OZEA 5KYXB 5L7TA 3LV8A 2P6RA 1N4AA 1TQ6A 1L5GB 3OF5A 2EQBA 1UBCA 4XEUA 3FPEA 3KXIA 3PL1A 4EW2A 2WJHA 3WTCA 3AVTA 5I9BA 4X0EA 2QLMA 3VX3A 1BH2A 3C3XA 3PX3A 3SBOA 3WJ1A 2Y1DA 4J49A 1P0CA 4UEKA 1OLSB 3EWNA 4LXIA 2A7XA 5J0QA 3NM4A 3PV0A 5DBAA 4O4JA 1K5GA 5ELXA 3PC8C 3NHPA 4ZOHC 5K20A 1RP1A 2A9FA 5JRZA 3W5HA 3JZAA 1M73E 3ND6A 4E03A 1NJWA 3R3SA 4Y30A 4YFKA 2F4NA 3WGKA 4NICA 3PCXA 1NRWA 1IBRA 2RGGA 3C1ZA 4LRWA 4WQMA 1KAOA 3EVDA 1ZUIA 4FFPA 5JI2E 5CG1A 1WZNA 5GWXA 4IXDA 3L41A 1HUZA 2HYIC 5CVJA 1P8JA 4KVGA 4P1ZA 1P0IA 3GCZA 4N7JA 2IYYA 1JIQA 2H4YA 4WFJA 2JL1A 4TMZA 2YIJA 2KV2A 1QV9A 4EX6A 1YQGA 5TR9A 4ECXA 2FUEA 3FOBA 4D6XA 2R6CA 1L8XA 3S99A 3PNYA 5JFTA 1C7JA 4Q16A 1YTUA 5JAIA 1MB3A 5CLGA 1H0SA 2HA4A 4P32A 1LA2A 2PGXA 2EQAA 4E5KA 2Y1LA 1V0JA 4PX5A 3HCOA 4ZCPA 2VHXA 4LISA 2F44A 3K8OE 2O59A 1H4VB 4DC0A 4HWKA 3MLEA 1P17A 2GZ2A 2P67A 5SYNA 2YHBA 2YXPX 4HRVA 3NVYA 4WK0B 1OLUB 2BFNA 1M83A 4BS9A 5AVOA 5SY6A 4MUKA 3KL4A 1BFUA 3ADDA 3PNPA 4HNAA 4II7A 4WZBA 4XWOA 3GO4A 1DVRA 2EJTA 4EKYA 5DBOA 4HQKA 2JKZA 5FI5A 5AKGA 1GPAA 1V2GA 4PSVA 3INTA 4C7JA 2OO7A 4QW9A 2JEIA 1JBKA 3O83A 2J4CA 2UZAA 8ICHA 5IAGA 5JI3E 3BJEA 3UAGA 1L7OA 4B9NA 3G5LA 2I5PO 4I50A 3U7QA 5CP8A 1JXQA 3HO6A 1M5UA 1VJ1A 4YACA 1IAQA 4E7OA 2N47A 1KDZA 4OATA 2RCYA 2F64A 4QGFA 2PWAA 2WF8A 1KIFA 2QU8A 3B48A 3AW9A 4TYWA 4XARA 3F8SA 3LQYA 3OP1A 1ISSA 4XYBA 2RI1A 1UDWA 3R7LA 3NFRA 1Z0SA 4DWIA 2OYRA 2VJYA 1NXWA 1AZSC 2OLEA 5GJCA 3RR8A 2ZJ7A 4S24A 4NS1A 1J0DA 1UBOS 2KQUA 3C97A 3IYLW 1T8PA 2J5BA 1W59A 5LQAA 1ZQVA 2EANA 5IJXA 2XTMA 3TM4A 5EHNA 2AUTA 1M1NB 1WPGA 2BOVA 1H6AA 3S2IA 2VK1A 3KBOA 1TXGA 5JFGA 4JI4B 2IP2A 2JA1A 4R2LA 4EP1A 4D8YA 2L2QA 2JXJA 2VRBA 1YONA 3WZLA 3MWFA 1M3SA 4RSRA 4QBGB 1I6WA 1KEEB 2BLLA 3CX6A 1WNFA 2CCKA 5HOEA 2QROA 4HCJA 4UMEA 3DEKA 2ZRKA 4HH4A 1G8SA 1X7WA 4EJFA 2VHVA 3UWMA 4V0RA 1Y5RA 3H1AA 1G19A 4UJ3A 3IDOA 3MRVA 1W8IA 4NNOA 5AKEA 1SRQA 1OWLA 1QRDA 2VRNA 3TQ1A 4FFDA 4O25A 4LZAA 4DWOA 5KNCD 4FFNA 4TXNA 4NBVA 4NECA 5TXGA 3P52A 3L46A 1D4OA 3BILA 5DBHX 3HB7A 3QMWA 4R5HA 4JJIA 1ZGHA 3T1TA 5D46A 4HY3A 3QTBA 5JAUA 1DG3A 3CB4A 5E6UA 5M5BA 2MUTB 1R4NA 2QRZA 1OAOA 2ZYIA 4OHKA 2ZJ2A 3WWDA 5B4VA 2ZS7A 3HMKA 5EG5A 1JIKA 4AB1A 5CM9C 3G5MA 5BOVA 2FTKE 1X86B 5HXAA 4ZOCA 4IEFB 3OWXA 4OYRA 2CHQA 2WAAA 1KAHA 4B0OA 2Z6QA 3CLRC 2O8CB 4EQ6A 2OGSA 5AQ1A 2ZRCA 4MPRA 5CLHA 4D26A 5KPJA 2QORA 1FNMA 4D8XA 2HTEA 2XWJI 2HUPA 3T15A 1MJFA 1NR7A 2H06A 4MIEA 1M2WA 4AO7A 3T5JA 4MRRA 5JCJA 3U44A 4YAIA 4ZZ1A 2ECKA 1OWNA 1YRWA 2I0FA 2BGGA 2AMLA 3G8DA 3GJQA 3COPA 5D3MB 5EP4A 1CFZA 1YRQA 4KDCA 1L7NA 1DBPA 1YQ9A 1ZM4A 2FRVA 3W7AA 2DFLA 5JQWA 5GQSA 4BDPA 3VH4A 3K75D 3Q7QA 2O0LA 3AN1A 3AG6A 1EJBA 5DM1A 4D74A 4OP3A 1LS1A 5KVAA 2KVCA 3LA6A 4J9NA 1ZZGA 4LC1A 3RJTA 1SVKA 2YJTD 4N65A 2PY6A 3C3BA 4N3NA 5K6AA 4I5IA 1APBA 3CKMA 4J9RA 1DJPA 1AUPA 4YRSA 2AJLI 5B3AA 5FTWA 3QWAA 3RUHA 4O5KA 1R9JA 2BCVA 1I10A 1VFPA 2QUJA 1W19A 3LQ2A 2K4MA 2R25B 2WIBA 1MX9A 4TKVA 4K4GA 4L72A 4WNIA 3BHJA 5HGJA 5K8LA 2AOTB 1T6ZA 1XD2A 4M1WA 3B3GA 1AS2A 4LJAA 4TZ6A 1BVSA 1S4MA 1DKQA 3HXQA 5BSHA 1GPLA 3L1IA 4MRMB 4O4IA 1XZHA 2I6XA 4KAXA 4C7KA 1BS2A 3IA7A 1SXJE 3KOOA 3UVEA 2XQIA 1F9EA 1JS1X 4Q7EA 4ELVA 1MO4A 4CIYA 1R10A 1U0EA 1F48A 3GROA 3C5FA 4F06A 3AEUB 3I5UA 3OMLA 4ZCLA 3HN6A 2G9RA 2A1JA 1ZMTA 2I7XA 1YR2A 4N9WA 4NFHA 5CLIA 4IMIB 5DHRA 4IGIA 4EY8A 3RAEC 1PKEA 1G9SA 2OXFA 2PYDA 1OZ0A 3W5IA 1E9EA 2IY9A 3FG9A 2P9QA 5CRIA 1MXHA 3I01A 3TQRA 5JNVA 4Q4DA 2D8CA 4ZC1A 2I4IA 1YJ5A 2QI9F 5K1ZA 4RZRA 4MEJA 4MWDA 1W46A 4I66A 4YDQA 1QH9A 3ZU4A 1C2YA 1N2JA 1N8TA 3UJAA 3SHVA 5AK4A 3PSHA 3F8TA 1J1UA 3I45A 4ECUA 2PNJA 2C2KA 4PCVA 1XLTC 1YVPA 1KJJA 5E8JA 3RQSA 1NXTA 1FFGA 2ZCVA 2CNNA 4X65B 4E07A 1GZ3A 1E4VA 4MMZB 1GILA 3UMJA 2ZWVA 4OL9A 3HQ4O 1KEWA 3RCBA 4DLYA 3W6ZA 4MP8A 4PZOA 4BLPA 2NV0A 1W29A 3JTEA 5LQRA 5KI6A 1YU6A 3FGZA 2XCTB 1II9A 4KQFA 2G71A 2GCPA 3HB1A 3IPCA 2Q1WA 4DHWA 4M0EA 4DR5B 2HDHA 1O58A 4CG1A 1KK2A 5EIHA 2UYYA 1NUQA 4B2LA 5BNTA 4LBVA 3KEQA 1J9ZA 1VA5A 1XT6A 3NDBB 4ZVRA 2KJ5A 4EJSC 2P91A 4L5BA 3LF2A 3GFKB 4ZP1A 3X1DA 5KX5F 5DLYA 1LH0A 1TX4B 1SO8A 2C1EA 2D5CA 1BH6A 1YB4A 2I29A 3NBMA 1SXJD 2XITA 3GG9A 1QOPB 4FEGA 5KFSA 4Y6LA 2RC5A 3L8YA 4I2FA 1U5BA 1I32A 5KQGA 4ZHQA 3FZQA 3CW2C 1VLZA 4X1IA 1PR2A 4RY0A 4FS3A 2WA1A 3GGCA 5EE9A 2V96A 4XUCA 4TMXA 4F6LA 2Z9BA 1LJLA 1S8FA 3O91A 3MPOA 4M55A 4MW4A 2FFAA 3A06A 3OJOA 1W5BA 3DTTA 3T54A 1NFRA 1LK0A 3G79A 3KSDO 2XUQA 3GVXA 1E9BA 4F6RB 1P2GA 4E2ZA 5CEJA 2A35A 1N2BA 2FR1A 1R6AA 1JTVA 5ABPA 1Y8RB 2A5JA 3FA2A 2J3JA 1E3IA 4JAVC 4A5OA 3VFDA 2E5SA 4I2CA 4RCYA 1AUQA 4BQSA 4J6EA 2Z4TA 1MQ9A 2QYOA 3FYCA 4MWBA 5KOYA 1NK4A 3QTTA 1Y6JA 3I8SA 1C41A 4HR7A 2WABA 4OYHA 2G4CA 4Q47A 5I48A 2QZ4A 2Q9AA 2VT7A 1PV1A 2J85A 4K6CA 3T9AA 5FQOA 1P0PA 2WTUA 2BBTA 3TLAA 3HB4X 1JMKC 3RVSA 4BZPA 3W3AA 3H1GA 4C6SA 3WMGA 1IWOA 6AT1A 3PC6A 2CGEA 3SEQA 5HQJA 4L8YA 3TSZA 1HDRA 3F53A 3QFFA 1WUTA 1ZIOA 3A6JA 4FLFA 1BX3A 4BJ1A 3LVBA 1R37A 2CV1A 5IP5A 4RIIA 4PSAA 2GLUA 5FKJA 3HT3A 3QVTA 1MORA 2ODBA 4MVWA 3KCNA 4HDNB 5B6IA 5K0TA 4OLFA 1O3YA 3DDUA 1FYXA 3EE6A 1ZVMA 4GXNA 5FTKA 1QAQA 1A04A 5ALPA 4J03A 2Z5VA 4C7MA 1TD1A 1R0RE 4M76B 4EG4A 1KZYC 1IXRA 4UM9D 4YB8A 3RJKA 1TW2A 1H22A 4DN6A 4PBRA 2OECA 1H0KA 3M9XA 1D03A 3UAVA 4YUZA 1E5XA 5FF9A 1I33A 1DC6A 3I04M 4XQGA 3TW8A 1O5OA 3KKOA 2I4LA 3GA0A 3KPVA 1FRQA 2CB0A 1LLQA 1C1DB 9LDBA 4HDRA 1Z13A 4JV1A 1D2AA 3BTUA 5CG2A 1Z25A 1M2GA 4CGZA 1EFVA 1P2BA 4MYSA 5JPDA 4BMSA 1SCUA 5T7BA 1R4AA 2DQNB 3VX4A 1BGXT 3GU3A 3HP7A 4R7ZA 3I9MA 4NAVA 4G0XA 1R9GA 1USVA 3GZ4A 3JD4A 3V7YA 1QNFA 3QE2A 3DUFB 2EDAA 3P4UA 1ZOIA 2V4RA 4MWZA 5LP1A 3ABOB 2NQTA 2RMKA 2G1KA 5C7LO 2XCPA 2YWCA 3EBPA 4ZREA 1BW9A 1Y1QA 1OH6A 4RCZA 3BE8A 3WRVA 1SOUA 3UT5B 3HU5A 4MKHA 3Q72A 2PMDA 3WLMA 3RK4A 4OFXA 4B87A 4LW8A 3G0GA 1ECGA 4UHJA 1MC8A 4I1OA 4WCVA 2HO5A 4KIJA 3W5CA 4IJWA 1FSSA 3O92A 4ESHA 3U1BA 2YJZA 3BT7A 4I4IA 2VDJA 3ZDYB 1XZLA 3EASA 4GZ3A 2XY6A 1QRRA 3H19A 4LS3A 5J47A 2VF4X 2XY5A 4EA8A 3FTCA 1JAXA 3CRW1 4MQEA 1KJWA 3OU2A 4I7EA 4FMBB 3GGDA 1QGZA 3T34A 1KDHA 4G9GA 3LZ6A 5HBRA 3TIGA 2JLWA 3AIIA 4EX7A 1ISRA 2BFFB 3IP6A 1KYVA 1D7OA 3ROFA 4YPVA 4V03A 2K5UA 4DKJA 2TMYA 2IUTA 5CA0F 2ZG6A 3DUWA 4DLVA 2NO9A 3UENA 3ZV6A 2E3JA 3RHSA 3ZGOA 1NZPA 3DZFA 1JWBB 4QXOA 2DR3A 1N5KA 1UZAA 3NHMA 4CL2A 3BCRA 3U60B 2XXAB 4BMOB 3S3TA 1P2FA 2PRZA 2EBHX 2CN1A 4QPDA 3HU1A 1IB6A 1NOKA 2QJOA 3FJYA 4B5LA 5L3QB 3OFND 3AVQA 4LBWA 5BWCA 2HLPA 5AJZA 3TIIA 5IC4A 1ZIYA 3KHHA 2VYCA 5IN5A 5GM1A 2AZ4A 1XCLA 2JRLA 4D9HA 1AJEA 2QVGA 3RJFA 1E1CB 1LSJA 5AT1A 2XUIA 3PEUA 1ZMBA 5ECDA 4Q66C 5CHGA 4FI3F 2QJFA 1YJXA 1KL9A 4MW5A 2RD2A 5KJEA 3AUUA 2QNRA 3SY8A 1OPRA 3VDRA 4LWOA 5KFRA 4I4TA 1QS0B 3G2HA 3TAPA 1F3OA 5BOMA 2BZSA 1VJDA 3NHBA 2O3QA 1WQ3A 2C77A 4UTPA 3AY3A 3PLAE 4KH1A 1U9IA 3WWCA 2ZBPA 2BQUA 3HILA 4UAUA 1Z4NA 4OI2A 1R0ZA 2KB0A 3AUKA 1IRIA 2C1XA 1NW4A 2ZT6A 1G2IA 3CF6R 1V45E 1UM8A 1N78A 5AIAA 5KTNA 2QAGB 3FW1A 3KKKA 1TKAA 1W5SA 3WQBA 4RQ6A 2QQ0A 4J0JA 4M1YA 3PKIA 5L45A 2VT2A 4ILKA 2DTXA 2H4JA 4QVIA 1A4RA 2ST1A 1T26A 4HUQB 3CLHA 5AJUA 4C29A 2ZBFA 2PR2A 4FFOA 3EGXB 4PYLA 4CF6A 5DQIA 4V0OA 1ORWA 1F7UA 3R75A 3UB4A 4YAJA 1CI4A 5JDIC 5I9LA 4RZ2A 4LSMA 4Y2TA 2P3LA 1L4FA 2J09A 2BPCA 3H0MB 1XZMA 3M3DA 2QAIA 1TEXA 1A0OA 1C1XB 1Y48E 2HJHA 4FPXA 4ZT6A 1VI2A 3KJXA 1LLFA 4FGSA 3W8RA 4RKYA 221PA 5CRXA 3GQBB 4DA4A 3LUHA 5B58T 3IV7A 1K7XB 2BMJA 1E62A 4TMKA 4ECRA 2APJA 2CXOA 2QE7A 3L7CA 4YECA 2LGJA 4YH1A 2R4TA 4ZQHA 4KN8A 2XVMA 1Z0IA 2AZTA 3RHFA 4N01A 3GYGA 1IK4A 2HXYA 1GNQA 4WNCA 3ACDA 4GMGA 3HR4A 1ZN9A 3B6JA 5JHHB 3O9MA 5BT8A 4E2FA 2HLDA 5KNDD 1RRVA 4OLBA 1GG9A 4XYEA 2GOLA 4PONA 1NG9A 1WUKS 5EZYA 4CR7A 1KY4A 4WEQA 3T4UA 3VR5H 1L4HA 1KKMA 3M6WA 1ADFA 3KQKA 3A0BU 4GM0A 4YUYA 2CVOA 3IOMA 3ANYB 2QD2A 3WWEA 4MUIA 5EMLA 1IDN1 5SY9A 5EWGA 5IXSA 3ANNA 4XOIA 2MU2A 3PDCA 4XM2A 3DVAA 3C2LA 4IX1A 4TUYF 2PT9A 2JD1A 5ARDA 4ED2A 3EF3A 5T5QA 3QLJA 3Q1LA 5AVSA 4QWDA 4ZEXA 2G70A 3MABA 1KKUA 2Z6UA 2ZRDA 4BJ3A 2PVSA 4UAGA 1KH2A 4PINA 4CI0B 2PZGA 3ZZ1A 3VGJA 3W9YA 4DQ0A 1E6KA 4R3NA 3DZ8A 4QKQA 4F9TA 4DRYA 3ZDBA 1RRPA 3QYJA 2AOXA 3BF8A 5K8CA 5KFBA 2IYFA 2HCFA 2JJ1A 3OX1A 1U7PA 2CK3D 3BK2A 2QRMA 2RHBA 2HHVA 4GXJA 1RVV1 2PL3A 4L9SA 2GCOB 3WG9A 3JD2A 1GA6A 4W9NA 4GPBA 3RFVA 5F52A 5F9FA 4KQ9A 3M5WA 5DLGA 1LK7A 2XI4A 1O96A 3OIWA 3DL4A 3VVLA 1H6DA 1ADBA 3GJSA 3K53A 1DBWA 1ZD3A 2DFKB 4US1R 4BO7A 3PF9A 4R64A 3REGA 2E4UA 1SUCA 2BGKA 2QSYA 3RIGA 2QS9A 4PS0A 4P7KA 2WE8A 1LCIA 2PPLA 4G89A 2AMYA 2RLTA 5F1KA 5IF3A 3ZI7A 6REQB 5JRDS 2HSZA 5FO1A 4FYMA 3U4QB 1MZPA 3DAPA 5FBHA 4G0ZA 3TAHA 2IBTA 1JJ7A 2WOJA 4D9CA 3TI7A 4MUNA 1XG5A 5CB0A 2CLEB 1ZCFA 3RQIA 3IM1A 5CVTA 4GOMD 5K3EA 1SHZA 3HU2A 2PGAA 4R63A 4UB1A 1V6AA 3UG6A 1SZDA 1YFLA 4MFAA 4Q9IA 1ICIA 1ZGBA 1K7EB 4LQ4A 2M32A 3FI9A 4NPHA 1WMSA 3NHSA 4F92B 5AK6A 1ZN2A 2VDOB 1VKZA 3GRUA 2REQA 3DXYA 3R7AA 1G16A 3ND9A 1YRLA 3KQMA 3CEJA 2XMRA 3OC0A 4OHUA 4YVFA 1UPTA 5BW6B 4D3ZA 1QIMA 1V11A 4IXTA 4XUEA 4G5RA 3CY6A 4DEYA 4NYMQ 4K4IA 4JBNA 4O8ZA 1D09A 3MWGA 4DQKA 5IYZA 3M9OB 4TZKA 2DPIA 3R3XA 2NNLD 4KIGA 1RRKA 1WSWA 1L7VC 4KSYA 3X2FA 4AWAA 2JIBA 5A4KA 1Q1BA 4UQOA 4HV4A 1TQ8A 2GFIA 5KFGA 4M8IA 2OY0A 3R7WB 2AGPA 1ZOOA 3FHTA 4EW1A 1W0JD 3W6PA 4C1NA 5IWAB 2DFNA 4UD2A 1WMEA 2WY2D 1TA0A 2J48A 1V48A 4FMPA 5C5DA 3D3JA 4B9SA 1H5NA 1DV2A 2JGIA 1Y5IA 1KSFX 1ULZA 4ZIRB 3A3YA 4RUAA 5BV1A 4Q9HA 2Y0BA 3NIFB 1NHWA 1HNXB 2IDZA 5DZSA 4LE2A 3GFBA 1SL2A 3W5BA 4IILA 4A0GA 2XVTA 2ZSFA 1CQPA 2Z43A 2C3OA 4Z5XA 3IMGA 2JASA 4JQCA 5DB6A 2XNKA 1XL0A 1QE3A 2BFPA 2JD2A 3WJAA 2FMPA 3TLZA 4B32A 4HUTA 1T3LA 2CLMB 4BNKA 1CY4A 3N74A 2CYBA 1ORVA 5CFLA 4JLVA 1F2UB 3CVOA 1SZPA 2RQ5A 2HR1A 2OSBA 1OOEA 4G4SO 4XGNA 3PFIA 1Z5VA 1KYQA 4IUCS 1U0OC 5F7ZA 3G3EA 1EH5A 4LYEA 3F6YA 3CWQA 4DILA 1BG6A 1ZHOA 1JSZA 2A0XA 4AF6A 4ROTA 2WYUA 4ESEA 4W4TA 1QF9A 5JOQA 5BOLA 1Q15A 4Y2QA 3STTA 3OIDA 1CETA 3N9IA 3HJRA 1U0FA 3LI2A 2SECE 2DB3A 2H0AA 3HKZF 3D2LA 3FVQA 4DMHA 2W6ZA 1OIXA 3QPVA 1DOQA 2CNBA 2GAFA 2X8LA 1YQQA 1MFPA 1UQUA 1Z19A 5ES4B 1WVIA 3JQFC 4W8HA 3FNRA 3AF0A 3PHBE 4LE1A 3PR1A 4DA6A 2H3VA 2C2BA 1RR6A 1U0SY 1UJ5A 1G20A 1A88A 1KZ4A 2UVQA 1WIWA 4JEUA 2Q5QA 5AWFC 1HQDA 3KT8A 1X9XA 2D4AA 1R8YA 4R1NA 3DL0A 2V98A 4DYHA 5KIAA 4EZ9A 3DWFA 2OSVA 4YWHA 1B93A 5KYVA 4KLQA 4BN0A 1GZVA 1KNQA 3G02A 4TWRA 3S2YA 4W7SA 4X1KA 3HJGA 1ZLXA 5COAA 3HH8A 1CRPA 1A7JA 1KC1A 1SWVA 2WB1C 8ICCA 2OFXA 2ZS8A 2JIDA 2B1JA 2FX5A 3WLTA 5DGAA 3E3MA 3G2JA 4QOHA 1HDXA 3L6CA 1TGVA 1YRYE 2AJ8A 1UKZA 3RF7A 4MITA 3DLPX 1B8NA 2O7RA 4YP5A 1GGHA 3MWDB 3JVUA 5GV8A 1COWA 2ZJ5A 2WG2A 1AVTA 4F2GA 4J76A 1O08A 4PYKA 3D2CA 3EVGA 3ML1A 4X7MA 1YCHA 4GXTA 5E4FA 1OX4A 2C5EA 4QDUA 3QUTA 5KX5B 2EJWA 2UYOA 3LUDA 3NETA 2GYVA 4DQXA 4UUNA 3OCXA 2JEJA 5DSXA 3LYUA 4HBGA 3DBIA 3QI2A 1QPGA 1N2ZA 1NKVA 2R11A 3L3BA 3I28A 2ERXA 3RT9A 1LU9A 2AZMA 3DB2A 1BFKA 2RGUA 1TYEB 1USUA 4QXMA 1LBTA 4LXUA 3USZA 4DM3A 1COZA 4JWKA 4XIIA 1ZCJA 3W1EA 2VUUA 4G1MB 4OQQA 5B1DA 2FW7A 2EQYA 1SH7A 2A30A 4KWEA 3AQ4A 4H0NA 4DR3B 4RGYA 5SY4A 3KE9A 2HCJB 3UOWA 1CR2A 3L92A 1ZESA 1WZUA 2D1SA 4CV2A 2MU1A 2VSNA 3TUIC 3W5VA 4A7PA 4AY4A 1F1BA 1EFRD 2E9SA 2MWMA 3DTVD 3ZKWB 2GN1A 2EZ8A 3C0KA 5EP2A 4FW9A 3IIMA 2VKQA 3PC4A 4ZVMA 2WWVD 1E9VA 2H5EA 3H7IA 2E89A 5AI6A 3K96A 4CKCB 2QV7A 2NU8B 2PTHA 1KP9A 1QMPA 1ONPA 3WL4A 1ZQXA 4WIAA 1WXWA 2GWRA 4WADA 2V6IA 3QVLA 2OCEA 3JQBC 1JIVA 3AINA 2GYWA 2AGQA 5KTQA 1XAIA 2AYXA 1JR2A 3HWSA 5CPFA 3EZ9A 3K8ZA 3DMFA 4F9FA 1Z6XA 5A0LA 1SVUA 3TSOA 5F9MA 3T0IA 1U7DA 3VPAA 1J8YF 2NTYC 2EEZA 4NK5A 1U2DC 3H5OA 3B5IA 4M9NA 2OKCA 3R2JA 3PV8A 3MC1A 3K2IA 3FPAA 5IKEA 3S5UA 5ETJA 4A36A 2DE0X 1JQEA 3ZWNA 1B73A 2Z8YA 3EHEA 1GLGA 3HCWA 4PU0A 3FCUB 5ER9A 2BV3A 1JU9A 3RTGA 3A3OA 3AM5A 3KAKA 1XZBA 4UPEA 2DCMA 1E5VA 1ZOSA 3LMKA 3H6KA 4P4SA 3Q8XB 2HL6A 2A1UA 5EFZA 5JD5A 3GUHA 5DTJA 4UTVA 2FFQA 1CVIA 3N05A 1Z15A 1T4CA 4TKUB 3UPQA 3DXZA 3NDRA 2F2AB 2BGUA 1WDTA 3WX0A 1THGA 1TU3A 3VZBA 2GF2A 4MDEA 1DIOB 3G7SA 2NV2B 2KZMA 1DRUA 1AKEA 1ZQNA 2VVTA 4DOAA 1M76A 1A5BB 3LECA 3INGA 2AXTU 3E8XA 5FNVB 2WW8A 1M2NA 4COOA 4RTKA 1J8QA 3T5HA 5A9SB 3RTDA 4CMAA 2ZTVA 4WVLA 3ZUPA 3U4MA 2PAFA 2GWHA 3LDAA 2ZB8A 4B7ZA 1I2DA 4UHKA 2PKWA 5K8JB 1VLVA 2C7PA 1AGXA 4DOCA 2CUTA 4BQFA 4R0NA 2OBLA 5AXDA 2AG1A 3STWA 2QU7A 3OHMA 4C03A 2JS7A 3JQEA 1VG8A 1F3LA 2G0NA 1Z06A 3A2MA 5KOJB 1F12A 3P2MA 2VH2A 4D3FA 2WINI 3A7DA 4GI7A 4IGAA 4QFCA 3AMVA 4XWGA 5KYYB 4E5YA 4J8PA 4L27A 3QVJA 1D8LA 4JP5A 2FMUA 5EINA 1Y9JA 5HIJA 3CLTC 1DO2A 3ADBA 1A2KC 2JLUA 3MWEA 4C3ZA 2KS6A 5AUQA 3BWVA 2GD0A 1QH8A 3VO2A 3BQNB 3AU9A 3ZD9A 2F2TA 3KJEA 4XWKA 3T1OA 3HP4A 4NCHA 1BS1A 1BE1A 2PYZA 4BV3A 3M6LA 2JFHA 1RSZA 1NYLA 1U48A 1TUBB 2I9GA 3FOEC 3N2EA 4YJ2A 3EFEA 5KFHA 1TEZA 1Q3TA 4B3RB 3OCJA 2X4IA 4L4SA 4G1FA 2FP4A 2ZSAA 4CNBA 2COEA 1KNXA 3HSKA 1E3WB 4RORA 4W1RA 4OQDA 3I5MA 3B2QA 1OZAA 2CVQA 4MI9A 2QRLA 2QM8A 4W5HA 5I01A 1Z8NA 5KJ1A 2FX2A 5JYBA 4DSIA 3PD1A 4RIHA 5A4IS 2VPQA 4Q1AA 3ZBUA 4KYIB 4W9RA 4H1UA 2QM0A 4YRKA 4IDEA 2SBTA 5T6BA 3TIFA 4F1KA 5EQFA 1CR1A 1A5AB 2O6LA 2I2WA 3AB8A 3RU3A 2WTAA 4I5DA 3GDXA 1QH1B 1V39A 5B1EA 5E4YA 3BH7A 3GIWA 5SZKB 3MFHA 2YQZA 2QZ9A 4I5GA 3UCXA 2R85A 4MS1B 4TLLB 3VYRB 5D00A 1KO8A 1FFXB 3O8OA 1H2RS 2MAXA 1E1LA 3LQ1A 2QDXA 4JBXA 4CQMB 3LBFA 4OQMA 1E9AA 4CHTA 4BVBA 2Q4BA 3VUEA 1GUDA 3NORA 1IZ9A 1OFHA 4B2YA 2X41A 2PKCA 3LCJA 1TPYA 4IQUA 3KZIU 1Y4UA 3D7KA 2VHQA 1ZMRA 3K16A 4Q7LA 3V1LA 1W1WA 3KXPA 2Y2UA 3NHYA 4AMYA 1VZ2A 4EHLA 3ACBA 2LMRA 1J5EB 5FEMA 2UZ1B 4II3A 1SUAA 1GZ4A 5LP6C 1KE1A 3FUXA 4BP1A 2QT9A 1UFKA 4UEJA 2BI7A 4IZ6A 3VZCA 2IUUA 1KL7A 3UHOA 4LRYA 3GJ8A 3D1LA 1GPBA 2PX0A 4YR2A 5FHRA 2RAFA 4Y0VA 3QFHA 2OT3B 3L6UA 2XWQA 2X42A 1OMOA 1AHHA 2DHQA 2XT9A 4M7OA 4ZAVA 2WU4A 4NKRA 3FSJX 5A02A 1ZQYA 5C46F 4E3WA 4LJYA 5I6DA 2CXUA 2RGYA 3X2EA 2CD9A 3NWBA 3HYCA 3DE2X 1A71A 3UUGA 2ZIXB 1JHYA 2XCSB 2ZTCA 4D6YA 4DXDA 2D2EA 1IQPA 4NBNA 2XVZA 3KYIB 4NS4A 3A9UA 1D6JA 4KLDA 4DMFA 1XUOA 3T9DA 1TCVA 4QULA 3GDOA 4RS3A 2TMGA 4I46A 2NZJA 4U4AA 2QPLA 9GPBA 2QX6A 3RASA 1L4YA 3RYFB 3OH8A 3CR3C 4I0WB 5B5EU 1VG0B 1UOOA 2R6JA 4DOMA 4GVXA 3ICEA 4B33A 1IJKA 1EYZA 1JFFA 3TRKA 1OBFO 2NSDA 4B8WA 2FEXA 1W44A 2RGXA 4KN7A 4ED1A 1V7ZA 3GLIA 1OLOA 2CLHB 1EX6A 3FUUA 4NCJA 4KQGA 2W2LA 3KSMA 4DLZA 1U2GA 2F59A 3E05A 3JD3A 1GUAA 1MX3A 1CT9A 3L4PA 3JZMA 2KJQA 4B76A 3WHLA 4EKNB 3TCXB 1WY5A 4X95A 3OIVA 5KHAA 3TANA 4ZARA 4CMCA 1SG6A 4CU2A 3C6YA 5KFPA 1AURA 3PT9A 5EJ2A 4ZYTA 4MLDA 3OE4A 3PYXA 4UM7A 4JDPA 3I0ZA 1K6EA 3FWYA 5TT0A 3MS7A 3W5DA 3ZGXA 4WHMA 4JEMA 2C2HA 2Y0SF 1LBEA 1ODKA 1VE9A 2R8YA 1JJBA 3BH0A 4JP8A 4RIGA 2O8DB 1QPZA 2OOKA 5EJGA 4U7HA 2QVYX 4EAAA 2P0YA 4IMRA 4H6WA 2JH7A 3D4NA 2AD1A 3DOEA 1JH8A 1M1YA 1Y9AA 5ARCA 2RK3A 4DBLE 3UJ9A 4RACA 3ESRA 2XXBA 4KLIA 3LPLA 4NK4A 2VDVE 1SPXA 3PNCA 5C4IA 2PI5A 2C7QA 3OPQA 4HQLA 3AF1A 3CKKA 3DJFA 4HYKA 4RULA 4HI0E 2GESA 4GD3Q 1JHPA 4DMKA 3PW2A 3VNQA 4IHJA 4F96A 4CT5A 3R3UA 4GSKA 4DQUA 1F4PA 1CE8B 4BO1A 2XBMA 5BR7A 4N3GA 1HEIA 1I6MA 1U7WA 4HQ6A 4BE7B 4Y1RA 2CC2A 1ISHA 1CUCA 2WAXA 4N03A 3ZWBA 4BFYA 1XEXA 5J5CA 4S1VA 1L5SA 3DS8A 1XJ5A 5K2OA 3G2KA 4NJEA 2PS1A 2FSIA 2PLWA 3KVYA 4RGQA 1PWHA 1FS4A 2NZXA 1L7PA 1SIWA 4YV7A 3FCSB 3WC4A 3B9BA 1ZINA 4UNSA 1E2BA 4UBJA 4IDGA 3H9BA 2JLXA 4TS4A 2P77A 4MF8A 5HR6A 1G60A 3AIMA 4MDFA 3DL7A 4YWJA 5FOQA 1BWSA 4WK6A 1B3BA 2JLVA 1ZWKA 4QDOA 5KFVA 2O7VA 3AILA 3GLTA 3R9XA 2Q50A 4I2GA 1CW2B 5K5EA 1WV0A 3FHLA 1X77A 1KQNA 5G0SA 3R7BA 2H7XA 1EUCA 4KFSA 2PV7A 1LI5A 1EUQA 5JU5A 2QY6A 2GPAA 4V2IA 2YIVX 1LV5A 5DB7A 3OU6A 4PYMA 2BM8A 1XTZA 1PUZA 3DM5A 3PSIA 1RTKA 2P75A 1K6JA 1RZ3A 2PQMA 4ZYVA 2J5RA 2GSWA 2ZAOA 3NAQA 3C70A 4RMGA 2OFFA 2OXTA 2QARB 1PIWA 3PIDA 4ZN6A 1CVRA 4BNFA 4PV7A 3BRSA 2PQ2A 4WN9B 3GVPA 4ZO4A 2IS2A 2ZWIA 1R8JA 2B7BA 2NRXA 4FYYA 3MXTA 3UUWA 1A4IA 1O6ZA 2OWDA 2PZMA 1PWYE 3UXNA 1C9YA 1L7AA 1K0FA 4U5XA 5JSQA 1GAXA 1EM8B 1EVYA 3AJRA 4FFBA 9ICIA 3IILA 5IDQA 3ITKA 5K09A 4GOND 4F5YA 4AFNA 4BWJA 2AF3C 4P9NA 4M9XA 2YASA 2B3TA 4CM3A 4Q0MA 4C08A 1C8BA 1KO7A 3FNQA 2OILA 3SLRA 3ND5A 5JG7A 4I28A 4OO1J 2C7OA 5AHOA 3VKHA 3C4VA 3GV8B 2IXBA 4UZEA 5K8VA 1MH1A 4A0RA 2Z4SA 2LHTA 3RVDA 1FU8A 2M1XA 1LX6A 3ZWWA 4CR6A 4ECWA 2F8KA 1K06A 3OLVA 2DWOA 3WDSA 1RRGA 2Z4RA 3A10A 3ZJ4A 3KHSA 5B2ZA 5EJ9A 1OT3A 2HTFA 2WWWA 3H5TA 4Z1OA 1CJSA 2OBFA 3HU3A 2DU8A 5J43A 3DMDA 1JR6A 1C4XA 5H70A 3IAS1 1GU7A 4DJFC 1YZUA 2QWXA 3BIXA 5CDFE 4O1HA 4BKRA 1CEZA 5KFQA 1A1VA 3IAEA 1D2MA 3WB0A 1YBMA 2QENA 5T8KA 4AVYA 1ZVKA 1KO5A 4IS3A 5D6OA 3ZGLA 1EFAA 2X0NA 1LDNA 4AYBF 3PWSA 4JXXA 3W3AH 1GUYA 3UGQA 4GQBA 1RADA 4W7IA 1W96A 4NFSA 1BMTA 2ZAMA 2O4CA 4S1TA 4LF4B 1H85A 4PGGA 4OD0A 3DF9A 4F1WA 4XWAA 2IP1A 3NZEA 1CZRA 4U0KA 3BHIA 3LKZA 4U3JA 4CIXA 3I12A 1QTNA 3NS7A 2X40A 1GZ7A 4IQWA 3OURA 3WFJA 4RH3A 5IUNC 2W9BB 4GBJA 1EWRA 2O1SA 3OOEA 2AJTA 4IC9A 4DCSA 3B1XA 4IV8A 3T3HA 5DGBA 2VTBA 2KD1A 3ER9A 3WWZA 2ZUCA 1Z6QA 5AKKA 3SAJA 2LDBA 1T2EA 3ZW8A 1NNSA 3B38A 3IODA 3RJIA 2NRVA 4PTLA 1TECE 4A10A 3LZDA 2WWFA 2NVUB 3Q3CA 1NUAA 1ULUA 4LY3A 4FW8A 3IT1A 3LC7O 4HLUA 3REFA 3QVWA 4ATNA 1MQAA 2G9VA 4FEAA 1II0A 4KO2S 1C7ZA 4JOBA 2W8LA 4MW2A 4EB8A 5BN4A 4Q4JB 3A37A 1C7RA 1NX6A 3P9QA 1ZO8A 4PQFA 5F35A 1T8YA 1AKTA 4P3NA 3SFTA 4BVKA 1F5SA 3RS5A 4HS4A 1AA9A 2JK1A 3G2LA 3L0CA 3UUEA 4M9HA 1W6UA 1NM5A 5IBCA 4XM1A 1XO0A 1A9ZA 1NJSA 4RSGA 1HZJA 2VWHA 1YIAA 5KEIA 4ZVNA 3C7TA 1X6JA 3C21A 1HSZA 1W2WB 5ER6A 4DSAA 4UW9A 3QI7A 4XVCA 4J3JA 1TADA 3S5JA 1VRVA 3JYLA 4MRNA 1JHUA 3V4OA 1OBOA 4OFBA 1BDHA 3H7AA 5DWVA 2RHWA 1YA4A 3MW8A 2I9PA 5TPWA 3LG2A 4A2QA 1QOZA 3UXMA 4DZZA 1YH3A 2XOEA 4B45A 3FLEA 1U2RA 1W5EA 2Y0CA 4K88A 1JGTA 4IDAA 1RBYA 3LPCA 2WNHA 2W48A 2DFVA 3WB2A 4E0BA 2VTEA 3UA4A 4W5WA 4OG2A 2B2NA 1IXZA 2LBPA 2UVPB 4ED7A 2VWPA 4K6MA 4QQRA 4XEHA 1P5HA 1ZJ4A 3OQBA 4NE2A 2IV3A 4RYLA 3TLXA 4H27A 4A3SA 3T9CA 4OAOA 1KI6A 1YZQA 3H13A 4HH3C 1SULA 4KG7A 2X58A 5AYVA 1WETA 3ZDEA 4C30A 3SJUA 2TSYB 3E5RA 1KSHA 5CJ7A 3MMXA 5DNEA 2EW2A 5EIBD 3QLVA 4UPVA 4KPFC 2COUA 4QVKA 3G0BA 4HGQA 5JQGF 3H84A 3RYHB 3IV6A 4NBUA 2ADFA 1XXHA 1KFTA 4HB3A 4GVPA 5FR2A 1S4QA 1PE0A 1LBHA 2IOFA 3MJDA 3SXUB 3OGUA 2X9QA 5BV7A 4P7JA 3QEOA 1JI0A 4QTUB 2JCBA 3W2TA 4ZQCB 4TTJA 3NP9A 4I9HA 3MQ2A 1K8ZB 1N6PA 3T3GA 3JD0A 4OHMA 1DXQA 4QG3A 2J9GA 4AZTA 4MB6A 4PLYA 4HXGA 2HCRA 4RABA 3SJBA 8ICOA 5FIUA 4O3MA 3IDQA 4OMUA 4EJ0A 1SCIA 2ZR0A 3WMFA 3NC4A 3WGUA 4KR2A 2HSJA 1JXOA 5KVCA 1G2PA 1QCDA 2ODNA 1CBUA 1C14A 1WO8A 4IICA 4U7JA 2YQ4A 2WG0A 5AIBA 4DT1B 2AZXA 3P5SA 3F9IA 3BD9A 4O29A 3UMMA 4TZ0A 2ADOA 9ATCA 4WDQA 3UZUA 2XSZD 2DBVO 1XCPA 4DTCA 4BFLA 1UF9A 4JV0A 1WV1A 4MV5A 4FUTA 4AKTA 1OZGA 2I2XB 4TN5A 2YFQA 3ZBTA 3ON5A 3MTEA 2BFMA 4HG2A 4UB8U 1B43A 4ZQEA 1HYQA 1GRQA 3PFCA 3WAKA 2R44A 2W2VA 3L0IB 5J58A 4MX8A 5J3JA 4F93B 1D2HA 4PW0A 3LT2A 4EELA 1TF7A 1U8ZA 4MR9A 4QTYA 1PJ3A 1V47A 1OAOC 4YAKA 1UINA 4FONA 4DJAA 2XRYA 2O0HA 4B4VA 5AJVB 4MJ7A 3ZD6A 4F4CA 4N4AA 2HSWA 5LU9A 5HIMA 1BXGB 3KTAB 4EGCB 3Q3HA 3TVTA 2QR3A 9ICXA 4ZVOA 4MW9A 3AR3A 3OX3A 3K70B 3HR7A 3Q8MA 5JS2A 1IVNA 1XTJA 5J1TB 1F8FA 3FI0A 2A58A 1XJWA 2JZNA 1SUDA 3K72B 3AUXA 1CUZA 2G1JA 3IP3A 4DQPA 1SVNA 2JLQA 2R8BA 2FEMA 2RH5A 1CP2A 3H1FA 2XEXA 4Q00A 1S3SA 4BMZA 2KBFA 4WW0A 2G9ZA 2MA1A 4D81A 2OR3A 4JI7B 4AX8A 4L2IA 3HVIA 5CM2Z 5FLKA 1A82A 9ICBA 5DCYA 2QG9A 1L7DA 2EWVA 2KSOB 1N3YA 1QG0A 2PAAA 5K6AC 3S29A 4O9MA 1R6XA 3RH6A 1IU9A 1QHHA 2FXIA 2OBBA 3GXOA 1J97A 3L6OO 3HKBA 2KE7A 4U9HS 3EMVA 4H77A 2JFFA 5DTMA 4ZMSA 1H0HA 5KSPA 1A5SB 4RTPA 4B3TB 3RARA 5AI4A 1POWA 4NJ8A 1V7PC 1WCXA 3C7CB 2YJGA 4BCBA 1V1MB 3WSVA 1KIAA 2DHEA 3LVRE 3PDIB 1R5OA 4J0IA 3E27A 3USES 3FTQA 3LHDA 4HOYA 5DBGA 2LIPA 3UPTA 2YQEA 3CNLA 4RVSA 3MBKA 3GJ3A 4OM8A 5J2TF 5ALLA 1RC1A 4KLUA 7MHTA 2YN0A 2EC5A 3AGPA 5BYBA 4ARVA 3MD0A 3E0XA 4XW2A 2YVKA 3U5ZB 3GFSA 1E3QA 4C7XA 3X43A 2WWHA 1YJ8A 3H97A 2O2YA 4DC1A 2GF9A 2FPOA 1UCFA 3TEJA 5JVDB 1AQIA 3G1TA 2W2QA 4IQTA 1EBFA 1XF9A 3OM0A 1DP4A 5DF1A 3MINA 1ZBQA 4TM7A 3SMQA 4O2RA 2VDUE 3QFRA 3S1AB 1LQTA 3Q3GE 3KPYA 4D4JA 2ZYDA 1ZIPA 5BO5A 3HR8A 5B7QA 2OG1A 2OXCA 5DDMA 5FEUA 2N9UA 2X1HA 2N1RA 4BXOA 1J7JA 2M6RA 3D6JA 1T3HA 1Y1RA 4CF4A 3PSFA 4OTZA 2WR8A 2V97A 4MQUA 3KHUA 3BQ2A 4S04A 3BCHA 4PNHA 2H3EA 4LEIA 3OEYA 4CMGA 2V0GA 2XW6A 3PVZA 3R9WA 4TUSA 1N2CA 4RXUA 3KYDB 2Z5LA 4NCAA 1KI8A 2JANA 3SBDA 3A1DA 3E48A 4M2YA 9ABPA 2BHLA 4FGUA 3IUMA 4KQKA 1VG9B 1F9AA 2EZXA 4D02A 5JUWA 3I53A 2FPPB 1VZ3A 3A2NA 3N8NA 3FKSD 5JWOA 1QZ3A 4E2YA 1HDYA 4LDNA 1M72A 2YJNA 2N3ZA 4JI2B 1RMQA 1GAQA 2X9VA 2QEQA 2VP3A 4Q5IA 3ECAA 2ZJYA 1Q7BA 4C7OB 2QKYA 4IQ8A 1PU2A 1SN7A 5JJIA 1L5ZA 3PEVA 3JWEA 1XRJA 4IW3B 1UA1A 1N0VC 1MQ8B 3KOZA 3A70A 4M6WA 2H4WA 2MHCA 5GTHU 1E20A 4JJFA 2HQ1A 2OWEA 1JW9B 1PKXA 5H3HA 4RXMA 3I6BA 3A6KA 1TUEA 2G36A 1FNBA 1MX1A 1R27A 1UQTA 5DH9A 3EJWA 1XU7A 1K1SA 1ABBA 1W36B 2NN3C 4RETA 2VXYA 4I36A 4LYJA 2O57A 4PGQA 1S0VA 4RF2A 3JQ8A 3WMRA 4ON9A 1ACJA 3H5VA 1KAMA 4B0PA 3F7NA 5K2MA 2C97A 3NHAA 1MJGM 3VYSB 3GRCA 3EF0A 3QF7A 5ALRA 1R8XA 4RLHA 3BPSA 1OZHA 2B7LA 4PCUA 4RQNA 3JD1A 2A7QA 1II8B 5G1NA 2DT8A 5CFQA 3HV0A 1D9ZA 1S97A 5AK0A 3GJ6A 2A57A 3OTHA 3MA0A 3LTNC 7ICUA 2II6A 5INTA 1M6HA 1MB9A 3TDNA 2A94A 4W5NA 3AJAA 1X9GA 4XLZA 1XZIA 3RRBA 5HQ3A 4A0QA 4O5CA 3IR7A 4MAAA 5EIFA 4QAQA 3DMRA 2CDRA 1NI3A 5MHTA 2G5HB 3TTYA 5K0NA 3RC1A 4V1CI 4RHTA 4DIMA 2R1TB 3M6MD 1SB3C 1JKMA 3W5AA 2D2XA 1FFHA 1GZHB 4XDGA 4HGYA 4B8YA 2NQ2C 1ZXBA 2X13A 4BWYA 3T9FA 2RSLA 4Y9RA 2V9PA 4L15A 4OGKA 3THWB 2Y9MB 4Q4HB 1VOTA 3UQ2A 4H0FA 2QRJA 5B7PA 1Z47A 4AJIA 2IOHA 4AQYB 3ENKA 4JD5A 3KJHA 4IGEA 1DQPA 1U3FA 2XF2A 4BAZA 4PRZA 4P36A 2B35A 5J40A 1ECPA 5HS4A 2BZ1A 3BREA 4F11A 3IAXA 2RHMA 1V41E 1A8HA 1MQ3A 1GV0A 1X6IA 4BRZA 2HH9A 4C20A 5JH7A 3PGJA 3L82B 5DI3A 1NKCA 1O54A 3RGGA 1QVWA 1SL0A 3W2EA 5KWIA 4TV9A 5DNDA 1ZC3A 2Z7JA 4KX3A 2XE7A 5I8PA 1T0PA 1FYEA 4NX2A 3EEBA 3GA7A 4CG0A 3FDFA 2GXAA 3PRYA 5FBZA 3ORRA 2I33A 1IXRC 2AIRA 1WDWB 2W43A 5KDOA 1CNEA 4OMDA 1KEPA 3BJZA 4B34A 5LPNA 3UMBA 1KTVA 1E66A 5J2JA 2HBLA 1H05A 1F60A 1V7CA 1RVDA 3MTBA 4I6EA 1IHDA 1GR1A 3FMPB 2FVYA 1I3NA 4IQGA 4RQTA 2N42A 1OR8A 3KV1A 5JSUA 4GNRA 2AC7A 1P7VA 3GRPA 1JSCA 1V9SA 4B81A 1PDWA 2BP7B 1EP1B 1VLLA 2FPRA 2X5KO 4MA5A 1AKYA 1U45A 1WB6A 4HXEB 2B4TO 4E1VA 5JS8A 1PVDA 2HMYB 2E8PA 1IBMB 4AWBA 1HT3A 4WZAA 1V3QE 3ZCQA 3D4BA 2IPNA 1GEEA 4AZSA 1N4DA 4I29A 2A0WA 2G5CA 4FILA 3KWFA 4GU5A 1NRXA 3G9XA 3MWLA 1IPHA 2X2PA 3FVTA 5A6VA 3PX2A 2ZB7A 2VK4A 4DLBA 3DVSX 3KZ1E 3T79A 2ZDGA 3OY2A 3ZXIA 1XKXA 2VJ4A 4X7BA 1QORA 1ZSNA 1QQ7A 4BGVA 2D2FA 1N5OX 5CLFA 1OJ7A 5FOWA 1E2PA 1EFDN 3L0PA 3C3PA 2I4TA 3ANMA 2NZWA 1K27A 3RAGA 3O0DA 3LUBA 2X9LA 4YMUA 4OI1A 5TISU 4FGLA 4J9KA 4ZAXA 1DQNA 4O0IA 2W37A 2W11A 4JMUA 4IMJB 3WKEA 4URVR 5JAZA 2C2GA 4MJ3A 1UJCA 3UB2A 4KMOA 1Q21A 3O8QB 3K0AB 2ZIAA 4BWGA 1N5MA 2IVFA 4DEVA 4GOJA 4BWMA 3GC6A 3AUFA 3FDJA 4Y8VA 1GKLA 3CU5A 3A9VA 4I1YA 4YGYA 2ASLA 4QJBA 2OXRA 1HNZB 1JALA 3E9RA 3PJEA 3EXAA 3U4HA 4EY3A 1U0BB 2Z2JA 3LL7A 1ZM7A 4QYSA 4E3ZA 4DDWA 2IEZA 4NDAA 1JG7A 1AXRA 3AVYA 1G4UR 4D1YA 1ESNA 2W3SA 2I87A 4RXTA 1J5XA 5EMHA 4KWHA 1QKJA 1AKQA 4RKEA 1CRZA 1HZZA 3PQEA 4I6JA 5GIOE 3H11A 5IUJC 5JTTA 3E22B 4LWPA 3TQCA 1A6SA 2CFOA 4BB9A 1W25A 2QX9A 3E5NA 1SVMA 3O0TA 4H1WA 3FTDA 5LMCA 2H5IA 5H1YA 4ZDWA 3VPXA 1RKVA 1KYXA 3L0SA 1BHQ1 5C8YA 2W9MA 2NZ2A 1GP2A 1PQPA 2ILVA 1U9IC 5DMXA 1XROA 2RIRA 2ZAIA 1KOGA 1ZQGA 2IYAA 2BPFA 2B6GA 2R8ZA 1GFIA 3G17A 3TE6A 3ETCA 5EERA 5L6LB 4YJFB 3JAWB 1BPYA 3L6EA 3JAKB 4BE4A 3KETA 4TUPA 2QJTA 1CZKA 1QYIA 2YS7A 4ARIA 2ZXHA 5AESA 1XRPA 2P9EA 5LJIA 3OPYB