2HDOA

Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
207
Chain Sequence
MTYQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTFPMAAEQAMTELGIAASEFDHFQAQYEDVMASHYDQIELYPGITSLFEQLPSELRLGIVTSQRRNELESGMRSYPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGMDPNADHQKVAHRFQKPLDILELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycolate phosphatase
publication title Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from Lactobacillus plantarum at 1.50 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 57
structure length 207
sequence length 207
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hdoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hdoA01
1RLTA 3ZX5A 2JARA 3P96A 3VAYA 5ALLA 5AICA 5AM2A 1WVIA 3FPBA 3ZVLA 2Q4TA 4F72A 4I9GA 4Y2RA 3WKAA 3R09A 2IA5A 3J7TA 1XPJA 3SHQA 5IT4A 3DDHA 3U26A 4Y2TA 3N1UA 5AKZA 2D2VA 4EZEA 1T5TA 5ALIA 2I33A 3L8FA 1WR8A 4HGQA 4CF4A 3L8HA 3E58A 3WKEA 4UMEA 2ZBEA 3DV9A 4HGNA 5ALKA 2P69A 2IOFK 4YIHA 3KOOA 2PQ0A 2O9JA 1L7NA 1XVIA 2WF8A 2FEAA 3KD3A 3B9BA 4OCZA 3AR6A 3RFUA 1QH9A 2WF9A 3U7GA 1Z4IA 2P11A 5AW4A 3OCYA 1U02A 2MU2A 1RPZA 3B8EA 3L7YA 2YN4A 2GHTA 3PGVA 3PGLA 2RAVA 2YMQA 2C8KA 2YJ4A 4G9BA 1RMTA 1YDFA 2EARA 1RLOA 4NV0A 4UAVA 4BNDB 3W5DA 4EX6A 4Y2XA 5ALRA 5AIBA 2YY6A 3MPOA 2B8EA 2B30A 4GXTA 5AVSA 4NABA 5AW9A 5AW2A 3UM9A 2I7DA 1ZJJA 4CE6A 1WZCA 2YMMA 4NAVA 4GIBA 4CF5A 1U2TA 1L7PA 1N9KA 1RMYA 1NF2A 5IT0A 4HYTA 2R8XA 2O2XA 3ED5A 5AKYA 5ALNA 2FPXA 3MC1A 2VKQA 4H1WA 1T5SA 2B82A 5AI0A 3MMZA 1JUDA 4G63A 2YBDA 1F5SA 3L8GA 5AHXA 2RB5A 3L0BA 3ZTYA 5ALQA 1VJ5A 1J8DA 4C4RA 1Z4QA 3AR7A 3FGOA 3QUBA 1L6RA 5AESA 4DW8A 2FDRA 4EELA 3NALA 1K1EA 3A1EA 2G09A 2YJ6A 3R9KA 2FPSA 3EPRA 2HEGA 1LTQA 3QUTA 3L0YA 4YCLA 5AVUA 1Z5GA 4KX3A 3QYPA 1TJ3A 4UW9A 1CQZA 1IWOA 4Y2QA 2IYEA 3FPSA 5AVYA 2G08A 5ALOA 1ZD2P 1RQLA 5AW8A 5AI5A 4L6AA 3KZXA 2Q5EA 4J2TA 3U7FB 5ALZA 2B1QA 3NASA 3QX7A 2C4NA 1L8OA 2DQSA 4CF3A 1Z5UA 1ZD4A 5AW7A 2PKEA 1TA0A 3L1UA 3QXGA 2BY4A 5AW0A 3L5KA 4XOUA 3ONNA 4L6CA 4UARA 2PR7A 4BNDA 4AS3A 5AI4A 5AW1A 2ZXEA 4Y3UA 4YGYA 5AM0A 3QU4A 3OCWA 2MU1A 1ZD3A 2WF5A 1U7OA 2HCFA 4PNHA 1T9ZA 1YS9A 5ALPA 1KYTA 4UM7A 3NAMA 2AH5A 3NIWA 5AI6A 4UU1A 2W4MA 1VJRA 4QQFA 3WK8A 5AI9A 5A3SA 4BX2A 2ODAA 3A1DA 2I6XA 3WGVA 5AVXA 2WF7A 3AR5A 1Y8AA 5E0OA 1L7OA 3B9RA 5ALSA 4KNWA 4UU0A 3IB6A 2HX1A 3UMGA 4OD0A 3OCVA 4UASA 2YMPA 3CZ4A 1XP5A 3IJ5A 4RESA 4C4TA 3AR9A 3QUCA 3E84A 3EWIA 3M1YA 5A3RA 3KBBA 1PW5A 1J97A 2HI0A 2P27A 3AR4A 3U7EB 5AIAA 5AKLA 4KYTA 1QYIA 2W43A 5AKJA 2ZG6A 1Z4KA 4O8CA 5AW6A 1RKQA 2BDEA 2ZBGA 4NWIA 4ZEXA 1ZS9A 2BDUA 3ZWDA 1ZRMA 3I28A 1WPGA 3EF0A 1NNLA 2HSZA 5AM1A 5ALYA 3ZUPA 2JAUA 1Z4OA 2G06A 4HGPA 2B8JA 4E88A 1ZRNA 3UMCA 3OPXA 3MN1A 5ALEA 3SKXA 1L8LA 3F9RA 3SD7A 3BA6A 4HAIA 2X4DA 5AM5A 5AVTA 3L8EA 3D6JA 4EENA 2GHQA 5JJBA 2ZOSA 3CNHA 5AKIA 4BEWA 5AKEA 1SU4A 4CNQA 4B6JA 3ZW7A 3SF0A 4BX3A 2ZBDA 4HGRA 3NANA 3U7HB 1RQNA 4BKMA 5AW3A 2AMYA 1YNSA 2G07A 3W5AA 5T41A 5AW5A 2YMLA 2OA0A 2FI1A 2FPWA 3QU7A 3WKCA 4ZEVA 1S2OA 3WK4A 2G0AA 3NRJA 3AR8A 5IS2A 5ALHA 4Y2PA 4BYGA 2G1AA 4MWOA 5ALMA 2C9MA 5AVWA 3W5BA 3ESRA 2JGAA 1Q92A 3ZI4A 2ZBFA 2IOFA 4Y2SA 4IFTA 2MSNA 1L7MA 4HGOA 5ALGA 1ZOLA 4Y2UA 1YMQA 4OFZA 3ZVNA 3I76A 1SWVA 3IRUA 3WKBA 4UATA 3FVVA 4FE3A 2G80A 3OCXA 4XPZA 1EK1A 2C88A 1Z4LA 4DWOA 3U13A 2CFTA 2I34A 3ZX4A 5ALWA 3QU5A 5AVQA 5ALFA 4DFDA 5FP0A 3E81A 4UMVA 3A1CA 4IG4A 3WK7A 2B1RA 2QYHA 2HF7A 4YCNA 3I1YA 4XE5A 3E8MA 5ALDA 4F71A 1SWWA 1RKVA 3AR2A 3DAOA 3HYCA 4EEKA 2RARA 3K1ZA 3PDWA 3KC2A 3N07A 4EX7A 1CR6A 4AS2A 2QLTA 2NO5A 1NRWA 1RDFA 4Y2YA 1RRCA 4BX0A 2OBBA 1RKUA 4FYPA 5AVRA 5AI8A 3L0CA 4BEVA 2R8EA 3ZVMA 3R4CA 5AK5A 5AVZA 3N5KA 2GMWA 2R8YA 1TE2A 3QUQA 4UM5A 3WK5A 3FZQA 4Y2VA 2OYCA 4AP9A 2EAUA 4UMDA 3KDPA 5ALJA 5ALXA 2HF2A 5AKGA 5AK3A 5AM3A 2GFHA 2IOHA 3QLEA 2I54A 3PCTA 4C4SA 1Z88A 2EATA 3FM9A 1Z4NA 4Y2JA 4RETA 3AR3A 1U2SA 2CFRA 3WGUA 2W11A 1U7PA 4ZEWA 3SKYA 2JAWA 4FFDA 1QQ7A 1FEZA 3QNMA 3EF1A 5AK4A 3L1VA 1ZD5A 3WK6A 3RF6A 3ESQA 5ALUA 4JB3A 3N8GA 5ALVA 2FPRA 3ET5A 4I9FA 4YH1A 4J03A 2JAOA 2Q4RA 2YJ3A 2HDOA 1O08A 4YIKA 3A3YA 3QU9A 4NFLA 3WKDA 3TLMA 1RMQA 2NO4A 4XQ0A 5ALTA 2HOQA 3S6JA 1Q91A 1RC8A 1AQ6A 2WHEA 2GO7A 2C8LA 1RLMA 5AKKA 3SMVA 1TJ4A 3GYGA 1Z4PX 1QQ5A 5AKXA 4DCCA 3W5CA 3U19A 2CFSA 5AVVA 3WK9A 4BBJA 1YV9A 4KN8A 2RBKA 4JDPA 3DNPA 5A3QA 2OM6A 1YJ5A 3NUQA 2CN1A 1N8NA 1VFPA 2YJ5A 3HLTA 3SLRA 1TJ5A 4UMFA 2NYVA 1S8OA 4OHFA 2I55A 4QJBA 3UMBA 4KX5A 1X42A 3OTQA 3OCZA 3ET4A 2R8ZA 2WM8A 3I6BA 3OCUA 4YCMA 5AK6A 1LVHA 2FUCA 4MUMA 3ZU6A 4KNVA 3QU2A 1QQ6A 3ZWKA 1O03A 3N28A 4UAUA 2HHLA 2FUEA 1EK2A 2P9JA 2B0CA 2WFAA 4L57A 2AGVA 1Z4JA 2WF6A 2YFYA 1Z4MA 3ZTWA 3QGMA 2AUTA 3M9LA 3BWVA 2FPUA 2HO4A 5AKHA 1MH9A 5AM4A
chains in the Genus database with same CATH superfamily
3HRHA 3ME5A 4H7HA 3FPBA 2NU8B 2IXEA 4RIEA 3T7JA 4X7PA 3K5IA 3E3MA 4AN4A 3IN5A 3HCPA 1XK6A 1NBIA 5DKWA 3KAJA 1Z5OA 5HCIA 2IU3A 1O95D 3CUEF 2EJWA 3M82A 3TLAA 4W63A 5F7JA 2X19A 1JR6A 1UKAA 4DWVA 2W2LD 1HDZA 3GO4A 2WYVA 4DSOA 4ZK6A 4KO4S 1OFVA 4MPJA 5FJJA 1B6SA 4IQTA 2E6KA 5H70A 1DCFA 1CIJA 4KWTA 2PXAA 1L4LA 4ZJYA 5BUCA 1YDWA 2QX6A 3P9YA 4GYJA 1N7JA 1JH9A 5FFNA 1KFJB 1T9KA 4MF2A 2I87A 2PZKA 4J9VA 4CG3A 5E9JA 1UJMA 4J49A 3FSJX 4IHAA 1IEVA 4FD3A 2VANA 4LIPD 5JFTA 3ZGZA 2ZIXB 4FMCF 3R9XA 1ZETA 3IE2A 3SEAA 4ECTA 3HDQA 1GGJA 2WAMA 3UTDA 1HC7A 2H7XA 4YCBA 4OXXA 1IRXA 3HEAA 5HQTA 3WYEA 2BJWA 4E31A 1ZVVA 3HJCA 3L77A 4JZKA 4XX0A 3VYSB 2EW8A 4OI4A 3I2GA 3RF7A 2IVZA 2PSFA 3OQMA 2R3SA 1FFVA 2F3SA 3U37A 3R74A 4HD8A 2WVGA 2IBMA 3V8PA 1A1VA 1JLLB 5E1MA 3H2KA 1CXZA 1HQDA 3PD1A 3ZHQA 1YR6A 2VNHA 3KR9A 5CJ2A 4DRZA 3STXA 1NPDA 4QOJA 1NG1A 3SJBA 5JH7F 4QGBA 1D8AA 3UG7A 1N2EA 3O94A 3HCRA 4U3JA 1RP1A 4IQGA 3DEKA 1K5GA 3RRHA 2X2FA 4TM7A 1Z4OA 5IF3A 2GN4A 4WESA 4L02A 2QARA 4LI3X 3UMCA 3H8WA 1ZQTA 1XA3A 3OI7A 4MGIR 1H6CA 2AFIE 5BSFA 3FLEA 2O2YA 3FHOA 1RRMA 3SS9X 4IRUB 3WGZA 1ID8A 1JZQA 3ZCQA 2Z95A 2V9WA 5HMMA 1D4AA 3U1BA 2JA2A 2ZS7A 4LOKA 1JXLA 1ST2A 3FVQA 5M3BA 1DG3A 5JZVA 3VPGA 5J5CA 3K0EA 4H2DA 1YBAA 2W6QA 1ZXLA 4PPYA 3CUUA 3TRFA 4HX2A 5AOBA 2JHGA 3BAZA 3V2HA 4UVHA 2LV8A 1P0MA 4NCNA 2DUNA 4MI3A 3WLEA 2W6IA 2XUOA 4IUYA 5B4UA 1RKBA 3OFSA 1VCHA 4M8NE 3I5XA 2GSDA 2BGKA 3EVZA 2V4RA 9ICSA 4XRGA 1KFSA 2MJLA 2HHUA 3EEOA 3EW9A 2V96A 3VJLA 3A32A 4P9NA 8ICBA 2EG9A 1N1EA 3VPCA 4AP9A 2ZWOA 4RL6A 3S5JA 3WWCA 4MFFA 3T5DA 3FMFA 3TBFA 1YRQA 4HQRA 2UXDB 1F2DA 2AN4A 2BPOA 3M2PA 4DPKA 2HW8A 4KE8A 4MDYA 4JOQA 2NTVA 5CGQB 1E3EA 1VHTA 4IIDA 3LUBA 4JMPA 1KO1A 3HVRA 4M98A 2JEFA 3VNVA 3S6JA 1Y3IA 3M1LA 4A0RA 4I3GA 4FW8A 2Y0EA 2K4EA 4B09A 2KNJA 3MCWA 4PXAA 4I4CA 2CWWA 3C2KA 4YRCA 1Q0UA 4XTRA 3P9PA 1CU1A 4HLQB 4B3JA 4CDMA 2FH5B 1EKXA 4KR2A 1FFSA 3NIFB 3IKMB 3V34A 2CSXA 4LCJA 3DE5X 3ETLA 3PX3A 4NZNA 4KRGA 4QARA 1KE1A 5DX8A 1RRPA 3K2IA 1JIXA 1MQAA 1MH9A 4X7BA 4BNMA 3VAYA 5AM2A 3N2KB 5KNCH 5KG4A 4O02B 4OB8A 2FG7C 3L79A 2KJQA 3J7TA 2Q0SA 1TCAA 3RRZA 4JOBA 3RC7A 4C7MA 3EDQA 3UXPA 1MP0A 5ANRB 3U3KA 3O7WA 1U3FA 3PW7A 1P80A 4WLFA 1GRQA 1W36B 3CNEA 1P0QA 3FHJA 6Q21A 2XBMA 3U7JA 4BWYA 3I09A 3X1JA 1E3SA 3JR3A 4AFNA 2XWJI 4P4NA 2YJ4A 3RYHA 5EMKA 1I0IA 3W5DA 3RTGA 2J6UA 2K4PA 1XF9A 1RWXA 1CV2A 4ZQFA 4OM8A 3W8FA 2XTNA 2HZBA 4DSTA 4MQEB 2VAXA 3MZ0A 5ALQA 4PQEA 4C8LA 8ICYA 4OP3A 4OMFG 3BZWA 2F1RA 1PL6A 2Q50A 3ELDA 1F8GA 2R44A 5G40A 3W3AH 4Q37A 1FDTA 4AMZA 1WLYA 3MJDA 3QXJA 4V24A 5CT9A 4Q45A 2PSJA 2IHKA 3DEHA 1Z63A 3J80A 1FX1A 4EI9A 4DA0A 3MABA 3QENA 5CUQA 3NJ8A 3L5KA 3ONNA 4DY4A 2G4VA 3GY0A 1M1XB 2GYUA 3D7SA 1ZQKA 1U9JA 4MQFB 2BCEA 3H84A 4AX4A 4K8OA 1MGPA 5GONF 3T6KA 4N3CA 3JYPA 4X1KA 4FEYA 2Y0BA 4M46A 3MTGA 3KQOA 1VB5A 3UWPA 1L5KA 1WMBA 1XOIA 2IK8A 2FSFA 4B46A 1BDIA 5L4SA 3FVRA 1TU4A 2ZPUA 1YBFA 1CEQA 1BW9B 4BV2A 2AI1A 3M6VA 3H5TA 2WJ4A 2J33A 4BKUA 1QYIA 4YMOA 3BAFA 1F9EA 4KLDA 4WV3A 4PLVA 2JFOA 4TMZA 1ZKDA 2RJNA 3Q7RA 4AYXA 4O6VA 3P9XA 2ORED 4EO4A 3I2FA 4FOOA 4M9XA 2OG1A 2PG3A 3ISCA 3FBWA 1L5HA 3EOAI 3ETCA 3CNHA 3P4UA 4YT4A 2K89A 3IDFA 3OJFA 3QWBA 4D8XA 3GCWA 1JLKA 3I01A 3NV7A 1ZSNA 3O4VA 5EXPA 5K3FB 4JV2A 2AEJA 1DNPA 3KSDO 3DDCA 4CT0A 2ZBFA 4Y0AA 3D0OA 1SULA 4HUQA 4L4SA 2XPCA 2GX6A 4H1TA 3RPEA 1R6BX 2BTQA 3V3TA 4DC0A 3N59A 3L92A 3JPWA 1Q95A 1IDOA 5CURA 5INTA 1SWWA 1ENYA 2FTKE 2CZQA 4KMOA 2OBXA 3DT8A 1A95A 1I6KA 2R8YA 2QAGC 2O8CA 3PVCA 3NTUA 1JQJC 4R6XA 2PUEA 1GFWA 1GN9A 3HWSA 3G6XA 3ZE7A 5JALA 5MFPA 2F62A 2BUAA 5JLJA 2WK1A 2VPWA 3BFVA 5LP6B 1E1KA 1HLGA 2FFBA 3AHEA 5CHYA 5E79U 2ISSD 1A2QA 1RR6A 3IHTA 1C3JA 1Y9EA 4MQ4A 4I8DA 1UJBA 5F3XB 1B7GO 3H83A 4D4HA 2A5YB 2HMYB 3GDFA 5DP2A 5ECYA 2ZJ4A 2FKAA 1G21B 1NTRA 3N0XA 1K63A 1CY8A 5SZHB 4MW4A 3ADCA 1X42A 4JWTA 3FN4A 2IWHA 1FVHA 4XI9A 2C9DA 2H1CA 2XKBA 3O92A 3AI7A 1LFDB 1J21A 2BR3A 2IWRA 4RT2A 4YUAA 5BO5A 1ZM4A 4IM7A 5K51A 4I2EA 1F0KA 4HH3C 1XVAA 1J2RA 3K73O 2F1OA 4KAJA 3IRVA 2CNKA 4ZOEA 2ZQ5A 4H60A 2K60A 5CA7A 2HCRA 1RRGA 1NVAA 4HGQA 3VV2A 4F60A 4B44A 4BNZA 4HDNB 3L8YA 4C0JA 3G1WA 3AEZA 5FA5A 4GH5A 2G9NA 1DBQA 4JIGA 4MS1A 3DVAA 5B66U 1VRVA 4OYHA 4D9FA 3HPRA 4A6PA 3G2JA 4CEIB 3V8NA 3GNLA 2D74A 1P2UA 2C7PA 3HJRA 3CG4A 2C29D 4KN6A 5I9LA 2RK4A 2WG1A 5CMLA 2FMSA 1T9DA 1W7AA 1UMCB 3CPJB 4AWXA 3F5FA 1S0MA 3T9EA 2XY5A 2W54A 2AMVA 2C4WA 1COZA 4M2YA 4P7GA 1KAMA 5IJ0A 2ZITA 3AFIA 4TYQA 1NI3A 1NU6A 1Q2UA 3D64A 3LKBA 3NFYA 1IY0A 521PA 4BIIA 1ICIA 5LQUA 3PV8A 1I13A 1QH8A 2GFQA 3IAM1 3T79A 3M6MD 1Y7LA 1VIDA 4TWZA 3HSKA 1GARA 2C77A 1MJGA 1C2YA 1ZD4A 2P9YA 5J5VA 5L3SA 4KQWA 4U7PB 1VPDA 3B7PA 4BQPA 4QC2A 1MAUA 1OD6A 2Q8QA 2JLWA 2Q6OA 2UYOA 3C8HA 4ZQEA 3VZRA 3B9RA 1XA4A 2AJBA 3HLKA 2M6LA 1Q1EA 7ICFA 1TYBE 3EF3A 3V4SA 3M9NB 1SXEA 4B80A 3H5AA 3CMMA 3R1IA 4KYTA 3D0RA 1WQ1R 2J9XB 2EV9A 5IYZB 2WQ6A 4DSUA 4R1LA 4J3FA 1PVQA 2FOIA 1D6NA 3KUCA 1XD8A 4BAGA 1MA7A 1D6JA 3KB8A 4P81A 2DXIA 4J6FA 3RYCB 4B3GA 2BDPA 1XNRB 3LC1O 3ND6A 2D6FA 3EVAA 5FI5A 4ZCTA 4HGRA 2FSGA 3OTWA 4R9SA 1T4MA 2A1TR 1DTWB 2E4YA 1P77A 4CMGA 4B9SA 2HO5A 3CF0A 3KKEA 2R48A 2Q7XA 1QKIA 3FDIA 2Z3VA 3OIFA 4GQIA 4IFTA 4A8HA 4DA9A 4QYSA 7YASA 3GJ4A 5J0PA 2VSOA 4N40A 1V5EA 1VL0A 1WY5A 1EK0A 4ZDWA 1XZDA 4YJGA 4X97A 1NOKA 1AK9A 4M9QA 3LFHA 2VJ4A 5DHUA 1UADA 4JBIA 3VSEA 1S2IA 2I29A 4U2CA 4YLYA 3V2GA 3T9AA 3IXMA 3ANMA 1YI0A 3GGSA 2FOLA 2CNDA 2OWEA 1O3YA 4J9KA 3MGHA 2H9IA 2KW5A 2XF2A 2AX4A 1TQ2A 1SO8A 3C1TA 5EZ6B 1OYOA 3UMMA 3ZE8A 4AJEA 4XX1A 1B6TA 4KQ1A 4MR7A 1OLUA 5EKUA 1Z8FA 1QGZA 2YHSA 3UY4A 1Z35A 1RT9A 4QJ5A 3PQ3A 1UFRA 2HSWA 4MO2A 2XQGA 4MPRA 4YP9A 2G1JA 2PCJA 4RPIA 3WBKA 5I01A 1CE8A 2BW0A 4G0WA 2OV6A 2C42A 4RXMA 1YO6A 2JRCA 4FS1A 4D3YA 4KLMA 1SHZA 3HZZA 1M74A 5L40A 5K0NA 3KB2A 3PUZA 4AZ3B 4ICIA 4H7IA 4MNTA 5DDIP 3VR4D 3PI6A 4IL5A 1OBOA 2E1EA 1YCFA 3SV3A 4Z54A 5IBCA 5DHPA 5I9BA 1KDPA 3R41A 4FZJA 3U16A 3I5UA 3OTQA 4M1ZA 2JIZD 1LVGA 2G25A 1T94A 1EDDA 2VYFA 4EB6B 1QYVA 1UPFA 1Z9BA 1VLQA 3D2AA 2ZR7A 4L57A 4PN7A 4A8JB 2Q21A 3I1FA 4J9PA 3K8ZA 4HMPA 2O52A 2Q27A 4HB0A 3CRRA 2ZSEA 4O5OA 1X9WA 4Y2RA 2NQ2C 2CLIB 3W4KA 5K0ZA 2BM0A 4Y2TA 5AKZA 4II7A 4LZJA 3RUPA 3JD0A 2JD1A 1N60A 2ZBEA 2DPMA 2VDPB 2C2GA 3LPMA 3HNRA 3U3XA 2ZI4A 1PUZA 3SDZA 1BHQ1 3OZWA 4F1KA 3NOOA 3RB4A 2G5PA 4Q19A 2QT0A 4NDAA 4DOMA 1G3QA 1UANA 2XUHA 1LNQA 3T1TA 3TIVA 4O2AA 5J3JA 3UM9A 3FPKA 2Z04A 3QZ7A 2E4WA 1Z00B 2FB9A 1Q46A 3I3OA 3L7CA 3IA2A 4FZ5A 5JE8A 4ZEOA 4EITA 1DBRA 2X3UA 1YOBA 2EKDA 4Z3KA 1ZUHA 1GPMA 3GLGB 4EO7A 4N0EA 4RMHA 3RCBA 3CYMA 2VCYA 2PNFA 2W6JD 1R3DA 3SF8A 3ZYZA 1WXWA 2L5YA 3QTBA 4BQOA 3NIBA 5IN5A 3EVNA 1JGTA 4UW9A 4R16A 4BNTA 1QG0A 5M34A 4DGSA 5DHSA 4EMTA 1EHYA 4TWJA 4JYCA 2MA1A 3FKSA 2BQUA 2WKQA 2PZLA 1GPNA 4JROA 1WKCA 4KLLA 3RVRA 3K0AB 3JQFA 5C81A 3B5JA 1FSZA 4ECWA 3L8ZA 5DNUA 3CJRA 1EPUA 5TQ2A 2C5GA 3I5MA 5GTIU 2A1TS 2Q2OA 2FSIA 2HWYA 3S4YA 3OEHD 1VJTA 1TTQB 4LWPA 2VAPA 5CT6A 2HMUA 1TFRA 5HKLA 1KR2A 5CB6A 3PNPA 3T7EA 1SFRA 4FYKA 4MV7A 3A28A 2VH2A 4OLJA 2WM2A 1VCOA 3P4XA 4YR9A 3GK3A 2NT3A 3R8FA 5EHNA 1W85B 1QSSA 5CEHA 3H9JA 4RKWA 1MORA 4B2IA 3MGAA 1AV7A 4ZOAA 2PZAA 4RVGA 3BGSA 3WGGA 1Z2OX 4P4PA 4ZYZA 1HY3A 5DB8A 4LFBB 5IUKC 1X1EA 2F3TA 1QHEA 2O6LA 4BX3A 5KT3A 3F7OA 1NW4A 3ETDA 5CD9A 1G5FA 2EXXA 3QU7A 4YJ3B 3G2HA 3IIIA 4AMYA 3R5HA 4Y2PA 1YS1X 1VZ2A 3GJ8A 1VG1A 4MUAA 3W2EA 3PVZA 1OLOA 3JWEA 1PZMA 3CH6A 4HSEA 2Y6VA 4I55F 1XQ6A 5JBNA 3SR3A 2NADA 1T1SA 3NR2A 1G3UA 1B0PA 3JQCA 2IS2A 5THXA 4HDSA 5CLHA 2TMKA 1P81A 4MKHA 3HYCA 2RARA 4HXEB 3UV3A 2ISPA 3CPHA 5LDHA 1ZIDA 2L42A 1L1RA 3PC8A 2WU0A 2ZE5A 4AL4A 1RBYA 1Y9JA 2B98A 2YJTD 3BXHA 2VPYA 2VP2A 2ZATA 2VQDA 4BMOB 2I6FA 2BIFA 3QWIA 1U2SA 1KEWA 1U28A 1X8JA 4EVSA 1RPJA 5BSHA 1P2TA 2QB1A 2GOYA 2YOHA 1T24A 3OAAA 2ID8A 1LBEA 4JELA 5L4LA 2IXDA 2F64A 3PF8A 1FSPA 2AKEA 4OF4A 4QZIA 1DLJA 3BQ0A 6ABPA 1T3QA 4M7PA 2BPGA 3ZE0B 2B7BA 7ICMA 1Z0JA 5LKAA 2IDKA 3T12A 3K9WA 2RIRA 3H5LA 1R4NA 1ZVQA 1G2IA 4RLQA 3K30A 1LDMA 3ROZA 1MB4A 3PKZA 5GQSA 2N9UA 4NV3A 3GEIA 4N47A 1K08A 3INRA 1XEAA 4C5AA 2M2IA 3T54A 4ZANA 2YTUA 3OOHA 1LVHA 1Q50A 1EIWA 1UAGA 3SZOA 2JLVA 3VH4A 4G24A 5KVAA 4EBBA 4NCIA 2GETA 4WOBA 3C2LA 2GF0A 1XMIA 1D5CA 5DB9A 4M2LA 3LCRA 1RLTA 2ZWAA 4Q9AA 3CINA 1TD9A 2Q4DA 3PDHA 3U5TA 5CIWA 1M8JA 2PBZA 3ELWA 1T35A 5LB4A 9LDTA 2GN1A 4MRVA 3HABA 5F23A 1C30A 4YIHA 1I1OA 3RIYA 4OLFA 1JR2A 1TMYA 4KLZA 2ZSBA 1JEEA 1MDBA 4J0KA 1SOWA 2CHVA 1F1BA 1XDDA 4RJIA 2AKYA 2NRTA 1O77A 4PHFA 4ZN6A 1AHHA 2J6IA 1KI6A 3AM4A 2G1PA 4ZVQA 5EEGA 1AS0A 4F4JA 1DOZA 1R6XA 1OOEA 3LC0A 4TUQA 1GAXA 2FCAA 1A9XA 1I7SB 1R0WA 3LO8A 2H2GA 2SICE 4WZAE 2IXGA 4NNJA 2OE2A 2H3EA 2KHQA 1AZTA 4LDZA 4XDZA 5AJVB 2PAAA 2D2FA 1A9OA 1R64A 3ANNA 4TS9A 3KKNA 1YZLA 1L7AA 4ON9A 3Q72A 2JI7A 4DRYA 4J6EA 5KYYB 4R9VA 3O4FA 4ZVKA 4ZGWA 1N5JA 3CSUA 4QGSA 3BH7A 1XD2B 2HBQA 3QVGA 3T3DA 3A4MA 4BQRA 1XX6A 1W47A 1DAIA 4F45A 1ABEA 4G5HA 3N2ZB 5IKEA 2RGAA 3DA8A 5JIBA 3C3CA 4QIHA 1CUEA 5C0OE 4U6NA 4WOPA 4IXDA 5I5GA 1TXGA 1E6EA 4LRTB 3TPZA 1XSLA 4O8CA 2Y1EA 4I6GA 2AZXA 5AUOB 1N6IA 3DLTA 2IHNA 1K6EA 1LB2B 3I2IA 1KSJA 3ETHA 4FLFA 4C7OB 2EQ5A 3AQFA 1S4MA 3HXLA 4MVJH 2I9PA 2JNWA 4UC0A 2HJSA 3E9DA 3MFYA 3NWJA 1WG8A 2O0JA 1H2HA 9ICEA 5L51A 4FHCA 4LK3A 3HR4A 1JFTA 3KQTA 2V0GA 2ZRLA 5CXQA 4HEHA 4ZAFA 2PV7A 4FR2A 4PAOA 1VPWA 4MV5A 4ZPXA 4YI3A 3OKFA 2LW7A 4A16A 4C2BA 3NYRA 4DR3B 3BREA 4PZ0A 2V7VA 3LY7A 3OZGA 4RH3A 2NXWA 3OOSA 4EG6A 1NZDA 4QQNA 1JTFA 3UOWA 3OM9A 2D6FC 3SVZA 4DFDA 5D84A 3QTTA 4JR1A 4PLGA 5CVDA 4HGYA 3K9GA 4NOJA 3QFCA 8GPBA 2PSSA 4BEBA 4GMFA 2XLBA 2KJ9A 2PY6A 3VTZA 1JBEA 4B8WA 3B7GA 4G3IA 4Q1VA 4MOWA 1X7GA 3RS9A 5LJIA 3PQ2A 3N2YA 4OX9Y 4UBCA 3AQ4A 3AIKA 1YR1A 3PR2B 5CFLA 3RAJA 2CCGA 2BM9A 1LW7A 1SBNE 3CH7A 4O63O 4IICA 2YOFA 2GFHA 5I48A 4D8WA 1XYVA 1VMKA 4RPCA 1PDWA 3EFOA 3GRAA 2EL9A 1FSSA 1M6WA 4MQUA 3GNSA 4LDPA 2HDOA 4GR4A 1SIBE 4NFLA 3U3ZA 1V5IA 3GBPA 3CW9A 2GWHA 1RWBA 3PFWO 4M8IA 2ACVA 1Z8DA 5L1LA 4EGCB 3UJBA 5D3KA 4LJYA 1L7EA 3HBMA 2EAMA 3IDAA 2WV7A 3TJMA 1ZU4A 3BE8A 1VHWA 3OFND 2PZMA 1XSEA 3UWMA 2GCIA 2JH9A 1TJ5A 2OVFA 4QZDA 3UHJA 5M04A 4MMYB 4BLSA 4WSOA 3BMNA 2BMDA 1V38A 4DS3A 4EB8A 2EU8A 4KWIA 5DM1A 4ENUA 3FPFA 1QBGA 2L2QA 5B1IA 3M9LA 4HK4A 3BKXA 1TRHA 5AM4A 3W1WA 1Z19A 1U45A 4GBGA 1WW8A 1T5DX 2KZZA 2X7XA 3TD9A 4ENRA 3L9XA 5DMXA 4IWNA 3N05A 1DDOA 2YY7A 2AJLI 1OLSA 2PT9A 4MI6A 1G8MA 2VL7A 4V02A 2VHXA 2AFHB 5EP1A 1Z83A 3OZEA 4IFBA 4JJAA 4C6TB 2OO5C 5JARA 5CM9C 3KD3A 1YCGA 2IU0A 2AQ4A 4RE5A 4PVCA 3MOGA 4O1MA 1RPZA 7ICEA 5T6BA 2G0NA 3PVXA 5IVKA 2JFFA 5T57A 2NV2B 1J9ZA 5DHAA 2D4HA 4K9KA 4MRAA 3IQDB 5AOVA 5KCMA 2I1VB 4GZ5A 1W1UA 4IO0A 4YLEA 1BU5A 3EXFB 4JOSA 4US8A 4J0QA 3DOOA 5AOAA 7REQA 2XJ9A 4C03A 4GHWA 3ULKA 2QJWA 4FSXA 5CK4A 4NU8X 1EK5A 1F06A 3MD0A 2RKOA 1LJLA 1QLHA 2FKNA 3E5RA 4XFJA 5KKAA 3R7LA 3O73A 1CYEA 3QRWA 4FI3F 5CDUA 2E4ZA 4JLPA 2CXNA 2QVXX 3L1HA 3SBEA 1DADA 5CA0B 4BNDA 1E2DA 1T43A 3H65A 4M7WA 1JZSA 2WM3A 4NAUA 2DGZA 2HCFA 1T9ZA 1NY6A 3P52A 5AI6A 2ZB7A 3JSXA 3H4VA 2VJKA 1ISGA 4IOMA 1P2SA 2HPVA 1T2VA 3S2FA 3PC6A 5BV8A 4ZVLA 1H22A 2ZCUA 5KNCA 2H4XA 4NPAA 3U9SA 1EEHA 4R1NA 1KKMA 2JHFA 3U7EB 2Y99A 1HM5A 2AC2A 3VXKA 3ERCA 1M2VA 5DSXA 1X39A 1ONOA 1P3JA 1NNLA 3DW1X 2OYYA 1QCDA 1AMOA 4NBLA 3ZDXB 1YR3A 2MWMA 1EGAA 1TM1E 3UMSA 5EJEA 1CI4A 3BZBA 3TL6A 5B57C 5I5EA 3SFVA 2XE7A 1K3TA 2Q2WA 1KBZA 2FI1A 4KYVA 2VK2A 3NS7A 1TIBA 2ZSKA 4QKQA 2YINC 1SUWA 4YDRA 4NY8A 2CFCA 2Z58A 1POWA 1AXEA 1OBVA 4IUCS 4Z0TA 3IC5A 4C2UA 3H86A 2WVJA 3S8EA 2G80A 4AJNA 3RAQA 3WL8A 3OE4A 3LT0A 2RHRA 1ABFA 5TQJA 3T5CA 1S9HA 1GPWB 1V4VA 3GQBA 5FWXB 2A7XA 1O4VA 1EWVA 1D7OA 1JHDA 3LY8A 5B5EU 3TQSA 4WERA 2XDQB 5FBHA 1YU9A 4GX1A 3PICA 3FTQA 1C80A 4DL9A 2XTAA 2QMQA 4DL5A 1UIRA 2EL7A 3A4TA 1RM6C 4XWGA 1RWPA 2PUTA 2GAAA 3THVA 3NNDA 3IULA 5DBAA 3GXBA 3AM5A 3E5MA 5DO9A 3BS5A 3ITDA 3I04M 3GD5A 1UBFA 3PVSA 1MZPA 3F2VA 4PYNA 1OASA 4JWNA 4DIFA 4B84A 4E08A 3GJ5A 2JBAB 4LWZA 1CQJA 4YRPA 1UCVA 3OF3A 1RIFA 3WDSA 2GZDA 3DVQX 4KK3A 5KNBH 3PC8C 2V6JA 4IHJF 1ZXBA 1G5TA 2UKDA 4QU8A 2GO7A 1F0MA 3KALA 4JBLA 1VBKA 1E3MA 5KS2A 1Z5NA 3CLRC 3EZGA 1OIVA 1KIFA 1J20A 4KH0A 3TAPA 2FQQA 8ICXA 4HV4A 1G42A 5JW6A 2KN7A 1OXBB 2Y8EA 4NMXB 4EDFA 5DTIA 3ESBA 3MMSA 3K31A 1H2WA 1PUIA 3QGMA 3SX0A 1UOOA 4HB4A 1EUZA 4QBHA 3AUOA 4YRTA 2FRXA 3TIXB 5JMOA 1IEQA 5DNWA 4GXKA 1WX1A 3QW4B 2AR7A 5DM60 1QSLA 4UXHA 4TVBA 2J5XA 1G98A 2JGDB 4B81A 1I3MA 4MLZA 4LV5B 1P0CA 5CFPA 1MPXA 2XD4A 1R0YA 2WNIA 2PX6A 3TCXB 3TFRA 1YJ8A 1N9GA 4KXXA 1UL1X 1X38A 2MU2A 3WMEA 4K7JA 2E0IA 1PFUA 1TCUA 3JQGA 2O8EB 2IXTA 2WKRA 4CR8A 4CKEB 3HBNA 4JY7A 1G4AE 5TPZA 1T5SA 2B82A 1RNLA 4Z4GA 1YXMA 1IY9A 2FUG1 3CU5A 4OMDA 2WWIA 3VM6A 1M2JA 4OTZA 1EUDB 3HH8A 1YB7A 3SV4A 4TZKA 4NOKA 1MAWA 3F1LA 4LGYA 5I3CA 4OOFA 3SEFA 1L1FA 3UPUA 9ICBA 1W76A 5DQGA 2QUAA 1D04A 1BYUA 1CLEA 1IZZA 3NHJA 5JHGB 4FZ3A 2BPCA 1R0KA 4JUIA 1OFIA 3HB5X 2QAGA 2E2WA 1MT0A 2GBLA 2FWIA 3BORA 1P6UA 4FGWA 4HDMA 3ASVA 3HVKA 5IN4A 3K94A 4QUHA 1UJ6A 1Z16A 5B1SA 4EKGA 5KSYA 1H2EA 3F5MA 4QVIA 1ZD3A 3NIDB 4DR5B 5LA6B 3TQOA 5KOJB 4JU8A 3ROXA 4MYCA 4ED9A 1OR8A 3KO8A 3TTXA 3AI2A 4KYIB 1LGYA 3U56A 5SY6A 1U2PA 1PX0A 4QUAA 1H3EA 3F6YA 3ASUA 5EE9A 1CPYA 1T4DA 1G16A 2HGZA 3ILYA 4CU5A 3CKMA 1N2XA 2AC4A 3PTAA 3PSIA 2BEJA 3E7FA 1GG9A 2ZYDA 3THOA 2P79A 4BRSA 2N46A 1UMBB 4DEXA 2X0FA 2NRWA 1QIFA 1UPBA 2P9ZA 1KYIA 5AM1A 2B36A 3PC3A 2J67A 3GMIA 2WTMA 2WA2A 2DGDA 1ZXIA 4UULA 3ZKWA 2W03A 3Q3CA 4L8FA 2G8LA 5TLSA 5AJYA 1WXQA 3L8EA 1T15A 5AVTA 3EGDA 1ZNYA 3E7XA 3OQHA 1ZKMA 1EFAA 3LYHA 4XDYA 3OT4A 2VRWA 3FRHA 1MBZA 4RENA 1AA6A 4GKAA 5B2ZA 3IBYA 5G3YA 3F2DA 1UA0A 2Y27A 3CTPA 4WBNF 2WFLB 1SXDA 3ZBTA 3F6SA 1ECFA 5LZ9A 3C7DB 3WGYA 3D8RA 4WJZA 1TNDA 2C2WA 1KEEA 3IXLA 5L45A 4GU5A 1M34A 2DQYA 3EH1A 5JUMA 4GBJA 4FSHA 4X95A 1Z0DA 2H11A 4HH1A 3WMXA 2A1JB 1S3IA 2ZWPA 1XLVA 4YXMA 3SYMA 4B1FA 3UQ0A 4AY6A 4AECA 2IUFA 3GAZA 2CD9A 2QN7A 3O84A 3B2NA 4Y2YA 4HEJA 3FFBA 4CEHA 3KZOA 1XZIA 3B3AA 2NTEA 2EZ4A 2MINB 3IAXA 2VWGA 4EPRA 1J99A 5TDHA 5ALJA 1R8SA 2EZUA 4IDGA 3IQWA 5DU2A 1QC5B 4Q7LA 4IFIA 3JQQA 2VSYA 3H97A 3WB0A 4KR9A 3L41A 3FMGA 5E95A 4V0LA 3RRXA 4OK3A 1LRKA 2JAOA 3K5PA 2Y1DA 4YQWA 3OCJA 3MWFA 4X7MA 1Q0QA 4AQDA 2RCNA 2DOKA 3L4SO 1COOA 2PXXA 2CFSA 5DGBA 3GVHA 3DNPA 1N6OA 3O9VA 2HBZA 4O8ZA 3L0DA 5CAEB 2J9FB 4P4UA 2CNWD 3LX4A 1VJ0A 1JG2A 5BORA 1JR4A 4I46A 3SLKA 1XVLA 1U0SY 4C0WA 1REQB 1TDJA 4Z4CA 4UAUA 1WHTA 3LM8A 4DMCA 4EMUA 2AUTA 4B4OA 3SFTA 1GZ3A 5F52A 4S1NA 2PFOA 2VEDA 3FUCA 4PPQA 4G1BA 1E2IA 1HLFA 4LJ4A 1L6NA 3AMZA 3WIBA 3TQRA 3RS8A 2KV2A 3KTOA 3G3EA 4L75A 4UCQA 2X7JA 3HDJA 4EG3A 2CVFA 4CMIB 4PLTA 1RYUA 4MA4A 4KGVA 3NXKA 4MKZA 5D46A 1JDTA 4Q4CA 1PEKE 3PGLA 2H5EA 5C4GB 1FDOA 1ECLA 2LYBA 4QECA 1A7JA 5A6SA 2VJOA 1ZQZA 1THTA 1KNQA 4K9SA 1P2GA 2PQ6A 1C3EA 5EJ7A 5AKYA 4K9NA 2GN0A 1GADO 5AHXA 4R40A 3L8MA 3RR8A 1GTG1 1J8DA 3DZFA 4QJFB 2BSAA 2ZYAA 3AUAA 3NT4A 4WK6A 3DFUA 1ODCA 1HDGO 1R7RA 4C0KA 4KFCA 3ZQ4A 4B6OA 1M5UA 3O4GA 2PUBA 5FNZA 1ZQRA 1XZAA 3N76A 4QYMA 1QGED 1JECA 5F64A 4AY3A 3LBAA 4R8RA 4J7CA 4ZQGA 3AEKA 1TIKA 3K9BA 1UFKA 1S4QA 3ISDA 3IVRA 1T5LA 2HDWA 3V4FA 1KYQA 5HIJA 1J0CA 2NU6A 3LHKA 2ZE7A 4TTJA 1X1SA 1EZ1A 1TJYA 3RYIB 4RKQA 2NIPA 2YC4C 3NHPA 2QYTA 3I64A 2PGDA 1ABBA 2H1HA 3QUCA 1DPGA 2OV2A 4QPPA 3EWSA 2BQ3A 1W0CA 3QKSA 1P4AA 2ZRHA 3GZFA 4LFAB 3PGXA 1XD9A 3KVOA 3HKBA 4ETNA 1X80A 2CXOA 3CX3A 2QX8A 1V85A 1XMQB 3W5HA 5KAIU 4ED1A 3BGWA 1XFDA 2VJNA 3EDMA 3MXTA 4BGDA 1G7SA 1W30A 4BKMA 1KYWA 1MVOA 3PRHA 1T7PA 1WMFA 1QO9A 3B0YA 2G7ZA 4DMHA 4JI2B 1RU3A 5DGTA 3DBHB 2QPAA 3NNNA 4UCXA 5HS4A 4HLDA 1N5DA 3RK1A 4X5VA 1TCVA 7ICRA 2XCLA 1J49A 1B8UA 2HFJA 4H1UA 3IKTA 7AT1A 4MV6A 3TDNA 4OO1J 4TVSA 1MEEA 1T6XA 2A0FA 4BP3A 4ML3A 3WLRA 4QQ8A 4ILKA 3TMKA 3SQNA 2E37A 3JTMA 3O4IA 4PYQA 4V38A 2QTTA 2VZLA 3RB3A 5FP0A 2LKCA 3HXMA 1N8TA 3DBLA 4CLXA 5B3LA 4NIMA 3UXOA 3WIDA 1DE0A 2N0SA 2OZPA 3H6GA 5DXJA 2A8YA 2UVQA 5AR1A 2O3JA 4RYLA 3ZDYB 4RD2A 1V95A 2DKZA 2IDJA 4ZVUA 3W5UA 1PP4A 3CIOA 3USCS 1EGHA 2D3TA 3LQRA 1A98A 2KMLA 1X77A 5FR2A 3FYHA 1U4SA 4BP1A 2YXBA 2J0UB 2FEXA 2VHUA 3GBSA 3GUCA 3WGUA 2H2IA 5U4QA 3GLIB 4GECA 4Q6BA 4US0R 4AD8A 2G70A 4RIFA 5JSUA 1QMPA 1E8MA 4FS2A 4RU1A 1FRQA 3JW8A 3DMFA 1YZ3A 2EFGA 1ZK0A 4YONB 1SVUA 2QRKA 4GPTA 1U9ZA 1ULTA 3RV4A 3E0XA 4XEHA 4KLJA 3ANSA 3U19A 1OI7A 3U81A 5A3QA 2OV1A 2VG8A 3TXYA 3TM5A 2DLCX 9ICQA 2IYTA 4DV3B 1C7ZA 3O8OA 2PUVA 1EX1A 2H2AA 3DOIA 2C96A 2BTOA 2DWCA 4JKYA 1E2JA 5CB8A 1V1RA 3ESYA 3ORRA 1IV8A 4K86A 1XKQA 1IMJA 1BMQA 5EKTA 5IH7A 3OC6A 3GPDG 4MS4A 2VTVA 2WF6A 2JAXA 5KQRA 3ZHZA 3PSTA 4IS2A 2JLAA 3ETRA 1HA3A 3TLBA 4B40A 1CEZA 3DMGA 4R2MA 2VBIA 2ZVQX 3JATA 5KFUA 4H0CA 2Q9BA 2OHXA 2BMJA 3EHEA 2B2CA 1J8YF 3V8QA 2KIVA 1UA1A 1Q77A 3KOOA 3D7LA 3S40A 1T4GA 4BC0A 2O8BA 2XEDA 1R4MB 4ASUD 1K3UB 2OECA 3B20A 2I2XB 5GTHU 5FV4A 3L1KA 1E6WA 5IXSA 4XA5A 5ED0A 3T5MA 4J9QA 1NT4A 4ZOCA 2YCBA 1ZIPA 1DAGA 5JXHA 4O5KA 3OU2A 4YP7A 4JH0A 5CIYA 4C0SA 1E7MA 1GGEA 4TUYB 2P5YA 5CD1A 4OJTA 4QZHA 2J45A 1J4AA 2YJGA 1EE9A 4FWTA 1RYBA 3BF8A 2C5SA 3AEVA 3GCDA 1PSZA 4JUAA 4NVRA 4MO9A 3OLZA 3OX1A 4ZT2A 2I4MA 1JLMA 3DCYA 6ADHA 1ZL0A 3R9KA 3L0YA 1SUAA 3N2LA 4MAAA 4NSNA 1P5HA 3TAXA 3AUYA 2W04A 1GG8A 3Q40A 4Y6RA 4BIMA 5JRTA 1TCBA 5HIKA 4HWSA 1HFJA 1SBYA 4NHOA 1SKWA 1JDSA 2FEWB 1ISPA 1UXIA 4G2TA 3GARA 4PLFA 4WLUA 1L7XA 3F0TA 5CXUA 5DYNA 4Q9KA 3TACB 4JP8A 3RAXA 1XQ1A 1GTMA 3C3EA 5JCPA 2WTEA 4CLRA 4ZC1A 3GRZA 3L6DA 5K0TA 4UOQA 4EFLA 3L6BA 2BLNA 4O59O 5B4TA 4JJZA 5IULC 2V5UA 2A88A 2XWQA 2C78A 2GBLC 4DCNA 2ZG6A 5EIBD 4NAHA 3EDYA 3ZDEA 4NWIA 2M9NA 3FFAA 4PO9A 2WTNA 1BPDA 4HO1X 3KEFA 4PSDA 2XR1A 4MP8A 1ZA2A 1UBCA 1OI3A 1YK0A 4Q6WA 1AZWA 2CGEA 1IHDA 2BI4A 4LYFA 1FFAA 5NULA 4PYKA 4EMBA 4NCAA 1TKRA 1Q1GA 1A4IA 1VC2A 1T3ZA 2G1AA 3K70D 1XNSA 1C4WA 2WMNB 3HXPA 3ESRA 3Q2IA 4G8DA 4AJJA 2VF4X 1T3HA 5G1NA 1BX0A 4YUWA 1V43A 3HP6A 4QULA 1GL6A 4PGXA 4DLNA 4F9TA 4Q9HA 5IDXA 3JD4A 3KLPX 4D9MA 3GROA 4XPZA 4JKOA 4YV1A 3EIUA 5T64A 3OZVA 2JJ2A 1LSUA 4UKDA 5A2GA 3FF1A 1UZLA 5ALFA 4U8HA 3LI2A 2W42A 1JHQA 3OMWA 1D0VA 5DLYA 4KIGA 1NLYA 3G9QA 1GGHA 3TLGB 4Z8YA 4ND8B 2IQ5A 4LDNA 1EVZA 1NGSA 2QLTA 4EG8A 4UM9D 5EJIA 3E23A 3BG5A 1JEAA 4WOCA 4UAWA 2B78A 4RF3A 1BGXT 2YIJA 3EA4A 4ZOHC 2FOXA 5A4KA 2VDJA 1JN0A 1LH0A 1FEZA 4EQ6A 3GQCA 4NRDA 3RU7A 2ZCVA 5JG7A 1QIMA 1E3TA 1D8BA 2V9ZA 5IIJA 4MRRA 3GFOA 3MVEA 3TRDA 2UDPA 4XQ0A 1KK1A 2BP7A 1JWBB 1BN6A 1QTRA 4DILA 3DLIA 3FMPB 3K1YA 2E21A 3PZBA 1J5EB 4X0EA 3TE6A 1I8TA 5FOVA 2OBNA 5BSRA 4Q05A 1OPRA 2Z8XA 3UBTA 4P4MA 1N3IA 4JUDX 3O8RA 3RSZA 3PQ5A 2XWPA 2VXYA 3B6MA 2BOVA 4QWEA 1LLQA 3S1AB 2CDCA 2RDIA 1H42A 4UDOA 2K5UA 2VCHA 2P6UA 1LX6A 1PNOA 1JPVA 1BS9A 1YZ7A 4Z49A 2UXCB 2PMWB 3LV8A 2A9JA 2PN1A 3S2SA 3BCRA 2GESA 3Q9LA 3GV0A 4ECVA 1MA3A 2Q4OA 2R2AA 1P45A 4Q9JA 3MS7A 4UQOA 1JXQA 4MYHA 1DIGA 5AMXA 4YQYA 1H4TA 4BE9A 4DNQA 5FOUA 2OCDA 4O3MA 1GWNA 2MR5A 1SC3A 3O74A 4LZNA 3H0CA 1LI5A 4B34A 5EXSA 1FP6A 4DTIA 4YDQA 4R3WA 3BXXA 1T25A 3G0IA 5K8VA 1XWFA 2PZFA 4LRXA 1ISFA 1B41A 721PA 3KOXA 2WA1A 2D7DA 1V47A 3IIKA 2H7CA 3AL0C 1DT5A 2RMKA 5JANA 4BO6A 2J3QA 1FLVA 3ZLBA 2JCGA 2X77A 1I7LA 3AF1A 3AY0A 4EIWA 2FUG6 4YMVA 3Q0TA 5C2JB 3CV3A 3M9XA 3EA5A 3F9CA 3CISA 1O4WA 2QM7A 1H5QA 1T36B 1VZ3A 3KBOA 2Q5HA 1II8B 3EMDA 2XIJA 1SKAA 2AH5A 3ZHOA 3RS2A 2JFYA 5LD2C 2K87A 4CG0A 3DV0A 5DHRA 1AQUA 1OU0A 2CNNA 2BEKA 2NUPA 4O25A 4OIFA 4IAOA 1Z0UA 3UJ6A 1HKHA 1CRPA 3RARA 3NPMA 2W2PA 1DPFA 4KCGA 3AGQA 4C76A 4X54A 1U3DA 1CRQA 3FKSD 3L01A 5E8JA 1FTQA 1KQ3A 1SQSA 4JI5B 2EVWX 4X66B 4QDTA 5A5GA 2CXYA 5D3QA 5EZYA 1IIPA 1PWHA 2PEZA 3TKAA 3TW0A 5B1HA 5HW0A 4KWEA 5AH0A 1RJ9A 1PZNA 3D8NA 3TI9A 3S68A 3ZW7A 4JL8A 1UAYA 4CFZA 1MO3A 9ICTA 3FRIA 5BQFA 1PYOA 2M6RA 1Q57A 4QXMA 3JV7A 1NM5C 2JH3A 4PGYA 4Q1EA 4LHWA 4BPRA 1DI0A 3AL2A 1JA1A 3KQKA 3KQUA 4JD5A 4BNVA 1I5EA 2C4UA 4P4SB 2X22A 2OO5A 3ZXIA 1K88A 2V4UA 1UZUA 1R5OA 3EDOA 2OXIA 4BY9E 2WJIA 4NG4A 3TNFA 3B7WA 2QYHA 5L7WA 4NZ9A 2VDLB 1IHYA 5CNIA 4G09A 4OV6B 4GSLA 3B2QA 4U7DA 5JMWA 1G8PA 1NA5A 5K0CA 4WXYB 1PIWA 3AFNA 1UJCA 4B9TA 2K4MA 3FAKA 4BNJA 2ALZA 1AS3A 5J2TA 4C4SA 3MJEA 2BFAA 2N3ZA 1W87A 2JAWA 4BGUA 3QNMA 1P8AA 2CJYA 2ZT6A 1RLUA 1I7DA 5D7NA 3NTLA 4J03A 1WM1A 1AKTA 2C84A 2EZZA 3QY9A 2PKQO 5DM4A 4JLKA 1RRVA 2WVHA 4BTLA 1PKXA 1Z4PX 2JGJA 2E6UX 1GOTA 2ZJ5A 2WU4A 3BHJA 121PA 2BR0A 2A92A 1U48A 1PG2A 2QN2A 1S8OA 1G1MA 1E1CB 1XL0A 3CLRD 3LE8A 5LKRA 1MIHA 1L0BA 4WEQA 4D80A 4HMQA 4ZZIA 1BCSA 4XWOA 4JNKA 3EZLA 3OAAD 3AWDA 4Z6EA 3S3TA 4JYPA 2P5TB 4UFNA 1U4NA 4NG5A 4PX5A 3U1VA 2R1TA 3PGA1 4AKEA 2WKPA 1A8QA 4IJ6A 1I3KA 3AU8A 2V6FA 4C4ZA 2DPLA 1EVEA 1P18A 1TTTA 5TGDA 9ICNA 1ZGHA 3AR6A 4P4TA 5DBIA 3WJ7A 3R3SA 1U0TA 3TI7A 5C4MA 5B37A 2Z1DA 1NBHA 3N58A 4UJ5A 4IDCA 1RMTA 2ECOA 2V7QA 1HZZA 2B8EA 2PJRA 4GE0A 4FDUA 2O5VA 3A2MA 3L6RA 3H87A 3NTQA 2OSVA 2BI7A 3Q7EA 1IG0A 1QZXA 3RFCA 4UCFA 4YRSA 3VUFA 4BFYA 2EJUA 3AR7A 5KNDH 5FRDA 2CVHA 1ENZA 2XYRA 4Q21A 2EDUA 2HQBA 3I0ZA 1PZFA 1V8OA 2RG1A 4BNXA 4ARAA 3ABIA 2Q8PA 2WQ7A 2FFRA 1ZCZA 3ECAA 3P5SA 2YQEA 2R6CA 4AQ7A 1J8FA 2DZDA 4CF3A 4H7KA 5HCUA 1OE0A 3M0EA 3RB0A 4A2CA 3JQDA 3FTDA 3UPQA 5L1MA 1XCOA 4KQFA 4UB6U 4XCQA 1Z62A 4QOIA 4BO1A 4GG1A 2OAP1 1LK0A 1M66A 5DI3B 3UMGA 3GILA 1NSYA 3NRZA 5BVHB 4PYJA 1BD4A 5L3QB 4BDTA 1J1UA 2FMFA 4X85A 1LRLA 2FN9A 2QE6A 3CRXA 1GNTA 1FYDA 2IHTA 5BYAA 2H16A 1B3RA 4G0VA 3EZYA 2LKYA 1VE7A 2A78A 2Q3HA 2XI4A 1XZHA 2PPVA 1G60A 1HFWA 3SR0A 4DOBA 2J0EA 3DEEA 5ALEA 3WMRA 4PSKA 3AMVA 2NLOA 1PT9A 5DW3A 3E1SA 2EANA 2P35A 3UMYA 3NAGA 1KAGA 1NAIA 1ZD9A 3EOZA 4C0HA 2G0AA 3WK4A 1T0HB 4MWZA 4LYHA 3PX2A 3GRRA 4E5KA 1LXCA 4TQAA 3IAAA 4REQB 5KJFA 4DDHA 3OPMA 1JKJB 1SKYB 2ZJYA 3LY5A 2I3BA 4JR0A 4C8NA 5DLGA 5KQMA 1S02A 2O2SA 4M1SA 3IBTA 2XRYA 3OHAA 3GXOA 2QTRA 1WEHA 1G5IA 3I1YA 2JHCA 2KZ3A 4ENPA 1MLDA 2QTCA 2NXCA 2FUNB 2KJ8A 2I80A 1BMFD 3KNZA 1HYEA 5F21A 2GXQA 3K9FC 4D3SA 3LP6A 4YRIA 1UKZA 3DEJA 3PXXA 2EAUA 3V00A 3D8TA 4P4GA 4JSTA 4X8OA 4DDVA 5A4DA 1IM4A 3U4GA 5K0SA 1ZZGA 2VHYA 2XNJA 3LUHA 1J8QA 2ZRMA 4TXHA 4HVCA 3H04A 1P9RA 1PJQA 1FRZA 2HU7A 3T5HA 3ZIAA 1WUYA 2P2ZA 4E30A 1I9CA 2YN2A 4FDVA 2UVRA 3UHPA 2QGZA 4W8GA 2JDIA 2YASA 4DL7A 2IIVA 2Q3EA 3L43A 4RVDA 3WGOA 5FWYB 4CXMA 2QRUA 1KDRA 1APBA 1A72A 2W2KA 1XZJA 3HZRA 3NWBA 3T7KA 5COQA 2VNKA 4I6EA 2NZ2A 4EJFA 4TV9A 2NYVA 4KVAA 5BUSA 1E9BA 3TW6A 4Z9AA 1CJBA 1NW3A 2X9QA 1FU8A 1JR3D 4U2DA 1NKBA 3BBLA 3GVIA 4FE7A 4ZCLA 4V1CB 4HDQB 4OLBA 1NJ1A 5CNKA 3CGWA 4YV0A 4KO1S 5KPJA 5D7BA 3RSLA 1ZH6A 1WBDA 5DOVA 2O8DB 1WCV1 1TM7E 4FK8A 5G4KB 2X4GA 3EFEA 1DKPA 3SYZA 2PT7A 2WSIA 4B0PA 2K7FA 2AX3A 1TYDE 1UMDA 1N33B 1FOEB 1YRLA 2JZBB 3OC0A 3NW9A 1RAAA 1XKXA 1H8HA 5EWJB 2Y9PB 4UMEA 2QRLA 3N70A 1N4DA 3X44A 2QUBA 4IXMA 4LRYA 2Q5IA 2IOFK 2IPMA 2OC9A 4LVCA 4JP5A 1QH9A 1DQRA 3JZDA 4CLEA 3LOQA 5J8YA 1Y1RA 3EPLA 3AG5A 3FB4A 2WWVD 2DFKB 1MAHA 3AK4A 1QHYA 2B30A 3V4ZA 1DRUA 3TB4A 1WP4A 3E9QA 1O87A 4P84A 4NENB 4JHLA 4B6FA 1O7JA 2DTDA 5I8PA 3PEVA 2BRUA 1Q21A 1SC6A 4GI2A 2DY0A 2B4QA 3CH5A 3KE8A 3FNGA 2EGUA 1TK3A 4QXRA 4X61A 3ZDQA 2G63A 3LXMA 9ICVA 4B9AA 4HB3A 4DSEA 2UZIR 5DM0A 1XZNA 5SZKB 1QK4A 4GLBA 4BVBA 2QRNA 1WBBA 3GIKA 4UJ3A 4PL1A 4KIFA 3JQAD 2AGOA 2QT1A 1VLMA 4CIXA 3T15A 3P45A 1ZICA 5AI5A 2ZI7A 3AQEA 3QPWA 1EFPB 1QOZA 4O4JA 2B61A 3OP4A 2IIQA 3KKKA 2H9AA 1KVQA 1SUDA 5CJPA 3ROFA 1BO6A 3MRTA 5AW1A 3PO5A 3KZNA 3MGIA 5JS1A 4EKDA 5JRZA 2CF6A 2GPWA 5GV7A 3J81k 4C29A 5EERA 1JLSA 3KAKA 5JDIA 4HWKA 4C4TA 4OI2A 2EGHA 1XZKA 5LP6C 2AHOA 5JRDS 1XUOA 1EQ2A 1DIBA 2PUAA 2GCEA 3ZWDA 1ZRMA 4NHEA 3BMOB 1YI8A 2LBOA 1Y9AA 3EBPA 4XWTA 4QW8A 3AU2A 2DWPA 2WZCA 3GX1A 2WILA 3RSQA 3FUUA 4MI1A 1NTOA 1GQOA 4MWCA 1F44A 3GLHA 5BY2A 3QPBA 4QGAA 4GP7A 1ZH8A 2RGUA 3TI0A 4HG2A 1S77D 3JQEA 4FC6A 2VH1A 3KEQA 1KSFX 4D45A 2YMLA 5LB2A 1LQ2A 3D8BA 4Q12A 5K5EA 3CZRA 2HMWA 3GUYA 2HHHB 1Z28A 4JVNA 1YC5A 4YR2A 1IHOA 3WGNA 2W4IA 3C5CA 5L3VA 1IVNA 1DBVO 5DP1A 3QMPA 5CFQA 1NYRA 3X1WA 1TUIA 1EXVA 1PQUA 5FYQA 1JG6A 3QJYA 1P1HA 4CPDA 1U04A 5LM3A 3VU0A 4B33A 4CKBB 5KDLA 5JR3A 4F71A 1WCNA 1W2WB 2BONA 1LJ8A 1WB4A 1RVDA 3AKCA 1T9CA 3KTQA 2PL5A 2WPDA 2QTVB 4EGSA 5A9SB 2MSWA 4U6PA 2B25A 2IE0A 4UEWA 3UANA 2WSBA 1OA1A 1L3VA 2PKRA 3BSYA 3O26A 1AZSC 3TYXA 2IBSA 2EATA 1UWLA 2C2HA 8ICWA 4O5EA 5LZ8A 3HBAA 1T8SA 2C2RA 3HB4X 2ZJBA 1TMKA 3I58A 3V97A 3EPHA 4R9NA 3CRW1 3IEIA 4QPJC 5A5DA 4K6KA 3IUMA 5H81A 1EDBA 4UUOA 4B0OA 2YR0A 3ER6A 3Q6IA 3KS9A 4U39A 1RQ2A 3E4DA 3HB1A 1J9GA 1PJLA 1SIWA 4XQEA 1FIUA 1RABA 4JLAA 2HRZA 4YECA 4GBED 2WU3A 2DUMA 3MEQA 1KGDA 1WZIA 3OA0A 1WD5A 3PCRB 4XTCS 4KNVA 4CM8B 3DYBA 1SHJA 2YW9A 1UZNA 2JBWA 2ACWA 2QW8A 2YXDA 3LQFA 2PFGA 3JPNA 1N6LA 4MS3A 2I3DA 1FFWA 4IZHA 4HAOA 3AIIA 4FYIA 4IG9A 4DC9A 4HWRA 2VYQA 5ENDA 3GVCA 4REMA 4G5XA 3TNLA 4AF6A 1KC3A 3WKEA 2Q5JA 4HS9A 1WUHS 1M0WA 5T4HA 4YRNA 2Y9TA 2W2NA 1RLJA 3O0FA 2QD3A 1H5NA 3R7WA 1WIWA 1PQYA 3PXBA 2VH5R 4OEHA 4GQAA 3TFOA 2WJ6A 4TOIA 4ZT7A 4EJ0A 4TZ6A 3QITA 4PS1A 1RJGA 5COBA 2IS4A 1MIOA 1S10A 3KXKA 2PEYA 3O8DA 4C4OA 4X20B 5CLLA 4Y6GB 5EIAA 3R8CA 2WB4A 2EDCA 2GVNA 2XVTA 2HCJB 4EAAA 4AY2A 1VDMA 4I66A 3DTVB 3AXTA 3W8EA 3T5AA 3QM1A 3L93A 4KMSA 4A7PA 4L28A 4AAYA 1Z73A 4ZAWA 4EI7A 4DYHA 5J2GA 1JT2A 1Q44A 1E9VA 1HZZC 3I9V6 5TMBA 4YMNA 3NX4A 2AN9A 4LJXA 3KZKA 1T34A 1CIVA 1ZW1A 1S2LA 2BMFA 1UPAA 3G5TA 4Q3OA 3D4NA 5EQJB 2AK3A 1WO8A 3DB2A 1WXXA 4RLFA 2ONYA 3W3AA 4YCJA 5KG6A 1B6RA 1KEUA 1I2DA 4L1KA 4BNWA 4JJ8A 5JQGB 5LOVA 2ZRJA 3U4QA 4Q7QA 3E3LA 4G5YA 4RGBA 4G2NA 5A02A 1Y6RA 3CZ4A 3GRPA 2PWZA 3BFPA 4AZ0B 4BFVA 2XMSA 4FKZA 2KP7A 2J0VA 1IUOA 2P1DA 3X43A 1EB8A 3T5BA 2FF5A 2IEGA 5K8JB 4XM0A 3BWCA 4L95C 5BOSA 2YX8A 3SJ7A 2HCTA 2ISQA 8ICCA 1U2EA 3MRSA 3BL5A 4PC6A 4IHQA 4M9SA 3LVFO 5L3RA 3QTLA 4RVSA 3PR5B 1RQNA 4H3HB 4O2AF 5A1TA 8ABPA 3K3PA 1MOZA 3P2IA 5EESA 2AOXA 4E3WA 3QQ5A 3HW8A 2XRFA 3K8YA 1FJ2A 2HA6A 2EQBA 5L7TA 3RV3A 5D3MA 2DBYA 4IGIA 3VNRA 1WUKS 3K16A 3RT7A 1O6BA 5KYGA 1YZNA 1SU7A 4LMPA 2HHTA 3PHLA 1ADFA 1QVZA 1A04A 3RW9A 2AMJA 1Z6ZA 1NOJA 2C92A 2F8TA 3OHMA 4RW0A 4I5IA 1ORDA 1C1DA 1IJBA 5I7OA 2PFQA 4EX7A 5ADVA 3ST7A 1DHTA 1FFCA 1RRFA 2OORA 2AF4C 3NDBB 4ZEMA 1V3UA 4M9JA 1INLA 1P9LA 2J6BA 3OT1A 5BSUA 3Q2OA 5DEOA 1G20E 3DTTA 5MHTA 5CVCA 5CR9A 1KEJA 4KZKA 2PKCA 2BFWA 4FBGA 2FA9A 1NKVA 3VOTA 4DM7A 5AK3A 1UPTA 2OD9A 3OEWA 3WLOA 3X1KA 4U2BA 1KXJA 4DVJA 1NV8A 4WUTA 4IVRA 4QWCA 1ST3A 4TTTS 1MVLA 7ICHA 5D6OA 2PLAA 4HAZA 3WKDA 3LP5A 4G0UA 4C80A 5ICFA 5GP1A 3UA4A 3ETJA 5FO1A 3GYGA 3IDZA 2P7HA 2ZDGA 4HB2A 1HT1E 2JLBA 1U2RA 3ABZA 4P22A 2ICAA 3P0RA 3DH0A 5TQVA 4X6XA 3C8ZA 4E13A 5FYDA 4EUSA 1VJCA 1GPUA 2P6MA 3DUFA 3BGDA 4OL9A 4WI1A 3B52X 1HO3A 3VC1A 3T9BA 1I36A 4P0PA 2ILVA 2LRHA 3EMKA 2ZR0A 4X8LA 4FBUA 3ZY4A 4X92A 3HN2A 2YV3A 4F4HA 1YVPA 5ALLA 2DPGA 2WDZA 1NIPA 1ZRHA 3IBCA 4AN0A 2QZPA 4RPLA 2KLHA 1ZUWA 3BCHA 4EEZA 4JVLA 4EW2A 3BWXA 1EX7A 3TO5A 2Q3DA 3GT0A 2OV3A 2D2EA 1DKUA 3TFSA 4HYYA 3NH6A 5LLDA 1ZQNA 3SSNA 4XVUA 2P11A 2HYIC 1U5BA 1RE0A 3BE4A 3C3BA 2YRWA 4ZHQB 5MN5A 2VBGA 4RKEA 3DQQA 5E4TA 3FYSA 3DVRX 3V46A 3WIEA 3ZJ5A 3LQ4A 2OMEA 2OHVA 5ALNA 4AT1A 3OQOA 1WXIA 2Q7OE 4RYDA 2XB8A 3OQPA 5DSZA 2EKZA 2I66A 1NK9A 1AHPA 3VR2A 2JFBA 3BH0A 3QF7A 5J2CA 3RVOA 2ZZMA 2EFYA 3I52A 5DH9A 5EJ8A 5J8YC 5LUBA 3DT9A 2YJ6A 4E3ZA 3OEEA 3L4JA 1U7XA 5AVUA 2R79A 1XWLA 3LPCA 3C6QA 5KTPA 4V3CA 2IYLD 1DAKA 1OAOC 4L6AA 2X23A 3TQHA 5FX2A 2BRUC 2G76A 1FS6A 3IEXA 2GT1A 4W5NA 5CR0A 5AI4A 1F4PA 1UBKS 1FFBA 1P3DA 2D5IA 3K7EA 2ZIWB 2DUYA 4LYAA 3WGIA 2JCBA 3NVAA 4JX9A 4F96A 1JEQB 2DLNA 5E7QA 2AB0A 3W6UA 2ON6A 3TVYA 2I2AA 4Q9LA 1WSBA 4EVRA 2PVSA 4JBGA 3I9JA 4BVGA 3T3IA 2HJHA 2OT3B 4A15A 1ZISA 3E2EA 3HG7A 4E5SA 4LJLA 4LOJA 3SE7A 3PWZA 5AKJA 1CR2A 1B2LA 1VG0B 4I4LA 3OZDA 4L4RA 5E1OA 4KLSA 2W6ID 4HGPA 2C59A 1OXVA 3BTVA 2ETVA 1JQLB 1F51E 5JDIC 1MABA 4IF6A 3PGJA 4E70A 1NZPA 3AEQA 3ENKA 1M72A 2BFCA 4INAA 2RH5A 1SB3C 5GM1A 3IYLW 2YQ5A 5KWIA 2JGNA 4RMNA 5A4IS 2UXBB 3UHOA 5I7RA 3ZY3A 2XZOA 3IQHX 3KHHA 4UEOA 1GR0A 3DS8A 2GYWA 3RYFB 2QJRA 4CKEA 4KSCA 4NZZA 1SQ0A 3DEZA 1CCWA 3HV2A 2N1MA 1XZPA 3EQ9A 1L5YA 4K3VA 4DLTA 4YRZA 3TLEA 4CM4A 4OQ4A 3G8BA 4O2BA 2WNHA 5C9ZA 3NCTA 5B2FA 5JBQA 2VJMB 5JD4A 1VHQA 2Q0QA 4WFKA 5P21A 4LOLA 5CB4A 3K09A 4IR9A 3AR3A 2HWWA 3ZCXA 1V8DA 1XJWA 2OAQ1 3FR7A 3RF6A 2HF9A 2I6TA 3W9SA 1HDOA 3L05A 2Z2IA 4CTMA 4HQLA 4XD7A 3WL5A 4B6QA 2RC5A 3CNNA 3N8DA 1X9XA 3T41A 4BFWA 2RGEA 4FZNA 2CHGA 1HNWB 3HL4A 3O9ZA 4L72A 1C1XA 3ZR4B 5JXGA 1YQEA 4FMDB 2A9OA 1NP6A 1YZVA 3GZNA 4RY0A 3WJAA 2VNIA 2BJVA 2JLXA 4N49A 3GZ4A 3FGPA 4KVGA 3D3JA 1ZDMA 4BTEA 1DG1G 4MUNA 3WWOA 3GLTA 3KOYA 4R5HA 5GOZA 4DLRA 4PVDA 4Q8EA 2R1VA 3EG9B 1XJCA 1LK7A 4OA8A 2JH8A 4FCCA 5L1IA 2COKA 1UC8A 2FX3A 5CVEA 2HV9A 4M54A 2MRLA 1K1QA 1E7YA 3CBQA 1J39A 2O2GA 1YZFA 2BSXA 5BR7A 4A8TA 4PBTA 2Q3CA 4LJKA 1XTSA 2PQ0A 1E2KA 1UXHA 2FEAA 4IYRA 5FFMA 1JX4A 1A9TA 2X1VA 4FWBA 3N87A 1U02A 3V7LA 4KBGA 3BEOA 1NM5A 5JOQA 3VNAA 1TUBB 4PHHA 4B32A 4I2VA 2ZYWX 4TMYA 4CCWA 5SICE 1U0EA 1TCCA 3DZBA 1MQ8B 2PBRA 1NV9A 3M70A 3VDNB 4WNAB 1L7VC 3WIVA 1P19A 4AWBA 2XCUA 2H59A 2NU8A 3AM1A 4TRNA 1NBOA 4NCKA 1X1QA 1D9FA 4URVR 3TW4A 3FNHA 2XDAA 3QKWA 2ZRQA 4W7HA 1GPYA 4QEZA 4DBVO 1XFAA 1OSNA 1JBKA 1BMDA 2J1LA 4JI0B 1JMKC 2C2OA 3R3UA 5E9AA 3EW7A 3LS2A 1TEHA 3ITNA 2ZU0C 4OXIA 1DLIA 1WQ3A 2ZVJA 4G4SO 1P7YA 4YVZA 2PR7A 3CCFA 2C9OA 1Y6FA 1V7CA 2ONJA 2R11A 2OOSA 2V98A 4XYLA 2WPNA 2G67A 4ARCA 2C99A 3FZYA 4ITRC 4K6GA 4UASA 2GZAA 2NW6A 2ZIXA 1OFHA 1IY1A 1R4ZA 3FUXA 3IO3A 4R54A 3QBTA 1E5DA 4OHRA 3P0FA 2VHWA 3HHEA 1IIBA 1DO8A 3WMGA 4DSKA 4CRWB 3QLJA 3GT4A 4IH9A 4TTPA 3WGJA 3F3YA 3MJFA 4A2QA 4S1PA 3HY3A 4Q43A 3OPXA 1WU7A 2R66A 4D1YA 3WQHA 1WPRA 3ES9A 5HKBA 4C78A 3KX2A 4GPIB 1JLLA 2NM0A 4WPGA 4JC0A 4D0SA 1P0IA 2PCLA 4N5LA 2AYZA 2OWOA 3KJIA 2WP0A 1YZQA 3E15A 4J91A 2OYRA 1N34B 3OJOA 4QHTA 3U7IA 1P8JA 1T6NA 2R86A 1GQYA 1U2DA 3BHNA 4EYIB 2IHBA 2VDVE 3C16C 5KNDA 1CSEE 3T7AA 1C3OB 2QXTA 3BXEA 3LL7A 4QRHA 1IPEA 4DM4A 4BNLA 2CEKA 3BGVA 2JIQA 821PA 2PMEA 2OBFA 2QQEA 3ORFA 2XGOA 1ZQXA 5BW5A 4EG5A 4YA6A 2O6HA 2KSQA 7GPBA 2W9AA 1JI7A 2NZYA 4G5RA 4LZGA 2Y1JA 3DOJA 4TYMA 2HKIA 3OFJA 3BK7A 1PL7A 3X2FA 1OYWA 1N0UA 5CBPB 1G3MA 3SP1A 4GMGA 4KR3A 2WHPB 1VXRA 3Q7IA 2ZUCA 3W9YA 2IOHA 3RH0A 3GWZA 1U2GA 1Z88A 3DB1A 3GP3A 4PX2A 2HA4A 4ZEWA 1FTGA 4RTSA 4KLIA 1FFHA 4F6RB 3I9MA 4FNGA 1IOWA 1E6CA 2EBUA 1TAUA 4LXUA 3OZIA 5HM6A 4PGFA 5A5VA 2H7VA 4YIKA 2OORC 5HG0A 3RRJA 1OB2A 4N6NA 4D8VA 1X92A 4DWIA 1BS1A 2VJDA 3EAFA 1M7GA 1HDEA 4LQDA 3PNQA 4MHSA 2ZRKA 4S3MA 1YV9A 4L9SA 4P54A 2ISOA 5C18A 3A70A 3BB4A 4MTLA 4UUPA 2HWXA 2ZRDA 3HYSA 1NE2A 1VYVA 4KX5A 4YCXA 2XZDA 4HFRA 4YCMA 1V2HE 3AFOA 4YR0A 3OIWA 1BFDA 5HBGA 3GJRA 4EJ2A 1JJFA 3O4JA 1KGSA 4JUCA 4EA7A 5DRYA 4B4VA 3DE6X 3MT9A 5EFOA 4WCFB 1GQQA 1D2CA 2JI4A 4RAOA 2F8MA 3R20A 5H4GA 1HDRA 5CYFA 4M55A 1V7PC 2IUEA 4PXYA 4CR6A 5J0SA 1B2RA 4DY6A 1G2OA 3HWWA 2AV6A 3G0GA 1LBHA 1XL1A 2CLEB 2Z98A 1YBHA 1JJAA 3Q3HA 1KZ7B 5KX5B 4PR3A 1SELA 2OD2A 5CM2Z 3IDQA 4O3QA 5HGXA 3IAHA 1IVYA 1GA4A 3OM8A 4RPHA 4QAJA 1FNCA 4ZQIA 4J3NA 4RQ6A 3SYNA 3NM5A 2CUZA 4WBXC 4BQFA 3IEMA 3AY7A 1FA9A 3G9ZA 4B3SB 2IPNA 4EYEA 2PGAA 3FZGA 4PHTA 3N2KA 5BR8B 1PWZA 3FVWA 4HLUA 4OG2A 4R66A 5KWEA 3E70C 4PHGA 2O7SA 4EW1A 4AK9A 3O91A 1OXXK 4PFKA 5BPHA 4C5CA 2WIJA 3FYUB 3FPGA 4PNZA 2I6SA 1RQLA 2J0UA 1CUBA 1Z8HA 1J0DA 5EWMB 3PMLA 5KIAA 2WJGA 5B3KA 4OQDA 4YS6A 4Q34A 1KLNA 1T4BA 1EVIA 1TT5B 1ZWKA 2QE7A 3LO5A 4FOLA 4ZYUA 2OCGA 3VOSA 4I9UA 4J7AA 2LIPA 4DEYA 3LLSA 4KTTE 3GGCA 4N65A 4MQEA 2HSEA 4M47A 1TQ8A 4KN9S 4FFLA 2PVCA 5DFAA 1J7JA 1ADGA 5ED4A 3OT5A 1OV6A 3RJMA 4GYYA 2ZPTX 3KJXA 5G0TA 1Z5PA 1NONA 4WFJA 2ZBGA 3IJEB 2QNIA 3I28A 4QZ9A 3P2EA 2ENUA 1IULA 4KLNA 2C82A 4JC8A 4L8LA 1BE0A 2ZB3A 1KOLA 4B7AA 4K9DA 2C5AA 4MPTA 1ZSYA 2X0DA 2OXTA 1KU6A 2A2ZA 3GJ6A 3SF0A 4BQQA 1H3FA 2HH9A 2PGJA 2B7LA 1FTYA 1L3UA 1Z0AA 2DSTA 4MQFA 4GAEA 2WAYA 4ARBA 1MAAA 3TSZA 4B4WA 4E94A 1GKIA 1E7WA 4ERXA 4A5OA 5IS2A 4AJ9A 2X76A 4C7XA 1KZHA 2OH2A 4MVJA 1R4MA 2B92A 1QP0A 4B3HA 1BW9A 5I9SA 1OH5A 4Z4HA 4B73A 3C3AA 5G1PA 2VQEB 3ISVA 4W5TA 3H0RB 3UCFA 2WIGA 3STTA 1U80A 4DWOA 5J2JA 4HNAB 2XHZA 3F5QA 2BZGA 1A9QA 3TN7A 1R37A 4JA0A 2W98A 2ZS8A 2HN9A 3GLFB 1PGOA 4CN9A 3LWLA 3IMFA 2OBBA 3ZTTA 2RHTA 3VDQA 3OQ6A 3GEHA 1SM4A 3S0JA 3VHLB 5I7SA 4LJ8A 3TX2A 4JODA 9ATCA 4ICAA 3WK5A 1JEDA 5K3FA 1JVNA 2JASA 4NMHA 1G8HA 5EJAA 3A0BU 2IEAA 3NHAA 4BNKA 1OH7A 3I4LA 4XEUA 2JZOA 3H5IA 5AYVA 3SHOA 4MRMB 3AJ8A 3A0UA 4RHEA 4WBSA 5BXQC 2DPJA 4F4IA 5JZOA 2XYGA 3IHLA 3JD2A 1BHJA 4PM4A 3I9V1 1DC7A 2O5CA 3RUFA 3JVDA 1CUDA 1C20A 3DHNA 3MIIA 2RGDA 5HFJA 1Q14A 4RV9A 1AN9A 2NPOA 3E8XA 3K09C 3ZCVA 2OM6A 1CEXA 4PF1A 3ICWA 2H4ZA 2SNIE 5G53C 4XB2A 3NVMB 4F5QA 1J7KA 2O3RA 4AUKA 1W94A 4HFMA 1W46A 2V5VA 4MUMA 3MMXA 4XPIB 3ZWKA 4XYEA 1F7VA 3MDAA 3WWEA 2D0PB 3BMCB 3TTWA 4JBHA 3U3DA 1OZGA 5LP6A 1ODJA 3V5NA 3C6ZA 2RHWA 3GPCA 2GZRA 4CMCA 5DNCA 3AKDA 4JMLA 3TAQA 1UP6A 3I32A 2GTIA 3TMYA 4G0MA 2Q9UA 2D3WA 2ONKA 2CUNA 5HXAA 1GTRA 3T5GA 3M4XA 5C7IO 1Z33A 1G21A 5B6IA 3MSXA 3QVVA 3T5KA 3E18A 3B9BA 3G1TA 4BZZA 5SZJA 3U62A 2RBEA 3U7GA 1E4EB 3LIIA 1M8FA 4EI2A 2SKDA 1QHSA 1W34A 3GEBA 3HO1A 4V0QA 2D5AA 3ZCSA 3MMPA 1UFVA 1KVUA 4QAQA 4Y7DA 2HHQA 3HCBA 2F9MA 4GWGA 3WRXA 1SUFA 1QHIA 2QJFA 3DWGA 3C97A 1JJVA 4M0CA 5BQOA 1KIMA 3IG8A 1X3LA 4XZ3A 4MB6A 1N48A 2F77X 2F7SA 3F46A 1KRPA 2P0EA 2R8HA 1L7DA 5LDDC 1K3FA 1YVEI 4X3PA 2UYQA 1C0LA 3H0KA 4HDNA 4NFHA 3I1JA 3BF7A 3NWOA 1RQXA 2QW0X 2W3RA 1R10A 3RVSA 3K0BA 1KSPA 4ZJPA 2FWPA 1Y8CA 2M9MA 1LPAB 1ZHFA 1DJPA 3IGFA 2D1SA 4GW3A 4CEIA 3A37A 3KEMA 1QYDA 4Q4JB 5BR1A 5JY6A 4AKIA 2AG6A 3WGMA 3ZD7A 5IDYA 4MI9A 1PJTA 4BKOA 1D0IA 2IU6A 3I8XA 2LWIA 2H4YA 3BD9A 4LOIA 2HIMA 1D2HA 4PNHA 1BHO1 1UMCA 4HTFB 1WXHA 3R23A 4EFDA 2VA2A 3PRYA 1JQDA 3UXNA 4OD0A 1UBNA 4BL5A 4C21A 3D6MA 3B78A 1NVEA 3TVDA 3PX4A 1WZUA 1YZGA 3KDAA 2JIDA 2XUPA 3A9SA 2W90A 3SZUA 2Z5VA 5F2KA 2OY0A 3ADKA 2I6UA 3DLAA 3ZUPA 3T35A 3RD5A 4WK4B 1GCGA 3W05A 4U63A 2XUQA 3L0IB 3EBOA 1LB1B 2OILA 5CPFA 3EVCA 3LF1A 2CE7A 2PX8A 3OIUA 4F50A 3LX8A 3RRYA 1GU0A 4EI8A 2GJ9A 3ZEIA 4KRXA 5DTRA 3ZZNA 2UAGA 1XDGA 5JAMA 3VR6H 1TKDA 5LYJB 4U6QA 3B1FA 1A2KC 1DS6A 3LHFA 2W2MA 2FK8A 2Z57A 4M7RA 4EPVA 4B3CA 4QL3A 1BXKA 4QTZA 3RT1A 3F5EA 3D6FA 4TQRA 1JR3E 2Q1XA 3H9UA 3AY3A 5IYZA 1Y88A 4L3OA 4KODA 4CTKA 1VOTA 1IM2A 5FBZA 4JMUA 4YMIA 4PHDA 4MW9A 5ALDA 5K3EA 1ISSA 3H05A 3RYCA 2M0NA 1OWPA 3VSBA 3RRNA 5GY7A 5J63A 3O83A 2W00A 2AEEA 3UGKA 1U2DC 1WNFA 5JZ9A 1DTWA 3KDPA 1S0UA 3G7SA 4EG4A 2Q9AA 2LHTA 3I4CA 2HR1A 4NM1A 3F4BA 3D3KA 3ODGA 2D8AA 5KTQA 1MAVA 1TZ2A 3UCXA 3K1AB 2FN7A 3U4MA 3R75A 3SYKA 1U8CB 3MBIA 1D1PA 8ADHA 3PCXA 4D2IA 4EBDA 2X0NA 4HPXB 2NO4A 4NP6A 1GRRA 2O8VA 4F5WA 2YHIB 8ICOA 3DR3A 1ZQSA 1YCDA 2HK7A 2CW5A 4S24A 4BB0A 1T2DA 4MCJA 2UUCB 1LF0A 3BT7A 1U2GC 1XXHB 3UV7A 2HQSA 3HCDA 4MVCA 5KNBA 1OILA 1JYEA 2CDBA 4CCYB 2ATEA 2CDRA 4R69A 4CU2A 1LS1A 2R6JA 1YUNA 4P7BA 5I4KA 4B35A 2WHQA 3ZIAD 4FN5A 1NC1A 4LECA 4PGGA 5C5IA 3RVPA 1U9YA 2JDID 4PIPA 2H17A 1RYFA 5T7BA 1XNHA 4WAUA 3G2NA 2Q4TA 4CTJA 4Q1AA 1KTVA 3SHWA 3HA3A 4AZ3A 2E4UA 5JEDA 4P7FA 2FZLA 1QGUB 3V42A 4C30A 4ZQCB 4EHKA 5ALKA 4KVFA 5I7UA 3COVA 2PAFA 2HJGA 2XODA 2BGTA 4P32A 2R4QA 4MKXA 5EI5A 2AOUB 4TRRA 2VR1A 2H2DA 3THYB 5HIIA 3RR2A 1WY7A 4EB6A 3V2IA 1RHMA 1XIVA 3QSYA 4WLOA 1T29A 2K4IA 2G72A 4A8JA 1VI6A 1Q83A 2YKGA 2FPXA 4XYBA 1Y6JA 1X7HA 1H8HD 4LDRA 2W2VA 4QO8A 3CJQA 1Y3AA 5LBIA 3IT1A 1GKUB 3VR5H 4CHGA 5LJLA 5BV0A 4ENWA 5C1IA 4DMKA 5KBYA 4G89A 4JHXA 1NZBA 1VXOA 3QFTA 1EDZA 2Y1KA 1AMNA 4YASA 3KPJA 4KDRA 3T7IA 4R0VA 4GOLD 5JJIA 1Y8ZA 1XRNA 1XYYA 1JI0A 4D44A 3IOEA 2ONZA 1D1SA 4HLUC 3BDVA 3AXSA 1QDLB 1RWQA 4X1OA 5FBVB 3OG9A 1Z00A 2CMGA 3VTFA 4WCVA 3GAAA 2ZUVA 3C8UA 5JD5A 2ZIUB 4RDCA 4KNWA 4RJTA 4RXTA 3VR3A 4F3NA 4GI5A 5C4IA 1W36C 3GLGA 1UKVY 2UVVA 4DV5B 3IP9A 5KKCA 1FTNA 1IM5A 1XCJA 3HCFA 3EQ7A 1VL1A 4KMUA 4XQCA 3ORYA 4YP1A 1FVFA 4IIHA 3UB4A 2L0XA 5HZHA 3OPYB 3GH1A 1M10A 1IG6A 5BYKA 2IGTA 2IGBA 2ZRCA 3D6AA 4L5YA 4L51A 4F4FA 2DHRA 2Q4EA 4YRJA 3K0AA 2P9TA 3OGUA 1Z6AA 4AICA 3GIJA 4FLEA 4CMAA 4DQLA 3PPXA 1CJMA 5CNMA 1KTIA 3LVRE 5DB7A 5D5HA 3VPBA 3O1IC 2ESRA 3RC8A 2SCUB 2JIRA 3WZ2A 5C7YA 4RZIA 2KFNA 1A9YA 4UAYA 4IJQA 1H4VB 2EDAA 4HWGA 3TDMA 4Q82A 2FZKA 4YJ2B 1W85A 3R0JA 1EWRA 2CCJA 4WZ6<