2HDOA

Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
207
Chain Sequence
b'MTYQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTFPMAAEQAMTELGIAASEFDHFQAQYEDVMASHYDQIELYPGITSLFEQLPSELRLGIVTSQRRNELESGMRSYPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGMDPNADHQKVAHRFQKPLDILELF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycolate phosphatase
publication title Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from Lactobacillus plantarum at 1.50 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 57
structure length 207
sequence length 207
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hdoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hdoA01
2FEAA 5ALWA 2HF2A 3EWIA 3ZU6A 3SHQA 4UU1A 4KNWA 4YGYA 2G07A 1QQ7A 5AM1A 1J8DA 1NRWA 1WZCA 1Z4JA 2X4DA 3ZW7A 3DNPA 3M1YA 4CF4A 3ET5A 1T5SA 2ZBEA 3QUBA 4FE3A 4ZEXA 2G08A 2PR7A 4UASA 2IA5A 4RETA 3R4CA 2I34A 4GIBA 4EX7A 2C4NA 2WF9A 3SLRA 2R8ZA 1ZS9A 3AR4A 2D2VA 2WFAA 4IFTA 1LVHA 3OCWA 3SF0A 4Y2XA 2C88A 1RLMA 3I6BA 2C9MA 3FPBA 1U7OA 4UARA 1QQ5A 2FPWA 4L57A 1Z4IA 2PQ0A 1F5SA 1YS9A 4B6JA 5AKHA 4UMDA 2BDUA 1O08A 4OD0A 1T5TA 3B8EA 5AVQA 4YCNA 4KN8A 4J2TA 1RPZA 1AQ6A 4AP9A 5AI4A 3FVVA 5AM3A 5ALMA 3FZQA 3N8GA 4Y2PA 2P11A 2OM6A 4ZEVA 4CF5A 3L8FA 1Q91A 2HF7A 3DV9A 2HOQA 4QQFA 1VJ5A 4BNDB 4UM7A 2C8LA 4UMVA 5ALQA 2NYVA 1YDFA 4BNDA 1ZRNA 1ZD2P 3MC1A 3L0CA 1ZOLA 2HCFA 1CR6A 2FUCA 4XE5A 2JAOA 4BEVA 5AM2A 3U13A 5ALFA 3QUQA 4UMFA 3ZTWA 2G80A 3MMZA 5AVSA 5AM0A 3WGUA 3MPOA 5AVYA 4DW8A 1PW5A 4BX2A 3W5CA 2ODAA 4MWOA 2B1RA 1TE2A 3QGMA 1RKQA 3WK6A 5ALVA 3D6JA 3DDHA 2JAUA 3A3YA 5AW1A 2GO7A 4O8CA 2WF7A 2JGAA 1SU4A 1WR8A 5AM4A 3N28A 2IOHA 4F72A 4HGOA 4JDPA 5AK5A 3E84A 5ALEA 1TJ5A 1Q92A 3BWVA 2GHQA 3ESQA 3OPXA 5AESA 1L7PA 4HGQA 5ALXA 1NNLA 3WGVA 2YBDA 3L1UA 3WK7A 2I33A 5AW5A 2AGVA 1XPJA 3AR7A 5A3QA 3AR9A 5A3SA 2OYCA 3WKCA 5AVTA 3ET4A 4CNQA 5AI5A 2AUTA 4NWIA 3QNMA 3SKYA 1ZD3A 3R9KA 4XOUA 1FEZA 2WM8A 3ZVMA 3ZWDA 1N8NA 4MUMA 3K1ZA 2YJ4A 3QUTA 2VKQA 1WPGA 4OHFA 1RC8A 4CF3A 4UATA 5AVRA 1U02A 3WKBA 2Q4RA 3NIWA 3SD7A 1S8OA 5FP0A 3W5AA 2G06A 5ALPA 4YIKA 4BBJA 3IJ5A 2G09A 4EEKA 1L7OA 3A1EA 5AKEA 2P27A 2FPXA 5AKXA 2FPRA 2RBKA 1RRCA 2ZG6A 4XQ0A 3GYGA 2GFHA 2G1AA 4EELA 3PCTA 1MH9A 3F9RA 2O2XA 4KX5A 1RQLA 2CFTA 1Y8AA 2YJ6A 2ZBGA 2IOFA 4CE6A 2B0CA 2NO5A 1Z4QA 1JUDA 5AICA 1VFPA 3ZTYA 2Q5EA 3RFUA 3KZXA 5ALNA 2W11A 5AW4A 3QU9A 2WHEA 1Z4KA 1TJ4A 4PNHA 4Y2JA 3WKDA 4FYPA 2WF8A 1KYTA 1Z4LA 2PKEA 3E81A 2OA0A 3QU4A 3W5DA 3M9LA 4BEWA 1RKUA 3VAYA 2P69A 3NUQA 2YMLA 5AIAA 4Y2UA 4DCCA 1CQZA 4L6AA 3ZVNA 5ALKA 2QYHA 2R8YA 4YCLA 3FPSA 3ZX5A 2IOFK 2CFSA 3QU7A 4E88A 2JARA 1L8LA 3B9BA 2FPSA 3EPRA 2Q4TA 1QH9A 5ALDA 5AVXA 3ED5A 5IT4A 3IRUA 3QYPA 3SMVA 3ESRA 3AR5A 3NALA 1J97A 5AKKA 2ZBDA 5AI8A 4GXTA 5ALLA 3I1YA 3NASA 5AK6A 4Y2TA 1L7NA 3NANA 2HO4A 1T9ZA 4UAVA 3L0BA 4KYTA 2YN4A 3KOOA 1O03A 5AK4A 3UM9A 4C4RA 2DQSA 1XVIA 4EENA 3SKXA 3QX7A 1LTQA 5AW2A 3QU5A 5JJBA 1Z5UA 1TA0A 3P96A 3N5KA 2HDOA 1Z5GA 3A1CA 1U7PA 2C8KA 3U19A 4OFZA 1S2OA 3L8HA 3ZI4A 2RB5A 4G9BA 4FFDA 2GMWA 4HGNA 3AR3A 5AHXA 4DFDA 2I55A 3OCUA 4EZEA 3WKAA 1YJ5A 2W43A 2ZOSA 2B1QA 3EF1A 4OCZA 5AK3A 3BA6A 4NAVA 3N07A 4L6CA 2WF6A 4HGPA 4BKMA 5ALJA 4H1WA 1RLOA 3RF6A 5AW9A 3I28A 1EK1A 3OCVA 2EAUA 3QUCA 1VJRA 3KD3A 5IS2A 4UAUA 3U7HB 2MSNA 4XPZA 1Z4MA 2YJ5A 1EK2A 4NABA 2YMQA 1RQNA 2NO4A 3PGVA 2MU1A 3S6JA 4J03A 2FPUA 3HLTA 2HHLA 5AVZA 1SWWA 5ALRA 4AS2A 3I76A 3DAOA 3QLEA 4Y3UA 5IT0A 3L7YA 1K1EA 4YCMA 2R8XA 4DWOA 1QYIA 3EF0A 5AVVA 4EX6A 5ALUA 3NAMA 5AKGA 4KNVA 1RMTA 3L0YA 2EARA 3NRJA 2QLTA 4NFLA 5AM5A 1Z4OA 3AR2A 3OCXA 3OCYA 5AW7A 1ZJJA 1N9KA 1ZD4A 5T41A 2IYEA 1RDFA 2FUEA 3FGOA 2BDEA 1RKVA 4IG4A 3KDPA 5AI6A 4C4TA 3QXGA 4BYGA 5E0OA 2HI0A 4KX3A 1X42A 2JAWA 3U26A 5AI0A 2O9JA 5ALOA 2EATA 1NF2A 5AI9A 5AW8A 1L7MA 3U7GA 5ALIA 1YNSA 3QU2A 2AMYA 4YH1A 1SWVA 4F71A 3L8GA 3MN1A 2G0AA 3PGLA 1YMQA 1U2SA 4BX0A 3L5KA 4I9FA 4AS3A 2I7DA 1RMQA 5AVWA 2MU2A 5AKLA 4JB3A 1WVIA 2B8JA 4UMEA 5AW3A 3OTQA 2RARA 1Z4NA 5ALYA 1U2TA 4G63A 3UMGA 3PDWA 3A1DA 2B82A 3WK9A 3E58A 4HYTA 2P9JA 3W5BA 2YMMA 4HAIA 4QJBA 4RESA 4Y2SA 2FDRA 4C4SA 3TLMA 4NV0A 1XP5A 4Y2QA 2ZXEA 3L8EA 2YMPA 2BY4A 2YJ3A 3B9RA 5AW0A 2YFYA 3WKEA 3WK5A 3E8MA 3R09A 2HSZA 3HYCA 3ZWKA 3WK4A 2HX1A 1L8OA 2WF5A 2AH5A 2R8EA 4Y2YA 5AKJA 2I6XA 2RAVA 5ALZA 3ONNA 1IWOA 4Y2RA 2FI1A 3FM9A 4UW9A 3U7EB 5AKZA 1ZRMA 3KC2A 5ALHA 5ALTA 2W4MA 2CN1A 1RLTA 2B8EA 4HGRA 3AR8A 3N1UA 3UMBA 4YIHA 2OBBA 5A3RA 2YY6A 5AVUA 5ALSA 5AW6A 3J7TA 2B30A 4UM5A 1RMYA 4ZEWA 3WK8A 3L1VA 3UMCA 3IB6A 3CZ4A 3CNHA 1Z4PX 3KBBA 3ZVLA 4BX3A 1Z88A 1YV9A 5AIBA 3AR6A 3U7FB 2ZBFA 1ZD5A 3ZUPA 2HEGA 1TJ3A 2GHTA 2I54A 3OCZA 4I9GA 2CFRA 5AKYA 4Y2VA 1QQ6A 5ALGA 4UU0A 3ZX4A 1L6RA 5AKIA
chains in the Genus database with same CATH superfamily
2FEAA 5LOVB 4HT3B 1RD4A 4IKEA 2Z6VA 1P73A 3MWDB 3THWA 1IXZA 4F3CA 4ZCLA 3MHTA 2OOKA 3L7BA 4QZ8A 3CY6A 1A8UA 3OA0A 3KOWA 3TOSA 3AWIA 4DNPA 1X14A 1U7OA 1XAHA 4F85A 1G8FA 3KZOA 1FFUA 4OSEA 7MDHA 1PL0A 3KQSA 1IIRA 3HACA 5F35A 4ZMSA 4PGHA 5BMOA 4BVFA 2ZZNA 3IDSA 2YIMA 5G3ZA 3O3MB 5CX4A 3AP1A 2JAPA 2PMFA 3H3XA 3OTWA 4Y9UA 1IMJA 1E6MA 3BB1A 1VMDA 5IK2D 4QM6A 4RK0A 2XYQA 2HK6A 1P9LA 5JROA 1FSGA 4RY0A 4UMFA 3TLCA 2OBXA 4OREX 1CEEA 2VK4A 3CVYA 4N7MA 6GPBA 3MMSA 5JV5A 1FFYA 7REQB 4XFDA 3AQFA 2I4MA 1N2EA 1NFFA 2V6GA 4ECYA 4XJSA 3L1UA 1QQBA 2FW9A 4HCJA 4NWIA 4CEIB 1SIWA 1V9LA 3OZRA 3ZVMA 2D6FA 3A9CA 4EA9A 4H3HB 1Z6ZA 4F2SA 2ICAA 2WFLB 5AQEA 3DZHA 3AY3A 3THRA 1L1RA 2Z8XA 3VKHA 3F8WA 3V7NA 2X0RA 4LQLA 7ABPA 3HYRA 3G8DA 4NBRA 3GRZA 3PD0A 3PTAA 5DB7A 1Z8NA 4MW9A 4RTKA 4RWEA 5LUAA 3GFGA 4JT4A 4HQFA 1O96B 1PFKA 1BZYA 1ZIOA 4TPKA 4FYYA 3AFOA 3U3JA 3HKDB 3E9EA 3D2QA 4G4IA 1QH9A 3PC3A 2W9AA 1QPGA 2Z9CA 4G2NA 3PENA 5HNKA 5DH9A 3FZYA 2HSWA 4TRMA 3OCJA 1P7YA 3N2NA 1R88A 1S4QA 3QVGA 4FLFA 4LF6B 4N6OA 4LN1A 4YV1A 3WLLA 1T2VA 1OXSC 1SKYB 4L73A 4ZI7F 4YVZA 4Q39A 4RZSA 1GU1A 3AG6A 3EC7A 2PMWB 4MV1A 2HA2A 3ECSA 2GZ3A 1PW7A 2QNRA 2V7EA 4NAVA 3W0LB 1ZK3A 3ZDAA 1N92A 1QE0A 1BS1A 2ZK7A 4W8GA 3TCKA 5LJIA 3TSCA 5ECYA 2IZZA 3EEIA 2IYTA 3G0OA 3E8SA 2O8CB 1PG5A 2DFDA 4NDAA 4KQ9A 3MCUA 3EQ6A 3DAOA 3QLEA 1BQEA 3UF0A 2CV0A 2R8KA 4DWOA 4ZCPA 4LSWA 2AOVA 2PMCA 1LWOA 1F1BA 3N58A 4KQHA 3B70A 2ZI5A 3IR7A 4J1TC 3M6ZA 5CYOA 2GILA 2Y71A 5A4DA 3DAPA 1KQPA 3TOCA 2UUBB 5KWVA 1I2AA 4UVEA 1F3LA 1XU4A 3ESYA 4QBIA 3HBNA 2Y0PA 1B93A 4UAJA 5ALIA 4M9JA 2PGNA 2C77A 1JG4A 3HA3A 3MWEB 5K6AA 3TQSA 1CVIA 4LY9A 3CEJA 3FSGA 3JU3A 4X95A 1S0MA 1U0JA 1WHSA 1JS1X 4ZALA 3AHGA 2O2HA 5AVOA 3R9IA 2XB9A 1P2DA 1RW4A 5CCEA 5KFUA 4I55F 3NTLA 3EGOA 1MQ3A 1UR5A 2HOIA 5JZOA 4GPBA 1DTEA 4MGIR 4XSHA 4B74A 1WB6A 5DYIA 1X7WB 4LJAA 1PLLA 2BP7B 3NH6A 4F5YA 1U2DA 2WWXA 1PJTA 1BIFA 3I9LA 1G98A 2ZCJA 2NV6A 2VYQA 2MUTB 4WHMA 2KX7A 1U98A 1KKLA 4IZHA 5D6OA 2E9SA 1VE6A 4W7SA 4L8LA 7AT1A 1DHRA 1C7RA 3OP1A 3ENVA 4R05A 3ADOA 1MN8A 3FY4A 1U0GA 4PGGA 2X4DA 4Z9XA 4WINA 1JKJB 5B1DA 3DMRA 4INAA 4NV3A 1NNSA 1MTZA 3F5QA 4IUCS 3RRBA 1V97A 2C2RA 4FNMA 4YK7A 2WIKA 5EUBA 1C3JA 5EIBC 3PNMA 4B09A 3FWNA 1YE3A 1ULUA 3Q88A 1M2JA 5KKCA 5KYTA 2HF7A 1JF8A 2R84A 1AB6A 4CGYA 1QZTA 3DFIA 5IBQA 3ETRA 2Q2WA 3CCBA 3CJTA 3HCBA 1RZ3A 5CA7A 2XDWA 2E4WA 7ICNA 1OMOA 4FOSA 1QKJA 2WRZA 3STXA 2EP7A 3G1WA 3KKEA 1LI5A 3K9GA 4DFJA 1R12A 4CW7A 1E9FA 1EVEA 1CY2A 2Q1UA 2IC5A 2J32A 1SXHA 1CIVA 1BPDA 3MYYA 3DWEX 4FILA 4BMVA 3HA2A 3E3LA 4FCCA 2QUKA 2V55B 2XQFA 2Z2XA 6AT1A 3NXSA 2UVDA 3I52A 1UDAA 1QHYA 3ICOA 2DOKA 1L7OA 2G5TA 1EJ2A 4IFEA 1TK3A 3WLAA 2M98A 2C2BA 1GPLA 3DTTA 2DM6A 1SIBE 4W9NC 3DVAB 1COZA 4JC0A 2TSYB 2FPGA 1JFRA 2R751 1GUZA 3E53A 1KFCB 1LEHA 4X20B 1ATIA 3PW7A 5JJ5A 3WIOA 1WXFA 1Z6GA 4NECA 4BXOB 1X2EA 3KKZA 5ECWA 3PNYA 4KXFB 1QONA 1USIA 5KJ6A 3ED5A 3ZJTA 1X74A 2XYPA 3JQEA 3E5MA 2PCJA 5DCLA 3SSMA 1X7GA 2IYYA 1VLJA 2RE8A 3PSAA 3ZWAA 4DCNA 1ADJA 2PXAA 3EXFB 3F90A 1WW2A 4E7PA 4V0RA 1XEXB 1O97C 2ZSFA 2HDOA 3JQFC 3LDAA 3HSYA 4OEHA 1LPMA 3EMKA 5NULA 3E7FA 5DE3A 1XSNA 1CS0A 3A6DA 3DULA 2O3SA 4B8ZA 4RC9A 3U6KA 5IF3A 1HV8A 1YJQA 1RYYA 3AHDA 4B79A 4NLKA 4QWDA 2J4FA 4Q12A 1JU4A 1P9OA 3EEQA 1NQUA 2P4HX 1RXUA 4PPXA 4KYVA 5JHGB 3E7WA 3PD1A 3QVKA 4OHBA 5C8ZA 2XGOA 4BNNA 4IX1A 1L4UA 5LYJF 2FUG1 4ECQA 1X1RA 3GC6A 4A5OA 1YS7A 3WOHA 2XVYA 2HU8A 1MOSA 4CDGA 3IQGX 4QFCA 3KKAC 5KHAA 2TMKA 3OLWA 4TV9B 3JSAA 4ZOLB 1BH6A 4ARIA 4ZMRA 3T7AA 3PUKA 4HNHA 4EZIA 1FMTA 1U9ZA 3ETEA 4DCMA 4F2RA 3ROXA 4LSMA 1TK8A 1KHTA 2C9CA 3VJMA 4BWJA 2OG2A 5K03A 4K6MA 4NBWA 4HX5A 4HH0A 3WWPA 4WNCA 5DTMA 2VDUE 2OQ2A 2ZTMA 1DC6A 2YN0A 4Y1RB 4P4LA 3IP6A 4D5GA 3D7SA 4PPFA 5IYZF 3C5EA 2FJPA 5IAJA 5C1PA 5DT9A 3ENNA 1CUFA 4A2CA 1HMPA 1C4WA 3P32A 2E7ZA 4YXWD 2NZWA 1VL5A 1EWKA 3CIOA 2GLUA 3V48A 5HM6A 1A9OA 1MAHA 2DFPA 1ZQ1A 3THXB 5IZ4A 1HEKA 4QDTA 1TDJA 5KC8A 1HT1E 3ANNA 1KQOA 1KVSA 2EF1A 3TGLA 1O94D 2LCFA 2BM8A 2IHYA 3FVTA 1MX9A 3DZFA 1QU3A 1GPNA 2OLEA 3MUOA 5I51A 2OV3A 1UMCB 1HYBA 4JC5A 1BCSB 1QR2A 3D5QA 2DZDA 3LKZA 3CNNA 1QO0A 1M8PA 4BYMA 4BO4A 2LIVA 4P7FA 1BPBA 4X5VA 4DMMA 3RADC 3SLRA 5T4FA 1HH4A 4IIDA 2RQ5A 3I3SR 3UMRA 4NOMA 3KKKA 4PYRA 5JCXA 3SXJA 2VJ5A 3Q9UA 2IUYA 4D8XA 3PNOA 3QPUA 5DW3A 3DL0A 3WHIA 4DT1A 1MJGM 1XMVA 4CF5A 1N62A 1G8PA 4WDRA 1YOBA 3VU9A 4KN9S 4C3VA 5KOJB 4KAAA 3GZTB 4Q4JB 1JFFB 1E6UA 4NY1A 5DKWA 1NTRA 2RHGB 5F21A 2FSVA 2YVAA 3GN2A 3EJWA 1TEXA 2VJAA 1P2FA 4LOKA 3VDRA 4JJ4A 5IAAA 2JGAA 1WHTA 4RKYA 5EUQB 2F3QA 3RTEA 1ORTA 3O4JA 1YZTA 2P7HA 3AR7A 5IJXA 1K97A 4KLMA 4QXPA 1JDZA 3GH1A 3P19A 3IA2A 2HWUA 3VR2A 3KEFA 4G0UA 1CR1A 4GLXA 1HDGO 1W19A 3SU8A 4WLOA 3T3FA 1P4HA 3LC2O 4HWRA 4DKJA 3DT6A 3ZH2A 3LWMA 3I1JA 3SWWA 3FTFA 3WA6A 4D81A 1FFHA 1TMYA 1C9MA 3L9XA 4NI5A 2LUOA 4K26A 4OPMA 3IDOA 1FVXA 3OX1A 5JPDA 4R1TA 4OYYA 3IL2A 4Z4HA 3CM0A 2BD0A 4UEQA 4PFKA 4XYBA 3G23A 2PNFA 2YHSA 5K0LA 4DBVO 1SV0C 4HDKB 5ALDA 4G25A 1JPJA 2WOJA 3L0OA 2QD5A 9LDBA 1XAIA 1UPUA 1L7EA 2H8KA 2PE5A 3C6ZA 3TLKA 2RH5A 1XXLA 3T3PB 5FYDA 2P35A 3AVTA 4XAQA 1W5FA 3ZIAA 1Q3HA 2HK9A 2W3SA 5JO9A 1Z68A 3OZXA 1PR4A 2REXB 4E2WA 4L6CA 1EVJA 2FFJA 2I66A 2P4QA 2WPNA 3RKRA 3H83A 5JCZA 2VR1A 1OTHA 4DY6A 1DQZA 1HQCA 3RS2A 2K87A 3KJNA 2MU1A 4X41A 4NG5A 4JJ7A 3FAKA 3V80A 4IDBA 3B5IA 2H1WA 5KFHA 3FDXA 2FX2A 3H2GA 2JJ2D 1XWWA 3WE7A 3A9RA 1J0EA 2EJBA 3OZBA 3QJGA 3NYIA 1LLCA 1WLSA 3HR4A 3P9QA 2OE2A 5FOTA 5JXHA 2P6MA 4D82A 4IG4A 2HK7A 4XVHA 4CODB 4KG7A 5AOVA 2QTFA 2O9JA 3LC0A 4TV8A 1CRPA 4O5KA 3SIPA 1VI5A 4J29A 4O25A 2P5TB 3VX3A 3UB2A 3O9MA 2ZT8A 3MMPA 3RTCA 5KYWB 4BB6A 3DXXA 2BSQA 1M6VA 3ISBA 1AKYA 4QFDA 3PEEA 3V1MA 3EVCA 3HUDA 1QRSA 1VIAA 2JC3A 3BL6A 3EIHA 4C7VA 4OATA 4X94A 3DTVA 1T2EA 5A5VA 3T7RA 1HDIA 4JYZA 4XX0A 1RC1A 2WUDA 1SKRA 1SULA 3WC4A 5ALSA 4J0FA 4NXZA 1RJFA 3F73A 3FZEA 1T5HX 1KFEB 3HG7A 3R7BA 1LY1A 3X1MA 4AYXA 2IKSA 3FE2A 3ZUPA 1H8HA 5IVKA 4WJKB 5GY7A 2X3YA 1CDDA 1FTWA 3RPEA 4D9HA 3GV8B 4UHEA 1ENPA 1FUKA 2DTXA 2PK3A 2OGSA 1M0SA 3QUBA 2NU6B 3KWJA 3L7JA 1CUBA 5SZHB 4S3MA 2EGUA 4JC8A 2PV0A 4Q1BA 3K2QA 3CLUD 4ES6A 4ITVA 1R74A 3OCWA 4E09A 4MA0A 1ARZA 2QAGC 2IHZA 1PS8A 3NJRA 2G7ZA 5ESXA 4LRQA 4DOAA 2HZBA 4IH9A 1OLOA 3HJUA 2KB0A 5ALMA 4TKVB 4FFRA 1XPRA 2PGAA 3DUWA 2YIDA 1BPXA 1QCCA 3U4GA 3AI1A 2C9YA 2J0VA 2BR4A 4O6VA 4YBRA 3ZK7A 3GK3A 4MVJA 4U63A 2GJ9A 4TVOA 5JCOA 1LLDA 5EE1A 3B9JA 3GRYA 2XUQA 4WLUA 5CA0B 2ATXA 1RKQA 4NP6A 1UDRA 2A78A 2Z4RA 4CLOB 4X6UA 3UCFA 4JA2A 3O1IC 5HQ3A 5ALXA 2B9EA 1UMBB 2ZITA 3V1KA 1KYQA 1KP2A 2O7NA 2R65A 1RWWA 1V38A 5FBLB 3UIEA 2WWWA 3KT8A 2IX3A 4Z2YA 3BQTA 3PSTA 3PTZA 1Z6PA 1V2HE 4HSGA 3Q8KA 1W4CA 3U3RA 1TQ8A 4GR5A 1PT5A 3BE4A 3H5OA 2IUFA 1XMQB 1RRCA 4OK5A 2W83A 5JNRA 1NAHA 3ROZA 1ORRA 1F8YA 2JGDA 3LJKA 2JA2A 1J8FA 3ZHSA 4D02A 4E5PA 2KFNA 1E6EA 3B13B 1EAYA 3DWIA 5IVIA 2XC9A 2O2YA 5CRIA 1C0IA 2W03A 2N1MA 1Y1RA 3BRWA 3JS5A 4FUTA 3OECA 3ZW8A 1YCFA 9ICEA 3MUFA 4XGNA 1KR2A 4R63A 4RTSA 2RK4A 5EWJA 3SCZA 3ZE9A 3GH3A 3UYLA 4RSGA 1XVIA 4H0FA 2RP5A 4MK4A 4RWZA 2FVYA 1Y3BE 3KJFA 3PDUA 1S0NA 1EZ4A 1PT9A 3PLAE 3D1JA 3OKCA 3FTDA 1I32A 3KJIA 3LQYA 1A7KA 3UHJA 1Y33E 5CD9A 3RRGA 2XEXA 3UNXA 3ZDZB 4K03A 2F1JA 3IE2A 2VRNA 5KNBH 2YIVX 1XEWX 4CQNA 3ZPXA 3X43A 4U7WA 2X5OA 2FETA 4CIDA 3M1LA 4JROA 9ICMA 2DQ4A 3K9LA 3NFRA 1B0UA 3H86A 4HEQA 5DOVA 1CUAA 2BFPA 3AUXA 4HO1X 2GVDC 3OLVA 5TMEA 4RPHA 1SCNE 4DUYB 2PCLA 5HMMA 1HFJA 2HSGA 2OXOA 3H0LB 1VIDA 2QW0X 3SJ7A 3FZGA 1E2NA 2WICA 3JVIA 2JFYA 4HOYA 1W9MA 3PTLA 4EUSA 4EYOA 1C14A 1ML3A 4HNAB 4IS2A 5CB8A 1U1DA 4OMDA 4KUEA 1PV2A 3C29A 2FK7A 4FN4A 4U7GA 4RHFA 1DL5A 1P4GA 3RAGA 3UMGA 4FR0A 1BW9B 5F2NA 3DF9A 2QGNA 2GM3A 4AF6A 4GSLA 4MUXA 1NXPA 2R48A 3ACBA 4GOJA 5KYXB 5KOHB 2L18A 1ULHA 2OFWA 2AMJA 1J5EB 1S3FA 1ODCA 3W6PA 3PPYA 4G8JA 4JP2A 4LJ8A 2VH1A 1EXWA 1T13A 3VYWA 4AZVA 3TL3A 2YQZA 5G1OA 3SZGA 2ONKA 3I42A 5E7IA 3EEBA 3MHPA 4XB6B 5A0FA 3AM1A 1P3Y1 1MMFB 3FCXA 3SZMA 3QPDA 3Q4GA 4OX9B 4PRZA 1TAGA 4QGGA 4NMWA 1KFKB 2GERA 4AG5A 4BTEA 3OCZA 4DG5A 2OHGA 4RUCA 1X6JA 2RBGA 4IIJB 2XTAA 1LFAA 5A3VA 5CH3A 3ETLA 2KYRA 3JATB 1FVOA 2TRSB 2DWQA 2HAEA 3COVA 4CEJA 4UAGA 3TIIA 2Y1JA 5U1PA 4O3MA 2PMDA 4UTOA 5DHQA 4CRXA 3RWOA 1CVRA 1S9DA 2JB9A 5BV1A 2WFAA 4ZI7A 4QEZA 2C9MA 4TT3A 2VI5A 1A1SA 4NPAA 2XRFA 2UZ0A 5EP1A 4KXQA 1QVRA 3SDSA 3FKQA 2X40A 1GY8A 1YA4A 2GXSA 2BKAA 4CMJA 4GNKA 3AW8A 1UT6A 3WX0A 4RV4A 4BLUA 1LTKA 3L0CA 1U2ZA 3HL4A 4NYIR 3O2JA 2XYRA 3KNZA 1UIRA 4QQ8A 3RSHA 1DEKA 1ZGZA 4UUPA 4ICIA 1L6NA 3DMDA 3GZFA 4BUJA 3TW8A 4ZAWA 1UQRA 2WIGA 4NZPA 4TROA 5AM4A 1YBAA 3VR5D 3C3CA 2X8AA 5TQVA 4TXLA 1TT7A 4B85A 3E9YA 1NBMA 2YDYA 1TVKA 1MVNA 3NHFA 4PRKA 3KQWA 1V1MA 2JI9A 4F8YA 3DGEC 4OAOA 5LMZA 1XQ1A 3V7FA 2ZJBA 2C3YA 3ZQ4A 3FBWA 3DLIA 2W6ID 2GJ4A 4XXHA 4C0ZA 5DSTA 2PLRA 1GFWA 1P45A 3GYGA 3EVFA 1KZ9A 3PYXA 3AQIA 3F71A 3KUCA 1JG3A 4I55A 3QVWA 1QNLA 2J87A 2C4HA 1M5TA 2ZRMA 1M0WA 3S8YA 4WKBA 5FYQA 2C3OA 2ZRIA 3FF1A 3NUQA 1C8VB 3OQJA 1OT5A 1UJMA 1XCBA 3CGGA 2DMRA 3FPSA 1KH1A 1QWOA 2ONJA 4UFNA 5KFSA 1A0PA 1FDIA 3D54D 1E2HA 3QEBZ 1DXQA 2RGBA 5LR6A 2IYPA 4D3SA 3WDSA 2V98A 5AYVA 4L2IA 2QI9F 2GKGA 3V7JA 3RM3A 1ORVA 4MR8B 2Z56A 2RJOA 2O6LA 3GCGA 1YZNA 5K0CA 3RLIA 4AM8A 2H7CA 3ZI4A 4C78A 4L9WA 4EZEA 4HUQA 2IWHA 1X7DA 4CL3A 4AMUA 4E70A 2X22A 1N1EA 2CPRA 2H9YA 1TKBA 3KKNA 3LQFA 1YOVA 2H0RA 4CTKA 4Z4EA 3PP8A 1W46A 1WCXA 1CFJA 2R1TA 3VPSA 3TTUA 3JALB 3TNFA 3G5MA 1CZHA 1HBJA 2RKWA 1YCHA 4QXRA 4FZRA 1BRMA 5KNLA 1JU3A 3ZZ0A 3UJ7A 2PT5A 3PRJA 1PK3A 3WNBA 3AOEC 4C7BA 1TEVA 3A9TA 3DVRX 3KUKA 1Q3TA 2DYKA 3MJRA 5KTTA 2D1TA 4L75A 4TTVA 2MCFA 3L84A 4TXNA 1Q3UA 4EVSA 3LHKA 4ECVA 3MD9A 3DOFA 3GFQA 3AP2A 2QN9A 3RNOA 4U7PB 3C3BA 4OJKA 1UC5B 1E3SA 2OGTA 1R0BA 2XF8A 2XXBA 1DIBA 4EUKA 5LA6F 2BJHA 1IZ7A 1TC1A 2CLLB 4GOKA 1XTJA 2JIZD 4FBTA 1ZU4A 2GSDA 2NAFA 1BDHA 4KEAA 1A50B 2HRDA 3KWMA 2W00A 1T6XA 1T4CB 4UUOA 4OI1A 1GAJA 3E7DA 2XIDA 3K9BA 1SZDA 4EI2A 4R83A 1D07A 1WB4A 4NLGA 3QOYA 4WN9B 1T4MA 4LYJA 1XO1A 3P9PA 4TXHA 4IV0A 1XNRB 1PK1B 1DO0A 3ZXXA 3KD2A 1BYUA 4WADA 1QVZA 4NMMA 2HBQA 1GUDA 1UBUS 1IBCA 2CLDX 4TL6A 1PVPA 4CCYA 3GIJA 4J07A 4LWOA 4HL6A 1XYGA 1GU7A 1D6JA 2QL9A 2VS1A 2LKCA 4LYFA 1JQJC 3RYCA 4KQEA 2HF9A 2KM1A 5JBQA 1J1IA 5M2QA 4Y2XA 1G3MA 3DYVA 4E30A 1Y5LA 1DCMA 4S2UA 4P3OA 1GQQA 1VIMA 3F2IA 1EESA 2AWOA 2FX5A 4EM6A 4DKXA 2FDXA 4YEDA 3BTVA 1JHAA 3CBQA 1DCTA 1LPOA 1S9HA 4K4IA 4BMZA 1H1DA 2IBKA 2QRJA 3TJZA 4H7JA 2O23A 2UUPA 1ZNYA 3L46A 2OK7A 1VG1A 4IO1A 3NBAA 2C0CA 3F5DA 2ZRLA 1CF4A 2X9LA 2HY7A 4D74A 1GZSA 3QELB 2WWIA 2QSZA 4P4TA 1IN4A 2XVAA 4FEYA 1C3OA 1T34A 3KPWA 4WSOA 1KJIA 5IXYA 4L0DA 3BKWA 1U7DA 4Y30A 3VKVA 4N0EA 2AUTA 1PYOA 2LXNA 1JILA 3UVEA 3Q6MA 3FDSA 1UAGA 3GHYA 4K6OA 2HR1A 1SD5A 3UV6A 3QWAA 4KE7A 3BSWA 2WA1A 4AULA 1QIIA 2B69A 2V8OA 1EFRA 4ZOBA 4BBJA 4YIKA 3P9CA 3R9WA 4RD6A 5CNJA 3I2GA 2R96A 3BG5A 5TPZD 2AYYA 4PZAA 4IQTA 1XCLA 3IAXA 4YJ3F 2B6NA 1CQIA 3ABRB 4MHVA 1ZFNA 2ROQA 1DKMA 1EPUA 1TJ4A 3L06A 4Z53A 5I47A 3OF5A 3KV3O 3ZS9A 2VRWA 4DCCA 2E1PA 3B9PA 2XCPA 5A6SA 3K0FB 4F91B 3LHFA 2QPLA 5KFTA 2LYHA 1T0IA 4C5CA 3AXTA 2CL5A 2PMZF 3I39X 2G9RA 2VPWA 4EHLA 1CTQA 2Z3ZA 1J4AA 1NA5A 3A6PC 4KPYA 3FPEA 1AG9A 3DO6A 3Q8MA 3KQNA 2PJUA 3AVYA 3ISCA 4IXMA 3W3AD 1V4VA 3NHKA 4OFZA 4AY3A 4NSNA 2OZPA 1VBFA 4EBDA 3FPFA 2JK1A 3E05A 5HX7A 3RTGA 4MR9A 3L92A 3Q7SA 4R7ZA 5IS2A 1UAAA 1YH3A 1YRWA 3L82B 3V3TA 2XAAA 3F53A 3A7DA 5H5JA 4WJLA 4A1FA 2Y1GA 4ZEOA 3VR0A 3ST7A 1TCCA 1SQ0A 1U81A 3RFTA 1GTMA 4N65A 1WXGA 4QIHA 1UOPA 3AFMA 2ZXHA 5EXSA 2FUEA 2AEJA 3OE7A 1G7TA 4R1QA 3KCNA 2FSGA 5G4LA 2QORA 2KFZA 4FFLA 1KGSA 3MSXA 2QQ0A 3PUIA 2Z2YA 3QZ7A 2C1EA 2IEBA 4E5DA 3REQB 1IQRA 1RTKA 3QKRA 4L5CA 3NOQA 3AUJB 5DLGA 1W25A 1K7FB 4K6FA 3I32A 3A1DA 4N5DA 3CW9A 4CV0A 4XQ9A 5DASA 2CGEA 4ROTA 4QPZA 3EXHA 3M1IA 2FLLA 1W2GA 8ICYA 3RT7A 3EHDA 3AUAA 2AJQA 4CQMB 3ECCA 4P2HA 3M5PA 4R7TA 3RS9A 4NHOA 3F4BA 4I46A 2HIMA 5JMWA 4TV8F 2EX4A 1P1IA 3T5KA 1DBSA 3O1HB 4BNKA 621PA 2CNLA 4L95C 4XWWA 1E1KA 2ASVA 3F7OA 1N34B 3W2GA 1Q5PA 2VZ8A 4LX0A 1TF5A 4IL6U 3WB0A 2A0YA 3T1HB 4JVNA 2JCVA 4QYSA 7ICLA 3FYDA 3LWLA 2F43A 2PSHA 1KBOA 1RSZA 4LC9A 3V5NA 1FNCA 1O94C 3WADA 5DDMA 2E4AA 1P91A 4YXFA 2OY0A 1R15A 1IHYA 5ILOA 3DQZA 1NN5A 1Y7PA 2Y1LA 4TVKA 4GXNA 2IEAA 4EG8A 3H2ZA 2C4MA 1TA4A 3HKBB 1I33A 3B1FA 4KN8A 5EHGA 2WHPA 4ODIA 1T25A 2RGUA 4Y2PA 3FCYA 3UCEA 2HXGA 1I7LA 2F44A 2HOQA 3MFHA 3AO0B 5CG2A 2YRFA 3D2AA 3ITEA 4BFXA 3T5LA 4RLHA 1PT6A 3IUMA 4A8JB 2W58A 4RY8A 2UZIR 1B2RA 2QE6A 1NK6A 3UT5B 2YZ7A 3FOAA 4FHFA 3G17A 1ECGA 2VDWA 4KLSA 1OIVA 1YI8A 4QASA 1QIGA 3JPYA 1E3MA 4F4JA 3UY4A 4R2MA 2AGVA 3RODA 3N2EA 4D4JA 3NDPA 5BT8A 1EWRA 4XOUA 5F9LA 3L49A 3K8ZA 4PJ0U 2JFUA 2PFGA 1VTKA 1COWD 5IKMA 4CF3A 4C20A 4OFWA 1WKVA 3GF4A 2X58A 1U1GA 3OJOA 5DGHA 1I7QB 5DHUA 1JAXA 1KO7A 9ICHA 3ZDFA 2FN7A 1WWVA 2GZ1A 3T34A 4ZDKA 5H3LA 3GLHA 4JA0A 1DEOA 4BNFA 2JJ1A 4YREA 5KYGA 4G0NA 2KZZA 3HYTA 3T79A 1RABA 4N3GA 3L4PA 4KVGA 2EBFX 3GQVA 4EK9A 2WW8A 3MQ4A 4IH1A 1NULA 3W5UA 2D00A 3PICA 1H0SA 5M3BA 2IXAA 2CF6A 3ELYA 3WRXC 2OXCA 2WTMA 4QYTA 1JXOA 3VSBA 3N0TA 3ZWXA 3B6ZA 2GBIA 1KDYA 4EG7A 4DLXA 4TZTA 5AD1A 1XWLA 3D8HA 3VC7A 1NMQA 3L0BA 4OGLA 9ICUA 3W1EA 3V4RA 5BOSB 4MYSA 5HKBA 4E2FA 1CUZA 3BIXA 3OZTA 4C22A 3CU5A 1B23P 8ICCA 3I4LA 3PJEA 3D59A 2C8KA 3RT9A 2OLJA 3E48A 5KSYA 2JLVA 2BMEA 4DS4A 4E6PA 1T9DA 3WJ1A 4HFNA 4IFBA 1NKTA 4J16C 3C3JA 3H2JA 3M83A 3O47A 3V1UA 4QATA 1C0PA 2P9YA 4XD2A 1DRUA 3FYUA 3WYFA 2DFLA 1GQFA 2ZSEA 4WACA 3PQ6A 4WK0B 3T5JA 3NIBA 1N57A 2G0NA 1GL3A 1OTXA 3RNLA 4ARZA 4UZEA 3RTAA 1BPZA 1IB0A 3EVGA 1T0UA 2JLQA 3KT3A 4L4UA 3CPEA 3BF7A 2QLTA 1A4XA 1XEAA 5IVDA 2C97A 1ZD4A 2HRBA 2XY6A 2CNOA 4K6CA 4BECA 1PZXA 2HSJA 5KYUA 3TOXA 2GJ8A 1QLHA 3E70C 3PEWA 4NVRA 3LA8A 1UA0A 1TUBB 1TLFA 1WY7A 3G89A 2V1XA 2ZB3A 3CXUA 2IU0A 2UXCB 1I3LA 5FQNA 3RJKA 1ZN9A 2J9FB 3RUEA 4CMIA 3PE6A 3BK1A 3O2SB 3S99A 4IHAA 2IPXA 2I3AA 4MVJI 4TXMA 4P9NA 1SCUB 4HAIA 1GZ3A 1O6CA 2DPGA 1C50A 4LC0A 4RQNA 3EXG1 2HSZA 4N5NA 1K4MA 3TECE 4GYWA 2CVOA 3TAPA 1RJ9A 4YJGB 3FETA 1KR5A 3LH5A 4OP3A 1B15A 2K60A 2H5LA 1MQ8B 5TPWA 3EOBI 4FSDA 3X2SA 1N0VC 3JQBA 2ZANA 1KRHA 7ICEA 1Y80A 5DYWA 4QJ3A 5JS7A 2AQ4A 2DLDA 3A3KA 1T2CA 1NX9A 2W2XA 2ZWVA 2YINC 1Z2CA 5IWCA 3CZ4A 4OU4A 4RY9A 3GLKA 4PZUA 4JI7B 1RBMA 4UB1A 2JDIA 5LD2C 2E1RA 3FRIA 5AKYA 4M7PA 1XYYA 5DNVA 3L4BA 5F1YA 1QOZA 3SI7A 3ZHOA 1QLJA 3QPVA 4G5SA 2BKLA 4AB1A 1CQXA 2BEKA 2X0JA 3U9TA 3TQFA 2NGRA 1ZVMA 3LOPA 1QFYA 2CHEA 4LF5B 4ILKA 4RTPA 2V8BA 2IYAA 1GQRA 4BVLA 1V4BA 4DVGA 3IX7A 3ZGOA 4BGUA 1L5FA 1T8SA 3T99A 3CLUC 1WMEA 4EB8A 1XIVA 3U13A 2RB4A 3GGGA 4Z3DA 1RXYA 4AF7A 2AN3A 4ACBA 4OQZA 1NXWA 5K0JA 3LZDA 4ZREA 2IY7A 4JLNA 1E18A 3MTDA 5AXBA 1LDEA 4G8CA 2JBAB 4FEEA 4V03A 3KHHA 1KYVA 2I3BA 1SKAA 4MV5A 2ZTCA 3NIFB 1XD8A 1SQ5A 1FXSA 5TISU 4DLZA 1KE1A 1XWIA 3UGKA 5GZ3A 1ABBA 3NJ8A 4X63A 2GD2A 5LU8A 2ZG6A 3VZBA 1ONOA 2EL9A 4Z7QB 4P80A 2I2BA 1E3WB 5HFJA 1TTPB 2F3NA 2V4QA 3RFAA 2Q3MA 4BFSA 4BN4A 2FWMX 3O6VA 2H2GA 4FJ1A 3JWGA 2X2OA 3BRCA 1GTRA 1KZ1A 2O5EA 2CJYA 2HNKA 4JV5B 1ENYA 1SCQA 5JFGA 5AVXA 3FPHA 5DYGA 2XBLA 4MHSA 5CB1A 2C3PA 1ABEA 3MWJA 5CFRA 2HO4A 3PQCA 1UEIA 3ZK9A 1P5JA 3C6MA 4JD5A 3LCUA 4ZK6A 3ZWNA 2C96A 3SX0A 1C0KA 3OHPA 1YA8A 3NHMA 1JLHA 4AMYA 1RU3A 1WS6A 1E59A 3DVSX 3NT4A 1EA7A 2XUPA 1WZNA 3RUCA 1ORDA 2ES6A 2BEWA 1Y5IA 4QGFA 2PUGA 4OUDA 4WQMA 3EVDA 4J43A 4QOEA 1IHOA 1U3GA 1R27A 4DDMA 4L5IA 4PN7A 3N97B 2B35A 2ZR7A 9ICRA 4UAUA 1BQ4A 1FRZA 4EB6B 5I3ZA 2EZUA 3C3MA 5PGMA 4RK6A 2QROA 3N2IA 3N0XA 4BMDA 3RC8A 3TBKA 1U7WA 5J29A 3QEMA 1ODIA 4DREA 2ZR9A 3TDNA 3HGTA 2P3LA 4MR7B 1DINA 4EG6A 5KG1A 1M6WA 2YWEA 4BX8A 1RR6A 3NW9A 1M9NA 4C0XA 3TF5A 3EVZA 3K6SB 1OYVA 1COOA 1E60A 2ZIWB 1N9KA 1OVMA 1QH0A 5IDWA 1G2PA 3FDJA 4G97A 3GFFA 3GGSA 5DLYA 4EMBA 2YJNA 5ALOA 3AM5A 2X7HA 5KZMB 4YH1A 2WUEA 3NHWA 2BFFB 4Q4AB 2G0AA 3EGDB 3B2NA 5K0FA 4RULA 1U0HC 1JXLA 1JEEA 1K08A 3HDQA 2W2LD 1NKCA 3LY5A 3QBDA 1M2EA 1JHMA 2HUNA 3LHIA 4KXNA 2EZTA 4F4CA 4AX8A 1SM4A 1QMGA 1TYAE 1LZLA 4E13A 4Y2YA 5KT2A 3CUUA 4JKIA 4LZAA 3OIGA 1IWOA 2C57A 3FCOA 4GL4A 2NO6A 3TQQA 1DQRA 2HHJA 1M8KA 1MAAA 2Z3VA 3RASA 1LPAB 1I3KA 2NZUG 1DJOA 3SHWA 1M0TA 4JWMA 1QYCA 1S77D 2Z04A 1GHTA 1QP8A 2H08A 4YMNA 1TFUA 4MUEA 5BMVA 3IPRA 3K96A 1IZ9A 5HHIA 3BHIA 3OJEA 1PZNA 5GJCA 1GITA 2B4YA 1C8BA 4S1VA 1IONA 5J0QA 4TMZA 3G8CA 5IJ0A 3R0ZA 1QE5A 3FUTA 4KLZA 4IFTA 4OO1J 4LY0A 3QNWA 3PPVA 5JXWA 2ZJ1A 5HUHA 3QTLA 4HFRA 1JECA 5KSWB 4U7HA 1O3YA 3RB4A 3RAPR 3IALA 5JUMA 3P71T 4IQ8A 3RO7A 1U7UA 2GLEA 4KE9A 4W1QA 3JR3A 1MH1A 2RGAA 1UWVA 1P4RA 3AC0A 4WKOA 4G0ZA 3OG9A 1X77A 5CM8B 4UU7A 4WH0A 2QVYX 4REQB 1NG9A 3CF4G 2O0HA 4P84A 4TKUB 4CCWA 2UYGA 4LGCA 1O6GA 1Q22A 4CM8B 3IBYA 4BWVA 3QVXA 1X0XA 3OZUA 4NBTA 2X1MA 3A6HA 4D9FA 5AHOA 3LLUA 1L4KA 4X7PA 4RZRA 3UK2A 2OYCA 4P2BA 4UZSA 3M49A 4JSRA 4D4GA 5KAIU 1XHEA 3EFOA 4PHFA 1DZIA 2R6HA 4H35A 4O0MA 4MUAA 3DZGA 2DY1A 1FFSA 1OAKA 3TEJA 5FH9A 2JDID 3T4PA 3E9ZA 3WG9A 3UWKA 4HVLA 3B1KA 4FGSA 3ENKA 3DGFC 5LA6A 3ZTYA 1G4HA 1DS6A 1WZUA 4BNXA 2PFPA 1NLZA 4FX5A 2GN2A 5DNWA 3EYWA 3R3WA 3NTUA 5J0PA 3GFOA 4W6QA 3M6AA 4ZODA 2P69A 4JVMA 4I5GA 1BD4A 3VO2A 2W6ZA 1T6BY 2HEIA 1KMIY 1ZUNB 3U16A 1B0PA 1H2FA 4EYEA 5BVHB 5FWXA 2R5NA 3ESRA 1N61A 5HKAA 1DC3A 5AI8A 4CGZA 3EIFA 2YXPX 3DV0B 2PA0A 4P35A 4KGXA 3C3YA 2VJPA 3LUAA 2J1LA 1BDIA 2C7QA 3T5CA 2PD6A 4EH1A 1YFKA 1WSWA 2VPPA 1TYBE 2G5IB 1K63A 1THMA 2EFGA 16PKA 1W88B 2GRUA 2BKXA 1E6KA 5L6LB 1KZHA 4UBKA 3QBVA 2QG4A 3OT5A 3T3DA 1VE7A 3DDNA 1U9YA 3NOXA 2E5WA 2YV2A 2EW2A 4ALMA 1ZN7A 3A04A 4J49A 4ZVSA 1XPUA 2HADA 2HVIA 4MI3A 2VJMB 3CH5A 5KFBA 1N2JA 4E6EA 3U2QA 5EJGA 2GQ0A 1JMKC 1GLVA 3W4KA 3OQOA 3H8MA 4HDRA 3V8RA 1QSGA 3LCCA 4DA6A 3TTWA 1YQEA 4YBZA 1FDOA 4GOND 1CY6A 4E22A 2I87A 1ZKDA 1H2WA 4JCOA 2W8BA 1X8KA 5BW8A 3HPRA 4BLPA 3V8EA 4O2AB 2QTGA 5F3RA 3EOZA 3L0SA 4I50B 2AFRA 4N47A 1NJ8A 1EQ2A 1BPEA 3K09C 1RMQA 4P3YA 3L6BA 4G5XA 3RAEC 4RF2A 4YC7A 3JCZA 4K0RA 2Q2NA 2QU7A 1E4EB 3IT3A 3OZ7A 3H11B 5JJIA 2Q28A 3ONEA 2JHFA 2NXWA 4RS4A 3FTNA 4Q7QA 2OP1A 4L8YA 4IIYA 1IEVA 2P6UA 1MN6A 3FSGD 2NMVA 4DF4A 2GBLA 3UPQA 2ZBPA 2AC4A 2OYRA 3PF9A 1Y1QA 2AEMA 1FQWA 1J06A 5KNBA 3AETB 3EIEA 4F1WA 3EH2A 4KNYA 2D3TA 5EIWA 2CCGA 2I8AA 4YJ3A 1ID8A 2XLCA 3RJJA 3SNHA 2V9ZA 2XPCA 4DZZA 3HKEA 2Q4OA 1X9MA 2DG2A 4OQXA 1CUEA 2KJ5A 2H1LA 2FKAA 1IEWA 1WCYA 2RG7A 1XJ0A 1CRQA 2YVKA 4XCVA 1JKMA 4XWOA 4R40A 1PV1A 3BOSA 3CZRA 1C2TA 2PJZA 2O0MA 2X2PA 1G59A 3PW0A 221PA 5DULA 4RACA 3RYHA 1JKIA 2ZRAA 5EYPB 1Q15A 4UUMA 3PO4A 5M34A 1W35A 2PUDA 3TNLA 4DUGA 1Q7EA 2IXGA 1ISMA 2MR5A 5LBIA 5FF9A 4G0XA 4OBXA 4HYYA 2K5UA 4PYKA 1I14A 5JEEA 5FWYA 4L3OA 2SKEA 1NQWA 4LVSA 2OBLA 3DD1A 3KQVA 2ECKA 3TARA 3UATA 2QTHA 5KFFA 5C3MA 4M7WA 2RIRA 2UUOA 4WNAA 3AU8A 2EL7A 3KYCA 4MWOA 4WK6A 3M6LA 5I9MA 5C34B 1SV4A 1SVWA 1MAUA 5ICSA 1Q77A 3PQDA 5DDYA 4HMOA 4XYEA 2HC9A 3CNLA 4GVPA 1TJ5A 1LX7A 3JX9A 1R4AA 1EXNA 3LX6A 2UZ1A 3U5TA 3KYBA 4JLJA 3ISDA 3MRTA 1W5TA 1NKBA 4ZHQF 2O8EB 4N54A 3PWZA 1H2BA 4MPJA 1U63A 3LT0A 4EGCB 3V4LA 2FPKA 2B8TA 3KX2A 4AMBA 3A1EA 1Y4ZA 5AKXA 4XQ0A 2FSIA 3UJHA 4FWTA 1EWVA 3MD0A 2XNSA 1YHYA 4NE2A 4EYQA 1UFKA 1UOQA 3N4MB 5F76A 5JDCC 2GN0A 1Q1BA 4B9NA 2B2XA 3B6MA 4AS1A 3TJRA 4M9UA 4Y2JA 3WKDA 4FYPA 5EIXA 4ZC8A 4A5SA 3SG0A 2G82A 1UT5A 2YMLA 1QHHA 4DQDA 5IX8A 3PG5A 5A4JA 1FP7A 1ISPA 2IVFA 2XCAA 2CFSA 3RTDA 3WQRA 4OHXA 2YWXA 4LJSA 4QU9A 2OEPA 1T91A 4PV7A 5IKXA 1F38A 1TADA 4GI3A 2R68A 4GXTA 3V7WA 2W8LA 1EVYA 4IDNA 4X6LA 1KK3A 3O0FA 3LHSA 4EENA 1KO8A 4J4BA 5B1SA 4QXQA 2UVWA 1ZH2A 3U39A 1JTFA 3QOFA 2NUAA 4RMHA 5TQ2B 1MSWD 2W2KB 4PLTA 3OZGA 2PEZA 4CKBB 3OEYA 4IJUA 1W8DA 2ZT7A 4RM3A 3PMLA 1QGOA 1KY5A 4KTVE 4FYHA 3GJ0A 3AKYA 1CQJA 1O54A 1NPTO 2QK4A 2BFEB 721PA 5JQGB 2G6TA 1SL0A 1OBHA 4KLNA 4XIGS 4BL5A 1YONA 4WASA 2A3RA 3MXOA 2CVFA 3S7ZA 3ORHA 1FP1D 3IAS6 2ZSAA 4ED7A 4C4OA 1SC6A 1FCJA 4CKWB 1W1UA 5EXEA 1W85B 3EH1A 3WFIA 2F3RA 5IM4F 3C16C 4M1KA 5KYVA 2BDEA 2FRXA 5I7VA 5CW2A 1YDWA 2P2GA 2A3NA 5HUQA 5CEFA 2GOLA 2AW3A 5FA5A 2JGJA 1RP7A 3ANXA 2VP2A 3WYAA 1H5UA 3VH1A 3C7CB 3DEYX 3KR0A 4QDXA 3AZPA 4PVCA 3F97A 3UAGA 1XP5A 4Y2QA 4P4SA 2WVGA 3B9RA 1J39A 1Y6FA 1MJFA 5DHAA 1UQUA 2ZYSA 1T1IA 2QLFA 4REOA 5F2OA 1J2RA 1H1LA 4GUAA 4ZAVA 2RJNA 3KDAA 3GP3A 1AHNA 3N86A 3SLGA 3VYUB 1JHQA 2R87A 3DFKA 2HDWA 1QIHA 5GMOA 2FUKA 4E14A 1NMXA 4RLQA 3STTA 3WZLA 3HY6A 2F9LA 5EIFA 1Z08A 2KMDA 3QWFA 4QE3A 1D9FA 4UREA 3RFXA 3ZVLA 4ZRDA 2EKPA 2PEYA 1FTYA 4CLRA 1Q17A 3HXQA 1LJ8A 4ND8A 4KQMA 1PBTA 1YR7A 2XHZA 1YGYA 4Q9NA 1UPFA 5LP6B 2CV1A 3AP3A 3NC0C 2UVPB 4B3BA 4MA4A 1SHLA 5K6TA 3P0IA 4IDGA 2ZP1A 3LLCA 1DADA 4ZJZA 2YFKA 1TMKA 3R9XA 5LQJA 4UPEA 1QO0D 1FPQA 3RUHA 2GVNA 2R8OA 2E4ZA 1D5CA 4WI1A 1WCLA 1JQLB 1N3BA 3UUGA 2N42A 1OILA 1HF3A 3EZ9A 1WEHA 4UTRA 2CBZA 1RXIA 5ELLA 4BO0A 2GETA 4TTPA 4WEQA 5DBGA 4JKYA 2NVUB 4HH3C 5EKXA 5FOSA 2OHOA 1N2OA 3FNEA 4HGOA 1IN7A 4CM1A 4Q1DA 3V55A 3D8NA 2E21A 3MNFA 1E9RA 4LQ4A 2W7TA 3ABSB 4YLGA 1XZMA 3E8XA 3E2MA 2HYIC 4Y6SA 4LOAA 2FGKA 3KSRA 2ZULA 1N6PA 5EKSA 4JSTA 2CYBA 2G09A 1V5FA 3I9V1 2LVBA 4CU5A 3SX2A 4X1KB 3VR2D 3R75A 2YFQA 2KLHA 1CZKA 4FZJA 1NUAA 3WYBA 4Z1MA 3O8BA 2QZSA 1C1HA 4G09A 1DSSG 4L6AA 3RIEA 3M81A 3SAGA 3LY8A 4NQZA 2OPHA 4AKIA 4GQAA 2HMAA 4DNOA 1AM4D 3KTDA 1GCIA 4CHGA 3PYMA 4HVTA 1Y6JA 5KTOA 1TO6A 2GCGA 3IIMA 4WXRA 2DXIA 2QTVA 2QN1A 4QBGB 2DETA 3T9EA 4D4IA 5DJ5A 3SKXA 1UMKA 4CFZA 3EZFA 5IU6A 4V1CA 2FPMA 1VCNA 4L5AA 2DJ5A 1R8JA 3ZCTA 3BJYA 3WKAA 1FSZA 2IWRA 2KW5A 5AK3A 2GRAA 2JXJA 3V1YA 3TZ6A 3VZCA 5AW9A 3ZIAD 4LNUA 2HJVA 1D5WA 4IVPA 4COKA 4E2ZA 1AK1A 3GLIA 3GI1A 4IXNA 4EGQA 2XNCA 4M1OA 4EKIA 3U4QB 1X8JA 3D3JA 4MGKR 5INTA 2YUIA 1VLHA 1VMIA 4ZARA 3IEUA 1FU7A 1R0XA 2FOLA 4HHEA 4FWIB 3AEXA 3HVJA 4MAAA 1SHZA 4KGZA 5LZ7A 1YL7A 5HIJA 4JHXA 3PR1A 1E64A 3DVQX 2HI0A 4LDNA 2GM4A 1BS9A 2R62A 4PXAA 1IOVA 1NM5A 2AF4C 4O4HB 4US8A 2R8HA 2XZOA 4HWGA 3UQ0A 3VNRA 3PUWA 4EEXA 4JS0A 3JQPA 3BDIA 4ICAA 3H4IA 1M10A 1U94A 5BXYA 1AS3A 4KPEC 1L4HA 2DPJA 4MCIA 4AP6A 3GP8A 4EQ6B 4D80A 5LZ2A 1H4TA 4PGQA 4MW0A 3K7EA 1RRGA 2WF5A 1YUMA 1FX1A 5KX5F 4BPBA 3FSJX 1SD1A 3HYNA 2BMDA 3WMRA 1RYRA 2OCBA 1Y9EA 4DLTA 2K4EA 3JPWA 4HGRA 2YR0A 4YIHA 2W5UA 1SB8A 5FPKA 3KJEA 1NW5A 4OQPA 2XT6A 1TMGE 3DTVD 3UMCA 3AF0A 1HIWA 1NIPA 2OENG 2CD9A 3FPGA 1IY8A 2XR1A 1WD7A 3HX0A 4J91A 2XVMA 1ND5A 5BNWA 2I54A 4DL6A 1UINA 1G1AA 3X1KA 2P62A 2HHTA 3SHQA 2OKCA 2YWRA 4G84A 5IH7A 1BMDA 2G07A 3WLHA 4F8JA 3ROQA 5JVDB 2ANCA 3QNUA 5CGQB 4GBGA 1XZ8A 2HJSA 1H8HD 3WGHA 1D4OA 3C23A 1K3UB 3X2EA 4CLDA 1XL0A 3EW9A 2WF9A 2QP9X 5CVDA 4NZNA 5J2JA 1FYWA 4P86A 2JHGA 1E7SA 2VOJA 5LIPA 1WE2A 1OB2A 3D4LA 5AHRA 4P3NA 1U8TA 4QYWA 5T4BA 3K0AA 3LT1A 5BMVF 1JEOA 1ZQDA 1WSBA 1A2BA 1QB7A 3WGYA 3X3HA 2EKLA 3C3PA 9ICVA 3OIWA 4DW8A 1N5JA 3RGWS 4FHDA 4CMAA 5G4KA 1HMYA 2QRHA 1ZLYA 4UBNA 2ZS9A 5FTJA 5G3YA 1UWKA 5DXJA 1JXAA 4ZQIA 4MVJD 4NE7A 4IYJA 3ESQA 1JDBB 2JATA 1WOYA 3H2SA 3A2LA 1D2AA 4YACA 2R9VA 1SRQA 4DB4A 3PEUA 1Z36A 2A8YA 1GAEO 4L15A 5A4AA 1QZ3A 1DAGA 5ESRA 4U2FA 3TD2A 4I4TF 5KKNB 3S1AA 3DYIA 5J2FA 4FCVA 2PH1A 1OGYA 1P9RA 5ECGC 2FMKA 3B60A 2I62A 1WQ4A 1JHDA 3DEAA 5EHQA 2A35A 1DELA 3G9XA 3O8QA 2WF8A 3WRYC 4O5EA 1U9IA 1YIOA 4JVOA 5ESDA 2J0EA 1KWKA 1L5MA 3HXKA 3BQMB 4LXTA 3ZZMA 8ICZA 4KO3S 3EZ6A 2H31A 3D3KA 2GESA 1CERA 3FPLA 8ICVA 5ERXA 2GKSA 5FOUA 2BH2A 3OT1A 1IJFA 3B3QA 3BRWD 4Z4IA 3E82A 5HZHA 1H9AA 2QD1A 4U8GA 3EXG2 4Q1CA 5KIAA 3I9MA 3AR3A 4ZMBA 5CT5A 3PJDA 2KK0A 3USES 4BKMA 1ZWKA 3FOFC 2YWJA 2PGOA 3IB3A 2EAUA 4P32A 4QZBA 1I7DA 4BNGA 3C3AA 3NG1A 1XO0A 2VTKA 3TO5A 1NYLA 2G0TA 3PBKA 4N5MA 1X6IA 4RM2A 4L4XA 3GVHA 3L02A 3W9BA 4UM8B 4ZH4A 1OPRA 1QHFA 4Q3KA 4U3JA 5L3RA 1J9EA 1LNQA 5JHHB 1V4NA 2F00A 5FV4A 3PDJA 1I4WA 2AXPA 1AUPA 5T41A 3QHAA 1ZOSA 2BBOA 3IILA 4B6OA 2UVUA 3HL0A 3KQTA 1D2GA 1GCUA 2P5YA 3ME5A 4AURA 2B0JA 3P9XA 4BFZA 2OGZA 1DC4A 5KG4A 3HN2A 2GCOA 4RK1A 3ND9A 3GV7B 2Y1DA 3ESXA 3MRSA 2W90A 1FFCA 2ZIUA 3FPAA 5E9JA 3BA1A 4DA8A 1EVLA 2H63A 1OJ7A 2OZKA 3DHEA 4QYXA 1BPYA 4WW0A 2V3WA 4JJAA 3MB5A 2WG2A 2A0WA 2CMDA 2YTUA 3RAFC 3M9OB 3GIMA 3MPUA 5ALHA 1VHLA 1V41E 2PUEA 2FH5B 1BMTA 1V35A 4GYKA 4TUYF 3PCRB 3EDMA 3SIWA 1GAQA 3QI2A 4XM0A 4KFTA 3W1WA 1UJNA 2UYYA 5HHTA 4NCXA 2EZYA 1SBQA 5CT9A 1SKBA 2R6DA 1KWGA 1O0BA 1AMNA 1EJ0A 4M0LA 1G4UR 2BHTA 4ASUA 4QUHA 3SC2A 3LUBA 3AMZA 5I4CA 1NRWA 2PYIA 3M1YA 1P2BA 2XXAB 1UPBA 3LUHA 2ARKA 1CY0A 4FDLA 5A1JA 2JFGA 4ZZ3A 1JGTA 3VMFA 3R8CA 2D2VA 4EY3A 1NRJB 3GL9A 3SQXA 1JSCA 5EJAA 5BUCA 2WD9A 1RHKA 3H5RA 4WVFA 2QTZA 4UUBA 1F2TA 4D98A 1ZJMA 3QRWA 3I0ZA 5A4FS 4DSIA 2XX3A 3LT4A 3AFHA 1TVEA 4TT3D 1Y9ZA 3D8TA 3WL3A 4XE5A 2X4LA 4BVGA 4IIEA 3T54A 3BWDD 1ZJWA 1L4NA 4QGAA 3M8SA 1U6JA 3JD0A 3NO4A 2PX2A 4CMGA 1QQAA 4I6EA 2TECE 2H16A 1JDPA 5CAEA 3TG2A 1FU8A 1LK5A 4R69A 4G1UC 1EFUA 4I6JA 1P8AA 1GPAA 2FV8A 5K3OA 1M1YE 4KLFA 2WJWA 2YJ4A 2VHYA 4AW9A 3O2QB 3DCNA 4HZUB 2VKTA 4QICA 5MDHA 2D2IA 4M9RA 1EUDA 3T9DA 1NBMD 4YQFA 4M54A 3W7VA 2JHPA 1GDHA 1DAIA 4EHBA 3BPSA 3C3EA 3F8SA 1TZBA 3V7YA 3S3TA 2VPXA 5KMGB 4AZ3B 2WJJA 3CONA 3TM5A 2YYSA 4M1YA 3L8CA 2PR2A 4ATNA 2CMKA 3Q3EA 2YXBA 4IS7A 3D02A 1QH8B 1EWTA 3PGMA 2ACWA 9ICOA 3CKKA 3WRWA 5I01A 4JLUA 3QF4B 4U9HS 2ADMA 2LYAA 1KI7A 2D6FC 4KMMA 4M0CA 9ICCA 5ER6A 1ZAYA 5K8UA 1ZISA 2VJDA 4LYEA 1CEYA 3KSAC 2PDAA 2KJQA 3GGJA 5A7GA 5CFOA 3V7LA 2PWAA 1T9ZA 5BN5B 3RAXA 1JDTA 3CH7A 2WP8J 3U7IA 2GAOA 1Z5ZA 3FHCB 1L4BA 2QX6A 2C4TA 5FL3A 3GFTA 3VHLB 1ADGA 4L6IA 1A96A 2COEA 3BMOB 1Y7TA 1TOAA 2NUBA 2WKSA 3DDUA 4N40A 2WJHA 3CZMA 4ZQBA 2O3RA 1NVXQ 2IF0A 3I28A 2C2YA 4XEUA 2FQQA 3HU5A 4B84A 3R20A 4IWYA 4FINA 1QTQA 1Y9JA 4TWRA 1F7UA 5BWOA 2YW9A 1VCOA 1P5HA 3GELA 3S0JA 3PC8A 2PT7A 4B8WA 1D4FA 4G1BA 1XNQB 4IDHA 4X00A 5CDFA 4UAWA 5CCDA 2O20A 4F7DA 1YVDA 2WHQA 2PI5A 4MGZR 4LECA 3C28A 1LI7A 2NO9A 3LG2A 5CIQA 2SCUB 3E9QA 5E0OA 4IDFA 4DRXA 1Y1TA 4P98A 3ZJUA 4H6VA 4OJPA 3NDJA 5F12A 5BYKA 2EEPA 3FH0A 4KLUA 4HLQB 2L5YA 1DRJA 1G3RA 2IEGA 4G63A 4ZHQA 8ICIA 3KDSE 3ESDA 1YB4A 4V38A 4IXWA 1QG6A 1W5BA 4JXXA 3VVLA 3EPPA 3HVUA 2I65A 1DARA 4GX5A 1EHCA 1Z19A 2ZSKA 1ZUWA 4GGPA 3Q8WA 1UBTS 2O3QA 4DQRA 1IIBA 4KAJA 1QGED 4OSPA 5I45A 2FPIB 4GOMD 2A9OA 5C4GB 4W99A 1IY1A 2P2YA 3COPA 5K6AC 1J23A 4MVJM 2QT0A 1NKVA 4H60A 1SIOA 5H4GA 2HEGA 1TJ3A 4A0QA 4OJTA 2QR3A 4DIBA 2LKDA 5FULA 3H13A 5HGJA 4YDHB 2Q5CA 3F3SA 3LPCA 1GG9A 4U5QA 1NW3A 3HJAA 1U2DC 1MGOA 4R3UC 2R8BA 2YFHA 1X80A 3SQWA 2VSOA 2VUIB 4LJLA 5AKHA 1RIIA 2X19A 2ALZA 1I8TA 3ZYZA 3GZNB 4DQXA 1P4SA 3NUGA 2GGSA 1Q91A 1DAMA 2V03A 3BE8A 3EVNA 3DZJA 5A4MS 1K75A 3M7DA 1XD9A 4NLZA 2G72A 4QDZA 3WZMA 4D43A 1S1CA 3PEVA 3S2YA 2AMFA 1JXMA 5A05A 1JBEA 2O2ZA 3RWBA 4K9DA 3VHRA 3OTHA 2NVBA 1UPCA 1MIOB 3M82A 1P1RA 1RXEA 4HK4A 1RYDA 1PJ4A 1TD9A 1QF6A 5IM4A 1J2MA 4EJ0A 3CE9A 5JXIA 4KFUA 1XPJA 2V7UA 1CVLA 4TM7A 3RHZA 4QARA 1K89A 5IILA 4JX9A 2O07A 2AG8A 3L4KA 1EP9A 4PX9A 2V1UA 2HD4A 3EIUA 3F5MA 4FFNA 4G9GA 4HQ6A 3V2HA 4E1BA 4EG3A 1R0CA 4M9SA 5JH7B 4OGGA 4KRFA 4NL4H 1EFRD 1AGNA 3BIOA 3AVQA 2EDAA 2RGGA 2C2GA 2V6JA 2RHWA 1P81A 2VYNA 4N7BA 3K70B 1VL8A 3J80A 1BGXT 2V9PA 1WXHA 4GF5A 1X1TA 4IIXA 5JNTA 1TCUA 5BWBA 3H75A 2D2FA 3LQ4A 4LXXA 1BXGB 4EO4A 4FXPA 2CXRA 2QI9C 3KXDA 2KIWA 4BNLA 2MSWA 2KZ3A 2DU8A 1Y7LA 4DLKA 1XXHE 4PLHA 2QZ9A 3AHIA 1WCNA 3EIXA 3UO8B 3GUYA 3HWX1 2JVIA 1KSFX 4MKXA 2ET6A 1I6LA 2DKXA 1EGMB 4IV8A 1RLOA 3K1AA 4Z8YA 1M1YB 3F98A 3LVFO 2VP0A 1KP9A 4TSFA 4YHHB 3OHBA 1JLLB 4UOQA 1T35A 1LSOA 1XLVA 3PDIA 4HQKA 4DLLA 3B3JA 4Q1FA 4DEYA 3T61A 2MRLA 4KPUB 5AVVA 5FJJA 3D9QX 1YE8A 2L0XA 3P52A 1IQ0A 4NFLA 2QLMA 1FSPA 4E4YA 3G0DA 2FWBA 1GRCA 3PUHA 3PV0A 2OCIA 4AECA 3ZDDA 1WL8A 1SXJE 3K53A 3OQPA 1IH8A 5ELXA 1RFLA 2H3ZA 1A8PA 5J0UA 3ZWOA 1ZUHA 4IRCA 2QL5A 4F71A 5TSDA 4NJEB 2C07A 2EU8A 1V37A 2P2SA 1KAEA 3L5KA 3OE7D 4BEBA 1V5WA 4OL9A 5D1NA 4DV3B 3DAHA 3CW2A 1FYFA 5D3KA 1RPAA 4RQ1A 2Z7JA 1OASA 2P6RA 4UKDA 4P4PA 1FPMA 4LF7B 2C4VA 3QUSA 4KZKA 4B6PA 4Y6GB 3B1WA 1UCVA 4ZQEA 4HSEA 3WI7A 1ZZEA 3M4ZA 3D2BA 1V45E 4WFJA 4G5QA 2KTQA 4EOGA 2ZJ8A 4BX9A 3AESB 4IGAA 4F4HA 1TIPA 3L8MA 4FB5A 2MAXA 1M7BA 3NV9A 5DNAA 1DQYA 5HKKA 5FPHA 3GLQA 1M8JA 3TADA 4MWSA 1CJCA 4HYEA 2XKBA 1MGPA 4AZWA 3O93A 1VKNA 4US2R 2I1VB 2VAXA 3IUEA 1H4SA 4X3OA 1NJXA 1XVTA 1T8UA 2PYZA 1T1GA 5TDHA 2WC1A 1DEXA 2BGTA 2QR5A 1ACLA 1LJUA 2HXYA 1E1RA 3V8BA 2AS0A 3BCSA 5FR2A 4U7DA 1TUEA 1UFVA 1H65A 3TQRA 2FWIA 5H8WA 3SR0A 4O2BB 2C4NA 4IHKA 4F5WA 1T9BA 3INNA 3VU1A 5L45A 4O9MA 1ZQ1C 3MTGA 5TY0A 2Y4OA 3V33A 2QTRA 4NF2A 2PQ0A 2R5FA 4DM7A 2ZVPX 1JIUA 4R66A 5IIMA 4YCNA 5FFNA 2A5YB 4LQCA 2J4CA 3AEYA 3D3NA 3NMUF 4QQFA 4V0OA 2ORVA 2B7BA 5JASA 2RCNA 3C1UA 1NT4A 3MC1A 1YVPA 3QSYA 4C1NA 2QY6A 2IZ5A 1AA6A 3TUZC 5AM0A 1T36B 2VA3A 3D5TA 5EWEA 3LT2A 1D0SA 1XD2B 1USVA 3AVWA 1M72A 1F51E 3FHOA 4GI1A 4MYCA 1Y8QB 2VWQA 1KJNA 2BBWA 1X8XA 3IP5A 3E84A 1VL1A 2PMEA 1R0ZA 2KPOA 3KXLA 1WDMA 3LDHA 2JIOA 3HN6A 3B0YA 2ODTX 3ET4A 1TCVA 4GGMX 2JEYA 1O9GA 2GPYA 3TKYA 3P20A 4BP9A 3DHYA 1WY5A 1XWFA 6PFKA 1UZUA 4MF2A 1NLFA 3BMNA 5EMLA 4AY5A 2QRVB 2FPXA 2I1QA 5GADl 5F9FA 2FSVC 1QBGA 1SKMA 2I6UA 8ICFA 1W5AA 4PAGA 3N7SC 4AMGA 3QXXA 5BQXA 4J1NA 2BTQB 4KI7A 2IHKA 2ATIA 4WEOA 5KX5A 4I1OA 5A9SB 2KNJA 4DM4A 4O3QA 1EX6A 4NENB 4J76A 4ZT3A 2E8PA 1ZQHA 1C1YA 1ODFA 1E5XA 4DL4A 2JJ1D 5E6UB 5ADUS 1X6VA 4FGUA 5B57C 4MQFB 3AWDA 3CYFA 1QTNA 5DSZA 5IT4A 3JD3A 1LS1A 1VBNA 2PMZC 3EPKA 5DNEA 4D46A 4F04A 2BYTA 4KV7A 1IUPA 4DSLA 1ZIXA 4PZPA 1DHTA 4HAUA 2FR0A 1SKSA 5MN4A 2IRWA 3E23A 1N6KA 3OU6A 3NS1A 3TINA 4RD3A 2VF4X 1G6KA 4DJ5X 1MRSA 1VCHA 1KEPA 1R6BX 2A33A 1KLNA 1B1AA 4QSHA 2IQIA 1YJ5A 2GJKA 4LDJA 3BGDA 4KBYA 2QARA 2W37A 1I80A 3U7QA 3SYLA 4XVUA 4FZMA 2WHXA 1QP0A 4YJFA 2OVFA 2YJ5A 4QJFB 1NP3A 4NABA 3V1TC 4J03A 5JD3A 4BV9A 2C2EA 1S2IA 1AF4A 1VSQA 2P90A 5KFJA 3OFJA 3H3JA 3E9NA 4F7WA 4ED3A 1DAEA 3G13A 2XE6A 3HB5X 4YVFA 2QLNA 1EVQA 2FEWB 1PEKE 2ZAYA 1C7YA 1YR1A 4UBOA 3H4TA 4QW9A 1FP2A 1X9XA 5FQOA 2O0KA 5CA1F 3DKRA 3FGOA 5KQLA 4XB1A 2F77X 1LBQA 5EMKA 1VA5A 3C7TA 1EEXB 2JGMA 4B2LA 3OLXA 1FMCA 5CB4B 3U3OA 1XG5A 1KAOA 1RAGA 2IA6A 4KWCA 1BCRB 2J3QA 4DF8A 5AOAA 1T2DA 3R3SA 1JG2A 1H85A 3OMLA 2VJKA 2QMHA 4LPKA 4GQIA 4OLBA 5BN4B 3ZWKA 2BFWA 4I4TA 4YQZA 4F4FA 3I45A 1XXHB 3TIGA 3DZDA 3NETA 3COJA 5D1HA 4Z0TA 2Q6VA 2P4SA 1J21A 1EBBA 2CHFA 2P68A 5EINA 3KZIU 3UMBA 2ZYAA 4B3RB 1IZ0A 4ZCQA 2A9RA 2GAAA 3H0KA 4PXSA 2R1VA 1OI3A 3RS4A 2Q3HA 3GIIA 3KO8A 1GGHA 2K6GA 4EGFA 4F4YA 1XMPA 4QOIA 5K4HA 5LQSA 3U7RA 4MQBA 1QDLB 3WBFA 3IMKA 4HRAA 3RQIA 3MRVA 4XQGA 1RPLA 1Y8RB 3UB4A 2Q41A 1Y9DA 2PAFA 4MFAA 4RQMA 1SXJB 4DRZA 4D7AA 4ZWNA 4S1NA 1ZQMA 1WF3A 1EE2A 3BMQB 1RLMA 2AJDA 1JEYA 3SQMA 2EZ9A 2GPWA 1F1JA 1Z3EB 4PTYA 4X8OA 1EXMA 3UFBA 1LK7A 4FDTA 1F60A 4PHGA 4KR9A 3TANA 1MDBA 1Z3IX 4HZGA 1ICEA 1IK4A 5EWLB 5BQ5A 4KLEA 1Q6ZA 2QBYB 1UBFA 4UXJA 5HFNA 4PL1A 3DZKA 4QELA 5ENZA 1NN1A 1LJLA 1M5UA 1ZOIA 3CF2A 4KO2S 2VO1A 1PJRA 1W36B 1TE2A 1NBAA 4EF5A 2NUPB 2FPPB 1KBZA 1M2FA 3F2CA 5IBPA 4BDPA 1IUKA 4WV3A 5E0KB 1XNGA 1YZQA 4ELVA 4DLYA 2E4UA 1M83A 1KO1A 2C8JA 4MWCA 3AV0B 1US8A 2E0IA 4J0QA 3V2IA 1NOJA 2N9UA 1GP2A 4I19A 1L7BA 4OM7A 1A88A 3BD7A 3VYTB 1QCZA 2I22A 3CURA 3NEYA 3HCCA 2Q0XA 3M3DA 3SD7A 4L16A 5JCOC 1QVAA 5KFGA 1EP1B 3PJRA 4RL6A 5BSUA 1UBHS 1IU9A 1RWPA 4BO2A 2AQIA 3TQTA 1E1LA 4AWXA 2F2AB 3GN1A 1MQ2A 1DUVG 2P77A 1FRFS 4E03A 5DF1A 5G0VA 1J20A 3ZWYA 4TUYA 4EW2A 4G3IA 1PNOA 1VDVA 4ED6A 1SOMA 4WBXC 2ODWA 2VH5R 3PC7A 3W5SA 3N76A 3LBAA 4DCUA 5HA5A 3CF0A 3FC4A 4MS1A 3B5EA 4OH7A 3NKVA 4L9SA 5JY1A 3KVRA 1Q1EA 3W79A 2ZBUA 1U0RA 3UN1A 3W7AA 1MNAA 3B7GA 1Y0BA 3QU5A 5BSHA 5JYDA 3A1CA 2RHOA 2ENWA 3LFTA 4URUR 4JODA 1GTSA 3EPGA 2B94A 1ADCA 2Q3CA 2R7NA 5FBRB 5JAHA 3K4QA 4DJAA 2X7JA 5DGXA 3UPUA 2M6SA 1A7JA 1I2CA 3D4IA 1PV4A 2HHLA 2WI8A 1W0CA 4AJHA 5J58A 4AF8A 1AURA 4IDCA 4AO8A 4ZGWA 4G0YA 2CLFB 3E7PA 4B17A 2QMEA 1PFWA 3L18A 4CCHA 1JSLA 1FF9A 8ICXA 1YULA 1N5IA 4KQWA 3KDPA 2QL6A 1NONA 3RC7A 1WQ1R 4MV4A 5LQDA 3SN6A 1BDMA 1QJCA 2YKGA 1QZZA 1YXMA 3TTSA 4JBIA 3BE5A 3T6KA 5CTJA 4GYYA 4J9UE 1QLNA 1I0IA 3C1TA 2VQSA 2J5BA 4I4CA 2QEQA 5JJCA 2AC7A 4FWBA 3R76A 3UGTA 3EZ5A 4Z7OB 1JAYA 1YZVA 4GX0A 3MBYA 2YMPA 3B7WA 2IPLA 2R4QA 4BCCA 3RBEA 1JSRA 2HU5A 1LW7A 2HRRA 1Z16A 3CX7A 3NVDA 4U7CA 1OI7A 4CZ2A 1HWYA 4R8VA 1LBIA 1VMAA 2G28A 4NFSA 3HC7A 2M1XA 3KOZA 1M2NA 2VF5X 4RA6A 1HQKA 1UM9B 4KO1S 1G9XA 4Z86A 1ZJYA 4ZT6A 1ZUIA 1UEJA 2NXEA 2AZXA 4XJXA 3NWJA 3CLSD 4F12A 3F47A 5EEHA 3I5YA 5CDHA 1KQ3A 4UHBA 2HJ9A 1VGQA 3A4MA 3ZHQA 2R6FA 1BKSB 2NP6A 4RCZA 3HEBA 4PBSA 3BMCB 3IVCA 1B42A 1N2CA 3L0IB 1T4GA 4D0RA 4JHLA 1U5BB 1F0YA 3Q87B 4OJLA 2RKOA 2OECA 1RAHA 4MINA 4M0DA 2VQFB 4Z8XA 2AEFA 1U0LA 4BQPA 4ZA2A 2FUG6 4PYNA 2MTBA 1M1NA 3OM0A 4MRMA 2DBZA 3SF8A 1S5LU 3GBVA 1PJAA 5KI6A 4HI0E 1UMDB 4MGHA 3PI7A 4LYDA 4HRVA 2ACKA 3ER9A 3SC6A 4D3YA 3Q9NA 2EBWA 4K81B 4F3OA 5G02A 1D09A 3GD5A 4YB8A 4GL2A 3MMZA 1KDRA 1DQNA 1FUYB 4FHCA 8ICJA 4GMXA 2R8IA 4WCFA 3E18A 1HNZB 2Z2KA 3N2YA 5FCDA 1BC5A 3WP1B 1GV1A 2ZROA 1KDTA 3TNDA 3WBKA 4MUBA 1PD1A 1BG6A 1W4AA 3FR7A 1V3TA 1XA3A 1J2YA 3H2IA 1T1JA 4MDFA 2WM8A 1RQXA 1Z8FA 4O4JB 2CMHA 4RV5A 1WPGA 2WUFA 1GADO 2JLZA 1MF7A 2ZIZA 1NGSA 1XZLA 4F5DA 2CSUA 5JYEA 5IFKA 2Q6KA 4HBGA 1SAYA 2P9CA 4HX2A 4HB2A 1Q1NA 2WT9A 2YJ6A 3BFVA 1J6UA 4ED1A 3R41A 4MCHA 2OMEA 1AZTA 2HMTA 1E3QA 2HHWA 1NUPA 2PRIA 2BONA 4CQJA 5F2KA 4C7JA 3IEKA 4NFYA 3WL6A 3CUTA 1LRKA 1UXKA 4UHKA 3PFCA 4K0KB 1QO9A 3LUGA 1NW9B 3A58B 2RHBA 1PLJA 2C4UA 4RQ0A 4Q82A 1HA3A 3HYLA 1SCBA 1XQ9A 3QE2A 3PPIA 3Q3GE 4B6FA 4NKRA 2ZUFA 4LDQA 3NNSA 1E99A 4G5HA 3EF3A 2VPYA 3LXUX 1FZTA 2BI4A 1XQ6A 3FFBA 2JKZA 1OCEA 2J31A 2C3UA 1QVVA 4PYMA 2WT8A 4BNWA 9ATCA 4DIMA 2IY8A 1DNPA 1H42A 4KXLA 2PZEA 3TNYA 2KICA 1EK0A 5F73A 2I2WA 1HDOA 4XWYA 2AOWA 2VHCA 3IEVA 1X7ZB 2FG7C 4RKFA 2X6TA 4C76A 3HWWA 3H40A 4DQSA 1HY3A 1IRIA 4K9NA 5DPMA 3PR2B 4BAGA 1C7FA 3PQ7A 5ITZA 3BK2A 1YVEI 2Z5VA 1SWVA 3TM4A 1ZO8A 3MN1A 1LW6E 4ZTBA 3CR8A 1N4AA 3RU3A 1KPHA 1T43A 4JFAA 3AHJA 4M9NA 1BJKA 2PQ2A 2YX8A 1CEQA 1X2BA 3F7NA 3GRKA 4EZBA 3RBXA 3NAQA 3PFNA 4P4NA 3OQNA 3A31A 2DPLA 1I1QB 1Z00B 1YE5A 2C84A 1H66A 4M3NA 7ICVA 4Q4HB 4Q9HA 1SC4A 1F12A 4WOCA 5J2BA 1ZI8A 1A71A 1PTJA 1UFQA 1T1EA 2AGPA 3T9FA 4JK1A 7ICIA 1WCIA 1YQUA 3KJXA 1MZVA 4RTNA 5DBHX 5HQTA 1KFTA 5KNBD 5DBAA 1EUQA 1Z4PX 1E4OA 4MA5A 5AIBA 2XRMA 4KW7A 3G85A 4I5DA 1O2DA 3H5AA 3T4EA 3ZGXA 1IFXA 3TLGA 1YBFA 2O8BA 1ED1A 2VTBB 1X15A 3WJ2A 1YRLA 1POWA 3GUZA 1U99A 3FPKA 4PYIA 3TLBA 3ITKA 3CLHA 4KR2A 3KLNA 1ZVJA 4F86A 3P0RA 4QTTB 3MWLA 3MDCA 2HHXA 3N8IA 2ZCVA 1LDMA 2A59A 3WOVA 2R47A 2DFKB 3WLKX 2JD1A 3D7KA 2W55A 3THVA 4ZI5A 3AINA 3NHLA 4RXTA 2DKNA 2H5JA 2YY7A 4DUGD 2GO1A 5JNVA 1Y4SA 4K9SA 1CUYA 4K6GA 4B2YA 3T3NA 1ZD2P 5DRTA 3EYAA 3RVMA 1KA9H 5FI1B 1KFJB 3RVPA 4H0NA 4QTXA 4N3CA 3KB2A 2P1DA 1LLFA 1MO3A 4JDPA 3L6CA 2PS0A 1U5AA 3U6BA 2Q07A 1DJPA 4NCJA 2LYBA 3GU3A 4H15A 3AEQB 3ZR4B 4UBLA 2PRJA 2B2CA 5TEVA 5DIFA 4AWAA 2Q4RA 4F3TA 4LPSA 2EH9A 1ZQBA 2GI4A 3L1JA 3MRXA 2WNHA 1MAVA 5TVKA 1K98A 4LRYA 5B3LA 3GX1A 1YQWA 2VHEA 3DMGA 2NYUA 2OAQ1 1WNFA 4QDKA 4NLLA 5AUQA 1DP4A 4LV5B 4JUZA 3K1YA 1RI2A 4DWJA 3GPCA 3B89A 2RK6A 3TFWA 3PYLA 3EUFA 2GNAA 1MTOA 5IKPA 4MKHA 1HQDA 4I2FA 2IYUA 3BDVA 2WD7B 2NRXA 3DE5X 5HE8A 4Y8VA 2Q4EA 4FN5A 1U0EA 4WZAE 3W90A 4E2XA 5KT5A 3C98A 2QUAA 3QXJA 1H69A 1LFDB 2HKIA 4JU9A 4MW4A 1BEUB 3F3KA 4DJDC 1G0OA 2FW0A 1PZEA 4KHPB 3QKSA 1V25A 2H65A 3LXMA 3MUNA 1Z5GA 2YVQA 1UBMS 4JJ8A 2CWDA 5ENVA 4YAWA 3B7PA 1TKDA 3O8OB 3JAWB 5CLFA 2IE8A 3MF4A 3DDWA 5DSXA 2ZI9A 5IAEA 4MDEA 4MJ7A 1M6NA 1RJGA 3ANLA 1H6AA 2IHMA 2AN9A 3AUUA 2OBMA 4NDZA 4B48A 1ZI9A 3ABOB 3E0XA 2WWGA 2FWNA 1C9KA 1NJGA 4H7EA 4Y3UA 5TS3A 3RVBA 3OD5A 2P8JA 4DQPA 1N3YA 4GX2A 2Q2VA 2JEFA 2N0SA 4U4AA 1T8EA 3FYCA 4BRZA 4MW7A 2OCXA 1ZPDA 5AW7A 3OBBA 1DOHA 4PH5A 2GJSA 1J7KA 3WLQA 5JSZB 2XMCA 4KX3A 1JDSA 3RW9A 2REBA 3RUPA 1Z2EA 1IZ8A 4J9PA 2XE8A 3L07A 4R51A 4YV7A 4X84A 2G71A 5HJ5A 4C7OA 1EDBA 1ZESA 3G2OA 3PA8A 4HV4A 3JZFA 4OIFA 2E1EA 3R4VA 4KE6A 2CYAA 2HDNB 4XI9A 3UXYA 2BFCA 1SG9A 1D0IA 3GG9A 3EA4A 4IVRA 4RTRA 4NNOA 3QX3A 4P0QA 4HDSB 4OB8A 4YRMA 4C0KA 5ALZA 2L2QA 4WCDA 3OIFA 1ZH8A 1PCXA 2FQ1A 3CB4A 2NTVA 1GPWB 2AI2A 2O14A 2JGIA 4ZRNA 4QVKA 5CM2Z 1OREA 4YAUA 1NOKA 2ZRNA 1K7EB 5J2TF 2AXEA 3N2ZB 2J9YB 5LMCA 1XLUA 2IXBA 2P1RA 1MZPA 2FZWA 2P9EA