2HDOA

Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
207
structure length
207
Chain Sequence
MTYQALMFDIDGTLTNSQPAYTTVMREVLATYGKPFSPAQAQKTFPMAAEQAMTELGIAASEFDHFQAQYEDVMASHYDQIELYPGITSLFEQLPSELRLGIVTSQRRNELESGMRSYPFMMRMAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDSVSDEQTAQAANVDFGLAVWGMDPNADHQKVAHRFQKPLDILELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from Lactobacillus plantarum at 1.50 A resolution
rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords Phosphoglycolate phosphatase
total genus 57
structure length 207
sequence length 207
ec nomenclature ec 3.1.3.18: Phosphoglycolate phosphatase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2hdoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2hdoA01
2CFSA 4OD0A 1ZD4A 2CFRA 3QXGA 3QYPA 1EK2A 1RPZA 4OCZA 5ALYA 2CFTA 2O2XA 4L57A 3RFUA 5AVSA 5AVUA 1K1EA 3CZ4A 4UU1A 4Y2RA 1T9ZA 2D2VA 3OCXA 1WZCA 4HGQA 2Q4TA 4AP9A 2AH5A 3P96A 5AW8A 4QQFA 2ZBDA 1JUDA 5AK5A 1L7OA 4EZEA 5AVWA 4EEKA 2WM8A 1TE2A 3B9RA 1S2OA 1TJ3A 4IG4A 4UM5A 1Z4IA 2RB5A 3NUQA 1RMYA 5ALQA 2FUCA 1LTQA 1X42A 3D6JA 5ALGA 4H1WA 2DQSA 4L6AA 2Q5EA 4BKMA 1Q92A 2IA5A 1XP5A 4J2TA 1YV9A 2AMYA 4EX6A 3B8EA 5AVVA 4F71A 2ZBGA 3QUTA 4UMVA 3ED5A 3KD3A 5AVQA 4DCCA 2RARA 3AR9A 4BNDB 1ZRNA 3E58A 3KDPA 2HX1A 1RDFA 2YBDA 4BEVA 3A1CA 2IOHA 2GHQA 3WK5A 4CF5A 3ZX5A 3IJ5A 3ZX4A 3ZW7A 1WR8A 1CQZA 3NRJA 4KYTA 3SMVA 1RQLA 3FM9A 4BNDA 2YMMA 4KNVA 4NABA 2P69A 5AI0A 2YMPA 2R8EA 3A1EA 3PDWA 3U7EB 3FZQA 4UMDA 4G9BA 1L8OA 4KN8A 3KBBA 4E88A 1WPGA 2JAUA 4Y2TA 3PGLA 1IWOA 4YCNA 2B8JA 2WF6A 5AKYA 3AR7A 5AKXA 5AKGA 2BDEA 3OCUA 4YIKA 3L7YA 4UARA 3ET5A 2WF5A 2BY4A 2R8YA 5AKZA 2EATA 2QYHA 2OA0A 1L6RA 5ALJA 1RC8A 3SLRA 1ZS9A 2YMLA 2P27A 2RBKA 3AR8A 1Z4JA 2GMWA 2C88A 4EX7A 3L1UA 2W43A 2FPSA 3EF1A 5AI5A 3R4CA 1TJ4A 1FEZA 4BX2A 5AM5A 1VJ5A 3NAMA 3QUBA 4ZEXA 5AESA 1QQ7A 5IS2A 2HHLA 1Z5GA 1U7PA 1ZJJA 2B82A 3W5DA 5ALLA 2MSNA 2MU1A 1ZD5A 3K1ZA 3U19A 3A1DA 2G08A 5ALRA 4JDPA 3ET4A 4I9FA 4OFZA 3FVVA 2JAWA 5AW2A 2YMQA 3W5BA 3IB6A 2PKEA 2G09A 4NAVA 5ALDA 5ALPA 3E81A 4L6CA 3QUQA 2HI0A 3A3YA 4G63A 3OCZA 2G1AA 2ZBEA 3L0YA 1NRWA 2I55A 2HF2A 4HYTA 4UAVA 5IT0A 3WKEA 5ALFA 2OYCA 2WF9A 5AI6A 4NV0A 2YJ5A 3QU4A 1ZD3A 3ZU6A 3N1UA 2VKQA 3WGVA 1QYIA 5AKLA 3VAYA 4BX0A 2CN1A 3NALA 1Z4KA 2FPXA 5A3RA 5AKJA 2YY6A 3QUCA 4HGPA 5AI8A 3MC1A 5FP0A 3DNPA 5AM2A 3KC2A 3WKDA 3UMCA 5AW1A 3N5KA 2NO5A 3UM9A 3EF0A 4UASA 2HO4A 3L8FA 2YJ4A 5AW9A 4CF4A 5A3SA 1N8NA 4HAIA 1RKQA 3M9LA 1TJ5A 2O9JA 4Y2UA 5ALHA 4NFLA 1EK1A 5AVTA 4O8CA 1J8DA 3FPSA 1J97A 2GHTA 4RESA 3I28A 2HF7A 4Y3UA 1RLMA 5ALMA 1SU4A 1O03A 3AR3A 3U7FB 2YN4A 3SKYA 3OCWA 4UMFA 1WVIA 1TA0A 5AK6A 2B8EA 4QJBA 3U13A 4YIHA 4FFDA 3QNMA 4ZEWA 4MUMA 2I33A 1S8OA 3QU5A 4I9GA 3AR2A 1LVHA 1YS9A 4Y2XA 5ALVA 3QU2A 1U02A 3U26A 5AVZA 2Q4RA 3ZTYA 5AKEA 1Y8AA 2EARA 4J03A 2IOFA 3SF0A 4BBJA 3ZTWA 3ESQA 5AM0A 4OHFA 2G80A 2ZG6A 3RF6A 2OM6A 3SHQA 2R8ZA 2I54A 3OCVA 4B6JA 5AW6A 1Z88A 4BYGA 1KYTA 1NNLA 2OBBA 2MU2A 4XPZA 3EPRA 1ZD2P 2JGAA 4NWIA 3DV9A 2WFAA 4UAUA 1XPJA 4UMEA 3I6BA 3J7TA 2NYVA 2ODAA 4YH1A 4Y2VA 3SD7A 1O08A 4Y2JA 5AW7A 4RETA 3L1VA 2HCFA 3E8MA 1QQ6A 5ALNA 2I7DA 3I76A 1SWWA 4DFDA 2HEGA 1L7PA 4UU0A 1RRCA 1T5SA 3U7HB 1RKVA 3QGMA 3AR5A 3UMBA 2G07A 2B30A 2FPWA 2IYEA 4BX3A 5ALXA 4CF3A 5ALWA 3NANA 2ZOSA 3WK4A 4C4TA 5ALKA 2R8XA 3M1YA 5ALOA 3WK8A 2FPUA 2YFYA 1YMQA 4BEWA 1VFPA 3ZWKA 1Q91A 3NIWA 5AM4A 5AKIA 2W4MA 3OCYA 1U7OA 2C4NA 4AS2A 3MPOA 1YJ5A 2QLTA 3WKAA 2FPRA 4Y2PA 4HGRA 3QU7A 3L5KA 3W5AA 1Z4PX 2FDRA 2B0CA 1Z4LA 4UW9A 3ONNA 1L8LA 2WHEA 4EENA 1Z4OA 3GYGA 1QQ5A 4CNQA 5AI9A 3ZVMA 4Y2YA 2FUEA 5ALSA 4YCLA 1RLOA 5AVYA 4KNWA 2GO7A 4DWOA 1Z4MA 1SWVA 3WK7A 2ZXEA 5AI4A 3R9KA 5AK4A 2EAUA 2AUTA 1T5TA 1L7MA 4HGNA 3L8GA 4UM7A 5JJBA 3QLEA 5AM3A 1VJRA 1MH9A 4MWOA 4YGYA 3I1YA 2YJ3A 5AVXA 3NASA 5A3QA 3W5CA 3HLTA 3AR4A 1RMTA 3OPXA 3EWIA 2JARA 5AW3A 1RLTA 3ZI4A 3FGOA 2FEAA 3B9BA 5ALTA 3L8HA 4YCMA 4HGOA 5T41A 2PQ0A 5AW4A 2P11A 3N8GA 2WF7A 3PGVA 5AKKA 3MMZA 5AM1A 3KOOA 2FI1A 5ALZA 2W11A 4PNHA 5AK3A 1NF2A 3ZUPA 2IOFK 3DAOA 3L0CA 2ZBFA 3BWVA 4KX5A 3QX7A 3R09A 3KZXA 1ZOLA 5ALEA 4UATA 5ALIA 3CNHA 4XOUA 5AW5A 5AW0A 3AR6A 3DDHA 3E84A 1Z4NA 4GXTA 4ZEVA 1PW5A 2YJ6A 1ZRMA 3WKBA 1Z5UA 5AIBA 3WK9A 4KX3A 3MN1A 3ZWDA 3HYCA 5AVRA 1CR6A 2AGVA 3WKCA 3ESRA 3BA6A 3ZVNA 2WF8A 1F5SA 1N9KA 5IT4A 2P9JA 5E0OA 4CE6A 3WGUA 4FYPA 2B1RA 1XVIA 2C9MA 2G06A 2B1QA 2JAOA 2BDUA 4XE5A 3L0BA 2RAVA 2PR7A 3PCTA 1Z4QA 3FPBA 2G0AA 3TLMA 3ZVLA 2GFHA 3L8EA 3OTQA 4AS3A 2HOQA 2X4DA 3QU9A 4F72A 5AHXA 5AIAA 4C4SA 5AKHA 3IRUA 4IFTA 2NO4A 2C8LA 4XQ0A 3U7GA 4JB3A 3F9RA 3N28A 4Y2SA 1QH9A 5AICA 4FE3A 3UMGA 1AQ6A 3S6JA 2HDOA 1RMQA 3WK6A 1YNSA 4GIBA 1RKUA 2C8KA 2I6XA 4Y2QA 3N07A 1RQNA 4DW8A 3SKXA 1YDFA 1U2SA 4C4RA 2I34A 1L7NA 1U2TA 2HSZA 4EELA 5ALUA
chains in the Genus database with same CATH superfamily
3QOYA 2A1JB 3QWAA 3BFVA 1NK4A 4HMOA 4M0UA 1QX4A 3H8WA 1NLYA 3FNRA 3IOMA 3PF8A 2JHGA 4JELA 1QIFA 2BGNA 1Z2NX 3BXPA 2FMPA 1GRRA 1NAHA 4LXQA 1SUSA 5CB4A 3D8UA 4RF3A 2QGZA 3WB1A 1P31A 1ONNA 5L45A 2FSSA 3BF7A 4HGZA 4CM8A 3WYBA 1N77A 4Q01A 4JQOA 4ELUA 3AYZB 1II8B 3EFBA 4GPIB 3ADBA 1WZCA 4ZPXA 3BUSA 5LP6B 3K96A 2HHQA 1NF9A 2M2IA 1U0JA 2R7LA 4AYXA 4LECA 2NU7B 3OOYA 1VLLA 5I8WA 5LLDA 4QQFA 4X92A 3NEYA 1X6VA 4YRCA 4ED7A 1DLIA 1EKXA 1G3QA 5BVHB 4PRKA 1LB1B 3B9RA 2WAOA 3SBOA 3OE7A 1JECA 9ICGA 1IHUA 1KPIA 1O6ZA 3TLGB 1I2CA 1KIMA 2IPAB 3NU1A 3GFTA 3PL1A 5CTJA 2DWUA 2A67A 2XY5A 2FKAA 4WZBA 5L4SA 4KN5A 4PC3A 3C3EA 3KLMX 2KK0A 1UBSB 1QX3A 2DH5A 3L7IA 4QBTA 3G0CA 3THYA 1IEXA 2JLAA 4HLNA 5JCPA 3TBKA 3ZXSA 9ICXA 2IA5A 2O6HA 2BI8A 2PH3A 1EGQA 1E9BA 1E92A 1HYQA 4LVUA 1WABA 2DQ4A 1UKBA 3H1FA 2H2WA 3I37X 4ZGWA 1NJ8A 2D1FA 2JI8A 3VDMA 1UPBA 1X7WB 2VJQA 5IILA 3NV9A 4ZI5A 4MZXA 1EWRA 2UZ4A 2BUAA 4I4TA 4NLCA 2JAXA 2P8SA 2XSZA 4K2AA 2WFLB 2GLXA 5E2AA 2R6JA 2W54A 3EXIA 4EZ9A 3SIXA 3SYTA 5KYXA 3OLVA 4Q3DA 3S81A 4DV2B 1VCOA 3KDPA 5JU5A 3MR3A 2A14A 2QUBA 2PZAA 4MEJA 1AURA 1M5RA 2YBDA 3C15C 4NH0A 1AA9A 2JLZA 2ZR9A 1KE2A 3WFZA 4OMCA 1TMYA 1IK4A 2IOHA 2Y67A 1CYDA 1KYIA 1PFQA 3FVQA 3K4HA 1QF9A 5E9JA 3QUAA 1C7YA 1ADFA 3GEDA 4YVZA 5DH9A 5EUMA 5H4HA 4EHNA 5LDDC 5FRDA 4O2BB 1SKAA 5D5HA 2B21A 1PJLA 3GC6A 1WMBA 1Z6QA 2V6JA 3JTMA 3VKUA 1T3NA 4XR9A 4B2PA 4CCYA 2HW8A 3BIJA 1Q12A 2JIDA 3AKYA 4FHCA 4MJ3A 4O3NA 2QP3A 2R8GA 4JI7B 1DDOA 2VDJA 1H6AA 2WJAA 2ZUVA 2HHAA 4UB5A 3KAPA 2J6UA 4DL3A 1HIWA 4PZZA 1BPZA 2W6JD 5LA6B 1NZJA 3IUJA 4DLRA 3IT2A 2PSHA 3GJTA 1WIWA 3WV5A 4JUDX 3KV1A 1MAVA 3C87A 4K3VA 5CVEA 3VO2A 1C3JA 1PSZA 5T67A 2C96A 5G1NA 2XWPA 3ZDQA 3FPFA 4IQVA 1NQUA 3G23A 1BWSA 3H0EA 3N7SC 5THXA 5JY6A 3CEAA 1KDOA 3K53A 2BV3A 2BI4A 2X7XA 4P33A 2WWTA 4JJ7A 1HDCA 3OEYA 4YIKA 3NBXX 2IV3A 1FJXA 1NXVA 4WEQA 2BAGA 3L05A 2HWXA 3ZGNA 3CVUA 2GVZC 4PIVA 1YFLA 4DQPA 2F1JA 5JSYA 4A6EA 4OJOA 1E2DA 4Y6GB 2CZCA 2HT1A 3B6ZA 4KQWA 1AV6A 1IWBB 2EJUA 4KRYA 4MB0A 5JJIA 5BT9A 4E12A 2F43A 1SL0A 3F4KA 1V6CA 2A4MA 2BLLA 2ACEA 2YYYA 3PFIA 5A9SB 2PQ2A 2IBMA 1TM3E 4E15A 3DLBA 3BD7A 1E2BA 1V11A 4HDMA 4U1RA 4ZC8A 3FWNA 1C0KA 1N56A 1ISSA 4ENPA 5AM5A 1CF9A 4GC7A 1MGOA 4WWHA 2RSLA 3AW8A 2LYBA 3PNVA 1QB7A 4EBCA 1EFRD 5LOVB 3RGGA 1P7DA 4TYNA 3TCNA 2RH4A 4UBMA 4JKIA 3JPRA 3FN4A 2WQ6A 2QSZA 1YB2A 2ZQYA 3OQJA 5T6BA 2IH2A 1RYFA 2OV3A 1OBVA 1D4ZA 3MGKA 4PZDA 3SAFA 4PYMA 3UJHA 2ZRIA 4RNDB 5HMMA 8ICFA 1T35A 3WXMA 1I7LA 4B3JA 2ARKA 1KEKA 1XNRB 1YJQA 4BQSA 1DIHA 2O8EA 2CFCA 2YMQA 1AF4A 3TI7A 7ABPA 3NUZA 4KPGA 4KXNA 4O3MA 1ZVQA 4N9WA 3UMFA 2CZQA 4BWVA 1MB4A 1WKCA 2PGNA 1T3TA 3AY6A 3M9XA 4I4CA 1O2DA 4NNJA 5I7EA 3K71B 4Q6WA 1IQUA 2J6SA 3PEEA 4G63A 4JBIA 1E79D 3TXYA 5LD2B 2C3PA 4XIJA 2HMSA 4LRUA 5C81A 3WWPA 4OAQA 2EYQA 1QGED 2EP7A 1LDBA 1U8YA 2R751 2C1EA 2OH2A 2ZIGA 4MEAA 4U7JA 3WLQA 3OEEA 1LQUA 4MHVA 5I9IA 2IHYA 3QITA 2QAJA 4HFRA 4IVQA 3MEQA 4LBZA 2UXCB 3L82B 1GTL1 2H08A 3FDFA 4Z7OB 5KCZA 4EA9A 5KOIA 2C84A 2HK7A 3B9JA 3QV2A 1UJ2A 4I6GA 1JG4A 3LW7A 4OYRA 4PAGA 3PUZA 5K4LA 5E3IA 4CEJB 2R44A 2WE7A 4P0QA 4QWCA 1P4SA 1LKYA 2IDJA 2A88A 3GW8A 4L5JA 3KHHA 1BQEA 4J0GA 2A1AA 3VAYA 1TEHA 5T3YA 1D8TA 1CZOA 5GJBA 1A0PA 3LPDA 2QTRA 3HU3A 5DWVA 5E6RB 4WJLA 3DSRA 4RNNA 5JFGA 1LC0A 3HPQA 3KTOA 3K4PA 4OAPA 1F06A 2O8FA 1UMCB 3QUCA 3GAZA 1COZA 3H5IA 2CUNA 1OGYA 3CCCA 3PW4A 4YN4A 4C7XA 2HW3A 1U8TA 4PGQA 2X4GA 3QFTA 5IHXA 5KKAA 1WBBA 4HN2A 3WMRA 1P1FA 4BTEA 4KLCA 1QRRA 3UMCA 5AW1A 3GEMA 1IL0A 1NN0A 1JG1A 1OLSA 1NXXA 2OORA 2QG4A 2WSBA 3DWEX 2P90A 3GIWA 4LBYA 3IQIX 4RIHA 3VSBA 3J80A 2HO4A 2VJKA 5I7VA 1TX4B 5AOVA 3HN6A 1V7QA 2RP5A 3QF4B 1XXHB 5TIIA 1ZMTA 4JMPA 3REOA 2ZIWB 3A58B 2BH9A 4KMOA 2ZS7A 1QZTA 1EK1A 2WZDA 1XQVA 4NFHA 5G2OA 2BPCA 4M2YA 1AKUA 1J8DA 3DE2X 3TTVA 4E5DA 5AVTA 1CJMA 5FAKA 2F3UA 4OBEA 1P8JA 1WU8A 2ONJA 3V6LA 4EW1A 3K30A 1C9MA 1PLKA 1QO9A 2O05A 1VBFA 1E6UA 3F9CA 3IX7A 2PRJA 3ZLJA 1TO1E 1SC3A 2RDIA 1JHUA 2ZSHA 2ZYSA 3I9OA 2ZJ2A 4QKQA 2UXDB 2AWOA 2CKDA 4F3RA 1DG3A 1NJWA 3L8CA 5D84A 1KVTA 2A5DA 1A1VA 5JY1A 4NJMB 4MPTA 3W1EA 2ROQA 2FFBA 5CLLA 3MMSA 1KI7A 1X1DA 3WQRA 5KOYA 1FSFA 3RYFA 2NACA 3RBVA 2Z6QA 1X13A 4KLOA 2J5QA 4X61A 1HPLA 1VOTA 5F1KA 3H6GA 3TZHA 4H3VA 2L69A 4LMPA 5JCJA 3RRXA 4F4DA 2ZB3A 2C4KA 2IOFA 4W7IA 4CPDA 4ZWNA 4M6WB 1IXRC 2Q5LA 5CYPA 3P9QA 4BKOA 1PZNA 1PN3A 1WMDA 2AA3A 1EXDA 4WVFA 1ZIPA 5BUZA 1RC1A 5G0TA 3TL3A 3NVMB 4WV3A 5JJCA 3RREA 3SQIA 1JPVA 1T8WA 4BL5A 3P0HA 3KCNA 1BDJA 2I71A 2LKDA 1MGPA 2JCYA 2MOKA 4PG4A 5CMLA 3N0RA 4D57A 1ZD2P 3OHBA 1NJ5A 3IT0A 3IPXA 3THVA 2FEXA 4J07A 4LXTA 5EHGA 3LZ6A 3WHPA 2Y3IA 5ELMA 1XI2A 1DJLA 5EWMA 3RWMB 2AJLI 4JDUA 1UKVY 2GJKA 1Y4SA 4NG4A 4J9PA 4M1OA 1S8FA 3EXHB 3ZVRA 4AJNA 4DL2A 3VZBA 2HCFA 2WVAA 3H2HA 2A1UB 2KD1A 3AKEA 3SQMA 2I3BA 3NP7A 1KY4A 3BE4A 1RCFA 3QFFA 1U6IA 4DCVA 3OFVA 4XGQA 1TVMA 4CL2A 1THTA 4BYMA 1Z33A 1W2HA 2IPNA 4BO0A 1F51E 3U7HB 5LDGA 3TW8B 4KC0A 4LAFA 3K0FA 1RKVA 2WYOA 3QGMA 1V1MA 4X94A 2OXIA 4G5SA 5FTLA 1OC4A 4DLLA 3AQIA 1LBSA 2I6UA 1FXWF 1I2BA 3NXKA 1P3DA 4OOEA 4YDHB 5EZYA 4J9OA 3JALA 3FB4A 1LFDB 1QBKC 2FK7A 3DZFA 2YCLA 3IHLA 5E6UB 4DSFA 1M83A 2UUBB 5LFAA 4H7HA 1ISIA 2HQBA 1IOWA 4JC0A 4EP1A 1G66A 3KPWA 4DV0B 5E4FA 5AHRA 4UCXA 4G26A 4YRAA 1DC6A 1IVNA 2CZGA 2D06A 2C2MA 3PDHA 5IFKA 3HEMA 3UGKA 5AJZA 4KI7A 2C29D 3FAKA 4I5DA 3ZE8A 3UBTA 3IULA 1BNPA 1DAGA 3EW7A 4A0HA 1TEXA 4MUKA 3WQSB 4AS1A 1UAGA 2NZVG 1RJEA 3KOWA 4W9NA 2YNMC 3NHRA 3DWIA 1EB8A 4II3A 4MWBA 3JQGA 5HFAA 3S7ZA 3UENA 4RAOA 5A0VA 3IVXA 5FOTA 4C2UA 4KLUA 2BW0A 1XYGA 2JD1A 2C2HA 3OQVA 2O6KA 3EIEA 4G3XA 3I92A 4K9PA 4RW0A 4EYKA 1B8NA 3H6KA 2IHMA 2VP6A 3F2VA 3HB7A 3K73O 1U99A 4UW9A 1PJSA 3N8KA 4WLEA 1O6BA 1P2VA 2Y1GA 4FXOA 1VJDA 4G0YA 1IJBA 1E6MA 2WAMA 3FZYA 2H7YA 4RQ8A 2RBEA 1ZUNB 3L41A 1XTPA 3R3SA 4PIPA 4E5MA 1RYYA 2B6HA 1N5JA 3G02A 3TVDA 1G3MA 1K6IA 4H31A 5HF8A 5GWXA 1MA0A 3HJTA 2FDCA 1ZQRA 2XT6A 2Q62A 4AWBA 2F6RA 1RIFA 1XCMA 4Z9FA 1JVSA 4BVLA 4LX0A 4QXOA 1NONA 1ZQSA 4RUCA 1Z4MA 2P2ZA 3DONA 1SHJA 1A04A 2AXNA 1JU3A 4GMHA 4NJEB 3X1YA 5CVTA 3MR6A 1H0HA 3MOIA 4DEVA 4GYKA 2NZUG 2P79A 1X8XA 4I50A 3RVRA 1M1NB 4HDNA 2PX4A 3LUGA 1GG9A 3MCZA 5HNKA 3SZOA 4S12A 7MHTA 1OIXA 1SURA 5HQ3A 2BCSA 2J33A 2Y92A 3CNEA 3IJRA 1STOA 4BUGA 1OH5A 2HU2A 3KT6A 5JMWA 1Z83A 3NAZA 1BJKA 4D4HA 1ZEMA 5FA8A 4PZCA 3TD2A 5MF6A 2O2YA 1K68A 2AJQA 4LF9B 1XZCA 3KWJA 4XDGA 4NEHB 3H2KA 1E9EA 1H2ZA 3MGHA 4MWGA 3ZD7A 1G5IA 4AKHA 4LE2A 3ANNA 3QEMA 1J2YA 1PGPA 4PNHA 2A2ZA 3QX8A 4IM7A 1ILEA 1V3QE 4TLDA 1QH8B 2P6NA 1I3CA 5EIFA 2N1BA 1YE8A 3VFDA 1T2UA 3QX7A 1NVDA 1QG4A 3R09A 3UBMA 4ZCQA 4LWQA 2LW7A 1ES9A 3GA5A 3V2HA 3P2JA 4ALMA 3BEDA 2RIRA 3H5OA 5BR4A 5ER6A 5KFNA 4RCYA 2P35A 1RI5A 4B6RA 5ERGB 1FRZA 4G85A 1C7QA 4RDXA 5KNDD 1UPXA 2RI0A 4RK5A 3GUYA 3V1MA 2DUWA 2PG3A 4MUNA 2Y1LA 3IBGA 2KMDA 3OIDA 4LHXA 1K3UB 4R3WA 5EMMA 3EZ5A 3P26A 1EXWA 4HD8A 4YHHB 4JXZA 3DMRA 5AIBA 4QGHA 4DCGA 5CDHA 4C7ZA 1BEUB 2IH5A 4KX3A 4W5RA 3STHA 3EDRA 3L4JA 1XTQA 5FR1A 3NX4A 3WKCA 1E6KA 5J2UF 1DRUA 3IAM1 5EAIA 2XXBA 3AIKA 3KM0A 2XEDA 3D0KA 5J2EA 3PZPA 2BM9A 3B53X 2CGEA 4KPEC 2C58A 4MQUA 3IOEA 4J2OA 1ZGHA 1TECE 4ZAVA 4IXWA 2H59A 5TZVA 3AUTA 2KX7A 3QKTA 3B82A 3R0VA 4EKGA 1X92A 5EJ7A 1RYMA 1QG2A 5E6SA 2LCIA 1ZQXA 2IYZA 4TT3A 4J1TA 4B3CA 1P44A 1WV1A 3DLCA 4Z0HO 4NS4A 5HM8A 3RR8A 2GX6A 4M89A 1OR8A 3GDFA 3LECA 2VCEA 4LWOA 1TD9A 1VLVA 3ZW8A 2FN7A 5JHGB 3CLUC 4E2FA 2QRVA 1HDXA 1EWQA 4A8JA 2I6FA 3I9V1 4NBUA 4FD2A 4C9BA 4POOA 4AP6A 2ZIUB 3S28A 2C7VA 4AC9A 4QWWA 3GDOA 4FE7A 2DWOA 2W5UA 5J9FA 3RB8A 4QZAA 1MH1A 3DB1A 4AK9A 3GD7A 2BTQA 1UAYA 1DAOA 2D5CA 2JVJA 3MMXA 4KBYA 1X1BA 4TV8F 4XX0B 2JLQA 2AW3A 5HR7A 2VJCA 3Q3GE 4PYQA 5IAAA 2QI9C 1MRSA 2NNLD 2F64A 2CT8A 3QVLA 1KEEB 2O7QA 3SIWA 1GJRA 1DKUA 3KVRA 5DOVA 5A7GA 4C7JA 4QG3A 5JQGF 4O4JF 1A9YA 3AQ4A 2H9YA 3TVTA 3R3JA 1G1AA 3BS5B 4MW5A 4HX5A 4DLBA 4GKKB 4GXQA 2ZTDA 3VH2A 4HXYA 1K66A 1KI8A 4LYDA 3KWMA 1HT2E 4IINA 3GFBA 2PX3A 3N2IA 8ICQA 1W0KD 4PRYA 4R1QA 3LT4A 1RYBA 2WAXA 1XN1A 1M2VB 1AF7A 5B2EA 2BELA 2GBGA 1EFPB 3ZGVA 2ILVA 1G19A 5K0GA 3WGZA 2P9CA 4FI3F 1QRUA 1GOTA 2QRZA 3IR5A 3NNSA 4D4KA 1TA4A 3LHFA 1K0UA 4CCSA 1ONOA 5AK5A 2JEYA 3IAXA 1M34A 4V1CB 3KEMA 4EZEA 4EEKA 2FWBA 4MVXA 1GPKA 1Z17A 2FX3A 1UZUA 2OGWA 2G1UA 5H68A 1LX7A 1J24A 4Z86A 3GQBA 1JFVA 4IJMA 2GN1A 1P7CA 1ZM7A 3F6EX 1ZGGA 2OE2A 1ITZA 1T8SA 1HEIA 4PYRA 1DUVG 1L5VA 2P5UA 4LZAA 4P4OA 3Q3EA 4MICA 4AKTA 4I9HA 1XE3A 1ZJWA 3F98A 5COAA 4B8WA 5EXPA 4L6AA 1OFTA 4M0KA 1TA9A 5JC8A 5IIMA 4L4UA 2J5XA 2CRXA 4LWZA 1H4TA 3FLEA 1P62B 3PXAA 2DPLA 4JCOA 4RMJA 4CDMA 4EY8A 3GROA 3P2EA 1MP0A 3R7FA 2GD6A 3W7AA 3QUTA 2R7KA 2J9FB 2ODGA 2XCQA 3MWYW 4MW2A 4RIIA 4TXHA 4YA6A 3HNPA 4L75A 3F4BA 5G1PA 3G68A 4MW7A 4X41A 4NOMA 3EIUA 1JIHA 2HY7A 3NKLA 3ANYB 4AQDA 4YRRA 2IYFA 2QUAA 3E58A 1ZH8A 3I39X 3KQSA 4W9MC 1TGVA 3O4RA 1PL8A 3AU9A 2UVPA 5JEEA 4A36A 2HV9A 3RBDA 2ZYAA 1XZKA 2X77A 1B4FA 3NHSA 3TVYA 2MDTA 4MB2A 4DXAA 2XUOA 4NYMQ 3S2YA 3IUPA 2WM3A 1TKBA 1KYQA 2ZYDA 3ZW7A 4PHFA 1DO0A 3VGJA 1OLXB 3EMBA 3ORFA 1DWUA 1QAOA 4YNBA 2V55B 2Z4TA 2HUNA 1JZTA 2AE1A 1GT6A 2DFKB 4NYIR 3PRKE 5G02A 5A71A 4EITA 2IYAA 2BEUB 3CS3A 2BZ1A 5H1YA 4EHBA 4G65A 4XAQA 1V4BA 4PLGA 3F6PA 3DDOA 2QRUA 2P9YA 2PZJA 3EA4A 3HJRA 1QKIA 3HS3A 2VJYA 4PWYA 4KPFC 4E88A 1SR8A 3AFGA 4J9VA 4ESVA 2IBSA 3SQXA 2WJHA 2XF2A 1GDDA 4OYLA 2W22A 3OGUA 2VJPA 2ZRMA 10MHA 1Q1AA 3MWEB 4DN6A 2PN1A 3N39C 1FSGA 2Y0CA 5F98A 2GWHA 3DTTA 1L1QA 5AKYA 3NCHA 1L4MA 2W90A 3DLTA 3RRGA 4FGLA 4J16C 4EHJA 1NKCA 3GPIA 4NCNA 5JCOC 4PR0A 4ZOEA 5TJHA 2XMPA 4TQUS 2RGXA 3HR7A 2AXPA 3BDAA 2BY4A 4GS5A 1N6OA 4OQ4A 1A71A 1QB8A 3GRKA 3RVOA 3PW0A 2X0IA 4D8UA 2QM3A 4C5CA 5ESRA 9ICEA 2PU5A 1Q74A 1KJWA 2ECKA 4MHOA 1E1DA 1T6YA 1FLNA 4QWDA 1K98A 1MW9X 1ODIA 2BFDB 2SICE 3BMQB 3ND9A 2OPBA 3Q7IA 1ZA2A 2C5HA 2EZ9A 1VZ3A 1ZS9A 3ID6C 4IDPA 2WKPA 3H1BA 4N7JA 3SLRA 4XWOA 5AUQA 1B1AA 4UE2A 2GMWA 2VZ8A 1OXMA 1TJNA 3Q5EA 4TLMB 1GNSA 2P66A 3P0RA 3FKQA 3NHAA 2F2TA 3ZZUA 2WIDA 2QB5A 1H0RA 1NXQA 1Q16A 2Z5LA 3L8ZA 4NPCA 5TLSA 4RD3A 5KFEA 1NW4A 1PI3A 2A86A 2XYVA 3O8DA 4JR0A 4ZO9A 3RSLA 4FBLA 4XWKA 2YS7A 4A8JC 2AOUB 3HMQA 3O91A 3C4JA 1I94B 4CEHB 2HMYB 4MS3B 2P5YA 4M83A 1ADJA 1T2FA 2OCKA 4GO1A 4P34A 4YONB 1Q3KA 3FZNA 3M1LA 4WY5A 2LPEA 4GI7A 4ETIA 4K6FA 4LQ4A 4JEMA 5CR9A 2QJRA 3HB9A 4EWLA 4ZMBA 1UBHS 4DWJA 4M9GA 1A4XA 1M8FA 2A6PA 4OM8A 5GJWC 4B40A 4EYEA 3HN7A 1QVRA 1EUCA 3T3FA 1E89A 3H0CA 3K0CC 3MCUA 1Q0SA 3T54A 2VSYA 1IJFA 2YX8A 2OCIA 1QIIA 3G1WA 3N75A 4I9FA 2CLKB 4US2R 5AW2A 3HHPA 5JIBA 1OAOC 3P9XA 4KFTA 1B1CA 2BHLA 4DBVO 2J3JA 3V7YA 3HCAA 5FFNA 3F53A 2E8NA 2WJIA 1U5CA 2GUWA 2IIQA 2RC6A 3LKDA 1NW7A 2C5SA 2GYUA 3HJEA 2OBXA 3G2KA 5CNJA 2BSAA 3I5YA 4Q1FA 4HLUA 2VYVD 2GSDA 3QKSB 4RZIA 2P40A 3PQ7A 4LJLA 4MPDA 4B9VA 3CR7A 3UUWA 3ZDXB 1U0TA 4DDHA 4QFBA 4BMSA 2ORYA 3I3SR 4P6VF 3T95A 1YZUA 1CNMA 2I55A 3CRMA 5IXYA 4FC6A 1W1UA 1VCMA 1P2GA 4QSHA 4HUTA 4QRIA 3K0KA 1XAIA 1TAMA 2V9ZA 3HDJA 4DSIA 1QO0A 1SQSA 2YICA 3QBEA 4CIVA 3BL6A 3BWEA 1XTBA 2GVDC 4MQEA 4OSPA 1YR8A 2R97A 3N7UA 5EP3A 4J7XA 1QOQB 3BQ1A 4R5MA 5ICSA 5J4LA 2I2FA 3IODA 1X1TA 4N49A 3CW2C 1XU4A 1F2TA 2XKAA 4MUFA 4FYJA 1IBLB 3AHHA 2HXYA 5JCXA 1I5EA 4JVLA 3CNOA 3FI9A 4Q9DA 5GM1A 1OF1A 2MYPA 1ESCA 1YNOA 4FX5A 3DLHA 5FPTA 3T5CA 4DYHA 1XL0A 4MGKR 3CH5A 2FP4A 4YRSA 3DXZA 1UPFA 2CJYA 3THWA 3A2KA 3RTGA 1F1JA 1RZVA 3E7DA 5KTKA 1X1CA 2AUNA 2GD0A 4FD3A 1V48A 5JJLA 2GTHA 2R6GA 4XZ3A 3IESA 2W3RA 1BQ4A 1J8YF 3AG5A 4ABYA 3LUCA 5TSDA 5JS1A 1ND5A 4TRMA 5A6SB 4C7OB 2BPFA 3MMPA 4G67A 3T15A 2KFZA 4CUKA 1NLFA 4UASA 1IV8A 2Q1SA 3CG4A 2VPIA 1Y6JA 1MAUA 4HY3A 3AFIA 1V1RA 3O74A 3JAKA 5H8WA 3IHWA 3QWFA 1X86B 4O2AF 4U7DA 2QZSA 1NBWB 3V4OA 5JI2E 3H5WA 2FY8A 1ZQVA 5TC4A 4MR7B 3UAGA 1JFRA 2GHTA 4EZ6A 4RTLA 4B87A 1HGXA 1L7AA 3WZLA 1X7YB 2P9QA 1PK3A 2QV0A 3EY9A 2B2CA 3HJAA 2JJ1A 3QMMA 4G0XA 4LJ5A 5AXAA 3Q7PA 3TLYA 2OG2A 3DDWA 3RODA 3D6TB 1NVWQ 3T1QA 6REQA 1V3VA 1M6VB 2ATLA 2FE4A 1WYGA 4WOKA 1KR5A 1XK7A 4W8HA 4WOBA 2AIRA 3KIPA 3BG5A 4TKUB 3K9GA 1T2VA 121PA 1BU8A 1QFYA 2VJNA 3NHWA 2P9BA 2VP0A 2PMEA 3ZI7A 2R2AA 4KEAA 1DFHA 1LSJA 1ZQ9A 3GOQA 3DBVO 2HMUA 2QKQA 3V6HA 1X9WA 1R9NA 4RPKA 3IKMB 4CG0A 2OCGA 3OT1B 1VYTA 3DBOB 2CUKA 3FDIA 2Z5FA 3H0LB 1TXGA 1XHFA 3DAPA 4OHFA 4CCHA 1UPUA 1U8FO 2G17A 1JXOA 2AG8A 4UAJA 4CKXA 1A98A 5CP8A 3INTA 2Z2KA 3F5DA 1Z88A 4WNAB 1RRGA 3JQCA 4NNPA 2W2TA 3VVLA 1KA9H 1SKQA 4B6SA 4O3OA 2VDVE 2LBPA 1EWYA 4L8FA 3RC7A 2BMVA 3HN2A 3T1HB 4H1UA 3KXKA 2RI6A 3FKJA 2DE0X 4BMXA 4KLSA 2QR2A 3DV9A 2WFAA 1LS6A 1ZL2A 2OV8A 2NIPA 4RFSB 2QAGA 3QMWA 4YMLA 1YCFA 2Q27A 2K2QB 3QFHA 4JD5A 5F64A 5IW8A 1AE1A 3I6ZA 4BO3A 4CM3A 4IWXA 3U1BA 4B3DA 1SL1A 1DHRA 1OY1A 1CE8B 4IJKA 3V1YA 1A8IA 4JI2B 3E8MA 1GKYA 4DL4A 3T5TA 4D45A 1H6BA 4J0KA 4G5YA 3V80A 3EIFA 2O5EA 1SV0C 4DFDA 4X1YA 2BMAA 4IJ6A 3LUFA 3ECAA 4AVYA 3EGWA 2LMRA 4BNWA 3CF2A 5BQ3A 5LJLA 1E98A 1R0YA 1T5SA 3P52A 3TN7A 4N0DA 1IU9A 1Z1VA 1FMCA 2FWPA 2QN8A 1KORA 1M10A 2QUZA 1N5MA 4ONEA 3HK2A 3BILA 3U4QB 4BMNA 1JQ3A 2B30A 4XX1A 4A8TA 5BO5A 5EJAA 3OI7A 1T25A 4KXUA 3C39A 1T1IA 5ITZB 2G6TA 5ALWA 1AC5A 3KSRA 2E85A 2Q5QA 3O4GA 5IEBA 4KLLA 2GB4A 3C5WP 4XWTA 2K4EA 4BJ1A 3W5UA 4Z6CA 5J47A 4RNOA 2PFNA 4EECA 4AG6A 2VSNA 4O4JA 4AMGA 1WZ2A 1CDEA 1QE5A 4NZOA 5BVGB 1CR2A 4R4JA 1NDUA 3A0RB 3EH1A 2UUOA 3CUSA 4GMGA 2VHTA 4HTFA 1GSIA 2FFQA 1QK5A 3OKPA 4TTQA 2KVSA 2GPNA 1GA6A 1HNNA 4E13A 2B5WA 4UNSA 1G2QA 1U2DC 3INNA 3NDPA 3DMGA 5DEIA 4NE7A 1JVNA 5DYYA 2FVXA 1ZCAA 2X0FA 3S5JA 5B7PA 3DD5A 3WQHA 3T79A 4EI8A 1NWCA 1K5DA 3VR4H 4X3OA 4F8EA 5PGMA 1UJMA 3IOYA 3UW3A 4CVNA 3BSYA 3OBIA 5JAMA 3UW1A 1BQ3A 4QO8A 3JPNA 2PY6A 4DG5A 1SU6A 2ZRKA 3Q87B 5HR6A 4HVCA 3ES9A 2C7QA 2PKQO 2QD4A 4R8UA 1WX1A 4CM4A 4B9LA 3GA0A 3G2MA 3ZD8A 3RM3A 1Y3HA 4MV0A 2RGBA 2Z9CA 5BVHA 1UFRA 2NYUA 4H3KB 2YVUA 3D7RA 5KFPA 4JCCA 2CVFA 1GPDG 2WHEA 2FLKA 4NOKA 3L18A 3M4XA 1QHGA 3I9JA 3D0OA 3HB1A 3ZVMA 3NFRA 1SU7A 2C0PA 2G83A 1NLMA 2YHBA 4FYMA 4B9MA 3DYIA 4KHZA 4IGEA 4FBGA 4ER7A 5JZBA 2OCEA 2GN8A 5IVIA 4L3WA 1O94C 2L2QA 5CCXA 2YVLA 3HBFA 4XGNA 3RTDA 3VU0A 3DOJA 1FY2A 5EE3A 1V8FA 2I76A 2WB2A 1V16A 3ZWMA 1T5TA 4RMHA 4O4LF 2QSUA 3FF1A 1VCIA 2IYPA 3UAOA 1KJNA 4EW3A 5JE8A 1N5IA 4YP1A 3SSAA 3UB4A 1W9HA 2VP9A 1LSSA 2YJ3A 1R2QA 3K8ZA 4NCKA 5GY7A 2FLPA 4BO5A 3OC0A 4R7ZA 1SV0A 2KE5A 2YN0A 4HQ6A 4OA5A 3JPSA 3I42A 1WD7A 3QJYA 4X6LA 1JIJA 4C6HA 5HQTA 1GP2A 4BNYA 2CNNA 1VHLA 2OHXA 3QRWA 3E5HA 3SE7A 1N2OA 5BN4B 5HXAA 4L15A 3OURA 4KL8S 5FL3A 3WDSA 1TTPB 3A25A 4ZVNA 3ZNNA 4CCAA 4QTXA 4XYGA 5DYWA 4EGFA 4YMVA 2JAQA 2FRDA 2PQ0A 4I19A 4I14A 1VJ0A 1PQWA 4QHYA 2CUZA 4NDZA 1SVLA 2HRCA 4EG4A 5CG1A 4WN9B 2DLDA 3COWA 2W2PA 3F3KA 4BGIA 1N4DA 1T0BA 4PFSA 2I29A 2WAQF 4DIOA 4ZZ3A 4JBGA 2E89A 4TKMA 5K6AA 2Y0SF 3SC2B 3EX7C 4R1MA 4KVFA 1SCQA 2XWJI 3C97A 3BCSA 1G21E 3OEED 4UQPA 1GITA 1YMUA 1JU9A 3L40A 4XOUA 3THWB 2AZ4A 3NONA 1FRFS 2PX5A 4IDQA 3FMGA 3B12A 5DB9A 3P0JA 4GXTA 2YNMD 1ADCA 4ZOAA 5EIOA 3E9CA 4KMRA 4Q4JA 3BQ7A 3R5TA 3JYQA 4FWTA 4X93A 3RRHA 4DBZA 4I8XA 4YRKA 1DAFA 5SZIA 2OECA 3LVQE 2VNJA 1CP3A 1EE9A 3CLKA 2AFIA 4L5IA 4G3IA 2YOHA 1FFXB 1PFGA 3DXFA 4S3MA 3BA6A 2C3YA 2QNIA 2P5SA 4J4BA 2JEOA 1EVIA 4HUQA 4JJGA 4Q21A 1PYDA 3OJFA 4LSWA 5KNIA 5BOVA 4OH7A 2WJ3A 1R5OA 4FYPA 4M6WA 4TTVA 4UVHA 3TM5A 2H2IA 3UEOA 4B44A 3EZ7A 5KO2A 2XA2A 3RG2A 3UC9A 3ELYA 3OG9A 3PW7A 1N4AA 2OOKA 3BAFA 3FPLA 3K0CA 3CLSC 1CUBA 4MWSA 3AHCA 3RGWS 4MO2A 4YRNA 2QP4A 3A4YA 3CRQA 4PFJA 1M6HA 3JW8A 5L40A 3RYCB 4TURA 4MV9A 3T5AA 3FPBA 3RRBA 3D59A 1PU2A 3KT3A 4IHKA 3MFYA 4CKBB 1E4YA 4MA4A 4C0ZA 3P9SA 2QJOA 5NULA 2PH7A 3D3QA 5CUQA 4LZOA 4QD3A 2JH1A 3DOFA 2SHKA 5F12A 3AM1A 1FUIA 1GZ4A 1UEXC 2D6FC 1XN4A 3BD6A 3ETNA 3EWSA 1FVHA 3OIUA 7ICGA 1RPAA 2P7HA 4OYYA 4QU9A 5TQ0B 3SYRA 2DKFA 4F56A 1AGRA 1BYUA 4JB3A 3F9RA 1NI3A 1R0LA 2AN4A 5I7UA 1DPFA 4RPHA 4TV8B 5EVCA 2P9GA 4M87A 1ZAYA 1BZYA 5AICA 2X19A 1TO2E 3A0HU 3VBEA 4LIPD 2AOTA 1VL5A 2QENA 4XVRA 1T5HX 4COOA 5KREA 1JG3A 2XGPA 1KSHA 1IN8A 4ZA2A 3OZBA 1ZYQA 3U80A 3PEWA 2BYTA 2FPKA 2NRVA 4XUEA 2PT6A 3ICOA 2PUAA 1N1EA 3OBBA 3DH0A 1G41A 4DV1B 1TF7A 1ESNA 4Z2YA 1AKQA 3IP4B 1QVZA 4ER6A 3MOGA 3R6DA 2FXVA 3MLEA 4LXUA 2KOBA 1HXHA 2CMFA 4QGAA 1VSQA 2FNAA 1SC1A 3B1JA 1Z2CA 2BHTA 2YW2A 3EY4A 2C04A 1Y7HA 2W2VA 2JKVA 1L7NA 4ICAA 3GO4A 4JJEA 3CF4A 4IJWA 1T8PA 2V97A 4FQ7A 1L5MA 1E2LA 4BN5A 4DGSA 4K4IA 4JGGA 4OU5A 1CCWA 3LX6A 6LDHA 1ULHA 4MVJI 3GRZA 3B6MA 2WMDA 4L0DA 2WD7A 3C6MA 4L4ZA 5EUCA 4R2WA 1U04A 5FBQB 3PX4A 1BYIA 2NV0A 3K9WA 1BWRA 4CODB 3K1YA 2W2MA 1T9HA 3DDSA 4UU1A 3RJ5A 1ZUIA 4F97A 5A05A 3RK1A 2V7WA 1DAEA 4GP9A 4V0NA 4Z0PA 2EBWA 3T7CA 2IP2A 1GCGA 5DYIA 1LFAA 3FLAA 2DQKA 3INYA 1ZICA 4WFKA 1HT1E 1OAOA 3T35A 3ND8A 2X2FA 4ZT4A 4ZEOA 5L1JA 3BZWA 3E0XA 5EKDA 4HNHA 3B2NA 1XMPA 5FUYA 5IC5A 5LQCA 5I7FA 2PUBA 4OLAA 3M82A 1JQLB 1ZIOA 3TACB 3O8RA 1N9GB 3OETA 5KTRA 9ICNA 1IUNA 1Q44A 1Q1EA 3W5SA 3FUUA 3K5PA 1Y6QA 3R7WB 4DJDC 5A02A 3VYUB 2VRNA 5BRAA 1S2OA 2KBEA 1NXSA 1ODSA 1TJ3A 2GEDA 4I6JA 2CB9A 3ZDBA 2CEAA 4C7VA 5KSWB 2QW8A 5L6MB 2QN7A 3GV0A 3HCDA 4NIMA 3D2SA 3AG6A 4CEHA 4F2SA 1Q2XA 4IMIB 3O93A 1QSGA 2Q6IA 3CNBA 1XZAA 3F8WA 4G86A 2JVKA 2MUTB 4ZZ0A 2AJ8A 2Q5EA 2H51A 4IF6A 3N2KB 4IZOA 3C6XA 3CEPB 3FCXA 4HDCA 3TRKA 2VA2A 4XFKA 4JU8A 4DRXA 1UBTS 1XP5A 5EINA 5KJ1A 4IF4A 2PWBA 3A3KA 4QU8A 4TMZA 4I50B 1NV9A 1R0SA 3ED1A 1R8YA 2VK8A 1E0KA 2RKOA 1OYOA 1KYZA 1N2CE 4TXNA 4UMVA 3RV4A 3ULKA 3ED5A 1Z8NA 1HO3A 3E0FA 1CJVC 1N9ZA 4FFPA 1Y1SA 5BW8A 3U4IA 3S2FA 4EJ0A 3E9ZA 3E1GA 4AYBF 4EH1A 1QG0A 2ODQA 5LMUB 3GJ5A 4KO3S 4WERA 3WLRA 1QQAA 2CSUA 2K7ZA 4LOAA 1QIJA 1NK5A 2RIPA 3QTLA 4R83A 4F7WA 3MK31 3OEHA 3WIVA 1Q6YA 3LY8A 4RD2A 4Q9JA 3W6OA 5IEJA 4DCPA 3IJ5A 5F5XA 2ZM6B 3DF7A 9ICLA 4X1IA 3PC8C 2G8LA 5DNCA 5HIKA 1VP9A 2BFEA 2WJYA 3RYFB 3G5TA 1NNUA 4OP1A 9ICKA 4BKQA 2CK3D 4D6PA 4EI7A 5FQOA 3AI3A 3CTMA 4NABA 1DI0A 3EXEA 2K89A 2FB9A 4IXMA 4JC8A 2ES6A 3PKZA 3WRVA 1YQXA 1DT3A 3L46A 2FPPA 3LQQA 3FNBA 3DEEA 2P41A 3VR4D 3FLMA 3N76A 4A6XA 3U4MA 4ZJUA 1KYVA 1F2TB 2OILA 4FIDA 5EQTA 2QRMA 4IZ6A 1Z06A 5D8DA 3UWSA 1PL7A 1UL1X 4GC5A 1DFGA 1RRKA 4YMOA 3BJIC 4ZYZA 1H85A 1KOGA 1TUEA 2EHDA 4RSHA 2NPFA 3CUVA 4B33A 3BWCA 8ICXA 1U8EA 1XLVA 2ZQ5A 1HT3A 3BZKA 1R4MB 3LC2O 5JDCA 4HQNA 3H8MA 2YWXA 1FO4A 1C3EA 3IVRA 4W7SA 1ZZGA 2ZTMA 4F2HA 1QMPA 4HRAA 4LJ9A 2JBAA 2NXEA 1JYSA 2P2GA 4IY1A 5DISB 3RARA 1Q7GA 2HGSA 4CU5A 2P2YA 2PLAA 2OA0A 5BSUA 3E9DA 2ZPTX 4C7OA 4EKDA 3UZUA 1NATA 3D4NA 1OUQA 1RRFA 4F0JA 1XAHA 4DCJA 5EGNA 1VGVA 1G4UR 1TPZA 2AD1A 2D1TA 2QT9A 2R8PA 3MS4A 5J0QA 2P27A 1WB4A 4L8GA 4MTCA 4AJ4A 3UPUA 4PS0A 4DXHA 1V35A 1PUZA 2DWQA 2G9NA 1YA4A 1YQDA 2FFJA 2XUAA 3DOIA 5DTRA 5E6SB 1MRZA 3EF1A 5IAEA 3DEJA 5AI5A 1M76A 5IJ0A 4I7EA 1I6MA 3WNVA 2GCOB 4D9BA 2PKCA 2E1FA 1JIUA 2EV9A 3MJDA 3ZS9A 1Q7EA 2YXLA 4NNOA 1N33B 1VJ5A 3R3HA 4KQXA 5KNCD 4FNAA 5AESA 1I1OA 4EYOA 2Q2WA 2FR8A 3OZTA 4LOKA 4OQXA 1Z5GA 3EODA 5B7QA 2GBLA 5BN3B 4LFBB 2MSNA 1ZD5A 1U9IC 3E4CA 4XCVA 3CKKA 1KAOA 5KT4A 1SQGA 2QZZA 2ZUEA 1ZNYA 4FFRA 2X2OA 4DLTA 3E23A 4Q7MB 5IM5A 1LPOA 1BE0A 1USIA 1HZZC 2ODWA 3QOXA 1RKXA 2RDMA 2VAVA 3O4FA 3IBFA 1F7UA 3JCZA 1L4UA 3MFHA 1XDGA 3HDHA 2V4QA 2SCUA 1KP2A 1UZMA 4HNTA 4DDWA 1BH6A 3PVXA 4M1QA 2EQYA 1LLQA 4PPGA 5ALPA 1IK6A 3RBZA 5HGXA 2J30A 2JBHA 2UYYA 3H6HA 4JNCA 3UCFA 3WMEA 2FN3A 3NC0C 2FRDC 3ASYA 4BRWA 5L3VA 3AF2A 3U0VA 2H2AA 4MSUA 1P2UA 4RPJA 3U7QB 1H1DA 1R3DA 1U3VA 1NTRA 3EGXA 4B76A 4GKJB 1ZUNA 2RJ3A 1NQTA 4W1PA 4MR8B 3Q2KA 2QEQA 1KSJA 1L5FA 3OX2A 3L1IA 2Z98A 4MW1A 5KNBA 4H7IA 1KXZA 3EDQA 3ZBUA 5KX5F 2Z8XA 2YXNA 2TMGA 3ZHTA 1JEYA 1L4GA 2I4LA 2VSXA 2M6RA 3MT0A 4JGBA 1YFKA 1Y7IA 4M0LA 5AVKA 3V8PA 2B37A 1IZYA 1ZHHA 4JI4B 3SKVA 3MJSA 4C0WA 2AI1A 2C95A 2E5FA 4A23A 3SG0A 1AROP 3J7AC 5CFZA 4PXYA 1OI3A 4E7OA 1ZXXA 5B36A 1T5BA 1WXHA 3BDPA 2V74B 4KN9S 4O33A 5KSOA 2JEFA 3D5QA 1P5RA 2Y0DA 2V0NA 2WTMA 1WPRA 1ZQYA 3O0FA 3A9WA 3P71T 4IOJA 5I3ZA 5HRCA 2J9YB 4GLFA 1DKQA 4EQZA 4DDMA 4H17A 4FZJA 4EHHA 3B1ZA 3B3QA 1FFWA 4ZZIA 2QX8A 1S6YA 2W7TA 5CIWA 1CUDA 4LJKA 5A3VA 3VKFA 1UWCA 3DA8A 1QCCA 1D2EA 1ATIA 1EFVA 1E3DA 2IU4A 5DYTA 4BU0A 4L4YA 4NFLA 5KOHA 3TIIA 4U6PA 2J41A 2CF6A 3VKVA 1FNMA 1NBMD 3OMWA 2CE7A 5K5EA 1L4BA 4FTWA 5F73A 5CDGA 5F9NA 4N6NA 2VLBA 2ZYGA 4IRCA 3I73A 4BLSA 5BXQC 3GLKA 2BGRA 1W0KA 4YC7A 2C0CA 3CW9A 4LY0A 2N1RA 4KVZA 1SG9A 4BUZA 2UZ0A 4YIHA 1DLJA 4ETMA 4QLAA 4UBNA 3B1VA 3WGNA 5JNVA 2R5FA 1HQCA 4PAOA 3B38A 3JQAD 4U2GA 1G7TA 1G7SA 2JG3A 4V0KA 4WDQA 5K4HA 5YASA 1R0KA 3BWMA 1AD2A 4E2XA 2EJWA 3QU2A 3U26A 5IABA 1P5HA 2Y1EA 1DC7A 1DQYA 3J81A 4HCJA 1KF0A 3CH4B 1PYGA 1J1UA 5IT9A 1MJGM 1YVEI 1WCYA 1OTYA 1EVKA 4NCIA 1UBOS 4EEXA 1S5LU 3FOZA 1G9TA 1UUFA 4UTPA 3LGXA 4FB4A 3HL4A 1MFZA 4YFKA 1E2KA 2G80A 4OGWA 2RAPA 1A82A 2GO1A 5EJ8A 1WHTA 2Y4NA 5AW6A 2VC2B 1BDHA 5L7YA 1SVSA 2OAQ1 4ZCIA 1DWPA 2KSQA 4UEWA 5JNRA 4D9IA 2D7JA 3QFSA 5EIXA 3L7AA 3CQ9A 5GZ6A 5D6NA 5CFRA 4B3MB 1E96A 4JITA 3SLGA 4RGBA 2EU8A 1FMLA 1PJBA 1AQLA 3X44A 4CT4B 1EFAA 2K4HA 2P62A 1DIAA 5EXXA 2HMTA 4RIFA 1S2MA 1FS6A 2Q5JA 2C4WA 2BDTA 5AUPB 4H16A 1V41E 1U8AA 2EAPA 2CDCA 3WWZA 4I4LA 4ZKDA 5KFRA 5BN4A 2NVUA 4FVTA 3V4FA 1Z18A 4ZGBA 3PMNA 4EDHA 4PHEA 3U17A 4A92A 4LZWA 2AFHB 2XA1A 4QNNA 2R84A 4EJMA 4QGFA 5IJWA 1U0FA 4BMPB 2WB1C 4EAAA 2B4QA 1L4EA 2JFWA 2PAAA 1IY2A 2VHZA 1JAZA 2BCGY 4LC0A 5JNSA 1GYQA 4RFLA 4F1KA 2GK3A 1Q83A 2I7VA 4UUPA 1XTVA 4N3CA 4EYIB 4HAWA 1GTJ1 2R7NA 2K8AA 3IV7A 4DIUA 3KQVA 4E31A 5TDHA 4RUKA 1HSZA 2IYEA 2LCFA 2GD2A 2PS9A 1YOVB 2PKRA 3UJNA 3UPTA 1CHDA 5CP2A 1XKXA 4HB0A 1ZQ1C 1ZQKA 2ZXIA 1XTRA 2CKMA 3E9QA 2WYIA 4QYWA 1H2RS 1ZJ6A 2IH4A 1RWXA 4PGXA 3DQZA 1AXRA 1Y5RA 3OECA 4QPJC 2CXRA 2P77A 3BREA 4Q1AA 5T6MA 4MR9A 1JPJA 1LPMA 1O1YA 2E0IA 2OHIA 2I4IA 2NVOA 5FOWA 3TAXA 3PI6A 4PH5A 2DSNA 2ZU0C 4MIYA 3H9CA 1WSDA 1U94A 5G5GA 1PK1B 2O5CA 4IRDA 1DL5A 1NRIA 3T8YA 1TEVA 1Z6YA 3ESYA 3GAFA 2TMYA 3WXBA 1DEAA 3ZGYA 1M2VA 1A7UA 3AF1A 1L5ZA 3L77A 3VA7A 3ZY5A 4EW6A 2PYZA 2B1IA 1KH3A 1VG9B 4FR0A 3KS9A 5KNBD 5BNWA 1A5TA 4XM2A 1U3UA 2ZJ1A 3DQPA 4DQRA 2QLTA 1KJYA 4OU4A 2EIHA 5JEDA 1HFEL 3AF5A 1LU9A 4F5EA 3GLSA 3HWWA 1OTHA 2JHDA 2VNAA 3PX0A 3I0NA 3E9MA 3T38A 1SUDA 3LNTA 3ONNA 1VL1A 1XWWA 1HA3A 3CR3C 1L8LA 1CRQA 4S1TA 3SNKA 2ZIZA 3GFFA 3L02A 1UKAA 3CG0A 5FNZA 4EGJA 3REFA 4AI6A 3VHXA 2D8MA 1JLMA 4JX9A 2YV2A 3HVHA 4U6NA 3IMEA 3W2EA 3PD0A 2FZWA 2QXTA 4KOEC 3T5JA 2OHGA 1UFOA 4URVR 3A3PA 2XADA 3L7DA 3OEWA 2GO7A 1NYLA 2W4IA 3G2NA 2P9EA 3Q9NA 4NU6A 3SEQA 3W3AD 5B55A 4D3FA 4NE2A 2HIMA 1AQUA 3TKYA 2JRCA 3MELA 3BSFA 4RTOA 2JW5A 5HKKD 3IFSA 1EBFA 5P21A 4RSMA 4JIGA 1KI2A 2JZBA 4YMSA 3OP4A 5AJYA 1O89A 3H3XA 2Q5HA 3N8IA 2CNOA 2PZGA 4GEKA 4IDDA 4W4TA 2JFNA 2PWYA 2VJDA 2ZE8A 5KT7A 4N82A 3T7RA 5KYWA 4DSKA 1RQ7A 3HKDB 1W4AA 4HZIA 3HYLA 4JUIA 5JQGA 5M34A 1P7WA 3AX6A 5ALTA 5K3FB 3FDJA 3L8HA 4F06A 2ZJYA 2WSIA 4GL4A 3LOPA 2UZIR 4FHGA 1MD9A 2GCNA 5DBCA 4ECRA 4ZVTA 1SUEA 1VKJA 3PXXA 1POXA 2GAFA 2OL4A 3HKBA 3A9RA 5CA0B 4IJVA 2WF7A 1CDOA 1JAHA 1WP4A 2P6MA 1PX0A 3JVDA 3W4JA 1LCIA 3WSTA 3OFKA 3U3MA 1ZJZA 5T4BA 3AL2A 3D3NA 2IP4A 2VTEA 4DR4B 3KSZO 1UEIA 1VPTA 1DRKA 3BWVA 3ETHA 4G4GA 3EG9B 2DU8A 5SYAA 4ACOA 4QUJA 1C3LA 4WK4B 3MNFA 1X7YA 4MPPA 5JZOA 2V6GA 4ND6A 5F4BA 4UATA 3AZOA 4EBFA 1FIQA 3ACBA 1C9EA 2XMBA 3L7BA 4R41A 3V4LA 1U90A 3KP1A 4D43A 2VTBA 1PFYA 2KYRA 4DSLA 1S0UA 1WOMA 3EXFB 4BQOA 4H08A 5K8LA 3V1TC 3KHUA 2AC4A 1JHVA 2WA2A 3AEQA 3WWYA 1TOAA 4A5SA 6CHYA 1DVRA 3BXHA 4Y6QA 1Y9DA 1ZY2A 5HKLA 1KU6A 2BD0A 2HMXA 3HKCA 1KJJA 2A0XA 3FHCB 5JO0A 1RZ3A 1ZCFA 4R81A 3CBQA 1VJTA 3BC1A 3RS3A 4LI3X 3E1KA 4B9EA 3PC7A 5LXTF 1VECA 1Q1GA 2FFAA 3ADOA 1BKYA 1O58A 3K0BA 4Q4AB 1Y0BA 1APBA 2ODNA 3T5LA 1EGVB 2C9MA 1GG5A 4BVKA 5D5QA 2EHJA 5AT1A 1RHQA 3MAGA 2DTDA 3LLUA 1DIRA 3RVMA 2XZDA 3BEOA 2VZ9A 3WRYA 4BTLA 3DC7A 4MI3A 1MB2A 1YE3A 4EMSA 1AKMA 4K81B 5DWQA 2D0PB 4YRDA 5FNVF 2J67A 1T15A 3AY3A 3PHCA 1K9SA 3PZRA 3BXFA 4X91A 2QV7A 3S3TA 3W4KA 3RAGA 4EVSA 3WWCA 5IKXA 2P65A 4ZVRA 3DP7A 2HOQA 1DIGA 1P2SA 2OO5A 4BFYA 5BRJA 1URPA 2WTFA 1MRNA 2JASA 4PXAA 3FJOA 5K8IA 1O6CA 2OORC 5AKHA 4P0PA 2V4UA 2XDQA 3HACA 1JQDA 4FONA 4YFYA 1IY9A 3SF8B 4DANA 4EG7A 4GDFA 2H1CA 3ZQ4A 2PMBA 1MMFB 3SJZA 5JAUA 1NFRA 3A2NA 1OI7A 1XK6A 4Y7CA 4AKIA 4J0IA 4J0JA 3WBKA 3OLQA 5FHRA 2AJDA 3RB3A 4M9XA 4UREA 3FUXA 1E1CA 3P4UA 1GUAA 2XTJA 3BDVA 2QG9A 4QEZA 4P3OA 2NZ2A 2V3WA 4DREA 1TMOA 4R68A 5KUTA 1INLA 1KEVA 4BWYA 1M3SA 1Y1PA 3ISDA 2J08A 3A11A 1T2DA 2I65A 3C1OA 2W9BB 1G1MA 2FQXA 5SZJA 1RQNA 1M8PA 4XB2A 1B76A 4GQBA 3EZXA 1J9ZA 5K03A 3AEVA 4DUZB 3D1JA 1CDZA 3PQ2A 1U2SA 4OEHA 3SX4A 2PKYX 3PJRA 4UCWA 3MPUA 4CM8B 3HDVA 2I34A 3L6BA 1NK8A 1U65A 2JBWA 4NZ9A 4EELA 5CT6A 2L82A 5CYFA 5FWNA 4FDVA 3VPXA 5JXGA 4OD0A 2VSFA 4Y9RA 5BWLA 1V85A 2VF2A 2JGLA 4KTVE 1ZD4A 2VBIA 5F35A 5FOXA 1IOZA 1OAAA 1TUIA 2HYIC 2HF9A 3LGAA 1JRPA 4OCZA 4RQBA 3BKWA 1NK7A 2RE8A 2CC2A 5A4FS 3DEIA 3VR2D 4C0JA 2NV6A 3CZ4A 2QM7A 3N9IA 2F76X 4Y2RA 2R11A 1T9ZA 4DL9A 4DA9A 4J76A 1XZBA 3AL3A 3ENWA 3FD8A 1PS8A 5CB6A 2B3DA 2NNWB 2VSOA 2XC9A 3TLGA 1PJAA 2CDRA 1XZPA 4PZ0A 4EAQA 4GT1A 4HJXA 1SPBS 3M5PA 2JMGA 4LA4A 3TDKA 2O20A 1A2KC 2I1VB 3EUWA 3RSGA 1U7UA 3FDXA 3KJNA 3LVRE 3LZDA 4RL4A 5E9QA 3O8OA 2GZRA 3ZN2A 1FDTA 1W0CA 4WFIA 1TCBA 2QD1A 4UHEA 4F9TA 3E2MA 2HCBA 2YASA 2JZCA 5DX8A 4F5OA 1L3CA 2XCLA 3IDOA 1LTQA 3LDHA 3WB2A 2GCOA 1GFZA 4PE5B 4CMEC 2QX7A 2IU0A 4H1WA 4B3GA 3HYNA 1FJ2A 5FWDA 3T3EA 1F8FA 3PC3A 4I50F 1FU7A 1UOPA 2HA3A 1GGHA 3JAKB 2H06A 2ORED 3NHUA 421PA 5JECA 3N6RA 1Q1NA 3K2BA 4W5NA 3KTFA 4NC9A 1ZGAA 5ESXA 1NL3A 4ZU3A 4BKRA 3ZE1B 3VVMA 1HE5A 3NVWA 4HS4A 2YV3A 4JLSA 4WKPA 2OWEA 4N0QA 4WNYA 2WINI 4BJHB 2O8BA 1CZKA 2VTKA 4HH3C 4BLVA 5L1KA 1N8SA 2RHDA 4CMEA 3EPIA 1JQ5A 2FWAA 4ETNA 2CXHA 4NLZA 2COKA 3QSYA 3ND7A 1R6AA 4F5NA 1EQ2A 3LK9A 4FFLA 3AB3A 1G60A 5BQPA 1JH8A 2XQFA 3Q8KA 2L19A 2NTVA 3B13B 2BEKA 4MCJA 4FX2A 3GRPA 4WXMA 3KKAA 5A4JA 2OSBA 5AO9A 5FWYA 4YQFA 5MHTA 4TMKA 4JJ8A 1V0JA 1X0XA 4ZAGA 3FH0A 4LXYA 3LGSA 1Z5PA 3U7QA 3OY7A 5C1PA 8ATCA 1AVTA 2XMQA 1GG8A 3QYFA 4WW0A 1AUXA 1FF9A 2QF7A 4JI8B 4O1IA 2EC5A 1BCSA 4X6YA 2X42A 5F23A 2OGUA 4IIFA 1E59A 2A5JA 3P2IA 3VNQA 3BQMB 1ZONA 3R3WA 4R2MA 5IUNC 3BVPA 5FLKA 5KSZA 5FORA 5E3JA 5DGAA 4QWMA 4C0XA 4DUYB 3FKSD 3E8SA 3UKOA 3KG2A 5K3CA 5K4GA 3P2MA 2QSYA 3A0BU 2VLIA 2BMFA 1DQNA 5KFVA 3BWYA 5U4XA 1YB7A 3GG9A 4EY4A 4IMJB 3HTXA 1OGIA 2ATEA 5FJIA 3EZ2A 1OXUA 2WF5A 4L3OA 4HG2A 5EMNA 4LVOA 1XR3A 3NB0A 3HNOA 1NY5A 1W88A 5F3DA 2GN6A 3DJFA 2I2DA 2XGSA 3IG5A 2IELA 2IS1A 4INZA 4IGIA 1EGAA 4MMZB 4DS4A 7ICNA 1VHJA 2Z2XA 5ALJA 1A8QA 1G20E 1Z6ZA 2PA3A 2ZBQA 1BMFD 1J2RA 2X3YA 2XNDD 3ANSA 1XRNA 4OXXA 5EIAA 3RFFA 3ZJUA 1NVVQ 2QR5A 1JKFA 3HWRA 1DQZA 1EFKA 3MTDA 1N6LA 1FZQA 2D2XA 2Q46A 3KQYA 1R6UA 4K26A 3TRDA 1YA6A 3IPRA 3CGGA 1KTIA 5C8XA 4UTXA 2YBEA 1UXOA 4E7PA 4B2IA 1I24A 3S44A 2VDWA 3T7JA 2ZWIA 1A5SB 4JVMA 3U49A 4BX2A 1JSXA 1H4QA 2JNWA 3QQPA 2CVHA 1USGA 4ZOLF 2JS7A 4Z9BA 1KL7A 3GGPA 3QUBA 4GRAA 5BWOA 2D5IA 3WYEA 4AMVA 3R5XA 4KQIA 4TKZA 2Z2YA 1C0EA 2HHLA 3CNQS 3TG8A 1SO8A 2FMFA 3KETA 3ZYZA 3PPIA 1K5GA 5FOQA 3U44B 4I1VA 4JT9A 2QRKA 5JFOA 5E1BA 2BBWA 4LTMA 2AOTB 1Q21A 4F5WA 1DX6A 4OFZA 1ZGZA 2BBOA 3PUYA 1R00A 3D0QA 1K88A 2I8LA 5EKSA 3CB2A 2G04A 2C2BA 4Q7QA 5JH7A 4GPBA 2V7UA 1X7ZB 3ST7A 2A1TR 4LOIA 1U0OC 1K9VF 3SS7X 5B6PA 2G09A 1F7VA 1QF6A 4FBTA 1GEEA 3GD5A 1JGTA 1LPSA 2BJWA 5C8YA 1TKCA 2JCXA 3GEBA 1PUIA 3QUQA 5JD4A 3PTLA 2O3UA 3F3MA 4ID3A 3TOVA 2X8JA 3QWIA 3L6DA 3OCZA 4P3PA 5CFPA 2OKCA 5E4YA 3RTCA 4L28A 3CY6A 1F8GA 2O8DB 1SZPA 1E77A 1ZXBA 3GJQA 3ZBPA 4NMHA 2HWYA 1GKLA 1U48A 4YN3A 1HTTA 1SUIA 2LIVA 3U3XA 2WD7B 4YMIA 4DL6A 3EFHA 5J0OA 1JDUA 4B9SA 2X5OA 1KJIA 2ODEA 2WR8A 3PC6A 5L6LB 2OEHA 3JWEA 3O4IA 5COBA 1MNQA 2I5PO 3M6UA 5KFMA 3HP4A 5AKLA 1XJ0A 1CV2A 3FBTA 4DQDA 2O3TA 2NO6A 1V7CA 3NT2A 4P4NA 5J43A 4JUCA 4R2HA 1KDVA 2ECFA 3HUTA 3MRSA 4X45A 4EHDA 1Z4KA 1DIOB 1ZK0A 4EA6A 5BPFA 2FZ5A 3PFWO 4YMHA 5D01A 1Y37A 2IQ5A 1PD0A 1O8CA 4HJRA 4O9MA 1QBGA 2YYZA 1GEGA 2YWFA 1NDQA 3AUAA 4DXDA 9ICRA 2X6TA 1KZ7B 2NO5A 3W1WA 3WYDA 2MRLA 1QO7A 2XY4A 3CPHA 1KR2A 3G2OA 4QUAA 3R44A 5TS2A 3ZHZA 1QIKA 4EHLA 1BRTA 1CQPA 1CUEA 1WAMA 3WWDA 4DRXB 1PWYE 2Y77A 4DIKA 3LZCA 5A6VA 2QZPA 1TF2A 5BN5A 3ER8A 2KEYA 1S2GA 1AG9A 1M7BA 1IONA 2WU0A 1N6NA 2BR4A 3ENZA 4LZLA 4RMIA 3PVCA 4WJKB 2G25A 4JJZA 1T5IA 3ZE7A 3GFOA 3RTEA 4XFDA 3T7AA 5G0SA 4YRZA 3H84A 3RVPA 1JG7A 1KN5A 7ICSA 1CY6A 3ZXYA 1JFSA 5DO9A 5KHAA 2XT0A 3FJYA 1KW4A 2SKEA 1PJ8A 1TA0A 1C5KA 2ISSD 3TPZA 4ZRDA 7ADHA 1T9AA 1ZQBA 7ICFA 4XR4A 1ULAA 3K6JA 3ZWWA 4LHWA 4BVAA 3W2GA 5HQJA 5JS8A 1FZTA 4OBXA 4LS3A 1I01A 3KZMA 2Z57A 4TRJA 3R6LA 5CT4A 4E11A 5DCLA 1JALA 1E1QD 1XQ6A 4MF2A 3OKCA 5JWRA 1SOMA 3CLRC 2BGUA 3PQFA 1SULA 3OZCA 4YDQA 2CLFB 2ZS9A 2QTBA 3HXLA 2CJXA 5EP1A 4BCBA 1I36A 1XYYA 4A16A 4Q15A 3EXEB 1FYVA 7REQA 2VBFA 4CN8A 3RDPA 5DE3A 4AZSA 2DWCA 2D1SA 3FFWA 2HJRA 3ZY3A 5EWMB 3F73A 4CIYA 7ICMA 4GSKA 1U2DA 2PT5A 3ZY6A 1PWHA 3UK1A 3G85A 1J5XA 3B52X 4UULA 1IY8A 3OOSA 4A8EA 2FWIA 4XPZA 4MUBA 2XNDA 4REOA 4X8MA 3SIRA 3W0LB 2XXJA 4CCWA 2FSIA 3QVWA 2JGAA 3RUAA 3TFQA 3LBFA 4DRYA 5FPPA 1R37A 3ICPA 3I6BA 4XYMA 2KS6A 3KKKA 2ODAA 1ZJYA 1MV8A 3WMGA 1O08A 2QM0A 3GUHA 3NTQA 4UXJA 2QXUA 3I05A 5K3FA 5KTOA 1DRJA 5F77A 1KRXA 4GDMA 1FX1A 4RAQA 5J1TB 5L3QA 2BZFA 4JI3B 4WKCA 1SWWA 2ZT7A 3M8KA 2W9AA 1DAHA 2J4FA 2FDXA 5JVDA 4L3VA 3V5NA 3AW9A 3OJSA 2VH5R 1QHYA 4QYTA 2XDAA 3NBAA 1YZHA 4CKWA 3DZIA 3SV3A 1SZHA 4QZ9A 4FFBB 3GVXA 1Q19A 2R2GA 3PA6A 4D79A 3FTEA 1P0IA 3HRHA 2CHFA 3LRTA 4XPIA 4QIWF 2LNDA 1GGFA 1EZ4A 2EWVA 4ZEMA 5KWVA 2D7CA 1FS5A 4TWAA 3PC4A 5CM2Z 5REQA 5L3ZA 3GFVA 1YB5A 4IP0A 2YIMA 2QYOA 2F9LA 1WZIA 3Q7TA 4I46A 1J2TA 2H2GA 3LFTA 4HO1X 5EPOA 1SBHA 4K9OA 1EXMA 2H3IA 1Y5NA 1K7FB 1RRVA 1TVCA 1SBQA 2PBZA 3H5VA 4NMLA 3LHSA 1S9DA 1TZ2A 1Z74A 4G5FA 1WPXA 3PXCX 1AJEA 4KE6A 3NIWA 4RHTA 4ZQFA 5HMLA 3S5UA 2ZTSA 3RVSA 4NECA 2EKLA 1XDBA 1OX4B 1O95A 4CTNA 2EERA 2DHDA 4M9ZA 1U7OA 4J75A 4OQNA 4HQKA 1ZINA 3PRHA 5FWAA 1QLHA 2P67A 2RRDA 3A9TA 3I09A 3K05A 1OA1A 2EJCA 5K6TA 1YJ5A 2JFQA 3L1JA 3LCCA 4NDAA 4KREA 1LRKA 4Z8YA 4MYSA 4JLJA 5BW4A 5IZCC 1CY7A 5J2HA 4DSJA 4RDIA 1H65A 1P81A 4CIXA 4DMRA 3WMXA 1C7EA 4ALKA 2R6DA 1T5OA 2VHXA 4K05A 1M2OA 4BP8A 4UAZA 1X7DA 4LCJA 3WRWA 1YHYA 2VN8A 4NFSA 4EATA 2UZ1B 3F67A 3M4JA 3GYGA 2HK9A 2BTEA 2E55A 1C8VB 2JIZA 3FWYA 3UJ9A 2EFHB 4Y2YA 2BC9A 5E3HA 3RSSA 1X87A 1R0CA 5TQ2A 4GM4A 1GPAA 1MAHA 4FNGA 4BB6A 5AVYA 4DWOA 1NJ2A 1JR4A 1OX6A 4P35A 5DLQC 4EFDA 2XDQB 1JV2B 3R23A 5AI4A 1YJBA 1Z2DA 4TLBA 5AK4A 2MA1A 4F5ZA 1MO4A 3A1NA 1EAMA 1AUQA 1RBMA 5DLDA 3RAXA 3QBVA 3ELDA 4JLNA 1J39A 1Z35A 1WKBA 3AP1A 4M7OA 2XF8A 1KY5A 2F9MA 3HJHA 1LX6A 1I3MA 3HKZF 1U1DA 3K75D 2GNPA 2HNAA 1PGOA 5DPMA 4QREA 1L5SA 4PICA 5IJZA 5HRUA 3HFSA 2CXTA 1RLTA 3ZI4A 4N0PA 2DKOA 4JGIA 3T94A 5CH3A 2DUYA 5LU9A 2ZZMA 5FUBA 2ODBA 5C53B 1JF8A 1FUEA 1P4RA 2Y71A 5B2ZA 3TZQA 3DE4X 2EVWX 5EQJB 8GPBA 1V4VA 4DOBA 1TRHA 2EW8A 3FVTA 3TSCA 2VXBA 3TOZA 1QVWA 1DTEA 3E22B 1YZVA 2PLRA 4IIJF 4BAZA 2X13A 1JPNA 1KYYA 4TS3A 1LBQA 2BTOA 5C1DA 1SVOA 1SCUA 1KC3A 4ZI2A 4YEDA 1ZOSA 4WXYB 3WYFA 3L3FX 2JLWA 3B51X 5KNCA 5A1JA 4UBCA 4CKZA 4OL0A 1SC4A 4HP8A 4DNOA 2M0NA 5CD1A 2JCGA 2Q9BA 3UCXA 5K0EA 2JB9A 4HB4A 1UQUA 2GJ9A 3KSDO 4QAQA 3VTAA 3WNDA 4CKYA 5KZMB 4MF8A 4ZOQI 3U9TA 2R96A 3TDNA 4LSMA 1K7CA 4IWYA 4JOBA 3D8RA 3WK9A 2DQYA 5JATA 3MBKA 3F5MA 1ZQPA 1R4MA 2WWRA 1Q7BA 2G9ZA 3MN1A 4KQ9A 1KEZA 4XRRA 3T5BA 4FZMA 4ER3A 5LXTB 1OBHA 1EBBA 2AGVA 3RRNA 2D54A 3QVTA 2IXDA 2J0UB 5CJJA 5JRTA 1WQ1R 4LW8A 4ND5A 3P45A 3C7KA 3W2IA 4RLSA 1CUHA 3CYFA 4Y7DA 2VDUE 3TNLA 2VHUA 3C41J 2WYHA 4W1RA 4E21A 2YZGA 4DLPA 4LWPA 4B9UA 4E3ZA 3IQHX 1YONA 1NP3A 2ZJ3A 5GM2A 2QRVB 1Z8DA 2R62A 2RAVA 4G1UC 2WWWA 4G1EB 5EE1A 3PCXA 3PPWA 4JQSA 1QGYA 4MCAA 4OK6A 5K2MA 1BDMA 1GTZA 4RKEA 3SICE 2XT9A 3RC3A 1I4DD 2HPZA 4EFNA 4USAA 2KJ9A 5K0SA 1HWYA 1RZRA 1PQYA 2C5FA 4AS3A 4BMOB 5TMBA 4F72A 1B0UA 1VYUA 5AIAA 1NVGA 1U0HC 1ONPA 1Z0DA 1Z5VA 2IF2A 4HC4A 4NU8X 2RHMA 2VSQA 1I4LD 4BCDA 1CYEA 2G28A 1UC4B 3AKDA 4TL9A 1GV1A 4ZOLA 3BJMA 3MDAA 4EABA 9ICJA 3SJCA 4BJ5A 4C0QC 4EJ6A 1CUIA 4JJ6A 1O6GA 1A8UA 1YWGO 3EC7A 4KQFA 4OXKA 4PSDA 1WJGA 1X9HA 3MZ0A 1G20B 2UVWA 5EA2A 3WB9A 2DECA 2C3UA 5FWYB 1ZI9A 4D92A 4AKEA 1VE1A 4MRMA 4UAYA 5JR3A 1U8UA 1Q1ZA 1JX4A 2B7CA 4W1QA 4DMKA 4I1OA 5CB4F 3VH1A 4QLOA 2WABA 3FX2A 5E7JA 1DO2A 3DLPX 1NUTA 4K1LA 4MRAA 3ZHXA 1IRXA 1M54A 3GUCA 1AKYA 3LDFA 3KKAC 2Y0SC 1ST3A 3KYCB 3SZUA 5AR1A 3CW8X 3OMXA 4RK0A 1Q1BA 3IEKA 2DLNA 4CM5A 3PJEA 4LGMA 3RSOA 4KMSA 4AIRA 2P6PA 2J8ZA 1N75A 3IKVA 2Q3FA 3EBPA 5K3OA 4ZTUB 4Y9TA 4Z7QB 1SD1A 1RM4A 2MINA 3M4NA 4O4HF 3RYHB 4C07A 1EK2A 3R9WA 4OUDB 4WCVA 4AUMA 1RWKA 3AQFA 4BNZA 7YASA 2M6KA 1ISJA 1I7NA 3B20A 1JSLA 3QYAA 3UJPA 3VKGA 3FCOA 4ZT5A 2QARB 2NO9A 3HP7A 4MRNA 2HV8A 3MT8A 3TD6A 3UMJA 4US1R 3X1XA 5HPYB 4KIJA 2RHFA 1NXWA 2C00A 3RSHA 4UOZA 4HAXA 3RLFA 1MQ2A 3SEAA 3DL4A 4R0NA 3VYRB 5A06A 2ES4A 2ZBDA 4ZCPA 2F43B 4WOPA 2VAWA 1KDPA 4GLBA 2ET6A 2H0RA 1KGDA 2HA4A 4ZQGA 3UK2A 4M0PA 3RFCA 1KEPA 1PR0A 2E48A 4HDSA 1S2DA 1HUOA 2Z56A 5IKMA 3VYSB 2YWJA 3UHPA 1G55A 3NUQA 5G41A 2P3OA 2E1RA 3A6JA 5D86A 1L5GB 1HE3A 4J9LA 2EOAA 4NJOA 4EKYA 1NU8A 3H8SA 1QYDA 1TAGA 1W93A 1SBTA 5JMOA 4Q3CA 1ZLYA 3JZMA 4GSYA 2FTKE 3O0DA 2JEGA 3FBWA 2CD9A 1Y7PA 2DR3A 3KT8A 2VPTA 2OCYC 1C3OB 3MERA 5CNKA 2ZVQX 1KEWA 4HEA6 5CDFE 1UIRA 3KXDA 3G2IA 4L5BA 1E3WB 3W8FA 5HR5A 1BHQ1 4KQEA 5KYTA 4U2KA 1PVVA 1NX9A 3DTVB 4JJ4A 3V6MA 5EWLB 4B32A 1W36D 5AVQA 4E94A 3EIWA 5IZ4A 4LGVA 1B16A 1D9XA 3NVZA 3U1VA 1X7ZA 3DV0B 3Q3IA 3VJLA 5B2FA 1YZKA 2WB4A 1B3RA 4GMKA 4PL2A 1PDVA 2D1YA 3SR4A 2GHQA 5DNEA 4IJUA 3AU2A 4PO1A 3PUWA 3T4XA 1MC1A 4ZPJA 1ZXIA 1MB3A 2QW0X 3W90A 4H60A 2WLSA 3WAKA 1ZM3A 4KAXA 5GGXA 5CLFA 3M4ZA 1TT7A 2OCDA 2YMMA 1KMCA 1WA5A 2X23A 2X6QA 2YW9A 2GNAA 3H2JA 3EG9A 5AI0A 4ECZA 1MQ8B 2R8EA 3IIEA 4KPUA 2JH3A 3ITDA 3SHFA 4L9SA 3GGCA 1JSRA 1FK8A 3WADA 1PFUA 3AVYA 1TCUA 2PFGA 5A2QA 1GNPA 1FBTA 1R10A 4YAEA 3R0JA 2HLNA 4Q9AA 2DZDA 1WP9A 2QGFA 3I5AA 1T4GA 3WB0A 1EFUA 1TYZA 4YPOA 4P0QB 1N48A 3CC8A 1YT5A 4FN5A 4W5HA 3CUUA 2W83A 4BFWA 8MHTA 4WTOA 3PLRA 3T6KA 3P32A 1RWQA 3ECSA 3W8EA 5E6RA 3UK7A 3NDIA 2ZI6A 3X1WA 5HZHA 3F5FA 4MAFA 1Z28A 2AQKA 3LT2A 1UDRA 1YVUA 2F48A 2QZ9A 2A33A 1E4OA 1QLJA 4L02A 4L4SA 1MVOA 1PNTA 2RI1A 1Z5OA 4NL4H 2RHHA 2R8OA 5T8KC 4AROA 1FW6A 4WMLA 3NHKA 1FFSA 4YG2A 3AI1A 4JLWA 2G71A 3OZXA 4JNKA 1T9GR 5FTMA 3EZFA 3W7BA 1OILA 4MHSA 1OFUX 3H4IA 4XLLA 2OD7A 2PVCA 4TUQA 3DDZX 2F8LA 3B6KA 5A7FA 1GHTA 3G2QA 3MSCA 5J0RA 1YIDA 5DHRA 4FYXA 5IYZA 3PE3A 1JROA 1AXGA 1O87A 1OFHA 1P2DA 5EE0A 1XXHA 2C88A 2FUKA 3GLQA 3KHTA 1ZQGA 4KGXA 1MVNA 1B8VA 4DPKA 1PVDA 4AWXA 2HA7A 5DG9A 4W82A 5DCYA 3PP8A 1EUCB 3ENNA 3KKNA 2V4RA 4RNCA 3C5VA 1M1YA 4C0SA 2R1TA 2GNOA 3H42B 1VKZA 3GH1A 3KQNA 3FPAA 1HORA 2OMEA 4EUHA 3QM1A 1ETHA 5KYGA 3D3EA 3O47A 1A76A 2B61A 1P45A 1ZJJA 2B82A 2EJVA 2XE4A 1V8ZA 2WG0A 3P27A 4DE5A 1FCJA 4F6RB 1RZRD 3DE3X 4J9QA 1H3FA 4HEQA 1J90A 4XIYA 4U2CA 4CR6A 1E5TA 3U56A 1P9OA 4JZKA 2WU3A 1AMUA 3V2UA 1KI1A 4HQRA 1KO5A 2B83A 2IDZA 3KFLA 2O0LA 3GI1A 4DZRA 5IVHA 1XSNA 2V1XA 1RPLA 2JATA 2W71A 5FDFA 4G5XA 1N2CB 3OM8A 2DBQA 4YCJA 1ISGA 1WDLA 1RJDA 1XU9A 4GQAA 4DNXA 3I04M 3OUTA 3KYBA 5HIAA 5KWSA 4NMXB 1BMTA 2OCBA 3BMXA 3HA7A 3E81A 4XUGB 2QE6A 3UHAA 3A3YA 1T8EA 3EPLA 5ER9A 2E3TA 4DS5A 1W6RA 2QRLA 4OB8A 1YZ7A 4RACA 5ECDA 4ZAZA 3PQ5A 5LQDA 1H42A 3RYCA 2JHPA 4CKEB 4QARA 2L42A 1DZIA 1OB5A 3UHJA 1UOOA 1Z6TA 2F90A 4BEWA 2EWWA 1WUKS 4NK4A 3VHXB 1RBQA 3AP2A 3INGA 5KFJA 2JGDB 4J1SA 1NSYA 3GUVA 3SDSA 2LHTA 4G8CA 3GIKA 3SS8A 3T1VA 5I6DA 1XMJA 1L7VC 2ASEA 3LPNA 3NV7A 2YJ5A 1KMHA 2YRWA 2X0NA 2BPOA 4IIDA 4H7DA 5ES3A 1CETA 5D4BA 2X0EA 1BXGB 1QYIA 1DKPA 2BLNA 3CCFA 4EVQA 5A6SA 2B7BA 1G17A 1KYWA 3IG8A 1N92A 3H5LA 4UPVA 5TEVA 4GM0A 1Q7TA 4IQ0A 4PAQA 2PGIA 4CIAA 5AKJA 2ZB4A 4YCBA 2WKSA 1IHXA 4F4YA 4CKWB 2HHVA 4ALJA 1A97A 1VSBA 3ZW9A 3HVJA 2F3QA 4K6CA 2FGKA 4WESA 4D8TA 4V02A 1N7HA 4MR7A 5ARBA 4F2DA 3EF0A 4L0QA 1E5LA 4TPKA 2JJQA 4IEIA 5CA0A 3AFMA 4MWTA 1HX7A 2PO7A 5AW9A 4F9GA 3M9LA 1JJAA 2FYTA 3CF4G 1U9ZA 4PHGA 1XZ8A 4L08A 4CLHA 4D9NA 1VRVA 4F2PA 3GMSA 2XY6A 4IQWA 4O8CA 3R3VA 2NLOA 3VU9A 2OTCA 4ED2A 1SKUA 5CLHA 4JENA 4MDFA 1T4DA 1Y8CA 2PBRA 3JWHA 3JS5A 1JQBA 1Z1BA