1O08A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 1-phosphate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o08A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o08A01
3SKXA 1RMQA 1S8OA 1RKQA 4YCLA 2YBDA 2WF8A 2QYHA 3QLEA 3WK5A 5A3SA 5ALPA 3I1YA 3KC2A 4HGNA 4UMDA 4AS3A 3W5AA 4Y3UA 5AKGA 1TJ4A 2WM8A 4QJBA 3PGLA 4CNQA 4G9BA 2OM6A 4HGRA 2WF5A 1XPJA 4EEKA 2JGAA 1WR8A 1SWVA 4C4SA 5ALHA 4BNDB 3KBBA 4J2TA 3AR2A 4KX3A 1U2SA 3AR9A 2B1QA 3ZUPA 2QLTA 2HX1A 5ALSA 4H1WA 3AR8A 3AR6A 1N9KA 2DQSA 3FPSA 4Y2VA 4FE3A 4BNDA 5ALXA 3L8EA 5ALLA 3EF0A 1X42A 5AI0A 1PW5A 1L7NA 2HDOA 4UW9A 1ZD2P 2HF7A 2FPUA 5AI6A 4OFZA 1ZRMA 2G08A 1Z88A 5AVUA 5AM4A 1XVIA 4DW8A 1S2OA 5AKLA 2GMWA 2YMPA 1IWOA 5AW8A 3EWIA 4XOUA 4UMEA 2HOQA 2EATA 5AM2A 1Z4QA 2RARA 2BDUA 4KYTA 1NF2A 4OD0A 5A3RA 5ALVA 1RDFA 4UU0A 4I9FA 5A3QA 3ZVMA 3J7TA 4UATA 3OPXA 4C4TA 5ALRA 2YMQA 4UM7A 3TLMA 3ZWDA 2O2XA 5AW3A 4E88A 1EK1A 5AW4A 1RLTA 2C4NA 3UMGA 2P69A 5AM3A 1WPGA 5AVWA 4HGOA 3RFUA 3B9RA 1KYTA 2FI1A 3L0BA 4BKMA 3FM9A 1L6RA 3QGMA 4EELA 2EARA 2I7DA 2AMYA 3NIWA 3NALA 1NRWA 2WHEA 1TJ5A 4ZEXA 3U7FB 2JAWA 4F72A 1TA0A 1Z5GA 1QQ7A 3N07A 5ALQA 2B8EA 5AK6A 2RBKA 2HCFA 1YS9A 4Y2XA 5IT4A 2G1AA 3W5BA 5ALWA 2JAOA 3WKDA 4EX7A 2YJ6A 4AP9A 5AK4A 4Y2UA 4FYPA 5AESA 3OCYA 3DAOA 2Q4RA 2HSZA 3OTQA 5AM5A 3B9BA 5AHXA 4KX5A 3WK4A 1ZS9A 5IS2A 5ALZA 3OCZA 1Z4PX 3DDHA 4RETA 1AQ6A 2Q4TA 1QYIA 3PDWA 2YJ3A 3E58A 4UAVA 4PNHA 1L7PA 5E0OA 1RPZA 5AW0A 3SD7A 3MN1A 2W4MA 5AKEA 1N8NA 2D2VA 3ZVLA 2ZOSA 2ZBFA 3HLTA 4UARA 4YH1A 2C9MA 5AKZA 2CFRA 1ZJJA 3QUBA 1T5SA 1RLOA 2ZBGA 5AW9A 2GHTA 1VJ5A 4HGQA 4C4RA 4DWOA 2P27A 1ZRNA 4ZEWA 3SMVA 2C8LA 3OCVA 5AVZA 3U7EB 3I28A 3GYGA 3KZXA 1YDFA 3ED5A 4Y2SA 2R8ZA 3CNHA 3ET4A 4FFDA 2IOFK 2I33A 2EAUA 4G63A 3W5CA 3L7YA 3N28A 3AR3A 4I9GA 1SU4A 4UM5A 3NRJA 4HGPA 1Z4NA 1YNSA 4JDPA 3QU2A 3P96A 2FUCA 3R4CA 4MWOA 3NANA 4KNWA 3SKYA 4F71A 2G07A 2OBBA 1FEZA 5IT0A 2HI0A 1MH9A 1RC8A 1ZD3A 2YMMA 3WKAA 5AVYA 5AI9A 4EENA 2WFAA 3QU5A 1T9ZA 2BY4A 5AKJA 2CFTA 3DNPA 2ZXEA 3KDPA 1RKUA 2MU2A 2Q5EA 1U7OA 2HF2A 1T5TA 1J97A 3N5KA 5AKKA 5ALDA 3OCUA 3L1VA 2FUEA 4HYTA 5ALOA 2C8KA 2JARA 4BX2A 5AW6A 2HEGA 2P9JA 3SF0A 4NWIA 3R09A 2FPRA 2R8EA 3W5DA 2ZBDA 3A1EA 5ALUA 3UMCA 2ODAA 3EF1A 2JAUA 4JB3A 2B30A 3E81A 2B1RA 5ALIA 1TE2A 2IA5A 2RAVA 4BEWA 5ALYA 2GFHA 2W11A 1Q91A 4UASA 4ZEVA 4IFTA 5AVTA 3R9KA 3FGOA 1O08A 2PKEA 3A1CA 3L1UA 1SWWA 4UAUA 3I76A 2NO4A 3L8FA 3QU4A 4OCZA 3PCTA 2R8YA 3ONNA 2VKQA 3DV9A 3L5KA 3QXGA 4RESA 1YMQA 2ZG6A 1RLMA 1QH9A 5ALKA 2OA0A 1L8LA 3ZTYA 2G06A 2C88A 3AR5A 1RQNA 2AGVA 3A3YA 1QQ5A 2AH5A 5AKHA 4KNVA 3ZX5A 1RRCA 5ALJA 4B6JA 3BWVA 2WF9A 4OHFA 5AW5A 5ALMA 3WK7A 1ZD4A 1CQZA 2HO4A 1JUDA 1Z4KA 4YGYA 1YJ5A 2P11A 4EX6A 2FPXA 3WGUA 3FVVA 3E84A 4GIBA 4UMFA 3QU7A 1Z5UA 2G0AA 2B0CA 3WGVA 5AKIA 2B82A 5ALNA 1YV9A 4KN8A 4Y2PA 4BEVA 1RQLA 3AR4A 3ET5A 1L8OA 2GHQA 2X4DA 5AIBA 2FDRA 5ALGA 1EK2A 1WZCA 3BA6A 3WK9A 3A1DA 5ALFA 2WF6A 2CFSA 4Y2QA 2GO7A 4YCNA 2AUTA 1TJ3A 2IOHA 5AKXA 5AM0A 3UM9A 3S6JA 3KD3A 1LTQA 3U7HB 3I6BA 1L7OA 3L0YA 3B8EA 2MSNA 3QNMA 3EPRA 2CN1A 5AM1A 1RKVA 3KOOA 4Y2RA 3WKEA 4Y2TA 3D6JA 3IB6A 5AK3A 1CR6A 5AW2A 3ZI4A 3N1UA 5T41A 4L57A 1U2TA 1RMYA 3OCWA 4BBJA 5AI5A 2W43A 4CF3A 5ALEA 3ZW7A 2YMLA 3FZQA 2RB5A 3QUQA 5AVQA 3ESQA 4YIHA 2I6XA 3QUCA 4O8CA 3CZ4A 3U19A 4DFDA 3ZWKA 4YIKA 4HAIA 1XP5A 5AVXA 1ZD5A 2YJ5A 2YY6A 1QQ6A 2IYEA 3AR7A 3ESRA 3WK6A 4NAVA 1Z4JA 2YFYA 1Z4IA 2I34A 2YN4A 1Z4MA 4GXTA 5AKYA 5AIAA 4NFLA 3SLRA 5AICA 1ZOLA 5AK5A 1Z4LA 1VJRA 3M9LA 2BDEA 4NV0A 4YCMA 4L6AA 2PR7A 2IOFA 1U02A 1LVHA 3L8HA 4UMVA 3E8MA 3U13A 3UMBA 3U26A 1VFPA 2HHLA 1L7MA 2ZBEA 4XQ0A 4BYGA 1K1EA 4IG4A 3QUTA 2O9JA 2G09A 1F5SA 3ZTWA 5AVSA 5AI8A 3VAYA 2FPSA 3OCXA 4CF5A 1U7PA 2I55A 3MPOA 4J03A 4EZEA 5AVVA 5JJBA 2WF7A 3WK8A 3RF6A 2MU1A 4BX3A 2PQ0A 5AI4A 1O03A 4BX0A 3K1ZA 4L6CA 3NASA 3QX7A 4AS2A 3NAMA 4CF4A 4NABA 2FPWA 2NYVA 4DCCA 2OYCA 3QYPA 5ALTA 2FEAA 3MMZA 1WVIA 4UU1A 1NNLA 3ZVNA 2G80A 3ZU6A 2YJ4A 3WKCA 3PGVA 3IJ5A 3QU9A 1Y8AA 3N8GA 3WKBA 3M1YA 4QQFA 4Y2YA 1RMTA 5AW7A 2B8JA 2I54A 1J8DA 1Q92A 3L0CA 4XPZA 3HYCA 4Y2JA 3F9RA 5AVRA 3L8GA 3MC1A 4MUMA 1Z4OA 3SHQA 3NUQA 4CE6A 5FP0A 4XE5A 3U7GA 3IRUA 3ZX4A 2R8XA 3FPBA 2NO5A 5AW1A
chains in the Genus database with same CATH superfamily
1KBUA 4C4OA 5IN5A 3L2OB 5CK4A 4TURA 4YN4A 3GLUA 4D4JA 3ZJVA 3OI7A 1CD5A 1MORA 1ZK0A 2WINI 4CKEB 5JDCA 5A3SA 2ERYA 1N32B 5JARA 2K60A 3LGAA 4TTRA 4MMZB 3K0KA 1Y0BA 3P9QA 1E32A 2AQKA 4FLEA 5AKGA 1SVNA 4RA6A 5GV7A 5C1DA 3KHRA 4MFFA 4GXQA 4BXOB 4CNQA 4NZYA 4PNZA 2BRUC 2HMWA 1RWPA 3N7AA 3DUFB 3RABA 3I5XA 3MAAC 1X9GA 2BGKA 3B70A 3CEJA 4GWKA 4CLRA 3WGKA 3GLGA 2FRXA 3H6KA 3TW4A 1J0EA 1YQDA 3Q98A 3U3OA 1F60A 2K87A 4PS0A 5CBPB 3WGLA 1I1HA 2XUPA 4WK0B 3ACDA 2B3TA 4DSEA 1NQWA 1AK1A 4OJNA 3SSMA 1RI3A 2X5OA 3JZMA 1A5ZA 1NATA 1RWBA 2QXUA 4FN5A 1Z74A 2FP4B 3I6YA 5EXSA 5JZVA 4WLOA 1T24A 1M8PA 1TEVA 3IPAA 3PWZA 4WV3A 2L17A 2PZGA 3PT5A 1V39A 5TS3A 3U7QB 2IGBA 4URHA 3TB4A 2O05A 5CK5A 4H1WA 3WG9A 3ISBA 4HO1X 4JI2B 4CT5A 2QTVA 5CD1A 2CF6A 1ES9A 5I7WA 5JFGA 3AQEA 3IRVA 4ND2A 1KKMA 5E9JA 4GGOA 5JCPA 2BKVA 4BNDA 4YPVA 4KC0A 2QVGA 3AZPA 4FCVA 2BGRA 2O6HA 3R24A 4GRIA 4I1YA 2PWYA 5AI0A 1L7NA 2C22A 2CJPA 2HDOA 3T38A 4IJUA 3FBTA 1FDTA 1MB3A 1LPPA 5HR5A 4D57A 1M1NB 5LL6P 3QXHA 2ZIVB 2BKXA 4PSUA 4U9UA 5JI3E 2NG1A 4X6LA 4AP6A 4WCVA 4EEXA 1FUIA 2M6LA 3H16A 3MABA 4MVJH 2F8TA 1E6CA 3GFPA 2JH8A 3GRVA 4YV7A 1KEUA 4OOEA 1JU4A 4KCGA 2R2AA 2R3SA 3P52A 4KQMA 2AA3A 4OAPA 4WKNA 5JFOA 5L3SB 1ZEJA 4DB2A 3ZH9B 5T4BA 1P31A 2IYZA 4ZI7A 2VT2A 2Y27A 2NUAA 2JHGA 2JPDA 3OO1A 4IVPA 3MFQA 5EIEA 4DSTA 3E9NA 2VA8A 4M47A 5EJ7A 2ZQ5A 1CZNA 3E9QA 3GR6A 2J30A 3TLMA 1P0IA 2B36A 5KNCA 4MQ5A 1TIBA 2I2XB 1OBCA 3BCUA 1CBUA 2EJTA 2OLKA 5FUVA 3O8RA 1VPWA 4BV8A 4Z2AA 1W9HA 4J9SA 2QY9A 4AYXA 2PGDA 4IL6U 2QIPA 3LUHA 3P9PA 4PPQA 4UBIA 2JLWA 4I4LA 2B8NA 2PVCA 5B3JC 5C8DA 1TGYA 3F1LA 8ICQA 5DG9A 1G5HA 1L4BA 2BR0A 4R9SA 4XXHA 4CEIB 1LF5A 5I5GA 4JI0B 2R6AA 3QE3A 1HFKA 1SVUA 1VGQA 2QARA 4G8JA 4HJXA 4GT1A 2GEBA 1R12A 1YQXA 2XMGA 4FBGA 3RVBA 3GJ0A 4JVSB 2BEKA 3NJRA 1UT5A 1YFLA 1XZDA 1XDWA 1JB9A 3NVZA 2VSXA 4AW9A 4WEQA 3HVUA 4E70A 3DOJA 4BVHA 4LZWA 3AP2A 2FPOA 1KI4A 2PFSA 2IYYA 2W7TA 3EVAA 4MRVA 4WN9A 3TI9A 5IAEA 3UMVA 3BMCA 4EPWA 4LXUA 5FUXA 3KKLA 2E21A 2OVBA 2WIJA 4MWGA 4U02A 4HNVA 2A1JA 4HN4B 4EUHA 1W6RA 1H1DA 3TXAA 3W6PA 5AK6A 2G4LA 3G1UA 1Z6YA 1X9MA 4L72A 5EE3A 1HSZA 2HBYA 3FCEA 5B5SA 3GLFA 1DOZA 3BQ0A 4IKPA 3TMYA 4LYEA 1H8ED 2VPPA 3QRWA 4QO8A 2NWQA 3KEFA 2FFJA 3HKBA 1BOFA 3MJRA 2IFTA 4H3HB 4NLNA 4DA9A 4R2WA 4MKFA 2C5SA 2IJGX 1DT3A 3OFVA 3ZJTA 3DHNA 3KG2A 4MA4A 3UMRA 4I8XA 4BLQA 2EZZA 4DMFA 4JLNA 2Q4RA 4DEVA 1UMBB 3PR4A 3AL0B 3OTQA 3B9BA 3FG9A 3KOXA 3PUZA 4TWZA 1ULHA 2A8YA 2E18A 3BB1A 4LDNA 2WIBA 4PZPA 2GN9A 2IHBA 3HR4A 5IS2A 1JKFA 3C1AA 1YBHA 3NVVA 1QF7A 2D5LA 3OHMA 4HUQA 4WCFB 1IOLA 1EAMA 3DDHA 1NF9A 1ZPDA 3D4PA 4OM7A 1AQ6A 3O3MB 5SV2A 3FYHA 1SQ6A 4GXJA 3KZNA 4G0YA 3FNHA 3PDWA 1G7TA 4WBNA 4YT5A 3RRZA 4WA8A 1C0PA 5EHGA 4M83A 1DGSA 4P0QA 1TC1A 1Q15A 2G5PA 2HKIA 3KQTA 2JIQA 4L5JA 1CRPA 2DPYA 4OH1A 2GETA 4RVDA 5F7JA 2J48A 5D5HA 2GVDC 3D4BA 2H6EA 4A9AA 5HHHA 1J5EB 4ZCLA 1LSJA 4FN4A 3W9UA 4N76A 2A5LA 1C4WA 1T3ZA 3WGMA 1E2PA 1R0KA 2PSDA 1GILA 4BWVA 1XSLA 3QPAA 5BVGA 3IVXA 2DQNB 1KLNA 1H6CA 1SOMA 3I2YX 4QRDA 3ZZ0A 4HZIA 4AECA 4P0QB 4BQPA 3HP6A 2HK9A 1H85A 3T7RA 4GLOA 3DM9B 4K1LA 5BPFA 2R1TA 1U9IC 1WOMA 2MTBA 2WUEA 1GRQA 1RRVA 3AC0A 4B5KA 1T26A 3H4MA 3L0OA 2JD0A 4RW0A 4BO5A 4DDTA 2Z8YM 3WSVA 1UQTA 2JK1A 1T1EA 3IOYA 3R3ZA 4R8SA 2O50A 4L8VA 3ET4A 5E9QA 1IIBA 2WTXA 1FFHA 1XQ6A 2V7EA 1DV1A 1U04A 3V8PA 4AUEA 4AVYA 3W5CA 3EB9A 3PFHA 1W2HA 1OZFA 1O9HA 4Q3DA 4X20A 4DOBA 1BVRA 3P71T 1OI7A 2H2AA 3LFUA 3FHJA 4DEYA 3AESB 3ZCVA 4PO8A 1CU1A 5T57A 2YUIA 1TX4B 5THQA 3A11A 3DB2A 4N40A 1RYEA 4YR7A 4ZCTA 4UPEA 5DXJA 4WI1A 3IT1A 3JQ9C 3HP7A 5KFIA 3NATA 1OBFO 1RJGA 4XX0A 4WH0A 4EKDA 1QCZA 5TVKA 1R66A 2WHXA 3R4CA 4HDSB 5CXUA 2IYPA 4DB4A 3QV1A 2KHQA 3K70C 3AH8A 5H59A 3VU8A 4B0PA 3ZU4A 4NR0A 5CDTA 4L4ZA 4TLCA 1LS6A 1NMSA 2WWYA 2ZJYA 4BO2A 2VA3A 2ZPTX 5B3AA 2OKGA 2QGNA 1ZIDA 1MEEA 1N2OA 1BMFA 4CCWA 5AVYA 1AMNA 2IPLA 2O06A 2CEAA 1GNVA 4UTXA 3GBPA 3SZRA 4ZQHA 1D0SA 4Q12A 4L50A 3OMXA 5ADHA 3PLAE 4KAXA 2FPIA 3COYA 4RAOA 3CSDA 1HDZA 3TQSA 2GGSA 1Z5NA 2BZ1A 2P1RA 3WLOA 5EZ6B 1YRYE 4IKEA 2CDCA 4IGEA 4E5MA 2A9QA 5L8VA 4PM4A 5L7WA 1UA1A 3STYA 2F8KA 4C1BA 1S2MA 4KFUA 4FYWA 3X3HA 3E2IA 3FPKA 2B6NA 3UXMA 3A9UA 2PUTA 2I9GA 1MMFB 1PR6A 3RH0A 1KNQA 1B7GO 3M6UA 1KFCB 3RT7A 4I2GA 1VLQA 2GBLA 1NW3A 3GQBB 3LKDA 3PDIB 1WSWA 3AVXA 3KLMX 1TD9A 3GIJA 4YMSA 4EG8A 4U7HA 1F3OA 3ZW9A 2B30A 2IL1A 5ADVA 2B1RA 3ZGLA 3JRNA 4S2UA 1ORRA 2GFHA 3DLPX 3HYSA 1DC7A 3CKYA 3R6LA 2VDPB 1T8TA 2QL5A 3IDOA 4OLBA 2FK8A 2MYPA 4JK1A 2ATIA 2XTJA 3WBJA 4H1VA 3R7FA 4C89A 3TUZC 1TL7C 5JDIA 4FYIA 2ZR7A 5K0JA 1DC4A 1LSUA 2QT9A 2HHHB 3ZHBA 4D0LB 5JEEA 3F90A 4N03A 1BHSA 1JX6A 1SWWA 1R16A 3QOYA 4AUKA 5L9AA 3A27A 1UQUA 4V1CB 2O8DB 3G6YA 2QRGA 2QARB 1YQUA 2ZEJA 3NRCA 3UZUA 4RDHA 2EEPA 1TU3A 3FYDA 4OJ6A 1I3OA 3UKDA 5CXQA 4FHFA 5DNUA 2BGUA 4HZUB 1Y8CA 4RVGA 4CUZA 4OMDA 4QZVA 2J0SA 3TPCA 3G2QA 1SH7A 4XQCA 5LDHA 1E0DA 2RJNA 3HPRA 3A6PC 1TM7E 3C5VA 1BG6A 3ZTYA 3KHUA 3VJRA 1RQNA 3ITEA 1F0MA 2XJ4A 3JW8A 3LUFA 3JPRA 5ALJA 3WV5A 4EA8A 4DLNA 4JV1A 3BQ2A 2ZB2A 1NT4A 4F38A 5BWLA 5AW5A 5ALMA 3OA0A 2XTAA 3ZKWB 2CVZA 4R0NA 5DHPA 4YP9A 4CLHA 2EQAA 4OQEA 5KNDD 3QKSA 8ICFA 1G5IA 1WMSA 2VQDA 4BNJA 2GESA 3SSAA 3FUVA 3A1TA 2LHTA 4IUBS 1X8LA 3QJGA 5FBHA 4GIBA 1YZLA 4UMFA 4EHJA 3ONVA 1SCUA 4ELTA 1WXQA 1CG6A 5HF6A 3BQMB 3EOZA 4V0ME 4HEHA 3NHAA 2XVYA 4RKWA 1KOFA 2YQEA 5I6DA 3ANTA 1M34B 1MB9A 4QWMA 1XTQA 2OD2A 1ZJNA 1UXIA 5AHOA 1NLZA 4B3SB 1YBMA 4ZVNA 1DARA 2AG5A 2H16A 3AR4A 1HT1E 1EPUA 4QAQA 2X4DA 4Q4AB 1O96A 2FDRA 1HYBA 4C0XA 1YIDA 2EP8A 3ICWA 4R1LA 3ICQB 3C5HA 3CR3C 2UVVA 1QG2A 2AMVA 3EPGA 1P44A 2FQXA 3DJYA 4CHGA 4E08A 2AN4A 3AJ8A 3Q87B 4MKIA 4ZGBA 1B0XA 1YS1X 1UK9A 1W4BA 1X8JA 5JJIA 2WU8A 2YWBA 4XJSA 4FGKA 3G8AA 4J9UE 1H1LB 3K16A 3NOQA 2GNOA 2C9ZA 3BWYA 4JA0A 1PVRA 1YKFA 2R4QA 3DOUA 4GUAA 1XQ1A 1UDCA 4V0NA 5DULA 3KVYA 1KSHA 4USAA 2BI8A 3GJ4A 3Q9UA 4GC7A 3RSOA 5KWEA 1AQNA 1XMVA 5T5QA 4B3CA 4CDGA 5HQ3B 1SFRA 2G6BA 2GBPA 5LXTB 4GDFA 3H5RA 4ZV7A 3GLRA 3D2NA 3EXEB 2HLDA 3EE6A 3PX3A 2XA2A 3IJPA 4TYNA 4RWEA 1JROA 2GBIA 5TISU 2WEKA 2ZT8A 3I64A 1M2OB 1PGPA 1DAGA 1P17A 3OCWA 5KOIA 4OAQA 2WMNB 3IOEA 5FJJA 4CF3A 1TMOA 4QLBA 3OQ6A 3LHFA 4PSDA 2EG5A 3TADA 4HRXA 2XUFA 2CSUA 3DR5A 3NHPA 3R0VA 4PLPA 1SN7A 3OHAA 4LIPD 1VSBA 3WISA 1ZQKA 1J2NA 1VPLA 4Y2GA 3DVLA 4RJJA 1ONBA 2FF7A 4KK4A 1QV7A 1HE8B 4MAAA 2LM4A 3ND6A 4YJ2B 4X95A 3VR5D 4TS3A 5E7QA 2XKAA 4PG4A 4DBZA 1I2AA 3W1WA 1XAHA 1VPDA 2FQ1A 3MB5A 1C9NA 3UB4A 5KB3A 5LZ2A 1BDHA 1I2CA 2D5BA 1KA9H 3U19A 5KFZA 2HMXA 1QCKA 4DFDA 2AXEA 2V5AA 4LZJA 3PS9A 1DLJA 4BGUA 4RZHA 2ZSBA 3IURA 3RYIA 4P36A 5C4GB 4YRIA 3K70D 5IIJA 4IOLA 3W06A 1KK1A 1N8TA 2AN3A 3D59A 4L76A 2AJBA 2YOFA 5KG3A 2MAXA 5HTKA 1Z4JA 3QKSB 1Z9BA 3I1IA 4XFKA 5CA7A 3V8RA 1GPJA 4FZVA 3OM1A 1ZYUA 1K06A 4IMPA 2CDBA 2IEDA 5AIAA 4OSPA 4PX9A 3ZQUA 3O1HB 4HV4A 4D4HA 3VJKA 3SLRA 1Q14A 4N7BA 4F3RA 1ORHA 4ZHQF 1R4MA 1BGWA 1ZJZA 5BUSA 1P7CA 2PT5A 4GOLD 2JZBB 5DBAA 1GV0A 2QW1A 1LLFA 4YD2A 3CT6A 3FPFA 3LYAA 3ZQ6A 4DADA 4YCMA 3GLHE 4XRGA 4XCQA 1PGOA 1CQIA 2XB6A 1AHPA 4R83A 3WWPA 4W5JA 4JCCA 1VFPA 1MZVA 2HHLA 3LT2A 4M89A 2ZBEA 3WNBA 3E61A 2A67A 1XDGA 4Z5XA 3D6VA 4MR9B 3RAQA 1UFOA 5KQSA 2UYGA 4F2SA 3W5HA 5KINB 1U6JA 3DWEX 2W3SA 4ECUA 2MSEB 3LECA 3OFND 3L4SO 3EIFA 4U63A 3FROA 3OCXA 1U7PA 5FTJA 1CR0A 4CG2A 1OMOA 2WWRA 4FILA 4C7JA 1JG4A 3ICCA 4ZDKA 3UQ0A 2E1EA 5KAFU 1PR0A 1VDZA 4GMFA 1WTAA 5JJBA 2ZW9A 1T25A 5KYUB 3NWJA 4RY9A 2VANA 2ZIXA 5ECDA 1TIPA 2F6RA 1YJQA 3PNMA 5HQTA 1V9SA 2NV0A 4BQOA 2MUTB 5IZ4A 4FOPA 4RHTA 2LE0A 3G0GA 3I58A 1JTFA 3S5UA 1X9WA 2D8CA 3LBYA 1U8TA 4KFRA 4O3FA 1DTWB 2YZMA 3KFLA 3IBTA 5EMKA 4QAJA 5AXCA 1FDVA 2BTQA 3PFBA 4CQMA 1P4SA 1Z0FA 5UKDA 1SOAA 3NETA 4AJHA 5A1JA 3VMMA 1UP4A 1LZKA 4DS5A 5JQGF 5J2UA 2F3SA 2OHIA 1XTBA 3GGCA 1YIOA 1KFTA 2RIPA 1J7JA 3FPCA 3ZY6A 3AVQA 2D0OB 3H11B 1ZETA 4BJ3A 3RAEC 4JI7B 5GJBA 5HR6A 4JBGA 3R9XB 3BRSA 1ZQJA 1EZZA 2J6HA 2I8AA 2QRJA 4P3NA 4EWLA 1P4HA 4F4XA 4NE2A 2XYQA 4QPDA 3BB3A 4GX5A 3N2KB 3CZAA 1IATA 2QR5A 5HUJA 1H9CA 1QK4A 3ESXA 3B9PA 4M4SA 4B7CA 4KJXA 4MR9A 3SEAA 3B1KA 2VZ0A 4DNXA 3U44A 4HRVA 3A70A 3QEBZ 1B6RA 4HNRA 2H92A 2IUSA 2IHTA 2Z1DA 2P8JA 4ZI7F 3T7CA 3AETA 3QNWA 5FYDA 2R8XA 1UAYA 3PC4A 4K4IA 421PA 3UK0A 3VH4A 5AW1A 1LC3A 4YP0A 4HS9A 4XLTA 1H9AA 3PVSA 5EJ9A 3SR3A 4HAYA 1PK3A 1Q84A 1X86B 3W2FA 3A25A 4C2TA 2F3NA 2E1PA 2XHZA 3MRXA 2V7QA 3WK5A 4PGHA 3NP9A 4JJAA 1J0CA 4JKIA 2A0FA 4P6VF 1M2HA 3IPXA 3NHBA 3N2GB 4CBVA 2WM8A 3BZKA 3Q7PA 5SY9A 3PGLA 1E1RD 1JHOA 2RGBA 3RCBA 3UFXA 3WI7A 1GAEO 4E3ZA 3OE4A 4MW2A 1DAPA 1DOQA 1J20A 4IGKA 5L6LB 4I3FA 3M7IA 2DETA 5EE9A 1SWVA 4C4SA 1VE6A 4IHJB 3NHZA 4JJ7A 2A1TR 4LQCA 3RB0A 1M67A 1GTJ1 4Q7EA 5KVQA 2ZWAA 3OPYA 3IIEA 5EJ6A 5I4KA 3TACB 1DX6A 2ZE8A 2IX9A 2RGUA 1T2FA 3O2QB 1KO1A 1RWKA 3GB9A 4ESEA 1C30A 3ZDFA 4BU0A 1RAEA 1Q5PA 3DQZA 2HJVA 4L51A 1K6MA 4QPPA 3WADA 4E2XA 2ISPA 1OU4A 1U11A 1L9KA 2Y93A 7ICFA 5HG0A 3H9EO 2G0NA 2ZIXB 2WSLA 1R0BA 3P0HA 3D7NA 5ALXA 4FNMA 5HF5A 2WUGA 5D84A 3L8EA 3ZVRA 2HHTA 2JIMA 1UZAA 2P79A 2RK6A 2ZYUX 4FOOA 2NX2A 3MSXA 4BEJA 3QEAZ 1UBTS 1Z2EA 2EBFX 1M34E 1MCZA 2CJFA 4E03A 1BQ4A 2C31A 1M7GA 3Q1KA 4OFZA 1FTYA 5JD5A 4UE2A 2OECA 1SG9A 1VE7A 4F4DA 3I39X 2Z6AA 4CMIB 1N5WA 2YMPA 1IWOA 3OMLA 2JJQA 4MGIR 5EA2A 2I76A 1H3FA 5A2QA 2HHSA 4I2EA 3GVIA 1EFRD 3S8MA 4NBLA 3ZE1B 1Q3TA 2QI9F 2VQ6A 4JLMA 1RZRD 1NF2A 2WV7A 2IEAA 2XZPA 1A72A 3UIEA 2CMFA 2GK6A 4UU0A 2DSNA 1M6WA 1YZQA 3WB0A 1K8QA 2E4AA 5J2DA 4HEQA 3OPXA 3HA7A 1S9DA 4N0MA 1ZVJA 3LPAA 2JAHA 3ROZA 1PLKA 2BAGA 3ZWDA 4G3IA 5TF4A 3HRDD 4O3PA 3FLAA 3IUYA 3V4SA 3ZE0B 1XLVA 2RGDA 3MTDA 1A97A 1RAIA 1V1JA 2AZMA 3QF4A 4URWR 4GL2A 3NHLA 4Z49A 3IAS1 3UKOA 2BP7B 3A2MA 1QSGA 2HZ7A 3G0BA 4WZBB 4M1WA 4JQYA 3QMPA 4DLTA 4NCXA 1CRLA 4KRYA 1LBHA 2H4YA 1W48A 3I9V6 3PQCA 3P2IA 3QKRA 3IUBA 4G0XA 4ZOLA 3X1MA 2FLNA 1HFJA 3LA8A 3SSNA 4BO1A 1ADJA 1V8FA 2KYRA 1V26A 1BKYA 4X84A 5DGIA 1V97A 1P18A 4GPBA 1Z38A 3P20A 4PGQA 2I99A 3B3GA 2O07A 5D5PA 1ZOSA 2DC1A 3FDZB 3QNUA 4JL5A 5CDFA 3ZOKA 4GDMA 1Z13A 4FGWA 2PPLA 3REGA 2EARA 3OZVA 3AVUA 1F6WA 1IK6A 2E4XA 3A6JA 4DANA 1EYZA 5LQDA 3KFUF 1D2GA 2R84A 3L0PA 1LBQA 3EULA 1TJ5A 2R97A 2YKGA 1SQSA 1ODKA 4A6DA 2K6GA 3OP1A 1YR9A 3PPIA 3NNSA 1T3GA 3EG9A 4O2BA 3THWA 2G1JA 2G17A 4IIVA 5LQMA 5JSHA 2WIDA 2VHQA 5KTYA 4B6QA 4HX9A 4YK7A 1FRFS 4YXWD 1GCIA 2LKYA 4JZYA 4O5CA 4HS4A 3OP4A 3I42A 3PWTA 2BZSA 4Y2XA 3MNFA 4J1SA 1ONNA 4HN2A 1H8EA 1M9NA 4XYEA 4KP7A 1NXPA 2H85A 2KM1A 1NIPA 4ZEOA 2KSOB 4EX7A 3O5AA 2HPVA 2JFVA 1FTSA 2CK3A 1G7CA 3GNSA 4LI0A 4V3CA 4AWXA 4BFWA 4BLOA 3MJ4A 3W77A 3C97A 1SZJG 1RAAA 3HC7A 3KWMA 3NAQA 4Y1FA 1KIFA 2FZLA 2HBRA 3ZE2B 2G3YA 4YMTA 3DAOA 5SYAA 5B30A 3DBOB 3NPAA 5E9AA 1TTTA 1GPKA 1UC8A 2FWNA 2A92A 3PR3A 4ENPA 4DCVA 5JQGB 2AXQA 2IV7A 1THTA 1GITA 1CJUC 1Q77A 3O75A 1ULZA 3EH1A 1HQCA 6REQB 3WGGA 2QUZA 2PRZA 4R9RA 4RETA 3AEUA 1RWMA 6ADHA 2Z6UA 3I01A 3W1EA 1RQ7A 4KQXA 4OHOA 2ZM6B 3DV0B 3P9YA 3DE4X 2BR5A 5LNK1 4UAVA 3E22A 3ZWWA 2HW8A 2DQ4A 2RC5A 4BN5A 3T1YB 1WXXA 4K6HA 4RK6A 1JR3E 2ZWMA 3D7KA 2H2DA 1SMKA 1OAOC 3SGLA 1ZAKA 3IXQA 1S3IA 1GA6A 4BJ5A 3HXOA 3SVLA 4NLBA 4BECA 1BYUA 3FLEA 2ZDGA 3CSSA 4M1MA 4YRJA 1KI7A 5JNUA 4KLLA 3SF8B 1TEXA 2P5YA 3HZOA 1FJ2A 4ETIA 4MWTA 4E2YA 4YRMA 3TOCA 1P39A 5KG6A 1L8AA 1QE3A 3EMKA 2YB1A 5HKKD 3M70A 5JNTA 1ZRNA 5AVZA 3K94A 3TOVA 3O8BA 2HXGA 4C7ZA 4J0FA 4JC8A 1XEAA 3GYGA 2GAFA 3GJYA 3R6DA 1DZ3A 1WB9A 1A6SA 1T0BA 4WXRA 4M0MA 5J5CA 5ECGC 3FB1A 4DNFA 2MSKA 1NI3A 3TM5A 2EAUA 3TLJA 2C29D 2IU3A 2Q5CA 4ZU1X 3B3AA 1DPGA 5JVDF 1XA3A 2O1WA 1OH7A 1PIWA 1IBRA 2DRIA 2W9CA 3WJ7A 3C39A 1PL0A 4AJEA 4DLYA 3B5JA 2QIOA 1W88B 4JX8A 3PGXA 4P35A 1NN0A 2X0RA 3DP9A 3I0ZA 2J6CA 3F7MA 5LQKA 3MWFA 4JDPA 4LKRA 4O1HA 4OJLA 1I1NA 3C7AA 3G2KA 4G5RA 4QZFA 2JEIA 2X5JO 3KUUA 4M99A 2PRJA 1XTRA 1SKRA 1ND6A 1E3EA 4GU5A 2GEJA 1Y8RB 4TQRA 4NVRA 1JT2A 5EL0A 1HO3A 3CW8X 3NH9A 4XKJA 5J0RA 1JAHA 1C0IA 2QTVB 2J8ZA 2OCAA 3V9PA 1X7YB 4Q82A 2CMGA 1L4LA 4FMBB 3KB2A 1A88A 1GGFA 3H11A 3ESBA 1EG2A 4M1ZA 3TIFA 3EEYA 1T7PA 3QU5A 3A28A 4JVMA 1ULBA 2KB0A 2F44A 3IUEA 2PA0A 1H2AS 4Q1AA 4IHQA 2CY0A 5JWOA 5KIAA 3CLRC 4ENQA 4KVGA 5LNK6 3KT6A 3IQWA 2R8OA 3TG8A 4OO1J 1L4EA 4DLKA 4PQFA 2FZEA 5K3DA 3GP8A 4BLUA 5DTIA 4EY6A 2QP9X 3N76A 3ZOZA 1PS8A 1J2EA 4UDXX 1QYVA 3EXIA 2Z4RA 1OIVA 3UAXA 3RC7A 2CNNA 4WCDA 4LZZA 1EKXA 5BSUA 2WT9A 3MF4A 1EP3B 2W9XA 4HUJA 4BNVA 2W6OA 3QVLA 2POQX 2ZBDA 3HGMA 1KETA 2FHSA 3D3WB 3PUWA 4O5AA 2ZSEA 3LC1O 3ZDCA 4LQLA 4N0PA 4ZT3A 5HRCA 1E6UA 2ZYVX 2VLIA 5DGXA 3NOOA 1V2GA 2JAUA 2JA2A 4PYKA 1DQYA 3W2HA 1CJKC 4BLPA 2WD9A 3KQWA 2RAVA 5LYJA 3KKNA 4EGCB 4TM8A 4TV9F 1Z3EB 5J43A 4EH1A 4JFAA 5CVUA 3LDGA 2CHUA 5CYPA 4G5YA 5H9VA 3O92A 1WTCA 4J4TA 3R9KA 2WWGA 1V8ZA 4DR2B 3PC2A 3GJSA 3WE7A 2ECFA 1DADA 1K0FA 4G5SA 5J4YA 4IZ6A 3SWWA 3ZIDA 3M49A 1HDEA 1PW7A 3UG7A 2Q6OA 3SS7X 1F51E 1CYDA 1U0NA 1ZQDA 1P1FA 2D13A 1TTPB 2JGFA 1GARA 2FVXA 2Z83A 4M46A 3CP8A 5CPBA 2FZ5A 5H8WA 1A2QA 2YIMA 3ZWOA 1JL3A 1FZQA 5D85A 5BV0A 4JYCA 1IUPA 2BI4A 2NTJA 4B6RA 4JNCA 5I47A 3C0KA 3K2EA 4WIAA 1NFQA 1K6JA 1VSVA 3DNFA 5CNIA 5BUCA 2R8BA 2HSGA 4EY5A 2G06A 1BE0A 3OAAA 4TWBA 5LP6F 2FKAA 4ZI3A 1X80B 1WS6A 4G85A 4UB4A 1DHTA 2YWXA 4GM4A 3WMXA 4BKPA 3RARA 1Y88A 1QS0A 3I5MA 1PZNA 2WF9A 4TMXA 1I2BA 4ENVA 3ZZMA 1M2VB 4TKLA 5I5EA 4F4UA 1Q21A 1PQWA 3A0RB 2WZCA 3LVVA 1K7FB 4XGNA 1Z4KA 2WFZA 4E07A 4BY9E 3V1TC 3WP0A 1YKSA 2W2OA 3HDVA 2O7SA 4G81A 4P5PA 4EATA 1AZTA 1GFWA 1V43A 4IIDA 4X3CA 3R7WA 3SFVA 4QEDA 2OMKA 2FSVC 2PD4A 2P77A 3QU7A 1N25A 1PTKA 3A7EA 1YGPA 3DDSA 4BFZA 5FPKA 4GSLA 1KP9A 3WSWA 3MTQA 4N18A 5FXMA 2XLCA 4TMKA 1RKXA 1ZIOA 4HPJB 2VJLA 1FU8A 4JB0A 2HRZA 2IU0A 3TBFA 4AZTA 5C1BA 4MH0R 4MV3A 4KGDA 3MMSA 1CZLA 3TIXB 4KYVA 4P0PA 2HK7A 3QEMB 4YCDA 4Z86A 3ZDYB 2FV8A 5KUTA 1LLQA 5ALFA 3LOUA 4IP0A 2H4HA 1JQDA 1A8QA 3DWFA 4WBNB 8ICXA 4XUDA 4LJLA 4NC9A 4O08A 1PN3A 3T3HA 1MO5A 1NVVQ 4C21A 4JFRA 3CZCA 1OYWA 4Y9DA 1KVTA 3FZGA 4ZVKA 3BXZA 4WK4B 1RZRA 3OOEA 1LTQA 3IUNA 1U98A 2YJGA 4HWRA 4R1MA 1L7OA 1CF2O 1L7EA 4YECA 5D1NA 2CN1A 3NKVA 4EL5A 3S2EA 3SDZA 5DNWA 2YYZA 2OV4A 1VI2A 1TKBA 1EDBA 2Q4OA 4I81A 4JX9A 4K6CA 4LXIA 3VKWA 4EY3A 2PLFA 1GAXA 1XRLA 3LQQA 4R1QA 1E5VA 2NUTA 3V8NA 2QRVB 5T41A 2FXIA 2WLTA 3RS0A 4EGFA 4B9SA 1QDUA 1V9PA 3WU2U 1CCWA 2CJWA 1A76A 3H4IA 3HKCA 1NBHA 2GI4A 4IIHA 1JE1A 1BPBA 1M2EA 1L5KA 1T91A 3IMFA 4C0JA 3D7RA 2GRJA 2EW8A 3DZ8A 4MS3B 1DBIA 1LF0A 2VWHA 4F2DA 1U7UA 3DT6A 3EDOA 2DLDA 2K2QB 2QDKA 1IXRA 2HWYA 2ASLA 1QIFA 3EZYA 3KD2A 4OHZA 3OJWA 5TEWA 4FNAA 4QZCA 4B6SA 1LY1A 4RNDB 2ZIEA 4W1RA 5KFMA 3TXYA 2FXVA 3PC8A 3EXHB 1WCIB 3ASYA 1XVUA 1DO2A 3G0OA 2BIFA 1RXEA 5JMPA 3KSUA 1J1IA 2IVFA 2Q3LA 3KHSA 5C52B 1UKVY 1PNRA 4DV7B 4RV9A 3VJLA 2GPWA 3DHYA 4H77A 2CXRA 4ARAA 3AKZA 3QBVA 2P6NA 3E2EA 2WIAA 5HE8A 3UHPA 1MQ3A 1SB3C 2P2NA 4P2HA 3FPLA 4HEA6 4MCJA 4ZO4A 4M76B 4MUXA 1XRJA 2DKXA 4OK3A 4ALIA 4KPEC 2RBEA 5TE9A 4K9NA 2J87A 1SXJB 3AXTA 3SJZA 3WX0A 1Q1GA 1VHJA 2FWAA 4MDEA 2NVWA 3KXDA 3UK2A 4GX2A 3KT3A 3WP1B 1KDPA 4LG1A 5EJGA 5EP1A 2OZPA 4NESA 3CLRD 3DS8A 1AKVA 4GL4A 3N58A 1VJRA 3P2YA 4O4LB 3U16A 4DQVA 4M1TA 4I55B 2J0UB 2QWXA 1SHLA 1ESZA 1S2NA 2Y66A 3OIFA 1V2HE 1D8BA 5KYUA 1US8A 1GFZA 1JQ5A 1QDEA 3DAGA 3LXUX 4UMVA 3E8MA 2LZ0A 2Q99A 4X1YB 5BQ3A 1OXVA 4NMMA 1O5IA 3AFHA 3RSQA 3D0OA 1FYXA 1TVKA 5K3AA 1EWVA 3V5NA 1HDRA 1H4TA 4DEZA 2BCSA 4EVIA 5J4KA 2A9FA 4H08A 4CQMD 4LA4A 4Z99A 3M9MB 3ISVA 3MS7A 3SEFA 4BQNA 2VTBB 4GXKA 4EG1A 4NY1A 3MK31 4QHTA 4WY8A 5IVKA 1QRRA 4HKTA 1WCV1 4I55F 3QWBA 4TUQA 1ZMRA 2A5YB 3B1XA 5DK4A 4AZ3B 1IHUA 1PFGA 4MUAA 4DMGA 5KYWA 2Z1MA 4JQOA 4OOFA 5JXIA 3TSAA 2DWUA 3ORSA 2ZXIA 4IQ4A 2MU1A 2ENUA 2G1KA 2VUIB 1YAHA 3A8TA 4L8WB 1ZM3A 3C85A 3P9ZA 1PWZA 2Q45A 3Q7SA 3RSLA 4CT4B 1C4XA 3K1ZA 1N0UA 1WSDA 2A84A 2CLHB 3EGVA 3BRQA 2JW5A 4MW9A 3WY9A 4CKWB 1IY2A 2FUG6 3OT1B 4NABA 5KNIA 4ND4A 4QC2A 4UOEA 3PW7A 1CUCA 1RC0A 3F7NA 4H7DA 1XAGA 4P2GA 4PYJA 2OYYA 2WTNA 1P1RA 3IIKA 3ROPA 2XEDA 2FUG1 1OROA 3PHGA 3RTDA 1Q1ZA 1DINA 2GWHA 4DFMA 3GLVA 1J42A 5L51A 1AQIA 4DDMA 4HADA 5G5GA 1OREA 1R0WA 9ICMA 1MX9A 1SAYA 2E49A 2QTWB 3DYVA 2RP5A 1L4GA 2ACEA 3NGMA 3WKCA 1LK7A 1UZLA 5DHAA 5A3VA 1QO0D 4NOJA 3DXYA 2ZAGA 2OHGA 1CULC 1SK8A 1ZMBA 3ABOB 4H7FA 1W5TA 3Q2KA 2C94A 3O1LA 3DOCA 3STHA 1GGEA 2EEZA 2VRCA 1DXOA 3GGSA 4XR9A 4AKHA 2CD9A 3SZUA 1WA5A 3CEPB 5KG5A 4NZMA 4LKOA 2OCYC 3KSMA 1OGIA 1P3Y1 2PANA 3BWMA 4NDNE 1CVRA 1PRYA 4WW0A 2KIWA 3NNDA 5REQA 2XXAB 4NBKA 3SENA 3H9BA 2FQWA 3GDXA 4B76A 4XWOA 3E0FA 2J9GA 5JS8A 2BH2A 5H3CA 3RREA 3FNQA 1ID8A 3U9LA 3AEKA 1P61B 1R8YA 2CCKA 2FW1A 3QLEA 4QWEA 2O3JA 3K2QA 2R9VA 2IRWA 4OQDA 4QBFA 5HJEA 4K3VA 1ZIYA 2JIRA 3DE0X 4ZOCA 4MV1A 4JWNA 3D8BA 1N75A 1SQFA 4P84A 1EBUA 1PWYE 1TC2A 2EP7A 2J67A 4UFOA 4ZOEA 3KLPX 5JADA 5DCWA 1NWHA 1DAFA 4HBZA 3BMCB 2R96A 3BMOB 1ZP6A 2O8FA 3IP6A 3S2IA 1FRQA 2H2HA 1BXGB 1NUHA 5K1ZA 4CQMB 1RWWA 1WR8A 2CL5A 4WAUA 3C3WA 4MUJA 1Y6QA 1A71A 1ENYA 4UNNA 4BN0A 3RS8A 2J7KA 4TTPA 1I3NA 1O87A 2B35A 2DPMA 4AB1A 4KX3A 4B4OA 2UYHA 3JPOA 1XL1A 4AS1A 1II8B 3N2IA 1CHNA 4XI9A 5LUBA 4P3PA 1DEOA 5DLGA 1AKYA 4E3WA 3AOEA 4F8EA 3OY7A 5DOVA 4A8EA 2YINC 4A0FA 4B09A 1U8UA 1H6AA 3KKAC 2WIGA 1INLA 1PJCA 3A1WA 2O6KA 4JUFA 4LV5B 4NTZA 3SBEA 1ZZEA 4FLMA 621PA 3ZV6A 1NKTA 3PLRA 4MUBA 3OY2A 1K5PA 3NC4A 1D0IA 5BYJA 2O48X 2ZIZA 1P1HA 2CWDA 3RSZA 1F14A 2HA6A 3I9MA 5I7UA 1W94A 4UNRA 3EF0A 2J5XA 3AU9A 2CLMB 4Z7JA 3MWDB 5CRIA 3IKMB 4X91A 2HEIA 1G98A 2ZJZA 2TRSB 1BU8A 1VKZA 4N0EA 4RF3A 3VR1A 1WY5A 4JQCA 2FP4A 3S99A 2CHQA 4ZA2A 5BN4B 1JAZA 2NUAB 3M6ZA 3KKQA 1HE3A 3PUHA 4J9NA 4LVCA 3DBHB 1P5RA 4YRSA 3L6RA 2KE5A 4JJ6A 8ICGA 4DLXA 3EXG1 4IXNA 3VJMA 1WU7A 2XUHA 1VSQA 3CMCO 4REQA 3QHQA 1X77A 2BGIA 4AMBA 3TAPA 1RDFA 2XIDA 4OHWA 2KEYA 4HDMB 2CD7A 3FWHA 4K1XA 4NLZA 4KLGA 4KPUA 4NJOA 4TGLA 1MU0A 3MCAA 4XM2A 5FNZA 5FOXA 4CKBB 4DR3B 1CEXA 2R6FA 2QDXA 1PJ8A 3H5LA 1L9XA 4B83A 1JMVA 5AW3A 2LBOA 3DM5A 3GHYA 1P29A 1JG2A 4GGMX 3W4IA 1WQ3A 4BFTA 2IYRA 1RU3A 4OG2A 4P92A 3FYUA 4M8SA 1TM2A 3QMWA 6NULA 2V6JA 3BOSA 2VIIA 4TMTA 1VOTA 3D5TA 1RHMA 4H4EA 1HDGO 3ZGYA 2XNCA 2FPKA 3HMKA 3OU6A 2V45A 3AY7A 1AUPA 1CZHA 5KFVA 4UHBA 1NNUA 3RU3A 2JJ2D 3FM9A 2VDUE 2F17A 4J49A 2Z6QA 1KFBB 4M8IA 4WUTA 2H5EA 1L6RA 1A5SB 3BWXA 2OXEA 4BFVA 4WADA 4MGZR 2HRQA 3PUVA 1Y37A 3T7JA 3O9ZA 3SYKA 1HDXA 4FSXA 3IJRA 1C3OB 1ADYA 3GD5A 4DQSA 1AQUA 3QIAA 5JIBA 1HGXA 4MW7A 2ZZMA 1OWPA 2BJWA 1NYRA 5CX1A 2DR0A 5DX8A 2PUJA 2GBLC 2HQSA 2QTMA 4Q66C 4TT3A 5ELMA 4GG1A 2PTHA 2WSBA 1Z2PX 3OBIA 4LVNA 1BD4A 3WMEA 1JSCA 2JAOA 2Q1SA 1FLDA 1L4UA 1AUVA 2DUYA 2ENWA 1IAVA 4GM1A 1X7WB 4OHPA 3CNQS 1DIGA 1RXSA 1H9BA 1LTKA 4IF6A 4TZTA 2DECA 4FYPA 4C2AA 1P2VA 1UANA 2FZVA 4C7BA 3PENA 4K9LA 1OUQA 2IXTA 3AHFA 3KJEA 4JLUA 5E1BA 3OOYA 4GKAA 2BLLA 4RHFA 4KLCA 5AHXA 4Z0NA 3FUCA 1SVKA 3N2ZB 1VL5A 4RT3A 5BT9A 2I3AA 2R48A 3TRDA 5G53C 3E9CA 3EXG2 4BNKA 2WKRA 3BWCA 1KSJA 1SELA 4GECA 1XJQA 3E58A 3GFRA 3OJXA 3OX1A 1YR1A 5EAIA 4F1WA 1NA5A 3H83A 3VO2A 2ILVA 1WL8A 3DBRA 4M88A 4UVHA 1NVDA 2UUAB 3GAZA 3TPFA 1NOJA 5E2BA 3VR6H 2XHEA 1T5BA 4KI0A 4F1KA 4PV7A 2TMGA 4JB2A 1G1MA 1IG0A 5EXDA 4K9DA 4MPJA 3KTAB 3TLZA 4CVNA 5CT9A 1ADBA 3F5EA 2FEKA 2JLUA 4YMNA 4J0IA 5HDQA 4EVQA 2CFRA 2RRDA 4FBLA 4ZRNA 3FOEC 5KQLA 1CUSA 4DWJA 1EWQA 1RYFA 4RJKA 4GHWA 4TQAA 2N42A 1EXWA 4ZEWA 1Z5OA 2WYHA 1VIAA 3PEUA 4Y6RA 4CIXA 4PLGA 1QYCA 1J2MA 1GTZA 4F8JA 3EVBA 5CA1B 3W2TA 3JWIA 4JOQA 3UGKA 1DU4A 4PZAA 1VDVA 1IE3A 2BGJA 4X64B 4B4WA 4ZAVA 1L7VC 5FUBA 3CNHA 2Y4NA 2IOFK 3KKZA 5G3ZA 1PS0A 4LZNA 1MIOA 1OPRA 1ZGGA 3QFCA 1JLRA 4MAMA 1JIVA 1XRMA 3BGDA 2PAAA 2PSJA 1HE5A 3K9QO 1MT3A 5KG1A 1QIJA 3KAQA 7ICMA 1FU4A 2HRRA 4W5OA 3ER8A 4RSGA 3BA1A 8ICWA 1KZ7B 1EFVA 4HGPA 2P2YA 4L16A 2X2EA 3F5AA 3LTNC 5JOQA 1M76A 1SJ9A 2HNKA 2ZSFA 2G04A 2Y1CA 1DPFA 4NMHA 5KWJA 2X7XA 3U4QA 2A30A 2DG2A 2C5LA 5P21A 3EUAA 3OFSA 4KLNA 3NANA 4U2KA 4YP6A 5LC1A 2A3NA 1J22A 2VYVD 3SKYA 1T2EA 2JZCA 5LQSA 1GL7A 4RANA 2VQEB 1E94E 1UFVA 2WTBA 9ICFA 1AKTA 4HX5A 2C0CA 3C41J 3VQTA 5GVSA 2YMMA 1H4QA 3KWFA 4YPFA 3WKAA 1P7ZA 1FXWA 3LX5A 5KT4A 4BNMA 4LWOA 4WINA 3PEYA 1P6QA 1FL9A 1WDLA 2C2WA 2VBIA 2W48A 4JSRA 5AKJA 3K20A 4IVRA 5I7EA 2H1OA 2PCLA 2VH1A 3H5IA 1NKBA 3A04A 4V38A 3TF5A 1RKUA 4JUZA 2Q5EA 1Y42X 1KJ9A 1U7OA 3IKVA 4GS5A 4H6XA 4AMVA 3DMNA 1JYEA 1FUYB 1T2UA 5TGDA 1K2WA 1HRKA 1CUVA 2R8PA 4JLPA 5AKKA 3H8MA 5COAA 1YBAA 1V7CA 3V1YA 1L8XA 4B8WA 2Z57A 1FYDA 5CNJA 2OZEA 3L8DA 4CR7A 1E62A 1RM6C 3HRKA 4GD3Q 4KO8A 4REQB 4CM1A 4XIIA 1JDTA 2V0NA 2SBTA 3FBWA 2NP6A 3ZCQA 4YRGA 2OGTA 1FTGA 4ZYUA 1Q1NA 3SLKA 1FP2A 2O8VA 1Q7BA 5E6RB 1JS1X 3N59A 4JITA 3B6IA 2OWEA 3P5SA 3U4MA 4NATA 4AY2A 2W11A 2UVUA 4G65A 4WASA 2VDNB 4AIRA 2BM1A 4HNSA 1Z19A 3X0DA 3E1GA 4C4PA 4ZEVA 4IXTA 5AVTA 4NCAA 1JDZA 3GV8B 1O08A 1X9IA 3EVFA 3LBAA 3NV9A 4S1OA 4UFNA 5FWXA 2JRLA 5J40A 4KQCA 5D7BA 4AZWA 2W6QA 1D5WA 2XIJA 4DMLA 4YRNA 1IU9A 1ZQZA 5DKFA 3MBIA 3UXOA 4O6VA 3VV3A 3ETDA 4KIWA 4BOYA 2VQFB 2DF4B 4RPJA 5EPEA 1KY5A 4Z3OA 3R0XA 4BNZA 1NBMD 5MFZA 2FMIA 3PHCA 2B92A 3C7TA 1U8EA 3N8KA 3B9QA 1YB2A 3PJGA 4MFCA 1HNXB 4O0IA 1WW8A 5F52A 3G0CA 4CTNA 1RBZA 1B41A 1L8LA 3UWKA 5LMZA 4HFJA 2K7FA 4NXZA 4N6NA 4ECZA 3LT1A 4PCVA 1QQ5A 1QHYA 3D4LA 4Q8FA 4WL0A 1BRMA 3T41A 1KQOA 3OSNA 1X3LA 2HJSA 4E1VA 4HH0A 2AI3A 3C98A 5JY6A 4C29A 3K1AB 3V80A 3BDIA 1ZD4A 1VMEA 1JUDA 3QZ7A 1SKUA 4XWYA 2EERA 4MK4A 1IBLB 5GTIU 1ZEMA 2P0EA 1NYQA 3R5TA 4PLTA 1RFLA 1H3NA 1IN1A 1BMQA 1WEHA 1WNTA 1BN6A 4HR7A 3GQBA 3WGNA 1YDMA 5CDSA 1UBUS 1G9SA 2CLOB 1JALA 1Y6ZA 1Z7GA 2Q2NA 1IUKA 4FCTA 5DB8A 2CLEB 2CXTA 3B1VA 4KN8A 4Z1MA 4BRZA 4FWTA 1QKIA 1HEKA 2REXB 4LDRA 4MRNA 2CDRA 2XLBA 1AZLA 3AQ4A 4FPXA 3SM9A 2QE7A 1QRDA 4LN1A 1RQLA 5ARCA 5FEMA 3STWA 2W04A 3MQFA 4K2AA 3G59A 5HWSA 2QUHA 1VL8A 1ZOOA 4TVBA 1J5XA 4U7CA 3LHKA 3Q0EA 1CUHA 1UK7A 3F5DA 4JU9A 1NN3A 2GYVA 4AKTA 2PZAA 1YA8A 4IFBA 2IHYA 4UVEA 5KHAA 2WF6A 2P4HX 4FZRA 4UAYA 2HA7A 2Z9DA 4CT0A 4JOBA 4F2HA 3K2IA 3TAXA 1STOA 3FTEA 1R9GA 1ZH0A 5KJCA 2C7VA 2GTPA 2YWDA 3FWKA 2DB3A 4ZXFA 1YOBA 3G5UA 4PHHA 5AM0A 1DBQA 3U61B 1RYRA 5DSXA 4C1NA 4XYGA 4D9IA 4FMPA 3GFSA 3KQOA 2B4QA 2BQRA 2O1XA 1SCDA 4GE3A 1JIUA 3U60B 3MQ4A 4ISCA 3EYWA 4YAWA 4DSZA 2PGNA 1W5EA 2C8JA 5FPYA 2JIOA 2Q41A 3PB3A 4LOAA 3TTWA 5C8ZA 4LISA 4LBVA 2P3OA 4C4YA 1WDTA 4OHVA 1HORA 1IRXA 3ND5A 1TK9A 2W93A 3T4XA 5KQGA 2ORYA 3N97B 3V1UA 2WQZA 4F5EA 1LVUA 4O4HF 4EG6A 3DL7A 4AMYA 1G3RA 4LJ4A 3WGTA 4UAZA 2Q21A 2QMZA 3WMGA 3UAGA 4UXHA 1ECJA 2CZCA 5AHKA 1N2CB 1WABA 4CYMA 1IJKA 1OWNA 1QFYA 2XDQB 2E6KA 3Q2IA 4JC4A 4CIWA 3U48A 3HVIA 1YGYA 2HBLA 5HKBA 3DL0A 5H16A 3RBAA 3FOFC 3A1UA 1YT3A 5JAOA 1YB1A 1GUZA 1GR0A 1ISJA 1VTKA 2GCGA 4I9UA 5B3LA 2KFZA 2QA5A 3SHWA 5DTMA 1UC4B 2I1VB 3H42B 3UK7A 3W7VA 4ALNA 4UTNA 3KHTA 1O95D 4O8CA 1KARA 1Z17A 2A7XA 4G9EA 4RL4A 3ZWKA 4O3NA 4QNMA 1I0LA 1ULUA 2Y68A 1VFNA 4KQ6A 4LGCA 4M9RA 4NLLA 4PRKA 3T12A 4ZVLA 4RY2A 1EFPB 3OOWA 3ZCUA 1U9JA 4FEGA 3PTAA 1I3CA 2J5KA 1WAMA 5EP3A 1FCJA 2H3FA 1EQAA 3DD5A 4HDMA 2XUIA 1UDAA 3W2EA 3ZJ4A 4V2IA 1L1RA 4GP9A 1O57A 1NHGA 1OX4A 3ILVA 2XGJA 2R2GA 1R6XA 9ICOA 3MERA 2AQ0A 2EIXA 1Z0JA 3MWGA 3AJRA 2HVIA 3VO1A 1ODCA 1JMKC 4PLYA 5DV9A 5EXPA 4UD6A 1UUFA 2AFIE 2QP3A 4QTXA 5BP7A 7MDHA 3PNBA 1SUSA 5K0BA 3E7XA 2PR7A 1ZUIA 5JJ5A 4CEJA 1JG1A 2Q5QA 3ZVNA 3IM1A 1U49A 2IXAA 1XTPA 3EDCA 4NECA 3DL4A 4TT3D 4YWJA 3R76A 1HTBA 1BGVA 4C0WA 2BFEA 3KQVA 2P5UA 1TKAA 4IBOA 4KXUA 1TPYA 3LPDA 3MGIA 4KQ2A 4OXXA 4X85A 2H1SA 2C54A 2XI9A 1WSBA 4LVUA 2D2EA 3LOQA 5L1JA 3HY4A 1DK3A 4FDUA 3HJTA 3M33A 2ZRKA 1QV6A 4DG8A 1IVYA 1ZAYA 5BN5A 3AKDA 1NJWA 5PGMA 4ILKA 1QFZA 2DFLA 1NX9A 4G5GA 4R8UB 5BVHA 3O8QA 1KEVA 3MPOA 2ZI9A 1GG5A 3VUEA 3DO5A 3S1AB 1NLFA 2OKCA 4E15A 4YCSA 1SHKA 2D1TA 2DQYA 2V7XA 3JU3A 3H9JA 3KZMA 3NEAA 1H0RA 3L4BC 4DCSA 1Z2CA 4E33A 3F2CA 1T4DA 3IOCA 5ILQA 3RTEA 5BWMA 1RXUA 4MW0A 2AMFA 3I45A 2HIGA 3KHGA 2KZ3A 3PDJA 3QTLA 3W0LB 3BQ7A 7ICUA 4IQTA 2YOHA 1SXGA 4B9VA 3PSFA 3DWIA 3EIQA 3OKPA 4OKNA 5CEJA 1W76A 5BVHB 2AC2A 2W0MA 2XDAA 4LE0A 3UKJA 3HJFA 1ECLA 4N39A 1X7XA 2B4RO 3NIFB 1K92A 2E4ZA 4Z4QA 1LBEA 1PK1B 4NJMA 3UW1A 4LDAA 2JEGA 3BE8A 3JX9A 4TTSA 2DT8A 5JE8A 1VKRA 4EI2A 1M1YB 3C16C 3NQ41 1YJBA 3S3TA 4CR8A 1QONA 4EJSC 3C5CA 5CJPA 5JAMA 5D7NA 3CUEF 4JV2A 4OKIA 1YR8A 2GLTA 2HU5A 2QSUA 3R3HA 5EMJA 4ZVSA 3T9AA 4CM4A 4GZ6A 4NY8A 4AZ0A 4Y2YA 1RMTA 4P3KA 1L5YA 4OHRA 2M9NA 1SUEA 1Q92A 3IQZA 4LJ9A 5TJ9A 3JY6A 3NHMA 1P62B 5EFZA 5EUCA 2ZVPX 2P7HA 5PNTA 4RQNA 1JHUA 1XA0A 5DOZA 5K09A 1QHXA 1EIZA 2XVMA 5KFCA 2P1ZA 4GQAA 1JPNA 1NUUA 1Q44A 5DTEA 1IHXA 4XE5A 3VKUA 3SQIA 3PUYA 3TKYA 1LC0A 4BQIA 1KGDA 3R41A 4TWRA 3U0BA 2XWSA 1HR0B 3WAJA 1S8FA 4I4NA 5DP1A 3GWZA 2XCAA 2D4HA 3SKXA 4AYWA 1S8OA 2YBDA 2EAOA 4FU0A 4RXMA 4DILA 4LMAA 3AIMA 3QKWA 3OE5A 1XZPA 3E2MA 4G24A 2VBCA 3MWLA 1A8HA 1QU3A 1P2TA 3R3VA 1E1CA 2OGSA 1TCVA 5L4LA 4I2VA 2OC9A 3PKZA 3LL7A 4II2A 4QELA 2CDAA 4FNGA 2OM6A 1FYFA 4IIFA 3CISA 4TTVA 3OM0A 2JR5A 3DE1X 4Q7KA 2LUOA 5DHQA 4YQWA 3N9IA 4KQGA 1V37A 5G3YA 1DIAA 3GHHA 1D4ZA 3GJ6A 5ER6A 4RPIA 1PYOA 3BFPA 3EVNA 1CQIB 4YD1A 4OQZA 4R51A 1XYVA 1FXWF 1V48A 3R5SA 2IXGA 4BNDB 1KOLA 3L7OA 4Q9JA 5HM6A 3KUXA 1IIRA 1YI8A 3V4VB 5IVIA 5DE3A 3JZAA 3URKA 4GM0A 1EGVB 1Q3VA 3JQBC 4QU0A 3PV0A 3FOCA 5EVJA 1T9DA 4FB4A 1XNHA 1FMCA 2Z1NA 2Q1YA 4IR9A 1T5DX 4WXPA 3QUSA 2QV7A 3GX1A 4IR1A 1GA1A 2W2PA 1SUIA 2PG3A 1IN7A 3OECA 4KWHA 4BNTA 2ZWIA 1OVGA 1F4LA 4IO0A 3C3PA 3ROKA 3WAKA 2HBQA 1X42A 4G26A 1IDOA 5LJLA 2EAPA 4EITA 5HCUA 1IHOA 1PQYA 3K4GA 5GIPE 1M8GA 4WBXC 3HVHA 4K28A 2CEKA 1B42A 4F60A 5DCUA 5C4MA 5J2EA 2E7ZA 2EZXA 3H5OA 5AKLA 3KK0A 1JR4A 1NONA 4WESA 1GQFA 2F48A 5B12A 9ATCA 3I73A 2ZB7A 3PF9A 1N8KA 1O6CA 1U9YA 1KE2A 1O94D 2QJTA 2HJWA 5ERGB 4ZMBA 4CTOA 2BDUA 4DQIA 4QPZA 5LR6A 2FDCA 4HOYA 3RVSA 1NYTA 5TT1A 8ICEA 5BPCA 1EVEA 1O95C 1WMFA 4M0PA 4B4DA 4ZK2A 2H63A 3P9KA 5AVJA 2NZWA 3HSSA 3PPYA 4IDGA 1OC4A 2V0CA 3VPGA 5FPPA 4RCVA 3RUIA 3UXEA 1XEWX 1XN4A 4K6OA 4I6EA 2RHDA 4KRFA 2O19A 3KVOA 1DJLA 2WT8A 4XR4A 5AJHA 3IHLA 3NKLA 4ONEA 1Y4ZA 4H7IA 3ZR4B 4CEJB 4JROA 3KHKA 3PHJA 1EUZA 4MV0A 4BVLA 2R6JA 4HGOA 4KUEA 2VDLB 2V7BA 4B2PA 5IG2A 3AEXA 4JXZA 5KOJB 1KQNA 1X1TA 1EUDB 3HL4A 2E4WA 4N3CA 4CIAA 1G9XA 2IY8A 4F04A 1IMJA 3CNBA 5AQ1A 1ZD9A 4RAQA 2CMKA 3VYWA 3R40A 3G8YA 5BWBA 4ZIRB 2BTEA 1K1QA 1YE8A 2GERA 2GLEA 2I7DA 2OD7A 4KE7A 4LSWA 4XVRA 1LDGA 1I5EA 1GUFA 4L4UA 1Q1EA 1UBCA 2NO7A 3O38A 3UPDA 2AOUB 5A4IS 4MI9A 4ACOA 3DOOA 1SVLA 4AMZA 3RYFB 1TA0A 3ENNA 5JHHB 3SJCA 4X60A 1Z2NX 5LFAA 4TKMA 4CF6A 5JNRA 1SGGA 1R6TA 2KJQA 1QQ7A 3GXBA 4TL6A 5DW0A 5F9MA 2HPHA 3D2QA 1RPJA 1RM0A 1KYQA 2G1AA 4GE0A 4YGXB 3SLGA 5CM8B 5B6PA 2NRXA 3P7MA 2AG0A 2F9LA 2B78A 2J3DA 2JZOA 3RANA 5JQGA 2JI4A 1NK9A 1ENPA 1RYHA 2SKDA 2A3RA 4LHSA 4C6RA 2YIVX 4S05A 4RTSA 5SZJA 4RHYA 2PGOA 2W2NA 3I72A 4FKBA 2QE6A 3JZIA 4LRTB 3F6BX 4MYCA 3P0RA 3UNXA 1UPUA 2QAIA 3EXHA 2NQ8A 2KBFA 1G16A 3PX0A 1KFKB 3AF4A 2QOEA 4KW7A 3V2UA 4OHBA 5G0TA 1TRKA 5AM5A 2LCQA 3E4CA 3C1UA 2V7UA 4UM9B 1NMYA 1H94A 4RTNA 2RD2A 3H8JA 2BFFA 2NSHA 3QVGA 3WQQA 4D6YA 3FTNA 1VMIA 3PNYA 2C4HA 3AUYA 4B9EA 1Z4PX 4KWCA 4CN8A 5GM2A 3PI6A 5I7OA 3MMXA 4UBLA 2OBXA 1VM6A 1X6JA 3PVXA 2GEVA 5KFRA 1LQTA 3NEPX 5DHFA 5F4BA 1E1NA 2A7QA 3WRWA 5A04A 4KAJA 4NIMA 2X8BA 1NBME 3CS3A 5CT5A 3UV7A 4YDRA 5AKEA 1BROA 1GKYA 3TJRA 2J9XB 2C77A 3M5WA 3KPUA 3ETLA 2P5SA 3ES9A 3VU3A 3VRHA 3ABRB 3EZ7A 4NU5A 3E82A 4B2IA 3FCOA 1ZVMA 3GRAA 1MOSA 5J1TB 5IARA 3WGJA 1G7SA 3C6MA 2WQ7A 1ZQRA 3FMVA 4JENA 3VR4A 1OZGA 2CCGA 2OZVA 2P27A 3L6EA 1O97D 1RS0A 1EZ4A 1QGAA 1XVLA 4PGGA 3W8FA 4PFKA 4L73A 2XCUA 4WZBA 5C5DA 2IIPA 3JQAA 1YDFA 1M3SA 4BRSA 5KQRA 3VZCA 2GD2A 4WOBA 5KKNB 2RSLA 3UGTA 3BMQB 1E59A 1G4HA 5IXYA 1FUKA 4R41A 3N28A 1G8JA 3WL7A 1PJSA 4ECYA 1IOWA 1J8FA 2NYUA 2NYAA 2WVGA 4RXUA 1RNLA 3T9DA 1X7ZB 5FF9A 3FUWA 3GCWA 4QYXA 5A9TA 3S2FA 5EIBD 1K3TA 3NRJA 2VDQB 4HXEB 1GNLA 2FEMA 2LCFA 1JHMA 2SKEA 3A3PA 1RYUA 2NTYC 3F97A 4HTFB 1JEJA 4TT8A 5JWHA 3W79A 3ZYZA 4DMRA 1HLGA 5DJ5A 4UEQA 4HRYA 2IITA 5AVKA 2Z2YA 1VQ1A 4QFMA 4WOJA 4AKSA 1AQLA 4LZGA 1P3JA 2O3SA 1ND5A 4ADSG 1LDBA 3OHPA 1MH9A 3HO6A 2IEIA 1RC8A 1VXRA 4J1TC 1DGQA 2CXQA 4YRPA 1RSZA 4R54A 4NPAA 4EENA 1UBMS 1N56A 2FJ6A 4PYLA 4HWGA 1B14A 1JLHA 1GGVA 2ZTMA 3BTVA 3MJSA 2NZ2A 4DA7A 4QG3A 3ETJA 5A0TA 4DLLA 5LMNB 1C7YA 4QXQA 3VDQA 1I2ZA 3INTA 4C01A 4EGAA 1MABA 2IHVA 3MELA 1H2RS 4LWPA 1KE1A 1XQYA 5HF8A 4DLEA 1KJJA 3I9NA 4MRMA 4GMKA 2PX6A 4IWNA 4C3UA 5DBCA 1NPYA 5KOHA 1J49A 2WWXA 4Q4HA 1E2QA 3LRPA 4Y9TA 2ETVA 1I7QB 5LDGA 4BX2A 1TXGA 2ZJFA 1O94C 4JI1B 2P9JA 4F3NA 3R09A 2OZKA 4URFA 2FPRA 2R8EA 2BFEB 4KGVA 4RE5A 3O8LA 5JC8A 4C30A 5KPDA 3DF9A 2ODAA 4A8PA 3I2GA 1ZYQA 3KEOA 6GPBA 2H8KA 1GZ5A 4HDAA 1GKIA 2W71A 1NY5A 4OJPA 3AW9A 3EAGA 4CRXA 3CE6A 3NTOA 5ALYA 3RVJA 4AG6A 3TG2A 2GK3A 2WDZA 4UASA 2WWIA 2W58A 3C15C 3EQ7A 3WGIA 1HZZA 3IIIA 1EHCA 2XCQA 1QP8A 2PMFA 3C21A 1AGNA 2B37A 4JBXA 3VVBA 3BRCA 4HB2A 2YBEA 1Z7WA 4JLAA 3LUBA 3E3LA 1YDGA 3A2NA 2JAPA 4RHXA 1JT9A 2AB0A 3IDZA 3Q8PB 4KFCA 3RJTA 1LKZA 3QU4A 5IDYA 4LF6B 2ZUEA 2BJHA 1E7WA 1XU4A 1I7LA 2BD0A 3K9BA 4FK8A 1TMYA 6REQA 2VKQA 3TZLA 3RB8A 4Q9LA 1G5QA 2P9EA 4IIJA 5KU1A 5KX5A 1BRTA 4W5HA 2QGZA 5DDMA 9ICWA 1KXZA 4XD2A 4IJWA 1Z83A 3TAUA 4KR3A 5IJ0A 3LBIA 1WSAA 2IZ7A 3UA4A 3EUEA 1AZSC 4H17A 4QZBA 1TYZA 2HF9A 4U1RA 1M1ZA 2R6ZA 4Z0TA 3NVKI 4BKOA 4PTYA 4BZPA 4Z6FA 2WHQA 2AGOA 4WK2B 1R5JA 3PC6A 5EQFA 3RU7A 2PT6A 2PMKA 3ZNNA 1FUUA 5B1SA 4DVGA 4AO6A 2WP0A 3EBPA 5HBGA 2R4UA 3GFVA 2WU0A 4NHOA 3RC2A 4EG5A 1ETUA 3JPYA 3T7DA 3QSGA 2C2GA 1K5OA 1SD5A 2HA3A 5IC5A 4V1CI 1NULA 2VDKB 1P9OA 3S70A 4DBLE 3B12A 2VPQA 1DQSA 1US8B 3ZQKA 1CLEA 1R8SA 5IRCD 1KVQA 1QXSA 3R5JA 2ZWVA 3U3ZA 4CMKA 4EF5A 2QTTA 2ZBPA 1JJIA 2ISQA 3N87A 5L9XA 3QVGB 4KN6A 4KFTA 4CMEC 1KRXA 5BOLA 1LPNA 5AIBA 2OE2A 3DZGA 3PQ4A 2C1ZA 3HNPA 4P38A 4YCBA 3WFJA 4KR9A 2RGEA 3DFFA 5JXWA 3IAS6 1U5BB 9ICQA 2LMRA 4RYDA 1SXHA 1ETHA 1WDMA 2I4MA 3FTDA 3TSZA 3AKCA 8ICRA 1M75A 1WQ1R 4L3OA 5EMHA 4DQDA 4IEFB 2PSFA 4IHJA 5DT2A 4PHTA 3UM9A 3VR4H 3OAAD 1PFKA 4G8BA 3TW6A 3FNIA 4NCJA 2K4HA 7ICPA 2XMSA 3GN1A 3P9RA 2H1LA 4FYHA 3ZHVA 1CKEA 1JLMA 3TN7A 2FW9A 3VGPA 2IXDA 1I32A 1GA4A 4QZAA 4BE7B 4PBSA 3LBNA 4HLUC 4Y2TA 4B7AA 5KJ6A 3IUMA 5KT7A 2B8WA 4EAQA 1Q0TA 2XOKA 1HK7A 5BMVA 3QE4A 3U80A 3N74A 2P2DA 2J3EA 3EDYA 3NS7A 3DD1A 4P34A 5CYFA 3LWBA 1MUUA 1VLVA 2OCEA 4K03A 4U39A 1O9BA 3U7QA 2GVZC 4PHFA 4H1HA 3OH8A 4ZQIA 5B4UA 3TARA 1CIVA 1Z37A 3C6BA 4R8VA 2R1ZA 5D49A 3PW2A 2PN1A 3PIRA 1OB5A 1H38A 2V9WA 1V3TA 3VHXA 4LF4B 4R40A 2KOBA 1DXHA 2Z2JA 2VJ5A 3LSTA 1ANKA 3BIJA 1JPVA 2BPOA 2F7SA 3M6KA 2G8LA 3IFSA 2QMHA 3ESQA 3FSGA 4A8JC 4G1FA 7ICQA 3ZWAA 4YLEA 3WR5A 2EFYA 1SKYB 1M1NA 2HWUA 3HJCA 3VZPA 4BMOB 3NJ4A 4ZZ0A 5IHPA 3THXA 5GGXA 1VA4A 2JLQA 2ZS7A 1XP5A 1I2MA 2E9SA 4PLZA 3JCZA 3QX8A 2PNJA 4OAOA 5LP6C 3DZBA 1YVPA 3RTGA 2H1IA 3C8ZA 4F2PA 4I2JA 3FE2A 4GLJA 4YN3A 3BFVA 3HP1A 5CP8A 5FR1A 3N7TA 4DJ5X 3R6WA 3TSOA 5HS4A 2V6MA 1JIXA 5KNCD 1NNEA 1ED1A 3G8DA 3B1ZA 3DKRA 2Y1IA 3K15A 3ZK7A 2YN4A 2PDAA 1XLTC 4GRAA 2XTNA 4LGYA 4LAFA 3X1XA 2IBMA 3D43A 5IUNC 3WMWA 2AOWA 1Q7TA 4XDYA 2KKPA 3AUOA 1I24A 3V2GA 2W7PA 3D3NA 5AICA 2BYTA 4MRSA 1K89A 1L0BA 2VA2A 1GDHA 2WAAA 5A71A 1DAEA 4TM7A 4ZZ2A 3U6KA 1OXUA 1ZITA 5TPZD 2NO9A 2V9PA 3A14A 3EFBA 4NG5A 4WA7A 4RQ5A 2G0TA 4EJMA 1E1DA 1S1CA 4RK0A 1BMFD 2OBLA 4J2HA 4EW2A 3ZXUB 1M73E 4KBGA 3JZDA 3K96A 3B13B 5KTQA 3O82A 4XTRA 5CVVA 5EINA 1R6UA 1CC1S 3T7TA 4W9MC 2VYFA 4R65A 4RVOA 4IIYA 3LHDA 2WJAA 2NU9B 1LWOA 5ICCA 1QYRA 2J6BA 1XMXA 2Y05A 2A9KA 2EWVA 3ZTWA 2JIDA 2F77X 8ICIA 3OWHA 1YTLA 3GJRA 4ER6A 3LT0A 3RR7A 4ZPXA 3H2YA 5L3QA 1JDPA 1JFFB 1IQUA 2PX0A 3OFKA 2JAQA 1PAUA 4LHXA 5F2NA 5F9FA 1YONA 2CDNA 4PHGA 1BDMA 4IJKA 1S97A 4ZD6A 1SVOA 1W88A 3DEAA 1ADGA 3RS9A 5J2TA 4BX3A 2PQ0A 5AUQA 2OO5A 1E2GA 1YJ8A 3F5MA 4L9SA 4UHDA 1V8BA 1HRDA 4PTLA 4PU0A 5DGCA 1FF9A 3I2IA 1W30A 5KT2A 2PU5A 3FF1A 4FINA 4AF6A 2UZ3A 1ZDMA 3FBGA 1L7RA 4NZOA 5D6OA 1JEOA 2HWXA 4WFQA 5M29A 5FO0A 3KQKA 1DP4A 4YAOA 2VTBA 3SDBA 5ALTA 4M37A 1JU3A 3T7AA 1IY8A 1SV0C 3BL6A 3DKVA 4C8OA 3HN6A 1LDEA 4OGWA 2NAPA 5H4HA 3COWA 3HDHA 4ARSA 2CXPA 1JG7A 2G9ZA 2H7CA 3PNKA 2KI5A 3K05A 3UICA 4BZWA 3VC8A 3CZ5A 4CCYA 5C9ZA 3HU3A 3L1IA 2X8AA 3GRZA 3QU9A 3IJ5A 3TTTA 4JI8B 4TQSA 1IY9A 4Y2HA 2A1IA 3ZNPA 4MUKA 3DGFC 2AKAB 1D5CA 2GHIA 2ADFA 2ODPA 4KLOA 2Q50A 2WP8J 4YAEA 3JPSA 1UIMA 1Z26A 4J3NA 5JNSA 4AC9A 4JN6B 5JFTA 4IFEA 4FFNA 5ILOA 3L8GA 3FXAA 4KPGA 3OKFA 5KFPA 2W2LA 2BEUB 3U7GA 5J3JA 5HFJA 4PXSA 4Q3NA 4JL6A 3ZXXA 3L1JA 5HKLA 4D5EA 4CCHA 1ZZGA 2XIQA 3PCXA 3E9DA 2F4VB 3ABZA 5I8ZA 3CVXA 3AMVA 3B78A 1GO3F 3BHNA 1YQGA 3KPJA 4GVXA 4GOOD 1JIHA 1SQGA 4MS4B 3ZV7A 4QUKA 4BB9A 4B8YA 4D74A 2MJLA 4IZIA 4XWKA 2F64A 1KP3A 2GNAA 4O5OA 4UNQA 1DG3A 1NURA 2V7QD 4UMDA 4AS3A 1VGVA 4Y3UA 3EHEA 3CB4A 3OTWA 1M8JA 2PBRA 3RRNA 1AROP 1DQRA 2M1ZA 3QYAA 2BTQB 3ZZUA 1Q7EA 4NNJA 3PT9A 2BFCA 2CLDX 4P58A 1BW9A 1ZQUA 3PNVA 2FMTA 1NJ1A 1MGPA 1X1QA 3MCUA 1A2KC 4FXPA 3RVNA 4B4VA 2HMTA 1UBKS 4KMOA 1DOAA 2PV7A 4JI3B 4D96A 4YAJA 1TO2E 4JEHA 3SZ3A 3KBBA 4HUTA 1NZJA 2DJIA 4TRJA 4DLZA 2JXJA 3RIMA 1HBJA 1L5LA 3KPWA 2IUYA 2DOKA 3TZHA 4J0DA 4HK4A 1RRFA 2X13A 5A4KA 3ZW8A 4BAZA 3VSEA 3R0JA 1U0RA 4F4YA 5BSFA 3PHLA 5KFTA 1NW9B 2JLCA 4KL8S 1P5HA 2QNRA 5CM9C 4NCNA 3OJOA 3I9LA 5FLEX 1IHYA 1OHHA 4HGYA 3AUKA 4Y2VA 1KL7A 2GUWA 2QMYA 2JATA 2B94A 2KN7A 1I01A 5ALLA 1B74A 1DUIA 1DO8A 3KKPA 3HCWA 1QS0B 3L4EA 3TLGA 4EFKA 5IEJA 3H4BA 5EERA 2OC4A 2FPUA 1R0YA 4NNOA 1QK3A 3EODA 2Z8XA 2EZUA 5ERYA 1Z88A 4LWQA 1JWAB 1C3VA 3C43A 2LBPA 4Y6OA 5J1SB 3CZPA 5IU6A 2E0IA 3CLTC 1RAHA 1WVMA 1XMSA 2L0XA 1PGNA 1TA4A 4HI0E 2Y0CA 1AUXA 5EP4A 2V4RA 1HEUA 4XLLA 4MIKA 3WLSA 4E5KA 4B33A 2VSNA 3K8QA 4P7GA 5DM60 2BFCB 1D0VA 5L4SA 3WBBA 1R8JA 4N65A 1KJZA 3KKEA 4E09A 5KYXB 1AS2A 5C0OE 4QODA 1N8SA 5FFFA 2GJ8A 3KSAC 3VPFA 1EFPA 3VYSB 3PY8A 1W29A 4Q3CA 5B37A 1PV4A 2FRVA 3LIPA 2RDJA 1Y4UA 3LK7A 4X0EA 3SS9X 3E6AA 2HO5A 5CA0B 1RLJA 3GUCA 4OU4A 4CV2A 1AV6A 1NZBA 4I29A 1WPGA 2PA3A 3G2OA 1R9NA 3K30A 2VCYA 2D0DA 4DUGD 2BFNA 1E77A 2AWNA 1MG5A 1XV5A 1ZBDA 3LK6A 4BGDA 2GZAA 3LY8A 5GVRA 2PKQP 3WLHA 3I4FA 1N7IA 3HACA 4F21A 3DLHA 4B47A 4M1YA 3I1JA 2F43B 2D6FA 13PKA 2PMWB 2PSEA 2PRIA 3G2MA 3NFYA 5EWLB 4EELA 4WY2A 4A6XA 2CHGA 2OLEA 3CZMA 5DBHX 7ICKA 4CKBA 5ECWA 2XRYA 1XMOB 1YRQA 5IYZA 1SC9A 3CN7A 4WT7A 1NJ6A 4IVNA 2PWPA 5BW6B 1KI2A 1RPAA 4MVJP 5KWVA 2HR1A 3Q88A 1JXLA 1OJLA 1GPH1 5G1NA 3COSA 3RVOA 3KOWA 2VI5A 1NJXA 2GN2A 1U8AA 1J8VA 1C50A 1BQEA 4XD7A 1Q6YA 1SXJE 4TZKA 3JTMA 5CB1A 3D02A 5JY1A 1Q7CA 1JDVA 4H60A 3V1NA 1QK5A 4ON9A 3R8CA 2KLHA 2D0PB 3CX7A 2PKRA 3MOIA 4DREA 2UZ4A 2FETA 4P7KA 2GYYA 1Z34A 5AT1A 4L5CA 3WLTA 1ZWKA 3MIIA 4DOMA 1OXJA 1RXIA 1MVOA 5AESA 3VUFA 4U2GA 2VYVA 2YS6A 4TXLA 4G5QA 1C2TA 2QP4A 3OPYI 4OY3A 3IAM6 1RXVA 5NLLA 4GMGA 5J58A 1FDOA 2XVZA 1T5OA 3PL1A 1GQRA 3DLTA 5ALZA 3VHLB 1V4NA 4KLUA 1Y7HA 3HVKA 2WTMA 1HOXA 1FVOA 1WF3A 1QYIA 3SQWA 2KJ5A 3AVWA 2FZGA 1XL0A 4ZO7A 1RRKA 2P6MA 4QWBA 1AK2A 1YKGA 2BH9A 1N0VC 1GSOA 3H7IA 4C6TB 1COWA 1PZXA 3CU5A 4JLJA 5G0WA 2H4ZA 3VCBA 2R47A 2AMJA 3F47A 3MUOA 4DLSA 5D3ZA 2ZAIA 1BIFA 2H54A 4ZAYA 2I6UA 4NLGA 5K9ZA 4NBVA 5KFJA 1AHNA 5DG7A 3QITA 2ZBFA 3U4IA 5DX0A 2H7XA 3BC1A 5IBRA 1BTOA 4DDWA 1A82A 1M66A 4L07A 1UODA 5JW6A 4B81A 2XMRA 4H7JA 2HXYA 3LXRA 2H0RA 2PIAA 1EFVB 3PC8C 4MR8A 4RADA 2P6UA 3C48A 1VJ5A 3CIOA 1CP2A 4C4RA 3JAKB 4TLEA 2RH5A 4H0FA 4UKDA 4QUHA 4OHKA 3NM5A 3OUZA 2WE7A 3A6HA 4J0CA 5K0FA 2VWGA 3WIBA 2HT1A 1HI9A 4YR0A 4AZVA 4TYMA 4F6RB 4Q1CA 2EGHA 3O9VA 1NRJB 4DBVO 4EY8A 5KTNA 2XE4A 1JFSA 4KLAA 4NZZA 1ODTC 4LHVA 5IF9A 4QTZA 2X5KO 2CUKA 4FDTA 1CUEA 3AR3A 4JR0A 4M49A 7GPBA 4GBED 4QOJA 1LBTA 3G0HA 1Q2XA 1JYFA 1X8XA 2ZWOA 4GFJA 3CRW1 5EY5B 1Z35A 3SKVA 2IH4A 3S29A 3FHOA 4A8JA 3QOXA 2XTMA 4US1R 2PFKA 1MZPA 2E1RA 1TMGE 3WSTA 3WYBA 2CLSA 3VC2A 5L3SA 2C82A 5ISMA 3I2KA 3AV0B 3CH6A 2XNSA 2Z3WA 2I5PO 3ODGA 3A4VA 3BQTA 2B8TA 4G89A 8ICHA 2PBZA 3IESA 4LTMA 3HJGA 3PYLA 4RVCA 2C42A 2PBFA 2OBBA 4UHKA 4P4SA 3KKMA 4JP2A 3WWYA 2WR8A 5CJ7A 3AI1A 3O4FA 3FCYA 1JHYA 2OHOA 4ND7A 5BYKA 5E8RA 3X1DA 5ADWA 3I4LA 3IUPA 4LRXA 2V7PA 4FCWA 1ZXXA 3QLUC 5F33A 1SVIA 1VCOA 3TW8A 1E92A 2VYND 1Z56C 1J2UA 5KT5A 4TV8F 3GJ3A 4AZ0B 3PJFA 1SB9A 4C8NA 1ZESA 3EMBA 3OC0A 1P0QA 1LK0A 2AJ8A 2D8AA 4D97A 1QLWA 1HXHA 1ZM9A 2QM0A 1NBOA 1R88A 2F9MA 1KMMA 2YS7A 3O4RA 1XMIA 4RDXA 2ZSJA 1KY4A 1JQ3