1O08A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 1-phosphate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o08A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o08A01
1RKQA 2YN4A 3QUTA 2JARA 2ZBDA 4KX5A 3NANA 3OCWA 4EX6A 2I54A 2WFAA 5ALEA 3W5CA 2IOFA 2HX1A 4PNHA 2I6XA 1Z4QA 4YIKA 2GO7A 5A3SA 2FPSA 3P96A 1RMTA 5AI9A 5ALXA 2IA5A 5AVXA 2G08A 5AI8A 2I34A 3WK5A 1L7MA 3WGVA 1O08A 3S6JA 3J7TA 5AHXA 3NRJA 2C4NA 4HGPA 3IJ5A 3QU7A 1AQ6A 2HF7A 5AK4A 5AW1A 2FI1A 5ALRA 2B1RA 3ZWKA 1RMQA 1WPGA 3KBBA 2B1QA 2BY4A 4YIHA 4KNVA 4J03A 4C4SA 5ALZA 2MU2A 1L6RA 4BYGA 1Z5GA 5AKHA 2W11A 2QYHA 1TE2A 4NV0A 3A3YA 1VFPA 5A3RA 3I6BA 2HDOA 3QUBA 3E58A 3L1VA 3N28A 3KZXA 4EX7A 4FE3A 2WF7A 1Z4OA 4QQFA 4OFZA 2R8XA 1J8DA 2PKEA 2EAUA 1ZD5A 2JAUA 3QX7A 5AW7A 1QQ5A 3ZU6A 3WKEA 3HYCA 4HGRA 3U7HB 2ZOSA 3ZWDA 5ALHA 3QU2A 3SLRA 3ONNA 5AKLA 1NNLA 3N8GA 1WVIA 2FUEA 3NUQA 2YJ6A 2Q5EA 1MH9A 2FPXA 4HGQA 4I9FA 5AW5A 4BX0A 5AM5A 2NYVA 3ZUPA 3RF6A 1Z4NA 2I55A 4EELA 2HEGA 1TJ4A 3ET4A 4ZEWA 4CF5A 3QLEA 5ALSA 3N5KA 5ALDA 2B8JA 5AM2A 4HGOA 5AVRA 3UMBA 5ALIA 2JGAA 2R8ZA 4QJBA 1RQNA 2G0AA 4MUMA 5ALLA 3QNMA 4EZEA 3EPRA 4XE5A 3WK7A 5ALPA 1KYTA 2W4MA 2X4DA 3A1DA 3ZVNA 1K1EA 4MWOA 3ZTWA 4IG4A 4BEWA 3L0CA 4CNQA 4UM5A 5JJBA 1VJ5A 1T9ZA 3OCUA 4FFDA 1WZCA 2P27A 2I7DA 2G1AA 3TLMA 2QLTA 4J2TA 1ZRNA 5AK6A 5AIAA 3R4CA 5AVVA 5AKXA 2WF9A 2WM8A 1ZS9A 2ZXEA 2GMWA 3SKYA 3W5DA 4GIBA 1ZD4A 5ALUA 1YS9A 3WK9A 5T41A 3SHQA 4Y2VA 3OCXA 2YMQA 4UM7A 3ZX5A 1T5SA 3L8EA 2CFRA 3KDPA 5IS2A 3WKBA 2HSZA 3N1UA 5ALTA 1ZD2P 4UAVA 1SWVA 2Q4TA 5AW3A 1U7PA 2YMLA 4C4RA 4KNWA 4H1WA 5AKEA 4OD0A 4KN8A 3QU9A 2HHLA 2P9JA 5AK3A 4UAUA 2RBKA 3CZ4A 1Z4LA 2G80A 2AGVA 4GXTA 1JUDA 3FZQA 2FDRA 4CE6A 1U7OA 3E8MA 1WR8A 3PGVA 4EEKA 4OHFA 3M9LA 3PGLA 4YCLA 3B8EA 2B8EA 2OM6A 3NAMA 3NASA 4Y2PA 3I28A 1ZJJA 5AW0A 2I33A 3CNHA 3AR3A 5IT4A 4IFTA 2JAOA 2B82A 3DAOA 1FEZA 5AVQA 3FPSA 4B6JA 3ZTYA 3MC1A 3EF0A 3AR8A 2ZBEA 3BWVA 3PDWA 4CF3A 3QGMA 1RC8A 2Q4RA 2AH5A 2R8YA 3OCYA 2HO4A 1Q92A 3E84A 3NALA 4BX2A 4UMFA 3U7GA 5FP0A 4FYPA 1X42A 1SU4A 1U2SA 3MN1A 2RARA 4NABA 4BEVA 3I1YA 1RLOA 2OBBA 2YMPA 2D2VA 2HCFA 4XPZA 1S8OA 3QYPA 3FM9A 4EENA 3EF1A 3AR6A 1S2OA 4DFDA 1F5SA 4DW8A 1Q91A 2WF6A 2OA0A 3ZX4A 1L7PA 3KOOA 5ALNA 5AM0A 5AVUA 3ZVMA 5IT0A 1NRWA 4UASA 2YJ3A 2MU1A 3M1YA 1QH9A 1ZOLA 3DNPA 1RKUA 2R8EA 5AM3A 5AW8A 5AW9A 1L7NA 2BDUA 4Y2QA 1TA0A 3AR4A 3WK6A 3E81A 1RMYA 3ESQA 1L8LA 3ET5A 2ZG6A 1Z4MA 3SF0A 5ALJA 1QQ7A 3F9RA 1ZD3A 1SWWA 2O2XA 3L7YA 3DDHA 4UW9A 2P11A 4Y3UA 2W43A 2JAWA 2AMYA 4AS3A 3DV9A 3UMCA 3MMZA 3ZVLA 3U19A 2FPUA 2FUCA 3OCZA 1Y8AA 3K1ZA 5ALWA 2FEAA 3FVVA 3AR9A 4CF4A 1RKVA 2CFSA 4BKMA 4I9GA 4JDPA 1L7OA 2G07A 2B30A 2WF5A 5AM1A 1YDFA 2YJ5A 1TJ5A 3WK4A 1CR6A 2C8KA 5AKIA 3SMVA 2MSNA 4NFLA 5ALMA 4F72A 5AI4A 3L0BA 5AVSA 5ALVA 4RESA 1QQ6A 2IOFK 2PQ0A 3KC2A 1T5TA 2YJ4A 5AESA 5AVZA 4Y2SA 3I76A 3WKCA 5AKGA 1Z5UA 5AK5A 3IRUA 3R9KA 2C88A 1YJ5A 4YCMA 4HYTA 2EATA 2HI0A 5AM4A 3A1CA 3ZW7A 4ZEVA 1LVHA 2ZBFA 3SKXA 4ZEXA 3U7FB 3U7EB 4UMDA 4XOUA 5ALFA 2OYCA 3MPOA 5AVYA 2GFHA 3L8GA 4BNDA 5AIBA 3L5KA 4BNDB 2VKQA 5AKJA 2WHEA 5AVWA 1EK1A 3L8FA 2BDEA 4Y2JA 1Z88A 2DQSA 3EWIA 3IB6A 3VAYA 2ODAA 3WKAA 1RPZA 2CFTA 2FPRA 3L1UA 4F71A 1RLTA 3L8HA 3RFUA 2YMMA 3ED5A 3QU4A 1YNSA 3OPXA 1PW5A 3FGOA 1VJRA 4HAIA 4UU1A 2RAVA 3ZI4A 3W5BA 4KX3A 3WGUA 4Y2RA 1Z4PX 5ALKA 1NF2A 4BX3A 1N8NA 4YGYA 2C9MA 1U2TA 3B9BA 2CN1A 1RDFA 2EARA 1Z4KA 4AS2A 2ZBGA 3QXGA 2NO4A 3SD7A 4UMVA 4DCCA 1RQLA 1EK2A 4OCZA 3AR2A 5AW2A 2FPWA 2YBDA 4NAVA 5ALYA 4YH1A 4JB3A 4RETA 3R09A 3U26A 5AW6A 2NO5A 4DWOA 4C4TA 1Z4IA 2IYEA 3GYGA 2GHQA 4Y2YA 5ALOA 3QUQA 2WF8A 4G63A 5AI5A 3AR5A 5ALQA 1IWOA 3D6JA 4XQ0A 2GHTA 5A3QA 1TJ3A 1O03A 2YY6A 4AP9A 2HOQA 1ZRMA 5AI0A 3FPBA 3L0YA 2G06A 5AKZA 1LTQA 3KD3A 2IOHA 1XVIA 4NWIA 1Z4JA 2YFYA 4UMEA 2P69A 5AVTA 3UMGA 1YV9A 3QUCA 4Y2TA 1L8OA 4E88A 4UARA 4UATA 4YCNA 3HLTA 3N07A 3AR7A 3NIWA 4Y2UA 1RLMA 2HF2A 5ALGA 1U02A 4O8CA 3WKDA 4HGNA 1N9KA 3PCTA 4L6AA 3UM9A 3W5AA 1CQZA 4G9BA 1RRCA 2C8LA 4L57A 4BBJA 3A1EA 1XP5A 4KYTA 4Y2XA 3OTQA 2AUTA 3ESRA 5E0OA 3QU5A 3B9RA 1QYIA 5AKKA 2RB5A 1XPJA 5AI6A 2PR7A 5AICA 2B0CA 2G09A 5AW4A 3WK8A 3OCVA 3BA6A 1J97A 4L6CA 4UU0A 1YMQA 5AKYA 2O9JA 3U13A
chains in the Genus database with same CATH superfamily
2H9IA 4R8UB 1NZDA 2ENWA 3OCWA 3NANA 4G8CA 1IK6A 4N6GA 4J1TC 4RK5A 3VA7A 1TAMA 1GPUA 1L5SA 2PLFA 3W5CA 1QRSA 4UB6U 1G2OA 4XCXA 4DUYB 1FBNA 5TGDA 5P21A 3MELA 3FYHA 3GUYA 1HZJA 3MS4A 4YRLA 4ECEA 1HYGA 2UZ4A 1S10A 4G0UA 4DCTA 1KKXA 1EB9A 3DE3X 1YVEI 4L4ZA 7MDHA 2X5XA 2YYAA 2HRQA 1HZZC 3C16C 1U0NA 1XJ0A 3S6JA 2IVZA 3BGOS 2IXAA 2ZQZA 4JR0A 4PXYA 5M04A 3MHTA 2PKXA 3HWWA 2BPFA 2PA0A 2XOXA 4ZYUA 4LTMA 2IHKA 5IVDA 3IG5A 4MUGA 4RQTA 1R4AA 2JLSA 4DXHA 3NMUF 3PITA 2B0JA 2F90A 4MUJA 4TMTA 2B1QA 1V7PC 2PVPA 4JT4A 4EYOA 3BS4A 4YIHA 1NURA 4CKEB 1TCVA 1CG6A 3I9OA 5K99A 1R8XA 2FWRA 4GM4A 4OFBA 3LWZA 4AJNA 4CKWB 4CQLA 4JKOA 2HRCA 3H1PA 2IJGX 1X92A 1K5PA 4UBLA 2ONYA 3THXB 1MJFA 4ENTA 5KG6A 1VHTA 3LLCA 5CM2Z 1M2OB 2IY7A 2OGSA 2ESRA 3B60A 1LX7A 4UB2A 2ECQA 3U3OA 3IMKA 4BHTA 1PJLA 3Q7IA 4NONA 1C1YA 1KSFX 1W0KA 1J2EA 3NLLA 4Q9AA 3R75A 1GZ4A 3GILA 1OLXB 1GTVA 1OZFA 2GYYA 2J6UA 1JSCA 2HWXA 2NO6A 2NTJA 3OX3A 4KGZA 4FFPA 3SFTA 4YAEA 5EXXA 3O1LA 3WSVA 1QIIA 1MENA 4G0QA 2BHRA 2EYUA 5ESXA 3V6JA 1JR3A 1X8KA 1E1DA 4F3OA 5FQNA 3HL4A 1ZMBA 1D04A 3DTVD 2IDKA 2VXOA 3CFYA 3EOAI 5EL0A 1W36B 2OQ2A 2YHAA 2VJNA 5F5LA 5F1KA 3WDLA 1ZUWA 1T2FA 2Y0DA 4OOFA 3VNRA 3VNBA 5KVSA 1UWKA 2FW0A 4IXWA 1Z4NA 5EE0A 3QEBZ 3EVCA 2F7SA 4XRRA 3UJ7A 1G8JA 3ZGVA 4PONA 4TL6A 1HEKA 3IPYA 4B8YA 4NZMA 1G3IA 2HEIA 2V6JA 5K45A 1BVSA 1U7WA 1J25A 4O3NA 1H05A 4XZ3A 2QK4A 1KQFA 4EBCA 2QJOA 4MEAA 4BGVA 2IEGA 3PRYA 4FFBB 2AD1A 4H4EA 4PZEA 5C2JB 1KTVA 2RH8A 4M21A 1Q1NA 3T35A 2HBQA 5EZYA 2FP3A 1IDN1 4C0XA 5TMEA 1UOEA 5KYVA 2H57A 4HAUA 1G5TA 4DJFC 3F1KA 1I80A 4PO1A 1BHSA 1OJ7A 3C3DA 2GOLA 4KFTA 4NFSA 5EMLA 1C7YA 3QOXA 1Q14A 2KMLA 4NYIQ 5A4DA 4G1CA 3TZQA 1GNQA 1NV9A 2X2EA 4C0AC 5JUWA 3G6KA 4JS0A 3CX6A 3RFCA 1WSBA 4R54A 4HLNA 4RSMA 3RARA 2J08A 1YE3A 4M9JA 1LPPA 1KZ1A 5TMPA 2BFCB 4HQLA 2OGZA 3EQ2A 4ELUA 4G9EA 5FORA 4P80A 1Q7CA 3AUFA 2FPMA 1MX5A 4OIMA 1RYMA 4IDPA 1NUTA 2CZCA 1FJXA 4BV8A 2WF9A 3E9MA 1K1SA 2WM2A 4F2HA 5IAJA 4A4DA 4IJVA 2AK2A 5BR7A 2AZXA 2ZRMA 4HAYA 3OQOA 1IU9A 2PT9A 1X9WA 1DTEA 3ECAA 3N76A 2Y1FA 4WJLA 1QS0A 4A0GA 2YMQA 2OGTA 4PZYA 4CM3A 1AO3A 1E7MA 5I3CA 2OV1A 2GBLC 2GEKA 2EGHA 3BTUA 4DLZA 4I19A 4GU5A 1I4DD 5MFZA 4P92A 3TQHA 1E1RA 5AUQA 4K81B 3U4GA 4ZU3A 4IRKA 5IHXA 4X1KA 1FP4B 2JCYA 4FFVA 1ZQTA 4X84A 5CEFA 1OT5A 1ZUD1 5TC4A 2ZUDA 2AN4A 4XARA 4Q16A 1Z47A 5A6VA 1YVRA 3S0JA 3Q3JB 4PF1A 5FPQA 4C76A 1WABA 5CAEB 2ZTMA 3FW1A 1IXRC 4LZDA 3HY6A 3M2PA 4ZT7A 5KPJA 1WKCA 2QZPA 3PQ8A 3V72A 3SPXA 1GQOA 4R69A 4AN1A 3SQNA 4LY3A 3TS1A 1OXTA 2A1IA 3V9AA 2OYRA 2ZTDA 2E87A 4F06A 2GCIA 1LCIA 2QXTA 4YT4A 5DCUA 3WLNA 5FI1B 4CZ2A 2EZYA 2G1KA 1Y3CE 2YJGA 1JI3A 1ULAA 3DEFA 1AUXA 3UTDA 4IO1A 4XDHA 5K9ZA 3ZJTA 4PLGA 1KH1A 1VLBA 1KO8A 1M2JA 2DWPA 1A77A 3LK6A 5FNVF 1UK9A 4PG5A 2NT3A 3A31A 4FYKA 3GJ7A 1NPTO 4G84A 4K8OA 5FOWA 1JKIA 2B8EA 1T3GA 2HF9A 2JVJA 3EHDA 5JH7B 3K1YA 1SCUA 2IPMA 3QKUA 5IDVA 4ZZ3A 1FSZA 1FX0A 1G20B 5A9SB 3SSAA 4EJ2A 1CUWA 2ZWPA 3KQNA 3EQ9A 4ZJZA 2M0NA 3CNHA 1QFZA 2X9VA 3PFKA 4KBFA 3HUDA 4TOIA 2DKNA 4ZQHA 2B82A 4IYJA 2CXNA 1G42A 1XLUA 3JD0A 3GPIA 3MNFA 4MW0A 1KH3A 5H2FU 3IERA 3TTUA 2VQEB 2NTNA 2GVDC 3QA3E 2DQNB 1P2UA 2AG1A 3PDWA 2Y9MB 3QVLA 2OBYA 3OX2A 5SYNA 4C2BA 4UQGA 4CF3A 5FNVB 1QE5A 2PEZA 3EXAA 1TNDA 2XB9A 5M5BA 1FFSA 3AZOA 2BEJA 2ZSFA 4LJKA 3UNXA 1DUIA 2EP7A 3G9XA 3K35A 2I9GA 2QW0X 4M4SA 4UMFA 4FYPA 4X20A 3SAJA 1CRPA 2XUGA 3KFVA 4LK3A 1TZJA 3U4AA 2A5GA 3ISTA 2WJAA 1FNDA 2R87A 4DDUA 3MWDB 4NHEA 5IKOA 4EBEA 4MR7B 3SX2A 4ZVRA 3RC3A 3I04A 5KOJB 4EZ6A 1EUCA 4OJPA 1U1FA 2PMFA 3INYA 4Z9YA 4CN8A 5ECGC 2UUAB 2O8EB 3KKQA 4OAPA 3NJ8A 2R8KA 2X13A 3KSDO 4BMDA 3MD0A 1USIA 2ZIVA 3NNDA 4M2LA 4ER6A 4TPKA 2ETXA 2YVUA 4EJSB 4Z49A 1HLFA 5KJCA 1AQYA 4WE3A 5DGIA 3PUKA 4DC1A 1JHVA 2VUTA 3IP9A 1BN6A 1VE1A 2VZ8A 4D96A 3ICQB 5ALNA 2X4GA 5H81A 1YWGO 2IOQA 3ER9A 3I9V1 1D0IA 2YDYA 3CISA 4NCXA 1U0TA 4RK7A 2EZXA 1CJCA 2QB1A 1M73E 3MWEB 4P35A 4MQEB 3DKPA 3RJ5A 1QK5A 1IMJA 4RKYA 2PUTA 4KQ1A 5LMUB 5AT1A 1ZVVA 3ZHBA 2L17A 3DDZX 1OW5A 1BPZA 2RQ5A 1T9BA 4U63A 4Y2QA 3NETA 5K0GA 1IEQA 1TADA 2QYTA 1BDJA 3LX4A 4ARUA 1CVIA 3WBJA 1F1JA 3RH4A 4IR7A 3TM4A 4N54A 3X2SA 2GF2A 1NYLA 4HXGA 3KUKA 3BXFA 1I7LA 4GXNA 5G53C 5BURA 5CFLA 2FUG6 2DUYA 2HQSA 4BO3A 1CRWG 1EX9A 1I5OA 1QRRA 3UK6A 4AKSA 3WGZA 5DGDA 4MQLA 1SCUB 1JB1A 3GEIA 1XFAA 4DOAA 1NT4A 2OHJA 3DL4A 3FNQA 3KNZA 4NJEA 3NTOA 2IX9A 4OFWA 3FYUB 4TL7A 5EOZA 2YR0A 2PIDA 3BX1A 4BQSA 5B1IA 2Q5CA 3F5MA 1ZGHA 3BBPA 5HJ5A 4IDNA 1FSSA 2Z1DA 4OOEA 4KLNA 1QHXA 3ZNOA 3K1ZA 3RG8A 4C0WA 2D7JA 2XJ9A 1DQRA 2J6TA 1BXZA 4TTIA 3T7SA 3ELDA 2BFAA 4ENPA 4BKMA 1YA6A 2WTAA 3IEKA 5DN6A 2C59A 4CEJA 3DFMA 5I48A 3SZ2A 2FJ0A 5CB4B 1FS4A 2DB3A 5DRTA 2YCLA 3AUOA 3BWYA 1Z7EA 2A0WA 1TJ5A 2B3DA 2HU7A 3F6CA 3G17A 3LKBA 3QKSB 2XQJA 1SV4A 4IH4A 4EO4A 5LN1A 2RE8A 3E48A 5AKIA 3SMVA 2MSNA 5CUQA 3RDPA 2OYYA 4TV8A 2Z83A 1ECBA 1T8SA 1ADCA 1FP4A 4RMIA 3C3JA 4F72A 1AC5A 1U1IA 2VAMA 1J20A 5AI4A 2HLHA 2ZB3A 2MYNA 2PUVA 3EC2A 3MWJA 2IYVA 4X90A 1RXWA 1P1IA 4U2KA 4RESA 4F9GA 2R8BA 4EFLA 1GVHA 4OF4A 5JQWA 3L4KA 1J0EA 1UBUS 1YB5A 5LQNA 4DSLA 3HCNA 4X93A 1M1YE 2QTNA 4XLTA 1I4LD 1BQEA 3ITDA 2XCPA 2IYSA 3CWQA 2Q0HA 4CT0A 4AZ3B 1EVKA 5FWAA 3D8UA 2PUCA 4G9GA 4ECWA 1HI9A 3R9KA 3HBNA 1TW2A 1CZLA 1WU8A 2HHJA 1UK8A 2P77A 3UMVA 4IQGA 4PL1A 3OHMA 2H7YA 1MPTA 4RD6A 4MFFA 1SPXA 4DLXA 3P9SA 4FC6A 1PWHA 2JLWA 1M8GA 2WIKA 2WWGA 4FDLA 5FYDA 4NZZA 1IE3A 3SHOA 4MTLA 5HF6A 4ZOLA 3RJZA 4HB4A 3TLAA 3RKSA 4NMLA 4JP5A 1TM7E 1CX9B 3KD2A 3PC4A 4D9FA 1FX0B 1G20A 1R27A 4QFBA 4ACOA 4MO9A 5EHNA 3RKUA 3WJ7A 4JENA 2IZOA 2C7BA 4F5RA 3GLKA 5CP8A 1NW9B 1N7IA 3N2IA 2C0CA 3JYLA 1RAEA 4XUDA 3PPVA 4BP8A 5C3MA 5J2BA 1FIQA 4YUXA 5C0YA 2W2XA 3R3VA 1X8XA 3RAQA 4PAWA 3SV3A 3Q9UA 4IIXA 4YJFA 4DV1B 2FZCA 4HWPA 2H3HA 2WG1A 2P2YA 1X0VA 3R6GA 2HJRA 4LQDA 3AY6A 2JGIA 3ZV5A 4REQB 1H85A 1RJ9A 3STVA 5JD5A 4KRYA 1UFKA 3GFVA 4CGYA 4BQFA 4DSNA 2QMOA 3EGEA 1EZ1A 4W1QA 3AUSA 1IQUA 5DTQA 2BM1A 4W5JA 2BEVA 5FUYA 2L18A 4BYMA 3LX5A 5LQCA 3V1LA 4Q3LA 3HJNA 2IS4A 1KWKA 3ABIA 3KKOA 3RTGA 4C7JA 1LPBB 4CVNA 1YKFA 4QU5A 4OB7A 2I7CA 1BZYA 3K5HA 2Z5LA 2ICAA 4QZCA 4MR7A 5K8TA 3ANYB 1XCGB 1FU7A 4A27A 5KYTA 2AG5A 3ISDA 2XUDA 1VDMA 4RU1A 4KFRA 1SKUA 4N3NA 2DX7A 1DXOA 3ZZTA 1OLOA 4RQ8A 1A7JA 1ISSA 1B8VA 1CB7A 3NG1A 4FJ1A 3W2IA 1DTWB 5EVCA 1T4CA 5DGAA 1E6EA 1XA4A 1K6XA 3DE0X 3BRWA 3EDOA 4JX8A 3LS2A 4NATA 1PD1A 4HI0E 1EUZA 2AG0A 3LMKA 3NTXA 4B3RB 4V39A 1UMCA 3ORHA 3QXCA 1SL0A 3QG1A 3M9WA 4EY5A 1KY3A 3HJUA 3O21A 2Z0MA 2PFGA 4KSYA 1NHWA 1RFLA 2HLDA 3V4LA 2QBYA 3T3OA 1ITZA 1BWRA 2JZNA 1RM5A 3HPQA 2CXYA 1G18A 2D06A 2BE9A 4ZPXA 2Z95A 2W9AA 3OE1A 2IYEA 1GQSA 3WNQA 1J00A 5LSAA 3CKYA 4EGJA 1QGDA 1TK0A 5HKOA 4RNOA 2Q0SA 2RGEA 1PFQA 4M49A 1YCFA 2AI3A 2OGWA 4WADA 1R50A 3MUOA 5JH7F 1SC4A 2C3UA 2WD9A 1XC7A 4DLNA 5JALA 2D2FA 3AP1A 3QXHA 1IFXA 1VYUA 1V8OA 1ECJA 4JB2A 1Y1SA 4AQ7A 2PG3A 4HZUB 1A5ZA 4CEIA 2XOEA 1ZA1A 1O3YA 4HQOA 3O0DA 4PQRA 4G3IA 5ECDA 4QQNA 5JHGB 1YF3A 4DV0B 1OLUB 4ES6A 4KBYA 2CT8A 1NK0A 1DEOA 3BQMB 2HSDA 4KWHA 1NY6A 1YQ9A 4M47A 3GFPA 4WK4B 4FQ8A 3O38A 1TU3A 4Q44A 2PDAA 4OI2A 2NQTA 3ZPXA 4R84A 1CZNA 3FTDA 4JITA 1IJFA 4OQLA 4FSDA 4RO0A 1KQPA 3GI1A 2VSOA 5CTJA 4XJTA 5L6LB 3V8QA 1EGHA 4F4YA 2FFRA 3KKPA 4KZPA 5C8VA 5IJ0B 5KFMA 1A5AB 1U8XX 2A9RA 2GOYA 2X0IA 4RIIA 2IIPA 4JBXA 3U0BA 2IC5A 1VIVA 2QROA 2H3ZA 1YH3A 5KFNA 1RLMA 3MGAA 2HF2A 3GEEA 5IFKA 5EWMA 1U02A 1ZQZA 1AQUA 1DPGA 5HEKA 3RPEA 4TTVA 2NSHA 1BWSA 1SB9A 2NGRA 1H4TA 3AF5A 3FVQA 3WLRA 1EI9A 2P0YA 3BAFA 4GMKA 1QGAA 4F5NA 2LRHA 1DC7A 4HD8A 4NH4A 4E15A 2AF4C 5KNDH 4LJ7A 1SBCA 4OJLA 1CQZA 1H2YA 1M8KA 4G9BA 1NR1A 1Z00A 1J24A 1SELA 3P2OA 1L9XA 1SBIA 4BVKA 4C0ZA 3LECA 3C2MA 3LXRA 4YS6A 4ZT6A 3RVDA 3ZW8A 1EA5A 2I4TA 2JLBA 3L9XA 3HB4X 3IO3A 1IN6A 4XEHA 3O92A 4YMWA 3L3FX 2IHJA 3M6XA 2XA9A 2C2EA 3ANXA 3PV0A 3NOXA 2K8AA 4CMKA 3PT5A 3INRA 4K03A 3W5VA 3RRNA 4OU5A 1H9AA 4L22A 2CLOB 3MCUA 2VRBA 4MLCA 1Z6YA 4MJLA 3D9QX 4R2IA 3ZE7A 4QYWA 3K09A 2H1SA 2KM1A 1Q0ZA 3KTAB 1V43A 1H0HA 4Y9TA 4BAUA 3K9GA 4ZIRA 5CBPA 1TEHA 2CJYA 2KHZA 2UZ0A 1QH0A 3JQ8A 3NBUA 3OWHA 3KVVA 5D3QA 5GVRA 4YCAA 1JEEA 1U2GA 3IAM1 4PC7A 2QP4A 4C7ZA 4NAUA 3CE9A 3J7TA 2FW6A 4ZXPA 8ICCA 1QB7A 5TQ2A 1VA5A 3RCBA 1RHKA 3QNUA 3OICA 4R81A 2JANA 4RJJA 3ACDA 4ESVA 1NSTA 2VQ6A 4WN9A 3PGMA 4NYMR 2O0JA 2FQQA 1R18A 5K4AA 2OBNA 4ETMA 2FSPA 3O84A 4KIWA 3OF2A 5J0TA 1Z34A 3BILA 1UBRS 1P18A 4TURA 5IZCA 5AVXA 1RFGE 4HSEA 2I87A 3CGGA 4FMBB 5L3QB 1A88A 2DH5A 1T5DX 1L8XA 4BLUA 1T35A 4F5QA 1A0PA 3H2KA 1B6RA 4HHEA 2CC2A 3SXUB 3DDSA 4QDKA 1OAAA 2C4HA 2CV2A 3GJZA 4ZI5A 3H0RB 5ALRA 4B84A 1BJTA 3HU5A 3KEQA 4DSUA 4RKQA 1GDTA 2F1JA 3B51X 5JG7A 1N62A 1GCIA 3R0VA 5EP4A 5FTJA 5EXTA 3CXUA 3MBYA 2W11A 6REQA 3O74A 2I71A 5FOUA 1Q1AA 1PT6A 1CUIA 1PV1A 1GTL1 2HDOA 1PVVA 1V95A 2AR9A 2X8AA 1I2CA 3GJ0A 4ER3A 3EA0A 1Z8HA 3WA6A 2DPYA 3KZXA 2PQ2A 4MVJA 4FYVA 1V6SA 1N7GA 2V4QA 4IIEA 4UTZA 5FFMA 1AUOA 1Z4OA 1N3IA 1OLXA 2OZKA 3FCOA 4QQFA 3I3SR 1UZUA 1UQVA 2A9KA 2PEYA 3NDIA 4EF6A 3NVWA 2C1EA 1QQ5A 2BL4A 2AG6A 5EPUA 3HYCA 5K4GA 4HGRA 3CR3C 3E9YA 4U7DA 3I58A 5FLKA 4A6EA 5B3LA 2JJ2A 3ONNA 9ICRA 2SICE 3QXXA 4YJGB 3NTRA 5E1BA 3DC2A 3NHBA 1KDZA 3LDGA 4JLWA 3G3EA 4OQNA 1EHYA 1NBEA 3HKDB 3BK7A 4O4JB 1UMCB 4F93B 1F0KA 2Y27A 1BD4A 1J0BA 4JBYA 4TRNA 5AJZA 4GX1A 4BVHA 3HKEA 4DLAA 1X3SA 2ACKA 4KACA 3H13A 3W8RA 3K30A 2R7MA 4O4IF 3AVXA 1R12A 4KLMA 1T2CA 2IS1A 4WIAA 3GLUA 4LHWA 2JK1A 1ODJA 3BQ0A 2CF6A 3NT2A 1XVUA 4GBJA 3OFJA 3ZD9A 1G5QA 3GJ3A 5C4GB 5KL8B 2BRUC 5L8VA 3JRXA 3KTOA 3CX7A 4KFUA 4B3FX 4H16A 4QICA 1JU3A 1SXGA 1H2AS 2XUKA 3AI3A 4PTYA 5B4VA 1PN3A 5EXPA 2KBEA 1L3IA 1PBNA 1N2XA 3TW8A 4JMLA 4C9BA 4W5NA 2HWUA 3I8XA 4Q9LA 3ZY6A 3PP8A 4W9NA 3DAFA 2AJDA 2C61A 1C7EA 3CY6A 4JOQA 4QYIA 3H8WA 1VL0A 4L73A 2E1EA 1ZQQA 1N0WA 3QEAZ 2J09A 4NC9A 4WN9B 1JDUA 4AO8A 2J41A 5ALPA 4ARSA 4D0GA 5TJHA 1KYTA 3E22A 3P5BA 1T0BA 4AX4A 1XCPA 3GFRA 4ZVVA 4JIGA 5JVDF 4MDFA 4ALJA 3HABA 3IR7A 3LYSA 3R77A 4IG4A 4EF4A 3DLCA 3M4NA 4C01A 3LWDA 3E03A 1JTEA 2ADMA 2WIFA 3SHTA 4DPMA 4I4TB 1CF2O 3W9UA 4FFDA 3TECE 2Z7JA 4RJIA 4M0CA 3D8BA 1P1FA 3TSOA 5J8YA 1C9NA 3UJ9A 1J5PA 2LGJA 4O25A 5ITVA 2PZBA 2DQKA 5AK6A 2GK7A 3CRNA 1ST3A 3C98A 5IC5A 4OHKA 1IB6A 3KWMA 5KQLA 2CJPA 2ZXEA 4MZDA 4G24A 2MUTB 1A1SA 4HDKA 2BKXA 4J0GA 2HO5A 3OX4A 4J9OA 4QO7A 4DQXA 2C9YA 2JFFA 2X41A 3F1LA 5B7GA 1EB8A 2DUJA 2QRNA 2R8GA 1F2UB 5CITA 2ZCJA 5LNK1 1K8XB 2CNBA 1CV2A 3ROFA 2I3AA 2BPGA 1N34B 4QGGA 4XW2A 1ZQOA 4YEDA 3W04A 1UT5A 5E6UB 2UKDA 3CUEF 2Z2YA 1UA0A 2H1IA 1GAWA 1U6KA 3OSUA 4LY0A 5BORA 2HV8A 4GL4A 4X3PA 1SKBA 2REQA 1ZQSA 3LVFO 1U8AA 4ZJPA 3MM4A 1U4SA 5HMLA 2SCUA 2WA2A 3GJ8A 4UAJA 2WUDA 1M5UA 3N8IA 4D02A 1MOZA 4P31A 2YMLA 4F4IA 3JPNA 3FFAA 5AKEA 4K4GA 1O9GA 2GCPA 3M6LA 4QYTA 4CV1A 4DR1B 2X1HA 3H19A 1E9BA 2EXXA 1Y0BA 3DAYA 5GIPE 1Z2EA 1MQ9A 1B15A 2IF0A 3NC0C 1CUAA 1NW4A 3RGGA 3I30X 1LVUA 4ZGGA 4KVAA 1L4HA 1M8JA 3AT1A 3DOJA 3H4TA 3LUGA 5DWDA 1JYEA 5C32A 2BCVA 2ID7A 2D1QA 4IVQA 4B9VA 1IBSA 3PXUA 3PKIA 4PQFA 1FQKA 4LRTB 4P8RA 3S27A 4LF4B 1AKRA 3QYFA 4TSFA 4X45A 1ZGAA 1Z73A 4LSWA 1E1QA 4JIMA 2OL4A 4HL6A 1AUQA 4QPZA 3WQRA 3DLAA 1ACMA 1EVZA 1LXCA 4H7KA 4DL7A 1NLYA 4BE9A 4I2IA 1W9MA 4L02A 4CKBA 5HJEA 1XZBA 3W1EA 5BP7A 2K60A 1J6UA 1XQ9A 4J43A 3ROXA 3PL1A 5AJHA 3FOFC 1VLQA 5DLPA 2HLDD 3FLAA 4Q4AB 3EASA 1KK2A 2AC4A 3T79A 3NZEA 1XNQB 2NPOA 4GMFA 3H4DA 2EP8A 3FPSA 3BERA 4A6XA 4DJTA 1T36B 3D5QA 4A2QA 1ZQMA 1I1OA 1KPHA 1J8FA 1UPUA 4CKXA 4B40A 3VNUA 5BWNA 2FMTA 2Y0EA 4Q1FA 4AJKA 3PWZA 4L9RA 2PLRA 1ZW6A 1IZ9A 1HG1A 1KC1A 1V16B 3ENVA 3F3KA 3F7OA 3MJSA 4BATA 2XECA 4OI0A 3S8YA 2ZE7A 2PXIA 3EZ9A 4DDKA 1Y3FE 2R6CA 3QVOA 4HATA 5HK9A 5KTPA 3FHLA 2AJTA 4IDOA 3SJAA 2ZJFA 3IEVA 1QC5A 1O0SA 4CWAA 1L7VC 1DXYA 2JH8A 4XDZA 3CPHA 1DT3A 3I1YA 2C83A 2A1TS 4RH1A 4XVUA 3AIIA 1VIDA 2GDJA 4UXIA 4WRRA 3U62A 1AJEA 2H4HA 3IUNA 2BEUB 3CZQA 4M88A 9ICKA 4PGFA 3EF1A 2ZTCA 2YWJA 1LBEA 1G8YA 3AR6A 3CW2A 2X2FA 3EBLA 4CQNA 2IT1A 1UH5A 2JDIA 2ZIXA 3IDQA 2ZSJA 2YL2A 1UZMA 1F8YA 3FIJA 3MT9A 4I1RA 4U7GA 4ZJUA 5FH9A 5AVUA 3RSHA 2YWEA 1AQIA 4TQSA 5CJ7A 1VG9B 5IKEA 1N61A 1Z6ZA 4OL0A 4WBXC 2Y93A 4DFPA 2D1TA 5CR9A 3DNPA 5EP1A 2IV7A 5B7NA 4R2JA 2FLVA 3QELA 5AM3A 2IZ7A 3WMWA 1ESEA 2IEAA 4JDUA 4YCDA 3SHWA 3SXJA 4DSTA 2WIBA 3ZZUA 3GPLA 3K72B 1Z0DA 2BZ1A 2D5LA 2WWFA 5LJIA 4MULA 5HS6A 4YRIA 3LC0A 4ND4A 4XAQA 1XZDA 2NQ8A 3A2LA 1GPBA 5EJ5A 2PUHA 4A0RA 1BQ4A 1IC6A 1SURA 2BFDB 3JATA 1U3UA 4IHQA 4LA4A 5KFHA 3IO5A 3C41J 5EVJA 2ZYUX 2WUWE 3LL7A 4R8MA 1XJ5A 3FI9A 3E2EA 3KPUA 3NVKI 1G6KA 4DTCA 4K6CA 5EWFA 1GZSA 4GWKA 3EBOA 1QSSA 3K73O 1O0CA 2VYVD 3AHIA 3UPTA 1JQDA 1H2WA 1NVTA 1ZICA 3AQFA 2DR0A 4II7A 3WZMA 1JYFA 3C39A 4A92A 3DV9A 4CV3A 1A6SA 4JEHA 3FDXA 1YK0A 5L3VA 2QUZA 5IDXA 5ENDA 2IBKA 1WXQA 4Q45A 2YOGA 1LEHA 3ICXA 3C2QA 1PKXA 4LOKA 4GD3Q 4WZAA 5TT1A 1PVOA 3ZD6A 1QIFA 1SJ9A 3K75D 2ZTSA 3CE6A 3S4YA 4E5VA 4FBUA 3CUVA 3E7FA 2NT4A 1LI4A 4OKNA 4FSHA 5CW2A 1PU2A 1GGMA 5F51A 2PZFA 3IX7A 4PLFA 4LZLA 5IWCA 3DEAA 3A9TA 3R3HA 3NBAA 4Y1EA 2G07A 3WWPA 3DPIA 2YJ5A 1YDFA 2JGEA 5TJ9A 3H8MA 4IGAA 2O50A 1HLGA 4W7IA 5J0PA 3CR7A 1KJZA 3CTPA 3KVRA 5B64A 1D6SA 2DYKA 3N4MB 4V24A 3PW0A 3UBMA 4NZOA 3TDMA 5L6MB 3F49S 1NTOA 2J3QA 3I9KA 3TLZA 4MEXA 4NV1A 5JDCA 1U8FO 2NXWA 2PX0A 2QOEA 2FE4A 3DFZA 1YBHA 3OJOA 5EXDA 4B6EA 4FYXA 4NXNB 1XJCA 2VCHA 3RH0A 3BG5A 1ATIA 4EHLA 2FEWB 1MKYA 2W22A 4UU7A 5E0KB 4BUZA 4UBKA 3UJHA 4FQ5A 3IVXA 4O5AA 1I36A 1N6PA 4NE9A 2IWHA 1OBCA 5IH3A 2XICA 4DR3B 3U1TA 1E64A 5AVZA 1PYGA 1XTUA 2QRZA 2XLBA 4UFPA 4QREA 1GN8A 4L5IA 4LV5B 3MWEA 1MGPA 4UNSA 1ABEA 2XJ4A 3QLTA 1K3UB 5SZIA 1O2DA 4UEKA 5DT2A 2XVXA 4H1VA 4H27A 4YALA 5TLSA 3KB1A 5EP3A 5CB1A 2ZBFA 1P9RA 3IP5A 1E2QA 1CQIB 4ZHQB 5IXYA 5KWEA 3ZHOA 3HADA 2PY6A 3OO1A 2M6SA 4IAOA 2OYCA 5F9LA 1H2RS 5B2EA 4HEJA 5ICFA 2I7VA 2C4VA 4DEZA 1EWQA 1COZA 1TCCA 1FDTA 1IHPA 1I3CA 2Y1IA 2ZANA 1E9RA 4JP2A 1L4LA 5G0WA 5KHOC 3GP8A 1T0UA 4HSGA 3IILA 4PTZA 1EK1A 2BZSA 4O3OA 5CGQB 1XRNA 2VJLA 3KZVA 1X6VA 1RVDA 4TXMA 2W2OA 4IIJB 2WKSA 3CF4G 4KXXA 3O2NA 1IMOA 4LF9B 3JASB 5FNVA 4YRDA 3AHEA 3QOYA 4I4NA 3VHXB 3WKAA 3JZDA 3MUFA 3W9YA 4DRXB 1IBMB 1E79D 4M0DA 4Y6GB 3RM3A 2ILVA 2JJ1D 1FYVA 2HT1A 2A94A 4IDCA 4FHEA 1GCOA 3FDZB 2HBLA 5SV2A 5SYMA 2QORA 2BCSA 5L40A 1N2GA 2D13A 1DEAA 1HT3A 4LF7B 5EMJA 3G88A 5KFJA 4OREX 2GBPA 5ADHA 1Y9EA 4YFYA 1FFXB 2NW6A 3LQ4A 5HRUA 2QL5A 4JI0B 2PSDA 4CM1A 2I03A 2KB0A 4IL6U 2OKGA 1EUCB 2O0HA 2FX2A 3RUHA 1GSOA 4Q6BA 4ZOLF 4WBSA 1M2EA 5ITZA 1TK2A 1LI5A 1IM2A 4S24A 4C87A 5B6PA 3IIIA 2D0DA 4HAVA 5BUSA 5I4IA 1KQQA 1YBAA 3DXYA 3GRZA 1Y3DE 1W73A 2FQ1A 1Z19A 4Q93A 2BGGA 3DMFA 1RCFA 2AQ4A 2I2DA 4C7YA 4LGMA 4AS2A 2DERA 3N2KA 4AMBA 3ZKWA 3SD7A 1TEXA 1JSZA 4F2PA 4OCZA 3Q8MA 3EPIA 4HPXB 3WICA 2VDWA 1JQAA 2NRVA 2AX3A 1DDOA 2XHZA 4KE6A 1KR2A 4NENB 4FZVA 4NLLA 4OGFA 1L4MA 3T7AA 3KALA 3F5FA 1I6KA 3ZCVA 3GVIA 3HDVA 1WUYA 3NYQA 3VDQA 4RABA 5TEVA 2NRWA 5AW6A 3OZDA 5GADl 4EDFA 2UXDB 3OHAA 2GN4A 2PKWA 4FOPA 4MJ3A 4P3NA 5CNJA 1U98A 2Y2VA 4DV5B 3CF4A 4K8RB 4RUKA 1XVLA 1ZR2A 2HWYA 3UCXA 3BQ1A 3VXKA 4UVGA 4D9NA 2C4UA 1RQ2A 3P19A 3MLBA 3KAPA 4HB3A 3AIOA 4ZJYA 4KB5A 3HKZF 4XUSA 4GP7A 4XWOA 1Q57A 4OAOA 1SU7A 4IINA 4AJHA 3WLKX 1T13A 1RYBA 2C77A 1USKA 3PW7A 1O7JA 3KR0A 1TVKA 1E9AA 4EW3A 2DCMA 2YHBA 3AU2A 4O5KA 1GZ5A 3RU7A 1JIXA 3WA7A 4G6ZA 2ZTLA 4G8JA 1WKBA 1BCSB 4LKOA 5F3DA 4MPTA 2AOUB 1T5HX 1NF9A 1VHDA 1HQCA 1JN0A 2FKNA 4FOOA 3OE4A 4R8SA 3T9AA 5J0RA 3GBSA 4BLWA 1I4WA 5BWCA 5JYEA 2PUAA 1F14A 1Z18A 3PT9A 1M2VB 4M1TA 2IUUA 2QT1A 1BXGB 5J8YC 3O9ZA 2X8BA 3IEXA 3FNHA 3QKRB 1ZNYA 1ISFA 2HHQA 4JBIA 4BV2A 3OTHA 5J4YA 4H2DA 2ZRHA 3NIWA 4UJ3A 3VR4A 2E4YA 4I2VA 2BZ0A 3QLUC 1YOVB 4M9ZA 3ZCTA 1T9DA 3E3LA 5ERXA 1P6UA 1XXHA 1GNVA 1W4LA 4O2BF 4GI1A 3U37A 2RDIA 1YJAA 2FB9A 2JZBA 3EVAA 1N9KA 3W5IA 1Z1BA 2KFNA 2AXEA 4RKWA 1I32A 4Z8YA 5HW0A 5HX7A 3TJMA 1OGIA 3NHAA 4UBNA 3M1IA 5DM1A 5G0VA 4MS4A 5KSOA 1P44A 4F3NA 5H0IA 3M6IA 1XP5A 3L6UA 4TKZA 1K7XB 3OTQA 2ZU6A 1WBBA 1F2VA 2HGZA 3C6KA 4FR2A 4M22A 3KU4A 1F20A 1S2DA 3RYCB 4LZPA 3I01M 1USGA 1G1AA 1QYIA 4LVUA 4WGGA 4KLQA 4DC0A 1GPWB 5BYAA 1IVSA 1RXYA 3AL0C 3EW9A 2GXSA 2C84A 2GKSA 2OFFA 1Z13A 3PNQA 4QE3A 4J3NA 2LD4A 5JJKA 1V4VA 4KAXA 4RDIA 1Q0UA 2JGFA 4L5BA 3UAGA 1J1IA 1V1RB 3WMGA 4PZDA 1E58A 1FL9A 2OC4A 4BU1A 3PDHA 5EJ4A 4TTAA 2K6GA 2N42A 2P1ZA 1E0JA 2VHCA 3BK2A 1TYCA 4K0KB 1NN3A 1CDZA 4F5ZA 2FA9A 3HJGA 3IAAA 5EHGA 3KK0A 4X00A 1E2GA 5DGTA 3B5IA 4YMIA 4WXHA 2JRCA 4DG8A 1OFUX 4HX9A 4FGZA 2I6XA 4KQEA 4MSUA 5A3SA 4QIWF 2KZMA 4MVCA 1BDBA 4NMXB 4JYZA 3MXOA 1PT8A 4XR4A 2ZVPX 1OFIA 4E2FA 3WK5A 4P4SA 2OEHA 3KZKA 1M7BA 5BMVA 4M1OA 3EMDA 1EGAA 1FTYA 1SXJA 5AHXA 2W6JA 3I42A 3BWBA 3L8MA 3PNYA 5CNKA 5IJ0A 2PBRA 3AP3A 1YB1A 2ZCUA 3G0DA 1P3JA 4MUYA 2LCIA 4MOWA 1KW4A 4WK2B 3F5SA 5K3DA 4QIWC 1NFFA 5CB0A 2B4KA 1GUBA 3W2GA 3W3AH 9ICWA 1JV2B 1GT6A 4FWIB 1XZCA 2BY4A 2C9OA 3SAGA 1PG2A 1LLUA 1SVLA 4J03A 3GEMA 3Q9LA 2JD1A 5TQVA 2G63A 2JFZA 2O8NA 1ZQPA 5F2NA 5BV1A 2CLIB 2JIZA 4OLAA 1SUAA 2ZYGA 1J5XA 4MA4A 3IVRA 3LX8A 1CUUA 3LJKA 3NORA 1X1AA 1R0WA 3V2HA 4L8YA 4I29A 1DRKA 4PQYA 5FLYA 3NEJA 1JJAA 2XDQA 1T15A 2UYYA 1BAPA 1KL9A 1E60A 1WF6A 2FLNA 1EFCA 1J8DA 1EFVA 1TGVA 2OHHA 2PLNA 3GGJA 3GRKA 1SUIA 1DTWA 2A0YA 3ITEA 1KMIY 1Q1QA 1K6EA 1X7ZB 2IYFA 2EX0A 2P30A 3KXIA 4E3ZA 2CYBA 2RD2A 2E3JA 1VCMA 2PVCA 3HDQA 4Y1RB 3RC1A 1T25A 4F3KA 5ITSA 2GM3A 3T7KA 4C1BA 3AFOA 2A9OA 2EL7A 3SZRA 4J1TA 2CFOA 3K6KA 4GZ3A 5HUHA 4C7KA 2ZYWX 4IQ0A 1XZKA 3FAZA 1MH9A 4B43A 3G6VA 1GGJA 3L01A 1BDIA 2P9CA 2FR8A 3EUEA 3UAWA 4AXBA 4NX2A 1CI4A 1NQOA 2RGGA 2X0KA 3CN7A 4YV0A 2I5PO 5JO9A 1RM4A 2ZWVA 1YQTA 2ZJ8A 2COKA 2XCUA 2NYVA 4LE0A 3W5SA 4B4WA 4EAQA 4EATA 2ZIUB 2WD7B 4QASA 4KIUA 2JA2A 4IHJB 3ET4A 1MA0A 1QIDA 2AJ8A 1R66A 2RIRA 2YOHA 2CWDA 3IE2A 3P27A 5ALSA 2VA2A 3EXG1 4B0OA 1M6YA 1LRKA 4FZNA 1Y89A 3R40A 1X6IA 2WYUA 4GQAA 4K05A 3RQIA 2YVQA 3AEYA 2I5HA 5KQPA 3QX9A 4XYGA 4PRKA 4D4KA 4M1KA 3L7KA 2EJBA 1GR0A 2R8ZA 3LUCA 1OZAA 5ICMA 2RBEA 3A6LA 3ZXYA 3EZ7A 4UQOA 2FEMA 3LYLA 1JEJA 1KU6A 2O52A 4EZEA 2TMDA 4I9NA 4EGFA 4IIJF 5C8DA 5KVAA 3EH2A 3HEMA 3DV0B 2W4MA 1DIAA 3A1DA 2P79A 1B6TA 4YA6A 5FNZA 5KX5F 2WJYA 3CLSC 4B7AA 2PMDA 4MWOA 2UZAA 3H86A 5DMHA 4HR7A 3UQ0A 1M2OA 2XI9A 1U8UA 2XADA 4FPXA 1OLSB 3BORA 2DC1A 1ZK3A 3VR2D 2BGIA 3WWOA 4K7JA 3PJRA 1T2NA 1OBOA 2PX3A 1RC0A 3EVEA 2XGOA 2PWPA 4UM5A 4BQIA 5JBNA 1SCDA 5I47A 3RB3A 3AM4A 5CLLA 3ZHRA 3HHPA 5C0OE 3S1SA 3U5ZB 4R1PA 4RVFA 1QE0A 3NRBA 1KEJA 4F8RA 2BT4A 1TLFA 4WTOA 4JK3A 3EGIA 3FJYA 4E5UA 1DELA 1JEAA 2JHCA 2NXJA 2QRMA 3F7MA 3MTJA 4JQZA 4GO1A 4Y6PA 1K63A 2CDCA 3A4YA 3QX8A 4GPBA 2H48A 5CCEA 2LZ0A 4LHSA 1GZHB 9LDBA 2QF7A 3FOZA 1XXHB 5AHWA 3ZK7A 3TNJA 3UMJA 3R9WA 2BMFA 2Q1SA 5GVSA 5B36A 1G9SA 1OYYA 4GLLA 2FN3A 1PI3A 3OTWA 4NCKA 1UC8A 3A28A 3SZ3A 3B6ZA 5DB6A 1RKXA 2VHTA 1SXJD 5ALTA 2W6JD 3BH7A 1ZD2P 3DEJA 5BOSB 4OQ4A 3CNBA 2QY6A 4PSDA 1BCRA 1YL5A 3ER8A 2EG9A 1EGQA 4PCLA 1L3CA 3UV6A 4DWJA 4AYBF 3G2PA 3JQEA 3FVWA 3PNVA 1GQYA 1FUYB 1XZMA 3N6VA 1BG6A 3MQFA 1YT3A 2JH7A 3H5LA 3T7IA 4NOKA 4PXSA 1GGKA 1T8UA 3NTQA 4EBBA 1K8ZB 3LOQA 4GXTA 3TZEA 1JFFB 3PE3A 1NP7A 3NHMA 3G9ZA 3S28A 3WHLA 2B94A 1E9DA 3PHBE 3GRRA 4H35A 2KKVA 4AYBC 4CE6A 1H94A 2FR0A 4JWNA 2JB9A 3M5CA 2J5QA 3OEEA 4M38A 3W6UA 4N5HX 2H07A 3I9JA 4URWR 2V74B 3VHLB 2CXUA 2VPWA 1U7XA 5JWOA 1IPFA 4TV9F 2JAPA 1ULTA 4CMCA 1H1LB 2EZ8A 1ZQIA 2VRWA 3WVNA 2F1KA 2OWDA 4IKOA 5LZ8A 1NZFA 3EVZA 1JE0A 4RTPA 1NKVA 1ZD8A 4DOCA 2OWOA 2E18A 3LAWA 1JFTA 1EGMB 4PSUA 2JASA 2AWNA 4GKAA 4QOJA 2H4JA 2FW9A 2NXCA 5DRYA 1TAHA 2DP4E 3SK0A 4BU0A 3ZXIA 3HTXA 4MYSA 1KAOA 1WHSB 5DPMA 5IEJA 4DQRA 2DKFA 3BWVA 3HBLA 2ASJA 3HWRA 3TIXB 2WM3A 5J5CA 5IUNC 1SZHA 3U49A 4Q18A 4R2MA 1RD4A 2XGJA 4QM6A 4FB5A 3LQFA 3VU9A 3ILXA 3EXFA 3MUEA 4QQRA 2OXTA 2ID9A 4PAGA 3GW8A 3EIOA 3ZCPA 1QHYA 3FUUA 3QA9A 3U7GA 3PUZA 3N59A 1MRSA 3UC9A 3ONFA 1X42A 1P0MA 1HC7A 2H52A 2REQB 1IZYA 1F6DA 1FFHA 1TZKA 3TAPA 2JHGA 2WJVA 4HWSA 2QAGB 4Q9HA 4R9NA 1UPAA 2PJDA 3D2QA 2B83A 3JYQA 3SZMA 1FP1D 3FF1A 4YWJA 1CUCA 4B5KA 3LW8A 5BOLA 1CIVA 1SH7A 2QUAA 2OBBA 3FIUA 1ZM7A 4PIVA 3OPNA 3HDJA 4QZFA 4ZRDA 5ARDA 2QDKA 5A6SB 2HK8A 5FJIA 2ZUSA 2Q6IA 5J0OA 4U8GA 1KHTA 2QGNA 3CSSA 1EQ2A 3GV8B 1LNSA 3IE0A 4OQDA 3DOOA 4DW8A 5KTYA 2J0UB 1ID8A 4G8DA 2OENG 3GAAA 2QTZA 1E2JA 2WWRA 4K9NA 1GL9B 1DBVO 3TL3A 5AM0A 2VCEA 1F0MA 1VKRA 3DF7A 4LZZA 2Q49A 3DVLA 2YJ3A 4P4OA 1CY2A 3M1YA 2WEKA 1Q0LA 1HFJA 4N48A 1TO6A 3OQBA 1L1QA 1JG1A 1RKUA 5DIFA 5FI0B 3K0EA 3QMMA 5A0VA 3MRVA 4EBDA 1XWFA 2HWKA 2PH7A 3RHZA 4B3DA 1NQ5A 3G2MA 3R23A 2EFJA 4N7RA 4DCUA 4ZDIA 2EZZA 1V85A 3SJCA 4I2DA 2Y6VA 1L8LA 1IBCA 1LJUA 3FROA 5IMBA 1GPYA 5J4LA 1ZH8A 2G36A 1ZJ6A 5HZKA 1T6BY 3Q7PA 4M1QA 4HZIA 4Y6RA 3PFGA 2QX4A 2XD4A 1K7EB 4FEAA 2IZ0A 4ED8A 3RH6A 2W90A 4ZALA 4BQPA 5CA1F 2VJAA 2W43A 5C7YA 1CY4A 1YDWA 2JAWA 2WG2A 3GFBA 3IAHA 4YV2A 3NJ4A 4B3TB 5FLEX 1TUBB 4LPKA 1M1UA 5D5QA 1V9PA 3W06A 4CN9A 2PYDA 1CZHA 3TRFA 3UMCA 1Z68A 1Y9ZA 1KTQA 1NOKA 2FMHA 4JVSB 2C8JA 4AO7A 3RU2A 5HFJA 4D4IA 4ECAA 1VI5A 2MYPA 2FLLA 4FP9A 1YRLA 3K20A 3MINB 5C18A 1IM8A 5KC9A 3EPPA 2FPGA 3AFNA 3DYVA 1PFYA 2II6A 4KJZA 1L5NA 3RW9A 2OE2A 1OR8A 3LWBA 2KBFA 4QZVA 3SVLA 1V6AA 5A5DA 5CA1B 3ZHVA 1L7OA 3AHFA 3G1UA 1GTRA 2AC7A 1P17A 1UBHS 2CL6X 2PTGA 3LXMA 4ZVLA 1L5FA 4KPGA 4NG5A 1MJGM 5JQGB 2AWOA 3JY6A 3OO0A 1DK3A 1QCZA 3PUXA 1IIBA 4YCSA 3VHRA 3CRZA 1YL6A 2PGJA 2JKVA 2F59A 2QD2A 3WOHA 4L7VA 3HDGA 2O2ZA 4RV4A 3EGVA 4RHTA 3BL8A 3H3XA 4X7BA 5JROA 1RRFA 2G70A 5LP1A 1XCOA 1YK1A 5CFZA 2FG5A 1JR3D 1KLNA 3C3WA 1W52X 5CK4A 5LQDA 3J81k 2XMBA 4JC4A 3NC4A 4U9HS 3FBWA 1TEZA 2PH1A 4D97A 1U5AA 1VKJA 2BJVA 1UXKA 4UB8U 3BGVA 4DVGA 3Q2IA 2KW5A 1GVNB 1OHHD 4INJA 1G21A 1WU7A 2P62A 2Q1XA 4S2EA 4GWLA 4OATA 5EESA 3GLIE 3P9PA 4R83A 4OKIA 1ZL0A 4DIEA 1CUYA 4MVWA 3COZA 8ICQA 4RTNA 4A1OA 2EERA 4ZHQA 1R3DA 3C0KA 1TMGE 2AZMA 4YVFA 4WNIA 4QZ8A 1ZK2A 3MR6A 1G8HA 1MHPA 5EZYB 2D3DA 1UJ6A 5KHLB 3LZ6A 1H65A 2GZSA 4MQFA 4WINA 1LU9A 1Y3IA 2Q4EA 3GFGA 3O5AA 2C07A 4KI0A 5E2IA 3UK2A 1U9IC 3EZ5A 4UTOA 5I01A 4J49A 2W3SA 3TSWA 1TK9A 1WTAA 2MMCA 1E8DA 3AY7A 3ED1A 2BSAA 1RAHA 4QU8A 1XU4A 3HZOA 4FI3C 2E85A 1FNNA 4ED9A 5HS4A 2JIPA 2CBXA 1BSVA 3ADKA 3P1JA 4FE7A 1EE2A 3R8CA 3V1MA 3VAYA 3AVYA 3GT7A 1Q6YA 1SZCA 2GDZA 2QZZA 3WLAA 4CG1A 5I7EA 4C4YA 4AY2A 5BV8A 4KLRA 3X2EA 4J94A 4DYHA 1LQTA 2P9QA 5EN4A 2GERA 2OZVA 2R5WA 2C95A 4WK6A 2K2QB 4P6VF 3CM0A 3AUUA 3BIOA 2XY5A 1Y1QA 3HM2A 3PPYA 5JYDA 3C8UA 5F2KA 2HOIA 4RIHA 3W5BA 2QSJA 4YFKA 2FSHA 2QAGA 2V6BA 1NBOA 1QTIA 2H0AA 5FF9A 2G40A 2XUZA 3GZTB 4N5NA 5FUBA 4CMIB 4QZHA 2XGQA 2PI5A 1LV8A 1XT6A 4BOYA 4ZGWA 2IU6A 3FSJX 3RVKA 5JZVA 4Q48A 1KWGA 3R7NA 1SVWA 2H3VA 4Q3EA 3ZHTA 2QTWB 4KLCA 3PYXA 4BCDA 5REQA 1Z4KA 4K9LA 5D6OA 4R2WA 4TRRA 4EL0A 3AB3A 1N8TA 4KLGA 3VTAA 1GT91 1T9HA 1YCGA 3KLMX 1XYGA 4Y1GA 3SZOA 3GIKA 1HE8B 3RTCA 2C2DA 2NOAA 1E3SA 2QMUA 2QL6A 3I04M 4IZHA 4QXQA 2IELA 5HK8A 2GKGA 1YDMA 4W9NC 2AQ8A 3JS5A 4GZLA 3STUA 1KOFA 1J0DA 1NKTA 5B37A 2PO7A 5C1BA 2QQ5A 5KFSA 1JS1X 1P5FA 4H4CA 4KR0A 4EJMA 2QN7A 3IP6A 2IZ6A 3ND9A 1AZWA 1CF4A 4L75A 2BFDA 1J4AA 2XUQA 3T1NA 4AM8A 3CW2C 1A9OA 3DOUA 4GRAA 1P7WA 2H4FA 5EERA 2TMYA 4WBNA 1ABFA 3PJGA 5KFQA 1HG0A 1V11B 4QL3A 4G36A 5JS6A 3AONB 2W6NA 3FDJA 3PGKA 4ENWA 2MSLA 2VRNA 2XF8A 4HAZA 4F1JA 3CLVA 4MS3A 5DX1A 3F98A 5E2BA 2XHEA 1UIRA 3H9BA 4KXVA 3R6WA 2K4HA 9ICBA 5J23A 1VYTA 4OJKA 1XK6A 2GZ3A 1MX1A 1JHOA 2XVMA 4EKGA 1Z29A 3IXLA 3HWX1 3VU3A 3SP1A 3B6KA 2WUFA 4HGZA 1U28C 4J16A 1E7RA 1QXSA 2XDAA 3F6RA 4BKOA 4FWTA 4NWIA 1FU4A 2J8ZA 4MEBA 3K70C 2MTBA 2EHDA 4FONA 2ID4A 3CLTD 3HJBA 4MICA 3UMSA 3L0PA 3TEMA 3A3KA 4QGFA 3ZWCA 1I6WA 1ID1A 3LPMA 3SOPA 1MAVA 2EFHB 3KXKA 1KQGA 5IW8A 4HMQA 1Q7TA 4F56A 1U0EA 2XY7A 2O3QA 1NRIA 3L6OO 4YAWA 3IPRA 2GI4A 1KYXA 1T1RA 2OV6A 3VAAA 2Y1JA 3HRIA 3DC7A 4BB6A 3M9XA 1AIPA 2MSDB 3PUJA 2VA9A 3ML1A 4PY2A 1ONBA 2C2ZA 2P7IA 3ABQB 4MINA 1IN4A 3UKDA 4BUJA 1Z8NA 2H08A 4A0QA 5KOJA 5FAXA 3L8CA 3AKEA 3H8VA 2IPNA 4FDUA 4RKFA 4HDMA 4LHEA 2VR1A 4IVRA 3KQWA 1E2LA 4XEUA 7ICTA 3TRDA 4DYDA 2OP1A 3F46A 4TT3A 2I67A 4BFUA 1OKKD 1PV4A 3BM5A 1NL3A 1VZ2A 2AUTA 4Q39A 4OGLA 2MDTA 3D2NA 1GYPA 1EE1A 3TFQA 4P4MA 2HBKA 5JE8A 4Q15A 2PXCA 4XWWA 4P4GA 1XPJA 4JEIA 2XTJA 4MQEA 1KRHA 2WAQF 1VHJA 4AN4A 1SN7A 1HDOA 3BA6A 4M7WA 1OXSC 4JK1A 2I65A 2PFQA 2DHQA 1YMQA 2QG6A 5WRFA 5HOQA 5AKYA 1KNQA 4CEIB 4FFWA 3PB3A 3RIMA 3LT0A 1FDWA 2IYXA 4D43A 4Q05A 4PGXA 3INGA 3ZWXA 5KNCH 2DGDA 1Y9DA 1X7WA 2C1ZA 2ATXA 7ICRA 1K08A 4NCHA 4AO6A 3OOYA 1A1VA 4IOLA 3PFCA 1N33B 1E59A 2EJWA 2NSYA 2YBEA 3T15A 1PQUA 3BE6A 3KOXA 1N92A 3MTQA 3C2LA 5BW8A 1QJ4A 5ESDA 4CXMA 1IQRA 4WV3A 3OEED 1GFSA 1P5JA 3LM8A 3FHCB 1O08A 1E2DA 2E9SA 3DVSX 5CHGA 3GJQA 3ISVA 4IIVA 3T3IA 1BXGA 3QKRA 3D3JA 4GOOD 2YVAA 4PO3X 4J07A 1U9CA 1M6VB 3ZWKA 3VBCA 3N7SC 1Q7RA 1WPGA 1T5LA 4KH0A 1ZJ5A 3WIVA 2XKJE 1UKYA 2ENUA 2Y1DA 3HKCA 5KTNA 1PFWA 4NESA 4OJNA 4UE6A 3GGSA 3GA0A 1TE2A 4F50A 1Y7HA 3L7JA 5LVAA 1D5WA 2XSZA 3T0IA 3I6BA 2VRCA 1DIRA 2BKVA 2C78A 4EHNA 4FBTA 3COPA 4PC6A 1Z0AA 5B55A 4PHAA 8ICWA 3TW0A 5GZ6A 2HA0A 3PEYA 4EX7A 5K4LA 1NVXQ 1Y7LA 3RIXA 3BDPA 3D31A 4PBSA 5KVQA 4L16A 3A9SA 1TPYA 1X7ZA 4C6TA 2NTVA 4BVAA 4OFZA 1U1DA 2GCNA 3NRCA 5BWMA 4D5EA 4PPXA 4LMRA 2BMDA 3VZRA 4BDTA 2EBHX 3ROEA 4LOHA 3U7HB 4WMLA 3OQ1A 2G5HB 4ID9A 1JFLA 1S2LA 2YV3A 1KSPA 2LKDA 1Y48E 2IL1A 4NCJA 1N5JA 4Q3CA 2LV8A 3WL7A 2X23A 1RWMA 2X2OA 1FQJA 1TK5A 2ODPA 3JR7A 5E7MA 1HETA 9ICPA 1YQWA 2KE5A 4F3RA 3I5YA 1ELOA 2O2IA 1I8TA 4OK6A 1MDFA 5JR3A 5BSRA 1XXHE 2UZ3A 2VWHA 4YYZA 4GOND 2J3MA 4U7PB 3RF6A 2G8LA 2XT0A 4A0FA 1E6UA 4TQGA 1FUKA 3Q3HA 1SB8A 5DLGA 1WUHS 3DZGA 3K8YA 2IK8A 4GZMA 4TMVA 3IYLW 4RUAA 4QWBA 4BV9A 5KPDA 5DB9A 2CW5A 4G56A 1NM5C 4E6EA 5GJVC 4HGOA 4JU9A 5JLAA 5TSDA 2IGTA 3QVGA 3OPMA 4OG2A 4OI1A 3PO5A 4Q3OA 4ZDKA 3F53A 4ID3A 5LR6A 1TT5B 2I8AA 4IIBA 1HDYA 2PS0A 4P81A 5L95A 1JT9A 2HREA 5T14A 2ECKA 5YASA 3FE2A 4BNTA 3BTVA 4RBNA 1VOTA 5F9MA 1EP1B 1RLIA 2HSJA 3EOZA 2JLXA 2UVQA 4FZ5A 3JVEA 4YDHB 4IHKA 2BQ3A 2YIVX 2PL1A 3H75A 2MWMA 3HEBA 5F4ZA 3JARB 4Y0VA 4RY2A 4MIOA 1C7RA 3EISA 3L1KA 4JC0A 3LXUX 1JYSA 4FBMA 4KXWA 1ICIA 1RWPA 3D0KA 3OCUA 1KMMA 1R6BX 1RP1A 2BLLA 3HJRA 5LXTF 3T3GA 3QI7A 1XMXA 1QHNA 3KQMA 1QG4A 3ZH2A 5JXHA 5AIAA 1TTPB 3D4BA 1J8QA 3BHMA 2PPLA 4GZ5A 2CRXA 1EM6A 2P65A 2GMWA 3VPXA 4A5OA 3G0HA 2F9FA 2JZBB 2A86A 4Y1RA 3WE7A 1P9LA 1R4MB 2GCGA 4RHCA 2WSSD 421PA 1KZYC 4FFRA 4MVJE 9ATCA 1KYYA 2VDQB 3HDHA 3QOWA 1L8AA 2GASA 3KPJA 4IILA 4Y9UA 4ZRNA 1SD2A 4ZZ2A 5JAHA 2WU4A 4MZXA 8ABPA 5CJPA 2QPAA 121PA 9ICVA 2OAP1 2Q5HA 3Q1LA 1QIJA 5AJXA 4EJSC 2QW8A 2PE5A 1COKA 1G60A 2FHPA 1JGTA 2ONKA 3AINA 2OCBA 2YY5A 3ETEA 3PC3A 3ZJ5A 2CXXA 1QH8A 1QGUA 3ANNA 4KPUB 7ICMA 9ICHA 1F0NA 2Q62A 3D64A 1PKEA 4H6XA 1GNRA 3MJCA 3DLIA 1SUDA 3AMZA 3WJ2A 3H9QA 1WUJS 4EHAA 1V2GA 4C8MA 1B42A 4KC0A 1D07A 1DC5A 3OZVA 3GU3A 3RAGA 1Y80A 2JA1A 1F7VA 4FMDB 1KXZA 4PZ9A 5J0SA 1Z4LA 2FYTA 2VDLB 2G80A 3E22B 4AG3A 3NM6B 3TLKA 5TRTA 4ALNA 2EDUA 5KOYA 4TL9A 2ZYRA 3B5JA 3C3BA 1PT9A 3G59A 3KPVA 3SZGA 4ESHA 1KDRA 2VNIA 1FK8A 4N0PA 4LNAA 3KSAC 2GO1A 2WYVA 2QSZA 1JH9A 1X9SA 3I5UA 3DS8A 4Z6CA 2R25B 5KYKA 1CTQA 1UBKS 1N6RA 2O7NA 1UKBA 4OJTA 2CNLA 2W71A 2WP8J 1XK7A 3ZY5A 2I33A 2Q50A 2A9JA 1W1IA 4XKJA 2EOAA 2ODBA 4REQA 1IWPB 1QZ3A 2JAOA 1TC2A 1V3VA 3FCUB 4Q7LA 4HEA1 4Y8VA 1CULC 4O3RA 3EZLA 4PE5B 2O59A 4Z7OB 4O4IB 1V3QE 1NVVR 2G04A 1WOYA 4D3DA 3IODA 4AC9A 1K27A 5MHTA 3NH9A 1J7KA 3Q12A 4I3HA 4LDRA 2WJZB 3EXFB 1QGZA 2OMEA 1KGSA 3Q3EA 1RC8A 2V9PA 4LJ5A 3TLEA 1MO2A 4QKQA 2P5YA 3E5NA 3I5MA 1C8LA 3R1IA 2R8YA 4KLHA 3OCYA 2BBSA 3A9WA 3X2FA 3HXOA 1W36C 2VJPA 3EBPA 4HTFB 3AYZB 5ARBA 4E0DA 1LLQA 3ER6A 1KVSA 1KZ4A 1RJFA 2OC9A 4AJOA 2JJYA 3K70D 4QXRA 4MUIA 5I45A 2IYUA 4TROA 1JFSA 1NYTA 1T4CB 3EVNA 4C5CA 4B44A 1BEEA 1SB3C 2WKQA 4Q4HB 1E0AA 5FO0A 2XGGA 1NJSA 3GMTA 4L78A 2ZXFA 5K3EA 4IXNA 3TYXA 1SG9A 3ECCA 3VJLA 4UCFA 3B52X 4MRNA 2ZSAA 1GXSA 1G3QA 4ITVA 2TS1A 2V4UA 4BMVA 1JFVA 1UXIA 3VYWA 2NADA 3IQIX 4TLMB 1ODTC 2RGDA 1E77A 5KG0A 3O4HA 5EIWA 4B9TA 3DE1X 2R1TA 4CEHA 1U31A 5ELLA 5F4BA 3SX0A 2WHPA 3Q15C 4HH4A 4LFAB 3FWPA 4KQFA 4X44A 3R5TA 3QJGA 3I0MA 3QW4B 1YIAA 3RK4A 3N8NA 1FFAA 4ZVPA 4JT8A 1JIKA 3BK1A 3F5DA 2JK0A 5CT4A 2VATA 1NZPA 1E2HA 2JD2A 3DR3A 3QIVA 2R2GA 1BNCA 1M9NA 1WMSA 4KODA 4QUAA 2V1XA 1KPGA 3H2BA 3L92A 4RD4A 3ZDRA 4PEVA 2HLNA 3P2KA 1VFNA 4OYHA 4RZIA 4AMVA 3E4DA 2DQYA 2QU8A 2J6SA 2P5SA 3P71T 1AGRA 1RLUA 1PCXA 2ZJ2A 1ZD3A 3CC8A 5AVKA 4M8LA 5T57A 1RXCA 1EFKA 1WZIA 2UZ1B 3KETA 3NCTA 1U2DC 5KC8A 2E8OA 2WNIA 3BSFA 4CT4B 1IRIA 3HDTA 1E2IA 2QL7A 3AYXB 3JD2A 4FO6A 4DL3A 3LDUA 3UGJA 2V7VA 3E1SA 4B35A 1ADBA 1G16A 3ZU5A 2IKQA 3GIJA 1LLCA 3P0EA 5KYGA 2ZRQA 4C6SA 4XPIB 5GPBA 2ZVQX 3ZVLA 3A58B 2FPUA 1QC5B 2XV1A 3DSRA 2LM4A 2QN6A 4RLFA 2E6UX 3GUHA 1K6JA 2OUKA 2QTLA 1VE5A 3LK7A 4LZNA 5ALWA 1IEWA 2BF7A 2BUCA 3GBVA 4XQGA 4CF4A 2LIPA 3ETJA 4TLBA 2QGFA 4X1KB 4I9GA 1UKAA 4JDPA 4E32A 3UFXA 1PT7A 1UJ5A 3IHLA 3KB8A 2NUAB 2ZIXB 1XCJA 1YAHA 3NM4A 1RBQA 1UQUA 2EWMA 1XZHA 2MOKA 2YV5A 5DHQA 3HE3A 4MQ4A 3A1UA 1G66A 4J8PA 1TF5A 1W94A 4QJFB 3KLOA 3P0FA 3HJFA 5BOSA 2PGNA 2CHUA 1EUYA 4DA0A 5LMZA 3G0GA 1DRGA 1E5QA 2A67A 3RSGA 4NRDA 5EJ7A 2AQKA 1DAKA 4ENUA 4R1MA 1TZBA 4IIGA 4MQMA 1EX6A 2KVSA 5DB4A 2IHZA 5DQIA 1ZONA 3PPWA 1UDWA 1J2MA 2XQIA 4DTIA 2YJ4A 1N57A 1DBIA 4EZ9A 1GL6A 1M34B 2GZHA 5GTHU 3EK2A 5DO9A 4FKZA 1NE2A 3KG2A 4YN4A 4L95C 1V37A 2W2NA 4A0SA 3CBQA 1R9MA 3CT4A 4M0UA 4FFSA 5JCJA 3GEBA 4OQZA 1RRGA 4Y6OA 1CEQA 4GX2A 3WDMA 3ZQKA 3M89A 5KQSA 2FN8A 1LUAA 1PS8A 3H11A 1XDSA 2ECFA 3H1BA 2JLQA 4P0TA 3JQCA 4F2SA 1ZQXA 5D5HA 5DK4A 2EATA 5EQDA 5JOQA 2HKIA 3AF3A 1B26A 2BFCA 4XLLA 5LB4A 4XCVA 1NUHA 1FS6A 4G5FA 3IKTA 4O2LA 3L49A 1B0XA 1P2BA 1L7BA 2GFHA 1E6CA 5FPYA 1P1JA 1SNYA 1QFSA 1OA0A 1K5OA 2ZULA 4QUIA 4YREA 3IUJA 1UT8A 1XL1A 2MRLA 4NL9C 1RXEA 1U1EA 5GY7A 4EVSA 2A88A 1D0SA 1GUZA 1C29B 3O26A 4HMPA 3STYA 3W4JA 5B58T 2EV9A 5HHHA 1YC5A 3QE2A 4JFAA 3A6FA 1VMDA 1ZO8A 3BRQA 3F8WA 1CKEA 2HFKA 4X8OA 3IN5A 2FN7A 3GR6A 3KQQA 4MAAA 1O94C 3A3OA 3AM1A 2R48A 4PZCA 2OCXA 4L8VA 2OD9A 5DGHA 1JVNA 3KUUA 3DCJA 5E4YA 4TS3A 2GYVA 1EBFA 1TJNA 1JMYA 5H3HA 2PRKA 2IU4A 4UDXX 3O94A 3T3PB 4I2HA 1FBTA 3WXMA 2CK3D 4YMNA 2J3JA 4YCBA 4F85A 1DT5A 4UTRA 3TD9A 1C20A 4YMLA 3QX3A 1HOXA 3HDYA 4TMYA 3G2OA 3ABSB 1W7AA 1E1YA 5EZYF 1JI7A 1CU1A 4Q1VA 4TXJA 3UWSA 1RHQA 4JSTA 3RSSA 4XWKA 4LMAA 1SVOA 1SBTA 3T9DA 2UUBB 3QBTA 4UQLA 4BUCA 2ZETA 1K2VN 3RWBA 3QLVC 2C9MA 1P0IA 8ICXA 4GM1A 2D0OB 2XR1A 1OILA 1CZOA 4DSFA 4MA5A 4R7GA 4F4JA 1G21B 3BJRA 4MW2A 2WUVA 3CRXA 3K31A 4JSRA 3DHVA 4KR7A 4ILKA 4F1WA 1URPA 5B1EA 1JR3E 3E23A 3MZ0A 3CPJB 1N3LA 2IUTA 2WFZA 4AG5A 2ZRNA 2AJQA 2FPWA 4NAVA 5F9NA 2M6RA 4HC4A 4LOJA 1ZLYA 1MO3A 4ZN6A 1YA4A 3EZFA 4WOBA 2CNWD 1DC4A 1I5EA 3IBFA 5K01A 4YRTA 3M83A 5D3MA 3ZS8A 1N2ZA 2X77A 1SO8A 1I3KA 4WJ3B 1S4MA 3HXMA 1FO4A 2FWIA 1H93A 1JVBA 1WPRA 2RHTA 4Q12A 5LIPA 3K96A 1Z45A 2GBCA 3V1UA 5HKKD 3TZKA 2XNSA 1FYXA 1M2KA 4B3XA 4M7RA 3W6OA 4IS3A 1YFZA 1Z7BA 3DTTA 1B3BA 4HYQA 5U4QA 3B1ZA 4BZWA 1XMOB 5EHQA 5ALQA 2QV0A 5C3UA 4BVEA 1OROA 1WVMA 1FCJA 2ZPAA 4KMUA 3EFEA 3EHEA 3HUEA 1ZYQA 4OK3A 3GLIA 4PZAA 2NRXA 1PL7A 4ZT2A 4EHDA 3KQUA 2WVHA 2A58A 1IOVA 3FY4A 1FMFA 4EY6A 2ONZA 3C6QA 4MWTA 2QPLA 2HDHA 3IKVA 1LTQA 4QAQA 1N5OX 5H80A 1QS0B 1E1QD 3KT6A 4JX9A 3OZFA 1EPUA 3RFVA 3NVVA 4ECTA 1BPXA 1ACLA 1K0FA 5IJZA 4QFDA 5JCXA 1E9FA 1RIFA 3NS7A 3IPAA 4GBGA 4HWTA 3SMQA 1NJ5A 1J42A 4CR6A 1XEXA 4M3NA 2E89A 1VHWA 3M33A 2X19A 4H7FA 4BECA 4W1SA 3HNRA 2RGXA 3PCXA 2G7ZA 3HRKA 4BNKA 3VKHA 3PHGA 4AVYA 1DXHA 3I2HA 3HYSA 1HTTA 4J0EA 3TSYA 1VG8A 3N58A 1CR0A 1KK1A 1HEIA 3P9NA 3G49A 4L28A 3T5TA 4ZYYA 3T5KA 2SCUB 3DJFA 3HS3A 2CD7A 2JH9A 4YMOA 1OV6A 5KFBA 1LI7A 1QBKC 1GTMA 3D7KA 3KKLA 1QVRA 2O0MA 4GG1A 2VHZA 4EJSA 4I6GA 2Y1WA 2VOJA 1D2EA 2BELA 4L6AA 1S7GA 4MVXA 4WY2A 1RRCA 3E4CA 4CT5A 4QWDA 1FTNA 4KQ2A 4RW0A 2M98A 2LPMA 4IOMA 4XWYA 3ESRA 2I66A 4Y30A 4EZIA 4UUQA 3B9RA 4YAJA 4DA4A 1SOAA 2X9LA 3M6VA 2XC9A 4R5HA 4D4GA 5H59A 5T64A 3NHJA 1N1DA 1L5LA 3ZY4A 2QG4A 2OCIA 2HCTA 4MLPA 5I9LA 4WCVA 2E21A 1FDVA 2A1UB 2JXJA 4OI4A 1SULA 3KVYA 1U3FA 2J0SA 1W29A 5CURA 2OLEA 3H5NA 3CEMA 4FC7A 1WTCA 1MO5A 1ZIOA 2DTXA 4C2TA 3U40A 1G3RA 1GL7A 2WFAA 2H54A 4XD2A 3C5EA 3M4JA 4AYXA 1EVLA 4MQ5A 2AOUA 4MIYA 2A1TR 2VDOB 3CPSA 1RWKA 2IOFA 4Z9XA 1T2AA 1YS7A 2ZTUA 7REQA 4AJ1A 1F8UA 3C6MA 3G5MA 4ND7A 4R1SA 1EJ6A 2FPSA 4ZHSA 1PJRA 1AU9A 4PJ0U 2O1WA 3HVKA 3I64A 5FWXA 2WWVD 1G64A 1M2FA 2LVBA 2QKQA 2PPVA 3G5AA 5CB4A 1AA6A 1S6YA 3LYHA 2PX2A 4TSFD 3H05A 4OEHA 3THSA 4G1FA 5G1PA 1HF3A 1XWLA 3VU1A 3DAGA 4RFLA 4BASA 5KFGA 3DAPA 2WDPA 4IW3B 4HGPA 2E49A 3ROGA 3URMA 1I14A 4ZCQA 3SIPA 5A2GA 1OZ0A 1NF8A 4C8LA 1TUEA 2ZJ6A 1RI1A 3HH8A 2HQBA 4HQFA 1XOIA 4Y1FA 1HORA 1NMQA 3ZBPA 1WMAA 2KZZA 1RXUA 2B20A 4RZSA 3SIWA 3TM5A 3UHOA 5KFXA 2O06A 3NHRA 4KNVA 1XKXA 3NJRA 4OLJA 5DI3B 5JSHA 2IXDA 4I9HA 2P3QA 1N0HA 4PSKA 5JC8A 2ZR7A 3DW1X 2FZKA 4Z9AA 3A25A 4E4TA 4PANA 2BFNA 3PMNA 5T8KC 5FL7A 2YHSA 2JLCA 4C6TB 4MUAA 4PFJA 4ZYZA 5LYJB 1Z12A 1QV9A 4G5QA 1QPGA 2C2BA 2WJ4A 5EIOA 1YBVA 4N76A 1T4BA 2K2WA 4UM9D 3ZE9A 3E9QA 3GCDA 1C3LA 1XBTA 4I55A 1DO2A 1R0RE 2JHAA 3E0FA 3IUMA 3TB6A 3UAYA 1JPNA 3LP8A 3T12A 4Z4CA 1SG6A 1G63A 4E0BA 3KV3O 1IIPA 1KETA 5JHHB 4ZHQF 1QM5A 4C0KA 2ZUWA 1NXVA 4HWGA 2E4UA 1QO7A 4QBFA 4EK9A 1C50A 2GN8A 1WO8A 2FSVA 4HVAA 2FPXA 3FMOB 1QQTA 1O96A 2FOLA 4G5GA 4HUQA 2FRVA 4RD0A 5AW5A 5T6BA 4BX0A 4M8IA 3AV0B 1ZQEA 1G6HA 4M04A 1P91A 4WBNB 3N53A 3NR2A 4DOMA 2PZKA 2RHJA 3GMDA 3HWSA 4LQ4A 2AIRA 5GQSA 4BFCA 4CF5A 2WJPA 3ZCQA 2DZDA 1ODFA 3FPKA 3A0BU 4MXDA 2M6KA 3AZQA 3S40A 3M3HA 3JQ6A 1NMYA 4N1AA 4MUBA 2O8DB 1OLUA 1ABBA 2QN3A 2DEUA 1T2VA 1X7WB 3GYBA 1KVTA 4H7EA 2RH5A 5ED0A 5KHAA 4BWFB 4EFMA 4JJ7A 3S8MA 2WWWA 4DADA 1Q7GA 4JI8B 5E6RB 5KFDA 1MQSA 2EW2A 4BLQA 2H18A 3QMWA 4P4LA 3V55A 4BMNA 1XFDA 4OJ5A 1J09A 4Z7NB 1IIRA 1ATZA 5FBVB 4MVJH 1P75A 4ZU6X 2JJMA 2FSUA 3D6UA 3PUVA 1L1FA 4BWVA 4WBNF 3ZVNA 4IXDA 3JRWA 2Q29A 4IZ6A 4DL5A 4B6PA 1BGXT 1TB4A 1Z16A 1FPMA 1JDSA 1XRMA 3PQCA 5C80A 2Q1WA 4QHSA 3SQXA 1FFEA 2NZ2A 3KXPA 4QJ3A 1PR5A 2H4XA 1M6VA 1KP2A 4K4HA 3VAZA 1U8TA 1U0GA 2HVIA 1WZCA 4HWRA 5C9ZA 3NQ41 2JMGA 4L6IA 1KEEA 3HW8A 2QLTA 3SIXA 3UZUA 2OXFA 1ZINA 5I3ZA 3UB2A 2A2ZA 2GEJA 4S35A 3TI7A 3K94A 5AVVA 5JTUA 4W99A 1SBZA 4RGQA 2YNMC 3PICA 4KQ6A 5C1IA 1Z0JA 4L08A 4NM2A 4A8PA 1HDXA 2WZDA 4KLAA 4N6NA 3TUIC 7ICFA 1PUXA 1V8PA 2D8AA 2GZMA 3MOGA 3R0QA 1DKQA 2PWAA 1SBHA 4D46A 4F4HA 3WK9A 3FWYA 4RPZA 2P68A 4U7JA 1RWXA 3KZCA 1DZ3A 2JBAA 1XEWX 1UHUA 2JCSA 2OBXA 2QNIA 3HZHA 4N3GA 4UZEA 5BQXA 4Z6FA 4RIGA 5HWSA 1VG0B 4G3XA 1N2JA 2K4MA 2BFMA 1Y63A 3B0YA 4PAMA 4TV8F 3RIEA 2ZIUA 2J6HA 2WD7A 2H2AA 3GVPA 5D6NA 4Q43A 1HMPA 3OLQA 1NQXA 1P1KA 3HHEA 3JQ8B 1Y5IA 2EKZA 3IAS6 2HY7A 1E20A 3Q9NA 5AD1A 3I6QA 1UWVA 1XP8A 1YUNA 3CNOA 2X0RA 3PSAA 4HH0A 3PLRA 4F2DA 5K4HA 1BE8A 3R7SA 5BYBA 1B4DA 3O0TA 2P2SA 3LY7A 3TUJC 3W05A 1U5CA 4ZV7A 2JVIA 3QPVA 3LA6A 2QM3A 3AWIA 2IEYA 1V3TA 4A8HA 4QXAA 2VN8A 3WYBA 1TD9A 2F77X 3B3QA 3H65A 4Z2AA 3DZHA 3NHZA 4ROTA 5DULA 3RYHB 1K7CA 3WGQA 3JQ7A 1CUFA 3EPJA 2ZI9A 4DM4A 3BCSA 4F4KA 4P34A 4C3ZA 4MLDA 4M9CA 1K06A 4UUBA 4ZI7A 5A4IS 1PF7E 3OY7A 1Q7EA 2IDMA 1O94D 4IIJA 4NE7A 3UMFA 4DJJA 4GP9A 4DIDA 1YDEA 3KEOA 3V8VA 2PUFA 3PC7A 3K6SB 2AJCA 3VISA 4IRMA 5KFIA 1NRJB 2VZEA 3M3DA 4J9LA 1X2BA 2XW6A 4Q3BA 4ZYXA 4UM8B 8ICUA 1DINA 3FMVA 5D49A 4JJIA 5BSVA 4L0MA 1DEKA 4JQSA 2X0EA 3NBMA 1IUOA 1XSPA 4O5CA 3MC1A 4BJQA 2NSJA 2QQFA 4P3XA 3C5GA 3RRYA 3AR8A 1VLMA 4N41A 4Q4CA 4LGYA 1ZGCA 4TZ0A 5J2JA 1MC1A 1BROA 1BX3A 5DI3A 2PCJA 3M6UA 1LWNA 4J9NA 1E3JA 2ISCA 2LMRA 3SQMA 3V4FA 1C0EA 2IX3A 4NLZA 4KLOA 3NBKA 3O9MA 1UZNA 3MQ4A 3R4VA 1BX0A 3IIKA 3D2AA 3NALA 2YX8A 1IJEA 4EB3A 3GVXA 4DQSA 1ZYUA 3LBAA 3HA7A 3RU9A 3M6FA 2P6NA 3BE5A 1HL7A 4B83A 1IUPA 4FFNA 1EG7A 4AJ2A 3EA5A 2AXQA 4OGKA 3CG4A 5F73A 3S8EA 1FRQA 2B1GA 1GSIA 3F6YA 1CEXA 4PNZA 2Y4OA 3PVXA 2N1MA 1EDDA 2NNLD 5A0FA 4DYVA 1DK2A 2AMFA 5GM2A 5CCBA 3VYSB 1OZGA 1X0XA 2PT7A 1SHTX 5DLEA 3IV6A 1NVFA 2IIQA 5FA5A 1XS9D 1F5SA 2UYOA 3GOHA 3NATA 9LDTA 4LOIA 1AKNA 2H5EA 2EKPA 4YJKA 5KAIU 2Q07A 4NZNA 3HCDA 2A9PA 3P45A 5J0XA 3BJYA 1CQJB 2Q2WA 1XF1A 5ARCA 3RVSA 1PJAA 1YE8A 2BHTA 3UJ6A 1YQXA 4TS9A 1HYEA 1UT6A 3KQOA 3FLBA 4QODA 2AK3A 4G41A 4PGQA 2QX7A 4ED7A 4UNQA 3STWA 3O9VA 6AT1A 4GT1