1O08A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 1-phosphate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o08A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o08A01
3U7FB 2YJ6A 1RQNA 3BA6A 2YBDA 1YMQA 3OCZA 3ESRA 3PCTA 4I9GA 4ZEWA 4CE6A 3U7EB 5AKGA 3ET5A 3QUTA 4DCCA 3OCWA 4UM5A 4DFDA 2O2XA 3NAMA 4YH1A 2I6XA 3KZXA 5AKEA 5AI8A 4Y2XA 2WM8A 5AKLA 2I7DA 3K1ZA 5AI9A 2W4MA 1NRWA 5ALYA 1ZJJA 2JAOA 1ZD4A 3W5AA 4C4RA 2Q5EA 3WK7A 2CN1A 2PQ0A 4KN8A 1Z5GA 3RF6A 2B30A 3L1VA 1CR6A 5ALRA 1O08A 1L6RA 2RAVA 3N5KA 2RB5A 2OBBA 4XQ0A 3SF0A 3QGMA 2FPRA 2JAWA 5AM5A 2WF9A 5ALOA 3EF1A 4CNQA 1WR8A 5AVXA 4L6AA 1U2TA 4AS3A 1RKVA 2HF2A 5AKHA 1YS9A 3I28A 5AK5A 5AKXA 1TA0A 3QX7A 1FEZA 3AR2A 1QH9A 1ZS9A 3L0BA 5ALVA 4OFZA 5AW3A 3FZQA 5ALDA 4KNVA 1ZRMA 4UMEA 4BX2A 1Z4MA 4GIBA 1RRCA 1RLTA 3WKDA 3M1YA 3NANA 3KDPA 2ZOSA 4KX3A 3J7TA 5ALKA 3ZI4A 5A3QA 1YJ5A 2B1QA 2ZBGA 4J03A 2W11A 4AS2A 2FI1A 3DV9A 2C4NA 3OTQA 1XP5A 3U7HB 4UMVA 3OCYA 2MU1A 2G1AA 3OCVA 2G80A 4KX5A 2IOFK 4RESA 5ALEA 2AMYA 1Z4PX 3WK6A 5AW2A 2QLTA 5IT0A 1RLOA 1YV9A 3WK8A 3M9LA 5AK6A 2GO7A 3S6JA 1J97A 3E58A 2HCFA 3I1YA 5AW7A 3ZTWA 3U13A 3E81A 5IT4A 3UMBA 2WF8A 5AHXA 3L5KA 3HYCA 4UM7A 1NNLA 3QU9A 2FEAA 2IOHA 2Q4RA 1RLMA 4AP9A 2DQSA 2VKQA 2ZXEA 3AR8A 1WVIA 2EARA 1SWWA 4C4SA 2ODAA 4OD0A 5AKJA 3U7GA 3QU5A 2NO5A 3WKAA 3L1UA 1EK1A 5AVVA 5AK3A 4F71A 2HSZA 4KYTA 4CF3A 5AM0A 2YMLA 4YCMA 3L8HA 4OCZA 5AM4A 4C4TA 4BYGA 3R4CA 1RMQA 3L7YA 1QQ6A 4Y2QA 1U2SA 5AW0A 4G9BA 3W5BA 2HOQA 3MC1A 1L8OA 2PKEA 1RC8A 1Y8AA 3A1CA 4G63A 1F5SA 2OM6A 2YJ4A 2P11A 4EZEA 5ALFA 3IRUA 2CFSA 4UARA 4E88A 4JDPA 2I34A 4GXTA 5ALWA 5AM2A 3N07A 1L8LA 2YJ5A 4NABA 5AIAA 3QLEA 2YJ3A 5AVZA 3KC2A 2D2VA 5A3RA 2G06A 4MUMA 4RETA 2IA5A 3KD3A 1TJ4A 3KBBA 5AKYA 4QQFA 3N28A 3L0CA 4IFTA 4J2TA 5AVQA 4JB3A 2PR7A 3N1UA 1RMTA 3CNHA 2CFRA 4L57A 5AKIA 4DW8A 5AI5A 4B6JA 1L7PA 5FP0A 3WK4A 3L8FA 1ZD5A 3PGLA 4Y2JA 4EX7A 4FYPA 3EF0A 4YGYA 1U02A 1Q91A 1QYIA 2IOFA 4UAVA 1N9KA 2G0AA 1Z4LA 3L8GA 1LVHA 4NWIA 1Z4OA 4XE5A 2FPSA 3A1EA 2MSNA 4HGRA 1J8DA 4BKMA 2NO4A 3ZVMA 3DNPA 1Z4JA 4F72A 5AW4A 3ZW7A 1SU4A 1K1EA 3NALA 4BNDA 1CQZA 3B9RA 4IG4A 5AI4A 3A1DA 3SMVA 1ZOLA 2BDUA 2FDRA 3PDWA 3SD7A 3W5DA 3NIWA 2QYHA 4BEWA 2HDOA 3P96A 4UATA 4Y2PA 3SKYA 4ZEXA 3B9BA 5ALSA 2GHQA 3DDHA 4ZEVA 1RMYA 3AR4A 3L8EA 2OYCA 2G08A 3QUCA 2FPWA 2YN4A 4YCLA 2HX1A 3WK9A 5AI6A 4O8CA 1RPZA 4Y2UA 5AM3A 3MMZA 4UAUA 3B8EA 3TLMA 4HGNA 1Z4NA 1VFPA 3KOOA 4BBJA 2B82A 3HLTA 2I55A 3NUQA 4NFLA 2YMMA 5AKZA 2C8KA 3EWIA 3RFUA 5AESA 2B8JA 3ZX4A 3PGVA 5ALGA 2FPXA 3SKXA 3OPXA 2FUCA 5ALJA 1Q92A 4BX3A 4QJBA 1L7NA 2R8EA 3WGUA 2JAUA 4UW9A 3ZVLA 2C88A 2P27A 5ALTA 3ONNA 4YCNA 3NRJA 2WHEA 5AVWA 2FPUA 2G07A 3AR5A 3E8MA 5AW8A 2ZBEA 2CFTA 3GYGA 5ALUA 2HEGA 1IWOA 3OCUA 1S2OA 4EELA 1QQ5A 1L7OA 2BDEA 2IYEA 3ZX5A 3A3YA 1T9ZA 5AI0A 2YY6A 2YMQA 3L0YA 1TE2A 1Z4IA 1N8NA 3FVVA 2C8LA 2EATA 5ALNA 4OHFA 5E0OA 3QUBA 2RARA 3MN1A 4MWOA 2HI0A 2YMPA 2YFYA 5AK4A 3WK5A 3BWVA 3I6BA 5ALMA 4BX0A 2WF6A 4Y2SA 3W5CA 4UU1A 4PNHA 2W43A 4UMFA 5IS2A 2MU2A 3E84A 1ZD3A 5AVTA 4EENA 4FFDA 4DWOA 1S8OA 4EX6A 1O03A 1VJRA 3ED5A 2WF5A 2P9JA 4HGOA 4KNWA 2AH5A 3SHQA 2G09A 1RKUA 4NV0A 5AICA 3U26A 2NYVA 3SLRA 5AVYA 5AW5A 5T41A 1ZRNA 2X4DA 4CF4A 5ALHA 3OCXA 2OA0A 3FPSA 3UMGA 3VAYA 4Y2YA 5ALIA 3ZTYA 2AGVA 3FPBA 2R8ZA 1X42A 5A3SA 2JGAA 4HGQA 2P69A 1QQ7A 3QU4A 1RQLA 3CZ4A 2GFHA 1Z4QA 2WFAA 1Z5UA 2ZBDA 1XVIA 4HGPA 2GMWA 1Z88A 4XOUA 3U19A 3QU7A 1EK2A 2HHLA 4XPZA 2I54A 1SWVA 3WKBA 3ZU6A 4UASA 1NF2A 2O9JA 1RKQA 3ZWDA 3QNMA 5AVSA 3ET4A 1TJ5A 4Y2RA 4L6CA 2BY4A 3QU2A 1JUDA 4NAVA 1U7PA 4H1WA 4CF5A 3WKEA 4HAIA 3AR3A 3ESQA 3IJ5A 3R09A 5AW1A 1T5TA 1YDFA 2WF7A 3WGVA 5AVUA 4EEKA 5ALQA 2I33A 1TJ3A 5ALXA 3UM9A 3AR7A 2JARA 2EAUA 1VJ5A 3EPRA 3ZWKA 3QXGA 2R8YA 1AQ6A 4BNDB 5AKKA 5AVRA 5ALZA 3DAOA 4Y3UA 1L7MA 3D6JA 4UU0A 3QUQA 1U7OA 1ZD2P 1Z4KA 3F9RA 2AUTA 2Q4TA 4BEVA 1MH9A 4Y2VA 3AR9A 5AW9A 5ALPA 1RDFA 3IB6A 1XPJA 4UMDA 3N8GA 1KYTA 3AR6A 5AW6A 3WKCA 1T5SA 3UMCA 3ZUPA 3ZVNA 2HO4A 2C9MA 4I9FA 2B8EA 5AIBA 2GHTA 2R8XA 4YIHA 1PW5A 5JJBA 4Y2TA 2ZBFA 1LTQA 5AM1A 1WPGA 3QYPA 4FE3A 3R9KA 3NASA 2FUEA 3MPOA 1YNSA 4HYTA 3I76A 2B0CA 3FGOA 3FM9A 2B1RA 5ALLA 2RBKA 2ZG6A 1WZCA 4YIKA 2HF7A
chains in the Genus database with same CATH superfamily
2PZMA 3UMVA 3U7FB 4FMCB 1DGQA 2GEUA 1GCIA 2GNOA 3OCZA 3C8HA 2JFVA 4E3ZA 3IN5A 2IOQA 1FLDA 3RB8A 3IIJA 7ICLA 1G5QA 3Q3HA 4P7GA 1NHGA 1LXCA 2XUFA 2AN5A 2XNDD 4OA8A 3TFOA 2LCQA 1J2UA 2CHQA 2H3HA 1VKNA 2NXEA 3GB9A 4HDSB 2FEOA 5F4ZA 5J4HA 3I92A 4Y2XA 5CX1A 4OSPA 3IQXA 4RTSA 1E7RA 1DUIA 2CVHA 3I53A 4ZHQB 4EBDA 4BO4A 2XVAA 3I2KA 1B26A 4WFQA 2JFWA 1Y3BE 3AEUB 1ZGHA 1T36A 2CLDX 1BE0A 1OZ0A 5FAKA 4WFJA 5KFRA 3W6ZA 1EP1B 2PQ0A 4JUZA 4HQOA 5JYEA 5DULA 4IVPA 4FCTA 4GZ3A 2QX6A 5EG5A 3H4MA 4ZMRA 3JQBA 1KE1A 2VUIB 5TB5A 3IUMA 4UAZA 1MX3A 4MI6A 4QGFA 2WF9A 4ND6A 1M66A 2O7QA 3NU1A 1ODCA 3KUCA 4UNIA 3WNCA 4BLPA 3V6JA 3SWWA 3WSWA 1R0WA 3KL4A 2E48A 1CE8B 1GUBA 1XKXA 3EA0A 2H2DA 5CPBA 5J40A 5IHPA 4IDBA 3C4VA 2C2BA 1RHMA 3GP5A 2RK4A 3IFSA 1QNFA 3G7SA 2FGJA 3CSSA 5DHQA 3VAZA 4W5RA 1XUOA 3TEMA 3CF2A 4F2DA 1FEZA 3L49A 3R3JA 4OJTA 1NQTA 2GEBA 5H9VA 3QLVC 1VSTA 4PHPA 3VZRA 4G1EB 1U47A 1E79A 4B6FA 3CV3A 1H6DA 3A11A 2OXRA 4J0GA 3BDIA 5DBFA 1Y63A 4H2DA 5JCOC 5E1DA 4EITA 2XTZA 1ZAKA 2C5EA 3TB6A 4QDXA 3OQ1A 1DPFA 1WZUA 2H31A 1IM2A 4LV5B 4LISA 3W6PA 5GJVC 2ZRFA 3U4MA 1XJ5A 3GMTA 4IEFB 1BDIA 4G0XA 4HYYA 4HDKB 1G6Q1 4TYQA 3RTVA 1YA6A 2V6JA 4GH5A 2YVKA 4TKVB 1NIJA 5CJ7A 2B98A 2MRLA 3H99A 2UVUA 4Q1FA 5F64A 5KFAA 4MRSA 5IKMA 1YDGA 1L5WA 1PQYA 2PUBA 4UXIA 4A4DA 2QS9A 1GUAA 3L6OO 2RMKA 1CQIA 4O4IB 4BLVA 5ES3A 1YV9A 5JD5A 3OX3A 2IUEA 1AQUA 1K6IA 1SXJD 5BV7A 4I2DA 2C83A 2GD1O 2OWDA 3F71A 2Y05A 4KSYA 1P0PA 2YRWA 3QBVA 4YI3A 3ZHYA 4DDWA 2GCEA 5KOIA 1JMVA 4W8GA 1UAYA 5GTHU 1DAMA 1EM8B 1NJFA 1ZH2A 1UZLA 2BFAA 1DWUA 2C07A 2DE0X 3TL6A 4B3HA 4QU5A 2BONA 3KJEA 1J8MF 1EBBA 4DSIA 4CGZA 4DHWA 3F5QA 1YMVA 2WILA 3LDGA 1M34B 1NXQA 4RQMA 4AP9A 13PKA 4RY8A 3O8QB 1ZXBA 4BU1A 4EPXA 3LUCA 3KIPA 5AXCA 4RK0A 3GDFA 4TQRA 5D3ZA 2XUJA 5ESDA 4BFSA 5CM2Z 2FG7C 5J59A 4AMYA 4BQEA 1JEYA 4P34A 3RYHA 1JS1X 4E70A 4U1RA 3S29A 1ONBA 1ZINA 5DEOA 2HWWA 1FQKA 4LUCA 2I4MA 2C1ZA 5BN5A 4EBFA 4MKGA 5I7SA 2WKSA 1ZUWA 5HBGA 3TLZA 2H63A 4UC0A 4RHEA 3PDJA 3ZU2A 2CEAA 3OZ7A 4CMBA 1P17A 1CR2A 3K3PA 4RPLA 4CMAA 3MA0A 4YQWA 1S89A 4IINA 4B33A 2FZEA 3WOHA 3AY0A 4MH0R 3H8WA 4Q93A 5F35A 3AU8A 2AG0A 4YRDA 4ZDJA 2R8OA 4QG3A 5I4CA 3L8HA 4PX9A 2JLSA 3VHQA 5KTRA 4KUHA 4C4TA 1TQ2A 3NOOA 1PQPA 2REBA 1TAGA 3AVOA 4Q9NA 2HQRA 4YJ2B 4G9BA 5FAXA 3K6SA 4DJAA 3KR0A 4CLOA 2E8NA 4IOKA 2D0PB 4MYHA 3MWYW 3W1WA 1R9MA 3MM4A 2WZDA 2H11A 3FDJA 1MA7A 3HCNA 4G63A 2NN3C 3BSSA 3EFEA 4MP3A 4XPIA 3OTIA 1XQ9A 4NICA 3GDGA 5T67A 2G1PA 3KVOA 4KI0A 4PZAA 4DR5B 3F73A 4LF9B 3VYTB 5ALFA 3H1FA 2DBQA 1H2XA 2PUEA 3PMLA 3LWNA 3QH4A 3RRYA 4JASB 5JI2E 2QTBA 5KYUB 3FPJA 5KG3A 5ELLA 1OTHA 1WXEA 1ZPDA 3OBBA 3OKFA 3Q15C 4MUYA 4TQAA 1DO0A 2EKDA 2I34A 4U0KA 4CMKA 4BCBA 2PO5A 4Q3LA 1MZPA 1AROP 4BNWA 5AM2A 2AVNA 2X2PA 4ANFA 1BTOA 2H54A 3CZ5A 4K03A 1S0OA 1W49A 3R7WB 4MUKA 3ZQUA 2AG1A 2E4XA 3HI4A 5A04A 2V6BA 2WICA 3R3UA 4UOZA 2BFPA 3Q6NA 4A92A 5D3QA 2VBGA 2D06A 1DCKA 3EYAA 4C87A 4BECA 2RCYA 2XZTA 1IHXA 4RVSA 1NUPA 1KVSA 3MXTA 3AEKB 3O3NB 2FMFA 4IHQA 4WOBA 2IEIA 2A0XA 5A0TA 2QTTA 1QUEA 3SQDA 1JAIA 5BV1A 3ZZUA 1W88B 4I2NA 5CFPA 3F5EA 1VL8A 2DSNA 4GRIA 5JRZA 1C3EA 3CNHA 4I8IA 5AKIA 4XD7A 2V7QD 3H1PA 4W63A 1CRZA 2UUPA 2ZUWA 3VTKA 1WB9A 2H1OA 3BXEA 2JCYA 1FY2A 3I4CA 3N3AC 4LY0A 4RVGA 4X95A 4ZO6A 4ZOQI 3B1YA 1QCZA 1Z73A 1DO2A 3G8CA 2ZJAA 3HJEA 3JQGA 4CVNA 2XRFA 5J1TB 4DILA 3PLAE 4IIGA 4IWYA 1TZJA 3NVKI 1GARA 4MWBA 1G5HA 1Q7BA 3GLHB 3M3HA 4Y6SA 4ZI5A 1U80A 4MV4A 5LR6A 4N5MA 4C8KA 2QSZA 2RGNA 2X77A 3REQB 3ZHSA 4PZZA 3UXOA 2V9WA 1JDPA 4BFYA 5A6VA 4ECZA 4HGRA 3V33A 3VO1A 2YV3A 3RHZA 2ZM6B 1J1IA 1CWUA 2P62A 3DM5A 2BQRA 4CKXA 2XZOA 1Y8QA 1Z5WA 3B60A 1RAIA 2D0DA 4FZLA 1N48A 1OFVA 2Y1CA 1VGVA 2R1TA 2XWPA 1E7QA 3BREA 1V6AA 3DFMA 5REQA 1VKRA 3DT8A 3ABQB 2Z8ZA 4BNDA 2NMVA 3TACB 4RT3A 3P26A 3O1LA 4LY3A 1TPZA 1WF6A 4U7DA 4MJ3A 4E5MA 1SB8A 1Y6RA 1JALA 4KLFA 4W8HA 3HY6A 5KNBD 2YYZA 3G9ZA 1GG5A 1DWQA 4KODA 4URWR 3WGYA 4CLXA 8ABPA 3GUUA 3HUTA 4IDCA 1EK5A 1JPUA 3Q6MA 3ELDA 3HV2A 3RWBA 3F5FA 2RGGA 4LBYA 5K1ZA 1RPLA 1MB2A 3FKSD 3NHWA 4ODIA 1HT0A 3ZC3A 3ZCPA 5CDGA 1QH8A 2HMYB 2WZQA 1Z5ZA 4RVNA 5D01A 1N5XA 2YZ7A 3BAZA 4G4JA 2PS3A 4L8GA 1W5EA 4KYUA 4ZT3A 4C5BA 2P2GA 5LP6F 3GZTB 4J4BA 1R6DA 1B8OA 2BRUA 3KOYA 3QVLA 1E7SA 4TVKA 4CEIA 3DULA 2WWVD 3VA7A 4EYEA 8LDHA 2Z30A 3HYNA 1UK7A 1E9RA 3LHIA 2TMYA 4RACA 1U11A 4TTSA 1F3LA 1N5IA 2F8MA 4LVOA 1NAHA 2V4UA 1R4AA 3AY6A 5J0SA 3X1ZA 1P2TA 3KKNA 4KLCA 4NV1A 1N0WA 3HLTA 1II9A 3KX2A 3M8RA 2ILVA 2ODWA 4M8NE 4R9RA 5HF6A 3V9AA 3IOYA 3AQEA 3RFUA 4WI1A 1VG9B 2QZJA 3NLLA 2KKVA 2OV4A 1ORHA 4H15A 1AKQA 2Z8YA 2SECE 4ZARA 5C7IO 4NOMA 1BOFA 1Z62A 1FTQA 3LA8A 3NH6A 3VU3A 4X6UA 3C3EA 1ZICA 4MW1A 2WIBA 3RRNA 2ACKA 1QIJA 2C57A 3IBGA 5CLHA 4C04A 4PQGA 5CCEA 1GSAA 5HHIA 2FR1A 2ZVPX 3F8SA 5JRJA 2FUCA 2GBIA 3IGFA 1G63A 3IXQA 3Q7EA 2DFPA 2Q6LA 2FK8A 1LC3A 2C42A 3BFPA 3OZCA 4RL6A 4P93A 1A2BA 2A59A 1XALA 4UW9A 3H5IA 5K8CA 1Z15A 4EY7A 1MKYA 4EB0A 3IAEA 1AK2A 3K7EA 3RV4A 1L5HB 4QT0A 4ZYLA 3WP0A 3BQTA 1VLQA 1GGMA 3D3WA 3G2MA 4HX5A 5K0LA 3W6NA 4B8WA 5IX8A 1NK6A 3ICXA 4N8DA 1JIIA 3WL7A 4FFSA 4P4SA 4GD3Q 3E8MA 4DDMA 4W5WA 4DJJA 4TZ6A 3CVJA 1GCOA 2GO1A 3FB4A 3Q8XB 1ZBDA 4R5HA 2O6LA 4CQMD 1RR6A 1IM8A 1CY7A 1J5XA 2Y68A 1KJ8A 2WSSD 1W0KD 2B4KA 1L7OA 3KJGA 5BW6B 5I4BA 1YRYE 2QX9A 3KWFA 2WVJA 1JEAA 2CGEA 2CMHA 2OC4A 4F7WA 3G0HA 2GK6A 1E9FA 2WU4A 1PL6A 3A6HA 2PANA 3FFAA 2Q4EA 1NFQA 4GXRA 4E6PA 5FX2A 4D8XA 4WZBE 1J5PA 1CUUA 3UUGA 4CMIB 3ZZMA 3VU8A 3WYBA 4ND5A 1NXXA 3TCXB 1AB6A 3B3FA 4ZK6A 1NTOA 1XTPA 5KS2A 1OIWA 1TDJA 1BEUB 4P08A 5ITSA 1ID8A 1CQPA 2DT8A 2K8BB 1QG6A 1ESZA 5C1IA 2Z3VA 2C94A 2YHIA 4ZOLA 1RIIA 3NPMA 4HB0A 4XWWA 5IIMA 1GZSA 2V7WA 4IEIA 1BXRB 4YAJA 5DW3A 2OFXA 5DBGA 4AJHA 2KE5A 3ZI7A 5U9CA 1NKTA 4F5YA 2XYPA 1FXSA 3UV7A 3MCVA 3D1VA 2DH6A 1EX6A 5KAPA 2GNAA 3IHQB 1Z7WA 3A10A 4OM7A 4OSEA 4PE5B 2FG5A 3L06A 1CZNA 4N0MA 2GESA 4BMNA 4DCPA 5KJFA 3Q5GA 3UPTA 2C4HA 2R1UA 4K0KB 4FD3A 4B6QA 4MEXA 4J43A 3U5TA 4QARA 3FGZA 2P1DA 5CVUA 4O63O 1OGJA 3RFTA 1RXWA 4DB2A 4QWEA 1KYVA 1ZMOA 2EJWA 2Q99A 3BK2A 3LAWA 3QJYA 4MR7B 1PR1A 1SHLA 1DQSA 2XCIA 1DMSA 1E1CB 4L95C 1AF7A 2O8FB 2WIJA 3BGDA 1T24A 4W5HA 4IJQA 2QL5A 5F23A 1Q57A 4RFSB 4DGSA 4LI3X 1SXGA 2HMAA 2OFWA 4NS4A 3HCDA 4Y7CA 5EE3A 3PYXA 3IP9A 4XGRA 4II7A 3RSZA 3T7IA 3TW6A 4C7OB 1KFKB 3CEJA 2EYQA 2Q3LA 3RK0A 2Q4BA 4Q4LA 2AUNA 1HUZA 2CB9A 2VBFA 4NU5A 4OATA 4OFWA 4BUZA 5IFLA 1VG0B 3RREA 1JEQA 1Y5NA 1ZITA 3D4NA 1ZKDA 3JRWA 3L18A 4NHEA 1W5TA 2E49A 1XNQB 4D97A 4AFNA 3UB2A 1YZFA 4X94A 2FRXA 1GG9A 3HR8A 1DX6A 1F2TA 4FNOA 5BSGA 5K6RA 4ZFNA 4J16A 3PTAA 3D3EA 1OWOA 1PLLA 4GMFA 1E6LA 2WQZA 5BMVA 1P45A 1G8SA 2C4MA 3RTCA 4ZV4A 1HYGA 1Z7BA 1IBSA 2PTGA 2FF5A 4EUHA 3VJLA 1PWEA 9LDBA 2O2JA 3KHGA 4NCBA 3MBOA 2DFDA 1YHZA 3JD2A 3M8KA 1DTSA 3BFXA 3H2BA 1LI4A 3ILSA 3KPVA 4X45A 3N39C 2O2SA 4ITUA 3QU7A 4PGMA 3CLTC 5D7BA 4AO7A 4U2EA 4EKDA 3UPUA 1NR1A 2FSGA 3EOZA 4KO1S 5NULA 2Q2NA 5L4SA 3SC2B 4BQSA 1Q1AA 1U7HA 2PD4A 4BRSA 4CNBA 5L40A 4ID3A 2NO6A 4AJLA 5CD1A 3NIDB 4M9LA 3QLVA 3L7OA 4BLRA 1KI7A 2GWSA 1P7ZA 4F1WA 2EFCB 5KTYA 2LUOA 2DCMA 3U3ZA 2I7CA 1ULAA 4DMKA 3JATA 1HOTA 5DDIP 1BX1A 2H06A 3VO2A 3GIMA 3QWAA 1ZVJA 1N2IA 5AW1A 3JSXA 2BHSA 3KOXA 3I30X 3KHRA 3RAPR 3WB0A 3GRPA 5EE9A 2WB1C 1DJOA 4A03A 1CV2A 1BKYA 1DIRA 2PWAA 2EJTA 1QIGA 3K72B 4HLCA 4OHWA 5C18A 5AVUA 1WWKA 4Z9AA 4EW2A 2QB0A 1R27A 2X0JA 4L5CA 3OQNA 5A0VA 3EUB2 1GKIA 2ZI7A 3E1KA 4IMJB 3ZWKA 1OAKA 1OPRA 3EZLA 3FI0A 3NWPA 3OF3A 4JC0A 5E7JA 5LBTA 3MGAA 1GO3F 2P67A 2Y4OA 3E9DA 2I4RA 2VDWB 3INNA 4MRPA 1LWNA 2RHLA 5B58T 2V65A 4RNNA 1QQAA 4LNAA 4R0NA 2PGLA 1G98A 4BWMA 1PQWA 2JH9A 2JGDB 4HC4A 4LHSA 1RJ9A 2X6QA 4Q9JA 4MRAA 4RQBA 4U7TB 5JVDB 1A69A 4K9PA 1V4BA 3CWQA 4RJJA 1WSDA 1RCTE 1KERA 5DISB 4B81A 4UBBA 5ALPA 5KG7A 2BCSA 1E5VA 2YVAA 2EKBA 2YV1A 3WLAA 5L3ZA 1NKSA 3D5QA 3RUPA 4BMZA 4C7YA 2LVBA 3Q9UA 5CM9C 2M98A 3TZKA 2J0QA 3DMFA 2EF1A 2OQIA 3TAPA 3P0FA 3C1UA 5SYNA 1Y7IA 5CFOA 5F3RA 1N3LA 5H5JA 2DVMA 2W4IA 4GOLD 4MWCA 1X7XA 3TQOA 3KEMA 2VDVE 1FSFA 3MYYA 4TS1A 4FW9A 3FNQA 1GA1A 4TM7A 2QT0A 5H70A 4UHJA 3G6KA 4J7AA 4CM1A 3OPVA 2H00A 4RA9B 4CL2A 3F74A 5JJBA 3MAAC 4IJ5A 3GFTA 2WWTA 2ZBFA 2O8BA 4YRBA 2B4RO 1G3MA 2JLWA 1YDWA 1F8YA 1GAEO 1J2RA 3HCAA 4I1UA 5G0UA 4A0GA 4PYJA 3B0XA 2PY6A 3GLFE 2EQYA 4RQ5A 1RQGA 2OZPA 3GLKA 3OUUA 5DPMA 1VCIA 5FOVA 5ALLA 5KFCA 3PQ7A 3ZE1B 2ZULA 3MNFA 3LXRA 2P90A 2R25B 1GN8A 4FT2A 2WOOA 3A2LA 3E9RA 3EH1A 4RY0A 4YCCA 3CVXA 2NVOA 3UMYA 3E3MA 2PQ2A 2XYQA 1GUYA 3GLHA 4OREX 1O9BA 7YASA 3DPSA 3DD1A 4QOSA 4X90A 3VU9B 1C30B 7ICKA 3MSXA 1PG5A 1G291 2CHGA 1C3JA 2XT0A 4P7FA 3SZLA 4NFHA 3W1EA 4QWAA 4YH1A 4UOQA 4ER7A 1KK3A 1FNCA 1LD3A 1BN7A 2DFLA 4R1TA 3PHCA 3RSOA 3U4DA 4GX2A 5IDXA 1O95C 1T0PA 1EJ2A 3HR7A 4KFTA 5A0LA 4XQGA 5PGMA 4O4LF 5REQB 5KG5A 3VV2A 2DUYA 4I5GA 4P3KA 4HDMB 1KSPA 2IP4A 2DMRA 2HAEA 4UU7A 5TQ0A 3JPPA 1TVEA 5JCXA 4OBXA 4DUGD 2NT3A 2OZLA 3LF2A 2CBGA 4DQSA 3RH0A 2VYFA 2PGOA 3IVGA 1RI1A 4TKUA 2PWYA 3W2EA 2W9AA 2WA2A 4CUKA 2PMBA 1NQOA 5BN1A 7ICSA 4CFZA 3P71T 1M76A 4LE1A 3JAWB 2QD1A 1S77D 3GNLA 1KP9A 2HJSA 4Z99A 5KPDA 4ESVA 2MJLA 2AKYA 4CNQA 1D2GA 1UOEA 3TSYA 4B48A 1MC8A 3BMQA 5HQ3A 2V9CA 3G82C 2CL5A 4MB6A 1LBHA 3FWPA 1N36B 3E82A 1G0OA 4B34A 4BP9A 4FYVA 3GWGA 3OA2A 3HCCA 1CP2A 4FKMA 1VYHA 4CG2A 2IPLA 4RS4A 1H2RS 4X54A 1YS9A 1N0IA 1RW4A 3H83A 1D8AA 3MJ4A 4O0LA 4W1QA 3RYFB 4DJTA 3B82A 3TR5A 3D4IA 3H0KA 2JJYA 1GXSA 5FL7D 4CFYA 1I2CA 4LRUA 2QJRA 2F3SA 3EJ6A 3TAUA 1RWPA 2BGIA 1QRRA 1QS0B 1ZRMA 3ILHA 4CMCA 3ZGZA 1RPAA 3C3DA 2HDNB 4G5QA 4DIDA 4UPVA 1W85B 4HFMA 4FKZA 3M89A 2W58A 4KUEA 5DK6A 3T94A 3AU9A 4LJYA 3OE7A 3PUWA 2C29D 3E2PA 3H11B 1R8YA 3OICA 1PKXA 3T4UA 3VKFA 4PLZA 3U3MA 2C4NA 2Y6VA 1YZ7A 1W0JA 1R9JA 3OTQA 2NXNA 4HDRB 3V4PB 1PSWA 4TS3A 4ZZ0A 4RHCA 3I45A 1YVPA 3OCYA 1V39A 1USKA 1KDPA 2A2ZA 2HMUA 2P4QA 2GZ3A 2R6CA 2Z04A 5IP5A 4G9EA 1T2FA 4OBWA 4XGNA 4MWDA 3H8MA 1MA0A 4BWYA 4WV3A 5E9QA 2NVWA 5BUZA 2KQUA 2D2FA 4M1MA 4HADA 3GRVA 1DFHA 1E6KA 1RLOA 2H7VA 1B1AA 2OBNA 3LT4A 3M9LA 4FN5A 2C00A 4Z2YA 3W5SA 3E58A 3WLJA 1N0VC 3HA7A 5CBPB 2VYQA 2HCFA 2I7VA 3D7LA 4Z0NA 5IM4F 1OR8A 2IDZA 1WABA 2PZFA 3OQJA 4ZQHA 5AHXA 3A0UA 3ZGVA 3VZDA 3HJUA 2JLYA 2LHTA 1QVVA 4DLVA 2FEAA 2Q4RA 4GPEA 4DM7A 4ENPA 3P9IA 4I36A 2ONZA 3NW9A 2MSWA 3S2EA 1DRVA 4F46A 2VKQA 4D0NA 1CJCA 2UVDA 1C2YA 3SF8B 1IBMB 3HJBA 4DOMA 2F48A 1MAAA 4C0ZA 1TM3E 2X13A 1ZGGA 3DMYA 4PX5A 3CRMA 4C3VA 4L22A 4QD3A 4ZA2A 3BRWA 2AC4A 2RHHA 3GLUA 5CXUA 3PPIA 5HWSA 3U81A 1CSEE 2IP2A 4CN9A 2XAUA 1JAHA 1JPJA 1L3IA 5IIIA 2FSHA 3R8CA 4E11A 1I01A 5BMVF 4XQ8A 1YBMA 4QJ3A 5C1DA 3WLNA 2QQEA 3LYSA 4XGIA 4Q9AA 3ZWXA 1U0OC 1ZLXA 4EF5A 3DLIA 4OJLA 4GZ5A 3TK1A 1LU9A 4BCDA 5C0YA 1XKTA 2VG8A 3F2DA 3CZCA 4KH1A 3AT1A 2H65A 4WW0A 1H2BA 5JI3E 1GVHA 3HJTA 1I4EB 1VLZA 4BU0A 1MJFA 2G1UA 3WB1A 2H1VA 4YMTA 4XOIA 3UPQA 1Y0BA 2BR4A 2JH3A 2QXTA 1EDZA 1E9VA 2HRDA 3N2LA 3QPUA 4FBLA 4RSGA 1L5FA 3OLXA 5K3EA 4JXXA 1BA3A 1UPXA 4HEA6 4C7BA 4GR5A 4QM7A 1LS1A 3D0OA 1FS4A 2I3GA 3NDRA 4CMEC 4QIWF 4NJMA 2JFHA 2O8FA 4YR2A 2P9EA 2ANCA 2F1OA 4K3VA 1RWWA 2DWOA 3KWMA 1XTIA 2C5FA 4KQIA 4C8OA 4MVJD 4BY9E 2X0FA 1VHWA 4IBOA 1U45A 2PRKA 3JQ9C 1L8LA 1Q95A 1DAFA 2LR0A 2RHFA 3BHJA 5DYTA 1IK4A 2IE8A 3WGIA 4YJFB 3R3VA 3ROZA 4Q43A 1DDIA 1PW7A 2QAGA 4EQZA 5IK2D 1I10A 1UDXA 4MUMA 3BZKA 1JDSA 2ZJFA 3KD3A 1QSGA 2VK1A 3KBBA 5LQMA 3DYBA 5JWRA 3HB4X 4PZYA 2CVFA 2FSVC 2R4QA 1YWGO 5SY6A 2CHFA 3WLQA 2P1RA 1Y6ZA 3JARA 4BLQA 4TWJA 4D96A 2NPFA 5EWMA 4EJSB 2P78A 3PI7A 3AJRA 5EXTA 1X40A 3THWB 4AK9A 4DT1B 1ABEA 2D1SA 4M8IA 2YV4A 4HYEA 5CRIA 2FGKA 3WWCA 4L76A 1FSGA 4ADSG 4ND4A 4YBZA 2YZ2A 3LRXA 2Y27A 3K0AA 4RAOA 4JLMA 2OG1A 4PO9A 3UATA 4A15A 2ZXHA 3A28A 3AOEC 2WA1A 3IE2A 4N5NA 3EFOB 2I5PO 1X9XA 2BZ1A 3JYQA 3PHHA 3MDCA 1EWTA 1II0A 3OE5A 1UXIA 2ZAOA 4W7HA 1DKUA 5KT4A 4MRVA 1OYYA 1M6NA 4O5KA 3LVFO 1TYBE 1W48A 1L5YA 1UC5B 2C2OA 1JHUA 2VHYA 4WY8A 5M34A 4FQ5A 1AHPA 3WYEA 4EEZA 3T1VA 3OPYB 2HNBA 1ZA2A 4HEHA 3ICOA 4J6FA 4L9RA 1DU4A 5E3HA 3FFBA 4M53A 4Q4DA 3T8YA 3LLMA 8ICLA 4IS7A 1H6AA 4E7OA 5F7XA 3MAJA 5IABA 3TZEA 4EYHB 9ICKA 4M6WA 3GLSA 2OAP1 1KMCA 2QW1A 1RLIA 2BMDA 3LQYA 1OI3A 1RXIA 4LTDA 2BUCA 1PI3A 3A6EA 3AHHA 4GLJA 4ZV9A 4LJXA 2ISCA 2JGDA 2IVFA 4IDHA 2ZZKA 1OV4A 3CCBA 3SMVA 1Z8NA 1RJ9B 4HQRA 5G2OA 4BAGA 4ENWA 5KFWA 1C0IA 4DEVA 2JL1A 2PQ6A 2G4LA 4R71A 4DQ0A 4JX8A 2HDOA 3HRIA 1D6MA 2XWBF 4TUSA 4B4DA 4II2A 2BHRA 1AIPA 5DCUA 4N40A 5IAJA 3EAQA 3V34A 3OA0A 3MOIA 5KYTA 1BZYA 1JMSA 1L3TA 1SBCA 3GQCA 1YAJA 2A8YA 1EYZA 5EE0A 3HZRA 3JVEA 4GF5A 4M0MA 1I6WA 2OYCA 5H3CA 4EW3A 3QUCA 1QHIA 1T8EA 2B1IA 9ICHA 2FPWA 2HA2A 2R2GA 3C70A 4AUMA 4X1KB 4YCLA 1ECBA 2WBLC 3WK9A 2VQ6A 2WHQA 2AFHA 1VJ1A 2YY7A 5AM3A 1SUAA 1AS2A 1N75A 1ZK3A 5CB4A 5CB6A 5EERA 1YMUA 4EQ6A 1A9RA 2P3SA 4O2BF 1X7YB 2FB9A 2P66A 1SRRA 2HQSA 3KDSE 3VKVA 3KB6A 3JZMA 4D3SA 5C8XA 1BCRB 3UXMA 2JW5A 4C0WA 4PO8A 5IWAB 2GZAA 4KLAA 2I55A 1N7JA 3IQGX 3ISVA 1OBVA 4IQ0A 4CEHB 1YK1A 5LKRA 4GI3A 1W76A 2C8KA 4J4TA 3T7TA 4YUXA 1U5BB 3W79A 2J45A 1JQKA 1UIMA 2QN9A 1MBZA 2WDPA 3UTCA 1KC3A 2O1WA 2QLFA 3D8NA 5A7HA 4D7AA 5FNVB 4HWKA 2HK7A 3OE7D 1UDRA 1PVQA 1WUHS 4U4AA 2Z5GA 3NYQA 4EMUA 3OQBA 2RDIA 5ALGA 4NLGA 1I2AA 1T3QA 1R0BA 1Z22A 2GS9A 4IFIA 1CIJA 2R96A 1E5DA 3JPWA 3OPXA 5TJHA 4HVAA 4DL2A 4P2BA 4B4KA 4FB4A 3V8RA 3LG2A 5K05A 3MMNA 4OJMX 5E3JA 1L5ZA 3ZGXA 1XWLA 4X84A 1L7NA 3ZV3A 5B4VA 2FFQA 4MFFA 1L5MA 4MS1A 4B9NA 3OEWA 4CKEA 2D74A 4F96A 1JVSA 4QEKA 5ALTA 1N5OX 4JJ8A 2JA1A 2UZ1A 3EPIA 4IHKA 1JTFA 3S1SA 2VCHA 3PVCA 2PBRA 3MT7A 3R2JA 3KZMA 4H1TA 3D8UA 4RTJA 3UC9A 5EWJB 3BGWA 2GVZC 4CM4A 2JANA 5T4BA 1DUSA 3G2PA 2E89A 3GYGA 4KYVA 1VLLA 4O5OA 4IL5A 1BRTA 4TKUB 1I7QB 4RFLA 1B42A 1KYXA 4LQCA 3WI7A 1PEYA 3CRW1 1X7GA 3A6JA 4EUSA 2I2AA 2WLSA 3F6CA 1DJLA 4MAAA 4XJSA 4MYUA 1ZUNA 1W6RA 2A4KA 1XSPA 2KZMA 2ZT8A 3FYUA 1IBKB 3IQHX 3NTXA 1CU1A 2QRGA 1R4NA 3UPDA 1IJKA 3T9FA 5FUXA 1PFQA 4UBIA 1L5QA 2PRSA 1IY1A 4BB0A 4KLQA 3SQXA 1Z56C 1Z8FA 2EATA 3QPAA 4RJIA 1ZHOA 3C3MA 4MDFA 2H1WA 3HA3A 5TEWA 2PFGA 1CKEA 3CN9A 1N6KA 4J0QA 5KDLA 1GXSB 1PR2A 1CUEA 1PX2A 3DZKA 4P4NA 4XVHA 1JN0A 3VNBA 3EQ7A 2OGTA 2HXSA 2C77A 3HC7A 1COOA 2Z2IA 4YRGA 4I66A 4MYTA 2NVUA 3RR7A 1PJ3A 1H4TA 1GZ3A 4FFDA 3PQ5A 5KFJA 3MFQA 4RH1A 1TYZA 3SEQA 1KAMA 2NP7A 3U9SA 5T4FA 3LPLA 1E3TA 4ER0A 3OJ0A 2ZBQA 5DTRA 2QVYX 2JF0A 2SKCA 2SKDA 3UAZA 4O3RA 4Q18A 3T1HB 4L6IA 3JV7A 1ZK2A 1ZQZA 5KT6A 1KI2A 1XYYA 2D5LA 4FSDA 4MLZA 2W04A 1NVVQ 4NU6A 3USCS 2O59A 1VECA 2CDNA 1U63A 1RFGE 2A5DA 1EEXB 3U4QA 5JECA 3RRBA 1F17A 1NBMD 4ENRA 2IV2X 3CNEA 2XCRB 1KSHA 3DOOA 1OLXA 3N8KA 4QZ9A 3ZPXA 1QLWA 2VP6A 3FPSA 3W6UA 4DOCA 3VDMA 2QVLA 3TQHA 3WL5A 1KRXA 3GF4A 2X6TA 5AUQA 4YMSA 5DLQC 1E4OA 1KAEA 2P6MA 3O4RA 1WBBA 1MT3A 1GQRA 4AYWA 9MHTA 4Q3CA 2HREA 3UJCA 2YWJA 2IRWA 2QIOA 3DTYA 3BKXA 3IR7A 4F92B 3IO3A 3PR4A 4MMXB 3GI1A 4UZSA 5F77A 3OHMA 3WC4A 2ZGVA 3ZIAD 4NCAA 5EMJA 4PRZA 3HSSA 2OO3A 1IBRA 4TYMA 4EL0A 1BW9B 5JWOA 1EDOA 3K0SA 2WFAA 4DA9A 3OPQA 5KAIU 1N1EA 2ZJZA 4KN7A 3FVRA 3AUUA 3L8ZA 3ZY6A 5KJ6A 4LYEA 3TPCA 2OFOA 4F04A 2M6LA 4BXOA 5JTIA 5KT5A 4I1VA 4ZAFA 4ARUA 3CRRA 4JQZA 1HLFA 3F8TA 1C0EA 2WT9A 2XY5A 1KTQA 3JVVA 5KI6A 2NG1A 3G5AA 5FO1A 3TLCA 3WQQA 1LWOA 5CK4A 3ZDQA 5FBVB 4PG4A 1ZSVA 3NDPA 2ECOA 1QXSA 1JKFA 2Q1XA 2VDNB 3G1TA 2OESA 2AJQA 5AJYA 2I66A 5CVTA 2VHQA 3ZWMA 3IAM1 3E03A 5DLGA 3C3AA 2JAPA 2EYUA 2H4XA 2R6DA 2TS1A 1W2WB 3GFSA 4J9SA 1H85A 4AJ4A 2F3RA 2YJNA 3FFTA 4NLZA 1T3HA 3DZHA 2BMJA 3EZNA 4GXNA 4R8MA 3UKDA 5DDMA 1K4YA 2PBLA 3ZQJA 1BWPA 4HWOA 3DDNA 5E7MA 4LVSA 3TECE 3PFKA 3TMAA 1DEXA 3DQPA 3OLZA 4F9FA 2ZANA 3RCBA 2EXXA 2QVCA 1ZMRA 3UKJA 1S2IA 4NJMB 5L7TA 3CNQS 1UMBB 5AQ1A 2RGNC 2WE8A 1LX6A 4Y3UA 4PLWA 5KOJB 4F56A 4TTTS 1IHOA 4IDQA 4BWJA 4CN8A 5BQXA 1R8JA 5ECYA 2PJRA 3R9XA 4FD2A 5KG6A 1N3BA 3AXSA 4NAUA 4A0RA 3UB3A 3K4QA 2HEIA 3U4AA 1TUGA 3N58A 2IYFA 4PO3X 4RIIA 4D9CA 4TMXA 3DTVB 1MJGA 2EL9A 1SC1A 1E1NA 4WGGA 5JZMA 1C7JA 3CIFA 1TXGA 5A9RA 1NPDA 4ZJZA 3QVSA 2D0OB 4RTRA 2QAGB 3TZ6A 1BGVA 4LDQA 4EOGA 5FPPA 3F4KA 2NTEA 2PT5A 1E92A 2OP1A 5FD8A 4FYYA 1OHHA 3E61A 1X1QA 3ZVNA 4E1BA 4ETWA 2CVQA 4OP3A 2GHTA 5DFAA 2GZ1A 4R1LA 4MQEB 5EOZA 2A1TS 4FEYA 2IPMA 3JPNA 1GFSA 2C2YA 1VMAA 5KTSA 4OSOA 2BBOA 2NU9A 4UCWA 1BROA 1X1RA 9ICUA 2A5GA 3EDRA 1JWAB 3FJ1A 1B8PA 1UBSB 3LCRA 1JR4A 3HFGA 4FFVA 3MQ4A 1F2VA 2WSSA 2KW5A 3K0AB 5INTA 4IOLA 1ZM2A 2XUKA 2HCJB 4H7FA 3PHJA 2C2EA 1X1EA 4UNPA 4H16A 4DA6A 3JASB 4E4RA 2Q41A 2PCLA 1W94A 4FK8A 1JH8A 1EM8A 2YTUA 1Y33E 2YNMD 3MGGA 4M46A 1R1DA 1YMQA 2WAMA 4EY3A 4ECQA 7ABPA 4AT1A 4B9TA 4HEA1 3R7SA 2G5PA 1P39A 1BVYF 1XAGA 3FR8A 2QB1A 4GU5A 2FVXA 2B4AA 1ORWA 3C3YA 1KEUA 2W2QA 4MCHA 4H7IA 1UJ5A 3UWOA 5AI8A 3UZUA 4L50A 2CLKB 3ROTA 5EJEA 4PSUA 4G5GA 5KFHA 2WV9A 3HXPA 2QMOA 2CLCX 2QX4A 4QODA 4UULA 5GADl 3PR5B 1JHVA 2PJUA 3I9OA 4JQYA 4TTAA 5LOVA 3D0QA 3BXXA 1ZQKA 4N7MA 4BO0A 3PZPA 3W5AA 1GM5A 3EEFA 2PMZF 3F9IA 3NFRA 4S1VA 4BDPA 5KG4A 4TMTA 4MVJH 3CR7A 2OV8A 4R1MA 2HU2A 3FDZB 1BXZA 2HTEA 3QVXA 3B1KA 4ETNA 1X15A 5JS8A 3ESDA 3S2YA 5JASA 3HADA 4OQEA 2HHHB 1LSSA 3HYTA 4QC2A 4IUBS 3DHNA 4YJ3F 1KORA 3QMPA 1ZR2A 4X71A 8GPBA 4TVBA 1QFYA 3ZVRA 2ES4A 1IQRA 1GG2A 1Z39A 2OOKA 5JSYA 1SKAA 1NYLA 2HF2A 4BLSA 2B2XA 2I0FA 3KOUA 3W8NA 3UH0A 1M7HA 3OEHD 2GUGA 3KR2A 2FWBA 5KFKA 3B5IA 3HNRA 2IWHA 2A9KA 2GM3A 1BS9A 3LX5A 3NIFB 3U4IA 3UWSA 2RGXA 1N6IA 3R6DA 2X2EA 5ALDA 1CS0A 4P4PA 4E6EA 4ED3A 3G0CA 3H2SA 4BJ1A 5KFFA 5FTJA 2ZSJA 4YMGA 1BJTA 4QAJA 3WIUA 5HPYB 4GIBA 3DAYA 4PLFA 4KBYA 1CRQA 1O1YA 1XMPA 3S1AB 4ESEA 1XHLA 1U1EA 2NUTA 2ZKLA 4Y9RA 4FYIA 3J7TA 4ITVA 4PWZA 5EGNA 1KHHA 1LKZA 4KO8A 4BO6A 2FMTA 4X85A 2L2QA 1EAYA 3N2ZB 5CLJA 2XNCA 1P0CA 1ZXIA 1C9EA 5EVCA 5MN5A 4E0DA 2COUA 2BEWA 2CDAA 2VK4A 4PXYA 2AYXA 3IG8A 5J2FA 1W93A 2WWXA 3PEFA 2QU7A 4RESA 2FV8A 2PJDA 3O2NA 4YB8A 3KZ1E 1NK8A 4EHAA 3G2HA 3RUHA 1ENYA 1T94A 4QYTA 1D5CA 1LLFA 3F1KA 2HHJA 5J0PA 3WK8A 2P79A 3K8QA 4FGUA 1MN8A 2UZ1B 1VDVA 1ND6A 3FZYA 4US1R 1RM4A 2UYYA 3FOBA 4QFBA 4ZPJA 4YPVA 5AW7A 4Y9DA 5AFSA 3U13A 3PU6A 2F8KA 2P4EA 2VK8A 3AM4A 4FX5A 3EYZA 3SQIA 3GPCA 3CBGA 2C9OA 4HN2A 4C0KA 1GGFA 2F17A 1NI4B 5F9HA 4PGYA 3RVDA 4M1OA 3EVTA 1E7YA 2R8JA 4I50B 1A27A 3BZWA 3P52A 5IAKA 3ZHCA 1ZOPA 4EGJA 4FOOA 2HK9A 3FYUB 3CC8A 4LK3A 1J25A 2XUZA 3BMCB 2PZKA 4J0HA 4QU9A 3WLTA 3NS1A 3FWZA 1E77A 5IDWA 1WJGA 3UK1A 3OZRA 5FUWA 1Z2OX 2ZYRA 3BH7A 4P22A 4Q24A 1O9GA 5AP9A 3T7AA 3UK6A 4KXLA 2P9YA 5JQGA 3L4EA 3BDPA 2QMUA 3ZV4A 3E22A 5K3SA 3GILA 1NDUA 1L7AA 2QKYA 2I7TA 3UFXB 1G4HA 1GADO 1NBWB 3ADDA 4GYKA 3ETNA 4AG5A 3TQ1A 1UKYA 4AECA 4XSHA 4FHZA 3UA4A 5H1YA 5EWFA 5JSHA 3T3IA 4BOYA 4MB2A 1JHZA 4FBUA 3EGDB 1AY0A 3PXEA 5P8WA 2PKQP 3GUVA 3FTDA 1WMSA 3CS3A 5TQJA 4JITA 3D1JA 5IT9A 4QWMA 1Z0SA 4RGVA 1MVNA 4MX8A 1JXMA 5J2JA 1QWOA 4GOMD 4PC2A 1NJYA 2HSDA 3V7FA 3KKAC 1P7CA 2G9ZA 3EHDA 4GW3A 4Z51A 3FYUC 1M8KA 5DG9A 2G9QA 2QN6A 3EF3A 4REQB 3NEPX 1INLA 3A1FA 1R6UA 4RHFA 2IF0A 1OYWA 1WUIS 5IXJA 3W8FA 4ARBA 1FNDA 5E6RA 5THKA 3TRHA 4CEIB 4Q44A 2JFYA 3B78A 3DHEA 3MZ0A 4MUNA 1LDEA 1TUBB 5EKUA 3A0HU 3JYOA 2UVVA 4J9UE 5JDCC 3AX6A 1CD5A 3QUAA 3S5JA 3GDOA 4X5VA 2Y76A 1Y3FE 3ZK9A 1OLXB 2Q45A 2QNRA 3GT7A 4QQKA 1K08A 4HZUB 4TTVA 5B3AA 3P2OA 3URMA 4EJSC 4HH4A 5ICMA 3KYJB 5IFKA 2PSSA 3OZBA 1WVMA 3K9NA 3BGSA 2VAMA 3RWMB 3SPXA 4MQ4A 2ZWVA 2IS2A 4MEBA 3HP6A 1B73A 4M60A 3G2LA 1XEXA 4ZXFA 5HIJA 1QIFA 3SIPA 4ZD6A 2DECA 1ODFA 2CV1A 3AONB 3DSRA 2EX1A 3L7IA 1NBME 1S2MA 4L27A 4EVQA 4YAIA 4Z4GA 2DHDA 4PV7A 7ICIA 2EF0A 3FTQA 4BVJA 2D6FC 4IY1A 4DM4A 3N8NA 3OQ6A 3IPCA 4RBNA 4MYRA 2DFTA 2BF4A 3GAMA 4CF7A 3T5MA 3H5TA 1MGPA 1ZQCA 2HMWA 3NIGB 1F6WA 5E3IA 3S2IA 3U4CA 1D8YA 4Z7JA 3ZBQA 2WY2D 4H0FA 3VNUA 5AK0A 1KSGA 2QARB 4RZSA 5JISA 1U9LA 4Z86A 1OI4A 3GC6A 5GTIU 3FYTA 1L5SA 4FYPA 1GAJA 3EF0A 3D6HA 4YGYA 5EQTA 2APJA 4BTVA 1ZQDA 2CNWA 4P4SB 3F47A 1D8LA 4XIYA 4GSLA 4GVPA 5KVVA 1THZA 1N2CA 3AUJB 3HLYA 2GF9A 3UQ0A 1T5BA 1ZI8A 3UFBA 5BOMA 3K15A 1LRJA 2CYBA 1VL5A 2CVZA 2QRUA 3OIWA 4NBSA 2ZTEA 3VH4A 4EG4A 4FVTA 3HN2A 3OM8A 3STHA 3RARA 3CW9A 3WGHA 1TK9A 5JAMA 4IGKA 1IYZA 4ZALA 4D9NA 1NKVA 3GLIE 1QGDA 2HLDD 2IODA 1DAKA 3HYLA 3R6WA 3RJIA 1Y9EA 3ZW7A 1G2OA 4Z7OB 4PY2A 4EY6A 5JLJA 4OUKX 1CQZA 1JR6A 2HSWA 2D1TA 4NMHA 4TXJA 3SZGA 4CMIA 3AESA 5JZOA 2PFOA 2B83A 1QF6A 1A4RA 1VXRA 3LIIA 3HUEA 4RTKA 1DC7A 3SCZA 2R47A 2DF8A 2GBLA 2HF9A 3MWDB 3PDWA 5U4XA 1ODLA 2H3QA 3O0DA 4NECA 4DLTA 4CV1A 4DLAA 4NLKA 3D4BA 1Y1RA 2JJMA 3F9CA 1QRSA 2OD7A 1U7ZA 4EECA 4RTMA 2J85A 3G1UA 1GGKA 4OA5A 1EFHA 1NC3A 2PD6A 3LTNC 1U4NA 3L43A 1KL9A 3GFKB 1J49A 1TRKA 1T4DA 4D9BA 4DR3B 5KL8B 2WM2A 3BPSA 5IUJC 5EQJB 5AHKA 3IAHA 1BWQA 5IH7A 4DR2B 1XMSA 3MCUA 4CKCA 3WGMA 4CR8A 3OEHA 2VCYA 3UJNA 1JFRA 3P20A 1UBHS 4FE7A 3VYWA 5CEHA 4KVZA 1VFPA 4MR8A 1OT3A 2VJLA 4BCCA 4CT4B 1KZYC 5MFZA 4OQLA 3V4ZA 2J3JA 1PNVA 1QP0A 1SVNA 1L1EA 4LDRA 4O2RA 5HDQA 1TC2A 3H4BA 3A1VA 1ZQBA 3NRBA 4FEGA 4HLUC 4DMLA 3HK2A 3OHBA 4HEJA 4XIGS 2JK1A 4LZOA 2GTIA 2FZLA 3QK7A 5J4YA 2O8CA 1XMVA 3LS2A 2JZOA 4M37A 1Z75A 4MIOA 1M2JA 3U6KA 5IIJA 1RM3A 2X9QA 2ZWIA 3TTVA 1GGNA 1V48A 3GPLA 2G4VA 1NOKA 1YKSA 3IKLA 3SBOA 2KHZA 3JR7A 8OHMA 1P3Y1 3GQBA 4C9BA 5M7EA 1UC4B 2Q6OA 5LZ9A 3SAFA 1NJ2A 1XWIA 5KTQA 2HCTA 1CEZA 1HSZA 2M32A 3I9NA 3OBIA 3QKIA 2Q1UA 2AE2A 4LZZA 3RK1A 3QPWA 4PL1A 4M4SA 2YYAA 4RK1A 5CX1B 3T5BA 3UWPA 4DCUA 1WE2A 4E2FA 5MFPA 3W9UA 1OUQA 1KFSA 5IUNC 3QEJA 3QE2A 3UN1A 1YS6A 1QRUA 1R9GA 4QOJA 3JRXA 1DIBA 4UFNA 4IIBA 4URUR 2Q7DA 1K9VF 2EEZA 3D7KA 3OX4A 3HU3A 1OREA 4O59O 2FE9A 1YU9A 4DCOA 2J3DA 2IU4A 1Z06A 1VE3A 3BMNB 3PC2A 5KFYA 2Y6UA 2I3ZA 3FDIA 4KBGA 1WA5A 1FNMA 2X1MA 5T8KC 1Q0SA 4JGBA 3GJTA 2I2BA 2WINI 4WGFA 4GX1A 5K8JB 2NTYC 3KT6A 4H1UA 4C2AA 3TB4A 2EJBA 2F67A 1CCWA 4NG5A 4BNJA 1YZLA 1Z4IA 1HDXA 4G89A 2BJVA 3EH2A 2B8TA 5JCOA 1F44A 2C54A 1XZNA 1HE8B 1L9XA 1OHHD 4O2BA 4P4UA 3E05A 4JKIA 5DYYA 5T4EA 3LY9A 1T91A 4HAYA 3IP1A 2ZPTX 1GTL1 7MDHA 5CWRA 4KQWA 4E22A 4Y2SA 1QONA 1VPDA 4HWGA 4DIEA 1QU2A 1ZWKA 4L72A 3W5CA 2I99A 1Y7LA 1YZUA 3DOJA 4NFSA 3S1AA 2QA5A 3L8MA 4R81A 3TFQA 2ASVA 2BHTA 3TZBA 3UJ6A 2ODTX 2HSGA 3CG4A 4G07A 1E9CA 4K9NA 4UNSA 4HP8A 3UVEA 5KG1A 4YP1A 1PT8A 4C3ZA 5KO2A 2ECFA 5LP6A 5ICSA 3JZDA 2P9JA 2C5AA 2MMGA 5C7LO 3NC1C 2G09A 1W0JD 1TD1A 4OHYA 2F1IA 1RYHA 2AR0A 2V6GA 1UBKS 3FLEA 1UQTA 3QPDA 4LHEA 4DFKA 3C6BA 3V6MA 2G0NA 3Q0TA 3R7BA 3SOZA 4QUIA 1B0ZA 2JJ2A 1ZJWA 3NHBA 2I80A 4OU5A 1SL1A 2BEVA 4RY2A 1LDBA 1SVKA 1I5OA 3GJXC 4NYMR 3U7QA 2IYQA 3UMFA 3FPAA 1M8PA 2P91A 4XA5A 3HZOA 3D3QA 4JUFA 3VAYA 1P5ZB 4TRJA 4WCFA 4OJPA 3KTOA 5CR0A 1FS6A 3IAS1 1ENZA 1NASA 2PH5A 2WAAA 3A32A 3EBOA 3X2FA 4F8JA 3LLUA 3V48A 4U2DA 4HSGA 3P2KA 1HA3A 4KXYA 4GX5A 4JOCA 1ESMA 1Q8KA 4HGZA 1Q20A 4D9MA 1ULHA 4F3NA 1M2OB 3UGJA 4BN5A 3HXOA 3O38A 5DLFA 1ZQXA 1ZQLA 4QHYA 3GFOA 3D9QX 1ZJMA 4LYGA 2PAAA 4NLLA 4QBGB 5DBEX 1DRWA 5H8WA 4OJ6A 1XZDA 3UMRA 3PD1A 2W2PA 3PGKA 3RUIA 2Q2WA 3ZD9A 3IIEA 1KEJA 1JG6A 1Q17A 1TMOA 1Z4QA 1MEJA 1W0KA 2GDZA 3A3PA 3VU9A 1MNQA 2PZGA 3LI2A 2CVPA 5J3JA 2ZBDA 3HW8A 1ZGZA 2ET6A 2B5OA 1WB4A 2ZAIA 4TOIA 3T34A 8ICKA 2YDXA 1U8YA 3Q8QB 5ED4A 1GQOA 1GPH1 3O9ZA 1XTTA 3ZU6A 2GKOA 4ACBA 3AP3A 4HXFB 4K05A 3SSMA 4HYQA 4Z5XA 1M6EX 5LD2B 1RYZA 1SN7A 3E18A 3IQFA 4UNNA 5TQ0B 1NRXA 1Y1TA 3ET4A 3NDJA 2BFDA 2OWOA 3W0LB 1JN3A 4KE9A 3A2KA 4QZAA 3W05A 3BTOA 1JXLA 1YR3A 1XK7A 2K4MA 1DBRA 2X3UA 2Z2ZA 3O94A 4HFJA 3PIIA 1ECFA 4Y8VA 5D51S 2QUZA 5LUBA 1RYDA 2GA9A 1L9KA 2J3HA 2MOKA 4OQDA 4YK7A 2RK6A 1U8UA 1YOVB 1KRPA 1HI9A 4GZLA 2OQVA 1R5NA 2O1EA 3SZRA 2ZB2A 4N5LA 1JHMA 3STWA 2HWKA 1AN0A 2GN4A 4TL8A 5B1EA 4AW9A 4RVFA 4NE9A 1HDOA 2DM6A 2IBTA 1AUPA 4TUQA 3ZDAA 4K1XA 2OKCA 3DDOA 4LWZA 1KJJA 2JKZA 2RKWA 2XYVA 1FYDA 1XLVA 3ECCA 3TRDA 3RSSA 5DLYA 1VOTA 3RIGA 4JROA 1VCOA 4QJFB 5LLSA 1Q3UA 4MRMA 3FSGA 1XCMA 2J9FB 4GBED 3EQ8A 1QKKA 1A5SB 3IR6A 3FCOA 4NYIR 2KB0A 4JZKA 3R7WA 4Y2VA 1UXKA 2GEKA 4LCBA 4TTPA 4MGIR 5A05A 4QDKA 1QFJA 4P7JA 2FUG6 1DKMA 4M49A 1R5JA 5F3WB 1IG3A 2XUIA 1F20A 1LPBB 2XLCA 3GV8B 3L3BA 3AR6A 3NCTA 1KL7A 4JKOA 3TN7A 3B51X 5FOXA 2EERA 1XLTA 4G0UA 1LBEA 3L7KA 3W77A 4XWAA 1W88A 4G1BA 2VI5A 4XRRA 4Q7JB 1TZMA 1WKVA 3FKSA 4KFSA 2W8KA 5TE9A 4TYWA 3OC6A 3QENA 5EA2A 5FRDA 1Q7RA 1PE0A 1RSZA 3L0PA 3D8RA 3OKPA 1SNYA 4RENA 3EW9A 4X1YB 5H59A 4A73A 1FSPA 4EUEA 3N2GB 4P36A 2QARA 2G5GX 1DG1G 3N75A 3AVTA 2OCLA 3B1WA 2ONCA 2GK7A 4N0QA 4RV5A 1T0HB 3NGMA 2B1RA 1CXZA 5DN9A 2PUAA 4B79A 3DXYA 2XOEA 2R7NA 2O6KA 1H9AA 3GGOA 3TD6A 4HWRA 1Q2XA 3BD7A 4UXJA 3VH3A 4MA0A 9ICWA 5CK5A 2ZIWA 2HF8A 3L4SO 3J81A 3ZWAA 3DBVO 4UM5A 1C9KA 3FPCA 2IIBA 4MW5A 4BNGA 3JWEA 3CWZA 3BSYA 3IP7A 5AKEA 3B89A 2CXQA 821PA 4MUGA 1YIDA 2R9VA 4WXHA 3WICA 3NEAA 3T38A 1JLMA 1TYAE 4W9MC 3CUKA 1M83A 2EG5A 1PDVA 1BGWA 1QCDA 2ZAGA 5JD6A 2I3AA 4B09A 3W3AA 3KQNA 1FCJA 2LPMA 2KE7A 4I5FA 4F2HA 1BMFD 2HBKA 5ALRA 4X7PA 1STOA 1XJWA 1OLSB 4OP1A 4P53A 3RBXA 3SBXA 2YVLA 4P3YA 5KQPA 4EO9A 3C3WA 3Q2OA 5EQDA 5L3QA 4IUCS 3ZHTA 2FPRA 4WZZA 2PMDA 5BN3A 2W55A 5DEIA 4DPMA 3DEZA 1GZ6A 4UTZA 5KYXA 3EF1A 4WZAA 2JVKA 1I0LA 1AUXA 2DQ4A 3N76A 4OFBA 3ZZ0A 2W83A 5BV2P 2C7VA 3WDLA 1KFEB 2JXJA 3PICA 1UT8A 1WHTA 4XEHA 5U4QA 3OOEA 4DBVO 3IUEA 1JEEA 1HFJA 3M2TA 4F6CA 4BWFB 1SRQA 1C7RA 4M2YA 3RI3A 1ZQHA 3AP1A 4HAXA 4E5KA 2IYNA 1SXPA 3TE6A 1SKMA 3E0QA 1AV6A 4M83A 4DR7B 1EUDB 1K8QA 3TTTA 2R3SA 5KZMB 1FTGA 2AR7A 3L0BA 4MR8B 5FTMA 5GP1A 1AUQA 1SHJA 1NBHA 3NGXA 4KZKA 1H5UA 1AF4A 1JSZA 3AQFA 3ZNOA 3MWEA 4BRUA 1CJMA 1B2RA 2L18A 2VF5X 2W2MA 2HJHA 2RC6A 2V3VA 1BPZA 1Q74A 4EABA 1FK8A 4YMHA 4F2GA 3CH7A 3HKBB 3C15C 2QYTA 2A19A 3HVJA 4ARZA 1PGNA 3FYSA 1FMFA 5FBLB 1U8FO 2P2YA 3G2IA 3RC7A 3LHKA 3MWJA 1PK7A 2NRWA 1CT9A 4QUBA 3GMDA 2BPGA 2I8CA 1MTOA 4DC0A 4UTNA 4ECVA 4IF4A 2XW6A 1MB0A 1I0IA 1Y1KE 3KLPX 3MS2A 4J16C 4WLFA 3STXA 3OHSX 1JVNA 1KJQA 3V7WA 4D56A 2AMYA 1PSZA 2HJGA 2X9GA 1U1IA 2W2XA 3NVDA 4LZPA 4YLYA 1AXEA 4PNPA 2G67A 2PX5A 4XTRA 2RG7A 3OLYA 1FYFA 3N7RC 5KQMA 1J97A 2GO7A 1BKSB 1G6HA 1VJ0A 1UK8A 1X13A 2YV2A 2Z1DA 2Q0ZX 3IVRA 3PBKA 4XQCA 3PD7A 3AZQA 3KWJA 4LHZA 1N0UA 2RIRA 3DXFA 1RT9A 3M6UA 1Q1BA 1ZVKA 1KJWA 3LY8A 4OMDA 4TGLA 3UMBA 4ZANA 5SY9A 4BZPA 4GICA 1G17A 1ORIA 2K4PA 2WF8A 3WMRA 2WHXA 4BNKA 5A5FA 3QSYA 3UAWA 4H6WA 4PGFA 1PZFA 3LVQE 1XP8A 4AICA 3N7UA 1RCFA 4OU4A 1KQPA 3GN2A 3QXJA 5DGDA 2NU8B 5IRCD 3X44A 4W82A 1UFKA 1U49A 1A7KA 1IN7A 1CUXA 2G72A 2ZXEA 2Z4SA 2GOLA 1T26A 3E15A 4G5RA 1GNPA 3IHWA 2RONA 2VJMA 2BKUA 2O0MA 4FFOA 2XR1A 4BO8A 5J4KA 3FNRA 1BPBA 2C8VA 3LLCA 3OHPA 1F7VA 1FP6A 3STYA 1OE0A 3CO0S 1IQ0A 4QXOA 4ZVPA 3AKZA 3L1UA 2H48A 3VGPA 4IGFA 3FDXA 1J5EB 4AF8A 2JI8A 1XGKA 5SICE 1QAOA 1X38A 1C3OB 3DR3A 3SZMA 2W2NA 5C81A 5CW1A 2IH4A 4L78A 2OXIA 1XELA 1J22A 2IF2A 2YFKA 4DEXA 3Q8KA 1JU3A 2ID9A 1YHYA 4FP9A 5MDHA 4YCMA 1SKWA 5FBKA 4TL6A 3PIDA 5DSZA 2H5JA 3LA6A 1Z13A 4Y2QA 2K2QB 1N9ZA 1HV8A 1VA4A 2MSEB 3BAFA 3ROXA 2FOXA 5EEHA 3W5BA 1FFBA 2BEKA 4Z3KA 1P44A 3ZJ5A 1XDWA 3TG2A 2E2WA 3F1LA 3CMCO 3HCPA 3ELBA 5B5EU 2ZSBA 3LWZA 4XDZA 3THOA 4E33A 2ZPUA 4L0CA 4RF3A 4EZEA 5TLSA 4G1CA 4NHOA 5G0WA 2GASA 1I2MA 4X1KA 2WJPA 2J07A 3T3MB 4DG8A 3HCOA 3WQSB 3ITEA 2ZRAA 1OA1A 2WR8A 1U1CA 4TN5A 3LQ1A 3VH2A 2GI4A 2PSEA 3LYAA 2VZ0A 5BP7A 1JEOA 4S2EA 1XZGA 3TEJA 3OQPA 3TPZA 4Q4HB 2FWMX 1ACMA 1LF5A 1VIDA 4OHOA 5ADVA 4LDNA 3H5OA 1L5GB 4AD8A 1EJBA 3GFFA 4K2HA 2I6QA 2JFFA 5CVJA 5LQSA 3RM3A 4N12A 5DOVA 5BW8A 1KBUA 3EY4A 2Y9TA 3C3CA 4HQNA 3SG0A 1BHO1 5AOAA 1I4TD 2Y0EA 2OWEA 1C7YA 4CLEA 1LPAB 4GAEA 4KLSA 4JU8A 2H3FA 5FNVA 4XYBA 3RJTA 2QMYA 1TJ4A 2RAFA 3JZAA 3TL2A 2IIVA 1IZZA 1VYTA 2Q3EA 1ENOA 3U40A 6REQA 4Z0PA 4BV8A 4C01A 2RHJA 3RVMA 1MVLA 3UNXA 4UUNA 3D31A 1S10A 3L0CA 4AX8A 5FLXA 4BFUA 2VYNA 4BNZA 4BO7A 1TM1E 1RG6A 1AKMA 1B14A 1KBQA 2H8GA 4XVUA 4CHGA 3TG8A 1GAXA 1POXA 4BVFA 1KBZA 4LZDA 1SVMA 1MEEA 3TADC 1GSHA 1OUMA 1WTCA 2ZCUA 2BKVA 3GP8A 1Q0QA 3CUSA 4HLNA 5DHPA 1VCHA 5EJAA 5LQKA 4C4AA 3L8FA 5EUBA 1IC6A 2CBZA 2V54A 3MTQA 4DSFA 3O2QB 4RWZA 5CDYA 3BBLA 4H3VA 1DFGA 2FP3A 2R60A 1CUWA 4QJIA 1J2YA 4LY9A 1CNEA 1RM0A 3EVNA 2XHZA 2GJ8A 2CC2A 3FN4A 3K1AA 3LQQA 5CXQA 4ND8A 2KKPA 1LC0A 1Z4OA 5JSUA 1MJHA 1YS2X 3RC2A 4FYHA 4PZ9A 2BT4A 2F3NA 4M36A 3VSCA 4Y18A 4UUQA 1HDRA 2PPLA 4FO6A 4J3NA 4NMMA 5IBCA 1TKRA 4C8NA 2GM9A 2WPDD 2ZITA 1SU4A 3PD0A 4JNCA 7GPBA 5EFZA 4D4LA 2C82A 4Q7KA 2H7XA 2XTMA 3IXMA 3L7AA 1UFQA 1OF1A 3RT9A 1JHOA 2CMKA 4CU2A 3O3CA 2C7QA 4DF3A 3DF7A 3GOQA 4AQDA 1GVNB 1N2CE 2UXBB 1E4EA 2QPLA 2VDRB 2BDUA 1RRKA 5IYZB 2JI9A 3KNZA 2VJBA 4RE6A 4XLLA 4KGZA 3C5WP 1YHNA 2IY7A 1XZEA 9ICPA 2XPCA 1T9CA 1VFNA 1N8KA 3SFVA 3O84A 5IU6A 3KLOA 4E0BA 1S2LA 1DELA 1NWHA 2EIXA 2PL1A 4PGGA 4ZPXA 1DBQA 4OQNA 4YT8A 1HDEA 4V0RA 4DZTA 1KK1A 1E66A 3EULA 4PRKA 3F4LA 1EFVA 1MUUA 4PCVA 1K5OA 1A5TA 1L1RA 4UQOA 5DXJA 3T3NA 1TAUA 3GARA 4WBSA 1BNOA 2HX1A 4HWPA 5IVPA 1X39A 1Z47A 1ZN7A 1MLDA 4Y2UA 2WM9B 4EGAA 3WAKA 4C0SA 4UAUA 4QO7A 3UENA 3TAXA 4MFCA 3U7IA 2V6IA 3B1FA 4RA9A 5IEJA 1MB3A 3KOOA 1NK4A 3KUUA 1DV1A 2CL6X 2IX9A 2J0VA 1EZ1A 2ZYIA 4QJ4A 2A0YA 5H83A 2FMUA 4Q47A 5KCZA 3ETRA 1ADGA 2WUFA 2YMMA 1DC6A 2VEDA 3F0TA 4X60A 3VZPA 1NQ5A 4AQYB 2NUPB 3CX8A 1JHXA 2FFBA 3FAKA 1DK2A 3H9JA 2OCYC 3PF8A 4RDIA 4LF5B 2XY6A 3K6JA 3FJOA 2GKSA 1SCUA 4LRWA 5JMOA 3MD0A 4WKOA 2X19A 3JALB 4WEQA 3EFHA 5FWXA 5IJXA 2ODGA 1SZJG 2ZIUB 2A9JA 1XJCA 3IESA 2C22A 3KYCB 1D09A 5B57C 3FOZA 2R7LA 1ESNA 2TECE 3WJ1A 4C88A 1FSZA 1YNOA 2DUMA 4DQIA 2NRZA 1KZ4A 2R6JA 3EQZA 1EFLA 4OK6A 5DHTA 4TV8F 2OBXA 4Y0AA 4QYIB 5H4HA 4MVJM 3RS3A 4CODB 5HX7A 4TT3D 3AMVA 2R8EA 2VAWA 4CIAA 1MW9X 4O4LB 3QELB 1ZBQA 3C6XA 2KVCA 1R0LA 3OQIA 2HBJA 3TTSA 1ZM9A 1QVRA 2ZE8A 4YCXA 4WKGA 3UGTA 2WQ6A 2JEGA 4P54A 4CM8A 3Q11A 1FFVA 4RQ2A 4NESA 3CLRD 3VVMA 2OSBA 2XIQA 2P5YA 3ZNNA 2A5FA 2PUWA 2V9ZA 3NGLA 4YS6A 4X1IA 3ST7A 4BE7B 4K46A 2PLNA 3NHRA 4C21A 3OCUA 1AHHA 2WAXA 4WCFC 4UHEA 3X2SA 5EP2A 1BE8A 2AQIA 2KSOB 2AN4A 2FNAA 4L0MA 5JARA 3QHAA 4TWZA 1EBFA 2N42A 4YR3A 5FPKA 5JROA 2ADMA 4NV3A 1JBKA 1U9ZA 3HP4A 3K9WA 2B78A 9ICLA 3T9DA 3ACCA 3V4SA 4OEHA 1ZIYA 1WXHA 2BFMA 3S55A 1ZQQA 4P3NA 5LMCA 3PKJA 2GSDA 5IXYA 4DMUB 1PK3A 1JDBB 4OHFA 1YR7A 3ZGLA 4YMNA 3OFVA 1C1DA 3KELA 2F43A 2HI0A 3WHIA 1H3EA 4A8JB 2V8BA 1RYMA 1P2UA 1RQ2A 1R16A 1RIFA 2HWUA 3BWBA 3HB1A 4MK4A 5E2AA 3UAVA 1QYXA 2OORC 4KLNA 2VZEA 3MDAA 2ATXA 1JWBB 1MRNA 2GZDA 3HN7A 4ON9A 3UAOA 4RPYA 3BA1A 3JQAD 4PPYA 3SNKA 1JLLA 1L6IA 3CUUA 3F97A 2QT1A 1Z9BA 2C4TA 3ORSA 4MZDA 4RM2A 4V2UA 1VJRA 3ZV6A 1ATIA 5EPUA 3TXAA 5KIAA 3ZHVA 2FPMA 5DX0A 4WESA 1DZ3A 3AG5A 3PXDA 1V7ZA 5EJFA 2QD4A 3UQZA 5KSPA 3IP4B 2XNHA 3PDIB 2ZTCA 4RM3A 4JLOA 1DQZA 1Z0DA 4Z53A 2E82A 1KQFA 1IIPA 4WNYA 3ZQ6A 4B3BA 1L7XA 1QGUB 1ULBA 2XGGA 3X1KA 4NLCA 1XT6A 3LO8A 1HQKA 1TZKA 2EWVA 3OTGA 3KQTA 4I5DA 3WJAA 1ZQIA 3FI9A 5A4AA 3EZ5A 4P5DA 4CKWB 4L8LA 4LDZA 4G97A 3SE7A 3MABA 4CM7A 4Q1BA 2IH2A 4B76A 1SCBA 2GK4A 4PHTA 3UMGA 1GU1A 1HUOA 1O95A 4UDYX 3TRJA 4QQNA 1S6YA 3LCCA 5J29A 1KQNA 2XGPA 2MIIA 2QLNA 3UIEA 4I2BA 3ZTYA 1XPRA 4KN6A 2AGVA 2J5RA 2W93A 3R5SA 4DA7A 421PA 2OG2A 1NR5A 4HZGA 4LRSB 2ZBUA 3UBMA 4DCTA 4F4WA 4RTLA 3HJHA 1E58A 4RT2A 2ALZA 4IH9A 2BM1A 4XUGB 1BPEA 1IN5A 1G5IA 1K9SA 2AFRA 4LXTA 5FWAA 1BO6A 3QFTA 1RQLA 3LWLA 2JZCA 2PZBA 1J2NA 1Q7GA 3USES 1B15A 2HQBA 3GLGE 9ICIA 3H7IA 2QE7D 4EI2A 4DZZA 4ECSA 4OI0A 2QW0X 2PX3A 2HHWA 3CLKA 4RHYA 5B37A 5JPDA 1CETA 1MV8A 4HGPA 4I55A 3X1XA 5KYWB 1D07A 2EQ5A 3R5TA 3U19A 4DBLE 1YH3A 4XPZA 4YLGA 2ZSAA 5HKBA 3SC6A 2DL0A 3VNAA 3OFSA 3WKBA 2AZ4A 4QASA 5I7UA 2WG0A 7ICMA 4MQFA 3PO4A 1COKA 1C3OA 1ZGCA 4H3HB 4WY5A 3RW9A 4ZJPA 2BN4A 2HGZA 5JAPA 5CXXA 2MINA 1CEXA 2A1JB 3BCHA 4LFCB 3FNIA 1KOJA 3UJ3X 3QE9Y 4FOPA 2ZYVX 2ERYA 3PHBE 4DAEA 5U1PA 1PP4A 5I9MA 2EHJA 1FQJA 3ADCA 3KTAB 2R6HA 2V3WA 4PGHA 4C07A 3NDBB 1T5TA 3VR0A 2WD8A 5C37A 1WDWB 3SNHA 4NENB 4I2JA 3H5NA 4EEKA 1SBQA 3AFIA 5CT6A 2Y92A 1NJWA 4NCIA 2EAUA 3PC7A 3UV6A 1P80A 2VTDA 4I4NA 1KDOA 3UA3A 4AZ0A 4DTCA 1UADA 4B9MA 1X14A 2E55A 1NW4A 4XUEA 1GQQA 1QOQB 5A03A 1QM5A 5L1MA 4Z4FA 5J58A 1DS6A 3FNEA 3L4BC 4JWTA 1K75A 1Y9AA 3PJDA 2RDMA 3K9GA 3DP7A 1RQXA 2D2XA 2FRVA 1XSNA 5MN4A 4RUCA 1TC1A 3PRKE 5E6UB 1IY2A 3OT1A 4Q3KA 4U63A 1SUBA 3RKUA 1HFWA 2B1GA 4WZBB 5EJ5A 3K5HA 4HNTA 3BMXA 1X7ZB 1UP7A 4OQFA 1NJGA 5JD3A 1WDMA 5CNKA 4ZYXA 4CTNA 1OJ7A 4LE2A 4JLNA 3N8GA 1OFGA 3RC1A 1FF9A 2E4WA 2H2FA 4Y30A 5G4LA 4RQ4A 2EKLA 4CMJA 1N5MA 4FKBA 1NVVR 3EG9A 1TMYA 2J5BA 1BKDR 4BYMA 3PX7A 2WJGA 3PX3A 4Y67A 2B34A 1SOAA 4U8HA 3P2EA 4QUJA 4D8TA 4QPDA 2CCKA 4D41A 3LUDA 3BWCA 3PDUA 3C8ZA 4EPYA 1WDLA 1ZQAA 2VA9A 4S1PA 2Q1TA 3FYCA 5GQSA 4IVQA 3CH6A 1RI5A 4TMYA 3GBSA 3X1MA 4XRHA 4GBGA 7ICOA 4YUZA 3FDFA 3O1IC 2DTEA 3DEYX 3WRXA 1IUOA 4DHEA 2HPZA 1AZLA 1DGSA 4FE3A 3LUBA 1M72A 2O8NA 3PENA 4PZ0A 1HX7A 3ZJYA 2YS6A 3B3JA 4CRWB 5C9ZA 4AY4A 1WUYA 2KMLA 4R8RA 4RCZA 5TPZD 3N7TA 4CJXA 3LPMA 2XDWA 4YRRA 3TBKA 3RGWS 3BD8A 1FDTA 5KFXA 1F0NA 3BIXA 1KDRA 1Q50A 2PX4A 4JT8A 2A9FA 4KL8S 2W3SA 4P86A 5E0KB 2LDXA 4F9TA 3ET5A 1A04A 4ZT4A 3IC5A 1GGEA 3OCWA 3RC9A 1Q11A 2GVDC 2PMFA 1N2HA 3CF6R 2P5UA 4KDCA 1KAGA 2FLNA 3M6AA 4LVCA 4PNZA 5TS3A 3U3OA 2XQVA 3BE4A 3BJZA 3BCRA 4F4UA 1A0OA 2HXGA 3GLFA 2DY0A 1XDBA 4ZTUB 2QOEA 5JS7A 3GJ6A 4AYBC 1VLHA 1XZHA 2Z8YM 1NRWA 1ZJJA 2JAOA 3A4VA 5FOTA 3I62A 2GYYA 2NSHA 4L28A 1XTUA 4RFVA 3UW3A 3MB8A 4NDZA 1NNI1 1T1IA 1ZHHA 2W6ZA 3GCWA 3TRIA 4RHTA 2JZBB 4YMLA 2XQGA 4J1TA 1MSWD 4N82A 5B6JA 5JATA 3VR4H 3FMVA 1DHRA 1M33A 1X3LA 3E0XA 1HKHA 2V5AA 1GFIA 2X8WA 2ZVDA 1T13A 3DZIA 3K0KA 1BFKA 4RPCA 3SIXA 1BC5A 1SK9A 1XDGA 2OMEA 1W8DA 1QFMA 1E1QD 2NYUA 2O3TA 2PIAA 3HDQA 3W4JA 1HMPA 4EFNA 2PG3A 4IR9A 2W6MA 4F3KA 1WR8A 2GNPA 1EH5A 2N1BA 3ZI0A 2XC9A 3Q7QA 1A0PA 2QM0A 4KQGA 4C5CA 4WOKA 3ENWA 4NBWA 2N75A 3N0VA 3BD9A 5KFLA 4KQMA 2J3QA 2E4UA 5D7NA 3AN1A 1ISHA 2RHBA 1PG2A 1N9GA 8ICGA 2BPOA 2P30A 2VOJA 1M6VB 4G65A 3LM8A 4PSCA 5EZYA 5CB4B 3HLKA 1E9EA 1WCLA 1BHQ1 4XFDA 3GGJA 4EQ6B 4RHUA 1QTQA 4OJ5A 1CUBA 1RWMA 1YQQA 2OBLA 1CUJA 3AERA 3I58A 2IIQA 4OFZA 3PUJA 2P3QA 1U3DA 3OLVA 3D4LA 5AW3A 3HA2A 2EQAA 4LW8A 1U3UA 4J1TC 4XLTA 2V98A 2O7VA 8ICOA 1AKNA 3ZLBA 3HKDA 1RRGA 3ZGOA 4NKRA 5I7HA 3M1YA 1PTKA 4F91B 3B1VA 2AWOA 1IAQA 1SQ0A 5A4IS 1QIHA 1Y6FA 1OASA 4Q3AA 4F6LA 2WJ3A 4BNTA 4HZUA 2NX2A 3LGSA 5EC8A 3TFRA 1RI2A 3NHYA 1Z8HA 3CNOA 2EGUA 2YJTD 8MHTA 1ISFA 5FTWA 3SI8A 5IC4A 3OIUA 5JH7F 4HNAA 1E3QA 2WFMA 3PNKA 2P2NA 1N77A 1U94A 4MWEA 3V4OA 3L05A 4KX5A 1D8TA 1K7SN 1RJGA 2I2XB 1X80A 1E96A 3M6MD 4QSMA 4WK4B 3ZY2A 1K97A 4TV9F 5DSTA 1Z4PX 3MXOA 1ADFA 1IRIA 4BLOA 5IJ9A 2XDAA 5J2TA 3F6BX 4L3VA 5CX4A 2P68A 3T5DA 4WCDA 2EFYA 3VDRA 4IJWA 1E1QA 1OB5A 2BAGA 3I52A 2GEVA 1D9ZA 5EJ6A 5JD4A 1DJNA 3GIDA 3P4UA 3ZHZA 1EHYA 4PHDA 3ZTWA 2HJVA 2FWAA 1IZ0A 2IJGX 4NLBA 3E81A 2VYVA 1K63A 1GSOA 3QTBA 3KAQA 4YCBA 1PLJA 1G20B 2A33A 4GP6A 3SOPA 4ZOAA 4IJUA 4AMZA 4YRFA 4PW0A 1WS6A 1H5QA 4RNCA 1V8ZA 2CUNA 4KP7A 2WZBA 1A9YA 4INZA 4Q9LA 4GBMA 2HBQA 2WMNB 1KOLA 3O91A 1TO2E 1CNFA 4CG3A 4Y6LA 1Z6XA 4UQLA 1NT2A 2NU6B 2V7QA 3ANNA 2R1VA 2LXNA 3HJGA 4I5EA 3M2PA 2FQQA 3EZGA 3MUNA 4MI3A 4B31A 4ID9A 4ZI7F 4J9LA 3NJ8A 4B3IA 3EQ2A 2W6JA 4URXR 5JH7B 2NO5A 1EDDA 5HCIA 4YXMA 2HKIA 2LNDA 4LBVA 3K5PA 1ZMBA 1D4OA 4FR0A 3U1BA 5CAEA 5FTKA 4JP1A 2E5FA 3KXPA 2RGYA 4NYIQ 3D6MA 1AO0A 2VRCD 2HBZA 3C7KA 3RAGA 1HDIA 1GPBA 1T8TA 2GAAA 2I3BA 1M73E 3I4FA 1V85A 3AESB 3PYLA 4ILEA 2VCEA 2ZYAA 3L04A 2NVUB 3ZK8A 1M9NA 4BMYA 4Q19A 5JAHA 5A4MS 4I46A 4LXQA 1NN0A 3KB2A 4HJXA 1CE8A 5DG7A 4UUOA 3SC4A 3M6KA 3AJ9A 2D4AA 2XMPA 4X92A 5FUYA 1UJNA 4DSNA 2PKEA 2XUPA 3FXAA 4IQTA 2BCQA 1F5SA 4FZ3A 1K7EB 3DEAA 3EOAI 4FC6A 2X4IA 3K1JA 3LUFA 1ZNYA 4IO0A 5KBYA 3HU2A 2JGKA 3T1OA 8ICRA 2C2HA 3ETHA 3DKKA 2BGNA 1JNYA 1QK4A 2OLKA 4M88A 2YHAA 2W8BB 3DBHB 4I50F 1UMDA 1VE5A 2HB6A 2EZUA 3KKMA 4LYDA 5G41A 4WL0A 5ALWA 2V0CA 2AFIB 4H6PA 3N07A 4B84A 3IAAA 4MO2A 1XD8A 1XF9A 2PS9A 1WD5A 4JJEA 5F5LA 1A2QA 1Y8ZA 4LZWA 1PJ4A 2FR0A 2FWRA 4A0QA 4EDFA 2QRNA 3EGWA 5KYKA 1VE9A 4QIHA 3IQEA 5CEJA 1J39A 1U0NA 3V7JA 1UEIA 4QWCA 2JHPA 4TUPA 2QNIA 3D2LA 3LZ6A 5CH8A 1UWLA 1KQGA 4F38A 1WZNA 3D2BA 3UB4A 4CIWA 4PYNA 1DHTA 2AJ8A 4BASA 4C4XA 4C7ZA 4K5QA 4KR9A 3D7RA 5SV2A 4QQFA 2O4UX 2JGRA 4ED8A 4R2LA 1DTWA 1SCKA 1TT5A 1IXKA 1X9MA 3A0BU 2IVZA 3DW1X 2R11A 5A0FA 1QZTA 2PR7A 3OZTA 5AXBA 3LHSA 5AI5A 4UB4A 1KDTA 4J1NA 1K8ZB 2J3EA 1FMJA 3AM3A 3AH8A 3DVRX 4Q4JB 2MYNA 4IRCA 1MP0A 5I48A 3IUYA 3M6VA 4ED6A 2QMQA 3BB1A 3OSZA 1RXUA 4QT4A 4M0CA 1ZETA 1GTJ