1O08A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 1-phosphate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o08A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o08A01
2HEGA 1Y8AA 3DAOA 4NV0A 1Z4QA 5AKIA 1EK1A 3N5KA 3KD3A 4UU0A 5A3SA 5AM0A 2AH5A 2MU1A 1EK2A 2YJ6A 3AR9A 1RQNA 4BKMA 5AVWA 4BX2A 3QU2A 2G0AA 5AK5A 2P27A 3ZVLA 4UMFA 3KZXA 1TJ4A 2FPSA 4UM7A 5A3RA 3E58A 1U02A 2HX1A 1XPJA 2HF2A 3VAYA 4OCZA 2ZBGA 1NRWA 3A3YA 5AICA 5AVTA 2O9JA 5AW8A 2I7DA 2P69A 3BWVA 4OFZA 4Y2TA 2YMLA 5ALZA 5AIAA 2WF6A 3AR2A 2EATA 4BYGA 2JARA 2C4NA 5ALSA 2WF5A 4ZEXA 3FPSA 4UMDA 3W5BA 2O2XA 1L8LA 4GXTA 2HO4A 3CZ4A 4HGRA 3ESRA 1XP5A 3ZWDA 2CFSA 2W43A 3EPRA 4Y2JA 4L57A 3AR4A 3L0BA 3I76A 1TJ3A 2WM8A 4AS2A 1RMYA 1Z4IA 1TJ5A 3MMZA 3WGUA 1Q91A 4YIHA 5AI0A 3FM9A 4NFLA 2MU2A 4BEVA 1RKQA 2FDRA 3NASA 5AKKA 5AK4A 4JDPA 5AM1A 2AUTA 1QYIA 3QNMA 3L8HA 2G1AA 4UMVA 2BY4A 5ALHA 3QYPA 5ALIA 3AR5A 4HGOA 1S2OA 4DCCA 3OCUA 3ESQA 2G80A 3OCXA 1RRCA 3QUCA 5AK6A 5IT0A 1YJ5A 1O03A 1ZRMA 3R4CA 3AR6A 3WGVA 5AK3A 2QYHA 1N8NA 4J2TA 4NABA 4KX3A 3D6JA 4UMEA 1PW5A 3KDPA 4MWOA 3N8GA 2I6XA 4CF4A 4G9BA 5AKZA 3HLTA 3FZQA 1TA0A 3KOOA 3PGLA 2GFHA 4PNHA 3SKXA 1VFPA 4Y2XA 2RAVA 3UMBA 3WK5A 1VJ5A 2BDEA 4DFDA 2NO4A 2HHLA 3W5CA 5ALYA 2YBDA 2R8XA 4HGNA 3OCVA 2OBBA 1VJRA 1YDFA 4EEKA 2JGAA 1YNSA 2RARA 2HF7A 2NO5A 5T41A 3A1CA 1RQLA 4Y2VA 4F72A 5E0OA 4EENA 3DV9A 3B9BA 2WFAA 2FPWA 3ZW7A 3U7FB 1RLTA 2QLTA 2B8EA 3SLRA 4QJBA 2B8JA 2R8YA 2ODAA 2ZG6A 3IJ5A 2C8KA 3QU4A 1QQ6A 2WF8A 2P9JA 4UU1A 3ZX5A 3U7HB 3L7YA 2DQSA 1RMQA 3QU7A 1WR8A 1T5SA 2ZBEA 1RLOA 4BNDA 2JAUA 2YN4A 5AKHA 3WKAA 3L8FA 3OCYA 3IB6A 5ALOA 3RF6A 5AVSA 4FFDA 3L0YA 5AVVA 1Z4MA 3GYGA 1WZCA 4YCMA 3R9KA 3BA6A 3L0CA 3NIWA 1SU4A 2W4MA 4DWOA 4EZEA 3ET4A 4CF3A 3L5KA 2ZXEA 4C4TA 2X4DA 3B8EA 4GIBA 3WKEA 2Q5EA 3SMVA 3ZWKA 3AR8A 5AKJA 3U7EB 1T9ZA 2EARA 4XQ0A 3R09A 4CE6A 3MPOA 2CFRA 2WHEA 3WK4A 5AM5A 3SD7A 4HAIA 1CR6A 3ZTYA 3KBBA 1ZS9A 2WF7A 3UMCA 3A1DA 3ZI4A 4AP9A 5ALUA 2IOFK 5IT4A 1S8OA 4C4RA 2RB5A 4UAUA 4UM5A 1U7PA 5AVXA 2RBKA 1KYTA 3M1YA 3S6JA 3ZU6A 5AVRA 4YCLA 3AR7A 4NWIA 3ED5A 5AVUA 5AVZA 1NNLA 2FPRA 1Z4JA 2OA0A 3WK8A 2GHQA 4UATA 3L1UA 1J8DA 4C4SA 3QU9A 3E81A 4BX3A 5ALVA 3WKBA 1NF2A 3FGOA 1ZD4A 1QH9A 5ALWA 2ZBDA 1RMTA 2JAWA 5AKLA 5AW3A 2B1RA 4EELA 3I6BA 3E8MA 3L8EA 3DNPA 4G63A 4ZEVA 4UW9A 1L8OA 5ALQA 3ZUPA 1L7OA 4B6JA 2AGVA 4BBJA 4UAVA 4RESA 3UMGA 2D2VA 3RFUA 2FEAA 4J03A 3J7TA 5AKYA 4UARA 5ALNA 3W5DA 4KX5A 3FPBA 3WK9A 4Y2UA 5AIBA 4HYTA 1F5SA 3KC2A 2IOFA 2P11A 1X42A 2R8EA 1RPZA 1Z4NA 2VKQA 5A3QA 2FPXA 4HGQA 2I55A 1Z88A 1Z4LA 4Y2QA 4Y2SA 5AM3A 2FPUA 2YJ3A 1LVHA 2R8ZA 5FP0A 2OYCA 1ZRNA 4XE5A 3U26A 1YMQA 3U13A 2G06A 3PGVA 1WPGA 3SKYA 1Z5UA 5ALXA 2ZBFA 4OHFA 4JB3A 3QU5A 1RKVA 3MN1A 3B9RA 3MC1A 4L6AA 1FEZA 1J97A 2ZOSA 3ZVMA 2GHTA 5AW4A 3ZVNA 1QQ7A 2W11A 2I33A 4L6CA 1SWWA 4DW8A 2CFTA 5IS2A 2C9MA 5ALGA 2YY6A 4UASA 1Z5GA 4YCNA 3NAMA 5AI8A 2C8LA 1SWVA 5ALLA 2YMMA 3QX7A 4EX7A 3ET5A 5AM2A 5AW0A 3SHQA 3OCZA 5AI6A 2YJ4A 5AHXA 1QQ5A 1MH9A 3N1UA 1Z4PX 2FUEA 3WK7A 3WKDA 3F9RA 3PCTA 4MUMA 4AS3A 3QGMA 2IYEA 4IG4A 4FYPA 1IWOA 2I34A 1L6RA 4YGYA 1O08A 3NALA 2AMYA 2NYVA 2WF9A 3AR3A 1WVIA 2YFYA 5AKGA 5AI5A 2HI0A 5AW9A 1JUDA 1Z4OA 4Y2PA 2Q4RA 1ZD5A 3OTQA 2B30A 3NRJA 5ALTA 5AKXA 1CQZA 5ALEA 1RDFA 3E84A 4CF5A 1ZOLA 3DDHA 1Z4KA 1RKUA 2HCFA 3P96A 3OCWA 5AKEA 2C88A 4I9GA 2BDUA 3FVVA 3PDWA 4E88A 3HYCA 3QUTA 1N9KA 2YMQA 1ZD2P 4F71A 4FE3A 2YJ5A 5AVQA 4I9FA 4IFTA 3N07A 1U2TA 4ZEWA 3OPXA 2PQ0A 3TLMA 5AM4A 3A1EA 1YS9A 4BNDB 3EF1A 2MSNA 3QUQA 5AI9A 3L8GA 4RETA 5AW6A 3L1VA 2G08A 5ALRA 5AESA 4XOUA 5AVYA 2IA5A 2B0CA 3W5AA 4XPZA 3N28A 3UM9A 5AI4A 4YH1A 3EF0A 1Q92A 1AQ6A 5AW2A 5ALFA 2PKEA 2B1QA 4Y2YA 2JAOA 2OM6A 4CNQA 2EAUA 4KN8A 3EWIA 2FUCA 1XVIA 1T5TA 5ALDA 2GMWA 4Y2RA 5ALPA 2I54A 4BEWA 4KNVA 1ZD3A 5JJBA 3QUBA 3ONNA 3ZX4A 4KYTA 3WKCA 5AW7A 3NANA 4NAVA 3CNHA 4O8CA 1U7OA 2IOHA 2FI1A 3WK6A 1L7NA 3M9LA 3I28A 1K1EA 2YMPA 3ZTWA 2HOQA 1L7PA 4EX6A 1ZJJA 1RC8A 2HSZA 2G07A 4HGPA 5ALKA 2GO7A 3IRUA 3QXGA 3U19A 3K1ZA 1YV9A 1RLMA 4H1WA 4Y3UA 2Q4TA 3QLEA 3NUQA 4OD0A 1TE2A 4KNWA 1U2SA 2HDOA 5AW1A 3I1YA 3SF0A 5ALMA 5ALJA 4YIKA 4QQFA 5AW5A 1L7MA 1LTQA 2G09A 3U7GA 2CN1A 2PR7A 2B82A 4BX0A
chains in the Genus database with same CATH superfamily
4XZ3A 4BGVA 3MTIA 3IBTA 4HHEA 3E7WA 4XWKA 1F51E 1AKMA 1P7VA 1WXQA 1T6BY 3R3VA 4HQLA 3OA0A 3KXPA 1GDHA 1KEEA 3P94A 2X8JB 2OFPA 3GEDA 3Q8KA 2VF4X 3AY0A 4LWZA 3RFCA 2Q4EA 4DWVA 2YX1A 1K7SN 3GN2A 1OW5A 3R5XA 5LDDC 2EL9A 1UXOA 2DFVA 1NI4A 2JL1A 3ORHA 2OCLA 3Q7EA 3A4MA 5EWMB 1ZQFA 4RLHA 2SCUB 1MEOA 3E7XA 1JSXA 1LPNA 4K6HA 3WGNA 2NSLA 4NENA 1AURA 4Q48A 1V6SA 1EFRA 5EWLB 2AJTA 3WFIA 4IJWA 4QGFA 4DADA 5F98A 3AF1A 5IXSA 4BQRA 3BTSA 3CW2A 4WJZA 5H9VA 3A1CA 3ABSB 4J0QA 3EEQA 1PZFA 4RCZA 5EIEA 4AP6A 1MA7A 2HBRA 2ATVA 3KR9A 1I1OA 1NXPA 5HR5A 2O7QA 1L5YA 2FLKA 1H5QA 3HILA 3F5QA 3O1IC 2D1QA 1ZMBA 3QH4A 2A94A 1JI0A 4JLUA 3LS2A 3TFOA 3ZXUB 3ICPA 4IWNA 4HSEA 4QZAA 5CLHA 1FK8A 4RSGA 1NN5A 4Q1FA 1UANA 5JD4A 4OEHA 1NXXA 3LD9A 1I4TD 3ZE9A 4FMDB 4Z0NA 1JTFA 1K66A 1ZR2A 4MF8A 5MN6A 1PT7A 3FWYA 1RWNA 4UXIA 3U3MA 5K8UA 4YRAA 4MCHA 4BWYA 1YBFA 5JG7A 1RMTA 4EELA 3H4MA 2PUBA 2EFHB 1U7DA 4IV0A 1FX1A 2Z6QA 3GVXA 4ALIA 3G8YA 3UWSA 5J0OA 4AG5A 5I8WA 4WBNB 1FQKA 5BT9A 3I01A 3AY6A 1G8KA 2NUPA 2BFNA 3IPCA 3M4JA 4DMMA 1K7XB 3V2GA 5HMLA 3A1VA 1Y3HA 3BK2A 2V7PA 3QX3A 2QRZA 2X6TA 2Y9MB 3GAZA 2VUUA 4UC0A 5FQOA 1CJKC 3D8NA 3SZGA 3AQFA 3U4QB 1LJLA 4QGAA 2A5JA 1FIQA 3RRNA 4OIMA 2Q41A 1UC5B 4O2BB 3AIKA 3PL5A 2JH1A 4I1SA 2O3QA 4ALMA 7ICQA 3KTQA 2ZIEA 1ADBA 1K06A 3NWBA 4W9MC 1GGVA 4WPGA 1CR4A 3RC9A 5BVHA 3CUYA 5JFOA 2BDUA 3MR6A 1ZCAA 1OLOA 5KFEA 1DFGA 3OMWA 1CFZA 1OZAA 1ULSA 3GJZA 5J0TA 3T4PA 1DBQA 3CX3A 1UDXA 4YRDA 2HHUA 3ZLBA 3L8GA 4O5KA 3IURA 4DOMA 3GLTA 3GDFA 4LK3A 1V1RA 4Z6KA 2CD7A 3BVPA 1EA7A 3T3EA 4GRDA 3EAFA 4FW8A 1U3DA 5IJWA 1JLLA 1XZCA 5K2OA 4R9VA 1HPLA 1GTVA 1DAKA 2GTHA 1A1VA 1X1QA 3N0WA 4UKDA 2CB9A 4J0DA 2H6EA 5KYWA 1K7YA 4RJLA 3FFTA 4PNEA 3H4TA 2JLWA 3SYKA 2LR0A 4URXR 4DIBA 4LWQA 2B1IA 3BJRA 3B6ZA 2IDZA 8ICEA 3OKPA 1USWA 1XCPA 1F8XA 4NU5A 1SB8A 2AZ4A 2PGNA 2H1RA 5K8LA 1S0OA 2EFGA 1F8YA 1M2VB 3KJIA 1OFUX 2KNJA 1E1MA 1Q0LA 2ZIVB 1M6VB 1I4DD 1N7HA 4RL6A 3EPKA 721PA 1HTWA 3OX2A 3LUDA 1D9FA 3MWYW 1O58A 4X6UA 2H17A 2BI4A 2C5SA 1N36B 1KR2A 4HS9A 3RYCB 4N5MA 2ONJA 1VL1A 3KOZA 4E11A 9ICTA 1NE2A 1H4QA 1HETA 2XMSA 4B3BA 1CIJA 3AFMA 2QRLA 5E9AA 3A3NA 5M04A 4FHGA 1U3VA 4U7PB 5EUCA 4YMUA 1CNFA 4CQLB 5KYYB 4DSOA 2RKOA 2PSFA 5CR0A 1T3NA 3LF2A 1TRKA 4G0YA 3VNUA 2KN7A 2ZROA 5LCXA 4F84A 2V55B 3HV2A 4ZOHC 4C20A 4R3UC 3OU2A 3PKIA 2R79A 4TV9B 1P33A 2PX0A 5JRJA 5CFPA 5FEUA 4CGYA 3SZRA 2NPOA 3T9AA 1CYEA 1SBCA 3PUXA 1U4BA 4DHEA 3NHZA 3MJ4A 1EFKA 4L3VA 4DF3A 3EW9A 3REQB 2G5PA 3CF4G 4NBUA 4B44A 3KLMX 1LPMA 4PLVA 4C7VA 3I2GA 1HYGA 2BMEA 5FNZA 3GBPA 4XR9A 4L5BA 2PIAA 1ZGBA 4LZJA 4GXKA 3QVWA 4MI6A 1YCHA 4DQPA 2O5EA 4FGJA 3WMXA 3R09A 1XFAA 2XYHA 5KFOA 1K08A 5JDIC 2NUTA 5I7FA 1F60A 3M9NB 2FMFA 1Y8ZA 1WHSB 4ZQEA 1A7AA 5AFSA 5L7TA 2HWKA 4X8LA 4U0KA 2XYGA 5G5HA 1B1AA 4P58A 1JSZA 5KWEA 3OQBA 2K60A 3WYNA 1T2NA 5F2OA 3LBNA 3VC8A 4UUMA 2GK4A 3RUAA 4Q00A 3IR5A 3JVUA 3H2YA 4UW9A 6REQB 2F8LA 1L5FA 3ETEA 4GOJA 1ODTC 2SKCA 1VSTA 4DLTA 1IHXA 3ABQB 1XNSA 5FOTA 1XZBA 4CIDA 2Z6UA 3M7DA 2XCIA 4PRKA 3MEQA 3L6BA 3SQOA 2DT8A 5F1YA 5JBNA 4O3SA 1NKBA 3D2QA 3LA8A 4HXFB 4UQOA 1T10A 4Q1EA 5FOUA 5FOWA 3QOWA 3FKJA 3R3YA 3BWMA 1MXFA 3O8DA 4D4MA 1UF9A 3VR2A 1D4ZA 1JL3A 4AUEA 4AKHA 3OLYA 1UZLA 2XODA 3ZHOA 4LGMA 2HZ7A 1D6NA 2R00C 2YRFA 3E7FA 5EIOA 3ZYCA 4UVIA 5HUQA 1OU0A 1Y98A 4LTDA 3AVVA 1DXOA 3D3EA 2HO5A 3QTTA 2WHPA 3EEBA 2KPOA 5G3YA 2O0LA 3HY3A 4BXOB 2A0FA 1RBZA 4L2IA 1X6IA 5BSKA 1MG0A 4B2YA 3SXPA 4X20B 4CHTA 3QLUC 2ILVA 3FH0A 3GJXC 5COQA 2VOEA 2HCFA 2J6BA 2J9XB 3NCHA 1OMOA 5BV2P 2WVHA 1JU4A 2FYTA 2KSOA 2YJ5A 1GPLA 5A6VA 3WL3A 2G72A 3SIPA 1QS0A 1DBPA 4J7UA 1MQ9A 2W2PA 4IZ6A 4OQYA 1EA5A 3SZ2A 3ZE7A 3V34A 4CMIA 2GZSA 5G5GA 1W4CA 4PAGA 3N0VA 3EF0A 4B1FA 3AJDA 4L8YA 4PY2A 5FXMA 1JJ7A 4F8EA 1NPDA 4N9QA 3RS8A 2WB1C 4P3KA 2WE7A 1DJMA 3F5FA 1U0JA 1CUYA 4JBYA 5KTPA 1AXGA 1E2LA 2FSPA 3KQUA 3R6LA 2EAMA 4QQRA 2EQ5A 3UKOA 3CNHA 5IBPA 5GM2A 1LQ2A 5KAMA 5DASA 2P79A 4WDRA 1PJ4A 3AKCA 3TKYA 1Q0PA 1BXGA 3LFUA 1R0CA 221PA 2Z5LA 1SC4A 3LL4A 3CRZA 2KE7A 1XXHE 1A9QA 2BLLA 1NVTA 3ZBUA 3BTVA 2WHQA 3GFOA 2PQ2A 1E0SA 1II8B 4UMFA 2BPFA 2JFUA 2WKPA 4AROA 4JC4A 1YZHA 3ZHZA 1KQQA 4HF7A 3L0IB 2P2YA 4QFCA 3HADA 3I5YA 2B8NA 1IBKB 1KYYA 2PCJA 2TMDA 2I6UA 4Y2JA 4BRSA 4BCBA 1SIUA 3BFKA 1KFCB 2OM2A 3L0BA 2YYSA 1TVKA 5IH7A 4RF3A 3ZCUA 4IEFB 1ZCZA 1FQOA 1I1HA 4LX0A 1XAIA 4TPKA 1LZLA 3V8BA 1E4YA 5TGZA 3HJAA 3EGXA 3VR5D 3ESQA 4DHWA 1O94C 5EN4A 1BDIA 2F1JA 3HNRA 1ODSA 5EKUA 2YQEA 1VRWA 3AHEA 1XXLA 4MZDA 1RXSA 2V6GA 1PW5A 3K9WA 3TJZA 1XAJA 4BKUA 4F5QA 1U0FA 1I3KA 3HLTA 3Q5EA 1GLNA 4LPSA 4C43A 2FWRA 3PCRB 4URFA 4DY6A 4P6VF 5AUQA 2X1VA 1R9NA 2G88A 4TQRA 2P3SA 2A14A 3SJZA 1ESNA 2NYRA 4HN4B 1OD6A 2VAXA 4AY4A 4JI8B 4II2A 4WN9B 1DFIA 2ODAA 3BMXA 4IP0A 1XRJA 2CXNA 1N5DA 2AVDA 3EN0A 2PMZC 1BH2A 3EIHA 3P7MA 3D6VA 3Q2KA 3DLCA 3JQ7B 2GQ0A 3Q2OA 4XVQA 3V7JA 4IHJB 5IMSA 4M88A 4P1ZA 2R4TA 3RR8A 3BERA 2XQVA 5DGCA 4AKSA 1PLJA 1V9PA 1S9DA 2HJHA 2FEOA 3E05A 2YYAA 2VKTA 3JWGA 4BFCA 5CCEA 1E60A 4TXMA 3EVEA 4FNOA 1RQGA 3AUAA 1X8JA 1QRRA 3WJ1A 3PHHA 1P5ZB 3GLHA 4P7JA 3MUOA 2IWRA 5KC9A 3DMFA 3CJQA 2EEPA 2EBHX 3B70A 5KTTA 4YRNA 4JVLA 4R2MA 3EOBI 3HBLA 1L3BA 5H80A 3E81A 2Y1KA 3KELA 3DPSA 5D01A 1RYYA 2X40A 1LDYA 4ZT7A 4BE9A 3BQ9A 1PK9A 3PE3A 5CH8A 3C3DA 2YRXA 3JQDA 1DRWA 3GEIA 2OCBA 2P11A 3OH8A 4QOGA 3DAPA 4BWGA 3IR6A 1WD5A 3EOZA 4KRYA 2X8JA 3A04A 4BNMA 2I66A 4UU8A 3AU9A 5IEJA 4B46A 3WIEA 3H9QA 4AZVA 5LU9A 2AJ8A 2Y2UA 3FFWA 3RFFA 5HJ5A 2WSSA 1UFRA 4J7CA 5EWMA 2PFSA 3WLAA 3GRZA 3WIOA 2SCUA 3MJVA 1X6JA 1GZHB 4BMNA 1JU3A 1R74A 1C7RA 3AYXB 3K31A 3Q6IA 1UXIA 5HG0A 4ZI2A 5KINB 4Q7JB 2VNHA 4R4JA 3KEQA 1YA8A 4FTWA 5EWLA 4B3SB 2GKSA 3T94A 4W99A 2Q6TA 3Q5DA 1GAQA 3I9LA 4ZV4A 1AKTA 2RHTA 4QPCA 3M5DA 4C3ZA 1K5PA 3FTNA 3JYHA 4J94A 4BO8A 4OJ6A 2KMLA 1CUZA 4JOBA 1QBGA 4Q7QA 1PJ3A 3HSYA 1NVDA 4TLCA 2TS1A 4D8TA 1IG3A 2Z1MA 5FA8A 4CCWA 3A6DA 4UNRA 1YGYA 1TK8A 3VKVA 1BFKA 3MJTA 3W9SA 4X92A 3RT1A 2XGOA 4M8SA 3HN2A 4PYOA 4C8NA 5I7AA 3UMYA 3GNLA 3EZ6A 3ZE6A 4C0BA 1XLTA 2WTEA 1YZ3A 4JJ6A 4BYMA 2FZ4A 4J29A 4B3XA 2CJYA 2EOAA 3FUVA 5JS8A 2KK0A 3ND8A 3UIEA 4CUJA 1S8AA 1XD9A 2HEGA 1TI7A 1Q3KA 1CDZA 3EH2A 1B93A 4X90A 3WNVA 4EFMA 5DYWA 5E1OA 5DMXA 2V7VA 2P6RA 5A3RA 5JNLA 3VAYA 4GX1A 2GEJA 2YMLA 2A3NA 1KBQA 3SLGA 8ICIA 4WBNA 5FPPA 3L18A 2XICA 4AVYA 2YV2A 1Q7CA 1BEZA 3ZHRA 2ZT7A 3EXAA 4TVOA 1XP5A 4G0WA 3NRZA 1LPPA 3GMIA 2Q9CA 4DLBA 4QGHA 2ZT5A 4KWEA 2IF0A 3EPHA 1IVNA 3H86A 2NZ2A 4FEGA 3S2ZA 4WY5A 4BVKA 1FS6A 1X7YB 2NV2B 4K6FA 2IS1A 1YZKA 3T06B 3CSSA 3RHZA 1X86B 1ZU4A 1MORA 2OYSA 4O2BA 2BDPA 2IHVA 4S0XA 2OAQ1 2OXIA 1YZNA 3K70D 3RVJA 3O90A 2R4QA 2E8NA 1HFEL 1R0WA 1DPFA 3TSAA 4UTZA 2IYQA 1TT7A 1Z6GA 5LP1A 5CNKA 3WLQA 4TT3D 4IGFA 2QLBA 1QIFA 3FJOA 3PUIA 2WFAA 1V3TA 1TLFA 1I3OA 2AN9A 5L9XA 3LDFA 3U3ZA 1Z45A 3TLYA 2QEQA 3VPAA 4K0RA 4F2WA 1J2EA 3SZMA 1JB1A 3MJSA 2W48A 2XNCA 1YS7A 3ZBQA 1BHO1 3T12A 3IQEA 2ID9A 1U8YA 2OK7A 1NZBA 1MD9A 1COOA 2CLCX 4XA5A 3GLSA 4I08A 2C2DA 4HZUB 3LDAA 2R1UA 5GTIU 3M0EA 2BKEA 3SLKA 4YMGA 1Y5RA 4BP9A 2ODEA 4B85A 5AJTA 1FDIA 1EH5A 3PTAA 121PA 4D5GA 5KKCA 2JXJA 1YCGA 3K9CA 1Z08A 3S2IA 1MJNA 1W6RA 4Q9NA 1O95D 4YEDA 5BXQC 1Z0AA 3S7TA 3W2FA 1JQ5A 4NV1A 3N9IA 4D45A 3QK7A 4F46A 5L53A 3MCVA 3DNPA 2PK3A 4X6LA 2YXEA 1Z8NA 1EG7A 5BSWA 1M2VA 4NMXB 4G2NA 2ZIVA 3BF8A 3MD0A 1M6VA 4QOHA 5CLGA 4AJOA 5EPOA 2AJBA 4MEJA 2J32A 3L9XA 4YRQA 1DVRA 3N7TA 2IHKA 1U4SA 1GA1A 1GITA 3NWJA 4M87A 3D31A 2AV6A 1PX0A 5FO0A 1U1GA 3RYCA 3U9TA 4HDNB 1P1BA 4OK3A 1IB6A 4OHFA 2YOFA 1BQ4A 5J2EA 3C1TA 3DTYA 5HJEA 1YIOA 3DL7A 2G9RA 3EBPA 3G2OA 2IEGA 2OO3A 1I7NA 4JKYA 5IH3A 2PXHA 4TMYA 5EMJA 4CQLA 5J40A 4WI1A 3LDGA 1ZAYA 5KYYA 4DR7B 4QYWA 1HX7A 1KI9A 5JW6A 3C3KA 3JPTA 4RF2A 2H5JA 3NJRA 1FP7A 3H1EA 1LUAA 4YR3A 4B3FX 3RVMA 3NBFA 2B30A 1Z5WA 2GZMA 3W6OA 3N8NA 1R1DA 1Y8CA 4DWJA 4RV9A 4TV9A 3OCWA 4PYLA 1OV4A 4RTLA 4DARA 3A4LA 5BYAA 2FPIB 4AJEA 1YS9A 4LVCA 3NFRA 4MNTA 3HDTA 2C8JA 1W48A 4ZTZB 4ARUA 1DIOB 3REQA 1C1HA 4ECTA 3JYLA 4YDRA 1HG0A 1XZNA 3AF4A 3L7CA 1I8TA 3L79A 5LLTA 1MN8A 2BJHA 1IZ0A 1KIMA 2B7BA 3N0XA 1D8YA 3R7DA 2FWMX 5DHSA 5MN5A 1Y7LA 5AD1A 3IHLA 3GRPA 4C2UA 3S2YA 3DVQX 5D1NA 3PHIA 1HL3A 3AUUA 3H1GA 4IQ8A 4KLLA 4GWLA 1Y1PA 5DCLA 4HWGA 5BSEA 2GYUA 3OZAA 4J2OA 5CLLA 4DLEA 2XAAA 3LX4A 4TUSA 3I83A 4AUMA 2XGSA 1V2HE 2ZITA 2X1HA 4YRKA 2Q8QA 4AW9A 2PR7A 1AQIA 3C3JA 1Y8AA 8ICYA 1KI6B 4LRSB 1COKA 1SVWA 4P7BA 5FPSA 2X6QA 3AUXA 2K6GA 4LXIA 4DQDA 3JYNA 3VNVA 4BC0A 2PUGA 2CLEB 2GZRA 4KQKA 5B53A 5CLFA 2VFAA 3CLRD 1ZW1A 1DXHA 2PMCA 4DIMA 3DEEA 3H4BA 4M9UA 3R5FA 1WY5A 4C2AA 3KJZA 5MDHA 1L5OA 4H7HA 4DMUB 2HDHA 1F9AA 1UWKA 3ASZA 1TJ5A 2MDTA 3I6YA 4Y7DA 4M83A 2DQNB 1P3JA 1XROA 4DBLC 1K5OA 3B1KA 1UXKA 7MHTA 3PXCX 2HNKA 4IDFA 3LYSA 3HRHA 5TS2A 1GL9B 2DY0A 3T5JA 2G70A 5DHQA 2OC4A 2VNJA 4EZIA 2FKAA 1VGQA 4J2TA 3UCEA 4G0VA 3FDXA 4QDTA 4KTTE 4UMEA 3SY8A 2PXXA 4FYXA 4MUFA 5C51B 1OXBB 4BXOA 4DRXB 5C8VA 5HP4A 4Y6RA 1SXJB 3DKVA 4FCVA 2W83A 4XIYA 2JJ1D 4X20A 3CY6A 3IT0A 3HL0A 5DYGA 2HWUA 3K5IA 4WECA 2WSYB 5DBAA 3SLRA 5CDFA 5IYZB 1Y6FA 5LZ8A 2Q3EA 3MK31 2QLLA 5FTJA 5CVDA 3G2KA 2E49A 4ENSA 4RY8A 5LSAA 2JA1A 5J0SA 1YQDA 1G19A 3I2YX 2ZPUA 1DXSA 3KHHA 4MB6A 3DWIA 4LZWA 1XC7A 4NBTA 2W7TA 5AM5A 2W2KB 3ER9A 3TAXA 1BKSB 1SG9A 1ILWA 3PHCA 2YV3A 3CZQA 3KJHA 1E6MA 2MINB 5GY7A 3DQQA 2D54A 2QQ5A 2XKKA 4Z2YA 5ALVA 1P1KA 2X4LA 3FGOA 3WNZA 4F1WA 3E8MA 2NP7A 4BN4A 3QFSA 4QZCA 4NOJA 1OF1A 3D81A 3OQIB 1P4HA 1II8A 1B3RA 1RJ9B 1M5UA 2RHDA 1LK0A 3V8RA 1OZGA 5KZMB 1GPYA 2RGGA 4M99A 3OT1B 5F5NA 5C37A 1DJOA 3CWQA 4QJ5A 1AHPA 5CA0F 4ZD6A 2OPBA 4INOA 4U1RA 1CEQA 1X7ZB 3I0ZA 4HDKA 1YT3A 2O7RA 3WQBA 1VBMA 4TRRA 3BEOA 4PGXA 4HDOB 2AR9A 4MUHA 1BAPA 3TS1A 3NU1A 4MLZA 3M9XA 4B3HA 2REXB 2H51A 5DKFA 4OF4A 4BMVA 4BFXA 1Z5GA 4IX1A 5C8DA 1XJQA 1PL8A 2HJ9A 2YMMA 1Y1TA 3AW8A 5J2TB 5CVJA 5AHXA 4QZDA 5DCWA 3CEJA 1GPKA 3DEFA 1QJ4A 2ATIA 5DOZA 4INJA 4YB8A 2BF7A 5KT7A 4UDNA 1H6CA 1T1RA 4J0JA 4M38A 1EIWA 4QA9A 4NZ9A 3QVMA 3W2TA 1H2AS 2OLJA 1WW2A 2QB5A 3DO5A 2FMHA 2W7PA 4WN9A 4BLOA 2XB6A 3H5VA 3QVXA 2IPNA 4GYKA 5HKBA 3R5JA 4PX2A 4YHHB 1OFTA 4PIPA 1DAPA 1OXJA 2D62A 4MVJE 3JQ7A 3TLAA 2XR1A 2QL9A 5KFYA 2WYHA 1L7DA 1VI6A 5KNBD 2ATEA 2IBMA 2UYYA 1NUPA 4MYTA 2ZU0C 2HBZA 4Y2HA 2ZJ0A 3VC2A 1HO3A 5JZMA 5I9SA 4DR5B 2HJRA 3CX6A 5KVAA 4RL4A 4RVSA 2Y1IA 2OHHA 3V7FA 2JGMA 2JGIA 2D0PB 3KX2A 2OCIA 1M1NB 5DEIA 3AI1A 2XVMA 5CIYA 4OO3A 2A1UB 2B37A 1TIBA 4NH4A 4H7IA 4OL0A 2IZ5A 5FTMA 1RQNA 5AJZA 2DFPA 3X43A 3RGWS 3ISCA 4IQFA 3QPBA 2W98A 5EJEA 4IXTA 4E5SA 3G2MA 1R0YA 3VTAA 3RHSA 3PZPA 3Q3EA 5DYIA 1QIHA 1V35A 3OCCA 4YT2A 1S02A 3FNIA 1VJTA 5EJ7A 3KSZO 5CVCA 3Q4GA 7MDHA 4CTJA 5KQRA 1QTRA 3DCIA 1IBCA 1DV2A 4JLMA 4YIHA 4QGSA 2RAUA 3LQRA 4GI3A 2PU7A 4WFQA 2C0PA 4TSRA 3HNPA 3IM1A 4MQLA 1PSDA 3C70A 3NVMB 1JJAA 3RSHA 4P38A 4WACA 5ILQA 1I2DA 3EZYA 2ZSBA 3WGVA 2NZJA 2ZRHA 5KO2A 1NVEA 1ZETA 4HWKA 3BAZA 3FMOB 4IFEA 4EFKA 3KDPA 2X0FA 1PNTA 1NVMB 2Y68A 1A77A 1Z62A 3R3HA 1DBVO 3CHYA 3RS3A 1KIFA 4I3HA 4G89A 2NO4A 1X7HA 2IYSA 1SKUA 3TVDA 2V3CC 5E8JA 1UMKA 3FYDA 1Z83A 3RJKA 1L5WA 2FU5C 1F8FA 3F74A 3OZVA 1DL5A 4O5EA 4BNHA 3IDSA 1JTVA 4DQIA 1RLOA 3IE2A 3U9SA 2Z8YM 4EKDA 4MK4A 5B3JC 5CT5A 1GL6A 4G3IA 1ECWA 4JT2A 4R7GA 1ENYA 1T3TA 1P9LA 1YR9A 4JQSA 1SJ9A 3FVQA 4GIBA 1NWCA 3G8DA 5IZ4A 5HKKD 3O84A 1E0DA 3Q0TA 1MHPA 4MV4A 3N3AC 3T3DA 4PBSA 1U2PA 5FBLB 3PPYA 2QIOA 1J8VA 1LD3A 2OLKA 1AHNA 2H85A 3SSOA 2OP0A 3IQWA 1H4TA 3TDMA 2ZRFA 1PK1B 2C2KA 1C9NA 4E03A 4MW6A 2O3TA 3K9FC 1LSJA 2J3JA 4F5OA 1VPWA 1LPOA 3N86A 2FVXA 1QG4A 3W3ZB 5LIPA 1DC4A 3PJGA 4ENUA 3MUEA 4X54A 3LFTA 3KG2A 5ALQA 2D6FA 2AGVA 2CHQA 4EPVA 5JIBA 4JSTA 2LRHA 5D1HA 2NZUG 3VO8A 4DL9A 4CFZA 4ON9A 1IM2A 1HMYA 4LE0A 5BUSA 4R1QA 1Z2NX 3UUFA 3OX3A 2GM3A 4Q9DA 3AERB 1HDZA 4YWJA 2R6ZA 1PEKE 4HDMB 4A0RA 3AL2A 4LY3A 3WYEA 1CR0A 1QG6A 3RO7A 2D3DA 5KTOA 1SCQA 3WMWA 3A4YA 1P5HA 3OVMA 1K3FA 3OZWA 2QIPA 2REQA 3ZE0B 1B8PA 1X7YA 3K05A 5HS4A 5D6OA 2QMQA 3UOWA 1Z4PX 521PA 1YDGA 4H3HB 3PCTA 2WPDA 3H75A 5GPBA 1NUTA 3R40A 3FX2A 2PGIA 4NY8A 3V33A 1WUDA 5DBBA 1DC5A 1JQ3A 4UHKA 3CEAA 1WD7A 4JWKA 3RH6A 2Q4RA 1C50A 4N03A 5IILA 3DB2A 2XRFA 2ODQA 4JUDX 2XRZA 1ACMA 4EHJA 1MT3A 2R9VA 3EEIA 8ADHA 3GZ4A 3KR1A 2IYYA 2FK8A 1QTQA 3GEHA 2GF0A 1U2QA 5ALRA 5JWHA 3F3YA 4MWDA 3HZHA 4Z6EA 3AB7A 5EXEA 1UPCA 1DGSA 1JR4A 2ATCA 1J0AA 1AQ6A 5ALFA 2MR6A 4RAOA 2JFPA 3H5OA 1NI3A 3IDOA 3UMFA 3OESA 8ICQA 1XJCA 1WUKS 4U3JB 4BE7B 4JUAA 5D3MB 4EL0A 1E99A 2IHBA 3Q11A 2NYAA 4HZUA 5K0LA 4R2KA 4XYMA 4WADA 2HOQA 2DBRA 2NIPA 4TVSA 2YWCA 2GO7A 2Q8NA 1DQRA 1KL9A 3ZW8A 4A8JC 4ECWA 1U3UA 3IUNA 3HA5A 1RVDA 2Y1XA 4WOKA 1SQ6A 1AIPA 3JD0A 4JCCA 1W73A 2BCRA 5IAOA 4LJ4A 4EQZA 1XVAA 3FB4A 5M3BA 3I72A 2IUEA 1UAYA 4A8HA 1YZFA 1O0CA 3STXA 2J08A 1ONOA 3ZVRA 1XLVA 3ESRA 4RHTA 1MG5A 2CDAA 4JNKA 2QMHA 1RW4A 2O3RA 4GPTA 4ZQBA 1M8PA 2QGNA 2JD2A 4HDNA 3B6JA 1NM5A 4YBRA 1DC3A 5BNFA 3DXXA 5JSKA 4J1TC 1NNSA 2XCRB 1LLQA 1SRRA 1JQLB 3CNNA 2G80A 3UOAB 2WSIA 4JOQA 4LVSA 2CUZA 3UHJA 1MNQA 5B7GA 2QYHA 2IH5A 4ZHQB 2BM9A 3VHLB 3GOQA 3A7DA 4MV3A 2C92A 4PYQA 5FPTA 1T5IA 2AN4A 2G6TA 2O8NA 1PVPA 4J1NA 1OSNA 3HCNA 4BIIA 3L84A 4DLSA 3SKXA 3OFVA 4K9MA 3ZCXA 3FFBA 3R9IA 4FR2A 3A2NA 3PJRA 1OASA 2BH9A 3NX4A 2X4IA 4R64A 2YR0A 1TV9A 3EDMA 3FDSA 4TGLA 5D5QA 3O95A 1XZLA 2FPIA 1JRLA 2PPLA 2ZS8A 3OM8A 1E6LA 3O4FA 5AR1A 1UJ5A 3QWAA 1JMSA 3R3UA 4A10A 2CL6X 9ICMA 2BCQA 3LVWA 1XA0A 2HK9A 2EBWA 4F5ZA 4G09A 4DWOA 4EZEA 1YMVA 2PYDA 3KT6A 1RFGE 1SVUA 4YFVA 1ZL2A 2XQKA 1EFUA 4M8LA 4D0GA 2YYZA 4R5HA 1CZHA 4ZDKA 3OWHA 3THWB 1G8MA 2BLNA 3MNFA 3K9QO 4PAWA 5BN1A 2BD0A 2FWIA 4PSUA 5IJAA 2YS6A 5GV8A 1Z17A 1B76A 1NNLA 2OA0A 3LUPA 4UBLA 1M2EA 3TOXA 1VE9A 4GGMX 3PTZA 1MX1A 4PGAA 4ZQFA 1KI6A 4NMWA 2ZJ8A 1L8OA 1KEVA 4FDUA 3LK9A 4WLVA 2QL7A 4J03A 3RM3A 2ISSD 1DX4A 1V5EA 3D3NA 1FRNA 2B25A 1EWVA 4IH1A 4WEOA 1PEYA 1FW6A 1MT0A 2UXBB 1JIXA 4M1TA 2WJAA 3TLKA 1H1TA 2CNDA 3IESA 2NUBA 3RTDA 3MDAA 4MWTA 2CK3D 2QTLA 1MQSA 2OSBA 1ODLA 5FJJA 5JCZA 1C3JA 1PFKA 1PN3A 5HS6A 4YP9A 5KU1A 1XL1A 1A6SA 3AWIA 2A1TR 2AIRA 3BC1A 2GD6A 1XHLA 1U3CA 1V8BA 1QWOA 1HE4A 5DSXA 2WT8A 2ZBVA 2OO5C 4DCGA 2B69A 3AINA 2XUFA 2FNAA 2DPHA 5EY5B 821PA 8OHMA 3DE1X 1OYVA 1HUQA 1SRQA 1T5BA 5AI5A 9ICHA 2BHRA 4K05A 3HK2A 1OE0A 4DRXA 1RDFA 4RPYA 4XWOA 3ZJ5A 1AUOA 1SXJA 3NONA 4MGKR 3NXKA 3ZGZA 1BMQA 3NGLA 2ATXA 1D2HA 1GQFA 3PUWA 5IYZA 1CEZA 4RETA 3GQCA 2LYHA 1RZUA 1GL7A 4KIWA 4LMPA 1WUTA 4CNQA 3PX0A 1C3VA 2ZKLA 2FXIA 4NKRA 3A26A 3DEJA 4JI3B 3ONNA 5TGDA 1S76D 1QQAA 4KLGA 3RBZA 4F4ZA 3WL6A 2W2KA 4CIBA 4TXJA 4Z9YA 4L4SA 3DZIA 1A8QA 5EJGA 4V38A 3ZCQA 3UVEA 2HHXA 1COWD 3MAJA 5T4FA 2QT1A 3CBGA 3S44A 1OGIA 2MINA 1CZNA 5F3RA 5HHIA 1CUWA 2YQ5A 2PUDA 4RTQA 2D7CA 3WYFA 5TY0A 2C4VA 7ICRA 1BH6A 7ICUA 3HO6A 4RHYA 4U9UA 4CMEC 1K2WA 3OQIA 1YJCA 5FPHA 4PNZA 1Y33E 1KO1A 2VYND 3PB3A 5H4GA 4GXTA 2HQBA 3OT1A 1JMVA 2ZVDA 3DKIA 3EPRA 1ORIA 1X7ZA 1WBBA 3F4LA 5FUWA 3Q12A 3Q0EA 3V2IA 9ICRA 3GXOA 1Q57A 2MMGA 1XUOA 1ECLA 4CMHA 2O8DB 4P32A 4IF4A 3NHLA 4MAFA 3LECA 1UM8A 3KEMA 4KV7A 4P3OA 3AF6A 1QIJA 5B12A 1XZEA 1NDQA 1ZQPA 3WWOA 4K2AA 2V97A 5J2TA 5D3ZA 2O2CA 4ER7A 1O6GA 4MKFA 4B9NA 4KKVA 1X66A 1OGJA 2WFZA 1ZOOA 2Q4DA 5EE9A 4FYKA 3GV5B 1U2GA 2WHRA 4LVUA 2HBQA 3LW7A 4B9EA 4EGAA 3DMTC 4EA7A 1GY8A 4ENQA 1X94A 1GZ4A 3WA6A 4KQGA 4EKNB 1TM7E 3OJLA 1R8SA 2PE5A 2QTRA 3B1XA 2ZS7A 5KYVA 3DT9A 5AKHA 3RJMA 3B1YA 3NIWA 4OHBA 5JXJA 2DZDA 3ZWKA 1ACLA 5FLYA 3E2PA 3ESAA 3SXJA 3SD7A 2ZWIA 1H22A 1RAEA 5BMVF 2MAXA 2C82A 4XDGA 2BQUA 3LC2O 3FJYA 2WA1A 4KLUA 2Y0SC 1F12A 1Y6JA 4XYEA 1P60A 1M1NA 5FL3A 4C4SA 1C80A 3E7PA 4X45A 2AR0A 1H8HD 3Q5GA 2A1UA 1VOTA 4BRZA 3MFIA 5IDWA 2LXNA 3IVCA 1CPYA 1GA6A 1W4BA 4GZ3A 2AGQA 4PYJA 5CA1B 1U7XA 3GFFA 4FEEA 1Z88A 4CZ2A 4QUEA 5AM3A 1CK4A 4F3OA 1ONSA 2VJBA 3I30X 4K1LA 3ICCA 3WSVA 4Q3AA 5SYAA 3EODA 3V2UA 3FG9A 5A62A 1GDDA 4JLWA 5ALGA 4OJPA 2YFQA 3O3NB 2DFDA 4OMFG 2HQOA 5KT2A 1QH8B 2BE7A 2QOEA 1OWOA 1SUBA 4BQNA 2A88A 1ZJ6A 1NLZA 4FKZA 3CTMA 2AOTB 1A9PA 2CYCA 1VCHA 4M9ZA 4XSGA 1R9GA 1QO7A 4OXNA 4BNYA 2FOLA 2G63A 3WHKA 3CVJA 3QYFA 2CE7A 4R40A 2X1LA 3RWMB 4RPCA 3IPLA 3WIUA 2O57A 3HUFA 4DGQA 2AQKA 3HLYA 2H1WA 2D7JA 1XK6A 4C9BA 1XOIA 3HEMA 1SZDA 1CNMA 1E3WB 5JYDA 2BE9A 1HLDA 4D9NA 3QUAA 4FX2A 1K5GA 2ECFA 2CMKA 2RG1A 5AW6A 1FDSA 4WXHA 4PG7A 5B1SA 4PW0A 3SI7A 3N2YA 4ZCQA 1S2IA 1XO0A 5I7EA 3KKKA 5GP1A 1MC1A 1G5PA 2ICAA 1LJ8A 4JKIA 1R27A 3I2JA 4POAA 2F00A 2N42A 4O3NA 2MHCA 1QPBA 2Y4OA 2WNIA 3W4KA 1W5SA 2IHTA 4G97A 4TKLA 4G5YA 2VYVD 3KAPA 1CDDA 1SKQA 3VCBA 5B3KA 2FI1A 3L6UA 4J6FA 3MJFA 4ARZB 4XIIA 1O8CA 4JIGA 4PZEA 4G85A 1JIQA 1OUMA 2QVXX 5CK5A 1AQNA 3L1HA 4H6XA 4NYJR 1PK1A 4ZP1A 2A9KA 2WRZA 3W8EA 3L43A 3L3BA 1TQ6A 5DLGA 1ZQSA 3DZJA 3VPFA 4BX0A 2IT1A 2GFQA 2LBPA 2D8CA 3SQIA 4YJFB 3OZXA 5A3SA 3MCZA 2CXRA 2V03A 3AESB 1MAAA 4HOYA 2R48A 2Q3HA 2C9BA 3LLUA 5KT5A 3AQIA 3HA2A 1WA5A 3H9EO 5KT6A 3EXG1 4DV2B 1YIDA 5ALZA 1KBUA 2CNWA 3MUNA 4ZREA 2GCOB 4LX8A 4Z6DA 1JRPA 2W9CB 5H5JA 4D9CA 1QTNA 4R81A 4QT4A 4BDSA 5DWVA 3NATA 5FI5A 4JVNA 1NFQA 5LQUA 3AERA 1TO6A 3OGUA 3F71A 1Z4IA 4HDMA 1FSPA 1MRNA 3F46A 4ERXA 1AKVA 1ZD9A 3A70A 3B85A 3KAKA 1UODA 4PLTA 2WG2A 3ENVA 4PV7A 4C88A 4EI9A 3O31A 2BFDB 4NV3A 1KQPA 1N32B 3LGAA 1AUQA 4YMTA 5DXAA 4H4EA 5F9NA 3V8NA 1UBNA 2XRYA 5DIZA 2IEBA 4M0DA 1JDSA 3INNA 3AB8A 1F6DA 4M1EA 3JZIA 3EGOA 4F9TA 4NP6A 3ZHTA 1USKA 1TTTA 1TTQB 3R4VA 3Q85A 3GV0A 2ZRGA 3DOFA 5GTDA 1IOLA 1ZLXA 2QMOA 1JAZA 3KKOA 4KN6A 4Q01A 2OXRA 5EHQA 3WYCA 2IYAA 3GLHE 3OCYA 3IB6A 3ZNNA 1RIFA 1JA1A 2I2DA 3INRA 5E7JA 3GYGA 3QVTA 3JQEA 1F1JA 2JZCA 3P4YA 2QY9A 4ER3A 1OY1A 1R5BA 4AX4A 3KQKA 4U3JA 5D3MA 2DWCA 4NRDA 3KUCA 1Y6QA 1ZNQO 3P4UA 1HEKA 2QTWB 4LBWA 1KYTA 3TD6A 4BO2A 3AKYA 3BS5B 2Y1OA 5A0FA 4WRRA 4OVKA 5FTNA 4YMLA 1Z4JA 4FC7A 3NEYA 4ND5A 3AN1A 4DCVA 4ILEA 4ZICA 5LB4A 1GIAA 3QW4B 1KZYC 5JDCC 1L7OA 2XT9A 4K86A 2GJSA 3GUHA 1Z29A 3RFUA 9ICIA 3OG9A 2Q2NA 4KX5A 2N3ZA 1Z35A 5DYTA 4RD3A 3ZD6A 1BDJA 5JJLA 2R60A 3QWFA 2IZOA 5GMOA 3B6KA 1KJ9A 3N2LA 4OHVA 4RHFA 5J0YA 2G04A 1A2QA 4WNYA 2IHUA 3VSEA 1Y5MA 3PDCA 1GOTA 1A4IA 1O97C 3H87A 3X1XA 2C0CA 4QVKA 4KLAA 2I33A 4DW8A 1RXEA 2ZUEA 2Z8YA 9ABPA 3HZRA 4MKZA 3BAFA 1XPRA 3QX7A 1K86A 3AJRA 1TPZA 4D3YA 4MUMA 1EDEA 3G89A 3OSNA 3FOEC 1P0IA 1XEAA 1AMOA 4OJLA 4FBUA 3QELB 2M98A 2ABWA 2H4FA 4JC5A 2P90A 3E3AA 1Z22A 4DANA 4KXWA 4NYMQ 1QCZA 1RXUA 1KEKA 1GQSA 2A9FA 3DW1X 4AJ4A 2ZB7A 3UHAA 4UAJA 4AG6A 3UG6A 2ZBRA 4XB6B 2ZBPA 3K0CA 1KBOA 2RC6A 4GRIA 3GA5A 1NRXA 3FLAA 1L3CA 4G4IA 4TMWA 4LIPD 2JGDB 2BHTA 2PGLA 4PM4A 1RRMA 2QB0B 1A3CA 5H3CA 1KS9A 4AKTA 3HKCB 3ZGOA 2JAOA 3TTWA 1R5OA 2E6UX 1PW7A 5B7QA 2QQ0A 2DQKA 3KU4A 3H97A 2VIIA 3ZX4A 1AF7A 4OK6A 3WK6A 1W29A 1U48A 4R3WA 3THWA 5CEHA 1U2DA 4IWXA 3T0GA 2PFNA 4URVR 2G9NA 1WMAA 1U2SA 2PG3A 1PGJA 3ZNOA 5DBOA 2B20A 4ER0A 4G0QA 4N0MA 2IZ7A 1YONA 4ED6A 4QXPA 1MP0A 3WRYA 2NT3A 3HKDB 3M3HA 3RIGA 4TZKA 4GE3A 4Q9LA 3ZHUA 1PJLA 4Y0NA 5F2NA 2ZRPA 1FTYA 4GI2A 3AC0A 1RYNA 3GZFA 4E3ZA 4CRXA 5J2UB 1GCOA 4RNOA 2R85A 2YIVX 3JRWA 4M7PA 1ONNA 2H4JA 3UPUA 4AAYA 4FX5A 3I76A 1L0BA 1DTWB 4COKA 5B55A 5L1JA 5K3CA 4EJSC 3V32A 3DG9A 4CTKA 5DSZA 4DCCA 5FWAA 4IUCS 3WA7A 1IBRA 3FTCA 5KNCA 2XRMA 1KDOA 2FW6A 1RP1A 3T5CA 1Y81A 4PHHA 3FDZB 2F77X 2L5YA 1UJMA 4TS3A 3FCUB 1N0HA 3TLJA 3NGDA 3U7RA 2QM7A 5H4HA 3P0RA 3II6X 3V7NA 4I29A 2XZOA 4EBBA 3IC5A 4MKRA 3MRXA 2HQSA 2WAMA 5H7XA 1X40A 5A4DA 3CU5A 3BXEA 3WLTA 5EWJB 1QE0A 3SC2B 3NJ8A 2HUPA 4B8WA 1QCYA 4K2HA 3OQ6A 4ZOBA 3OT4A 2BBOA 4MSUA 2VXOA 1AZLA 2R62A 3H9CA 3KFUF 3HE3A 3TDNA 5AVVA 2EX0A 1XWWA 1SU4A 4KWIA 1LDGA 1MF7A 1AKQA 1ZQ1C 2XBUA 2WNHA 2O2IA 3AR8A 3F1LA 4CETA 2R66A 3HB9A 1BYIA 2NO1A 3WK4A 3EOAI 1EGQA 3OUTA 4AP9A 4IRCA 1NF3A 3AKEA 4TWAA 5BQ5A 4M8KA 2BGIA 3UTDA 2P5SA 7ICPA 4G9EA 1MIHA 1X9GA 1DWOA 1A9TA 1FXWF 1RABA 3HJNA 4RA6B 4RFVA 1IRIA 5HHTA 4JV1A 3RS7A 5G0TA 3CA8A 4ABTA 1M34B 2P7IA 2BEVB 4ELTA 1A2KC 3MQ4A 4KNYA 5A4JA 4U4AA 4NCIA 3LH5A 4DXHA 2I9GA 1XEXB 1ZZGA 1Z12A 1TQ8A 4QNLA 2QAJA 1ZQLA 3AVYA 4WINA 3BIJA 1MJHA 4OQPA 1LDMA 1G8AA 1JKJB 4FYYA 3IDWA 4A26A 1ZK3A 2VPWA 2HW8A 3T1HB 1EX6A 1NQTA 1LLUA 5JEDA 3A0BU 5HDQA 4OX9B 4U63A 1NBIA 2XADA 4C05A 4W63A 5T4BA 3UWOA 1J0EA 4EPXA 2TMGA 2VRCA 2HCTA 3C6YA 4DIOA 5AXCA 2O8DA 1C0IA 1TMKA 1M6WA 3HCFA 4NFYA 2FUEA 2GEFA 4A4DA 4UCQA 3T95A 4F2GA 3VKHA 4C22A 2IDJA 2IEIA 4Y9TA 3Q6NA 1JG4A 2E4XA 3T3PB 4BJ6A 6YASA 2FPGB 4GMDA 2V1XA 5DGBA 4R54A 2GCGA 3E15A 2FEMA 3FVTA 2PX4A 3KKZA 1HQCA 2VATA 3FF4A 3PDWA 2PX8A 2HUNA 1EP9A 3SEFA 2CRXA 2FFRA 4RQ1A 2VVTA 4B9MA 3WYGA 5H82A 2LGJA 2RK3A 2OHFA 3KQVA 3V7KA 3D7SA 4MV5A 1LF5A 4M9XA 5ELXA 3ZJ4A 3F1KA 1XN1A 3U4QA 3MHPA 2H7VA 3LXXA 1E2DA 2FUCA 3P9ZA 1YFZA 2I2FA 3MTEA 5JJBA 3DEYX 5JS2A 3O3OB 3D2SA 1IZ9A 3SPXA 2QN2A 3SX0A 2IOHA 1E2IA 3EVGA 3N70A 3AUSA 4WXYB 4UAYA 2BKVA 4M49A 2COEA 4C80A 3FHOA 1DWUA 2H92A 3GEBA 3T5DA 5FPKA 4AJ9A 1VMIA 2D1FA 5SYNA 2HFKA 4TOIA 1EK1A 3KD3A 5ITVA 4KUEA 3DXYA 3HN6A 4L0QA 2EFDB 3WB1A 3ZWNA 3MABA 1X0XA 1L3VA 2ERXA 5TJ9A 3V4PB 5AVTA 5J5CA 2JIQA 1Z7GA 1NJ6A 3ZXYA 1G2OA 1JZSA 2Z09A 5CA1A 1V3QE 2ZJBA 2QF7A 1T4CB 4J16A 3WQRA 2DPXA 1SUFA 4LJ9A 2W8KA 1BE1A 1NKSA 2IVZA 2NU7B 3X3HA 3I45A 3IHTA 3TRJA 2BRUC 4BEVA 2GSDA 1W5FA 4R16A 3MT9A 3TK1A 2NVOA 3D02A 3L8HA 4NCBA 4D9IA 1OQAA 5G3ZA 3GO4A 4RIGA 4EWLA 4TQUS 4HR7A 2ZUSA 2V96A 3BB3A 5CDFE 1QH8A 4QIWC 1ZMOA 6CHYA 1S3GA 4JP1A 5IJ0B 2AOTA 1SVSA 1RYUA 3MLEA 5IUKC 1KA9H 4R7TA 2GT1A 3GJ4A 3LKBA 1H69A 3ZQUA 3ECSA 3GJQA 3I5UA 5FLXA 1HGXA 3VU3A 3IAFA 4RNNA 2SKDA 5CD1A 1V71A 4LVNA 2JIZA 1OXKB 1G5IA 4RK0A 1JEJA 1C7JA 1B4FA 1E3WA 2G5HB 1KAGA 4OHKA 5BQFA 3AJ8A 1CDEA 2RI0A 3N8KA 3BIFA 3ED1A 1KTQA 3R9KA 3BA6A 3LT1A 1HF3A 2QM0A 2JHGA 1RJEA 3Q7TA 4R0MA 4ZRNA 1QUFA 1EX9A 4B6PA 3A6EA 2WB2A 5J0WA 5F5LA 3BZCA 3PBKA 3ZTYA 2B2CA 3A32A 5FNVB 3IS3A 4ARZA 3ZQ4A 1G5HA 2JZNA 1NE7A 4KMOB 2OK8A 1RAAA 3MLAA 2QM3A 2FSUA 1N2JA 2YWFA 5IINA 2OV4A 1ZVVA 1DIBA 2I7CA 2D13A 1IXSB 1P9NA 4YJFA 3NOOA 3AESA 2H3EA 1FFHA 1ZGZA 4IL5A 4NMHA 4WNCA 3QOFA 1ZG3A 4EYQA 1I80A 3WSTA 1L4EA 4BGUA 4E2ZA 2JKZA 3WU2U 5KJEA 4LFAB 2RIRA 2QRJA 4ZAYA 3PPXA 4ZVSA 2IXBA 2GCOA 3ACDA 3G0BA 2GZ3A 1V96A 2W9CA 2HBKA 5T64A 1WPGA 2XE6A 1GNSA 1WHSA 2OKCA 4L9WA 4QHSA 5EUQB 1J9EA 2G1PA 4P3PA 2C9MA 2ZSJA 4X94A 2F3PA 5FF9A 5JO0A 2CDNA 2GBIA 2XUZA 4OOFA 3TD2A 4AJIA 1NK8A 2ZAYA 4GMHA 2WD9A 2CFCA 2YICA 2BFDA 3IFSA 2O5CA 3L6DA 3ETNA 4Z4CA 1JW9B 2OUIA 3QGMA 3ORQA 4KLFA 6REQA 1O08A 4NQRA 1ZVMA 3C14C 3CTPA 2WHXA 3P9CA 5KPDA 4MVCA 3RS4A 4GQIA 4ZALA 3KQPA 5JS1A 5FLKA 1A5BB 3HKEB 3RODA 2C7GA 1EVLA 2RMKA 1WJGA 4B3MB 1GRQA 2LIPA 3J80A 3SVZA 2VG8A 2MA1A 3EIEA 1W0CA 4OI2A 2JFQA 2AZTA 1OIWA 2H3IA 2C59A 1GO3F 1RADA 2VXYA 4GPBA 3GRFA 4D80A 2GTIA 4ZI5A 2HIAA 5EFZA 3GEEA 1HE5A 4QNNA 1T4BA 3MWFA 3OU7A 2VYCA 3MRVA 4L75A 1X3LA 1OTXA 1BVSA 2V54A 1KFDA 3NQ41 1R88A 1XC9A 1RXCA 2XQIA 4D4GA 3VR3A 2HTFA 2H0QA 4CV2A 3NOVA 1UPUA 2DJ5A 1N5WA 4IS3A 5KU7A 5AJXA 1VB3A 4WOCA 4XX0B 1RHRA 2BWJA 4A03A 3LPLA 4ILKA 4ZCSA 1DAFA 2PT6A 3BS5A 4CWAA 1PDOA 3MAAC 3VZQA 4Y98A 2V1UA 4L5YA 2F3TA 2DWQA 4MITA 2XZLA 2CW5A 1VG8A 4YQYA 2VNSA 4UM7A 4AZ0B 1U8XX 5EJMA 2R7LA 5A1JA 1U8TA 3D7KA 3FYHA 1GUDA 3EMVA 2CHVA 4NJMB 9ICUA 2HU5A 4RPKA 4YO7A 4KQ6A 5TQ0B 2C2WA 3IODA 4MW9A 1LDEA 1AA9A 5A6SB 3HPRA 2PH3A 5DDYA 1PJRA 4I5EA 4GNKA 1E94E 1TLTA 3FZYA 5FUVA 5C1DA 3FMGA 5P21A 1AQYA 3B52X 2C9CA 1RWVA 4QFDA 1ZCBA 1FUEA 4E2FA 3KPUA 4NZZA 1UUFA 3X1YA 2PZBA 3W6ZA 2GVZC 2ZGVA 4Q4AB 3CZPA 4WCVA 3UENA 1TF2A 4P93A 5CLQA 1E66A 1WQ3A 2HBYA 5BMOA 3QELA 3BFXA 4WK2B 1FBNA 1DKQA 2GBLC 5F4ZA 2L19A 4R6WA 1RHQA 1U1CA 3LVQE 2E4ZA 3OE5A 1OJ7A 2D2XA 2O3UA 3LO5A 2EANA 1DB3A 2ZG6A 4E51A 4J4TA 3I8SA 2UVRA 3R23A 1W4AA 4FZNA 2JGDA 2A5GA 2QB0A 1WZIA 4XGIA 1G9SA 3HKCA 3W8DA 1IULA 4CF3A 3SC3A 3MS7A 3WKEA 2HRQA 4XCQA 2P6MA 4NS4A 1AY0A 1RAHA 4QFMA 3EGEA 3QWHA 2E8PA 2WUWE 2DFLA 4H77A 1POXA 1S8FA 5KFGA 3GLVA 3A25A 3F2VA 2HTEA 2NQ2C 4QARA 2V4MA 1N6KA 1UDRA 3LQFA 1MB0A 1ZOIA 4HNSA 3USES 1QVRA 4AKGA 1EGAA 4E0BA 2WMYA 4MRPA 5IKMA 5DEOA 3HKDA 2GNAA 4FMPA 2J3HA 1J07A 1QAOA 4L27A 1C9YA 1EDOA 5JCJA 3D6FA 2NQTA 4LBYA 4GQAA 4IHJA 1XX6A 3L4EA 1CF4A 1J1ZA 5KSZA 3UT0A 4RUAA 4BZPA 5J2UA 3A1NA 2OBFA 2C29D 1QZUA 1M7HA 1PCXA 2GM4A 1GM5A 4RHEA 4FSHA 4OGFA 3O2NA 1DTWA 1KARA 4DLZA 2X14A 2QYOA 3BE5A 4OLFA 3GFGA 1KDRA 3QFRA 4NBLA 2M6SA 2HKIA 2YNMA 3H40A 3KWFA 2X1MA 5B6IA 4RWZA 3R7BA 2Z43A 1HT0A 1PTJC 2QE7D 3FDZA 4EG0A 4PO8A 2X9VA 1KYIA 2G4CA 5TF4A 1CUEA 4Z3KA 3IRVA 1WUYA 2X3FA 4GDFA 1DRGA 3I64A 4WV3A 3N39C 4WJLA 4P4TA 3E18A 2A6PA 2LM1A 5EWJA 1YU9A 3HVRA 5JDIA 4OJQA 3Q3HA 3SC2A 1DXQA 2UUCB 4LI0A 5EQFA 1ATIA 1IZYA 3KT0A 2V58A 4KTVE 3KJFA 1P2SA 3K4PA 2AQ4A 2XF8A 4MQMA 4DL5A 4MP3A 1XALA 3L7OA 3PI7A 3SC6A 3TTVA 2E2WA 5D8DA 3GFRA 5PNTA 1HDYA 1ONPA 1K97A 2M1ZA 3TQOA 1NK0A 2PMBA 3GFQA 3AHDA 2OY0A 4EF5A 1O8BA 4B7XA 4RA6A 5HQ3B 1C4KA 4WZ6A 5DBGA 1M34A 3CPHA 2BEVA 4A1OA 1W0KA 2OP1A 3TE7A 1JHAA 2Z95A 1JG6A 4DUZB 1XEXA 5FORA 3N87A 2YJNA 5DOVA 3K3PA 3OURA 4LCEA 3OZUA 3JYPA 1JKJA 3A11A 4D0NA 2VDVE 3IKVA 4GLBA 1WAMA 1FMJA 2P9TA 5BSVA 5EHZA 5F78A 4POOA 4C0AC 3BQ1A 1YS4A 3C3CA 5ESXA 1RYRA 3PW4A 4LOLA 3ZHXA 1RM0A 1V8OA 1T8WA 3B5IA 2NVBA 1ZVKA 1STOA 2RKBA 2CEKA 1OHHD 2O06A 1FLDA 3KCQA 2EKLA 2IJGX 1CU1A 3DBOB 1ICEA 2QVLA 1C2TA 3MT0A 4KR0A 4ZVNA 2ZYGA 3JWIA 1XQ9A 4PWYA 2FPGA 4W9NA 2WZCA 2Q3BA 1VL6A 4TRNA 2F3UA 3JPQA 1PSWA 3HPOA 4OHMA 3ZW7A 1B74A 4NEQA 1EB8A 2CVPA 2EWMA 4FQ8A 2CF6A 2KHZA 2P9JA 4XYGA 2GVDC 4JIMA 4PBRA 5T6MA 3BHNA 1RI3A 4LZAA 5AXDA 4K46A 4TS1A 1D5WA 4U5XA 1T5DX 1SHKA 1CERA 5FD8A 2O1WA 1JHRA 2F8SA 4TXNA 3BT7A 8ICPA 3ITDA 4TL7A 3HYSA 2ZJ1A 3DC2A 3ECCA 1KMIY 1JDTA 1F3LA 1Q46A 1H2XA 1VRCA 3UBTA 4FDVA 1SIWA 1KXZA 4HXGA 1V48A 1CDOA 2PVCA 3I6BA 4O63O 3OAAA 4C6TB 1JH8A 2Y9UA 3HU3A 1ELOA 3A05A 1BEEA 1Q7BA 3GW8A 5M29A 3D8BA 4BBAA 1KZ7B 1Q0SA 3KDAA 1VLBA 2XQJA 3LBAA 1T4CA 3H9UA 5BOLA 4IUYA 3P0HA 1B6GA 1GAJA 3LL7A 1JLKA 1MO3A 4N6GA 3L4BA 2NU7A 4URYR 1TAUA 2VZ0A 1MSWD 3L8CA 2I4IA 1SXJE 1ISFA 4LHYA 3EXEB 2WU4A 5SZIA 5AM2A 2RDJA 2H3HA 1O89A 5ED0A 3DD5A 3WZ2A 2D3TA 1TZJA 1P7YA 2VJPA 3R0ZA 3BREA 5IJ0A 4M9SA 1QF7A 4H6PA 4Z1MA 3RJFA 4EY4A 6NULA 4TYNA 3SHVA 2VHZA 4H0CA 1CJUC 1S7GA 5BWNA 4JJGA 1T2VA 1RC1A 3P8ZA 3NT5A 2PL1A 3A1TA 1YDMA 4Z8XA 3QEBZ 3JQGB 3A1EA 1XKQA 1DKNA 1U2EA 3C8HA 3RTAA 4JR2A 2XJ4A 2FX5A 1XCJA 2V7QD 3BS4A 3TZCA 1WUIS 5CM9C 3PC8A 1CRPA 3RRXA 5JI3E 5FL7A 3WMGA 4PZLA 4IJKA 4TYMA 4UBCA 5K0JA 4F5RA 3DP7A 3L0SA 1DINA 4UREA 3OEHA 3CN7A 1F7VA 3A7EA 3L01A 2H07A 2HSZA 8ICOA 4NFSA 5FNVA 3I58A 5DLQC 2HAEA 3FWKA 2HPHA 2XE4A 1R15A 1EFTA 2C97A 4EI8A 3CKYA 5KX5B 4OSEA 2BFBB 4KMOA 5BQXA 1SBYA 1S3IA 5AVJA 2E8OA 3HBFA 3C3WA 2MYPA 1TYZA 4BTVA 4YA6A 2WKWA 2Q0QA 3F5AA 2WAAA 2P40A 2DYKA 4PFQA 4I28A 1KI1A 2ZBGA 3A3YA 3TUIC 5CJ2A 3A6PC 5ADUS 5DNDA 3E9EA 2KVSA 1VLJA 1TUBB 5LZ7A 4BNIA 1Y3FE 2V9WA 3CMCO 4UCWA 3M6ZA 4FSDA 1FBTA 3TF5A 3DE4X 1WXDA 2YHSA 5K3FB 4IO0A 3ETCA 1IN5A 3SV4A 1VKJA 3G2QA 1SV0C 3W90A 1TX4B 2GERA 3IMKA 3KZCA 3R4CA 4G8BA 3MG9A 3H5IA 2IHJA 4JVMA 2BR5A 1GR1A 3LW8A 1IBLB 3C6MA 1VM6A 2XDQB 3D6NB 1IHUA 4W5QA 4QEKA 2Y1WA 4JUFA 1ZMRA 5JALA 1GV0A 3KE8A 1QU3A 4A2CA 5TXGA 5J9FA 1ZGAA 1WWKA 3DO6A 3HKEA 4I2AA 4P4GA 3ICQB 3V1UA 1RQXA 2W03A 3HU2A 2PXCA 5FIUA 4X1YB 2GXUA 3EDCA 3K30A 5TARA 1IE3A 4J90A 4F2HA 3MM4A 4PHTA 1PS9A 3NUZA 1T5LA 4DJAA 9ICAA 3GDXA 3HVHA 4DC0A 5KSYA 2NZYA 4JS0A 5IM4A 5F7OA 3V4ZA 1UBTS 1ZX1A 1QNLA 4DA8A 4J9OA 4BECA 2C95A 1T7PA 2ZSUA 1EWKA 4L76A 1Z63A 3ETDA 2IOQA 5D6NA 4EFLA 4EHDA 5IW8A 1LY1A 1PNVA 3L04A 4GPAA 1IC6A 3QF4B 4II3A 1QR2A 2PBFA 2A5YB 2YDYA 5F7JA 3HCAA 2IUUA 3QYAA 4XX0A 5JEEA 2OAEA 5CCBA 2J48A 3DLPX 1F0NA 4QWMA 4TX1A 5TJHA 4I1PA 4OHOA 4F6CA 3ZHYA 5FDFA 4TTRA 3ABZA 3DL0A 2RJOA 4C6SA 3KQWA 2JFYA 1NX9A 2F8TA 1KQNA 3FNQA 4MHSA 3A1WA 4EEYA 4AZ0A 1KFBB 4OKSA 3RV4A 5FHQA 4FGZA 4ZT3A 4UHDA 2HDWA 5AJWA 4KBGA 4NJMA 2I7XA 3B60A 1MJFA 3SHWA 5A7HA 5TQ0A 3U13A 3I9KA 1T3GA 2R6FA 4MULA 3SKYA 2ESRA 2C2OA 5A6SA 5IK2D 1FYXA 1L5ZA 3EXHB 1F4PA 3FDIA 3MHTA 5GQSA 1K1QA 4X00A 1M5TA 3L8ZA 5IP5A 1J5XA 4JP8A 1KKMA 4RY0A 2A9RA 5AK0A 2B4KA 4W82A 2HMAA 5BWCA 3K71B 1M8FA 2HOIA 1OA1A 1D0SA 3LHIA 1V8DA 2VDMB 4GW3A 9ICWA 3VO9A 3MWGA 3PDJA 4Q4AA 4F4HA 4HSGA 1RJ9A 4ELVA 1JUDA 1TAMA 4BLWA 3W3AA 1X9XA 1I7DA 4MVJP 1P2GA 1P74A 3RHTA 1M10A 4A73A 2H7YA 1MEEA 4HD8A 4QLBA 1PV1A 5I9IA 3A4VA 3VZRA 3QUTA 4RORA 4PL1A 3FDFA 5FWNA 4MDFA 1Y5LA 5BWLA 4D43A 1XZ8A 1DNPA 5DM2A 1Q1NA 3DZHA 1KNQA 5AESA 4PN3A 5TT1A 4MV0A 4B40A 5IVDA 1S9HA 2YFKA 1L9KA 4YAWA 1NC1A 2JGJA 4OXKA 1Q19A 2RGYA 1G3IA 2OWOA 5KTSA 3AONB 1FUYB 2ZUUA 4PZ9A 4PWZA 3KYCB 3I23A 3EW7A 3BD8A 2H9YA 2JH8A 1YS6A 1KJZA 4RV5A 4YUZA 5KHAA 4MKIA 3RBAA 4KR6A 5T8KC 9ICBA 5U1PA 1M6HA 3USCS 1EP1B 4P2GA 1Z9BA 1OH7A 3BE4A 3N2NA 1B8VA 1AU9A 2FPSA 4HFNA 1ORVA 5JCXA 5HK9A 2XECA 4ECAA 4ZJYA 4C01A 4Z7NB 4W5OA 4G25A 3GVHA 2MRLA 3GXBA 4FYIA 3D8SA 1C0PA 1NR7A 3ECAA 2O2XA 2FDXA 4AJ2A 2H2HA 1CQPA 4IFBA 4B4VA 1HNWB 2AOXA 2YVUA 3WLLA 4LHSA 4FN5A 4TKZA 4L57A 4HJRA 2A78A 3RCBA 4C30A 4QDOA 3C4QA 2KIVA 5A0VA 4LZPA 4IHQA 3X44A 3IYLW 1SGWA 4Q4LA 3O8CA 2WTXA 2IPLA 3QPVA 2H8GA 3W4JA 3ZE1B 3D1VA 3AG5A 4TKUB 1FJHA 2AW3A 4R31A 4QZFA 1R5JA 1QFSA 4KSBA 1SCNE 2VK8A 3KEGA 4F4FA 1XSNA 1KP2A 3WNQA 2IF2A 3RJTA 3BEDA 2WOJA 4LOJA 5ED4A 4EHBA 1R6BX 5IN4A 1GG2A 1RLTA 4DGSA 5HGJA 2KKVA 1VCIA 1QANA 5LXTF 3JD1A 2QZ4A 3K94A 2O8EB 3SYTA 4QOIA 4YCBA 2R47A 2XTAA 4G3XA 2F76X 1B26A 4W1QA 3L0YA 1FNCA 4RABA 3L0CA 4QYXA 2LKYA 1T2CA 1YRAA 4ONEA 1NJFA 4RJKA 2CFRA 3HKZC 1W5TA 4QUGA 5HR7A 1LBHA 3PGKA 4NOMA 2GK3A 3K8ZA 1OX4B 3LUBA 3U1BA 4OGWA 3PX6A 3QRWA 2RB5A 4UUBA 1J7JA 1ZRHA 1X1RA 4DY4A 5JXGA 4IXDA 1ZQTA 2IGBA 2RDIA 2QV0A 2NV3A 1E58A 1YB4A 1JGTA 2CXSA 3F96A 4F3YA 2GHQA 4V0RA 3VPXA 2GRAA 5HQ3A 3FVRA 4B6JA 4C7KA 3DV0B 2XEXA 4I27A 4DQQA 2HHSA 4QQKA 4I9UA 4YXFA 5JJKA 3D7LA 1XTPA 1U90A 1QYWA 1BSVA 3HWX1 3ZH2A 3UAYA 1PFQA 3I3SR 4L8LA 1E2EA 2P1RA 4YAJA 1MOSA 2Y1JA 3OPMA 1AGNA 5LQMA 1TAHA 4MQBA 5EA2A 4EA6A 4F4XA 2QYTA 3FCEA 2VCEA 4E31A 1V2GA 3PNQA 3RLIA 5HZKA 2JEZA 3U4GA 3PEFA 2CWWA 3LBHA 5H3LA 2BCGY 3DE0X 1K98A 1J6UA 5KYNA 4MFFA 3P2IA 3LYHA 4Q3CA 2PVPA 2BZSA 1CX9B 3N6XA 5JHHB 3AR3A 1FYDA 3ZDAA 5K4LA 5G0UA 1XHEA 3E84A 3PIRA 4LHZA 1FYWA 1TF5A 2NXCA 3V6KA 5ARCA 4D46A 1SQFA 2J7PA 1RRGA 3C45A 3ILSA 1HNZB 4K8RB 4IR7A 4I0WB 4B76A 4A0SA 2XQGA 5DG7A 2AK2A 4LDJA 2RGRA 5CTJA 2H31A 2AJDA 2VUTA 2EC5A 5IVIA 2J5RA 2ZXIA 3P2JA 3PE4A 3GBVA 3O74A 4YRFA 1QWSA 4GE0A 4CODB 1H6DA 2CLSA 1QVWA 1FUUA 4JH0A 1QYDA 4JGBA 3M9LA 4DLNA 4WERA 4BP3A 1CY2A 1CQIB 4JUCA 1YZTA 1SUCA 4XWTA 1KOJA 3RSZA 1ZC4A 4MA5A 2R86A 2OXTA 3RRYA 3SBEA 2QTVB 5HDBB 4OYRA 4MVJH 3FHLA 5TEWA 5KEIA 4TMKA 2WP8J 5BOMA 4I55B 4H08A 4WLOA 5U4XA 1QB8A 3H11B 3FTFA 2JEYA 5CNJA 1FMTA 2V5UA 9ICKA 1F2UB 4LJSA 4C6TA 4YRZA 4H15A 4I8DA 4JJZA 2IX9A 1VXOA 1HDXA 3HABA 3R7NA 1GGMA 3ASYA 9ICSA 3QMPA 4HGRA 1D2EA 2LE0A 4HNRA 4YJ2F 3IA2A 1GD1O 3LXRA 1UZNA 2XMDA 1OPXA 1X80B 1GLGA 4EEZA 1PJSA 3VPSA 10MHA 3SR6A 4EKYA 2XMPA 3UCFA 1H8EA 1MOZA 2UYOA 4ZYUA 5KSOA 3K5PA 3EXEA 4QGGA 1FP6A 2VJCA 3L4SO 2XBMA 3KQQA 1N8NA 4D92A 3A6LA 4S24A 2DR0A 3L9WA 2FPKA 4YAUA 3UHOA 1HA3A 1VJDA 3FYSA 3ABRB 3PR4A 1X14A 2OPHA 4YMSA 2TRSB 4UTRA 1XTTA 3P2YA 4MWCA 1N5OX 2CE2X 2Y99A 5KQPA 4BS9A 3A9WA 1ISGA 2QI9F 4UU1A 4XQEA 3OKAA 3VH4A 1LS6A 2IY7A 3JQGA 3GEMA 2Y1CA 2GR9A 4HDAA 3TRFA 1WS6A 1IV8A 1E2QA 3DHWC 4Y67A 1ACJA 1T9ZA 2JFGA 4DPKA 4ZHQA 4P2BA 1OI4A 1ZGHA 3HWTA 4OXRA 4GMFA 3DYIA 1G66A 3RU7A 4NZPA 1L7BA 2JI4A 3A9UA 1MJ5A 1G17A 3WYAA 3JQ9A 1HTTA 1I6LA 2AG6A 4Q7LA 3S6JA 1F44A 1W2WB 3GUCA 5A3JA 3ZGVA 4YRPA 1ZEMA 4KQ2A 5KX5A 3X1KA 2BFBA 4BJ1A 1G8FA 1NZJA 1L2TA 4YYZA 5DGAA 1VYHA 2Q5JA 1JR2A 2MYTA 2WUDA 2Q0XA 1IU9A 2FE1A 2ID8A 2AOWA 4MQFB 4UJ3A 2RGCA 3PWKA 1QSGA 2PHZA 1P7ZA 4YBZA 5AIBA 1E9EA 4EUEA 1OI3A 3FVWA 1ZSNA 8ICMA 3QTLA 1X9HA 4Q37A 3PG5A 1S3SA 1TUBA 2PLWA 3GPCA 4UOEA 4ES6A 4B2IA 3RJHA 1PIWA 1WSDA 4PX3A 1E5DA 2I87A 4EZ6A 4L6CA 5K3FA 4NAUA 2VH5R 3O73A 4U6PA 4O1HA 5BNIA 1PQ4A 2H9AA 3V1MA 5EKTA 3ZE8A 1MIOB 3MGCA 1TCBA 4WLNA 4L7VA 2DBQA 3EY9A 2UZ3A 1EXNA 2ZANA 3KKNA 3GAFA 2F67A 4Z6CA 1IWOA 1NLYA 1N5LA 2IUTA 4PGYA 3USZA 4QBFA 2XXJA 1Z4OA 3GCZA 2XDQA 3W2IA 1NBMD 4I9GA 3UJ7A 2JFNA 3DTNA 4HYQA 3KQOA 1HKHA 5DTJA 3GFTA 4U2FA 1JDBC 1VIMA 4C2TA 2F1OA 1GUAA 3QUQA 2FQYA 3EZFA 2PKQP 2O2YA 4EBCA 2POCA 5FBVB 4JV5B 4X1YA 1TOAA 1MMFB 3GWGA 1PG2A 3RJEA 1RHKA 1ZI6A 2D0IA 2YS7A 2Z5GA 2ACEA 1I5EA 3PSFA 2I54A 3RANA 3WOVA 2BKXA 3QUBA 4GR9A 5KAPA 5F3WB 3HFRA 1BE0A 3OICA 3R5KA 1QO9A 2JCYA 1PYOA 3QF4A 1EGHA 3QLEA 3UGQA 1MENA 2J7KA 3AWDA 3DLAA 2G1JA 5KDLA 4MEAA 3PNYA 4HQRA 2L42A 1ADYA 1G4AE 2R65A 3P0FA 1S96A 5JASA 5JQGB 3QE4A 1LV5A 1NAHA 1F06A 4LF6B 3IPRA 2HCRA 2C98A 4Z4FA 5JNRA 1ULTA 1QKJA 4RSHA 2HHTA 1BKDR 2IQ5A 5HFJA 4P5DA 2QUKA 3R7WB 1QHYA 2IFTA 3IEIA 5K7SA 2W2XA 5CURA 3DO8A 2PFQA 1OXSC 5EZQA 2W6JD 2H4YA 1VHLA 4Y1GA 3P97A 1RZRA 1LA2A 3SSNA 3BXGA 5HKLA 2KW5A 2HNAA 4ZIRB 4H2DA 2CNLA 4W6ZA 4GOMD 3I9OA 4RDHA 3EXHA 4Q3EA 2WQ6A 1V39A 4ENRA 2X0IA 1F2TB 5AXBA 4DV0B 4A3SA 2JEGA 1TZCA 1JNXX 4AWXA 1SIJA 3LVFO 4H17A 2D5IA 1T0BA 1DC6A 4CCYB 4QLOA 3SENA 1TQDA 2DJIA 4JT8A 4BDTA 3V6HA 1QIDA 3CP8A 5G1OA 4IYJA 4JEMA 4W1RA 5BVGB 4NLZA 4ZOLB 4Q43A 3HS3A 5KG6A 3O4HA 1E96A 5HF9A 4CG1A 4BFYA 1PHRA 4Q15A 1YUMA 1NFFA 1TK9A 2Z3ZA 4RJ2A 2PUFA 3VKUA 2ZBUA 3W7VA 3OHBA 4KOEC 2EARA 1PL0A 1MO2A 3DEIA 3KB6A 5THXA 1JN3A 2UVDA 1LVGA 4DQUA 4PHCA 2O6LA 1EJ2A 5ALUA 3V55A 2V7WA 4MYHA 3KYCA 1X1CA 4LA4A 1QZZA 1VDZA 3CFYA 4O59O 4GX0A 4BIMA 3G6KA 2IK8A 3H19A 3BK1A 3E4CA 4F12A 4ECUA 2G5TA 5HOQA 4RZ2A 3RJZA 1CEXA 1JKIA 4YFKA 4JV2A 4B82A 1FLVA 1JPUA 3T7CA 2IY9A 1I4OA 2OKGA 1UQUA 1WZUA 3NKLA 1NXSA 5JH7F 4H4CA 1EUYA 1DWQA 4MV6A 2FPXA 3KWJA 1WMSA 3VI3B 2GEBA 3B7WA 2BFWA 3DDSA 2A57A 3C85A 3IQDB 4JBHA 3VYUB 3IUEA 1CQJB 3DBVO 3M6FA 1ZQIA 3B6IA 1WHTB 3D3WB 2P4SA 1E6EA 2OCAA 1ZRSA 2KWIA 4JYMA 2ORED 4FE4A 3E27A 2PLRA 2FHPA 3MELA 1LFAA 3OECA 4HAVA 2H16A 5IJZA 4KMMA 1OREA 2A8YA 4BEBA 3EEOA 4TKUA 1HC7A 2RHJA 1TT5B 1K63A 4RPGA 4YLYA 2GA8A 1M1YB 4MOWA 1NSTA 2K4PA 3NTUA 1GZDA 2OR3A 3RLFA 2VP2A 5KTKA 2Q3LA 2IBSA 1BN7A 2B8TA 3LCUA 5EJ4A 1D2GA 2LMRA 5ENZA 4IIDA 3TMKA 1L3SA 1E79D 3OO1A 2IPAB 1HDRA 2HWXA 2O8EA 3FAZA 5KS2A 1G3UA 1XEFA 1F7UA 1TKAA 4LW8A 4HWRA 3ZNPA 1JHPA 4KYIB 2GO1A 1T2FA 1XMXA 3HLKA 4KNVA 1VHWA 1GG8A 1DJQA 5GGYA 1HZZC 2DT5A 4RZSA 3SHOA 1OX4A 2NPFA 5LBIA 3RUCA 5ALKA 3QXGA 1XRLA 3W6UA 3DFUA 4K4HA 4CUZA 1LTQA 3R7AA 3KLPX 1EE1A 2VDNB 2KYRA 5E2BA 1CR1A 1E5TA 2EP8A 2KX7A 1ZXBA 3KCNA 1R16A 3NHJA 4FVTA 4DV5B 1RI1A 4INZA 3WZMA 4EJSB 1XELA 3DV0A 4ALLA 4KN9S 4Z51A 1YVDA 3T3FA 1S1CA 3HEAA 3E48A 3R20A 2POQX 3PCXA 4O0IA 3A3OA 3HDQA 2E5LB 3I62A 2OUKA 1VHDA 2WYIA 5DJ5A 1XNGA 1K1SA 4IIVA 1X7DA 4O4IF 2HQRA 4YCSA 1J2MA 4ZODA 4J7AA 2CVOA 1NG9A 3NIGB 1ZQRA 2A1IA 2VL7A 1JVSA 2QPLA 5FV4A 1YHNA 2F3SA 3RC7A 1FDOA 1A88A 1ZN7A 3TZHA 3K1JA 1J0XO 3PO5A 2PZEA 4JT4A 3BSSA 3QJ5A 4CF4A 4ZFNA 2F3RA 1ISRA 3KOOA 5E7QA 1ZP6A 2IHYA 4WFJA 5FUYA 4MKXA 2CBXA 2PT7A 1VL8A 1YE3A 2JATA 4DPMA 1DLJA 4OQMA 4KYUA 1ICIA 5F7XA 4OBBA 1X9WA 1VLLA 4EYIB 4WOJA 4KQXA 5I4BA 1B23P 4M9LA 4DLUA 2EKBA 4QJIA 4Q9JA 4M9RA 2YL2A 4F3CA 3TOZA 1DAEA 2H9IA 4TMXA 3KQMA 2YJZA 1VSBA 3C43A 5A4IS 3QLTA 3T0IA 4URHA 1AJEA 3Q3GE 2BR4A 3EPJA 1IJKA 1V7ZA 1S0UA 2IW3A 2ZWVA 1XDSA 3HL4A 1DCTA 4ID9A 2XY7A 3TO5A 4JYAB 1UBRS 2YZ7A 1S0MA 4C4OA 2FAXA 1CQIA 1TVCA 4QZVA 4DUGD 3L7JA 1DHRA 4NCXA 4JX9A 4P36A 4PPXA 1FTWA 1OLUB 4EFDA 2QTVA 1XVUA 3WB2A 5BOSB 3TRKA 3QU9A 1TGYA 3K35A 2JAWA 2CZCA 3S1LA 4I55A 2ZWMA 5C1IA 3H1PA 4P4OA 4J0IA 1SKMA 1ZUD1 1JJBA 3H11A 1V16B 5K4HA 4AQYB 3RB4A 1F2UA 2B3TA 1KEJA 4EO9A 4DL4A 2A0KA 3QYJA 3A58B 3KT8A 4Y2QA 3H2HA 4YMHA 4CQNA 2QMYA 4RQBA 3TQCA 2Z5FA 5C7IO 4JB8A 4RQ8A 5GJWC 4Y18A 2CXXA 4CT5A 5EESA 1J97A 3ZVMA 3I42A 2P67A 3AV3A 5ENDA 2JLRA 1ECCA 2ZKIA 3G8CA 3C16C 3MTBA 2XNJA 3U31A 1XZJA 4EYKA 1OX5A 4N5NA 2IU4A 3HFJA 3UXOA 2X0NA 4WBXC 3PXGA 1E9FA 2YFYA 1TVMA 2QP4A 1BA2A 4JXXA 3D59A 5BORA 4HT3B 1CVIA 2UUAB 1ECBA 1QVZA 4F7DA 1VKZA 1CRZA 2QG4A 1DMRA 2C04A 3D43A 5G0VA 4WMLA 4S1WA 3MMSA 4WSOA 1F4LA 2G08A 3COZA 5J2HA 1J1UA 2BFEB 1SB9A 1NUQA 3FWNA 3AKZA 1U8UA 4HXEB 5ILGA 3QV1A 1MQ8B 3G5UA 5CNMA 1NY5A 1VMKA 1T15A 1XQYA 5ECYA 4F4YA 3R1IA 4WCFC 2QVBA 1U7OA 1M34E 2PS9A 3IEXA 1QSSA 4I2EA 1Q3VA 1CJMA 1GGNA 3BGWA 1OZHA 4H1WA 1BXZA 2XGJA 4MO2A 2AG1A 3U7GA