1O08A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 1-phosphate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-phosphoglucomutase
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o08A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o08A01
5FP0A 5T41A 1VFPA 2B1QA 4Y2UA 3WKAA 5ALEA 3WKBA 3I6BA 2FDRA 3W5CA 1RLOA 3ESQA 4UMEA 3IJ5A 1ZJJA 2CFRA 5AVUA 4BEVA 3UMGA 4EZEA 4XE5A 3DNPA 1QH9A 4KNWA 2MSNA 3SD7A 4BKMA 2NYVA 1L6RA 3L1VA 2YBDA 4Y2QA 3BWVA 4HYTA 2QYHA 3ET5A 3PGLA 3SHQA 1YDFA 4UM7A 3E8MA 4CNQA 1T5TA 1YNSA 3ZW7A 3OCZA 3SKYA 2R8ZA 3FM9A 3N1UA 4KNVA 4IFTA 3QU9A 2HO4A 3L1UA 4HAIA 2IOFK 4FE3A 3RFUA 3W5DA 4DFDA 1N9KA 1KYTA 4Y2XA 2C8LA 3WK4A 1VJRA 1O03A 2YN4A 3KD3A 3UMBA 1ZD5A 5AVZA 4KN8A 5ALUA 2WF6A 3IRUA 2R8YA 2WF8A 4OCZA 2RBKA 1Z4LA 3VAYA 4G9BA 2EARA 4BNDB 2B30A 4XPZA 2YJ4A 4YIHA 5ALRA 2FUCA 2PKEA 4I9GA 5AKGA 3A1DA 5ALIA 3L8EA 3ZTWA 5ALJA 1NF2A 4MWOA 2FPUA 3R4CA 3ZWKA 4CF5A 4J03A 1Z4IA 1Z88A 2BDEA 4EENA 3EPRA 3AR2A 4FYPA 2GMWA 3NASA 2YJ5A 4AP9A 1ZRNA 4UATA 1ZD3A 3WKEA 1CQZA 3OTQA 5ALZA 4UAVA 1PW5A 2O9JA 2FPXA 2I54A 4DCCA 2Q4RA 3NANA 3ONNA 4AS3A 4NWIA 2G1AA 2OA0A 2OM6A 2ODAA 2RARA 1L8OA 1Y8AA 3AR9A 4OFZA 4DW8A 3FPBA 3MC1A 5AM3A 4YCNA 3QUTA 2HEGA 3ZX5A 3R9KA 3K1ZA 2FUEA 3L8HA 2PR7A 4UM5A 2B82A 3GYGA 3QX7A 1RMTA 1ZD2P 1T9ZA 2ZOSA 3MN1A 2ZG6A 2YFYA 3QUBA 3FVVA 5AVRA 3S6JA 2ZXEA 5AW3A 5AW0A 1Z4QA 1RKQA 4IG4A 3CNHA 1ZRMA 5AW5A 3DAOA 2HDOA 4QJBA 5A3QA 4KX3A 3M1YA 4UMFA 3QU5A 5AKLA 1YV9A 3EF1A 1RC8A 2P11A 3QXGA 2R8EA 4B6JA 1Z4JA 2OBBA 5ALWA 2G09A 3WK7A 3RF6A 5AVSA 1VJ5A 4O8CA 1TJ5A 4Y2PA 1ZS9A 2HF7A 5ALKA 2G06A 1O08A 3OCUA 1Q91A 3PDWA 4YIKA 5AVXA 4BBJA 3FGOA 3NUQA 3A3YA 3WKDA 2WF7A 5ALVA 3W5AA 4H1WA 4CE6A 3U19A 1F5SA 1QQ6A 3I76A 3J7TA 2RB5A 1WVIA 4JDPA 1U2SA 5AKJA 2O2XA 3E81A 2YMQA 3N8GA 2EATA 3U7HB 3QUQA 1CR6A 5AW1A 2C88A 1ZD4A 1Z4OA 5AIAA 5AESA 4HGQA 3SMVA 2FI1A 4F71A 3W5BA 4UAUA 2RAVA 2DQSA 1XP5A 4UW9A 4BX3A 3EF0A 2G80A 3AR5A 1YJ5A 4HGPA 1U2TA 1NNLA 2PQ0A 1L7OA 1Q92A 5AKZA 4L6AA 1S8OA 2G08A 3L7YA 4UU1A 2YJ3A 1XPJA 5AIBA 5ALTA 1MH9A 1L7PA 4GIBA 2R8XA 2IOHA 3FZQA 5ALDA 2G0AA 3N28A 5ALYA 3WGVA 4OD0A 3U13A 4CF3A 3ZVNA 2HCFA 1RMQA 4HGOA 1LVHA 3QGMA 3NIWA 1YS9A 3ZUPA 2GFHA 4BX0A 2AH5A 3ESRA 5E0OA 2GHTA 2W11A 3E58A 2D2VA 4ZEVA 2W43A 5ALSA 3MPOA 3ZI4A 3ZVMA 3AR7A 3L0BA 1L8LA 3QUCA 1TJ3A 5AHXA 3WK5A 5AM1A 2HX1A 5AI6A 3WGUA 2JGAA 2P27A 5AVVA 2B8EA 3I28A 2NO4A 3BA6A 3L0YA 4FFDA 2YMMA 3WK8A 5A3SA 3SLRA 2P69A 1N8NA 1WZCA 1XVIA 2MU1A 5AKEA 4YH1A 5AK5A 2P9JA 3NALA 4UMVA 2NO5A 3ZVLA 4OHFA 5ALXA 4Y2TA 5AKYA 2IA5A 1J97A 2EAUA 2FPRA 3QYPA 3L5KA 3U7GA 5AKXA 2I7DA 3NRJA 4EEKA 3ZX4A 1RKVA 1Z5GA 2I33A 4KYTA 2WHEA 3DDHA 5AW4A 1RLMA 5IT0A 1RQLA 5AVYA 2QLTA 2BY4A 5A3RA 2I34A 4Y2VA 3WKCA 5AICA 5AKHA 1QYIA 5AM4A 3AR8A 3B8EA 4MUMA 4YCLA 5AW6A 4EELA 3HLTA 4UARA 3R09A 2FEAA 5AVWA 2AGVA 1RRCA 4RETA 3U7EB 2AUTA 1FEZA 4ZEXA 3QLEA 1L7MA 3B9BA 3QNMA 1QQ5A 3UM9A 2JAWA 2BDUA 3QU7A 1RQNA 1U7PA 4Y2SA 4C4TA 2W4MA 3AR6A 4YGYA 4GXTA 2IYEA 4RESA 3DV9A 5AW8A 5AKKA 4G63A 3OPXA 4I9FA 4UU0A 4NFLA 4Y2YA 2WF5A 2IOFA 4QQFA 1Z4MA 4NV0A 4NABA 5JJBA 3M9LA 5IS2A 1RDFA 1SWVA 5ALFA 5AVQA 2HI0A 1TJ4A 1Z4KA 2X4DA 1EK2A 5AK3A 3OCYA 5AM5A 3N5KA 3SKXA 5AW9A 3KBBA 1SU4A 4L6CA 5ALGA 1RPZA 1SWWA 1JUDA 5IT4A 4JB3A 3L8FA 4BYGA 3PGVA 3A1EA 2JAUA 5ALLA 2I55A 2VKQA 1ZOLA 4Y2RA 2CFTA 2ZBDA 4E88A 1TA0A 3KDPA 3CZ4A 5AM2A 2B8JA 1TE2A 4ZEWA 2FPSA 5ALMA 4XOUA 2YMLA 4UMDA 2JAOA 3ZTYA 3PCTA 3IB6A 3L8GA 3NAMA 2CN1A 3EWIA 4NAVA 5ALOA 1Z5UA 4BEWA 2B1RA 3TLMA 1RLTA 3U26A 4DWOA 5AW2A 4UASA 2ZBGA 2MU2A 4AS2A 1YMQA 3OCWA 3ED5A 2HHLA 5ALPA 5ALQA 3ZU6A 1RMYA 3P96A 5AW7A 1L7NA 2GHQA 2ZBFA 1U02A 3L0CA 5AI9A 3UMCA 3A1CA 2WFAA 4F72A 4L57A 2C4NA 5ALHA 1S2OA 5AK4A 4PNHA 3QU2A 4CF4A 2Q4TA 3QU4A 2FPWA 4XQ0A 3ZWDA 2I6XA 1Z4NA 1J8DA 2HOQA 1LTQA 3B9RA 3FPSA 4KX5A 1NRWA 5ALNA 3MMZA 4C4SA 3AR3A 1U7OA 4J2TA 2YMPA 1QQ7A 5AI4A 1EK1A 2OYCA 2C8KA 3OCVA 5AI0A 3D6JA 1Z4PX 4EX7A 1X42A 2Q5EA 4Y2JA 4BNDA 1T5SA 5AM0A 1AQ6A 2CFSA 2YJ6A 3N07A 1WPGA 2WM8A 2WF9A 3KZXA 3ET4A 2YY6A 3I1YA 3KC2A 2AMYA 4Y3UA 3U7FB 5AVTA 3HYCA 2ZBEA 3F9RA 2HSZA 1RKUA 1K1EA 2HF2A 2G07A 4HGRA 5AI5A 2C9MA 4HGNA 3E84A 1WR8A 5AKIA 4YCMA 5AI8A 3WK9A 3OCXA 2JARA 3KOOA 4C4RA 3WK6A 3SF0A 3AR4A 1IWOA 4EX6A 2GO7A 5AK6A 4BX2A 2B0CA
chains in the Genus database with same CATH superfamily
4N0QA 2XKAA 3A9UA 3AUTA 2FMSA 3GEHA 5ENDA 2CFRA 1SB3C 3ESZA 2OCKA 2B0JA 4UTOA 5A9TA 3KQUA 2UVUA 3RHZA 5HKLA 5T14A 1Y4SA 4CETA 1H8EA 5CNIA 3P5SA 2ZJ0A 2JEFA 3IVAA 4BNKA 2YX8A 1OXTA 1PGOA 1IB6A 4DWIA 2I2XB 1H0SA 4MQBA 4TKVA 4FBUA 3EXIA 3VV2A 5ALRA 1Q1NA 4UBLA 3LX8A 3LUKA 1RR6A 2XICA 4EJSB 1O3YA 2R4TA 4PC3A 5FBRB 4A8HA 1S2MA 4CUKA 1EFRD 2LI6A 2A92A 3L01A 2XTAA 2QPTA 3JVDA 1P4RA 3KT8A 3SJZA 1LZLA 1KAHA 2VDVE 1SQ5A 1NKCA 4JL5A 1U45A 1NW6A 3LUJA 5MN5A 2VA9A 4H35A 3LC1O 3SS7X 4JJ6A 4R2MA 3C29A 2JIPA 4R6XA 4Q3CA 5HVNA 1TZ2A 4ZP1A 3HM9A 3AWDA 5CDGA 4LC0A 3NGMA 4JQOA 5KQLA 3SICE 4QTXA 4EZ6A 3DCIA 1JG7A 4LXXA 5EE5B 4AURA 4ZVOA 1NP3A 1A76A 2O2GA 3QBVA 7ICIA 1S8AA 1AZTA 5D1HA 3LIPA 1LS1A 3K6KA 5JAUA 3AFMA 3PKJA 4H7PA 3L7MA 1AT1A 2COUA 4INJA 4O4IB 2HJVA 3V46A 3K8QA 3H2KA 5BURA 2ZUBA 2NPIA 5IKMA 4G3IA 4EPRA 2LPEA 2PQ0A 3L0SA 1SKQA 5CTJA 2PCJA 2F44A 3PPWA 2ZUEA 3EJWA 5JAZA 3DKPA 1HJPA 1NIJA 1Y3IA 5SYMA 1L5OA 2BIFA 1J21A 4JR2A 4HAXA 3K1AA 4EHFA 1RIFA 3P71T 2D2FA 4XWOA 1E4VA 5CR9A 4MO2A 5J8YA 4HB3A 5AM1A 2FR1A 3AVYA 3DNFA 3PC8C 2M1XA 1PJAA 3ZHTA 2QUKA 1XELA 2FSVA 1SELA 1DCTA 1DBSA 1KI4A 4QM6A 3QFTA 3U7QB 4BO9A 5DLDA 1FYXA 5HUJA 1B0ZA 3NRJA 4X8LA 1Z5GA 1NY5A 5EFOA 1KZYC 4ZGGA 2R96A 2ODEA 4I8IA 5IDWA 3YASA 5TGZA 1A04A 3RARA 1TAQA 3SAHA 1Q14A 3P0RA 4Q43A 1LXCA 4LDJA 2XH8A 3PLNA 5JPIA 3DFFA 4JHLA 1ZOPA 5E4TA 2IYEA 4YRQA 5E4JA 2BP7A 2HBMA 3FMFA 1P72A 2CDNA 3EGDA 1IBLB 5J4KA 1N1GA 5AW9A 4E07A 2WHXA 1M1NA 1XLTC 4TMKA 4EMTA 1J2MA 2VKQA 5LYJF 5G0TA 4LSZA 4TGLA 3D3JA 3GFGA 3VR6D 3FKQA 5REQB 5IUKC 4Q1AA 3U3DA 3GQBB 4ZCMA 3FHTA 1O94A 1FDIA 2ZT8A 3UMMA 1J0EA 4C7XA 3PEUA 6AT1A 3DDNA 1TGYA 1A0PA 3GZNA 5F98A 2LDBA 4J7AA 4PU0A 1SV4A 1EWVA 1MGPA 2FH5B 1ZQGA 1RPNA 4D45A 1H2FA 4TXHA 2JBAA 4G8JA 3MR6A 1IUPA 3C7DB 2ZAMA 4ZT5A 4AP6A 3U7FB 4RK6A 1V47A 1GEEA 3UV7A 5J0OA 1G3UA 1VSVA 1YCGA 1FDWA 1UK9A 1WUTA 2GPTA 4IDEA 1XXHA 1SQGA 5CU7A 4F4DA 4N0PA 1N5LA 3TK1A 2OT3B 3PBKA 4KB5A 5I7SA 1YWGO 2XOEA 5IFKA 1NU6A 2QL9A 1T7PA 2VLBA 3TFRA 3F2IA 1SQFA 1BW9B 2WJAA 5BNWA 4ARBA 4PYMA 4YONB 3TFQA 5D00A 4HF7A 1ZGGA 1T1GA 4LZAA 3V1LA 2K4PA 3V4OA 1I4DD 3L7CA 3TL3A 3PF9A 2O06A 2O3SA 2PV0A 4QZVA 3L4SO 4FNMA 1KYTA 2A84A 4RGBA 1N92A 3KZOA 5F7JA 1M6NA 2IBKA 4O3RA 3U48A 2IS6A 5KJFA 4M1YA 1BA2A 2EARA 2OD9A 3QF7A 3OM9A 1C1XA 4FOOA 4RUCA 3LLCA 3GBSA 1UF9A 3ZE0B 1UXGA 2VG8A 3VR3A 1F2UB 3PHGA 3FCSB 2PLRA 5LUAA 4HH0A 3LHFA 2QJOA 3M9WA 3ZV4A 1LKYB 3MGIA 2HA0A 1TT7A 1CR4A 3Q85A 2JRLA 2GBCA 3HKCA 3P9RA 1Z7BA 1S0OA 2WWRA 3EY4A 3JASB 3ILYA 3MAAC 1Y89A 1HFEL 1B0XA 1GG2A 2C82A 3HCFA 4NU5A 4ED3A 1OSNA 3VU3A 1ESZA 1T9HA 2GK3A 4BKUA 4BP8A 2EYUA 4DBZA 4X0EA 4E0BA 4HB0A 2VDWB 3JQDA 1VJ0A 5HIKA 4RW0A 1JDJA 3W9BA 5ALKA 4J9NA 5GPBA 2CY0A 2XNHA 4Q4AB 4RJ2A 2OLEA 3UA3A 5JS7A 2HEIA 5J2FA 2OZKA 2RGWA 3LOQA 2O57A 1FNBA 3TRJA 3VYUB 1LK7A 3DULA 4PGXA 1OVMA 1GM5A 3WE7A 3IILA 4KRYA 1KDZA 1GUZA 2OK8A 3BQ9A 3M7DA 1XF1A 2QWXA 4ZTBA 1UWKA 4NJMB 3VH3A 4JENA 1GGKA 1M6HA 3R7DA 1G7CA 1K0FA 5ALYA 1W93A 1X0XA 4D57A 5TMPA 1CEEA 2D2VA 3L0IB 4ZZ0A 4Z53A 2A1IA 4IG9A 4H6XA 4EB6A 1U3VA 1QHYA 5EIFA 5EIOA 5CYPA 3K6SB 3TARA 4TV9B 2XCIA 4RF3A 2YXBA 3L0YA 4FFDA 4XD2A 4B9SA 1WBJB 1NXXA 4W4TA 1YT5A 1ZQJA 5BPCA 4YCSA 3PX6A 1FQJA 2ODWA 2IH2A 5B1EA 4BO6A 1A9XA 1P8AA 4HEQA 1ZJMA 1QIFA 1H1DA 2AB0A 3DTNA 4OH1A 1YC5A 5TF0A 2V6IA 3RUCA 2ZUCA 3E6AA 2XUOA 5LA6B 1F3OA 3F8WA 1ZK1A 2P6RA 1H4TA 3QLEA 2DPJA 4I27A 1IN7A 3DYIA 1CUCA 1ZQNA 2NZ8A 4YUAA 1SUDA 4C0WA 1Z2CA 4F4YA 3SZMA 5CIYA 4UZEA 2C42A 1QAQA 2H65A 1FU7A 3F98A 1QXSA 2GCIA 3LL4A 3R5HA 4OQLA 8ICFA 1IG3A 4DIMA 1YFZA 1JUDA 1YHZA 2AI2A 3W7VA 1XTIA 4QARA 3ZY5A 2Q50A 1YNOA 2ZVPX 2XCAA 2VDNB 3OJOA 2ISSD 1K66A 1OH7A 4Y6PA 4BNTA 3WRYA 4URFA 3PHHA 5ALOA 2KBEA 4O4JB 4W6ZA 3QVMA 4TTPA 3HRHA 4BNGA 3KLMX 1TVEA 4W5NA 1N7GA 4V0QA 4DLUA 5K3FA 4JB2A 2HRBA 2NACA 4NEGA 4R0MA 3M6AA 4PO9A 1S2OA 1TFRA 3M6LA 2BHLA 1N7HA 3TNFA 4ZH4A 3AR3A 3NS1A 1X74A 3G1TA 4YRDA 4A9AA 2XCLA 5J4YA 5JBQA 2IYFA 3NTXA 2HLHA 3K9WA 1D03A 3AF0A 3B78A 3L8DA 1EINA 3WLNA 4TLCA 5FDFA 4L9RA 1GVHA 5DM4A 2IYXA 2L17A 4F06A 5IIIA 2KTQA 3PXCX 4WLUA 3ELDA 4RD3A 2QBYA 2I7CA 3B60A 1HE1C 4GZLA 2J59A 4XB6B 1MU0A 2X6QA 1FP7A 4TKZA 2ZVQX 4S3MA 1WF3A 1USIA 3SR6A 1HM5A 1FDSA 4D98A 4FCWA 4EATA 2GM4A 2R8KA 3ZJ5A 1L4MA 2YXDA 4KVAA 2Q46A 4DNPA 1OX6A 1ZHFA 1YNSA 1I7SB 1RAHA 2WIDA 4PG4A 2HO4A 2HU8A 3CUUA 1JDNA 5HIIA 3WBBA 1PO7A 1E3TA 4MKGA 4C1BA 2EF1A 1WP4A 2QL7A 2QRHA 1H22A 3MOIA 2I3ZA 2VNAA 3FVTA 4LJXA 2Y4NA 1XCOA 1E3LA 1HRDA 2W9CB 8ICLA 2XB2A 1QK4A 4UATA 4Z54A 2CHFA 3WOVA 1EVZA 2R5WA 2XCSB 2B82A 3Q8MA 3AERA 1OBVA 3MJSA 4IIYA 4K40A 1W96A 2OZEA 4TQ9A 2VDMB 4UBKA 3A36A 2EVWX 1JL3A 1CW2B 4YRNA 1E1MA 1J07A 1G4AE 2NTEA 3JPSA 2PUHA 4RVFA 4C0AC 3EF1A 4BBZA 1TUBA 1RWQA 5EKUA 2IUTA 1WTCA 1ZAKA 4ACAA 3WTCA 1SXQA 3O4JA 3KL2A 2PQ6A 5EL0A 3PFGA 5HJEA 2AI3A 5KMGB 1SL2A 3WLFA 2BCJQ 3B3FA 1V35A 1T9GS 3ZGOA 2O8FB 4NU6A 4FMCB 4U7JA 4N54A 2D8MA 3AJAA 4N40A 4QTYA 1NVTA 2IXFA 3Q5EA 4C6SA 2VP0A 2K7ZA 4KUEA 3RU9A 3QBJA 3SXUB 2HW8A 2K6GA 4XGIA 4B83A 4BUGA 3ZE7A 4RH3A 3GFSA 2YXEA 5F64A 3A4NA 1U3CA 1Q0ZA 1ADCA 4FI3F 4N41A 4C22A 3UJ9A 4ARZB 3ZIAD 1PVVA 4F85A 2MSLA 2X8BA 3BORA 2M0NA 2FWIA 3Q1KA 4QBKA 1VA4A 2C94A 3DVAA 3WK8A 2ZYDA 3B70A 4QPCA 2JMGA 4RZQA 1YVEI 1JHMA 3ZYCA 4G6ZA 3NOVA 1NMEA 3BWCA 1W85B 1KVSA 1YFJA 3GGDA 3SBOA 1WQ4A 3BXFA 1G38A 5CLQA 2H5IA 2ZRFA 5EJ6A 4KYTA 1M2OB 4OPMA 3RF7A 2I34A 2NT4A 3AEKA 5C7YA 1NW9B 5E8RA 3RH5A 2WLTA 3SHFA 3IUMA 4AXBA 3G59A 2RGXA 2NU9A 1U9IC 2P90A 2VTKA 3TR6A 2B3TA 3A6HA 2IOQA 3KPWA 3V6JA 2BAGA 2ROQA 3HY3A 1F7UA 4D44A 2HK7A 2R5NA 5AP9A 2Q0HA 2A67A 2QTVB 2L5YA 4LVOA 1O7JA 3GEBA 3REQA 2VJMA 5M2QA 5JU6A 3CW9A 2P6NA 3R3HA 4RQTA 1LJLA 1ILWA 3HGQA 5DWDA 2V5AA 3I53A 3EODA 2RBEA 1JQAA 2W6MA 4TWJA 4QGAA 5J2IA 4ZAYA 2WWIA 1PK7A 4XQCA 1UQVA 3U7IA 1KY2A 2KEYA 1TYBE 4BIIA 5J4VA 1DJPA 4ITVA 4BZQA 3CPJB 2OXFA 1LFDB 1Z0DA 2FVYA 1GG5A 3T7DA 4E4TA 3TQCA 3RUPA 4HZGA 1N2CE 1K8ZB 4QWAA 4J2TA 3OIWA 2IU0A 3D6JA 3ESYA 4X1IA 2R4UA 4E11A 4EJSA 3JQFA 4HQKA 2YY7A 3W6PA 5K0GA 4L07A 2G07A 4IQ4A 1TKAA 5JCJD 3D6HA 2AA3A 1SXPA 2PEYA 3AQFA 3OTHA 2Y6VA 2GEFA 4FC6A 2I6QA 8ATCA 2W2KB 4KWHA 5FUYA 5IAGA 1T5BA 5K0BA 3HYSA 4RDIA 1UT6A 4ZT2A 4P92A 5BWMA 5F33A 3NGXA 4YAFA 3CISA 5CNJA 3QOFA 4MCIA 4QLAA 5CDSA 3PNVA 3VH4A 4EUKA 4BLRA 4RMGA 1D4FA 1N6RA 1UFRA 4J1SA 1KP9A 4NPAA 3T9CA 5F1YA 1AH2A 4N9WA 3FUCA 3KD3A 1NE2A 1GDTA 1WB4A 4EB0A 4O4IA 2DVMA 5B1DA 3M1LA 2EFEB 3N2NA 3VAYA 4JI4B 5IVPA 2W7PA 4OXQA 4JN6B 2Z09A 5A0FA 1T1RA 4NOLA 4EUSA 3PQ8A 4BU0A 5BQ3A 3CEMA 3TKAA 2PL3A 3P5BA 2VTDA 4DMCA 4B5LA 2YQ5A 4J0DA 1GITA 1LLDA 1XZ8A 2KK0A 1V8PA 4OFZA 4ZANA 2IU6A 9ICOA 4XWYA 4G67A 4LQ4A 2H9YA 1BKDR 4J91A 1XZBA 4LC9A 3CC8A 1CF4A 4EH1A 1L5NA 2OFOA 2GILA 3QRWA 4BWGA 1L3CA 1YA8A 1GTJ1 3KVVA 2V7WA 3VXKA 2QMZA 4LZZA 4DLGA 2FUG1 1TM1E 3C8ZA 3K0SA 1PSWA 4B8YA 4CEJB 4C4OA 3CF2A 1TEXA 1TJPB 4QFCA 1IEWA 1NK4A 4IV5A 4RUAA 1CUIA 1XF9A 2R8GA 1QE0A 5DTRA 2F4NA 1MRSA 4KXMA 2OK7A 4RFSB 4RVOA 3SQLA 1HQKA 2QXTA 4JV5B 4P0QB 1BKSB 1UBEA 4MKXA 5HTKA 3COVA 1ZQSA 1Z07A 4HGPA 2HTEA 2J09A 1RXVA 3AG6A 4MI1A 2UVRA 1P8JA 4ZI7F 3KB2A 5B5EU 5HFNA 4PYIA 4EYQA 1X19A 3GAAA 1JEEA 4X1KA 3B13B 2OY0A 1KI6B 1P2DA 2I3BA 5H59A 4A0RA 2NUTB 3H9QA 1SKSA 2J7PA 4PZDA 1ES9A 3WYCA 2W8BB 1SIOA 2XYPA 4QHTA 3UBTA 1NLZA 3QE9Y 1VLLA 2WNIA 1T8TA 5K6RA 5GZ6A 5K6AC 3P9IA 3OICA 3A06A 2RH4A 4E30A 2ZJOA 4E33A 5AKXA 4YMLA 3A58B 1LD3A 2ERYA 5EYPB 1MVLA 4B82A 2Q3CA 2GNAA 1DC7A 8ICOA 4ZMBA 3BFJA 1JXAA 3ZV7A 4PO1A 1UPBA 3E70C 4U2EA 1U6JA 4HEHA 1Q2UA 1P1BA 1XZGA 1KL7A 3QOXA 3X1JA 5KG6A 3CSSA 2C7VA 1W35A 3RSSA 4R01A 3KLPX 1P31A 2ZTSA 3MR2A 1LBSA 1QF7A 4RM2A 4OKSA 1ZK4A 2KE7A 2A3VA 3P52A 1KNQA 2IZ5A 3T54A 3RVPA 3HKBA 3UB4A 3ZV6A 6CHYA 3GJYA 5E79U 3A1EA 2PLAA 1ISPA 1Z47A 3SYZA 2WT9A 1AOXA 4OKNA 3BJZA 3FFWA 2YMLA 3FTCA 2RP5A 5JYEA 1Y6GA 1I6MA 1I10A 2E0IA 5E1OA 2FWBA 3GMIA 1X9WA 4K4IA 1OI3A 1JAZA 2RHRA 1L5WA 3X1YA 3WI7A 1OZGA 2X5OA 2F17A 3GV5B 4DJAA 4EZBA 3QPVA 4DDKA 3TCNA 2I2CA 4FYYA 3D0RA 2WT4A 1QWOA 1GPDG 3KZCA 2HADA 4RXMA 3O0DA 3QU2A 3CBGA 2YOHA 4RSMA 5CB6A 1NW5A 1Q7RA 5ALNA 1CE8B 5EINA 2C4UA 4ZVLA 4LRYA 3H1EA 1N5WA 3RAGA 1YOVB 4BE9A 4QWBA 4JC4A 2H11A 3EVCA 4YJHB 1QYDA 1K6IA 2IS4A 1RQRA 2W37A 4CG3A 2CEAA 4TXJA 4F04A 2W42A 2HSZA 1YZUA 1F2UA 1T25A 2PFSA 1YBMA 2CHGA 1GSOA 4Z2YA 5IIKA 4I2CA 1LKYA 2B4TO 2FLVA 2FUKA 3V9AA 4FFSA 3PWSA 5EMKA 4ESHA 3ULKA 2XEXA 3MEQA 3JASA 4YD2A 2FDRA 4XLLA 2JKZA 1OWNA 4DG9A 721PA 3IJ5A 2SECE 1IXRC 1UBTS 4YAWA 1SK9A 3L1VA 3TZBA 1QTIA 2E85A 5AR1A 2VDWA 1MVNA 4AZWA 3WRWA 1V0JA 4DOMA 2EW2A 5KT4A 4OI2A 3BTVA 2ETXA 1J24A 4Q4AA 4WXRA 4RZSA 4KLJA 4MR7B 2LP4Y 2YWGA 5C8YB 4ZI5A 2COEA 5AUOB 2C0CA 3FSGD 3H0MB 3R7SA 4BMXA 1VHWA 3REGA 4ZYVA 1G21B 1FZQA 4AYXA 8ICAA 4NJMA 5EGNA 5CX1A 2IMWP 3V55A 1V26A 2E3JA 3DZHA 1S97A 1EX9A 3C2LA 1V8DA 3JWIA 3IA7A 5EQFA 5DNYB 5EEHA 2PX6A 3AWIA 3FYSA 2H2DA 4AO6A 5L1LA 2Q07A 1U81A 2JZCA 4CIWA 4KO2S 2H8GA 1Q0RA 4TOIA 3WJ2A 2FW0A 3T3OA 3OIFA 4KODA 4XQ8A 2D1YA 1PZHA 3KKAC 4F46A 5IVKA 3TEMA 4TV9A 2WHPB 1XT6A 3V2HA 2FJUA 4NK4A 3AVVA 4H0FA 3E27A 5T6BA 2WY2D 1P45A 4CE6A 3T1YB 1UC4B 3TTYA 3WYEA 2I67A 4F3KA 9ICXA 3TRHA 4EG8A 3IKVA 4D6PA 1IQPA 1F06A 2QE7A 4RDCA 4I14A 2DEUA 3K0AB 5KVQA 4JFRA 2O7RA 4LZWA 1WXFA 5NULA 4EKEA 3LO5A 4P7FA 3PY8A 4TS4A 4CI0B 3QPUA 1M2GA 1RAGA 1E20A 2MYTA 1JQDA 2IYZA 1WBBA 3VC3A 1G0OA 1PR9A 1P81A 3HU1A 2ZS7A 3HI4A 5BYKA 3EIUA 1RZ3A 4O4JA 4Y8VA 4PO3X 3HDGA 4X61A 2Y1CA 3KQYA 5DE3A 4UCWA 3G2OA 3NIGB 2OXRA 1B8UA 1VG0B 5DNVA 1XVUA 3TI9A 1FFXB 1BWSA 3OPNA 3QMVA 5A3RA 2KS6A 4TX1A 4MQMA 4W9MC 4DSTA 1DBQA 2PJZA 4B9LA 4LNUB 3BCHA 2R68A 3M8KA 5CH3A 4G5SA 5NLLA 1NG1A 1GRQA 5G53C 3KZMA 1JQLB 4JYCA 5IF3A 3WNZA 3T4PA 5H1YA 2JK1A 1N6KA 2QX8A 3NTRA 4WXYB 1NPTO 3A04A 5KFZA 5EXDA 3OZIA 4Z7NB 3A4VA 1MQ9A 1ZN2A 3DO6A 1UKVY 1KI8A 4DV7B 2J33A 1FQKA 1I0ZA 4GBMA 2FCAA 4TLLB 1QBKC 3N2LA 5A0VA 1HNXB 1F8XA 2GD2A 1L5ZA 4GOJA 4WKPA 3DFKA 4J6EA 4S05A 2QOEA 3PZBA 1TIPA 4UHEA 4A23A 4HK4A 5TJHA 2WJ4A 4Z1MD 1MT0A 3RTCA 3LAWA 3M5PA 3K70D 3EVNA 4CF6A 1CVRA 3D2AA 5BWBA 3RYIA 4INZA 2QB5A 2H52A 2IYLD 4M8LA 1QQ7A 1Z25A 1CUZA 2JFBA 2CB9A 5LXTB 4YV0A 2PZAA 1D6SA 4BDSA 4OLBA 1V7CA 4L95C 2YJ6A 3G2HA 1YT3A 2C2ZA 2NT3A 1QIIA 2RHMA 4LOJA 4ZC8A 2W9CA 4KAXA 5FLXA 2XTJA 2GFIA 4UTXA 2WNSA 1I6LA 1UEJA 2TECE 5CXSA 1MXFA 3P2OA 4OFXA 2R7AA 1ZJJA 3HXOA 3WGTA 3TZ6A 3BH7A 2VHQA 1N62A 5JS2A 1J20A 1I7QB 2X0FA 3UKOA 4MUYA 1XIVA 2YYZA 1Y7HA 5TGTA 5BT8A 3HN7A 2YWBA 3A2NA 4C2UA 1M1UA 4KG7A 4G41A 4IWNA 2WSLA 1XZCA 1ZJ4A 5KMGA 4NL9A 3BBPA 1FPQA 1JRPA 4DLAA 4IJWA 4KQHA 2O8FA 2R8OA 3H0KA 2H1HA 4MVJA 1PNTA 3E5MA 3RBXA 5B1IA 2XV1A 2CDCA 2ATEA 3TB6A 3DEKA 3TGLA 2CD7A 4YPVA 4J9VA 3EDMA 5JXGA 4BHTA 4F2RA 3SXUA 1GKIA 2CE2X 1AIPA 1XQ6A 4XJXA 4BO7A 1N9GB 4DW8A 1O95D 1A77A 1DQZA 2JKYA 3LUFA 4BRWA 5AVRA 3PR1A 1A7KA 3HGMA 4F5ZA 3GJ3A 3V8VA 1PQYA 1W6RA 4D9IA 4M8SA 3PL5A 4BNZA 3OCUA 2Q1UA 4RQAA 5JI3E 3TAPA 5CT5A 1AKRA 3OD1A 4P86A 4M47A 1OAKA 1ZVJA 4U3JB 1C0KA 4RV9A 4F9TA 2BCRA 2P3OA 2K8AA 5CYOA 4N65A 4BJQA 4W5WA 2HHUA 1XCMA 4UXHA 4YI3A 3TSCA 2XWPA 4HNHA 5U1PA 4PSAA 1S5LU 1ULBA 3AQ4A 3PFIA 3OA0A 3OQ1A 5IXSA 5I9NA 4R1OA 5I5EA 3KWJA 3D6UA 2JC3A 1LPAB 5F78A 4RPCA 4HSGA 1DLJA 4NOKA 3X1MA 4FU0A 2I62A 2W00A 1E9SA 1JHOA 1JBEA 2JGAA 4LV6A 3TUZC 1KIMA 2B94A 1H9CA 1DL5A 4N3GA 4LXGA 2J0QA 2VOEA 3B5JA 4RD1A 1JMVA 2BKLA 2XJ4A 3SQXA 1TQ6A 3ISBA 4QZCA 3F67A 4NX2A 2N75A 4KKXB 4QYWA 4MVJH 2GJAA 5AOCA 4L08A 3MJRA 2OZVA 5IKXA 2GTPA 1F6BA 1VJTA 4MKIA 4RAOA 2C5SA 1E7QA 5J3JA 2HJHA 1K5HA 4BV2A 4BTEA 3Q3EA 1PVDA 2B9VA 2FYTA 2WIJA 2RAFA 1Y48E 3DV9A 2RGEA 3CW8X 1RP7A 3QK7A 3ADBA 1GSAA 4HNGA 2HI0A 2QPAA 4H1VA 4NYIQ 2Q4OA 4JXKA 1LX7A 3BTUA 5AHRA 5HR5A 2WJVA 3PNKA 2J45A 1K7YA 1T0HB 2DMRA 2CFTA 4HLUC 2ZWAA 4K81B 1QF6A 4OK6A 1SOAA 2W2KA 1GPYA 5HK8A 4D3ZA 4QIHA 4H7DA 4ZT4A 2QN2A 1YU9A 1RQGA 2QD5A 3V1YA 4F5WA 4IPTA 4PICA 4L4SA 2PSFA 3EDRA 3H4VA 5CA1B 4XJVA 4I3FA 3GIKA 4L57A 1NXOA 3V6KA 4RPIA 3I64A 3G2NA 2PH3A 2KQUA 3GIIA 1QPBA 1W8DA 3B9RA 2DBZA 2WLSA 1K0UA 2YMPA 2DB3A 3R7WB 5JH7F 3HVKA 2OYRA 1C7JA 2J5BA 4YJFB 5DP2A 5EVCA 1TM2A 2ZTLA 1F14A 2O14A 2HFKA 2RGRA 3IVXA 3KJXA 5CLHA 3VTKA 3L4BC 4WLEA 1E8DA 4H77A 2WYWA 1NBEA 4RPZA 2J9ZB 4HUTA 4LYHA 4KWEA 3N9IA 4YCMA 2OBFA 2OCGA 3IBGA 1ML3A 3GRFA 1YF3A 3VC7A 2WBLC 3RB0A 2I4OA 4HWOA 1EVEA 1V6SA 1GA4A 4ZHQF 3CF6R 4N5HX 2XCOA 4R54A 2B20A 4S1NA 4ENUA 3GD5A 4Z5XA 1JFFB 4ETMA 3DLCA 3PSTA 3PC4A 2XHZA 1DG9A 4TROA 3DLBA 2V6GA 1ZXXA 4E7OA 3M3DA 3OIVA 2AW5A 1QHXA 2N1RA 1DDGA 4EUHA 4HX5A 4FWIB 2IC5A 3U62A 1QV6A 2R0QC 1YMVA 3MJEA 3AONB 4HFRA 4JUCA 4P0QA 1OIXA 1O95C 2Z2YA 3CH7A 1ED1A 3G79A 2LE0A 1QE5A 3NBKA 3OLVA 3I5YA 1GZ3A 4ZREA 5K0CA 3CYMA 2WKQA 1IJBA 4QJ5A 5SZJA 4DDHA 1KI6A 3O8OB 2R00C 1BVRA 4S04A 1Z3IX 2VS1A 3ZCUA 1P5RA 1EFAA 1DWOA 1FTQA 3EXEA 3L18A 2Z3WA 1X3LA 5JQGF 2W8BA 2X4LA 3SIPA 3VC1A 5LJLA 2UYOA 4AJ9A 2ZE7A 2O0HA 3QLJA 2FHSA 5E1DA 5EHGA 5B3KA 2CNWD 2NSDA 1CZKA 1W29A 1HSOA 3T9DA 3I30X 1V85A 1UMKA 3DVQX 4TWZA 1Q0PA 1AKVA 3GDWA 3BHNA 2HGZA 5A3VA 1RYDA 1VJDA 3MYRA 4BQPA 2HRQA 1P1HA 3EF0A 4KAJA 2D7DA 1V96A 3NG1A 3HJHA 1Q1BA 1V4BA 4I50B 3UAGA 5BMVB 4F7WA 4QL3A 4E5PA 1T2CA 1F4LA 1Y3DE 3FD8A 5IMBA 1GPH1 1CNEA 3EQ8A 5TS2A 4IKPA 4D9BA 2A1TR 4MEAA 4LHSA 2AYXA 3F3YA 4LHEA 3VX4A 3RIHA 3EA0A 1SVNA 3KNZA 3GCWA 4Y0VA 4CG0A 4YJGA 4F12A 1C9DB 5KFYA 3QENA 4PR0A 4BAUA 4BQRA 1E5QA 1F48A 3MS4A 3C8HA 3P0HA 3SLRA 4R1TA 3WS7A 1YASA 3D3WB 5JD6A 2WTMA 4G86A 3SR0A 3PPXA 2WWHA 2X41A 4FHDA 4TRMA 4D25A 4EHKA 2OBMA 5FUMA 2QP3A 2QTCA 4MS4B 3OURA 1RQLA 4D9HA 4QC2A 1WE2A 1CE8A 3HRKA 7ICVA 1V6AA 2QRVB 3Q8KA 2W71A 4E2XA 4RETA 1Y8QA 4RE6A 2AZXA 2AG1A 4ZGWA 1X3SA 5KVVA 1XN4A 1UBNA 4GPZA 4GXTA 4YJHA 2CV1A 1ZXLA 1ZW6A 5KYYB 5FHRA 2WF5A 3RFXA 3RAPR 1EH5A 4UULA 3M9NB 4N7JA 3U6KA 3UNXA 3GGJA 1C7EA 5DZSA 1FFYA 1KQQA 1D9DA 2WE7A 1RHUA 2EX4A 1HMPA 1X14A 2NXNA 1HLDA 3U56A 3SXJA 3FCAA 4R7ZA 4UMDA 4OL9A 4ZPXA 4PIVA 4K1XA 3WWYA 3IHQB 5CK5A 2IZ1A 4P3PA 3AMVA 2VWGA 1Y6FA 1GNLA 2E4AA 5DBAA 4R0NA 1Q83A 2ONYA 1N1EA 4Y7DA 4FFRA 1CK4A 3W5VA 2HYDA 4MR7A 5FBVB 5C8YA 4LFAB 4OSOA 2JCYA 4LRXA 4M87A 3NUZA 3ONDA 1Y37A 2KMDA 1YKGA 4HYKA 3NDPA 1KDOA 3EXFA 2WFLB 4Y3UA 2A88A 1AKYA 3H40A 3CR3C 4QGSA 4FE4A 4BEBA 2BFWA 1FLNA 4I4TB 2IEAA 2QJFA 1NJ2A 3H3XA 4JVLA 4HB4A 2Q45A 3DL2A 4YJ3F 1NJGA 3GLFA 3F2DA 1R6BX 4KNWA 2WHPA 4RS4A 4IY1A 1CETA 1I3OA 4R3UC 3F7OA 1IN6A 4KQ1A 2C4KA 3D3NA 3DUWA 4RO0A 1G8KA 2BEVB 3OWOA 5IDYA 5FI1B 3RNLA 5IILA 2OZLB 4QIWC 5KOYA 1RS0A 1SK8A 1KORA 4LW8A 5U9CA 2I4TA 3U4CA 3M6FA 2D1SA 3BILA 3ASYA 3E1SA 4BNDB 2YJZA 3K0KA 1N60A 2ECQA 2ZJ1A 1TD9A 4OQQA 1R9JA 3GPCA 3V4PB 4REOA 2YXLA 1SKYE 4FEGA 4V0SA 3AR2A 4HDMB 2KHQA 1V11B 1ZRNA 3RFTA 2EL9A 4C5CA 1QRDA 1PZXA 2FPXA 4BRZA 1PZFA 3NHFA 1GV1A 4JBHA 4WNIA 3LWMA 5CFZA 2HWUA 1SKRA 2YVUA 5ITWA 4OQEA 2O2YA 3ZG6A 1P2FA 3K15A 2A3RA 4KYVA 4F91B 4IAOA 4Q6BA 4DPLA 3DOIA 5CD1A 2DHCA 4NQZA 4KCGA 3CNHA 1B7GO 1GAEO 3ORRA 1EQUA 3ONEA 4ZARA 2CNNA 3WBJA 5IZ4A 5HF9A 3HCNA 2ZWVA 4IHAA 3R0IA 3ACDA 2NZUG 5G1OA 1CDEA 4DMHA 2VJAA 4ON9A 3ENKA 2FSHA 2IZ7A 3MF4A 4YAGA 1UODA 4ITUA 4JDPA 1CJCA 1K89A 1FFXA 4PTLA 1BN7A 1YZ3A 2PWYA 2E37A 3QFHA 3L02A 4LNUA 3PFHA 4FBGA 2PQMA 1Z5ZA 4TTSA 2H5LA 4GSYA 4V2UA 5EFZA 1J1UA 1M73E 5CEJA 4L6AA 3X2SA 4QUIA 5UKDA 3OAAD 3RLFA 3TSOA 3QFSA 4LZJA 1VBMA 4U39A 3SHWA 2BUCA 1DSSG 4NOMA 1M1XB 4Q3EA 1WY7A 1Q0UA 2DKZA 1X7ZB 4ZEVA 1DNPA 4UEQA 1W0JA 3BE6A 1ACLA 1DQPA 4DMMA 3ZJUA 4HVTA 2H2IA 1T4BA 1DADA 3RANA 2I5PO 2DQ4A 1KAMA 3KE9A 3PWZA 5LBIA 3VDXA 5BT9A 4JL6A 3S29A 4KN9S 3P19A 2HLPA 4DF4A 2QZJA 4KR2A 5IWAB 2NSJA 4CM8B 4LG1A 1JECA 2PYIA 3DMDA 1UWLA 4BN0A 1Z5WA 3TRIA 5HZGA 3GWZA 2ZSHA 2MIIA 2QR3A 1M0EA 4UARA 1VL5A 1NUTA 3FCCA 3OJCA 1MAHA 1KEWA 2XUKA 3UT6A 3DAHA 2ZJFA 4C29A 4JJ7A 1Z1VA 1C9YA 2QUAA 5CGQB 4A8TA 2XBUA 1NYLA 4PYKA 4ENRA 1ICEA 2DULA 3A6FA 3FZNA 3N4MB 1SXJB 4F1JA 1FOEB 1O57A 2DH5A 3ZGNA 4QWEA 4N7BA 4AROA 1KZ6A 3EUAA 3UANA 2DP4E 3H2BA 2NX2A 3C6ZA 2D4AA 1EG7A 1BXKA 1V9LA 4X6LA 5DOVA 1W19A 4H4DA 4KW7A 4NBLA 3P9NA 2OOKA 4C08A 1NOMA 3H4MA 3CH5A 2PT7A 1MDFA 2BVNA 2W3SA 3CKKA 3R75A 2Q8QA 1U02A 3HJCA 1Z1BA 1Y7PA 4FS8A 4OSEA 4E2WA 1KTIA 2CXRA 3TQ1A 2VAVA 1A6SA 2P4HX 3LY9A 1XNRB 1JIUA 3UCFA 4C4SA 3FNIA 2GSWA 4NCNA 4PYJA 4GZ3A 1FBNA 1AQJA 3F6BX 4CIYA 3B6EA 2LZ0A 1BAPA 3PMNA 3K4QA 2WUWE 3DE6X 4QTUB 3OBIA 3VYSB 4RU1A 4OQNA 3BF7A 4MUJA 1FNCA 1N9GA 5K8VA 4HCJA 4D0NA 4RADA 4CMCA 1NUQA 2VVTA 1CB7A 8ICNA 1Q8KA 2JLWA 5K4AA 4OQPA 3H4IA 5D1NA 3OA2A 3WWZA 1ADBA 4GKAA 4Y0AA 4MEXA 5TMDA 1Z5OA 5G3ZA 5JAHA 4KIUA 3F6SA 5C3MA 1DQSA 1AUXA 4DQ0A 3HWX1 2ZRIA 5A3JA 3JYQA 4E2YA 1Y88A 3IV7A 4EFNA 5EMNA 5I8WA 2RKOA 3ZLVA 4GQBA 5BSEA 4XYGA 4RXUA 1V4VA 2BPCA 1K88A 1X9HA 3NRBA 3H42B 3UJ3X 1QB8A 1HKUA 4F86A 1TI7A 5CLLA 1IQ0A 4JYMA 1NMQA 4D6YA 1BSVA 4D92A 1MH1A 3CWQA 1CPYA 2XZDA 2XUQA 1L5HB 2HGSA 1N36B 5M04A 4PIMA 1TO2E 3CNNA 4XTRA 3S68A 3P0FA 2BEWB 3LZCA 4CHTA 1YDHA 4AY3A 4Y9SA 4ZTUB 1V3VA 1QF9A 4DCSA 5DWVA 3PO4A 1R5JA 3IUBA 2HPZA 1JU3A 4OJPA 4ED6A 2OGZA 1U1GA 1WD5A 3ITKA 2GO1A 4UEWA 1EUCB 5AVSA 2VJYA 3W8NA 2I9GA 5EQDA 4EBEA 3HWSA 1T29A 4E14A 1MCZA 4G23A 4COKA 4GPD1 4QFDA 2BR4A 3L77A 2FEKA 1VI6A 3USCS 1Z38A 1Z2DA 2CXNA 4C04A 4FGLA 4TVSA 3FYHA 3OMLA 1VL6A 4CMAA 4BQFA 4BWMA 2D5AA 3HCWA 4BNNA 2WWXA 2W6ZA 1Y8CA 1RVV1 3AY6A 4KPGA 5I9TA 6YASA 3K0HA 1OA1A 3W8DA 1OW5A 4W63A 1RHKA 3ZDRA 2ZB3A 3TOXA 2NYRA 1ISFA 4CLDA 3DHWC 1WXXA 3Q2OA 2YZMA 4GIBA 1ZNQO 3OKAA 5HA5A 1VECA 4DPMA 1XDZA 4P7JA 4AS1A 3F5QA 1KYXA 1EEXB 4LXTA 5EKSA 1KDRA 1QG6A 4KOAA 3I8OA 3KAJA 5FLKA 1U9IA 5H9WA 4JUZA 4UAGA 1VHQA 7ICGA 1Z73A 3O3OB 3FKSD 1SY7A 1MKYA 1Z39A 4DIKA 1YR9A 4BB9A 5CA1A 2UXCB 1A82A 4KWIA 2L18A 1IBSA 4PJ0U 2VPPA 3PR5B 1X2EA 3I2YX 2FEWB 3QVLA 3LC2O 3THRA 2WWGA 4EYHB 2QUBA 4CDRA 2VQ6A 4YJFA 3X1XA 2G70A 4I2DA 2C2HA 4H3SA 4WK4B 2HVIA 3M4ZA 2PLFA 4NFLA 3E03A 1GUDA 3BWXA 3E35A 2CYCA 1SXEA 1N5OX 2B8TA 4ISCA 5ER6A 3SS8A 4NESA 1NZJA 1DEKA 2OQVA 3UV6A 4FJ0A 2OV2A 4RU9A 1HZZC 5AM2A 2FWNA 3ZHCA 4J0CA 5EXTA 2Y1KA 3ZTYA 5KG7A 2ZANA 5FBQB 3UWDA 4LPSA 2PSJA 4G4IA 5JVDA 4FDAA 1MX9A 4EO4A 5JWRA 1MW9X 2HA6A 4QHSA 1NZFA 2GPNA 1TA4A 4EBCA 1KSGA 4Q34A 3LBAA 3IT3A 4ZVNA 4CUJA 4UQOA 4WCDA 3ORSA 2IYVA 1JT9A 5CM9C 5JO9A 1X8KA 2GOYA 3EMKA 2IE0A 5IFLA 3CUYA 3NEPX 4QLBA 2ENUA 3TLGB 2VZ8A 3RB4A 4WZBE 3EAGA 5AM0A 4Q8EA 3G9XA 3AU9A 4J9PA 4FR5A 4N82A 2WP8J 2WMDA 1TGVA 4KRXA 4HDRB 3D8HA 3ZXIA 4IQWA 3B1VA 4RY9A 4XKJA 1DS6A 4IGAA 3WK6A 5CPBA 3O8OA 3RVMA 1V7ZA 2HW3A 3DEIA 3STXA 1M72A 4LDPA 2NV2B 4DZTA 4U9IS 3PZRA 1IXSB 4BVEA 1O4VA 4ATNA 5MFZA 5T57A 3R74A 2G4VA 1UINA 1TJNA 2ZR9A 3HZOA 2XGSA 1WQ3A 4DJ5X 5FBLB 5G5GA 4P3OA 4A2PA 1C81A 2PLWA 1ZNXA 1U3FA 2FPLA 1M34A 2FNAA 2AG6A 1CF2O 2F8KA 2V9WA 4R8SA 1HOXA 1GG9A 4Z7QB 4NLKA 4YYZA 1HT3A 4M9LA 1U7UA 1Z2AA 5DKFA 2CL0X 5I8PA 1ZVKA 1SZPA 7ICEA 1HEIA 2PZLA 4NHOA 1PEAA 4FMBB 2BH9A 5JY6A 2A0KA 2HSGA 3IDOA 5ALIA 1TMGE 4US0R 1PT7A 3IDAA 3NIFB 1Y7LA 4I50A 2GFQA 2BTQB 2AU0A 1U98A 4H6VA 3K8OE 3CRW1 1DX9A 4GP7A 3CX6A 2OHHA 4M53A 3H5VA 1RFLA 5K8CA 1Z7GA 1D9ZA 2N1MA 3QLVC 1E4YA 1DG1G 4PYNA 1FUKA 3JSXA 1GQOA 1Y34E 4I28A 3IBCA 3MTGA 5C52B 4C76A 4MLPA 2ILTA 1KS9A 2HSWA 3F90A 5C7OO 2DQNB 2HRZA 3N7AA 2AEFA 1TRKA 2NVOA 4IIJB 3JQAB 4FFBA 3TS1A 4IIEA 3OZUA 1R00A 3PIRA 3GMSA 4NQRA 5LB2A 4DWJA 3RQSA 3KSUA 1H2RS 1QZ3A 1O6FA 2DPLA 2GN9A 4HDNB 3VSBA 4MS4A 8ICEA 2I87A 4M36A 4GO1A 3T3FA 1NMZA 2QRVA 4UQPA 3UCEA 4GH5A 4IXMA 2PKQO 1L5SA 2VPTA 4P34A 1ODTC 4B87A 4M0PA 3EZ7A 3KU1A 1NBMA 2OSBA 4UNNA 1RI4A 3TTUA 4KU4A 1CQPA 3ZCXA 1WMDA 4IIBA 3GP5A 3S2YA 4F3RA 2GFHA 1X1RA 5HYVA 3UK1A 4B3FX 2Y1XA 3BDVA 3L7KA 1GKUB 4ENTA 2RAUA 3VKVA 5BRJA 3FC4A 1D9XA 4MRSA 4Q9HA 3HQ4O 2PWZA 1H38A 3VNRA 3K73O 1IFXA 4EG4A 1NHWA 3ZCVA 4AL4A 5KT7A 2GYVA 5J5VA 2X9NA 4D0RA 1AVTA 3HLTA 2DCMA 3G6KA 5F9HA 1GFIA 3MS2A 2XIJA 4JLUA 1HE5A 1G5HA 2WFLA 3NH9A 3L6DA 3PHBE 1Z3EB 4R9SA 4E21A 4UVDA 1YRHA 2FFHA 1NK5A 3LUBA 3G1WA 4AX8A 2H3HA 1QYXA 1LV8A 4YLYA 4QUDA 3MVEA 1GU0A 3I6MA 4KFUA 1VKJA 1BOOA 2QV0A 1P60A 4C7VA 4IUCS 2ZWPA 3C0KA 1VPWA 3PA6A 5KWSA 4OBEA 3D6NB 2ZTEA 1RVDA 4OB6A 5IK2D 3Q7QA 1FFHA 1C7FA 3ZTTA 5D3ZA 3IDWA 2FOIA 2D5IA 4XDYA 4C0SA 1IV8A 4FFVA 4LISA 1NSFA 9ICQA 3KZ1E 3EIXA 1Z8FA 3O94A 1L7NA 4OOFA 2BEVA 3W1VA 4NAUA 1T3LA 1R64A 2XUJA 2FMTA 2H06A 3U81A 4RA6B 3KD2A 1BMFD 4IDBA 4JLBA 1IXRA 1X42A 4JKOA 2WZQA 4BNDA 2F8MA 3D2NA 1VDMA 2HDNB 4ECUA 4B7XA 5CDUA 1F0PA 2ZBEA 4M1QA 5JLAA 3KCNA 2VSQA 5FR2A 4J75A 2WJPA 4CIXA 1V11A 5DXFA 1RBMA 4A16A 5KU1A 4AY5A 1XEFA 4DYDA 4MW4A 5DIZA 4AMBA 5K20A 2X5JO 1SCBA 2WQZA 4N8EA 3IUNA 4BGDA 1PEYA 4BY9E 2A7QA 3HXKA 2XECA 2ZCUA 2BT4A 3JRWA 3U7QA 3MHPA 4AYBC 4DBLE 3PNQA 2Q29A 4A1OA 1YS2X 3OZSA 3PVXA 3P45A 4ZOLF 4BZZA 1OT3A 4YUYA 4WJLA 1C8KA 3ZS9A 4GFDA 3AJDA 3H04A 4QULA 5EWEA 3G5AA 2IW3A 5DQGA 4C21A 5ALUA 4EECA 3E05A 4L8VA 1FTYA 5I4BA 3QZ7A 2R11A 3IELA 3GGOA 3PQCA 5GJBA 5J23A 1N0VC 1ISRA 5AJYA 5F9NA 3MOGA 1T5LA 1T5OA 5IJAA 4LF5B 3OO1A 4A10A 3RUDA 5REQA 2DKOA 3GQBA 4P2HA 5ELMA 1OLUB 4EIWA 1X7ZA 4IILA 3Q7RA 4F2HA 4PGMA 5EN4A 3JR3A 4L16A 3PUZA 3UJBA 5KFIA 2MYNA 3LUCA 3BA1A 4PO8A 3IBTA 4BNMA 1D1PA 3UOAB 2WU3A 2HF7A 4IHJB 1HDCA 1E66A 1OD6A 4CM8A 2M9NA 1EI9A 2FZKA 3N8GA 4UNPA 4PHTA 4C89A 3AUAA 4O5EA 2NRVA 1ZITA 2PD4A 4TKMA 5L45A 4BX3A 5FNVF 3TPFA 3EEQA 2QY6A 5BV7A 4QUJA 1G5PA 1XA0A 1P29A 5HEKA 1PSZA 2YYYA 1EFVB 3MABA 1G2PA 2UZAA 1J06A 4ZI3A 2R18A 3I1IA 5F12A 3W06A 4CF7A 1SXJA 1LVHA 1PDVA 4MKRA 4P35A 4AP5A 1BW9A 4EYOA 3HB7A 1QE3A 3B3JA 2GTHA 1UBSB 3I5UA 4ZAWA 4G8CA 3DJFA 2X19A 4G0WA 2G6BA 2GJ8A 9ICBA 1A8UA 4GQIA 3FOEC 1L9KA 3GZ4A 4C88A 2JAQA 3CB2A 3E53A 3NGDA 3RVDA 1MABB 4O2LA 4B34A 5KT6A 4FOSA 2PR2A 4CL3A 3SFVA 2K8CB 2QARB 3ZX4A 1S2DA 1JJAA 4XUCA 4DSNA 1XNJA 4PIPA 2PQ2A 4HG2A 3D2QA 4O5KA 4ZT3A 4KWTA 1U94A 3D4BA 1ZL2A 3PJRA 5L51A 3Q5GA 4B9EA 2ZETA 4XQEA 2P2GA 3T5BA 3WV4A 5JJCA 3EVFA 1CHNA 2QNRA 2EKLA 1XQWA 5E95A 5I7AA 5C8ZA 2FGJA 4LXUA 2H3FA 4MDHA 1VPVA 2V7VA 3R8XA 1ISIA 4QDOA 3PGVA 2WUVA 2XYRA 1UZAA 1U2DC 2Y1WA 1EDEA 1H05A 3OWXA 4F3YA 4KGDA 2CXQA 2R86A 4DUGD 1OI7A 4EY3A 3RIEA 3OJEA 5LBUA 3TIIA 5C46F 3OF5A 3OFNA 4FB4A 3KYIB 4DV2B 4FE7A 1OKKA 3RJFA 2F64A 3SM3A 2BKXA 2FPPB 2ECKA 2QRKA 3P1JA 2PKXA 2C8JA 3DMHA 2HJWA 1J0XO 3F71A 2ZI5A 1N5XA 3R6DA 2WIAA 3O8RA 1B2LA 1XDBA 1NK9A 4ZXPA 1LFAA 1R6TA 2FFRA 1GQ2A 3KKNA 3KM0A 2X22A 2VJ5A 2O05A 1LI4A 4Q44A 1HEUA 1WRBA 4ZZ2A 4DJEC 1T36B 2OGTA 3GILA 2XGQA 3QX3A 1KS2A 1U28C 5A1JA 4B74A 2VP6A 3K6SA 1FTSA 2C3MA 4IH4A 4Q7QA 4LJ9A 2AN1A 3ADOA 1LCIA 3ANTA 1JHUA 4QUKA 3U60B 1ULUA 1JTVA 2E1EA 4IVPA 2OPBA 3GPLA 3G8AA 2OBNA 1VE3A 4P31A 2ZR0A 2Z4RA 3KKEA 2X2PA 3TECE 4Q39A 1EUCA 5LA6A 4DNXA 1VQ1A 2O48X 1T5TA 4MEYA 5B4UA 5LKAA 4QRIA 2BMFA 2H57A 2A9RA 3IOEA 3VTZA 1VBNA 5KDOA 2OO5A 5HUQA 1YFLA 3HV2A 3UMBA 4GBJA 1Z15A 4G5HA 1Z2NX 4IQ8A 3DBRB 6ADHA 1EX7A 5KJ6A 1S01A 1T3TA 1SPBS 1G8FA 3TTSA 5B57C 5ECGC 4EEXA 1G3QA 1EIWA 4DLWA 2W6JD 1RJWA 4EUFA 1JKIA 3RUAA 5E38A 1I7LA 2BBOA 4MLCA 1B0AA 1IVYA 3DXXA 1CDZA 2RC5A 4AM8A 2QX9A 4O0MA 2Q5LA 5BSWA 1ZUD1 3WGZA 3PD1A 3RU3A 1XNGA 3HB5X 3TIFA 3N2GB 2EZZA 1ODLA 4C0JA 1MQ2A 2I6FA 3K9NA 5KHOC 2R8EA 2FB9A 1KFDA 4PZCA 1Q0QA 3LM8A 2WTFA 1ZH4A 2QB1A 1E3IA 3JVUA 5JARA 3M8SA 1VRVA 3RT9A 2VYND 1ZBQA 3FKJA 1UH5A 3UXMA 1LZKA 1BEEA 5IIJA 2VUUA 1Z82A 1DRGA 4Z6FA 5LQUA 2IXEA 1ZQOA 3QUQA 2I03A 2X23A 1C41A 4CDGA 1HTTA 2YVQA 1R37A 1WG8A 1EFTA 1Z5PA 4DCMA 5BSVA 4LSGA 1DI0A 3GRAA 3SQOA 9ICMA 3VZCA 5EJ7A 3QI2A 2DFNA 3V8BA 4JMLA 3H8VA 1AJEA 1DC4A 3A6ZA 3ZU5A 1YS9A 1NN0A 1NMYA 2HV8A 1W4AA 4LJ5A 4YDRA 2ODGA 4J7CA 4BO8A 1W4BA 3ZN2A 2JCSA 1DQNA 2EKZA 2HBKA 1TUGA 1VL1A 1JEDA 5AI6A 1R12A 4YP7A 3TXAA 3ONFA 3BE5A 3I28A 1Y3CE 2WUEA 5HP4A 4Z2AA 2YHBA 4OJ5A 4JZKA 1LJUA 1E79A 4ADSG 1GTZA 4JEUA 4PYOA 4R84A 1D7AA 4V03A 1Z7WA 3AFIA 4HLUA 4GOLD 1E9DA 5IVDA 5FORA 1RQ2A 2O3TA 3KJFA 3B8EA 1CG6A 3BJEA 3NZEA 5B7GA 1DU4A 4DMGA 3Q2KA 3CJQA 5GJCA 1AZLA 3Q9NA 2EF0A 3WAJA 5JAOA 1NMSA 4NENB 4NCHA 3KG2A 2Y93A 2CVFA 3L4PA 4H3VA 3WIOA 1G8YA 1X1EA 2J3IA 1K63A 3HL4A 3HBLA 4M0UA 2C2KA 3WTBA 5JSYA 1BNCA 2AXEA 4IXNA 5MGNA 1Q7CA 3ITDA 4C07A 4CQNA 1Y82A 2IHMA 1LQUA 3KCQA 1MO4A 4WEQA 5IAEA 5GTIU 3LCRA 1VI5A 3A4YA 1I4EB 4U2GA 1USUA 4DLNA 1YR3A 4ACBA 3MBKA 1PRYA 3OCWA 5CBPB 2H7YA 3ZU6A 5G1NA 2NQ8A 5FYQA 5J0YA 4G0UA 1G6OA 2Y1DA 3WL6A 1SXDA 2EAMA 3DOOA 1ZZGA 2ENWA 4URWR 3WL5A 1SXIA 3LX5A 1K5PA 2BQRA 3FWZA 1VCIA 2JH8A 2JGMA 4MITA 2FK7A 5JBIA 1B6GA 4DILA 2IKSA 3HXLA 4U7WA 4WK0B 4UDNA 3H5LA 3J81k 4J43A 1Z68A 2HUPA 2H48A 3WYBA 1WCLA 5EJEA 1CX9B 3IV9A 4U1RA 3FWNA 2QN6A 3LY8A 1H0HA 2QTHA 1RACA 4MPTA 4QBFA 1OH5A 3T7AA 4BJHB 4ARZA 4QDUA 4HAOA 3W2TA 5AKIA 9ICUA 5AI8A 5CW1A 2C7RA 2NPFA 1CR1A 3C21A 2W2PA 3OKCA 3C87A 2AFHB 4DG8A 2YIJA 3WKAA 2LYBA 1FFDA 1QFJA 1W85A 5K8UA 2ZYHA 4QVKA 4KPUB 1ZJWA 2D0OB 3M0EA 5EIAA 3SC6A 1M2OA 1XPUA 2CFIA 2PNJA 3FI9A 1NVWQ 4XLZA 4IIJA 4Q48A 3JQAA 3RKUA 1DLIA 1KJNA 2XMCA 3K20A 2ATXA 4B9AA 2C22A 4HDNA 4GOKA 4D96A 3KHGA 5SY4A 1JJ7A 3SSAA 1P2GA 4TVBA 1Z0KA 1P1JA 4IRMA 4NC9A 1RCTE 1E5TA 2QTVA 3KWFA 2P6MA 5DLEA 2BR0A 4F5OA 3SEIA 2E89A 3K1TA 2KIVA 5C0OE 1BH2A 3UH0A 4TSKA 2QENA 2CT8A 1AX9A 2GRAA 5EI5A 4JJFA 4B2PA 2ZSFA 3FFBA 3IEXA 4D9CA 4B8WA 3A6GA 1ETHA 4IIUA 1GFSA 1N2IA 1TYZA 1O97D 4R1PA 1SIBE 2FPIB 1QDUA 3WYDA 4O2BB 2WPDD 3KTAB 4G8DA 4YUVA 5AKLA 4DT1B 3C97A 1SD1A 1V97A 3E9YA 2XQJA 2VIIA 1WF6A 4W5HA 4B44A 1C7IA 5DT9A 1OWLA 4N01A 3VI3B 4C30A 2C00A 2PGOA 3TW8B 3K1YA 1US8B 2O2XA 2YMQA 1FCJA 2VATA 4DDTA 1YZKA 4ER7A 3O93A 4UB3A 3VNAA 5AK0A 3HVIA 2ZRHA 1RRFA 5IAJA 4IQ0A 5BUQA 4C05A 4F84A 3QEMB 4KQCA 2E3TA 1EBFA 5EAIA 4QAJA 4NONA 4IGEA 3K70C 4JKYA 4XX1A 3JD1A 2Q5JA 3C6YA 4TTRA 3NHWA 4HQNA 4ZYLA 4UUQA 1NVVQ 1QR2A 4ND7A 1XLUA 2GHTA 3IPYA 3MRTA 1CY4A 3QHQA 4LZOA 2VHWA 2V5VA 5KTTA 4Y30A 4NZYA 4ZDJA 5DGCA 1V1RB 1DDIA 1MPTA 3NC1C 4U7PB 4QRDA 4TUYB 2UUPA 4M49A 3F2VA 1EIZA 4U2CA 4C4AA 1XTRA 1QIHA 1MJNA 3I6YA 5IKEA 3HEMA 2H7CA 4QZ8A 2ZYVX 3TXYA 4B4KA 3H87A 2LCFA 3PO5A 4C5BA 2DKXA 3N97B 1C4OA 5KT2A 2IYTA 1S2NA 2PJRA 1ZOSA 3AL2A 2FVXA 1A9RA 1P6UA 4DB2A 4UE3S 4O3PA 4ZC1A 3ND8A 3H2HA 1VPTA 3EZ6A 4ELTA 4RJTA 3O83A 4GBGA 1UUFA 3ORQA 2D62A 1MA7A 3JAWB 1DVRA 3L06A 4KP7A 2GN4A 4O4LB 2KN7A 1XFAA 3VPHA 1NQUA 3J80A 4WMLA 5E3JA 3BQMB 3QXCA 3T35A 4E5SA 1L5KA 3UT5B 3BCSA 1OXUA 5A5EA 5EJGA 5K8TA 1AQYA 4CEJA 1SVSA 3NIBA 3T7SA 3DMYA 3IB6A 3OY7A 1B42A 2C2WA 1NOKA 4DOAA 4L28A 3L84A 4TM8A 4M9GA 1UQRA 3P96A 5KFCA 4RFSA 5DG7A 5LQSA 3MTBA 2P9EA 1YHYA 2LBOA 5F3XB 2ZB4A 1J8DA 4DUYB 2GPBA 3DTVD 3O91A 2F8LA 2WTXA 1PDOA 4BMOB 1DXSA 1E63A 2J8ZA 2QG6A 2A0XA 2QTZA 3ZWYA 1KBZA 2NUTA 4WJKB 4U6SA 1RKUA 3TB4A 1HNZB 3RVOA 3CPSA 2R7KA 1MFPA 1SVMA 5C8DA 4YV2A 2XYQA 1XDGA 4CJXA 1K3UB 4G1MB 4DYVA 3QSGA 1OLUA 3FB1A 1TYDE 3OLWA 3NC0C 2GJKA 4UBOA 4DIFA 4QSMA 2AQKA 1SL1A 3IDSA 4Q8FA 1TU0A 1T0PA 4JBYA 4KO1S 5EYPA 4AZ0B 1UXHA 3WMWA 5A4DA 2GK4A 3LI2A 4NLBA 5DULA 3PC8A 4G5QA 4IHJA 1D2CA 1XUOA 4PC1A 4RVUA 2ZSEA 3O1IC 4F8RA 4FXOA 1WEKA 2E5WA 4KMSA 5DTIA 1KMNA 1KO4A 5FPYA 3EQZA 5KNCA 1YONA 2FY8A 1U1IA 2KNJA 2OZPA 5IANA 3DEEA 4PC2A 3TQFA 4FYPA 1B0PA 2BPGA 2IXBA 2BJHA 3CU5A 5CLGA 1M7BA 2DFDA 2WVAA 4WBNB 1A97A 1HE2A 4B48A 2HM7A 4JNKA 3P9CA 4PYRA 4X7MA 5E6SB 5ENVA 4R4JA 4W1QA 3K53A 2IDJA 3HRIA 1ZCJA 3VJMA 1CUXA 1E3EA 2F1OA 1XLTA 5JJIA 4I1OA 1JHQA 1MBZA 2UZ1B 1MABA 4RMIA 4Q82A 4MHSA 1NASA 3W1EA 3ERCA 1U99A 2VSOA 4HTAA 4BBJA 1SB9A 3ZD9A 1MIHA 5DGIA 3NOOA 1F2VA 3WLSA 1FF9A 1YOVA 3W5JA 2QARA 2G1UA 4RFLA 1TVAA 4EA9A 2PPLA 3UK6A 2BELA 4HJXA 3WP0A 2XI4A 4DEXA 4EBDA 1K1SA 4IIFA 3G0CA 1HFKA 5KQGA 1VCHA 4NXNB 3FDZB 1CRPA 1RM5A 2OESA 4X7PA 3LUAA 1DXOA 1PIWA 2ZJ8A 2Y2UA 5GONB 4BGEA 3A0RB 1SVUA 2W9BB 1JLLB 5T8KC 1F38A 4KE9A 2H5XA 1S3IA 3E8SA 1G2QA 1H8HA 3CG4A 1O2DA 1UFOA 3BXPA 2PRIA 3THXB 4KFSA 4KLCA 4IDAA 1JR4A 2A57A 3ESCA 1ACJA 2G5HB 2RHDA 1VBFA 3PFFA 3FFXA 3JD0A 2J6IA 3ANMA 1E89A 1CZHA 2JFXA 1NT2A 2QYOA 2JB9A 1BPZA 1MFZA 3IS3A 1P1FA 4Q1BA 2NZXA 1JYEA 5TB5A 4NYJR 2P5UA 2LBPA 2P6OA 1F8GA 4UUBA 1DEXA 3HUUA 4DGQA 3HVUA 2AG5A 1G21A 4MW0A 4NEQA 4QICA 3DEFA 4ARCA 3VJLA 3U7JA 2E5FA 4DL7A 2QVYX 1VKHA 1TU3A 5BR1A 3JARB 5IEJA 4DJJA 4PHAA 1UZUA 2FW9A 4RTLA 2C5LA 2A9QA 4DM7A 4Z4HA 5ERXA 1T36A 4D4GA 2QP9X 1Z4MA 2HU5A 4PHCA 4RL4A 1O5IA 3ZXSA 4C06A 4P53A 2ZCJA 1C9EA 1ZINA 3KBBA 4MB2A 3O9VA 2XKBA 4BQEA 3RT1A 2BE7A 5KFBA 5TY0A 5ALMA 2EOAA 1Z28A 5KTPA 3U1BA 1BH6A 1RBYA 1CKEA 1WCXA 4D3DA 5IDQA 4LHYA 3IEMA 4NLNA 1ZXIA 3V7JA 3BIXA 4QOGA 1J2NA 2PL5A 5J2UB 4GC5A 3K0AA 3HCAA 4E4YA 3PQ7A 1HWYA 1I1OA 1PT5A 1LTQA 3VPXA 3GUZA 4C0BA 2RHOA 2AHOB 2GS9A 1M1YE 3JQ8B 3DBRA 3IOBA 2ZYIA 2ST1A 1NJFA 3Q6NA 4Q24A 3PXXA 2AMJA 4WOJA 2PTGA 3II6X 3TYXA 5FTMA 4F4HA 3U61B 1R0CA 2NZJA 3F74A 5EWLB 3R9WA 5HRAA 4WNYA 2HMUA 4GFJA 1XQVA 1GRNA 2OILA 2P2DA 1T2FA 5HS4A 1I2MA 1SR8A 3MGBA 1N48A 1W49A 4HN4B 4MVYA 4FEAA 5C3UA 3ESQA 3N2GA 1TAUA 3V1UA 2C78A 4P4LA 4EY6A 1ZMBA 4YJ2F 1NJSA 3DE5X 2GESA 1Q7GA 1E5DA 1G3MA 1BROA 5J40A 1JGTA 1C3XA 3MTQA 4YR0A 4RPKA 1XK6A 1DBPA 1GPBA 2E9SA 2YZ2A 1CZOA 3SI7A 4C8LA 1BNPA 3WGGA 3WK4A 2XR1A 5D6OA 2FPOA 4Z0HO 4DL6A 2WF8A 1PR5A 1BD4A 2RJ3A 2BFNA 3E15A 2WM9B 3N8KA 3AGPA 1Z4IA 3WYNA 3EVZA 1AKUA 1XNHA 1HMYA 2PX4A 1RHQA 3EULA 3G89A 3AR9A 1SUIA 3INGA 1M10A 5K3CA 3GDOA 1JSRA 4O3MA 2G7ZA 3NHKA 4BO5A 2HJ9A 4W5QA 4L8FA 8ICXA 2QUJA 2AF4C 4ED1A 3RF9A 5L1JA 1D09A 5LXTA 1PR6A 4A15A 1V38A 5P8WA 4L8WB 4ZAXA 3I76A 1XALA 5TJ9A 1FVFA 1GUBA 4UB2A 5HILA 5ES4B 3RDPA 7ICUA 1W9MA 2ETVA 3L1KA 1YAJA 1PWHA 2OCPA 1UZMA 2VP3A 1C0EA 3C3DA 3N3BC 3EBPA 2X9LA 4GLXA 1AK9A 1XPJA 1V95A 2XKJE 4BZWA 4JLDA 1KMQA 4YHHB 1KQNA 4K9QA 2W6ID 3DEHA 3LPLA 3MZ0A 3R1IA 4K9MA 2VXCA 2F90A 4C3VA 4IJMA 2YB4A 5EP1A 4BX0A 2WVGA 4IBOA 1GAJA 2IRWA 5C7LO 3PSPA 2I71A 1Q3UA 4YMOA 5DYTA 1J8YF 3PU6A 4JYPA 4E1BA 5I7EA 4ARSA 3JQBC 3UAYA 3PIDA 4TURA 4F5EA 2Q5CA 2TMGA 1GL7A 4K6HA 5FKJA 5H3HA 1PJBA 2IUUA 4RYLA 3EEYA 3I9OA 3SWWA 3EIFA 1ONSA 4Z3KA 1G2OA 1HK7A 5CBPA 1B4FA 4MUAA 1Q15A 5DMHA 4Y2HA 3W2EA 1MLDA 5EJMA 3UOWA 4QQKA 1HZZA 3C5GA 5AVYA 2BPFA 1VA5A 1QYIA 4QTZA 1PQPA 4QVGA 4AC9A 4BZXA 4DN6A 1IH8A 2JATA 1GWNA 4F7DA 2R8JA 2BI7A 3N75A 1NSYA 3FGPA 4LMBA 3I2FA 2UVVA 1IIRA 4CTOA 3DBIA 3H11B 2Q0SA 4PLWA 4B4UA 4WJ3B 4QXAA 1TYEB 4IO0A 3TQTA 4ECZA 5BSUA 1Z45A 3CUEF 4HWKA 2XRFA 3Q0IA 3VSCA 2V4ZA 1U80A 2WA1A 2AFHA 1PD0A 4BP9A 3P97A 1DELA 1OC2A 4C4YA 4KPUA 3RAEC 3ZGZA 5JCZA 3RC7A 1A8IA 5A06A 3SR4A 4JI8B 3UWMA 2OHJA 3PEEA 4WV3A 2NGRA 5EKDA 4U3JA 2JJ1A 2WA2A 3NVDA 4NK5A 3SC4A 3ZLTA 3ICWA 1L8QA 3F73A 3WGLA 1XQXA 4ODIA 3WL8A 5K5EA 2GHQA 4QW8A 2RDIA 4WEOA 1VYTA 3GLIE 2OAQ1 4OI4A 2DWQA 1N5KA 1FYWA 4CN9A 3G5TA 1J2RA 1U4OA 3FXAA 4NZ9A 3V1NA 2OD2A 3DKVA 2Q5EA 3DEJA 3WX0A 1OZFA 2FPGB 3GUUA 2E87A 3GEGA 3VFDA 1SVLA 3L0OA 4U6NA 1PL6A 1KK1A 2F59A 2XAUA 1J0BA 2FFQA 3OZEA 5FJJA 4D4IA 4K4HA 2X8WA 4X6UA 2C2RA 1L3IA 2P9CA 4J7XA 3F4KA 2EZYA 4O5OA 1EGMB 2C92A 1UCFA 3O75A 4N12A 2FPIA 3A4LA 5K99A 2QR5A 4O2BA 2XUIA 1F3LA 3KHLA 1XSNA 4UPVA 5DM70 4DT1A 2ZM6B 4ZAGA 1QK3A 2QRNA 2RD2A 3WNCA 1X6IA 4BNYA 1XSLA 3GDHA 2QSJA 3EZFA 2C2MA 3RGWS 3KAKA 2Z2XA 3QLVA 4P32A 3TW8A 3DAYA 4LSWA 3OQPA 2W90A 3OJUA 1UJCA 4N5DA 4K05A 4TTTS 2VPYA 4O02B 3HA2A 1HX7A 2II6A 1OBCA 1SC3A 1DKOA 1VMKA 3E9ZA 4DPKA 3LNTA 2BBTA 3GA5A 2OQRA 1U5CA 5DLQC 5DPMA 1JDUA 4YAEA 4FOLA 4B79A 3DZJA 4U02A 4ED7A 1HDZA 2G9QA 3Q98A 1RM6C 4MVJE 5KFGA 1G4HA 2J5KA 1R9NA 1OWPA 1JQKA 1CRLA 1WXGA 4JI7B 2Q1XA 5DBIA 3B6KA 4F4WA 5MHTA 3T5CA 5AW5A 1EFKA 5JYDA 3CF4G 1V1RA 4FYIA 5HFJA 4ALJA 2FX5A 1ICIA 4ED0A 4TUYA 2GDJA 3AI7A 3R7WA 3PDWA 4CTJA 4I2GA 2H1SA 3FJYA 4GXQA 1U9JA 3Q9UA 3AHFA 4CL8A 5F5NA 1SV0C 2WV7A 3H1GA 4GPIB 4FD3A 2CXTA 3PIIA 1EXWA 4QSHA 1MX3A 4MMZB 1KMHB 4ZGBA 1EWYA 2PBFA 5JDCC 4QUBA 5A2QA 4DV5B 3M4YA 1G55A 5KHAA 3IO5A 4K9KA 3HA7A 3P9PA 4UU1A 3ASVA 4G5XA 4EB3A 1WMEA 3JAWA 4NMMA 4DLLA 1DHRA 4PW0A 3RIXA 4CF3A 3IE1A 3BWBA 4YRSA 4ZOCA 1ZUHA 1RYNA 1KXJA 2ANCA 4HQ6A 3FGNA 1DGSA 3E58A 4J9KA 1AO3A 2ZRLA 3UT5A 1JFFA 5KWEA 3L0BA 3VO9A 3CLRD 3OOWA 2HA7A 4RKRA 1GQYA 1ZGHA 1CBUA 1GYPA 1JXOA 2QJRA 4HI0E 3C70A 3ABRB 3K70B 2A5DA 1FMJA 2FW8A 3NVWA 4LZDA 2A9KA 1PX2A 1PK3A 4OVKA 5KTSA 4R41A 2JS7A 1GYRA 2QRMA 4E6PA 3P8ZA 5EE3A 2ACEA 2AGVA 7ICSA 2EZ8A 1DMRA 4L74A 2O0MA 4LQLA 2XRYA 1GU7A 2DR2A 2BMEA 3QJ5A 4CR6A 4IR1A 4L4RA 2H2HA 3ZJTA 1GARA 3WQHA 4FNOA 5JJBA 4ECEA 1T10A 1ZCAA 3N6RA 1R8JA 4DWVA 4D3XA 3RR7A 4TS3A 4EF5A 1P0QA 4B5KA 3LZ6A 1ZESA 2YRFA 3KDPA 3I1JA 1N33B 3ZK9A 2JD1A 3OKPA 3NWPA 5ICGA 1R6DA 4C8MA 7GPBA 4M6WB 3DOHA 2PMBA 3SOPA 3TOVA 1UDWA 3IIIA 1QAMA 5JXHA 1IXZA 4AZ0A 1OQAA 1JHXA 1FB5A 2BGRA 1RMYA 1NIPA 2HHVA 2ZUFA 2NXJA 5J58A 4DKJA 2EH9A 1BMQA 1V8FA 1UM9B 3DVLA 5BMVA 2HKIA 3UFBA 1JJBA 3K92A 1Z4PX 3C23A 3ZV5A 1Q44A 2J3JA 1MO2A 3V4RA 1NLFA 1PGPA 2YQZA 1PN3A 4YRGA 5KG3A 4C0KA 2B4KA 4ECSA 4Q7MB 2AQ8A 2Z6VA 4H7FA 4DL5A 4R6WA 4OLAA 1FVHA 1N6PA 8ICYA 3D6VA 1IWOA 3ZIAA 4XDZA 4DSEA 5IJZA 4WBNA 4I81A 2E8NA 3PGA1 5E6SA 3D3WA 3DF7A 4OHKA 3DR3A 2W22A 1RW4A 1Y5MA 2WI8A 4UBJA 4A2WA 2X8AA 3AB7A 4L51A 3FY4A 3L7LA 3OM0A 1UPAA 5FTJA 2IP4A 3HXQA 3DG9A 1BO6A 4QRHA 2RIPA 5P21A 3J81A 3MM4A 4OI1A 2EHJA 5K6AA 2CLIB 4ZMRA 3HJNA 3H2JA 5KYYA 1HE3A 3OZRA 1NSTA 4YPFA 4D0GA 3EPGA 3RODA 1COWA 3MWDB 3EE6A 3FDZA 4BKPA 4HYQA 3UXHA 1QTRA 2NVBA 3T3IA 5GONA 3FDIA 5HG0A 2CMFA 2W9BA 1OTXA 4JCCA 4A27A 3WYGA 3WKEA 2XTNA 5TQVA 3UF0A 3WLAA 1YZVA 1YRBA 3THXA 3FRJA 3PUHA 2HEGA 3WAGA 3UGQA 1FY2A 2Z04A 3MW8A 2PFPA 5IF9A 4FT4A 3FLMA 4CDMA 5AW0A 2Y2VA 1WABA 4MQ5A 4MYRA 3K0BA 2E1FA 4BB0A 1NK0A 2HHCA 4K3VA 1PR4A 2PKWA 4QNRA 1TCBA 4RWZA 1U8CB 3T7JA 2O5CA 1UAYA 3JWJA 1KYZA 1JXLA 1VL8A 1MAUA 2YDYA 5AVXA 4E32A 1RPAA 3CR8A 1UFQA 2XODA 1QDEA 4JWKA 2Y4OA 4O29A 1OR8A 2BD0A 5DEIA 4UHDA 1DKMA 3T95A 3JARA 3AVWA 1E6EA 1WOMA 1J22A 2B8WA 1VLMA 4I4TA 2A9JA 4FDUA 1FX1A 1KI2A 3FJOA 3IAS6 1TZJA 1N5MA 3FZQA 3KUDA 4EARA 4RH0A 1XTTA 4FMDF 2XTMA 5DH9A 1UFVA 5CVDA 3QGMA 3OZFA 1PQUA 4RBNA 1T0JB 1NN1A 4PANA 2XGJA 4EP1A 3QF4B 5F5LA 3RTDA 4KMUA 4Z9YA 1KP2A 3OLYA 2HU2A 2B69A 2J30A 4N18A 3CVUA 5IN5A 3L1HA 2P79A 1IWBB 4URHA 1MPXA 2OZLA 3LQ1A 3AP2A 4B85A 4EG1A 2WHYA 1XP8A 3VDQA 2FAXA 1JI3A 2CMKA 3VHXB 4LF4B 2IPLA 1U2DA 4UUPA 2WAQC 3C6KA 1XU7A 2H51A 3VTAA 4HDMA 5FD8A 4B46A 2AHOA 2XSZD 3JQ8A 4K9OA 3QUSA 3JD4A 4H1UA 1L4HA 1OPXA 4H7JA 4RLQA 5JHHB 2E55A 1E7YA 4JX8A 1RYEA 1T8EA 2PUTA 1K6JA 3EXHC 3F7NA 5EWLA 4QUGA 1SCUB 4L0MA 4QO8A 1E59A 1E8NA 2P9ZA 4Q7KA 2NVWA 1O87A 4RTPA 1ODCA 1UKEA 3PCTA 3BGVA 2QIOA 4X9XA 4MW9A 3HFRA 1B14A 2XCQA 1UBRS 2R1UA 3KKAA 1J8FA 4WN9B 3FIUA 3DE3X 4AS2A 4D4LA 4LBVA 5BW6B 1XI2A 3IQHX 7YASA 3RK1A 1SEVA 5IM4F 2ZB7A 5KCZA 3A1CA 7ABPA 1BS1A 4Q66C 5BNFA 4RVCA 3T5LA 4TRRA 3R3UA 4AUEA 3IOYA 3MG9A 3FLAA 2HLDD 3R5KA 4M4SA 3PJGA 2JEZA 2BDTA 4FHEA 2NO0A 4F5PA 2XMPA 2YFHA 1Q57A 2RLTA 3NHUA 3QBEA 4I3HA 1MC4A 4AKIA 3FFAA 2R25B 3F9RA 1C0LA 3A3OA 3CZCA 4IUYA 5J0QA 4OMFG 4AKSA 1RLIA 2LD4A 3SQIA 3SZRA 3NP7A 2JARA 1YA4A 3BKXA 3EB9A 1JPVA 5HNKA 4GR5A 1RZRD 3PJDA 3OE1A 3JYOA 3OEYA 3NBQA 4C7BA 3DWGA 4IXDA 4L75A 5DDMA 2RHJA 3IKJA 2BWJA 1QIKA 4EI9A 2HR1A 4V2IA 2ZJ5A 2JCXA 3VPBA 5K8IA 3HKDB 1SBIA 4QECA 2QYHA 4OTZA 9ICKA 3QLUC 4TL7A 3IL2A 3HWRA 3BB3A 5JSHA 1QGED 4OAPA 5FHQA 4JLMA 3HEAA 2YS7A 4I55F 5JZVA 2E8MA 3O1JC 1BHSA 1VJRA 4RANA 3X2EA 5LU9A 3NDBB 3M7IA 4QATA 3ROPA 4R3WA 4KTQA 2AJ8A 3D2LA 2C2XA 2QORA 3OEEA 4REMA 1WCIB 3OZBA 3Q6MA 2BCQA 3BERA 1IN1A 2X77A 5B12A 3AKZA 5IHPA 4Q7LA 2B35A 2HNBA 3T5JA 1ZJNA 3C8DA 1PFQA 5JATA 5CIQA 3PXBA 3UPDA 2HRDA 2PR7A 2IPMA 1R0BA 4NVRA 3DMNA 3LF2A 4ZN6A 3DMFA 3VR5D 4EY4A 2UYYA 1U0GA 1KAEA 5CB1A 3RWBA 2HDOA 2R66A 1VRCA 1J56A 1DRJA 4B33A 4DA8A 3FNRA 4BFLA 5FBKA 1LVGA 2FHPA 4DS4A 5JZBA 4JJ4A 4HDSB 2W6PA 2YVLA 4AN1A 3B9JA 1GCOA 4AF6A 1X9IA 4ETNA 5CXUA 3CLKA 4TUSA 4AWXA 1E0SA 3G2LA 1K7FB 1UXJA 4LFCB 1KH3A 4BLVA 1EX1A 1P1RA 3T7RA 2UYCA 2VOJA 1ZQUA 1Y98A 2ZYTX 4L72A 1QSSA 2CFCA 1OIWA 4B71A 3H11A 1DKRA 3AMZA 1LPPA 1TO1E 1OXJA 4HEA1 4P8RA 5FUBA 4LJ4A 3MWYW 4ZU3A 2MJLA 4I5EA 4QZIA 1EZ1A 2R6AA 4J0EA 1KI7A 2MWMA 2C2EA 1U8YA 3RNOA 3RB8A 1XRRA 3CYFA 3QVSA 2NO1A 2VZLA 3HJTA 4D8TA 4OXIA 1H3NA 2BGWA 3UHJA 2NO4A 2YMMA 1C7RA 4IO1A 3QIVA 1TTQB 1C9MA 5E9QA 1F60A 1J97A 4ZCRA 3K6JA 5HHIA 2JA2A 4PF1A 5ECDA 3W2FA 3FSGA 1ZQCA 1VL0A 2PBZA 4JI1B 3DDHA 2OLJA 5AW4A 1ZC3A 5FLEX 3PJEA 2P4QA 2DUWA 2LTAA 1R18A 2AV6A 3D0KA 3MIZA 2AMFA 4EELA 3R09A 1L5HA 1N2XA 4YRCA 2BGNA 4B40A 4L0QA