1O08A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 1-phosphate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-phosphoglucomutase
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o08A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o08A01
1F5SA 1L6RA 4BEVA 4Y2VA 3S6JA 2G1AA 3SHQA 2HI0A 3I76A 2ZOSA 3UMBA 2C88A 4F72A 3R09A 4B6JA 2RBKA 1Z4IA 3ESRA 2I6XA 4HAIA 1O03A 5ALSA 3SKXA 2HCFA 3DDHA 3PGLA 2B1RA 4H1WA 3L0YA 5AKZA 4XOUA 3NASA 5ALMA 2IOHA 5AESA 4ZEWA 2BDUA 4G63A 4QQFA 3QUTA 5AIBA 3MC1A 2ZBFA 2R8YA 3E84A 1YMQA 3M1YA 2GFHA 4E88A 4BX0A 2G08A 2W11A 1RDFA 3SLRA 4NWIA 3OCXA 3MPOA 3KZXA 2YMMA 1NF2A 1SU4A 3WKBA 3AR9A 1J8DA 5IS2A 2YMLA 3L7YA 5ALVA 2X4DA 2O2XA 4C4SA 1NNLA 2I7DA 1K1EA 5ALEA 1TE2A 2JGAA 1TJ5A 4UASA 3RF6A 1LVHA 2W43A 3QXGA 5AW0A 5AI6A 1N8NA 3OCUA 1YNSA 3F9RA 3AR3A 4UW9A 3QGMA 3U7FB 4UATA 3L5KA 4Y2RA 5AM0A 3FGOA 4UMDA 4Y2XA 2FPXA 5A3QA 5AW8A 2FPUA 4UMVA 3UM9A 3ZU6A 4YCLA 2AGVA 3SMVA 5AI4A 4HGNA 2HO4A 2OBBA 1ZRMA 2HOQA 3NALA 1WPGA 4EX6A 2JAUA 4UU0A 1N9KA 1VFPA 2MU2A 4G9BA 3TLMA 3ZW7A 4AP9A 3QYPA 4Y2YA 1Z5GA 4EEKA 3IB6A 3ZX5A 5AW2A 3WGVA 1L7OA 4EELA 1U2TA 3FPBA 2G0AA 1RLMA 2RAVA 2NO5A 5ALNA 1RRCA 4UM5A 1XPJA 4ZEVA 2IA5A 5AVUA 5AVTA 4L57A 5AKKA 4O8CA 4XQ0A 3OCVA 1LTQA 4NV0A 3UMCA 4DWOA 4HGQA 4MUMA 1QYIA 3D6JA 2HEGA 2EAUA 1X42A 3L0CA 1AQ6A 4UMFA 4BX3A 3QLEA 2RARA 4I9FA 1EK1A 3WK9A 3ET5A 3L8HA 5AVYA 5ALGA 5AK5A 5ALJA 1Z4NA 2Q4RA 3AR7A 5ALFA 3CZ4A 1PW5A 1Q91A 2GHTA 4BYGA 1EK2A 1YDFA 5ALYA 1ZRNA 4UAUA 3ONNA 3A1EA 4Y2TA 2OM6A 3B8EA 3KDPA 2B8JA 2C8KA 2YMQA 2ZBEA 5IT0A 3U19A 3CNHA 4CNQA 5AKLA 2C9MA 2YY6A 4UARA 3B9BA 5ALHA 2IOFK 2YJ3A 4CF4A 2MU1A 3ZVLA 2PKEA 1Z5UA 3KD3A 2WFAA 5ALRA 2R8XA 1MH9A 5AK6A 2O9JA 3WK5A 2MSNA 2C8LA 5ALWA 1T5SA 2FDRA 1ZJJA 1Z4LA 4JDPA 1QQ7A 2AUTA 5AW1A 3QUCA 2GMWA 5AVSA 4XE5A 5AKEA 3AR4A 3ZTYA 2OA0A 5ALPA 1Z4PX 1QH9A 2B8EA 4EENA 2GO7A 3HYCA 4XPZA 1YS9A 1L8OA 3L0BA 5AM2A 3BA6A 1JUDA 2W4MA 4YCMA 4AS2A 2CFTA 4NABA 1YV9A 2JARA 2ZBDA 4Y3UA 4KYTA 3QU5A 5ALQA 2YFYA 3NANA 4J2TA 3AR8A 4FFDA 2ZBGA 3SKYA 2IOFA 4C4TA 3FVVA 4HYTA 2BY4A 3R4CA 4Y2PA 2FEAA 4KNWA 3U7HB 5AVWA 2FUEA 5AK4A 3WK8A 1TA0A 5AK3A 1RKVA 5ALTA 4YGYA 4OFZA 2JAWA 2PQ0A 3I28A 5A3RA 1SWWA 2I54A 4FYPA 2DQSA 4Y2UA 3OTQA 3ET4A 3DNPA 3PCTA 3KBBA 5AW4A 5A3SA 3AR5A 3EWIA 5AM4A 3U26A 3A1CA 3PGVA 4OHFA 5AW5A 3WKEA 1Z4JA 3NUQA 2ZXEA 5AVQA 4HGOA 4JB3A 4UAVA 3L1VA 4CE6A 2NO4A 2IYEA 1L8LA 1U2SA 4Y2JA 3ZTWA 1Z88A 4I9GA 3OCZA 4CF5A 3OPXA 2HSZA 1U7PA 2C4NA 3ZVNA 2YMPA 3ZWKA 3ZI4A 3QU9A 3MN1A 3VAYA 2P27A 5AKJA 1QQ6A 1T5TA 2FPRA 3N07A 4FE3A 3W5DA 2D2VA 1XVIA 3OCWA 1Z4QA 2R8EA 3N1UA 4OCZA 2B0CA 2FPSA 3PDWA 3KOOA 4UMEA 4BNDA 5AI9A 5ALZA 2FI1A 3QUQA 4L6AA 1O08A 5ALIA 2YJ6A 2AH5A 4RESA 3NIWA 2WF9A 2OYCA 1S8OA 1TJ4A 2I33A 2Q5EA 4UU1A 3WKAA 2ZG6A 1ZD4A 1ZD2P 4DW8A 3U7GA 3QUBA 2YBDA 3SD7A 5FP0A 5AM3A 1NRWA 1VJ5A 4J03A 1KYTA 1ZOLA 2G09A 3W5CA 2WHEA 3DV9A 1ZS9A 3FZQA 1WR8A 5E0OA 1QQ5A 4HGRA 3QU2A 3WK6A 1CQZA 1WZCA 3NAMA 2I55A 3OCYA 3ZX4A 4BEWA 2NYVA 4Y2SA 4GIBA 1RPZA 5AW7A 3QX7A 3WGUA 1SWVA 2EARA 4YIKA 4YIHA 1J97A 3L8GA 2G07A 5AVXA 4EZEA 2RB5A 2WM8A 4HGPA 5AI0A 3FPSA 2HDOA 2BDEA 4KN8A 1L7PA 2YN4A 3IJ5A 2I34A 4ZEXA 2EATA 2B1QA 3BWVA 2WF5A 1RKUA 1RC8A 2G06A 3FM9A 4F71A 4Y2QA 2ODAA 2P11A 3N28A 5T41A 4NFLA 3IRUA 3WKCA 3EF1A 5ALKA 3WK4A 4PNHA 5AKYA 5AKIA 1CR6A 2JAOA 5AW3A 4L6CA 3QNMA 4CF3A 4MWOA 1S2OA 3MMZA 3ED5A 2FUCA 3QU4A 1Y8AA 3R9KA 3L8EA 4RETA 1RLTA 2WF8A 3B9RA 5AVRA 2P69A 3N5KA 1VJRA 1Z4KA 3DAOA 3E81A 5AVZA 3ZUPA 2QYHA 3N8GA 1WVIA 4DCCA 1Z4OA 2CFSA 5AW9A 3WKDA 1ZD5A 5AHXA 5AM5A 5AICA 3HLTA 4DFDA 3QU7A 2Q4TA 4YCNA 3NRJA 1Z4MA 2YJ5A 4OD0A 1RMQA 4BX2A 5ALUA 1L7MA 2FPWA 4KX3A 5AI5A 3U13A 3I6BA 3W5AA 2B30A 3RFUA 1FEZA 4C4RA 5AKHA 1RQNA 3WK7A 4NAVA 1Q92A 3GYGA 2HHLA 5AW6A 3AR6A 3I1YA 3ZWDA 1ZD3A 4KX5A 1T9ZA 3UMGA 2CN1A 4BBJA 2CFRA 1TJ3A 2PR7A 3SF0A 2R8ZA 1YJ5A 3W5BA 3J7TA 1U02A 2B82A 2HF2A 1RMTA 5ALLA 2YJ4A 4IG4A 5AKGA 1L7NA 3K1ZA 1RQLA 4EX7A 1XP5A 3A3YA 4GXTA 5AI8A 1IWOA 2AMYA 4BNDB 4UM7A 2VKQA 4YH1A 3L1UA 3KC2A 4AS3A 3M9LA 5AVVA 1U7OA 1RKQA 3E58A 2G80A 2QLTA 5JJBA 4KNVA 3EF0A 3A1DA 5ALDA 3E8MA 3P96A 2HX1A 5IT4A 1RLOA 4IFTA 3AR2A 2P9JA 3ESQA 5AIAA 5AKXA 3U7EB 5ALXA 3EPRA 2WF6A 3ZVMA 3L8FA 4QJBA 5AM1A 5ALOA 2HF7A 2WF7A 2GHQA 4BKMA 1RMYA
chains in the Genus database with same CATH superfamily
3WBBA 4J0FA 2VI5A 1SFRA 5FHRA 1W85B 1DGSA 5SY4A 3SKXA 2KKPA 4MPJA 2XYHA 3T99A 5ALMA 1W5TA 4DXHA 5K1ZA 4U3JA 1RRGA 3HVUA 1SG6A 4TKUA 2R1VB 1NAIA 5J23A 2HADA 3UUGA 3GD5A 2H4HA 4DF8A 4J7AA 1P61B 4G5QA 1WMFA 4FT4A 3O5AA 4PLCA 1CJBA 1JG4A 1SUDA 1UJMA 3MCWA 2QU8A 1Y5NA 1FSGA 1HYGA 3HBFA 5GJWC 3EPIA 4HZUB 5CFLA 3QYPA 2GEFA 3PVXA 3ZCXA 5HMMA 1OAAA 3IG5A 2Y71A 4R9RA 1IIRA 2A0UA 2QN1A 3E9EA 3D6JA 1YRYE 1A77A 1WULS 4PBTA 3ET5A 1QIJA 2WIGA 1M5UA 1QZZA 3I39X 2EANA 2OGZA 2IXBA 3FFBA 1C1HA 2YHBA 1T2UA 1BPDA 5D01A 2HA4A 1EBUA 2ZR9A 1HZZA 1YCHA 4RVSA 1SGWA 2OM6A 8ICVA 2P6MA 3PXBA 1YBFA 3P0FA 1J8MF 1NYQA 4JV0A 2IE0A 2RGRA 3ML1A 1KMNA 3SJ7A 1UBJS 3PQ7A 4UD6A 4K6MA 4AU1A 3TLKA 3NPMA 1MC5A 5JQGB 4X71A 1H9BA 5JI2E 3HKEA 1QB7A 2BPFA 4Q12A 3AVQA 5F5NA 2JANA 3GUYA 4BUJA 1E0AA 1VSTA 4PC6A 4QXOA 2PT7A 1DUSA 2ACEA 2ZBDA 2ECKA 4TTQA 2IOFA 5BWMA 3G8DA 1T9GR 1TLLA 1SXEA 4G4GA 1V1JA 1EJ2A 4OEHA 4MZXA 1CY4A 2ZAYA 4H9GA 4M98A 3E82A 4G5XA 1MC1A 3KX2A 3C2QA 4DSNA 4WNCA 1G9SA 4OBXA 4UUPA 5CCEA 1P19A 3BSFA 1I14A 2ONZA 5FD8A 1HE8B 2V03A 3ZU3A 1A8PA 2RK6A 2GF9A 4O4IA 2RAPA 2HSZA 4DANA 1XCJA 1NFRA 2Z2KA 1PGQA 1ZCAA 1G20E 1D2EA 4PIMA 1Z4QA 2FPSA 2PXXA 3B6KA 4K4GA 2PI5A 3DDNA 2JFUA 3OT1B 2G9UA 1WUJS 4G36A 3H2GA 5JY1A 1KWGA 2ATXA 5LIRA 2WF9A 5GGXA 1N3YA 5I9MA 3SD7A 1EG7A 4PZCA 2LZ0A 5EIHA 1LV5A 1KXZA 1B4DA 1YOVB 3RVPA 2H1RA 1I6LA 2Q9AA 3PX4A 1L1EA 4DXAA 4QPNA 4LGYA 2B6HA 2QTHA 5EIEA 3TQTA 4AKEA 3QG5A 3QWHA 1BMDA 1FMCA 2XUAA 4HL6A 1NG1A 1XMXA 5KFZA 4JBNA 3UPDA 1E92A 5GP1A 4PLPA 1GU0A 2OAQ1 4ZEMA 3OJFA 5CURA 3GRRA 1UKVY 4CIDA 2V7EA 1N1DA 1JJBA 2DPGA 1GTG1 1L1FA 1NKCA 1ZJ6A 1BEEA 4O2AF 2YVKA 3A3NA 4E33A 5DO9A 2J85A 2R7NA 2P0EA 1KI9A 1GKKA 5A7HA 4BE4A 2R6JA 2P6RA 2XVXA 4KX5A 5DDIP 1W35A 4N3CA 2I91A 5FNZA 1LFDB 5BMVA 4AJ2A 1P9RA 4LDZA 3ZZUA 4M9HA 1VPWA 1BE0A 4TWIA 4EUEA 5I47A 1ZKMA 2WMNB 3PDIB 1M66A 4OA8A 4I2NA 5BQ5A 1VLHA 4MUIA 2QR2A 5AD1A 2BI8A 4YXFA 2X9QA 1UBMS 1AC5A 5C8DA 3ZY4A 1Z5ZA 5DBAA 3FH0A 2XUIA 2XXAB 5FBZA 1O95A 1NZBA 2CJWA 4PF1A 4AL4A 3VH4A 3A05A 3N2LA 1SXJB 1ABFA 3EDCA 2R8YA 3DMPA 2UDPA 3DM5A 3KT3A 5CLLA 1E61A 1YJCA 3NOQA 4NS4A 4BPRA 1G7SA 1ZM3A 2PFPA 2I6UA 5KU1A 2FPUA 2ZB3A 4E09A 3E9MA 2W6NA 1H4QA 3RBVA 1WVGA 5A0VA 4WDRA 2OZKA 3WXBA 1WWKA 1SK8A 2GHIA 3A3KA 4DR7B 1ECLA 5AVUA 1VB3A 4QBKA 5F2OA 5JY6A 3DZDA 2WWWA 3BSSA 4G4JA 1E2KA 2Q6OA 1Z4NA 1TVAA 2ZXUA 3JD3A 1TMOA 1JIUA 2I7VA 5C51B 2BP7A 3OESA 5DGCA 2A1IA 4UAUA 3TG8A 4X1YB 2DL0A 5JISA 1SVLA 4A03A 3L84A 1JQ3A 4UHEA 5B1HA 1WF3A 5CJJA 4PG8A 2DPHA 4HNAA 2YJ3A 4TUQA 1H2FA 4L07A 1ETHA 4K6OA 5ALRA 2W4IA 2QR3A 3KUUA 5HIJA 4MUAA 4JP1A 4CUZA 3PNPA 2CXQA 4CFSA 4ITUA 3NVVA 2O06A 3RB8A 3EGDA 1GADO 5CLGA 3WQHA 4TYQA 3GH3A 4RTJA 4AI6A 3LS2A 3BERA 4XQEA 2PVCA 5FDFA 1OJ7A 5BW4A 2IQ5A 1JN0A 2BCSA 5A4DA 1V37A 3VOAA 2WILA 3CLVA 1EFPB 4RQBA 3UAWA 3BDPA 3OZIA 3A6ZA 3GFPA 2OCBA 4WLVA 4M47A 4L73A 2A57A 1KN5A 1Z26A 4RPGA 4A36A 1KMCA 1KDPA 1YS6A 3RYHA 3ONWA 4MICA 5A03A 2JRLA 3THRA 1UOQA 4G3XA 4LRTB 1E2IA 5FYQA 2QBYA 3A36A 3OJLA 3EXIB 4CKEA 1MIHA 1Q14A 2AMFA 3EH2A 4AJ9A 1H3NA 2ZSFA 3AUJB 2DHCA 2Q3LA 4C30A 2PH3A 3S4YA 5A9SB 4DZTA 4F11A 3RVJA 3E4DA 4H7HA 3K9WA 2GRJA 3OCYA 4INAA 2P2CA 1MENA 4PM4A 4NY8A 1E69A 3DE5X 2QP9X 5AVXA 1GYPA 2DP4E 4HGPA 4X44A 4RPJA 1FY2A 1RWVA 2G1PA 3BWVA 1DC6A 1EUZA 3P27A 1DWOA 1CS4C 4YQEA 3OQBA 4IX9A 4RHYA 3DMRA 4QPJC 4ADSG 2HBMA 2VPQA 1JWBB 4OH1A 3QWBA 2VYNA 3GEMA 5JTUA 4IMIB 1RYBA 2ZI7A 3NKFA 5CT4A 4M04A 4MPRA 2J5RA 3GLHB 4RQMA 3B3JA 3TZCA 1M1XB 1NVGA 2KSOA 3NUGA 4BC1A 2XB2A 1H38A 3EDOA 1EKXA 4IFIA 4G01B 5F23A 1YQQA 1QYWA 3G0BA 4G3IA 3GI1A 3F8SA 4UEOA 2EP7A 4WD3A 3BGOS 1QORA 4DIMA 1OYWA 2I3AA 1VG1A 4LQLA 3DMHA 3A3YA 4P34A 4ONEA 4OHPA 3KC2A 2YB4A 1WCIA 5LYJA 4E13A 2RIRA 4V1CI 5AM1A 3H0EA 1NP7A 3PQDA 5BPFA 1A8HA 2GHQA 3AUFA 4HZGA 2GPAA 3EVFA 4DA7A 3UF0A 3ZCSA 4IHQA 3D3NA 3LH5A 4L7VA 4E3WA 2E6KA 4PG5A 3GZFA 3IGFA 2QVGA 3VNBA 4G0ZA 3ADPA 4UVIA 1G66A 3V4FA 4HLCA 3JYLA 2WA1A 4D5EA 5G1PA 4MVJF 4DADA 5JCJA 4RNNA 8ICBA 3VDRA 4P5EA 4XJSA 2JFOA 4EG8A 3FCXA 3DONA 4RKYA 2IWHA 2WHYA 1OXBB 1U0JA 1AJEA 5BV8A 3GRFA 3N2EA 4Z8YA 1LI4A 3CVXA 5HSGA 2ZM6B 4N1AA 3P32A 2ZWIA 4PN7A 3ER9A 1Z5GA 2J3QA 4AICA 1DI0A 4N0QA 1J1ZA 5KVVA 3ZWQA 2FPGB 3GEBA 4QXPA 2YWDA 3O8OA 5EL0A 3ZZ0A 1ZQXA 2L17A 1B43A 1VBMA 3WK9A 2BZ1A 2O19A 2ZCJA 2QGFA 4RK6A 2VO1A 5LZ8A 4LSZA 4AKIA 2A5YB 3V72A 3IHLA 3RS9A 3WAJA 1WZEA 1U98A 3HCBA 2K2QB 2FPPA 2H1HA 3KTQA 4J9VA 1HDRA 4O4HF 3U60B 3KLPX 3ETNA 3NRWA 4J4HA 3VDMA 4XD7D 2WFAA 4JT9A 4URFA 2VOEA 1OV4A 2PS9A 4QM6A 1RT9A 4HDSA 4IJ6A 4UAWA 2QW8A 3T5PA 4ZYLA 1WS6A 4KAJA 1T0PA 5LFAA 1TU3A 4F6CA 4TL9A 3MBKA 4TURA 2BKLA 2Y1IA 3B78A 1EE9A 4MEAA 1C0LA 5HF5A 4IGIA 2EJWA 4QJ5A 2DWOA 3W9SA 3KFLA 3BS7A 3PHHA 2JL1A 2ZUFA 5J2KA 2PSJA 3PK0A 3L4KA 2W2TA 3L8DA 1Z6GA 1XTVA 3CQ9A 4PXYA 1BHSA 1QGUB 1I2DA 4CL8A 3NT4A 1F7UA 2R60A 2QRKA 2C4NA 2ZTCA 5AH0A 2C9OA 4F04A 1HUZA 1CUEA 4QSHA 3BFXA 1EJ0A 5ECWA 1VHQA 3HJFA 2YV2A 4TTRA 1KZYC 2C3MA 3P5BA 4GI5A 4YUWA 2H3QA 5EGSA 4F6LA 3MIIA 2A86A 5KFOA 1ADYA 3O74A 3E9QA 2HRDA 3OZFA 4DNPA 5D86A 2PWYA 1R74A 3LYSA 4W5HA 3L2OB 3B1VA 5AHOA 3T94A 2P1DA 3U7IA 2B21A 2CXXA 3PC2A 3L92A 5CITA 1ZOOA 1PVRA 1SURA 1ECBA 2H08A 4OHKA 1U0GA 1B8UA 5G1NA 1NR1A 3VZQA 4W5RA 2GARA 4O4LF 5L1LA 4EBDA 5AW3A 1A9QA 2WABA 2WUFA 2CXUA 2P69A 2DETA 4LNAA 5CT8A 5E1BA 1N8KA 1MJHA 4H15A 4CL3A 4M2YA 3HKDA 2ISCA 4OJNA 1GTSA 4D96A 1IY2A 2OLEA 1OWLA 4NECA 3OSPA 4NLKA 1K6XA 2IGTA 2XNCA 4ECVA 1YKSA 4JMPA 4OHZA 4YEDA 3G17A 1ZONA 2PZMA 3EYAA 4O5EA 1JWLA 1YACA 1XA0A 3JYNA 3JQDA 4M49A 1FMJA 5JNUA 4OUDB 4Z53A 1NI4B 2X0KA 3FI9A 5JJKA 2GPJA 4HDRA 13PKA 2G80A 5AJHA 1B16A 4U7PB 2VQFB 4RABA 3EPGA 4AWAA 3GLFE 1WMDA 2GEKA 5CU7A 3T95A 2AN1A 4D3FA 4N9WA 3KQLA 2UYGA 3WYGA 1PAUA 3LWBA 2EZZA 4OFWA 5EJMA 4ZTUB 1OLOA 2W6JD 4GM0A 1ADBA 1YTLA 3NNDA 4RMHA 1I7PA 1L7EA 2V0NA 1SBTA 1UT6A 2PZAA 4KHPB 5FLKA 1WB6A 1P2UA 5E0KB 5FUQA 1OTHA 1NJXA 2J59A 3CGWA 5BWCA 1KPIA 4ZTZB 5DLYA 3AXSA 4Z4EA 1RZTA 3OCXA 2EJCA 4MMYB 1V9LA 1T0BA 5HIIA 1NUTA 2FZEA 2V6IA 5CX4A 1TJ5A 2WTBA 3KFUF 3G9TA 1E9FA 3O9MA 1U0TA 4IIXA 1FZQA 3C70A 3QJGA 3OT4A 3AXTA 1W4RA 4FTWA 4YJ2A 2V3VA 5KSPA 3ZX5A 4DL4A 3KJZA 3PFKA 1AKTA 1UDBA 4ZZ1A 3HW8A 3ND9A 2DR2A 3RS0A 3QMMA 4FW9A 1M6VA 1L8XA 3TDMA 4OGGA 3I58A 2EKBA 5DW3A 5DHPA 2HU2A 3G8CA 4DG9A 4GP6A 4KLQA 3RC3A 3UJHA 1ZICA 3VV3A 3D0QA 4WN3A 4ACBA 3RSSA 4BVJA 3PE6A 3DZKA 3DL4A 4K9KA 3V7NA 2GA9A 5JE8A 2HBLA 1GGKA 1E2MA 2PKEA 4ARZB 5BVGB 3EUFA 1CWUA 4WKCA 2ZJZA 2FMQA 4NI5A 2NU9A 4AROA 3F5AA 1BVYF 1PLKA 4BLUA 1WXDA 4J1TA 2B8EA 3ZCPA 3TYXA 3TZBA 9ICPA 1FLDA 4KH0A 5K0EA 1GKUB 3N0RA 3O2SB 4RTNA 1QX3A 3B89A 1PZGA 4FFMA 3W1WA 2OV2A 2PGNA 2FR0A 4Z51A 4MW6A 5H70A 3IVMA 5DSTA 1P77A 3H84A 1SIJA 9ICCA 4OA5A 1KL9A 5HZGA 3TW8B 4ZQGA 4S1WA 3MEQA 1BCRB 1AD2A 1PNQA 1SH7A 1H2XA 3OICA 1A2KC 4S35A 4HGOA 4OIFA 1JR2A 1XS9D 4U4AA 3TQCA 2B69A 4DL6A 1WXHA 1W0CA 3M8KA 4DV7B 1ETUA 1XTTA 4LY9A 3F6YA 1OLXA 4C0SA 2BMDA 3RWBA 4YMOA 5DB6A 2B5OA 3W8DA 4XRRA 4WKOA 4OJ6A 1T13A 3FKQA 4CTMA 5KFRA 1ZL0A 2R5WA 5JDCC 3MGCA 1WQ3A 1ZGCA 2OGWA 1PJ3A 3GMIA 1F3OA 3NHFA 1ZW6A 4RPYA 2H1LA 2F3TA 1V43A 1JJFA 5U1PA 4NPHA 3ZWCA 1U0OC 1P31A 4YDHB 1D1SA 4IIFA 3UT5B 4C6TA 5E79U 3Q2KA 4NZ9A 1OSNA 1ZY2A 2ZTDA 1CR6A 2C82A 1MX9A 3GGJA 4BFXA 4CMKA 2CLEB 1E2JA 3KK0A 1X9GA 4BKUA 2CNWD 4JR1A 3NWEA 1F2TB 4JJAA 3VHRA 1ODFA 4B6FA 1D9XA 3GH1A 3H04A 3T4EA 3AG5A 1HK7A 1NVMB 2OZPA 5DULA 2WJVA 1BKDR 4LOIA 3H5TA 3WE7A 1ZAKA 2Q9CA 4XRHA 4CW7A 7GPBA 2FE1A 3ZU5A 1MABB 3V00A 4HDAA 3QPWA 2E1FA 4BFZA 5IFLA 1H8HD 4GPAA 4IGFA 1G42A 4OAOA 2YXBA 4EYIB 4QJFB 1FDWA 4GBMA 4D9HA 4LV8B 4Y8VA 2X0NA 2JCBA 2QRMA 3FWZA 2LTAA 2Q2QA 2LKDA 3IH5A 3AKZA 1GVHA 3RKRA 4C8MA 1MJGA 1AS2A 2QT9A 3CX7A 4C2UA 4MI3A 3R09A 5KSYA 1JW9B 4YAGA 4LHXA 3UENA 3FAZA 3R0QA 4KJZA 3ESCA 5T6MA 1E6WA 4ZZ3A 5DNUA 3X1DA 1DXHA 2I3BA 4QZ9A 4GSYA 5TRTA 1XWIA 1B8VA 3RC8A 3U44A 1GPKA 3GLGA 1NNLA 3RVRA 4J43A 4WXMA 4M0PA 2W9BB 1FOEB 4RF2A 4UDXX 4KE7A 1C9DB 3WGYA 1DBSA 2HW8A 4F4YA 2OUIA 3LTNC 5EE3A 4ZO9A 5DX0A 2FCAA 1VHWA 4ZZ0A 2JBAA 5L51A 1ZIDA 4R6XA 2IXDA 4QGGA 3O3NB 1Z06A 4GI7A 4WA7A 4RQ2A 2RAVA 4E5PA 4ZO4A 2HJ9A 4GZ6A 3QBEA 4PRZA 1YU9A 4CEIB 4F5ZA 1V1MA 3LDUA 4L57A 3D2SA 5I7FA 2REQA 1HFEL 3IC5A 1C3OA 3OSZA 3QPVA 3KQMA 3ANXA 3JPOA 3M7IA 1A9XB 2RGWA 3BM5A 4L22A 4U5XA 4MTCA 1DTWB 3A58B 1E9RA 3RHFA 3BHMA 4MVYA 3ESXA 3KJQA 1U0SY 3IEIA 2HJVA 5FPPA 3LNTA 3ROXA 2HQ1A 5CB4A 3TB4A 1FSSA 3T1TA 3HLYA 3MB5A 5FWYB 4BJ6A 1HYEA 2ZWMA 4WKPA 2ET6A 4HX9A 3VR0A 4Y7CA 1BHQ1 2I2AA 5K6RA 4HRYA 4RD1A 3RH5A 4ED0A 4O5AA 2DE0X 2FG7C 4G89A 2ZJ6A 3ESAA 3U1VA 5DYYA 1CUDA 3V3KA 3WJ1A 2KV2A 1AO3A 4J1QA 3RE1A 4G23A 5G3YA 2VDQB 2IF2A 3LXUX 3TCKA 1V41E 1D2MA 1RJ9A 3SFTA 1N78A 3NATA 1FX0B 4DPMA 1WG8A 5C35A 1P29A 2VIXA 1NVKA 4EGJA 1TGYA 3K2IA 4I50F 3HGQA 3MTIA 3MGHA 4XD7A 3QELB 1XCLA 4Q19A 4EY6A 5IJWA 3FW1A 2IHNA 1O9BA 2HGZA 1KYIA 1ES9A 4K5QA 4GR5A 2XWBF 1NK7A 1FVHA 1G8PA 3QPUA 1U0LA 5P21A 4H7DA 1YF3A 1QVZA 3IOCA 2XY6A 1EUQA 3GVIA 3ZV3A 4HKTA 1OF1A 2FI1A 1W5EA 1RJGA 2G4LA 4X97A 5BYBA 3L43A 3R0IA 1S8NA 2R1UA 4M9SA 5C8XA 4R6WA 3VR3A 1P9WA 2C7QA 1JDZA 3BFPA 5KFFA 2XRZA 2XJ4A 5D3QA 3SAHA 4CL0A 1HKHA 5LQRA 4YIKA 2JZBB 1COKA 1Y9DA 4HXGA 3KSUA 4X92A 3N28A 3ZD9A 1UXKA 3N0WA 2EGGA 5ALKA 1DE0A 2VA9A 5DQHA 3AHHA 2JPDA 2ZJYA 1S4QA 2ANCA 3VSEA 1VJRA 1TF2A 1Z7YA 4ED2A 2CLIB 3WKDA 1UDCA 1M33A 1U9YA 1WU8A 2V9CA 3N0TA 4Z86A 1V3QE 2GJAA 1YE8A 4JV1A 3O9VA 4UD2A 1PV1A 1HBJA 1KQ3A 5CFZA 4LZAA 3QKUA 1FXWA 3IV9A 3EFBA 1ZQRA 1XAIA 5KX5F 3KYBA 4QG3A 2BFAA 1NI3A 4Q1FA 4JBYA 2Q1WA 1ID1A 3FTCA 2QZJA 4R81A 3NFYA 2KIVA 1B0PA 4PC1A 4MQ4A 3BX1A 5FOTA 1VKJA 3LQQA 4F5RA 4Z99A 2GCPA 1JX6A 3DH0A 3PL5A 1JEQB 3DM9B 3MMXA 4ESOA 1R66A 4NQRA 5A6VA 1UZAA 5JSKA 1NF9A 8ICAA 3H8WA 1W0JA 3VNVA 4YP6A 4RM2A 1CIVA 5EHGA 7ICPA 3Q98A 4M86A 1YDGA 1D5WA 4QICA 1W73A 1ZJYA 3O82A 4DQIA 1QJCA 1AMOA 1MG5A 1YZVA 4YVZA 5K0BA 4WZBB 4JVNA 4I8DA 4RHUA 2A1AA 3GGDA 4FHGA 4HLQB 4E30A 1PIWA 2D74A 3BKXA 2HK6A 5LB2A 4GOKA 1DBWA 4E5KA 4DJFC 1J7JA 1G21A 2RKOA 3S1LA 4P9NA 5AI6A 3NHLA 1K7YA 3CH4B 3EAQA 4XR4A 1XHEA 3WP0A 1PVVA 4JBIA 3TH5A 5IKPA 3TARA 2Z09A 3HWTA 4MR9B 3I5YA 3L7CA 4RCVA 4JJ6A 2R6CA 3LA6A 1NU6A 4F7DA 3THYA 2OSBA 3ZDXB 1NHGA 1BNCA 3DV0B 1XALA 1P1KA 3VC3A 5IBQA 5BPHA 1EHYA 3U7RA 2IYYA 2PMBA 4O25A 1NVTA 4RAQA 5CDUA 2Y93A 3GIMA 4M9LA 1TU4A 1DWUA 4DSLA 1QRAA 1N2XA 3RTGA 3QYJA 2Q1XA 5J2BA 2PCLA 1YJ8A 4KU4A 4NE9A 1YS4A 1CRWG 3ZBPA 2L5YA 3LP5A 4FXOA 3IO3A 3TVTA 3I9KA 1BOOA 3EISA 1QHHA 1S1CA 4R1OA 4C2TA 4D99A 1Z1VA 4BO0A 2IS1A 2ZBVA 4IMPA 3LPLA 1LNQA 1QFYA 4UVHA 5CK4A 3A6DA 4M1YA 2VTEA 2QTVA 5J2TF 5C1OA 1F5NA 1Q7EA 4JGGA 1ZRSA 1UK9A 2ES4A 1CRZA 4PO3X 2D8CA 3WI7A 4LF4B 1PG0A 1UXGA 1VRWA 1YBMA 2W9CA 4O2AA 3TVYA 1O6FA 5IJXA 1B2LA 2C8JA 4GOXA 1VKHA 1RKBA 3CWZA 1G8KA 1L3IA 1TYZA 5E2AA 1O95D 1JFRA 3NOVA 1KAQA 3OHBA 4WASA 4RS4A 3LC7O 4MO9A 1PR6A 3GEGA 1XO0A 1KVUA 4B73A 4QPDA 4UOEA 1J20A 5BSGA 3L4PA 2YOHA 3TL6A 1EZ4A 2AMJA 1IV8A 5HP4A 3QZ7A 1SG9A 3H8MA 5TDHA 1QRSA 3PI6A 4MDEA 1UPCA 3CRXA 1RZUA 5GTHU 3QF4B 2P4SA 1T4BA 1SBCA 3K92A 4JVOA 4NY1A 4JJ7A 1EE2A 4ENWA 2I65A 4P7BA 3R8XA 3UAZA 5PNTA 1SL1A 5AVOA 3BL5A 4A0FA 4DV3B 2JGNA 5EYPA 4H0NA 4GG1A 4P38A 5J2HA 3FJOA 4P82A 3I62A 4XX1A 3FJ1A 2IYZA 2OFPA 1XEXA 4GWLA 5COAA 3BCHA 4ZN6A 1PR3A 3V2IA 1U3TA 3FE2A 3IQHX 2EH9A 1DKUA 1O87A 2O8NA 2PGDA 2NMVA 3RUDA 3T5LA 3OQIB 1UWLA 1K5DA 2AOUB 4QVKA 4DS3A 2IV2X 3D1VA 2WF8A 4QZHA 3B9RA 4JGIA 1F6DA 3K09C 1KMIY 5FKJA 4Y18A 4E07A 3WIDA 1YUMA 4Q3KA 4JYMA 2VEDA 4XWGA 4E03A 3B1JA 4IQ4A 1Q3VA 2NVWA 3LXRA 4DLUA 3T5CA 4YY3B 3E22B 1N5LA 1TO1E 2NNWB 1BGVA 1OLSA 3C2MA 4RSHA 2I2WA 3PDUA 3ZE1B 4JLDA 4Z6DA 5BQOA 4O3NA 4JQCA 4L72A 3PEEA 1SIUA 3F2VA 1SBYA 3LC0A 1I4LD 3VPAA 3I5AA 2J31A 4ESEA 3BL8A 1YK0A 2VATA 2X6RA 2V97A 4H08A 5ALDA 1T5HX 1XFAA 3QEJA 4IFTA 3IHTA 1LPPA 2OTCA 1UPHA 3IR5A 2F1KA 1L7VC 3GWGA 3K0AA 4KPYA 2A9QA 1IG0A 1Y6FA 3E15A 3Q2OA 3H2JA 3ABZA 3USES 3V6KA 1UFOA 2VHZA 3F4LA 1SXDA 4YRNA 4ND2A 1P5RA 1SUBA 3F5EA 1G3UA 9LDTA 2IPMA 4NCXA 2NOAA 5KFNA 1H8HA 3UXOA 4DCGA 2IYAA 3LFTA 2HBJA 4C4SA 1AUXA 3DKRA 2FV8A 1Z68A 2SNIE 1NQUA 4J6EA 4X20B 3TQOA 5AW8A 2VSOA 3UM9A 2A3RA 1ZRMA 3QVGA 4ZU6X 4JFAA 1UXJA 1QTIA 1PVQA 3CEMA 4YXWA 2W9XA 4QJ4A 5H7XA 1EVZA 2NXWA 4KMSA 4G1UC 3OTGA 2NAPA 5ADUS 4ENTA 1GPJA 3G2IA 3SJAA 1V8ZA 2CLSA 1JBEA 3NEYA 3QV2A 2X4LA 2X0JA 4FQ5A 4KLNA 4PQEA 5JADA 1E0DA 3SQXA 3U4AA 3H0CA 4AQ7A 2VYND 3MT7A 4YS6A 2Q2VA 3A1TA 5ICSA 4HS4A 1JTFA 4Y2TA 2GF2A 2V8OA 3TGWA 5C8ZA 2GZ3A 4P32A 4W82A 3TR5A 4OQXA 4P1ZA 4BJ5A 3UT0A 3DO5A 4ENSA 3RB4A 3V5NA 3NNNA 4RZHA 2VH5R 5ALWA 1Z4LA 4LDQA 1E1YA 4AN0A 3KWFA 4HWPA 1YU6A 5IBPA 1GO3F 2QHXA 1LUAA 1U3WA 2QQ0A 3OO0A 1I2ZA 4GC5A 2IZ5A 2Q0XA 2HU5A 2GXQA 3L7NA 1M1NB 2CDNA 2V7PA 3LZCA 2CC2A 2R48A 2AXEA 1C7QA 2OD7A 4Z4FA 3H1TA 4PZEA 3RYFB 1XEFA 2BM0A 3Q10A 4DQXA 3WLRA 1HR0B 1UMCA 5JATA 4ELUA 2X1MA 3PIIA 3AUOA 3WGOA 3UGTA 1FCJA 2PD6A 1MEOA 2I5PO 4RKRA 1Z00A 3P19A 4GAEA 1PCXA 1PDWA 4JT2A 5KOIA 2R4QA 2ZAMA 3PC6A 3RUPA 5IANA 2FW1A 1OZGA 2EDAA 4J0QA 4I1PA 3UUWA 1J2UA 1CLUA 4MVCA 2BEWA 3BGIA 3JQAB 1FSZA 4AXXA 1USIA 1JG7A 4BWGA 2A5LA 4KMOA 2XVTA 5GINE 2GTHA 2ZJ8A 3JD1A 4ZARA 5DX8A 4CMIA 1JT9A 2XF2A 3A04A 3BXEA 3NB0A 3TKYA 2C84A 4OSEA 1WR8A 1I9GA 5G0SA 4IIYA 3FR8A 3LMKA 3NAMA 1G38A 3COWA 4DIDA 4IVPA 3K1AA 4PQFA 1TRHA 3ICXA 3VVBA 3N05A 2C95A 4WK2B 2N46A 1CNFA 1I6WA 1QGED 5FWDA 2ZE8A 5JNRA 1QZTA 1X92A 4YV2A 4RVGA 2VA8A 4Z4GA 2ZIEA 5AKIA 2YWFA 3UKJA 4BZZA 2QRPA 2H06A 4CBVA 4ND7A 3N70A 2R8HA 1LH0A 3KUXA 4ND4A 1B0ZA 1W8IA 2DFLA 5MN4A 4RPCA 4KFSA 4J4BA 4ECAA 4LC1A 1KJZA 1O5OA 3BWCA 1WXEA 4ND3A 3RFUA 1HRKA 4E21A 2BFEB 2GSWA 1T24A 2BMAA 1XTIA 3D8HA 5TS2A 3NBFA 3U7QB 1QK5A 2JHAA 4MQFA 3Q6IA 2ZI3A 4DC1A 3PXXA 5SV2A 4S1VA 3HB0A 1P6XA 3IBTA 2BT4A 4ZJYA 2HSEA 4BWVA 1QF7A 2V7UA 4E2ZA 5EQFA 4M1WA 4IINA 4MUKA 4IDFA 3SQWA 2XWQA 2CJYA 1A4IA 2AI3A 1HQDA 2BKVA 3HA7A 1U3CA 3JW8A 1CW2B 5AKXA 4C03A 1E3WA 1PBTA 5CX1A 3HSSA 4QRDA 1KYVA 2PWAA 3H3JA 1RXUA 1WZ2A 3BK2A 4BO5A 5DF1A 4BX9A 2YZMA 3K53A 5TVGA 5L3SA 2GPBA 2QLBA 5CCXA 1XMJA 1D8YA 1R88A 2FW7A 3HYTA 4F2GA 3R6TA 2IPNA 5JROA 1TC1A 1ZGJA 4NOMA 1XRPA 3T1OA 3VV2A 3FNGA 3RIMA 4KLGA 5IAJA 1P0QA 4BY9E 1TECE 2GA8A 1X1SA 2VF7A 1F06A 1AK1A 4OH7A 3GMDA 4D3DA 3CG0A 3FXAA 4LVSA 1S8FA 4UATA 3L5KA 2W71A 2F55A 2ZDQA 3VPXA 2P5UA 3LBNA 3JQCA 3JYPA 2W6IA 2WAMA 4EB8A 2XGMA 4NH4A 1FFHA 5B30A 1KEZA 4NL9A 1ZLYA 3HCPA 4DPKA 4I4TF 3BK7A 1Z5VA 1UIRA 2JIZA 1VLJA 4POAA 3MWJA 3NAGA 2C28A 2FMIA 4QWWA 4Q3CA 4ZCMA 2KVSA 4AYBC 1JU9A 2A6PA 3LQ4A 1SQ6A 1MQ9A 3V7JA 1TCCA 2GTIA 4XPIA 2ZTLA 3AR7A 4RKQA 2ZFUA 3PNKA 1QK3A 4CIWA 4C01A 3Q8XB 4IS7A 3IUNA 4ZA2A 2BKEA 2PNFA 3EGIA 4UTXA 1O58A 4CPDA 5EHIA 3C21A 3ND6A 1EVIA 4BDSA 1LWNA 3KV3O 3C29A 1W88A 2JGLA 4KYUA 3QE4A 4M46A 4PCLA 1F8GA 4EF5A 3TAQA 4QREA 1U5AA 4RZSA 9ICVA 1VLVA 1D0IA 3UK6A 4EI9A 1U8UA 3QENA 5T4HA 3HFRA 3GN2A 4JGBA 4B3BA 1UHUA 2FMXA 4PYRA 1Y82A 1DAMA 3WRVA 4MTLA 5JMWA 2H51A 3CF6R 1FYWA 2OC9A 4PZPA 4ZXPA 2IYWA 1JPNA 1QGYA 3KKQA 4YK7A 3M33A 4O29A 1VYTA 3UA4A 4PO8A 1N6IA 3GNLA 1SWWA 4YCJA 3KAKA 3IAM6 4ZTBA 1ACLA 2ATCA 5DBEX 3CPJB 5AVJA 4P7JA 4XVUA 1T34A 2PR2A 4FNAA 1H65A 2PMCA 2BGUA 4TMZA 2AG5A 1U1EA 2JI7A 3ZVNA 2VYCA 5EINA 3UKDA 3EPJA 1JJAA 4ER3A 4TV9B 1JQJC 3W1EA 3SENA 8ICXA 5DCYA 2G76A 2CD7A 1I51A 3JQ8A 3R3JA 1XR3A 1ZU4A 1O94D 5DU2A 3HCAA 5A5FA 5ED0A 4XUDA 4D9NA 2ORED 2O2HA 4AURA 3ONDA 2RH5A 3VU0A 4AMBA 1XG5A 3JASB 4BRZA 1XXHE 1SCAA 2IYUA 1ULSA 2JVKA 4JC5A 2K8BB 2OE2A 1KORA 5IJ9A 2KX7A 1E89A 1QXSA 1II9A 1WV0A 4Z4CA 3DLTA 2FZKA 1QCYA 2R00C 5EQJB 3NEPX 1L2TA 2HCRA 5HTKA 4M9XA 4Y2GA 2ECQA 3DFUA 1YE3A 3HXTA 3TNDA 4NHOA 3V9PA 2I1QA 1KHHA 3UMSA 5HPYB 4WEOA 1JTEA 3C41J 4RETA 2V7WA 2IFTA 2XBUA 4FU0A 1M1YE 2HWYA 2JH3A 5GJBA 3HNRA 5IINA 4EYSA 1A95A 5BRAA 4NC9A 3PICA 2QX6A 5KNBA 3W0LB 3GRPA 3SU8A 1WV1A 3LWLA 2OV8A 1TPYA 1XKQA 2AEMA 1UJNA 1WSBA 3UY4A 4DT1B 3UMGA 5F9MA 1L5FA 5IH7A 4W6QA 2QIOA 1Z2AA 5KFKA 1USKA 5I8WA 2GH1A 3EGVA 1RWNA 3CX6A 5C7IO 1XAHA 1W75A 2QY6A 5J0UA 1W5BA 2V0GA 4DQRA 1E5VA 5F35A 3ER6A 1NY6A 1XLTA 4EZIA 4UDYX 4LZJA 4YLEA 2NX2A 3OZTA 2NTJA 3MSCA 2HI0A 4R0VA 5FPSA 3N7SC 3KVYA 2M6SA 3ESRA 3OIUA 4EZ9A 3ZWXA 1N5KA 2GZHA 3H3FA 3FDFA 2QU7A 1IBSA 4I55B 1H6BA 2LD4A 3I83A 4PWZA 3B3GA 3NIFB 4CGZA 5H0IA 1GRQA 2HREA 3S7ZA 2NQ2C 5CA1F 4PS1A 3ZW9A 4WNAB 5KNDH 1DIHA 2ZWVA 1WHSB 2C4TA 1T8EA 4YAKA 2QZ9A 3EVZA 1D1TA 2C98A 3KRTA 1XTJA 2LCIA 3OFVA 1WTCA 5HDBB 5JTTA 3UJBA 2FETA 4F5NA 3HJGA 2BGJA 3GV0A 4Z9FA 2G67A 4OKNA 3N74A 3E3NA 3RKSA 3OTWA 1P3DA 1AURA 1AXGA 4FT2A 3HKCB 2X1HA 4GLLA 2UXDB 2CXOA 4ZJZA 4ZHQF 5G5HA 5JSZA 3H11A 4V38A 1TUGA 4E5SA 3ZGLA 4DL5A 1X42A 3QLEA 1WOMA 2VQ3A 3IELA 2KZ3A 4K4HA 5AJTA 1JLHA 3L3BA 4RW0A 4FKZA 4OMDA 5F9FA 1CYEA 3FHLA 3RK0A 3D2CA 4USAA 2HF9A 4FXPA 3H87A 2OXEA 4BNLA 3ZQ4A 2HCJB 2E4VA 2VTBA 1DAKA 4OQDA 1HMYA 3KLOA 5KYXB 2JLXA 2Y9TA 2HJSA 4LV6A 3RUFA 3W9YA 5CLQA 2DCUA 2GR9A 3C5GA 4QDJA 4BNGA 4CV2A 1JAHA 3B12A 3S55A 1RXVA 2QJRA 3DLIA 3KHRA 4F4UA 3UICA 1Y6ZA 1UAGA 4PLVA 4EI7A 3ZQUA 4MQEB 2BH9A 2BKAA 4J2HA 2JR5A 2HZBA 3DA8A 4OK6A 1PQPA 1KJYA 1L3VA 1N57A 5JO9A 3JQQA 1P60A 4TL8A 3AM5A 1MEEA 1U1FA 4BGEA 5IM4F 1Q7RA 1ZA2A 4OQPA 5LBIA 1QGDA 3DLPX 4KAXA 3RREA 2GWSA 1SVWA 1B00A 1P8JA 4IJWA 5B64A 2WYUA 3EGXA 4G8JA 4ZI5A 1JQBA 3KZOA 4MGKR 1DRGA 4FBMA 4CR6A 4ZVKA 4XCQA 3PNQA 2D8MA 3WLJA 2Z08A 1WBJB 3LCUA 4AJ4A 4AUKA 4ZXFA 5A05A 1DEHA 5TMDA 5KDDA 1S2GA 1EFHA 1C0EA 3V42A 2BWJA 3HDTA 4O8ZA 3IE2A 3K5PA 2C54A 2B8NA 4TLMB 1Z8DA 3MCTA 1T5LA 2BCUA 3SC3A 1OUMA 2J1LA 3ZQJA 3EVCA 4H0CA 4LJ8A 1NULA 2DGZA 2WM8A 4LBYA 3VO9A 4UBMA 2QRUA 1ORDA 2VF5X 2AJBA 4QWMA 2YOGA 5FHQA 5K3OA 2MAXA 4ETWA 1T3LA 3IRUA 2ODWA 3WKCA 3KQYA 3CZAA 1C7JA 3IAXA 3WL5A 1RHUA 4L4XA 5IT9A 3GA7A 3BQMB 5B1EA 1EINA 5I7HA 5J47A 2YN0A 3UAXA 3BT7A 4PZUA 3CGGA 4AG5A 1RQGA 1FEZA 4DEZA 2V4MA 4DPLA 5CA0A 4HNRA 3VVCA 2AEEA 2OENG 1RQ7A 3RFVA 2OVBA 2VUHB 1K68A 3R41A 3FCCA 1OAKA 2CLCX 2IZ0A 5F3DA 3DVQX 3DZCA 1IATA 2Y99A 1A50B 4Q93A 1KEPA 1KQNA 3ENNA 2XA9A 3K5HA 3K8YA 3OETA 1FTNA 4J9SA 4ZCLA 3AEQB 1DWQA 2ZI5A 5KFJA 1CEYA 2K4PA 1BROA 3DQPA 2R44A 3V1TC 5DYNA 1VMKA 1WB5A 1Y5RA 2W6PA 4YUYA 5J8YA 1H2EA 1TZCA 2Y1WA 3A4TA 3C28A 1XZPA 4ARCA 4GLFA 1MOSA 3IP7A 3PW0A 2NU8B 3K0FA 3RV3A 4O02B 1JKMA 5AWFC 1U49A 4BX0A 2H3VA 1NATA 2E8NA 1IOWA 3BGDA 1TZ2A 2YMLA 4V0OA 3I4FA 1NDQA 1T0UA 8ABPA 2V9ZA 3VZCA 2I7DA 1NXSA 5F2NA 1Y8RA 3GVPA 3I6QA 1N8NA 1GPAA 1R9JA 1NUUA 4WECA 2B8TA 1VMIA 1KDRA 3VR3D 5LP6A 3MGKA 2LE0A 4NATA 1N1GA 3HCCA 2GWRA 3MLEA 4RZ2A 1VE7A 4JQOA 4I50A 1YFZA 1EUCA 3SCZA 3WYNA 3NAQA 3V97A 1CUSA 3N2KA 1WXQA 5IAOA 2IYTA 3OC6A 4ZOEA 5BT9A 2KLBA 4E4YA 4X6UA 3AZQA 4P08A 3RIHA 3LPNA 4YYEA 3ITDA 1S10A 2ZYTX 1LQ2A 1TKAA 3AUAA 3KPUA 1GPWB 4J9OA 3ZLBA 4ZVNA 3HZOA 4MUYA 2DLNA 2D59A 1JJ7A 4PZZA 2OBMA 2IIBA 3GV5B 3PGJA 4RTLA 4B3FX 2VNKA 1IY8A 1DIBA 2HUPA 2O8CA 4NEGA 4Q1AA 3CB4A 4DA6A 1C0KA 1FTWA 2F1RA 4PR3A 4P4OA 3ESZA 1ECWA 2Q6KA 2GBGA 3FFWA 3LHKA 1LJLA 3WL4A 1KNXA 3N9IA 1V16A 3SYTA 3WK5A 2GEVA 1V35A 4FSXA 3DKKA 1YNOA 3RB6A 2OZLA 5JSHA 1OBFO 4HX2A 3UJAA 1WXWA 3ZLVA 3PUIA 3T06B 2GSDA 1YR9A 3ZV5A 1Z3CA 2VT7A 3TAPA 4QZ8A 4ECSA 4FFDA 3EGEA 5IIOA 3N2NA 2ORIA 1UCVA 3JWGA 3CRNA 2X8LA 4D44A 3U7HB 2JATA 4N7RA 3TLYA 3VR4D 2XIQA 5ADVA 4EIWA 2L18A 4QHSA 3RR2A 4MW7A 5EIWA 3RR8A 5BR7A 2C61A 1W0JD 4G37A 1ZR2A 2PJZA 5A3SA 1EZZA 2QKQA 1N8TA 2PU5A 1AHNA 3FMPB 1PD1A 1OIXA 1Q3TA 1YFLA 4K46A 1F1BA 1DQRA 2G9RA 4A6DA 4ND6A 1MV8A 3OPXA 1TCBA 2VPZA 1PGNA 2HRQA 4EDHA 2FPRA 3V8VA 1E9DA 1FRZA 3WGTA 2IHUA 5DN6D 2BCVA 2F1OA 4PR0A 2J0SA 1KFDA 4HWOA 4WZAA 4KSCA 1T29A 4YRCA 1DCKA 4OL0A 4FCVA 1RZVA 2PXIA 2Q1SA 3NDPA 5KYWB 3FY4A 5J2UA 4RMJA 3PNVA 1D9FA 3CCCA 1COWD 3I01M 2GK4A 4G0MA 4C4AA 1H0SA 3DWEX 3K0CA 3NBYC 5FX2A 2DF4B 5WRFA 4CIAA 1RBZA 3F6RA 4ZEXA 1ZEJA 4D3YA 5AJZA 5HQ3B 2WG0A 2Z4TA 1U65A 3KYDA 4BP8A 4G1EB 5GVRA 3P0IA 4JUBA 4BU0A 1O94A 1T5DX 4HLUC 3SZMA 1YFKA 2GBLC 3NEJA 3V8MA 7ICTA 2LI6A 1MVLA 1RYMA 1KC3A 1LPSA 3TX2A 3OX2A 1N48A 4AQYB 1IIPA 3WRXC 3SR6A 4P4LA 1ZK2A 2H7YA 3U5TA 5CDGA 2NZWA 5GZ3A 3E5HA 5AW6A 3HHPA 4MWDA 1T9KA 3RT7A 4L16A 5LLDA 2XCQA 1KEVA 1OD6A 1N9GA 3TXXA 1AMUA 4C7YA 3GIJA 2EL9A 4MRRA 1ZUD1 4CDGA 3AM9A 1VMDA 1ZM4A 1K4YA 4L4SA 3VISA 2PYZA 5I45A 1E66A 3I9FA 4KLDA 2CHGA 2C77A 3T52A 3RFCA 1JHRA 4KXVA 4W1RA 4M1SA 3QPCA 1UPTA 5K3FA 3IBCA 3QKRA 4F6RB 4AVYA 3Q3GE 3I76A 2PUJA 4OB7A 4YB8A 1H0HA 5CEJA 3X2EA 2PZFA 1SQFA 1P45A 1XDBA 3M70A 1X39A 3HS3A 3D0KA 2K5UA 9GPBA 1A82A 5JZSA 4TS9A 1TX4B 1RDFA 3SLRA 3F7NA 4G97A 4MB6A 2CUKA 3MHPA 4KR6A 1Z0SA 3OLXA 4DDHA 2FH5B 1TUBB 5DM2A 4BNVA 3EXHB 5DMXA 5J2TA 2IBMA 2XKKA 2WIDA 3QBVA 2XBLA 4QTYA 3MMPA 3GY0A 3M34A 4EFNA 3SF8B 1Z07A 3T5BA 1IEWA 3VNRA 4CCWA 1CUBA 1LZKA 1QFMA 3LVRE 4NNJA 1QKKA 3LLCA 4LIPD 1X3LA 4LXTA 2MUTB 1YC2A 1EYZA 4INOA 1TC2A 1E1LA 4KLIA 1X9HA 4ZEVA 3U3JA 4F86A 3J80A 2XTJA 5FBHA 2KJQA 3B1ZA 2V8BA 5HFAA 4MQ5A 5D6NA 1D7OA 1U3FA 1C0IA 4DRXA 1A7AA 2IYLD 3R0XA 4QBTA 4DWIA 5C31A 1A76A 1QH1A 1AXEA 4Z6CA 1DKQA 3EOBI 4D0NA 1C0PA 4DNOA 4A8JA 4IHJF 2WYOA 4A6XA 1HE2A 2FPLA 3OLWA 3TD9A 4CQMB 3WB9A 3GDGA 8ICIA 2A1UA 2WWHA 2E48A 4OLJA 4QGSA 1H2ZA 3C4VA 2C8LA 3RUEA 2XCOA 3QZUA 4KV7A 2PO7A 3B6IA 5F2EA 3USZA 5JIBA 1FDIA 3ELWA 4HNTA 2QGNA 3L93A 4OTZA 1WCXA 4KWIA 4US8A 3B7GA 4P4MA 1Q0HA 1L4LA 3FTFA 3TADA 5E6RB 1ABBA 4U2EA 3JQ7A 2H11A 2AFIB 3ZE0B 3JVIA 4CVNA 3LX8A 2W98A 1KPHA 3IJRA 1N6LA 2X3YA 3ZY6A 4LRQA 1A7JA 2DQSA 2UZ4A 4YUVA 4D8VA 5CTAA 4RQ1A 1KP2A 1JHXA 4FE4A 4WW0A 4ZAVA 2Q9UA 1JWAB 4YRPA 2AXTU 5M34A 5AJVB 4P33A 4EVIA 1OCEA 3TW4A 3SDSA 4E5VA 4Z0TA 2GAAA 1P6UA 3JPWA 5G0WA 1S89A 4GKVA 5GAJA 3ZV4A 2FJUA 5H80A 1S8OA 4ZRDA 4AF6A 2Q5EA 4BNJA 2B4QA 2HBZA 3N2YA 3WGNA 2XT0A 2X77A 1FRNA 1LFAA 3KKKA 4EKNB 2JHPA 2O8FB 1H2HA 1R2QA 2IHKA 2E87A 3ANYB 4EZEA 2WWIA 4YXWD 1QHIA 1MNAA 2AE1A 4L3WA 4L4RA 1R12A 2R11A 5GM2A 4B4KA 3KWMA 4QKQA 2MSKA 4P2BA 2QN6A 1Z63A 3N76A 1R0YA 3OH8A 4JX8A 3HCEA 4UTRA 3WGHA 3TLBA 2O50A 6GPBA 2YQEA 3BIOA 1E5TA 1NLZA 4BMDA 1J23A 5C5EA 3ZUPA 1N75A 4F21A 4WXRA 1V8PA 1QB8A 4FOPA 4EGFA 2XODA 2ERCA 2ON6A 4XCXA 2QL7A 1ADGA 3F2IA 4B7AA 3D31A 5DGHA 3TVDA 3INRA 1Y7HA 3VZBA 1LA2A 3ETDA 3EG5A 3LVFO 5LZ2A 3AOEA 1XNRB 1V47A 1U3DA 3WBFA 5TQ0A 5F98A 1ENZA 5AI8A 2BISA 3THWA 4JODA 4EQ6A 1EFCA 5GADl 4YNBA 2ZIXB 4DEVA 2BCJQ 1EDOA 4EMTA 2MOKA 3R77A 5DM1A 1WPRA 2R97A 4ZIRB 5ITWA 2GD1O 3ETLA 1OIWA 2E4WA 2UZ0A 1B23P 4MV7A 2DUJA 3WDMA 1TZBA 1W36C 3S6JA 1VE9A 3AVOA 5HR5A 4KBFA 1ZQNA 2YHIB 5GTDA 1FRQA 3WWCA 3MWEB 3VAZA 3ISJA 3T8YA 2ZBFA 1ECJA 1UFRA 1TAUA 2IU4A 1QIDA 3X44A 3VO2A 3V7KA 1N2CE 1JFTA 4LHZA 3C1YA 4D74A 1U4SA 4PHAA 4DKJA 1NYLA 3KVNA 3A9VA 1X7DA 3O4IA 3FMFA 2D0OB 1XZLA 1TIKA 1LDNA 4GPEA 4Q3BA 1QLHA 4ZQIA 3IMFA 2H9YA 3RSQA 4MA5A 1BPYA 1P7YA 3ETEA 3ANMA 3IQZA 3NGXA 1EBFA 2FN9A 4V0SA 4LNUB 1L9KA 1UBKS 3I2FA 2VT2A 4S0XA 3M4ZA 2XCLA 1N0VC 5B3KA 4MVJD 2CBXA 2QAJA 2AR9A 1EX9A 3QMWA 1NMEA 1A6SA 1KGSA 1GEEA 2NTVA 1W52X 1YZUA 5DDMA 2I9PA 3AN1A 3K15A 3OOJA 4MLDA 1UOEA 4BLRA 4WGGA 1SBIA 3MB8A 3FPAA 5CJPA 1O97C 1WUKS 3IP8A 2A8YA 3U56A 1LBSA 3KQKA 4AJ1A 4EAQA 1E2LA 3TBKA 1LB1B 3DLBA 4MCIA 3IS3A 4JZYA 4K9PA 2J6UA 2VSNA 3HVJA 4W4TA 1CV2A 4C7VA 2HQSA 4O2LA 1T2FA 2VUSA 1QANA 4YQFA 1N77A 1PWEA 1UQTA 2JAPA 2NUTB 3WLQA 1GSIA 3THXA 4MQMA 2BBTA 2EP5A 4QNRA 5AK3A 2XA2A 3GO4A 2AC2A 4L0MA 1KEKA 1IB6A 3FUCA 3WNCA 1P0FA 4D97A 2DMRA 2FKNA 2RH9B 3L8MA 4IQTA 3A1CA 3STYA 2PQMA 1N62A 2J4CA 4KFUA 4OAPA 2NZXA 1DRKA 5ENDA 4I9GA 3HVIA 5TE9A 1H6CA 4HK4A 4XYLA 4KKXB 5IUKC 4B3RB 3HCFA 9ICFA 4J6FA 2NUBA 2Y2UA 3AIMA 9ICBA 1RWQA 4R5MA 4F5PA 5CA7A 4GT1A 3U7GA 3VR4A 4EA6A 2EFHB 4DCJA 1YCDA 3O3CA 4IOKA 3PE3A 3RS7A 3ZJTA 5TF4A 5IDWA 5DP1A 5FI5A 2W6ID 5LMCA 1ZCBA 2HA0A 3W8FA 2CNKA 3GBSA 1IZ9A 1UKEA 2OCYC 4TQRA 4MR7A 2BGNA 2JIZD 1RW4A 4ZQHA 5DN6A 2ODAA 3OPYI 5GIPE 3HU2A 3BVPA 2BTOA 4YALA 1BW9B 3CX3A 3CEPB 1FRFS 4YRQA 1IZYA 3DMYA 3AY6A 1GFIA 1YS1X 4QNNA 5FF9A 3EC1A 3E81A 3EJ6A 3BTUA 5EQTA 1DMSA 3HHEA 5JWRA 4BN4A 1YQ9A 1COWA 1SEVA 1Y6RA 2FPWA 2OVFA 4E1BA 1WNFA 2C1EA 2EKQA 4D4LA 5D00A 1ELOA 1Y5LA 3QYAA 3TPFA 2XWPA 4HLNA 5FBKA 5HTOA 4E4TA 3HU3A 2C2GA 1C9EA 2AFRA 4ZQEA 3WZLA 5K8TA 1U1CA 2RH8A 2TECE 4XDZA 4JBHA 4A9AA 3BXZA 1RLOA 3IUPA 3LYUA 5SYNA 4KQKA 5CRIA 3W79A 2YUIA 3R5FA 3TSAA 4BVBA 4Z0HO 3AMVA 4Q4DA 2ADMA 1C1XA 1JDTA 2ZYIA 2BHRA 1QS0A 4U0JA 4YQYA 2DPXA 2HOFA 3SC6A 5HCUA 2XDQB 4P4SB 4OBBA 4MWSA 3GXOA 1N36B 4S1OA 3GGSA 3EZ6A 4YRMA 2FPOA 1J33A 5GONB 1IJFA 4PH5A 3KQHA 4G09A 3V7LA 4ENPA 2G5HB 4WBNB 4MEXA 3HDYA 1N8SA 3B6ZA 1WDKA 4UW9A 1BX1A 1EMDA 3PFGA 1MT0A 3ZDRA 4B75A 2IUUA 2YL2A 1FP6A 1FNMA 2A4KA 4O3FA 2Q6TA 3CVYA 4A3SA 1O9GA 4AJLA 1Y9EA 1U4BA 2JLCA 2O23A 2V1UA 3R20A 4DXDA 2CHQA 1IQPA 2DAPA 2PMWB 5EFOA 4KR9A 1K27A 3U81A 5CXQA 1GZSA 3ZDAA 1VL6A 2DB3A 3GLIB 1LDBA 4OV6B 3OF2A 3TTVA 4LW8A 1MHPA 5DIZA 1I4EB 4KR7A 3PR1A 1FNDA 1P4SA 1Q3HA 1NXTA 3AJRA 2Q4RA 1JDUA 2Z4SA 3JTEA 1VI5A 1CUFA 3FLBA 4PAQA 3T34A 2CDAA 4U1RA 2X86A 4HY3A 1RM6C 4URXR 2WKSA 3M7DA 3EZGA 3LECA 2O0LA 1A7UA 4TLLB 5THKA 1E1CA 4LYEA 3GT3A 2XZOA 121PA 3IDQA 1BE6A 2B5VA 5KNBD 5C1BA 3SIXA 2V7VA 4DJ5X 1H4VB 1I2BA 5BSHA 3EBLA 1FQOA 1II8A 2NUPB 2C59A 5AKEA 4QUHA 3RRMA 3QJ5A 4YR3A 5C3MA 4UREA 3I09A 3TZHA 3MAGA 4YDSA 2V1XA 5BOSA 1PT7A 1UBFA 3IPAA 3Q2IA 4E31A 4G2TA 5IYZB 2G36A 2XE6A 4CEHB 3E9YA 1TA0A 2VHQA 3LRXA 4FZMA 5KTNA 4MHTA 4M0UA 4X54A 3A4NA 4J76A 3B60A 3KBBA 3EXEB 1G5FA 3SLKA 3ID6C 3RRFA 1VSQA 2NRXA 2CXPA 3PRJA 1M6YA 1XCOA 3I9NA 3QVXA 3NONA 2P6UA 2OHHA 4AYXA 1U2SA 4R9NA 1KK2A 3ORSA 3AEVA 5KYKA 3EC7A 3L6RA 1Z8HA 5KFGA 3F67A 2FEPA 2VDPB 4MV3A 4NBVA 2GK3A 2P9YA 2J5QA 1MB3A 3AHDA 2M9MA 5K01A 2PZKA 3Q6MA 4BZQA 4M4SA 1WQ4A 3HBLA 3ROKA 4X90A 1R3DA 1IE3A 1UQRA 1PF7E 1TEVA 3DBLB 2H7VA 4ED1A 3WK6A 5ILQA 1T8SA 5CHGA 4FLMA 4YT8A 3ETHA 4YR0A 1KFBB 1H5NA 4HZIA 5J0WA 3RC7A 3CZPA 2ZJFA 2XCPA 1S6YA 1USWA 4RIHA 5TPWB 5L1JA 421PA 2XGQA 3DFZA 4RHEA 5KTTA 3GHHA 2PANA 2JK1A 4LEIA 1YR6A 3V7UA 4P98A 3CW2A 3KTDA 9ICQA 1ZOSA 3BCRA 1BFDA 1E4VA 1I3KA 3IVXA 4KPGA 4YHBA 5L3ZA 2EDCA 4DS4A 1EFRD 3JARB 1F0KA 5BQPA 3OU7A 1WD7A 4KDFA 4JI3B 5BXQC 2P9HA 3HGMA 2X4IA 4AJNA 3N8DA 4UHDA 3V8PA 4I5DA 2PKQP 4B9EA 5EEGA 4MROA 3IX7A 2H4ZA 4UJ5A 4WVFA 1QTRA 2OFOA 4KWTA 2JFVA 1FP2A 5DB9A 3RTDA 3ZHUA 4DL2A 4FR2A 2M0NA 1F4PA 2QVZX 2QRVB 4OKSA 4MOWA 4R51A 1W48A 3DOIA 3HXQA 2ONJA 2AZ4A 3TTTA 3NRZA 4GMDA 3V3TA 2AR0A 2XTAA 2JEYA 4GMGA 3ZD6A 3VZRA 4QNMA 4ZYTA 1Z4IA 3PENA 5EXTA 3VPBA 3WJ2A 4H59A 3F7TA 3GFGA 3A27A 1M6EX 1E3LA 3OMWA 5JVDF 4J9MA 2AQKA 4II3A 5IEBA 2UVRA 1JQEA 5BN5A 3KE8A 1NF2A 4LYGA 1QX4A 2VRNA 4YC7A 3KQQA 4MF2A 2JCSA 3IALA 5IULC 1AGYA 3JR7A 2WDZA 2GKGA 3O6VA 2AFHB 3V6JA 2P68A 4UCWA 1PG5A 1IXKA 2ZAGA 4MYTA 2E7ZA 2B4TO 4DFPA 1EE1A 3CVVA 2P77A 1RLMA 2NO5A 4UFOA 1Z25A 4KEAA 4P83A 1OFGA 4XGKA 4JU8A 1KFSA 3AEUA 2FSUA 1MD9A 1JQAA 3RDPA 4IPTA 5EGNA 3VPHA 3ILVA 4B7XA 1IK6A 3BSWA 2ESRA 1B41A 1AA6A 1E32A 4M9QA 2FZLA 2AG0A 3NJ4A 3IUJA 1ZKDA 1EZ1A 1KNQA 2CKMA 1U9IC 2I4NA 1G4HA 4B47A 3GFRA 1VKOA 5IM5A 1K08A 2QXUA 4QXMA 4IX1A 3LAWA 4QDTA 4KXNA 1K1QA 3UCXA 1WMEA 4MW2A 5LQSA 1EXNA 4C0LA 2ZP1A 2GPYA 2A9KA 1V97A 3HYCA 3DMTC 1XWLA 3K20A 1NZPA 1W581 5CH5A 4BB9A 4A8PA 4MVJA 2AJCA 1R4AA 5FTJA 1SXJC 2QYOA 3HRHA 5EE9A 1AN0A 1ULTA 5KUTA 5LQDA 1YZ7A 3VU9A 3AY0A 3HFJA 1EDDA 1R6TA 1XD9A 1RYHA 5F12A 4JNKA 4L5CA 1RABA 2J8ZA 4CKWA 1UMDA 4BFVA 2OO5A 2O48X 1WVMA 1S3FA 1AQYA 2O4UX 4OM8A 1FW8A 3KZ1E 4IJ5A 4XQCA 3PEYA 2VJQA 1SL2A 3H4VA 2RGYA 4UDOA 4F93B 4TWRA 3JQRA 4CNBA 3FGNA 2WHPB 1NMZA 3FSGA 4D42A 3FUUA 4C0WA 4Q43A 4D4HA 4F8EA 4OJ5A 5TISU 4FLFA 2H2HA 3PO5A 3AY3A 1SCBA 5JFTA 2JMGA 5KOYA 4PGFA 5HXAA 3VH1A 3IEVA 5LYYA 5LU8A 4X95A 1SZPA 2DWPA 1R8JA 2FLPA 1HKUA 1JPJA 2XGJA 4KRXA 4B3TB 5DHTA 4GIBA 2C78A 2IEDA 1DG9A 4O4HA 2OXCA 2IHZA 2VP5A 4CMCA 4KACA 5D3MA 3IKVA 5TZVA 4PE5B 1GPYA 4KGZA 4FCWA 4DQ0A 1YUBA 3K05A 1KTVA 5K4AA 2HCTA 2J9FB 2P11A 2YTUA 1X7XB 5B3JC 3TL2A 1GNTA 1BU5A 3LSYA 2VDJA 1Y9AA 3NBQA 3R9KA 3X1ZA 4WUTA 1RLTA 2PRIA 4HAXA 4HQRA 5JAIA 3OZVA 1XROA 1HFWA 4DQDA 3U4IA 4QOSA 3E27A 3OBBA 3E5NA 5BOVA 5CLFA 3BD8A 5EKTA 1ORVA 1H94A 3DPSA 2XCAA 2EYUA 2Q5LA 5I4BA 4HSGA 4FNOA 5CM2Z 3VTZA 3IL2A 1JI0A 2GAJA 3SYRA 4IDPA 5FBRB 3OFND 3DDCA 2IE8A 3T3IA 3B48A 2XVAA 4UTOA 5F76A 2R8ZA 2WZDA 4UZFA 1ENYA 3HVKA 2ZU6A 5E9AA 5DCWA 4MP8A 4EHNA 3BXGA 3LDAA 5C8YB 1A4RA 3SHTA 4QO7A 4ND8B 4XFKA 1FLVA 3BWEA 1ZQEA 3QSGA 1Q3KA 1WNTA 4AS3A 4TN5A 3R7DA 2HO5A 4G26A 4OVKA 1A5AB 5E6SB 2VT3A 5BNFA 2ZQZA 2ZUVA 2WF6A 2FMUA 3B7WA 1BXGA 3UK2A 3CRW1 3TINA 4G6ZA 1Y37A 1GA4A 3UHAA 5L4SA 2O2CA 1MC8A 2WTEA 5EHXA 1KMQA 5C1PA 1UBRS 3AFOA 4NMWA 1YH3A 4RANA 3MC1A 4QGBA 2X5NA 1YHZA 1GN8A 3EDYA 3AF1A 2W2KB 4IIHA 4L2IB 1QRUA 1JECA 4H16A 5JLJA 2GAIA 1N5IA 3R74A 4DJEC 2J6IA 4O4LA 2HWKA 4YTEA 3H4DA 3RUHA 3KZVA 3JPYA 4NG5A 2PG3A 1BWSA 2EYQA 3VFDA 1WKCA 2OG2A 3PUVA 1DQSA 1AK2A 1TT5B 3W3AD 5KTKA 3KKOA 4I2AA 1DJPA 5EWGA 1P91A 3ON5A 3M6UA 1E0JA 8LDHA 1OV6A 3HBNA 5JYCA 4OGFA 5K8LA 4CLHA 4IUDS 1K7EB 3K9BA 2OK8A 3GRVA 3W2TA 4EM6A 2GILA 5JAHA 2FSFA 3L4BC 4DSIA 4F1WA 3EE6A 2XE7A 5KG4A 2PV7A 3TCXB 2AKYA 3IG8A 2W83A 2EGUA 1XT6A 3QG1A 4BNIA 1N5WA 2R1TA 4WLNA 2FR8C 2XBMA 3URKA 1YVDA 2QTMA 3RSLA 2YIJA 4HFJA 3VC2A 3CLTD 1E62A 1HIWA 2D4AA 2XOKD 2FOXA 3U4MA 1OW5A 2I3ZA 2IW3A 4Y2HA 2UZ3A 4KPUB 4CUKA 2F4NA 4D45A 2QORA 3R0VA 2WWGA 2DH6A 2XDWA 3B1KA 2GPTA 2G72A 4HPWA 3WB1A 1CKEA 2QZ4A 5C7YA 2BFFB 3JV7A 5AUPB 5EZYF 2RSLA 4BWMA 3B5JA 4XE5A 4N82A 5BOMA 2P9EA 2GLTA 4F9TA 4S05A 3MINA 3DTVB 4ZD6A 2IPOA 5AUOB 3NJRA 4TTTS 4EJSA 1L7AA 3IV7A 1UWCA 2CFTA 2UVPB 3E2EA 3HADA 3KPJA 2PX6A 2FEAA 3OUUA 3K31A 1I9CA 1RQ2A 2J3JA 4AJKA 1ODSA 3JWPA 3MYYA 3IIEA 4G0YA 4ZO7A 1JB1A 2ARKA 1N7HA 3PU6A 2AZTA 5GIOE 3ZVRA 2DUUA 1WBBA 5JV5A 3QYFA 1J0BA 5LJLA 4G84A 5ICMA 4ED7A 2ZJAA 3U4QA 1XJQA 2J4FA 3K0KA 1EPUA 1K3UB 1XPRA 1KI4A 1GDHA 4DYHA 4KE8A 4TKZA 2BM9A 1JEYB 3EBPA 4G5FA 3DHEA 3IYLW 5IX8A 3R23A 4Q1VA 2PX5A 1SXIA 2PKXA 4B74A 1P72A 3EZFA 4JLJA 1ZQZA 5BSEA 2BUAA 1ILWA 3HR8A 2LNDA 2ZJ2A 3JZIA 4E51A 5IAGA 3PRHA 4M9GA 2H2DA 4U63A 4MDFA 2VNAA 3FKSD 5HF9A 1FZTA 2XAAA 4F4ZA 3R76A 3CURA 3H75A 1QIMA 4WCFB 1U45A 3PQ5A 2H48A 3QUAA 1HF3A 5SZJA 1ZISA 3WY9A 3JQFA 3ZDEA 2YYYA 3WDLA 2HBQA 1EAMA 1LKYA 4OI1A 5MGNA 1KK3A 4B85A 3ZKWB 4DCCA 2H2IA 3A4YA 1SCKA 4RLQA 3IP5A 2AEJA 4ARVA 2G3YA 1CI4A 3DDZX 4H4EA 4IZ6A 1U9JA 2O8EB 1ULBA 1EK6A 5KWIA 2OAP1 2EW8A 5B5EU 4H0FA 4RHCA 2V5AA 4K86A 1LLUA 2IH5A 1ZXLA 4ZGBA 4YI5A 3OTHA 1HDYA 1CG6A 4QPCA 4GXTA 3WS7A 4QG7A 4JAVC 2OORA 4B9UA 5DYWA 1I7LA 1CRLA 3GUVA 3KKNA 3LHDA 2NG1A 3EF0A 4MS1B 3OGUA 1DZIA 4WX2B 1NI5A 1M0SA 5KJ6A 1T1GA 1XNQB 2VPPA 4X1KA 2XAUA 5JOQA 4H3HB 5DJ5A 1XRJA 2FSVA 1EFRA 4MW4A 2ROQA 1P7ZA 4IHJA 2RI1A 2DSTA 2I6XA 1T2VA 3EEQA 1KU0A 2B94A 4GSLA 5DGAA 2GPNA 1SA0A 1XELA 3Q7QA 3LO8A 1OXMA 5TQ2B 2J9XB 2A35A 1E3DA 4KLAA 1UC8A 2G08A 2XDYA 4M0LA 5HS6A 1E94E 3BWDD 3EW9A 3HM2A 3BQ0A 1ATIA 1SU4A 1XYVA 3L7YA 4LX8A 4HAZA 1TZJA 5JMOA 3LLUA 2X9LA 3ZNNA 3UATA 4W8GA 3NHUA 3C1UA 3MG9A 4DG5A 3DJYA 3UQ0A 4MIEA 4ZVTA 2DWQA 5EERA 1MXHA 5EPOA 3NW9A 1GLVA 4HGNA 1KO4A 1T5BA 4ZRNA 4QASA 4MWGA 4P8RA 4DDWA 4LYDA 4P54A 1J6UA 4XOIA 4C4ZA 4P0QB 3FPBA 1DKMA 1O8BA 1HQCA 3TWOA 3AZOA 1OXJA 3QW2A 2DJIA 1WCYA 3FTDA 4ER0A 1KEUA 3DPIA 2JD1A 1JDVA 2A33A 3W2GA 1CLEA 1PEYA 3CIOA 5GMOA 1CUHA 4FYJA 5EPEA 2ZRGA 3HFSA 1N3LA 4EGCB 4ZWNA 1IBRA 5DMHA 5A02A 3PIRA 3ESDA 3PS9A 1WO8A 3W2FA 2CHVA 3OHAA 1P0PA 4UCQA 4ED6A 2JIRA 1CQPA 4OSPA 1AROP 3JAKA 3RTAA 2P35A 4EHDA 2BPGA 3TE6A 4M1ZA 4DDVA 2ZVJA 1T5SA 2R8IA 2JW5A 2VJAA 3K72B 1CB7A 1URPA 3L5OA 1FDRA 1V1RA 3RAGA 2C3UA 4N40A 5K9ZA 1CVRA 4TMYA 5SICE 3GC6A 4D1YA 1DBIA 4E5NA 7ICQA 2QD2A 1HSOA 3GJ7A 3VA7A 4XIGS 5T67A 2PRJA 1DIGA 1HURA 5AK4A 1KGDA 4BWYA 2F64A 2OHOA 1TYEB 3LVQE 2B2CA 3TFOA 4M1KA 4BL5A 3DMNA 3HB5X 2BJVA 3X1MA 2QRGA 3IT0A 1HO3A 2AUNA 1KH2A 3R3VA 4UAJA 4OJYA 4UOQA 4KK3A 5HR7A 2BRUC 4TLEA 5DGBA 1WSAA 9ICNA 2M6RA 4M1EA 4E1VA 2XCIA 1KOGA 1KOFA 5IH3A 4X9XA 2QL5A 1H66A 1GGEA 2FPIA 4GRDA 1HEYA 2FZVA 2IA6A 4BFWA 3MJFA 4BXOA 4DV5B 4ZOLF 4Q8EA 4OJQA 4Q05A 2JIPA 4Z6KA 2GK7A 3QTTA 3QMPA 4B3XA 3KQUA 1FMLA 4M1TA 3MJCA 3NHJA 1U7ZA 4GXRA 4N48A 4KO2S 3WLHA 2BHTA 1PFGA 4GRIA 2BTQB 1BN7A 3GZNB 1LI7A 4DJDC 4NE2A 1G5IA 5H3CA 4HVTA 1USGA 3TMYA 3OM9A 1T3TA 4M0CA 3EODA 2W8BB 5F78A 5EMLA 3PT9A 4Q24A 4C0ZA 2ORWA 1KDZA 3NVZA 4RXTA 3FVRA 3W7AA 4IRMA 5HUQA 5L9XA 5FPHA 1TM4E 4EB3A 3W2EA 4JZKA 4LRWA 1KE1A 2GI4A 5DGXA 3DOEA 4RMNA 2BFMA 5JD6A 2PX4A 3EXHC 1XD2B 4GMKA 3BIFA 3T6KA 5ALUA 3GA5A 2QUZA 1K9SA 1P44A 5JPDA 1O6CA 2ACKA 4HDKB 3W06A 2QZPA 5J0OA 4YAIA 1J5PA 2YJNA 3PHGA 3BD9A 1G2OA 1NONA 1PT5A 1JZSA 1HNNA 2N1RA 2PRYA 1U7OA 2WB1C 2G0TA 2ZGVA 2RGCA 1IXRC 4LE0A 3JAWB 2XLBA 1RMYA 4QLBA 1QV9A 2QUKA 1GT91 3QH4A 2EWMA 4HAIA 4RX1A 1ZQTA 1E3EA 3NWBA 1M34A 3D8RA 5IC5A 3STHA 1OH7A 3C3AA 5DK4A 1DKRA 7ICSA 1DAHA 3OFNA 5EIAA 4B6EA 1R50A 2IUSA 2FSSA 2DUYA 3ADCA 4J9KA 5FCDA 3BK1A 3IVRA 3NBKA 1DMRA 5GV7A 5CT5A 4ZANA 5J5VA 4R3UC 1D8BA 4PHHA 2H3ZA 3GFQA 4MAMA 1G18A 2AV6A 4W5WA 2B25A 3F4BA 3SN6A 4LV5B 3PRYA 3DFMA 1E4EA 3UCEA 3GMSA 4W7HA 2WAQC 3GP5A 1ISGA 1QAOA 3IB6A 3UUFA 2W00A 1L5GB 2WYWA 3G7SA 5K2OA 3F9CA 5A04A 3BREA 2JHFA 1V96A 1IM4A 1U1IA 3ZBUA 2VDWB 4PC2A 1YZFA 5KX5A 3WYEA 2FFQA 4XXHA 5DB7A 2BHSA 1RYZA 3PTAA 3AB7A 4ETNA 1NXQA 2H2AA 3H97A 2IKQA 1P1IA 3SIWA 3AF4A 4R2IA 3UWOA 1CZRA 4DUGA 3D54D 1GNPA 1C9MA 1LLCA 1N9ZA 4ON9A 3RPEA 5M04A 3P9CA 3MS2A 3PC7A 3W3AA 4B33A 5AKLA 2C9MA 4QAQA 1X14A 2X0FA 3KXKA 4ZC8A 3UPTA 2R2AA 2B1JA 3GW8A 2GEJA 4OHVA 4HCJA 3WWOA 2IT1A 3U7JA 1TZMA 4NBLA 4CM4B 1J0XO 2X7XA 2KICA 4C5BA 1IAVA 3J81j 3D5QA 2BV3A 1NKSA 5FWXB 3QV1A 1ULUA 1XZKA 3RAEC 3PDJA 4AS2A 4ND1A 4QDOA 3PPYA 2QAGA 2ZVPX 1GIAA 2HFKA 3IUQA 1UWKA 5ECDA 3PHJA 2XOKA 5AVWA 4MV5A 1UK7A 2Z4RA 2X2EA 2NLOA 1Q17A 1L1RA 5IKOA 4P3XA 1Q2UA 3W6PA 3I2YX 4B40A 3F2CA 1XMOB 5KEIA 1JDBB 5F9HA 2GB4A 1AKYA 5EVJA 2JH1A 4RCYA 1KQFA 5DTEA 3PCRB 3GZJA 3A6HA 3U3OA 2Z2XA 2AYZA 3IVAA 1NBOA 4WOJA 3O8QB 1XVIA 1ZQAA 4GNRA 2CW5A 3OHMA 4P22A 1MKYA 3UJCA 1AY0A 5J1TB 3LQKA 1TCAA 3G2LA 4MYUA 5SZKB 3RC2A 2C03A 3DV9A 3TZKA 3ICQB 4HD8A 1DTSA 1KDYA 4KDCA 1XCPA 3OJWA 1CZKA 4FFPA 5FLEX 5BW5A 1NBIA 2PQ2A 4C4PA 5EHZA 4D7AA 3EGCA 3FYHA 1C30B 4YPOA 3JZDA 2PUDA 4P92A 1EK0A 1HORA 1PQWA 2K8CB 2QV7A 3SOPA 4IMJB 2G4VA 2W2LA 3MD0A 4HH4A 1PV4A 1UMKA 4MLPA 4KNYA 2EZYA 5AVRA 1LY1A 4JV2A 2LCFA 2CKDA 1Z0FA 2X2OA 1MQSA 2VVTA 3BWYA 3MJEA 3WJAA 1VLMA 821PA 3DBHA 4JYBA 3OMLA 1LBIA 2D2XA 3FWNA 4A8TA 3WRYC 5AKHA 2KS6A 3CNBA 2ZRNA 3STXA 3FKSA 1Z9BA 4DSZA 4RE5A 2BCQA 1OH5A 2BFDA 3I23A 4LF8B 1EVLA 4XX0B 3T1QA 2XI4A 2HWXA 3HDJA 2E0IA 3CPSA 4LZNA 5EPUA 4UM7A 1A0PA 3BJRA 2VYVA 3S1AA 2FSIA 4MUXA 4U0KA 3H9QA 3PI7A 3T0IA 5IBRA 6REQA 3FZYA 4TTPA 2REBA 4FPXA 1NF3A 4F4WA 4LRXA 1KY5A 4A10A 3VC8A 3WGIA 1QYDA 3K2BA 3QP9A 1ODKA 2QJOA 4ZEWA 3QBTA 1OB5A 1KIFA 3FBWA 1VLQA 3KJGA 4IMRA 1QBGA 2BYTA 2LYBA 5ER6A 5I9TA 3SXJA 1FUIA 2QZSA 3DD5A 5JC8A 1X9IA 1F8XA 4BV2A 2D0IA 2QLFA 2ZUTA 1HNZB 3IBFA 3FCUB 2WB2A 2VA3A 2ATLA 3KPWA 1FDVA 5EZ5A 1X2EA 4FOTA 1ISRA 4LOAA 2E18A 4TUYF 3MBOA 5JWOA 1LEHA 2NU6A 4M6WB 4XM2A 3K70B 1ZPDA 3KPYA 5EC8A 4RL6A 1J06A 3R2JA 4YV1A 1BCSB 4NJEB 1QO9A 2GXAA 1QYIA 4QL3A 1KZ4A 2C7RA 4W5JA 3VU8A 1REQB 5ETJA 2AJDA 2KN7A 3IN5A 4IDOA 1ESCA 1JIKA 4B32A 2ZSBA 4B3GA 1C3JA 5KOJA 2YDXA 4JI5B 4IEIA 2DBQA 1VSUA 3P7MA 2OEPA 4CV3A 3FCOA 4CN9A 1WCLA 2PT5A 4KL8S 2QZZA 3M83A 2JH7A 5IMSA 5G0VA 1BO6A 2XGOA 3SIPA 3MUFA 3UV3A 5HE9A 3V33A 1L8OA 4L5IA 2COUA 3C48A 4M3NA 2FYTA 2IJGX 3O8BA 2W4MA 2EGHA 3WX0A 3CXRA 2VC2B 3IURA 2I1LA 1R00A 5F73A 2PRKA 4DDMA 3VPFA 8ICTA 3URMA 3B1XA 3AM3A 2X9VA 1W30A 1CIJA 2WZBA 1K7SN 3HA5A 3KYCA 1ZQSA 3LUBA 4I2EA 4EO9A 4DSKA 1EM8A 3QVJA 1F51E 4YRAA 1BPZA 1K6EA 3NTLA 1MT3A 3O03A 1QKIA 5FT9A 1WMAA 5CPBA 3FPCA 1DHTA 2PFOA 3ZWKA 2C1XA 5J59A 2JAHA 4TMVA 1JAYA 5BNWA 3BJEA 4DC0A 1TO2E 3LIPA 3H5RA 2WG1A 1NUHA 1HY3A 4LKRA 3JTMA 3SNKA 3P9IA 5HEKA 1F0PA 2I33A 4XEUA 2BMEA 4DWVA 2HHTA 1F44A 3G2JA 3LX6A 3CYMA 3GPCA 2PO5A 4ZT5A 1F1JA 4IDDA 4M54A 3FZQA 5E0OA 4MWZA 1VBNA 1VSBA 3M89A 1QAMA 5J4LA 5EMNA 1SD2A 4D4JA 3FZNA 3CIFA 5BY2A 1A8UA 3FPFA 1PKEA 1SHLA 1WPQA 5JVDA 3O95A 2PFQA 1K8ZB 1CY2A 2R86A 1W6UA 1NW4A 3X1KA 1X74A 1ZGZA 1PSZA 1RWBA 4JWMA 1FO4A 1PJTA 3N3BC 1ESDA 3A6FA 5DI3B 1SVSA 3O8RA 1U80A 5AICA 4IBOA 2HLDA 4L6IA 3VR6H 4AYWA