1O08A

Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 1-phosphate
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-phosphoglucomutase
publication title The pentacovalent phosphorus intermediate of a phosphoryl transfer reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1o08A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1o08A01
5AW3A 1U2SA 5ALQA 2B30A 4BNDB 4FFDA 3QUQA 2EAUA 3U7EB 1RKQA 3ET4A 3NANA 3R4CA 4EX6A 5ALTA 2HX1A 5ALNA 3HLTA 1RC8A 5ALFA 4GXTA 4B6JA 5ALUA 1RLTA 3SMVA 5AKEA 1Z4IA 1O08A 3L7YA 3I28A 1VJ5A 3MMZA 4QQFA 2YMPA 4NAVA 4FE3A 3UMCA 2FPWA 2X4DA 2JAWA 2FPUA 2HO4A 3S6JA 4UM5A 2I55A 1YNSA 3FPSA 3I76A 5AI8A 3U26A 1U02A 2IYEA 3BWVA 5AI6A 4BX2A 4NFLA 2FI1A 2YFYA 1O03A 4UMFA 2ZG6A 1L7OA 2GFHA 3EWIA 2WF5A 2YMQA 3SKYA 2OM6A 4YIHA 5AKZA 1U7PA 2YBDA 1K1EA 1Z4JA 4BBJA 2G07A 3ET5A 1NF2A 3M9LA 2YMMA 5AW9A 3DNPA 2GHTA 4CF3A 5ALKA 1ZD3A 3E81A 4Y2JA 2YJ3A 4OCZA 3ZI4A 2HHLA 5AW7A 4CF4A 2ZBFA 3GYGA 5AM1A 4BEWA 5A3QA 2JAOA 1VJRA 4Y2QA 1NRWA 1RQNA 3L5KA 2OBBA 4KX5A 3D6JA 3WKEA 3ZVNA 4YCNA 2Q4TA 4OFZA 5AVQA 2W4MA 2ZBDA 1Y8AA 4AS3A 5T41A 5ALDA 4NABA 2WF6A 2RB5A 1J97A 3J7TA 5AKGA 4JB3A 4H1WA 2HI0A 3I6BA 5AKLA 4EZEA 3ESQA 1YV9A 2YMLA 4NWIA 5AW8A 5AIAA 2AMYA 3N1UA 1T5SA 4UASA 3WK8A 5AICA 5AVVA 1U7OA 3W5AA 3W5CA 3WK4A 3NUQA 3L0YA 4C4RA 2IOHA 4MUMA 2ZBEA 5IS2A 2YJ5A 4Y2UA 3EF0A 3QUTA 4XQ0A 4GIBA 3QU5A 3DAOA 1QH9A 1RMTA 2FPSA 1Z5UA 1Z4OA 2MSNA 3QX7A 2BDUA 1RMQA 3OCVA 5IT0A 3F9RA 2PQ0A 2MU1A 2HDOA 3QXGA 2G08A 1ZD4A 5AM3A 4MWOA 4UM7A 5AK3A 2YJ4A 2I54A 3OTQA 1F5SA 3QUBA 4UATA 1FEZA 1VFPA 4HGQA 3ZVLA 3QGMA 4Y2PA 4F72A 3ED5A 2DQSA 3FVVA 4UU1A 2NO5A 2OYCA 2ZOSA 3ESRA 1SWVA 5A3RA 5AI9A 4OHFA 1L7NA 3WGUA 2ZBGA 4C4SA 5AHXA 2B1RA 5JJBA 1ZOLA 2C8KA 4XPZA 4G63A 4C4TA 3UMBA 1QQ6A 4UMEA 3R9KA 1YDFA 2O9JA 3TLMA 1NNLA 5AW5A 5ALPA 1RRCA 2EATA 1Z4KA 3PGVA 5AW4A 2FDRA 2IOFA 1MH9A 4UAVA 3N28A 1RPZA 1IWOA 2B1QA 1J8DA 2ZXEA 2FPRA 3L8EA 3DDHA 2I7DA 3KOOA 3ZUPA 2O2XA 3WK6A 4J03A 3OCUA 3KBBA 1ZJJA 4Y2XA 3IB6A 1X42A 4JDPA 2B8EA 5E0OA 5AVTA 3E58A 1EK1A 3OCYA 4ZEVA 3BA6A 3SD7A 5ALVA 3NRJA 1RLMA 3MPOA 1TJ4A 1Z88A 5ALRA 2GMWA 2RARA 3L8FA 2YJ6A 2NYVA 2Q5EA 1L8LA 1KYTA 2P27A 3E8MA 4EENA 4EELA 3M1YA 3AR3A 2YY6A 3IRUA 5ALEA 1ZD2P 2YN4A 4BX0A 2FEAA 3QNMA 1SWWA 5AW0A 2OA0A 3E84A 3OCXA 1ZD5A 2FUEA 1L7PA 3ZWKA 1Q92A 2WF9A 3U13A 2I34A 1JUDA 5AVUA 3I1YA 3AR9A 3ZTYA 4Y2SA 2WHEA 5A3SA 2MU2A 3ZU6A 4BX3A 3AR5A 3NIWA 4CE6A 2Q4RA 1U2TA 2CFRA 2CFTA 3L0CA 4ZEWA 3CNHA 3L1UA 3N5KA 3NALA 3MC1A 2HCFA 1L8OA 3U19A 4IG4A 4FYPA 1PW5A 2C88A 5AIBA 4L57A 4DW8A 2I33A 2AH5A 3FPBA 2JARA 1Z4MA 3QU2A 3U7HB 1Z4NA 5ALSA 3AR2A 2HOQA 3ZX4A 3QU7A 3QLEA 5FP0A 3K1ZA 3AR6A 2HSZA 2B8JA 3A1CA 3SF0A 3OCZA 4YH1A 3FGOA 5AW6A 3WKAA 3WGVA 1TA0A 3QU4A 3P96A 3NAMA 2AGVA 2HF2A 3RF6A 4KNWA 1Q91A 4ZEXA 4Y2VA 3KDPA 5ALZA 2GHQA 1TJ5A 3A3YA 3ZWDA 2RAVA 1RQLA 4HGNA 1LVHA 3B8EA 2NO4A 4IFTA 4O8CA 3NASA 5AVWA 3A1EA 5AKYA 4YGYA 5ALIA 3SKXA 2BDEA 3L0BA 2JAUA 4Y2RA 5AVYA 3FZQA 1WZCA 5AI5A 1SU4A 2FUCA 2BY4A 4KNVA 2WM8A 5ALMA 3PCTA 3DV9A 3U7FB 1YJ5A 4L6CA 4CNQA 4RETA 2WF8A 5AM5A 4L6AA 2RBKA 3EF1A 4Y2YA 3A1DA 1RMYA 4BKMA 1XP5A 2VKQA 1L6RA 4UAUA 3QYPA 4I9FA 4BEVA 3R09A 5AW1A 1RLOA 4HAIA 4KN8A 1Z4PX 2G06A 3EPRA 4KX3A 3SHQA 1QYIA 2WF7A 4KYTA 4I9GA 4DWOA 4UMDA 3KZXA 5AI0A 4RESA 5AM0A 3WKBA 2PKEA 3AR4A 2G0AA 2CFSA 3N8GA 2PR7A 2G1AA 2FPXA 3QU9A 5AVRA 1YMQA 3RFUA 2B0CA 4XE5A 2C8LA 5IT4A 2AUTA 5AKKA 1L7MA 5ALHA 3PDWA 1EK2A 5AK5A 3AR8A 1TJ3A 1CR6A 3U7GA 2QYHA 3L8GA 2HF7A 1Z5GA 3WKDA 5AM2A 2R8XA 5AVXA 2JGAA 3L1VA 1XPJA 3UMGA 1RKVA 2B82A 5AVZA 4YCLA 1WPGA 4UW9A 2CN1A 4Y3UA 4G9BA 3ONNA 1YS9A 5AKHA 5AESA 2HEGA 4UARA 3OCWA 3ZX5A 1LTQA 2G09A 3SLRA 5ALWA 4HGPA 4UMVA 5AM4A 1AQ6A 3KD3A 2QLTA 5ALOA 2I6XA 3WKCA 3W5DA 3WK7A 2C9MA 4QJBA 3CZ4A 4XOUA 5ALYA 4HGOA 3HYCA 1Z4LA 3WK5A 3B9BA 2P69A 3L8HA 3KC2A 3ZW7A 1Z4QA 2ODAA 5AK4A 5AKJA 1S8OA 2P9JA 5ALJA 1XVIA 1ZRNA 5AI4A 4EX7A 2G80A 4OD0A 4BYGA 2D2VA 1ZRMA 3QUCA 5ALLA 4J2TA 5AW2A 2C4NA 1N9KA 4NV0A 1QQ7A 1WVIA 4UU0A 1TE2A 3W5BA 1T9ZA 3OPXA 4YCMA 5AK6A 4EEKA 2IOFK 4DFDA 4HYTA 1WR8A 2W11A 2P11A 3IJ5A 2R8EA 4AS2A 5AVSA 1CQZA 3WK9A 1RDFA 5AKXA 2GO7A 4F71A 4DCCA 2W43A 4CF5A 3AR7A 3PGLA 4BNDA 1T5TA 3ZTWA 3ZVMA 4E88A 2WFAA 2IA5A 3N07A 3FM9A 4PNHA 5ALXA 1QQ5A 3VAYA 2EARA 1N8NA 4Y2TA 1S2OA 4YIKA 5ALGA 1ZS9A 3B9RA 4HGRA 1RKUA 3UM9A 2R8YA 2R8ZA 5AKIA 4AP9A 3MN1A
chains in the Genus database with same CATH superfamily
3AILA 2ZIWB 4EQ6A 2VHVA 5A1TA 1Z5OA 5JRDS 4A82A 1PLJA 4ZOBA 5I4CA 1KWGA 4LJKA 5G41A 3W8RA 4DZRA 1P39A 4HH1A 4B34A 1XEAA 1G55A 1KI9A 1T2VA 2BTEA 3BB4A 4XARA 4WXRA 4NMHA 2ZR9A 1T5HX 3PX3A 1MABA 1GYRA 2ZBVA 4MPDA 2E1RA 4IDFA 4X3OA 4L4RA 1OLOA 3B52X 4F8JA 3KQNA 4JVLA 1HT3A 1Q83A 3VGPA 1V9LA 1TKCA 4KE8A 1BXRA 1HE3A 1G42A 8ADHA 1Z33A 3OZ7A 1EMDA 4C78A 3KSRA 3ZI4A 1APBA 5D5PA 1DK3A 1K98A 5T6BA 3A32A 4DMFA 4URVR 3HL0A 2YHBA 1ZQOA 3CO5A 1EP2B 2Y4OA 3TR0A 5AVQA 1Z5VA 2I4OA 3AHFA 3KFVA 3ANTA 2D5CA 1Q0PA 1SB9A 1HV8A 4LI3X 2OE2A 4FYMA 3K2QA 4NWIA 2PRIA 2NW6A 2AMYA 3VR5A 5CYGA 1AKTA 1PJQA 3IBSA 3EYZA 1ZOIA 3H11B 1VIMA 1DKMA 1R18A 2HIMA 4M8LA 3U40A 1H0SA 3CTMA 5B7GA 2BGUA 1E3MA 3HA7A 3H6HA 4JLDA 4MNTA 2QSUA 3IC5A 4CKWB 4MWEA 2YQZA 3MCVA 1B23P 2J87A 2WLSA 4PSCA 1YZYA 2NO5A 2KMLA 4V3BA 4NFSA 5C8YB 3QVUA 2P9HA 4CM4A 1I3OA 2I66A 1VL5A 1TF7A 3LWBA 2Y1IA 3V4SA 4TYNA 4O0LA 3AJ8A 2DLCX 4IM7A 1TAQA 3ZE0B 2Z4TA 4LNUA 2J7KA 1K7EB 4KVZA 1KFCB 4RMJA 1DKQA 1YB1A 4J7XA 1XC7A 2YFKA 2D5AA 3SD7A 4WBNF 3ZKAA 2R8KA 1P8AA 3CWCA 1X7YA 4UTNA 2P27A 4TZ6A 2RKBA 4H7DA 4MKFA 4UB2A 4JBHA 4WY8A 3WV5A 5HJEA 1A98A 4PWZA 1UBNA 2E8OA 4JB0A 2KLHA 5L9XA 4U7GA 3DZ8A 1MO5A 1QK4A 3TBFA 4ECRA 2IE8A 2LMRA 2VAXA 1OX5A 3C1ZA 3REOA 4E5YA 2F8TA 4LC9A 3QFCA 4Q7EA 3P96A 1R66A 3NQ41 2X8LA 4DWWA 1Y5NA 4YAKA 3TZQA 3PL5A 3OH8A 3QBTA 2JASA 3OQIB 3NS7A 3DEKA 4U6NA 2EF0A 5L3QB 5JALA 1Z7WA 2EDCA 2H8GA 5CVEA 5EKDA 2OD2A 2YV1A 2RBKA 3AFOA 4ZVVA 1V8ZA 3LX5A 4PAGA 2VANA 1SZCA 1KYYA 5GADl 2EJUA 2A0XA 3TW0A 3QOFA 4F50A 1U3GA 2AFVA 1VKJA 1CQIB 3JVUA 1VCMA 5AKKA 3U3KA 4KCGA 1QDEA 3SYRA 3H5LA 3WWCA 5DI3B 1FMJA 1YDEA 4D44A 4I29A 3G5LA 3IAUA 3F8SA 2ORVA 3DDOA 3IODA 5JLAA 1ID8A 4GM1A 3LUDA 2FYTA 3RH0A 3JWPA 1COOA 1Q46A 4QWMA 3R6TA 4XJTA 4HGOA 5EQDA 2UYOA 3LG2A 4PTZA 1M5UA 4X5OA 3ZW7A 4GD3Q 3DP7A 1Y6RA 1JHPA 1M1XB 1IOVA 5WRFA 4AKEA 3WNQA 4J94A 2ZT7A 3H3FA 4L4UA 1PL6A 4I14A 3V4ZA 2JH3A 1D4ZA 3HP1A 1E92A 3RJMA 3HI4A 1UP7A 3ZHQA 2B61A 3SC4A 4DSOA 1XZKA 5LJIA 3PFGA 5IVHA 2IVZA 1WB5A 1SQFA 2IA5A 4YRDA 3GEPA 1T3SA 3JPOA 1QLWA 5BMVB 4J4TA 2OILA 2O8NA 3QX9A 1GTVA 4UNNA 2QMYA 3C48A 1WCIB 3HLTA 3EW9A 3L04A 4F5OA 3O8QB 4WCFB 2OT3B 3KV1A 5BMOA 3WIBA 3PWKA 2OBNA 4V39A 4FIDA 2FPWA 1G17A 3UPQA 2YZNA 4IDOA 4BO4A 1Q1BA 2ACEA 1GDTA 1Z63A 4V0LA 2QTBA 4HLUA 1VJDA 1VIYA 3WWPA 1L4HA 3DDUA 4CF3A 1D1QA 2AL7A 3IBGA 3BQTA 1GG9A 2D1QA 4QXMA 1A96A 2ES4A 2QPAA 3ZNQA 4CR7A 4BP1A 3L7AA 3CW2A 2DPIA 3WRXC 1HR0B 2Z1MA 2H2DA 1EZ4A 4PAQA 3RVQA 4HQOA 1JROA 4KLRA 2AQ0A 2VH5R 2P9CA 2ZPAA 1BA3A 3O3MB 1PLKA 4CM6A 3UN1A 3C24A 4W7SA 4ZVPA 4HBZA 3I2GA 5IS2A 3D6AA 4DC1A 1RPNA 4N0QA 2AZTA 1RYHA 3CSDA 1VMDA 9ICLA 4PHGA 4Q93A 1BWPA 5I3ZA 3STTA 2DQSA 5TF0A 2AMFA 5IH7A 1YRQA 3V1UA 3UAVA 3IDFA 2AZMA 3IIKA 5TNXA 2DAPA 1FTNA 1Q21A 3Q1KA 2CDBA 3KL4A 2VYND 4DQUA 3BTVA 3WDKA 4ZT7A 2XMQA 1Z6AA 5IXJA 5INTA 4W1RA 3MSCA 1XAJA 5EP2A 1K8QA 2ONZA 3CLTD 4RQUA 1F2TB 1EE2A 4Q9NA 4I08A 5E0OA 4PZOA 3JWJA 3T7IA 4Y6QA 2Q5IA 2F3PA 2H9YA 3ZDAA 2HR1A 3DE2X 3TPZA 1L4FA 4Q3BA 3QNMA 3VR2A 3CA8A 3KTAB 4J9RA 3FKSA 2CXQA 3BZCA 3MB5A 5BWNA 4LGCA 4IRCA 1E8DA 6PFKA 2AK2A 4MRMA 2NTYC 1VG1A 4Q1BA 1OPXA 1OZAA 2RHLA 4TMVA 1SV4A 2V6IA 1W0KA 4C29A 3PUXA 3VZDA 5F73A 4M47A 1IQRA 1L5FA 1EFPA 1A95A 5EP4A 3VH3A 3F98A 4J9OA 1AMUA 3NEPX 3V46A 1KJZA 5KYYB 3BWCA 4HDRA 4M9JA 1DG3A 3TEFA 2FN3A 1P61B 3HU5A 3FOZA 4MZXA 3KAQA 5EGNA 4HB3A 2AI1A 4IVQA 2HA4A 2HPVA 4ZZ1A 4BLVA 3D6TB 2P0YA 1M2WA 1Y8QB 2IS6A 5JVDB 5EVJA 3TQQA 4MHTA 1OFIA 3SJCA 4U9IS 3KLMX 4U9UA 3ZBQA 2OXFA 3CZQA 3RTBA 3NO4A 1M6YA 1NULA 1CJCA 3WL4A 2OGWA 2C1XA 1L5KA 3N05A 1AT1A 5HBRA 3PO5A 1ZMTA 3HZOA 1G3UA 1QHHA 3ZV7A 3F9IA 1T8YA 1DXSA 3MJSA 1MRSA 3ZWVA 1WDLA 3R6WA 4GP7A 1NRJB 2A1UB 2CBXA 2ZE8A 2A9PA 4O1MA 1AGYA 2JFGA 3MWEB 5KL1B 3AVTA 4JCOA 1GPYA 3HB7A 3AINA 2BTQA 2ZTEA 3LZDA 2W04A 4IIHA 2GFQA 4BDTA 3HSKA 1GU7A 4X45A 1XOIA 3MWYW 2JXJA 1S8AA 4A8HA 2W11A 1V8DA 4Z53A 2J46A 2GO7A 1HMYA 3Q8QB 4LTMA 4D0GA 2GYWA 1JXAA 4IMRA 2GUGA 4IJQA 1NJWA 4ISCA 2DPLA 1JHZA 2WQZA 4IL6U 1GP2A 2ZJAA 3H2KA 1QS0B 5E6SA 3W4JA 3USES 5EVCA 4QGHA 2VAPA 3ME5A 1E3WB 4CL3A 4QJ3A 5DB4A 4EA7A 4BLUA 5JE8A 2JLXA 1R0WA 3FNBA 1MAAA 1YUNA 4NP6A 4OHUA 3I76A 4ZN6A 3F9CA 3ANLA 2XQGA 4DCPA 4CFSA 4NFLA 1TQ6A 1SXPA 2F3UA 1TTPB 3DGFC 2Q49A 3HBNA 2B4TO 1QK5A 1ZD3A 4XGKA 3T79A 2PGIA 4Q4AB 5BNFA 1JAZA 2FNAA 2XBLA 8ICQA 1C50A 3JALB 1DJPA 4GE0A 2QL7A 3O0FA 2LCIA 2NPIA 2V0NA 4B6PA 3UUFA 4YP5A 2RB5A 5IAEA 3BTUA 3K72B 2RLTA 3DE3X 4DSFA 2OHOA 3L8CA 1AOXA 4YBZA 1UZNA 4DPMA 3SYTA 3QELB 4O4LB 3SI8A 1XRPA 4C4YA 1B15A 1R64A 4KBFA 3BUSA 3EF0A 3D7MA 2CC2A 4I2BA 4JI2B 4Y9RA 3BF7A 2HXGA 3FDFA 4NCKA 4NL9C 2YJ4A 1FUIA 4OU4A 1F5SA 4OKIA 1VFPA 3QGMA 5IWAB 4KLOA 2J07A 2HD4A 3MS7A 4C4SA 4FP9A 5HQ3A 2F2AB 1XKXA 4DRYA 1OE0A 2I3DA 1UJMA 5ALPA 3CF4A 2M9MA 1YJAA 4IC9A 4AIIA 4ZQGA 4EHIA 3ZEIA 1N32B 1F7VA 3VR4H 2IYOA 4J0CA 1ZC4A 4QO8A 2OUIA 2OHXA 2JPDA 3GCGA 5DYGA 3JPWA 3WNVA 2JC3A 4AXBA 4FNOA 2HBRA 2ONJA 5HIKA 3MZ0A 3FCCA 1D04A 4Q1FA 5IEJA 4NY1A 4GMHA 4ZCTA 4RF3A 1J5EB 2XNHA 4RH1A 2H07A 3HM2A 4YRGA 4QWBA 1QYCA 3BORA 1YCGA 2Q5FA 4YDQA 2WIJA 2ZSFA 3IJEB 4W1PA 2BRUC 3ZJVA 1QFYA 5F2EA 5L3RA 2WUWE 5ED0A 3ISTA 3VISA 2JVIA 3QM1A 2VJ5A 4IGEA 3OT1B 3OA0A 1I2MA 5B64A 1DCMA 4HC4A 4FHCA 4C5CA 3JAKA 3TOXA 1T2FA 3IOYA 1V5IA 2HA2A 4M1KA 4F21A 2J6BA 4IGFA 2WJHA 2W6JD 3VU3A 1GQSA 5BUSA 4GOXA 4BBAA 2ZWMA 4WNAB 1KBOA 5KYXA 4HDSB 2FRVA 5KEIA 4XWKA 1ONOA 1NVEA 4GE3A 4YJ3A 2VQ6A 1VE9A 3B9JA 1FS4A 1G5TA 2VF4X 2QY6A 3R6LA 1N4DA 1RU3A 4KX3A 4RE6A 3WMFA 1M5TA 3AG6A 3BGSA 4I9GA 5KYGA 2XV1A 3EUEA 4NIMA 5AM0A 2IA6A 1EBFA 1OLUB 1M54A 1QIHA 4FCTA 2J9ZB 1YQEA 4EGQA 2VHEA 1XZMA 2X7JA 4TVOA 4OXXA 5BSEA 2NV0A 2MSEB 4NZPA 1YR2A 2D59A 1XL0A 2AHRA 5KCMA 2BR5A 2B5OA 3KYDA 5GPBA 3IE0A 3ZCPA 3ZGNA 1SQ0A 1T0PA 4HAYA 1FTYA 4ARVA 3ZK8A 4IWYA 2K4IA 2WAYA 3X44A 1JHXA 1GT6A 4CT0A 1ONBA 3MVEA 4RWEA 3FWZA 3DBLB 4K26A 3RJIA 1M2FA 1OGJA 1L5SA 2OB1A 5FKJA 2C0CA 3OO1A 3IR6A 4LSWA 2JZBB 5EJ7A 3DXFA 4ETMA 4J9UE 3T3GA 1HXHA 2WJ6A 3T06B 1G9XA 3VZBA 1N0UA 5EOZA 1PCXA 2BWJA 3Q15C 5ALGA 3NTUA 2C7QA 5KSWB 5FFMA 1U2SA 2KS6A 3SZGA 4QNLA 3GVHA 2G5PA 4RAQA 2XXJA 1G4AE 2A9FA 4OK3A 4UM8B 1O08A 4BS9A 2NXNA 2QARA 4QTXA 1ILWA 2XUPA 5HHIA 5EESA 2JFNA 2NO1A 3J81A 2HJHA 1AHHA 1YNSA 3IQEA 2WIDA 5LXTF 1YRBA 4HNAA 1ULSA 2YFYA 1ZA2A 2NZUG 4MS1A 3Q7QA 2PGXA 1GL3A 2X77A 1XNSA 4UTXA 2CBZA 2PH7A 3QV2A 1UZUA 3LU1A 2N42A 3S2YA 3DFUA 2PUJA 3NG1A 2ZPTX 3KTOA 4QBGB 3IPCA 3PIDA 1BE8A 2R5NA 5J40A 4Q3CA 4MPTA 1ZO8A 1G21E 1T8RA 4HFNA 1IVSA 2WJVA 8ICVA 4BX9C 1FMLA 4O2BF 3SC6A 2MRLA 1CVRA 4NECA 1BROA 2G82A 2QV0A 3P2MA 1FTWA 4I0WB 4IEIA 2C07A 3D2NA 9ICMA 2JFPA 1ISFA 5CBPB 3SM9A 3JWEA 2IZ7A 1W29A 4CHTA 3E03A 3MFYA 1KS2A 3U7IA 5IAAA 1SA0A 1UM9A 3HGMA 2L19A 5IPFA 4JOBA 3L84A 2ZROA 2ZBGA 1MV5A 2KM1A 3B3GA 4Q24A 2J9FB 5CFNA 1OFUX 2PZAA 2PKRA 5K05A 1O9BA 1QHYA 1GR1A 1XTKA 4KQMA 1QV6A 4PRLA 4EABA 4ED7A 3OE5A 1FVOA 1I7NA 3HVJA 1ZJJA 5LA6B 2QN1A 4R16A 1EAMA 5EFOA 1C3OA 1H0RA 2XIQA 4U2BA 4Q6WA 2Q5EA 3CBGA 1GNQA 1V7CA 4D4IA 1GZ4A 1TLTA 2REBA 5M3BA 1K6IA 2QM7A 1SU6A 1Y9DA 4F6CA 3KXIA 1XNQB 2CXHA 5DT2A 2NPFA 4DB2A 3ZIAA 1XZGA 3PC7A 3U4HA 4AQDA 4Z3OA 2V6MA 5GONB 4KBGA 1XB2A 1IEXA 4DLVA 1MR3F 1F1BA 4F4CA 1VB5A 2Y0BA 5HF8A 3BE4A 2CE7A 3AVQA 3V1NA 4GR9A 4MA5A 5P21A 3A28A 1NDHA 3M4XA 2AGVA 1LZKA 5JWRA 5KFHA 1ZBQA 1HEIA 2H4HA 1Z8HA 3R44A 2IYVA 3RUHA 3IUBA 2ZT8A 1EFAA 3WQBA 2V7QD 1Q95A 3OKFA 3L43A 2BDEA 4RZRA 2ECQA 2BH9A 5HVNA 5KG2A 1U98A 3DCYA 1BJTA 2GLEA 2ZGVA 1ZJYA 3P32A 2JKVA 5MF6A 1NNEA 3H18A 4HWPA 2NYRA 4YMUA 2OPHA 3KHHA 3G0DA 3K16A 5L1JA 3TUZC 1TM5E 3RFTA 1QYIA 4WN9A 1HSOA 2AVDA 2VJMB 5PNTA 4PFSA 1K7CA 2VYCA 3HMKA 2BKAA 1E2NA 2DWOA 2G1AA 4C7MA 3JARA 5JNLA 2QT0A 3BDVA 5BQXA 4RVCA 1QSGA 3TOSA 1EFKA 2A6PA 3GJZA 3DMDA 1W2GA 1U8FO 5JXGA 2C2MA 3V9PA 5LQRA 5K0BA 2CNNA 3TQIA 1JG6A 4UB5A 1IAQA 1IXRA 1ML3A 5KNBD 1DJMA 4AG6A 3G9UA 3LY7A 2RH4A 4URWR 4IXWA 5J29A 3AFNA 3NVWA 3AERA 1HLFA 3PYXA 4BCBA 4EUKA 3PCXA 4HNUA 2P4UA 3WGTA 1DC6A 3NM6B 3UQZA 1Z4QA 2CWDA 1UF9A 2WB2A 1TJNA 1I2AA 2HL6A 1UBGA 4DKJA 2N75A 2GO1A 1A82A 5G0UA 1UPXA 3SDSA 2DWPA 3BMXA 2POCA 2P4EA 3KLOA 1NVVQ 4FMBB 3ETLA 2OGUA 3HW8A 3OX4A 5HOQA 3NXSA 1KKXA 4AYWA 1C20A 1GCIA 3NC4A 1WL8A 5ALQA 3O6VA 3QUQA 3C5FA 4XUGB 5GIPE 4KO3S 3PW0A 2XB8A 1Z6YA 3I09A 1V4VA 2BKUA 3BWXA 4MUAA 4OHMA 5C37A 3U4IA 2AG5A 4A3SA 2IYYA 5CA1B 4HPJB 3FX2A 3KK0A 3VJLA 3PICA 5HX7A 3BM5A 4NXMB 7ICKA 2W9CA 3V8QA 4INJA 3M6UA 1WSBA 1HE1C 5AKZA 2FOLA 5DLGA 3ZBPA 3HWWA 1H94A 1DDIA 4AF6A 4YHBA 2DR2A 2ES6A 4GXJA 4JV0A 1V96A 1KVQA 5KTTA 2FPLA 2ATXA 3V80A 1NJ6A 3ROGA 4CYMA 4EZBA 3F6EX 2WTMA 4ENUA 3HUTA 4H1WA 5CB8A 1TTQB 2WJAA 2FH5B 1VYUA 3GB9A 3ISBA 3DYVA 1Y3IA 1A8SA 1XZQA 1DQPA 4N7RA 4TVKA 1B0UA 1NK7A 3PNYA 1DX9A 4F60A 2CLLB 4Y2UA 2OCIA 3GLHA 2NUAA 4YP9A 3N2YA 4R8MA 2Y6VA 1GGNA 2BQUA 3QE3A 3JU3A 1C1DB 4XDYA 3VKUA 1V25A 3ZOZA 3NC0C 5FTJA 3NATA 3QEKA 3ESRA 2QP4A 3SICE 2Q3FA 1U8AA 1SQ6A 4FQ5A 2QNRA 4B75A 2D2XA 1YJBA 1TCUA 4F5EA 3BE6A 4KSBA 2JIZD 1NF3A 4H0FA 2W55A 3ZU2A 3PC8C 2A33A 4OJ5A 1TYCA 4ALKA 3E9QA 5DMHA 1JKFA 2DBVO 5CDFA 4XVQA 3DKKA 1GNPA 4EARA 5A2GA 3BA6A 1II0A 3RQIA 1GGFA 2YY6A 3TSYA 4P81A 4MB0A 2BR4A 1JVSA 4D99A 3DAGA 1J70A 5HS4A 3UAOA 3K94A 4ZQEA 1KVTA 4BIMA 4C43A 2GETA 2I8LA 4MRVA 3AUSA 3HZRA 1WUHS 4OUDA 4C5BA 4MZDA 2NO0A 3BGOS 1VJGA 5KKAA 1PN3A 1EX9A 1BE6A 3QUAA 4TXMA 2GBLC 3KDPA 4QTYA 1U2PA 3Q5EA 1S01A 2J8ZA 2IYXA 3O94A 4N82A 1NN3A 1FSSA 1H69A 5EMMA 5F23A 1NFFA 4EFNA 2R66A 3PG5A 4W8OA 2JAUA 4N7JA 4PQRA 2H4YA 1R5NA 3FRIA 4XM1A 3OPYA 4TYWA 4G5OA 3AXTA 5HUQA 3RBXA 3LUHA 1A9QA 3BSWA 3O9ZA 5AW1A 4C3ZA 1CW2B 3USCS 3BIXA 1CC1S 1CUJA 4O0MA 3ES9A 5IJ9A 5ADHA 4JLUA 4A6XA 4ALNA 4QBTA 2ZI4A 1CRWG 3AF6A 4BRWA 4KL8S 3SEFA 4R5MA 1ZEMA 5FTKA 3OEWA 1PNVA 5CNJA 3IVAA 4EG0A 2DOKA 5T4HA 2PZBA 3IAHA 5L4SA 4HRAA 4Z6EA 1GG5A 3CZRA 3VPHA 4N6GA 4MQEA 4PLCA 1EQAA 4HLDA 3H2ZA 3JPYA 3AIMA 1JNXX 4FC6A 2LHTA 4ECTA 1S5LU 3NB0A 4OLHA 2PX3A 5CCBA 3F6BX 1UC5B 4TWAA 1ZEJA 1YS6A 2BD0A 3LVRE 1MKYA 4IUDS 4CN8A 3B5EA 4EUHA 3COWA 2RGCA 4FUQA 4F7WA 1QG2A 1WEHA 2UVWA 5HE9A 3DMHA 5C7LO 3M83A 1ZYQA 2OR3A 1IFXA 1L3UA 1SUWA 5LQKA 1K2VN 5AKIA 5SYMA 3FTEA 1RYSA 3LT1A 1BYUA 4E5NA 3ICPA 4G1CA 2VOEA 8ICCA 1E1YA 2O52A 4NYIR 4B6JA 2BCQA 1ZQDA 3EGCA 8ICEA 3BQ9A 5CA0A 3I28A 4RTQA 2JGJA 1W4AA 1ZWKA 5A4FS 2A1AA 3L40A 3N8IA 4OHVA 5BPHA 2BGWA 4Q4CA 1IDOA 4EHHA 4QZGA 2GFHA 1P1BA 2QIPA 3P0IA 3LXRA 5J4HA 4KUHA 4MEYA 2DCMA 1JEYA 1ES9A 1OXVA 4I99A 1CRLA 2PUDA 2ORWA 4IOMA 3E9NA 3QFRA 1OA1A 1PGQA 4NOLA 4DQIA 2AGOA 3PBKA 2ODQA 1EINA 4I1OA 1YMVA 4FD3A 5KFPA 3OG9A 4FXOA 1GRNA 1YASA 3SF8A 4F4HA 3RROA 1HMPA 2W00A 1REQA 3S2GA 4Q1DA 2K7FA 1JU4A 4ZOHC 2QTFA 2JAHA 5JAMA 2B3TA 4RANA 2QP9X 3EGWA 4KO2S 1L6IA 1N5RA 4QZIA 3TLGA 3V6HA 3S1SA 2C4MA 4MRSA 4Q4HA 2PYZA 2BSAA 3D7LA 3TCKA 3UF0A 4HGQA 4M46A 3PVZA 5JC1A 1KRWA 5K6RA 4QTZA 4AURA 3UGKA 3LWMA 3UXNA 4GQIA 1U4BA 3V33A 1CUEA 4P4PA 4P3KA 4HTFB 1STOA 2D5IA 4PPNA 3FPEA 2HW8A 2BM1A 4ZT3A 2FPRA 3WAJA 1MQ9A 4OL9A 4BMSA 4ZD6A 4TXLA 2IZ6A 1PUZA 4AB1A 2ZRPA 2J30A 2WB4A 4L0MA 3O38A 1R9NA 1ZSVA 3GRAA 2YC4C 8ICBA 1SRQA 1NLUA 1X6VA 2XMGA 1BYIA 1JH8A 5FFFA 1CK4A 1NT2A 3EXEA 2XUDA 2ZT5A 4OA8A 1NK6A 1KEUA 2C9YA 3KKAA 3HN6A 1LPNA 1MOSA 1U2EA 2GA8A 4M9SA 3R3HA 5DYWA 4O59O 2DSNA 1XNGA 3BRWD 3WJ2A 3TAHA 4A10A 3K6JA 1Q17A 3MWLA 2LIPA 1Q91A 3ONEA 3V6JA 3MYYA 3H8SA 4W5OA 3LDUA 2W7TA 2QYSA 3VO1A 4NG5A 5J2CA 3W78A 2D5LA 1LUAA 1OH7A 2GYUA 3C29A 1OLXB 2MSKA 4MV7A 1V6CA 3HZZA 3ZIUA 2C4VA 1I24A 3HT3A 4KNVA 2OM2A 2IZZA 1TTTA 1D7AA 1E7WA 1YGPA 4ND5A 5E2IA 1DK2A 4WDQA 1QP8A 4GS5A 2JIPA 5HR6A 2O2EA 4NBWA 2NGRA 2G4CA 5IJXA 1UBUS 2H18A 3T3MB 3T5MA 4L16A 5G0TA 1KNQA 1NN5A 2J3MA 3QQPA 2VVTA 2V03A 1SUDA 1JMKC 3VSDA 1N78A 4NMXB 2BEVA 1TAHA 2PD6A 4M3NA 2EG9A 1PWXA 3HXKA 1U2GA 1U5BB 5JRZA 2GD6A 3RF7A 3R8XA 4HBGA 1EXNA 1ZVVA 4MIOA 1SXIA 4M2LA 4YP0A 3GAMA 1KZYC 2GN4A 3I83A 4CMEA 5L6MB 1DTWB 3RSQA 3HU1A 5EXPA 3UPDA 1JEDA 1GGEA 4OQZA 1M1YA 2C31A 2XMBA 3KUKA 4HLCA 1Y5RA 1L5YA 3KHKA 4WACA 4BNFA 1ETUA 2C5BA 1U0NA 2I6GA 1LC0A 1WZNA 1N6KA 5FLXA 2AF4C 3K0HA 2F4VB 4LNAA 4JBYA 3NM4A 3IDOA 3UK6A 2NU6A 1Z74A 4DJ5X 4BO9A 1LPMA 1XGKA 1QIIA 1LPPA 4HAWA 4PZ0A 5K09A 3O0DA 1Y3BE 3IUPA 5KPJA 2OAP1 1QLJA 4WZAE 3LYSA 4TKMA 4CIDA 2FZWA 4RIEA 1G6HA 1YS7A 5JS6A 1BMQA 1BX1A 2FFAA 4RA9A 3ZY2A 3IHQB 3ZG6A 1RVDA 1BE1A 5IM4A 3B1ZA 1ESDA 4IUYA 1FK8A 4CLRB 1FDWA 2WYHA 3ROQA 3C7CB 2A5JA 4GAEA 5FPHA 3UMCA 4QA9A 1M9NA 2JLWA 3IP8A 1GXSB 1TM1E 4II3A 1XI2A 2C0PA 1Y48E 1Z47A 2Q3MA 4IIUA 3PR1A 1H2AS 2OHFA 3B38A 2XE7A 1WSAA 3ROKA 1CRQA 1WHSB 1ML4A 1AQIA 2AC7A 1OQAA 2XY4A 5ABPA 4JJ4A 1R3UA 3QP9A 3LVQE 2WB1C 4XQGA 1Y88A 4AWBA 1UPUA 5NLLA 1NZBA 3OLYA 1LKZA 3P0FA 4MIEA 3KAKA 1ATZA 3P9IA 4JNCA 2NMVA 3C5HA 4NABA 4TVSA 4BNZA 3AI1A 3I1FA 5DLPA 2W6JA 5TS2A 4RQ5A 1Z6TA 2WICA 1OGIA 5GTDA 5LD2C 1G0NA 4R0NA 1J0XO 1T10A 3EXG1 3CVVA 2ZBQA 2ZSIA 3UUGA 2Q3JA 4DRZA 1T4DA 1VGRA 3PP8A 2NRTA 3VC1A 3CB2A 1TVMA 4I3FA 4BLQA 1O6ZA 4EYEA 2WOOA 1YZFA 4P93A 3FBWA 4TKUA 4MH0R 3AB8A 3CUTA 2MSDB 1L5OA 3EMVA 4MWTA 3UA3A 5I7RA 4H4DA 4PHAA 1N56A 3RC1A 3VKFA 2PH3A 4CF7A 2XD4A 3IOBA 3NR2A 1NNLA 1PS0A 2RJOA 3AV3A 2NRWA 1VKNA 1Z8DA 2VXOA 3B82A 4KW7A 3BSSA 4PZZA 3K6SA 4HWOA 1Z5WA 4PYOA 3IDAA 3PFIA 4YRKA 4MROA 1QHIA 3IUYA 2A86A 3G7NA 3P7MA 4MGEA 3Q9UA 5FTNA 4A0FA 1QIJA 4DR2B 2Q41A 4QUDA 2PGOA 2YKGA 2FUEA 5K9ZA 2ZW9A 3AMZA 3SX2A 4O1IA 5JBIA 4FBGA 4ZALA 3OFND 8ABPA 2BPOA 3E8SA 2ZWPA 2BI4A 3U19A 7ICMA 1IY0A 4N5LA 3E5HA 5DTRA 4QOSA 1NOJA 1QYDA 3S3TA 2I33A 4XD7D 2AW3A 3T9EA 1WNTA 1PGJA 3NAMA 4K9MA 3LQKA 5ISMA 3IA7A 4CETA 4GSKA 3ZWDA 1RQLA 2YIDA 2ERXA 7MDHA 1FY2A 3SKXA 2I62A 1ESNA 3JYHA 4O2AF 1YMUA 4AKTA 4GOND 5DEIA 3QE9Y 3CPSA 4O29A 2V1UA 3V6LA 5HFNA 3MILA 3CVUA 1KK2A 1ZG3A 2PFSA 3QYJA 4WBNA 3ZQUA 2PKQO 2VSQA 3I5YA 3I2IA 4BU1A 3HWSA 4ZWNA 4RK4A 2PKEA 3A6GA 2VFAA 2B1JA 3AG5A 2DY1A 3DBHA 2ZSDA 4J16A 4Y9SA 4LNUB 4N76A 2OCDA 3DVSX 2WMNB 2VP4A 1WPGA 4I81A 3GJXC 3T0GA 4GPIB 2HEGA 4LK3A 5FIUA 1X7YB 3LLCA 4U2KA 621PA 3ADCA 4Z4FA 3LX8A 4QASA 1NZJA 2AQ8A 5ALYA 4F4KA 1Z4LA 4RVOA 4UBKA 2CLFB 1UZLA 2WTUA 4CCAA 2VDQB 4Q4DA 2YRWA 3BFXA 4IRUB 1ZBDA 3VPCA 1LC3A 2Z1DA 1IN8A 4JB8A 3WGHA 2QLJA 4MITA 3EGVA 3ZGXA 1X1DA 1C14A 3LY8A 2W71A 1MSWD 3D3NA 4OM8A 4B5KA 4OUKX 3GNTA 2W54A 3AEXA 3IFSA 3PZPA 4BEBA 3QE4A 4DEXA 1ZS9A 1WB6A 5IWCA 1JFLA 3WO0A 3GT7A 1JA0A 3P0JA 1KTQA 1BDMA 3HO6A 4MO2A 2R6GA 4LF4B 4RPHA 3F7MA 3L93A 2C82A 2AJTA 2XYHA 2GCOA 2XBUA 2RH5A 3WZLA 1XZEA 2IYTA 5C81A 1J90A 4X6UA 4AYBF 4ZHSA 1ZY2A 4PLFA 1X80A 4NLNA 4WJZA 1WD7A 4D3ZA 5FYDA 1BDJA 4FZMA 4FEGA 3GMIA 1OIWA 2QPLA 4X60A 2XWPA 2R87A 3P0HA 2RHWA 2G3YA 4R83A 1IEVA 3ZE8A 1O97C 3UATA 4CF4A 2C1EA 5KDDA 3T1OA 5LLSA 2C58A 3ZD8A 1ADCA 5KFVA 1E2MA 1T2CA 1P5JA 3BMQB 1GKKA 4X24A 5C34B 3MR5A 2EV9A 2D5BA 4WRRA 3KOZA 5F7ZA 5DV9A 1KI7A 1XTIA 1E7RA 1GU0A 2V7QA 1XIVA 1KW4A 1FNBA 2NM0A 3DHYA 4CT5A 3E18A 4ECUA 9ICVA 4LMRA 2WEKA 1RMTA 2CL7X 3PE3A 1ZH0A 3UT0A 2XY7A 1H2ZA 1ZMBA 3DE4X 3EDYA 4TTTS 3D8SA 4Z86A 4C0WA 4K05A 4A73A 1F0KA 4P4LA 3W4IA 8ICFA 3BJEA 5I3CA 1PVQA 1NQOA 4FGUA 4JYAB 2C2BA 1ZNYA 4PRKA 4D8WA 3CEAA 2AOUA 5J0SA 4PONA 2PH1A 4NV1A 1YRWA 1I5OA 5J5CA 5HQTA 4A92A 3BMCA 5KNBA 1RQPA 3MNFA 2PO7A 2GOLA 2Q3BA 2B8EA 1A3CA 5EP3A 3V7LA 3MPOA 2WQ6A 2YJ6A 1KYTA 3I9FA 3V2IA 5F3DA 5CHGA 1ZK1A 3MXOA 4AMUA 4IDNA 5HIAA 4MI3A 4NBUA 4BV2A 3A31A 2VJYA 4X93A 5DXFA 5EE1A 3TADA 3HV2A 1SG0A 2OORC 1VSTA 4RZXA 1Z9BA 5EJAA 4XSHA 1XYYA 1EXMA 3T3DA 5JNUA 5BRJA 1Q1AA 3BK7A 1JDUA 1PF7E 2EQBA 2JARA 3U7HB 2XMDA 1DUSA 2FPGA 4Y9TA 2ZRJA 3G17A 4MYRA 4JDUA 3U5ZB 3VVBA 3AOGA 4PPGA 5KAIU 4WLUA 5JD3A 3BH0A 3LBAA 5DGXA 4FJ0A 1LVHA 3GIKA 2ODGA 4LQLA 4LYHA 4FCCA 3ZV4A 1I9GA 4YJFA 4OBEA 5I7AA 3RIEA 4P4SB 1RWXA 2EIXA 1RSZA 5SY9A 2ZE6A 3LVVA 4XVHA 4IIDA 4TUPA 4BFTA 1MNQA 1ZR4A 5JZSA 1C7FA 2EVWX 3MGBA 3TQOA 4HAIA 4B3HA 4BAGA 5EP1A 3NBFA 5EWJA 3PFKA 3AF3A 4BDSA 2R48A 1CUVA 1WQ4A 5K03A 4N5NA 4ZICA 5KJCA 1OW5A 3UG7A 1GCUA 3L4KA 2FEPA 1HBJA 2V6JA 3LC0A 3SBDA 1QM5A 3IKMB 1OUMA 3RFXA 4KDFA 1X1SA 3SI7A 4Y3UA 2ZJ2A 3I62A 4NK5A 5TC4A 4DC0A 3UC5A 4JB2A 4FGLA 1I14A 5KNDH 2QVYX 4Z4IA 9ICCA 4ASUD 2O8DA 4B32A 4QM7A 4P80A 2PS1A 3U7RA 3WLEA 2XW6A 9ICKA 3EVGA 1TZBA 3R8CA 2NZXA 3Q8XB 2KN7A 5KFAA 1NI5A 1GKYA 2ICAA 2ONKA 4JSTA 1PBTA 3ZKWA 4MDEA 3E22A 1V1RA 4ZVOA 5DB8A 4MW9A 1QQ5A 5GP1A 1D4FA 2NAPA 1EFPB 5LMZA 1C0LA 1Z7YA 3MJRA 1D2AA 2H7CA 1PV2A 5FBWB 1KWKA 4MW2A 2YYSA 2JIZA 4UASA 4O1HA 4XB2A 2J41A 4C4AA 3JQ8A 2DT5A 2P9EA 4BRZA 1N63A 3EVFA 4MV9A 2PXHA 2ZYSA 2IH5A 1Q2XA 3QVWA 4XQEA 1RTTA 3SYKA 5CLLA 1CLEA 2R7MA 4MULA 3R8FA 4BP8A 1CBUA 1YR9A 3BCUA 3ZDYB 2RG1A 2IPLA 2VHQA 5H70A 421PA 1PP4A 1RYDA 4XXHA 3SXUA 3QXHA 5CW1A 3DZHA 4OH7A 4ADSG 3PVCA 4LE2A 4Y2JA 1BD4A 2FR8C 3VR3A 2HMUA 5AM1A 1J56A 4QELA 3ZNOA 5IARA 4B31A 2A1IA 3LGSA 3HCOA 4RT2A 5JNVA 4YN4A 1X1CA 4PPQA 4GLLA 4YACA 2OOKA 2ZQZA 4MP3A 3CX3A 4EZEA 2VSOA 5KT3A 3VQTA 4WJKB 4UBIA 5ECDA 1Z45A 4F6RA 1NV9A 4M1SA 3NHPA 2P41A 2Z08A 3HC7A 3SZLA 1WSWA 3LP5A 1J9EA 4J3FA 2V45A 2IP2A 2H5EA 4LZAA 3C74A 3CIOA 2NO9A 3RHFA 3KB6A 5JYCA 1LDMA 4ZHQB 3TYXA 4Y2PA 5DIFA 2XVXA 3Q87B 1ZN8A 4XUEA 4YT5A 1QIDA 1PV4A 4WVFA 4OJLA 1CP2A 4WKPA 2HK6A 3WGGA 2LYAA 5CJPA 1TUIA 3THVA 5KFTA 2BLNA 2IXAA 4RZ2A 2DU8A 3L1HA 4PQGA 3UZUA 4ISBA 1C0EA 3AUJB 3N5CA 5LMCA 3L7LA 2CLCX 4DLSA 9MHTA 3UK2A 2CEKA 4YJ2F 2E1EA 2O6HA 3ETDA 5LKRA 1FP1D 1W5FA 1NE2A 3HR8A 1GFIA 4G56A 3MLAA 3K4PA 2HRBA 4KOEC 4B84A 1B3BA 5D84A 1N48A 2QUKA 2FZ5A 4Y9UA 3OD1A 2ET6A 3NIFB 1B1AA 5CYFA 3FVWA 3T5CA 3LT0A 1RZUA 1DGSA 3OOWA 4LZLA 3KETA 4JOSA 2BGKA 4FX5A 4J6EA 3DUFA 3Q10A 1G7RA 3WRYC 4G0YA 4BO1A 1BC5A 5LB2A 2I2DA 1RI2A 1M33A 1O95D 3HP4A 3KT3A 2BM9A 4ZH4A 3L0SA 3IP4B 1TEVA 1Z15A 2JCGA 2XGGA 3DFMA 1W46A 1RQ2A 4G1BA 5T8KC 2DQ4A 2WZDA 3ZZUA 2RAPA 4YVFA 4KRGA 3DQPA 1EB8A 2HK7A 3F97A 4C14A 2O7VA 3C16C 2C57A 3T9AA 3DKIA 5B7PA 3LY5A 1XMQB 5EHNA 4K3VA 2WF8A 4P0TA 3RVNA 1Z7GA 1P9OA 1C4XA 2XDYA 3BH7A 4BBZA 4E5KA 1UMBA 4MVJG 1BKYA 4NESA 3OOEA 2AKAB 4FIZA 1THMA 5J2HA 4WQMA 4L4XA 4DWOA 3IT0A 2Q2OA 4N7BA 3AKCA 1HH4A 4I2NA 4H6XA 5H9WA 3DLHA 4E08A 3TTXA 4EYIB 3RTCA 1FXWF 1PT6A 2EQAA 3IEUA 4LVOA 4RHTA 1MO3A 4P4GA 1FDRA 2CN1A 3OT4A 2ZDQA 3KT8A 1C4OA 3QVTA 4HZUB 3EUWA 3ANXA 4ZPJA 2NNWB 4UPVA 1EUCB 1UJBA 3R9WA 4CIAA 1WD5A 1KJ8A 4K6CA 1JP7A 1NXTA 2HRZA 5AI4A 2PL5A 4NJ8A 3L0PA 2PA0A 5E3JA 1WZUA 1GG8A 1Y63A 3H4DA 3JAKB 4UXJA 1MOQA 3H6KA 4N9WA 4FHGA 1JKMA 2O1EA 4QHYA 4JBNA 4F5NA 4P34A 2PXAA 4ICIA 1M0EA 1DB3A 3OHSX 4ZJPA 4R8UB 1PQ4A 3B2QA 2BHNA 1U65A 4K3UA 5E95A 1WZEA 2ZVQX 4Z54A 1H8HD 1FP4A 5DBBA 4A16A 2KZZA 1MU0A 5LP6F 2A9QA 5KYXB 1D5WA 4YJ3B 2C54A 1FZQA 2WU3A 3DM5A 4BDPA 3VMMA 2XMZA 2FFBA 1C0PA 2VRCD 4D92A 1KDPA 2NZ2A 3JVDA 1O2DA 4CEJA 1LWNA 1K75A 1VTKA 3RT7A 2GD1O 1H3NA 2H2GA 3CH5A 4ZJUA 3NPAA 5E4YA 1G59A 3TLCA 4EGJA 2JW5A 4TM8A 4LHSA 1O6GA 4TYQA 1RP7A 3EUAA 3BRWA 3KYDB 5KJ1A 1IOWA 2FP4A 1XVAA 4IIGA 5BR1A 1T5SA 5JECA 3T1HB 4XGRA 5FOXA 5AICA 1HDGO 4M2YA 5HF9A 1NKVA 3AKDA 2P1RA 5IAJA 4F2SA 3TQRA 4EFKA 3GZFA 3TTVA 2N1MA 4RMIA 1LZLA 2ZB2A 3R4VA 1CY1A 2W6CX 3GWZA 3QXGA 4LJRA 1YBMA 4XUDA 1A9XB 1CR0A 4NYIQ 5DP1A 4NARA 4C6TA 2Q8PA 5LXTA 4FZNA 5LUAA 2BGNA 3IPXA 2C8KA 1GLNA 2CJFA 3T9CA 1M0WA 1KK3A 1UK9A 1CDZA 2OOSA 3IQZA 3GLFB 1CR2A 1J9GA 1HTWA 3TQHA 2VXYA 1ZQJA 3TK1A 5B3LA 3I9OA 4MPJA 1IXZA 3KOOA 1FW6A 2GLXA 3OCUA 4GGMX 3ZK7A 2H57A 5E2AA 4LHWA 4E2WA 2X1VA 6ADHA 1P7CA 4ND7A 3H8WA 2RP5A 1T3NA 3MGAA 2Q1SA 3GG9A 4MS1B 1ZJ6A 3FZGA 5H3LA 3TLYA 1QV9A 4CDMA 5L4NA 2PFGA 4BBPA 2ABWA 1L7PA 4O2BA 1W0CA 3ZD6A 4YFVA 4QZDA 2HWKA 1JXOA 2EF1A 3UUEA 1N6HA 2ZRLA 3M81A 4W7IA 2JIQA 1RAFA 2VT7A 4OF4A 5JTTA 4KWTA 4XAQA 1CDEA 4EG8A 4M86A 4DYDA 2RHDA 3PSHA 1XRMA 4YAFA 1BHSA 1QVVA 3KAPA 3EQZA 2OFFA 1QCCA 4RCYA 3RVJA 4ND8A 1XC9A 4D0RA 3FB1A 5A7FA 3VYUB 2Q21A 4ZEXA 5CPFA 4BNTA 3SJZA 2XX3A 3OMWA 3PSTA 3ZWOA 4KQJA 2FDCA 4MV4A 1SD1A 2NSYA 4UBOA 2HNAA 4IFTA 1FFVA 3AM5A 4M1MA 1I3KA 4HH3C 2X40A 2OZVA 1MB2A 1BPDA 3ZH9B 5JROA 4YNBA 3GFOA 3DYBA 5I7WA 5K3CA 4HO1X 2VIIA 2UZ1A 1V9PA 4BJ5A 4OLAA 4PZ9A 4BLTA 3KUUA 4DSTA 2O3QA 4FBTA 1SA0B 3AQEA 1UM9B 1O9HA 3H6GA 4MVJE 2N9UA 3Q2IA 1PTJC 1ZQTA 3M9NB 2V9PA 4F4IA 1PQWA 4EOGA 3I72A 3NAQA 5DRTA 4R9NA 1WBJB 3ASVA 4RESA 5C46F 3AFHA 4BWVA 2G67A 5EZYB 2JFQA 2QMZA 1F8FA 5ALHA 1SBZA 1JU3A 4EW1A 3MAJA 4L9WA 3AOEA 4V0NA 1Z5GA 2VYVD 3H7IA 2WHXA 3KZIU 3ONNA 1RAGA 3DCNA 2GYYA 1PYOA 1MW9X 5K5EA 1Q16A 4CL0A 4JP1A 3CRQA 4HB0A 1KEZA 2X19A 4GFDA 2E6KA 1XP8A 3QZ7A 3E70C 1P33A 4PHEA 4RFVA 3F8TA 3BBLA 3TDNA 1CRPA 1PRYA 1FE8A 1WCWA 1ICIA 3SYLA 1S5PA 1XHEA 3FSRA 1QP0A 1MLDA 4YCMA 3D4OA 3QBEA 1DLJA 4N18A 1O57A 1LK7A 2WKRA 5B7QA 2IPXA 4YXJA 2RRDA 3R3VA 1OXMA 5I45A 3SX4A 1AO0A 3PLNA 1SKWA 1Z62A 4IYJA 4YREA 5CLFA 4URFA 2R8GA 1RJFA 2PLWA 1E99A 3U7EB 4XIJA 2OO5A 5EPOA 5IIOA 4KLGA 1XEXA 4WH0A 3DLBA 4AVYA 2P40A 1JDPA 4WK2B 3WP0A 5L1IA 4OHBA 1EGAA 2JF0A 3OLWA 4WN9B 2LKCA 4B48A 2Q4EA 4WIAA 4CCSA 5BY2A 3P27A 4GLOA 4TTQA 2YBDA 1K1EA 3DE6X 3HJGA 1XDDA 3JARB 5AP9A 1DC7A 3OFNA 4LZPA 3HCNA 3QZUA 1OH5A 4NE2A 4DWJA 1CE8A 4F56A 3P4YA 5DYYA 5C3MA 4XD7A 4RIIA 3UWPA 1KOJA 4GLBA 3AERB 1XD2A 2WV7A 2ZR8A 5SV2A 1NG9A 1H4SA 2XT6A 1PVPA 2Y1JA 4LV5B 4RULA 5ICMA 3K0CA 2WKQA 4G0XA 2IJGX 3DVLA 3PWSA 5LPNA 4PGXA 4KP7A 3ZU3A 3A4IA 1BVYF 3ZLVA 2KB0A 3A06A 4DSKA 4RC9A 3SQOA 4M9CA 5ESRA 5IVKA 4H77A 4ZANA 4K2HA 1GV0A 4DMGA 5DM4A 3ALRA 1GSHA 3OCJA 1W1UA 3EH2A 2DF4B 5A5EA 3ADOA 4RHEA 4JI6B 5A9SA 1YKFA 2R4UA 3D0OA 2HJVA 1SGGA 3MSXA 2GEFA 1G8FA 1R8SA 2QTRA 3FF1A 4TTJA 1NYQA 4QDZA 4IEFB 1EQ2A 4UB3A 1MX9A 2IDMA 4KJXA 2OWEA 4BHTA 2W9CB 5T14A 3LUKA 4PYQA 1R0BA 4W9NC 4ARIA 1BZYA 3CZMA 2ZXHA 3KDAA 3V8BA 1GAWA 1B2LA 2QZJA 3X2EA 5JDIC 2I34A 3ZJTA 1VHWA 1I7SB 1CY4A 5JU5A 3AYXB 4B3MB 1WOMA 1RABA 4FM9A 3GRPA 1T4BA 1WCXA 4N3BA 4EKEA 1R4NA 1PJAA 3WHLA 2Q8NA 3SMQA 2FK8A 2FXVA 2X6TA 2F1HA 1CDOA 2YVLA 5GY7A 5F1KA 3GUZA 3PITA 3V7FA 1Z26A 3KHRA 1PSZA 3SC2B 5EKSA 3THSA 4AUNA 3UA4A 2C7PA 2WFLA 2QDKA 1MJGA 2ADOA 2XECA 4B45A 1NUSA 5IHPA 4NLBA 5B3KA 2RHFA 5JLJA 2J1LA 3TM4A 3GLHB 1TF2A 2XOXA 3O2SB 3PCTA 3ZBUA 9GPBA 3ZGZA 4JBXA 1BGXT 2IC5A 1TCBA 1R6DA 4ZTBA 3WLTA 2VKQA 3G9XA 4L4YA 2VZ0A 1W5AA 2JG3A 2RGNA 3MT7A 1V3VA 1IEQA 1L3IA 5L9AA 4Y1FA 3C3YA 1KJJA 5FL3A 1HI9A 4ZV7A 2VWQA 1R16A 3Q3EA 4XRHA 3MRSA 2G9UA 4GX5A 1MN8A 1P31A 5AHKA 4JP3A 1DAOA 1FJXA 1ITZA 1I3NA 2R79A 2VDLB 4N03A 4XOIA 1LTQA 4DDMA 3DPUA 2B9EA 3M5PA 5F64A 4LMAA 2JD1A 1R12A 5ADUS 5KNLA 1R9MA 3EZ6A 1GDDA 1YB7A 2PANA 2XMSA 5BV2P 3KC2A 3HHPA 4QAQA 1M8FA 3VKWA 3UMRA 1M2JA 1T8TA 4HGZA 3PFCA 1KZ1A 4OFXA 3MWGA 3OOYA 3U5TA 3KG2A 2WNSA 3PHCA 4HOYA 3ZEAA 4BV3A 5DK4A 4WECA 1GARA 2Y93A 4MGKR 4Y2TA 1M6VA 5TJHA 4ZAFA 8ICKA 2EP7A 1XJQA 1SCBA 4KSYA 2HVHA 3M5DA 3M6WA 4EX6A 3J81k 2ONCA 2PH5A 1AQYA 2VHYA 2C96A 1NURA 1PUIA 4GQAA 4MLZA 1JA1A 1WSDA 2ZTSA 1UBJS 3LZ6A 1W85A 1DFIA 4R1LA 4USAA 5JRTA 5IJ9B 2P6OA 4YRMA 4RGBA 4ML3A 1PT9A 1CLUA 1HIWA 3Q3VA 2Q6LA 2P5YA 3ZWCA 1G8HA 4MK4A 3FUVA 1MOPA 2MMGA 3MRTA 1N2OA 3BX1A 2QLNA 2BC9A 4H7FA 3C6QA 2E1FA 3EPGA 2NVWA 2GEKA 5EE3A 3QZ8A 4MQEB 5C5IA 1YR6A 1TUBB 4DFPA 1NVUQ 4UXHA 1PZMA 4N7MA 3VR3D 4D98A 1WLSA 5BV1A 3Q3HA 3KQQA 3V97A 2PR2A 4OGFA 5FQOA 2DFTA 5J1SB 1TM4E 4V1CB 1RBZA 4JU8A 1AS2A 1UKEA 1X7DA 3FRHA 4DPKA 2LKDA 4YRSA 2DUJA 2EAOA 2GK6A 4EL5A 1U45A 2G08A 2J5KA 4RABA 3T7SA 2FPIB 4IJUA 2EW2A 1ZJNA 5CTJA 4Q00A 1X9WA 4P5PA 5KHOC 3T5JA 1FQWA 3X43A 2F55A 1TPZA 2RDMA 4ZT6A 5EHXA 4Y1RA 4Y2HA 3G2OA 4DLNA 4L0QA 2YR0A 2VDJA 4R8SA 4TWIA 3M6MD 1Y34E 4PE5B 2IHJA 3H1BA 4QU0A 5ALRA 1U0BB 5KG4A 4PV7A 3DEHA 3DR5A 4U2EA 4ASUA 3UQYS 1VHJA 5TZVA 2IYLD 3HY4A 5KFRA 1GGHA 1JEYB 2YYAA 2NO7A 2ATEA 4HH4A 4Q3OA 2HF8A 2M6RA 3ASUA 4QE3A 2ENWA 3BMOA 4L22A 4BB0A 1KVSA 5C8ZA 4DCSA 1AKUA 3PWTA 4AWXA 1Z38A 2HQRA 5KO2A 4JQCA 2QB0B 1ZVKA 4M1ZA 2K7ZA 1G7TA 3NZEA 1QIEA 1R5BA 3SF8B 2OC9A 4TLBA 4AO7A 1IHXA 4X1KB 1REQB 4KLEA 3EEBA 5JSUA 3QLVC 3KJQA 4C87A 2D0OB 5FOTA 3KWFA 1QHSA 1CZNA 2YWEA 5C4MA 1WP9A 2R65A 5DCWA 4TV8B 1RWOA 3MT8A 4DR5B 3J80A 5K1ZA 4WKBA 5KOYA 4GLXA 5BWOA 4R3NA 5HM8A 2MT9A 1Q7RA 3KE9A 2ZT6A 2D1SA 3A0BU 5LZ8A 4C0QC 4PHDA 3TBKA 2I7VA 4WN3A 1N7HA 2IEBA 1ZQCA 4M7OA 1TMGE 2XH8A 2PGJA 2I03A 4DV6B 1U9ZA 2DFNA 4K6HA 2PU7A 4FFNA 3EA4A 3QVGA 2IBMA 2UKDA 4F3NA 3C7DB 3SSNA 2GXSA 3V32A 1ZH4A 3PHLA 1MB4A 5AM2A 3OJLA 2CV2A 4ITVA 2R8RA 2RHHA 1ZR2A 3ND8A 3IYLW 1USGA 2G09A 1BPEA 4Y6PA 4ZU6X 3IESA 3IOMA 3EQ8A 1ISMA 2XWQA 4O3MA 3FVRA 5LC1A 2VWGA 2HOFA 2FEXA 3D4PA 5FUMA 3QKTA 2NT3A 1YS4A 1X6IA 3GJ8A 2VUUA 3UAYA 2E4ZA 3EXEB 5I8ZA 3BQMB 1ND5A 1V3QE 2O2SA 4BYGA 2XZOA 4ZI3A 1XSNA 2XCLA 2GEJA 4Z4CA 3V5NA 5ICGA 3N7TA 1FUKA 3WK9A 3W6PA 5M29A 2ATLA 3BFPA 5KAPA 3VR5H 3TN7A 1KAMA 3PQFA 4LGMA 3VJMA 3AEVA 3EDQA 4A8EA 2YWRA 3RJJA 4WV3A 1CNMA 1PD1A 1U90A 2O4CA 1K5OA 2QPTA 3KPUA 7REQA 5D01A 3WNZA 3PNLA 1GPH1 4JX8A 2OEHA 2GHRA 2JMGA 1NKTA 4HJRA 4JJ7A 1I51A 1N7IA 1PHPA 4PGFA 5HCNA 2Y3IA 5GM2A 6GPBA 5KPDA 2V96A 2VTVA 3GBSA 5BN5A 3WDSA 2FI1A 1UC9A 1SC4A 1UIMA 4KR2A 3KJFA 4RQMA 4PR0A 3LK7A 1CQJA 1YIDA 2JNWA 2BFEB 2Y1XA 3UO8B 3P97A 5HRAA 1KI2A 3V6KA 2AOTA 1SXJD 3WMXA 4UEQA 1K5DA 2DZDA 1O95A 1QR2A 4UNQA 5IJ0B 3R0VA 5JD5A 3T8YA 3PO4A 1U9IA 2Q2NA 2JFFA 2ZWVA 4FDLA 1JFRA 1X9MA 1YV9A 3IDWA 3O4FA 3PZRA 4KXFB 1MH1A 2PMWB 3DEYX 2Y0EA 2B5VA 2ZK7A 2JB9A 5DTEA 5C8DA 4MP8A 4LSZA 8ICYA 2XCRB 1EG2A 3N2ZB 2X8WA 2IH2A 4CLXA 4HWRA 3RR7A 1FFGA 5BQPA 4U2GA 3I8OA 3UK1A 4WZZA 3FYUA 3RU3A 2GF2A 2NU6B 5TEWA 4LXQA 2GLTA 1WB9A 1SHJA 2PUFA 3FA2A 4ALLA 1RQRA 2YQ4A 3OFSA 4WSOA 1WAMA 3AP3A 1U9CA 4AZWA 1OAOA 3DB2A 3GJ6A 1KFTA 2WSLA 2Q6OA 5D7BA 1PEKE 1TJPB 2UVPB 5H8WA 3ICXA 3FNRA 2LV8A 5JDCC 2GT1A 2HA5A 4KFTA 2FA9A 4D8UA 3V2GA 5AVTA 3FPCA 4UNPA 3WNCA 4OGLA 2ZEJA 1SKYE 1UP6A 4DUGD 3ZDRA 2JLCA 4TLMB 4ZA2A 2G76A 3IDZA 2WM2A 4XCVA 2I6SA 3ZHOA 3DS8A 2FWJA 3BS4A 3E9YA 1AV7A 2DCUA 1J1IA 4PLZA 1BCRA 3RRFA 3M9XA 4I6GA 3BRQA 3ZH2A 2GD2A 2ZSJA 3KSBC 3N7RC 1QX3A 2PSJA 1ENZA 1Y6ZA 3VV3A 1B6SA 1GPWB 3IUNA 2UXCB 3FOCA 5JCOC 1VLHA 3UKJA 3RIMA 4QRDA 1PW5A 3BXZA 3BHJA 2P2LA 3KUXA 2AH5A 3VPFA 4NM2A 5COQA 3VO2A 3RF6A 4I9UA 3I52A 2BUCA 2BTOA 1H8HA 2MSWA 4KN7A 4EB8A 3IMFA 3SU8A 1P1CA 3IOEA 5AKYA 3FOWA 1ZH2A 5A71A 4IVPA 3RT9A 3H5WA 3IXMA 1HPLA 1VIAA 3OSNA 3LKVA 3L7IA 4TKUB 3QOYA 1GPUA 2NVBA 2GS9A 2VRCA 3ILVA 2UUCB 3RVSA 3C5GA 2AI3A 4E0BA 3L4EA 4Z1MD 2EZXA 1PNRA 4AYTA 4X1OA 3PT9A 3QPAA 2HUNA 3GN1A 3WL8A 4PHCA 2AR0A 2PR7A 1XA0A 4Q9DA 2W48A 2WTXA 4DNQA 2XUOA 4DCTA 1E2JA 2O0HA 1P1IA 4OYLA 1J4AA 2IUEA 2X4LA 4RPCA 4IIJF 1IUKA 4UW9A 1E98A 1J99A 1MFZA 5DSZA 5CXUA 2I6TA 4MWGA 3MQ2A 1TW2A 3DDZX 2OESA 4QD3A 2HU7A 5DG9A 4IMPA 1ID1A 2WDPA 4BMXA 2KZ3A 2GN6A 4RK7A 1FTQA 4P54A 1PT8A 5AKJA 1KO8A 1M2VB 2FMHA 4JY7A 4N5IX 4KN4A 1OZFA 1TFUA 4O2AA 3FTQA 3LC1O 2IFTA 4YRZA 4AXXA 2ZIGA 2XUIA 3KZCA 4G36A 5JXJA 1XQVA 1C3JA 1HNNA 5AVSA 5LQNA 4I4TF 3RK0A 3FG9A 1KJIA 5EJ5A 4ZEMA 4OQLA 4A0SA 5ICSA 3SSMA 2NQ8A 3COZA 2FSIA 1XLVA 2VRNA 5CD9A 1EP9A 3DHNA 3AJAA 1X1AA 2CFCA 3OBIA 4Z6CA 2Z3VA 3RTGA 4XIYA 2A19A 1Q14A 3GFTA 3L7YA 4MUXA 2IEYA 1SOAA 2JEIA 4DT1A 2OLJA 1G6KA 1MA7A 3P9YA 4EQ6B 3UNXA 3JD2A 1UXJA 1ISIA 3EHEA 2XIJA 4L08A 1Y7LA 1WO8A 3X1DA 3AONB 5JZBA 1NY6A 3LQQA 3MGKA 3MGHA 1PR2A 3DBHB 1NV8A 1MABB 2QD3A 4R71A 2QI9C 2X0KA 2FQQA 4L5CA 2WAXA 2EJWA 3CHYA 1X7ZA 3HJEA 1Y80A 1ZL2A 3S7TA 1TK5A 3GD7A 3EPKA 2HMXA 1BXRB 4WTOA 3TG2A 1PK7A 4KX5A 5H4HA 3QLUA 2AE2A 2VHCA 3OE4A 3EG9A 1T13A 3R5XA 3DZFA 4KIUA 3HFSA 1SD5A 2IELA 1NK8A 5DX0A 3L07A 4TL9A 1AS0A 4J7CA 2FQWA 2PMZC 3CGWA 1TT5A 2CGEA 3C2LA 2BDPA 3PPIA 1XX6A 1OBOA 1D6MA 1MFPA 2P4QA 3STVA 3GV5B 5K0LA 2UVVA 3KJGA 2GBPA 8ICGA 3B6ZA 3I92A 4L8LA 1JQJC 4QWCA 1V2HE 5LIPA 5D46A 4BUGA 3JAWA 2PWBA 3WLIA 3CR7A 1QG0A 2XSZD 3H13A 1IBLB 2GN1A 2H9AA 1H93A 2JVKA 1JBQA 3DO6A 1QHEA 1JZSA 4BQFA 1OILA 1Z0FA 3BD7A 3BD6A 2N3ZA 1T0JB 3WLQA 1JYSA 2GAAA 3H9GA 4NYJR 2FR1A 2WUGA 4BL5A 1BKDR 3FUCA 2EBUA 3PNSA 1N5WA 4DLKA 2GCOB 1JI7A 3B2NA 4PCAA 4CM4B 2VYVA 4BCDA 3ZZTA 4D6XA 2OBFA 3GGDA 2HHSA 1VHDA 1JR2A 1X80B 4UC0A 2FW0A 3NP9A 3B1XA 1WP4A 3IAEA 2IZ0A 1OMOA 3REFA 4RU9A 3A2LA 4YROA 2ZCJA 4ED8A 1YE8A 3EEIA 3MGVA 2IMWP 4XVRA 1YL6A 3C43A 3UC9A 1NU6A 1O6BA 4ZOLF 3TLJA 4Y18A 4BXOA 5T3YA 1BOOA 3LSTA 4F93B 4RTPA 4F5YA 1UH5A 4DA9A 3KU1A 4R1UA 5IIIA 4LWOA 3WGJA 1T9GR 3UKDA 1Q2UA 3C4QA 4L3VA 2VDWA 5IXSA 4UHBA 3AR6A 2DTEA 1RJ9A 1X8JA 4ZCSA 2FMXA 6CHYA 4RW0A 1YK0A 4UAWA 1VXRA 4OJPA 5KTSA 3U39A 3T3FA 3DDNA 3A37A 5C5DA 3V4RA 5A0FA 1WZCA 3KPJA 3E3OA 4M9GA 4OJMX 1IHYA 1ORWA 1ODIA 1W4ZA 3QOWA 1AIPA 3GJTA 1N1MA 5IANA 1TADA 3T61A 5J0XA 2HMVA 2HUPA 4CTOA 5B7NA 3IAS6 2XCSB 2GHIA 3VHRA 2HTFA 3BQ0A 4GGPA 2XQJA 3BEOA 3N8GA 1JB9A 3S8MA 2AOUB 2C7OA 4PHPA 3ZWYA 4B6QA 2WWWA 1M6WA 3NEJA 1XZJA 2ORIA 3B3AA 2BFOA 3BMCB 1RHMA 2ZI6A 5L45A 1Q77A 1J8YF 4B3XA 2ZJZA 2GNOA 5AVOA 1RHUA 3QA9A 3CUUA 3SEZA 1ECGA 1DOHA 2QX8A 4TS4A 2CFIA 2LI6A 3Q72A 2VLBA 1NG1A 4GGOA 2OTCA 2I0FA 1EFTA 1UWKA 1PJTA 3DL4A 1XZDA 3K2IA 1P60A 2QW8A 3T52A 5JMPA 3L5OA 4NV0A 2BGIA 3UKOA 5F3WB 4B9TA 3AI7A 4KLHA 2OXCA 4DV3B 2Z3WA 1NX9A 3QK7A 3TW6A 3DG9A 3I2FA 4YR2A 5SY4A 1XHFA 2RBEA 5JD6A 3CT4A 3RH6A 3LWDA 4YJFB 1NBHA 3WMRA 2HX1A 4Q01A 2YZ2A 5A6VA 4EO9A 3IOCA 1I6KA 3HB5X 4JH0A 1MJNA 4ED3A 1WW2A 1N2CA 4RVDA 3WMWA 3KKLA 1MB0A 4BKQA 1CUCA 3ENZA 4NBSA 3F6RA 4ESVA 4S0XA 3CVYA 4CVNA 4Q48A 4C0BA 5T4BA 4NCHA 3FXAA 4QW8A 4LKOA 1XU7A 2VWHA 2QQ5A 4QATA 2H31A 1T4GA 2FWIA 3AF2A 1U6IA 5CYPA 4URYR 4WLNA 3PCRB 4K6MA 4I50F 4KIWA 2DT8A 5TLSA 1T1EA 3TDMA 2VYFA 4J7UA 4G1FA 4UFOA 3B48A 4ZO7A 3TVDA 4NY8A 2E7ZA 5J0TA 3D8NA 4JBGA 2ZKIA 4MR9A 1KQ3A 2ZBDA 3BAZA 3J7TA 4EEYA 1LF5A 4P8RA 2ID9A 1E7QA 2O8DB 1VJ0A 1UDWA 4NCNA 2DUMA 4U5QA 4FHFA 2VJNA 4XWWA 4YQZA 2HDNB 4BRSA 1N4AA 2QLMA 4RD2A 4FQ8A 4D1YA 1ISPA 4GIBA 3I12A 2AXTU 2P65A 5JATA 2XA1A 1FJ2A 3GJSA 3RRBA 1TQ8A 1PAUA 2AJCA 3PRYA 4MVXA 1EDOA 3ZKWB 1N60A 3E22B 3ZU4A 3AK4A 2VPYA 3KZVA 1PG2A 2P2SA 3FGZA 2H1CA 1L3TA 1NSFA 4UUOA 5CGQB 2LE0A 3BK2A 1VJCA 1ZNZA 3ORHA 3JQ8B 3A36A 4QOIA 4UUBA 2PEZA 1JDBC 4ZREA 1W36C 3LY9A 4RZUA 1E1LA 3U0BA 2FMFA 4RNCA 1I1OA 4ZQCB 1DO8A 4ZCMA 4F2WA 4YVZA 1LSOA 2NYVA 1EVLA 3VZPA 4R65A 2DM6A 1XZBA 3SS8A 3K5PA 1CF9A 1VLLA 1SWWA 4FW9A 1BQ4A 1KYXA 4N5HX 3U16A 1IOZA 4YYZA 1HNWB 1NA5A 4UAGA 1COWD 2V3VA 3N7PD 3G85A 1TZ2A 2FN4A 2F1OA 2XRYA 4I2VA 3ZHBA 1H2EA 1C9EA 3A9WA 3KPYA 4A6DA 2QTHA 1XG5A 2V7VA 4XB6B 5ALSA 1JAHA 4QG3A 4JYPA 3ZDCA 4MRMB 1JDSA 4XQ8A 5BXYA 4JROA 3II6X 1U7UA 3NHLA 3O4GA 5JNWA 1D4OA 3P0RA 1KO1A 1NW9B 2X5JO 1WETA 5DKWA 3VOAA 2NZWA 3KQVA 1E32A 4UOZA 2GK4A 1SU4A 3OQBA 1WXDA 2FB9A 3QJGA 1JQBA 1GEGA 1A0PA 2DY0A 3FDZA 2I3ZA 3RLIA 4YJ2A 4GL4A 1FYEA 2DPMA 4ARAA 3LO5A 4JNKA 1Y9EA 4FB4A 2ID7A 2ZANA 1LRKA 3A6DA 4GZLA 4HDRB 3GR6A 1P2FA 1LV8A 4K6FA 3WQQA 2DGZA 4NE9A 5AVRA 4RUCA 5EKTA 2B0CA 4EVIA 3QPWA 1LKYA 5ILQA 2XQKA 1XXHA 2HBJA 2YW9A 1HL7A 3CCCA 3ESDA 2OFPA 3N58A 3RH4A 1PS8A 3D2AA 4BNUA 4NDNE 5EWFA 3FKQA 1SEVA 2PNJA 3OC0A 3HYCA 2ZZKA 4BFVA 1SZPA 3LQYA 3WK5A 4JN6B 1QHHB 3DL2A 5KTPA 5HA5A 1LBHA 2RBGA 4X8LA 3ZJUA 2BCEA 1T91A 3RSSA 4OATA 3H9JA 2XGJA 3DUFB 3C85A 2H2WA 1X8KA 5T64A 4IXMA 4Z8XA 2BTQB 1C30A 1K8RA 2HYDA 1L4NA 1HQYE 1UWCA 2W43A 3N07A 4MGHA 2UYYA 3H9QA 4DTCA 8ICPA 5C1PA 1N6PA 4G41A 2XVTA 3GD5A 3I05A 1A9TA 2D74A 4MS3A 2PBLA 1JHRA 1P0IA 5JEEA 1T6YA 4RVNA 1MB9A 5LCXA 2HH9A 3NTOA 3U17A 3VA7A 1FXWA 5EG5A 1ZKMA 1SVWA 4WFIA 1VL1A 5BYJA 3USZA 5DDYA 4PC2A 4N0EA 1UMBB 1SBCA 5E6SB 4XPIA 1RBQA 1FVXA 4F5WA 3JZDA 5EEHA 4C76A 4EI7A 3D8HA 1DBSA 4QEZA 4LSGA 1XVVA 2J6CA 4TLAA 3S2UA 1QZTA 5JG7A 3DF7A 4NCAA 4M04A 4RJLA 5J63A 3ZCVA 1R00A 1MF7A 4W8HA 3GJ4A 4XR9A 1PK1A 2QK4A 4PZAA 4R84A 4LOJA 3MTBA 2W4MA 1JRPA 4DEZA 3TB6A 2F3NA 1JQ3A 1TK0A 1C7JA 5HIMA 3V42A 1SBTA 3EFBA 1NNUA 3H05A 4HAZA 2V59A 5J2UF 4E51A 2CNOA 3WBKA 1T0HB 4PS1A 2JGLA 2TSYB 4R54A 1T4CA 1YRYE 4JXKA 1AN0A 5LU8A 5KFXA 5LP6A 2FPSA 1PZEA 5NULA 2PD4A 5EJMA 1RMQA 3HFGA 3GDGA 1ZM3A 4R98A 3JV7A 3B9PA 1WXEA 1C1XA 8ICRA 4X84A 4JBLA 4PG7A 1KR2A 1ADBA 3UIEA 4C01A 3ESBA 4LS3A 1OY1A 3PLRA 3ZCXA 3PEYA 5LIRA 1JTEA 5ARDA 1FP4B 4CIVA 2J7PD 3QLTA 5AH0A 2AN4A 3FHCB 2X41A 1DNPA 5HQ3B 4OYRA 1JA9A 3WHPA 1DFGA 3DLTA 4I9HA 5DCUA 1GCAA 3M9MB 1ADJA 4R1QA 4G65A 2W58A 4ND2A 5IP5A 4F11A 2CDCA 4CEJB 4YV0A 2A1TS 4GLJA 3U1TA 1T29A 3WS7A 4LMBA 3LDAA 3N86A 3FETA 3WJ7A 4AUEA 1X3SA 4QOFA 3I58A 4GUAA 1IHOA 3HM9A 1USIA 1P2VA 1CB0A 4PC6A 4Q8EA 4JL8A 4AROA 5EJ8A 1IY9A 5TISU 3VC2A 1RFGE 3TSCA 4MQBA 4RXUA 5JD4A 4PGQA 2PIAA 2FFQA 3OZCA 2FP4B 1KGDA 2P30A 1UFOA 3VKHA 1CYDA 4FFBA 5FOSA 3DMTA 2DPGA 4C4XA 5BT8A 3R7LA 2PS0A 3NHRA 2RI0A 4Z4GA 2BISA 3OEHA 1DAKA 4PQFA 4W1QA 3VU0A 1AUQA 3PKJA 4GOJA 4J9SA 5CLHA 2FP3A 2Z09A 4X44A 3G2JA 4OQXA 3C0KA 4IILA 5F12A 3DDSA 1RWNA 5LDHA 1K5HA 4TPKA 4B3DA 3GFGA 2XAUA 1J25A 1KDHA 4B4OA 4J91A 2XOKD 1YMQA 3PJGA 2AUTA 3D2QA 4OXQA 4UVIA 1SXJA 4C2UA 1WXXA 1T8EA 2C2ZA 4D74A 1ZU5A 3ROMA 4EJSA 4RMHA 9LDTA 2TS1A 2QZZA 3PKZA 3RG2A 1ABBA 4JKYA 2R8JA 4O2BB 4KFRA 3T5TA 3D0QA 2FQXA 3ODPA 1ISSA 3JWHA 2QE7D 1UK7A 4GT1A 1I13A 1PK8A 5AK4A 4IV0A 3H1TA 4ZCLA 4L5IA 1I3MA 1EH5A 3ABQB 4JV1A 1B4DA 1DV1A 3H84A 5DNVA 1C3VA 4L28A 2ZZNA 2E8MA 5L3ZA 4MYSA 4DMHA 4ND8B 1QBKC 4MMXB 1G3MA 2ODNA 1JFSA 1X1QA 3UK0A 3EFOA 4KWHA 2R3SA 4FILA 3R3SA 1SC9A 4JVOA 4KTTE 4PCUA 3FHLA 2UZAA 1GGKA 4P7BA 1O6CA 3H8VA 9ICRA 2V7TA 1GUDA 2AG1A 4JJGA 3WGZA 3GFQA 2FPPA 2UZ1B 1I1HA 2PRJA 1OXXK 3HH8A 2B5WA 4RYDA 3K0AA 2OPBA 2JFWA 1YS2X 4ENQA 3N87A 4DUGA 2FPUA 4J9QA 2QARB 1E4EA 1QHXA 5JRJA 2E3JA 4KEAA 4R01A 1MPXA 3KIPA 1QPGA 3H0CA 1JPNA 1X74A 3O90A 1ECBA 4PJ0U 2YJ3A 2ZIFA 4HNAB 3DAPA 1AQJA 3UJCA 2EKZA 3WWEA 5AXAA 3SZMA 2RHRA 1KE2A 1QNLA 3PYLA 3WNBA 1MQSA 1ZIYA 3K5HA 4B3RB 5K8JB 3V6MA 1G8AA 4KAAA 4PPFA 5DSXA 1KERA 2FJ6A 4D9NA 1BU8A 2HCTA 3X2SA 5CDSA 3PRHA 3L79A 2ZE7A 2ZQYA 4TMZA 4PTYA 3H5IA 4DL3A 1W2WB 1ANKA 1F1JA 4W5HA 3N76A 8ICUA 5IT0A 3HDJA 4JC8A 3NDBB 2FMTA 2VO1A 4YI3A 1XEWY 3WXBA 1Z2PX 1V4NA 4Z1MA 4GI2A 5JMWA 3GOHA 2ATIA 3I5XA 1Q0SA 1ZOLA 2ST1A 5L3SA 1VG8A 2PAFA 1O8BA 1XWFA 1CB7A 4LZZA 5F5XA 2J3EA 3RC3A 3CEJA 4KODA 3ZGOA 4YLYA 4MWBA 1IY2A 4AMYA 3QI2A 1XLWA 2I1LA 2Z7JA 5B12A 4EYKA 1U4NA 2NXEA 5ELXA 3E58A 3BD9A 4PNPA 1H2BA 3JQAD 2W4QA 4I9NA 1BEUB 1IUNA 4HVCA 1BRMA 2YVKA 4QC2A 1C3OB 1II8A 2XCTB 2NZVG 5KKCA 5KG6A 4F9EA 3B89A 4MUNA 1IIBA 4JJ6A 3OPVA 1CE8B 1MHTA 5BURA 1T9HA 1MQAA 4ZEWA 2QN6A 4RVUA 4CKCA 4YCCA 1J5XA 1PQUA 1V5EA 3QPBA 5JPDA 3EISA 2OBYA 3IAXA 3WYEA 3CYMA 2ZWAA 1XD2B 3PIIA 2REXB 2DFPA 5GGYA 4MKIA 2QMEA 1GNLA 1OZGA 2CPRA 1SZDA 2Y6UA 5E9AA 4LTDA 2V7PA 2G9VA 5J4YA 5IF3A 1Y6GA 3Q1LA 2I6QA 2IL1A 2ZJOA 3OM8A 2QTGA 4L8FA 2PWAA 2GXQA 3OQ6A 2OQIA 3GEDA 3LP6A 5EE0A 4YMHA 3PF8A 4F4YA 2EERA 3BZWA 1NN1A 2PRZA 4QU5A 2YW2A 3KQUA 1G5FA 4UAUA 2FSPA 3SYNA 1KZ6A 3RE1A 3G23A 1Z4PX 4BFYA 2NVOA 4MVWA 5HP4A 2ZAGA 3LYUA 4IGKA 5K8TA 3IB3A 4QDKA 5GJVC 3QFSA 4Z51A 4DUZB 1TB4A 3BXEA 1IU9A 3IHLA 4RYLA 3QY9A 3THOA 3HKDA 3EPIA 3VTAA 3EIUA 3WRXA 1E0AA 3P71T 4C1BA 4MCHA 4J9KA 4C7JA 1QC5A 4GLFA 3CONA 1RRGA 2WIBA 1U1FA 2D4AA 2ZRQA 5E9WA 3RJHA 4PX2A 4BZWA 2IX3A 4PIPA 2GJSA 2MTBA 2BBOA 4JP5A 4KDEA 4WOCA 3AEKA 3ZYZA 1D8LA 1X7WA 1M0SA 4RQ4A 1FOEB 2XSZA 2VNHA 4DCNA 2XKJE 4CF5A 1DWUA 1AXGA 4ZCQA 2NZ8A 3E1GA 2ZYTX 3QH4A 1I30A 2B4YA 3M3PA 1GAEO 4G0VA 1HDXA 2CDRA 1E1MA 4E13A 1P0MA 1RKQA 2R8HA 3FAZA 4MO9A 1G4UR 1KR5A 2Y66A 5FOUA 4B73A 4K9PA 4TTAA 3HLYA 1JSRA 5M2QA 2GGSA 1AX9A 3EVAA 5SICE 3NV7A 1Q20A 1NZPA 4IIYA 3NVDA 4EUFA 1GR0A 3RAGA 4DLEA 1VE3A 5ECYA 4IVNA 1D1TA 4LDZA 1WV0A 4MVJP 5IKEA 4Q3EA 1IN4A 4WLOA 4TMTA 2V9CA 2ASDA 1AUVA 1E69A 4IHKA 3WL5A 2B25A 1R50A 3ICQB 3LUBA 3CZPA 5KZMB 2LXNA 4O4IF 1ZSNA 3TL3A 2Q5CA 3Q5DA 3EBPA 3IVCA 2WWRA 3O4RA 4G8DA 2YN0A 3HO8A 2AXPA 5LQAA 1QGED 3NBUA 5DWDA 2D1TA 2JAXA 3DONA 1KQGA 4PLHA 4LYGA 1XTSA 1EHYA 3L0YA 3FE2A 1F4VA 1JHAA 1GGMA 5JS7A 1DBWA 4H35A 1DBQA 2C98A 4ZVRA 4YR9A 5DHQA 4G4GA 2EJVA 2V5VA 4TTIA 4IMIB 2BJHA 3F6CA 1FIUA 1SOVA 1QRDA 2YDYA 2NUAB 2H3ZA 2JLRA 2OO3A 5IASA 2P5SA 2VJLA 1M6VB 2HHAA 4BAZA 4K9DA 2E37A 4R64A 5BSGA 5FRDA 2P2YA 4MQ5A 3ZUPA 1X0VA 2JGNA 2WQ7A 10MHA 5HEKA 1L6NA 4BGVA 5HRCA 3RRMA 3B5JA 1L5UA 2G5HB 3LQ4A 4QBKA 4PHFA 2G88A 5MN5A 3NAGA 3B0YA 1T36A 1WKVA 1U1EA 1XNHA 3QTLA 3IBCA 3HZHA 3U13A 5AVUA 2H1VA 2ZIXA 3VU9A 4DADA 3LHDA 3RREA 3HP6A 1KPIA 4M0CA 3C2QA 1DAMA 3L0CA 4DWIA 2WWVD 3MC1A 1MNAA 1HX7A 4O4JF 1CUIA 4OQNA 4JK1A 3ZQ4A 3UHJA