3HPOA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus y714s mutant bound to g:t mismatch
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
579
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVSGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 579
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hpoA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hpoA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hpoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpoA01
1WAJA 1X9SA 3O4NA 2F8TA 5J29A 3PW7A 2E4LA 4Q8EA 4FM1A 3JPQA 2YKNA 3MR2A 4DFPA 4FJNA 3RWUA 4XIUA 2JLEA 3H8SA 4PHEA 3ISCA 4DTRA 3QNNA 1WSJA 5I3UA 5IIOA 1ZQAA 2Z1IA 4IRKA 4FJLA 5J2HA 2AQ4A 2VG6A 4B9SA 4FJJA 4M3RA 4CHZA 1ZQFA 4OGCA 3OYBA 3MR3A 3RTVA 2BPFA 3K75D 1GOCA 4QW8A 1MSWD 2DY4A 8ICTA 4O44A 1HQUA 4DTPA 5C42A 3QZ7A 4R64A 3ZT0A 4AH9A 1BISA 5DB8A 4FLZA 1NJZA 3ORYA 5J0SA 4AHSA 1S0OA 3N97B 4KKOA 3ZDEA 3OVNA 4QZGA 5DKWA 1VSLA 1TKDA 1LWFA 3CG7A 4CGJA 3SUQA 1T4GA 2KTQA 3C6UA 4RQ5A 4EP4A 5KG3A 2AGPA 5KG7A 3BJYA 1IKXA 5DQIA 2HNDA 5KFZA 5CY4A 3QZ8A 2ZD1A 3PUFA 4DQIA 2F1HA 1RCHA 2P6RA 5KFGA 2A1RA 4DTUA 4BWJA 2BCSA 4NYFA 4I29A 2F8SA 4NLNA 3KKSA 4PA1A 1D5AA 4DSJA 1RDCA 3V9SA 8ICPA 2YNFA 1RT6A 4O5EA 3E01A 3OJSA 5EOZA 1FKPA 5HP4A 4DWIA 3CM5A 4Q43A 1YT3A 1Q8IA 4FJHA 1XU4A 5T7BA 2XCAA 4DL7A 3TQ1A 5CZ1A 3NHGA 4M3XA 4ECYA 2YNHA 1XSLA 2PI5A 4YNQA 4M42A 4KLFA 3SUPA 3G6YA 3QINA 4FJKA 3PR5B 3DRSA 3IS9A 1U4BA 4UB1A 4UB2A 1WN7A 1EP4A 3ZT3A 2AGOA 4M47A 5KG2A 1Y88A 3IRXA 4J9SA 4QCLA 3EW9A 3NGZA 1ZQNA 3KD1E 1LAVA 2KW4A 3M9MB 9ICGA 1ZQOA 4FW2A 1UA1A 2NUBA 3NH1A 5IIJA 3PV8A 5JUMA 3CQ8A 2JGUA 5KT6A 2W42A 4QZCA 4R8UA 4CEZA 9ICKA 4E7KA 4PHDA 1TL3A 3ZD9A 2W9AA 2IA6A 4FK2A 1UT5A 3V6JA 1TV9A 3GIJA 3AVKA 2BCVA 4BGDA 3H8JA 4J9MA 5J0YA 4HYKA 4KHQA 4YXJA 4F8RA 4IG3A 2AGQA 2JEJA 5IINA 3K58A 3VQ8A 3SPYA 3OS1A 5CJ7A 3RJHA 4QWEA 1ZJMA 1RTHA 4ID5A 5E41A 5J2AA 4FLTA 4CF1A 5L1IA 4CF9A 3PNCA 3K4GA 1ZQSA 1TKTA 3HWTA 4DF4A 3AVAA 2KFZA 2HVIA 2NRWA 4PGYA 4RQ2A 2QK9A 1N5YA 2FPLA 2IAJA 4DS4A 3OGUA 2RN2A 4YR3A 4DF8A 2W8LA 1CXQA 2P6UA 4CEAA 1S6QA 3KK1A 4EYHB 2FMPA 9ICXA 4J9LA 4K4GA 3NF7A 4CGHA 4J9OA 3DOKA 3KHRA 3C94A 4MEXA 2ASLA 3WNHA 4UB4A 1CEZA 3PMNA 1ZBHA 4R8UB 5KFIA 5CP2A 4HCBA 5FRNA 2XY7A 4IFYA 4BE2A 4RQ8A 3V6HA 2C28A 4CJ4A 3NH2A 3RJIA 1KFSA 3LPUA 8ICSA 3B6OA 4ZH4A 3EYZA 4Q44A 1S77D 2ALZA 4KLIA 5J2FA 1TK5A 4CGIA 4B8AB 5KTQA 3ZSWA 4PGQA 3ULDA 3SV3A 9ICLA 4CHQA 5KRTA 3AO1A 3FYHA 1FKOA 3PVXA 2HMIA 3KK2A 4ED0A 1MU2A 1XI1A 3U6FA 1B9DA 5KT3A 3OS2A 4CERA 3VQDA 3F73A 2X74A 3RJEA 4OVLA 4DSEA 4DEZA 4DMNA 4TUPA 8ICQA 4UAYA 1BPZA 4B9VA 4QZ8A 4I9LA 2FBYA 2LYHA 1NK4A 4FLVA 2F96A 2B4JA 1JLAA 2IC3A 4FM2A 4PUOA 1ZQWA 1KCFA 3U3YA 4FBUA 3BDPA 3ITHA 2RF2A 4I2FA 1RDDA 1BL3A 4F3TA 3ASMA 4P4PA 3C95A 4KLLA 2YHAA 4BWMA 8ICRA 3PY8A 2HHVA 2HNZA 2Z1HA 4CEOA 3VQ6A 3L2RA 7ICNA 2D5RA 3ZT1A 2UVRA 1JXBA 4CJPA 2AQ0A 5HMMA 4KPYA 4OPJA 4FJ5A 5D3GA 4DL2A 5IIMA 3TAPA 1TAUA 4F91B 3HPGA 2BGWA 3TAEA 8ICFA 4EP5A 4IQVA 1ZQUA 3TFSA 3UQ2A 2BCRA 2R8KA 1T3NA 3DLGA 4DOAA 4ED1A 3RMAA 1RDBA 4YCXA 4FZXC 4AHUA 1BCOA 3MECA 4ECRA 1YVUA 5HROA 8ICCA 2FBVA 4CGGA 4KTZA 1RT4A 2ITGA 1LAWA 3N4MB 3H8WA 4KTQA 4RUCA 4C8OA 1XHXA 2J6TA 3SZ2A 4NXZA 3HO1A 2VANA 4KTWA 1KFDA 1C1BA 1W0HA 4RW4A 5C24A 4I28A 7ICTA 4KAZA 4CESA 1B92A 2JZBA 1QTMA 1TVRA 4FVMA 4CIFA 1ZQXA 3VQ7A 2R8HA 3AO2A 4M45A 4ED6A 8ICVA 4CHYA 3QLHA 2GBZA 1JLBA 4RUAA 1WNSA 4RQ6A 3V7KA 2Q0ZX 3NDKA 3AVNA 4J9QA 3LANA 3RR8A 3JPPA 4DL3A 1TKXA 1HMVA 4FJMA 3T5LA 1VSFA 4O0JA 4TUQA 1BIUA 8ICLA 4NCGA 3PW0A 9ICCA 1LV5A 1S1XA 1BGXT 2B5JA 3V1QA 5KFYA 1BQMA 4JS4A 3EWAA 1BVSA 3TAFA 4ECSA 2OYQA 3RJKA 4OKJA 3TAMA 1J53A 2VG5A 3FDSA 2KFNA 5KT7A 1S1UA 2ATQA 1I3AA 3QEBZ 3KTQA 1T7PA 4O3NA 1O1WA 2PFOA 1SL2A 2ASDA 4KLTA 3TR8A 1S6PA 4RW7A 4CJEA 3MXMA 1VSKA 4G1QA 4YP3A 4LVSA 5DBCA 3JYTA 4F5QA 3MFHA 2IGIA 3AVGA 4K8XA 1NOZA 1T8EA 5K14A 4M2YA 3LP2A 2PZSA 3HYFA 4CK2A 4N56A 2G8WA 1X9MA 1BPYA 4YMMA 4HTUA 2DFHA 5DK5A 1KLNA 3VQAA 5J0OA 1C7YA 3DLEA 3ZT2A 5KFUA 4FZYA 3DRPA 3PW5A 5DDMA 2OWOA 2Y1JA 1RBUA 4CJQA 8ICAA 5JS1A 3QESA 4RW6A 3RMBA 4YD1A 1ASUA 3KLHA 2VA2A 3PX6A 4FLWA 2P5GA 3HW8A 4HUFA 3ZSZA 3PX4A 4E1NA 5KFEA 9ICEA 1TL1A 1D9DA 3VQPA 3EZ5A 1NJYA 5KRSA 5DB9A 2ZTCA 4I9QA 4IQTA 4ELUA 4KLGA 3V7JA 4B9TA 4G3IA 3HVRA 5KFWA 4GXIA 3RJGA 5BOMA 4CJ5A 2A1SA 3GIMA 3QETA 4P2HA 3VQQA 1EXQA 1C6VA 4DQPA 2BHNA 1MC8A 4ICLA 2C2EA 2ZJ8A 3GILA 4KI4A 3IG1A 9ICHA 8ICOA 4FCYA 3T5KA 4Z6FA 4O5BA 3H40A 1X2IA 3HP6A 4CEDA 4QZBA 2BDPA 2BCQA 1QHTA 3S3OA 9ICFA 2XGPA 3MAQA 1TKZA 3VA0A 1HJRA 4RQ0A 3L2UA 4QZIA 5DBAA 4RQ3A 2ZUBA 4F93B 4ELTA 3CYMA 4M3UA 5DLFA 3SQ2A 1A5XA 2A1JA 2Y1IA 1B22A 1ZQVA 3QEPA 5DG7A 4KO0A 4RPXA 2G8IA 3MEEA 4QOZB 3K57A 3SJJA 4B8CA 4KLDA 2KQ2A 1JIHA 4PGXA 3PO5A 3Q8QB 4F2RA 3JPSA 5J0WA 5BPCA 3PW4A 1SZPA 4FJGA 4QZEA 4JWMA 1QE1A 1TK0A 8ICKA 2ZE2A 1S0MA 4RG8A 4YR0A 4IBNA 2PFPA 5KG1A 4GC7A 1UA0A 1C1CA 4DU3A 2PY5A 4RT3A 2IDOA 1NK8A 3DYAA 4FW1A 1JX4A 4TQSA 3RH5A 8ICIA 4EZ9A 7ICGA 3QIOA 4BXOA 2EX3A 5EU7A 3OY9A 2NRZA 5L1JA 1S1WA 4YXMA 4BDPA 2HHWA 9ICSA 3PW2A 1ZQMA 4OKKA 1HYVA 2JEFA 5EWEA 7ICJA 7ICKA 1UAXA 4F50A 4KHWA 5HLFA 3AUOA 3GQCA 4FZZA 3OHBA 1JKHA 1RTDA 2BR0A 1BIZA 3S9HA 4M9GA 4E0DA 4NLZA 2A1JB 4RQ1A 1ASVA 4EEYA 3LAMA 4O9MA 4QWCA 3VA3A 4O3OA 4DTNA 3Q8SB 5FROA 1J5OA 1LWEA 1MQ3A 4FS1A 3QE9Y 3AVMA 3TARA 3T5JA 1K6YA 4CJWA 5CR0A 3OYLA 1QQCA 3MGIA 1XSPA 1NOMA 4ID1A 1RBRA 1U9LA 4CIGA 4J2DA 4X5VA 2ETJA 3O3GA 3MDCA 3OYCA 1SV5A 4OGEA 4F2SA 4RW8A 2XGQA 4NM2A 3D0PA 5KGWA 3CM6A 1BHLA 3RB6A 2V9WA 4CHOA 5DG9A 3AVIA 5KFBA 3GV8B 4KLQA 4BXOB 5I42A 2OZSA 5DQGA 4AHCA 4OLBA 4YVZA 4M04A 4ECXA 4ECZA 2JEIA 4GW6A 1B9FA 1A5VA 4R65A 5HRPA 2IHNA 4I2GA 3C2MA 1Y97A 3UQ0A 3KD5E 2RPIA 3MXJA 4I2DA 4JV0A 1SKWA 4O4GA 3SNNA 1HQEA 4CF2A 2RKIA 2X78A 4DU4A 1NJXA 3ISNC 1SKSA 4RZRA 3ZDDA 1TFRA 1S1TA 9ICJA 4M3WA 1L3TA 3HVTA 3SQ4A 3JPOA 1ZQHA 3C5FA 5J2CA 8ICGA 4FLYA 2OA8A 3K5OA 3L3VA 3VN5A 4JS5A 8ICUA 1ZQYA 4DL5A 1D9FA 1WSGA 5CHGA 2GWSA 3AVLA 2XCPA 5DQHA 2XY6A 1ASWA 1Z25A 3V9XA 4CJTA 4Z4EA 1U04A 3G0ZA 5DGAA 4IR1A 1JXEA 7ICPA 1BPDA 4TURA 3NFAA 3OYKA 2X6SA 7ICRA 4M9NA 2R8JA 4GXKA 4F5OA 2BQRA 2MAXA 3C2LA 3GV5B 1XC9A 4KI6A 1RXVA 4NCBA 3MR6A 5HRRA 3O3HA 4CFCA 1U48A 4MF2A 4I27A 2HVHA 2P51A 3OYHA 1NKEA 1ZQZA 5CWRA 3P5JA 1ZQCA 4FJIA 4Q8FA 1FXXA 4R63A 1BPXA 4J9PA 4DO9A 3KHHA 4CGFA 3ISDA 7ICIA 4B9NA 4CJVA 4QZAA 4Q5VA 5L1LA 8ICHA 3SI8A 4M0AA 1KVCA 4YFKA 4M3ZA 3HSTB 4OKEA 3LDSA 2G8UA 1S97A 1IKYA 3D45A 4N41A 5DG8A 1NK5A 1WCNA 4MF8A 1UWBA 3Q8PB 4GLXA 1CUKA 3EY1A 1ZETA 2FMQA 1COOA 7ICVA 1QLNA 4F4ZA 2UVVA 1BQNA 4M6WA 4HVJA 3SI6A 1X9WA 3LWLA 4R66A 2YV0X 4UBBA 4FYDA 2VA3A 2IBKA 1L3UA 4KHUA 4NLKA 4I7FA 3NCIA 5CYQA 1WSIA 1HNVA 4KB1A 1Z00A 3OS0A 4DL6A 4UB3A 1HUOA 1JLGA 2ZUDA 4ED8A 4CF8A 3KJVA 4W5QA 4PY5A 3DLKA 4KMUA 1IG9A 4JK1A 4DOCA 1C0TA 4IKFA 3AU2A 4AHVA 3NTUA 2AJQA 3H4BA 4JV2A 4LH4A 3MXIA 1TK8A 2FBTA 4YD2A 5KFOA 5J0TA 2C2DA 1JLFA 3GDXA 2YNGA 3V9ZA 2M9NA 2C2RA 2WTFA 1CXUA 4J2EA 5DB7A 3M8PA 4J2BA 3NE6A 1EXNA 2Z1GA 4RQ4A 1UOCA 4FJ7A 4PH5A 2C22A 4IQUA 2IS3A 1N48A 4CEEA 4FLUA 1ZBIA 4M6WB 5D49A 1RNHA 4M9JA 4F4WA 1S9EA 4LD0A 4M9HA 9ICQA 3BGRA 2W9CA 3NBPA 1DLOA 5J0XA 2DFFA 2OPQA 3F9KA 2V4RA 3Q8KA 3RRHA 4CK3A 3K59A 2DFLA 4QZDA 4AHTA 4YFUA 1WLJA 5J2QA 4Y1DA 5HP1A 5CYMA 4C8LA 1RBTA 1NOYA 1IKVA 4P4MA 4O5CA 5SWMA 2DFEA 1A77A 1WCLA 1Z00B 3SV4A 4TUSA 4DTOA 2I5JA 2ZUCA 3KLEA 2VG7A 4ECTA 1QSYA 2FC0A 4JUZA 4GXJA 4KV8A 1VSIA 4W5OA 4E3SA 1G15A 4Z6DA 2OPPA 2ATLA 5J2KA 2D0CA 5KFAA 2OPSA 3AA3A 4F4YA 4CFBA 2F1JA 5J2JA 1SL1A 3LZJA 1IM4A 3THVA 3V7LA 9ICUA 3P83D 3RR7A 1TV6A 4XQ8A 3OYIA 8ICWA 2FPKA 4M9LA 2UVUA 3RJFA 5D46A 4MQ3A 2EHGA 4IRCA 1S0VA 3V72A 3NH0A 3OJUA 1K1QA 3JSMA 1NJWA 3V6DA 3OYFA 3C1YA 3UXOA 4HUEA 4M3TA 1K1SA 1S5JA 9ICBA 3AA5X 2W9CB 5DDYA 9ICTA 1JN3A 1PZNA 1KLMA 3DI6A 3B6PA 1LW0A 4CFDA 2VWKA 1JLQA 4KHYA 1S1VA 3CFOA 4CECA 2W9MA 4GMJB 4KLJA 4ELVA 9ICWA 3M8QA 5KFXA 3AVFA 3OYEA 3NAEA 4DTMA 1CZBA 4BDZA 4CCHA 3QEXA 5HRNA 3QNOA 1RBSA 2JZBB 2XY8A 3TWHA 4QWAA 1A76A 4EBDA 4CJUA 1NKCA 3RMDA 3M9OB 3KHLA 5DBBA 3C23A 3HPOA 4F5RA 3HM9A 4LSNA 2HHQA 2FPMA 5KFMA 3ZCMA 4KLMA 3C6TA 4FM0A 4HCCA 1ZQRA 4YMOA 5J2GA 5J2MA 1RBVA 3K5NA 4EBEA 2R7YA 2WOMA 2YKMA 3AA4A 4QZHA 3KHGA 3AV9A 4KLSA 3G6VA 4Y1CA 3HX0A 4KN7A 3AU6A 4CJSA 3TANA 4NLGA 4F4XA 2RDJA 4IG0A 3DLHA 7ICUA 1RYSA 2E6LA 1QSLA 4ZHRA 3ZSRA 4GVMA 2UVWA 3NF9A 3V9UA 5TZVA 1N56A 3Q8LA 1HYZA 5CZ2A 5KFSA 2O4GA 4W5NA 5HRSA 3TAGA 1L5UA 7ICLA 1X1PA 3SYZA 3BQ2A 4HUGA 3MABA 3I0RA 7ICHA 4CK1A 3HJFA 5SZTA 3OHAA 4QW9A 3VQBA 3OYGA 2ZTDA 3C2KA 3O3FA 3LAKA 5DMRA 2I1QA 4QWBA 3OYNA 1KDHA 1R0AA 1NK0A 3C21A 4TQRA 4E7HA 3VQ5A 2Q3SA 3LDAA 4PWDA 4MFBA 1VSMA 4KFBA 4PPXA 5KFTA 4H8KA 3T5HA 1MQ2A 2IHMA 3CFPA 3B0YA 2B21A 4F3OA 3RH6A 4RT2A 5CB1A 4UBCA 3LWMA 3OSNA 3V6KA 1RDAA 3TAQA 4ED2A 4EZ6A 8ICEA 4PHPA 4MFAA 3WNEA 2OPRA 3K2PA 3ZSOA 5J2NA 3QEIA 4B9UA 3NGDA 2P5OA 2GUIA 4YG2A 5C5JA 2D0AA 1IXRA 1ZYQA 2FLNA 1HNIA 2G8KA 3RBDA 7ICOA 4AHRA 4DS5A 2NRTA 3MDAA 4RNOA 4I2QA 2KZ3A 1KRPA 1U45A 3VQCA 4O5KA 2GV9A 4TSXA 4I2PA 2XY5A 3EPIA 4Z4CA 3RB4A 1REVA 2ISOA 1D8YA 4KB0A 1HYSA 4W5RA 4DQSA 1UT8A 3AA2A 1XSNA 4N5SA 3I0SA 3AVJA 4Z4HA 3SPZA 4NM1A 3E2EA 2ASJA 1ZQDA 1F21A 4Z4FA 1ZBLA 3V1RA 3QERA 3T3FA 2W8KA 8ICBA 1VSEA 4OLAA 4M3YA 2HHSA 3QO9A 5J1EA 4P4OA 2QXFA 4YMNA 2I9GA 4IQWA 2HW3A 2R8GA 3LP3A 4CJLA 4EYIB 3SUOA 1EETA 3HK2A 3A2FA 3OSPA 3QIPA 3VQ4A 3T19A 1IH7A 3K5LA 3GIKA 1BPEA 1ZQQA 3L2VA 1WSFA 3UIQA 1HRHA 1XHZA 2HHXA 3ZT4A 4K8ZA 5IILA 4O3PA 4OJRA 1BCMA 4E89A 4FK0A 4KN4A 1GOAA 1GOBA 1Q9XA 4DTXA 4IR9A 8ICJA 1C0MA 4IFVA 3IHQB 5KFHA 3V9WA 1I39A 2PYLA 4RW9A 5KI6A 3NGYA 1JMSA 3GFKB 3SQ1A 4KLEA 1KVBA 1IKWA 1J54A 4E19A 4DTSA 1HJPA 1RT7A 3TI0A 4JWNA 1HPZA 4DU1A 4ECVA 1SKRA 3VQEA 4J2AA 4E7LA 4K4IA 3HPHA 5KFPA 4LZGA 2JEGA 4DTJA 5KFQA 5J0RA 2J6SA 3KIOA 4RNMA 1B43A 5CA7A 2ZQBA 3V81A 1CZ9A 4K4HA 1ZJNA 2YHBA 2VWJA 3UXNA 3Q8RB 4M41A 5JS2A 3GV7B 9ICRA 4O3SA 3DM2A 1Q9YA 2DTUA 3MBYA 5HNKA 4F5PA 4YR2A 2B6AA 3MGHA 4FO6A 3C5GA 1DOQA 2FMSA 4CFAA 1EX4A 4RNNA 2FBXA 1Z3EB 3SUNA 4UAWA 2VA8A 5KT2A 4DQRA 4FJ9A 2Z1JA 2PXIA 4DSKA 4KLUA 1ZQPA 2ZTEA 3DMJA 2J6UA 1J9AA 3OYJA 4ZTJA 1RTIA 1WSHA 3G6XA 1D8LA 4O3QA 4DLEA 2D0BA 4JRPA 2ZJ5A 2XO7A 5KFCA 4GC6A 2W9BA 3ZSYA 1NK7A 5KT5A 4CEBA 4DSFA 1JXLA 1ZBFA 4JV1A 1YTUA 1LW2A 5KG6A 4Z6EA 3ZSQA 4QAGA 3CFRA 4DFMA 4J9NA 5J2EA 4O3RA 1RTJA 4FJ8A 3O4QA 4UQGA 5DB6A 3HT3A 2DPJA 2ISPA 2PI4A 9ICMA 3L3UA 4H4OA 4E7JA 3P1GA 3KKRA 3ZDBA 2PFQA 1T05A 3H08A 2DPIA 1JL2A 4B9LA 4Q45A 7ICQA 5J0QA 4JLHA 1VSJA 4CJ3A 4DL4A 3TABA 2BCUA 5L9XA 4N76A 8ICZA 1VRUA 5D4BA 1RZTA 2WONA 4XA5A 3OYAA 5KG5A 3OYDA 1JL1A 4C8KA 4KRFA 3SQ0A 1S0NA 3ZDAA 4EBCA 4CJKA 3M9NB 3ISBA 1DTQA 1XS9D 4NCAA 4ECWA 4W5TA 4Z4GA 2W9BB 3M8SA 4MFFA 1SUQA 1VK0A 3PX0A 5HHHA 4B08A 1YTAA 5HMLA 1S9FA 1U49A 5DGBA 2LSNA 3TFRA 3PMLA 5IIIA 7ICEA 4KITB 1S76D 4RPZA 4KLOA 2P1JA 3QEWA 4DLGA 1W9HA 4FK4A 4BE1A 4CHPA 5KFLA 2PFNA 4DFJA 2AU0A 3LPTA 7ICFA 2BGGA 2P66A 5IIKA 4I2HA 1WAFA 4DOBA 3FFIA 1XO1A 5KGXA 5EWFA 1LB2B 3NGIA 3LP1A 2KZZA 3RMCA 3EPGA 3JPNA 4J9KA 3S3NA 5KFKA 5DLGA 1RPLA 5KT4A 5KFJA 4KHNA 4L8RB 1JLEA 3RAQA 3HXMA 8ICYA 5BOLA 4H4MA 1RXWA 4C8MA 4PQUA 2HHUA 4FBTA 1ZBUA 4HHTA 3Q8MA 5KFRA 1LWCA 8ICNA 4LH5A 4JRQA 3ZSVA 4CF0A 1BI4A 5KG0A 4B3OA 1KTQA 5HHIA 1ZQJA 1U47A 4KREA 4J9RA 4BACA 4R5PA 3RH4A 4Z4IA 2NRVA 4Z6CA 4BDYA 5EWGA 5KG4A 1ZQTA 3V1OA 3L2QA 3DOLA 3LP0A 5J0PA 4N47A 5L1KA 3WNGA 4DFKA 4KLHA 1RT5A 4XRHA 3OYMA 3L2WA 1TVAA 2HB5A 4MEYA 3RRGA 3BQTA 1HUZA 3UXPA 3MFIA 4LY7A 4E7IA 3GIIA 4KHSA 4AILC 3AVHA 3H4DA 1DTTA 3DLBA 4BE0A 4QWDA 1ITGA 3AO4A 4CE9A 1VSHA 4DG1A 2BKEA 3BQ0A 3RJJA 4RU9A 1C1AA 4CJRA 9ICPA 3KLFA 5J2DA 2R8IA 2F1IA 3NF6A 1TGOA 3PO4A 1A5WA 4OPKA 3RB3A 9ICAA 5HBMA 4FJXA 3DLRA 4CIEA 1QSSA 9ICVA 3I8DA 3PR4A 4LSLA 1BI4B 9ICNA 4ED7A 3NF8A 1T03A 4ED3A 3MR5A 3L8BA 4QZFA 9ICIA 3V4IA 1C0UA 1RT3A 1VSDA 4MFCA 3RBEA 3HP9A 1L3VA 1SL0A 2XC9A 3B0XA 3C1ZA 2RDIA 2QKBA 3IM1A 1NKBA 1ZQIA 5J2PA 1WSEA 5F9LA 4B9MA 3WNFA 4WE1A 5J2BA 3MEDA 4FLXA 1ZQKA 3AVCA 3JPRA 2QKKA 2KN7A 3AO3A 2HHTA 2FLLA 1TAQA 3LALA 3RB0A 4LZDA 1H38A 2X6NA 4Z0UA 3QEVA 5KFDA 4ECUA 4XUSA 4QZ9A 1DGSA 1ZQLA 2ZJAA 2BPGA 2MUTA 2FLPA 1FK9A 3JPTA 4CGDA 5FRMA 2BPCA 2XHBA 4PHAA 3ZDCA 1RT1A 4RQ7A 3ZSXA 3SCXA 4IDKA 1RT2A 4ECQA 4I2CA 4F92B 3RAXA 4I2JA 2G8VA 3T1AA 4F4KA 2BQ3A 3QEAZ 8ICMA 2NRXA 2IOCA 3MEGA 4E1MA 2G8FA 3VQ9A 5FDLA 4I2BA 1S9GA 1ZQBA 2H5XA 3K5MA 3BQ1A 1IO2A 2YNIA 1NK9A 5F9NA 2XRIA 1NK6A 3S3MA 1V9PA 1ZQGA 4O55A 4NY8A 3ALYA 1JLCA 2IMWP 4RPYA 4I2IA 2KZMA 3AO5A 7ICSA 5KFFA 3HL8A 1XWLA 3ZD8A 4FS2A 2O4IA 4C8NA 2BANA 4F5NA 4YQWA 4IRDA 4NYNA 4CJFA 1L3SA 1KSPA 1BPBA 3H7IA 4I2AA 1EKEA 3IAYA 4UB5A 3LZIA 1ZQEA 1Z26A 2HNYA 3G10A 1N6QA 1KFTA 1KEJA 2MUTB 3KLIA 4FXDA 3LK9A 1KVAA 3U3GA 4ZTFA 3KLGA 2BQUA 1CLQA 2BE2A 9ICOA 2E6MA 1QS4A 4CEQA 4UAZA 5KFVA 7ICMA 8ICXA 1RILA 3ETLA 4CHNA 4DQQA 1AROP 5J0UA 2V4QA 5J2IA 3KK3A 3AVBA 2PYJA 4DSIA 3M8RA 4DSLA 4I2EA 2G8HA 4O0IA 4Q0BA 1RYRA 3DRRA 5KFNA 5C25A 4YN4A 3UPQA 2OZMA 1S10A 1VRTA 4CEFA
chains in the Genus database with same CATH superfamily
1N5TA 3VGKA 5E84A 3R5CA 5A6WA 1NGDA 1J2MA 3UD5A 3TJAA 4BRPA 3RWUA 1DJ0A 3H8SA 4EELA 4LF1A 4PEOA 1WSJA 2ILZA 5KOXA 3QYPA 2Z1IA 5D0HA 3HFZB 3VESA 4JI8F 3FZHA 4FSVA 4WZMA 3G6EN 5U47A 2W7OA 3HHDA 3KLIB 2FZKB 1GOCA 3VTHA 2DY4A 1J5EF 4O44A 1V97A 4R64A 5CAAA 4BG9A 1Z4NA 1E6YB 4WFNL 1BISA 1SXDA 3KK3B 3ORYA 1B64A 4OHXA 2NYIA 1BXNA 2VIHA 1UVMA 2HBYB 4KKOA 3ZDEA 3VC8A 5DKWA 2UUBK 1VSLA 2KTQA 4EP4A 2BOPA 3G6ES 5KG3A 4J91A 4X66J 2QMUB 4JN4A 2YKNB 2HNDA 2KG1A 5CY4A 2JLFA 4WPAA 1HFEL 2IVOA 2A1RA 3KJQB 4OZ0A 2OP5A 3CW2C 4NYFA 1AFJA 4I29A 5B0GA 4NLNA 4WTYA 4HACB 4M5IA 3NEKA 2YNFA 1GEHA 3CM5A 5HANA 1Q8IA 3BEGB 1XU4A 1R8PA 1Y3JA 5IM0A 2HBRB 3NHGA 2E29A 4M3XA 4ECYA 2YNHA 3R5BA 4CNQA 1XSLA 1HQUB 5C42B 4M42A 2VC1A 4KLFA 3QINA 4WCEL 3PR5B 3I55N 4XPCA 3J80O 3AD7C 2IYIA 1SJ1A 1WN7A 1EP4A 3ZT3A 3T9NA 4KGMA 1ATSA 1Y88A 1YBUA 4J9SA 3NGZA 2KW4A 1VLBA 1RU2A 3M9MB 2BZFA 1ZQOA 1CQNA 2HLUA 4I68A 3THPA 2LMIA 5CYJA 3PV8A 1NSKL 2LDIA 5ALYA 4QZCA 1GLDG 4R8UA 4IH7A 4R79A 3M05A 3R6GB 4I67A 3C6UB 4RNFA 2CG8A 1TV9A 3F53A 3AVKA 2JJ4D 2EG1A 1P9QC 3EMTA 1U0HA 3VAGA 4ES1A 1ZAXA 4KHQA 3ENQA 1N33K 2HQFA 1BQXA 4K4SA 3I55S 3JB9k 3E0FA 3OS1A 3C7NA 4JV5J 4OYZA 4QWEA 1ZJMA 5GAEP 1WD6A 3R1HA 1D1UA 2FHMA 2DK2A 3AOAA 2CPYA 1X6IA 5GIOA 5J2AA 2W3SA 4CF9A 5CQGA 1FKPB 1XUPO 3NG8A 1QQ7A 3K4GA 1ZQSA 4NMLA 4AM7A 4DF4A 3B78A 3C14B 2BM0A 2OJ3A 3VETA 1S4EA 2G09A 1D9AA 3NGTA 2QK9A 3EE8A 1RJJA 2FPLA 2RN2A 4YR3A 3GJRB 5AT1B 2QWMA 1CXQA 4P0PA 3U26A 1U1OA 1HUXA 2J8SA 8AT1B 3HMJG 4BRLA 3KHRA 3B54A 2ASLA 1VQ4S 1ZBHA 4UOGA 5IQQA 1F6TA 1TL3B 3BSAA 3D0GE 2Q3PA 3IXQA 4ZPDA 4HCBA 1P8ZA 2XY7A 3DFEA 5F3ZA 4IFYA 2VPWB 4TN2A 3VGMA 4BE2A 3V6HA 4IG3B 1IBLJ 2MQQA 2EZYA 3NH2A 3LPUA 1RWMB 8ICSA 1QVFR 3ICLA 3MPVA 1P7DA 3QFWA 4ZH4A 4RL1A 2CWKA 1S77D 3DXMB 1UPPA 3G2XA 2RE2A 3GJTB 2HFZA 2AYBA 3SCIE 3L0QA 1TKTB 4PGQA 4I0WA 3UMCA 3B82A 9ICLA 1ZH5A 4JHDB 2ZNZA 3BS5A 5F8IA 2VGMA 2QTDA 2IAJB 4BQLA 1RP5A 3MM7B 4JD2B 4CERA 1GQEA 3MM9B 3OFEA 5AQWA 1VFJA 3QJPA 3GMGA 2X74A 2PA3A 4DMNA 2BW7A 4OX6A 4UAYA 4QIWF 1YF5L 2HMPA 2FBYA 2LYHA 2B4JA 2KDOA 2EI5A 1JLAA 2VBYA 1M90T 2KU7A 5BRFA 4FBUA 3BDPA 4C11A 3C0BA 2RF2A 4QPTA 1BL3A 4F3TA 1HNXK 4P4PA 3BH6B 4KLLA 4YB1P 4DR3K 1SV4A 2YHAA 5KPRA 4BWMA 8ICRA 4C7YA 3ZT1A 4CJPA 2F8KA 5L8RC 3N9UC 2HZAA 3CJKB 3BGLA 4KPCA 1CJKA 4Y34A 4QS9A 3HPGA 4P9SA 8ICFA 2E5IA 4IQVA 4K4YA 3TFSA 1FKOB 2GCFA 5JMVA 2BCRA 3BY5A 2HMIB 2R7TA 3CCMS 4JI0F 4DOAA 3CDUA 3RMAA 3VALA 2IY5B 1RDBA 4KYZA 2UU9J 4AHUA 4FZXC 1KKHA 8ICCA 4HR2A 1LCUA 2KJVA 4KTQA 1ZTTA 2J6TA 1ZC6A 1H2TZ 3QFHA 2VANA 1N32J 3A3NB 1D8BA 1NRKA 4RW4A 1W0HA 4I28A 7ICTA 3EICA 3VEWA 2YWWA 4CO3A 4IH5A 1Q86T 2UXCJ 2IC3B 2RP5A 1UJ6A 4PUOB 2HBMA 3AY0A 2KEYA 2F9JA 1R6VA 3GFYA 3AQEA 2DGXA 1JCEA 4AL5A 1BG3A 2F7VA 4FKXA 3W5YA 3H2VE 2R8HA 3K0SA 5D8HB 4RUHA 4ED6A 2KYXA 3KMSA 4M45A 1Z1ZA 4JI1K 4USHA 4P2SA 2F8LA 4XPEA 2DIVA 2DRDA 3V7KA 4CI6A 4DPYA 2Q0ZX 3NDKA 1CVJA 3JPPA 3W7BA 2K89A 1MG7A 1TKXA 2D74B 1I6JA 4NXMK 3VEZA 3T5LA 1IBLK 1VSFA 4B3SF 4TUQA 1BIUA 3PW0A 1CZAN 1NH8A 1S1XA 2E9TA 2FD2A 5KFYA 1QUPA 4NEYA 2UXDF 1R8CA 4HTIA 2B9XA 4JS4A 2ZWHA 1BVSA 3VAFA 2O67A 2ZKTA 4FXVA 1IWGA 2WSCC 2XZWA 3N28A 2HYIB 2W2QP 2AA4A 2V8DA 2Y1RI 5HROB 3FBFA 1S1UA 3CF5Q 1T7PA 4O3NA 1SL2A 4KLTA 3IR5B 1VQ7S 1U26A 3OL6A 1VSKA 4YP3A 1TR0A 3JYTA 2FJEB 4F5QA 1SC1B 2HRUA 3ZTOA 3VEXA 1BMQB 2PZSA 4A61A 1DQAA 2QWLA 4DR4K 1E4FT 1KOOA 1EQYA 1X9MA 2CFXA 1BPYA 2F63A 4Z2XA 3D67A 5DK5A 2BACA 1JLBB 1KLNA 2I7PA 5J0OA 4CF5A 2LXIA 2NXJA 3WKBA 2LKYA 3BO3A 3PRVA 1HMVB 2RIJA 2LBOA 5E3QA 3DRPA 5EXWA 2Y1JA 4HL9A 2O6KA 5D0EA 1IBMJ 3AJ2A 4LF5K 5IFMA 3RMBA 3TEGA 5AE1A 1ASUA 2F65A 5ALDA 3KLHA 5C2GA 2M70A 4LT6A 2P5GA 1RZMA 3HW8A 3PX4A 1HHSA 4E1NA 2RVJA 3NCQA 4WJBA 5ALMA 2JLGA 2P9KB 1GLJO 2LDYA 1TU0B 1VQMN 1ZD4A 3EZ5A 1VK3A 1W25A 3FRZA 4KBOA 5KRSA 5JVHQ 2UU9K 2ZTCA 4I9QA 1VQYA 4FL9A 1TUUA 1U6ZA 5KFWA 4G1QB 5BOMA 4U8VA 4PXCA 2A1SA 2AJ2A 4JI5F 3VQQA 1TUVA 4DQPA 3LP2B 2KHOA 2V2VA 3SAHA 2BV3A 3OD2A 1G3OA 3HHLB 3EDRB 3FNNA 1JK9B 4W92B 1MWZA 3JAMU 4C4SA 3GILA 2XSFA 1HKBA 3TNVA 1FDNA 3IG1A 9ICHA 8ICOA 2R42A 3FFKB 2MU2A 3H40A 3ETOA 4X4SA 2NR0A 2YX7A 4CEDA 1F0MA 3ZZPA 2W41A 5D4OA 1VQMS 3A13A 3AQFA 3CJBA 4HHJA 3UFCX 2QB0B 2CPZA 2VH7A 3PM9A 1DFDA 2WVFA 4RQ0A 5A8WB 4QZIA 3ZNUA 5DBAA 3UDCA 3TA0A 2CQCA 5DLFA 2BJ9A 2M9KA 2X1BA 2A1JA 1S49A 3NMUA 1B22A 4GO7X 2ZIWA 3ZX3A 2G8IA 2OD6A 2Z2ZA 2FI1A 4JKBA 3MEEA 3DXSX 4B8CA 4KLDA 2AKWB 3DLJA 4C97A 3GFHA 2GO8A 3CQYA 2VQEJ 2MB0B 2D1CA 5J0WA 4GVBB 4JWMA 8ICKA 1GAOA 3OR2A 3SCKE 1VDVA 4NPOA 4US8A 1IVZA 4Q2LA 2WF6A 3BYPA 4QJVA 3DYAA 2CXEA 4FW1A 3OPKA 1RLCL 2KN4A 5AIBA 8ICIA 4DV5K 3QIOA 4BXOA 5EU7A 2BH1A 3OY9A 5BR8J 1XMBA 3CF5L 1S1WA 3FEYB 3PW2A 1NMDA 3LGNA 5EWEA 1UAXA 3AUOA 3GQCA 5C25B 1UJ4A 3FCVA 2BR0A 2DHHA 4PL8A 1SC6A 5JTIA 2MPUA 2ZZNA 1ASVA 4TU9A 3CNQP 3MDQA 4QWCA 2H4YB 1RHUB 3T79A 2VGNA 4O3OA 4FYVB 4DV4J 2YHWA 3PDNA 1OO0B 2VICA 3CB4A 2D3ZA 4F0KA 3ZZYA 1K6YA 2QI2A 4ILHA 2KHQA 3ENAA 1NGGA 1XSPA 1QE1B 2PGCA 4J2DA 1LKYB 1U7LA 2XMUA 2CRXA 5F3TA 4QU6A 4DR1J 2XGQA 1T44A 3ZTPA 5KGWA 2NO4A 3CM6A 2FC9A 2NCKL 4PAAA 3AVIA 2EFVA 2IM3A 4LFBF 4KLQA 2FHJD 2OZSA 4AHCA 4OLBA 3UN5A 4ECZA 5BYQA 2MYFA 1SV0C 2HK2A 2FF3B 3FEXB 5HLFB 3NVZA 3C2MA 1RTDB 3UQ0A 1Y97A 3KD5E 2ES6A 1YHQN 3G87A 3WC0A 1LWXA 4CF2A 2RKIA 3KBBA 1WF2A 3KG1A 4MDAA 3ISNC 4YOWA 3O9SA 1HARA 5THWA 4Y0FA 2VWBA 1TFRA 2IBOA 1LWEB 4M3WA 1L3TA 2LM1A 3SQ4A 1UVNA 1ZQHA 1WJ9A 1SGGA 8ICGA 4LFCF 3VN5A 4JS5A 1ZQYA 5ALPA 1VCTA 4MKYA 1P27B 1WSGA 5FD1A 4J37A 4C6AA 3DV9A 2XQCA 4JI7J 1QD1A 3PSPA 2BEFA 4OQJA 3H5UA 1YHQS 3PKMA 1BPDA 4WXWA 4TURA 3NFAA 2KT5A 5EOYA 3ILLA 1T3VA 2QWRA 2D3O1 1NGEA 4F5OA 1XC9A 1KC8T 4NASA 3RRKA 2FQQB 4NCBA 2GMJA 1QZ5A 5EE1A 3ALRA 1U48A 3HSZA 3DC2A 4I27A 1RWKB 3ZC4A 1NKEA 4O4GB 3HM8A 5IWAF 3ED5A 1HQEB 2F7TA 1TAMA 2QARA 2XEXA 3P5JA 1URRA 2NUHA 1ZQCA 4Q8FA 1WSRA 4R63A 3KHHA 1GT8A 2LU1A 1XR5A 3CDEA 2RILA 2ZZTA 4Q5VA 5L1LA 8ICHA 5AQZA 3HVTB 4M3ZA 2W4PA 2VQFK 4AQYK 2G8UA 2O8EA 2PFFB 1N36J 2KV2A 4KE5A 3HILA 3H46O 2UUWA 3U7JA 1RSCA 1BQNA 3LF0A 2MA1A 4M6WA 4J9UE 4BRMA 4HVJA 3I56N 1H7WA 1X9WA 3ADAC 4DV7J 4OMFG 1OPZA 2YV0X 2DNMA 2HOQA 4PWWA 2IBKA 4DR1K 3VCDA 4KHUA 4I7FA 4BLGA 5CYQA 1VQON 2K1RB 4LRDA 4DL6A 4RBVA 1PBAA 1UHUA 5ALXA 3KJFB 4A57A 2ZIVB 4U6PA 1WOSA 2HAFA 2HFVA 3G71N 4CF8A 2VFRA 1ITPA 4JOUA 5F0WA 2OM6A 2CQ4A 3W5ZA 2JDJA 3LDPA 3KUEA 4JK1A 1D3WA 4DOCA 5HO4A 3O6WA 5E79U 4X2BA 1TP7A 4L74A 3I56S 2AJQA 3MM6B 3TP2A 2MQNA 4X4TA 4PXBA 4LR7A 4ZJLA 2C2RA 5AQVA 3D68A 4J2EA 3PSTA 3W60A 3H5YA 2DWQA 5DB7A 1IKYB 3D4JA 1MROB 3QX7A 2E8MA 2KB2A 4DPOA 1NU0A 1COKA 1VQOS 5ALHA 1NH7A 1UKUA 3T1YJ 4X64K 3CMQA 1UOCA 3R97A 4FJ7A 4PH5A 2AJ1A 2CIMA 2PMWA 3G71S 4FLUA 1RKIA 4OX9J 1ZBIA 3KVGA 3CIZA 2RB7A 4M9JA 4F4WA 4P75A 4WBFA 1FDAA 3NBPA 1J6ZA 1DLOA 3F9KA 2W2PP 1UCVA 2V4RA 4CK3A 3K59A 3CE8A 4H0PA 4IXCA 4Y1DA 4O5CA 2E1YA 1A77A 4KHMA 4L73A 1U1QA 2I5JA 1W2IA 1Q81O 2EG2A 2ERRA 4ECTA 2FJ6A 2FC0A 3IG8A 1RXOB 5KAIU 3MTKA 4W5OA 1JNZB 1C0TB 4Z6DA 1XERA 3M6WA 3MX5A 5J2KA 1UZDA 2OPSA 3AA3A 5CHCB 5BXIA 3LZJA 1RDWX 3V7LA 9ICUA 3RR7A 2N4DA 5J1NA 2CPIA 4XQ8A 1EKRA 3EKUA 2FPKA 8RUCA 2ZOFA 2CPFA 4UQTA 1T0TV 4JV5F 1FXRA 2EHGA 2W24A 5ALVA 3V72A 3NH0A 4JAXA 1K1QA 1NJWA 2MZTA 4FVUA 4HUEA 4M3TA 3FUYA 1K1SA 9ICBA 3WEEB 4OD0A 1S9EB 2WBNA 4Y2PA 1N36K 3H45C 2K3KA 4RR5A 4PG4A 3P5TL 1JN3A 2CADA 2HG4A 2YBVA 2HOEA 3CTRA 1N61A 3W2VB 1JLQA 1LVHA 4KHYA 2Q79A 3AM9A 2W9MA 4KLJA 1C1BB 9ICWA 4DUZF 2Z58B 1VQ6N 3NAEA 3KLEB 2VG7B 2RHSB 2MXYA 4BDZA 4CCHA 1FW6A 5HRNA 3PJWA 5AZJA 4QWAA 5KPZA 1A76A 2GQ2A 2MGZB 2D3DA 3MUVP 4LF8K 3AB2B 2JR5A 2LYVA 3EGVA 1VQNN 3BPSP 3HM9A 3N5BA 2FPMA 4FPAA 3BBFA 4DFDA 4YMOA 1BD6A 1T9WA 3SSRA 5ALNA 2PT0A 1RBVA 1K8AO 4EBEA 1I3OB 4OYIA 2EBEA 2DCLA 3AA4A 2XBPA 3VF6A 4A46A 3JSMB 3V6DB 3QPIA 4Y1CA 3HX0A 2C3YA 2Y0SD 4NLGA 4C0ZA 2P9PA 4BUGA 3T1YK 3KKAC 3N79A 1PCAA 3K2YA 4EWTA 1XNRF 3ZSRA 3DI6B 3H2UB 3V9UA 4OX9K 1VQNS 2CJQA 1HYZA 5CZ2A 3UD3P 2O4GA 4DU7A 1S1VB 3P31A 3UDLA 2O8BB 3M8QB 2B56A 5HMWA 3G96A 2ZTDA 1HWIA 3SCJE 2O8FB 4ZVEA 2BJ1A 2Q1LA 2E5SA 2BE9B 2OTLN 3VQ5A 3LDAA 5AFUH 2DR9A 5F1XA 4PWDA 4QNLA 3H1VX 3TA1A 1PVRA 4KFBA 4KR0B 3HI0A 3VZHA 4PPXA 4ZIWA 3W8PA 3EL2A 4IO9Q 4H8KA 4LSNB 2QMXA 4JI6F 1CS4B 2A3ZA 2BKPA 1CULA 3C6TB 3B0YA 4RT2A 5AKGA 4OJ1A 5J2MB 4CLYA 3CDBA 2MQPA 2YX1A 1AB8A 2IDLA 5C10A 2QWQA 2AW0A 4TKTA 5CEHA 3WNEA 2VUGA 2OPRA 4K4UA 2XI9A 3K2PA 3MMJA 3QEIA 4AYBF 4B9UA 1GTHA 2OTLS 2HQDA 2GX8A 4N8OA 2P5OA 1F5CA 2N7CA 4LBHA 3DGVA 2W7PA 1ZYQA 2FLNA 1FF2A 2HS4A 1V4TA 3QSIA 5D77A 2G8KA 3DXKA 4IOBA 5E3RA 3T1HJ 2NRTA 3MDAA 4RNOA 5LMNJ 4CH7A 5ETOA 1KRPA 1Q3UA 1N32F 1U45A 3PYEA 3NGRA 2JSXA 3J81U 3L7OA 1UZHA 4USIA 3OVBA 1SJFA 4JI3J 4OLPA 1DAXA 3BF3A 3W0LA 4OFZA 4MFBB 4MH8A 4NXNF 1Q82O 3UM9A 1FVSA 4BJQA 4TLRA 2QWNA 1UVJA 1D8YA 2ZBPA 4KB0A 3FLCO 1UT8A 1RHMB 2WRMA 3THYB 4Z4HA 3SPZA 3HBTA 4LF4J 4NM1A 3P6YC 4B3MF 1F21A 4TXSA 1F5AA 4Z4FA 1WB9A 1ZBLA 3V1RA 4YN3B 2NLWA 1K9MT 4L3QA 5J1EA 4N8NA 5J2NB 1KL9A 3CC7N 4OYOA 1MWQA 1RYUA 4K4ZA 3HK2A 3A2FA 1NBEB 3OSPA 3N01A 3QIPA 2DXEA 4OV1A 2KVCA 3GIKA 3KDOA 1BO5O 1ZQQA 3L2VA 4FYXB 3QU5A 2Z2MA 2ZVSA 3OW2R 2ZDOA 1AUDA 2E8OA 4K8ZA 1BCMA 4KN4A 2MY7A 4H4KC 4EAHD 5AQGA 3RAMA 3D6JA 3QUQA 1F60B 3U9DA 3MF5A 3AFGA 4LF2A 1REVB 4OZ5A 1AUSL 3CC7S 3T69A 4IOXA 2XI2A 3NGYA 2KJ9A 4IO8A 4LF9J 5AKYA 3ZFVA 3CCLN 2VASA 1PJ7A 5ALGA 1J54A 3EE3A 3I0SB 3RVCA 2HSZA 2F77X 4PZOA 4ID8A 4DU1A 3TEHB 3HF5A 1NHUA 3JSBA 2VONA 1M1GA 4UUWA 3HPHA 4ATNA 3CD7A 3NNCA 2YWEA 3DDIA 2AZ1A 1N54B 3KIOA 2ZXHA 2I38A 5CA7A 1EETB 2D69A 1S8OA 1YJ7A 4YHHJ 1KAYA 4BC4A 1CJVA 4EI2A 4JKCA 3UXNA 3Q8RB 2UXBJ 3V4MA 3I96A 5AJ3F 3GV7B 4YDUC 9ICRA 1YSJA 1SC3B 1FO4A 4IO9L 3QT8A 2VOPA 3CCLS 1UMJA 3CCVN 4YR2A 2B6AA 3MGHA 3FR0A 3ZTSA 3QGPA 1EX4A 4RNNA 3EXCX 1S12A 3M7VA 3WXJA 3MPUB 4NYPA 1TYQB 4IFVB 1VIOA 4WK1A 3T1HK 3HKZD 2Z1JA 5JMNA 4DSKA 4RW9B 2IJRA 2ZTEA 3FCWA 3EX7B 3QNMA 2HOIA 2I8EA 4C4WA 4DLEA 4JRPA 4JI3K 1IKWB 4NLXA 3CJ5A 3QUTA 1RT7B 2P9GA 1JXLA 1ZBFA 1LW2A 1FFSB 3CFRA 4QAGA 3W61A 1Q8BA 1ZOTA 3JTNA 4CZMA 4CNYA 5ETRA 2OTJN 9ICMA 2ISPA 2PI4A 3FMWA 2ASPA 4O4RA 3AXKA 3KKRA 4DUYJ 2ZBQA 1U2VA 2Q2RA 3CD6N 2EZZA 3MURP 2P9LB 1PO6A 4B9LA 2KE7A 4Q45A 5B0FA 3HHLC 1NSAA 4CJ3A 4KMOB 4N76A 3R1LA 5ALSA 1ZBTA 2JXJA 1XNSA 3IR7B 5KG5A 1WELA 4UAVA 5B66U 3EUNA 4FPRA 3CVKA 3DMJB 4KRFA 3CHWA 2K4IA 3M6XA 1QDUB 3PEHA 1RTIB 3BGOP 2E88A 2OTJS 1P6TA 4DV6F 2Z7JA 3QJLA 2POKA 4BS2A 2JWNA 2AYMA 4WKRA 1VK0A 3GR1A 3NS7B 3CD6S 2B51A 4B08A 2AMCB 4PPDA 1WHVA 4NI2A 3WDOA 5DDRC 4GKJJ 2G13A 4EENA 5AQNA 3OL7A 2LSNA 2XZTB 3PMLA 1WUUA 1RABB 5IIIA 7ICEA 4C1NI 4KLOA 2DR7A 2F5GA 1B4SA 5GADI 4ITSA 3GB0A 1WBBA 2QA2A 3VR1A 3WQPA 2KHDA 1K73O 4BE1A 1U25A 1CJUA 4PL1A 4WK3A 4DFJA 3C15B 2AU0A 4BRGA 1M1KO 5GAGP 1VQ9N 4FYWB 3LPTA 1WKLA 3UPFA 2BGGA 3PFOA 6AT1B 1XO1A 1EAYC 3HD2A 2UXBK 3M1VB 3NGIA 2ZF5O 2GOLA 3VAJA 2KZZA 1ELOA 3M6UA 3GONA 4DZDA 5H9FK 2WONB 4TNOA 1GNKA 5KL1B 2JRZA 4BC9A 5KFJA 2QSWA 4L75A 3RAQA 8ICYA 2HVZA 4KSEB 1M5PC 5BOLA 4F0HA 5AQUA 2F1FA 3TUPA 4C8MA 1RTZA 2VJ4A 5B0CA 2Y8WA 1JJHA 1ZBUA 2GELA 1IG8A 3O6QA 2MTLA 2X51A 4JRQA 8ICNA 4K8RA 1SUQB 3ZSVA 1A6SA 1CJTA 4B3OA 2UUTA 1HNVB 4KREA 3QGIA 1RAOA 4NOHA 3RH4A 2P9SA 1SV0A 3V1OA 4FN5A 3CD0A 4Y3CA 1OUQA 3DLKB 1Z1VA 3LQVA 5L1KA 4MK9A 4FZVA 1R89A 4AL6A 4KLHA 3S1TA 2LU2A 3IC1A 3OYMA 1NDKA 4WFAQ 2HB5A 5LM7E 3DGPA 2OEMA 3T9ZA 2QE5A 2J9DE 3BQTA 1WG1A 3M2VB 3ATVA 3A8KA 2DGWA 3W66A 3GIIA 4AILC 2AXTU 5D4NA 3AVHA 1NNDA 3LP1B 3H4DA 2GUPA 1DTTA 4MJKA 3K9KA 4UY85 2C2OB 2GGPB 3AO4A 4ZK7M 1N34K 3NGUA 4YY3J 3BQ0A 4RU9A 3M32A 4BR5A 1FWKA 3KLFA 3M8ZA 1QM9A 1TE2A 4JI7F 3CCRN 3HHKA 2F1IA 3E51A 4HI1A 3W8GA 3RYLA 4DDFA 4YOXA 4PQUB 4DCPB 4OPKA 3ELHA 1FJ7A 2CNKB 1DKGD 1HI0P 3EEQA 2ZM6J 2CVIA 1LWCB 2J7WA 3I8DA 5M2PA 3BP8A 2JRSA 3CJRA 4USJC 1C0UA 1V9OA 1X4AA 3D2EB 2KIWA 5FLXU 1L3VA 3DOLB 2GWJA 1SL0A 4M95A 3B0XA 3C1ZA 2JC1A 3MMBB 4OX8A 3PHTA 1VC0A 4CD1A 2CQBA 5K9FA 5J2PA 4K25A 1WSEA 5F9LA 3Q7CA 3PRDA 4WE1A 3CCRS 5J2BA 2E8AA 3T6BA 4BC3A 2CQ1A 2F9DA 4FF4A 3JPRA 4OYXA 4ER8A 2KN7A 2MKKA 3I5BA 3R2DJ 4EX7A 3WK6A 1M6YA 2F4VF 1F9HA 4W4MA 3TZZA 2R2SA 3N7RC 4O0NA 4OV6A 3CUNA 2L08A 4MT1A 4XH1A 1NO8A 4HT7A 2B8QA 2MRLA 5J8YA 2FLPA 3BEXA 3JPTA 2HQ3A 3H6EA 1J97A 1NNLA 5M1NA 1OJ4A 3RJMB 3NCPA 3IO1A 3AL0B 3QGHA 4FWLA 2YMPA 2OYYA 4LRCA 2Q0UA 4F92B 5HBMB 2YX8A 3N7PD 4GKKF 4ANEA 4WP3A 5LJ5Y 1JCFA 1EHWA 3W63A 1KVJA 3KK7A 3MEGA 4E1MA 1QAJA 4LSLB 2ZWOA 2WB4A 4I2BA 2C2KB 1ZQBA 4Y2KA 4BR2A 2DKXA 4NLOA 3K5MA 2M0GB 1RT3B 2AT1B 3BQ1A 2VV5A 1R43A 2HWIA 2XRIA 1YVNA 3S3MA 1XMQJ 1XN9A 3ALYA 1LXJA 2HFSA 3Q24A 2EWSA 2KZMA 4FS2A 4ILJA 1UPHA 2I5HA 4C8NA 1N63A 2LPEA 4YQWA 4IRDA 5JLHA 1N88A 2WVDA 2FVPA 3D54A 1BPBA 4I2AA 3AAPA 1PSDA 2EK1A 2R18A 3LZIA 3DXBA 1HW9A 5AQPA 2AWZA 4GY2B 1KFTA 3GJQB 1FK9B 3KLIA 4FXDA 2BQUA 4DV0F 1SVDA 4MTPA 4OPHA 4OJ6A 2E6MA 4FPBA 3DDKA 1RCXB 1H0HB 1E6YA 4IDKB 1U2RA 4YY3K 8ICXA 4I6MB 4DQQA 3O9QA 5J2IA 2KI2A 3POTB 4ETXA 3KK3A 1QAIA 5FDLB 4WFAL 1S9GB 3AVBA 4DSIA 3R5JB 2G8HA 3WZ0A 5KFNA 2NRRA 2YNIB 2ZIUB 2OZMA 4PXEA 4AYBC 2A18A 2M52A 1NPPA 2RE1A 3O4NA 4NO7A 1YXQA 2CAJA 2YKNA 1VQSA 2DNPA 3G8TA 2UUAJ 4DFPA 3DHXA 4Y2CA 4KX5A 3BQ7A 5AM3A 3ISCA 5IIOA 1JJ2R 4IRKA 5J2HA 1T9TA 2HGMA 3H0MB 2AQ4A 1O51A 2R7XA 3F56A 3UR0A 1ZQFA 2HNYB 4OYMA 3MR3A 2F8MA 4DJBA 2IOHA 2EW9A 1MSWD 1HJOA 1FX4A 1HL6A 1HQUA 5C42A 2FY8A 3ZT0A 5ETQA 1SZHA 2V7ZA 1ZAWA 3C19A 4ZPTR 2ROEA 3IBWA 1NJZA 2QM1A 3ENBA 2E2PA 3DU5A 2ZJRQ 4AHSA 1GTEA 3J7A1 3N97B 4QZGA 1CI4A 1RQNA 4KC5A 4LRFA 2J9EA 2G0CA 3QFUA 3SUQA 4QQBA 3C6UA 3IWNC 5DQIA 2H48B 1FRHA 1I51B 2P6RA 1M5OC 1FD2A 2E5LJ 3O44A 2VG6B 4DSJA 3HFKA 1RDCA 1GMWD 2CYYA 3ILOA 4LBIA 3OJSA 1HKGA 1FKPA 5HK4A 1YT3A 4FJHA 4KY3A 3O9RA 4DHVA 3C14A 4DL7A 1S4FA 1Z2LA 5CZ1A 2MLZA 4PG5A 3SUPA 4FJKA 1X5TA 1U1NA 3T41A 3TVKA 3A3PB 2WC9A 4OYBA 4G9ZA 1IV8A 4UB1A 2HBQB 1HHTP 1ECWA 4UB2A 1RAAB 4ZLPA 4M47A 3S41A 2CXYA 1OH8A 1ZQNA 2HQGA 5AXKA 6FDRA 2J0WA 2DNKA 5DM6Q 1M1HA 2VHGA 1WF0A 1UA1A 1UW9A 3DDNA 5IIJA 4HI2A 5JUMA 2W42A 4M5HA 4FWRA 1LWFB 9ICKA 1TL3A 3ZD9A 2IA6A 1UT5A 1KVIA 3CEDA 3V6JA 3CETA 1Y3KA 2AEMA 3H8JA 2H1YA 4J9MA 4ICAA 1L8LA 1PAEX 2ZD1B 2AH5A 4HYKA 1KN6A 4YXJA 1BDGA 4IG3A 3CO0P 5IINA 2H3FA 4LVOP 4BRIA 3SPYA 2P9IB 3RJHA 3MOJB 5B0DA 3GYXB 4EHUA 3D1QA 4QYZK 3J7ZT 1RT6B 3EKSA 1IJJA 3NL0A 3PNCA 1TKTA 1ZD3A 4LQ9A 3KHYA 1NB2A 5C15A 2KFZA 2NRWA 3NVWA 4Y00A 3D0HE 4JHDA 1S79A 4HEA9 2CJKA 1M5HA 3H0RB 1N5YA 4KHRA 1DXSA 2IAJA 3DRSB 4DS4A 3OGUA 4DF8A 4JD2A 2ACYA 2W8LA 3MM9A 2P6UA 3QT7A 4EYHB 5AQMA 2FMPA 3IRXB 4J9LA 1N33F 3LO3A 3NF7A 1HD0A 3D3BJ 3SK3A 1CEZA 1H2VZ 5DZ7A 2DGVA 5BR9A 2YKQA 3D6RA 2HHHK 5JJBA 3TYTA 4BVPA 2ZEJA 3ZX2A 4X62J 4RQ8A 5H2FU 3ENHA 3RJIA 1KFSA 3CRXA 3QBCA 4AXIA 2NRHA 1E6VB 1U8WA 4I56A 3DN9A 3KOOA 3CJKA 1OY6A 4ID5B 4ZS6A 2E1EA 3EYZA 3TQEA 2NPIA 5A2QU 1IUJA 2EBGA 4CTAB 4B8AB 5AQJA 3BO4A 2ZJRL 2WVBA 4DR7J 1MDUB 5LSLA 3ULDA 4CHQA 4RO0A 4G1PA 1FKOA 3PVXA 2MZQA 3CC2N 2FHKA 2HMIA 1URJA 3BGFA 2YKAA 5AK6A 3U6FA 3M1YA 4XDDA 2IVNA 1B9DA 5KT3A 3OS2A 1S6QB 2Q36A 1ULRA 3KK1B 4PXDA 3FQLA 4WJ3B 3BSCA 4DSEA 4DEZA 1L7OA 2X1GA 1T11A 2XM3A 1VQKN 2HWTA 4BC2A 3MM8B 5ETKA 4K0KJ 3CJ9A 4I9LA 1NK4A 1RWVB 2IC3A 1N0UA 4FM2A 4PUOA 2V7YA 1ZQWA 1SQFA 3NAIA 2E2OA 5M2UA 1VHXA 3BR8A 4FPIA 2ROGA 1HWJA 3HSJA 3K1RB 2CDQA 3C95A 3CC2S 1IBKF 4HWIA 3R8EA 2GIRA 2Z1HA 4CEOA 3ZLJA 2NV3A 2E3TA 5AQIA 3L2RA 4P2FA 2E1ZA 2UVRA 3KDNA 4OPAA 3I32A 1XQSC 5LT5A 1MN7A 2KYZA 5D3GA 4LF9F 4DL2A 3TZYA 4X65J 1Q5VA 2BGWA 2U2FA 4BREA 5ADXA 3P3DA 1ZQUA 1YJVA 2EQYA 3UQ2A 3D9BA 2R8KA 3KK2B 4CLSA 1MU2B 4YCXA 2ZH6A 1OKJA 5HROA 2GMHA 4KTZA 2ITGA 1HNXF 1LAWA 3N4MB 4Y2YA 4B3RK 1NGHA 3H8WA 3UWTA 4RUCA 4F3MA 4DX6A 4DR3F 4OCZA 4NXZA 4YHHF 1Q86O 4DPWA 3CP8A 2V5HG 4YDUA 1XR6A 5ALFA 3CCZA 1PBUA 1Q78A 2KLAA 5DETA 4CESA 1Q18A 1B92A 5TKWA 3UVJB 4LF6K 2H3QA 3B4DA 4JK7A 4UUXA 3ZETB 3PIPL 4CIFA 1OS5A 3HULA 2LXUA 2HNZB 3MZIA 1V38A 2FVCA 4JI8J 4CHYA 4I69A 2GBZA 5M1QA 1JLBA 2LECA 4KBIA 4USAA 4KGZB 2GLEA 2I7NA 1WUDA 3TSUA 5DO2A 3AVNA 1GLEG 3RR8A 2PEHA 3ETRA 1J5EJ 1HMVA 4FJMA 3DDHA 8ICLA 2CNNB 1ZM4A 4ZP9A 2JFKA 1NZAA 2CJBA 2XMAA 3ZYYX 4OZ1A 1I94K 4WF9Q 3O5BA 1I1GA 4CZCA 4DR7K 3O2IA 3FDSA 2YXLA 4FFDA 5KT7A 1VMBA 2FF6A 2P9KA 1RT5B 2B43A 3QEBZ 3KTQA 1PKUA 2ASDA 2ZFHA 9ATCB 4JB3A 2MQMA 1YDLA 1ZA1B 2N3LA 2KL8A 4PKHA 4UOFA 4BRDA 4JMUA 4CRXA 1VLYA 3LTOA 1O6XA 4G1QA 4NLRA 3BO2A 1Y9OA 2IGIA 4ZIVA 1NOZA 1TVRB 4NXMF 2JOQA 3OW2M 3LP2A 2Y3YA 4X4OA 2X1FA 3UI3A 2RQKA 3HHLA 3K0JA 1V85A 4CK2A 1UFLA 4PQAA 2B9YA 4X4VA 2CQDA 3GBTA 2BZ2A 2CQ2A 3TVZA 1WKJA 4FNHA 3D1HA 4K2XA 3ET6B 3BYRA 2EFOA 2KKHA 2Q6CA 2NO5A 4MKBA 4C4RA 4KHPK 2N1RA 1LKZA 2F76X 1ZZFA 4FZYA 3M6GA 1RWPB 3WKDA 5HVHA 3CIPA 2QB0A 4NCGB 1RBUA 8ICAA 3QESA 2PEBA 2C2NA 2B5JB 2R9LA 3PIOQ 1BQMB 5A8WA 1K8AT 5T41A 4NLTA 3GE9A 5BPLA 2A1BA 5KFEA 4P2XA 3T7ZA 1UL3A 1ZPWX 3K8WA 5EX3A 1KQKA 1N60A 4EK2A 2RRDA 3TSQA 3PFEA 1NJYA 1YVFA 1IBCB 1S6PB 1FFWB 2A2CA 5K8OA 3MWTA 3KG0A 3V7JA 1NHVA 4ACOA 3K7RA 4G3IA 4WU3A 3HVRA 1EWRA 4GXIA 3C16B 4L72B 4GVBA 5FJ4A 4P7TA 2XMVA 3QETA 4P2HA 1GK8A 1EXQA 4QIEA 1FVQA 2QG9B 2C2EA 1HHQA 2XYGB 3IDHA 2MLXA 3CGIA 4KI4A 1DGJA 4FCYA 1VJ5A 3CXCR 4O5BA 2BM1A 1G2EA 2BDPA 4C1NK 3VF0B 5H1SV 1MN8A 4NLUA 2EAMA 2L5YA 3WXMB 1SS6A 2VBWA 3MCNA 4LUBA 3VA0A 4I6WA 4AD6A 3L2UA 2RDDA 4F93B 4M3UA 2H3EB 4BR7A 1HW8A 3D2NA 2WK4A 4CBUA 1C4AA 4G6VB 3WXIA 4C4TA 4GO5X 2BANB 3PO5A 3Q8QB 5GAHI 2DGOA 3E8OA 4FJGA 3OFGA 2J0QD 3CCQN 1QE1A 1TK0A 3A3OB 4RG8A 4JKFA 4BX9C 1UVKA 2RQ4A 4GC7A 4H03B 2OH2A 4DU3A 4LF7F 3A12A 1NK8A 1S3XA 2VDIA 3KWMA 4WF9L 5C0YA 1L3KA 2FC8A 3KUHA 5KOWA 4MHVA 4EZ9A 7ICGA 2E9ZA 3EVOA 1X66A 2NRZA 3QQCD 2D0PA 4BDPA 9ICSA 1TKZB 3BGUA 3LDQA 3D7EO 4ZKAA 2CGJA 5HLFA 4Q0BB 4FZZA 3OHBA 4P52A 1RTDA 3CCQS 4M9GA 1YJWS 2C2ZB 1NGCA 4KO0B 4O9MA 1NHKL 2FTRA 1VBKA 3VA3A 3Q86A 5M1PA 4UB8U 4CZIA 4DTNA 3Q8SB 3VOVA 1LWEA 3AVMA 3SDEA 3T5JA 4CJWA 3G8QA 4DV5F 1QQCA 3CIMA 1EWQA 2ZE2B 4CIGA 3O3GA 3ISND 1SJQA 1FJGK 4FWPA 1SC4B 3UB5A 3PIOL 3BH7B 1JROA 4YB5A 4H5WA 1BHLA 3RB6A 1S5ZA 1NEEA 3GV8B 4BHQA 2E5JA 4ZOSA 1G99A 4JI0J 4ANCA 3EJMA 4ECXA 1URNA 2P6SA 1A5VA 5EVZA 4R65A 1WOOA 3N4PA 5HRPA 3SIPB 2IHNA 2R2TA 3QUBA 1HNZK 3RBZA 3ZZZA 3MXJA 4I2DA 4O4GA 3SNNA 1HQEA 4PJ0U 3HFVA 4M1KA 5AK5A 1TZ0A 2X78A 2DHXA 1NJXA 1HR0F 1SKSA 3QAEA 1QQNA 1XMQF 5ALZA 2QLWA 4RZRA 4PG6A 3ZDDA 2V0NA 5BYRA 3L7PA 1YJUA 3HVTA 3SMSA 2HAIA 4U95A 4ILGB 1WEXA 5J2CA 1QAXA 5ETLA 3K5OA 3L3VA 4DV1K 8ICUA 4DL5A 1D9FA 4C98A 3FRYA 1Q1KA 2GWSA 3AVLA 3F5AA 1F3VA 5DQHA 1SV5B 2V52B 1Z25A 3V9XA 4RW8B 3G0ZA 3TADA 1CC8A 4U7CA 2DNNA 5ALIA 3J7AP 7ICPA 2B4VA 5E33A 3OTOK 4FXWA 1U1MA 4B3SJ 2Z0GA 2X6SA 2R8JA 4GXKA 2BQRA 1A6LA 3GV5B 4C48A 3QRPA 1EP4B 3C46A 4PKGA 2XWYA 3O3HA 2K1RA 4ZCKA 4BRFA 2LCWA 4CFCA 4CO4A 2D4WA 3CPEA 3N6LA 4CYUB 1M5KC 4JKAA 1ZXOA 2ZIVA 2DF4B 2VBZA 3UO0A 2DNYA 2VD3A 2W2MP 3K9JA 4FE3A 3Q8YA 4J9PA 3M2UB 4CGFA 5CHIA 4UATA 4B9NA 2ABYA 4CJVA 3N4QA 3MM6A 3AMZA 3FBEA 3SAGA 3ZNJ1 1S1TB 1EB0A 2QLTA 1WWUA 4ZVPB 1WC5A 2CRLA 4CZGA 2YH1A 1IKYA 4BC5A 1MROA 4IQMA 2K60A 1WCNA 4CM2A 1BA0A 2G08A 4QIWD 4OI2A 4F4ZA 1UTAA 2J8AA 1O5JA 1WOPA 1VQLS 3SI6A 1YK9A 5GAEI 2G0AA 1RDUA 2E9RX 5G0RB 1BUXA 5KAKA 1RWXB 3GU0A 2BX6A 1ZXIA 3ZX0A 1L3UA 4NLKA 4X4QA 3UQSA 2RUSA 3NCIA 2ADBA 3TX0A 2VFUA 3US5A 1RLDA 3OS0A 2JH1A 1NM1A 4K43A 1HUOA 1ZRNA 2CQHA 4ED8A 3T6JA 1K0TA 4OHWA 2P9UB 5IT9Y 3SSQA 4JI0K 5F8MA 2NZCA 3GLJA 2G0IA 1C0TA 2K7KA 4K4XA 3EZUA 4IKFA 2O8CB 1C0GA 2CN1A 5CRXA 3NTUA 4FZMA 4JI5J 4QU7A 2GW8A 4YD2A 2FUG9 4HTLA 5I4MA 2QXLA 2C2DA 3H7HB 3WT0A 4ZITA 2WTFA 1CXUA 3AQOA 1HBOB 1UWBB 4JEPA 4OJOA 2E5LF 3NVMA 2AJ4A 5FIIA 4CEEA 1RU1A 3IDWA 2E1MC 4C0BA 3VAMA 1SIJA 3WEEA 1S9EA 4LD0A 4M9HA 3GCXP 4QZDA 2W25A 2UV8G 5CYMA 3BZQA 4K5RA 1NOYA 3W2VA 5C2CA 5AKEA 5SWMA 2DFEA 2GS8A 1WCLA 4WZQA 4WXOA 4B3SK 3SV4A 2NXUA 2HS3A 1MWMA 4TUSA 3AD9C 3BZCA 1VHFA 4DTOA 5EDWA 2UXDK 3KLEA 2VG7A 5KQ8A 5DM7Q 1QSYA 2KG5A 4WQ4A 4E3SA 1G15A 4X64F 4PKDB 2MGZA 2AEFA 2ATLA 2D0CA 4QS7A 5TKYA 4F4YA 1EZZB 4ZPBA 3M4XA 5L39A 3A4TA 3THVA 2CPDA 2YNGB 1ZAVA 2Y1LB 3X3UA 4M9LA 1ZD2P 3M8PB 3SMVA 4JP8A 5ALOA 5D46A 4Z7YA 1Y5IB 1KQQA 3U9ZA 4IRCA 3OJUA 2FJXA 3JSMA 3V6DA 1JJ2M 3OYFA 2LM4A 1PG5B 3C1YA 2F9TA 2M4MA 2Q0RA 1ZBSA 5DDYA 4ZDNA 1FE0A 2OPQB 5FPNA 9ICTA 5DZ6A 1PZNA 3DI6A 3RSEB 3CCTA 1FT8A 5HP1B 3B9JA 1UVLA 4PYAA 4FO0A 1IKVB 4C0OC 2RS8A 4C0HA 2HDOA 2V67A 1S1VA 3CFOA 2UYTA 1NLKL 2O8BA 3AA8A 5BRHA 3UW1A 4C8ZA 4ALZA 3D6MB 3M8QA 3H8MA 1CZBA 5AQOA 3QEXA 4KV8B 2WSEC 4IFEA 2O8FA 4IO1A 3M5RA 2DHAA 2OPPB 3RMDA 3M9OB 1BNPA 4M5LA 3ETMA 1K0VA 3KHLA 3QMLA 3C23A 5D0RA 4WKYA 1FWPA 5AM0A 4LSNA 1CS4A 1TV6B 2YN4A 3ZCMA 5ETTA 3C6TA 2DB1A 4NLVA 4FM0A 3Q83A 4HCCA 1WEYA 1ZQRA 4BCAA 5AM1A 5J2GA 5J2MA 4UT4A 2GJIA 4QBUA 1S5LU 3NRZA 2R7YA 3QWUA 5CCLA 4CDGA 2J9DA 3KHGA 4KLSA 2GHPA 3VTIA 3G6VA 2KNJA 1X60A 4KN7A 3AU6A 2WF9A 4CJSA 4W90B 1DEJA 4LFBJ 3U4LA 3FC9A 2V6AA 4WTOB 4GVLA 1IQTA 1QSLA 3F9MA 4GVMA 3NF9A 4JI2F 3UR3C 4LF8F 4M5GA 1UPMB 4X4UA 3KYLA 4W5NA 3VVUA 7ICLA 1X4EA 4HUGA 3HJFA 3UDEA 3AJ1A 3OHAA 4WCEQ 2DGTA 3C2KA 3JYTB 3LAKA 5DMRA 2I1QA 3OYNA 2QL7B 4XEIA 3VEYA 2Q3SA 3HT0A 3GP9A 4FWMA 4MFBA 4ZVGA 4LFCJ 2OGUA 2V8VA 2QC3A 2V50A 2XB2D 5ETPA 2IHMA 1UWAA 2FYXA 2B21A 1FCAA 1Z4OA 4NLBA 3DLLQ 5CB1A 3THYA 4ZJQA 4Y2AA 3OSNA 2WOMB 3V6KA 2RSQA 2YKMB 3TAQA 4ED2A 4EZ6A 8ICEA 4PHPA 4MFAA 4DBQA 3ZSOA 5J2NA 2A2DA 1FDBA 4RPFA 1HBMB 4U7UK 2BJEA 3EO3A 5DM7L 3NGDA 4ZHRB 2ITMA 1F44A 3VAIA 1B7FA 1TMMA 2GUIA 4H0TB 1X4DA 4YG2A 2L9DA 3H90A 2F2AB 2HGNA 1FXDA 2WF7A 3I33A 3SSSA 1IXRA 1GX5A 5IWAJ 4U7UD 5AM2A 1O13A 1R7IA 5AQSA 3I0RB 1WKKA 2W03A 1WC4A 2KD1A 4LSZB 2O1PA 4CLLA 4B1XB 1VOMA 4TSXA 2NS1B 2XY5A 3EPIA 4Z4CA 3RB4A 4ETZA 1REVA 1QVGR 4D3HA 2OIHA 1C0FA 5MLCV 3F41A 1YRUA 2ZHAA 1J27A 3QMQA 3I0SA 4JI4K 3NOCA 5IT9O 1K9MO 3NOGA 1YUWA 1Q7LB 2ASJA 2E1PA 1PK3A 2VPZB 4RJVA 3QU9A 2B6GA 4OLAA 4M3YA 2HHSA 3MOZA 4LR9A 4QR1A 4YMNA 4IQWA 2HW3A 4K5SA 2WMMA 2OEHA 1RA7A 1EETA 3ENOA 1DY3A 3VQ4A 2YX6A 1Q0NA 1IV0A 1BPEA 4LFBK 2WB1F 3IRUA 1WSFA 1HRHA 2IMOA 2ZC4A 2L9NA 4IR9A 8ICJA 1C0MA 5LSOA 4I2PB 1TYQA 4IFVA 3UN2A 3PKYA 4XDCA 4RW9A 1M5VC 1NU4A 2YQEA 1SI9A 4UZCA 2FDNA 2JHDA 3GFKB 2DISA 2PKEA 4KLEA 1KVBA 3VEOA 1IKWA 2KVQE 1RT7A 4JWNA 4ECVA 1SKRA 1WC0A 3L5KA 4K4IA 4CM0A 1X40A 1Y5LB 4DTJA 3JS9A 5KFQA 2GAGC 1RA6A 2J6SA 1BY9A 5A0YB 1X6JA 2NXEA 1CZ9A 4K4HA 3WKEA 4TY8B 2K4PA 5GTHU 1ZJNA 3VPZA 2E2NA 5AZIB 2P8IA 1N5SA 1Q9YA 2VKQA 3NKYA 2JFDA 3A8JA 2DTUA 3MBYA 2P9LA 1CPZA 5AQLA 3QU7A 3TTFA 3C5GA 2G9OA 2FMSA 3DLLL 1FEHA 5SUHA 3AAQA 3VZIA 3IP4B 2FBXA 2QYCA 5IWAK 2DY9A 3SUNA 4UAWA 2VA8A 4RBTA 1VBYA 3GSIA 4JKDA 1N4LA 4AFFA 4KLUA 1ZQPA 5LOQA 2CKWA 3DMJA 2WTUA 3GG4A 4V1Ak 2J6UA 2ZC3A 3IAM9 1RTIA 3G6XA 2Y0BB 3HHLD 1D8LA 1YBAA 2W6KA 1VQ4N 2PC6A 2ZJ5A 1U0SA 4DR6F 5GADP 2G5IB 5AKXA 1HPZB 3ZSYA 1NK7A 5T14A 4ISFA 2O66A 2IM0A 3TTDA 5KT5A 4MN4C 4QS8A 1VS3A 2ASOA 4K41A 3ZXWA 2YQ3A 5LL6d 3ULHA 4CT9A 4J9NA 3GOIA 3TRGA 4Y2QA 1H72C 2BUNA 4OJ3A 4O3RA 1V3ZA 2YWKA 1RAJA 3C2PA 3O4QA 2DTJA 3D28A 4MYUA 2GVDB 2OELA 2GIQA 4DUZJ 3HVWA 1YX2A 2ZDPA 1FNXH 3ZDBA 2DPIA 3DM2B 1ED1A 1JL2A 4OX7A 3I5AA 7ICQA 1KNZA 2A3JA 5J0QA 3M1VA 3NWGA 4JLHA 2C3PA 4DKWA 4DL4A 3BDEA 8ICZA 1EJ7L 4A8WA 1RZTA 2WONA 3R3TA 4KH5A 3OYAA 4PZNA 2K8GA 3R3LA 4B1VA 1JL1A 4IQXA 1ZOLA 3SLCA 4C8KA 2DR5A 2FVQA 1XC3A 2A40A 4X66K 3ZDAA 4OZLA 3MXHP 4ECWA 4FWNA 2LQBA 2W9BB 3H8YA 2GO9A 3MMCB 4LQ3A 2KM8B 1SUQA 2ZG6A 5HHHA 3GJSB 3FE1A 1XNRJ 5HMLA 1U49A 3CQXA 5DGBA 2DR8A 2QSFA 3TFRA 4KITB 1S76D 1RTJB 2EPIA 2P1JA 1DQ9A 1OVQA 2IHR1 2CG4A 1RWOB 3IGNA 3WK7A 2PAVA 2HURA 4DLGA 1JJ4A 2O3DA 1W9HA 2W4DA 4CLTA 5KFLA 5BYSA 2PFNA 1T05B 4QIGA 5HMYA 2P66A 5IIKA 3M2VA 5IT0A 1WAFA 4DOBA 3CCMN 1NJIO 3LP1A 4A8QA 3RMCA 4H54A 1VRUB 4JI6J 4OO1J 3A0HU 3EPGA 3JPNA 2GGPA 3S3NA 2H5EA 3CCEN 4KHNA 4L8RB 1FNOA 1BQNB 2HVDA 3HXMA 3CNHA 2EC2A 3NVYA 4CO1A 2M5YA 4YMEA 4PQUA 2ZGYA 4BR0A 5KFRA 1LWCA 2Z4PA 4UTGA 4LH5A 1ZQ1C 4CF0A 1FIQA 3I6PA 1AA1B 5HHIA 1ZQJA 4JV5K 1U47A 2M8HA 8ATCB 1H2UX 4J9RA 4WFZA 3D2EA 2J5AA 4NLCA 4BDYA 3GU3A 4IJNA 5KG4A 1ZQTA 3IFEA 3DOLA 5M1KA 3WNGA 3MMBA 4US9A 2DIUA 2GNKA 3CCES 2BOAA 1KD1O 4MEYA 5AK3A 5G5GA 3DU6A 1XTZA 5A8RB 2KKPA 3UXPA 3MFIA 3FFIB 2G2ZA 4DUZK 4E7IA 4KHSA 2LLZA 4GRSA 3MHYA 1JJCB 4NXNJ 2ZH7A 2QKQA 4QWDA 1RK8A 1QQ6A 1ZD5A 3ULEB 2E7VA 1DK2A 3MCPA 3FGVA 3W62A 2I0XA 4CJRA 9ICPA 1JLEB 4A8EA 1G6BA 1VQ7N 4B3MJ 4WU2A 4Y2XA 1B0TA 4IS7A 1DRZA 1B0VA 3RB3A 3O3LA 5HBMA 4CLPA 4XAKA 1BOTO 2HMXA 3PR4A 4LSLA 1BI4B 3PYFA 2L41A 4ED7A 4MIAA 1GX6A 3D66A 2EEYA 1FFVA 4QOTA 1RT3A 3BKTA 4R5PB 3LP0B 5ITHA 3LGMA 4Y2RA 3H0PA 1XNRK 1NKBA 1ZQIA 2RRNA 4IZ9A 5AI6A 2QA4S 3PNIA 4B9MA 3LH2S 5ALEA 2JH7A 1ZQKA 4EUVA 2V8PA 2HHTA 1RB0A 1TAQA 1W2BR 3TO8A 4F25A 3W5XA 3OL8A 3L95X 1S59A 3M8WA 2R7VA 4DG1B 4XUSA 1FFUA 5F0UA 1FK9A 5FRMA 2UUCF 2BPCA 3ZDCA 4ISEA 4JI6K 3H2LA 2XNQA 4IDKA 3BSOA 2G8VA 2MZJA 4I6MA 3QEAZ 8ICMA 3TOQA 1V5VA 3POTA 3NS1A 5FDLA 1S9GA 3ZZTA 3QATA 2CQ0A 5K5MA 2W1BA 2V34A 3O4WA 1WWVA 4ERDA 2YNIA 3O9TA 4MO4A 2ZIUA 1GLFO 1FTRA 1V9PA 2HQCA 5EN1A 1ZQGA 3FSXA 4O55A 5AJ3J 1DBDA 5KL8B 1RKJA 2DGZA 2Z56B 3M30B 4OIXA 4ZVFA 2IMWP 1A0PA 1WNEA 1MWYA 2VDHA 3HL8A 2O4IA 1BHNA 1T9VA 4F5NA 2Y0SC 4AYBD 4NYNA 4CJFA 1HWLA 2OHDA 2BJ3A 1T9XA 4B3TJ 1EKEA 2CPHA 4DV3F 2RHQB 4Z7CA 1N32K 1XJWB 3QWPA 1ZQEA 2HNYA 2B4OA 2UXCK 5AQXA 1KVAA 3U3GA 4ZTFA 4NXNK 2FXUA 3TZWA 1RT1B 2X3DA 1QS4A 4CEQA 1VIXA 3SQGB 2OFGX 2ASMA 4F36A 3HX9A 4GV6A 1RILA 2RLTA 3KNGA 2YKPA 2EWHA 4JNEA 3R2CJ 4B3MK 1VC5A 5E7OB 1FNMA 1R6YA 5LXYA 5F0XA 4O0IA 1RYRA 4A8OA 2ZH9A 2RRBA 3SFUA 1JWWA 4CEFA 1WAJA 4ED4A 5J29A 2DNQA 3BS9A 3FK4A 4E98A 1P90A 1EX8A 3PW7A 4FM1A 5JLFA 2KVSA 1IR1A 3IN5A 2YTUA 3MR2A 5IT4A 2QL5B 3N5FA 2C2MB 1IJEB 3MM5B 3OT9A 4M63A 5K8NA 2N82B 3JSRA 2X1AA 4CI0B 2JLEA 2HRTA 1IG6A 3KXDA 3E9LA 3CSKA 4KQZA 4P2MA 2LMRA 3CMAN 4FJLA 2VG6A 5B09A 5CD4A 3VAKA 2KIVA 4FJJA 2ZHBA 3IP0A 4M3RA 3ZZOA 2NNWA 4OGCA 3OYBA 5AI0A 1N6QB 3SBTA 4DV6J 3RTVA 2BPFA 2XICA 4F71A 4MMOA 2F3NA 3SR6A 3MTJA 1YKWA 3UNGC 4UY8O 3KLGB 1H73A 3R9PA 8ICTA 2BE2B 4DTPA 4MK7A 2NQPA 3QZ7A 3DWLA 2E1RA 4AH9A 1S22A 3J7YI 3WUHA 1SKUB 4ZCIA 5DB8A 1VBZA 2ZOMA 2D6FC 4ZN3A 4E1JA 5HL7Q 1PGZA 1YJTA 1XO0A 3VERA 2Z2YB 3IFRA 3CMAS 4LMZA 3OVNA 2CNOB 1EARA 2ZGZA 1TKDA 1VRTB 2WBRA 1LWFA 2MKSA 2KKVA 1T4GA 5GAHU 1NM2A 4RQ5A 3O1BA 3L4IA 1IBMK 3N7SC 3J81Y 2AGPA 2YI1A 2K8AA 2WB1C 5KFZA 1AZSB 3OBYA 3QZ8A 2VC0A 2ZD1A 2CQIA 1RCHA 5AJ3K 2IIHA 5KFGA 4WP9A 4DTUA 4BWJA 5I3UB 3VEVA 2BCSA 3P96A 2P9IA 3M2RB 1JNRB 1FI4A 4PA1A 3NLCA 2W01A 2BRLA 5CZXA 3V9SA 8ICPA 1XMOJ 1RT6A 4O5EA 3E01A 4D3GA 2J7KA 1KBRA 5EOZA 2DJWA 2DY1A 1JALA 1Q8KA 4Q43A 5KPTA 5T7BA 2O01C 3FQKA 4A48A 3TQ1A 4XO0A 4CZHA 1UETA 2PI5A 2E5GA 2C3MA 2W2OP 3G6YA 1W97L 3DRSA 3G9CA 2XNRA 3J7AN 2XULA 1U4BA 4ILLA 1X0FA 5AE2A 2AGOA 5KG2A 3ID8A 3IRXA 3HJEA 3IRWP 4F67A 2Q6BA 4FW2A 2GH1A 2NUBA 4QIFA 5KT6A 5AXNA 3KLVA 4E7KA 4PHDA 3OHRA 2OEJA 4I6AA 3U1NA 1FFGB 5CABA 4GNIA 2AV5A 3GIJA 2WF5A 3LW5C 4L6V3 4K42A 4EX6A 1IKXB 2BCVA 1TTHB 3NUQA 3LUYA 3N0VA 1X8DA 2QZ8A 3DJCA 3J7ZO 2XMWA 1HBUB 1E6VA 2ZH4A 4Y0WA 4ID5A 5AI4A 3D6TB 2KMDA 2J76E 4FLTA 5I3PA 1CSJA 4CF1A 4CTAA 3AQPA 2JX2A 2VQEK 2CH5A 3HWTA 1AW0A 3SEOA 3AVAA 2MJNA 5AKIA 5HJYA 4CZEA 2KHCA 2ZH1A 2OHFA 1KQSR 3EVMA 3IS9B 4MDBA 1PK1B 3N4WA 3MN6A 1S6QA 4CEAA 3KK1A 1YWXA 1KBUA 2DEIA 4JKHA 2WVEA 9ICXA 1R8BA 2IDEA 2E8PA 1WBDA 4CGHA 4J9OA 2MHNA 3MM8A 4DR5F 1S99A 4MEXA 1SB3C 3WNHA 3PMNA 1N52B 5BR8K 4XH5A 1EQMA 1PVQA 2HOFA 4P74A 3VGVA 3PTWA 1T3OA 3KFWX 1PAUB 2B0GA 5B5EU 4Y28C 4ANDA 2JWKA 3QT5A 3ZTQA 1DT9A 1UQVA 1OXJA 2F4VJ 1XR7A 4AUKA 5BJRA 1TQLA 2C28A 4CJ4A 2R3VA 3WK5A 1RTHB 3B6OA 4B6JA 3A8IA 1KWMA 4R25A 5J8YC 1IR2A 3BM7A 4Q44A 1AXQA