3HPOA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus y714s mutant bound to g:t mismatch
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVSGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
total genus 214
structure length 579
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hpoA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hpoA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hpoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpoA01
3H4DA 4NLZA 2DFHA 3QEIA 3QERA 3OYKA 4W5RA 1BIZA 3V9UA 4DQQA 3FFIA 3CFRA 3DYAA 5E41A 4YQWA 1IKYA 3PW4A 5KT6A 1JN3A 4I27A 3M9MB 3CFOA 1LV5A 4DU4A 1ZBFA 2H5XA 3RJKA 3NGDA 4CGDA 5KG3A 4BE0A 4RPZA 3AVNA 2YNFA 4W5NA 3WNEA 1ZBIA 3PR5B 4FJNA 4DL4A 1C0TA 8ICUA 8ICLA 4IQWA 3AUOA 4GC7A 5DLFA 2DFFA 5L1LA 4F5QA 4E0DA 4ED3A 1RTDA 3V9ZA 4Q43A 5CYMA 3GV7B 1Q8IA 4M2YA 4CIEA 1YVUA 4QZHA 3GILA 1RDBA 2XY6A 4KLIA 4O5EA 3EW9A 1X2IA 1VSJA 2OZMA 3PO5A 4ECUA 4DFMA 5EOZA 5J2KA 3AVIA 4R64A 4E7JA 1G15A 2BPCA 1B9DA 3T5LA 4BWJA 3KHLA 3C2MA 2BCVA 1ASVA 4DLEA 2PFPA 4H4OA 3VQEA 3AV9A 1GOBA 7ICRA 4B9UA 3WNGA 2F96A 3KLHA 3M8SA 1ASWA 1ZQIA 3F73A 2HVIA 3MBYA 1L5UA 4K4IA 2V4RA 5KFAA 1TK0A 4QWBA 3QIPA 1U45A 3DLKA 2DTUA 4YR0A 4CFBA 4J9QA 4FLXA 4I2IA 1RT5A 5J2JA 3TFSA 4Z6CA 3GIKA 1T4GA 2R8HA 5D4BA 3AVBA 4F92B 4Z4EA 1MQ2A 3E2EA 3MEDA 4QW8A 5IIIA 3ZDCA 4J9LA 4CJVA 4EBCA 1UA1A 4FO6A 2RN2A 3U3GA 4HYKA 4EBDA 4KITB 1LWEA 4J2EA 3NE6A 5CA7A 5BOLA 1BI4A 3RBEA 1W9HA 3ZSZA 4FJ8A 4LH4A 3VQQA 3DM2A 3WNHA 5J2CA 1WAFA 2LSNA 3HX0A 3EPGA 1NJWA 1BGXT 1ASUA 1COOA 1S6QA 1VSIA 1SKSA 3V1OA 1NJYA 2BCRA 3PW5A 3TQ1A 3DI6A 2FLNA 4JRQA 4DS4A 3DLRA 5DBCA 5KRSA 4HTUA 4YD2A 3PUFA 3UPQA 3HPHA 1RT7A 3V9XA 4FJ9A 4KB1A 3DMJA 3PW7A 3D45A 1KVBA 5DMRA 4CEDA 2ISPA 3KK3A 3OSPA 1EXNA 3TAFA 5CWRA 3AA4A 1XWLA 1A5VA 5KTQA 4RG8A 1NK5A 3V6JA 3QEXA 1W0HA 3VN5A 2RKIA 1WNSA 2MUTB 1NOMA 3OYJA 3H8JA 2W9CA 3ZSWA 4CEAA 4ED2A 1VSFA 2AGPA 5J2MA 1XO1A 1KSPA 2W42A 4EZ9A 1S0OA 3GQCA 1NJXA 4FJKA 3NGZA 4JS5A 2ZTEA 4FJHA 5HHHA 8ICCA 3RJEA 9ICAA 4O5KA 1EKEA 3O3HA 3D0PA 1KCFA 3ETLA 3JPNA 2JEJA 2C28A 1UAXA 3QE9Y 4W5QA 3AA3A 1WCNA 4CJFA 4BXOA 4UB1A 3GFKB 2OZSA 4ECWA 4NLNA 4FJGA 1XC9A 4OLAA 3MDCA 4IQTA 3ZSYA 3LANA 5J1EA 4QZBA 2FPMA 4RT2A 3Q8LA 3QIOA 2FBVA 2HHXA 3JPTA 1JL1A 4HUEA 1SL2A 2VANA 3SUQA 1TL1A 2JEFA 1DLOA 7ICHA 5DB9A 4FYDA 3CM6A 5J2FA 1BCOA 4FLZA 2F1JA 3RH5A 9ICQA 2FMQA 5KFUA 1D8LA 1QSYA 4O4GA 3RJIA 3L2RA 4G1QA 4I2GA 3UXNA 2IDOA 3KHHA 4Z6DA 3ZCMA 4M3TA 4TUPA 4GXJA 2PYJA 2B6AA 3NH1A 1VRTA 3JSMA 1EP4A 5EU7A 4I2FA 4PGXA 4DFKA 2HHTA 4KTWA 5C25A 3HW8A 4F50A 5KG0A 5IIMA 9ICMA 3JPOA 4YG2A 3K5LA 5CY4A 3HK2A 3VQAA 2G8UA 3CYMA 4KHNA 1VK0A 3EY1A 4DTMA 5KG5A 1D9DA 3LPTA 4YFUA 1S1UA 2R8IA 1JXBA 4N76A 3BQTA 3MXMA 2F1HA 4KLFA 4BDZA 4M6WA 1RT3A 4B9NA 3AO4A 4IQVA 4J9OA 3SNNA 4UAWA 3HL8A 3S3NA 2P66A 1RYRA 5JS1A 3O3FA 3K59A 1T05A 2BHNA 1RBSA 2XY5A 4CJWA 7ICKA 3RB6A 1L3VA 4UBBA 1HYSA 1HMVA 1S76D 4YVZA 4Q44A 1EETA 2ZD1A 3ISCA 2ITGA 1S10A 1T7PA 3DRPA 4PGQA 4ED6A 4K8XA 4OJRA 5DK5A 3ZDBA 3WNFA 2B21A 1XHXA 2EHGA 4PUOA 4PH5A 1ZQBA 2NRTA 4N5SA 3KHRA 3V6DA 4LH5A 3L2WA 1JLFA 4GMJB 1HYVA 1JIHA 2BPFA 1NJZA 3MR2A 4KTZA 2OA8A 4J9SA 3ITHA 1QQCA 4BWMA 2IOCA 2J6TA 4DU1A 4LZDA 3K5MA 5FRMA 3M8QA 3VQDA 3V7KA 5K14A 1EX4A 2D0CA 4YMMA 1MSWD 3S3MA 1ZQXA 3GV8B 3P1GA 4ED0A 3I0SA 3OYFA 4I2DA 2BCUA 4IRCA 3V7LA 3GDXA 5CJ7A 3OJSA 4F5OA 9ICSA 4UB3A 2BGWA 1KLNA 5CB1A 2ASLA 2RPIA 5FRNA 5J0UA 3QEPA 4M3WA 8ICIA 4JRPA 4KLOA 4KHWA 5KFTA 2F1IA 1UA0A 4EYIB 3KLFA 1IH7A 5KFNA 3PVXA 1TKXA 4LSLA 5KGWA 4RQ6A 4XUSA 3JPPA 2ETJA 4DFPA 1JL2A 1XSPA 2VG5A 4JWMA 4NXZA 1FXXA 3QESA 4NLKA 1JLAA 5KFZA 2FPLA 1HQUA 3IAYA 3PO4A 3G6YA 5L9XA 1WSFA 3OYIA 4PHEA 4IRKA 1X1PA 2YKNA 4MF2A 3SJJA 5JUMA 2HNDA 3M9NB 2BQUA 2ZUDA 3ZDAA 4HCCA 4KRFA 1DOQA 1BISA 3VQ8A 2AJQA 1S9FA 4RPXA 1RDCA 4RW4A 3IM1A 2VA3A 8ICXA 4QAGA 1CZBA 5KG4A 4M9GA 1CUKA 1I3AA 3KK1A 3V72A 1RCHA 1K1QA 3C5GA 2R8JA 1VSKA 4QZDA 3GIMA 5FDLA 4E19A 4KN7A 1S0VA 4CHOA 3ZDDA 4BDYA 1LWFA 5C24A 5KFVA 4JV1A 2AQ4A 4IRDA 4R5PA 5I42A 4CIGA 2R8GA 1UOCA 4CK2A 4P4MA 4M41A 3NFAA 4FW1A 2JLEA 3K5NA 3RMAA 4CJ3A 3GIIA 3U6FA 3C2LA 3NCIA 2FMPA 3M8PA 1TK5A 4RQ1A 5HP1A 5I3UA 3IHQB 4LVSA 5HLFA 3RMBA 3K57A 1SKRA 2HNYA 3LPUA 4F5PA 3TABA 3PV8A 2Z1IA 3NBPA 3B0XA 3MEEA 4ECTA 3VQBA 5CP2A 3OS1A 3PX4A 2OPRA 3SQ0A 2IBKA 8ICQA 4IBNA 9ICNA 5J0OA 5CZ1A 3VQ9A 4E7LA 5D3GA 2C2DA 4DQIA 4NCAA 5DGBA 4DSLA 4HCBA 3C1ZA 2XRIA 2I1QA 2ASJA 4JLHA 4KV8A 4YNQA 3OVNA 4TURA 1SV5A 5EWGA 4O55A 2HVHA 1ZJNA 4QZIA 3Q8KA 4DU3A 3M9OB 3V6KA 3RMCA 3ZSXA 2W9AA 5T7BA 4CCHA 3LZJA 1JXLA 3JYTA 1ZQEA 9ICCA 3QZ8A 4NYFA 1Q9YA 1D9FA 4MEYA 3BGRA 2OPPA 5IIKA 2DY4A 4XRHA 3PW2A 5DBAA 3KLIA 4W5TA 2NRWA 3TWHA 4M3RA 1NK6A 4I7FA 1B43A 4DG1A 5HMMA 3KKRA 3QINA 5J2QA 3T19A 3ZT3A 3AO5A 2NRVA 2JZBB 7ICQA 1RBRA 3ZSRA 4CEQA 4QZ9A 4CEEA 3OYHA 1EXQA 5J0RA 9ICRA 1WAJA 4EYHB 4C8KA 4FM1A 8ICMA 3Q8PB 2VWJA 4Z6FA 1ZQWA 1XS9D 2W8KA 3OYEA 4J9RA 4R66A 5J0SA 2PXIA 2G8KA 1VSLA 2Y1IA 3HJFA 3V4IA 2AU0A 2XHBA 2NRZA 4ED8A 3SI8A 2IC3A 5KG7A 5KFMA 2XY7A 2ALZA 1ZYQA 7ICTA 4DTJA 1BPBA 3RJJA 3JPSA 3ZD9A 4CFDA 2YKMA 4DL3A 4O3PA 4L8RB 3TFRA 2A1SA 4Q5VA 4KLLA 4CERA 2F8SA 3PX0A 2XCPA 3L2UA 1VSDA 3G6VA 5L1JA 4CJKA 2P51A 5KFCA 4NM2A 3QEAZ 4AHTA 1A77A 4FZXC 1FK9A 4O0JA 3TI0A 1NKCA 3NGIA 3HWTA 3CFPA 4O3QA 4DTRA 3OHBA 2PFNA 3DLGA 4EZ6A 3UQ0A 3UXOA 3N4MB 5CYQA 3UIQA 3LALA 2X6SA 3C2KA 5J0WA 3RR7A 1ZQUA 2V9WA 3RJGA 3DRSA 1RT2A 4JS4A 3Q8MA 1XU4A 3SUPA 5IIOA 2QKBA 3VQPA 3OS0A 4J9PA 3IS9A 3AVHA 5IILA 1Z3EB 3HSTB 3OYAA 4K8ZA 3MDAA 4AILC 4DSFA 3OJUA 5IINA 1TGOA 4FLVA 3RWUA 2DFLA 9ICFA 4OKJA 3AO2A 4CK1A 4F3TA 4DOBA 1WSIA 3UXPA 1BPDA 4ELTA 2G8FA 4QZCA 3NF6A 4R63A 3GIJA 4RUCA 4O0IA 3JPQA 3L2QA 1IO2A 3NH2A 1NKBA 3K75D 2XO7A 2FBYA 4MFBA 2WOMA 4I2CA 1KDHA 2QXFA 5J2HA 1N6QA 1C0UA 3PW0A 4C8NA 4MFAA 1JLEA 2FLPA 4ZTJA 4E7KA 2BDPA 2KFZA 3I8DA 4RNNA 4JWNA 3SCXA 2W9CB 1JLBA 4QZEA 4Z4HA 3NH0A 1YTAA 2FBTA 2KFNA 5KFOA 4KPYA 1NOZA 5KFHA 7ICLA 4M42A 2HHQA 5HMLA 4OKEA 4QOZB 1S1WA 2B4JA 2W9BB 4ZHRA 1S6PA 3KK2A 2IA6A 1J54A 4M9JA 5DLGA 1HPZA 1RTJA 3O3GA 8ICJA 2D5RA 3SI6A 3AVMA 5L1KA 2ATLA 1KEJA 4O5CA 3B6PA 2JGUA 4Z4CA 3RH6A 4UAYA 4QZ8A 1WSEA 4I2BA 4M45A 3TAPA 1JLGA 4M04A 4DF8A 2IHMA 5DQIA 1BHLA 4CGJA 4ICLA 4PHDA 3SQ2A 4IR1A 5J2GA 3AVGA 4PHAA 2G8IA 4R8UB 3SYZA 3ZT0A 5HBMA 3LDAA 1BVSA 3ISNC 4YXMA 8ICWA 3O4QA 1RILA 4CHYA 3LDSA 5KT4A 3FDSA 3PY8A 9ICPA 4N56A 3OYCA 3OYDA 2A1JB 4KN4A 3DLBA 4KLGA 2M9NA 1UWBA 3RTVA 4XIUA 4J2AA 2ZTDA 4KLTA 3K5OA 4TSXA 1TV9A 2KN7A 3C21A 1S1XA 1ZJMA 4IFVA 4TQSA 4I2JA 1ZQSA 3QETA 3RRHA 4PHPA 5KFFA 2PYLA 3C23A 3ZD8A 2ZJAA 4LY7A 1SL1A 2DFEA 4B9MA 1ZQPA 4DL2A 4RPYA 2PY5A 4F2SA 4KKOA 4KHUA 1C1AA 1WSJA 3T3FA 1VSHA 4GXKA 4ECQA 1RT1A 2BANA 4FJ5A 4K4GA 5J2PA 3RRGA 5KFSA 8ICZA 1ZQLA 1BIUA 4YMOA 3BDPA 4F2RA 4Q8FA 1KVCA 3C1YA 4I2HA 1N48A 3ISDA 9ICOA 2ZE2A 3AU2A 5TZVA 4FW2A 1NK8A 4I9QA 1BPEA 3MGHA 1QSLA 3ASMA 4M47A 3L3UA 1TL3A 1RPLA 5KFPA 4YFKA 3SUOA 2P5GA 5DKWA 3LWLA 5HRRA 4RU9A 1DTTA 4CJQA 4RQ2A 3VA0A 4B8CA 5J2AA 3H7IA 1RT4A 4DWIA 4CF1A 2KQ2A 3QNOA 3T5HA 5DG8A 2KZZA 4Z4IA 1HNIA 4FBUA 3ZDEA 2AQ0A 3SQ1A 4MFFA 2YHBA 3EZ5A 4F93B 4N47A 1ZQJA 4KMUA 5CZ2A 3AVAA 3V1RA 1Y88A 1Y97A 1Z00B 4OGCA 1U49A 4IQUA 2Z1JA 2W9MA 2FLLA 4EP4A 4F4KA 4KI6A 2X78A 2C22A 3TAGA 4FVMA 1MU2A 5J0PA 4CEBA 4B9LA 1XSLA 4M6WB 4F4YA 3QLHA 2C2EA 3HT3A 3HXMA 8ICOA 5DG9A 2WONA 4CF9A 1LAVA 2NRXA 1RYSA 4NCBA 1U04A 3AVKA 1XSNA 4B3OA 4F3OA 1WCLA 2P1JA 2BQRA 4CFCA 5HRSA 5KG6A 3BQ0A 9ICIA 4BACA 4YN4A 4HVJA 2ATQA 4Z4GA 2ZUBA 2ZTCA 4O3RA 4Q8EA 4FBTA 5F9NA 1A5WA 2BGGA 2RDJA 1ZQZA 4OVLA 5J2BA 3K4GA 5HRNA 3KD5E 1ZQAA 1Z00A 1C1CA 4J2DA 1S1TA 3DLHA 8ICGA 4GVMA 4DQPA 1U47A 3SZ2A 1U48A 4DTUA 2IGIA 2VA2A 1Q9XA 4E7HA 2RDIA 5FROA 2PZSA 3DRRA 3Q8SB 2ZQBA 3G0ZA 4PWDA 1VRUA 4F8RA 2G8VA 4ECSA 4I9LA 4GXIA 5DQGA 2OPSA 4I2PA 2YNHA 4CF8A 2OPQA 4KO0A 2P6RA 1REVA 8ICPA 1FKPA 2HMIA 4F5RA 5IIJA 4I2QA 3PMNA 4LD0A 3H40A 1F21A 4FK0A 4YXJA 4FLWA 2GWSA 2KW4A 4I2AA 2VWKA 3RMDA 4QWCA 5CR0A 4F91B 4CEOA 4CHPA 3KIOA 2E6LA 1TVRA 4DF4A 4MF8A 4MEXA 1WSHA 3UQ2A 2PFQA 1LWCA 1JXEA 2E6MA 1HYZA 1KFDA 3MFIA 3BQ2A 4CESA 5J0YA 4BE1A 2FPKA 4FJMA 1NKEA 1HQEA 3HPGA 2P5OA 4MFCA 3RB4A 2Y1JA 3ZSVA 4C8OA 4FJ7A 2DPIA 5DB8A 4J2BA 1RNHA 5DDMA 1ZQDA 3L8BA 1SUQA 3OYLA 1D5AA 5DGAA 4NM1A 4O5BA 4M9HA 1ZQNA 3DOLA 1RT6A 3ZSOA 4NCGA 4CEFA 4CEZA 4R65A 2FBXA 3KLGA 4P2HA 4FZYA 8ICKA 1LB2B 2I9GA 2RF2A 9ICBA 4RW6A 2X74A 4M9LA 1JLQA 5KG1A 3PMLA 3G10A 1T03A 9ICLA 3LWMA 1S0MA 4OPJA 5C5JA 3S3OA 3VQ7A 2PFOA 4FJXA 3I0RA 1BL3A 1AROP 4QWAA 4KLMA 2BCSA 4DL5A 4J9NA 4ZTFA 2BE2A 5DG7A 4NLGA 1S9EA 1WN7A 8ICNA 3ZT4A 1XHZA 3SUNA 4ED1A 4LSNA 4BE2A 3ALYA 2MAXA 4GC6A 3C5FA 1SZPA 4CFAA 5KFDA 1TKDA 4DSJA 4LZGA 1KRPA 4H8KA 4KLHA 2GBZA 8ICFA 3M8RA 1X9MA 3ULDA 1X9WA 2ASDA 3QZ7A 1K6YA 4DTPA 4UBCA 4E3SA 4KHYA 1B9FA 1ZQMA 3QEBZ 1ZQVA 1HJRA 4CHZA 2PI5A 3CQ8A 4J9MA 2G8HA 1HJPA 3HP6A 4FJLA 1ZQKA 4HUFA 7ICUA 7ICPA 1NK9A 4DL7A 3O4NA 5KFYA 4F4WA 1S97A 4FZZA 4KFBA 1L3UA 8ICVA 4CJ5A 4JV0A 2HHSA 4DL6A 4DMNA 4R8UA 4E1NA 1KLMA 3DOKA 4JUZA 4IFYA 3MAQA 4OLBA 2NUBA 4QZGA 3P83D 1NOYA 2BCQA 4IR9A 1ZBLA 2ZJ5A 3K2PA 4CGGA 3B0YA 4AH9A 3H8SA 2VA8A 4UB4A 3RJFA 3OHAA 1TK8A 3V9WA 2Q3SA 1IKWA 2G8WA 5KFRA 1VSMA 4CF0A 4CHNA 2BPGA 2A1RA 4KHSA 2VG7A 5F9LA 2OYQA 1ZQOA 4DOAA 5BOMA 4PA1A 1JKHA 3LAMA 1ZQFA 3EYZA 1GOAA 4B9SA 2JEIA 1CZ9A 1HUZA 3IRXA 7ICIA 3A2FA 1QHTA 3RH4A 4RQ0A 3OS2A 4RT3A 1GOCA 4M3ZA 8ICRA 3NGYA 4Z0UA 2EX3A 4EP5A 4YP3A 2MUTA 1C6VA 1C7YA 3RBDA 1KVAA 1QTMA 1RTIA 3HP9A 5J0TA 4YR2A 3S9HA 3MECA 1J9AA 3VA3A 4KLEA 2YNIA 4CJEA 4CJTA 2DPJA 5KFJA 3AU6A 3TANA 1FKOA 4UB2A 2XCAA 4J9KA 9ICEA 1J5OA 9ICGA 4ID1A 1CXQA 3OYNA 1A76A 5HNKA 2F8TA 3TAQA 3QNNA 5L1IA 2IHNA 2UVUA 1NK4A 4CGIA 4I28A 2P6UA 3OGUA 3T5KA 3LP0A 3ORYA 3V7JA 3MR6A 2BQ3A 4O9MA 8ICEA 1RBVA 4F4ZA 2ZUCA 4YCXA 5D49A 3ZT1A 4CJUA 3HPOA 2IS3A 1KFTA 1RDAA 3ZSQA 4KAZA 3THVA 2J6SA 3LP1A 4FM0A 1U9LA 3MXJA 4CJSA 4FK4A 1ZBUA 1IM4A 3MABA 1IKVA 2B5JA 4CGHA 1TAQA 1CEZA 4M9NA 4Q45A 4CJ4A 8ICSA 3MGIA 2D0AA 1ITGA 1BI4B 4AHUA 4XA5A 3C95A 4O3SA 3C94A 9ICTA 4GLXA 1BPZA 1KFSA 2ISOA 1MQ3A 4CE9A 4K4HA 8ICBA 5KRTA 3L2VA 3VQ4A 4KI4A 1S1VA 3OYGA 3KLEA 2KTQA 1S9GA 4FXDA 4DFJA 3NF9A 4WE1A 5JS2A 4FM2A 4P4PA 1L3SA 5J29A 1LW0A 1WSGA 5KG2A 7ICJA 5J2IA 3ISBA 4G3IA 4IKFA 4UB5A 1ZQCA 9ICXA 4JV2A 1IXRA 4DLGA 1QSSA 4DO9A 2IAJA 4ZH4A 4N41A 3H08A 7ICEA 1S5JA 1Z25A 4M3UA 4RQ5A 4DSEA 4KTQA 4ECVA 3N97B 4RQ3A 3TAEA 5KT5A 5KFIA 1YTUA 8ICAA 2FC0A 1JLCA 4IG0A 3PX6A 4FCYA 2FMSA 1RZTA 3MR3A 5J0XA 8ICYA 1TVAA 1R0AA 2OWOA 4RZRA 1TAUA 4O44A 1BQMA 5DB7A 4F5NA 1WLJA 1D8YA 3VQCA 3LP3A 3OYMA 3VQ6A 1XI1A 3IG1A 7ICGA 3GV5B 4RNOA 9ICUA 4ECXA 5EWFA 2QK9A 3SPZA 1BQNA 1Z26A 5SZTA 1O1WA 2HHVA 4BXOB 3L3VA 2V4QA 1H38A 4AHRA 1ZBHA 3V1QA 4IDKA 1HNVA 2X6NA 3SV3A 3Q8RB 1RBTA 4QW9A 3PR4A 5KT7A 1A5XA 2HB5A 2Z1GA 5SWMA 4C8LA 1LW2A 1TKTA 1C0MA 2HNZA 2GUIA 3RAQA 3MR5A 4KLUA 3AA2A 3LZIA 3LP2A 4KLQA 4PQUA 2YV0X 3MEGA 4QWDA 5KFBA 3U3YA 3AO1A 4Z6EA 1PZNA 3TARA 4HHTA 1DTQA 4UQGA 3HVTA 3AVCA 4B9TA 4CF2A 3NAEA 4BGDA 4FLUA 4OPKA 3C6TA 4YMNA 4FLYA 2BR0A 2Q0ZX 4H4MA 4RQ4A 3SQ4A 5J2NA 1N5YA 4F4XA 2XY8A 4YR3A 4RW7A 1TV6A 4QCLA 5KI6A 4AHSA 4DOCA 3HO1A 4FK2A 4CGFA 4RQ7A 3KKSA 3CG7A 2ZJ8A 4YD1A 2A1JA 4Y1DA 4E89A 3TR8A 2JEGA 4NYNA 3ZT2A 4EEYA 3QEWA 2LYHA 1IKXA 3KTQA 4ID5A 1QE1A 7ICMA 4X5VA 5DDYA 4W5OA 4IG3A 3NHGA 3EPIA 1JX4A 3HVRA 8ICTA 2HHWA 1T3NA 4ECZA 1ZQQA 1ZQHA 2AGQA 4XQ8A 3DLEA 2J6UA 2JZBA 4OGEA 3OSNA 1BPYA 3SV4A 9ICWA 4KLDA 4FLTA 5KFXA 4GW6A 3RB0A 2KZMA 3BJYA 3AVLA 5DQHA 3H8WA 3Q8QB 1X9SA 1TFRA 1LAWA 4MQ3A 4RQ8A 4FJJA 7ICFA 5BPCA 1B92A 2GV9A 1ZQRA 3VQ5A 4CJRA 1I39A 1JMSA 4FJIA 4CIFA 2Z1HA 2UVRA 3OYBA 4ECYA 4I2EA 5KT3A 5KFQA 5J0QA 2W8LA 3RR8A 4M3XA 4JK1A 1IG9A 4AHCA 2C2RA 4E7IA 3K58A 4DEZA 3E01A 2W9BA 2HHUA 4DTOA 2BKEA 2R8KA 4B8AB 4ELVA 2QKKA 4RNMA 4FS2A 2XGPA 4KLJA 4DQRA 1BPXA 5EWEA 1HRHA 5J2DA 2D0BA 2I5JA 4DS5A 9ICKA 1S77D 4PY5A 3H4BA 1QLNA 4Y1CA 2R7YA 4FS1A 5D46A 5KFGA 4DSKA 4DSIA 3RJHA 1C1BA 4M0AA 4DTSA 1N56A 7ICSA 4P4OA 1CXUA 3V9SA 3KJVA 4UAZA 4DTNA 3AVJA 4B08A 1CLQA 5KT2A 2YHAA 1ZQGA 3T1AA 2VG6A 5HRPA 3SPYA 1UT5A 1NK7A 1RXVA 2PI4A 4BDPA 5HROA 1ZETA 3FYHA 5HHIA 1B22A 1RTHA 3AVFA 5KFEA 3JPRA 3QEVA 1RXWA 2WTFA 5CHGA 4B9VA 4KREA 1V9PA 3NF8A 5J2EA 3KHGA 1RBUA 1ZQTA 5KFLA 3OY9A 4I29A 4M3YA 4ECRA 4E1MA 7ICNA 2XGQA 4TQRA 1T8EA 1MC8A 4RW8A 1SKWA 3PNCA 1RDDA 1TKZA 4O3NA 1SL0A 3LK9A 4OKKA 3QO9A 3RB3A 3B6OA 2AGOA 3P5JA 5DBBA 4NY8A 5C42A 4QZAA 1ZQYA 4CK3A 2UVWA 2UVVA 2IMWP 4AHVA 9ICJA 5DB6A 1BCMA 1QS4A 4TUQA 4KHQA 3TAMA 1UT8A 1HUOA 4ELUA 3MXIA 2HW3A 4CHQA 3NTUA 4ED7A 3LAKA 3AA5X 3NF7A 2YNGA 4KB0A 3T5JA 2XC9A 3KD1E 2E4LA 9ICVA 5KGXA 1KTQA 3MFHA 4DQSA 4KLSA 4QWEA 4C8MA 3C6UA 4RW9A 3EWAA 2O4GA 4CJLA 3RAXA 3HYFA 1YT3A 4TUSA 4CJPA 4O3OA 4CECA 5KFKA 3G6XA 3HM9A 2KZ3A 3F9KA 4Q0BA 1J53A 1U4BA 4PGYA 1VSEA 1L3TA 4Z4FA 4PPXA 3AO3A 4DTXA 7ICVA 8ICHA 5HP4A 1NK0A 5KFWA 7ICOA 9ICHA 4QZFA 1S0NA 3CM5A 3NDKA 2O4IA 1K1SA 4HUGA 4RUAA 4EBEA 3BQ1A 3V81A 3V6HA 1DGSA
chains in the Genus database with same CATH superfamily
1HLUA 1ZTTA 2LQJA 2ROGA 2ZG6A 2V7YA 1IBMK 4B3SJ 3FFIA 3BR8A 2WTUA 3CFRA 2UV8G 3ZX0A 3HSDA 1IKYA 1CG2A 1PVRA 5KT6A 4AYBC 1JN3A 3M9MB 2V8VA 4ETZA 1Z05A 2ZVIA 3H8YA 3TW0A 2H5XA 3RJKA 3HULA 5KG3A 3U1NA 2PGCA 1U1QA 4RPZA 2GIRA 1YVNA 4W5NA 2DXDA 4DL4A 1NU0A 1C0TA 4USAA 2F4VJ 2IJFA 3O8WA 4A57A 2F8MA 4GC7A 4A2AA 1VC5A 2IOFK 2FJVA 1OVQA 4F5QA 1N5WA 3C16A 1RB0A 4E0DA 1NLVA 1RUSA 3L7UA 3C14B 2V52B 1ACMB 4Q43A 2FZKB 5JRTA 1N36F 2WVFA 1B9DA 3T5LA 2D74B 2D8CA 4CT9A 2JFKA 2E8OA 1T6CA 5E7OB 4ZKAA 2FDNA 4H4OA 3TWZA 2PBDA 2DNNA 3O44A 4KX5A 3PJWA 3PSPA 4MDAA 1RAEB 4UUXA 4LREA 1ZQIA 3F73A 4PCQA 5A2QO 2VB6A 1X66A 1TK0A 1SH3A 3VTIA 1L8LA 3WK9A 5B66U 4J9QA 4I2IA 4YEAA 4EU0A 3CVKA 4BC2A 3CP8A 3SXLA 2W01A 2MY8A 5BPMA 4ZLPA 1WI6A 5AKJA 2YKNB 3D67A 3D2WA 5IIIA 2VPYB 2IAJB 5H2FU 5AKZA 4IS7A 4J9LA 4JV5K 4KRWA 1UA1A 1QQNA 3JTNA 1W97L 3NE6A 5CA7A 3RBEA 1W9HA 1ROFA 2R2RA 2JHEA 4CDGA 3VQQA 3BPDA 1RABB 3HX0A 1NJWA 3MEEB 4UARA 1GQEA 2YMMA 1TTHB 1ASUA 5G5GA 1COOA 3GJRB 3EUB2 1JKHB 3V1OA 1NJYA 3DOLB 2BKOA 2NXEA 1ZPVA 1PIEA 2WAQD 4ZVHA 5ETOA 3VEXA 3WIVA 4OYOA 4EGLA 3DLRA 2A6MA 5CA5A 3ILIA 1NZBA 4C3LA 3IA0A 1SVDA 3L3CA 4MK8A 3NGUA 3HPHA 1FEHA 2OCEA 4KB1A 3PW7A 2GO9A 4IL6U 3TX8A 3D45A 5DMRA 4CEDA 1HHSA 2J76E 2FVPA 4J91A 3OSPA 1EXNA 2VZ9A 3TAFA 7FDRA 2JHDA 5CWRA 3AA4A 1MWMA 2V51B 1GEHA 4PG7A 5DZ7A 1BMQB 1ZD4A 1LEOA 4DR5F 1W0HA 3VN5A 4U9RA 2RKIA 3H3OB 2MUTB 2VDHA 1NOMA 4ED2A 1WUUA 1VSFA 2F9JA 1XO1A 2J8AA 1KSPA 4WZMA 1C4CA 2JRZA 4EZ9A 1S0OA 4CZCA 1JALA 1F5AA 4Y2XA 3CMEN 3RJEA 2YHYA 2A2DA 3CNHA 4JI8F 2C28A 3QE9Y 4IO9L 5JU5A 2RILA 5H9FJ 2QSFA 1M5SA 2YY3A 1W2BR 3Q22A 4ECWA 1KQSM 4A8KA 2FYXA 4OLAA 3KZIU 3ENAA 3ISND 2AYMA 1RCXB 4C1NI 1FCAA 3MDCA 3H2UB 4H0OA 2LU2A 5C42B 3IDWA 5ALGA 4DX6A 5J1EA 4TY8A 4QZBA 4RT2A 3QIOA 3DXMA 1JL1A 4HUEA 1Q5YA 2VANA 2PEHA 4OJLA 4NL9C 2UXBJ 3BO4A 5AZIB 4WPAA 3GYNA 7ICHA 2V4JB 3WKBA 3CDAA 2BE7D 2RHQB 2D9OA 4FLZA 2QEXN 3RH5A 3MCSA 5KFUA 4ZVPB 4NPOA 3H45C 3K0JA 3VVUA 4GXJA 2E2OA 5DM6L 4USUA 5G0RA 3WX8A 3IM8A 5E26A 4I2FA 2HHTA 2LM4A 4JB3A 2ADBA 2OUGA 1XNRF 2O8FB 2N82B 3VQAA 2DGQA 3JXUA 2G8UA 1C1CB 4DTMA 5KG5A 1D9DA 4YFUA 2XVTA 1S1UA 1JXBA 2KSOB 3UDLA 3MXMA 1S5LU 4QYZJ 2F1HA 1UJ4A 4KLFA 4BDZA 1RT3A 4B9NA 1YJ9S 4QR0A 3UDVA 1F0MA 3QLHB 2W2OP 2LEPA 4J9OA 3SNNA 4UAWA 3HL8A 3FUYA 3OW2R 2P66A 1RI7A 2F8HA 2R7TA 4OJPA 4JI3J 1CQNA 3RSEA 3LM9A 4LBPA 2XY5A 7ICKA 1REVB 2PSZA 1URNA 4UBBA 1YWXA 2HNDB 3HTVA 3P39A 4Y2PA 3IWNC 1S76D 2F77X 1U2FA 4NXNK 3OFGA 1EETA 2A19A 2ZD1A 2DGOA 4DV2J 2R7XA 3DRPA 4OI1A 2IOFA 4K8XA 2R18A 1WI8A 2B21A 1IWGA 3Q2TC 2F44A 4FWOA 4PUOA 3FMWA 4IOCL 1I6JA 2KICA 4KT0C 1ZQBA 2NRTA 3G87A 3KHRA 4DPUA 1UL3A 4DU7A 1HYVA 3PIOL 2Z4PA 1TL4A 4C3KA 2D3ZA 1Q78A 2OA8A 4ZP6A 3TVYA 3HZ6A 3ITHA 3IRWP 1QQCA 2GMLA 1DT9A 1RTJB 3QGGA 1XK8A 5AXKA 1RADB 2B0CA 4ILLA 4FWNA 4ZLNA 2A42A 3OR2B 2O8CA 3CERA 1RU2A 3CCQN 3V7KA 5K14A 3KUEA 3AGRA 2LM1A 3S3MA 3O80A 3I0SA 4OD0A 1KR4A 3GDXA 3OJSA 4F5OA 2FTRA 9ICSA 3N01A 5CB1A 3C65A 1F0XA 2HG4A 8ICIA 4KHWA 1J2NA 2EZYA 2NZ4A 5ALZA 3KLFA 4CLTA 1VQLN 2A3VA 5KGWA 3W0LA 2ETJA 4JI2F 2JC1A 1ZAXA 4DFPA 1JL2A 3SEIA 3D2EA 1NHKL 2VG5A 4O23A 3M2VB 4OQJA 5KFZA 5BRDA 3NNCA 3IAYA 2VOOA 3QBWA 3HSCA 3O08A 2GJIA 1J2MA 4PHEA 4IRKA 4JI4F 4MF2A 3TEGA 4A2BA 3KFUF 1N88A 4O3MA 2DCLA 4C23A 4HCCA 3WIUA 5ALUA 5GAHI 2GFFA 3KFWX 3QNMA 4JK9A 4TU8A 4RPXA 1RDCA 2BUPA 3IM1A 4LBHA 2QLJB 4CNQA 4LF5J 2OPRB 1UZDA 5KG4A 1VYAA 4GVLA 3GR0A 3KK1A 3V72A 2AD9A 4YB1P 1VSKA 5FDLA 2ACMA 3Q83A 4LSLB 1X4GA 1RSCA 2ZHOA 1KQGB 2G09A 1LWFA 4DV6F 4RWTA 4JV1A 2AQ4A 5I42A 1VK8A 5A2QU 1S1TB 4DCCA 2ADCA 4PG8A 1OW5A 2Q6CA 4FW1A 1C0TB 2UUBK 3HMJG 3MECB 1NH8A 3C2LA 1TK5A 4LVSA 2YX6A 5HSPA 2I7PA 1IKYB 3MF5A 4PYDA 3Q8VA 1SKRA 3JSYA 3NGTA 3LPUA 1MN7A 1RTDB 2MSNA 1Y0HA 3TABA 1XNQK 2AXTU 4KGXB 2WAQF 3GR1A 3PV8A 2Z1IA 4DZDA 2YMPA 3QFWA 3ZI4A 1NCLA 3OS1A 5HR6A 4RKUC 2LEBA 3EO3A 2VFVA 4H0VB 3MHYA 2HPUA 5CZ1A 3VQ9A 5D3GA 4CM2A 5E0OA 2QLWA 1D1UA 3BV8A 3FBBA 3E51A 1RHKB 2XRIA 3O2IA 2J9DA 1NPPA 3OVNA 2QTWA 4TURA 3PKMA 2FHJD 1X4FA 3KD3A 2OSQA 4TKTA 4LF4F 4QZIA 3H5YA 4L3NA 4BROA 4FYXB 2HFZA 2B7BB 1JXLA 2GO7A 3UN5A 3JYTA 4RX6A 1X4EA 4MMOA 2OH2A 3T9NA 1HARA 5IIKA 3P31A 4OJ5A 1NNLA 4ZPBA 2VF3A 5DBAA 5AFUH 4KE5A 4OX9J 5JMNA 3QSIA 4M3RA 1NK6A 4I7FA 1B43A 3CMES 2CPHA 2DIVA 4DG1A 2LQ9A 3T19A 5LT5A 4FF4A 3KKAA 3TUZC 4WE1B 4UOCA 4CEEA 5LJWA 1EXQA 5J0RA 5A0YB 3TJ8A 3W62A 3SCKE 2DGWA 4AL5A 4IOXA 3GMGA 1X5OA 1B99A 3D3CJ 2AU0A 2XHBA 2ZM6K 2NRZA 5KFMA 2G13A 2ALZA 3M8ZA 1R89A 5AKXA 3F2BA 2WF5A 1Q3UA 4Y0FA 2I6WA 3WUHA 3PX0A 1JI7A 4ACOA 1FJGK 1VSDA 4PKHA 2B4OA 5F3ZA 2P51A 4B02A 2C3UA 1XMBA 4NM2A 1VI7A 1Y00A 1NMNA 1E4FT 3D68A 4JP8A 2BRLA 4M8LA 5A8KB 2CPFA 4C1NK 4FZXC 4CZEA 2FGOA 2XQCA 3HWTA 4O3QA 1QQ7A 2MLZA 2RP5A 3ZZTA 3OHBA 1QE1B 3DLGA 4EZ6A 2AF6A 5CYQA 1SJ4P 4X4QA 2D4WA 3VAGA 1DGJA 1HYSB 1OH7A 3RJGA 5CR4A 3DRSA 2ZJQQ 2UU9F 1XU4A 4ZPVR 3FC9A 1OH8A 1HPMA 2Z58B 3QBXA 2QKBA 2WF6A 4B3MF 4J9PA 4C9DA 3M7DA 4ZVEA 2ATCB 3D28A 1GLCG 2ZHAA 3CCZA 3CQYA 3OYAA 2QRRA 4DSFA 3OJUA 4X64K 1NDCA 4WP8A 4I67A 4FLVA 1NGAA 9ICFA 4P7VA 4DR7F 1WSIA 1JJHA 1S6PB 5B5EU 1BPDA 1WKLA 3L9ZA 2G8FA 2QLTA 1FK9B 4TVAB 4MKAA 3H0PA 4R63A 5TKWA 1VQ6N 2A1BA 4A5AA 3TADC 3OFEA 3QU5A 2EWSA 4MFBA 3NBPB 2DNMA 2P6SA 4I2CA 3UCZP 3FCVA 2A3JA 3UWTA 2HSEB 1C0UA 3PW0A 3QU2A 4C8NA 3HKZF 2DTJA 4MFAA 4MIAA 1I3OB 1SZ2A 2EBEA 3SCXA 2HSTA 1JLBA 1BWVA 3RSEB 3R7BB 2NRRA 1AW0A 1UW4A 3NH0A 2ZXHA 1RBLA 1Z1ZA 5KFOA 3I28A 3BBFA 2H54B 4M42A 3UNGC 2H3GX 1IR1A 2B4JA 4UY85 3N9UC 4Y2RA 3KK2A 2HNYB 1HPZA 4M9JA 5BYSA 3O3GA 8ICJA 3SI6A 3AVMA 4ZS6A 5L1KA 2WBMA 3VGMA 5GIOA 3FRYA 2Q3PA 3C6AA 2X1BA 4WCEQ 4GKKK 3W7BA 1FX4A 1TUVA 2OP5A 4N7TA 4WFZA 4M45A 1M0SA 1AT1B 4DF8A 4P71A 1U26A 2KKVA 1BHLA 4CZJA 5AQGA 3L7PA 3GU3A 4RJVA 3MCMA 3AVGA 4PHAA 1XTZA 2CQPA 3GOIA 5HBMA 2CPJA 1BVSA 1JLGB 3AJ1A 4ILGB 1YJ7A 1YLXA 2V4JA 8ICWA 2Q0RA 3MDQA 3OFHA 3Q23A 3FDSA 2DWQA 4XDDA 3W64A 2A1JB 4KN4A 4KLGA 1Y3JA 1K0VA 3OLAA 5HANA 4DKWA 1D8BA 4WQ4C 1PAEX 1S1XA 2B0GA 2UUAK 4TQSA 4DR2F 2EAMA 1VS3A 5DDQC 2ZJAA 2QZ8A 2XZDB 2R7UA 2PD1A 3QO9B 1DEJA 2JH1A 2PY5A 4MHVA 2LBOA 3H5XA 5LMNJ 2RB7A 1SXLA 1VSHA 3KUHA 3V4IB 2MSSA 4LVOP 2MSTA 5IWAJ 3I0SB 3CJAA 2E2PA 3RRGA 3DGVA 8ICZA 2JVRA 1BIUA 4YMOA 1NGEA 3VGLA 5GAHP 3D6FB 2ZH3A 1FNMA 4I2HA 4LR7A 5ETRA 1N48A 4DV4K 3CCTA 2MPUA 4I9QA 4YOXA 1V4TA 5HI7A 1O0PA 3BF1A 3E01B 4Y2KA 4BUGA 2YWEA 1OY6A 4OYMA 3MM5A 4RU9A 5HRRA 4CJQA 1SAZA 4RQ2A 1TL7A 3FC4A 3BBBA 4DPYA 2XB2D 3HZGA 2CQCA 3W3DA 1U1NA 2KQ2A 1H73A 3N79A 4OMFG 5ALVA 1ZM9A 5DG8A 2D1CA 4Z4IA 1U8WA 3W65A 2YXLA 4FBUA 3HOTA 3BS7A 5B08A 2DD8S 2M3DA 5KPTA 3V1RA 4GO7X 2GIFA 1Y88A 2NZTA 4CH0S 1I5OB 3MX5A 2X78A 2IYGA 2RQ5A 1JROA 4FVMA 1N5TA 3JQJA 4P7TA 4B9LA 1XSLA 1Q1KA 3PZPA 2QYGA 3NGSA 5F8MA 6FDRA 3R3TA 4JI2J 1RDUA 4H54A 1O5JA 1FEZA 4WIQA 3J8AA 5DG9A 1KP6A 2WONA 2FVRA 2VU5A 4KX3A 1OH6A 2E5LK 1QDUB 3HI9A 4I0WA 1XSNA 4PRFA 1XERA 1RWNB 3C0BA 1V9OA 3CUNA 5JICA 1T9YA 4CFCA 1DJ0A 1KQSR 4Q8EA 2MKJA 3CC4N 2HHHF 1A5WA 2MHEA 1PILA 4DV1K 5AK6A 5HRNA 2YX1A 3ET6A 2K4PA 5ALJA 1U48A 3D66A 2UUCF 4JV5J 3A5NC 1Q9XA 3CC2S 3RBZA 3MM9A 4I7FB 4K0KF 1E6YB 2F1FA 3F5TA 5GAGI 2ZIUA 3IR7B 1ZPWX 3G0ZA 3HDSA 1FXRA 4F8RA 3CCVN 4AD6A 4HTLA 1UVIA 5DQGA 1F2HA 2OPSA 4E8UA 1YZ7A 2WC9A 4CF8A 1RLCL 1VLYA 1V6HA 1QY7A 4KPCA 1ULRA 4WXOA 3D1QA 4A4JA 3EE8A 3QU9A 4GVEA 2JNJA 2RUSA 3F56A 4HEA9 5HO4A 1F21A 2XI2A 3UFCX 1TQLA 2U2FA 4BRNA 5AKIA 5AQYA 5CEHA 2W03A 2KW4A 2VWKA 2B43A 4EEKA 1VIOA 1H2TZ 4NWBA 4CHPA 1KOHA 3MM6A 1LVHA 2IVOA 2JH3A 4MF8A 2ZNZA 4ISFA 1ZD5A 1PBUA 1LQ9A 1JXEA 3DU6A 2HBLA 1GO3F 2J0QD 4BE1A 3OBWA 2FPKA 1QQMA 4EI2A 3VWSA 2CQGA 3VF2A 5AFUA 2AYBA 3QPIA 3ZSVA 4BR9A 3ZLJA 1RTIB 4J2BA 4LF4J 5CHIA 4FWPA 1ZQDA 2ZBQA 1R0AB 1D5AA 3QRPA 1U02A 3SD7A 4M9HA 2MKSA 4DV5J 1GLDG 5B7WA 3N4WA 4CEFA 4CEZA 3T6JA 4JEPA 2FBXA 1JXVA 4FZYA 8ICKA 4YOEA 2RF2A 9ICBA 1OPIA 2ZVSA 4M9LA 4NLSA 5IV3A 2EK6A 4MDBA 3PMLA 1KQFB 3SBGA 1T03A 9ICLA 4C7QA 1BNPA 2A5XA 5C5JA 3VQ7A 3I0RA 4HT7A 1SBRA 2G4BA 3TA0A 4C4SA 4K4VA 4C7YA 5D15A 4DL5A 4J9NA 4ZTFA 1ILYA 2UUTA 2DGZA 2R3VA 4DX7A 3B6BA 3ALYA 2MAXA 2W4DA 3ALRA 1HBUA 2N7YA 2VKQA 2DNGA 5KFDA 4K4UA 4LZGA 1H3DA 3OR1A 2RVJA 4KLHA 4DPXA 8ICFA 3ULDA 2ALYB 4CLZA 1K6YA 1BDGA 1XNQF 3PYFA 1B4FA 3VGKA 3TKAA 2KXHA 3M1VA 2ZBIA 1S6OA 4DI6A 1QVGR 2G8HA 1D09B 4BR0A 1F9HA 3C7NB 4FJLA 2OHDA 5AZJB 7ICUA 2BM1A 3O4NA 5KFYA 3L4PA 2MU2A 5LMNK 4KFBA 3PYGA 1WC6A 4JV0A 2RRDA 3MWPA 2HHSA 1HWJA 1N33J 3MX2A 5JVGL 1KLMA 2HMXA 2Z2YB 3DOKA 3BDEA 2JSXA 3HHLB 1HBNB 4QU7A 2NUBA 4BC5A 5ALSA 1NOYA 4ZVSB 3CT9A 2ZJ5A 1TKZB 2Q79A 4BREA 2B4PA 1UCVA 4DV4J 1TK8A 4LRAA 3GYXB 5A6WA 3V9WA 2Q3SA 4CHNA 3WKCA 1VSMA 5HJYA 1SC1B 2BPGA 4CD3A 1U1MA 2A1RA 2MQNA 4KHSA 2H5IB 2VG7A 5F9LA 2B4UA 2OYQA 3R5CA 1VQ9S 1X5TA 5EE0A 2XSFA 1ZQOA 4DOAA 4PA1A 4B3RJ 3CDBA 1XMOF 4HAIA 1UWAA 2M8DB 3D6RA 1KQKA 1FTRA 2BTFA 1FDBA 1NGGA 1TL5A 1RHMB 1RISA 3EYZA 2AT1B 3NS6A 1H2UX 1GOAA 2EC2A 2GAHC 1W25A 3F53A 2JEIA 1CZ9A 2VQFJ 3I56S 2GC8A 3IRXA 2DHGA 4HKQA 3HCXA 3CCES 2UXCJ 3CC7S 2IM0A 4BJQA 4CI0B 1RA6A 4Z0UA 3I76A 2ZH7A 5AHXA 1SH2A 4YP3A 3QDKA 3Q24A 4OI3A 1QTMA 1RTIA 3HP9A 2DGSA 5J0TA 1SJ1A 1NPRA 4IWVA 3AM9A 2CPDA 3VA3A 4KLEA 2DXEA 1BD6A 1D9AA 4MJKA 2H3IA 1XMOK 3QBCA 4ANDA 5AZJA 7FD1A 1JK9B 4CLUA 2RAQA 2G0AA 3A3NB 3QNNA 2IHNA 3NMAA 3IRUA 3FMBA 1NK4A 4KYZA 2OMOA 4IO1A 2MA1A 4O9MA 1RBVA 2KI2A 4C4WA 4BC4A 4F4ZA 1NI3A 3ZTPA 4CZHA 2LYBA 3ZT1A 3HPOA 2IS3A 2CUYA 3R8YA 3IUCA 3MN5A 5DM6Q 3VR1A 1NRKA 4KAZA 1QAJA 3LP1A 1GXLA 2YNGB 1RWWB 4FM0A 1OPZA 2XS7A 4CJSA 4B1YB 4CTAA 1IM4A 5M2PA 2E1FA 3ONQA 2JC0A 1WDTA 3DRRB 3US5A 4WP9A 1CEZA 2HSZA 1H2VZ 2Y9UA 4Q45A 4CJ4A 4FZNA 3N6LA 8ICSA 1N5VA 4YHHK 1ITGA 1WG4A 1BI4B 2JLFA 4ILHA 3L3FX 3F2DA 3W2VB 3H3NO 4GLXA 3CC4S 3D5MA 5BYRA 2B6AB 2HWHA 1U6FA 5KRTA 3FBFA 3J80Y 4YDDB 3EGWB 3MOZA 4OJOA 4LRBA 4NWIA 1WSGA 1Q82O 3UCUP 2ZIWA 4G3IA 2IA0A 3MCPA 4IKFA 4UB5A 4WF9L 2QV6A 2AEMA 1QZ5A 5AKGA 2IOHA 4ZH4A 2I0XA 2AJ2A 3VCDA 2MGZA 5ALYA 4KTQA 1S59A 3VQSA 1HQEB 3CWJA 4RQ3A 1O51A 3TAEA 3UKRB 4FPBA 1JLCA 3DM2B 4E98A 3MR3A 1OSCA 3JSMB 1RT4B 8ICYA 1TVAA 2OWOA 5DB7A 3VQCA 5HL7L 5F1XA 3EEQA 3U1MA 5J1NA 4HT5A 3WXJA 2MYFA 1HBMA 7ICGA 5T14A 4ECXA 4CZLA 5AQXA 1KVIA 3SPZA 3M30A 2N1RA 1KONA 4WWSA 1O1WA 2HHVA 2RRAA 4B1UB 3L3VA 3KHYA 3A3PB 1Q18A 1H38A 1YJNS 1ZBHA 2C42A 2UXCF 2X6NA 3Q8RB 4DG1B 3WQTA 3MMAA 1RAOA 1A5XA 2HB5A 4MT1A 3HVAA 3JAMO 1O6XA 3HKZC 5A8WB 1LW2A 2HWTA 3B4DA 2E8PA 2GUIA 1T0TV 3I31A 1N62A 1KBUA 2BV3A 1WHVA 3E9OA 3IC1A 3U9DA 3MPWA 3MEGA 4Z6EA 3P49B 1YKWA 1WG5A 4CF2A 3DRPB 1YI2N 2H65B 2MQLA 3TA1A 4D3GA 3MAAA 4LF6F 1RKJA 4FLUA 5T7LA 1OQ3A 2ZIWB 4H4MA 3OA9A 4FO0A 2YKQA 1Z4OA 2GZOA 1TV6A 4ATNA 5ITHA 2B9XA 5KI6A 4DR1J 3HO1A 4FK2A 4OYBA 4CGFA 2X1AA 5A0YA 4NB4A 2ZJ8A 4Y1DA 2UUAF 4E89A 2DF4B 4ALZA 1DY3A 2CNNB 2CVEA 3PKYA 3JAMU 1ZC6A 1IKXA 1N5YB 4PYAA 2G5IB 1TL1B 4Q7AA 3NHGA 4Y3CA 1YXQA 2XSJB 3RYLA 3HVRA 1RTZA 2I38A 4ECZA 1VQKN 4FZVA 1ZQHA 1BPYA 3EN9A 4KLDA 5KFXA 4KV8B 2KZMA 3ZC4A 3AJ2A 3AVLA 2F5GA 3Q8QB 1ELOA 2OFHX 3MCNA 1R3NA 2H4WB 4MQ3A 1M1HA 2F7VA 3EDQB 3MMAB 4G9BA 7ICFA 2CA9A 1ZQRA 3UMBA 5AR0A 3MAHA 2R7OA 5B8HA 4CIFA 1VQMS 2C1EB 2Z1HA 2LCWA 1MN9A 1TP7A 4ECYA 3OYBA 5CYMB 2P9KB 1UMJA 2C2KB 3RR8A 1AYEA 4JK1A 2C2RA 1Q7LB 2B5JB 4FXVA 4C4RA 4M5IA 2KEYA 1NSAA 3D2NA 2D3UA 4B3TF 1DRGA 3QMLA 1U1PA 2R8KA 3QATA 4DUZJ 1X8DA 2QKKA 2CXEA 1S5ZA 4FS2A 1RGIA 1MG7A 5GINA 4OZJA 3W2WB 1VQ9N 5EY4A 3U9ZA 2LYAA 1EQMA 5J2DA 1G7CB 5AI5A 4P2SA 2LA6A 4DS5A 4KQZA 5HVGA 4PY5A 4L73A 3R97A 3CEDA 2GWJA 4J03A 2CN1A 3ULEA 4K8RA 2UXDK 4B1VA 2H3QA 5KFGA 5LY3A 2LLZA 3RJHA 4M0AA 1N56A 7ICSA 2IPOB 3V9SA 3HKZD 4DTNA 3AVJA 1R8PA 4B08A 1ZQGA 3T1AA 5HRPA 1UT5A 1RXVA 2NLXA 5HROA 2DR9A 4PABA 2NXCA 3CJBA 3UN3A 2GHWA 4OZ3A 1Q86O 1RXWA 2KT3A 2HBMA 5CHGA 5MAOA 2ZZMA 5M1OA 1ZS6A 5F8NA 3NF8A 2FQQB 3U26A 2K1RB 5LJVA 2O5DA 1NNDA 2X3DA 1WOSA 1ZQTA 2YNHB 3LH2S 3OY9A 4I29A 5C2FA 2ZJPL 3WK5A 2XGQA 3SJHA 2KJVA 3PNCA 4GRSA 4K50A 1TKZA 4RBTA 2FSKA 4Y2UA 4OKKA 4URSA 3SLCA 3QO9A 4V19J 3RB3A 4WCEL 3ENVA 2G2YA 2QC3A 5AQFA 5D0RA 1CC8A 3D7EO 4AFFA 5DBBA 5C42A 4QZAA 3E0FA 2UVWA 2UVVA 1DZ5A 1FESA 1VQ8S 5LMUJ 4JOUA 3QGPA 3MXIA 2YJEA 4DN0A 1HR0J 1EQ0A 2L41A 2E4LA 3I6PA 3VZHA 5KGXA 1KTQA 4BRQA 4BGAA 3J81U 1JNRB 1SS6A 3RAXA 4ZN1A 3PNIA 1EHWA 3PFOA 2YJFA 1NGDA 4TUSA 3AFGA 2EAPA 3L0QA 2UUCJ 5KFKA 3HM9A 2ZWHA 1PC5A 4BC3A 4IOBA 2QLBB 1FJEB 1U4BA 1HJOA 4LF9F 1VBYA 5AE2A 1IG8A 1VSEA 3K7RA 2BW7A 4EHTA 3PYEA 1FE0A 4Z4FA 2W54A 4Y2VA 4O8UA 3J7YI 3TX0A 2HHHJ 4PPXA 2IM2A 3AO3A 5KFWA 3AQEA 2FJXA 2G08A 5KL1B 4HUGA 2EG1A 4F02A 3BQ1A 1RAIB 3S1TA 3L7OA 2VH7A 2DB1A 4NLZA 2HS3A 2XM3A 4NZ6A 2DFHA 3QEIA 4QIFA 3OYKA 3H2VE 3R6LB 4DQQA 3D7SB 5E41A 4YQWA 2ZWPA 2ZH2A 3LGHA 3PW4A 2WZ1A 3QIDA 2DKOB 2XZTB 5ALNA 4IG0B 2VPZB 4A8XA 3RW6A 1SB3C 3HM8A 4LF7F 4Y0WA 4U7BA 2JWNA 3CCUN 4JNEA 4HWIA 2KVIA 1RWXB 3WNEA 2IRUA 5DO2A 1PVQA 4FJNA 4NLYA 5H1SV 2GWKA 4RR5A 5AM3A 1ZH5A 2V2KA 5I3UB 2NRHA 4CWBA 3C19A 4CYUA 1OY9A 3I5CA 1Q8IA 5ETPA 4M2YA 5ETVA 3QT8A 1YVUA 2XY6A 1J97A 3EW9A 1LK7A 1X2IA 2P9SA 3GE9A 2FVQA 2O67A 5EOZA 2Y1RI 1U2RA 1YGYA 4R64A 4WYLA 2DY1A 3DLLQ 2BPCA 3KHLA 2BCVA 1ASVA 2L9DA 1L7PA 2OD4A 5D4LA 3AV9A 1YHQS 1GOBA 2W04A 4IG3B 3ZZYA 1WOOA 2MZTA 3ZZPA 4KHPK 4ZA1A 3N5BA 4EX6A 1HI1A 2OTLS 4BGBA 1X3MA 3MBYA 4P73A 3SSRA 4K4IA 5KFAA 4QWBA 1O8BA 1NBWA 3DLKA 4CFBA 4FLXA 2BVZA 1RT5A 3O9QA 3GIKA 4Y2IA 3TNVA 3THWB 1VJQA 3AVBA 5AKLA 4F92B 1MQ2A 3E2EA 3MEDA 1QAXA 4P2MA 1WWUA 2WFBA 4QW8A 3KLHB 1I94F 2OGUA 2W25A 2JX2A 3R5DA 1VGYA 3RAMA 2ZZNA 1H0HB 4EBDA 1LWEA 1S3XA 3ZETB 4J2EA 1BI4A 1NSKL 2CDRB 5AI4A 1NBEB 3VAMA 3DM2A 1A9NB 5J2CA 4L74A 2R7WA 2DHXA 2VBWA 5C7PA 2O66A 3EPGA 2L5YA 5AQUA 4QOTA 5HVHA 3H0LB 2BCRA 3LQVA 3OBIA 2P9IB 3TQ1A 4JRQA 3BGRB 4I56A 4QIVA 3KMQA 2B9WA 3PIOQ 2G0IA 4M5LA 3KLIB 2WF9A 2ESEA 4W4MA 1S7HA 5GAHU 2YB4A 4HTUA 4YD2A 2AZ3A 2J0XA 1RT7A 4K4YA 2HFVA 3E9PA 3DMJA 1FX2A 4Y2SA 4I68A 1KVBA 1PCAA 2PMHA 4ZVRB 3M2UB 4IDKB 1Z1VA 1XWLA 5KTQA 5BPNA 1BHNA 1Y64A 1NK5A 3V6JA 3B8HA 5CZXA 3MMBB 4US8A 4LF4K 5EHHA 1OO0B 2I6XA 3P5BP 2FJ6A 1EAYC 3UR0A 3HHNB 5J2MA 1T9VA 2HOEA 1D8ZA 5GTIU 3KG1A 2Q1LA 2W42A 4CRJA 3GQCA 1T3VA 2CH5A 3F2KA 4EHUA 3CJTA 5L1MA 1R8CA 4AYBD 2GAGC 1GX5A 3D0PA 1KCFA 3KWMA 4A8QA 2AA4A 3DXBA 3AA3A 1NDKA 3VF4A 4CJFA 2XSJA 4UB1A 5GAGP 3QGIA 2YWWA 3BS9A 5ALKA 4NLNA 3W8GA 4JI4K 4QJFB 4XEIA 4WJ3B 1M90O 3MTKA 3NL0A 3FQLA 4FN5A 4CQ1A 3AL0B 5CABA 1J6ZA 2HHXA 3JPTA 2J9EA 2DNLA 2GV1A 4GIBA 1Y9OA 3SBMA 2J5AA 2H3VA 2NS1B 3GFXA 3ETMA 4F9OA 1TL1A 1WTFA 1U6ZA 1FT8A 4OYIA 2AMCB 4A62A 5TKYA 4DCJB 1FO4A 5J2FA 3FK4A 1P8GA 2P9IA 2MY7A 3EUNA 1SCJB 3CCLS 1HA1A 2FMQA 3AQOA 5HMXA 2HDOA 2XMJA 4X4RA 3GYGA 3R1XA 3L2RA 3G9CA 4I2GA 2IDOA 3KHHA 4AT1B 3CJKB 3QICA 3VMFB 3BP8A 3M8QB 2OD6A 2OAUA 3CCVS 3H1VX 4WF9Q 4ZJQA 4U96A 1RT3B 5C25A 3HW8A 4CIOA 2LHTA 5KG0A 3P3DA 3MGJA 1ICEB 4ICLB 4P75A 1NZ8A 1FRHA 4KHNA 3EY1A 2NUUG 4XDCA 3QAUA 3LPTA 3NKYA 1L7MA 3V6DB 3R2CJ 5J2MB 2GQ2A 1CZAN 3SQGB 2CQ1A 2YQ0A 4CO2A 4GKJK 3GU0A 5K20B 3AO4A 4K25A 1P27B 4IEIA 3KJVB 2GO8A 4WZQA 4KHPF 1RYRA 3O3FA 3TJ9A 2VODA 1T05A 3CJ2A 4CO0A 2QT7A 2BHNA 2IJNA 4NA3A 1RBSA 2UXBF 2VICA 3RB6A 2YNIB 2DH7A 1HYSA 4P10A 1HMVA 1FKOB 1F3FA 1KHVA 5AQZA 4A8SA 3R6MA 2UXBK 5FPMA 3C8YA 2QA4G 4OPAA 2P9GA 3ISCA 2ITGA 2K1RA 2K3IA 5ADXH 5FLXU 5B0EA 4YB5A 4QS7A 5DK5A 3ZDBA 1XMOJ 1XHXA 1HNWK 1W7WA 2EHGA 4PH5A 2HZAA 4ZP7A 1N36J 1HW8A 5AQQA 4LT6A 1S1UB 3DRXA 3CDEA 4Y00A 2VYPA 4LH5A 4YOYA 1JLFA 2QL5B 2L9NA 5KQDA 3MR2A 4ED4A 5CRXA 5AQPA 3WK4A 3FZKA 1LCUA 1VQNS 4BWMA 1N34J 1V4SA 2IOCA 3DU5A 1Q0NA 4DU1A 3EZOA 3BSCA 4LF7K 1V97A 3K5MA 2W6LA 3H1QA 5B0AA 3VQDA 3D0GE 4DR5K 3MPYA 2YBVA 2ZGYA 2BANB 2D0CA 4YMMA 3GV8B 4ED0A 3OYFA 3CCUS 2GA7A 4NXNF 3DDKA 4NCGB 1QM9A 3FNNA 2BGWA 3M5RA 2PMZF 1EX8A 5FRNA 5AIAA 3DC2A 3I32A 4AXJA 4JK7A 1UA0A 1IBKJ 1IH7A 3BH7B 1QH9A 1UPHA 1ZRMA 4B1ZA 1RA7A 1KWMA 4ES3A 2E2NA 1XSPA 2OEJA 3QIPB 1S6UA 1MN8A 1QUVA 1W26A 1K5OA 3IMXA 2FPLA 3ET6B 1GT8A 4LMZA 1P9QC 4YHHF 4WU2A 3G6YA 5LM7E 3A12A 1ZTWA 2QM1A 4JHDB 3W9IA 2PKEA 3SJJA 4OI6A 5M1FA 3DKDA 1R27B 2HNDA 2W3RA 5DDRC 2PT0A 1E6VB 2V67A 2KT5A 1IBLK 3W66A 4YHHJ 3PIPQ 1VRUB 2JGAA 2W2QP 3VQ8A 5I3PA 4C97A 2CNLB 5JVGQ 1CZBA 2MMYA 5AQRA 3LP2B 5EGYA 4X66J 3M6VA 3I33A 1CS4A 1HIYA 2R8JA 2F63A 2V8PA 1N52B 3GIMA 3EL2A 4E19A 1RKIA 1HHTP 3RG6A 3ZDDA 4PL8A 4JI1J 3IG8A 4R5PA 3NS5A 2XNQA 5LOQA 1T9TA 1JLAB 3GJQB 3SIPB 4I6WA 3N28A 3MDFA 4LUBA 4P4MA 1JLBB 3EXYA 2JLEA 3RMAA 3U6FA 4GMKA 1T6DA 4O44B 1EO1A 5I3UA 3IHQB 1U0SA 2EKNA 5FD1A 4HVZA 3K57A 2E1YA 2FSJA 3EZUA 2ZHBA 3C14A 2XI3A 2ROPA 4F5PA 2ZWOA 1R0CB 2NCKL 2HLTA 2HKEA 3NBPA 1OKJA 3MEEA 4ECTA 2E5SA 4KHMA 2OPRA 3ZZ0A 2Q36A 3WZ0A 9ICNA 2LQ8A 2KRRA 1YBUA 3CGIA 4E7LA 3OL6A 1ZD3A 3UKRA 2B51A 4ILRA 2XYGB 1SIWB 3GLJA 2VQEJ 1FD8A 4HCBA 1QAYA 1IQTA 2I1QA 2GVDA 4JLHA 1I94J 3IBWA 5EWGA 3GSIA 1A6SA 4O55A 1PSDA 3M2RB 1K0TA 1KS2A 3AOBA 4YORA 2B9EA 3RMCA 4URGA 1R6YA 2BOAA 4WKRA 4X62F 4A48A 2E20A 3M8PB 3FZHA 3BY5A 1ZQEA 1X60A 3W9HA 2PAVA 5FLXO 2CQIA 3U27A 1D9FA 3MWBA 2OPPA 1UEKA 2DY4A 4UAVA 1A0PA 3KLIA 3TYTA 4HTJA 1NMEB 4W5TA 4MK9A 3TWHA 2Z2LA 3KJQB 4NXMK 2QXLA 5HMMA 4A59A 5JJBA 1LWCB 3ZT3A 3AO5A 2E5HA 2NRVA 2EC0A 3ONNA 3O1WA 4QZ9A 3OYHA 2WHOA 3UD5A 2H4YB 1WAJA 3VGTA 4C8KA 8ICMA 1FRXA 2I9SA 2VWJA 4DQ8A 2YHWA 4Z6FA 1ZQWA 1XS9D 2ZKUA 1L7NA 2W8KA 1B0PA 5AQLA 2WB1C 4PZOA 2VD3A 4M7XA 3HJFA 3V4IA 4JI3F 2FDRA 2E1AA 2KG1A 3WKEA 1CJVA 1FD2A 4DTJA 1PK1A 1C2PA 2KV2A 3AEVA 4CFDA 2YKMA 4O3PA 2A1SA 2MZRA 4CERA 2F8SA 3TSPA 3NOCA 3MWTA 4RQNA 4X65J 4LSNB 3IN5A 3CCLN 1NB2A 3SDEB 4OX7A 5ALOA 4OX6A 2DO0A 5F3XB 1R8AA 5AXMA 2CYYA 1NDLA 3VEOA 1E6VA 1BG3A 4O0JA 2EFOA 3F5EA 1R8BA 2KK0A 1RFQA 3CFPA 3JTOA 5H9EJ 5HR7A 2JR5A 1XR5A 1VCTA 2X6SA 3C2KA 5J0WA 4CH7A 3WX4A 2N4DA 1KAZA 4A46A 1RT2A 4JS4A 3QJJA 3SUPA 1M5PC 4TU7A 4J37A 1VR6A 1U09A 2PA3A 4CO5A 3WT0A 4BR5A 4MKBA 2QO3A 5G4DA 2BJ9A 2CRLA 5C10A 1M1GA 1S49A 2RMLA 3AY9A 3AVHA 5IILA 2X51A 4RWWA 1Z3EB 2W24A 3GP9A 2VASA 4EMDA 3QFPA 2Q4TA 3IV6A 1WC0A 2ZH8A 4WFNL 1YJUA 2DFLA 3HHLC 3G96A 2XYPB 3EGNA 2OHFA 2IVNA 3AO2A 4DOBA 4M5KA 1OQ6A 3UXPA 4BLGA 1WG1A 3NUQA 4NI2B 1PYSB 3GIJA 4O0IA 5ADZA 4US9A 3OL7A 5E3AA 4QR1A 2BOPA 1NKBA 3PFEA 3VENA 3EGVA 4ZIWA 2Q0UA 3C29A 2DEIA 2NREA 1KDHA 1BQMB 2QXFA 2Q97A 5J2HA 3IR5B 4DZ6A 3OTEA 2ROEA 2E5JA 4LRCA 1JLEA 3FCHA 4E7KA 2BDPA 3KWGA 3I8DA 3KLVA 2W9CB 3ICXA 4MAKA 2ZJRQ 4Z4HA 1N0UA 4L72B 4DJBA 4DR3F 4BVOA 5HAOA 5EX3A 5HLFB 4ZN3A 2HHQA 5HMLA 1DQ9A 4U95A 4OKEA 1V3SA 3KBBA 2VCPA 1RTJA 3AA9A 1J54A 4JKBA 2BYCA 3LP1B 3NVYA 4DN9A 4MKYA 2VONA 3LYSA 2VWBA 1VOMA 4Z4CA 3RH6A 4QZ8A 1WSEA 4I2BA 4PQAA 3TAPA 1HNXJ 4ZVTB 4M04A 3HZEA 4DDFA 2KHVA 4KH6A 3BSNA 4CD1A 3J7AN 3FCWA 2GH1A 1NU4A 1WEZA 3CJ3A 1WC5A 4U7UK 4PHDA 4OHXA 3S6JA 5J2GA 4NRTA 5J2NB 2YNFB 4DV7F 4R8UB 3SYZA 3ZT0A 3T9ZA 4YXMA 1S79A 3O4QA 5AQNA 5KT4A 4FSVA 5DETA 9ICPA 1W2IA 3OYDA 1PBAA 1PC4A 3DLBA 1WUDA 3FGUA 3RTVA 3G82A 2ZTDA 1H7XA 4LQ9A 3K5OA 4BRMA 1QZ6A 3DV9A 2HRTA 2KN7A 4LVNP 4OX9F 1W7AA 3ETRA 2DR6A 3CMQA 4I2JA 5ETMA 3QB0A 1HI0P 5FPNA 5KFFA 2PYLA 1UJ5A 3ZD8A 3D6TB 4CZFA 3PACA 3MM8A 2I8EA 4PZVA 4KKOA 1C1AA 2HVEA 4R0JA 3T3FA 1RT1A 4EFHA 4NOHA 2BANA 1OXJA 4FJ5A 4R79A 4L76A 5KFSA 3MMJA 2DGXA 2KFYA 5ALHA 4C8ZA 5GAEI 5I42B 2GVZA 2VPWB 2VJ4A 1KVCA 3C1YA 3DXKB 2V68A 1LXNA 1V38A 9ICOA 2E29A 4F25A 3GPAA 2F7TA 3AU2A 4KHPJ 4ZK7M 4FW2A 3HJVA 5J2PB 3MGHA 1HNIB 1KEKA 3GCXP 4M47A 1PVPA 4X4VA 1RPLA 5KFPA 2P5GA 5DKWA 3ZXWA 4BRFA 2A10A 1YIJS 1WHYA 3VA0A 4QS8A 5J2AA 1A6LA 4CF1A 1URJA 4K41A 5EXWA 2KZZA 2HOIA 4OIXA 3M1VB 2UYTA 2RRNA 3EGZA 5B0BA 1EZZB 3AVAA 5JLFA 3SAHA 3D2EB 1Z00B 2Z1JA 4YOVA 4FYWB 4EP4A 3EKUA 2QA2A 4EAHD 3ZZZA 1E4GT 3C15A 1EKSA 1M1KO 1ZD2P 2J9CA 2M88A 3MPDA 5D77A 1O08A 2IVYA 4M6WB 4DUYK 1RDFA 2CG4A 2VQFF 2JLGA 2FY1A 3HT3A 3VQTA 8ICOA 2DGVA 2EANA 3SCJE 4CF9A 3DEEA 1VQ8N 1TMMA 2NRXA 2XMVA 4NCBA 1J5EF 5BXIA 4EENA 3OVBA 1B7FA 4M5DA 1RLDA 2E1RA 5HRSA 2KIVA 1WF0A 2V34A 3CJ5A 2XMUA 4OI0A 2EBGA 1SH0A 4QJVA 4YN4A 4HVJA 2ZTCA 1DK2A 4FBTA 3C7NA 1Q8KA 5F9NA 4H5VA 1HW9A 1ZQZA 1AZSA 2AYEA 4ZP8A 4OVLA 2GLEA 2VKZG 2RJZA 3N7SC 1IXKA 1KVKA 4J2DA 2QMXA 1S1TA 1U1RA 3VVTA 3DLHA 8ICGA 4LBIA 4TXSA 2JJ4D 2K8BB 1Q95G 4CTAB 4DHVA 2GGPA 4LFCF 2HFSA 4E7HA 1HBNA 3LPYA 5D3GB 3Q8SB 4HR2A 4WYBA 4CZIA 4PWDA 1VRUA 2FF6A 2UP1A 3B78A 3NAIA 4ECSA 3QFHA 3GFYA 3OTOJ 4I2PA 4JI6J 4K4SA 4KO0A 2P6RA 1JUDA 1IWAA 1RM6C 1REVA 3A0IX 2AJ4A 2HMIA 3H98A 2HWIA 3I8BA 4NXMF 5ALLA 3H2LA 3WK8A 3K89A 3L6QA 2OPPB 5AT1B 4QNLA 3LVWA 2GWSA 1X6JA 4I2AA 2VBZA 3VC8A 3RMDA 5AIBA 4ANCA 5A0LA 4CEOA 3UE5A 2K3KA 2WOMB 1LWCA 1WORA 4BRCA 1HYZA 3ZTSA 3MFIA 3E58A 3BQ2A 4I2QB 3HX9A 3NVZA 3FVYA 2P9NA 2X1GA 4CESA 3PJ9A 2O8FA 1BE4A 3C6TB 3NAHA 5AJ3J 3HPGA 3O8MA 2P5OA 4D3HA 3P96A 2WRMA 3NY0A 2LYVA 5DB8A 4H5RA 5DDMA 3L8BA 1MLAA 1SUQA 2LEAA 3OYLA 3CCRN 5IS2A 3OQ2A 1D3WA 1SQEA 3EJMA 2V69A 3DRSB 1ZQNA 1GMWD 3A8JA 3FFIB 3WBZA 3DYAB 2RQMA 1TL3B 1UQVA 4ZHRB 4H5TA 2CJXB 1RT6A 4EUVA 1SZHA 1QQ6A 4P2HA 1N0VC 3CJKA 1RK8A 5LL6Z 2WB1F 1WC1A 2P9EA 3J7AP 3D6HB 4PG4A 3G10A 2Q2RA 2GQQA 3LWMA 4WK1A 4P72A 3MM9B 5HQMA 4UASA 5IWAF 4TN2A 1LWXA 4FJXA 1YHQN 2F65A 3DHXA 1YBTA 5BPLA 4L3KA 1N32F 3OLBA 2V8DA 5C2GA 2OMLA 2LA4A 1QJHA 3V5RA 3ZT4A 3QMQA 1XHZA 4GC6A 1SZPA 4NRUA 1RXOB 1TKDA 4Z7CA 4DSJA 4DPTA 3MAAB 5DM7Q 1KRPA 4DV0F 3M8RA 1X9MA 4LFBF 3IAM9 3NVWA 3QZ7A 2RU9A 4OYPA 2ACYA 4U8VA 4E3SA 4F3QA 3QEBZ 3PXGa 3M6XA 1HJRA 2PI5A 4J9MA 3ZO7A 2BA9A 3HP6A 2E5IA 2W6KA 7ICPA 2VV5A 4C6AA 2VIXA 4F4WA 1S97A 1V5VA 1L3UA 2XTJP 1URRA 1OMSA 3PCOB 1YJWN 2LPEA 2R7SA 2CDQA 3OUYB 3TZXA 4PL2A 3KLFB 4BR2A 4JUZA 4OLBA 4LJMA 1N2XA 4QZGA 4JD2B 1ZBLA 3IWLA 4CGGA 2GX9A 4AH9A 2VA8A 4UB4A 3RJFA 1CQMA 4NLBA 1IKWA 2G8WA 5E3PA 3NEKA 4CF0A 2LU1A 3MURP 1QVFM 2WCXA 1IKVB 4FFDA 3VAJA 2RIJA 2Y0SD 3I4HX 3ZZRA 3W5YA 2QYCA 5BOMA 3QWPA 2IVPA 2FIUA 3HKWA 3OW2M 2YVSA 1ZXIA 3PEHA 1Z6RA 4CLKA 3BGOP 2YTCA 3CJ7A 4A8MP 4OYXA 3H20A 1QHTA 4X4OA 1S1XB 1TUYA 2WVCA 2KXFA 2M4MA 4B3TK 1ATRA 3UN2A 3GCWP 3VTHA 1N34K 3HJEA 5AJ3F 1DQ8A 4FKXA 2ERRA 1QQOA 3KK7A 5EE9A 2HGMA 2E7WA 2MUTA 1C6VA 3BEXA 3UKUB 2XZWA 2J0SD 4GY2B 3RBDA 1MW7A 4ZVOB 1KVAA 2B6GA 4GVBA 2KJWA 2DQNB 2IRXA 2CGJA 3S9HA 3MECA 2EDUA 1IM6A 1J9AA 1RT1B 4OLPA 3M3ZA 4WXWA 4AM7A 2JL9A 4UB2A 2ZF5O 2FF3B 9ICGA 2NUHA 1JJ4A 5FLXY 3OYNA 1N8RO 2X3GA 2MJNA 2WBNA 2DNQA 2ZH1A 4DV6K 1M5VC 2BJ7A 3VEYA 1CS4B 2GOLA 1WHWA 3LP0A 4LRFA 1IJJA 1WOQA 5AI9A 1HWKA 4ZCIA 5D49A 2I7NA 1KFTA 4U67Q 4IDHA 1VQ4N 2XMAA 3Q89A 4PR6A 5GVQA 1RDAA 1GLLO 2J6SA 4HHUA 2COLA 4OX8A 2ZJPQ 3NVMA 1SGGA 1UEUA 2CQ2A 2VQFK 1VLOA 3T6BA 4BRGA 1IKVA 2GHVC 4GFJA 3M05A 4KIAA 2VFRA 1YRXA 2KRBA 3KKAC 1P6TA 3MGIA 1PO6A 2DITA 3SMPA 4XA5A 3C94A 4LFCJ 9ICTA 1XQIA 3CTRA 1BPZA 1XUPO 1KFSA 3MTJA 3TR5A 4ES1A 4K4HA 8ICBA 1WJ9A 1RCOB 4JBCA 3FBCA 3KLEA 2HHHK 1S9GA 1HD1A 2KKZA 4RLEA 4WE1A 5JS2A 4P4PA 5J29A 3BKTA 3ICLA 2CQ4A 2WONB 2QA1A 1UAWA 4JI0F 2E9TA 1UVKA 1ZQCA 2BMBA 9ICXA 3OXLA 2MQQA 3CF5Q 1VIXA 2AH5A 4FWKA 5AZIA 2JVOA 1S5JA 1HWIA 3SCLE 1BXNA 4RQ5A 2YY6A 5LSOA 2OEHA 2EEYA 3BZKA 2QL7B 2WVDA 2RHKA 3R2DJ 2CH6A 4H0TB 5KFIA 1YTUA 2R7QA 4LIRA 3SFUA 3VAHA 2HNZB 2KHOA 3UI3A 2IIRA 2RT3A 1Q4RA 2KHCA 4IOAL 2KU7A 1NAQA 5J0XA 5CE3A 1VQNN 3RUBL 4O44A 3UVJA 4F5NA 4AP9A 1NGCA 5CAAA 3CJ0A 4NL5A 2YWKA 1F9FA 3LP3A 1HNVB 1XI1A 1JB0C 3IG1A 1NM2A 9ICUA 3VZIA 4F72A 1S72S 4C0OC 1Z26A 5SZTA 2ZIXA 4KH0B 4IO9Q 1E3MA 2W4PA 2V4QA 4IZ9A 5ALWA 4OZ1A 3OTCA 4KHRA 3SV3A 1DRZA 4OI4A 4NE9C 3OTOF 1B3TA 3H46O 5B0CA 1PYTA 2Z1GA 3OL9A 5ALDA 1GK8A 1T94A 4XAKA 1C0MA 1OWXA 1PUZA 3MR5A 2NYHA 4NXMJ 3LZIA 3POTA 2HBZB 5CD4A 4PQUA 4BRHA 3QWUA 2DCUB 2FHOB 4QWDA 2MZJA 5K14B 5KFBA 3H59A 4NLVA 1PZNA 4HHTA 4XH4A 4M1KA 3NWRA 1DTQA 3HVTA 3KVGA 4B9TA 4Q0BB 4OPKA 3C6TA 4YMNA 4FLYA 3IG5A 2QB0B 1YUWA 1XNRK 2Q0ZX 3AODA 2YKOA 2HMIB 2Y3YA 3C46A 2XY8A 4YR3A 1WBDA 4QCLA 5KPZA 3T41A 2ZJRL 4DOCA 1VJWA 1T3QA 3RGIA 4YD1A 2A1JA 3PM9A 3THTA 4DUZF 4NYNA 4EEYA 3QEWA 1X4DA 1VHFA 3KTQA 1FWLA 2E5LJ 4X65K 5AM2A 7ICMA 1VQSA 5DDYA 3G2XA 4MH8A 4FWMA 4W5OA 3P45B 4PEOA 4TLQA 3LDOA 8ICTA 4OZNA 2HHWA 2CADA 2D3OR 3KOAA 4IUFA 1L6NA 3JSBA 1Z2LA 2AGQA 1FWKA 2JZBA 3ZZUA 2BZ2A 4UOFA 3SV4A 4U7UD 3EICA 1B64A 3KDNA 1HKAA 2AIRB 3SDEA 3CF5L 2CJAA 3HF5A 4YOWA 2RQCA 5DQHA 4H4KA 3EE9A 8RUCA 1KKXA 3HILA 1JJ2R 2YH1A 2IRYA 1FE4A 1YJWS 4JKDA 5C0YA 3E9LA 2CPRA 3JQMA 4FJJA 3D6JA 1RAHB 1JMSA 4CI6A 1JRPA 3IBPA 5AQTA 3KG4A 4FJIA 1K9MO 2UVRA 3V4MA 4NYOA 2Z2ZA 3MD1A 4DR7K 4UAUA 4K4ZA 5KFQA 2W8LA 5J0QA 3S41A 1UFKA 4DR1F 2HQIA 1YZ6A 1XO0A 3K58A 3E01A 2E1MC 2BKEA 4I69A 1FRJA 2UUAJ 3R9LA 2KO1A 4DV2F 4FP9A 1GLFO 4KLJA 3RF9A 3OHRA 4P0PA 3I9V9 5T7LB 4YOUA 2K4EA 2I5JA 2KKHA 3ZFVA 3A4TA 4Y1CA 4FS1A 2LFVA 4UZBA 2J4RA 1KXPA 4F36A 4UTGA 2HVZA 4U7CA 4KB7A 4DU8A 1H1VA 1C1BA 4FYVB 4P4OA 3O0FA 4L3QA 5GAEU 1EWRA 2MKCA 1AFIA 1CLQA 2OJ3A 5KT2A 4PL7A 3SPYA 1CRXA 4BDPA 2E1CA 1TU0B 5AI6A 2WHEA 2M0NA 1RTHA 1MWQA 3JPRA 2NNWA 3QEVA 3O5BA 2AX1A 4L75A 2C2ZB 5IM0A 3R1LA 3A8EA 4KREA 1YJRA 2VKRA 1CSJA 4C3MA 4U67L 1NGHA 1X4HA 1UVJA 4ECRA 2ZOGA 2HF3A 4C7ZA 2OXOA 4E1MA 7ICNA 4TQRA 2BBEA 2Y8WA 5A76A 1MC8A 3U4LA 4I6YA 1EP4B 2GJFA 2HIQA 2BDUA 1FNOA 1RHRB 3AD9C 4NY8A 5AM0A 4LFBJ 3BKFA 2WB4A 2Q1NA 2GUPA 3K5PA 3MM7B 3KYLA 1UFLA 1QS4A 1NLKL 5B0GA 1KDNA 1SJFA 4KHQA 1NEEA 3TAMA 1UT8A 2FY8A 1WKJA 4UOHA 4ELUA 2VJVA 4USJC 3AY0A 2ZH4A 4CHQA 3NTUA 1MDUB 1MWZA 4X4NA 3AA5X 3CD7A 5BN9A 2RD5C 3TTDA 2YNGA 5IT4A 3LVVA 4CLWA 4KLSA 4C8MA 1J5EK 3C6UA 4RW9A 2CQHA 1Z19A 2V9KA 5HMYA 4UQTA 1NO8A 1XR7A 4O3OA 3Q86A 2PFUA 1G3OA 5C12A 5IT9O 6FD1A 5F0WA 2FVSA 5F2RA 4RW4B 2J8SA 3CNQP 5D78A 4ETXA 2ZUGA 3KZBA 2YMQA 4YUDA 1D0EA 2YPYA 4P0QB 2ZUAA 5AM4A 3T1HJ 4ER8A 3OVAA 2E7XA 1NK0A 7ICOA 4X64F 9ICHA 4M5GA 1S0NA 3H8MA 5LJ3Y 5M1QA 4MYTA 5IM0B 2FC9A 2E8NA 1HNWF 2O4IA 1K1SA 3UQSA 3C16B 2NR0A 2DKZA 2BJEA 3V6HA 2H3EB 2V7ZA 3JS6A 4QR2A 3UKUA 5E5NA 3SSSA 1IBMJ 4BRKA 3QERA 2ZC3A 4W5RA 1N61A 4K4XA 1RHQB 2Y8YA 1SQFA 3H7HB 1XNQJ 3CFOA 3NVVA 3KUGA 5ALFA 2OTLN 1LV5A 2C2OB 3UD3P 4DU4A 5D4NA 1ZBFA 3DN9A 4DOZA 2EG2A 4K4TA 4CGDA 4BE0A 1RQLA 1VQPS 3AVNA 2VHGA 1RT2B 1ZBIA 4DR6F 3WXLA 8ICUA 8ICLA 4IQWA 3UR3C 1D4XA 1RHJB 2DFFA 3J7A1 3W5XA 5L1LA 9ATCB 2KNJA 4DR3J 3V9ZA 1SC6A 3QJPA 1YJTA 5GAGU 5E2QA 4TY9A 4C48A 2E66A 3PHEA 5DRKA 4CIEA 4QZHA 4KLIA 4O5EA 4RQMA 4IFYB 2K60A 2ZIVA 2OZMA 2MKKA 3CJ9A 3PO5A 4FYYB 3AXKA 4DFMA 1IV8A 5J2KA 4E7JA 1G15A 3NNAA 1WC4A 4I2PB 4OX9K 3K1ZA 1K9MT 4DLEA 2PFPA 3CULA 1WYGA 4F0KA 4B9UA 1UP1A 4JYAF 3KLHA 2HVIA 1OJ4A 2P5VA 3OTQA 2V4RA 2VG5B 3FSYA 1T4GA 3QUTA 2VJ5A 1JLQB 1T3OA 2XULA 4RW7B 3CW2C 3KZXA 3GG1A 3ZTOA 3SMSA 2FUG9 4RNHA 1UCNA 4EBCA 3TZYA 3VEWA 1B0XA 1NGIA 4JKEA 3M32A 1ZXOA 4HYKA 1K8KB 4IQXA 4EELA 4LF6K 1A0OB 3ZSZA 4FJ8A 3CIMA 4NLTA 1JJ2M 3R1HA 5KAFU 4B3OB 1WAFA 2LSNA 5IV4A 4BCAA 1BGXT 3BZQA 1NZAA 2EXUA 1SKSA 2P8IA 2OELA 1FTCA 2HS4A 2P9NB 3DI6A 2ODGA 2A40A 2FLNA 2GEMA 4DS4A 3M6UA 2BH1A 2AEJA 2ILYA 5AQIA 4EO8A 1RT5B 2VQEK 3J81O 2Y9HA 4FJ9A 3R5GA 1T03B 3R8EA 1FNXH 1YIJN 2ISPA 3KK3A 3HVTB 3FZFA 4NLWA 3EXCX 3OPKA 4RG8A 5I4MA 2DBBA 4AUKA 3QEXA 3DXMB 4CLLA 1WNSA 1RBOB 3OYJA 3H8JA 1FVSA 4ZOSA 2W9CA 3MR7A 4Y65A 5JVHQ 2AGPA 2K4HA 5FJ4A 2HGNA 3OTDA 3E66A 4FJKA 4JS5A 3ENBA 2LKYA 4FJHA 2Z2MA 5HHHA 8ICCA 3W2WA 2K8AA 2P9PB 2RHFA 2VDIA 2EFQA 4O5KA 3O3HA 3WXMB 1L8OA 2CNOB 1WCNA 1YVFA 1N5XA 4NLUA 4IOAQ 3WKDA 3P6YC 4FJGA 2VIHA 5FDLB 1H98A 4EIAA 1Q8BA 1LW0B 5IQ6A 1FRIA 4GV3A 3LANA 3A5LC 2FPMA 2PC6A 2FBVA 1SL2A 2HMPA 2IBOA 4ZPCA 5RUBA 1U1OA 3GZFA 3VPZA 3SUQA 3HFZB 2ZH6A 2QWLA 3CM6A 2O8EA 5D4PA 3OV7A 4UF4A 3F41A 1BCOA 3ZX2A 4RWXA 1D8LA 1UVNA 1QSYA 4O4GA 3RJIA 1R0BG 3CI5A 4IJAA 1RG6A 2F9WA 4OHWA 4Z6DA 3ZCMA 3MN6A 4RW6B 2PYJA 4UY8O 3EE3A 3JS9A 3VOVA 1VRTA 2OYYA