3HPOA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus y714s mutant bound to g:t mismatch
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVSGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
total genus 214
structure length 579
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hpoA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hpoA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hpoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpoA01
2BDPA 1Q9XA 2E6LA 4FJ5A 3QZ7A 5CJ7A 4IFYA 1SL1A 4DL3A 2IA6A 1UT8A 4KLTA 3C23A 3MBYA 4CHYA 2AGQA 2Q0ZX 3NAEA 3ZD8A 1N6QA 1NOYA 9ICRA 1ZJMA 4MFAA 2C2RA 4E7JA 4F3TA 3OYAA 2JEJA 1QSYA 3LP2A 2RDIA 1HJPA 4GC6A 1J9AA 2BCVA 3GILA 3KD1E 4K8ZA 1TVRA 3CG7A 3V6KA 2JLEA 3AVFA 1LWEA 3EPIA 4OPKA 4KTZA 1JIHA 3UQ2A 3KLFA 2KTQA 2FMPA 1ZQQA 4KLMA 4I2EA 2FMQA 5KG1A 3RB6A 4KKOA 4KLOA 3OVNA 5DG9A 4QZFA 5DK5A 8ICHA 4EYHB 2BHNA 3PR4A 8ICTA 4JRPA 2KZZA 3I0RA 3LDSA 4RNNA 3D45A 3F73A 3LPTA 4CGHA 2IHNA 2ALZA 1B22A 1RDDA 2QKKA 8ICPA 1I3AA 3K5OA 4YD2A 4M3ZA 4ECXA 3AVHA 5SZTA 4LD0A 4YFUA 4DFMA 4CF1A 4PQUA 4UAWA 2PYLA 1XHXA 3OYJA 4RQ1A 4F91B 3GIJA 4MQ3A 3JPTA 1LAVA 3TAQA 5EOZA 1B43A 4QZGA 3D0PA 5HRSA 5JS2A 5J0RA 4CJQA 5D3GA 2IHMA 4DTPA 1RBSA 2C28A 4DS5A 2ZQBA 2DPJA 5KFMA 1ZQRA 1HYZA 1X9SA 1HUOA 4NCAA 4DS4A 4W5QA 4BXOB 4M3TA 2PFQA 1UWBA 4Z4GA 1ZQBA 4FS2A 3SI8A 5KFCA 5KT2A 7ICNA 4M9JA 3JYTA 3C6UA 3QLHA 4BACA 5BPCA 4CEAA 4DQRA 1YT3A 4JWMA 9ICBA 1RT2A 4GXKA 2G8HA 5KFFA 2FBVA 2A1SA 8ICWA 4ED6A 4KLQA 4M0AA 3QEIA 2DFHA 4GW6A 2FLLA 5KFOA 3C5GA 4YMMA 2ETJA 1RCHA 4CE9A 1BIZA 2UVVA 3NCIA 2XGPA 3RB0A 3DOKA 4F5RA 1XU4A 3RAQA 3NGZA 3M9MB 1JLCA 1Q9YA 5L1KA 4B9TA 4QZCA 5EWGA 2AGOA 4CJ3A 2NRTA 3ISBA 2I9GA 2OPRA 4QWBA 2FPMA 1RYRA 5KFJA 3DOLA 1XSNA 4E1MA 4TUPA 1BISA 5HMMA 4O4GA 4QZDA 4UQGA 3B6OA 5D4BA 1ZQIA 1RILA 3C2KA 3PW7A 4FYDA 4PHPA 3QZ8A 2YNFA 4XA5A 5DG8A 1SKWA 4B9UA 4RPZA 1U49A 4NM2A 7ICUA 4BDZA 4O3OA 4F8RA 1QSLA 5BOMA 1C1BA 2YNHA 3VQPA 4YXMA 3B0YA 1IKXA 4HUGA 4Q44A 4UB1A 4Q43A 1ZETA 5DQHA 1BQMA 3UXOA 3AVBA 3B0XA 1C0TA 1RZTA 4Z0UA 1YTAA 4LY7A 1C1CA 2XGQA 4HVJA 3QIOA 4FBTA 4Z6FA 9ICAA 3OGUA 3HP6A 4ED0A 4E7LA 4FLTA 2LSNA 2VWJA 4DSKA 3AVLA 1ZQKA 2ISOA 1BPEA 1XC9A 5KFBA 3TAPA 3A2FA 4FM0A 1NJWA 4DO9A 2KZ3A 5C25A 4FLUA 4OPJA 4F5NA 2R8JA 3JPOA 3G6XA 1SZPA 3OY9A 1RXWA 2Y1IA 4Q8FA 4FJKA 4CK1A 3OYDA 1CLQA 3MECA 4H4MA 1KRPA 4NCGA 3PMNA 3K75D 4FJNA 2FLPA 4OKKA 5DB8A 3O4QA 3NF7A 3AA3A 3SV3A 2P6UA 7ICTA 1S76D 3P5JA 4CEQA 3HYFA 4YD1A 2M9NA 2XC9A 2KZMA 4DU4A 3P1GA 7ICGA 3KD5E 3KTQA 4OLBA 1L3SA 5J0PA 1EX4A 3Q8PB 4QZEA 4CEZA 4DFJA 2W9MA 4KITB 3L2RA 1JLGA 8ICAA 4O0JA 4RQ4A 3LALA 5KI6A 5J2EA 1FXXA 2RN2A 3SQ1A 5DB6A 1KVBA 4TURA 4ECVA 5J29A 4GMJB 4F50A 1KSPA 3DRPA 3TWHA 2E6MA 2ZJ8A 4ICLA 2OZSA 3SPZA 4AHCA 2ATQA 3ZSWA 5CZ1A 4BDPA 1I39A 2ISPA 3BGRA 3AO5A 1HQUA 4CHNA 2XCPA 4CGGA 4AHUA 3MGIA 2A1RA 3PW5A 4KLJA 3V9ZA 4ED3A 3RJGA 3TFRA 1MQ2A 7ICLA 3MAQA 2PZSA 9ICNA 3CM5A 4QZAA 3GFKB 4CF2A 1KLMA 4CFCA 2ZTDA 4FJIA 3VQAA 3KLIA 1ZBHA 4IG0A 1WNSA 4CK2A 3OJUA 4O5CA 4M42A 5J0UA 4CJEA 3GIKA 3LZIA 3L2WA 1Q8IA 3ZSXA 1HYSA 3NTUA 4M6WA 9ICVA 3MDCA 3V81A 4Q8EA 3SUPA 2HNDA 1N5YA 1JLFA 3ASMA 3NH2A 2BCRA 4J2BA 5KT3A 1NKBA 5DLFA 4JS4A 1RNHA 1KFDA 4RW4A 1UA0A 2PI5A 4CJKA 4KPYA 1WSHA 3QINA 4B9VA 2EX3A 5KFUA 4FO6A 4FJXA 2P66A 4RQ7A 4BE2A 4ECRA 3AO2A 3OYHA 2HB5A 2BKEA 3KIOA 4M6WB 4DFPA 3JPPA 3KHHA 1EXNA 3QNOA 4F2SA 2VA2A 5KFYA 1WSEA 4E89A 5DGAA 4Z4IA 4RQ2A 1VSLA 4KLLA 1Z25A 2BQ3A 1GOCA 3OSPA 1ZYQA 3H8SA 2UVRA 4UBCA 3T5JA 3ITHA 4F2RA 4R8UB 5HHHA 2VA8A 1T03A 4RQ3A 4DF8A 2HHXA 1TAUA 5L1JA 3RRHA 3LZJA 1LWFA 3O3GA 4KLFA 1TL3A 4CGIA 4JS5A 4EZ9A 1A76A 3GV5B 1U9LA 2ASLA 1WAFA 2PFNA 1X9MA 4RW8A 4B8AB 4OVLA 4RZRA 4I2GA 3AVKA 4F4WA 1BPXA 1U4BA 3ZT0A 3V7KA 3TAEA 1VSFA 3V9SA 2W9BB 4RT3A 8ICJA 3AVGA 3B6PA 4G1QA 2G8KA 5CYQA 1U48A 4FVMA 4RNMA 4FJ8A 4UAYA 2FPKA 4DF4A 3G10A 4MF8A 4I2CA 4LH4A 1CXUA 3VQ9A 1IG9A 5KT6A 4XQ8A 2BGGA 3KJVA 2HNYA 1RBVA 2FPLA 5J2BA 4DL4A 2PI4A 1FKPA 4F5OA 3K2PA 5L1IA 2XY6A 1HNIA 4I2HA 1LAWA 4QWCA 4E19A 4J9PA 4RNOA 3AVCA 1UAXA 1ZQLA 1TVAA 1G15A 4RUAA 4HTUA 1SL0A 1RT1A 2IOCA 1JLAA 5JUMA 2DFFA 5F9LA 7ICQA 2O4GA 1KLNA 3LP0A 5IIJA 1S1WA 3O3HA 2A1JB 2ZJ5A 4OJRA 4C8LA 1BQNA 1RYSA 5IIMA 4EYIB 2NRZA 3V1QA 4M3UA 3ISDA 2IMWP 3MDAA 3HPHA 4FZXC 2DPIA 1CEZA 3H4BA 3VQBA 4X5VA 3QO9A 1DGSA 2ZTEA 1IH7A 1BCMA 3AO1A 4E3SA 3RJKA 2HHUA 1O1WA 4RW6A 4KLSA 4PGXA 1RDCA 4QW9A 8ICZA 4NM1A 4IG3A 2IGIA 5HBMA 4Z6EA 3TANA 4CFDA 4FLZA 3ORYA 1COOA 3Q8SB 4O0IA 1XI1A 1NJZA 4JRQA 5DBCA 3HK2A 3SUOA 4YVZA 4CF9A 3SJJA 4M9HA 3HM9A 4CJUA 3K58A 1JLBA 4PA1A 1UA1A 3WNEA 4G3IA 1NK6A 4I27A 1X1PA 4QAGA 4DOBA 5L1LA 1H38A 3O4NA 4KLIA 3I0SA 4I2JA 4AHRA 3CFPA 3KHLA 5FROA 9ICQA 1UOCA 3H4DA 3L2UA 3RTVA 3RJHA 3C2MA 3DLHA 4MFFA 4Q0BA 1ZQJA 1ZQHA 4ED1A 2ZE2A 2ZUDA 3PV8A 3RJJA 4OGEA 4O5BA 1K1QA 1ZQZA 4DL7A 1U47A 4QZ8A 4W5TA 4KLDA 3Q8RB 3MFHA 2ZD1A 1HYVA 1YTUA 4XIUA 4JLHA 5C24A 4DEZA 1TK5A 4L8RB 4F5PA 3K57A 4PUOA 4I2QA 1W9HA 3ZT3A 1C0MA 5HRNA 3DLRA 4HHTA 3HL8A 3DM2A 7ICOA 9ICGA 3OYCA 2KFZA 2BCQA 4EP4A 2HHWA 2XY5A 2BCUA 2YHAA 1BL3A 3RBDA 4M47A 4Y1CA 3QEAZ 1JKHA 3KHGA 1S1VA 5KG5A 4O3SA 4ZTJA 1TK8A 4K4HA 1SL2A 4CHZA 9ICOA 2W9BA 1RBRA 3QEPA 2QKBA 5DBBA 3T3FA 3AU6A 4RQ8A 2HNZA 4LH5A 4AHVA 4B9LA 4EBEA 2IDOA 1N48A 4DG1A 1NK4A 5J2HA 4DTSA 4J9RA 1JLQA 2RPIA 4Q5VA 1WSJA 5KFSA 5L9XA 8ICRA 2HHVA 2G8WA 4NCBA 4I9QA 1VSIA 2ASJA 1RT4A 3QNNA 3HVTA 4YNQA 5DQIA 4EBCA 1N56A 4M45A 3SQ0A 3PW0A 1TGOA 4IQTA 1LW2A 4ED8A 4HCBA 1TKTA 2XO7A 3H40A 1KVAA 5EWEA 1NK5A 1A5XA 2G8VA 3M8RA 3CFOA 3K5NA 4N5SA 5CWRA 4QZHA 1VRUA 4ECYA 4MFBA 3OS2A 2OPPA 1JLEA 4N76A 2G8IA 1BPYA 3S3OA 5E41A 2OWOA 1QE1A 1HNVA 4R66A 2PY5A 4F92B 3CQ8A 3NH1A 3VQQA 2IC3A 2P51A 1FKOA 2ATLA 2WOMA 3DLGA 3M8SA 5J0OA 1BPBA 1KEJA 4CHPA 3ZCMA 5HHIA 2AQ0A 5KFWA 3E01A 4KTWA 3ZDCA 2VG5A 1D5AA 4I2PA 4GVMA 4CHOA 4R64A 3PY8A 1EKEA 2BPFA 2PYJA 3TQ1A 4KHNA 1ZBUA 4RQ0A 2NRVA 2G8UA 1V9PA 1S6PA 4OLAA 3RJFA 2F8SA 1LWCA 3RB4A 5KRTA 1S0NA 1LB2B 4M9GA 5KFKA 1BVSA 3JPRA 5KFGA 3OHAA 3DYAA 2D5RA 3NE6A 5KRSA 4BGDA 4N47A 1XSPA 2OA8A 4IRDA 4HUFA 4KN7A 3VQ5A 3ZDAA 4TUSA 5FRMA 4PH5A 4XRHA 4TQRA 3VA0A 1RT5A 2Z1JA 4DOAA 3PX4A 4LZDA 4I2DA 4RG8A 4R8UA 3ZT1A 4RUCA 4RQ6A 1S9EA 3LPUA 5CZ2A 1HUZA 9ICLA 4O5KA 1J5OA 3CYMA 3ZT2A 1HJRA 4QCLA 3GV8B 3SPYA 5DB9A 5J0SA 3QEBZ 4B8CA 1ZQSA 9ICTA 4FJMA 3TAFA 1XWLA 4PHDA 4CERA 3RR8A 1ZQMA 3U3YA 3ZSZA 1QQCA 3L2QA 2NRXA 3AA4A 4FM2A 1KDHA 2J6SA 9ICPA 3OS0A 2DFEA 4FW2A 4J9NA 3OHBA 2AQ4A 3FYHA 3SV4A 4OKJA 1CUKA 4DSEA 4J2DA 5KFXA 4N56A 4KHYA 3SNNA 4P4OA 4PHEA 5BOLA 3THVA 4E0DA 7ICJA 1S9FA 1ZQPA 4QZBA 4OGCA 1NK7A 3ZSOA 4DL2A 4GXIA 3GIMA 3OYNA 2FLNA 4IFVA 3RMDA 3V1RA 1B92A 2ZTCA 2MUTA 1TKXA 2F8TA 4CFBA 8ICMA 4IR1A 3LAKA 5KFPA 3VQDA 3EWAA 3T5LA 8ICVA 5KFIA 4F4KA 4CJFA 1S10A 1IXRA 2R8GA 3RMCA 1KCFA 5HRRA 2VWKA 1ZBFA 3V72A 4FLVA 2HHSA 1IKVA 2UVWA 4DOCA 4J2AA 1YVUA 1RDBA 3H08A 2X78A 1S1XA 3QIPA 1Z00A 4DTXA 3T5HA 2IBKA 4CK3A 1RTHA 2Z1GA 4FLWA 4UBBA 5KFAA 1A5WA 2NRWA 7ICPA 3ZSVA 4ZH4A 2AGPA 1ZQFA 3VQ7A 5K14A 1NKEA 2C2EA 4LSNA 1ZQNA 3H8JA 3DLBA 4F4XA 1VK0A 3EPGA 5KTQA 1IKYA 3MXMA 2PFPA 2BCSA 3C5FA 4MEYA 4KHQA 2C2DA 4DTOA 1XO1A 4CEBA 1D9FA 4JWNA 4DSFA 4KO0A 4W5OA 7ICSA 5J2AA 2P6RA 3QEWA 2OYQA 3SZ2A 4KB0A 1Z26A 4YN4A 4KB1A 1EP4A 4KHWA 4RT2A 4KTQA 3BDPA 2JGUA 3VQCA 2FC0A 5J2GA 1X9WA 4O9MA 1WN7A 3ZSQA 4FCYA 3MFIA 4P4PA 4YG2A 5KG0A 3UPQA 3JSMA 2NUBA 4DQSA 4IRKA 1S77D 3K5MA 2BQRA 3G6YA 2YNIA 5D46A 4I29A 4CFAA 1T8EA 4O55A 1L3TA 4YMOA 4YR0A 8ICEA 1RBUA 4R5PA 4KLGA 3N4MB 1SV5A 2Q3SA 3OYFA 4GC7A 3NGIA 8ICIA 3V7LA 1TKDA 1C6VA 3SYZA 4RU9A 4AH9A 3E2EA 3MEGA 1WAJA 1KVCA 4DFKA 8ICXA 1ZBLA 1B9DA 1ITGA 3NGDA 1QHTA 2JZBA 4LZGA 1JXEA 3N97B 3AO3A 1T3NA 3QETA 1J54A 4UB2A 3ISCA 3GV7B 3NDKA 3QEVA 3OYEA 2IAJA 3OYLA 8ICUA 3V6DA 4CJPA 3C94A 1ZQYA 7ICEA 2RF2A 2F96A 3ZT4A 4YQWA 4NLGA 5HNKA 2BQUA 4B9MA 4JV2A 1S0OA 2GV9A 1ZQXA 4F4YA 5KT4A 3S3MA 3PX0A 3RB3A 3MXIA 5IILA 3MXJA 5J2PA 4KHSA 2W9CA 1NOMA 4UAZA 3HO1A 2YV0X 3BQ1A 9ICKA 2DTUA 4KAZA 4C8NA 4EEYA 3KLGA 5IINA 1L3VA 3RMAA 5CP2A 1Z00B 3DRRA 1KFTA 5KG4A 3JPSA 5DDMA 4Z4CA 4B9SA 1NK8A 5KFVA 1XS9D 4E7KA 1X2IA 4CJTA 3IHQB 3AVJA 1JL2A 3MABA 1T05A 4FJHA 7ICFA 4ECSA 4QOZB 4DSIA 3RWUA 7ICRA 3C1YA 5J0TA 4RPXA 3OJSA 4DTNA 2W8KA 2VANA 5DDYA 1C1AA 2AJQA 8ICBA 2XY7A 3G0ZA 1QTMA 4FLXA 4I2IA 1DTTA 4M41A 2Y1JA 4KLHA 3C21A 4E7IA 4CEOA 8ICFA 1RT3A 1ZQCA 1JXBA 4CHQA 5KFNA 4CJSA 3JPNA 3ZD9A 4R63A 1NJXA 5SWMA 3GQCA 4FBUA 4EP5A 4ECZA 1ZQAA 1B9FA 1K6YA 1ZQEA 3LP1A 4YFKA 2ZJAA 1ZJNA 2ASDA 4JK1A 4M9NA 2GWSA 3ZDBA 3TARA 4ECUA 4ECWA 4ED2A 4IR9A 2W9CB 3MR3A 3OYIA 3KLEA 1ASWA 5CB1A 1Y88A 1ZQUA 1SKSA 4O3NA 2WTFA 2FBYA 3V9WA 9ICHA 3MR2A 4OKEA 3NH0A 3DRSA 2HW3A 4DQIA 1RTJA 3AVAA 3NBPA 1XHZA 4Z4FA 4BE1A 4W5RA 2KFNA 3C95A 4F93B 1WLJA 2MUTB 4ID5A 3AU2A 3LAMA 9ICMA 1SKRA 3DLEA 4FK2A 1C7YA 2QK9A 1HMVA 5HP1A 3H7IA 2DFLA 1WSIA 4M3YA 3AA5X 5J2DA 4J9KA 5KG6A 2BPGA 4C8OA 3Q8QB 2A1JA 2B5JA 1VSHA 1S0VA 3NF6A 4DMNA 3O3FA 4IQVA 2X6NA 4CCHA 3GIIA 4I28A 3OS1A 3TI0A 5J2NA 3LDAA 3M8QA 1KFSA 3UQ0A 2KW4A 4GLXA 4JV1A 2XHBA 3K5LA 3ULDA 4NYNA 2I5JA 3SCXA 3RBEA 3ETLA 1VSJA 4BDYA 4NY8A 9ICCA 1EXQA 4KREA 5J0QA 3IRXA 3WNGA 4CJ4A 2V9WA 3V9UA 4NXZA 3RAXA 5F9NA 3ZSRA 2BR0A 4KLEA 4KHUA 5CHGA 3V9XA 9ICWA 4B3OA 3L2VA 4I2BA 3ALYA 3S9HA 2I1QA 5J0WA 1TKZA 3K59A 5C5JA 5IIOA 1J53A 1NJYA 4ID1A 4P2HA 3U6FA 5DMRA 1R0AA 4FZYA 1CXQA 3LWMA 3UIQA 3SI6A 3VA3A 4J2EA 4B9NA 1F21A 3IM1A 4CJLA 3T1AA 4ECTA 1S1UA 2QXFA 1Y97A 4QZIA 4H4OA 3RRGA 4Q45A 3Q8LA 3MEDA 5JS1A 5KG3A 3S3NA 7ICHA 3KKSA 1TAQA 4BWJA 5FDLA 3IG1A 2R8KA 3DI6A 4NLKA 4KLUA 4MEXA 3HPGA 1LW0A 3AVMA 5DG7A 5J1EA 8ICCA 5I42A 4WE1A 3FDSA 4PGYA 5J0XA 3PR5B 2YKMA 1ZQOA 5D49A 3LP3A 9ICXA 1QLNA 1U04A 1TV9A 4IBNA 3GDXA 2BGWA 5KGWA 4CGFA 2ZUBA 1QS4A 4UB5A 4CJWA 4FJGA 5DLGA 4F3OA 1WSFA 3ZDDA 3VN5A 1BI4A 3VQ4A 2XRIA 1Z3EB 1VSKA 2ZUCA 4RW7A 5KG2A 2J6TA 5EWFA 3HJFA 3AVIA 1REVA 4E1NA 1HQEA 3CFRA 3EYZA 4IQUA 1JN3A 3RH5A 2YKNA 3AUOA 3V4IA 4DSJA 5J2KA 4AHSA 3TABA 3PUFA 4C8KA 1IM4A 2B4JA 5J2CA 3L3VA 8ICQA 5KT5A 3C2LA 4KRFA 4YCXA 4YXJA 2E4LA 4ED7A 1JX4A 3HX0A 5C42A 4M3WA 5KGXA 5HLFA 4PWDA 4BE0A 4O3QA 4ZHRA 2F1JA 3JPQA 2O4IA 1JXLA 2HVIA 3MR6A 3PVXA 2F1HA 8ICYA 4FJJA 4CGJA 1WCNA 3RH6A 1L3UA 4CESA 5J2MA 3G6VA 4YR3A 2B6AA 1RTDA 1JL1A 1KTQA 2B21A 4F4ZA 4FJ9A 4MF2A 2HVHA 1IKWA 4M3RA 4KI6A 3VQ6A 4FK4A 3C6TA 1AROP 4CECA 4UB3A 3NHGA 2W8LA 5KFRA 9ICSA 3V6HA 4J9SA 4M04A 3BQTA 3HXMA 8ICGA 3NFAA 4CF8A 1BGXT 3RJIA 1HPZA 3TAGA 2P5GA 4EBDA 1MU2A 5FRNA 4KFBA 4CJRA 4TSXA 3SUNA 4HUEA 3BQ0A 2Z1IA 4W5NA 3C1ZA 4J9QA 3PO5A 3WNHA 4J9MA 3EZ5A 4TQSA 2IS3A 3CM6A 2JEIA 4RW9A 1TFRA 2JEGA 2MAXA 2W9AA 5KT7A 5KFDA 3WNFA 1BIUA 3EY1A 3MR5A 4CGDA 3OYGA 1S9GA 5J2FA 1D8YA 5KFLA 1NKCA 1BPZA 2OPSA 7ICMA 1T7PA 3LWLA 4CEEA 1ZQGA 4P4MA 1DTQA 2Z1HA 4M9LA 3M9OB 3UXPA 1CZBA 3Q8MA 1S1TA 1NK0A 2FBXA 4EZ6A 2V4QA 3AA2A 4DTMA 2EHGA 2D0AA 3TR8A 4KV8A 1S5JA 3NF9A 4FJ7A 5KG7A 3EW9A 4BXOA 1VSDA 3SQ2A 3M9NB 2GBZA 8ICSA 4FW1A 1NK9A 1T4GA 3ISNC 1VRTA 2J6UA 3PMLA 2R8IA 4QWDA 4CJVA 3VQEA 3MEEA 1L5UA 1ZQDA 4DSLA 4CIEA 7ICIA 5T7BA 4RQ5A 2R7YA 2AU0A 4NLNA 3M8PA 4BWMA 5KFQA 9ICUA 2F1IA 2BE2A 4Z6CA 4LSLA 3V6JA 3AV9A 5HRPA 2RKIA 4K8XA 2HMIA 3HP9A 3RMBA 3SQ4A 5KFTA 1DLOA 5CYMA 3HVRA 4B08A 3KLHA 3KKRA 4FJLA 1W0HA 1S6QA 5J2JA 3AO4A 3IAYA 2HHTA 4DU1A 2P1JA 4QZ9A 3UXNA 5J2IA 2BANA 9ICIA 4I7FA 5TZVA 5HP4A 3HT3A 1GOBA 2R8HA 5DB7A 1NOZA 2YNGA 4HYKA 3V1OA 4J9LA 2UVUA 1ZBIA 4Y1DA 5CY4A 3TAMA 2VG6A 2OPQA 5I3UA 4CEFA 1PZNA 3ZSYA 2OZMA 4J9OA 5CR0A 1RTIA 4N41A 1BPDA 1C0UA 5HMLA 3LK9A 3PW4A 3HW8A 2ITGA 4FXDA 4FM1A 4PPXA 1RT6A 3T5KA 9ICJA 1UT5A 2VG7A 3PW2A 1ZQVA 1A5VA 2D0CA 3LANA 4IKFA 4R65A 2X6SA 5EU7A 4E7HA 3NF8A 3Q8KA 4MFCA 4NYFA 2GUIA 8ICKA 4I2FA 1RBTA 4KI4A 1S97A 3L8BA 5J0YA 1A77A 5DKWA 4YP3A 3RJEA 1TL1A 3P83D 1FK9A 2KQ2A 1LV5A 4DTUA 3U3GA 4F5QA 4ECQA 4YMNA 4NLZA 4I9LA 1DOQA 4Z4EA 3VQ8A 1MSWD 3BJYA 4DL5A 4RPYA 4DWIA 3L3UA 2RDJA 2X74A 3NGYA 1VSEA 4O3RA 3V7JA 2V4RA 4CF0A 4DLEA 4XUSA 5DBAA 4FZZA 3FFIA 3QESA 3K4GA 3HPOA 4CEDA 4LVSA 5J2QA 4DTRA 3QEXA 4CIGA 1TV6A 3TFSA 3DMJA 1ZQTA 1RT7A 4YR2A 4DQQA 1ZQWA 4PGQA 4O44A 3I8DA 4QW8A 4DL6A 4H8KA 3MGHA 2WONA 5CA7A 2XY8A 1CZ9A 2P5OA 4PY5A 1ASUA 4FLYA 1QSSA 4ELUA 3AVNA 2KN7A 5IIKA 3DLKA 3ZDEA 8ICLA 3QE9Y 4C8MA 1HRHA 1S0MA 3OYBA 4FK0A 1GOAA 3HSTB 1TK0A 1IO2A 2JEFA 1RDAA 5DGBA 4FS1A 2FBTA 2C22A 1ASVA 2YHBA 3OYMA 2JZBB 3T19A 1VSMA 3KHRA 2VA3A 4IRCA 2HHQA 1D9DA 1MQ3A 9ICFA 2D0BA 3SUQA 4K4IA 1BHLA 4IDKA 1WSGA 1RPLA 4UB4A 3PO4A 2FMSA 2XCAA 4O5EA 9ICEA 5HROA 1U45A 5KFEA 4DU3A 4HCCA 3H8WA 4DQPA 3OYKA 8ICOA 2G8FA 2H5XA 4M3XA 2W42A 3PX6A 1SUQA 4AHTA 4IQWA 1BCOA 3KK3A 3RH4A 2BPCA 3PNCA 4Z6DA 1EETA 3KK1A 4JUZA 4M2YA 3QERA 4DLGA 5DQGA 8ICNA 4KN4A 3BQ2A 4ELTA 1XSLA 3IS9A 4KMUA 4O3PA 4GXJA 1K1SA 5KFHA 4QWEA 3F9KA 1MC8A 1BI4B 4CIFA 5IIIA 1D8LA 4ZTFA 2LYHA 4JV0A 1WCLA 3KK2A 7ICVA 4TUQA 1JMSA 5KFZA 2PXIA 1RXVA 4DTJA 7ICKA 4CJ5A 4QWAA 3HWTA 3OSNA 4K4GA 2DY4A 4AILC 4Z4HA 4ELVA 4PHAA 3RR7A 2PFOA 4I2AA
chains in the Genus database with same CATH superfamily
3ZZUA 1N60A 2ASYA 4JV5J 3MAHA 5H1SQ 3ENWA 1Q9XA 3VF0B 4I6YA 4IFYA 2YX6A 4JYAK 3EZOA 1UT8A 2BBEA 4NZ6A 4KB7A 2R7TA 2VDHA 3C23A 1B0PA 4R79A 3MBYA 2Q0ZX 1NBEB 1SJRA 2LPEA 1N6QA 3N7PD 9ICRA 3OL6A 4C0BA 2RRDA 3T79A 3C65A 1HARA 3EWGA 3VCBA 2JEJA 2H1YA 3LP2A 4OLOA 2MHEA 3OYAA 1NH7A 3P31A 1J9AA 2BCVA 3TPQA 3CG7A 2F2AB 3V6KA 4USHA 2O01C 2IC3B 3KNGA 3AEVA 3LPEA 4JI6J 2QB0B 4ED5A 4OPKA 4W98A 2UXBK 4DV4J 2FJXA 1Z19A 2KTQA 1ATNA 4KLMA 2FMQA 3OVNA 3CPEA 4LFAF 5DG9A 3SDEB 3D2FB 4BR4A 4CDGA 4N8NA 1TL7A 2LFVA 1C0TB 1SPBP 2JGAA 2KZZA 3I0RA 4RNNA 3BREA 3S8SA 4CDIA 1B22A 1RDDA 5IQ6A 3QAEA 1RGVA 1S59A 8ICPA 1DQ8A 2HQIA 4QIWC 4PXDA 1I3OB 2QB0A 3FGVA 3GCWP 2AYBA 4Y2IA 5SZTA 1RLCL 4DFMA 4BQLA 3TSQA 4PQUA 3PJWA 2AJ1A 4MQ3A 4JI8F 3HRGA 1HD0A 3LOUA 2O8FB 5EOZA 1TL7B 3D0PA 5GADU 4E2FB 5D3GA 3IV6A 1FEEA 2IHMA 3C66A 2C28A 5AKXA 3S41A 3TVYA 3LF0A 1F0XA 2UXBJ 5KFMA 3WT0A 1HYZA 1HUOA 1QE1B 1T9XA 2DH7A 1L7MA 3MGJA 1ZH5A 1UWBA 3NRBA 4K4SA 1T9VA 4EWTA 1ZQBA 4BQZA 4FS2A 3SI8A 3LH2S 7ICNA 3JYTA 3C6UA 3ZETA 1IKXB 4ZP6A 5ALXA 3JSRA 3U9ZA 1YT3A 3FZ2A 3ISZA 4B1XB 2FBVA 2A1SA 1D8BA 4M0AA 3CCQN 5AQNA 2MQOA 3QEIA 3SENA 1I1GA 4GW6A 2ZWHA 1U6ZA 5KFOA 4TY8B 5H1SV 1S4FA 1VQMN 1PC4A 1BIZA 5AI6A 2R2SA 2CZ9A 2FZCB 5D77A 3CERA 2AJ2A 3RB0A 3DOKA 1JLEB 2NO4A 3OFEA 3JAMO 1ZM4A 3UN3A 3JS9A 1COKA 2XSJB 5IT9O 2ZKTA 3CIZA 3AA8A 2F77X 5AI5A 2FPHX 4B3TF 1Q9YA 4B9TA 4YB5A 1YRTA 3CDBA 4J8FA 3DXMA 2LCWA 3WIUA 2OPRA 4CO4A 3I33A 3DLGB 4QWBA 2XMKA 4WP8A 4E1MA 4TUPA 3Q83A 2DNZA 2LDYA 2RMLA 2E2OA 1OQ3A 4O4GA 3RSEA 1PYTA 5D4BA 4OI1A 1ZQIA 1RILA 4IDHA 3C2KA 2CAJA 3K17A 3CC7S 4BRMA 3IAS9 2ZGZA 5DG8A 4JB8B 4BDZA 4O3OA 1K0VA 2HLUA 3L3FX 1QSLA 2YNHA 1QUPA 2BZ2A 1FDAA 2W2MP 1WD6A 4HUGA 2OPRB 3AGKA 5BR8K 4UB6U 1LFWA 3UVJB 2G0JA 1GLFO 4B1VA 4ES3A 1GQEA 2OPQB 5KAKA 4QPXA 4DPTA 5B5EU 2G5IB 1YZ7A 2CPXA 1RHKB 3HJVA 2XGQA 3QNMA 1SQKA 4KH5A 4HVJA 3RFAA 1K73T 4Z6FA 1U1OA 3FGUA 4O3MA 3OGUA 3HP6A 3U7JA 5EGYA 4FLTA 4KGXB 3GZ7A 5TKWA 2KD1A 3NRWA 3TTCA 1WEXA 2Y0SF 3AGRA 2ISOA 4PHTX 1WHYA 3KKAA 5GMDA 1BPEA 1WKJA 2QARB 2VJUA 2GUPA 2I5JB 1TMJA 4FM0A 1BQMB 2HIQA 5C25A 4OPJA 2EFVA 2B56A 4YY3F 1H3DA 1QH9A 1SZPA 1IBKK 4LF7K 1RXWA 1X7VA 2CRXA 3PIPQ 4Q8FA 1VQ7S 4RU2A 3BB5A 4FJKA 2VGNA 4V1Ak 4H4MA 2HGMA 2H4YB 1NDLA 2X1BA 4EFHA 3IAM9 5DB8A 3O4QA 4IG0B 1FDBA 2MEWA 2K8BB 3GL1A 2P8IA 3P5JA 1IIPA 3CO9A 2VDIA 2CWXA 3GSDA 2M9NA 2AYEA 4QIGA 5AQFA 3C14B 1U6FA 3AAQA 3KD5E 5IWAK 3KTQA 1RDRA 3CC4S 5J0PA 1YIJN 1D4XA 3Q8PB 4EO6A 2J7KA 2YKAA 2UUCJ 4DFJA 2FLOA 3L2RA 2HBMA 1JLGA 3O1WA 3C15A 1PIEA 2OPSB 1FXXA 5DB6A 5ETNA 3BY5A 1FIQA 2AHOB 3B4MA 4ECVA 2L9DA 3JAMU 2HWIA 2CPRA 5AM5A 5L1MA 3TWHA 5DM7L 2ZH8A 1SV4A 4ICLA 5F1XA 2OZSA 2LXUA 3DXMB 4P0PB 2N1RA 3HHDA 4DU8A 2OSQA 3H3OB 3ZSWA 5CZ1A 1I39A 3ENOA 4NEYA 2HIYA 3AO5A 2XCPA 1GLCG 2MLXA 3O80A 3V9ZA 4A8QA 1MQ2A 4KT0C 5A6WA 4EGLA 1U02A 3THWA 2Y9UA 3QSIA 1VQSA 1H98A 3CM5A 4QZAA 1L3KA 3QQCD 3UO0A 4ZVSB 1ZBHA 4IG0A 2P9EA 3OJUA 4O5CA 4M42A 4CJEA 5HL7L 4DV3J 4B02A 3BS9A 1Q8IA 4RBUA 3G6ES 9ICVA 4M6WA 3SUPA 5AJ3F 3Q8UA 1JLFA 2GX8A 5KT3A 5AKLA 1F3VA 2F3NA 3HFVA 2CJXB 1VAZA 1FO4A 3I4HX 2RHKA 3Q89A 4DCHA 4CJKA 3D54A 4KPYA 3RYLA 1L8LA 3EZUA 3X1LB 4IOAL 2BABA 2RKIB 3QDKA 5KFUA 1Q53A 1NI3A 2I0XA 2Q0RA 4RQ7A 4CZHA 3AO2A 4H5RA 2GIFA 5BN8A 1RQ0A 4PAAA 4KH6A 4M6WB 4DFPA 2QKQA 3JPPA 3FZBA 4OZ5A 3HVWA 3W65A 1URRA 2VA2A 4H0VB 4E89A 5DGAA 4G65A 5BRFA 1RT2B 1Z25A 2MQMA 1RWVB 2IM0A 1ZYQA 1ED1A 2P9KB 4LIRA 1VQ9N 1LXJA 3ETOA 4F04B 1T03A 3W8GA 3QBXA 2KHVA 3LDPA 5L1JA 1LXNA 2YXLA 1NU4A 1J5OB 1SJFA 1YJWS 1YJNS 2GIQA 2GHPA 4CGIA 1JXVA 4JS5A 1A76A 2PMZF 3O9QA 2ASLA 1AUSL 1WAFA 3BSNA 2CPFA 1DURA 1FKAF 1X9MA 1IBKJ 4LRDA 2JFKA 3GU0A 4RW8A 4OVLA 1UW4A 3TA1A 1XERA 1IV0A 3LM9A 1TAMA 3I28A 4Y65A 3V7KA 4IG3B 4BLGA 3TAEA 2QX0A 2W9BB 8ICJA 1XR5A 2K1RA 1RKIA 5CYQA 1N33J 2DHSA 3WX8A 3ZNJ1 2WF6A 4A5AA 3OTQA 4RNMA 2E1ZA 2ZITA 1SC4B 4I2CA 1UHUA 2QC3A 4LH4A 1Q81T 3KJVA 3C29A 1ITPA 2WB1C 1FKPA 4WWSA 3KK3B 3A5OC 1BD6A 4I2HA 4QWCA 5DM7Q 4E19A 2GVZA 1OJ4A 3FC4A 2ROEA 3SMZA 3R5DA 3D6MB 1CQMA 2V34A 2NXUA 1YKWA 1FWPA 1SL0A 1RAAB 5AI9A 3IG8A 1WOQA 4Q7AA 4WFBQ 5F9LA 2IMOA 1GEHA 4FWRA 3H2UB 2KT5A 4MKAA 5IIMA 4C4TA 5IT9U 2MZSA 4NXNJ 2Q31A 4M3UA 3LGMA 1I94F 4FZXC 1D0EA 3J81O 1TKZB 3ZO7A 3W2WA 2QV6A 2FHOB 5J2NB 3UFCX 3AO1A 2H54B 3RJKA 5HK4A 1OPIA 2F8EX 2HHUA 3DXSX 3ILOA 3GJTB 4BGBA 5AKIA 4KLSA 3ZC4A 4PGXA 1RDCA 4NM1A 1NJIO 1Z4NA 3AL0B 5ALVA 3BM7A 3M8PB 3M8YA 4FLZA 1S1UB 3CDWA 4DR4F 4AQYJ 2HFOA 2VF3A 4Q0BB 1NJZA 1VR6A 2Q1LA 1VC5A 1RTZA 4M9HA 4HR2A 2DGXA 4CJUA 1X6JA 4IZ9A 3JXOA 4DUZJ 3WNEA 4NASA 1S6PB 3G2XA 1QVFM 5L1LA 1H38A 1X9JA 1KQQA 3TTDA 4DR3K 3W7BA 2XVTA 1C1CB 3HI9A 2RE2A 3KHLA 4JI4K 5FROA 2QEXS 2K06A 1UOCA 3QB0A 4DV0F 3H4DA 2CVEA 7AT1B 3EE8A 1RACB 4M7XA 3C2MA 2KHCA 3DLHA 2XMTA 3EGVA 4CO5A 2ZE2A 4LF9F 3UE5A 2OEJA 4B1WB 4O5BA 3THYB 2XLKA 5M1FA 4YY3K 1MWMA 2RAQA 4W5TA 2B8PA 3Q8RB 1YGYA 3MWBA 1WSRA 2WHOA 2JR5A 5C24A 2DKXA 4DEZA 1FESA 1JJ2M 4ZP7A 3M8QB 5HRNA 3H1VX 4CNZA 1NNEA 4HHTA 4QU6A 7ICOA 2QEXN 2KFZA 2HHWA 5KAIU 2CPIA 2BX6A 3A8KA 2RUGA 2BVZA 4X4VA 4NPOA 1TK8A 2QWNA 2FVCA 3QEPA 1FFVA 4ER8A 3MCMA 2Y8WA 4WYLA 2CZ4A 3G9CA 3L7OA 3HM8A 2OYYA 1BUXA 3AFGA 5DDRC 1KP6A 3R7BB 1NK4A 3C19A 1LCUA 2W2NP 5J2HA 1EAYC 3CXCM 2RPIA 4V19S 4QIWF 5L9XA 2J76E 2CQ0A 2OAUA 1KQKA 4UASA 1KTVA 4NXNK 4I9QA 2ASJA 1XNSA 3A3PB 1RT4A 3QNNA 5B0CA 2IOHA 4UZBA 4EBCA 2C3PA 1ZM9A 4OI3A 1M1KT 1QZ5A 3KD3A 2C2KB 2RVJA 1REGX 2XO7A 2CADA 3OD2A 3VF4A 2D1CA 3Q23A 2K60A 4ERDA 1A5XA 2G8VA 4DHYA 4BG8A 1NGEA 4I64A 3K5NA 4N5SA 1S9EB 3E8OA 4LVNP 1OVQA 4FWPA 3H59A 1S1XB 3SD7A 5E2QA 5I9EB 2O8EB 4N76A 3N7RC 5B0BA 4ID8A 3FZFA 3S3OA 4X65K 2OWOA 5IS2A 2N7YA 4X84A 2AYGA 3ALRA 5ALMA 4R66A 4JI5J 3M6GA 2PY5A 2YQ1A 2V67A 3VQQA 2P51A 5ADXH 1YJWN 1KEJA 1BDGA 1HNIB 4YOVA 4ILRA 1WB9A 1DY3A 1R8HA 3E01A 4Y2VA 3SAGA 4I2PA 4UZCA 5D78A 4GVMA 4LF8J 5F41A 1RHMB 3A5NC 4JKFA 4YY3J 1EKEA 2OUGA 3SCJE 1PJ7A 4KHNA 1LWFB 4Y2UA 4YN3B 4LQ9A 4BC2A 3RJFA 1S0NA 5F3TA 5ETQA 2EPIA 1PVRA 3BP8A 5KFKA 3JPRA 5KFGA 2YWGA 2E8NA 3T6JA 3I5CA 3NE6A 5KRSA 3ZLJA 4Y2RA 4BGDA 2OA8A 2CGLA 3KHYA 1HQEB 4KN7A 3WXKA 3GTYX 3ZDAA 2IYGA 2FHMA 3VEZA 3MN7A 4WFNL 2J9DA 3ENVA 3OW2R 3PX4A 3ID8A 4B1UB 4RG8A 3D2NA 3ULEA 1MNEA 3NMUA 4RQ6A 5JVGL 2HS3A 5CZ2A 2V6AA 2JDJA 1J97A 3CYMA 4R0JA 1T44A 3HHKA 2LMIA 3ZT2A 3GV8B 3VALA 3KFUF 5J0SA 4CP5A 2GO8A 2R7QA 4CERA 4I6AA 1ZQMA 3U3YA 3CI5A 4QIWD 4USMA 3ZSZA 1QQCA 1EJ7L 2J6SA 2DFEA 3L3CA 1IUJA 2YNHB 1RA6A 3AOCA 1IBMF 4AM7A 2DKOB 3VR1A 3WKBA 2PMWA 3MECB 1HBNA 3TX8A 3TSPA 4KHYA 1UVIA 3N6MA 2DNNA 2KVQE 4DR7F 2ERRA 1F9FA 4FF1A 4QZBA 2ZM6F 2UXCJ 4OGCA 4CZKA 3THXB 5AQMA 3GIMA 1P6TA 2O8CB 2C3MA 2RILA 3OYNA 4IFVA 4NLPA 2ADCA 2ZTCA 3DN9A 3F2DA 3R6MA 8ICMA 2ZIWA 4NLOA 1SCJB 2D3ZA 2MZRA 1D3WA 4KH0B 5B0GA 4BCAA 2ZIVA 3LAKA 3VCDA 3ILIA 3GR1A 3T5LA 8ICVA 2ACMA 5FLXU 4CW7B 2JFDA 2E1MC 1PKUA 2R8GA 2GQ2A 1RDUA 3RMCA 2YNIB 3JQKA 4FWKA 1N36F 2ZOMA 3FZKA 4FLVA 1OSCA 1OH5A 1ZD2P 1YTYA 1IKVA 3BQ7A 4DOCA 3FQKA 2QN6B 2G1HA 2P6SA 3CE8A 4LF7F 4BC7A 3QIPA 1SZ2A 2ZVIA 3KG4A 1RTHA 1NDCA 3FJ2A 5E79U 3ET6B 4LQ3A 2NRWA 1NG9A 2AGPA 3R1HA 4X4UA 5DDOC 4HACA 1VK0A 2DHAA 4CT9A 4RW6B 2XWXA 5KTQA 3MXMA 4CTAA 2NO5A 4K4YA 1F5AA 3EMTA 2SXLA 1D9FA 4C3MA 4DN9A 2P6RA 3QEWA 4PZNA 3MCAB 4LF9K 3SZ2A 2LQ5A 1Z26A 5L9NA 3SCIE 4YN4A 2MJUA 4KB1A 4KHWA 2VIHA 5AE3A 4MH8A 4USKA 2V4JB 2NSCA 3BDPA 2JGUA 1SJ3P 4XH4A 1L7NA 3JSYA 3MFIA 1RU1A 4NYPA 3N0VA 1MA9B 4C23A 4EHTA 3UPQA 4C9DA 1EIYB 5F3ZA 2R7XA 5E3AA 3G6YA 4K8RA 2NZCA 4QR2A 5D46A 2C42A 4YR0A 8ICEA 4FYVB 2QW9A 2DPNA 2ZHBA 1DFDA 8ICIA 3V7LA 3I6PA 5H9FK 1WOOA 2VFRA 2UV8G 1FXRA 1NAQA 3MEGA 3NNAA 3WK4A 1KVCA 3A0BU 4OX6A 4BUGA 2G2OA 5A8KA 1UFLA 3EE3A 4NO7A 3Q7CA 1W2BR 2F7TA 1MG7A 1QHTA 2JZBA 4ITSA 4J37A 2XZWA 3N97B 1SH2A 4N7TA 3QETA 4UB2A 1WG1A 3QEVA 5ETRA 5LMUF 3OR1B 3B82A 5F8JA 3TADC 3O4WA 3DDIA 1NGBA 3ZT4A 1TMMA 4YQWA 4E1JA 4B9MA 4JV2A 3UKRA 1M1KO 1NBWA 3H5YA 1CPZA 2O6KA 2Z8QA 2QLXA 2EAMA 3RB3A 3EN9A 2BTFA 4KHSA 1RT7B 2MQNA 3UE2A 2VJ5A 5CH7B 3HO1A 1IR1A 3LPYA 3W5YA 1L3VA 3DRRA 3SJHA 1X5SA 3TZWA 4DR2K 5J2MB 5DDMA 1SKUB 4Z4CA 1N36K 2F76X 4B9SA 2A2CA 1SS6A 5KFVA 2C2ZB 4IO1A 1FJ7A 5IT4A 3CD6S 2FGCA 5THWA 4K59A 2FHJD 2UUBJ 7ICFA 4ZPTR 5LSLA 3OJSA 4ZCMA 1NSKL 4ES1A 1E6YA 2X1AA 2VANA 5DDYA 4HL9A 2P9LB 1ZXOA 1C1AA 4BRAA 1RDWX 4BREA 2RQ4A 1FCAA 1FXDA 2MSSA 2B4UA 3SBTA 4P9SA 2HQ3A 5IT0A 3VEYA 2VHGA 4FDFA 4H0OA 4KLHA 2LM1A 1E6VB 2Q36A 2CPDA 2FDRA 1RT3A 3HKZC 1ZQCA 2ITMA 1J6ZA 2RQKA 4CJSA 5ADXA 4USVA 3EJMA 1QAXA 2GOLA 4WP3A 3GQCA 4EP5A 4JI0K 1EETB 5T7LB 3OHRA 1K6YA 4JI5F 3LP1A 1Q4RA 4YFKA 3H6EA 2UUWA 4M9NA 1JWWA 4UOHA 1GH8A 1KNZA 1HFEL 4LBHA 2B7CB 2VYPA 5D4PA 4FN5A 3TTFA 3QT5A 4O3NA 2FBYA 2MZTA 9ICHA 2BRLA 1HEKA 3AVAA 4CZLA 1SZHA 1IKYB 1WSVA 4Z4FA 3W2VB 4RW7B 5B0FA 4IWVA 3RGIA 4R5PB 1RXOB 3C95A 3C6TB 3FAHA 4PRFA 2RU3A 2MUTB 1Y3JA 4URQU 3AU2A 1Q81O 3Q22A 2EC0A 5ALGA 4Y2XA 1SKRA 1GMWD 2AD9A 1HKGA 4FK2A 5DJBA 4F36A 1HMVA 4C7YA 5KG6A 3SEIA 2EG2A 3POTA 3VAHA 2BMBA 1S0VA 2DO4A 5HVFA 3O3FA 4IQVA 4CCHA 2QA4S 3Q8VA 2Z7JA 4UW2A 1QJHA 1P8GA 2QLJB 2AXTU 2K7JA 3TVZA 3D7EO 3UQ0A 2KXNB 1BU6O 2KW4A 4GLXA 1LWXA 3T41A 4Y2JA 2XS5A 2XHBA 2HNDB 2Y0SD 1GLBG 3FC9A 1NZPA 3IM8A 1VSJA 5U47A 3G71N 4NY8A 2M88A 5A0LA 3OXLA 5J0QA 4QR0A 3WNGA 3QX7A 3I0SB 5F9NA 4IJAA 4A2AA 2UYTA 2KH9A 2KT3A 2Y1RI 4JI6F 2RLTA 4IFEA 1M1GA 1X5PA 4ANCA 5L46A 1ELOA 2UUTA 3VEWA 4B3OA 3L2VA 4I2BA 4QQBA 3S9HA 2I1QA 5J0WA 3ISND 2IIHA 1IBLJ 5IIOA 3IDWA 2CUYA 2V8DA 2HK3A 4P2SA 5C2DA 1P90A 2LHTA 4LSZB 5FLXO 1R0AA 5DMRA 2PSZA 3GYNA 3LW5C 3UIQA 5AI4A 1RZMA 3QFHA 3SI6A 2ROGA 1M0SA 4FSVA 4B9NA 3WKCA 3IM1A 2CQ4A 4CJLA 1Y00A 3T1AA 5CXTA 2CXYA 4X64J 1NPPA 1Y97A 3R6LB 4ZP8A 2C3UA 1CI4A 5KG3A 1SQGA 2HFSA 4J9UE 3S3NA 1KN5A 4CO1A 5AR0A 2BKPA 4NZ0A 3N6LA 2QLBB 5FDLA 3CTRA 4JEPA 2R8KA 5D6GA 3D3BJ 4KLUA 1KKXA 4LC9B 5ETOA 3OXGA 1EP4B 5I42A 1HKBA 1X9XA 2ZBCA 3MM7B 4WE1A 4USUA 4J91A 5ETVA 3PR5B 3FCWA 1FEZA 1ZQOA 1FO1A 2GH1A 3NG8A 4WXWA 1QLNA 1B0TA 1U04A 1VRTB 2BGWA 2A41A 2H3QA 3EDQB 4ZJLA 4UB5A 4N77A 2PMZD 4RTFD 1BO5O 2WF8A 2DR6A 3ZDDA 1BI4A 1KEKA 4BRKA 4X4SA 2NRRA 1VSKA 2ZUCA 3BDEA 1WDDA 2YHXA 3MPVA 2ZH7A 5AKZA 2J6TA 1KC8O 3MWPA 1EQYA 3QFUA 2G09A 2HHPA 3HJFA 5FPNA 2EK1A 4IQUA 1JN3A 2HWTA 3RH5A 3AUOA 5HR7A 4DV3K 4AHSA 3TABA 1OY9A 3I9ZA 2HPUA 5K4LA 1YHQN 4U7CA 4ZJOA 5MLCQ 1DRGA 3L3VA 4RNFA 3CD5A 1R0AB 3H42A 1JLAB 5K8OA 4C3KA 2AP6A 5HLFA 3BZKA 2BW7A 3DCAA 3BF1A 2OHDA 2F1JA 2HMPA 2O4IA 1JXLA 3CCRN 4BR9A 2EXUA 3IG5A 2G9OA 4GV3A 3RH6A 1L3UA 5JJBA 2IVPA 3CXCR 1KTQA 3MGVA 1WELA 3TJAA 5GAGP 2YMPA 2HVHA 4QIVA 4DR4J 3VQ6A 4FK4A 4A8YA 1N4LA 4QNLA 2HHHJ 3CJ9A 3ZTSA 4RPFA 2P9GA 5KPRA 3CCSN 1W97L 4M5IA 5KFRA 4J9SA 3KUGA 1V9OA 4M04A 4P74A 4U67Q 3HXMA 2GZOA 3H7HB 4B3RK 4F25A 4CJRA 1WG5A 2LQJA 4OYZA 1GLEG 3SUNA 4K4UA 3KXDA 5K8PA 4M95A 4GKKF 4Y0WA 3DLLQ 3PO5A 2DNMA 3ULEB 4TQSA 3H8MA 2JEGA 4RW9A 5KFDA 1BIUA 4AL6A 2IIRA 2AZ1A 2XQCA 2EQYA 1NKCA 2V51B 4MYUA 5HVGA 1ZQGA 2Z1HA 5HOOA 3PZPA 1FNOA 2GHWA 1TV6B 2ZZTA 3DRSB 1CJTB 1X4EA 1TUGB 5GVQA 4LFBF 1S5JA 1GFWB 1CG2A 2YB4A 3HOTA 5HMWA 4P10A 4CLZA 2BW2A 5HR6A 2MLZA 3VHQA 5E3QA 1HX1A 4CZMA 3M9NB 4LF8F 1FT8A 1VK3A 4P7VA 3MX2A 3ISNC 3EGWB 1SC1B 3PMLA 4QWDA 2VASA 3MEEA 5BYSA 1L5UA 2LM4A 2KE7A 5HSPA 4CIEA 3BEXA 2AU0A 2N82B 2UUCF 2GIRA 9ICUA 2J9DE 2KJ5A 4FZNA 3QIDA 3MK6A 3L4QA 3MD3A 2ZH1A 3VMFB 2HMIA 3UPFA 3SQIA 3N6NA 3RMBA 3A3OB 2JL9A 5KFTA 3A3NB 1DLOA 5CYMA 2NS1B 1JCEA 2QL9B 4OX9K 5KL8B 2YMLA 3BN7A 4B3SK 1W0HA 1PYOB 1SH3A 2ZZMA 3IAYA 2YWHA 2HHTA 4DPUA 2ZWPA 4ANEA 1JNZB 2MQ8A 2VQFK 4ALZA 5DB7A 3HI0A 3V1OA 3SBMA 4H5VA 4HH0A 3IC1A 2P9LA 2JC1A 1LW0B 5I3UA 4CEFA 1PZNA 1JCFA 3ZSYA 2W2QP 1J5EK 1C0UA 3CHWA 4C3LA 3PW4A 3W3SA 4FXDA 1BG3A 3HULA 2OTJN 1WWUA 2QTWA 2HQGA 1UT5A 2Q66A 1VJ5A 2ZBIA 2D0CA 3VEVA 5ETMA 4B3RJ 3WXJA 1GTEA 2IJFA 4E7HA 3NF8A 3Q8KA 4MFCA 8ICKA 4DUYF 4I2FA 1RBTA 3L8BA 5E7OB 5DKWA 1YI2S 4X4OA 1H1VA 2HHHK 3QGPA 3OTEA 4DTUA 2H3VA 2R2TA 2VODA 3BV8A 4UB8U 4PYDA 1KQSR 1X8DA 4G1QB 4Z4EA 4K0KF 5AJ3J 2HBJA 1G1XA 1DK2A 1MU2B 4X64K 3PTWA 4USWA 2WTUA 1VIXA 2Q43A 4O3RA 1QTNB 4CF0A 5KOWA 2HQFA 4XUSA 4OQJA 3IM9A 1RWMB 3K4GA 4CEDA 4ICAA 2NZ4A 3CC4N 3E51A 4NWBA 3U1LA 1BWVA 2DKZA 1IN0A 1Q95G 4XDCA 1K9MO 3AY9A 3AJ2A 4DR5J 1S5ZA 3I56N 1TELA 2NXCA 3I8DA 4DL6A 2BOAA 1CZ9A 4CF4A 4KHPJ 4KJIA 1CQNA 4ELUA 3GG0A 1CJKA 5HROB 1UETA 3ZDEA 2A1AA 1YITS 1FF2A 1TFYA 3OYBA 3J7AN 1V3SA 2CIMA 5DGBA 3O6WA 3V4IB 3NMAA 2QYCA 2CZVC 3D2EB 3BPSP 2B8QA 3OYMA 2MQQA 1IJEB 4HHHA 2EDUA 2JXJA 3PSPA 2ZWOA 5M2PA 1Q86O 2KHOA 2D41A 2NNWA 3UNYA 4IRCA 2HHQA 1D9DA 1S49A 1AUDA 1HNZK 2QWLA 3SUQA 1N36J 2B0CA 3PO4A 1BMQB 4O5EA 9ICEA 5HROA 4JI3K 2RF2B 3JTNA 2QL7B 1M5KC 2G8FA 4M3XA 1F5BA 1R8PA 1Y5NB 4WFYA 3QUQA 3E0FA 1XMQK 3KK3A 1KQFB 3RH4A 2BPCA 1HBUB 2FYXA 4JD2A 3QERA 8ICNA 5AXMA 1NH8A 1KC8T 4ELTA 1XSLA 1RAHB 3MWTA 1FKOB 1RADB 4WFBL 4O3PA 1K1SA 3BSAA 3IR6B 1BI4B 5JLFA 1QVFR 1MWZA 2DEIA 4PXEA 4Y6IA 3KK2A 2QB1A 4NI2A 1QCKA 2PXIA 1RXVA 3G4SN 3CCEN 4B1YB 4LSLB 7ICKA 4DR5F 3M2RB 3G6EN 2EEYA 1XNQF 1ECWA 4ELVA 4PHAA 2PFOA 3ZT0A 2ZC4A 1W26A 4OYIA 2VL1A 4JI7J 3QZ7A 3K89A 4KBIA 1H0HB 4P72A 4O5FA 1SL1A 2UZAA 1LW2B 1VQON 2DNGA 4ZCKA 5C10A 4KLTA 2NZTA 3MM8A 3QSYB 2MKKA 1MMNA 3NAEA 3TAMB 4KHPF 1S1TB 1NOYA 5CCMA 1RAFB 2C2RA 4PG7A 2RDIA 5F8GA 5AKJA 4GC6A 3H0RB 4L6V3 9RUBA 1OVYA 1KN6A 1PVPA 3WU2U 2M52A 4DV1F 3AVFA 3FM9A 2E8MA 1N5QA 5ALQA 3UQ2A 3MMBA 2FMPA 2VKZG 4IXCA 5KG1A 4C4RA 4RNHA 3MM5B 5DK5A 2UXCK 3ZFVA 3B9JA 3PR4A 1G7CB 3H3NO 1YZ6A 4Y2AA 3LDSA 3D45A 3LPTA 3B6BA 2HMIB 2P9PB 5KAFU 2QMXA 3VVUA 4KGKA 1BLUA 4DN0A 3KG0A 1I3AA 4YD2A 3W66A 1Z1BA 3I32A 5AFUH 4QJFB 2DCLA 3I9V9 2PYLA 1XHXA 4AYBD 1N0UA 5ALLA 1K8AT 3JPTA 2WOMB 1EKRA 3F0NA 4Y28C 3M32B 5HRSA 5J0RA 1Q8KA 3C8YA 4FXVA 3ILLA 1TUVA 4JI2K 1OPZA 4ZOSA 2E7VA 4L72B 3H45C 1X9SA 5D0GA 4NCAA 2ZIXB 4DS4A 3C28A 4W5QA 3ZTRA 1JK9B 3D6RA 3RRKA 1APSA 4K41A 2M7SA 1VI7A 2R7RA 1X40A 2ZH5A 2KKVA 2HG4A 3L4BC 4CEAA 4CO0A 4I2PB 2R2UA 2DD8S 5J1PA 2MJNA 4ZVUB 4BRFA 8ICWA 1U2RA 2VICA 2CDQA 4DR6K 4WFAQ 3KLIB 2LEPA 2HGNA 4CE9A 2UUBF 3F56A 1SIZA 2GMHA 4K5SA 1BHNA 1UW9A 3K8WA 1XU4A 2PGCA 1JMTA 1N33F 3IWNC 1B7YB 3VGTA 3M9MB 5L1KA 4ENOA 4RW8B 4PZOA 5EWGA 3O3LA 1CULB 4BX9C 3ISBA 3W2WB 4FZLA 2E8OA 3H8YA 2HQDA 5A8WB 3DOLA 1I94K 1XSNA 3CJAA 2PT0A 2YHWA 2UV8A 4C2MA 3LDLA 3S1TA 2QSFA 4NL9A 3PW7A 4KX5A 3QZ8A 2YNFA 3QGGA 2H3IA 4FWLA 3LP2B 4B9UA 4RPZA 1ZPVA 2OI2A 3KDOA 4OO1J 3QRPA 7ICUA 4F8RA 3EUB2 2B6AB 3WXMB 1VQ4N 1LFPA 1X4HA 2VBXA 4Q44A 4UB1A 2X3GA 2Y0BB 4Q43A 4E8UA 1V38A 2NYHA 1H74A 3AVBA 4FWMA 3MC1A 1RZTA 1JALA 2GHVC 4JKHA 1X66A 1CJVA 4UUWA 4FBTA 2M8DB 9ICAA 1VHIA 2E44A 5EN1A 3CJRA 2LSNA 4BC9A 1J2NA 5I3PA 2U2FA 2PA8D 5ALWA 3THYA 2AJFE 1YRXA 3TZYA 3ILJA 2YCHA 1T3OA 2OJ3A 2E5IA 2JRSA 4DO9A 2KZ3A 1SXLA 2DO0A 4F5NA 2R8JA 3LL3A 2O8BB 1ZXIA 4IJNA 2Y1IA 1CLQA 1X5TA 1CVJA 3K8VA 4YOYA 3TA2A 3SQOP 3DFEA 1A0PA 3QATA 1AZSA 1KOOA 3Q7BA 3K75D 1NGAA 1FFGB 5AM0A 1PO6A 4UF4A 3SV3A 3AA3A 5CHIA 3WBZA 3FEYB 1XC3A 5ELZA 1NZAA 4ES2A 2L5YA 3PXGa 1JQGA 2KZMA 5T41A 4MKVA 3G87A 2QRRA 7ICGA 1EHWA 3JTOA 4UAUA 3DKDA 1XNQK 3NOGA 5F2RA 2UUBK 2YWKA 3RW7A 4OLBA 2BH1A 2XSFA 1EX4A 4U67L 2HNZB 4OJHA 2Q1NA 2Q6CA 1KOHA 3TJ8A 2Q3PA 4FOIA 4NOHA 3IBCB 4RQ4A 4WKRA 2H9ZA 3LALA 3THPA 3SQ1A 2E8PA 4X62F 4XPCA 4DV2F 3UW1A 2NYVA 5J29A 2CJAA 4F50A 2DHXA 1KSPA 3DRPA 3IP0A 2XHCA 1MLAA 2XZTB 2XSJA 2B6GA 2QZ8A 3SPZA 3UD3P 3VGSA 1YUWA 2ISPA 3NVMA 1PAUB 3J80U 5M1NA 3O08A 4IH6A 1M6YA 4LFBJ 4PEOA 2A1RA 3HOSA 3UI3A 4X4TA 1XJWB 2HZVA 1N5TA 2A40A 5GAEP 2PZSA 4RBTA 3P4UB 4B3TJ 3CMEN 3GFKB 1A6LA 4CF2A 1TZ0A 2DRBA 3CCJN 3N7SC 4J7CA 3MUMP 1WNSA 3CNQP 3LZIA 3U8XA 5RUBA 3MDCA 3V81A 2KHQA 2R7SA 2R4FA 4OFZA 3O8MA 2PEBA 3T69A 5H9EJ 3ASMA 2BCRA 2WBMA 3VGLA 3VETA 4J2BA 1Q78A 3M6WA 4DR3J 5DLFA 4PXBA 1T95A 5D3GB 1TKTB 2LU2A 3C16B 2CPEA 1WSHA 1EQ0A 1NSQA 2EX3A 3C15B 4FO6A 2F1FA 2A18A 4FJXA 1SQFA 2JNJA 4V19X 4BE2A 4OHVA 4ECRA 3OYHA 2MTLA 2KM8B 4HT7A 2BKEA 3H2VE 4URSA 3KIOA 3CGIA 3MZIA 3FR0A 1FX4A 4WIIA 2VKQA 1EXNA 3WHIA 2E1FA 5KFYA 4CIOA 2QMUB 3UN5A 1I5OB 1HD1A 3JS6A 1VQ9S 3I5BA 3ZTQA 1VSLA 2BQ3A 4J90A 5D0HA 4LRCA 4KSEB 3UQSA 2HFNA 2PFUA 1HR0K 2LYVA 3H8SA 5M1PA 1E6YB 1U2FA 3ITHA 4F2RA 4R8UB 3V2UC 2VA8A 2W2PP 2HHXA 3RRHA 3LZJA 4C6AA 1HIWA 4DV7K 2HHHF 2NSBA 3HVTB 2CJYB 3NVWA 4FPIA 2J0XA 2AF6A 2WBNA 3M5RA 2LA4A 5EXWA 3AVKA 3IKMA 1BPXA 2BOPA 1U4BA 2GJIA 2W6LA 1VSFA 4A8XA 2L9NA 5GTHU 4RT3A 1ZAWA 4G1QA 3B6PA 2GCFA 4FXWA 2KG5A 3CJ7A 2QA1A 4FVMA 1W7AA 4DU7A 3GWCA 3F9MA 3L4PA 4MF8A 5AM2A 3VQ9A 2HNYA 4EUVA 1BUPA 2ZIUB 5GAGU 1F2GA 4ZS6A 2KKPA 4F5OA 2DIVA 3K2PA 3HMJG 2XY6A 4M5JA 1XMOJ 2RHQB 2CQ2A 4NLSA 4RNOA 1TYQA 4CT8A 2BM0A 1LKYB 4ZJQA 5BR8J 2WB1F 2ZH9A 1G15A 4OHXA 4H03B 3J81Y 4CZGA 2HZCA 3BZCA 4JAXA 1SC6A 2WRMA 2DFFA 2D9OA 5A8WA 3LP0A 4USTA 4K7QA 5FPMA 2ZJ5A 1P27B 4C8LA 2DNLA 5ALKA 1PBUA 3T1HJ 1QAJA 1B70B 2OSRA 4AXIA 2DHGA 2C3YA 4CD1A 3KUEA 3M1YA 4UOGA 1QHAA 4TU7A 3P6YC 3KJNB 2D1KA 4E3SA 4CE6A 4UOCA 1O1WA 1VQKS 2CQDA 2FE9A 1SWVA 4PQAA 4Y3CA 4CYUB 2BXJA 4IO9Q 3NMRA 4CFDA 4O0IA 1XI1A 3QU2A 4JI1F 2B4VA 3D2QA 3CJSA 4DG1B 2A2DA 2V8HA 3TR5A 3SJJA 1SB3C 3HM9A 1JLBA 1NK6A 2E5GA 4JI6K 4RW9B 2LECA 5FPDA 4KLIA 3I0SA 4WZQA 5E26A 4DR7K 4FKYA 4WJBA 1NGGA 1WI8A 1ZRMA 1H7XA 1HW9A 2QWPA 2VG6B 4IL6U 4PG5A 1C4AA 3R5CA 3RJHA 1U8SA 1GO3F 2HI0A 4IOXA 4HKQA 4ED1A 3CC2N 5EHHA 5TISU 3MCNA 1ATRA 1CBKA 1OH6A 2RHFA 4KLDA 2AKWB 3GG4A 2ZD1A 4JI8K 5ETKA 1TK5A 3MM6B 4QYZK 3FRZA 3K57A 8AT1B 3QO9B 1W9HA 1SV0C 2IYIA 1HNXK 4BR2A 3WC0A 2D3OR 3O9UA 3DLRA 3HL8A 1T94A 9ICGA 4RUBA 3VV2B 2BCQA 2BJ9A 4CM0A 4M47A 1RI7A 4Y1CA 5JLHA 1JKHA 1ZQ1C 3KHGA 1N34F 3GB0A 5B0AA 1C0FA 3AAWB 5A76A 1XNQJ 1FE0A 4K4HA 2W9BA 5HMYA 3T3FA 3AU6A 2A6AA 1GXUA 1F5CA 2HNZA 4AHVA 3MMBB 4EBEA 5C15A 1N48A 1P1LA 4DG1A 3D2FA 3W9IA 3HZEA 3J7ZO 3NWGA 1P9QC 4MK8A 3BO2A 2KVCA 1WSJA 2G8WA 2HHVA 3OR2B 5A8RA 5EE0A 1PILA 3QBCA 1IXKA 5AE1A 3MMCA 4NLRA 1N56A 3FZMA 3QBWA 2FVQA 1SXDA 4IQTA 1LW2A 1AZSB 2H51B 3B4DA 1TKTA 3M1FA 4DV1J 3H40A 3QMLA 2JHDA 5EWEA 2V0NA 3ZX2A 1CSJA 5KQDA 1W7WA 1E3MA 3CD0A 4L3NA 3A8EA 5CWRA 5ETLA 4EO8A 1HPMA 4QZHA 2CQCA 1H6KX 3UKUB 3HFKA 4ECYA 2FJVA 2R7VA 4HTLA 4MFBA 1Z2ZA 5AM3A 2IRXA 4ANDA 1KBRA 2OPPA 2ZD1B 1JLEA 2G8IA 3D1QA 2UU9F 1BPYA 3MAAA 4U6PA 1N34J 3MMAB 2ZIXA 3KKFA 1IBMK 4M5GA 2XLIA 4F92B 2HFVA 3W61A 1DKGD 4DDFA 2IC3A 3C2PA 3FCHA 3DLGA 3M8SA 2BANB 1BPBA 5J0OA 3CCLS 4JKGA 3UCUP 4CHPA 5AE2A 3CJ4A 3I96A 5KFWA 3GFHA 3W0LA 2QL5B 5C0YA 4KTWA 1VHFA 1Q1KA 3F5AA 2ALYB 1WBDA 3ZDCA 1D5AA 4WBFA 2DRDA 4JN4A 4PKHA 2PYJA 2BPFA 4U7UD 1UWAA 1FFSB 1VK8A 4RQ0A 2G8UA 4LRAA 2CNLB 3LYSA 2W25A 1VQ7N 4DR6J 1K73O 5CR4A 1TL5A 3RB4A 1J5EF 1LB2B 2GNKA 3DYAA 2D5RA 1XSPA 4IRDA 4KH1B 2WFAA 3KWGA 5LMUK 3FLCO 3FK4A 2DT9A 2WVDA 4PKDB 4PH5A 2ZE2B 1W2BM 3WKDA 1O08A 1IQZA 1WUUA 4OCZA 4LZDA 4I2DA 4R8UA 1S9EA 3ZZRA 2M5YA 1WC1A 3LPUA 1UTAA 1HUZA 4OI6A 4YOXA 4TU8A 1J5OA 3TJ9A 5AK6A 1HJRA 1RHUB 4LT6A 2HSZA 3SPYA 5DB9A 3QEBZ 2CNNB 4FPRA 4FJMA 9ICTA 2U1AA 3TAFA 3RR8A 4K42A 1NO8A 3SDEA 4WXOA 3L2QA 4FM2A 3AA4A 1WUAA 3OS0A 4DV7F 1C1BB 2EZYA 3KKAC 4CNYA 2FJWA 3FYHA 5F0XA 1ZA2B 2DRAA 5GINA 3A5MC 3R7SB 4BC3A 1DT9A 1UVLA 3K1ZA 1SH0A 5I4MA 3TACB 1SVDA 4PHEA 4E0DA 2LYBA 1Q8LA 1DQAA 3WEEA 3GDQA 4NWIA 3IWLA 4DL2A 3KK7A 2KMDA 2J0SD 2FLNA 3RMDA 3V1RA 4NL9C 3KUHA 1B92A 4O8KA 2NV3A 2MUTA 1IWAA 1TKXA 2F8TA 3ZZZA 5AI0A 2Q4TA 3HKWA 4DUYJ 2FGOA 2CA9A 2ACYA 5KFPA 3EWAA 5KFIA 3M8WA 1R0BG 4FZMA 3PIOQ 1KCFA 5HRRA 2VWKA 3V72A 2YH0A 1TL3B 4LFCK 1OQ6A 4J2AA 2QARA 1YVUA 3O6QA 4M1KA 4NLBA 3HX9A 2GJ2A 2Z1GA 5ALZA 2MSTA 7ICPA 3ZSVA 2LKZA 5J8YC 1ZQFA 1UKUA 3ZTOA 2ILYA 2C2EA 1ZQNA 3H8JA 3DLBA 4F4XA 4BRPA 1SIJA 3DC2A 1BNOA 3IBPA 1IKYA 3OVAA 4IOAQ 1KONA 4LR8A 2HDOA 4I56A 2ZUGA 1X4DA 3CCRS 1NGIA 4KHQA 2C2DA 2E9ZA 1XO1A 1QVGR 4I1TA 4DSFA 2MGZB 4KO0A 1UEKA 2EKNA 1AXQA 3I8BA 4OJ5A 5AIBA 2MHNA 4DJBA 1VQ6S 1Q7LB 2WVBA 5HMZA 3CRXA 3RVCA 1V5VA 3LP1B 1VFJA 3G25A 4C80A 2G0CA 3J7YU 2YH1A 2J9EA 5GAEI 1Z4OA 5HO4A 3U26A 1WN7A 3RSEB 3UCGA 4X65F 2NUBA 3ENQA 4DR1K 3F2BA 3TEHB 3K5MA 2QYGA 3VAGA 4I29A 3MM8B 2WZ1A 1L3TA 4JI8J 4K4VA 3AMZA 4ZPAA 1Q5YA 4KLGA 1N6QB 1VQ6N 2X3DA 5IQQA 1HWKA 3E9PA 3NGIA 1U1LA 2KB2A 5EX0A 4CZJA 1MWYA 5AQTA 1DGKN 3SYZA 4CZIA 1TFWA 3E2EA 2EG1A 3B8AX 3H5UA 3KWIA 4PG8A 1ZBLA 1X0PA 1Q79A 4OJ1A 3D9BA 1B9DA 1ITGA 1B64A 1IG6A 3UDLA 2R7OA 2F44A 4LF1A 1NNLA 3HZGA 2AMCB 2YY3A 3NDKA 3GV7B 3T1YK 3GONA 2IAJA 3OYEA 8ICUA 2MKSA 3UDVA 4Y34A 3PHEA 2PDAA 1NM1A 1ZQYA 2BJ7A 3I82A 7ICEA 3GYXB 1F3FA 3MTKA 4A2BA 1Y3KA 5IOLA 1UJ6A 3NS1A 2BQUA 1S0OA 2LLZA 4PL2A 2YKNB 2GO7A 3PX0A 3AT1B 4MDBA 3IFEA 3TX0A 1QDUB 2DNQA 1RYUA 3MXIA 2W4PA 2ZJRQ 4CRXA 5J2PA 2F65A 2W9CA 5F8NA 1VQPS 3WQPA 1F9HA 2FD2A 3EGNA 1Y5LB 4RQNA 1NXIA 3LDQA 4ZIWA 3BQ1A 4KRWA 4GNIA 2O8FA 2DTUA 1YG0A 5JMVA 3HT0A 1ULRA 3KLGA 3H0LB 1NRKA 3NVVA 1VBXA 5CP2A 2GAHC 3BGUA 1YBAA 1KFTA 1VQ8S 4K2JA 2Z2ZA 4F67A 3GJQB 1XS9D 4E7KA 4CJTA 3C7NB 4U9RA 2F8MA 1JL2A 4ID5B 3MABA 4QOZB 4ECSA 4USAA 4YORA 1XN9A 7ICRA 2WK4A 4RPXA 2XYPB 4OZ2A 3CJ1A 1AFJA 4PABA 2CGKA 4ZCIA 4B3MF 1N62A 1DTTA 1B7FA 2Y1JA 3V6DB 4XTTA 2W01A 2DH8A 4TYBA 8ICFA 3JPNA 2VG7B 4ECZA 4Z7YA 4DV4K 1B9FA 3NOCA 3MUVP 3HZ6A 2PO4A 2A3ZA 1YXQA 5ETPA 3IS9B 2GWSA 3TARA 2CXEA 4ECUA 5KL1B 4ED2A 4IR9A 4H5NA 2CH5A 1HNZJ 4ZHRB 2W9CB 2GVZB 4BRNA 2EFPA 3TWZA 3KLEA 4UTGA 4AQYK 3CQYA 1ZQUA 4OL8A 2DTJA 2HBLA 2MXYA 3DRSA 2HW3A 4AT1B 1RB0A 1FE4A 3ICXA 1FWLA 3ZYYX 4BE1A 4DR3F 4W5RA 3P38A 2KFNA 1KQGB 1LWEB 4BG9A 1WBBA 4C7QA 3MDQA 2W54A 1REVB 1Q7YO 1UMJA 2YNGB 4LUBA 1JLBB 4F93B 1KAXA 1IVZA 3R1LA 5GAHU 1WLJA 3ZX3A 2DWQA 4JV5K 3FFIB 1HI8A 2BDUA 9ICMA 4DR7J 1KVJA 3D0IE 3JXUA 2RQCA 3DLEA 4M5KA 2I1RA 1C7YA 2W2OP 2QK9A 4CNQA 3H7IA 1RWUA 3FBCA 3AA5X 3S6JA 2YWWA 2BPGA 1GX6A 5HQ8A 1NM2A 2A1JA 4A8MP 2B5JA 1VSHA 5F3XB 2X6NA 3MCPA 1WTFA 4KX3A 1NHKL 2JV3A 2YY6A 4ATNA 3BS5A 5IT9Y 5AQZA 1KFSA 1ZPWX 4CO3A 4PYAA 4DUZF 3WXIA 1S7IA 2Y3YA 3CB4A 2IHR1 4IFVB 1BC6A 1KWMA 3IDHA 3SCXA 3ETLA 4EU0A 1T6CA 4BDYA 4WQ4A 3DOLB 5GAEU 4BS2A 1L8OA 1RM6C 4DPOA 4XEIA 9ICCA 4DPXA 3GZFA 3IRXA 2V9WA 3CDEA 2BR0A 2W03A 4TY8A 4NCGB 1U24A 2RSQA 1SC3B 4KHUA 3PM9A 3MUTP 1JUDA 4F0MA 2DR7A 1TKZA 3K59A 2AV5A 1NJYA 3D2SA 1FVQA 4TVAB 4DCPB 5B09A 3VERA 3U6FA 3DOMB 5H9EK 4ED4A 3EGZA 3LWMA 2KVSA 2HSTA 3PSFA 3JSMB 4J2EA 2QWRA 3BS7A 2KM8C 1WWVA 2IOFK 2F3JA 3CWJA 1HUXA 2QXFA 1VRUB 5AXLA 4Z94A 3R9PA 3CCVS 4QZIA 4BRCA 3PRDA 2WF7A 1AYEA 2CNKB 3KKSA 2IJNA 3IG1A 2VQEK 2OPPB 4WK3A 1RU2A 3D1HA 3HPGA 3AVMA 3W63A 5DG7A 3JYTB 5A8KB 2DGTA 2FVPA 2OEHA 4WFAL 4PGYA 1I94J 2MKYA 5D49A 4MT1A 1GNKA 1SJQA 3CMQA 2D0OA 2I6XA 4QU7A 4IBNA 1DXSA 2YWEA 4I6WA 1BQNB 1RK8A 3P96A 5KGWA 4CGFA 4DHVA 1QS4A 4CJWA 2VJVA 4F3OA 1WSFA 1YJNN 1NWKA 2MU2A 1H73A 3DJCA 3VQ4A 5F8LA 3LVVA 4RW7A 5KG2A 4CJ7A 5EWFA 3J7A1 2CQHA 1VRQC 2APOA 1VJWA 1WHXA 3EYZA 4GKKK 1RT3B 1HI1A 3V4IA 4DSJA 2LKYA 4C11A 4DCOB 3R27A 3TVKA 3D2EA 5J2CA 3PKMA 1VQOS 3J7ZT 2V52B 5B0EA 8ICQA 1S48A 5KT5A 4KRFA 4ED7A 1WEZA 3CJ0A 2HOQA 2LXFA 4M3WA 2E2QA 2HQCA 3EUNA 3VZIA 3WX4A 1N52B 4O3QA 4LF5J 5DM6L 3MR6A 4OPHA 4BC4A 4M5NA 2AJ4A 2A1BA 4FJJA 1VQMS 4OYXA 5J2MA 3A0HU 1RTDA 3DDHA 1T9YA 1JL1A 1U0HB 5C2GA 5AI8A 5ALYA 2E1YA 5M1QA 1IKWA 1FA0A 3CCSS 2HBZB 2JVRA 4YOUA 2KSOB 1AROP 1CS4A 3VAFA 2KT2A 4LF8K 4JHDA 4FE3A 3NHGA 2R3VA 1EWQA 1M5VC 3BQTA 4CF5A 1RWNB 2DIUA 2P5GA 4EBDA 3DXKB 1MU2A 5FRNA 2F9TA 4KFBA 3MTJA 3POTB 4TSXA 4HUEA 4CLYA 2V63A 1CJTA 2Z1IA 3TZZA 4J9QA 1L6NA 5EX3A 1XR7A 3FUYA 3G8SA 4D3GA 3LQVA 3E66A 2CJBA 1G6BA 1HNWF 3CCQS 2IS3A 2JEIA 2IDLA 2W9AA 3V5RA 3F53A 3WK8A 4TLQA 4ISFA 2KICA 4MHVA 1S9GA 5J2FA 2NXJA 1UVNA 3H0PA 4LF5K 5KFLA 3M30A 1RWXB 2E7WA 1RT5B 2G1DA 3M9OB 3TQEA 2V2ZA 3UM9A 4B3MJ 2LI6A 1RCXB 3HF5A 1NK0A 2FBXA 2MKJA 4CLFA 5ALRA 2YTUA 4FJ7A 2XNQA 3K9KA 1R27B 4MO5A 3VF6A 3RF9A 2KI2A 4C4SA 4BXOA 2J7UA 5CE3A 1VSDA 4KHMA 3JQJA 8ICSA 3PYFA 5K14B 4X64F 1RLDA 5J1EB 1FTRA 3QYPA 2P9KA 4MIAA 2E1RA 7ICIA 3OXFA 2R7YA 4NLNA 3D1OA 2C2OB 3M8PA 4IEEA 2F1IA 2BE2A 3KLGB 1WI6A 2XICA 1HNXF 1IBKF 4UY8O 2B9XA 3QXGA 3CCMS 1BWFO 4JKEA 3HVRA 4X66J 3DV9A 1WUDA 4ETXA 4AD6A 3UXNA 5J2IA 9ICIA 3CCVN 5TZVA 2DXDA 5CZXA 5HP4A 4QPTA 3RJMB 1KBUA 1GOBA 2R8HA 1NOZA 2YNGA 4I67A 2PA3A 4HYKA 5E3CA 4OJ6A 5AXKA 2VG6A 2DGUA 2V69A 3PSTA 2NUUG 5CD4A 2RQMA 3JTPA 3LDOA 5CR0A 1RTIA 1KR4A 5HMLA 3LK9A 4KQZA 3HW8A 2WMMA 1RQLA 2XYGB 2ITGA 5JXSA 4MN4C 2MYFA 1NGCA 3T5KA 4HT5A 4DUYK 9ICJA 2MQPA 2Z58B 1ZQVA 3GE1A 2HWHA 1U0HA 4NYFA 5LJ5Y 4OV1A 2OFHX 4U8VA 1YDLA 1S97A 2WF9A 3PIOL 1EARA 4YP3A 4RW4B 1NU0A 3P83D 5FLXY 1FK9A 2FSJA 2KYZA 2WC9A 2G07A 4ECQA 2KG1A 2KV2A 1DOQA 4L3KA 4OZLA 1MSWD 1X60A 3VQ8A 3ZEUA 3BJYA 2KXHA 3NGYA 2VIXA 1VSEA 5F8IA 2FHJA 2CKWA 1CJKB 3OTDA 2MZQA 3OBIA 2V4RA 1KQSM 1V3ZA 5DBAA 4FZZA 4CH0S 3PSIA 4WTOB 5H2FU 5J2QA 3IRXB 3CMAS 1V97A 1RSCA 1XMQJ 4DTRA 2RS8A 4DR5K 5ALIA 3PJXA 4USIA 3C6HA 3DMJA 1ZQTA 2RU9A 3TZXA 2WCXA 4QW8A 4H8KA 4NRUA 3H2LA 5CA7A 2N4DA 3LA0A 4PY5A 2YHYA 3ZXWA 4OJPA 4URGA 3NGTA 2LU1A 3AVNA 4FOEA 4KH4A 4NE9C 1HPZB 4C8MA 1HRHA 4F0KA 3MPDA 1RWKB 1ASVA 4DX5A 4C0ZA 4IH7A 1WDTA 4DQ8A 1T9WA 4NRTA 2ZHAA 2VA3A 2A6MA 1MQ3A 9ICFA 3HDSA 1BE4A 1BHLA 1WSGA 5KPTA 4UB4A 3FKBA 3NASA 1I51B 1U45A 3FSIA 5KFEA 2ZJPQ 1M1HA 2ZFHA 4F72A 3H8WA 3HSZA 8RUCA 1MA7A 3EKSA 2W42A 3PX6A 4AHTA 1R6YA 4PWUA 2QXLA 4RWWA 1BCOA 1FRJA 1HI0P 1GTHA 4ILLA 3PNCA 3ENAA 3KLFB 4EX6A 4KN4A 3UCZP 4KKOB 3IS9A 1FWKA 2GFFA 3NVZA 5KFHA 2EH9A 4QWEA 2DGVA 3F9KA 2H3GX 4CIFA 1MROB 3B8HA 2E7XA 3CMES 4JV0A 4OLPA 4FPAA 4M8LA 3UWTA 4JI4F 3AD7C 4TUQA 5KFZA 3DAWA 4DTJA 1JI7A 2LQ8A 3HWTA 2D3O1 3GYGA 2MRLA 2DY4A 2BE7D 5A8RB 4P7TA 2B43A 4WF9Q 1W25A 3RR7A 2YMMA 4LF6F 3EVMA 2D74B 5F8MA 4WFZA 3TKAA 4WYWA 4L3QA 3NGRA 2E6LA 4X62J 4FJ5A 3TYTA 1QUVA 3DM2B 4BR5A 4DL3A 2AX1A 2IA6A 1R8CA 3KVGA 2YX4A 2UXBF 1Y7PA 3TUIC 2CG8A 2A3JA 4E7JA 2OHFA 4FKXA 4F3TA 5EVZA 1Y10A 4X66F 1HJPA 2I6WA 3TEGA 4A8OA 3BS5B 2JLEA 1H2VZ 1LWEA 3EPIA 2MSNA 1HQUB 1FD2A 4KTZA 1JIHA 3KLFA 4YB1P 3BO3A 1ZQQA 4I2EA 4KKOA 3RB6A 4KLOA 2VFUA 1UCVA 4ZP9A 1R8AA 8ICHA 1I6JA 4EYHB 1NEEA 3R97A 1U1PA 8ICTA 2D0PA 4JRPA 2CN1A 3HCXA 1AQ6A 5ALHA 4CGHA 4EEKA 4JKBA 5EDWA 4OX7A 4JI1J 2ALZA 1RHJB 5AJ3K 2QKKA 4Y2CA 1S9GB 4IH5A 3ETMA 4ECXA 1ZAXA 1X31C 1LK7A 4CF1A 4UAWA 2V2KA 3OYJA 4QS8A 4RQ1A 2POKA 1WC3A 1LAVA 2B9YA 4Z7CA 5EUHA 1WKKA 3OFGA 4DOZA 4QZGA 5JS2A 4I6MB 2E8AA 4CJQA 3UKUA 4DTPA 4DS5A 2ZQBA 2YTCA 2DPJA 1A9NB 3DDNA 1UPPA 1O8BA 3MCOA 2WSFC 3G8TA 2PFQA 1F5SA 4CF3A 4BRHA 4Z4GA 1J2VA 1WOPA 5KFCA 3KK1B 4UY8T 1KKHA 4LVOP 4BACA 3TUPA 5BPCA 2XMJA 1OXJA 1FRMA 2M70A 4DQRA 1YX2A 1NSPA 9ICBA 2QMWA 4QJVA 1RT2A 4NZ7A 1HKCA 4DX7A 2ZH6A 1CLFA 5CZVA 2W43A 4ED6A 4KLQA 2LDIA 3CC7N 5B08A 2DFHA 2KK0A 2PMHA 2FLLA 4B1ZA 3C5GA 1QZ6A 1HWLA 2ETJA 2LEBA 1RCHA 3O5BA 3SSSA 3MMVA 3O5TB 2BKOA 3NCIA 3DRRB 2HBQB 3OV7A 2FI1A 2F7VA 1TU0B 4KO0B 2HOFA 3LP0B 4F5RA 4PPDA 1RE1B 3BGOP 4PG6A 3FBBA 3NGZA 1JLCA 3L7UA 2CQGA 2HBYB 4NLUA 3NRZA 2RB7A 4QZCA 3U27A 2AGOA 2NRTA 1G4CA 2CDRB 2I9GA 1N2XA 1BWEA 2GMLA 3ZZYA 2L3MA 1RYRA 2ZDOA 5KFJA 2IVNA 3O8WA 3FVYA 5IM0B 4HAIA 1RT6B 1UL3A 1UAWA 4PL8A 4CBUA 2F4VJ 1HWJA 4OPAA 1VGYA 4PHPA 4FYDA 4IUFA 3OR1A 2RT3A 1R43A 1PC5A 1QAYA 4TNOA 3TNVA 3J80Y 4DV2J 3GIRA 1IV8A 1SKWA 4RKUC 4KGZB 4FF2A 3P5TL 3G4SS 2GELA 5BOMA 3VQPA 4YXMA 1GXTA 1IKXA 1ZETA 5DETA 2J8SA 5DQHA 4DPWA 3CDAA 4WQ5A 1BQMA 1FJGJ 1ICEB 1FDDA 2H5JB 3EDRB 4Z0UA 4LY7A 1C1CA 3MM5A 3WK5A 1WC4A 1VQNN 4E7LA 1NB2A 3AQOA 2VWJA 3W64A 2W41A 1T02A 3IUCA 4H4KC 4DSKA 1AFIA 5BR8F 1ZQKA 4IOBA 4JB3A 3M2VA 3CPWR 4NLCA 1AT1B 3VTHA 3BR8A 4RLEA 4OYOA 3MMJA 3TAPA 3A2FA 4FVCA 3PLAA 4DR2F 3UMCA 5E33A 2Y1LB 2GV1A 2WHEA 3G6XA 1SXEA 1EO1A 4PKGA 4GFJA 3MECA 5KOXA 4NXMJ 4NCGA 4E98A 1YJ9S 4OYBA