3HPOA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus y714s mutant bound to g:t mismatch
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
579
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVSGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
molecule tags Transferase/dna
source organism Geobacillus stearothermophilus
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
total genus 214
structure length 579
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hpoA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hpoA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hpoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpoA01
2R8KA 1BVSA 4QZDA 3FYHA 2BPFA 1BIZA 1ZBFA 2XCAA 4LSLA 3M9MB 4H4MA 4YMOA 5FROA 2ZUBA 4QWAA 5L1LA 4TSXA 2G8HA 1D9FA 4XQ8A 2Z1IA 4E3SA 3VQDA 4CHQA 2ZTEA 5J2FA 1EKEA 3K57A 2ZTCA 4F5OA 3SV4A 4ED6A 4O55A 9ICKA 3ZT3A 1LV5A 7ICEA 3QEXA 3AV9A 2FLNA 3G10A 2FPLA 4FLYA 3ASMA 1S1TA 5DQHA 4EZ9A 3V81A 3Q8PB 4E1MA 7ICSA 4FW1A 3MAQA 4FLVA 4DL2A 3K58A 3FDSA 3RR8A 1UOCA 2XHBA 4KI4A 3V9WA 1LB2B 3LDSA 4DO9A 2R8IA 1KFTA 3D45A 4CFCA 2QXFA 1ZQBA 4DTJA 1JLQA 8ICXA 8ICCA 4Z6CA 1NK6A 2P66A 1K6YA 3RH4A 3SUQA 1HJPA 2YNFA 3BQ1A 1PZNA 2NRZA 4YQWA 1B22A 2PFNA 3DYAA 4NCAA 8ICHA 1IKXA 2X74A 3CFOA 4O4GA 2C2EA 5SZTA 4JS4A 1IM4A 1LAWA 1DTQA 2DFEA 1S9GA 2ETJA 1COOA 5L9XA 4NLKA 1IKVA 1VSKA 3VQ6A 3ZSQA 1FKOA 1WSGA 4F5NA 4O0IA 5HBMA 1JLEA 3P5JA 4DS4A 5J0XA 1QE1A 5HRNA 3G6XA 2ASDA 3NFAA 3DLBA 4JV0A 4GXJA 4Y1CA 5KG7A 4UAWA 3OGUA 3NDKA 1T03A 4I2AA 5DB9A 3RWUA 2VG5A 3DRRA 4G1QA 4CGHA 3MDCA 3HXMA 3LWMA 9ICGA 5J2PA 1S0NA 2ISOA 4AH9A 2DFHA 1XHZA 4RUCA 1C0TA 4I2FA 9ICFA 4ZHRA 1XI1A 4B9TA 3ZT2A 5KT6A 5DBBA 4IBNA 4YFKA 3KHHA 7ICOA 2AJQA 1SV5A 4P4OA 2JLEA 5TZVA 9ICMA 4IRDA 4CHYA 1RBSA 3WNGA 3ZT4A 4YXMA 1RT5A 4I2EA 1WSHA 3D0PA 5CB1A 3HPOA 4IDKA 3PV8A 2FLPA 2B4JA 3RB3A 4CF1A 3VN5A 5KFWA 2KN7A 5CY4A 4M9GA 3VQPA 3V6KA 3RB0A 2VA2A 2IOCA 4W5RA 3H40A 3TAMA 3C5FA 1U9LA 3HM9A 4C8NA 4FK0A 1WAJA 4CJ5A 3QEAZ 3B6PA 3BQ0A 5HHIA 4DFJA 3AO5A 4B08A 2ZJAA 3OYNA 4KLMA 3DLGA 1JLFA 1NKBA 1ZQYA 1B9DA 3BGRA 9ICTA 3RAXA 4RNOA 4FLUA 1RT7A 4EP5A 3AA5X 4P2HA 4NXZA 7ICJA 4CJTA 2JZBA 3KKRA 3OSNA 2BGGA 4CEEA 5DGAA 4ED1A 4M3YA 4CK2A 4F4XA 4CF9A 4RNMA 2BCUA 2IHMA 4NM1A 4M3RA 4M9JA 4DQRA 1I39A 4RG8A 3QLHA 2HVIA 2AGPA 4Q44A 4R65A 1KVAA 2EX3A 5KG4A 1QLNA 4KHSA 1Q9YA 2OYQA 8ICBA 8ICQA 4FLTA 5CZ1A 4HTUA 3QNNA 5I3UA 4KLJA 3WNEA 3RMCA 1RTJA 1XU4A 4KREA 5J0SA 7ICVA 3DOLA 4UQGA 2OZMA 4RQ7A 4W5QA 4BE2A 4O5EA 3CFRA 5C25A 2FMQA 1BPDA 3OYDA 1S10A 1RDBA 3SCXA 1C1AA 1WN7A 3LZJA 4P4PA 3AVLA 1KLMA 4FS1A 4J9NA 3B0YA 3MDAA 3MGIA 2QKKA 5FRNA 4DTNA 2YNIA 1RT3A 2C28A 4CGJA 5HP1A 4CJKA 2G8VA 3EY1A 2E6MA 1C0MA 4DSEA 4I2DA 4DMNA 4GVMA 5IIMA 5HLFA 3SJJA 1S0MA 2PFOA 4YMNA 5HRPA 4M3ZA 3C94A 1C1CA 1T3NA 3TABA 3QESA 1C0UA 4EP4A 1D5AA 3HPGA 3ZDEA 4YXJA 3L3UA 4CE9A 1VSHA 1Q8IA 3VQ7A 4RQ8A 5KRSA 2XGQA 4I2GA 2OPPA 5KFQA 4RQ4A 3AVFA 2FC0A 3V1QA 7ICQA 4KLQA 1ZQMA 9ICJA 3EWAA 4IR1A 2I1QA 3VQQA 4CGFA 2PI4A 1S1UA 1XWLA 4B3OA 8ICWA 4PUOA 5CR0A 1HYZA 3HVRA 4I2PA 1ZBLA 4KTQA 2F8TA 3SNNA 1TGOA 1U48A 4PQUA 4M6WA 5IIJA 3RH5A 3PW7A 1YTUA 3VQ4A 4OKKA 1ZQIA 2DFLA 3UXPA 4HYKA 2BCQA 3RJKA 5KT3A 5IILA 4J9QA 4JS5A 1D8LA 2ASLA 4GC7A 4FO6A 3K75D 4CEFA 3SQ2A 4YR0A 1RNHA 4LZDA 2FBTA 1ZQNA 4RQ2A 4FYDA 8ICOA 1B43A 4O3OA 5J29A 2UVUA 5J2EA 1WSEA 3SYZA 1J54A 4FVMA 5L1IA 1HMVA 4YCXA 3TAPA 5KT2A 4DU1A 5DQIA 2C2DA 4Z0UA 1J5OA 4RW7A 4GMJB 5IINA 5KFMA 1S1VA 4E7JA 3E2EA 8ICEA 2OZSA 1VRTA 2IGIA 5J2JA 1VSMA 4DSIA 2RN2A 3MEGA 4Q5VA 4M9LA 4EBEA 2D5RA 4I2QA 2PXIA 3IS9A 3TAQA 3SI6A 4IQTA 4OGEA 1JKHA 4GLXA 3Q8KA 1UT5A 4DS5A 5KFUA 3AVJA 4CJFA 9ICLA 1JX4A 9ICIA 4JRPA 4I2IA 3MABA 4N5SA 2KZ3A 4O3QA 3C6TA 4YNQA 2IHNA 1Z00A 4Y1DA 7ICMA 9ICNA 4ECYA 1JLGA 4RZRA 5HRRA 4Z4HA 3IAYA 3G6VA 4KLSA 3ZSVA 3Q8RB 5BOMA 9ICWA 4QWEA 2IDOA 4E7LA 4Z4GA 5C5JA 2BCSA 1V9PA 4F4ZA 4R63A 1BI4B 3JPTA 1AROP 4UB2A 3ZD8A 3QO9A 3OSPA 3V6JA 4XRHA 2I5JA 3SI8A 3O3FA 5KFKA 4DF8A 2JGUA 3TFSA 2IMWP 1TL1A 4HUFA 4M45A 4I9QA 4PGXA 2NRXA 2MUTA 2A1RA 3SV3A 1RILA 1KEJA 1NOZA 3O3GA 1LWEA 1ZQXA 1Y88A 3N97B 3LPUA 4DQIA 3MEDA 2BPCA 1U45A 1FXXA 4DSJA 3JPSA 2KZMA 3CG7A 3HW8A 4Z4IA 2KZZA 1O1WA 4EEYA 4YN4A 1MQ3A 3BDPA 5K14A 2V4RA 3NHGA 3QEPA 1BGXT 5KG2A 1HUZA 2R7YA 4N47A 3LK9A 1ZQHA 1U47A 4EBCA 3JPNA 4QZBA 3KLFA 4FK2A 1A5VA 2RDJA 4CHPA 2NRVA 1IKYA 4N41A 5J0TA 2A1JA 4O5CA 3MR5A 4ELVA 3T5HA 2GBZA 1ASUA 1TK5A 4FZYA 9ICAA 4KTZA 1ZQEA 3KHRA 3QEVA 1C6VA 4CHOA 3KLGA 5EWEA 4F4KA 2E4LA 1HPZA 1ZBHA 2Y1JA 2ITGA 1BI4A 1JXBA 1QQCA 5J0OA 2ZJ5A 5KFHA 1JXLA 4KTWA 3QE9Y 5J2BA 4BXOA 4FCYA 4B9LA 2PI5A 3MXJA 3NH1A 4DQQA 2BR0A 2Q0ZX 4ECSA 1K1SA 4PHDA 2MAXA 4PGYA 3HVTA 4NM2A 4QZEA 2B5JA 3BJYA 3ZSZA 1TKXA 5DKWA 4J2AA 3KLEA 9ICUA 3RJEA 5J0PA 4IRCA 3QEBZ 4FJMA 4DLGA 2BQRA 4DTUA 2YHAA 1EX4A 3RMAA 4CJEA 1XS9D 1C1BA 3NAEA 1ZQUA 2UVVA 4W5OA 5FRMA 4FJJA 7ICUA 4O3NA 2IA6A 1EP4A 2YKMA 4O5KA 3KK3A 4KITB 5EOZA 1ZQRA 4HUEA 1XO1A 4DFPA 1KVBA 1JL1A 1HYSA 2A1SA 4BGDA 3KD1E 1KTQA 1TVAA 2ZTDA 2FPKA 9ICSA 4R5PA 1RXWA 4LVSA 3S9HA 3V6DA 2RF2A 3OS2A 2W42A 3OJSA 4ID1A 1NK5A 3ZCMA 5HP4A 1RT1A 4FJ9A 1N56A 2J6TA 2KTQA 5KFZA 1ZBIA 1WNSA 4CIGA 8ICYA 5F9LA 4FJIA 2OWOA 3TANA 4DQPA 2QKBA 1IKWA 3KHLA 5KFLA 4QWDA 2P6UA 1T8EA 4NLZA 4GW6A 3TWHA 1HQEA 3MR2A 1QSSA 4NLGA 3ZSOA 3SZ2A 5KFIA 3NGIA 1R0AA 5J0WA 4OLAA 4F50A 4I7FA 8ICRA 1Q9XA 3U3YA 5HHHA 1CUKA 3SPZA 4KO0A 4FJ7A 3C2LA 5JS1A 4HHTA 4QW9A 8ICPA 9ICOA 1WCNA 5KFRA 3NE6A 4F4WA 2I9GA 4E89A 4DSLA 3SPYA 4CESA 1BQNA 4ED7A 5C24A 1VRUA 5JS2A 1J9AA 3O3HA 4JWMA 4MQ3A 1U49A 5IIOA 8ICNA 3K5NA 4F5RA 2OPRA 2XCPA 4FJLA 4DSFA 3KD5E 4HCBA 4QZHA 4M0AA 5FDLA 4PA1A 9ICBA 1TL3A 2X6SA 1WSJA 3M8SA 3QINA 4N76A 3ISBA 5DGBA 2G8IA 1A77A 3C21A 1BISA 4I29A 2JEGA 4LD0A 3T5LA 2HHXA 1RBUA 1CXUA 1JN3A 4UBBA 2GV9A 2FBXA 4JUZA 2X78A 1I3AA 4ELTA 3PR5B 5L1KA 4E19A 3QNOA 1DGSA 2FBYA 3ALYA 4FW2A 4J9RA 4Z4FA 3LDAA 2PFPA 3OYJA 3AVHA 4BDYA 1DOQA 2AGQA 3P1GA 2UVWA 4BDZA 1UWBA 4QWBA 4L8RB 2Z1JA 1NJWA 4CIFA 1RCHA 2YNGA 4RQ3A 4DSKA 4QZCA 4QW8A 5KTQA 3G6YA 1DTTA 1VSLA 3H7IA 4J9LA 2VG6A 4RW8A 3JPRA 2JEIA 1NOMA 2W9CB 1RBVA 4MFFA 4KLGA 4M3TA 4W5NA 1IO2A 4OPKA 4R8UA 5J0QA 3I8DA 3EPGA 3HPHA 5KI6A 4ELUA 4CJRA 5KFTA 3L2WA 3KTQA 5DG8A 3GIIA 1UA1A 4E7KA 1MQ2A 2JZBB 4LH5A 4DOAA 4FK4A 3V7LA 5CJ7A 4K4IA 3M8RA 4XA5A 1KLNA 3MR6A 4DTXA 2JEFA 1ZQPA 3QERA 5KT5A 3LP1A 4HCCA 3HJFA 1KRPA 4BWMA 2FLLA 3QIOA 1TAQA 8ICMA 1SL1A 4BWJA 5SWMA 4C8KA 4YR3A 3PR4A 4RPYA 5KGWA 1LWFA 4J2DA 4CJUA 3TAEA 5J2NA 1GOCA 3H08A 4AHCA 4CCHA 4RUAA 4GXKA 2G8FA 3ORYA 3MFIA 3OYIA 4F4YA 2E6LA 2FPMA 3L2UA 3JPPA 2FMPA 3V72A 1BCOA 1WCLA 3ZDBA 2D0BA 1LW2A 4M3WA 3OYKA 1ZQZA 4Q43A 3T5KA 4KHQA 1BPXA 4FLWA 1X1PA 4Z6DA 2F1HA 4DFKA 1TV9A 5DDYA 4EBDA 3CYMA 3C1ZA 3K5LA 3UPQA 1NJXA 3AUOA 3DRSA 5F9NA 4AHTA 5J2HA 4FJ5A 1ZQKA 4QZGA 3RB4A 1RDDA 2ZQBA 1ZQGA 4IFVA 3ZD9A 4KHYA 3V1OA 1WLJA 3VQAA 2ATQA 4ICLA 1NK0A 3LZIA 2ISPA 1VSIA 3LALA 2WTFA 2DPIA 2ATLA 2WONA 4BE1A 4CK1A 1C7YA 4QZIA 1X9MA 9ICHA 3AO4A 1NK7A 4KLUA 1VSFA 4RQ0A 4CIEA 4JV1A 3UQ0A 1ZBUA 4DLEA 1A76A 3IG1A 4ID5A 1T7PA 2G8UA 4F2SA 3B6OA 5KFBA 4DG1A 2IBKA 4KPYA 3RMBA 3SQ4A 4O3RA 4BE0A 4CHZA 3NGZA 3Q8SB 7ICPA 4O5BA 5EU7A 3NF7A 1U4BA 3PW2A 1RDAA 1D8YA 4FJHA 4ZTJA 4G3IA 2IC3A 4I2JA 1NOYA 3TARA 3QIPA 4KN4A 4FLZA 4KKOA 2YKNA 4AILC 3AA4A 2VA8A 4F92B 2Q3SA 4Z4EA 3Q8LA 4IRKA 4ECVA 1CZBA 3NH0A 1QTMA 3SUPA 2VA3A 1RDCA 8ICJA 3C5GA 2FMSA 3DLRA 5EWGA 4QCLA 4FJ8A 5KFNA 4UB3A 5J2CA 4TQSA 4CJ3A 4FM1A 5KFJA 2AQ4A 3VA0A 4RQ5A 7ICKA 4OJRA 1SL0A 4FZZA 4FXDA 5J0UA 1IH7A 3OYHA 3L2RA 1ZJNA 5DBAA 3V9ZA 8ICVA 1ZQCA 4MEXA 7ICHA 5CP2A 3Q8QB 4H8KA 1JXEA 4RT2A 1ZQSA 4KHUA 3HL8A 4DEZA 1Z25A 2LSNA 5HROA 1JLAA 3NF6A 4Q45A 1T05A 5JUMA 4ECXA 4ED2A 1UAXA 4K4GA 4AHUA 1KCFA 4I9LA 4FJNA 4P4MA 5CYQA 3HWTA 3CM6A 1ZQLA 1B9FA 1K1QA 4AHRA 4QOZB 4CK3A 3C2KA 4GC6A 3GILA 3JYTA 3BQ2A 2XY8A 4M9NA 5IIIA 2UVRA 3IHQB 1SKWA 7ICIA 1NJYA 4DTSA 3UXNA 3U6FA 5KG0A 4OPJA 4J9PA 4RW6A 2KFZA 1Y97A 4NLNA 5KFCA 5KFSA 3PW0A 3RBDA 1H38A 2AGOA 1S6PA 4K8ZA 1LWCA 2G8WA 1TK0A 4NCGA 4RW4A 2QK9A 3ZSRA 2HHQA 4TQRA 3KLIA 4Q8FA 1JLBA 4AHSA 4M42A 4PY5A 4Z6FA 5CWRA 2PFQA 3GFKB 1XSNA 2W9CA 2W9BB 4CHNA 1HJRA 1Z26A 1NK8A 2KQ2A 4Z6EA 2KW4A 4PH5A 3V4IA 1RTHA 4YVZA 4CGGA 1HQUA 2FBVA 3TQ1A 4RPZA 4YD2A 1RT6A 1RYSA 4W5TA 9ICRA 2ZUDA 4DQSA 3KKSA 3OS0A 3C95A 3UIQA 2RKIA 2AU0A 1GOAA 1CEZA 1L3VA 2VWKA 1S76D 4DOBA 4DTPA 1MSWD 4RQ1A 3OYMA 3KIOA 4CGIA 3PW5A 1HNVA 1RT2A 3HP6A 3DOKA 4CF8A 4YG2A 4B8AB 1L3TA 1J53A 1QHTA 5KG3A 1VSEA 4J9MA 4ECRA 4KAZA 4KLTA 3LAKA 4M3XA 2R8HA 4DL7A 2V4QA 3VQBA 1ZQJA 4KN7A 3V7KA 4F93B 4UB1A 2ALZA 4CEDA 4MF8A 1SL2A 3NH2A 1L5UA 4DU4A 3RRGA 1RZTA 3LAMA 2B21A 4KLDA 2P1JA 3RMDA 1XSPA 4KLFA 4KLOA 3V9UA 4H4OA 4CFAA 3AVCA 3NTUA 4NYNA 2W9BA 5T7BA 1RXVA 2P6RA 3ZDCA 1YVUA 7ICLA 1ITGA 5KFAA 2XY7A 2HW3A 4OKEA 3ISCA 1X9WA 3JPQA 2VANA 4XUSA 2GWSA 2Z1HA 1TAUA 4DWIA 3LWLA 5KFYA 1BPBA 3A2FA 4MF2A 5KFOA 4RU9A 4YR2A 2H5XA 1EXNA 4M9HA 4KI6A 4DL3A 3MECA 5J0YA 1QSLA 4IG0A 4I28A 4R66A 1S9EA 2DTUA 5KG5A 1ASWA 2HB5A 3RB6A 3H4DA 3HT3A 3RJGA 3FFIA 4BACA 3PX0A 5KRTA 3HSTB 8ICUA 3RJHA 4PGQA 4CEOA 3C6UA 2XC9A 1ZETA 2M9NA 1W0HA 5J1EA 3L8BA 3CQ8A 4FJGA 2C2RA 4FJKA 3OHAA 1ZQFA 3OVNA 4DOCA 1JMSA 5KG1A 2KFNA 3AA3A 4F5QA 1S97A 5DG9A 4RQ6A 3OYFA 1RBTA 1ZQDA 3LPTA 3H8SA 3DLKA 5DB8A 5BPCA 2HMIA 3AO1A 3NCIA 2LYHA 1QSYA 2X6NA 3VQCA 4DTMA 2OA8A 4ED0A 3M9OB 3ITHA 1SUQA 4DL6A 1BQMA 3IM1A 2IAJA 4YMMA 1BHLA 4F3TA 5J2QA 5D4BA 4B9VA 4CFDA 5DG7A 4FS2A 1RPLA 7ICGA 4DL5A 1TVRA 3MBYA 2Z1GA 1T4GA 1X2IA 4JK1A 2HNDA 4JV2A 1S0VA 3H4BA 4FBTA 2BHNA 3N4MB 1ZQQA 1ZQWA 9ICPA 1TK8A 2VWJA 2D0CA 4J9SA 3DLEA 4M2YA 4DFMA 4IKFA 4FBUA 8ICSA 5CA7A 3S3OA 4UB4A 4BXOB 2EHGA 4CEAA 9ICQA 5KT4A 4UAZA 4OVLA 4IQUA 1ZJMA 3EYZA 1VK0A 5EWFA 3PVXA 9ICCA 2XGPA 3OHBA 4J9KA 3RJFA 5KFXA 4QWCA 3V1RA 4BDPA 2RDIA 3OYEA 2ZJ8A 4TUQA 4CJ4A 1KFDA 2GUIA 1S77D 2PY5A 2J6UA 5KFPA 3AVGA 5HNKA 3VQ9A 3L3VA 1RTIA 3GIMA 4F91B 2XY5A 4FM0A 3GV8B 4ECQA 1RYRA 1HYVA 5DB7A 3EPIA 3OYCA 1NKEA 5C42A 3PMNA 3F73A 4B9MA 3PY8A 3S3MA 9ICEA 3L2VA 2W8LA 4RPXA 3GQCA 2HHVA 2YHBA 4K8XA 4CJSA 5KFDA 1QS4A 4KB1A 1Z00B 3DMJA 2D0AA 2HNYA 4CECA 3GIJA 4Q8EA 4E7IA 5IIKA 3KJVA 3G0ZA 2XO7A 4J2BA 2MUTB 1JIHA 5HMLA 3NGDA 4JLHA 1HNIA 5J2IA 1WSIA 1ZYQA 3RJJA 4YFUA 1ZQOA 1ASVA 2G8KA 4DL4A 2F96A 1SZPA 4KB0A 1A5WA 3V7JA 4LY7A 3PX4A 3TAGA 1NKCA 3KLHA 4F8RA 4IG3A 3KK1A 2DPJA 3ZSYA 4CJPA 3NF9A 7ICTA 5J2KA 3PX6A 2NRWA 4J9OA 3GV5B 4NY8A 1S1WA 1S6QA 3KHGA 1NK4A 3CFPA 3LANA 3VA3A 1JL2A 1UA0A 3DI6A 4GXIA 1N48A 3DRPA 4C8MA 4CFBA 4K4HA 3PO5A 2XRIA 3RRHA 1X9SA 4OGCA 4CJLA 1B92A 4ZTFA 4I2HA 2JEJA 4LSNA 1KVCA 1TFRA 4ECUA 3PUFA 1S0OA 2BQ3A 3AVIA 3QEIA 4UBCA 1S1XA 4E7HA 4NYFA 4QAGA 4M41A 5DMRA 2PYJA 7ICNA 3MXMA 3VQ8A 3MXIA 2IS3A 5KG6A 1TKTA 4AHVA 4KHNA 2NUBA 2OPSA 2BE2A 2XY6A 8ICGA 4F5PA 1U04A 3K2PA 4Z4CA 4ZH4A 5DB6A 2HHSA 1ZQVA 1YTAA 2ASJA 5J2GA 4TUPA 4O44A 8ICZA 5J0RA 4C8OA 3M8QA 4CJQA 2HHUA 2BCRA 3OYBA 3HX0A 3O4NA 3RTVA 4IQWA 5CHGA 5J2DA 5KFFA 4ED3A 2VG7A 8ICKA 1Z3EB 3HK2A 3AVBA 4ED8A 3PNCA 3NBPA 2DY4A 1F21A 4M6WB 1ZQTA 3LP0A 4CEBA 2BGWA 1HUOA 4PPXA 5D3GA 4O3PA 4KLLA 4NCBA 4OKJA 4CERA 3OJUA 2YNHA 3F9KA 3TFRA 3ZT1A 4EYHB 4IR9A 2P51A 4E0DA 2HNZA 1BPZA 4ECTA 4DTRA 5HMMA 4YD1A 4PWDA 3V6HA 4KRFA 3AO3A 4FLXA 4N56A 3ZSWA 3PW4A 8ICFA 5DLFA 1A5XA 4QZ8A 3JSMA 1IG9A 1ZQAA 2BDPA 3TAFA 1WSFA 3PO4A 4PHEA 1HRHA 1MC8A 3T5JA 3ZDDA 2DFFA 4HUGA 3DLHA 2BPGA 1XC9A 1VSDA 3RH6A 3T1AA 4DF4A 1JLCA 2F1JA 4KLHA 1TKZA 1BCMA 3ETLA 3Q8MA 2RPIA 4YP3A 4B9UA 3K5OA 3MFHA 3C2MA 4TURA 4I2BA 2W8KA 1NJZA 1RBRA 4O9MA 1KFSA 4QZFA 4LZGA 3U3GA 4MFCA 3HP9A 4R64A 2BANA 2YV0X 3RJIA 4CF0A 3HO1A 3H8WA 3ULDA 3K4GA 3ISNC 1SKSA 4FM2A 3S3NA 1S5JA 3AVMA 4KLEA 3VQEA 5KFGA 2WOMA 2O4GA 3KK2A 5DQGA 5J2MA 1LAVA 4DU3A 1KDHA 2R8JA 1RTDA 5KFEA 3RR7A 3OY9A 4TUSA 3AVKA 4FZXC 4KLIA 8ICIA 8ICTA 2BCVA 8ICLA 3ZT0A 1CLQA 3LP2A 2HHTA 4RT3A 2OPQA 2HHWA 3HYFA 4DTOA 3MGHA 2W9MA 5E41A 1G15A 3L2QA 3TR8A 4C8LA 3TI0A 1YT3A 3WNHA 4CGDA 4O0JA 3P83D 2Y1IA 1BPYA 3IRXA 2O4IA 2W9AA 3SQ1A 3SQ0A 1CXQA 3V9SA 3E01A 4R8UB 1KSPA 4I27A 1UT8A 5DDMA 3I0SA 4RW9A 4RNNA 1IXRA 3V9XA 4O3SA 4F2RA 1EETA 1WAFA 3H8JA 2R8GA 2B6AA 4CJVA 4PHPA 1L3SA 4IFYA 4I2CA 3NGYA 3O4QA 3JPOA 4B8CA 1N6QA 2NRTA 2ZE2A 4LH4A 2P5GA 4UAYA 1S9FA 4IQVA 2PZSA 3SUNA 2F8SA 4KHWA 3RAQA 2V9WA 3WNFA 9ICXA 5KGXA 4ECZA 1NK9A 1BPEA 2P5OA 2ZD1A 3AU2A 3AU6A 4Q0BA 4M47A 3M8PA 1RT4A 3QEWA 5D49A 3AO2A 1N5YA 4QZ9A 4MFBA 5CZ2A 2C22A 3GIKA 3EZ5A 1VSJA 4HVJA 4JRQA 4X5VA 3UQ2A 4PHAA 4XIUA 2HVHA 5DK5A 4WE1A 5KFVA 1LW0A 5BOLA 3QZ8A 3BQTA 4KV8A 1D9DA 3QZ7A 4KMUA 3SUOA 3OS1A 4UB5A 3T3FA 4CJWA 4FJXA 3ISDA 7ICRA 3AA2A 1EXQA 4CF2A 4M04A 3PMLA 3MEEA 5DBCA 1MU2A 1L3UA 1TKDA 3T19A 1BIUA 4J2EA 4MEYA 5KT7A 1XSLA 2PYLA 2BQUA 1W9HA 4EZ6A 4ECWA 7ICFA 4OLBA 1DLOA 2ZUCA 8ICAA 4M3UA 3THVA 3GV7B 5D46A 1FKPA 3B0XA 3ZDAA 3MR3A 2J6SA 4JWNA 3QETA 3RBEA 3CM5A 3C23A 4E1NA 1CZ9A 3K5MA 5I42A 3M9NB 5HRSA 3EW9A 3LP3A 5CYMA 5L1JA 1TV6A 3AVAA 5DLGA 3VQ5A 4B9SA 3UXOA 4MFAA 2F1IA 2BKEA 3ZSXA 1GOBA 4KFBA 3NF8A 3OYAA 3K59A 1FK9A 1XHXA 3OYGA 3AVNA 1BL3A 1REVA 3OYLA 2AQ0A 3I0RA 4QZAA 3GDXA 1SKRA 9ICVA 2A1JB 4EYIB 4B9NA 5J2AA 3DM2A 4CEZA 4CEQA 4F3OA 3C1YA
chains in the Genus database with same CATH superfamily
4FNHA 1JKHB 2R8KA 5DM7L 1BVSA 1BIZA 2OI2A 3DOMA 4E2FB 4H4MA 2E1FA 4YMOA 3DKDA 4FWNA 3UVJB 3FZLA 4QWAA 3KLEB 3MWTA 1J2NA 2CXEA 3A8IA 1RDWX 3WK9A 2PDAA 4XQ8A 2Z1IA 2OFGX 3AQPA 3BSNA 4CHQA 2ZTEA 1LK5A 5HMYA 5J2FA 1NPPA 1EKEA 4F5OA 4FPAA 3NWGA 1MWKA 3ZT3A 1RT5B 4PPZA 2Z4PA 2PC6A 2FLNA 3ZEUA 4I4BA 3AEVA 4Y2AA 3ASMA 1S1TA 4A8MP 5GAEI 1W2BM 5L1MA 5AQWA 2EFQA 2MQ8A 1UPHA 5C2GA 3QSYB 1CVJA 4FLVA 4U8VA 4JMUA 3FDSA 3MTKA 1EZZB 3M32A 2ZE2B 4A8WA 4DO9A 1DAXA 5GAGI 2PN6A 3D2FB 3ENQA 4UOGA 1WWVA 2IIRA 2DHHA 4MKYA 1XMQJ 1RDFA 2OSQA 1NK6A 3RH4A 3SUQA 2Q43A 3KWGA 3Q86A 2JRSA 2ZD1B 1WTBA 2KYXA 2E5LJ 5M2UA 2NRZA 3KFUF 1IKXA 3CFOA 1ZXIA 2Y0BB 2P9IA 2AKWB 2ZM6K 3P3DA 4BX9C 2DCLA 3NGRA 2PO4A 3H98A 3V81B 5AQHA 2VQEJ 4NLKA 2DR9A 5I3QA 1IKVA 4TXSA 3F41A 4ITSA 3I5AA 3GJQB 2U2FA 3GL1A 1Y5IB 3JTPA 2B8PA 4F5NA 5AM3A 4O0IA 2MU2A 1X4CA 4O4GB 4DBQA 1QE1A 3G6XA 3NFAA 5LSRA 1VQ7N 4N8OA 2JH3A 3F56A 1N63A 1KVKA 3PHEA 5IM0B 3NDKA 2XMVA 2R2SA 4ZJQA 2ZJPQ 3MDCA 3HXMA 1IBLK 2CQDA 2DGOA 9ICGA 5J2PA 2RU9A 3IKMA 4ISFA 4CRXA 2AYBA 2ISOA 3GYXB 3HOSA 1RU2A 3W1YC 4XO0A 1XIQA 3OT9A 3MPUB 1XMQK 4RUCA 4ZHRA 4XDDA 2UUAJ 4IBNA 2VBWA 4CO0A 4YFKA 1OSDA 1PKUA 3J7YI 4BG9A 4DX5A 2VFVA 4TKTA 2O5DA 2FY1A 4CJ7A 1GLEG 2MGZA 4UTGA 4M63C 1RT5A 5AFUH 1XNQJ 3D0PA 3KKFA 1K0VA 2D0OA 3ZO7A 3QBCA 3DLJA 2OGUA 5C25B 3RB3A 2KN7A 2F8LA 4FXWA 3VQPA 3IFRA 4C4WA 3CEDA 1HX1A 4WQ4A 2F8MA 4BC2A 4MYTA 3MM6A 5HQLA 1SV5B 2FZKB 1QDUB 3MMAB 1HWIA 4DV5J 3QEAZ 2LU1A 1IR1A 3B6PA 4DCPB 5HHIA 3PM9A 3TEHB 5IOLA 1OPIA 3AO5A 4H5RA 4U7UK 2ZJAA 3OYNA 5GTHU 2XVTA 1NKBA 5EE1A 4DV6K 2LFVA 3QT8A 1Q8BA 3MMJA 3RAXA 2VF3A 1HD1A 4RNOA 1RT7A 3QUTA 1S72S 5HK4A 4JI8F 3KK2B 2JZBA 5M1PA 1UW4A 3OSNA 2BGGA 3V6DB 3EVOA 2W04A 4CK2A 1RU1A 3VTHA 2E3TA 2V4JB 2IHMA 2HFZA 4LFBK 4DQRA 3UMGA 5CYJA 1FKPB 2OTLN 2Q4TA 4R79A 2DBYA 1YHQS 2HVIA 4Q44A 3DXBA 1VK3A 5A8WB 5DETA 5CD4A 1KVAA 1HIWA 2FHJA 1AUSL 2YHXA 4CF4A 8ICBA 1C0GA 3TNVA 4FLTA 4URGA 3QNNA 2CG8A 3WU2U 2LA4A 3WNEA 2XTJP 4L74A 1RACB 2D3OR 2L9NA 4DUZF 3UR0A 4BREA 4F71A 4RQ7A 4V19S 5GIOA 4Z37A 2RAQA 5C25A 1GLDG 3SQGA 2DRBA 1RDBA 3SCXA 1RBLA 3LZJA 2QLXA 3S1TA 3D6RA 1XQSC 2JFDA 4FS1A 3FEZA 4I68A 4M5GA 4DQ8A 5F8GA 4F4AA 2QKKA 2DHGA 2ZGZA 1BXNA 4DUTA 2VDIA 4DTNA 4NLQA 2G0IA 2DITA 4B9QA 3IGNA 4US8A 2C28A 5HP1A 2QARB 3EY1A 2GHVC 3MUVP 3DOLB 2A2CA 4F9OA 4RWXA 5AIBA 3F2KA 3CDUA 5ALTA 5F8LA 4KGKA 3MPDA 3D68A 3JS9A 4CF5A 2GVDA 1H1VA 5AQRA 1BUXA 2UUCF 3P45B 9ATCB 4HL9A 3LM2A 4C0HA 2W01A 1MDUB 1XEZA 3TJAA 4TU8A 1C1CA 2IY5B 2FI1A 3RYLA 2KM8C 3PJXA 4EP4A 3DJCA 3CJ4A 4YXJA 5B0AA 3BF3A 3L3UA 4CLKA 1VSHA 1P8GA 2PFUA 1RADB 1FNMA 1IBKJ 2XGQA 2B4PA 5KFQA 3AVFA 3BBCA 3V1QA 2VKRA 1F0MA 5JMNA 4KLQA 3FR0A 2OUGA 2K8GA 2I1QA 3VQQA 2PI4A 3SJHA 3IBCB 4EENA 1I94F 2WW4A 3IG8A 4PUOA 3CXCM 1HYZA 4I2PA 3G71N 1U48A 1GT8A 4M6WA 5IIJA 1B7YB 4QS9A 5CEHA 3O08A 3VQ4A 3K2YA 4OKKA 2BCQA 4BHQA 2BM1A 1HBMA 1YX2A 4JS5A 2ASLA 4YY3K 2IVOA 2ZIUA 3NUQA 4CEFA 3D0GE 1J2MA 1ZQNA 1UPPA 3ZFVA 3UNYA 2NUHA 2J4RA 1B43A 5J29A 1YIJS 2CIMA 3MCNA 2HRYA 3S6JA 3I9V9 3KK1B 4K5SA 2O8DA 2VONA 1Q95G 4DU1A 2C2DA 1J5OA 4RW7A 2MQLA 3POTA 4JI5K 3SEIA 4E7JA 4DPUA 3M6UA 3F9MA 1VRTA 2NXCA 3D7SB 1UVJA 3MEGA 1VQON 1RISA 2M2BA 2DEIA 2V8PA 3M4XA 2PXIA 4LR8A 3ZZZA 2I9SA 4OHZA 1OVYA 2HDOA 1JKHA 2KSOB 1NZBA 4JRPA 4H0YB 4USMA 4CLWA 2C42A 2ZH7A 5DZ7A 2KU7A 3L7UA 4N5SA 3C6TA 4YNQA 2HQCA 2IHNA 2W25A 4P7VA 1XMOF 4ECYA 1JLGA 4DXLA 4FWKA 5HRRA 3G6VA 1RAHB 4Y2RA 2NNWA 2J7UA 4LT6A 1JMTA 4PWDB 5C5JA 3KVGA 5AQFA 5J2QB 1FERA 2FJDB 1NHKL 3QGGA 1SUQB 4UF4A 1FE4A 4LRBA 3IP0A 5KFKA 4DF8A 3H3NO 2JGUA 1TL1A 1PSDA 4I9QA 4U67Q 3BP8A 1NOZA 5LXRA 1LWEA 3DN9A 2AYGA 4DPWA 1ZQXA 1Y88A 3RSEB 5AQXA 3LPUA 4DQIA 4OHXA 1BQXA 3JPSA 1CJKB 1A9NB 3LUYA 5KPRA 1T3VA 3CG7A 4W92B 4IEIA 3HW8A 3QIDA 2KZZA 5GADI 4EEYA 2ZC4A 4YN4A 1MQ3A 1KQKA 2V4RA 4B1YB 3GYGA 3QEPA 1KHVA 4RBUA 3SSSA 3JPNA 3KLFA 3CIZA 3I5CA 4FK2A 3KJNB 2W7OA 4O0NA 3W64A 3VAGA 2NRVA 4N41A 4QBUA 3CXCR 2A1JA 3MR5A 1IBMJ 4OZ3A 5ALLA 1ASUA 4FZYA 1ZQEA 1N33J 2V8GA 3N7RC 1FA0A 4O4RA 1FJGK 1HPZA 1ZBHA 2ITGA 1M5OC 1SJ3P 1QQCA 5AZJA 3QUBA 5KFHA 4BXOA 2CJKA 4OZNA 3VTIA 3SBGA 2EC0A 3KLHB 1BA1A 5F8NA 4Q0BB 2MAXA 4TY8A 2B5JA 3BJYA 3CB4A 4IO9Q 1RAGB 2XMWA 3HX9A 1KAYA 1KW4A 4WFXA 3NAHA 2AWZA 4IRCA 1U6BA 3QEBZ 1BQMB 2YHAA 1RGVA 1EX4A 4QJFB 4GY2B 3NAEA 2UVVA 4W5OA 5FRMA 1VGYA 4FJJA 1EP4A 2YKMA 4GIBA 3KK3A 1ZQRA 4DFPA 2W4DA 2W03A 1FIQA 4UY8O 1KTQA 4M63A 3ZZRA 1TVAA 4NRUA 3QLHB 4WP9A 3KUHA 1HFEL 5EX3A 2R4FA 4B3TK 3O2IA 1RWKB 4KGVB 5KL8B 4HH0A 3O5TB 1K73T 1HMVB 2QLFB 1HBNB 1W7WA 2ZH6A 3A5LC 3OS2A 4FF3A 3M6KA 5ETSA 5BRHA 4CH0S 1RT1A 1N56A 1WUUA 2KTQA 4WQ4C 3H5SA 1WNSA 3NLCA 4YDUA 1X3MA 3AXKA 3KKAC 3BPDA 3TANA 3AHPA 2V69A 3M05A 4HI1A 2QKBA 2DR5A 3KHLA 1F9EB 1HBNA 2P6UA 4NLZA 3SEOA 5FLXU 1PO6A 5KFIA 3OLBA 1VQSA 5IT9U 3NCRA 2W7PA 5FPEA 3EZOA 4OLAA 1JCFA 3BO4A 4I7FA 5E3RA 4AYBF 3U3YA 2Q79A 4EWTA 3DGPA 4OLPA 4NZ6A 4FJ7A 5JS1A 5F2RA 2YMQA 8ICPA 9ICOA 2FJVA 1HKBA 3FBEA 2UUBJ 4A8OA 3MURP 3CJ3A 1OJ4A 3JQKA 2J8AA 1VRUA 5JS2A 4A8FA 4JWMA 4MQ3A 1U49A 8ICNA 1KD1O 2EVZA 4Y0WA 4Y2TA 5JRTA 3KD5E 2GLEA 1FDBA 5FDLA 1TL3A 1GFWB 2W4PA 1YRUA 5D3GB 1CZAN 4P72A 1WSJA 3ISBA 1U1LA 4DV0K 4C1NI 3UQSA 4H0OA 1J5EK 1RAEB 2OTJN 4ATNA 2D0PA 2K06A 1RTDB 3B9JA 5IWAK 1RBUA 1S57A 2YKNB 2GV9A 1VQ5S 2AD9A 3G9CA 5D15A 1YITN 3IR7B 3BGLA 3VGLA 2BZ2A 1M5HA 5ETNA 3OYJA 3SQGB 3O9UA 4BDYA 3PKMA 3KNAA 2I6XA 2UXCK 2UVWA 4L8RB 2Z1JA 1L8OA 1X31C 4CIFA 1KD1T 3P5BP 1Q78A 3CIPA 3FFKB 2IRUA 3LDLA 4B3SF 2RT3A 4GFJA 2GAGC 5K14B 4DSKA 2FYXA 4K7QA 4C48A 3JSYA 4G6VB 1VSLA 3H7IA 1X5OA 2P2CB 1J27A 3FC4A 2YX7A 3US5A 1RBVA 1NJIO 4KLGA 5GAGP 4M3TA 4W5NA 2AW0A 2K1RB 2GGPA 2M70A 2G07A 2IPOB 5ETOA 3CCMS 3CCMN 2DIVA 3D6JA 2FHJD 4ELUA 3N4WA 2UU9J 4UQTA 4KH5A 4AQYJ 2VKZG 1TUGB 2XZTB 3NL0A 4FK4A 1FDAA 4WYWA 4GKJJ 3W3DA 5H9FJ 4XA5A 3ICLA 2JEFA 3OL7A 1HLUA 3SAFA 2BANB 3CCEN 2YPZA 4BY9C 1KRPA 4BWMA 2QWPA 1LW2B 1TAQA 8ICMA 1TP7A 3HBTA 2UXDJ 1IBMF 4KT0C 3G2XA 1CPZA 4BWJA 1N5TA 4P10A 3PR4A 3D2NA 1RWPB 1U02A 1KOHA 4K2XA 3THXA 3MM5B 4J2DA 3TAEA 2MLZA 1HUXA 2ZXIA 2DISA 4JKFA 2CJQA 5E7OB 3CMAN 2G8FA 2B4UA 3OYIA 3T41A 2XZDB 3MX2A 2E6LA 5GVQA 4DV3F 5I9EB 4JI6F 4G9BA 4BCAA 1QAJA 1L3KA 5D4PA 3UDLA 3ET6A 1SQGA 3WKEA 4M3WA 1VRTB 2VKQA 7AT1B 4JI7F 3ONNA 4C97A 5IS2A 1PUZA 3ETOA 4ZN1A 1YJNN 3WXKA 1A6SA 3SD7A 1S99A 3M2RA 1LOUA 2F1HA 3JXOA 2EZXA 4WU2A 3C1ZA 1C0TB 1HHQA 1UTAA 1PAEX 1NJXA 3DRSA 5F0XA 4EFAC 2X1FA 5J2HA 1HR0K 4QZGA 1SWVA 3ZD9A 3V1OA 2ATQA 2NZTA 1NK0A 1QZ5A 1CQNA 1VSIA 2O66A 2XSJB 1SPBP 2WTFA 2ATLA 5DZ6A 3OXLA 2O8FA 1M5KC 4KBIA 2HNZB 2E1CA 1X9MA 1SQKA 2RMLA 3AO4A 1YIJN 3H0LB 4RW6B 3O1LA 1Y3KA 1YJ9S 1SCJB 3IRUA 1ZBUA 2DHAA 3TQEA 4C80A 4JI1F 4IH7A 3QQCD 2YWFA 2DNRA 3K1ZA 4F25A 3RMBA 4BE0A 2A1AA 3NGZA 5LJ5Y 1TMMA 1WDTA 7ICPA 1UEVA 4O5BA 1D8YA 4QIFA 1W2IA 3QBWA 4MT1A 4USTA 3G71S 4ZTJA 1AT1B 4G3IA 2J9DA 1NOYA 1A6LA 3MEKA 1EB0A 4FLZA 3KG4A 2ROPA 3MAAA 2RQ4A 5A8RA 4DV1J 4M5KA 3FBBA 3NH0A 1QTMA 3C8YA 1M90O 3N01A 3EGWB 3MC1A 3CD7A 1QTNB 4H4OB 3D2FA 2JRZA 2X51A 4FM1A 3OPKA 3TJ8A 4FZZA 4FXDA 1NHUA 4IL6U 1HWLA 4X4UA 2LQJA 3BSOA 5DBAA 3CULA 3VGMA 4DR6J 1ZZNA 3VWSA 1K0TA 1Y0HA 1JXEA 5ETMA 3HSZA 1S1WB 4WYBA 4DEZA 3QJPA 4CH7A 1DHMA 1TUWA 3L09A 2YX6A 2KHQA 4ZVRB 1EQMA 2K1RA 4BRMA 3HWTA 4R0JA 1K1QA 3H59A 4CTAB 3DV9A 3QT6A 4GC6A 4JV5K 2DY1A 4KH1B 1SZ2A 4P71A 5IIIA 2O6KA 1IJFB 5ELZA 2ZJQL 5ITHA 2UU9F 4ILRA 1T94A 3AL0B 3U6FA 2NO4A 3TWZA 4LQ9A 4J9PA 3GYNA 4NLUA 5D0EA 1HWJA 3H25A 5KFSA 3EGVA 1H38A 3R6LB 5ALXA 1N8RO 1S6PA 2XLIA 4MYUA 5CCMA 3HHLC 1TK0A 1WC1A 1BO5O 4H5TA 2C3MA 2DNOA 4AHSA 3VMFB 2BJEA 4Z6FA 1VHIA 2X1AA 4HH1A 3GDQA 2ZHOA 2VFTA 1U1RA 1N61A 1CQMA 2ZWPA 3H5YA 1HJRA 3GP9A 2GX9A 1WNEA 3D0HE 3WKDA 1HW8A 5JTIA 4U6PA 4ZVUB 1MA9B 1FTCA 2NXUA 1RBOB 5ETQA 3Q23A 4YD2A 1NBWA 1RYSA 2BACA 1RTHB 1VQMN 3P4UB 3WXIA 3C95A 5ALSA 2KLAA 1DGJA 1FF2A 2AU0A 1YJ7A 2DNGA 3RGIA 2W2OP 4DTPA 1MSWD 3BF1A 1X4DA 4NA1A 1XO0A 4IXCA 1RT2A 1XQIA 1VYAA 3HP6A 2ZJQQ 2HAFA 3DOKA 4CF8A 1JLAB 3DGPB 4ANCA 3MCMA 4B8AB 3NMUA 1NGGA 3NGUA 4U7CA 2M5YA 3NASA 4KAZA 3LAKA 4CLUA 2V4QA 4LBPA 5EX0A 2GJFA 1DY3A 1K8AT 3ZC4A 1S8OA 3ATUA 1M5VC 3KUGA 4CEDA 2EXUA 4M1KA 1SL2A 1LKZA 1UFWA 3AY0A 3UD3P 3ISZA 4RU2A 1COKA 3RRGA 2YKOA 3LAMA 4KLDA 3LL3A 4U9RA 3N4QA 1O03A 3Q89A 3CSKA 2E1MC 5B0EA 6FDRA 1Q82T 1L8LA 5AE1A 3CF5Q 4X64F 3HRDD 2QGFB 5IQQA 1E6VB 4A61A 2COLA 1ZOLA 5KFAA 1QE1B 3HHEA 4YY3J 4NCGB 3ISCA 1WEYA 1AXQA 1RDRA 1X9WA 2NS1B 3CE8A 2VANA 4I7FB 4BRNA 1TAUA 3C16A 3KK3B 1NBEB 4KX3A 4MF2A 5KFOA 3HI9A 1S5ZA 2E2PA 5HROB 2H5XA 4M9HA 3QWPA 3MECA 3UCZP 5J0YA 3ALRA 1QSLA 1S9EA 3ZYYX 5ADZA 3H4DA 2EK6A 2YKQA 3FFIA 3M1VB 4OPHA 2HSZA 3CJKB 4NLCA 5FPDA 3H2LA 3L4IA 2FE9A 1ITPA 1LXJA 3C6UA 5AE3A 3SXLA 5ETTA 3LP2B 3EO3A 2IRXA 3IGVA 4HT5A 3CQ8A 2C2RA 4OZ2A 4X4RA 3OHAA 1ZQFA 3M2VB 4KRWA 3AA3A 1HNXJ 5DG9A 2L5YA 4P0PA 2MKJA 3J7ZO 4EIAA 3AARA 4GNIA 1QSYA 3TOQA 2I8EA 3VQCA 2VU5A 4ED0A 3M9OB 4XH1A 2IAJA 4YMMA 1BHLA 2OEMA 4CFDA 4FS2A 1P6TA 4CGZA 1D4XA 7ICGA 4DL5A 2DXDA 3MBYA 1T4GA 4JK1A 2HNDA 2K3IA 2HIYA 4ZPCA 4JV2A 5C24B 4X4SA 4DCOB 4H0VB 2BHNA 1HQUB 2VWJA 5CABA 1KS2A 4M2YA 2MSSA 1HNZK 4GVBA 8ICSA 1GMUA 3QWUA 3NNHA 4CEAA 2AMCB 1RK8A 4OVLA 2R7UA 4IQUA 5M1FA 3EYZA 2ZIWB 1VK0A 3HKZD 2GQCA 3PDNA 2V68A 2XGPA 3OHBA 3MDFA 4FZMA 1R59O 4CDIA 1LWEB 4IUFA 2VWBA 3H8YA 1RQNA 3EZWA 1KFDA 5ALJA 1HQEB 1S77D 2PY5A 1OY6A 1W7AA 2N4CA 4CZEA 2IM2A 4PXEA 3L3VA 2QB0B 1RTIA 1HYVA 5DB7A 3EPIA 1FRIA 1VJ5A 1OY8A 4B17A 1VQKS 3F73A 1IJEB 3PY8A 3S3MA 4DCJB 3D7EO 3L2VA 4JI1J 3VEYA 2E9ZA 5A6PA 2FUG9 2YHBA 2YVSA 4CJSA 1NSPA 1Y9OA 1E3MA 2KDOA 1Q8LA 1VQPS 3THYA 1NAQA 4ZP6A 4IO9L 2JH1A 3DNCA 3K7RA 3QFHA 2DRDA 1T6CA 2UV8A 4E7IA 3WK7A 3VCBA 3X1LB 5IIKA 2XMAA 3KJVA 5J2NB 1BA0A 3G0ZA 4J2BA 5JLHA 4WQ5A 4YEAA 1DRGA 2DT9A 2YTUA 3HHLD 2EAOA 4DUYF 5HVHA 2F96A 1SZPA 4KB0A 1VQ8N 5HJXA 3CP8A 3TAGA 2NYVA 4IG3A 4J90A 3GWCA 2O8DB 3KK1A 3SBTA 2F3JA 3V5RA 2KT2A 2W7AA 5J2KA 3J7YU 2U1AA 5MLCV 3GV5B 1S1WA 2DGTA 3NVWA 4JI6J 2FSJA 3A13A 1NK4A 1RM6C 3VCDA 1MWYA 1FWPA 2DO0A 2BDUA 3DI6A 4USVA 2RU3A 2Q66A 4CFBA 3QUQA 4K4HA 5LY3A 3PO5A 1U1NA 3RRHA 1X9SA 4OGCA 1EAYC 2NCKL 1B92A 2EG1A 2KL8A 2XS7A 1R8HA 3FUYA 1SAZA 1RJJA 2JEJA 4ILGB 5EY4A 3EM1A 4ECUA 4UBCA 4TU9A 2HCFA 1VRUB 1S1XA 4MJKA 4E7HA 3I0SB 4NYFA 4QAGA 3FFIB 1TTHB 4ZLPA 4B3MK 5KG6A 1TKTA 1Q86O 4OYPA 2WB4A 3ENOA 2OPSA 2C2ZB 2BE2A 4BRGA 4AYBC 1WWUA 2XY6A 3DDKA 1TMJA 4ZH4A 5DB6A 2KICA 2B9YA 4K8RA 4HEA9 4TUPA 5EVZA 1FXLA 4HAIA 3HI0A 4CJQA 4LF1A 4YOEA 1ZAXA 1VQ7S 1NU0A 1YZ7A 5F41A 1I94J 3HX0A 3O4NA 4IQWA 5J2DA 4FPBA 1EWQA 2ZITA 1N54B 1PC5A 2KHDA 3NBPA 1H7XA 1ZQTA 1PBUA 1SH2A 1L7PA 1YRTA 4KLLA 5C42B 1S1UB 4JI6K 5DM6L 2E5JA 5IT9O 1IBLJ 2YY3A 3IUCA 4ECTA 1UVKA 4DTRA 5HMMA 4YD1A 4CP5A 5T41A 3SIPB 2ASMA 3WBZA 4PHTX 2OAUA 3ZZTA 2F63A 2F4FA 3ZSWA 1PAUB 1N5SA 2IJFA 1IG9A 1HBMB 1AQ6A 1SQEA 3VAKA 1Q7LB 1MC8A 1UPMB 2D9PA 4CO3A 2KE7A 3DLHA 1Q79A 3P31A 4HUGA 2BPGA 1XC9A 3CCQN 8ATCB 1Z2LA 2O8CA 4AXJA 1JLCA 2VZ9A 4K4XA 2F1JA 4KLHA 4K4ZA 3IMQJ 3E66A 1BCMA 3GB0A 4EELA 3C2MA 4I2BA 3OL6A 1LW0B 2AYMA 1FWKA 4AQYF 3EZUA 4QZFA 3UE2A 4KGMA 4MFCA 4AF1A 1VBXA 4DR5K 3ILOA 2CH5A 3CPWM 1VMBA 2WCXA 1N8RT 1E4FT 3H8WA 3ULDA 3K4GA 1ZD5A 3FRYA 1HKCA 5BRFA 4FM2A 3S3NA 3AVMA 1DBDA 5BYSA 3VQEA 2EFPA 3SBMA 4FYYB 5DQGA 4DU3A 2YCHA 5AKJA 2R8JA 1ZAWA 2HGLA 1WB9A 4FVCA 4V19X 3CF5L 3SK3A 2ZDOA 2OEHA 3RR7A 5HAOA 1N88A 4NXNK 1LVHA 3WDOA 4OI0A 3AVKA 1ILYA 1ZPVA 1X8DA 4FZXC 4KLIA 4FL9A 8ICIA 8ICTA 8ICLA 3NCQA 1CLQA 3AD7C 3P39A 2UYTA 2VFUA 4OJPA 2DNZA 2HHWA 4DTOA 4FWPA 3KUEA 2KIVA 4NXMJ 1OSCA 2E5HA 3L2QA 4C8LA 1JJ2M 4UOFA 1QJHA 1UVIA 1R43A 2Y1IA 3PG9A 4OX8A 4I1TA 1S6OA 3OR1B 2GS8A 3MN9A 2YNFB 1CXQA 3V9SA 1V4SA 3E01A 1SC4B 1RTJB 1LOTB 1F3FA 2KOBA 4NLPA 3TUIC 3GFXA 4EX6A 2QA1A 1IXRA 2Q97A 2R8GA 1W25A 4CJVA 4I2CA 2N82B 3RUBL 1ZOTA 2NRTA 4LH4A 2VOPA 1A0PA 5CAAA 4IQVA 3FCWA 2PZSA 4WTYA 2K60A 1WHWA 3PIOQ 2PFDA 2P5OA 2G4BA 1R3NA 4OYOA 2PD1A 5D49A 2HZAA 4P2XA 3HHLB 2HFVA 2CPRA 1FFSB 5CZ2A 2IYGA 4DZDA 4DV5K 2DGXA 1VSJA 1PIEA 4K25A 4X5VA 4PHAA 3OR2B 2A10A 1KHWA 4ZLLA 2HBRB 2ZIXA 4WE1A 4WP3A 5KFVA 2M52A 5BOLA 2IJNA 4H4KA 3T1YF 5AIAA 3GTYX 3QZ7A 1BNPA 2V2KA 2FF3B 1TFWA 4EUVA 4CJWA 4ZVOB 2ZUAA 3AA2A 4XTTA 4CF2A 4IC9A 2FY8A 5DBCA 1MU2A 1L3UA 2OPRB 4PZOA 1TKDA 2VBXA 2HSEB 4DJBA 1X9JA 3GFZA 7ICFA 3SCJE 3I0RB 4DV7K 2ZUCA 4DV5F 4M3UA 3ETRA 2DR6A 1WOSA 1CG2A 2OCEA 2DL0A 3QETA 4H5WA 3NGSA 4E1NA 3K5MA 2QEXS 3EW9A 4PZVA 3HLUA 5L1JA 2WFAA 3UXOA 1N0VC 3OFGA 2MA1A 5I3PA 1NGIA 4P73A 4MFAA 4I6AA 3ZSXA 5I42B 1R27B 3GR1A 1Y3JA 3OYGA 3OYLA 4QZAA 1HNWF 9ICVA 1XR7A 4HTLA 4B9NA 2NUUG 1O6XA 4GKKF 3RBXA 1P90A 1RAAB 3EE3A 3CCVS 2CPHA 4RO0A 4RL1A 4CEQA 4CEZA 1KONA 3C1YA 3C65A 2BPFA 1TE2A 2XCAA 5FROA 2ZUBA 5IM0A 3TW0A 4TSXA 2QZ8A 4K43A 1D9FA 2KG0A 4WE1B 2XICA 2BV3A 1DT9A 1XBWA 2A40A 2VQEK 1UFLA 3CPEA 5HQ8A 3SV4A 2HEKA 4O55A 2YI1A 9ICKA 3TX8A 4QQBA 2GMJA 2A19A 3QUCA 4OI1A 4ZVSB 4BG8A 2IOHA 1IM6A 1TZ0A 4FLYA 1BD6A 2GWKA 3M7DA 3BR9A 2D74B 3MM5A 2R9LA 1TUYA 2ASPA 7ICSA 4FW1A 4DL2A 3VQTA 2P9IB 4B3RK 3RR8A 3HSDA 2FJWA 4NEYA 3V9WA 1LB2B 3LDSA 3MK6A 3O8WA 2VASA 2NYIA 4JI4F 1KFTA 3UN2A 1ELOA 3R5CA 3D45A 3S41A 3PEHA 1MN9A 3MR7A 5M1KA 2NXNA 2ES6A 1JLQA 2CZ4A 3E9LA 3I96A 5BXIA 3FRZA 1M1GA 5AKGA 3TA0A 2P66A 4DR1J 4BRAA 1K6YA 4F0KA 1GX6A 4WXWA 1YBTA 3OR1A 5D77A 4WF9Q 1PZNA 3BKFA 1B22A 2ZH2A 2PFNA 3CJAA 3QU5A 2CPZA 2HMPA 1DTQA 2CNOB 2J5AA 5HMXA 2ETJA 1COOA 3O1BA 4Y2MA 5U47A 1SQFA 4ETZA 3QNMA 5IQ6A 2QA4G 4H0PA 4BUGA 2YKPA 3H42A 2XMTA 3ZSQA 3FGVA 1TL1B 3KWIA 2E7WA 3CJ0A 2MJUA 5CA5A 1WG1A 3DEEA 4DS4A 2LVWA 1G7CB 5HRNA 2ASDA 3UMCA 4OCZA 4PKDB 2X3DA 3WT0A 4Y2YA 4CM0A 4GXJA 1T03A 3QBXA 3U7JA 4I2AA 2G2YA 3BH7B 2WRMA 2KXFA 3DRRA 3EVMA 4G1QA 1YTYA 1HI0P 3RSEA 1VC6A 4EHUA 1P27B 5F8MA 2R7XA 4GVLA 1GTHA 3EX7B 4AH9A 3C6TB 3BBFA 2OH2A 2DFHA 1RE1B 1OYDA 1XHZA 2PMZF 2QKQA 4I2FA 3O0FA 3ZT2A 5AM1A 5KT6A 3LDOA 3KHHA 2DGQA 3BSAA 3NNAA 3Q7BA 4P4OA 2JLEA 3QRPA 1WG5A 3UO0A 2EANA 4QZVB 3G8TA 9ICMA 1URNA 4YHHJ 5HMZA 4Z94A 4JKGB 4JI7K 3POTB 3VC8A 3PV8A 2DNQA 3WQUA 3TZZA 1OPZA 1UETA 2FLPA 2B4JA 2AJFE 4M9GA 3TPQA 1TVRB 4KPCA 4ILHA 3V6KA 4P2FA 2CNKB 2QLTA 5LL6d 4W5RA 2JWLA 3I28A 4F0HA 4ZVTB 1U9LA 4L3KA 2E29A 3OL9A 3CJ2A 4QIWC 4MDBA 2HYIB 4FVUA 3ICXA 3OTCA 2ZH4A 4FSVA 3UKUB 4LIRA 3HFVA 1W2BR 4CNZA 2NLWA 4KLMA 3PFEA 2M9KA 4ZVHA 2F8EX 1KVIA 1REVB 3FBCA 4K4VA 2RHSB 1P9QC 3CCSN 1OYEA 3W65A 3KKRA 4MK8A 4Y28C 3ZTRA 7FDRA 4HDHA 4LF8K 4CF9A 3QDKA 1B0XA 3A3OB 1OQ3A 5AKLA 5ALZA 5AJ3F 2VPZB 1XNQK 4RG8A 1RFQA 3QLHA 4XPEA 4TNOA 1JLFB 4R65A 1M6YA 1YDLA 3JAMY 1EKSA 1Q18A 4C7YA 4KHSA 2IA0A 5CZ1A 1OVQA 4DV4K 1WUAA 3O6QA 3CCLN 4FOIA 1ROFA 4KREA 5J0SA 7ICVA 2GO9A 1HJOA 1AYEA 3DOLA 4W5QA 4O5EA 5ALFA 2MKCA 2W6LA 3CFRA 2FMQA 1N4LA 1VOMA 2R2TA 1WN7A 2MKSA 3CMAS 4OI6A 2IDEA 4PPDA 4QOTA 3AVLA 1RBAA 4JKGA 2MZRA 1WC4A 2RQKA 4URQU 3MDAA 5FRNA 3BGRB 4KBOA 3QGHA 1JK9B 2P6TA 2JOQA 4NXMK 4CGJA 3DLGB 2CNLB 4ZP9A 2P35A 2HZCA 1ZBSA 1C0MA 1JQGA 4DSEA 4NLOA 1IVZA 3OTQA 4R0EA 4K4WA 4DMNA 4GVMA 5HP1B 1SJFA 2ZZTA 4ZJOA 5IIMA 4USWA 5HLFA 3MPWA 3I55N 2GMLA 1S0MA 3QAEA 4Y2PA 3I5BA 1EO1A 5HRPA 4PG6A 3GZFA 1T3NA 2F4VK 3TABA 2UU9K 2RRDA 4JKHA 3M6GA 4DR4J 3AGKA 1D5AA 4B3RJ 4DR7J 4CT8A 1Q8IA 3W60A 5KRSA 4RBTA 4ES2A 3J7ZT 4Y2JA 3EGZA 4IDHA 7ICQA 2H5EA 3P8BB 2RHKA 4J9VA 1F9FA 4KO0B 9ICJA 2VIXA 3LYSA 2BM0A 5I3UB 3N6LA 1Y7PA 3HKZF 8ICWA 5CR0A 3HVRA 3O6WA 2FZCB 3C6HA 4A57A 1AB8A 3SNNA 2KMDA 4UAVA 3IDHA 3RH5A 2CPXA 1N5XA 4OYAA 4FWOA 1ZQIA 5E3QA 4HYKA 2H3IA 3RJKA 4PYDA 2C2NA 5IILA 5AQMA 4UZBA 4GC7A 4FO6A 3SQ2A 1RNHA 4LZDA 4FFDA 1PGZA 1LFPA 1UJ5A 3QJJA 3WXMB 1XNQF 8ICOA 3DWLA 5JICA 2UVUA 3M1FA 3IAM9 4FVMA 3ILIA 2ZM6J 5L1IA 2CPEA 3R8YA 4FN5A 2MTLA 1VBYA 3BUZB 1QY7A 3TAPA 2FHKA 3EVWA 4Y3CA 2WF8A 2H51B 3I82A 4OFZA 4GMJB 3LP0B 2UUAF 1H6KX 5KFMA 1VQLN 2OZSA 1PCAA 5J2JA 1VSMA 4EBEA 2W4CA 2D5RA 2XMMA 4CYUB 5GAEU 3IS9A 4HHJA 3TAQA 3SI6A 4GLXA 5AKHA 1UT5A 4L72B 5KFUA 5B0GA 4Y2CA 2YMPA 3MTJA 4CJFA 3AGRA 4I2IA 4TLRA 3B82A 1U2RA 3K0JA 4ZPBA 2UUBK 4Y1DA 4NL9C 3NRWA 3R5BA 1GK8A 3PIOL 4HDGA 1T9YA 3HCXA 4KLSA 4P9SA 5FIIA 3WEEA 5BOMA 3PSIA 2A5XA 3NWRA 4QWEA 4M94A 2IDOA 5F1XA 2P6SA 5ALDA 3R3TA 4R63A 4CZLA 3JPTA 3JSRA 4G9ZA 3OVBA 1VQKN 4FNIA 3T6BA 5G5HA 4XRHA 3KZXA 3OTOK 3HRGA 1WG4A 2PMWA 4IQXA 3CJ5A 1R0CB 4HUFA 4M45A 4J37A 2CJXB 2W2NP 1MU2B 3SV3A 5D0RA 2MSTA 1Z2ZA 4Q2LA 4Z7CA 4RPFA 4P75A 1NRKA 1NPRA 3MEDA 2VIHA 1KAXA 1U45A 3FZBA 1FXXA 3Q24A 1R7IA 1IJJA 4X66K 3PKYA 4BRIA 3QU9A 5AQUA 3CCWA 3D5MA 1D0EA 3MM7B 3SMPA 1O1WA 4WWSA 3BDPA 3L0QA 3THWA 2Y0SC 4DR3F 2FJBB 1BGXT 1SIZA 4M5DB 3HM8A 3J80O 4X2BA 3LK9A 1X5TA 1FESA 2HI0A 4EBCA 3D2QA 5IV3A 4GVEA 2F44A 4ZJLA 1QH9A 1VBKA 5CZVA 3UW1A 2P9UA 2KT3A 4M95A 1P8ZA 1D8ZA 1NM1A 4O5CA 2DGWA 2ZH3A 3OUYB 2GBZA 2N7CA 4NOHA 4C6AA 1F3VA 3C15B 4CHOA 4IOCL 1CS4A 3KLGA 2H5IB 2QARA 1RHRB 2QXLA 2E4LA 4Q7AA 5K4LA 5KQ8A 3BQ7A 1NNLA 4NX9A 3VAJA 3B8AX 3TX0A 1NGBA 4KTWA 2DR8A 4B1ZA 5H1SQ 3ISND 5GAGU 3NH1A 4YB5A 2BR0A 4ECSA 1RT4B 4A2BA 2L9WA 4RBVA 2ATCB 4X84A 4PGYA 2BUPA 4NM2A 2RQ5A 1N36F 3NRZA 3OBYA 3Q7CA 4YOVA 4DR5J 5DKWA 4J2AA 2CN1A 2LYVA 2VHGA 4IG0B 1X6JA 2BQRA 4B3RF 5T7LB 2ZEJA 3C14B 3RMAA 4CJEA 1S1TB 3OFEA 4I2QB 3DOKB 2G08A 2XMJA 4LF2A 1KVBA 3DFEA 2BMBA 3THYB 1R6VA 3DU6A 2ZTDA 2AEFA 1FK9B 3QFWA 5AXLA 2MY8A 3FQLA 1N33K 2JVRA 2A1BA 3V6DA 4CWBA 4NEZA 5IT4A 4ID1A 2H48B 5HP4A 3CJ7A 2E5SA 3RAMA 1G1XA 3H46O 4CIGA 8ICYA 4IEEA 4FJIA 3C29A 3MN5A 3AAQA 4DQPA 4OJ6A 1IKWA 5C2CA 5KFLA 4QWDA 4JI2F 3CJ9A 1T8EA 3NGKA 1FXDA 1HQEA 4QPXA 4R5PB 1FNXH 3ZSOA 3GJRB 3LQVA 3I76A 1Z4OA 1R0AA 5J0WA 1HNXK 1HBOA 1MG7A 3A3NB 2B9XA 1Q9XA 3C6AA 2CQ4A 5F8IA 1IQZA 5HHHA 5AQLA 1UVLA 4KO0A 4P74A 3VEVA 5ALMA 3C28A 4HHTA 4QW9A 2D6FC 5CYMB 1WCNA 5KFRA 5FLXO 2QYGA 2KD1A 1NWKA 2ZIVA 3C7NA 4E89A 3TUJC 3TZYA 1BQNA 5D0GA 4I6YA 1SXEA 1XN9A 5BRDA 1RG6A 1NEEA 1WF0A 3K5NA 2XCPA 2ZZMA 3U1MA 2J7WA 1XMBA 2F9JA 4A8XA 4HCBA 1IBCB 4QZHA 4Z2XA 4ILJA 4JI5J 1GLFO 1MROB 3PLAA 1EHWA 2CQ0A 2HBMA 5TISU 3CWJA 2UXBF 3CETA 3QINA 3HJEA 2IOFK 4N76A 1FRJA 4MO4A 5DGBA 2CQ1A 2H54B 2R7VA 1A77A 3C21A 4I29A 2WF6A 2JEGA 1UCNA 5A8RB 4LD0A 2AIRB 3T5LA 2CQPA 2HHXA 1NCLA 3JSMB 1WBDA 4UBBA 2FBXA 4JUZA 3GLJA 4ELTA 4N77A 1QZ6A 3PR5B 2LMIA 2VOOA 1REGX 3ALYA 3GCXP 4J9RA 2YWHA 4DN0A 2DK2A 2M3DA 2PFPA 4DB3A 4B3TF 3A8JA 2BVZA 3P1GA 1Y5LB 4WIQA 3MXHP 1NJWA 4JI3K 2VC1A 3W7BA 1VQNN 2YNGA 3TACB 2EQYA 4CLSA 4DN9A 4MIAA 2HOFA 3DXKB 2V7ZA 4QZCA 3R6GB 1N32K 3ENAA 4QW8A 2DIUA 2WBMA 4I6MB 4DOZA 4OYMA 4RW8A 3JPRA 2JEIA 2W9CB 2ASOA 3R9KA 1GH8A 2Q1LA 4DV1F 5HR6A 3OXGA 2JLFA 4BR2A 3CJRA 1B0VA 1RT6B 2GC8A 3SQOP 1R89A 3QB0A 5JMVA 5A2QO 1TKTB 3JB9k 3KTQA 5DG8A 4YORA 1WELA 2RRBA 3M8RA 3TA1A 1SC1B 2YX8A 4DTXA 1ZQPA 5KT5A 2LEAA 4HCCA 3BEGB 5GIPA 2QSWA 4X4NA 4ZS6A 4NE9C 2AX1A 4NI2B 3IXQA 4DPXA 3DI6B 5GMEA 3M8WA 4WJBA 2IBOA 3R5DA 1SL1A 1RAIB 2UXBJ 5SWMA 4C8KA 4YR3A 4RPYA 4ES1A 4CI6A 1LWFA 4X66F 3ZXWA 5ETVA 5HO4A 5J2NA 3NY0A 1GOCA 3H08A 4AHCA 1NDPA 2LQ5A 3JQJA 5JVGL 4QYRA 1NB2A 2BE2B 4F4YA 3I56N 1DKGD 4G1PA 3JPPA 3GBTA 2FMPA 2K4IA 3PYDA 2D0BA 1LW2A 1HNZJ 4WQ5C 4Q43A 3T5KA 1Y10A 3W9IA 3GU0A 1QQOA 4FYVB 4KHQA 1BPXA 4FLWA 3V4IB 1YF5L 3G96A 1X1PA 2YJFA 4LFCF 1F1BB 5DDYA 5AZJB 3RJMB 1T05B 3K5LA 3UPQA 3AUOA 5F9NA 4MHVA 4WCEQ 2KN4A 4ILLA 4OV1A 1RDDA 3K0SA 3UKRB 4LFBJ 4KHYA 3R7BB 3VQAA 3KZIU 2P9SB 1I1GA 1CLFA 4NZ7A 4LF5J 1WBBA 2EEYA 2DPIA 3C3LA 3CCUN 3CQYA 1ED1A 1LCUA 2KVQE 2LEPA 2RRAA 1K5OA 1VSFA 3AQFA 3L7PA 4JV1A 2RHQB 1A76A 1HLWA 5A0YA 3FSIA 4UOCA 4F2SA 1U0HA 4DG1A 4PL8A 2XNQA 2ZF5O 2ODGA 4LF6J 3OPXA 4KPYA 1VQ6S 4O3RA 3MEEB 2D3O1 3Q8SB 5AFUA 4IWVA 5EU7A 3QIPB 3WXJA 3NF7A 4ZMMA 1VLBA 3O5BA 5ALWA 2HBJA 4IFEA 4FJHA 2BJ7A 3O44A 3OQ2A 2LM1A 2UUCK 3QIPA 4KN4A 2PGCA 2D3ZA 2YKNA 3T1HF 3AB2B 1LWFB 1DEJA 4Z4EA 3GONA 1ZD3A 1CZBA 3CDWA 1LWXA 4D3HA 4PKGA 2H3QA 1UCVA 2VA3A 5A0YB 3KMQA 1ICEB 8ICJA 4QCLA 5TKWA 1JJ2R 3LP1B 5J2CA 4TQSA 1B99A 5KFJA 3PTWA 4NLYA 3VA0A 3G86A 4RQ5A 7ICKA 4B3SK 2WONB 3L2RA 1QD1A 3ULEA 1ZJNA 3V9ZA 4OX7A 1ZQCA 1NG9A 4MEXA 2B7CB 1X4EA 4IYQA 1ZQSA 1M1KT 4KHUA 3HL8A 1RZMA 4MO5A 1T05A 3CUNA 1U1QA 4ECXA 4ED2A 1HNVB 3OA9A 2DNNA 1Q3UA 1KCFA 1E6YA 3Q2SC 1B9FA 3W9JA 4LVOP 2G1HA 2MZJA 2J7KA 3C2KA 3BQ2A 5ETLA 2HNDB 3IHQB 3GSIA 2KJWA 2BBEA 4PXCA 4Y34A 1NJYA 2DNPA 4J9UE 4JYAJ 1Z4UA 8RUCA 1S4EA 2Z2YB 1V9OA 4OPJA 3CCZA 1ZH5A 4KY3A 3A4TA 5CHCB 3LDQA 3RBDA 1UFKA 2AGOA 2ACMA 2L9DA 1S4FA 1LWCA 2G8WA 1RP5A 3TSQA 1AW0A 1U24A 3HZEA 1Q4RA 4TQRA 4Q8FA 1JLBA 3G6ES 1YBAA 3GFKB 1XSNA 3UKUA 2W9CA 5IZHA 3O9RA 3CCJN 1HWUA 4EMDA 3B8HA 1Z26A 1NK8A 1S49A 1S48A 5B08A 2KQ2A 3DLEB 2R42A 3MN7A 2FD2A 2Z8QA 3TU5A 1RTHA 4X64J 1PJ5A 4JD2B 4CGGA 4KR0B 2Y9UA 2FBVA 3SDEB 4RPZA 2KEYA 2WC9A 2JVOA 3HVTB 4BR5A 2BJ3A 3IBFB 3UM9A 4W5TA 9ICRA 4CBWA 1DK3A 5FJ4A 2CWXA 5AQGA 2FSKA 1NH8A 3KIOA 4YDDB 3PW5A 3VGSA 3EUB2 1HNVA 1R8AA 1R0BG 2ASYA 4KV8B 2XZWA 5AQIA 3SQIA 4YG2A 1K8KB 5KG3A 2FSNA 2UUTA 4P0QB 4OI3A 5MAOA 4CO1A 2MKHA 4ECRA 4KLTA 4YOYA 2R8HA 4DL7A 4JYAF 4QIGA 3EJMA 1ZQJA 3BGOP 1SV0C 3HHDA 3BGFA 3V7KA 4C7ZA 2HWTA 1FRMA 1WHVA 4WKYA 4DV7J 2I5HA 4P6QA 4RX6A 1L5UA 4DU4A 2G0CA 1T9XA 2AJ2A 2P1JA 2WFBA 5K8NA 4KLFA 2AHOB 2YQ1A 4Y65A 4FWSA 5AQQA 1IBKK 4C3KA 3R1HA 3AVCA 3NTUA 5DDOC 4NYNA 3S01A 2FC9A 2KVCA 1T95A 2QW9A 1RQLA 1YVUA 2VCPA 2EG2A 2A2DA 2VG7B 4IOXA 1FFVA 1S7IA 1PJ6A 2K8AA 1SBRA 2O8BB 3H5XA 5KPTA 3TADA 1CJVA 4X4TA 2QL7B 2HQ3A 5B8HA 4L3NA 3CD6S 4XUSA 3CGIA 4DV4J 2Z1HA 3P6YC 3I4PA 1UEUA 5KFYA 4WJ3B 4AXIA 1N52B 4RU9A 4YR2A 3R9PA 4IO8A 4DR7F 4I28A 2VQFK 4R66A 3DHWC 1FJCA 4NYOA 2RE2A 2NXEA 2XWXA 3RJGA 2R7OA 1PJ7A 3C0BA 2EWSA 3OFHA 4BC9A 1UEKA 1U2VB 2ACYA 1KN6A 3VENA 5JJBA 4ANEA 5HN0A 2L48A 3AJDA 4CW7B 1MWQA 2AJ4A 4FJGA 1RUSA 1SJ1A 4FJKA 4DOCA 4C11B 1YI2S 3OTOJ 1JMSA 5KG1A 2KFNA 2OANA 4RQ6A 3ILJA 1N62A 1RBTA 1NZAA 3H8SA 3DLKA 3MI7X 5BPCA 2CQCA 3AO1A 2EI5A 3B78A 1DK2A 4R25A 3MGJA 4DTMA 2OA8A 3SFUA 2F3NA 3QRRA 5E2QA 4JI3F 4EGLA 4F3TA 5J2QA 1YJVA 5JVGQ 3WKAA 3BO2A 4ACOA 2Z1GA 3CCLS 3SDEA 2EC2A 1ZA1B 4M5DA 2O8EA 3H4BA 3U27A 2P9LB 3N4MB 1ZQQA 3EDRB 5L46A 1QUPA 4ZVEA 3A8EA 3MAHA 4GMKA 3DLEA 2PT0A 5CA7A 3T9ZA 2F7TA 2VQFJ 3S3OA 2OMOA 5A2QY 2MPUA 1RGIA 2IM0A 2Q6BA 1ZJMA 5GAHI 5EWFA 1VIOA 1VQ9N 3PFOA 3N28A 3V1RA 4BDPA 2RDIA 3OYEA 5AE2A 1U8SA 3HVWA 1TKXB 2FPHX 1IUJA 2E1AA 3T79A 2OFHX 2J6UA 4DR4K 4JD2A 3TUZC 2P9EA 4FM0A 2ZG6A 4ECQA 1RYRA 4PXBA 3OYCA 4LRFA 5BR8F 2OHDA 5EE3A 2K4PA 3BN4A 2RF2B 3AA9A 2DNYA 2D4WA 1WC6A 3LOUA 1RWWB 4YDXA 3MMBA 4UY8T 4RPXA 2QSFA 3CO9A 4EX7A 2G9OA 2LXUA 4USKA 3SAGA 1GX5A 4AL6A 2F4VF 4NXNJ 5H2FU 1VLOA 1A7GE 2ERRA 2GX8A 2VJ5A 4KB1A 5BJRA 2BKOA 3J81j 2CGKA 3DMJA 3MCOA 3SR6A 2HNYA 1KP6A 3GIJA 2EFGA 4JI2K 2HLTA 4I2PB 2ZDPA 2GO8A 4V19J 1JIHA 2ZVIA 3KWMA 1JALA 1I6JA 3BYPA 3IO1A 2KG5A 1ZYQA 2F2AB 3RJJA 3NVYA 2P9LA 2AP1A 4M7YA 3K9JA 2O8EB 1YITS 3TO8A 2G8KA 3CW2C 1QVFM 2G5HB 4MLEA 3CCTA 3PACA 4LQ3A 5ALQA 1NKCA 2DH8A 4F8RA 3M6WA 3QYPA 4FWQA 2QC3A 3H2VE 1KC8T 3VOVA 4HHUA 3PCOB 3PX6A 2NRWA 3DLKB 4NJ8A 1U1KA 1F6TA 2CJAA 1S6QA 1CJUB 4IFVB 5E3AA 1N32J 4IO1A 3THXB 1OS5A 3TZWA 1WOPA 1SC6A 4JNEA 2C2MB 3AOAA 2WSFC 3F2BA 5AZIA 2IJRA 2W2QP 1N48A 4HTIA 1IR0A 4IG3B 4CO5A 4FDFA 1WSVA 2BA9A 3VV2B 1EARA 3PUFA 1S0OA 2KNJA 2BQ3A 2DGSA 3QEIA 2LECA 3G6EN 2PYJA 3E01B 2DGVA 1VAZA 4NWIA 2CVIA 4HLBA 3ENWA 8ICGA 4Z4CA 3K2PA 4USUA 2HHSA 1ZQVA 3VGVA 4JEPA 4OX9F 1NZ8A 2R3VA 4QS7A 2AZ3A 3FJ2A 3KDNA 5BN9A 3LVWA 3J81U 3WZ0A 3DAWA 2GFFA 1K73O 1H73A 2GIFA 5CHGA 3MF5A 2VG7A 1Z3EB 4JI7J 3BKUA 3W66A 3LP0A 4KYZA 2LCWA 4CEBA 3DDNA 1HUOA 4PPXA 2DCUB 2Q0UA 4KQZA 1UWAA 3EWGA 3A5NC 4UAUA 1TL5A 3IA0A 2YNHA 2C2OB 3BM7A 4IR9A 2PSZA 1X40A 4BR9A 1RTIB 1BPZA 3BSCA 2XI9A 2MKYA 2MHEA 3V6HA 5C2DA 3CERA 4KRFA 3IM9A 4N56A 5B5EU 1Q0NA 3PW4A 8ICFA 3N5BA 3M1YA 3OTBA 1V3RA 5DRKA 4LJXA 2E20A 3PO4A 4OYXA 1NSAA 5LJ3Y 1LXNA 2CQBA 3IV6A 1VSDA 1CJTA 4NB4A 1Z1VA 3N0VA 2VPXB 2IM1A 3HKWA 1DTTB 4CLFA 4BC4A 4B9UA 4LF4J 4QIWD 4TURA 2W8KA 4KMOB 2F7VA 3PIPL 4RR5A 4LZGA 2EAPA 4BROA 2HHPA 2Q36A 4CF0A 1H2TZ 5K8PA 1MMDA 2J9CA 2E1YA 5E0OA 2A42A 5AXNA 2IMOA 2NZ4A 3TKAA 1N5YB 2O4GA 2HMIB 2OEKA 1KDHA 1T3OA 2N7YA 1RTDA 3D9BA 3PJ9A 4LF9J 3OY9A 4TUSA 3SMVA 3NKYA 3NBPB 5C7PA 3LP2A 4RQMA 4CH1A 2ADBA 4K41A 2V8DA 1ZM3A 1EP4B 3KNGA 4RT3A 1CULA 2OPQA 5J2PB 4A8QA 1RYUA 3MGHA 5E41A 2F8HA 3SCIE 5G0RA 3D0IE 4JI8J 1IG6A 1FE0A 4CGDA 1U1OA 3P83D 3O8MA 2M8HA 4DX8H 2O4IA 2W9AA 3F5AA 3R7SB 1UWBB 2GJIA 2H4YB 3ZTPA 4CD1A 2C3PA 3E1YA 1KSPA 4I27A 1UT8A 3KYLA 5DDMA 3HMJG 3I0SA 1N34J 5F3ZA 3N79A 1P1LA 4ES3A 1X66A 3V9XA 1K47A 4O3SA 3TTFA 4F2RA 1EETA 1WAFA 3H8JA 1L3SA 3N6MA 3ZZYA 1RLDA 4I6MA 1F0XA 4A62A 4UUWA 3O4QA 3JPOA 1XNRK 2ZE2A 2VV5A 1OW5A 2KG1A 4NL5A 5B0DA 2ESEA 2GUPA 1LFWA 3BPSP 4QJVA 2QIFA 2ZGYA 4OL8A 4LIWA 3ULEB 2B5JB 1LKYB 1NK9A 1JJCB 1F5SA 4OQJA 3AU6A 4Q0BA 4M47A 3M8PA 5GAHP 3QEWA 2VC0A 1ATSA 3AO2A 3ULHA 3DRYA 3KLFB 1YJWN 2ZOFA 3WC2A 4MFBA 1WKJA 3DRRB 2WZ1A 4OMFG 3W3SA 3GIKA 1KKXA 5IT9Y 4KSEB 2VJUA 3ELHA 4LFCJ 3I87A 2CH6A 4XIUA 3AQEA 5DK5A 4MKVA 2V9KA 3PXGa 3FZFA 5A8KA 2YKMB 2QX0A 3OBWA 3BQTA 1RT2B 1D9DA 3TUPA 3QATA 5K8MA 1KQSM 4KMUA 5AI5A 3SUOA 3OS1A 4ZA1A 2V5HG 7ICRA 4M04A 3PMLA 1HHSA 1RCXB 1L7MA 3MEEA 3OD2A 5KNIA 2DRAA 2YHWA 2G09A 3T19A 4MEYA 1W9HA 3F53A 1CI4A 5AKYA 2QG9B 8ICAA 1I94K 3W5YA 3THVA 5GTIU 4ID5B 3ZDAA 3MR3A 3IWXA 3RBEA 1X5PA 3CM5A 3C23A 5GMKa 5CYMA 4NLSA 2XBPA 3F0NA 1TV6A 2HBQB 6FD1A 4LR7A 4NWBA 3U8XA 4LR9A 1FO1A 3FEYB 2E7XA 1GOBA 4O8KA 3NF8A 3OYAA 2Y1RI 2V2VA 2KVIA 3GMGA 5BR8J 4F0MA 1H0HB 1BL3A 2LYBA 2CQ3A 2XM3A 3P5TL 2IDLA 1SKRA 2A1JB 4EYIB 3Q22A 2MZQA 4CIOA 2OYYA 4FJ8A 3BDEA 2HLUA 3BGUA 4UW9A 4ZITA 3FYHA 2LBOA 1ZBFA 2V2ZA 4LSLA 1WHYA 5CCLA 5A2QU 5L1LA 2XB2D 4EHTA 3CNQP 1TL4A 3GJSB 5K8OA 3L9ZA 1FFWB 4E3SA 2UXCJ 3D28A 3VQDA 4A2AA 4BBYA 1VQOS 3CCUS 3DDHA 1WTFA 2ZNZA 3LVVA 2F65A 1S3XA 4FKYA 1T44A 1LV5A 3QEXA 2NLXA 2LQ8A 3G10A 2FPLA 1WSRA 2WF7A 2HBKA 4OYIA 1XR6A 4EZ9A 3Q8PB 4E1MA 1PVRA 1RKIA 5LMUJ 3NOGA 2KRRA 1NGFA 2F77X 3K58A 4DFDA 3OUYA 5KAIU 2CQIA 4LRDA 3DLLQ 1UOCA 2AP6A 1Z6RA 2XHBA 4KI4A 4I6WA 3ZNJ1 2R8IA 4WFNQ 5L9NA 4JV5J 5G4DA 2QXFA 1ZQBA 3ZX3A 2HPUA 4DTJA 1KDNA 4EO8A 8ICXA 4Z6CA 1T9VA 4XPCA 2K8BB 3M8PB 2XO6A 2DWQA 1I5OB 2LYAA 3OVSA 4YQWA 4JI8K 4NCAA 8ICHA 4O4GA 2X74A 4JS4A 4LF4K 2C2EA 2V8VA 1IM4A 2A6AA 1LAWA 3P49B 1TAMA 1HNIB 2F40A 2KSOA 2OKQA 2HBLA 1S9GA 5DDRC 1UVNA 5L9XA 3R5GA 4WF9L 3DXSX 1GLCG 5AQTA 4FWMA 4L73A 3HSCA 1BE4A 1H3DA 4CLTA 4G1IA 2DKZA 1O8BA 3CJ8A 4FE3A 4LFAK 2I5JB 1JLEA 2OD6A 1Q86T 3P5JA 1IKXB 4DHYA 2WMMA 3OVAA 2EK1A 3G8QA 4WPAA 1M1KO 4JN4A 2RH3A 4K50A 3H0MB 3DLBA 4OZ1A 1XNSA 3CVKA 5TKYA 2MYFA 5AKEA 2NPIA 3ZI4A 5KG7A 5AQPA 2WK4A 4ZKAA 4JKBA 4EU0A 4K0KJ 2PA8D 1NB7A 2KJ9A 1SVDA 4CGHA 4RWWA 3NVZA 3OL8A 3M8ZA 1S0NA 3UDEA 1QQNA 3M32B 4OHVA 1T0TV 2WAQF 2GVDB 1BWEA 2V0NA 2CJYB 3KD3A 1C0TA 2V50A 2DQNB 2D9OA 4FO0A 2JNJA 5LMNK 1FRLA 7ICOA 4E1JA 2HVEA 5TZVA 1RBSA 4LF7F 5CH7B 2X3GA 3ZT4A 3W8GA 1WF2A 4YXMA 1GTEA 1BQNB 1NGHA 1WSHA 5CB1A 1FFGB 3FLCO 2G0JA 1ZPWX 5K5MA 2AJ1A 5KFWA 3OLAA 4OYWA 2XIDA 1X6IA 4HR2A 1J6ZA 2N4DA 2VA2A 2IOCA 3H40A 3TAMA 3VHQA 3C5FA 2CRXA 2GTDA 2ZH8A 3HM9A 3CDAA 4CJ5A 1PVQA 1Q46A 4UY85 4WZMA 3EUNA 2CFXA 3ILLA 4KHPF 2B56A 2XG8A 4K5RA 3AT1B 4J8FA 3TSUA 1VHFA 2DH7A 2QA4S 4PL1A 2MSNA 1YK9A 4ZN3A 2HQDA 2JC1A 2QV6A 1ZC6A 3OTOF 9ICTA 4DZ6A 5D8HB 1Q7YT 4I56A 3AA5X 4NXZA 7ICJA 1RQ0A 3PRBA 4CEEA 2LEBA 4M3YA 4F4XA 2BCUA 1RHKB 4M3RA 2ALYB 1I39A 2MJNA 5C15A 1KOOA 3K17A 2G5IB 4LMZA 4AE5A 2GGPB 3D6HB 2MGZB 4O23A 3J81O 2J8SA 3JYTB 4DV0F 5KG4A 2EX3A 4ZPAA 2UUBF 3VQSA 3GE9A 1RB0A 1FKAF 4HTUA 2K2PA 5I3UA 5AT1B 3VZHA 3RW7A 2RUSA 4KLJA 1RTJA 2B4VA 1XU4A 3OW2R 4OD0A 2OTJS 1S6QB 3MHYA 4OJ3A 3OYDA 2YNIB