3HPOA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus y714s mutant bound to g:t mismatch
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVSGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 214
structure length 579
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hpoA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hpoA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hpoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpoA01
4ECYA 4PPXA 1VSJA 4O5CA 4C8KA 4ECZA 4M42A 1C1CA 1S6QA 3VQEA 4Z4GA 1TKZA 3VQ5A 4FJNA 3Q8KA 1VSEA 2P6RA 1F21A 5JS1A 4M9GA 1FXXA 1RBVA 2ATLA 5J2CA 2PFOA 3SUOA 1BCOA 3NF8A 4Y1CA 3HJFA 4OJRA 3G10A 4CEEA 2OPPA 5KFPA 5CYMA 4QWAA 2Y1IA 2ASJA 2M9NA 3PMLA 4YMNA 3HVRA 4BXOB 4F5QA 4ED8A 2W8KA 5CP2A 9ICFA 4ED2A 1ZQYA 4IQUA 4TQRA 4LSNA 4DL6A 5HRSA 2P1JA 2BGGA 1ZBHA 3V9SA 3M9NB 4KFBA 4DG1A 4PGYA 3DOLA 3GIIA 5L1IA 3MABA 1S0NA 3BQ2A 3L2VA 4ICLA 1SL2A 5D4BA 4KLTA 2ETJA 2FLPA 4RNNA 4M3WA 1XS9D 1XU4A 4KI4A 1NOZA 2NRTA 4EEYA 3RH4A 1IM4A 1L5UA 2ZTCA 2G8FA 4DF8A 4KB0A 3JPNA 3ZDBA 7ICNA 4FK2A 7ICEA 4W5QA 4HTUA 4JWMA 2BCQA 3BGRA 5KFRA 4YN4A 2NRXA 2VG6A 1RTDA 4I28A 4KLEA 4CIEA 5DBAA 5L1KA 9ICSA 3O4NA 3AA4A 4YCXA 3K5NA 4BE0A 2G8WA 1BQMA 1JXLA 1CZ9A 4F4KA 1RT4A 1U45A 3KKSA 1XSPA 4DQIA 3ZT1A 1UT5A 4F5OA 3DLRA 3SI6A 2ZTEA 3V4IA 2FBVA 4CJVA 4Z6EA 3P83D 3FYHA 1TKDA 5IIOA 3KK1A 1U04A 2R8HA 2OPQA 5KFSA 4W5TA 1RTJA 4GLXA 3ZSWA 1TKXA 4FZXC 3MECA 3OYJA 3QNOA 4N56A 4NLZA 1BIUA 1HJPA 3ZT2A 3NDKA 2AQ0A 4Q8EA 1CXQA 2FPLA 3LDAA 4J2BA 1S77D 3OY9A 4GC6A 4ED6A 4GVMA 2F1IA 1TL1A 3LP0A 5J0RA 1NKBA 3DRPA 5J0WA 4HCCA 1JLEA 5I42A 4I9QA 5J2NA 4TSXA 5EU7A 4ZHRA 4J9NA 9ICNA 7ICUA 3ZD8A 5D49A 4IFYA 3T3FA 3PMNA 2ZD1A 3KHLA 4UB3A 7ICVA 1SUQA 2DPIA 3IRXA 3PW2A 2Z1JA 4PA1A 3GIKA 3RJEA 1JN3A 1TFRA 2HVIA 4DOAA 2YNGA 2XGPA 3V1OA 2BQRA 3RR8A 3UQ0A 3SUQA 3JPQA 4DTUA 5KFXA 1C1BA 1UOCA 4YD2A 5EOZA 4FLZA 4DOBA 3OGUA 3QEWA 2OZSA 1S76D 4DQPA 1ZBLA 3TAGA 1I3AA 4C8MA 1HQUA 3LWMA 4M6WA 1NK0A 3WNGA 2ATQA 2LSNA 5HMLA 4AHVA 5DLGA 3MGHA 4UB2A 3MXMA 4RQ7A 3RRGA 5DB8A 3L2WA 9ICLA 4CGGA 4AHSA 1C1AA 2NUBA 4IQWA 3K4GA 5C5JA 4DU1A 3LK9A 3OHBA 2W8LA 3V7LA 3NF6A 4AHCA 4EYIB 3MGIA 5KFHA 4F4XA 3OYAA 4JRPA 1EKEA 3NF7A 3UQ2A 1KLNA 4E7JA 2G8IA 1COOA 2FLLA 3V6JA 3EPIA 1NK7A 3ALYA 4LD0A 2P5OA 3RJHA 4CJ3A 4CFDA 4QZFA 2FBYA 1ZETA 3O3GA 1DGSA 5KG1A 3AU2A 5J2GA 7ICTA 3NF9A 4KTWA 2ZE2A 4W5RA 4CJUA 1JLFA 4DTRA 2AJQA 4PY5A 3B0XA 2F1HA 5J2IA 4DTMA 3QIPA 3U3YA 8ICHA 5F9LA 1ZQSA 1C0MA 4E3SA 4F5RA 1VSDA 4ZTJA 4PUOA 2B6AA 4IR1A 4O3NA 2YHBA 4FJJA 3LPUA 1IXRA 1NK9A 1I39A 1S1UA 5JUMA 5J0OA 2XC9A 3UPQA 5J0QA 1NJZA 2OPSA 3DI6A 4O3OA 4FXDA 1J54A 3V9WA 4KI6A 2VA8A 3NHGA 4YFUA 3WNEA 9ICPA 3ZDEA 1K6YA 3JPRA 1KVBA 1A76A 5KFMA 3F73A 2HMIA 3Q8SB 2DFLA 1EXNA 4PHPA 4F8RA 2W9BA 2PXIA 5HP4A 1VSMA 3MEDA 1Q9XA 1TK0A 3C23A 4ED7A 4CF1A 3KHGA 1ZQFA 1YVUA 3MDAA 1B9FA 4E1MA 1GOBA 2YNHA 4KN7A 3NH2A 4JLHA 1ZYQA 4YNQA 4W5OA 5KG3A 2BDPA 1S9EA 4UAYA 4M9HA 2PI4A 4MEXA 5KFEA 1HRHA 1WSGA 1VK0A 4HHTA 2IGIA 3K59A 1CZBA 1ZQEA 3OSPA 7ICIA 2HVHA 1JXBA 4F5NA 4JRQA 1QS4A 4CGDA 3TAPA 3T19A 4RU9A 4ECXA 1IH7A 5BOMA 3OYBA 1Y88A 5KFDA 1ZQTA 1Q9YA 7ICRA 2BE2A 3ISDA 2Y1JA 3AA2A 4FK4A 4KLDA 4CJ5A 2WTFA 4I2EA 2BQUA 3VQBA 3UXOA 3QEBZ 4W5NA 3TAMA 4DFPA 3QIOA 4LSLA 3GQCA 1QHTA 3IM1A 3OHAA 4PGQA 4QZIA 1U4BA 1JLBA 4I9LA 3DOKA 5DDYA 2NRVA 3HT3A 4DSKA 1BPZA 2R7YA 3NGZA 1RTIA 1DLOA 3V6HA 5DQIA 4QW9A 4DU3A 4YFKA 1UWBA 3NGIA 4RPYA 5KG0A 8ICZA 2HNDA 2AGQA 4CK2A 4HVJA 3KHHA 8ICQA 4CFAA 1KTQA 3DYAA 5J2JA 5SZTA 2J6SA 3AVAA 5C42A 4Z6CA 3AUOA 3GV5B 3PX6A 2VWJA 2LYHA 4DU4A 3T5JA 1RYRA 5J2EA 2HHTA 5DQGA 1ASVA 1UT8A 1VSKA 3OYFA 5FROA 2B5JA 1RT3A 2JLEA 3V7JA 5KFJA 2DPJA 1EX4A 4F2RA 4KKOA 4G3IA 1IKVA 4P4PA 4FM0A 3QEPA 4NLKA 5CHGA 2RF2A 4J2EA 4Z4FA 4XIUA 3LP1A 3AO2A 3UXNA 5CZ1A 1DTQA 5DK5A 8ICIA 3RR7A 3T5KA 3ZSOA 1NOYA 4YVZA 2BANA 1KFTA 2I1QA 4NM2A 3N97B 4RZRA 3M9MB 4ECTA 4CHPA 2BKEA 3HK2A 2AQ4A 3MDCA 1RPLA 3SJJA 2VWKA 5DGBA 5L1JA 4CJQA 1BI4A 3AVJA 1U48A 1ZQQA 1Z25A 1BPDA 1JLQA 4JK1A 4CEBA 1YTAA 4CK3A 2BHNA 3LAMA 4CJPA 4ZTFA 4M6WB 1KFDA 4FZYA 3LAKA 1SL1A 4DS4A 1BPEA 4DEZA 8ICEA 8ICNA 1ZQBA 3JYTA 1EXQA 1TVAA 3RMDA 2FMSA 7ICHA 4J2DA 3PVXA 1BHLA 4IG3A 1ZQNA 4FK0A 3TABA 4KREA 4ECVA 4J9SA 4FCYA 8ICVA 5KG2A 2BCVA 1VRUA 3OYDA 4F92B 5IIJA 3S3OA 1HJRA 4KLOA 1NK6A 1N5YA 4UQGA 3JPPA 4C8NA 4KLFA 4ELVA 2F8SA 4ZH4A 1JXEA 1A5VA 3GILA 4M9LA 2KFZA 3KD1E 3OJSA 4NY8A 1RDDA 1HYSA 2PZSA 3M8SA 2W9CA 1RILA 2A1JA 5DLFA 4RT2A 4C8LA 2DY4A 4O4GA 4ELTA 1X9WA 4M9NA 4I2PA 3NBPA 2FPMA 1VSLA 2ZJAA 5CYQA 1T4GA 5KFNA 3EW9A 5C25A 1RT2A 3KHRA 5KG6A 4DL3A 2HHXA 4NCAA 3QEVA 4QZHA 4IQTA 3C5GA 2RDIA 1KCFA 3OYKA 3I0RA 3KLEA 4B9UA 4M47A 1ZJMA 5I3UA 1NK5A 1S0VA 9ICEA 2YNFA 4KN4A 3MR5A 8ICSA 4CIGA 2B4JA 3VQ7A 3QO9A 4KTQA 4CEOA 4RQ4A 4CGJA 3TANA 4Q8FA 2W9BB 2XCAA 8ICYA 4CK1A 4BACA 3B0YA 4BE2A 2PI5A 4I2GA 1ZQVA 4F93B 4XUSA 2ASDA 1L3VA 2BPCA 3L2UA 1JLCA 4CJEA 4O3RA 4CJKA 4FJKA 1C6VA 3C94A 1RBSA 3JPTA 3H4DA 4XRHA 8ICGA 8ICRA 3KLFA 4QWCA 3IG1A 4CJWA 4DMNA 1CLQA 1HNIA 4QZCA 4FM2A 1DOQA 4MF8A 3LALA 4NCGA 1FK9A 3GFKB 5J2PA 3SQ4A 3OS0A 3H7IA 3ZD9A 4DQSA 1FKOA 4J9OA 4ED3A 3SQ2A 4FS2A 4CJ4A 2IAJA 1ZQDA 4RNMA 2Z1IA 1U9LA 9ICUA 4N5SA 3HPOA 4LH4A 4O0IA 4AHUA 3SI8A 3GV8B 4DO9A 1HYZA 2NRWA 4RUAA 3G6XA 4R66A 5BPCA 1ZQIA 9ICTA 1JIHA 3ZT0A 4I2DA 3OSNA 2G8HA 4ECRA 4B9NA 1S97A 1BISA 4KITB 3H08A 2AGPA 5KG7A 5FDLA 4Z4IA 1HUZA 3ETLA 4BDZA 3K75D 3IS9A 4AHRA 1RDAA 3H40A 1QE1A 4R63A 3PY8A 3M8RA 4P2HA 3K5OA 3AVFA 3DLBA 4YD1A 1X9SA 1W0HA 8ICMA 5HROA 4L8RB 3NH1A 3CM6A 2C28A 3VQ9A 3ZSZA 3Q8RB 9ICKA 4QZ9A 3BQTA 4EBDA 5CJ7A 4QCLA 3QEAZ 1REVA 4RW7A 3CFPA 1SV5A 7ICQA 1D8YA 2MAXA 1JX4A 5IIIA 3T5HA 4CGFA 1BPXA 1IKWA 4DTOA 4PQUA 2ISPA 4KHYA 3H8JA 2UVVA 4J9RA 5KRTA 4HCBA 3RJKA 4CF0A 4KAZA 1ZBUA 4LZGA 4O3QA 2HNZA 1ZQPA 2JGUA 1NJYA 1TAUA 3AVCA 4RQ1A 4B9TA 3LZJA 2IHNA 4GXIA 3PX0A 4IRDA 4OLBA 2UVUA 4G1QA 3DLKA 1KFSA 2UVWA 4KHSA 3RJGA 1D5AA 5DB7A 3ZDAA 3RTVA 3JPOA 5IINA 2JEFA 1NKEA 4CGHA 4DWIA 3VQDA 3G6YA 3PW0A 5CY4A 1HYVA 1VSIA 3NH0A 4OGCA 1HUOA 1RT6A 3H4BA 3OS1A 3V9UA 4QW8A 2FPKA 1ZQJA 3QEXA 5KGWA 2BPFA 3ZSXA 1ZQWA 3HX0A 2QKKA 1MQ3A 1TK5A 4DTSA 1S6PA 2IA6A 5KFWA 2ZUBA 3ZDCA 1SKSA 1C0TA 7ICJA 3PW7A 2BCUA 2C2RA 3CYMA 3HYFA 3CG7A 5KFUA 4DFMA 2OA8A 4FM1A 5J0PA 3Q8PB 4TUQA 5DBCA 1WN7A 3KTQA 1RBRA 3E2EA 1QQCA 1EP4A 1B22A 2A1SA 4FLUA 1LB2B 4CJFA 1NK4A 3V9XA 2XY8A 3SCXA 4KLGA 4OPJA 1ZQAA 3OS2A 4DOCA 5KFQA 1BCMA 4LZDA 2KZMA 3QERA 3L2QA 5CA7A 4NYFA 4ID5A 2KZ3A 1SKWA 4OKKA 2ISOA 4RQ0A 4BDYA 4R65A 4CJLA 1RDCA 5KT3A 2W9CB 2A1JB 3DRSA 3BJYA 4MFCA 2HHSA 3RAXA 3IAYA 4O5KA 4QZBA 3MR6A 4B3OA 3EYZA 1TL3A 4YR2A 2RKIA 1K1QA 4FYDA 3V7KA 3K57A 3M8QA 4DS5A 4QWDA 4DQQA 4QWEA 4QZGA 3C5FA 3DMJA 3OYEA 4E89A 5J2QA 3ASMA 4O9MA 4BWMA 2RDJA 4EP5A 1S1WA 4JUZA 4OKEA 5DDMA 4B9SA 7ICSA 1S9GA 4JV2A 5IIMA 1RXWA 2DFFA 1T03A 2PFQA 4B9VA 3OYCA 3ISBA 1YT3A 4I7FA 4JS4A 2IOCA 1A77A 4DTJA 4OGEA 4PHEA 3QINA 4UB4A 4CHOA 4UAZA 1WSEA 4QZAA 4I29A 1SZPA 5J0SA 4M3RA 3TAQA 4J9QA 5KFVA 1RT7A 5FRMA 4M3ZA 4IFVA 4CEQA 5D46A 1T05A 3TR8A 1LW0A 4FLTA 4QZEA 5EWFA 2IMWP 4IQVA 4K4IA 3QLHA 4I2HA 4X5VA 3MFHA 3ZSRA 3V9ZA 4LH5A 4QAGA 4UB1A 9ICXA 3VQCA 3S9HA 1LWFA 4E7HA 1J53A 1ZJNA 1O1WA 2C2EA 1ZQRA 1EETA 3KK2A 1QSLA 3AO4A 4CEAA 2XY7A 3OYMA 3TWHA 1TV6A 8ICOA 5K14A 1LV5A 2Q0ZX 1ZQMA 1S10A 5KFBA 4CIFA 2F96A 1S9FA 2WOMA 4NCBA 2JZBA 3JSMA 3ZSQA 1Z00A 1WAJA 3AA5X 8ICLA 1JLAA 1YTUA 4ECUA 5KFTA 2ZTDA 4Q43A 3V6KA 2D5RA 4MFFA 2IBKA 3PX4A 2KFNA 1JLGA 5KG5A 3AO5A 5KFCA 4Z4EA 3TFRA 1KRPA 4FJLA 1LAVA 1KVCA 4O3PA 4AILC 2MUTA 5DG9A 4I27A 5L1LA 5HBMA 4IG0A 1X2IA 1XHXA 2KTQA 1BPYA 1RNHA 3O3HA 1XWLA 4EP4A 4KMUA 3LZIA 5KI6A 4P4MA 3HXMA 4NYNA 1QSYA 5KG4A 4GMJB 3V1RA 3D0PA 4O5BA 2V4QA 3BDPA 3K5LA 4K8XA 1B92A 4FLVA 2Z1HA 4CGIA 3KLHA 1ZBFA 4DSIA 4IDKA 1IKXA 4ECQA 4CESA 5HRPA 1JMSA 3RJIA 4J9LA 4CHQA 1XI1A 4M41A 3EPGA 4JV1A 1LW2A 4QZDA 2P51A 4MFBA 4KLLA 1JL2A 3O4QA 4KHNA 1MC8A 4FJ9A 3PNCA 4OKJA 1C0UA 5J0TA 4MFAA 3MEEA 1JL1A 3FFIA 1H38A 1ZQOA 1B9DA 2X78A 2R8GA 2XY5A 1TGOA 4EYHB 3K5MA 3RBDA 5HNKA 7ICOA 3AVGA 3C2KA 4PHAA 1GOCA 4CFBA 5KT7A 4FJGA 5CR0A 5KT5A 4XQ8A 2P66A 3NGDA 2EHGA 2O4GA 2YV0X 4UAWA 1TK8A 3B6PA 3RB0A 1LAWA 3SNNA 1WLJA 9ICAA 2XY6A 4E1NA 3K2PA 4KV8A 2J6UA 1WCLA 3Q8QB 9ICCA 8ICTA 1WSIA 3PV8A 2FMQA 2BPGA 3AA3A 3MBYA 3VQ6A 2ITGA 5BOLA 2FLNA 5KFIA 2V4RA 4LY7A 1KDHA 3U6FA 3MXIA 5J2DA 4KLHA 4IBNA 2ZJ5A 3T5LA 3SPZA 3WNFA 4PHDA 4CJSA 4RQ3A 4FBTA 1QLNA 5DBBA 5KTQA 4KHWA 2P5GA 5DB6A 4IRCA 3PO4A 3AO3A 3OYIA 4M3UA 4I2QA 3RMBA 3SPYA 3EWAA 2B21A 4B08A 3SV3A 4MF2A 3TAEA 2FBXA 2E4LA 4F4YA 4H4MA 3V72A 3MFIA 3KK3A 3L3VA 2I9GA 2HHQA 2E6MA 5J2MA 2P6UA 1RCHA 4RQ8A 2BR0A 4P4OA 1N56A 1TV9A 5DG7A 4RW4A 5KFKA 1ZQHA 4DSJA 3HVTA 2D0BA 3C1ZA 4JV0A 3NE6A 9ICWA 3A2FA 2DFEA 3QEIA 3Q8LA 4DL7A 4J9MA 1U49A 4I2BA 2PYJA 4O0JA 4GXJA 3S3MA 4DF4A 3CM5A 4HYKA 5KRSA 4KLIA 4DSFA 4F50A 4CECA 1S1TA 2W42A 3K58A 4EBEA 4Z0UA 4YR0A 1SL0A 3HM9A 3AVNA 2X74A 4EZ9A 3QZ8A 2VA2A 1A5WA 1ZQLA 8ICAA 1BQNA 9ICBA 4BDPA 1WAFA 3RJJA 3P1GA 2G8KA 1UA1A 3RB3A 3S3NA 2XCPA 3GIMA 9ICRA 3HPHA 4NXZA 3OYNA 2YHAA 4OPKA 1T3NA 5T7BA 3PW4A 9ICHA 4CFCA 3HWTA 2QXFA 4OVLA 2HB5A 3GV7B 1QTMA 4NLGA 1CXUA 4KB1A 1Q8IA 4KPYA 4CJTA 3SUPA 4Z6DA 1CUKA 1ZQKA 1ZQUA 2OZMA 3GDXA 4RQ2A 4GW6A 1LWEA 3GIJA 4KLUA 1IG9A 4YMOA 9ICOA 5KFLA 2OPRA 4N76A 2X6NA 4N41A 4YXMA 3G6VA 2AU0A 2KW4A 1HMVA 3MEGA 5KFOA 4CF8A 1D9FA 3CQ8A 2ZJ8A 4Q5VA 5DQHA 3KLGA 1PZNA 4TUSA 2JZBB 4AHTA 1Z00B 4CEDA 4FJMA 4DLEA 7ICKA 5KFZA 1ASUA 2JEIA 1ZBIA 5EWGA 4CCHA 3ORYA 2IDOA 4E7KA 4UB5A 4M9JA 1RTHA 3VQ4A 1NKCA 2XO7A 3CFOA 3TQ1A 5D3GA 4KLJA 5HMMA 1VSHA 4DSLA 3V6DA 4K8ZA 4BWJA 4CEFA 3KIOA 2MUTB 3H8WA 3AVKA 2IC3A 1S1XA 3KD5E 3RB4A 4KLSA 4PWDA 3ZCMA 2R8IA 9ICGA 1KSPA 3TARA 4IR9A 5C24A 1SKRA 1ZQGA 3ISCA 8ICFA 1U47A 2HHVA 1W9HA 3OVNA 4R8UA 3EY1A 3ULDA 4FJ7A 1B43A 4M3TA 8ICXA 3QETA 1WNSA 4YP3A 4WE1A 1JKHA 5FRNA 3SZ2A 2RN2A 1X9MA 2O4IA 3G0ZA 5CB1A 2EX3A 2W9AA 2BCRA 4F3TA 1XHZA 1G15A 4BE1A 5DMRA 1S1VA 4NLNA 4KO0A 3DLGA 1MSWD 1Z26A 4CHZA 1WCNA 2DTUA 4M3YA 2D0AA 4DQRA 2R8KA 1RBUA 2XRIA 4QWBA 4HUEA 4EBCA 4FJIA 4J2AA 1HQEA 1RZTA 5SWMA 3I0SA 2V9WA 3RMAA 3HL8A 8ICBA 4O5EA 2YKMA 1GOAA 3PO5A 3MR3A 3H8SA 4FLYA 2E6LA 5KFAA 1BI4B 2PFPA 4DTNA 4K4GA 2VG7A 3THVA 2G8UA 1CEZA 3FDSA 3QNNA 9ICIA 5J29A 2XGQA 1LWCA 3C95A 8ICPA 3DLHA 4AH9A 4FW1A 3ZSVA 4O55A 4Z4HA 1D9DA 3LP3A 2GUIA 4B8CA 2H5XA 3SQ1A 1X1PA 3VA3A 3EZ5A 4PGXA 3QE9Y 1RBTA 3MXJA 3M9OB 3NGYA 4N47A 4RQ5A 3C21A 3RJFA 2HHWA 4RG8A 2IHMA 3AV9A 5HHIA 3C2LA 4DLGA 5CWRA 3ISNC 3HSTB 3RRHA 1HPZA 3PR5B 2YKNA 4NM1A 8ICWA 4J9PA 4FW2A 3NCIA 2ALZA 3ZT3A 5J2HA 2GBZA 3AO1A 4E0DA 1BIZA 4DL2A 4CERA 3RWUA 2WONA 5KT2A 2C22A 2YNIA 5CZ2A 4DL5A 3C6TA 1VRTA 2HHUA 5EWEA 5J0UA 4M3XA 2QK9A 4KLMA 3SUNA 3VQQA 3QZ7A 4YMMA 4RPXA 4FS1A 3IHQB 1Z3EB 3V1QA 4GXKA 4H8KA 1RYSA 1AROP 1MU2A 4R5PA 1UAXA 4FLWA 3UXPA 4CHNA 4B9MA 7ICLA 4XA5A 3AVMA 4F91B 7ICFA 4FJXA 2FBTA 3RAQA 4RNOA 3KLIA 3JPSA 4J9KA 1RDBA 4C8OA 2BQ3A 4MQ3A 1A5XA 3SV4A 1J5OA 3KKRA 1N48A 4LVSA 2VG5A 4CE9A 3DLEA 5TZVA 4Q45A 2BGWA 4IRKA 2D0CA 4EZ6A 2C2DA 1WSHA 4RT3A 3P5JA 1HNVA 4KLQA 8ICJA 5E41A 3C1YA 4DSEA 3HPGA 2JEGA 4ECSA 2ASLA 5IILA 3AVHA 3BQ0A 4BXOA 2JEJA 1NJXA 3QESA 3RMCA 4HUFA 9ICJA 4K4HA 9ICMA 5DKWA 1TAQA 3NTUA 4E19A 1TKTA 2F1JA 4CF9A 4ELUA 1VSFA 3O3FA 3UIQA 1WSFA 5J2AA 7ICGA 2KQ2A 3TI0A 2UVRA 3RH5A 4M45A 4M04A 5KFGA 3Q8MA 8ICCA 3LANA 4CJRA 4OLAA 1C7YA 1IO2A 3OYGA 3LP2A 4TQSA 5JS2A 3D45A 2G8VA 4RPZA 2VANA 4M2YA 3ZDDA 1BPBA 4DFJA 4CF2A 5DB9A 3N4MB 2ZUCA 4RUCA 2FMPA 4Y1DA 4JWNA 1BGXT 2XHBA 2AGOA 1IKYA 4YG2A 3HP9A 5HP1A 1RXVA 2OYQA 4PH5A 3T1AA 3VA0A 3KJVA 1ASWA 3VQAA 1FKPA 2OWOA 3PR4A 2KN7A 4B9LA 2IS3A 4RW8A 1T7PA 3AVBA 2ZQBA 3PUFA 3WNHA 5HLFA 3HO1A 4KHQA 4I2IA 1ITGA 3C6UA 3ITHA 2GV9A 4FVMA 3SYZA 1QSSA 2FC0A 4F4WA 1Y97A 2A1RA 1RT1A 4JS5A 4R8UB 1WSJA 3F9KA 4HUGA 4KHUA 4Z6FA 5F9NA 3MR2A 4Q0BA 4BGDA 4FBUA 2BCSA 4FJHA 1L3UA 3AVIA 4YR3A 3SQ0A 4RQ6A 1BL3A 5KFYA 4KRFA 1BVSA 3PW5A 8ICUA 3HP6A 4DTPA 3TAFA 3MAQA 1NJWA 3OYHA 3VQ8A 4YXJA 1KEJA 1D8LA 1ZQCA 2J6TA 5IIKA 3AVLA 5J0YA 5DGAA 1R0AA 2Z1GA 2GWSA 4DTXA 4ED1A 4KTZA 3HW8A 4UBBA 5KT6A 3NFAA 1L3TA 4QZ8A 3RB6A 1MQ2A 4FO6A 4FJ8A 3OJUA 9ICQA 2R8JA 3B6OA 2VA3A 3L8BA 4I2CA 1RT5A 4Z4CA 4UBCA 4R64A 4B8AB 4CHYA 1XSNA 2HNYA 3U3GA 3AU6A 3DM2A 1S0MA 1KVAA 4M0AA 1N6QA 5HRNA 4RW9A 4GC7A 3NAEA 2PYLA 1S0OA 9ICVA 4ED0A 1S5JA 4CEZA 4F4ZA 1K1SA 3VN5A 3OYLA 3E01A 1T8EA 4RW6A 4E7LA 3BQ1A 2KZZA 2ZUDA 1NOMA 4O44A 4FZZA 5J0XA 3C2MA 4Q44A 3CFRA 5J2BA 5J2KA 4MEYA 2PFNA 4FLXA 3L2RA 4TUPA 1L3SA 2DFHA 4DL4A 2X6SA 5KFFA 3LWLA 1UA0A 2NRZA 1KLMA 4YQWA 2RPIA 1XSLA 1V9PA 1TVRA 5KT4A 5J1EA 4I2AA 3TFSA 3L3UA 5KGXA 4TURA 1XC9A 2F8TA 4F2SA 2HW3A 1NK8A 5J2FA 3ZT4A 4F3OA 2QKBA 5L9XA 3ZSYA 3VQPA 5HHHA 3M8PA 1ZQXA 4FJ5A 4I2FA 3RH6A 2I5JA 5HRRA 4QOZB 1ZQZA 4F5PA 7ICPA 3V81A 4E7IA 4I2JA 3DRRA 3I8DA 5DG8A 1XO1A 1DTTA 4ECWA 4H4OA 3LDSA 4IKFA 4DFKA 2W9MA 3LPTA 4ID1A 2Q3SA 1J9AA 7ICMA 4O3SA 3RBEA 8ICKA 2PY5A
chains in the Genus database with same CATH superfamily
4ECYA 4PPXA 1VSJA 3BH7B 3A8YA 4DV2K 2I0XA 3F44A 1Y4ZB 3WC0A 1E6VA 1TKZA 2JNJA 5J8YC 1FJ7A 1F21A 1GNKA 4LRCA 3QFWA 1FXXA 5D4PA 2ATLA 2DJWA 2PFOA 3SUOA 2H1YA 4B02A 2F5GA 3HJFA 4AT1B 1V85A 1HNVB 3KBBA 3CIZA 3SCLE 2MSSA 2FGCA 5D8HB 2ZHBA 2CIMA 3SFUA 2DR9A 1QCKA 2QL9B 4DOZA 4YHHK 4P6QA 3TJAA 4ED8A 4A46A 1Q18A 2CUYA 2L48A 9ICFA 1X4BA 5GAGI 4HTIA 1JJHA 4IQUA 4TQRA 1LWFB 2BGGA 2IYGA 2YKQA 4F0KA 2EXUA 3M9NB 3V9SA 3CCZA 2RAQA 5EXWA 1HBMB 3DOLA 3GIIA 3MABA 2RILA 2AD9A 4Y00A 4ICLA 3LDLA 4KLTA 3DDKA 1HUXA 3FBBA 3LP2B 1YZ6A 4UAVA 1T3VA 1XU4A 2NRTA 2EC0A 4EEYA 1NMDA 5HMWA 4H5WA 1IM4A 4GKJJ 3FZLA 2ZWHA 3I9ZA 4ZPTR 1DY3A 3AMZA 4KB0A 1R8HA 4JI3K 3M8ZA 2IRXA 5HP1B 1ECWA 4W5QA 3A0HU 2KK0A 4LIRA 2P9SA 1RTDA 4CIEA 5L1KA 4IG0B 3O4NA 2NXEA 1RWXB 4GKKF 1X6JA 4F4KA 1ZZNA 2MMYA 1N34F 4DR1F 2IOFK 2AJFE 1UT5A 3SI6A 3ITHB 3DLRA 2L9WA 5B0CA 2XS7A 2ZM6K 2FBVA 2R7TA 4CJVA 1X0FA 1U2RA 4HACB 3P83D 4MK9A 3QRPA 3QYPA 3BYPA 5IT9U 1PG5B 1LEOA 1I94K 2K7KA 1VQ7S 2OPQA 4TU9A 5HL7Q 2B9YA 4PG8A 2VQFK 3NWGA 3ZSWA 3S1TA 4FZXC 2D41A 2AEMA 2E5JA 1WC1A 4EENA 5A8WB 1BG3A 4WJBA 1S77D 4JI4J 5E3AA 4C6AA 3R6MA 4GC6A 3D7SB 3PYEA 2F1IA 2J9EA 2Q97A 4LSZB 1OYDA 4F7VA 2QSFA 3NNHA 3QATA 4B3TK 3IWXA 4I9QA 2MJUA 4TYAA 3FCWA 1KN6A 3D66A 2HSEB 1MROB 2JZ5A 2GLEA 5D49A 3WK5A 3AH6A 1RHUB 5A2QO 2RHKA 2HFVA 2ZD1A 3KHLA 3D3BJ 3BP8A 2FHMA 1J5EK 1Y64A 3RJEA 4US9A 4DOAA 2KG5A 3V1OA 3QX7A 3UQ0A 2QLWA 4JHDB 4RW9B 1VQ6S 1XMOF 4RQNA 4FLZA 2BTFA 3OGUA 4DCHA 1GMWD 3M2VA 5F1XA 1S76D 2IM1A 3EUNA 4OJ5A 1UZHA 3LWMA 2NYIA 4RW6B 4M6WA 3RFAA 1OWXA 4KH4A 2ATQA 2LSNA 2MLZA 4ISFA 4AHVA 2GCFA 3MGHA 2AIRB 3M7VA 3R5BA 2E5LF 4ILMA 2V9KA 1Z1VA 5DB8A 3L2WA 3GZFA 2YCHA 4KGVB 2WB1F 5HOOA 4AHSA 1WJ9A 1C1AA 4YY3J 2NUBA 1F5CA 3IO1A 2M0GB 3LK9A 4NYPA 3CF5Q 3NF6A 1Z4UA 1RWMB 4PL8A 3MGIA 2JWLA 3OR2A 4TY8B 2VFUA 3KK3B 2WW8A 4JRPA 1EKEA 2HMPA 3QT5A 3MGVA 1KLNA 2HRUA 4OHXA 1QD1A 2P5OA 3RZAA 4CJ3A 3THXA 3CCUN 3HKZD 2BE9B 3VETA 2FBYA 1DGSA 3FMWA 1YJ9N 3O1LA 3DRRB 2H3EB 3R7BB 3ZFVA 1SQKA 4CJUA 5FLXU 2PMHA 4KRWA 4YOEA 5LJVA 3CD0A 4A8MP 1VDHA 3NAHA 2ZIXA 5F9LA 1U6ZA 2LM1A 4LQ9A 2K4EA 3MN6A 4O3NA 3A8EA 1V4SA 4FPBA 5K9FA 2CDRB 2KB2A 1TKZB 3UD4P 1BOTO 2EEYA 3UPQA 1X0PA 2B6GA 2LDIA 4FXDA 4KI6A 4YFUA 1TP7A 2PC6A 9ICPA 1FTCA 1Q0NA 1K6YA 2AJ0A 4U67L 2R7OA 1EXNA 5BRHA 1K47A 1VSMA 3U27A 1Q9XA 1X4EA 3C23A 4ED7A 4ILLA 2M5YA 2ZF5O 3MK6A 3KHGA 5A76A 2KYZA 2LQBA 4F04B 4UZCA 4J5OA 2CZVC 4YNQA 4PG7A 2BDPA 2I8EA 2W40A 1SH2A 4M9HA 3DOLB 2IGIA 3TTCA 2QMXA 4OYXA 2J9DA 3Q2SC 4ICLB 2RHFA 2G5HB 1ZQEA 3IBWA 2YQ1A 5K8NA 4JRQA 1QS4A 4CGDA 3H45C 5AI4A 2O8BA 1X4DA 2Q2RA 2G1HA 3OYBA 1ZQTA 1WHVA 2CNNB 1RDUA 4XH1A 2Y1JA 1R8PA 3NUQA 4M7XA 4US8A 3AA2A 4FK4A 4KLDA 4CJ5A 1WF1A 2F3NA 2CJAA 3K8WA 2P9SB 3UXOA 3QEBZ 1RTDB 2IC3B 2Z56B 4C4SA 4WYBA 1PUZA 2VC0A 1CJTA 1T11A 3DOKA 1V4TA 1UVJA 5DDYA 4DUZF 4Z94A 1DJ0A 1BPZA 4WFBQ 1RTIA 1SXEA 2UUAJ 2M8HA 2KL8A 4QW9A 5AE2A 2DIVA 3H0MB 3EM1A 4YFKA 2OSQA 5KG0A 1X5TA 1ULRA 4ZOHC 4YOXA 1BUXA 4TU7A 2AGQA 2OPQB 2DGWA 3TQEA 1NAQA 2KIVA 4R79A 3QNMA 3BUZB 5GVQA 2ROGA 2LYHA 4JKFA 1KQKA 2K1RA 2DO4A 1UL3A 1NLVA 5ALHA 1RYRA 3JSBA 3BDEA 1LK5A 3C46A 1LVHA 3CD6S 2J8SA 3SDEB 2H3VA 2RE2A 5EE9A 2DPJA 3L3FX 2NXJA 4JI5F 3WX4A 2E8OA 5DK5A 8ICIA 1BO5O 2ZD1B 4TXSA 2G1DA 4YVZA 2XHWA 4ZCMA 4DPXA 2WF8A 4NM2A 3I5BA 4G9BA 2GO9A 4RZRA 2C42A 2Y0SF 4RO0A 1JB0C 2VWKA 3CC2N 1BI4A 3I28A 1ZQQA 5B7WA 2LXIA 2Q3PA 1Y3JA 4C3LA 1JLQA 3E1YA 3M2VB 4CEBA 4CK3A 4NWBA 7FDRA 4QPTA 2FJVA 4M6WB 1KFDA 4EEKA 3QU7A 5GTIU 1PGZA 3FUYA 3C7NB 1RBLA 1BPEA 1CPZA 2BX6A 2HIYA 3IBCB 1WORA 4GNIA 1TVAA 4ZP9A 7ICHA 1HPZB 3NGTA 3CJAA 2XICA 2BXJA 1QAYA 4DR5J 2UUBK 3E9LA 4WK3A 3TABA 4KREA 3EE8A 5KG2A 2BCVA 4AXIA 4E8UA 5IIJA 3OL8A 2I7NA 4KLOA 5JVHQ 1GLDG 4FKYA 3OR2B 4KLFA 3SXLA 4USMA 3GJQB 4E98A 4JYAF 3ATVA 2CVIA 2GUPA 2GX8A 2WHEA 3OJSA 4M63A 1BWVA 2RQKA 1HYSA 1OKJA 4B9QA 2GMJA 2XLIA 3THXB 2K4IA 2DY4A 2CJQA 1UVNA 1N5SA 4CH1A 5CYQA 3OLBA 4Q7AA 3EW9A 3OBIA 4XPCA 5C25A 4LFBJ 1XR7A 5AQLA 3T6JA 1GLEG 1L7PA 4NOHA 2ZIXB 4DL3A 3J7YU 2RS2A 2M70A 2LMIA 4IQTA 4QYRA 1KCFA 3KLEA 1CJUA 1MWQA 1NK5A 3N4WA 2RUSA 3CDAA 3MR5A 3CRXA 2HURA 1N88A 2PBDA 4OPAA 2RU9A 5HVFA 3VQ7A 3FCHA 3QO9A 1VQ7N 2GAHC 5LMUJ 2OANA 4CGJA 3TANA 4JI1K 3JTPA 4NRTA 4CK1A 3MPUB 3JXOA 1RK8A 3N6NA 6AT1B 1ZQVA 2ASDA 4MO5A 1L3VA 3MURP 1OSDA 3MUTP 1RHRB 3GTYX 4O3RA 1DARA 3AM9A 4FJKA 3RYLA 5LMNK 5G5HA 1QHAA 3C94A 3JPTA 8ICGA 4K0KK 3ID8A 4CLYA 1S7HA 3E9OA 4DMNA 4QZCA 1SJ4P 3DXKA 4NCGA 1KBUA 2GTDA 2DK2A 5J2PA 1U1RA 3OS0A 5IT0A 1N32F 2JH7A 2HAIA 3ZD9A 2VJ4A 4U95A 1B99A 3O9SA 3FZMA 5F0XA 1FT8A 1N4LA 2VPZB 2IAJA 1ZQDA 1PYOB 1FRXA 3MDQA 4DCJB 2HQGA 4LH4A 4AHUA 2QMWA 4ISGA 1VQ6N 1HYZA 2CQ3A 2NRWA 2EG1A 4JP8A 3VV2B 4R66A 2ABYA 1OY6A 3WXLA 2Q0RA 2WB1C 4I2DA 2AZ3A 4B9NA 1BISA 4KITB 1FWKA 1CJTB 2AGPA 5AICA 1HUZA 2COLA 3I6PA 2YKOA 3DOKB 1HPMA 3HSGA 3QRQA 4QR1A 1RTIB 1RT1B 2ZBCA 4C8YA 3QYYA 3DWLA 4IH6A 4YD1A 3DLBA 1W0HA 2E9RX 4DV2J 2LMRA 1NSAA 1NPKA 2E1AA 4NLXA 5J1NA 3VQ9A 2MU2A 2X3GA 1VC5A 4QZ9A 5D0EA 2HQCA 5CJ7A 3QEAZ 3RF9A 3TNVA 4ZLNA 1T9TA 3IR7B 3ZX0A 5IIIA 2XSJA 2K1RB 1IKWA 4DTOA 4PQUA 4BR9A 4GV9A 3TOQA 4CF0A 4YHHJ 3DN9A 3L7OA 1FXRA 4KAZA 4LZGA 1Y00A 5LXYA 2HVDA 3M6WA 2UZAA 2HNZA 3X3UA 2JGUA 4B9TA 1UZDA 2DGZA 4WK1A 1TUYA 4GXIA 4IRDA 3RJMB 2G2YA 2IM0A 3SENA 4WXOA 4C23A 4RWWA 4KHSA 2KICA 3KJQB 1XN9A 3E66A 1VHIA 3RW6A 3ZDAA 5AKEA 1XNQK 4ISEA 1Q81T 1BHNA 5HQ8A 2ITMA 4WBFA 2KE7A 4CWBA 4WF9L 4BRIA 4LBHA 2V69A 3BS9A 3PDNA 3CCJS 1HYVA 1VSIA 4OGCA 2ZUAA 3VTHA 5AI5A 3OTOK 3OS1A 3KD3A 1UVLA 4JI3J 1JLQB 2QKKA 4USKA 1TK5A 2BJ7A 5L1MA 3VZIA 3L4QA 4CJ7A 5BPNA 2KM8C 1SKSA 2D74B 3M6KA 3HI0A 3PW7A 2J5AA 4DFMA 2ZM6J 2R7QA 5H1SQ 5F8HA 2CQHA 2XY8A 2IIRA 4OV6A 3Q24A 5HANA 3BS7A 4LZDA 4ZN1A 4IEEA 2VQFJ 4AM6A 1QAJA 1BLUA 3QERA 4K4ZA 5CA7A 3L2QA 3M8PB 3MX2A 1SKWA 1SI9A 3EUB2 4R65A 3QJPA 3FZBA 1HYSB 1R89A 4O5FA 3BJYA 1HBNA 4MFCA 2LYBA 4QZBA 2RKIA 3DEEA 1WC0A 4FYDA 4BRCA 3M8QA 4WFYA 1KQGB 5AKXA 5CYQB 4B3TJ 3W0LA 2DISA 4E89A 1ZC6A 1HNWK 1HR0K 4O9MA 4AQYK 5C25B 2RDJA 3HLUA 4B9SA 2N4CA 2NSBA 3MMAB 4DV0F 1L3KA 3FR0A 4EHUA 1S9GA 4KE5A 5IIMA 4FYWB 4X4UA 4I6AA 1J5EJ 4B9VA 3CMAS 4IWVA 2Q6BA 1F44A 3KLEB 1CJUB 4A59A 3D4JA 3TYTA 4P2SA 1LKYA 1M0SA 5KOXA 2A19A 3C14A 4I29A 3LTOA 1FRLA 5J0SA 2DY9A 3MOZA 3W3SA 1H2VZ 2ZWOA 1N36F 3GZ7A 2KT5A 5ALIA 3P3DA 4CEQA 1FXLA 3O6QA 1T05A 4ZDNA 3MTKA 4QZEA 3H1QA 1KVIA 3ZSRA 4I2HA 3V9ZA 3B6BA 2VKZG 4P2FA 4WXWA 3T7ZA 4JI6F 4K59A 1SQFA 3CD6N 1NU4A 2ZDOA 2N7YA 1IBKF 3JS6A 4K25A 6FD1A 2Y0SC 1VK8A 3GP9A 1RG6A 5ALTA 1TV6A 3QGIA 3DXKB 4NCGB 3BEXA 2Q0ZX 1X4AA 5J2PB 2ZH4A 4OJLA 4CIFA 2HHHK 2JZBA 1MW7A 1Z00A 5ETKA 3I96A 2V0NA 3AA5X 3A5OC 1VQMS 2IAJB 4LF5K 2ZTDA 4BRHA 3V6KA 2ZEJA 2X51A 5A2QY 2D5RA 2B56A 4KHPK 2KFNA 1YXQA 1KRPA 1KKHA 1RT4B 4P7TA 1A0PA 5AK6A 1YJWS 2NXNA 4EP4A 4X4VA 3R5GA 3TA2A 1KWMA 4P75A 2G5IB 3HXMA 5IC4B 3DFEA 1VQKN 1U2VA 4W4MA 1VS3A 3V1RA 2QE5A 4K8XA 2Z8QA 5H9EK 4FLVA 4N8NA 2FE9A 1CQNA 4CGIA 4RJVA 3TTDA 4C7ZA 1WWUA 3VVTA 4FF1A 3P31A 1TE2A 1CQMA 2W24A 4CESA 5HRPA 1JMSA 2BJ9A 3I4HX 2WAQC 1SJ1A 2NREA 3EPGA 1BXNA 4MLHA 1S22A 4JV1A 4KHNA 2KD1A 2Y8YA 2XSJB 1IKWB 3N5FA 2R18A 4PQUB 3WIVA 2MZ1A 4FJ9A 2U1AA 3PNCA 2KJWA 2BW7A 5J2NB 2HNZB 1HIYA 1W2IA 2YHWA 2X78A 4RNHA 1TGOA 3K5MA 3W1YC 3M6UA 4DV1F 2P9IA 3F5EA 1EQ0A 4CI6A 3NEKA 1RQLA 3BSAA 1M1KO 4FJGA 1VAZA 5CR0A 4XQ8A 5F2RA 2P66A 4NLPA 3NGDA 3ISZA 1SH0A 2EHGA 1DRGA 3B8HA 3CCLN 4R0JA 2HBRB 3QMLA 2OHFA 4I67A 3EE3A 4H4KA 3ZXWA 4DR7K 3UR0A 3HFZB 1HQUB 3IMXA 1GXTA 4OJ3A 4J7CA 1T94A 1Y5LB 2VKRA 2XQCA 1LK7A 2FMQA 1N0UA 3CCWA 2OJ3A 5KFIA 2GO7A 2RDDA 5IV3A 5F3ZA 1Q5VA 3TPQA 1SBRA 3DGVA 1B4SA 3SPZA 2I1RA 1G7CB 1QLNA 2LI6A 3SAFA 2J0WA 3AO3A 3OYIA 2A6OA 4I2QA 3N79A 1A6SA 3GG1A 3RMBA 3EWAA 1TAMA 3SV3A 5B08A 2L9NA 3L4BC 3HTVA 1WUUA 3GIRA 2VONA 3IM8A 5EX3A 1TUVA 5C12A 4RW4A 2PE8A 2CJKA 3AQPA 1FX2A 2D0BA 2HBKA 3NE6A 2E2OA 3QEIA 3M8QB 1MN7A 2C3PA 1AUDA 4DL7A 3D0GE 4I2BA 2XMUA 3AN1A 1GLCG 4GXJA 2F9WA 3CXCR 2YX8A 2OTLS 4NLWA 5KRSA 2N7CA 1S1UB 5LSOA 4CECA 5CQGA 1S9GB 3K58A 4EBEA 4RBVA 2FZCB 4YR0A 1BQXA 1XK8A 2JHDA 2IDLA 3THWA 4JI0K 1SL0A 5DO2A 2X74A 3LDPA 1QY7A 4KIAA 5GIPA 3IBPA 1A5WA 1ZQLA 2HBJA 2BV3A 2MEWA 3T1HK 1X8DA 3W5ZA 2CG4A 1BQNA 1LKYB 1T9UA 4WCEL 4DR3K 9ICBA 3P1GA 2V50A 3C14B 4YN3B 3S3NA 2XCPA 5EE0A 1D8BA 3T1YF 4PYDA 5L38A 4Y2YA 3OFHA 4CBXA 4CFCA 3C29A 4OVLA 4BRKA 1DK3A 5AQNA 3GV7B 4XAKA 2O8CA 3VESA 3UCUP 3TJ9A 2FD2A 1Q8IA 4CJTA 1T02A 1CUKA 1ZQUA 4UASA 3R5JB 5L8RC 1UTAA 4GW6A 5F8JA 2R2TA 3OBYA 4IJNA 2OM6A 9ICOA 3CO0P 3O2IA 1GMUA 2DPNA 3L3CA 4PYAA 4LUBA 2BM0A 2UUBJ 2AP1A 4N41A 2XLKA 4B3RK 2KW4A 3AL0B 1HMVA 2YVSA 4GKJF 5KFOA 3WKCA 2ZJ8A 1KVJA 4Q5VA 2RQMA 4UUWA 1W7WA 2FUG9 4P72A 7AT1B 2JZBB 1Z00B 4CEDA 7ICKA 5KFZA 2Q36A 2MSNA 2PA3A 4M5IA 5IS2A 4CCHA 3ORYA 2ZZMA 2GWJA 4DX5A 3CCJN 1NKCA 3GSIA 2XO7A 5B0GA 3CFOA 4ZPBA 1QQ5A 2IRUA 5D3GA 3HX9A 1ZM9A 3V6DA 1URJA 3ADAC 4P0QA 4ZVHA 1ZS6A 3H8WA 4ERDA 2FVSA 3KD5E 4G1PA 2W43A 3ZCMA 1JJCB 3WDOA 2Q1LA 5IQ6A 1IG6A 4F25A 3KHYA 5AFUH 2RQCA 4YUDA 5A8KA 1MWZA 1WKKA 3MZIA 3ZZPA 1W9HA 3EICA 1U2VB 4OI2A 4MK8A 1RGIA 2ZGZA 3JB9k 4CO4A 2VKQA 2B8PA 3CETA 2N3OA 2DT9A 2QMUB 1ATNA 5AQMA 4WE1A 3QETA 5FRNA 3SZ2A 3TUJC 2UXDK 2O4IA 2QA1A 2W9AA 5AKZA 2HDOA 1XHZA 2J0XA 2B7BB 5DMRA 1S1VA 3KYLA 5EE1A 1M6YA 1C20A 1MSWD 2KHDA 1FJEB 3OUYA 4JI1J 2EFNA 4HDHA 5MLCV 1SC1B 8AT1B 3D1QA 3SBMA 4HUEA 4A62A 2LQ5A 4FJIA 1KW4A 1Z4NA 2OKQA 5LMNJ 1AYEA 3RMAA 4O3MA 4K0KJ 4BGAA 1PKUA 3PKMA 3DU6A 2B9EA 1NH8A 2BMBA 2E6LA 4DR6K 1WWVA 3KNAA 3KFUF 2PFPA 3CMAN 1NGIA 2W7AA 3QNNA 4OO1J 5J29A 4GVBA 3DLHA 4A8WA 4FWLA 4IOAL 4EGLA 4B3SF 2WSEC 2XNQA 1FHTA 4B8CA 3ZEUA 3EZ5A 1RBTA 4Z7YA 4YY3F 5E5NA 1X40A 3O6WA 4RR5A 4EWTA 5C2GA 2YY6A 2ZGYA 4QYZK 3AV9A 3C2LA 3KLVA 5GADU 2WBNA 1OH5A 4NWIA 3HM8A 3NRBA 3RRHA 4RL1A 1UFLA 2P6TA 3NGRA 4FW2A 3PSTA 3A1YG 1ATRA 4P52A 2EK1A 1BIZA 4I69A 4I2QB 5KT2A 2C22A 5JTIA 1VRTA 1HKBA 4F4AA 2P9KB 5J0UA 1JROA 5AM1A 2QK9A 1SV0A 4X64F 4X66J 4KLMA 4PL7A 4M5MA 2N4DA 2GQQA 1J97A 2ZVSA 4RPXA 4FS1A 2Y0BB 1NSQA 3SSQA 4NXNK 3D2NA 1AROP 5ALDA 4ANDA 3J81U 3VAFA 4K4UA 4R5PA 2O8DA 4RW4B 1VQMN 2P8IA 3NRZA 2HIQA 3ETOA 2D1CA 4CH7A 2OFGX 1NM1A 4M8LA 2E3TA 2V2KA 4CHNA 4B9MA 7ICLA 2OSRA 4OYZA 1RAFB 3G9CA 3A0BU 4IC9A 2K8BB 3S7RA 2YWHA 3W3DA 4J9KA 1RDBA 4OX8A 2M8DB 2EAPA 3H3OB 2NNWA 1J5OA 3SV4A 3HSZA 5ETMA 5JXSA 1XNQJ 2VG5A 1YJWN 3J7AP 3DLEA 3CWJA 3P4IA 1LOUA 3K2YA 1JJ4A 5LJ5Y 2UXCK 2E9TA 4NLCA 3UCZP 3TSPA 1JK9B 2F77X 2FDRA 4EZ6A 4JV5F 3P5JA 1UP1A 1BNOA 1SZHA 4KLQA 3OTOJ 3HPGA 4DSEA 5G4DA 4ECSA 2ASLA 3TEHB 2ZIUA 5IILA 2FVQA 4BVPA 4H5NA 1FNMA 2VL1A 4BXOA 3R1XA 1JLCB 4QPXA 3QESA 2VBYA 4CZMA 3RMCA 2QWLA 4H0TB 1ZAVA 2DKXA 1D0EA 1I1GA 2O8CB 3NTUA 4E19A 2DR6A 1G2EA 4I1TA 2HWIA 4ELUA 3JAMO 3CJTA 1VSFA 3G2XA 2N3LA 2PMZD 4OZLA 3CNHA 4UUXA 3HVAA 2KQ2A 2UVRA 3R2CJ 2V67A 2VGMA 2K4PA 5AIBA 2XG8A 3FRYA 2KLAA 1HMVB 3NNCA 1XNSA 5JS2A 1K8KA 3PTWA 1ZM2A 4CF2A 1BPBA 5HI7A 4DFJA 4PPZA 5DB9A 2ZUCA 4RUCA 3SSRA 1YBUA 4CP5A 4ZCIA 4EX7A 1Q16B 1Q4RA 2XHBA 2AGOA 1IKYA 3G86A 3CJ3A 4FF2A 4ZPVR 2F9DA 4HH0A 5D3GB 4CLZA 2UUAF 1FKPA 4CF5A 3PR4A 3FZKA 2MA1A 4B9LA 5CE3A 4USAA 4RW8A 3ALRA 1T7PA 1Q46A 1NO8A 2W1BA 3KJFB 4KHMA 1QE1B 1HNWJ 3JSYA 3O8WA 1HR0J 4FVMA 4AQYJ 1H6KX 1FX4A 2JDJA 3SYZA 5A8KB 4F4WA 1Y97A 4K8RA 1RFQA 2QRRA 5EUHA 4JS5A 2DB1A 1M90O 3SMPA 2JGAA 3U4LA 4KHUA 5DM7L 2NZTA 4FSVA 4LF9F 4BGDA 4FBUA 4BG9A 1DK2A 2KVIA 4KPCA 1L3UA 3D2WA 1FIQA 1RWWB 4YR3A 1HNXK 2ZJPL 2O6KA 1BVSA 3PW5A 3HP6A 4DTPA 1BA0A 1S1VB 3MAQA 4BR5A 2HZVA 1VLOA 1RBOB 3CCTA 1AFJA 3UFCX 1KEJA 4DJBA 1U1KA 4N77A 2J6TA 5IIKA 2RHQB 2ROPA 3G6ES 2CN1A 2GWSA 4DTXA 4MHVA 3C28A 3KWMA 3FC9A 3HFKA 2OCEA 3TVZA 1AUSL 3NFAA 1MQ2A 3B4MA 2H5JB 4U9RA 9ICQA 3CJ5A 2R8JA 3B6OA 2OHDA 3L8BA 4I2CA 2CYYA 4WFNQ 3NY0A 5BJRA 2P9PA 5AQPA 4CHYA 2GELA 1JXVA 1D3WA 4S0MA 4ENOA 2OTLN 1RQNA 5J8YA 1FFWB 1S0MA 2IRYA 5E3QA 2W01A 2GA7A 1JJ2R 2HHHJ 1M5VC 9ICVA 1S5JA 4TYBA 5B5EU 1E6YB 2WBMA 2HLUA 4PG5A 4GVBB 4LF5J 1NGGA 3E01A 3Q86A 4ZPDA 2IVOA 1TMMA 3HVWA 2ZUDA 4KHPJ 3PYDA 5FIIA 1NOMA 1NEEA 2RSQA 4PWWA 3ZEUB 5J0XA 1DAXA 2HLTA 1Y5IB 4KQZA 5J2KA 3LO3A 2PFNA 2XI3A 1NLKL 5KFFA 2E2QA 4ER8A 2NRZA 3WKBA 3RG6A 1NNDA 2QKQA 3U1LA 5ALMA 4PXEA 1RHKB 5H9EJ 3L3UA 4KH5A 1IWGA 1FRMA 4X62K 1XC9A 4NE9C 1K9MO 2XBPA 3IWLA 4F3OA 2QKBA 5L9XA 3R5DA 3RH6A 3G8SA 1X4FA 4F5PA 3VGTA 1ZD4A 4R5PB 2O8DB 3BO2A 2KHCA 2JC1A 1PAEX 3R1LA 1XO1A 1DTTA 4ECWA 1NCLA 2NCKL 3KZIU 5ADXA 2W9MA 4HLBA 1BUPA 3LPTA 4Y2UA 2FI1A 3Q22A 4Y2SA 1J9AA 3CE8A 4EFAC 4LFAK 5KQDA 1J5OB 4FPIA 4O5CA 2HGNA 2JH1A 2JC0A 2P5VA 5MLCQ 1F0MA 2BBEA 1NGEA 4M42A 1CJKA 1S6QA 4BR4A 2GIQA 1VQSA 3S6EA 2VG5B 4FJNA 3DLEB 3Q8KA 1Q3UA 2YKPA 3ZZTA 3ILIA 4WZMA 1YTYA 1BCOA 2GGPA 4DR7J 4DV6K 4OJRA 3G10A 4CNZA 4CEEA 2OPPA 3PEHA 2QM1A 3OXFA 2ASJA 3DU5A 2ZIUB 1VLBA 2M9NA 3HVRA 4BXOB 4F5QA 1R3NA 5CP2A 4DV7K 2E8MA 3VAHA 1DZ5A 2RRAA 4DL6A 3SIPB 5AM5A 5CCMA 4B3MJ 3P49B 2QWNA 1MWKA 5L1IA 5KPRA 2RUGA 2D4WA 3NMRA 5DS7A 3BQ2A 4Q2MA 3AD9C 2O8FA 3L2VA 4CLLA 4DFDA 2DNOA 3CT9A 5D4BA 3R2DJ 1OVQA 2EAMA 1KD1O 4RNNA 4M3WA 1SWWA 1K8KB 4MAKA 2H3QA 2Y3YA 4PZVA 4DHVA 4KI4A 2FJWA 2XZWA 2QA2A 3R3LA 3RH4A 3QBWA 4OI4A 3ENOA 2LHTA 3FC4A 2R7RA 4PQAA 2QWPA 4DF8A 1NGHA 2FIUA 4CDGA 4LRBA 4LJXA 7ICNA 1IKYB 7ICEA 3FCVA 4HTUA 4JWMA 3OQ2A 3BGRA 2BJ3A 2VG6A 4YDDB 3AD8C 2W4CA 2DEJA 3D0IE 3H59A 4BC9A 2YMLA 1FKPB 2FZKB 3FK4A 4F02A 4PR6A 2AZ1A 4RW8B 2DD8S 2O3DA 4QNLA 4ZLJA 3UCGA 2ZTEA 2BKPA 2M3DA 4MH8A 1OUQA 2ZBQA 3A3NB 4DU8A 1KC8T 4WQ4C 2QLBB 3FYHA 2EFPA 1HWJA 3KK1A 4JI0J 5EVZA 1HHQA 1V3ZA 5ALSA 5HATA 3BKTA 3J7ZT 2HFNA 3T1HJ 3OYJA 4K42A 4DR3J 4LF6K 1BIUA 5LSLA 1HJPA 2J7KA 3DDHA 2AQ0A 4Q8EA 1C0UB 3LDAA 3DGPB 1RAHB 3F2KA 3LL3A 1TL1A 2HVZA 4YMEA 3M8YA 3QT8A 1XERA 4YOVA 3M3ZA 1NKBA 2Y9HA 3DRPA 1JLEA 5I42A 3A3PB 3IG5A 1NZAA 5EU7A 3KG1A 4ZHRA 2I2YA 2QTWA 2YQEA 2CNLB 1NDPA 2P35A 3EKSA 1RAIB 1XJWB 3W5YA 2KVSA 1FDDA 4ES2A 4IFYA 3T3FA 1L7MA 4UB3A 3HHLC 3IRXA 4ID8A 4DV4K 1H7XA 2P9PB 4B3RJ 5C10A 2ZIVA 3KXDA 1JN3A 4JN4A 3NCRA 4JI3F 2DNPA 5AKIA 2XGPA 1WB9A 4FWOA 4MJKA 3L5KA 4DTUA 5LL6d 2KXHA 4YD2A 3KUEA 4UOGA 2OZSA 1Q1KA 5G0RA 4DQPA 1ZBLA 3TAGA 2F40A 3E01B 3ZZOA 5IFMA 1B0VA 1UVIA 3G87A 4FWRA 3WNGA 3AA8A 4B1VA 2GO8A 5HMLA 5G5GA 5DLGA 4DR2K 4UB2A 5E79U 2IJRA 3RRGA 2H9ZA 4LR7A 1MA7A 4LBPA 3R27A 4CGGA 3SMSA 2NO5A 2VQEK 4Y2IA 4J37A 4IH5A 5C5JA 1PBUA 2W8LA 3V7LA 4CT8A 1VBZA 3DAWA 1O0PA 4H0XB 2CRXA 4EYIB 5C2CA 4H4MB 2MJNA 5KFHA 3OW2R 4ZVRB 3OYAA 3CI5A 4E7JA 5AKGA 1WTFA 3JSRA 4GMKA 2UXDJ 4ACOA 1HA1A 4LF4K 2BUNA 2D6FC 2FLLA 1FERA 3V6JA 3MM5B 3RJHA 3A8IA 3GFZA 5E26A 4CFDA 3O3GA 5KG1A 1KQFB 7ICTA 2YQ0A 1CG2A 4KTWA 3S6JA 5E3PA 4W5RA 2AJQA 1P6TA 2NRRA 3QIPA 3U3YA 1C0MA 5BRDA 4DZ6A 4PUOA 4IR1A 2JFDA 2YHBA 4TKTA 4K5SA 1IXRA 5L9NA 1NK9A 2QARA 1CJKB 1S6QB 3N01A 2OMLA 2Q79A 4U6PA 1NJZA 1HKAA 2OPSA 4DR6J 1J54A 3V9WA 2NQPA 2LYVA 1FEEA 1VMBA 2GGPB 3ZDEA 2GHPA 1U0HA 1A76A 4ZVEA 3Q8SB 2OPPB 2DFLA 4PHPA 2MKSA 4OYPA 5FD1A 3RBZA 3LPEA 2WVEA 3MMBA 2E1CA 4CF1A 1ZQFA 5A0YA 3CEDA 2OTJS 4KN7A 3NH2A 5KG3A 4QYZJ 1S9EA 3VOVA 4UAYA 2XMKA 3G6EN 4MEXA 1HRHA 4Y6IA 4HHTA 2ZH6A 5F3XB 3D6TB 4MKBA 3DLLL 3K59A 2O8FB 3HHKA 1CZBA 2D3OR 7ICIA 2HVHA 4F5NA 5AJ3K 3NP5A 1DFDA 3T19A 4ECXA 3KKAC 4C98A 4KJIA 5B8HA 2VOPA 3AQOA 3K9JA 5KFDA 7ICRA 1EAYC 2BE2A 5DZ7A 3ISDA 1WELA 1KQSR 3LUYA 3P8BB 2E1YA 4NXMK 4JKGA 4BY9C 1RSCA 3BGRB 4DUYK 2VG6B 3L09A 2FB0A 4DFPA 3QIOA 3SQGB 4LSLA 1QHTA 1Y10A 2QIFA 4DV3K 4TN2A 1U4BA 2ZJRL 1RYUA 4DSKA 4RBUA 3VF0B 2F1FA 4BRAA 1S48A 4MIAA 2NZ4A 1UWBA 4A5AA 3KK1B 2VJ5A 2HNDA 1RXOB 3KHHA 4A8EA 3PCOB 1KTQA 2UXCJ 3CJCA 2F44A 4Z6CA 1O51A 3AUOA 2B4UA 1U02A 3J81j 1W2BR 1Q82O 3C15B 3QUBA 3L7UA 1ASVA 4B1UB 1TL1B 5F8LA 4ZN3A 2B5JA 5AQQA 3U9DA 2ZXIA 5AK3A 3FZHA 1OJ4A 2M9KA 5KFJA 3DRPB 2EAOA 1JLEB 2XI9A 2R7XA 5I42B 4PJ0U 4G3IA 1IKVA 4DV5F 4P4PA 2CPRA 4QS8A 5DM6Q 2FVRA 4ZHRB 3M6GA 4ILRA 2RF2A 4J2EA 3SSSA 3LP1A 3HF5A 3UXNA 4IFYB 1WTBA 4CZKA 4K4VA 4C1NI 3IRXB 1NOYA 2J76E 2DGVA 3WEEA 2ZIVB 4ECTA 2P9UB 4ICAA 2VOOA 1JWWA 5GAEI 4PL1A 3MDCA 1IJJA 3SJJA 3R1HA 4A8OA 3BB5A 1Z25A 2A6AA 2YXLA 2BOPA 5JVGL 5G0RB 3D6MB 2I6WA 3VQSA 1YTAA 2BHNA 2Z2MA 2XEXA 4FZYA 3H0RB 3HKZF 3LAKA 1SL1A 3Q8YA 2AHOB 1VJQA 2V34A 4DS4A 2BOAA 1J2VA 3SCIE 1A9NB 1X60A 2A3ZA 4DEZA 8ICEA 4BLGA 2BRKA 5AQJA 1UCNA 1XMQF 2DWQA 1WOOA 3RMDA 4ZCLA 3QUCA 4WQ5C 1BHLA 4IG3A 2VODA 2QWMA 1QQ7A 4ECVA 3GU3A 4J9SA 4F0HA 2KIWA 3UO0A 2OLWA 3GB0A 2KVQE 2F7VA 1G4CA 1V3RA 3US5A 4KB7A 3PHTA 4C8NA 2APOA 4ZH4A 2FSJA 1JXEA 3JAMY 2CJXB 2GZOA 1HNXJ 4X65F 3GILA 4M9LA 3M4XA 2KFZA 3KD1E 1O6XA 3J7YI 4NY8A 5JU5A 5ETTA 4CI0B 2ZJQL 3HILA 2PZSA 2D8CA 1WD6A 4LR8A 2MKJA 4IQMA 4I6MB 3DXSX 5EX5A 2DEIA 3NWRA 2CQDA 2J0QD 4HHJA 4NLVA 4LFCF 1X9WA 4M9NA 3BSOA 2ZJAA 2WB1D 5M2PA 4RX6A 3PIOQ 3SEIA 5AM4A 3VPZA 4GKKK 1NGDA 1TELA 1N34K 2J8AA 2KU7A 3KHRA 3QIPB 1M5KC 3E3XA 2KO1A 3QEVA 4PUOB 2NPFA 3I0RA 2QARB 1SXDA 4B9UA 2QX0A 3R8YA 3CULA 2OPSB 4KN4A 1K8AO 4A2BA 2RU3A 2Q6CA 3E51A 8ICSA 2YWFA 2DGXA 1U0HB 3CDEA 3K17A 2HK3A 3PG9A 4KTQA 4RQ4A 5GMEA 2FJBB 2CFXA 3IDHA 2MY7A 8ICYA 2C3YA 3B0YA 2CQGA 2PA8D 3MMBB 2R9LA 4XUSA 5GADP 4CJEA 2UYTA 3IWNC 5A0YB 3NGSA 2CQ2A 4K5RA 4Y34A 3J8AA 3D2FA 4CJKA 3BY5A 1C6VA 3H4DA 1URNA 1S9EB 3KLFA 3IG1A 3UDEA 1NI3A 1GH8A 1GQEA 2HOFA 3QWUA 3LALA 2EK6A 2FGOA 5T14A 4H5VA 3AB2B 2ZKTA 1U25A 2XYGB 3H7IA 2A3JA 2KI2A 4J9OA 4ZP8A 4X62J 3M32A 2K89A 3NGUA 1OMSA 1WUAA 4ZVPB 4WU2A 2BE2B 3M2UA 1U9LA 9ICUA 3M7DA 2RIJA 4Y2KA 4JKGB 4RUAA 3SCJE 1OIAA 3G6XA 1HD0A 1X4CA 3L6QA 4K41A 5BPCA 1CI4A 4HI2A 4OMFG 5M2RA 5LXRA 3ZT0A 3D0HE 4LSLB 2FDNA 2G8HA 1S97A 2AP6A 2VWBA 2CVEA 5KG7A 1FD2A 2F8HA 1S99A 4BDZA 3K75D 3EZOA 3IS9A 4AHRA 2WVFA 1V38A 2H51B 3PY8A 4IO9L 3K5OA 2HQFA 4LFAJ 3H2UB 4K2JA 3J80O 2LECA 1FRIA 4K4SA 1UWBB 2IVFB 2FPHX 4Y2TA 1C4AA 2HNDB 3BQTA 4BRFA 2FHJD 4QCLA 1REVA 4ZOSA 7ICQA 2MAXA 4DV6J 5D15A 5ETPA 1JX4A 1BPXA 5KRTA 3Q0AA 4WFAL 1IG8A 2K8CB 1ZBUA 3BPDA 5LMNF 2B5JB 4CLUA 3U26A 1ZQPA 1NJYA 1TAUA 1X7VA 2MQNA 3AVCA 3CQYA 2CQ1A 2IHNA 4DV7J 1P7DA 3PX0A 4H0YB 1WHXA 2JXJA 4G1QA 5HQMA 4K2XA 2J0SD 1IKVB 3ZZYA 1K5OA 4GIBA 1WBDA 4IJAA 2OO4A 3I55S 1OW5A 2G4BA 2RF2B 3RJGA 3PRBA 2IY5B 2HNYB 5DB7A 2XLJA 2JEFA 1NKEA 2YWEA 2VU5A 4OZJA 4OYWA 1B0PA 4NLSA 3WEEB 2PAVA 4EIAA 3PW0A 5CY4A 1NHKL 1HUOA 5AM0A 1RT6A 1K73O 2HOEA 3H4BA 4NL9C 1NBEB 4QW8A 2FPKA 4GY2B 4JB3A 3QEXA 5ETLA 3ZSXA 4BRMA 1ZQWA 3HX0A 1B4FA 3QSYB 4DTSA 3BPSP 1S6PA 4OX9F 4A8QA 3ONQA 3QMQA 4DR4F 4P2MA 3TEGA 4MLEA 2K3KA 3WQUA 1MMLA 2VC1A 3FEYB 1OVYA 1U2CA 2CWXA 2OTJN 4FM1A 4DDFA 5DBCA 3KTQA 3OR1A 2Y0SD 1QQCA 5A8RA 1EP4A 1FWPA 4Y0FA 1B22A 2A1SA 4X66F 5TKYA 5I9EB 3V9XA 1VIXA 3SCXA 3H98A 3WK8A 4DOCA 3Q8VA 4Y2RA 1BCMA 2KZMA 3AODA 2QI2A 3MUVP 4M5GA 1GK8A 1VGYA 4ID5A 4QS9A 4LF6J 1IBMF 4KYZA 4U7UD 1ZM3A 3TSQA 2GS8A 3CP8A 1RDCA 4NZ7A 2EW9A 3DRSA 5EDWA 1BWEA 3UMGA 4O5KA 4B3OA 1TL3A 1UCVA 1N63A 1RJJA 2WF5A 4QWDA 1YRXA 4DQQA 5KPTA 4QZGA 2Y8WA 4XH4A 3ASMA 5B66U 1N33F 4JUZA 4OKEA 4DUZK 5DDMA 4JNEA 3SBTA 7ICSA 2DFFA 1T03A 4FN5A 4C0BA 2VDIA 4DV4J 1FNOA 1YT3A 3I0RB 5GAHP 4I7FA 5HMYA 2BKNA 2WSCC 5M2UA 2IOCA 2YJFA 5GAEP 4K4XA 4OGEA 1SC3B 2YKAA 4UB4A 1XEZA 3FAHA 5CYMB 2JMGA 1SZPA 2WAQD 1NDLA 3M6VA 4M3RA 4J9QA 2XS5A 5FRMA 3IP0A 3ID6A 4JBCA 5B0FA 4NA3A 2MHNA 3KMQA 2C2ZB 3TR8A 2X1BA 1X5SA 2KVCA 4DR2J 4IQVA 4K4IA 4X5VA 5E2QA 3VERA 2H48B 3D2FB 4LH5A 4UB1A 9ICXA 3VQCA 1LWFA 2ZBRA 4E7HA 1J53A 2JWNA 2NR0A 4JI5K 1ZJNA 2KG0A 1YITN 3IG1B 2VQEJ 3CCMS 3KK2A 1QSLA 4CEAA 3TWHA 1FNXH 2X1FA 5ALRA 4DN0A 3FMBA 1LV5A 1QUVA 2EZXA 3O9TA 1ZQMA 5CAAA 2BYCA 1S9FA 3JSMA 3M32B 3ZSQA 8ICLA 3IAM9 3W8PA 3GFXA 3HKZC 4ECUA 5KFTA 1VRQC 2QO3A 3M2UB 2QA4G 2EDUA 4Q43A 1Q95G 4LF4J 1EQMA 1T9XA 3CCUS 5CXTA 3CXCM 2IBKA 2ESEA 1JLGA 5KG5A 3AO5A 3TFRA 2UV8G 2R7VA 4AILC 4AQYF 1Q53A 2DITA 2EI5A 1ROFA 2C2OB 3CDUA 5DG9A 2I7PA 1PC5A 5HBMA 3ENHA 4IG0A 1X2IA 3VEYA 3ZLJA 1BPYA 3KG4A 4U67Q 2NLXA 4TY9A 3K1RB 4KMUA 3LZIA 3IS9B 2Z4PA 4FZLA 3N4QA 1X4GA 3NCPA 1QSYA 5KG4A 3CJ4A 4GMJB 2F9TA 4O5BA 4KX3A 4GVLA 1B92A 2EVZA 3NVVA 1TKXB 1D09B 2JWKA 2K2PA 4CLKA 3MN5A 3UD3P 1QVGM 3RJIA 1XI1A 1VQ9S 4M41A 1FFGB 1REVB 3AD7C 5BYRA 4MFBA 3S41A 1C4CA 1MC8A 2HZCA 1DQ9A 3NVMA 5A8WA 1LCUA 1KHVA 2VZ9A 4HH1A 4OKJA 3OTBA 3EDRB 4I6YA 1WUDA 1UJ4A 1Y0HA 3S8SA 2DHXA 4MFAA 3R6LB 3FFIA 4WU3A 3OVAA 3TTFA 1PYSB 1P8GA 3MM9A 4EYHB 2JX2A 2VBZA 3FNNA 2PFUA 5HNKA 3AVGA 2EWHA 4G1QB 1A0OB 4CFBA 3WQPA 3T41A 1IJFB 1FRJA 4R25A 4CVNE 2VICA 2ZZNA 4MDBA 4OQJA 1E4GT 4UAWA 2C1EB 3WK6A 2DHGA 3BKFA 3B6PA 3RB0A 3J7AN 3SNNA 1WLJA 2YMMA 1WF0A 3CW2C 1RT6B 2XY6A 4LVNP 4NXMJ 4K4YA 2VHGA 2MQMA 3P96A 4DUYJ 1S6PB 1OY8A 3U6FA 3O44A 3FQLA 4DV3J 3MXIA 3T5LA 2G13A 3BBBA 3EXYA 4U7CA 2YTCA 3BEGB 3WNFA 4CJSA 2VFTA 4FBTA 1RDFA 4KSEB 1QQOA 1Q86O 4KHWA 1YUWA 3OR1B 3R8EA 1EP4B 5ETOA 4KBIA 3SPYA 1WC6A 1RDRA 3CJBA 1ZAXA 3OD2A 4B08A 1N32K 3TAEA 2FBXA 3PJ9A 3MFIA 1HL6A 4LF2A 1S4EA 4JI8F 2LFVA 4NRUA 3KK3A 5CA5A 4ID5B 2MTLA 2E6MA 2ILZA 4KT0C 3SJHA 1RWKB 2BR0A 2RHSB 4TU8A 1N56A 4PXDA 2DVIA 2DNMA 5DG7A 3DRSB 1H1VA 2XSFA 1RWUA 1XQIA 4DSJA 2HI0A 3HVTA 4B3OB 1TL3B 4DBQA 1MMNA 3QIDA 9ICWA 2WMMA 5I4MA 2YMPA 2W2OP 1WC3A 4TNOA 1VQ8S 3S3MA 2R4FA 2W2QP 4DF4A 3CM5A 4GFJA 2PGCA 5D4OA 4KLIA 2ERRA 4QJFB 5A0LA 3EJMA 4R0EA 1UFWA 3AVNA 3VAKA 1FEZA 1RA7A 3CC2S 4I7FB 2V7YA 1S12A 4BDPA 4YS2A 4M94A 2G8KA 3RB3A 2HAFA 3MCPA 4BRLA 1NGBA 5T7BA 3PW4A 2P9CA 3MMVA 3UD5A 3HWTA 2IM2A 2QXFA 4Y2VA 2GC8A 4EHTA 2HB5A 4WKRA 1MN8A 3CQXA 3HJEA 1QTMA 1CXUA 4B3MF 4KPYA 4YORA 2AYBA 1YBAA 5ALOA 1ZQKA 2MY8A 2CQBA 3VGMA 5D4LA 3MCOA 2HS0A 1IG9A 4ZPWR 2OPRA 5CRXA 4CZIA 2X6NA 2H5IB 2HBLA 1VLYA 2W3RA 4ZVUB 1QTNB 3KK2B 3QRRA 3Q89A 3F53A 2V2ZA 3GCWP 3I55N 4CF8A 3H2VE 5DQHA 3KLGA 3GR0A 4RU2A 2ZWPA 3TJ8A 2RMLA 3QU4A 3JSMB 4M63C 4AHTA 1HIWA 1AT1B 5AXMA 3WHIA 2JEIA 3TX8A 2V8DA 4B1WB 5D0GA 4M9JA 4BREA 4IO1A 5AE3A 1RTHA 3P5TL 2CJ9A 2X1GA 1JLGB 3THTA 4KLJA 3AGKA 5AKLA 4CEFA 2KRBA 2A18A 1OY9A 2IC3A 3MXHP 3RB4A 5HBMB 2QW9A 3TUPA 5A2QU 2R8IA 2D3DA 3KZXA 4GKKJ 4IR9A 1N34J 2VD3A 3MMCA 5HAOA 1IBLF 1ZQGA 4WWSA 3ISCA 8ICFA 3UPFA 4B1YB 4C3MA 9RUBA 2J4RA 3J7Z5 4M3TA 4ZPAA 8ICXA 1WNSA 2ILYA 1JKHA 3CD7A 1W25A 1X9MA 4JK7A 5KL1B 1UPMB 2BCRA 4F3TA 1G15A 5EN1A 4MFBB 2EZYA 3QNWB 3DLGA 4NZ0A 3BO4A 1RI7A 2H3ZA 2ADBA 2FJAB 4NLYA 1RWNB 4QWBA 1SJRA 3ZO7A 4KKOB 1XO0A 2LU1A 1LXNA 3FFIB 4J2AA 4PAAA 1OH7A 1RZTA 1U24A 4OHYA 3MM9B 2LM4A 3W5XA 4FYYB 3SDEA 1EKSA 4KBOA 4LRDA 2V9WA 2AEFA 3OPXA 4PZNA 4PZOA 5K20B 4BQLA 1UKUA 2B7CB 3PO5A 2MZSA 1YGYA 4DV0K 5HQLA 2PDAA 1CVJA 5AQZA 3ZZZA 4L3NA 1F5SA 2H65B 4K50A 1WC4A 5KFAA 5B0AA 1SQGA 2GVDA 4Y2CA 3UDLA 5EY4A 3CJQA 3PSFA 4DTNA 2QWQA 1S3XA 3N6MA 2VG7A 1DQAA 3B9JA 2LQ8A 1LWCA 2XGQA 4FP9A 4ZVTB 3C95A 2JVOA 4FW1A 5CABA 1GMWA 3V5RA 3WK4A 2RQ5A 2V8PA 4LJMA 2HS4A 4Z4HA 1N36K 1NB7A 4K4TA 3GWCA 2C3UA 2LDYA 5AT1B 3O9UA 2F63A 3MXJA 3M9OB 3LW5C 1V9OA 3C7NA 1WKLA 4RQ5A 3RJFA 4MIBA 3CCRS 3EL2A 5HHIA 3W2WA 4DLGA 5CWRA 4M5NA 4JI6K 1XR6A 1WDDA 3NOCA 5CCLA 1HPZA 5IM0A 1IBKK 4PXBA 3WBZA 3ZT3A 1NG9A 2YB1A 2A10A 1KP6A 5FPDA 2AX0A 4E0DA 4JKDA 3ICXA 2QT7A 2BZFA 5CZ2A 4DL5A 1KEKA 4URGA 3CCMN 1O08A 1M5PC 4M3XA 1FDBA 2LEPA 3DHXA 4XPEA 5ETVA 3VQQA 3THYA 3QZ7A 1PK1B 4ZVOB 4Y2XA 3IHQB 1WSRA 4CO5A 1FO1A 1RYSA 3I56S 1GTEA 3NBPB 2E5SA 2O66A 4FLWA 1YG0A 3HVTB 4KGMA 4BS2A 2E29A 4WF9Q 4Y0WA 4ZITA 1LKZA 4F91B 7ICFA 4FJXA 4YDUC 3F2DA 5M1QA 4DKWA 4RNOA 3BGUA 1G3OA 4USTA 2BQ3A 3K9KA 4MQ3A 3HZGA 1Y11A 2GIRA 1N0VC 1ZBSA 1ED1A 2YPZA 3IM9A 4HHHA 1LXJA 1N48A 4LVSA 5KAKA 3WXMB 1M1KT 1P9QC 4HEA9 4BCAA 3GFHA 5D0RA 4IRKA 2XHCA 5IQQA 3W60A 1WSHA 4RT3A 3PM9A 2ASOA 4OYAA 2ASPA 8ICJA 5DDPC 3ETRA 1VR6A 1F60B 3CO9A 4A47A 4LMZA 3D2SA 4KAIA 3J80Y 1VQ9N 1JQGA 3BSCA 4HUFA 4WFZA 1H3DA 2UUCF 9ICMA 1TU0B 5BPMA 3CJ9A 5DKWA 1QQ6A 1TKTA 1UW9A 2F1JA 4U8YA 4NEYA 4DQ8A 1JMTA 1YJNS 1UW4A 4JKCA 1ZQ1C 5AFUA 4NLDA 3O3FA 4JKBA 2OH2A 1YJ7A 3UIQA 2C2KB 4DV1K 3BGFA 4M5JA 4NL5A 3OLAA 3BREA 1U1QA 2KKHA 3TI0A 2OPRB 4M04A 2QJ3A 5CEHA 1CC7A 1C7YA 2R7UA 1IO2A 3OYGA 1N60A 4ZLLA 3BF3A 2G8VA 3NNAA 4ZJQA 4RPZA 4AF1A 3KLGB 4Z7CA 3I33A 3FBEA 1IVZA 1W26A 4Y1DA 4CBWA 4JWNA 1BGXT 2G0JA 3VAMA 3CJSA 3W64A 4NYZA 4FWSA 2FC8A 1RM6C 2MZRA 3T1AA 3VA0A 1RTHB 1FD8A 4CF4A 2JJ4D 4KH1B 2QL5B 4NMXA 2E44A 5AI9A 2M4MA 5AIAA 2OWOA 2AF6A 4IO8A 1D8ZA 4BVOA 1M5OC 3SAGA 4PG6A 1NHUA 3H5YA 5HLFA 3WNHA 3UDVA 1JNZB 5M1NA 3UDCA 3MMCB 4DUZJ 4CO0A 3OTDA 1F3FA 2FC0A 2CPHA 1RT1A 5F0WA 1HNZK 2QLJB 2IBOA 2ZOFA 3F9KA 4HUGA 4Z6FA 5CZVA 3MR2A 4FWQA 4Q0BA 2WTUA 2MKCA 3I82A 1SIJA 1FJGF 1Z1ZA 1JKHB 1NZPA 1QUPA 3AVIA 3SQ0A 4RQ6A 1VQ5S 5KFYA 1RGVA 1R43A 4KRFA 1DRZA 2BKOA 3UN5A 3QT6A 3TAFA 1UQVA 1NJWA 2RD5C 4YXJA 2AYGA 3DLGB 4P10A 2W54A 3ULHA 2BACA 4J91A 2I6XA 5GTHU 5EE3A 2ZBPA 5LM7E 1R0AA 5BN8A 2Z1GA 4BROA 2KNJA 1R0BG 1RTZA 3DLKB 1P1LA 3T9ZA 2XWYA 5GAGP 1X3MA 1KKXA 3BKUA 4QZ8A 4QZVB 1Q7YO 1D4XA 4C0ZA 4B17A 2BEFA 1VQNS 4JI5J 1H7WA 2VA3A 3QFPA 2VDHA 2FY8A 4R64A 4EU0A 4H0OA 2YHYA 2HOQA 1P90A 1VQ8N 4A8KA 2Y9TA 3DM2A 4JAXA 4WP8A 2QFIA 2GVDB 1N6QA 5HRNA 2EPIA 1HBUA 3A5LC 1R8AA 2O67A 2ZIWA 2AA4A 2VFVA 2VG7B 1CULA 2PN6A 1K1SA 1LWCB 3OYLA 4N8OA 3F2CA 3T1YK 1OSCA 4E7LA 3FZ2A 2KZZA 2YX6A 1VQYA 4O44A 2XZDB 3UNGC 1L8OA 4IUFA 4FLXA 4TUPA 1T0TV 1L3SA 4DL4A 3W2WB 1UA0A 3W62A 1VQKS 3TRGA 1TVRA 5IM0B 4BHQA 4Z37A 3C66A 3LQVA 1KXPA 4GKJK 1FWLA 4CYUA 5KGXA 4EUVA 4M95A 4F2SA 2OELA 1U6BA 1F9HA 4AXJA 2J9DE 2BJ8A 3THYB 3LDQA 4V19J 3ZSYA 3M8PA 5JLFA 1U09A 4FJ5A 4L74A 4A8SA 5HRRA 7ICPA 2CQPA 5DG8A 2FJXA 2LKYA 3MWPA 4H4OA 1ZRMA 4ZVGA 4DFKA 5K8PA 3ULEA 4K4WA 4ID1A 2PO4A 4J9UE 2GVZB 2PMZF 3PJXA 4RUBA 3KOOA 2XULA 3SMZA 3RBEA 2PY5A 3K0JA 3CCLS 2DXDA 4C8KA 4ECZA 3MMAA 5IOLA 1U2FA 2P6RA 2WK4A 3GMGA 5THWA 4WIQA 2D1KA 1RBVA 3EEQA 4F67A 5J2CA 3NF8A 3IGVA 3QGGA 1RAJA 3I8BA 5KFPA 4DI6A 1WEXA 2Y1IA 1IJEB 3R9PA 3PMLA 1OQ3A 4YMNA 1WEZA 2EFQA 3IG8A 2ASMA 1NPPA 2LVWA 1ZQYA 4LSNA 1TKTB 2P1JA 5HJXA 1ZBHA 3OW2M 1XNRF 5BR8F 2YH0A 4GO5X 4KFBA 5AQKA 4PGYA 4JI2K 4M5LA 1S0NA 5AR0A 2A40A 4X62F 1G99A 3HHLA 1SL2A 3RW7A 2WVDA 1IR1A 3POTB 4C9DA 4X4QA 3HHLD 5M1OA 2FLPA 3PHEA 2VFRA 4A48A 3EDQB 3HHNB 2BABA 1L5UA 2ZTCA 2G8FA 2YBVA 3JPNA 3GCXP 3ZDBA 2ZVIA 1JCFA 1HHSA 3MCMA 3ILLA 5KFRA 4PKDB 3SBGA 4B3SK 1U1PA 2GHVC 9ICSA 2LEBA 3G4SS 4ZPCA 4O8UA 4YCXA 3K5NA 1BQMA 4XH5A 1RHMB 1V5IB 1CZ9A 1RT4A 1U45A 3KKSA 1VQOS 5HLFB 1XSPA 2LCWA 4RKUC 3V4IA 4JKHA 5AM2A 4ZVSB 4KGZB 3CCRN 4DX8H 4Z6EA 5IIOA 4USUA 4EI2A 3AXMA 3CJ1A 3M8WA 1YVNA 2CRLA 1ZRNA 2G09A 2R8HA 4AP9A 3O08A 4RPFA 4Q0BB 4W5TA 2K4HA 4CZLA 2E5HA 2P6SA 4AUKA 1BWFO 3MECA 4LF1A 1O8BA 4LIWA 4CM0A 4MK7A 3ZT2A 1YJTA 4X64K 5ALYA 1QDUB 4ILGB 3OY9A 4ED6A 2F8KA 4GVMA 2DUYA 3IRWP 3HKWA 3T69A 2P2CB 3QBXA 1R0AB 5J0RA 1F0XA 2D3ZA 2F9JA 5J0WA 4HCCA 2DBBA 3I56N 3PIPL 5J2NA 1HLUA 3ZZ0A 1QQMA 1J27A 4J9NA 3LM2A 2E5IA 2LEAA 3B54A 1IV8A 4ALZA 4HVZA 2V2VA 2DGOA 4FKXA 3W8GA 7ICVA 1KQSM 2DPIA 2Z1JA 1MLAA 3ZETA 4A57A 3U1NA 3DM2B 5CD4A 2Z58B 5BYQA 1TFRA 4FO0A 2YNGA 2BQRA 1YKWA 4BC7A 1N6QB 3JPQA 2LA4A 4LRAA 4X2BA 1HBUB 4ZS6A 4CLTA 4MTPA 2RE1A 3NGKA 4JV5K 1UOCA 5EOZA 2ZIWB 4ZA1A 4DOBA 3O1BA 1CULB 3A0IX 4KH0B 3QEWA 1EKRA 1I3AA 1HQUA 3TSUA 1KVKA 2GOLA 2CPFA 5D78A 1D9AA 4U7BA 4O44B 2W11A 1CSJA 4EELA 1NU0A 4UOCA 1Q7LB 1MWMA 1SWVA 1EARA 2JLGA 1OO0B 4OZ5A 4Y65A 2WHOA 1RAGB 4J90A 2VPWB 3AOCA 1YJNN 3K4GA 1TVRB 3TR5A 4FF4A 3CVKA 4LF6F 3NMAA 3H1VX 4CYUB 4F4XA 2I9SA 1M90T 2B43A 3PEJA 2PEHA 3DDIA 3UQ2A 1I94J 3HSJA 3VR1A 1TUGB 4NASA 1COOA 1N52B 1NK7A 1ZA2B 4LD0A 2OD6A 3BYRA 4L75A 4CZJA 3VEZA 4QZFA 1U0SA 2UXBF 3AU2A 2EWSA 5J2GA 2UU9F 3NF9A 4F3MA 2KHOA 2UUAK 2ZE2A 1ESVA 4H4OB 1SJFA 3ULEB 4DTRA 1S7IA 4PY5A 3H8MA 5J2IA 1QJHA 3OTCA 8ICHA 1RHJB 1J6ZA 4E3SA 4UB6U 4F5RA 4ZTJA 1S57A 2W4DA 1Z1BA 4FJJA