3HPOA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus y714s mutant bound to g:t mismatch
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVSGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 579
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hpoA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hpoA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hpoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpoA01
3RB4A 4O44A 5DLGA 4O3NA 2HHVA 5DQGA 3RH6A 1ZQIA 1F21A 2R8HA 1RBSA 4ED6A 2UVWA 1WAJA 2MAXA 3ZSRA 4LD0A 3ZSWA 3O3HA 4DTXA 3PUFA 2F8SA 1IKWA 4W5RA 2FBXA 1BPEA 3DLKA 5L9XA 3HPHA 1TK5A 2W9BB 8ICVA 4Z6DA 3RTVA 2UVVA 3SUOA 3RJJA 3NHGA 4E19A 8ICMA 3WNHA 2FMPA 1W9HA 2Q0ZX 1XS9D 4QWDA 1NOZA 4LY7A 1ZQPA 2R8IA 4GXIA 4Q8EA 3SQ0A 4I2HA 2HB5A 4EYIB 3JPQA 1D9FA 5DGAA 4NLNA 1BQMA 5KFMA 5HP1A 1TKTA 3H8JA 1KSPA 1QSLA 3RJGA 4HUFA 1Z3EB 5DG7A 4UB5A 4R65A 1ZJMA 2QK9A 2A1JB 4I2GA 4CF0A 3MR3A 3AVBA 4IRDA 4FW1A 1T05A 4RQ4A 4DL7A 2OWOA 2VA8A 1EX4A 1KFTA 4IRCA 1QSYA 2OPSA 4RQ7A 4OVLA 1MC8A 4CF2A 4Z4HA 5C42A 3JPTA 3GFKB 5CR0A 1NJZA 5EOZA 5BOLA 3OYDA 2NRWA 1ZQYA 3MGIA 2R7YA 2BCSA 3SUNA 4P4PA 4FLXA 4E1MA 2RF2A 4F93B 4Z4EA 2KZ3A 4M9NA 4DLGA 5CHGA 1J54A 2RKIA 4AHSA 3AVCA 2BCRA 4F5PA 4CHPA 1WCLA 1ITGA 1MSWD 2O4IA 1XSLA 3LK9A 1B43A 8ICFA 4I2FA 4KTWA 5HRPA 3V9ZA 4KHYA 4M45A 4DF4A 3LP1A 4E7KA 1C7YA 2HNYA 2ASLA 3V81A 3MGHA 1NOYA 4CK1A 4I2PA 8ICAA 5KFHA 3VQAA 3SNNA 8ICWA 3HM9A 4FJ7A 3K4GA 3ZDEA 5FROA 1CLQA 4B3OA 4R5PA 2ZJ5A 8ICUA 4BGDA 3TABA 1ZQWA 2ASJA 4QAGA 3AVKA 4RQ6A 2HHQA 3DI6A 4CEQA 4ID5A 3RB3A 5J2DA 2DTUA 5JUMA 4EYHB 4RW6A 4NYFA 3T5JA 4ECTA 5KFAA 5KGWA 3ISBA 1CZBA 2ZD1A 5KFCA 3GIMA 2Z1HA 5IIJA 3QLHA 5IINA 2HVHA 1QE1A 3QIOA 3SCXA 2YHAA 5HMLA 4YVZA 2IA6A 3Q8MA 1HUOA 3PW2A 1K1QA 2VA3A 3Q8RB 4F5RA 4OKJA 3CYMA 2JGUA 4O5KA 2XY5A 3MXJA 8ICXA 4QW8A 4M9LA 8ICKA 4Z4CA 3IRXA 3OYEA 9ICFA 4EZ9A 9ICGA 4CGFA 4QOZB 7ICKA 3UIQA 2ZQBA 3F9KA 2HMIA 4CF9A 4KLTA 1O1WA 1IG9A 1CXUA 1L3SA 4FLUA 5J29A 7ICSA 1CXQA 4F5OA 7ICOA 5I42A 3JPPA 3PX4A 1LWCA 2KFZA 1S5JA 1RBUA 4B9NA 3EPIA 4IG3A 4NLZA 3OS0A 4N5SA 4B9TA 2FBTA 5HHHA 1MQ2A 5HHIA 4O3PA 4YN4A 3KHRA 5HNKA 4PGYA 4LSLA 2DPIA 1RDAA 4CERA 4MFAA 3LPUA 4EBEA 3HWTA 4QZGA 4DL5A 2IMWP 2I5JA 4F2SA 4MFCA 2OZSA 4KI4A 3FDSA 4RQ5A 1G15A 4DTSA 5HRSA 4O3RA 3T5HA 2ASDA 4ECZA 2FBYA 3RJHA 4YMOA 2HHUA 4KLOA 3TFSA 1YT3A 3AVLA 4M47A 8ICCA 1BCMA 4FJ9A 2V4QA 2PFNA 1S1XA 1D8LA 1L3VA 5FRMA 4HVJA 3Q8SB 5HROA 1NK7A 3NBPA 5DKWA 5KFDA 3M8QA 3LP3A 2HVIA 4OGEA 9ICNA 3KHHA 5J2BA 3Q8PB 3HVTA 4FZXC 5C25A 3T5LA 4DQRA 1JLBA 3L2UA 3C21A 5KT3A 9ICHA 4UAZA 3HPOA 4JV0A 4QZDA 4JWMA 3M8RA 5DB8A 3BQTA 3OYGA 3DYAA 4FJ5A 4CJKA 2HW3A 2B21A 5DG9A 3L3VA 1U4BA 2W9MA 1S97A 1ZQUA 4CJEA 2A1SA 2JEGA 2KZZA 9ICKA 2NRVA 3VQ4A 1RTDA 4KPYA 3LZIA 4LVSA 3JPNA 3M8PA 3LPTA 4I2DA 3S3NA 4TUQA 4DFJA 1LW2A 4NCGA 4PY5A 4KRFA 3AV9A 1R0AA 9ICQA 2P1JA 3JSMA 1RT3A 2R8KA 4I2JA 1Z25A 4ECQA 2DFLA 7ICLA 4DL4A 4O5BA 2X6SA 4J9SA 5J0SA 4DFKA 1ZBFA 3V6KA 3DLGA 1V9PA 4KFBA 1WN7A 1Z26A 3OYKA 1JL2A 3GIJA 4M6WA 4KLLA 3LAMA 2D0BA 4I9LA 4FZZA 2ZJAA 1NK8A 7ICEA 1YTUA 4FK4A 4O3OA 3RH5A 1IKVA 3L2RA 3IS9A 2FLPA 2VANA 9ICIA 5KFJA 1BL3A 1S1WA 3TAGA 2KTQA 1HJRA 1TKXA 2FLNA 3ZT3A 2HNDA 9ICAA 2UVRA 4CEOA 7ICHA 1T4GA 1Q9XA 2YKMA 4KV8A 4RQ0A 2E6MA 1T7PA 5KFNA 1JLQA 5DBBA 4AHCA 2R8GA 1BI4A 3G6YA 3AVNA 3OS2A 2IGIA 1S1TA 2IOCA 3MBYA 5KFTA 3CG7A 4RW4A 3H40A 4BE2A 3LALA 1VSMA 3D45A 3QINA 1ZQGA 1XHXA 3NGZA 1T03A 4IBNA 3AVAA 2GWSA 2PYJA 5TZVA 2A1RA 4AHTA 3D0PA 2IBKA 4CJPA 1BCOA 4CJFA 3SI6A 3K5OA 5L1KA 3ZDDA 5K14A 3NH0A 4M9HA 8ICZA 2VG7A 3S3OA 3VA3A 4KITB 3LDSA 1XC9A 4DQIA 1J5OA 3V72A 1Q9YA 3TR8A 4DL2A 4FW2A 4K4IA 1HJPA 3IM1A 1ZETA 3VQEA 3V7LA 4RUCA 2IHNA 4B9UA 4GVMA 4YCXA 1NKCA 1HUZA 2P6UA 4FS1A 1DOQA 3NH2A 5KFVA 5DB7A 9ICBA 3L8BA 4Q45A 1N56A 3RRGA 2ALZA 3I0SA 5L1IA 1SL2A 5J0RA 4FJIA 4KN4A 1L5UA 1I39A 3AO3A 5J2NA 3V7JA 2BANA 4RZRA 3C95A 1RDBA 4C8LA 3VQPA 4UAWA 3QESA 4R63A 3EYZA 4YMNA 3PW5A 4O3QA 1JLAA 2W9BA 1LB2B 4PPXA 1JMSA 3AVGA 1KEJA 3TARA 4OKEA 1T3NA 1ZQNA 3OYIA 4Q0BA 5JS1A 3LDAA 4CJ5A 4CJTA 5EWEA 1Q8IA 4KN7A 4CJQA 1D9DA 1PZNA 4N56A 1UA0A 3OYBA 3N97B 1HYSA 9ICCA 4BE0A 7ICVA 2B4JA 4KLDA 3B0YA 5DBAA 3OJUA 1NKBA 2AQ4A 4CEBA 4BDZA 4RUAA 3OYLA 3T19A 2BQ3A 3GILA 3HT3A 1HPZA 4FJLA 3ZSZA 7ICNA 4FJKA 4CIFA 4KLFA 2YHBA 1D8YA 1RTJA 4ECXA 5J0XA 3HSTB 2GUIA 2ITGA 5CA7A 4CK2A 2A1JA 3KLFA 1ASVA 3V6DA 2HHTA 3MAQA 5E41A 5CYMA 4F3TA 3RMBA 4LSNA 2I9GA 3SQ2A 3LWMA 2W9CB 4FK2A 1IKXA 3L3UA 1X9WA 4OGCA 4QZIA 3H4DA 1B92A 5DMRA 2FPKA 1RDCA 5HLFA 1BPBA 2IC3A 4W5NA 3OSNA 1HNVA 4GLXA 1QQCA 1FKOA 1XSNA 2ZUDA 2FPLA 4E3SA 2LSNA 4J2BA 4KHWA 4RPYA 3O3GA 3HP9A 4OJRA 4QZ8A 4CFBA 4CHQA 2PFOA 3MFIA 4PHAA 2AGPA 1FKPA 1TGOA 5FRNA 3QEIA 4DFPA 3U3GA 3Q8KA 4HYKA 4DU4A 4F8RA 3KLIA 3M8SA 2H5XA 2DFHA 4YFUA 1ZBLA 4BXOB 4BE1A 4DL3A 2QKKA 3TAMA 2BR0A 2Z1JA 4CESA 4TSXA 1ZQDA 1D5AA 3TAPA 3V9SA 1X9SA 9ICLA 1W0HA 1K6YA 3H08A 5KFFA 9ICOA 1UA1A 1JL1A 1TV9A 4CJVA 3UQ2A 4RU9A 4LZGA 3EY1A 2ZTCA 5J0UA 2BPFA 1KFSA 2NRXA 4O0IA 2BHNA 4M04A 4CEEA 4RNNA 1RZTA 4O9MA 3HVRA 4YG2A 1TK8A 3V6JA 1S9FA 4HCCA 4CEFA 2XO7A 4AILC 3E01A 4FXDA 9ICTA 3V6HA 4BWMA 3ZSQA 4UB4A 1NK4A 1YTAA 1TAQA 2I1QA 1RYRA 5DQHA 5D49A 3LANA 4JRQA 4I2CA 4RT3A 4EBCA 4ED2A 4YR3A 1BPDA 2YKNA 4F2RA 2D0AA 4YD2A 3QE9Y 3OYCA 5F9NA 3PW4A 4J9KA 4I27A 4CFCA 1TL1A 1JLCA 1RDDA 3ZDAA 1VSLA 8ICNA 4KHSA 3QETA 3AA3A 3AU2A 2R8JA 3O4QA 4YFKA 3SQ1A 4IQVA 4BWJA 2ZJ8A 1J9AA 1JLFA 2LYHA 3P83D 9ICWA 5CZ2A 4XIUA 7ICRA 4M9GA 5CP2A 2JEIA 1B22A 1VSEA 1L3TA 1RT5A 3KK2A 3ISNC 3SV3A 2XCPA 2BPGA 4O5EA 3V1OA 1N6QA 4OKKA 3KK1A 5KFKA 4DTOA 3HK2A 2D5RA 2QKBA 1HNIA 2BGWA 4R8UB 1ZQFA 2ZTDA 3ZSVA 4I2EA 2ATQA 3EZ5A 1GOAA 2F8TA 4DFMA 3MR6A 3KK3A 1U48A 4TUSA 9ICEA 3LP0A 5DBCA 3BDPA 4E7IA 1S76D 2HHSA 1QTMA 1Z00B 1NK9A 5HBMA 3VN5A 4G1QA 4CHYA 2NUBA 2XGPA 1MU2A 7ICQA 2ETJA 5KI6A 4CGGA 1JIHA 1KLNA 4KLJA 4AHRA 4RNOA 1TL3A 2C22A 1XHZA 1JXEA 3K75D 4MFBA 2PY5A 2WONA 2C2DA 4DMNA 3C1ZA 1IXRA 1JXLA 4RQ1A 2IDOA 3QIPA 2JZBA 3TAQA 2BKEA 4O0JA 4DSLA 5KFUA 4C8KA 1X1PA 5J2IA 3AVHA 5KT5A 5J2AA 4CF8A 5J2CA 1TKDA 2MUTA 4NCAA 4YMMA 3JPSA 5KFSA 1ZBUA 4E7JA 5KG0A 1C1AA 5KRSA 1VSHA 1ZQSA 3H7IA 4CIEA 1SL1A 3G6XA 2P51A 4DU3A 4JUZA 4KHNA 9ICPA 4DQQA 1C0TA 3CFOA 1SV5A 5KFQA 2C2RA 4HTUA 3S3MA 1EXQA 3ISDA 4ZTJA 5KFGA 5KG5A 3FYHA 2YNIA 4ZTFA 3RB6A 4KHQA 4NLKA 2RDIA 4ELVA 2VG6A 1C6VA 4RPXA 3OHAA 4FM0A 3BQ2A 1ZQZA 4IDKA 3KLEA 3OYJA 3QEVA 4CCHA 9ICJA 3C2MA 1IO2A 3C1YA 4CGHA 1UAXA 4GXJA 1HQEA 1FXXA 4H8KA 2BDPA 5SWMA 1UT8A 2DPJA 2VA2A 3HO1A 3KKSA 1ASWA 4DTMA 4GC7A 4DOAA 1DTTA 4JRPA 4CGJA 3OYAA 1ZQKA 1VSDA 1ZQHA 1GOCA 2FC0A 1DGSA 5KT7A 4IG0A 4FJ8A 3QO9A 4FM2A 2IAJA 3TAEA 3MXIA 1ZQMA 4I28A 3NGDA 4J9OA 1UWBA 4DLEA 3AVJA 1ZQEA 3NGIA 5D46A 4FYDA 4K4HA 4RW7A 5CB1A 3RR8A 3NE6A 3HW8A 1KCFA 4QWAA 8ICLA 4RQ8A 4RT2A 8ICQA 1J53A 3RRHA 2OYQA 1ZQJA 4FM1A 2ISOA 1RTIA 4I2QA 4R66A 4ECRA 2DFFA 4KTZA 4IRKA 2NRZA 3HX0A 1EP4A 4CIGA 4XA5A 3C6UA 4DS4A 2V4RA 4Z6FA 1JLEA 4O3SA 5KT2A 1WSGA 1RPLA 5DLFA 1Y97A 3QEPA 1B9DA 4I29A 4JV2A 2XY6A 3AU6A 4F91B 5J2EA 4ECVA 8ICSA 3AVIA 1NOMA 4E0DA 4QZCA 3AVMA 9ICMA 4CF1A 5J0WA 1RBRA 1ZQVA 3TI0A 1ZQQA 8ICPA 4DOCA 5D3GA 3ORYA 3IHQB 1VSKA 3L2WA 3B6OA 3GIIA 3CFPA 3HXMA 1A77A 4TQRA 2E6LA 3VQCA 4OLAA 4Y1DA 1KRPA 3RJFA 2HNZA 3HPGA 4NXZA 5L1LA 4IQUA 3OYNA 3ZDBA 3SZ2A 1BIUA 4N47A 2G8FA 3KLHA 5J2JA 4NLGA 1RT6A 4J9LA 4FJMA 5KFBA 1A5VA 2ZE2A 4HUGA 2YNFA 4LZDA 3NGYA 1KFDA 1IH7A 7ICTA 5SZTA 2F96A 1LAVA 4FJXA 2WOMA 4EEYA 4Q8FA 3K5LA 5I3UA 1SL0A 3GIKA 3NFAA 1XSPA 4CJ4A 3AO2A 2AGOA 2F1JA 3PW0A 2GV9A 3FFIA 4WE1A 1JKHA 1UT5A 4ED1A 4I2IA 4RQ3A 1LW0A 4ZHRA 1VK0A 1HYVA 3BGRA 9ICVA 8ICTA 2Z1IA 3C5GA 3V1RA 4O5CA 2RN2A 4BDYA 4P2HA 1ZQRA 4PUOA 3VQQA 3DRRA 1CEZA 4AHVA 1LV5A 2PFPA 2PFQA 3DOLA 1HMVA 1WSFA 1XWLA 2C2EA 4GW6A 2ZTEA 3B0XA 1ZQXA 4MFFA 4OPJA 2OPRA 4Z0UA 2P6RA 2W9CA 4DG1A 4Z4IA 5HRNA 4B9VA 4C8NA 3EWAA 3OS1A 3F73A 4M3YA 3AA2A 3OJSA 1JLGA 3CM5A 3RMCA 4DQPA 4B9SA 4J9PA 4ZH4A 5KG3A 1BPXA 4C8MA 1KDHA 2F1IA 3G6VA 5EU7A 4E89A 4GXKA 4KMUA 5HP4A 1ZQLA 4FVMA 4GMJB 4KB0A 3V9WA 1C1CA 1EETA 3VQ7A 1RT7A 4M6WB 3LWLA 3AVFA 3WNEA 3NCIA 3CFRA 4F4WA 3PO5A 7ICPA 3K5MA 4BXOA 4QZAA 4FLTA 5L1JA 4YXJA 5JS2A 1ZQTA 4CFAA 4H4OA 2OZMA 2KZMA 4B8AB 3S9HA 4ED3A 4F4ZA 4JV1A 5IILA 5IIMA 3ZSYA 3C2KA 4DF8A 4CEDA 4PHEA 4DSEA 9ICRA 1BI4B 4XUSA 1WNSA 4CJLA 8ICBA 3AO4A 5KFOA 3SJJA 2YNGA 4LH5A 3DMJA 3K5NA 3OSPA 4QZHA 4RPZA 1KTQA 4Z6CA 4LH4A 3RMDA 3NF6A 3PW7A 3NH1A 5KG4A 5BPCA 1KVBA 3G10A 4FLWA 3HL8A 4PA1A 3KHGA 3RH4A 4ECSA 3M9OB 4KLIA 1NJWA 4RG8A 4QZFA 2YV0X 4UB2A 2FBVA 4W5OA 2X6NA 4E7LA 1IM4A 4FZYA 4ED7A 1S1UA 4DTRA 3TANA 5BOMA 2ISPA 5DG8A 2PXIA 2RPIA 4B8CA 3UXPA 1S6QA 4ELTA 3QEAZ 2Z1GA 4O4GA 1KVCA 3M9NB 4IKFA 7ICMA 1SKWA 4PWDA 4E1NA 3A2FA 5C5JA 1REVA 4F4XA 2GBZA 1WCNA 4I2BA 1BPZA 4UQGA 4KLQA 3KHLA 3KKRA 5KFZA 4CGDA 4M42A 4F3OA 4FO6A 1BHLA 1CZ9A 3ISCA 1TVRA 4R8UA 4E7HA 4UB1A 2XHBA 1WSEA 5D4BA 2OA8A 3C23A 4Y1CA 3KIOA 5KFPA 2JEFA 4GC6A 3PMNA 4CK3A 4CHNA 1TK0A 4AH9A 4FJHA 3SPYA 2ATLA 1BISA 3K2PA 3SPZA 4TURA 3TWHA 3KD5E 1N5YA 4IR9A 1QHTA 3QEXA 1Z00A 5J2HA 3PNCA 1ASUA 4CGIA 4G3IA 3E2EA 2EX3A 1X2IA 1NK6A 3N4MB 4QZBA 3SV4A 1VRUA 3V9XA 4ED0A 3CQ8A 5J0OA 3OYFA 3T5KA 2D0CA 1C0UA 1A5XA 4CJRA 4FBTA 4CECA 4JS4A 1JN3A 4QWEA 2FPMA 4NCBA 1BQNA 3MEGA 1T8EA 3IG1A 3C5FA 2OPPA 5IIIA 2VWJA 1WSJA 7ICJA 4M0AA 3JPRA 4X5VA 4C8OA 1BIZA 3BQ0A 4DU1A 3C2LA 3UXNA 1NKEA 2JEJA 4KHUA 1ZQAA 2BE2A 2OPQA 4KREA 1TAUA 1NJXA 4YP3A 5DGBA 4PHDA 4EP5A 4ED8A 5KT6A 2G8HA 1NK5A 3ZT0A 3H4BA 3VQ8A 1QLNA 3JYTA 3VQDA 2AU0A 5KFEA 4NYNA 4KLHA 4DL6A 4B9LA 2J6SA 1RT1A 3THVA 3ZSOA 5J2PA 3ASMA 1Y88A 1SKSA 4J9NA 2X74A 2PZSA 9ICSA 2IS3A 1RXVA 3KD1E 4CHZA 2FLLA 4TQSA 1VSFA 3RAQA 1DTQA 3DLRA 3JPOA 4F50A 3AO5A 4ECUA 3U6FA 2IHMA 3SUPA 1XU4A 4ID1A 4CEAA 4MEYA 3L2VA 1RTHA 3AA4A 1I3AA 4DSIA 3IAYA 4BDPA 3KLGA 4CJ3A 3WNGA 2WTFA 1LWFA 2XY8A 4H4MA 4F4KA 1U49A 1BVSA 4KAZA 3UQ0A 4FLYA 2HHWA 4OPKA 3MEDA 4QWCA 3PR5B 4J9RA 5DB6A 1HYZA 2Y1JA 3PVXA 3ZT4A 4PH5A 5J0YA 3PX0A 4K4GA 4DEZA 4B08A 3TQ1A 1QSSA 3RJEA 7ICGA 5KFLA 3P1GA 3O4NA 4DSKA 3U3YA 4Z4GA 1S0VA 4Q44A 9ICUA 3MDCA 1KVAA 2J6TA 3NF9A 3MFHA 3OYHA 3VQ9A 1EKEA 3MECA 3DM2A 4YQWA 4I2AA 4CE9A 1MQ3A 2VG5A 4CHOA 4TUPA 5KG1A 4RW8A 2KFNA 4IQWA 3ZCMA 4JLHA 4M41A 3MR5A 3C6TA 4M3UA 4NM2A 3UXOA 1TFRA 1CUKA 4KLSA 1SZPA 3PR4A 3LP2A 4FCYA 2ZUBA 3RJIA 1X9MA 4M9JA 1YVUA 4M3XA 4KLMA 3OYMA 2XGQA 2C28A 1WSIA 4FLVA 3UPQA 4KLGA 1U04A 4FJNA 8ICJA 1S9GA 3ULDA 4DTNA 2W8KA 4MF8A 1RCHA 2B5JA 8ICIA 4O55A 4F5QA 2W9AA 2B6AA 2F1HA 3PV8A 4CFDA 4DSJA 2P66A 3RR7A 1HQUA 4BACA 2G8IA 8ICRA 3NF7A 4CJUA 3G0ZA 4AHUA 9ICXA 3K59A 4KLEA 2O4GA 4Q5VA 5KG2A 1VSJA 4FJJA 1AROP 4OLBA 1XI1A 2J6UA 4Q43A 2XRIA 2W8LA 3T1AA 5KT4A 2AJQA 2PI4A 4HHTA 3V7KA 3VA0A 1TKZA 4MQ3A 2BQRA 4YD1A 3QNNA 4UBBA 2AQ0A 1RT4A 1S10A 4N76A 1B9FA 4UB3A 7ICFA 4QCLA 4ECYA 5FDLA 4K8XA 4MF2A 1SKRA 3TAFA 4K8ZA 4I9QA 1WAFA 4F92B 3O3FA 4Z4FA 5KFIA 5J0QA 3I0RA 1NJYA 2FMSA 2P5GA 1TV6A 2KQ2A 2JZBB 1XO1A 2DY4A 4DWIA 2V9WA 3V9UA 4Z6EA 3MXMA 4M3RA 4XQ8A 1EXNA 5CY4A 5CWRA 1NK0A 4N41A 4QZEA 2KW4A 2MUTB 1LAWA 4ICLA 2KN7A 1ZYQA 1VSIA 3SQ4A 4RQ2A 5KFYA 3DRPA 4EBDA 1U45A 3NTUA 3GDXA 1U9LA 2G8WA 5J2KA 4F5NA 4QWBA 1WLJA 5KTQA 3PY8A 4EZ6A 1ZBIA 3QZ8A 1HRHA 4J2AA 2PYLA 3SYZA 2HHXA 1IKYA 4P4MA 5DDYA 4QZ9A 2RDJA 4F4YA 1S0OA 4L8RB 4DO9A 4ECWA 4JS5A 4M3WA 3PO4A 3OY9A 1ZQOA 3H8SA 3LZJA 4CJSA 4J9QA 1S0NA 4MEXA 1S9EA 4CJWA 4DTJA 4IFYA 4DTPA 4M3ZA 3GV8B 2XC9A 4P4OA 3ZD8A 3OGUA 5HMMA 7ICIA 1RILA 3L2QA 8ICYA 4IQTA 3OHBA 2M9NA 3GV7B 3SI8A 2BCUA 4IR1A 3NAEA 2EHGA 3GV5B 4DSFA 3CM6A 3ZT1A 4KB1A 3MEEA 2W42A 2ZUCA 1U47A 3OVNA 5IIOA 5DDMA 1RT2A 2UVUA 5KFWA 3RMAA 3RB0A 3AUOA 5CJ7A 3ZD9A 2Q3SA 4PHPA 2YNHA 5DK5A 3NDKA 1A5WA 3AA5X 2G8UA 4I7FA 3TFRA 1S77D 1K1SA 1QS4A 1WSHA 3Q8QB 1COOA 3MABA 5KGXA 2FMQA 4RW9A 4JK1A 4KLUA 5J2QA 3ITHA 5EWGA 3KJVA 1KLMA 3QERA 1ZBHA 1RNHA 4YR0A 4ELUA 3HYFA 5HRRA 3LAKA 1TVAA 7ICUA 2DFEA 1SUQA 3KTQA 3ALYA 4YXMA 2P5OA 2G8VA 5C24A 3QEWA 2Y1IA 5KG7A 4FLZA 3PX6A 5CZ1A 5F9LA 4FBUA 3QNOA 3P5JA 1A76A 4DTUA 3MR2A 3M9MB 3ETLA 5J2FA 4DQSA 3V1QA 5IIKA 3DOKA 1ZJNA 4KKOA 8ICOA 4IFVA 1JX4A 1H38A 4QW9A 3VQ6A 1DLOA 1GOBA 4KI6A 5DB9A 4RNMA 4W5QA 2BCQA 3MDAA 8ICHA 3HJFA 1L3UA 2NRTA 5J2GA 3NF8A 4J9MA 4HCBA 1RYSA 3AO1A 4KO0A 1C1BA 4YNQA 3QZ7A 4FJGA 3Q8LA 3HP6A 5KFXA 1UOCA 5KFRA 3DLBA 5KG6A 3EPGA 3ZT2A 2BGGA 4J2DA 3VQ5A 2PI5A 1N48A 3BQ1A 8ICGA 5J1EA 2BPCA 3GQCA 4CEZA 4NY8A 4DS5A 4B9MA 8ICEA 1C0MA 1RXWA 3K57A 4PGXA 1BGXT 4UBCA 4FS2A 5DQIA 1VRTA 1RBVA 4DOBA 3ZDCA 2VWKA 3RBDA 3RWUA 3EW9A 3C94A 3I8DA 3VQBA 3WNFA 1LWEA 3H8WA 1FK9A 1ZQCA 1S6PA 4J2EA 5J0PA 2JLEA 3RAXA 1BPYA 3BJYA 3PMLA 4YR2A 3SUQA 3RJKA 4M2YA 4M3TA 3T3FA 4EP4A 4HUEA 1ZQBA 1S1VA 2BQUA 4W5TA 4XRHA 4PGQA 4PQUA 2BCVA 2AGQA 2E4LA 3DLHA 4NM1A 4FK0A 3V4IA 1JXBA 2QXFA 4KTQA 5EWFA 3DRSA 5CYQA 3K58A 3QEBZ 3ZSXA 3DLEA 3RBEA 5KRTA 2X78A 5J2MA 5J0TA 1RBTA 4R64A 4UAYA 2XCAA 1S0MA 4JWNA 5T7BA 3B6PA 2XY7A 2G8KA
chains in the Genus database with same CATH superfamily
4A47A 1UVIA 1HWKA 1BG3A 2YX8A 1T3VA 5DQGA 1MN8A 3TACB 3OFHA 4DDFA 1B4SA 1NSKL 3A0HU 3A8KA 1W25A 1K0VA 1VQ8S 2UVWA 1WAJA 3TTFA 3ZSRA 3O3HA 3FCWA 3HHLB 2GO8A 3CCVS 3DLKA 3HKWA 4P2FA 4B3SJ 1JLAB 1TK5A 2W9BB 2HQGA 5AK4A 4JKGA 1VLOA 4M5KA 3SUOA 2K4HA 4E19A 4ES2A 1KAXA 2PAVA 5ALIA 3T1YJ 3VWSA 5CHCB 1S79A 1YXQA 3OFGA 2Y8WA 1HYSB 3KDOA 4I2HA 2HB5A 4LFAK 2GX9A 4NLVA 5LL6Z 5D15A 3HHLC 2ASPA 2V6AA 4OZLA 5JLHA 4YHHK 2YX6A 1BQMA 2ZBRA 4WFAQ 5KFMA 1FW6A 1TKTA 1B0PA 4B3RF 3A3PB 3RJGA 3T6JA 4JI7F 3HSDA 3QSYB 2KI2A 5DG7A 2MZQA 4R65A 1ZJMA 1X5SA 3R5CA 4I2GA 3H8MA 3AVBA 1RXOB 4FW1A 1WTBA 1YJRA 1YJTA 2QYGA 1KFTA 1X8DA 2PMWA 3OW2R 4X64J 1MC8A 4CF2A 2MQPA 2DPNA 4Z4HA 4AXJA 5CR0A 1NJZA 5EOZA 1RDFA 1F60B 3A5MC 2IC3B 2ZZNA 2PMZD 3UM9A 1PAUB 4L3KA 3ENQA 1U1OA 5AI4A 1FKOB 1N54B 4M9NA 3GFYA 4WK3A 4DLGA 4JI2F 2RKIA 2WAQD 2BCRA 3J81Y 3MM5A 5AXNA 1WWHA 3MCNA 1Z2LA 1NHKL 4OQJA 3WK8A 4Z7CA 3LK9A 8ICFA 2FSJA 2VYPA 5HRPA 3V9ZA 4OIXA 3LP1A 3OBWA 1C7YA 2HNYA 3V81A 2J8AA 3MGHA 4NL9C 2J5AA 4WKYA 5KFHA 3VQAA 1S72S 3EN9A 1URRA 3W7BA 3HM9A 1YI2N 3TTDA 1ZRMA 2CWXA 5CYJA 5FROA 3BBBA 1G6BA 2YJEA 4BGDA 3J8AA 3TABA 2N82B 2QWRA 3NRWA 3CD7A 4FE3A 3DI6A 2DNMA 5L1MA 5KOWA 1V4SA 5JUMA 5HL7L 2D8CA 4RW6A 1K44A 4NYFA 3E01B 2K7KA 5KQ8A 2BJ3A 1OH5A 2XNQA 3BS9A 2WSFC 3ISBA 3IN5A 2G0JA 2ZD1A 2Z1HA 4DPTA 2HVHA 4GNIA 1VCTA 1C0UB 1QE1A 5AJ3F 2O3DA 3PW2A 1UP1A 1K1QA 5GMKa 4MDAA 1J27A 2F65A 2H4YB 4DR7K 3I76A 1RKJA 3QMLA 2QLFB 1JLCB 3F5AA 1NHUA 1T9UA 3IWLA 2JGUA 1SH3A 5DZ6A 2AH5A 3AJ1A 3MXJA 2BKOA 3IRXA 2P6TA 9ICFA 4JP8A 3NLCA 5BN9A 3W0LA 5HOOA 4S0MA 1UTAA 4KLTA 1BWFO 1SXLA 1IG9A 2DO4A 3H20A 1SIWB 3H5SA 5J29A 7ICSA 4USKA 3KK2B 3GSIA 1CXQA 7ICOA 4B9NA 3EPIA 5IT9O 4JKEA 2FBTA 5HHIA 3KHRA 4L76A 1FJ7A 4U6PA 1RDAA 1KEKA 4CERA 2OIHA 1S12A 3L7UA 2I5JA 2BH1A 3ILOA 1SS6A 4DV2F 3G4SN 1YG0A 1VQOS 1Q5YA 1VJ5A 3VHQA 4IOCL 4ECZA 3DGPA 3FEZA 2P8IA 4CNQA 1NM2A 2YY3A 2HHUA 3HVWA 4HI2A 4H0TB 3QNWB 3GYGA 1I94K 1OY6A 2CQGA 2PFNA 1GAOA 4CO0A 5FRMA 4HVJA 3Q8SB 1TL3B 3NRZA 5HQ8A 2XI9A 2I8EA 3FSXA 2LPEA 4DZ6A 2RHFA 9ICNA 3MOZA 3KHHA 3Q22A 3QIPB 5J2BA 4QR0A 4FYYB 3HVTA 4FZXC 4B3RJ 1SJRA 2XQCA 1H3DA 5HR7A 4YB5A 3IGVA 4DQRA 3DXSX 1RWKB 3BBCA 3I55S 3JAMO 3U7JA 3O6QA 9ICHA 3QJPA 5AKYA 2CNOB 2FJVA 2KKVA 3GYNA 1XR7A 4P52A 5I3PA 4XPEA 3ENVA 1GLEG 3R6LB 1KS2A 3L6QA 1PC4A 4WYLA 2HW3A 1VQ9S 4JYAF 2DT9A 5C2FA 3DN9A 1UMJA 5DG9A 3K1ZA 1S97A 4JN4A 3MMCB 4AUKA 2YNIB 4ZVPB 4CJEA 2JEGA 2KZZA 9ICKA 2NRVA 3IMXA 2HQ3A 3A3OB 3LA0A 3JPNA 5F8HA 4TUQA 5JMNA 1LW2A 4TNOA 4PY5A 9ICQA 2BE7D 1RT3A 2XBPA 4C4RA 3SSSA 3WZ0A 5GADP 1DGJA 2WVCA 3TX8A 4O5BA 5CHIA 3EUB2 3J81U 3DLGA 3T1HF 2VWBA 1SB6A 3MI7X 1U1QA 1DTTB 4K59A 5I3QA 3QYPA 4OHYA 4CLLA 2ZJAA 2E1CA 3IM9A 4EENA 3L2RA 3QO9B 1XNQJ 1BL3A 1W97L 5C0YA 2FVPA 2KTQA 3TAGA 4UY85 4BRDA 1UW9A 5B0AA 5EXWA 3ZT3A 1JCGA 1S5LU 3CCLS 2HRUA 2UVRA 1GQEA 5BRFA 2XEXA 2PMZC 3OA9A 3H5YA 4BRAA 2PA3A 1CULB 1R6YA 3FZFA 2E6MA 4JOUA 1JCFA 2HVDA 2QLXA 2Q6CA 4A8EA 5DBBA 4EMDA 1N52B 2DYAA 1S8OA 3AVNA 1RTIB 2YN4A 3MM7A 2PIIA 3OS2A 2YH0A 3THWB 1UJ4A 5KFTA 2QO3A 2UUAK 3C6UB 4B1UB 3PJXA 2MGZB 3N4WA 1VSMA 3QINA 1KBUA 1ZQGA 1UPHA 2B4UA 5G0RB 4WQ5A 4AM6A 4IBNA 2GWSA 2EWSA 1DQ8A 3O9RA 4AHTA 2WF8A 1OH7A 1BCOA 2P9IA 3K5OA 3ONNA 3NH0A 3S3OA 2ZZMA 2E8OA 2F4VK 1IV0A 4JAXA 1N60A 1J5OA 2H48B 4HHUA 4RQMA 2DNPA 2XWYA 3TR8A 3J7Z5 1HJPA 5M1NA 2C2MB 3IM1A 1RU1A 2NS1B 3VQEA 3V7LA 3CVKA 3RGIA 3ULEA 5D3GB 1DOQA 3QUCA 3BYRA 3PXGa 4H5RA 5KFVA 3G8QA 3EZUA 9ICBA 1N56A 3RRGA 1LOTB 3AD9C 5DM7Q 2E1ZA 4F71A 1UEVA 2VQFF 5L1IA 4FJIA 4ZVHA 1FRXA 1I39A 3UNYA 2MJNA 8ATCB 3OR2B 2BANA 3SQGA 1DRZA 3MDQA 2HMPA 1OVYA 1HW9A 4CLTA 4C8LA 3K0JA 2AX1A 3VQPA 3KLHB 4YMNA 2X1BA 5AQKA 3POTB 3NY0A 4PPXA 2W11A 5F8LA 1KEJA 2XMMA 1T3NA 5M2UA 1RT2B 4HT5A 2K8AA 3QBWA 3HKZF 4CJQA 1D9DA 4CF5A 4G9BA 4B1ZA 2WOMB 2YNHB 2QM1A 1UA0A 3FZ2A 1XTZA 3VCBA 5DO2A 9ICCA 3QQCD 4QJFB 7ICVA 2ADCA 2N3LA 2LMIA 2QWQA 3ZFVA 3Q23A 3ZETA 5LM7E 2ZWHA 2LEBA 4EHUA 3OJUA 4WE1B 3QJJA 2AQ4A 3A0BU 4CEBA 4BDZA 2HFUA 2BQ3A 3GILA 1MWQA 2YMMA 4FJLA 1GLBG 2KRBA 4CIFA 4WWSA 4K4YA 4A8KA 4USAA 1H2VZ 3BGRB 4LF7K 4KLFA 3JQKA 5H9FJ 2YHBA 1D8YA 2AW0A 1K9MO 4Y2QA 3HSTB 2IOHA 4Z37A 4A61A 3S1TA 5LSRA 2RVJA 2H3QA 5CA7A 2A1JA 1T44A 3MUVP 1ASVA 3BN4A 1EHWA 3W8PA 2RP5A 3V6DA 1NBEB 3KUHA 2BX6A 3E9OA 2WBNA 5AQRA 5G5HA 4EAHD 1PVQA 3KOAA 2DR5A 4PHTX 4ZP9A 2HF3A 3LYSA 4M5DA 5DDPC 5ETTA 1GLFO 2MB0B 3KHYA 3G8TA 3CUNA 3BO2A 4LF5F 3H4DA 4JYAJ 1B92A 1JLGB 5HLFA 1RDCA 4PL8A 1BPBA 3T79A 2DEIA 2UV8A 2V7YA 1IJFB 1KHVA 4CYUB 2V69A 2MHNA 2ZOMA 2WBRA 3M2UA 3NWRA 4ZPCA 4MO5A 3O80A 3ETRA 5CCLA 4C98A 2LSNA 4J2BA 2CQ1A 3OL8A 4KHWA 4P0PA 4HHHA 3OR1B 4CHQA 2PFOA 5ETQA 2EFGA 3AL0B 4WFZA 1FKPA 2M88A 3QEIA 4DFPA 1SQGA 4ZN1A 4W98A 2Q66A 4HTIA 1ZD5A 1MG7A 4OYMA 4YFUA 2C3OA 2DFHA 2W6KA 3SK3A 4BE1A 3IRWP 4DL3A 3CDWA 2N3OA 4ZCMA 4H4OB 3MZIA 2WBMA 2QTDA 1X9SA 3G25A 1W0HA 3R9LA 2E1PA 2R18A 9ICOA 3B54A 4JI6F 3CQXA 4O3MA 1F5CA 1YF5L 3AT1B 4FWMA 2BDUA 2E9RX 4RU9A 1NH8A 4AM7A 2EFPA 3MPWA 3GU3A 2LKYA 4M04A 3HVRA 3V6JA 1S9FA 4HCCA 4KHMA 4X65J 4P2XA 5C2GA 3CIPA 2VFVA 2QXLA 2J8SA 3D7EO 2WB1F 5JVGL 2HBMA 4HHJA 4GFJA 3W2WA 4JRQA 4I2CA 4EBCA 4ED2A 4MDBA 2COLA 2F8MA 3OTEA 1WOPA 2RILA 5ALVA 3PEJA 2Q6BA 3FEXB 4CFCA 1L7NA 1TL1A 1U2CA 1FVSA 5GADI 3ZDAA 3M6ZA 4XK8C 2L41A 3HOSA 3NP5A 1B64A 3QETA 3AA3A 1S6UA 2R8JA 2CGLA 4B6JA 1S6QB 1VBZA 2LYHA 9ICWA 1RACB 2O8EB 2H5EA 1PO6A 3MR7A 5AM3A 4KBOA 4M9GA 1N61A 2JEIA 1WEZA 1B22A 1RT5A 3SV3A 1RHMB 2YQ3A 2BPGA 3V1OA 2OTJS 1U0HB 4DJBA 3NRBA 3ZO7A 5AQVA 1PCAA 3KK1A 3OUYA 1I5OB 2D5RA 2VQFJ 3IBFB 1HNIA 3KD3A 2BGWA 1TVRB 3NGRA 2YWWA 3EGZA 4ETZA 4MIBA 1ZA2B 3OL9A 3D1HA 4DFMA 3MR6A 1IN0A 4TUSA 3H25A 2ZIXA 2DUYA 2CJAA 4KBIA 2I0XA 1N5YB 1Z00B 3WEEB 6AT1B 3H45C 2H54B 2NUBA 2QN6B 1FJEB 3M1YA 4ANDA 7ICQA 1Q4RA 4MYUA 1HJOA 3VERA 4ZPVR 1VRUB 5A2QO 4AHRA 2P9EA 2NXNA 4RNOA 4C0BA 3FJ2A 3KNAA 2XMTA 2IDOA 4DCOB 2DH7A 2ES6A 5CZVA 4C8KA 4I1TA 4X4UA 1X1PA 3HHDA 3GG4A 3EZWA 2FHJA 1XMBA 3SAFA 4WXWA 2KG0A 4G1PA 4XAKA 5ALUA 4NLCA 1C1AA 4JHDA 5KRSA 4P74A 2P51A 3FR0A 1CJUA 1WHVA 3R6GB 4B3TJ 5IT0A 4DX7A 4LF5J 1HBOA 4I64A 3CCSS 3S3MA 2BJ8A 4EUVA 4I56A 4LFCK 1YBUA 5BR8F 5KFGA 4H03B 4BGBA 2QA2A 4KHQA 4P2MA 4AYBD 4B3MK 1N5TA 1C6VA 2WB4A 3OHAA 3UN5A 4FM0A 3BQ2A 1S5ZA 2D7SA 1ZQZA 4IDKA 2KICA 1XO0A 2XYPB 3C1YA 4CGHA 1R0CB 1UAXA 9RUBA 1XMQK 2BDPA 1VQPN 3F2BA 4A62A 2DPJA 5BJRA 3KKSA 3HJEA 3G82B 1ASWA 4GC7A 4DOAA 5BPLA 1JI7A 2C2OB 4PG6A 4BRLA 1VSDA 5HMYA 1ZQHA 1GOCA 5BPMA 1Z1VA 5KT7A 4IG0A 2KIVA 2CPRA 4LIRA 4FM2A 2IAJA 4EFHA 3MCPA 3TAEA 3NXZA 4KHRA 2MKKA 2LVWA 3H98A 4I28A 3NGDA 4ILJA 4Z7YA 2GTDA 4EEKA 2W2NP 4RW7A 3RR8A 1BD6A 4FYWB 8ICLA 4ZPDA 4BRKA 4C23A 3D0IE 3P3DA 5MLCQ 3EDQB 1J53A 4OYWA 1WHXA 1IG6A 1XERA 4NRTA 2KB2A 4R66A 2M3DA 3MPUB 4KTZA 2XULA 4IRKA 1FDNA 2V8DA 4CF4A 3HD1A 4BS2A 2V4RA 1JLEA 1JNRB 2B7CB 4A5BA 2XWXA 1RPLA 2ZH2A 1PK1B 4C48A 1SPBP 3M30B 4TU7A 1HEKA 1KQSM 1VQ4N 4ECVA 1WSVA 1H2TZ 5BYSA 5J8YA 4QZCA 2W3RA 2B5JB 5HQMA 2FVQA 1CC8A 2B6AB 4FP9A 1XUPO 1RBRA 3ZZZA 6FDRA 5ALFA 3EX7B 2DH9A 3KZXA 4DOCA 1WF0A 1TUUA 3TWZA 2VBYA 4F3MA 2CUYA 4CBUA 3CC4S 3C28A 3UW1A 1PYSB 1B7YB 2W7AA 2K3KA 2HQIA 1HR0J 5GAGP 1A77A 2OFHX 3VQCA 1OS5A 4WYWA 3M4XA 1RG6A 3OYNA 5FP0A 3MM6A 1BIUA 4X4SA 1RT4B 1Q78A 5J2JA 3MD1A 3CB4A 5KFBA 1GMUA 2YNFA 1KFDA 3WC0A 3G6ES 3TSUA 1GLAG 1LAVA 2WW8A 1RA7A 4MN4C 3I0RB 4RWWA 4WP3A 2D0PA 2E8MA 1L3KA 3NFAA 1SIJA 3HSGA 2GV9A 2M9KA 5AQWA 3L4PA 2GMJA 4RQ3A 4ZHRA 2P9PA 3LDOA 1HYVA 9ICVA 3DRPB 2Z1IA 1ZXOA 3V1RA 3O4WA 4ZOHC 4PUOA 1KVJA 3VQQA 3DRRA 1CSJA 3MAAA 2E2QA 2PFPA 1XWLA 1FE0A 2CYYA 4ISEA 4Z0UA 4RJVA 2ROEA 1T9VA 4MTPA 2W4CA 2E1FA 3F73A 4A2AA 3PRBA 5E3AA 5AKIA 3L7OA 1FJGJ 1YUWA 5FIIA 4E89A 4GXKA 5CAAA 3ZLJA 5EX0A 2HPUA 1IV8A 4JI1J 1ZQLA 2QB1A 1GMVA 1ZAWA 3KWGA 5L38A 3MEEB 3V9WA 1T9XA 1X9XA 3IR6B 2KN4A 3DDIA 3W2VB 5ALEA 3C66A 3RVCA 5L1JA 5HQLA 1J5EJ 4IEEA 1PGZA 4YXJA 2GH1A 3W3SA 3RBXA 2L3MA 4I7FB 1ZQTA 3PKYA 4CFAA 3OXGA 1WI8A 2KZMA 2F7VA 4CZGA 5GADU 4JV1A 1FO4A 1AB8A 4RW9B 2YHYA 3AEVA 2BKNA 3HRDD 1I3OB 5F3XB 2RSQA 4LF8F 4DR7F 1HKGA 4DF8A 2ASOA 4CEDA 4CQ1A 3D67A 4DSEA 1Q7LB 1BI4B 4XUSA 2GGPA 2IRUA 1FJCA 1YSJA 3SCIE 2YNGA 3S8SA 1SKUB 2VKQA 2CNKB 2A40A 2QYCA 2VC0A 2VU5A 3RMDA 4MO4A 1RWOB 4FNHA 3PW7A 2OCEA 3R5AA 5A8KA 2CRLA 2GIQA 1QZ5A 4JD2A 3UKRB 2FF3B 2GMHA 1FNXH 4LQ3A 3KHGA 5B0GA 1CJTB 1E4GT 4CW7B 2FBVA 1RDUA 1UVLA 4WU2A 2CA9A 2VUGA 2MQOA 4E7LA 1IM4A 3VCDA 4ED7A 4FZYA 3TANA 4KH4A 3D5MA 2KH9A 4KRWA 4CZHA 3RJMB 2DR9A 4F0KA 1VQSA 4ELTA 3QEAZ 4O4GA 3M9NB 1GT8A 4PWDA 1SV0C 4KC5A 4C0ZA 3I0SB 1REVA 4KPCA 4F4XA 4MK7A 1WCNA 3QSIA 1I94F 2GBZA 4BRGA 5AQJA 1TTHB 5A6WA 2CJBA 4LFAJ 1BHLA 3CE8A 5GTIU 1YJNS 3ISCA 5EE1A 1GNKA 4YHHJ 1VRTB 1WSEA 3ELHA 3NL0A 2W03A 3IDHA 1N36K 5KFPA 3OTBA 3Q89A 3PMNA 4CK3A 2Z7JA 4RWTA 2E2OA 1BISA 4C2MA 2HBQB 1X4DA 1S6PB 3C16A 2P9NB 5DM6Q 3N6MA 4PYDA 2CPYA 4TU8A 2K06A 2KV2A 1EWQA 2ZBCA 1NEEA 4ZVGA 3OTOK 2P9CA 5BRHA 1RWUA 4K4ZA 3CJRA 2EG1A 2DGZA 3C15A 4P7TA 3CQ8A 4IO9L 1QVFR 3T5KA 1CG2A 3QGGA 2B0GA 2CKWA 3GG1A 2QSFA 1YJWS 2B0CA 5CYQB 4DXLA 1RBLA 4QWEA 3ZX0A 1NDKA 4JI0F 5F8IA 4QPTA 3HI9A 1BQNA 4A8SA 3KG0A 4Q2LA 5J2MB 3EGNA 2DRAA 1Y00A 3C5FA 2OPPA 2JSXA 2B9YA 3H2UB 3OPXA 3OVAA 2HBJA 3NS1A 3AY9A 1BIZA 3ULHA 3CPWM 2KKPA 1YTYA 1YZ6A 2M4MA 4C6AA 2BE2A 5GAGI 1RHRB 3I55N 2H51B 3FBEA 1SJ4P 4KREA 2UXCK 3I31A 1NNEA 2CRXA 4EP5A 2G8HA 4ED8A 5KT6A 2Y1LB 4CO4A 2KKZA 3H4BA 2RRAA 3VQ8A 4ZA1A 3JYTA 3VQDA 5KFEA 2DNOA 1I1GA 2ZC3A 4UUWA 1RT1A 3CD5A 3DLKB 3CDEA 1HBMA 2LCWA 3CCQN 3D68A 5AQQA 4IO1A 4JKGB 1NZ8A 3CC7N 3KD1E 1KOHA 5IT9U 3FKBA 4TQSA 1KKXA 2MY8A 4DL0C 2EQYA 3A12A 3CQYA 1BQXA 3MDFA 5AKXA 3SUPA 5IQQA 5AKGA 3QAUA 1UFKA 4OI3A 3M6WA 2DGVA 3SQOP 4NA3A 3OT9A 1F0XA 4GKKF 4LFBK 3ZZUA 5HJYA 2A3VA 2R7VA 4YORA 2A2CA 4H0YB 4DSIA 1BQMB 2KU7A 2E1RA 3MHYA 1TKTB 3WNGA 2AP6A 3UQSA 2VONA 2O8DA 3HBTA 2G2YA 5AI9A 3UQ0A 2HHWA 4OPKA 3PYGA 3ADAC 3W64A 4J9RA 4DR7J 3KJQB 1EQYA 4NZ0A 2V94A 2Y1JA 2R2TA 3O9SA 5J0YA 2LKZA 4ZOSA 3D3CJ 4B08A 1NGHA 3M6GA 3TQ1A 3C65A 2CH6A 4EELA 3G87A 2BRKA 2Z4PA 5ETSA 3U3YA 3VGLA 1FERA 4DN0A 4IC9A 1KVAA 2J6TA 3NF9A 3MWBA 3DM2A 1TUYA 4WCEL 5AQLA 1MQ3A 5KG1A 3GCWP 2KFNA 1R43A 2FPHX 1TFRA 4KLSA 3PR4A 3LP2A 4FCYA 2PGCA 4M9JA 2RKIB 2MSNA 4M3XA 2LU2A 2EWHA 2VQEK 1DQ9A 3MM5B 3GP9A 5ITHA 2XGQA 2XICA 2W1BA 3LP1B 1S9GA 2XHWA 5ETNA 3IBWA 3UD5A 2HNYB 1URNA 1RCHA 3V81B 2VOPA 1EWRA 3O8MA 4CFDA 4DSJA 2DK2A 3AXMA 3VEOA 3VETA 4CZFA 1H74A 1I94J 3G0ZA 5E26A 1TL7B 1V3RA 3K59A 4EHTA 4KLEA 4FF1A 3DV9A 4FJJA 2Y8YA 1XI1A 2JVRA 3B4MA 3DI6B 1UVKA 4OI2A 2XRIA 2HRTA 2XG8A 4LF7F 4RW6B 4Y0FA 4MQ3A 2BQRA 1SZHA 2FJBB 4G1QB 3QNNA 3R7SB 1Z05A 2KSOA 1WUDA 1S10A 4J7CA 4MH8A 1OYDA 2ZD1B 2V52B 1OH6A 4MF2A 2A3JA 3UKUA 2PD1A 2Z57B 3I5BA 1QE1B 4NOHA 4K8ZA 2A18A 1WAFA 4OX9K 1YKWA 2V7ZA 1AT1B 2Q1NA 3L4QA 3BS7A 2V4JA 2OD4A 3KUGA 3FQKA 3K0SA 5KOXA 1U6BA 1KXPA 3IRXB 3KKAA 3W9HA 3WX4A 1M1KO 4ICLA 1LAWA 1PUZA 2KN7A 4AD6A 1VSIA 3X1LB 3QUTA 2EG2A 4EBDA 3LUYA 5A8WA 4K4UA 2CQ3A 3GDXA 5F8NA 1AUDA 5GAHU 4QWBA 1C0FA 4ZKAA 3TJ8A 2RQ5A 4EWTA 4ZP7A 1UWAA 2R3VA 1YITS 2QARA 4Y2UA 2PYLA 2HHXA 1U6FA 1U7LA 3U9DA 4B1VA 4DO9A 2CH5A 2CJYB 3SFGA 4PKHA 1Y5NB 4I4BA 2OLWA 5MAOA 1CZAN 1Y3KA 4MYTA 3DU5A 3TVZA 3QWPA 4DTJA 4IFYA 2OTLS 4P4OA 4B02A 3OHBA 1Y7PA 2VODA 3DGPB 5CR4A 2R2RA 3NAHA 3ZT1A 4KB1A 2QGFB 3K8WA 2ZUCA 1U47A 2O01C 1NSAA 4YDDB 4IL6U 2QX0A 3EZOA 4ZMMA 4K2XA 5KFWA 3HI0A 3NGKA 3AUOA 5HMZA 3IV6A 2MQQA 4DR5K 3CCES 3NDKA 5M1QA 1L7MA 2YPYA 2UUAJ 2XMVA 3I9ZA 1YGYA 1K1SA 4NXNF 3HVTB 5KPRA 3MABA 1PK3A 4PYAA 5KGXA 5T7LA 4JK1A 2FYXA 3WKDA 2E9ZA 4KLUA 5J2QA 2XMUA 1KLMA 5A8RB 3VF6A 1VQKN 4ELUA 2F4VJ 2DFEA 2GVDA 5E7OB 1EKSA 3QEWA 1FA0A 2GIRA 3GJRB 2IOFK 5ETMA 3M8YA 3TX0A 4DX6A 2GEMA 1QVGR 3QNOA 1PVRA 1GTEA 2GLEA 3ETLA 3NG8A 5ADZA 4X84A 1YRUA 3DOKA 1NPPA 1ZJNA 3ONQA 4KKOA 1BO5O 5BXIA 4DQ8A 4IFVA 1JX4A 1H38A 5B0EA 2SXLA 4OHZA 3NASA 3I28A 1LW2B 4GKJF 4U8YA 2UYTA 3WK7A 1RT3B 2KG1A 4C3KA 1XN9A 1TMMA 2NRTA 3LM2A 4J9UE 4K4SA 4NA2A 4ICAA 4OPAA 3HP6A 1DT9A 3DLBA 2HQDA 5KG6A 4X66K 2PI5A 2XZWA 4MLEA 3PSPA 4EO6A 2RLTA 2BPCA 5H9EJ 1Q86T 2EAMA 3ZYYX 4NY8A 3CSKA 3MPVA 4DS5A 3PEHA 3TA1A 2B7BB 1TMJA 1RXWA 1U02A 4DV1K 2VJUA 3S41A 3L0QA 1RT6B 4DUYK 1RBVA 4K4VA 4LF7J 4PKDB 3RG6A 3EW9A 2KOBA 3GPAA 3WNFA 1FK9A 4JV5K 2CQ2A 5J0PA 3MM7B 5ALWA 1BPYA 2BJDA 2XS2A 3RJKA 3BF1A 3T3FA 1ITPA 2C2ZB 3RYLA 2EXUA 4U96A 5TKWA 1VJQA 2BQUA 4XRHA 1RWWB 2RHKA 4NM1A 4FK0A 1JXBA 2CIMA 3W65A 4RCHA 1T0TV 2HGMA 2P9IB 3U1MA 1V38A 3IR7B 2XLKA 1HKCA 3CMAN 1FRJA 3QEBZ 1ZOTA 2FHOB 2QFJA 2NXUA 3DLEA 3RBEA 1SJFA 2IM0A 2W04A 4HH0A 4B3MF 3T6BA 1J5OB 2E7XA 2X78A 4QYRA 2KT5A 3NS7B 1RBTA 2E44A 1Q18A 3G71N 1LXJA 5T7BA 1HI8A 3ULEB 1TFWA 2XY7A 3AM9A 4NEYA 4O44A 4WQ5C 4YEAA 3PSFA 1XMQF 4DV5K 3RUBL 3RH6A 2ZDOA 3R8YA 5ALRA 3R1XA 2VL1A 3S6JA 1RBSA 3AQFA 4ED6A 2BANB 3SQGB 2MAXA 2PA8D 2UUCF 2BOPA 1WB9A 2DXDA 3AMZA 1IKWA 3HCXA 3QB0A 4ATNA 1BPEA 4BR2A 1LKZA 4F04B 1EQ0A 2W2PP 4URGA 3TUPA 5IS2A 1NMDA 3QXGA 2MA1A 2YWFA 2FMPA 2FZGB 3CNQP 4CZLA 1W9HA 1XS9D 2XB2D 4D3GA 4OZNA 4QWDA 2NRRA 3NCRA 2FHJD 4LY7A 4URQU 1ZQPA 3O1LA 3U1NA 3BBFA 1Q53A 2H3IA 4TVAB 5A76A 3ZETB 2H3VA 4ALZA 3I82A 3KBBA 1D8ZA 3JPQA 4KH5A 1HHQA 5GMEA 4DV4F 5ALQA 5AT1B 3WQTA 3CJ8A 3CERA 5B09A 4QYZK 1NU4A 4HUFA 1Z3EB 1HI1A 1REGX 4FZMA 2QK9A 2A1JB 4CF0A 3DMJB 5A2QU 4RQ4A 4L74A 2BEFA 3A8IA 3PFOA 1RQ0A 4IRCA 4M5DB 4FOEA 2BM1A 4OVLA 1KONA 5C42A 2QWOA 2HBKA 1BMQB 1SQEA 3KZIU 1OYEA 1O5JA 2LYBA 4DX8H 1ESVA 2ZKTA 1YIJN 3HMJG 5HLFB 4QOTA 4BCAA 5BOLA 3WKEA 4OV6A 2LYAA 3MGIA 1FESA 3KLVA 3FMWA 3MF5A 1XQSC 3VPZA 4BQLA 2F76X 4FLXA 2RF2A 1J54A 2X3DA 4ZVRB 3SSRA 1ZH5A 4AHSA 3AVCA 4P0PB 2WAQF 2B9XA 3Q2TC 3AY0A 1WCLA 1ITGA 1MSWD 2O4IA 1XSLA 3D7SB 3M2RA 1B43A 1FKPB 1IG8A 4NZ7A 3D2EA 3WXIA 1WF1A 2IA0A 4YB6A 1WOSA 3QFWA 4OYPA 4DF4A 2EKNA 1Y9OA 1OMSA 5LXRA 2W01A 4OHVA 4JI3K 4U7UD 4CK1A 2CPZA 2E5IA 3THPA 3VENA 4I2PA 2GS8A 2DR8A 3A5LC 2OM6A 5CQGA 2RE1A 1UFWA 3ETMA 2ZH9A 8ICWA 1FRMA 3PKMA 1IQZA 4FJ7A 1XNSA 1HNWK 3ZDEA 4HAIA 3M32A 4BC9A 2ZJ5A 2DNZA 3H8YA 2WZ1A 2C3UA 3AVKA 2HHQA 4ID5A 3RB3A 2H3ZA 4YOVA 2IPOB 5J2DA 3OTCA 1AA1B 4ZVQB 4DV0F 2VIXA 4ECTA 3VGUA 5KFAA 2GQCA 1B7FA 1P6TA 1CZBA 1P8GA 2A41A 3O9TA 5KFCA 1YLXA 1WKLA 5IIJA 4CH7A 4OJHA 3W2WB 5HMXA 1GX6A 4CD1A 3QBXA 1WC1A 3KWMA 2YHAA 5HMLA 3NAIA 2ASYA 4BBYA 3Q8MA 2YX7A 4CRXA 4J9VA 2FJAB 2VA3A 5K4LA 3WQPA 2QJ3A 2QT7A 2VV5A 4F5RA 1FFSB 3GOIA 3CYMA 4LFCJ 4UY8T 4OKJA 4AL6A 2XY5A 1SVDA 2NLXA 1PIEA 4M9LA 3IG8A 9ICGA 2YVSA 3I33A 3UIQA 4B3MJ 4CT8A 2ZQBA 2AMCB 2VFSA 2C2KB 2R7RA 3NNAA 4FLUA 1RT5B 2DGQA 3PIPQ 1A9NB 3P4UB 4IEIA 5I42A 3JPPA 2KJ9A 5KAKA 4WFAL 2CQDA 2HHHK 3D2FA 1XMQJ 4KX3A 4CO5A 4NLZA 3KK1B 3OUYB 3I32A 1A0OB 4H0VB 1HNIB 5HHHA 4BRIA 3Q7CA 5HNKA 4PGYA 3GFXA 4MFAA 4EBEA 3HWTA 4QZGA 4QIWD 2IMWP 4F2SA 3F2KA 4MFCA 2OZSA 1WG4A 1KQGB 7FDRA 2ZIXB 2KVIA 3MC1A 3VR1A 4LVNP 2NXJA 4DTSA 4MKBA 3WXMB 3T5HA 2NUHA 2Z2MA 1K73T 2ASDA 5IM0A 3OD2A 4CZIA 2FBYA 2O8CB 3J7ZT 4LJXA 2HZAA 4YMOA 4KLOA 1ZAVA 1YT3A 3TFSA 1P7DA 1HARA 8ICCA 4IOBA 2ZF5O 2VFTA 2KJWA 3ZZYA 2KVCA 1Q95G 1S1XA 1R7IA 1ICEB 5HROA 2AYBA 3LOUA 3NMAA 3MEDB 2OEKA 1OPZA 4ZVSB 5KFDA 2N1RA 3LP3A 2D6FC 3NWGA 4DV4J 2A6AA 1CS4A 1SIZA 1VS3A 5AZJA 1BLUA 4ZIWA 4YOTA 1B99A 3OTDA 1BE4A 4DR2F 1TAMA 3IMQJ 3SDEA 3C21A 3EVWA 1HWIA 1M5HA 2FC9A 2I9SA 1X4AA 4JHDB 3O08A 3H3NO 4QZDA 4JWMA 3M8RA 1F2GA 1CJUB 3PTWA 4OX6A 4GY2B 1W2BM 4FJ5A 5FLXY 2JNJA 1FXDA 4A8MP 1HBOB 3MN9A 1G7CB 2R7SA 2B21A 4RO0A 4YDUC 4ISGA 3CJAA 3DXKA 2CDRB 3VQ4A 1RTDA 4KPYA 3LZIA 3OLAA 4X62F 1YBTA 4RU2A 3M6XA 3SBGA 3AFGA 2B4OA 4IDKB 5GAEI 1YI2S 2R9LA 2CQIA 2HS4A 4ECQA 2DFLA 4OX7A 1MMDA 2XLIA 2HVZA 5ADXA 1SC4B 3FGVA 2X6SA 1ZBFA 5J0SA 4DFKA 3NNCA 1RFQA 1XR5A 1FEHA 1Z26A 3OTOF 3GIJA 4M6WA 1U8WA 4I9LA 2F8KA 1SC3B 5DRKA 2D0BA 4FZZA 3RZAA 7ICEA 3Q2SC 1YTUA 4FK4A 1IKVA 3RH5A 4RR5A 3IWXA 2FLPA 4IG0B 3UVJA 5KFJA 2IAJB 4IJNA 1T95A 5D0RA 4A8XA 1NZAA 2ROGA 2EDUA 1HJRA 2FLNA 3D6TB 5K8NA 5ETPA 9ICAA 1QTNB 1CJKB 4RW7B 4CEOA 3NGUA 3J7YI 3HHNB 4C0HA 1T4GA 2FHMA 5B8HA 1HLWA 2E1MC 1U2VA 2XM3A 2R8GA 1DXSA 2V0NA 3G6YA 2AJ2A 4DPUA 4A2BA 1JROA 1S1TA 2Z8QA 2EZXA 5F8MA 3MBYA 5E3QA 2UXCF 3H40A 5F3ZA 1JLEB 3R3TA 3D45A 3NGZA 1TELA 3D0PA 3H3OB 2FY1A 1Q82T 3SI6A 5AK6A 3HSCA 3VTHA 5GMDA 1ZM9A 3ZDDA 2W2OP 2YHWA 3VA3A 3LDSA 4LRAA 1XC9A 2ZIWB 4DQIA 3V72A 4DL2A 4K4IA 3O2IA 1SWWA 2RHQB 2CVIA 2VKRA 5HO4A 3UFCX 4USTA 2P6UA 3FFKB 1A6SA 4ZCIA 3G4SS 4Q45A 2ILYA 1TQLA 4LFBF 1VBYA 2EZYA 4P7VA 1T11A 1G4CA 4LSZB 2KHDA 1PBUA 2KE7A 4AXIA 5J8YC 2XS7A 4QPXA 1OW5A 1RDBA 3MM6B 2HBZB 4UAWA 3QESA 3EYZA 4LF6K 1LB2B 3QFPA 2PBDA 1JMSA 2YNFB 2HLTA 2E1YA 3VALA 2O8FA 4Q0BA 2HBRB 1U0SA 4CJTA 1KKHA 5EWEA 4KN7A 1VK3A 2MKYA 2BJ1A 5AZIA 2XLJA 2B51A 4UAVA 1M5OC 1NAQA 1U2RA 3OYBA 4I67A 3CJ9A 4WJBA 2B4JA 1RDWX 3WK9A 1JK9B 3G8SA 1X6JA 3WHIA 1F9HA 2K4IA 3HT3A 1HPZA 4K25A 1WWUA 4ZHRB 2P9PB 4CVNE 2J0QD 1Q5VA 4B1XB 4HDHA 4BR4A 2HI0A 4GIBA 1RTJA 4ECXA 1VHFA 4PUOB 3DRRB 2OANA 4CK2A 3KLFA 3MAAB 1ATRA 4Y2JA 3MAQA 2KT2A 1FEEA 1RA6A 3RMBA 3TA2A 4F3TA 2WSEC 3SQ2A 1Z2ZA 3QAEA 3ZXWA 4FZVA 1IKXA 4OGCA 1X9WA 1YRXA 4QZIA 2LU1A 2VGNA 4C4WA 1PG5B 2XYHB 5KQDA 5KAIU 1WG5A 1Q8LA 1HNVA 1QQCA 1Q86O 1QAYA 1BU6O 2K8CB 1IJEB 5IZHA 2XZDB 1IR1A 4K43A 5LJVA 4RPYA 3O3GA 3HP9A 1JCEA 5HSPA 2HOQA 2F9JA 1HD1A 1P1TA 5AQSA 4PHAA 1TGOA 3U3GA 4RBTA 4HYKA 5FPDA 3F2DA 4DU4A 3KLIA 1G1XA 2H5XA 5DS7A 3LGMA 1OY8A 3OTOJ 2QKKA 2DXEA 3TAMA 2D1CA 3EMTA 2Z1JA 4TSXA 2MZRA 2U1AA 3PHEA 3D3BJ 3V9SA 4Y2YA 3ET6A 4QS8A 1KD1T 5LJ3Y 5A0YB 3FZMA 2C3MA 2F9TA 3FBCA 2DKXA 4Y2SA 4CJVA 5JRTA 3DLJA 3R1HA 4JKCA 1S57A 4DPWA 1GLJO 2BPFA 3CF5Q 1KFSA 4O0IA 4CEEA 4ZLPA 4DR3F 4RNNA 1RZTA 1TK8A 2YNGB 3ZEUA 4CEFA 4TU9A 4AILC 5DM7L 3MXHP 3V6HA 4UB4A 2QTWA 2KXHA 1TAQA 5ALNA 4YOXA 3K8VA 2M8HA 1UPMB 4ZPWR 3BY5A 2UXCJ 4JD2B 3QUBA 3VOVA 3NS5A 4F2RA 2D0AA 1UPPA 4FWPA 3OYCA 4PL7A 2GOLA 3PW4A 1YHQN 3N01A 1KQFB 2BA9A 2PFUA 2AX0A 3ED5A 4C97A 5MLCV 3C29A 8ICNA 3UMGA 3N6NA 2QMUB 3UN2A 3IAM9 4BWJA 3W66A 2ZJ8A 1MNEA 1Z4NA 1JLFA 4O4GB 1XNRK 4PWDB 1Z4OA 1V85A 2CG8A 2HOEA 2GUPA 5H1SQ 2O8BA 1REVB 5CP2A 4A46A 1VSEA 3ISNC 5M2RA 4KT0C 4LR8A 3UNGC 3AOCA 1FO1A 1N6QA 2EFVA 3ZTSA 4C3MA 1MN7A 2GZOA 4OKKA 4LFBJ 4C7QA 5KFKA 4DR5F 1CPZA 2QKBA 3TUJC 2F9DA 2IDEA 1WC0A 2O66A 4BG9A 3NVMA 3ZSVA 3EL2A 2Y3YA 4I2EA 2H3EB 5AXKA 3IFRA 2EPIA 3IKMA 1AZSA 4JMUA 3FCVA 9ICEA 2BJ7A 3CJTA 3LP0A 1BXNA 1IBMF 5ALYA 3BDPA 3PRDA 1F5SA 4XPCA 3FZKA 1QTMA 3PDNA 1WKJA 1FX4A 4QBUA 3AOBA 4YB1P 2FJXA 2Y0SD 4CHYA 2HIQA 3ENHA 3Q24A 4OJPA 1NGDA 3QX7A 4NYZA 2ETJA 4CGGA 3C15B 2ZUGA 4UW2A 2AJ0A 1DK3A 1XHZA 1JXEA 3K75D 4MFBA 2FJWA 1ZTTA 2WONA 4FWNA 2FY8A 4UOCA 4ID8A 3A5OC 4LRCA 4DMNA 4OZ0A 1IXRA 1JXLA 3RBZA 2JZBA 1BQNB 2GV1A 2UUWA 3TSQA 3MWTA 1WUUA 4HVZA 2A2DA 2OPPB 2YWKA 2VQEJ 2OHDA 1YJ9N 2LQ9A 2LQJA 4I69A 2AD9A 1VOMA 1NB7A 3TOQA 3I4PA 4NLDA 4PG8A 5B0BA 4PZVA 4V1Ak 5J2CA 3HULA 4CF8A 1XIQA 3CULA 4NCAA 2BE2B 1FIQA 1VSHA 1ZQSA 3H7IA 4CIEA 1SL1A 1MA7A 2JX2A 4JUZA 2DGUA 3JYTB 3CCJN 1TUVA 2C2RA 2FUG9 4HTUA 1RT1B 3ISDA 1T9TA 4CTAA 4WQ4A 3M2VB 3CJKA 2R7WA 3FYHA 3SMSA 4KH1B 4DV1F 3RB6A 3FSYA 3GE1A 4AYBF 4MLHA 1SJ1A 2MSSA 4NEZA 3FLCO 1UCNA 1FD8A 1X4EA 4BRNA 4ETXA 3KLEA 2E5LK 4BC2A 2ZH4A 4JV5F 3TVYA 4USHA 4GXJA 1UZHA 1HQEA 3CW2C 4JKDA 5GINA 2QWMA 1Q8KA 1N32F 5SWMA 3SCKE 3BEGB 4TYAA 4CZEA 4E2FB 2YX4A 2DTJA 4V19X 4UQTA 4K4WA 4DR1K 2F1FA 4CGJA 3OYAA 1H7WA 4DR6K 4OX9J 2QB0A 4ZK7M 4O23A 2O8DB 1U1NA 1NGIA 3CJ5A 1DGSA 2UU9K 3R5DA 2Y1RI 5HN0A 4NMXA 1UWBA 2GWKA 2RU3A 1ZOLA 1QQOA 8AT1B 4K4HA 5CB1A 4UY8O 3NE6A 3HW8A 5AQNA 1LKYA 2IJRA 1SWVA 1O0PA 3D6HB 2NYHA 4D3HA 3WQUA 2OYQA 4QNLA 1P1LA 4FM1A 2ISOA 4MT1A 2O6KA 3DM2B 4ECRA 2AIRB 1WF2A 1M90O 2NRZA 1EP4A 1JQGA 1LEOA 4DS4A 3VMFB 4Z6FA 2IFXA 1B0TA 3LP2B 4O3SA 5KT2A 4AP9A 5HK4A 5DLFA 1PBAA 3QEPA 1B9DA 4XTTA 1MWZA 3HHLD 3ZZ0A 4BC4A 3AVIA 1S9GB 1GEHA 4E0DA 2J9CA 2NZTA 3AVMA 1LWCB 2ZH1A 3NVZA 5HVGA 4OMFG 2CQ0A 1ZQQA 8ICPA 1K73O 4O5FA 3IHQB 2G13A 1VSKA 3J7ZO 1M1HA 4LSLB 2HHPA 3B6OA 1P8ZA 4CIOA 4A59A 2W40A 4DR5J 1QCKA 2LDIA 2X1GA 1IVZA 2GW8A 3HXMA 2CJQA 3C19A 4B3SF 1KRPA 2CZVC 3ETOA 2YKOA 3UE5A 3ENWA 4J37A 2DNKA 3MMBA 2KSOB 1JJ2M 2XVTA 3DEEA 2MZTA 2PEBA 2MRLA 2ZE2A 2MZ1A 4LZDA 3TEGA 3NGYA 2MLYA 3UKUB 1IH7A 4U7UK 1WI6A 1O6XA 3MOJB 1EX8A 3R5GA 4Q8FA 3CI5A 4OLOA 2YWEA 2V4JB 1SL0A 4CJ4A 2FB0A 2VDIA 4FNIA 5C25B 1FKAF 3O8WA 4IH5A 2FVRA 3FFIA 3SSQA 1JKHA 4ED1A 4FF3A 3LW5C 4ICLB 1U1LA 4W92B 4B1WB 1VC0A 3THYA 5KL1B 8ICTA 2MYFA 2MKHA 5A8WB 3VC8A 4BDYA 5ALSA 4P2HA 1AQ6A 1VI7A 4X64F 4PKGA 4LRBA 2IVOA 4NXMK 1CEZA 1LV5A 1IBKK 2DL0A 2PFQA 3DOLA 5F0XA 1WSFA 3EVOA 4MFFA 2QARB 4OPJA 5CD4A 1RE1B 4X66J 3ZNUA 2QLWA 2P6RA 3MWPA 2W9CA 3KKAC 2K1RA 2ZJRQ 4I6MA 3EWAA 4C7YA 3TPQA 2HGLA 4M3YA 3OJSA 3RMCA 4RKUC 1BPXA 4ZIVA 2OXOA 4C8MA 3G6VA 2QLJB 1VQPS 5AKLA 2PE8A 4DV1J 4KMUA 3UR0A 3M1FA 5IWAK 1U6ZA 4DUYJ 5HP4A 4YOYA 1RB0A 2OKQA 3VEVA 4RLEA 5SUHA 1EETA 3LWLA 3WNEA 1TP7A 4JV5J 3SIPB 3EE9A 4F4WA 2YPZA 1C0GA 5CE3A 3K5MA 4BXOA 5B0FA 5E5NA 1S1WB 5AE1A 5JS2A 2LYVA 2K7JA 2BJ9A 2V67A 1DK2A 4B8AB 1RBAA 1TL4A 4DBQA 3MMAA 5K8MA 5T7LB 2MTLA 5IIMA 2A10A 1TL5A 5J2QB 5IV4A 1KLMB 1RWXB 4CO1A 4LF4K 2Y9UA 5AFUH 1RHKB 2W25A 1S4EA 1WNSA 4C8YA 4CJLA 1NSQA 5AQIA 3AO4A 4P10A 5KFOA 4YUDA 3D0HE 1GMWD 4LH5A 4RW4B 3AQEA 1X31C 2HQFA 3WIVA 2NRHA 1VQMN 1VQ4S 1JB0C 2HHHF 4IOAQ 4DV5J 5KG4A 5BPCA 1KVBA 3PYFA 3I8BA 3G10A 1FWKA 3DOKB 4KKOB 3DC2A 3OVBA 3EICA 2KXFA 4IFVB 2NREA 4ECSA 1NI3A 3M9OB 5E3PA 4UB2A 2QLTA 1WEYA 1IBLK 4OZ5A 2J4RA 2HAIA 4YOWA 2Z2YB 1S1UA 3A13A 4DPXA 4CLFA 1DHMA 2RPIA 4B8CA 1RQLA 2J9EA 4IKFA 1M1GA 4E1NA 2DIUA 1ZM4A 1HHTP 5F0UA 3UMBA 1N0VC 2CJKA 4JI8K 3M05A 4K4XA 1HNZK 5JU5A 1N5WA 5ADXH 1IIPA 4LIWA 2ZGZA 1N8RT 3I1YA 1EZZB 1YK9A 3J80O 2XHBA 2QA1A 5D4BA 3C23A 1HQ2A 4Y1CA 3KIOA 2KD1A 2JEFA 3K5PA 4GC6A 4QYZJ 3EO3A 4CHNA 4BRPA 4FJHA 2YH1A 4F3QA 2CNLB 1RP5A 3KD5E 1HWLA 1GXTA 2RHSB 4CGIA 2M5YA 1G3OA 3FNNA 2G1DA 3MMVA 2EX3A 2WB1D 1X2IA 1NK6A 1KQKA 2YXLA 3SV4A 2L9WA 1PILA 4HR2A 1WEXA 4CLZA 1C0UA 2QIFA 1FDAA 1U1KA 4CJRA 4CECA 1PYTA 4NLUA 1R31A 2EFNA 3ATUA 4OYOA 1E6YA 2EC2A 2VJ5A 3MEGA 1X6IA 2M2BA 3IG1A 2VWJA 5IIIA 2F7TA 7ICJA 3CDUA 1R8PA 4C8OA 4O44B 3KFWX 4DU1A 1NKEA 4B9QA 2JEJA 4KHUA 3MURP 3TO8A 2N4CA 4HWIA 2GCFA 4JI3J 3WXKA 4YP3A 3SMZA 5DGBA 2B8QA 1XBWA 1NK5A 3ZT0A 2QL7B 4YMEA 3BH6B 2AU0A 4CBXA 3EJMA 1IKWB 4B9LA 1HNWJ 3THVA 5LSOA 2G4BA 4JI4K 1SB3C 4LBHA 3ASMA 4J9NA 2X74A 4M94A 9ICSA 1KAZA 3OLBA 4DB3A 1VGYA 5ALDA 2V2QA 3CP8A 1N33K 3MN6A 1DTQA 4MJKA 2D3OR 2FJ6A 3IRUA 2IHMA 2YMPA 3VAHA 1XU4A 2G5HB 3OTQA 4P6QA 1M6YA 4CEAA 4MEYA 3L2VA 4JK8A 3L09A 2QZ8A 2M0NA 1XNQF 3A4TA 2DHXA 3IAYA 4CJ3A 1LWFA 2G2OA 2XY8A 2GVZA 3KJFB 3H2LA 4KSEB 3VZIA 5F1XA 4QIGA 4FLYA 3PR5B 1RADB 1NDPA 3DFEA 3PVXA 4PH5A 3FE1A 5DDOC 1M5PC 4QS9A 1SQFA 5LMNK 4ZVUB 3P1GA 2RE2A 2HKEA 4DSKA 1PJ5A 3SXLA 4Q44A 2GQQA 3OYHA 3VQ9A 2HHHJ 1EKEA 3MECA 4ER8A 4I2AA 2IYIA 5L9NA 4HEA9 4TUPA 4RW8A 2CPJA 2RF2B 1YVFA 3HKZC 4ED4A 3LO3A 5DM6L 5RUBA 4F26A 2K60A 3P39A 2E88A 1WSIA 4DV3K 3D2EB 3UPQA 4LF6F 1D09B 4KLGA 1X4HA 3QT6A 5KAFU 1P9YA 3NGSA 4DTNA 1S59A 2RQKA 3UDVA 2CPEA 2FJDB 3PV8A 4YN3B 3IXQA 4I2PB 4NI2A 3VTIA 1HQUA 4Q7AA 4L72B 3NF7A 2LQ8A 3BP8A 3JQMA 4AHUA 5AI6A 1M5SA 9ICXA 2ATCB 2P2CB 2O4GA 1PKUA 1K8AO 1VSJA 1AROP 3M32B 4OLBA 2UP1A 1JALA 3OVSA 1Z4UA 4DUTA 5ALOA 2J6UA 4ID5B 2W8LA 3T1AA 3Q0AA 2NO4A 1WC6A 1HNXK 1TUWA 1FWPA 4FXWA 4UBBA 1H7XA 2OELA 2ZM6K 3D6FB 3UO0A 4N76A 1Q81T 4ECYA 3U27A 3PSIA 1SKRA 3QT5A 2UUTA 3P5BP 2R7OA 3TAFA 3F44A 2Q31A 2F8EX 2DY9A 1M5VC 4I9QA 4CP5A 1KBRA 4F92B 2BUPA 2X7IA 5KFIA 5J0QA 2P5GA 3L95X 2KQ2A 2DY4A 4DWIA 1SZ2A 3V9UA 5B66U 3M3ZA 2DNRA 3CCTA 2MGZA 5CWRA 1VQNN 2OUGA 4QZEA 2KW4A 2MUTB 4KX5A 4Y6IA 3UI3A 2I6XA 1LNQA 1ZYQA 4JI7K 1N63A 3WK5A 2YX1A 4ZPBA 3V4MA 1U45A 3M5RA 1J6ZA 4MIAA 3TZXA 3EKSA 5I42B 3PY8A 3CCQS 4EZ6A 3D2FB 1JJ4A 2Q2RA 1ZBIA 3QZ8A 3CC7S 3H0MB 4J2AA 4P73A 1ZZFA 3SYZA 1JUDA 3PM9A 4P4MA 2ZEJA 4UOHA 4QZ9A 4KGXB 2HFOA 1Y64A 4M3WA 3PO4A 3OY9A 1ZQOA 4OLPA 3ZZOA 1S0NA 2KM8B 2WB1C 1S9EA 2VPYB 4LRFA 3AAPA 4BR7A 4DTPA 4M3ZA 3GV8B 4JI2K 2XC9A 3ZD8A 7ICIA 3OGUA 5HMMA 1RILA 3OR2A 2GAHC 3RW7A 5IM0B 1OO0B 4NLWA 4IQTA 2M9NA 2DNHA 4IR1A 1LQ9A 2EHGA 2J0XA 4IYQA 2W42A 2UUBK 4FZLA 3OVNA 5IIOA 1S1XB 1RT2A 2VC1A 3IGNA 4RPFA 5HROB 3RMAA 3RB0A 4ED5A 3SBTA 4XDDA 2YNHA 2KM8C 1CS4B 4R25A 3TFRA 1S77D 1NU0A 3CO9A 3HVAA 4DMZA 5AZJB 3CJBA 2GHVC 2DGXA 1RAIB 1VJWA 2ZIUA 2ZXIA 3EXCX 3ITHA 4X65F 1XMOK 2QRRA 3SDEB 4B1YB 5HRRA 3HYFA 7ICUA 4K4TA 1SUQA 5C15A 4UB6U 5AM0A 1GO3F 1KR4A 4J03A 3CNHA 5ALLA 1O03A 5KG7A 4FLZA 4HACA 5F9LA 3OPKA 1IWAA 3AGKA 4FBUA 2K8BB 4DTUA 3A8EA 1JMTA 5AJ3K 1LFWA 4K7QA 2EBEA 2CGKA 4C80A 1RTDB 3M6VA 2G06A 2F44A 3T9NA 1X7VA 2KHCA 1VQ5N 4WFXA 3J81O 4HI1A 1FVQA 1DLOA 5DB9A 4RNMA 2HOIA 4FN5A 4LF6J 1KN6A 1A6LA 2YB1A 1KL9A 4J9MA 4WXOA 5AIBA 1C1BA 4A8FA 3QZ7A 3Q8LA 3JS6A 1UOCA 5KFRA 3OFFA 4NWBA 3ZT2A 2BGGA 2HG4A 5F41A 3QFUA 3NMRA 3VQ5A 1N48A 3GJTB 5J1EA 5ALMA 4OCZA 2AZ1A 1T6DA 5AQTA 3SCLE 2HNZB 1IKVB 3UVJB 3NS6A 4GVEA 2BYCA 1V9OA 2V2ZA 2CPDA 1C0MA 4C3LA 2DH8A 4OJ1A 3EXYA 4Y2CA 4PGXA 4MKAA 1BGXT 4FS2A 3ZX3A 3WDOA 4DOBA 4M5GA 4ANCA 5AQZA 2VWKA 3RBDA 4DKWA 1H73A 3RWUA 2X1AA 5FPNA 1DJ0A 3C94A 5AKKA 4DV2K 5FD1A 1U2VB 3VQBA 1LWEA 4GO7X 4ZVTB 1FF2A 4NE9C 1RABB 1V5IB 2BJEA 2DBYA 4CM2A 3PMLA 4YR2A 1S1TB 2CGJA 2ZDPA 3SUQA 3SBMA 1RHJB 4HUEA 2QLBB 1TUGB 4PQUA 3HRGA 3DLHA 3E9LA 3VVUA 4A57A 1KNZA 2LM1A 4PG7A 1FXLA 1CBKA 3K58A 1JRPA 4U67Q 1K47A 3CD0A 4IWVA 2B9WA 3JTNA 3H46O 4ZCLA 2Q4TA 1HMVB 2B4VA 5GVQA 5EE9A 4CDGA 5J0TA 2YY6A 4JWNA 5IC4B 3WXJA 1WYGA 3HSJA 2W43A 2E5LF 2G8KA 4RL1A 3L3CA 3RB4A 4B3TF 5HMWA 5DLGA 1H98A 1OWXA 2HHVA 2O8EA 3UN3A 1ZQIA 3KDNA 4DR1F 2R8HA 4DR6F 1R0BG 1ECWA 4TXSA 4KHPK 1U0HA 4LD0A 3K9KA 3PUFA 3L9ZA 1RGIA 2UU9F 2F8SA 2GFFA 4HLBA 1D1UA 2WF7A 3QU4A 4PJ0U 5L9XA 2Z2LA 3R5JB 8ICVA 3VZHA 2VJVA 4Z6DA 2O8FB 3L5KA 4Q0BB 2HWHA 2HCFA 3RJJA 2G0IA 3N79A 3WNHA 5ALJA 5AZIB 2R2UA 2DGOA 2MZSA 1NOZA 2X51A 2NLWA 4U7CA 3GG0A 3N5FA 3VF2A 2R8IA 4Q8EA 4GMKA 3R27A 3T1HK 3NVYA 4FPRA 2KHOA 1VQKS 1ILYA 1T9WA 2XO6A 4EYIB 2WTUA 2X3GA 4PR6A 2VJ4A 1D9FA 3ILIA 2JH1A 1HPZB 1VMBA 4PXCA 3FZHA 2QE5A 4BVOA 1QSLA 4DPYA 2LM4A 1RTJB 3CO0P 1AFJA 4A8OA 4UB5A 1KAYA 4LR7A 3KLFB 4IRDA 1AFIA 4DL7A 1K0TA 4G1IA 2VA8A 4XDCA 3DOMA 1XNRJ 3HD2A 2OPSA 5ALGA 2QEXN 3JPTA 1IKXB 3TZZA 5JXSA 2PO4A 5E0OA 3OYDA 1BA0A 2NRWA 2P6SA 4WFNQ 2W3SA 2R7YA 1HNVB 4WFYA 4LBPA 5CD4H 3TSPA 2WUSA 3SUNA 4P4PA 5EY4A 3FQLA 4E1MA 4F93B 2KZ3A 4CO3A 1N8RO 5CHGA 3R5BA 4F7VA 5F0WA 5K8OA 2GO7A 4F5PA 2RD5C 4M1KA 4I2FA 2H5JB 5KPZA 2W24A 3AXKA 4KHYA 4M45A 3KLIB 3CJCA 4E7KA 2IMOA 4GV6A 1NOYA 1J2NA 3KOOA 3TAMB 3UB5A 1HR0F 4JKHA 3B4DA 3ET6B 4X4OA 1YZ7A 4MIWA 5B08A 5K8PA 2CN1A 1VRQC 4MAKA 5AQHA 2G0AA 1G99A 1CLQA 4B3OA 4UUXA 1ZQWA 4QAGA 4RQ6A 1SJ3P 1ZQ1C 3NNHA 2DTUA 2AKWB 2EK1A 1NGJA 4EYHB 3H42A 3R7BB 3ZEUB 3T5JA 5M1FA 1NDCA 3GSDA 3HSZA 5AQXA 5KGWA 4NXMF 1KQSR 1ELOA 3GIMA 3CMAS 3ICLA 1Q79A 2R7UA 1VC5A 5IINA 4FPIA 3QIOA 3SCXA 3K17A 3CJSA 4YVZA 4C7ZA 2LXFA 2IA6A 1NCLA 3G71S 3IUCA 1RAFB 1NJIT 1QH9A 2CG4A 8ICXA 3WX8A 8ICKA 4Z4CA 4EZ9A 1K5OA 2ZJQQ 5IWAF 7ICKA 1X4BA 3QICA 4QOZB 5BRDA 4BUGA 1JLFB 3F9KA 5AI8A 2HMIA 2ZXHA 3W61A 2O8BB 3H2VE 3T7ZA 4LR9A 5M1OA 4IOXA 2GNKA 2E5LJ 4M5JA 3GR0A 4FVUA 1N6QB 4XH5A 3PX4A 2W2QP 4I6WA 1S5JA 1RBUA 5D6GA 2VB6A 2L48A 1D8BA 3OS0A 4N5SA 1XJWB 3ILJA 3HZ6A 1FJGF 3OL6A 4DR1J 4DR6J 3HOTA 4NPOA 4A48A 4JI1F 3LPUA 2WHEA 4BQZA 1CVJA 4QIWF 4DL5A 2UU9J 3V5RA 1AZSB 4FF4A 2VBZA 1LWXA 3KJNB 4KI4A 3CC2N 5AQYA 4IDHA 2M70A 3LP0B 4XO0A 2E1AA 1G15A 5EHHA 1WWVA 3EDRB 3E51A 4O3RA 3DCAA 3G2XA 1Y5IB 1J5EF 4PKIA 3AVLA 4M47A 2YJFA 2V4QA 5AICA <