3HPOA

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus y714s mutant bound to g:t mismatch
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVSGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
total genus 214
structure length 579
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hpoA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hpoA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hpoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpoA01
5DG7A 4F8RA 3I0RA 4CGFA 1Q9YA 2R8HA 3ZCMA 3HK2A 3JPOA 3OJSA 1ZBLA 3C5GA 4GC7A 1IKVA 3ZSOA 4KMUA 1EETA 4JWNA 4ICLA 3KKSA 1XO1A 3AA2A 5DGAA 9ICGA 2I5JA 3TFRA 4CFCA 4RQ8A 3K59A 1WCNA 4O55A 5TZVA 5KFYA 1WSJA 3NGIA 3S3OA 5DBAA 2I1QA 3QEAZ 1HRHA 3EWAA 9ICLA 3MGHA 3ORYA 8ICVA 3LP0A 4NM2A 1RZTA 1A5VA 4AH9A 3IHQB 1T7PA 2F8TA 4CF8A 1Z00A 4M9GA 3QIPA 3IM1A 4B8CA 3TANA 4MFBA 1RILA 1VSLA 3AU2A 3NFAA 5DLFA 3CYMA 2ZUBA 3U3YA 4RQ0A 5F9NA 4E1MA 3SV4A 5J2GA 3ZDBA 4E7LA 1BGXT 2PFQA 1RCHA 3B6PA 4B9MA 8ICEA 2HVHA 4CIFA 4LVSA 1X9SA 4FS1A 2DY4A 4B9VA 2FPMA 3NDKA 5J2EA 3E2EA 8ICKA 3ISNC 4FJ5A 3KD1E 4Z4GA 2BHNA 2X74A 1ZBHA 4BE2A 3MEEA 3UXNA 3L3UA 5KTQA 3SI6A 1ZQAA 3V1QA 1UAXA 3K75D 4B9LA 4BGDA 4OLBA 2Z1HA 4M45A 4ID5A 4PQUA 4KB1A 8ICRA 7ICQA 5IINA 3RB4A 3SUNA 5J2MA 3LK9A 3VQDA 3SQ0A 3WNGA 3CFOA 2JEFA 3LANA 4BWMA 2FMPA 4YR0A 4RW7A 4QZDA 4I27A 2HHWA 3T1AA 4DMNA 3SQ2A 1WSEA 3EPIA 1X2IA 4KN7A 4KLIA 5D49A 2RKIA 1NJXA 2F1HA 4ED0A 3QEIA 4N47A 4M6WB 4I2JA 1TGOA 4ECTA 2JZBB 4FJLA 2VWKA 4BDYA 5KFMA 3NE6A 5DQIA 3SQ4A 3TQ1A 4KB0A 2GV9A 2HHVA 3NF8A 1KLNA 4E7HA 4MF2A 1VSIA 4DSJA 3V1RA 2DPJA 3PMNA 2KZ3A 4DSKA 5CYMA 3HXMA 4PWDA 4CECA 4UB1A 4IRDA 3OYAA 4FLVA 4F92B 4F3OA 3V9SA 2IA6A 4R5PA 4CHZA 4RT2A 1T8EA 4B9TA 5J2HA 3UQ0A 4M9HA 3PMLA 1C1CA 4M3XA 4YN4A 4QW8A 1ZQTA 3O3FA 1UT8A 4PHEA 5CWRA 1RDBA 3C2LA 2NUBA 1Q8IA 1RT5A 4MEXA 1RT1A 4I2HA 4KI4A 1HYSA 1BPDA 1ZQYA 4J2BA 2KN7A 3C21A 3V7KA 1RTDA 2Q0ZX 5J0YA 4AILC 1TV9A 3TARA 5DB9A 3H4DA 1C1BA 4FLYA 5KFGA 5J0SA 3ASMA 3VA3A 3LP2A 2UVUA 1BVSA 3RJKA 3OJUA 2W9AA 4ECXA 2VA3A 3MFIA 2BGGA 1IKXA 3TR8A 4M9LA 4F5OA 2O4IA 3C6TA 5KG2A 4DQRA 2PY5A 2ETJA 2LYHA 3QZ7A 1WAFA 2BE2A 4W5QA 1QSYA 7ICLA 5DKWA 5FRNA 4Q8EA 3F73A 4OLAA 4O5CA 3VQ4A 4QZGA 1SV5A 3ZDEA 3TFSA 4DSLA 3C95A 4YNQA 1KDHA 3MR5A 1QSSA 3AVAA 5J2QA 3OYGA 2IHNA 7ICIA 3NTUA 1WNSA 5HLFA 1KCFA 1ZQBA 3SUQA 1S1UA 3B0YA 3TI0A 1T4GA 4UB4A 3ZT2A 1X9MA 1CUKA 9ICRA 4F4KA 4Q0BA 2OPRA 4YXMA 4DL7A 1HJPA 2B5JA 2V4RA 4R63A 3VQ8A 4Z4CA 4KREA 9ICWA 1BPYA 5KT4A 9ICEA 4FK2A 3RR8A 1BCMA 4MF8A 2XY7A 2AU0A 3OYNA 3K5OA 2GBZA 3P5JA 2NRWA 1TAQA 8ICBA 1S77D 3NF6A 2R8GA 4YFKA 2ZTEA 3QNOA 5C24A 5I3UA 4I2FA 1TKXA 4E0DA 4O3NA 1MSWD 2NRTA 3TWHA 4HUGA 1J9AA 1KVAA 3EW9A 1D8LA 8ICPA 3QE9Y 4FM2A 4CHYA 1ZQEA 5KT2A 1RYRA 2R8KA 3QEPA 2FPKA 3KHHA 1RT2A 3OS1A 1WSGA 7ICPA 3AVFA 2HHSA 1REVA 1VSJA 4CHQA 1RDCA 3PVXA 1JX4A 4NYNA 3LZIA 5KFWA 1TL3A 4FJNA 2PI5A 3C6UA 4O4GA 2IMWP 4QWAA 4G3IA 4YVZA 1ZQHA 5J0WA 3VA0A 1NOZA 4F91B 2HHTA 1DLOA 4KTWA 4Q45A 5HRRA 4HUFA 4ECQA 1U49A 3KTQA 4Z6DA 3HM9A 1SL0A 1W0HA 4I2EA 4YFUA 4Y1DA 2YNFA 1Z00B 3I8DA 4BE0A 3BQTA 3T3FA 2ISPA 4DTOA 3HVRA 4YR3A 3V9WA 3M9NB 1C0UA 2W9CA 1ZJMA 4UBBA 5J0UA 4BACA 1VK0A 4EBDA 1TK5A 3C1ZA 4OPKA 4O5KA 5CP2A 1LAWA 1BPEA 4I2DA 3V7LA 3QZ8A 4IRCA 3V4IA 1BPZA 1VSMA 1WLJA 1RXWA 9ICFA 2GWSA 3EZ5A 3ISDA 1KSPA 1RT6A 4NLZA 4ELTA 4CEDA 1RTHA 3OYBA 4KITB 4ED7A 2ZUCA 3H7IA 8ICUA 3GV5B 1BL3A 2XY5A 1JLFA 5BOLA 4FYDA 3G10A 7ICFA 3LWMA 3HPGA 2IHMA 1LWCA 4RW8A 1HYZA 4MQ3A 4DTXA 1Z3EB 4M41A 1S1VA 3K58A 1A76A 3H8WA 2IBKA 3V6DA 9ICKA 1S6QA 2DTUA 4IBNA 2JEIA 4ZTJA 3RJJA 2ZJ8A 3OHAA 4DFMA 3TAQA 4M47A 4DL5A 5DK5A 1HJRA 5K14A 4NLGA 4O5EA 4RT3A 1BHLA 1XHXA 4CERA 4DWIA 3O3HA 1CZ9A 4KPYA 1QTMA 3MR2A 1T3NA 4I9LA 4IR9A 8ICYA 4GXKA 2W9CB 5DB8A 2VWJA 4QAGA 4GLXA 4F4ZA 1LWEA 1JXEA 1JLAA 4E7IA 5BPCA 1ZQWA 3GQCA 2HVIA 1NOYA 3CM5A 2D0CA 1ZQMA 1QHTA 4IDKA 3JPTA 4DU1A 1CEZA 3GIJA 4DOCA 4EP5A 4CJEA 5DMRA 2WOMA 5BOMA 4IFYA 4RNMA 1NK7A 1WN7A 3ZSVA 1TV6A 5KFIA 1ZQUA 3IG1A 2XCAA 4FLTA 3AVGA 4QWDA 4DLGA 1JL1A 2FC0A 4H4MA 2A1JA 1K6YA 2DFLA 5DB7A 1DGSA 5J0PA 3DMJA 4EBCA 3DOLA 4I2GA 4CJPA 3RBDA 2ZE2A 3OY9A 3ZT4A 4DG1A 1G15A 3M8QA 2ISOA 1D9FA 4BXOB 4Z6CA 2Y1JA 1DTTA 3LP3A 4FS2A 4F4WA 3CQ8A 3QERA 4FCYA 4Q5VA 4QCLA 4O5BA 3U3GA 2JEJA 3DI6A 1XC9A 3QESA 4CK2A 1IH7A 4Q43A 1JN3A 1IKWA 1KLMA 1V9PA 2P1JA 3UIQA 4RG8A 1Y88A 1CXQA 3DOKA 2C22A 2E6LA 1PZNA 4J9PA 4Z4EA 1CZBA 2BCVA 3O4QA 3V6KA 1RBSA 4FM1A 5KFRA 4DTJA 3L2VA 2XGPA 4ED3A 4LH5A 4CJTA 3ISCA 1JIHA 2X6SA 4KLTA 2F96A 3SPYA 4XIUA 4KI6A 9ICNA 3QEVA 1RYSA 5IIJA 3SJJA 5J0RA 1S5JA 1C0MA 3H8JA 5KFZA 5EOZA 4RQ3A 4KLHA 2RN2A 4C8MA 4FW1A 1WCLA 4RQ6A 5HP1A 7ICUA 2FPLA 1L5UA 3V9UA 4IQWA 4CJFA 5KFKA 1BISA 2OPSA 3GV7B 2HHQA 9ICSA 4C8NA 4F4XA 1NK4A 2EX3A 3ALYA 3KLIA 5I42A 5DG9A 1SL1A 2FMSA 1B43A 3GILA 3C2MA 4MEYA 1RBVA 9ICJA 4JS5A 5J2AA 1RBUA 2P5GA 4CJQA 5EWFA 3U6FA 4RPZA 3OHBA 4W5TA 1UWBA 4IKFA 2E6MA 5CA7A 3G6VA 5KG1A 4OJRA 5J2NA 1J54A 2G8IA 1KEJA 2AQ0A 4K4HA 3RRHA 4AHSA 1B9DA 2B4JA 4J9OA 1JLBA 2YNIA 4KLEA 1ZBIA 4N41A 5EWGA 3UXOA 9ICPA 3ZDAA 1D9DA 2KFNA 4FK0A 4IR1A 4RUAA 3RBEA 2B6AA 4IQTA 8ICXA 1VSHA 3DLBA 5J2KA 2YNGA 1R0AA 2KW4A 3G0ZA 1SUQA 2BCUA 1UT5A 9ICXA 4CGHA 1L3SA 1ZQQA 1NK8A 1GOBA 4YP3A 4RW6A 4DQSA 5J2DA 4KHUA 1FKOA 5CHGA 4I2BA 3K5LA 3PR5B 1NOMA 3KLEA 3LP1A 1XSLA 4EYHB 3PR4A 3LZJA 4XA5A 4B9UA 4QOZB 3OYMA 2A1JB 1EKEA 5L1IA 1KVBA 4OKKA 3PW0A 4CF0A 2W9BA 4H8KA 3AVHA 5JS1A 1U4BA 3VQ9A 1JMSA 1Q9XA 1KVCA 1FXXA 4R8UA 3D0PA 4DTMA 2ZJ5A 4YR2A 3G6YA 2BANA 4CF9A 2PFNA 5KG5A 4CFDA 2JGUA 5HRPA 2RDJA 3A2FA 3L3VA 3PW7A 5CJ7A 3OSPA 4WE1A 1S0VA 4FBUA 5DLGA 5IIKA 3HJFA 5J0QA 1BI4A 1TKDA 5KFLA 7ICHA 2P5OA 4DU4A 3IS9A 3ITHA 4PA1A 2AGPA 3B0XA 5JS2A 4RZRA 4UAYA 1KFTA 1HYVA 3RMBA 2XGQA 1T03A 4K4GA 1HMVA 3AO2A 5KFFA 1Y97A 4EP4A 9ICTA 3M8SA 4N5SA 4O3OA 2XY8A 1L3VA 1ZQGA 3RJEA 4TURA 3Q8PB 2FBVA 2V4QA 1NKEA 4I9QA 3AO1A 1EP4A 8ICTA 9ICVA 3PW4A 3RB0A 2UVVA 4I7FA 3DYAA 4DO9A 4CEOA 3DRPA 4FLXA 8ICLA 4E19A 4CJ5A 3AVNA 4KLMA 4N56A 3O3GA 4CHOA 2W9MA 4HYKA 3AVLA 2WONA 4F5NA 4R8UB 8ICWA 3ZSZA 4ELUA 3RWUA 4F5RA 1MC8A 2FLLA 4KAZA 4O0JA 2X6NA 2IS3A 1UOCA 4CJVA 1TL1A 4FJ9A 2KZMA 3OYLA 2A1SA 3BGRA 4ECZA 4TUPA 5KFJA 4AHCA 4AHVA 4K4IA 1J53A 3ZSYA 2HB5A 3DLEA 4NM1A 3Q8KA 2VA8A 3AVMA 5KFHA 5CZ2A 4CFBA 3Q8MA 2PXIA 5HROA 3VQ6A 1NJYA 1NK6A 3CFRA 1TFRA 4DFJA 3SZ2A 4KV8A 1C6VA 2ZQBA 1TKZA 3MR3A 2P6UA 3UXPA 4ECYA 5L1KA 1K1SA 1X9WA 3MXJA 4CEBA 2W8KA 1C0TA 4ZTFA 4JRPA 4K8XA 4RPYA 2C28A 3TAFA 2JLEA 3AVBA 4KLDA 3K4GA 1HUOA 2G8KA 4KLJA 3QNNA 4BXOA 5DDMA 4OPJA 1F21A 2DFFA 5KG6A 2KTQA 2XO7A 2G8WA 1JXBA 3KLHA 3FFIA 9ICOA 4CGGA 5F9LA 3B6OA 4GVMA 2G8HA 1JLEA 4CK1A 5E41A 2W8LA 5J1EA 1J5OA 2OPQA 1COOA 3OYFA 3ZSWA 1ZYQA 3LPUA 3CFPA 4CJ3A 4RQ2A 4KKOA 4PH5A 4UB5A 3AA4A 1U9LA 1SKSA 4CEEA 1D5AA 4KHNA 1KRPA 2PFOA 4N76A 1ZQCA 5D46A 4QWEA 4PGYA 2WTFA 5IIOA 2IOCA 1DOQA 8ICGA 5DQHA 3MBYA 8ICZA 4CK3A 4R66A 4HHTA 3LAMA 3GFKB 5KFNA 2R8JA 4TSXA 5SZTA 2BCSA 4FM0A 4JV2A 3IAYA 3MFHA 5KT3A 3RJGA 4RQ1A 3RB6A 4TUQA 4FXDA 2ASJA 4ZH4A 3QEBZ 3I0SA 4RW4A 4M9NA 5L9XA 2PYLA 3OVNA 3V9XA 1QQCA 4G1QA 1HNVA 2C2DA 1YVUA 2RDIA 5KFVA 3S3MA 4B8AB 2BDPA 5CY4A 4QZAA 4UB2A 8ICJA 3MGIA 2FBTA 5KG0A 2BPGA 4HCBA 1CXUA 1JLGA 1D8YA 7ICMA 1ZBUA 4RQ7A 1S9EA 4GXJA 3HT3A 3OYJA 4FO6A 3OYHA 1KFDA 1HUZA 1BIUA 2VG6A 4CJUA 1ZQNA 4FJMA 3L2QA 4E7KA 3ULDA 4EZ9A 3MXMA 3QIOA 4DQIA 4CJKA 3EPGA 1ZBFA 3BQ0A 5IILA 3OS0A 7ICOA 1BPBA 1XSPA 4P2HA 1S10A 3OGUA 1QS4A 4JLHA 3L2RA 4FLWA 2QXFA 4LZDA 5D3GA 3KHLA 2I9GA 2VANA 4JV1A 1BQNA 3SNNA 4LZGA 3BQ2A 5HRNA 3Q8QB 3SUPA 4M3UA 3SV3A 2IGIA 4DOBA 2ITGA 4CEAA 3KD5E 1N56A 3TAMA 4DS4A 3M9MB 3ZSXA 4J2EA 1RDDA 2FMQA 4FJXA 1DTQA 3LDAA 3T19A 5DB6A 3AVIA 3SPZA 4GMJB 3GIIA 2HW3A 3WNFA 1CLQA 1IO2A 1FK9A 1A5WA 3QETA 2ZTDA 3OYDA 1RT4A 3DM2A 4Z0UA 1BCOA 5HBMA 4R64A 3MEDA 4DSIA 3RJHA 1VSDA 4CF1A 3NH0A 2ASDA 3AO5A 5FDLA 5HMLA 3TAPA 4JV0A 1QSLA 4I2CA 4CEZA 3KHGA 2OA8A 1L3TA 3JPPA 3BQ1A 4FJIA 7ICNA 3VN5A 4ED8A 1TVRA 4FJ7A 4F93B 4ECWA 5KFOA 1BQMA 1SZPA 3C2KA 3ETLA 1XS9D 2C2EA 3V72A 2MUTB 3MDAA 3OS2A 4DEZA 4CJSA 4DQQA 3NF7A 3JYTA 3KK3A 3RH6A 1N6QA 3M9OB 4KRFA 1Z25A 1W9HA 1EXNA 3AU6A 3IRXA 4B08A 4I2AA 1ASVA 2PYJA 4ECRA 4DTRA 5J29A 1RT7A 1ZQLA 3RH5A 3H08A 2IAJA 3TAGA 1C1AA 1ZQXA 3JPRA 1TVAA 1XWLA 4JK1A 3H8SA 4F5PA 1S0NA 4H4OA 4O3RA 4O3PA 3L2UA 3JSMA 2YNHA 5J2JA 2R8IA 8ICFA 2XHBA 4FZZA 4FBTA 1BIZA 4C8LA 3AA5X 2KFZA 5EU7A 1YTAA 3AVKA 4NCAA 4I2QA 3RAQA 3VQBA 4NLNA 2XCPA 4PHDA 4NCGA 2OWOA 3C1YA 3HPOA 4EEYA 1NJZA 4QZ9A 4J2DA 8ICHA 3VQEA 2MUTA 3KLGA 2UVRA 1GOCA 4YMNA 3HX0A 5KG4A 5DBBA 2M9NA 3SQ1A 3JPSA 3T5LA 4KTZA 4RU9A 3KK1A 5DGBA 2HMIA 1JLCA 4CJ4A 1ZQFA 5CB1A 2FBXA 3D45A 3FDSA 7ICKA 5KT6A 3N97B 3ZDCA 8ICOA 1S1TA 2ASLA 4ED1A 3RR7A 3E01A 1S9GA 3C94A 2P6RA 1IM4A 4JWMA 4OKJA 4IFVA 4DF4A 1ZQZA 3T5HA 3MABA 4TUSA 2Z1JA 1HNIA 2YV0X 5KT5A 4QZBA 4M3RA 7ICVA 5KFAA 4RNOA 4EBEA 4M6WA 4L8RB 1EXQA 4FK4A 3OYCA 1RPLA 5J0TA 1AROP 3NH2A 4Z6EA 4FJHA 3DRSA 1U04A 5KFUA 4HVJA 2HHXA 4KLQA 3GDXA 4DL2A 1TK0A 1U45A 2W9BB 2VA2A 4YMOA 1JL2A 2F8SA 2W42A 4KHSA 1ASUA 1X1PA 1VSEA 4YG2A 3KIOA 4DSFA 3VQPA 5DBCA 3CG7A 3K2PA 5KFCA 3QINA 3OYIA 2XY6A 2J6TA 3HWTA 5DDYA 1S0MA 4ECVA 2Y1IA 1HQUA 4DTUA 5KFSA 1VRUA 2IDOA 4YXJA 3T5JA 2V9WA 2PI4A 8ICNA 2HNYA 3AVJA 2VG7A 2BKEA 4EYIB 5KG7A 1L3UA 3MEGA 4CF2A 4I2PA 4DS5A 1WSHA 4J2AA 2YHBA 4M3YA 3HP6A 1MQ2A 2BQRA 3MR6A 4F2RA 4MFAA 3MDCA 5HNKA 5J0OA 4M42A 4UAZA 4CJRA 4KLLA 5IIIA 4Y1CA 4CE9A 4W5NA 4B3OA 3LALA 4JUZA 3VQ5A 1LWFA 9ICHA 4DU3A 4LY7A 4CHPA 4NYFA 1ZQJA 1RNHA 4J9QA 5KFBA 4QWBA 1K1QA 2ATQA 4O0IA 3EYZA 4KLSA 9ICAA 1WAJA 3PW5A 3HYFA 1QLNA 1MU2A 3ZT0A 3RH4A 5KFEA 4HTUA 4W5RA 2O4GA 2PFPA 4J9RA 1S0OA 4KO0A 4F5QA 1ITGA 3VQAA 1WSIA 2RF2A 4AHUA 3OSNA 4CGJA 1BPXA 3AO3A 4PY5A 2AGOA 7ICRA 3LPTA 2Z1IA 9ICUA 1RBRA 4GC6A 4I2IA 4CIEA 3QEXA 4ED2A 2PZSA 2J6SA 8ICAA 4RUCA 1A77A 5KFQA 2AQ4A 7ICTA 2NRZA 2BQUA 3LDSA 4JRQA 4FZXC 4M04A 4K8ZA 5KI6A 3PO4A 7ICSA 3ZT3A 3GIMA 5L1JA 1ZQVA 3QO9A 1UA0A 5FRMA 1XU4A 3KHRA 4DFKA 4O44A 4ELVA 4LSNA 5CR0A 5KFDA 1NKCA 4PGQA 3LAKA 1NK9A 3T5KA 1S97A 3NGZA 5KRSA 2ZD1A 2BPCA 4J9NA 4CJLA 2ZTCA 3ZD8A 9ICMA 4BE1A 4Q44A 3PX4A 1TKTA 3UPQA 4OVLA 3VQ7A 4GXIA 5DQGA 1IKYA 3AUOA 4P4MA 4DSEA 4RW9A 4ZHRA 5KFXA 4MFCA 2VG5A 1ZJNA 4O9MA 5HHHA 4M2YA 4UAWA 5T7BA 1VSKA 1LB2B 3NF9A 5KGWA 3ISBA 3QLHA 3RMAA 4CHNA 4X5VA 4KTQA 2BCQA 4F50A 3KLFA 3K5MA 1YTUA 4KLGA 5J2PA 3M8PA 4FVMA 4PGXA 3PUFA 4ECUA 2E4LA 1I3AA 4QW9A 2OYQA 1GOAA 3ZSRA 3KJVA 1S76D 3JPQA 3MECA 2XC9A 1NK0A 3S3NA 3HW8A 2DPIA 4NXZA 1SKRA 3HPHA 4Z4FA 2UVWA 3PV8A 4QWCA 3DLGA 4TQRA 3NGYA 4AHTA 4HUEA 4OGCA 1C7YA 3SYZA 3GIKA 4CGIA 4M0AA 4DOAA 4HCCA 4IQVA 2F1IA 2FLNA 8ICQA 2J6UA 1I39A 1JXLA 1QE1A 3RRGA 1RT3A 3WNEA 4J9KA 7ICEA 4DTPA 3VQQA 1XSNA 3SUOA 2HHUA 9ICCA 2BGWA 2HNZA 3HO1A 2Z1GA 5D4BA 1A5XA 4C8OA 2JZBA 5J2CA 1ZQKA 5CYQA 5SWMA 4UQGA 2DFHA 3EY1A 1RXVA 3NHGA 3V6JA 4RPXA 4F4YA 3Q8LA 3GV8B 1ZQRA 3VQCA 4KLUA 5KFTA 1KFSA 4YD1A 2G8FA 2OZSA 3M8RA 3RMDA 3L2WA 4NY8A 4CCHA 3PNCA 5KG3A 4CEQA 4FJ8A 1TAUA 4KFBA 4RQ4A 4DFPA 3OYEA 1HPZA 5HRSA 7ICJA 4CIGA 3OYKA 5KRTA 3FYHA 1LV5A 3BDPA 4LH4A 4E89A 2BQ3A 1SL2A 2OPPA 4TQSA 4BDPA 4I28A 4JS4A 1N48A 3AO4A 1ZQPA 3AV9A 3V81A 1SKWA 3AA3A 3H40A 5HHIA 3K57A 2LSNA 4R65A 1ZETA 4DL3A 5HMMA 3DLKA 3P83D 4J9SA 1ASWA 3L8BA 4QZ8A 4LSLA 3MXIA 4XQ8A 1U48A 4CGDA 4YMMA 3C23A 4AHRA 4RQ5A 4KLFA 2G8UA 2A1RA 4LD0A 4ID1A 1RTJA 3TAEA 3AVCA 3RMCA 3V1OA 4XRHA 4CJWA 3Q8SB 4O3QA 5J2FA 4UB3A 3NBPA 4DTSA 2RPIA 1NK5A 2BPFA 4IQUA 1EX4A 4B9SA 2XRIA 2H5XA 2R7YA 4F3TA 1H38A 4ECSA 4YD2A 4E7JA 3LWLA 4FZYA 3RJFA 4NCBA 4FW2A 2F1JA 3DLRA 1Z26A 4F2SA 2X78A 4O3SA 2ALZA 3WNHA 8ICMA 4DTNA 5IIMA 3DLHA 3V6HA 1S1XA 4CFAA 1LAVA 4C8KA 9ICQA 3HVTA 3KKRA 4P4PA 4ED6A 3THVA 1VSFA 4PHAA 1O1WA 4PUOA 4Z6FA 2ZJAA 4FJJA 1S9FA 2NRVA 4M9JA 4MFFA 4P4OA 1XI1A 4QZHA 4B9NA 3KK2A 4M3WA 3V7JA 4I29A 4KLOA 8ICCA 2YKMA 1NJWA 3NAEA 4IG0A 4YQWA 4M3TA 9ICBA 2KQ2A 4GW6A 4DQPA 1IXRA 3RB3A 3RJIA 3NGDA 3RAXA 1TK8A 2FLPA 1B92A 5C5JA 4M3ZA 3G6XA 4Z4IA 4OGEA 4BWJA 2D0AA 3NH1A 3PX0A 9ICIA 1B22A 3ZDDA 5CZ1A 3N4MB 3HL8A 3PY8A 8ICIA 3ZSQA 5EWEA 3S9HA 4FJGA 1BI4B 4EZ6A 2FBYA 4DL6A 3SCXA 3HP9A 4OKEA 1ZQIA 5KFPA 5HP4A 2EHGA 5L1LA 5FROA 2OZMA 4PHPA 3NCIA 1RBTA 2QK9A 1YT3A 1JLQA 4FLUA 4J9MA 4E3SA 4KHYA 2KZZA 5DG8A 1UA1A 2C2RA 2ZUDA 2IC3A 3F9KA 3DRRA 1T05A 5KGXA 4QZEA 2G8VA 4CEFA 5J2IA 7ICGA 1ZQDA 2BR0A 2MAXA 3JPNA 2Q3SA 1S1WA 1ZQSA 4KHQA 4UBCA 1KTQA 2DFEA 5JUMA 2BCRA 4QZFA 1RTIA 2NRXA 4KN4A 3PO5A 5J2BA 3TABA 3K5NA 4W5OA 3P1GA 1XHZA 1JKHA 3QEWA 3V9ZA 2YHAA 2ATLA 5C42A 2B21A 3SI8A 1MQ3A 3BJYA 2D0BA 2D5RA 5KT7A 2HNDA 4BDZA 4CESA 4DL4A 1S6PA 5C25A 3MAQA 3CM6A 4RNNA 2QKKA 2QKBA 1RDAA 3ZT1A 1VRTA 3PX6A 4J9LA 1HQEA 4XUSA 3O4NA 2JEGA 1ZQOA 2AGQA 1LW2A 1WSFA 1LW0A 3Q8RB 3ZD9A 1FKPA 4QZCA 3UQ2A 8ICSA 4Z4HA 2GUIA 2P66A 4YCXA 3PW2A 3C5FA 1B9FA 4FJKA 1N5YA 1NKBA 4KHWA 3H4BA 4Q8FA 4E1NA 4FLZA 5J0XA 2P51A 4DF8A 4NLKA 4PPXA 4DLEA 3HSTB 1U47A 3RTVA 4QZIA 2AJQA 4IG3A 2YKNA 4IRKA 1IG9A
chains in the Genus database with same CATH superfamily
1RHQB 3RG6A 5LMUK 5K8OA 5DG7A 1Q9YA 4UATA 1RUSA 2NR0A 1ZBLA 1WWHA 1K44A 2BJ3A 3ZSOA 2LQ9A 1EETA 3ONQA 4ICLA 3F53A 1FFVA 2JC1A 2WAQC 1N62A 5GAGP 5AKZA 2RILA 4BC3A 2I5JA 1FFWB 1NDKA 3PEJA 4CFCA 3K59A 3N79A 4DX8H 4ZJQA 2EZZA 5KFYA 2UXBK 2NO5A 4CP5A 3S3OA 2XHWA 1B0TA 2BZ2A 2ROPA 3JYTB 3G87A 2RJZA 2RSQA 1N6QB 3PCOB 1HQ2A 3ORYA 1FWLA 3DEEA 3IHQB 5KAKA 2XZDB 1DEJA 4NYZA 4QR2A 4M9GA 3P45B 4OI4A 3W9JA 1FJGK 1TUUA 5K8PA 1JLBB 3O8MA 1BUXA 4OYAA 5DLFA 4LFBK 2ZUBA 3U3YA 2H4WB 2OM6A 3FGUA 3B4DA 2RRAA 2PFQA 1RCHA 2PT0A 5HO4A 4LR9A 4NMXA 2NRRA 3CQYA 2DY4A 5JTIA 4R79A 5GADI 8ICKA 2HF4A 3ISNC 5D0EA 4FJ5A 1EHWA 3AAQA 1IKYB 4D3HA 1ZBHA 2E2NA 1PK1B 1IBMK 4CI0B 4UF4A 3ZC4A 3UXNA 4LF7K 2MU2A 2W1BA 1JROA 3UN5A 1UAXA 3K75D 4B9LA 4BGDA 3M30A 1SQEA 2ES6A 8ICRA 2GTDA 3SUNA 2ZH3A 3A3PB 3CC4N 2DR6A 2F4VJ 2LCWA 3MEKA 3GJRB 2RUSA 3SQ0A 4ZPBA 2QFJA 2MZSA 2JEFA 4BWMA 1P6TA 4DMNA 1WSEA 4KN7A 1WHYA 1XR7A 4JKAA 3KVGA 1L7MA 1T9UA 2NPFA 4N47A 3GZFA 4M6WB 4I2JA 1O5JA 2MSTA 5AHXA 4ECTA 3ZTOA 4OI1A 2DUYA 4FJLA 2VWKA 4DPUA 5DQIA 3SQ4A 2BMBA 4TY8A 4M5DA 2LXFA 5B8HA 2GV9A 4FNHA 1MWZA 3NF8A 4TN2A 3CIZA 1KLNA 1UJ5A 1TMMA 4CO5A 1MLAA 3CXCM 8AT1B 1XNQF 4LBIA 3DXMB 4H4KC 3LDQA 4CECA 1LXJA 1OH8A 4F92B 3NS6A 4NLOA 4NZ0A 3CF5L 1SXEA 3F44A 3KNAA 1DQ9A 2YX7A 2HBMA 3UQ0A 3CERA 5AQOA 3PMLA 4LR7A 2Y0SC 4YN4A 1WF2A 2C1EB 1A6LA 3RGIA 3B82A 5KAIU 1X4AA 2Q79A 3RW6A 3MM5B 2VASA 1G99A 4K42A 4LBHA 2MTLA 1FDAA 4ICLB 1TUWA 2WVFA 4DXLA 4AXJA 1D9AA 1XJWB 2NUBA 3W60A 2VFTA 5D15A 1RT5A 1RT1A 2K60A 4CLLA 1HYSA 4K5RA 5AQMA 3V7KA 2Q0ZX 5J0YA 3M2RB 1TV9A 3K89A 2A5XA 2PAVA 3VEZA 5EVZA 4Y2MA 3VA3A 2V7ZA 1BVSA 3RJKA 2RHKA 4H5TA 4CLYA 1QM9A 1IKXA 4M9LA 3KWIA 3D2EA 4BC5A 5KG2A 2V94A 8ATCB 4FPAA 1AQ6A 1COKA 2MQNA 2Y8YA 3QZ7A 1WAFA 4W5QA 5CYMB 3VEXA 5KNIA 2MKJA 2X1BA 4ZVGA 4PG7A 2EFQA 1VK8A 1H98A 2RVJA 3VQ4A 3QIPB 2V51B 3TJAA 4BR0A 3ZDEA 4JKDA 4YNQA 2FJ6A 1KDHA 1F1BB 2CAJA 2CNLB 4MO5A 4KO0B 1QSSA 5J2QA 3AVAA 2M2BA 5HR7A 1U6FA 3QU9A 4O8UA 1VI7A 2KSOB 5KPRA 3NTUA 3ILOA 5HLFA 3C16A 4ZITA 1ELOA 5F8GA 2ASMA 2RUGA 4M5GA 3SUQA 3I5AA 2R42A 1V3RA 3PFOA 1ROFA 3SEOA 2LQJA 5FD1A 2QL5B 9ICRA 3GDQA 2UUCK 1HJPA 3D6FB 3C2PA 3D3CJ 4R63A 3VQ8A 5IC4B 4KREA 2EI5A 4PJ0U 1WEXA 4FK2A 3EZUA 3IRXB 4JI7J 1X4CA 2E8PA 2GBZA 1KEKA 3P5JA 1FRJA 4JMUA 2ZTEA 3OVAA 3C66A 4B6JA 1Q81T 2QT7A 4F25A 3DFEA 1KKXA 1MSWD 4B9QA 3TWHA 4HUGA 3M5RA 2KSOA 1IVZA 3BN4A 1EAYC 2WB4A 3EL2A 3VAJA 2K89A 1RYRA 2R8KA 3KHHA 1B70B 4Y2SA 2B9WA 2GQQA 3MPUB 1VQ5N 3BYRA 3LZIA 2ZM6K 2FSKA 5DS7A 5KFWA 3O5TB 4UT4A 4GKKF 4IJNA 3VEOA 5E26A 2PI5A 2IMWP 1R8CA 1NHVA 4X2BA 1DLOA 4ETXA 4P10A 4ECQA 2RE1A 1PO6A 1SL0A 3B6BA 5AI5A 3UR3C 4YFUA 1C0TB 4UARA 1Z00B 2YNFA 2HFOA 1D1UA 3I8DA 4A8YA 1IV0A 3A3OB 1HKAA 3HVRA 4YR3A 4AL7A 2MKYA 3THYA 1VQ8N 4WFBL 4US9A 4UBBA 5J0UA 4BACA 1VK0A 2AYMA 4BBYA 3O4WA 4HEA9 5BYSA 3J81O 1TL5A 1Y3KA 2EZXA 5CP2A 2Q0UA 3KJQB 3NGKA 4NI2A 3QZ8A 1BPZA 2W2MP 1VSMA 1HMVB 4ZIVA 4PR6A 2HQ3A 3FZHA 4ZPCA 2FF6A 1XR6A 2ZKTA 2A0FB 4NLZA 4USTA 3OYBA 4ED7A 1Y11A 3R1XA 3GV5B 1JLFA 3KKAC 2E5LF 3VAFA 5ALEA 5ALIA 3GWCA 2HQCA 2K3KA 1LWCA 3F2KA 4DTXA 1DGKN 2O67A 3TEHB 1U2VA 4OPAA 4M41A 4G6VB 3CNQP 1SC6A 1S1VA 3QICA 3H8WA 2IBKA 1IWAA 2QE5A 2DTUA 2ZJ8A 3OHAA 3HCXA 1H0HB 5DK5A 4NLGA 4RT3A 1BHLA 4CERA 3O3LA 3FZFA 1R8BA 4A8OA 3MR2A 2CPXA 4J90A 8ICYA 1X5OA 3BGRB 4ZN1A 1DRGA 2LKZA 5DETA 4JI5J 5BR8F 1T9VA 3LH2S 2BJEA 4YY3F 1FFSB 2WBNA 1NOYA 3UE2A 3I0RB 3D2WA 4FF1A 2D0CA 3IAM9 1PILA 3L4BC 3HJEA 2NCKL 1QHTA 1RT6B 1PAUB 5IQ6A 1HNWF 2D3UA 3ULEB 3NVYA 1CEZA 4BRQA 5DMRA 4OZ1A 2WOMA 4L3KA 4LFAK 5BOMA 2QN6B 4TYAA 4RNMA 1WN7A 1TV6A 5KFIA 1ZQUA 2CJ9A 4NA2A 3LO3A 3N6LA 2YPYA 2Q6BA 3A5LC 2A1JA 2AEMA 2QGFB 3EGWB 2MGZA 4FWMA 2DFLA 3W0LA 1Q7LB 3W3SA 3IBCB 5J0PA 1JLCB 2KH9A 5HJXA 4CJPA 2HURA 1QHAA 3RBDA 3OY9A 1IN0A 2KV2A 1G15A 4IOCL 3H25A 2ISOA 4BXOB 5ALGA 1C0GA 2POKA 4B1YB 4F4WA 1SKUB 1H7XA 3QERA 2GVZA 5GVQA 2UUCJ 4NA1A 2OPQB 4QCLA 2BW2A 3UD3P 2OELA 1Z05A 2VF3A 3U3GA 1XC9A 3SEIA 3GE9A 1VQKS 3NCQA 3AQOA 1IH7A 2MY7A 2VICA 3NVMA 3TSQA 3IG5A 2E1AA 1NMDA 2W7AA 5EE0A 1BDGA 3ET6A 1R6YA 5ALKA 4M5KA 4LVNP 2KM8B 1CXQA 3FEXB 4FZNA 2C22A 2HZAA 2E6LA 1VHIA 1EP4B 4LF4F 1WKKA 1V6HA 1ED1A 2AYGA 2BCVA 3OT9A 4FM1A 4ZCLA 4DTJA 5AKJA 3PACA 7FD1A 1EQ0A 2JFDA 4KLTA 4OYZA 3SPYA 4XIUA 2KHCA 1YBTA 1RYSA 5IIJA 3SJJA 3UMGA 2QW9A 2XMAA 1YUWA 3H8JA 5EOZA 2YNGB 1FCAA 4EWTA 4MMOA 3H2UB 1BNPA 1R7IA 4RQ6A 3D9BA 3MWTA 1L5UA 5KFKA 3GV7B 4NLRA 4P0QA 3OFEA 1NK4A 2GGPB 1F2HA 2EX3A 3AY0A 4MDBA 4KH4A 3KLIA 5I42A 3R6MA 3ALRA 1SL1A 2E1PA 1A6SA 4ZLJA 1B43A 3GILA 4MEYA 1RBVA 2ZBPA 4B1VA 9ICJA 4WTYA 4K25A 3GR1A 1UVKA 2V8HA 2O8EA 4CJQA 2A41A 3U6FA 5G5GA 2ADCA 5HMXA 1M1HA 1UWBA 1QZ5A 4XEIA 3TO8A 3QQCD 5IT9U 2E6MA 2DWQA 1KEJA 1X4FA 4RW8B 1B9DA 5C24B 1S9GB 4B3MJ 1HWKA 2WF7A 2YNIA 2Z0GA 1ZBIA 4J7CA 2LFVA 3WXLA 2EZYA 4HDGA 5EWGA 3PYGA 3BKFA 3A0IX 9ICPA 1D9DA 4C1NI 4RUAA 2DKZA 1IJEB 4OJOA 1HI8A 3I1YA 1CJVB 3CJ0A 2W4CA 1SUQA 9ICXA 4NEZA 1GNKA 2DK2A 3N6MA 4CGHA 4YP3A 4DQSA 3ULEA 5BXIA 4AL6A 4Y0FA 2EG1A 3K5LA 3KZIU 3FZMA 1TV6B 3TVZA 4QS8A 3KDOA 2O8EB 2A1JB 1EKEA 5L1IA 1KVBA 4H8KA 3AVHA 1Q9XA 1KVCA 1LKZA 4MK8A 3JTOA 2Q1NA 4B3TJ 3D0PA 3G6YA 2OCEA 4CF9A 1IBLK 2D3DA 3ZTQA 5KG5A 4BR2A 4CFDA 4BRLA 3MC1A 2FLOA 3Q8UA 3ELHA 3OL6A 3GBTA 5HRPA 1VISA 3HFZB 3D5MA 3PW7A 1QAJA 4ANDA 4FBUA 3VAGA 1ZXIA 3LOUA 4ZCMA 3OLAA 5IWAF 5AQUA 2DKOB 2L5YA 1ZPWX 1RHKB 3MGVA 4UASA 2HLTA 4C3MA 3M2VA 3QGGA 1R6VA 2PMWA 2X1AA 1F2GA 3KD3A 3PTWA 1KFTA 1HYVA 2XGQA 2VPZB 3CO9A 3GJTB 3M6WA 4EP4A 2VDHA 1FTRA 3M8SA 2MLYA 2JOQA 1WJ9A 1NKEA 5JU5A 8ICTA 1EP4A 9ICVA 2RQKA 2BOPA 3RB0A 3PSFA 4CZFA 4FLXA 1FX2A 1SJQA 4KLMA 2F8MA 4WTOB 1MROA 3LW5C 3KFWX 2WONA 4F5NA 1KBUA 2XMVA 8ICWA 3RBZA 3RWUA 5M1KA 2PDAA 2OANA 2X6NA 2IS3A 4NLQA 3K9KA 4W92B 4CJVA 1Q7YO 4DV2J 5MLCV 2RHQB 1DURA 3OYLA 2MSSA 1KVIA 3R5JB 2IVMA 2DGVA 4ECZA 3WKBA 1Y64A 1J53A 3QAUA 1KTVA 3UE5A 3D54A 2KG5A 3Q8KA 2JV3A 5DDPC 3SENA 1IXKA 1LCUA 3LDLA 2KOBA 3DDIA 1N33K 2XNRA 1NGJA 2JVOA 2N4CA 3CFRA 4DFJA 1RADB 3SZ2A 3CI5A 2D0OA 1N36K 2CGJA 3MR3A 4ZA1A 2ATCB 2X3DA 4M5LA 4WK3A 1HKCA 2VODA 3NNHA 1SAZA 4HT5A 1KP6A 1PAEX 2NSBA 4BC4A 2LEBA 2JHDA 1PYSB 3NOCA 3GL1A 4H5WA 3AVBA 2NYVA 4KLDA 5AZJA 1HUOA 4YY3J 3M30B 4U7CA 1WKLA 2CQCA 3W7BA 1S72S 5K5MA 1F21A 2DFFA 4CO4A 1N0UA 3VF6A 4CW7B 2JJ4D 9ICOA 5F9LA 3BSOA 3S6EA 3CJQA 1JLEA 5J1EA 2K7JA 3OYFA 3VZHA 4KKOA 4DR7K 3BN7A 1H2TZ 3U9ZA 2L9WA 2MA1A 4RO0A 5AIAA 1KLMB 5HVFA 4CBWA 1XMOF 4PXCA 3MF5A 4UY85 4M63A 3CJCA 4KHNA 3KKAA 1KRPA 1NSKL 1HR0K 5IIOA 2ZWHA 3MBYA 3LTOA 5E33A 4RNFA 4HHTA 3LAMA 3GFKB 1SBRA 5SZTA 2BCSA 2K1RB 4FM0A 3IAYA 2JFKA 1ZAWA 2P9LB 3MFHA 4FXWA 1ZA2B 2CDQA 2R7XA 4FXDA 2IVYA 3PM9A 2XQCA 4LFBJ 4RW4A 2PYLA 3V9XA 3R5AA 2G0AA 4G1QA 5ALRA 3ENVA 1ZBTA 2XI2A 4YOUA 1RKJA 1YIJS 4QZAA 4Z7YA 1MN8A 2HPUA 2FHJA 3D1HA 4B1WB 2Z2LA 1JLGA 1D8YA 3TA0A 3MMBB 4RQ7A 1FJGF 5G4DA 2K4PA 1UAWA 4FO6A 3OYHA 1KFDA 3DNCA 1HUZA 2B51A 2VG6A 1WF1A 1BIUA 1QQ5A 2E1FA 3VESA 2EG2A 3L4PA 3DRSB 1NHUA 3BS9A 4NXNJ 2D8CA 4HH0A 2YMPA 3AODA 4ITSA 1ZBFA 3HFVA 1WWUA 1S99A 1H6KX 4OHVA 7ICOA 1TUVA 1W2IA 4GO5X 1C0FA 1LXNA 2QXFA 4EHTA 4LZDA 5D3GA 1KAYA 1VLYA 2VANA 3J7ZO 2JRSA 4X4QA 2MJNA 4LZGA 4FZMA 1F3VA 5AT1B 1B4FA 4ACOA 2E1ZA 2WF6A 2IGIA 5EY4A 2MDAA 3JSBA 1K0TA 3N9UC 4LF2A 3J7AN 4BRDA 4DS4A 3O9RA 4C0OC 4DV5J 1Q78A 3MMAA 4FJXA 2G0CA 4JI5K 4NLVA 3AVIA 3LPEA 1REGX 4FWQA 3OXLA 3FSXA 1CLQA 1IO2A 1WG8A 5ALTA 3M1VA 2ZTDA 2IYGA 4A8KA 2OSRA 4R64A 3AM9A 3MEDA 3HSCA 1VSDA 2ASDA 3AO5A 4PRFA 5FDLA 4AM7A 3VGUA 5HQLA 3JS9A 4CEZA 3NBPB 3OUYA 3QLHB 3KJVB 4Z94A 1IV8A 3TVYA 1PJ5A 1RAJA 4P74A 3MD1A 3PRBA 2V2VA 3KLFB 2VHGA 1W2BM 4JI5F 3ZFVA 2E5HA 4ED8A 1TVRA 4F93B 4TLRA 5KFOA 1BQMA 2HBKA 3ETLA 3E66A 3IN5A 1Q1KA 4CJSA 4DKWA 3NF7A 2BANB 3KK3A 3RH6A 5ALDA 1IM6A 2MKIA 1KQSR 3IRXA 3MM6A 1PJ7A 1N5QA 2ADBA 2XEXA 5JXSA 1NZBA 1ASVA 5J29A 2M3DA 4CLPA 4A8FA 3Q7CA 2IAJA 2VQEK 5AK3A 1RDFA 4J9VA 2NQPA 1ZQXA 3TACB 1TVAA 1XWLA 3DDNA 3QUCA 2I38A 2ZNYA 5DM6Q 2AEJA 1WC4A 3MWBA 4O3RA 1X5TA 1RTDB 4O3PA 2R7OA 2YNHA 1TL3B 2KJ5A 2CN1A 4JI8K 2E2QA 4WJBA 1VQMS 3WIUA 5AQZA 2V2KA 3C6UB 5HQMA 1IBKK 4ZVEA 3GMGA 4EEYA 2DGQA 3O44A 5FIIA 5AXNA 3NEKA 1YVNA 4YMNA 3HX0A 2O8FA 1AUDA 1NZAA 2NXUA 5DBBA 1Y5LB 1BHNA 5M2UA 1M1GA 3A12A 3T5LA 1JNRB 4H0PA 4I6YA 3I0SB 3WXKA 3EEQA 3D45A 4YN3B 2UXBJ 3UKUB 3VAHA 2O8CB 4M5MA 2K3IA 3Q83A 1S1TA 2ASLA 1HQUB 3C94A 1PC5A 3UNYA 3V81B 2MZRA 3BDEA 3QMQA 2UUAK 4IFVA 2GH1A 2CQ0A 1HNIA 2YV0X 7ICVA 4O5FA 4EBEA 2E2PA 4M5NA 1JRPA 2CPHA 4CNZA 1K8KA 5LJVA 4L8RB 1RAEB 5J0TA 1HHTP 3RRKA 5ITHA 3VAIA 2X3GA 3Q23A 4DFDA 1U04A 1UFWA 4WP3A 4ILRA 4HVJA 2IJNA 2HHXA 2Y1RI 1U45A 2NXEA 4I67A 1JL2A 1PBUA 3UPFA 4WU3A 3SFUA 4FXVA 3PFEA 1WOSA 3DOKB 3IWLA 3BB5A 2KKZA 4GKJK 2KIVA 1IBMJ 2ZWOA 4WFAL 2XY6A 4OYXA 4YOWA 3FSIA 1YKWA 1M6YA 4KMOB 4MIWA 1YJTA 2PEHA 3UW1A 2DEJA 1HQUA 5GAEI 4DTUA 2RQ5A 1VRUA 3UDVA 3M6GA 3T5JA 2YI1A 2V9WA 2PI4A 4W98A 4EYIB 2J0SD 4JN4A 5JVHQ 4DR2K 2ZJQL 1SH2A 2EK1A 1RLDA 1ZOTA 2ZBRA 3LUYA 1CS4B 1RDWX 3C7NA 2QLBB 4J2AA 4OJGA 4HTJA 2QM1A 1Q53A 5AQHA 2WMMA 1J2NA 2RU3A 2BRLA 5HNKA 1U24A 2FJBB 3I32A 4UAZA 4ZCKA 1HQEB 5IIIA 4DBQA 1WOQA 4CE9A 1HBUA 2HVEA 3LALA 4JUZA 4I1TA 1HX1A 3VQ5A 2Z56B 1LWFA 2YWHA 3QPIA 1K73O 2KVIA 4CZEA 1O13A 3NS5A 1NGDA 4O0IA 4IG3B 3IAS9 3O9UA 5J2NB 1QLNA 3EJMA 2BE2B 4ZP9A 3RH4A 2G2ZA 3P8BB 2O4GA 1GT8A 4KO0A 2RQMA 1ITGA 1DXSA 2YMQA 3WXMB 2P9NB 4AHUA 4CGJA 2BX6A 2AGOA 3HJVA 1S1UB 1KS2A 5AM0A 7ICRA 9ICUA 3K5PA 1U1RA 2LP4A 7FDRA 4GC6A 4I0WA 3X1LB 1L8OA 4F26A 3QEXA 1UW9A 4YB5A 2J6SA 1IJFB 4XTTA 5ETVA 4BG9A 7ICTA 4WCEQ 2R7VA 4WFNL 2EWHA 2VGNA 2BQUA 3UQSA 5HROB 1FFGB 1VLBA 1VQNN 4LQ9A 2IHR1 1YI2S 1X9JA 3O1LA 4FZXC 5CEHA 3KUGA 1PBAA 3U8XA 2ZIUA 5KI6A 4NCGB 4NPOA 7ICSA 1BLUA 4QOTA 1TKZB 4X4NA 2BUNA 5FRMA 3OTOK 1J5EK 1QTNB 2BXJA 4ELVA 4LSNA 4TYBA 1JNZB 2E66A 3SMPA 5KFDA 1NKCA 2Q66A 4NRUA 3T5KA 1V4SA 2ZD1A 2V4JA 4WFYA 3LM2A 4C4WA 4BE1A 2D1KA 3PX4A 1TKTA 3UPQA 1D0EA 3N01A 4HI1A 4DR1K 1TKXB 3VQ7A 2FTRA 5B0CA 5DQGA 1IKYA 4H03B 1HBOA 3MDFA 3HBTA 4DSEA 2GAHC 4EI2A 3W2VB 2W24A 4IO8A 1ZJNA 4O9MA 2HFNA 3NF9A 3PLAA 1X42A 3THWB 1OJ4A 1XBWA 2IFXA 3HHEA 2BCQA 1VRTB 3SSRA 4PGXA 2ZVSA 2MY8A 4ECUA 1ZOLA 1I3AA 4QW9A 1X4GA 3ZSRA 1EWRA 5EHHA 2XC9A 4WFXA 1SQGA 2NPIA 1OKJA 1SKRA 2Y9TA 4Z4FA 2F8LA 3AD9C 2E5LK 4FKXA 4Y00A 2IMOA 2J4RA 3DXKA 2KM8C 4JYAK 4DOAA 2F40A 4HCCA 5ALFA 5ETKA 4DV5F 2J76E 2O8BA 1V3SA 2N3OA 2VIHA 1HFEL 2EW9A 3CEDA 4M5DB 1OW5A 4BQZA 1TAMA 1DZ5A 5FLXY 1VQLN 3M6XA 3KMQA 4EIAA 1VBXA 1E6VB 5A2QO 2J0QD 2DFHA 4JK8A 3C65A 1VQMN 4A8SA 2HQDA 4CZKA 1ZQRA 3NRWA 2HSZA 3IMQJ 1KFSA 2KIWA 3W2WA 2G8FA 3RMDA 3L2WA 2BJ1A 4NY8A 1E6YA 1JB0C 3CCQS 3OYEA 4JOUA 3H7HB 3ZTRA 1BA1A 4NB4A 3DRYA 3OYKA 3J7ZT 1S7HA 1N33F 3QFPA 1PJ6A 2QARA 2O8BB 2AMCB 4TQSA 4I28A 3WXIA 5A0YB 1N48A 2WC9A 3AA3A 2G5HB 1RT5B 4M7XA 3NMAA 3NP5A 2DBYA 2LSNA 1T03B 3FFIB 1X31C 4LFBF 4DL3A 3DLKA 2CUYA 4C4TA 2D3OR 1F0XA 4U7BA 2HVZA 2W01A 1GMVA 2CYYA 3MM8A 3EVMA 3MXIA 2UUBK 4AHRA 3C23A 5JVGL 4KLFA 1HBNA 1URRA 2DY9A 4LD0A 3GYGA 1PYTA 1RTJA 3TAEA 3AVCA 3BGUA 2VWBA 4LFCJ 1MWYA 1FE0A 2FIUA 4KR0B 4MO4A 3QFHA 2GIFA 4YHHF 1EX4A 4B9SA 2XRIA 5AR0A 3KLVA 1RHMB 1MG7A 2R7YA 4HVZA 2BTFA 2QARB 3AT1B 1WHVA 1MA7A 5D6GA 3OR1B 1FE4A 1VQON 2FJEB 4WYWA 4A47A 1C20A 3CPWR 1Z26A 4F2SA 4O3SA 3WK7A 4KH6A 1W26A 2W04A 4DTNA 1DFDA 3VGKA 2N82B 3I6PA 3P96A 3N0VA 3NNAA 3MM8B 3HVTA 3QFWA 2HK2A 5ETMA 2A6AA 1T0TV 3K0SA 1VSFA 1AZSA 2AEFA 4FYWB 2YX1A 4I2QB 5IQQA 1UW4A 1S9FA 2NRVA 1KXPA 1UVJA 4BRGA 1XI1A 4BX9C 2E5SA 4KB7A 3W9IA 3TW0A 2OTJN 1IKWB 3WKCA 2ZOFA 1SS6A 4IG0A 1RB0A 1P8ZA 2KQ2A 4OZ3A 4DQPA 1IXRA 1LOUA 1OSCA 4AFFA 2L3MA 3Q89A 4Z4IA 3FBEA 1NDPA 2E8OA 3G71S 3GE1A 1EJ7L 2QB0A 1B22A 3HL8A 1HWJA 3SBMA 4CNYA 3LVWA 3VENA 5BR8J 1GK8A 3RAMA 1ZPVA 3HP9A 2WK4A 1CJTB 1ZQIA 1XMOK 1LEOA 2OFHX 5FROA 1QQOA 3AARA 3TADC 4E3SA 2KZZA 1NB7A 3RSEA 1FA0A 2BE7D 2LMIA 3DRRA 5JRTA 2KB2A 4ID5B 1T05A 3PRDA 5KGXA 2ALYB 3GYXB 3L7UA 4IG0B 4CEFA 4RR5A 5CD4H 4XH5A 5M2RA 1ZQDA 3VALA 2BR0A 4LFCF 2HAIA 4CLTA 1A0PA 3TX0A 2MAXA 2KHVA 5E84A 1S1WA 4DQ8A 1QH9A 3MUMP 2DFEA 1KVJA 5AFUA 4YOVA 4QZFA 1HR0J 1RTIA 2NRXA 4X4PA 5J2BA 3CCUN 3IGNA 1O51A 4DG1B 3SQGA 3TUIC 1XNQJ 2KK0A 2ATLA 2B21A 3FBFA 2ZIXB 3ULHA 4IZ9A 3I5BA 5KT7A 2HNDA 1XR5A 2QL9B 2IM1A 2V8GA 3CDEA 1NCLA 3D1OA 3W65A 4YHHJ 1OYEA 3FQKA 1YGYA 4XUSA 3KZXA 5AE1A 1LW2A 2AGQA 1E3MA 4JI1K 3Q8RB 5DRKA 2P35A 3UQ2A 5KOXA 1N34K 3H3OB 2QZ8A 4JB8B 5M1NA 1N5YA 4KHWA 3H4BA 4Q8FA 4MKYA 2P51A 4AYBF 4DF8A 1RBAA 3FKBA 3HRGA 3QNWB 5AZJB 1WC0A 4MJKA 1U47A 3RTVA 1FD8A 4QZIA 2AJQA 3CJ4A 2PE8A 3WK6A 2V0NA 2C3PA 1UQVA 4IRKA 1IG9A 3M2UB 4URQU 1YJUA 5CCMA 2LXUA 2FJXA 3I0RA 3HK2A 4CGFA 2P9IA 2YB1A 3OJSA 3CO0P 1GAOA 2GWKA 4KMUA 4JWNA 3QBCA 2MQLA 3OV7A 3GU0A 4C9DA 3S1TA 2LBOA 2QXLA 3AA2A 2FPHX 3TFRA 3BO2A 4RQ8A 3IM8A 4CZGA 2NUUG 1WCNA 4O55A 4XK8C 1WSJA 2OEJA 4OI6A 4K8RA 2I1QA 1Y0HA 4ZLLA 3Q8YA 3MCMA 1U1OA 5JLHA 3QEAZ 4JD2B 4MT1A 2V8DA 1P9YA 1HRHA 3EWAA 9ICLA 3MN7A 3MGHA 3OBWA 3LP0A 2WONB 1QD1A 4AH9A 3CMEN 1T7PA 4I69A 2HDOA 5BPMA 4CF8A 8RUCA 2WVDA 3K8WA 2MZTA 3IM1A 3TZZA 4PKIA 3TANA 3A8JA 3ZZOA 4NWIA 4DV3J 3PRVA 2R7TA 5ALJA 1YG0A 3NFAA 1QZ6A 2C3YA 2VC0A 2AX1A 5LOQA 2OTLN 3SV4A 1X0FA 4E7LA 1FRIA 3B6PA 4B9MA 5CZXA 4CIFA 3MEGB 1VJ5A 4ES1A 2VQFJ 4J91A 5GMEA 2XWXA 2FPMA 3NRBA 2X1GA 3MR7A 1WF0A 4DV0J 1HBMB 2BHNA 2BEFA 5AXLA 4BE2A 4PXEA 2CPRA 1T05B 4BUGA 1ULRA 4Y2CA 3SI6A 1S48A 4CZCA 1OPZA 4JKHA 2UUTA 4CLFA 1I51B 2FJDB 4M45A 4PQUA 4C7ZA 1KR4A 5IINA 3DLJA 4DUYJ 2QWMA 4JNEA 1GLAG 3QDKA 4JI2F 1MU2B 3HDSA 1OPIA 3R2DJ 2W54A 1P27B 2Y8WA 3IGVA 1ZM3A 4YR0A 4RW7A 4I27A 2PD1A 2M8DB 4GVLA 3SBTA 3KFUF 4KLIA 4X4OA 5D49A 1NJXA 2P9CA 4CGZA 3M8YA 3MUTP 3VGTA 1GLJO 1WOOA 4OJ3A 1FNOA 3E3XA 2C42A 1UPHA 4DR6F 4MYUA 2GJ2A 1RAAB 4PG8A 5CHIA 2OP5A 1K9MT 3EE3A 1BG3A 1LW2B 2YTUA 1UWBB 2JH7A 2YY6A 4C23A 4LJXA 5ALOA 4USWA 4MK7A 4DV6J 4KPCA 1H2UX 3G96A 3M32A 2DPJA 2GVDB 3PMNA 3GIRA 1N5YB 2KZ3A 1NZPA 5K8NA 2FVPA 4PWDA 4M5JA 3M8WA 3DGVA 4IRDA 4EGLA 4ZKAA 4MAKA 3VGSA 4F3OA 3V9SA 4CHZA 1T8EA 2LEPA 1FVSA 3GFYA 4B9TA 1URNA 4H0XB 1KL9A 2RNEA 3CCLS 1SJ3P 1HNXJ 1U1NA 2P9IB 4KGKA 4XDCA 2PMZF 5SUHA 3O3FA 1X6IA 2B8QA 1VQSA 2EANA 4PHEA 5CWRA 2WRMA 3WQTA 4PWWA 3C2LA 3DI6B 1TL4A 4AL5A 1WTBA 2RB7A 4I2HA 4NL9A 3NG8A 3UCZP 1BPDA 1ZQYA 4WBFA 3C21A 3F2BA 5RUBA 4LF9J 5BPNA 4CWBA 1RTDA 4L3QA 1WG5A 2V50A 4FLYA 5KFGA 5AQLA 2Z58B 3LP2A 2XBPA 3CCSS 2W9AA 4ECXA 3LP1B 3MFIA 1YI2N 2BBEA 4F5OA 1WSRA 1MMNA 2WZ1A 3OQ2A 4DR4J 2P9SB 4DQRA 1UP1A 2W2QP 2DNGA 1QSYA 1NGFA 2GJFA 4Q8EA 3ETOA 4O5CA 1SV5A 3UDCA 4DSLA 4B3MF 3IWXA 5K14B 2WCXA 3UNGC 3KHYA 3CJ3A 5AE2A 1WNSA 5ETLA 2FVQA 2F2AB 4FO0A 2CGKA 1LWXA 2H5JB 1S1UA 3B0YA 3MEDB 3SCIE 1T4GA 2QSFA 3PG9A 2EFNA 4OZ0A 1CSJA 1J6ZA 2V4RA 3WXJA 4BR5A 2V8PA 2F7VA 1NLVA 1BPYA 3AXMA 2E7VA 4FF2A 4CI6A 5KT4A 2OIHA 1T3VA 2AJ1A 3SDEB 1NXIA 2OMLA 3RR8A 4MF8A 2XY7A 5A0LA 1UFLA 4TU9A 3V5RA 4Y2TA 2KKPA 2AU0A 3OYNA 4GV9A 2ACMA 3K5OA 3WDOA 2ZH1A 2JX2A 3GB0A 2CADA 8ICBA 3BO4A 5EE1A 3WK8A 5I3UA 1D4XA 1H74A 2WHEA 3GFXA 1K73T 1EWQA 5AKIA 2CH5A 2NRTA 4C1NK 1UVLA 2ZXHA 1IR0A 1J9AA 1D8LA 3QE9Y 4CHYA 3EICA 2ZD1B 2OXOA 2I5HA 5ELZA 1RLCL 5FLXU 5KT2A 1XEZA 2CXYA 3KJFB 4K2JA 4BR9A 2HIYA 2FPKA 2D41A 3OS1A 3AVFA 4CHQA 2H3IA 4KRWA 1RDCA 3GJSB 1NLKL 1N5VA 3J7A1 4FPRA 4FJNA 1Z1ZA 3C6UA 4YVZA 1ZQHA 5D4OA 3VA0A 4AUKA 1NOZA 2CVEA 4F91B 3H59A 2HHTA 3GP9A 5HRRA 2E9RX 2XHCA 4HUFA 1U49A 3VZIA 1W0HA 1N8RT 4UAUA 2J9DA 1ACMB 3HZEA 1Q46A 3R97A 3V6DB 4FYXB 1VFJA 3D6JA 1OQ3A 2KO1A 5DDOC 2DRDA 2W6LA 2EDUA 4DTOA 1WEYA 3M9NB 1C0UA 4Y3CA 2JR5A 4FWRA 2W9CA 4DV0F 1S1TB 1NBEB 3AQPA 1TK5A 3C1ZA 4OPKA 4GY2B 2D9PA 1ATRA 4WK1A 1LAWA 2XNQA 3VV2B 3V4IA 2DKXA 1WLJA 4DU8A 3T9ZA 9ICFA 3CE8A 2GWSA 1KSPA 3A5OC 4ELTA 2GAGC 4KITB 1NJIT 1S8OA 4Y65A 8ICUA 2KKHA 5L39A 3W1YC 1Q86T 3NWRA 3CDUA 4AF1A 3GCXP 2E7XA 2EWSA 2VD3A 4ERDA 2E7WA 7ICFA 3NVVA 1ZM4A 4PL8A 6FDRA 1HYZA 5CRXA 2HEKA 4ZLPA 4DZ6A 3V6DA 3W2WB 4JKGB 1KVKA 2P9GA 4B3SJ 4DFMA 2YKMB 4WXOA 3TAQA 1B64A 4M47A 5JVHL 5K14A 4IO9L 1WBBA 1ECWA 4DWIA 3O3HA 1CZ9A 5A8KA 1M90T 2QKQA 3W9HA 4KPYA 5D4NA 4I9LA 1JLGB 5AKXA 1GLDG 5AKEA 4GXKA 2ERRA 2E5LJ 3BPSP 4LF7F 1KQKA 1C4CA 2VWJA 4DCHA 2H3EB 1LWEA 5LXRA 1U1MA 4DDFA 1OVQA 4YOXA 3G4SS 2HQGA 5ALSA 2EPIA 2NSCA 3ZZZA 3HZ6A 4USIA 3HI0A 3AMZA 1N61A 3WC2A 4IDKA 4BRCA 2H9ZA 4DU1A 3UCUP 3GIJA 4DOCA 2VBYA 1U1KA 4EP5A 4YHHK 3MX2A 3THWA 3T79A 3JB9k 1S3XA 2E5JA 3SAFA 4X66J 2AX0A 2YWEA 2HWIA 4DLGA 1NGGA 2OPRB 2FC0A 3TTCA 4H4MA 4OQJA 3KXDA 4GVBB 4NXNF 2OTJS 4QR1A 3DOLA 3H20A 3O08A 5ALQA 2MQPA 4OI2A 3ZT4A 1XMOJ 5JLFA 3O9TA 3ONNA 1Y5IB 4CIOA 4DR3J 1RQ0A 1U0SA 4CD3A 4Z6CA 1DTTA 4ZVOB 1HNIB 5LJ5Y 4BRPA 1FRXA 3PIOQ 2L9NA 4FCYA 2UV8G 4Q5VA 4OHWA 4ALZA 3MOJB 5K4LA 3R5BA 1F5SA 4KJIA 2LM4A 1HW8A 4CK2A 4HI2A 3O1BA 1JN3A 3H8MA 2MQ8A 3IFEA 4OO1J 1DK2A 2A2DA 1Q95G 3FRZA 4CH7A 3UIQA 1Y88A 3H5UA 4OI0A 2YWWA 3SMZA 3DOKA 1H1VA 1CZAN 3AA8A 3TR5A 2ASPA 5GADU 4CJTA 5GAGU 2KLAA 2F96A 1GLEG 3QEVA 1R31A 2V4JB 1TP7A 5J0RA 2CIMA 3MPWA 4DV3K 1R0AB 2BM0A 5LT5A 1RQLA 4RW9B 2B9XA 1WCLA 3EMTA 3OFGA 4OL8A 2FPLA 1PSDA 3C7NB 3UDLA 3V9UA 2HBZB 1T3QA 2HHQA 4C8NA 3F2CA 4F4XA 1RE1B 1U2RA 1R8AA 4RW6B 3V2UC 5J8YC 1Q5YA 4ZHRB 5L46A 4Y2JA 2ZJPL 1JLQB 2KT5A 2FC8A 2VH7A 1G7CB 4RPZA 5CAAA 3OTBA 3OHBA 1Q86O 1XC3A 4W5TA 1OQ6A 4IKFA 1G6BA 1UEVA 5CA7A 5KG1A 5J2NA 3UKUA 2G8IA 1SXDA 3DRXA 1E4GT 4AHSA 1WEZA 2K8BB 1XMQJ 3O6QA 3R8YA 2LPEA 2Z7JA 2MPUA 2FGOA 1RCXB 3DDKA 1XUPO 1L3KA 4PG4A 2Z2YB 2KHDA 4EENA 1RTIB 2RU9A 2YNGA 3D66A 2CZ4A 1HUXA 3G0ZA 3BGLA 1UT5A 4NWBA 1N36F 1GOBA 4Y2XA 4RW6A 1TUGB 3NNCA 4CYUA 4C7QA 5CHGA 4I2BA 5IM0B 2CJQA 3MHYA 3T1HF 4DPTA 4YDUC 1T11A 1RWOB 4E8UA 4B9UA 1YZ6A 5AK5A 4CF0A 2W9BA 1AFJA 2E1EA 1NNEA 2AZ3A 4AQYF 5JS1A 1Y3JA 2UXDF 4R8UA 4DTMA 4YR2A 3DOLB 2PFNA 4H5VA 4OX8A 4DR4K 3O9SA 2XI9A 3C6TB 2E9ZA 4JHDA 2RDJA 3L3VA 3U1MA 1FIQA 1TKTB 3QX7A 1NSPA 3MMCA 2HOQA 3VF4A 2W2PP 2W6KA 1CS4A 1XIQA 7ICHA 2P5OA 4ZPWR 2JLGA 4PA1A 4A57A 3VETA 5AJ3K 2AGPA 1Z1BA 3B0XA 4XH4A 3M8QB 2O1PA 3C19A 2R9LA 4UAYA 1RBOB 2IM2A 2H51B 4R0JA 4CYUB 3BR9A 3CPWM 3PKYA 2CJXB 1SC3B 3EDRB 2RQCA 9ICTA 1RA6A 1S9EB 4O3OA 3HHLC 3BSCA 1WDDA 1ZQGA 3RJEA 3Q8PB 3QBWA 3ET6B 2R7WA 2ZHOA 3EZWA 2UVVA 2KYXA 1U2VB 2VJVA 3DRPA 1Q7YT 5C7PA 3AVNA 4N56A 1RG6A 4MTPA 3CCJS 2KT2A 4CHOA 5IWAK 3F41A 3QU5A 4DJBA 1HD1A 2BJ8A 2FLLA 3HM8A 4HL9A 4O0JA 2MKHA 2OI2A 3HT0A 1UOCA 1JKHB 1TL1A 4FJ9A 2KZMA 5ALLA 1PG5B 4KT0C 4BROA 3DM2B 3BGRA 1URJA 3G71N 4I4BA 2LDYA 4K4IA 2HB5A 4BG8A 3AVMA 3GZ7A 3BF3A 5KFHA 4CFBA 3Q8MA 2PXIA 5HROA 5LJWA 2EAMA 2EBEA 1NJYA 2IJRA 4ILLA 1R0CB 4KV8A 3MD3A 3ZEUB 3D67A 3I87A 1RT2B 1HKBA 1C6VA 3OBYA 1TKZA 4ECYA 2IIRA 1AA1B 1Z2ZA 1K1SA 1HBMA 1X9WA 2W8KA 1C0TA 4ZTFA 2DEIA 4DV7K 4IFYB 1F60B 4PXDA 2ZGZA 2RRBA 2DR9A 1ZH5A 4DR5K 2A42A 5A8RB 4X84A 1X40A 4BS2A 2E88A 2ZVIA 2KYZA 1UEKA 3QNNA 4BXOA 2BABA 5LSLA 3OXGA 3BQ7A 5KG6A 3O5BA 2XO7A 1JXBA 3R5GA 3KLHA 1CRXA 3FFIA 2PEBA 4H0YB 4JI3K 3B6OA 2G8HA 3RVCA 3QT5A 5E41A 3KG1A 2W8LA 2OPQA 4RQ2A 3G6ES 4PH5A 4UB5A 3AA4A 4ENOA 2RRNA 1SKSA 3IA0A 1XQIA 2DH7A 4CH0S 3NS1A 3R9PA 1D5AA 2KN4A 1LWCB 3S41A 2CGLA 3PJ9A 3CJ8A 3AY9A 2ZWPA 1ZS6A 3FSYA 4V19X 5IT0A 4PGYA 2EH9A 2WTFA 4CVNE 8ICGA 4CO2A 3F56A 5TKYA 4CK3A 3KK1B 5KFNA 3PJWA 4QS9A 3VGVA 2AW0A 3GPAA 3R7NB 4ES2A 5KT3A 2QO3A 4A59A 2VFUA 3QEBZ 2HMIB 1NSQA 5B7WA 2CPYA 2A18A 3OR1A 4PABA 3AEVA 3PIPQ 1HNVA 3CT9A 5ETTA 3ICLA 3QT8A 4JKEA 5KFVA 1FKAF 5CY4A 3W64A 1S59A 2BACA 3PHTA 2DHGA 1E6VA 8ICJA 4TNOA 2FBTA 2QLWA 5KG0A 2BPGA 4YMEA 2OJ3A 3HOSA 4PL1A 7ICMA 3K0JA 1S9EA 1RT4B 1VQ9N 4DR3K 1SJ1A 4RBTA 1ZQNA 2YHWA 2C2MB 4JI8F 1HWIA 4E7KA 3U9DA 1QQMA 2XMMA 3IRWP 3QIOA 4DQIA 3C14B 3EPGA 1QCKA 2MGZB 4Z7CA 2B4VA 2EFOA 3LGHA 4WZQA 3UDEA 2MKCA 4DUZF 4CBXA 2AJ2A 1QS4A 3RFAA 1NAQA 3L2RA 4FLWA 3CIMA 2WVCA 1FO4A 4WFBQ 4N8NA 3SNNA 3BQ2A 3Q8QB 3K1ZA 4M3UA 2VPYB 4DOBA 3ZETA 3MI7X 5G0RB 3N7RC 1N56A 4NXMJ 4RW7B 3ZSXA 2YH1A 5LMNF 4J2EA 1RDDA 1DTQA 4HAIA 5DB6A 4PG6A 4GMJB 3WNFA 2H65B 3CCVS 1VDVA 4Q0BB 3QETA 3OYDA 1RT4A 2HCFA 5E79U 4Z0UA 3OVSA 4DZDA 4B3TF 2FVCA 2E1YA 1JCEA 2P9PB 2NNWA 5HMLA 3TAPA 1CC8A 3RSEB 3VCDA 3C14A 4BGAA 3B8HA 3B9JA 3QSYB 3KHGA 1D3WA 3SR6A 3ATVA 4FJIA 2IRUA 7ICNA 1AUSL 2H5EA 4LR8A 3D68A 3K8VA 1NM2A 3AHPA 1L7OA 4BRFA 4O23A 1SZPA 3C2KA 2FZCB 3FC4A 2YMMA 2C2EA 5LMNJ 3V4MA 5LJ3Y 2DHXA 2ZDOA 2UUAJ 4DEZA 5LSOA 3JYTA 4K41A 4NL9C 1F5CA 4LC9B 1N6QA 1SWWA 4EU0A 4XAKA 3AU6A 1EXNA 4XO0A 4B08A 5C2DA 5HATA 4DR4F 2DNOA 3VGLA 1XO0A 4I2AA 2M7SA 2PYJA 4DTRA 1V9OA 1N34J 2YVSA 2W3RA 3NWGA 1Q82T 4LF8K 2DNRA 3JPRA 4FNIA 3M2VB 4JK1A 1REVB 1EKRA 1WHWA 2A6OA 3B54A 3H8SA 3SSSA 5E3PA 2KXFA 2CJYB 2YX6A 1TL7A 1VQ5S 2EQYA 4KSEB 5J2JA 3G8SA 4QPTA 4FBTA 1BIZA 1Y5NB 4KQZA 2GQCA 2KFZA 3H2VE 2DNKA 2VJUA 2ASOA 4L76A 5EU7A 4O4GB 3RAQA 1ZM9A 4NLNA 2XCPA 2AWZA 4NOHA 2DHAA 4KFBB 2DTJA 2OWOA 3C1YA 1XNRJ 4A5AA 8ICHA 5LL6Z 2UVRA 1I94F 4MK9A 1LKYB 3JQMA 3FUYA 3I55S 1S5ZA 4NZ7A 3FQLA 1L6NA 3RUBL 2KVSA 3G86A 4RW4B 1ZQFA 3I8BA 3FDSA 2QYCA 1PC4A 1XN9A 4IJAA 4M95A 3ZDCA 3WKEA 4ED1A 3E01A 2P6RA 4OKJA 1RWKB 5CCLA 2RQ4A 4DF4A 1ZTWA 4QZBA 3UVJA 3IP4B 2FC9A 2M8HA 3D6TB 4RNOA 4M6WA 4A61A 3IR5B 1RPLA 1RTHB 1AROP 3NH2A 4LSLB 2ZBIA 3ILIA 3DRSA 5KFUA 2WAQD 4JI2K 3MXHP 2E9TA 1TK0A 2N7YA 4JV5F 1ZXOA 4YMOA 4JI3F 1E4FT 2W42A 4KHSA 2FSJA 5KAFU 1FO1A 1RCOB 4DSFA 2DCLA 1NNDA 5B0GA 2Q31A 3VQPA 2ZH5A 2QMXA 5DBCA 1FNMA 2ZM6F 3HHDA 2VFVA 3O0FA 5G0RA 1F3FA 4K4VA 1DAXA 1RJJA 3UMBA 2JNJA 3PIPL 1SC1B 2KRRA 3HWTA 5DDYA 3NGSA 4JKGA 4KH0B 2BVZA 1S0MA 1S7IA 3CCTA 4ECVA 2RH3A 1N63A 5ADZA 3E01B 1BQNB 4NLWA 4RWTA 3CVKA 1RGVA 3T6JA 3CPEA 2O8CA 3DHWC 8ICNA 2VG7A 4NL5A 3M6KA 1NNLA 2YKOA 1G1XA 3ZNUA 5KG7A 1L3UA 3P31A 3B4MA 4UAVA 2HFZA 5EOYA 3BR8A 4CF2A 4I2PA 4CZMA 1RHJB 3A13A 2XB2D 2CG8A 4F2RA 2BQRA 5HANA 4MFAA 5J0OA 3JAMO 2EAPA 3QBXA 4KLLA 4NXNK 2LA6A 4NXMK 3WBZA 4TKTA 1TR0A 3N5BA 4EAHD 4QIVA 4B3OA 1UZHA 3BKTA 1YJRA 3AGKA 4DU3A 2K1RA 2H3ZA 5BR9A 1ZQJA 5AQQA 3PKMA 4J9QA 5KFBA 5HAOA 3L3CA 2OSQA 3EYZA 2ATQA 3BS7A 9ICAA 1WAJA 2MZQA 4JEPA 2UU9J 1CQNA 4Y6IA 3T7ZA 2PFPA 1Q0NA 3NUQA 3VQAA 1BPXA 4U9RA 3EN9A 3QRPA 3LPTA 2Z1IA 2YKNB 1VRUB 3MMBA 4P73A 4BREA 5HL7L 5M2PA 2ZHBA 5AKLA 1Q82O 2ZIVB 2MZ1A 1Q79A 5IT9O 1BXNA 3BBFA 4K0KJ 1QUPA 2C3UA 4JKCA 4OZ2A 1ATSA 2GJIA 1JI7A 4MIAA 2NRZA 4FVUA 4BRMA 3BKUA 2VQFK 4JI6K 5L38A 4PQAA 4QYZK 4K8ZA 5B0DA 4PPZA 2B9YA 1IBCB 4K4WA 3DXMA 3ZT3A 3GIMA 5L1JA 1XQSC 3QO9A 4C8YA 2RS2A 5L1MA 1XU4A 3U1NA 1TYQB 1R27B 2DITA 2GNKA 1R3NA 2QC3A 2WB1C 2WSFC 3F5TA 1VHXA 4ZVFA 3I82A 1RA7A 3QUTA 1FDBA 1S97A 3NGZA 3HOTA 1WI6A 2BPCA 4OHYA 1RWWB 9ICMA 4Q44A 4G1IA 4OVLA 4MFBB 3I55N 1SZHA 4TVAB 3VR1A 3JXOA 3UI3A 3ZO7A 1AXQA 4P4MA 2ZJRQ 1X4HA 3VHQA 4RW9A 4MFCA 2VG5A 5E3QA 4DR2J 3GOIA 4M2YA 1VSKA 5KGWA 3QLHA 5AKGA 5HL7Q 4F50A 3KLFA 3K5MA 5AM1A 3M8PA 4YB6A 3PUFA 2Z2ZA 2OYQA 3EE8A 2VFRA 2YJFA 1S76D 3H3NO 3JPQA 3MECA 2JMGA 4NXZA 2G4BA 2DNLA 4G9ZA 2BM1A 2UVWA 3DLGA 1OVYA 4M5HA 1X3NA 3HFKA 1ICEB 2BW7A 2Z4PA 2XTJP 2MRLA 4HUEA 4OGCA 1C7YA 1WC3A 3CCUS 2UV8A 4M0AA 1P90A 3AAPA 4IQVA 2F1IA 3CTRA 2FLNA 2FUG9 2IAJB 4Y2YA 4H5RA 1QE1A 1RT3A 2HBJA 3FZBA 3SLCA 1L8LA 3CCZA 3CC2S 2NUHA 2AD9A 3TUJC 3R3TA 4FKYA 1TE2A 3BPDA 1S6UA 3D2QA 2W25A 1XSNA 3CMQA 2HHUA 4P7VA 2ZH8A 2BGWA 4BCAA 2HNZA 2I5JB 1Q81O 4OLOA 2Z1GA 2IOFA 3C16B 4C8OA 2JZBA 1ZQKA 1XNRK 1JJHA 1LK5A 4UQGA 2FD2A 4KH1B 2AYBA 3V6JA 2F8EX 3JSMB 5GAGI 3BBCA 2P9KB 2M5YA 2P2CB 3CGIA 2IYIA 3FBCA 4LRFA 2WF8A 2E8NA 1KQGB 4B1XB 4FWSA 3M8RA 1SC4B 3R7SB 3WX4A 2P6TA 3L3FX 4RQ4A 4WJ3B 1T9TA 5AJ3J 3N5FA 4Y2UA 5T14A 1FRMA 2CFXA 1R43A 4PL7A 4EFHA 3FYHA 3BDPA 3W5XA 4B1ZA 2BQ3A 3D6RA 2GQ2A 1SL2A 4NEYA 4BC9A 3KKFA 3E58A 2OPPA 4MKAA 3S01A 5AM3A 1U6ZA 2BJ7A 3MM7A 5D77A 4JS4A 3V81A 3POTB 3AV9A 3BM7A 2FDNA 1RXOB 2HWHA 3K57A 1VQ8S 4OX6A 2XULA 4R65A 1YDLA 2Q4TA 5HMMA 4IOAQ 3P83D 2D3ZA 4J9SA 1ASWA 1SZ2A 4WQ5C 3L8BA 3ENWA 3MAAA 3AB4B 3HKZF 3E0FA 3DYAB 2IVOA 2U2FA 5EDWA 3V1OA 4O4RA 2CQ2A 2CPEA 1FERA 4AT1B 1K0VA 4DTSA 3NGRA 4HACB 3H0LB 2QB1A 2RPIA 2M9KA 2BPFA 4CRXA 4RTFD 2FYXA 4WQ5A 3ZZYA 1C0UB 1JJ4A 2H5XA 3C6AA 3QT7A 3SAHA 1VBYA 1N4LA 4E7JA 3LWLA 4LREA 4FZYA 4X4TA 4FW2A 2FSNA 3DLRA 2ZC4A 2ZOMA 1JWWA 1IG6A 1BO5O 2GIRA 4ZPDA 4KHPJ 4U7UD 2OO4A 2ALZA 3WNHA 8ICMA 2W40A 4PWUA 2CH6A 1S1XA 4CFAA 4WZMA 4C8KA 1MW7A 1F9HA 3MAAB 4K4YA 3THVA 2CKWA 2B7CB 4GKJF 4MFFA 5FPEA 1WC1A 3WUHA 4IXCA 3BO3A 4GVEA 5E3CA 3CF5Q 4QZHA 5KOWA 3KK2A 2O8FB 3DCAA 3V7JA 3IKMA 5E7OB 5ADXH 1N33J 2FF3B 5JVGQ 5B0BA 8ICCA 5A2QU 5ALYA 1DY3A 2YKMA 1NJWA 3ZZRA 2LMRA 5F0WA 4P52A 3H0RB 1DK3A 3RB3A 1FJGJ 2EEYA 1TK8A 2FLPA 1B92A 4M3ZA 1MWKA 4OJLA 4ES3A 4OGEA 4ZCIA 2FHMA 4B17A 2EC2A 3C8YA 3PX0A 1YJ7A 2LU1A 3ZDDA 5CZ1A 2QA2A 4OZJA 3PY8A 2XYPB 4K50A 1OY9A 1O03A 5C25B 1NSAA 2H5IB 3A8YA 2B7BB 5CQGA 4OKEA 4C80A 1NGCA 5AI8A 2WTUA 1RTZA 2V8VA 2QL7B 2XMWA 3BH7B 4KHRA 2IRYA 3MAHA 5C10A 3MCNA 1JLQA 2FVSA 2FXUA 4KHYA 1X0PA 4K4TA 1UA1A 4H4MB 2ZUDA 5AI6A 5ALXA 1I94K 2QV6A 3F9KA 5MLCQ 2DT9A 2Q97A 2KJWA 3F2DA 4H0VB 4K4ZA 1GLLO 4I6MA 4GO7X 7ICGA 3GCWP 1DJ0A 3JPNA 2Q3SA 5AQPA 1ZQSA 2Z57B 2R7QA 4UBCA 2CPFA 3ADAC 5JUMA 2BCRA 1FXRA 1DTTB 2VPXB 3PO5A 1JJ2M 2JH3A 4HH1A 3K5NA 3P1GA 5GAEP 4CBUA 1JKHA 1RDRA 1TL1B 3QEWA 3PYDA 1XHZA 5C42A 3FGVA 1FJ7A 3BJYA 2AIRB 2D5RA 1WB9A 3R5CA 1HNXK 4DL4A 5F0UA 5A8WB 2WB1F 3CM6A 2B8PA 2QKBA 3W8GA 1T9WA 2YWKA 4B1UB 3CJKA 3M6ZA 1VRTA 4Q2LA 2HLUA 2JEGA 4NLPA 2VIXA 1WSFA 3TVKA 4U96A 2HWTA 1LW0A 4H5NA 3ZD9A 1FKPA 5IV4A 5C2FA 2ZUAA 3BZQA 4YCXA 4FJKA 3W63A 1U02A 2LECA 4E1NA 4IH7A 1F9EB 4XPCA 5IT9Y 3CCQN 3AGRA 3VVUA 5AICA 3OL7A 3IBPA 3J80O 5AM5A 1NMNA 1HNWJ 2DR5A 2E8MA 4IQMA 1YITN 2Y0BB 2QIFA 4FDFA 2GC8A 2D9OA 1OYDA 4A8WA 1HYSB 3HHLD 1VHFA 4F8RA 2R8HA 4YOTA 3ZETB 2HHPA 5IOLA 3C5GA 1YWXA 4HDHA 5IWAJ 3KKSA 1H73A 2OTLS 5CHCB 1S72N 5DGAA 4X62F 2GGPA 2A3JA 1IKXB 2DISA 2YB4A 2QWNA 4L72B 1BQXA 2HGMA 4W90B 3NGIA 2DVIA 3ZNJ1 3QT6A 2MEWA 2ROGA 4K43A 4NM2A 1RZTA 1A5VA 1X5PA 2F8TA 3M1FA 3LDPA 3DOMA 1B3TA 1VSLA 3AU2A 2HS3A 4OFZA 3CCMS 1ZAXA 3CYMA 4RQ0A 5F9NA 2QB0B 4E1MA 5J2GA 3ZDBA 2EC0A 1BGXT 2RKIB 2HVHA 3NAHA 4LVSA 4HLBA 2KXNB 4M94A 4S0MA 4ZPVR 4LRDA 4B9VA 1JXVA 1UKUA 3E2EA 3ETMA 3MN9A 5CE3A 2OGUA 3G8QA 4U8VA 5ETRA 4Z4GA 2X74A 4DX5A 3MEEA 3QUBA 1HNZJ 4LF1A 3JQJA 1YQHA 3EGNA 4K2XA 2ROEA 2HF3A 5KTQA 2UXDK 1ZQAA 3V1QA 2W3SA 2FQQB 2M52A 2XSFA 3FBBA 4C48A 4CE6A 4OLBA 2Z1HA 3MM9B 4ID5A 1NEEA 4B02A 7ICQA 3RB4A 4CNQA 5J2MA 5JJBA 4URGA 3T41A 4I6WA 3VAKA 4ATNA 2MHEA 3WNGA 3CFOA 3BS5A 5CABA 4YS2A 4QZDA 2HHWA 3N7PD 1SCJB 3SQ2A 2LXIA 1T3OA 4XDDA 5A6PA 1SGGA 2RKIA 1F44A 1VGYA 3SQGB 2G08A 2F63A 3AOAA 4Y2QA 1XNQK 5KFMA 1RISA 4KHPF 1GLBG 4NLBA 4FWNA 2ZF5O 2G2OA 2HHVA 3HVAA 4E7HA 1UL3A 2KD1A 4ETZA 3Q22A 1EX8A 3P39A 3V1RA 3ZLJA 1R8PA 1MA9B 1QQ6A 4GIBA 4DPWA 4UB1A 3OYAA 5DZ7A 1A7GE 4OZ5A 5C2CA 4R5PA 3IRUA 2DD8S 3UD5A 2FHOB 1ZQ1C 3IC1A 1SIJA 4M3XA 4QW8A 3PHEA 3GTYX 5F8IA 4FWLA 3PSTA 2ZE2B 3QB0A 3MK6A 5AFUH 5AKYA 3LYSA 2LYVA 5BPLA 2PMZC 4PL2A 2MKSA 1N5SA 4P6QA 4H4OB 1NWKA 1C4AA 3D28A 1Q8IA 4OYMA 1S79A 2KN7A 1HW9A 2B5JB 4DCOB 5EGYA 4ER8A 4AILC 2U1AA 3TARA 4Y2VA 1HA1A 4UTGA 1Z2LA 5DB9A 2K8CB 1SH3A 3H4DA 5LL6d 1T94A 3NKYA 2GEMA 1GXTA 1KAZA 5ETNA 3OJUA 4LF4K 2DGZA 4Y2IA 1CJKB 2BGGA 3TR8A 3WU2U 4KBIA 2F4FA 3C6TA 3M32B 4C11A 2PY5A 1R59O 2ETJA 2LYHA 3K9JA 7ICLA 2ABYA 2QTDA 5FRNA 4ZJLA 4OLAA 2UUBF 1SB6A 3TFSA 3C95A 3JAMU 4UOHA 2V5HG 3TTFA 4OIXA 1KHVA 2PFFB 1M5KC 4BC2A 2AYEA 2VONA 1N5TA 3A8IA 3KDNA 4NO7A 3ZZTA 4NJ8A 1KCFA 4JI1J 3O2IA 4UQTA 3MMAB 5HJYA 1ZQBA 1ZD2P 2I6XA 2YQ3A 2HFUA 1CUKA 5L9NA 1UVIA 4F4KA 2OD4A 3IR6B 4YXMA 4DL7A 1YAGA 2AKWB 4Z4CA 3MM9A 3EGZA 4F7VA 3WKAA 1GTEA 4Y28C 4JI0J 9ICEA 3WHIA 2PN6A 1NPRA 1OO0B 3BS5B