2KOBA

Solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
b'RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR structure of CLOLEP_01837 (fragment 61-160) from Clostridium leptum. Northeast Structural Genomics Consortium Target QlR8A
rcsb
source organism Clostridium leptum dsm 753
molecule tags Structural genomics, unknown function
total genus 34
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kobA01
1Q3VA 1KBUA 1XO0A 1DRGA 2KJ8A 2KHQA 1PVQA 2A3VA 1CRXA 1NZBA 3MGVA 2HOFA 1P7DA 2KJ9A 2KIWA 2OXOA 2KEYA 4CRXA 3CRXA 1XNSA 4ACOA 3LYSA 3C28A 1Z19A 2KD1A 2HOIA 2KOBA 1OUQA 3C29A 1F44A 1Z1BA 2KKVA 4A8EA 1PVPA 2KHVA 5CRXA 2KKPA 1PVRA 1MA7A 2CRXA 1A0PA 3NRWA 2KJ5A 1Q3UA
chains in the Genus database with same CATH superfamily
2JXJA 4PHPA 5AM0A 3H7IA 4PL1A 2R8KA 4I2AA 1SKSA 1UQVA 4QZAA 4BXOB 2LM1A 3HKZF 2HBJA 2EZZA 4YG2A 4GXJA 5C5JA 5ALFA 2WF8A 8ICUA 9ICFA 4UQGA 5ALOA 1NZBA 3BS5B 4DSLA 4M9JA 3QUBA 5AM4A 7ICRA 3D2NA 2AXTU 4OJ6A 4UW9A 3AN1A 4QWBA 5KFRA 4P0QB 4KLJA 4U6PA 1T3QA 1CEZA 1ZQRA 1DRGA 1T4GA 2W7PA 1D9FA 3QNMA 2GO7A 2L5YA 4ED7A 1XS9D 4DLGA 1QLNA 4WJ3B 2A1AA 3DDHA 4BJQA 5J0PA 4JWMA 3C28A 9ICTA 3Q8RB 1PK1A 2OEHA 2LPEA 3PO5A 1Z1BA 3QU9A 3BQ2A 1CI4A 2G5IB 3HKZC 2DKXA 2CPRA 5JTIA 2DPIA 3SEIA 1XU4A 1NJWA 3AMZA 4F50A 4JV0A 2KFZA 3EPGA 2EAOA 1COOA 3LWMA 2BPCA 4US8A 2K4PA 2BDUA 8ICXA 3IRUA 5AK6A 4IC9A 1SL0A 5TZVA 2XCAA 3KHGA 4Y2RA 3ZDAA 4IRDA 2Z7JA 3RH5A 1N5WA 4YXMA 4I28A 3NRWA 1Z00A 4C4TA 3ZDDA 5KFOA 3PW0A 1V85A 4AYBC 1ZQCA 3BZCA 3BS7A 1RXVA 2BGWA 5J0UA 8ICCA 2G06A 4ECSA 4O3NA 2KIVA 5CR0A 4R65A 2E8PA 3SENA 3SAHA 5AI8A 2JEJA 3F53A 1ZD3A 2YMMA 3HW8A 3PSIA 4DFMA 1ZQXA 5J0XA 4DQRA 3NVWA 5ALSA 5J2JA 2E8MA 3LYSA 3Q8LA 4CF3A 4UB3A 7ICTA 3PSFA 4J9OA 2BQRA 5F3XB 3UXOA 2AGQA 2C28A 4KLQA 3C1YA 1NI3A 5HNKA 3L4PA 2R8GA 1UA1A 1ZQQA 9ICLA 3UMBA 1N56A 1X9SA 4O5EA 1ZRNA 1L7NA 1QSSA 4R63A 4Z6CA 2R8JA 1COKA 3KZIU 2ZJAA 1B0XA 4ED8A 1SWVA 1KRPA 2KSOB 3VCBA 4NLKA 1IIPA 2K8AA 1J2MA 2KKVA 4GFJA 1IG6A 2KV2A 1KQQA 3JPOA 2RLTA 2HSZA 1MA7A 4M0AA 3QUQA 4C8KA 1XSPA 4QW9A 3T5HA 2YB4A 2ZIWA 2PFQA 2YTUA 1MC8A 4QZCA 4CDGA 2ESEA 2HOIA 2BR0A 3RJEA 4O3PA 1X40A 5J2DA 7ICFA 4QWDA 1ZQEA 3ZDCA 2E1FA 5KFYA 3E0FA 3BJYA 4Q8EA 2ZTEA 2XY6A 2D8CA 3Q8MA 2ES6A 1BPXA 4TUSA 3LK9A 5G5HA 5J0QA 3WK7A 3H8MA 5J2BA 3RB3A 2BQUA 4UBBA 5AK4A 1ZRMA 5KAIU 5F9NA 2ASDA 3H0RB 4NLNA 2KNJA 1BPDA 2YMLA 5KFTA 4BWJA 2K60A 1J97A 4J9NA 3HX0A 3UXPA 4R64A 3G6YA 3SD7A 1ZQUA 4YN4A 1ECWA 3SMVA 3ICXA 5E79U 3D2SA 5AKEA 4FFDA 3QU2A 4O9MA 4R8UB 4ECRA 1X9WA 4PGQA 3V7LA 3E58A 5DDYA 3WK6A 1JRPA 1L3UA 4KLFA 3EYZA 4K4GA 7ICJA 4NV0A 4RPZA 2FMSA 1H38A 2E8NA 9ICOA 1Z19A 3SR6A 2HDOA 3CYMA 5DB6A 5KFLA 1V9PA 1KFSA 4BX9C 5KG3A 3ZDEA 2XVTA 4Y2VA 3GV8B 1Q46A 4JB3A 4GC6A 4J9KA 2FLLA 3OTQA 4ECVA 1TAUA 4RT2A 1YZ6A 3HP6A 2AHOB 4JV2A 5ALLA 1SXEA 2J6UA 2UVWA 4F4WA 3RF9A 4ED1A 5JUMA 1X6JA 2IBKA 1X42A 2KMDA 5AI0A 2E3TA 1RZTA 5AKJA 2EZXA 2OM6A 4IR9A 9ICXA 4F4XA 3TARA 2IHNA 1NK5A 1D8LA 2HBKA 3H4BA 4ELTA 3KHRA 3GQCA 3RJKA 3NVVA 3RRGA 2JH1A 4NWIA 5FP0A 3M9OB 4KLGA 1L7PA 2ZUBA 1O08A 1A76A 1S10A 2W9MA 4O0IA 2V4RA 4OJ5A 1S77D 4KN7A 3SZ2A 4BGDA 4KLSA 4B9SA 1TAQA 9ICUA 5DDMA 3UQ0A 3B0XA 8ICPA 1KTQA 2PI5A 2VA8A 2F1JA 3SAFA 2W11A 5KG0A 2NRVA 3NRZA 5CRXA 2H3VA 3KD3A 4I29A 3T79A 2BCQA 5BOLA 3THVA 1NOMA 1ZD4A 3UMCA 5ALNA 4P4MA 3QEAZ 4CRXA 3OSPA 2F8KA 4I2GA 4RQ7A 3ORYA 2VJ5A 3F2DA 3AUOA 2KZZA 1SZHA 2ZIUA 1JN3A 5DB8A 2AU0A 2YX8A 1SZPA 4NLBA 3WU2U 2FPMA 4F4YA 4USAA 1ZQJA 2ZTCA 5BOMA 4ED3A 1NK8A 1S9FA 4YP3A 4PHDA 5EWEA 2EQYA 3GILA 3GDXA 2MUTA 3T5KA 3T3FA 4RQ6A 2W8LA 3I1YA 3JPPA 2W9BB 4P0PB 4OJOA 4YR0A 4LZDA 1BPZA 2ZG6A 2K8CB 5DB7A 3MGIA 2LM4A 2ZIVA 1SV4A 2KICA 4EBDA 4F71A 1S0OA 1L7MA 4Y2QA 4I2JA 3DEEA 3IP4B 2DF4B 2W7OA 4J9PA 1QQ6A 5L1JA 2FI1A 5AM3A 2FDRA 2IOHA 1VJ5A 3NS1A 2XI9A 7ICPA 2ZXIA 5CP2A 5AK5A 3SV3A 1UCVA 5KFPA 5AKIA 2V4QA 3PW2A 4QJFB 2F77X 1NNLA 4YMMA 4F92B 5K4LA 1XO0A 3ZDBA 1PVQA 8ICSA 1NJYA 2WFAA 5D49A 1L5UA 4DQIA 1KDHA 4F8RA 4B9LA 1TAMA 5IILA 3MC1A 2WTFA 2DQNB 3OHAA 3QX7A 3MABA 4EZ9A 5ALQA 2JRZA 4F4KA 1URJA 3RJFA 3IG5A 8ICIA 2EANA 5KFVA 3TFSA 1JXLA 4BUGA 4UASA 2A1JA 5EWGA 4DL3A 4XA5A 5CEHA 2JEIA 3PV8A 2GH1A 2QKQA 4Y2XA 3G6VA 5J2AA 2WF5A 4M9LA 4B9TA 4I2BA 3NUQA 5KT5A 4O3SA 4Q43A 2F76X 3TAPA 1WCNA 2EAMA 4GIBA 1ZQHA 2KG5A 4MF2A 3IHQB 3ONNA 1DOQA 4HAIA 5KG1A 2JMGA 1ZQTA 1N2XA 4Y2YA 4NY8A 4QZDA 2XC9A 3SV4A 2AQ4A 2KJ8A 2W43A 5G5GA 2DKZA 5CHGA 4FBUA 4M6WA 5KT3A 8ICZA 2E1EA 1ZQLA 2ZXHA 2JHDA 4RUCA 3RJGA 2BDPA 1ZQOA 2QB0A 2KZ3A 2DBYA 4NJ8A 5HMLA 4DLEA 2HMXA 4UAUA 4Y2UA 5J0WA 1F44A 2ZUDA 2FLPA 2ASJA 1NK7A 3KOOA 1ZOLA 4FBTA 5HHHA 5AKZA 3MFHA 2XGPA 1Q3VA 4UB2A 5IIKA 5HHIA 3SYZA 1FIQA 5TISU 3Q8QB 2IOFK 3Q8PB 9ICNA 1BPBA 4GXKA 5HR6A 4RQ8A 2HW3A 1IXRA 1N60A 4QWCA 3J81j 1DGJA 2F3NA 2MA1A 3WKCA 5IIMA 8ICFA 4TUPA 2K89A 4DOCA 3NGDA 4Y2PA 1HUOA 4AYBF 3TADA 2C2DA 3WKBA 2UVUA 4TURA 5EWFA 1SXDA 2RQ5A 2LYBA 1NJXA 1DK3A 3N7RC 2WF7A 9ICGA 4CE6A 4DL6A 4DSIA 4YD2A 4PJ0U 2W8KA 4X5VA 1QSLA 3Q8KA 4Z6FA 5AM1A 8ICYA 3FM9A 2KP7A 1BNPA 3WK4A 2LYHA 3JPSA 3LWLA 4PGXA 3H8SA 5KT6A 2NRWA 5KFSA 1LKYB 4UB5A 3QE9Y 3FDSA 3GFKB 3GV7B 4KN4A 2VA3A 4F5RA 3MFIA 2H3QA 1ZYQA 1IM4A 8ICOA 1EXNA 8ICTA 3V7KA 3PVXA 3RB6A 5DKWA 3PR4A 1XSNA 1FFVA 1ZQPA 2ODGA 4C7YA 1PK1B 3TFRA 4DQPA 5ALXA 9ICWA 9ICIA 1XNSA 3ISBA 5IIJA 3V6JA 2R18A 1WUDA 4J9RA 1JIHA 3MR2A 2W9CA 1N62A 2G08A 1KKXA 3TADC 3BQ1A 4ECQA 4TQSA 2CRXA 4XUSA 3KFUF 2J6SA 4KLTA 1RQNA 2H5XA 3CNHA 4EENA 3N97B 4C8LA 4O3OA 3KBBA 2JZBA 1X9MA 4FZLA 5AICA 4M9HA 1S0MA 4EBEA 2JEFA 2B0CA 1Z00B 8ICEA 1X6IA 5KG5A 2BPGA 1D8BA 1NK9A 1YZ7A 3N4MB 3UMGA 4B9UA 3C5FA 1DGSA 5KFKA 4AP9A 3A0HU 5ALPA 4DL7A 2EZYA 4C7ZA 7ICEA 2O6KA 5ALTA 3WKEA 4O3MA 3L5KA 4DOAA 4P2HA 4FZMA 4F5QA 2BQ3A 3IN5A 4C4RA 2E5SA 4FE3A 1WWUA 3B0YA 4ECUA 3G6XA 5IIIA 1MN8A 2CXYA 4F5OA 2YN4A 3JPTA 2F1HA 3V6KA 2IA6A 2UVVA 3JPQA 4ELUA 4KX5A 2MRLA 1KL9A 3U26A 1HIWA 3QXGA 1PVRA 5ALVA 3OSNA 3V7JA 5KFWA 5J29A 1SWWA 3PSTA 2NO5A 4RZRA 3KTQA 1HJPA 3D2QA 4E0DA 2KIWA 3RR7A 2BZFA 1DXSA 5AKYA 5KFEA 2ALZA 4IS7A 2HBLA 2BCUA 5KFAA 1QH9A 4IRKA 4YMNA 5L1MA 5KNIA 3C2KA 5J0OA 4G9BA 4ECTA 2ZIWB 2D6FC 2F1IA 9ICEA 4KTQA 4ED2A 1XC9A 4PPXA 5ALIA 2PXIA 4DCCA 2FMPA 4I2EA 1SL2A 4I2DA 1V38A 4NLZA 3DV9A 2AGPA 1V97A 3M1YA 5KAFU 1MQ2A 2RDJA 1U47A 4PZOA 1O03A 4F3OA 2LMRA 4P4PA 2JH7A 4QWAA 1Z4OA 4RQ5A 4NL9C 3ISCA 3M7DA 3H40A 3EPIA 2EH9A 2W3SA 5KFIA 1NKCA 4YQWA 3M8SA 5DQGA 9ICSA 2NV3A 5DBCA 5KFNA 5ALDA 2G09A 3JPNA 2DL0A 1M6YA 1Y88A 4YD1A 9ICKA 3OHBA 1RXWA 4P4OA 2HHWA 3GIKA 7ICHA 4FZNA 4EEYA 5EE0A 2CN1A 1XSLA 1BGXT 1CUKA 3GU3A 5L1LA 1HUZA 7ICKA 4DSFA 3OJSA 1UHUA 2KOBA 4RNOA 3PY8A 1TK8A 3M8RA 2F44A 3IM1A 2KN7A 1WYGA 3HT3A 3RH6A 1A77A 5L1KA 4Z6EA 3AL0B 5AKXA 4IQWA 2FMQA 2HHTA 2KK0A 1HEKA 4EYIB 5AI4A 2NRXA 2FPLA 4JWNA 3EWAA 2HVIA 1WWVA 3BQ0A 4KLMA 4IRCA 1PK3A 1T3NA 2XICA 1ZQAA 5DQIA 1NK6A 3C29A 3QYPA 5KFGA 4MFFA 3HRDD 4B6JA 1WG8A 4QZFA 1MSWD 2K4EA 4QZHA 5DG8A 1NKEA 4G3IA 3GV5B 4KLHA 2Y0SC 3MR3A 2H3ZA 2RP5A 3PR5B 7ICNA 4O5KA 2OCEA 5EE1A 2EDUA 4J9SA 9ICCA 2W04A 1K1SA 4EELA 3GZFA 3LDAA 2QARA 2HHXA 5CWRA 4TUQA 5J0SA 4RNNA 2HVHA 3V6HA 1A0PA 3KKAA 3IDWA 8ICNA 1PZNA 5ALRA 4C0ZA 5KFHA 5KG2A 2W9AA 3LVWA 5L1IA 3CRXA 2DFLA 5KFQA 5DBBA 1T94A 1TVAA 4QZEA 1VLBA 1LV5A 2PI4A 2GWSA 2LBOA 5J0RA 2FPKA 4YR3A 1XO1A 4U7CA 3SQIA 2WHEA 1GO3F 2ZIXA 1TV9A 2JV3A 2HHVA 1ZD2P 2V9WA 5GTHU 2QB1A 2I9GA 2M0NA 4RT3A 4DQQA 5ALHA 3JPRA 3RBDA 4B9MA 1ZQ1C 3OPXA 5AKLA 3C1ZA 2KKPA 3T5LA 2MSNA 4C8MA 4C4SA 1FEZA 4LJXA 5DG9A 4CF4A 2P66A 2ZTDA 2Y1JA 4EYHB 1IV8A 1SIJA 3QU7A 4CNQA 5J2KA 4DFPA 2WAQF 2ZIUB 5J2CA 8ICQA 4RQNA 4QZ9A 3AQEA 3TANA 9ICQA 4A8EA 2BPFA 2LKYA 5AKKA 4EX6A 3KKAC 2YQEA 5ALJA 3QEBZ 3HPOA 1RYSA 1F0MA 3SI8A 2MUTB 2Y9TA 2NO4A 5D46A 3MDCA 1TFRA 2ZUCA 4I2HA 5ALKA 1LVHA 4UB6U 4DFDA 3H0MB 2ZIVB 1S76D 4KMUA 4C8NA 1SL1A 3PO4A 1T7PA 3ED5A 1B4FA 1LB2B 3IV6A 1QSYA 2F2AB 3ALRA 3EZ5A 5KFJA 3MDAA 3M9NB 2KD1A 4F93B 2D3DA 1BPYA 2KTQA 2WAQC 1J2NA 4M2YA 4ECXA 3GIJA 4JV1A 2AH5A 3MBYA 3WK5A 2IHMA 4J9LA 3BDPA 4HYKA 4LVSA 1L8LA 4Q45A 3GIIA 2K4IA 4PZNA 4BWMA 4QZIA 1U49A 1ZJMA 4US9A 1A6SA 3M9MB 3I76A 2ZJ5A 1RG6A 1NJZA 5J8YC 8ICBA 1U9LA 4Q8FA 4DWIA 4Y2SA 2KJ5A 1ZQSA 4MHVA 3AU6A 4FO6A 5ALMA 1Q8KA 2A1JB 2P6RA 1F5SA 5JRTA 8ICAA 3F2BA 2VANA 3HILA 8ICMA 5CJ7A 1Z4NA 1TK5A 4F91B 4BXOA 3KHHA 9ICRA 3A0BU 4DSKA 3CP8A 3RR8A 4ECWA 1UA0A 1JROA 2FJ6A 2VA2A 1X9XA 2XO7A 1NK0A 5HR7A 4RQ2A 2W03A 2RHFA 7ICMA 2G0AA 5J2GA 4F4ZA 4RQ1A 8ICHA 2Y1IA 2DWQA 1UT8A 3BS5A 1BVSA 1KEJA 2LYAA 1TK0A 2XY7A 1Z1VA 4XQ8A 4DF8A 3UPQA 4F2RA 4RQ0A 2G5HB 1Q3UA 4M6WB 2MAXA 3GIMA 2XGQA 4P0QA 3WKAA 3S6JA 9ICPA 2ASLA 5AM5A 5DGBA 3TAQA 1NZPA 2F8LA 4J9QA 2N1RA 4K4HA 1N5XA 2QB0B 7ICGA 3H8WA 8ICWA 4MEXA 4KLOA 9ICAA 1U45A 3B9JA 4DL4A 3RJIA 4DS4A 1PUZA 3F5AA 4OCZA 2A3VA 5KL1B 1CRXA 2BCRA 4QIWF 4JK1A 1LKYA 3TQ1A 2HI0A 4ECYA 5HP4A 1OUQA 5KL8B 5GTIU 4IL6U 1RM6C 4ZH4A 4RPXA 1ZQVA 4M47A 2KVCA 5ALYA 2AQ0A 4C8OA 3H8JA 4OJPA 2G07A 3KHLA 1FO4A 9ICHA 5CB1A 3PX6A 4NLGA 1JMSA 5ALUA 5AM2A 5AIBA 4I27A 3D6JA 3VC8A 2HHQA 1RQLA 1ZJNA 2W3RA 5AKHA 3ZD9A 4F5NA 4EBCA 2I1QA 2KFNA 4PHEA 1DK2A 3RBEA 3UM9A 1N48A 1X66A 4QZ8A 2FE9A 5AHXA 3UXNA 3L3FX 2C22A 4RUAA 4QIWC 1C7YA 8ICRA 5B5EU 4ED6A 1L8OA 2MU2A 2BCVA 3TACB 2K4HA 3F2CA 5KT2A 3M6ZA 5F9LA 2YMQA 4YVZA 3PMLA 4DQSA 2ATLA 2BKEA 1VDVA 1X2IA 3Q8SB 4UB8U 2OHFA 4NXZA 2KSOA 1SV0A 5EE3A 4MFAA 3N7PD 4Y2JA 4M9NA 3HJEA 3C5GA 2KE7A 4GXIA 2Y9UA 1SKRA 4IQUA 4OO1J 7ICUA 1ZQIA 1K1QA 2KJ9A 4DFJA 3R9KA 2IMWP 4FS2A 5ALGA 3E2EA 2W9CB 4PHAA 1JALA 9ICVA 4CF5A 1OXJA 4KLDA 3ISDA 4F5PA 2WF6A 3NTUA 3C2MA 2JZBB 1BPEA 1KFDA 1UT5A 2YY6A 2BCSA 4TQRA 4NL9A 2WB1F 4QNLA 5AI6A 2BHNA 4DEZA 2DPJA 5EOZA 4ED0A 3BZKA 2JEGA 5DLFA 1SKWA 1B43A 5J2HA 5B66U 1BNOA 1ZQDA 2HHUA 1RPLA 3UQ2A 3O0FA 5T14A 5A0LA 1D8YA 2HBMA 5EE9A 5KFCA 1SV0C 4DL2A 3QZ7A 1ZQMA 2J6TA 3AU2A 2B21A 4B9VA 9ICMA 5J0YA 1L7OA 4DS5A 2VKQA 4R8UA 5J2FA 4DF4A 4BDPA 3QZ8A 4XRHA 7ICIA 4LZGA 2VJ4A 4FS1A 2PFOA 3H0LB 5DG7A 2WB1C 5DLGA 1XWLA 2QLTA 3V72A 1ZQGA 3BQTA 3PX0A 2H3IA 2W54A 3RB4A 2XCPA 1AROP 1ZXIA 5AK3A 3TI0A 4PH5A 7ICOA 2HCFA 1S5LU 1KFTA 5KFMA 2IOFA 7ICSA 1S0NA 3ZI4A 2E8OA 3PW5A 5KT7A 4KITB 2Y0SF 5KG4A 1B22A 5KFXA 3N7SC 2DGZA 3NVZA 4MF8A 2P35A 8ICLA 4Q44A 4KLUA 1QQ5A 4JUZA 2WF9A 2FLNA 1JI7A 3RAXA 5IIOA 3PMNA 2ISOA 2M9NA 2NRTA 5DB9A 3F5EA 1ZETA 4CGZA 2W55A 4RNMA 3C23A 3RRHA 4QWEA 2P6UA 2KHQA 2OH2A 4NLCA 2NYVA 2JGAA 3MGVA 4UAVA 2HOFA 4UBCA 5D4BA 1TKDA 4I2IA 4ACOA 3BQ7A 5KT4A 5J2IA 2C2RA 1PVPA 2NRZA 4IR1A 5ALZA 3C2LA 1RYUA 2C2EA 2ISPA 1U48A 4Z6DA 3OJUA 4J03A 3QUTA 8ICKA 1AQ6A 5AKGA 5AI5A 3AEVA 3RTVA 2VIXA 3QU4A 5KFBA 3RB0A 2YB1A 5KG6A 3K1RB 7ICLA 5KFDA 4YR2A 2AGOA 4IQTA 1JX4A 1TE2A 4DOBA 3LVVA 3SAGA 1KBUA 3KZXA 2GLEA 1FFUA 1SB3C 1S97A 1L6NA 2DUYA 2GOLA 4IQVA 4O5CA 1WCLA 1QCKA 5ALEA 3K1ZA 2PFNA 2LI6A 3NVYA 2OYYA 3HWTA 3PNCA 2B6GA 4PGYA 3I28A 4C80A 3RAQA 3IG8A 2W9BA 4P0PA 1L3SA 2UVRA 4PL2A 4QW8A 4UATA 2RDIA 1NK4A 2PMZF 2QARB 5J0TA 4NM1A 3EW9A 3MR5A 5AIAA 3MGHA 4UB1A 2R8HA 4F2SA 3TKAA 4KLLA 3K4GA 5KG7A 4UB4A 9ICBA 3NASA 1U4BA 4UAWA 4J9MA 5BPCA 4B9NA 3H4DA 4RU9A 4CCHA 1RYRA 3OGUA 8ICGA 2KEYA 2K8BB 5DBAA 4UARA 5HMMA 1ZQKA 3MR6A 1QTMA 2ZJ8A 1L3VA 4F72A 4ECZA 1JUDA 1QQ7A 1YT3A 2H3FA 4EEKA 2EAPA 3QUCA 5J8YA 5C0YA 5DGAA 2ZIXB 3C21A 4I2CA 1K5OA 1ZQNA 4M04A 8ICVA 1SGGA 5KFFA 2RRDA 1ZQWA 1UPHA 2YMPA 3FC4A 3AQFA 4O3QA 4KMOB 3CW2C 4Y2TA 1N61A 4ZOHC 2PMZC 4YFKA 3RH4A 4DSJA 2LHTA 2HHSA 4KLEA 4DSEA 5JU5A 5IINA 7ICVA 3FYHA 4YCXA 1KN5A 4EZ6A 4OJLA 3ETLA 4MFCA 2OWOA 1OW5A 2XIDA 3PX4A 3K75D 4ICAA 2Q0ZX 8ICJA 1C20A 3ZD8A 2PKEA 3N28A 1RDFA 3PW4A 4RQ3A 3PW7A 3QU5A 4GLXA 1L3TA 5ALWA 1NKBA 3PSPA 1D9DA 4O3RA 5AI9A 4K4IA 2A19A 4EX7A 3RFAA 1ZQZA 1KSPA 4ELVA 4I2FA 2KHVA 2KVSA 4YXJA 1ZD5A 3RJHA 4NM2A 4DFKA 5KTQA 2KZMA 3AM9A 3T5JA 1ZQFA 3M6KA 4M9GA 1T8EA 2JR5A 4OD0A 9ICJA 2I6XA 4DL5A 3PZPA 1P7DA 3ETRA 4YMOA 4UAYA 5DQHA 2I5HA 7ICQA 3EUB2 1S8OA 3FAHA 2XY5A 4RQMA 3WK9A 4JMUA 4KX3A 2R8IA 5CA7A 1MQ3A 1KW4A 1Z3EB 2AJQA 2Q4TA 4QZGA 4R66A 4KLIA 1S0VA 4DO9A 3RJJA 3WKDA 5KFUA 2OXOA 5H2FU 4RPYA 3WK8A 1JXEA 5KFZA 4GC7A 4RQ4A 1ED1A 5J2EA 4QZBA 2HOQA 5L9XA 2PFPA 4MEYA 1ZQYA 1N63A 1KLNA 4UAZA 1ZQBA
chains in the Genus database with same CATH topology
3SAGA 3E0FA 2ZIVA 3F5AA 3KZXA 4OJLA 4U7CA 2KICA 4FZNA 3SQIA 1KBUA 4OO1J 2HBKA 2KJ8A 5KL1B 2A3VA 2CN1A 1CRXA 4AYBC 1GO3F 4PL1A 2ZIXA 2KJ9A 3DEEA 4QIWF 3IP4B 1L6NA 2JH1A 2K4IA 3GU3A 2XIDA 2DF4B 2E1EA 2GOLA 2ZXHA 2JHDA 4NWIA 2W7OA 2M0NA 4ICAA 2G06A 2KOBA 2XI9A 3HKZF 5KL8B 2ZXIA 1OUQA 1A6SA 2HBJA 1ZQ1C 4FE3A 3K1ZA 3OPXA 4KX5A 2Y0SF 2H3QA 2OYYA 2KKPA 2MRLA 3H0RB 1HIWA 2KVCA 3N7SC 4QJFB 2F77X 2DGZA 2KNJA 3SAHA 1PVRA 3IG8A 2KJ5A 3F53A 4OJ5A 4P0PA 3AL0B 4OJPA 4PL2A 3PSTA 2G07A 1HEKA 1XO0A 1PVQA 3PSIA 1NZBA 2PMZF 3D2QA 2KIWA 2WAQF 2WB1F 2ZIUB 2HMXA 3PSPA 4QNLA 1TAMA 3F2BA 1XNSA 3LYSA 2XICA 2DQNB 2HBLA 2R18A 3AQEA 1ECWA 1WUDA 3SMVA 3C29A 3PSFA 3RFAA 1F44A 3D2NA 3ICXA 3SAFA 4OJ6A 4A8EA 2KHVA 3VC8A 5CRXA 3D2SA 2LKYA 1URJA 2H3VA 2K4EA 2G08A 3T79A 3F5EA 3CP8A 4CGZA 2CRXA 3KFUF 4P0QB 2ZIWB 3IG5A 2Y0SC 3M6KA 4U6PA 1Q3VA 4CRXA 2D6FC 2H3ZA 2RP5A 1DRGA 2KHQA 5HR7A 2OH2A 3PZPA 2W03A 2RHFA 3O0FA 2VJ5A 2G0AA 4NLCA 2JGAA 4BUGA 4NV0A 5T14A 3MGVA 2W7PA 1P7DA 2HOFA 3F2DA 5HR6A 2W04A 2KEYA 2K8BB 3GZFA 5A0LA 4WJ3B 4BJQA 4ACOA 1SZHA 3VCBA 4FZLA 3C28A 1Z19A 1IIPA 2K8AA 2HBMA 2MA1A 3IN5A 3L3FX 2ZIUA 1Z1BA 4QIWC 3CYMA 2KKVA 2YX8A 4JMUA 4GFJA 4NLBA 2LYAA 1PVPA 4KX3A 2K89A 4BX9C 2KV2A 2G5IB 3H0MB 2ZIVB 2JH7A 2XVTA 1YT3A 2K4HA 2G5HB 2H3FA 3HKZC 3F2CA 2CPRA 4AYBF 5C0YA 1A0PA 1MA7A 2GH1A 3M6ZA 1D8BA 1Q3UA 2Q4TA 2VKQA 2ZIXB 3M7DA 4P0QA 2YB4A 2ZIWA 4C0ZA 2F2AB 3ALRA 3NUQA 2OXOA 2F76X 2RRDA 4CDGA 3LVWA 2LYBA 1UPHA 2F8LA 2VIXA 3AQFA 3CRXA 2YB1A 2N1RA 2KD1A 3RF9A 4KMOB 2HOIA 2NV3A 2VJ4A 3N7RC 1ED1A 2BDUA 2PMZC 1T94A 3H0LB 3ONNA 2G09A 2LHTA 2WAQC 2WB1C 4IC9A 2HOQA 4O3MA 3LVVA 3N7PD 4P0PB 4OJOA 2JMGA 2Z7JA 4FZMA 2H3IA 2LBOA 2ZG6A 2E1FA 2K8CB 3NRWA 2E5SA 2OM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3V A;  1KBU A;  1XO0 A;  1DRG A;  2KJ8 A;  2KHQ A;  1PVQ A;  2A3V A;  1CRX A;  1NZB A;  3MGV A;  2HOF A;  1P7D A;  2KJ9 A;  2KIW A;  2OXO A;  2KEY A;  4CRX A;  3CRX A;  1XNS A;  4ACO A;  3LYS A;  3C28 A;  1Z19 A;  2KD1 A;  2HOI A;  2KOB A;  1OUQ A;  3C29 A;  1F44 A;  1Z1B A;  2KKV A;  4A8E A;  1PVP A;  2KHV A;  5CRX A;  2KKP A;  1PVR A;  1MA7 A;  2CRX A;  1A0P A;  3NRW A;  2KJ5 A;  1Q3U A; 
#chains in the Genus database with same CATH topology
 2JXJ A;  4PHP A;  5AM0 A;  3H7I A;  4PL1 A;  2R8K A;  4I2A A;  1SKS A;  1UQV A;  4QZA A;  4BXO B;  2LM1 A;  3HKZ F;  2HBJ A;  2EZZ A;  4YG2 A;  4GXJ A;  5C5J A;  5ALF A;  2WF8 A;  8ICU A;  9ICF A;  4UQG A;  5ALO A;  1NZB A;  3BS5 B;  4DSL A;  4M9J A;  3QUB A;  5AM4 A;  7ICR A;  3D2N A;  2AXT U;  4OJ6 A;  4UW9 A;  3AN1 A;  4QWB A;  5KFR A;  4P0Q B;  4KLJ A;  4U6P A;  1T3Q A;  1CEZ A;  1ZQR A;  1DRG A;  1T4G A;  2W7P A;  1D9F A;  3QNM A;  2GO7 A;  2L5Y A;  4ED7 A;  1XS9 D;  4DLG A;  1QLN A;  4WJ3 B;  2A1A A;  3DDH A;  4BJQ A;  5J0P A;  4JWM A;  3C28 A;  9ICT A;  3Q8R B;  1PK1 A;  2OEH A;  2LPE A;  3PO5 A;  1Z1B A;  3QU9 A;  3BQ2 A;  1CI4 A;  2G5I B;  3HKZ C;  2DKX A;  2CPR A;  5JTI A;  2DPI A;  3SEI A;  1XU4 A;  1NJW A;  3AMZ A;  4F50 A;  4JV0 A;  2KFZ A;  3EPG A;  2EAO A;  1COO A;  3LWM A;  2BPC A;  4US8 A;  2K4P A;  2BDU A;  8ICX A;  3IRU A;  5AK6 A;  4IC9 A;  1SL0 A;  5TZV A;  2XCA A;  3KHG A;  4Y2R A;  3ZDA A;  4IRD A;  2Z7J A;  3RH5 A;  1N5W A;  4YXM A;  4I28 A;  3NRW A;  1Z00 A;  4C4T A;  3ZDD A;  5KFO A;  3PW0 A;  1V85 A;  4AYB C;  1ZQC A;  3BZC A;  3BS7 A;  1RXV A;  2BGW A;  5J0U A;  8ICC A;  2G06 A;  4ECS A;  4O3N A;  2KIV A;  5CR0 A;  4R65 A;  2E8P A;  3SEN A;  3SAH A;  5AI8 A;  2JEJ A;  3F53 A;  1ZD3 A;  2YMM A;  3HW8 A;  3PSI A;  4DFM A;  1ZQX A;  5J0X A;  4DQR A;  3NVW A;  5ALS A;  5J2J A;  2E8M A;  3LYS A;  3Q8L A;  4CF3 A;  4UB3 A;  7ICT A;  3PSF A;  4J9O A;  2BQR A;  5F3X B;  3UXO A;  2AGQ A;  2C28 A;  4KLQ A;  3C1Y A;  1NI3 A;  5HNK A;  3L4P A;  2R8G A;  1UA1 A;  1ZQQ A;  9ICL A;  3UMB A;  1N56 A;  1X9S A;  4O5E A;  1ZRN A;  1L7N A;  1QSS A;  4R63 A;  4Z6C A;  2R8J A;  1COK A;  3KZI U;  2ZJA A;  1B0X A;  4ED8 A;  1SWV A;  1KRP A;  2KSO B;  3VCB A;  4NLK A;  1IIP A;  2K8A A;  1J2M A;  2KKV A;  4GFJ A;  1IG6 A;  2KV2 A;  1KQQ A;  3JPO A;  2RLT A;  2HSZ A;  1MA7 A;  4M0A A;  3QUQ A;  4C8K A;  1XSP A;  4QW9 A;  3T5H A;  2YB4 A;  2ZIW A;  2PFQ A;  2YTU A;  1MC8 A;  4QZC A;  4CDG A;  2ESE A;  2HOI A;  2BR0 A;  3RJE A;  4O3P A;  1X40 A;  5J2D A;  7ICF A;  4QWD A;  1ZQE A;  3ZDC A;  2E1F A;  5KFY A;  3E0F A;  3BJY A;  4Q8E A;  2ZTE A;  2XY6 A;  2D8C A;  3Q8M A;  2ES6 A;  1BPX A;  4TUS A;  3LK9 A;  5G5H A;  5J0Q A;  3WK7 A;  3H8M A;  5J2B A;  3RB3 A;  2BQU A;  4UBB A;  5AK4 A;  1ZRM A;  5KAI U;  5F9N A;  2ASD A;  3H0R B;  4NLN A;  2KNJ A;  1BPD A;  2YML A;  5KFT A;  4BWJ A;  2K60 A;  1J97 A;  4J9N A;  3HX0 A;  3UXP A;  4R64 A;  3G6Y A;  3SD7 A;  1ZQU A;  4YN4 A;  1ECW A;  3SMV A;  3ICX A;  5E79 U;  3D2S A;  5AKE A;  4FFD A;  3QU2 A;  4O9M A;  4R8U B;  4ECR A;  1X9W A;  4PGQ A;  3V7L A;  3E58 A;  5DDY A;  3WK6 A;  1JRP A;  1L3U A;  4KLF A;  3EYZ A;  4K4G A;  7ICJ A;  4NV0 A;  4RPZ A;  2FMS A;  1H38 A;  2E8N A;  9ICO A;  1Z19 A;  3SR6 A;  2HDO A;  3CYM A;  5DB6 A;  5KFL A;  1V9P A;  1KFS A;  4BX9 C;  5KG3 A;  3ZDE A;  2XVT A;  4Y2V A;  3GV8 B;  1Q46 A;  4JB3 A;  4GC6 A;  4J9K A;  2FLL A;  3OTQ A;  4ECV A;  1TAU A;  4RT2 A;  1YZ6 A;  3HP6 A;  2AHO B;  4JV2 A;  5ALL A;  1SXE A;  2J6U A;  2UVW A;  4F4W A;  3RF9 A;  4ED1 A;  5JUM A;  1X6J A;  2IBK A;  1X42 A;  2KMD A;  5AI0 A;  2E3T A;  1RZT A;  5AKJ A;  2EZX A;  2OM6 A;  4IR9 A;  9ICX A;  4F4X A;  3TAR A;  2IHN A;  1NK5 A;  1D8L A;  2HBK A;  3H4B A;  4ELT A;  3KHR A;  3GQC A;  3RJK A;  3NVV A;  3RRG A;  2JH1 A;  4NWI A;  5FP0 A;  3M9O B;  4KLG A;  1L7P A;  2ZUB A;  1O08 A;  1A76 A;  1S10 A;  2W9M A;  4O0I A;  2V4R A;  4OJ5 A;  1S77 D;  4KN7 A;  3SZ2 A;  4BGD A;  4KLS A;  4B9S A;  1TAQ A;  9ICU A;  5DDM A;  3UQ0 A;  3B0X A;  8ICP A;  1KTQ A;  2PI5 A;  2VA8 A;  2F1J A;  3SAF A;  2W11 A;  5KG0 A;  2NRV A;  3NRZ A;  5CRX A;  2H3V A;  3KD3 A;  4I29 A;  3T79 A;  2BCQ A;  5BOL A;  3THV A;  1NOM A;  1ZD4 A;  3UMC A;  5ALN A;  4P4M A;  3QEA Z;  4CRX A;  3OSP A;  2F8K A;  4I2G A;  4RQ7 A;  3ORY A;  2VJ5 A;  3F2D A;  3AUO A;  2KZZ A;  1SZH A;  2ZIU A;  1JN3 A;  5DB8 A;  2AU0 A;  2YX8 A;  1SZP A;  4NLB A;  3WU2 U;  2FPM A;  4F4Y A;  4USA A;  1ZQJ A;  2ZTC A;  5BOM A;  4ED3 A;  1NK8 A;  1S9F A;  4YP3 A;  4PHD A;  5EWE A;  2EQY A;  3GIL A;  3GDX A;  2MUT A;  3T5K A;  3T3F A;  4RQ6 A;  2W8L A;  3I1Y A;  3JPP A;  2W9B B;  4P0P B;  4OJO A;  4YR0 A;  4LZD A;  1BPZ A;  2ZG6 A;  2K8C B;  5DB7 A;  3MGI A;  2LM4 A;  2ZIV A;  1SV4 A;  2KIC A;  4EBD A;  4F71 A;  1S0O A;  1L7M A;  4Y2Q A;  4I2J A;  3DEE A;  3IP4 B;  2DF4 B;  2W7O A;  4J9P A;  1QQ6 A;  5L1J A;  2FI1 A;  5AM3 A;  2FDR A;  2IOH A;  1VJ5 A;  3NS1 A;  2XI9 A;  7ICP A;  2ZXI A;  5CP2 A;  5AK5 A;  3SV3 A;  1UCV A;  5KFP A;  5AKI A;  2V4Q A;  3PW2 A;  4QJF B;  2F77 X;  1NNL A;  4YMM A;  4F92 B;  5K4L A;  1XO0 A;  3ZDB A;  1PVQ A;  8ICS A;  1NJY A;  2WFA A;  5D49 A;  1L5U A;  4DQI A;  1KDH A;  4F8R A;  4B9L A;  1TAM A;  5IIL A;  3MC1 A;  2WTF A;  2DQN B;  3OHA A;  3QX7 A;  3MAB A;  4EZ9 A;  5ALQ A;  2JRZ A;  4F4K A;  1URJ A;  3RJF A;  3IG5 A;  8ICI A;  2EAN A;  5KFV A;  3TFS A;  1JXL A;  4BUG A;  4UAS A;  2A1J A;  5EWG A;  4DL3 A;  4XA5 A;  5CEH A;  2JEI A;  3PV8 A;  2GH1 A;  2QKQ A;  4Y2X A;  3G6V A;  5J2A A;  2WF5 A;  4M9L A;  4B9T A;  4I2B A;  3NUQ A;  5KT5 A;  4O3S A;  4Q43 A;  2F76 X;  3TAP A;  1WCN A;  2EAM A;  4GIB A;  1ZQH A;  2KG5 A;  4MF2 A;  3IHQ B;  3ONN A;  1DOQ A;  4HAI A;  5KG1 A;  2JMG A;  1ZQT A;  1N2X A;  4Y2Y A;  4NY8 A;  4QZD A;  2XC9 A;  3SV4 A;  2AQ4 A;  2KJ8 A;  2W43 A;  5G5G A;  2DKZ A;  5CHG A;  4FBU A;  4M6W A;  5KT3 A;  8ICZ A;  2E1E A;  1ZQL A;  2ZXH A;  2JHD A;  4RUC A;  3RJG A;  2BDP A;  1ZQO A;  2QB0 A;  2KZ3 A;  2DBY A;  4NJ8 A;  5HML A;  4DLE A;  2HMX A;  4UAU A;  4Y2U A;  5J0W A;  1F44 A;  2ZUD A;  2FLP A;  2ASJ A;  1NK7 A;  3KOO A;  1ZOL A;  4FBT A;  5HHH A;  5AKZ A;  3MFH A;  2XGP A;  1Q3V A;  4UB2 A;  5IIK A;  5HHI A;  3SYZ A;  1FIQ A;  5TIS U;  3Q8Q B;  2IOF K;  3Q8P B;  9ICN A;  1BPB A;  4GXK A;  5HR6 A;  4RQ8 A;  2HW3 A;  1IXR A;  1N60 A;  4QWC A;  3J81 j;  1DGJ A;  2F3N A;  2MA1 A;  3WKC A;  5IIM A;  8ICF A;  4TUP A;  2K89 A;  4DOC A;  3NGD A;  4Y2P A;  1HUO A;  4AYB F;  3TAD A;  2C2D A;  3WKB A;  2UVU A;  4TUR A;  5EWF A;  1SXD A;  2RQ5 A;  2LYB A;  1NJX A;  1DK3 A;  3N7R C;  2WF7 A;  9ICG A;  4CE6 A;  4DL6 A;  4DSI A;  4YD2 A;  4PJ0 U;  2W8K A;  4X5V A;  1QSL A;  3Q8K A;  4Z6F A;  5AM1 A;  8ICY A;  3FM9 A;  2KP7 A;  1BNP A;  3WK4 A;  2LYH A;  3JPS A;  3LWL A;  4PGX A;  3H8S A;  5KT6 A;  2NRW A;  5KFS A;  1LKY B;  4UB5 A;  3QE9 Y;  3FDS A;  3GFK B;  3GV7 B;  4KN4 A;  2VA3 A;  4F5R A;  3MFI A;  2H3Q A;  1ZYQ A;  1IM4 A;  8ICO A;  1EXN A;  8ICT A;  3V7K A;  3PVX A;  3RB6 A;  5DKW A;  3PR4 A;  1XSN A;  1FFV A;  1ZQP A;  2ODG A;  4C7Y A;  1PK1 B;  3TFR A;  4DQP A;  5ALX A;  9ICW A;  9ICI A;  1XNS A;  3ISB A;  5IIJ A;  3V6J A;  2R18 A;  1WUD A;  4J9R A;  1JIH A;  3MR2 A;  2W9C A;  1N62 A;  2G08 A;  1KKX A;  3TAD C;  3BQ1 A;  4ECQ A;  4TQS A;  2CRX A;  4XUS A;  3KFU F;  2J6S A;  4KLT A;  1RQN A;  2H5X A;  3CNH A;  4EEN A;  3N97 B;  4C8L A;  4O3O A;  3KBB A;  2JZB A;  1X9M A;  4FZL A;  5AIC A;  4M9H A;  1S0M A;  4EBE A;  2JEF A;  2B0C A;  1Z00 B;  8ICE A;  1X6I A;  5KG5 A;  2BPG A;  1D8B A;  1NK9 A;  1YZ7 A;  3N4M B;  3UMG A;  4B9U A;  3C5F A;  1DGS A;  5KFK A;  4AP9 A;  3A0H U;  5ALP A;  4DL7 A;  2EZY A;  4C7Z A;  7ICE A;  2O6K A;  5ALT A;  3WKE A;  4O3M A;  3L5K A;  4DOA A;  4P2H A;  4FZM A;  4F5Q A;  2BQ3 A;  3IN5 A;  4C4R A;  2E5S A;  4FE3 A;  1WWU A;  3B0Y A;  4ECU A;  3G6X A;  5III A;  1MN8 A;  2CXY A;  4F5O A;  2YN4 A;  3JPT A;  2F1H A;  3V6K A;  2IA6 A;  2UVV A;  3JPQ A;  4ELU A;  4KX5 A;  2MRL A;  1KL9 A;  3U26 A;  1HIW A;  3QXG A;  1PVR A;  5ALV A;  3OSN A;  3V7J A;  5KFW A;  5J29 A;  1SWW A;  3PST A;  2NO5 A;  4RZR A;  3KTQ A;  1HJP A;  3D2Q A;  4E0D A;  2KIW A;  3RR7 A;  2BZF A;  1DXS A;  5AKY A;  5KFE A;  2ALZ A;  4IS7 A;  2HBL A;  2BCU A;  5KFA A;  1QH9 A;  4IRK A;  4YMN A;  5L1M A;  5KNI A;  3C2K A;  5J0O A;  4G9B A;  4ECT A;  2ZIW B;  2D6F C;  2F1I A;  9ICE A;  4KTQ A;  4ED2 A;  1XC9 A;  4PPX A;  5ALI A;  2PXI A;  4DCC A;  2FMP A;  4I2E A;  1SL2 A;  4I2D A;  1V38 A;  4NLZ A;  3DV9 A;  2AGP A;  1V97 A;  3M1Y A;  5KAF U;  1MQ2 A;  2RDJ A;  1U47 A;  4PZO A;  1O03 A;  4F3O A;  2LMR A;  4P4P A;  2JH7 A;  4QWA A;  1Z4O A;  4RQ5 A;  4NL9 C;  3ISC A;  3M7D A;  3H40 A;  3EPI A;  2EH9 A;  2W3S A;  5KFI A;  1NKC A;  4YQW A;  3M8S A;  5DQG A;  9ICS A;  2NV3 A;  5DBC A;  5KFN A;  5ALD A;  2G09 A;  3JPN A;  2DL0 A;  1M6Y A;  1Y88 A;  4YD1 A;  9ICK A;  3OHB A;  1RXW A;  4P4O A;  2HHW A;  3GIK A;  7ICH A;  4FZN A;  4EEY A;  5EE0 A;  2CN1 A;  1XSL A;  1BGX T;  1CUK A;  3GU3 A;  5L1L A;  1HUZ A;  7ICK A;  4DSF A;  3OJS A;  1UHU A;  2KOB A;  4RNO A;  3PY8 A;  1TK8 A;  3M8R A;  2F44 A;  3IM1 A;  2KN7 A;  1WYG A;  3HT3 A;  3RH6 A;  1A77 A;  5L1K A;  4Z6E A;  3AL0 B;  5AKX A;  4IQW A;  2FMQ A;  2HHT A;  2KK0 A;  1HEK A;  4EYI B;  5AI4 A;  2NRX A;  2FPL A;  4JWN A;  3EWA A;  2HVI A;  1WWV A;  3BQ0 A;  4KLM A;  4IRC A;  1PK3 A;  1T3N A;  2XIC A;  1ZQA A;  5DQI A;  1NK6 A;  3C29 A;  3QYP A;  5KFG A;  4MFF A;  3HRD D;  4B6J A;  1WG8 A;  4QZF A;  1MSW D;  2K4E A;  4QZH A;  5DG8 A;  1NKE A;  4G3I A;  3GV5 B;  4KLH A;  2Y0S C;  3MR3 A;  2H3Z A;  2RP5 A;  3PR5 B;  7ICN A;  4O5K A;  2OCE A;  5EE1 A;  2EDU A;  4J9S A;  9ICC A;  2W04 A;  1K1S A;  4EEL A;  3GZF A;  3LDA A;  2QAR A;  2HHX A;  5CWR A;  4TUQ A;  5J0S A;  4RNN A;  2HVH A;  3V6H A;  1A0P A;  3KKA A;  3IDW A;  8ICN A;  1PZN A;  5ALR A;  4C0Z A;  5KFH A;  5KG2 A;  2W9A A;  3LVW A;  5L1I A;  3CRX A;  2DFL A;  5KFQ A;  5DBB A;  1T94 A;  1TVA A;  4QZE A;  1VLB A;  1LV5 A;  2PI4 A;  2GWS A;  2LBO A;  5J0R A;  2FPK A;  4YR3 A;  1XO1 A;  4U7C A;  3SQI A;  2WHE A;  1GO3 F;  2ZIX A;  1TV9 A;  2JV3 A;  2HHV A;  1ZD2 P;  2V9W A;  5GTH U;  2QB1 A;  2I9G A;  2M0N A;  4RT3 A;  4DQQ A;  5ALH A;  3JPR A;  3RBD A;  4B9M A;  1ZQ1 C;  3OPX A;  5AKL A;  3C1Z A;  2KKP A;  3T5L A;  2MSN A;  4C8M A;  4C4S A;  1FEZ A;  4LJX A;  5DG9 A;  4CF4 A;  2P66 A;  2ZTD A;  2Y1J A;  4EYH B;  1IV8 A;  1SIJ A;  3QU7 A;  4CNQ A;  5J2K A;  4DFP A;  2WAQ F;  2ZIU B;  5J2C A;  8ICQ A;  4RQN A;  4QZ9 A;  3AQE A;  3TAN A;  9ICQ A;  4A8E A;  2BPF A;  2LKY A;  5AKK A;  4EX6 A;  3KKA C;  2YQE A;  5ALJ A;  3QEB Z;  3HPO A;  1RYS A;  1F0M A;  3SI8 A;  2MUT B;  2Y9T A;  2NO4 A;  5D46 A;  3MDC A;  1TFR A;  2ZUC A;  4I2H A;  5ALK A;  1LVH A;  4UB6 U;  4DFD A;  3H0M B;  2ZIV B;  1S76 D;  4KMU A;  4C8N A;  1SL1 A;  3PO4 A;  1T7P A;  3ED5 A;  1B4F A;  1LB2 B;  3IV6 A;  1QSY A;  2F2A B;  3ALR A;  3EZ5 A;  5KFJ A;  3MDA A;  3M9N B;  2KD1 A;  4F93 B;  2D3D A;  1BPY A;  2KTQ A;  2WAQ C;  1J2N A;  4M2Y A;  4ECX A;  3GIJ A;  4JV1 A;  2AH5 A;  3MBY A;  3WK5 A;  2IHM A;  4J9L A;  3BDP A;  4HYK A;  4LVS A;  1L8L A;  4Q45 A;  3GII A;  2K4I A;  4PZN A;  4BWM A;  4QZI A;  1U49 A;  1ZJM A;  4US9 A;  1A6S A;  3M9M B;  3I76 A;  2ZJ5 A;  1RG6 A;  1NJZ A;  5J8Y C;  8ICB A;  1U9L A;  4Q8F A;  4DWI A;  4Y2S A;  2KJ5 A;  1ZQS A;  4MHV A;  3AU6 A;  4FO6 A;  5ALM A;  1Q8K A;  2A1J B;  2P6R A;  1F5S A;  5JRT A;  8ICA A;  3F2B A;  2VAN A;  3HIL A;  8ICM A;  5CJ7 A;  1Z4N A;  1TK5 A;  4F91 B;  4BXO A;  3KHH A;  9ICR A;  3A0B U;  4DSK A;  3CP8 A;  3RR8 A;  4ECW A;  1UA0 A;  1JRO A;  2FJ6 A;  2VA2 A;  1X9X A;  2XO7 A;  1NK0 A;  5HR7 A;  4RQ2 A;  2W03 A;  2RHF A;  7ICM A;  2G0A A;  5J2G A;  4F4Z A;  4RQ1 A;  8ICH A;  2Y1I A;  2DWQ A;  1UT8 A;  3BS5 A;  1BVS A;  1KEJ A;  2LYA A;  1TK0 A;  2XY7 A;  1Z1V A;  4XQ8 A;  4DF8 A;  3UPQ A;  4F2R A;  4RQ0 A;  2G5H B;  1Q3U A;  4M6W B;  2MAX A;  3GIM A;  2XGQ A;  4P0Q A;  3WKA A;  3S6J A;  9ICP A;  2ASL A;  5AM5 A;  5DGB A;  3TAQ A;  1NZP A;  2F8L A;  4J9Q A;  2N1R A;  4K4H A;  1N5X A;  2QB0 B;  7ICG A;  3H8W A;  8ICW A;  4MEX A;  4KLO A;  9ICA A;  1U45 A;  3B9J A;  4DL4 A;  3RJI A;  4DS4 A;  1PUZ A;  3F5A A;  4OCZ A;  2A3V A;  5KL1 B;  1CRX A;  2BCR A;  4QIW F;  4JK1 A;  1LKY A;  3TQ1 A;  2HI0 A;  4ECY A;  5HP4 A;  1OUQ A;  5KL8 B;  5GTI U;  4IL6 U;  1RM6 C;  4ZH4 A;  4RPX A;  1ZQV A;  4M47 A;  2KVC A;  5ALY A;  2AQ0 A;  4C8O A;  3H8J A;  4OJP A;  2G07 A;  3KHL A;  1FO4 A;  9ICH A;  5CB1 A;  3PX6 A;  4NLG A;  1JMS A;  5ALU A;  5AM2 A;  5AIB A;  4I27 A;  3D6J A;  3VC8 A;  2HHQ A;  1RQL A;  1ZJN A;  2W3R A;  5AKH A;  3ZD9 A;  4F5N A;  4EBC A;  2I1Q A;  2KFN A;  4PHE A;  1DK2 A;  3RBE A;  3UM9 A;  1N48 A;  1X66 A;  4QZ8 A;  2FE9 A;  5AHX A;  3UXN A;  3L3F X;  2C22 A;  4RUA A;  4QIW C;  1C7Y A;  8ICR A;  5B5E U;  4ED6 A;  1L8O A;  2MU2 A;  2BCV A;  3TAC B;  2K4H A;  3F2C A;  5KT2 A;  3M6Z A;  5F9L A;  2YMQ A;  4YVZ A;  3PML A;  4DQS A;  2ATL A;  2BKE A;  1VDV A;  1X2I A;  3Q8S B;  4UB8 U;  2OHF A;  4NXZ A;  2KSO A;  1SV0 A;  5EE3 A;  4MFA A;  3N7P D;  4Y2J A;  4M9N A;  3HJE A;  3C5G A;  2KE7 A;  4GXI A;  2Y9U A;  1SKR A;  4IQU A;  4OO1 J;  7ICU A;  1ZQI A;  1K1Q A;  2KJ9 A;  4DFJ A;  3R9K A;  2IMW P;  4FS2 A;  5ALG A;  3E2E A;  2W9C B;  4PHA A;  1JAL A;  9ICV A;  4CF5 A;  1OXJ A;  4KLD A;  3ISD A;  4F5P A;  2WF6 A;  3NTU A;  3C2M A;  2JZB B;  1BPE A;  1KFD A;  1UT5 A;  2YY6 A;  2BCS A;  4TQR A;  4NL9 A;  2WB1 F;  4QNL A;  5AI6 A;  2BHN A;  4DEZ A;  2DPJ A;  5EOZ A;  4ED0 A;  3BZK A;  2JEG A;  5DLF A;  1SKW A;  1B43 A;  5J2H A;  5B66 U;  1BNO A;  1ZQD A;  2HHU A;  1RPL A;  3UQ2 A;  3O0F A;  5T14 A;  5A0L A;  1D8Y A;  2HBM A;  5EE9 A;  5KFC A;  1SV0 C;  4DL2 A;  3QZ7 A;  1ZQM A;  2J6T A;  3AU2 A;  2B21 A;  4B9V A;  9ICM A;  5J0Y A;  1L7O A;  4DS5 A;  2VKQ A;  4R8U A;  5J2F A;  4DF4 A;  4BDP A;  3QZ8 A;  4XRH A;  7ICI A;  4LZG A;  2VJ4 A;  4FS1 A;  2PFO A;  3H0L B;  5DG7 A;  2WB1 C;  5DLG A;  1XWL A;  2QLT A;  3V72 A;  1ZQG A;  3BQT A;  3PX0 A;  2H3I A;  2W54 A;  3RB4 A;  2XCP A;  1ARO P;  1ZXI A;  5AK3 A;  3TI0 A;  4PH5 A;  7ICO A;  2HCF A;  1S5L U;  1KFT A;  5KFM A;  2IOF A;  7ICS A;  1S0N A;  3ZI4 A;  2E8O A;  3PW5 A;  5KT7 A;  4KIT B;  2Y0S F;  5KG4 A;  1B22 A;  5KFX A;  3N7S C;  2DGZ A;  3NVZ A;  4MF8 A;  2P35 A;  8ICL A;  4Q44 A;  4KLU A;  1QQ5 A;  4JUZ A;  2WF9 A;  2FLN A;  1JI7 A;  3RAX A;  5IIO A;  3PMN A;  2ISO A;  2M9N A;  2NRT A;  5DB9 A;  3F5E A;  1ZET A;  4CGZ A;  2W55 A;  4RNM A;  3C23 A;  3RRH A;  4QWE A;  2P6U A;  2KHQ A;  2OH2 A;  4NLC A;  2NYV A;  2JGA A;  3MGV A;  4UAV A;  2HOF A;  4UBC A;  5D4B A;  1TKD A;  4I2I A;  4ACO A;  3BQ7 A;  5KT4 A;  5J2I A;  2C2R A;  1PVP A;  2NRZ A;  4IR1 A;  5ALZ A;  3C2L A;  1RYU A;  2C2E A;  2ISP A;  1U48 A;  4Z6D A;  3OJU A;  4J03 A;  3QUT A;  8ICK A;  1AQ6 A;  5AKG A;  5AI5 A;  3AEV A;  3RTV A;  2VIX A;  3QU4 A;  5KFB A;  3RB0 A;  2YB1 A;  5KG6 A;  3K1R B;  7ICL A;  5KFD A;  4YR2 A;  2AGO A;  4IQT A;  1JX4 A;  1TE2 A;  4DOB A;  3LVV A;  3SAG A;  1KBU A;  3KZX A;  2GLE A;  1FFU A;  1SB3 C;  1S97 A;  1L6N A;  2DUY A;  2GOL A;  4IQV A;  4O5C A;  1WCL A;  1QCK A;  5ALE A;  3K1Z A;  2PFN A;  2LI6 A;  3NVY A;  2OYY A;  3HWT A;  3PNC A;  2B6G A;  4PGY A;  3I28 A;  4C80 A;  3RAQ A;  3IG8 A;  2W9B A;  4P0P A;  1L3S A;  2UVR A;  4PL2 A;  4QW8 A;  4UAT A;  2RDI A;  1NK4 A;  2PMZ F;  2QAR B;  5J0T A;  4NM1 A;  3EW9 A;  3MR5 A;  5AIA A;  3MGH A;  4UB1 A;  2R8H A;  4F2S A;  3TKA A;  4KLL A;  3K4G A;  5KG7 A;  4UB4 A;  9ICB A;  3NAS A;  1U4B A;  4UAW A;  4J9M A;  5BPC A;  4B9N A;  3H4D A;  4RU9 A;  4CCH A;  1RYR A;  3OGU A;  8ICG A;  2KEY A;  2K8B B;  5DBA A;  4UAR A;  5HMM A;  1ZQK A;  3MR6 A;  1QTM A;  2ZJ8 A;  1L3V A;  4F72 A;  4ECZ A;  1JUD A;  1QQ7 A;  1YT3 A;  2H3F A;  4EEK A;  2EAP A;  3QUC A;  5J8Y A;  5C0Y A;  5DGA A;  2ZIX B;  3C21 A;  4I2C A;  1K5O A;  1ZQN A;  4M04 A;  8ICV A;  1SGG A;  5KFF A;  2RRD A;  1ZQW A;  1UPH A;  2YMP A;  3FC4 A;  3AQF A;  4O3Q A;  4KMO B;  3CW2 C;  4Y2T A;  1N61 A;  4ZOH C;  2PMZ C;  4YFK A;  3RH4 A;  4DSJ A;  2LHT A;  2HHS A;  4KLE A;  4DSE A;  5JU5 A;  5IIN A;  7ICV A;  3FYH A;  4YCX A;  1KN5 A;  4EZ6 A;  4OJL A;  3ETL A;  4MFC A;  2OWO A;  1OW5 A;  2XID A;  3PX4 A;  3K75 D;  4ICA A;  2Q0Z X;  8ICJ A;  1C20 A;  3ZD8 A;  2PKE A;  3N28 A;  1RDF A;  3PW4 A;  4RQ3 A;  3PW7 A;  3QU5 A;  4GLX A;  1L3T A;  5ALW A;  1NKB A;  3PSP A;  1D9D A;  4O3R A;  5AI9 A;  4K4I A;  2A19 A;  4EX7 A;  3RFA A;  1ZQZ A;  1KSP A;  4ELV A;  4I2F A;  2KHV A;  2KVS A;  4YXJ A;  1ZD5 A;  3RJH A;  4NM2 A;  4DFK A;  5KTQ A;  2KZM A;  3AM9 A;  3T5J A;  1ZQF A;  3M6K A;  4M9G A;  1T8E A;  2JR5 A;  4OD0 A;  9ICJ A;  2I6X A;  4DL5 A;  3PZP A;  1P7D A;  3ETR A;  4YMO A;  4UAY A;  5DQH A;  2I5H A;  7ICQ A;  3EUB 2;  1S8O A;  3FAH A;  2XY5 A;  4RQM A;  3WK9 A;  4JMU A;  4KX3 A;  2R8I A;  5CA7 A;  1MQ3 A;  1KW4 A;  1Z3E B;  2AJQ A;  2Q4T A;  4QZG A;  4R66 A;  4KLI A;  1S0V A;  4DO9 A;  3RJJ A;  3WKD A;  5KFU A;  2OXO A;  5H2F U;  4RPY A;  3WK8 A;  1JXE A;  5KFZ A;  4GC7 A;  4RQ4 A;  1ED1 A;  5J2E A;  4QZB A;  2HOQ A;  5L9X A;  2PFP A;  4MEY A;  1ZQY A;  1N63 A;  1KLN A;  4UAZ A;  1ZQB A; 
#chains in the Genus database with same CATH homology
 3SAG A;  3E0F A;  2ZIV A;  3F5A A;  3KZX A;  4OJL A;  4U7C A;  2KIC A;  4FZN A;  3SQI A;  1KBU A;  4OO1 J;  2HBK A;  2KJ8 A;  5KL1 B;  2A3V A;  2CN1 A;  1CRX A;  4AYB C;  1GO3 F;  4PL1 A;  2ZIX A;  2KJ9 A;  3DEE A;  4QIW F;  3IP4 B;  1L6N A;  2JH1 A;  2K4I A;  3GU3 A;  2XID A;  2DF4 B;  2E1E A;  2GOL A;  2ZXH A;  2JHD A;  4NWI A;  2W7O A;  2M0N A;  4ICA A;  2G06 A;  2KOB A;  2XI9 A;  3HKZ F;  5KL8 B;  2ZXI A;  1OUQ A;  1A6S A;  2HBJ A;  1ZQ1 C;  4FE3 A;  3K1Z A;  3OPX A;  4KX5 A;  2Y0S F;  2H3Q A;  2OYY A;  2KKP A;  2MRL A;  3H0R B;  1HIW A;  2KVC A;  3N7S C;  4QJF B;  2F77 X;  2DGZ A;  2KNJ A;  3SAH A;  1PVR A;  3IG8 A;  2KJ5 A;  3F53 A;  4OJ5 A;  4P0P A;  3AL0 B;  4OJP A;  4PL2 A;  3PST A;  2G07 A;  1HEK A;  1XO0 A;  1PVQ A;  3PSI A;  1NZB A;  2PMZ F;  3D2Q A;  2KIW A;  2WAQ F;  2WB1 F;  2ZIU B;  2HMX A;  3PSP A;  4QNL A;  1TAM A;  3F2B A;  1XNS A;  3LYS A;  2XIC A;  2DQN B;  2HBL A;  2R18 A;  3AQE A;  1ECW A;  1WUD A;  3SMV A;  3C29 A;  3PSF A;  3RFA A;  1F44 A;  3D2N A;  3ICX A;  3SAF A;  4OJ6 A;  4A8E A;  2KHV A;  3VC8 A;  5CRX A;  3D2S A;  2LKY A;  1URJ A;  2H3V A;  2K4E A;  2G08 A;  3T79 A;  3F5E A;  3CP8 A;  4CGZ A;  2CRX A;  3KFU F;  4P0Q B;  2ZIW B;  3IG5 A;  2Y0S C;  3M6K A;  4U6P A;  1Q3V A;  4CRX A;  2D6F C;  2H3Z A;  2RP5 A;  1DRG A;  2KHQ A;  5HR7 A;  2OH2 A;  3PZP A;  2W03 A;  2RHF A;  3O0F A;  2VJ5 A;  2G0A A;  4NLC A;  2JGA A;  4BUG A;  4NV0 A;  5T14 A;  3MGV A;  2W7P A;  1P7D A;  2HOF A;  3F2D A;  5HR6 A;  2W04 A;  2KEY A;  2K8B B;  3GZF A;  5A0L A;  4WJ3 B;  4BJQ A;  4ACO A;  1SZH A;  3VCB A;  4FZL A;  3C28 A;  1Z19 A;  1IIP A;  2K8A A;  2HBM A;  2MA1 A;  3IN5 A;  3L3F X;  2ZIU A;  1Z1B A;  4QIW C;  3CYM A;  2KKV A;  2YX8 A;  4JMU A;  4GFJ A;  4NLB A;  2LYA A;  1PVP A;  4KX3 A;  2K89 A;  4BX9 C;  2KV2 A;  2G5I B;  3H0M B;  2ZIV B;  2JH7 A;  2XVT A;  1YT3 A;  2K4H A;  2G5H B;  2H3F A;  3HKZ C;  3F2C A;  2CPR A;  4AYB F;  5C0Y A;  1A0P A;  1MA7 A;  2GH1 A;  3M6Z A;  1D8B A;  1Q3U A;  2Q4T A;  2VKQ A;  2ZIX B;  3M7D A;  4P0Q A;  2YB4 A;  2ZIW A;  4C0Z A;  2F2A B;  3ALR A;  3NUQ A;  2OXO A;  2F76 X;  2RRD A;  4CDG A;  3LVW A;  2LYB A;  1UPH A;  2F8L A;  2VIX A;  3AQF A;  3CRX A;  2YB1 A;  2N1R A;  2KD1 A;  3RF9 A;  4KMO B;  2HOI A;  2NV3 A;  2VJ4 A;  3N7R C;  1ED1 A;  2BDU A;  2PMZ C;  1T94 A;  3H0L B;  3ONN A;  2G09 A;  2LHT A;  2WAQ C;  2WB1 C;  4IC9 A;  2HOQ A;  4O3M A;  3LVV A;  3N7P D;  4P0P B;  4OJO A;  2JMG A;  2Z7J A;  4FZM A;  2H3I A;  2LBO A;  2ZG6 A;  2E1F A;  2K8C B;  3NRW A;  2E5S A;  2OM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...