2KOBA

Solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of CLOLEP_01837 (fragment 61-160) from Clostridium leptum. Northeast Structural Genomics Consortium Target QlR8A
rcsb
source organism Clostridium leptum dsm 753
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 34
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kobA01
1Z19A 4ACOA 1A0PA 1NZBA 1OUQA 1PVPA 1CRXA 2KHQA 1PVRA 1P7DA 2KKVA 1DRGA 1XO0A 5CRXA 1XNSA 3CRXA 3C29A 1KBUA 2KHVA 3C28A 1PVQA 3LYSA 2KIWA 3NRWA 4A8EA 2KOBA 3MGVA 1MA7A 2A3VA 2HOFA 2KEYA 2KD1A 1Q3UA 1F44A 2CRXA 2OXOA 2KKPA 2KJ5A 2KJ8A 2HOIA 4CRXA 2KJ9A 1Q3VA 1Z1BA
chains in the Genus database with same CATH superfamily
1JALA 1UPHA 2E1EA 2XCAA 2OYYA 1TV9A 3JPPA 1T3NA 2YMMA 4Q8EA 1FIQA 3ISDA 3HILA 1U48A 2V4RA 3D2NA 4JV2A 5J0WA 3Q8RB 5DBAA 1U49A 3C1ZA 2KSOB 3IHQB 5ALUA 3Q8LA 2PFPA 9ICIA 4IRKA 1L5UA 1ZD2P 3BQ1A 5HHHA 5KFYA 4M04A 2L5YA 4Y2JA 1ZQVA 1UA0A 2ES6A 3TFSA 9ICAA 3TAPA 4I29A 2OCEA 4GC7A 9ICCA 3SR6A 5J2EA 4EEYA 5C0YA 1RYUA 2LPEA 4F5QA 1U9LA 2JH7A 1ZQ1C 2WHEA 4G9BA 3ZDAA 8ICEA 2LBOA 2A3VA 2P6RA 1CEZA 4ED6A 4FBUA 2YMLA 1EXNA 4PPXA 1L8LA 2WB1F 1KLNA 3KD3A 5DGAA 4F4YA 2LI6A 1M6YA 2C28A 5EE9A 1WYGA 3UPQA 5AHXA 2HHUA 5KFKA 4YMNA 3AQEA 3SMVA 4O5CA 5AI9A 1KFSA 1WCNA 1XC9A 3B9JA 5GTHU 1QSLA 5D49A 3WK8A 2EZXA 8ICTA 2KG5A 3FC4A 1N61A 4F72A 4IRDA 5AKLA 3NGDA 2W03A 2RLTA 3IG5A 4TQRA 5JRTA 5DGBA 5KG7A 5EOZA 1PVRA 2RHFA 1WWVA 2AHOB 2XO7A 2XCPA 3T79A 3ZI4A 8ICHA 2PFNA 1NK8A 4IL6U 1ZQQA 4C4TA 1ZQJA 4O3OA 4LZDA 1ZQMA 5KFSA 7ICTA 4EBEA 2CXYA 4I2JA 4QZCA 4YD2A 4RNOA 3H7IA 4BWJA 5L1MA 1ZQEA 3KKAA 3H0LB 2ZTCA 2OH2A 5CEHA 2DFLA 4NWIA 4EENA 3JPTA 1U45A 4QWBA 4YN4A 1SZPA 2K89A 2XY6A 3RJHA 1V9PA 1BNOA 2F2AB 2HBLA 8ICKA 1SV0A 8ICJA 3HJEA 2HHWA 1PK1B 4P2HA 3GQCA 1RDFA 3K1RB 3QEBZ 4J9LA 1DK3A 1Z3EB 1SKWA 4KX5A 3ONNA 4KLMA 3H8WA 5J2KA 9ICRA 1B43A 3BQTA 4FO6A 1LV5A 2FE9A 5KFHA 5CB1A 4B9NA 4NM1A 3ISBA 2ODGA 3NVVA 3AUOA 4TUPA 3UXNA 3PMNA 5AM0A 8ICNA 2HOIA 3CNHA 5KFRA 3RR8A 2FLPA 3QE9Y 1QH9A 5J29A 2BCUA 2ZIUB 5L1JA 3PW4A 1S0VA 3TAQA 3EWAA 4JMUA 2XY5A 2NRVA 4Y2YA 4RQ6A 4R65A 5DQGA 2JEFA 4O3RA 1MA7A 2W7OA 3DV9A 1D8YA 1SXDA 2A1AA 1SXEA 2NRTA 1X6JA 1QCKA 3BS5B 3QU7A 2KK0A 7ICMA 2XGPA 1ZQIA 2M0NA 2ZTDA 1ZQOA 1X9XA 2J6UA 2KHQA 2IBKA 4RQ2A 5KAIU 3WK6A 1FFUA 3RJGA 4F2SA 4I2DA 3JPOA 3PX4A 3B0YA 2A1JA 4EBCA 1FEZA 3RB3A 3VC8A 5KFGA 2AGOA 3RAXA 5CP2A 8ICWA 2EQYA 4M9HA 5J2IA 1LB2B 4Z6FA 3V6HA 4P0QB 1X66A 2HVHA 3NTUA 5DBCA 2F44A 2R18A 4O3MA 3E0FA 3NVWA 3M9OB 3GIMA 1TK8A 5BOMA 7ICJA 9ICNA 2DPIA 1XU4A 5BPCA 4NXZA 5DB6A 1QTMA 1DGSA 4QJFB 4Y2TA 2LYAA 3G6YA 2JZBB 2I9GA 7ICIA 4RNMA 1L3SA 5AKKA 5ALIA 5AI0A 1Q46A 3HP6A 3F2BA 3BJYA 1T8EA 3UMCA 5J0SA 2GOLA 3WKBA 4I27A 2BQRA 5CR0A 1ZQAA 4QZIA 2QB1A 3QU9A 1NK9A 1S97A 1UQVA 3KTQA 4QWAA 4C4RA 3D6JA 4YCXA 1K1SA 2P66A 1H38A 4QZ8A 1JI7A 3M6KA 3GDXA 1SB3C 4FZNA 2HOQA 4OJ5A 3UMGA 3MFHA 4LJXA 1TKDA 5KFTA 1ZQSA 3HKZC 4NM2A 3L5KA 4GXJA 3BQ7A 1C20A 1FFVA 5ALNA 3O0FA 1ZD5A 3IDWA 2D3DA 5KT3A 1D9FA 5KT2A 4K4GA 4PH5A 3PSTA 2K4HA 3V72A 2KJ9A 3D2QA 4QIWC 4XQ8A 2FLLA 1DGJA 4UAWA 9ICQA 1SKRA 1CUKA 4GFJA 5AK3A 3H4DA 4DQPA 5ALLA 4GLXA 1QSSA 2WF7A 4M0AA 3A0HU 1KTQA 4DWIA 5D4BA 3V6JA 2HOFA 1AROP 5EE0A 5J2HA 1VLBA 3DDHA 2JV3A 7ICVA 3PVXA 4EYIB 5KG6A 1ZJNA 2VIXA 1CRXA 5KG3A 4J9RA 2HI0A 3WU2U 2ASDA 3PR5B 3NASA 4I2IA 1DXSA 2BDPA 2C2RA 2KIVA 9ICFA 4PZOA 2R8IA 4OJ6A 8ICQA 2R8KA 5TZVA 5ALHA 3GILA 2KP7A 5ALFA 8ICXA 5AIAA 1KL9A 2YTUA 2JRZA 4YR2A 5AK6A 5DG7A 4C7ZA 2EZYA 4R63A 3WK7A 1MQ3A 5DG9A 1HUOA 2DF4B 3CYMA 3QU2A 3SEIA 1K5OA 2E3TA 4Y2RA 3MDCA 2Y9TA 2WFAA 4IQTA 3PW2A 5J8YC 1KW4A 2ATLA 2JH1A 4DFPA 4FE3A 2BQ3A 3SAHA 4ECQA 2FMPA 1TAUA 5AKIA 2KTQA 1JN3A 4Q43A 3Q8PB 1N2XA 5AM3A 1ZD3A 4KX3A 5IIKA 4EBDA 3TADA 4U6PA 4FZMA 2EH9A 9ICJA 1B0XA 1SV0C 4M47A 4KLIA 2BZFA 1JUDA 2AGPA 4J03A 4TUQA 1L6NA 3WK9A 2FJ6A 4O5KA 3AMZA 2EDUA 4CE6A 4OJOA 3OJUA 2GO7A 4QZGA 4F2RA 2W7PA 2Y0SF 1TFRA 4C8LA 1HEKA 3GZFA 2JXJA 2KOBA 4AP9A 2KD1A 4DEZA 5J0OA 4I2EA 3MFIA 2XY7A 4UB6U 9ICOA 5AM5A 2NRWA 1MN8A 2Y0SC 3QZ8A 5AKZA 3QX7A 4ZH4A 3RH5A 2Q0ZX 4UB5A 3KHHA 4UASA 4ECUA 4P4OA 3EZ5A 5A0LA 5DDYA 4R8UB 2K4IA 4PL2A 3GIKA 3WKEA 8ICRA 2UVVA 1S77D 2IMWP 5J2JA 1RQLA 2NO5A 3RRHA 2MA1A 5ALEA 2IOFA 3C2MA 5KFJA 1QLNA 5KFDA 1XS9D 1RXVA 7ICSA 1Z00A 5ALVA 3NVZA 3PX0A 4DFMA 2ZIVA 5DBBA 2PMZF 2KMDA 4PGQA 2FPMA 3T5JA 4F3OA 3GU3A 1X6IA 3EW9A 5AKXA 1A6SA 4DLGA 2DBYA 2KKVA 5AM4A 3SENA 3T3FA 1ZQKA 1RZTA 5ALQA 3I28A 9ICSA 3H4BA 7ICGA 9ICPA 3BS5A 5KG5A 5J0YA 2NRXA 3OHAA 4C8KA 3ISCA 4KLUA 1SL2A 9ICTA 4UBBA 5J0PA 3WK5A 5EWEA 3M1YA 4PGYA 5J2DA 3THVA 4QZAA 4MHVA 3KZXA 3PO4A 5J8YA 4UB8U 3R9KA 2E8NA 1TAQA 4C7YA 4DOBA 2F1HA 5KG0A 3SD7A 1PUZA 1MSWD 3MDAA 2P35A 2DGZA 4DF4A 4YFKA 4JK1A 2HBMA 2BKEA 2HVIA 1SV4A 1S0MA 3PW5A 2PXIA 4DFDA 3K75D 3KKAC 5GTIU 5KG1A 3HRDD 3NRZA 4Z6DA 8ICCA 4DL2A 1YT3A 4B9UA 3ICXA 4EZ6A 2VJ4A 1GO3F 2FPKA 2ZIXA 4US8A 1JX4A 2R8HA 1X40A 3LDAA 3KHGA 4IQVA 5DB8A 5KFXA 4RQ5A 2F8LA 1D8BA 5DB7A 1B22A 4ECSA 5HR7A 4PHDA 3JPSA 4AYBF 2J6TA 1ED1A 1O03A 3QUQA 3IG8A 4F5PA 2D8CA 2E5SA 3C1YA 2OM6A 3ED5A 5K4LA 3PY8A 3AEVA 5KFNA 3C28A 3V7JA 1NJWA 4TURA 5HMMA 4ECRA 3B0XA 4K4IA 2ESEA 2W9BB 8ICUA 3ORYA 4M9LA 2CPRA 4BXOA 1QQ6A 5HMLA 7ICLA 3H8JA 2FMQA 3F2DA 4R66A 3QUBA 3S6JA 5J0XA 1KFDA 4DS5A 1RM6C 4P0QA 4NLKA 2VA8A 3E2EA 5AKYA 3F5EA 1Z4OA 4DSLA 4C4SA 4B9LA 3RJIA 2PFOA 2FI1A 1F5SA 2MSNA 3RB4A 1S8OA 3FM9A 4MF2A 3HT3A 1KSPA 5HP4A 2PFQA 4F5OA 1BPEA 2G06A 2W9MA 5KFEA 5J2AA 1ECWA 3MGVA 4CF5A 4J9MA 4UB1A 2DKZA 1F44A 3V7LA 2ZXIA 8ICZA 5ALRA 2KJ8A 1ZQZA 5F9NA 3NVYA 4Y2PA 5IIOA 1BPYA 1NKEA 2G07A 5J2GA 4YXJA 4J9NA 1J97A 3WKDA 3GFKB 3RFAA 4DFJA 1HUZA 5KNIA 4KLTA 8ICIA 5ALGA 4ECZA 5CHGA 1MQ2A 3PO5A 4RQ7A 4KLGA 5HR6A 4LVSA 4BWMA 3PX6A 1N62A 3D2SA 4QIWF 3RB6A 3PNCA 2DL0A 1L7PA 4KTQA 3MGHA 2G0AA 3ZD9A 1YZ6A 1ZQYA 4FFDA 5KFZA 1N60A 2E8PA 2GH1A 2C2DA 2KHVA 5J0QA 1ZQNA 2BCVA 3NRWA 4A8EA 4F4KA 3TI0A 2G09A 4YMMA 4MEYA 3F2CA 1LKYA 4B9VA 4CF4A 2BQUA 1UA1A 3C21A 3GV8B 2F1JA 2JEGA 1OUQA 1XWLA 4OD0A 1ZQRA 4YXMA 1NI3A 4RQNA 2ZG6A 2HBKA 2HHQA 3EUB2 4ECXA 1N5XA 4RQ0A 4PGXA 4I28A 4Q8FA 2F3NA 2IOHA 3M9MB 4XA5A 4CGZA 3QZ7A 2J6SA 1L7OA 1MC8A 5AICA 2KICA 4DLEA 2W3RA 2K8BB 3GIIA 3FYHA 4RZRA 3GIJA 5AI5A 3F53A 2XC9A 5ALPA 4O3PA 3ZDBA 1SL0A 4DQQA 3E58A 1X9WA 4I2GA 2ZIWB 4QZDA 4NY8A 1A76A 2E8MA 5J0UA 2K60A 2ZJAA 3QUTA 1BPZA 3TARA 2W3SA 5J2FA 4FS1A 4CNQA 3TFRA 4MFCA 2GWSA 3ETLA 2JR5A 1IXRA 4F5NA 2VANA 1ZQXA 3ALRA 3AQFA 5FP0A 2C22A 3UMBA 3JPRA 2VA3A 8ICSA 4NJ8A 2KVCA 2ZJ5A 4O9MA 3BZKA 3UQ0A 1L3UA 1RYRA 1COOA 3QXGA 2G5IB 2JEIA 5KFLA 1JIHA 5IIJA 5AKHA 4Y2QA 2I6XA 4P4MA 4J9SA 1JRPA 3MR6A 4M9JA 8ICPA 1NK4A 2AGQA 3ETRA 2B6GA 4KLQA 2AQ4A 5KL1B 2LYHA 1D8LA 1ZOLA 3OSPA 5CA7A 4QW9A 4TUSA 2VJ5A 4ED8A 4E0DA 4I2HA 2RRDA 8ICLA 2JEJA 4KLSA 1ZQBA 4RQ4A 4M2YA 2WB1C 5ALDA 1OXJA 3T5HA 2YX8A 4I2AA 1Z19A 9ICMA 1NZBA 4ED1A 2YN4A 2HCFA 3RF9A 3PSFA 5TISU 1P7DA 1NNLA 3SI8A 4OJLA 1XNSA 8ICBA 5H2FU 4F93B 4RT3A 1XSNA 9ICWA 1KRPA 1NK7A 2H5XA 3QEAZ 1PZNA 5ALMA 1HIWA 3UXPA 2BCRA 1RQNA 3UM9A 1UT5A 4BUGA 1ZQLA 2GLEA 2RDJA 1VDVA 1BPBA 1IM4A 1SL1A 3UXOA 4KLLA 7ICFA 7ICUA 4Z6CA 1OW5A 4UARA 5KG4A 2OHFA 1C7YA 1PK3A 2KVSA 2LKYA 1RYSA 5IIMA 4JV0A 3PSPA 4C8MA 3TADC 3SAFA 2R8GA 1ZD4A 5KL8B 3IN5A 5DB9A 3EPIA 4DL7A 2YB4A 3DEEA 2V9WA 4ECWA 1KFTA 4ED3A 4ELTA 4JWMA 2DKXA 5KT6A 5KFPA 5AK5A 5JU5A 3RR7A 1L3TA 3CP8A 5ALSA 2KNJA 2UVUA 2BHNA 4B9TA 1FO4A 4MFFA 5L1LA 3RH4A 4GXKA 1XO1A 4I2CA 1ZQFA 3GV5B 4BXOB 5J2CA 2JHDA 3KHRA 4KMUA 1DK2A 3KOOA 1WUDA 2KIWA 1ZXIA 2XI9A 2HHTA 5T14A 2LYBA 1L7NA 4IS7A 1N48A 2ASLA 4OO1J 5AI8A 4X5VA 2P6UA 1SGGA 4JB3A 1NZPA 3AU2A 4DSJA 1L3VA 7ICOA 4M6WB 5F9LA 3C5FA 4QWEA 3H0MB 5J0RA 3V6KA 4EX6A 1XSPA 5DLFA 2NYVA 3ZDCA 3LVWA 3EPGA 1ZRNA 2KV2A 2ALZA 4ELUA 4BJQA 1NKBA 3L4PA 5AI6A 5KFWA 3G6XA 3PZPA 3I76A 5C5JA 2FLNA 5DLGA 4KN7A 3T5LA 3RJKA 1QQ7A 2DWQA 2HMXA 2WF6A 4TQSA 2KE7A 4MF8A 1T4GA 4QZ9A 3QU5A 5KFVA 5AKJA 3BDPA 4UATA 4C0ZA 4QNLA 2W54A 1A0PA 2ZIXB 1V38A 1U4BA 5KFBA 4JUZA 1TE2A 2ZUDA 3C29A 4Q44A 1ZQWA 1JMSA 2K8AA 4O3NA 2KFNA 4FBTA 3RH6A 4RPXA 3RBEA 2EAOA 9ICHA 3H8SA 3OSNA 3QU4A 1KDHA 4BX9C 4JV1A 3H0RB 3HKZF 1L7MA 2A1JB 3M9NB 2H3FA 5KFMA 4KLHA 1S76D 1UCVA 1LKYB 3A0BU 4UAUA 4YR3A 4UBCA 3BQ2A 1SZHA 2IHMA 2OXOA 2PKEA 3VCBA 2ZXHA 4PZNA 1N5WA 1UT8A 3QYPA 4PHEA 3RBDA 1SKSA 4US9A 3M6ZA 3TKAA 3SYZA 2ZUCA 4J9QA 1IIPA 5AI4A 5JTIA 3HW8A 3PW7A 3KBBA 2B0CA 2KSOA 5J0TA 5L1IA 1ZQCA 4Y2XA 3OTQA 3LK9A 9ICXA 4F92B 4F91B 3HX0A 2I5HA 4M9NA 4WJ3B 1WG8A 5DDMA 4M9GA 2Y1IA 1ZQHA 2CN1A 2DUYA 4RQ8A 3MR2A 2IA6A 4EYHB 5KG2A 8ICMA 1HJPA 4IR1A 1LVHA 2ZIWA 5KFUA 4Y2SA 1ZQDA 3Q8KA 3L3FX 2RP5A 2Y1JA 9ICUA 5IIIA 3KZIU 4RQMA 2OEHA 4O0IA 2JMGA 2W9AA 4LZGA 1SIJA 5ALYA 4O3SA 5ALKA 2IOFK 4JWNA 4NLCA 2YQEA 2HHXA 3RB0A 3AU6A 4RNNA 3C2KA 3BZCA 3WKAA 3Q8QB 2NV3A 5ALTA 4UW9A 3GV7B 1QQ5A 1B4FA 3C5GA 3PW0A 2W8KA 2WAQF 2FDRA 5KT4A 4QWDA 2BCQA 5ALWA 1RXWA 3T5KA 1ZQUA 1TVAA 4UAVA 3N7SC 2QARA 2QB0B 4DF8A 3LVVA 2KZZA 1NK6A 2HDOA 4CRXA 3V7KA 2F77X 4FS2A 5KFOA 2AH5A 2G08A 2NO4A 4HAIA 2W9BA 1QSYA 2BPFA 4DL5A 3N7RC 4ZOHC 4NLGA 2C2EA 1F0MA 3QNMA 2R8JA 1XSLA 2H3ZA 5ALOA 2KKPA 2G5HB 2AQ0A 2M9NA 3PV8A 2RQ5A 4UAYA 3M8SA 2KN7A 1K1QA 1PVPA 2ZIVB 1DOQA 2ZTEA 2OWOA 2DQNB 2YY6A 7ICEA 2W8LA 1BPXA 4B9MA 3N28A 2BPGA 2WF5A 4B6JA 4RUCA 1WCLA 2LHTA 2HBJA 4ED2A 1D9DA 1VJ5A 1PK1A 4YP3A 5B66U 3F5AA 2AU0A 5ALZA 4U7CA 2W9CB 4KLJA 2QARB 3NS1A 2NRZA 3N4MB 4NLZA 1TK5A 1NJXA 1ZQPA 4ICAA 4O5EA 8ICAA 4OJPA 1X9SA 4CF3A 4AYBC 2H3IA 1RPLA 5HNKA 3MBYA 4C8OA 2Q4TA 2LM1A 1WWUA 4ECYA 7ICRA 1PVQA 1N63A 2EZZA 4QW8A 5KFCA 4ED7A 3FDSA 5CWRA 1L8OA 3JPNA 4QZEA 9ICEA 4KLEA 8ICFA 2WF8A 3ZD8A 2N1RA 5DQHA 3MC1A 2EANA 4RPZA 2FMSA 3OJSA 1V97A 1T7PA 1NK0A 3OPXA 4DS4A 4PHPA 4BGDA 4M6WA 1NJZA 2LM4A 2AXTU 1Z1VA 5EE3A 4YQWA 1KQQA 4QZHA 3C2LA 4J9KA 1Q3UA 8ICGA 2W9CA 4IQWA 2HSZA 1Z1BA 4F8RA 3K4GA 2O6KA 1ZETA 5DQIA 4NLNA 1CI4A 5JUMA 4IQUA 4PJ0U 4GXIA 7ICQA 2VA2A 4USAA 1KBUA 2BR0A 3Q8MA 3PMLA 9ICGA 5L9XA 1YZ7A 3H8MA 3AM9A 4EZ9A 2XVTA 4UB3A 1NOMA 5KAFU 5DG8A 4CCHA 3EYZA 4YG2A 3I1YA 4KLFA 1Q8KA 1ZJMA 1ZQGA 1T3QA 1AQ6A 8ICVA 3WK4A 8ICOA 3IRUA 3U26A 4MEXA 1S9FA 2QB0A 4RUAA 1URJA 2HW3A 2RDIA 1JROA 5KT7A 2PMZC 2XGQA 5DKWA 1Q3VA 3QUCA 4KLDA 1Y88A 4F5RA 3HPOA 3TACB 2A19A 2W04A 4YMOA 1SWVA 8ICYA 1BNPA 4EELA 4RPYA 9ICVA 2W55A 4FZLA 4GIBA 2IHNA 4BDPA 2I1QA 3IV6A 4NL9C 4YVZA 9ICKA 2K4EA 3IP4B 2W43A 4DSKA 4O3QA 4MFAA 2WF9A 4UB2A 1X2IA 2BCSA 2E8OA 4DSEA 1BPDA 4P0PA 1DRGA 3CRXA 4GC6A 2BDUA 3MABA 2LMRA 3NUQA 2K8CB 4YD1A 4RQ1A 2F1IA 2WTFA 1TAMA 4DCCA 4IR9A 5BOLA 3RJJA 2ZIUA 5L1KA 4ACOA 2FPLA 4XRHA 4F71A 3SV3A 1NK5A 4Y2UA 4QWCA 7ICKA 2UVWA 4ECVA 3AL0B 4R8UA 2ISPA 3JPQA 3M8RA 1TK0A 4IC9A 5F3XB 2F8KA 3RRGA 4F4WA 3H40A 7ICHA 3IM1A 3BS7A 2PI5A 4KLOA 2MUTB 9ICLA 2KZ3A 9ICBA 4DO9A 1T94A 5KFAA 2F76X 1J2MA 3N97B 2HHVA 4KMOB 2YMPA 4DFKA 4Y2VA 3SZ2A 1J2NA 4DQSA 4OCZA 4QZFA 4RU9A 2UVRA 1Z4NA 2V4QA 4DSIA 3J81j 5AK4A 4HYKA 3MR3A 4ELVA 2EAMA 4DSFA 2JGAA 4P0PB 4C8NA 5AKGA 1BVSA 2QKQA 3AN1A 2YMQA 1V85A 5CRXA 2B21A 1S5LU 1KN5A 2HHSA 3M7DA 3TANA 4RT2A 5KFIA 4IRCA 4NL9A 4P4PA 3ZDEA 1IG6A 2KFZA 5CJ7A 3MGIA 1KEJA 3RAQA 3C23A 7ICNA 2DPJA 1RG6A 1UHUA 2ISOA 1JXLA 1S0OA 1JXEA 1COKA 5KTQA 5E79U 1S0NA 4DL6A 5ALXA 5ALJA 3N7PD 4J9OA 1O08A 3PSIA 2ZUBA 2ZJ8A 2KEYA 2D6FC 3LWMA 3FAHA 4DQRA 5AIBA 5EWFA 4R64A 3ZDDA 4EX7A 3OHBA 4KN4A 2XICA 2MU2A 3CW2C 4RQ3A 2QLTA 2WAQC 5B5EU 4UQGA 2BPCA 4G3IA 3TQ1A 3SQIA 7ICPA 3MR5A 5IINA 2PI4A 2BGWA 2AJQA 2VKQA 5EWGA 2CRXA 2YB1A 1S10A 4NLBA 4F50A 3SV4A 2XIDA 5G5HA 3OGUA 2MRLA 5G5GA 5D46A 3RTVA 4Z6EA 5EE1A 5AM1A 5J2BA 4EEKA 2MAXA 4PHAA 4C80A 5AM2A 4Q45A 4YR0A 1U47A 1N56A 1SWWA 4UB4A 1KKXA 4QZBA 3Q8SB 4F4ZA 5IILA 4I2FA 2KJ5A 2EAPA 1NJYA 2H3VA 2H3QA 5HHIA 1IV8A 3SAGA 3RJEA 4I2BA 2E1FA 5AKEA 4B9SA 4DOAA 1A77A 4XUSA 4KITB 3HWTA 1Z00B 1XO0A 4DL3A 4ECTA 3RJFA 4CDGA 3LYSA 4PL1A 1X9MA 3WKCA 4ED0A 4DOCA 3G6VA 3K1ZA 2W11A 5KT5A 3PR4A 2KZMA 5KFFA 1BGXT 2K4PA 4DL4A 4DQIA 3LWLA 2JZBA 1NKCA 1ZYQA 4K4HA 3BQ0A 1ZQTA 2MUTA 3KFUF 5KFQA 2Z7JA 1ZRMA 4F4XA 2Y9UA 4NV0A 3UQ2A 3KHLA 4UAZA 4J9PA 2ASJA 1X42A
chains in the Genus database with same CATH topology
2E1EA 1UPHA 4ACOA 4BJQA 2W03A 3IG5A 2ZIUB 1PVPA 2OYYA 2XICA 2ZIVB 2G07A 2MA1A 2CN1A 2F8LA 1PVRA 2RHFA 2WAQC 3PZPA 1D8BA 4JMUA 2LKYA 3AL0B 3SQIA 1KBUA 2DQNB 3T79A 3RFAA 3D2NA 4IC9A 2HMXA 5HR7A 3M6KA 3PSPA 2ZIWA 1MA7A 2DF4B 3CYMA 2VKQA 4FZNA 2W7OA 2HOQA 4AYBF 3SAFA 4OJ5A 3ALRA 3AQFA 3L3FX 2CRXA 5KL8B 2YB1A 5HR6A 2RP5A 1ED1A 4NLBA 2ZIVA 3IN5A 1T94A 4C0ZA 2PMZF 4QIWF 3D2SA 2JH1A 2LHTA 2HBJA 4FE3A 2XVTA 2YB4A 2F76X 3DEEA 3HKZC 2XIDA 3IG8A 1A0PA 2ZIXB 4QNLA 3SAHA 4KMOB 2M0NA 2G0AA 2E5SA 2KVCA 3F5AA 3GU3A 2JMGA 4U7CA 2OM6A 2MRLA 2KHQA 3O0FA 1A6SA 2KKVA 2GH1A 4KX3A 2G5IB 3C29A 2KHVA 3C28A 3H0LB 3NRWA 4A8EA 4U6PA 2OH2A 2K8AA 4NLCA 4FZMA 2G09A 4NWIA 1URJA 4ICAA 3F2CA 3CP8A 2JGAA 3PSTA 2KNJA 4OJPA 4P0PB 2KJ5A 2K4HA 5C0YA 2KJ9A 3D2QA 2H3VA 2H3QA 4QIWC 2K89A 2PMZC 4AYBC 1Q3VA 2NV3A 3SAGA 2H3IA 3VC8A 5KL1B 1L6NA 2E1FA 2W04A 4BX9C 4GFJA 1OUQA 2Q4TA 3H0RB 2F2AB 2HBLA 3HKZF 4OJOA 2CPRA 2JH7A 1ZQ1C 2WAQF 2ZG6A 1XO0A 2HBKA 3KZXA 2H3FA 4FZLA 5CRXA 2JHDA 2W7PA 4P0QB 2Y0SF 2VJ5A 3F2DA 4CDGA 1PVQA 1HEKA 1WUDA 2KIWA 3GZFA 3LYSA 4PL1A 2LBOA 2KOBA 2RRDA 4P0QA 2A3VA 3M7DA 2XI9A 2R18A 4KX5A 3ONNA 2HOFA 4O3MA 3N7SC 3E0FA 1SZHA 4CGZA 2KD1A 3F5EA 5T14A 2OXOA 3VCBA 2LYBA 2ZXHA 2KICA 3LVVA 2WB1F 2WB1C 4CRXA 2K4EA 2K8BB 2N1RA 2YX8A 3IP4B 3K1ZA 2DGZA 4OO1J 2F77X 1Z19A 3M6ZA 2VIXA 1NZBA 1CRXA 2G08A 3RF9A 2HBMA 3PSFA 4QJFB 3AQEA 1IIPA 2Y0SC 3F53A 3OPXA 1DRGA 1P7DA 2LYAA 4P0PA 1XNSA 4OJLA 3CRXA 3SMVA 2G06A 2BDUA 3N7RC 3H0MB 3NUQA 1ECWA 3MGVA 3N7PD 3KFUF 2K8CB 5A0LA 3PSIA 2Z7JA 2H3ZA 2KEYA 4NV0A 1TAMA 1HIWA 2K4IA 3LVWA 3F2BA 2KKPA 4PL2A 2ZIWB 2ZXIA 1Q3UA 1YT3A 1F44A 2D6FC 2KJ8A 2G5HB 3ICXA 2KV2A 4OJ6A 4BUGA 2HOIA 2VJ4A 4WJ3B 1GO3F 2ZIUA 2GOLA 2ZIXA 1Z1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z19 A;  4ACO A;  1A0P A;  1NZB A;  1OUQ A;  1PVP A;  1CRX A;  2KHQ A;  1PVR A;  1P7D A;  2KKV A;  1DRG A;  1XO0 A;  5CRX A;  1XNS A;  3CRX A;  3C29 A;  1KBU A;  2KHV A;  3C28 A;  1PVQ A;  3LYS A;  2KIW A;  3NRW A;  4A8E A;  2KOB A;  3MGV A;  1MA7 A;  2A3V A;  2HOF A;  2KEY A;  2KD1 A;  1Q3U A;  1F44 A;  2CRX A;  2OXO A;  2KKP A;  2KJ5 A;  2KJ8 A;  2HOI A;  4CRX A;  2KJ9 A;  1Q3V A;  1Z1B A; 
#chains in the Genus database with same CATH topology
 1JAL A;  1UPH A;  2E1E A;  2XCA A;  2OYY A;  1TV9 A;  3JPP A;  1T3N A;  2YMM A;  4Q8E A;  1FIQ A;  3ISD A;  3HIL A;  1U48 A;  2V4R A;  3D2N A;  4JV2 A;  5J0W A;  3Q8R B;  5DBA A;  1U49 A;  3C1Z A;  2KSO B;  3IHQ B;  5ALU A;  3Q8L A;  2PFP A;  9ICI A;  4IRK A;  1L5U A;  1ZD2 P;  3BQ1 A;  5HHH A;  5KFY A;  4M04 A;  2L5Y A;  4Y2J A;  1ZQV A;  1UA0 A;  2ES6 A;  3TFS A;  9ICA A;  3TAP A;  4I29 A;  2OCE A;  4GC7 A;  9ICC A;  3SR6 A;  5J2E A;  4EEY A;  5C0Y A;  1RYU A;  2LPE A;  4F5Q A;  1U9L A;  2JH7 A;  1ZQ1 C;  2WHE A;  4G9B A;  3ZDA A;  8ICE A;  2LBO A;  2A3V A;  2P6R A;  1CEZ A;  4ED6 A;  4FBU A;  2YML A;  1EXN A;  4PPX A;  1L8L A;  2WB1 F;  1KLN A;  3KD3 A;  5DGA A;  4F4Y A;  2LI6 A;  1M6Y A;  2C28 A;  5EE9 A;  1WYG A;  3UPQ A;  5AHX A;  2HHU A;  5KFK A;  4YMN A;  3AQE A;  3SMV A;  4O5C A;  5AI9 A;  1KFS A;  1WCN A;  1XC9 A;  3B9J A;  5GTH U;  1QSL A;  5D49 A;  3WK8 A;  2EZX A;  8ICT A;  2KG5 A;  3FC4 A;  1N61 A;  4F72 A;  4IRD A;  5AKL A;  3NGD A;  2W03 A;  2RLT A;  3IG5 A;  4TQR A;  5JRT A;  5DGB A;  5KG7 A;  5EOZ A;  1PVR A;  2RHF A;  1WWV A;  2AHO B;  2XO7 A;  2XCP A;  3T79 A;  3ZI4 A;  8ICH A;  2PFN A;  1NK8 A;  4IL6 U;  1ZQQ A;  4C4T A;  1ZQJ A;  4O3O A;  4LZD A;  1ZQM A;  5KFS A;  7ICT A;  4EBE A;  2CXY A;  4I2J A;  4QZC A;  4YD2 A;  4RNO A;  3H7I A;  4BWJ A;  5L1M A;  1ZQE A;  3KKA A;  3H0L B;  2ZTC A;  2OH2 A;  5CEH A;  2DFL A;  4NWI A;  4EEN A;  3JPT A;  1U45 A;  4QWB A;  4YN4 A;  1SZP A;  2K89 A;  2XY6 A;  3RJH A;  1V9P A;  1BNO A;  2F2A B;  2HBL A;  8ICK A;  1SV0 A;  8ICJ A;  3HJE A;  2HHW A;  1PK1 B;  4P2H A;  3GQC A;  1RDF A;  3K1R B;  3QEB Z;  4J9L A;  1DK3 A;  1Z3E B;  1SKW A;  4KX5 A;  3ONN A;  4KLM A;  3H8W A;  5J2K A;  9ICR A;  1B43 A;  3BQT A;  4FO6 A;  1LV5 A;  2FE9 A;  5KFH A;  5CB1 A;  4B9N A;  4NM1 A;  3ISB A;  2ODG A;  3NVV A;  3AUO A;  4TUP A;  3UXN A;  3PMN A;  5AM0 A;  8ICN A;  2HOI A;  3CNH A;  5KFR A;  3RR8 A;  2FLP A;  3QE9 Y;  1QH9 A;  5J29 A;  2BCU A;  2ZIU B;  5L1J A;  3PW4 A;  1S0V A;  3TAQ A;  3EWA A;  4JMU A;  2XY5 A;  2NRV A;  4Y2Y A;  4RQ6 A;  4R65 A;  5DQG A;  2JEF A;  4O3R A;  1MA7 A;  2W7O A;  3DV9 A;  1D8Y A;  1SXD A;  2A1A A;  1SXE A;  2NRT A;  1X6J A;  1QCK A;  3BS5 B;  3QU7 A;  2KK0 A;  7ICM A;  2XGP A;  1ZQI A;  2M0N A;  2ZTD A;  1ZQO A;  1X9X A;  2J6U A;  2KHQ A;  2IBK A;  4RQ2 A;  5KAI U;  3WK6 A;  1FFU A;  3RJG A;  4F2S A;  4I2D A;  3JPO A;  3PX4 A;  3B0Y A;  2A1J A;  4EBC A;  1FEZ A;  3RB3 A;  3VC8 A;  5KFG A;  2AGO A;  3RAX A;  5CP2 A;  8ICW A;  2EQY A;  4M9H A;  5J2I A;  1LB2 B;  4Z6F A;  3V6H A;  4P0Q B;  1X66 A;  2HVH A;  3NTU A;  5DBC A;  2F44 A;  2R18 A;  4O3M A;  3E0F A;  3NVW A;  3M9O B;  3GIM A;  1TK8 A;  5BOM A;  7ICJ A;  9ICN A;  2DPI A;  1XU4 A;  5BPC A;  4NXZ A;  5DB6 A;  1QTM A;  1DGS A;  4QJF B;  4Y2T A;  2LYA A;  3G6Y A;  2JZB B;  2I9G A;  7ICI A;  4RNM A;  1L3S A;  5AKK A;  5ALI A;  5AI0 A;  1Q46 A;  3HP6 A;  3F2B A;  3BJY A;  1T8E A;  3UMC A;  5J0S A;  2GOL A;  3WKB A;  4I27 A;  2BQR A;  5CR0 A;  1ZQA A;  4QZI A;  2QB1 A;  3QU9 A;  1NK9 A;  1S97 A;  1UQV A;  3KTQ A;  4QWA A;  4C4R A;  3D6J A;  4YCX A;  1K1S A;  2P66 A;  1H38 A;  4QZ8 A;  1JI7 A;  3M6K A;  3GDX A;  1SB3 C;  4FZN A;  2HOQ A;  4OJ5 A;  3UMG A;  3MFH A;  4LJX A;  1TKD A;  5KFT A;  1ZQS A;  3HKZ C;  4NM2 A;  3L5K A;  4GXJ A;  3BQ7 A;  1C20 A;  1FFV A;  5ALN A;  3O0F A;  1ZD5 A;  3IDW A;  2D3D A;  5KT3 A;  1D9F A;  5KT2 A;  4K4G A;  4PH5 A;  3PST A;  2K4H A;  3V72 A;  2KJ9 A;  3D2Q A;  4QIW C;  4XQ8 A;  2FLL A;  1DGJ A;  4UAW A;  9ICQ A;  1SKR A;  1CUK A;  4GFJ A;  5AK3 A;  3H4D A;  4DQP A;  5ALL A;  4GLX A;  1QSS A;  2WF7 A;  4M0A A;  3A0H U;  1KTQ A;  4DWI A;  5D4B A;  3V6J A;  2HOF A;  1ARO P;  5EE0 A;  5J2H A;  1VLB A;  3DDH A;  2JV3 A;  7ICV A;  3PVX A;  4EYI B;  5KG6 A;  1ZJN A;  2VIX A;  1CRX A;  5KG3 A;  4J9R A;  2HI0 A;  3WU2 U;  2ASD A;  3PR5 B;  3NAS A;  4I2I A;  1DXS A;  2BDP A;  2C2R A;  2KIV A;  9ICF A;  4PZO A;  2R8I A;  4OJ6 A;  8ICQ A;  2R8K A;  5TZV A;  5ALH A;  3GIL A;  2KP7 A;  5ALF A;  8ICX A;  5AIA A;  1KL9 A;  2YTU A;  2JRZ A;  4YR2 A;  5AK6 A;  5DG7 A;  4C7Z A;  2EZY A;  4R63 A;  3WK7 A;  1MQ3 A;  5DG9 A;  1HUO A;  2DF4 B;  3CYM A;  3QU2 A;  3SEI A;  1K5O A;  2E3T A;  4Y2R A;  3MDC A;  2Y9T A;  2WFA A;  4IQT A;  3PW2 A;  5J8Y C;  1KW4 A;  2ATL A;  2JH1 A;  4DFP A;  4FE3 A;  2BQ3 A;  3SAH A;  4ECQ A;  2FMP A;  1TAU A;  5AKI A;  2KTQ A;  1JN3 A;  4Q43 A;  3Q8P B;  1N2X A;  5AM3 A;  1ZD3 A;  4KX3 A;  5IIK A;  4EBD A;  3TAD A;  4U6P A;  4FZM A;  2EH9 A;  9ICJ A;  1B0X A;  1SV0 C;  4M47 A;  4KLI A;  2BZF A;  1JUD A;  2AGP A;  4J03 A;  4TUQ A;  1L6N A;  3WK9 A;  2FJ6 A;  4O5K A;  3AMZ A;  2EDU A;  4CE6 A;  4OJO A;  3OJU A;  2GO7 A;  4QZG A;  4F2R A;  2W7P A;  2Y0S F;  1TFR A;  4C8L A;  1HEK A;  3GZF A;  2JXJ A;  2KOB A;  4AP9 A;  2KD1 A;  4DEZ A;  5J0O A;  4I2E A;  3MFI A;  2XY7 A;  4UB6 U;  9ICO A;  5AM5 A;  2NRW A;  1MN8 A;  2Y0S C;  3QZ8 A;  5AKZ A;  3QX7 A;  4ZH4 A;  3RH5 A;  2Q0Z X;  4UB5 A;  3KHH A;  4UAS A;  4ECU A;  4P4O A;  3EZ5 A;  5A0L A;  5DDY A;  4R8U B;  2K4I A;  4PL2 A;  3GIK A;  3WKE A;  8ICR A;  2UVV A;  1S77 D;  2IMW P;  5J2J A;  1RQL A;  2NO5 A;  3RRH A;  2MA1 A;  5ALE A;  2IOF A;  3C2M A;  5KFJ A;  1QLN A;  5KFD A;  1XS9 D;  1RXV A;  7ICS A;  1Z00 A;  5ALV A;  3NVZ A;  3PX0 A;  4DFM A;  2ZIV A;  5DBB A;  2PMZ F;  2KMD A;  4PGQ A;  2FPM A;  3T5J A;  4F3O A;  3GU3 A;  1X6I A;  3EW9 A;  5AKX A;  1A6S A;  4DLG A;  2DBY A;  2KKV A;  5AM4 A;  3SEN A;  3T3F A;  1ZQK A;  1RZT A;  5ALQ A;  3I28 A;  9ICS A;  3H4B A;  7ICG A;  9ICP A;  3BS5 A;  5KG5 A;  5J0Y A;  2NRX A;  3OHA A;  4C8K A;  3ISC A;  4KLU A;  1SL2 A;  9ICT A;  4UBB A;  5J0P A;  3WK5 A;  5EWE A;  3M1Y A;  4PGY A;  5J2D A;  3THV A;  4QZA A;  4MHV A;  3KZX A;  3PO4 A;  5J8Y A;  4UB8 U;  3R9K A;  2E8N A;  1TAQ A;  4C7Y A;  4DOB A;  2F1H A;  5KG0 A;  3SD7 A;  1PUZ A;  1MSW D;  3MDA A;  2P35 A;  2DGZ A;  4DF4 A;  4YFK A;  4JK1 A;  2HBM A;  2BKE A;  2HVI A;  1SV4 A;  1S0M A;  3PW5 A;  2PXI A;  4DFD A;  3K75 D;  3KKA C;  5GTI U;  5KG1 A;  3HRD D;  3NRZ A;  4Z6D A;  8ICC A;  4DL2 A;  1YT3 A;  4B9U A;  3ICX A;  4EZ6 A;  2VJ4 A;  1GO3 F;  2FPK A;  2ZIX A;  4US8 A;  1JX4 A;  2R8H A;  1X40 A;  3LDA A;  3KHG A;  4IQV A;  5DB8 A;  5KFX A;  4RQ5 A;  2F8L A;  1D8B A;  5DB7 A;  1B22 A;  4ECS A;  5HR7 A;  4PHD A;  3JPS A;  4AYB F;  2J6T A;  1ED1 A;  1O03 A;  3QUQ A;  3IG8 A;  4F5P A;  2D8C A;  2E5S A;  3C1Y A;  2OM6 A;  3ED5 A;  5K4L A;  3PY8 A;  3AEV A;  5KFN A;  3C28 A;  3V7J A;  1NJW A;  4TUR A;  5HMM A;  4ECR A;  3B0X A;  4K4I A;  2ESE A;  2W9B B;  8ICU A;  3ORY A;  4M9L A;  2CPR A;  4BXO A;  1QQ6 A;  5HML A;  7ICL A;  3H8J A;  2FMQ A;  3F2D A;  4R66 A;  3QUB A;  3S6J A;  5J0X A;  1KFD A;  4DS5 A;  1RM6 C;  4P0Q A;  4NLK A;  2VA8 A;  3E2E A;  5AKY A;  3F5E A;  1Z4O A;  4DSL A;  4C4S A;  4B9L A;  3RJI A;  2PFO A;  2FI1 A;  1F5S A;  2MSN A;  3RB4 A;  1S8O A;  3FM9 A;  4MF2 A;  3HT3 A;  1KSP A;  5HP4 A;  2PFQ A;  4F5O A;  1BPE A;  2G06 A;  2W9M A;  5KFE A;  5J2A A;  1ECW A;  3MGV A;  4CF5 A;  4J9M A;  4UB1 A;  2DKZ A;  1F44 A;  3V7L A;  2ZXI A;  8ICZ A;  5ALR A;  2KJ8 A;  1ZQZ A;  5F9N A;  3NVY A;  4Y2P A;  5IIO A;  1BPY A;  1NKE A;  2G07 A;  5J2G A;  4YXJ A;  4J9N A;  1J97 A;  3WKD A;  3GFK B;  3RFA A;  4DFJ A;  1HUZ A;  5KNI A;  4KLT A;  8ICI A;  5ALG A;  4ECZ A;  5CHG A;  1MQ2 A;  3PO5 A;  4RQ7 A;  4KLG A;  5HR6 A;  4LVS A;  4BWM A;  3PX6 A;  1N62 A;  3D2S A;  4QIW F;  3RB6 A;  3PNC A;  2DL0 A;  1L7P A;  4KTQ A;  3MGH A;  2G0A A;  3ZD9 A;  1YZ6 A;  1ZQY A;  4FFD A;  5KFZ A;  1N60 A;  2E8P A;  2GH1 A;  2C2D A;  2KHV A;  5J0Q A;  1ZQN A;  2BCV A;  3NRW A;  4A8E A;  4F4K A;  3TI0 A;  2G09 A;  4YMM A;  4MEY A;  3F2C A;  1LKY A;  4B9V A;  4CF4 A;  2BQU A;  1UA1 A;  3C21 A;  3GV8 B;  2F1J A;  2JEG A;  1OUQ A;  1XWL A;  4OD0 A;  1ZQR A;  4YXM A;  1NI3 A;  4RQN A;  2ZG6 A;  2HBK A;  2HHQ A;  3EUB 2;  4ECX A;  1N5X A;  4RQ0 A;  4PGX A;  4I28 A;  4Q8F A;  2F3N A;  2IOH A;  3M9M B;  4XA5 A;  4CGZ A;  3QZ7 A;  2J6S A;  1L7O A;  1MC8 A;  5AIC A;  2KIC A;  4DLE A;  2W3R A;  2K8B B;  3GII A;  3FYH A;  4RZR A;  3GIJ A;  5AI5 A;  3F53 A;  2XC9 A;  5ALP A;  4O3P A;  3ZDB A;  1SL0 A;  4DQQ A;  3E58 A;  1X9W A;  4I2G A;  2ZIW B;  4QZD A;  4NY8 A;  1A76 A;  2E8M A;  5J0U A;  2K60 A;  2ZJA A;  3QUT A;  1BPZ A;  3TAR A;  2W3S A;  5J2F A;  4FS1 A;  4CNQ A;  3TFR A;  4MFC A;  2GWS A;  3ETL A;  2JR5 A;  1IXR A;  4F5N A;  2VAN A;  1ZQX A;  3ALR A;  3AQF A;  5FP0 A;  2C22 A;  3UMB A;  3JPR A;  2VA3 A;  8ICS A;  4NJ8 A;  2KVC A;  2ZJ5 A;  4O9M A;  3BZK A;  3UQ0 A;  1L3U A;  1RYR A;  1COO A;  3QXG A;  2G5I B;  2JEI A;  5KFL A;  1JIH A;  5IIJ A;  5AKH A;  4Y2Q A;  2I6X A;  4P4M A;  4J9S A;  1JRP A;  3MR6 A;  4M9J A;  8ICP A;  1NK4 A;  2AGQ A;  3ETR A;  2B6G A;  4KLQ A;  2AQ4 A;  5KL1 B;  2LYH A;  1D8L A;  1ZOL A;  3OSP A;  5CA7 A;  4QW9 A;  4TUS A;  2VJ5 A;  4ED8 A;  4E0D A;  4I2H A;  2RRD A;  8ICL A;  2JEJ A;  4KLS A;  1ZQB A;  4RQ4 A;  4M2Y A;  2WB1 C;  5ALD A;  1OXJ A;  3T5H A;  2YX8 A;  4I2A A;  1Z19 A;  9ICM A;  1NZB A;  4ED1 A;  2YN4 A;  2HCF A;  3RF9 A;  3PSF A;  5TIS U;  1P7D A;  1NNL A;  3SI8 A;  4OJL A;  1XNS A;  8ICB A;  5H2F U;  4F93 B;  4RT3 A;  1XSN A;  9ICW A;  1KRP A;  1NK7 A;  2H5X A;  3QEA Z;  1PZN A;  5ALM A;  1HIW A;  3UXP A;  2BCR A;  1RQN A;  3UM9 A;  1UT5 A;  4BUG A;  1ZQL A;  2GLE A;  2RDJ A;  1VDV A;  1BPB A;  1IM4 A;  1SL1 A;  3UXO A;  4KLL A;  7ICF A;  7ICU A;  4Z6C A;  1OW5 A;  4UAR A;  5KG4 A;  2OHF A;  1C7Y A;  1PK3 A;  2KVS A;  2LKY A;  1RYS A;  5IIM A;  4JV0 A;  3PSP A;  4C8M A;  3TAD C;  3SAF A;  2R8G A;  1ZD4 A;  5KL8 B;  3IN5 A;  5DB9 A;  3EPI A;  4DL7 A;  2YB4 A;  3DEE A;  2V9W A;  4ECW A;  1KFT A;  4ED3 A;  4ELT A;  4JWM A;  2DKX A;  5KT6 A;  5KFP A;  5AK5 A;  5JU5 A;  3RR7 A;  1L3T A;  3CP8 A;  5ALS A;  2KNJ A;  2UVU A;  2BHN A;  4B9T A;  1FO4 A;  4MFF A;  5L1L A;  3RH4 A;  4GXK A;  1XO1 A;  4I2C A;  1ZQF A;  3GV5 B;  4BXO B;  5J2C A;  2JHD A;  3KHR A;  4KMU A;  1DK2 A;  3KOO A;  1WUD A;  2KIW A;  1ZXI A;  2XI9 A;  2HHT A;  5T14 A;  2LYB A;  1L7N A;  4IS7 A;  1N48 A;  2ASL A;  4OO1 J;  5AI8 A;  4X5V A;  2P6U A;  1SGG A;  4JB3 A;  1NZP A;  3AU2 A;  4DSJ A;  1L3V A;  7ICO A;  4M6W B;  5F9L A;  3C5F A;  4QWE A;  3H0M B;  5J0R A;  3V6K A;  4EX6 A;  1XSP A;  5DLF A;  2NYV A;  3ZDC A;  3LVW A;  3EPG A;  1ZRN A;  2KV2 A;  2ALZ A;  4ELU A;  4BJQ A;  1NKB A;  3L4P A;  5AI6 A;  5KFW A;  3G6X A;  3PZP A;  3I76 A;  5C5J A;  2FLN A;  5DLG A;  4KN7 A;  3T5L A;  3RJK A;  1QQ7 A;  2DWQ A;  2HMX A;  2WF6 A;  4TQS A;  2KE7 A;  4MF8 A;  1T4G A;  4QZ9 A;  3QU5 A;  5KFV A;  5AKJ A;  3BDP A;  4UAT A;  4C0Z A;  4QNL A;  2W54 A;  1A0P A;  2ZIX B;  1V38 A;  1U4B A;  5KFB A;  4JUZ A;  1TE2 A;  2ZUD A;  3C29 A;  4Q44 A;  1ZQW A;  1JMS A;  2K8A A;  4O3N A;  2KFN A;  4FBT A;  3RH6 A;  4RPX A;  3RBE A;  2EAO A;  9ICH A;  3H8S A;  3OSN A;  3QU4 A;  1KDH A;  4BX9 C;  4JV1 A;  3H0R B;  3HKZ F;  1L7M A;  2A1J B;  3M9N B;  2H3F A;  5KFM A;  4KLH A;  1S76 D;  1UCV A;  1LKY B;  3A0B U;  4UAU A;  4YR3 A;  4UBC A;  3BQ2 A;  1SZH A;  2IHM A;  2OXO A;  2PKE A;  3VCB A;  2ZXH A;  4PZN A;  1N5W A;  1UT8 A;  3QYP A;  4PHE A;  3RBD A;  1SKS A;  4US9 A;  3M6Z A;  3TKA A;  3SYZ A;  2ZUC A;  4J9Q A;  1IIP A;  5AI4 A;  5JTI A;  3HW8 A;  3PW7 A;  3KBB A;  2B0C A;  2KSO A;  5J0T A;  5L1I A;  1ZQC A;  4Y2X A;  3OTQ A;  3LK9 A;  9ICX A;  4F92 B;  4F91 B;  3HX0 A;  2I5H A;  4M9N A;  4WJ3 B;  1WG8 A;  5DDM A;  4M9G A;  2Y1I A;  1ZQH A;  2CN1 A;  2DUY A;  4RQ8 A;  3MR2 A;  2IA6 A;  4EYH B;  5KG2 A;  8ICM A;  1HJP A;  4IR1 A;  1LVH A;  2ZIW A;  5KFU A;  4Y2S A;  1ZQD A;  3Q8K A;  3L3F X;  2RP5 A;  2Y1J A;  9ICU A;  5III A;  3KZI U;  4RQM A;  2OEH A;  4O0I A;  2JMG A;  2W9A A;  4LZG A;  1SIJ A;  5ALY A;  4O3S A;  5ALK A;  2IOF K;  4JWN A;  4NLC A;  2YQE A;  2HHX A;  3RB0 A;  3AU6 A;  4RNN A;  3C2K A;  3BZC A;  3WKA A;  3Q8Q B;  2NV3 A;  5ALT A;  4UW9 A;  3GV7 B;  1QQ5 A;  1B4F A;  3C5G A;  3PW0 A;  2W8K A;  2WAQ F;  2FDR A;  5KT4 A;  4QWD A;  2BCQ A;  5ALW A;  1RXW A;  3T5K A;  1ZQU A;  1TVA A;  4UAV A;  3N7S C;  2QAR A;  2QB0 B;  4DF8 A;  3LVV A;  2KZZ A;  1NK6 A;  2HDO A;  4CRX A;  3V7K A;  2F77 X;  4FS2 A;  5KFO A;  2AH5 A;  2G08 A;  2NO4 A;  4HAI A;  2W9B A;  1QSY A;  2BPF A;  4DL5 A;  3N7R C;  4ZOH C;  4NLG A;  2C2E A;  1F0M A;  3QNM A;  2R8J A;  1XSL A;  2H3Z A;  5ALO A;  2KKP A;  2G5H B;  2AQ0 A;  2M9N A;  3PV8 A;  2RQ5 A;  4UAY A;  3M8S A;  2KN7 A;  1K1Q A;  1PVP A;  2ZIV B;  1DOQ A;  2ZTE A;  2OWO A;  2DQN B;  2YY6 A;  7ICE A;  2W8L A;  1BPX A;  4B9M A;  3N28 A;  2BPG A;  2WF5 A;  4B6J A;  4RUC A;  1WCL A;  2LHT A;  2HBJ A;  4ED2 A;  1D9D A;  1VJ5 A;  1PK1 A;  4YP3 A;  5B66 U;  3F5A A;  2AU0 A;  5ALZ A;  4U7C A;  2W9C B;  4KLJ A;  2QAR B;  3NS1 A;  2NRZ A;  3N4M B;  4NLZ A;  1TK5 A;  1NJX A;  1ZQP A;  4ICA A;  4O5E A;  8ICA A;  4OJP A;  1X9S A;  4CF3 A;  4AYB C;  2H3I A;  1RPL A;  5HNK A;  3MBY A;  4C8O A;  2Q4T A;  2LM1 A;  1WWU A;  4ECY A;  7ICR A;  1PVQ A;  1N63 A;  2EZZ A;  4QW8 A;  5KFC A;  4ED7 A;  3FDS A;  5CWR A;  1L8O A;  3JPN A;  4QZE A;  9ICE A;  4KLE A;  8ICF A;  2WF8 A;  3ZD8 A;  2N1R A;  5DQH A;  3MC1 A;  2EAN A;  4RPZ A;  2FMS A;  3OJS A;  1V97 A;  1T7P A;  1NK0 A;  3OPX A;  4DS4 A;  4PHP A;  4BGD A;  4M6W A;  1NJZ A;  2LM4 A;  2AXT U;  1Z1V A;  5EE3 A;  4YQW A;  1KQQ A;  4QZH A;  3C2L A;  4J9K A;  1Q3U A;  8ICG A;  2W9C A;  4IQW A;  2HSZ A;  1Z1B A;  4F8R A;  3K4G A;  2O6K A;  1ZET A;  5DQI A;  4NLN A;  1CI4 A;  5JUM A;  4IQU A;  4PJ0 U;  4GXI A;  7ICQ A;  2VA2 A;  4USA A;  1KBU A;  2BR0 A;  3Q8M A;  3PML A;  9ICG A;  5L9X A;  1YZ7 A;  3H8M A;  3AM9 A;  4EZ9 A;  2XVT A;  4UB3 A;  1NOM A;  5KAF U;  5DG8 A;  4CCH A;  3EYZ A;  4YG2 A;  3I1Y A;  4KLF A;  1Q8K A;  1ZJM A;  1ZQG A;  1T3Q A;  1AQ6 A;  8ICV A;  3WK4 A;  8ICO A;  3IRU A;  3U26 A;  4MEX A;  1S9F A;  2QB0 A;  4RUA A;  1URJ A;  2HW3 A;  2RDI A;  1JRO A;  5KT7 A;  2PMZ C;  2XGQ A;  5DKW A;  1Q3V A;  3QUC A;  4KLD A;  1Y88 A;  4F5R A;  3HPO A;  3TAC B;  2A19 A;  2W04 A;  4YMO A;  1SWV A;  8ICY A;  1BNP A;  4EEL A;  4RPY A;  9ICV A;  2W55 A;  4FZL A;  4GIB A;  2IHN A;  4BDP A;  2I1Q A;  3IV6 A;  4NL9 C;  4YVZ A;  9ICK A;  2K4E A;  3IP4 B;  2W43 A;  4DSK A;  4O3Q A;  4MFA A;  2WF9 A;  4UB2 A;  1X2I A;  2BCS A;  2E8O A;  4DSE A;  1BPD A;  4P0P A;  1DRG A;  3CRX A;  4GC6 A;  2BDU A;  3MAB A;  2LMR A;  3NUQ A;  2K8C B;  4YD1 A;  4RQ1 A;  2F1I A;  2WTF A;  1TAM A;  4DCC A;  4IR9 A;  5BOL A;  3RJJ A;  2ZIU A;  5L1K A;  4ACO A;  2FPL A;  4XRH A;  4F71 A;  3SV3 A;  1NK5 A;  4Y2U A;  4QWC A;  7ICK A;  2UVW A;  4ECV A;  3AL0 B;  4R8U A;  2ISP A;  3JPQ A;  3M8R A;  1TK0 A;  4IC9 A;  5F3X B;  2F8K A;  3RRG A;  4F4W A;  3H40 A;  7ICH A;  3IM1 A;  3BS7 A;  2PI5 A;  4KLO A;  2MUT B;  9ICL A;  2KZ3 A;  9ICB A;  4DO9 A;  1T94 A;  5KFA A;  2F76 X;  1J2M A;  3N97 B;  2HHV A;  4KMO B;  2YMP A;  4DFK A;  4Y2V A;  3SZ2 A;  1J2N A;  4DQS A;  4OCZ A;  4QZF A;  4RU9 A;  2UVR A;  1Z4N A;  2V4Q A;  4DSI A;  3J81 j;  5AK4 A;  4HYK A;  3MR3 A;  4ELV A;  2EAM A;  4DSF A;  2JGA A;  4P0P B;  4C8N A;  5AKG A;  1BVS A;  2QKQ A;  3AN1 A;  2YMQ A;  1V85 A;  5CRX A;  2B21 A;  1S5L U;  1KN5 A;  2HHS A;  3M7D A;  3TAN A;  4RT2 A;  5KFI A;  4IRC A;  4NL9 A;  4P4P A;  3ZDE A;  1IG6 A;  2KFZ A;  5CJ7 A;  3MGI A;  1KEJ A;  3RAQ A;  3C23 A;  7ICN A;  2DPJ A;  1RG6 A;  1UHU A;  2ISO A;  1JXL A;  1S0O A;  1JXE A;  1COK A;  5KTQ A;  5E79 U;  1S0N A;  4DL6 A;  5ALX A;  5ALJ A;  3N7P D;  4J9O A;  1O08 A;  3PSI A;  2ZUB A;  2ZJ8 A;  2KEY A;  2D6F C;  3LWM A;  3FAH A;  4DQR A;  5AIB A;  5EWF A;  4R64 A;  3ZDD A;  4EX7 A;  3OHB A;  4KN4 A;  2XIC A;  2MU2 A;  3CW2 C;  4RQ3 A;  2QLT A;  2WAQ C;  5B5E U;  4UQG A;  2BPC A;  4G3I A;  3TQ1 A;  3SQI A;  7ICP A;  3MR5 A;  5IIN A;  2PI4 A;  2BGW A;  2AJQ A;  2VKQ A;  5EWG A;  2CRX A;  2YB1 A;  1S10 A;  4NLB A;  4F50 A;  3SV4 A;  2XID A;  5G5H A;  3OGU A;  2MRL A;  5G5G A;  5D46 A;  3RTV A;  4Z6E A;  5EE1 A;  5AM1 A;  5J2B A;  4EEK A;  2MAX A;  4PHA A;  4C80 A;  5AM2 A;  4Q45 A;  4YR0 A;  1U47 A;  1N56 A;  1SWW A;  4UB4 A;  1KKX A;  4QZB A;  3Q8S B;  4F4Z A;  5IIL A;  4I2F A;  2KJ5 A;  2EAP A;  1NJY A;  2H3V A;  2H3Q A;  5HHI A;  1IV8 A;  3SAG A;  3RJE A;  4I2B A;  2E1F A;  5AKE A;  4B9S A;  4DOA A;  1A77 A;  4XUS A;  4KIT B;  3HWT A;  1Z00 B;  1XO0 A;  4DL3 A;  4ECT A;  3RJF A;  4CDG A;  3LYS A;  4PL1 A;  1X9M A;  3WKC A;  4ED0 A;  4DOC A;  3G6V A;  3K1Z A;  2W11 A;  5KT5 A;  3PR4 A;  2KZM A;  5KFF A;  1BGX T;  2K4P A;  4DL4 A;  4DQI A;  3LWL A;  2JZB A;  1NKC A;  1ZYQ A;  4K4H A;  3BQ0 A;  1ZQT A;  2MUT A;  3KFU F;  5KFQ A;  2Z7J A;  1ZRM A;  4F4X A;  2Y9U A;  4NV0 A;  3UQ2 A;  3KHL A;  4UAZ A;  4J9P A;  2ASJ A;  1X42 A; 
#chains in the Genus database with same CATH homology
 2E1E A;  1UPH A;  4ACO A;  4BJQ A;  2W03 A;  3IG5 A;  2ZIU B;  1PVP A;  2OYY A;  2XIC A;  2ZIV B;  2G07 A;  2MA1 A;  2CN1 A;  2F8L A;  1PVR A;  2RHF A;  2WAQ C;  3PZP A;  1D8B A;  4JMU A;  2LKY A;  3AL0 B;  3SQI A;  1KBU A;  2DQN B;  3T79 A;  3RFA A;  3D2N A;  4IC9 A;  2HMX A;  5HR7 A;  3M6K A;  3PSP A;  2ZIW A;  1MA7 A;  2DF4 B;  3CYM A;  2VKQ A;  4FZN A;  2W7O A;  2HOQ A;  4AYB F;  3SAF A;  4OJ5 A;  3ALR A;  3AQF A;  3L3F X;  2CRX A;  5KL8 B;  2YB1 A;  5HR6 A;  2RP5 A;  1ED1 A;  4NLB A;  2ZIV A;  3IN5 A;  1T94 A;  4C0Z A;  2PMZ F;  4QIW F;  3D2S A;  2JH1 A;  2LHT A;  2HBJ A;  4FE3 A;  2XVT A;  2YB4 A;  2F76 X;  3DEE A;  3HKZ C;  2XID A;  3IG8 A;  1A0P A;  2ZIX B;  4QNL A;  3SAH A;  4KMO B;  2M0N A;  2G0A A;  2E5S A;  2KVC A;  3F5A A;  3GU3 A;  2JMG A;  4U7C A;  2OM6 A;  2MRL A;  2KHQ A;  3O0F A;  1A6S A;  2KKV A;  2GH1 A;  4KX3 A;  2G5I B;  3C29 A;  2KHV A;  3C28 A;  3H0L B;  3NRW A;  4A8E A;  4U6P A;  2OH2 A;  2K8A A;  4NLC A;  4FZM A;  2G09 A;  4NWI A;  1URJ A;  4ICA A;  3F2C A;  3CP8 A;  2JGA A;  3PST A;  2KNJ A;  4OJP A;  4P0P B;  2KJ5 A;  2K4H A;  5C0Y A;  2KJ9 A;  3D2Q A;  2H3V A;  2H3Q A;  4QIW C;  2K89 A;  2PMZ C;  4AYB C;  1Q3V A;  2NV3 A;  3SAG A;  2H3I A;  3VC8 A;  5KL1 B;  1L6N A;  2E1F A;  2W04 A;  4BX9 C;  4GFJ A;  1OUQ A;  2Q4T A;  3H0R B;  2F2A B;  2HBL A;  3HKZ F;  4OJO A;  2CPR A;  2JH7 A;  1ZQ1 C;  2WAQ F;  2ZG6 A;  1XO0 A;  2HBK A;  3KZX A;  2H3F A;  4FZL A;  5CRX A;  2JHD A;  2W7P A;  4P0Q B;  2Y0S F;  2VJ5 A;  3F2D A;  4CDG A;  1PVQ A;  1HEK A;  1WUD A;  2KIW A;  3GZF A;  3LYS A;  4PL1 A;  2LBO A;  2KOB A;  2RRD A;  4P0Q A;  2A3V A;  3M7D A;  2XI9 A;  2R18 A;  4KX5 A;  3ONN A;  2HOF A;  4O3M A;  3N7S C;  3E0F A;  1SZH A;  4CGZ A;  2KD1 A;  3F5E A;  5T14 A;  2OXO A;  3VCB A;  2LYB A;  2ZXH A;  2KIC A;  3LVV A;  2WB1 F;  2WB1 C;  4CRX A;  2K4E A;  2K8B B;  2N1R A;  2YX8 A;  3IP4 B;  3K1Z A;  2DGZ A;  4OO1 J;  2F77 X;  1Z19 A;  3M6Z A;  2VIX A;  1NZB A;  1CRX A;  2G08 A;  3RF9 A;  2HBM A;  3PSF A;  4QJF B;  3AQE A;  1IIP A;  2Y0S C;  3F53 A;  3OPX A;  1DRG A;  1P7D A;  2LYA A;  4P0P A;  1XNS A;  4OJL A;  3CRX A;  3SMV A;  2G06 A;  2BDU A;  3N7R C;  3H0M B;  3NUQ A;  1ECW A;  3MGV A;  3N7P D;  3KFU F;  2K8C B;  5A0L A;  3PSI A;  2Z7J A;  2H3Z A;  2KEY A;  4NV0 A;  1TAM A;  1HIW A;  2K4I A;  3LVW A;  3F2B A;  2KKP A;  4PL2 A;  2ZIW B;  2ZXI A;  1Q3U A;  1YT3 A;  1F44 A;  2D6F C;  2KJ8 A;  2G5H B;  3ICX A;  2KV2 A;  4OJ6 A;  4BUG A;  2HOI A;  2VJ4 A;  4WJ3 B;  1GO3 F;  2ZIU A;  2GOL A;  2ZIX A;  1Z1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...