2KOBA

Solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR structure of CLOLEP_01837 (fragment 61-160) from Clostridium leptum. Northeast Structural Genomics Consortium Target QlR8A
rcsb
source organism Clostridium leptum dsm 753
molecule tags Structural genomics, unknown function
total genus 34
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kobA01
2KHQA 1A0PA 1KBUA 2CRXA 1DRGA 1NZBA 1Z1BA 1PVQA 5CRXA 3C28A 4A8EA 1Q3VA 2KJ9A 2KJ5A 2KIWA 2KJ8A 3C29A 2HOIA 2KOBA 1P7DA 3NRWA 1Z19A 2A3VA 2KEYA 4ACOA 1XO0A 1PVPA 2OXOA 1Q3UA 3CRXA 1CRXA 2KKVA 3LYSA 3MGVA 2KD1A 1F44A 2HOFA 2KHVA 2KKPA 4CRXA 1XNSA 1OUQA 1PVRA 1MA7A
chains in the Genus database with same CATH superfamily
1B22A 5L1MA 2YN4A 4CCHA 1PK1A 4JB3A 1D8LA 1MSWD 4Y2PA 4ED6A 3VCBA 4M6WB 2D6FC 1TVAA 4U7CA 3HT3A 4YQWA 2XICA 4Y2TA 2K89A 1IXRA 5KFMA 1JI7A 3PSTA 2ZIUB 5HHHA 9ICXA 1U45A 5DGBA 1DOQA 4RUCA 4B9LA 1BNOA 3SENA 5JUMA 3TI0A 3AL0B 3RR8A 2XO7A 3I28A 1HUOA 2YQEA 1SB3C 2ODGA 3C28A 2E1FA 2W54A 4YMOA 3H4BA 1ZQMA 4OO1J 2G09A 1FFUA 1SV0A 8ICFA 4KLEA 5KG2A 3OTQA 4YXJA 4EZ9A 2DF4B 2ESEA 1N2XA 1XC9A 1SKSA 1X9MA 1Y88A 3OHAA 2XC9A 3V7KA 1SWVA 2E8NA 4UAYA 1L3UA 4PL2A 4G9BA 3C23A 4DF4A 9ICRA 1ZQDA 2W9MA 4O3PA 5KT2A 8ICVA 3GV7B 3EYZA 4EZ6A 1YZ7A 2F2AB 5ALVA 3EPGA 2ASDA 5AM5A 3JPNA 1VDVA 2HHWA 2HBLA 3TAPA 2W8LA 4DL4A 4YCXA 2AQ0A 5DG9A 4Z6FA 2H3QA 4XA5A 4FBTA 4KLGA 4J03A 2JH1A 4RQMA 2JZBB 5J2AA 2D8CA 1QCKA 4ELTA 2ZIXA 4UB5A 5DG8A 1UQVA 2LPEA 4J9MA 3LWMA 3K1RB 5KT7A 2BHNA 4KTQA 4UB8U 1WYGA 5ALJA 1BPDA 3HX0A 5ALHA 1WWUA 2XCAA 9ICGA 4P0PB 4CF5A 5ALZA 5KG5A 2W55A 3ISDA 2IOHA 2GLEA 3T79A 3F2DA 2KP7A 4LZDA 3SZ2A 2CPRA 3Q8QB 3O0FA 2ISOA 3Q8MA 1BVSA 2NYVA 4C4RA 1BPYA 3NVWA 4OCZA 1S0VA 4RQ6A 3BS7A 5EWGA 1ZQLA 2BQ3A 5KFIA 8ICMA 4DOAA 3C2KA 8ICEA 2HBKA 4F5QA 4R8UA 1JN3A 3UXNA 3G6VA 3SQIA 3PZPA 4ECWA 3OJUA 2YB1A 4DO9A 4RU9A 3DDHA 4PHDA 3QNMA 1Z00B 7ICTA 5KFKA 1F0MA 2XY7A 5DBAA 2LI6A 4QIWC 7ICVA 2DFLA 4DLEA 2MUTB 3AEVA 1RPLA 4ED8A 2HI0A 4ECXA 4PZNA 5HR7A 3TKAA 5J8YA 4C4TA 2NRXA 3RB0A 4AP9A 5F3XB 2IMWP 3HPOA 3M8SA 4LVSA 1N62A 4FBUA 2IHNA 1K1SA 5KT6A 5ALEA 4QZFA 1COOA 4TQSA 1JROA 2R8IA 1RZTA 1HUZA 1BNPA 2KV2A 5DDYA 2KE7A 2HOIA 4PHEA 4J9LA 3S6JA 4NM2A 4YVZA 3TARA 3HKZC 4CDGA 4XQ8A 3PW0A 2BPCA 2ZUCA 2BGWA 4KLHA 2ZIWA 3GIMA 4DQSA 2E5SA 4E0DA 3CW2C 3KKAA 3MFIA 1BPEA 3RBEA 1D9FA 5DLGA 3FM9A 4M0AA 4Q44A 1TK8A 4DSFA 3F5AA 3LDAA 3TQ1A 4NLGA 7ICQA 3PY8A 3PMLA 2BCRA 4NLKA 4B9MA 2PKEA 1ZYQA 5ALIA 2BPGA 2W03A 2UVRA 2WAQF 5EOZA 1NK4A 1DGSA 7ICPA 2Y9UA 5AKZA 5KFOA 2PFPA 2DUYA 1B43A 4GXKA 5KL1B 4DFDA 3H8JA 3FYHA 1NI3A 3OSPA 2P6RA 2W7PA 1A6SA 4Q43A 3KFUF 3EPIA 4DEZA 5F9LA 2AGPA 3N4MB 1X9XA 5HR6A 4CRXA 4ECUA 3SAGA 4ECTA 2K8CB 4KMUA 4KLJA 5J29A 3VC8A 4RQ0A 4HYKA 1SV0C 4Y2VA 1V97A 3H0MB 1T8EA 1D8YA 3MC1A 4J9QA 4LJXA 4P0QB 3ZDAA 4I2DA 4YN4A 1ZQRA 3RJEA 2HBJA 1DK2A 3PV8A 1QQ7A 2VKQA 3KBBA 4Y2YA 2K8AA 4EBCA 2Y0SF 5L1JA 4O0IA 3WKEA 2KOBA 3J81j 1SWWA 1Z19A 3D6JA 5HHIA 4NV0A 5KAFU 4F4KA 1WCNA 3PO4A 4BWMA 9ICSA 3E0FA 2AH5A 4IRCA 4IRKA 2EAPA 4O3SA 3M7DA 1LB2B 4I2GA 4NJ8A 1T3NA 1L7MA 1P7DA 1FEZA 2KNJA 2NO4A 4B9TA 3QEBZ 1SKRA 5J2CA 1HJPA 4O5EA 3MGVA 5AI8A 2XY6A 4ZH4A 4UAVA 3F2BA 1UT8A 3MDAA 2CRXA 3MGHA 9ICHA 3GV5B 4I2JA 2DWQA 2JEJA 4FZNA 4G3IA 3UMCA 1S9FA 1UHUA 2KZZA 4KLDA 1L8LA 4DL7A 5KTQA 3CRXA 1ZQKA 3IM1A 3ZDCA 5JTIA 5DB9A 5DBBA 2FPKA 2G5HB 4MF2A 3GILA 4QZHA 5ALDA 4RNMA 1ZQIA 4ECVA 5AIAA 1A77A 4OJLA 5KFFA 4DF8A 2WF9A 5IIOA 2ZIVB 2F8LA 4NY8A 3M1YA 2XGQA 4HAIA 1ZQFA 3SD7A 1T94A 2P6UA 3M9OB 4RQNA 1Q8KA 2LYHA 1O03A 1ZQQA 1YZ6A 4F50A 3ZD8A 4R66A 5DQIA 5KFRA 3C2MA 5J8YC 5L1IA 2PMZC 3WU2U 2AGOA 2BPFA 1L3SA 3TACB 2R18A 2ISPA 3DV9A 4F2RA 4IQTA 2KKVA 1S10A 2LHTA 4B9NA 1IIPA 1UA1A 3HP6A 3KZIU 3PW7A 2BCSA 9ICKA 4M2YA 1RG6A 2A1AA 1SZPA 1U47A 1NNLA 4BX9C 3JPPA 5HMLA 5KFDA 3WK5A 4C8KA 3RB4A 3JPSA 3KKAC 5AK3A 5ALUA 2F1IA 4FFDA 4I2EA 1UPHA 2LMRA 4PHAA 5L9XA 4DOBA 2BCUA 1KRPA 7ICHA 5HMMA 1KFDA 4YR3A 3BQTA 1T3QA 1O08A 2I5HA 4JUZA 3CNHA 2FE9A 4NLBA 4OD0A 1NOMA 7ICFA 2A1JB 7ICGA 1QLNA 4ED1A 4DS4A 2NRTA 3ONNA 2LBOA 5BPCA 3JPTA 1UT5A 2P35A 1SL1A 1QSSA 5KT3A 3RRGA 3MGIA 2E1EA 4B6JA 5J0YA 3WK8A 8ICYA 4F72A 3T5KA 2BDPA 5ALMA 4YD2A 4IQWA 3OSNA 2HVIA 1T7PA 2HHUA 2YX8A 4C8MA 1V38A 3E58A 4Y2QA 3IP4B 3H40A 4DL5A 4BDPA 5CWRA 5KT4A 2GH1A 2EZZA 3RJGA 3TAQA 3V7JA 3BZKA 3M9MB 3MR6A 4RQ7A 2M9NA 5KFLA 5J2KA 2WTFA 7ICJA 5AK6A 2WB1F 1N63A 1NJYA 2KN7A 3UPQA 4F4XA 2C2DA 4EEYA 8ICQA 2JH7A 4QNLA 3NTUA 5J2GA 3RF9A 2H3IA 3MFHA 1TK5A 4UB3A 1PK3A 1ZQNA 4A8EA 3C29A 4YMMA 4AYBF 3BJYA 2QB0A 2QLTA 1IG6A 3FAHA 2R8JA 2DL0A 2C2RA 4J9PA 3WKAA 4DFMA 4KITB 2AU0A 2VA2A 5CR0A 3NS1A 1QH9A 3TFSA 2Z7JA 4KN7A 3KHLA 3SYZA 1TK0A 4UB2A 4EENA 1KBUA 2FLNA 2F8KA 2KJ8A 2FMSA 3B0YA 5B5EU 5C0YA 3OJSA 4I2FA 4QIWF 3PR5B 4PGQA 1GO3F 2ZG6A 2XI9A 1ZQAA 1KFSA 2YMPA 1BGXT 1JIHA 2KSOB 5J0TA 1MA7A 4WJ3B 5J2EA 1RYSA 3C21A 2A19A 2ZJ5A 5DB6A 5EE3A 2BCQA 2HHSA 2KJ5A 3ALRA 1X6JA 3WKDA 5EWFA 4DLGA 3GDXA 3HKZF 5D4BA 1KW4A 2Y9TA 2F1JA 2YY6A 1F5SA 1TE2A 1XSPA 3GQCA 2QB1A 4M9LA 3GV8B 3G6YA 3ICXA 5HNKA 1S0MA 3GIIA 3OHBA 4BXOB 1IM4A 5AKEA 5E79U 5AKIA 1Z4OA 4F93B 4EYIB 2F76X 2J6SA 1Q46A 3V72A 3NVVA 1KEJA 4UBCA 4F5PA 4ECYA 3RJKA 4ED2A 5ALTA 1L5UA 1WCLA 5EE9A 5DBCA 3T5JA 3RR7A 3PX6A 2FLLA 1X9SA 5KFGA 4EBDA 2NRVA 5KG0A 5L1KA 1RYUA 4CE6A 2W9BB 4KX3A 4ZOHC 1ZQ1C 5K4LA 4U6PA 1BPXA 4DL3A 2JEFA 4KMOB 4GC6A 5DQGA 3ORYA 1SGGA 5AKYA 1KQQA 8ICAA 3SMVA 2CXYA 3AM9A 3KOOA 5AKXA 3PSFA 5AM4A 2HVHA 2Y1IA 2OH2A 8ICTA 4DCCA 2AHOB 1M6YA 1ZQEA 4NLCA 4C7YA 1ECWA 3PW4A 3N7RC 4M9NA 2GOLA 3V6KA 2EZYA 4UATA 5AKJA 4QW9A 1PUZA 1LKYA 3N7SC 4EX7A 3I1YA 1RXVA 1S0OA 1NJZA 2E3TA 3V6HA 1KDHA 1L6NA 2C28A 3UM9A 5T14A 2RLTA 1UA0A 1ZQUA 5EE0A 4QZDA 3M6KA 3U26A 4P2HA 4DQIA 3PMNA 5IIKA 3SI8A 2KHQA 3C5FA 4CF4A 2NRWA 1ZJMA 1ZQVA 3TADA 3AQFA 4RT3A 2KIWA 4O3MA 4F2SA 3PSIA 4UW9A 2RHFA 4JWMA 4MFCA 2AGQA 4JV0A 3RJFA 2O6KA 4DSIA 4EELA 2QARA 2AJQA 5JRTA 5KFYA 1KLNA 3NASA 3ZD9A 4KLTA 2EDUA 5BOLA 1ZQHA 1T4GA 5J2BA 2H3VA 5KG3A 2Y1JA 2KEYA 5KG4A 4JV1A 4IQUA 2FMQA 3BQ1A 4F3OA 3KZXA 4QZBA 2PFNA 1J97A 4DFPA 2DBYA 2D3DA 1FO4A 2W43A 2XY5A 1JALA 2B6GA 3QUCA 1A0PA 1PVQA 2OYYA 4DSLA 4O5CA 3QU9A 5FP0A 3C1YA 1DK3A 1PVPA 1ZQZA 4IQVA 5EWEA 2I9GA 1MN8A 4EBEA 4MEYA 1UCVA 4F5OA 2PI4A 3V6JA 2MA1A 2PFOA 2K60A 4YG2A 3RJIA 2EZXA 4P4OA 3AQEA 5DLFA 2W9CA 2A1JA 3I76A 1PK1B 4UB6U 1L7NA 3SV3A 1ZJNA 2W3RA 1DGJA 1U9LA 3NGDA 1COKA 4QZEA 3K75D 3BS5A 1QSYA 5KL8B 2KHVA 4I2HA 5ALFA 1L8OA 1NJWA 2YMQA 3RRHA 1CI4A 4NWIA 3KTQA 3QZ8A 4QZ9A 5KNIA 7ICKA 2NRZA 1LVHA 5KFNA 3PW5A 3MDCA 1KTQA 5DG7A 9ICFA 2KFZA 9ICCA 5KG1A 3RFAA 4TQRA 4I29A 1KKXA 4M04A 4B9SA 2MSNA 2G5IB 4GXJA 5KFWA 3PW2A 5J0RA 2H3FA 3EZ5A 2EAMA 2B0CA 1S76D 1NK7A 2ZJAA 3PR4A 4R64A 2BQRA 3RH4A 2HHXA 4PPXA 4UASA 3AN1A 4RZRA 3K4GA 3ZDBA 1J2MA 1PZNA 3NRWA 2WF8A 4DL2A 2IBKA 4ACOA 8ICOA 3ZI4A 1OXJA 5IIMA 5J0WA 4C8LA 3NRZA 4K4HA 3H8WA 2KFNA 4I2AA 2RP5A 4PHPA 4QWEA 1AROP 4P4MA 8ICRA 4QZIA 5KFEA 1B4FA 4RNNA 5KFJA 2ZIXB 2ZXHA 4KLIA 3K1ZA 5GTIU 5B66U 2NV3A 5G5HA 1ZQJA 1K1QA 4M6WA 1JXLA 2Q0ZX 3ETLA 2ZIUA 5IILA 3T5LA 2KTQA 4QW8A 9ICVA 1C20A 2OEHA 5CJ7A 2WFAA 3ED5A 3QYPA 1JMSA 4EYHB 7ICNA 2EQYA 4BWJA 8ICJA 3B9JA 3HILA 1NZPA 3H0RB 4DSKA 2RDJA 4RQ8A 2FMPA 2ALZA 3MBYA 2JRZA 1ZQGA 5KFZA 5HP4A 5DQHA 4KLFA 3KD3A 4C8OA 4O3RA 5CP2A 8ICKA 3TADC 2J6UA 4JV2A 4R8UB 4F4WA 3QXGA 7ICOA 3SR6A 5TISU 8ICPA 2F3NA 3RTVA 4C80A 2E8OA 4C8NA 4BXOA 2VJ5A 3L4PA 1QSLA 2ATLA 3Q8LA 4MFFA 2IOFK 2WAQC 2C2EA 1JXEA 5AI0A 5ALSA 3L3FX 3PNCA 4IRDA 3QU4A 2JHDA 3H7IA 2G08A 4O3QA 3NVYA 2H5XA 1PVRA 1XS9D 3IHQB 4FZLA 4JK1A 5ALYA 4C0ZA 4DS5A 2M0NA 2VANA 2BDUA 4GXIA 1RDFA 2JZBA 8ICHA 1SKWA 4BGDA 2K4IA 3BQ0A 3N97B 4UARA 4XRHA 1SXDA 3M9NB 7ICSA 2ZIWB 4I2IA 1Z1VA 1ZETA 4P0PA 3QUTA 3IDWA 2WF5A 3THVA 1X66A 8ICBA 2KZ3A 4R65A 2KK0A 1L3TA 2GWSA 2LKYA 4UAWA 2W8KA 4Q45A 2Y0SC 4PL1A 3WK4A 2W11A 7ICEA 2W3SA 4O9MA 1SIJA 3E2EA 4J9RA 3AMZA 2G0AA 1QQ5A 4FZMA 3RJJA 4ICAA 3WK9A 4F5NA 1S5LU 4QZCA 1ZQTA 4YR2A 1H38A 3AUOA 1Z00A 2EAOA 2YMMA 5ALXA 3GIJA 4MFAA 4IL6U 2ZTDA 5KFBA 2ASJA 2K4PA 2DKXA 5GTHU 4J9OA 2FDRA 2MUTA 5DDMA 4UB4A 3PSPA 9ICAA 4FS2A 4RQ5A 8ICZA 5EE1A 2UVVA 3AU6A 4YMNA 4BJQA 5KG7A 1OW5A 4ED0A 4F4YA 3RB6A 4I2CA 3L5KA 3Q8RB 5J0OA 3Q8SB 4P4PA 5J2DA 2OCEA 3D2SA 3UXPA 4DFJA 2J6TA 8ICUA 3FDSA 1KSPA 1ZQYA 2E8MA 4OJOA 1SL0A 2I6XA 2K4HA 1S77D 3ISCA 3R9KA 3RAQA 1X9WA 7ICRA 4DFKA 1SZHA 3OPXA 8ICIA 5KFUA 3BDPA 3RAXA 1WUDA 1Z4NA 2XGPA 2RRDA 2LYBA 2BR0A 4RQ4A 4RPXA 4M9HA 3N28A 1ZD4A 7ICUA 7ICMA 4Q8EA 4QJFB 4KLOA 3SV4A 2ZTEA 5J0UA 2WF6A 4NL9A 2V4RA 4XUSA 1Z1BA 5J0QA 2MU2A 4OJ5A 4J9KA 5AI4A 1TAUA 3MR5A 4Z6DA 1B0XA 4GLXA 1VJ5A 1ZQOA 9ICJA 4PH5A 2HOFA 1NKBA 2HW3A 4MF8A 4ECRA 1Z3EB 1D8BA 5DKWA 4QWAA 4P0QA 4GFJA 5AM3A 3KHGA 2B21A 4QWDA 1Q3UA 1TAMA 2LM1A 2FJ6A 8ICLA 9ICOA 2KKPA 5DGAA 4O5KA 1IV8A 4YP3A 1RXWA 4DWIA 3UMGA 9ICUA 5CRXA 8ICGA 2ZUDA 3WK7A 2ZUBA 2HDOA 5F9NA 1WG8A 2YTUA 2PXIA 1LV5A 3T5HA 2K8BB 5KFVA 1RQNA 2JV3A 2BQUA 1MQ2A 4GIBA 4YD1A 3AU2A 4TUSA 4KX5A 4O3NA 4Q8FA 1SV4A 3Q8KA 2XVTA 9ICIA 5ALLA 4TUPA 4DQRA 1KFTA 3SAFA 2V9WA 4M9JA 2JGAA 1N48A 4FE3A 5AI6A 2YMLA 2XIDA 3RB3A 3V7LA 3MR2A 2RDIA 5ALWA 1S97A 4KLQA 4MHVA 2WB1C 2YB4A 2LM4A 1HEKA 2KIVA 1NK9A 4CNQA 3IG5A 4I27A 2VA8A 3QE9Y 4US8A 5AKKA 3N7PD 1X42A 4M47A 3T3FA 4DQPA 4ECQA 4DQQA 5AM2A 1XO1A 4I28A 7ICLA 2CN1A 2KZMA 2K4EA 3GIKA 1BPZA 3A0BU 4AYBC 2DPIA 2BCVA 5TZVA 4RQ2A 2W9AA 2ZIVA 3H8MA 3Q8PB 4R63A 4KLUA 2IOFA 4OJ6A 2IA6A 2JEIA 8ICNA 1J2NA 4FO6A 3D2NA 3IN5A 4CF3A 3C1ZA 1KN5A 4Y2SA 2NO5A 1YT3A 4B9VA 2HSZA 3KHHA 2RQ5A 4UAUA 2UVUA 1DXSA 3PO5A 3F53A 3CYMA 3QUQA 5AK5A 1XWLA 5DB8A 2DQNB 5KT5A 2FI1A 3QU7A 4GC7A 1XSNA 2EH9A 3GFKB 2ASLA 5ALOA 3M6ZA 2OHFA 3OGUA 2N1RA 2R8HA 4JWNA 4Y2UA 2QB0B 9ICTA 2F1HA 5KFQA 1MQ3A 1NK5A 2HHVA 3F2CA 4ECSA 1V9PA 2XCPA 4QZ8A 4X5VA 4TURA 4O3OA 8ICSA 5ALPA 5ALKA 4ED7A 1ZRMA 1Q3VA 5AHXA 3GZFA 3QU5A 3H0LB 2V4QA 5ALQA 2C22A 3ZDEA 2HOQA 5AK4A 3TANA 1XSLA 2PMZF 3M8RA 1NJXA 1N5WA 4RQ1A 5G5GA 4YXMA 3UQ0A 4NL9C 5D46A 5J0SA 9ICBA 3RBDA 2DPJA 2JEGA 3NUQA 2BKEA 2OWOA 5KFCA 4F92B 3KHRA 3SAHA 4Z6CA 3PX4A 3EUB2 1TKDA 2ZJ8A 4ECZA 4KN4A 5IIJA 3GU3A 4QWBA 1TV9A 3PX0A 5J2FA 4UQGA 4Z6EA 1JUDA 2E8PA 3EW9A 1NK6A 4M9GA 4F4ZA 3C2LA 1X40A 4ED3A 2MRLA 2A3VA 3SEIA 2OM6A 5AM0A 1L3VA 4TUQA 8ICWA 1N60A 5IINA 4IS7A 1ZQBA 2LYAA 2UVWA 1ZOLA 1N61A 2VA3A 1ZQWA 1RQLA 3B0XA 3UXOA 3LWLA 3BQ2A 1URJA 4Y2JA 3QEAZ 1X6IA 3ISBA 1XU4A 3WKBA 4NM1A 5KFAA 4LZGA 1SXEA 1N5XA 5A0LA 2Q4TA 4I2BA 2KMDA 8ICXA 2ES6A 1FIQA 2L5YA 1NK0A 1S0NA 2I1QA 1XNSA 1ZRNA 3H4DA 5KG6A 2PI5A 2KVCA 3QX7A 3IV6A 5AM1A 5CB1A 1U49A 1L7PA 3LK9A 2OXOA 2HMXA 4J9NA 5CA7A 1K5OA 4F71A 3LVWA 2KSOA 1ZQXA 3BQ7A 2WF7A 5BOMA 1FFVA 4OJPA 4CGZA 4Y2RA 5J0XA 9ICPA 3QUBA 3D2QA 3HRDD 2DGZA 4RQ3A 2W7OA 1A76A 4DOCA 2AQ4A 1LKYB 4FS1A 1AQ6A 5L1LA 5D49A 1XO0A 5ALRA 1NKCA 4KLMA 3UMBA 3LYSA 1JX4A 2KD1A 3QU2A 5ALGA 5KAIU 3MABA 9ICLA 1BPBA 4B9UA 4F5RA 1L7OA 3LVVA 5AKLA 5DB7A 3G6XA 4C4SA 9ICEA 4YR0A 3RH6A 1TFRA 1NKEA 3EWAA 1QQ6A 3RJHA 4NXZA 2ZTCA 4UBBA 9ICNA 5AKHA 2PFQA 4NLZA 2JMGA 2FPLA 1N56A 2W04A 2H3ZA 3MR3A 2QARB 1ZD5A 2F44A 1ZXIA 5J2IA 4US9A 3A0HU 5JU5A 2QKQA 2EANA 2HCFA 2W9BA 2KJ9A 4EX6A 3WK6A 4EEKA 3JPOA 2HHTA 2GO7A 1S8OA 2ZXIA 5KFTA 3BZCA 4BUGA 2G06A 2MAXA 3UQ2A 2F77X 1JRPA 2JXJA 4F8RA 1RM6C 1DRGA 4K4GA 1CUKA 5CHGA 2VJ4A 4PJ0U 4QWCA 4DL6A 2HBMA 4ELVA 1CEZA 5J2HA 4PGYA 5KFXA 2KICA 1CRXA 1QTMA 4UAZA 2R8KA 5AI9A 3NVZA 3RH5A 1OUQA 2P66A 1C7YA 1ZQSA 3FC4A 5H2FU 1SL2A 1VLBA 3CP8A 3IRUA 4IR1A 3QZ7A 4RPZA 5AKGA 4JMUA 2W9CB 3F5EA 5KFHA 4MEXA 2WHEA 1ZQPA 8ICCA 9ICQA 3ZDDA 4RT2A 3BS5B 2HHQA 3WKCA 4C7ZA 1RYRA 1ZD2P 1NK8A 3C5GA 1NZBA 3JPQA 4IC9A 2IHMA 5AI5A 4RNOA 1D9DA 2FLPA 4QZGA 2DKZA 5ALNA 2JR5A 4DSEA 4ELUA 1U4BA 1WWVA 1ZD3A 7ICIA 9ICMA 2VIXA 1HIWA 4PGXA 3H8SA 2KG5A 4QZAA 5IIIA 1ZQCA 4Y2XA 5J2JA 4DSJA 3IG8A 3DEEA 1KL9A 4RUAA 4F91B 5AIBA 3HW8A 5J0PA 5KFSA 3JPRA 2KVSA 4NLNA 4UB1A 5CEHA 1U48A 2BZFA 1EXNA 4PZOA 1TAQA 2FPMA 3HWTA 3TFRA 1V85A 3HJEA 2R8GA 2AXTU 3ETRA 5KFPA 2G07A 3PVXA 9ICWA 1MC8A 5C5JA 4KLLA 4K4IA 4IR9A 5AICA 1X2IA 4J9SA 4YFKA 1ED1A 4KLSA 4RPYA 4USAA 1F44A
chains in the Genus database with same CATH topology
2H3IA 4CGZA 2K4EA 3F5AA 4AYBC 3D2QA 4P0PB 2DGZA 4A8EA 3SAHA 3CP8A 2W7OA 4BX9C 3C29A 1P7DA 2VJ5A 4AYBF 2ZIVA 2KNJA 1D8BA 3VCBA 2H3VA 3NRWA 4JMUA 2D6FC 2KEYA 4ACOA 4KX3A 4U7CA 3F5EA 4P0QA 1XO0A 2WAQC 2XICA 4GFJA 3PSPA 1ZQ1C 2K89A 3GU3A 1Q3UA 3PSTA 4OJ6A 1TAMA 1UPHA 2W03A 2ZIUB 4U6PA 3F2DA 3T79A 3KZXA 2WAQF 3L3FX 3LYSA 3MGVA 2CPRA 2KD1A 4BJQA 3O0FA 4KMOB 2JHDA 2G08A 2KKPA 3AL0B 3F2BA 2Z7JA 3D2NA 3IN5A 1PVRA 3LVVA 1A0PA 1KBUA 4FZLA 2CRXA 5CRXA 1NZBA 1PVQA 3SMVA 4C0ZA 4IC9A 3C28A 2RP5A 2E1FA 2M0NA 2KJ8A 2OYYA 2BDUA 3PSFA 1YT3A 3D2SA 4FZNA 5C0YA 2MRLA 4OO1J 2K4IA 5KL1B 2A3VA 2OH2A 2OM6A 2G09A 4NLBA 2K8BB 1PVPA 4QIWF 4NLCA 3ONNA 4OJOA 2JMGA 2LBOA 1ECWA 2HBKA 2W7PA 3CRXA 2W04A 3F53A 1A6SA 2LYAA 1GO3F 2H3ZA 2K4HA 2VIXA 2XI9A 1HIWA 2ZG6A 2DF4B 2ZIXB 2ZIWB 3CYMA 3KFUF 1F44A 3SQIA 4KX5A 3PZPA 3N7RC 2ZXHA 2E1EA 2GOLA 1SZHA 2DQNB 2YB1A 2MA1A 3K1ZA 3OPXA 4CRXA 5HR6A 2G5HB 4P0PA 2NV3A 1MA7A 4WJ3B 2XVTA 3SAGA 1URJA 3IG8A 3M6ZA 2K8CB 3DEEA 3N7SC 2KJ5A 2KJ9A 3ALRA 3AQEA 3VC8A 2YX8A 1WUDA 2N1RA 4OJLA 4PL2A 3H0MB 4QIWC 2RRDA 3SAFA 2ZIVB 2F8LA 2ZIUA 3IP4B 2LYBA 1L6NA 2JGAA 4P0QB 5A0LA 5T14A 2Q4TA 3HKZF 2F2AB 4FE3A 1T94A 2LKYA 2GH1A 2XIDA 5HR7A 2ZXIA 3F2CA 4BUGA 5KL8B 4QJFB 3M6KA 2KHVA 2HBJA 2G06A 2HBLA 1XNSA 2Y0SC 4PL1A 2F77X 4NWIA 2KHQA 2VKQA 2WB1C 1DRGA 2YB4A 2K8AA 2H3QA 1HEKA 2KV2A 1Z1BA 2KVCA 2Y0SF 1Q3VA 3AQFA 3ICXA 2KIWA 4OJ5A 2HOIA 2KOBA 3GZFA 2WB1F 2VJ4A 3IG5A 3H0RB 2G07A 1Z19A 2G0AA 3H0LB 4O3MA 2HBMA 2PMZC 2JH1A 3PSIA 4NV0A 2RHFA 3RFAA 2R18A 3HKZC 4CDGA 2HOQA 3N7PD 2OXOA 4FZMA 2ZIWA 2PMZF 2ZIXA 2F76X 2G5IB 2HMXA 3E0FA 2KICA 1ED1A 4ICAA 2E5SA 2KKVA 1OUQA 1CRXA 2H3FA 2LHTA 2JH7A 2HOFA 4QNLA 3LVWA 3M7DA 1IIPA 3NUQA 2CN1A 3RF9A 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHQ A;  1A0P A;  1KBU A;  2CRX A;  1DRG A;  1NZB A;  1Z1B A;  1PVQ A;  5CRX A;  3C28 A;  4A8E A;  1Q3V A;  2KJ9 A;  2KJ5 A;  2KIW A;  2KJ8 A;  3C29 A;  2HOI A;  2KOB A;  1P7D A;  3NRW A;  1Z19 A;  2A3V A;  2KEY A;  4ACO A;  1XO0 A;  1PVP A;  2OXO A;  1Q3U A;  3CRX A;  1CRX A;  2KKV A;  3LYS A;  3MGV A;  2KD1 A;  1F44 A;  2HOF A;  2KHV A;  2KKP A;  4CRX A;  1XNS A;  1OUQ A;  1PVR A;  1MA7 A; 
#chains in the Genus database with same CATH topology
 1B22 A;  5L1M A;  2YN4 A;  4CCH A;  1PK1 A;  4JB3 A;  1D8L A;  1MSW D;  4Y2P A;  4ED6 A;  3VCB A;  4M6W B;  2D6F C;  1TVA A;  4U7C A;  3HT3 A;  4YQW A;  2XIC A;  4Y2T A;  2K89 A;  1IXR A;  5KFM A;  1JI7 A;  3PST A;  2ZIU B;  5HHH A;  9ICX A;  1U45 A;  5DGB A;  1DOQ A;  4RUC A;  4B9L A;  1BNO A;  3SEN A;  5JUM A;  3TI0 A;  3AL0 B;  3RR8 A;  2XO7 A;  3I28 A;  1HUO A;  2YQE A;  1SB3 C;  2ODG A;  3C28 A;  2E1F A;  2W54 A;  4YMO A;  3H4B A;  1ZQM A;  4OO1 J;  2G09 A;  1FFU A;  1SV0 A;  8ICF A;  4KLE A;  5KG2 A;  3OTQ A;  4YXJ A;  4EZ9 A;  2DF4 B;  2ESE A;  1N2X A;  1XC9 A;  1SKS A;  1X9M A;  1Y88 A;  3OHA A;  2XC9 A;  3V7K A;  1SWV A;  2E8N A;  4UAY A;  1L3U A;  4PL2 A;  4G9B A;  3C23 A;  4DF4 A;  9ICR A;  1ZQD A;  2W9M A;  4O3P A;  5KT2 A;  8ICV A;  3GV7 B;  3EYZ A;  4EZ6 A;  1YZ7 A;  2F2A B;  5ALV A;  3EPG A;  2ASD A;  5AM5 A;  3JPN A;  1VDV A;  2HHW A;  2HBL A;  3TAP A;  2W8L A;  4DL4 A;  4YCX A;  2AQ0 A;  5DG9 A;  4Z6F A;  2H3Q A;  4XA5 A;  4FBT A;  4KLG A;  4J03 A;  2JH1 A;  4RQM A;  2JZB B;  5J2A A;  2D8C A;  1QCK A;  4ELT A;  2ZIX A;  4UB5 A;  5DG8 A;  1UQV A;  2LPE A;  4J9M A;  3LWM A;  3K1R B;  5KT7 A;  2BHN A;  4KTQ A;  4UB8 U;  1WYG A;  5ALJ A;  1BPD A;  3HX0 A;  5ALH A;  1WWU A;  2XCA A;  9ICG A;  4P0P B;  4CF5 A;  5ALZ A;  5KG5 A;  2W55 A;  3ISD A;  2IOH A;  2GLE A;  3T79 A;  3F2D A;  2KP7 A;  4LZD A;  3SZ2 A;  2CPR A;  3Q8Q B;  3O0F A;  2ISO A;  3Q8M A;  1BVS A;  2NYV A;  4C4R A;  1BPY A;  3NVW A;  4OCZ A;  1S0V A;  4RQ6 A;  3BS7 A;  5EWG A;  1ZQL A;  2BQ3 A;  5KFI A;  8ICM A;  4DOA A;  3C2K A;  8ICE A;  2HBK A;  4F5Q A;  4R8U A;  1JN3 A;  3UXN A;  3G6V A;  3SQI A;  3PZP A;  4ECW A;  3OJU A;  2YB1 A;  4DO9 A;  4RU9 A;  3DDH A;  4PHD A;  3QNM A;  1Z00 B;  7ICT A;  5KFK A;  1F0M A;  2XY7 A;  5DBA A;  2LI6 A;  4QIW C;  7ICV A;  2DFL A;  4DLE A;  2MUT B;  3AEV A;  1RPL A;  4ED8 A;  2HI0 A;  4ECX A;  4PZN A;  5HR7 A;  3TKA A;  5J8Y A;  4C4T A;  2NRX A;  3RB0 A;  4AP9 A;  5F3X B;  2IMW P;  3HPO A;  3M8S A;  4LVS A;  1N62 A;  4FBU A;  2IHN A;  1K1S A;  5KT6 A;  5ALE A;  4QZF A;  1COO A;  4TQS A;  1JRO A;  2R8I A;  1RZT A;  1HUZ A;  1BNP A;  2KV2 A;  5DDY A;  2KE7 A;  2HOI A;  4PHE A;  4J9L A;  3S6J A;  4NM2 A;  4YVZ A;  3TAR A;  3HKZ C;  4CDG A;  4XQ8 A;  3PW0 A;  2BPC A;  2ZUC A;  2BGW A;  4KLH A;  2ZIW A;  3GIM A;  4DQS A;  2E5S A;  4E0D A;  3CW2 C;  3KKA A;  3MFI A;  1BPE A;  3RBE A;  1D9F A;  5DLG A;  3FM9 A;  4M0A A;  4Q44 A;  1TK8 A;  4DSF A;  3F5A A;  3LDA A;  3TQ1 A;  4NLG A;  7ICQ A;  3PY8 A;  3PML A;  2BCR A;  4NLK A;  4B9M A;  2PKE A;  1ZYQ A;  5ALI A;  2BPG A;  2W03 A;  2UVR A;  2WAQ F;  5EOZ A;  1NK4 A;  1DGS A;  7ICP A;  2Y9U A;  5AKZ A;  5KFO A;  2PFP A;  2DUY A;  1B43 A;  4GXK A;  5KL1 B;  4DFD A;  3H8J A;  3FYH A;  1NI3 A;  3OSP A;  2P6R A;  2W7P A;  1A6S A;  4Q43 A;  3KFU F;  3EPI A;  4DEZ A;  5F9L A;  2AGP A;  3N4M B;  1X9X A;  5HR6 A;  4CRX A;  4ECU A;  3SAG A;  4ECT A;  2K8C B;  4KMU A;  4KLJ A;  5J29 A;  3VC8 A;  4RQ0 A;  4HYK A;  1SV0 C;  4Y2V A;  1V97 A;  3H0M B;  1T8E A;  1D8Y A;  3MC1 A;  4J9Q A;  4LJX A;  4P0Q B;  3ZDA A;  4I2D A;  4YN4 A;  1ZQR A;  3RJE A;  2HBJ A;  1DK2 A;  3PV8 A;  1QQ7 A;  2VKQ A;  3KBB A;  4Y2Y A;  2K8A A;  4EBC A;  2Y0S F;  5L1J A;  4O0I A;  3WKE A;  2KOB A;  3J81 j;  1SWW A;  1Z19 A;  3D6J A;  5HHI A;  4NV0 A;  5KAF U;  4F4K A;  1WCN A;  3PO4 A;  4BWM A;  9ICS A;  3E0F A;  2AH5 A;  4IRC A;  4IRK A;  2EAP A;  4O3S A;  3M7D A;  1LB2 B;  4I2G A;  4NJ8 A;  1T3N A;  1L7M A;  1P7D A;  1FEZ A;  2KNJ A;  2NO4 A;  4B9T A;  3QEB Z;  1SKR A;  5J2C A;  1HJP A;  4O5E A;  3MGV A;  5AI8 A;  2XY6 A;  4ZH4 A;  4UAV A;  3F2B A;  1UT8 A;  3MDA A;  2CRX A;  3MGH A;  9ICH A;  3GV5 B;  4I2J A;  2DWQ A;  2JEJ A;  4FZN A;  4G3I A;  3UMC A;  1S9F A;  1UHU A;  2KZZ A;  4KLD A;  1L8L A;  4DL7 A;  5KTQ A;  3CRX A;  1ZQK A;  3IM1 A;  3ZDC A;  5JTI A;  5DB9 A;  5DBB A;  2FPK A;  2G5H B;  4MF2 A;  3GIL A;  4QZH A;  5ALD A;  4RNM A;  1ZQI A;  4ECV A;  5AIA A;  1A77 A;  4OJL A;  5KFF A;  4DF8 A;  2WF9 A;  5IIO A;  2ZIV B;  2F8L A;  4NY8 A;  3M1Y A;  2XGQ A;  4HAI A;  1ZQF A;  3SD7 A;  1T94 A;  2P6U A;  3M9O B;  4RQN A;  1Q8K A;  2LYH A;  1O03 A;  1ZQQ A;  1YZ6 A;  4F50 A;  3ZD8 A;  4R66 A;  5DQI A;  5KFR A;  3C2M A;  5J8Y C;  5L1I A;  2PMZ C;  3WU2 U;  2AGO A;  2BPF A;  1L3S A;  3TAC B;  2R18 A;  2ISP A;  3DV9 A;  4F2R A;  4IQT A;  2KKV A;  1S10 A;  2LHT A;  4B9N A;  1IIP A;  1UA1 A;  3HP6 A;  3KZI U;  3PW7 A;  2BCS A;  9ICK A;  4M2Y A;  1RG6 A;  2A1A A;  1SZP A;  1U47 A;  1NNL A;  4BX9 C;  3JPP A;  5HML A;  5KFD A;  3WK5 A;  4C8K A;  3RB4 A;  3JPS A;  3KKA C;  5AK3 A;  5ALU A;  2F1I A;  4FFD A;  4I2E A;  1UPH A;  2LMR A;  4PHA A;  5L9X A;  4DOB A;  2BCU A;  1KRP A;  7ICH A;  5HMM A;  1KFD A;  4YR3 A;  3BQT A;  1T3Q A;  1O08 A;  2I5H A;  4JUZ A;  3CNH A;  2FE9 A;  4NLB A;  4OD0 A;  1NOM A;  7ICF A;  2A1J B;  7ICG A;  1QLN A;  4ED1 A;  4DS4 A;  2NRT A;  3ONN A;  2LBO A;  5BPC A;  3JPT A;  1UT5 A;  2P35 A;  1SL1 A;  1QSS A;  5KT3 A;  3RRG A;  3MGI A;  2E1E A;  4B6J A;  5J0Y A;  3WK8 A;  8ICY A;  4F72 A;  3T5K A;  2BDP A;  5ALM A;  4YD2 A;  4IQW A;  3OSN A;  2HVI A;  1T7P A;  2HHU A;  2YX8 A;  4C8M A;  1V38 A;  3E58 A;  4Y2Q A;  3IP4 B;  3H40 A;  4DL5 A;  4BDP A;  5CWR A;  5KT4 A;  2GH1 A;  2EZZ A;  3RJG A;  3TAQ A;  3V7J A;  3BZK A;  3M9M B;  3MR6 A;  4RQ7 A;  2M9N A;  5KFL A;  5J2K A;  2WTF A;  7ICJ A;  5AK6 A;  2WB1 F;  1N63 A;  1NJY A;  2KN7 A;  3UPQ A;  4F4X A;  2C2D A;  4EEY A;  8ICQ A;  2JH7 A;  4QNL A;  3NTU A;  5J2G A;  3RF9 A;  2H3I A;  3MFH A;  1TK5 A;  4UB3 A;  1PK3 A;  1ZQN A;  4A8E A;  3C29 A;  4YMM A;  4AYB F;  3BJY A;  2QB0 A;  2QLT A;  1IG6 A;  3FAH A;  2R8J A;  2DL0 A;  2C2R A;  4J9P A;  3WKA A;  4DFM A;  4KIT B;  2AU0 A;  2VA2 A;  5CR0 A;  3NS1 A;  1QH9 A;  3TFS A;  2Z7J A;  4KN7 A;  3KHL A;  3SYZ A;  1TK0 A;  4UB2 A;  4EEN A;  1KBU A;  2FLN A;  2F8K A;  2KJ8 A;  2FMS A;  3B0Y A;  5B5E U;  5C0Y A;  3OJS A;  4I2F A;  4QIW F;  3PR5 B;  4PGQ A;  1GO3 F;  2ZG6 A;  2XI9 A;  1ZQA A;  1KFS A;  2YMP A;  1BGX T;  1JIH A;  2KSO B;  5J0T A;  1MA7 A;  4WJ3 B;  5J2E A;  1RYS A;  3C21 A;  2A19 A;  2ZJ5 A;  5DB6 A;  5EE3 A;  2BCQ A;  2HHS A;  2KJ5 A;  3ALR A;  1X6J A;  3WKD A;  5EWF A;  4DLG A;  3GDX A;  3HKZ F;  5D4B A;  1KW4 A;  2Y9T A;  2F1J A;  2YY6 A;  1F5S A;  1TE2 A;  1XSP A;  3GQC A;  2QB1 A;  4M9L A;  3GV8 B;  3G6Y A;  3ICX A;  5HNK A;  1S0M A;  3GII A;  3OHB A;  4BXO B;  1IM4 A;  5AKE A;  5E79 U;  5AKI A;  1Z4O A;  4F93 B;  4EYI B;  2F76 X;  2J6S A;  1Q46 A;  3V72 A;  3NVV A;  1KEJ A;  4UBC A;  4F5P A;  4ECY A;  3RJK A;  4ED2 A;  5ALT A;  1L5U A;  1WCL A;  5EE9 A;  5DBC A;  3T5J A;  3RR7 A;  3PX6 A;  2FLL A;  1X9S A;  5KFG A;  4EBD A;  2NRV A;  5KG0 A;  5L1K A;  1RYU A;  4CE6 A;  2W9B B;  4KX3 A;  4ZOH C;  1ZQ1 C;  5K4L A;  4U6P A;  1BPX A;  4DL3 A;  2JEF A;  4KMO B;  4GC6 A;  5DQG A;  3ORY A;  1SGG A;  5AKY A;  1KQQ A;  8ICA A;  3SMV A;  2CXY A;  3AM9 A;  3KOO A;  5AKX A;  3PSF A;  5AM4 A;  2HVH A;  2Y1I A;  2OH2 A;  8ICT A;  4DCC A;  2AHO B;  1M6Y A;  1ZQE A;  4NLC A;  4C7Y A;  1ECW A;  3PW4 A;  3N7R C;  4M9N A;  2GOL A;  3V6K A;  2EZY A;  4UAT A;  5AKJ A;  4QW9 A;  1PUZ A;  1LKY A;  3N7S C;  4EX7 A;  3I1Y A;  1RXV A;  1S0O A;  1NJZ A;  2E3T A;  3V6H A;  1KDH A;  1L6N A;  2C28 A;  3UM9 A;  5T14 A;  2RLT A;  1UA0 A;  1ZQU A;  5EE0 A;  4QZD A;  3M6K A;  3U26 A;  4P2H A;  4DQI A;  3PMN A;  5IIK A;  3SI8 A;  2KHQ A;  3C5F A;  4CF4 A;  2NRW A;  1ZJM A;  1ZQV A;  3TAD A;  3AQF A;  4RT3 A;  2KIW A;  4O3M A;  4F2S A;  3PSI A;  4UW9 A;  2RHF A;  4JWM A;  4MFC A;  2AGQ A;  4JV0 A;  3RJF A;  2O6K A;  4DSI A;  4EEL A;  2QAR A;  2AJQ A;  5JRT A;  5KFY A;  1KLN A;  3NAS A;  3ZD9 A;  4KLT A;  2EDU A;  5BOL A;  1ZQH A;  1T4G A;  5J2B A;  2H3V A;  5KG3 A;  2Y1J A;  2KEY A;  5KG4 A;  4JV1 A;  4IQU A;  2FMQ A;  3BQ1 A;  4F3O A;  3KZX A;  4QZB A;  2PFN A;  1J97 A;  4DFP A;  2DBY A;  2D3D A;  1FO4 A;  2W43 A;  2XY5 A;  1JAL A;  2B6G A;  3QUC A;  1A0P A;  1PVQ A;  2OYY A;  4DSL A;  4O5C A;  3QU9 A;  5FP0 A;  3C1Y A;  1DK3 A;  1PVP A;  1ZQZ A;  4IQV A;  5EWE A;  2I9G A;  1MN8 A;  4EBE A;  4MEY A;  1UCV A;  4F5O A;  2PI4 A;  3V6J A;  2MA1 A;  2PFO A;  2K60 A;  4YG2 A;  3RJI A;  2EZX A;  4P4O A;  3AQE A;  5DLF A;  2W9C A;  2A1J A;  3I76 A;  1PK1 B;  4UB6 U;  1L7N A;  3SV3 A;  1ZJN A;  2W3R A;  1DGJ A;  1U9L A;  3NGD A;  1COK A;  4QZE A;  3K75 D;  3BS5 A;  1QSY A;  5KL8 B;  2KHV A;  4I2H A;  5ALF A;  1L8O A;  1NJW A;  2YMQ A;  3RRH A;  1CI4 A;  4NWI A;  3KTQ A;  3QZ8 A;  4QZ9 A;  5KNI A;  7ICK A;  2NRZ A;  1LVH A;  5KFN A;  3PW5 A;  3MDC A;  1KTQ A;  5DG7 A;  9ICF A;  2KFZ A;  9ICC A;  5KG1 A;  3RFA A;  4TQR A;  4I29 A;  1KKX A;  4M04 A;  4B9S A;  2MSN A;  2G5I B;  4GXJ A;  5KFW A;  3PW2 A;  5J0R A;  2H3F A;  3EZ5 A;  2EAM A;  2B0C A;  1S76 D;  1NK7 A;  2ZJA A;  3PR4 A;  4R64 A;  2BQR A;  3RH4 A;  2HHX A;  4PPX A;  4UAS A;  3AN1 A;  4RZR A;  3K4G A;  3ZDB A;  1J2M A;  1PZN A;  3NRW A;  2WF8 A;  4DL2 A;  2IBK A;  4ACO A;  8ICO A;  3ZI4 A;  1OXJ A;  5IIM A;  5J0W A;  4C8L A;  3NRZ A;  4K4H A;  3H8W A;  2KFN A;  4I2A A;  2RP5 A;  4PHP A;  4QWE A;  1ARO P;  4P4M A;  8ICR A;  4QZI A;  5KFE A;  1B4F A;  4RNN A;  5KFJ A;  2ZIX B;  2ZXH A;  4KLI A;  3K1Z A;  5GTI U;  5B66 U;  2NV3 A;  5G5H A;  1ZQJ A;  1K1Q A;  4M6W A;  1JXL A;  2Q0Z X;  3ETL A;  2ZIU A;  5IIL A;  3T5L A;  2KTQ A;  4QW8 A;  9ICV A;  1C20 A;  2OEH A;  5CJ7 A;  2WFA A;  3ED5 A;  3QYP A;  1JMS A;  4EYH B;  7ICN A;  2EQY A;  4BWJ A;  8ICJ A;  3B9J A;  3HIL A;  1NZP A;  3H0R B;  4DSK A;  2RDJ A;  4RQ8 A;  2FMP A;  2ALZ A;  3MBY A;  2JRZ A;  1ZQG A;  5KFZ A;  5HP4 A;  5DQH A;  4KLF A;  3KD3 A;  4C8O A;  4O3R A;  5CP2 A;  8ICK A;  3TAD C;  2J6U A;  4JV2 A;  4R8U B;  4F4W A;  3QXG A;  7ICO A;  3SR6 A;  5TIS U;  8ICP A;  2F3N A;  3RTV A;  4C80 A;  2E8O A;  4C8N A;  4BXO A;  2VJ5 A;  3L4P A;  1QSL A;  2ATL A;  3Q8L A;  4MFF A;  2IOF K;  2WAQ C;  2C2E A;  1JXE A;  5AI0 A;  5ALS A;  3L3F X;  3PNC A;  4IRD A;  3QU4 A;  2JHD A;  3H7I A;  2G08 A;  4O3Q A;  3NVY A;  2H5X A;  1PVR A;  1XS9 D;  3IHQ B;  4FZL A;  4JK1 A;  5ALY A;  4C0Z A;  4DS5 A;  2M0N A;  2VAN A;  2BDU A;  4GXI A;  1RDF A;  2JZB A;  8ICH A;  1SKW A;  4BGD A;  2K4I A;  3BQ0 A;  3N97 B;  4UAR A;  4XRH A;  1SXD A;  3M9N B;  7ICS A;  2ZIW B;  4I2I A;  1Z1V A;  1ZET A;  4P0P A;  3QUT A;  3IDW A;  2WF5 A;  3THV A;  1X66 A;  8ICB A;  2KZ3 A;  4R65 A;  2KK0 A;  1L3T A;  2GWS A;  2LKY A;  4UAW A;  2W8K A;  4Q45 A;  2Y0S C;  4PL1 A;  3WK4 A;  2W11 A;  7ICE A;  2W3S A;  4O9M A;  1SIJ A;  3E2E A;  4J9R A;  3AMZ A;  2G0A A;  1QQ5 A;  4FZM A;  3RJJ A;  4ICA A;  3WK9 A;  4F5N A;  1S5L U;  4QZC A;  1ZQT A;  4YR2 A;  1H38 A;  3AUO A;  1Z00 A;  2EAO A;  2YMM A;  5ALX A;  3GIJ A;  4MFA A;  4IL6 U;  2ZTD A;  5KFB A;  2ASJ A;  2K4P A;  2DKX A;  5GTH U;  4J9O A;  2FDR A;  2MUT A;  5DDM A;  4UB4 A;  3PSP A;  9ICA A;  4FS2 A;  4RQ5 A;  8ICZ A;  5EE1 A;  2UVV A;  3AU6 A;  4YMN A;  4BJQ A;  5KG7 A;  1OW5 A;  4ED0 A;  4F4Y A;  3RB6 A;  4I2C A;  3L5K A;  3Q8R B;  5J0O A;  3Q8S B;  4P4P A;  5J2D A;  2OCE A;  3D2S A;  3UXP A;  4DFJ A;  2J6T A;  8ICU A;  3FDS A;  1KSP A;  1ZQY A;  2E8M A;  4OJO A;  1SL0 A;  2I6X A;  2K4H A;  1S77 D;  3ISC A;  3R9K A;  3RAQ A;  1X9W A;  7ICR A;  4DFK A;  1SZH A;  3OPX A;  8ICI A;  5KFU A;  3BDP A;  3RAX A;  1WUD A;  1Z4N A;  2XGP A;  2RRD A;  2LYB A;  2BR0 A;  4RQ4 A;  4RPX A;  4M9H A;  3N28 A;  1ZD4 A;  7ICU A;  7ICM A;  4Q8E A;  4QJF B;  4KLO A;  3SV4 A;  2ZTE A;  5J0U A;  2WF6 A;  4NL9 A;  2V4R A;  4XUS A;  1Z1B A;  5J0Q A;  2MU2 A;  4OJ5 A;  4J9K A;  5AI4 A;  1TAU A;  3MR5 A;  4Z6D A;  1B0X A;  4GLX A;  1VJ5 A;  1ZQO A;  9ICJ A;  4PH5 A;  2HOF A;  1NKB A;  2HW3 A;  4MF8 A;  4ECR A;  1Z3E B;  1D8B A;  5DKW A;  4QWA A;  4P0Q A;  4GFJ A;  5AM3 A;  3KHG A;  2B21 A;  4QWD A;  1Q3U A;  1TAM A;  2LM1 A;  2FJ6 A;  8ICL A;  9ICO A;  2KKP A;  5DGA A;  4O5K A;  1IV8 A;  4YP3 A;  1RXW A;  4DWI A;  3UMG A;  9ICU A;  5CRX A;  8ICG A;  2ZUD A;  3WK7 A;  2ZUB A;  2HDO A;  5F9N A;  1WG8 A;  2YTU A;  2PXI A;  1LV5 A;  3T5H A;  2K8B B;  5KFV A;  1RQN A;  2JV3 A;  2BQU A;  1MQ2 A;  4GIB A;  4YD1 A;  3AU2 A;  4TUS A;  4KX5 A;  4O3N A;  4Q8F A;  1SV4 A;  3Q8K A;  2XVT A;  9ICI A;  5ALL A;  4TUP A;  4DQR A;  1KFT A;  3SAF A;  2V9W A;  4M9J A;  2JGA A;  1N48 A;  4FE3 A;  5AI6 A;  2YML A;  2XID A;  3RB3 A;  3V7L A;  3MR2 A;  2RDI A;  5ALW A;  1S97 A;  4KLQ A;  4MHV A;  2WB1 C;  2YB4 A;  2LM4 A;  1HEK A;  2KIV A;  1NK9 A;  4CNQ A;  3IG5 A;  4I27 A;  2VA8 A;  3QE9 Y;  4US8 A;  5AKK A;  3N7P D;  1X42 A;  4M47 A;  3T3F A;  4DQP A;  4ECQ A;  4DQQ A;  5AM2 A;  1XO1 A;  4I28 A;  7ICL A;  2CN1 A;  2KZM A;  2K4E A;  3GIK A;  1BPZ A;  3A0B U;  4AYB C;  2DPI A;  2BCV A;  5TZV A;  4RQ2 A;  2W9A A;  2ZIV A;  3H8M A;  3Q8P B;  4R63 A;  4KLU A;  2IOF A;  4OJ6 A;  2IA6 A;  2JEI A;  8ICN A;  1J2N A;  4FO6 A;  3D2N A;  3IN5 A;  4CF3 A;  3C1Z A;  1KN5 A;  4Y2S A;  2NO5 A;  1YT3 A;  4B9V A;  2HSZ A;  3KHH A;  2RQ5 A;  4UAU A;  2UVU A;  1DXS A;  3PO5 A;  3F53 A;  3CYM A;  3QUQ A;  5AK5 A;  1XWL A;  5DB8 A;  2DQN B;  5KT5 A;  2FI1 A;  3QU7 A;  4GC7 A;  1XSN A;  2EH9 A;  3GFK B;  2ASL A;  5ALO A;  3M6Z A;  2OHF A;  3OGU A;  2N1R A;  2R8H A;  4JWN A;  4Y2U A;  2QB0 B;  9ICT A;  2F1H A;  5KFQ A;  1MQ3 A;  1NK5 A;  2HHV A;  3F2C A;  4ECS A;  1V9P A;  2XCP A;  4QZ8 A;  4X5V A;  4TUR A;  4O3O A;  8ICS A;  5ALP A;  5ALK A;  4ED7 A;  1ZRM A;  1Q3V A;  5AHX A;  3GZF A;  3QU5 A;  3H0L B;  2V4Q A;  5ALQ A;  2C22 A;  3ZDE A;  2HOQ A;  5AK4 A;  3TAN A;  1XSL A;  2PMZ F;  3M8R A;  1NJX A;  1N5W A;  4RQ1 A;  5G5G A;  4YXM A;  3UQ0 A;  4NL9 C;  5D46 A;  5J0S A;  9ICB A;  3RBD A;  2DPJ A;  2JEG A;  3NUQ A;  2BKE A;  2OWO A;  5KFC A;  4F92 B;  3KHR A;  3SAH A;  4Z6C A;  3PX4 A;  3EUB 2;  1TKD A;  2ZJ8 A;  4ECZ A;  4KN4 A;  5IIJ A;  3GU3 A;  4QWB A;  1TV9 A;  3PX0 A;  5J2F A;  4UQG A;  4Z6E A;  1JUD A;  2E8P A;  3EW9 A;  1NK6 A;  4M9G A;  4F4Z A;  3C2L A;  1X40 A;  4ED3 A;  2MRL A;  2A3V A;  3SEI A;  2OM6 A;  5AM0 A;  1L3V A;  4TUQ A;  8ICW A;  1N60 A;  5IIN A;  4IS7 A;  1ZQB A;  2LYA A;  2UVW A;  1ZOL A;  1N61 A;  2VA3 A;  1ZQW A;  1RQL A;  3B0X A;  3UXO A;  3LWL A;  3BQ2 A;  1URJ A;  4Y2J A;  3QEA Z;  1X6I A;  3ISB A;  1XU4 A;  3WKB A;  4NM1 A;  5KFA A;  4LZG A;  1SXE A;  1N5X A;  5A0L A;  2Q4T A;  4I2B A;  2KMD A;  8ICX A;  2ES6 A;  1FIQ A;  2L5Y A;  1NK0 A;  1S0N A;  2I1Q A;  1XNS A;  1ZRN A;  3H4D A;  5KG6 A;  2PI5 A;  2KVC A;  3QX7 A;  3IV6 A;  5AM1 A;  5CB1 A;  1U49 A;  1L7P A;  3LK9 A;  2OXO A;  2HMX A;  4J9N A;  5CA7 A;  1K5O A;  4F71 A;  3LVW A;  2KSO A;  1ZQX A;  3BQ7 A;  2WF7 A;  5BOM A;  1FFV A;  4OJP A;  4CGZ A;  4Y2R A;  5J0X A;  9ICP A;  3QUB A;  3D2Q A;  3HRD D;  2DGZ A;  4RQ3 A;  2W7O A;  1A76 A;  4DOC A;  2AQ4 A;  1LKY B;  4FS1 A;  1AQ6 A;  5L1L A;  5D49 A;  1XO0 A;  5ALR A;  1NKC A;  4KLM A;  3UMB A;  3LYS A;  1JX4 A;  2KD1 A;  3QU2 A;  5ALG A;  5KAI U;  3MAB A;  9ICL A;  1BPB A;  4B9U A;  4F5R A;  1L7O A;  3LVV A;  5AKL A;  5DB7 A;  3G6X A;  4C4S A;  9ICE A;  4YR0 A;  3RH6 A;  1TFR A;  1NKE A;  3EWA A;  1QQ6 A;  3RJH A;  4NXZ A;  2ZTC A;  4UBB A;  9ICN A;  5AKH A;  2PFQ A;  4NLZ A;  2JMG A;  2FPL A;  1N56 A;  2W04 A;  2H3Z A;  3MR3 A;  2QAR B;  1ZD5 A;  2F44 A;  1ZXI A;  5J2I A;  4US9 A;  3A0H U;  5JU5 A;  2QKQ A;  2EAN A;  2HCF A;  2W9B A;  2KJ9 A;  4EX6 A;  3WK6 A;  4EEK A;  3JPO A;  2HHT A;  2GO7 A;  1S8O A;  2ZXI A;  5KFT A;  3BZC A;  4BUG A;  2G06 A;  2MAX A;  3UQ2 A;  2F77 X;  1JRP A;  2JXJ A;  4F8R A;  1RM6 C;  1DRG A;  4K4G A;  1CUK A;  5CHG A;  2VJ4 A;  4PJ0 U;  4QWC A;  4DL6 A;  2HBM A;  4ELV A;  1CEZ A;  5J2H A;  4PGY A;  5KFX A;  2KIC A;  1CRX A;  1QTM A;  4UAZ A;  2R8K A;  5AI9 A;  3NVZ A;  3RH5 A;  1OUQ A;  2P66 A;  1C7Y A;  1ZQS A;  3FC4 A;  5H2F U;  1SL2 A;  1VLB A;  3CP8 A;  3IRU A;  4IR1 A;  3QZ7 A;  4RPZ A;  5AKG A;  4JMU A;  2W9C B;  3F5E A;  5KFH A;  4MEX A;  2WHE A;  1ZQP A;  8ICC A;  9ICQ A;  3ZDD A;  4RT2 A;  3BS5 B;  2HHQ A;  3WKC A;  4C7Z A;  1RYR A;  1ZD2 P;  1NK8 A;  3C5G A;  1NZB A;  3JPQ A;  4IC9 A;  2IHM A;  5AI5 A;  4RNO A;  1D9D A;  2FLP A;  4QZG A;  2DKZ A;  5ALN A;  2JR5 A;  4DSE A;  4ELU A;  1U4B A;  1WWV A;  1ZD3 A;  7ICI A;  9ICM A;  2VIX A;  1HIW A;  4PGX A;  3H8S A;  2KG5 A;  4QZA A;  5III A;  1ZQC A;  4Y2X A;  5J2J A;  4DSJ A;  3IG8 A;  3DEE A;  1KL9 A;  4RUA A;  4F91 B;  5AIB A;  3HW8 A;  5J0P A;  5KFS A;  3JPR A;  2KVS A;  4NLN A;  4UB1 A;  5CEH A;  1U48 A;  2BZF A;  1EXN A;  4PZO A;  1TAQ A;  2FPM A;  3HWT A;  3TFR A;  1V85 A;  3HJE A;  2R8G A;  2AXT U;  3ETR A;  5KFP A;  2G07 A;  3PVX A;  9ICW A;  1MC8 A;  5C5J A;  4KLL A;  4K4I A;  4IR9 A;  5AIC A;  1X2I A;  4J9S A;  4YFK A;  1ED1 A;  4KLS A;  4RPY A;  4USA A;  1F44 A; 
#chains in the Genus database with same CATH homology
 2H3I A;  4CGZ A;  2K4E A;  3F5A A;  4AYB C;  3D2Q A;  4P0P B;  2DGZ A;  4A8E A;  3SAH A;  3CP8 A;  2W7O A;  4BX9 C;  3C29 A;  1P7D A;  2VJ5 A;  4AYB F;  2ZIV A;  2KNJ A;  1D8B A;  3VCB A;  2H3V A;  3NRW A;  4JMU A;  2D6F C;  2KEY A;  4ACO A;  4KX3 A;  4U7C A;  3F5E A;  4P0Q A;  1XO0 A;  2WAQ C;  2XIC A;  4GFJ A;  3PSP A;  1ZQ1 C;  2K89 A;  3GU3 A;  1Q3U A;  3PST A;  4OJ6 A;  1TAM A;  1UPH A;  2W03 A;  2ZIU B;  4U6P A;  3F2D A;  3T79 A;  3KZX A;  2WAQ F;  3L3F X;  3LYS A;  3MGV A;  2CPR A;  2KD1 A;  4BJQ A;  3O0F A;  4KMO B;  2JHD A;  2G08 A;  2KKP A;  3AL0 B;  3F2B A;  2Z7J A;  3D2N A;  3IN5 A;  1PVR A;  3LVV A;  1A0P A;  1KBU A;  4FZL A;  2CRX A;  5CRX A;  1NZB A;  1PVQ A;  3SMV A;  4C0Z A;  4IC9 A;  3C28 A;  2RP5 A;  2E1F A;  2M0N A;  2KJ8 A;  2OYY A;  2BDU A;  3PSF A;  1YT3 A;  3D2S A;  4FZN A;  5C0Y A;  2MRL A;  4OO1 J;  2K4I A;  5KL1 B;  2A3V A;  2OH2 A;  2OM6 A;  2G09 A;  4NLB A;  2K8B B;  1PVP A;  4QIW F;  4NLC A;  3ONN A;  4OJO A;  2JMG A;  2LBO A;  1ECW A;  2HBK A;  2W7P A;  3CRX A;  2W04 A;  3F53 A;  1A6S A;  2LYA A;  1GO3 F;  2H3Z A;  2K4H A;  2VIX A;  2XI9 A;  1HIW A;  2ZG6 A;  2DF4 B;  2ZIX B;  2ZIW B;  3CYM A;  3KFU F;  1F44 A;  3SQI A;  4KX5 A;  3PZP A;  3N7R C;  2ZXH A;  2E1E A;  2GOL A;  1SZH A;  2DQN B;  2YB1 A;  2MA1 A;  3K1Z A;  3OPX A;  4CRX A;  5HR6 A;  2G5H B;  4P0P A;  2NV3 A;  1MA7 A;  4WJ3 B;  2XVT A;  3SAG A;  1URJ A;  3IG8 A;  3M6Z A;  2K8C B;  3DEE A;  3N7S C;  2KJ5 A;  2KJ9 A;  3ALR A;  3AQE A;  3VC8 A;  2YX8 A;  1WUD A;  2N1R A;  4OJL A;  4PL2 A;  3H0M B;  4QIW C;  2RRD A;  3SAF A;  2ZIV B;  2F8L A;  2ZIU A;  3IP4 B;  2LYB A;  1L6N A;  2JGA A;  4P0Q B;  5A0L A;  5T14 A;  2Q4T A;  3HKZ F;  2F2A B;  4FE3 A;  1T94 A;  2LKY A;  2GH1 A;  2XID A;  5HR7 A;  2ZXI A;  3F2C A;  4BUG A;  5KL8 B;  4QJF B;  3M6K A;  2KHV A;  2HBJ A;  2G06 A;  2HBL A;  1XNS A;  2Y0S C;  4PL1 A;  2F77 X;  4NWI A;  2KHQ A;  2VKQ A;  2WB1 C;  1DRG A;  2YB4 A;  2K8A A;  2H3Q A;  1HEK A;  2KV2 A;  1Z1B A;  2KVC A;  2Y0S F;  1Q3V A;  3AQF A;  3ICX A;  2KIW A;  4OJ5 A;  2HOI A;  2KOB A;  3GZF A;  2WB1 F;  2VJ4 A;  3IG5 A;  3H0R B;  2G07 A;  1Z19 A;  2G0A A;  3H0L B;  4O3M A;  2HBM A;  2PMZ C;  2JH1 A;  3PSI A;  4NV0 A;  2RHF A;  3RFA A;  2R18 A;  3HKZ C;  4CDG A;  2HOQ A;  3N7P D;  2OXO A;  4FZM A;  2ZIW A;  2PMZ F;  2ZIX A;  2F76 X;  2G5I B;  2HMX A;  3E0F A;  2KIC A;  1ED1 A;  4ICA A;  2E5S A;  2KKV A;  1OUQ A;  1CRX A;  2H3F A;  2LHT A;  2JH7 A;  2HOF A;  4QNL A;  3LVW A;  3M7D A;  1IIP A;  3NUQ A;  2CN1 A;  3RF9 A;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...