2KOBA

Solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Solution NMR structure of CLOLEP_01837 (fragment 61-160) from Clostridium leptum. Northeast Structural Genomics Consortium Target QlR8A
rcsb
source organism Clostridium leptum dsm 753
total genus 34
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kobA01
3C29A 2KD1A 3CRXA 2KJ8A 3LYSA 1XO0A 1A0PA 4ACOA 2HOFA 1Q3UA 2KHQA 2KKVA 1PVQA 2KHVA 1PVRA 1NZBA 1CRXA 1P7DA 2KKPA 3C28A 1Z1BA 2CRXA 2HOIA 1KBUA 1Q3VA 1XNSA 1PVPA 4A8EA 2KIWA 2KJ9A 3NRWA 1OUQA 4CRXA 1Z19A 2OXOA 2KJ5A 5CRXA 3MGVA 1F44A 2KOBA 1DRGA 2KEYA 1MA7A 2A3VA
chains in the Genus database with same CATH superfamily
1FFUA 4GXKA 4B9TA 1D8YA 5KAFU 4YR3A 4B9VA 3OTQA 2WF5A 2KIVA 1QSYA 3PNCA 5ALLA 3PVXA 2W3RA 1DXSA 2R8GA 3EW9A 3KKAC 3V7KA 5KTQA 1SXDA 1Z4OA 2W8LA 2VA2A 5KT7A 2GWSA 2IHNA 1TAQA 1KDHA 4TURA 4J9SA 4M9NA 1ZD4A 2WF9A 4DL6A 2ZIVB 5KFBA 3G6YA 2VA3A 1XWLA 2G0AA 2C2DA 2XVTA 1ZQBA 2KZMA 4KLQA 2HOQA 2HCFA 2KSOA 4PGYA 2RLTA 5KFVA 2DPJA 3F5AA 5KT5A 4ECZA 3UMGA 5J2HA 2JGAA 4O0IA 2OYYA 3DDHA 2ZXIA 3QUCA 4NXZA 2Y9UA 4F5PA 2DUYA 4PPXA 2H3QA 1D9FA 4RT3A 1JUDA 1BPYA 4BUGA 1QQ6A 4QWCA 2BCVA 5KL1B 4Y2RA 2IOFA 2VKQA 4JWMA 2MRLA 4P0PA 5HR7A 4EX6A 4J9OA 1ZD5A 1X9WA 4QZBA 4C0ZA 2BKEA 3SAHA 1ED1A 4IRDA 1DOQA 4RQ7A 3KZXA 4P0QB 4C7ZA 8ICTA 2QB0A 2B0CA 2DKXA 3BS7A 3JPSA 1XSNA 1X6IA 3KHLA 2OCEA 2P6UA 7ICLA 3GILA 3TFSA 1LB2B 3ZD9A 3IDWA 2LKYA 5JU5A 3PMLA 1HJPA 3WK8A 1NJYA 3NS1A 1ZQLA 4O5EA 4F4XA 2I9GA 5KFGA 4QW8A 2BPCA 5KL8B 4KLDA 5F9NA 1ZQRA 4DS5A 4ECXA 9ICMA 1BNOA 5KFNA 4NLNA 9ICAA 1XSPA 1HUZA 4KLIA 2JEGA 3SEIA 1FFVA 4OJLA 2BQ3A 3JPOA 1S0MA 5J0OA 1NK7A 2BR0A 4UBBA 2Y0SF 2BCUA 3KHRA 8ICBA 1TKDA 1D8LA 1KSPA 2HBKA 1S9FA 4ECWA 3HKZF 2FDRA 3PX0A 1ZRNA 4ICAA 1COOA 4FZNA 5EWFA 5J2FA 3Q8SB 3VCBA 5AM5A 1NZBA 3QU5A 5AKIA 4GLXA 1WWUA 1XSLA 1MN8A 3PW4A 2ZUDA 8ICRA 2W04A 4F5QA 3GIIA 1IM4A 2KK0A 2J6UA 4RQMA 2KD1A 4O3RA 4ZH4A 4TUQA 4RQ3A 3JPTA 3MR6A 2I5HA 2XC9A 4F5OA 4KTQA 2K89A 2KP7A 2K4IA 3SAFA 2AGOA 4RQ5A 3D2SA 5ALYA 5ALVA 1K1QA 4EYHB 4DFMA 3UQ2A 2AXTU 4ACOA 1NKBA 1Z1BA 2HHTA 1U47A 4CNQA 1U9LA 1KQQA 4O5CA 3RH4A 7ICKA 4C8KA 3PW7A 1BPXA 8ICKA 5EE3A 4KLOA 2ZIWB 2NV3A 4F92B 5EWGA 9ICFA 1ZQMA 2A3VA 4B9LA 2ZIXA 8ICFA 1F0MA 2OM6A 1PK1A 9ICLA 4I2JA 4KLMA 1UA0A 4OJPA 4BXOB 3WU2U 2WB1F 1JRPA 5AM4A 4RT2A 2VJ5A 1ZJMA 2F8KA 4DO9A 1S0VA 2FPLA 1KRPA 3RRGA 4Y2QA 9ICSA 1ZQEA 2W9BB 2AGQA 4O3OA 4Y2SA 4RNMA 3RJHA 5HR6A 1DGSA 5AK5A 1PUZA 7ICRA 4DWIA 5JTIA 3ISDA 5J2IA 1SL1A 3U26A 3EYZA 1Z4NA 3JPRA 3C1YA 1HUOA 4F8RA 2EZXA 2EH9A 3HPOA 4KN4A 4HYKA 3TADA 1SZHA 2HOFA 3FDSA 2OWOA 1Z00A 4F72A 3GU3A 1T4GA 2A19A 1RDFA 5EE1A 8ICQA 2AGPA 4FZLA 1D8BA 4DLGA 1A77A 4FBTA 2KVSA 1X66A 2HW3A 1F5SA 5H2FU 2A1JA 4J03A 5DBCA 5KFQA 3TANA 1NI3A 5AM3A 4C8NA 1Q8KA 3MGHA 5ALOA 7ICSA 2ZJ8A 1ZQCA 5KFLA 7ICEA 4M6WA 1AQ6A 2FLLA 3MGVA 3IRUA 2DGZA 2IMWP 1LKYB 5AIAA 3T3FA 5HMLA 1RG6A 1B22A 4YFKA 1XC9A 1MQ3A 4Y2JA 3L5KA 4P4MA 2W54A 4C4SA 5ALNA 4IQUA 2V4QA 2LHTA 5E79U 4R8UB 3D6JA 4YMMA 4KLLA 2MUTB 4QWEA 3JPNA 3QNMA 2ISPA 5KFIA 3AM9A 3PW5A 3PO4A 2F76X 1N2XA 4F5RA 3T5HA 4Y2XA 3RJIA 1S76D 5AI5A 1XNSA 1ZQWA 4EENA 4C8MA 4F4ZA 4KLTA 4ED1A 2FJ6A 5CJ7A 1JROA 2LYHA 3F2CA 4Y2VA 1N5WA 5IIKA 3SV4A 1XS9D 5J0RA 5BPCA 1HIWA 2ODGA 2JEFA 5AI6A 2BQUA 3N4MB 2XGPA 3QUQA 2HDOA 4JV1A 1GO3F 3RB3A 4NLCA 1QH9A 3NASA 4PL2A 5CEHA 1UHUA 5J29A 3J81j 3OHAA 4YMNA 2WF6A 4M9JA 4ELVA 3IM1A 2CN1A 4Z6FA 3UPQA 2KKPA 2YMLA 4RPZA 2AQ0A 5JUMA 8ICYA 4C7YA 1JXEA 3LVVA 2KICA 4JMUA 1S10A 4F91B 2F44A 2JZBA 3VC8A 2YMPA 1BNPA 4YR2A 1JI7A 3SENA 4QZDA 1U45A 4DQRA 2PMZC 4RQNA 3K1ZA 2ALZA 3OJUA 3KOOA 3D2NA 3M8SA 3V6HA 1TK0A 1RYRA 5KT6A 4DSLA 4DS4A 4J9KA 4J9QA 1QSLA 3H8SA 3EZ5A 5ALIA 5ALRA 1L3UA 5IIMA 4CDGA 1H38A 5IIJA 2J6TA 2KHQA 4RQ1A 2WHEA 2K8BB 1L7PA 3C23A 3RR8A 3NVZA 2XY6A 4RQ8A 9ICUA 1BPDA 3NRWA 1X9SA 3GIKA 2H3FA 4M0AA 3QZ7A 3AQFA 3T5LA 4FBUA 4UATA 8ICIA 1IG6A 2Y9TA 2C28A 3KBBA 3PV8A 4ZOHC 4LZDA 5AI9A 5TISU 2BGWA 3Q8RB 4CF5A 4F4YA 2YB1A 4NV0A 2V4RA 2FI1A 3B0XA 1C20A 1KEJA 2CXYA 4KITB 1RPLA 2ZTEA 4DCCA 5T14A 3DV9A 2YY6A 3NTUA 5AM0A 4M9HA 1N63A 3M9OB 2NYVA 5EE0A 2FMSA 4QZEA 4JUZA 3PO5A 3C28A 3B9JA 3M6KA 1LKYA 2NO5A 4QZ8A 1NK5A 4Z6CA 7ICUA 2DBYA 4DQSA 8ICSA 2PFNA 1L7NA 1PZNA 4UAUA 2R8JA 3CW2C 1XO0A 1B43A 2ZIUB 1A0PA 3E58A 1NOMA 3ETRA 3LVWA 3HW8A 4ED8A 5DLGA 1Q3VA 8ICPA 2QARA 2ZTDA 2PFPA 4GFJA 2IA6A 2WF7A 4C80A 1MA7A 2R8KA 2AH5A 3NVWA 4YR0A 1ZQTA 3TACB 4I29A 3MBYA 4TUSA 3RRHA 4PHEA 4B9NA 3H40A 3RH5A 2HOIA 5D4BA 5CA7A 3BQ2A 1KKXA 3MR3A 3RJKA 3HT3A 4DSJA 2OXOA 2FMPA 1NNLA 1SKSA 4IQTA 5DBBA 2IHMA 4R63A 3RJGA 4I2FA 1V97A 2LMRA 5KFZA 3WKCA 3ZDBA 3JPPA 2RDJA 3IV6A 3Q8MA 2RP5A 1S5LU 1SB3C 4BWMA 2DQNB 1QCKA 4F2RA 1DK3A 5J0XA 3HX0A 4DSEA 2VANA 4KX3A 4LZGA 2QB1A 3N7PD 4UAVA 1N62A 3N7RC 2P35A 2EAMA 1S0NA 8ICXA 1CRXA 1ZQJA 1RQLA 2W9CA 1JX4A 2W55A 2RDIA 4MFFA 3HWTA 2W7PA 4I2AA 4MHVA 2OHFA 5G5GA 4X5VA 2K60A 2Y0SC 3GV5B 9ICPA 2ISOA 4F4KA 3A0HU 5AIBA 5HMMA 1ZETA 2P6RA 3ISBA 3HKZC 1Q3UA 1PVQA 5KFHA 1SXEA 3LWLA 5CB1A 4DOAA 3RJFA 2ZUCA 3QEAZ 4Z6DA 5AK4A 5KG0A 3A0BU 3OHBA 4RQ2A 5KFDA 1F44A 2W03A 5AI0A 3FAHA 5KG5A 3M9NB 2KZZA 3ICXA 1SWWA 1OW5A 4DF4A 4PGXA 1NJXA 5J0YA 4DOCA 3QU4A 5DDMA 1L7OA 5J2DA 3RJEA 3H8WA 2LPEA 3FYHA 1SV4A 1U48A 2BDUA 4ECSA 2F8LA 2AQ4A 5J2BA 1MSWD 5AM1A 2E8OA 4Q8EA 2YB4A 2PFQA 3OPXA 4RQ4A 5AKYA 5J2GA 1SIJA 5DG9A 1NK6A 1ZQNA 3WK5A 7ICGA 2JH1A 2HI0A 2WFAA 4AP9A 4MEXA 1UQVA 5GTIU 3F53A 4QZ9A 3KFUF 2PKEA 3KTQA 4K4GA 5EE9A 3ETLA 3H8MA 5KNIA 4DFKA 4FFDA 4QZFA 1A76A 4TQSA 3GQCA 2UVUA 2MU2A 5K4LA 3ALRA 3AQEA 2R18A 3DEEA 3GZFA 2KZ3A 4UB3A 5AKJA 2WTFA 2HHXA 2BCRA 4RNNA 2FE9A 1K5OA 3MFHA 1VDVA 4FE3A 2ZIUA 2D3DA 3M6ZA 1X2IA 1UT5A 4NM1A 2KV2A 3NVYA 1SKRA 3PW2A 3OGUA 4J9NA 5L1JA 1S77D 1V9PA 3V7JA 1N5XA 1QTMA 4LVSA 2CRXA 1RXVA 1NKEA 5DB6A 5CR0A 8ICJA 2WF8A 4UB8U 2BQRA 3TI0A 4I28A 3BQ1A 4QWAA 3AN1A 1RZTA 2EAPA 3S6JA 4O5KA 2PI5A 1ZJNA 3ZDCA 5DBAA 3HP6A 2ZIVA 3ISCA 4I2EA 4BWJA 4Y2TA 3WKDA 1T3QA 3L4PA 4O3QA 3Q8LA 5TZVA 4KLUA 1YT3A 4UQGA 9ICCA 4GXIA 1UCVA 4I2HA 4EEYA 4PHDA 1J97A 5F3XB 1O03A 4AYBC 4EBCA 1T94A 3C5FA 1JXLA 2N1RA 1N60A 1KFTA 2KVCA 4QZHA 5KFEA 1ZQGA 3RB6A 4ECVA 4P4PA 3D2QA 4I2GA 5CP2A 3M9MB 4YMOA 4YD2A 2GLEA 5KFSA 5AKEA 2C22A 4LJXA 2ESEA 4M9LA 4USAA 4P0QA 2KEYA 5KFYA 1MQ2A 2LM4A 3CRXA 1FEZA 3V6JA 2G06A 3RF9A 1KFSA 1QQ7A 4UASA 2ZJAA 5KFRA 2AHOB 1SWVA 3H4DA 2DWQA 4FO6A 3ZD8A 4NLGA 2Y1IA 4QZAA 5ALMA 4US8A 1OUQA 5J0WA 1J2MA 2HBJA 2FPMA 4OCZA 5DQIA 5KT2A 3QXGA 5KFWA 1C7YA 1TE2A 5AKKA 2EZZA 8ICGA 1Z3EB 2HHSA 1J2NA 5DB8A 2JEJA 2ZXHA 3QYPA 2BCQA 3T5KA 3SD7A 1RYSA 5DG7A 5KFOA 1SL0A 3RJJA 3KZIU 3SZ2A 5DKWA 1WG8A 5ALTA 5B5EU 4JV0A 2E8NA 3BS5B 3UXPA 1COKA 5KFMA 4BX9C 2YTUA 2H5XA 4KLFA 4F93B 4U6PA 3RBDA 4E0DA 2E1FA 3BQ7A 2HHVA 2F2AB 1WCNA 3IG8A 4B9UA 1RM6C 1QSSA 3PX4A 2A1AA 3KHHA 2WAQC 4PHAA 3SYZA 9ICVA 2RRDA 5C5JA 3NRZA 4PL1A 1X42A 3H7IA 9ICEA 1ZQAA 4MFCA 1Z19A 2JHDA 2UVRA 1NK9A 3RH6A 5AKZA 5ALWA 1UA1A 2XICA 8ICNA 4OJ5A 4QJFB 3AU2A 4XA5A 8ICUA 2AU0A 5ALDA 1S8OA 3PSTA 4UAZA 2KJ9A 5KFKA 7ICIA 1WYGA 4IL6U 3I76A 3WK4A 3GIJA 5L1MA 3GV8B 4DEZA 3E2EA 5J2AA 4KN7A 4US9A 5DB7A 2KSOB 7ICPA 4IRCA 2NRWA 9ICQA 9ICKA 1NJZA 5AKGA 4I27A 2ZIWA 8ICAA 1PVPA 2HMXA 1T8EA 4C8LA 5ALHA 3KD3A 1S97A 1M6YA 2JXJA 3SV3A 4KLEA 3H4BA 4EYIB 1SV0A 2OH2A 4BXOA 1UT8A 5KT4A 3WKBA 5AM2A 4FZMA 4NLKA 1NK8A 4P0PB 3CNHA 3C2MA 3IP4B 1TFRA 3M8RA 4EBEA 4I2IA 1YZ6A 5HHHA 9ICOA 2M0NA 3H0MB 3EWAA 5DQGA 4F3OA 4DQIA 4CF4A 4U7CA 1ZQXA 4IRKA 2W9BA 2XCPA 2E8MA 2R8HA 5DGAA 2EQYA 4HAIA 1U49A 5J0TA 1SGGA 3MR2A 1ZYQA 1T7PA 3PZPA 3IG5A 3SMVA 4UB5A 1NK4A 5ALQA 3LDAA 4DSIA 4OD0A 4PH5A 1P7DA 4RQ0A 1ECWA 2LM1A 4PZOA 2KG5A 2HHQA 3N7SC 5ALZA 2ASLA 8ICZA 4CRXA 3C21A 1TVAA 5C0YA 4G3IA 1ZQDA 9ICJA 2I1QA 3WK7A 3QEBZ 8ICVA 1ZD3A 2F1HA 4R65A 4YD1A 4O3MA 4O9MA 2K8CB 3HJEA 4GC6A 8ICCA 3QUTA 5F9LA 1LVHA 4NWIA 5KT3A 2PMZF 3GV7B 9ICTA 4O3SA 5KFUA 1VJ5A 2K8AA 2JEIA 2K4EA 2OEHA 2F3NA 3H0RB 2CPRA 3QUBA 3K4GA 1ZQZA 2Q0ZX 1SL2A 4K4HA 3UXNA 4DL2A 3FC4A 3TFRA 2NO4A 3F5EA 4A8EA 5ALJA 4ECTA 5J0UA 2G5IB 3GIMA 3T79A 5BOLA 3V72A 1ZQOA 3AL0B 1N56A 4ECUA 2DF4B 3WKEA 3T5JA 5ALEA 7ICOA 2GO7A 3MDAA 3UXOA 4I2BA 2BPFA 4MF2A 4R8UA 2G09A 2H3VA 5DDYA 4ED2A 3NUQA 2MUTA 3BJYA 5KG2A 2DKZA 4J9PA 1ZD2P 1ZQYA 2KOBA 2O6KA 2BDPA 1VLBA 4DL3A 1DRGA 2K4PA 3G6XA 4YXJA 1CI4A 3LWMA 4PZNA 7ICMA 1EXNA 3WKAA 3PSPA 5CWRA 4IR9A 4GXJA 4Y2YA 3BZKA 3GDXA 3RB4A 1CEZA 1MC8A 4ECYA 2C2EA 7ICVA 1KTQA 2RHFA 4DOBA 4DL4A 3IN5A 3QU9A 2G07A 2FPKA 4Q45A 3TAPA 7ICNA 3JPQA 3AMZA 4DF8A 1IV8A 5BOMA 2PFOA 2ZIXB 4QIWF 5J0QA 1Q46A 1BPZA 4TQRA 1PK1B 2XCAA 1SV0C 9ICGA 3MFIA 5L1LA 4B9SA 2H3ZA 2LYBA 3SAGA 3V6KA 2NRVA 4R66A 3EPGA 1L3SA 2KN7A 5AK3A 5AKXA 4RPYA 1ZOLA 2JH7A 1CUKA 1B0XA 5L9XA 2BPGA 4B6JA 4EEKA 3QZ8A 3AU6A 4F5NA 4KLGA 4YXMA 4DQPA 4EZ9A 3PR4A 5KFJA 1L8LA 1BPBA 4IQWA 1L8OA 1OXJA 1ZRMA 3BQTA 4Y2PA 3UM9A 1TK8A 3Q8PB 1DGJA 4O3PA 3C2LA 2VJ4A 3H0LB 2KHVA 1V38A 2HHUA 4JB3A 4KX5A 2HVHA 5AI8A 2KIWA 5KG7A 4DLEA 2BCSA 2HVIA 1Z00B 3ZDDA 1KW4A 3RFAA 3K75D 1NJWA 3HILA 1K1SA 3ORYA 2D8CA 4UW9A 1FIQA 3ED5A 5KFCA 3QX7A 3PY8A 2A1JB 3F2BA 2IOHA 3MDCA 5ALKA 3LK9A 1ZQ1C 2Y1JA 4Y2UA 2YN4A 4ED7A 5HP4A 4M6WB 4ED0A 2K4HA 7ICHA 3RR7A 3IHQB 4QW9A 4ED3A 3H8JA 4ECRA 4JV2A 9ICWA 1DK2A 4CF3A 5G5HA 3AEVA 4RPXA 9ICHA 3I28A 3K1RB 5KFAA 5ALFA 3O0FA 4ECQA 4ED6A 2P66A 4UAWA 3Q8KA 4PGQA 1UPHA 4YQWA 4DSKA 3I1YA 2LI6A 2ZTCA 4EX7A 4ELUA 2ZJ5A 3PR5B 2C2RA 1JIHA 4DSFA 3PW0A 3PX6A 2HHWA 2Q4TA 3NVVA 2B6GA 1XO1A 1JMSA 5D46A 3PSIA 3ZI4A 1X40A 5DLFA 2FMQA 7ICQA 5KFPA 5J2CA 5J8YA 2PXIA 2QLTA 1ZQSA 3OSPA 4EZ6A 4BGDA 2UVWA 2NRTA 2WB1C 2KFNA 3QU7A 9ICNA 4OO1J 4RQ6A 4OJOA 4QZCA 1KN5A 1O08A 2JV3A 1A6SA 5J0SA 4JK1A 2BZFA 1SZPA 1NKCA 4NY8A 2W8KA 3MABA 3MGIA 4QNLA 2E5SA 4NLBA 2PI4A 1RQNA 2B21A 5D49A 1KL9A 4J9MA 4KMOB 3TQ1A 1L7MA 4G9BA 4F2SA 1WWVA 1X9MA 2E1EA 4BDPA 2GH1A 5DGBA 2DL0A 5KG4A 3RBEA 2LBOA 5AI4A 2W11A 3OJSA 2E3TA 2F77X 2W43A 5AK6A 1L5UA 3FM9A 4DL5A 3C2KA 4ELTA 3R9KA 2XY7A 4CE6A 1NZPA 3PSFA 1ZQIA 4WJ3B 1BPEA 5AKLA 4P4OA 2FLNA 3TARA 5J2JA 4MF8A 2JZBB 3QE9Y 5IILA 2UVVA 2YMMA 4IQVA 1X9XA 3CP8A 4J9RA 1TV9A 5AKHA 8ICHA 4PJ0U 2QKQA 5J0PA 1X6JA 4RNOA 2EAOA 4TUPA 3BQ0A 1SKWA 3MC1A 5J2EA 1B4FA 4NL9A 5A0LA 2YX8A 4XRHA 2G5HB 4F50A 4YCXA 2KKVA 1TAMA 1PK3A 2W7OA 4DFJA 4FS2A 2JR5A 4FS1A 2GOLA 7ICFA 2V9WA 1QLNA 2LYAA 1T3NA 4O3NA 5KAIU 5DQHA 1ZQHA 1HEKA 3OSNA 2EZYA 4CGZA 4YN4A 1Y88A 2W9MA 3BDPA 4BJQA 4UBCA 4Q43A 2XGQA 5IINA 2MA1A 1N61A 4AYBF 2I6XA 8ICMA 4KLHA 3M1YA 4GC7A 5KG1A 3V7LA 5ALGA 5DB9A 3N97B 4J9LA 1TK5A 2XY5A 4UB2A 4DFPA 1NK0A 3M7DA 3Q8QB 2KJ5A 2D6FC 4IR1A 4XUSA 4Q8FA 8ICWA 5JRTA 5AICA 3THVA 3B0YA 1L6NA 3N28A 4B9MA 1KFDA 5ALPA 5HHIA 2R8IA 2ZUBA 3RAXA 4KLSA 1ZQQA 3ZDAA 1URJA 4I2DA 4RUAA 4C4RA 4P2HA 4QZGA 4UAYA 1ZQPA 4C8OA 4PHPA 4JWNA 1KLNA 4M04A 3WK6A 1PVRA 2EDUA 5J8YC 2XI9A 1S0OA 4RZRA 2Z7JA 3C1ZA 3WK9A 3L3FX 4DQQA 1WCLA 2F1JA 4YG2A 5HNKA 1Z1VA 2XO7A 1XU4A 1JN3A 2QARB 8ICLA 4NLZA 4QWBA 4IS7A 4NM2A 3F2DA 2HSZA 2RQ5A 5KG3A 3SR6A 3RB0A 3ONNA 1ZQVA 4YVZA 3ZDEA 3UMBA 1U4BA 2W3SA 4GIBA 3QU2A 3C5GA 3KKAA 4IC9A 4QZIA 5FP0A 4Q44A 2KJ8A 2IBKA 2VA8A 4I2CA 5IIIA 4OJ6A 4F4WA 7ICTA 2ATLA 5ALXA 1RXWA 3NGDA 4R64A 1ZXIA 1ZQUA 3GFKB 2G08A 3E0FA 3EUB2 5B66U 2KTQA 4CCHA 5KFXA 3UMCA 2WAQF 2XIDA 4UB4A 4RU9A 3SI8A 3EPIA 5KG6A 2F1IA 2NRXA 4F71A 5IIOA 4NJ8A 2BHNA 1FO4A 2HBMA 3RTVA 5L1KA 1LV5A 5EWEA 2MSNA 1BGXT 8ICOA 9ICRA 3KHGA 5DG8A 2DFLA 4C4TA 3BZCA 8ICEA 3MR5A 4UARA 9ICIA 4EELA 4NL9C 2W9CB 2FLPA 3PMNA 1IXRA 3UQ0A 2JMGA 2QB0B 1YZ7A 4K4IA 2EANA 1L3TA 5EOZA 1L3VA 1AROP 2L5YA 4UB1A 3AUOA 2KE7A 5KFTA 2AJQA 3G6VA 5L1IA 3TADC 1V85A 1IIPA 2W9AA 1TAUA 1WUDA 9ICBA 3HRDD 3C29A 2ZG6A 2VIXA 4M47A 1ZQFA 2ASJA 2J6SA 2MAXA 2ES6A 5J2KA 1KBUA 7ICJA 4KLJA 5KFFA 2KFZA 4DL7A 4MFAA 2DPIA 4Z6EA 4EBDA 4QWDA 2KNJA 2YMQA 3SQIA 5CRXA 2IOFK 2YQEA 5ALSA 2NRZA 2JRZA 4YP3A 3RAQA 4RUCA 1JALA 2ASDA 5AHXA 1BVSA 2E8PA 9ICXA 3BS5A 4M2YA 4UB6U 2KMDA 3TKAA 1N48A 3LYSA 1D9DA 2H3IA 5ALUA 4MEYA 1ZQKA 2M9NA 1RYUA 5CHGA 4KMUA 3TAQA 4XQ8A 5GTHU 4M9GA 1QQ5A 4QIWC 4DFDA 3CYMA 2HBLA
chains in the Genus database with same CATH topology
3PSFA 4KX3A 3CRXA 4WJ3B 3N7PD 2K4HA 2XICA 4OJ5A 2G06A 3N7RC 3RF9A 4ACOA 2CN1A 3ALRA 4QJFB 3AQEA 1PVRA 2R18A 1CRXA 3DEEA 2KKPA 3GZFA 2ZIXB 3C28A 2XI9A 1Z1BA 4QIWF 3M6KA 4O3MA 5KL8B 2K8CB 2Z7JA 3O0FA 3CP8A 2W7PA 3PSTA 2KJ9A 3L3FX 1UPHA 1OUQA 4FE3A 4NWIA 2ZIUA 2PMZF 3M6ZA 3LVVA 2KICA 1IIPA 2Y0SC 2H3ZA 4JMUA 3MGVA 1WUDA 2HBJA 2LYBA 2NV3A 2ZIWB 3VC8A 3SAGA 2DGZA 2KV2A 4OJLA 2A3VA 2K8AA 2ZIXA 3C29A 2ZG6A 2VIXA 2K4EA 1XO0A 5A0LA 2ZIUB 2JH7A 3HKZC 1A0PA 2OM6A 2G5HB 2YX8A 1Q3UA 3F2DA 2PMZC 2KKVA 1TAMA 3H0RB 3K1ZA 2W7OA 1PVQA 2CPRA 2Q4TA 2Y0SF 3LVWA 3ONNA 2ZXHA 4OJPA 2CRXA 3D2NA 2GOLA 2ZIVB 2ZIWA 1KBUA 2WB1F 1Q3VA 3F5EA 1PVPA 4A8EA 2HMXA 2VJ5A 2HBKA 2G0AA 2LYAA 3PSIA 2XVTA 3HKZF 2G5IB 4GFJA 1HEKA 2LHTA 3T79A 2HOQA 2KNJA 1F44A 4CGZA 2W03A 1MA7A 3SQIA 5CRXA 3F5AA 3ICXA 4ICAA 4IC9A 4FZNA 2WB1C 2OH2A 3AL0B 2KJ8A 2DF4B 2ZIVA 5HR6A 2JGAA 4BJQA 4CDGA 4FZMA 2OYYA 4P0PB 2VJ4A 4OO1J 2KHQA 3IP4B 3VCBA 2ZXIA 2F76X 2KHVA 3H0LB 2K8BB 2MA1A 4OJOA 4BX9C 1NZBA 1D8BA 4AYBF 4OJ6A 4U6PA 1A6SA 2H3QA 2M0NA 4KX5A 3H0MB 2HOIA 1YT3A 2G09A 2H3VA 1XNSA 4U7CA 2KIWA 2G08A 2E1FA 3NUQA 3E0FA 4BUGA 3NRWA 4QNLA 2W04A 5KL1B 2E5SA 2VKQA 4NLBA 3M7DA 2OXOA 2MRLA 2KJ5A 2F2AB 2BDUA 2WAQF 2XIDA 4P0PA 2D6FC 5HR7A 3RFAA 2F8LA 2KOBA 4AYBC 1T94A 4KMOB 3IG8A 1DRGA 2H3FA 2N1RA 3PZPA 3IG5A 4C0ZA 3SMVA 2KD1A 3AQFA 2YB4A 3SAHA 3LYSA 1ED1A 2HBMA 3OPXA 1SZHA 3F2CA 2KVCA 2H3IA 2HOFA 4P0QB 2E1EA 3KZXA 2GH1A 3PSPA 3D2QA 2G07A 2WAQC 1P7DA 1L6NA 2RP5A 1HIWA 2JH1A 2K89A 2RRDA 2YB1A 1ECWA 2K4IA 4NV0A 3SAFA 2LBOA 3F2BA 4PL1A 3GU3A 3D2SA 2F77X 3N7SC 3F53A 1ZQ1C 2DQNB 1GO3F 4CRXA 1Z19A 2JHDA 2RHFA 3KFUF 4NLCA 1URJA 4P0QA 2JMGA 4PL2A 4QIWC 3IN5A 2LKYA 5T14A 3CYMA 2KEYA 5C0YA 4FZLA 2HBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C29 A;  2KD1 A;  3CRX A;  2KJ8 A;  3LYS A;  1XO0 A;  1A0P A;  4ACO A;  2HOF A;  1Q3U A;  2KHQ A;  2KKV A;  1PVQ A;  2KHV A;  1PVR A;  1NZB A;  1CRX A;  1P7D A;  2KKP A;  3C28 A;  1Z1B A;  2CRX A;  2HOI A;  1KBU A;  1Q3V A;  1XNS A;  1PVP A;  4A8E A;  2KIW A;  2KJ9 A;  3NRW A;  1OUQ A;  4CRX A;  1Z19 A;  2OXO A;  2KJ5 A;  5CRX A;  3MGV A;  1F44 A;  2KOB A;  1DRG A;  2KEY A;  1MA7 A;  2A3V A; 
#chains in the Genus database with same CATH topology
 1FFU A;  4GXK A;  4B9T A;  1D8Y A;  5KAF U;  4YR3 A;  4B9V A;  3OTQ A;  2WF5 A;  2KIV A;  1QSY A;  3PNC A;  5ALL A;  3PVX A;  2W3R A;  1DXS A;  2R8G A;  3EW9 A;  3KKA C;  3V7K A;  5KTQ A;  1SXD A;  1Z4O A;  2W8L A;  2VA2 A;  5KT7 A;  2GWS A;  2IHN A;  1TAQ A;  1KDH A;  4TUR A;  4J9S A;  4M9N A;  1ZD4 A;  2WF9 A;  4DL6 A;  2ZIV B;  5KFB A;  3G6Y A;  2VA3 A;  1XWL A;  2G0A A;  2C2D A;  2XVT A;  1ZQB A;  2KZM A;  4KLQ A;  2HOQ A;  2HCF A;  2KSO A;  4PGY A;  2RLT A;  5KFV A;  2DPJ A;  3F5A A;  5KT5 A;  4ECZ A;  3UMG A;  5J2H A;  2JGA A;  4O0I A;  2OYY A;  3DDH A;  2ZXI A;  3QUC A;  4NXZ A;  2Y9U A;  4F5P A;  2DUY A;  4PPX A;  2H3Q A;  1D9F A;  4RT3 A;  1JUD A;  1BPY A;  4BUG A;  1QQ6 A;  4QWC A;  2BCV A;  5KL1 B;  4Y2R A;  2IOF A;  2VKQ A;  4JWM A;  2MRL A;  4P0P A;  5HR7 A;  4EX6 A;  4J9O A;  1ZD5 A;  1X9W A;  4QZB A;  4C0Z A;  2BKE A;  3SAH A;  1ED1 A;  4IRD A;  1DOQ A;  4RQ7 A;  3KZX A;  4P0Q B;  4C7Z A;  8ICT A;  2QB0 A;  2B0C A;  2DKX A;  3BS7 A;  3JPS A;  1XSN A;  1X6I A;  3KHL A;  2OCE A;  2P6U A;  7ICL A;  3GIL A;  3TFS A;  1LB2 B;  3ZD9 A;  3IDW A;  2LKY A;  5JU5 A;  3PML A;  1HJP A;  3WK8 A;  1NJY A;  3NS1 A;  1ZQL A;  4O5E A;  4F4X A;  2I9G A;  5KFG A;  4QW8 A;  2BPC A;  5KL8 B;  4KLD A;  5F9N A;  1ZQR A;  4DS5 A;  4ECX A;  9ICM A;  1BNO A;  5KFN A;  4NLN A;  9ICA A;  1XSP A;  1HUZ A;  4KLI A;  2JEG A;  3SEI A;  1FFV A;  4OJL A;  2BQ3 A;  3JPO A;  1S0M A;  5J0O A;  1NK7 A;  2BR0 A;  4UBB A;  2Y0S F;  2BCU A;  3KHR A;  8ICB A;  1TKD A;  1D8L A;  1KSP A;  2HBK A;  1S9F A;  4ECW A;  3HKZ F;  2FDR A;  3PX0 A;  1ZRN A;  4ICA A;  1COO A;  4FZN A;  5EWF A;  5J2F A;  3Q8S B;  3VCB A;  5AM5 A;  1NZB A;  3QU5 A;  5AKI A;  4GLX A;  1WWU A;  1XSL A;  1MN8 A;  3PW4 A;  2ZUD A;  8ICR A;  2W04 A;  4F5Q A;  3GII A;  1IM4 A;  2KK0 A;  2J6U A;  4RQM A;  2KD1 A;  4O3R A;  4ZH4 A;  4TUQ A;  4RQ3 A;  3JPT A;  3MR6 A;  2I5H A;  2XC9 A;  4F5O A;  4KTQ A;  2K89 A;  2KP7 A;  2K4I A;  3SAF A;  2AGO A;  4RQ5 A;  3D2S A;  5ALY A;  5ALV A;  1K1Q A;  4EYH B;  4DFM A;  3UQ2 A;  2AXT U;  4ACO A;  1NKB A;  1Z1B A;  2HHT A;  1U47 A;  4CNQ A;  1U9L A;  1KQQ A;  4O5C A;  3RH4 A;  7ICK A;  4C8K A;  3PW7 A;  1BPX A;  8ICK A;  5EE3 A;  4KLO A;  2ZIW B;  2NV3 A;  4F92 B;  5EWG A;  9ICF A;  1ZQM A;  2A3V A;  4B9L A;  2ZIX A;  8ICF A;  1F0M A;  2OM6 A;  1PK1 A;  9ICL A;  4I2J A;  4KLM A;  1UA0 A;  4OJP A;  4BXO B;  3WU2 U;  2WB1 F;  1JRP A;  5AM4 A;  4RT2 A;  2VJ5 A;  1ZJM A;  2F8K A;  4DO9 A;  1S0V A;  2FPL A;  1KRP A;  3RRG A;  4Y2Q A;  9ICS A;  1ZQE A;  2W9B B;  2AGQ A;  4O3O A;  4Y2S A;  4RNM A;  3RJH A;  5HR6 A;  1DGS A;  5AK5 A;  1PUZ A;  7ICR A;  4DWI A;  5JTI A;  3ISD A;  5J2I A;  1SL1 A;  3U26 A;  3EYZ A;  1Z4N A;  3JPR A;  3C1Y A;  1HUO A;  4F8R A;  2EZX A;  2EH9 A;  3HPO A;  4KN4 A;  4HYK A;  3TAD A;  1SZH A;  2HOF A;  3FDS A;  2OWO A;  1Z00 A;  4F72 A;  3GU3 A;  1T4G A;  2A19 A;  1RDF A;  5EE1 A;  8ICQ A;  2AGP A;  4FZL A;  1D8B A;  4DLG A;  1A77 A;  4FBT A;  2KVS A;  1X66 A;  2HW3 A;  1F5S A;  5H2F U;  2A1J A;  4J03 A;  5DBC A;  5KFQ A;  3TAN A;  1NI3 A;  5AM3 A;  4C8N A;  1Q8K A;  3MGH A;  5ALO A;  7ICS A;  2ZJ8 A;  1ZQC A;  5KFL A;  7ICE A;  4M6W A;  1AQ6 A;  2FLL A;  3MGV A;  3IRU A;  2DGZ A;  2IMW P;  1LKY B;  5AIA A;  3T3F A;  5HML A;  1RG6 A;  1B22 A;  4YFK A;  1XC9 A;  1MQ3 A;  4Y2J A;  3L5K A;  4P4M A;  2W54 A;  4C4S A;  5ALN A;  4IQU A;  2V4Q A;  2LHT A;  5E79 U;  4R8U B;  3D6J A;  4YMM A;  4KLL A;  2MUT B;  4QWE A;  3JPN A;  3QNM A;  2ISP A;  5KFI A;  3AM9 A;  3PW5 A;  3PO4 A;  2F76 X;  1N2X A;  4F5R A;  3T5H A;  4Y2X A;  3RJI A;  1S76 D;  5AI5 A;  1XNS A;  1ZQW A;  4EEN A;  4C8M A;  4F4Z A;  4KLT A;  4ED1 A;  2FJ6 A;  5CJ7 A;  1JRO A;  2LYH A;  3F2C A;  4Y2V A;  1N5W A;  5IIK A;  3SV4 A;  1XS9 D;  5J0R A;  5BPC A;  1HIW A;  2ODG A;  2JEF A;  5AI6 A;  2BQU A;  3N4M B;  2XGP A;  3QUQ A;  2HDO A;  4JV1 A;  1GO3 F;  3RB3 A;  4NLC A;  1QH9 A;  3NAS A;  4PL2 A;  5CEH A;  1UHU A;  5J29 A;  3J81 j;  3OHA A;  4YMN A;  2WF6 A;  4M9J A;  4ELV A;  3IM1 A;  2CN1 A;  4Z6F A;  3UPQ A;  2KKP A;  2YML A;  4RPZ A;  2AQ0 A;  5JUM A;  8ICY A;  4C7Y A;  1JXE A;  3LVV A;  2KIC A;  4JMU A;  1S10 A;  4F91 B;  2F44 A;  2JZB A;  3VC8 A;  2YMP A;  1BNP A;  4YR2 A;  1JI7 A;  3SEN A;  4QZD A;  1U45 A;  4DQR A;  2PMZ C;  4RQN A;  3K1Z A;  2ALZ A;  3OJU A;  3KOO A;  3D2N A;  3M8S A;  3V6H A;  1TK0 A;  1RYR A;  5KT6 A;  4DSL A;  4DS4 A;  4J9K A;  4J9Q A;  1QSL A;  3H8S A;  3EZ5 A;  5ALI A;  5ALR A;  1L3U A;  5IIM A;  4CDG A;  1H38 A;  5IIJ A;  2J6T A;  2KHQ A;  4RQ1 A;  2WHE A;  2K8B B;  1L7P A;  3C23 A;  3RR8 A;  3NVZ A;  2XY6 A;  4RQ8 A;  9ICU A;  1BPD A;  3NRW A;  1X9S A;  3GIK A;  2H3F A;  4M0A A;  3QZ7 A;  3AQF A;  3T5L A;  4FBU A;  4UAT A;  8ICI A;  1IG6 A;  2Y9T A;  2C28 A;  3KBB A;  3PV8 A;  4ZOH C;  4LZD A;  5AI9 A;  5TIS U;  2BGW A;  3Q8R B;  4CF5 A;  4F4Y A;  2YB1 A;  4NV0 A;  2V4R A;  2FI1 A;  3B0X A;  1C20 A;  1KEJ A;  2CXY A;  4KIT B;  1RPL A;  2ZTE A;  4DCC A;  5T14 A;  3DV9 A;  2YY6 A;  3NTU A;  5AM0 A;  4M9H A;  1N63 A;  3M9O B;  2NYV A;  5EE0 A;  2FMS A;  4QZE A;  4JUZ A;  3PO5 A;  3C28 A;  3B9J A;  3M6K A;  1LKY A;  2NO5 A;  4QZ8 A;  1NK5 A;  4Z6C A;  7ICU A;  2DBY A;  4DQS A;  8ICS A;  2PFN A;  1L7N A;  1PZN A;  4UAU A;  2R8J A;  3CW2 C;  1XO0 A;  1B43 A;  2ZIU B;  1A0P A;  3E58 A;  1NOM A;  3ETR A;  3LVW A;  3HW8 A;  4ED8 A;  5DLG A;  1Q3V A;  8ICP A;  2QAR A;  2ZTD A;  2PFP A;  4GFJ A;  2IA6 A;  2WF7 A;  4C80 A;  1MA7 A;  2R8K A;  2AH5 A;  3NVW A;  4YR0 A;  1ZQT A;  3TAC B;  4I29 A;  3MBY A;  4TUS A;  3RRH A;  4PHE A;  4B9N A;  3H40 A;  3RH5 A;  2HOI A;  5D4B A;  5CA7 A;  3BQ2 A;  1KKX A;  3MR3 A;  3RJK A;  3HT3 A;  4DSJ A;  2OXO A;  2FMP A;  1NNL A;  1SKS A;  4IQT A;  5DBB A;  2IHM A;  4R63 A;  3RJG A;  4I2F A;  1V97 A;  2LMR A;  5KFZ A;  3WKC A;  3ZDB A;  3JPP A;  2RDJ A;  3IV6 A;  3Q8M A;  2RP5 A;  1S5L U;  1SB3 C;  4BWM A;  2DQN B;  1QCK A;  4F2R A;  1DK3 A;  5J0X A;  3HX0 A;  4DSE A;  2VAN A;  4KX3 A;  4LZG A;  2QB1 A;  3N7P D;  4UAV A;  1N62 A;  3N7R C;  2P35 A;  2EAM A;  1S0N A;  8ICX A;  1CRX A;  1ZQJ A;  1RQL A;  2W9C A;  1JX4 A;  2W55 A;  2RDI A;  4MFF A;  3HWT A;  2W7P A;  4I2A A;  4MHV A;  2OHF A;  5G5G A;  4X5V A;  2K60 A;  2Y0S C;  3GV5 B;  9ICP A;  2ISO A;  4F4K A;  3A0H U;  5AIB A;  5HMM A;  1ZET A;  2P6R A;  3ISB A;  3HKZ C;  1Q3U A;  1PVQ A;  5KFH A;  1SXE A;  3LWL A;  5CB1 A;  4DOA A;  3RJF A;  2ZUC A;  3QEA Z;  4Z6D A;  5AK4 A;  5KG0 A;  3A0B U;  3OHB A;  4RQ2 A;  5KFD A;  1F44 A;  2W03 A;  5AI0 A;  3FAH A;  5KG5 A;  3M9N B;  2KZZ A;  3ICX A;  1SWW A;  1OW5 A;  4DF4 A;  4PGX A;  1NJX A;  5J0Y A;  4DOC A;  3QU4 A;  5DDM A;  1L7O A;  5J2D A;  3RJE A;  3H8W A;  2LPE A;  3FYH A;  1SV4 A;  1U48 A;  2BDU A;  4ECS A;  2F8L A;  2AQ4 A;  5J2B A;  1MSW D;  5AM1 A;  2E8O A;  4Q8E A;  2YB4 A;  2PFQ A;  3OPX A;  4RQ4 A;  5AKY A;  5J2G A;  1SIJ A;  5DG9 A;  1NK6 A;  1ZQN A;  3WK5 A;  7ICG A;  2JH1 A;  2HI0 A;  2WFA A;  4AP9 A;  4MEX A;  1UQV A;  5GTI U;  3F53 A;  4QZ9 A;  3KFU F;  2PKE A;  3KTQ A;  4K4G A;  5EE9 A;  3ETL A;  3H8M A;  5KNI A;  4DFK A;  4FFD A;  4QZF A;  1A76 A;  4TQS A;  3GQC A;  2UVU A;  2MU2 A;  5K4L A;  3ALR A;  3AQE A;  2R18 A;  3DEE A;  3GZF A;  2KZ3 A;  4UB3 A;  5AKJ A;  2WTF A;  2HHX A;  2BCR A;  4RNN A;  2FE9 A;  1K5O A;  3MFH A;  1VDV A;  4FE3 A;  2ZIU A;  2D3D A;  3M6Z A;  1X2I A;  1UT5 A;  4NM1 A;  2KV2 A;  3NVY A;  1SKR A;  3PW2 A;  3OGU A;  4J9N A;  5L1J A;  1S77 D;  1V9P A;  3V7J A;  1N5X A;  1QTM A;  4LVS A;  2CRX A;  1RXV A;  1NKE A;  5DB6 A;  5CR0 A;  8ICJ A;  2WF8 A;  4UB8 U;  2BQR A;  3TI0 A;  4I28 A;  3BQ1 A;  4QWA A;  3AN1 A;  1RZT A;  2EAP A;  3S6J A;  4O5K A;  2PI5 A;  1ZJN A;  3ZDC A;  5DBA A;  3HP6 A;  2ZIV A;  3ISC A;  4I2E A;  4BWJ A;  4Y2T A;  3WKD A;  1T3Q A;  3L4P A;  4O3Q A;  3Q8L A;  5TZV A;  4KLU A;  1YT3 A;  4UQG A;  9ICC A;  4GXI A;  1UCV A;  4I2H A;  4EEY A;  4PHD A;  1J97 A;  5F3X B;  1O03 A;  4AYB C;  4EBC A;  1T94 A;  3C5F A;  1JXL A;  2N1R A;  1N60 A;  1KFT A;  2KVC A;  4QZH A;  5KFE A;  1ZQG A;  3RB6 A;  4ECV A;  4P4P A;  3D2Q A;  4I2G A;  5CP2 A;  3M9M B;  4YMO A;  4YD2 A;  2GLE A;  5KFS A;  5AKE A;  2C22 A;  4LJX A;  2ESE A;  4M9L A;  4USA A;  4P0Q A;  2KEY A;  5KFY A;  1MQ2 A;  2LM4 A;  3CRX A;  1FEZ A;  3V6J A;  2G06 A;  3RF9 A;  1KFS A;  1QQ7 A;  4UAS A;  2ZJA A;  5KFR A;  2AHO B;  1SWV A;  3H4D A;  2DWQ A;  4FO6 A;  3ZD8 A;  4NLG A;  2Y1I A;  4QZA A;  5ALM A;  4US8 A;  1OUQ A;  5J0W A;  1J2M A;  2HBJ A;  2FPM A;  4OCZ A;  5DQI A;  5KT2 A;  3QXG A;  5KFW A;  1C7Y A;  1TE2 A;  5AKK A;  2EZZ A;  8ICG A;  1Z3E B;  2HHS A;  1J2N A;  5DB8 A;  2JEJ A;  2ZXH A;  3QYP A;  2BCQ A;  3T5K A;  3SD7 A;  1RYS A;  5DG7 A;  5KFO A;  1SL0 A;  3RJJ A;  3KZI U;  3SZ2 A;  5DKW A;  1WG8 A;  5ALT A;  5B5E U;  4JV0 A;  2E8N A;  3BS5 B;  3UXP A;  1COK A;  5KFM A;  4BX9 C;  2YTU A;  2H5X A;  4KLF A;  4F93 B;  4U6P A;  3RBD A;  4E0D A;  2E1F A;  3BQ7 A;  2HHV A;  2F2A B;  1WCN A;  3IG8 A;  4B9U A;  1RM6 C;  1QSS A;  3PX4 A;  2A1A A;  3KHH A;  2WAQ C;  4PHA A;  3SYZ A;  9ICV A;  2RRD A;  5C5J A;  3NRZ A;  4PL1 A;  1X42 A;  3H7I A;  9ICE A;  1ZQA A;  4MFC A;  1Z19 A;  2JHD A;  2UVR A;  1NK9 A;  3RH6 A;  5AKZ A;  5ALW A;  1UA1 A;  2XIC A;  8ICN A;  4OJ5 A;  4QJF B;  3AU2 A;  4XA5 A;  8ICU A;  2AU0 A;  5ALD A;  1S8O A;  3PST A;  4UAZ A;  2KJ9 A;  5KFK A;  7ICI A;  1WYG A;  4IL6 U;  3I76 A;  3WK4 A;  3GIJ A;  5L1M A;  3GV8 B;  4DEZ A;  3E2E A;  5J2A A;  4KN7 A;  4US9 A;  5DB7 A;  2KSO B;  7ICP A;  4IRC A;  2NRW A;  9ICQ A;  9ICK A;  1NJZ A;  5AKG A;  4I27 A;  2ZIW A;  8ICA A;  1PVP A;  2HMX A;  1T8E A;  4C8L A;  5ALH A;  3KD3 A;  1S97 A;  1M6Y A;  2JXJ A;  3SV3 A;  4KLE A;  3H4B A;  4EYI B;  1SV0 A;  2OH2 A;  4BXO A;  1UT8 A;  5KT4 A;  3WKB A;  5AM2 A;  4FZM A;  4NLK A;  1NK8 A;  4P0P B;  3CNH A;  3C2M A;  3IP4 B;  1TFR A;  3M8R A;  4EBE A;  4I2I A;  1YZ6 A;  5HHH A;  9ICO A;  2M0N A;  3H0M B;  3EWA A;  5DQG A;  4F3O A;  4DQI A;  4CF4 A;  4U7C A;  1ZQX A;  4IRK A;  2W9B A;  2XCP A;  2E8M A;  2R8H A;  5DGA A;  2EQY A;  4HAI A;  1U49 A;  5J0T A;  1SGG A;  3MR2 A;  1ZYQ A;  1T7P A;  3PZP A;  3IG5 A;  3SMV A;  4UB5 A;  1NK4 A;  5ALQ A;  3LDA A;  4DSI A;  4OD0 A;  4PH5 A;  1P7D A;  4RQ0 A;  1ECW A;  2LM1 A;  4PZO A;  2KG5 A;  2HHQ A;  3N7S C;  5ALZ A;  2ASL A;  8ICZ A;  4CRX A;  3C21 A;  1TVA A;  5C0Y A;  4G3I A;  1ZQD A;  9ICJ A;  2I1Q A;  3WK7 A;  3QEB Z;  8ICV A;  1ZD3 A;  2F1H A;  4R65 A;  4YD1 A;  4O3M A;  4O9M A;  2K8C B;  3HJE A;  4GC6 A;  8ICC A;  3QUT A;  5F9L A;  1LVH A;  4NWI A;  5KT3 A;  2PMZ F;  3GV7 B;  9ICT A;  4O3S A;  5KFU A;  1VJ5 A;  2K8A A;  2JEI A;  2K4E A;  2OEH A;  2F3N A;  3H0R B;  2CPR A;  3QUB A;  3K4G A;  1ZQZ A;  2Q0Z X;  1SL2 A;  4K4H A;  3UXN A;  4DL2 A;  3FC4 A;  3TFR A;  2NO4 A;  3F5E A;  4A8E A;  5ALJ A;  4ECT A;  5J0U A;  2G5I B;  3GIM A;  3T79 A;  5BOL A;  3V72 A;  1ZQO A;  3AL0 B;  1N56 A;  4ECU A;  2DF4 B;  3WKE A;  3T5J A;  5ALE A;  7ICO A;  2GO7 A;  3MDA A;  3UXO A;  4I2B A;  2BPF A;  4MF2 A;  4R8U A;  2G09 A;  2H3V A;  5DDY A;  4ED2 A;  3NUQ A;  2MUT A;  3BJY A;  5KG2 A;  2DKZ A;  4J9P A;  1ZD2 P;  1ZQY A;  2KOB A;  2O6K A;  2BDP A;  1VLB A;  4DL3 A;  1DRG A;  2K4P A;  3G6X A;  4YXJ A;  1CI4 A;  3LWM A;  4PZN A;  7ICM A;  1EXN A;  3WKA A;  3PSP A;  5CWR A;  4IR9 A;  4GXJ A;  4Y2Y A;  3BZK A;  3GDX A;  3RB4 A;  1CEZ A;  1MC8 A;  4ECY A;  2C2E A;  7ICV A;  1KTQ A;  2RHF A;  4DOB A;  4DL4 A;  3IN5 A;  3QU9 A;  2G07 A;  2FPK A;  4Q45 A;  3TAP A;  7ICN A;  3JPQ A;  3AMZ A;  4DF8 A;  1IV8 A;  5BOM A;  2PFO A;  2ZIX B;  4QIW F;  5J0Q A;  1Q46 A;  1BPZ A;  4TQR A;  1PK1 B;  2XCA A;  1SV0 C;  9ICG A;  3MFI A;  5L1L A;  4B9S A;  2H3Z A;  2LYB A;  3SAG A;  3V6K A;  2NRV A;  4R66 A;  3EPG A;  1L3S A;  2KN7 A;  5AK3 A;  5AKX A;  4RPY A;  1ZOL A;  2JH7 A;  1CUK A;  1B0X A;  5L9X A;  2BPG A;  4B6J A;  4EEK A;  3QZ8 A;  3AU6 A;  4F5N A;  4KLG A;  4YXM A;  4DQP A;  4EZ9 A;  3PR4 A;  5KFJ A;  1L8L A;  1BPB A;  4IQW A;  1L8O A;  1OXJ A;  1ZRM A;  3BQT A;  4Y2P A;  3UM9 A;  1TK8 A;  3Q8P B;  1DGJ A;  4O3P A;  3C2L A;  2VJ4 A;  3H0L B;  2KHV A;  1V38 A;  2HHU A;  4JB3 A;  4KX5 A;  2HVH A;  5AI8 A;  2KIW A;  5KG7 A;  4DLE A;  2BCS A;  2HVI A;  1Z00 B;  3ZDD A;  1KW4 A;  3RFA A;  3K75 D;  1NJW A;  3HIL A;  1K1S A;  3ORY A;  2D8C A;  4UW9 A;  1FIQ A;  3ED5 A;  5KFC A;  3QX7 A;  3PY8 A;  2A1J B;  3F2B A;  2IOH A;  3MDC A;  5ALK A;  3LK9 A;  1ZQ1 C;  2Y1J A;  4Y2U A;  2YN4 A;  4ED7 A;  5HP4 A;  4M6W B;  4ED0 A;  2K4H A;  7ICH A;  3RR7 A;  3IHQ B;  4QW9 A;  4ED3 A;  3H8J A;  4ECR A;  4JV2 A;  9ICW A;  1DK2 A;  4CF3 A;  5G5H A;  3AEV A;  4RPX A;  9ICH A;  3I28 A;  3K1R B;  5KFA A;  5ALF A;  3O0F A;  4ECQ A;  4ED6 A;  2P66 A;  4UAW A;  3Q8K A;  4PGQ A;  1UPH A;  4YQW A;  4DSK A;  3I1Y A;  2LI6 A;  2ZTC A;  4EX7 A;  4ELU A;  2ZJ5 A;  3PR5 B;  2C2R A;  1JIH A;  4DSF A;  3PW0 A;  3PX6 A;  2HHW A;  2Q4T A;  3NVV A;  2B6G A;  1XO1 A;  1JMS A;  5D46 A;  3PSI A;  3ZI4 A;  1X40 A;  5DLF A;  2FMQ A;  7ICQ A;  5KFP A;  5J2C A;  5J8Y A;  2PXI A;  2QLT A;  1ZQS A;  3OSP A;  4EZ6 A;  4BGD A;  2UVW A;  2NRT A;  2WB1 C;  2KFN A;  3QU7 A;  9ICN A;  4OO1 J;  4RQ6 A;  4OJO A;  4QZC A;  1KN5 A;  1O08 A;  2JV3 A;  1A6S A;  5J0S A;  4JK1 A;  2BZF A;  1SZP A;  1NKC A;  4NY8 A;  2W8K A;  3MAB A;  3MGI A;  4QNL A;  2E5S A;  4NLB A;  2PI4 A;  1RQN A;  2B21 A;  5D49 A;  1KL9 A;  4J9M A;  4KMO B;  3TQ1 A;  1L7M A;  4G9B A;  4F2S A;  1WWV A;  1X9M A;  2E1E A;  4BDP A;  2GH1 A;  5DGB A;  2DL0 A;  5KG4 A;  3RBE A;  2LBO A;  5AI4 A;  2W11 A;  3OJS A;  2E3T A;  2F77 X;  2W43 A;  5AK6 A;  1L5U A;  3FM9 A;  4DL5 A;  3C2K A;  4ELT A;  3R9K A;  2XY7 A;  4CE6 A;  1NZP A;  3PSF A;  1ZQI A;  4WJ3 B;  1BPE A;  5AKL A;  4P4O A;  2FLN A;  3TAR A;  5J2J A;  4MF8 A;  2JZB B;  3QE9 Y;  5IIL A;  2UVV A;  2YMM A;  4IQV A;  1X9X A;  3CP8 A;  4J9R A;  1TV9 A;  5AKH A;  8ICH A;  4PJ0 U;  2QKQ A;  5J0P A;  1X6J A;  4RNO A;  2EAO A;  4TUP A;  3BQ0 A;  1SKW A;  3MC1 A;  5J2E A;  1B4F A;  4NL9 A;  5A0L A;  2YX8 A;  4XRH A;  2G5H B;  4F50 A;  4YCX A;  2KKV A;  1TAM A;  1PK3 A;  2W7O A;  4DFJ A;  4FS2 A;  2JR5 A;  4FS1 A;  2GOL A;  7ICF A;  2V9W A;  1QLN A;  2LYA A;  1T3N A;  4O3N A;  5KAI U;  5DQH A;  1ZQH A;  1HEK A;  3OSN A;  2EZY A;  4CGZ A;  4YN4 A;  1Y88 A;  2W9M A;  3BDP A;  4BJQ A;  4UBC A;  4Q43 A;  2XGQ A;  5IIN A;  2MA1 A;  1N61 A;  4AYB F;  2I6X A;  8ICM A;  4KLH A;  3M1Y A;  4GC7 A;  5KG1 A;  3V7L A;  5ALG A;  5DB9 A;  3N97 B;  4J9L A;  1TK5 A;  2XY5 A;  4UB2 A;  4DFP A;  1NK0 A;  3M7D A;  3Q8Q B;  2KJ5 A;  2D6F C;  4IR1 A;  4XUS A;  4Q8F A;  8ICW A;  5JRT A;  5AIC A;  3THV A;  3B0Y A;  1L6N A;  3N28 A;  4B9M A;  1KFD A;  5ALP A;  5HHI A;  2R8I A;  2ZUB A;  3RAX A;  4KLS A;  1ZQQ A;  3ZDA A;  1URJ A;  4I2D A;  4RUA A;  4C4R A;  4P2H A;  4QZG A;  4UAY A;  1ZQP A;  4C8O A;  4PHP A;  4JWN A;  1KLN A;  4M04 A;  3WK6 A;  1PVR A;  2EDU A;  5J8Y C;  2XI9 A;  1S0O A;  4RZR A;  2Z7J A;  3C1Z A;  3WK9 A;  3L3F X;  4DQQ A;  1WCL A;  2F1J A;  4YG2 A;  5HNK A;  1Z1V A;  2XO7 A;  1XU4 A;  1JN3 A;  2QAR B;  8ICL A;  4NLZ A;  4QWB A;  4IS7 A;  4NM2 A;  3F2D A;  2HSZ A;  2RQ5 A;  5KG3 A;  3SR6 A;  3RB0 A;  3ONN A;  1ZQV A;  4YVZ A;  3ZDE A;  3UMB A;  1U4B A;  2W3S A;  4GIB A;  3QU2 A;  3C5G A;  3KKA A;  4IC9 A;  4QZI A;  5FP0 A;  4Q44 A;  2KJ8 A;  2IBK A;  2VA8 A;  4I2C A;  5III A;  4OJ6 A;  4F4W A;  7ICT A;  2ATL A;  5ALX A;  1RXW A;  3NGD A;  4R64 A;  1ZXI A;  1ZQU A;  3GFK B;  2G08 A;  3E0F A;  3EUB 2;  5B66 U;  2KTQ A;  4CCH A;  5KFX A;  3UMC A;  2WAQ F;  2XID A;  4UB4 A;  4RU9 A;  3SI8 A;  3EPI A;  5KG6 A;  2F1I A;  2NRX A;  4F71 A;  5IIO A;  4NJ8 A;  2BHN A;  1FO4 A;  2HBM A;  3RTV A;  5L1K A;  1LV5 A;  5EWE A;  2MSN A;  1BGX T;  8ICO A;  9ICR A;  3KHG A;  5DG8 A;  2DFL A;  4C4T A;  3BZC A;  8ICE A;  3MR5 A;  4UAR A;  9ICI A;  4EEL A;  4NL9 C;  2W9C B;  2FLP A;  3PMN A;  1IXR A;  3UQ0 A;  2JMG A;  2QB0 B;  1YZ7 A;  4K4I A;  2EAN A;  1L3T A;  5EOZ A;  1L3V A;  1ARO P;  2L5Y A;  4UB1 A;  3AUO A;  2KE7 A;  5KFT A;  2AJQ A;  3G6V A;  5L1I A;  3TAD C;  1V85 A;  1IIP A;  2W9A A;  1TAU A;  1WUD A;  9ICB A;  3HRD D;  3C29 A;  2ZG6 A;  2VIX A;  4M47 A;  1ZQF A;  2ASJ A;  2J6S A;  2MAX A;  2ES6 A;  5J2K A;  1KBU A;  7ICJ A;  4KLJ A;  5KFF A;  2KFZ A;  4DL7 A;  4MFA A;  2DPI A;  4Z6E A;  4EBD A;  4QWD A;  2KNJ A;  2YMQ A;  3SQI A;  5CRX A;  2IOF K;  2YQE A;  5ALS A;  2NRZ A;  2JRZ A;  4YP3 A;  3RAQ A;  4RUC A;  1JAL A;  2ASD A;  5AHX A;  1BVS A;  2E8P A;  9ICX A;  3BS5 A;  4M2Y A;  4UB6 U;  2KMD A;  3TKA A;  1N48 A;  3LYS A;  1D9D A;  2H3I A;  5ALU A;  4MEY A;  1ZQK A;  2M9N A;  1RYU A;  5CHG A;  4KMU A;  3TAQ A;  4XQ8 A;  5GTH U;  4M9G A;  1QQ5 A;  4QIW C;  4DFD A;  3CYM A;  2HBL A; 
#chains in the Genus database with same CATH homology
 3PSF A;  4KX3 A;  3CRX A;  4WJ3 B;  3N7P D;  2K4H A;  2XIC A;  4OJ5 A;  2G06 A;  3N7R C;  3RF9 A;  4ACO A;  2CN1 A;  3ALR A;  4QJF B;  3AQE A;  1PVR A;  2R18 A;  1CRX A;  3DEE A;  2KKP A;  3GZF A;  2ZIX B;  3C28 A;  2XI9 A;  1Z1B A;  4QIW F;  3M6K A;  4O3M A;  5KL8 B;  2K8C B;  2Z7J A;  3O0F A;  3CP8 A;  2W7P A;  3PST A;  2KJ9 A;  3L3F X;  1UPH A;  1OUQ A;  4FE3 A;  4NWI A;  2ZIU A;  2PMZ F;  3M6Z A;  3LVV A;  2KIC A;  1IIP A;  2Y0S C;  2H3Z A;  4JMU A;  3MGV A;  1WUD A;  2HBJ A;  2LYB A;  2NV3 A;  2ZIW B;  3VC8 A;  3SAG A;  2DGZ A;  2KV2 A;  4OJL A;  2A3V A;  2K8A A;  2ZIX A;  3C29 A;  2ZG6 A;  2VIX A;  2K4E A;  1XO0 A;  5A0L A;  2ZIU B;  2JH7 A;  3HKZ C;  1A0P A;  2OM6 A;  2G5H B;  2YX8 A;  1Q3U A;  3F2D A;  2PMZ C;  2KKV A;  1TAM A;  3H0R B;  3K1Z A;  2W7O A;  1PVQ A;  2CPR A;  2Q4T A;  2Y0S F;  3LVW A;  3ONN A;  2ZXH A;  4OJP A;  2CRX A;  3D2N A;  2GOL A;  2ZIV B;  2ZIW A;  1KBU A;  2WB1 F;  1Q3V A;  3F5E A;  1PVP A;  4A8E A;  2HMX A;  2VJ5 A;  2HBK A;  2G0A A;  2LYA A;  3PSI A;  2XVT A;  3HKZ F;  2G5I B;  4GFJ A;  1HEK A;  2LHT A;  3T79 A;  2HOQ A;  2KNJ A;  1F44 A;  4CGZ A;  2W03 A;  1MA7 A;  3SQI A;  5CRX A;  3F5A A;  3ICX A;  4ICA A;  4IC9 A;  4FZN A;  2WB1 C;  2OH2 A;  3AL0 B;  2KJ8 A;  2DF4 B;  2ZIV A;  5HR6 A;  2JGA A;  4BJQ A;  4CDG A;  4FZM A;  2OYY A;  4P0P B;  2VJ4 A;  4OO1 J;  2KHQ A;  3IP4 B;  3VCB A;  2ZXI A;  2F76 X;  2KHV A;  3H0L B;  2K8B B;  2MA1 A;  4OJO A;  4BX9 C;  1NZB A;  1D8B A;  4AYB F;  4OJ6 A;  4U6P A;  1A6S A;  2H3Q A;  2M0N A;  4KX5 A;  3H0M B;  2HOI A;  1YT3 A;  2G09 A;  2H3V A;  1XNS A;  4U7C A;  2KIW A;  2G08 A;  2E1F A;  3NUQ A;  3E0F A;  4BUG A;  3NRW A;  4QNL A;  2W04 A;  5KL1 B;  2E5S A;  2VKQ A;  4NLB A;  3M7D A;  2OXO A;  2MRL A;  2KJ5 A;  2F2A B;  2BDU A;  2WAQ F;  2XID A;  4P0P A;  2D6F C;  5HR7 A;  3RFA A;  2F8L A;  2KOB A;  4AYB C;  1T94 A;  4KMO B;  3IG8 A;  1DRG A;  2H3F A;  2N1R A;  3PZP A;  3IG5 A;  4C0Z A;  3SMV A;  2KD1 A;  3AQF A;  2YB4 A;  3SAH A;  3LYS A;  1ED1 A;  2HBM A;  3OPX A;  1SZH A;  3F2C A;  2KVC A;  2H3I A;  2HOF A;  4P0Q B;  2E1E A;  3KZX A;  2GH1 A;  3PSP A;  3D2Q A;  2G07 A;  2WAQ C;  1P7D A;  1L6N A;  2RP5 A;  1HIW A;  2JH1 A;  2K89 A;  2RRD A;  2YB1 A;  1ECW A;  2K4I A;  4NV0 A;  3SAF A;  2LBO A;  3F2B A;  4PL1 A;  3GU3 A;  3D2S A;  2F77 X;  3N7S C;  3F53 A;  1ZQ1 C;  2DQN B;  1GO3 F;  4CRX A;  1Z19 A;  2JHD A;  2RHF A;  3KFU F;  4NLC A;  1URJ A;  4P0Q A;  2JMG A;  4PL2 A;  4QIW C;  3IN5 A;  2LKY A;  5T14 A;  3CYM A;  2KEY A;  5C0Y A;  4FZL A;  2HBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...