2KOBA

Solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
b'RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR structure of CLOLEP_01837 (fragment 61-160) from Clostridium leptum. Northeast Structural Genomics Consortium Target QlR8A
rcsb
source organism Clostridium leptum dsm 753
molecule tags Structural genomics, unknown function
total genus 34
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kobA01
3C29A 2KJ8A 1PVPA 1Z1BA 1DRGA 1CRXA 3CRXA 2A3VA 1PVRA 2KIWA 1PVQA 4CRXA 3MGVA 4A8EA 2KJ9A 3C28A 1OUQA 1KBUA 2OXOA 3LYSA 2KEYA 2KHVA 1A0PA 2HOFA 3NRWA 1P7DA 5CRXA 1NZBA 2KKVA 2KOBA 4ACOA 1Z19A 2HOIA 2KKPA 2KJ5A 1XNSA 1MA7A 1Q3UA 2KD1A 1F44A 1Q3VA 1XO0A 2KHQA 2CRXA
chains in the Genus database with same CATH superfamily
4UASA 2ZIXA 1M6YA 4O5EA 5AM2A 1KQQA 9ICTA 2HVIA 2YY6A 3QUBA 5DB8A 4DEZA 3SAHA 3V7JA 3GIIA 1T3NA 2K8AA 1Z1VA 1RDFA 4NLNA 4DCCA 3RB6A 2Y0SF 1X9XA 3H7IA 4ED2A 3H4BA 4IQWA 4K4HA 2W3RA 4KLJA 5H2FU 2KIVA 3TACB 3GILA 4YVZA 3BDPA 5DGBA 1RG6A 4QZEA 4KLMA 4B9SA 2C2DA 8ICTA 2JZBB 1ZQMA 5A0LA 2HDOA 3WKAA 4DL5A 1SIJA 1SZPA 4NWIA 3NGDA 4O5KA 4FS2A 4J9LA 4I28A 4KTQA 4BWJA 9ICWA 3KOOA 4RQ0A 2K4EA 4RQ3A 3Q8PB 4RQ8A 1NKEA 4O3OA 8ICNA 3V7KA 2E1EA 1KBUA 2MUTB 2PMZF 3IHQB 7ICKA 2IHMA 2XY7A 1COKA 2LM1A 3BZKA 4QZCA 4JV1A 4EBDA 4DQPA 5G5GA 1Q3VA 9ICNA 2AH5A 1A76A 1UA0A 3NVWA 2WF9A 4R66A 4FO6A 5DQGA 3ICXA 4NLCA 8ICLA 5ALZA 2VA8A 5KG6A 2XO7A 1U48A 4XRHA 4DSFA 2JH7A 2XICA 2P6UA 4XUSA 4ECYA 3QEAZ 1N2XA 2BCQA 2HHUA 2NYVA 3OTQA 5D49A 2JGAA 1SWVA 3SQIA 5KG7A 4BXOA 4DWIA 9ICAA 2K60A 4JV2A 5ALPA 3N28A 4ED7A 2W9BA 3T5HA 3QU7A 4RNMA 4NV0A 3QXGA 9ICMA 1ZD5A 5KG2A 7ICOA 4QZFA 5DQHA 2A1JB 4KLOA 1BPEA 8ICIA 4RUAA 5KFQA 5ALUA 3UMCA 1X9SA 1JRPA 2ZUDA 1WCNA 1FFVA 1N61A 1S9FA 1KL9A 1XSLA 5CWRA 4AP9A 4DLGA 3GFKB 2KTQA 5AKHA 2F1HA 1KSPA 5DB7A 2P6RA 2EQYA 2JZBA 2QB1A 4M9GA 3N7PD 5AIAA 1ZQUA 3L4PA 1RQNA 5EWFA 1ECWA 1J97A 1XSPA 2KSOA 2NRZA 1KW4A 2KVSA 9ICVA 5AICA 4FE3A 3TADC 7ICJA 2HBJA 2OHFA 3KHRA 3PMNA 2FPMA 1V9PA 3ZDEA 3OGUA 7ICIA 2MUTA 2P66A 2M0NA 1HEKA 3GIMA 3M9OB 4CGZA 2RHFA 5EE9A 1VLBA 2YN4A 4JWNA 3BQ2A 2Q4TA 2JXJA 5DG8A 3N4MB 1B43A 2F1IA 5J0PA 3HILA 5HNKA 2MSNA 4WJ3B 9ICJA 3TFSA 1UT8A 4YMNA 4DF8A 1UA1A 5AHXA 2KHVA 4CF3A 2KKVA 1X66A 2H3ZA 4Y2SA 1ED1A 5EE0A 2E8NA 1XS9D 4IQUA 5KL8B 5J0TA 3RBEA 4I27A 5C0YA 3HJEA 2PFNA 4KX3A 3Q8MA 3C21A 2LI6A 1IXRA 2HMXA 2A1JA 3IG5A 5KL1B 2KZMA 4QWEA 2XGQA 4Q8EA 2JH1A 4Y2YA 4F5RA 4ED1A 3B0YA 5IILA 2LMRA 3T79A 1DGSA 1H38A 5TISU 3D2NA 3PW0A 4M6WA 2YB4A 8ICVA 3F2BA 3OSPA 2YB1A 1Z3EB 3RH5A 5AKKA 2IOFK 2AHOB 2ZJ5A 2W8KA 3SAGA 1ZXIA 3ZI4A 4ECVA 2KZ3A 2F77X 1K1QA 1ZQCA 1ZOLA 3NASA 1T94A 2ZIWB 4ED0A 3K4GA 5K4LA 4TQRA 1ZQOA 1HJPA 1L7MA 4CNQA 3RFAA 1ZQDA 2K8CB 2CXYA 5KT3A 4MF8A 4Y2TA 4UB8U 4QWDA 2W8LA 3V6HA 2EZZA 4R8UA 4TUQA 4EZ9A 4UBBA 3AU2A 7ICNA 4Q8FA 3EWAA 4DL3A 4DSEA 1J2NA 4M9JA 1N63A 4UAUA 3SAFA 4J9OA 2G06A 1N60A 4PGQA 4F71A 3ZD9A 3KD3A 2N1RA 1ZQLA 3MFHA 3AL0B 4B6JA 1SXEA 4I2AA 1SV4A 1F0MA 3CP8A 4DFMA 2FI1A 4RQ1A 4DQSA 4K4GA 8ICAA 3NRWA 4EEKA 1ZJNA 4Q43A 1JN3A 2YMMA 2F44A 1BNPA 7ICTA 2W7OA 3H4DA 1SKWA 2ZUCA 2AXTU 5J2DA 1NOMA 1Y88A 3PMLA 3BQTA 4KLUA 1TAMA 2VIXA 4UB2A 4NJ8A 4OCZA 3JPSA 2KK0A 4EBEA 2Y1IA 2AGOA 4XA5A 1ZQWA 1IIPA 2K4IA 2NO5A 4ZH4A 4FFDA 5KFZA 3GV5B 3PO4A 3TI0A 9ICFA 2QB0A 1NZPA 3Q8LA 5KG3A 3MGHA 2R8JA 2Y0SC 4ICAA 3N7SC 4EELA 2R8GA 9ICEA 3GV7B 1QSSA 3PX4A 3V7LA 3TARA 4BWMA 3PZPA 2ZUBA 3AM9A 3E0FA 1PK1B 5J8YC 1GO3F 1PZNA 9ICGA 1PK3A 3PV8A 5AI9A 3KZXA 4F92B 4M04A 1RPLA 2BZFA 3RJIA 1NZBA 2ZTEA 4Y2VA 4NM2A 3SV3A 4Q44A 3H8WA 3IP4B 2BHNA 1Z00A 3OHBA 1HUZA 5ALQA 4ELUA 1BNOA 1ZJMA 3ED5A 3PR5B 3UMBA 1EXNA 1ZQQA 3BQ7A 1JALA 2W9MA 3VC8A 4C0ZA 1NKBA 4F5OA 1V85A 4UAVA 2ZXIA 4J9RA 1ZQIA 5KFHA 1BPZA 4Y2RA 2UVUA 5AKYA 5KFNA 4MFAA 2G5IB 2ATLA 1TKDA 1FIQA 5EE1A 5CRXA 1S0MA 2W9AA 4DFJA 5AKIA 1WWVA 4C80A 4TUPA 2W3SA 5DLFA 5L1LA 1SL0A 1NK6A 2HHXA 2BR0A 1VDVA 3WU2U 2FLPA 2GOLA 1WUDA 1ZQTA 4O3QA 3LK9A 4M9LA 3WKEA 1X9WA 1QH9A 2KJ9A 2DKZA 5G5HA 3WK5A 5JUMA 3QEBZ 2DL0A 2BPCA 3GQCA 1XNSA 1Q3UA 2BQRA 2HBLA 1L7OA 1NJXA 5ALOA 2PFOA 3C5FA 3I28A 2NO4A 3DV9A 4QZIA 4F2RA 2KFZA 1PK1A 3JPPA 5KT5A 5J0RA 3PR4A 4C8LA 1A77A 4J9QA 1UPHA 5AK3A 3ISDA 4Z6EA 4K4IA 2WAQF 5ALDA 1NI3A 2V4QA 3UXOA 4OJ5A 4IR9A 5KAFU 7ICFA 7ICMA 3PSPA 5ALXA 4ED8A 4Z6CA 2VJ4A 4OO1J 1L6NA 5HMMA 3Q8RB 4GC7A 3SI8A 5KFOA 3EW9A 2FMSA 3IRUA 4RQ5A 2C2EA 3WK8A 4U7CA 4KMOB 3RR7A 1C20A 1KRPA 2R8KA 4PL1A 2H3QA 5IIKA 3N97B 1ZQ1C 3AN1A 7ICRA 5J0YA 7ICEA 1JMSA 5KG1A 4YXJA 2KNJA 5BPCA 1ZD3A 2PFPA 5DKWA 5HHIA 2ZIVB 1S0OA 2A19A 1N62A 1X2IA 5J2KA 4YR0A 3T5JA 4Q45A 3GZFA 2HSZA 2DFLA 8ICSA 3MABA 4US9A 2UVVA 3UXNA 1RYRA 3K75D 1BPDA 3C2MA 4KLSA 2E8MA 3M6ZA 5CA7A 2IHNA 5AM4A 1F44A 1K5OA 1S8OA 4O3RA 2UVWA 4IL6U 3GIJA 2KICA 1ZQKA 1NJYA 1TK0A 5AK6A 2BDPA 5AK4A 2EANA 1VJ5A 1LKYB 1JXLA 1L3TA 1B0XA 5ALFA 1FO4A 1D8BA 3M9MB 1BPYA 5B66U 1X40A 1YT3A 2FDRA 1LV5A 3WKCA 3EYZA 2BCUA 7ICVA 2HOQA 1WG8A 4KLHA 1N56A 4P0QA 1WCLA 5D4BA 4UW9A 1TVAA 9ICBA 1NKCA 3NVYA 2ES6A 3D2SA 1QTMA 2PKEA 3EUB2 4B9LA 3RF9A 4DL7A 1ZETA 4PPXA 1Z19A 2J6UA 1BGXT 3NUQA 5J0XA 1AQ6A 4DS5A 3LVVA 5ALHA 2WF8A 4UQGA 8ICUA 2HCFA 4KLLA 2Y9TA 2DPJA 1L8OA 3HP6A 5ALNA 4M0AA 4RQMA 8ICBA 3ZDAA 2MRLA 5J0OA 2VJ5A 2E5SA 4LVSA 1D9DA 5AM5A 2VKQA 2ZJAA 2ZTCA 2NRTA 3T5KA 4BJQA 9ICHA 1KFSA 1WYGA 2OCEA 2GO7A 3OJSA 5IIIA 8ICJA 5DBAA 9ICLA 3QU5A 3RJGA 2HHQA 3ETLA 4KLEA 4EENA 2HI0A 5DGAA 4KITB 2W54A 5KFJA 4I2BA 4DF4A 3IN5A 1NK4A 4JWMA 9ICRA 1XC9A 4F4ZA 5KTQA 7ICLA 3F2DA 1PVQA 5EWEA 1OW5A 5ALWA 4J9KA 4RPYA 1QSLA 5JTIA 5DDYA 4E0DA 1IG6A 7ICSA 4QZDA 4DO9A 4IC9A 3C1ZA 1TFRA 2ZJ8A 4KMUA 3QYPA 4GFJA 1T8EA 1DRGA 4PGYA 4P4OA 1QSYA 2EAOA 3M9NB 5AI4A 3Q8SB 3MDAA 4IS7A 2K89A 1LKYA 4F4WA 3EPIA 3JPOA 1BPXA 3ETRA 4C7ZA 3HWTA 2FLLA 2E1FA 8ICMA 2XVTA 3OSNA 1UCVA 5KFGA 3ZDDA 4J9PA 1N5WA 4FZMA 3JPTA 5AK5A 4OJOA 5CP2A 3RRHA 5BOMA 3F2CA 2W55A 4QZAA 4I2EA 3Q8KA 9ICCA 2IMWP 2KFNA 3H0MB 4C4RA 2QKQA 2F3NA 2W9CB 1CUKA 4JK1A 5KFKA 3FC4A 4C4TA 3OHAA 3RH4A 4RQ6A 4ECQA 4QWAA 1ZQHA 5J0WA 4MFCA 2KIWA 4C8NA 3JPQA 5CJ7A 4YN4A 2FE9A 4CF4A 4DL2A 2KE7A 3OPXA 1XWLA 4PHAA 4JMUA 4JV0A 2BPFA 1P7DA 4US8A 1S0VA 4QZ8A 2A1AA 4DQRA 1IV8A 2JEGA 3HX0A 2PI4A 1U45A 2BKEA 1KEJA 2KN7A 4UAZA 2ASDA 4DSIA 5B5EU 1PVRA 1JX4A 3C23A 5DB6A 4Y2UA 3O0FA 4NM1A 4Z6FA 5DG9A 2WF6A 5ALRA 1TAQA 1ZYQA 4F5QA 4GXJA 9ICOA 4FBUA 2QARB 4FZNA 5HR6A 3CYMA 3D6JA 5KFPA 3RJHA 2K4PA 2HHWA 4G9BA 1Z1BA 1AROP 2KP7A 2W7PA 1NK9A 5KFEA 3QZ7A 1L7PA 3BQ0A 2PI5A 4ELTA 5KG5A 1MC8A 4RPXA 1Z4NA 2OXOA 1SZHA 2H3IA 4QZBA 4ACOA 2E3TA 4LZGA 2KG5A 3THVA 1S77D 4M9NA 4RT3A 3RR8A 2HHVA 1X6JA 5CHGA 1D8LA 4ECRA 5J2CA 3PW5A 3DEEA 4F3OA 2OYYA 3E58A 3QUCA 5KFSA 4FZLA 5J2HA 1MQ3A 3G6YA 3PW2A 3R9KA 5CR0A 2XCPA 2P35A 1V38A 3M6KA 1F5SA 5AKJA 4KLQA 5DBBA 2FMQA 3PO5A 1O03A 2RDJA 2F1JA 4F4XA 1A6SA 4NXZA 2V4RA 3QX7A 2BCRA 2WAQC 5DLGA 1RZTA 5IIJA 2BQUA 8ICWA 3DDHA 4F72A 1QQ6A 1U9LA 3ISCA 2FJ6A 5D46A 4M9HA 3NVZA 3S6JA 4YD1A 3SZ2A 4PHEA 3BS5B 2IA6A 3FYHA 4RQNA 2LYAA 5J0UA 5ALJA 2AQ0A 5KFUA 2GWSA 4I2DA 1L3UA 1OUQA 2B21A 4F8RA 1URJA 3HW8A 1TK8A 5DB9A 3MR5A 3C2LA 2XY5A 4QZ9A 5F3XB 2KJ5A 2G5HB 3GU3A 2ZIWA 4NL9A 2DGZA 2ODGA 5ALYA 4DQIA 4P4PA 3MR3A 2J6SA 3WK4A 1ZQJA 2WB1C 4LJXA 1L3VA 2DPIA 4NY8A 3HKZF 5KFBA 2XIDA 2R8HA 4ED3A 2RQ5A 5KFDA 4ELVA 3GDXA 3KKAA 4LZDA 5DBCA 1SV0A 4ECZA 3TFRA 3LDAA 3SENA 3V6JA 2H3VA 1BVSA 4PHPA 1FEZA 2ZIXB 1IM4A 3RTVA 1DXSA 4B9TA 4I2JA 1HIWA 4B9NA 1BPBA 3CW2C 2B0CA 3CNHA 4UARA 1LVHA 1XU4A 5AM3A 4KLGA 1SL1A 3TANA 8ICKA 2LHTA 4O3SA 3J81j 4BDPA 1RYSA 4PHDA 1MSWD 2XC9A 8ICOA 4DOCA 3C28A 5DDMA 4YQWA 4NLKA 2LPEA 1TV9A 2HW3A 4ECTA 2DQNB 1NK8A 2KV2A 3H8MA 4XQ8A 4R65A 2ZIUB 3FDSA 2F2AB 5KFVA 4QJFB 3C2KA 2ASLA 1L5UA 2CPRA 9ICPA 3NVVA 2WTFA 3RJJA 3M1YA 4BGDA 3JPNA 4J9SA 4MEXA 3BS7A 1JIHA 2EAMA 2C28A 4UAWA 4DS4A 2GH1A 5L9XA 3KZIU 4F2SA 1ZQVA 4YFKA 1MN8A 4IRCA 4YMMA 5ALSA 2M9NA 2E8PA 3ISBA 2EH9A 9ICKA 1OXJA 3FM9A 4KN4A 5AM1A 4GLXA 5J2EA 3K1ZA 2XGPA 1XSNA 1S97A 4I2HA 3A0BU 4FS1A 1XO0A 1ZQRA 5BOLA 3TKAA 2AJQA 3V6KA 4UBCA 1SB3C 2XI9A 1SKRA 4IR1A 3QU4A 2MAXA 3HT3A 4BXOB 3OJUA 2IOHA 4RQ4A 3BQ1A 4YG2A 2W9BB 1S0NA 1SWWA 2HOIA 2R18A 2VA2A 3Q8QB 2IOFA 4F91B 3TAPA 5AKEA 2LBOA 3RRGA 2NRXA 2D6FC 3GV8B 2VANA 2ZXHA 1PUZA 2FPKA 3MR6A 1L8LA 1X42A 2KOBA 5ALMA 2W11A 2WB1F 5AKZA 2MU2A 3KBBA 4ECXA 4MFFA 4O0IA 3IM1A 4PJ0U 4F5PA 1Q46A 5AI0A 4ECWA 4CRXA 3C5GA 4B9VA 2W04A 3AUOA 5KAIU 3RB0A 3LYSA 3SMVA 4ED6A 2HHSA 4F93B 2EZXA 4DSJA 4HAIA 5KFMA 3A0HU 2ZIUA 3D2QA 4DOBA 4IRKA 1ZD2P 5J2JA 5L1KA 4DFKA 2KSOB 2WHEA 3ORYA 3K1RB 2CN1A 4CDGA 1T3QA 4R64A 4NLGA 2XCAA 4BX9C 3ZD8A 4AYBF 4M47A 4J03A 9ICIA 4EYHB 2WF5A 8ICFA 3PW4A 2KEYA 4KX5A 4Z6DA 4KLTA 4O9MA 2BDUA 4EYIB 2NRWA 7ICPA 9ICUA 4QNLA 5KFYA 2H5XA 4YR2A 2JV3A 2K4HA 1U47A 3H8SA 5KFRA 4Y2JA 4HYKA 2I5HA 1YZ7A 3RAQA 5F9NA 5IIMA 5KFWA 2R8IA 8ICPA 1UHUA 4P0PB 7ICGA 4B9MA 4YP3A 3KFUF 5J2AA 1SXDA 2JRZA 8ICGA 1WWUA 2JEIA 2JMGA 2JHDA 5AKXA 3CRXA 3ZDCA 2F8LA 1O08A 4YR3A 4C8MA 2I1QA 5EOZA 1U49A 1C7YA 4NLBA 4UB1A 4F50A 2YMPA 1QCKA 1KFTA 3MR2A 3NTUA 3PSFA 1MA7A 4OD0A 1N5XA 8ICHA 2AQ4A 3QUTA 2C2RA 5KNIA 3KHLA 4UB3A 4RPZA 2FMPA 1L3SA 2KMDA 4RU9A 3RAXA 2RLTA 2ZIVA 2ESEA 4J9NA 1DOQA 2RDIA 4M6WB 4DQQA 8ICXA 3C1YA 4QWBA 2B6GA 1J2MA 5HHHA 3MC1A 2BPGA 4ECUA 1RM6C 2LM4A 4O3NA 2IBKA 2CRXA 5DQIA 1K1SA 1ZQEA 1ZQZA 4DLEA 4KLDA 4R63A 4I29A 1CRXA 2E8OA 3QZ8A 3MDCA 4MF2A 3VCBA 1HUOA 4EZ6A 2LYBA 1NK5A 1KTQA 2YX8A 5HP4A 3L3FX 3C29A 1COOA 2ISOA 3TADA 5KFTA 1ZRMA 5J0QA 5AI6A 5HR7A 1XO1A 3RH6A 4R8UB 4RUCA 2D3DA 2HOFA 2FPLA 4I2IA 2FLNA 4RQ7A 4C7YA 3RB3A 2YMQA 3PY8A 3T5LA 9ICSA 3PSIA 4EEYA 5KFXA 4F4KA 3UM9A 4O5CA 3TQ1A 1ZRNA 3T3FA 2L5YA 5J2IA 4YD2A 5L1MA 1U4BA 2ZTDA 4X5VA 5JRTA 5GTIU 1X9MA 1NK7A 4CCHA 3MGIA 4DFPA 5AI8A 4U6PA 2F8KA 4J9MA 4IRDA 3MGVA 4C4SA 4P0PA 5L1IA 1T4GA 9ICQA 1RYUA 3RB4A 2BGWA 5DG7A 1UQVA 2RP5A 4YMOA 2AU0A 5ALVA 4B9UA 8ICCA 3HPOA 1ZQNA 2YQEA 4YCXA 4RNOA 1NK0A 3KHGA 3HKZC 5AM0A 3AQEA 1KLNA 1D8YA 4PZNA 4EX6A 2DUYA 3WKDA 1S76D 2LKYA 4UB6U 5J29A 3RJEA 2VA3A 2C22A 4YXMA 3SYZA 1KN5A 2ASJA 4G3IA 4KLIA 3AEVA 2DKXA 5AKLA 4FBTA 2AGQA 4UATA 1QQ7A 3UXPA 1RQLA 4NLZA 4Y2XA 2HBKA 1RXVA 3G6VA 1ZQBA 4F4YA 2Q0ZX 2QB0B 5KFFA 5KT7A 2MA1A 1CI4A 3UPQA 5T14A 4GXKA 1D9FA 4O3PA 3QU9A 3NS1A 5EE3A 4QIWC 8ICYA 3PNCA 3H0RB 2UVRA 5KFCA 2EAPA 1QQ5A 4TURA 3RBDA 4OJPA 3H0LB 2A3VA 4PGXA 3F5EA 3FAHA 5KFIA 4BUGA 1LB2B 3H40A 3WKBA 2ALZA 3I1YA 1FFUA 1ZQFA 2PXIA 1ZQYA 3M8RA 2BCVA 4IQVA 1ZQAA 4DFDA 3SV4A 2KJ8A 5ALIA 1DK2A 3TAQA 1Z00B 1Q8KA 1UT5A 1KFDA 8ICZA 2J6TA 3JPRA 4QZHA 1A0PA 3UQ2A 5KT2A 1SKSA 3RJKA 5EWGA 4TUSA 2PFQA 1T7PA 4QWCA 8ICEA 1RXWA 2G09A 3F5AA 4JB3A 1JI7A 3QNMA 1TAUA 2XY6A 3QE9Y 1KKXA 3EPGA 1MQ2A 4A8EA 1ZQPA 2ISPA 5CB1A 4DL4A 4EBCA 4I2CA 1L7NA 2W9CA 2WFAA 3I76A 3M7DA 1S10A 3GIKA 2KKPA 1B4FA 1V97A 1JUDA 3L5KA 5TZVA 4DSLA 3KTQA 4C8OA 5AI5A 2BCSA 4Y2PA 1S5LU 4USAA 7ICHA 2Z7JA 4KN7A 2HVHA 3EZ5A 3PSTA 5KG0A 5AKGA 5AIBA 2W03A 2AGPA 3U26A 4NL9C 3AMZA 4GIBA 3WK6A 4C8KA 5ALTA 3ZDBA 1X6IA 5F9LA 3MBYA 2O6KA 3KHHA 1YZ6A 2YMLA 1QLNA 3V72A 3HRDD 3WK7A 4RT2A 4UB5A 4QW9A 3F53A 5IINA 7ICUA 2LYHA 2H3FA 4TQSA 5GTHU 5JU5A 3ALRA 1NJWA 3SEIA 5J0SA 2V9WA 2JEJA 3KKAC 4UB4A 1DK3A 2KZZA 1SV0C 3ONNA 3QUQA 2EDUA 3WK9A 5KT6A 2QARA 2I9GA 4ECSA 4P2HA 1KDHA 5IIOA 4GC6A 2K8BB 1N48A 5J2BA 1TE2A 5J2FA 2DBYA 5J8YA 3LVWA 1ZD4A 1ZQXA 3IG8A 4O3MA 2G08A 4OJ6A 1SL2A 1NNLA 4EX7A 4M2YA 3BJYA 4RNNA 4AYBC 2Y9UA 3IDWA 3NRZA 5C5JA 4JUZA 2I6XA 2PMZC 2G0AA 4DOAA 4UAYA 3PX0A 2QLTA 5KFLA 2DF4B 4MHVA 1PVPA 2DWQA 2GLEA 1JROA 3H8JA 2F76X 8ICRA 2NRVA 4QIWF 2NV3A 1NJZA 2YTUA 3B0XA 2Y1JA 1ZQSA 4GXIA 3E2EA 4P4MA 3BZCA 9ICXA 3UMGA 3G6XA 3B9JA 2JR5A 4PZOA 2KD1A 2BQ3A 1Z4OA 3UQ0A 4ZOHC 3MFIA 4IQTA 3M8SA 2OH2A 3LWLA 2OWOA 5L1JA 4I2GA 4RZRA 5KFAA 4DSKA 2OEHA 2EZYA 3PVXA 3BS5A 1SGGA 5ALGA 1DGJA 7ICQA 5ALLA 5J2GA 2W43A 3QU2A 4QZGA 2KHQA 3PW7A 4MEYA 3AQFA 5ALKA 2KVCA 4CE6A 2JEFA 5ALEA 4DL6A 4PL2A 4RQ2A 5E79U 3SD7A 1JXEA 4PH5A 5CEHA 4I2FA 2ZG6A 3SR6A 3PX6A 4F5NA 2OM6A 5KG4A 2D8CA 3AU6A 1CEZA 3N7RC 1TK5A 2G07A 5HMLA 4QW8A 4OJLA 1B22A 5KT4A 8ICQA 4P0QB 4KLFA 2RRDA 4Y2QA 3IV6A 2HHTA 2WF7A 3RJFA 2HBMA 4CF5A 1ZQGA 5FP0A 3LWMA
chains in the Genus database with same CATH topology
2LYAA 2KICA 2DF4B 2ZIXA 3AQEA 2JGAA 1PVPA 3SQIA 1PVRA 2CPRA 3F2DA 1PVQA 4CRXA 2F76X 4A8EA 4WJ3B 2LKYA 2W04A 3KZXA 4QIWF 1OUQA 2ZIVA 2NV3A 1URJA 3LYSA 3SMVA 3SAHA 2KHVA 3O0FA 4NV0A 1NZBA 3M7DA 4IC9A 2ZIUA 3D2QA 2K8AA 2KKVA 3SAFA 1UPHA 2KKPA 2KJ5A 2H3ZA 2G5HB 2GH1A 1ED1A 1D8BA 2G06A 2Y0SF 2KD1A 3GU3A 5KL8B 1YT3A 2CN1A 2WAQF 2F2AB 3IP4B 2ZIWA 2DGZA 4GFJA 4CDGA 2CRXA 2N1RA 4FZNA 2HOQA 3CYMA 5HR6A 4BX9C 1DRGA 4AYBF 1Z1BA 1CRXA 3AL0B 5C0YA 2OH2A 2W7PA 4OJ5A 2Z7JA 2HBKA 4P0QA 3VCBA 4KX3A 2K89A 2WB1C 3CP8A 3PSPA 3PSTA 2LYBA 2OXOA 2MA1A 2VJ4A 3F5AA 3HKZF 4OO1J 2KEYA 2W03A 5A0LA 4KX5A 1SZHA 2H3IA 2HMXA 5KL1B 3IG5A 3NRWA 3D2SA 1L6NA 2XIDA 5T14A 3VC8A 4NWIA 3RF9A 3K1ZA 2BDUA 2JH1A 4C0ZA 4ACOA 1Z19A 3NUQA 2E1FA 4U7CA 4KMOB 3T79A 2ZXIA 2XVTA 4QIWC 4QNLA 2W7OA 2YX8A 3LVVA 1XO0A 2KHQA 3H0RB 3L3FX 3C29A 3D2NA 2K4EA 3AQFA 4FZMA 4OJPA 2KVCA 3F53A 3H0LB 2K4HA 4PL1A 2A3VA 2H3FA 3F5EA 2YB4A 2H3QA 3N7PD 2H3VA 2XI9A 3ALRA 3DEEA 1ZQ1C 4PL2A 4OJOA 4BUGA 3F2BA 2G5IB 5HR7A 2E1EA 2ZIXB 1KBUA 2KNJA 2OYYA 2PMZF 3F2CA 1ECWA 1TAMA 2VIXA 2HOFA 2YB1A 1HIWA 2ZG6A 5CRXA 3ONNA 4FZLA 2ZIVB 4P0PB 2MRLA 2OM6A 2VJ5A 3H0MB 2E5SA 2HOIA 4FE3A 3PSIA 3SAGA 3KFUF 2R18A 3M6KA 2HBJA 1IIPA 2F77X 2K4IA 1Q3VA 2K8BB 2GOLA 1WUDA 2VKQA 3GZFA 2JMGA 2LBOA 2JHDA 3N7RC 2LHTA 2KJ8A 3ICXA 3CRXA 2F8LA 2G07A 4NLCA 4BJQA 4U6PA 2KIWA 3LVWA 1T94A 2D6FC 2M0NA 2ZIWB 1HEKA 3MGVA 4CGZA 1A6SA 4P0PA 2KJ9A 2RHFA 3OPXA 2ZXHA 3IG8A 4OJLA 3C28A 2G08A 4O3MA 4OJ6A 2Y0SC 4JMUA 2RP5A 4ICAA 4NLBA 2Q4TA 2WAQC 3N7SC 1A0PA 4P0QB 1P7DA 2DQNB 2RRDA 3PZPA 2KOBA 2KV2A 4AYBC 3RFAA 1XNSA 2JH7A 3M6ZA 2WB1F 3E0FA 3PSFA 2K8CB 1Q3UA 2XICA 1MA7A 2HBMA 1GO3F 1F44A 3IN5A 2HBLA 2PMZC 2ZIUB 2G09A 2G0AA 3HKZC 4QJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C29 A;  2KJ8 A;  1PVP A;  1Z1B A;  1DRG A;  1CRX A;  3CRX A;  2A3V A;  1PVR A;  2KIW A;  1PVQ A;  4CRX A;  3MGV A;  4A8E A;  2KJ9 A;  3C28 A;  1OUQ A;  1KBU A;  2OXO A;  3LYS A;  2KEY A;  2KHV A;  1A0P A;  2HOF A;  3NRW A;  1P7D A;  5CRX A;  1NZB A;  2KKV A;  2KOB A;  4ACO A;  1Z19 A;  2HOI A;  2KKP A;  2KJ5 A;  1XNS A;  1MA7 A;  1Q3U A;  2KD1 A;  1F44 A;  1Q3V A;  1XO0 A;  2KHQ A;  2CRX A; 
#chains in the Genus database with same CATH topology
 4UAS A;  2ZIX A;  1M6Y A;  4O5E A;  5AM2 A;  1KQQ A;  9ICT A;  2HVI A;  2YY6 A;  3QUB A;  5DB8 A;  4DEZ A;  3SAH A;  3V7J A;  3GII A;  1T3N A;  2K8A A;  1Z1V A;  1RDF A;  4NLN A;  4DCC A;  3RB6 A;  2Y0S F;  1X9X A;  3H7I A;  4ED2 A;  3H4B A;  4IQW A;  4K4H A;  2W3R A;  4KLJ A;  5H2F U;  2KIV A;  3TAC B;  3GIL A;  4YVZ A;  3BDP A;  5DGB A;  1RG6 A;  4QZE A;  4KLM A;  4B9S A;  2C2D A;  8ICT A;  2JZB B;  1ZQM A;  5A0L A;  2HDO A;  3WKA A;  4DL5 A;  1SIJ A;  1SZP A;  4NWI A;  3NGD A;  4O5K A;  4FS2 A;  4J9L A;  4I28 A;  4KTQ A;  4BWJ A;  9ICW A;  3KOO A;  4RQ0 A;  2K4E A;  4RQ3 A;  3Q8P B;  4RQ8 A;  1NKE A;  4O3O A;  8ICN A;  3V7K A;  2E1E A;  1KBU A;  2MUT B;  2PMZ F;  3IHQ B;  7ICK A;  2IHM A;  2XY7 A;  1COK A;  2LM1 A;  3BZK A;  4QZC A;  4JV1 A;  4EBD A;  4DQP A;  5G5G A;  1Q3V A;  9ICN A;  2AH5 A;  1A76 A;  1UA0 A;  3NVW A;  2WF9 A;  4R66 A;  4FO6 A;  5DQG A;  3ICX A;  4NLC A;  8ICL A;  5ALZ A;  2VA8 A;  5KG6 A;  2XO7 A;  1U48 A;  4XRH A;  4DSF A;  2JH7 A;  2XIC A;  2P6U A;  4XUS A;  4ECY A;  3QEA Z;  1N2X A;  2BCQ A;  2HHU A;  2NYV A;  3OTQ A;  5D49 A;  2JGA A;  1SWV A;  3SQI A;  5KG7 A;  4BXO A;  4DWI A;  9ICA A;  2K60 A;  4JV2 A;  5ALP A;  3N28 A;  4ED7 A;  2W9B A;  3T5H A;  3QU7 A;  4RNM A;  4NV0 A;  3QXG A;  9ICM A;  1ZD5 A;  5KG2 A;  7ICO A;  4QZF A;  5DQH A;  2A1J B;  4KLO A;  1BPE A;  8ICI A;  4RUA A;  5KFQ A;  5ALU A;  3UMC A;  1X9S A;  1JRP A;  2ZUD A;  1WCN A;  1FFV A;  1N61 A;  1S9F A;  1KL9 A;  1XSL A;  5CWR A;  4AP9 A;  4DLG A;  3GFK B;  2KTQ A;  5AKH A;  2F1H A;  1KSP A;  5DB7 A;  2P6R A;  2EQY A;  2JZB A;  2QB1 A;  4M9G A;  3N7P D;  5AIA A;  1ZQU A;  3L4P A;  1RQN A;  5EWF A;  1ECW A;  1J97 A;  1XSP A;  2KSO A;  2NRZ A;  1KW4 A;  2KVS A;  9ICV A;  5AIC A;  4FE3 A;  3TAD C;  7ICJ A;  2HBJ A;  2OHF A;  3KHR A;  3PMN A;  2FPM A;  1V9P A;  3ZDE A;  3OGU A;  7ICI A;  2MUT A;  2P66 A;  2M0N A;  1HEK A;  3GIM A;  3M9O B;  4CGZ A;  2RHF A;  5EE9 A;  1VLB A;  2YN4 A;  4JWN A;  3BQ2 A;  2Q4T A;  2JXJ A;  5DG8 A;  3N4M B;  1B43 A;  2F1I A;  5J0P A;  3HIL A;  5HNK A;  2MSN A;  4WJ3 B;  9ICJ A;  3TFS A;  1UT8 A;  4YMN A;  4DF8 A;  1UA1 A;  5AHX A;  2KHV A;  4CF3 A;  2KKV A;  1X66 A;  2H3Z A;  4Y2S A;  1ED1 A;  5EE0 A;  2E8N A;  1XS9 D;  4IQU A;  5KL8 B;  5J0T A;  3RBE A;  4I27 A;  5C0Y A;  3HJE A;  2PFN A;  4KX3 A;  3Q8M A;  3C21 A;  2LI6 A;  1IXR A;  2HMX A;  2A1J A;  3IG5 A;  5KL1 B;  2KZM A;  4QWE A;  2XGQ A;  4Q8E A;  2JH1 A;  4Y2Y A;  4F5R A;  4ED1 A;  3B0Y A;  5IIL A;  2LMR A;  3T79 A;  1DGS A;  1H38 A;  5TIS U;  3D2N A;  3PW0 A;  4M6W A;  2YB4 A;  8ICV A;  3F2B A;  3OSP A;  2YB1 A;  1Z3E B;  3RH5 A;  5AKK A;  2IOF K;  2AHO B;  2ZJ5 A;  2W8K A;  3SAG A;  1ZXI A;  3ZI4 A;  4ECV A;  2KZ3 A;  2F77 X;  1K1Q A;  1ZQC A;  1ZOL A;  3NAS A;  1T94 A;  2ZIW B;  4ED0 A;  3K4G A;  5K4L A;  4TQR A;  1ZQO A;  1HJP A;  1L7M A;  4CNQ A;  3RFA A;  1ZQD A;  2K8C B;  2CXY A;  5KT3 A;  4MF8 A;  4Y2T A;  4UB8 U;  4QWD A;  2W8L A;  3V6H A;  2EZZ A;  4R8U A;  4TUQ A;  4EZ9 A;  4UBB A;  3AU2 A;  7ICN A;  4Q8F A;  3EWA A;  4DL3 A;  4DSE A;  1J2N A;  4M9J A;  1N63 A;  4UAU A;  3SAF A;  4J9O A;  2G06 A;  1N60 A;  4PGQ A;  4F71 A;  3ZD9 A;  3KD3 A;  2N1R A;  1ZQL A;  3MFH A;  3AL0 B;  4B6J A;  1SXE A;  4I2A A;  1SV4 A;  1F0M A;  3CP8 A;  4DFM A;  2FI1 A;  4RQ1 A;  4DQS A;  4K4G A;  8ICA A;  3NRW A;  4EEK A;  1ZJN A;  4Q43 A;  1JN3 A;  2YMM A;  2F44 A;  1BNP A;  7ICT A;  2W7O A;  3H4D A;  1SKW A;  2ZUC A;  2AXT U;  5J2D A;  1NOM A;  1Y88 A;  3PML A;  3BQT A;  4KLU A;  1TAM A;  2VIX A;  4UB2 A;  4NJ8 A;  4OCZ A;  3JPS A;  2KK0 A;  4EBE A;  2Y1I A;  2AGO A;  4XA5 A;  1ZQW A;  1IIP A;  2K4I A;  2NO5 A;  4ZH4 A;  4FFD A;  5KFZ A;  3GV5 B;  3PO4 A;  3TI0 A;  9ICF A;  2QB0 A;  1NZP A;  3Q8L A;  5KG3 A;  3MGH A;  2R8J A;  2Y0S C;  4ICA A;  3N7S C;  4EEL A;  2R8G A;  9ICE A;  3GV7 B;  1QSS A;  3PX4 A;  3V7L A;  3TAR A;  4BWM A;  3PZP A;  2ZUB A;  3AM9 A;  3E0F A;  1PK1 B;  5J8Y C;  1GO3 F;  1PZN A;  9ICG A;  1PK3 A;  3PV8 A;  5AI9 A;  3KZX A;  4F92 B;  4M04 A;  1RPL A;  2BZF A;  3RJI A;  1NZB A;  2ZTE A;  4Y2V A;  4NM2 A;  3SV3 A;  4Q44 A;  3H8W A;  3IP4 B;  2BHN A;  1Z00 A;  3OHB A;  1HUZ A;  5ALQ A;  4ELU A;  1BNO A;  1ZJM A;  3ED5 A;  3PR5 B;  3UMB A;  1EXN A;  1ZQQ A;  3BQ7 A;  1JAL A;  2W9M A;  3VC8 A;  4C0Z A;  1NKB A;  4F5O A;  1V85 A;  4UAV A;  2ZXI A;  4J9R A;  1ZQI A;  5KFH A;  1BPZ A;  4Y2R A;  2UVU A;  5AKY A;  5KFN A;  4MFA A;  2G5I B;  2ATL A;  1TKD A;  1FIQ A;  5EE1 A;  5CRX A;  1S0M A;  2W9A A;  4DFJ A;  5AKI A;  1WWV A;  4C80 A;  4TUP A;  2W3S A;  5DLF A;  5L1L A;  1SL0 A;  1NK6 A;  2HHX A;  2BR0 A;  1VDV A;  3WU2 U;  2FLP A;  2GOL A;  1WUD A;  1ZQT A;  4O3Q A;  3LK9 A;  4M9L A;  3WKE A;  1X9W A;  1QH9 A;  2KJ9 A;  2DKZ A;  5G5H A;  3WK5 A;  5JUM A;  3QEB Z;  2DL0 A;  2BPC A;  3GQC A;  1XNS A;  1Q3U A;  2BQR A;  2HBL A;  1L7O A;  1NJX A;  5ALO A;  2PFO A;  3C5F A;  3I28 A;  2NO4 A;  3DV9 A;  4QZI A;  4F2R A;  2KFZ A;  1PK1 A;  3JPP A;  5KT5 A;  5J0R A;  3PR4 A;  4C8L A;  1A77 A;  4J9Q A;  1UPH A;  5AK3 A;  3ISD A;  4Z6E A;  4K4I A;  2WAQ F;  5ALD A;  1NI3 A;  2V4Q A;  3UXO A;  4OJ5 A;  4IR9 A;  5KAF U;  7ICF A;  7ICM A;  3PSP A;  5ALX A;  4ED8 A;  4Z6C A;  2VJ4 A;  4OO1 J;  1L6N A;  5HMM A;  3Q8R B;  4GC7 A;  3SI8 A;  5KFO A;  3EW9 A;  2FMS A;  3IRU A;  4RQ5 A;  2C2E A;  3WK8 A;  4U7C A;  4KMO B;  3RR7 A;  1C20 A;  1KRP A;  2R8K A;  4PL1 A;  2H3Q A;  5IIK A;  3N97 B;  1ZQ1 C;  3AN1 A;  7ICR A;  5J0Y A;  7ICE A;  1JMS A;  5KG1 A;  4YXJ A;  2KNJ A;  5BPC A;  1ZD3 A;  2PFP A;  5DKW A;  5HHI A;  2ZIV B;  1S0O A;  2A19 A;  1N62 A;  1X2I A;  5J2K A;  4YR0 A;  3T5J A;  4Q45 A;  3GZF A;  2HSZ A;  2DFL A;  8ICS A;  3MAB A;  4US9 A;  2UVV A;  3UXN A;  1RYR A;  3K75 D;  1BPD A;  3C2M A;  4KLS A;  2E8M A;  3M6Z A;  5CA7 A;  2IHN A;  5AM4 A;  1F44 A;  1K5O A;  1S8O A;  4O3R A;  2UVW A;  4IL6 U;  3GIJ A;  2KIC A;  1ZQK A;  1NJY A;  1TK0 A;  5AK6 A;  2BDP A;  5AK4 A;  2EAN A;  1VJ5 A;  1LKY B;  1JXL A;  1L3T A;  1B0X A;  5ALF A;  1FO4 A;  1D8B A;  3M9M B;  1BPY A;  5B66 U;  1X40 A;  1YT3 A;  2FDR A;  1LV5 A;  3WKC A;  3EYZ A;  2BCU A;  7ICV A;  2HOQ A;  1WG8 A;  4KLH A;  1N56 A;  4P0Q A;  1WCL A;  5D4B A;  4UW9 A;  1TVA A;  9ICB A;  1NKC A;  3NVY A;  2ES6 A;  3D2S A;  1QTM A;  2PKE A;  3EUB 2;  4B9L A;  3RF9 A;  4DL7 A;  1ZET A;  4PPX A;  1Z19 A;  2J6U A;  1BGX T;  3NUQ A;  5J0X A;  1AQ6 A;  4DS5 A;  3LVV A;  5ALH A;  2WF8 A;  4UQG A;  8ICU A;  2HCF A;  4KLL A;  2Y9T A;  2DPJ A;  1L8O A;  3HP6 A;  5ALN A;  4M0A A;  4RQM A;  8ICB A;  3ZDA A;  2MRL A;  5J0O A;  2VJ5 A;  2E5S A;  4LVS A;  1D9D A;  5AM5 A;  2VKQ A;  2ZJA A;  2ZTC A;  2NRT A;  3T5K A;  4BJQ A;  9ICH A;  1KFS A;  1WYG A;  2OCE A;  2GO7 A;  3OJS A;  5III A;  8ICJ A;  5DBA A;  9ICL A;  3QU5 A;  3RJG A;  2HHQ A;  3ETL A;  4KLE A;  4EEN A;  2HI0 A;  5DGA A;  4KIT B;  2W54 A;  5KFJ A;  4I2B A;  4DF4 A;  3IN5 A;  1NK4 A;  4JWM A;  9ICR A;  1XC9 A;  4F4Z A;  5KTQ A;  7ICL A;  3F2D A;  1PVQ A;  5EWE A;  1OW5 A;  5ALW A;  4J9K A;  4RPY A;  1QSL A;  5JTI A;  5DDY A;  4E0D A;  1IG6 A;  7ICS A;  4QZD A;  4DO9 A;  4IC9 A;  3C1Z A;  1TFR A;  2ZJ8 A;  4KMU A;  3QYP A;  4GFJ A;  1T8E A;  1DRG A;  4PGY A;  4P4O A;  1QSY A;  2EAO A;  3M9N B;  5AI4 A;  3Q8S B;  3MDA A;  4IS7 A;  2K89 A;  1LKY A;  4F4W A;  3EPI A;  3JPO A;  1BPX A;  3ETR A;  4C7Z A;  3HWT A;  2FLL A;  2E1F A;  8ICM A;  2XVT A;  3OSN A;  1UCV A;  5KFG A;  3ZDD A;  4J9P A;  1N5W A;  4FZM A;  3JPT A;  5AK5 A;  4OJO A;  5CP2 A;  3RRH A;  5BOM A;  3F2C A;  2W55 A;  4QZA A;  4I2E A;  3Q8K A;  9ICC A;  2IMW P;  2KFN A;  3H0M B;  4C4R A;  2QKQ A;  2F3N A;  2W9C B;  1CUK A;  4JK1 A;  5KFK A;  3FC4 A;  4C4T A;  3OHA A;  3RH4 A;  4RQ6 A;  4ECQ A;  4QWA A;  1ZQH A;  5J0W A;  4MFC A;  2KIW A;  4C8N A;  3JPQ A;  5CJ7 A;  4YN4 A;  2FE9 A;  4CF4 A;  4DL2 A;  2KE7 A;  3OPX A;  1XWL A;  4PHA A;  4JMU A;  4JV0 A;  2BPF A;  1P7D A;  4US8 A;  1S0V A;  4QZ8 A;  2A1A A;  4DQR A;  1IV8 A;  2JEG A;  3HX0 A;  2PI4 A;  1U45 A;  2BKE A;  1KEJ A;  2KN7 A;  4UAZ A;  2ASD A;  4DSI A;  5B5E U;  1PVR A;  1JX4 A;  3C23 A;  5DB6 A;  4Y2U A;  3O0F A;  4NM1 A;  4Z6F A;  5DG9 A;  2WF6 A;  5ALR A;  1TAQ A;  1ZYQ A;  4F5Q A;  4GXJ A;  9ICO A;  4FBU A;  2QAR B;  4FZN A;  5HR6 A;  3CYM A;  3D6J A;  5KFP A;  3RJH A;  2K4P A;  2HHW A;  4G9B A;  1Z1B A;  1ARO P;  2KP7 A;  2W7P A;  1NK9 A;  5KFE A;  3QZ7 A;  1L7P A;  3BQ0 A;  2PI5 A;  4ELT A;  5KG5 A;  1MC8 A;  4RPX A;  1Z4N A;  2OXO A;  1SZH A;  2H3I A;  4QZB A;  4ACO A;  2E3T A;  4LZG A;  2KG5 A;  3THV A;  1S77 D;  4M9N A;  4RT3 A;  3RR8 A;  2HHV A;  1X6J A;  5CHG A;  1D8L A;  4ECR A;  5J2C A;  3PW5 A;  3DEE A;  4F3O A;  2OYY A;  3E58 A;  3QUC A;  5KFS A;  4FZL A;  5J2H A;  1MQ3 A;  3G6Y A;  3PW2 A;  3R9K A;  5CR0 A;  2XCP A;  2P35 A;  1V38 A;  3M6K A;  1F5S A;  5AKJ A;  4KLQ A;  5DBB A;  2FMQ A;  3PO5 A;  1O03 A;  2RDJ A;  2F1J A;  4F4X A;  1A6S A;  4NXZ A;  2V4R A;  3QX7 A;  2BCR A;  2WAQ C;  5DLG A;  1RZT A;  5IIJ A;  2BQU A;  8ICW A;  3DDH A;  4F72 A;  1QQ6 A;  1U9L A;  3ISC A;  2FJ6 A;  5D46 A;  4M9H A;  3NVZ A;  3S6J A;  4YD1 A;  3SZ2 A;  4PHE A;  3BS5 B;  2IA6 A;  3FYH A;  4RQN A;  2LYA A;  5J0U A;  5ALJ A;  2AQ0 A;  5KFU A;  2GWS A;  4I2D A;  1L3U A;  1OUQ A;  2B21 A;  4F8R A;  1URJ A;  3HW8 A;  1TK8 A;  5DB9 A;  3MR5 A;  3C2L A;  2XY5 A;  4QZ9 A;  5F3X B;  2KJ5 A;  2G5H B;  3GU3 A;  2ZIW A;  4NL9 A;  2DGZ A;  2ODG A;  5ALY A;  4DQI A;  4P4P A;  3MR3 A;  2J6S A;  3WK4 A;  1ZQJ A;  2WB1 C;  4LJX A;  1L3V A;  2DPI A;  4NY8 A;  3HKZ F;  5KFB A;  2XID A;  2R8H A;  4ED3 A;  2RQ5 A;  5KFD A;  4ELV A;  3GDX A;  3KKA A;  4LZD A;  5DBC A;  1SV0 A;  4ECZ A;  3TFR A;  3LDA A;  3SEN A;  3V6J A;  2H3V A;  1BVS A;  4PHP A;  1FEZ A;  2ZIX B;  1IM4 A;  3RTV A;  1DXS A;  4B9T A;  4I2J A;  1HIW A;  4B9N A;  1BPB A;  3CW2 C;  2B0C A;  3CNH A;  4UAR A;  1LVH A;  1XU4 A;  5AM3 A;  4KLG A;  1SL1 A;  3TAN A;  8ICK A;  2LHT A;  4O3S A;  3J81 j;  4BDP A;  1RYS A;  4PHD A;  1MSW D;  2XC9 A;  8ICO A;  4DOC A;  3C28 A;  5DDM A;  4YQW A;  4NLK A;  2LPE A;  1TV9 A;  2HW3 A;  4ECT A;  2DQN B;  1NK8 A;  2KV2 A;  3H8M A;  4XQ8 A;  4R65 A;  2ZIU B;  3FDS A;  2F2A B;  5KFV A;  4QJF B;  3C2K A;  2ASL A;  1L5U A;  2CPR A;  9ICP A;  3NVV A;  2WTF A;  3RJJ A;  3M1Y A;  4BGD A;  3JPN A;  4J9S A;  4MEX A;  3BS7 A;  1JIH A;  2EAM A;  2C28 A;  4UAW A;  4DS4 A;  2GH1 A;  5L9X A;  3KZI U;  4F2S A;  1ZQV A;  4YFK A;  1MN8 A;  4IRC A;  4YMM A;  5ALS A;  2M9N A;  2E8P A;  3ISB A;  2EH9 A;  9ICK A;  1OXJ A;  3FM9 A;  4KN4 A;  5AM1 A;  4GLX A;  5J2E A;  3K1Z A;  2XGP A;  1XSN A;  1S97 A;  4I2H A;  3A0B U;  4FS1 A;  1XO0 A;  1ZQR A;  5BOL A;  3TKA A;  2AJQ A;  3V6K A;  4UBC A;  1SB3 C;  2XI9 A;  1SKR A;  4IR1 A;  3QU4 A;  2MAX A;  3HT3 A;  4BXO B;  3OJU A;  2IOH A;  4RQ4 A;  3BQ1 A;  4YG2 A;  2W9B B;  1S0N A;  1SWW A;  2HOI A;  2R18 A;  2VA2 A;  3Q8Q B;  2IOF A;  4F91 B;  3TAP A;  5AKE A;  2LBO A;  3RRG A;  2NRX A;  2D6F C;  3GV8 B;  2VAN A;  2ZXH A;  1PUZ A;  2FPK A;  3MR6 A;  1L8L A;  1X42 A;  2KOB A;  5ALM A;  2W11 A;  2WB1 F;  5AKZ A;  2MU2 A;  3KBB A;  4ECX A;  4MFF A;  4O0I A;  3IM1 A;  4PJ0 U;  4F5P A;  1Q46 A;  5AI0 A;  4ECW A;  4CRX A;  3C5G A;  4B9V A;  2W04 A;  3AUO A;  5KAI U;  3RB0 A;  3LYS A;  3SMV A;  4ED6 A;  2HHS A;  4F93 B;  2EZX A;  4DSJ A;  4HAI A;  5KFM A;  3A0H U;  2ZIU A;  3D2Q A;  4DOB A;  4IRK A;  1ZD2 P;  5J2J A;  5L1K A;  4DFK A;  2KSO B;  2WHE A;  3ORY A;  3K1R B;  2CN1 A;  4CDG A;  1T3Q A;  4R64 A;  4NLG A;  2XCA A;  4BX9 C;  3ZD8 A;  4AYB F;  4M47 A;  4J03 A;  9ICI A;  4EYH B;  2WF5 A;  8ICF A;  3PW4 A;  2KEY A;  4KX5 A;  4Z6D A;  4KLT A;  4O9M A;  2BDU A;  4EYI B;  2NRW A;  7ICP A;  9ICU A;  4QNL A;  5KFY A;  2H5X A;  4YR2 A;  2JV3 A;  2K4H A;  1U47 A;  3H8S A;  5KFR A;  4Y2J A;  4HYK A;  2I5H A;  1YZ7 A;  3RAQ A;  5F9N A;  5IIM A;  5KFW A;  2R8I A;  8ICP A;  1UHU A;  4P0P B;  7ICG A;  4B9M A;  4YP3 A;  3KFU F;  5J2A A;  1SXD A;  2JRZ A;  8ICG A;  1WWU A;  2JEI A;  2JMG A;  2JHD A;  5AKX A;  3CRX A;  3ZDC A;  2F8L A;  1O08 A;  4YR3 A;  4C8M A;  2I1Q A;  5EOZ A;  1U49 A;  1C7Y A;  4NLB A;  4UB1 A;  4F50 A;  2YMP A;  1QCK A;  1KFT A;  3MR2 A;  3NTU A;  3PSF A;  1MA7 A;  4OD0 A;  1N5X A;  8ICH A;  2AQ4 A;  3QUT A;  2C2R A;  5KNI A;  3KHL A;  4UB3 A;  4RPZ A;  2FMP A;  1L3S A;  2KMD A;  4RU9 A;  3RAX A;  2RLT A;  2ZIV A;  2ESE A;  4J9N A;  1DOQ A;  2RDI A;  4M6W B;  4DQQ A;  8ICX A;  3C1Y A;  4QWB A;  2B6G A;  1J2M A;  5HHH A;  3MC1 A;  2BPG A;  4ECU A;  1RM6 C;  2LM4 A;  4O3N A;  2IBK A;  2CRX A;  5DQI A;  1K1S A;  1ZQE A;  1ZQZ A;  4DLE A;  4KLD A;  4R63 A;  4I29 A;  1CRX A;  2E8O A;  3QZ8 A;  3MDC A;  4MF2 A;  3VCB A;  1HUO A;  4EZ6 A;  2LYB A;  1NK5 A;  1KTQ A;  2YX8 A;  5HP4 A;  3L3F X;  3C29 A;  1COO A;  2ISO A;  3TAD A;  5KFT A;  1ZRM A;  5J0Q A;  5AI6 A;  5HR7 A;  1XO1 A;  3RH6 A;  4R8U B;  4RUC A;  2D3D A;  2HOF A;  2FPL A;  4I2I A;  2FLN A;  4RQ7 A;  4C7Y A;  3RB3 A;  2YMQ A;  3PY8 A;  3T5L A;  9ICS A;  3PSI A;  4EEY A;  5KFX A;  4F4K A;  3UM9 A;  4O5C A;  3TQ1 A;  1ZRN A;  3T3F A;  2L5Y A;  5J2I A;  4YD2 A;  5L1M A;  1U4B A;  2ZTD A;  4X5V A;  5JRT A;  5GTI U;  1X9M A;  1NK7 A;  4CCH A;  3MGI A;  4DFP A;  5AI8 A;  4U6P A;  2F8K A;  4J9M A;  4IRD A;  3MGV A;  4C4S A;  4P0P A;  5L1I A;  1T4G A;  9ICQ A;  1RYU A;  3RB4 A;  2BGW A;  5DG7 A;  1UQV A;  2RP5 A;  4YMO A;  2AU0 A;  5ALV A;  4B9U A;  8ICC A;  3HPO A;  1ZQN A;  2YQE A;  4YCX A;  4RNO A;  1NK0 A;  3KHG A;  3HKZ C;  5AM0 A;  3AQE A;  1KLN A;  1D8Y A;  4PZN A;  4EX6 A;  2DUY A;  3WKD A;  1S76 D;  2LKY A;  4UB6 U;  5J29 A;  3RJE A;  2VA3 A;  2C22 A;  4YXM A;  3SYZ A;  1KN5 A;  2ASJ A;  4G3I A;  4KLI A;  3AEV A;  2DKX A;  5AKL A;  4FBT A;  2AGQ A;  4UAT A;  1QQ7 A;  3UXP A;  1RQL A;  4NLZ A;  4Y2X A;  2HBK A;  1RXV A;  3G6V A;  1ZQB A;  4F4Y A;  2Q0Z X;  2QB0 B;  5KFF A;  5KT7 A;  2MA1 A;  1CI4 A;  3UPQ A;  5T14 A;  4GXK A;  1D9F A;  4O3P A;  3QU9 A;  3NS1 A;  5EE3 A;  4QIW C;  8ICY A;  3PNC A;  3H0R B;  2UVR A;  5KFC A;  2EAP A;  1QQ5 A;  4TUR A;  3RBD A;  4OJP A;  3H0L B;  2A3V A;  4PGX A;  3F5E A;  3FAH A;  5KFI A;  4BUG A;  1LB2 B;  3H40 A;  3WKB A;  2ALZ A;  3I1Y A;  1FFU A;  1ZQF A;  2PXI A;  1ZQY A;  3M8R A;  2BCV A;  4IQV A;  1ZQA A;  4DFD A;  3SV4 A;  2KJ8 A;  5ALI A;  1DK2 A;  3TAQ A;  1Z00 B;  1Q8K A;  1UT5 A;  1KFD A;  8ICZ A;  2J6T A;  3JPR A;  4QZH A;  1A0P A;  3UQ2 A;  5KT2 A;  1SKS A;  3RJK A;  5EWG A;  4TUS A;  2PFQ A;  1T7P A;  4QWC A;  8ICE A;  1RXW A;  2G09 A;  3F5A A;  4JB3 A;  1JI7 A;  3QNM A;  1TAU A;  2XY6 A;  3QE9 Y;  1KKX A;  3EPG A;  1MQ2 A;  4A8E A;  1ZQP A;  2ISP A;  5CB1 A;  4DL4 A;  4EBC A;  4I2C A;  1L7N A;  2W9C A;  2WFA A;  3I76 A;  3M7D A;  1S10 A;  3GIK A;  2KKP A;  1B4F A;  1V97 A;  1JUD A;  3L5K A;  5TZV A;  4DSL A;  3KTQ A;  4C8O A;  5AI5 A;  2BCS A;  4Y2P A;  1S5L U;  4USA A;  7ICH A;  2Z7J A;  4KN7 A;  2HVH A;  3EZ5 A;  3PST A;  5KG0 A;  5AKG A;  5AIB A;  2W03 A;  2AGP A;  3U26 A;  4NL9 C;  3AMZ A;  4GIB A;  3WK6 A;  4C8K A;  5ALT A;  3ZDB A;  1X6I A;  5F9L A;  3MBY A;  2O6K A;  3KHH A;  1YZ6 A;  2YML A;  1QLN A;  3V72 A;  3HRD D;  3WK7 A;  4RT2 A;  4UB5 A;  4QW9 A;  3F53 A;  5IIN A;  7ICU A;  2LYH A;  2H3F A;  4TQS A;  5GTH U;  5JU5 A;  3ALR A;  1NJW A;  3SEI A;  5J0S A;  2V9W A;  2JEJ A;  3KKA C;  4UB4 A;  1DK3 A;  2KZZ A;  1SV0 C;  3ONN A;  3QUQ A;  2EDU A;  3WK9 A;  5KT6 A;  2QAR A;  2I9G A;  4ECS A;  4P2H A;  1KDH A;  5IIO A;  4GC6 A;  2K8B B;  1N48 A;  5J2B A;  1TE2 A;  5J2F A;  2DBY A;  5J8Y A;  3LVW A;  1ZD4 A;  1ZQX A;  3IG8 A;  4O3M A;  2G08 A;  4OJ6 A;  1SL2 A;  1NNL A;  4EX7 A;  4M2Y A;  3BJY A;  4RNN A;  4AYB C;  2Y9U A;  3IDW A;  3NRZ A;  5C5J A;  4JUZ A;  2I6X A;  2PMZ C;  2G0A A;  4DOA A;  4UAY A;  3PX0 A;  2QLT A;  5KFL A;  2DF4 B;  4MHV A;  1PVP A;  2DWQ A;  2GLE A;  1JRO A;  3H8J A;  2F76 X;  8ICR A;  2NRV A;  4QIW F;  2NV3 A;  1NJZ A;  2YTU A;  3B0X A;  2Y1J A;  1ZQS A;  4GXI A;  3E2E A;  4P4M A;  3BZC A;  9ICX A;  3UMG A;  3G6X A;  3B9J A;  2JR5 A;  4PZO A;  2KD1 A;  2BQ3 A;  1Z4O A;  3UQ0 A;  4ZOH C;  3MFI A;  4IQT A;  3M8S A;  2OH2 A;  3LWL A;  2OWO A;  5L1J A;  4I2G A;  4RZR A;  5KFA A;  4DSK A;  2OEH A;  2EZY A;  3PVX A;  3BS5 A;  1SGG A;  5ALG A;  1DGJ A;  7ICQ A;  5ALL A;  5J2G A;  2W43 A;  3QU2 A;  4QZG A;  2KHQ A;  3PW7 A;  4MEY A;  3AQF A;  5ALK A;  2KVC A;  4CE6 A;  2JEF A;  5ALE A;  4DL6 A;  4PL2 A;  4RQ2 A;  5E79 U;  3SD7 A;  1JXE A;  4PH5 A;  5CEH A;  4I2F A;  2ZG6 A;  3SR6 A;  3PX6 A;  4F5N A;  2OM6 A;  5KG4 A;  2D8C A;  3AU6 A;  1CEZ A;  3N7R C;  1TK5 A;  2G07 A;  5HML A;  4QW8 A;  4OJL A;  1B22 A;  5KT4 A;  8ICQ A;  4P0Q B;  4KLF A;  2RRD A;  4Y2Q A;  3IV6 A;  2HHT A;  2WF7 A;  3RJF A;  2HBM A;  4CF5 A;  1ZQG A;  5FP0 A;  3LWM A; 
#chains in the Genus database with same CATH homology
 2LYA A;  2KIC A;  2DF4 B;  2ZIX A;  3AQE A;  2JGA A;  1PVP A;  3SQI A;  1PVR A;  2CPR A;  3F2D A;  1PVQ A;  4CRX A;  2F76 X;  4A8E A;  4WJ3 B;  2LKY A;  2W04 A;  3KZX A;  4QIW F;  1OUQ A;  2ZIV A;  2NV3 A;  1URJ A;  3LYS A;  3SMV A;  3SAH A;  2KHV A;  3O0F A;  4NV0 A;  1NZB A;  3M7D A;  4IC9 A;  2ZIU A;  3D2Q A;  2K8A A;  2KKV A;  3SAF A;  1UPH A;  2KKP A;  2KJ5 A;  2H3Z A;  2G5H B;  2GH1 A;  1ED1 A;  1D8B A;  2G06 A;  2Y0S F;  2KD1 A;  3GU3 A;  5KL8 B;  1YT3 A;  2CN1 A;  2WAQ F;  2F2A B;  3IP4 B;  2ZIW A;  2DGZ A;  4GFJ A;  4CDG A;  2CRX A;  2N1R A;  4FZN A;  2HOQ A;  3CYM A;  5HR6 A;  4BX9 C;  1DRG A;  4AYB F;  1Z1B A;  1CRX A;  3AL0 B;  5C0Y A;  2OH2 A;  2W7P A;  4OJ5 A;  2Z7J A;  2HBK A;  4P0Q A;  3VCB A;  4KX3 A;  2K89 A;  2WB1 C;  3CP8 A;  3PSP A;  3PST A;  2LYB A;  2OXO A;  2MA1 A;  2VJ4 A;  3F5A A;  3HKZ F;  4OO1 J;  2KEY A;  2W03 A;  5A0L A;  4KX5 A;  1SZH A;  2H3I A;  2HMX A;  5KL1 B;  3IG5 A;  3NRW A;  3D2S A;  1L6N A;  2XID A;  5T14 A;  3VC8 A;  4NWI A;  3RF9 A;  3K1Z A;  2BDU A;  2JH1 A;  4C0Z A;  4ACO A;  1Z19 A;  3NUQ A;  2E1F A;  4U7C A;  4KMO B;  3T79 A;  2ZXI A;  2XVT A;  4QIW C;  4QNL A;  2W7O A;  2YX8 A;  3LVV A;  1XO0 A;  2KHQ A;  3H0R B;  3L3F X;  3C29 A;  3D2N A;  2K4E A;  3AQF A;  4FZM A;  4OJP A;  2KVC A;  3F53 A;  3H0L B;  2K4H A;  4PL1 A;  2A3V A;  2H3F A;  3F5E A;  2YB4 A;  2H3Q A;  3N7P D;  2H3V A;  2XI9 A;  3ALR A;  3DEE A;  1ZQ1 C;  4PL2 A;  4OJO A;  4BUG A;  3F2B A;  2G5I B;  5HR7 A;  2E1E A;  2ZIX B;  1KBU A;  2KNJ A;  2OYY A;  2PMZ F;  3F2C A;  1ECW A;  1TAM A;  2VIX A;  2HOF A;  2YB1 A;  1HIW A;  2ZG6 A;  5CRX A;  3ONN A;  4FZL A;  2ZIV B;  4P0P B;  2MRL A;  2OM6 A;  2VJ5 A;  3H0M B;  2E5S A;  2HOI A;  4FE3 A;  3PSI A;  3SAG A;  3KFU F;  2R18 A;  3M6K A;  2HBJ A;  1IIP A;  2F77 X;  2K4I A;  1Q3V A;  2K8B B;  2GOL A;  1WUD A;  2VKQ A;  3GZF A;  2JMG A;  2LBO A;  2JHD A;  3N7R C;  2LHT A;  2KJ8 A;  3ICX A;  3CRX A;  2F8L A;  2G07 A;  4NLC A;  4BJQ A;  4U6P A;  2KIW A;  3LVW A;  1T94 A;  2D6F C;  2M0N A;  2ZIW B;  1HEK A;  3MGV A;  4CGZ A;  1A6S A;  4P0P A;  2KJ9 A;  2RHF A;  3OPX A;  2ZXH A;  3IG8 A;  4OJL A;  3C28 A;  2G08 A;  4O3M A;  4OJ6 A;  2Y0S C;  4JMU A;  2RP5 A;  4ICA A;  4NLB A;  2Q4T A;  2WAQ C;  3N7S C;  1A0P A;  4P0Q B;  1P7D A;  2DQN B;  2RRD A;  3PZP A;  2KOB A;  2KV2 A;  4AYB C;  3RFA A;  1XNS A;  2JH7 A;  3M6Z A;  2WB1 F;  3E0F A;  3PSF A;  2K8C B;  1Q3U A;  2XIC A;  1MA7 A;  2HBM A;  1GO3 F;  1F44 A;  3IN5 A;  2HBL A;  2PMZ C;  2ZIU B;  2G09 A;  2G0A A;  3HKZ C;  4QJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...