2ZIUA

Crystal structure of the mus81-eme1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
302
structure length
281
Chain Sequence
GWHLSPGSYDIVLCVDLCETTGKQELVKELQRNSVTFDVRKLNVGDFLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLRKPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQKLYQNCTLFCRANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLMQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCTRGPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
molecule keywords Mus81 protein
total genus 84
structure length 281
sequence length 302
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziuA02
4P0QA 2ZIVB 2ZIXA 2ZIXB 2ZIWA 4P0QB 2ZIUA 4P0PA 2ZIWB 2ZIUB 2ZIVA 4P0PB
chains in the Genus database with same CATH superfamily
1MA7A 5CP2A 4Y2XA 2ZIUB 1XNSA 3PSIA 2A1JA 3IP4B 2NO4A 4R66A 1N2XA 1XSLA 1ZQAA 3C29A 1RZTA 3OJSA 1HIWA 4QZHA 2KOBA 5AM4A 5KFJA 2Y0SC 4R65A 4PHDA 3L3FX 1K1SA 3Q8LA 9ICIA 1Y88A 5KFQA 3N7RC 9ICSA 2KEYA 4EX6A 2DL0A 4YR3A 4ED1A 1V85A 2DGZA 4PHEA 1WCNA 3M1YA 4QIWF 4JK1A 8ICPA 2A1JB 1SKSA 4OO1J 2C2EA 4RQ2A 5L1IA 4RNOA 4DSEA 2A3VA 4Q43A 2XO7A 5KT4A 2L5YA 4TURA 2LYBA 3SAGA 5J0YA 3N97B 2HBMA 2KN7A 4CRXA 2K4IA 2F1HA 3KOOA 3RB3A 4RQ4A 4DFPA 3WK8A 4O0IA 4MFAA 3RJEA 3NS1A 3L4PA 2HHVA 4O9MA 4KN7A 4TQRA 3QUCA 4YD2A 1S97A 7ICRA 4QWDA 3KHRA 5ALJA 3EPIA 2BZFA 3PMNA 2E8NA 4C7YA 4J9PA 3V72A 3SMVA 2HMXA 3L5KA 3QU7A 4Z6FA 4NLGA 4KLHA 1N63A 3SV3A 1ZQIA 7ICLA 1QTMA 4EYIB 4NM2A 4Y2TA 2WTFA 5KFXA 3MFIA 3ISBA 4KLOA 1NK6A 1XSNA 4K4HA 8ICSA 1BGXT 4K4GA 2HOFA 3RRGA 3K75D 2XI9A 2PFPA 3MR3A 2LBOA 1NK5A 3RB4A 5ALKA 2LM4A 2G5IB 3SAHA 4A8EA 2A1AA 1KFSA 3RB0A 3H40A 5KG6A 5J0OA 2G07A 2W55A 4MHVA 4OCZA 4UAYA 3B9JA 2AXTU 4ED0A 5KAIU 5KFKA 4BGDA 7ICIA 1N62A 5J0WA 2HOQA 3LWLA 3V6HA 1FEZA 1ZQCA 2QB0B 3H0RB 7ICSA 1ZJMA 1SXEA 5K4LA 4RZRA 7ICNA 4C8OA 2JXJA 2FJ6A 3TAPA 2NRTA 3T5LA 2HW3A 3CYMA 3UQ0A 1QCKA 1JXLA 1S9FA 2AGQA 4F4YA 5HR7A 5AI0A 1LV5A 4FZLA 4G3IA 3ZI4A 2AGPA 5KNIA 3NVVA 2AU0A 3KBBA 5KFBA 4EBDA 1J2MA 3TI0A 3PSFA 5ALIA 5ALPA 1U47A 4M6WB 1PVRA 3GV8B 2KP7A 4IR9A 2EZXA 5CHGA 1ZYQA 1QSLA 1XS9D 2KKVA 2LI6A 4P4MA 3GU3A 4ELVA 4YXMA 1RQNA 3KKAC 3V7JA 2MSNA 3T5HA 4YR2A 1A6SA 3HWTA 1BPXA 4C8KA 5DLFA 3BQ1A 1YZ6A 1XO0A 1K1QA 4G9BA 5AK5A 4BJQA 2H3IA 2NRZA 2RDJA 4DSFA 2HHTA 4UW9A 5J0PA 4NL9C 4CNQA 2G5HB 1S0VA 1ZQ1C 3Q8QB 1NK4A 1KL9A 2Y9TA 4QZIA 3KD3A 4QW8A 2JR5A 2ZIXB 1LB2B 4I2GA 1KLNA 1URJA 7ICVA 1PVQA 4QZAA 1S0OA 3H8SA 5BPCA 4UB8U 1L5UA 4UBBA 5ALOA 3AL0B 1RXVA 4YR0A 1JX4A 2OXOA 3PR5B 3GV5B 1XO1A 4Y2RA 1TK5A 1ZQDA 4UASA 3MGVA 1L3UA 2BCSA 2G09A 8ICNA 2W9CB 1MQ3A 2N1RA 3ETRA 5DGBA 1MC8A 3WKDA 3JPSA 2OWOA 2QARB 4B6JA 4RQ1A 2E8MA 4ELUA 4I2CA 3BQ0A 4RUCA 4DQSA 3WKEA 4NV0A 3TADC 1MSWD 3TANA 3OPXA 4UB4A 4J03A 2OEHA 4MFFA 2E8OA 3MGIA 3N28A 2WHEA 3SENA 2XIDA 1JN3A 2YY6A 1ZQLA 4DQPA 3WK7A 4JWNA 2KJ5A 5DLGA 8ICYA 4RU9A 8ICEA 3Q8KA 3EW9A 3LWMA 1V97A 5G5GA 4KLJA 3H8WA 1SV0C 4R8UA 1ZQFA 4DFMA 5AKKA 3KTQA 4IRCA 2ZJ5A 2E1FA 1S76D 5AIBA 3MFHA 2KFZA 1WCLA 2ZXHA 2BPFA 7ICMA 5CR0A 4DFJA 4F4ZA 3PZPA 5CRXA 3QU9A 4F3OA 1JUDA 8ICCA 2BDPA 2KSOB 5HMMA 1ZJNA 3BS7A 1KFDA 5C0YA 2ZIVB 3RJHA 2PFNA 3RJFA 4NLZA 3JPOA 2DQNB 3ISDA 2K4HA 3D2QA 4CF3A 3MGHA 4DEZA 3F53A 2ALZA 1JI7A 4DCCA 1KBUA 4F71A 5IIKA 1PVPA 4PGQA 4I2IA 1D8LA 2VJ5A 4O3OA 4GFJA 4M04A 3RFAA 1MQ2A 2FLNA 5JTIA 1VDVA 2IOHA 2ZTEA 4US8A 3KFUF 1TK8A 4DSLA 3QZ7A 1ZQSA 2LYHA 4F50A 4ED2A 1X9SA 3KHLA 5J2IA 3M7DA 3SR6A 3NUQA 4KLIA 2KFNA 1ZQVA 4I2DA 5EE3A 4PHPA 1ZD3A 4KLDA 2VKQA 1PK3A 1SL2A 4P2HA 4PPXA 2KIWA 3QU2A 4KLMA 5KL1B 3R9KA 4DSJA 2BQRA 1N61A 1TE2A 1QQ6A 3Q8RB 2K8AA 1H38A 1L8LA 5AI8A 3BQ2A 3H0LB 4UATA 4ED8A 4RQ8A 3ED5A 4IQWA 1T94A 2WB1F 1S0NA 3OSNA 5HHHA 1ZQGA 2LHTA 2QB0A 1SL1A 4M47A 3UMCA 2KE7A 4KLSA 2WAQC 4PH5A 2KD1A 5IIMA 3QNMA 4RUAA 3OTQA 2YB1A 1XWLA 2KICA 1T7PA 4Y2YA 3HT3A 5DG8A 4YD1A 3C5FA 3QXGA 3CRXA 3RH6A 3IM1A 2KZZA 5AI6A 4DSIA 3SV4A 1IIPA 4F5NA 2D8CA 4AP9A 4Y2SA 2YMPA 2F8KA 4PJ0U 2FPLA 4EENA 2PFQA 2PKEA 4O5KA 5ALDA 3RAXA 3NGDA 3V7KA 5KG1A 3GIMA 5KFZA 7ICJA 1BPEA 4DL3A 1BNPA 4CCHA 2QB1A 5J2GA 1FFVA 3GIKA 4QWAA 4P4OA 1RM6C 4DL2A 4ELTA 4RQ3A 2DKXA 3LDAA 5EE9A 2OM6A 1DXSA 2FMSA 1C7YA 3BS5A 4EBEA 5ALHA 2MUTA 3AUOA 5J0XA 2BCUA 5IILA 5ALWA 2IMWP 5AKZA 4Q8FA 5CA7A 3TACB 2F1JA 4FZNA 3E0FA 3OHAA 4NWIA 2G08A 3QYPA 4DQQA 1YZ7A 1DRGA 3NVWA 1EXNA 2WF7A 4DQIA 2Y1JA 4J9KA 9ICJA 4C80A 3RB6A 4R63A 3QEAZ 3CP8A 4RNNA 3M8RA 4FBTA 5KFPA 4QZFA 2LPEA 4C8MA 4F5PA 1NJWA 7ICUA 4F72A 5KG5A 2KIVA 1ZQBA 4PL1A 1D9DA 1T8EA 2RQ5A 2V4RA 3M9NB 2R8IA 4GXKA 4CF5A 1Z19A 1S8OA 2DWQA 2W04A 5AIAA 1SZPA 3FAHA 3LYSA 2BQ3A 2BDUA 4Q44A 2FI1A 2W9MA 8ICQA 1X9MA 2KVCA 4Z6EA 1QH9A 2QARA 4QZGA 9ICLA 2H3FA 4NY8A 4EBCA 2DBYA 2CN1A 2YQEA 2IHMA 2KZ3A 1BVSA 2E1EA 5AKLA 5EE0A 1Q3UA 3H7IA 3JPNA 2UVUA 3PX6A 1U45A 1SB3C 3T79A 1A0PA 5KL8B 2J6SA 2Q0ZX 2FMPA 2EAOA 3B0XA 4DL5A 2ASLA 3D6JA 4JUZA 5HP4A 3WKCA 2E5SA 5KAFU 4NLNA 4EEYA 3GV7B 4PGYA 3PX4A 2IOFK 3AU2A 5KFDA 3B0YA 3E2EA 2OHFA 3IN5A 4Z6CA 1CRXA 5EWEA 5J8YA 3VC8A 5HHIA 8ICKA 5CJ7A 1XSPA 2V4QA 5IINA 4UBCA 5F3XB 2JEFA 3HRDD 3C2MA 7ICFA 4MF8A 2YMQA 4KLFA 4ED6A 5IIIA 2XICA 1COKA 4M9JA 1ZQHA 4FE3A 4B9UA 4TQSA 1FFUA 3G6XA 2W8LA 2VA3A 4C4TA 4DLEA 2FLPA 4AYBC 3IG8A 4UAUA 3D2SA 5EE1A 5ALYA 4KX3A 4F4WA 3PO5A 3H4DA 9ICTA 3PW5A 3C21A 4P0QB 2XVTA 5TISU 5KFNA 5J2DA 4C4SA 2XY7A 3I76A 4F2RA 1MN8A 4J9QA 1ZQRA 3JPQA 9ICCA 3BZCA 5TZVA 3PR4A 3MR2A 3T5KA 4EELA 2K4PA 2H3VA 3RH5A 3HJEA 5GTHU 9ICPA 4P0PB 3WK6A 3MR5A 2GOLA 5AM2A 1ZETA 2B0CA 2WFAA 1NZPA 4P0QA 2F76X 4XQ8A 2AQ0A 3ZDCA 1KSPA 2ZIUA 4DF4A 3H4BA 3ALRA 2EQYA 1JALA 5AM5A 1JIHA 1UCVA 1U48A 1WWVA 1ZD5A 1RG6A 5EWFA 2OYYA 2DUYA 4GC6A 4J9MA 1FO4A 2PI4A 1SKRA 4ICAA 3A0HU 4C0ZA 5FP0A 4RQMA 7ICTA 2IA6A 3C2LA 2KG5A 3HW8A 1SKWA 2JGAA 4GIBA 8ICUA 1RDFA 5DB8A 5J0TA 5KFTA 3T3FA 1BNOA 4J9SA 3F2BA 2UVWA 3ISCA 2KHQA 2W3RA 3LVWA 1AROP 4HAIA 4O5EA 2XGPA 1ZRNA 1PZNA 2WF5A 2ZUDA 3HILA 8ICMA 4F4KA 5KFVA 1NI3A 2IOFA 2QLTA 4FZMA 4DFKA 1U49A 1NJXA 3F5EA 4EZ9A 1YT3A 5H2FU 4FS1A 5KTQA 4US9A 2LM1A 8ICGA 4I2FA 5AICA 4I27A 3UXOA 2BCVA 5DB7A 2M0NA 1UQVA 4XA5A 4YMNA 5AHXA 5KFWA 4ED7A 1T3NA 2H3QA 4I28A 4NL9A 1HEKA 3M9MB 5KG2A 3KHHA 4FBUA 3SEIA 1A76A 2LKYA 9ICXA 1TAUA 4B9NA 3GIJA 1TKDA 4C7ZA 4PL2A 2HBJA 4AYBF 5L1LA 4Q8EA 2HCFA 4ZH4A 2ATLA 3ZDAA 1L3VA 1V38A 4GC7A 3C5GA 1D8YA 2K89A 2FE9A 2VJ4A 3KZXA 3A0BU 4EX7A 5AKIA 2BGWA 2KV2A 5KFSA 5ALTA 3BQ7A 5KT6A 2GWSA 5D49A 3RH4A 1ECWA 2HI0A 5AI4A 4YG2A 1ZQEA 5KFCA 2RP5A 4MF2A 2VA2A 1S10A 3QUTA 8ICWA 1RXWA 2AQ4A 4EYHB 3M8SA 1L7NA 2JRZA 3H8MA 5AKJA 2AJQA 1U4BA 8ICBA 3PW2A 1LKYB 3WKAA 3LVVA 2ZG6A 2ES6A 5J0UA 2KMDA 2YTUA 5A0LA 1N56A 2P66A 1ZQXA 4KX5A 1DGSA 2ZJAA 2Y9UA 1DOQA 4DLGA 4E0DA 4X5VA 5KT2A 4KLGA 3PX0A 1N60A 1O03A 5DGAA 1ED1A 5JUMA 3S6JA 9ICAA 3IV6A 4WJ3B 3HPOA 4Y2QA 9ICEA 1ZQMA 4Z6DA 4KTQA 7ICQA 3BQTA 2Y0SF 3PV8A 4JV2A 3C1YA 2R8GA 1NK9A 4KLEA 2J6TA 5ALEA 2HDOA 4UAWA 2JEIA 5EOZA 2H5XA 4PZNA 3NTUA 5AI5A 4J9OA 1V9PA 5DDYA 4I2JA 1AQ6A 3CW2C 2MU2A 3UM9A 5DBAA 1J97A 1Z4OA 3OJUA 3QZ8A 1KRPA 9ICGA 1Z3EB 4RNMA 2JV3A 2NRVA 8ICVA 4C8NA 1NJZA 2DKZA 2IHNA 5B5EU 3Q8PB 2IBKA 3EYZA 2KNJA 5DBBA 4YN4A 3K1ZA 3F5AA 4M6WA 5HMLA 2C2DA 3ZDEA 7ICPA 1D9FA 2KJ8A 2MAXA 7ICOA 4IQTA 5DG7A 2R8JA 4NJ8A 4KLLA 2F44A 3I28A 4XRHA 1KFTA 3QEBZ 2BR0A 4ED3A 8ICHA 2BQUA 3IDWA 2XY5A 2V9WA 5JU5A 1X66A 5BOMA 2P6RA 1FIQA 3Q8MA 2DPJA 2JH7A 2EAPA 5KG7A 5KT7A 1UA1A 4DS4A 3UPQA 4QZCA 3HP6A 4CE6A 5J0SA 9ICWA 3QUBA 5BOLA 3RTVA 2FPMA 1B43A 3PO4A 4OJOA 5ALVA 3VCBA 1RQLA 4DL7A 3THVA 1C20A 2ZXIA 4NXZA 2DFLA 1NKCA 2FMQA 3SD7A 1SWWA 5ALMA 7ICGA 2FLLA 3AM9A 9ICRA 4KITB 3UMBA 2EH9A 5KG3A 2AGOA 3NRZA 1L7OA 4F91B 2HOIA 5J2FA 8ICRA 2BPGA 1L3TA 2ASJA 3M9OB 4BWJA 1NKBA 2O6KA 1DK2A 1UT8A 1Q3VA 4JMUA 3ICXA 3WK4A 5ALNA 5HR6A 4NLCA 4U7CA 4M9NA 9ICVA 5J2CA 4P4PA 2I9GA 4IQVA 2FDRA 4ACOA 4IQUA 5AM0A 4IRKA 1B22A 3JPRA 1T3QA 5AKXA 2KZMA 2ZIVA 1OXJA 2ZUBA 4USAA 3GIIA 1ZQUA 3GQCA 2K8CB 3TAQA 4OJPA 8ICXA 2PXIA 4J9NA 2B21A 3AN1A 4RQ6A 2CRXA 1NK8A 4DQRA 2JMGA 2NO5A 4EZ6A 1B0XA 2GH1A 1XU4A 8ICIA 5AM3A 1KN5A 5L9XA 3ONNA 1JROA 1WYGA 2W9AA 2XC9A 1TAQA 3FDSA 1VJ5A 3U26A 5ALFA 5F9NA 2EZZA 4YVZA 1ZQOA 3MDAA 3RBDA 1RYRA 5DQHA 5J8YC 5DQGA 3UXPA 4F2SA 4QZEA 4ECRA 2F77X 2R8KA 3TADA 3PNCA 4KN4A 2ASDA 4K4IA 2ISPA 2JZBA 4O3MA 3MABA 1ZXIA 2HBLA 1S77D 4YXJA 1COOA 2YB4A 2OCEA 5D4BA 3WKBA 4J9RA 4BDPA 4CF4A 1Z1BA 2UVRA 2HHXA 2RLTA 4PHAA 4I2AA 1SZHA 3EWAA 4CDGA 2HVHA 3HX0A 5KFHA 3KKAA 4LZGA 4UB1A 1QQ7A 7ICKA 1ZQYA 3ZD9A 1L6NA 2YN4A 4B9TA 4IC9A 4B9VA 2NV3A 3MDCA 4QJFB 2EZYA 3IG5A 1TK0A 4DWIA 3K4GA 4F5OA 4BWMA 3LK9A 4Y2PA 2XCPA 2YMLA 9ICOA 2RDIA 1ZD4A 3PVXA 1PK1B 1ZD2P 4GXJA 2MRLA 4O3RA 1KDHA 5J2HA 2AHOB 5AKEA 1L3SA 4NLKA 2KTQA 3G6YA 2RRDA 2ISOA 3TFSA 1O08A 3IHQB 4IS7A 1JMSA 3QX7A 4TUSA 4R64A 4F5RA 5KFIA 5KFLA 2GLEA 1SWVA 4RT2A 2ZIXA 2W7OA 1S5LU 2J6UA 2ZJ8A 1S0MA 3PW7A 3PMLA 2G0AA 2B6GA 1JRPA 2K60A 4OJ6A 1BPYA 1TV9A 3GFKB 1X6JA 4MFCA 3BJYA 5DQIA 4F4XA 3KZIU 1A77A 4ECZA 9ICBA 2ZIWB 2W11A 2PMZC 5CEHA 9ICQA 4IL6U 1QLNA 4Y2UA 1ZQJA 1CUKA 1UPHA 3C2KA 5AKYA 4J9LA 3RJGA 3RF9A 2KJ9A 2WF9A 4PGXA 4CGZA 5KFOA 3H0MB 1OUQA 5KG4A 2HVIA 3F2CA 4QZDA 2W7PA 4KLUA 3NVYA 2ZIWA 4DF8A 3J81j 2F8LA 5AK3A 4JB3A 1IM4A 3Q8SB 1SV4A 2C22A 3BS5B 1WWUA 4M9HA 1GO3F 4M9LA 8ICAA 1J2NA 2XY6A 1ZQTA 1RPLA 2KKPA 4Q45A 3K1RB 3O0FA 3PY8A 3AU6A 3MR6A 5AM1A 5C5JA 1IV8A 4YCXA 1F5SA 4DO9A 3IRUA 3RJJA 3TKAA 1DGJA 1RYUA 3N4MB 3DEEA 3FYHA 4YMOA 1IG6A 1L8OA 3N7PD 5ALUA 1KW4A 4DOBA 3TQ1A 8ICJA 2KSOA 2VANA 3RR8A 2HHUA 4ECYA 5KFUA 4KLTA 4ECXA 3G6VA 4U6PA 1VLBA 4ECQA 4BXOB 2AH5A 4IR1A 3JPTA 4OJ5A 2FPKA 1ZOLA 4TUPA 5L1JA 2KHVA 5KFYA 5EWGA 1SV0A 3FC4A 4O3QA 2GO7A 4R8UB 4RQ7A 4DOAA 3CNHA 5KFRA 1ZQNA 2BCQA 3WK5A 3OSPA 4NM1A 1Z4NA 3V6KA 5L1KA 4UAZA 3GZFA 1L7PA 9ICHA 5J2EA 3EPGA 3RJKA 5J2AA 3N7SC 4F5QA 1T4GA 2K8BB 1LVHA 5AKGA 5AKHA 2W43A 5ALZA 3D2NA 2EANA 4BUGA 3WU2U 5IIOA 4YP3A 2EAMA 2VA8A 2K4EA 4UB3A 4P0PA 1RYSA 1F0MA 3GDXA 3C23A 2F1IA 3TFRA 5D46A 3PSPA 4UQGA 3AEVA 4F8RA 4I29A 3EZ5A 1F44A 2W8KA 1Z00A 1TVAA 5JRTA 2JZBB 2XGQA 5ALGA 4FO6A 5ALRA 4LVSA 4QZ9A 4UB5A 5T14A 4GLXA 2H3ZA 1X2IA 1ZQWA 2HHWA 2LYAA 5KFAA 1CEZA 3AQEA 4ECUA 2JHDA 4O3SA 2LMRA 1HUOA 3MBYA 5KT5A 4B9SA 4JV1A 3EUB2 3NASA 4QNLA 1M6YA 4JV0A 4RQ5A 1Z00B 9ICUA 1SL0A 2WB1C 4PZOA 5GTIU 4B9MA 5KFFA 8ICZA 2E3TA 4I2HA 2R18A 3SAFA 2F3NA 2RHFA 3C28A 2WAQF 2PMZF 2W54A 4O3PA 2ZTCA 4RQNA 1PK1A 5KT3A 3GILA 3QUQA 4ECSA 1NNLA 4DL4A 2DPIA 3UQ2A 3T5JA 1XC9A 4YMMA 2HSZA 1N48A 1SIJA 1HUZA 2CXYA 5ALSA 5G5HA 3RR7A 9ICKA 4ECWA 4FS2A 1BPDA 4QZBA 2P6UA 5DDMA 1TFRA 1WG8A 2JEGA 1ZRMA 1PUZA 2W9BB 3SQIA 4IRDA 2I5HA 1SXDA 2E8PA 5L1MA 1B4FA 3ZD8A 3QE9Y 2MA1A 2NYVA 3QU5A 4ECTA 4QW9A 3BZKA 4DSKA 4OJLA 2WF8A 3C1ZA 1NZBA 2YX8A 3ETLA 3PW0A 3OHBA 1OW5A 3M6ZA 2W9BA 2ZUCA 3PW4A 5ALLA 2Q4TA 2DF4B 5AI9A 4QWBA 2Y1IA 2MUTB 5ALXA 1ZQZA 4ECVA 3I1YA 2YMMA 1X6IA 1KQQA 5DKWA 5HNKA 2VIXA 4JWMA 4EEKA 7ICHA 2ZTDA 4QIWC 1P7DA 2M9NA 3RAQA 3TARA 4MEXA 4KMOB 1JXEA 5B66U 4F92B 5KFGA 8ICTA 2R8HA 4RPZA 8ICFA 3F2DA 2C28A 1NKEA 5AK6A 1QQ5A 1NOMA 5DG9A 3SYZA 3RBEA 1N5WA 4YFKA 5AK4A 2JH1A 1QSSA 3V7LA 1UT5A 4M0AA 3HKZC 4RQ0A 1IXRA 5CB1A 2Z7JA 3M6KA 3QU4A 4I2EA 3ZDBA 2OH2A 9ICMA 1TAMA 1QSYA 1K5OA 3AMZA 4GXIA 3SI8A 2CPRA 3H8JA 5KG0A 2EDUA 4I2BA 3UXNA 2UVVA 1NJYA 5J2JA 4YQWA 3RJIA 4O3NA 2WF6A 5DBCA 4QWEA 2A19A 3E58A 1N5XA 4NLBA 2JEJA 8ICOA 1ZQPA 2PFOA 4F93B 1X9XA 4M9GA 3HKZF 4O5CA 4B9LA 5J2KA 1LKYA 3RRHA 3MC1A 3DV9A 2W3SA 4DOCA 4DS5A 1U9LA 5E79U 1DK3A 5J2BA 4DFDA 4QWCA 4RPYA 3UMGA 4LZDA 1WUDA 2HBKA 8ICLA 4C8LA 3PSTA 4HYKA 2PI5A 5J0RA 4BXOA 2C2RA 3BDPA 9ICFA 3NVZA 2BCRA 5ALQA 4ZOHC 1KTQA 5IIJA 3V6JA 7ICEA 1KEJA 2BHNA 2D6FC 2P35A 4BX9C 1KKXA 4C4RA 4FFDA 2I6XA 4KMUA 1BPZA 5KFMA 1NK7A 5KFEA 2W03A 4RT3A 4OD0A 4UAVA 3FM9A 2KK0A 4TUQA 1SGGA 2ODGA 5DB6A 1Q8KA 4XUSA 1UHUA 1BPBA 4UB2A 3ZDDA 4KLQA 3AQFA 1NK0A 2ESEA 2F2AB 3JPPA 1X42A 3KHGA 1L7MA 5DB9A 4M2YA 1ZQQA 1UA0A 2HHSA 2KVSA 3NRWA 3SZ2A 2BPCA 2G06A 4Y2VA 2W9CA 4RPXA 2D3DA 4DL6A 4UB6U 9ICNA 5J0QA 5CWRA 3DDHA 5J29A 4QZ8A 2QKQA 2NRXA 1HJPA 2HHQA 3WK9A 4UARA 2NRWA 4MEYA 2XCAA 2I1QA 1D8BA 2BKEA 4LJXA 1X40A 1CI4A 1Q46A 4Y2JA 5F9LA 1ZQKA 3OGUA 1Z1VA 1X9WA 3ORYA
chains in the Genus database with same CATH topology
2LHTA 3M6ZA 1F44A 2ZIXA 2W7OA 1MA7A 4A8EA 4PL1A 1WUDA 2E1FA 2ZIUB 2Q4TA 2DF4B 1ED1A 2HBKA 2WAQC 3DEEA 2G0AA 3IG8A 4AYBC 2KD1A 2G07A 3PSIA 3D2SA 2ZIXB 2ZXHA 3IP4B 1Z19A 4WJ3B 3PSTA 2YB1A 4FZMA 2W04A 3N7PD 4KX3A 5T14A 2H3ZA 4OJ6A 2KICA 3F5EA 3LYSA 3PZPA 5CRXA 2BDUA 1YT3A 2LYAA 1URJA 3C29A 1PVQA 3AQEA 2JHDA 4OJOA 1HIWA 3CRXA 2D6FC 2Y0SF 2KOBA 3VCBA 2VIXA 4P0QB 4BX9C 2XVTA 2HOQA 2KVCA 2Y0SC 2ZIWB 1IIPA 2F77X 3L3FX 2PMZC 2ZXIA 3AL0B 5C0YA 3H0RB 2ZIVB 2H3FA 4QNLA 4QIWC 2OXOA 1XNSA 3N7RC 2M0NA 2DQNB 1P7DA 4O3MA 5HR7A 2K4HA 1UPHA 2KEYA 2W03A 3D2QA 2CN1A 4KMOB 2HBLA 3RF9A 4U6PA 2KJ9A 2DGZA 2H3QA 3F53A 2YB4A 4QIWF 1KBUA 1HEKA 4CGZA 3MGVA 2WB1C 2E1EA 3CYMA 3H0MB 2G09A 1Q3UA 4OO1J 4OJ5A 1PVPA 2H3VA 2LKYA 1Z1BA 2HOIA 3F2DA 3T79A 2N1RA 1OUQA 2R18A 3SAFA 4P0PB 2A3VA 1A0PA 1SZHA 2KHVA 2VJ5A 5KL8B 2GOLA 2RHFA 4GFJA 2HBJA 2WAQF 4PL2A 4AYBF 4CDGA 3AQFA 2PMZF 4FZLA 3C28A 3F2CA 2W7PA 2LYBA 3RFAA 3SAGA 2F2AB 4P0QA 2HBMA 2JH1A 2F76X 2ZIWA 2K89A 1Q3VA 2OM6A 2VJ4A 2ZIUA 4JMUA 3ALRA 4CRXA 3KFUF 2K4IA 2E5SA 3ICXA 2F8LA 3KZXA 1L6NA 2KV2A 5HR6A 4NLCA 4U7CA 3PSFA 4IC9A 3HKZC 3GZFA 4NV0A 3M7DA 2NV3A 2Z7JA 3NRWA 1PVRA 2OYYA 3NUQA 1GO3F 3M6KA 2KNJA 2G06A 4QJFB 4ACOA 3OPXA 1ECWA 3K1ZA 3F5AA 4FZNA 3IG5A 3SMVA 2OH2A 3E0FA 3SQIA 3IN5A 1TAMA 1CRXA 2HMXA 2RP5A 2KKVA 2VKQA 2ZIVA 4NWIA 2G08A 2KJ8A 4ICAA 3GU3A 4C0ZA 2KIWA 3N7SC 2KKPA 3VC8A 2CPRA 5KL1B 1A6SA 2K8BB 2MRLA 2XIDA 2JGAA 2K8CB 4OJPA 1D8BA 1XO0A 3O0FA 1DRGA 4NLBA 3D2NA 4BJQA 2H3IA 2KJ5A 2RRDA 4BUGA 2CRXA 2K8AA 2JMGA 2MA1A 2XICA 2K4EA 3HKZF 3CP8A 3LVVA 2ZG6A 2HOFA 4P0PA 4FE3A 3H0LB 4OJLA 2GH1A 3F2BA 2KHQA 2XI9A 5A0LA 3SAHA 2LBOA 1NZBA 1T94A 2G5HB 2WB1F 2YX8A 3LVWA 4KX5A 2G5IB 3PSPA 1ZQ1C 3ONNA 2JH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0Q A;  2ZIV B;  2ZIX A;  2ZIX B;  2ZIW A;  4P0Q B;  2ZIU A;  4P0P A;  2ZIW B;  2ZIU B;  2ZIV A;  4P0P B; 
#chains in the Genus database with same CATH topology
 1MA7 A;  5CP2 A;  4Y2X A;  2ZIU B;  1XNS A;  3PSI A;  2A1J A;  3IP4 B;  2NO4 A;  4R66 A;  1N2X A;  1XSL A;  1ZQA A;  3C29 A;  1RZT A;  3OJS A;  1HIW A;  4QZH A;  2KOB A;  5AM4 A;  5KFJ A;  2Y0S C;  4R65 A;  4PHD A;  3L3F X;  1K1S A;  3Q8L A;  9ICI A;  1Y88 A;  5KFQ A;  3N7R C;  9ICS A;  2KEY A;  4EX6 A;  2DL0 A;  4YR3 A;  4ED1 A;  1V85 A;  2DGZ A;  4PHE A;  1WCN A;  3M1Y A;  4QIW F;  4JK1 A;  8ICP A;  2A1J B;  1SKS A;  4OO1 J;  2C2E A;  4RQ2 A;  5L1I A;  4RNO A;  4DSE A;  2A3V A;  4Q43 A;  2XO7 A;  5KT4 A;  2L5Y A;  4TUR A;  2LYB A;  3SAG A;  5J0Y A;  3N97 B;  2HBM A;  2KN7 A;  4CRX A;  2K4I A;  2F1H A;  3KOO A;  3RB3 A;  4RQ4 A;  4DFP A;  3WK8 A;  4O0I A;  4MFA A;  3RJE A;  3NS1 A;  3L4P A;  2HHV A;  4O9M A;  4KN7 A;  4TQR A;  3QUC A;  4YD2 A;  1S97 A;  7ICR A;  4QWD A;  3KHR A;  5ALJ A;  3EPI A;  2BZF A;  3PMN A;  2E8N A;  4C7Y A;  4J9P A;  3V72 A;  3SMV A;  2HMX A;  3L5K A;  3QU7 A;  4Z6F A;  4NLG A;  4KLH A;  1N63 A;  3SV3 A;  1ZQI A;  7ICL A;  1QTM A;  4EYI B;  4NM2 A;  4Y2T A;  2WTF A;  5KFX A;  3MFI A;  3ISB A;  4KLO A;  1NK6 A;  1XSN A;  4K4H A;  8ICS A;  1BGX T;  4K4G A;  2HOF A;  3RRG A;  3K75 D;  2XI9 A;  2PFP A;  3MR3 A;  2LBO A;  1NK5 A;  3RB4 A;  5ALK A;  2LM4 A;  2G5I B;  3SAH A;  4A8E A;  2A1A A;  1KFS A;  3RB0 A;  3H40 A;  5KG6 A;  5J0O A;  2G07 A;  2W55 A;  4MHV A;  4OCZ A;  4UAY A;  3B9J A;  2AXT U;  4ED0 A;  5KAI U;  5KFK A;  4BGD A;  7ICI A;  1N62 A;  5J0W A;  2HOQ A;  3LWL A;  3V6H A;  1FEZ A;  1ZQC A;  2QB0 B;  3H0R B;  7ICS A;  1ZJM A;  1SXE A;  5K4L A;  4RZR A;  7ICN A;  4C8O A;  2JXJ A;  2FJ6 A;  3TAP A;  2NRT A;  3T5L A;  2HW3 A;  3CYM A;  3UQ0 A;  1QCK A;  1JXL A;  1S9F A;  2AGQ A;  4F4Y A;  5HR7 A;  5AI0 A;  1LV5 A;  4FZL A;  4G3I A;  3ZI4 A;  2AGP A;  5KNI A;  3NVV A;  2AU0 A;  3KBB A;  5KFB A;  4EBD A;  1J2M A;  3TI0 A;  3PSF A;  5ALI A;  5ALP A;  1U47 A;  4M6W B;  1PVR A;  3GV8 B;  2KP7 A;  4IR9 A;  2EZX A;  5CHG A;  1ZYQ A;  1QSL A;  1XS9 D;  2KKV A;  2LI6 A;  4P4M A;  3GU3 A;  4ELV A;  4YXM A;  1RQN A;  3KKA C;  3V7J A;  2MSN A;  3T5H A;  4YR2 A;  1A6S A;  3HWT A;  1BPX A;  4C8K A;  5DLF A;  3BQ1 A;  1YZ6 A;  1XO0 A;  1K1Q A;  4G9B A;  5AK5 A;  4BJQ A;  2H3I A;  2NRZ A;  2RDJ A;  4DSF A;  2HHT A;  4UW9 A;  5J0P A;  4NL9 C;  4CNQ A;  2G5H B;  1S0V A;  1ZQ1 C;  3Q8Q B;  1NK4 A;  1KL9 A;  2Y9T A;  4QZI A;  3KD3 A;  4QW8 A;  2JR5 A;  2ZIX B;  1LB2 B;  4I2G A;  1KLN A;  1URJ A;  7ICV A;  1PVQ A;  4QZA A;  1S0O A;  3H8S A;  5BPC A;  4UB8 U;  1L5U A;  4UBB A;  5ALO A;  3AL0 B;  1RXV A;  4YR0 A;  1JX4 A;  2OXO A;  3PR5 B;  3GV5 B;  1XO1 A;  4Y2R A;  1TK5 A;  1ZQD A;  4UAS A;  3MGV A;  1L3U A;  2BCS A;  2G09 A;  8ICN A;  2W9C B;  1MQ3 A;  2N1R A;  3ETR A;  5DGB A;  1MC8 A;  3WKD A;  3JPS A;  2OWO A;  2QAR B;  4B6J A;  4RQ1 A;  2E8M A;  4ELU A;  4I2C A;  3BQ0 A;  4RUC A;  4DQS A;  3WKE A;  4NV0 A;  3TAD C;  1MSW D;  3TAN A;  3OPX A;  4UB4 A;  4J03 A;  2OEH A;  4MFF A;  2E8O A;  3MGI A;  3N28 A;  2WHE A;  3SEN A;  2XID A;  1JN3 A;  2YY6 A;  1ZQL A;  4DQP A;  3WK7 A;  4JWN A;  2KJ5 A;  5DLG A;  8ICY A;  4RU9 A;  8ICE A;  3Q8K A;  3EW9 A;  3LWM A;  1V97 A;  5G5G A;  4KLJ A;  3H8W A;  1SV0 C;  4R8U A;  1ZQF A;  4DFM A;  5AKK A;  3KTQ A;  4IRC A;  2ZJ5 A;  2E1F A;  1S76 D;  5AIB A;  3MFH A;  2KFZ A;  1WCL A;  2ZXH A;  2BPF A;  7ICM A;  5CR0 A;  4DFJ A;  4F4Z A;  3PZP A;  5CRX A;  3QU9 A;  4F3O A;  1JUD A;  8ICC A;  2BDP A;  2KSO B;  5HMM A;  1ZJN A;  3BS7 A;  1KFD A;  5C0Y A;  2ZIV B;  3RJH A;  2PFN A;  3RJF A;  4NLZ A;  3JPO A;  2DQN B;  3ISD A;  2K4H A;  3D2Q A;  4CF3 A;  3MGH A;  4DEZ A;  3F53 A;  2ALZ A;  1JI7 A;  4DCC A;  1KBU A;  4F71 A;  5IIK A;  1PVP A;  4PGQ A;  4I2I A;  1D8L A;  2VJ5 A;  4O3O A;  4GFJ A;  4M04 A;  3RFA A;  1MQ2 A;  2FLN A;  5JTI A;  1VDV A;  2IOH A;  2ZTE A;  4US8 A;  3KFU F;  1TK8 A;  4DSL A;  3QZ7 A;  1ZQS A;  2LYH A;  4F50 A;  4ED2 A;  1X9S A;  3KHL A;  5J2I A;  3M7D A;  3SR6 A;  3NUQ A;  4KLI A;  2KFN A;  1ZQV A;  4I2D A;  5EE3 A;  4PHP A;  1ZD3 A;  4KLD A;  2VKQ A;  1PK3 A;  1SL2 A;  4P2H A;  4PPX A;  2KIW A;  3QU2 A;  4KLM A;  5KL1 B;  3R9K A;  4DSJ A;  2BQR A;  1N61 A;  1TE2 A;  1QQ6 A;  3Q8R B;  2K8A A;  1H38 A;  1L8L A;  5AI8 A;  3BQ2 A;  3H0L B;  4UAT A;  4ED8 A;  4RQ8 A;  3ED5 A;  4IQW A;  1T94 A;  2WB1 F;  1S0N A;  3OSN A;  5HHH A;  1ZQG A;  2LHT A;  2QB0 A;  1SL1 A;  4M47 A;  3UMC A;  2KE7 A;  4KLS A;  2WAQ C;  4PH5 A;  2KD1 A;  5IIM A;  3QNM A;  4RUA A;  3OTQ A;  2YB1 A;  1XWL A;  2KIC A;  1T7P A;  4Y2Y A;  3HT3 A;  5DG8 A;  4YD1 A;  3C5F A;  3QXG A;  3CRX A;  3RH6 A;  3IM1 A;  2KZZ A;  5AI6 A;  4DSI A;  3SV4 A;  1IIP A;  4F5N A;  2D8C A;  4AP9 A;  4Y2S A;  2YMP A;  2F8K A;  4PJ0 U;  2FPL A;  4EEN A;  2PFQ A;  2PKE A;  4O5K A;  5ALD A;  3RAX A;  3NGD A;  3V7K A;  5KG1 A;  3GIM A;  5KFZ A;  7ICJ A;  1BPE A;  4DL3 A;  1BNP A;  4CCH A;  2QB1 A;  5J2G A;  1FFV A;  3GIK A;  4QWA A;  4P4O A;  1RM6 C;  4DL2 A;  4ELT A;  4RQ3 A;  2DKX A;  3LDA A;  5EE9 A;  2OM6 A;  1DXS A;  2FMS A;  1C7Y A;  3BS5 A;  4EBE A;  5ALH A;  2MUT A;  3AUO A;  5J0X A;  2BCU A;  5IIL A;  5ALW A;  2IMW P;  5AKZ A;  4Q8F A;  5CA7 A;  3TAC B;  2F1J A;  4FZN A;  3E0F A;  3OHA A;  4NWI A;  2G08 A;  3QYP A;  4DQQ A;  1YZ7 A;  1DRG A;  3NVW A;  1EXN A;  2WF7 A;  4DQI A;  2Y1J A;  4J9K A;  9ICJ A;  4C80 A;  3RB6 A;  4R63 A;  3QEA Z;  3CP8 A;  4RNN A;  3M8R A;  4FBT A;  5KFP A;  4QZF A;  2LPE A;  4C8M A;  4F5P A;  1NJW A;  7ICU A;  4F72 A;  5KG5 A;  2KIV A;  1ZQB A;  4PL1 A;  1D9D A;  1T8E A;  2RQ5 A;  2V4R A;  3M9N B;  2R8I A;  4GXK A;  4CF5 A;  1Z19 A;  1S8O A;  2DWQ A;  2W04 A;  5AIA A;  1SZP A;  3FAH A;  3LYS A;  2BQ3 A;  2BDU A;  4Q44 A;  2FI1 A;  2W9M A;  8ICQ A;  1X9M A;  2KVC A;  4Z6E A;  1QH9 A;  2QAR A;  4QZG A;  9ICL A;  2H3F A;  4NY8 A;  4EBC A;  2DBY A;  2CN1 A;  2YQE A;  2IHM A;  2KZ3 A;  1BVS A;  2E1E A;  5AKL A;  5EE0 A;  1Q3U A;  3H7I A;  3JPN A;  2UVU A;  3PX6 A;  1U45 A;  1SB3 C;  3T79 A;  1A0P A;  5KL8 B;  2J6S A;  2Q0Z X;  2FMP A;  2EAO A;  3B0X A;  4DL5 A;  2ASL A;  3D6J A;  4JUZ A;  5HP4 A;  3WKC A;  2E5S A;  5KAF U;  4NLN A;  4EEY A;  3GV7 B;  4PGY A;  3PX4 A;  2IOF K;  3AU2 A;  5KFD A;  3B0Y A;  3E2E A;  2OHF A;  3IN5 A;  4Z6C A;  1CRX A;  5EWE A;  5J8Y A;  3VC8 A;  5HHI A;  8ICK A;  5CJ7 A;  1XSP A;  2V4Q A;  5IIN A;  4UBC A;  5F3X B;  2JEF A;  3HRD D;  3C2M A;  7ICF A;  4MF8 A;  2YMQ A;  4KLF A;  4ED6 A;  5III A;  2XIC A;  1COK A;  4M9J A;  1ZQH A;  4FE3 A;  4B9U A;  4TQS A;  1FFU A;  3G6X A;  2W8L A;  2VA3 A;  4C4T A;  4DLE A;  2FLP A;  4AYB C;  3IG8 A;  4UAU A;  3D2S A;  5EE1 A;  5ALY A;  4KX3 A;  4F4W A;  3PO5 A;  3H4D A;  9ICT A;  3PW5 A;  3C21 A;  4P0Q B;  2XVT A;  5TIS U;  5KFN A;  5J2D A;  4C4S A;  2XY7 A;  3I76 A;  4F2R A;  1MN8 A;  4J9Q A;  1ZQR A;  3JPQ A;  9ICC A;  3BZC A;  5TZV A;  3PR4 A;  3MR2 A;  3T5K A;  4EEL A;  2K4P A;  2H3V A;  3RH5 A;  3HJE A;  5GTH U;  9ICP A;  4P0P B;  3WK6 A;  3MR5 A;  2GOL A;  5AM2 A;  1ZET A;  2B0C A;  2WFA A;  1NZP A;  4P0Q A;  2F76 X;  4XQ8 A;  2AQ0 A;  3ZDC A;  1KSP A;  2ZIU A;  4DF4 A;  3H4B A;  3ALR A;  2EQY A;  1JAL A;  5AM5 A;  1JIH A;  1UCV A;  1U48 A;  1WWV A;  1ZD5 A;  1RG6 A;  5EWF A;  2OYY A;  2DUY A;  4GC6 A;  4J9M A;  1FO4 A;  2PI4 A;  1SKR A;  4ICA A;  3A0H U;  4C0Z A;  5FP0 A;  4RQM A;  7ICT A;  2IA6 A;  3C2L A;  2KG5 A;  3HW8 A;  1SKW A;  2JGA A;  4GIB A;  8ICU A;  1RDF A;  5DB8 A;  5J0T A;  5KFT A;  3T3F A;  1BNO A;  4J9S A;  3F2B A;  2UVW A;  3ISC A;  2KHQ A;  2W3R A;  3LVW A;  1ARO P;  4HAI A;  4O5E A;  2XGP A;  1ZRN A;  1PZN A;  2WF5 A;  2ZUD A;  3HIL A;  8ICM A;  4F4K A;  5KFV A;  1NI3 A;  2IOF A;  2QLT A;  4FZM A;  4DFK A;  1U49 A;  1NJX A;  3F5E A;  4EZ9 A;  1YT3 A;  5H2F U;  4FS1 A;  5KTQ A;  4US9 A;  2LM1 A;  8ICG A;  4I2F A;  5AIC A;  4I27 A;  3UXO A;  2BCV A;  5DB7 A;  2M0N A;  1UQV A;  4XA5 A;  4YMN A;  5AHX A;  5KFW A;  4ED7 A;  1T3N A;  2H3Q A;  4I28 A;  4NL9 A;  1HEK A;  3M9M B;  5KG2 A;  3KHH A;  4FBU A;  3SEI A;  1A76 A;  2LKY A;  9ICX A;  1TAU A;  4B9N A;  3GIJ A;  1TKD A;  4C7Z A;  4PL2 A;  2HBJ A;  4AYB F;  5L1L A;  4Q8E A;  2HCF A;  4ZH4 A;  2ATL A;  3ZDA A;  1L3V A;  1V38 A;  4GC7 A;  3C5G A;  1D8Y A;  2K89 A;  2FE9 A;  2VJ4 A;  3KZX A;  3A0B U;  4EX7 A;  5AKI A;  2BGW A;  2KV2 A;  5KFS A;  5ALT A;  3BQ7 A;  5KT6 A;  2GWS A;  5D49 A;  3RH4 A;  1ECW A;  2HI0 A;  5AI4 A;  4YG2 A;  1ZQE A;  5KFC A;  2RP5 A;  4MF2 A;  2VA2 A;  1S10 A;  3QUT A;  8ICW A;  1RXW A;  2AQ4 A;  4EYH B;  3M8S A;  1L7N A;  2JRZ A;  3H8M A;  5AKJ A;  2AJQ A;  1U4B A;  8ICB A;  3PW2 A;  1LKY B;  3WKA A;  3LVV A;  2ZG6 A;  2ES6 A;  5J0U A;  2KMD A;  2YTU A;  5A0L A;  1N56 A;  2P66 A;  1ZQX A;  4KX5 A;  1DGS A;  2ZJA A;  2Y9U A;  1DOQ A;  4DLG A;  4E0D A;  4X5V A;  5KT2 A;  4KLG A;  3PX0 A;  1N60 A;  1O03 A;  5DGA A;  1ED1 A;  5JUM A;  3S6J A;  9ICA A;  3IV6 A;  4WJ3 B;  3HPO A;  4Y2Q A;  9ICE A;  1ZQM A;  4Z6D A;  4KTQ A;  7ICQ A;  3BQT A;  2Y0S F;  3PV8 A;  4JV2 A;  3C1Y A;  2R8G A;  1NK9 A;  4KLE A;  2J6T A;  5ALE A;  2HDO A;  4UAW A;  2JEI A;  5EOZ A;  2H5X A;  4PZN A;  3NTU A;  5AI5 A;  4J9O A;  1V9P A;  5DDY A;  4I2J A;  1AQ6 A;  3CW2 C;  2MU2 A;  3UM9 A;  5DBA A;  1J97 A;  1Z4O A;  3OJU A;  3QZ8 A;  1KRP A;  9ICG A;  1Z3E B;  4RNM A;  2JV3 A;  2NRV A;  8ICV A;  4C8N A;  1NJZ A;  2DKZ A;  2IHN A;  5B5E U;  3Q8P B;  2IBK A;  3EYZ A;  2KNJ A;  5DBB A;  4YN4 A;  3K1Z A;  3F5A A;  4M6W A;  5HML A;  2C2D A;  3ZDE A;  7ICP A;  1D9F A;  2KJ8 A;  2MAX A;  7ICO A;  4IQT A;  5DG7 A;  2R8J A;  4NJ8 A;  4KLL A;  2F44 A;  3I28 A;  4XRH A;  1KFT A;  3QEB Z;  2BR0 A;  4ED3 A;  8ICH A;  2BQU A;  3IDW A;  2XY5 A;  2V9W A;  5JU5 A;  1X66 A;  5BOM A;  2P6R A;  1FIQ A;  3Q8M A;  2DPJ A;  2JH7 A;  2EAP A;  5KG7 A;  5KT7 A;  1UA1 A;  4DS4 A;  3UPQ A;  4QZC A;  3HP6 A;  4CE6 A;  5J0S A;  9ICW A;  3QUB A;  5BOL A;  3RTV A;  2FPM A;  1B43 A;  3PO4 A;  4OJO A;  5ALV A;  3VCB A;  1RQL A;  4DL7 A;  3THV A;  1C20 A;  2ZXI A;  4NXZ A;  2DFL A;  1NKC A;  2FMQ A;  3SD7 A;  1SWW A;  5ALM A;  7ICG A;  2FLL A;  3AM9 A;  9ICR A;  4KIT B;  3UMB A;  2EH9 A;  5KG3 A;  2AGO A;  3NRZ A;  1L7O A;  4F91 B;  2HOI A;  5J2F A;  8ICR A;  2BPG A;  1L3T A;  2ASJ A;  3M9O B;  4BWJ A;  1NKB A;  2O6K A;  1DK2 A;  1UT8 A;  1Q3V A;  4JMU A;  3ICX A;  3WK4 A;  5ALN A;  5HR6 A;  4NLC A;  4U7C A;  4M9N A;  9ICV A;  5J2C A;  4P4P A;  2I9G A;  4IQV A;  2FDR A;  4ACO A;  4IQU A;  5AM0 A;  4IRK A;  1B22 A;  3JPR A;  1T3Q A;  5AKX A;  2KZM A;  2ZIV A;  1OXJ A;  2ZUB A;  4USA A;  3GII A;  1ZQU A;  3GQC A;  2K8C B;  3TAQ A;  4OJP A;  8ICX A;  2PXI A;  4J9N A;  2B21 A;  3AN1 A;  4RQ6 A;  2CRX A;  1NK8 A;  4DQR A;  2JMG A;  2NO5 A;  4EZ6 A;  1B0X A;  2GH1 A;  1XU4 A;  8ICI A;  5AM3 A;  1KN5 A;  5L9X A;  3ONN A;  1JRO A;  1WYG A;  2W9A A;  2XC9 A;  1TAQ A;  3FDS A;  1VJ5 A;  3U26 A;  5ALF A;  5F9N A;  2EZZ A;  4YVZ A;  1ZQO A;  3MDA A;  3RBD A;  1RYR A;  5DQH A;  5J8Y C;  5DQG A;  3UXP A;  4F2S A;  4QZE A;  4ECR A;  2F77 X;  2R8K A;  3TAD A;  3PNC A;  4KN4 A;  2ASD A;  4K4I A;  2ISP A;  2JZB A;  4O3M A;  3MAB A;  1ZXI A;  2HBL A;  1S77 D;  4YXJ A;  1COO A;  2YB4 A;  2OCE A;  5D4B A;  3WKB A;  4J9R A;  4BDP A;  4CF4 A;  1Z1B A;  2UVR A;  2HHX A;  2RLT A;  4PHA A;  4I2A A;  1SZH A;  3EWA A;  4CDG A;  2HVH A;  3HX0 A;  5KFH A;  3KKA A;  4LZG A;  4UB1 A;  1QQ7 A;  7ICK A;  1ZQY A;  3ZD9 A;  1L6N A;  2YN4 A;  4B9T A;  4IC9 A;  4B9V A;  2NV3 A;  3MDC A;  4QJF B;  2EZY A;  3IG5 A;  1TK0 A;  4DWI A;  3K4G A;  4F5O A;  4BWM A;  3LK9 A;  4Y2P A;  2XCP A;  2YML A;  9ICO A;  2RDI A;  1ZD4 A;  3PVX A;  1PK1 B;  1ZD2 P;  4GXJ A;  2MRL A;  4O3R A;  1KDH A;  5J2H A;  2AHO B;  5AKE A;  1L3S A;  4NLK A;  2KTQ A;  3G6Y A;  2RRD A;  2ISO A;  3TFS A;  1O08 A;  3IHQ B;  4IS7 A;  1JMS A;  3QX7 A;  4TUS A;  4R64 A;  4F5R A;  5KFI A;  5KFL A;  2GLE A;  1SWV A;  4RT2 A;  2ZIX A;  2W7O A;  1S5L U;  2J6U A;  2ZJ8 A;  1S0M A;  3PW7 A;  3PML A;  2G0A A;  2B6G A;  1JRP A;  2K60 A;  4OJ6 A;  1BPY A;  1TV9 A;  3GFK B;  1X6J A;  4MFC A;  3BJY A;  5DQI A;  4F4X A;  3KZI U;  1A77 A;  4ECZ A;  9ICB A;  2ZIW B;  2W11 A;  2PMZ C;  5CEH A;  9ICQ A;  4IL6 U;  1QLN A;  4Y2U A;  1ZQJ A;  1CUK A;  1UPH A;  3C2K A;  5AKY A;  4J9L A;  3RJG A;  3RF9 A;  2KJ9 A;  2WF9 A;  4PGX A;  4CGZ A;  5KFO A;  3H0M B;  1OUQ A;  5KG4 A;  2HVI A;  3F2C A;  4QZD A;  2W7P A;  4KLU A;  3NVY A;  2ZIW A;  4DF8 A;  3J81 j;  2F8L A;  5AK3 A;  4JB3 A;  1IM4 A;  3Q8S B;  1SV4 A;  2C22 A;  3BS5 B;  1WWU A;  4M9H A;  1GO3 F;  4M9L A;  8ICA A;  1J2N A;  2XY6 A;  1ZQT A;  1RPL A;  2KKP A;  4Q45 A;  3K1R B;  3O0F A;  3PY8 A;  3AU6 A;  3MR6 A;  5AM1 A;  5C5J A;  1IV8 A;  4YCX A;  1F5S A;  4DO9 A;  3IRU A;  3RJJ A;  3TKA A;  1DGJ A;  1RYU A;  3N4M B;  3DEE A;  3FYH A;  4YMO A;  1IG6 A;  1L8O A;  3N7P D;  5ALU A;  1KW4 A;  4DOB A;  3TQ1 A;  8ICJ A;  2KSO A;  2VAN A;  3RR8 A;  2HHU A;  4ECY A;  5KFU A;  4KLT A;  4ECX A;  3G6V A;  4U6P A;  1VLB A;  4ECQ A;  4BXO B;  2AH5 A;  4IR1 A;  3JPT A;  4OJ5 A;  2FPK A;  1ZOL A;  4TUP A;  5L1J A;  2KHV A;  5KFY A;  5EWG A;  1SV0 A;  3FC4 A;  4O3Q A;  2GO7 A;  4R8U B;  4RQ7 A;  4DOA A;  3CNH A;  5KFR A;  1ZQN A;  2BCQ A;  3WK5 A;  3OSP A;  4NM1 A;  1Z4N A;  3V6K A;  5L1K A;  4UAZ A;  3GZF A;  1L7P A;  9ICH A;  5J2E A;  3EPG A;  3RJK A;  5J2A A;  3N7S C;  4F5Q A;  1T4G A;  2K8B B;  1LVH A;  5AKG A;  5AKH A;  2W43 A;  5ALZ A;  3D2N A;  2EAN A;  4BUG A;  3WU2 U;  5IIO A;  4YP3 A;  2EAM A;  2VA8 A;  2K4E A;  4UB3 A;  4P0P A;  1RYS A;  1F0M A;  3GDX A;  3C23 A;  2F1I A;  3TFR A;  5D46 A;  3PSP A;  4UQG A;  3AEV A;  4F8R A;  4I29 A;  3EZ5 A;  1F44 A;  2W8K A;  1Z00 A;  1TVA A;  5JRT A;  2JZB B;  2XGQ A;  5ALG A;  4FO6 A;  5ALR A;  4LVS A;  4QZ9 A;  4UB5 A;  5T14 A;  4GLX A;  2H3Z A;  1X2I A;  1ZQW A;  2HHW A;  2LYA A;  5KFA A;  1CEZ A;  3AQE A;  4ECU A;  2JHD A;  4O3S A;  2LMR A;  1HUO A;  3MBY A;  5KT5 A;  4B9S A;  4JV1 A;  3EUB 2;  3NAS A;  4QNL A;  1M6Y A;  4JV0 A;  4RQ5 A;  1Z00 B;  9ICU A;  1SL0 A;  2WB1 C;  4PZO A;  5GTI U;  4B9M A;  5KFF A;  8ICZ A;  2E3T A;  4I2H A;  2R18 A;  3SAF A;  2F3N A;  2RHF A;  3C28 A;  2WAQ F;  2PMZ F;  2W54 A;  4O3P A;  2ZTC A;  4RQN A;  1PK1 A;  5KT3 A;  3GIL A;  3QUQ A;  4ECS A;  1NNL A;  4DL4 A;  2DPI A;  3UQ2 A;  3T5J A;  1XC9 A;  4YMM A;  2HSZ A;  1N48 A;  1SIJ A;  1HUZ A;  2CXY A;  5ALS A;  5G5H A;  3RR7 A;  9ICK A;  4ECW A;  4FS2 A;  1BPD A;  4QZB A;  2P6U A;  5DDM A;  1TFR A;  1WG8 A;  2JEG A;  1ZRM A;  1PUZ A;  2W9B B;  3SQI A;  4IRD A;  2I5H A;  1SXD A;  2E8P A;  5L1M A;  1B4F A;  3ZD8 A;  3QE9 Y;  2MA1 A;  2NYV A;  3QU5 A;  4ECT A;  4QW9 A;  3BZK A;  4DSK A;  4OJL A;  2WF8 A;  3C1Z A;  1NZB A;  2YX8 A;  3ETL A;  3PW0 A;  3OHB A;  1OW5 A;  3M6Z A;  2W9B A;  2ZUC A;  3PW4 A;  5ALL A;  2Q4T A;  2DF4 B;  5AI9 A;  4QWB A;  2Y1I A;  2MUT B;  5ALX A;  1ZQZ A;  4ECV A;  3I1Y A;  2YMM A;  1X6I A;  1KQQ A;  5DKW A;  5HNK A;  2VIX A;  4JWM A;  4EEK A;  7ICH A;  2ZTD A;  4QIW C;  1P7D A;  2M9N A;  3RAQ A;  3TAR A;  4MEX A;  4KMO B;  1JXE A;  5B66 U;  4F92 B;  5KFG A;  8ICT A;  2R8H A;  4RPZ A;  8ICF A;  3F2D A;  2C28 A;  1NKE A;  5AK6 A;  1QQ5 A;  1NOM A;  5DG9 A;  3SYZ A;  3RBE A;  1N5W A;  4YFK A;  5AK4 A;  2JH1 A;  1QSS A;  3V7L A;  1UT5 A;  4M0A A;  3HKZ C;  4RQ0 A;  1IXR A;  5CB1 A;  2Z7J A;  3M6K A;  3QU4 A;  4I2E A;  3ZDB A;  2OH2 A;  9ICM A;  1TAM A;  1QSY A;  1K5O A;  3AMZ A;  4GXI A;  3SI8 A;  2CPR A;  3H8J A;  5KG0 A;  2EDU A;  4I2B A;  3UXN A;  2UVV A;  1NJY A;  5J2J A;  4YQW A;  3RJI A;  4O3N A;  2WF6 A;  5DBC A;  4QWE A;  2A19 A;  3E58 A;  1N5X A;  4NLB A;  2JEJ A;  8ICO A;  1ZQP A;  2PFO A;  4F93 B;  1X9X A;  4M9G A;  3HKZ F;  4O5C A;  4B9L A;  5J2K A;  1LKY A;  3RRH A;  3MC1 A;  3DV9 A;  2W3S A;  4DOC A;  4DS5 A;  1U9L A;  5E79 U;  1DK3 A;  5J2B A;  4DFD A;  4QWC A;  4RPY A;  3UMG A;  4LZD A;  1WUD A;  2HBK A;  8ICL A;  4C8L A;  3PST A;  4HYK A;  2PI5 A;  5J0R A;  4BXO A;  2C2R A;  3BDP A;  9ICF A;  3NVZ A;  2BCR A;  5ALQ A;  4ZOH C;  1KTQ A;  5IIJ A;  3V6J A;  7ICE A;  1KEJ A;  2BHN A;  2D6F C;  2P35 A;  4BX9 C;  1KKX A;  4C4R A;  4FFD A;  2I6X A;  4KMU A;  1BPZ A;  5KFM A;  1NK7 A;  5KFE A;  2W03 A;  4RT3 A;  4OD0 A;  4UAV A;  3FM9 A;  2KK0 A;  4TUQ A;  1SGG A;  2ODG A;  5DB6 A;  1Q8K A;  4XUS A;  1UHU A;  1BPB A;  4UB2 A;  3ZDD A;  4KLQ A;  3AQF A;  1NK0 A;  2ESE A;  2F2A B;  3JPP A;  1X42 A;  3KHG A;  1L7M A;  5DB9 A;  4M2Y A;  1ZQQ A;  1UA0 A;  2HHS A;  2KVS A;  3NRW A;  3SZ2 A;  2BPC A;  2G06 A;  4Y2V A;  2W9C A;  4RPX A;  2D3D A;  4DL6 A;  4UB6 U;  9ICN A;  5J0Q A;  5CWR A;  3DDH A;  5J29 A;  4QZ8 A;  2QKQ A;  2NRX A;  1HJP A;  2HHQ A;  3WK9 A;  4UAR A;  2NRW A;  4MEY A;  2XCA A;  2I1Q A;  1D8B A;  2BKE A;  4LJX A;  1X40 A;  1CI4 A;  1Q46 A;  4Y2J A;  5F9L A;  1ZQK A;  3OGU A;  1Z1V A;  1X9W A;  3ORY A; 
#chains in the Genus database with same CATH homology
 2LHT A;  3M6Z A;  1F44 A;  2ZIX A;  2W7O A;  1MA7 A;  4A8E A;  4PL1 A;  1WUD A;  2E1F A;  2ZIU B;  2Q4T A;  2DF4 B;  1ED1 A;  2HBK A;  2WAQ C;  3DEE A;  2G0A A;  3IG8 A;  4AYB C;  2KD1 A;  2G07 A;  3PSI A;  3D2S A;  2ZIX B;  2ZXH A;  3IP4 B;  1Z19 A;  4WJ3 B;  3PST A;  2YB1 A;  4FZM A;  2W04 A;  3N7P D;  4KX3 A;  5T14 A;  2H3Z A;  4OJ6 A;  2KIC A;  3F5E A;  3LYS A;  3PZP A;  5CRX A;  2BDU A;  1YT3 A;  2LYA A;  1URJ A;  3C29 A;  1PVQ A;  3AQE A;  2JHD A;  4OJO A;  1HIW A;  3CRX A;  2D6F C;  2Y0S F;  2KOB A;  3VCB A;  2VIX A;  4P0Q B;  4BX9 C;  2XVT A;  2HOQ A;  2KVC A;  2Y0S C;  2ZIW B;  1IIP A;  2F77 X;  3L3F X;  2PMZ C;  2ZXI A;  3AL0 B;  5C0Y A;  3H0R B;  2ZIV B;  2H3F A;  4QNL A;  4QIW C;  2OXO A;  1XNS A;  3N7R C;  2M0N A;  2DQN B;  1P7D A;  4O3M A;  5HR7 A;  2K4H A;  1UPH A;  2KEY A;  2W03 A;  3D2Q A;  2CN1 A;  4KMO B;  2HBL A;  3RF9 A;  4U6P A;  2KJ9 A;  2DGZ A;  2H3Q A;  3F53 A;  2YB4 A;  4QIW F;  1KBU A;  1HEK A;  4CGZ A;  3MGV A;  2WB1 C;  2E1E A;  3CYM A;  3H0M B;  2G09 A;  1Q3U A;  4OO1 J;  4OJ5 A;  1PVP A;  2H3V A;  2LKY A;  1Z1B A;  2HOI A;  3F2D A;  3T79 A;  2N1R A;  1OUQ A;  2R18 A;  3SAF A;  4P0P B;  2A3V A;  1A0P A;  1SZH A;  2KHV A;  2VJ5 A;  5KL8 B;  2GOL A;  2RHF A;  4GFJ A;  2HBJ A;  2WAQ F;  4PL2 A;  4AYB F;  4CDG A;  3AQF A;  2PMZ F;  4FZL A;  3C28 A;  3F2C A;  2W7P A;  2LYB A;  3RFA A;  3SAG A;  2F2A B;  4P0Q A;  2HBM A;  2JH1 A;  2F76 X;  2ZIW A;  2K89 A;  1Q3V A;  2OM6 A;  2VJ4 A;  2ZIU A;  4JMU A;  3ALR A;  4CRX A;  3KFU F;  2K4I A;  2E5S A;  3ICX A;  2F8L A;  3KZX A;  1L6N A;  2KV2 A;  5HR6 A;  4NLC A;  4U7C A;  3PSF A;  4IC9 A;  3HKZ C;  3GZF A;  4NV0 A;  3M7D A;  2NV3 A;  2Z7J A;  3NRW A;  1PVR A;  2OYY A;  3NUQ A;  1GO3 F;  3M6K A;  2KNJ A;  2G06 A;  4QJF B;  4ACO A;  3OPX A;  1ECW A;  3K1Z A;  3F5A A;  4FZN A;  3IG5 A;  3SMV A;  2OH2 A;  3E0F A;  3SQI A;  3IN5 A;  1TAM A;  1CRX A;  2HMX A;  2RP5 A;  2KKV A;  2VKQ A;  2ZIV A;  4NWI A;  2G08 A;  2KJ8 A;  4ICA A;  3GU3 A;  4C0Z A;  2KIW A;  3N7S C;  2KKP A;  3VC8 A;  2CPR A;  5KL1 B;  1A6S A;  2K8B B;  2MRL A;  2XID A;  2JGA A;  2K8C B;  4OJP A;  1D8B A;  1XO0 A;  3O0F A;  1DRG A;  4NLB A;  3D2N A;  4BJQ A;  2H3I A;  2KJ5 A;  2RRD A;  4BUG A;  2CRX A;  2K8A A;  2JMG A;  2MA1 A;  2XIC A;  2K4E A;  3HKZ F;  3CP8 A;  3LVV A;  2ZG6 A;  2HOF A;  4P0P A;  4FE3 A;  3H0L B;  4OJL A;  2GH1 A;  3F2B A;  2KHQ A;  2XI9 A;  5A0L A;  3SAH A;  2LBO A;  1NZB A;  1T94 A;  2G5H B;  2WB1 F;  2YX8 A;  3LVW A;  4KX5 A;  2G5I B;  3PSP A;  1ZQ1 C;  3ONN A;  2JH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...