2ZIUA

Crystal structure of the mus81-eme1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
302
structure length
281
Chain Sequence
GWHLSPGSYDIVLCVDLCETTGKQELVKELQRNSVTFDVRKLNVGDFLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLRKPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQKLYQNCTLFCRANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLMQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCTRGPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
total genus 84
structure length 281
sequence length 302
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziuA02
2ZIUA 4P0PA 2ZIUB 2ZIVB 4P0QA 2ZIXA 4P0QB 2ZIWA 4P0PB 2ZIWB 2ZIXB 2ZIVA
chains in the Genus database with same CATH superfamily
5ALPA 2NRTA 2ATLA 4RNOA 3G6VA 3ETLA 2KZ3A 1KBUA 4F2RA 2YMPA 2HBLA 9ICNA 5J2GA 3V7JA 4C4TA 5HMMA 5DBAA 2HVHA 9ICSA 4ICAA 1SZHA 7ICTA 5ALRA 3I76A 2WB1C 3T5LA 7ICRA 4F2SA 4YP3A 2IMWP 3CP8A 5KG0A 4UBCA 4DSJA 3HJEA 1KEJA 2NRVA 9ICFA 2QLTA 2BZFA 4XA5A 4UB2A 5KT6A 4NL9C 1S8OA 9ICMA 1NJWA 2PFOA 4DFMA 3H0LB 4XUSA 1P7DA 5KG3A 4DFJA 5GTHU 3ISCA 2KG5A 4UB5A 1DXSA 1L7MA 3RH4A 4EENA 3OJSA 1X40A 1PK3A 2H3QA 3MC1A 4I2EA 1ZQHA 2H3IA 1Z4OA 2JEIA 1RYRA 2AJQA 2FPKA 4MEYA 3KKAC 4QZGA 3BDPA 4X5VA 3RJHA 1DK3A 4DL4A 2YMLA 2ZJ5A 1X42A 1NJXA 7ICKA 3OJUA 2A19A 2V9WA 4Z6EA 1D8BA 1Z3EB 4P2HA 4Q45A 5IIMA 4DEZA 5A0LA 5AM0A 3VC8A 3MGHA 3JPSA 4YXMA 5KNIA 3QEBZ 1KSPA 2JEGA 4GC6A 1U48A 3QYPA 1QQ6A 2A1JB 1PUZA 3C29A 2F8LA 4UAZA 3ED5A 1A0PA 1L7PA 7ICLA 4QZCA 2P6UA 5EOZA 1S76D 3H8JA 1JIHA 3L4PA 1DK2A 4P0QA 4AYBC 2K8BB 1NZBA 1HIWA 3GIIA 3L3FX 4QZAA 2J6SA 4ED0A 3M6ZA 8ICEA 2GH1A 2VKQA 4GLXA 3CRXA 1FFVA 4RQNA 5KFLA 4PHDA 9ICWA 3SI8A 3AEVA 2BCUA 3RB6A 4K4IA 4PL1A 4DSIA 3WK5A 8ICXA 3C23A 1RQLA 2DUYA 2EH9A 4ELUA 4UAUA 7ICMA 2D3DA 4C8OA 3JPTA 4MEXA 4O3PA 1HEKA 2MSNA 1WUDA 4RQ7A 8ICIA 3I1YA 3OTQA 5AI9A 4O3NA 4NM2A 2RRDA 4EBEA 2G08A 5J0TA 1S10A 5AIAA 3DDHA 2L5YA 2PI4A 2H3VA 3RJFA 2W9AA 4IR9A 2LYAA 4KN7A 7ICQA 4J9PA 4F5NA 5F9NA 2R8IA 3FYHA 1Y88A 1N63A 4Y2QA 5G5GA 4A8EA 8ICFA 3T5HA 2Y9UA 1DGJA 1COOA 3KHHA 5BPCA 9ICHA 2Y9TA 3C21A 5KT4A 5AI0A 3JPRA 3NVYA 4FZMA 2AXTU 4ED7A 2AGOA 4M6WB 4MF2A 2OHFA 4HYKA 3MDAA 8ICMA 3C2KA 1K1QA 3PX0A 4KLIA 2EZZA 2HOIA 2F8KA 3BJYA 4J9LA 4B9TA 2F44A 1KL9A 2GLEA 2C28A 2I1QA 2ISPA 4YN4A 4O0IA 4Y2TA 3C1YA 4MFAA 4CCHA 2HMXA 1KFSA 4NLCA 2ZIVB 2BDUA 5ALLA 1NK9A 2E3TA 4ED6A 3RJJA 3TQ1A 1Z1VA 2O6KA 1UA0A 5CP2A 3WU2U 2IOFA 2W3RA 4DL5A 4DF8A 1BPXA 1XSPA 2ZIWA 2W9CB 2LBOA 5AKIA 1S97A 2RDJA 3SMVA 4I2JA 2WTFA 4F4ZA 2FLPA 3F2DA 4I27A 3MFIA 5ALGA 5CRXA 1ZQBA 3SAHA 3DEEA 8ICZA 4K4GA 5KFIA 4CNQA 3D6JA 5EE0A 5EE3A 3VCBA 1QSLA 5KFXA 3H40A 5KG5A 4KLFA 5HMLA 5D4BA 4F5OA 1J2NA 5DQIA 2HSZA 1XSNA 3SR6A 2OWOA 3EYZA 2OCEA 4IRKA 5KFWA 1S77D 4RU9A 4AP9A 4NLKA 1QSSA 2FE9A 5L1LA 1SXEA 2FMSA 5KG1A 5ALZA 2NRWA 9ICCA 4FZLA 2OXOA 3BS5B 8ICCA 9ICJA 3SAGA 3M6KA 3MR5A 3NS1A 3TADC 3ZDDA 3QZ7A 9ICGA 2HBJA 3KZIU 4EBDA 4IRDA 4GXKA 4DQPA 2ZUDA 5KFDA 3V6JA 3HW8A 3UXOA 3UQ0A 1KW4A 4DF4A 4IS7A 5KT2A 2WHEA 2JGAA 3H8WA 4GC7A 4QZFA 3GIKA 3RRHA 3T3FA 5FP0A 1NJYA 3IG8A 2KSOA 2YY6A 4LVSA 8ICTA 3Q8PB 4KMOB 3OHBA 4CE6A 2IHNA 3K1RB 2HHQA 4Y2RA 5DB9A 2M0NA 1N5WA 3MGVA 2AGPA 3GFKB 2PI5A 2H5XA 5EWGA 2F2AB 2XVTA 3UM9A 3M9OB 4UATA 1L8OA 3IHQB 4DLEA 3PZPA 4MFCA 2ZIUA 4EEYA 2BQ3A 2HHSA 3WK7A 3PSPA 4HAIA 3Q8QB 5JTIA 5KFYA 4F5PA 2A1JA 3EW9A 2KJ8A 5KFCA 4EEKA 4IQWA 2ZIXA 2H3ZA 1SWWA 3MFHA 1TKDA 4QJFB 2C2RA 1Q3UA 4J9QA 4DSKA 5J0SA 3DV9A 4R64A 2KOBA 5EWEA 2FPMA 2QB0A 2XO7A 1Z00A 1VJ5A 1U45A 7ICHA 5AK6A 2LM4A 3B0XA 2IOHA 1SZPA 8ICWA 4R8UB 2UVVA 5ALQA 3KTQA 5AK5A 2W43A 1Q8KA 1AROP 3NTUA 1SL2A 1BPZA 9ICRA 3N4MB 1NK0A 4M0AA 1ZXIA 4TUQA 1WCNA 3MGIA 3V7KA 4RNNA 7ICFA 1ZQDA 2F76X 4NV0A 4P4PA 5HHIA 2UVUA 2IHMA 1ZQ1C 2ESEA 5CR0A 1MC8A 3TACB 5IIOA 4YFKA 4CF3A 2NO5A 1PK1A 2PFPA 1WYGA 7ICIA 1ZQVA 5KG2A 1FIQA 2KEYA 1F5SA 4FZNA 3K75D 3GILA 4YR3A 3ZDAA 3L5KA 1TVAA 8ICUA 5AM1A 4KLHA 2JR5A 4J03A 3MR2A 2GOLA 4B9VA 4C80A 5J2KA 1YZ6A 4UB3A 1B22A 3Q8KA 1ZQGA 2HW3A 3QUTA 4I2HA 2E8MA 2HBKA 2YB1A 3Q8LA 2V4RA 1BNPA 5AI4A 9ICVA 3PR4A 1WCLA 4KX5A 4O3QA 4RQ1A 2CPRA 2AGQA 4US9A 4DFDA 2ZIVA 1MA7A 2KE7A 3QU4A 3ISDA 1PZNA 4QZDA 2W9BB 1QSYA 3QE9Y 3IV6A 4TQSA 4F71A 3E0FA 4NJ8A 1F44A 1S0MA 2BCRA 2B0CA 4F91B 4I28A 2LPEA 3JPOA 4ECQA 3SQIA 4KLQA 3KZXA 1SWVA 4PPXA 3RB0A 1KFDA 1B43A 4YMNA 3OSPA 2CXYA 3AQFA 4PHEA 5AHXA 3M1YA 3LDAA 3PVXA 1Z4NA 4UASA 4KLOA 2KK0A 1SV0A 4J9SA 2KJ9A 1ZYQA 3RB3A 5AKJA 2N1RA 5HR6A 2LMRA 1ZQPA 5AK4A 5B66U 4Y2PA 4RPZA 2M9NA 3ZDEA 4LJXA 3KFUF 4WJ3B 3QX7A 4JMUA 4F4KA 4M9LA 4JK1A 5E79U 4KLDA 2UVRA 3G6XA 4UAYA 4DL7A 3IDWA 5J2EA 2JH7A 2DL0A 3BS5A 2XCPA 4USAA 4XQ8A 2ZJAA 3BS7A 4MFFA 3HKZC 1LKYB 1ZRNA 1UQVA 1ZD4A 1TFRA 5H2FU 1EXNA 4B9LA 4ED8A 2W54A 4PGQA 2VA2A 3PW5A 3F53A 5AK3A 4LZDA 3KOOA 4QWAA 4M47A 2P35A 5DQGA 2W9MA 1RYUA 4RNMA 3TAQA 1ZQUA 2XICA 4M9JA 5KFSA 2I5HA 1TE2A 3GV8B 1URJA 1U4BA 4GFJA 2K4PA 2C2DA 3QUCA 3N28A 3F5EA 4EX6A 2BKEA 4IRCA 3FM9A 2KVCA 2XIDA 5KG7A 3HILA 5BOLA 2E5SA 3TFRA 5AI8A 2W55A 2MUTA 8ICVA 1ZQYA 2KP7A 5AI5A 3CYMA 2R18A 1N5XA 1V38A 4P4OA 1FEZA 4PGYA 3TI0A 4ECRA 4F5QA 2D8CA 3C5FA 4YXJA 2DKZA 3J81j 5DDMA 2KIWA 5HNKA 3PMLA 5AKGA 2Z7JA 4F4XA 2LYHA 2KN7A 3RBDA 2DFLA 4B9SA 4FO6A 2J6UA 3RRGA 1ZD3A 3R9KA 1UA1A 5AM2A 5J8YA 3CW2C 2ZTCA 5ALHA 2G0AA 5DB7A 1L8LA 5J29A 2RQ5A 5ALNA 4US8A 3BQTA 1NKCA 4DOCA 3QU9A 2P6RA 2XC9A 1IV8A 5L1KA 4YVZA 2DPJA 8ICYA 5JRTA 5HP4A 1XSLA 3ZDBA 4QWEA 3N97B 1ZQTA 3N7SC 4Y2VA 4ACOA 4G3IA 3UXPA 5J2AA 3KHRA 4KN4A 3H4DA 9ICAA 4Y2UA 4M9GA 8ICGA 5IINA 3AN1A 8ICRA 3FC4A 3ISBA 1ZQXA 2WB1F 3JPNA 3EPGA 1S5LU 1M6YA 4ED1A 4QW8A 5L9XA 3PR5B 2BR0A 5EWFA 2XY7A 3SV4A 1T3NA 1ZQJA 3SYZA 2BPCA 4MHVA 3HP6A 2NYVA 5EE9A 5DG7A 1X9SA 5J0YA 2Y1JA 4OJ6A 5DLFA 2E1FA 1T94A 3FDSA 1FO4A 2QARA 1ZOLA 2G07A 2PKEA 4J9OA 1XC9A 3NVWA 1KDHA 5KFJA 5AM4A 1NK6A 4TUPA 2ZXIA 4FFDA 3QU2A 2WF5A 1UPHA 2HOFA 3LWLA 2W7PA 1N61A 2CRXA 3QU7A 3RH5A 4YD2A 4NLNA 3EPIA 5AKLA 4NY8A 1OW5A 3ICXA 5KFOA 2V4QA 4CGZA 5ALKA 1PVPA 4O3RA 5KFNA 1IIPA 4O5EA 2WF8A 2F1JA 1U47A 1VLBA 2FMQA 2HHXA 1ZETA 2DWQA 4NM1A 2JEFA 3PW0A 2BCSA 1L6NA 3HPOA 3TAPA 2BHNA 4TURA 4UW9A 2K8AA 4QZ8A 5KFZA 4IQTA 4DQRA 5KT5A 1U49A 4LZGA 3SEIA 2AQ4A 5HHHA 4AYBF 9ICBA 4KLEA 1QQ5A 2JZBB 3V6KA 2KNJA 5ALJA 5J0UA 2RP5A 4NL9A 2HHTA 3NVZA 3ZI4A 3RB4A 1V9PA 2EAMA 1KRPA 3RJKA 3PX4A 4I2FA 4EZ9A 1X9XA 4OD0A 1NK4A 4KMUA 1ZJMA 3KHGA 5EE1A 4Y2XA 2WAQC 4BWMA 3KD3A 4YR0A 4PHAA 3KBBA 4UB4A 4OO1J 3KKAA 3OGUA 1SIJA 2YQEA 2XY6A 2NO4A 3QXGA 4C8NA 4C4SA 4Y2JA 1DRGA 1LKYA 4IQVA 2G5IB 1UT5A 2XGPA 4QWBA 1PVQA 4ECXA 2XY5A 1ZQIA 2EANA 1L7OA 1CI4A 1X2IA 5KT7A 1SL1A 1B4FA 2KHVA 3V72A 4M9HA 1NNLA 1D9FA 2MA1A 3UPQA 3I28A 4ZH4A 1J97A 2G5HB 4KLSA 2KKPA 2Q4TA 5ALIA 5JU5A 1Z1BA 4O3SA 4J9NA 1D8LA 4C7YA 4F4WA 4ED2A 3BQ0A 1AQ6A 1NJZA 1ED1A 3ORYA 3EZ5A 8ICHA 3H8MA 3RJIA 2BGWA 3BQ2A 4QZBA 1IM4A 1V97A 1SV0C 5J2CA 1ZQOA 4EZ6A 4JWMA 3H4BA 2E8PA 5GTIU 2YMMA 2XCAA 2OEHA 3LVVA 4BX9C 1ZQKA 8ICSA 5JUMA 1NZPA 7ICEA 2HI0A 1L3UA 3NRWA 2E8OA 1BGXT 5KAFU 3IG5A 8ICLA 2MRLA 3ALRA 2EAOA 4UARA 4P0PB 1QTMA 2MU2A 1ZQZA 2WFAA 4DSLA 3NUQA 2GWSA 4NXZA 5KFAA 3SZ2A 4BDPA 4U7CA 3UMGA 3C2LA 7ICSA 3MR3A 1RXWA 5KFUA 4JB3A 1ZQAA 3LWMA 1WWVA 3K4GA 4QZ9A 1TV9A 4ECYA 1T8EA 1ZQNA 4P0QB 2PFNA 4C4RA 3RJGA 2E8NA 3PW2A 4ZOHC 3PNCA 2K4HA 2R8KA 3HRDD 1PVRA 1BPBA 4RQ2A 2K8CB 4B9UA 3UQ2A 4I2CA 4RQ8A 5G5HA 1T3QA 4GIBA 4Z6FA 4QZEA 2RLTA 2Y0SC 3KHLA 3S6JA 3SENA 4J9RA 1H38A 2VJ4A 5J2BA 4BGDA 4YQWA 2XI9A 3RBEA 1K1SA 5AICA 3EUB2 3QNMA 5CA7A 5KFPA 3NRZA 4EYHB 5DDYA 2VA8A 4M6WA 1NK8A 4C0ZA 4DQQA 3B0YA 4CDGA 1JROA 5KFEA 1RZTA 3BQ1A 3M8SA 2VJ5A 4RQ6A 2ES6A 3ZD8A 9ICOA 5CJ7A 5J2IA 1F0MA 1B0XA 2HCFA 1BVSA 3Q8SB 1S0NA 4RPXA 3QUBA 1JALA 2IA6A 2W8LA 2KD1A 1X6JA 2FI1A 1ZD2P 3UMBA 5ALSA 4PZOA 3F2BA 2FJ6A 3U26A 2DGZA 1HUZA 3M9NB 8ICPA 3H0RB 4PGXA 4FE3A 2ZJ8A 3NASA 1ZQEA 3QU5A 2OH2A 2W9CA 3SAFA 5DBBA 4GXJA 4U6PA 2FLLA 4DOBA 3TADA 1KN5A 3V7LA 3AM9A 2AU0A 2A3VA 2JXJA 5KFTA 4YMOA 1BPDA 3BQ7A 4O5KA 3M8RA 2ZTDA 1LV5A 2ODGA 4BXOB 4R65A 1MSWD 2IBKA 3V6HA 2BPGA 2VIXA 3C5GA 4GXIA 3CNHA 4M2YA 4Q8FA 5J0RA 3EWAA 2H3FA 4F5RA 2JEJA 4DWIA 2F1IA 2JMGA 5F3XB 3AL0B 4B6JA 3NVVA 3JPQA 1OUQA 1T7PA 4F3OA 3GU3A 5DB8A 2ZIWB 3WK8A 2R8HA 4DFKA 1N60A 4DSFA 1YZ7A 1U9LA 3B9JA 2WF6A 1KQQA 5ALWA 4IL6U 4DSEA 9ICQA 4NLGA 3ETRA 5CHGA 4F8RA 1K5OA 3RFAA 3PW7A 4C7ZA 2KVSA 4Q44A 2YN4A 4I2BA 4BWJA 2PMZC 5AIBA 3MDCA 2IOFK 4RQ0A 4UBBA 5KTQA 4PJ0U 4DL6A 1RPLA 2I9GA 1WG8A 3A0HU 2HVIA 8ICAA 1TAMA 4O3OA 3RR7A 2RHFA 4J9KA 5J0WA 1JXEA 4QWCA 2EZYA 2ASJA 1QQ7A 1UCVA 2R8JA 4PHPA 4ECUA 8ICQA 1TAQA 4KTQA 1TK0A 4OJ5A 2ALZA 4DQIA 1N62A 5AKEA 4ED3A 2Y1IA 4IR1A 5KFBA 3FAHA 3SV3A 4B9NA 3GQCA 5ALFA 3RAXA 3F5AA 2QB1A 4DS5A 8ICBA 4YCXA 4DOAA 4FBUA 2GO7A 2A1AA 4UB6U 3WK6A 1XNSA 2AH5A 4J9MA 2JHDA 4F72A 4YMMA 4ECZA 5KFHA 4O3MA 2KICA 5L1JA 4I29A 1NOMA 2KSOB 5KG6A 1N56A 5ALEA 2LI6A 1IXRA 3AUOA 9ICLA 4P0PA 2F1HA 4RQ4A 4RUCA 4C8LA 1Z19A 3MBYA 1KKXA 4F93B 5C5JA 2DQNB 4FS2A 1JMSA 1RQNA 5KFKA 4Q43A 4KITB 8ICKA 3BZCA 5BOMA 4ECVA 3Q8RB 3N7PD 4F4YA 3E2EA 5DKWA 2ZIUB 1JRPA 2BCVA 5KFRA 2YX8A 4UQGA 4Y2YA 7ICGA 4R8UA 1XS9D 2EDUA 5J0OA 4UB8U 2KFNA 4DO9A 2YB4A 2PFQA 1CUKA 9ICUA 4OJOA 2ZIXB 9ICPA 3M9MB 2F77X 1S9FA 3A0BU 2DF4B 2EQYA 2OM6A 5D46A 3QEAZ 4PZNA 5ALOA 1L3VA 3HWTA 1LVHA 4ECTA 3HKZF 2QB0B 1Z00B 3OPXA 1VDVA 3UMCA 2KKVA 2PMZF 3E58A 2W8KA 5K4LA 1CRXA 2CN1A 4QW9A 1UT8A 2ASLA 4R66A 3RTVA 5C0YA 1L5UA 1ZQSA 2EAPA 5DLGA 9ICKA 3RAQA 5ALMA 1O08A 4DFPA 4P4MA 4EELA 1N48A 3MABA 2BQUA 4PH5A 2KZMA 3PMNA 2B21A 3GIJA 5KFGA 3WK4A 5AI6A 4ELVA 3GDXA 4FBTA 4IC9A 2R8GA 4TQRA 5AM5A 3C2MA 1J2MA 4RT2A 5AKKA 5F9LA 4KLUA 5DB6A 2W3SA 1PK1B 3RF9A 1SKSA 2HBMA 3WKEA 4NWIA 1ZRMA 2ASDA 2LKYA 1JXLA 2P66A 4OCZA 3M7DA 5AKZA 1D9DA 4JV2A 2LHTA 1BPYA 2PXIA 1X9MA 1XO0A 1L3TA 2W9BA 3MR6A 2KIVA 5L1IA 1CEZA 5AKXA 4NLZA 4JV0A 4CRXA 4RPYA 2K60A 2JV3A 3THVA 2HHWA 2WF9A 5J0QA 3HT3A 4DL2A 1ZQFA 4EX7A 1ZQWA 2KJ5A 3H8SA 4BXOA 1NI3A 2F3NA 4UAWA 1NK7A 3T5KA 1WWUA 2C22A 3PY8A 3PO5A 1JN3A 1S0VA 2G06A 3QUQA 1FFUA 5KL8B 4JWNA 1TAUA 4DLGA 2KV2A 1RXVA 1X9WA 3N7RC 4C8MA 4QZHA 9ICIA 5J0XA 1MN8A 1COKA 2BPFA 3WKDA 2Q0ZX 1XO1A 2K89A 4C8KA 2E1EA 4DCCA 2BCQA 1SV4A 2G09A 5DG8A 5T14A 1C20A 4Y2SA 2HOQA 2BQRA 3K1ZA 2FMPA 5DG9A 3HX0A 4KLGA 1XWLA 3TARA 1A76A 1X66A 5TZVA 4B9MA 4Q8EA 4FS1A 4QZIA 2W11A 1RM6C 2W03A 1KFTA 4KLTA 2LYBA 2NV3A 3ZD9A 5ALXA 8ICNA 8ICJA 2FPLA 3IRUA 4ELTA 1ZQRA 5CB1A 2HHVA 4RQ5A 3AU6A 4QIWC 2K4EA 1O03A 3GV5B 4RQ3A 3IP4B 1KTQA 3TFSA 2XGQA 4RZRA 3QZ8A 4TUSA 5AKYA 4DS4A 1ZQCA 5AM3A 2W04A 4MF8A 1DGSA 3D2QA 4CF4A 5ALVA 1X6IA 5KAIU 1N2XA 4KLLA 4JV1A 1QCKA 9ICEA 3D2SA 5IIKA 1L3SA 2YTUA 2VA3A 4Z6CA 7ICNA 2HHUA 2ZG6A 2D6FC 2KZZA 1OXJA 2KMDA 1YT3A 3PW4A 1RYSA 3UXNA 4I2DA 4RQMA 3GV7B 3IN5A 3JPPA 1JUDA 3BZKA 1BPEA 5J0PA 2KFZA 7ICJA 1V85A 4OJLA 3ONNA 5IIJA 3PSFA 5DGAA 5IIIA 1D8YA 3WKBA 5DQHA 3AU2A 2YMQA 2DPIA 2MUTB 4CF5A 2JRZA 2DKXA 5IILA 3PSIA 2B6GA 1QH9A 3AMZA 4K4HA 4YR2A 2ZTEA 2WAQF 3GIMA 7ICPA 4KX3A 4UAVA 4DL3A 3LK9A 2ISOA 1NKBA 3SD7A 1MQ3A 1A6SA 3TKAA 1GO3F 1XU4A 4JUZA 3PX6A 3G6YA 4I2AA 1RDFA 4R63A 1ZQLA 4XRHA 4YG2A 2FLNA 1RG6A 1HJPA 4BJQA 2W7OA 4RUAA 5CWRA 2ZUCA 3GZFA 3WKAA 2OYYA 3C1ZA 7ICVA 1DOQA 4DQSA 4KLMA 7ICUA 3RH6A 4BUGA 5KFQA 1HUOA 4ECSA 1TK8A 1NK5A 4QIWF 7ICOA 5TISU 3RR8A 1SKWA 5J2FA 1ECWA 2MAXA 5HR7A 2FDRA 2K4IA 5AKHA 3OHAA 1JX4A 3Q8MA 2EZXA 2LM1A 4Z6DA 3ZDCA 2VANA 1S0OA 2AQ0A 1Q46A 4RT3A 3WK9A 1SKRA 4O9MA 3T5JA 4I2IA 1ZD5A 1C7YA 4PL2A 1ZQQA 4E0DA 3O0FA 4G9BA 3OSNA 1SGGA 5J8YC 5ALYA 5ALDA 1UHUA 4KLJA 9ICTA 1KLNA 2QKQA 2QARB 5DGBA 4O5CA 2C2EA 1A77A 3IM1A 1SL0A 1JI7A 3AQEA 4M04A 5ALTA 3TANA 2ZXHA 3D2NA 5D49A 4EYIB 1BNOA 2JZBA 1MQ2A 2HDOA 4OJPA 4I2GA 3T79A 3H7IA 2J6TA 5CEHA 2I6XA 3RJEA 1NKEA 5B5EU 1IG6A 4NLBA 3H0MB 1LB2B 2NRZA 5KL1B 5DBCA 4UB1A 2KTQA 1TK5A 5KFMA 5KFVA 2NRXA 3LYSA 4QNLA 1ZJNA 1ZQMA 2BDPA 4M9NA 4EBCA 3NGDA 4ECWA 1SB3C 5KT3A 2ZUBA 2DBYA 2JH1A 9ICXA 1T4GA 3WKCA 1QLNA 2RDIA 1L7NA 4F92B 4IQUA 3PO4A 5J2DA 3F2CA 4QWDA 5KFFA 4F50A 3LVWA 2AHOB 3C28A 1SXDA 1Q3VA 5J2JA 3PSTA 3PV8A 8ICOA 5L1MA 2UVWA 5J2HA 4YD1A 2Y0SF 2KHQA 5KG4A 2WF7A 5ALUA
chains in the Genus database with same CATH topology
3OPXA 1DRGA 3H0RB 2KKVA 4U7CA 2F8LA 3C29A 2PMZF 4FE3A 2KJ9A 3IN5A 1CRXA 1A0PA 2CN1A 3N7RC 2N1RA 2ZXIA 3CYMA 2G5IB 1KBUA 4PL2A 2OH2A 3SAFA 5C0YA 2R18A 4OJ5A 4P0QA 4AYBC 5HR6A 3O0FA 2K8BB 4U6PA 1PVQA 4OJLA 2JGAA 2HMXA 1UPHA 1HIWA 2F76X 3ONNA 4NLCA 1NZBA 2HOFA 3PSFA 4NV0A 3L3FX 2W7PA 1ZQ1C 2HBLA 2K89A 2ZIVB 2KHVA 3IG8A 2CRXA 2BDUA 2E1EA 3M6ZA 2GH1A 2VKQA 3CRXA 4KMOB 3F5AA 2MA1A 2A3VA 3KFUF 4ICAA 4WJ3B 1SZHA 2KIWA 2G5HB 3ICXA 4JMUA 2KKPA 3AQEA 2G09A 2KEYA 2Z7JA 4FZNA 2WB1C 2Q4TA 5T14A 1PVPA 2M0NA 2HOQA 4CGZA 3MGVA 3PSIA 3K1ZA 1XNSA 1IIPA 2ZIWA 1Z1BA 2LBOA 4IC9A 4P0QB 2JHDA 3CP8A 2ZXHA 2VIXA 3D2NA 4PL1A 3SMVA 2WAQF 2H3FA 4O3MA 2F2AB 2XVTA 2KICA 4KX3A 2K4HA 2GOLA 3F2DA 2W03A 2G0AA 1PVRA 2JH7A 1L6NA 1HEKA 2JMGA 3PZPA 3AL0B 3RF9A 1WUDA 2HBMA 2K8CB 4NWIA 4OJPA 1ED1A 5CRXA 2ZIUA 3T79A 1A6SA 2LKYA 4P0PA 3SAHA 2LYBA 2NV3A 3DEEA 3H0LB 3M7DA 3HKZC 1OUQA 3GU3A 1GO3F 3PSPA 2Y0SC 2ZIWB 2K8AA 4NLBA 3H0MB 1P7DA 1Z19A 2RRDA 2G08A 3VCBA 2VJ4A 5KL1B 2HBKA 2YB1A 2LHTA 2DQNB 2KJ8A 1XO0A 2XI9A 3N7SC 4ACOA 2H3VA 3LYSA 4AYBF 2ZIXA 4QNLA 2H3QA 2H3ZA 4BJQA 4QIWC 2KNJA 2LYAA 2W7OA 2K4EA 4QJFB 4KX5A 3N7PD 2H3IA 3IP4B 2RP5A 1Q3UA 2ZIUB 3F53A 2CPRA 4C0ZA 4CRXA 2YX8A 3GZFA 4CDGA 2ZIVA 2OYYA 2VJ5A 4A8EA 3LVVA 1MA7A 3RFAA 2W04A 4BX9C 2KOBA 3D2QA 2WB1F 2JH1A 2YB4A 2XICA 4BUGA 2KJ5A 2PMZC 3NRWA 4OJOA 2ZIXB 1URJA 2F77X 3E0FA 4FZMA 4GFJA 1F44A 4FZLA 2DF4B 2OM6A 4QIWF 2WAQC 2KD1A 2OXOA 3F5EA 3IG5A 3F2CA 3SQIA 1TAMA 3D2SA 3SAGA 2KVCA 2RHFA 3KZXA 2MRLA 3ALRA 3M6KA 1ECWA 2XIDA 4OO1J 5HR7A 3LVWA 2K4IA 1D8BA 4OJ6A 4P0PB 1T94A 2E1FA 2G06A 3VC8A 5A0LA 3NUQA 5KL8B 3C28A 3F2BA 3AQFA 2KV2A 1Q3VA 3PSTA 2DGZA 2HOIA 2HBJA 3HKZF 2E5SA 2ZG6A 2D6FC 2G07A 2Y0SF 2KHQA 1YT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIU A;  4P0P A;  2ZIU B;  2ZIV B;  4P0Q A;  2ZIX A;  4P0Q B;  2ZIW A;  4P0P B;  2ZIW B;  2ZIX B;  2ZIV A; 
#chains in the Genus database with same CATH topology
 5ALP A;  2NRT A;  2ATL A;  4RNO A;  3G6V A;  3ETL A;  2KZ3 A;  1KBU A;  4F2R A;  2YMP A;  2HBL A;  9ICN A;  5J2G A;  3V7J A;  4C4T A;  5HMM A;  5DBA A;  2HVH A;  9ICS A;  4ICA A;  1SZH A;  7ICT A;  5ALR A;  3I76 A;  2WB1 C;  3T5L A;  7ICR A;  4F2S A;  4YP3 A;  2IMW P;  3CP8 A;  5KG0 A;  4UBC A;  4DSJ A;  3HJE A;  1KEJ A;  2NRV A;  9ICF A;  2QLT A;  2BZF A;  4XA5 A;  4UB2 A;  5KT6 A;  4NL9 C;  1S8O A;  9ICM A;  1NJW A;  2PFO A;  4DFM A;  3H0L B;  4XUS A;  1P7D A;  5KG3 A;  4DFJ A;  5GTH U;  3ISC A;  2KG5 A;  4UB5 A;  1DXS A;  1L7M A;  3RH4 A;  4EEN A;  3OJS A;  1X40 A;  1PK3 A;  2H3Q A;  3MC1 A;  4I2E A;  1ZQH A;  2H3I A;  1Z4O A;  2JEI A;  1RYR A;  2AJQ A;  2FPK A;  4MEY A;  3KKA C;  4QZG A;  3BDP A;  4X5V A;  3RJH A;  1DK3 A;  4DL4 A;  2YML A;  2ZJ5 A;  1X42 A;  1NJX A;  7ICK A;  3OJU A;  2A19 A;  2V9W A;  4Z6E A;  1D8B A;  1Z3E B;  4P2H A;  4Q45 A;  5IIM A;  4DEZ A;  5A0L A;  5AM0 A;  3VC8 A;  3MGH A;  3JPS A;  4YXM A;  5KNI A;  3QEB Z;  1KSP A;  2JEG A;  4GC6 A;  1U48 A;  3QYP A;  1QQ6 A;  2A1J B;  1PUZ A;  3C29 A;  2F8L A;  4UAZ A;  3ED5 A;  1A0P A;  1L7P A;  7ICL A;  4QZC A;  2P6U A;  5EOZ A;  1S76 D;  3H8J A;  1JIH A;  3L4P A;  1DK2 A;  4P0Q A;  4AYB C;  2K8B B;  1NZB A;  1HIW A;  3GII A;  3L3F X;  4QZA A;  2J6S A;  4ED0 A;  3M6Z A;  8ICE A;  2GH1 A;  2VKQ A;  4GLX A;  3CRX A;  1FFV A;  4RQN A;  5KFL A;  4PHD A;  9ICW A;  3SI8 A;  3AEV A;  2BCU A;  3RB6 A;  4K4I A;  4PL1 A;  4DSI A;  3WK5 A;  8ICX A;  3C23 A;  1RQL A;  2DUY A;  2EH9 A;  4ELU A;  4UAU A;  7ICM A;  2D3D A;  4C8O A;  3JPT A;  4MEX A;  4O3P A;  1HEK A;  2MSN A;  1WUD A;  4RQ7 A;  8ICI A;  3I1Y A;  3OTQ A;  5AI9 A;  4O3N A;  4NM2 A;  2RRD A;  4EBE A;  2G08 A;  5J0T A;  1S10 A;  5AIA A;  3DDH A;  2L5Y A;  2PI4 A;  2H3V A;  3RJF A;  2W9A A;  4IR9 A;  2LYA A;  4KN7 A;  7ICQ A;  4J9P A;  4F5N A;  5F9N A;  2R8I A;  3FYH A;  1Y88 A;  1N63 A;  4Y2Q A;  5G5G A;  4A8E A;  8ICF A;  3T5H A;  2Y9U A;  1DGJ A;  1COO A;  3KHH A;  5BPC A;  9ICH A;  2Y9T A;  3C21 A;  5KT4 A;  5AI0 A;  3JPR A;  3NVY A;  4FZM A;  2AXT U;  4ED7 A;  2AGO A;  4M6W B;  4MF2 A;  2OHF A;  4HYK A;  3MDA A;  8ICM A;  3C2K A;  1K1Q A;  3PX0 A;  4KLI A;  2EZZ A;  2HOI A;  2F8K A;  3BJY A;  4J9L A;  4B9T A;  2F44 A;  1KL9 A;  2GLE A;  2C28 A;  2I1Q A;  2ISP A;  4YN4 A;  4O0I A;  4Y2T A;  3C1Y A;  4MFA A;  4CCH A;  2HMX A;  1KFS A;  4NLC A;  2ZIV B;  2BDU A;  5ALL A;  1NK9 A;  2E3T A;  4ED6 A;  3RJJ A;  3TQ1 A;  1Z1V A;  2O6K A;  1UA0 A;  5CP2 A;  3WU2 U;  2IOF A;  2W3R A;  4DL5 A;  4DF8 A;  1BPX A;  1XSP A;  2ZIW A;  2W9C B;  2LBO A;  5AKI A;  1S97 A;  2RDJ A;  3SMV A;  4I2J A;  2WTF A;  4F4Z A;  2FLP A;  3F2D A;  4I27 A;  3MFI A;  5ALG A;  5CRX A;  1ZQB A;  3SAH A;  3DEE A;  8ICZ A;  4K4G A;  5KFI A;  4CNQ A;  3D6J A;  5EE0 A;  5EE3 A;  3VCB A;  1QSL A;  5KFX A;  3H40 A;  5KG5 A;  4KLF A;  5HML A;  5D4B A;  4F5O A;  1J2N A;  5DQI A;  2HSZ A;  1XSN A;  3SR6 A;  2OWO A;  3EYZ A;  2OCE A;  4IRK A;  5KFW A;  1S77 D;  4RU9 A;  4AP9 A;  4NLK A;  1QSS A;  2FE9 A;  5L1L A;  1SXE A;  2FMS A;  5KG1 A;  5ALZ A;  2NRW A;  9ICC A;  4FZL A;  2OXO A;  3BS5 B;  8ICC A;  9ICJ A;  3SAG A;  3M6K A;  3MR5 A;  3NS1 A;  3TAD C;  3ZDD A;  3QZ7 A;  9ICG A;  2HBJ A;  3KZI U;  4EBD A;  4IRD A;  4GXK A;  4DQP A;  2ZUD A;  5KFD A;  3V6J A;  3HW8 A;  3UXO A;  3UQ0 A;  1KW4 A;  4DF4 A;  4IS7 A;  5KT2 A;  2WHE A;  2JGA A;  3H8W A;  4GC7 A;  4QZF A;  3GIK A;  3RRH A;  3T3F A;  5FP0 A;  1NJY A;  3IG8 A;  2KSO A;  2YY6 A;  4LVS A;  8ICT A;  3Q8P B;  4KMO B;  3OHB A;  4CE6 A;  2IHN A;  3K1R B;  2HHQ A;  4Y2R A;  5DB9 A;  2M0N A;  1N5W A;  3MGV A;  2AGP A;  3GFK B;  2PI5 A;  2H5X A;  5EWG A;  2F2A B;  2XVT A;  3UM9 A;  3M9O B;  4UAT A;  1L8O A;  3IHQ B;  4DLE A;  3PZP A;  4MFC A;  2ZIU A;  4EEY A;  2BQ3 A;  2HHS A;  3WK7 A;  3PSP A;  4HAI A;  3Q8Q B;  5JTI A;  5KFY A;  4F5P A;  2A1J A;  3EW9 A;  2KJ8 A;  5KFC A;  4EEK A;  4IQW A;  2ZIX A;  2H3Z A;  1SWW A;  3MFH A;  1TKD A;  4QJF B;  2C2R A;  1Q3U A;  4J9Q A;  4DSK A;  5J0S A;  3DV9 A;  4R64 A;  2KOB A;  5EWE A;  2FPM A;  2QB0 A;  2XO7 A;  1Z00 A;  1VJ5 A;  1U45 A;  7ICH A;  5AK6 A;  2LM4 A;  3B0X A;  2IOH A;  1SZP A;  8ICW A;  4R8U B;  2UVV A;  5ALQ A;  3KTQ A;  5AK5 A;  2W43 A;  1Q8K A;  1ARO P;  3NTU A;  1SL2 A;  1BPZ A;  9ICR A;  3N4M B;  1NK0 A;  4M0A A;  1ZXI A;  4TUQ A;  1WCN A;  3MGI A;  3V7K A;  4RNN A;  7ICF A;  1ZQD A;  2F76 X;  4NV0 A;  4P4P A;  5HHI A;  2UVU A;  2IHM A;  1ZQ1 C;  2ESE A;  5CR0 A;  1MC8 A;  3TAC B;  5IIO A;  4YFK A;  4CF3 A;  2NO5 A;  1PK1 A;  2PFP A;  1WYG A;  7ICI A;  1ZQV A;  5KG2 A;  1FIQ A;  2KEY A;  1F5S A;  4FZN A;  3K75 D;  3GIL A;  4YR3 A;  3ZDA A;  3L5K A;  1TVA A;  8ICU A;  5AM1 A;  4KLH A;  2JR5 A;  4J03 A;  3MR2 A;  2GOL A;  4B9V A;  4C80 A;  5J2K A;  1YZ6 A;  4UB3 A;  1B22 A;  3Q8K A;  1ZQG A;  2HW3 A;  3QUT A;  4I2H A;  2E8M A;  2HBK A;  2YB1 A;  3Q8L A;  2V4R A;  1BNP A;  5AI4 A;  9ICV A;  3PR4 A;  1WCL A;  4KX5 A;  4O3Q A;  4RQ1 A;  2CPR A;  2AGQ A;  4US9 A;  4DFD A;  2ZIV A;  1MA7 A;  2KE7 A;  3QU4 A;  3ISD A;  1PZN A;  4QZD A;  2W9B B;  1QSY A;  3QE9 Y;  3IV6 A;  4TQS A;  4F71 A;  3E0F A;  4NJ8 A;  1F44 A;  1S0M A;  2BCR A;  2B0C A;  4F91 B;  4I28 A;  2LPE A;  3JPO A;  4ECQ A;  3SQI A;  4KLQ A;  3KZX A;  1SWV A;  4PPX A;  3RB0 A;  1KFD A;  1B43 A;  4YMN A;  3OSP A;  2CXY A;  3AQF A;  4PHE A;  5AHX A;  3M1Y A;  3LDA A;  3PVX A;  1Z4N A;  4UAS A;  4KLO A;  2KK0 A;  1SV0 A;  4J9S A;  2KJ9 A;  1ZYQ A;  3RB3 A;  5AKJ A;  2N1R A;  5HR6 A;  2LMR A;  1ZQP A;  5AK4 A;  5B66 U;  4Y2P A;  4RPZ A;  2M9N A;  3ZDE A;  4LJX A;  3KFU F;  4WJ3 B;  3QX7 A;  4JMU A;  4F4K A;  4M9L A;  4JK1 A;  5E79 U;  4KLD A;  2UVR A;  3G6X A;  4UAY A;  4DL7 A;  3IDW A;  5J2E A;  2JH7 A;  2DL0 A;  3BS5 A;  2XCP A;  4USA A;  4XQ8 A;  2ZJA A;  3BS7 A;  4MFF A;  3HKZ C;  1LKY B;  1ZRN A;  1UQV A;  1ZD4 A;  1TFR A;  5H2F U;  1EXN A;  4B9L A;  4ED8 A;  2W54 A;  4PGQ A;  2VA2 A;  3PW5 A;  3F53 A;  5AK3 A;  4LZD A;  3KOO A;  4QWA A;  4M47 A;  2P35 A;  5DQG A;  2W9M A;  1RYU A;  4RNM A;  3TAQ A;  1ZQU A;  2XIC A;  4M9J A;  5KFS A;  2I5H A;  1TE2 A;  3GV8 B;  1URJ A;  1U4B A;  4GFJ A;  2K4P A;  2C2D A;  3QUC A;  3N28 A;  3F5E A;  4EX6 A;  2BKE A;  4IRC A;  3FM9 A;  2KVC A;  2XID A;  5KG7 A;  3HIL A;  5BOL A;  2E5S A;  3TFR A;  5AI8 A;  2W55 A;  2MUT A;  8ICV A;  1ZQY A;  2KP7 A;  5AI5 A;  3CYM A;  2R18 A;  1N5X A;  1V38 A;  4P4O A;  1FEZ A;  4PGY A;  3TI0 A;  4ECR A;  4F5Q A;  2D8C A;  3C5F A;  4YXJ A;  2DKZ A;  3J81 j;  5DDM A;  2KIW A;  5HNK A;  3PML A;  5AKG A;  2Z7J A;  4F4X A;  2LYH A;  2KN7 A;  3RBD A;  2DFL A;  4B9S A;  4FO6 A;  2J6U A;  3RRG A;  1ZD3 A;  3R9K A;  1UA1 A;  5AM2 A;  5J8Y A;  3CW2 C;  2ZTC A;  5ALH A;  2G0A A;  5DB7 A;  1L8L A;  5J29 A;  2RQ5 A;  5ALN A;  4US8 A;  3BQT A;  1NKC A;  4DOC A;  3QU9 A;  2P6R A;  2XC9 A;  1IV8 A;  5L1K A;  4YVZ A;  2DPJ A;  8ICY A;  5JRT A;  5HP4 A;  1XSL A;  3ZDB A;  4QWE A;  3N97 B;  1ZQT A;  3N7S C;  4Y2V A;  4ACO A;  4G3I A;  3UXP A;  5J2A A;  3KHR A;  4KN4 A;  3H4D A;  9ICA A;  4Y2U A;  4M9G A;  8ICG A;  5IIN A;  3AN1 A;  8ICR A;  3FC4 A;  3ISB A;  1ZQX A;  2WB1 F;  3JPN A;  3EPG A;  1S5L U;  1M6Y A;  4ED1 A;  4QW8 A;  5L9X A;  3PR5 B;  2BR0 A;  5EWF A;  2XY7 A;  3SV4 A;  1T3N A;  1ZQJ A;  3SYZ A;  2BPC A;  4MHV A;  3HP6 A;  2NYV A;  5EE9 A;  5DG7 A;  1X9S A;  5J0Y A;  2Y1J A;  4OJ6 A;  5DLF A;  2E1F A;  1T94 A;  3FDS A;  1FO4 A;  2QAR A;  1ZOL A;  2G07 A;  2PKE A;  4J9O A;  1XC9 A;  3NVW A;  1KDH A;  5KFJ A;  5AM4 A;  1NK6 A;  4TUP A;  2ZXI A;  4FFD A;  3QU2 A;  2WF5 A;  1UPH A;  2HOF A;  3LWL A;  2W7P A;  1N61 A;  2CRX A;  3QU7 A;  3RH5 A;  4YD2 A;  4NLN A;  3EPI A;  5AKL A;  4NY8 A;  1OW5 A;  3ICX A;  5KFO A;  2V4Q A;  4CGZ A;  5ALK A;  1PVP A;  4O3R A;  5KFN A;  1IIP A;  4O5E A;  2WF8 A;  2F1J A;  1U47 A;  1VLB A;  2FMQ A;  2HHX A;  1ZET A;  2DWQ A;  4NM1 A;  2JEF A;  3PW0 A;  2BCS A;  1L6N A;  3HPO A;  3TAP A;  2BHN A;  4TUR A;  4UW9 A;  2K8A A;  4QZ8 A;  5KFZ A;  4IQT A;  4DQR A;  5KT5 A;  1U49 A;  4LZG A;  3SEI A;  2AQ4 A;  5HHH A;  4AYB F;  9ICB A;  4KLE A;  1QQ5 A;  2JZB B;  3V6K A;  2KNJ A;  5ALJ A;  5J0U A;  2RP5 A;  4NL9 A;  2HHT A;  3NVZ A;  3ZI4 A;  3RB4 A;  1V9P A;  2EAM A;  1KRP A;  3RJK A;  3PX4 A;  4I2F A;  4EZ9 A;  1X9X A;  4OD0 A;  1NK4 A;  4KMU A;  1ZJM A;  3KHG A;  5EE1 A;  4Y2X A;  2WAQ C;  4BWM A;  3KD3 A;  4YR0 A;  4PHA A;  3KBB A;  4UB4 A;  4OO1 J;  3KKA A;  3OGU A;  1SIJ A;  2YQE A;  2XY6 A;  2NO4 A;  3QXG A;  4C8N A;  4C4S A;  4Y2J A;  1DRG A;  1LKY A;  4IQV A;  2G5I B;  1UT5 A;  2XGP A;  4QWB A;  1PVQ A;  4ECX A;  2XY5 A;  1ZQI A;  2EAN A;  1L7O A;  1CI4 A;  1X2I A;  5KT7 A;  1SL1 A;  1B4F A;  2KHV A;  3V72 A;  4M9H A;  1NNL A;  1D9F A;  2MA1 A;  3UPQ A;  3I28 A;  4ZH4 A;  1J97 A;  2G5H B;  4KLS A;  2KKP A;  2Q4T A;  5ALI A;  5JU5 A;  1Z1B A;  4O3S A;  4J9N A;  1D8L A;  4C7Y A;  4F4W A;  4ED2 A;  3BQ0 A;  1AQ6 A;  1NJZ A;  1ED1 A;  3ORY A;  3EZ5 A;  8ICH A;  3H8M A;  3RJI A;  2BGW A;  3BQ2 A;  4QZB A;  1IM4 A;  1V97 A;  1SV0 C;  5J2C A;  1ZQO A;  4EZ6 A;  4JWM A;  3H4B A;  2E8P A;  5GTI U;  2YMM A;  2XCA A;  2OEH A;  3LVV A;  4BX9 C;  1ZQK A;  8ICS A;  5JUM A;  1NZP A;  7ICE A;  2HI0 A;  1L3U A;  3NRW A;  2E8O A;  1BGX T;  5KAF U;  3IG5 A;  8ICL A;  2MRL A;  3ALR A;  2EAO A;  4UAR A;  4P0P B;  1QTM A;  2MU2 A;  1ZQZ A;  2WFA A;  4DSL A;  3NUQ A;  2GWS A;  4NXZ A;  5KFA A;  3SZ2 A;  4BDP A;  4U7C A;  3UMG A;  3C2L A;  7ICS A;  3MR3 A;  1RXW A;  5KFU A;  4JB3 A;  1ZQA A;  3LWM A;  1WWV A;  3K4G A;  4QZ9 A;  1TV9 A;  4ECY A;  1T8E A;  1ZQN A;  4P0Q B;  2PFN A;  4C4R A;  3RJG A;  2E8N A;  3PW2 A;  4ZOH C;  3PNC A;  2K4H A;  2R8K A;  3HRD D;  1PVR A;  1BPB A;  4RQ2 A;  2K8C B;  4B9U A;  3UQ2 A;  4I2C A;  4RQ8 A;  5G5H A;  1T3Q A;  4GIB A;  4Z6F A;  4QZE A;  2RLT A;  2Y0S C;  3KHL A;  3S6J A;  3SEN A;  4J9R A;  1H38 A;  2VJ4 A;  5J2B A;  4BGD A;  4YQW A;  2XI9 A;  3RBE A;  1K1S A;  5AIC A;  3EUB 2;  3QNM A;  5CA7 A;  5KFP A;  3NRZ A;  4EYH B;  5DDY A;  2VA8 A;  4M6W A;  1NK8 A;  4C0Z A;  4DQQ A;  3B0Y A;  4CDG A;  1JRO A;  5KFE A;  1RZT A;  3BQ1 A;  3M8S A;  2VJ5 A;  4RQ6 A;  2ES6 A;  3ZD8 A;  9ICO A;  5CJ7 A;  5J2I A;  1F0M A;  1B0X A;  2HCF A;  1BVS A;  3Q8S B;  1S0N A;  4RPX A;  3QUB A;  1JAL A;  2IA6 A;  2W8L A;  2KD1 A;  1X6J A;  2FI1 A;  1ZD2 P;  3UMB A;  5ALS A;  4PZO A;  3F2B A;  2FJ6 A;  3U26 A;  2DGZ A;  1HUZ A;  3M9N B;  8ICP A;  3H0R B;  4PGX A;  4FE3 A;  2ZJ8 A;  3NAS A;  1ZQE A;  3QU5 A;  2OH2 A;  2W9C A;  3SAF A;  5DBB A;  4GXJ A;  4U6P A;  2FLL A;  4DOB A;  3TAD A;  1KN5 A;  3V7L A;  3AM9 A;  2AU0 A;  2A3V A;  2JXJ A;  5KFT A;  4YMO A;  1BPD A;  3BQ7 A;  4O5K A;  3M8R A;  2ZTD A;  1LV5 A;  2ODG A;  4BXO B;  4R65 A;  1MSW D;  2IBK A;  3V6H A;  2BPG A;  2VIX A;  3C5G A;  4GXI A;  3CNH A;  4M2Y A;  4Q8F A;  5J0R A;  3EWA A;  2H3F A;  4F5R A;  2JEJ A;  4DWI A;  2F1I A;  2JMG A;  5F3X B;  3AL0 B;  4B6J A;  3NVV A;  3JPQ A;  1OUQ A;  1T7P A;  4F3O A;  3GU3 A;  5DB8 A;  2ZIW B;  3WK8 A;  2R8H A;  4DFK A;  1N60 A;  4DSF A;  1YZ7 A;  1U9L A;  3B9J A;  2WF6 A;  1KQQ A;  5ALW A;  4IL6 U;  4DSE A;  9ICQ A;  4NLG A;  3ETR A;  5CHG A;  4F8R A;  1K5O A;  3RFA A;  3PW7 A;  4C7Z A;  2KVS A;  4Q44 A;  2YN4 A;  4I2B A;  4BWJ A;  2PMZ C;  5AIB A;  3MDC A;  2IOF K;  4RQ0 A;  4UBB A;  5KTQ A;  4PJ0 U;  4DL6 A;  1RPL A;  2I9G A;  1WG8 A;  3A0H U;  2HVI A;  8ICA A;  1TAM A;  4O3O A;  3RR7 A;  2RHF A;  4J9K A;  5J0W A;  1JXE A;  4QWC A;  2EZY A;  2ASJ A;  1QQ7 A;  1UCV A;  2R8J A;  4PHP A;  4ECU A;  8ICQ A;  1TAQ A;  4KTQ A;  1TK0 A;  4OJ5 A;  2ALZ A;  4DQI A;  1N62 A;  5AKE A;  4ED3 A;  2Y1I A;  4IR1 A;  5KFB A;  3FAH A;  3SV3 A;  4B9N A;  3GQC A;  5ALF A;  3RAX A;  3F5A A;  2QB1 A;  4DS5 A;  8ICB A;  4YCX A;  4DOA A;  4FBU A;  2GO7 A;  2A1A A;  4UB6 U;  3WK6 A;  1XNS A;  2AH5 A;  4J9M A;  2JHD A;  4F72 A;  4YMM A;  4ECZ A;  5KFH A;  4O3M A;  2KIC A;  5L1J A;  4I29 A;  1NOM A;  2KSO B;  5KG6 A;  1N56 A;  5ALE A;  2LI6 A;  1IXR A;  3AUO A;  9ICL A;  4P0P A;  2F1H A;  4RQ4 A;  4RUC A;  4C8L A;  1Z19 A;  3MBY A;  1KKX A;  4F93 B;  5C5J A;  2DQN B;  4FS2 A;  1JMS A;  1RQN A;  5KFK A;  4Q43 A;  4KIT B;  8ICK A;  3BZC A;  5BOM A;  4ECV A;  3Q8R B;  3N7P D;  4F4Y A;  3E2E A;  5DKW A;  2ZIU B;  1JRP A;  2BCV A;  5KFR A;  2YX8 A;  4UQG A;  4Y2Y A;  7ICG A;  4R8U A;  1XS9 D;  2EDU A;  5J0O A;  4UB8 U;  2KFN A;  4DO9 A;  2YB4 A;  2PFQ A;  1CUK A;  9ICU A;  4OJO A;  2ZIX B;  9ICP A;  3M9M B;  2F77 X;  1S9F A;  3A0B U;  2DF4 B;  2EQY A;  2OM6 A;  5D46 A;  3QEA Z;  4PZN A;  5ALO A;  1L3V A;  3HWT A;  1LVH A;  4ECT A;  3HKZ F;  2QB0 B;  1Z00 B;  3OPX A;  1VDV A;  3UMC A;  2KKV A;  2PMZ F;  3E58 A;  2W8K A;  5K4L A;  1CRX A;  2CN1 A;  4QW9 A;  1UT8 A;  2ASL A;  4R66 A;  3RTV A;  5C0Y A;  1L5U A;  1ZQS A;  2EAP A;  5DLG A;  9ICK A;  3RAQ A;  5ALM A;  1O08 A;  4DFP A;  4P4M A;  4EEL A;  1N48 A;  3MAB A;  2BQU A;  4PH5 A;  2KZM A;  3PMN A;  2B21 A;  3GIJ A;  5KFG A;  3WK4 A;  5AI6 A;  4ELV A;  3GDX A;  4FBT A;  4IC9 A;  2R8G A;  4TQR A;  5AM5 A;  3C2M A;  1J2M A;  4RT2 A;  5AKK A;  5F9L A;  4KLU A;  5DB6 A;  2W3S A;  1PK1 B;  3RF9 A;  1SKS A;  2HBM A;  3WKE A;  4NWI A;  1ZRM A;  2ASD A;  2LKY A;  1JXL A;  2P66 A;  4OCZ A;  3M7D A;  5AKZ A;  1D9D A;  4JV2 A;  2LHT A;  1BPY A;  2PXI A;  1X9M A;  1XO0 A;  1L3T A;  2W9B A;  3MR6 A;  2KIV A;  5L1I A;  1CEZ A;  5AKX A;  4NLZ A;  4JV0 A;  4CRX A;  4RPY A;  2K60 A;  2JV3 A;  3THV A;  2HHW A;  2WF9 A;  5J0Q A;  3HT3 A;  4DL2 A;  1ZQF A;  4EX7 A;  1ZQW A;  2KJ5 A;  3H8S A;  4BXO A;  1NI3 A;  2F3N A;  4UAW A;  1NK7 A;  3T5K A;  1WWU A;  2C22 A;  3PY8 A;  3PO5 A;  1JN3 A;  1S0V A;  2G06 A;  3QUQ A;  1FFU A;  5KL8 B;  4JWN A;  1TAU A;  4DLG A;  2KV2 A;  1RXV A;  1X9W A;  3N7R C;  4C8M A;  4QZH A;  9ICI A;  5J0X A;  1MN8 A;  1COK A;  2BPF A;  3WKD A;  2Q0Z X;  1XO1 A;  2K89 A;  4C8K A;  2E1E A;  4DCC A;  2BCQ A;  1SV4 A;  2G09 A;  5DG8 A;  5T14 A;  1C20 A;  4Y2S A;  2HOQ A;  2BQR A;  3K1Z A;  2FMP A;  5DG9 A;  3HX0 A;  4KLG A;  1XWL A;  3TAR A;  1A76 A;  1X66 A;  5TZV A;  4B9M A;  4Q8E A;  4FS1 A;  4QZI A;  2W11 A;  1RM6 C;  2W03 A;  1KFT A;  4KLT A;  2LYB A;  2NV3 A;  3ZD9 A;  5ALX A;  8ICN A;  8ICJ A;  2FPL A;  3IRU A;  4ELT A;  1ZQR A;  5CB1 A;  2HHV A;  4RQ5 A;  3AU6 A;  4QIW C;  2K4E A;  1O03 A;  3GV5 B;  4RQ3 A;  3IP4 B;  1KTQ A;  3TFS A;  2XGQ A;  4RZR A;  3QZ8 A;  4TUS A;  5AKY A;  4DS4 A;  1ZQC A;  5AM3 A;  2W04 A;  4MF8 A;  1DGS A;  3D2Q A;  4CF4 A;  5ALV A;  1X6I A;  5KAI U;  1N2X A;  4KLL A;  4JV1 A;  1QCK A;  9ICE A;  3D2S A;  5IIK A;  1L3S A;  2YTU A;  2VA3 A;  4Z6C A;  7ICN A;  2HHU A;  2ZG6 A;  2D6F C;  2KZZ A;  1OXJ A;  2KMD A;  1YT3 A;  3PW4 A;  1RYS A;  3UXN A;  4I2D A;  4RQM A;  3GV7 B;  3IN5 A;  3JPP A;  1JUD A;  3BZK A;  1BPE A;  5J0P A;  2KFZ A;  7ICJ A;  1V85 A;  4OJL A;  3ONN A;  5IIJ A;  3PSF A;  5DGA A;  5III A;  1D8Y A;  3WKB A;  5DQH A;  3AU2 A;  2YMQ A;  2DPI A;  2MUT B;  4CF5 A;  2JRZ A;  2DKX A;  5IIL A;  3PSI A;  2B6G A;  1QH9 A;  3AMZ A;  4K4H A;  4YR2 A;  2ZTE A;  2WAQ F;  3GIM A;  7ICP A;  4KX3 A;  4UAV A;  4DL3 A;  3LK9 A;  2ISO A;  1NKB A;  3SD7 A;  1MQ3 A;  1A6S A;  3TKA A;  1GO3 F;  1XU4 A;  4JUZ A;  3PX6 A;  3G6Y A;  4I2A A;  1RDF A;  4R63 A;  1ZQL A;  4XRH A;  4YG2 A;  2FLN A;  1RG6 A;  1HJP A;  4BJQ A;  2W7O A;  4RUA A;  5CWR A;  2ZUC A;  3GZF A;  3WKA A;  2OYY A;  3C1Z A;  7ICV A;  1DOQ A;  4DQS A;  4KLM A;  7ICU A;  3RH6 A;  4BUG A;  5KFQ A;  1HUO A;  4ECS A;  1TK8 A;  1NK5 A;  4QIW F;  7ICO A;  5TIS U;  3RR8 A;  1SKW A;  5J2F A;  1ECW A;  2MAX A;  5HR7 A;  2FDR A;  2K4I A;  5AKH A;  3OHA A;  1JX4 A;  3Q8M A;  2EZX A;  2LM1 A;  4Z6D A;  3ZDC A;  2VAN A;  1S0O A;  2AQ0 A;  1Q46 A;  4RT3 A;  3WK9 A;  1SKR A;  4O9M A;  3T5J A;  4I2I A;  1ZD5 A;  1C7Y A;  4PL2 A;  1ZQQ A;  4E0D A;  3O0F A;  4G9B A;  3OSN A;  1SGG A;  5J8Y C;  5ALY A;  5ALD A;  1UHU A;  4KLJ A;  9ICT A;  1KLN A;  2QKQ A;  2QAR B;  5DGB A;  4O5C A;  2C2E A;  1A77 A;  3IM1 A;  1SL0 A;  1JI7 A;  3AQE A;  4M04 A;  5ALT A;  3TAN A;  2ZXH A;  3D2N A;  5D49 A;  4EYI B;  1BNO A;  2JZB A;  1MQ2 A;  2HDO A;  4OJP A;  4I2G A;  3T79 A;  3H7I A;  2J6T A;  5CEH A;  2I6X A;  3RJE A;  1NKE A;  5B5E U;  1IG6 A;  4NLB A;  3H0M B;  1LB2 B;  2NRZ A;  5KL1 B;  5DBC A;  4UB1 A;  2KTQ A;  1TK5 A;  5KFM A;  5KFV A;  2NRX A;  3LYS A;  4QNL A;  1ZJN A;  1ZQM A;  2BDP A;  4M9N A;  4EBC A;  3NGD A;  4ECW A;  1SB3 C;  5KT3 A;  2ZUB A;  2DBY A;  2JH1 A;  9ICX A;  1T4G A;  3WKC A;  1QLN A;  2RDI A;  1L7N A;  4F92 B;  4IQU A;  3PO4 A;  5J2D A;  3F2C A;  4QWD A;  5KFF A;  4F50 A;  3LVW A;  2AHO B;  3C28 A;  1SXD A;  1Q3V A;  5J2J A;  3PST A;  3PV8 A;  8ICO A;  5L1M A;  2UVW A;  5J2H A;  4YD1 A;  2Y0S F;  2KHQ A;  5KG4 A;  2WF7 A;  5ALU A; 
#chains in the Genus database with same CATH homology
 3OPX A;  1DRG A;  3H0R B;  2KKV A;  4U7C A;  2F8L A;  3C29 A;  2PMZ F;  4FE3 A;  2KJ9 A;  3IN5 A;  1CRX A;  1A0P A;  2CN1 A;  3N7R C;  2N1R A;  2ZXI A;  3CYM A;  2G5I B;  1KBU A;  4PL2 A;  2OH2 A;  3SAF A;  5C0Y A;  2R18 A;  4OJ5 A;  4P0Q A;  4AYB C;  5HR6 A;  3O0F A;  2K8B B;  4U6P A;  1PVQ A;  4OJL A;  2JGA A;  2HMX A;  1UPH A;  1HIW A;  2F76 X;  3ONN A;  4NLC A;  1NZB A;  2HOF A;  3PSF A;  4NV0 A;  3L3F X;  2W7P A;  1ZQ1 C;  2HBL A;  2K89 A;  2ZIV B;  2KHV A;  3IG8 A;  2CRX A;  2BDU A;  2E1E A;  3M6Z A;  2GH1 A;  2VKQ A;  3CRX A;  4KMO B;  3F5A A;  2MA1 A;  2A3V A;  3KFU F;  4ICA A;  4WJ3 B;  1SZH A;  2KIW A;  2G5H B;  3ICX A;  4JMU A;  2KKP A;  3AQE A;  2G09 A;  2KEY A;  2Z7J A;  4FZN A;  2WB1 C;  2Q4T A;  5T14 A;  1PVP A;  2M0N A;  2HOQ A;  4CGZ A;  3MGV A;  3PSI A;  3K1Z A;  1XNS A;  1IIP A;  2ZIW A;  1Z1B A;  2LBO A;  4IC9 A;  4P0Q B;  2JHD A;  3CP8 A;  2ZXH A;  2VIX A;  3D2N A;  4PL1 A;  3SMV A;  2WAQ F;  2H3F A;  4O3M A;  2F2A B;  2XVT A;  2KIC A;  4KX3 A;  2K4H A;  2GOL A;  3F2D A;  2W03 A;  2G0A A;  1PVR A;  2JH7 A;  1L6N A;  1HEK A;  2JMG A;  3PZP A;  3AL0 B;  3RF9 A;  1WUD A;  2HBM A;  2K8C B;  4NWI A;  4OJP A;  1ED1 A;  5CRX A;  2ZIU A;  3T79 A;  1A6S A;  2LKY A;  4P0P A;  3SAH A;  2LYB A;  2NV3 A;  3DEE A;  3H0L B;  3M7D A;  3HKZ C;  1OUQ A;  3GU3 A;  1GO3 F;  3PSP A;  2Y0S C;  2ZIW B;  2K8A A;  4NLB A;  3H0M B;  1P7D A;  1Z19 A;  2RRD A;  2G08 A;  3VCB A;  2VJ4 A;  5KL1 B;  2HBK A;  2YB1 A;  2LHT A;  2DQN B;  2KJ8 A;  1XO0 A;  2XI9 A;  3N7S C;  4ACO A;  2H3V A;  3LYS A;  4AYB F;  2ZIX A;  4QNL A;  2H3Q A;  2H3Z A;  4BJQ A;  4QIW C;  2KNJ A;  2LYA A;  2W7O A;  2K4E A;  4QJF B;  4KX5 A;  3N7P D;  2H3I A;  3IP4 B;  2RP5 A;  1Q3U A;  2ZIU B;  3F53 A;  2CPR A;  4C0Z A;  4CRX A;  2YX8 A;  3GZF A;  4CDG A;  2ZIV A;  2OYY A;  2VJ5 A;  4A8E A;  3LVV A;  1MA7 A;  3RFA A;  2W04 A;  4BX9 C;  2KOB A;  3D2Q A;  2WB1 F;  2JH1 A;  2YB4 A;  2XIC A;  4BUG A;  2KJ5 A;  2PMZ C;  3NRW A;  4OJO A;  2ZIX B;  1URJ A;  2F77 X;  3E0F A;  4FZM A;  4GFJ A;  1F44 A;  4FZL A;  2DF4 B;  2OM6 A;  4QIW F;  2WAQ C;  2KD1 A;  2OXO A;  3F5E A;  3IG5 A;  3F2C A;  3SQI A;  1TAM A;  3D2S A;  3SAG A;  2KVC A;  2RHF A;  3KZX A;  2MRL A;  3ALR A;  3M6K A;  1ECW A;  2XID A;  4OO1 J;  5HR7 A;  3LVW A;  2K4I A;  1D8B A;  4OJ6 A;  4P0P B;  1T94 A;  2E1F A;  2G06 A;  3VC8 A;  5A0L A;  3NUQ A;  5KL8 B;  3C28 A;  3F2B A;  3AQF A;  2KV2 A;  1Q3V A;  3PST A;  2DGZ A;  2HOI A;  2HBJ A;  3HKZ F;  2E5S A;  2ZG6 A;  2D6F C;  2G07 A;  2Y0S F;  2KHQ A;  1YT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...