2ZIUA

Crystal structure of the mus81-eme1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
302
structure length
281
Chain Sequence
b'GWHLSPGSYDIVLCVDLCETTGKQELVKELQRNSVTFDVRKLNVGDFLWVARERVTPVPGQLRPPVGKELVLDYIIERKRMDDLCGSIIDGRFREQKFRLKRCGLRKPIYLVEECGSAAAHLSIPESTLQQAIVNTQVVDGFFVKRVQDAKESAAYLTIMTRYLQKLYQNCTLFCRANLSCSLMAFTEFNYGAIKNKCQTVREVFARQLMQISGVSGDKAAAVLEHYSTVSSLLQAYDKCSSETEKEKLLSSVKYGKLKRNLGPALSRTIYQLYCTRGPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mus81 protein
publication title Crystal structure of the Mus81-Eme1 complex
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 84
structure length 281
sequence length 302
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2ziuA02
4P0QA 2ZIXB 2ZIXA 4P0PB 2ZIUB 4P0PA 2ZIWB 2ZIWA 2ZIVA 2ZIUA 4P0QB 2ZIVB
chains in the Genus database with same CATH superfamily
2KVSA 1DGJA 4I28A 2WAQF 2LPEA 5EE0A 8ICJA 3B0YA 3NUQA 5KFVA 5AM2A 4E0DA 4Q45A 5J2FA 4IQWA 3UMGA 3MC1A 4QW9A 3GIIA 2BZFA 5C0YA 2GWSA 4KLEA 2DL0A 1SL0A 5HR6A 4RUAA 2ZUBA 1BPEA 2W11A 1ZYQA 4C4TA 2UVRA 4DF4A 4YN4A 3RJJA 2KZ3A 2XCAA 4I2BA 2AQ0A 4GXIA 3MFHA 1YZ7A 4Y2PA 5C5JA 3UQ0A 1BPXA 2EDUA 4EELA 3T5KA 4F92B 2VA2A 1T94A 5IINA 3MGIA 3AL0B 4PHPA 2WFAA 2EAPA 5KFBA 3ZDAA 5KT6A 4Q8EA 4Q8FA 1XO0A 4M2YA 4TQSA 3FAHA 3JPOA 1VDVA 2V9WA 4NLZA 1LVHA 1XC9A 5KFUA 3FYHA 1QSSA 5DLFA 1U47A 5KT7A 2ASJA 2GH1A 5KFCA 4UAWA 3N28A 4NM2A 4TUPA 4O3OA 1WUDA 1TAMA 2BDPA 5DB9A 2KN7A 2RQ5A 2BCSA 4Y2QA 3AN1A 3RB6A 3FDSA 4O3SA 2L5YA 4Y2UA 4JUZA 3PZPA 2DQNB 9ICGA 1GO3F 2BKEA 4F71A 5BOMA 3GFKB 4P0PB 1BNOA 7ICKA 4OJOA 8ICYA 4Q43A 3Q8PB 1TAUA 4NLKA 5BOLA 8ICQA 2Y0SC 4I2IA 3M9MB 1NZBA 3IG8A 2W9BB 4QWEA 3THVA 4F5RA 2QB0B 4Z6EA 8ICWA 3RAXA 1ZQVA 3MDAA 5JU5A 3V7KA 1DOQA 8ICVA 5AK5A 1V38A 5KL8B 4DFJA 5KFZA 3BQ1A 3QU4A 3G6VA 4F5OA 5ALHA 3GIKA 4B9LA 3VCBA 2W7PA 1XS9D 5ALTA 4OD0A 5H2FU 5IIJA 2FMPA 2EZZA 3C29A 1TV9A 5DQHA 5KT3A 1TE2A 4B9NA 3SAGA 2O6KA 3H8SA 1UT8A 3MBYA 3PR5B 5EWFA 4IS7A 3NS1A 5AKGA 3CYMA 5DDYA 2KD1A 3Q8SB 2VKQA 2JZBA 1JXLA 1NJXA 3SEIA 1SV4A 3QX7A 5BPCA 5HMLA 4MFAA 1XWLA 1TK8A 4JK1A 1ZRMA 4BX9C 4BWJA 4I2DA 5AHXA 3OGUA 2QLTA 2H3FA 1PZNA 4Y2XA 1OUQA 3MR6A 2JEGA 2KIVA 5L1JA 2OXOA 5B5EU 4EYHB 4KLDA 4KMOB 2Q4TA 4YXMA 4C0ZA 4EENA 4IQVA 3V6JA 3LWLA 3RRGA 5J0QA 3TAPA 1S8OA 4QWDA 4DL3A 2NV3A 5AM5A 4KN4A 1SKSA 7ICPA 3IHQB 1QQ6A 2KHQA 2HBJA 5J0WA 4IR9A 2ZIWB 4LZGA 1Q3VA 3PSFA 4MEXA 1Z3EB 3PSIA 1UT5A 3LVWA 3LVVA 4US8A 3RH6A 1ZQJA 5DKWA 4DSKA 3NRZA 1KFDA 4UBCA 3UMBA 2AJQA 4JB3A 5J0PA 3EPGA 7ICQA 5AM0A 3RTVA 5HHHA 4CF3A 5KFMA 1FFVA 1S77D 4UW9A 2D8CA 4UB8U 2AHOB 3HX0A 2CRXA 4IL6U 4C8NA 1ZQIA 5J0YA 2W04A 4UASA 2ZXIA 2Y9UA 3F2CA 5ALFA 5HNKA 3N7PD 5AKEA 4BWMA 1QTMA 3UQ2A 3PMNA 1F0MA 4UAUA 1L7NA 3SAFA 3M9OB 3RJIA 1WYGA 4YR3A 2G0AA 3E2EA 5DDMA 2W9AA 4DOCA 3KD3A 4KLOA 1N62A 5AIAA 5KFDA 2RRDA 5J2HA 8ICRA 3AQEA 5AK3A 2IHMA 1ECWA 2KE7A 2B21A 2DKXA 4O3MA 4C4RA 4K4IA 4K4HA 4YCXA 1ZQTA 4DL2A 4DSIA 4YMMA 1ZQMA 4DLEA 1RQLA 4QZEA 4ED6A 2GLEA 1ZQQA 2W54A 3R9KA 3IG5A 4QJFB 2KHVA 4YQWA 3F2DA 4KLJA 3F53A 1S0VA 4ECYA 2KSOB 4RQ0A 2WB1F 1ZQNA 3BS5B 2N1RA 2LM4A 1C7YA 3KHLA 8ICPA 3OSPA 4CNQA 3ZI4A 3NGDA 1JXEA 4TUQA 4F5NA 3OHAA 3V72A 1S5LU 2QB1A 1FIQA 2W43A 4P0QA 3NVWA 2DFLA 1D9DA 2F8KA 5CR0A 4QW8A 5DG9A 4HYKA 2E8MA 5KG4A 2FMQA 3K4GA 1JN3A 2LYBA 4DSJA 2EZYA 2FI1A 3N7SC 5L1IA 5AK4A 3C2KA 1SZPA 3GU3A 5KFWA 1IM4A 4RT3A 1ZETA 4GLXA 4C8MA 4UARA 2YN4A 5EOZA 1X42A 2FDRA 3QZ7A 2G08A 1DGSA 4NLBA 1H38A 3KHRA 1ZQHA 2UVUA 2NRXA 5ALXA 1PK1A 1ZJMA 2C2EA 3SQIA 3OJUA 2J6SA 8ICEA 4Z6CA 7ICMA 8ICFA 5A0LA 2G09A 3C2LA 3EUB2 1S97A 5EWEA 2F1JA 3PW7A 7ICHA 3JPSA 8ICKA 1L7OA 3CNHA 3DDHA 3HJEA 4G9BA 2EQYA 5KFPA 4IRDA 5J8YA 3IRUA 1XSNA 3IM1A 2A19A 1FEZA 2K8BB 1RXVA 1ZXIA 2G06A 5ALEA 4UB5A 3WK5A 8ICMA 4F4ZA 5J8YC 4YG2A 3HWTA 3ISBA 3L4PA 8ICLA 5KFYA 4DL7A 1SZHA 1DK3A 3SV4A 3AUOA 1BNPA 3TANA 4KLSA 5DBCA 4DWIA 4RZRA 2LI6A 4JWMA 1X66A 2HHTA 4C8OA 1TAQA 4KLMA 1ZQCA 3G6YA 4IRCA 1KKXA 4DSFA 1MQ2A 3T5JA 3CRXA 2RP5A 3WKBA 3NRWA 1M6YA 4ELVA 4DS5A 2E8OA 4YD1A 2OEHA 5L1MA 1N5WA 3KZIU 4PJ0U 3MR2A 2BDUA 5AKLA 2R8IA 4AYBF 3LK9A 4C8KA 5KG2A 1UA1A 5HHIA 9ICWA 2VIXA 3D6JA 5JTIA 2FPMA 1QH9A 5ALKA 5JRTA 2NRVA 3I1YA 3ZDCA 3UXPA 3AM9A 1AQ6A 3SENA 7ICVA 5AM1A 1Z19A 4DEZA 2ZUDA 1V9PA 3BQ0A 3U26A 2C22A 2M0NA 2I1QA 3HILA 4ECWA 2W3RA 2XICA 2JZBB 2FLLA 5J2CA 2JHDA 4KITB 2LMRA 4ELTA 2HVHA 5AI9A 1DK2A 2CPRA 4DQQA 4FZMA 2YB4A 5AI5A 2JV3A 2F77X 2JR5A 5AM3A 4NLCA 2XC9A 4EZ6A 4ED2A 1Q3UA 4OJ5A 2K4IA 2P6UA 2OHFA 8ICZA 2R18A 3T79A 5KFSA 9ICRA 2W7OA 5KAIU 2OH2A 2H3VA 4US9A 4PH5A 2BR0A 4M0AA 1SIJA 1S10A 3RH4A 1KEJA 3NVYA 4RUCA 4R65A 7ICOA 2F8LA 4J9RA 1BPDA 4DFDA 2LYHA 2H3IA 3KHHA 2J6UA 2KOBA 2XIDA 7ICRA 3DEEA 4QZ8A 8ICXA 2ZIVB 4B6JA 2PMZC 5DB6A 3ISDA 3TFSA 2MA1A 2KNJA 4TURA 1ZQUA 4HAIA 2LYAA 4M04A 2XGQA 1MC8A 3BZKA 3LWMA 1SL1A 1WWUA 5DG7A 1NK0A 1IIPA 9ICLA 2W9MA 9ICOA 2HCFA 2K4HA 4DL4A 2NO5A 3PO5A 2MUTA 4B9MA 2ATLA 5K4LA 4KLTA 4P4PA 4ED7A 2ES6A 3E58A 1QQ7A 4QZ9A 2ESEA 3WK4A 1J2MA 2JH7A 1ZJNA 1NK8A 2OYYA 4RQ3A 4O9MA 4J9OA 4MFFA 5KT4A 4F4KA 2OCEA 1Z1VA 1T3NA 5TISU 2BQRA 4UB6U 1CRXA 3V7LA 2C2DA 3AU6A 5KFKA 2H5XA 3GIJA 3EZ5A 5J2BA 3WK6A 4EYIB 4NJ8A 9ICAA 3NTUA 4KX5A 1X9XA 1WCLA 4U6PA 3KHGA 1X6IA 2F44A 2V4RA 3K75D 2D6FC 5FP0A 1VJ5A 3ONNA 2JXJA 1IV8A 2I6XA 5ALOA 2IA6A 2ZUCA 3TACB 2ASLA 2KFZA 2W9CB 5D4BA 3HT3A 3ISCA 4JWNA 1N5XA 3NASA 4FZLA 4F3OA 4P0QB 3QXGA 3ICXA 2K8AA 4CRXA 1LB2B 3H4DA 7ICUA 5J0TA 3OPXA 5TZVA 4F93B 3PW4A 3H8WA 3PX4A 9ICXA 2G07A 1JIHA 4FS1A 5EE9A 4ECSA 4YXJA 4PHEA 4I2AA 5ALUA 1WWVA 5KTQA 1NJZA 4PHAA 1Q46A 2WF9A 4UATA 2ZIXA 1TK5A 3QNMA 2KKPA 1PK1B 4BJQA 1B4FA 5ALMA 4CF4A 4YR2A 2XO7A 3M8RA 3BDPA 4RPZA 5DB8A 2AH5A 4R64A 9ICCA 2V4QA 5HP4A 1SKRA 2OWOA 5AKYA 5T14A 3G6XA 1XNSA 2E8PA 2EH9A 4C8LA 4PPXA 4FS2A 5E79U 2Z7JA 4UB3A 3K1RB 2HOQA 3OTQA 3QYPA 3I28A 4DO9A 3O0FA 2GO7A 1YT3A 1KW4A 3S6JA 1Z4NA 5KG0A 4PGXA 4F4XA 3ZDEA 5F9LA 2IOFK 5AKJA 1JI7A 2W8KA 3C28A 1KQQA 5CP2A 1COOA 1NK5A 3GDXA 1NKEA 1J97A 1UA0A 2KEYA 4GXJA 2B0CA 2JRZA 1ZQFA 4LJXA 5ALYA 4ED8A 4QZBA 1NI3A 4BGDA 4JV1A 2YMMA 3N4MB 1X9WA 3SI8A 1N2XA 1Z00A 4R66A 5D49A 1RDFA 4JV2A 3TI0A 3E0FA 4YVZA 3PX0A 3T5LA 3ALRA 2MU2A 5IIKA 3ZD8A 4O3QA 2HBMA 3KZXA 1RYRA 9ICQA 5L1LA 2ZXHA 2KJ8A 4WJ3B 4RQNA 3JPRA 2BQ3A 1TVAA 4KLGA 2EAMA 3MR5A 2FLPA 4CE6A 1SXEA 1NKCA 3QEBZ 5DQIA 4LVSA 2WF7A 4J9QA 4UAZA 1QSYA 1Q8KA 4O3PA 4P4OA 4RQ1A 3D2SA 3PSPA 3PSTA 2EZXA 2PXIA 4EBDA 2XI9A 4QZAA 1IG6A 4RU9A 1D8BA 1X40A 3V6KA 2Y0SF 3IV6A 1S0MA 4FBUA 3JPNA 2R8HA 4DOAA 3H4BA 3TFRA 1CEZA 3QEAZ 4FO6A 1JROA 5CWRA 5DBAA 3M9NB 1XO1A 4IR1A 4QIWC 2VJ4A 4Y2TA 4GFJA 3RR7A 1CI4A 3Q8RB 1WG8A 1A6SA 2NO4A 3Q8KA 4M6WA 5AKIA 3H0RB 5KT5A 5ALLA 5KNIA 4RQ8A 4KLFA 1HUOA 1NJWA 2A1AA 4DSEA 8ICBA 4ZH4A 2WHEA 4CF5A 7ICNA 2PFPA 2XGPA 5KFJA 3BZCA 1ZOLA 1SWVA 1RXWA 1URJA 5KFEA 4NLNA 7ICSA 5KG3A 3HPOA 1L3SA 2JEIA 4A8EA 2A1JA 3RJHA 1YZ6A 1COKA 1D9FA 1BPBA 2EANA 3NVVA 2A3VA 4F72A 3ORYA 3HKZC 2YB1A 3EWAA 1PVPA 2RDJA 2JEFA 4RQ6A 5AI8A 5IIIA 2XY7A 4M47A 2Y1JA 5KFHA 3WKDA 4DSLA 4DFMA 2MUTB 2HHVA 5KFLA 7ICGA 9ICFA 2WF5A 4F2SA 4O3RA 1HJPA 4TQRA 2FE9A 3QUBA 2WAQC 4YR0A 4ED1A 2ZG6A 3PV8A 3BQTA 3RBEA 1RYSA 3C5FA 5CA7A 1B0XA 4X5VA 1LKYB 2HOFA 2BPCA 2HHWA 2JGAA 4KLIA 2NRTA 5IIMA 1QCKA 1RZTA 1S0OA 5KG1A 3KKAA 4Y2VA 2BCQA 4KLLA 4K4GA 2F1HA 5KFRA 4PGQA 1PUZA 4ECQA 2NRWA 4G3IA 3PMLA 3RB3A 2F76X 3KKAC 5KFQA 4UB1A 3PY8A 3WK9A 5EE3A 4JV0A 2I9GA 3N7RC 2F2AB 2E8NA 2AGQA 3QE9Y 2PFQA 1KTQA 3RRHA 1ZQOA 1UCVA 2I5HA 1L8OA 2BCVA 3RJFA 3HW8A 2WF8A 2IOFA 3H40A 1L6NA 1WCNA 2E5SA 3SR6A 2DBYA 9ICIA 5IILA 1ZQYA 4O0IA 3BJYA 3JPQA 4I2EA 5CRXA 9ICUA 1A0PA 2HI0A 2CXYA 3SV3A 2JEJA 5AI0A 5AKZA 1BPYA 4M9JA 1RM6C 5AKKA 5ALPA 4OJ6A 4Y2JA 1X2IA 5B66U 1X6JA 1U9LA 1EXNA 3IDWA 3C23A 4RPXA 1SL2A 2ZJ8A 5ALDA 2E1EA 3F5EA 3MABA 1UHUA 2LM1A 3H0LB 2YTUA 3AU2A 1ZQEA 7ICJA 3JPPA 4RQ2A 3V7JA 4F5QA 3RJEA 1AROP 4BDPA 9ICKA 1U45A 1U49A 3WU2U 8ICSA 2R8KA 4ICAA 4J9SA 5KFTA 2ZJAA 3TQ1A 2BCUA 3H0MB 4I27A 3T3FA 3GV8B 9ICNA 1L3UA 1U48A 5GTHU 2ZIXB 5J2IA 4QZHA 3KFUF 9ICEA 4JMUA 2UVWA 3C1ZA 3T5HA 9ICHA 1V85A 4I2HA 5J29A 5J0RA 4XQ8A 4DQIA 3LYSA 5KFFA 4NXZA 4I2GA 3B0XA 3UMCA 2LKYA 5DG8A 5DQGA 2K4EA 4ED0A 3SMVA 1ZRNA 3QUQA 4M9HA 4ECRA 4ECTA 1D8YA 1OXJA 1BVSA 2E3TA 5G5HA 4XUSA 1L3VA 3WKCA 2D3DA 3WKAA 4YMNA 4XA5A 1F5SA 1KL9A 3H8MA 5AIBA 1ZQLA 2ZIUA 1NOMA 4KLQA 4OJPA 1OW5A 4U7CA 2KP7A 4MF2A 1S0NA 4F2RA 4I2CA 1PVQA 1TFRA 3BS5A 2VA3A 5ALNA 4QZIA 4UB4A 3UXNA 4J03A 2DPIA 1JRPA 3C21A 2RHFA 2HVIA 3QU2A 4J9NA 1KFSA 4TUSA 4XRHA 4KN7A 5AK6A 1ZQKA 8ICAA 5KFIA 4GXKA 3H7IA 5J0OA 1Z00B 2R8JA 3ED5A 5DGAA 4DF8A 2AXTU 8ICCA 2IOHA 3A0HU 2DPJA 2K89A 2NYVA 2ISOA 3AEVA 3ETLA 7ICEA 5J2KA 2HSZA 4BXOA 2KK0A 2FPLA 4RQ5A 2HHSA 2KIWA 3ETRA 2YX8A 2XY5A 5ALZA 2HW3A 2W3SA 1B22A 3AMZA 2YMQA 4RNMA 4RQMA 2P6RA 4QZFA 2H3QA 2UVVA 1KBUA 2P66A 4Q44A 1ZD3A 2YY6A 3ZDBA 3QZ8A 4NLGA 1NK9A 1K5OA 4Y2YA 4UAYA 3PNCA 1RQNA 4DOBA 2WTFA 1ZQZA 1XSLA 4F8RA 4R8UA 8ICGA 4FE3A 4F4WA 4MEYA 7ICIA 3C2MA 1K1SA 1VLBA 4ECUA 5ALWA 2Y9TA 1JX4A 1T8EA 4DLGA 1Z4OA 4O5EA 2KKVA 2R8GA 2M9NA 8ICHA 1TKDA 3GV5B 4RPYA 1LV5A 2KV2A 4DS4A 2XVTA 1ED1A 4M6WB 4QZGA 1B43A 4F91B 3Q8MA 1F44A 2KICA 4EX6A 2MRLA 3RJKA 4B9SA 3HP6A 4UQGA 3BQ7A 4YMOA 3B9JA 3SD7A 2PKEA 9ICVA 3MGVA 5CEHA 3V6HA 2QARA 2XY6A 4J9MA 2KJ9A 4AP9A 4C7ZA 1N63A 3FC4A 2E1FA 2HMXA 3EW9A 5AICA 2A1JB 1K1QA 1C20A 3M6KA 4KTQA 2WB1C 3H8JA 1RYUA 2DKZA 5F9NA 3MGHA 2G5HB 2PI4A 2DGZA 8ICUA 4R63A 3QUTA 1KLNA 4LZDA 5CJ7A 4CGZA 3GIMA 4QWAA 3SYZA 5KFXA 2GOLA 2ZTCA 1L5UA 1ZQXA 3KTQA 1X9MA 1NNLA 5KG5A 1XSPA 1N56A 3GV7B 1N48A 3TKAA 1DRGA 3L5KA 2JMGA 3UXOA 4KMUA 2VA8A 4F4YA 2KVCA 4DL6A 4B9TA 2ZJ5A 1MA7A 4RQ7A 5GTIU 4YFKA 3M6ZA 7ICLA 3PO4A 4Y2RA 3D2QA 4UBBA 1L7MA 2B6GA 1O08A 1ZQSA 2DUYA 1ZQAA 3TADA 5AKXA 1UQVA 4I2FA 2K4PA 4DQPA 2OM6A 5J2JA 8ICIA 3IN5A 4ELUA 4Y2SA 3TADC 3Q8QB 2BPGA 1ZD5A 5AM4A 2ZTEA 2C2RA 4NY8A 3PW0A 1NK7A 1J2NA 3M7DA 5AI6A 5J0XA 2PMZF 3UM9A 3UPQA 4USAA 3RBDA 4I2JA 4Z6FA 1MSWD 5J2DA 2ZTDA 4QZCA 2W8LA 2DF4B 3GZFA 3SAHA 5IIOA 5J2AA 2BQUA 4P4MA 1LKYA 5DGBA 4I29A 1HEKA 8ICTA 4IC9A 1SV0A 9ICMA 4ZOHC 1CUKA 5AKHA 3F2BA 3QU7A 1ZQGA 3PW5A 2CN1A 9ICPA 2ZIVA 4EZ9A 4UB2A 5ALGA 1A76A 1SV0C 9ICTA 2FJ6A 2HBKA 4ED3A 4KLUA 3C1YA 4NV0A 2KG5A 4NM1A 2RDIA 4OCZA 5ALQA 1SGGA 9ICBA 1ZD2P 2K8CB 3NVZA 4NL9A 5L9XA 1T4GA 2XCPA 3OSNA 4GIBA 1QLNA 3QU9A 1O03A 4AYBC 4M9GA 2HHXA 4NL9C 3RH5A 1U4BA 5HR7A 4M9NA 9ICJA 1ZD4A 3C5GA 4EX7A 4ECXA 1FFUA 1ZQ1C 3WK7A 1MN8A 2ASDA 2KFNA 1N60A 1QQ5A 5DB7A 1JALA 4DFPA 1ZQWA 2YMLA 3OHBA 2RLTA 2KJ5A 5ALIA 3TARA 8ICNA 2HOIA 2PI5A 3RF9A 1ZQDA 4O3NA 4PHDA 4FZNA 2DWQA 5DBBA 2IMWP 5HMMA 2F1IA 5CB1A 3RB0A 2FPKA 5J0SA 2ZIUB 5J2GA 3PR4A 4CDGA 9ICSA 4OJLA 4P2HA 3PX6A 4C80A 4C7YA 3KBBA 3HRDD 4P0PA 3SZ2A 1D8LA 2G5IB 4ACOA 5KL1B 2LBOA 3AQFA 1N61A 2VANA 4QWCA 4DCCA 3DV9A 2HDOA 5ALVA 4MHVA 2WF6A 3ZD9A 3IP4B 2W9CA 4PL2A 5KG6A 4GC6A 1SXDA 1SWWA 5ALJA 2W9BA 5G5GA 3D2NA 1NKBA 1KSPA 4DQSA 2QB0A 3PW2A 3WK8A 2W03A 1DXSA 1NK6A 3I76A 1ZQRA 2AGPA 3KOOA 2FMSA 2YMPA 1NJYA 1P7DA 4PGYA 1Z1BA 5KT2A 2H3ZA 4QZDA 1HIWA 1KN5A 3ZDDA 3JPTA 3FM9A 4BXOB 1TK0A 2K60A 2C28A 2PFOA 3RFAA 3TAQA 4DL5A 3GQCA 1JUDA 1BPZA 4KLHA 1T3QA 5KG7A 2HBLA 3M1YA 4GC7A 7ICFA 2YQEA 4IQUA 4O5KA 4FBTA 2Q0ZX 1A77A 5CHGA 4NWIA 2IBKA 1V97A 5EWGA 5AI4A 4J9PA 4O5CA 3RR8A 1SB3C 4IRKA 2LHTA 1L8LA 2MSNA 1ZQPA 4R8UB 5KFNA 3M8SA 4MFCA 4FFDA 1QSLA 1KDHA 3LDAA 4J9KA 1Y88A 5D46A 4UAVA 5L1KA 4ECZA 4MF8A 1S76D 2ODGA 5KFAA 2W55A 1HUZA 2IHNA 2AQ4A 4EEKA 4YD2A 1PVRA 8ICOA 1BGXT 4M9LA 2ZIWA 3A0BU 1MQ3A 2QARB 4PL1A 1S9FA 2BPFA 2PFNA 7ICTA 2QKQA 1SKWA 2BCRA 2KZZA 2AGOA 4YP3A 2KZMA 4DQRA 5ALRA 1KRPA 4IQTA 2KTQA 3BS7A 1IXRA 2AU0A 1NK4A 1NZPA 1XU4A 4RT2A 5J2EA 4ECVA 4CCHA 1RG6A 3N97B 3QUCA 4EEYA 5KFGA 3J81j 5EE1A 2HHQA 4J9LA 1T7PA 1ZQBA 2BHNA 1X9SA 3L3FX 3RJGA 3CP8A 1JMSA 4KX3A 4QWBA 3QU5A 4PZOA 2Y1IA 4QIWF 1FO4A 4RNNA 3OJSA 1RPLA 2FLNA 5DLGA 2KMDA 4EBEA 5ALSA 2ISPA 3Q8LA 5J0UA 3K1ZA 3RAQA 4B9UA 5F3XB 5JUMA 1UPHA 3GILA 4BUGA 2MAXA 2EAOA 4EBCA 2HHUA 2P35A 4RQ4A 1L3TA 3MFIA 3WKEA 3MDCA 3F5AA 4B9VA 1L7PA 4PZNA 1KFTA 1PK3A 3EPIA 4RNOA 3EYZA 2J6TA 2JH1A 5KFOA 3MR3A 2ALZA 2KSOA 2VJ5A 3PVXA 3HKZF 2F3NA 2NRZA 3VC8A 4OO1J 2BGWA 4C4SA 4DFKA 3RB4A 4QNLA 4Z6DA 4F50A 3BQ2A 5KAFU 4F5PA 3CW2C
chains in the Genus database with same CATH topology
4CGZA 4QJFB 2K4IA 2KHVA 2JGAA 2NV3A 4OJOA 3F2DA 1SZHA 5T14A 1XNSA 4NV0A 3F53A 2GOLA 2WAQF 2R18A 3T79A 2WB1F 2W03A 2KIWA 2KHQA 2HBJA 2YX8A 2Y0SC 2N1RA 2Z7JA 3LYSA 2ZIWB 2W7OA 1NZBA 3D2SA 2HOQA 3NUQA 2LKYA 1Q3VA 1DRGA 3PSFA 3PSPA 1P7DA 2JMGA 2K8CB 3IG8A 3PSTA 1Z1BA 2H3ZA 1Q3UA 1HIWA 2K4EA 4KX5A 2H3VA 3O0FA 2OH2A 3PSIA 2XI9A 3LVWA 3LVVA 3SMVA 5C0YA 2KVCA 2H3QA 1YT3A 1KBUA 3CRXA 2RP5A 5HR6A 1D8BA 4U6PA 1MA7A 2F76X 4AYBC 3NRWA 2Y0SF 3RFAA 4P0QA 3M6ZA 3N7RC 2F2AB 5HR7A 2F8LA 2D6FC 2H3IA 3ONNA 2HBLA 2KOBA 3D2QA 5KL8B 2XIDA 3C28A 4QIWC 1ZQ1C 2VJ4A 3DEEA 4GFJA 2BDUA 2ZIVB 2LYBA 1A6SA 3VCBA 4AYBF 2CRXA 2KEYA 3L3FX 2W7PA 3N7SC 2PMZC 4FE3A 4FZLA 4NWIA 2OM6A 2W04A 3CP8A 2ZXIA 3IN5A 4KX3A 3C29A 4P0QB 1L6NA 1T94A 2E5SA 2KNJA 2MA1A 2VIXA 3F2CA 3ICXA 3GU3A 2K8AA 4CRXA 2LYAA 5CRXA 3SAGA 3AL0B 2ZIUA 2KJ5A 3N7PD 3OPXA 4QIWF 2KKVA 1A0PA 3SAFA 2HOIA 4OJPA 2LHTA 1XO0A 4U7CA 2G08A 3RF9A 3M7DA 2KV2A 2PMZF 3CYMA 2KD1A 1IIPA 2XVTA 4FZNA 2VKQA 1ED1A 2G0AA 2K4HA 3K1ZA 4NLBA 4OJ6A 1URJA 1PVQA 2G07A 1F44A 2RRDA 3SQIA 1UPHA 4BUGA 2KICA 1Z19A 2MRLA 2ZIUB 4CDGA 2DF4B 3AQEA 4A8EA 2E1EA 3F5EA 3E0FA 1ECWA 3GZFA 3H0LB 3SAHA 4OJLA 2M0NA 2RHFA 3ALRA 2A3VA 2GH1A 3F5AA 5A0LA 4BX9C 3HKZC 3MGVA 4O3MA 2YB1A 1PVPA 2G09A 2XICA 2ZIXA 4P0PA 1WUDA 2G5IB 2JHDA 2HBMA 3KZXA 2H3FA 1TAMA 5KL1B 4ACOA 2KKPA 2LBOA 1OUQA 2JH1A 2KJ9A 3AQFA 4BJQA 4ICAA 1HEKA 2OXOA 2JH7A 4IC9A 2ZXHA 2KJ8A 4KMOB 2E1FA 2HMXA 3F2BA 2OYYA 2Q4TA 3H0MB 2WAQC 2ZG6A 1PVRA 3M6KA 4C0ZA 2VJ5A 2WB1C 2CN1A 3IP4B 4WJ3B 2CPRA 3HKZF 4FZMA 4PL2A 2ZIWA 2YB4A 2DQNB 3VC8A 2ZIVA 3PZPA 1GO3F 4OO1J 2G5HB 2K8BB 2F77X 4NLCA 2G06A 2DGZA 2K89A 2ZIXB 4PL1A 4P0PB 4QNLA 3D2NA 2HBKA 2HOFA 3KFUF 3H0RB 1CRXA 4JMUA 4OJ5A 3IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0Q A;  2ZIX B;  2ZIX A;  4P0P B;  2ZIU B;  4P0P A;  2ZIW B;  2ZIW A;  2ZIV A;  2ZIU A;  4P0Q B;  2ZIV B; 
#chains in the Genus database with same CATH topology
 2KVS A;  1DGJ A;  4I28 A;  2WAQ F;  2LPE A;  5EE0 A;  8ICJ A;  3B0Y A;  3NUQ A;  5KFV A;  5AM2 A;  4E0D A;  4Q45 A;  5J2F A;  4IQW A;  3UMG A;  3MC1 A;  4QW9 A;  3GII A;  2BZF A;  5C0Y A;  2GWS A;  4KLE A;  2DL0 A;  1SL0 A;  5HR6 A;  4RUA A;  2ZUB A;  1BPE A;  2W11 A;  1ZYQ A;  4C4T A;  2UVR A;  4DF4 A;  4YN4 A;  3RJJ A;  2KZ3 A;  2XCA A;  4I2B A;  2AQ0 A;  4GXI A;  3MFH A;  1YZ7 A;  4Y2P A;  5C5J A;  3UQ0 A;  1BPX A;  2EDU A;  4EEL A;  3T5K A;  4F92 B;  2VA2 A;  1T94 A;  5IIN A;  3MGI A;  3AL0 B;  4PHP A;  2WFA A;  2EAP A;  5KFB A;  3ZDA A;  5KT6 A;  4Q8E A;  4Q8F A;  1XO0 A;  4M2Y A;  4TQS A;  3FAH A;  3JPO A;  1VDV A;  2V9W A;  4NLZ A;  1LVH A;  1XC9 A;  5KFU A;  3FYH A;  1QSS A;  5DLF A;  1U47 A;  5KT7 A;  2ASJ A;  2GH1 A;  5KFC A;  4UAW A;  3N28 A;  4NM2 A;  4TUP A;  4O3O A;  1WUD A;  1TAM A;  2BDP A;  5DB9 A;  2KN7 A;  2RQ5 A;  2BCS A;  4Y2Q A;  3AN1 A;  3RB6 A;  3FDS A;  4O3S A;  2L5Y A;  4Y2U A;  4JUZ A;  3PZP A;  2DQN B;  9ICG A;  1GO3 F;  2BKE A;  4F71 A;  5BOM A;  3GFK B;  4P0P B;  1BNO A;  7ICK A;  4OJO A;  8ICY A;  4Q43 A;  3Q8P B;  1TAU A;  4NLK A;  5BOL A;  8ICQ A;  2Y0S C;  4I2I A;  3M9M B;  1NZB A;  3IG8 A;  2W9B B;  4QWE A;  3THV A;  4F5R A;  2QB0 B;  4Z6E A;  8ICW A;  3RAX A;  1ZQV A;  3MDA A;  5JU5 A;  3V7K A;  1DOQ A;  8ICV A;  5AK5 A;  1V38 A;  5KL8 B;  4DFJ A;  5KFZ A;  3BQ1 A;  3QU4 A;  3G6V A;  4F5O A;  5ALH A;  3GIK A;  4B9L A;  3VCB A;  2W7P A;  1XS9 D;  5ALT A;  4OD0 A;  5H2F U;  5IIJ A;  2FMP A;  2EZZ A;  3C29 A;  1TV9 A;  5DQH A;  5KT3 A;  1TE2 A;  4B9N A;  3SAG A;  2O6K A;  3H8S A;  1UT8 A;  3MBY A;  3PR5 B;  5EWF A;  4IS7 A;  3NS1 A;  5AKG A;  3CYM A;  5DDY A;  2KD1 A;  3Q8S B;  2VKQ A;  2JZB A;  1JXL A;  1NJX A;  3SEI A;  1SV4 A;  3QX7 A;  5BPC A;  5HML A;  4MFA A;  1XWL A;  1TK8 A;  4JK1 A;  1ZRM A;  4BX9 C;  4BWJ A;  4I2D A;  5AHX A;  3OGU A;  2QLT A;  2H3F A;  1PZN A;  4Y2X A;  1OUQ A;  3MR6 A;  2JEG A;  2KIV A;  5L1J A;  2OXO A;  5B5E U;  4EYH B;  4KLD A;  4KMO B;  2Q4T A;  4YXM A;  4C0Z A;  4EEN A;  4IQV A;  3V6J A;  3LWL A;  3RRG A;  5J0Q A;  3TAP A;  1S8O A;  4QWD A;  4DL3 A;  2NV3 A;  5AM5 A;  4KN4 A;  1SKS A;  7ICP A;  3IHQ B;  1QQ6 A;  2KHQ A;  2HBJ A;  5J0W A;  4IR9 A;  2ZIW B;  4LZG A;  1Q3V A;  3PSF A;  4MEX A;  1Z3E B;  3PSI A;  1UT5 A;  3LVW A;  3LVV A;  4US8 A;  3RH6 A;  1ZQJ A;  5DKW A;  4DSK A;  3NRZ A;  1KFD A;  4UBC A;  3UMB A;  2AJQ A;  4JB3 A;  5J0P A;  3EPG A;  7ICQ A;  5AM0 A;  3RTV A;  5HHH A;  4CF3 A;  5KFM A;  1FFV A;  1S77 D;  4UW9 A;  2D8C A;  4UB8 U;  2AHO B;  3HX0 A;  2CRX A;  4IL6 U;  4C8N A;  1ZQI A;  5J0Y A;  2W04 A;  4UAS A;  2ZXI A;  2Y9U A;  3F2C A;  5ALF A;  5HNK A;  3N7P D;  5AKE A;  4BWM A;  1QTM A;  3UQ2 A;  3PMN A;  1F0M A;  4UAU A;  1L7N A;  3SAF A;  3M9O B;  3RJI A;  1WYG A;  4YR3 A;  2G0A A;  3E2E A;  5DDM A;  2W9A A;  4DOC A;  3KD3 A;  4KLO A;  1N62 A;  5AIA A;  5KFD A;  2RRD A;  5J2H A;  8ICR A;  3AQE A;  5AK3 A;  2IHM A;  1ECW A;  2KE7 A;  2B21 A;  2DKX A;  4O3M A;  4C4R A;  4K4I A;  4K4H A;  4YCX A;  1ZQT A;  4DL2 A;  4DSI A;  4YMM A;  1ZQM A;  4DLE A;  1RQL A;  4QZE A;  4ED6 A;  2GLE A;  1ZQQ A;  2W54 A;  3R9K A;  3IG5 A;  4QJF B;  2KHV A;  4YQW A;  3F2D A;  4KLJ A;  3F53 A;  1S0V A;  4ECY A;  2KSO B;  4RQ0 A;  2WB1 F;  1ZQN A;  3BS5 B;  2N1R A;  2LM4 A;  1C7Y A;  3KHL A;  8ICP A;  3OSP A;  4CNQ A;  3ZI4 A;  3NGD A;  1JXE A;  4TUQ A;  4F5N A;  3OHA A;  3V72 A;  1S5L U;  2QB1 A;  1FIQ A;  2W43 A;  4P0Q A;  3NVW A;  2DFL A;  1D9D A;  2F8K A;  5CR0 A;  4QW8 A;  5DG9 A;  4HYK A;  2E8M A;  5KG4 A;  2FMQ A;  3K4G A;  1JN3 A;  2LYB A;  4DSJ A;  2EZY A;  2FI1 A;  3N7S C;  5L1I A;  5AK4 A;  3C2K A;  1SZP A;  3GU3 A;  5KFW A;  1IM4 A;  4RT3 A;  1ZET A;  4GLX A;  4C8M A;  4UAR A;  2YN4 A;  5EOZ A;  1X42 A;  2FDR A;  3QZ7 A;  2G08 A;  1DGS A;  4NLB A;  1H38 A;  3KHR A;  1ZQH A;  2UVU A;  2NRX A;  5ALX A;  1PK1 A;  1ZJM A;  2C2E A;  3SQI A;  3OJU A;  2J6S A;  8ICE A;  4Z6C A;  7ICM A;  8ICF A;  5A0L A;  2G09 A;  3C2L A;  3EUB 2;  1S97 A;  5EWE A;  2F1J A;  3PW7 A;  7ICH A;  3JPS A;  8ICK A;  1L7O A;  3CNH A;  3DDH A;  3HJE A;  4G9B A;  2EQY A;  5KFP A;  4IRD A;  5J8Y A;  3IRU A;  1XSN A;  3IM1 A;  2A19 A;  1FEZ A;  2K8B B;  1RXV A;  1ZXI A;  2G06 A;  5ALE A;  4UB5 A;  3WK5 A;  8ICM A;  4F4Z A;  5J8Y C;  4YG2 A;  3HWT A;  3ISB A;  3L4P A;  8ICL A;  5KFY A;  4DL7 A;  1SZH A;  1DK3 A;  3SV4 A;  3AUO A;  1BNP A;  3TAN A;  4KLS A;  5DBC A;  4DWI A;  4RZR A;  2LI6 A;  4JWM A;  1X66 A;  2HHT A;  4C8O A;  1TAQ A;  4KLM A;  1ZQC A;  3G6Y A;  4IRC A;  1KKX A;  4DSF A;  1MQ2 A;  3T5J A;  3CRX A;  2RP5 A;  3WKB A;  3NRW A;  1M6Y A;  4ELV A;  4DS5 A;  2E8O A;  4YD1 A;  2OEH A;  5L1M A;  1N5W A;  3KZI U;  4PJ0 U;  3MR2 A;  2BDU A;  5AKL A;  2R8I A;  4AYB F;  3LK9 A;  4C8K A;  5KG2 A;  1UA1 A;  5HHI A;  9ICW A;  2VIX A;  3D6J A;  5JTI A;  2FPM A;  1QH9 A;  5ALK A;  5JRT A;  2NRV A;  3I1Y A;  3ZDC A;  3UXP A;  3AM9 A;  1AQ6 A;  3SEN A;  7ICV A;  5AM1 A;  1Z19 A;  4DEZ A;  2ZUD A;  1V9P A;  3BQ0 A;  3U26 A;  2C22 A;  2M0N A;  2I1Q A;  3HIL A;  4ECW A;  2W3R A;  2XIC A;  2JZB B;  2FLL A;  5J2C A;  2JHD A;  4KIT B;  2LMR A;  4ELT A;  2HVH A;  5AI9 A;  1DK2 A;  2CPR A;  4DQQ A;  4FZM A;  2YB4 A;  5AI5 A;  2JV3 A;  2F77 X;  2JR5 A;  5AM3 A;  4NLC A;  2XC9 A;  4EZ6 A;  4ED2 A;  1Q3U A;  4OJ5 A;  2K4I A;  2P6U A;  2OHF A;  8ICZ A;  2R18 A;  3T79 A;  5KFS A;  9ICR A;  2W7O A;  5KAI U;  2OH2 A;  2H3V A;  4US9 A;  4PH5 A;  2BR0 A;  4M0A A;  1SIJ A;  1S10 A;  3RH4 A;  1KEJ A;  3NVY A;  4RUC A;  4R65 A;  7ICO A;  2F8L A;  4J9R A;  1BPD A;  4DFD A;  2LYH A;  2H3I A;  3KHH A;  2J6U A;  2KOB A;  2XID A;  7ICR A;  3DEE A;  4QZ8 A;  8ICX A;  2ZIV B;  4B6J A;  2PMZ C;  5DB6 A;  3ISD A;  3TFS A;  2MA1 A;  2KNJ A;  4TUR A;  1ZQU A;  4HAI A;  2LYA A;  4M04 A;  2XGQ A;  1MC8 A;  3BZK A;  3LWM A;  1SL1 A;  1WWU A;  5DG7 A;  1NK0 A;  1IIP A;  9ICL A;  2W9M A;  9ICO A;  2HCF A;  2K4H A;  4DL4 A;  2NO5 A;  3PO5 A;  2MUT A;  4B9M A;  2ATL A;  5K4L A;  4KLT A;  4P4P A;  4ED7 A;  2ES6 A;  3E58 A;  1QQ7 A;  4QZ9 A;  2ESE A;  3WK4 A;  1J2M A;  2JH7 A;  1ZJN A;  1NK8 A;  2OYY A;  4RQ3 A;  4O9M A;  4J9O A;  4MFF A;  5KT4 A;  4F4K A;  2OCE A;  1Z1V A;  1T3N A;  5TIS U;  2BQR A;  4UB6 U;  1CRX A;  3V7L A;  2C2D A;  3AU6 A;  5KFK A;  2H5X A;  3GIJ A;  3EZ5 A;  5J2B A;  3WK6 A;  4EYI B;  4NJ8 A;  9ICA A;  3NTU A;  4KX5 A;  1X9X A;  1WCL A;  4U6P A;  3KHG A;  1X6I A;  2F44 A;  2V4R A;  3K75 D;  2D6F C;  5FP0 A;  1VJ5 A;  3ONN A;  2JXJ A;  1IV8 A;  2I6X A;  5ALO A;  2IA6 A;  2ZUC A;  3TAC B;  2ASL A;  2KFZ A;  2W9C B;  5D4B A;  3HT3 A;  3ISC A;  4JWN A;  1N5X A;  3NAS A;  4FZL A;  4F3O A;  4P0Q B;  3QXG A;  3ICX A;  2K8A A;  4CRX A;  1LB2 B;  3H4D A;  7ICU A;  5J0T A;  3OPX A;  5TZV A;  4F93 B;  3PW4 A;  3H8W A;  3PX4 A;  9ICX A;  2G07 A;  1JIH A;  4FS1 A;  5EE9 A;  4ECS A;  4YXJ A;  4PHE A;  4I2A A;  5ALU A;  1WWV A;  5KTQ A;  1NJZ A;  4PHA A;  1Q46 A;  2WF9 A;  4UAT A;  2ZIX A;  1TK5 A;  3QNM A;  2KKP A;  1PK1 B;  4BJQ A;  1B4F A;  5ALM A;  4CF4 A;  4YR2 A;  2XO7 A;  3M8R A;  3BDP A;  4RPZ A;  5DB8 A;  2AH5 A;  4R64 A;  9ICC A;  2V4Q A;  5HP4 A;  1SKR A;  2OWO A;  5AKY A;  5T14 A;  3G6X A;  1XNS A;  2E8P A;  2EH9 A;  4C8L A;  4PPX A;  4FS2 A;  5E79 U;  2Z7J A;  4UB3 A;  3K1R B;  2HOQ A;  3OTQ A;  3QYP A;  3I28 A;  4DO9 A;  3O0F A;  2GO7 A;  1YT3 A;  1KW4 A;  3S6J A;  1Z4N A;  5KG0 A;  4PGX A;  4F4X A;  3ZDE A;  5F9L A;  2IOF K;  5AKJ A;  1JI7 A;  2W8K A;  3C28 A;  1KQQ A;  5CP2 A;  1COO A;  1NK5 A;  3GDX A;  1NKE A;  1J97 A;  1UA0 A;  2KEY A;  4GXJ A;  2B0C A;  2JRZ A;  1ZQF A;  4LJX A;  5ALY A;  4ED8 A;  4QZB A;  1NI3 A;  4BGD A;  4JV1 A;  2YMM A;  3N4M B;  1X9W A;  3SI8 A;  1N2X A;  1Z00 A;  4R66 A;  5D49 A;  1RDF A;  4JV2 A;  3TI0 A;  3E0F A;  4YVZ A;  3PX0 A;  3T5L A;  3ALR A;  2MU2 A;  5IIK A;  3ZD8 A;  4O3Q A;  2HBM A;  3KZX A;  1RYR A;  9ICQ A;  5L1L A;  2ZXH A;  2KJ8 A;  4WJ3 B;  4RQN A;  3JPR A;  2BQ3 A;  1TVA A;  4KLG A;  2EAM A;  3MR5 A;  2FLP A;  4CE6 A;  1SXE A;  1NKC A;  3QEB Z;  5DQI A;  4LVS A;  2WF7 A;  4J9Q A;  4UAZ A;  1QSY A;  1Q8K A;  4O3P A;  4P4O A;  4RQ1 A;  3D2S A;  3PSP A;  3PST A;  2EZX A;  2PXI A;  4EBD A;  2XI9 A;  4QZA A;  1IG6 A;  4RU9 A;  1D8B A;  1X40 A;  3V6K A;  2Y0S F;  3IV6 A;  1S0M A;  4FBU A;  3JPN A;  2R8H A;  4DOA A;  3H4B A;  3TFR A;  1CEZ A;  3QEA Z;  4FO6 A;  1JRO A;  5CWR A;  5DBA A;  3M9N B;  1XO1 A;  4IR1 A;  4QIW C;  2VJ4 A;  4Y2T A;  4GFJ A;  3RR7 A;  1CI4 A;  3Q8R B;  1WG8 A;  1A6S A;  2NO4 A;  3Q8K A;  4M6W A;  5AKI A;  3H0R B;  5KT5 A;  5ALL A;  5KNI A;  4RQ8 A;  4KLF A;  1HUO A;  1NJW A;  2A1A A;  4DSE A;  8ICB A;  4ZH4 A;  2WHE A;  4CF5 A;  7ICN A;  2PFP A;  2XGP A;  5KFJ A;  3BZC A;  1ZOL A;  1SWV A;  1RXW A;  1URJ A;  5KFE A;  4NLN A;  7ICS A;  5KG3 A;  3HPO A;  1L3S A;  2JEI A;  4A8E A;  2A1J A;  3RJH A;  1YZ6 A;  1COK A;  1D9F A;  1BPB A;  2EAN A;  3NVV A;  2A3V A;  4F72 A;  3ORY A;  3HKZ C;  2YB1 A;  3EWA A;  1PVP A;  2RDJ A;  2JEF A;  4RQ6 A;  5AI8 A;  5III A;  2XY7 A;  4M47 A;  2Y1J A;  5KFH A;  3WKD A;  4DSL A;  4DFM A;  2MUT B;  2HHV A;  5KFL A;  7ICG A;  9ICF A;  2WF5 A;  4F2S A;  4O3R A;  1HJP A;  4TQR A;  2FE9 A;  3QUB A;  2WAQ C;  4YR0 A;  4ED1 A;  2ZG6 A;  3PV8 A;  3BQT A;  3RBE A;  1RYS A;  3C5F A;  5CA7 A;  1B0X A;  4X5V A;  1LKY B;  2HOF A;  2BPC A;  2HHW A;  2JGA A;  4KLI A;  2NRT A;  5IIM A;  1QCK A;  1RZT A;  1S0O A;  5KG1 A;  3KKA A;  4Y2V A;  2BCQ A;  4KLL A;  4K4G A;  2F1H A;  5KFR A;  4PGQ A;  1PUZ A;  4ECQ A;  2NRW A;  4G3I A;  3PML A;  3RB3 A;  2F76 X;  3KKA C;  5KFQ A;  4UB1 A;  3PY8 A;  3WK9 A;  5EE3 A;  4JV0 A;  2I9G A;  3N7R C;  2F2A B;  2E8N A;  2AGQ A;  3QE9 Y;  2PFQ A;  1KTQ A;  3RRH A;  1ZQO A;  1UCV A;  2I5H A;  1L8O A;  2BCV A;  3RJF A;  3HW8 A;  2WF8 A;  2IOF A;  3H40 A;  1L6N A;  1WCN A;  2E5S A;  3SR6 A;  2DBY A;  9ICI A;  5IIL A;  1ZQY A;  4O0I A;  3BJY A;  3JPQ A;  4I2E A;  5CRX A;  9ICU A;  1A0P A;  2HI0 A;  2CXY A;  3SV3 A;  2JEJ A;  5AI0 A;  5AKZ A;  1BPY A;  4M9J A;  1RM6 C;  5AKK A;  5ALP A;  4OJ6 A;  4Y2J A;  1X2I A;  5B66 U;  1X6J A;  1U9L A;  1EXN A;  3IDW A;  3C23 A;  4RPX A;  1SL2 A;  2ZJ8 A;  5ALD A;  2E1E A;  3F5E A;  3MAB A;  1UHU A;  2LM1 A;  3H0L B;  2YTU A;  3AU2 A;  1ZQE A;  7ICJ A;  3JPP A;  4RQ2 A;  3V7J A;  4F5Q A;  3RJE A;  1ARO P;  4BDP A;  9ICK A;  1U45 A;  1U49 A;  3WU2 U;  8ICS A;  2R8K A;  4ICA A;  4J9S A;  5KFT A;  2ZJA A;  3TQ1 A;  2BCU A;  3H0M B;  4I27 A;  3T3F A;  3GV8 B;  9ICN A;  1L3U A;  1U48 A;  5GTH U;  2ZIX B;  5J2I A;  4QZH A;  3KFU F;  9ICE A;  4JMU A;  2UVW A;  3C1Z A;  3T5H A;  9ICH A;  1V85 A;  4I2H A;  5J29 A;  5J0R A;  4XQ8 A;  4DQI A;  3LYS A;  5KFF A;  4NXZ A;  4I2G A;  3B0X A;  3UMC A;  2LKY A;  5DG8 A;  5DQG A;  2K4E A;  4ED0 A;  3SMV A;  1ZRN A;  3QUQ A;  4M9H A;  4ECR A;  4ECT A;  1D8Y A;  1OXJ A;  1BVS A;  2E3T A;  5G5H A;  4XUS A;  1L3V A;  3WKC A;  2D3D A;  3WKA A;  4YMN A;  4XA5 A;  1F5S A;  1KL9 A;  3H8M A;  5AIB A;  1ZQL A;  2ZIU A;  1NOM A;  4KLQ A;  4OJP A;  1OW5 A;  4U7C A;  2KP7 A;  4MF2 A;  1S0N A;  4F2R A;  4I2C A;  1PVQ A;  1TFR A;  3BS5 A;  2VA3 A;  5ALN A;  4QZI A;  4UB4 A;  3UXN A;  4J03 A;  2DPI A;  1JRP A;  3C21 A;  2RHF A;  2HVI A;  3QU2 A;  4J9N A;  1KFS A;  4TUS A;  4XRH A;  4KN7 A;  5AK6 A;  1ZQK A;  8ICA A;  5KFI A;  4GXK A;  3H7I A;  5J0O A;  1Z00 B;  2R8J A;  3ED5 A;  5DGA A;  4DF8 A;  2AXT U;  8ICC A;  2IOH A;  3A0H U;  2DPJ A;  2K89 A;  2NYV A;  2ISO A;  3AEV A;  3ETL A;  7ICE A;  5J2K A;  2HSZ A;  4BXO A;  2KK0 A;  2FPL A;  4RQ5 A;  2HHS A;  2KIW A;  3ETR A;  2YX8 A;  2XY5 A;  5ALZ A;  2HW3 A;  2W3S A;  1B22 A;  3AMZ A;  2YMQ A;  4RNM A;  4RQM A;  2P6R A;  4QZF A;  2H3Q A;  2UVV A;  1KBU A;  2P66 A;  4Q44 A;  1ZD3 A;  2YY6 A;  3ZDB A;  3QZ8 A;  4NLG A;  1NK9 A;  1K5O A;  4Y2Y A;  4UAY A;  3PNC A;  1RQN A;  4DOB A;  2WTF A;  1ZQZ A;  1XSL A;  4F8R A;  4R8U A;  8ICG A;  4FE3 A;  4F4W A;  4MEY A;  7ICI A;  3C2M A;  1K1S A;  1VLB A;  4ECU A;  5ALW A;  2Y9T A;  1JX4 A;  1T8E A;  4DLG A;  1Z4O A;  4O5E A;  2KKV A;  2R8G A;  2M9N A;  8ICH A;  1TKD A;  3GV5 B;  4RPY A;  1LV5 A;  2KV2 A;  4DS4 A;  2XVT A;  1ED1 A;  4M6W B;  4QZG A;  1B43 A;  4F91 B;  3Q8M A;  1F44 A;  2KIC A;  4EX6 A;  2MRL A;  3RJK A;  4B9S A;  3HP6 A;  4UQG A;  3BQ7 A;  4YMO A;  3B9J A;  3SD7 A;  2PKE A;  9ICV A;  3MGV A;  5CEH A;  3V6H A;  2QAR A;  2XY6 A;  4J9M A;  2KJ9 A;  4AP9 A;  4C7Z A;  1N63 A;  3FC4 A;  2E1F A;  2HMX A;  3EW9 A;  5AIC A;  2A1J B;  1K1Q A;  1C20 A;  3M6K A;  4KTQ A;  2WB1 C;  3H8J A;  1RYU A;  2DKZ A;  5F9N A;  3MGH A;  2G5H B;  2PI4 A;  2DGZ A;  8ICU A;  4R63 A;  3QUT A;  1KLN A;  4LZD A;  5CJ7 A;  4CGZ A;  3GIM A;  4QWA A;  3SYZ A;  5KFX A;  2GOL A;  2ZTC A;  1L5U A;  1ZQX A;  3KTQ A;  1X9M A;  1NNL A;  5KG5 A;  1XSP A;  1N56 A;  3GV7 B;  1N48 A;  3TKA A;  1DRG A;  3L5K A;  2JMG A;  3UXO A;  4KMU A;  2VA8 A;  4F4Y A;  2KVC A;  4DL6 A;  4B9T A;  2ZJ5 A;  1MA7 A;  4RQ7 A;  5GTI U;  4YFK A;  3M6Z A;  7ICL A;  3PO4 A;  4Y2R A;  3D2Q A;  4UBB A;  1L7M A;  2B6G A;  1O08 A;  1ZQS A;  2DUY A;  1ZQA A;  3TAD A;  5AKX A;  1UQV A;  4I2F A;  2K4P A;  4DQP A;  2OM6 A;  5J2J A;  8ICI A;  3IN5 A;  4ELU A;  4Y2S A;  3TAD C;  3Q8Q B;  2BPG A;  1ZD5 A;  5AM4 A;  2ZTE A;  2C2R A;  4NY8 A;  3PW0 A;  1NK7 A;  1J2N A;  3M7D A;  5AI6 A;  5J0X A;  2PMZ F;  3UM9 A;  3UPQ A;  4USA A;  3RBD A;  4I2J A;  4Z6F A;  1MSW D;  5J2D A;  2ZTD A;  4QZC A;  2W8L A;  2DF4 B;  3GZF A;  3SAH A;  5IIO A;  5J2A A;  2BQU A;  4P4M A;  1LKY A;  5DGB A;  4I29 A;  1HEK A;  8ICT A;  4IC9 A;  1SV0 A;  9ICM A;  4ZOH C;  1CUK A;  5AKH A;  3F2B A;  3QU7 A;  1ZQG A;  3PW5 A;  2CN1 A;  9ICP A;  2ZIV A;  4EZ9 A;  4UB2 A;  5ALG A;  1A76 A;  1SV0 C;  9ICT A;  2FJ6 A;  2HBK A;  4ED3 A;  4KLU A;  3C1Y A;  4NV0 A;  2KG5 A;  4NM1 A;  2RDI A;  4OCZ A;  5ALQ A;  1SGG A;  9ICB A;  1ZD2 P;  2K8C B;  3NVZ A;  4NL9 A;  5L9X A;  1T4G A;  2XCP A;  3OSN A;  4GIB A;  1QLN A;  3QU9 A;  1O03 A;  4AYB C;  4M9G A;  2HHX A;  4NL9 C;  3RH5 A;  1U4B A;  5HR7 A;  4M9N A;  9ICJ A;  1ZD4 A;  3C5G A;  4EX7 A;  4ECX A;  1FFU A;  1ZQ1 C;  3WK7 A;  1MN8 A;  2ASD A;  2KFN A;  1N60 A;  1QQ5 A;  5DB7 A;  1JAL A;  4DFP A;  1ZQW A;  2YML A;  3OHB A;  2RLT A;  2KJ5 A;  5ALI A;  3TAR A;  8ICN A;  2HOI A;  2PI5 A;  3RF9 A;  1ZQD A;  4O3N A;  4PHD A;  4FZN A;  2DWQ A;  5DBB A;  2IMW P;  5HMM A;  2F1I A;  5CB1 A;  3RB0 A;  2FPK A;  5J0S A;  2ZIU B;  5J2G A;  3PR4 A;  4CDG A;  9ICS A;  4OJL A;  4P2H A;  3PX6 A;  4C80 A;  4C7Y A;  3KBB A;  3HRD D;  4P0P A;  3SZ2 A;  1D8L A;  2G5I B;  4ACO A;  5KL1 B;  2LBO A;  3AQF A;  1N61 A;  2VAN A;  4QWC A;  4DCC A;  3DV9 A;  2HDO A;  5ALV A;  4MHV A;  2WF6 A;  3ZD9 A;  3IP4 B;  2W9C A;  4PL2 A;  5KG6 A;  4GC6 A;  1SXD A;  1SWW A;  5ALJ A;  2W9B A;  5G5G A;  3D2N A;  1NKB A;  1KSP A;  4DQS A;  2QB0 A;  3PW2 A;  3WK8 A;  2W03 A;  1DXS A;  1NK6 A;  3I76 A;  1ZQR A;  2AGP A;  3KOO A;  2FMS A;  2YMP A;  1NJY A;  1P7D A;  4PGY A;  1Z1B A;  5KT2 A;  2H3Z A;  4QZD A;  1HIW A;  1KN5 A;  3ZDD A;  3JPT A;  3FM9 A;  4BXO B;  1TK0 A;  2K60 A;  2C28 A;  2PFO A;  3RFA A;  3TAQ A;  4DL5 A;  3GQC A;  1JUD A;  1BPZ A;  4KLH A;  1T3Q A;  5KG7 A;  2HBL A;  3M1Y A;  4GC7 A;  7ICF A;  2YQE A;  4IQU A;  4O5K A;  4FBT A;  2Q0Z X;  1A77 A;  5CHG A;  4NWI A;  2IBK A;  1V97 A;  5EWG A;  5AI4 A;  4J9P A;  4O5C A;  3RR8 A;  1SB3 C;  4IRK A;  2LHT A;  1L8L A;  2MSN A;  1ZQP A;  4R8U B;  5KFN A;  3M8S A;  4MFC A;  4FFD A;  1QSL A;  1KDH A;  3LDA A;  4J9K A;  1Y88 A;  5D46 A;  4UAV A;  5L1K A;  4ECZ A;  4MF8 A;  1S76 D;  2ODG A;  5KFA A;  2W55 A;  1HUZ A;  2IHN A;  2AQ4 A;  4EEK A;  4YD2 A;  1PVR A;  8ICO A;  1BGX T;  4M9L A;  2ZIW A;  3A0B U;  1MQ3 A;  2QAR B;  4PL1 A;  1S9F A;  2BPF A;  2PFN A;  7ICT A;  2QKQ A;  1SKW A;  2BCR A;  2KZZ A;  2AGO A;  4YP3 A;  2KZM A;  4DQR A;  5ALR A;  1KRP A;  4IQT A;  2KTQ A;  3BS7 A;  1IXR A;  2AU0 A;  1NK4 A;  1NZP A;  1XU4 A;  4RT2 A;  5J2E A;  4ECV A;  4CCH A;  1RG6 A;  3N97 B;  3QUC A;  4EEY A;  5KFG A;  3J81 j;  5EE1 A;  2HHQ A;  4J9L A;  1T7P A;  1ZQB A;  2BHN A;  1X9S A;  3L3F X;  3RJG A;  3CP8 A;  1JMS A;  4KX3 A;  4QWB A;  3QU5 A;  4PZO A;  2Y1I A;  4QIW F;  1FO4 A;  4RNN A;  3OJS A;  1RPL A;  2FLN A;  5DLG A;  2KMD A;  4EBE A;  5ALS A;  2ISP A;  3Q8L A;  5J0U A;  3K1Z A;  3RAQ A;  4B9U A;  5F3X B;  5JUM A;  1UPH A;  3GIL A;  4BUG A;  2MAX A;  2EAO A;  4EBC A;  2HHU A;  2P35 A;  4RQ4 A;  1L3T A;  3MFI A;  3WKE A;  3MDC A;  3F5A A;  4B9V A;  1L7P A;  4PZN A;  1KFT A;  1PK3 A;  3EPI A;  4RNO A;  3EYZ A;  2J6T A;  2JH1 A;  5KFO A;  3MR3 A;  2ALZ A;  2KSO A;  2VJ5 A;  3PVX A;  3HKZ F;  2F3N A;  2NRZ A;  3VC8 A;  4OO1 J;  2BGW A;  4C4S A;  4DFK A;  3RB4 A;  4QNL A;  4Z6D A;  4F50 A;  3BQ2 A;  5KAF U;  4F5P A;  3CW2 C; 
#chains in the Genus database with same CATH homology
 4CGZ A;  4QJF B;  2K4I A;  2KHV A;  2JGA A;  2NV3 A;  4OJO A;  3F2D A;  1SZH A;  5T14 A;  1XNS A;  4NV0 A;  3F53 A;  2GOL A;  2WAQ F;  2R18 A;  3T79 A;  2WB1 F;  2W03 A;  2KIW A;  2KHQ A;  2HBJ A;  2YX8 A;  2Y0S C;  2N1R A;  2Z7J A;  3LYS A;  2ZIW B;  2W7O A;  1NZB A;  3D2S A;  2HOQ A;  3NUQ A;  2LKY A;  1Q3V A;  1DRG A;  3PSF A;  3PSP A;  1P7D A;  2JMG A;  2K8C B;  3IG8 A;  3PST A;  1Z1B A;  2H3Z A;  1Q3U A;  1HIW A;  2K4E A;  4KX5 A;  2H3V A;  3O0F A;  2OH2 A;  3PSI A;  2XI9 A;  3LVW A;  3LVV A;  3SMV A;  5C0Y A;  2KVC A;  2H3Q A;  1YT3 A;  1KBU A;  3CRX A;  2RP5 A;  5HR6 A;  1D8B A;  4U6P A;  1MA7 A;  2F76 X;  4AYB C;  3NRW A;  2Y0S F;  3RFA A;  4P0Q A;  3M6Z A;  3N7R C;  2F2A B;  5HR7 A;  2F8L A;  2D6F C;  2H3I A;  3ONN A;  2HBL A;  2KOB A;  3D2Q A;  5KL8 B;  2XID A;  3C28 A;  4QIW C;  1ZQ1 C;  2VJ4 A;  3DEE A;  4GFJ A;  2BDU A;  2ZIV B;  2LYB A;  1A6S A;  3VCB A;  4AYB F;  2CRX A;  2KEY A;  3L3F X;  2W7P A;  3N7S C;  2PMZ C;  4FE3 A;  4FZL A;  4NWI A;  2OM6 A;  2W04 A;  3CP8 A;  2ZXI A;  3IN5 A;  4KX3 A;  3C29 A;  4P0Q B;  1L6N A;  1T94 A;  2E5S A;  2KNJ A;  2MA1 A;  2VIX A;  3F2C A;  3ICX A;  3GU3 A;  2K8A A;  4CRX A;  2LYA A;  5CRX A;  3SAG A;  3AL0 B;  2ZIU A;  2KJ5 A;  3N7P D;  3OPX A;  4QIW F;  2KKV A;  1A0P A;  3SAF A;  2HOI A;  4OJP A;  2LHT A;  1XO0 A;  4U7C A;  2G08 A;  3RF9 A;  3M7D A;  2KV2 A;  2PMZ F;  3CYM A;  2KD1 A;  1IIP A;  2XVT A;  4FZN A;  2VKQ A;  1ED1 A;  2G0A A;  2K4H A;  3K1Z A;  4NLB A;  4OJ6 A;  1URJ A;  1PVQ A;  2G07 A;  1F44 A;  2RRD A;  3SQI A;  1UPH A;  4BUG A;  2KIC A;  1Z19 A;  2MRL A;  2ZIU B;  4CDG A;  2DF4 B;  3AQE A;  4A8E A;  2E1E A;  3F5E A;  3E0F A;  1ECW A;  3GZF A;  3H0L B;  3SAH A;  4OJL A;  2M0N A;  2RHF A;  3ALR A;  2A3V A;  2GH1 A;  3F5A A;  5A0L A;  4BX9 C;  3HKZ C;  3MGV A;  4O3M A;  2YB1 A;  1PVP A;  2G09 A;  2XIC A;  2ZIX A;  4P0P A;  1WUD A;  2G5I B;  2JHD A;  2HBM A;  3KZX A;  2H3F A;  1TAM A;  5KL1 B;  4ACO A;  2KKP A;  2LBO A;  1OUQ A;  2JH1 A;  2KJ9 A;  3AQF A;  4BJQ A;  4ICA A;  1HEK A;  2OXO A;  2JH7 A;  4IC9 A;  2ZXH A;  2KJ8 A;  4KMO B;  2E1F A;  2HMX A;  3F2B A;  2OYY A;  2Q4T A;  3H0M B;  2WAQ C;  2ZG6 A;  1PVR A;  3M6K A;  4C0Z A;  2VJ5 A;  2WB1 C;  2CN1 A;  3IP4 B;  4WJ3 B;  2CPR A;  3HKZ F;  4FZM A;  4PL2 A;  2ZIW A;  2YB4 A;  2DQN B;  3VC8 A;  2ZIV A;  3PZP A;  1GO3 F;  4OO1 J;  2G5H B;  2K8B B;  2F77 X;  4NLC A;  2G06 A;  2DGZ A;  2K89 A;  2ZIX B;  4PL1 A;  4P0P B;  4QNL A;  3D2N A;  2HBK A;  2HOF A;  3KFU F;  3H0R B;  1CRX A;  4JMU A;  4OJ5 A;  3IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...