5E79U

Macromolecular diffractive imaging using imperfect crystals
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5e79U01
3KZIU 5GTIU 5KAFU 4PJ0U 5B66U 2DUYA 5TISU 3A0HU 4UB6U 5KAIU 1S5LU 5H2FU 4IL6U 3WU2U 5GTHU 5E79U 3A0BU 2AXTU 4UB8U 5B5EU
chains in the Genus database with same CATH superfamily
1RYUA 5AI4A 2A1JA 2WFAA 1QCKA 5EOZA 2B0CA 2KIWA 1ZQIA 3SAHA 1Z4OA 3BZCA 3V6HA 4QZEA 4Q8FA 1FIQA 4KLDA 4RUAA 5ALPA 5J2KA 1J97A 2YN4A 4MF8A 4GXKA 5ALIA 1U48A 5KT6A 3NASA 4O3QA 4C8KA 5CP2A 4MEXA 3RAXA 3KKAC 5J29A 2D8CA 1X9WA 4ED0A 1LV5A 1XO1A 2I9GA 4R8UB 4QZFA 5KFMA 1SZHA 2YMMA 3WK6A 4F5OA 2HHVA 3H8WA 2G08A 5BOMA 3JPNA 5GTIU 3KHGA 2RQ5A 4Q43A 4I2CA 4C8LA 3M8SA 3NRZA 3OPXA 1ZQOA 2XY6A 4RQ7A 5F9LA 4KX5A 4O3OA 4QWDA 1PK1A 2UVUA 2YMQA 2MUTA 3A0BU 9ICMA 5L1MA 2ZUCA 1KDHA 5J8YA 5KFSA 2NRTA 2LHTA 1X6IA 2KFZA 2RHFA 4O3SA 3BQTA 3G6VA 1KL9A 2XGQA 3D2NA 1S5LU 1AQ6A 4Z6EA 2I1QA 2W9MA 1ZQBA 3IM1A 4Y2YA 5JU5A 1NJWA 3KHRA 3C2MA 5J0YA 2PI5A 2C28A 4GIBA 4HYKA 1NK0A 1TKDA 3L4PA 4G9BA 4B9LA 1KTQA 1D8LA 4B6JA 1O03A 4LZDA 1JMSA 1MN8A 3HW8A 4F5RA 4QZ8A 4MF2A 4F5PA 3QX7A 4ECXA 1SV4A 4KLLA 4FS1A 1S0MA 1B43A 1N2XA 2JR5A 2XIDA 4F5NA 4UB6U 2XC9A 1SGGA 4P4OA 3GDXA 4EYHB 3KKAA 4UAZA 1ZQTA 4YMMA 3BQ2A 7ICTA 4UB1A 3RJFA 5J0XA 2XCAA 5AI9A 4QZGA 2W9CB 3F2BA 3KTQA 2F44A 2XY7A 9ICWA 1KQQA 1HIWA 3BJYA 4IRKA 8ICBA 3BS7A 4UARA 2G07A 4RT2A 9ICFA 4KLTA 1LB2B 3WK4A 5EWFA 2GLEA 3QU9A 1S8OA 1TV9A 2F8KA 1N5WA 1V9PA 3EPIA 5AIBA 3ZDDA 2W9BA 4DO9A 1QQ6A 4RQ8A 4PGYA 2JHDA 3SQIA 4NM2A 4B9VA 2AQ0A 2FMPA 1Z1BA 8ICYA 3M9OB 3CNHA 2QARB 1L8LA 2L5YA 1MC8A 4CDGA 1ZJNA 5KFQA 1MQ2A 2V9WA 2HBMA 2E8NA 2ESEA 4DQIA 1IM4A 2ZXHA 4QIWC 4PHEA 2MRLA 5AIAA 3SAGA 5D46A 5DB7A 1U47A 4UAWA 2DUYA 4Y2RA 1RPLA 1WWVA 2VA8A 4Z6CA 3A0HU 4IRDA 8ICFA 4EBCA 5HMMA 2NV3A 3UPQA 4ED2A 1UT5A 4DWIA 2GWSA 3NVYA 5IINA 1TFRA 3CYMA 2J6SA 3ISBA 3ZDBA 9ICTA 1DGJA 3MGVA 1NKBA 1A76A 5J2BA 3V7LA 5CHGA 4P0QB 5AI5A 3RJHA 2F2AB 4O9MA 1X9XA 1DRGA 3NVZA 2OYYA 1MQ3A 5H2FU 2W55A 2HOFA 1U49A 2HHSA 2KVSA 3E2EA 3B9JA 3C2LA 1L7OA 2KHVA 2HOIA 2HVHA 3Q8RB 4R64A 5DKWA 2NRVA 4YMNA 5AKYA 2JEFA 2ES6A 2O6KA 3ZD9A 2C2RA 5J2FA 4YQWA 1JIHA 3MDCA 7ICRA 5KAIU 2A3VA 3F2CA 2PMZC 3QEAZ 3HJEA 1ZJMA 3MC1A 3PX4A 2IA6A 2KJ9A 3QUTA 2JH1A 5KT3A 2ZG6A 2F1JA 3IG5A 4UB3A 2QB0B 3DDHA 4JV2A 5HR6A 1ZQAA 3WK7A 3BQ0A 4YCXA 2HBJA 5JTIA 1ZQVA 2XO7A 9ICSA 3E58A 5AM2A 1NJYA 2YB1A 3MABA 3NS1A 7ICMA 3N97B 4KMOB 4FZNA 3JPSA 3T5KA 3Q8MA 1VJ5A 4DS4A 1TVAA 5KFTA 5AM0A 1TK0A 3CP8A 3G6YA 5KL1B 1S9FA 2PI4A 3ONNA 1ZQFA 4EYIB 3ZDCA 3T5HA 1LKYA 3Q8QB 2DPJA 4DSLA 1CI4A 1RYSA 3OTQA 3I76A 1WUDA 1ZQEA 1CEZA 2F1IA 2G06A 2BZFA 3TFRA 2Z7JA 3QEBZ 2XY5A 3R9KA 5ALJA 4I2AA 3ZDAA 3F5AA 4TQRA 2PKEA 3WK8A 2JEIA 3HPOA 5HHIA 4Q44A 1ZQ1C 3QUCA 4XQ8A 5AKHA 4QIWF 3SR6A 3MFIA 4FFDA 3T5LA 1CUKA 4GXJA 4X5VA 1Z19A 3WK9A 4ECYA 3RB6A 3RB4A 5AK3A 4CCHA 1URJA 2BDPA 1ZYQA 1S77D 4CE6A 2YMPA 1L3SA 1RDFA 2BCVA 5DG9A 1Z1VA 4U6PA 1JUDA 2IOHA 2K4HA 4KLFA 4DF8A 1PVRA 2P6RA 1TAMA 5BPCA 5ALXA 4OJ6A 1TE2A 5KFXA 5J2DA 3RJKA 5DQGA 3C21A 4YR2A 5F9NA 4ZH4A 5IIMA 4RQ6A 2WF6A 3V6JA 1BNOA 7ICIA 3HT3A 2M0NA 5DQHA 4JWNA 4RQ2A 5J0RA 1C7YA 2PMZF 4P0PB 3C28A 4ED8A 5KFIA 4NLKA 3KZXA 1JX4A 3QU4A 1SKWA 2CN1A 5L1JA 2E8PA 3SMVA 5KFEA 3Q8PB 1ZQYA 5DBAA 8ICLA 4J03A 2CXYA 4C8NA 1KSPA 2FMSA 3DEEA 3BQ1A 7ICKA 1NK8A 1TK5A 4KLQA 5AM5A 1NK4A 1VLBA 3E0FA 3J81j 2HBLA 2PXIA 1N61A 3FDSA 4ED3A 4KLHA 2W7PA 9ICAA 5IILA 7ICQA 3UQ0A 3ISDA 3TFSA 1BPYA 5D49A 2OH2A 3PW5A 3FAHA 1BGXT 1XWLA 2UVWA 4BXOB 1Q46A 3D2QA 3VC8A 3MGHA 3AM9A 1S76D 3MGIA 2DF4B 8ICAA 1JALA 4ACOA 4KITB 5KT5A 7ICNA 4XA5A 3RJIA 4C80A 5EE3A 4NLBA 5CEHA 1D8YA 2MU2A 2LYHA 4C0ZA 5DGBA 4EBEA 5KTQA 2P66A 3C1YA 4A8EA 5KG6A 3AMZA 2LM4A 3WKEA 4GC7A 3PX6A 1ZQPA 4DFJA 4NLCA 1PZNA 3AQFA 3AN1A 4DQPA 4QZDA 2WF8A 3BZKA 2GOLA 4Y2JA 1S10A 3WKDA 4M9JA 2Y1IA 1BPXA 4WJ3B 5IIIA 4NWIA 2K4IA 8ICWA 3SAFA 4UBCA 3M7DA 2W43A 5IIKA 5ALVA 3JPPA 3C5FA 3LVWA 2ZIUB 3OJSA 1RXVA 2UVVA 2KVCA 5HR7A 3ZDEA 1QQ5A 1WG8A 1ZQLA 4KLEA 2R8GA 3U26A 1TK8A 2OWOA 3RB0A 5ALDA 4DQRA 3KOOA 5KFNA 1ZQKA 2XICA 2EQYA 2KTQA 9ICRA 3QUQA 4RUCA 1S0NA 2KNJA 4FBUA 8ICKA 4QNLA 3LK9A 4MFCA 1DK2A 4TUSA 2QB0A 5D4BA 2HHTA 2WHEA 3BQ7A 1X9SA 1O08A 2BCQA 3KHLA 3DV9A 2KV2A 4BUGA 2DKXA 2Y1JA 2D3DA 2G09A 2Y9UA 2K8CB 2W3SA 5ALOA 1FEZA 4XRHA 2GH1A 1ZQCA 4ECRA 5DBCA 1PVQA 4F5QA 2AGPA 3QU2A 3GV7B 3UXOA 2EH9A 4DQSA 2MSNA 4Y2PA 4C4SA 2IBKA 3N4MB 3I1YA 2JMGA 2KKVA 1Z4NA 1Y88A 5KG1A 4ICAA 4QWBA 3JPOA 4P2HA 3M9MB 3FYHA 3JPQA 4RNMA 3WKAA 8ICCA 1RYRA 1SWWA 4O3RA 5KG0A 1NJZA 4CF4A 5KFRA 5F3XB 1P7DA 4OJLA 2ASDA 2HDOA 2DFLA 1ECWA 4ECSA 2V4QA 5E79U 3KFUF 8ICTA 2FPLA 3L5KA 7ICHA 2KMDA 5K4LA 3OSNA 4I28A 5KFOA 2BQRA 3RJEA 1T94A 9ICCA 1X2IA 4C8OA 2HHXA 1RZTA 2H5XA 4KMUA 4I27A 4RQNA 1A0PA 4Z6FA 4Z6DA 2A19A 4PZNA 2AU0A 3TARA 4I2HA 4DSIA 4PHDA 2E8MA 2IHNA 2HHWA 1ZXIA 1JN3A 5ALSA 3PW7A 4BWMA 9ICIA 3N7SC 3RB3A 1ZQQA 3RFAA 3BDPA 4UAVA 4YN4A 9ICUA 1KLNA 1ZRMA 2ZTCA 1JRPA 5A0LA 4K4GA 4DL3A 1ZQWA 3MR3A 1U9LA 2G5IB 1QH9A 2HI0A 5DLGA 1ZQRA 4F8RA 2FMQA 3AQEA 3AU6A 2KKPA 5GTHU 2JEGA 4ELTA 2DPIA 1N5XA 5KFWA 7ICGA 2R18A 5KG4A 5HMLA 4C8MA 4P4MA 3H8MA 1UPHA 4I2DA 7ICJA 4G3IA 2J6UA 2KICA 1QSLA 5J2HA 3OHBA 4KLIA 1BPZA 3EWAA 1SXEA 4Y2UA 2VJ5A 2VKQA 5AKLA 3ALRA 1QQ7A 4DEZA 1B22A 2MAXA 2YMLA 3MR6A 4USAA 4PL1A 5AKJA 5KNIA 3HWTA 1HUOA 2F8LA 1EXNA 5FP0A 3V7JA 4DL6A 2EZXA 4MFAA 2IMWP 4JWMA 2LBOA 4I2GA 4EEYA 2E5SA 8ICPA 5ALNA 2OXOA 4BXOA 1Z00B 1ZQXA 5L1IA 4GFJA 1S97A 1D9DA 2FE9A 1ZQUA 3D2SA 2LI6A 2BPGA 3IDWA 5AI6A 1NK7A 1TAUA 3IHQB 1KN5A 8ICHA 1ZQJA 3ICXA 3RF9A 4DLGA 2KSOA 2YX8A 4ECTA 5L9XA 5EE1A 4U7CA 2K4EA 4GC6A 3RAQA 3HILA 4DFKA 2ODGA 5ALKA 2K8BB 5EWGA 3C29A 1T7PA 1WYGA 3QE9Y 3RRHA 2K4PA 4C7YA 5CRXA 4DL5A 4Q8EA 3ZD8A 8ICMA 3GILA 3F53A 5KT7A 4RNOA 3H8SA 1K5OA 2BCUA 2CRXA 4EEKA 2KIVA 9ICOA 5ALGA 3K1ZA 3OSPA 4BJQA 1SWVA 1ZETA 3TKAA 2XVTA 1L3VA 2ZIUA 2W04A 5ALTA 4F50A 4ECZA 2F77X 3WK5A 3SI8A 5KT4A 8ICQA 4F4ZA 2P35A 3UMGA 2E1FA 4UBBA 2HSZA 4AP9A 2YY6A 4OD0A 3GZFA 2AQ4A 4DL7A 9ICKA 4M6WB 4AYBC 5ALYA 1NK6A 5KFPA 5DB9A 8ICUA 4JMUA 2VIXA 1RG6A 2H3ZA 2H3QA 1KFSA 4KTQA 4M9HA 9ICNA 3ETRA 4R8UA 4I29A 1SL1A 5J2CA 1Q3VA 5KG7A 1RXWA 3ORYA 4DCCA 4DFDA 3GIKA 1A6SA 2BHNA 4YD2A 2W8KA 3IRUA 5AK4A 3MR5A 2KP7A 2NO4A 4PHPA 1WWUA 3HRDD 3C2KA 2C22A 1MA7A 8ICEA 2DWQA 1L7MA 5KAFU 3T5JA 1F44A 4C4RA 1UCVA 5DQIA 3MFHA 1NNLA 4DOBA 9ICPA 2HW3A 1X40A 2C2DA 2JZBB 4DF4A 5J0PA 4IQVA 1X66A 4RQ4A 4ED6A 2J6TA 3H0RB 1V97A 2AXTU 5CR0A 3JPRA 5HP4A 4DQQA 4IRCA 2P6UA 3THVA 4YMOA 2JH7A 4KLGA 4DFPA 5DLFA 4KLMA 2N1RA 3N28A 3UXNA 2HCFA 5CJ7A 3LDAA 1H38A 4US8A 4QZIA 4HAIA 1IV8A 2NRWA 1XU4A 4Q45A 4NXZA 2Y0SF 5KFVA 4KN4A 1M6YA 2DL0A 3T79A 3PO5A 4O5CA 2ZJAA 2KEYA 3EW9A 4ELUA 2BQ3A 3V6KA 3NGDA 4ED7A 5KG2A 1IXRA 4CNQA 1X6JA 3F2DA 3SV3A 3RBEA 5AKXA 4UB8U 4IQUA 4BWJA 4NJ8A 3KZIU 4DL4A 3PNCA 1ZQMA 2KHQA 2HOQA 5KFFA 4J9PA 1SB3C 2W9CA 3IG8A 3FM9A 2IOFK 5TISU 4C7ZA 2KJ8A 1NZPA 7ICEA 5AKIA 1UA0A 4RPXA 1AROP 2LM1A 4F2SA 4JV0A 1T4GA 3PO4A 3C23A 3QYPA 2EDUA 4DSJA 2W9BB 3H40A 4F3OA 4OJ5A 5AKGA 4AYBF 5DG7A 3H4BA 3QUBA 2A1AA 4O3PA 9ICQA 3QNMA 3TADC 4QWEA 2ISOA 2QB1A 1Q3UA 5J0OA 3GV5B 4UATA 2QARA 3C1ZA 1IIPA 3RRGA 2OEHA 4B9MA 4DSEA 2QKQA 5G5GA 1QSSA 2R8HA 5KFUA 4QZCA 1ZQSA 1KEJA 1WCLA 5ALHA 4QWAA 3GQCA 4DOAA 5J0UA 4ECVA 1S0OA 4Y2VA 2ZIWB 2LKYA 3G6XA 5L1LA 2G0AA 4QZHA 1YT3A 5IIJA 9ICXA 5ALRA 2ZTEA 1SZPA 3PR5B 3PW2A 2FI1A 1SL2A 3AL0B 4XUSA 3CRXA 4CGZA 3PVXA 5B5EU 3GFKB 2CPRA 4YR0A 4UB5A 5AKZA 4CF3A 4O0IA 3H8JA 4TQSA 2FLLA 2B6GA 1Q8KA 2E3TA 1L3TA 9ICLA 3ED5A 2F1HA 4P0QA 5KL8B 2YB4A 4CF5A 2IHMA 4MFFA 2ASLA 3OHAA 3V72A 4O5KA 3QZ8A 4BDPA 4I2FA 4YR3A 3EYZA 3K1RB 5KG3A 1N48A 4F93B 1DXSA 2QLTA 7ICPA 3N7PD 2VA3A 1KBUA 3CW2C 2M9NA 1ZD3A 2ZIXB 4M04A 2F3NA 2IOFA 1NJXA 2F76X 2YQEA 4NL9C 2LPEA 5ALMA 8ICNA 2I6XA 4J9RA 4RQ1A 3GIIA 3IV6A 3RR8A 9ICGA 2K8AA 1XSNA 2H3IA 4TURA 2FLNA 4JV1A 5AKKA 5DBBA 7ICSA 3TI0A 1BNPA 2KK0A 1L3UA 2KG5A 1NK5A 3TAPA 1XSLA 4F2RA 5DB8A 4EBDA 1COOA 4O5EA 3OJUA 2Y9TA 4M0AA 1NKCA 1RM6C 3QZ7A 1ZRNA 1K1QA 3IN5A 4BX9C 3TADA 4P4PA 4IQWA 4M6WA 1XNSA 4DL2A 3ZI4A 5HNKA 5KT2A 2JEJA 3H0MB 5ALEA 5KFKA 3PSIA 2KOBA 3HKZC 4EZ9A 5ALFA 2DGZA 1KW4A 2VA2A 3O0FA 5DDYA 4IC9A 2XGPA 1LKYB 4I2EA 3M8RA 3RR7A 4DSKA 1SXDA 1ZQHA 2E1EA 3UMBA 1BPDA 4F4XA 1OXJA 1DGSA 4J9SA 1FFVA 4Y2XA 2DQNB 4QW8A 5KFJA 3QU5A 5JRTA 4EX6A 4IL6U 4CRXA 3KBBA 1PK3A 3UXPA 4K4HA 4F71A 4YG2A 4UQGA 2JXJA 2RDIA 4RQ5A 4NLGA 4NV0A 4UB2A 3AUOA 2FLPA 1SKSA 3L3FX 1L6NA 1ZQZA 2PFOA 1U45A 3WKCA 4M2YA 5KFZA 1A77A 2JZBA 3SD7A 3RJGA 3B0YA 5DDMA 4B9UA 4NL9A 3K4GA 4TUPA 1T3NA 3S6JA 1BPEA 4RT3A 1T8EA 4UAUA 1N56A 1XSPA 1J2MA 3ISCA 2KZZA 4KLJA 4ELVA 4DLEA 2WF5A 5C5JA 2BQUA 4FE3A 4KLSA 2ATLA 5KG5A 2PFNA 2RRDA 1FO4A 1UA1A 2W03A 4IR1A 1ZOLA 1SL0A 5AM3A 2EAPA 3WKBA 2DKZA 2OCEA 5KFAA 2G5HB 3T3FA 2NYVA 3LWMA 2ZUBA 4IS7A 3RH4A 1NZBA 4GLXA 5TZVA 3B0XA 9ICHA 4EELA 4I2JA 3PZPA 3PW0A 8ICGA 1N62A 5CA7A 4P0PA 2EAOA 2JRZA 2JV3A 4NY8A 2OM6A 4QZAA 2WB1C 2ISPA 4NLZA 4DFMA 4J9MA 3C5GA 5AK6A 1VDVA 2VANA 5JUMA 1S0VA 9ICBA 3PMLA 1KKXA 4QZBA 4K4IA 1BVSA 3VCBA 2W7OA 4JUZA 1XO0A 3Q8LA 2R8JA 5KFCA 4UAYA 3PSPA 4PGXA 2Q0ZX 2ZIVB 1NI3A 4YP3A 3BS5B 2NRZA 1JXLA 3UQ2A 4Y2QA 3UM9A 2KZ3A 2E8OA 2BDUA 4EZ6A 8ICIA 5HHHA 3PMNA 3HKZF 3WU2U 4OJOA 2AH5A 4UASA 5AICA 5KFGA 5DGAA 2H3VA 2WAQC 1RQNA 5J0SA 4ECUA 3M6KA 4OO1J 1F0MA 2W54A 4M9LA 2KFNA 2YTUA 3Q8SB 1X9MA 4LZGA 1NOMA 3KHHA 4Y2SA 2ZIWA 4IQTA 2AJQA 3NRWA 1QLNA 4QZ9A 2V4RA 2MA1A 3MBYA 3GV8B 1HUZA 3EPGA 4J9OA 3H0LB 2Y0SC 3MR2A 2ZUDA 2W3RA 4R63A 5DG8A 4RQ3A 3TQ1A 4LJXA 5EE9A 3IP4B 1SV0C 3SENA 4JB3A 1L7PA 2D6FC 4R66A 4QW9A 5C0YA 4RU9A 5AI8A 4R65A 4ECQA 4TUQA 4QJFB 3M6ZA 3M9NB 1DOQA 4PL2A 2RDJA 4LVSA 2HBKA 4Y2TA 4YXMA 2A1JB 3AEVA 3FC4A 2ZIXA 2UVRA 4O3MA 2B21A 2AGOA 4F72A 2KZMA 3PW4A 2ALZA 4FBTA 4M9NA 3PX0A 2FDRA 5ALLA 2KN7A 5KFDA 3QU7A 1UQVA 3RH5A 3UMCA 3RBDA 4PH5A 4YFKA 1N60A 5DB6A 3LWLA 3F5EA 4ED1A 4OCZA 4F91B 1ED1A 4JK1A 5AI0A 2PFQA 3N7RC 1KFDA 1K1SA 3ETLA 8ICRA 1Z3EB 1QTMA 1T3QA 2HHUA 5L1KA 1GO3F 3PSFA 5EE0A 4J9LA 7ICOA 4FS2A 3K75D 4IR9A 4FZMA 5T14A 2RP5A 1JXEA 2I5HA 1HJPA 2EZZA 4PHAA 2K89A 9ICVA 2Q4TA 2ZJ5A 2WB1F 4J9KA 7ICUA 1ZQNA 1OUQA 2W8LA 1PK1B 4UW9A 2W9AA 2MUTB 5KFBA 2WTFA 3EUB2 8ICOA 3Q8KA 1SIJA 4KN7A 3PR4A 1ZQGA 1SKRA 1L5UA 2ZXIA 2EAMA 4BGDA 5KFHA 4YXJA 1SV0A 1TAQA 4RNNA 3SEIA 5ALZA 4RPYA 4EENA 2WAQF 7ICVA 4J9NA 5J2IA 4O3NA 1ZD4A 5AHXA 1ZQDA 2BGWA 5BOLA 4F92B 2LYAA 2LYBA 2BKEA 3NTUA 2XCPA 3TAQA 1XC9A 4KLUA 2BPCA 5J2GA 4FZLA 1B4FA 2PFPA 5CB1A 3PY8A 4OJPA 4C4TA 4YD1A 4PPXA 1DK3A 3HX0A 2H3FA 2LMRA 5AM1A 5KFLA 1U4BA 4B9NA 5CWRA 2K60A 1BPBA 3SZ2A 1KFTA 2WF7A 1UT8A 2BCSA 2KD1A 3RTVA 1MSWD 4UB4A 7ICLA 4RQMA 2NRXA 4RQ0A 3SV4A 4B9TA 1UHUA 4M9GA 3QXGA 5AM4A 3KD3A 4PZOA 2ASJA 2AHOB 1C20A 2WF9A 2W11A 3D6JA 2GO7A 1KRPA 4MHVA 4GXIA 4US9A 1F5SA 3MDAA 8ICXA 2BCRA 1JI7A 2OHFA 3H7IA 2KE7A 4DS5A 2AGQA 1FFUA 4ECWA 1CRXA 4KX3A 3RJJA 1L7NA 3EZ5A 1IG6A 2R8KA 1XS9D 1B0XA 4B9SA 1X42A 1V38A 4RZRA 1NKEA 3M1YA 2KJ5A 2FPMA 2VJ4A 3HP6A 1L8OA 5ALWA 2FJ6A 5ALUA 9ICEA 1ZD5A 5J2JA 3I28A 5J2EA 5ALQA 4I2BA 1YZ6A 3LYSA 1PUZA 1D8BA 3AU2A 5IIOA 4DSFA 2ZIVA 3BS5A 5AKEA 9ICJA 4NM1A 2JGAA 3SYZA 1HEKA 5J0QA 2C2EA 5G5HA 4F4WA 4NLNA 8ICJA 2HVIA 4F4KA 5EWEA 1N63A 4F4YA 1PVPA 2BPFA 1QSYA 1Z00A 3OGUA 1JROA 3GIJA 3GU3A 2BR0A 7ICFA 2NO5A 4KLOA 8ICZA 5J0TA 3JPTA 3NVWA 1OW5A 3TACB 5KFYA 1LVHA 2HHQA 3RH6A 1D9FA 5AK5A 1RQLA 1YZ7A 2KSOB 4PJ0U 5B66U 4FO6A 3GIMA 2R8IA 4DOCA 4RPZA 8ICSA 5J8YC 4J9QA 4ZOHC 1V85A 1NK9A 2RLTA 3NVVA 1WCNA 2ZJ8A 3V7KA 2HMXA 4MEYA 4YVZA 5J0WA 4M47A 3PV8A 4QWCA 2EZYA 3TANA 2ZTDA 2DBYA 2EANA 4PGQA 1ZD2P 4E0DA 4EX7A 1J2NA 1COKA 3PSTA 4I2IA 2XI9A 2FPKA 3H4DA 8ICVA 5J2AA 3NUQA 3LVVA
chains in the Genus database with same CATH topology
3KZIU 5GTIU 5KAFU 4PJ0U 5B66U 2DUYA 5TISU 3A0HU 4UB6U 5KAIU 1S5LU 5H2FU 4IL6U 3WU2U 5GTHU 5E79U 3A0BU 2AXTU 4UB8U 5B5EU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI U;  5GTI U;  5KAF U;  4PJ0 U;  5B66 U;  2DUY A;  5TIS U;  3A0H U;  4UB6 U;  5KAI U;  1S5L U;  5H2F U;  4IL6 U;  3WU2 U;  5GTH U;  5E79 U;  3A0B U;  2AXT U;  4UB8 U;  5B5E U; 
#chains in the Genus database with same CATH topology
 1RYU A;  5AI4 A;  2A1J A;  2WFA A;  1QCK A;  5EOZ A;  2B0C A;  2KIW A;  1ZQI A;  3SAH A;  1Z4O A;  3BZC A;  3V6H A;  4QZE A;  4Q8F A;  1FIQ A;  4KLD A;  4RUA A;  5ALP A;  5J2K A;  1J97 A;  2YN4 A;  4MF8 A;  4GXK A;  5ALI A;  1U48 A;  5KT6 A;  3NAS A;  4O3Q A;  4C8K A;  5CP2 A;  4MEX A;  3RAX A;  3KKA C;  5J29 A;  2D8C A;  1X9W A;  4ED0 A;  1LV5 A;  1XO1 A;  2I9G A;  4R8U B;  4QZF A;  5KFM A;  1SZH A;  2YMM A;  3WK6 A;  4F5O A;  2HHV A;  3H8W A;  2G08 A;  5BOM A;  3JPN A;  5GTI U;  3KHG A;  2RQ5 A;  4Q43 A;  4I2C A;  4C8L A;  3M8S A;  3NRZ A;  3OPX A;  1ZQO A;  2XY6 A;  4RQ7 A;  5F9L A;  4KX5 A;  4O3O A;  4QWD A;  1PK1 A;  2UVU A;  2YMQ A;  2MUT A;  3A0B U;  9ICM A;  5L1M A;  2ZUC A;  1KDH A;  5J8Y A;  5KFS A;  2NRT A;  2LHT A;  1X6I A;  2KFZ A;  2RHF A;  4O3S A;  3BQT A;  3G6V A;  1KL9 A;  2XGQ A;  3D2N A;  1S5L U;  1AQ6 A;  4Z6E A;  2I1Q A;  2W9M A;  1ZQB A;  3IM1 A;  4Y2Y A;  5JU5 A;  1NJW A;  3KHR A;  3C2M A;  5J0Y A;  2PI5 A;  2C28 A;  4GIB A;  4HYK A;  1NK0 A;  1TKD A;  3L4P A;  4G9B A;  4B9L A;  1KTQ A;  1D8L A;  4B6J A;  1O03 A;  4LZD A;  1JMS A;  1MN8 A;  3HW8 A;  4F5R A;  4QZ8 A;  4MF2 A;  4F5P A;  3QX7 A;  4ECX A;  1SV4 A;  4KLL A;  4FS1 A;  1S0M A;  1B43 A;  1N2X A;  2JR5 A;  2XID A;  4F5N A;  4UB6 U;  2XC9 A;  1SGG A;  4P4O A;  3GDX A;  4EYH B;  3KKA A;  4UAZ A;  1ZQT A;  4YMM A;  3BQ2 A;  7ICT A;  4UB1 A;  3RJF A;  5J0X A;  2XCA A;  5AI9 A;  4QZG A;  2W9C B;  3F2B A;  3KTQ A;  2F44 A;  2XY7 A;  9ICW A;  1KQQ A;  1HIW A;  3BJY A;  4IRK A;  8ICB A;  3BS7 A;  4UAR A;  2G07 A;  4RT2 A;  9ICF A;  4KLT A;  1LB2 B;  3WK4 A;  5EWF A;  2GLE A;  3QU9 A;  1S8O A;  1TV9 A;  2F8K A;  1N5W A;  1V9P A;  3EPI A;  5AIB A;  3ZDD A;  2W9B A;  4DO9 A;  1QQ6 A;  4RQ8 A;  4PGY A;  2JHD A;  3SQI A;  4NM2 A;  4B9V A;  2AQ0 A;  2FMP A;  1Z1B A;  8ICY A;  3M9O B;  3CNH A;  2QAR B;  1L8L A;  2L5Y A;  1MC8 A;  4CDG A;  1ZJN A;  5KFQ A;  1MQ2 A;  2V9W A;  2HBM A;  2E8N A;  2ESE A;  4DQI A;  1IM4 A;  2ZXH A;  4QIW C;  4PHE A;  2MRL A;  5AIA A;  3SAG A;  5D46 A;  5DB7 A;  1U47 A;  4UAW A;  2DUY A;  4Y2R A;  1RPL A;  1WWV A;  2VA8 A;  4Z6C A;  3A0H U;  4IRD A;  8ICF A;  4EBC A;  5HMM A;  2NV3 A;  3UPQ A;  4ED2 A;  1UT5 A;  4DWI A;  2GWS A;  3NVY A;  5IIN A;  1TFR A;  3CYM A;  2J6S A;  3ISB A;  3ZDB A;  9ICT A;  1DGJ A;  3MGV A;  1NKB A;  1A76 A;  5J2B A;  3V7L A;  5CHG A;  4P0Q B;  5AI5 A;  3RJH A;  2F2A B;  4O9M A;  1X9X A;  1DRG A;  3NVZ A;  2OYY A;  1MQ3 A;  5H2F U;  2W55 A;  2HOF A;  1U49 A;  2HHS A;  2KVS A;  3E2E A;  3B9J A;  3C2L A;  1L7O A;  2KHV A;  2HOI A;  2HVH A;  3Q8R B;  4R64 A;  5DKW A;  2NRV A;  4YMN A;  5AKY A;  2JEF A;  2ES6 A;  2O6K A;  3ZD9 A;  2C2R A;  5J2F A;  4YQW A;  1JIH A;  3MDC A;  7ICR A;  5KAI U;  2A3V A;  3F2C A;  2PMZ C;  3QEA Z;  3HJE A;  1ZJM A;  3MC1 A;  3PX4 A;  2IA6 A;  2KJ9 A;  3QUT A;  2JH1 A;  5KT3 A;  2ZG6 A;  2F1J A;  3IG5 A;  4UB3 A;  2QB0 B;  3DDH A;  4JV2 A;  5HR6 A;  1ZQA A;  3WK7 A;  3BQ0 A;  4YCX A;  2HBJ A;  5JTI A;  1ZQV A;  2XO7 A;  9ICS A;  3E58 A;  5AM2 A;  1NJY A;  2YB1 A;  3MAB A;  3NS1 A;  7ICM A;  3N97 B;  4KMO B;  4FZN A;  3JPS A;  3T5K A;  3Q8M A;  1VJ5 A;  4DS4 A;  1TVA A;  5KFT A;  5AM0 A;  1TK0 A;  3CP8 A;  3G6Y A;  5KL1 B;  1S9F A;  2PI4 A;  3ONN A;  1ZQF A;  4EYI B;  3ZDC A;  3T5H A;  1LKY A;  3Q8Q B;  2DPJ A;  4DSL A;  1CI4 A;  1RYS A;  3OTQ A;  3I76 A;  1WUD A;  1ZQE A;  1CEZ A;  2F1I A;  2G06 A;  2BZF A;  3TFR A;  2Z7J A;  3QEB Z;  2XY5 A;  3R9K A;  5ALJ A;  4I2A A;  3ZDA A;  3F5A A;  4TQR A;  2PKE A;  3WK8 A;  2JEI A;  3HPO A;  5HHI A;  4Q44 A;  1ZQ1 C;  3QUC A;  4XQ8 A;  5AKH A;  4QIW F;  3SR6 A;  3MFI A;  4FFD A;  3T5L A;  1CUK A;  4GXJ A;  4X5V A;  1Z19 A;  3WK9 A;  4ECY A;  3RB6 A;  3RB4 A;  5AK3 A;  4CCH A;  1URJ A;  2BDP A;  1ZYQ A;  1S77 D;  4CE6 A;  2YMP A;  1L3S A;  1RDF A;  2BCV A;  5DG9 A;  1Z1V A;  4U6P A;  1JUD A;  2IOH A;  2K4H A;  4KLF A;  4DF8 A;  1PVR A;  2P6R A;  1TAM A;  5BPC A;  5ALX A;  4OJ6 A;  1TE2 A;  5KFX A;  5J2D A;  3RJK A;  5DQG A;  3C21 A;  4YR2 A;  5F9N A;  4ZH4 A;  5IIM A;  4RQ6 A;  2WF6 A;  3V6J A;  1BNO A;  7ICI A;  3HT3 A;  2M0N A;  5DQH A;  4JWN A;  4RQ2 A;  5J0R A;  1C7Y A;  2PMZ F;  4P0P B;  3C28 A;  4ED8 A;  5KFI A;  4NLK A;  3KZX A;  1JX4 A;  3QU4 A;  1SKW A;  2CN1 A;  5L1J A;  2E8P A;  3SMV A;  5KFE A;  3Q8P B;  1ZQY A;  5DBA A;  8ICL A;  4J03 A;  2CXY A;  4C8N A;  1KSP A;  2FMS A;  3DEE A;  3BQ1 A;  7ICK A;  1NK8 A;  1TK5 A;  4KLQ A;  5AM5 A;  1NK4 A;  1VLB A;  3E0F A;  3J81 j;  2HBL A;  2PXI A;  1N61 A;  3FDS A;  4ED3 A;  4KLH A;  2W7P A;  9ICA A;  5IIL A;  7ICQ A;  3UQ0 A;  3ISD A;  3TFS A;  1BPY A;  5D49 A;  2OH2 A;  3PW5 A;  3FAH A;  1BGX T;  1XWL A;  2UVW A;  4BXO B;  1Q46 A;  3D2Q A;  3VC8 A;  3MGH A;  3AM9 A;  1S76 D;  3MGI A;  2DF4 B;  8ICA A;  1JAL A;  4ACO A;  4KIT B;  5KT5 A;  7ICN A;  4XA5 A;  3RJI A;  4C80 A;  5EE3 A;  4NLB A;  5CEH A;  1D8Y A;  2MU2 A;  2LYH A;  4C0Z A;  5DGB A;  4EBE A;  5KTQ A;  2P66 A;  3C1Y A;  4A8E A;  5KG6 A;  3AMZ A;  2LM4 A;  3WKE A;  4GC7 A;  3PX6 A;  1ZQP A;  4DFJ A;  4NLC A;  1PZN A;  3AQF A;  3AN1 A;  4DQP A;  4QZD A;  2WF8 A;  3BZK A;  2GOL A;  4Y2J A;  1S10 A;  3WKD A;  4M9J A;  2Y1I A;  1BPX A;  4WJ3 B;  5III A;  4NWI A;  2K4I A;  8ICW A;  3SAF A;  4UBC A;  3M7D A;  2W43 A;  5IIK A;  5ALV A;  3JPP A;  3C5F A;  3LVW A;  2ZIU B;  3OJS A;  1RXV A;  2UVV A;  2KVC A;  5HR7 A;  3ZDE A;  1QQ5 A;  1WG8 A;  1ZQL A;  4KLE A;  2R8G A;  3U26 A;  1TK8 A;  2OWO A;  3RB0 A;  5ALD A;  4DQR A;  3KOO A;  5KFN A;  1ZQK A;  2XIC A;  2EQY A;  2KTQ A;  9ICR A;  3QUQ A;  4RUC A;  1S0N A;  2KNJ A;  4FBU A;  8ICK A;  4QNL A;  3LK9 A;  4MFC A;  1DK2 A;  4TUS A;  2QB0 A;  5D4B A;  2HHT A;  2WHE A;  3BQ7 A;  1X9S A;  1O08 A;  2BCQ A;  3KHL A;  3DV9 A;  2KV2 A;  4BUG A;  2DKX A;  2Y1J A;  2D3D A;  2G09 A;  2Y9U A;  2K8C B;  2W3S A;  5ALO A;  1FEZ A;  4XRH A;  2GH1 A;  1ZQC A;  4ECR A;  5DBC A;  1PVQ A;  4F5Q A;  2AGP A;  3QU2 A;  3GV7 B;  3UXO A;  2EH9 A;  4DQS A;  2MSN A;  4Y2P A;  4C4S A;  2IBK A;  3N4M B;  3I1Y A;  2JMG A;  2KKV A;  1Z4N A;  1Y88 A;  5KG1 A;  4ICA A;  4QWB A;  3JPO A;  4P2H A;  3M9M B;  3FYH A;  3JPQ A;  4RNM A;  3WKA A;  8ICC A;  1RYR A;  1SWW A;  4O3R A;  5KG0 A;  1NJZ A;  4CF4 A;  5KFR A;  5F3X B;  1P7D A;  4OJL A;  2ASD A;  2HDO A;  2DFL A;  1ECW A;  4ECS A;  2V4Q A;  5E79 U;  3KFU F;  8ICT A;  2FPL A;  3L5K A;  7ICH A;  2KMD A;  5K4L A;  3OSN A;  4I28 A;  5KFO A;  2BQR A;  3RJE A;  1T94 A;  9ICC A;  1X2I A;  4C8O A;  2HHX A;  1RZT A;  2H5X A;  4KMU A;  4I27 A;  4RQN A;  1A0P A;  4Z6F A;  4Z6D A;  2A19 A;  4PZN A;  2AU0 A;  3TAR A;  4I2H A;  4DSI A;  4PHD A;  2E8M A;  2IHN A;  2HHW A;  1ZXI A;  1JN3 A;  5ALS A;  3PW7 A;  4BWM A;  9ICI A;  3N7S C;  3RB3 A;  1ZQQ A;  3RFA A;  3BDP A;  4UAV A;  4YN4 A;  9ICU A;  1KLN A;  1ZRM A;  2ZTC A;  1JRP A;  5A0L A;  4K4G A;  4DL3 A;  1ZQW A;  3MR3 A;  1U9L A;  2G5I B;  1QH9 A;  2HI0 A;  5DLG A;  1ZQR A;  4F8R A;  2FMQ A;  3AQE A;  3AU6 A;  2KKP A;  5GTH U;  2JEG A;  4ELT A;  2DPI A;  1N5X A;  5KFW A;  7ICG A;  2R18 A;  5KG4 A;  5HML A;  4C8M A;  4P4M A;  3H8M A;  1UPH A;  4I2D A;  7ICJ A;  4G3I A;  2J6U A;  2KIC A;  1QSL A;  5J2H A;  3OHB A;  4KLI A;  1BPZ A;  3EWA A;  1SXE A;  4Y2U A;  2VJ5 A;  2VKQ A;  5AKL A;  3ALR A;  1QQ7 A;  4DEZ A;  1B22 A;  2MAX A;  2YML A;  3MR6 A;  4USA A;  4PL1 A;  5AKJ A;  5KNI A;  3HWT A;  1HUO A;  2F8L A;  1EXN A;  5FP0 A;  3V7J A;  4DL6 A;  2EZX A;  4MFA A;  2IMW P;  4JWM A;  2LBO A;  4I2G A;  4EEY A;  2E5S A;  8ICP A;  5ALN A;  2OXO A;  4BXO A;  1Z00 B;  1ZQX A;  5L1I A;  4GFJ A;  1S97 A;  1D9D A;  2FE9 A;  1ZQU A;  3D2S A;  2LI6 A;  2BPG A;  3IDW A;  5AI6 A;  1NK7 A;  1TAU A;  3IHQ B;  1KN5 A;  8ICH A;  1ZQJ A;  3ICX A;  3RF9 A;  4DLG A;  2KSO A;  2YX8 A;  4ECT A;  5L9X A;  5EE1 A;  4U7C A;  2K4E A;  4GC6 A;  3RAQ A;  3HIL A;  4DFK A;  2ODG A;  5ALK A;  2K8B B;  5EWG A;  3C29 A;  1T7P A;  1WYG A;  3QE9 Y;  3RRH A;  2K4P A;  4C7Y A;  5CRX A;  4DL5 A;  4Q8E A;  3ZD8 A;  8ICM A;  3GIL A;  3F53 A;  5KT7 A;  4RNO A;  3H8S A;  1K5O A;  2BCU A;  2CRX A;  4EEK A;  2KIV A;  9ICO A;  5ALG A;  3K1Z A;  3OSP A;  4BJQ A;  1SWV A;  1ZET A;  3TKA A;  2XVT A;  1L3V A;  2ZIU A;  2W04 A;  5ALT A;  4F50 A;  4ECZ A;  2F77 X;  3WK5 A;  3SI8 A;  5KT4 A;  8ICQ A;  4F4Z A;  2P35 A;  3UMG A;  2E1F A;  4UBB A;  2HSZ A;  4AP9 A;  2YY6 A;  4OD0 A;  3GZF A;  2AQ4 A;  4DL7 A;  9ICK A;  4M6W B;  4AYB C;  5ALY A;  1NK6 A;  5KFP A;  5DB9 A;  8ICU A;  4JMU A;  2VIX A;  1RG6 A;  2H3Z A;  2H3Q A;  1KFS A;  4KTQ A;  4M9H A;  9ICN A;  3ETR A;  4R8U A;  4I29 A;  1SL1 A;  5J2C A;  1Q3V A;  5KG7 A;  1RXW A;  3ORY A;  4DCC A;  4DFD A;  3GIK A;  1A6S A;  2BHN A;  4YD2 A;  2W8K A;  3IRU A;  5AK4 A;  3MR5 A;  2KP7 A;  2NO4 A;  4PHP A;  1WWU A;  3HRD D;  3C2K A;  2C22 A;  1MA7 A;  8ICE A;  2DWQ A;  1L7M A;  5KAF U;  3T5J A;  1F44 A;  4C4R A;  1UCV A;  5DQI A;  3MFH A;  1NNL A;  4DOB A;  9ICP A;  2HW3 A;  1X40 A;  2C2D A;  2JZB B;  4DF4 A;  5J0P A;  4IQV A;  1X66 A;  4RQ4 A;  4ED6 A;  2J6T A;  3H0R B;  1V97 A;  2AXT U;  5CR0 A;  3JPR A;  5HP4 A;  4DQQ A;  4IRC A;  2P6U A;  3THV A;  4YMO A;  2JH7 A;  4KLG A;  4DFP A;  5DLF A;  4KLM A;  2N1R A;  3N28 A;  3UXN A;  2HCF A;  5CJ7 A;  3LDA A;  1H38 A;  4US8 A;  4QZI A;  4HAI A;  1IV8 A;  2NRW A;  1XU4 A;  4Q45 A;  4NXZ A;  2Y0S F;  5KFV A;  4KN4 A;  1M6Y A;  2DL0 A;  3T79 A;  3PO5 A;  4O5C A;  2ZJA A;  2KEY A;  3EW9 A;  4ELU A;  2BQ3 A;  3V6K A;  3NGD A;  4ED7 A;  5KG2 A;  1IXR A;  4CNQ A;  1X6J A;  3F2D A;  3SV3 A;  3RBE A;  5AKX A;  4UB8 U;  4IQU A;  4BWJ A;  4NJ8 A;  3KZI U;  4DL4 A;  3PNC A;  1ZQM A;  2KHQ A;  2HOQ A;  5KFF A;  4J9P A;  1SB3 C;  2W9C A;  3IG8 A;  3FM9 A;  2IOF K;  5TIS U;  4C7Z A;  2KJ8 A;  1NZP A;  7ICE A;  5AKI A;  1UA0 A;  4RPX A;  1ARO P;  2LM1 A;  4F2S A;  4JV0 A;  1T4G A;  3PO4 A;  3C23 A;  3QYP A;  2EDU A;  4DSJ A;  2W9B B;  3H40 A;  4F3O A;  4OJ5 A;  5AKG A;  4AYB F;  5DG7 A;  3H4B A;  3QUB A;  2A1A A;  4O3P A;  9ICQ A;  3QNM A;  3TAD C;  4QWE A;  2ISO A;  2QB1 A;  1Q3U A;  5J0O A;  3GV5 B;  4UAT A;  2QAR A;  3C1Z A;  1IIP A;  3RRG A;  2OEH A;  4B9M A;  4DSE A;  2QKQ A;  5G5G A;  1QSS A;  2R8H A;  5KFU A;  4QZC A;  1ZQS A;  1KEJ A;  1WCL A;  5ALH A;  4QWA A;  3GQC A;  4DOA A;  5J0U A;  4ECV A;  1S0O A;  4Y2V A;  2ZIW B;  2LKY A;  3G6X A;  5L1L A;  2G0A A;  4QZH A;  1YT3 A;  5IIJ A;  9ICX A;  5ALR A;  2ZTE A;  1SZP A;  3PR5 B;  3PW2 A;  2FI1 A;  1SL2 A;  3AL0 B;  4XUS A;  3CRX A;  4CGZ A;  3PVX A;  5B5E U;  3GFK B;  2CPR A;  4YR0 A;  4UB5 A;  5AKZ A;  4CF3 A;  4O0I A;  3H8J A;  4TQS A;  2FLL A;  2B6G A;  1Q8K A;  2E3T A;  1L3T A;  9ICL A;  3ED5 A;  2F1H A;  4P0Q A;  5KL8 B;  2YB4 A;  4CF5 A;  2IHM A;  4MFF A;  2ASL A;  3OHA A;  3V72 A;  4O5K A;  3QZ8 A;  4BDP A;  4I2F A;  4YR3 A;  3EYZ A;  3K1R B;  5KG3 A;  1N48 A;  4F93 B;  1DXS A;  2QLT A;  7ICP A;  3N7P D;  2VA3 A;  1KBU A;  3CW2 C;  2M9N A;  1ZD3 A;  2ZIX B;  4M04 A;  2F3N A;  2IOF A;  1NJX A;  2F76 X;  2YQE A;  4NL9 C;  2LPE A;  5ALM A;  8ICN A;  2I6X A;  4J9R A;  4RQ1 A;  3GII A;  3IV6 A;  3RR8 A;  9ICG A;  2K8A A;  1XSN A;  2H3I A;  4TUR A;  2FLN A;  4JV1 A;  5AKK A;  5DBB A;  7ICS A;  3TI0 A;  1BNP A;  2KK0 A;  1L3U A;  2KG5 A;  1NK5 A;  3TAP A;  1XSL A;  4F2R A;  5DB8 A;  4EBD A;  1COO A;  4O5E A;  3OJU A;  2Y9T A;  4M0A A;  1NKC A;  1RM6 C;  3QZ7 A;  1ZRN A;  1K1Q A;  3IN5 A;  4BX9 C;  3TAD A;  4P4P A;  4IQW A;  4M6W A;  1XNS A;  4DL2 A;  3ZI4 A;  5HNK A;  5KT2 A;  2JEJ A;  3H0M B;  5ALE A;  5KFK A;  3PSI A;  2KOB A;  3HKZ C;  4EZ9 A;  5ALF A;  2DGZ A;  1KW4 A;  2VA2 A;  3O0F A;  5DDY A;  4IC9 A;  2XGP A;  1LKY B;  4I2E A;  3M8R A;  3RR7 A;  4DSK A;  1SXD A;  1ZQH A;  2E1E A;  3UMB A;  1BPD A;  4F4X A;  1OXJ A;  1DGS A;  4J9S A;  1FFV A;  4Y2X A;  2DQN B;  4QW8 A;  5KFJ A;  3QU5 A;  5JRT A;  4EX6 A;  4IL6 U;  4CRX A;  3KBB A;  1PK3 A;  3UXP A;  4K4H A;  4F71 A;  4YG2 A;  4UQG A;  2JXJ A;  2RDI A;  4RQ5 A;  4NLG A;  4NV0 A;  4UB2 A;  3AUO A;  2FLP A;  1SKS A;  3L3F X;  1L6N A;  1ZQZ A;  2PFO A;  1U45 A;  3WKC A;  4M2Y A;  5KFZ A;  1A77 A;  2JZB A;  3SD7 A;  3RJG A;  3B0Y A;  5DDM A;  4B9U A;  4NL9 A;  3K4G A;  4TUP A;  1T3N A;  3S6J A;  1BPE A;  4RT3 A;  1T8E A;  4UAU A;  1N56 A;  1XSP A;  1J2M A;  3ISC A;  2KZZ A;  4KLJ A;  4ELV A;  4DLE A;  2WF5 A;  5C5J A;  2BQU A;  4FE3 A;  4KLS A;  2ATL A;  5KG5 A;  2PFN A;  2RRD A;  1FO4 A;  1UA1 A;  2W03 A;  4IR1 A;  1ZOL A;  1SL0 A;  5AM3 A;  2EAP A;  3WKB A;  2DKZ A;  2OCE A;  5KFA A;  2G5H B;  3T3F A;  2NYV A;  3LWM A;  2ZUB A;  4IS7 A;  3RH4 A;  1NZB A;  4GLX A;  5TZV A;  3B0X A;  9ICH A;  4EEL A;  4I2J A;  3PZP A;  3PW0 A;  8ICG A;  1N62 A;  5CA7 A;  4P0P A;  2EAO A;  2JRZ A;  2JV3 A;  4NY8 A;  2OM6 A;  4QZA A;  2WB1 C;  2ISP A;  4NLZ A;  4DFM A;  4J9M A;  3C5G A;  5AK6 A;  1VDV A;  2VAN A;  5JUM A;  1S0V A;  9ICB A;  3PML A;  1KKX A;  4QZB A;  4K4I A;  1BVS A;  3VCB A;  2W7O A;  4JUZ A;  1XO0 A;  3Q8L A;  2R8J A;  5KFC A;  4UAY A;  3PSP A;  4PGX A;  2Q0Z X;  2ZIV B;  1NI3 A;  4YP3 A;  3BS5 B;  2NRZ A;  1JXL A;  3UQ2 A;  4Y2Q A;  3UM9 A;  2KZ3 A;  2E8O A;  2BDU A;  4EZ6 A;  8ICI A;  5HHH A;  3PMN A;  3HKZ F;  3WU2 U;  4OJO A;  2AH5 A;  4UAS A;  5AIC A;  5KFG A;  5DGA A;  2H3V A;  2WAQ C;  1RQN A;  5J0S A;  4ECU A;  3M6K A;  4OO1 J;  1F0M A;  2W54 A;  4M9L A;  2KFN A;  2YTU A;  3Q8S B;  1X9M A;  4LZG A;  1NOM A;  3KHH A;  4Y2S A;  2ZIW A;  4IQT A;  2AJQ A;  3NRW A;  1QLN A;  4QZ9 A;  2V4R A;  2MA1 A;  3MBY A;  3GV8 B;  1HUZ A;  3EPG A;  4J9O A;  3H0L B;  2Y0S C;  3MR2 A;  2ZUD A;  2W3R A;  4R63 A;  5DG8 A;  4RQ3 A;  3TQ1 A;  4LJX A;  5EE9 A;  3IP4 B;  1SV0 C;  3SEN A;  4JB3 A;  1L7P A;  2D6F C;  4R66 A;  4QW9 A;  5C0Y A;  4RU9 A;  5AI8 A;  4R65 A;  4ECQ A;  4TUQ A;  4QJF B;  3M6Z A;  3M9N B;  1DOQ A;  4PL2 A;  2RDJ A;  4LVS A;  2HBK A;  4Y2T A;  4YXM A;  2A1J B;  3AEV A;  3FC4 A;  2ZIX A;  2UVR A;  4O3M A;  2B21 A;  2AGO A;  4F72 A;  2KZM A;  3PW4 A;  2ALZ A;  4FBT A;  4M9N A;  3PX0 A;  2FDR A;  5ALL A;  2KN7 A;  5KFD A;  3QU7 A;  1UQV A;  3RH5 A;  3UMC A;  3RBD A;  4PH5 A;  4YFK A;  1N60 A;  5DB6 A;  3LWL A;  3F5E A;  4ED1 A;  4OCZ A;  4F91 B;  1ED1 A;  4JK1 A;  5AI0 A;  2PFQ A;  3N7R C;  1KFD A;  1K1S A;  3ETL A;  8ICR A;  1Z3E B;  1QTM A;  1T3Q A;  2HHU A;  5L1K A;  1GO3 F;  3PSF A;  5EE0 A;  4J9L A;  7ICO A;  4FS2 A;  3K75 D;  4IR9 A;  4FZM A;  5T14 A;  2RP5 A;  1JXE A;  2I5H A;  1HJP A;  2EZZ A;  4PHA A;  2K89 A;  9ICV A;  2Q4T A;  2ZJ5 A;  2WB1 F;  4J9K A;  7ICU A;  1ZQN A;  1OUQ A;  2W8L A;  1PK1 B;  4UW9 A;  2W9A A;  2MUT B;  5KFB A;  2WTF A;  3EUB 2;  8ICO A;  3Q8K A;  1SIJ A;  4KN7 A;  3PR4 A;  1ZQG A;  1SKR A;  1L5U A;  2ZXI A;  2EAM A;  4BGD A;  5KFH A;  4YXJ A;  1SV0 A;  1TAQ A;  4RNN A;  3SEI A;  5ALZ A;  4RPY A;  4EEN A;  2WAQ F;  7ICV A;  4J9N A;  5J2I A;  4O3N A;  1ZD4 A;  5AHX A;  1ZQD A;  2BGW A;  5BOL A;  4F92 B;  2LYA A;  2LYB A;  2BKE A;  3NTU A;  2XCP A;  3TAQ A;  1XC9 A;  4KLU A;  2BPC A;  5J2G A;  4FZL A;  1B4F A;  2PFP A;  5CB1 A;  3PY8 A;  4OJP A;  4C4T A;  4YD1 A;  4PPX A;  1DK3 A;  3HX0 A;  2H3F A;  2LMR A;  5AM1 A;  5KFL A;  1U4B A;  4B9N A;  5CWR A;  2K60 A;  1BPB A;  3SZ2 A;  1KFT A;  2WF7 A;  1UT8 A;  2BCS A;  2KD1 A;  3RTV A;  1MSW D;  4UB4 A;  7ICL A;  4RQM A;  2NRX A;  4RQ0 A;  3SV4 A;  4B9T A;  1UHU A;  4M9G A;  3QXG A;  5AM4 A;  3KD3 A;  4PZO A;  2ASJ A;  2AHO B;  1C20 A;  2WF9 A;  2W11 A;  3D6J A;  2GO7 A;  1KRP A;  4MHV A;  4GXI A;  4US9 A;  1F5S A;  3MDA A;  8ICX A;  2BCR A;  1JI7 A;  2OHF A;  3H7I A;  2KE7 A;  4DS5 A;  2AGQ A;  1FFU A;  4ECW A;  1CRX A;  4KX3 A;  3RJJ A;  1L7N A;  3EZ5 A;  1IG6 A;  2R8K A;  1XS9 D;  1B0X A;  4B9S A;  1X42 A;  1V38 A;  4RZR A;  1NKE A;  3M1Y A;  2KJ5 A;  2FPM A;  2VJ4 A;  3HP6 A;  1L8O A;  5ALW A;  2FJ6 A;  5ALU A;  9ICE A;  1ZD5 A;  5J2J A;  3I28 A;  5J2E A;  5ALQ A;  4I2B A;  1YZ6 A;  3LYS A;  1PUZ A;  1D8B A;  3AU2 A;  5IIO A;  4DSF A;  2ZIV A;  3BS5 A;  5AKE A;  9ICJ A;  4NM1 A;  2JGA A;  3SYZ A;  1HEK A;  5J0Q A;  2C2E A;  5G5H A;  4F4W A;  4NLN A;  8ICJ A;  2HVI A;  4F4K A;  5EWE A;  1N63 A;  4F4Y A;  1PVP A;  2BPF A;  1QSY A;  1Z00 A;  3OGU A;  1JRO A;  3GIJ A;  3GU3 A;  2BR0 A;  7ICF A;  2NO5 A;  4KLO A;  8ICZ A;  5J0T A;  3JPT A;  3NVW A;  1OW5 A;  3TAC B;  5KFY A;  1LVH A;  2HHQ A;  3RH6 A;  1D9F A;  5AK5 A;  1RQL A;  1YZ7 A;  2KSO B;  4PJ0 U;  5B66 U;  4FO6 A;  3GIM A;  2R8I A;  4DOC A;  4RPZ A;  8ICS A;  5J8Y C;  4J9Q A;  4ZOH C;  1V85 A;  1NK9 A;  2RLT A;  3NVV A;  1WCN A;  2ZJ8 A;  3V7K A;  2HMX A;  4MEY A;  4YVZ A;  5J0W A;  4M47 A;  3PV8 A;  4QWC A;  2EZY A;  3TAN A;  2ZTD A;  2DBY A;  2EAN A;  4PGQ A;  1ZD2 P;  4E0D A;  4EX7 A;  1J2N A;  1COK A;  3PST A;  4I2I A;  2XI9 A;  2FPK A;  3H4D A;  8ICV A;  5J2A A;  3NUQ A;  3LVV A; 
#chains in the Genus database with same CATH homology
 3KZI U;  5GTI U;  5KAF U;  4PJ0 U;  5B66 U;  2DUY A;  5TIS U;  3A0H U;  4UB6 U;  5KAI U;  1S5L U;  5H2F U;  4IL6 U;  3WU2 U;  5GTH U;  5E79 U;  3A0B U;  2AXT U;  4UB8 U;  5B5E U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...