5E79U

Macromolecular diffractive imaging using imperfect crystals
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5e79U01
4UB6U 5B66U 3A0BU 5KAIU 5GTHU 2AXTU 3WU2U 5B5EU 5H2FU 1S5LU 5E79U 5TISU 3A0HU 4PJ0U 5GTIU 4IL6U 5KAFU 3KZIU 4UB8U 2DUYA
chains in the Genus database with same CATH superfamily
2F3NA 3R9KA 3M8RA 4F5NA 1TAMA 5JRTA 3OGUA 2JEIA 4YMNA 4USAA 2W04A 1YZ6A 5AIAA 2K4EA 1IV8A 4GFJA 1DGSA 1NZBA 2DUYA 1KFDA 3BS5A 7ICNA 1B4FA 4EZ9A 7ICGA 2K89A 5DB9A 1L6NA 2HOQA 7ICSA 2FJ6A 3MR2A 3GIIA 4IC9A 4DS4A 4FE3A 3NVYA 2UVUA 1X9WA 2W11A 1H38A 2GWSA 4ELTA 3GQCA 4P4OA 5AKYA 1SV4A 3UMCA 3PY8A 1V9PA 2LYBA 1NK8A 3NRZA 5EE3A 4PZOA 4JWMA 1BVSA 2H3FA 2PI4A 3IV6A 5KFDA 4DL4A 5KT2A 1RYUA 2AJQA 8ICBA 8ICNA 8ICVA 1TFRA 5DQIA 4O3RA 1V97A 3PW7A 5J2BA 4JV0A 4DL3A 2E8OA 4F2RA 5AM2A 5KL1B 9ICOA 2KZZA 2W7OA 3TADA 1RM6C 4LJXA 3HKZF 1URJA 4J9KA 3PSIA 3IDWA 5KAFU 1QSLA 2EZZA 4PL1A 4DSLA 4RZRA 9ICLA 3C28A 2HHTA 8ICCA 4YR0A 2KKPA 5ALLA 2W9BB 5KFYA 3PMNA 2XGQA 4AYBC 3D6JA 3M1YA 2DQNB 1SWVA 4DLEA 3RRHA 1ZD5A 1UPHA 2QB1A 4PZNA 1NK5A 3DEEA 4NLZA 2VJ5A 2F8KA 1X40A 2C22A 4QNLA 5KG5A 1KL9A 4QW8A 3K4GA 1FEZA 3HPOA 2HCFA 1RYRA 2AQ4A 4UBBA 5KFHA 1LVHA 2JMGA 4NLGA 2FI1A 1SIJA 4B9SA 2YMQA 2XY7A 5CHGA 4J9PA 2KIWA 2AGQA 4QZEA 4YP3A 4O3NA 4MFFA 3PV8A 4B6JA 2DF4B 2I6XA 9ICNA 2KE7A 3V6KA 3Q8SB 1TV9A 4OD0A 4J9OA 2ZJAA 1C7YA 2B6GA 2C28A 1U4BA 4DOAA 4ECUA 2W9AA 1AROP 3GILA 2BQRA 2W9BA 2VIXA 5IIOA 2GOLA 1DOQA 3O0FA 1VJ5A 3CRXA 2EDUA 5AM5A 3Q8LA 2JXJA 2W3SA 1T7PA 3N7PD 3MC1A 4HAIA 4ELVA 2AHOB 2JGAA 2ZXIA 1ZQYA 2W8KA 3L4PA 2EAOA 2F1HA 2F77X 2BR0A 2V9WA 5JUMA 4KX5A 1DK2A 4KLGA 3SAHA 1KN5A 1UQVA 4M9HA 1COKA 4RQ1A 2BPGA 1D8BA 4RT2A 5KFKA 3M8SA 4FS2A 1UHUA 3PZPA 2E5SA 2OYYA 4QZ8A 1JALA 5J8YC 4NJ8A 1WWUA 3I76A 1COOA 4FZMA 1TAQA 2ZJ5A 5ALIA 2Z7JA 2NO5A 5KT5A 4G3IA 2W55A 2EAMA 4JV2A 2J6UA 1PK1B 2YB4A 4OJLA 4I2EA 4EELA 1U9LA 4DSJA 2NRZA 1L7OA 4R8UA 4C4RA 4HYKA 4O9MA 1JN3A 3AM9A 1U48A 1Q3VA 1MQ3A 3JPTA 3OJSA 1RQNA 5AKLA 4KLIA 3HKZC 3OSPA 2DFLA 3GV5B 3RF9A 5KFVA 5J0TA 5J0RA 3OPXA 5ALGA 3H0RB 3LYSA 2DKZA 3EPGA 3UQ0A 4I28A 4I2FA 3WK8A 5DG7A 4TQSA 2OH2A 2D8CA 4UW9A 3D2QA 5KNIA 8ICXA 2HSZA 4P0PB 2QB0B 2AQ0A 3UXOA 2HHUA 5HHIA 1PK3A 3NVVA 5GTIU 3TADC 1SL2A 2ALZA 3LVWA 1VLBA 2KHQA 3QZ7A 3QE9Y 4UB1A 3KBBA 2F76X 5KG3A 4YFKA 1KQQA 3C2MA 2JZBA 8ICUA 1TK0A 2PI5A 4B9UA 9ICWA 3RJGA 2KNJA 3N7RC 1C20A 4O3PA 3RRGA 1QQ6A 2HI0A 4US9A 4CF3A 2CN1A 8ICLA 2FPMA 5KT6A 2H3VA 2K4PA 2KZ3A 2WF7A 2KTQA 5DLGA 1UCVA 5CP2A 1WG8A 1B0XA 3VC8A 2BCQA 5G5HA 9ICBA 3ORYA 4M9GA 3A0HU 5T14A 4ED0A 1ZQXA 3T79A 2BCUA 9ICAA 4Z6EA 4GLXA 4ED2A 5AKZA 2BQUA 5KFQA 4JB3A 3UM9A 2BHNA 2YY6A 4OO1J 3RJKA 2KSOA 2IMWP 4P0PA 1S10A 8ICGA 2MRLA 2QB0A 1SV0A 5AM4A 2Y1IA 2RLTA 4F4KA 2KFNA 3L3FX 2VJ4A 2ES6A 5KG0A 4QJFB 2LYHA 4UAVA 1RQLA 2M9NA 5J2GA 4Q43A 2FMSA 2G5IB 1N2XA 1N5WA 3NS1A 1NK6A 1NK9A 1TE2A 3EYZA 2GH1A 3RBDA 1ZQBA 2HHQA 3RJJA 1T94A 4ELUA 5DDMA 3H0MB 9ICTA 1KFTA 2K4IA 2W9MA 5CB1A 3NRWA 1ZD2P 1Z00B 3EWAA 4IS7A 2W54A 5KG6A 4ECZA 1N48A 1D8LA 1NK7A 4F4YA 1KTQA 4I2JA 3RJFA 5J2IA 2FE9A 2WF9A 2EZYA 2HMXA 3A0BU 4FBUA 4ICAA 4NWIA 1M6YA 2AXTU 2YMLA 3T5JA 1XO0A 3Q8MA 2NRWA 4KLJA 1U47A 2ZUBA 2BPCA 2MSNA 3NGDA 4ECRA 3RB4A 2ISOA 1PUZA 1YZ7A 3TQ1A 5KFAA 1KEJA 1Z19A 3MGVA 2HW3A 5JTIA 4MHVA 4LZDA 2JHDA 4YR2A 2W9CB 1ZJMA 4I2BA 3WK9A 2WHEA 2HDOA 5DG8A 2C2RA 1UT5A 3ICXA 3M6KA 2HBKA 4XQ8A 3HRDD 9ICKA 4DSKA 4RQMA 3MABA 3H4BA 3OHBA 3EZ5A 9ICPA 2GLEA 3PO5A 9ICXA 8ICZA 3M9MB 4QW9A 1ZQTA 1ZYQA 4O5EA 4M2YA 2KJ8A 4NLKA 3F2CA 2KFZA 4QZBA 2OEHA 1JX4A 5AI8A 2OM6A 4IR9A 1RYSA 5ALWA 3GIJA 4Y2XA 3UMBA 1SXEA 4KLMA 5DB8A 4O3OA 7ICFA 5KFFA 1N56A 2YX8A 4KLQA 4UB6U 4U7CA 3NTUA 4GC7A 2ZG6A 2Y0SC 2WAQF 1L8LA 2EZXA 1S5LU 2KP7A 2RRDA 5J0PA 4EBCA 4RQ7A 3SV3A 3GDXA 3FAHA 3KOOA 2HHVA 3FYHA 5L1JA 2W9CA 8ICFA 4RPYA 3UPQA 2F2AB 3D2NA 2ZJ8A 1NKBA 2KMDA 2FPLA 2IOHA 3ISBA 5ALVA 3HILA 3RB6A 1JRPA 2N1RA 1A6SA 4BUGA 1CEZA 4EEKA 4J9RA 5AK3A 3MFIA 4J03A 3PW2A 2H3ZA 2M0NA 4O5CA 4BXOB 3GIMA 1TK5A 1ZXIA 2HVIA 2ODGA 1SZHA 2LMRA 8ICSA 2EANA 2XCPA 4GXIA 2E8NA 1L8OA 4IL6U 3HP6A 5DQHA 3E2EA 4EYHB 5KG4A 2WTFA 4ED7A 4R63A 5AHXA 1XSPA 4QWEA 1LB2B 5ALJA 1XO1A 3PSPA 3QU4A 2MA1A 4C80A 1SV0C 5L1IA 5ALQA 5ALOA 4DOCA 2HOFA 1N62A 1ZD4A 4UB5A 4IRKA 3RH5A 3UMGA 4M6WB 4MEYA 2YMPA 1T3QA 1XNSA 3GZFA 4EZ6A 5F9NA 1J97A 1ZRNA 5KT3A 2DL0A 1KRPA 4KLUA 7ICOA 2HHSA 1ZETA 5KT4A 1ZQEA 5IIJA 3JPRA 3C23A 3KHRA 2ATLA 1Z4OA 5AI6A 1DK3A 5D46A 4UATA 4BXOA 3H4DA 4JUZA 5HP4A 5KFSA 1NKCA 2QLTA 3PSTA 4JMUA 3HJEA 5HHHA 4Z6CA 4IQUA 1L7MA 4IRDA 4F50A 1QCKA 4R65A 2JEGA 5CA7A 7ICEA 4OJ6A 3RR8A 1K1QA 2ZUDA 4DWIA 5L1MA 4EYIB 1MSWD 3SYZA 1U45A 5J2HA 1SL0A 9ICEA 5EWEA 1S0OA 4RPZA 1UA1A 1ZQDA 7ICPA 9ICCA 3GV7B 1ZQ1C 1NNLA 5KFNA 4MFAA 1JUDA 3KHGA 4C8KA 2XO7A 2BCSA 5EE1A 5J0SA 4Z6FA 2C2DA 3QZ8A 3JPOA 1Q3UA 5KFXA 3CYMA 5HMLA 4M6WA 4QZHA 2OXOA 5A0LA 2F1JA 2HVHA 5AKJA 4ED1A 4DS5A 3QUCA 3Q8QB 4KN7A 3FC4A 5KFMA 1SWWA 1ZQSA 3QU2A 3QUTA 2IHMA 4RU9A 3L5KA 5CJ7A 2ISPA 2NO4A 5J2CA 2E8PA 1QH9A 3PX0A 4UQGA 2LM4A 4DSEA 1WWVA 4UAYA 4DF8A 2FMPA 3RJEA 1A0PA 1OXJA 4BGDA 1N63A 4KLSA 3MR6A 1BGXT 5DKWA 1WCNA 1IM4A 1GO3F 2LYAA 4R8UB 5KG7A 1QSYA 1X66A 4I29A 3B0YA 5ALHA 1HIWA 5ALPA 3BQ0A 5KFCA 3GIKA 3PR4A 5J0QA 2WB1F 2QKQA 5KFIA 5IINA 4IQTA 1PVQA 1JXLA 2G08A 4PH5A 2HBJA 4NV0A 3C2LA 3EPIA 5H2FU 3AMZA 3AUOA 3NVWA 2R8KA 2ZXHA 3QU5A 1ZQPA 3TARA 3ISCA 2KN7A 5F9LA 5AM1A 1X2IA 5IIMA 2KOBA 2ZIUB 4NL9C 1V85A 3MGHA 3NASA 3SR6A 4DFMA 3KZXA 4UAUA 8ICKA 3LWLA 3H7IA 5TISU 3AU2A 3S6JA 1ZQAA 5HNKA 2KVSA 3TAPA 2F8LA 4IRCA 2D6FC 5D4BA 2FDRA 2DKXA 4ECVA 3C2KA 1KKXA 3GFKB 5ALRA 3V6JA 3WKDA 2KIVA 3TANA 1ZQKA 2R18A 4YXMA 2JZBB 4XUSA 1T3NA 2L5YA 2NRXA 4K4GA 3V7JA 1K1SA 3H8JA 1ZQRA 2A1JB 8ICYA 2D3DA 3QU7A 3FDSA 5DBBA 5KFEA 4DL6A 3H8SA 4Q45A 2KJ5A 4Y2UA 4DL7A 3QU9A 2JEFA 1V38A 2WF8A 2LM1A 3BQ7A 3OTQA 8ICJA 2ZTCA 3BQ1A 2ZIUA 4KLHA 1PVPA 3WKCA 2MUTA 1ZQFA 4QWCA 2WF5A 8ICRA 2KSOB 4M9LA 4XRHA 3T5LA 4Q44A 1TAUA 1NZPA 3DV9A 1NI3A 2WFAA 5AK4A 4TUQA 5JU5A 2UVVA 2XCAA 1RG6A 3KKAA 3SD7A 2PXIA 1BPXA 1XSNA 1SKSA 4G9BA 5B66U 4DEZA 1T4GA 2PKEA 4DFPA 5DBAA 5J2DA 2W43A 5KFWA 3CP8A 2UVRA 5KFPA 4BDPA 4ECQA 5ALXA 1N5XA 3H0LB 3IG8A 2G5HB 2XI9A 4P4MA 1N60A 2VA2A 2YQEA 2HHWA 1ZQCA 5TZVA 4MFCA 2G07A 1HUOA 4UBCA 3I1YA 2A1JA 4YG2A 1ZQVA 4UB3A 4MEXA 4ED3A 5AI4A 4DFKA 4GXJA 1FFVA 4J9QA 7ICRA 2DGZA 3MGIA 5EOZA 4B9LA 2WB1C 9ICVA 4F5PA 4BWJA 2RHFA 4FZLA 4O5KA 5KG2A 4ED8A 4EBEA 5BOMA 5CWRA 1O03A 4QZIA 1MA7A 2K8CB 3LWMA 3QYPA 5L1LA 1NK4A 4PPXA 3AN1A 2OCEA 5AKEA 1TK8A 4F5RA 4YN4A 2JEJA 3UQ2A 4ECTA 2FMQA 5ALSA 5J2AA 1KFSA 7ICVA 3LK9A 3THVA 4LVSA 3PW0A 1ZQLA 4YMMA 5DDYA 1ZOLA 3F5AA 3M6ZA 3SAFA 5ALTA 3QX7A 3KZIU 2Y9UA 4I27A 4GIBA 1QQ7A 4C7ZA 1Z4NA 4QWDA 4MF8A 2KZMA 4ED6A 3MDAA 3SQIA 5IIKA 4E0DA 1BPEA 1FO4A 3MDCA 4RUAA 2KHVA 1L3TA 4LZGA 3V6HA 3BDPA 2QARB 4Y2TA 5J0WA 3OSNA 5AKHA 4BWMA 3RAXA 4KTQA 2B0CA 3J81j 1Z3EB 1QSSA 7ICIA 1MQ2A 4KN4A 3RR7A 5KFLA 4ECWA 2KJ9A 4EEYA 5CR0A 5HR6A 1SZPA 2ZTEA 1FFUA 4NM1A 5ALDA 3GU3A 4DO9A 1FIQA 4WJ3B 1DRGA 4Y2YA 3F5EA 2P66A 4DQQA 1KW4A 5AM0A 4CRXA 3RAQA 3HW8A 3HWTA 3WKBA 4O0IA 4C8MA 1SL1A 5KFJA 3RB0A 1S97A 3MFHA 4QZDA 4JV1A 3RB3A 5KFGA 3C21A 4CCHA 4UASA 4PGXA 4Y2SA 3LVVA 4US8A 2B21A 4B9TA 3SENA 3ETLA 4DF4A 1S77D 1XS9D 4RQ4A 4JWNA 1JI7A 2MU2A 4MF2A 1MN8A 4KLDA 2JH7A 5J0UA 2QARA 4Y2RA 1NJWA 1KDHA 5AKXA 3I28A 5KG1A 3TKAA 2W8LA 1ZQQA 1TKDA 2R8GA 3EW9A 3AQEA 1AQ6A 3ZDBA 5DQGA 8ICMA 1D9DA 1QQ5A 1F5SA 7ICTA 1ZQJA 3B0XA 3KFUF 3IHQB 1RXWA 3KD3A 3RH4A 1TVAA 1JXEA 2LPEA 2F44A 5KTQA 1Z1VA 1Y88A 1KBUA 4DSFA 2E1FA 3C29A 4F92B 1RPLA 3ZD9A 4DSIA 3KKAC 3UXNA 4QZFA 1OUQA 4AP9A 2VANA 3CNHA 5B5EU 2BQ3A 2FLLA 1L7PA 3PW5A 2DPJA 4IQVA 1IXRA 1Q8KA 2V4QA 4DQPA 4CF4A 4DL2A 3AQFA 4C4TA 1PZNA 5J2KA 2I9GA 3IM1A 4PGYA 3C1YA 4NLCA 4F91B 4OJOA 5C0YA 1YT3A 5K4LA 1Q46A 2MAXA 5J2FA 1MC8A 4P0QA 1X9XA 2KK0A 4CDGA 2RP5A 3V7LA 4NY8A 4M47A 2EQYA 2KKVA 4R64A 1S76D 5FP0A 7ICHA 3Q8KA 1ZRMA 4QZGA 4M04A 4EENA 1ECWA 3IP4B 1ZQWA 3N28A 4YVZA 5EWFA 2RDIA 9ICJA 1L3VA 2Y1JA 5J8YA 1J2NA 2YB1A 1KLNA 1XC9A 2DWQA 5AKKA 2W03A 5AM3A 4J9MA 3JPQA 3G6VA 4F93B 3C5GA 3ZI4A 5C5JA 1QLNA 2JRZA 3QEAZ 4KLEA 4FBTA 1UT8A 4CE6A 4GC6A 3WU2U 2NV3A 4ECXA 2ZIWB 3PX4A 5ALFA 2R8HA 1B43A 4M9NA 4F5OA 2LBOA 5AICA 1QTMA 8ICAA 3PO4A 4BJQA 4IQWA 3H40A 2Y9TA 1SGGA 2UVWA 4RPXA 3HT3A 2J6TA 2AGPA 4C0ZA 4UARA 3PSFA 4NXZA 4NLNA 1N61A 4ACOA 4PGQA 3SAGA 4UB4A 3KHHA 1WYGA 3JPNA 5HMMA 5J0YA 4M9JA 2XY6A 4YD1A 1S9FA 2HOIA 4I2DA 2AU0A 3BQ2A 3TFRA 4B9MA 4RNNA 2G0AA 3K1RB 3OHAA 4YD2A 3T5HA 2O6KA 2F1IA 1ZJNA 4B9NA 4RNOA 5KFRA 3TAQA 7ICKA 3E0FA 2VA8A 5CRXA 3PX6A 4UAZA 4FS1A 1S0MA 2PFNA 2WAQC 3Q8RB 4YXJA 4Z6DA 4O3SA 1BPBA 3F2DA 1NJYA 2H3QA 2A1AA 4RNMA 4I2IA 2HHXA 2ZIWA 2ZIVB 2E1EA 3IRUA 1BPDA 2DBYA 5AI9A 2IHNA 4PHEA 1SB3C 2BGWA 4FZNA 3G6XA 1NJXA 3HX0A 3JPPA 5AIBA 9ICRA 1IG6A 1SKRA 3BS7A 4UB8U 2ZIXB 5G5GA 1XWLA 8ICTA 1UA0A 8ICHA 2VKQA 4TUSA 4J9NA 8ICIA 2A3VA 3WKEA 3V72A 1PVRA 3QUBA 4QWBA 2J6SA 3GV8B 2WF6A 4UB2A 4OJPA 4XA5A 5E79U 4YMOA 4RQ3A 2BZFA 2BKEA 4OCZA 4EX7A 1NK0A 3NVZA 2AH5A 4NLBA 2EH9A 2BCRA 1WCLA 1B22A 5ALMA 1NJZA 4KLFA 1RZTA 2PFOA 3JPSA 3RTVA 8ICQA 4F8RA 4F2SA 4J9SA 2JR5A 4P2HA 2EAPA 4RQ2A 4DLGA 2HBLA 3ONNA 2R8IA 4O3MA 4KLOA 1LKYB 3BZKA 3ISDA 4PHDA 2ZIVA 4O3QA 3PNCA 2I1QA 5IIIA 2NRTA 3PW4A 4KITB 3M9OB 3WK7A 3EUB2 3F2BA 4UAWA 8ICEA 2P6UA 2ZUCA 2MUTB 3PMLA 3KTQA 2XGPA 9ICGA 2ZIXA 4KMOB 4I2AA 4FFDA 2E3TA 4CNQA 4IR1A 7ICMA 1EXNA 3N7SC 1ZQHA 1S0VA 2PFPA 2DPIA 5GTHU 5KT7A 7ICQA 1ED1A 5BOLA 2OWOA 1BNPA 2Q4TA 4DFDA 2YTUA 5DBCA 2PMZF 1LV5A 1JROA 3AU6A 5KFUA 1JIHA 4DCCA 2KICA 1IIPA 5J0OA 4KLLA 5ALYA 1L7NA 3WKAA 3WK4A 1DXSA 4TUPA 4F72A 8ICWA 4Y2JA 3Q8PB 3SZ2A 3TACB 4F4ZA 1LKYA 1L5UA 4ZH4A 2IA6A 2IOFK 4C8OA 3B9JA 4EX6A 5J2EA 2HBMA 2P6RA 1X42A 3OJUA 5J0XA 1L3UA 4RUCA 2H5XA 5EE9A 1A76A 4M0AA 4F3OA 4CF5A 1O08A 3C5FA 3SV4A 3ZDEA 4TQRA 2K8AA 4QZAA 5KFOA 5EE0A 2I5HA 1OW5A 3UXPA 3RJIA 3DDHA 1XSLA 3RBEA 2AGOA 2FLNA 4RT3A 4BX9C 4QWAA 3SI8A 3D2SA 3RJHA 1D8YA 3G6YA 2RQ5A 4F71A 5ALZA 2XC9A 5IILA 1X9SA 2PFQA 5D49A 3ED5A 5ALUA 9ICQA 4RQ8A 1CRXA 4C4SA 2JV3A 1BPYA 4QIWF 4FO6A 3QEBZ 1ZD3A 4TURA 1PK1A 5KL8B 5AKGA 2ESEA 4KLTA 4DQIA 5KFZA 4KX3A 2A19A 1L3SA 4OJ5A 1U49A 4DQRA 5AKIA 1BNOA 5EWGA 1ZQIA 8ICOA 1S8OA 2YN4A 3VCBA 5AK5A 4RQ5A 1A77A 2W7PA 5DG9A 2Y0SF 1T8EA 2XICA 4C8NA 4X5VA 3H8MA 5ALKA 1DGJA 4I2HA 3T3FA 5KFTA 4JK1A 3QXGA 9ICIA 1ZQOA 3RFAA 2BDPA 2Q0ZX 1ZQNA 5AI0A 2ASLA 5CEHA 4Q8FA 4RQ0A 9ICUA 4KMUA 5DGBA 1WUDA 3MR5A 3K75D 3H8WA 3BQTA 3E58A 1S0NA 1RXVA 7ICJA 5DLFA 5DGAA 5KAIU 4Y2PA 2CXYA 3ZDDA 1HJPA 3M9NB 3LDAA 3QNMA 4A8EA 5J2JA 7ICUA 4C8LA 4RQNA 4P4PA 2LHTA 2GO7A 2JH1A 2V4RA 4I2GA 2CPRA 2KV2A 1F0MA 2ZTDA 4I2CA 2ASDA 3WK6A 4QZCA 2G09A 3FM9A 4F4XA 3SMVA 2PMZC 3QUQA 4DFJA 3ZDAA 1D9FA 1HEKA 2K8BB 2BPFA 3T5KA 1X6JA 1Z1BA 3BZCA 8ICPA 5F3XB 3ZD8A 1ZQGA 3IN5A 2KG5A 1JMSA 3IG5A 4B9VA 2R8JA 7ICLA 4J9LA 4C7YA 2YMMA 4DQSA 5DB7A 2RDJA 3N4MB 4K4IA 3ZDCA 2K4HA 3C1ZA 5L9XA 2H3IA 5J29A 3U26A 1SXDA 2IBKA 3KHLA 5DB6A 5ALNA 4F4WA 3MR3A 3CW2C 2KVCA 4EBDA 1ZQMA 1ZQUA 3BJYA 3SEIA 4DOBA 3ETRA 3AL0B 3PVXA 3WK5A 5KFBA 5BPCA 9ICMA 4CGZA 4YR3A 2OHFA 4YQWA 1X6IA 4ECYA 2C2EA 2CRXA 2KD1A 1KSPA 4GXKA 4PL2A 4P0QB 4QZ9A 2KEYA 3K1ZA 3RH6A 4ECSA 3M7DA 4YCXA 2XY5A 4QIWC 1VDVA 9ICFA 5HR7A 1X9MA 1Z00A 4RQ6A 4Q8EA 1CI4A 3TI0A 1SKWA 3F53A 3ALRA 2LI6A 2IOFA 4PHPA 3TFSA 3MBYA 1K5OA 2NRVA 4AYBF 4R66A 2XIDA 1ZQZA 4Y2VA 5ALEA 2G06A 2W3RA 5AI5A 3NUQA 3BS5B 1BPZA 3V7KA 4ZOHC 1CUKA 1NKEA 2BDUA 4Y2QA 4PHAA 2K60A 9ICHA 3AEVA 2E8MA 5AK6A 2NYVA 2BCVA 1HUZA 4U6PA 2FLPA 2XVTA 2FPKA 1J2MA 2LKYA 1XU4A 4NM2A 9ICSA 2VA3A 1NOMA 4K4HA 4PJ0U 3N97B 1F44A 2P35A 1P7DA 1RDFA 4DL5A 5L1KA 4F5QA 4NL9A 2ASJA 3PR5B
chains in the Genus database with same CATH topology
4UB6U 5B66U 3A0BU 5KAIU 5GTHU 2AXTU 3WU2U 5B5EU 5H2FU 1S5LU 5E79U 5TISU 3A0HU 4PJ0U 5GTIU 4IL6U 5KAFU 3KZIU 4UB8U 2DUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 U;  5B66 U;  3A0B U;  5KAI U;  5GTH U;  2AXT U;  3WU2 U;  5B5E U;  5H2F U;  1S5L U;  5E79 U;  5TIS U;  3A0H U;  4PJ0 U;  5GTI U;  4IL6 U;  5KAF U;  3KZI U;  4UB8 U;  2DUY A; 
#chains in the Genus database with same CATH topology
 2F3N A;  3R9K A;  3M8R A;  4F5N A;  1TAM A;  5JRT A;  3OGU A;  2JEI A;  4YMN A;  4USA A;  2W04 A;  1YZ6 A;  5AIA A;  2K4E A;  1IV8 A;  4GFJ A;  1DGS A;  1NZB A;  2DUY A;  1KFD A;  3BS5 A;  7ICN A;  1B4F A;  4EZ9 A;  7ICG A;  2K89 A;  5DB9 A;  1L6N A;  2HOQ A;  7ICS A;  2FJ6 A;  3MR2 A;  3GII A;  4IC9 A;  4DS4 A;  4FE3 A;  3NVY A;  2UVU A;  1X9W A;  2W11 A;  1H38 A;  2GWS A;  4ELT A;  3GQC A;  4P4O A;  5AKY A;  1SV4 A;  3UMC A;  3PY8 A;  1V9P A;  2LYB A;  1NK8 A;  3NRZ A;  5EE3 A;  4PZO A;  4JWM A;  1BVS A;  2H3F A;  2PI4 A;  3IV6 A;  5KFD A;  4DL4 A;  5KT2 A;  1RYU A;  2AJQ A;  8ICB A;  8ICN A;  8ICV A;  1TFR A;  5DQI A;  4O3R A;  1V97 A;  3PW7 A;  5J2B A;  4JV0 A;  4DL3 A;  2E8O A;  4F2R A;  5AM2 A;  5KL1 B;  9ICO A;  2KZZ A;  2W7O A;  3TAD A;  1RM6 C;  4LJX A;  3HKZ F;  1URJ A;  4J9K A;  3PSI A;  3IDW A;  5KAF U;  1QSL A;  2EZZ A;  4PL1 A;  4DSL A;  4RZR A;  9ICL A;  3C28 A;  2HHT A;  8ICC A;  4YR0 A;  2KKP A;  5ALL A;  2W9B B;  5KFY A;  3PMN A;  2XGQ A;  4AYB C;  3D6J A;  3M1Y A;  2DQN B;  1SWV A;  4DLE A;  3RRH A;  1ZD5 A;  1UPH A;  2QB1 A;  4PZN A;  1NK5 A;  3DEE A;  4NLZ A;  2VJ5 A;  2F8K A;  1X40 A;  2C22 A;  4QNL A;  5KG5 A;  1KL9 A;  4QW8 A;  3K4G A;  1FEZ A;  3HPO A;  2HCF A;  1RYR A;  2AQ4 A;  4UBB A;  5KFH A;  1LVH A;  2JMG A;  4NLG A;  2FI1 A;  1SIJ A;  4B9S A;  2YMQ A;  2XY7 A;  5CHG A;  4J9P A;  2KIW A;  2AGQ A;  4QZE A;  4YP3 A;  4O3N A;  4MFF A;  3PV8 A;  4B6J A;  2DF4 B;  2I6X A;  9ICN A;  2KE7 A;  3V6K A;  3Q8S B;  1TV9 A;  4OD0 A;  4J9O A;  2ZJA A;  1C7Y A;  2B6G A;  2C28 A;  1U4B A;  4DOA A;  4ECU A;  2W9A A;  1ARO P;  3GIL A;  2BQR A;  2W9B A;  2VIX A;  5IIO A;  2GOL A;  1DOQ A;  3O0F A;  1VJ5 A;  3CRX A;  2EDU A;  5AM5 A;  3Q8L A;  2JXJ A;  2W3S A;  1T7P A;  3N7P D;  3MC1 A;  4HAI A;  4ELV A;  2AHO B;  2JGA A;  2ZXI A;  1ZQY A;  2W8K A;  3L4P A;  2EAO A;  2F1H A;  2F77 X;  2BR0 A;  2V9W A;  5JUM A;  4KX5 A;  1DK2 A;  4KLG A;  3SAH A;  1KN5 A;  1UQV A;  4M9H A;  1COK A;  4RQ1 A;  2BPG A;  1D8B A;  4RT2 A;  5KFK A;  3M8S A;  4FS2 A;  1UHU A;  3PZP A;  2E5S A;  2OYY A;  4QZ8 A;  1JAL A;  5J8Y C;  4NJ8 A;  1WWU A;  3I76 A;  1COO A;  4FZM A;  1TAQ A;  2ZJ5 A;  5ALI A;  2Z7J A;  2NO5 A;  5KT5 A;  4G3I A;  2W55 A;  2EAM A;  4JV2 A;  2J6U A;  1PK1 B;  2YB4 A;  4OJL A;  4I2E A;  4EEL A;  1U9L A;  4DSJ A;  2NRZ A;  1L7O A;  4R8U A;  4C4R A;  4HYK A;  4O9M A;  1JN3 A;  3AM9 A;  1U48 A;  1Q3V A;  1MQ3 A;  3JPT A;  3OJS A;  1RQN A;  5AKL A;  4KLI A;  3HKZ C;  3OSP A;  2DFL A;  3GV5 B;  3RF9 A;  5KFV A;  5J0T A;  5J0R A;  3OPX A;  5ALG A;  3H0R B;  3LYS A;  2DKZ A;  3EPG A;  3UQ0 A;  4I28 A;  4I2F A;  3WK8 A;  5DG7 A;  4TQS A;  2OH2 A;  2D8C A;  4UW9 A;  3D2Q A;  5KNI A;  8ICX A;  2HSZ A;  4P0P B;  2QB0 B;  2AQ0 A;  3UXO A;  2HHU A;  5HHI A;  1PK3 A;  3NVV A;  5GTI U;  3TAD C;  1SL2 A;  2ALZ A;  3LVW A;  1VLB A;  2KHQ A;  3QZ7 A;  3QE9 Y;  4UB1 A;  3KBB A;  2F76 X;  5KG3 A;  4YFK A;  1KQQ A;  3C2M A;  2JZB A;  8ICU A;  1TK0 A;  2PI5 A;  4B9U A;  9ICW A;  3RJG A;  2KNJ A;  3N7R C;  1C20 A;  4O3P A;  3RRG A;  1QQ6 A;  2HI0 A;  4US9 A;  4CF3 A;  2CN1 A;  8ICL A;  2FPM A;  5KT6 A;  2H3V A;  2K4P A;  2KZ3 A;  2WF7 A;  2KTQ A;  5DLG A;  1UCV A;  5CP2 A;  1WG8 A;  1B0X A;  3VC8 A;  2BCQ A;  5G5H A;  9ICB A;  3ORY A;  4M9G A;  3A0H U;  5T14 A;  4ED0 A;  1ZQX A;  3T79 A;  2BCU A;  9ICA A;  4Z6E A;  4GLX A;  4ED2 A;  5AKZ A;  2BQU A;  5KFQ A;  4JB3 A;  3UM9 A;  2BHN A;  2YY6 A;  4OO1 J;  3RJK A;  2KSO A;  2IMW P;  4P0P A;  1S10 A;  8ICG A;  2MRL A;  2QB0 A;  1SV0 A;  5AM4 A;  2Y1I A;  2RLT A;  4F4K A;  2KFN A;  3L3F X;  2VJ4 A;  2ES6 A;  5KG0 A;  4QJF B;  2LYH A;  4UAV A;  1RQL A;  2M9N A;  5J2G A;  4Q43 A;  2FMS A;  2G5I B;  1N2X A;  1N5W A;  3NS1 A;  1NK6 A;  1NK9 A;  1TE2 A;  3EYZ A;  2GH1 A;  3RBD A;  1ZQB A;  2HHQ A;  3RJJ A;  1T94 A;  4ELU A;  5DDM A;  3H0M B;  9ICT A;  1KFT A;  2K4I A;  2W9M A;  5CB1 A;  3NRW A;  1ZD2 P;  1Z00 B;  3EWA A;  4IS7 A;  2W54 A;  5KG6 A;  4ECZ A;  1N48 A;  1D8L A;  1NK7 A;  4F4Y A;  1KTQ A;  4I2J A;  3RJF A;  5J2I A;  2FE9 A;  2WF9 A;  2EZY A;  2HMX A;  3A0B U;  4FBU A;  4ICA A;  4NWI A;  1M6Y A;  2AXT U;  2YML A;  3T5J A;  1XO0 A;  3Q8M A;  2NRW A;  4KLJ A;  1U47 A;  2ZUB A;  2BPC A;  2MSN A;  3NGD A;  4ECR A;  3RB4 A;  2ISO A;  1PUZ A;  1YZ7 A;  3TQ1 A;  5KFA A;  1KEJ A;  1Z19 A;  3MGV A;  2HW3 A;  5JTI A;  4MHV A;  4LZD A;  2JHD A;  4YR2 A;  2W9C B;  1ZJM A;  4I2B A;  3WK9 A;  2WHE A;  2HDO A;  5DG8 A;  2C2R A;  1UT5 A;  3ICX A;  3M6K A;  2HBK A;  4XQ8 A;  3HRD D;  9ICK A;  4DSK A;  4RQM A;  3MAB A;  3H4B A;  3OHB A;  3EZ5 A;  9ICP A;  2GLE A;  3PO5 A;  9ICX A;  8ICZ A;  3M9M B;  4QW9 A;  1ZQT A;  1ZYQ A;  4O5E A;  4M2Y A;  2KJ8 A;  4NLK A;  3F2C A;  2KFZ A;  4QZB A;  2OEH A;  1JX4 A;  5AI8 A;  2OM6 A;  4IR9 A;  1RYS A;  5ALW A;  3GIJ A;  4Y2X A;  3UMB A;  1SXE A;  4KLM A;  5DB8 A;  4O3O A;  7ICF A;  5KFF A;  1N56 A;  2YX8 A;  4KLQ A;  4UB6 U;  4U7C A;  3NTU A;  4GC7 A;  2ZG6 A;  2Y0S C;  2WAQ F;  1L8L A;  2EZX A;  1S5L U;  2KP7 A;  2RRD A;  5J0P A;  4EBC A;  4RQ7 A;  3SV3 A;  3GDX A;  3FAH A;  3KOO A;  2HHV A;  3FYH A;  5L1J A;  2W9C A;  8ICF A;  4RPY A;  3UPQ A;  2F2A B;  3D2N A;  2ZJ8 A;  1NKB A;  2KMD A;  2FPL A;  2IOH A;  3ISB A;  5ALV A;  3HIL A;  3RB6 A;  1JRP A;  2N1R A;  1A6S A;  4BUG A;  1CEZ A;  4EEK A;  4J9R A;  5AK3 A;  3MFI A;  4J03 A;  3PW2 A;  2H3Z A;  2M0N A;  4O5C A;  4BXO B;  3GIM A;  1TK5 A;  1ZXI A;  2HVI A;  2ODG A;  1SZH A;  2LMR A;  8ICS A;  2EAN A;  2XCP A;  4GXI A;  2E8N A;  1L8O A;  4IL6 U;  3HP6 A;  5DQH A;  3E2E A;  4EYH B;  5KG4 A;  2WTF A;  4ED7 A;  4R63 A;  5AHX A;  1XSP A;  4QWE A;  1LB2 B;  5ALJ A;  1XO1 A;  3PSP A;  3QU4 A;  2MA1 A;  4C80 A;  1SV0 C;  5L1I A;  5ALQ A;  5ALO A;  4DOC A;  2HOF A;  1N62 A;  1ZD4 A;  4UB5 A;  4IRK A;  3RH5 A;  3UMG A;  4M6W B;  4MEY A;  2YMP A;  1T3Q A;  1XNS A;  3GZF A;  4EZ6 A;  5F9N A;  1J97 A;  1ZRN A;  5KT3 A;  2DL0 A;  1KRP A;  4KLU A;  7ICO A;  2HHS A;  1ZET A;  5KT4 A;  1ZQE A;  5IIJ A;  3JPR A;  3C23 A;  3KHR A;  2ATL A;  1Z4O A;  5AI6 A;  1DK3 A;  5D46 A;  4UAT A;  4BXO A;  3H4D A;  4JUZ A;  5HP4 A;  5KFS A;  1NKC A;  2QLT A;  3PST A;  4JMU A;  3HJE A;  5HHH A;  4Z6C A;  4IQU A;  1L7M A;  4IRD A;  4F50 A;  1QCK A;  4R65 A;  2JEG A;  5CA7 A;  7ICE A;  4OJ6 A;  3RR8 A;  1K1Q A;  2ZUD A;  4DWI A;  5L1M A;  4EYI B;  1MSW D;  3SYZ A;  1U45 A;  5J2H A;  1SL0 A;  9ICE A;  5EWE A;  1S0O A;  4RPZ A;  1UA1 A;  1ZQD A;  7ICP A;  9ICC A;  3GV7 B;  1ZQ1 C;  1NNL A;  5KFN A;  4MFA A;  1JUD A;  3KHG A;  4C8K A;  2XO7 A;  2BCS A;  5EE1 A;  5J0S A;  4Z6F A;  2C2D A;  3QZ8 A;  3JPO A;  1Q3U A;  5KFX A;  3CYM A;  5HML A;  4M6W A;  4QZH A;  2OXO A;  5A0L A;  2F1J A;  2HVH A;  5AKJ A;  4ED1 A;  4DS5 A;  3QUC A;  3Q8Q B;  4KN7 A;  3FC4 A;  5KFM A;  1SWW A;  1ZQS A;  3QU2 A;  3QUT A;  2IHM A;  4RU9 A;  3L5K A;  5CJ7 A;  2ISP A;  2NO4 A;  5J2C A;  2E8P A;  1QH9 A;  3PX0 A;  4UQG A;  2LM4 A;  4DSE A;  1WWV A;  4UAY A;  4DF8 A;  2FMP A;  3RJE A;  1A0P A;  1OXJ A;  4BGD A;  1N63 A;  4KLS A;  3MR6 A;  1BGX T;  5DKW A;  1WCN A;  1IM4 A;  1GO3 F;  2LYA A;  4R8U B;  5KG7 A;  1QSY A;  1X66 A;  4I29 A;  3B0Y A;  5ALH A;  1HIW A;  5ALP A;  3BQ0 A;  5KFC A;  3GIK A;  3PR4 A;  5J0Q A;  2WB1 F;  2QKQ A;  5KFI A;  5IIN A;  4IQT A;  1PVQ A;  1JXL A;  2G08 A;  4PH5 A;  2HBJ A;  4NV0 A;  3C2L A;  3EPI A;  5H2F U;  3AMZ A;  3AUO A;  3NVW A;  2R8K A;  2ZXH A;  3QU5 A;  1ZQP A;  3TAR A;  3ISC A;  2KN7 A;  5F9L A;  5AM1 A;  1X2I A;  5IIM A;  2KOB A;  2ZIU B;  4NL9 C;  1V85 A;  3MGH A;  3NAS A;  3SR6 A;  4DFM A;  3KZX A;  4UAU A;  8ICK A;  3LWL A;  3H7I A;  5TIS U;  3AU2 A;  3S6J A;  1ZQA A;  5HNK A;  2KVS A;  3TAP A;  2F8L A;  4IRC A;  2D6F C;  5D4B A;  2FDR A;  2DKX A;  4ECV A;  3C2K A;  1KKX A;  3GFK B;  5ALR A;  3V6J A;  3WKD A;  2KIV A;  3TAN A;  1ZQK A;  2R18 A;  4YXM A;  2JZB B;  4XUS A;  1T3N A;  2L5Y A;  2NRX A;  4K4G A;  3V7J A;  1K1S A;  3H8J A;  1ZQR A;  2A1J B;  8ICY A;  2D3D A;  3QU7 A;  3FDS A;  5DBB A;  5KFE A;  4DL6 A;  3H8S A;  4Q45 A;  2KJ5 A;  4Y2U A;  4DL7 A;  3QU9 A;  2JEF A;  1V38 A;  2WF8 A;  2LM1 A;  3BQ7 A;  3OTQ A;  8ICJ A;  2ZTC A;  3BQ1 A;  2ZIU A;  4KLH A;  1PVP A;  3WKC A;  2MUT A;  1ZQF A;  4QWC A;  2WF5 A;  8ICR A;  2KSO B;  4M9L A;  4XRH A;  3T5L A;  4Q44 A;  1TAU A;  1NZP A;  3DV9 A;  1NI3 A;  2WFA A;  5AK4 A;  4TUQ A;  5JU5 A;  2UVV A;  2XCA A;  1RG6 A;  3KKA A;  3SD7 A;  2PXI A;  1BPX A;  1XSN A;  1SKS A;  4G9B A;  5B66 U;  4DEZ A;  1T4G A;  2PKE A;  4DFP A;  5DBA A;  5J2D A;  2W43 A;  5KFW A;  3CP8 A;  2UVR A;  5KFP A;  4BDP A;  4ECQ A;  5ALX A;  1N5X A;  3H0L B;  3IG8 A;  2G5H B;  2XI9 A;  4P4M A;  1N60 A;  2VA2 A;  2YQE A;  2HHW A;  1ZQC A;  5TZV A;  4MFC A;  2G07 A;  1HUO A;  4UBC A;  3I1Y A;  2A1J A;  4YG2 A;  1ZQV A;  4UB3 A;  4MEX A;  4ED3 A;  5AI4 A;  4DFK A;  4GXJ A;  1FFV A;  4J9Q A;  7ICR A;  2DGZ A;  3MGI A;  5EOZ A;  4B9L A;  2WB1 C;  9ICV A;  4F5P A;  4BWJ A;  2RHF A;  4FZL A;  4O5K A;  5KG2 A;  4ED8 A;  4EBE A;  5BOM A;  5CWR A;  1O03 A;  4QZI A;  1MA7 A;  2K8C B;  3LWM A;  3QYP A;  5L1L A;  1NK4 A;  4PPX A;  3AN1 A;  2OCE A;  5AKE A;  1TK8 A;  4F5R A;  4YN4 A;  2JEJ A;  3UQ2 A;  4ECT A;  2FMQ A;  5ALS A;  5J2A A;  1KFS A;  7ICV A;  3LK9 A;  3THV A;  4LVS A;  3PW0 A;  1ZQL A;  4YMM A;  5DDY A;  1ZOL A;  3F5A A;  3M6Z A;  3SAF A;  5ALT A;  3QX7 A;  3KZI U;  2Y9U A;  4I27 A;  4GIB A;  1QQ7 A;  4C7Z A;  1Z4N A;  4QWD A;  4MF8 A;  2KZM A;  4ED6 A;  3MDA A;  3SQI A;  5IIK A;  4E0D A;  1BPE A;  1FO4 A;  3MDC A;  4RUA A;  2KHV A;  1L3T A;  4LZG A;  3V6H A;  3BDP A;  2QAR B;  4Y2T A;  5J0W A;  3OSN A;  5AKH A;  4BWM A;  3RAX A;  4KTQ A;  2B0C A;  3J81 j;  1Z3E B;  1QSS A;  7ICI A;  1MQ2 A;  4KN4 A;  3RR7 A;  5KFL A;  4ECW A;  2KJ9 A;  4EEY A;  5CR0 A;  5HR6 A;  1SZP A;  2ZTE A;  1FFU A;  4NM1 A;  5ALD A;  3GU3 A;  4DO9 A;  1FIQ A;  4WJ3 B;  1DRG A;  4Y2Y A;  3F5E A;  2P66 A;  4DQQ A;  1KW4 A;  5AM0 A;  4CRX A;  3RAQ A;  3HW8 A;  3HWT A;  3WKB A;  4O0I A;  4C8M A;  1SL1 A;  5KFJ A;  3RB0 A;  1S97 A;  3MFH A;  4QZD A;  4JV1 A;  3RB3 A;  5KFG A;  3C21 A;  4CCH A;  4UAS A;  4PGX A;  4Y2S A;  3LVV A;  4US8 A;  2B21 A;  4B9T A;  3SEN A;  3ETL A;  4DF4 A;  1S77 D;  1XS9 D;  4RQ4 A;  4JWN A;  1JI7 A;  2MU2 A;  4MF2 A;  1MN8 A;  4KLD A;  2JH7 A;  5J0U A;  2QAR A;  4Y2R A;  1NJW A;  1KDH A;  5AKX A;  3I28 A;  5KG1 A;  3TKA A;  2W8L A;  1ZQQ A;  1TKD A;  2R8G A;  3EW9 A;  3AQE A;  1AQ6 A;  3ZDB A;  5DQG A;  8ICM A;  1D9D A;  1QQ5 A;  1F5S A;  7ICT A;  1ZQJ A;  3B0X A;  3KFU F;  3IHQ B;  1RXW A;  3KD3 A;  3RH4 A;  1TVA A;  1JXE A;  2LPE A;  2F44 A;  5KTQ A;  1Z1V A;  1Y88 A;  1KBU A;  4DSF A;  2E1F A;  3C29 A;  4F92 B;  1RPL A;  3ZD9 A;  4DSI A;  3KKA C;  3UXN A;  4QZF A;  1OUQ A;  4AP9 A;  2VAN A;  3CNH A;  5B5E U;  2BQ3 A;  2FLL A;  1L7P A;  3PW5 A;  2DPJ A;  4IQV A;  1IXR A;  1Q8K A;  2V4Q A;  4DQP A;  4CF4 A;  4DL2 A;  3AQF A;  4C4T A;  1PZN A;  5J2K A;  2I9G A;  3IM1 A;  4PGY A;  3C1Y A;  4NLC A;  4F91 B;  4OJO A;  5C0Y A;  1YT3 A;  5K4L A;  1Q46 A;  2MAX A;  5J2F A;  1MC8 A;  4P0Q A;  1X9X A;  2KK0 A;  4CDG A;  2RP5 A;  3V7L A;  4NY8 A;  4M47 A;  2EQY A;  2KKV A;  4R64 A;  1S76 D;  5FP0 A;  7ICH A;  3Q8K A;  1ZRM A;  4QZG A;  4M04 A;  4EEN A;  1ECW A;  3IP4 B;  1ZQW A;  3N28 A;  4YVZ A;  5EWF A;  2RDI A;  9ICJ A;  1L3V A;  2Y1J A;  5J8Y A;  1J2N A;  2YB1 A;  1KLN A;  1XC9 A;  2DWQ A;  5AKK A;  2W03 A;  5AM3 A;  4J9M A;  3JPQ A;  3G6V A;  4F93 B;  3C5G A;  3ZI4 A;  5C5J A;  1QLN A;  2JRZ A;  3QEA Z;  4KLE A;  4FBT A;  1UT8 A;  4CE6 A;  4GC6 A;  3WU2 U;  2NV3 A;  4ECX A;  2ZIW B;  3PX4 A;  5ALF A;  2R8H A;  1B43 A;  4M9N A;  4F5O A;  2LBO A;  5AIC A;  1QTM A;  8ICA A;  3PO4 A;  4BJQ A;  4IQW A;  3H40 A;  2Y9T A;  1SGG A;  2UVW A;  4RPX A;  3HT3 A;  2J6T A;  2AGP A;  4C0Z A;  4UAR A;  3PSF A;  4NXZ A;  4NLN A;  1N61 A;  4ACO A;  4PGQ A;  3SAG A;  4UB4 A;  3KHH A;  1WYG A;  3JPN A;  5HMM A;  5J0Y A;  4M9J A;  2XY6 A;  4YD1 A;  1S9F A;  2HOI A;  4I2D A;  2AU0 A;  3BQ2 A;  3TFR A;  4B9M A;  4RNN A;  2G0A A;  3K1R B;  3OHA A;  4YD2 A;  3T5H A;  2O6K A;  2F1I A;  1ZJN A;  4B9N A;  4RNO A;  5KFR A;  3TAQ A;  7ICK A;  3E0F A;  2VA8 A;  5CRX A;  3PX6 A;  4UAZ A;  4FS1 A;  1S0M A;  2PFN A;  2WAQ C;  3Q8R B;  4YXJ A;  4Z6D A;  4O3S A;  1BPB A;  3F2D A;  1NJY A;  2H3Q A;  2A1A A;  4RNM A;  4I2I A;  2HHX A;  2ZIW A;  2ZIV B;  2E1E A;  3IRU A;  1BPD A;  2DBY A;  5AI9 A;  2IHN A;  4PHE A;  1SB3 C;  2BGW A;  4FZN A;  3G6X A;  1NJX A;  3HX0 A;  3JPP A;  5AIB A;  9ICR A;  1IG6 A;  1SKR A;  3BS7 A;  4UB8 U;  2ZIX B;  5G5G A;  1XWL A;  8ICT A;  1UA0 A;  8ICH A;  2VKQ A;  4TUS A;  4J9N A;  8ICI A;  2A3V A;  3WKE A;  3V72 A;  1PVR A;  3QUB A;  4QWB A;  2J6S A;  3GV8 B;  2WF6 A;  4UB2 A;  4OJP A;  4XA5 A;  5E79 U;  4YMO A;  4RQ3 A;  2BZF A;  2BKE A;  4OCZ A;  4EX7 A;  1NK0 A;  3NVZ A;  2AH5 A;  4NLB A;  2EH9 A;  2BCR A;  1WCL A;  1B22 A;  5ALM A;  1NJZ A;  4KLF A;  1RZT A;  2PFO A;  3JPS A;  3RTV A;  8ICQ A;  4F8R A;  4F2S A;  4J9S A;  2JR5 A;  4P2H A;  2EAP A;  4RQ2 A;  4DLG A;  2HBL A;  3ONN A;  2R8I A;  4O3M A;  4KLO A;  1LKY B;  3BZK A;  3ISD A;  4PHD A;  2ZIV A;  4O3Q A;  3PNC A;  2I1Q A;  5III A;  2NRT A;  3PW4 A;  4KIT B;  3M9O B;  3WK7 A;  3EUB 2;  3F2B A;  4UAW A;  8ICE A;  2P6U A;  2ZUC A;  2MUT B;  3PML A;  3KTQ A;  2XGP A;  9ICG A;  2ZIX A;  4KMO B;  4I2A A;  4FFD A;  2E3T A;  4CNQ A;  4IR1 A;  7ICM A;  1EXN A;  3N7S C;  1ZQH A;  1S0V A;  2PFP A;  2DPI A;  5GTH U;  5KT7 A;  7ICQ A;  1ED1 A;  5BOL A;  2OWO A;  1BNP A;  2Q4T A;  4DFD A;  2YTU A;  5DBC A;  2PMZ F;  1LV5 A;  1JRO A;  3AU6 A;  5KFU A;  1JIH A;  4DCC A;  2KIC A;  1IIP A;  5J0O A;  4KLL A;  5ALY A;  1L7N A;  3WKA A;  3WK4 A;  1DXS A;  4TUP A;  4F72 A;  8ICW A;  4Y2J A;  3Q8P B;  3SZ2 A;  3TAC B;  4F4Z A;  1LKY A;  1L5U A;  4ZH4 A;  2IA6 A;  2IOF K;  4C8O A;  3B9J A;  4EX6 A;  5J2E A;  2HBM A;  2P6R A;  1X42 A;  3OJU A;  5J0X A;  1L3U A;  4RUC A;  2H5X A;  5EE9 A;  1A76 A;  4M0A A;  4F3O A;  4CF5 A;  1O08 A;  3C5F A;  3SV4 A;  3ZDE A;  4TQR A;  2K8A A;  4QZA A;  5KFO A;  5EE0 A;  2I5H A;  1OW5 A;  3UXP A;  3RJI A;  3DDH A;  1XSL A;  3RBE A;  2AGO A;  2FLN A;  4RT3 A;  4BX9 C;  4QWA A;  3SI8 A;  3D2S A;  3RJH A;  1D8Y A;  3G6Y A;  2RQ5 A;  4F71 A;  5ALZ A;  2XC9 A;  5IIL A;  1X9S A;  2PFQ A;  5D49 A;  3ED5 A;  5ALU A;  9ICQ A;  4RQ8 A;  1CRX A;  4C4S A;  2JV3 A;  1BPY A;  4QIW F;  4FO6 A;  3QEB Z;  1ZD3 A;  4TUR A;  1PK1 A;  5KL8 B;  5AKG A;  2ESE A;  4KLT A;  4DQI A;  5KFZ A;  4KX3 A;  2A19 A;  1L3S A;  4OJ5 A;  1U49 A;  4DQR A;  5AKI A;  1BNO A;  5EWG A;  1ZQI A;  8ICO A;  1S8O A;  2YN4 A;  3VCB A;  5AK5 A;  4RQ5 A;  1A77 A;  2W7P A;  5DG9 A;  2Y0S F;  1T8E A;  2XIC A;  4C8N A;  4X5V A;  3H8M A;  5ALK A;  1DGJ A;  4I2H A;  3T3F A;  5KFT A;  4JK1 A;  3QXG A;  9ICI A;  1ZQO A;  3RFA A;  2BDP A;  2Q0Z X;  1ZQN A;  5AI0 A;  2ASL A;  5CEH A;  4Q8F A;  4RQ0 A;  9ICU A;  4KMU A;  5DGB A;  1WUD A;  3MR5 A;  3K75 D;  3H8W A;  3BQT A;  3E58 A;  1S0N A;  1RXV A;  7ICJ A;  5DLF A;  5DGA A;  5KAI U;  4Y2P A;  2CXY A;  3ZDD A;  1HJP A;  3M9N B;  3LDA A;  3QNM A;  4A8E A;  5J2J A;  7ICU A;  4C8L A;  4RQN A;  4P4P A;  2LHT A;  2GO7 A;  2JH1 A;  2V4R A;  4I2G A;  2CPR A;  2KV2 A;  1F0M A;  2ZTD A;  4I2C A;  2ASD A;  3WK6 A;  4QZC A;  2G09 A;  3FM9 A;  4F4X A;  3SMV A;  2PMZ C;  3QUQ A;  4DFJ A;  3ZDA A;  1D9F A;  1HEK A;  2K8B B;  2BPF A;  3T5K A;  1X6J A;  1Z1B A;  3BZC A;  8ICP A;  5F3X B;  3ZD8 A;  1ZQG A;  3IN5 A;  2KG5 A;  1JMS A;  3IG5 A;  4B9V A;  2R8J A;  7ICL A;  4J9L A;  4C7Y A;  2YMM A;  4DQS A;  5DB7 A;  2RDJ A;  3N4M B;  4K4I A;  3ZDC A;  2K4H A;  3C1Z A;  5L9X A;  2H3I A;  5J29 A;  3U26 A;  1SXD A;  2IBK A;  3KHL A;  5DB6 A;  5ALN A;  4F4W A;  3MR3 A;  3CW2 C;  2KVC A;  4EBD A;  1ZQM A;  1ZQU A;  3BJY A;  3SEI A;  4DOB A;  3ETR A;  3AL0 B;  3PVX A;  3WK5 A;  5KFB A;  5BPC A;  9ICM A;  4CGZ A;  4YR3 A;  2OHF A;  4YQW A;  1X6I A;  4ECY A;  2C2E A;  2CRX A;  2KD1 A;  1KSP A;  4GXK A;  4PL2 A;  4P0Q B;  4QZ9 A;  2KEY A;  3K1Z A;  3RH6 A;  4ECS A;  3M7D A;  4YCX A;  2XY5 A;  4QIW C;  1VDV A;  9ICF A;  5HR7 A;  1X9M A;  1Z00 A;  4RQ6 A;  4Q8E A;  1CI4 A;  3TI0 A;  1SKW A;  3F53 A;  3ALR A;  2LI6 A;  2IOF A;  4PHP A;  3TFS A;  3MBY A;  1K5O A;  2NRV A;  4AYB F;  4R66 A;  2XID A;  1ZQZ A;  4Y2V A;  5ALE A;  2G06 A;  2W3R A;  5AI5 A;  3NUQ A;  3BS5 B;  1BPZ A;  3V7K A;  4ZOH C;  1CUK A;  1NKE A;  2BDU A;  4Y2Q A;  4PHA A;  2K60 A;  9ICH A;  3AEV A;  2E8M A;  5AK6 A;  2NYV A;  2BCV A;  1HUZ A;  4U6P A;  2FLP A;  2XVT A;  2FPK A;  1J2M A;  2LKY A;  1XU4 A;  4NM2 A;  9ICS A;  2VA3 A;  1NOM A;  4K4H A;  4PJ0 U;  3N97 B;  1F44 A;  2P35 A;  1P7D A;  1RDF A;  4DL5 A;  5L1K A;  4F5Q A;  4NL9 A;  2ASJ A;  3PR5 B; 
#chains in the Genus database with same CATH homology
 4UB6 U;  5B66 U;  3A0B U;  5KAI U;  5GTH U;  2AXT U;  3WU2 U;  5B5E U;  5H2F U;  1S5L U;  5E79 U;  5TIS U;  3A0H U;  4PJ0 U;  5GTI U;  4IL6 U;  5KAF U;  3KZI U;  4UB8 U;  2DUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...