5E79U

Macromolecular diffractive imaging using imperfect crystals
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5e79U01
3A0HU 3KZIU 4IL6U 4PJ0U 5TISU 5KAFU 2DUYA 4UB6U 5GTHU 5KAIU 3A0BU 5E79U 5GTIU 5H2FU 5B5EU 3WU2U 4UB8U 1S5LU 5B66U 2AXTU
chains in the Genus database with same CATH superfamily
3PW5A 3K4GA 3SV3A 3NRZA 3TAQA 1Z00A 4FE3A 3WK8A 2RLTA 2W9MA 3T3FA 1RYUA 3M6ZA 3QEAZ 2HMXA 1QQ7A 4RQ8A 2NRZA 3ZI4A 4EYHB 4CDGA 2B0CA 4NL9A 5C0YA 1BPXA 4NV0A 4F93B 2KTQA 2ZXIA 4JV0A 2BQ3A 4C4SA 2KIVA 3R9KA 5ALJA 4ED8A 1PVPA 2KEYA 1ZQDA 5ALVA 4QNLA 4ED1A 1ZQVA 4NLZA 4PL2A 1ZQSA 2WTFA 3UXNA 3BQ0A 1CEZA 1N63A 1KSPA 5KG7A 3PW7A 2W04A 2JEGA 1QH9A 4PHAA 1IV8A 1SV0C 3ZDBA 1MA7A 4EELA 1O08A 5B66U 4EZ6A 2FLNA 4RQMA 4F71A 2RRDA 3E58A 5HMMA 3TQ1A 4YG2A 3LYSA 3I28A 5KFYA 1L3VA 2DWQA 3M8SA 5DDMA 4QIWF 4UB6U 5AKGA 5KG2A 3IRUA 3WKBA 4YD2A 4BXOA 3PX4A 9ICWA 4HYKA 3ISDA 4YQWA 5CHGA 4ELVA 4K4GA 4KN4A 4C4RA 8ICSA 2FE9A 3QXGA 2KZZA 1NKCA 1U47A 1TE2A 4RQ6A 2F8KA 5KFWA 3PW0A 4J9OA 1U48A 3CW2C 3KD3A 2G08A 2JH1A 1COKA 2LM4A 2PKEA 3JPQA 1Z3EB 5G5HA 2JH7A 5J0RA 3JPTA 4P2HA 4Y2UA 5DLFA 2FMQA 3PSTA 4PHDA 2EAOA 4I2BA 3GV5B 3TFSA 8ICHA 5J2EA 3FM9A 2ZIVA 9ICOA 1T3QA 2ZIVB 3H0RB 3D2NA 4OJLA 3BZCA 3JPRA 3TI0A 2Y0SF 2R8GA 4NWIA 4F91B 2YX8A 1DGJA 5FP0A 5AM2A 2EZXA 5B5EU 2Y1JA 5KTQA 3SYZA 5T14A 4B9NA 4RT2A 3C2LA 1MC8A 3GIKA 4ECRA 2W9BB 1ZQEA 2A3VA 5DB6A 4EENA 1KLNA 4M47A 3AU6A 1BNPA 3PV8A 5J0XA 1AROP 5AICA 5EE9A 4UBBA 1JMSA 1A0PA 5HR7A 4C8LA 4DOCA 2WB1F 3B9JA 1DK2A 2HCFA 7ICPA 2AXTU 4M9GA 2W9CA 4BXOB 5IIMA 4UAVA 2KNJA 3QUQA 1KQQA 9ICGA 1UA1A 4ED2A 5KFMA 2BCUA 2PMZF 1UA0A 1BPZA 3KFUF 4P0QB 3K75D 4ED0A 2ES6A 1P7DA 5CEHA 4MF8A 2ZUCA 1Z1VA 1ZQZA 5AKKA 1FO4A 4C4TA 4EX7A 4DFDA 3OHAA 2KE7A 3QU2A 1ZQTA 5KFOA 2GWSA 3F5AA 1TV9A 3H4DA 5EWFA 2QB0B 1LB2B 4J9LA 1S0OA 1D9DA 4PL1A 8ICFA 3RB0A 1RM6C 5J2DA 4KMUA 3WKDA 2I6XA 3Q8LA 5KG1A 3KHLA 5BOMA 2W9BA 2YY6A 4JV1A 2ZIXA 4Q45A 1F44A 5DG7A 9ICXA 5EE0A 3H7IA 3PW2A 2K4HA 3GILA 1XC9A 2JGAA 4IRKA 2OHFA 2FMPA 4B6JA 4IC9A 1KN5A 3RFAA 4LZGA 1XSLA 2DF4B 1VLBA 2G07A 2IMWP 4CRXA 2KMDA 4KTQA 2LYAA 2KN7A 4Y2XA 4RUAA 3M9OB 4UB8U 4XRHA 2FPLA 1MSWD 4Y2PA 2NO5A 1C7YA 2MUTB 5J0PA 1L5UA 1Z00B 2DPJA 2W3RA 1KFTA 4NXZA 2IHMA 2QB1A 4J9MA 3NASA 2WAQF 2I9GA 5KG6A 5J29A 3V6KA 1HUZA 3RH6A 2YTUA 3C29A 4IL6U 2HSZA 1KTQA 2JZBA 1ZQBA 8ICJA 4EZ9A 5AI5A 3M9NB 4TUPA 1RDFA 1CUKA 3CRXA 3NVVA 3MGIA 3TADC 3K1ZA 9ICHA 3ETLA 3OJUA 1OUQA 5AK4A 4TURA 4M9HA 4DS5A 4RNMA 2K8BB 3UQ0A 2R18A 3SAFA 4UB2A 1UHUA 2JZBB 2P6UA 7ICFA 2E8OA 1GO3F 3OTQA 4DCCA 1NK8A 3MFIA 3F2CA 4O3NA 2QLTA 5KL8B 3QUTA 2FI1A 1ZQJA 2D8CA 5AKEA 3SZ2A 5F9NA 4QZBA 2ASDA 8ICIA 5AKIA 3MDCA 1ZQLA 4UB3A 3MGHA 4C0ZA 3OHBA 5KFBA 2MU2A 3EPGA 5IIJA 1M6YA 3ORYA 2VANA 1BPEA 4E0DA 5J0OA 1V38A 3IG5A 4KLJA 4P0PB 2Y1IA 2YMLA 3BS5B 3L4PA 4MHVA 2IHNA 2NRTA 4QZGA 1RYRA 7ICJA 2KSOA 5DBAA 4UATA 1S0NA 2BKEA 2YN4A 2E8MA 2J6SA 4QZ8A 4RPZA 4UB5A 1L7MA 1SV0A 3JPOA 2FPMA 3CYMA 1QCKA 5BOLA 3NS1A 4DQSA 1TAUA 2BZFA 2JEJA 1L3UA 1UQVA 1PVQA 3QU4A 2A1JB 4XUSA 4OO1J 3TACB 3EPIA 9ICFA 7ICIA 3LWLA 3BS7A 1QLNA 4BGDA 3BQ2A 4OJ6A 1RZTA 3LDAA 5J2IA 2HBJA 2GLEA 1B43A 2GO7A 2IOFA 4MEYA 2WF5A 1WUDA 5E79U 4YN4A 1TVAA 2N1RA 2P6RA 3RH5A 1L7PA 3PVXA 5ALWA 1TAMA 5ALFA 2KP7A 2KZMA 3PY8A 3CP8A 3N28A 5L9XA 2W43A 4IQWA 4JV2A 5KT4A 3JPNA 1ZETA 2FLPA 4Z6EA 7ICGA 9ICLA 2NYVA 2EZZA 1NJYA 5HR6A 4IQUA 3TAPA 3HT3A 4DQPA 5L1JA 3IN5A 1RXVA 1TAQA 3M1YA 1ZJNA 1ZJMA 1S76D 3QNMA 1N56A 1Z4OA 5L1MA 5ALPA 4RQ3A 3M6KA 2XY7A 1XSNA 4RPXA 1CI4A 3SR6A 1JRPA 3FAHA 1TK0A 4F72A 1LV5A 1JX4A 1VJ5A 4F5PA 4ECSA 2FJ6A 4QWBA 5JRTA 2MUTA 5IIKA 4C8KA 3GIIA 1N5XA 1BPDA 2BQRA 1T94A 4YR0A 3TADA 4P4MA 3LK9A 2DL0A 4Y2RA 1ECWA 2C28A 1NZPA 2HOQA 4Y2JA 9ICQA 5KFTA 3GDXA 1TFRA 2KKPA 4Z6DA 5IILA 2GOLA 1JALA 2ZIUB 3PSIA 1QSSA 1UPHA 2ZJAA 5TZVA 5ALIA 2VJ5A 5F3XB 2F44A 4DSIA 4NL9C 5KAIU 4YD1A 4DL7A 5J2KA 5J0UA 5KFQA 4Q8FA 2XCPA 3WKEA 4DSLA 4O5CA 4GC7A 1L7OA 2LYBA 3AMZA 3L5KA 1COOA 1L8LA 2DGZA 4J03A 2YMQA 3RH4A 3RJFA 1NK7A 4NLCA 5AM5A 3QEBZ 1WCNA 2A1JA 5AM3A 2YB1A 3UXPA 7ICTA 4PHEA 3MR5A 2JV3A 4O3SA 3RJJA 5JUMA 1ZQKA 9ICEA 2HBMA 2OH2A 1HEKA 3UQ2A 4F4ZA 1NOMA 4NLBA 4U7CA 4KLOA 3C1YA 1XWLA 1X9MA 4KLEA 2XI9A 3KHGA 1BNOA 2V4QA 2BCQA 3QE9Y 2QARA 4UAZA 3HWTA 4O5KA 2YB4A 2WF6A 3HILA 3QU5A 5KL1B 1N5WA 1WG8A 3PR4A 4ZOHC 3OPXA 1L3SA 1JI7A 5AIBA 2CPRA 4QZDA 5AK3A 3MR3A 5KFCA 2XVTA 4GIBA 8ICAA 1X66A 4UB1A 7ICMA 3M8RA 1C20A 3HRDD 3PMLA 1DXSA 3H4BA 1PVRA 3TFRA 3HKZC 5HHHA 3RAXA 4OCZA 4P0QA 3KKAA 1ZQUA 2FMSA 4C8OA 4M9NA 2NO4A 1Z19A 5GTHU 5AI9A 3KTQA 3UMGA 4US8A 4IS7A 4RNNA 4B9SA 3IG8A 3NVZA 4PGYA 2F1JA 2AU0A 1LVHA 2W9CB 3ZDEA 5KT2A 3Q8KA 3C23A 1SWWA 4DL4A 2AQ0A 4KLSA 2LKYA 5DKWA 4LVSA 2KOBA 2JRZA 3RBEA 2DKXA 3AN1A 2F76X 5JTIA 1RXWA 1NZBA 1D8BA 4QZFA 4Y2SA 1TKDA 3WK4A 3QZ8A 4FZLA 1N48A 2LI6A 3RRGA 4I2HA 3FDSA 2KVSA 1IM4A 2KZ3A 2JR5A 4K4HA 1RYSA 4QIWC 1S0MA 4B9UA 4DFKA 4FS2A 2BQUA 2VKQA 3RB3A 5AKJA 3F2BA 2BCSA 2HOFA 2PFNA 4DSFA 4TQSA 5ALHA 2HHSA 3EW9A 4J9NA 5AIAA 4NM1A 2MAXA 3B0YA 3AQEA 3NRWA 4EYIB 2H3VA 2HBKA 2GH1A 2HHVA 2LHTA 4J9SA 9ICIA 4BX9C 4M2YA 1B0XA 4KLMA 3ZD8A 3ONNA 4F3OA 1X9SA 5KG5A 3AM9A 4TUSA 5KFEA 1NKBA 1RPLA 5J0SA 1ZQMA 2ZIWB 4MFFA 1WYGA 3WK5A 5AK6A 2AGPA 2LYHA 4BWJA 4PH5A 4O3QA 2XIDA 1YT3A 2I1QA 3DEEA 1Q3UA 1T4GA 5KG3A 3BJYA 3PO4A 4CF5A 4Q44A 2AGQA 4I2DA 3TANA 2BPFA 2AH5A 9ICBA 3MR6A 4Y2TA 2C22A 2R8JA 7ICVA 2M9NA 4DOAA 3N7RC 2K89A 4C80A 4KLHA 8ICUA 3WKCA 1HJPA 5AK5A 1S0VA 2XICA 2EQYA 1ZQYA 4PZOA 4UB4A 4TUQA 5ALUA 2K60A 3MBYA 1X9WA 4ECTA 1SL0A 5AI0A 4DL6A 2E8PA 3J81j 3VCBA 5ALRA 2ZIUA 5EWEA 4FO6A 3D2SA 4JMUA 3UXOA 4DQQA 3V6JA 3GV7B 1ZQCA 1N60A 1A76A 2ZTEA 1U9LA 3ALRA 3L3FX 9ICPA 1ZRMA 1SV4A 8ICQA 4FBUA 2XGQA 5AI8A 3NGDA 4I29A 3Q8SB 1WWVA 4BDPA 4KLFA 2G5IB 1TK8A 8ICRA 2C2DA 2RQ5A 2KG5A 1ZD4A 5KFDA 2IOFK 2PMZC 2E8NA 4RU9A 1MQ3A 4KLLA 1PK3A 4DS4A 4GXJA 8ICYA 5KFXA 9ICKA 2ASLA 1L3TA 3AEVA 5D49A 4YR2A 8ICBA 4R66A 2G0AA 5IIOA 4QWCA 4A8EA 3HPOA 2W8KA 2RHFA 4QWEA 3OSNA 2G09A 3RB4A 4MF2A 4LZDA 3T5JA 4YMOA 3AU2A 2VIXA 2H5XA 3DV9A 1SZHA 5L1KA 7ICLA 1ZRNA 3GIJA 4OJPA 4DLGA 3ISBA 2BCRA 2EANA 2K4IA 4PHPA 3WK6A 2Q0ZX 1ZQIA 5BPCA 4KMOB 3RB6A 1U49A 3WK9A 4Y2VA 1JXLA 2HVHA 2B6GA 5J0QA 5DQGA 1URJA 4NLKA 3SAHA 2V9WA 1SZPA 4GXKA 4F4KA 3T5HA 3KZIU 4IRCA 3IP4B 2KD1A 7ICHA 1J2NA 2W11A 2ALZA 3V6HA 1IXRA 2VA3A 4JUZA 2XC9A 4YMMA 2W03A 2K8CB 2QKQA 1F5SA 2Z7JA 1NJZA 3C1ZA 1SXDA 5J8YA 1FFVA 3HKZF 4Z6FA 2KJ8A 2HOIA 4CF3A 1K1SA 4EBEA 5AKLA 4KX5A 4AYBC 3T5LA 4DF4A 2ZTDA 2MRLA 3H8WA 5HP4A 1SIJA 4IQVA 4RPYA 4UAWA 1ZQFA 5J2GA 4UAUA 1KFDA 1X6IA 4QJFB 3GV8B 5EWGA 4ECQA 2BPGA 5ALZA 3HX0A 4MEXA 3MC1A 2JMGA 4Q8EA 3T79A 4RT3A 2HHQA 4BJQA 4FS1A 5J0WA 2WFAA 4Q43A 2VA2A 4O5EA 4GC6A 5KT5A 5AKXA 5KFFA 4DFJA 2CN1A 1ZQNA 3PW4A 3QZ7A 3EZ5A 3C5GA 4KLGA 4UARA 1Y88A 4DEZA 5HNKA 4DWIA 4F5QA 3KZXA 1HUOA 1NK9A 2E1FA 3GU3A 4US9A 3N7SC 3MR2A 3HW8A 3PO5A 2EDUA 4QZCA 2OWOA 3RJHA 3H0LB 4QWDA 7ICEA 2YMPA 4M9JA 3FYHA 3G6XA 4TQRA 7ICNA 4CGZA 5CJ7A 4DFPA 3V7JA 3N97B 5HMLA 5EOZA 2JHDA 4YXMA 4KX3A 2Q4TA 4NLNA 2JEFA 5J0TA 4B9VA 3RBDA 5IIIA 3Q8QB 4O9MA 1S10A 9ICCA 3H8SA 8ICZA 3Q8MA 9ICUA 4ELTA 4R8UB 2HHWA 4C8MA 3QUCA 4ECXA 1SXEA 1K5OA 1YZ6A 5KFHA 4QZHA 5AI4A 1NNLA 3AUOA 3MABA 1PZNA 3KOOA 2Y9UA 2ZUBA 5JU5A 4R63A 3OSPA 2ZUDA 5H2FU 4R64A 2EAMA 2KHVA 9ICVA 2DBYA 1X42A 1ZD2P 1DGSA 3LWMA 3WU2U 5DG9A 4YCXA 4QZ9A 4JWNA 4EBDA 4I27A 4DF8A 4F92B 1ZD5A 2F77X 4UQGA 3C2MA 5KNIA 2PFOA 4MFAA 3H0MB 2LPEA 1SL1A 1TK5A 3BQ1A 3SV4A 1LKYA 5KT3A 1ZQRA 2H3FA 3M7DA 4QW9A 4YR3A 1ZQAA 3BQ7A 4I2FA 3NVWA 4PGQA 2UVUA 5KG4A 7ICUA 2P66A 2KKVA 3T5KA 3QU9A 4QW8A 2C2EA 3RAQA 4F4XA 7ICQA 4BWMA 2ISOA 3GQCA 3F53A 2F2AB 5DGBA 2KK0A 4R8UA 5KFZA 2RP5A 1L8OA 1KFSA 2R8IA 3ZDAA 4IR1A 3JPPA 5KFRA 4C8NA 3TKAA 5EE3A 2M0NA 1QTMA 5J2BA 2AQ4A 1YZ7A 3A0BU 3KHHA 2CRXA 1A77A 1QSYA 2PI4A 2R8KA 5AM0A 4JB3A 4I2EA 1XO1A 2L5YA 4ZH4A 3IDWA 1D8YA 4K4IA 1K1QA 4PZNA 4XA5A 3RJIA 8ICLA 3GZFA 2KFNA 1X40A 2G5HB 5AI6A 4OJOA 5J2HA 4EBCA 4F2RA 4DSJA 4PPXA 9ICJA 1DK3A 1UT5A 4KLUA 2XY6A 2BPCA 3H8JA 8ICKA 4GXIA 2PFPA 3PMNA 5KG0A 1V85A 2ZJ8A 5AHXA 4USAA 5GTIU 1BPYA 4QZIA 2KICA 8ICNA 4NY8A 4F5RA 1KDHA 4NJ8A 1XU4A 9ICTA 4FZNA 1ZQHA 2KIWA 3G6YA 1Q8KA 5AKHA 1S77D 5DLGA 2ATLA 4I2JA 2FPKA 2I5HA 1ZQ1C 5KFJA 4UBCA 4NLGA 5J8YC 3D2QA 4RZRA 2W54A 3QU7A 4RNOA 4I2IA 1O03A 4M6WB 2ESEA 1U4BA 5F9LA 5D46A 2UVRA 4J9KA 4UAYA 1XSPA 4I2CA 2P35A 1FEZA 2UVVA 1X2IA 1FIQA 3EYZA 5AKZA 4ACOA 2MSNA 4ICAA 3WKAA 2KVCA 1B22A 3PR5B 3QUBA 2BDUA 2KJ5A 8ICOA 1T3NA 3I76A 5DDYA 4GFJA 2XGPA 4DL3A 2ZIXB 4PJ0U 4U6PA 2HW3A 4MFCA 5AM4A 2RDJA 2KSOB 2J6TA 1X9XA 2KHQA 3JPSA 7ICRA 2W9AA 2HHTA 8ICCA 1BVSA 1N62A 5ALDA 8ICEA 2WF8A 1U45A 4AP9A 1WCLA 3ED5A 1CRXA 1XS9D 2XCAA 4ECYA 3ZD9A 4J9PA 8ICTA 4B9LA 2H3IA 3HP6A 3G6VA 2NRWA 8ICWA 4CNQA 4M0AA 4ECUA 5IINA 2R8HA 1OXJA 4F50A 3PZPA 4F2SA 3IM1A 5ALLA 1ZXIA 4KLQA 2VA8A 3U26A 3O0FA 4FZMA 4Y2YA 3IHQB 4P4OA 3MGVA 2OEHA 3PNCA 2F8LA 1SGGA 4O3OA 2NRVA 4IRDA 4RQ1A 1LKYB 2KV2A 3MDAA 4JWMA 2OYYA 8ICPA 4DL2A 1XNSA 3CNHA 4G9BA 1BPBA 1ZQPA 5KFVA 4RQ7A 1JROA 1SWVA 2C2RA 5KFKA 4KLIA 5KFIA 1L7NA 4B9TA 1B4FA 2WB1C 1S8OA 4M6WA 2UVWA 4RUCA 3NVYA 4XQ8A 3N4MB 5DB7A 2FDRA 4UASA 2JXJA 2NRXA 4YFKA 3OJSA 3SENA 3V7KA 5C5JA 1S97A 2BCVA 1ED1A 4ECZA 2W55A 5DBBA 1ZQOA 2BGWA 2HVIA 1PK1B 4DQRA 1DOQA 2H3QA 1NK0A 3SEIA 3D6JA 3N7PD 4BUGA 3LVWA 2BDPA 2DUYA 2KJ9A 5KFSA 3I1YA 5AM1A 4DOBA 2ZXHA 4OJ5A 2WF9A 1AQ6A 2JEIA 5TISU 3C2KA 1MQ2A 1ZYQA 1HIWA 4GLXA 4WJ3B 4J9QA 3VC8A 5G5GA 4CE6A 3RJEA 1NI3A 5ALKA 5DQIA 3PX0A 2QARB 1SL2A 5J0YA 2ZIWA 4C7YA 9ICRA 2W7PA 2IOHA 2ZTCA 1D8LA 5J2CA 5ALOA 1KW4A 2V4RA 1PUZA 1D9FA 2ISPA 4O3RA 4DFMA 8ICGA 4ECWA 4RQ5A 2H3ZA 2K4PA 3C28A 8ICXA 3MFHA 4I28A 4LJXA 2A19A 2WHEA 2HHUA 4B9MA 1SKRA 2Y9TA 1ZQXA 2CXYA 3WK7A 4EX6A 3B0XA 3NTUA 8ICVA 2E3TA 5KFGA 4ED7A 9ICMA 1J2MA 2AGOA 4G3IA 3NUQA 5CRXA 4KLTA 3Q8RB 2A1AA 3SI8A 1UCVA 5CA7A 4O3PA 1VDVA 1Q3VA 5KFPA 2MA1A 2WAQC 4J9RA 3RF9A 3KBBA 5ALGA 5DQHA 5KFNA 1T8EA 1NJXA 4ELUA 3UPQA 4Z6CA 4EEKA 2F1HA 3EUB2 5D4BA 1NK6A 2ZG6A 3E0FA 2BR0A 3ETRA 2F3NA 1EXNA 2EAPA 4P0PA 5HHIA 4F5NA 5J2FA 5CR0A 1FFUA 3PSPA 3H8MA 3RRHA 4KLDA 3C21A 3M9MB 2OCEA 4EEYA 2DFLA 1RG6A 4O0IA 1T7PA 1SKWA 1KRPA 1KKXA 3C5FA 5L1IA 4F5OA 4PGXA 4YMNA 2EH9A 2PI5A 4RQ2A 3KHRA 1L6NA 5KT6A 3A0HU 2HBLA 2F1IA 4UW9A 5CP2A 5KFLA 1Q46A 1F0MA 3LVVA 2YQEA 2XO7A 4M04A 3UMCA 5KFUA 1OW5A 2J6UA 1ZQWA 2DQNB 2K8AA 2RDIA 4O3MA 4M9LA 4DL5A 3TARA 3ICXA 3BZKA 1SKSA 1X6JA 3Q8PB 4CF4A 9ICSA 2D6FC 4I2AA 4I2GA 7ICSA 4R65A 5ALNA 2D3DA 4RQNA 3RJGA 4F4WA 3AQFA 2LM1A 3QYPA 2HI0A 3UMBA 3GFKB 1NKEA 2PXIA 2ZJ5A 2W7OA 5J2JA 4RQ4A 5ALXA 3EWAA 1Z1BA 2PFQA 5DB9A 3QX7A 1WWUA 2XY5A 2AJQA 1ZQQA 5ALQA 1MN8A 4FFDA 4ECVA 4DSEA 1ZOLA 1J97A 4Y2QA 2OXOA 3RR8A 2DKZA 7ICKA 1NJWA 5ALMA 1JIHA 2IA6A 4YVZA 1S9FA 3SD7A 1XO0A 1QQ6A 2LBOA 3RR7A 1BGXT 3DDHA 1KEJA 1V9PA 5ALTA 2WF7A 5K4LA 1QQ5A 1SB3C 4C7ZA 1NK5A 2BHNA 2W8LA 2OM6A 5CWRA 4YXJA 5DB8A 1RQLA 2DPIA 3HJEA 4YP3A 7ICOA 2VJ4A 4OD0A 2Y0SC 5KAFU 1A6SA 5ALYA 4ED3A 3SAGA 1IG6A 2E5SA 4DQIA 2EZYA 2B21A 4JK1A 1NK4A 4ED6A 5DGAA 3RJKA 1N61A 5ALEA 3THVA 2FLLA 4DSKA 3V72A 5KFAA 5CB1A 2G06A 5J2AA 3SQIA 1S5LU 4KITB 9ICNA 2ASJA 2E1EA 3S6JA 5A0LA 3ISCA 4QZAA 2IBKA 4CCHA 1DRGA 3F2DA 1ZQGA 3PSFA 3BDPA 3RTVA 4P4PA 4FBTA 3BS5A 4QZEA 3GIMA 1N2XA 2QB0A 2W3SA 2ODGA 3ZDCA 3UM9A 3H40A 4X5VA 3F5EA 3AL0B 4RQ0A 5DG8A 1KL9A 1KBUA 1JUDA 3KKAC 5KT7A 3IV6A 1ZD3A 1JXEA 4DO9A 1PK1A 4IQTA 5DBCA 3SMVA 4KN7A 4DLEA 1RQNA 1IIPA 4AYBF 4F8RA 9ICAA 3FC4A 2HDOA 1JN3A 4QWAA 1V97A 3BQTA 1Z4NA 2AHOB 3OGUA 4HAIA 5AKYA 2HHXA 1QSLA 1UT8A 2O6KA 3ZDDA 5EE1A 3PX6A 4F4YA 3V7LA 8ICMA 4NM2A 3E2EA 2K4EA 1H38A 2KFZA 2YMMA 5ALSA 2NV3A 2LMRA 3K1RB 5L1LA 4IR9A
chains in the Genus database with same CATH topology
3A0HU 3KZIU 4IL6U 4PJ0U 5TISU 5KAFU 2DUYA 4UB6U 5GTHU 5KAIU 3A0BU 5E79U 5GTIU 5H2FU 5B5EU 3WU2U 4UB8U 1S5LU 5B66U 2AXTU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H U;  3KZI U;  4IL6 U;  4PJ0 U;  5TIS U;  5KAF U;  2DUY A;  4UB6 U;  5GTH U;  5KAI U;  3A0B U;  5E79 U;  5GTI U;  5H2F U;  5B5E U;  3WU2 U;  4UB8 U;  1S5L U;  5B66 U;  2AXT U; 
#chains in the Genus database with same CATH topology
 3PW5 A;  3K4G A;  3SV3 A;  3NRZ A;  3TAQ A;  1Z00 A;  4FE3 A;  3WK8 A;  2RLT A;  2W9M A;  3T3F A;  1RYU A;  3M6Z A;  3QEA Z;  2HMX A;  1QQ7 A;  4RQ8 A;  2NRZ A;  3ZI4 A;  4EYH B;  4CDG A;  2B0C A;  4NL9 A;  5C0Y A;  1BPX A;  4NV0 A;  4F93 B;  2KTQ A;  2ZXI A;  4JV0 A;  2BQ3 A;  4C4S A;  2KIV A;  3R9K A;  5ALJ A;  4ED8 A;  1PVP A;  2KEY A;  1ZQD A;  5ALV A;  4QNL A;  4ED1 A;  1ZQV A;  4NLZ A;  4PL2 A;  1ZQS A;  2WTF A;  3UXN A;  3BQ0 A;  1CEZ A;  1N63 A;  1KSP A;  5KG7 A;  3PW7 A;  2W04 A;  2JEG A;  1QH9 A;  4PHA A;  1IV8 A;  1SV0 C;  3ZDB A;  1MA7 A;  4EEL A;  1O08 A;  5B66 U;  4EZ6 A;  2FLN A;  4RQM A;  4F71 A;  2RRD A;  3E58 A;  5HMM A;  3TQ1 A;  4YG2 A;  3LYS A;  3I28 A;  5KFY A;  1L3V A;  2DWQ A;  3M8S A;  5DDM A;  4QIW F;  4UB6 U;  5AKG A;  5KG2 A;  3IRU A;  3WKB A;  4YD2 A;  4BXO A;  3PX4 A;  9ICW A;  4HYK A;  3ISD A;  4YQW A;  5CHG A;  4ELV A;  4K4G A;  4KN4 A;  4C4R A;  8ICS A;  2FE9 A;  3QXG A;  2KZZ A;  1NKC A;  1U47 A;  1TE2 A;  4RQ6 A;  2F8K A;  5KFW A;  3PW0 A;  4J9O A;  1U48 A;  3CW2 C;  3KD3 A;  2G08 A;  2JH1 A;  1COK A;  2LM4 A;  2PKE A;  3JPQ A;  1Z3E B;  5G5H A;  2JH7 A;  5J0R A;  3JPT A;  4P2H A;  4Y2U A;  5DLF A;  2FMQ A;  3PST A;  4PHD A;  2EAO A;  4I2B A;  3GV5 B;  3TFS A;  8ICH A;  5J2E A;  3FM9 A;  2ZIV A;  9ICO A;  1T3Q A;  2ZIV B;  3H0R B;  3D2N A;  4OJL A;  3BZC A;  3JPR A;  3TI0 A;  2Y0S F;  2R8G A;  4NWI A;  4F91 B;  2YX8 A;  1DGJ A;  5FP0 A;  5AM2 A;  2EZX A;  5B5E U;  2Y1J A;  5KTQ A;  3SYZ A;  5T14 A;  4B9N A;  4RT2 A;  3C2L A;  1MC8 A;  3GIK A;  4ECR A;  2W9B B;  1ZQE A;  2A3V A;  5DB6 A;  4EEN A;  1KLN A;  4M47 A;  3AU6 A;  1BNP A;  3PV8 A;  5J0X A;  1ARO P;  5AIC A;  5EE9 A;  4UBB A;  1JMS A;  1A0P A;  5HR7 A;  4C8L A;  4DOC A;  2WB1 F;  3B9J A;  1DK2 A;  2HCF A;  7ICP A;  2AXT U;  4M9G A;  2W9C A;  4BXO B;  5IIM A;  4UAV A;  2KNJ A;  3QUQ A;  1KQQ A;  9ICG A;  1UA1 A;  4ED2 A;  5KFM A;  2BCU A;  2PMZ F;  1UA0 A;  1BPZ A;  3KFU F;  4P0Q B;  3K75 D;  4ED0 A;  2ES6 A;  1P7D A;  5CEH A;  4MF8 A;  2ZUC A;  1Z1V A;  1ZQZ A;  5AKK A;  1FO4 A;  4C4T A;  4EX7 A;  4DFD A;  3OHA A;  2KE7 A;  3QU2 A;  1ZQT A;  5KFO A;  2GWS A;  3F5A A;  1TV9 A;  3H4D A;  5EWF A;  2QB0 B;  1LB2 B;  4J9L A;  1S0O A;  1D9D A;  4PL1 A;  8ICF A;  3RB0 A;  1RM6 C;  5J2D A;  4KMU A;  3WKD A;  2I6X A;  3Q8L A;  5KG1 A;  3KHL A;  5BOM A;  2W9B A;  2YY6 A;  4JV1 A;  2ZIX A;  4Q45 A;  1F44 A;  5DG7 A;  9ICX A;  5EE0 A;  3H7I A;  3PW2 A;  2K4H A;  3GIL A;  1XC9 A;  2JGA A;  4IRK A;  2OHF A;  2FMP A;  4B6J A;  4IC9 A;  1KN5 A;  3RFA A;  4LZG A;  1XSL A;  2DF4 B;  1VLB A;  2G07 A;  2IMW P;  4CRX A;  2KMD A;  4KTQ A;  2LYA A;  2KN7 A;  4Y2X A;  4RUA A;  3M9O B;  4UB8 U;  4XRH A;  2FPL A;  1MSW D;  4Y2P A;  2NO5 A;  1C7Y A;  2MUT B;  5J0P A;  1L5U A;  1Z00 B;  2DPJ A;  2W3R A;  1KFT A;  4NXZ A;  2IHM A;  2QB1 A;  4J9M A;  3NAS A;  2WAQ F;  2I9G A;  5KG6 A;  5J29 A;  3V6K A;  1HUZ A;  3RH6 A;  2YTU A;  3C29 A;  4IL6 U;  2HSZ A;  1KTQ A;  2JZB A;  1ZQB A;  8ICJ A;  4EZ9 A;  5AI5 A;  3M9N B;  4TUP A;  1RDF A;  1CUK A;  3CRX A;  3NVV A;  3MGI A;  3TAD C;  3K1Z A;  9ICH A;  3ETL A;  3OJU A;  1OUQ A;  5AK4 A;  4TUR A;  4M9H A;  4DS5 A;  4RNM A;  2K8B B;  3UQ0 A;  2R18 A;  3SAF A;  4UB2 A;  1UHU A;  2JZB B;  2P6U A;  7ICF A;  2E8O A;  1GO3 F;  3OTQ A;  4DCC A;  1NK8 A;  3MFI A;  3F2C A;  4O3N A;  2QLT A;  5KL8 B;  3QUT A;  2FI1 A;  1ZQJ A;  2D8C A;  5AKE A;  3SZ2 A;  5F9N A;  4QZB A;  2ASD A;  8ICI A;  5AKI A;  3MDC A;  1ZQL A;  4UB3 A;  3MGH A;  4C0Z A;  3OHB A;  5KFB A;  2MU2 A;  3EPG A;  5IIJ A;  1M6Y A;  3ORY A;  2VAN A;  1BPE A;  4E0D A;  5J0O A;  1V38 A;  3IG5 A;  4KLJ A;  4P0P B;  2Y1I A;  2YML A;  3BS5 B;  3L4P A;  4MHV A;  2IHN A;  2NRT A;  4QZG A;  1RYR A;  7ICJ A;  2KSO A;  5DBA A;  4UAT A;  1S0N A;  2BKE A;  2YN4 A;  2E8M A;  2J6S A;  4QZ8 A;  4RPZ A;  4UB5 A;  1L7M A;  1SV0 A;  3JPO A;  2FPM A;  3CYM A;  1QCK A;  5BOL A;  3NS1 A;  4DQS A;  1TAU A;  2BZF A;  2JEJ A;  1L3U A;  1UQV A;  1PVQ A;  3QU4 A;  2A1J B;  4XUS A;  4OO1 J;  3TAC B;  3EPI A;  9ICF A;  7ICI A;  3LWL A;  3BS7 A;  1QLN A;  4BGD A;  3BQ2 A;  4OJ6 A;  1RZT A;  3LDA A;  5J2I A;  2HBJ A;  2GLE A;  1B43 A;  2GO7 A;  2IOF A;  4MEY A;  2WF5 A;  1WUD A;  5E79 U;  4YN4 A;  1TVA A;  2N1R A;  2P6R A;  3RH5 A;  1L7P A;  3PVX A;  5ALW A;  1TAM A;  5ALF A;  2KP7 A;  2KZM A;  3PY8 A;  3CP8 A;  3N28 A;  5L9X A;  2W43 A;  4IQW A;  4JV2 A;  5KT4 A;  3JPN A;  1ZET A;  2FLP A;  4Z6E A;  7ICG A;  9ICL A;  2NYV A;  2EZZ A;  1NJY A;  5HR6 A;  4IQU A;  3TAP A;  3HT3 A;  4DQP A;  5L1J A;  3IN5 A;  1RXV A;  1TAQ A;  3M1Y A;  1ZJN A;  1ZJM A;  1S76 D;  3QNM A;  1N56 A;  1Z4O A;  5L1M A;  5ALP A;  4RQ3 A;  3M6K A;  2XY7 A;  1XSN A;  4RPX A;  1CI4 A;  3SR6 A;  1JRP A;  3FAH A;  1TK0 A;  4F72 A;  1LV5 A;  1JX4 A;  1VJ5 A;  4F5P A;  4ECS A;  2FJ6 A;  4QWB A;  5JRT A;  2MUT A;  5IIK A;  4C8K A;  3GII A;  1N5X A;  1BPD A;  2BQR A;  1T94 A;  4YR0 A;  3TAD A;  4P4M A;  3LK9 A;  2DL0 A;  4Y2R A;  1ECW A;  2C28 A;  1NZP A;  2HOQ A;  4Y2J A;  9ICQ A;  5KFT A;  3GDX A;  1TFR A;  2KKP A;  4Z6D A;  5IIL A;  2GOL A;  1JAL A;  2ZIU B;  3PSI A;  1QSS A;  1UPH A;  2ZJA A;  5TZV A;  5ALI A;  2VJ5 A;  5F3X B;  2F44 A;  4DSI A;  4NL9 C;  5KAI U;  4YD1 A;  4DL7 A;  5J2K A;  5J0U A;  5KFQ A;  4Q8F A;  2XCP A;  3WKE A;  4DSL A;  4O5C A;  4GC7 A;  1L7O A;  2LYB A;  3AMZ A;  3L5K A;  1COO A;  1L8L A;  2DGZ A;  4J03 A;  2YMQ A;  3RH4 A;  3RJF A;  1NK7 A;  4NLC A;  5AM5 A;  3QEB Z;  1WCN A;  2A1J A;  5AM3 A;  2YB1 A;  3UXP A;  7ICT A;  4PHE A;  3MR5 A;  2JV3 A;  4O3S A;  3RJJ A;  5JUM A;  1ZQK A;  9ICE A;  2HBM A;  2OH2 A;  1HEK A;  3UQ2 A;  4F4Z A;  1NOM A;  4NLB A;  4U7C A;  4KLO A;  3C1Y A;  1XWL A;  1X9M A;  4KLE A;  2XI9 A;  3KHG A;  1BNO A;  2V4Q A;  2BCQ A;  3QE9 Y;  2QAR A;  4UAZ A;  3HWT A;  4O5K A;  2YB4 A;  2WF6 A;  3HIL A;  3QU5 A;  5KL1 B;  1N5W A;  1WG8 A;  3PR4 A;  4ZOH C;  3OPX A;  1L3S A;  1JI7 A;  5AIB A;  2CPR A;  4QZD A;  5AK3 A;  3MR3 A;  5KFC A;  2XVT A;  4GIB A;  8ICA A;  1X66 A;  4UB1 A;  7ICM A;  3M8R A;  1C20 A;  3HRD D;  3PML A;  1DXS A;  3H4B A;  1PVR A;  3TFR A;  3HKZ C;  5HHH A;  3RAX A;  4OCZ A;  4P0Q A;  3KKA A;  1ZQU A;  2FMS A;  4C8O A;  4M9N A;  2NO4 A;  1Z19 A;  5GTH U;  5AI9 A;  3KTQ A;  3UMG A;  4US8 A;  4IS7 A;  4RNN A;  4B9S A;  3IG8 A;  3NVZ A;  4PGY A;  2F1J A;  2AU0 A;  1LVH A;  2W9C B;  3ZDE A;  5KT2 A;  3Q8K A;  3C23 A;  1SWW A;  4DL4 A;  2AQ0 A;  4KLS A;  2LKY A;  5DKW A;  4LVS A;  2KOB A;  2JRZ A;  3RBE A;  2DKX A;  3AN1 A;  2F76 X;  5JTI A;  1RXW A;  1NZB A;  1D8B A;  4QZF A;  4Y2S A;  1TKD A;  3WK4 A;  3QZ8 A;  4FZL A;  1N48 A;  2LI6 A;  3RRG A;  4I2H A;  3FDS A;  2KVS A;  1IM4 A;  2KZ3 A;  2JR5 A;  4K4H A;  1RYS A;  4QIW C;  1S0M A;  4B9U A;  4DFK A;  4FS2 A;  2BQU A;  2VKQ A;  3RB3 A;  5AKJ A;  3F2B A;  2BCS A;  2HOF A;  2PFN A;  4DSF A;  4TQS A;  5ALH A;  2HHS A;  3EW9 A;  4J9N A;  5AIA A;  4NM1 A;  2MAX A;  3B0Y A;  3AQE A;  3NRW A;  4EYI B;  2H3V A;  2HBK A;  2GH1 A;  2HHV A;  2LHT A;  4J9S A;  9ICI A;  4BX9 C;  4M2Y A;  1B0X A;  4KLM A;  3ZD8 A;  3ONN A;  4F3O A;  1X9S A;  5KG5 A;  3AM9 A;  4TUS A;  5KFE A;  1NKB A;  1RPL A;  5J0S A;  1ZQM A;  2ZIW B;  4MFF A;  1WYG A;  3WK5 A;  5AK6 A;  2AGP A;  2LYH A;  4BWJ A;  4PH5 A;  4O3Q A;  2XID A;  1YT3 A;  2I1Q A;  3DEE A;  1Q3U A;  1T4G A;  5KG3 A;  3BJY A;  3PO4 A;  4CF5 A;  4Q44 A;  2AGQ A;  4I2D A;  3TAN A;  2BPF A;  2AH5 A;  9ICB A;  3MR6 A;  4Y2T A;  2C22 A;  2R8J A;  7ICV A;  2M9N A;  4DOA A;  3N7R C;  2K89 A;  4C80 A;  4KLH A;  8ICU A;  3WKC A;  1HJP A;  5AK5 A;  1S0V A;  2XIC A;  2EQY A;  1ZQY A;  4PZO A;  4UB4 A;  4TUQ A;  5ALU A;  2K60 A;  3MBY A;  1X9W A;  4ECT A;  1SL0 A;  5AI0 A;  4DL6 A;  2E8P A;  3J81 j;  3VCB A;  5ALR A;  2ZIU A;  5EWE A;  4FO6 A;  3D2S A;  4JMU A;  3UXO A;  4DQQ A;  3V6J A;  3GV7 B;  1ZQC A;  1N60 A;  1A76 A;  2ZTE A;  1U9L A;  3ALR A;  3L3F X;  9ICP A;  1ZRM A;  1SV4 A;  8ICQ A;  4FBU A;  2XGQ A;  5AI8 A;  3NGD A;  4I29 A;  3Q8S B;  1WWV A;  4BDP A;  4KLF A;  2G5I B;  1TK8 A;  8ICR A;  2C2D A;  2RQ5 A;  2KG5 A;  1ZD4 A;  5KFD A;  2IOF K;  2PMZ C;  2E8N A;  4RU9 A;  1MQ3 A;  4KLL A;  1PK3 A;  4DS4 A;  4GXJ A;  8ICY A;  5KFX A;  9ICK A;  2ASL A;  1L3T A;  3AEV A;  5D49 A;  4YR2 A;  8ICB A;  4R66 A;  2G0A A;  5IIO A;  4QWC A;  4A8E A;  3HPO A;  2W8K A;  2RHF A;  4QWE A;  3OSN A;  2G09 A;  3RB4 A;  4MF2 A;  4LZD A;  3T5J A;  4YMO A;  3AU2 A;  2VIX A;  2H5X A;  3DV9 A;  1SZH A;  5L1K A;  7ICL A;  1ZRN A;  3GIJ A;  4OJP A;  4DLG A;  3ISB A;  2BCR A;  2EAN A;  2K4I A;  4PHP A;  3WK6 A;  2Q0Z X;  1ZQI A;  5BPC A;  4KMO B;  3RB6 A;  1U49 A;  3WK9 A;  4Y2V A;  1JXL A;  2HVH A;  2B6G A;  5J0Q A;  5DQG A;  1URJ A;  4NLK A;  3SAH A;  2V9W A;  1SZP A;  4GXK A;  4F4K A;  3T5H A;  3KZI U;  4IRC A;  3IP4 B;  2KD1 A;  7ICH A;  1J2N A;  2W11 A;  2ALZ A;  3V6H A;  1IXR A;  2VA3 A;  4JUZ A;  2XC9 A;  4YMM A;  2W03 A;  2K8C B;  2QKQ A;  1F5S A;  2Z7J A;  1NJZ A;  3C1Z A;  1SXD A;  5J8Y A;  1FFV A;  3HKZ F;  4Z6F A;  2KJ8 A;  2HOI A;  4CF3 A;  1K1S A;  4EBE A;  5AKL A;  4KX5 A;  4AYB C;  3T5L A;  4DF4 A;  2ZTD A;  2MRL A;  3H8W A;  5HP4 A;  1SIJ A;  4IQV A;  4RPY A;  4UAW A;  1ZQF A;  5J2G A;  4UAU A;  1KFD A;  1X6I A;  4QJF B;  3GV8 B;  5EWG A;  4ECQ A;  2BPG A;  5ALZ A;  3HX0 A;  4MEX A;  3MC1 A;  2JMG A;  4Q8E A;  3T79 A;  4RT3 A;  2HHQ A;  4BJQ A;  4FS1 A;  5J0W A;  2WFA A;  4Q43 A;  2VA2 A;  4O5E A;  4GC6 A;  5KT5 A;  5AKX A;  5KFF A;  4DFJ A;  2CN1 A;  1ZQN A;  3PW4 A;  3QZ7 A;  3EZ5 A;  3C5G A;  4KLG A;  4UAR A;  1Y88 A;  4DEZ A;  5HNK A;  4DWI A;  4F5Q A;  3KZX A;  1HUO A;  1NK9 A;  2E1F A;  3GU3 A;  4US9 A;  3N7S C;  3MR2 A;  3HW8 A;  3PO5 A;  2EDU A;  4QZC A;  2OWO A;  3RJH A;  3H0L B;  4QWD A;  7ICE A;  2YMP A;  4M9J A;  3FYH A;  3G6X A;  4TQR A;  7ICN A;  4CGZ A;  5CJ7 A;  4DFP A;  3V7J A;  3N97 B;  5HML A;  5EOZ A;  2JHD A;  4YXM A;  4KX3 A;  2Q4T A;  4NLN A;  2JEF A;  5J0T A;  4B9V A;  3RBD A;  5III A;  3Q8Q B;  4O9M A;  1S10 A;  9ICC A;  3H8S A;  8ICZ A;  3Q8M A;  9ICU A;  4ELT A;  4R8U B;  2HHW A;  4C8M A;  3QUC A;  4ECX A;  1SXE A;  1K5O A;  1YZ6 A;  5KFH A;  4QZH A;  5AI4 A;  1NNL A;  3AUO A;  3MAB A;  1PZN A;  3KOO A;  2Y9U A;  2ZUB A;  5JU5 A;  4R63 A;  3OSP A;  2ZUD A;  5H2F U;  4R64 A;  2EAM A;  2KHV A;  9ICV A;  2DBY A;  1X42 A;  1ZD2 P;  1DGS A;  3LWM A;  3WU2 U;  5DG9 A;  4YCX A;  4QZ9 A;  4JWN A;  4EBD A;  4I27 A;  4DF8 A;  4F92 B;  1ZD5 A;  2F77 X;  4UQG A;  3C2M A;  5KNI A;  2PFO A;  4MFA A;  3H0M B;  2LPE A;  1SL1 A;  1TK5 A;  3BQ1 A;  3SV4 A;  1LKY A;  5KT3 A;  1ZQR A;  2H3F A;  3M7D A;  4QW9 A;  4YR3 A;  1ZQA A;  3BQ7 A;  4I2F A;  3NVW A;  4PGQ A;  2UVU A;  5KG4 A;  7ICU A;  2P66 A;  2KKV A;  3T5K A;  3QU9 A;  4QW8 A;  2C2E A;  3RAQ A;  4F4X A;  7ICQ A;  4BWM A;  2ISO A;  3GQC A;  3F53 A;  2F2A B;  5DGB A;  2KK0 A;  4R8U A;  5KFZ A;  2RP5 A;  1L8O A;  1KFS A;  2R8I A;  3ZDA A;  4IR1 A;  3JPP A;  5KFR A;  4C8N A;  3TKA A;  5EE3 A;  2M0N A;  1QTM A;  5J2B A;  2AQ4 A;  1YZ7 A;  3A0B U;  3KHH A;  2CRX A;  1A77 A;  1QSY A;  2PI4 A;  2R8K A;  5AM0 A;  4JB3 A;  4I2E A;  1XO1 A;  2L5Y A;  4ZH4 A;  3IDW A;  1D8Y A;  4K4I A;  1K1Q A;  4PZN A;  4XA5 A;  3RJI A;  8ICL A;  3GZF A;  2KFN A;  1X40 A;  2G5H B;  5AI6 A;  4OJO A;  5J2H A;  4EBC A;  4F2R A;  4DSJ A;  4PPX A;  9ICJ A;  1DK3 A;  1UT5 A;  4KLU A;  2XY6 A;  2BPC A;  3H8J A;  8ICK A;  4GXI A;  2PFP A;  3PMN A;  5KG0 A;  1V85 A;  2ZJ8 A;  5AHX A;  4USA A;  5GTI U;  1BPY A;  4QZI A;  2KIC A;  8ICN A;  4NY8 A;  4F5R A;  1KDH A;  4NJ8 A;  1XU4 A;  9ICT A;  4FZN A;  1ZQH A;  2KIW A;  3G6Y A;  1Q8K A;  5AKH A;  1S77 D;  5DLG A;  2ATL A;  4I2J A;  2FPK A;  2I5H A;  1ZQ1 C;  5KFJ A;  4UBC A;  4NLG A;  5J8Y C;  3D2Q A;  4RZR A;  2W54 A;  3QU7 A;  4RNO A;  4I2I A;  1O03 A;  4M6W B;  2ESE A;  1U4B A;  5F9L A;  5D46 A;  2UVR A;  4J9K A;  4UAY A;  1XSP A;  4I2C A;  2P35 A;  1FEZ A;  2UVV A;  1X2I A;  1FIQ A;  3EYZ A;  5AKZ A;  4ACO A;  2MSN A;  4ICA A;  3WKA A;  2KVC A;  1B22 A;  3PR5 B;  3QUB A;  2BDU A;  2KJ5 A;  8ICO A;  1T3N A;  3I76 A;  5DDY A;  4GFJ A;  2XGP A;  4DL3 A;  2ZIX B;  4PJ0 U;  4U6P A;  2HW3 A;  4MFC A;  5AM4 A;  2RDJ A;  2KSO B;  2J6T A;  1X9X A;  2KHQ A;  3JPS A;  7ICR A;  2W9A A;  2HHT A;  8ICC A;  1BVS A;  1N62 A;  5ALD A;  8ICE A;  2WF8 A;  1U45 A;  4AP9 A;  1WCL A;  3ED5 A;  1CRX A;  1XS9 D;  2XCA A;  4ECY A;  3ZD9 A;  4J9P A;  8ICT A;  4B9L A;  2H3I A;  3HP6 A;  3G6V A;  2NRW A;  8ICW A;  4CNQ A;  4M0A A;  4ECU A;  5IIN A;  2R8H A;  1OXJ A;  4F50 A;  3PZP A;  4F2S A;  3IM1 A;  5ALL A;  1ZXI A;  4KLQ A;  2VA8 A;  3U26 A;  3O0F A;  4FZM A;  4Y2Y A;  3IHQ B;  4P4O A;  3MGV A;  2OEH A;  3PNC A;  2F8L A;  1SGG A;  4O3O A;  2NRV A;  4IRD A;  4RQ1 A;  1LKY B;  2KV2 A;  3MDA A;  4JWM A;  2OYY A;  8ICP A;  4DL2 A;  1XNS A;  3CNH A;  4G9B A;  1BPB A;  1ZQP A;  5KFV A;  4RQ7 A;  1JRO A;  1SWV A;  2C2R A;  5KFK A;  4KLI A;  5KFI A;  1L7N A;  4B9T A;  1B4F A;  2WB1 C;  1S8O A;  4M6W A;  2UVW A;  4RUC A;  3NVY A;  4XQ8 A;  3N4M B;  5DB7 A;  2FDR A;  4UAS A;  2JXJ A;  2NRX A;  4YFK A;  3OJS A;  3SEN A;  3V7K A;  5C5J A;  1S97 A;  2BCV A;  1ED1 A;  4ECZ A;  2W55 A;  5DBB A;  1ZQO A;  2BGW A;  2HVI A;  1PK1 B;  4DQR A;  1DOQ A;  2H3Q A;  1NK0 A;  3SEI A;  3D6J A;  3N7P D;  4BUG A;  3LVW A;  2BDP A;  2DUY A;  2KJ9 A;  5KFS A;  3I1Y A;  5AM1 A;  4DOB A;  2ZXH A;  4OJ5 A;  2WF9 A;  1AQ6 A;  2JEI A;  5TIS U;  3C2K A;  1MQ2 A;  1ZYQ A;  1HIW A;  4GLX A;  4WJ3 B;  4J9Q A;  3VC8 A;  5G5G A;  4CE6 A;  3RJE A;  1NI3 A;  5ALK A;  5DQI A;  3PX0 A;  2QAR B;  1SL2 A;  5J0Y A;  2ZIW A;  4C7Y A;  9ICR A;  2W7P A;  2IOH A;  2ZTC A;  1D8L A;  5J2C A;  5ALO A;  1KW4 A;  2V4R A;  1PUZ A;  1D9F A;  2ISP A;  4O3R A;  4DFM A;  8ICG A;  4ECW A;  4RQ5 A;  2H3Z A;  2K4P A;  3C28 A;  8ICX A;  3MFH A;  4I28 A;  4LJX A;  2A19 A;  2WHE A;  2HHU A;  4B9M A;  1SKR A;  2Y9T A;  1ZQX A;  2CXY A;  3WK7 A;  4EX6 A;  3B0X A;  3NTU A;  8ICV A;  2E3T A;  5KFG A;  4ED7 A;  9ICM A;  1J2M A;  2AGO A;  4G3I A;  3NUQ A;  5CRX A;  4KLT A;  3Q8R B;  2A1A A;  3SI8 A;  1UCV A;  5CA7 A;  4O3P A;  1VDV A;  1Q3V A;  5KFP A;  2MA1 A;  2WAQ C;  4J9R A;  3RF9 A;  3KBB A;  5ALG A;  5DQH A;  5KFN A;  1T8E A;  1NJX A;  4ELU A;  3UPQ A;  4Z6C A;  4EEK A;  2F1H A;  3EUB 2;  5D4B A;  1NK6 A;  2ZG6 A;  3E0F A;  2BR0 A;  3ETR A;  2F3N A;  1EXN A;  2EAP A;  4P0P A;  5HHI A;  4F5N A;  5J2F A;  5CR0 A;  1FFU A;  3PSP A;  3H8M A;  3RRH A;  4KLD A;  3C21 A;  3M9M B;  2OCE A;  4EEY A;  2DFL A;  1RG6 A;  4O0I A;  1T7P A;  1SKW A;  1KRP A;  1KKX A;  3C5F A;  5L1I A;  4F5O A;  4PGX A;  4YMN A;  2EH9 A;  2PI5 A;  4RQ2 A;  3KHR A;  1L6N A;  5KT6 A;  3A0H U;  2HBL A;  2F1I A;  4UW9 A;  5CP2 A;  5KFL A;  1Q46 A;  1F0M A;  3LVV A;  2YQE A;  2XO7 A;  4M04 A;  3UMC A;  5KFU A;  1OW5 A;  2J6U A;  1ZQW A;  2DQN B;  2K8A A;  2RDI A;  4O3M A;  4M9L A;  4DL5 A;  3TAR A;  3ICX A;  3BZK A;  1SKS A;  1X6J A;  3Q8P B;  4CF4 A;  9ICS A;  2D6F C;  4I2A A;  4I2G A;  7ICS A;  4R65 A;  5ALN A;  2D3D A;  4RQN A;  3RJG A;  4F4W A;  3AQF A;  2LM1 A;  3QYP A;  2HI0 A;  3UMB A;  3GFK B;  1NKE A;  2PXI A;  2ZJ5 A;  2W7O A;  5J2J A;  4RQ4 A;  5ALX A;  3EWA A;  1Z1B A;  2PFQ A;  5DB9 A;  3QX7 A;  1WWU A;  2XY5 A;  2AJQ A;  1ZQQ A;  5ALQ A;  1MN8 A;  4FFD A;  4ECV A;  4DSE A;  1ZOL A;  1J97 A;  4Y2Q A;  2OXO A;  3RR8 A;  2DKZ A;  7ICK A;  1NJW A;  5ALM A;  1JIH A;  2IA6 A;  4YVZ A;  1S9F A;  3SD7 A;  1XO0 A;  1QQ6 A;  2LBO A;  3RR7 A;  1BGX T;  3DDH A;  1KEJ A;  1V9P A;  5ALT A;  2WF7 A;  5K4L A;  1QQ5 A;  1SB3 C;  4C7Z A;  1NK5 A;  2BHN A;  2W8L A;  2OM6 A;  5CWR A;  4YXJ A;  5DB8 A;  1RQL A;  2DPI A;  3HJE A;  4YP3 A;  7ICO A;  2VJ4 A;  4OD0 A;  2Y0S C;  5KAF U;  1A6S A;  5ALY A;  4ED3 A;  3SAG A;  1IG6 A;  2E5S A;  4DQI A;  2EZY A;  2B21 A;  4JK1 A;  1NK4 A;  4ED6 A;  5DGA A;  3RJK A;  1N61 A;  5ALE A;  3THV A;  2FLL A;  4DSK A;  3V72 A;  5KFA A;  5CB1 A;  2G06 A;  5J2A A;  3SQI A;  1S5L U;  4KIT B;  9ICN A;  2ASJ A;  2E1E A;  3S6J A;  5A0L A;  3ISC A;  4QZA A;  2IBK A;  4CCH A;  1DRG A;  3F2D A;  1ZQG A;  3PSF A;  3BDP A;  3RTV A;  4P4P A;  4FBT A;  3BS5 A;  4QZE A;  3GIM A;  1N2X A;  2QB0 A;  2W3S A;  2ODG A;  3ZDC A;  3UM9 A;  3H40 A;  4X5V A;  3F5E A;  3AL0 B;  4RQ0 A;  5DG8 A;  1KL9 A;  1KBU A;  1JUD A;  3KKA C;  5KT7 A;  3IV6 A;  1ZD3 A;  1JXE A;  4DO9 A;  1PK1 A;  4IQT A;  5DBC A;  3SMV A;  4KN7 A;  4DLE A;  1RQN A;  1IIP A;  4AYB F;  4F8R A;  9ICA A;  3FC4 A;  2HDO A;  1JN3 A;  4QWA A;  1V97 A;  3BQT A;  1Z4N A;  2AHO B;  3OGU A;  4HAI A;  5AKY A;  2HHX A;  1QSL A;  1UT8 A;  2O6K A;  3ZDD A;  5EE1 A;  3PX6 A;  4F4Y A;  3V7L A;  8ICM A;  4NM2 A;  3E2E A;  2K4E A;  1H38 A;  2KFZ A;  2YMM A;  5ALS A;  2NV3 A;  2LMR A;  3K1R B;  5L1L A;  4IR9 A; 
#chains in the Genus database with same CATH homology
 3A0H U;  3KZI U;  4IL6 U;  4PJ0 U;  5TIS U;  5KAF U;  2DUY A;  4UB6 U;  5GTH U;  5KAI U;  3A0B U;  5E79 U;  5GTI U;  5H2F U;  5B5E U;  3WU2 U;  4UB8 U;  1S5L U;  5B66 U;  2AXT U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...