1Z00A

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00A01
2BQ3A 4P2HA 3GFKB 4GXIA 3OHBA 2ASLA 1RXVA 2VA2A 4J9MA 4KLUA 4ECQA 4P4MA 4YXMA 5DQIA 4YN4A 4LVSA 4I27A 4F92B 2DFLA 1HUZA 4EBDA 2C22A 5DB8A 1RPLA 1NK7A 3RH5A 4GXJA 3RJJA 3H8SA 1T7PA 4MFAA 1TKDA 4EZ6A 1S9FA 4QW8A 4Q44A 5J2HA 5BOMA 2P6RA 3RJIA 3THVA 4RPYA 3BJYA 4DOBA 4RQ0A 1JX4A 2BR0A 4I2HA 2BPFA 4F2SA 3HWTA 5D46A 1N56A 2I9GA 8ICCA 1TAQA 9ICLA 4M9JA 9ICKA 1UT8A 1S0NA 1WCLA 3V6KA 1U4BA 1S0VA 9ICQA 9ICVA 5J2CA 3RRGA 1SL0A 1NK9A 1CEZA 5DBCA 2VA8A 4ECXA 4IQWA 2JZBA 5DDMA 4RZRA 1SKRA 2A1JA 3ZD8A 8ICNA 1ZQKA 2XY7A 2HHWA 3B0XA 3OJUA 1U47A 4O3NA 5KFUA 3PX4A 2NRXA 3RJEA 4O3QA 3RR7A 1QLNA 7ICPA 2JEGA 2W9MA 4O3PA 5IIJA 4K4IA 2AJQA 1KSPA 2HHQA 3KTQA 4DL4A 7ICSA 1NJZA 4DF4A 3Q8SB 2PI4A 4B9LA 2AU0A 7ICHA 1KEJA 5J0TA 5J2GA 5KFZA 1S0OA 1AROP 5KT2A 2ATLA 4KN4A 3RB4A 2KTQA 4XRHA 4M0AA 2HHXA 1L3UA 1K1QA 4I2JA 1SZPA 5J0WA 3BQ1A 4TUPA 2AQ4A 5KT5A 4RQ1A 8ICBA 1D9DA 4DSEA 4Q8EA 4IRCA 4J9LA 3RJGA 5KFXA 3OJSA 5KFLA 4TURA 4ED6A 4X5VA 1TK8A 5DG8A 4KLEA 5J0UA 8ICMA 4KLLA 1BVSA 4RQ8A 4DQSA 4F91B 5EWEA 4YCXA 5J2EA 5DB7A 4GLXA 4C8KA 4YR3A 5HHIA 4GC7A 5F9LA 4I2FA 3MGIA 4F4WA 4B9NA 1ZETA 2JEFA 4RT2A 5KFIA 4R8UB 1MQ2A 3V7LA 1NKEA 7ICRA 5DB6A 4B9MA 2AGQA 3UQ0A 3Q8LA 3PV8A 7ICMA 3JPRA 5L1KA 4FO6A 2DPJA 2FMPA 1Z00A 5TZVA 2BCRA 2ZJ5A 4I2EA 4TQSA 5IIOA 5BOLA 4F4XA 4YFKA 9ICMA 1NK6A 2XGQA 5IINA 8ICFA 4B9VA 2BCSA 4DLGA 4ECZA 4ED1A 1ZQLA 1U9LA 4R65A 3OHAA 2J6UA 4Z6CA 3PMNA 5J0YA 3SV3A 1NJWA 4F5RA 4CCHA 4KN7A 4C8NA 2HW3A 1ZQGA 8ICKA 4ED3A 4I29A 3KHGA 1B43A 5DB9A 4QZHA 1T8EA 5J0XA 4M6WA 1L3TA 4Q45A 4F5QA 4KLMA 2VANA 2ZTDA 4RQ5A 1KFDA 2AQ0A 4QZAA 5KFBA 1U49A 5KG5A 3NGDA 2KFNA 2R8IA 5KFKA 1T3NA 4R66A 4EBEA 2R8HA 1L3SA 2HHTA 4O0IA 7ICUA 5KFOA 2ZTCA 4M9LA 1Z3EB 3EPIA 2C28A 1NK0A 3HT3A 3MR2A 1XSNA 5KFEA 5J29A 4I2CA 4GXKA 4KLHA 2ALZA 3ZDAA 3MR3A 3ZDCA 9ICTA 4RT3A 4J9QA 2HVHA 8ICAA 4RQ3A 3GV8B 4DL7A 2BPGA 2R8GA 4DL3A 3LWMA 3C2LA 4E0DA 4KLTA 3V6JA 5KFVA 3MABA 8ICJA 1Y88A 3HX0A 3PO4A 2JEJA 3RJFA 5KG1A 2RDIA 1KRPA 1UT5A 2AGOA 4KLGA 1S0MA 5DG7A 4EZ9A 9ICIA 4I2GA 4J9RA 4QZGA 1EXNA 3OSNA 5IILA 3NTUA 4KTQA 3G6VA 3BQ0A 1D9FA 4PGYA 1ZJNA 1ZJMA 5L1IA 1RZTA 4F5OA 1DOQA 4F8RA 3MBYA 3PW2A 2ISPA 2Q0ZX 5EWGA 5L9XA 3G6YA 3T5JA 3TQ1A 9ICRA 1U45A 3EZ5A 3N4MB 5CHGA 4UB4A 1RXWA 4F93B 2VA3A 5DGBA 4YD1A 2XCAA 1XC9A 1LB2B 2W9BA 1D8YA 3RBDA 3RJHA 5J2AA 8ICQA 4DWIA 4KLJA 1TK5A 4BXOA 5J0RA 4XUSA 4YMOA 3GIKA 2XY5A 2PFPA 3GIIA 4DSFA 1XSLA 1H38A 2BDPA 2BKEA 4Z6EA 5KG4A 5HMMA 4QWDA 2FMQA 4IRKA 4JWNA 1ZQAA 7ICKA 3C2KA 4RQ2A 5C5JA 4DSKA 1UA0A 2XO7A 4M9NA 4YMNA 2P66A 4QWEA 4EYHB 2W9AA 1KTQA 5KFRA 4UQGA 3C21A 5KFDA 3QEBZ 1NK8A 1COOA 4DFMA 7ICNA 3ETLA 9ICBA 3Q8QB 5IIMA 3GV7B 2C2RA 2V4RA 4I2IA 3BQ2A 2C2DA 1QSSA 1XS9D 8ICEA 7ICEA 2ZUBA 3T5KA 1UA1A 3FYHA 3OGUA 3MFIA 3TAPA 3RBEA 3SZ2A 4MFCA 1NKCA 4M2YA 4DFPA 2ZUCA 3OSPA 1XU4A 4ED2A 1BPXA 2PFOA 1BPBA 3HW8A 4I2BA 4QW9A 2NRZA 4ELVA 3RB0A 3RJKA 8ICPA 3H7IA 4ED8A 4JWMA 1D8LA 5DBAA 1QTMA 4TUSA 4TQRA 1T4GA 3SI8A 4IQTA 4RNMA 4QZEA 2ZJ8A 3E2EA 1ZQVA 4ECUA 4JV0A 3H40A 1ZQPA 7ICFA 4G3IA 4BWMA 1XSPA 1SKSA 4QZIA 4C8OA 1X9SA 5KG7A 7ICGA 9ICAA 1S10A 8ICWA 9ICJA 3GIJA 2F1IA 2W8LA 4ECVA 3T5HA 8ICHA 4DQQA 3AUOA 3C23A 3ZD9A 1SL2A 4P4OA 1KFTA 5JUMA 5J0SA 1N48A 1B22A 5KFJA 2ASDA 1RYSA 5J2JA 1NK4A 3K75D 2MUTB 3UPQA 4EEYA 2FLNA 8ICGA 2P6UA 5KFWA 3TANA 1A76A 4DEZA 4R63A 4FBUA 2AGPA 4J9NA 4Z6DA 4YR2A 1MSWD 4MF8A 2XCPA 4FBTA 7ICOA 4DOCA 3GIMA 3H4DA 4DS4A 1X2IA 5KG2A 4UB5A 3C5GA 3PVXA 4KLFA 4UBCA 4F2RA 2W9CB 4FS2A 9ICPA 1BPEA 3JPSA 9ICUA 2PFNA 4BWJA 4F5PA 4DL2A 2J6TA 2UVWA 2IBKA 1TVAA 5BPCA 2KN7A 4F5NA 4M9HA 2FMSA 7ICQA 4DL5A 2BGWA 3QZ7A 4IR1A 4C8MA 1ZQSA 2V9WA 1NOMA 4ECRA 3SV4A 2Y1IA 5J0QA 1ZQCA 8ICTA 2KZZA 1NKBA 4ECSA 5EOZA 4F4YA 4ZH4A 5KG3A 3SYZA 1BPYA 1ZQJA 4B9TA 1NJXA 3Q8KA 5DG9A 2BHNA 4YP3A 3RTVA 1QSYA 4BDPA 1ZQXA 3ZDEA 4RPZA 3JPPA 4F50A 5IIIA 3AU2A 1ZQWA 1ZQUA 2XY6A 3QEAZ 3ISCA 5CP2A 4QZDA 4YMMA 2JEIA 4NM1A 4GC6A 2FLPA 5KFAA 4DQRA 9ICSA 9ICWA 4R8UA 5KFQA 5DBBA 7ICVA 3Q8RB 3B0YA 3MFHA 5DQGA 2XGPA 3TFSA 4XQ8A 5CA7A 4TUQA 3G6XA 1KLNA 4BGDA 1QSLA 4JV2A 4HYKA 5HNKA 1L3VA 4JV1A 5J0OA 4O9MA 4JUZA 4UAZA 2IA6A 2WTFA 4MFFA 1A77A 1IM4A 2H5XA 3V72A 5KFTA 4NM2A 3GV5B 4QWAA 3UQ2A 3H4BA 1LV5A 1ZQDA 2FPLA 3AU6A 1TAUA 3BQTA 4J9SA 3ZDBA 4O3OA 3KHLA 4QZ8A 3H8WA 5F9NA 3GILA 2NRWA 5KT3A 3M8SA 3ZDDA 3JPTA 5KFHA 8ICIA 8ICOA 4DSJA 2JZBB 2FPMA 1NJYA 2HVIA 7ICTA 9ICOA 1JN3A 2A1JB 4UAWA 2IHNA 5CWRA 3N97B 1ZQQA 4FS1A 1HJPA 5HMLA 3RH6A 1PZNA 4O5KA 4KLQA 3LWLA 3HPOA 3RB6A 3HP6A 8ICSA 4PHPA 4MF2A 5KFCA 5DDYA 2BPCA 3QE9Y 4B9SA 3RAQA 3PR4A 2NRVA 4LZDA 4F4KA 5J0PA 5L1JA 5DKWA 4ECWA 1TK0A 3PR5B 3H8JA 4PH5A 3PX0A 1X9WA 9ICHA 3MR6A 4PHAA 3KHRA 1U48A 2DPIA 2V4QA 1HUOA 3RR8A 1ZQFA 1RYRA 2HHUA 1JIHA 2M9NA 4MEYA 4PGXA 4QWCA 2F1HA 4DO9A 4O3RA 2F1JA 1ZQBA 3V7JA 2NRTA 2ZJAA 2W8KA 4KLDA 2FPKA 3FDSA 5KTQA 3LK9A 5KFGA 1ZQTA 3JPOA 3UXPA 1BPDA 3JPQA 4QZ9A 2BCUA 2XC9A 4ELUA 2PXIA 1ZQYA 3PW5A 4RQ7A 4DQIA 4RUCA 8ICYA 4XA5A 4R64A 4YG2A 9ICXA 5KG0A 3EW9A 2B21A 3EPGA 3IM1A 3PMLA 3M9OB 1MC8A 4LZGA 2BQRA 4YR0A 4QZFA 1BGXT 7ICJA 4DQPA 4YQWA 5DQHA 4F4ZA 5HP4A 2KZMA 1NK5A 4UB3A 5J2DA 1Z00B 2UVVA 1IXRA 1DGSA 2ZTEA 4RNNA 3MR5A 3MDCA 5CR0A 4DL6A 1S97A 4NY8A 4KITB 2Y1JA 3Q8MA 4NLKA 5KT7A 3Q8PB 5L1LA 3T5LA 5KT6A 5J2FA 1X9MA 1SKWA 4K4HA 3ORYA 1XO1A 5D4BA 1L5UA 3IHQB 8ICUA 5DLFA 2UVRA 5J2KA 5EWFA 1JXLA 5DGAA 5KFPA 4M6WB 3TARA 4RU9A 4QWBA 4UB2A 4O3SA 4Q8FA 1ZQHA 2IHMA 3LDAA 4DLEA 2LYHA 4RPXA 1MQ3A 1ZQIA 2C2EA 4IQUA 1WCNA 4NLGA 1ZQZA 4O5CA 5KFMA 2BQUA 9ICGA 2HHSA 1TV9A 2UVUA 2R8JA 4I28A 8ICRA 4RQ4A 1C7YA 1S77D 4YXJA 1K1SA 4NXZA 3GDXA 1KDHA 1ZQNA 1XWLA 4RQ6A 4UAYA 3QZ8A 4KLIA 1JMSA 1JXEA 2ASJA 4IRDA 4DOAA 2BCVA 2FLLA 4QZCA 3TFRA 4MEXA 8ICLA 2MAXA 4DF8A 4J9PA 2PI5A 4KLOA 4EYIB 9ICCA 4I2DA 4P4PA 5CB1A 5KFSA 4Z6FA 4M04A 4KMUA 4J9KA 2R8KA 4DS5A 1ZQMA 5KG6A 2HHVA 3PO5A 5IIKA 3M9NB 1ZQOA 4KLSA 3PW7A 3TAQA 4DSIA 4B9UA 4UB1A 4M9GA 3M9MB 4M47A 3BDPA 3V7KA 4RNOA 9ICNA 3C1YA 3PW0A 2RDJA 3RB3A 3EWAA 3C5FA 9ICEA 3C1ZA 1S76D 2KFZA 3PX6A 4ED7A 2J6SA 2MUTA 3PNCA 5J2BA 5HHHA 3TI0A 4DSLA 4EBCA 3RAXA 4DFJA 4QZBA 2GWSA 2W9BB 3KHHA 3JPNA 4BXOB 4I2AA 2OWOA 5KFFA 3PW4A 3ISBA 2PFQA 8ICVA 8ICZA 4ECYA 1CUKA 5J2IA 2BCQA 5D49A 3MGHA 5KFYA 4UBBA 3M8RA 4PPXA 3RRHA 4JK1A 7ICIA 2I1QA 1KFSA 4RUAA 4PGQA 2W9CA 4NLZA 4ED0A 3C2MA 1ZYQA 3GQCA 4PHEA 3UXOA 3ISDA 4YVZA 3K4GA 4J9OA 1ZQRA 3EYZA 1ZQEA 4C8LA 1BPZA 4NLNA 4PHDA 2KZ3A 5KT4A 3RH4A 8ICXA 4K4GA 1V9PA 4IQVA 5KFNA 4F3OA 2ZUDA 3MDAA 3T3FA 4IR9A 9ICFA 1TFRA 7ICLA 5CJ7A 2IMWP 3UXNA 4ECTA 1SL1A 2ISOA 4Q43A 3PY8A 3V6HA 5DLGA 4O5EA 4ELTA 4YD2A 4DFKA
chains in the Genus database with same CATH superfamily
2BQ3A 4P2HA 3GFKB 3OHBA 4J9MA 1NI3A 4KLUA 3CP8A 1L7PA 1F5SA 4YXMA 2C22A 5DB8A 1NK7A 4IL6U 5J2HA 2KSOB 3THVA 3BJYA 1JX4A 4DOBA 4RQ0A 3N7RC 1X9XA 5AKHA 5B5EU 9ICLA 2DKZA 2RRDA 4BJQA 3KFUF 3V6KA 9ICQA 5ALKA 3VCBA 1SL0A 2MSNA 1UQVA 8ICNA 2D8CA 3B0XA 3HJEA 4O3NA 4O3QA 2NV3A 7ICSA 2W3SA 2AU0A 5KFZA 2ATLA 4C4RA 2HHXA 2KTQA 4NWIA 5J0WA 4F71A 5KT5A 1ZD4A 4IRCA 4P0QB 2KSOA 3A0BU 5KFLA 4CDGA 4X5VA 5DG8A 4KLEA 5J0UA 3RF9A 4RQ8A 2GLEA 4GC7A 5F9LA 2KK0A 5K4LA 2PMZC 5KFIA 3V7LA 5DB6A 4FZLA 5TZVA 4I2EA 5IIOA 2KEYA 4YFKA 1ZRNA 8ICFA 4KX5A 5IINA 3L4PA 1ZQLA 5AM3A 4Z6CA 1NJWA 4F5RA 2LI6A 4C8NA 4ED3A 4QZHA 4KLMA 4Q45A 2ZIVA 1KFDA 1T3NA 4R66A 2ZTCA 3EPIA 4ACOA 3MR2A 2W11A 4I2CA 4KLHA 2ALZA 3ZDAA 3MR3A 3LVWA 8ICAA 2DQNB 3LWMA 3V6JA 5KFVA 3WK8A 3IP4B 2EDUA 1S0MA 9ICIA 2KVCA 3SAGA 1DOQA 2Q0ZX 5L9XA 1CRXA 3EZ5A 2G0AA 2F3NA 3CRXA 4F93B 2VA3A 2XCAA 1XC9A 3SEIA 1JROA 2MU2A 2WB1C 2YMLA 5J2AA 4G9BA 5J0RA 5ALVA 4DSFA 1XSLA 2A19A 1QQ5A 4JWNA 7ICKA 4IRKA 1ZXIA 3OPXA 4DSKA 3D2NA 4QWEA 4EYHB 1J97A 1KQQA 5KFDA 1WG8A 5AIBA 5IIMA 1QSSA 5ALGA 3T5KA 3OGUA 1O08A 2KICA 4MFCA 1LKYB 2ZUCA 4I2BA 5AKGA 2NRZA 2E1EA 8ICPA 2HCFA 5DBAA 1QTMA 2WAQC 3SI8A 5AK6A 2ZJ8A 1FIQA 3H40A 1L8LA 2JGAA 4WJ3B 1SKSA 1UHUA 7ICGA 2XICA 3EUB2 5G5GA 9ICJA 3GIJA 4ECVA 1KFTA 2XVTA 2FLNA 8ICGA 1A76A 2KKPA 2AGPA 2XCPA 1PVPA 3GIMA 3H4DA 2KV2A 5KG2A 2D6FC 4UB5A 2JRZA 4F2RA 9ICPA 2J6TA 4DL2A 2IBKA 1TVAA 1VDVA 2BGWA 3QZ7A 4IR1A 2LBOA 4Y2SA 2WF8A 2KZZA 4ECSA 5EOZA 4F4YA 4ZH4A 5KL1B 3SYZA 1BPYA 5EE1A 4AP9A 4ZOHC 1QSYA 4BDPA 1ZQXA 3ZDEA 1UCVA 3M1YA 4KX3A 3JPPA 3WK7A 3F2BA 3AU2A 2XY6A 3QEAZ 5CP2A 2K4EA 2W54A 4GIBA 9ICWA 2QB0B 3Q8RB 3CW2C 2XGPA 1KLNA 4IC9A 5HNKA 1L3VA 5J0OA 1TE2A 2H5XA 4QJFB 3V72A 2HOQA 3CNHA 3QX7A 4OD0A 2OM6A 4PL1A 3ZDBA 4O3OA 2G08A 4QZ8A 3KHLA 1PK3A 2NRWA 3ZDDA 3JPTA 5ALTA 4DSJA 2HVIA 3N97B 1ZQQA 4CE6A 2A3VA 5HMLA 2QLTA 1PZNA 4O5KA 4MF2A 5KFCA 3AQEA 2BPCA 4PJ0U 2HBMA 4LZDA 3PSPA 3ED5A 4PH5A 4UAVA 4GFJA 2IOFA 2QB1A 1JIHA 4PGXA 4C4SA 4QWCA 2HDOA 2XI9A 4O3RA 1ZQBA 5ALMA 2FPKA 3UXPA 1BPDA 3TACB 2HSZA 3JPQA 4ELUA 1YZ6A 4DQIA 4R64A 2W7PA 1Z1BA 9ICXA 2B21A 3EPGA 2ZIXB 3PMLA 2BQRA 7ICJA 4DQPA 1RQLA 3TADC 3H0LB 2KZMA 1QQ6A 3J81j 1IIPA 4KITB 3E0FA 5HR6A 4NLBA 3ORYA 1XO1A 5D4BA 1N5WA 4EX7A 3KKAC 5AM2A 4QWBA 1V38A 3H0MB 1J2NA 4Q8FA 3LDAA 4RPXA 1WCNA 1ZQZA 5EE3A 3GZFA 4CRXA 8ICRA 3NVVA 3L5KA 5AIAA 2P35A 1KDHA 4KMOB 4KLIA 3F53A 3QU4A 2ASJA 5ALDA 3NVWA 4DOAA 4QZCA 2PI5A 1WUDA 4I2DA 4P4PA 5CB1A 4M04A 3WKAA 3M6ZA 2R8KA 2KP7A 4DS5A 3WU2U 5IIKA 5J8YC 2G5HB 3TAQA 4DSIA 4UB1A 3M9MB 4RNOA 3C1YA 1S5LU 3NRWA 4DFJA 2GWSA 1Q46A 2PFQA 8ICZA 5D49A 3U26A 4UBBA 4JK1A 2I1QA 1JALA 2YB4A 4PGQA 2YMMA 5ALLA 2HBLA 3C2MA 1ZOLA 3WK4A 1ZYQA 4PHEA 3ISDA 3PSTA 4C8LA 4NLNA 2WF9A 4PHDA 1X6JA 2Y9TA 4K4GA 4CGZA 4FZMA 2ISOA 3PY8A 3V6HA 4PZOA 3CYMA 3NVZA 2F44A 3HKZC 4I27A 4F92B 1ZD2P 1SV0C 1RPLA 3RH5A 2OCEA 3RJJA 4RQNA 1MN8A 4EZ6A 1S9FA 4QW8A 2E8MA 2PMZF 4Q44A 1L8OA 2BR0A 3AM9A 1FEZA 2LYAA 4PL2A 4F2SA 1N5XA 2Y9UA 1NK9A 1CEZA 5DBCA 4IQWA 2JZBA 3NRZA 1FFVA 2A1JA 3BZKA 2FJ6A 2JXJA 2YB1A 1L7NA 2YMPA 2HHWA 1U47A 2B0CA 3RR7A 7ICPA 4BUGA 2ZIWB 1D8BA 4DL4A 1PK1B 4DF4A 3Q8SB 1NJZA 4B9LA 7ICHA 1AROP 3LVVA 5KT2A 4Y2XA 1L7OA 3WKBA 1SZPA 3BQ1A 2AQ4A 4DSEA 4J9LA 1X42A 3RJGA 1KL9A 3OJSA 1SXDA 4ED6A 1TK8A 8ICMA 4KLLA 1BVSA 4BX9C 4YR3A 2JH7A 2R18A 3MGIA 1XNSA 2JEFA 4R8UB 1MQ2A 4QIWF 3MC1A 2LM4A 3PV8A 7ICMA 2DPJA 2FMPA 1Z00A 3E58A 2ZJ5A 4TQSA 1Q3VA 2YX8A 2EZZA 1NK6A 4F72A 5AI4A 2BCSA 3L3FX 5AKEA 4OJLA 4R65A 3OHAA 5J0YA 5EE9A 2F76X 2HI0A 3N7PD 4KN7A 2HW3A 1ZQGA 4I29A 2KE7A 5J0XA 4F5QA 3WK9A 1FO4A 2VANA 4RQ5A 2AQ0A 5KFBA 2HHTA 1C20A 7ICUA 4M9LA 1Z3EB 2C28A 4C0ZA 5KFEA 2VJ4A 3A0HU 4RQ3A 3GV8B 2R8GA 3DEEA 3C2LA 8ICJA 1Y88A 3RFAA 2RDIA 1KRPA 1UT5A 2ZIUB 5AICA 2AGOA 4EZ9A 4J9RA 3OSNA 1EXNA 2WAQF 2QARB 2WFAA 1SGGA 5L1IA 4UW9A 1PVQA 3G6YA 9ICRA 1U45A 5CHGA 4UB4A 1RXWA 1OUQA 2RQ5A 5DGBA 1D8YA 2W9BA 3RBDA 4DWIA 4KLJA 1TK5A 4BXOA 1NZPA 4XUSA 2RP5A 1MA7A 2BKEA 4Z6EA 5KG4A 2FMQA 1ZQAA 2KJ5A 2W9AA 1KTQA 2BDUA 2E1FA 1SIJA 4UQGA 1SWWA 1NK8A 1NZBA 7ICNA 4DFMA 9ICBA 2V4RA 5AI5A 5AKIA 3MFIA 4Y2RA 3SZ2A 4DFPA 3SENA 1BPBA 2ES6A 4QW9A 4ELVA 5AHXA 3TKAA 3IG5A 1IV8A 4FZNA 5HR7A 3UMBA 4RNMA 4QZEA 3IN5A 3E2EA 3BQ7A 4JV0A 2HBKA 1XSPA 1X66A 1S10A 2G09A 4DQQA 3AUOA 3ZD9A 4P4OA 5J0SA 5KFJA 2ODGA 3UPQA 3TANA 4FBUA 4J9NA 7ICOA 2KG5A 1MSWD 4DOCA 1V97A 3PVXA 2K8BB 4UBCA 2W9CB 3JPSA 3OTQA 2PFNA 4BWJA 4F5PA 2UVWA 5BPCA 2KN7A 4M9HA 2FMSA 4C8MA 2V9WA 2FI1A 4ECRA 2H3FA 5KG3A 4B9TA 4Y2TA 4P0QA 3Q8KA 5DG9A 2BHNA 3RTVA 2HMXA 2H3ZA 1ZQUA 1SB3C 3ISCA 4YMMA 2JEIA 4GC6A 5DBBA 2WHEA 2JHDA 2M0NA 3MFHA 1K5OA 3TFSA 5CA7A 3ONNA 4O9MA 4JUZA 4UAZA 3F5AA 1IM4A 2H3VA 1YT3A 1WYGA 5KFTA 2AXTU 2Q4TA 4QIWC 3UQ2A 1ZQDA 2FPLA 1TAUA 3UMCA 4J9SA 5ALEA 3H8WA 4NV0A 8ICOA 4NJ8A 4UB6U 1NJYA 9ICOA 4UAWA 2KJ8A 2IHNA 5CWRA 3RH6A 4AYBC 3HP6A 5AM0A 1RQNA 1SWVA 2KKVA 3PR4A 2NRVA 5J0PA 5L1JA 1TK0A 1X9WA 5AKYA 3B9JA 3MR6A 3RR8A 2V4QA 1HUOA 2F1HA 2DL0A 3V7JA 2W8KA 4KLDA 4U6PA 1OW5A 3JPOA 4QZ9A 1ZQYA 3PW5A 4RQ7A 3NUQA 4XA5A 4YG2A 1M6YA 3IM1A 4O3MA 4YQWA 5AKXA 4F4ZA 2KIWA 3BS5B 2W55A 1BNPA 4RNNA 2ZTEA 4NY8A 3MR5A 3Q8MA 2YMQA 4A8EA 3IRUA 5KT6A 5J2FA 1LVHA 1JXLA 4CF3A 1FFUA 4M6WB 5ALRA 2KJ9A 1MQ3A 2KIVA 2LYHA 1ZQIA 3K1RB 4O5CA 5KFMA 2BQUA 4NL9A 4I28A 1LKYA 4OO1J 3QZ8A 2B6GA 2BCVA 2FLLA 3TFRA 4MEXA 2MAXA 4EYIB 3K1ZA 5ALYA 4J9KA 3HKZF 5KG6A 4KLSA 2AH5A 4B9UA 3PW0A 3EWAA 3C5FA 3C1ZA 4MHVA 2CN1A 2EQYA 3AN1A 4DSLA 3TI0A 1X6IA 2OHFA 3KHHA 2ESEA 8ICVA 4ECYA 2BCQA 5KFYA 2E3TA 3RRHA 3VC8A 4US8A 3GQCA 2Z7JA 3K4GA 2DBYA 3EYZA 3WKCA 8ICXA 1V9PA 4IQVA 4F3OA 1O03A 2ZUDA 7ICLA 5CJ7A 2IMWP 4ECTA 1SL1A 4EELA 1B4FA 3WKEA 5AM4A 4DCCA 1RXVA 1YZ7A 3O0FA 4ECQA 1AQ6A 4DFDA 2QB0A 4YN4A 4LVSA 3HILA 5KAIU 3PZPA 3H8SA 1T7PA 5BOMA 2P6RA 1ZQ1C 4I2HA 2AHOB 1P7DA 4OJOA 8ICCA 1TAQA 9ICKA 4FFDA 1UT8A 1S0NA 5J2CA 1KBUA 3RRGA 2VA8A 4ECXA 3GU3A 5AM5A 4EEKA 1ZQKA 3IDWA 2XY7A 1UPHA 2W9MA 2F8KA 4O3PA 2HHQA 3KTQA 5J0TA 1S0OA 4XRHA 5AKJA 4I2JA 4TUPA 8ICBA 2E8OA 5AI9A 1RYUA 1TAMA 4F91B 4YCXA 5AKKA 5JTIA 4I2FA 4B9NA 4NLCA 1ZETA 4UATA 1SV4A 1F0MA 2ZIXA 3D6JA 5B66U 5ALNA 1NKEA 3UQ0A 3Q8LA 1RG6A 3KOOA 4FO6A 2DKXA 1DGJA 2EAOA 3N7SC 4OJ6A 3QUQA 5AK5A 5BOLA 4OJPA 1Z4NA 3AMZA 5FP0A 4ECZA 4ED1A 2NYVA 2KNJA 4FE3A 3PMNA 3SV3A 2E8NA 8ICKA 3WK6A 3KHGA 1T8EA 1L3TA 1SZHA 5C0YA 2JR5A 2ZTDA 2KFNA 3NGDA 1KW4A 1XO0A 5KFOA 4UARA 3HT3A 5J29A 9ICTA 1DK3A 4RT3A 2YTUA 4J9QA 2HVHA 4B6JA 4DL7A 2BPGA 4DL3A 1KKXA 1QH9A 4KLTA 4JMUA 1SXEA 3HX0A 5ALIA 2JEJA 3RJFA 3ALRA 2VJ5A 4C4TA 5DG7A 3BQ0A 1D9FA 4PGYA 3BZCA 1ZJNA 1RZTA 4F8RA 3D2SA 3NASA 3PW2A 3T5JA 3TQ1A 4Y2QA 4YD1A 3D2QA 2XY5A 2PFPA 2BDPA 1H38A 5HMMA 2KMDA 3C2KA 5C5JA 4Y2PA 4U7CA 2XO7A 4P0PB 4CF4A 4YMNA 3KD3A 4JB3A 1Q3UA 4UASA 3KZXA 3WK5A 3QEBZ 3ETLA 3GV7B 8ICEA 7ICEA 1N62A 3FYHA 3TAPA 3RBEA 1Z1VA 3C28A 4M2YA 1ED1A 3OSPA 1XU4A 2PFOA 2G5IB 2F2AB 3RB0A 3RJKA 4ED8A 2IOHA 4JWMA 1D8LA 4TUSA 4TQRA 4IQTA 2GOLA 1ZQPA 7ICFA 4CNQA 4BWMA 4C8OA 4QZIA 4CF5A 5KG7A 2K89A 3T5HA 2W8LA 2W7OA 3WKDA 5CEHA 2D3DA 2ASDA 1NK4A 2MUTB 2P6UA 1B22A 4RQMA 2F77X 4YR2A 4MF8A 4FBTA 4DS4A 2ZIWA 2E5SA 4FS2A 9ICUA 1PK1A 5KNIA 4IS7A 4F5NA 4AYBF 1B0XA 2W43A 4Y2UA 2Y1IA 8ICTA 5J0QA 1NKBA 1OXJA 1GO3F 1QCKA 3SMVA 4YP3A 2K60A 3BS7A 4Y2YA 4F50A 5IIIA 5AK4A 4Y2JA 4QZDA 4NM1A 5KFAA 9ICSA 4R8UA 7ICVA 3B0YA 5DQGA 2CXYA 5ALUA 4XQ8A 1HEKA 4TUQA 2I5HA 3G6XA 4JV2A 2HBJA 5AM1A 4HYKA 2IOFK 2IA6A 1L7MA 2FDRA 3GV5B 3H4BA 3AU6A 3BQTA 1PUZA 1PVRA 3GILA 5KFHA 8ICIA 5ALQA 2LMRA 5AI8A 7ICTA 3FC4A 4ICAA 5G5HA 4FS1A 1HJPA 1DK2A 4KLQA 3HPOA 3RB6A 2PKEA 1N63A 3QE9Y 3RAQA 5AKLA 5DKWA 3PX0A 4PHAA 3KHRA 2DPIA 2HHUA 2M9NA 4DO9A 3AL0B 2F1JA 2ZIUA 2ZJAA 5KTQA 3LK9A 2F8LA 2QARA 2BCUA 2XC9A 2OEHA 2PXIA 8ICYA 5KG0A 3QUBA 1DRGA 3M9OB 1WWVA 1MC8A 4YR0A 1BGXT 3DV9A 5DQHA 2LKYA 1COKA 1NK5A 4UB3A 4UAUA 1L6NA 2UVVA 1IXRA 1S97A 4DL6A 5CR0A 2Y1JA 4NLKA 3KZIU 5L1LA 2KHVA 4K4HA 1L5UA 8ICUA 3KBBA 2UVRA 5EWFA 2NO5A 2KHQA 1N60A 1HIWA 2EZXA 3DDHA 5DGAA 3SAHA 4RU9A 2ZIVB 4UB2A 2E8PA 1ZQHA 4DLEA 1ZD3A 1WWUA 3QUCA 2C2EA 4IQUA 4NLGA 9ICGA 4OCZA 4YXJA 1K1SA 4RQ6A 2H3IA 4UAYA 3F2CA 1JXEA 2LYBA 8ICLA 4KLOA 4Z6FA 4KMUA 1ZQMA 2L5YA 2HHVA 1V85A 2LHTA 5E79U 1ECWA 4M9GA 4M47A 1N61A 2EZYA 3QNMA 3BDPA 3V7KA 3RB3A 3H8MA 3QU2A 1S76D 5A0LA 5KL8B 4ED7A 3PNCA 5J2BA 5HHHA 3QYPA 3JPNA 2OWOA 4C7YA 3PW4A 3ISBA 1CUKA 2YN4A 4PPXA 7ICIA 1KFSA 2WF7A 5JRTA 2W9CA 4NLZA 1NNLA 4ED0A 4J9OA 1ZQRA 1ZQEA 1BPZA 2XIDA 5KT4A 2OXOA 3RH4A 2ZG6A 9ICFA 3MDAA 3T3FA 4IR9A 3UXNA 4Q43A 5ALOA 2JH1A 5DLGA 3AQFA 4YD2A 3PSIA 4GXIA 2ASLA 2VA2A 4EX6A 4P4MA 2Y0SF 5AI0A 5DQIA 2K4HA 2DFLA 1HUZA 4EBDA 4GXJA 5L1MA 4MFAA 1TKDA 3RJIA 4RPYA 2BPFA 2KVSA 3HWTA 4J03A 5D46A 1N56A 2I9GA 3M6KA 4M9JA 3QUTA 1WCLA 3SQIA 1U4BA 2EANA 1S0VA 9ICVA 5DDMA 2DWQA 2HOFA 4RZRA 1SKRA 3ZD8A 2W04A 2EH9A 3OJUA 3AEVA 3PX4A 5KFUA 2NRXA 3RJEA 1QLNA 1ZRMA 2JEGA 5IIJA 4K4IA 2AJQA 1KSPA 1Q8KA 2O6KA 3T79A 2PI4A 5KAFU 1KEJA 5J2GA 9ICEA 5AI6A 4KN4A 3RB4A 4M0AA 1L3UA 1K1QA 3I28A 4Y2VA 5CRXA 5ALWA 2EAPA 4RQ1A 1D9DA 4Q8EA 2N1RA 5KFXA 4TURA 4DQSA 4C8KA 5J2EA 5EWEA 3QU5A 4GLXA 5DB7A 5HHIA 4F4WA 3IG8A 4RT2A 1RDFA 3TADA 3ETRA 7ICRA 4B9MA 3N28A 2AGQA 3JPRA 3BS5A 5L1KA 2BCRA 3ICXA 3HRDD 4F4XA 9ICMA 2W03A 4USAA 2XGQA 4B9VA 3QXGA 4DLGA 3M7DA 3KKAA 1U9LA 2J6UA 1S8OA 4CCHA 1B43A 5DB9A 4M6WA 2HOIA 3PSFA 4QZAA 1U49A 5KG5A 2R8IA 5KFKA 1L3SA 4EBEA 2R8HA 5EE0A 4O0IA 1NK0A 1XSNA 4GXKA 5JU5A 3ZDCA 3ZI4A 1KN5A 4E0DA 2I6XA 3MABA 3PO4A 4QNLA 2KOBA 5KG1A 2MRLA 5J8YA 2DGZA 5GTIU 4KLGA 1A0PA 4I2GA 4QZGA 5IILA 3NTUA 4KTQA 3G6VA 2K4PA 1ZJMA 4F5OA 1Z19A 3MBYA 2ISPA 5EWGA 3N4MB 2DF4B 5AK3A 2RHFA 8ICQA 1LB2B 3RJHA 1VLBA 5AKZA 4YMOA 3GIKA 2NO4A 4C7ZA 3GIIA 4QWDA 3C29A 4RQ2A 1UA0A 4M9NA 2P66A 5KFRA 2MA1A 3C21A 2ZXIA 4UB8U 1COOA 2K8AA 2YQEA 3Q8QB 2C2RA 4C80A 4I2IA 3BQ2A 2C2DA 1XS9D 2ZUBA 1UA1A 2A1AA 2BZFA 1NKCA 4NL9C 1BPXA 4ED2A 3HW8A 1SV0A 3H7IA 2OYYA 4HAIA 1T4GA 1ZQVA 3UM9A 4ECUA 2Y0SC 4G3IA 1Z4OA 3SD7A 1X9SA 9ICAA 8ICWA 2F1IA 2LM1A 8ICHA 3C23A 1SL2A 5JUMA 1N48A 1JI7A 1RYSA 5J2JA 2VKQA 3K75D 4EEYA 5KFWA 2W3RA 2LPEA 4DEZA 4R63A 1J2MA 4Z6DA 2G07A 1X2IA 2KD1A 3C5GA 4KLFA 1BPEA 3NS1A 7ICQA 4DL5A 1ZQSA 1NOMA 1BNOA 3FAHA 3SV4A 1ZQCA 2VIXA 1ZQJA 5ALZA 2YY6A 1NJXA 3I1YA 4RPZA 5F3XB 2G06A 3F5EA 1ZQWA 2FLPA 1X40A 3NVYA 1VJ5A 4DQRA 3S6JA 5KFQA 5ALFA 4PZNA 3UMGA 5ALPA 1CI4A 4BGDA 1QSLA 4JV1A 4MFFA 2WTFA 1A77A 4NM2A 4QWAA 1LV5A 1N2XA 1RM6C 5F9NA 5KT3A 3M8SA 2CPRA 2JZBB 2FPMA 1IG6A 1JN3A 2A1JB 1JUDA 4LJXA 3LWLA 2DUYA 4PHPA 8ICSA 5DDYA 3SR6A 4B9SA 2ZXHA 4F4KA 4ECWA 3PR5B 2JMGA 3FM9A 2GH1A 3H8JA 4OJ5A 1URJA 9ICHA 1ZD5A 1U48A 1ZQFA 1RYRA 4MEYA 1DXSA 2NRTA 3FDSA 5KFGA 2QKQA 1ZQTA 2CRXA 3QU9A 4RUCA 3EW9A 3IV6A 4LZGA 4QZFA 5ALHA 3MGVA 5HP4A 5ALXA 5J2DA 1Z00B 3SAFA 1DGSA 3MDCA 1F44A 5KT7A 3Q8PB 3T5LA 4P0PA 1X9MA 1SKWA 3IHQB 5DLFA 5GTHU 2GO7A 5J2KA 5KFPA 5TISU 3TARA 1T3QA 3H0RB 4O3SA 2IHMA 2HHSA 2WF5A 1TV9A 2UVUA 2R8JA 5T14A 4RQ4A 1C7YA 1S77D 2FE9A 2K8CB 4NXZA 3GDXA 1ZQNA 1XWLA 1JMSA 4EENA 5ALJA 4IRDA 4DF8A 4J9PA 9ICCA 5KFSA 4US9A 1JRPA 3PO5A 2H3QA 3M9NB 1ZQOA 3PW7A 2WB1F 5ALSA 9ICNA 2RDJA 2WF6A 3QU7A 2KFZA 5H2FU 3PX6A 3R9KA 2J6SA 2MUTA 4EBCA 3RAXA 1T94A 4QZBA 2W9BB 2RLTA 4BXOB 4I2AA 1A6SA 5KFFA 5J2IA 2JV3A 3MGHA 3M8RA 4RUAA 2EAMA 2OH2A 3UXOA 4YVZA 2KZ3A 3LYSA 5KFNA 2K4IA 1TFRA 3F2DA 1QQ7A 3I76A 4O5EA 4ELTA 4DFKA
chains in the Genus database with same CATH topology
2BQ3A 4P2HA 3GFKB 4GXIA 3OHBA 2ASLA 1RXVA 2VA2A 4J9MA 4KLUA 4ECQA 4P4MA 4YXMA 5DQIA 4YN4A 4LVSA 4I27A 4F92B 2DFLA 1HUZA 4EBDA 2C22A 5DB8A 1RPLA 1NK7A 3RH5A 4GXJA 3RJJA 3H8SA 1T7PA 4MFAA 1TKDA 4EZ6A 1S9FA 4QW8A 4Q44A 5J2HA 5BOMA 2P6RA 3RJIA 3THVA 4RPYA 3BJYA 4DOBA 4RQ0A 1JX4A 2BR0A 4I2HA 2BPFA 4F2SA 3HWTA 5D46A 1N56A 2I9GA 8ICCA 1TAQA 9ICLA 4M9JA 9ICKA 1UT8A 1S0NA 1WCLA 3V6KA 1U4BA 1S0VA 9ICQA 9ICVA 5J2CA 3RRGA 1SL0A 1NK9A 1CEZA 5DBCA 2VA8A 4ECXA 4IQWA 2JZBA 5DDMA 4RZRA 1SKRA 2A1JA 3ZD8A 8ICNA 1ZQKA 2XY7A 2HHWA 3B0XA 3OJUA 1U47A 4O3NA 5KFUA 3PX4A 2NRXA 3RJEA 4O3QA 3RR7A 1QLNA 7ICPA 2JEGA 2W9MA 4O3PA 5IIJA 4K4IA 2AJQA 1KSPA 2HHQA 3KTQA 4DL4A 7ICSA 1NJZA 4DF4A 3Q8SB 2PI4A 4B9LA 2AU0A 7ICHA 1KEJA 5J0TA 5J2GA 5KFZA 1S0OA 1AROP 5KT2A 2ATLA 4KN4A 3RB4A 2KTQA 4XRHA 4M0AA 2HHXA 1L3UA 1K1QA 4I2JA 1SZPA 5J0WA 3BQ1A 4TUPA 2AQ4A 5KT5A 4RQ1A 8ICBA 1D9DA 4DSEA 4Q8EA 4IRCA 4J9LA 3RJGA 5KFXA 3OJSA 5KFLA 4TURA 4ED6A 4X5VA 1TK8A 5DG8A 4KLEA 5J0UA 8ICMA 4KLLA 1BVSA 4RQ8A 4DQSA 4F91B 5EWEA 4YCXA 5J2EA 5DB7A 4GLXA 4C8KA 4YR3A 5HHIA 4GC7A 5F9LA 4I2FA 3MGIA 4F4WA 4B9NA 1ZETA 2JEFA 4RT2A 5KFIA 4R8UB 1MQ2A 3V7LA 1NKEA 7ICRA 5DB6A 4B9MA 2AGQA 3UQ0A 3Q8LA 3PV8A 7ICMA 3JPRA 5L1KA 4FO6A 2DPJA 2FMPA 1Z00A 5TZVA 2BCRA 2ZJ5A 4I2EA 4TQSA 5IIOA 5BOLA 4F4XA 4YFKA 9ICMA 1NK6A 2XGQA 5IINA 8ICFA 4B9VA 2BCSA 4DLGA 4ECZA 4ED1A 1ZQLA 1U9LA 4R65A 3OHAA 2J6UA 4Z6CA 3PMNA 5J0YA 3SV3A 1NJWA 4F5RA 4CCHA 4KN7A 4C8NA 2HW3A 1ZQGA 8ICKA 4ED3A 4I29A 3KHGA 1B43A 5DB9A 4QZHA 1T8EA 5J0XA 4M6WA 1L3TA 4Q45A 4F5QA 4KLMA 2VANA 2ZTDA 4RQ5A 1KFDA 2AQ0A 4QZAA 5KFBA 1U49A 5KG5A 3NGDA 2KFNA 2R8IA 5KFKA 1T3NA 4R66A 4EBEA 2R8HA 1L3SA 2HHTA 4O0IA 7ICUA 5KFOA 2ZTCA 4M9LA 1Z3EB 3EPIA 2C28A 1NK0A 3HT3A 3MR2A 1XSNA 5KFEA 5J29A 4I2CA 4GXKA 4KLHA 2ALZA 3ZDAA 3MR3A 3ZDCA 9ICTA 4RT3A 4J9QA 2HVHA 8ICAA 4RQ3A 3GV8B 4DL7A 2BPGA 2R8GA 4DL3A 3LWMA 3C2LA 4E0DA 4KLTA 3V6JA 5KFVA 3MABA 8ICJA 1Y88A 3HX0A 3PO4A 2JEJA 3RJFA 5KG1A 2RDIA 1KRPA 1UT5A 2AGOA 4KLGA 1S0MA 5DG7A 4EZ9A 9ICIA 4I2GA 4J9RA 4QZGA 1EXNA 3OSNA 5IILA 3NTUA 4KTQA 3G6VA 3BQ0A 1D9FA 4PGYA 1ZJNA 1ZJMA 5L1IA 1RZTA 4F5OA 1DOQA 4F8RA 3MBYA 3PW2A 2ISPA 2Q0ZX 5EWGA 5L9XA 3G6YA 3T5JA 3TQ1A 9ICRA 1U45A 3EZ5A 3N4MB 5CHGA 4UB4A 1RXWA 4F93B 2VA3A 5DGBA 4YD1A 2XCAA 1XC9A 1LB2B 2W9BA 1D8YA 3RBDA 3RJHA 5J2AA 8ICQA 4DWIA 4KLJA 1TK5A 4BXOA 5J0RA 4XUSA 4YMOA 3GIKA 2XY5A 2PFPA 3GIIA 4DSFA 1XSLA 1H38A 2BDPA 2BKEA 4Z6EA 5KG4A 5HMMA 4QWDA 2FMQA 4IRKA 4JWNA 1ZQAA 7ICKA 3C2KA 4RQ2A 5C5JA 4DSKA 1UA0A 2XO7A 4M9NA 4YMNA 2P66A 4QWEA 4EYHB 2W9AA 1KTQA 5KFRA 4UQGA 3C21A 5KFDA 3QEBZ 1NK8A 1COOA 4DFMA 7ICNA 3ETLA 9ICBA 3Q8QB 5IIMA 3GV7B 2C2RA 2V4RA 4I2IA 3BQ2A 2C2DA 1QSSA 1XS9D 8ICEA 7ICEA 2ZUBA 3T5KA 1UA1A 3FYHA 3OGUA 3MFIA 3TAPA 3RBEA 3SZ2A 4MFCA 1NKCA 4M2YA 4DFPA 2ZUCA 3OSPA 1XU4A 4ED2A 1BPXA 2PFOA 1BPBA 3HW8A 4I2BA 4QW9A 2NRZA 4ELVA 3RB0A 3RJKA 8ICPA 3H7IA 4ED8A 4JWMA 1D8LA 5DBAA 1QTMA 4TUSA 4TQRA 1T4GA 3SI8A 4IQTA 4RNMA 4QZEA 2ZJ8A 3E2EA 1ZQVA 4ECUA 4JV0A 3H40A 1ZQPA 7ICFA 4G3IA 4BWMA 1XSPA 1SKSA 4QZIA 4C8OA 1X9SA 5KG7A 7ICGA 9ICAA 1S10A 8ICWA 9ICJA 3GIJA 2F1IA 2W8LA 4ECVA 3T5HA 8ICHA 4DQQA 3AUOA 3C23A 3ZD9A 1SL2A 4P4OA 1KFTA 5JUMA 5J0SA 1N48A 1B22A 5KFJA 2ASDA 1RYSA 5J2JA 1NK4A 3K75D 2MUTB 3UPQA 4EEYA 2FLNA 8ICGA 2P6UA 5KFWA 3TANA 1A76A 4DEZA 4R63A 4FBUA 2AGPA 4J9NA 4Z6DA 4YR2A 1MSWD 4MF8A 2XCPA 4FBTA 7ICOA 4DOCA 3GIMA 3H4DA 4DS4A 1X2IA 5KG2A 4UB5A 3C5GA 3PVXA 4KLFA 4UBCA 4F2RA 2W9CB 4FS2A 9ICPA 1BPEA 3JPSA 9ICUA 2PFNA 4BWJA 4F5PA 4DL2A 2J6TA 2UVWA 2IBKA 1TVAA 5BPCA 2KN7A 4F5NA 4M9HA 2FMSA 7ICQA 4DL5A 2BGWA 3QZ7A 4IR1A 4C8MA 1ZQSA 2V9WA 1NOMA 4ECRA 3SV4A 2Y1IA 5J0QA 1ZQCA 8ICTA 2KZZA 1NKBA 4ECSA 5EOZA 4F4YA 4ZH4A 5KG3A 3SYZA 1BPYA 1ZQJA 4B9TA 1NJXA 3Q8KA 5DG9A 2BHNA 4YP3A 3RTVA 1QSYA 4BDPA 1ZQXA 3ZDEA 4RPZA 3JPPA 4F50A 5IIIA 3AU2A 1ZQWA 1ZQUA 2XY6A 3QEAZ 3ISCA 5CP2A 4QZDA 4YMMA 2JEIA 4NM1A 4GC6A 2FLPA 5KFAA 4DQRA 9ICSA 9ICWA 4R8UA 5KFQA 5DBBA 7ICVA 3Q8RB 3B0YA 3MFHA 5DQGA 2XGPA 3TFSA 4XQ8A 5CA7A 4TUQA 3G6XA 1KLNA 4BGDA 1QSLA 4JV2A 4HYKA 5HNKA 1L3VA 4JV1A 5J0OA 4O9MA 4JUZA 4UAZA 2IA6A 2WTFA 4MFFA 1A77A 1IM4A 2H5XA 3V72A 5KFTA 4NM2A 3GV5B 4QWAA 3UQ2A 3H4BA 1LV5A 1ZQDA 2FPLA 3AU6A 1TAUA 3BQTA 4J9SA 3ZDBA 4O3OA 3KHLA 4QZ8A 3H8WA 5F9NA 3GILA 2NRWA 5KT3A 3M8SA 3ZDDA 3JPTA 5KFHA 8ICIA 8ICOA 4DSJA 2JZBB 2FPMA 1NJYA 2HVIA 7ICTA 9ICOA 1JN3A 2A1JB 4UAWA 2IHNA 5CWRA 3N97B 1ZQQA 4FS1A 1HJPA 5HMLA 3RH6A 1PZNA 4O5KA 4KLQA 3LWLA 3HPOA 3RB6A 3HP6A 8ICSA 4PHPA 4MF2A 5KFCA 5DDYA 2BPCA 3QE9Y 4B9SA 3RAQA 3PR4A 2NRVA 4LZDA 4F4KA 5J0PA 5L1JA 5DKWA 4ECWA 1TK0A 3PR5B 3H8JA 4PH5A 3PX0A 1X9WA 9ICHA 3MR6A 4PHAA 3KHRA 1U48A 2DPIA 2V4QA 1HUOA 3RR8A 1ZQFA 1RYRA 2HHUA 1JIHA 2M9NA 4MEYA 4PGXA 4QWCA 2F1HA 4DO9A 4O3RA 2F1JA 1ZQBA 3V7JA 2NRTA 2ZJAA 2W8KA 4KLDA 2FPKA 3FDSA 5KTQA 3LK9A 5KFGA 1ZQTA 3JPOA 3UXPA 1BPDA 3JPQA 4QZ9A 2BCUA 2XC9A 4ELUA 2PXIA 1ZQYA 3PW5A 4RQ7A 4DQIA 4RUCA 8ICYA 4XA5A 4R64A 4YG2A 9ICXA 5KG0A 3EW9A 2B21A 3EPGA 3IM1A 3PMLA 3M9OB 1MC8A 4LZGA 2BQRA 4YR0A 4QZFA 1BGXT 7ICJA 4DQPA 4YQWA 5DQHA 4F4ZA 5HP4A 2KZMA 1NK5A 4UB3A 5J2DA 1Z00B 2UVVA 1IXRA 1DGSA 2ZTEA 4RNNA 3MR5A 3MDCA 5CR0A 4DL6A 1S97A 4NY8A 4KITB 2Y1JA 3Q8MA 4NLKA 5KT7A 3Q8PB 5L1LA 3T5LA 5KT6A 5J2FA 1X9MA 1SKWA 4K4HA 3ORYA 1XO1A 5D4BA 1L5UA 3IHQB 8ICUA 5DLFA 2UVRA 5J2KA 5EWFA 1JXLA 5DGAA 5KFPA 4M6WB 3TARA 4RU9A 4QWBA 4UB2A 4O3SA 4Q8FA 1ZQHA 2IHMA 3LDAA 4DLEA 2LYHA 4RPXA 1MQ3A 1ZQIA 2C2EA 4IQUA 1WCNA 4NLGA 1ZQZA 4O5CA 5KFMA 2BQUA 9ICGA 2HHSA 1TV9A 2UVUA 2R8JA 4I28A 8ICRA 4RQ4A 1C7YA 1S77D 4YXJA 1K1SA 4NXZA 3GDXA 1KDHA 1ZQNA 1XWLA 4RQ6A 4UAYA 3QZ8A 4KLIA 1JMSA 1JXEA 2ASJA 4IRDA 4DOAA 2BCVA 2FLLA 4QZCA 3TFRA 4MEXA 8ICLA 2MAXA 4DF8A 4J9PA 2PI5A 4KLOA 4EYIB 9ICCA 4I2DA 4P4PA 5CB1A 5KFSA 4Z6FA 4M04A 4KMUA 4J9KA 2R8KA 4DS5A 1ZQMA 5KG6A 2HHVA 3PO5A 5IIKA 3M9NB 1ZQOA 4KLSA 3PW7A 3TAQA 4DSIA 4B9UA 4UB1A 4M9GA 3M9MB 4M47A 3BDPA 3V7KA 4RNOA 9ICNA 3C1YA 3PW0A 2RDJA 3RB3A 3EWAA 3C5FA 9ICEA 3C1ZA 1S76D 2KFZA 3PX6A 4ED7A 2J6SA 2MUTA 3PNCA 5J2BA 5HHHA 3TI0A 4DSLA 4EBCA 3RAXA 4DFJA 4QZBA 2GWSA 2W9BB 3KHHA 3JPNA 4BXOB 4I2AA 2OWOA 5KFFA 3PW4A 3ISBA 2PFQA 8ICVA 8ICZA 4ECYA 1CUKA 5J2IA 2BCQA 5D49A 3MGHA 5KFYA 4UBBA 3M8RA 4PPXA 3RRHA 4JK1A 7ICIA 2I1QA 1KFSA 4RUAA 4PGQA 2W9CA 4NLZA 4ED0A 3C2MA 1ZYQA 3GQCA 4PHEA 3UXOA 3ISDA 4YVZA 3K4GA 4J9OA 1ZQRA 3EYZA 1ZQEA 4C8LA 1BPZA 4NLNA 4PHDA 2KZ3A 5KT4A 3RH4A 8ICXA 4K4GA 1V9PA 4IQVA 5KFNA 4F3OA 2ZUDA 3MDAA 3T3FA 4IR9A 9ICFA 1TFRA 7ICLA 5CJ7A 2IMWP 3UXNA 4ECTA 1SL1A 2ISOA 4Q43A 3PY8A 3V6HA 5DLGA 4O5EA 4ELTA 4YD2A 4DFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BQ3 A;  4P2H A;  3GFK B;  4GXI A;  3OHB A;  2ASL A;  1RXV A;  2VA2 A;  4J9M A;  4KLU A;  4ECQ A;  4P4M A;  4YXM A;  5DQI A;  4YN4 A;  4LVS A;  4I27 A;  4F92 B;  2DFL A;  1HUZ A;  4EBD A;  2C22 A;  5DB8 A;  1RPL A;  1NK7 A;  3RH5 A;  4GXJ A;  3RJJ A;  3H8S A;  1T7P A;  4MFA A;  1TKD A;  4EZ6 A;  1S9F A;  4QW8 A;  4Q44 A;  5J2H A;  5BOM A;  2P6R A;  3RJI A;  3THV A;  4RPY A;  3BJY A;  4DOB A;  4RQ0 A;  1JX4 A;  2BR0 A;  4I2H A;  2BPF A;  4F2S A;  3HWT A;  5D46 A;  1N56 A;  2I9G A;  8ICC A;  1TAQ A;  9ICL A;  4M9J A;  9ICK A;  1UT8 A;  1S0N A;  1WCL A;  3V6K A;  1U4B A;  1S0V A;  9ICQ A;  9ICV A;  5J2C A;  3RRG A;  1SL0 A;  1NK9 A;  1CEZ A;  5DBC A;  2VA8 A;  4ECX A;  4IQW A;  2JZB A;  5DDM A;  4RZR A;  1SKR A;  2A1J A;  3ZD8 A;  8ICN A;  1ZQK A;  2XY7 A;  2HHW A;  3B0X A;  3OJU A;  1U47 A;  4O3N A;  5KFU A;  3PX4 A;  2NRX A;  3RJE A;  4O3Q A;  3RR7 A;  1QLN A;  7ICP A;  2JEG A;  2W9M A;  4O3P A;  5IIJ A;  4K4I A;  2AJQ A;  1KSP A;  2HHQ A;  3KTQ A;  4DL4 A;  7ICS A;  1NJZ A;  4DF4 A;  3Q8S B;  2PI4 A;  4B9L A;  2AU0 A;  7ICH A;  1KEJ A;  5J0T A;  5J2G A;  5KFZ A;  1S0O A;  1ARO P;  5KT2 A;  2ATL A;  4KN4 A;  3RB4 A;  2KTQ A;  4XRH A;  4M0A A;  2HHX A;  1L3U A;  1K1Q A;  4I2J A;  1SZP A;  5J0W A;  3BQ1 A;  4TUP A;  2AQ4 A;  5KT5 A;  4RQ1 A;  8ICB A;  1D9D A;  4DSE A;  4Q8E A;  4IRC A;  4J9L A;  3RJG A;  5KFX A;  3OJS A;  5KFL A;  4TUR A;  4ED6 A;  4X5V A;  1TK8 A;  5DG8 A;  4KLE A;  5J0U A;  8ICM A;  4KLL A;  1BVS A;  4RQ8 A;  4DQS A;  4F91 B;  5EWE A;  4YCX A;  5J2E A;  5DB7 A;  4GLX A;  4C8K A;  4YR3 A;  5HHI A;  4GC7 A;  5F9L A;  4I2F A;  3MGI A;  4F4W A;  4B9N A;  1ZET A;  2JEF A;  4RT2 A;  5KFI A;  4R8U B;  1MQ2 A;  3V7L A;  1NKE A;  7ICR A;  5DB6 A;  4B9M A;  2AGQ A;  3UQ0 A;  3Q8L A;  3PV8 A;  7ICM A;  3JPR A;  5L1K A;  4FO6 A;  2DPJ A;  2FMP A;  1Z00 A;  5TZV A;  2BCR A;  2ZJ5 A;  4I2E A;  4TQS A;  5IIO A;  5BOL A;  4F4X A;  4YFK A;  9ICM A;  1NK6 A;  2XGQ A;  5IIN A;  8ICF A;  4B9V A;  2BCS A;  4DLG A;  4ECZ A;  4ED1 A;  1ZQL A;  1U9L A;  4R65 A;  3OHA A;  2J6U A;  4Z6C A;  3PMN A;  5J0Y A;  3SV3 A;  1NJW A;  4F5R A;  4CCH A;  4KN7 A;  4C8N A;  2HW3 A;  1ZQG A;  8ICK A;  4ED3 A;  4I29 A;  3KHG A;  1B43 A;  5DB9 A;  4QZH A;  1T8E A;  5J0X A;  4M6W A;  1L3T A;  4Q45 A;  4F5Q A;  4KLM A;  2VAN A;  2ZTD A;  4RQ5 A;  1KFD A;  2AQ0 A;  4QZA A;  5KFB A;  1U49 A;  5KG5 A;  3NGD A;  2KFN A;  2R8I A;  5KFK A;  1T3N A;  4R66 A;  4EBE A;  2R8H A;  1L3S A;  2HHT A;  4O0I A;  7ICU A;  5KFO A;  2ZTC A;  4M9L A;  1Z3E B;  3EPI A;  2C28 A;  1NK0 A;  3HT3 A;  3MR2 A;  1XSN A;  5KFE A;  5J29 A;  4I2C A;  4GXK A;  4KLH A;  2ALZ A;  3ZDA A;  3MR3 A;  3ZDC A;  9ICT A;  4RT3 A;  4J9Q A;  2HVH A;  8ICA A;  4RQ3 A;  3GV8 B;  4DL7 A;  2BPG A;  2R8G A;  4DL3 A;  3LWM A;  3C2L A;  4E0D A;  4KLT A;  3V6J A;  5KFV A;  3MAB A;  8ICJ A;  1Y88 A;  3HX0 A;  3PO4 A;  2JEJ A;  3RJF A;  5KG1 A;  2RDI A;  1KRP A;  1UT5 A;  2AGO A;  4KLG A;  1S0M A;  5DG7 A;  4EZ9 A;  9ICI A;  4I2G A;  4J9R A;  4QZG A;  1EXN A;  3OSN A;  5IIL A;  3NTU A;  4KTQ A;  3G6V A;  3BQ0 A;  1D9F A;  4PGY A;  1ZJN A;  1ZJM A;  5L1I A;  1RZT A;  4F5O A;  1DOQ A;  4F8R A;  3MBY A;  3PW2 A;  2ISP A;  2Q0Z X;  5EWG A;  5L9X A;  3G6Y A;  3T5J A;  3TQ1 A;  9ICR A;  1U45 A;  3EZ5 A;  3N4M B;  5CHG A;  4UB4 A;  1RXW A;  4F93 B;  2VA3 A;  5DGB A;  4YD1 A;  2XCA A;  1XC9 A;  1LB2 B;  2W9B A;  1D8Y A;  3RBD A;  3RJH A;  5J2A A;  8ICQ A;  4DWI A;  4KLJ A;  1TK5 A;  4BXO A;  5J0R A;  4XUS A;  4YMO A;  3GIK A;  2XY5 A;  2PFP A;  3GII A;  4DSF A;  1XSL A;  1H38 A;  2BDP A;  2BKE A;  4Z6E A;  5KG4 A;  5HMM A;  4QWD A;  2FMQ A;  4IRK A;  4JWN A;  1ZQA A;  7ICK A;  3C2K A;  4RQ2 A;  5C5J A;  4DSK A;  1UA0 A;  2XO7 A;  4M9N A;  4YMN A;  2P66 A;  4QWE A;  4EYH B;  2W9A A;  1KTQ A;  5KFR A;  4UQG A;  3C21 A;  5KFD A;  3QEB Z;  1NK8 A;  1COO A;  4DFM A;  7ICN A;  3ETL A;  9ICB A;  3Q8Q B;  5IIM A;  3GV7 B;  2C2R A;  2V4R A;  4I2I A;  3BQ2 A;  2C2D A;  1QSS A;  1XS9 D;  8ICE A;  7ICE A;  2ZUB A;  3T5K A;  1UA1 A;  3FYH A;  3OGU A;  3MFI A;  3TAP A;  3RBE A;  3SZ2 A;  4MFC A;  1NKC A;  4M2Y A;  4DFP A;  2ZUC A;  3OSP A;  1XU4 A;  4ED2 A;  1BPX A;  2PFO A;  1BPB A;  3HW8 A;  4I2B A;  4QW9 A;  2NRZ A;  4ELV A;  3RB0 A;  3RJK A;  8ICP A;  3H7I A;  4ED8 A;  4JWM A;  1D8L A;  5DBA A;  1QTM A;  4TUS A;  4TQR A;  1T4G A;  3SI8 A;  4IQT A;  4RNM A;  4QZE A;  2ZJ8 A;  3E2E A;  1ZQV A;  4ECU A;  4JV0 A;  3H40 A;  1ZQP A;  7ICF A;  4G3I A;  4BWM A;  1XSP A;  1SKS A;  4QZI A;  4C8O A;  1X9S A;  5KG7 A;  7ICG A;  9ICA A;  1S10 A;  8ICW A;  9ICJ A;  3GIJ A;  2F1I A;  2W8L A;  4ECV A;  3T5H A;  8ICH A;  4DQQ A;  3AUO A;  3C23 A;  3ZD9 A;  1SL2 A;  4P4O A;  1KFT A;  5JUM A;  5J0S A;  1N48 A;  1B22 A;  5KFJ A;  2ASD A;  1RYS A;  5J2J A;  1NK4 A;  3K75 D;  2MUT B;  3UPQ A;  4EEY A;  2FLN A;  8ICG A;  2P6U A;  5KFW A;  3TAN A;  1A76 A;  4DEZ A;  4R63 A;  4FBU A;  2AGP A;  4J9N A;  4Z6D A;  4YR2 A;  1MSW D;  4MF8 A;  2XCP A;  4FBT A;  7ICO A;  4DOC A;  3GIM A;  3H4D A;  4DS4 A;  1X2I A;  5KG2 A;  4UB5 A;  3C5G A;  3PVX A;  4KLF A;  4UBC A;  4F2R A;  2W9C B;  4FS2 A;  9ICP A;  1BPE A;  3JPS A;  9ICU A;  2PFN A;  4BWJ A;  4F5P A;  4DL2 A;  2J6T A;  2UVW A;  2IBK A;  1TVA A;  5BPC A;  2KN7 A;  4F5N A;  4M9H A;  2FMS A;  7ICQ A;  4DL5 A;  2BGW A;  3QZ7 A;  4IR1 A;  4C8M A;  1ZQS A;  2V9W A;  1NOM A;  4ECR A;  3SV4 A;  2Y1I A;  5J0Q A;  1ZQC A;  8ICT A;  2KZZ A;  1NKB A;  4ECS A;  5EOZ A;  4F4Y A;  4ZH4 A;  5KG3 A;  3SYZ A;  1BPY A;  1ZQJ A;  4B9T A;  1NJX A;  3Q8K A;  5DG9 A;  2BHN A;  4YP3 A;  3RTV A;  1QSY A;  4BDP A;  1ZQX A;  3ZDE A;  4RPZ A;  3JPP A;  4F50 A;  5III A;  3AU2 A;  1ZQW A;  1ZQU A;  2XY6 A;  3QEA Z;  3ISC A;  5CP2 A;  4QZD A;  4YMM A;  2JEI A;  4NM1 A;  4GC6 A;  2FLP A;  5KFA A;  4DQR A;  9ICS A;  9ICW A;  4R8U A;  5KFQ A;  5DBB A;  7ICV A;  3Q8R B;  3B0Y A;  3MFH A;  5DQG A;  2XGP A;  3TFS A;  4XQ8 A;  5CA7 A;  4TUQ A;  3G6X A;  1KLN A;  4BGD A;  1QSL A;  4JV2 A;  4HYK A;  5HNK A;  1L3V A;  4JV1 A;  5J0O A;  4O9M A;  4JUZ A;  4UAZ A;  2IA6 A;  2WTF A;  4MFF A;  1A77 A;  1IM4 A;  2H5X A;  3V72 A;  5KFT A;  4NM2 A;  3GV5 B;  4QWA A;  3UQ2 A;  3H4B A;  1LV5 A;  1ZQD A;  2FPL A;  3AU6 A;  1TAU A;  3BQT A;  4J9S A;  3ZDB A;  4O3O A;  3KHL A;  4QZ8 A;  3H8W A;  5F9N A;  3GIL A;  2NRW A;  5KT3 A;  3M8S A;  3ZDD A;  3JPT A;  5KFH A;  8ICI A;  8ICO A;  4DSJ A;  2JZB B;  2FPM A;  1NJY A;  2HVI A;  7ICT A;  9ICO A;  1JN3 A;  2A1J B;  4UAW A;  2IHN A;  5CWR A;  3N97 B;  1ZQQ A;  4FS1 A;  1HJP A;  5HML A;  3RH6 A;  1PZN A;  4O5K A;  4KLQ A;  3LWL A;  3HPO A;  3RB6 A;  3HP6 A;  8ICS A;  4PHP A;  4MF2 A;  5KFC A;  5DDY A;  2BPC A;  3QE9 Y;  4B9S A;  3RAQ A;  3PR4 A;  2NRV A;  4LZD A;  4F4K A;  5J0P A;  5L1J A;  5DKW A;  4ECW A;  1TK0 A;  3PR5 B;  3H8J A;  4PH5 A;  3PX0 A;  1X9W A;  9ICH A;  3MR6 A;  4PHA A;  3KHR A;  1U48 A;  2DPI A;  2V4Q A;  1HUO A;  3RR8 A;  1ZQF A;  1RYR A;  2HHU A;  1JIH A;  2M9N A;  4MEY A;  4PGX A;  4QWC A;  2F1H A;  4DO9 A;  4O3R A;  2F1J A;  1ZQB A;  3V7J A;  2NRT A;  2ZJA A;  2W8K A;  4KLD A;  2FPK A;  3FDS A;  5KTQ A;  3LK9 A;  5KFG A;  1ZQT A;  3JPO A;  3UXP A;  1BPD A;  3JPQ A;  4QZ9 A;  2BCU A;  2XC9 A;  4ELU A;  2PXI A;  1ZQY A;  3PW5 A;  4RQ7 A;  4DQI A;  4RUC A;  8ICY A;  4XA5 A;  4R64 A;  4YG2 A;  9ICX A;  5KG0 A;  3EW9 A;  2B21 A;  3EPG A;  3IM1 A;  3PML A;  3M9O B;  1MC8 A;  4LZG A;  2BQR A;  4YR0 A;  4QZF A;  1BGX T;  7ICJ A;  4DQP A;  4YQW A;  5DQH A;  4F4Z A;  5HP4 A;  2KZM A;  1NK5 A;  4UB3 A;  5J2D A;  1Z00 B;  2UVV A;  1IXR A;  1DGS A;  2ZTE A;  4RNN A;  3MR5 A;  3MDC A;  5CR0 A;  4DL6 A;  1S97 A;  4NY8 A;  4KIT B;  2Y1J A;  3Q8M A;  4NLK A;  5KT7 A;  3Q8P B;  5L1L A;  3T5L A;  5KT6 A;  5J2F A;  1X9M A;  1SKW A;  4K4H A;  3ORY A;  1XO1 A;  5D4B A;  1L5U A;  3IHQ B;  8ICU A;  5DLF A;  2UVR A;  5J2K A;  5EWF A;  1JXL A;  5DGA A;  5KFP A;  4M6W B;  3TAR A;  4RU9 A;  4QWB A;  4UB2 A;  4O3S A;  4Q8F A;  1ZQH A;  2IHM A;  3LDA A;  4DLE A;  2LYH A;  4RPX A;  1MQ3 A;  1ZQI A;  2C2E A;  4IQU A;  1WCN A;  4NLG A;  1ZQZ A;  4O5C A;  5KFM A;  2BQU A;  9ICG A;  2HHS A;  1TV9 A;  2UVU A;  2R8J A;  4I28 A;  8ICR A;  4RQ4 A;  1C7Y A;  1S77 D;  4YXJ A;  1K1S A;  4NXZ A;  3GDX A;  1KDH A;  1ZQN A;  1XWL A;  4RQ6 A;  4UAY A;  3QZ8 A;  4KLI A;  1JMS A;  1JXE A;  2ASJ A;  4IRD A;  4DOA A;  2BCV A;  2FLL A;  4QZC A;  3TFR A;  4MEX A;  8ICL A;  2MAX A;  4DF8 A;  4J9P A;  2PI5 A;  4KLO A;  4EYI B;  9ICC A;  4I2D A;  4P4P A;  5CB1 A;  5KFS A;  4Z6F A;  4M04 A;  4KMU A;  4J9K A;  2R8K A;  4DS5 A;  1ZQM A;  5KG6 A;  2HHV A;  3PO5 A;  5IIK A;  3M9N B;  1ZQO A;  4KLS A;  3PW7 A;  3TAQ A;  4DSI A;  4B9U A;  4UB1 A;  4M9G A;  3M9M B;  4M47 A;  3BDP A;  3V7K A;  4RNO A;  9ICN A;  3C1Y A;  3PW0 A;  2RDJ A;  3RB3 A;  3EWA A;  3C5F A;  9ICE A;  3C1Z A;  1S76 D;  2KFZ A;  3PX6 A;  4ED7 A;  2J6S A;  2MUT A;  3PNC A;  5J2B A;  5HHH A;  3TI0 A;  4DSL A;  4EBC A;  3RAX A;  4DFJ A;  4QZB A;  2GWS A;  2W9B B;  3KHH A;  3JPN A;  4BXO B;  4I2A A;  2OWO A;  5KFF A;  3PW4 A;  3ISB A;  2PFQ A;  8ICV A;  8ICZ A;  4ECY A;  1CUK A;  5J2I A;  2BCQ A;  5D49 A;  3MGH A;  5KFY A;  4UBB A;  3M8R A;  4PPX A;  3RRH A;  4JK1 A;  7ICI A;  2I1Q A;  1KFS A;  4RUA A;  4PGQ A;  2W9C A;  4NLZ A;  4ED0 A;  3C2M A;  1ZYQ A;  3GQC A;  4PHE A;  3UXO A;  3ISD A;  4YVZ A;  3K4G A;  4J9O A;  1ZQR A;  3EYZ A;  1ZQE A;  4C8L A;  1BPZ A;  4NLN A;  4PHD A;  2KZ3 A;  5KT4 A;  3RH4 A;  8ICX A;  4K4G A;  1V9P A;  4IQV A;  5KFN A;  4F3O A;  2ZUD A;  3MDA A;  3T3F A;  4IR9 A;  9ICF A;  1TFR A;  7ICL A;  5CJ7 A;  2IMW P;  3UXN A;  4ECT A;  1SL1 A;  2ISO A;  4Q43 A;  3PY8 A;  3V6H A;  5DLG A;  4O5E A;  4ELT A;  4YD2 A;  4DFK A; 
#chains in the Genus database with same CATH topology
 2BQ3 A;  4P2H A;  3GFK B;  3OHB A;  4J9M A;  1NI3 A;  4KLU A;  3CP8 A;  1L7P A;  1F5S A;  4YXM A;  2C22 A;  5DB8 A;  1NK7 A;  4IL6 U;  5J2H A;  2KSO B;  3THV A;  3BJY A;  1JX4 A;  4DOB A;  4RQ0 A;  3N7R C;  1X9X A;  5AKH A;  5B5E U;  9ICL A;  2DKZ A;  2RRD A;  4BJQ A;  3KFU F;  3V6K A;  9ICQ A;  5ALK A;  3VCB A;  1SL0 A;  2MSN A;  1UQV A;  8ICN A;  2D8C A;  3B0X A;  3HJE A;  4O3N A;  4O3Q A;  2NV3 A;  7ICS A;  2W3S A;  2AU0 A;  5KFZ A;  2ATL A;  4C4R A;  2HHX A;  2KTQ A;  4NWI A;  5J0W A;  4F71 A;  5KT5 A;  1ZD4 A;  4IRC A;  4P0Q B;  2KSO A;  3A0B U;  5KFL A;  4CDG A;  4X5V A;  5DG8 A;  4KLE A;  5J0U A;  3RF9 A;  4RQ8 A;  2GLE A;  4GC7 A;  5F9L A;  2KK0 A;  5K4L A;  2PMZ C;  5KFI A;  3V7L A;  5DB6 A;  4FZL A;  5TZV A;  4I2E A;  5IIO A;  2KEY A;  4YFK A;  1ZRN A;  8ICF A;  4KX5 A;  5IIN A;  3L4P A;  1ZQL A;  5AM3 A;  4Z6C A;  1NJW A;  4F5R A;  2LI6 A;  4C8N A;  4ED3 A;  4QZH A;  4KLM A;  4Q45 A;  2ZIV A;  1KFD A;  1T3N A;  4R66 A;  2ZTC A;  3EPI A;  4ACO A;  3MR2 A;  2W11 A;  4I2C A;  4KLH A;  2ALZ A;  3ZDA A;  3MR3 A;  3LVW A;  8ICA A;  2DQN B;  3LWM A;  3V6J A;  5KFV A;  3WK8 A;  3IP4 B;  2EDU A;  1S0M A;  9ICI A;  2KVC A;  3SAG A;  1DOQ A;  2Q0Z X;  5L9X A;  1CRX A;  3EZ5 A;  2G0A A;  2F3N A;  3CRX A;  4F93 B;  2VA3 A;  2XCA A;  1XC9 A;  3SEI A;  1JRO A;  2MU2 A;  2WB1 C;  2YML A;  5J2A A;  4G9B A;  5J0R A;  5ALV A;  4DSF A;  1XSL A;  2A19 A;  1QQ5 A;  4JWN A;  7ICK A;  4IRK A;  1ZXI A;  3OPX A;  4DSK A;  3D2N A;  4QWE A;  4EYH B;  1J97 A;  1KQQ A;  5KFD A;  1WG8 A;  5AIB A;  5IIM A;  1QSS A;  5ALG A;  3T5K A;  3OGU A;  1O08 A;  2KIC A;  4MFC A;  1LKY B;  2ZUC A;  4I2B A;  5AKG A;  2NRZ A;  2E1E A;  8ICP A;  2HCF A;  5DBA A;  1QTM A;  2WAQ C;  3SI8 A;  5AK6 A;  2ZJ8 A;  1FIQ A;  3H40 A;  1L8L A;  2JGA A;  4WJ3 B;  1SKS A;  1UHU A;  7ICG A;  2XIC A;  3EUB 2;  5G5G A;  9ICJ A;  3GIJ A;  4ECV A;  1KFT A;  2XVT A;  2FLN A;  8ICG A;  1A76 A;  2KKP A;  2AGP A;  2XCP A;  1PVP A;  3GIM A;  3H4D A;  2KV2 A;  5KG2 A;  2D6F C;  4UB5 A;  2JRZ A;  4F2R A;  9ICP A;  2J6T A;  4DL2 A;  2IBK A;  1TVA A;  1VDV A;  2BGW A;  3QZ7 A;  4IR1 A;  2LBO A;  4Y2S A;  2WF8 A;  2KZZ A;  4ECS A;  5EOZ A;  4F4Y A;  4ZH4 A;  5KL1 B;  3SYZ A;  1BPY A;  5EE1 A;  4AP9 A;  4ZOH C;  1QSY A;  4BDP A;  1ZQX A;  3ZDE A;  1UCV A;  3M1Y A;  4KX3 A;  3JPP A;  3WK7 A;  3F2B A;  3AU2 A;  2XY6 A;  3QEA Z;  5CP2 A;  2K4E A;  2W54 A;  4GIB A;  9ICW A;  2QB0 B;  3Q8R B;  3CW2 C;  2XGP A;  1KLN A;  4IC9 A;  5HNK A;  1L3V A;  5J0O A;  1TE2 A;  2H5X A;  4QJF B;  3V72 A;  2HOQ A;  3CNH A;  3QX7 A;  4OD0 A;  2OM6 A;  4PL1 A;  3ZDB A;  4O3O A;  2G08 A;  4QZ8 A;  3KHL A;  1PK3 A;  2NRW A;  3ZDD A;  3JPT A;  5ALT A;  4DSJ A;  2HVI A;  3N97 B;  1ZQQ A;  4CE6 A;  2A3V A;  5HML A;  2QLT A;  1PZN A;  4O5K A;  4MF2 A;  5KFC A;  3AQE A;  2BPC A;  4PJ0 U;  2HBM A;  4LZD A;  3PSP A;  3ED5 A;  4PH5 A;  4UAV A;  4GFJ A;  2IOF A;  2QB1 A;  1JIH A;  4PGX A;  4C4S A;  4QWC A;  2HDO A;  2XI9 A;  4O3R A;  1ZQB A;  5ALM A;  2FPK A;  3UXP A;  1BPD A;  3TAC B;  2HSZ A;  3JPQ A;  4ELU A;  1YZ6 A;  4DQI A;  4R64 A;  2W7P A;  1Z1B A;  9ICX A;  2B21 A;  3EPG A;  2ZIX B;  3PML A;  2BQR A;  7ICJ A;  4DQP A;  1RQL A;  3TAD C;  3H0L B;  2KZM A;  1QQ6 A;  3J81 j;  1IIP A;  4KIT B;  3E0F A;  5HR6 A;  4NLB A;  3ORY A;  1XO1 A;  5D4B A;  1N5W A;  4EX7 A;  3KKA C;  5AM2 A;  4QWB A;  1V38 A;  3H0M B;  1J2N A;  4Q8F A;  3LDA A;  4RPX A;  1WCN A;  1ZQZ A;  5EE3 A;  3GZF A;  4CRX A;  8ICR A;  3NVV A;  3L5K A;  5AIA A;  2P35 A;  1KDH A;  4KMO B;  4KLI A;  3F53 A;  3QU4 A;  2ASJ A;  5ALD A;  3NVW A;  4DOA A;  4QZC A;  2PI5 A;  1WUD A;  4I2D A;  4P4P A;  5CB1 A;  4M04 A;  3WKA A;  3M6Z A;  2R8K A;  2KP7 A;  4DS5 A;  3WU2 U;  5IIK A;  5J8Y C;  2G5H B;  3TAQ A;  4DSI A;  4UB1 A;  3M9M B;  4RNO A;  3C1Y A;  1S5L U;  3NRW A;  4DFJ A;  2GWS A;  1Q46 A;  2PFQ A;  8ICZ A;  5D49 A;  3U26 A;  4UBB A;  4JK1 A;  2I1Q A;  1JAL A;  2YB4 A;  4PGQ A;  2YMM A;  5ALL A;  2HBL A;  3C2M A;  1ZOL A;  3WK4 A;  1ZYQ A;  4PHE A;  3ISD A;  3PST A;  4C8L A;  4NLN A;  2WF9 A;  4PHD A;  1X6J A;  2Y9T A;  4K4G A;  4CGZ A;  4FZM A;  2ISO A;  3PY8 A;  3V6H A;  4PZO A;  3CYM A;  3NVZ A;  2F44 A;  3HKZ C;  4I27 A;  4F92 B;  1ZD2 P;  1SV0 C;  1RPL A;  3RH5 A;  2OCE A;  3RJJ A;  4RQN A;  1MN8 A;  4EZ6 A;  1S9F A;  4QW8 A;  2E8M A;  2PMZ F;  4Q44 A;  1L8O A;  2BR0 A;  3AM9 A;  1FEZ A;  2LYA A;  4PL2 A;  4F2S A;  1N5X A;  2Y9U A;  1NK9 A;  1CEZ A;  5DBC A;  4IQW A;  2JZB A;  3NRZ A;  1FFV A;  2A1J A;  3BZK A;  2FJ6 A;  2JXJ A;  2YB1 A;  1L7N A;  2YMP A;  2HHW A;  1U47 A;  2B0C A;  3RR7 A;  7ICP A;  4BUG A;  2ZIW B;  1D8B A;  4DL4 A;  1PK1 B;  4DF4 A;  3Q8S B;  1NJZ A;  4B9L A;  7ICH A;  1ARO P;  3LVV A;  5KT2 A;  4Y2X A;  1L7O A;  3WKB A;  1SZP A;  3BQ1 A;  2AQ4 A;  4DSE A;  4J9L A;  1X42 A;  3RJG A;  1KL9 A;  3OJS A;  1SXD A;  4ED6 A;  1TK8 A;  8ICM A;  4KLL A;  1BVS A;  4BX9 C;  4YR3 A;  2JH7 A;  2R18 A;  3MGI A;  1XNS A;  2JEF A;  4R8U B;  1MQ2 A;  4QIW F;  3MC1 A;  2LM4 A;  3PV8 A;  7ICM A;  2DPJ A;  2FMP A;  1Z00 A;  3E58 A;  2ZJ5 A;  4TQS A;  1Q3V A;  2YX8 A;  2EZZ A;  1NK6 A;  4F72 A;  5AI4 A;  2BCS A;  3L3F X;  5AKE A;  4OJL A;  4R65 A;  3OHA A;  5J0Y A;  5EE9 A;  2F76 X;  2HI0 A;  3N7P D;  4KN7 A;  2HW3 A;  1ZQG A;  4I29 A;  2KE7 A;  5J0X A;  4F5Q A;  3WK9 A;  1FO4 A;  2VAN A;  4RQ5 A;  2AQ0 A;  5KFB A;  2HHT A;  1C20 A;  7ICU A;  4M9L A;  1Z3E B;  2C28 A;  4C0Z A;  5KFE A;  2VJ4 A;  3A0H U;  4RQ3 A;  3GV8 B;  2R8G A;  3DEE A;  3C2L A;  8ICJ A;  1Y88 A;  3RFA A;  2RDI A;  1KRP A;  1UT5 A;  2ZIU B;  5AIC A;  2AGO A;  4EZ9 A;  4J9R A;  3OSN A;  1EXN A;  2WAQ F;  2QAR B;  2WFA A;  1SGG A;  5L1I A;  4UW9 A;  1PVQ A;  3G6Y A;  9ICR A;  1U45 A;  5CHG A;  4UB4 A;  1RXW A;  1OUQ A;  2RQ5 A;  5DGB A;  1D8Y A;  2W9B A;  3RBD A;  4DWI A;  4KLJ A;  1TK5 A;  4BXO A;  1NZP A;  4XUS A;  2RP5 A;  1MA7 A;  2BKE A;  4Z6E A;  5KG4 A;  2FMQ A;  1ZQA A;  2KJ5 A;  2W9A A;  1KTQ A;  2BDU A;  2E1F A;  1SIJ A;  4UQG A;  1SWW A;  1NK8 A;  1NZB A;  7ICN A;  4DFM A;  9ICB A;  2V4R A;  5AI5 A;  5AKI A;  3MFI A;  4Y2R A;  3SZ2 A;  4DFP A;  3SEN A;  1BPB A;  2ES6 A;  4QW9 A;  4ELV A;  5AHX A;  3TKA A;  3IG5 A;  1IV8 A;  4FZN A;  5HR7 A;  3UMB A;  4RNM A;  4QZE A;  3IN5 A;  3E2E A;  3BQ7 A;  4JV0 A;  2HBK A;  1XSP A;  1X66 A;  1S10 A;  2G09 A;  4DQQ A;  3AUO A;  3ZD9 A;  4P4O A;  5J0S A;  5KFJ A;  2ODG A;  3UPQ A;  3TAN A;  4FBU A;  4J9N A;  7ICO A;  2KG5 A;  1MSW D;  4DOC A;  1V97 A;  3PVX A;  2K8B B;  4UBC A;  2W9C B;  3JPS A;  3OTQ A;  2PFN A;  4BWJ A;  4F5P A;  2UVW A;  5BPC A;  2KN7 A;  4M9H A;  2FMS A;  4C8M A;  2V9W A;  2FI1 A;  4ECR A;  2H3F A;  5KG3 A;  4B9T A;  4Y2T A;  4P0Q A;  3Q8K A;  5DG9 A;  2BHN A;  3RTV A;  2HMX A;  2H3Z A;  1ZQU A;  1SB3 C;  3ISC A;  4YMM A;  2JEI A;  4GC6 A;  5DBB A;  2WHE A;  2JHD A;  2M0N A;  3MFH A;  1K5O A;  3TFS A;  5CA7 A;  3ONN A;  4O9M A;  4JUZ A;  4UAZ A;  3F5A A;  1IM4 A;  2H3V A;  1YT3 A;  1WYG A;  5KFT A;  2AXT U;  2Q4T A;  4QIW C;  3UQ2 A;  1ZQD A;  2FPL A;  1TAU A;  3UMC A;  4J9S A;  5ALE A;  3H8W A;  4NV0 A;  8ICO A;  4NJ8 A;  4UB6 U;  1NJY A;  9ICO A;  4UAW A;  2KJ8 A;  2IHN A;  5CWR A;  3RH6 A;  4AYB C;  3HP6 A;  5AM0 A;  1RQN A;  1SWV A;  2KKV A;  3PR4 A;  2NRV A;  5J0P A;  5L1J A;  1TK0 A;  1X9W A;  5AKY A;  3B9J A;  3MR6 A;  3RR8 A;  2V4Q A;  1HUO A;  2F1H A;  2DL0 A;  3V7J A;  2W8K A;  4KLD A;  4U6P A;  1OW5 A;  3JPO A;  4QZ9 A;  1ZQY A;  3PW5 A;  4RQ7 A;  3NUQ A;  4XA5 A;  4YG2 A;  1M6Y A;  3IM1 A;  4O3M A;  4YQW A;  5AKX A;  4F4Z A;  2KIW A;  3BS5 B;  2W55 A;  1BNP A;  4RNN A;  2ZTE A;  4NY8 A;  3MR5 A;  3Q8M A;  2YMQ A;  4A8E A;  3IRU A;  5KT6 A;  5J2F A;  1LVH A;  1JXL A;  4CF3 A;  1FFU A;  4M6W B;  5ALR A;  2KJ9 A;  1MQ3 A;  2KIV A;  2LYH A;  1ZQI A;  3K1R B;  4O5C A;  5KFM A;  2BQU A;  4NL9 A;  4I28 A;  1LKY A;  4OO1 J;  3QZ8 A;  2B6G A;  2BCV A;  2FLL A;  3TFR A;  4MEX A;  2MAX A;  4EYI B;  3K1Z A;  5ALY A;  4J9K A;  3HKZ F;  5KG6 A;  4KLS A;  2AH5 A;  4B9U A;  3PW0 A;  3EWA A;  3C5F A;  3C1Z A;  4MHV A;  2CN1 A;  2EQY A;  3AN1 A;  4DSL A;  3TI0 A;  1X6I A;  2OHF A;  3KHH A;  2ESE A;  8ICV A;  4ECY A;  2BCQ A;  5KFY A;  2E3T A;  3RRH A;  3VC8 A;  4US8 A;  3GQC A;  2Z7J A;  3K4G A;  2DBY A;  3EYZ A;  3WKC A;  8ICX A;  1V9P A;  4IQV A;  4F3O A;  1O03 A;  2ZUD A;  7ICL A;  5CJ7 A;  2IMW P;  4ECT A;  1SL1 A;  4EEL A;  1B4F A;  3WKE A;  5AM4 A;  4DCC A;  1RXV A;  1YZ7 A;  3O0F A;  4ECQ A;  1AQ6 A;  4DFD A;  2QB0 A;  4YN4 A;  4LVS A;  3HIL A;  5KAI U;  3PZP A;  3H8S A;  1T7P A;  5BOM A;  2P6R A;  1ZQ1 C;  4I2H A;  2AHO B;  1P7D A;  4OJO A;  8ICC A;  1TAQ A;  9ICK A;  4FFD A;  1UT8 A;  1S0N A;  5J2C A;  1KBU A;  3RRG A;  2VA8 A;  4ECX A;  3GU3 A;  5AM5 A;  4EEK A;  1ZQK A;  3IDW A;  2XY7 A;  1UPH A;  2W9M A;  2F8K A;  4O3P A;  2HHQ A;  3KTQ A;  5J0T A;  1S0O A;  4XRH A;  5AKJ A;  4I2J A;  4TUP A;  8ICB A;  2E8O A;  5AI9 A;  1RYU A;  1TAM A;  4F91 B;  4YCX A;  5AKK A;  5JTI A;  4I2F A;  4B9N A;  4NLC A;  1ZET A;  4UAT A;  1SV4 A;  1F0M A;  2ZIX A;  3D6J A;  5B66 U;  5ALN A;  1NKE A;  3UQ0 A;  3Q8L A;  1RG6 A;  3KOO A;  4FO6 A;  2DKX A;  1DGJ A;  2EAO A;  3N7S C;  4OJ6 A;  3QUQ A;  5AK5 A;  5BOL A;  4OJP A;  1Z4N A;  3AMZ A;  5FP0 A;  4ECZ A;  4ED1 A;  2NYV A;  2KNJ A;  4FE3 A;  3PMN A;  3SV3 A;  2E8N A;  8ICK A;  3WK6 A;  3KHG A;  1T8E A;  1L3T A;  1SZH A;  5C0Y A;  2JR5 A;  2ZTD A;  2KFN A;  3NGD A;  1KW4 A;  1XO0 A;  5KFO A;  4UAR A;  3HT3 A;  5J29 A;  9ICT A;  1DK3 A;  4RT3 A;  2YTU A;  4J9Q A;  2HVH A;  4B6J A;  4DL7 A;  2BPG A;  4DL3 A;  1KKX A;  1QH9 A;  4KLT A;  4JMU A;  1SXE A;  3HX0 A;  5ALI A;  2JEJ A;  3RJF A;  3ALR A;  2VJ5 A;  4C4T A;  5DG7 A;  3BQ0 A;  1D9F A;  4PGY A;  3BZC A;  1ZJN A;  1RZT A;  4F8R A;  3D2S A;  3NAS A;  3PW2 A;  3T5J A;  3TQ1 A;  4Y2Q A;  4YD1 A;  3D2Q A;  2XY5 A;  2PFP A;  2BDP A;  1H38 A;  5HMM A;  2KMD A;  3C2K A;  5C5J A;  4Y2P A;  4U7C A;  2XO7 A;  4P0P B;  4CF4 A;  4YMN A;  3KD3 A;  4JB3 A;  1Q3U A;  4UAS A;  3KZX A;  3WK5 A;  3QEB Z;  3ETL A;  3GV7 B;  8ICE A;  7ICE A;  1N62 A;  3FYH A;  3TAP A;  3RBE A;  1Z1V A;  3C28 A;  4M2Y A;  1ED1 A;  3OSP A;  1XU4 A;  2PFO A;  2G5I B;  2F2A B;  3RB0 A;  3RJK A;  4ED8 A;  2IOH A;  4JWM A;  1D8L A;  4TUS A;  4TQR A;  4IQT A;  2GOL A;  1ZQP A;  7ICF A;  4CNQ A;  4BWM A;  4C8O A;  4QZI A;  4CF5 A;  5KG7 A;  2K89 A;  3T5H A;  2W8L A;  2W7O A;  3WKD A;  5CEH A;  2D3D A;  2ASD A;  1NK4 A;  2MUT B;  2P6U A;  1B22 A;  4RQM A;  2F77 X;  4YR2 A;  4MF8 A;  4FBT A;  4DS4 A;  2ZIW A;  2E5S A;  4FS2 A;  9ICU A;  1PK1 A;  5KNI A;  4IS7 A;  4F5N A;  4AYB F;  1B0X A;  2W43 A;  4Y2U A;  2Y1I A;  8ICT A;  5J0Q A;  1NKB A;  1OXJ A;  1GO3 F;  1QCK A;  3SMV A;  4YP3 A;  2K60 A;  3BS7 A;  4Y2Y A;  4F50 A;  5III A;  5AK4 A;  4Y2J A;  4QZD A;  4NM1 A;  5KFA A;  9ICS A;  4R8U A;  7ICV A;  3B0Y A;  5DQG A;  2CXY A;  5ALU A;  4XQ8 A;  1HEK A;  4TUQ A;  2I5H A;  3G6X A;  4JV2 A;  2HBJ A;  5AM1 A;  4HYK A;  2IOF K;  2IA6 A;  1L7M A;  2FDR A;  3GV5 B;  3H4B A;  3AU6 A;  3BQT A;  1PUZ A;  1PVR A;  3GIL A;  5KFH A;  8ICI A;  5ALQ A;  2LMR A;  5AI8 A;  7ICT A;  3FC4 A;  4ICA A;  5G5H A;  4FS1 A;  1HJP A;  1DK2 A;  4KLQ A;  3HPO A;  3RB6 A;  2PKE A;  1N63 A;  3QE9 Y;  3RAQ A;  5AKL A;  5DKW A;  3PX0 A;  4PHA A;  3KHR A;  2DPI A;  2HHU A;  2M9N A;  4DO9 A;  3AL0 B;  2F1J A;  2ZIU A;  2ZJA A;  5KTQ A;  3LK9 A;  2F8L A;  2QAR A;  2BCU A;  2XC9 A;  2OEH A;  2PXI A;  8ICY A;  5KG0 A;  3QUB A;  1DRG A;  3M9O B;  1WWV A;  1MC8 A;  4YR0 A;  1BGX T;  3DV9 A;  5DQH A;  2LKY A;  1COK A;  1NK5 A;  4UB3 A;  4UAU A;  1L6N A;  2UVV A;  1IXR A;  1S97 A;  4DL6 A;  5CR0 A;  2Y1J A;  4NLK A;  3KZI U;  5L1L A;  2KHV A;  4K4H A;  1L5U A;  8ICU A;  3KBB A;  2UVR A;  5EWF A;  2NO5 A;  2KHQ A;  1N60 A;  1HIW A;  2EZX A;  3DDH A;  5DGA A;  3SAH A;  4RU9 A;  2ZIV B;  4UB2 A;  2E8P A;  1ZQH A;  4DLE A;  1ZD3 A;  1WWU A;  3QUC A;  2C2E A;  4IQU A;  4NLG A;  9ICG A;  4OCZ A;  4YXJ A;  1K1S A;  4RQ6 A;  2H3I A;  4UAY A;  3F2C A;  1JXE A;  2LYB A;  8ICL A;  4KLO A;  4Z6F A;  4KMU A;  1ZQM A;  2L5Y A;  2HHV A;  1V85 A;  2LHT A;  5E79 U;  1ECW A;  4M9G A;  4M47 A;  1N61 A;  2EZY A;  3QNM A;  3BDP A;  3V7K A;  3RB3 A;  3H8M A;  3QU2 A;  1S76 D;  5A0L A;  5KL8 B;  4ED7 A;  3PNC A;  5J2B A;  5HHH A;  3QYP A;  3JPN A;  2OWO A;  4C7Y A;  3PW4 A;  3ISB A;  1CUK A;  2YN4 A;  4PPX A;  7ICI A;  1KFS A;  2WF7 A;  5JRT A;  2W9C A;  4NLZ A;  1NNL A;  4ED0 A;  4J9O A;  1ZQR A;  1ZQE A;  1BPZ A;  2XID A;  5KT4 A;  2OXO A;  3RH4 A;  2ZG6 A;  9ICF A;  3MDA A;  3T3F A;  4IR9 A;  3UXN A;  4Q43 A;  5ALO A;  2JH1 A;  5DLG A;  3AQF A;  4YD2 A;  3PSI A;  4GXI A;  2ASL A;  2VA2 A;  4EX6 A;  4P4M A;  2Y0S F;  5AI0 A;  5DQI A;  2K4H A;  2DFL A;  1HUZ A;  4EBD A;  4GXJ A;  5L1M A;  4MFA A;  1TKD A;  3RJI A;  4RPY A;  2BPF A;  2KVS A;  3HWT A;  4J03 A;  5D46 A;  1N56 A;  2I9G A;  3M6K A;  4M9J A;  3QUT A;  1WCL A;  3SQI A;  1U4B A;  2EAN A;  1S0V A;  9ICV A;  5DDM A;  2DWQ A;  2HOF A;  4RZR A;  1SKR A;  3ZD8 A;  2W04 A;  2EH9 A;  3OJU A;  3AEV A;  3PX4 A;  5KFU A;  2NRX A;  3RJE A;  1QLN A;  1ZRM A;  2JEG A;  5IIJ A;  4K4I A;  2AJQ A;  1KSP A;  1Q8K A;  2O6K A;  3T79 A;  2PI4 A;  5KAF U;  1KEJ A;  5J2G A;  9ICE A;  5AI6 A;  4KN4 A;  3RB4 A;  4M0A A;  1L3U A;  1K1Q A;  3I28 A;  4Y2V A;  5CRX A;  5ALW A;  2EAP A;  4RQ1 A;  1D9D A;  4Q8E A;  2N1R A;  5KFX A;  4TUR A;  4DQS A;  4C8K A;  5J2E A;  5EWE A;  3QU5 A;  4GLX A;  5DB7 A;  5HHI A;  4F4W A;  3IG8 A;  4RT2 A;  1RDF A;  3TAD A;  3ETR A;  7ICR A;  4B9M A;  3N28 A;  2AGQ A;  3JPR A;  3BS5 A;  5L1K A;  2BCR A;  3ICX A;  3HRD D;  4F4X A;  9ICM A;  2W03 A;  4USA A;  2XGQ A;  4B9V A;  3QXG A;  4DLG A;  3M7D A;  3KKA A;  1U9L A;  2J6U A;  1S8O A;  4CCH A;  1B43 A;  5DB9 A;  4M6W A;  2HOI A;  3PSF A;  4QZA A;  1U49 A;  5KG5 A;  2R8I A;  5KFK A;  1L3S A;  4EBE A;  2R8H A;  5EE0 A;  4O0I A;  1NK0 A;  1XSN A;  4GXK A;  5JU5 A;  3ZDC A;  3ZI4 A;  1KN5 A;  4E0D A;  2I6X A;  3MAB A;  3PO4 A;  4QNL A;  2KOB A;  5KG1 A;  2MRL A;  5J8Y A;  2DGZ A;  5GTI U;  4KLG A;  1A0P A;  4I2G A;  4QZG A;  5IIL A;  3NTU A;  4KTQ A;  3G6V A;  2K4P A;  1ZJM A;  4F5O A;  1Z19 A;  3MBY A;  2ISP A;  5EWG A;  3N4M B;  2DF4 B;  5AK3 A;  2RHF A;  8ICQ A;  1LB2 B;  3RJH A;  1VLB A;  5AKZ A;  4YMO A;  3GIK A;  2NO4 A;  4C7Z A;  3GII A;  4QWD A;  3C29 A;  4RQ2 A;  1UA0 A;  4M9N A;  2P66 A;  5KFR A;  2MA1 A;  3C21 A;  2ZXI A;  4UB8 U;  1COO A;  2K8A A;  2YQE A;  3Q8Q B;  2C2R A;  4C80 A;  4I2I A;  3BQ2 A;  2C2D A;  1XS9 D;  2ZUB A;  1UA1 A;  2A1A A;  2BZF A;  1NKC A;  4NL9 C;  1BPX A;  4ED2 A;  3HW8 A;  1SV0 A;  3H7I A;  2OYY A;  4HAI A;  1T4G A;  1ZQV A;  3UM9 A;  4ECU A;  2Y0S C;  4G3I A;  1Z4O A;  3SD7 A;  1X9S A;  9ICA A;  8ICW A;  2F1I A;  2LM1 A;  8ICH A;  3C23 A;  1SL2 A;  5JUM A;  1N48 A;  1JI7 A;  1RYS A;  5J2J A;  2VKQ A;  3K75 D;  4EEY A;  5KFW A;  2W3R A;  2LPE A;  4DEZ A;  4R63 A;  1J2M A;  4Z6D A;  2G07 A;  1X2I A;  2KD1 A;  3C5G A;  4KLF A;  1BPE A;  3NS1 A;  7ICQ A;  4DL5 A;  1ZQS A;  1NOM A;  1BNO A;  3FAH A;  3SV4 A;  1ZQC A;  2VIX A;  1ZQJ A;  5ALZ A;  2YY6 A;  1NJX A;  3I1Y A;  4RPZ A;  5F3X B;  2G06 A;  3F5E A;  1ZQW A;  2FLP A;  1X40 A;  3NVY A;  1VJ5 A;  4DQR A;  3S6J A;  5KFQ A;  5ALF A;  4PZN A;  3UMG A;  5ALP A;  1CI4 A;  4BGD A;  1QSL A;  4JV1 A;  4MFF A;  2WTF A;  1A77 A;  4NM2 A;  4QWA A;  1LV5 A;  1N2X A;  1RM6 C;  5F9N A;  5KT3 A;  3M8S A;  2CPR A;  2JZB B;  2FPM A;  1IG6 A;  1JN3 A;  2A1J B;  1JUD A;  4LJX A;  3LWL A;  2DUY A;  4PHP A;  8ICS A;  5DDY A;  3SR6 A;  4B9S A;  2ZXH A;  4F4K A;  4ECW A;  3PR5 B;  2JMG A;  3FM9 A;  2GH1 A;  3H8J A;  4OJ5 A;  1URJ A;  9ICH A;  1ZD5 A;  1U48 A;  1ZQF A;  1RYR A;  4MEY A;  1DXS A;  2NRT A;  3FDS A;  5KFG A;  2QKQ A;  1ZQT A;  2CRX A;  3QU9 A;  4RUC A;  3EW9 A;  3IV6 A;  4LZG A;  4QZF A;  5ALH A;  3MGV A;  5HP4 A;  5ALX A;  5J2D A;  1Z00 B;  3SAF A;  1DGS A;  3MDC A;  1F44 A;  5KT7 A;  3Q8P B;  3T5L A;  4P0P A;  1X9M A;  1SKW A;  3IHQ B;  5DLF A;  5GTH U;  2GO7 A;  5J2K A;  5KFP A;  5TIS U;  3TAR A;  1T3Q A;  3H0R B;  4O3S A;  2IHM A;  2HHS A;  2WF5 A;  1TV9 A;  2UVU A;  2R8J A;  5T14 A;  4RQ4 A;  1C7Y A;  1S77 D;  2FE9 A;  2K8C B;  4NXZ A;  3GDX A;  1ZQN A;  1XWL A;  1JMS A;  4EEN A;  5ALJ A;  4IRD A;  4DF8 A;  4J9P A;  9ICC A;  5KFS A;  4US9 A;  1JRP A;  3PO5 A;  2H3Q A;  3M9N B;  1ZQO A;  3PW7 A;  2WB1 F;  5ALS A;  9ICN A;  2RDJ A;  2WF6 A;  3QU7 A;  2KFZ A;  5H2F U;  3PX6 A;  3R9K A;  2J6S A;  2MUT A;  4EBC A;  3RAX A;  1T94 A;  4QZB A;  2W9B B;  2RLT A;  4BXO B;  4I2A A;  1A6S A;  5KFF A;  5J2I A;  2JV3 A;  3MGH A;  3M8R A;  4RUA A;  2EAM A;  2OH2 A;  3UXO A;  4YVZ A;  2KZ3 A;  3LYS A;  5KFN A;  2K4I A;  1TFR A;  3F2D A;  1QQ7 A;  3I76 A;  4O5E A;  4ELT A;  4DFK A; 
#chains in the Genus database with same CATH homology
 2BQ3 A;  4P2H A;  3GFK B;  4GXI A;  3OHB A;  2ASL A;  1RXV A;  2VA2 A;  4J9M A;  4KLU A;  4ECQ A;  4P4M A;  4YXM A;  5DQI A;  4YN4 A;  4LVS A;  4I27 A;  4F92 B;  2DFL A;  1HUZ A;  4EBD A;  2C22 A;  5DB8 A;  1RPL A;  1NK7 A;  3RH5 A;  4GXJ A;  3RJJ A;  3H8S A;  1T7P A;  4MFA A;  1TKD A;  4EZ6 A;  1S9F A;  4QW8 A;  4Q44 A;  5J2H A;  5BOM A;  2P6R A;  3RJI A;  3THV A;  4RPY A;  3BJY A;  4DOB A;  4RQ0 A;  1JX4 A;  2BR0 A;  4I2H A;  2BPF A;  4F2S A;  3HWT A;  5D46 A;  1N56 A;  2I9G A;  8ICC A;  1TAQ A;  9ICL A;  4M9J A;  9ICK A;  1UT8 A;  1S0N A;  1WCL A;  3V6K A;  1U4B A;  1S0V A;  9ICQ A;  9ICV A;  5J2C A;  3RRG A;  1SL0 A;  1NK9 A;  1CEZ A;  5DBC A;  2VA8 A;  4ECX A;  4IQW A;  2JZB A;  5DDM A;  4RZR A;  1SKR A;  2A1J A;  3ZD8 A;  8ICN A;  1ZQK A;  2XY7 A;  2HHW A;  3B0X A;  3OJU A;  1U47 A;  4O3N A;  5KFU A;  3PX4 A;  2NRX A;  3RJE A;  4O3Q A;  3RR7 A;  1QLN A;  7ICP A;  2JEG A;  2W9M A;  4O3P A;  5IIJ A;  4K4I A;  2AJQ A;  1KSP A;  2HHQ A;  3KTQ A;  4DL4 A;  7ICS A;  1NJZ A;  4DF4 A;  3Q8S B;  2PI4 A;  4B9L A;  2AU0 A;  7ICH A;  1KEJ A;  5J0T A;  5J2G A;  5KFZ A;  1S0O A;  1ARO P;  5KT2 A;  2ATL A;  4KN4 A;  3RB4 A;  2KTQ A;  4XRH A;  4M0A A;  2HHX A;  1L3U A;  1K1Q A;  4I2J A;  1SZP A;  5J0W A;  3BQ1 A;  4TUP A;  2AQ4 A;  5KT5 A;  4RQ1 A;  8ICB A;  1D9D A;  4DSE A;  4Q8E A;  4IRC A;  4J9L A;  3RJG A;  5KFX A;  3OJS A;  5KFL A;  4TUR A;  4ED6 A;  4X5V A;  1TK8 A;  5DG8 A;  4KLE A;  5J0U A;  8ICM A;  4KLL A;  1BVS A;  4RQ8 A;  4DQS A;  4F91 B;  5EWE A;  4YCX A;  5J2E A;  5DB7 A;  4GLX A;  4C8K A;  4YR3 A;  5HHI A;  4GC7 A;  5F9L A;  4I2F A;  3MGI A;  4F4W A;  4B9N A;  1ZET A;  2JEF A;  4RT2 A;  5KFI A;  4R8U B;  1MQ2 A;  3V7L A;  1NKE A;  7ICR A;  5DB6 A;  4B9M A;  2AGQ A;  3UQ0 A;  3Q8L A;  3PV8 A;  7ICM A;  3JPR A;  5L1K A;  4FO6 A;  2DPJ A;  2FMP A;  1Z00 A;  5TZV A;  2BCR A;  2ZJ5 A;  4I2E A;  4TQS A;  5IIO A;  5BOL A;  4F4X A;  4YFK A;  9ICM A;  1NK6 A;  2XGQ A;  5IIN A;  8ICF A;  4B9V A;  2BCS A;  4DLG A;  4ECZ A;  4ED1 A;  1ZQL A;  1U9L A;  4R65 A;  3OHA A;  2J6U A;  4Z6C A;  3PMN A;  5J0Y A;  3SV3 A;  1NJW A;  4F5R A;  4CCH A;  4KN7 A;  4C8N A;  2HW3 A;  1ZQG A;  8ICK A;  4ED3 A;  4I29 A;  3KHG A;  1B43 A;  5DB9 A;  4QZH A;  1T8E A;  5J0X A;  4M6W A;  1L3T A;  4Q45 A;  4F5Q A;  4KLM A;  2VAN A;  2ZTD A;  4RQ5 A;  1KFD A;  2AQ0 A;  4QZA A;  5KFB A;  1U49 A;  5KG5 A;  3NGD A;  2KFN A;  2R8I A;  5KFK A;  1T3N A;  4R66 A;  4EBE A;  2R8H A;  1L3S A;  2HHT A;  4O0I A;  7ICU A;  5KFO A;  2ZTC A;  4M9L A;  1Z3E B;  3EPI A;  2C28 A;  1NK0 A;  3HT3 A;  3MR2 A;  1XSN A;  5KFE A;  5J29 A;  4I2C A;  4GXK A;  4KLH A;  2ALZ A;  3ZDA A;  3MR3 A;  3ZDC A;  9ICT A;  4RT3 A;  4J9Q A;  2HVH A;  8ICA A;  4RQ3 A;  3GV8 B;  4DL7 A;  2BPG A;  2R8G A;  4DL3 A;  3LWM A;  3C2L A;  4E0D A;  4KLT A;  3V6J A;  5KFV A;  3MAB A;  8ICJ A;  1Y88 A;  3HX0 A;  3PO4 A;  2JEJ A;  3RJF A;  5KG1 A;  2RDI A;  1KRP A;  1UT5 A;  2AGO A;  4KLG A;  1S0M A;  5DG7 A;  4EZ9 A;  9ICI A;  4I2G A;  4J9R A;  4QZG A;  1EXN A;  3OSN A;  5IIL A;  3NTU A;  4KTQ A;  3G6V A;  3BQ0 A;  1D9F A;  4PGY A;  1ZJN A;  1ZJM A;  5L1I A;  1RZT A;  4F5O A;  1DOQ A;  4F8R A;  3MBY A;  3PW2 A;  2ISP A;  2Q0Z X;  5EWG A;  5L9X A;  3G6Y A;  3T5J A;  3TQ1 A;  9ICR A;  1U45 A;  3EZ5 A;  3N4M B;  5CHG A;  4UB4 A;  1RXW A;  4F93 B;  2VA3 A;  5DGB A;  4YD1 A;  2XCA A;  1XC9 A;  1LB2 B;  2W9B A;  1D8Y A;  3RBD A;  3RJH A;  5J2A A;  8ICQ A;  4DWI A;  4KLJ A;  1TK5 A;  4BXO A;  5J0R A;  4XUS A;  4YMO A;  3GIK A;  2XY5 A;  2PFP A;  3GII A;  4DSF A;  1XSL A;  1H38 A;  2BDP A;  2BKE A;  4Z6E A;  5KG4 A;  5HMM A;  4QWD A;  2FMQ A;  4IRK A;  4JWN A;  1ZQA A;  7ICK A;  3C2K A;  4RQ2 A;  5C5J A;  4DSK A;  1UA0 A;  2XO7 A;  4M9N A;  4YMN A;  2P66 A;  4QWE A;  4EYH B;  2W9A A;  1KTQ A;  5KFR A;  4UQG A;  3C21 A;  5KFD A;  3QEB Z;  1NK8 A;  1COO A;  4DFM A;  7ICN A;  3ETL A;  9ICB A;  3Q8Q B;  5IIM A;  3GV7 B;  2C2R A;  2V4R A;  4I2I A;  3BQ2 A;  2C2D A;  1QSS A;  1XS9 D;  8ICE A;  7ICE A;  2ZUB A;  3T5K A;  1UA1 A;  3FYH A;  3OGU A;  3MFI A;  3TAP A;  3RBE A;  3SZ2 A;  4MFC A;  1NKC A;  4M2Y A;  4DFP A;  2ZUC A;  3OSP A;  1XU4 A;  4ED2 A;  1BPX A;  2PFO A;  1BPB A;  3HW8 A;  4I2B A;  4QW9 A;  2NRZ A;  4ELV A;  3RB0 A;  3RJK A;  8ICP A;  3H7I A;  4ED8 A;  4JWM A;  1D8L A;  5DBA A;  1QTM A;  4TUS A;  4TQR A;  1T4G A;  3SI8 A;  4IQT A;  4RNM A;  4QZE A;  2ZJ8 A;  3E2E A;  1ZQV A;  4ECU A;  4JV0 A;  3H40 A;  1ZQP A;  7ICF A;  4G3I A;  4BWM A;  1XSP A;  1SKS A;  4QZI A;  4C8O A;  1X9S A;  5KG7 A;  7ICG A;  9ICA A;  1S10 A;  8ICW A;  9ICJ A;  3GIJ A;  2F1I A;  2W8L A;  4ECV A;  3T5H A;  8ICH A;  4DQQ A;  3AUO A;  3C23 A;  3ZD9 A;  1SL2 A;  4P4O A;  1KFT A;  5JUM A;  5J0S A;  1N48 A;  1B22 A;  5KFJ A;  2ASD A;  1RYS A;  5J2J A;  1NK4 A;  3K75 D;  2MUT B;  3UPQ A;  4EEY A;  2FLN A;  8ICG A;  2P6U A;  5KFW A;  3TAN A;  1A76 A;  4DEZ A;  4R63 A;  4FBU A;  2AGP A;  4J9N A;  4Z6D A;  4YR2 A;  1MSW D;  4MF8 A;  2XCP A;  4FBT A;  7ICO A;  4DOC A;  3GIM A;  3H4D A;  4DS4 A;  1X2I A;  5KG2 A;  4UB5 A;  3C5G A;  3PVX A;  4KLF A;  4UBC A;  4F2R A;  2W9C B;  4FS2 A;  9ICP A;  1BPE A;  3JPS A;  9ICU A;  2PFN A;  4BWJ A;  4F5P A;  4DL2 A;  2J6T A;  2UVW A;  2IBK A;  1TVA A;  5BPC A;  2KN7 A;  4F5N A;  4M9H A;  2FMS A;  7ICQ A;  4DL5 A;  2BGW A;  3QZ7 A;  4IR1 A;  4C8M A;  1ZQS A;  2V9W A;  1NOM A;  4ECR A;  3SV4 A;  2Y1I A;  5J0Q A;  1ZQC A;  8ICT A;  2KZZ A;  1NKB A;  4ECS A;  5EOZ A;  4F4Y A;  4ZH4 A;  5KG3 A;  3SYZ A;  1BPY A;  1ZQJ A;  4B9T A;  1NJX A;  3Q8K A;  5DG9 A;  2BHN A;  4YP3 A;  3RTV A;  1QSY A;  4BDP A;  1ZQX A;  3ZDE A;  4RPZ A;  3JPP A;  4F50 A;  5III A;  3AU2 A;  1ZQW A;  1ZQU A;  2XY6 A;  3QEA Z;  3ISC A;  5CP2 A;  4QZD A;  4YMM A;  2JEI A;  4NM1 A;  4GC6 A;  2FLP A;  5KFA A;  4DQR A;  9ICS A;  9ICW A;  4R8U A;  5KFQ A;  5DBB A;  7ICV A;  3Q8R B;  3B0Y A;  3MFH A;  5DQG A;  2XGP A;  3TFS A;  4XQ8 A;  5CA7 A;  4TUQ A;  3G6X A;  1KLN A;  4BGD A;  1QSL A;  4JV2 A;  4HYK A;  5HNK A;  1L3V A;  4JV1 A;  5J0O A;  4O9M A;  4JUZ A;  4UAZ A;  2IA6 A;  2WTF A;  4MFF A;  1A77 A;  1IM4 A;  2H5X A;  3V72 A;  5KFT A;  4NM2 A;  3GV5 B;  4QWA A;  3UQ2 A;  3H4B A;  1LV5 A;  1ZQD A;  2FPL A;  3AU6 A;  1TAU A;  3BQT A;  4J9S A;  3ZDB A;  4O3O A;  3KHL A;  4QZ8 A;  3H8W A;  5F9N A;  3GIL A;  2NRW A;  5KT3 A;  3M8S A;  3ZDD A;  3JPT A;  5KFH A;  8ICI A;  8ICO A;  4DSJ A;  2JZB B;  2FPM A;  1NJY A;  2HVI A;  7ICT A;  9ICO A;  1JN3 A;  2A1J B;  4UAW A;  2IHN A;  5CWR A;  3N97 B;  1ZQQ A;  4FS1 A;  1HJP A;  5HML A;  3RH6 A;  1PZN A;  4O5K A;  4KLQ A;  3LWL A;  3HPO A;  3RB6 A;  3HP6 A;  8ICS A;  4PHP A;  4MF2 A;  5KFC A;  5DDY A;  2BPC A;  3QE9 Y;  4B9S A;  3RAQ A;  3PR4 A;  2NRV A;  4LZD A;  4F4K A;  5J0P A;  5L1J A;  5DKW A;  4ECW A;  1TK0 A;  3PR5 B;  3H8J A;  4PH5 A;  3PX0 A;  1X9W A;  9ICH A;  3MR6 A;  4PHA A;  3KHR A;  1U48 A;  2DPI A;  2V4Q A;  1HUO A;  3RR8 A;  1ZQF A;  1RYR A;  2HHU A;  1JIH A;  2M9N A;  4MEY A;  4PGX A;  4QWC A;  2F1H A;  4DO9 A;  4O3R A;  2F1J A;  1ZQB A;  3V7J A;  2NRT A;  2ZJA A;  2W8K A;  4KLD A;  2FPK A;  3FDS A;  5KTQ A;  3LK9 A;  5KFG A;  1ZQT A;  3JPO A;  3UXP A;  1BPD A;  3JPQ A;  4QZ9 A;  2BCU A;  2XC9 A;  4ELU A;  2PXI A;  1ZQY A;  3PW5 A;  4RQ7 A;  4DQI A;  4RUC A;  8ICY A;  4XA5 A;  4R64 A;  4YG2 A;  9ICX A;  5KG0 A;  3EW9 A;  2B21 A;  3EPG A;  3IM1 A;  3PML A;  3M9O B;  1MC8 A;  4LZG A;  2BQR A;  4YR0 A;  4QZF A;  1BGX T;  7ICJ A;  4DQP A;  4YQW A;  5DQH A;  4F4Z A;  5HP4 A;  2KZM A;  1NK5 A;  4UB3 A;  5J2D A;  1Z00 B;  2UVV A;  1IXR A;  1DGS A;  2ZTE A;  4RNN A;  3MR5 A;  3MDC A;  5CR0 A;  4DL6 A;  1S97 A;  4NY8 A;  4KIT B;  2Y1J A;  3Q8M A;  4NLK A;  5KT7 A;  3Q8P B;  5L1L A;  3T5L A;  5KT6 A;  5J2F A;  1X9M A;  1SKW A;  4K4H A;  3ORY A;  1XO1 A;  5D4B A;  1L5U A;  3IHQ B;  8ICU A;  5DLF A;  2UVR A;  5J2K A;  5EWF A;  1JXL A;  5DGA A;  5KFP A;  4M6W B;  3TAR A;  4RU9 A;  4QWB A;  4UB2 A;  4O3S A;  4Q8F A;  1ZQH A;  2IHM A;  3LDA A;  4DLE A;  2LYH A;  4RPX A;  1MQ3 A;  1ZQI A;  2C2E A;  4IQU A;  1WCN A;  4NLG A;  1ZQZ A;  4O5C A;  5KFM A;  2BQU A;  9ICG A;  2HHS A;  1TV9 A;  2UVU A;  2R8J A;  4I28 A;  8ICR A;  4RQ4 A;  1C7Y A;  1S77 D;  4YXJ A;  1K1S A;  4NXZ A;  3GDX A;  1KDH A;  1ZQN A;  1XWL A;  4RQ6 A;  4UAY A;  3QZ8 A;  4KLI A;  1JMS A;  1JXE A;  2ASJ A;  4IRD A;  4DOA A;  2BCV A;  2FLL A;  4QZC A;  3TFR A;  4MEX A;  8ICL A;  2MAX A;  4DF8 A;  4J9P A;  2PI5 A;  4KLO A;  4EYI B;  9ICC A;  4I2D A;  4P4P A;  5CB1 A;  5KFS A;  4Z6F A;  4M04 A;  4KMU A;  4J9K A;  2R8K A;  4DS5 A;  1ZQM A;  5KG6 A;  2HHV A;  3PO5 A;  5IIK A;  3M9N B;  1ZQO A;  4KLS A;  3PW7 A;  3TAQ A;  4DSI A;  4B9U A;  4UB1 A;  4M9G A;  3M9M B;  4M47 A;  3BDP A;  3V7K A;  4RNO A;  9ICN A;  3C1Y A;  3PW0 A;  2RDJ A;  3RB3 A;  3EWA A;  3C5F A;  9ICE A;  3C1Z A;  1S76 D;  2KFZ A;  3PX6 A;  4ED7 A;  2J6S A;  2MUT A;  3PNC A;  5J2B A;  5HHH A;  3TI0 A;  4DSL A;  4EBC A;  3RAX A;  4DFJ A;  4QZB A;  2GWS A;  2W9B B;  3KHH A;  3JPN A;  4BXO B;  4I2A A;  2OWO A;  5KFF A;  3PW4 A;  3ISB A;  2PFQ A;  8ICV A;  8ICZ A;  4ECY A;  1CUK A;  5J2I A;  2BCQ A;  5D49 A;  3MGH A;  5KFY A;  4UBB A;  3M8R A;  4PPX A;  3RRH A;  4JK1 A;  7ICI A;  2I1Q A;  1KFS A;  4RUA A;  4PGQ A;  2W9C A;  4NLZ A;  4ED0 A;  3C2M A;  1ZYQ A;  3GQC A;  4PHE A;  3UXO A;  3ISD A;  4YVZ A;  3K4G A;  4J9O A;  1ZQR A;  3EYZ A;  1ZQE A;  4C8L A;  1BPZ A;  4NLN A;  4PHD A;  2KZ3 A;  5KT4 A;  3RH4 A;  8ICX A;  4K4G A;  1V9P A;  4IQV A;  5KFN A;  4F3O A;  2ZUD A;  3MDA A;  3T3F A;  4IR9 A;  9ICF A;  1TFR A;  7ICL A;  5CJ7 A;  2IMW P;  3UXN A;  4ECT A;  1SL1 A;  2ISO A;  4Q43 A;  3PY8 A;  3V6H A;  5DLG A;  4O5E A;  4ELT A;  4YD2 A;  4DFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...