1Z00A

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
b'MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00A01
5J29A 4ED7A 3AU2A 1CUKA 3PO4A 4O5EA 8ICNA 3MDCA 3BJYA 2BPFA 1MQ3A 1XSNA 5IIOA 4XRHA 5KFAA 1KFDA 3PY8A 5DLFA 4O3OA 1T3NA 4QZIA 5KFVA 3UQ0A 3MDAA 4ED6A 4RQ0A 1SKWA 4B9MA 9ICPA 2W9MA 4PHPA 2FPKA 3GIJA 8ICUA 1WCNA 2B21A 1SKSA 1JMSA 2F1HA 4UAWA 1WCLA 3ZD9A 3HT3A 3MGHA 2H5XA 3RR7A 2R8HA 5D4BA 4Z6EA 4E0DA 8ICHA 2J6SA 1H38A 3H8SA 3QE9Y 1QLNA 2NRWA 5J0QA 4M47A 2RDIA 4NY8A 3RRGA 3MFIA 1ZQFA 4Q8FA 3PMLA 3FYHA 3SI8A 5BPCA 4J9NA 2W9AA 2C2DA 2Q0ZX 2VA2A 4B9VA 5CA7A 3TAPA 2LYHA 1XU4A 1S77D 8ICKA 4EBDA 1X9SA 1X9MA 4TQRA 5KT3A 2ASLA 2GWSA 8ICJA 3V72A 1HUZA 7ICKA 2DPJA 4YR0A 4DL3A 1ZQVA 3MABA 1BVSA 2P66A 2R8KA 1SL1A 4O0IA 1ZJNA 4RUCA 4O3QA 4R8UB 5J2HA 8ICZA 4P4MA 4J9QA 2ZJ5A 3K4GA 4C8MA 2ZTDA 4QZBA 2C28A 1TKDA 2KZZA 4J9KA 2IMWP 4QZEA 5L1LA 4NLKA 4O3SA 3UXOA 3GFKB 4F3OA 8ICMA 4BXOA 3EWAA 4TUQA 4JUZA 2Y1IA 4P2HA 1UT8A 1TK8A 3BDPA 1N48A 1KDHA 5BOLA 3RJIA 1S0NA 3JPRA 4IRKA 4PHAA 1K1SA 5IINA 3PW5A 1DGSA 4MEXA 2BDPA 9ICVA 5KFPA 4IQUA 3H8WA 2KZ3A 1TK0A 4ECUA 1BPZA 8ICIA 5KT6A 1NOMA 4DEZA 2UVWA 1TFRA 7ICIA 8ICRA 2DPIA 3EW9A 3TI0A 1XSPA 9ICKA 3PVXA 1XSLA 4KLSA 1NJZA 3ZD8A 5D46A 3RB4A 2PFNA 2FPMA 1KLNA 1JN3A 1KRPA 1ZQCA 2V4RA 3PO5A 4DOCA 4C8KA 5CHGA 1ZQAA 5HHIA 2ZTEA 4DLGA 1Z00B 4ECVA 4ECYA 4QWEA 4LZDA 5EWEA 4DSJA 2HHWA 8ICQA 4F5RA 2HHQA 4QWBA 4DQIA 2FMPA 3MR3A 1ZQLA 4NXZA 5KTQA 4DL5A 3H7IA 3HP6A 4KLHA 4O5KA 3HWTA 4F5PA 2XCPA 1U48A 7ICRA 2FPLA 5DBAA 1D8YA 5J2EA 1ZQOA 2IA6A 1NKCA 1ZQZA 2XO7A 3TQ1A 2KZMA 2A1JB 2KTQA 2XCAA 3G6YA 5KFRA 3TANA 4QWAA 3Q8RB 4ED2A 2ZTCA 4M2YA 1S76D 4BGDA 3C2MA 3FDSA 3E2EA 1MSWD 8ICYA 5DB9A 3M8SA 5DLGA 5KFGA 1TAUA 2FMQA 4RQ5A 4RUAA 4XA5A 4YCXA 5F9NA 3MR2A 3LWMA 4J9RA 3MGIA 4J9LA 4ED1A 2ATLA 4I29A 2HHSA 7ICHA 3KHLA 5KFEA 3Q8SB 9ICQA 1NK5A 4I2GA 1SL0A 3C1YA 3OHBA 4KLLA 5KFBA 3TARA 3HX0A 1S0VA 3T5KA 4PH5A 1B43A 1NK7A 3K75D 3T5JA 1QSYA 8ICVA 4RNNA 4KLFA 5KFQA 4J9MA 5DDYA 3PV8A 1NK0A 4IQVA 4RT3A 7ICVA 8ICTA 4J9OA 4QWDA 4DF8A 3H40A 3NTUA 2C22A 4LZGA 7ICMA 3H8JA 1SKRA 4ECZA 2ASDA 5DQHA 4Q8EA 4PGYA 4F91B 1D8LA 9ICWA 3H4DA 5KG0A 4Z6CA 3OSNA 4UBBA 2AQ4A 2ZUCA 3LK9A 1L3SA 4JV2A 9ICCA 4QZGA 4ED0A 4DL7A 8ICFA 4DQPA 4KLJA 3ISDA 1TVAA 4Q43A 4F50A 4UAZA 4GLXA 4O3PA 4J9PA 2BGWA 2MUTA 2JZBA 4YMMA 5C5JA 3Q8QB 1ZQTA 5DGBA 5CB1A 5DG8A 4Q45A 4RQ4A 2ZJ8A 4YMNA 3MR5A 4FS2A 1ZQBA 4K4HA 4DS4A 2Y1JA 5J0RA 4UBCA 7ICNA 3IM1A 1Z3EB 5KG2A 3PW0A 1NK9A 2XGQA 4BDPA 1BPEA 5J0TA 1ZQDA 4KLUA 3C21A 1S97A 2HHVA 4PGQA 1LB2B 2XY7A 1KFTA 4Q44A 3PW2A 3GDXA 4ED3A 1SL2A 4DQRA 8ICOA 5KFKA 4EBCA 5TZVA 4B9LA 2UVVA 4MFCA 3RBDA 4NLNA 4I2BA 2WTFA 4GC6A 4KN7A 4UB1A 5KFIA 3PW4A 4YP3A 2XY5A 4C8LA 4K4GA 3JPNA 2BCUA 4DSLA 5IIJA 1ZQMA 4M6WA 4GXJA 3QEAZ 4YVZA 2FMSA 5KFMA 4BWJA 9ICNA 5DKWA 1JXLA 3HW8A 3Q8MA 9ICJA 1B22A 4P4OA 4EYIB 1AROP 3V6KA 4I2CA 3RAXA 4YFKA 3KHHA 2PFOA 4ECSA 1KFSA 7ICPA 3RB6A 2JEIA 7ICOA 9ICFA 3RJGA 4X5VA 1RXWA 3Q8PB 4DQSA 4B9UA 1RPLA 1QTMA 4YMOA 2NRZA 3KHRA 4EBEA 5KFDA 5IIMA 4FBTA 4RPXA 4TURA 1BPYA 4FBUA 4F92B 3THVA 2HW3A 1X2IA 4M9JA 4DSKA 5KFFA 4KLQA 3MR6A 5JUMA 3EYZA 2FLPA 3ZDBA 1TK5A 4C8OA 5J2KA 1HJPA 3LWLA 2HVIA 3ISBA 4HYKA 2AGPA 5CR0A 1DOQA 4GXKA 3AUOA 2P6RA 5DQIA 5KG5A 4GXIA 3OSPA 1U45A 1A77A 2C2EA 4ELVA 4F2SA 3EPIA 1L3TA 1SZPA 4I27A 3SV4A 4DSEA 2AJQA 1UT5A 2AQ0A 5L9XA 2BQRA 4YD2A 4KLTA 5DB8A 3RRHA 3GV7B 5CJ7A 4M9LA 2PXIA 5DQGA 4YR2A 5KG6A 3QEBZ 5KFTA 4TQSA 2W8LA 2R8GA 4KITB 2MUTB 4ECTA 4EZ6A 4RQ7A 4TUSA 1S0MA 4O9MA 5KG3A 1ZQQA 1QSLA 2BR0A 3V6JA 2ISOA 4KTQA 5DBCA 4B9NA 2ZUBA 1UA0A 1ZQIA 3RJEA 1KTQA 5DG9A 4F4WA 2J6TA 5KFYA 5J0XA 1NKBA 1EXNA 5IIIA 3PR4A 1ZQXA 1BPDA 1PZNA 3GIIA 5J2IA 2IHNA 4UB4A 3GIKA 3BQTA 4RZRA 3C5GA 7ICUA 4EZ9A 1D9DA 1RYRA 1JXEA 5CP2A 2FLLA 2V9WA 9ICLA 3IHQB 5KT4A 4ECWA 3RB3A 3H4BA 1S10A 4IQWA 2I1QA 4ECXA 5DDMA 4TUPA 2IBKA 4DS5A 4QZHA 3QZ8A 1BPBA 4M6WB 1L3UA 5HP4A 5KG7A 3C5FA 1KSPA 4JK1A 2PI4A 3GV5B 4IR9A 2F1IA 3NGDA 5L1IA 2BHNA 2V4QA 4KLOA 2KFNA 3T5HA 3ISCA 3RJFA 3PNCA 5HHHA 4RU9A 3PX6A 1NKEA 2VA8A 7ICQA 4DOBA 9ICSA 1HUOA 3QZ7A 2XC9A 4I2AA 3GV8B 2NRXA 4QW9A 1NK4A 2ISPA 3UXNA 4BXOB 4NLZA 4I2IA 5J2JA 4R8UA 4ECQA 5DGAA 3EZ5A 3PW7A 4DFPA 4F2RA 4QZ9A 5EOZA 3JPPA 1T7PA 5J0UA 3Q8LA 7ICJA 8ICPA 7ICSA 2DFLA 5EWGA 5HMLA 4F5OA 3C23A 4DO9A 4Z6FA 4M9NA 4K4IA 2PFPA 4I2HA 2JEJA 4KLGA 2KFZA 5KFSA 2ASJA 4IQTA 3KTQA 3B0YA 3ZDDA 4DL6A 4F8RA 1S0OA 2NRTA 5HMMA 3TFRA 5KT5A 3BQ2A 2BCSA 4GC7A 4CCHA 3BQ1A 5KFWA 5CWRA 4PHDA 5KFUA 4DFJA 3ETLA 4R65A 4MF2A 2VA3A 4MFFA 1COOA 4F4XA 4KLDA 2ZUDA 3MFHA 4IRCA 5J2BA 1ZYQA 3JPSA 2BQUA 2BQ3A 1D9FA 3C2KA 4PPXA 4UB2A 3PR5B 2UVUA 5F9LA 4DL2A 8ICSA 4M9GA 9ICHA 4YD1A 4JWNA 1Z00A 5L1JA 4QW8A 5KFCA 5J0OA 1BPXA 3GILA 2F1JA 1ZQYA 3C1ZA 4JV1A 4XQ8A 9ICGA 4DLEA 4NM1A 5J2DA 3RTVA 3RBEA 4LVSA 1NK6A 4EEYA 4R64A 1ZETA 4ELTA 4O5CA 7ICGA 4RT2A 3LDAA 4KLMA 2W9CA 3OJSA 3N4MB 4KMUA 9ICRA 4YQWA 3HPOA 2A1JA 1L3VA 2PI5A 4MEYA 4C8NA 5KFOA 8ICXA 3ZDEA 4DOAA 3KHGA 4KN4A 1ZQKA 4YXJA 4RPZA 3GIMA 2ALZA 4I2JA 7ICFA 4DSIA 4I2DA 1ZQNA 8ICAA 4RNOA 4XUSA 3V7KA 5L1KA 4ECRA 1XC9A 4J9SA 4R66A 2W9BA 2R8JA 3RJKA 2PFQA 4B9SA 4M0AA 8ICBA 2NRVA 4PHEA 3JPQA 4ED8A 4UB5A 3Q8KA 3RAQA 2AU0A 4IRDA 8ICCA 5BOMA 3OHAA 5HNKA 3T5LA 9ICOA 5DB7A 3UQ2A 5EWFA 4F4ZA 1ZQHA 1IXRA 5KFLA 1UA1A 4KLIA 4G3IA 5IILA 4Z6DA 1MQ2A 9ICTA 5IIKA 5KFXA 4QZ8A 2JEFA 4DQQA 2R8IA 2MAXA 1NK8A 2C2RA 2KN7A 4NM2A 3BQ0A 4YG2A 1ZQWA 2AGOA 5KG1A 5KFHA 5J2GA 1U4BA 2BPGA 2BCQA 1S9FA 3ZDAA 2RDJA 3SV3A 2HVHA 4IR1A 2W8KA 2ZJAA 3M9MB 4MFAA 1ZQRA 4M9HA 5J2FA 1K1QA 4O3RA 3N97B 4I28A 1JIHA 3UXPA 4RNMA 1C7YA 9ICBA 5KT7A 4QWCA 3M9NB 2JZBB 4RQ3A 1XO1A 4JV0A 2JEGA 4F4YA 3B0XA 4P4PA 4F5NA 2XGPA 1IM4A 5J0PA 1MC8A 2P6UA 4DSFA 4UAYA 1LV5A 2HHTA 3SYZA 1T4GA 2XY6A 1JX4A 1ZJMA 3PMNA 4QZCA 3AU6A 1RXVA 4YR3A 3JPTA 3T3FA 3ZDCA 5J2CA 3RH4A 1T8EA 4R63A 3M9OB 1U49A 4QZDA 4PGXA 1U47A 1QSSA 1ZQSA 4EYHB 5KFNA 2HHXA 2FLNA 3G6XA 9ICIA 3PX4A 4FS1A 2HHUA 1ZQGA 4DFMA 4F93B 2I9GA 2BCRA 4DWIA 2BPCA 3G6VA 3RB0A 2VANA 5J0WA 4UB3A 3GQCA 4F5QA 3PX0A 4RQ2A 1BGXT 2W9CB 3RR8A 1V9PA 1U9LA 3OJUA 4FO6A 2M9NA 3V6HA 1TV9A 9ICUA 4ELUA 2BKEA 1NJYA 9ICXA 1N56A 4O3NA 1ZQUA 3M8RA 3RJJA 1A76A 3RH6A 5J0YA 2J6UA 5KFZA 2AGQA 4B9TA 4JWMA 5KT2A 5DBBA 3OGUA 2W9BB 5J2AA 4UQGA 5DB6A 1RZTA 4NLGA 4KLEA 8ICGA 9ICMA 7ICLA 5D49A 4RQ1A 4QZAA 4M04A 4QZFA 1Y88A 3JPOA 4DL4A 3EPGA 3RJHA 1X9WA 8ICEA 1XWLA 1KEJA 1NJXA 3TAQA 5KFJA 5DG7A 4YN4A 7ICTA 4RPYA 1XS9D 5J0SA 3SZ2A 4RQ8A 3C2LA 8ICWA 3V7LA 9ICEA 4ZH4A 2BCVA 8ICLA 1L5UA 2OWOA 1RYSA 4DF4A 7ICEA 1ZQEA 4I2FA 9ICAA 2IHMA 1ZQPA 4BWMA 1CEZA 3UPQA 2UVRA 4DFKA 4F4KA 1ZQJA 3V7JA 4MF8A 3TFSA 5KG4A 4I2EA 4RQ6A 3RH5A 3ORYA 1TAQA 1NJWA 4YXMA 3MBYA
chains in the Genus database with same CATH superfamily
2ZIVB 3MDCA 1KQQA 5IIOA 3D6JA 2D8CA 5DLFA 4O3OA 2FE9A 4Y2SA 3UQ0A 4ED6A 4RQ0A 3MGVA 1SZHA 1WCLA 3ZD9A 4NL9A 3HT3A 2H5XA 1S8OA 2R18A 2R8HA 5D4BA 4Z6EA 4E0DA 8ICHA 1N61A 1H38A 4M47A 2EDUA 1OXJA 3PMLA 4UAVA 2W9AA 2LYHA 1XU4A 2YQEA 4EBDA 1X9MA 5KT3A 3V72A 2DPJA 2MU2A 1KW4A 5J8YA 1SL1A 4O3QA 4J9QA 2ZJ5A 3K4GA 3PSFA 4J9KA 2JRZA 5EE9A 8ICMA 4JUZA 4P2HA 3NVWA 3BDPA 1KDHA 3JPRA 4PHAA 4MEXA 2BDPA 9ICVA 8ICIA 5AM1A 1NOMA 4DEZA 1TFRA 1X9XA 9ICKA 1XSLA 4KLSA 3CW2C 1NJZA 3ZD8A 3RB4A 5ALNA 1JN3A 2JHDA 5AI0A 4DOCA 4C8KA 5CHGA 1VLBA 4OCZA 4ECVA 8ICQA 4QWBA 3NVVA 4DL5A 1JUDA 5B5EU 4F5PA 1FFVA 1U48A 5EE3A 1D8YA 1NKCA 2XO7A 2KZMA 3AQEA 4ED2A 1S76D 4M2YA 3TADA 5DLGA 2FJ6A 1TAUA 3MR2A 4XA5A 3LWMA 4HAIA 4ED1A 4GIBA 3FM9A 1TAMA 2LM1A 3BZKA 5KFBA 4QNLA 4PH5A 3K75D 4RT3A 4OJ5A 4DF8A 2C22A 4QJFB 3H8JA 1SKRA 4PGYA 3IRUA 2NV3A 3H4DA 5KG0A 2ZUCA 3LK9A 1L3SA 4JV2A 1PK3A 2MSNA 4DQPA 1MN8A 4GLXA 1JRPA 2MUTA 1ZQTA 5DGBA 5DG8A 3IM1A 1X42A 3PW0A 5AKKA 3C21A 3DEEA 1S97A 2HHVA 2XY7A 1SL2A 2W3SA 1PVRA 2UVVA 3PW4A 4YP3A 3JPNA 2BCUA 1ZQMA 4UARA 3QUTA 4GXJA 2KICA 9ICNA 4C4RA 3N7RC 9ICJA 1B22A 4NLCA 4I2CA 3KHHA 2JEIA 3RJGA 1ZD4A 3QU2A 4DQSA 1QTMA 2NRZA 2JMGA 4EBEA 2E5SA 2EAMA 4DSKA 4KLQA 2FLPA 5KL8B 4P0PB 3D2QA 4GXIA 1A77A 4I27A 4ELVA 1L3TA 2AJQA 5CJ7A 3I76A 4YR2A 2W8LA 4NL9C 4ECTA 2ISOA 4B9NA 1ZQIA 3M6ZA 1BPDA 1PZNA 2WHEA 1O03A 2FLLA 1COKA 2Y9UA 3WKAA 5J8YC 3IHQB 4ECXA 4PZNA 4DS5A 4QZHA 4JK1A 4IR9A 2F1IA 2KFNA 4KLOA 2ODGA 4RU9A 4DOBA 1HUOA 2XC9A 2KIVA 2ISPA 4I2IA 4ECQA 2B6GA 8ICPA 1BNPA 2WB1F 2NO5A 1S0OA 3BQ1A 5KFWA 4PHDA 4ZOHC 2M0NA 4LJXA 5ALEA 2DUYA 2KKPA 5J2BA 1ZYQA 2BQ3A 3AMZA 4PPXA 4UB2A 2UVUA 5F9LA 4DL2A 5AI9A 5KFCA 5J0OA 1BPXA 3TADC 4JV1A 1XNSA 4XQ8A 4C4SA 4DLEA 5J2DA 3RBEA 3C29A 2G5HB 2XVTA 4RT2A 4KLMA 4KMUA 3HPOA 2K8CB 3UMBA 1F44A 2ALZA 3GIMA 2KJ9A 8ICAA 4RNOA 4XUSA 5ALKA 2R8JA 4US9A 4B9SA 1K5OA 8ICBA 2HBKA 4PHEA 2E1EA 3OHAA 9ICOA 5EWFA 1UA1A 5IILA 9ICTA 4OJPA 1MQ2A 1WUDA 3SR6A 2LYAA 2AGOA 4BX9C 4IR1A 2ZJAA 3H8MA 1ZQRA 2EH9A 5J2FA 4O3RA 3N97B 2BDUA 3UXPA 9ICBA 1V85A 2LBOA 4QWCA 1XO1A 2ZIVA 4A8EA 1IV8A 3B0XA 3QU9A 2XGPA 2YMMA 4DSFA 3L4PA 1JX4A 1QQ6A 3A0BU 5AIBA 3T3FA 3RH4A 1QSSA 4QZDA 1FEZA 3WKCA 1ZQGA 4F93B 2BCRA 3C28A 4FZNA 4F5QA 5H2FU 1U9LA 3VC8A 1WWUA 1ZQUA 3QX7A 5AKEA 5KFZA 2AGQA 2W9BB 2QARA 1RZTA 2K4PA 4NLGA 4KLEA 9ICMA 5D49A 4QZAA 3GU3A 3EPGA 3RJHA 2B0CA 8ICEA 4UB8U 3UMGA 5KFJA 5DG7A 2RLTA 3C2LA 1JROA 1L5UA 2OWOA 3RFAA 3CRXA 5CEHA 2UVRA 2YB4A 1Z19A 3V7JA 1OW5A 2Y9TA 3TACB 3ORYA 1NJWA 4ACOA 4YXMA 3MBYA 1F5SA 3PO4A 4O5EA 2BPFA 1XSNA 5AKLA 4QZIA 2FPKA 4KMOB 4Y2RA 2HOQA 3UMCA 2NRWA 5J0QA 4NY8A 2RDIA 3RRGA 3MFIA 3CYMA 5BPCA 2Q0ZX 8ICKA 5JU5A 7ICKA 1L7OA 4YR0A 1XO0A 2G5IB 2GLEA 1BVSA 2P66A 2R8KA 4P4MA 4Y2PA 2C28A 5L1LA 2YMPA 4BXOA 1K1SA 3KZXA 1RDFA 1DGSA 2KZ3A 1BPZA 8ICRA 2DPIA 3EW9A 3TI0A 5AKIA 3N7PD 5D46A 2PFNA 2FPMA 1KRPA 4UATA 5HHIA 2ZTEA 3M6KA 4DSJA 5EWEA 2HHWA 4F5RA 3L5KA 5AM3A 2MRLA 5KTQA 3HILA 2HBMA 2GH1A 4Y2QA 5AK3A 2XCAA 3CP8A 4FZLA 4C4TA 2W55A 5KFRA 3TANA 3Q8RB 1QH9A 3FDSA 3E2EA 1MSWD 5KFGA 1KL9A 4I29A 2HHSA 2ATLA 4MHVA 2KMDA 5KFEA 9ICQA 1NK5A 4I2GA 1SL0A 3C1YA 4PL2A 3OHBA 3TKAA 2PMZC 2DL0A 3T5KA 1B43A 1NK7A 2EANA 3T5JA 4RNNA 4KLFA 5KFQA 2JGAA 8ICTA 1T94A 2HDOA 3ETRA 1ZD2P 4LZGA 7ICMA 1ZRMA 5F3XB 4ECZA 2ASDA 3SAHA 5AKXA 2VIXA 1FO4A 3OSNA 2AQ4A 1UHUA 9ICCA 4ED0A 2I6XA 4Q43A 4FZMA 5JRTA 3MR5A 4Q45A 4FS2A 2D3DA 4YMNA 3QU5A 4K4HA 7ICNA 1Z3EB 2RRDA 5KG2A 1NK9A 3PSTA 2XGQA 1BPEA 2HSZA 5AI5A 4CF4A 3PW2A 8ICOA 4EBCA 3AL0B 4NLNA 2WTFA 2HOIA 5KFIA 3WK9A 1SWVA 2E8MA 2H3QA 5KFMA 4BWJA 1CI4A 3HW8A 1O08A 2QARB 3QU4A 3T79A 1AROP 3V6KA 4KX5A 2PFOA 1KFSA 7ICPA 3RB6A 9ICFA 3WKEA 4X5VA 2JH1A 4U7CA 1NZBA 2F77X 5E79U 2ESEA 5ALPA 3THVA 5AM2A 1X2IA 1L7NA 1HJPA 3ISBA 5CR0A 5KG5A 3OSPA 4F2SA 1Z4OA 3EPIA 1SZPA 4DSEA 3PSIA 3KD3A 2AQ0A 2BQRA 5DB8A 1JALA 4FFDA 1A6SA 2AH5A 5KG6A 2WAQC 5KFTA 1HIWA 4TQSA 2RP5A 3EUB2 4EZ6A 2PKEA 4CDGA 4RQ7A 3ICXA 4O9MA 2KIWA 4KTQA 3KKAA 3V6JA 4OJOA 2J6TA 5J0XA 1NKBA 5IIIA 4IS7A 3GIIA 2LPEA 3BQTA 1D9DA 1RYRA 5CP2A 9ICLA 1L8LA 4RQMA 4ECWA 2I1QA 4TUPA 1KN5A 1BPBA 4M6WB 3QZ8A 5HP4A 1L3UA 2ES6A 3C5FA 2VKQA 1DGJA 5L1IA 2V4QA 3T5HA 2P35A 5HHHA 5EE0A 1URJA 2G08A 4CRXA 5GTIU 3UXNA 4BXOB 1L6NA 2NYVA 4QIWF 5AKJA 3JPPA 7ICJA 7ICSA 4IC9A 4F5OA 2E8OA 5ALHA 2IOFA 4DO9A 4Z6FA 4K4IA 1UCVA 2NO4A 2JEJA 2KFZA 1LKYB 4IQTA 1MA7A 3KTQA 3B0YA 4DL6A 3ALRA 3TFRA 5KT5A 3BQ2A 2KJ8A 2MA1A 1SV0A 4CCHA 5KFUA 4MF2A 4MFFA 3JPSA 2BQUA 2LM4A 4FE3A 4JB3A 3C2KA 8ICSA 2K89A 4YD1A 4JWNA 1Z00A 5L1JA 4QW8A 3GILA 2DQNB 1IG6A 1RYUA 1NK6A 3QU7A 3E58A 4O5CA 1ZETA 3QUQA 2PI5A 4MEYA 3ZDEA 1ZQKA 4YXJA 5ALTA 7ICFA 4I2JA 1Q46A 4I2DA 3F53A 1ZQNA 1RQNA 4ECRA 4R66A 2W9BA 4CF5A 4M0AA 2NRVA 3JPQA 3CNHA 5BOMA 2KOBA 3T5LA 3R9KA 4KLIA 4G3IA 1SXDA 5KFLA 5CRXA 1PK1A 3AEVA 4Y2JA 3AQFA 4QZ8A 2C2RA 2N1RA 2J6SA 3N7SC 2BCQA 5KFHA 5J2GA 1PVPA 2HVHA 4P0QA 3DV9A 1LVHA 4C7YA 1K1QA 1JIHA 4RNMA 4AYBF 4F72A 3M9NB 3KBBA 5AI6A 4RQ3A 5ALGA 2JEGA 4F4YA 1IM4A 2P6UA 2HHTA 2XY6A 1T4GA 3PMNA 3AU6A 1RXVA 4YR3A 3JPTA 3ZDCA 1YZ7A 2WF9A 4R63A 2KKVA 1U47A 1ZQSA 5KFNA 4PL1A 2HHXA 2FLNA 9ICIA 3PX4A 4FS1A 5AHXA 2KEYA 2KVSA 2HHUA 1KKXA 4DFMA 1IIPA 1B4FA 2I9GA 4DWIA 3RB0A 4UASA 5J0WA 1X6JA 1BGXT 2W9CB 2KHVA 3OJUA 1T3QA 1TV9A 4ELUA 2Q4TA 2BKEA 1N56A 3M8RA 4NJ8A 3UM9A 4JWMA 2QLTA 5KT2A 5DBBA 3PZPA 8ICGA 2F8LA 4PJ0U 3SEIA 4QZFA 1X9WA 3WKDA 2LKYA 1NJXA 1ZRNA 3TAQA 2W43A 1P7DA 4YN4A 1DRGA 2F3NA 3BS7A 4DF4A 7ICEA 4UW9A 9ICAA 1WYGA 3HKZC 5KNIA 2G06A 3KKAC 3UPQA 4DFKA 4F4KA 3TFSA 2XICA 4I2EA 4RQ6A 3WK5A 3RH5A 3RH6A 5HR7A 5J29A 1CUKA 2XI9A 8ICNA 3BJYA 1MQ3A 4XRHA 5KFAA 1KFDA 3I28A 1SKWA 2W9MA 4PHPA 8ICUA 1SKSA 1JMSA 2F1HA 2G07A 3MGHA 3RR7A 1DK2A 3LYSA 2RQ5A 2F8KA 3QE9Y 1RM6C 3FYHA 3SI8A 4J9NA 2C2DA 2Y0SC 3H0RB 2ASLA 3WK6A 5ALVA 4O0IA 3LVWA 4RUCA 5ALIA 5J2HA 8ICZA 3E0FA 4QZBA 3FAHA 1TKDA 4QZEA 1ZXIA 4NLKA 4O3SA 5A0LA 3GFKB 4TUQA 1SV0C 2HCFA 1UT8A 1TK8A 1N48A 3RJIA 4IRKA 5IINA 4IQUA 3H8WA 5KFPA 1TK0A 7ICIA 1XSPA 3PVXA 2F76X 2ZIXB 1ZQCA 3PO5A 1ZQAA 1Z00B 2G0AA 4LZDA 2FMPA 1ZQLA 2WF6A 3H7IA 3HP6A 4O5KA 3HWTA 2XCPA 3IG5A 2BZFA 7ICRA 5DBAA 2IA6A 3BS5B 1M6YA 1ZQZA 5AI8A 2KTQA 1FIQA 2I5HA 5KAFU 2DWQA 3G6YA 2ZTCA 4BGDA 3BZCA 5DB9A 2FMQA 4RQ5A 4RUAA 4J9RA 4YCXA 4DL4A 4M04A 3MGIA 2FDRA 3ONNA 4KLLA 5AIAA 3HX0A 1J2MA 8ICVA 3F2BA 1PK1B 5DDYA 7ICVA 4J9OA 4QWDA 3NTUA 2F2AB 4P0QB 4Q8EA 4Y2UA 4UAUA 1N5WA 4QZGA 8ICFA 3ISDA 1QQ5A 5AK6A 4F50A 3QXGA 4O3PA 4J9PA 2ZXIA 4YMMA 5C5JA 1PVQA 2ZJ8A 1ZQBA 1YZ6A 4DS4A 5J0RA 4UBCA 4BDPA 3ED5A 1L7MA 3J81j 1ZQDA 4KLUA 4PGQA 5AICA 1LB2B 1KFTA 4ED3A 4DQRA 5KFKA 4MFCA 3RBDA 4OJ6A 4GC6A 3DDHA 4KN7A 3IP4B 4UB1A 4C8LA 1N60A 1FFUA 4DSLA 2EAOA 4M6WA 2KP7A 3QEAZ 4YVZA 2KSOA 2ZXHA 3Q8MA 4P4OA 4EYIB 2AHOB 1N62A 4YFKA 7ICOA 1HEKA 3Q8PB 2ZIUB 4B9UA 1RPLA 3KZIU 5IIMA 4FBTA 4RPXA 4TURA 5AM5A 2Z7JA 2YX8A 2HW3A 5AKHA 3MR6A 5JUMA 2JH7A 3ZDBA 4C8OA 2HVIA 4HYKA 1LKYA 1DOQA 4GXKA 5DQIA 3AM9A 3SV4A 1UT5A 5TISU 3RF9A 4YD2A 4KLTA 4M9LA 2PXIA 1J97A 4AP9A 2YMLA 1ED1A 4IL6U 4J03A 4TUSA 3PSPA 5G5HA 4CE6A 5DBCA 2ZUBA 1UA0A 1KTQA 3QNMA 5DG9A 4F4WA 1Q8KA 5J2IA 1ZQXA 3M7DA 2IHNA 4UB4A 4RZRA 2AXTU 4OO1J 2EZYA 7ICUA 2W7PA 2K4EA 4IQWA 3RB3A 1GO3F 1NZPA 1VDVA 2IBKA 1X6IA 1KSPA 2PI4A 3NGDA 3QUCA 5ALSA 3ISCA 3RJFA 3PX6A 2VA8A 7ICQA 5JTIA 3L3FX 1WG8A 4QW9A 5J2JA 2KV2A 4R8UA 3EZ5A 4NV0A 4F2RA 4QZ9A 5J0UA 5AKGA 5EWGA 4BUGA 5HMLA 2OCEA 4UB6U 2HOFA 3C23A 4M9NA 1Z4NA 2PFPA 4I2HA 4KLGA 5T14A 5KFSA 2ASJA 2YB1A 5L1MA 4PZOA 2K60A 2WF7A 4GC7A 5CWRA 3ETLA 4F4XA 4KLDA 3OPXA 2ZUDA 3D2SA 3MFHA 1UPHA 4IRCA 3AN1A 1D9FA 9ICHA 4G9BA 5ALLA 4M9GA 2E8NA 2H3IA 1ZQYA 3C1ZA 9ICGA 3RTVA 2WB1C 4USAA 4R64A 4ELTA 4F71A 2W9CA 3F2CA 3OJSA 3N4MB 1PUZA 9ICRA 4YQWA 2A1JA 5ALOA 3GZFA 8ICXA 5KAIU 1SGGA 4DOAA 2OHFA 4RPZA 2D6FC 1S5LU 5ALRA 4J9SA 3RJKA 2PFQA 2AU0A 4ED8A 4UB5A 3RAQA 4IRDA 2E1FA 1JI7A 5HNKA 5DB7A 3UQ2A 1ZQHA 1IXRA 4Z6DA 3QYPA 5KFXA 2JEFA 2W3RA 5EE1A 1NK8A 3BQ0A 4NM2A 1ZQWA 5KG1A 3ZDAA 1S9FA 3SAFA 3SV3A 2W8KA 4OJLA 4MFAA 4M9HA 4I28A 5KT7A 1Z1BA 3NUQA 1KBUA 2CN1A 4JV0A 1N5XA 2E8PA 4F5NA 3D2NA 2KNJA 2VJ5A 5AKZA 2QB0A 1UQVA 1T8EA 3M9OB 1U49A 4NLBA 4EYHB 3A0HU 3G6VA 3GQCA 4RQ2A 2KSOB 3H0LB 1V9PA 5K4LA 3V6HA 9ICUA 9ICXA 2EQYA 1C20A 4O3NA 1Q3VA 4RQNA 5G5GA 2J6UA 2YMQA 4Y2VA 4U6PA 4CNQA 5J2AA 1ZOLA 5DB6A 4UQGA 4RQ1A 3N28A 3FC4A 1Y88A 3JPOA 3WK4A 1XWLA 1KEJA 2QB1A 1YT3A 2F44A 3WK8A 7ICTA 2HBLA 4RPYA 1XS9D 3SZ2A 1RG6A 8ICWA 3V7LA 4ZH4A 8ICLA 3HRDD 2VJ4A 1B0XA 4BWMA 1CEZA 2O6KA 1ZQJA 2DKXA 4MF8A 2ZIWA 5KG4A 1CRXA 4ED7A 3AU2A 2ZIXA 3I1YA 2G09A 3SAGA 3NVYA 3F5EA 3PY8A 1T3NA 5KFVA 3MDAA 4B9MA 9ICPA 3ZI4A 3GIJA 1WCNA 2B21A 4UAWA 3BS5A 1QLNA 3H8SA 7ICHA 4Q8FA 1ZQFA 2CPRA 4B9VA 3IN5A 2VA2A 5CA7A 3TAPA 1S77D 1ZD5A 1X9SA 2GWSA 4TQRA 8ICJA 1HUZA 4DL3A 4DCCA 1ZQVA 2KD1A 3B9JA 3IG8A 5ALXA 3S6JA 3MABA 3KOOA 5ALYA 3SMVA 1ZJNA 2A1AA 4R8UB 1SB3C 2GO7A 4C8MA 2ZTDA 2YN4A 2KZZA 2IMWP 5AI4A 2CRXA 3UXOA 4F3OA 4Y2TA 3EWAA 2Y1IA 1NI3A 1ECWA 1A0PA 5B66U 5BOLA 1S0NA 4C80A 3PW5A 2LHTA 4ECUA 3SD7A 5KT6A 2UVWA 2WF8A 2KG5A 3WK7A 1KLNA 1DXSA 2H3VA 2V4RA 2PMZF 1SIJA 4DLGA 4ECYA 4QWEA 2HHQA 5ALFA 4DQIA 2JR5A 3MR3A 4NXZA 4EELA 4KLHA 3HJEA 3WU2U 2FPLA 5J2EA 1ZQOA 3TQ1A 2A1JB 2KE7A 5ALMA 4C7ZA 4QWAA 3C2MA 4GFJA 1F0MA 8ICYA 3M8SA 5F9NA 2H3ZA 4J9LA 3KHLA 3Q8SB 4KX3A 2H3FA 3TARA 1S0VA 1QSYA 2K4IA 4J9MA 2ZIUA 3PV8A 1NK0A 4IQVA 2W04A 1V38A 1DK3A 3H40A 5DQHA 5ALZA 4F91B 5KL1B 2HMXA 1D8LA 9ICWA 5HR6A 2KVCA 3IDWA 4Z6CA 1D8BA 4UBBA 3NVZA 2LMRA 4DL7A 2RHFA 4KLJA 1TVAA 4UAZA 4DFDA 2BGWA 2QB0B 2JZBA 3Q8QB 5CB1A 4RQ4A 2Y1JA 2E3TA 5J0TA 4Q44A 2WF5A 3GDXA 5C0YA 3IV6A 3K1ZA 5TZVA 4B9LA 1VJ5A 2K8BB 4I2BA 2XY5A 4K4GA 5IIJA 2WAQF 2FMSA 3NS1A 5DKWA 1JXLA 4CF3A 4US8A 1QCKA 3RAXA 1X40A 4ECSA 3KFUF 5ALJA 1RXWA 4YMOA 3KHRA 5KFDA 2DKZA 1SWWA 1BPYA 4FBUA 4F92B 4M9JA 3NASA 5KFFA 3EYZA 1TK5A 1L8OA 5J2KA 3LWLA 2AGPA 2KHQA 1SV4A 2P6RA 3AUOA 2ZIWB 5AK5A 1U45A 1N63A 2C2EA 1ZQ1C 5L9XA 2OEHA 3RRHA 2DGZA 3U26A 3GV7B 5DQGA 3QEBZ 2R8GA 3WKBA 4O3MA 4KITB 2MUTB 2W7OA 2JXJA 1S0MA 4EX6A 2OM6A 5KG3A 1ZQQA 2BR0A 1QSLA 4OD0A 3RJEA 5KFYA 5ALUA 1EXNA 3PR4A 3GIKA 2HBJA 1TE2A 3C5GA 1Q3UA 4CGZA 4EZ9A 1JXEA 2V9WA 2DF4B 5KT4A 1S10A 3H4BA 5DDMA 2EAPA 3H0MB 5KG7A 3GV5B 4EEKA 2BHNA 2LYBA 1QQ7A 3F5AA 3PNCA 1NKEA 9ICSA 3OTQA 3QZ7A 4I2AA 5FP0A 3GV8B 2NRXA 1NK4A 5ALQA 4NLZA 5ALWA 2KK0A 5DGAA 2L5YA 3PW7A 4DFPA 5EOZA 1T7PA 3Q8LA 2DFLA 2W54A 1X66A 2KJ5A 1Z1VA 2A3VA 3M1YA 3ZDDA 4F8RA 2NRTA 5HMMA 2BCSA 2K4HA 5AKYA 3QUBA 1ZD3A 4DFJA 4R65A 2VA3A 1COOA 3PR5B 3SENA 2OH2A 2ZG6A 2IOHA 2F1JA 3NRZA 5AM0A 5ALDA 4QIWC 4NM1A 4LVSA 4EEYA 3NRWA 7ICGA 3LDAA 2QKQA 3LVVA 3SQIA 1L3VA 4C8NA 5KFOA 3KHGA 4KN4A 2YTUA 4DSIA 4WJ3B 3V7KA 5L1KA 1XC9A 2DBYA 1AQ6A 5AM4A 3Q8KA 2XIDA 8ICCA 4Y2XA 4F4ZA 2FI1A 5IIKA 4DQQA 2R8IA 2MAXA 3K1RB 2KN7A 1V97A 4YG2A 1U4BA 2BPGA 3F2DA 2RDJA 2W03A 3M9MB 4NWIA 1SXEA 2YY6A 1WWVA 2JV3A 2K8AA 1C7YA 2OYYA 1OUQA 2JZBB 1L7PA 4P4PA 4EENA 5J0PA 3VCBA 1MC8A 4Y2YA 4UAYA 1LV5A 2LI6A 3SYZA 2HI0A 1ZJMA 4QZCA 2OXOA 1N2XA 2EZZA 5J2CA 2A19A 4ICAA 4PGXA 2CXYA 4BJQA 3G6XA 3O0FA 2IOFK 4JMUA 2BPCA 4C0ZA 2VANA 3HKZF 1NNLA 4UB3A 3PX0A 2WFAA 5GTHU 3RR8A 4FO6A 2M9NA 4AYBC 1NJYA 1RQLA 2W11A 3RJJA 1A76A 5J0YA 4B9TA 3OGUA 1J2NA 3MC1A 5AK4A 7ICLA 3BQ7A 4B6JA 5J0SA 2GOLA 4RQ8A 9ICEA 4EX7A 2BCVA 1RYSA 1ZQEA 4I2FA 2EZXA 2IHMA 1ZQPA 2Y0SF 4P0PA 1BNOA 1TAQA
chains in the Genus database with same CATH topology
5J29A 4ED7A 3AU2A 1CUKA 3PO4A 4O5EA 8ICNA 3MDCA 3BJYA 2BPFA 1MQ3A 1XSNA 5IIOA 4XRHA 5KFAA 1KFDA 3PY8A 5DLFA 4O3OA 1T3NA 4QZIA 5KFVA 3UQ0A 3MDAA 4ED6A 4RQ0A 1SKWA 4B9MA 9ICPA 2W9MA 4PHPA 2FPKA 3GIJA 8ICUA 1WCNA 2B21A 1SKSA 1JMSA 2F1HA 4UAWA 1WCLA 3ZD9A 3HT3A 3MGHA 2H5XA 3RR7A 2R8HA 5D4BA 4Z6EA 4E0DA 8ICHA 2J6SA 1H38A 3H8SA 3QE9Y 1QLNA 2NRWA 5J0QA 4M47A 2RDIA 4NY8A 3RRGA 3MFIA 1ZQFA 4Q8FA 3PMLA 3FYHA 3SI8A 5BPCA 4J9NA 2W9AA 2C2DA 2Q0ZX 2VA2A 4B9VA 5CA7A 3TAPA 2LYHA 1XU4A 1S77D 8ICKA 4EBDA 1X9SA 1X9MA 4TQRA 5KT3A 2ASLA 2GWSA 8ICJA 3V72A 1HUZA 7ICKA 2DPJA 4YR0A 4DL3A 1ZQVA 3MABA 1BVSA 2P66A 2R8KA 1SL1A 4O0IA 1ZJNA 4RUCA 4O3QA 4R8UB 5J2HA 8ICZA 4P4MA 4J9QA 2ZJ5A 3K4GA 4C8MA 2ZTDA 4QZBA 2C28A 1TKDA 2KZZA 4J9KA 2IMWP 4QZEA 5L1LA 4NLKA 4O3SA 3UXOA 3GFKB 4F3OA 8ICMA 4BXOA 3EWAA 4TUQA 4JUZA 2Y1IA 4P2HA 1UT8A 1TK8A 3BDPA 1N48A 1KDHA 5BOLA 3RJIA 1S0NA 3JPRA 4IRKA 4PHAA 1K1SA 5IINA 3PW5A 1DGSA 4MEXA 2BDPA 9ICVA 5KFPA 4IQUA 3H8WA 2KZ3A 1TK0A 4ECUA 1BPZA 8ICIA 5KT6A 1NOMA 4DEZA 2UVWA 1TFRA 7ICIA 8ICRA 2DPIA 3EW9A 3TI0A 1XSPA 9ICKA 3PVXA 1XSLA 4KLSA 1NJZA 3ZD8A 5D46A 3RB4A 2PFNA 2FPMA 1KLNA 1JN3A 1KRPA 1ZQCA 2V4RA 3PO5A 4DOCA 4C8KA 5CHGA 1ZQAA 5HHIA 2ZTEA 4DLGA 1Z00B 4ECVA 4ECYA 4QWEA 4LZDA 5EWEA 4DSJA 2HHWA 8ICQA 4F5RA 2HHQA 4QWBA 4DQIA 2FMPA 3MR3A 1ZQLA 4NXZA 5KTQA 4DL5A 3H7IA 3HP6A 4KLHA 4O5KA 3HWTA 4F5PA 2XCPA 1U48A 7ICRA 2FPLA 5DBAA 1D8YA 5J2EA 1ZQOA 2IA6A 1NKCA 1ZQZA 2XO7A 3TQ1A 2KZMA 2A1JB 2KTQA 2XCAA 3G6YA 5KFRA 3TANA 4QWAA 3Q8RB 4ED2A 2ZTCA 4M2YA 1S76D 4BGDA 3C2MA 3FDSA 3E2EA 1MSWD 8ICYA 5DB9A 3M8SA 5DLGA 5KFGA 1TAUA 2FMQA 4RQ5A 4RUAA 4XA5A 4YCXA 5F9NA 3MR2A 3LWMA 4J9RA 3MGIA 4J9LA 4ED1A 2ATLA 4I29A 2HHSA 7ICHA 3KHLA 5KFEA 3Q8SB 9ICQA 1NK5A 4I2GA 1SL0A 3C1YA 3OHBA 4KLLA 5KFBA 3TARA 3HX0A 1S0VA 3T5KA 4PH5A 1B43A 1NK7A 3K75D 3T5JA 1QSYA 8ICVA 4RNNA 4KLFA 5KFQA 4J9MA 5DDYA 3PV8A 1NK0A 4IQVA 4RT3A 7ICVA 8ICTA 4J9OA 4QWDA 4DF8A 3H40A 3NTUA 2C22A 4LZGA 7ICMA 3H8JA 1SKRA 4ECZA 2ASDA 5DQHA 4Q8EA 4PGYA 4F91B 1D8LA 9ICWA 3H4DA 5KG0A 4Z6CA 3OSNA 4UBBA 2AQ4A 2ZUCA 3LK9A 1L3SA 4JV2A 9ICCA 4QZGA 4ED0A 4DL7A 8ICFA 4DQPA 4KLJA 3ISDA 1TVAA 4Q43A 4F50A 4UAZA 4GLXA 4O3PA 4J9PA 2BGWA 2MUTA 2JZBA 4YMMA 5C5JA 3Q8QB 1ZQTA 5DGBA 5CB1A 5DG8A 4Q45A 4RQ4A 2ZJ8A 4YMNA 3MR5A 4FS2A 1ZQBA 4K4HA 4DS4A 2Y1JA 5J0RA 4UBCA 7ICNA 3IM1A 1Z3EB 5KG2A 3PW0A 1NK9A 2XGQA 4BDPA 1BPEA 5J0TA 1ZQDA 4KLUA 3C21A 1S97A 2HHVA 4PGQA 1LB2B 2XY7A 1KFTA 4Q44A 3PW2A 3GDXA 4ED3A 1SL2A 4DQRA 8ICOA 5KFKA 4EBCA 5TZVA 4B9LA 2UVVA 4MFCA 3RBDA 4NLNA 4I2BA 2WTFA 4GC6A 4KN7A 4UB1A 5KFIA 3PW4A 4YP3A 2XY5A 4C8LA 4K4GA 3JPNA 2BCUA 4DSLA 5IIJA 1ZQMA 4M6WA 4GXJA 3QEAZ 4YVZA 2FMSA 5KFMA 4BWJA 9ICNA 5DKWA 1JXLA 3HW8A 3Q8MA 9ICJA 1B22A 4P4OA 4EYIB 1AROP 3V6KA 4I2CA 3RAXA 4YFKA 3KHHA 2PFOA 4ECSA 1KFSA 7ICPA 3RB6A 2JEIA 7ICOA 9ICFA 3RJGA 4X5VA 1RXWA 3Q8PB 4DQSA 4B9UA 1RPLA 1QTMA 4YMOA 2NRZA 3KHRA 4EBEA 5KFDA 5IIMA 4FBTA 4RPXA 4TURA 1BPYA 4FBUA 4F92B 3THVA 2HW3A 1X2IA 4M9JA 4DSKA 5KFFA 4KLQA 3MR6A 5JUMA 3EYZA 2FLPA 3ZDBA 1TK5A 4C8OA 5J2KA 1HJPA 3LWLA 2HVIA 3ISBA 4HYKA 2AGPA 5CR0A 1DOQA 4GXKA 3AUOA 2P6RA 5DQIA 5KG5A 4GXIA 3OSPA 1U45A 1A77A 2C2EA 4ELVA 4F2SA 3EPIA 1L3TA 1SZPA 4I27A 3SV4A 4DSEA 2AJQA 1UT5A 2AQ0A 5L9XA 2BQRA 4YD2A 4KLTA 5DB8A 3RRHA 3GV7B 5CJ7A 4M9LA 2PXIA 5DQGA 4YR2A 5KG6A 3QEBZ 5KFTA 4TQSA 2W8LA 2R8GA 4KITB 2MUTB 4ECTA 4EZ6A 4RQ7A 4TUSA 1S0MA 4O9MA 5KG3A 1ZQQA 1QSLA 2BR0A 3V6JA 2ISOA 4KTQA 5DBCA 4B9NA 2ZUBA 1UA0A 1ZQIA 3RJEA 1KTQA 5DG9A 4F4WA 2J6TA 5KFYA 5J0XA 1NKBA 1EXNA 5IIIA 3PR4A 1ZQXA 1BPDA 1PZNA 3GIIA 5J2IA 2IHNA 4UB4A 3GIKA 3BQTA 4RZRA 3C5GA 7ICUA 4EZ9A 1D9DA 1RYRA 1JXEA 5CP2A 2FLLA 2V9WA 9ICLA 3IHQB 5KT4A 4ECWA 3RB3A 3H4BA 1S10A 4IQWA 2I1QA 4ECXA 5DDMA 4TUPA 2IBKA 4DS5A 4QZHA 3QZ8A 1BPBA 4M6WB 1L3UA 5HP4A 5KG7A 3C5FA 1KSPA 4JK1A 2PI4A 3GV5B 4IR9A 2F1IA 3NGDA 5L1IA 2BHNA 2V4QA 4KLOA 2KFNA 3T5HA 3ISCA 3RJFA 3PNCA 5HHHA 4RU9A 3PX6A 1NKEA 2VA8A 7ICQA 4DOBA 9ICSA 1HUOA 3QZ7A 2XC9A 4I2AA 3GV8B 2NRXA 4QW9A 1NK4A 2ISPA 3UXNA 4BXOB 4NLZA 4I2IA 5J2JA 4R8UA 4ECQA 5DGAA 3EZ5A 3PW7A 4DFPA 4F2RA 4QZ9A 5EOZA 3JPPA 1T7PA 5J0UA 3Q8LA 7ICJA 8ICPA 7ICSA 2DFLA 5EWGA 5HMLA 4F5OA 3C23A 4DO9A 4Z6FA 4M9NA 4K4IA 2PFPA 4I2HA 2JEJA 4KLGA 2KFZA 5KFSA 2ASJA 4IQTA 3KTQA 3B0YA 3ZDDA 4DL6A 4F8RA 1S0OA 2NRTA 5HMMA 3TFRA 5KT5A 3BQ2A 2BCSA 4GC7A 4CCHA 3BQ1A 5KFWA 5CWRA 4PHDA 5KFUA 4DFJA 3ETLA 4R65A 4MF2A 2VA3A 4MFFA 1COOA 4F4XA 4KLDA 2ZUDA 3MFHA 4IRCA 5J2BA 1ZYQA 3JPSA 2BQUA 2BQ3A 1D9FA 3C2KA 4PPXA 4UB2A 3PR5B 2UVUA 5F9LA 4DL2A 8ICSA 4M9GA 9ICHA 4YD1A 4JWNA 1Z00A 5L1JA 4QW8A 5KFCA 5J0OA 1BPXA 3GILA 2F1JA 1ZQYA 3C1ZA 4JV1A 4XQ8A 9ICGA 4DLEA 4NM1A 5J2DA 3RTVA 3RBEA 4LVSA 1NK6A 4EEYA 4R64A 1ZETA 4ELTA 4O5CA 7ICGA 4RT2A 3LDAA 4KLMA 2W9CA 3OJSA 3N4MB 4KMUA 9ICRA 4YQWA 3HPOA 2A1JA 1L3VA 2PI5A 4MEYA 4C8NA 5KFOA 8ICXA 3ZDEA 4DOAA 3KHGA 4KN4A 1ZQKA 4YXJA 4RPZA 3GIMA 2ALZA 4I2JA 7ICFA 4DSIA 4I2DA 1ZQNA 8ICAA 4RNOA 4XUSA 3V7KA 5L1KA 4ECRA 1XC9A 4J9SA 4R66A 2W9BA 2R8JA 3RJKA 2PFQA 4B9SA 4M0AA 8ICBA 2NRVA 4PHEA 3JPQA 4ED8A 4UB5A 3Q8KA 3RAQA 2AU0A 4IRDA 8ICCA 5BOMA 3OHAA 5HNKA 3T5LA 9ICOA 5DB7A 3UQ2A 5EWFA 4F4ZA 1ZQHA 1IXRA 5KFLA 1UA1A 4KLIA 4G3IA 5IILA 4Z6DA 1MQ2A 9ICTA 5IIKA 5KFXA 4QZ8A 2JEFA 4DQQA 2R8IA 2MAXA 1NK8A 2C2RA 2KN7A 4NM2A 3BQ0A 4YG2A 1ZQWA 2AGOA 5KG1A 5KFHA 5J2GA 1U4BA 2BPGA 2BCQA 1S9FA 3ZDAA 2RDJA 3SV3A 2HVHA 4IR1A 2W8KA 2ZJAA 3M9MB 4MFAA 1ZQRA 4M9HA 5J2FA 1K1QA 4O3RA 3N97B 4I28A 1JIHA 3UXPA 4RNMA 1C7YA 9ICBA 5KT7A 4QWCA 3M9NB 2JZBB 4RQ3A 1XO1A 4JV0A 2JEGA 4F4YA 3B0XA 4P4PA 4F5NA 2XGPA 1IM4A 5J0PA 1MC8A 2P6UA 4DSFA 4UAYA 1LV5A 2HHTA 3SYZA 1T4GA 2XY6A 1JX4A 1ZJMA 3PMNA 4QZCA 3AU6A 1RXVA 4YR3A 3JPTA 3T3FA 3ZDCA 5J2CA 3RH4A 1T8EA 4R63A 3M9OB 1U49A 4QZDA 4PGXA 1U47A 1QSSA 1ZQSA 4EYHB 5KFNA 2HHXA 2FLNA 3G6XA 9ICIA 3PX4A 4FS1A 2HHUA 1ZQGA 4DFMA 4F93B 2I9GA 2BCRA 4DWIA 2BPCA 3G6VA 3RB0A 2VANA 5J0WA 4UB3A 3GQCA 4F5QA 3PX0A 4RQ2A 1BGXT 2W9CB 3RR8A 1V9PA 1U9LA 3OJUA 4FO6A 2M9NA 3V6HA 1TV9A 9ICUA 4ELUA 2BKEA 1NJYA 9ICXA 1N56A 4O3NA 1ZQUA 3M8RA 3RJJA 1A76A 3RH6A 5J0YA 2J6UA 5KFZA 2AGQA 4B9TA 4JWMA 5KT2A 5DBBA 3OGUA 2W9BB 5J2AA 4UQGA 5DB6A 1RZTA 4NLGA 4KLEA 8ICGA 9ICMA 7ICLA 5D49A 4RQ1A 4QZAA 4M04A 4QZFA 1Y88A 3JPOA 4DL4A 3EPGA 3RJHA 1X9WA 8ICEA 1XWLA 1KEJA 1NJXA 3TAQA 5KFJA 5DG7A 4YN4A 7ICTA 4RPYA 1XS9D 5J0SA 3SZ2A 4RQ8A 3C2LA 8ICWA 3V7LA 9ICEA 4ZH4A 2BCVA 8ICLA 1L5UA 2OWOA 1RYSA 4DF4A 7ICEA 1ZQEA 4I2FA 9ICAA 2IHMA 1ZQPA 4BWMA 1CEZA 3UPQA 2UVRA 4DFKA 4F4KA 1ZQJA 3V7JA 4MF8A 3TFSA 5KG4A 4I2EA 4RQ6A 3RH5A 3ORYA 1TAQA 1NJWA 4YXMA 3MBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J29 A;  4ED7 A;  3AU2 A;  1CUK A;  3PO4 A;  4O5E A;  8ICN A;  3MDC A;  3BJY A;  2BPF A;  1MQ3 A;  1XSN A;  5IIO A;  4XRH A;  5KFA A;  1KFD A;  3PY8 A;  5DLF A;  4O3O A;  1T3N A;  4QZI A;  5KFV A;  3UQ0 A;  3MDA A;  4ED6 A;  4RQ0 A;  1SKW A;  4B9M A;  9ICP A;  2W9M A;  4PHP A;  2FPK A;  3GIJ A;  8ICU A;  1WCN A;  2B21 A;  1SKS A;  1JMS A;  2F1H A;  4UAW A;  1WCL A;  3ZD9 A;  3HT3 A;  3MGH A;  2H5X A;  3RR7 A;  2R8H A;  5D4B A;  4Z6E A;  4E0D A;  8ICH A;  2J6S A;  1H38 A;  3H8S A;  3QE9 Y;  1QLN A;  2NRW A;  5J0Q A;  4M47 A;  2RDI A;  4NY8 A;  3RRG A;  3MFI A;  1ZQF A;  4Q8F A;  3PML A;  3FYH A;  3SI8 A;  5BPC A;  4J9N A;  2W9A A;  2C2D A;  2Q0Z X;  2VA2 A;  4B9V A;  5CA7 A;  3TAP A;  2LYH A;  1XU4 A;  1S77 D;  8ICK A;  4EBD A;  1X9S A;  1X9M A;  4TQR A;  5KT3 A;  2ASL A;  2GWS A;  8ICJ A;  3V72 A;  1HUZ A;  7ICK A;  2DPJ A;  4YR0 A;  4DL3 A;  1ZQV A;  3MAB A;  1BVS A;  2P66 A;  2R8K A;  1SL1 A;  4O0I A;  1ZJN A;  4RUC A;  4O3Q A;  4R8U B;  5J2H A;  8ICZ A;  4P4M A;  4J9Q A;  2ZJ5 A;  3K4G A;  4C8M A;  2ZTD A;  4QZB A;  2C28 A;  1TKD A;  2KZZ A;  4J9K A;  2IMW P;  4QZE A;  5L1L A;  4NLK A;  4O3S A;  3UXO A;  3GFK B;  4F3O A;  8ICM A;  4BXO A;  3EWA A;  4TUQ A;  4JUZ A;  2Y1I A;  4P2H A;  1UT8 A;  1TK8 A;  3BDP A;  1N48 A;  1KDH A;  5BOL A;  3RJI A;  1S0N A;  3JPR A;  4IRK A;  4PHA A;  1K1S A;  5IIN A;  3PW5 A;  1DGS A;  4MEX A;  2BDP A;  9ICV A;  5KFP A;  4IQU A;  3H8W A;  2KZ3 A;  1TK0 A;  4ECU A;  1BPZ A;  8ICI A;  5KT6 A;  1NOM A;  4DEZ A;  2UVW A;  1TFR A;  7ICI A;  8ICR A;  2DPI A;  3EW9 A;  3TI0 A;  1XSP A;  9ICK A;  3PVX A;  1XSL A;  4KLS A;  1NJZ A;  3ZD8 A;  5D46 A;  3RB4 A;  2PFN A;  2FPM A;  1KLN A;  1JN3 A;  1KRP A;  1ZQC A;  2V4R A;  3PO5 A;  4DOC A;  4C8K A;  5CHG A;  1ZQA A;  5HHI A;  2ZTE A;  4DLG A;  1Z00 B;  4ECV A;  4ECY A;  4QWE A;  4LZD A;  5EWE A;  4DSJ A;  2HHW A;  8ICQ A;  4F5R A;  2HHQ A;  4QWB A;  4DQI A;  2FMP A;  3MR3 A;  1ZQL A;  4NXZ A;  5KTQ A;  4DL5 A;  3H7I A;  3HP6 A;  4KLH A;  4O5K A;  3HWT A;  4F5P A;  2XCP A;  1U48 A;  7ICR A;  2FPL A;  5DBA A;  1D8Y A;  5J2E A;  1ZQO A;  2IA6 A;  1NKC A;  1ZQZ A;  2XO7 A;  3TQ1 A;  2KZM A;  2A1J B;  2KTQ A;  2XCA A;  3G6Y A;  5KFR A;  3TAN A;  4QWA A;  3Q8R B;  4ED2 A;  2ZTC A;  4M2Y A;  1S76 D;  4BGD A;  3C2M A;  3FDS A;  3E2E A;  1MSW D;  8ICY A;  5DB9 A;  3M8S A;  5DLG A;  5KFG A;  1TAU A;  2FMQ A;  4RQ5 A;  4RUA A;  4XA5 A;  4YCX A;  5F9N A;  3MR2 A;  3LWM A;  4J9R A;  3MGI A;  4J9L A;  4ED1 A;  2ATL A;  4I29 A;  2HHS A;  7ICH A;  3KHL A;  5KFE A;  3Q8S B;  9ICQ A;  1NK5 A;  4I2G A;  1SL0 A;  3C1Y A;  3OHB A;  4KLL A;  5KFB A;  3TAR A;  3HX0 A;  1S0V A;  3T5K A;  4PH5 A;  1B43 A;  1NK7 A;  3K75 D;  3T5J A;  1QSY A;  8ICV A;  4RNN A;  4KLF A;  5KFQ A;  4J9M A;  5DDY A;  3PV8 A;  1NK0 A;  4IQV A;  4RT3 A;  7ICV A;  8ICT A;  4J9O A;  4QWD A;  4DF8 A;  3H40 A;  3NTU A;  2C22 A;  4LZG A;  7ICM A;  3H8J A;  1SKR A;  4ECZ A;  2ASD A;  5DQH A;  4Q8E A;  4PGY A;  4F91 B;  1D8L A;  9ICW A;  3H4D A;  5KG0 A;  4Z6C A;  3OSN A;  4UBB A;  2AQ4 A;  2ZUC A;  3LK9 A;  1L3S A;  4JV2 A;  9ICC A;  4QZG A;  4ED0 A;  4DL7 A;  8ICF A;  4DQP A;  4KLJ A;  3ISD A;  1TVA A;  4Q43 A;  4F50 A;  4UAZ A;  4GLX A;  4O3P A;  4J9P A;  2BGW A;  2MUT A;  2JZB A;  4YMM A;  5C5J A;  3Q8Q B;  1ZQT A;  5DGB A;  5CB1 A;  5DG8 A;  4Q45 A;  4RQ4 A;  2ZJ8 A;  4YMN A;  3MR5 A;  4FS2 A;  1ZQB A;  4K4H A;  4DS4 A;  2Y1J A;  5J0R A;  4UBC A;  7ICN A;  3IM1 A;  1Z3E B;  5KG2 A;  3PW0 A;  1NK9 A;  2XGQ A;  4BDP A;  1BPE A;  5J0T A;  1ZQD A;  4KLU A;  3C21 A;  1S97 A;  2HHV A;  4PGQ A;  1LB2 B;  2XY7 A;  1KFT A;  4Q44 A;  3PW2 A;  3GDX A;  4ED3 A;  1SL2 A;  4DQR A;  8ICO A;  5KFK A;  4EBC A;  5TZV A;  4B9L A;  2UVV A;  4MFC A;  3RBD A;  4NLN A;  4I2B A;  2WTF A;  4GC6 A;  4KN7 A;  4UB1 A;  5KFI A;  3PW4 A;  4YP3 A;  2XY5 A;  4C8L A;  4K4G A;  3JPN A;  2BCU A;  4DSL A;  5IIJ A;  1ZQM A;  4M6W A;  4GXJ A;  3QEA Z;  4YVZ A;  2FMS A;  5KFM A;  4BWJ A;  9ICN A;  5DKW A;  1JXL A;  3HW8 A;  3Q8M A;  9ICJ A;  1B22 A;  4P4O A;  4EYI B;  1ARO P;  3V6K A;  4I2C A;  3RAX A;  4YFK A;  3KHH A;  2PFO A;  4ECS A;  1KFS A;  7ICP A;  3RB6 A;  2JEI A;  7ICO A;  9ICF A;  3RJG A;  4X5V A;  1RXW A;  3Q8P B;  4DQS A;  4B9U A;  1RPL A;  1QTM A;  4YMO A;  2NRZ A;  3KHR A;  4EBE A;  5KFD A;  5IIM A;  4FBT A;  4RPX A;  4TUR A;  1BPY A;  4FBU A;  4F92 B;  3THV A;  2HW3 A;  1X2I A;  4M9J A;  4DSK A;  5KFF A;  4KLQ A;  3MR6 A;  5JUM A;  3EYZ A;  2FLP A;  3ZDB A;  1TK5 A;  4C8O A;  5J2K A;  1HJP A;  3LWL A;  2HVI A;  3ISB A;  4HYK A;  2AGP A;  5CR0 A;  1DOQ A;  4GXK A;  3AUO A;  2P6R A;  5DQI A;  5KG5 A;  4GXI A;  3OSP A;  1U45 A;  1A77 A;  2C2E A;  4ELV A;  4F2S A;  3EPI A;  1L3T A;  1SZP A;  4I27 A;  3SV4 A;  4DSE A;  2AJQ A;  1UT5 A;  2AQ0 A;  5L9X A;  2BQR A;  4YD2 A;  4KLT A;  5DB8 A;  3RRH A;  3GV7 B;  5CJ7 A;  4M9L A;  2PXI A;  5DQG A;  4YR2 A;  5KG6 A;  3QEB Z;  5KFT A;  4TQS A;  2W8L A;  2R8G A;  4KIT B;  2MUT B;  4ECT A;  4EZ6 A;  4RQ7 A;  4TUS A;  1S0M A;  4O9M A;  5KG3 A;  1ZQQ A;  1QSL A;  2BR0 A;  3V6J A;  2ISO A;  4KTQ A;  5DBC A;  4B9N A;  2ZUB A;  1UA0 A;  1ZQI A;  3RJE A;  1KTQ A;  5DG9 A;  4F4W A;  2J6T A;  5KFY A;  5J0X A;  1NKB A;  1EXN A;  5III A;  3PR4 A;  1ZQX A;  1BPD A;  1PZN A;  3GII A;  5J2I A;  2IHN A;  4UB4 A;  3GIK A;  3BQT A;  4RZR A;  3C5G A;  7ICU A;  4EZ9 A;  1D9D A;  1RYR A;  1JXE A;  5CP2 A;  2FLL A;  2V9W A;  9ICL A;  3IHQ B;  5KT4 A;  4ECW A;  3RB3 A;  3H4B A;  1S10 A;  4IQW A;  2I1Q A;  4ECX A;  5DDM A;  4TUP A;  2IBK A;  4DS5 A;  4QZH A;  3QZ8 A;  1BPB A;  4M6W B;  1L3U A;  5HP4 A;  5KG7 A;  3C5F A;  1KSP A;  4JK1 A;  2PI4 A;  3GV5 B;  4IR9 A;  2F1I A;  3NGD A;  5L1I A;  2BHN A;  2V4Q A;  4KLO A;  2KFN A;  3T5H A;  3ISC A;  3RJF A;  3PNC A;  5HHH A;  4RU9 A;  3PX6 A;  1NKE A;  2VA8 A;  7ICQ A;  4DOB A;  9ICS A;  1HUO A;  3QZ7 A;  2XC9 A;  4I2A A;  3GV8 B;  2NRX A;  4QW9 A;  1NK4 A;  2ISP A;  3UXN A;  4BXO B;  4NLZ A;  4I2I A;  5J2J A;  4R8U A;  4ECQ A;  5DGA A;  3EZ5 A;  3PW7 A;  4DFP A;  4F2R A;  4QZ9 A;  5EOZ A;  3JPP A;  1T7P A;  5J0U A;  3Q8L A;  7ICJ A;  8ICP A;  7ICS A;  2DFL A;  5EWG A;  5HML A;  4F5O A;  3C23 A;  4DO9 A;  4Z6F A;  4M9N A;  4K4I A;  2PFP A;  4I2H A;  2JEJ A;  4KLG A;  2KFZ A;  5KFS A;  2ASJ A;  4IQT A;  3KTQ A;  3B0Y A;  3ZDD A;  4DL6 A;  4F8R A;  1S0O A;  2NRT A;  5HMM A;  3TFR A;  5KT5 A;  3BQ2 A;  2BCS A;  4GC7 A;  4CCH A;  3BQ1 A;  5KFW A;  5CWR A;  4PHD A;  5KFU A;  4DFJ A;  3ETL A;  4R65 A;  4MF2 A;  2VA3 A;  4MFF A;  1COO A;  4F4X A;  4KLD A;  2ZUD A;  3MFH A;  4IRC A;  5J2B A;  1ZYQ A;  3JPS A;  2BQU A;  2BQ3 A;  1D9F A;  3C2K A;  4PPX A;  4UB2 A;  3PR5 B;  2UVU A;  5F9L A;  4DL2 A;  8ICS A;  4M9G A;  9ICH A;  4YD1 A;  4JWN A;  1Z00 A;  5L1J A;  4QW8 A;  5KFC A;  5J0O A;  1BPX A;  3GIL A;  2F1J A;  1ZQY A;  3C1Z A;  4JV1 A;  4XQ8 A;  9ICG A;  4DLE A;  4NM1 A;  5J2D A;  3RTV A;  3RBE A;  4LVS A;  1NK6 A;  4EEY A;  4R64 A;  1ZET A;  4ELT A;  4O5C A;  7ICG A;  4RT2 A;  3LDA A;  4KLM A;  2W9C A;  3OJS A;  3N4M B;  4KMU A;  9ICR A;  4YQW A;  3HPO A;  2A1J A;  1L3V A;  2PI5 A;  4MEY A;  4C8N A;  5KFO A;  8ICX A;  3ZDE A;  4DOA A;  3KHG A;  4KN4 A;  1ZQK A;  4YXJ A;  4RPZ A;  3GIM A;  2ALZ A;  4I2J A;  7ICF A;  4DSI A;  4I2D A;  1ZQN A;  8ICA A;  4RNO A;  4XUS A;  3V7K A;  5L1K A;  4ECR A;  1XC9 A;  4J9S A;  4R66 A;  2W9B A;  2R8J A;  3RJK A;  2PFQ A;  4B9S A;  4M0A A;  8ICB A;  2NRV A;  4PHE A;  3JPQ A;  4ED8 A;  4UB5 A;  3Q8K A;  3RAQ A;  2AU0 A;  4IRD A;  8ICC A;  5BOM A;  3OHA A;  5HNK A;  3T5L A;  9ICO A;  5DB7 A;  3UQ2 A;  5EWF A;  4F4Z A;  1ZQH A;  1IXR A;  5KFL A;  1UA1 A;  4KLI A;  4G3I A;  5IIL A;  4Z6D A;  1MQ2 A;  9ICT A;  5IIK A;  5KFX A;  4QZ8 A;  2JEF A;  4DQQ A;  2R8I A;  2MAX A;  1NK8 A;  2C2R A;  2KN7 A;  4NM2 A;  3BQ0 A;  4YG2 A;  1ZQW A;  2AGO A;  5KG1 A;  5KFH A;  5J2G A;  1U4B A;  2BPG A;  2BCQ A;  1S9F A;  3ZDA A;  2RDJ A;  3SV3 A;  2HVH A;  4IR1 A;  2W8K A;  2ZJA A;  3M9M B;  4MFA A;  1ZQR A;  4M9H A;  5J2F A;  1K1Q A;  4O3R A;  3N97 B;  4I28 A;  1JIH A;  3UXP A;  4RNM A;  1C7Y A;  9ICB A;  5KT7 A;  4QWC A;  3M9N B;  2JZB B;  4RQ3 A;  1XO1 A;  4JV0 A;  2JEG A;  4F4Y A;  3B0X A;  4P4P A;  4F5N A;  2XGP A;  1IM4 A;  5J0P A;  1MC8 A;  2P6U A;  4DSF A;  4UAY A;  1LV5 A;  2HHT A;  3SYZ A;  1T4G A;  2XY6 A;  1JX4 A;  1ZJM A;  3PMN A;  4QZC A;  3AU6 A;  1RXV A;  4YR3 A;  3JPT A;  3T3F A;  3ZDC A;  5J2C A;  3RH4 A;  1T8E A;  4R63 A;  3M9O B;  1U49 A;  4QZD A;  4PGX A;  1U47 A;  1QSS A;  1ZQS A;  4EYH B;  5KFN A;  2HHX A;  2FLN A;  3G6X A;  9ICI A;  3PX4 A;  4FS1 A;  2HHU A;  1ZQG A;  4DFM A;  4F93 B;  2I9G A;  2BCR A;  4DWI A;  2BPC A;  3G6V A;  3RB0 A;  2VAN A;  5J0W A;  4UB3 A;  3GQC A;  4F5Q A;  3PX0 A;  4RQ2 A;  1BGX T;  2W9C B;  3RR8 A;  1V9P A;  1U9L A;  3OJU A;  4FO6 A;  2M9N A;  3V6H A;  1TV9 A;  9ICU A;  4ELU A;  2BKE A;  1NJY A;  9ICX A;  1N56 A;  4O3N A;  1ZQU A;  3M8R A;  3RJJ A;  1A76 A;  3RH6 A;  5J0Y A;  2J6U A;  5KFZ A;  2AGQ A;  4B9T A;  4JWM A;  5KT2 A;  5DBB A;  3OGU A;  2W9B B;  5J2A A;  4UQG A;  5DB6 A;  1RZT A;  4NLG A;  4KLE A;  8ICG A;  9ICM A;  7ICL A;  5D49 A;  4RQ1 A;  4QZA A;  4M04 A;  4QZF A;  1Y88 A;  3JPO A;  4DL4 A;  3EPG A;  3RJH A;  1X9W A;  8ICE A;  1XWL A;  1KEJ A;  1NJX A;  3TAQ A;  5KFJ A;  5DG7 A;  4YN4 A;  7ICT A;  4RPY A;  1XS9 D;  5J0S A;  3SZ2 A;  4RQ8 A;  3C2L A;  8ICW A;  3V7L A;  9ICE A;  4ZH4 A;  2BCV A;  8ICL A;  1L5U A;  2OWO A;  1RYS A;  4DF4 A;  7ICE A;  1ZQE A;  4I2F A;  9ICA A;  2IHM A;  1ZQP A;  4BWM A;  1CEZ A;  3UPQ A;  2UVR A;  4DFK A;  4F4K A;  1ZQJ A;  3V7J A;  4MF8 A;  3TFS A;  5KG4 A;  4I2E A;  4RQ6 A;  3RH5 A;  3ORY A;  1TAQ A;  1NJW A;  4YXM A;  3MBY A; 
#chains in the Genus database with same CATH topology
 2ZIV B;  3MDC A;  1KQQ A;  5IIO A;  3D6J A;  2D8C A;  5DLF A;  4O3O A;  2FE9 A;  4Y2S A;  3UQ0 A;  4ED6 A;  4RQ0 A;  3MGV A;  1SZH A;  1WCL A;  3ZD9 A;  4NL9 A;  3HT3 A;  2H5X A;  1S8O A;  2R18 A;  2R8H A;  5D4B A;  4Z6E A;  4E0D A;  8ICH A;  1N61 A;  1H38 A;  4M47 A;  2EDU A;  1OXJ A;  3PML A;  4UAV A;  2W9A A;  2LYH A;  1XU4 A;  2YQE A;  4EBD A;  1X9M A;  5KT3 A;  3V72 A;  2DPJ A;  2MU2 A;  1KW4 A;  5J8Y A;  1SL1 A;  4O3Q A;  4J9Q A;  2ZJ5 A;  3K4G A;  3PSF A;  4J9K A;  2JRZ A;  5EE9 A;  8ICM A;  4JUZ A;  4P2H A;  3NVW A;  3BDP A;  1KDH A;  3JPR A;  4PHA A;  4MEX A;  2BDP A;  9ICV A;  8ICI A;  5AM1 A;  1NOM A;  4DEZ A;  1TFR A;  1X9X A;  9ICK A;  1XSL A;  4KLS A;  3CW2 C;  1NJZ A;  3ZD8 A;  3RB4 A;  5ALN A;  1JN3 A;  2JHD A;  5AI0 A;  4DOC A;  4C8K A;  5CHG A;  1VLB A;  4OCZ A;  4ECV A;  8ICQ A;  4QWB A;  3NVV A;  4DL5 A;  1JUD A;  5B5E U;  4F5P A;  1FFV A;  1U48 A;  5EE3 A;  1D8Y A;  1NKC A;  2XO7 A;  2KZM A;  3AQE A;  4ED2 A;  1S76 D;  4M2Y A;  3TAD A;  5DLG A;  2FJ6 A;  1TAU A;  3MR2 A;  4XA5 A;  3LWM A;  4HAI A;  4ED1 A;  4GIB A;  3FM9 A;  1TAM A;  2LM1 A;  3BZK A;  5KFB A;  4QNL A;  4PH5 A;  3K75 D;  4RT3 A;  4OJ5 A;  4DF8 A;  2C22 A;  4QJF B;  3H8J A;  1SKR A;  4PGY A;  3IRU A;  2NV3 A;  3H4D A;  5KG0 A;  2ZUC A;  3LK9 A;  1L3S A;  4JV2 A;  1PK3 A;  2MSN A;  4DQP A;  1MN8 A;  4GLX A;  1JRP A;  2MUT A;  1ZQT A;  5DGB A;  5DG8 A;  3IM1 A;  1X42 A;  3PW0 A;  5AKK A;  3C21 A;  3DEE A;  1S97 A;  2HHV A;  2XY7 A;  1SL2 A;  2W3S A;  1PVR A;  2UVV A;  3PW4 A;  4YP3 A;  3JPN A;  2BCU A;  1ZQM A;  4UAR A;  3QUT A;  4GXJ A;  2KIC A;  9ICN A;  4C4R A;  3N7R C;  9ICJ A;  1B22 A;  4NLC A;  4I2C A;  3KHH A;  2JEI A;  3RJG A;  1ZD4 A;  3QU2 A;  4DQS A;  1QTM A;  2NRZ A;  2JMG A;  4EBE A;  2E5S A;  2EAM A;  4DSK A;  4KLQ A;  2FLP A;  5KL8 B;  4P0P B;  3D2Q A;  4GXI A;  1A77 A;  4I27 A;  4ELV A;  1L3T A;  2AJQ A;  5CJ7 A;  3I76 A;  4YR2 A;  2W8L A;  4NL9 C;  4ECT A;  2ISO A;  4B9N A;  1ZQI A;  3M6Z A;  1BPD A;  1PZN A;  2WHE A;  1O03 A;  2FLL A;  1COK A;  2Y9U A;  3WKA A;  5J8Y C;  3IHQ B;  4ECX A;  4PZN A;  4DS5 A;  4QZH A;  4JK1 A;  4IR9 A;  2F1I A;  2KFN A;  4KLO A;  2ODG A;  4RU9 A;  4DOB A;  1HUO A;  2XC9 A;  2KIV A;  2ISP A;  4I2I A;  4ECQ A;  2B6G A;  8ICP A;  1BNP A;  2WB1 F;  2NO5 A;  1S0O A;  3BQ1 A;  5KFW A;  4PHD A;  4ZOH C;  2M0N A;  4LJX A;  5ALE A;  2DUY A;  2KKP A;  5J2B A;  1ZYQ A;  2BQ3 A;  3AMZ A;  4PPX A;  4UB2 A;  2UVU A;  5F9L A;  4DL2 A;  5AI9 A;  5KFC A;  5J0O A;  1BPX A;  3TAD C;  4JV1 A;  1XNS A;  4XQ8 A;  4C4S A;  4DLE A;  5J2D A;  3RBE A;  3C29 A;  2G5H B;  2XVT A;  4RT2 A;  4KLM A;  4KMU A;  3HPO A;  2K8C B;  3UMB A;  1F44 A;  2ALZ A;  3GIM A;  2KJ9 A;  8ICA A;  4RNO A;  4XUS A;  5ALK A;  2R8J A;  4US9 A;  4B9S A;  1K5O A;  8ICB A;  2HBK A;  4PHE A;  2E1E A;  3OHA A;  9ICO A;  5EWF A;  1UA1 A;  5IIL A;  9ICT A;  4OJP A;  1MQ2 A;  1WUD A;  3SR6 A;  2LYA A;  2AGO A;  4BX9 C;  4IR1 A;  2ZJA A;  3H8M A;  1ZQR A;  2EH9 A;  5J2F A;  4O3R A;  3N97 B;  2BDU A;  3UXP A;  9ICB A;  1V85 A;  2LBO A;  4QWC A;  1XO1 A;  2ZIV A;  4A8E A;  1IV8 A;  3B0X A;  3QU9 A;  2XGP A;  2YMM A;  4DSF A;  3L4P A;  1JX4 A;  1QQ6 A;  3A0B U;  5AIB A;  3T3F A;  3RH4 A;  1QSS A;  4QZD A;  1FEZ A;  3WKC A;  1ZQG A;  4F93 B;  2BCR A;  3C28 A;  4FZN A;  4F5Q A;  5H2F U;  1U9L A;  3VC8 A;  1WWU A;  1ZQU A;  3QX7 A;  5AKE A;  5KFZ A;  2AGQ A;  2W9B B;  2QAR A;  1RZT A;  2K4P A;  4NLG A;  4KLE A;  9ICM A;  5D49 A;  4QZA A;  3GU3 A;  3EPG A;  3RJH A;  2B0C A;  8ICE A;  4UB8 U;  3UMG A;  5KFJ A;  5DG7 A;  2RLT A;  3C2L A;  1JRO A;  1L5U A;  2OWO A;  3RFA A;  3CRX A;  5CEH A;  2UVR A;  2YB4 A;  1Z19 A;  3V7J A;  1OW5 A;  2Y9T A;  3TAC B;  3ORY A;  1NJW A;  4ACO A;  4YXM A;  3MBY A;  1F5S A;  3PO4 A;  4O5E A;  2BPF A;  1XSN A;  5AKL A;  4QZI A;  2FPK A;  4KMO B;  4Y2R A;  2HOQ A;  3UMC A;  2NRW A;  5J0Q A;  4NY8 A;  2RDI A;  3RRG A;  3MFI A;  3CYM A;  5BPC A;  2Q0Z X;  8ICK A;  5JU5 A;  7ICK A;  1L7O A;  4YR0 A;  1XO0 A;  2G5I B;  2GLE A;  1BVS A;  2P66 A;  2R8K A;  4P4M A;  4Y2P A;  2C28 A;  5L1L A;  2YMP A;  4BXO A;  1K1S A;  3KZX A;  1RDF A;  1DGS A;  2KZ3 A;  1BPZ A;  8ICR A;  2DPI A;  3EW9 A;  3TI0 A;  5AKI A;  3N7P D;  5D46 A;  2PFN A;  2FPM A;  1KRP A;  4UAT A;  5HHI A;  2ZTE A;  3M6K A;  4DSJ A;  5EWE A;  2HHW A;  4F5R A;  3L5K A;  5AM3 A;  2MRL A;  5KTQ A;  3HIL A;  2HBM A;  2GH1 A;  4Y2Q A;  5AK3 A;  2XCA A;  3CP8 A;  4FZL A;  4C4T A;  2W55 A;  5KFR A;  3TAN A;  3Q8R B;  1QH9 A;  3FDS A;  3E2E A;  1MSW D;  5KFG A;  1KL9 A;  4I29 A;  2HHS A;  2ATL A;  4MHV A;  2KMD A;  5KFE A;  9ICQ A;  1NK5 A;  4I2G A;  1SL0 A;  3C1Y A;  4PL2 A;  3OHB A;  3TKA A;  2PMZ C;  2DL0 A;  3T5K A;  1B43 A;  1NK7 A;  2EAN A;  3T5J A;  4RNN A;  4KLF A;  5KFQ A;  2JGA A;  8ICT A;  1T94 A;  2HDO A;  3ETR A;  1ZD2 P;  4LZG A;  7ICM A;  1ZRM A;  5F3X B;  4ECZ A;  2ASD A;  3SAH A;  5AKX A;  2VIX A;  1FO4 A;  3OSN A;  2AQ4 A;  1UHU A;  9ICC A;  4ED0 A;  2I6X A;  4Q43 A;  4FZM A;  5JRT A;  3MR5 A;  4Q45 A;  4FS2 A;  2D3D A;  4YMN A;  3QU5 A;  4K4H A;  7ICN A;  1Z3E B;  2RRD A;  5KG2 A;  1NK9 A;  3PST A;  2XGQ A;  1BPE A;  2HSZ A;  5AI5 A;  4CF4 A;  3PW2 A;  8ICO A;  4EBC A;  3AL0 B;  4NLN A;  2WTF A;  2HOI A;  5KFI A;  3WK9 A;  1SWV A;  2E8M A;  2H3Q A;  5KFM A;  4BWJ A;  1CI4 A;  3HW8 A;  1O08 A;  2QAR B;  3QU4 A;  3T79 A;  1ARO P;  3V6K A;  4KX5 A;  2PFO A;  1KFS A;  7ICP A;  3RB6 A;  9ICF A;  3WKE A;  4X5V A;  2JH1 A;  4U7C A;  1NZB A;  2F77 X;  5E79 U;  2ESE A;  5ALP A;  3THV A;  5AM2 A;  1X2I A;  1L7N A;  1HJP A;  3ISB A;  5CR0 A;  5KG5 A;  3OSP A;  4F2S A;  1Z4O A;  3EPI A;  1SZP A;  4DSE A;  3PSI A;  3KD3 A;  2AQ0 A;  2BQR A;  5DB8 A;  1JAL A;  4FFD A;  1A6S A;  2AH5 A;  5KG6 A;  2WAQ C;  5KFT A;  1HIW A;  4TQS A;  2RP5 A;  3EUB 2;  4EZ6 A;  2PKE A;  4CDG A;  4RQ7 A;  3ICX A;  4O9M A;  2KIW A;  4KTQ A;  3KKA A;  3V6J A;  4OJO A;  2J6T A;  5J0X A;  1NKB A;  5III A;  4IS7 A;  3GII A;  2LPE A;  3BQT A;  1D9D A;  1RYR A;  5CP2 A;  9ICL A;  1L8L A;  4RQM A;  4ECW A;  2I1Q A;  4TUP A;  1KN5 A;  1BPB A;  4M6W B;  3QZ8 A;  5HP4 A;  1L3U A;  2ES6 A;  3C5F A;  2VKQ A;  1DGJ A;  5L1I A;  2V4Q A;  3T5H A;  2P35 A;  5HHH A;  5EE0 A;  1URJ A;  2G08 A;  4CRX A;  5GTI U;  3UXN A;  4BXO B;  1L6N A;  2NYV A;  4QIW F;  5AKJ A;  3JPP A;  7ICJ A;  7ICS A;  4IC9 A;  4F5O A;  2E8O A;  5ALH A;  2IOF A;  4DO9 A;  4Z6F A;  4K4I A;  1UCV A;  2NO4 A;  2JEJ A;  2KFZ A;  1LKY B;  4IQT A;  1MA7 A;  3KTQ A;  3B0Y A;  4DL6 A;  3ALR A;  3TFR A;  5KT5 A;  3BQ2 A;  2KJ8 A;  2MA1 A;  1SV0 A;  4CCH A;  5KFU A;  4MF2 A;  4MFF A;  3JPS A;  2BQU A;  2LM4 A;  4FE3 A;  4JB3 A;  3C2K A;  8ICS A;  2K89 A;  4YD1 A;  4JWN A;  1Z00 A;  5L1J A;  4QW8 A;  3GIL A;  2DQN B;  1IG6 A;  1RYU A;  1NK6 A;  3QU7 A;  3E58 A;  4O5C A;  1ZET A;  3QUQ A;  2PI5 A;  4MEY A;  3ZDE A;  1ZQK A;  4YXJ A;  5ALT A;  7ICF A;  4I2J A;  1Q46 A;  4I2D A;  3F53 A;  1ZQN A;  1RQN A;  4ECR A;  4R66 A;  2W9B A;  4CF5 A;  4M0A A;  2NRV A;  3JPQ A;  3CNH A;  5BOM A;  2KOB A;  3T5L A;  3R9K A;  4KLI A;  4G3I A;  1SXD A;  5KFL A;  5CRX A;  1PK1 A;  3AEV A;  4Y2J A;  3AQF A;  4QZ8 A;  2C2R A;  2N1R A;  2J6S A;  3N7S C;  2BCQ A;  5KFH A;  5J2G A;  1PVP A;  2HVH A;  4P0Q A;  3DV9 A;  1LVH A;  4C7Y A;  1K1Q A;  1JIH A;  4RNM A;  4AYB F;  4F72 A;  3M9N B;  3KBB A;  5AI6 A;  4RQ3 A;  5ALG A;  2JEG A;  4F4Y A;  1IM4 A;  2P6U A;  2HHT A;  2XY6 A;  1T4G A;  3PMN A;  3AU6 A;  1RXV A;  4YR3 A;  3JPT A;  3ZDC A;  1YZ7 A;  2WF9 A;  4R63 A;  2KKV A;  1U47 A;  1ZQS A;  5KFN A;  4PL1 A;  2HHX A;  2FLN A;  9ICI A;  3PX4 A;  4FS1 A;  5AHX A;  2KEY A;  2KVS A;  2HHU A;  1KKX A;  4DFM A;  1IIP A;  1B4F A;  2I9G A;  4DWI A;  3RB0 A;  4UAS A;  5J0W A;  1X6J A;  1BGX T;  2W9C B;  2KHV A;  3OJU A;  1T3Q A;  1TV9 A;  4ELU A;  2Q4T A;  2BKE A;  1N56 A;  3M8R A;  4NJ8 A;  3UM9 A;  4JWM A;  2QLT A;  5KT2 A;  5DBB A;  3PZP A;  8ICG A;  2F8L A;  4PJ0 U;  3SEI A;  4QZF A;  1X9W A;  3WKD A;  2LKY A;  1NJX A;  1ZRN A;  3TAQ A;  2W43 A;  1P7D A;  4YN4 A;  1DRG A;  2F3N A;  3BS7 A;  4DF4 A;  7ICE A;  4UW9 A;  9ICA A;  1WYG A;  3HKZ C;  5KNI A;  2G06 A;  3KKA C;  3UPQ A;  4DFK A;  4F4K A;  3TFS A;  2XIC A;  4I2E A;  4RQ6 A;  3WK5 A;  3RH5 A;  3RH6 A;  5HR7 A;  5J29 A;  1CUK A;  2XI9 A;  8ICN A;  3BJY A;  1MQ3 A;  4XRH A;  5KFA A;  1KFD A;  3I28 A;  1SKW A;  2W9M A;  4PHP A;  8ICU A;  1SKS A;  1JMS A;  2F1H A;  2G07 A;  3MGH A;  3RR7 A;  1DK2 A;  3LYS A;  2RQ5 A;  2F8K A;  3QE9 Y;  1RM6 C;  3FYH A;  3SI8 A;  4J9N A;  2C2D A;  2Y0S C;  3H0R B;  2ASL A;  3WK6 A;  5ALV A;  4O0I A;  3LVW A;  4RUC A;  5ALI A;  5J2H A;  8ICZ A;  3E0F A;  4QZB A;  3FAH A;  1TKD A;  4QZE A;  1ZXI A;  4NLK A;  4O3S A;  5A0L A;  3GFK B;  4TUQ A;  1SV0 C;  2HCF A;  1UT8 A;  1TK8 A;  1N48 A;  3RJI A;  4IRK A;  5IIN A;  4IQU A;  3H8W A;  5KFP A;  1TK0 A;  7ICI A;  1XSP A;  3PVX A;  2F76 X;  2ZIX B;  1ZQC A;  3PO5 A;  1ZQA A;  1Z00 B;  2G0A A;  4LZD A;  2FMP A;  1ZQL A;  2WF6 A;  3H7I A;  3HP6 A;  4O5K A;  3HWT A;  2XCP A;  3IG5 A;  2BZF A;  7ICR A;  5DBA A;  2IA6 A;  3BS5 B;  1M6Y A;  1ZQZ A;  5AI8 A;  2KTQ A;  1FIQ A;  2I5H A;  5KAF U;  2DWQ A;  3G6Y A;  2ZTC A;  4BGD A;  3BZC A;  5DB9 A;  2FMQ A;  4RQ5 A;  4RUA A;  4J9R A;  4YCX A;  4DL4 A;  4M04 A;  3MGI A;  2FDR A;  3ONN A;  4KLL A;  5AIA A;  3HX0 A;  1J2M A;  8ICV A;  3F2B A;  1PK1 B;  5DDY A;  7ICV A;  4J9O A;  4QWD A;  3NTU A;  2F2A B;  4P0Q B;  4Q8E A;  4Y2U A;  4UAU A;  1N5W A;  4QZG A;  8ICF A;  3ISD A;  1QQ5 A;  5AK6 A;  4F50 A;  3QXG A;  4O3P A;  4J9P A;  2ZXI A;  4YMM A;  5C5J A;  1PVQ A;  2ZJ8 A;  1ZQB A;  1YZ6 A;  4DS4 A;  5J0R A;  4UBC A;  4BDP A;  3ED5 A;  1L7M A;  3J81 j;  1ZQD A;  4KLU A;  4PGQ A;  5AIC A;  1LB2 B;  1KFT A;  4ED3 A;  4DQR A;  5KFK A;  4MFC A;  3RBD A;  4OJ6 A;  4GC6 A;  3DDH A;  4KN7 A;  3IP4 B;  4UB1 A;  4C8L A;  1N60 A;  1FFU A;  4DSL A;  2EAO A;  4M6W A;  2KP7 A;  3QEA Z;  4YVZ A;  2KSO A;  2ZXH A;  3Q8M A;  4P4O A;  4EYI B;  2AHO B;  1N62 A;  4YFK A;  7ICO A;  1HEK A;  3Q8P B;  2ZIU B;  4B9U A;  1RPL A;  3KZI U;  5IIM A;  4FBT A;  4RPX A;  4TUR A;  5AM5 A;  2Z7J A;  2YX8 A;  2HW3 A;  5AKH A;  3MR6 A;  5JUM A;  2JH7 A;  3ZDB A;  4C8O A;  2HVI A;  4HYK A;  1LKY A;  1DOQ A;  4GXK A;  5DQI A;  3AM9 A;  3SV4 A;  1UT5 A;  5TIS U;  3RF9 A;  4YD2 A;  4KLT A;  4M9L A;  2PXI A;  1J97 A;  4AP9 A;  2YML A;  1ED1 A;  4IL6 U;  4J03 A;  4TUS A;  3PSP A;  5G5H A;  4CE6 A;  5DBC A;  2ZUB A;  1UA0 A;  1KTQ A;  3QNM A;  5DG9 A;  4F4W A;  1Q8K A;  5J2I A;  1ZQX A;  3M7D A;  2IHN A;  4UB4 A;  4RZR A;  2AXT U;  4OO1 J;  2EZY A;  7ICU A;  2W7P A;  2K4E A;  4IQW A;  3RB3 A;  1GO3 F;  1NZP A;  1VDV A;  2IBK A;  1X6I A;  1KSP A;  2PI4 A;  3NGD A;  3QUC A;  5ALS A;  3ISC A;  3RJF A;  3PX6 A;  2VA8 A;  7ICQ A;  5JTI A;  3L3F X;  1WG8 A;  4QW9 A;  5J2J A;  2KV2 A;  4R8U A;  3EZ5 A;  4NV0 A;  4F2R A;  4QZ9 A;  5J0U A;  5AKG A;  5EWG A;  4BUG A;  5HML A;  2OCE A;  4UB6 U;  2HOF A;  3C23 A;  4M9N A;  1Z4N A;  2PFP A;  4I2H A;  4KLG A;  5T14 A;  5KFS A;  2ASJ A;  2YB1 A;  5L1M A;  4PZO A;  2K60 A;  2WF7 A;  4GC7 A;  5CWR A;  3ETL A;  4F4X A;  4KLD A;  3OPX A;  2ZUD A;  3D2S A;  3MFH A;  1UPH A;  4IRC A;  3AN1 A;  1D9F A;  9ICH A;  4G9B A;  5ALL A;  4M9G A;  2E8N A;  2H3I A;  1ZQY A;  3C1Z A;  9ICG A;  3RTV A;  2WB1 C;  4USA A;  4R64 A;  4ELT A;  4F71 A;  2W9C A;  3F2C A;  3OJS A;  3N4M B;  1PUZ A;  9ICR A;  4YQW A;  2A1J A;  5ALO A;  3GZF A;  8ICX A;  5KAI U;  1SGG A;  4DOA A;  2OHF A;  4RPZ A;  2D6F C;  1S5L U;  5ALR A;  4J9S A;  3RJK A;  2PFQ A;  2AU0 A;  4ED8 A;  4UB5 A;  3RAQ A;  4IRD A;  2E1F A;  1JI7 A;  5HNK A;  5DB7 A;  3UQ2 A;  1ZQH A;  1IXR A;  4Z6D A;  3QYP A;  5KFX A;  2JEF A;  2W3R A;  5EE1 A;  1NK8 A;  3BQ0 A;  4NM2 A;  1ZQW A;  5KG1 A;  3ZDA A;  1S9F A;  3SAF A;  3SV3 A;  2W8K A;  4OJL A;  4MFA A;  4M9H A;  4I28 A;  5KT7 A;  1Z1B A;  3NUQ A;  1KBU A;  2CN1 A;  4JV0 A;  1N5X A;  2E8P A;  4F5N A;  3D2N A;  2KNJ A;  2VJ5 A;  5AKZ A;  2QB0 A;  1UQV A;  1T8E A;  3M9O B;  1U49 A;  4NLB A;  4EYH B;  3A0H U;  3G6V A;  3GQC A;  4RQ2 A;  2KSO B;  3H0L B;  1V9P A;  5K4L A;  3V6H A;  9ICU A;  9ICX A;  2EQY A;  1C20 A;  4O3N A;  1Q3V A;  4RQN A;  5G5G A;  2J6U A;  2YMQ A;  4Y2V A;  4U6P A;  4CNQ A;  5J2A A;  1ZOL A;  5DB6 A;  4UQG A;  4RQ1 A;  3N28 A;  3FC4 A;  1Y88 A;  3JPO A;  3WK4 A;  1XWL A;  1KEJ A;  2QB1 A;  1YT3 A;  2F44 A;  3WK8 A;  7ICT A;  2HBL A;  4RPY A;  1XS9 D;  3SZ2 A;  1RG6 A;  8ICW A;  3V7L A;  4ZH4 A;  8ICL A;  3HRD D;  2VJ4 A;  1B0X A;  4BWM A;  1CEZ A;  2O6K A;  1ZQJ A;  2DKX A;  4MF8 A;  2ZIW A;  5KG4 A;  1CRX A;  4ED7 A;  3AU2 A;  2ZIX A;  3I1Y A;  2G09 A;  3SAG A;  3NVY A;  3F5E A;  3PY8 A;  1T3N A;  5KFV A;  3MDA A;  4B9M A;  9ICP A;  3ZI4 A;  3GIJ A;  1WCN A;  2B21 A;  4UAW A;  3BS5 A;  1QLN A;  3H8S A;  7ICH A;  4Q8F A;  1ZQF A;  2CPR A;  4B9V A;  3IN5 A;  2VA2 A;  5CA7 A;  3TAP A;  1S77 D;  1ZD5 A;  1X9S A;  2GWS A;  4TQR A;  8ICJ A;  1HUZ A;  4DL3 A;  4DCC A;  1ZQV A;  2KD1 A;  3B9J A;  3IG8 A;  5ALX A;  3S6J A;  3MAB A;  3KOO A;  5ALY A;  3SMV A;  1ZJN A;  2A1A A;  4R8U B;  1SB3 C;  2GO7 A;  4C8M A;  2ZTD A;  2YN4 A;  2KZZ A;  2IMW P;  5AI4 A;  2CRX A;  3UXO A;  4F3O A;  4Y2T A;  3EWA A;  2Y1I A;  1NI3 A;  1ECW A;  1A0P A;  5B66 U;  5BOL A;  1S0N A;  4C80 A;  3PW5 A;  2LHT A;  4ECU A;  3SD7 A;  5KT6 A;  2UVW A;  2WF8 A;  2KG5 A;  3WK7 A;  1KLN A;  1DXS A;  2H3V A;  2V4R A;  2PMZ F;  1SIJ A;  4DLG A;  4ECY A;  4QWE A;  2HHQ A;  5ALF A;  4DQI A;  2JR5 A;  3MR3 A;  4NXZ A;  4EEL A;  4KLH A;  3HJE A;  3WU2 U;  2FPL A;  5J2E A;  1ZQO A;  3TQ1 A;  2A1J B;  2KE7 A;  5ALM A;  4C7Z A;  4QWA A;  3C2M A;  4GFJ A;  1F0M A;  8ICY A;  3M8S A;  5F9N A;  2H3Z A;  4J9L A;  3KHL A;  3Q8S B;  4KX3 A;  2H3F A;  3TAR A;  1S0V A;  1QSY A;  2K4I A;  4J9M A;  2ZIU A;  3PV8 A;  1NK0 A;  4IQV A;  2W04 A;  1V38 A;  1DK3 A;  3H40 A;  5DQH A;  5ALZ A;  4F91 B;  5KL1 B;  2HMX A;  1D8L A;  9ICW A;  5HR6 A;  2KVC A;  3IDW A;  4Z6C A;  1D8B A;  4UBB A;  3NVZ A;  2LMR A;  4DL7 A;  2RHF A;  4KLJ A;  1TVA A;  4UAZ A;  4DFD A;  2BGW A;  2QB0 B;  2JZB A;  3Q8Q B;  5CB1 A;  4RQ4 A;  2Y1J A;  2E3T A;  5J0T A;  4Q44 A;  2WF5 A;  3GDX A;  5C0Y A;  3IV6 A;  3K1Z A;  5TZV A;  4B9L A;  1VJ5 A;  2K8B B;  4I2B A;  2XY5 A;  4K4G A;  5IIJ A;  2WAQ F;  2FMS A;  3NS1 A;  5DKW A;  1JXL A;  4CF3 A;  4US8 A;  1QCK A;  3RAX A;  1X40 A;  4ECS A;  3KFU F;  5ALJ A;  1RXW A;  4YMO A;  3KHR A;  5KFD A;  2DKZ A;  1SWW A;  1BPY A;  4FBU A;  4F92 B;  4M9J A;  3NAS A;  5KFF A;  3EYZ A;  1TK5 A;  1L8O A;  5J2K A;  3LWL A;  2AGP A;  2KHQ A;  1SV4 A;  2P6R A;  3AUO A;  2ZIW B;  5AK5 A;  1U45 A;  1N63 A;  2C2E A;  1ZQ1 C;  5L9X A;  2OEH A;  3RRH A;  2DGZ A;  3U26 A;  3GV7 B;  5DQG A;  3QEB Z;  2R8G A;  3WKB A;  4O3M A;  4KIT B;  2MUT B;  2W7O A;  2JXJ A;  1S0M A;  4EX6 A;  2OM6 A;  5KG3 A;  1ZQQ A;  2BR0 A;  1QSL A;  4OD0 A;  3RJE A;  5KFY A;  5ALU A;  1EXN A;  3PR4 A;  3GIK A;  2HBJ A;  1TE2 A;  3C5G A;  1Q3U A;  4CGZ A;  4EZ9 A;  1JXE A;  2V9W A;  2DF4 B;  5KT4 A;  1S10 A;  3H4B A;  5DDM A;  2EAP A;  3H0M B;  5KG7 A;  3GV5 B;  4EEK A;  2BHN A;  2LYB A;  1QQ7 A;  3F5A A;  3PNC A;  1NKE A;  9ICS A;  3OTQ A;  3QZ7 A;  4I2A A;  5FP0 A;  3GV8 B;  2NRX A;  1NK4 A;  5ALQ A;  4NLZ A;  5ALW A;  2KK0 A;  5DGA A;  2L5Y A;  3PW7 A;  4DFP A;  5EOZ A;  1T7P A;  3Q8L A;  2DFL A;  2W54 A;  1X66 A;  2KJ5 A;  1Z1V A;  2A3V A;  3M1Y A;  3ZDD A;  4F8R A;  2NRT A;  5HMM A;  2BCS A;  2K4H A;  5AKY A;  3QUB A;  1ZD3 A;  4DFJ A;  4R65 A;  2VA3 A;  1COO A;  3PR5 B;  3SEN A;  2OH2 A;  2ZG6 A;  2IOH A;  2F1J A;  3NRZ A;  5AM0 A;  5ALD A;  4QIW C;  4NM1 A;  4LVS A;  4EEY A;  3NRW A;  7ICG A;  3LDA A;  2QKQ A;  3LVV A;  3SQI A;  1L3V A;  4C8N A;  5KFO A;  3KHG A;  4KN4 A;  2YTU A;  4DSI A;  4WJ3 B;  3V7K A;  5L1K A;  1XC9 A;  2DBY A;  1AQ6 A;  5AM4 A;  3Q8K A;  2XID A;  8ICC A;  4Y2X A;  4F4Z A;  2FI1 A;  5IIK A;  4DQQ A;  2R8I A;  2MAX A;  3K1R B;  2KN7 A;  1V97 A;  4YG2 A;  1U4B A;  2BPG A;  3F2D A;  2RDJ A;  2W03 A;  3M9M B;  4NWI A;  1SXE A;  2YY6 A;  1WWV A;  2JV3 A;  2K8A A;  1C7Y A;  2OYY A;  1OUQ A;  2JZB B;  1L7P A;  4P4P A;  4EEN A;  5J0P A;  3VCB A;  1MC8 A;  4Y2Y A;  4UAY A;  1LV5 A;  2LI6 A;  3SYZ A;  2HI0 A;  1ZJM A;  4QZC A;  2OXO A;  1N2X A;  2EZZ A;  5J2C A;  2A19 A;  4ICA A;  4PGX A;  2CXY A;  4BJQ A;  3G6X A;  3O0F A;  2IOF K;  4JMU A;  2BPC A;  4C0Z A;  2VAN A;  3HKZ F;  1NNL A;  4UB3 A;  3PX0 A;  2WFA A;  5GTH U;  3RR8 A;  4FO6 A;  2M9N A;  4AYB C;  1NJY A;  1RQL A;  2W11 A;  3RJJ A;  1A76 A;  5J0Y A;  4B9T A;  3OGU A;  1J2N A;  3MC1 A;  5AK4 A;  7ICL A;  3BQ7 A;  4B6J A;  5J0S A;  2GOL A;  4RQ8 A;  9ICE A;  4EX7 A;  2BCV A;  1RYS A;  1ZQE A;  4I2F A;  2EZX A;  2IHM A;  1ZQP A;  2Y0S F;  4P0P A;  1BNO A;  1TAQ A; 
#chains in the Genus database with same CATH homology
 5J29 A;  4ED7 A;  3AU2 A;  1CUK A;  3PO4 A;  4O5E A;  8ICN A;  3MDC A;  3BJY A;  2BPF A;  1MQ3 A;  1XSN A;  5IIO A;  4XRH A;  5KFA A;  1KFD A;  3PY8 A;  5DLF A;  4O3O A;  1T3N A;  4QZI A;  5KFV A;  3UQ0 A;  3MDA A;  4ED6 A;  4RQ0 A;  1SKW A;  4B9M A;  9ICP A;  2W9M A;  4PHP A;  2FPK A;  3GIJ A;  8ICU A;  1WCN A;  2B21 A;  1SKS A;  1JMS A;  2F1H A;  4UAW A;  1WCL A;  3ZD9 A;  3HT3 A;  3MGH A;  2H5X A;  3RR7 A;  2R8H A;  5D4B A;  4Z6E A;  4E0D A;  8ICH A;  2J6S A;  1H38 A;  3H8S A;  3QE9 Y;  1QLN A;  2NRW A;  5J0Q A;  4M47 A;  2RDI A;  4NY8 A;  3RRG A;  3MFI A;  1ZQF A;  4Q8F A;  3PML A;  3FYH A;  3SI8 A;  5BPC A;  4J9N A;  2W9A A;  2C2D A;  2Q0Z X;  2VA2 A;  4B9V A;  5CA7 A;  3TAP A;  2LYH A;  1XU4 A;  1S77 D;  8ICK A;  4EBD A;  1X9S A;  1X9M A;  4TQR A;  5KT3 A;  2ASL A;  2GWS A;  8ICJ A;  3V72 A;  1HUZ A;  7ICK A;  2DPJ A;  4YR0 A;  4DL3 A;  1ZQV A;  3MAB A;  1BVS A;  2P66 A;  2R8K A;  1SL1 A;  4O0I A;  1ZJN A;  4RUC A;  4O3Q A;  4R8U B;  5J2H A;  8ICZ A;  4P4M A;  4J9Q A;  2ZJ5 A;  3K4G A;  4C8M A;  2ZTD A;  4QZB A;  2C28 A;  1TKD A;  2KZZ A;  4J9K A;  2IMW P;  4QZE A;  5L1L A;  4NLK A;  4O3S A;  3UXO A;  3GFK B;  4F3O A;  8ICM A;  4BXO A;  3EWA A;  4TUQ A;  4JUZ A;  2Y1I A;  4P2H A;  1UT8 A;  1TK8 A;  3BDP A;  1N48 A;  1KDH A;  5BOL A;  3RJI A;  1S0N A;  3JPR A;  4IRK A;  4PHA A;  1K1S A;  5IIN A;  3PW5 A;  1DGS A;  4MEX A;  2BDP A;  9ICV A;  5KFP A;  4IQU A;  3H8W A;  2KZ3 A;  1TK0 A;  4ECU A;  1BPZ A;  8ICI A;  5KT6 A;  1NOM A;  4DEZ A;  2UVW A;  1TFR A;  7ICI A;  8ICR A;  2DPI A;  3EW9 A;  3TI0 A;  1XSP A;  9ICK A;  3PVX A;  1XSL A;  4KLS A;  1NJZ A;  3ZD8 A;  5D46 A;  3RB4 A;  2PFN A;  2FPM A;  1KLN A;  1JN3 A;  1KRP A;  1ZQC A;  2V4R A;  3PO5 A;  4DOC A;  4C8K A;  5CHG A;  1ZQA A;  5HHI A;  2ZTE A;  4DLG A;  1Z00 B;  4ECV A;  4ECY A;  4QWE A;  4LZD A;  5EWE A;  4DSJ A;  2HHW A;  8ICQ A;  4F5R A;  2HHQ A;  4QWB A;  4DQI A;  2FMP A;  3MR3 A;  1ZQL A;  4NXZ A;  5KTQ A;  4DL5 A;  3H7I A;  3HP6 A;  4KLH A;  4O5K A;  3HWT A;  4F5P A;  2XCP A;  1U48 A;  7ICR A;  2FPL A;  5DBA A;  1D8Y A;  5J2E A;  1ZQO A;  2IA6 A;  1NKC A;  1ZQZ A;  2XO7 A;  3TQ1 A;  2KZM A;  2A1J B;  2KTQ A;  2XCA A;  3G6Y A;  5KFR A;  3TAN A;  4QWA A;  3Q8R B;  4ED2 A;  2ZTC A;  4M2Y A;  1S76 D;  4BGD A;  3C2M A;  3FDS A;  3E2E A;  1MSW D;  8ICY A;  5DB9 A;  3M8S A;  5DLG A;  5KFG A;  1TAU A;  2FMQ A;  4RQ5 A;  4RUA A;  4XA5 A;  4YCX A;  5F9N A;  3MR2 A;  3LWM A;  4J9R A;  3MGI A;  4J9L A;  4ED1 A;  2ATL A;  4I29 A;  2HHS A;  7ICH A;  3KHL A;  5KFE A;  3Q8S B;  9ICQ A;  1NK5 A;  4I2G A;  1SL0 A;  3C1Y A;  3OHB A;  4KLL A;  5KFB A;  3TAR A;  3HX0 A;  1S0V A;  3T5K A;  4PH5 A;  1B43 A;  1NK7 A;  3K75 D;  3T5J A;  1QSY A;  8ICV A;  4RNN A;  4KLF A;  5KFQ A;  4J9M A;  5DDY A;  3PV8 A;  1NK0 A;  4IQV A;  4RT3 A;  7ICV A;  8ICT A;  4J9O A;  4QWD A;  4DF8 A;  3H40 A;  3NTU A;  2C22 A;  4LZG A;  7ICM A;  3H8J A;  1SKR A;  4ECZ A;  2ASD A;  5DQH A;  4Q8E A;  4PGY A;  4F91 B;  1D8L A;  9ICW A;  3H4D A;  5KG0 A;  4Z6C A;  3OSN A;  4UBB A;  2AQ4 A;  2ZUC A;  3LK9 A;  1L3S A;  4JV2 A;  9ICC A;  4QZG A;  4ED0 A;  4DL7 A;  8ICF A;  4DQP A;  4KLJ A;  3ISD A;  1TVA A;  4Q43 A;  4F50 A;  4UAZ A;  4GLX A;  4O3P A;  4J9P A;  2BGW A;  2MUT A;  2JZB A;  4YMM A;  5C5J A;  3Q8Q B;  1ZQT A;  5DGB A;  5CB1 A;  5DG8 A;  4Q45 A;  4RQ4 A;  2ZJ8 A;  4YMN A;  3MR5 A;  4FS2 A;  1ZQB A;  4K4H A;  4DS4 A;  2Y1J A;  5J0R A;  4UBC A;  7ICN A;  3IM1 A;  1Z3E B;  5KG2 A;  3PW0 A;  1NK9 A;  2XGQ A;  4BDP A;  1BPE A;  5J0T A;  1ZQD A;  4KLU A;  3C21 A;  1S97 A;  2HHV A;  4PGQ A;  1LB2 B;  2XY7 A;  1KFT A;  4Q44 A;  3PW2 A;  3GDX A;  4ED3 A;  1SL2 A;  4DQR A;  8ICO A;  5KFK A;  4EBC A;  5TZV A;  4B9L A;  2UVV A;  4MFC A;  3RBD A;  4NLN A;  4I2B A;  2WTF A;  4GC6 A;  4KN7 A;  4UB1 A;  5KFI A;  3PW4 A;  4YP3 A;  2XY5 A;  4C8L A;  4K4G A;  3JPN A;  2BCU A;  4DSL A;  5IIJ A;  1ZQM A;  4M6W A;  4GXJ A;  3QEA Z;  4YVZ A;  2FMS A;  5KFM A;  4BWJ A;  9ICN A;  5DKW A;  1JXL A;  3HW8 A;  3Q8M A;  9ICJ A;  1B22 A;  4P4O A;  4EYI B;  1ARO P;  3V6K A;  4I2C A;  3RAX A;  4YFK A;  3KHH A;  2PFO A;  4ECS A;  1KFS A;  7ICP A;  3RB6 A;  2JEI A;  7ICO A;  9ICF A;  3RJG A;  4X5V A;  1RXW A;  3Q8P B;  4DQS A;  4B9U A;  1RPL A;  1QTM A;  4YMO A;  2NRZ A;  3KHR A;  4EBE A;  5KFD A;  5IIM A;  4FBT A;  4RPX A;  4TUR A;  1BPY A;  4FBU A;  4F92 B;  3THV A;  2HW3 A;  1X2I A;  4M9J A;  4DSK A;  5KFF A;  4KLQ A;  3MR6 A;  5JUM A;  3EYZ A;  2FLP A;  3ZDB A;  1TK5 A;  4C8O A;  5J2K A;  1HJP A;  3LWL A;  2HVI A;  3ISB A;  4HYK A;  2AGP A;  5CR0 A;  1DOQ A;  4GXK A;  3AUO A;  2P6R A;  5DQI A;  5KG5 A;  4GXI A;  3OSP A;  1U45 A;  1A77 A;  2C2E A;  4ELV A;  4F2S A;  3EPI A;  1L3T A;  1SZP A;  4I27 A;  3SV4 A;  4DSE A;  2AJQ A;  1UT5 A;  2AQ0 A;  5L9X A;  2BQR A;  4YD2 A;  4KLT A;  5DB8 A;  3RRH A;  3GV7 B;  5CJ7 A;  4M9L A;  2PXI A;  5DQG A;  4YR2 A;  5KG6 A;  3QEB Z;  5KFT A;  4TQS A;  2W8L A;  2R8G A;  4KIT B;  2MUT B;  4ECT A;  4EZ6 A;  4RQ7 A;  4TUS A;  1S0M A;  4O9M A;  5KG3 A;  1ZQQ A;  1QSL A;  2BR0 A;  3V6J A;  2ISO A;  4KTQ A;  5DBC A;  4B9N A;  2ZUB A;  1UA0 A;  1ZQI A;  3RJE A;  1KTQ A;  5DG9 A;  4F4W A;  2J6T A;  5KFY A;  5J0X A;  1NKB A;  1EXN A;  5III A;  3PR4 A;  1ZQX A;  1BPD A;  1PZN A;  3GII A;  5J2I A;  2IHN A;  4UB4 A;  3GIK A;  3BQT A;  4RZR A;  3C5G A;  7ICU A;  4EZ9 A;  1D9D A;  1RYR A;  1JXE A;  5CP2 A;  2FLL A;  2V9W A;  9ICL A;  3IHQ B;  5KT4 A;  4ECW A;  3RB3 A;  3H4B A;  1S10 A;  4IQW A;  2I1Q A;  4ECX A;  5DDM A;  4TUP A;  2IBK A;  4DS5 A;  4QZH A;  3QZ8 A;  1BPB A;  4M6W B;  1L3U A;  5HP4 A;  5KG7 A;  3C5F A;  1KSP A;  4JK1 A;  2PI4 A;  3GV5 B;  4IR9 A;  2F1I A;  3NGD A;  5L1I A;  2BHN A;  2V4Q A;  4KLO A;  2KFN A;  3T5H A;  3ISC A;  3RJF A;  3PNC A;  5HHH A;  4RU9 A;  3PX6 A;  1NKE A;  2VA8 A;  7ICQ A;  4DOB A;  9ICS A;  1HUO A;  3QZ7 A;  2XC9 A;  4I2A A;  3GV8 B;  2NRX A;  4QW9 A;  1NK4 A;  2ISP A;  3UXN A;  4BXO B;  4NLZ A;  4I2I A;  5J2J A;  4R8U A;  4ECQ A;  5DGA A;  3EZ5 A;  3PW7 A;  4DFP A;  4F2R A;  4QZ9 A;  5EOZ A;  3JPP A;  1T7P A;  5J0U A;  3Q8L A;  7ICJ A;  8ICP A;  7ICS A;  2DFL A;  5EWG A;  5HML A;  4F5O A;  3C23 A;  4DO9 A;  4Z6F A;  4M9N A;  4K4I A;  2PFP A;  4I2H A;  2JEJ A;  4KLG A;  2KFZ A;  5KFS A;  2ASJ A;  4IQT A;  3KTQ A;  3B0Y A;  3ZDD A;  4DL6 A;  4F8R A;  1S0O A;  2NRT A;  5HMM A;  3TFR A;  5KT5 A;  3BQ2 A;  2BCS A;  4GC7 A;  4CCH A;  3BQ1 A;  5KFW A;  5CWR A;  4PHD A;  5KFU A;  4DFJ A;  3ETL A;  4R65 A;  4MF2 A;  2VA3 A;  4MFF A;  1COO A;  4F4X A;  4KLD A;  2ZUD A;  3MFH A;  4IRC A;  5J2B A;  1ZYQ A;  3JPS A;  2BQU A;  2BQ3 A;  1D9F A;  3C2K A;  4PPX A;  4UB2 A;  3PR5 B;  2UVU A;  5F9L A;  4DL2 A;  8ICS A;  4M9G A;  9ICH A;  4YD1 A;  4JWN A;  1Z00 A;  5L1J A;  4QW8 A;  5KFC A;  5J0O A;  1BPX A;  3GIL A;  2F1J A;  1ZQY A;  3C1Z A;  4JV1 A;  4XQ8 A;  9ICG A;  4DLE A;  4NM1 A;  5J2D A;  3RTV A;  3RBE A;  4LVS A;  1NK6 A;  4EEY A;  4R64 A;  1ZET A;  4ELT A;  4O5C A;  7ICG A;  4RT2 A;  3LDA A;  4KLM A;  2W9C A;  3OJS A;  3N4M B;  4KMU A;  9ICR A;  4YQW A;  3HPO A;  2A1J A;  1L3V A;  2PI5 A;  4MEY A;  4C8N A;  5KFO A;  8ICX A;  3ZDE A;  4DOA A;  3KHG A;  4KN4 A;  1ZQK A;  4YXJ A;  4RPZ A;  3GIM A;  2ALZ A;  4I2J A;  7ICF A;  4DSI A;  4I2D A;  1ZQN A;  8ICA A;  4RNO A;  4XUS A;  3V7K A;  5L1K A;  4ECR A;  1XC9 A;  4J9S A;  4R66 A;  2W9B A;  2R8J A;  3RJK A;  2PFQ A;  4B9S A;  4M0A A;  8ICB A;  2NRV A;  4PHE A;  3JPQ A;  4ED8 A;  4UB5 A;  3Q8K A;  3RAQ A;  2AU0 A;  4IRD A;  8ICC A;  5BOM A;  3OHA A;  5HNK A;  3T5L A;  9ICO A;  5DB7 A;  3UQ2 A;  5EWF A;  4F4Z A;  1ZQH A;  1IXR A;  5KFL A;  1UA1 A;  4KLI A;  4G3I A;  5IIL A;  4Z6D A;  1MQ2 A;  9ICT A;  5IIK A;  5KFX A;  4QZ8 A;  2JEF A;  4DQQ A;  2R8I A;  2MAX A;  1NK8 A;  2C2R A;  2KN7 A;  4NM2 A;  3BQ0 A;  4YG2 A;  1ZQW A;  2AGO A;  5KG1 A;  5KFH A;  5J2G A;  1U4B A;  2BPG A;  2BCQ A;  1S9F A;  3ZDA A;  2RDJ A;  3SV3 A;  2HVH A;  4IR1 A;  2W8K A;  2ZJA A;  3M9M B;  4MFA A;  1ZQR A;  4M9H A;  5J2F A;  1K1Q A;  4O3R A;  3N97 B;  4I28 A;  1JIH A;  3UXP A;  4RNM A;  1C7Y A;  9ICB A;  5KT7 A;  4QWC A;  3M9N B;  2JZB B;  4RQ3 A;  1XO1 A;  4JV0 A;  2JEG A;  4F4Y A;  3B0X A;  4P4P A;  4F5N A;  2XGP A;  1IM4 A;  5J0P A;  1MC8 A;  2P6U A;  4DSF A;  4UAY A;  1LV5 A;  2HHT A;  3SYZ A;  1T4G A;  2XY6 A;  1JX4 A;  1ZJM A;  3PMN A;  4QZC A;  3AU6 A;  1RXV A;  4YR3 A;  3JPT A;  3T3F A;  3ZDC A;  5J2C A;  3RH4 A;  1T8E A;  4R63 A;  3M9O B;  1U49 A;  4QZD A;  4PGX A;  1U47 A;  1QSS A;  1ZQS A;  4EYH B;  5KFN A;  2HHX A;  2FLN A;  3G6X A;  9ICI A;  3PX4 A;  4FS1 A;  2HHU A;  1ZQG A;  4DFM A;  4F93 B;  2I9G A;  2BCR A;  4DWI A;  2BPC A;  3G6V A;  3RB0 A;  2VAN A;  5J0W A;  4UB3 A;  3GQC A;  4F5Q A;  3PX0 A;  4RQ2 A;  1BGX T;  2W9C B;  3RR8 A;  1V9P A;  1U9L A;  3OJU A;  4FO6 A;  2M9N A;  3V6H A;  1TV9 A;  9ICU A;  4ELU A;  2BKE A;  1NJY A;  9ICX A;  1N56 A;  4O3N A;  1ZQU A;  3M8R A;  3RJJ A;  1A76 A;  3RH6 A;  5J0Y A;  2J6U A;  5KFZ A;  2AGQ A;  4B9T A;  4JWM A;  5KT2 A;  5DBB A;  3OGU A;  2W9B B;  5J2A A;  4UQG A;  5DB6 A;  1RZT A;  4NLG A;  4KLE A;  8ICG A;  9ICM A;  7ICL A;  5D49 A;  4RQ1 A;  4QZA A;  4M04 A;  4QZF A;  1Y88 A;  3JPO A;  4DL4 A;  3EPG A;  3RJH A;  1X9W A;  8ICE A;  1XWL A;  1KEJ A;  1NJX A;  3TAQ A;  5KFJ A;  5DG7 A;  4YN4 A;  7ICT A;  4RPY A;  1XS9 D;  5J0S A;  3SZ2 A;  4RQ8 A;  3C2L A;  8ICW A;  3V7L A;  9ICE A;  4ZH4 A;  2BCV A;  8ICL A;  1L5U A;  2OWO A;  1RYS A;  4DF4 A;  7ICE A;  1ZQE A;  4I2F A;  9ICA A;  2IHM A;  1ZQP A;  4BWM A;  1CEZ A;  3UPQ A;  2UVR A;  4DFK A;  4F4K A;  1ZQJ A;  3V7J A;  4MF8 A;  3TFS A;  5KG4 A;  4I2E A;  4RQ6 A;  3RH5 A;  3ORY A;  1TAQ A;  1NJW A;  4YXM A;  3MBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...