1Z00A

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00A01
2AGQA 1NKEA 4DEZA 1KTQA 5J2KA 5CP2A 3GIJA 5D49A 7ICHA 3C2KA 2JEFA 9ICFA 1Z00A 1MQ2A 1ZQYA 4F5PA 3AU2A 3JPRA 4ECQA 4J9SA 4EBDA 3H40A 4KLJA 1XU4A 2HHTA 4YQWA 4KLDA 5KFPA 2FMQA 3ZD9A 1IXRA 7ICKA 5DB7A 3SYZA 2DFLA 3ZDEA 5DG8A 4ED3A 4O3PA 2PFOA 4LZDA 4BXOA 3MR2A 3RR8A 1U9LA 5KT4A 5J2GA 4B9VA 2XGQA 7ICMA 2FLPA 8ICKA 4F5NA 4IRCA 4G3IA 3GIKA 2I1QA 4R8UB 5KG5A 3OHBA 4DL3A 3PW5A 1BGXT 1X9WA 4YMNA 3LDAA 3JPPA 3GILA 4P4OA 2BHNA 1U45A 5J0SA 4CCHA 4F5OA 1KLNA 4F4KA 9ICNA 4QZ8A 4RNOA 5HMMA 3TFRA 7ICJA 4MFCA 4DF4A 2R8JA 3ORYA 5DQIA 3PO4A 4O9MA 9ICHA 2XY5A 2PI5A 3G6VA 5KFVA 1ZQZA 5KT5A 3C1YA 4DS5A 4O0IA 5KFMA 1C7YA 5DB8A 4IR1A 4ECWA 4I2JA 4QZHA 8ICHA 1NJZA 4MFAA 4F91B 2F1IA 2BQRA 5J0XA 2ISOA 2NRWA 3KHLA 1ZQUA 2W9AA 2BPGA 1T7PA 4M9JA 4M9LA 4IR9A 4ECUA 5J2DA 1ZQPA 4FBUA 1UT5A 4YD2A 2J6SA 7ICRA 1DOQA 5KTQA 2AGPA 3HW8A 4M04A 4JV0A 4UBBA 3NGDA 4F5RA 1XSNA 4R65A 2C22A 1BPEA 2BR0A 3UXNA 4RT2A 2AJQA 4RU9A 3V7JA 2DPJA 3GV8B 3OGUA 3V6KA 3QZ8A 4UQGA 1BPXA 5KFAA 5DLFA 4I2EA 7ICUA 1T4GA 4J9PA 1B22A 2C28A 5DBAA 3PW2A 2V9WA 7ICTA 1HUOA 1ZQOA 4TURA 3RJJA 8ICBA 2A1JA 2XC9A 2C2RA 3SZ2A 5HHIA 3M8SA 3V7KA 2ATLA 2UVUA 2F1JA 3KTQA 4NLZA 2A1JB 2BCRA 4R63A 4UB4A 5KT2A 4F2SA 2HHSA 2ASDA 1WCNA 5KFJA 5BOMA 3HPOA 4MEXA 4DWIA 1BPYA 4P2HA 3PR5B 4NM1A 9ICMA 4DL5A 4BWMA 3BQ0A 4ECVA 3QE9Y 3QEBZ 4I27A 1S0OA 4P4PA 7ICLA 1QTMA 4YD1A 3C5GA 4YFKA 4DLEA 1JIHA 1CUKA 4YR0A 3V72A 2XY7A 1BVSA 4QZGA 5KG0A 2FLNA 4BDPA 4HYKA 2HHUA 2KFNA 2FPMA 5CA7A 4NLKA 4ELUA 8ICLA 4JWMA 5KFSA 4DS4A 9ICEA 9ICIA 3RTVA 4B9SA 5KFQA 5TZVA 4UB5A 5CB1A 4NLNA 5BPCA 4RQ0A 4IQUA 4RQ4A 4DSKA 4BGDA 2LYHA 2KZMA 5CHGA 2VA8A 3B0XA 4O3QA 1TK5A 1KFTA 4C8MA 3GV5B 4ZH4A 2ASLA 3UXOA 2P6RA 2BCQA 4I28A 9ICUA 4F93B 5J2FA 4R8UA 2JEGA 4EYIB 3T5HA 5KG7A 4RZRA 1QSSA 3THVA 4EZ9A 3PO5A 2ZTDA 4UBCA 3UXPA 4YMMA 1UA1A 2FMSA 5DLGA 4DOCA 1T3NA 4QWAA 4RQ7A 3OHAA 4XUSA 1NK0A 4F92B 7ICEA 5DGAA 3H4BA 9ICOA 4DSJA 3SV4A 3HX0A 1U49A 3RRGA 4I2FA 2V4QA 1ZQRA 3T5LA 3PW7A 3EYZA 5KFTA 2P6UA 3HWTA 3C5FA 4DFMA 2W9BA 3GDXA 5KFHA 3PV8A 5DKWA 3QZ7A 1T8EA 4QWBA 3T3FA 4DSEA 4RQ2A 4F50A 4ECYA 4Q8EA 8ICRA 1NK9A 2ASJA 7ICVA 5JUMA 4KLGA 4QWEA 3LWLA 4DL4A 2HVHA 2MAXA 3PMNA 3MGIA 1QLNA 4UAWA 8ICJA 2FPLA 4QW8A 2XO7A 3Q8RB 3RJGA 5L1KA 4I2CA 3AU6A 2ZJAA 1NK4A 4NM2A 4IQWA 3BJYA 1JN3A 2IHNA 4B9LA 4B9NA 2Q0ZX 9ICKA 4KLHA 5KFDA 4YG2A 3G6XA 1TAUA 5DB9A 4M2YA 4MF2A 4RQ6A 2J6TA 3PW0A 3OJSA 3M9OB 4RNNA 3QEAZ 4EBEA 5J2BA 2KTQA 1RYRA 1JMSA 3MFIA 2DPIA 1Z3EB 5J2CA 3T5KA 3ISCA 1BPDA 1HJPA 5L1LA 1D8LA 5J2HA 1KEJA 2VANA 5KFKA 2ZJ5A 4ECRA 1SKWA 3FYHA 4DSLA 4YXMA 1SL2A 2PI4A 3OJUA 1KFDA 5HHHA 5IIMA 1UA0A 2J6UA 4DQIA 5DB6A 1ZQQA 8ICMA 1ZQSA 2BCUA 3KHGA 2MUTA 1NK8A 4M9NA 1ZQXA 1K1SA 5EWFA 4DSFA 5KFCA 2ZUCA 4KLEA 4GXJA 7ICSA 3HP6A 5DG7A 4ED2A 2PFQA 4C8NA 1KDHA 1ZQBA 1XWLA 4ED8A 9ICCA 4YP3A 3Q8PB 4DQPA 1ZQGA 3UQ2A 1U48A 5DGBA 5J0OA 1EXNA 2R8HA 4O3NA 4KTQA 7ICFA 4UAYA 7ICGA 5J0UA 5IIIA 1ZQTA 1TVAA 1ZQAA 8ICAA 9ICQA 2ZUBA 4BWJA 2W8LA 5J0PA 2W9CB 5IIJA 2KZZA 4I2DA 4QZIA 1XC9A 4C8OA 1RPLA 4RPYA 4EZ6A 4ED6A 3RRHA 1RXWA 5CR0A 4O5CA 1SZPA 2V4RA 7ICIA 2NRTA 1SKSA 4Z6EA 5DDMA 4J9OA 3LWMA 4KLOA 3H7IA 5IILA 4DFPA 7ICNA 1UT8A 2BQUA 9ICBA 3PX4A 4Q8FA 1NKCA 4DFKA 2H5XA 3OSPA 1U47A 3GFKB 4O5KA 5D46A 4RPZA 8ICWA 2BKEA 8ICFA 3EWAA 5DG9A 1LB2B 3LK9A 4YXJA 3C2MA 3KHHA 1ZQJA 4Q45A 3MGHA 3ISDA 2RDJA 4KLFA 4M6WA 4RUAA 1NK6A 4O3SA 2BQ3A 3RJFA 4PHEA 9ICRA 4EBCA 3RR7A 5EWEA 3M9NB 4M6WB 3HT3A 1BPZA 4K4GA 4I2HA 2ISPA 4F5QA 2AQ0A 4MF8A 3MR3A 9ICVA 3ZD8A 1SKRA 4QZFA 4R66A 1KRPA 4F3OA 4ED1A 4KLMA 4RT3A 1S97A 1V9PA 4C8KA 3TAQA 3ISBA 5EOZA 3NTUA 4MEYA 4GLXA 4DOBA 1ZQIA 4EYHB 3GV7B 2B21A 3OSNA 1X9SA 1NKBA 2FLLA 2HHVA 3ZDCA 2NRZA 4TQSA 4M9HA 5HP4A 1TK0A 1S0MA 3MFHA 4QZAA 3EPIA 4PH5A 4QWDA 3PVXA 3RH6A 4IQTA 4I2GA 9ICSA 2HHXA 1S76D 3Q8KA 3RH5A 2HW3A 4FO6A 2RDIA 3TANA 1ZQDA 2BPCA 5KFYA 4PHDA 4DL6A 1SL0A 5L9XA 2JZBB 4QZ9A 1JXLA 4KITB 1K1QA 9ICAA 3RB0A 4O5EA 4YR2A 1Z00B 3RBDA 2BGWA 3Q8MA 1ZQCA 4RQ5A 4ECSA 3MR5A 4P4MA 3RB6A 8ICTA 3C1ZA 3G6YA 4PGXA 2ZJ8A 9ICWA 1ZQFA 5DQHA 3RAQA 3K75D 4YVZA 4QWCA 4DQSA 4DFJA 4UB2A 4X5VA 5KFZA 2Y1IA 4KLTA 5KG6A 4KLUA 3MDAA 3C2LA 5D4BA 4QW9A 5KFFA 5L1IA 4J9NA 1S10A 4J9MA 1ZJMA 4NY8A 8ICGA 5KT6A 5J0WA 2OWOA 8ICPA 2ZTEA 2R8GA 2JZBA 3V7LA 5IINA 1ZQKA 1D9DA 4B9MA 8ICNA 1RYSA 3ZDDA 4Z6DA 4FS1A 3SV3A 2PFNA 4DOAA 1N48A 9ICJA 3BQTA 4Q44A 4QZEA 1Y88A 2XGPA 3UQ0A 1S0NA 5KG3A 3IHQB 2HVIA 4J9KA 2AGOA 1ZQMA 2P66A 4GXKA 3Q8LA 1MSWD 8ICUA 3FDSA 4YN4A 5J0QA 8ICSA 3E2EA 1MC8A 5HNKA 4DO9A 4M0AA 4PGQA 4YR3A 4YMOA 5CWRA 2ZTCA 2KN7A 4ED0A 7ICPA 1A77A 4EEYA 1TK8A 3PR4A 1SL1A 3JPQA 2C2DA 5KFRA 3M8RA 1ZQLA 2UVWA 2C2EA 2BDPA 4BXOB 5KG2A 5KFLA 9ICPA 2NRVA 1L3VA 3JPTA 1ZQVA 8ICZA 4ED7A 1IM4A 4ECZA 5DQGA 4XRHA 3V6HA 2VA2A 4F8RA 4UB1A 5L1JA 5KT7A 3KHRA 8ICOA 1ZQEA 3PX6A 3TFSA 1TKDA 4O3RA 3M9MB 4DL7A 1LV5A 3N4MB 2HHQA 1L3TA 5KFOA 2XCAA 1PZNA 5J29A 4F2RA 2WTFA 1HUZA 3TARA 1NJWA 1ZYQA 1DGSA 3MABA 5DBBA 4R64A 3RBEA 4F4WA 4JWNA 4K4IA 4M9GA 4DLGA 2XY6A 4M47A 4KLSA 1RXVA 4ECTA 2PXIA 4K4HA 3EZ5A 3N97B 4DL2A 3GIIA 4KLQA 2JEIA 1XO1A 5J2AA 4O3OA 1NK7A 4I2IA 8ICXA 5KFWA 4GC7A 5KFEA 3RB4A 3ETLA 1L3UA 1KFSA 4RQ1A 8ICVA 4DQRA 8ICEA 2FPKA 4KLIA 4PHAA 4RUCA 4J9LA 4DQQA 2I9GA 9ICXA 1L3SA 2BCSA 4KMUA 4F4ZA 4MFFA 1TAQA 4PGYA 3EPGA 4PPXA 4LZGA 5KT3A 5HMLA 1COOA 2NRXA 5KFIA 4UB3A 2W9BB 3MBYA 1KSPA 3C23A 4F4XA 3RJEA 2XCPA 2AQ4A 1JXEA 1NK5A 3RJKA 4Z6FA 5KFXA 3MR6A 2UVVA 2W8KA 5IIOA 5J2JA 8ICIA 1ZQWA 2M9NA 1S77D 4XA5A 2IHMA 4IQVA 5C5JA 3GQCA 1XSLA 4I2BA 2F1HA 3H8SA 4TUSA 1NOMA 4JK1A 4QZBA 1B43A 2MUTB 3TQ1A 1TV9A 1D9FA 1S0VA 1X9MA 3T5JA 4FS2A 5BOLA 9ICLA 3MDCA 3H8WA 5KG4A 4XQ8A 3Q8QB 3RJHA 4TUQA 2PFPA 2AU0A 1NJYA 9ICTA 4ELTA 4I29A 4RQ3A 3SI8A 4NLGA 4GC6A 3RH4A 3H8JA 1A76A 3PMLA 5J2IA 3RJIA 3ZDBA 4UAZA 4JUZA 1NJXA 3ZDAA 7ICOA 1AROP 2W9CA 5F9NA 5KFNA 5J0YA 1QSYA 4Q43A 1ZQHA 1CEZA 5KG1A 4JV2A 1ZJNA 2FMPA 4QZDA 2JEJA 3EW9A 4DSIA 4LVSA 5IIKA 4QZCA 3Q8SB 2ALZA 8ICCA 4J9RA 4RQ8A 1D8YA 5KFBA 5J2EA 3BQ1A 4J9QA 2BPFA 3JPOA 2KZ3A 4I2AA 4IRDA 4B9TA 4DF8A 4B9UA 4TQRA 4ECXA 5KFGA 5DBCA 1ZQNA 4PHPA 3PW4A 4NXZA 4RNMA 1N56A 1TFRA 3GIMA 1ZETA 2W9MA 4FBTA 1XS9D 5J0TA 5J0RA 3K4GA 2R8IA 2R8KA 4IRKA 2UVRA 4KLLA 4F4YA 1BPBA 1L5UA 4TUPA 1WCLA 4Z6CA 2VA3A 8ICQA 2Y1JA 4GXIA 3PNCA 3V6JA 2KFZA 2IBKA 5DDYA 3C21A 2IA6A 3TAPA 4ELVA 3RB3A 3B0YA 2BCVA 5EWGA 8ICYA 4C8LA 2IMWP 2HHWA 1MQ3A 5KFUA 3BQ2A 1QSLA 4JV1A 3AUOA 3H4DA 3UPQA 3BDPA 1XSPA 4YCXA 1U4BA 1S9FA 1JX4A 2GWSA 3JPSA 3PY8A 9ICGA 2ZUDA 4KN7A 3RAXA 1X2IA 4KN4A 5CJ7A 3TI0A 4E0DA 3PX0A 4RPXA 3JPNA 1RZTA 3IM1A 1H38A 5F9LA 7ICQA
chains in the Genus database with same CATH superfamily
2YMMA 5GTIU 5AKXA 4GFJA 3F2DA 3FAHA 7ICHA 1L8OA 1ZQYA 3JPRA 4EBDA 2HHTA 2NV3A 1KN5A 3BS7A 4YQWA 1SXDA 1IXRA 2DQNB 5DB7A 3K1RB 2DFLA 2PFOA 2CN1A 1FIQA 5KT4A 2GLEA 3SMVA 3RF9A 8ICKA 3PW5A 1X9WA 4YMNA 3GILA 4CCHA 3KZIU 4F5OA 1KLNA 3SAGA 5EE3A 3L4PA 3AN1A 2W3RA 5ALTA 5J8YA 3C29A 9ICHA 1KW4A 2W03A 4IR1A 2E5SA 1C7YA 8ICHA 2NRWA 3KHLA 1T7PA 4IR9A 4ECUA 5J2DA 2J6SA 1SV4A 2KVSA 4F5RA 3WK9A 3V7JA 3HKZF 2KOBA 3QZ8A 1ZD4A 1BPXA 1L7OA 7ICUA 1B4FA 2XIDA 5DBAA 7ICTA 3LVWA 3RJJA 4TURA 8ICBA 2XC9A 3AQFA 2D8CA 3V7KA 2F1JA 1CI4A 1PUZA 4UB4A 2HDOA 4MEXA 1BPYA 3BQ0A 3DV9A 4P4PA 1QTMA 4YD1A 2BR0A 4DLEA 1L7MA 1MSWD 2HHUA 5KG0A 4BDPA 4HYKA 2FPMA 3A0BU 5EE9A 3RTVA 4UB5A 4NLNA 4IQUA 4BUGA 2VA8A 3TADA 2A3VA 9ICUA 4UW9A 1TE2A 3KOOA 1WWUA 5DLGA 2JR5A 3OHAA 5DGAA 3H4BA 3HJEA 3SV4A 1U49A 3EYZA 4DFMA 2W9BA 3CNHA 1T8EA 3T3FA 1QQ7A 4RQ2A 2F76X 3S6JA 2WHEA 2KV2A 2HBLA 2MAXA 2ZIXB 4UAWA 3UM9A 1NK4A 4NM2A 2VIXA 3TKAA 4DFDA 4US8A 4KLHA 3BZCA 1TAUA 2YN4A 4EBEA 2KTQA 1Z3EB 5J2HA 1KEJA 4PJ0U 1BNOA 3NASA 2NO5A 4YXMA 1SL2A 2H3ZA 5AM2A 1ZQQA 1ZQSA 3KHGA 2GO7A 1L7PA 2MUTA 3T79A 1K1SA 2AXTU 2ZUCA 7ICSA 3HP6A 1PVPA 1XWLA 4DQPA 1U48A 2R8HA 7ICFA 5J0UA 5J0PA 2W9CB 5IIJA 2W54A 4RPYA 4ED6A 2K4HA 3WKCA 3LWMA 4P0QB 3LVVA 4CF5A 2I5HA 1PK3A 3H0LB 1NKCA 3PZPA 1U47A 3GFKB 3EWAA 2YMLA 4U7CA 5ALPA 3QUCA 2RDJA 3RJFA 3KD3A 1S8OA 5EWEA 4K4GA 4JMUA 4EENA 3ZD8A 1SKRA 1KRPA 4F3OA 3VC8A 3ISBA 5EOZA 2EAPA 5AK6A 4DOBA 4EYHB 1WWVA 2B21A 3OSNA 2FLLA 2E8OA 2M0NA 4QZAA 1SV0C 4QWDA 3PVXA 3RH6A 2G07A 4IQTA 3Q8KA 3RH5A 1UHUA 2HW3A 2E8NA 2JZBB 1JXLA 3KFUF 1K1QA 9ICAA 1Z00B 5AKYA 3O0FA 3MR5A 3G6YA 2QARB 3M1YA 9ICWA 2ZJ8A 5DQHA 4DQSA 4X5VA 2Y1IA 5KG6A 2O6KA 3MDAA 3ICXA 3C2LA 4QW9A 5KFFA 4UB6U 5KT6A 2DUYA 2JZBA 3M6KA 5IINA 1D9DA 1RYSA 3ZDDA 4Z6DA 4DOAA 1N48A 5JRTA 3IRUA 9ICJA 3QNMA 4QZEA 2AGOA 2P66A 1F0MA 5ALJA 3SENA 3FDSA 4YN4A 5J0QA 8ICSA 1NZBA 3E2EA 4DO9A 4ED0A 5CWRA 2ZTCA 7ICPA 1TK8A 3TACB 3I28A 5KFRA 1ZQLA 2C2EA 2BDPA 2QB0A 5KFLA 9ICPA 3SQIA 1ZQVA 3V6HA 4ECZA 3F5EA 4XRHA 2W7PA 2OM6A 5KT7A 8ICOA 2RQ5A 4O3RA 3TFSA 1TKDA 1LV5A 3N4MB 1SXEA 1PZNA 5J29A 5AKHA 4EEKA 1WYGA 3MABA 2DBYA 4NL9C 4F4WA 3ONNA 2EAMA 4M9GA 4M47A 1RXVA 1VJ5A 4OJ5A 3GIIA 4WJ3B 1XO1A 1X9XA 5J2AA 4O3OA 1NK7A 8ICXA 5KFWA 4C4SA 2LYBA 4PHAA 1L3SA 4KMUA 4PGYA 4FZNA 5KT3A 5KFIA 5ALDA 3MBYA 3C23A 3RJEA 2KHVA 2AQ4A 4FZMA 3IG8A 1S77D 2IHMA 2ZIWB 1TV9A 3N7SC 3MDCA 5KG4A 3Q8QB 2PFPA 1L6NA 1NJYA 4ELTA 2DKXA 1A76A 3PMLA 4IS7A 4OJOA 2KG5A 3KBBA 5ALRA 1ZQHA 5ALHA 2D3DA 4DSIA 3H0RB 2EH9A 8ICCA 2WF6A 1UQVA 2PMZF 4IRDA 4B9TA 4DF8A 4TQRA 1RM6C 1L8LA 5KFGA 5CRXA 4RNMA 1HIWA 2F2AB 4G9BA 2R8IA 2R8KA 4IRKA 4UAVA 4TUPA 2Y1JA 3QX7A 2KVCA 3C21A 3SR6A 1FEZA 3AM9A 2L5YA 1QSLA 3H4DA 4Y2UA 2GH1A 4CE6A 3PY8A 9ICGA 4KN7A 1X2IA 3TI0A 3PX0A 4RPXA 1H38A 3V6KA 7ICQA 1NKEA 4DEZA 1KTQA 1SIJA 9ICFA 1Z00A 4J9SA 4KLJA 2OYYA 2FMQA 7ICKA 3SYZA 3ZDEA 4O3PA 5ALWA 3MR2A 3UMGA 1U9LA 5J2GA 5AI6A 4G3IA 3OHBA 1BGXT 3NRZA 1U45A 3LYSA 4NL9A 3QUBA 4MFCA 2R8JA 1KKXA 5DQIA 3PO4A 4O9MA 2G08A 2PI5A 4CGZA 1ZQZA 5KT5A 2IOHA 2R18A 1A0PA 5DB8A 4UAUA 3BZKA 4I2JA 1SB3C 5EE0A 4MFAA 2F1IA 2KICA 3PSTA 1ZRNA 2ISOA 2BPGA 1XO0A 1Q3VA 3A0HU 3EUB2 1ZQPA 1UT5A 1DOQA 5KTQA 3I76A 3NGDA 4R65A 3UXNA 2LI6A 4RT2A 2AJQA 4RU9A 3OGUA 3N28A 4UQGA 5KFAA 1X40A 2ODGA 2C28A 2EZZA 2ATLA 5HHIA 3M8SA 1V85A 4USAA 2A1JB 2BCRA 4F2SA 1WCNA 4QNLA 4P2HA 3QEBZ 3QE9Y 3NUQA 7ICLA 2FLNA 1BVSA 4QZGA 4NWIA 8ICLA 4JWMA 4DS4A 4AYBF 5TZVA 4AP9A 4RQ0A 1Z4OA 2LYHA 5CHGA 2NO4A 4C8MA 2DKZA 3GV5B 2P6RA 4I28A 2BCQA 4C80A 2DF4B 4R8UA 4F93B 5J2FA 1QSSA 4UBCA 3UXPA 4YMMA 1UA1A 4NV0A 4C7YA 1JROA 2QARA 4DSJA 3HX0A 4I2FA 1ZQRA 3T5LA 3AL0B 5KFTA 2P6UA 3HWTA 3GDXA 5KFHA 1P7DA 3ETRA 4QWBA 4DSEA 4F50A 2YTUA 2W04A 1NK9A 2JV3A 2ASJA 7ICVA 5JUMA 4KLGA 2JH1A 2K89A 3LWLA 4DL4A 3PMNA 2A19A 2OXOA 5K4LA 3AU6A 2ZJAA 1O03A 2IHNA 5AK5A 2KJ5A 3G6XA 3GU3A 2ESEA 2J6TA 3UMCA 3QEAZ 2YB1A 1RYRA 4Y2YA 3T5KA 1BPDA 1D8LA 2VANA 5KFKA 2ZJ5A 5EE1A 4CNQA 1KFDA 5HHHA 3SAFA 8ICMA 2DWQA 1ZQXA 5ALLA 4DSFA 2E1FA 4KLEA 5CEHA 2PFQA 1KDHA 9ICCA 4PZOA 2EANA 2B6GA 3QXGA 1ZQAA 5C0YA 8ICAA 2KZZA 4QZIA 2RRDA 3KKAC 1RPLA 2G0AA 1NI3A 4OJ6A 4EZ6A 3RRHA 1RXWA 5G5HA 2KIWA 4J9OA 3H7IA 5IILA 7ICNA 1QH9A 3PX4A 4DFKA 3OSPA 5D46A 1N60A 2BKEA 3IDWA 1MN8A 3C2MA 1ZQJA 4UARA 3MGHA 4M6WA 4RUAA 1NK6A 2PMZC 9ICRA 3M9NB 3HT3A 3N7RC 4OCZA 4F5QA 3WK7A 1QQ6A 3MR3A 4GIBA 2HMXA 4QZFA 3WK6A 4IC9A 2FJ6A 4RT3A 3NTUA 1X9SA 2OCEA 4M9HA 1S0MA 3NVZA 4OO1J 9ICSA 2HHXA 1S76D 4UB8U 2RDIA 1ZQDA 2BPCA 3NS1A 4PL2A 4U6PA 4KITB 2YMQA 2ZIUA 2CRXA 4O5EA 2BGWA 4P4MA 8ICTA 3RAQA 3K75D 4QWCA 2DL0A 4UB2A 4KLTA 1N5XA 1A6SA 5AI9A 5L1IA 1Z1BA 2OWOA 4KX5A 8ICNA 2PFNA 3I1YA 2XGPA 3UQ0A 1S0NA 5ALOA 5KG3A 3IHQB 2HVIA 3Q8LA 4YMOA 2KN7A 3PR4A 3M8RA 2Z7JA 1L3VA 8ICZA 1LKYA 1SGGA 5DQGA 2BDUA 5L1JA 3KHRA 3F2BA 3PX6A 4DL7A 2HHQA 1L3TA 2XCAA 3VCBA 1NJWA 1ZYQA 1DGSA 2Y0SF 5AM0A 5DBBA 5ALEA 4NLBA 4JWNA 2HI0A 4KLSA 2NYVA 4ECTA 1TAMA 4KMOB 3OPXA 1Z19A 4KLQA 2JRZA 4I2IA 1X42A 5KFEA 1Q3UA 2ZIXA 1L3UA 2W3SA 4EX7A 3WKBA 4J9LA 9ICXA 3GZFA 5ALNA 4PPXA 2F8KA 2EZYA 1KSPA 4C0ZA 1O08A 4DCCA 2RP5A 1NK5A 5KFXA 5AHXA 5J2JA 1ZQWA 2M9NA 2XVTA 3GQCA 4I2BA 3TQ1A 1NOMA 4JK1A 4QZBA 2MUTB 1YZ6A 5BOLA 9ICLA 3H8WA 2YY6A 1ED1A 4XQ8A 3RJHA 4TUQA 2LPEA 4RQ3A 2N1RA 1HEKA 1ZXIA 4JUZA 2W9CA 1X66A 4Q43A 5KG1A 1ZJNA 2FMPA 2G5IB 3Q8SB 1D8YA 2BPFA 4JB3A 5J2EA 3BQ1A 4I2AA 3JPOA 5HR6A 5AIAA 1SWWA 4B9UA 4Y2XA 1ZQNA 2F3NA 1T94A 1TFRA 2YB4A 4FBTA 1XS9D 5J0TA 5ALMA 2UVRA 3QU5A 4F4YA 4GXIA 3L5KA 1PK1A 3PNCA 3V6JA 2KFZA 3NRWA 3TAPA 8ICYA 4C8LA 2IMWP 3BQ2A 2YX8A 2JMGA 3JPSA 3AMZA 2AHOB 3QUTA 3IM1A 2AGQA 5CP2A 3HKZC 3D2SA 2IOFA 3QYPA 2JEFA 4Y2QA 1MQ2A 4ECQA 1XU4A 4KLDA 3ZD9A 4CF3A 5DG8A 4LZDA 4BXOA 3RR8A 1URJA 3H8MA 4B9VA 2MSNA 4HAIA 4F5NA 2I1QA 4Y2SA 5KG5A 3DEEA 2K60A 4C4TA 3JPPA 4P4OA 9ICNA 4F4KA 5HMMA 2WF7A 3TFRA 3KKAA 4DF4A 5AI8A 2XY5A 3AEVA 3C1YA 5KFMA 4ECWA 4QZHA 1NJZA 2BQRA 1FFVA 4M9LA 4MHVA 4FBUA 4Y2PA 2Y0SC 4YD2A 2E1EA 7ICRA 4OD0A 2AGPA 3HW8A 4JV0A 2HBJA 2W43A 3SAHA 2K4PA 3GV8B 4LJXA 2WAQF 2JHDA 5DLFA 1T4GA 4J9PA 1B22A 2EQYA 1T3QA 2C2RA 4US9A 4ZOHC 3SZ2A 3KTQA 1SWVA 4R63A 5KT2A 2ASDA 3HPOA 4CDGA 4NM1A 9ICMA 4I27A 4QIWC 3C5GA 4YFKA 1S0VA 2XY7A 2KFNA 5CA7A 5KFSA 9ICEA 1IG6A 5KFQA 2KNJA 5CB1A 4RQ4A 5FP0A 3M6ZA 3B0XA 2KHQA 2KK0A 2MA1A 3UXOA 1NZPA 4EYIB 4RZRA 4EZ9A 3PO5A 2ZTDA 2FMSA 1T3NA 4QWAA 4XUSA 1JALA 3RRGA 2V4QA 3BS5B 3C5FA 3QZ7A 4Q8EA 3CW2C 1F5SA 2HVHA 2QLTA 2KJ9A 4FZLA 3MGIA 2FPLA 3H0MB 2XO7A 3UMBA 5L1KA 3AQEA 4IQWA 3BJYA 2Y9UA 1FO4A 5B5EU 2GOLA 5ALGA 2Q0ZX 9ICKA 4YG2A 5DB9A 4M2YA 4MF2A 4RQ6A 3RFAA 3PW0A 3OJSA 5J2BA 3MFIA 2DPIA 5J2CA 3ISCA 5L1LA 5F3XB 5ALKA 4ECRA 1SKWA 3FYHA 2PI4A 5IIMA 2J6UA 5DB6A 2ZIUB 2BCUA 4M9NA 5EWFA 1L7NA 5KFCA 5E79U 4GXJA 5DG7A 4ED2A 2KIVA 4C8NA 4YP3A 3Q8PB 3KZXA 1ZQGA 3UQ2A 5J0OA 7ICGA 2FDRA 5IIIA 9ICQA 2ZUBA 2W8LA 4Y2JA 4I2DA 1DRGA 4C8OA 1J97A 2D6FC 5A0LA 1SZPA 2V4RA 1KL9A 7ICIA 2NRTA 1SKSA 2P35A 4AYBC 4Z6EA 5DDMA 2KSOA 4KLOA 4DFPA 1UT8A 4Q8FA 2H5XA 4O5KA 4C7ZA 4RPZA 8ICWA 5ALXA 5DG9A 3LK9A 2WF8A 3KHHA 4Q45A 4O3SA 2BQ3A 1RQNA 4PHEA 3RR7A 1YZ7A 1BPZA 4KX3A 2AQ0A 9ICVA 1N61A 3WK4A 1AQ6A 1COKA 5AM1A 1V9PA 4C8KA 4FE3A 4MEYA 4GLXA 1ZQIA 1NKBA 1V97A 3IP4B 3ZDCA 4Y2VA 2B0CA 2FE9A 3EPIA 4PH5A 3WK5A 2K8BB 4FO6A 4PHDA 4DL6A 1SL0A 4ICAA 4Y2RA 2K4IA 4NJ8A 3K1ZA 4RQ5A 5L1MA 4ECSA 5JU5A 3C1ZA 2MRLA 4PGXA 2XICA 5ALUA 1ZQFA 4BX9C 3QU9A 4BJQA 1S10A 4J9MA 1ZJMA 5J0WA 8ICPA 2R8GA 3V7LA 3SV3A 4Q44A 5KAIU 2G09A 4J9KA 8ICUA 2ZIWA 4GXKA 5AKJA 2OEHA 1MC8A 5HNKA 4M0AA 4YR3A 3F5AA 1SL1A 3JPQA 2C2DA 5KG2A 3QUQA 1IM4A 4F8RA 1Z1VA 3IN5A 5T14A 1ZQEA 1N5WA 5KNIA 1WG8A 4R64A 3RBEA 2XY6A 2KKVA 2XI9A 4CRXA 1NNLA 2Q4TA 3N97B 4DL2A 1JUDA 4GC7A 5AI0A 3ETLA 1KFSA 1OUQA 5HR7A 8ICVA 1ZD5A 4DQRA 2FPKA 3BS5A 4KLIA 5ALYA 1ZRMA 4RUCA 4F4ZA 1TAQA 2G5HB 4F71A 3EPGA 1QQ5A 4LZGA 5HMLA 2A1AA 1COOA 2NRXA 4UB3A 2JH7A 3QU2A 2XCPA 3RJKA 2QKQA 4Z6FA 2UVVA 2W8KA 2E8MA 8ICIA 1OW5A 2EAOA 1PVRA 2FI1A 4IQVA 5C5JA 1XSLA 2HOIA 1IIPA 2LM1A 4RQMA 1D9FA 1FFUA 2RLTA 3N7PD 3PSIA 2AU0A 9ICTA 3SI8A 4GC6A 2JGAA 3H8JA 3RJIA 5KFNA 3F2CA 1CEZA 4JV2A 2JEJA 2WB1F 4LVSA 4QJFB 4QZCA 2ALZA 3R9KA 4J9RA 2KZ3A 1SZHA 5AM4A 2HBMA 1ZQ1C 4ECXA 3ED5A 4PHPA 3PW4A 1K5OA 4NXZA 1N56A 2H3FA 1BNPA 2W9MA 2W7OA 2KE7A 4KLLA 1L5UA 1WCLA 2KSOB 2LYAA 8ICQA 3IV6A 2IOFK 2IBKA 5DDYA 2IA6A 4ELVA 2BCVA 2I6XA 4JV1A 1IV8A 3NVWA 3WK8A 3UPQA 1XSPA 3TADC 4QIWF 1U4BA 1S9FA 2GWSA 1VDVA 2ZUDA 4CF4A 4KN4A 5CJ7A 4TUSA 5F9LA 1JRPA 5J2KA 3GIJA 5D49A 3C2KA 3CRXA 4F5PA 3AU2A 2CXYA 3PSFA 3H40A 4P0PB 5KFPA 5GTHU 4IL6U 4ED3A 3NVVA 2XGQA 7ICMA 2FLPA 4IRCA 2WFAA 3GIKA 4R8UB 4DL3A 3LDAA 2BHNA 5J0SA 4QZ8A 4RNOA 4ACOA 1XNSA 1RYUA 7ICJA 1VLBA 1UPHA 3ORYA 3G6VA 5KFVA 4DS5A 4O0IA 3E58A 1PVQA 3MGVA 4F91B 5J0XA 1CRXA 3IG5A 1QCKA 1ZQUA 5AIBA 2W9AA 4M9JA 3QU7A 2K8CB 2Y9TA 1J2NA 1LKYB 1YT3A 4M04A 4UBBA 3M7DA 1XSNA 2C22A 1BPEA 2DPJA 2LM4A 4I2EA 3PW2A 2V9WA 4Y2TA 1HUOA 1ZQOA 2A1JA 2UVUA 4NLZA 2CPRA 5AKGA 5KL1B 2HHSA 5KFJA 5BOMA 4DWIA 4F72A 3PR5B 4DL5A 4BWMA 4ECVA 1S0OA 2LBOA 5H2FU 1JIHA 1CUKA 4YR0A 3V72A 1N2XA 4NLKA 4ELUA 1RDFA 1ZD2P 3ALRA 9ICIA 4B9SA 5AI4A 5AM3A 5BPCA 2HBKA 4DSKA 4BGDA 3OTQA 2HOFA 2KZMA 4O3QA 1TK5A 1KFTA 1DK2A 2WF9A 2ASLA 2F77X 2YQEA 4ZH4A 2JEGA 3T5HA 5KG7A 3THVA 2ZXIA 4DOCA 2HCFA 2ZIVA 3WU2U 4RQ7A 1B0XA 4B6JA 1X6IA 4F92B 1NK0A 3FC4A 7ICEA 3D2QA 9ICOA 1DK3A 1V38A 1WUDA 3PW7A 1SV0A 1JI7A 1J2MA 3PV8A 5DKWA 1F44A 5AKEA 4ECYA 3QU4A 8ICRA 1RG6A 2W55A 5ALZA 2WF5A 4QWEA 5AKKA 1N62A 5ALQA 1QLNA 8ICJA 4QW8A 3RJGA 3Q8RB 4I2CA 5AK4A 1JN3A 4B9LA 4B9NA 1Q46A 5KFDA 1ZOLA 3M9OB 4RNNA 1JMSA 1HJPA 3WKDA 2F44A 3B9JA 4DSLA 3OJUA 1UA0A 4DQIA 2KJ8A 1NK8A 4O3MA 3D6JA 4P0QA 1ZQBA 4ED8A 4J03A 5DGBA 2BZFA 1EXNA 4O3NA 4KTQA 4UAYA 5AKIA 2K8AA 5AK3A 3J81j 1ZQTA 1TVAA 3FM9A 4BWJA 1XC9A 4UATA 2EZXA 5CR0A 4O5CA 2VJ4A 2OH2A 3HRDD 2BQUA 9ICBA 4EX6A 4P0PA 8ICFA 1LB2B 5KL8B 4YXJA 4KLFA 2LHTA 3ISDA 4EBCA 1C20A 4M6WB 4I2HA 2ISPA 2G06A 4MF8A 2AH5A 4R66A 4KLMA 4ED1A 1S97A 3TAQA 5AKLA 3F53A 3GV7B 2HHVA 2NRZA 1RQLA 4TQSA 5HP4A 1TK0A 3MFHA 2E3TA 2W11A 4I2GA 3E0FA 3TANA 1ECWA 5KFYA 1KQQA 5L9XA 4QZ9A 3L3FX 3RB0A 2RHFA 2KKPA 4C4RA 4YR2A 3RBDA 5ALIA 3Q8MA 1ZQCA 3SD7A 3RB6A 3WKEA 3HILA 1PK1B 5ALVA 1OXJA 4YVZA 2HSZA 4DFJA 4KLUA 5KFZA 3PSPA 2ZG6A 5D4BA 4J9NA 4NY8A 1S5LU 8ICGA 4RQNA 5AI5A 2ZTEA 1ZQKA 4B9MA 3C28A 4FS1A 2LKYA 3BQTA 1Y88A 1ZQMA 2KEYA 2PKEA 1KBUA 4FFDA 1ZD3A 2KP7A 5KAFU 4PGQA 1A77A 4EEYA 2DGZA 2UVWA 5ALSA 4BXOB 2NRVA 3JPTA 4ED7A 2VA2A 3WKAA 4UB1A 1D8BA 3M9MB 5KFOA 5JTIA 4F2RA 3NVYA 3CYMA 2WTFA 1HUZA 2MU2A 4PZNA 3TARA 2JXJA 2ZXHA 5J8YC 4K4IA 2WB1C 4DLGA 2ES6A 1LVHA 1Q8KA 5AKZA 2PXIA 4K4HA 3EZ5A 2JEIA 5ALFA 2EDUA 3RB4A 2VJ5A 2KD1A 5B66U 4RQ1A 8ICEA 4DQQA 2I9GA 3ZI4A 2BCSA 4MFFA 3BQ7A 2W9BB 1X6JA 1N63A 4F4XA 2QB1A 1JXEA 5AM5A 3MR6A 2QB0B 5IIOA 2K4EA 2HOQA 1Z4NA 4XA5A 4NLCA 2H3QA 2F1HA 3H8SA 1B43A 1X9MA 3T5JA 4FS2A 1DGJA 3D2NA 3U26A 4I29A 4NLGA 3RH4A 4UASA 4A8EA 5J2IA 3ZDBA 4UAZA 1NJXA 3ZDAA 7ICOA 2VKQA 1AROP 5F9NA 1QSYA 5J0YA 2LMRA 5AICA 4QZDA 5G5GA 3EW9A 1DXSA 5IIKA 3CP8A 2ZIVB 3MC1A 4RQ8A 1GO3F 5KFBA 4J9QA 4OJLA 2H3IA 5DBCA 3GIMA 1ZETA 1UCVA 2WAQC 5J0RA 3K4GA 1MA7A 1M6YA 4EELA 1BPBA 4PL1A 3DDHA 4Z6CA 2F8LA 2VA3A 2OHFA 2YMPA 3RB3A 3B0YA 5EWGA 2HHWA 1MQ3A 5KFUA 2KMDA 5TISU 3AUOA 3BDPA 4YCXA 2H3VA 1JX4A 3RAXA 4E0DA 3SEIA 2E8PA 3JPNA 1RZTA 4OJPA
chains in the Genus database with same CATH topology
2AGQA 1NKEA 4DEZA 1KTQA 5J2KA 5CP2A 3GIJA 5D49A 7ICHA 3C2KA 2JEFA 9ICFA 1Z00A 1MQ2A 1ZQYA 4F5PA 3AU2A 3JPRA 4ECQA 4J9SA 4EBDA 3H40A 4KLJA 1XU4A 2HHTA 4YQWA 4KLDA 5KFPA 2FMQA 3ZD9A 1IXRA 7ICKA 5DB7A 3SYZA 2DFLA 3ZDEA 5DG8A 4ED3A 4O3PA 2PFOA 4LZDA 4BXOA 3MR2A 3RR8A 1U9LA 5KT4A 5J2GA 4B9VA 2XGQA 7ICMA 2FLPA 8ICKA 4F5NA 4IRCA 4G3IA 3GIKA 2I1QA 4R8UB 5KG5A 3OHBA 4DL3A 3PW5A 1BGXT 1X9WA 4YMNA 3LDAA 3JPPA 3GILA 4P4OA 2BHNA 1U45A 5J0SA 4CCHA 4F5OA 1KLNA 4F4KA 9ICNA 4QZ8A 4RNOA 5HMMA 3TFRA 7ICJA 4MFCA 4DF4A 2R8JA 3ORYA 5DQIA 3PO4A 4O9MA 9ICHA 2XY5A 2PI5A 3G6VA 5KFVA 1ZQZA 5KT5A 3C1YA 4DS5A 4O0IA 5KFMA 1C7YA 5DB8A 4IR1A 4ECWA 4I2JA 4QZHA 8ICHA 1NJZA 4MFAA 4F91B 2F1IA 2BQRA 5J0XA 2ISOA 2NRWA 3KHLA 1ZQUA 2W9AA 2BPGA 1T7PA 4M9JA 4M9LA 4IR9A 4ECUA 5J2DA 1ZQPA 4FBUA 1UT5A 4YD2A 2J6SA 7ICRA 1DOQA 5KTQA 2AGPA 3HW8A 4M04A 4JV0A 4UBBA 3NGDA 4F5RA 1XSNA 4R65A 2C22A 1BPEA 2BR0A 3UXNA 4RT2A 2AJQA 4RU9A 3V7JA 2DPJA 3GV8B 3OGUA 3V6KA 3QZ8A 4UQGA 1BPXA 5KFAA 5DLFA 4I2EA 7ICUA 1T4GA 4J9PA 1B22A 2C28A 5DBAA 3PW2A 2V9WA 7ICTA 1HUOA 1ZQOA 4TURA 3RJJA 8ICBA 2A1JA 2XC9A 2C2RA 3SZ2A 5HHIA 3M8SA 3V7KA 2ATLA 2UVUA 2F1JA 3KTQA 4NLZA 2A1JB 2BCRA 4R63A 4UB4A 5KT2A 4F2SA 2HHSA 2ASDA 1WCNA 5KFJA 5BOMA 3HPOA 4MEXA 4DWIA 1BPYA 4P2HA 3PR5B 4NM1A 9ICMA 4DL5A 4BWMA 3BQ0A 4ECVA 3QE9Y 3QEBZ 4I27A 1S0OA 4P4PA 7ICLA 1QTMA 4YD1A 3C5GA 4YFKA 4DLEA 1JIHA 1CUKA 4YR0A 3V72A 2XY7A 1BVSA 4QZGA 5KG0A 2FLNA 4BDPA 4HYKA 2HHUA 2KFNA 2FPMA 5CA7A 4NLKA 4ELUA 8ICLA 4JWMA 5KFSA 4DS4A 9ICEA 9ICIA 3RTVA 4B9SA 5KFQA 5TZVA 4UB5A 5CB1A 4NLNA 5BPCA 4RQ0A 4IQUA 4RQ4A 4DSKA 4BGDA 2LYHA 2KZMA 5CHGA 2VA8A 3B0XA 4O3QA 1TK5A 1KFTA 4C8MA 3GV5B 4ZH4A 2ASLA 3UXOA 2P6RA 2BCQA 4I28A 9ICUA 4F93B 5J2FA 4R8UA 2JEGA 4EYIB 3T5HA 5KG7A 4RZRA 1QSSA 3THVA 4EZ9A 3PO5A 2ZTDA 4UBCA 3UXPA 4YMMA 1UA1A 2FMSA 5DLGA 4DOCA 1T3NA 4QWAA 4RQ7A 3OHAA 4XUSA 1NK0A 4F92B 7ICEA 5DGAA 3H4BA 9ICOA 4DSJA 3SV4A 3HX0A 1U49A 3RRGA 4I2FA 2V4QA 1ZQRA 3T5LA 3PW7A 3EYZA 5KFTA 2P6UA 3HWTA 3C5FA 4DFMA 2W9BA 3GDXA 5KFHA 3PV8A 5DKWA 3QZ7A 1T8EA 4QWBA 3T3FA 4DSEA 4RQ2A 4F50A 4ECYA 4Q8EA 8ICRA 1NK9A 2ASJA 7ICVA 5JUMA 4KLGA 4QWEA 3LWLA 4DL4A 2HVHA 2MAXA 3PMNA 3MGIA 1QLNA 4UAWA 8ICJA 2FPLA 4QW8A 2XO7A 3Q8RB 3RJGA 5L1KA 4I2CA 3AU6A 2ZJAA 1NK4A 4NM2A 4IQWA 3BJYA 1JN3A 2IHNA 4B9LA 4B9NA 2Q0ZX 9ICKA 4KLHA 5KFDA 4YG2A 3G6XA 1TAUA 5DB9A 4M2YA 4MF2A 4RQ6A 2J6TA 3PW0A 3OJSA 3M9OB 4RNNA 3QEAZ 4EBEA 5J2BA 2KTQA 1RYRA 1JMSA 3MFIA 2DPIA 1Z3EB 5J2CA 3T5KA 3ISCA 1BPDA 1HJPA 5L1LA 1D8LA 5J2HA 1KEJA 2VANA 5KFKA 2ZJ5A 4ECRA 1SKWA 3FYHA 4DSLA 4YXMA 1SL2A 2PI4A 3OJUA 1KFDA 5HHHA 5IIMA 1UA0A 2J6UA 4DQIA 5DB6A 1ZQQA 8ICMA 1ZQSA 2BCUA 3KHGA 2MUTA 1NK8A 4M9NA 1ZQXA 1K1SA 5EWFA 4DSFA 5KFCA 2ZUCA 4KLEA 4GXJA 7ICSA 3HP6A 5DG7A 4ED2A 2PFQA 4C8NA 1KDHA 1ZQBA 1XWLA 4ED8A 9ICCA 4YP3A 3Q8PB 4DQPA 1ZQGA 3UQ2A 1U48A 5DGBA 5J0OA 1EXNA 2R8HA 4O3NA 4KTQA 7ICFA 4UAYA 7ICGA 5J0UA 5IIIA 1ZQTA 1TVAA 1ZQAA 8ICAA 9ICQA 2ZUBA 4BWJA 2W8LA 5J0PA 2W9CB 5IIJA 2KZZA 4I2DA 4QZIA 1XC9A 4C8OA 1RPLA 4RPYA 4EZ6A 4ED6A 3RRHA 1RXWA 5CR0A 4O5CA 1SZPA 2V4RA 7ICIA 2NRTA 1SKSA 4Z6EA 5DDMA 4J9OA 3LWMA 4KLOA 3H7IA 5IILA 4DFPA 7ICNA 1UT8A 2BQUA 9ICBA 3PX4A 4Q8FA 1NKCA 4DFKA 2H5XA 3OSPA 1U47A 3GFKB 4O5KA 5D46A 4RPZA 8ICWA 2BKEA 8ICFA 3EWAA 5DG9A 1LB2B 3LK9A 4YXJA 3C2MA 3KHHA 1ZQJA 4Q45A 3MGHA 3ISDA 2RDJA 4KLFA 4M6WA 4RUAA 1NK6A 4O3SA 2BQ3A 3RJFA 4PHEA 9ICRA 4EBCA 3RR7A 5EWEA 3M9NB 4M6WB 3HT3A 1BPZA 4K4GA 4I2HA 2ISPA 4F5QA 2AQ0A 4MF8A 3MR3A 9ICVA 3ZD8A 1SKRA 4QZFA 4R66A 1KRPA 4F3OA 4ED1A 4KLMA 4RT3A 1S97A 1V9PA 4C8KA 3TAQA 3ISBA 5EOZA 3NTUA 4MEYA 4GLXA 4DOBA 1ZQIA 4EYHB 3GV7B 2B21A 3OSNA 1X9SA 1NKBA 2FLLA 2HHVA 3ZDCA 2NRZA 4TQSA 4M9HA 5HP4A 1TK0A 1S0MA 3MFHA 4QZAA 3EPIA 4PH5A 4QWDA 3PVXA 3RH6A 4IQTA 4I2GA 9ICSA 2HHXA 1S76D 3Q8KA 3RH5A 2HW3A 4FO6A 2RDIA 3TANA 1ZQDA 2BPCA 5KFYA 4PHDA 4DL6A 1SL0A 5L9XA 2JZBB 4QZ9A 1JXLA 4KITB 1K1QA 9ICAA 3RB0A 4O5EA 4YR2A 1Z00B 3RBDA 2BGWA 3Q8MA 1ZQCA 4RQ5A 4ECSA 3MR5A 4P4MA 3RB6A 8ICTA 3C1ZA 3G6YA 4PGXA 2ZJ8A 9ICWA 1ZQFA 5DQHA 3RAQA 3K75D 4YVZA 4QWCA 4DQSA 4DFJA 4UB2A 4X5VA 5KFZA 2Y1IA 4KLTA 5KG6A 4KLUA 3MDAA 3C2LA 5D4BA 4QW9A 5KFFA 5L1IA 4J9NA 1S10A 4J9MA 1ZJMA 4NY8A 8ICGA 5KT6A 5J0WA 2OWOA 8ICPA 2ZTEA 2R8GA 2JZBA 3V7LA 5IINA 1ZQKA 1D9DA 4B9MA 8ICNA 1RYSA 3ZDDA 4Z6DA 4FS1A 3SV3A 2PFNA 4DOAA 1N48A 9ICJA 3BQTA 4Q44A 4QZEA 1Y88A 2XGPA 3UQ0A 1S0NA 5KG3A 3IHQB 2HVIA 4J9KA 2AGOA 1ZQMA 2P66A 4GXKA 3Q8LA 1MSWD 8ICUA 3FDSA 4YN4A 5J0QA 8ICSA 3E2EA 1MC8A 5HNKA 4DO9A 4M0AA 4PGQA 4YR3A 4YMOA 5CWRA 2ZTCA 2KN7A 4ED0A 7ICPA 1A77A 4EEYA 1TK8A 3PR4A 1SL1A 3JPQA 2C2DA 5KFRA 3M8RA 1ZQLA 2UVWA 2C2EA 2BDPA 4BXOB 5KG2A 5KFLA 9ICPA 2NRVA 1L3VA 3JPTA 1ZQVA 8ICZA 4ED7A 1IM4A 4ECZA 5DQGA 4XRHA 3V6HA 2VA2A 4F8RA 4UB1A 5L1JA 5KT7A 3KHRA 8ICOA 1ZQEA 3PX6A 3TFSA 1TKDA 4O3RA 3M9MB 4DL7A 1LV5A 3N4MB 2HHQA 1L3TA 5KFOA 2XCAA 1PZNA 5J29A 4F2RA 2WTFA 1HUZA 3TARA 1NJWA 1ZYQA 1DGSA 3MABA 5DBBA 4R64A 3RBEA 4F4WA 4JWNA 4K4IA 4M9GA 4DLGA 2XY6A 4M47A 4KLSA 1RXVA 4ECTA 2PXIA 4K4HA 3EZ5A 3N97B 4DL2A 3GIIA 4KLQA 2JEIA 1XO1A 5J2AA 4O3OA 1NK7A 4I2IA 8ICXA 5KFWA 4GC7A 5KFEA 3RB4A 3ETLA 1L3UA 1KFSA 4RQ1A 8ICVA 4DQRA 8ICEA 2FPKA 4KLIA 4PHAA 4RUCA 4J9LA 4DQQA 2I9GA 9ICXA 1L3SA 2BCSA 4KMUA 4F4ZA 4MFFA 1TAQA 4PGYA 3EPGA 4PPXA 4LZGA 5KT3A 5HMLA 1COOA 2NRXA 5KFIA 4UB3A 2W9BB 3MBYA 1KSPA 3C23A 4F4XA 3RJEA 2XCPA 2AQ4A 1JXEA 1NK5A 3RJKA 4Z6FA 5KFXA 3MR6A 2UVVA 2W8KA 5IIOA 5J2JA 8ICIA 1ZQWA 2M9NA 1S77D 4XA5A 2IHMA 4IQVA 5C5JA 3GQCA 1XSLA 4I2BA 2F1HA 3H8SA 4TUSA 1NOMA 4JK1A 4QZBA 1B43A 2MUTB 3TQ1A 1TV9A 1D9FA 1S0VA 1X9MA 3T5JA 4FS2A 5BOLA 9ICLA 3MDCA 3H8WA 5KG4A 4XQ8A 3Q8QB 3RJHA 4TUQA 2PFPA 2AU0A 1NJYA 9ICTA 4ELTA 4I29A 4RQ3A 3SI8A 4NLGA 4GC6A 3RH4A 3H8JA 1A76A 3PMLA 5J2IA 3RJIA 3ZDBA 4UAZA 4JUZA 1NJXA 3ZDAA 7ICOA 1AROP 2W9CA 5F9NA 5KFNA 5J0YA 1QSYA 4Q43A 1ZQHA 1CEZA 5KG1A 4JV2A 1ZJNA 2FMPA 4QZDA 2JEJA 3EW9A 4DSIA 4LVSA 5IIKA 4QZCA 3Q8SB 2ALZA 8ICCA 4J9RA 4RQ8A 1D8YA 5KFBA 5J2EA 3BQ1A 4J9QA 2BPFA 3JPOA 2KZ3A 4I2AA 4IRDA 4B9TA 4DF8A 4B9UA 4TQRA 4ECXA 5KFGA 5DBCA 1ZQNA 4PHPA 3PW4A 4NXZA 4RNMA 1N56A 1TFRA 3GIMA 1ZETA 2W9MA 4FBTA 1XS9D 5J0TA 5J0RA 3K4GA 2R8IA 2R8KA 4IRKA 2UVRA 4KLLA 4F4YA 1BPBA 1L5UA 4TUPA 1WCLA 4Z6CA 2VA3A 8ICQA 2Y1JA 4GXIA 3PNCA 3V6JA 2KFZA 2IBKA 5DDYA 3C21A 2IA6A 3TAPA 4ELVA 3RB3A 3B0YA 2BCVA 5EWGA 8ICYA 4C8LA 2IMWP 2HHWA 1MQ3A 5KFUA 3BQ2A 1QSLA 4JV1A 3AUOA 3H4DA 3UPQA 3BDPA 1XSPA 4YCXA 1U4BA 1S9FA 1JX4A 2GWSA 3JPSA 3PY8A 9ICGA 2ZUDA 4KN7A 3RAXA 1X2IA 4KN4A 5CJ7A 3TI0A 4E0DA 3PX0A 4RPXA 3JPNA 1RZTA 3IM1A 1H38A 5F9LA 7ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGQ A;  1NKE A;  4DEZ A;  1KTQ A;  5J2K A;  5CP2 A;  3GIJ A;  5D49 A;  7ICH A;  3C2K A;  2JEF A;  9ICF A;  1Z00 A;  1MQ2 A;  1ZQY A;  4F5P A;  3AU2 A;  3JPR A;  4ECQ A;  4J9S A;  4EBD A;  3H40 A;  4KLJ A;  1XU4 A;  2HHT A;  4YQW A;  4KLD A;  5KFP A;  2FMQ A;  3ZD9 A;  1IXR A;  7ICK A;  5DB7 A;  3SYZ A;  2DFL A;  3ZDE A;  5DG8 A;  4ED3 A;  4O3P A;  2PFO A;  4LZD A;  4BXO A;  3MR2 A;  3RR8 A;  1U9L A;  5KT4 A;  5J2G A;  4B9V A;  2XGQ A;  7ICM A;  2FLP A;  8ICK A;  4F5N A;  4IRC A;  4G3I A;  3GIK A;  2I1Q A;  4R8U B;  5KG5 A;  3OHB A;  4DL3 A;  3PW5 A;  1BGX T;  1X9W A;  4YMN A;  3LDA A;  3JPP A;  3GIL A;  4P4O A;  2BHN A;  1U45 A;  5J0S A;  4CCH A;  4F5O A;  1KLN A;  4F4K A;  9ICN A;  4QZ8 A;  4RNO A;  5HMM A;  3TFR A;  7ICJ A;  4MFC A;  4DF4 A;  2R8J A;  3ORY A;  5DQI A;  3PO4 A;  4O9M A;  9ICH A;  2XY5 A;  2PI5 A;  3G6V A;  5KFV A;  1ZQZ A;  5KT5 A;  3C1Y A;  4DS5 A;  4O0I A;  5KFM A;  1C7Y A;  5DB8 A;  4IR1 A;  4ECW A;  4I2J A;  4QZH A;  8ICH A;  1NJZ A;  4MFA A;  4F91 B;  2F1I A;  2BQR A;  5J0X A;  2ISO A;  2NRW A;  3KHL A;  1ZQU A;  2W9A A;  2BPG A;  1T7P A;  4M9J A;  4M9L A;  4IR9 A;  4ECU A;  5J2D A;  1ZQP A;  4FBU A;  1UT5 A;  4YD2 A;  2J6S A;  7ICR A;  1DOQ A;  5KTQ A;  2AGP A;  3HW8 A;  4M04 A;  4JV0 A;  4UBB A;  3NGD A;  4F5R A;  1XSN A;  4R65 A;  2C22 A;  1BPE A;  2BR0 A;  3UXN A;  4RT2 A;  2AJQ A;  4RU9 A;  3V7J A;  2DPJ A;  3GV8 B;  3OGU A;  3V6K A;  3QZ8 A;  4UQG A;  1BPX A;  5KFA A;  5DLF A;  4I2E A;  7ICU A;  1T4G A;  4J9P A;  1B22 A;  2C28 A;  5DBA A;  3PW2 A;  2V9W A;  7ICT A;  1HUO A;  1ZQO A;  4TUR A;  3RJJ A;  8ICB A;  2A1J A;  2XC9 A;  2C2R A;  3SZ2 A;  5HHI A;  3M8S A;  3V7K A;  2ATL A;  2UVU A;  2F1J A;  3KTQ A;  4NLZ A;  2A1J B;  2BCR A;  4R63 A;  4UB4 A;  5KT2 A;  4F2S A;  2HHS A;  2ASD A;  1WCN A;  5KFJ A;  5BOM A;  3HPO A;  4MEX A;  4DWI A;  1BPY A;  4P2H A;  3PR5 B;  4NM1 A;  9ICM A;  4DL5 A;  4BWM A;  3BQ0 A;  4ECV A;  3QE9 Y;  3QEB Z;  4I27 A;  1S0O A;  4P4P A;  7ICL A;  1QTM A;  4YD1 A;  3C5G A;  4YFK A;  4DLE A;  1JIH A;  1CUK A;  4YR0 A;  3V72 A;  2XY7 A;  1BVS A;  4QZG A;  5KG0 A;  2FLN A;  4BDP A;  4HYK A;  2HHU A;  2KFN A;  2FPM A;  5CA7 A;  4NLK A;  4ELU A;  8ICL A;  4JWM A;  5KFS A;  4DS4 A;  9ICE A;  9ICI A;  3RTV A;  4B9S A;  5KFQ A;  5TZV A;  4UB5 A;  5CB1 A;  4NLN A;  5BPC A;  4RQ0 A;  4IQU A;  4RQ4 A;  4DSK A;  4BGD A;  2LYH A;  2KZM A;  5CHG A;  2VA8 A;  3B0X A;  4O3Q A;  1TK5 A;  1KFT A;  4C8M A;  3GV5 B;  4ZH4 A;  2ASL A;  3UXO A;  2P6R A;  2BCQ A;  4I28 A;  9ICU A;  4F93 B;  5J2F A;  4R8U A;  2JEG A;  4EYI B;  3T5H A;  5KG7 A;  4RZR A;  1QSS A;  3THV A;  4EZ9 A;  3PO5 A;  2ZTD A;  4UBC A;  3UXP A;  4YMM A;  1UA1 A;  2FMS A;  5DLG A;  4DOC A;  1T3N A;  4QWA A;  4RQ7 A;  3OHA A;  4XUS A;  1NK0 A;  4F92 B;  7ICE A;  5DGA A;  3H4B A;  9ICO A;  4DSJ A;  3SV4 A;  3HX0 A;  1U49 A;  3RRG A;  4I2F A;  2V4Q A;  1ZQR A;  3T5L A;  3PW7 A;  3EYZ A;  5KFT A;  2P6U A;  3HWT A;  3C5F A;  4DFM A;  2W9B A;  3GDX A;  5KFH A;  3PV8 A;  5DKW A;  3QZ7 A;  1T8E A;  4QWB A;  3T3F A;  4DSE A;  4RQ2 A;  4F50 A;  4ECY A;  4Q8E A;  8ICR A;  1NK9 A;  2ASJ A;  7ICV A;  5JUM A;  4KLG A;  4QWE A;  3LWL A;  4DL4 A;  2HVH A;  2MAX A;  3PMN A;  3MGI A;  1QLN A;  4UAW A;  8ICJ A;  2FPL A;  4QW8 A;  2XO7 A;  3Q8R B;  3RJG A;  5L1K A;  4I2C A;  3AU6 A;  2ZJA A;  1NK4 A;  4NM2 A;  4IQW A;  3BJY A;  1JN3 A;  2IHN A;  4B9L A;  4B9N A;  2Q0Z X;  9ICK A;  4KLH A;  5KFD A;  4YG2 A;  3G6X A;  1TAU A;  5DB9 A;  4M2Y A;  4MF2 A;  4RQ6 A;  2J6T A;  3PW0 A;  3OJS A;  3M9O B;  4RNN A;  3QEA Z;  4EBE A;  5J2B A;  2KTQ A;  1RYR A;  1JMS A;  3MFI A;  2DPI A;  1Z3E B;  5J2C A;  3T5K A;  3ISC A;  1BPD A;  1HJP A;  5L1L A;  1D8L A;  5J2H A;  1KEJ A;  2VAN A;  5KFK A;  2ZJ5 A;  4ECR A;  1SKW A;  3FYH A;  4DSL A;  4YXM A;  1SL2 A;  2PI4 A;  3OJU A;  1KFD A;  5HHH A;  5IIM A;  1UA0 A;  2J6U A;  4DQI A;  5DB6 A;  1ZQQ A;  8ICM A;  1ZQS A;  2BCU A;  3KHG A;  2MUT A;  1NK8 A;  4M9N A;  1ZQX A;  1K1S A;  5EWF A;  4DSF A;  5KFC A;  2ZUC A;  4KLE A;  4GXJ A;  7ICS A;  3HP6 A;  5DG7 A;  4ED2 A;  2PFQ A;  4C8N A;  1KDH A;  1ZQB A;  1XWL A;  4ED8 A;  9ICC A;  4YP3 A;  3Q8P B;  4DQP A;  1ZQG A;  3UQ2 A;  1U48 A;  5DGB A;  5J0O A;  1EXN A;  2R8H A;  4O3N A;  4KTQ A;  7ICF A;  4UAY A;  7ICG A;  5J0U A;  5III A;  1ZQT A;  1TVA A;  1ZQA A;  8ICA A;  9ICQ A;  2ZUB A;  4BWJ A;  2W8L A;  5J0P A;  2W9C B;  5IIJ A;  2KZZ A;  4I2D A;  4QZI A;  1XC9 A;  4C8O A;  1RPL A;  4RPY A;  4EZ6 A;  4ED6 A;  3RRH A;  1RXW A;  5CR0 A;  4O5C A;  1SZP A;  2V4R A;  7ICI A;  2NRT A;  1SKS A;  4Z6E A;  5DDM A;  4J9O A;  3LWM A;  4KLO A;  3H7I A;  5IIL A;  4DFP A;  7ICN A;  1UT8 A;  2BQU A;  9ICB A;  3PX4 A;  4Q8F A;  1NKC A;  4DFK A;  2H5X A;  3OSP A;  1U47 A;  3GFK B;  4O5K A;  5D46 A;  4RPZ A;  8ICW A;  2BKE A;  8ICF A;  3EWA A;  5DG9 A;  1LB2 B;  3LK9 A;  4YXJ A;  3C2M A;  3KHH A;  1ZQJ A;  4Q45 A;  3MGH A;  3ISD A;  2RDJ A;  4KLF A;  4M6W A;  4RUA A;  1NK6 A;  4O3S A;  2BQ3 A;  3RJF A;  4PHE A;  9ICR A;  4EBC A;  3RR7 A;  5EWE A;  3M9N B;  4M6W B;  3HT3 A;  1BPZ A;  4K4G A;  4I2H A;  2ISP A;  4F5Q A;  2AQ0 A;  4MF8 A;  3MR3 A;  9ICV A;  3ZD8 A;  1SKR A;  4QZF A;  4R66 A;  1KRP A;  4F3O A;  4ED1 A;  4KLM A;  4RT3 A;  1S97 A;  1V9P A;  4C8K A;  3TAQ A;  3ISB A;  5EOZ A;  3NTU A;  4MEY A;  4GLX A;  4DOB A;  1ZQI A;  4EYH B;  3GV7 B;  2B21 A;  3OSN A;  1X9S A;  1NKB A;  2FLL A;  2HHV A;  3ZDC A;  2NRZ A;  4TQS A;  4M9H A;  5HP4 A;  1TK0 A;  1S0M A;  3MFH A;  4QZA A;  3EPI A;  4PH5 A;  4QWD A;  3PVX A;  3RH6 A;  4IQT A;  4I2G A;  9ICS A;  2HHX A;  1S76 D;  3Q8K A;  3RH5 A;  2HW3 A;  4FO6 A;  2RDI A;  3TAN A;  1ZQD A;  2BPC A;  5KFY A;  4PHD A;  4DL6 A;  1SL0 A;  5L9X A;  2JZB B;  4QZ9 A;  1JXL A;  4KIT B;  1K1Q A;  9ICA A;  3RB0 A;  4O5E A;  4YR2 A;  1Z00 B;  3RBD A;  2BGW A;  3Q8M A;  1ZQC A;  4RQ5 A;  4ECS A;  3MR5 A;  4P4M A;  3RB6 A;  8ICT A;  3C1Z A;  3G6Y A;  4PGX A;  2ZJ8 A;  9ICW A;  1ZQF A;  5DQH A;  3RAQ A;  3K75 D;  4YVZ A;  4QWC A;  4DQS A;  4DFJ A;  4UB2 A;  4X5V A;  5KFZ A;  2Y1I A;  4KLT A;  5KG6 A;  4KLU A;  3MDA A;  3C2L A;  5D4B A;  4QW9 A;  5KFF A;  5L1I A;  4J9N A;  1S10 A;  4J9M A;  1ZJM A;  4NY8 A;  8ICG A;  5KT6 A;  5J0W A;  2OWO A;  8ICP A;  2ZTE A;  2R8G A;  2JZB A;  3V7L A;  5IIN A;  1ZQK A;  1D9D A;  4B9M A;  8ICN A;  1RYS A;  3ZDD A;  4Z6D A;  4FS1 A;  3SV3 A;  2PFN A;  4DOA A;  1N48 A;  9ICJ A;  3BQT A;  4Q44 A;  4QZE A;  1Y88 A;  2XGP A;  3UQ0 A;  1S0N A;  5KG3 A;  3IHQ B;  2HVI A;  4J9K A;  2AGO A;  1ZQM A;  2P66 A;  4GXK A;  3Q8L A;  1MSW D;  8ICU A;  3FDS A;  4YN4 A;  5J0Q A;  8ICS A;  3E2E A;  1MC8 A;  5HNK A;  4DO9 A;  4M0A A;  4PGQ A;  4YR3 A;  4YMO A;  5CWR A;  2ZTC A;  2KN7 A;  4ED0 A;  7ICP A;  1A77 A;  4EEY A;  1TK8 A;  3PR4 A;  1SL1 A;  3JPQ A;  2C2D A;  5KFR A;  3M8R A;  1ZQL A;  2UVW A;  2C2E A;  2BDP A;  4BXO B;  5KG2 A;  5KFL A;  9ICP A;  2NRV A;  1L3V A;  3JPT A;  1ZQV A;  8ICZ A;  4ED7 A;  1IM4 A;  4ECZ A;  5DQG A;  4XRH A;  3V6H A;  2VA2 A;  4F8R A;  4UB1 A;  5L1J A;  5KT7 A;  3KHR A;  8ICO A;  1ZQE A;  3PX6 A;  3TFS A;  1TKD A;  4O3R A;  3M9M B;  4DL7 A;  1LV5 A;  3N4M B;  2HHQ A;  1L3T A;  5KFO A;  2XCA A;  1PZN A;  5J29 A;  4F2R A;  2WTF A;  1HUZ A;  3TAR A;  1NJW A;  1ZYQ A;  1DGS A;  3MAB A;  5DBB A;  4R64 A;  3RBE A;  4F4W A;  4JWN A;  4K4I A;  4M9G A;  4DLG A;  2XY6 A;  4M47 A;  4KLS A;  1RXV A;  4ECT A;  2PXI A;  4K4H A;  3EZ5 A;  3N97 B;  4DL2 A;  3GII A;  4KLQ A;  2JEI A;  1XO1 A;  5J2A A;  4O3O A;  1NK7 A;  4I2I A;  8ICX A;  5KFW A;  4GC7 A;  5KFE A;  3RB4 A;  3ETL A;  1L3U A;  1KFS A;  4RQ1 A;  8ICV A;  4DQR A;  8ICE A;  2FPK A;  4KLI A;  4PHA A;  4RUC A;  4J9L A;  4DQQ A;  2I9G A;  9ICX A;  1L3S A;  2BCS A;  4KMU A;  4F4Z A;  4MFF A;  1TAQ A;  4PGY A;  3EPG A;  4PPX A;  4LZG A;  5KT3 A;  5HML A;  1COO A;  2NRX A;  5KFI A;  4UB3 A;  2W9B B;  3MBY A;  1KSP A;  3C23 A;  4F4X A;  3RJE A;  2XCP A;  2AQ4 A;  1JXE A;  1NK5 A;  3RJK A;  4Z6F A;  5KFX A;  3MR6 A;  2UVV A;  2W8K A;  5IIO A;  5J2J A;  8ICI A;  1ZQW A;  2M9N A;  1S77 D;  4XA5 A;  2IHM A;  4IQV A;  5C5J A;  3GQC A;  1XSL A;  4I2B A;  2F1H A;  3H8S A;  4TUS A;  1NOM A;  4JK1 A;  4QZB A;  1B43 A;  2MUT B;  3TQ1 A;  1TV9 A;  1D9F A;  1S0V A;  1X9M A;  3T5J A;  4FS2 A;  5BOL A;  9ICL A;  3MDC A;  3H8W A;  5KG4 A;  4XQ8 A;  3Q8Q B;  3RJH A;  4TUQ A;  2PFP A;  2AU0 A;  1NJY A;  9ICT A;  4ELT A;  4I29 A;  4RQ3 A;  3SI8 A;  4NLG A;  4GC6 A;  3RH4 A;  3H8J A;  1A76 A;  3PML A;  5J2I A;  3RJI A;  3ZDB A;  4UAZ A;  4JUZ A;  1NJX A;  3ZDA A;  7ICO A;  1ARO P;  2W9C A;  5F9N A;  5KFN A;  5J0Y A;  1QSY A;  4Q43 A;  1ZQH A;  1CEZ A;  5KG1 A;  4JV2 A;  1ZJN A;  2FMP A;  4QZD A;  2JEJ A;  3EW9 A;  4DSI A;  4LVS A;  5IIK A;  4QZC A;  3Q8S B;  2ALZ A;  8ICC A;  4J9R A;  4RQ8 A;  1D8Y A;  5KFB A;  5J2E A;  3BQ1 A;  4J9Q A;  2BPF A;  3JPO A;  2KZ3 A;  4I2A A;  4IRD A;  4B9T A;  4DF8 A;  4B9U A;  4TQR A;  4ECX A;  5KFG A;  5DBC A;  1ZQN A;  4PHP A;  3PW4 A;  4NXZ A;  4RNM A;  1N56 A;  1TFR A;  3GIM A;  1ZET A;  2W9M A;  4FBT A;  1XS9 D;  5J0T A;  5J0R A;  3K4G A;  2R8I A;  2R8K A;  4IRK A;  2UVR A;  4KLL A;  4F4Y A;  1BPB A;  1L5U A;  4TUP A;  1WCL A;  4Z6C A;  2VA3 A;  8ICQ A;  2Y1J A;  4GXI A;  3PNC A;  3V6J A;  2KFZ A;  2IBK A;  5DDY A;  3C21 A;  2IA6 A;  3TAP A;  4ELV A;  3RB3 A;  3B0Y A;  2BCV A;  5EWG A;  8ICY A;  4C8L A;  2IMW P;  2HHW A;  1MQ3 A;  5KFU A;  3BQ2 A;  1QSL A;  4JV1 A;  3AUO A;  3H4D A;  3UPQ A;  3BDP A;  1XSP A;  4YCX A;  1U4B A;  1S9F A;  1JX4 A;  2GWS A;  3JPS A;  3PY8 A;  9ICG A;  2ZUD A;  4KN7 A;  3RAX A;  1X2I A;  4KN4 A;  5CJ7 A;  3TI0 A;  4E0D A;  3PX0 A;  4RPX A;  3JPN A;  1RZT A;  3IM1 A;  1H38 A;  5F9L A;  7ICQ A; 
#chains in the Genus database with same CATH topology
 2YMM A;  5GTI U;  5AKX A;  4GFJ A;  3F2D A;  3FAH A;  7ICH A;  1L8O A;  1ZQY A;  3JPR A;  4EBD A;  2HHT A;  2NV3 A;  1KN5 A;  3BS7 A;  4YQW A;  1SXD A;  1IXR A;  2DQN B;  5DB7 A;  3K1R B;  2DFL A;  2PFO A;  2CN1 A;  1FIQ A;  5KT4 A;  2GLE A;  3SMV A;  3RF9 A;  8ICK A;  3PW5 A;  1X9W A;  4YMN A;  3GIL A;  4CCH A;  3KZI U;  4F5O A;  1KLN A;  3SAG A;  5EE3 A;  3L4P A;  3AN1 A;  2W3R A;  5ALT A;  5J8Y A;  3C29 A;  9ICH A;  1KW4 A;  2W03 A;  4IR1 A;  2E5S A;  1C7Y A;  8ICH A;  2NRW A;  3KHL A;  1T7P A;  4IR9 A;  4ECU A;  5J2D A;  2J6S A;  1SV4 A;  2KVS A;  4F5R A;  3WK9 A;  3V7J A;  3HKZ F;  2KOB A;  3QZ8 A;  1ZD4 A;  1BPX A;  1L7O A;  7ICU A;  1B4F A;  2XID A;  5DBA A;  7ICT A;  3LVW A;  3RJJ A;  4TUR A;  8ICB A;  2XC9 A;  3AQF A;  2D8C A;  3V7K A;  2F1J A;  1CI4 A;  1PUZ A;  4UB4 A;  2HDO A;  4MEX A;  1BPY A;  3BQ0 A;  3DV9 A;  4P4P A;  1QTM A;  4YD1 A;  2BR0 A;  4DLE A;  1L7M A;  1MSW D;  2HHU A;  5KG0 A;  4BDP A;  4HYK A;  2FPM A;  3A0B U;  5EE9 A;  3RTV A;  4UB5 A;  4NLN A;  4IQU A;  4BUG A;  2VA8 A;  3TAD A;  2A3V A;  9ICU A;  4UW9 A;  1TE2 A;  3KOO A;  1WWU A;  5DLG A;  2JR5 A;  3OHA A;  5DGA A;  3H4B A;  3HJE A;  3SV4 A;  1U49 A;  3EYZ A;  4DFM A;  2W9B A;  3CNH A;  1T8E A;  3T3F A;  1QQ7 A;  4RQ2 A;  2F76 X;  3S6J A;  2WHE A;  2KV2 A;  2HBL A;  2MAX A;  2ZIX B;  4UAW A;  3UM9 A;  1NK4 A;  4NM2 A;  2VIX A;  3TKA A;  4DFD A;  4US8 A;  4KLH A;  3BZC A;  1TAU A;  2YN4 A;  4EBE A;  2KTQ A;  1Z3E B;  5J2H A;  1KEJ A;  4PJ0 U;  1BNO A;  3NAS A;  2NO5 A;  4YXM A;  1SL2 A;  2H3Z A;  5AM2 A;  1ZQQ A;  1ZQS A;  3KHG A;  2GO7 A;  1L7P A;  2MUT A;  3T79 A;  1K1S A;  2AXT U;  2ZUC A;  7ICS A;  3HP6 A;  1PVP A;  1XWL A;  4DQP A;  1U48 A;  2R8H A;  7ICF A;  5J0U A;  5J0P A;  2W9C B;  5IIJ A;  2W54 A;  4RPY A;  4ED6 A;  2K4H A;  3WKC A;  3LWM A;  4P0Q B;  3LVV A;  4CF5 A;  2I5H A;  1PK3 A;  3H0L B;  1NKC A;  3PZP A;  1U47 A;  3GFK B;  3EWA A;  2YML A;  4U7C A;  5ALP A;  3QUC A;  2RDJ A;  3RJF A;  3KD3 A;  1S8O A;  5EWE A;  4K4G A;  4JMU A;  4EEN A;  3ZD8 A;  1SKR A;  1KRP A;  4F3O A;  3VC8 A;  3ISB A;  5EOZ A;  2EAP A;  5AK6 A;  4DOB A;  4EYH B;  1WWV A;  2B21 A;  3OSN A;  2FLL A;  2E8O A;  2M0N A;  4QZA A;  1SV0 C;  4QWD A;  3PVX A;  3RH6 A;  2G07 A;  4IQT A;  3Q8K A;  3RH5 A;  1UHU A;  2HW3 A;  2E8N A;  2JZB B;  1JXL A;  3KFU F;  1K1Q A;  9ICA A;  1Z00 B;  5AKY A;  3O0F A;  3MR5 A;  3G6Y A;  2QAR B;  3M1Y A;  9ICW A;  2ZJ8 A;  5DQH A;  4DQS A;  4X5V A;  2Y1I A;  5KG6 A;  2O6K A;  3MDA A;  3ICX A;  3C2L A;  4QW9 A;  5KFF A;  4UB6 U;  5KT6 A;  2DUY A;  2JZB A;  3M6K A;  5IIN A;  1D9D A;  1RYS A;  3ZDD A;  4Z6D A;  4DOA A;  1N48 A;  5JRT A;  3IRU A;  9ICJ A;  3QNM A;  4QZE A;  2AGO A;  2P66 A;  1F0M A;  5ALJ A;  3SEN A;  3FDS A;  4YN4 A;  5J0Q A;  8ICS A;  1NZB A;  3E2E A;  4DO9 A;  4ED0 A;  5CWR A;  2ZTC A;  7ICP A;  1TK8 A;  3TAC B;  3I28 A;  5KFR A;  1ZQL A;  2C2E A;  2BDP A;  2QB0 A;  5KFL A;  9ICP A;  3SQI A;  1ZQV A;  3V6H A;  4ECZ A;  3F5E A;  4XRH A;  2W7P A;  2OM6 A;  5KT7 A;  8ICO A;  2RQ5 A;  4O3R A;  3TFS A;  1TKD A;  1LV5 A;  3N4M B;  1SXE A;  1PZN A;  5J29 A;  5AKH A;  4EEK A;  1WYG A;  3MAB A;  2DBY A;  4NL9 C;  4F4W A;  3ONN A;  2EAM A;  4M9G A;  4M47 A;  1RXV A;  1VJ5 A;  4OJ5 A;  3GII A;  4WJ3 B;  1XO1 A;  1X9X A;  5J2A A;  4O3O A;  1NK7 A;  8ICX A;  5KFW A;  4C4S A;  2LYB A;  4PHA A;  1L3S A;  4KMU A;  4PGY A;  4FZN A;  5KT3 A;  5KFI A;  5ALD A;  3MBY A;  3C23 A;  3RJE A;  2KHV A;  2AQ4 A;  4FZM A;  3IG8 A;  1S77 D;  2IHM A;  2ZIW B;  1TV9 A;  3N7S C;  3MDC A;  5KG4 A;  3Q8Q B;  2PFP A;  1L6N A;  1NJY A;  4ELT A;  2DKX A;  1A76 A;  3PML A;  4IS7 A;  4OJO A;  2KG5 A;  3KBB A;  5ALR A;  1ZQH A;  5ALH A;  2D3D A;  4DSI A;  3H0R B;  2EH9 A;  8ICC A;  2WF6 A;  1UQV A;  2PMZ F;  4IRD A;  4B9T A;  4DF8 A;  4TQR A;  1RM6 C;  1L8L A;  5KFG A;  5CRX A;  4RNM A;  1HIW A;  2F2A B;  4G9B A;  2R8I A;  2R8K A;  4IRK A;  4UAV A;  4TUP A;  2Y1J A;  3QX7 A;  2KVC A;  3C21 A;  3SR6 A;  1FEZ A;  3AM9 A;  2L5Y A;  1QSL A;  3H4D A;  4Y2U A;  2GH1 A;  4CE6 A;  3PY8 A;  9ICG A;  4KN7 A;  1X2I A;  3TI0 A;  3PX0 A;  4RPX A;  1H38 A;  3V6K A;  7ICQ A;  1NKE A;  4DEZ A;  1KTQ A;  1SIJ A;  9ICF A;  1Z00 A;  4J9S A;  4KLJ A;  2OYY A;  2FMQ A;  7ICK A;  3SYZ A;  3ZDE A;  4O3P A;  5ALW A;  3MR2 A;  3UMG A;  1U9L A;  5J2G A;  5AI6 A;  4G3I A;  3OHB A;  1BGX T;  3NRZ A;  1U45 A;  3LYS A;  4NL9 A;  3QUB A;  4MFC A;  2R8J A;  1KKX A;  5DQI A;  3PO4 A;  4O9M A;  2G08 A;  2PI5 A;  4CGZ A;  1ZQZ A;  5KT5 A;  2IOH A;  2R18 A;  1A0P A;  5DB8 A;  4UAU A;  3BZK A;  4I2J A;  1SB3 C;  5EE0 A;  4MFA A;  2F1I A;  2KIC A;  3PST A;  1ZRN A;  2ISO A;  2BPG A;  1XO0 A;  1Q3V A;  3A0H U;  3EUB 2;  1ZQP A;  1UT5 A;  1DOQ A;  5KTQ A;  3I76 A;  3NGD A;  4R65 A;  3UXN A;  2LI6 A;  4RT2 A;  2AJQ A;  4RU9 A;  3OGU A;  3N28 A;  4UQG A;  5KFA A;  1X40 A;  2ODG A;  2C28 A;  2EZZ A;  2ATL A;  5HHI A;  3M8S A;  1V85 A;  4USA A;  2A1J B;  2BCR A;  4F2S A;  1WCN A;  4QNL A;  4P2H A;  3QEB Z;  3QE9 Y;  3NUQ A;  7ICL A;  2FLN A;  1BVS A;  4QZG A;  4NWI A;  8ICL A;  4JWM A;  4DS4 A;  4AYB F;  5TZV A;  4AP9 A;  4RQ0 A;  1Z4O A;  2LYH A;  5CHG A;  2NO4 A;  4C8M A;  2DKZ A;  3GV5 B;  2P6R A;  4I28 A;  2BCQ A;  4C80 A;  2DF4 B;  4R8U A;  4F93 B;  5J2F A;  1QSS A;  4UBC A;  3UXP A;  4YMM A;  1UA1 A;  4NV0 A;  4C7Y A;  1JRO A;  2QAR A;  4DSJ A;  3HX0 A;  4I2F A;  1ZQR A;  3T5L A;  3AL0 B;  5KFT A;  2P6U A;  3HWT A;  3GDX A;  5KFH A;  1P7D A;  3ETR A;  4QWB A;  4DSE A;  4F50 A;  2YTU A;  2W04 A;  1NK9 A;  2JV3 A;  2ASJ A;  7ICV A;  5JUM A;  4KLG A;  2JH1 A;  2K89 A;  3LWL A;  4DL4 A;  3PMN A;  2A19 A;  2OXO A;  5K4L A;  3AU6 A;  2ZJA A;  1O03 A;  2IHN A;  5AK5 A;  2KJ5 A;  3G6X A;  3GU3 A;  2ESE A;  2J6T A;  3UMC A;  3QEA Z;  2YB1 A;  1RYR A;  4Y2Y A;  3T5K A;  1BPD A;  1D8L A;  2VAN A;  5KFK A;  2ZJ5 A;  5EE1 A;  4CNQ A;  1KFD A;  5HHH A;  3SAF A;  8ICM A;  2DWQ A;  1ZQX A;  5ALL A;  4DSF A;  2E1F A;  4KLE A;  5CEH A;  2PFQ A;  1KDH A;  9ICC A;  4PZO A;  2EAN A;  2B6G A;  3QXG A;  1ZQA A;  5C0Y A;  8ICA A;  2KZZ A;  4QZI A;  2RRD A;  3KKA C;  1RPL A;  2G0A A;  1NI3 A;  4OJ6 A;  4EZ6 A;  3RRH A;  1RXW A;  5G5H A;  2KIW A;  4J9O A;  3H7I A;  5IIL A;  7ICN A;  1QH9 A;  3PX4 A;  4DFK A;  3OSP A;  5D46 A;  1N60 A;  2BKE A;  3IDW A;  1MN8 A;  3C2M A;  1ZQJ A;  4UAR A;  3MGH A;  4M6W A;  4RUA A;  1NK6 A;  2PMZ C;  9ICR A;  3M9N B;  3HT3 A;  3N7R C;  4OCZ A;  4F5Q A;  3WK7 A;  1QQ6 A;  3MR3 A;  4GIB A;  2HMX A;  4QZF A;  3WK6 A;  4IC9 A;  2FJ6 A;  4RT3 A;  3NTU A;  1X9S A;  2OCE A;  4M9H A;  1S0M A;  3NVZ A;  4OO1 J;  9ICS A;  2HHX A;  1S76 D;  4UB8 U;  2RDI A;  1ZQD A;  2BPC A;  3NS1 A;  4PL2 A;  4U6P A;  4KIT B;  2YMQ A;  2ZIU A;  2CRX A;  4O5E A;  2BGW A;  4P4M A;  8ICT A;  3RAQ A;  3K75 D;  4QWC A;  2DL0 A;  4UB2 A;  4KLT A;  1N5X A;  1A6S A;  5AI9 A;  5L1I A;  1Z1B A;  2OWO A;  4KX5 A;  8ICN A;  2PFN A;  3I1Y A;  2XGP A;  3UQ0 A;  1S0N A;  5ALO A;  5KG3 A;  3IHQ B;  2HVI A;  3Q8L A;  4YMO A;  2KN7 A;  3PR4 A;  3M8R A;  2Z7J A;  1L3V A;  8ICZ A;  1LKY A;  1SGG A;  5DQG A;  2BDU A;  5L1J A;  3KHR A;  3F2B A;  3PX6 A;  4DL7 A;  2HHQ A;  1L3T A;  2XCA A;  3VCB A;  1NJW A;  1ZYQ A;  1DGS A;  2Y0S F;  5AM0 A;  5DBB A;  5ALE A;  4NLB A;  4JWN A;  2HI0 A;  4KLS A;  2NYV A;  4ECT A;  1TAM A;  4KMO B;  3OPX A;  1Z19 A;  4KLQ A;  2JRZ A;  4I2I A;  1X42 A;  5KFE A;  1Q3U A;  2ZIX A;  1L3U A;  2W3S A;  4EX7 A;  3WKB A;  4J9L A;  9ICX A;  3GZF A;  5ALN A;  4PPX A;  2F8K A;  2EZY A;  1KSP A;  4C0Z A;  1O08 A;  4DCC A;  2RP5 A;  1NK5 A;  5KFX A;  5AHX A;  5J2J A;  1ZQW A;  2M9N A;  2XVT A;  3GQC A;  4I2B A;  3TQ1 A;  1NOM A;  4JK1 A;  4QZB A;  2MUT B;  1YZ6 A;  5BOL A;  9ICL A;  3H8W A;  2YY6 A;  1ED1 A;  4XQ8 A;  3RJH A;  4TUQ A;  2LPE A;  4RQ3 A;  2N1R A;  1HEK A;  1ZXI A;  4JUZ A;  2W9C A;  1X66 A;  4Q43 A;  5KG1 A;  1ZJN A;  2FMP A;  2G5I B;  3Q8S B;  1D8Y A;  2BPF A;  4JB3 A;  5J2E A;  3BQ1 A;  4I2A A;  3JPO A;  5HR6 A;  5AIA A;  1SWW A;  4B9U A;  4Y2X A;  1ZQN A;  2F3N A;  1T94 A;  1TFR A;  2YB4 A;  4FBT A;  1XS9 D;  5J0T A;  5ALM A;  2UVR A;  3QU5 A;  4F4Y A;  4GXI A;  3L5K A;  1PK1 A;  3PNC A;  3V6J A;  2KFZ A;  3NRW A;  3TAP A;  8ICY A;  4C8L A;  2IMW P;  3BQ2 A;  2YX8 A;  2JMG A;  3JPS A;  3AMZ A;  2AHO B;  3QUT A;  3IM1 A;  2AGQ A;  5CP2 A;  3HKZ C;  3D2S A;  2IOF A;  3QYP A;  2JEF A;  4Y2Q A;  1MQ2 A;  4ECQ A;  1XU4 A;  4KLD A;  3ZD9 A;  4CF3 A;  5DG8 A;  4LZD A;  4BXO A;  3RR8 A;  1URJ A;  3H8M A;  4B9V A;  2MSN A;  4HAI A;  4F5N A;  2I1Q A;  4Y2S A;  5KG5 A;  3DEE A;  2K60 A;  4C4T A;  3JPP A;  4P4O A;  9ICN A;  4F4K A;  5HMM A;  2WF7 A;  3TFR A;  3KKA A;  4DF4 A;  5AI8 A;  2XY5 A;  3AEV A;  3C1Y A;  5KFM A;  4ECW A;  4QZH A;  1NJZ A;  2BQR A;  1FFV A;  4M9L A;  4MHV A;  4FBU A;  4Y2P A;  2Y0S C;  4YD2 A;  2E1E A;  7ICR A;  4OD0 A;  2AGP A;  3HW8 A;  4JV0 A;  2HBJ A;  2W43 A;  3SAH A;  2K4P A;  3GV8 B;  4LJX A;  2WAQ F;  2JHD A;  5DLF A;  1T4G A;  4J9P A;  1B22 A;  2EQY A;  1T3Q A;  2C2R A;  4US9 A;  4ZOH C;  3SZ2 A;  3KTQ A;  1SWV A;  4R63 A;  5KT2 A;  2ASD A;  3HPO A;  4CDG A;  4NM1 A;  9ICM A;  4I27 A;  4QIW C;  3C5G A;  4YFK A;  1S0V A;  2XY7 A;  2KFN A;  5CA7 A;  5KFS A;  9ICE A;  1IG6 A;  5KFQ A;  2KNJ A;  5CB1 A;  4RQ4 A;  5FP0 A;  3M6Z A;  3B0X A;  2KHQ A;  2KK0 A;  2MA1 A;  3UXO A;  1NZP A;  4EYI B;  4RZR A;  4EZ9 A;  3PO5 A;  2ZTD A;  2FMS A;  1T3N A;  4QWA A;  4XUS A;  1JAL A;  3RRG A;  2V4Q A;  3BS5 B;  3C5F A;  3QZ7 A;  4Q8E A;  3CW2 C;  1F5S A;  2HVH A;  2QLT A;  2KJ9 A;  4FZL A;  3MGI A;  2FPL A;  3H0M B;  2XO7 A;  3UMB A;  5L1K A;  3AQE A;  4IQW A;  3BJY A;  2Y9U A;  1FO4 A;  5B5E U;  2GOL A;  5ALG A;  2Q0Z X;  9ICK A;  4YG2 A;  5DB9 A;  4M2Y A;  4MF2 A;  4RQ6 A;  3RFA A;  3PW0 A;  3OJS A;  5J2B A;  3MFI A;  2DPI A;  5J2C A;  3ISC A;  5L1L A;  5F3X B;  5ALK A;  4ECR A;  1SKW A;  3FYH A;  2PI4 A;  5IIM A;  2J6U A;  5DB6 A;  2ZIU B;  2BCU A;  4M9N A;  5EWF A;  1L7N A;  5KFC A;  5E79 U;  4GXJ A;  5DG7 A;  4ED2 A;  2KIV A;  4C8N A;  4YP3 A;  3Q8P B;  3KZX A;  1ZQG A;  3UQ2 A;  5J0O A;  7ICG A;  2FDR A;  5III A;  9ICQ A;  2ZUB A;  2W8L A;  4Y2J A;  4I2D A;  1DRG A;  4C8O A;  1J97 A;  2D6F C;  5A0L A;  1SZP A;  2V4R A;  1KL9 A;  7ICI A;  2NRT A;  1SKS A;  2P35 A;  4AYB C;  4Z6E A;  5DDM A;  2KSO A;  4KLO A;  4DFP A;  1UT8 A;  4Q8F A;  2H5X A;  4O5K A;  4C7Z A;  4RPZ A;  8ICW A;  5ALX A;  5DG9 A;  3LK9 A;  2WF8 A;  3KHH A;  4Q45 A;  4O3S A;  2BQ3 A;  1RQN A;  4PHE A;  3RR7 A;  1YZ7 A;  1BPZ A;  4KX3 A;  2AQ0 A;  9ICV A;  1N61 A;  3WK4 A;  1AQ6 A;  1COK A;  5AM1 A;  1V9P A;  4C8K A;  4FE3 A;  4MEY A;  4GLX A;  1ZQI A;  1NKB A;  1V97 A;  3IP4 B;  3ZDC A;  4Y2V A;  2B0C A;  2FE9 A;  3EPI A;  4PH5 A;  3WK5 A;  2K8B B;  4FO6 A;  4PHD A;  4DL6 A;  1SL0 A;  4ICA A;  4Y2R A;  2K4I A;  4NJ8 A;  3K1Z A;  4RQ5 A;  5L1M A;  4ECS A;  5JU5 A;  3C1Z A;  2MRL A;  4PGX A;  2XIC A;  5ALU A;  1ZQF A;  4BX9 C;  3QU9 A;  4BJQ A;  1S10 A;  4J9M A;  1ZJM A;  5J0W A;  8ICP A;  2R8G A;  3V7L A;  3SV3 A;  4Q44 A;  5KAI U;  2G09 A;  4J9K A;  8ICU A;  2ZIW A;  4GXK A;  5AKJ A;  2OEH A;  1MC8 A;  5HNK A;  4M0A A;  4YR3 A;  3F5A A;  1SL1 A;  3JPQ A;  2C2D A;  5KG2 A;  3QUQ A;  1IM4 A;  4F8R A;  1Z1V A;  3IN5 A;  5T14 A;  1ZQE A;  1N5W A;  5KNI A;  1WG8 A;  4R64 A;  3RBE A;  2XY6 A;  2KKV A;  2XI9 A;  4CRX A;  1NNL A;  2Q4T A;  3N97 B;  4DL2 A;  1JUD A;  4GC7 A;  5AI0 A;  3ETL A;  1KFS A;  1OUQ A;  5HR7 A;  8ICV A;  1ZD5 A;  4DQR A;  2FPK A;  3BS5 A;  4KLI A;  5ALY A;  1ZRM A;  4RUC A;  4F4Z A;  1TAQ A;  2G5H B;  4F71 A;  3EPG A;  1QQ5 A;  4LZG A;  5HML A;  2A1A A;  1COO A;  2NRX A;  4UB3 A;  2JH7 A;  3QU2 A;  2XCP A;  3RJK A;  2QKQ A;  4Z6F A;  2UVV A;  2W8K A;  2E8M A;  8ICI A;  1OW5 A;  2EAO A;  1PVR A;  2FI1 A;  4IQV A;  5C5J A;  1XSL A;  2HOI A;  1IIP A;  2LM1 A;  4RQM A;  1D9F A;  1FFU A;  2RLT A;  3N7P D;  3PSI A;  2AU0 A;  9ICT A;  3SI8 A;  4GC6 A;  2JGA A;  3H8J A;  3RJI A;  5KFN A;  3F2C A;  1CEZ A;  4JV2 A;  2JEJ A;  2WB1 F;  4LVS A;  4QJF B;  4QZC A;  2ALZ A;  3R9K A;  4J9R A;  2KZ3 A;  1SZH A;  5AM4 A;  2HBM A;  1ZQ1 C;  4ECX A;  3ED5 A;  4PHP A;  3PW4 A;  1K5O A;  4NXZ A;  1N56 A;  2H3F A;  1BNP A;  2W9M A;  2W7O A;  2KE7 A;  4KLL A;  1L5U A;  1WCL A;  2KSO B;  2LYA A;  8ICQ A;  3IV6 A;  2IOF K;  2IBK A;  5DDY A;  2IA6 A;  4ELV A;  2BCV A;  2I6X A;  4JV1 A;  1IV8 A;  3NVW A;  3WK8 A;  3UPQ A;  1XSP A;  3TAD C;  4QIW F;  1U4B A;  1S9F A;  2GWS A;  1VDV A;  2ZUD A;  4CF4 A;  4KN4 A;  5CJ7 A;  4TUS A;  5F9L A;  1JRP A;  5J2K A;  3GIJ A;  5D49 A;  3C2K A;  3CRX A;  4F5P A;  3AU2 A;  2CXY A;  3PSF A;  3H40 A;  4P0P B;  5KFP A;  5GTH U;  4IL6 U;  4ED3 A;  3NVV A;  2XGQ A;  7ICM A;  2FLP A;  4IRC A;  2WFA A;  3GIK A;  4R8U B;  4DL3 A;  3LDA A;  2BHN A;  5J0S A;  4QZ8 A;  4RNO A;  4ACO A;  1XNS A;  1RYU A;  7ICJ A;  1VLB A;  1UPH A;  3ORY A;  3G6V A;  5KFV A;  4DS5 A;  4O0I A;  3E58 A;  1PVQ A;  3MGV A;  4F91 B;  5J0X A;  1CRX A;  3IG5 A;  1QCK A;  1ZQU A;  5AIB A;  2W9A A;  4M9J A;  3QU7 A;  2K8C B;  2Y9T A;  1J2N A;  1LKY B;  1YT3 A;  4M04 A;  4UBB A;  3M7D A;  1XSN A;  2C22 A;  1BPE A;  2DPJ A;  2LM4 A;  4I2E A;  3PW2 A;  2V9W A;  4Y2T A;  1HUO A;  1ZQO A;  2A1J A;  2UVU A;  4NLZ A;  2CPR A;  5AKG A;  5KL1 B;  2HHS A;  5KFJ A;  5BOM A;  4DWI A;  4F72 A;  3PR5 B;  4DL5 A;  4BWM A;  4ECV A;  1S0O A;  2LBO A;  5H2F U;  1JIH A;  1CUK A;  4YR0 A;  3V72 A;  1N2X A;  4NLK A;  4ELU A;  1RDF A;  1ZD2 P;  3ALR A;  9ICI A;  4B9S A;  5AI4 A;  5AM3 A;  5BPC A;  2HBK A;  4DSK A;  4BGD A;  3OTQ A;  2HOF A;  2KZM A;  4O3Q A;  1TK5 A;  1KFT A;  1DK2 A;  2WF9 A;  2ASL A;  2F77 X;  2YQE A;  4ZH4 A;  2JEG A;  3T5H A;  5KG7 A;  3THV A;  2ZXI A;  4DOC A;  2HCF A;  2ZIV A;  3WU2 U;  4RQ7 A;  1B0X A;  4B6J A;  1X6I A;  4F92 B;  1NK0 A;  3FC4 A;  7ICE A;  3D2Q A;  9ICO A;  1DK3 A;  1V38 A;  1WUD A;  3PW7 A;  1SV0 A;  1JI7 A;  1J2M A;  3PV8 A;  5DKW A;  1F44 A;  5AKE A;  4ECY A;  3QU4 A;  8ICR A;  1RG6 A;  2W55 A;  5ALZ A;  2WF5 A;  4QWE A;  5AKK A;  1N62 A;  5ALQ A;  1QLN A;  8ICJ A;  4QW8 A;  3RJG A;  3Q8R B;  4I2C A;  5AK4 A;  1JN3 A;  4B9L A;  4B9N A;  1Q46 A;  5KFD A;  1ZOL A;  3M9O B;  4RNN A;  1JMS A;  1HJP A;  3WKD A;  2F44 A;  3B9J A;  4DSL A;  3OJU A;  1UA0 A;  4DQI A;  2KJ8 A;  1NK8 A;  4O3M A;  3D6J A;  4P0Q A;  1ZQB A;  4ED8 A;  4J03 A;  5DGB A;  2BZF A;  1EXN A;  4O3N A;  4KTQ A;  4UAY A;  5AKI A;  2K8A A;  5AK3 A;  3J81 j;  1ZQT A;  1TVA A;  3FM9 A;  4BWJ A;  1XC9 A;  4UAT A;  2EZX A;  5CR0 A;  4O5C A;  2VJ4 A;  2OH2 A;  3HRD D;  2BQU A;  9ICB A;  4EX6 A;  4P0P A;  8ICF A;  1LB2 B;  5KL8 B;  4YXJ A;  4KLF A;  2LHT A;  3ISD A;  4EBC A;  1C20 A;  4M6W B;  4I2H A;  2ISP A;  2G06 A;  4MF8 A;  2AH5 A;  4R66 A;  4KLM A;  4ED1 A;  1S97 A;  3TAQ A;  5AKL A;  3F53 A;  3GV7 B;  2HHV A;  2NRZ A;  1RQL A;  4TQS A;  5HP4 A;  1TK0 A;  3MFH A;  2E3T A;  2W11 A;  4I2G A;  3E0F A;  3TAN A;  1ECW A;  5KFY A;  1KQQ A;  5L9X A;  4QZ9 A;  3L3F X;  3RB0 A;  2RHF A;  2KKP A;  4C4R A;  4YR2 A;  3RBD A;  5ALI A;  3Q8M A;  1ZQC A;  3SD7 A;  3RB6 A;  3WKE A;  3HIL A;  1PK1 B;  5ALV A;  1OXJ A;  4YVZ A;  2HSZ A;  4DFJ A;  4KLU A;  5KFZ A;  3PSP A;  2ZG6 A;  5D4B A;  4J9N A;  4NY8 A;  1S5L U;  8ICG A;  4RQN A;  5AI5 A;  2ZTE A;  1ZQK A;  4B9M A;  3C28 A;  4FS1 A;  2LKY A;  3BQT A;  1Y88 A;  1ZQM A;  2KEY A;  2PKE A;  1KBU A;  4FFD A;  1ZD3 A;  2KP7 A;  5KAF U;  4PGQ A;  1A77 A;  4EEY A;  2DGZ A;  2UVW A;  5ALS A;  4BXO B;  2NRV A;  3JPT A;  4ED7 A;  2VA2 A;  3WKA A;  4UB1 A;  1D8B A;  3M9M B;  5KFO A;  5JTI A;  4F2R A;  3NVY A;  3CYM A;  2WTF A;  1HUZ A;  2MU2 A;  4PZN A;  3TAR A;  2JXJ A;  2ZXH A;  5J8Y C;  4K4I A;  2WB1 C;  4DLG A;  2ES6 A;  1LVH A;  1Q8K A;  5AKZ A;  2PXI A;  4K4H A;  3EZ5 A;  2JEI A;  5ALF A;  2EDU A;  3RB4 A;  2VJ5 A;  2KD1 A;  5B66 U;  4RQ1 A;  8ICE A;  4DQQ A;  2I9G A;  3ZI4 A;  2BCS A;  4MFF A;  3BQ7 A;  2W9B B;  1X6J A;  1N63 A;  4F4X A;  2QB1 A;  1JXE A;  5AM5 A;  3MR6 A;  2QB0 B;  5IIO A;  2K4E A;  2HOQ A;  1Z4N A;  4XA5 A;  4NLC A;  2H3Q A;  2F1H A;  3H8S A;  1B43 A;  1X9M A;  3T5J A;  4FS2 A;  1DGJ A;  3D2N A;  3U26 A;  4I29 A;  4NLG A;  3RH4 A;  4UAS A;  4A8E A;  5J2I A;  3ZDB A;  4UAZ A;  1NJX A;  3ZDA A;  7ICO A;  2VKQ A;  1ARO P;  5F9N A;  1QSY A;  5J0Y A;  2LMR A;  5AIC A;  4QZD A;  5G5G A;  3EW9 A;  1DXS A;  5IIK A;  3CP8 A;  2ZIV B;  3MC1 A;  4RQ8 A;  1GO3 F;  5KFB A;  4J9Q A;  4OJL A;  2H3I A;  5DBC A;  3GIM A;  1ZET A;  1UCV A;  2WAQ C;  5J0R A;  3K4G A;  1MA7 A;  1M6Y A;  4EEL A;  1BPB A;  4PL1 A;  3DDH A;  4Z6C A;  2F8L A;  2VA3 A;  2OHF A;  2YMP A;  3RB3 A;  3B0Y A;  5EWG A;  2HHW A;  1MQ3 A;  5KFU A;  2KMD A;  5TIS U;  3AUO A;  3BDP A;  4YCX A;  2H3V A;  1JX4 A;  3RAX A;  4E0D A;  3SEI A;  2E8P A;  3JPN A;  1RZT A;  4OJP A; 
#chains in the Genus database with same CATH homology
 2AGQ A;  1NKE A;  4DEZ A;  1KTQ A;  5J2K A;  5CP2 A;  3GIJ A;  5D49 A;  7ICH A;  3C2K A;  2JEF A;  9ICF A;  1Z00 A;  1MQ2 A;  1ZQY A;  4F5P A;  3AU2 A;  3JPR A;  4ECQ A;  4J9S A;  4EBD A;  3H40 A;  4KLJ A;  1XU4 A;  2HHT A;  4YQW A;  4KLD A;  5KFP A;  2FMQ A;  3ZD9 A;  1IXR A;  7ICK A;  5DB7 A;  3SYZ A;  2DFL A;  3ZDE A;  5DG8 A;  4ED3 A;  4O3P A;  2PFO A;  4LZD A;  4BXO A;  3MR2 A;  3RR8 A;  1U9L A;  5KT4 A;  5J2G A;  4B9V A;  2XGQ A;  7ICM A;  2FLP A;  8ICK A;  4F5N A;  4IRC A;  4G3I A;  3GIK A;  2I1Q A;  4R8U B;  5KG5 A;  3OHB A;  4DL3 A;  3PW5 A;  1BGX T;  1X9W A;  4YMN A;  3LDA A;  3JPP A;  3GIL A;  4P4O A;  2BHN A;  1U45 A;  5J0S A;  4CCH A;  4F5O A;  1KLN A;  4F4K A;  9ICN A;  4QZ8 A;  4RNO A;  5HMM A;  3TFR A;  7ICJ A;  4MFC A;  4DF4 A;  2R8J A;  3ORY A;  5DQI A;  3PO4 A;  4O9M A;  9ICH A;  2XY5 A;  2PI5 A;  3G6V A;  5KFV A;  1ZQZ A;  5KT5 A;  3C1Y A;  4DS5 A;  4O0I A;  5KFM A;  1C7Y A;  5DB8 A;  4IR1 A;  4ECW A;  4I2J A;  4QZH A;  8ICH A;  1NJZ A;  4MFA A;  4F91 B;  2F1I A;  2BQR A;  5J0X A;  2ISO A;  2NRW A;  3KHL A;  1ZQU A;  2W9A A;  2BPG A;  1T7P A;  4M9J A;  4M9L A;  4IR9 A;  4ECU A;  5J2D A;  1ZQP A;  4FBU A;  1UT5 A;  4YD2 A;  2J6S A;  7ICR A;  1DOQ A;  5KTQ A;  2AGP A;  3HW8 A;  4M04 A;  4JV0 A;  4UBB A;  3NGD A;  4F5R A;  1XSN A;  4R65 A;  2C22 A;  1BPE A;  2BR0 A;  3UXN A;  4RT2 A;  2AJQ A;  4RU9 A;  3V7J A;  2DPJ A;  3GV8 B;  3OGU A;  3V6K A;  3QZ8 A;  4UQG A;  1BPX A;  5KFA A;  5DLF A;  4I2E A;  7ICU A;  1T4G A;  4J9P A;  1B22 A;  2C28 A;  5DBA A;  3PW2 A;  2V9W A;  7ICT A;  1HUO A;  1ZQO A;  4TUR A;  3RJJ A;  8ICB A;  2A1J A;  2XC9 A;  2C2R A;  3SZ2 A;  5HHI A;  3M8S A;  3V7K A;  2ATL A;  2UVU A;  2F1J A;  3KTQ A;  4NLZ A;  2A1J B;  2BCR A;  4R63 A;  4UB4 A;  5KT2 A;  4F2S A;  2HHS A;  2ASD A;  1WCN A;  5KFJ A;  5BOM A;  3HPO A;  4MEX A;  4DWI A;  1BPY A;  4P2H A;  3PR5 B;  4NM1 A;  9ICM A;  4DL5 A;  4BWM A;  3BQ0 A;  4ECV A;  3QE9 Y;  3QEB Z;  4I27 A;  1S0O A;  4P4P A;  7ICL A;  1QTM A;  4YD1 A;  3C5G A;  4YFK A;  4DLE A;  1JIH A;  1CUK A;  4YR0 A;  3V72 A;  2XY7 A;  1BVS A;  4QZG A;  5KG0 A;  2FLN A;  4BDP A;  4HYK A;  2HHU A;  2KFN A;  2FPM A;  5CA7 A;  4NLK A;  4ELU A;  8ICL A;  4JWM A;  5KFS A;  4DS4 A;  9ICE A;  9ICI A;  3RTV A;  4B9S A;  5KFQ A;  5TZV A;  4UB5 A;  5CB1 A;  4NLN A;  5BPC A;  4RQ0 A;  4IQU A;  4RQ4 A;  4DSK A;  4BGD A;  2LYH A;  2KZM A;  5CHG A;  2VA8 A;  3B0X A;  4O3Q A;  1TK5 A;  1KFT A;  4C8M A;  3GV5 B;  4ZH4 A;  2ASL A;  3UXO A;  2P6R A;  2BCQ A;  4I28 A;  9ICU A;  4F93 B;  5J2F A;  4R8U A;  2JEG A;  4EYI B;  3T5H A;  5KG7 A;  4RZR A;  1QSS A;  3THV A;  4EZ9 A;  3PO5 A;  2ZTD A;  4UBC A;  3UXP A;  4YMM A;  1UA1 A;  2FMS A;  5DLG A;  4DOC A;  1T3N A;  4QWA A;  4RQ7 A;  3OHA A;  4XUS A;  1NK0 A;  4F92 B;  7ICE A;  5DGA A;  3H4B A;  9ICO A;  4DSJ A;  3SV4 A;  3HX0 A;  1U49 A;  3RRG A;  4I2F A;  2V4Q A;  1ZQR A;  3T5L A;  3PW7 A;  3EYZ A;  5KFT A;  2P6U A;  3HWT A;  3C5F A;  4DFM A;  2W9B A;  3GDX A;  5KFH A;  3PV8 A;  5DKW A;  3QZ7 A;  1T8E A;  4QWB A;  3T3F A;  4DSE A;  4RQ2 A;  4F50 A;  4ECY A;  4Q8E A;  8ICR A;  1NK9 A;  2ASJ A;  7ICV A;  5JUM A;  4KLG A;  4QWE A;  3LWL A;  4DL4 A;  2HVH A;  2MAX A;  3PMN A;  3MGI A;  1QLN A;  4UAW A;  8ICJ A;  2FPL A;  4QW8 A;  2XO7 A;  3Q8R B;  3RJG A;  5L1K A;  4I2C A;  3AU6 A;  2ZJA A;  1NK4 A;  4NM2 A;  4IQW A;  3BJY A;  1JN3 A;  2IHN A;  4B9L A;  4B9N A;  2Q0Z X;  9ICK A;  4KLH A;  5KFD A;  4YG2 A;  3G6X A;  1TAU A;  5DB9 A;  4M2Y A;  4MF2 A;  4RQ6 A;  2J6T A;  3PW0 A;  3OJS A;  3M9O B;  4RNN A;  3QEA Z;  4EBE A;  5J2B A;  2KTQ A;  1RYR A;  1JMS A;  3MFI A;  2DPI A;  1Z3E B;  5J2C A;  3T5K A;  3ISC A;  1BPD A;  1HJP A;  5L1L A;  1D8L A;  5J2H A;  1KEJ A;  2VAN A;  5KFK A;  2ZJ5 A;  4ECR A;  1SKW A;  3FYH A;  4DSL A;  4YXM A;  1SL2 A;  2PI4 A;  3OJU A;  1KFD A;  5HHH A;  5IIM A;  1UA0 A;  2J6U A;  4DQI A;  5DB6 A;  1ZQQ A;  8ICM A;  1ZQS A;  2BCU A;  3KHG A;  2MUT A;  1NK8 A;  4M9N A;  1ZQX A;  1K1S A;  5EWF A;  4DSF A;  5KFC A;  2ZUC A;  4KLE A;  4GXJ A;  7ICS A;  3HP6 A;  5DG7 A;  4ED2 A;  2PFQ A;  4C8N A;  1KDH A;  1ZQB A;  1XWL A;  4ED8 A;  9ICC A;  4YP3 A;  3Q8P B;  4DQP A;  1ZQG A;  3UQ2 A;  1U48 A;  5DGB A;  5J0O A;  1EXN A;  2R8H A;  4O3N A;  4KTQ A;  7ICF A;  4UAY A;  7ICG A;  5J0U A;  5III A;  1ZQT A;  1TVA A;  1ZQA A;  8ICA A;  9ICQ A;  2ZUB A;  4BWJ A;  2W8L A;  5J0P A;  2W9C B;  5IIJ A;  2KZZ A;  4I2D A;  4QZI A;  1XC9 A;  4C8O A;  1RPL A;  4RPY A;  4EZ6 A;  4ED6 A;  3RRH A;  1RXW A;  5CR0 A;  4O5C A;  1SZP A;  2V4R A;  7ICI A;  2NRT A;  1SKS A;  4Z6E A;  5DDM A;  4J9O A;  3LWM A;  4KLO A;  3H7I A;  5IIL A;  4DFP A;  7ICN A;  1UT8 A;  2BQU A;  9ICB A;  3PX4 A;  4Q8F A;  1NKC A;  4DFK A;  2H5X A;  3OSP A;  1U47 A;  3GFK B;  4O5K A;  5D46 A;  4RPZ A;  8ICW A;  2BKE A;  8ICF A;  3EWA A;  5DG9 A;  1LB2 B;  3LK9 A;  4YXJ A;  3C2M A;  3KHH A;  1ZQJ A;  4Q45 A;  3MGH A;  3ISD A;  2RDJ A;  4KLF A;  4M6W A;  4RUA A;  1NK6 A;  4O3S A;  2BQ3 A;  3RJF A;  4PHE A;  9ICR A;  4EBC A;  3RR7 A;  5EWE A;  3M9N B;  4M6W B;  3HT3 A;  1BPZ A;  4K4G A;  4I2H A;  2ISP A;  4F5Q A;  2AQ0 A;  4MF8 A;  3MR3 A;  9ICV A;  3ZD8 A;  1SKR A;  4QZF A;  4R66 A;  1KRP A;  4F3O A;  4ED1 A;  4KLM A;  4RT3 A;  1S97 A;  1V9P A;  4C8K A;  3TAQ A;  3ISB A;  5EOZ A;  3NTU A;  4MEY A;  4GLX A;  4DOB A;  1ZQI A;  4EYH B;  3GV7 B;  2B21 A;  3OSN A;  1X9S A;  1NKB A;  2FLL A;  2HHV A;  3ZDC A;  2NRZ A;  4TQS A;  4M9H A;  5HP4 A;  1TK0 A;  1S0M A;  3MFH A;  4QZA A;  3EPI A;  4PH5 A;  4QWD A;  3PVX A;  3RH6 A;  4IQT A;  4I2G A;  9ICS A;  2HHX A;  1S76 D;  3Q8K A;  3RH5 A;  2HW3 A;  4FO6 A;  2RDI A;  3TAN A;  1ZQD A;  2BPC A;  5KFY A;  4PHD A;  4DL6 A;  1SL0 A;  5L9X A;  2JZB B;  4QZ9 A;  1JXL A;  4KIT B;  1K1Q A;  9ICA A;  3RB0 A;  4O5E A;  4YR2 A;  1Z00 B;  3RBD A;  2BGW A;  3Q8M A;  1ZQC A;  4RQ5 A;  4ECS A;  3MR5 A;  4P4M A;  3RB6 A;  8ICT A;  3C1Z A;  3G6Y A;  4PGX A;  2ZJ8 A;  9ICW A;  1ZQF A;  5DQH A;  3RAQ A;  3K75 D;  4YVZ A;  4QWC A;  4DQS A;  4DFJ A;  4UB2 A;  4X5V A;  5KFZ A;  2Y1I A;  4KLT A;  5KG6 A;  4KLU A;  3MDA A;  3C2L A;  5D4B A;  4QW9 A;  5KFF A;  5L1I A;  4J9N A;  1S10 A;  4J9M A;  1ZJM A;  4NY8 A;  8ICG A;  5KT6 A;  5J0W A;  2OWO A;  8ICP A;  2ZTE A;  2R8G A;  2JZB A;  3V7L A;  5IIN A;  1ZQK A;  1D9D A;  4B9M A;  8ICN A;  1RYS A;  3ZDD A;  4Z6D A;  4FS1 A;  3SV3 A;  2PFN A;  4DOA A;  1N48 A;  9ICJ A;  3BQT A;  4Q44 A;  4QZE A;  1Y88 A;  2XGP A;  3UQ0 A;  1S0N A;  5KG3 A;  3IHQ B;  2HVI A;  4J9K A;  2AGO A;  1ZQM A;  2P66 A;  4GXK A;  3Q8L A;  1MSW D;  8ICU A;  3FDS A;  4YN4 A;  5J0Q A;  8ICS A;  3E2E A;  1MC8 A;  5HNK A;  4DO9 A;  4M0A A;  4PGQ A;  4YR3 A;  4YMO A;  5CWR A;  2ZTC A;  2KN7 A;  4ED0 A;  7ICP A;  1A77 A;  4EEY A;  1TK8 A;  3PR4 A;  1SL1 A;  3JPQ A;  2C2D A;  5KFR A;  3M8R A;  1ZQL A;  2UVW A;  2C2E A;  2BDP A;  4BXO B;  5KG2 A;  5KFL A;  9ICP A;  2NRV A;  1L3V A;  3JPT A;  1ZQV A;  8ICZ A;  4ED7 A;  1IM4 A;  4ECZ A;  5DQG A;  4XRH A;  3V6H A;  2VA2 A;  4F8R A;  4UB1 A;  5L1J A;  5KT7 A;  3KHR A;  8ICO A;  1ZQE A;  3PX6 A;  3TFS A;  1TKD A;  4O3R A;  3M9M B;  4DL7 A;  1LV5 A;  3N4M B;  2HHQ A;  1L3T A;  5KFO A;  2XCA A;  1PZN A;  5J29 A;  4F2R A;  2WTF A;  1HUZ A;  3TAR A;  1NJW A;  1ZYQ A;  1DGS A;  3MAB A;  5DBB A;  4R64 A;  3RBE A;  4F4W A;  4JWN A;  4K4I A;  4M9G A;  4DLG A;  2XY6 A;  4M47 A;  4KLS A;  1RXV A;  4ECT A;  2PXI A;  4K4H A;  3EZ5 A;  3N97 B;  4DL2 A;  3GII A;  4KLQ A;  2JEI A;  1XO1 A;  5J2A A;  4O3O A;  1NK7 A;  4I2I A;  8ICX A;  5KFW A;  4GC7 A;  5KFE A;  3RB4 A;  3ETL A;  1L3U A;  1KFS A;  4RQ1 A;  8ICV A;  4DQR A;  8ICE A;  2FPK A;  4KLI A;  4PHA A;  4RUC A;  4J9L A;  4DQQ A;  2I9G A;  9ICX A;  1L3S A;  2BCS A;  4KMU A;  4F4Z A;  4MFF A;  1TAQ A;  4PGY A;  3EPG A;  4PPX A;  4LZG A;  5KT3 A;  5HML A;  1COO A;  2NRX A;  5KFI A;  4UB3 A;  2W9B B;  3MBY A;  1KSP A;  3C23 A;  4F4X A;  3RJE A;  2XCP A;  2AQ4 A;  1JXE A;  1NK5 A;  3RJK A;  4Z6F A;  5KFX A;  3MR6 A;  2UVV A;  2W8K A;  5IIO A;  5J2J A;  8ICI A;  1ZQW A;  2M9N A;  1S77 D;  4XA5 A;  2IHM A;  4IQV A;  5C5J A;  3GQC A;  1XSL A;  4I2B A;  2F1H A;  3H8S A;  4TUS A;  1NOM A;  4JK1 A;  4QZB A;  1B43 A;  2MUT B;  3TQ1 A;  1TV9 A;  1D9F A;  1S0V A;  1X9M A;  3T5J A;  4FS2 A;  5BOL A;  9ICL A;  3MDC A;  3H8W A;  5KG4 A;  4XQ8 A;  3Q8Q B;  3RJH A;  4TUQ A;  2PFP A;  2AU0 A;  1NJY A;  9ICT A;  4ELT A;  4I29 A;  4RQ3 A;  3SI8 A;  4NLG A;  4GC6 A;  3RH4 A;  3H8J A;  1A76 A;  3PML A;  5J2I A;  3RJI A;  3ZDB A;  4UAZ A;  4JUZ A;  1NJX A;  3ZDA A;  7ICO A;  1ARO P;  2W9C A;  5F9N A;  5KFN A;  5J0Y A;  1QSY A;  4Q43 A;  1ZQH A;  1CEZ A;  5KG1 A;  4JV2 A;  1ZJN A;  2FMP A;  4QZD A;  2JEJ A;  3EW9 A;  4DSI A;  4LVS A;  5IIK A;  4QZC A;  3Q8S B;  2ALZ A;  8ICC A;  4J9R A;  4RQ8 A;  1D8Y A;  5KFB A;  5J2E A;  3BQ1 A;  4J9Q A;  2BPF A;  3JPO A;  2KZ3 A;  4I2A A;  4IRD A;  4B9T A;  4DF8 A;  4B9U A;  4TQR A;  4ECX A;  5KFG A;  5DBC A;  1ZQN A;  4PHP A;  3PW4 A;  4NXZ A;  4RNM A;  1N56 A;  1TFR A;  3GIM A;  1ZET A;  2W9M A;  4FBT A;  1XS9 D;  5J0T A;  5J0R A;  3K4G A;  2R8I A;  2R8K A;  4IRK A;  2UVR A;  4KLL A;  4F4Y A;  1BPB A;  1L5U A;  4TUP A;  1WCL A;  4Z6C A;  2VA3 A;  8ICQ A;  2Y1J A;  4GXI A;  3PNC A;  3V6J A;  2KFZ A;  2IBK A;  5DDY A;  3C21 A;  2IA6 A;  3TAP A;  4ELV A;  3RB3 A;  3B0Y A;  2BCV A;  5EWG A;  8ICY A;  4C8L A;  2IMW P;  2HHW A;  1MQ3 A;  5KFU A;  3BQ2 A;  1QSL A;  4JV1 A;  3AUO A;  3H4D A;  3UPQ A;  3BDP A;  1XSP A;  4YCX A;  1U4B A;  1S9F A;  1JX4 A;  2GWS A;  3JPS A;  3PY8 A;  9ICG A;  2ZUD A;  4KN7 A;  3RAX A;  1X2I A;  4KN4 A;  5CJ7 A;  3TI0 A;  4E0D A;  3PX0 A;  4RPX A;  3JPN A;  1RZT A;  3IM1 A;  1H38 A;  5F9L A;  7ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...