1Z00A

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00A01
5IIKA 3ZDDA 2BCSA 1T7PA 2KZMA 4XA5A 4UAWA 3PMNA 4I2BA 3MR2A 1IXRA 2ZTCA 1XSPA 1U4BA 4RQ5A 3V6KA 4KITB 2NRTA 3H8JA 1Z00B 5J0UA 5KFFA 3Q8MA 1U47A 1X9WA 5KFXA 5KG3A 3GIIA 1L3VA 1QSLA 1ZQNA 3C1YA 2LYHA 4RQ1A 1NK4A 4B9LA 5KFBA 4P4OA 4ECTA 3NGDA 1N56A 3JPQA 5KFVA 3SV3A 4J9OA 4BXOB 4YXMA 7ICJA 4PHAA 3BJYA 4QZCA 9ICQA 5TZVA 8ICMA 8ICTA 3V7JA 1ZJNA 4TURA 4IQWA 2J6SA 3PW7A 3UQ0A 4XQ8A 1ZQBA 2NRWA 4ECRA 1HUOA 2FLPA 8ICBA 4O5CA 3PNCA 4QWAA 4QZ9A 3TAPA 5DB6A 5KFYA 4QW8A 4J9MA 1XO1A 4RQ8A 1BPXA 1X9SA 4C8OA 4PPXA 4GXJA 1NJZA 4FBUA 4KLGA 4P4PA 3EPIA 3SI8A 4QZAA 4M6WB 4J9NA 1MC8A 5DB7A 4M9HA 1COOA 3RJKA 4Z6DA 5KFZA 4F2SA 8ICHA 4TQSA 4JWMA 1SL0A 4MEXA 2R8KA 1AROP 4R65A 3TAQA 5KT7A 5EWGA 9ICUA 1KFSA 3MR3A 4Q44A 8ICFA 3OHBA 8ICPA 4F50A 4YN4A 4KMUA 1S0VA 8ICVA 3BQTA 2C2EA 4MF8A 1S76D 9ICLA 1NK6A 4TUQA 4I27A 5CP2A 3ZD8A 5J2HA 3UXOA 4DOAA 2KFZA 4YD1A 1UA1A 5L1IA 3RR8A 1NJWA 2BDPA 1HUZA 5L1JA 4O5EA 3KHLA 4DOBA 3C1ZA 3ETLA 4YG2A 3G6YA 2JEIA 3Q8PB 3LDAA 3ZD9A 1X2IA 1ZQHA 9ICAA 4I2JA 1ZQCA 5KFPA 2RDJA 4F8RA 2FLNA 1MSWD 3PX4A 3GIJA 4YCXA 2M9NA 1D8LA 4YR3A 4F4XA 1S97A 4ELVA 1L5UA 3PW5A 2BGWA 4G3IA 1JXEA 4YR0A 5J0RA 4M9GA 2AGQA 5KFAA 4DSJA 2HHSA 4FS1A 4NM2A 5KFKA 4R64A 3TI0A 3BDPA 5CR0A 5KG1A 4ED7A 4JUZA 5J29A 2XCPA 4ECYA 5J2GA 4GXIA 4ECZA 5J2IA 4DF8A 1NJXA 7ICEA 1RXVA 4NLKA 4RQ2A 3SYZA 4K4IA 3K75D 5IILA 4B9VA 4IQTA 1TFRA 4F5OA 2ZJAA 4DL3A 4EBEA 1ZQIA 2BKEA 2W9BB 4ECQA 4FBTA 7ICTA 7ICFA 3M9NB 4QWBA 3KHHA 2JEGA 7ICMA 8ICEA 3MBYA 1L3SA 8ICOA 3V72A 2ZJ5A 3KHGA 3C2MA 1ZETA 7ICVA 4RQ6A 4YMOA 4YD2A 2DPIA 4M9JA 3RJEA 2FPKA 5DG7A 1TKDA 4O3QA 3H8SA 5J2AA 1RZTA 1U9LA 4RT3A 1ZQLA 2R8GA 3IHQB 1ZQXA 5BOMA 4MFCA 5KG2A 3H4DA 3ZDCA 2KZ3A 4O5KA 2KFNA 8ICKA 4B9NA 2KN7A 1TV9A 4KLDA 4QWCA 5IIJA 4DS5A 5KFRA 3KTQA 4M0AA 4EYIB 1U49A 3ZDEA 1ZQJA 4Q8FA 1NK5A 3MR6A 5HHIA 2H5XA 3PW2A 4UB4A 1IM4A 5KFWA 1NOMA 1XSLA 1D8YA 4JWNA 7ICGA 4BGDA 5DGAA 5DG8A 2W9CA 2BCVA 1BPEA 5L9XA 4M9NA 3PX0A 5CA7A 3GILA 1N48A 5DDMA 2P6RA 1BPYA 2HHUA 3C5GA 2AQ0A 4ED0A 2FMSA 2FPLA 4ED3A 2C28A 1CEZA 3RJJA 1B43A 3ZDAA 4MFAA 3MFHA 4PHPA 2VA8A 4YMMA 4QZIA 3GDXA 4I2CA 5KFDA 5KG0A 2R8JA 4LZDA 3JPRA 4F4KA 4KLOA 5J0TA 5KG5A 2ZJ8A 1JN3A 1TK5A 2XO7A 3PO4A 5EOZA 1L3TA 3T5KA 1T3NA 2Q0ZX 4UB3A 4TQRA 3RJHA 3H40A 4J9PA 1ZQZA 2GWSA 4GC6A 4XRHA 5DBBA 5J2JA 1RYRA 1QLNA 4GLXA 2XC9A 1KFTA 1JIHA 3B0XA 3M9MB 4O3NA 2W9CB 3TFSA 4B9TA 4ZH4A 1U48A 9ICPA 1LV5A 5HP4A 1Y88A 2ASLA 4B9SA 1ZQPA 2R8IA 4UB5A 4UAZA 4EBDA 4DL6A 1ZQVA 3EWAA 4RT2A 4M6WA 5C5JA 3MDCA 5L1KA 4F5RA 1BPDA 3QE9Y 4JV0A 2AQ4A 4C8LA 4YMNA 8ICXA 4R63A 4KN7A 3QEAZ 2IHNA 4KLQA 4QZHA 1NJYA 4DSKA 3THVA 3PMLA 4QZEA 1MQ3A 3C5FA 9ICRA 4O3OA 2AGPA 2BQ3A 2FMQA 1ZQFA 5KT6A 5HHHA 2XY6A 7ICSA 2B21A 2P6UA 4HYKA 3RH6A 1ZQGA 5J0YA 4ELUA 4F5QA 4MFFA 2I1QA 9ICNA 3T5JA 4ECVA 4BXOA 2ASDA 1K1QA 2I9GA 1SL1A 3EW9A 2PFNA 1NK7A 5DKWA 4I2EA 1DGSA 2V4RA 3EPGA 3GV8B 1QTMA 9ICBA 1S0MA 5J2KA 2Y1IA 1MQ2A 2HHXA 2BHNA 4UBBA 3OGUA 1SZPA 5DDYA 5KFMA 4Q45A 2BPFA 3QZ8A 3T5LA 3UQ2A 2ZUCA 1ZQRA 2KTQA 4KLHA 3HP6A 1KTQA 4IR9A 2IMWP 4KLSA 4DSLA 1WCNA 3HW8A 5KG6A 4RPZA 4JV2A 8ICIA 4J9KA 1ZJMA 1UA0A 1NKBA 9ICFA 1JMSA 2BR0A 4UB1A 9ICJA 4RQ4A 4IQVA 4DSFA 7ICQA 1NK8A 4F2RA 5DGBA 3N4MB 8ICCA 4DWIA 4C8MA 3BQ1A 2NRVA 3RB4A 1TK0A 2RDIA 5EWEA 2IHMA 5J0SA 5IIOA 2BPCA 4RZRA 5KFTA 5J2FA 4QZBA 3RBDA 4JK1A 1NK9A 5DG9A 1JX4A 5IIMA 3V6JA 1TK8A 2PFPA 4PH5A 4P4MA 3RH5A 2IA6A 8ICQA 4DFJA 4KLJA 2BPGA 3OSPA 4EYHB 1SKSA 4DL7A 4DSEA 2HHWA 1KLNA 9ICWA 4DQRA 4QWEA 3HWTA 3V7KA 2PFOA 3PVXA 4FS2A 3V7LA 3E2EA 9ICMA 7ICNA 8ICUA 3TARA 4QZGA 4ELTA 3ISCA 3C2KA 3RAQA 4O3SA 4F5PA 3OJSA 2C2DA 3LK9A 3RJFA 5CB1A 4F92B 5F9NA 3G6VA 4NLGA 3IM1A 1XC9A 1S9FA 2FLLA 2J6UA 4J9SA 3JPTA 3M9OB 1ZYQA 4P2HA 7ICHA 2V9WA 4EZ9A 1Z3EB 2NRZA 3FDSA 5CWRA 1DOQA 3B0YA 2WTFA 4IRDA 3OSNA 5KT4A 9ICGA 3ORYA 1A76A 4KLMA 3EYZA 4NM1A 5D49A 2VA2A 4DQPA 3MR5A 4RUCA 2PXIA 5KFQA 3RTVA 2J6TA 2JEJA 7ICPA 3H4BA 2A1JB 3LWMA 4RNOA 4J9LA 3PR5B 1S0OA 4KLLA 3NTUA 8ICRA 2FPMA 2W9MA 3GV7B 1NKCA 5KT2A 1KEJA 5KFHA 1V9PA 4F91B 5F9LA 5DQHA 4RNNA 4DL5A 3Q8LA 1UT5A 2R8HA 4M04A 4RU9A 5DBAA 3AUOA 4PHEA 4QZ8A 7ICKA 3ISBA 2ATLA 5IINA 1KRPA 7ICIA 4RPYA 1BGXT 4DQIA 2F1HA 3UXNA 2NRXA 1D9DA 4F93B 4DL2A 9ICIA 3FYHA 1NK0A 1XU4A 4PGXA 1ZQOA 4QZFA 2JEFA 1H38A 5D46A 9ICXA 5KFOA 1KDHA 5KFUA 2W9BA 8ICNA 8ICAA 8ICGA 4CCHA 2VA3A 4F4ZA 4DL4A 4NXZA 4O3PA 4PGYA 3RB0A 1BPZA 3LWLA 4F3OA 2ASJA 3QZ7A 5HMMA 3MFIA 3T3FA 7ICOA 4NLNA 3PV8A 4TUSA 4Z6CA 1Z00A 5J2DA 3H8WA 5DQGA 3UXPA 3PY8A 4RQ3A 5KG7A 4Q8EA 2V4QA 4DQQA 4LVSA 2UVWA 3RRHA 2HHVA 4EBCA 3TQ1A 1QSYA 3MGIA 4X5VA 5L1LA 3AU6A 4NLZA 3SZ2A 4IQUA 2PI4A 2UVRA 2XY5A 4YP3A 2ALZA 2XGQA 1ZQAA 4BWMA 1T8EA 5HNKA 1S10A 4B9UA 4KLUA 4ECWA 4EZ6A 4KLIA 4IRKA 3RAXA 9ICVA 1XS9D 4RQ0A 2BCUA 3UPQA 5KT3A 5J0QA 5J2BA 4DS4A 2HHTA 1TVAA 8ICLA 3RRGA 1S77D 2C2RA 4J9QA 4DFPA 1KFDA 1SL2A 4YXJA 1CUKA 1ZQWA 3C21A 4Z6EA 5KFIA 3EZ5A 4DLGA 2AU0A 4YR2A 4I29A 2HVIA 5KFCA 4O3RA 3OJUA 4DQSA 5DLGA 4FO6A 3N97B 9ICEA 8ICWA 1ZQUA 5BOLA 5DBCA 2XGPA 1EXNA 4GC7A 3RR7A 2UVVA 4J9RA 1A77A 2W8LA 3PR4A 1RPLA 4KTQA 2ZTEA 4R8UB 4KLFA 2JZBA 4E0DA 1BVSA 4UAYA 4K4HA 4KN4A 1PZNA 3GV5B 2MUTA 1QSSA 4KLTA 4F5NA 4ED8A 4DFKA 1RYSA 2BCRA 5J0OA 1SKWA 4XUSA 2ZUBA 4DLEA 2BQUA 3RJGA 4YQWA 4M9LA 4DEZA 2KZZA 1C7YA 4I2DA 1ZQTA 3JPSA 1SKRA 4UB2A 3Q8RB 4UQGA 2HVHA 4I2GA 4RQ7A 3GQCA 5KFEA 3PW0A 1NKEA 2W9AA 8ICSA 7ICLA 3GIMA 2DPJA 4GXKA 5IIIA 2ISOA 4I28A 4M47A 3TFRA 5HMLA 4R66A 1B22A 1S0NA 7ICUA 3RH4A 5KFSA 3RBEA 4ECUA 1UT8A 3C23A 5KT5A 4RPXA 4I2HA 4B9MA 1ZQKA 3MDAA 4ECSA 4DFMA 4DOCA 1RXWA 4C8KA 8ICZA 3V6HA 4C8NA 5BPCA 3BQ0A 5KFNA 3K4GA 4IR1A 4BWJA 3OHAA 3JPPA 1ZQMA 3HT3A 2MUTB 2XCAA 2W8KA 4MF2A 3JPNA 1WCLA 3G6XA 3T5HA 9ICSA 2A1JA 4YVZA 4O0IA 3PO5A 2JZBB 3HPOA 2HW3A 4KLEA 4R8UA 3HX0A 3ISDA 2MAXA 4F4WA 3AU2A 3TANA 3BQ2A 2BCQA 2PI5A 3GFKB 4RUAA 3RJIA 2BQRA 4UBCA 4BDPA 1X9MA 4Z6FA 1KSPA 2VANA 2IBKA 4TUPA 3PX6A 5J2EA 3RB3A 9ICKA 2F1JA 1TAQA 4MEYA 4ED6A 8ICJA 2XY7A 1K1SA 1ZQSA 5CHGA 2AJQA 2ISPA 4QZDA 3MGHA 4ECXA 3MABA 3PW4A 3GIKA 4LZGA 1U45A 3M8RA 3Q8KA 4PHDA 9ICOA 4ED1A 1XWLA 1HJPA 3ZDBA 5J0WA 2ZUDA 5DB8A 5KG4A 4I2AA 2P66A 4DSIA 1T4GA 2F1IA 1ZQQA 4Q43A 2OWOA 2FMPA 3JPOA 4I2IA 4NY8A 3QEBZ 1JXLA 3H7IA 2DFLA 2UVUA 1D9FA 4PGQA 2PFQA 1L3UA 2HHQA 4IRCA 5KFGA 5KFLA 4DF4A 1ZQDA 9ICHA 9ICTA 1BPBA 5JUMA 4QWDA 3Q8QB 5EWFA 5J0PA 4DO9A 5D4BA 1XSNA 4O9MA 9ICCA 3C2LA 2AGOA 1TAUA 1LB2B 8ICYA 4K4GA 5KFJA 2ZTDA 4ED2A 7ICRA 5CJ7A 3Q8SB 3SV4A 5DQIA 4JV1A 4YFKA 5KTQA 4I2FA 2C22A 5DB9A 3KHRA 2Y1JA 1ZQEA 4QW9A 4RNMA 4EEYA 5DLFA 1ZQYA 3RB6A 4F4YA 5J2CA 4M2YA 5J0XA 3M8SA
chains in the Genus database with same CATH superfamily
5IIKA 1T7PA 2KZMA 4XA5A 1IXRA 2ZTCA 1U4BA 4RQ5A 1Z00B 5KFFA 4MHVA 3C1YA 4B9LA 3WU2U 4ECTA 3JPQA 5KFVA 3SV3A 5ALQA 4QZCA 4IQWA 3PW7A 5AKKA 2H3IA 3TACB 4ECRA 2EH9A 3PNCA 4QWAA 2RHFA 4QW8A 4CF3A 3PSIA 4KLGA 3AM9A 2OXOA 4NL9C 4QZAA 3F2DA 1COOA 3BS7A 3L5KA 1FFVA 2R8KA 3RFAA 2KHQA 4J03A 9ICUA 1S0VA 4TUQA 2CN1A 2RRDA 4I27A 5J2HA 3UXOA 4YD1A 3RR8A 1UPHA 5L1JA 4O5EA 3ETLA 4YG2A 2FJ6A 4NLBA 4EEKA 1ZQCA 1MSWD 3GIJA 4CF5A 5J0RA 2AGQA 5ALVA 5KFKA 3BDPA 2PKEA 4P0QA 2XCPA 1N62A 4ECZA 5ALZA 4DF8A 1NJXA 4C0ZA 7ICEA 3IG5A 5A0LA 5IILA 4IQTA 3M6KA 3NUQA 3D2SA 7ICFA 4QWBA 2ZJ5A 1ZETA 4YMOA 4YD2A 4M9JA 3NS1A 3RJEA 1ZQLA 4U7CA 2KP7A 1F0MA 5BOMA 3ZDCA 4P0QB 2KFNA 2B6GA 1KKXA 5IIJA 3KTQA 5KFRA 3ZDEA 2XICA 3PW2A 5KFWA 4BGDA 2NO5A 4OJLA 5AI6A 2BCVA 4QNLA 3GILA 5ALHA 2R18A 2FMSA 4ED3A 2EZZA 1B43A 4PHPA 4IS7A 1ZRMA 5KFDA 3UM9A 1X66A 5J0TA 3H40A 3IV6A 1ZQZA 5J2JA 1RYRA 4GLXA 3B0XA 3M9MB 3TFSA 1Q3VA 1U48A 2ASLA 4UAZA 4EBDA 1N63A 4RT2A 4JV0A 3SQIA 4R63A 2MA1A 1SWVA 4DSKA 4QZEA 1N5WA 1PVRA 4O3OA 5HHHA 4HAIA 2XY6A 2B21A 5J0YA 4MFFA 1RDFA 9ICNA 4Y2TA 2W7PA 3GV8B 1TAMA 2HHXA 1DK2A 3QU4A 3OGUA 2KVSA 1UCVA 1CRXA 3QX7A 4WJ3B 4JV2A 3S6JA 1KBUA 4IQVA 5DGBA 4DWIA 4QJFB 2KE7A 4C8MA 2DQNB 5J0SA 5IIOA 3RBDA 4PH5A 3VC8A 2DL0A 1TE2A 1SKSA 4DL7A 1JI7A 4QWEA 2PFOA 3KKAC 4C4TA 2YMQA 1LVHA 7ICNA 3TARA 1DGJA 3ISCA 3RAQA 4F5PA 1XC9A 4USAA 2FLLA 2ZG6A 4P2HA 4EZ9A 3NRZA 2JH1A 5ALSA 4AYBC 2YY6A 2JEJA 3LWMA 2K8AA 4J9LA 8ICRA 2FPMA 2W9MA 3GV7B 5AM0A 5KFHA 1V9PA 5DQHA 4DL5A 2R8HA 3A0BU 4PHEA 2YMLA 7ICKA 2KJ8A 3ISBA 5IINA 7ICIA 1BGXT 3BZKA 3UXNA 2W03A 1D9DA 4F93B 9ICIA 1XU4A 1SIJA 4PGXA 2JEFA 1OW5A 9ICXA 5ALYA 1KDHA 2WF7A 3DV9A 2F3NA 2VA3A 1F44A 3T3FA 5GTIU 3PV8A 1Z00A 2K4IA 4EENA 4EBCA 4X5VA 5L1LA 3AU6A 2UVRA 2YX8A 4YP3A 5EE9A 2XGQA 1T8EA 5HNKA 2YB1A 4KLUA 2G5IB 4US9A 4IRKA 2K4HA 3UPQA 5J2BA 2HHTA 1QQ7A 5AKEA 2E1FA 2C2RA 4J9QA 4DFPA 3C21A 4Z6EA 5AI5A 2VIXA 2JR5A 3OJUA 9ICEA 8ICWA 2LHTA 2KD1A 5DBCA 2XGPA 1Z1BA 3RR7A 1A77A 3PR4A 2KHVA 5ALLA 4UAYA 1B4FA 3QUCA 2MUTA 4F5NA 2BCRA 1SKWA 1SB3C 4XUSA 3RJGA 4FE3A 4PL2A 2CRXA 1C7YA 2W3RA 3LYSA 2HVHA 4CNQA 4PL1A 3PW0A 1WG8A 3GIMA 4M47A 3R9KA 2ISOA 1B22A 2G07A 5KFSA 1ZD5A 2A1AA 3V6HA 4C8NA 3WK8A 4DFDA 4IR1A 3OHAA 3HT3A 2MUTB 2W8KA 3JPNA 3G6XA 9ICSA 2K8CB 4O0IA 4R8UA 2MAXA 4F4WA 3AU2A 2BCQA 4UBCA 1X9MA 2DF4B 2E8PA 2VANA 2IBKA 4GFJA 3RB3A 9ICKA 3K1RB 3N7RC 2ISPA 4NLCA 1KL9A 1U45A 1P7DA 1FFUA 4ED1A 3K1ZA 1N2XA 5J8YA 3D2QA 5KG4A 1FO4A 1T4GA 3NASA 1ZQQA 3JPOA 4I2IA 1D9FA 2PFQA 2HBKA 1BPBA 5JUMA 4QWDA 1PK1B 1X9XA 2MRLA 4DO9A 2LMRA 2WF8A 1KW4A 1XSNA 3N7SC 5B5EU 1TAUA 1SGGA 8ICYA 7ICRA 5CJ7A 5DQIA 2EAPA 5AKIA 4YFKA 5KTQA 3KHRA 5JU5A 1XNSA 2K4EA 4RNMA 3SMVA 2ZIVA 1ZQYA 5J2CA 3M8SA 3HRDD 5G5HA 2Y0SC 3ZDDA 3PMNA 4IC9A 4I2BA 3H8JA 5J0UA 5H2FU 3Q8MA 5KG3A 3OPXA 5AIBA 4P4OA 5KFBA 1N56A 3H0MB 4BXOB 4YXMA 8ICMA 2HI0A 1ZJNA 4TURA 4FZMA 2J6SA 2NRWA 1L7OA 3SD7A 1A0PA 5DB6A 4C4SA 2GOLA 4PPXA 4UAVA 3WK5A 3MC1A 2G5HB 4Z6DA 5AI4A 4F2SA 1SL0A 4MEXA 5AKZA 4PZNA 5KT7A 5EWGA 3MR3A 8ICPA 2EDUA 4MF8A 1NK6A 5ALMA 1IIPA 4DOAA 5AM5A 1NJWA 1HUZA 1L8OA 2AHOB 3KHLA 4DOBA 3C1ZA 3G6YA 2QARA 3Q8PB 3LDAA 1ZQHA 1X2IA 9ICAA 4I2JA 2FLNA 4YCXA 4YR3A 3QUTA 3SR6A 1J2MA 3I76A 3TKAA 4G3IA 4M9GA 5KFAA 4DSJA 2HHSA 4NM2A 5J2GA 2DKXA 4RQ2A 3SYZA 2OCEA 4AP9A 1TFRA 2ZJAA 3KZIU 2W55A 3L4PA 5ALJA 3KOOA 3KHHA 2JEGA 8ICEA 5ALDA 3H8SA 1RZTA 1U9LA 1DXSA 1ZQXA 5KG2A 4IL6U 5HHIA 2H5XA 1IM4A 1J2NA 1NOMA 1SV4A 1D8YA 4OJOA 2W9CA 4M9NA 3PX0A 3AQEA 3TADA 2P6RA 3NRWA 3C5GA 4ED0A 2C28A 1L7NA 1CEZA 2E8MA 3WKAA 3L3FX 5F3XB 2Q4TA 2VA8A 4QZIA 3GDXA 1OXJA 2QB0B 3RF9A 2R8JA 4LZDA 1KQQA 5KG5A 2ZJ8A 2DUYA 5EOZA 2BZFA 1T3NA 4TQRA 2GWSA 4XRHA 3VCBA 1HIWA 5TISU 1KFTA 1JIHA 2LI6A 4M6WA 5C5JA 4ACOA 8ICXA 4KLQA 1NJYA 1MQ3A 2AGPA 7ICSA 2HOFA 3IP4B 2HOQA 3RH6A 2I1QA 1K1QA 3HILA 2V4RA 5J8YC 1S0MA 3KZXA 5J2KA 4UBBA 3BQ7A 4JMUA 3SAHA 3O0FA 5KFMA 2BPFA 2LM4A 3HP6A 2DGZA 4DSLA 2DKZA 4RPZA 2QLTA 2ZIVB 3PZPA 1UA0A 1SXEA 1JMSA 2BR0A 4UB1A 4RQ4A 1PK3A 4DSFA 2K4PA 3N4MB 2GLEA 3BQ1A 5EWEA 2IHMA 2E1EA 2BPCA 4NJ8A 5J2FA 4JK1A 4FZLA 3V6JA 2PFPA 4P4MA 2ODGA 3RH5A 2IA6A 8ICQA 3HWTA 2VJ4A 3V7LA 3IRUA 3OJSA 4F92B 5F9NA 2W54A 3NVZA 7ICHA 3FDSA 2H3FA 2WTFA 1A76A 3QYPA 4BUGA 2VA2A 4DQPA 1L8LA 1SXDA 2ES6A 5KFQA 3H4BA 2A1JB 4KLLA 2D6FC 3M6ZA 1Q8KA 4CF4A 2KVCA 4F91B 5F9LA 4QZ8A 2ATLA 1KRPA 4DQIA 1S8OA 1FIQA 2BDUA 4NV0A 4QZFA 1H38A 1ZD2P 8ICAA 8ICGA 4B6JA 5G5GA 4NXZA 4F3OA 3MFIA 4NLNA 4Z6CA 5J2DA 3H8WA 2YB4A 3UXPA 4Q8EA 5AM2A 2V4QA 4DQQA 1QSYA 3MGIA 4NLZA 4GIBA 3SZ2A 1ZXIA 2ALZA 3BS5B 5EE0A 4EZ6A 2BCUA 8ICLA 2ZXIA 1KFDA 1SL2A 1CUKA 4DLGA 3EZ5A 1YZ7A 1NNLA 4I29A 2HVIA 4O3RA 4FO6A 4GC7A 2G0AA 2W8LA 2VKQA 2JZBA 4G9BA 4ED8A 2OEHA 1J97A 2JRZA 2ZUBA 2BQUA 4DEZA 3UMBA 1LKYA 3JPSA 4UB2A 4EELA 2NO4A 8ICSA 7ICLA 4US8A 1UQVA 4ICAA 4GXKA 3TFRA 4Y2PA 3F53A 5HR6A 1VDVA 2KIVA 4RPXA 1URJA 5AM4A 3MDAA 4DFMA 1VLBA 5KFNA 3BQ0A 3K4GA 5KAIU 3JPPA 1ZQMA 2XCAA 1WCLA 2A1JA 4YVZA 2JZBB 3HPOA 5AK5A 3HJEA 2E3TA 1WWUA 2G06A 2NV3A 4Z6FA 1Z1VA 3GZFA 1KSPA 4F71A 5J2EA 1K1SA 2AJQA 4UATA 3MGHA 2WF6A 1PK1A 4BX9C 2ZUDA 3PSFA 5AI9A 5AKXA 5L1MA 2P66A 4DSIA 4CGZA 4Q43A 3NVYA 2ZIXA 1YZ6A 4OD0A 2UVUA 4PGQA 4A8EA 2LKYA 1ZOLA 5KFGA 4DF4A 4IRCA 2KG5A 5J0PA 2YMMA 1D8BA 2JHDA 3C2LA 1LB2B 3Q8SB 3SV4A 4JV1A 1MA7A 4I2FA 2C22A 2NYVA 3BS5A 2Y1JA 1ZQEA 1RYUA 3SEIA 5DLFA 3RB6A 4F4YA 5HMMA 5C0YA 2BCSA 5FP0A 3MR2A 1XSPA 2NRTA 1X9WA 2W3SA 5KFXA 2N1RA 1L3VA 2JGAA 2LYHA 4Y2QA 4RQ1A 1S5LU 2WB1F 4J9OA 2MU2A 8ICTA 3D6JA 3QU9A 2FLPA 8ICBA 1COKA 3QXGA 1T94A 4O5CA 1FEZA 2RLTA 2Y0SF 5AKLA 5KAFU 1BNOA 1XO1A 4RQ8A 4C8OA 2WAQF 3EPIA 3SI8A 2PMZC 4QIWF 4M6WB 1MC8A 1L6NA 4M9HA 3RJKA 5KFZA 8ICHA 3F5EA 2AH5A 2EZYA 1SZHA 1AROP 2OH2A 1ED1A 4JB3A 2KK0A 4Q44A 3E0FA 8ICFA 4F50A 3E58A 8ICVA 3BQTA 2B0CA 9ICLA 3EUB2 4C80A 5CP2A 5ALPA 3ZD8A 3WK4A 1UA1A 5L1IA 4P0PB 2RDJA 2XVTA 1QQ5A 1D8LA 4EX6A 4ELVA 1PUZA 1L5UA 3PW5A 2BGWA 4YR0A 3WKCA 5ALWA 5AKYA 3TI0A 5CR0A 5KG1A 2WF5A 3N7PD 5J2IA 1RXVA 4NLKA 5B66U 4K4IA 3K75D 4F5OA 2LPEA 4EBEA 1ZQIA 2BKEA 2Z7JA 3MBYA 1L3SA 3C2MA 3F2BA 4RQ6A 2DPIA 2FPKA 5DG7A 1TKDA 2R8GA 3WKBA 4RT3A 4Y2RA 4MFCA 8ICKA 4O5KA 4B9NA 1TV9A 1L7PA 4EYIB 1U49A 1JROA 4UB4A 4JWNA 1XSLA 5DG8A 4UARA 5CA7A 1N48A 1BPYA 2IOFK 4P0PA 4CDGA 3RJJA 1X40A 2W43A 2K60A 4MFAA 3MFHA 2HMXA 4I2CA 4YMMA 2YN4A 5KG0A 2CPRA 4F4KA 2H3ZA 4KLOA 3KKAA 1TK5A 3PO4A 2XO7A 2F44A 1ZQ1C 2Q0ZX 3RJHA 5DBBA 1QLNA 2GH1A 4EX7A 2W9CB 4O3NA 4ZH4A 1LV5A 5HP4A 4B9SA 1ZQPA 4BJQA 4QIWC 4UB5A 1ZQVA 3EWAA 2CXYA 4F5RA 3AQFA 3QE9Y 2AQ4A 2HBJA 4C8LA 4YMNA 3QUBA 1ECWA 2GO7A 2IHNA 3OTQA 3PMLA 4KX3A 1NZPA 1JUDA 1F5SA 2BQ3A 5AK3A 2P6UA 4HYKA 1O08A 4F5QA 3SENA 3T5JA 2I9GA 2LYAA 3EW9A 1NK7A 5DKWA 1SV0C 1DGSA 1RQLA 1MQ2A 2Y1IA 3F5AA 5DDYA 1SWWA 4Y2JA 4Q45A 2KICA 3M7DA 1KTQA 4C4RA 2IMWP 4KLSA 1AQ6A 5KG6A 1Q46A 4J9KA 1ZJMA 3DDHA 9ICJA 7ICQA 3ICXA 4F2RA 4OJ5A 2RDIA 4QZBA 2DWQA 5KFTA 5DG9A 5AK6A 2LYBA 1TK8A 2EZXA 4KLJA 2BPGA 3OSPA 4EYHB 2HHWA 1KLNA 5KL8B 4RQNA 3V7KA 3E2EA 9ICMA 1OUQA 3C2KA 4O3SA 1SV0A 2C2DA 3U26A 4O3MA 3RJFA 2LM1A 4UB6U 5CB1A 3G6VA 2HCFA 1PVPA 1S9FA 2J6UA 2KJ5A 4J9SA 3JPTA 2V9WA 1Z3EB 5CWRA 2E8OA 3OSNA 5KT4A 9ICGA 5ALOA 4KLMA 3EYZA 1MN8A 2KSOA 4NL9A 5JRTA 5D49A 4NM1A 3MR5A 3RTVA 4CRXA 3ETRA 4RQMA 4RNOA 3NTUA 2KIWA 2HOIA 2HBLA 5AM3A 1NKCA 3C28A 1UT5A 4M04A 5ALRA 1DRGA 3F2CA 1XO0A 4KMOB 2QB1A 2NRXA 3PSPA 4DL2A 1NK0A 1ZQOA 5D46A 5KFOA 2W9BA 1LKYB 4F4ZA 4DL4A 4O3PA 4PGYA 3RB0A 1BPZA 2OM6A 3QZ7A 7ICOA 4TUSA 5AHXA 4LVSA 3RRHA 4IQUA 1V85A 2PI4A 5ALGA 5KL1B 3QUQA 4B9UA 2WFAA 3RAXA 1XS9D 2ESEA 2JMGA 5KT3A 5J0QA 4DS4A 1V38A 1TVAA 3RRGA 1S77D 4UB8U 2RQ5A 1ZQWA 2YQEA 5KFIA 2IOHA 3N97B 4CE6A 1ZQUA 5BOLA 1C20A 1EXNA 1BNPA 4J9RA 1RPLA 2EQYA 4KTQA 2ZTEA 2KKPA 3IG8A 2EAOA 3CNHA 1BVSA 2DBYA 5ALTA 4K4HA 1PZNA 3GV5B 1QSSA 4KLTA 1RQNA 2PMZF 1RYSA 2WAQC 4DLEA 2KZZA 4I2DA 5E79U 1ZQTA 1SKRA 4UQGA 1NKEA 3GQCA 5KFEA 3HKZC 3IDWA 2AXTU 2DPJA 5IIIA 4I28A 5HMLA 4R66A 2O6KA 7ICUA 3RBEA 2VJ5A 3AEVA 1UT8A 4I2HA 3LVVA 4B9MA 1ZQKA 2QKQA 4ECSA 1RXWA 4C8KA 5BPCA 4BWJA 4FFDA 5AKHA 3WK6A 3T5HA 1RM6C 4KLEA 3HX0A 3M1YA 5AKGA 3TANA 3BQ2A 2PI5A 3GFKB 4RUAA 2BQRA 4DCCA 2W04A 2RP5A 4TUPA 2F1JA 4MEYA 8ICJA 1ZQSA 5CHGA 4QZDA 3KFUF 4ECXA 3PW4A 3GIKA 4PJ0U 3M8RA 3Q8KA 9ICOA 5ALIA 1XWLA 3QU5A 2E8NA 5DB8A 2JXJA 4NY8A 3QEBZ 2DFLA 1WYGA 5ALXA 2XIDA 2ZXHA 1L3UA 1ZQDA 5KFLA 3Q8QB 2FE9A 5EWFA 3H0LB 4O9MA 9ICCA 3NVWA 1K5OA 5KFJA 4OO1J 3ALRA 3I28A 5ALNA 3FM9A 4QW9A 2HDOA 3H8MA 2ZIWA 5J0XA 3T5LA 4Y2UA 4UAUA 4UAWA 5HR7A 3V6KA 4KITB 1U47A 3GIIA 5AK4A 1QSLA 1ZQNA 1N5XA 3IN5A 1NK4A 4C7ZA 3NGDA 2WB1C 7ICJA 4PHAA 3BJYA 3H0RB 9ICQA 5ALKA 5TZVA 2A3VA 3V7JA 3UQ0A 4XQ8A 1ZQBA 1HUOA 4QZ9A 3I1YA 3TAPA 5KFYA 4J9MA 3KD3A 1BPXA 1X9SA 4GXJA 2A19A 1NJZA 4FBUA 4P4PA 2F8KA 4J9NA 5DB7A 3LVWA 1Z4NA 1M6YA 2KKVA 3UMGA 4TQSA 5EE1A 4JWMA 4Y2XA 4R65A 2IOFA 3TAQA 4Y2YA 1KFSA 3T79A 3OHBA 2HSZA 4YN4A 4KMUA 2C2EA 1S76D 2Y9TA 2KFZA 2BDPA 2JEIA 3ZD9A 3J81j 4OJ6A 2YTUA 5KFPA 4F8RA 3PX4A 2M9NA 4F4XA 4U6PA 2KMDA 1S97A 1JXEA 2K8BB 4FS1A 4R64A 4ED7A 4JUZA 5J29A 4ECYA 2FDRA 1CI4A 4GXIA 1O03A 4B9VA 5AKJA 4DL3A 2EAMA 2W9BB 5CEHA 4ECQA 4FBTA 7ICTA 3M9NB 7ICMA 3KBBA 5GTHU 5JTIA 3V72A 3ZI4A 3KHGA 8ICOA 2E5SA 7ICVA 2F77X 2KNJA 4O3QA 5J2AA 3IHQB 2MSNA 1IG6A 3H4DA 2KZ3A 2KN7A 3UMCA 4KLDA 4FZNA 4QWCA 4DS5A 1JALA 4M0AA 3C29A 1KN5A 1ZQJA 4Q8FA 5AIAA 1NK5A 3MR6A 2ZIUA 2I6XA 7ICGA 1Q3UA 5DGAA 2KSOB 1BPEA 5L9XA 5KNIA 5DDMA 2M0NA 2QARB 3ONNA 2HHUA 2AQ0A 2FPLA 1T3QA 1DK3A 2EANA 3ZDAA 1PVQA 2KJ9A 1NZBA 4C7YA 3JPRA 2F8LA 4Y2VA 1JN3A 1L3TA 3T5KA 1Z19A 4UB3A 4J9PA 4OJPA 5AICA 4GC6A 2XC9A 9ICPA 4B9TA 1Y88A 3MGVA 2R8IA 2ZIUB 4DL6A 3MDCA 5L1KA 1BPDA 4KN7A 4F72A 3QEAZ 3BZCA 5ALFA 4QZHA 2XI9A 3THVA 3C5FA 9ICRA 2FMQA 1ZQFA 5KT6A 4ELUA 1ZQGA 2WF9A 1VJ5A 4ECVA 4BXOA 2ASDA 3FC4A 2OYYA 2HBMA 1SL1A 2PFNA 4I2EA 3EPGA 1QTMA 5CRXA 9ICBA 2BHNA 3HKZF 3QNMA 1SZPA 4LJXA 5ALUA 3QZ8A 3UQ2A 2ZUCA 1ZQRA 2KTQA 4KLHA 4IR9A 1WCNA 3HW8A 3CYMA 8ICIA 9ICFA 1V97A 1NKBA 1NK8A 2I5HA 8ICCA 1HEKA 1X6IA 4UW9A 1WUDA 3RB4A 1UHUA 2NRVA 3CW2C 1TK0A 4RZRA 1NK9A 1JX4A 5IIMA 1JRPA 4DFJA 3N28A 1QQ6A 4DSEA 2G09A 9ICWA 4DQRA 3PVXA 4FS2A 8ICUA 4QZGA 4ELTA 3LK9A 1ZD3A 5T14A 4NLGA 3IM1A 2QB0A 3DEEA 3AN1A 3TADC 1ZYQA 3M9OB 2NRZA 1DOQA 3B0YA 4IRDA 2Y9UA 3ORYA 1Z4OA 3SAGA 4RUCA 2PXIA 2J6TA 7ICPA 1S0OA 3NVVA 1QCKA 3PR5B 2KV2A 3AL0B 3WKDA 1KEJA 5KT2A 1N60A 4RNNA 3Q8LA 5EE3A 4RU9A 5DBAA 3AUOA 3QU7A 2F2AB 3WK7A 4RPYA 1N61A 2F1HA 3FYHA 2FI1A 2G08A 1IV8A 2W7OA 5KFUA 8ICNA 4CCHA 2ZIWB 2OHFA 3LWLA 2ASJA 5DQGA 3PY8A 4RQ3A 5KG7A 2UVWA 2HHVA 2W11A 3TQ1A 2XY5A 5AM1A 1ZQAA 4BWMA 1S10A 3A0HU 4ECWA 4KLIA 9ICVA 4RQ0A 1GO3F 3GU3A 3WKEA 3PSTA 4YXJA 2AU0A 4YR2A 5KFCA 2ZIXB 2D3DA 4DQSA 1YT3A 5DLGA 2UVVA 4OCZA 4R8UB 5AI0A 4KLFA 4E0DA 5ALEA 4KN4A 3B9JA 2F76X 4DFKA 5J0OA 2JV3A 4YQWA 4M9LA 4Y2SA 2H3QA 2KEYA 3Q8RB 4ZOHC 2L5YA 4I2GA 4RQ7A 5K4LA 2W9AA 1S0NA 3AMZA 3RH4A 4ECUA 2D8CA 3C23A 4NWIA 5KT5A 4KX5A 3ED5A 1X42A 3SAFA 4DOCA 8ICZA 3CRXA 4MF2A 1RG6A 3CP8A 2H3VA 2K89A 2YMPA 3PO5A 2HW3A 4PZOA 3ISDA 1QH9A 4AYBF 3RJIA 4BDPA 3PX6A 1ZRNA 1X6JA 1TAQA 4ED6A 2XY7A 3MABA 4LZGA 2JH7A 1L7MA 4PHDA 2LBOA 1HJPA 3ZDBA 5AI8A 5J0WA 4I2AA 2F1IA 2OWOA 3D2NA 2FMPA 1B0XA 3WK9A 1JXLA 3H7IA 3QU2A 2P35A 2HHQA 9ICTA 2WHEA 9ICHA 1A6SA 5D4BA 2KOBA 2AGOA 4UASA 4ED2A 2ZTDA 4K4GA 3FAHA 1WWVA 5DB9A 4EEYA 4M2YA 1ZD4A 1NI3A
chains in the Genus database with same CATH topology
5IIKA 3ZDDA 2BCSA 1T7PA 2KZMA 4XA5A 4UAWA 3PMNA 4I2BA 3MR2A 1IXRA 2ZTCA 1XSPA 1U4BA 4RQ5A 3V6KA 4KITB 2NRTA 3H8JA 1Z00B 5J0UA 5KFFA 3Q8MA 1U47A 1X9WA 5KFXA 5KG3A 3GIIA 1L3VA 1QSLA 1ZQNA 3C1YA 2LYHA 4RQ1A 1NK4A 4B9LA 5KFBA 4P4OA 4ECTA 3NGDA 1N56A 3JPQA 5KFVA 3SV3A 4J9OA 4BXOB 4YXMA 7ICJA 4PHAA 3BJYA 4QZCA 9ICQA 5TZVA 8ICMA 8ICTA 3V7JA 1ZJNA 4TURA 4IQWA 2J6SA 3PW7A 3UQ0A 4XQ8A 1ZQBA 2NRWA 4ECRA 1HUOA 2FLPA 8ICBA 4O5CA 3PNCA 4QWAA 4QZ9A 3TAPA 5DB6A 5KFYA 4QW8A 4J9MA 1XO1A 4RQ8A 1BPXA 1X9SA 4C8OA 4PPXA 4GXJA 1NJZA 4FBUA 4KLGA 4P4PA 3EPIA 3SI8A 4QZAA 4M6WB 4J9NA 1MC8A 5DB7A 4M9HA 1COOA 3RJKA 4Z6DA 5KFZA 4F2SA 8ICHA 4TQSA 4JWMA 1SL0A 4MEXA 2R8KA 1AROP 4R65A 3TAQA 5KT7A 5EWGA 9ICUA 1KFSA 3MR3A 4Q44A 8ICFA 3OHBA 8ICPA 4F50A 4YN4A 4KMUA 1S0VA 8ICVA 3BQTA 2C2EA 4MF8A 1S76D 9ICLA 1NK6A 4TUQA 4I27A 5CP2A 3ZD8A 5J2HA 3UXOA 4DOAA 2KFZA 4YD1A 1UA1A 5L1IA 3RR8A 1NJWA 2BDPA 1HUZA 5L1JA 4O5EA 3KHLA 4DOBA 3C1ZA 3ETLA 4YG2A 3G6YA 2JEIA 3Q8PB 3LDAA 3ZD9A 1X2IA 1ZQHA 9ICAA 4I2JA 1ZQCA 5KFPA 2RDJA 4F8RA 2FLNA 1MSWD 3PX4A 3GIJA 4YCXA 2M9NA 1D8LA 4YR3A 4F4XA 1S97A 4ELVA 1L5UA 3PW5A 2BGWA 4G3IA 1JXEA 4YR0A 5J0RA 4M9GA 2AGQA 5KFAA 4DSJA 2HHSA 4FS1A 4NM2A 5KFKA 4R64A 3TI0A 3BDPA 5CR0A 5KG1A 4ED7A 4JUZA 5J29A 2XCPA 4ECYA 5J2GA 4GXIA 4ECZA 5J2IA 4DF8A 1NJXA 7ICEA 1RXVA 4NLKA 4RQ2A 3SYZA 4K4IA 3K75D 5IILA 4B9VA 4IQTA 1TFRA 4F5OA 2ZJAA 4DL3A 4EBEA 1ZQIA 2BKEA 2W9BB 4ECQA 4FBTA 7ICTA 7ICFA 3M9NB 4QWBA 3KHHA 2JEGA 7ICMA 8ICEA 3MBYA 1L3SA 8ICOA 3V72A 2ZJ5A 3KHGA 3C2MA 1ZETA 7ICVA 4RQ6A 4YMOA 4YD2A 2DPIA 4M9JA 3RJEA 2FPKA 5DG7A 1TKDA 4O3QA 3H8SA 5J2AA 1RZTA 1U9LA 4RT3A 1ZQLA 2R8GA 3IHQB 1ZQXA 5BOMA 4MFCA 5KG2A 3H4DA 3ZDCA 2KZ3A 4O5KA 2KFNA 8ICKA 4B9NA 2KN7A 1TV9A 4KLDA 4QWCA 5IIJA 4DS5A 5KFRA 3KTQA 4M0AA 4EYIB 1U49A 3ZDEA 1ZQJA 4Q8FA 1NK5A 3MR6A 5HHIA 2H5XA 3PW2A 4UB4A 1IM4A 5KFWA 1NOMA 1XSLA 1D8YA 4JWNA 7ICGA 4BGDA 5DGAA 5DG8A 2W9CA 2BCVA 1BPEA 5L9XA 4M9NA 3PX0A 5CA7A 3GILA 1N48A 5DDMA 2P6RA 1BPYA 2HHUA 3C5GA 2AQ0A 4ED0A 2FMSA 2FPLA 4ED3A 2C28A 1CEZA 3RJJA 1B43A 3ZDAA 4MFAA 3MFHA 4PHPA 2VA8A 4YMMA 4QZIA 3GDXA 4I2CA 5KFDA 5KG0A 2R8JA 4LZDA 3JPRA 4F4KA 4KLOA 5J0TA 5KG5A 2ZJ8A 1JN3A 1TK5A 2XO7A 3PO4A 5EOZA 1L3TA 3T5KA 1T3NA 2Q0ZX 4UB3A 4TQRA 3RJHA 3H40A 4J9PA 1ZQZA 2GWSA 4GC6A 4XRHA 5DBBA 5J2JA 1RYRA 1QLNA 4GLXA 2XC9A 1KFTA 1JIHA 3B0XA 3M9MB 4O3NA 2W9CB 3TFSA 4B9TA 4ZH4A 1U48A 9ICPA 1LV5A 5HP4A 1Y88A 2ASLA 4B9SA 1ZQPA 2R8IA 4UB5A 4UAZA 4EBDA 4DL6A 1ZQVA 3EWAA 4RT2A 4M6WA 5C5JA 3MDCA 5L1KA 4F5RA 1BPDA 3QE9Y 4JV0A 2AQ4A 4C8LA 4YMNA 8ICXA 4R63A 4KN7A 3QEAZ 2IHNA 4KLQA 4QZHA 1NJYA 4DSKA 3THVA 3PMLA 4QZEA 1MQ3A 3C5FA 9ICRA 4O3OA 2AGPA 2BQ3A 2FMQA 1ZQFA 5KT6A 5HHHA 2XY6A 7ICSA 2B21A 2P6UA 4HYKA 3RH6A 1ZQGA 5J0YA 4ELUA 4F5QA 4MFFA 2I1QA 9ICNA 3T5JA 4ECVA 4BXOA 2ASDA 1K1QA 2I9GA 1SL1A 3EW9A 2PFNA 1NK7A 5DKWA 4I2EA 1DGSA 2V4RA 3EPGA 3GV8B 1QTMA 9ICBA 1S0MA 5J2KA 2Y1IA 1MQ2A 2HHXA 2BHNA 4UBBA 3OGUA 1SZPA 5DDYA 5KFMA 4Q45A 2BPFA 3QZ8A 3T5LA 3UQ2A 2ZUCA 1ZQRA 2KTQA 4KLHA 3HP6A 1KTQA 4IR9A 2IMWP 4KLSA 4DSLA 1WCNA 3HW8A 5KG6A 4RPZA 4JV2A 8ICIA 4J9KA 1ZJMA 1UA0A 1NKBA 9ICFA 1JMSA 2BR0A 4UB1A 9ICJA 4RQ4A 4IQVA 4DSFA 7ICQA 1NK8A 4F2RA 5DGBA 3N4MB 8ICCA 4DWIA 4C8MA 3BQ1A 2NRVA 3RB4A 1TK0A 2RDIA 5EWEA 2IHMA 5J0SA 5IIOA 2BPCA 4RZRA 5KFTA 5J2FA 4QZBA 3RBDA 4JK1A 1NK9A 5DG9A 1JX4A 5IIMA 3V6JA 1TK8A 2PFPA 4PH5A 4P4MA 3RH5A 2IA6A 8ICQA 4DFJA 4KLJA 2BPGA 3OSPA 4EYHB 1SKSA 4DL7A 4DSEA 2HHWA 1KLNA 9ICWA 4DQRA 4QWEA 3HWTA 3V7KA 2PFOA 3PVXA 4FS2A 3V7LA 3E2EA 9ICMA 7ICNA 8ICUA 3TARA 4QZGA 4ELTA 3ISCA 3C2KA 3RAQA 4O3SA 4F5PA 3OJSA 2C2DA 3LK9A 3RJFA 5CB1A 4F92B 5F9NA 3G6VA 4NLGA 3IM1A 1XC9A 1S9FA 2FLLA 2J6UA 4J9SA 3JPTA 3M9OB 1ZYQA 4P2HA 7ICHA 2V9WA 4EZ9A 1Z3EB 2NRZA 3FDSA 5CWRA 1DOQA 3B0YA 2WTFA 4IRDA 3OSNA 5KT4A 9ICGA 3ORYA 1A76A 4KLMA 3EYZA 4NM1A 5D49A 2VA2A 4DQPA 3MR5A 4RUCA 2PXIA 5KFQA 3RTVA 2J6TA 2JEJA 7ICPA 3H4BA 2A1JB 3LWMA 4RNOA 4J9LA 3PR5B 1S0OA 4KLLA 3NTUA 8ICRA 2FPMA 2W9MA 3GV7B 1NKCA 5KT2A 1KEJA 5KFHA 1V9PA 4F91B 5F9LA 5DQHA 4RNNA 4DL5A 3Q8LA 1UT5A 2R8HA 4M04A 4RU9A 5DBAA 3AUOA 4PHEA 4QZ8A 7ICKA 3ISBA 2ATLA 5IINA 1KRPA 7ICIA 4RPYA 1BGXT 4DQIA 2F1HA 3UXNA 2NRXA 1D9DA 4F93B 4DL2A 9ICIA 3FYHA 1NK0A 1XU4A 4PGXA 1ZQOA 4QZFA 2JEFA 1H38A 5D46A 9ICXA 5KFOA 1KDHA 5KFUA 2W9BA 8ICNA 8ICAA 8ICGA 4CCHA 2VA3A 4F4ZA 4DL4A 4NXZA 4O3PA 4PGYA 3RB0A 1BPZA 3LWLA 4F3OA 2ASJA 3QZ7A 5HMMA 3MFIA 3T3FA 7ICOA 4NLNA 3PV8A 4TUSA 4Z6CA 1Z00A 5J2DA 3H8WA 5DQGA 3UXPA 3PY8A 4RQ3A 5KG7A 4Q8EA 2V4QA 4DQQA 4LVSA 2UVWA 3RRHA 2HHVA 4EBCA 3TQ1A 1QSYA 3MGIA 4X5VA 5L1LA 3AU6A 4NLZA 3SZ2A 4IQUA 2PI4A 2UVRA 2XY5A 4YP3A 2ALZA 2XGQA 1ZQAA 4BWMA 1T8EA 5HNKA 1S10A 4B9UA 4KLUA 4ECWA 4EZ6A 4KLIA 4IRKA 3RAXA 9ICVA 1XS9D 4RQ0A 2BCUA 3UPQA 5KT3A 5J0QA 5J2BA 4DS4A 2HHTA 1TVAA 8ICLA 3RRGA 1S77D 2C2RA 4J9QA 4DFPA 1KFDA 1SL2A 4YXJA 1CUKA 1ZQWA 3C21A 4Z6EA 5KFIA 3EZ5A 4DLGA 2AU0A 4YR2A 4I29A 2HVIA 5KFCA 4O3RA 3OJUA 4DQSA 5DLGA 4FO6A 3N97B 9ICEA 8ICWA 1ZQUA 5BOLA 5DBCA 2XGPA 1EXNA 4GC7A 3RR7A 2UVVA 4J9RA 1A77A 2W8LA 3PR4A 1RPLA 4KTQA 2ZTEA 4R8UB 4KLFA 2JZBA 4E0DA 1BVSA 4UAYA 4K4HA 4KN4A 1PZNA 3GV5B 2MUTA 1QSSA 4KLTA 4F5NA 4ED8A 4DFKA 1RYSA 2BCRA 5J0OA 1SKWA 4XUSA 2ZUBA 4DLEA 2BQUA 3RJGA 4YQWA 4M9LA 4DEZA 2KZZA 1C7YA 4I2DA 1ZQTA 3JPSA 1SKRA 4UB2A 3Q8RB 4UQGA 2HVHA 4I2GA 4RQ7A 3GQCA 5KFEA 3PW0A 1NKEA 2W9AA 8ICSA 7ICLA 3GIMA 2DPJA 4GXKA 5IIIA 2ISOA 4I28A 4M47A 3TFRA 5HMLA 4R66A 1B22A 1S0NA 7ICUA 3RH4A 5KFSA 3RBEA 4ECUA 1UT8A 3C23A 5KT5A 4RPXA 4I2HA 4B9MA 1ZQKA 3MDAA 4ECSA 4DFMA 4DOCA 1RXWA 4C8KA 8ICZA 3V6HA 4C8NA 5BPCA 3BQ0A 5KFNA 3K4GA 4IR1A 4BWJA 3OHAA 3JPPA 1ZQMA 3HT3A 2MUTB 2XCAA 2W8KA 4MF2A 3JPNA 1WCLA 3G6XA 3T5HA 9ICSA 2A1JA 4YVZA 4O0IA 3PO5A 2JZBB 3HPOA 2HW3A 4KLEA 4R8UA 3HX0A 3ISDA 2MAXA 4F4WA 3AU2A 3TANA 3BQ2A 2BCQA 2PI5A 3GFKB 4RUAA 3RJIA 2BQRA 4UBCA 4BDPA 1X9MA 4Z6FA 1KSPA 2VANA 2IBKA 4TUPA 3PX6A 5J2EA 3RB3A 9ICKA 2F1JA 1TAQA 4MEYA 4ED6A 8ICJA 2XY7A 1K1SA 1ZQSA 5CHGA 2AJQA 2ISPA 4QZDA 3MGHA 4ECXA 3MABA 3PW4A 3GIKA 4LZGA 1U45A 3M8RA 3Q8KA 4PHDA 9ICOA 4ED1A 1XWLA 1HJPA 3ZDBA 5J0WA 2ZUDA 5DB8A 5KG4A 4I2AA 2P66A 4DSIA 1T4GA 2F1IA 1ZQQA 4Q43A 2OWOA 2FMPA 3JPOA 4I2IA 4NY8A 3QEBZ 1JXLA 3H7IA 2DFLA 2UVUA 1D9FA 4PGQA 2PFQA 1L3UA 2HHQA 4IRCA 5KFGA 5KFLA 4DF4A 1ZQDA 9ICHA 9ICTA 1BPBA 5JUMA 4QWDA 3Q8QB 5EWFA 5J0PA 4DO9A 5D4BA 1XSNA 4O9MA 9ICCA 3C2LA 2AGOA 1TAUA 1LB2B 8ICYA 4K4GA 5KFJA 2ZTDA 4ED2A 7ICRA 5CJ7A 3Q8SB 3SV4A 5DQIA 4JV1A 4YFKA 5KTQA 4I2FA 2C22A 5DB9A 3KHRA 2Y1JA 1ZQEA 4QW9A 4RNMA 4EEYA 5DLFA 1ZQYA 3RB6A 4F4YA 5J2CA 4M2YA 5J0XA 3M8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIK A;  3ZDD A;  2BCS A;  1T7P A;  2KZM A;  4XA5 A;  4UAW A;  3PMN A;  4I2B A;  3MR2 A;  1IXR A;  2ZTC A;  1XSP A;  1U4B A;  4RQ5 A;  3V6K A;  4KIT B;  2NRT A;  3H8J A;  1Z00 B;  5J0U A;  5KFF A;  3Q8M A;  1U47 A;  1X9W A;  5KFX A;  5KG3 A;  3GII A;  1L3V A;  1QSL A;  1ZQN A;  3C1Y A;  2LYH A;  4RQ1 A;  1NK4 A;  4B9L A;  5KFB A;  4P4O A;  4ECT A;  3NGD A;  1N56 A;  3JPQ A;  5KFV A;  3SV3 A;  4J9O A;  4BXO B;  4YXM A;  7ICJ A;  4PHA A;  3BJY A;  4QZC A;  9ICQ A;  5TZV A;  8ICM A;  8ICT A;  3V7J A;  1ZJN A;  4TUR A;  4IQW A;  2J6S A;  3PW7 A;  3UQ0 A;  4XQ8 A;  1ZQB A;  2NRW A;  4ECR A;  1HUO A;  2FLP A;  8ICB A;  4O5C A;  3PNC A;  4QWA A;  4QZ9 A;  3TAP A;  5DB6 A;  5KFY A;  4QW8 A;  4J9M A;  1XO1 A;  4RQ8 A;  1BPX A;  1X9S A;  4C8O A;  4PPX A;  4GXJ A;  1NJZ A;  4FBU A;  4KLG A;  4P4P A;  3EPI A;  3SI8 A;  4QZA A;  4M6W B;  4J9N A;  1MC8 A;  5DB7 A;  4M9H A;  1COO A;  3RJK A;  4Z6D A;  5KFZ A;  4F2S A;  8ICH A;  4TQS A;  4JWM A;  1SL0 A;  4MEX A;  2R8K A;  1ARO P;  4R65 A;  3TAQ A;  5KT7 A;  5EWG A;  9ICU A;  1KFS A;  3MR3 A;  4Q44 A;  8ICF A;  3OHB A;  8ICP A;  4F50 A;  4YN4 A;  4KMU A;  1S0V A;  8ICV A;  3BQT A;  2C2E A;  4MF8 A;  1S76 D;  9ICL A;  1NK6 A;  4TUQ A;  4I27 A;  5CP2 A;  3ZD8 A;  5J2H A;  3UXO A;  4DOA A;  2KFZ A;  4YD1 A;  1UA1 A;  5L1I A;  3RR8 A;  1NJW A;  2BDP A;  1HUZ A;  5L1J A;  4O5E A;  3KHL A;  4DOB A;  3C1Z A;  3ETL A;  4YG2 A;  3G6Y A;  2JEI A;  3Q8P B;  3LDA A;  3ZD9 A;  1X2I A;  1ZQH A;  9ICA A;  4I2J A;  1ZQC A;  5KFP A;  2RDJ A;  4F8R A;  2FLN A;  1MSW D;  3PX4 A;  3GIJ A;  4YCX A;  2M9N A;  1D8L A;  4YR3 A;  4F4X A;  1S97 A;  4ELV A;  1L5U A;  3PW5 A;  2BGW A;  4G3I A;  1JXE A;  4YR0 A;  5J0R A;  4M9G A;  2AGQ A;  5KFA A;  4DSJ A;  2HHS A;  4FS1 A;  4NM2 A;  5KFK A;  4R64 A;  3TI0 A;  3BDP A;  5CR0 A;  5KG1 A;  4ED7 A;  4JUZ A;  5J29 A;  2XCP A;  4ECY A;  5J2G A;  4GXI A;  4ECZ A;  5J2I A;  4DF8 A;  1NJX A;  7ICE A;  1RXV A;  4NLK A;  4RQ2 A;  3SYZ A;  4K4I A;  3K75 D;  5IIL A;  4B9V A;  4IQT A;  1TFR A;  4F5O A;  2ZJA A;  4DL3 A;  4EBE A;  1ZQI A;  2BKE A;  2W9B B;  4ECQ A;  4FBT A;  7ICT A;  7ICF A;  3M9N B;  4QWB A;  3KHH A;  2JEG A;  7ICM A;  8ICE A;  3MBY A;  1L3S A;  8ICO A;  3V72 A;  2ZJ5 A;  3KHG A;  3C2M A;  1ZET A;  7ICV A;  4RQ6 A;  4YMO A;  4YD2 A;  2DPI A;  4M9J A;  3RJE A;  2FPK A;  5DG7 A;  1TKD A;  4O3Q A;  3H8S A;  5J2A A;  1RZT A;  1U9L A;  4RT3 A;  1ZQL A;  2R8G A;  3IHQ B;  1ZQX A;  5BOM A;  4MFC A;  5KG2 A;  3H4D A;  3ZDC A;  2KZ3 A;  4O5K A;  2KFN A;  8ICK A;  4B9N A;  2KN7 A;  1TV9 A;  4KLD A;  4QWC A;  5IIJ A;  4DS5 A;  5KFR A;  3KTQ A;  4M0A A;  4EYI B;  1U49 A;  3ZDE A;  1ZQJ A;  4Q8F A;  1NK5 A;  3MR6 A;  5HHI A;  2H5X A;  3PW2 A;  4UB4 A;  1IM4 A;  5KFW A;  1NOM A;  1XSL A;  1D8Y A;  4JWN A;  7ICG A;  4BGD A;  5DGA A;  5DG8 A;  2W9C A;  2BCV A;  1BPE A;  5L9X A;  4M9N A;  3PX0 A;  5CA7 A;  3GIL A;  1N48 A;  5DDM A;  2P6R A;  1BPY A;  2HHU A;  3C5G A;  2AQ0 A;  4ED0 A;  2FMS A;  2FPL A;  4ED3 A;  2C28 A;  1CEZ A;  3RJJ A;  1B43 A;  3ZDA A;  4MFA A;  3MFH A;  4PHP A;  2VA8 A;  4YMM A;  4QZI A;  3GDX A;  4I2C A;  5KFD A;  5KG0 A;  2R8J A;  4LZD A;  3JPR A;  4F4K A;  4KLO A;  5J0T A;  5KG5 A;  2ZJ8 A;  1JN3 A;  1TK5 A;  2XO7 A;  3PO4 A;  5EOZ A;  1L3T A;  3T5K A;  1T3N A;  2Q0Z X;  4UB3 A;  4TQR A;  3RJH A;  3H40 A;  4J9P A;  1ZQZ A;  2GWS A;  4GC6 A;  4XRH A;  5DBB A;  5J2J A;  1RYR A;  1QLN A;  4GLX A;  2XC9 A;  1KFT A;  1JIH A;  3B0X A;  3M9M B;  4O3N A;  2W9C B;  3TFS A;  4B9T A;  4ZH4 A;  1U48 A;  9ICP A;  1LV5 A;  5HP4 A;  1Y88 A;  2ASL A;  4B9S A;  1ZQP A;  2R8I A;  4UB5 A;  4UAZ A;  4EBD A;  4DL6 A;  1ZQV A;  3EWA A;  4RT2 A;  4M6W A;  5C5J A;  3MDC A;  5L1K A;  4F5R A;  1BPD A;  3QE9 Y;  4JV0 A;  2AQ4 A;  4C8L A;  4YMN A;  8ICX A;  4R63 A;  4KN7 A;  3QEA Z;  2IHN A;  4KLQ A;  4QZH A;  1NJY A;  4DSK A;  3THV A;  3PML A;  4QZE A;  1MQ3 A;  3C5F A;  9ICR A;  4O3O A;  2AGP A;  2BQ3 A;  2FMQ A;  1ZQF A;  5KT6 A;  5HHH A;  2XY6 A;  7ICS A;  2B21 A;  2P6U A;  4HYK A;  3RH6 A;  1ZQG A;  5J0Y A;  4ELU A;  4F5Q A;  4MFF A;  2I1Q A;  9ICN A;  3T5J A;  4ECV A;  4BXO A;  2ASD A;  1K1Q A;  2I9G A;  1SL1 A;  3EW9 A;  2PFN A;  1NK7 A;  5DKW A;  4I2E A;  1DGS A;  2V4R A;  3EPG A;  3GV8 B;  1QTM A;  9ICB A;  1S0M A;  5J2K A;  2Y1I A;  1MQ2 A;  2HHX A;  2BHN A;  4UBB A;  3OGU A;  1SZP A;  5DDY A;  5KFM A;  4Q45 A;  2BPF A;  3QZ8 A;  3T5L A;  3UQ2 A;  2ZUC A;  1ZQR A;  2KTQ A;  4KLH A;  3HP6 A;  1KTQ A;  4IR9 A;  2IMW P;  4KLS A;  4DSL A;  1WCN A;  3HW8 A;  5KG6 A;  4RPZ A;  4JV2 A;  8ICI A;  4J9K A;  1ZJM A;  1UA0 A;  1NKB A;  9ICF A;  1JMS A;  2BR0 A;  4UB1 A;  9ICJ A;  4RQ4 A;  4IQV A;  4DSF A;  7ICQ A;  1NK8 A;  4F2R A;  5DGB A;  3N4M B;  8ICC A;  4DWI A;  4C8M A;  3BQ1 A;  2NRV A;  3RB4 A;  1TK0 A;  2RDI A;  5EWE A;  2IHM A;  5J0S A;  5IIO A;  2BPC A;  4RZR A;  5KFT A;  5J2F A;  4QZB A;  3RBD A;  4JK1 A;  1NK9 A;  5DG9 A;  1JX4 A;  5IIM A;  3V6J A;  1TK8 A;  2PFP A;  4PH5 A;  4P4M A;  3RH5 A;  2IA6 A;  8ICQ A;  4DFJ A;  4KLJ A;  2BPG A;  3OSP A;  4EYH B;  1SKS A;  4DL7 A;  4DSE A;  2HHW A;  1KLN A;  9ICW A;  4DQR A;  4QWE A;  3HWT A;  3V7K A;  2PFO A;  3PVX A;  4FS2 A;  3V7L A;  3E2E A;  9ICM A;  7ICN A;  8ICU A;  3TAR A;  4QZG A;  4ELT A;  3ISC A;  3C2K A;  3RAQ A;  4O3S A;  4F5P A;  3OJS A;  2C2D A;  3LK9 A;  3RJF A;  5CB1 A;  4F92 B;  5F9N A;  3G6V A;  4NLG A;  3IM1 A;  1XC9 A;  1S9F A;  2FLL A;  2J6U A;  4J9S A;  3JPT A;  3M9O B;  1ZYQ A;  4P2H A;  7ICH A;  2V9W A;  4EZ9 A;  1Z3E B;  2NRZ A;  3FDS A;  5CWR A;  1DOQ A;  3B0Y A;  2WTF A;  4IRD A;  3OSN A;  5KT4 A;  9ICG A;  3ORY A;  1A76 A;  4KLM A;  3EYZ A;  4NM1 A;  5D49 A;  2VA2 A;  4DQP A;  3MR5 A;  4RUC A;  2PXI A;  5KFQ A;  3RTV A;  2J6T A;  2JEJ A;  7ICP A;  3H4B A;  2A1J B;  3LWM A;  4RNO A;  4J9L A;  3PR5 B;  1S0O A;  4KLL A;  3NTU A;  8ICR A;  2FPM A;  2W9M A;  3GV7 B;  1NKC A;  5KT2 A;  1KEJ A;  5KFH A;  1V9P A;  4F91 B;  5F9L A;  5DQH A;  4RNN A;  4DL5 A;  3Q8L A;  1UT5 A;  2R8H A;  4M04 A;  4RU9 A;  5DBA A;  3AUO A;  4PHE A;  4QZ8 A;  7ICK A;  3ISB A;  2ATL A;  5IIN A;  1KRP A;  7ICI A;  4RPY A;  1BGX T;  4DQI A;  2F1H A;  3UXN A;  2NRX A;  1D9D A;  4F93 B;  4DL2 A;  9ICI A;  3FYH A;  1NK0 A;  1XU4 A;  4PGX A;  1ZQO A;  4QZF A;  2JEF A;  1H38 A;  5D46 A;  9ICX A;  5KFO A;  1KDH A;  5KFU A;  2W9B A;  8ICN A;  8ICA A;  8ICG A;  4CCH A;  2VA3 A;  4F4Z A;  4DL4 A;  4NXZ A;  4O3P A;  4PGY A;  3RB0 A;  1BPZ A;  3LWL A;  4F3O A;  2ASJ A;  3QZ7 A;  5HMM A;  3MFI A;  3T3F A;  7ICO A;  4NLN A;  3PV8 A;  4TUS A;  4Z6C A;  1Z00 A;  5J2D A;  3H8W A;  5DQG A;  3UXP A;  3PY8 A;  4RQ3 A;  5KG7 A;  4Q8E A;  2V4Q A;  4DQQ A;  4LVS A;  2UVW A;  3RRH A;  2HHV A;  4EBC A;  3TQ1 A;  1QSY A;  3MGI A;  4X5V A;  5L1L A;  3AU6 A;  4NLZ A;  3SZ2 A;  4IQU A;  2PI4 A;  2UVR A;  2XY5 A;  4YP3 A;  2ALZ A;  2XGQ A;  1ZQA A;  4BWM A;  1T8E A;  5HNK A;  1S10 A;  4B9U A;  4KLU A;  4ECW A;  4EZ6 A;  4KLI A;  4IRK A;  3RAX A;  9ICV A;  1XS9 D;  4RQ0 A;  2BCU A;  3UPQ A;  5KT3 A;  5J0Q A;  5J2B A;  4DS4 A;  2HHT A;  1TVA A;  8ICL A;  3RRG A;  1S77 D;  2C2R A;  4J9Q A;  4DFP A;  1KFD A;  1SL2 A;  4YXJ A;  1CUK A;  1ZQW A;  3C21 A;  4Z6E A;  5KFI A;  3EZ5 A;  4DLG A;  2AU0 A;  4YR2 A;  4I29 A;  2HVI A;  5KFC A;  4O3R A;  3OJU A;  4DQS A;  5DLG A;  4FO6 A;  3N97 B;  9ICE A;  8ICW A;  1ZQU A;  5BOL A;  5DBC A;  2XGP A;  1EXN A;  4GC7 A;  3RR7 A;  2UVV A;  4J9R A;  1A77 A;  2W8L A;  3PR4 A;  1RPL A;  4KTQ A;  2ZTE A;  4R8U B;  4KLF A;  2JZB A;  4E0D A;  1BVS A;  4UAY A;  4K4H A;  4KN4 A;  1PZN A;  3GV5 B;  2MUT A;  1QSS A;  4KLT A;  4F5N A;  4ED8 A;  4DFK A;  1RYS A;  2BCR A;  5J0O A;  1SKW A;  4XUS A;  2ZUB A;  4DLE A;  2BQU A;  3RJG A;  4YQW A;  4M9L A;  4DEZ A;  2KZZ A;  1C7Y A;  4I2D A;  1ZQT A;  3JPS A;  1SKR A;  4UB2 A;  3Q8R B;  4UQG A;  2HVH A;  4I2G A;  4RQ7 A;  3GQC A;  5KFE A;  3PW0 A;  1NKE A;  2W9A A;  8ICS A;  7ICL A;  3GIM A;  2DPJ A;  4GXK A;  5III A;  2ISO A;  4I28 A;  4M47 A;  3TFR A;  5HML A;  4R66 A;  1B22 A;  1S0N A;  7ICU A;  3RH4 A;  5KFS A;  3RBE A;  4ECU A;  1UT8 A;  3C23 A;  5KT5 A;  4RPX A;  4I2H A;  4B9M A;  1ZQK A;  3MDA A;  4ECS A;  4DFM A;  4DOC A;  1RXW A;  4C8K A;  8ICZ A;  3V6H A;  4C8N A;  5BPC A;  3BQ0 A;  5KFN A;  3K4G A;  4IR1 A;  4BWJ A;  3OHA A;  3JPP A;  1ZQM A;  3HT3 A;  2MUT B;  2XCA A;  2W8K A;  4MF2 A;  3JPN A;  1WCL A;  3G6X A;  3T5H A;  9ICS A;  2A1J A;  4YVZ A;  4O0I A;  3PO5 A;  2JZB B;  3HPO A;  2HW3 A;  4KLE A;  4R8U A;  3HX0 A;  3ISD A;  2MAX A;  4F4W A;  3AU2 A;  3TAN A;  3BQ2 A;  2BCQ A;  2PI5 A;  3GFK B;  4RUA A;  3RJI A;  2BQR A;  4UBC A;  4BDP A;  1X9M A;  4Z6F A;  1KSP A;  2VAN A;  2IBK A;  4TUP A;  3PX6 A;  5J2E A;  3RB3 A;  9ICK A;  2F1J A;  1TAQ A;  4MEY A;  4ED6 A;  8ICJ A;  2XY7 A;  1K1S A;  1ZQS A;  5CHG A;  2AJQ A;  2ISP A;  4QZD A;  3MGH A;  4ECX A;  3MAB A;  3PW4 A;  3GIK A;  4LZG A;  1U45 A;  3M8R A;  3Q8K A;  4PHD A;  9ICO A;  4ED1 A;  1XWL A;  1HJP A;  3ZDB A;  5J0W A;  2ZUD A;  5DB8 A;  5KG4 A;  4I2A A;  2P66 A;  4DSI A;  1T4G A;  2F1I A;  1ZQQ A;  4Q43 A;  2OWO A;  2FMP A;  3JPO A;  4I2I A;  4NY8 A;  3QEB Z;  1JXL A;  3H7I A;  2DFL A;  2UVU A;  1D9F A;  4PGQ A;  2PFQ A;  1L3U A;  2HHQ A;  4IRC A;  5KFG A;  5KFL A;  4DF4 A;  1ZQD A;  9ICH A;  9ICT A;  1BPB A;  5JUM A;  4QWD A;  3Q8Q B;  5EWF A;  5J0P A;  4DO9 A;  5D4B A;  1XSN A;  4O9M A;  9ICC A;  3C2L A;  2AGO A;  1TAU A;  1LB2 B;  8ICY A;  4K4G A;  5KFJ A;  2ZTD A;  4ED2 A;  7ICR A;  5CJ7 A;  3Q8S B;  3SV4 A;  5DQI A;  4JV1 A;  4YFK A;  5KTQ A;  4I2F A;  2C22 A;  5DB9 A;  3KHR A;  2Y1J A;  1ZQE A;  4QW9 A;  4RNM A;  4EEY A;  5DLF A;  1ZQY A;  3RB6 A;  4F4Y A;  5J2C A;  4M2Y A;  5J0X A;  3M8S A; 
#chains in the Genus database with same CATH topology
 5IIK A;  1T7P A;  2KZM A;  4XA5 A;  1IXR A;  2ZTC A;  1U4B A;  4RQ5 A;  1Z00 B;  5KFF A;  4MHV A;  3C1Y A;  4B9L A;  3WU2 U;  4ECT A;  3JPQ A;  5KFV A;  3SV3 A;  5ALQ A;  4QZC A;  4IQW A;  3PW7 A;  5AKK A;  2H3I A;  3TAC B;  4ECR A;  2EH9 A;  3PNC A;  4QWA A;  2RHF A;  4QW8 A;  4CF3 A;  3PSI A;  4KLG A;  3AM9 A;  2OXO A;  4NL9 C;  4QZA A;  3F2D A;  1COO A;  3BS7 A;  3L5K A;  1FFV A;  2R8K A;  3RFA A;  2KHQ A;  4J03 A;  9ICU A;  1S0V A;  4TUQ A;  2CN1 A;  2RRD A;  4I27 A;  5J2H A;  3UXO A;  4YD1 A;  3RR8 A;  1UPH A;  5L1J A;  4O5E A;  3ETL A;  4YG2 A;  2FJ6 A;  4NLB A;  4EEK A;  1ZQC A;  1MSW D;  3GIJ A;  4CF5 A;  5J0R A;  2AGQ A;  5ALV A;  5KFK A;  3BDP A;  2PKE A;  4P0Q A;  2XCP A;  1N62 A;  4ECZ A;  5ALZ A;  4DF8 A;  1NJX A;  4C0Z A;  7ICE A;  3IG5 A;  5A0L A;  5IIL A;  4IQT A;  3M6K A;  3NUQ A;  3D2S A;  7ICF A;  4QWB A;  2ZJ5 A;  1ZET A;  4YMO A;  4YD2 A;  4M9J A;  3NS1 A;  3RJE A;  1ZQL A;  4U7C A;  2KP7 A;  1F0M A;  5BOM A;  3ZDC A;  4P0Q B;  2KFN A;  2B6G A;  1KKX A;  5IIJ A;  3KTQ A;  5KFR A;  3ZDE A;  2XIC A;  3PW2 A;  5KFW A;  4BGD A;  2NO5 A;  4OJL A;  5AI6 A;  2BCV A;  4QNL A;  3GIL A;  5ALH A;  2R18 A;  2FMS A;  4ED3 A;  2EZZ A;  1B43 A;  4PHP A;  4IS7 A;  1ZRM A;  5KFD A;  3UM9 A;  1X66 A;  5J0T A;  3H40 A;  3IV6 A;  1ZQZ A;  5J2J A;  1RYR A;  4GLX A;  3B0X A;  3M9M B;  3TFS A;  1Q3V A;  1U48 A;  2ASL A;  4UAZ A;  4EBD A;  1N63 A;  4RT2 A;  4JV0 A;  3SQI A;  4R63 A;  2MA1 A;  1SWV A;  4DSK A;  4QZE A;  1N5W A;  1PVR A;  4O3O A;  5HHH A;  4HAI A;  2XY6 A;  2B21 A;  5J0Y A;  4MFF A;  1RDF A;  9ICN A;  4Y2T A;  2W7P A;  3GV8 B;  1TAM A;  2HHX A;  1DK2 A;  3QU4 A;  3OGU A;  2KVS A;  1UCV A;  1CRX A;  3QX7 A;  4WJ3 B;  4JV2 A;  3S6J A;  1KBU A;  4IQV A;  5DGB A;  4DWI A;  4QJF B;  2KE7 A;  4C8M A;  2DQN B;  5J0S A;  5IIO A;  3RBD A;  4PH5 A;  3VC8 A;  2DL0 A;  1TE2 A;  1SKS A;  4DL7 A;  1JI7 A;  4QWE A;  2PFO A;  3KKA C;  4C4T A;  2YMQ A;  1LVH A;  7ICN A;  3TAR A;  1DGJ A;  3ISC A;  3RAQ A;  4F5P A;  1XC9 A;  4USA A;  2FLL A;  2ZG6 A;  4P2H A;  4EZ9 A;  3NRZ A;  2JH1 A;  5ALS A;  4AYB C;  2YY6 A;  2JEJ A;  3LWM A;  2K8A A;  4J9L A;  8ICR A;  2FPM A;  2W9M A;  3GV7 B;  5AM0 A;  5KFH A;  1V9P A;  5DQH A;  4DL5 A;  2R8H A;  3A0B U;  4PHE A;  2YML A;  7ICK A;  2KJ8 A;  3ISB A;  5IIN A;  7ICI A;  1BGX T;  3BZK A;  3UXN A;  2W03 A;  1D9D A;  4F93 B;  9ICI A;  1XU4 A;  1SIJ A;  4PGX A;  2JEF A;  1OW5 A;  9ICX A;  5ALY A;  1KDH A;  2WF7 A;  3DV9 A;  2F3N A;  2VA3 A;  1F44 A;  3T3F A;  5GTI U;  3PV8 A;  1Z00 A;  2K4I A;  4EEN A;  4EBC A;  4X5V A;  5L1L A;  3AU6 A;  2UVR A;  2YX8 A;  4YP3 A;  5EE9 A;  2XGQ A;  1T8E A;  5HNK A;  2YB1 A;  4KLU A;  2G5I B;  4US9 A;  4IRK A;  2K4H A;  3UPQ A;  5J2B A;  2HHT A;  1QQ7 A;  5AKE A;  2E1F A;  2C2R A;  4J9Q A;  4DFP A;  3C21 A;  4Z6E A;  5AI5 A;  2VIX A;  2JR5 A;  3OJU A;  9ICE A;  8ICW A;  2LHT A;  2KD1 A;  5DBC A;  2XGP A;  1Z1B A;  3RR7 A;  1A77 A;  3PR4 A;  2KHV A;  5ALL A;  4UAY A;  1B4F A;  3QUC A;  2MUT A;  4F5N A;  2BCR A;  1SKW A;  1SB3 C;  4XUS A;  3RJG A;  4FE3 A;  4PL2 A;  2CRX A;  1C7Y A;  2W3R A;  3LYS A;  2HVH A;  4CNQ A;  4PL1 A;  3PW0 A;  1WG8 A;  3GIM A;  4M47 A;  3R9K A;  2ISO A;  1B22 A;  2G07 A;  5KFS A;  1ZD5 A;  2A1A A;  3V6H A;  4C8N A;  3WK8 A;  4DFD A;  4IR1 A;  3OHA A;  3HT3 A;  2MUT B;  2W8K A;  3JPN A;  3G6X A;  9ICS A;  2K8C B;  4O0I A;  4R8U A;  2MAX A;  4F4W A;  3AU2 A;  2BCQ A;  4UBC A;  1X9M A;  2DF4 B;  2E8P A;  2VAN A;  2IBK A;  4GFJ A;  3RB3 A;  9ICK A;  3K1R B;  3N7R C;  2ISP A;  4NLC A;  1KL9 A;  1U45 A;  1P7D A;  1FFU A;  4ED1 A;  3K1Z A;  1N2X A;  5J8Y A;  3D2Q A;  5KG4 A;  1FO4 A;  1T4G A;  3NAS A;  1ZQQ A;  3JPO A;  4I2I A;  1D9F A;  2PFQ A;  2HBK A;  1BPB A;  5JUM A;  4QWD A;  1PK1 B;  1X9X A;  2MRL A;  4DO9 A;  2LMR A;  2WF8 A;  1KW4 A;  1XSN A;  3N7S C;  5B5E U;  1TAU A;  1SGG A;  8ICY A;  7ICR A;  5CJ7 A;  5DQI A;  2EAP A;  5AKI A;  4YFK A;  5KTQ A;  3KHR A;  5JU5 A;  1XNS A;  2K4E A;  4RNM A;  3SMV A;  2ZIV A;  1ZQY A;  5J2C A;  3M8S A;  3HRD D;  5G5H A;  2Y0S C;  3ZDD A;  3PMN A;  4IC9 A;  4I2B A;  3H8J A;  5J0U A;  5H2F U;  3Q8M A;  5KG3 A;  3OPX A;  5AIB A;  4P4O A;  5KFB A;  1N56 A;  3H0M B;  4BXO B;  4YXM A;  8ICM A;  2HI0 A;  1ZJN A;  4TUR A;  4FZM A;  2J6S A;  2NRW A;  1L7O A;  3SD7 A;  1A0P A;  5DB6 A;  4C4S A;  2GOL A;  4PPX A;  4UAV A;  3WK5 A;  3MC1 A;  2G5H B;  4Z6D A;  5AI4 A;  4F2S A;  1SL0 A;  4MEX A;  5AKZ A;  4PZN A;  5KT7 A;  5EWG A;  3MR3 A;  8ICP A;  2EDU A;  4MF8 A;  1NK6 A;  5ALM A;  1IIP A;  4DOA A;  5AM5 A;  1NJW A;  1HUZ A;  1L8O A;  2AHO B;  3KHL A;  4DOB A;  3C1Z A;  3G6Y A;  2QAR A;  3Q8P B;  3LDA A;  1ZQH A;  1X2I A;  9ICA A;  4I2J A;  2FLN A;  4YCX A;  4YR3 A;  3QUT A;  3SR6 A;  1J2M A;  3I76 A;  3TKA A;  4G3I A;  4M9G A;  5KFA A;  4DSJ A;  2HHS A;  4NM2 A;  5J2G A;  2DKX A;  4RQ2 A;  3SYZ A;  2OCE A;  4AP9 A;  1TFR A;  2ZJA A;  3KZI U;  2W55 A;  3L4P A;  5ALJ A;  3KOO A;  3KHH A;  2JEG A;  8ICE A;  5ALD A;  3H8S A;  1RZT A;  1U9L A;  1DXS A;  1ZQX A;  5KG2 A;  4IL6 U;  5HHI A;  2H5X A;  1IM4 A;  1J2N A;  1NOM A;  1SV4 A;  1D8Y A;  4OJO A;  2W9C A;  4M9N A;  3PX0 A;  3AQE A;  3TAD A;  2P6R A;  3NRW A;  3C5G A;  4ED0 A;  2C28 A;  1L7N A;  1CEZ A;  2E8M A;  3WKA A;  3L3F X;  5F3X B;  2Q4T A;  2VA8 A;  4QZI A;  3GDX A;  1OXJ A;  2QB0 B;  3RF9 A;  2R8J A;  4LZD A;  1KQQ A;  5KG5 A;  2ZJ8 A;  2DUY A;  5EOZ A;  2BZF A;  1T3N A;  4TQR A;  2GWS A;  4XRH A;  3VCB A;  1HIW A;  5TIS U;  1KFT A;  1JIH A;  2LI6 A;  4M6W A;  5C5J A;  4ACO A;  8ICX A;  4KLQ A;  1NJY A;  1MQ3 A;  2AGP A;  7ICS A;  2HOF A;  3IP4 B;  2HOQ A;  3RH6 A;  2I1Q A;  1K1Q A;  3HIL A;  2V4R A;  5J8Y C;  1S0M A;  3KZX A;  5J2K A;  4UBB A;  3BQ7 A;  4JMU A;  3SAH A;  3O0F A;  5KFM A;  2BPF A;  2LM4 A;  3HP6 A;  2DGZ A;  4DSL A;  2DKZ A;  4RPZ A;  2QLT A;  2ZIV B;  3PZP A;  1UA0 A;  1SXE A;  1JMS A;  2BR0 A;  4UB1 A;  4RQ4 A;  1PK3 A;  4DSF A;  2K4P A;  3N4M B;  2GLE A;  3BQ1 A;  5EWE A;  2IHM A;  2E1E A;  2BPC A;  4NJ8 A;  5J2F A;  4JK1 A;  4FZL A;  3V6J A;  2PFP A;  4P4M A;  2ODG A;  3RH5 A;  2IA6 A;  8ICQ A;  3HWT A;  2VJ4 A;  3V7L A;  3IRU A;  3OJS A;  4F92 B;  5F9N A;  2W54 A;  3NVZ A;  7ICH A;  3FDS A;  2H3F A;  2WTF A;  1A76 A;  3QYP A;  4BUG A;  2VA2 A;  4DQP A;  1L8L A;  1SXD A;  2ES6 A;  5KFQ A;  3H4B A;  2A1J B;  4KLL A;  2D6F C;  3M6Z A;  1Q8K A;  4CF4 A;  2KVC A;  4F91 B;  5F9L A;  4QZ8 A;  2ATL A;  1KRP A;  4DQI A;  1S8O A;  1FIQ A;  2BDU A;  4NV0 A;  4QZF A;  1H38 A;  1ZD2 P;  8ICA A;  8ICG A;  4B6J A;  5G5G A;  4NXZ A;  4F3O A;  3MFI A;  4NLN A;  4Z6C A;  5J2D A;  3H8W A;  2YB4 A;  3UXP A;  4Q8E A;  5AM2 A;  2V4Q A;  4DQQ A;  1QSY A;  3MGI A;  4NLZ A;  4GIB A;  3SZ2 A;  1ZXI A;  2ALZ A;  3BS5 B;  5EE0 A;  4EZ6 A;  2BCU A;  8ICL A;  2ZXI A;  1KFD A;  1SL2 A;  1CUK A;  4DLG A;  3EZ5 A;  1YZ7 A;  1NNL A;  4I29 A;  2HVI A;  4O3R A;  4FO6 A;  4GC7 A;  2G0A A;  2W8L A;  2VKQ A;  2JZB A;  4G9B A;  4ED8 A;  2OEH A;  1J97 A;  2JRZ A;  2ZUB A;  2BQU A;  4DEZ A;  3UMB A;  1LKY A;  3JPS A;  4UB2 A;  4EEL A;  2NO4 A;  8ICS A;  7ICL A;  4US8 A;  1UQV A;  4ICA A;  4GXK A;  3TFR A;  4Y2P A;  3F53 A;  5HR6 A;  1VDV A;  2KIV A;  4RPX A;  1URJ A;  5AM4 A;  3MDA A;  4DFM A;  1VLB A;  5KFN A;  3BQ0 A;  3K4G A;  5KAI U;  3JPP A;  1ZQM A;  2XCA A;  1WCL A;  2A1J A;  4YVZ A;  2JZB B;  3HPO A;  5AK5 A;  3HJE A;  2E3T A;  1WWU A;  2G06 A;  2NV3 A;  4Z6F A;  1Z1V A;  3GZF A;  1KSP A;  4F71 A;  5J2E A;  1K1S A;  2AJQ A;  4UAT A;  3MGH A;  2WF6 A;  1PK1 A;  4BX9 C;  2ZUD A;  3PSF A;  5AI9 A;  5AKX A;  5L1M A;  2P66 A;  4DSI A;  4CGZ A;  4Q43 A;  3NVY A;  2ZIX A;  1YZ6 A;  4OD0 A;  2UVU A;  4PGQ A;  4A8E A;  2LKY A;  1ZOL A;  5KFG A;  4DF4 A;  4IRC A;  2KG5 A;  5J0P A;  2YMM A;  1D8B A;  2JHD A;  3C2L A;  1LB2 B;  3Q8S B;  3SV4 A;  4JV1 A;  1MA7 A;  4I2F A;  2C22 A;  2NYV A;  3BS5 A;  2Y1J A;  1ZQE A;  1RYU A;  3SEI A;  5DLF A;  3RB6 A;  4F4Y A;  5HMM A;  5C0Y A;  2BCS A;  5FP0 A;  3MR2 A;  1XSP A;  2NRT A;  1X9W A;  2W3S A;  5KFX A;  2N1R A;  1L3V A;  2JGA A;  2LYH A;  4Y2Q A;  4RQ1 A;  1S5L U;  2WB1 F;  4J9O A;  2MU2 A;  8ICT A;  3D6J A;  3QU9 A;  2FLP A;  8ICB A;  1COK A;  3QXG A;  1T94 A;  4O5C A;  1FEZ A;  2RLT A;  2Y0S F;  5AKL A;  5KAF U;  1BNO A;  1XO1 A;  4RQ8 A;  4C8O A;  2WAQ F;  3EPI A;  3SI8 A;  2PMZ C;  4QIW F;  4M6W B;  1MC8 A;  1L6N A;  4M9H A;  3RJK A;  5KFZ A;  8ICH A;  3F5E A;  2AH5 A;  2EZY A;  1SZH A;  1ARO P;  2OH2 A;  1ED1 A;  4JB3 A;  2KK0 A;  4Q44 A;  3E0F A;  8ICF A;  4F50 A;  3E58 A;  8ICV A;  3BQT A;  2B0C A;  9ICL A;  3EUB 2;  4C80 A;  5CP2 A;  5ALP A;  3ZD8 A;  3WK4 A;  1UA1 A;  5L1I A;  4P0P B;  2RDJ A;  2XVT A;  1QQ5 A;  1D8L A;  4EX6 A;  4ELV A;  1PUZ A;  1L5U A;  3PW5 A;  2BGW A;  4YR0 A;  3WKC A;  5ALW A;  5AKY A;  3TI0 A;  5CR0 A;  5KG1 A;  2WF5 A;  3N7P D;  5J2I A;  1RXV A;  4NLK A;  5B66 U;  4K4I A;  3K75 D;  4F5O A;  2LPE A;  4EBE A;  1ZQI A;  2BKE A;  2Z7J A;  3MBY A;  1L3S A;  3C2M A;  3F2B A;  4RQ6 A;  2DPI A;  2FPK A;  5DG7 A;  1TKD A;  2R8G A;  3WKB A;  4RT3 A;  4Y2R A;  4MFC A;  8ICK A;  4O5K A;  4B9N A;  1TV9 A;  1L7P A;  4EYI B;  1U49 A;  1JRO A;  4UB4 A;  4JWN A;  1XSL A;  5DG8 A;  4UAR A;  5CA7 A;  1N48 A;  1BPY A;  2IOF K;  4P0P A;  4CDG A;  3RJJ A;  1X40 A;  2W43 A;  2K60 A;  4MFA A;  3MFH A;  2HMX A;  4I2C A;  4YMM A;  2YN4 A;  5KG0 A;  2CPR A;  4F4K A;  2H3Z A;  4KLO A;  3KKA A;  1TK5 A;  3PO4 A;  2XO7 A;  2F44 A;  1ZQ1 C;  2Q0Z X;  3RJH A;  5DBB A;  1QLN A;  2GH1 A;  4EX7 A;  2W9C B;  4O3N A;  4ZH4 A;  1LV5 A;  5HP4 A;  4B9S A;  1ZQP A;  4BJQ A;  4QIW C;  4UB5 A;  1ZQV A;  3EWA A;  2CXY A;  4F5R A;  3AQF A;  3QE9 Y;  2AQ4 A;  2HBJ A;  4C8L A;  4YMN A;  3QUB A;  1ECW A;  2GO7 A;  2IHN A;  3OTQ A;  3PML A;  4KX3 A;  1NZP A;  1JUD A;  1F5S A;  2BQ3 A;  5AK3 A;  2P6U A;  4HYK A;  1O08 A;  4F5Q A;  3SEN A;  3T5J A;  2I9G A;  2LYA A;  3EW9 A;  1NK7 A;  5DKW A;  1SV0 C;  1DGS A;  1RQL A;  1MQ2 A;  2Y1I A;  3F5A A;  5DDY A;  1SWW A;  4Y2J A;  4Q45 A;  2KIC A;  3M7D A;  1KTQ A;  4C4R A;  2IMW P;  4KLS A;  1AQ6 A;  5KG6 A;  1Q46 A;  4J9K A;  1ZJM A;  3DDH A;  9ICJ A;  7ICQ A;  3ICX A;  4F2R A;  4OJ5 A;  2RDI A;  4QZB A;  2DWQ A;  5KFT A;  5DG9 A;  5AK6 A;  2LYB A;  1TK8 A;  2EZX A;  4KLJ A;  2BPG A;  3OSP A;  4EYH B;  2HHW A;  1KLN A;  5KL8 B;  4RQN A;  3V7K A;  3E2E A;  9ICM A;  1OUQ A;  3C2K A;  4O3S A;  1SV0 A;  2C2D A;  3U26 A;  4O3M A;  3RJF A;  2LM1 A;  4UB6 U;  5CB1 A;  3G6V A;  2HCF A;  1PVP A;  1S9F A;  2J6U A;  2KJ5 A;  4J9S A;  3JPT A;  2V9W A;  1Z3E B;  5CWR A;  2E8O A;  3OSN A;  5KT4 A;  9ICG A;  5ALO A;  4KLM A;  3EYZ A;  1MN8 A;  2KSO A;  4NL9 A;  5JRT A;  5D49 A;  4NM1 A;  3MR5 A;  3RTV A;  4CRX A;  3ETR A;  4RQM A;  4RNO A;  3NTU A;  2KIW A;  2HOI A;  2HBL A;  5AM3 A;  1NKC A;  3C28 A;  1UT5 A;  4M04 A;  5ALR A;  1DRG A;  3F2C A;  1XO0 A;  4KMO B;  2QB1 A;  2NRX A;  3PSP A;  4DL2 A;  1NK0 A;  1ZQO A;  5D46 A;  5KFO A;  2W9B A;  1LKY B;  4F4Z A;  4DL4 A;  4O3P A;  4PGY A;  3RB0 A;  1BPZ A;  2OM6 A;  3QZ7 A;  7ICO A;  4TUS A;  5AHX A;  4LVS A;  3RRH A;  4IQU A;  1V85 A;  2PI4 A;  5ALG A;  5KL1 B;  3QUQ A;  4B9U A;  2WFA A;  3RAX A;  1XS9 D;  2ESE A;  2JMG A;  5KT3 A;  5J0Q A;  4DS4 A;  1V38 A;  1TVA A;  3RRG A;  1S77 D;  4UB8 U;  2RQ5 A;  1ZQW A;  2YQE A;  5KFI A;  2IOH A;  3N97 B;  4CE6 A;  1ZQU A;  5BOL A;  1C20 A;  1EXN A;  1BNP A;  4J9R A;  1RPL A;  2EQY A;  4KTQ A;  2ZTE A;  2KKP A;  3IG8 A;  2EAO A;  3CNH A;  1BVS A;  2DBY A;  5ALT A;  4K4H A;  1PZN A;  3GV5 B;  1QSS A;  4KLT A;  1RQN A;  2PMZ F;  1RYS A;  2WAQ C;  4DLE A;  2KZZ A;  4I2D A;  5E79 U;  1ZQT A;  1SKR A;  4UQG A;  1NKE A;  3GQC A;  5KFE A;  3HKZ C;  3IDW A;  2AXT U;  2DPJ A;  5III A;  4I28 A;  5HML A;  4R66 A;  2O6K A;  7ICU A;  3RBE A;  2VJ5 A;  3AEV A;  1UT8 A;  4I2H A;  3LVV A;  4B9M A;  1ZQK A;  2QKQ A;  4ECS A;  1RXW A;  4C8K A;  5BPC A;  4BWJ A;  4FFD A;  5AKH A;  3WK6 A;  3T5H A;  1RM6 C;  4KLE A;  3HX0 A;  3M1Y A;  5AKG A;  3TAN A;  3BQ2 A;  2PI5 A;  3GFK B;  4RUA A;  2BQR A;  4DCC A;  2W04 A;  2RP5 A;  4TUP A;  2F1J A;  4MEY A;  8ICJ A;  1ZQS A;  5CHG A;  4QZD A;  3KFU F;  4ECX A;  3PW4 A;  3GIK A;  4PJ0 U;  3M8R A;  3Q8K A;  9ICO A;  5ALI A;  1XWL A;  3QU5 A;  2E8N A;  5DB8 A;  2JXJ A;  4NY8 A;  3QEB Z;  2DFL A;  1WYG A;  5ALX A;  2XID A;  2ZXH A;  1L3U A;  1ZQD A;  5KFL A;  3Q8Q B;  2FE9 A;  5EWF A;  3H0L B;  4O9M A;  9ICC A;  3NVW A;  1K5O A;  5KFJ A;  4OO1 J;  3ALR A;  3I28 A;  5ALN A;  3FM9 A;  4QW9 A;  2HDO A;  3H8M A;  2ZIW A;  5J0X A;  3T5L A;  4Y2U A;  4UAU A;  4UAW A;  5HR7 A;  3V6K A;  4KIT B;  1U47 A;  3GII A;  5AK4 A;  1QSL A;  1ZQN A;  1N5X A;  3IN5 A;  1NK4 A;  4C7Z A;  3NGD A;  2WB1 C;  7ICJ A;  4PHA A;  3BJY A;  3H0R B;  9ICQ A;  5ALK A;  5TZV A;  2A3V A;  3V7J A;  3UQ0 A;  4XQ8 A;  1ZQB A;  1HUO A;  4QZ9 A;  3I1Y A;  3TAP A;  5KFY A;  4J9M A;  3KD3 A;  1BPX A;  1X9S A;  4GXJ A;  2A19 A;  1NJZ A;  4FBU A;  4P4P A;  2F8K A;  4J9N A;  5DB7 A;  3LVW A;  1Z4N A;  1M6Y A;  2KKV A;  3UMG A;  4TQS A;  5EE1 A;  4JWM A;  4Y2X A;  4R65 A;  2IOF A;  3TAQ A;  4Y2Y A;  1KFS A;  3T79 A;  3OHB A;  2HSZ A;  4YN4 A;  4KMU A;  2C2E A;  1S76 D;  2Y9T A;  2KFZ A;  2BDP A;  2JEI A;  3ZD9 A;  3J81 j;  4OJ6 A;  2YTU A;  5KFP A;  4F8R A;  3PX4 A;  2M9N A;  4F4X A;  4U6P A;  2KMD A;  1S97 A;  1JXE A;  2K8B B;  4FS1 A;  4R64 A;  4ED7 A;  4JUZ A;  5J29 A;  4ECY A;  2FDR A;  1CI4 A;  4GXI A;  1O03 A;  4B9V A;  5AKJ A;  4DL3 A;  2EAM A;  2W9B B;  5CEH A;  4ECQ A;  4FBT A;  7ICT A;  3M9N B;  7ICM A;  3KBB A;  5GTH U;  5JTI A;  3V72 A;  3ZI4 A;  3KHG A;  8ICO A;  2E5S A;  7ICV A;  2F77 X;  2KNJ A;  4O3Q A;  5J2A A;  3IHQ B;  2MSN A;  1IG6 A;  3H4D A;  2KZ3 A;  2KN7 A;  3UMC A;  4KLD A;  4FZN A;  4QWC A;  4DS5 A;  1JAL A;  4M0A A;  3C29 A;  1KN5 A;  1ZQJ A;  4Q8F A;  5AIA A;  1NK5 A;  3MR6 A;  2ZIU A;  2I6X A;  7ICG A;  1Q3U A;  5DGA A;  2KSO B;  1BPE A;  5L9X A;  5KNI A;  5DDM A;  2M0N A;  2QAR B;  3ONN A;  2HHU A;  2AQ0 A;  2FPL A;  1T3Q A;  1DK3 A;  2EAN A;  3ZDA A;  1PVQ A;  2KJ9 A;  1NZB A;  4C7Y A;  3JPR A;  2F8L A;  4Y2V A;  1JN3 A;  1L3T A;  3T5K A;  1Z19 A;  4UB3 A;  4J9P A;  4OJP A;  5AIC A;  4GC6 A;  2XC9 A;  9ICP A;  4B9T A;  1Y88 A;  3MGV A;  2R8I A;  2ZIU B;  4DL6 A;  3MDC A;  5L1K A;  1BPD A;  4KN7 A;  4F72 A;  3QEA Z;  3BZC A;  5ALF A;  4QZH A;  2XI9 A;  3THV A;  3C5F A;  9ICR A;  2FMQ A;  1ZQF A;  5KT6 A;  4ELU A;  1ZQG A;  2WF9 A;  1VJ5 A;  4ECV A;  4BXO A;  2ASD A;  3FC4 A;  2OYY A;  2HBM A;  1SL1 A;  2PFN A;  4I2E A;  3EPG A;  1QTM A;  5CRX A;  9ICB A;  2BHN A;  3HKZ F;  3QNM A;  1SZP A;  4LJX A;  5ALU A;  3QZ8 A;  3UQ2 A;  2ZUC A;  1ZQR A;  2KTQ A;  4KLH A;  4IR9 A;  1WCN A;  3HW8 A;  3CYM A;  8ICI A;  9ICF A;  1V97 A;  1NKB A;  1NK8 A;  2I5H A;  8ICC A;  1HEK A;  1X6I A;  4UW9 A;  1WUD A;  3RB4 A;  1UHU A;  2NRV A;  3CW2 C;  1TK0 A;  4RZR A;  1NK9 A;  1JX4 A;  5IIM A;  1JRP A;  4DFJ A;  3N28 A;  1QQ6 A;  4DSE A;  2G09 A;  9ICW A;  4DQR A;  3PVX A;  4FS2 A;  8ICU A;  4QZG A;  4ELT A;  3LK9 A;  1ZD3 A;  5T14 A;  4NLG A;  3IM1 A;  2QB0 A;  3DEE A;  3AN1 A;  3TAD C;  1ZYQ A;  3M9O B;  2NRZ A;  1DOQ A;  3B0Y A;  4IRD A;  2Y9U A;  3ORY A;  1Z4O A;  3SAG A;  4RUC A;  2PXI A;  2J6T A;  7ICP A;  1S0O A;  3NVV A;  1QCK A;  3PR5 B;  2KV2 A;  3AL0 B;  3WKD A;  1KEJ A;  5KT2 A;  1N60 A;  4RNN A;  3Q8L A;  5EE3 A;  4RU9 A;  5DBA A;  3AUO A;  3QU7 A;  2F2A B;  3WK7 A;  4RPY A;  1N61 A;  2F1H A;  3FYH A;  2FI1 A;  2G08 A;  1IV8 A;  2W7O A;  5KFU A;  8ICN A;  4CCH A;  2ZIW B;  2OHF A;  3LWL A;  2ASJ A;  5DQG A;  3PY8 A;  4RQ3 A;  5KG7 A;  2UVW A;  2HHV A;  2W11 A;  3TQ1 A;  2XY5 A;  5AM1 A;  1ZQA A;  4BWM A;  1S10 A;  3A0H U;  4ECW A;  4KLI A;  9ICV A;  4RQ0 A;  1GO3 F;  3GU3 A;  3WKE A;  3PST A;  4YXJ A;  2AU0 A;  4YR2 A;  5KFC A;  2ZIX B;  2D3D A;  4DQS A;  1YT3 A;  5DLG A;  2UVV A;  4OCZ A;  4R8U B;  5AI0 A;  4KLF A;  4E0D A;  5ALE A;  4KN4 A;  3B9J A;  2F76 X;  4DFK A;  5J0O A;  2JV3 A;  4YQW A;  4M9L A;  4Y2S A;  2H3Q A;  2KEY A;  3Q8R B;  4ZOH C;  2L5Y A;  4I2G A;  4RQ7 A;  5K4L A;  2W9A A;  1S0N A;  3AMZ A;  3RH4 A;  4ECU A;  2D8C A;  3C23 A;  4NWI A;  5KT5 A;  4KX5 A;  3ED5 A;  1X42 A;  3SAF A;  4DOC A;  8ICZ A;  3CRX A;  4MF2 A;  1RG6 A;  3CP8 A;  2H3V A;  2K89 A;  2YMP A;  3PO5 A;  2HW3 A;  4PZO A;  3ISD A;  1QH9 A;  4AYB F;  3RJI A;  4BDP A;  3PX6 A;  1ZRN A;  1X6J A;  1TAQ A;  4ED6 A;  2XY7 A;  3MAB A;  4LZG A;  2JH7 A;  1L7M A;  4PHD A;  2LBO A;  1HJP A;  3ZDB A;  5AI8 A;  5J0W A;  4I2A A;  2F1I A;  2OWO A;  3D2N A;  2FMP A;  1B0X A;  3WK9 A;  1JXL A;  3H7I A;  3QU2 A;  2P35 A;  2HHQ A;  9ICT A;  2WHE A;  9ICH A;  1A6S A;  5D4B A;  2KOB A;  2AGO A;  4UAS A;  4ED2 A;  2ZTD A;  4K4G A;  3FAH A;  1WWV A;  5DB9 A;  4EEY A;  4M2Y A;  1ZD4 A;  1NI3 A; 
#chains in the Genus database with same CATH homology
 5IIK A;  3ZDD A;  2BCS A;  1T7P A;  2KZM A;  4XA5 A;  4UAW A;  3PMN A;  4I2B A;  3MR2 A;  1IXR A;  2ZTC A;  1XSP A;  1U4B A;  4RQ5 A;  3V6K A;  4KIT B;  2NRT A;  3H8J A;  1Z00 B;  5J0U A;  5KFF A;  3Q8M A;  1U47 A;  1X9W A;  5KFX A;  5KG3 A;  3GII A;  1L3V A;  1QSL A;  1ZQN A;  3C1Y A;  2LYH A;  4RQ1 A;  1NK4 A;  4B9L A;  5KFB A;  4P4O A;  4ECT A;  3NGD A;  1N56 A;  3JPQ A;  5KFV A;  3SV3 A;  4J9O A;  4BXO B;  4YXM A;  7ICJ A;  4PHA A;  3BJY A;  4QZC A;  9ICQ A;  5TZV A;  8ICM A;  8ICT A;  3V7J A;  1ZJN A;  4TUR A;  4IQW A;  2J6S A;  3PW7 A;  3UQ0 A;  4XQ8 A;  1ZQB A;  2NRW A;  4ECR A;  1HUO A;  2FLP A;  8ICB A;  4O5C A;  3PNC A;  4QWA A;  4QZ9 A;  3TAP A;  5DB6 A;  5KFY A;  4QW8 A;  4J9M A;  1XO1 A;  4RQ8 A;  1BPX A;  1X9S A;  4C8O A;  4PPX A;  4GXJ A;  1NJZ A;  4FBU A;  4KLG A;  4P4P A;  3EPI A;  3SI8 A;  4QZA A;  4M6W B;  4J9N A;  1MC8 A;  5DB7 A;  4M9H A;  1COO A;  3RJK A;  4Z6D A;  5KFZ A;  4F2S A;  8ICH A;  4TQS A;  4JWM A;  1SL0 A;  4MEX A;  2R8K A;  1ARO P;  4R65 A;  3TAQ A;  5KT7 A;  5EWG A;  9ICU A;  1KFS A;  3MR3 A;  4Q44 A;  8ICF A;  3OHB A;  8ICP A;  4F50 A;  4YN4 A;  4KMU A;  1S0V A;  8ICV A;  3BQT A;  2C2E A;  4MF8 A;  1S76 D;  9ICL A;  1NK6 A;  4TUQ A;  4I27 A;  5CP2 A;  3ZD8 A;  5J2H A;  3UXO A;  4DOA A;  2KFZ A;  4YD1 A;  1UA1 A;  5L1I A;  3RR8 A;  1NJW A;  2BDP A;  1HUZ A;  5L1J A;  4O5E A;  3KHL A;  4DOB A;  3C1Z A;  3ETL A;  4YG2 A;  3G6Y A;  2JEI A;  3Q8P B;  3LDA A;  3ZD9 A;  1X2I A;  1ZQH A;  9ICA A;  4I2J A;  1ZQC A;  5KFP A;  2RDJ A;  4F8R A;  2FLN A;  1MSW D;  3PX4 A;  3GIJ A;  4YCX A;  2M9N A;  1D8L A;  4YR3 A;  4F4X A;  1S97 A;  4ELV A;  1L5U A;  3PW5 A;  2BGW A;  4G3I A;  1JXE A;  4YR0 A;  5J0R A;  4M9G A;  2AGQ A;  5KFA A;  4DSJ A;  2HHS A;  4FS1 A;  4NM2 A;  5KFK A;  4R64 A;  3TI0 A;  3BDP A;  5CR0 A;  5KG1 A;  4ED7 A;  4JUZ A;  5J29 A;  2XCP A;  4ECY A;  5J2G A;  4GXI A;  4ECZ A;  5J2I A;  4DF8 A;  1NJX A;  7ICE A;  1RXV A;  4NLK A;  4RQ2 A;  3SYZ A;  4K4I A;  3K75 D;  5IIL A;  4B9V A;  4IQT A;  1TFR A;  4F5O A;  2ZJA A;  4DL3 A;  4EBE A;  1ZQI A;  2BKE A;  2W9B B;  4ECQ A;  4FBT A;  7ICT A;  7ICF A;  3M9N B;  4QWB A;  3KHH A;  2JEG A;  7ICM A;  8ICE A;  3MBY A;  1L3S A;  8ICO A;  3V72 A;  2ZJ5 A;  3KHG A;  3C2M A;  1ZET A;  7ICV A;  4RQ6 A;  4YMO A;  4YD2 A;  2DPI A;  4M9J A;  3RJE A;  2FPK A;  5DG7 A;  1TKD A;  4O3Q A;  3H8S A;  5J2A A;  1RZT A;  1U9L A;  4RT3 A;  1ZQL A;  2R8G A;  3IHQ B;  1ZQX A;  5BOM A;  4MFC A;  5KG2 A;  3H4D A;  3ZDC A;  2KZ3 A;  4O5K A;  2KFN A;  8ICK A;  4B9N A;  2KN7 A;  1TV9 A;  4KLD A;  4QWC A;  5IIJ A;  4DS5 A;  5KFR A;  3KTQ A;  4M0A A;  4EYI B;  1U49 A;  3ZDE A;  1ZQJ A;  4Q8F A;  1NK5 A;  3MR6 A;  5HHI A;  2H5X A;  3PW2 A;  4UB4 A;  1IM4 A;  5KFW A;  1NOM A;  1XSL A;  1D8Y A;  4JWN A;  7ICG A;  4BGD A;  5DGA A;  5DG8 A;  2W9C A;  2BCV A;  1BPE A;  5L9X A;  4M9N A;  3PX0 A;  5CA7 A;  3GIL A;  1N48 A;  5DDM A;  2P6R A;  1BPY A;  2HHU A;  3C5G A;  2AQ0 A;  4ED0 A;  2FMS A;  2FPL A;  4ED3 A;  2C28 A;  1CEZ A;  3RJJ A;  1B43 A;  3ZDA A;  4MFA A;  3MFH A;  4PHP A;  2VA8 A;  4YMM A;  4QZI A;  3GDX A;  4I2C A;  5KFD A;  5KG0 A;  2R8J A;  4LZD A;  3JPR A;  4F4K A;  4KLO A;  5J0T A;  5KG5 A;  2ZJ8 A;  1JN3 A;  1TK5 A;  2XO7 A;  3PO4 A;  5EOZ A;  1L3T A;  3T5K A;  1T3N A;  2Q0Z X;  4UB3 A;  4TQR A;  3RJH A;  3H40 A;  4J9P A;  1ZQZ A;  2GWS A;  4GC6 A;  4XRH A;  5DBB A;  5J2J A;  1RYR A;  1QLN A;  4GLX A;  2XC9 A;  1KFT A;  1JIH A;  3B0X A;  3M9M B;  4O3N A;  2W9C B;  3TFS A;  4B9T A;  4ZH4 A;  1U48 A;  9ICP A;  1LV5 A;  5HP4 A;  1Y88 A;  2ASL A;  4B9S A;  1ZQP A;  2R8I A;  4UB5 A;  4UAZ A;  4EBD A;  4DL6 A;  1ZQV A;  3EWA A;  4RT2 A;  4M6W A;  5C5J A;  3MDC A;  5L1K A;  4F5R A;  1BPD A;  3QE9 Y;  4JV0 A;  2AQ4 A;  4C8L A;  4YMN A;  8ICX A;  4R63 A;  4KN7 A;  3QEA Z;  2IHN A;  4KLQ A;  4QZH A;  1NJY A;  4DSK A;  3THV A;  3PML A;  4QZE A;  1MQ3 A;  3C5F A;  9ICR A;  4O3O A;  2AGP A;  2BQ3 A;  2FMQ A;  1ZQF A;  5KT6 A;  5HHH A;  2XY6 A;  7ICS A;  2B21 A;  2P6U A;  4HYK A;  3RH6 A;  1ZQG A;  5J0Y A;  4ELU A;  4F5Q A;  4MFF A;  2I1Q A;  9ICN A;  3T5J A;  4ECV A;  4BXO A;  2ASD A;  1K1Q A;  2I9G A;  1SL1 A;  3EW9 A;  2PFN A;  1NK7 A;  5DKW A;  4I2E A;  1DGS A;  2V4R A;  3EPG A;  3GV8 B;  1QTM A;  9ICB A;  1S0M A;  5J2K A;  2Y1I A;  1MQ2 A;  2HHX A;  2BHN A;  4UBB A;  3OGU A;  1SZP A;  5DDY A;  5KFM A;  4Q45 A;  2BPF A;  3QZ8 A;  3T5L A;  3UQ2 A;  2ZUC A;  1ZQR A;  2KTQ A;  4KLH A;  3HP6 A;  1KTQ A;  4IR9 A;  2IMW P;  4KLS A;  4DSL A;  1WCN A;  3HW8 A;  5KG6 A;  4RPZ A;  4JV2 A;  8ICI A;  4J9K A;  1ZJM A;  1UA0 A;  1NKB A;  9ICF A;  1JMS A;  2BR0 A;  4UB1 A;  9ICJ A;  4RQ4 A;  4IQV A;  4DSF A;  7ICQ A;  1NK8 A;  4F2R A;  5DGB A;  3N4M B;  8ICC A;  4DWI A;  4C8M A;  3BQ1 A;  2NRV A;  3RB4 A;  1TK0 A;  2RDI A;  5EWE A;  2IHM A;  5J0S A;  5IIO A;  2BPC A;  4RZR A;  5KFT A;  5J2F A;  4QZB A;  3RBD A;  4JK1 A;  1NK9 A;  5DG9 A;  1JX4 A;  5IIM A;  3V6J A;  1TK8 A;  2PFP A;  4PH5 A;  4P4M A;  3RH5 A;  2IA6 A;  8ICQ A;  4DFJ A;  4KLJ A;  2BPG A;  3OSP A;  4EYH B;  1SKS A;  4DL7 A;  4DSE A;  2HHW A;  1KLN A;  9ICW A;  4DQR A;  4QWE A;  3HWT A;  3V7K A;  2PFO A;  3PVX A;  4FS2 A;  3V7L A;  3E2E A;  9ICM A;  7ICN A;  8ICU A;  3TAR A;  4QZG A;  4ELT A;  3ISC A;  3C2K A;  3RAQ A;  4O3S A;  4F5P A;  3OJS A;  2C2D A;  3LK9 A;  3RJF A;  5CB1 A;  4F92 B;  5F9N A;  3G6V A;  4NLG A;  3IM1 A;  1XC9 A;  1S9F A;  2FLL A;  2J6U A;  4J9S A;  3JPT A;  3M9O B;  1ZYQ A;  4P2H A;  7ICH A;  2V9W A;  4EZ9 A;  1Z3E B;  2NRZ A;  3FDS A;  5CWR A;  1DOQ A;  3B0Y A;  2WTF A;  4IRD A;  3OSN A;  5KT4 A;  9ICG A;  3ORY A;  1A76 A;  4KLM A;  3EYZ A;  4NM1 A;  5D49 A;  2VA2 A;  4DQP A;  3MR5 A;  4RUC A;  2PXI A;  5KFQ A;  3RTV A;  2J6T A;  2JEJ A;  7ICP A;  3H4B A;  2A1J B;  3LWM A;  4RNO A;  4J9L A;  3PR5 B;  1S0O A;  4KLL A;  3NTU A;  8ICR A;  2FPM A;  2W9M A;  3GV7 B;  1NKC A;  5KT2 A;  1KEJ A;  5KFH A;  1V9P A;  4F91 B;  5F9L A;  5DQH A;  4RNN A;  4DL5 A;  3Q8L A;  1UT5 A;  2R8H A;  4M04 A;  4RU9 A;  5DBA A;  3AUO A;  4PHE A;  4QZ8 A;  7ICK A;  3ISB A;  2ATL A;  5IIN A;  1KRP A;  7ICI A;  4RPY A;  1BGX T;  4DQI A;  2F1H A;  3UXN A;  2NRX A;  1D9D A;  4F93 B;  4DL2 A;  9ICI A;  3FYH A;  1NK0 A;  1XU4 A;  4PGX A;  1ZQO A;  4QZF A;  2JEF A;  1H38 A;  5D46 A;  9ICX A;  5KFO A;  1KDH A;  5KFU A;  2W9B A;  8ICN A;  8ICA A;  8ICG A;  4CCH A;  2VA3 A;  4F4Z A;  4DL4 A;  4NXZ A;  4O3P A;  4PGY A;  3RB0 A;  1BPZ A;  3LWL A;  4F3O A;  2ASJ A;  3QZ7 A;  5HMM A;  3MFI A;  3T3F A;  7ICO A;  4NLN A;  3PV8 A;  4TUS A;  4Z6C A;  1Z00 A;  5J2D A;  3H8W A;  5DQG A;  3UXP A;  3PY8 A;  4RQ3 A;  5KG7 A;  4Q8E A;  2V4Q A;  4DQQ A;  4LVS A;  2UVW A;  3RRH A;  2HHV A;  4EBC A;  3TQ1 A;  1QSY A;  3MGI A;  4X5V A;  5L1L A;  3AU6 A;  4NLZ A;  3SZ2 A;  4IQU A;  2PI4 A;  2UVR A;  2XY5 A;  4YP3 A;  2ALZ A;  2XGQ A;  1ZQA A;  4BWM A;  1T8E A;  5HNK A;  1S10 A;  4B9U A;  4KLU A;  4ECW A;  4EZ6 A;  4KLI A;  4IRK A;  3RAX A;  9ICV A;  1XS9 D;  4RQ0 A;  2BCU A;  3UPQ A;  5KT3 A;  5J0Q A;  5J2B A;  4DS4 A;  2HHT A;  1TVA A;  8ICL A;  3RRG A;  1S77 D;  2C2R A;  4J9Q A;  4DFP A;  1KFD A;  1SL2 A;  4YXJ A;  1CUK A;  1ZQW A;  3C21 A;  4Z6E A;  5KFI A;  3EZ5 A;  4DLG A;  2AU0 A;  4YR2 A;  4I29 A;  2HVI A;  5KFC A;  4O3R A;  3OJU A;  4DQS A;  5DLG A;  4FO6 A;  3N97 B;  9ICE A;  8ICW A;  1ZQU A;  5BOL A;  5DBC A;  2XGP A;  1EXN A;  4GC7 A;  3RR7 A;  2UVV A;  4J9R A;  1A77 A;  2W8L A;  3PR4 A;  1RPL A;  4KTQ A;  2ZTE A;  4R8U B;  4KLF A;  2JZB A;  4E0D A;  1BVS A;  4UAY A;  4K4H A;  4KN4 A;  1PZN A;  3GV5 B;  2MUT A;  1QSS A;  4KLT A;  4F5N A;  4ED8 A;  4DFK A;  1RYS A;  2BCR A;  5J0O A;  1SKW A;  4XUS A;  2ZUB A;  4DLE A;  2BQU A;  3RJG A;  4YQW A;  4M9L A;  4DEZ A;  2KZZ A;  1C7Y A;  4I2D A;  1ZQT A;  3JPS A;  1SKR A;  4UB2 A;  3Q8R B;  4UQG A;  2HVH A;  4I2G A;  4RQ7 A;  3GQC A;  5KFE A;  3PW0 A;  1NKE A;  2W9A A;  8ICS A;  7ICL A;  3GIM A;  2DPJ A;  4GXK A;  5III A;  2ISO A;  4I28 A;  4M47 A;  3TFR A;  5HML A;  4R66 A;  1B22 A;  1S0N A;  7ICU A;  3RH4 A;  5KFS A;  3RBE A;  4ECU A;  1UT8 A;  3C23 A;  5KT5 A;  4RPX A;  4I2H A;  4B9M A;  1ZQK A;  3MDA A;  4ECS A;  4DFM A;  4DOC A;  1RXW A;  4C8K A;  8ICZ A;  3V6H A;  4C8N A;  5BPC A;  3BQ0 A;  5KFN A;  3K4G A;  4IR1 A;  4BWJ A;  3OHA A;  3JPP A;  1ZQM A;  3HT3 A;  2MUT B;  2XCA A;  2W8K A;  4MF2 A;  3JPN A;  1WCL A;  3G6X A;  3T5H A;  9ICS A;  2A1J A;  4YVZ A;  4O0I A;  3PO5 A;  2JZB B;  3HPO A;  2HW3 A;  4KLE A;  4R8U A;  3HX0 A;  3ISD A;  2MAX A;  4F4W A;  3AU2 A;  3TAN A;  3BQ2 A;  2BCQ A;  2PI5 A;  3GFK B;  4RUA A;  3RJI A;  2BQR A;  4UBC A;  4BDP A;  1X9M A;  4Z6F A;  1KSP A;  2VAN A;  2IBK A;  4TUP A;  3PX6 A;  5J2E A;  3RB3 A;  9ICK A;  2F1J A;  1TAQ A;  4MEY A;  4ED6 A;  8ICJ A;  2XY7 A;  1K1S A;  1ZQS A;  5CHG A;  2AJQ A;  2ISP A;  4QZD A;  3MGH A;  4ECX A;  3MAB A;  3PW4 A;  3GIK A;  4LZG A;  1U45 A;  3M8R A;  3Q8K A;  4PHD A;  9ICO A;  4ED1 A;  1XWL A;  1HJP A;  3ZDB A;  5J0W A;  2ZUD A;  5DB8 A;  5KG4 A;  4I2A A;  2P66 A;  4DSI A;  1T4G A;  2F1I A;  1ZQQ A;  4Q43 A;  2OWO A;  2FMP A;  3JPO A;  4I2I A;  4NY8 A;  3QEB Z;  1JXL A;  3H7I A;  2DFL A;  2UVU A;  1D9F A;  4PGQ A;  2PFQ A;  1L3U A;  2HHQ A;  4IRC A;  5KFG A;  5KFL A;  4DF4 A;  1ZQD A;  9ICH A;  9ICT A;  1BPB A;  5JUM A;  4QWD A;  3Q8Q B;  5EWF A;  5J0P A;  4DO9 A;  5D4B A;  1XSN A;  4O9M A;  9ICC A;  3C2L A;  2AGO A;  1TAU A;  1LB2 B;  8ICY A;  4K4G A;  5KFJ A;  2ZTD A;  4ED2 A;  7ICR A;  5CJ7 A;  3Q8S B;  3SV4 A;  5DQI A;  4JV1 A;  4YFK A;  5KTQ A;  4I2F A;  2C22 A;  5DB9 A;  3KHR A;  2Y1J A;  1ZQE A;  4QW9 A;  4RNM A;  4EEY A;  5DLF A;  1ZQY A;  3RB6 A;  4F4Y A;  5J2C A;  4M2Y A;  5J0X A;  3M8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...