1Z00A

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00A01
5DBAA 1ZQPA 5KG0A 2FMQA 5KG2A 2J6UA 3MR3A 1ZQLA 4Q43A 9ICNA 4DF8A 1TFRA 4F5QA 1A76A 1ZQYA 4Z6DA 5KFUA 1NJXA 5J0WA 4I2BA 2HHVA 3V6HA 5DGBA 4XQ8A 4Q45A 2FPKA 1JMSA 3LWMA 4RZRA 2AGOA 3Q8KA 1X9WA 4G3IA 1ZQNA 4M2YA 4M6WB 1S9FA 4QW8A 1IXRA 1RXWA 4Z6EA 1U4BA 5DBBA 2XCPA 3PX0A 5KFZA 4F5NA 2R8IA 5BOMA 3LK9A 3HP6A 5DB7A 2FPMA 4P2HA 4RQ7A 3RJKA 3RB6A 9ICWA 2ZUCA 7ICGA 3NTUA 3QEBZ 4B9SA 2ZTEA 4KLUA 3QZ7A 4BWMA 4M47A 3H4BA 4NM1A 4GXIA 1XO1A 3C5GA 2XY5A 2ASDA 4DF4A 1LV5A 7ICUA 4DQRA 3RR8A 4KLOA 4C8KA 1U49A 1ZQOA 1ZQXA 3JPTA 3IHQB 4BDPA 2FLLA 4ECSA 4DL2A 9ICSA 4KLEA 4Q44A 2BHNA 4J9OA 4NY8A 4RQ5A 8ICVA 5J29A 4O3NA 5HHHA 2HHTA 4PPXA 3H40A 3MGIA 3C5FA 3C1YA 4ECZA 3TQ1A 1ZQTA 4MF2A 4QWEA 2XC9A 5J2HA 1D9FA 4PHDA 4QZ9A 4ED1A 4ELTA 4M9LA 4DFJA 2ZJAA 3UXNA 5CA7A 5KT6A 3PNCA 3N4MB 8ICZA 4MFCA 1ZQGA 1ZQSA 4Z6FA 2H5XA 5HMLA 2KN7A 5D4BA 4RNMA 5DDMA 3HT3A 1ZQAA 2FLNA 1XU4A 4EYHB 2R8HA 4EEYA 1MQ2A 4RT2A 2W9AA 4EYIB 4QZAA 8ICQA 1SKWA 4R66A 1KFSA 5HHIA 5IINA 2R8GA 3AUOA 4FS2A 3ISDA 9ICXA 2KZMA 5CJ7A 4M9NA 3AU2A 3PW4A 3ORYA 3TARA 2PFPA 1UT5A 1RPLA 3G6XA 4O5CA 1JIHA 4RQ8A 4J9NA 4F5PA 3V6KA 1NJZA 5J0TA 4J9MA 4DSIA 1K1QA 2NRWA 1B43A 3RB0A 4Q8FA 4K4HA 1JN3A 4CCHA 9ICRA 2LYHA 5EWGA 8ICSA 4IRCA 4J9PA 1U48A 9ICIA 4RQ1A 5EWEA 2HHUA 3OJSA 3PO5A 2UVUA 4M6WA 3UXPA 4JK1A 3T3FA 1L3TA 5CWRA 4UB4A 2UVWA 2UVVA 1CEZA 1TAQA 5EOZA 3V7KA 4PGQA 1UA0A 2BPCA 3KHGA 5L1JA 3RRHA 2VA2A 5KFMA 3UQ2A 5BOLA 2HHQA 4KN7A 4UB5A 4F4KA 9ICKA 3JPRA 4UBCA 2ZJ5A 3SZ2A 1ZQEA 4IQWA 5DKWA 1RYSA 4IR9A 7ICMA 4C8LA 4E0DA 9ICAA 8ICLA 4DSKA 1HUOA 4B9VA 3PO4A 4YXMA 5KFSA 5J2BA 4BGDA 2F1HA 1TKDA 4NXZA 1BPYA 3ZD9A 4MF8A 2ISPA 1DGSA 2RDIA 2B21A 2C2DA 2ZUDA 4YR2A 3RTVA 1Z3EB 1U45A 1D8YA 3EYZA 3HWTA 2XY6A 9ICFA 5KFKA 5J2DA 3UPQA 3T5KA 1HUZA 3Q8RB 1RYRA 5KFTA 3RJFA 4KLDA 4I28A 2W9MA 2C22A 3RB4A 4Q8EA 4LVSA 2BCUA 5KT3A 1QSSA 4F4YA 3RR7A 4KLIA 4KLQA 7ICEA 4ECQA 2HHSA 7ICVA 4DLGA 3PR4A 4QZHA 2IA6A 3EW9A 3MFHA 1COOA 4J9SA 2ALZA 5L9XA 4DQQA 3H4DA 1L3VA 1ZQKA 2NRTA 2V9WA 1DOQA 1V9PA 3Q8SB 3FYHA 4KITB 5DB9A 5L1IA 4J9KA 7ICRA 1Y88A 4IQUA 3V6JA 2NRXA 2PFOA 4RUCA 1IM4A 2VA3A 4PHAA 4I2FA 3C1ZA 5F9NA 4BXOB 2MUTA 4ED6A 1D9DA 5DG9A 5KT7A 4UB3A 4F4ZA 1SKRA 2UVRA 5J0OA 2FMPA 1XS9D 3SYZA 1L5UA 4NLGA 3ZDCA 2I1QA 2HVHA 2J6TA 5J0QA 5DDYA 5KFPA 4QWDA 3RJEA 3JPPA 3GIJA 5HMMA 1SL1A 3ZDDA 2BCRA 3TI0A 5KFWA 4XUSA 5DB6A 3HX0A 4RPXA 3BJYA 1KTQA 8ICUA 7ICJA 5KG3A 3UXOA 3ISCA 2F1JA 3LDAA 2V4QA 4P4MA 2BPFA 3GV8B 9ICBA 1ZQFA 4YR0A 4QWCA 3GV7B 4JV1A 3T5JA 3BQTA 3PMLA 1U47A 1T8EA 4PGXA 4DL3A 2JZBB 2BQUA 2A1JA 1X9SA 3OSPA 4B9LA 3MBYA 4ECVA 3TAQA 7ICFA 4KN4A 1NK9A 1ZQIA 1XWLA 4GXKA 5J2CA 3M8RA 3C2KA 3RH6A 1QSYA 4RNNA 2I9GA 1TAUA 5J0RA 2XCAA 4KMUA 1KEJA 4XA5A 3BDPA 1LB2B 5DBCA 3RJHA 4FBTA 4KLGA 3K4GA 4JWMA 2KTQA 4YMMA 4EBEA 4I2GA 4XRHA 8ICRA 8ICFA 2R8KA 1XSLA 5L1LA 2ZTCA 4NLKA 4O0IA 8ICIA 4F92B 3KTQA 4QZEA 2F1IA 1NK4A 2Y1IA 5KG1A 2IHNA 5KFCA 1BPZA 2DPIA 2AQ0A 3RJGA 1BVSA 9ICLA 4DO9A 5IILA 3OHAA 2XY7A 2JEFA 4MFFA 3RAXA 3TANA 2IMWP 4YD1A 2XGPA 3TFSA 2VA8A 4M9JA 7ICIA 3SI8A 2P66A 4DSEA 8ICTA 4JWNA 5J2AA 4I29A 4O3OA 3PX4A 9ICUA 5IIIA 1KFTA 3LWLA 4KLFA 1HJPA 1ZQJA 4QWBA 4ED3A 4RUAA 3EPIA 5D46A 3QEAZ 5KG6A 4O3SA 2C2RA 4C8OA 2AGPA 1ZQMA 2JEGA 1RZTA 4ED7A 1NJYA 2W9BB 4YMNA 3RBEA 4EZ6A 2KFNA 4QZCA 2PXIA 2W9BA 9ICVA 4I2EA 5J2FA 3T5LA 1ZQDA 1S0MA 5J2GA 4GXJA 1XSPA 4TURA 4X5VA 4I2HA 3C2MA 3H8SA 8ICAA 7ICSA 3NGDA 3V7LA 4QZGA 2ASJA 4DWIA 1S97A 2BCSA 4UAYA 3PY8A 5HP4A 2ZUBA 3IM1A 4DOBA 3PW7A 4KLMA 3EPGA 5J0XA 2ISOA 1ZJMA 4O3RA 4JV0A 1NK8A 8ICGA 2AGQA 3V7JA 2JZBA 5KFQA 4YVZA 4UAWA 4MFAA 3PMNA 1A77A 1ZETA 4EBDA 2WTFA 2BQRA 4ED0A 1XSNA 1PZNA 3OHBA 1NK5A 1KDHA 5J2KA 2FPLA 1KFDA 1JX4A 4FS1A 5D49A 3BQ2A 4P4PA 5KT4A 5KFXA 3Q8MA 4LZGA 4YCXA 4RU9A 2MAXA 5DQIA 4QZIA 3GIKA 3G6YA 2W8LA 4ECYA 3RJIA 1ZJNA 1S10A 9ICOA 4DQPA 2AU0A 3G6VA 8ICYA 5DQGA 4QW9A 5KT5A 1S76D 8ICCA 2W9CB 3BQ0A 3MDAA 1BPXA 4DS4A 2FMSA 4I2AA 4O5EA 4R63A 4ECRA 2AQ4A 2DFLA 4UBBA 4M0AA 4RQ3A 4DS5A 1AROP 4QZFA 5JUMA 4RPYA 4DQIA 4O3QA 3THVA 3RAQA 4F50A 4IR1A 4KLLA 4DL5A 4M04A 3MFIA 5J0UA 4RNOA 4RPZA 4C8NA 4ECUA 1C7YA 3SV4A 3TAPA 1BPBA 3Q8PB 4ED8A 1L3UA 2BKEA 5DB8A 1NKEA 8ICNA 3C23A 4P4OA 3M9OB 4J9RA 7ICTA 3GILA 5J0SA 8ICPA 5J2EA 3TFRA 4M9HA 1XC9A 5DLGA 4ECTA 2C2EA 1ZQRA 1ZQHA 3ZDEA 3PV8A 1TK8A 1ZQVA 3MGHA 1T3NA 1SL0A 4YD2A 2KZ3A 1KLNA 3ZDAA 4HYKA 1WCLA 3ZD8A 1B22A 4IQVA 3K75D 4K4GA 4QZ8A 4GC6A 4ED2A 3HPOA 3RJJA 4M9GA 1ZQBA 3N97B 1EXNA 4UAZA 4UB2A 2JEJA 2HHXA 3H8WA 4JV2A 4DFPA 2XO7A 2AJQA 1Z00B 3M8SA 4I27A 4I2IA 2NRVA 5J2JA 4IQTA 3HW8A 5L1KA 4J9QA 4GC7A 1QTMA 1S0VA 3JPOA 1MQ3A 4FO6A 4MEYA 4F5RA 4LZDA 4I2JA 4R65A 3GIMA 2Q0ZX 1TK5A 2W9CA 4F8RA 5KFDA 2V4RA 2ZTDA 2BCVA 4I2CA 4KLJA 8ICMA 9ICGA 4YR3A 4PGYA 4DOAA 5KFGA 3OSNA 4NM2A 4R8UA 5KFVA 5DG8A 4B9TA 5TZVA 5C5JA 2W8KA 5CB1A 1L3SA 4DL7A 2JEIA 5KFFA 5KG4A 4B9UA 4EBCA 8ICOA 4TQSA 2DPJA 4YMOA 1MC8A 4DFMA 2P6RA 4ELVA 3JPNA 2BGWA 5KFEA 4ECWA 1UA1A 4DSLA 3KHRA 3AU6A 3Q8LA 2P6UA 3BQ1A 2PI4A 3H8JA 7ICNA 2ATLA 4ELUA 4UB1A 4DFKA 4B9NA 4YN4A 1JXEA 1BPDA 4F4XA 5DQHA 5HNKA 3GV5B 5CP2A 1K1SA 1ZQZA 4R8UB 1X9MA 1ZQQA 1S0OA 1CUKA 3PR5B 1NKBA 1JXLA 4F2RA 4PHEA 2PFNA 2KFZA 5KT2A 3ZDBA 3B0YA 3SV3A 7ICHA 3RBDA 1ZQCA 2OWOA 4JUZA 3PW5A 4YP3A 2HW3A 3GIIA 4UQGA 1TV9A 2BPGA 8ICHA 4YXJA 3PX6A 9ICTA 4YFKA 4QZBA 3M9MB 3ISBA 5KFNA 5EWFA 4PHPA 3MDCA 5KFLA 1BPEA 2BQ3A 3RH4A 4KLSA 3GDXA 1T7PA 2ASLA 2PFQA 9ICCA 5KTQA 8ICXA 5DLFA 4NLZA 9ICJA 2BR0A 5J0PA 3KHLA 3M9NB 3C2LA 1H38A 8ICJA 3Q8QB 3KHHA 2M9NA 3C21A 2Y1JA 5KFYA 1ZQUA 1WCNA 4BWJA 4DSJA 3PW2A 3PW0A 1NOMA 9ICMA 4YQWA 4KLHA 3PVXA 4DL4A 5KG7A 9ICHA 4C8MA 3QZ8A 3GQCA 3RRGA 4F4WA 3OJUA 1NK7A 2J6SA 4RT3A 4ECXA 2RDJA 7ICQA 4EZ9A 3UQ0A 4Z6CA 3ETLA 2ZJ8A 8ICEA 5IIJA 1RXVA 4MEXA 2BCQA 8ICWA 4DL6A 4IRKA 4O5KA 5BPCA 3OGUA 2HHWA 3H7IA 5KFOA 3MR5A 2PI5A 5KFJA 4RQ2A 9ICPA 1D8LA 1U9LA 5CHGA 1NK0A 2VANA 3MABA 4O3PA 5J0YA 3RB3A 5KFAA 3V72A 1S0NA 2GWSA 4F93B 5DG7A 4DEZA 3EZ5A 4KTQA 9ICQA 2IBKA 2C28A 4NLNA 5IIOA 4K4IA 4TUSA 3E2EA 2MUTB 4F2SA 1X2IA 1ZQWA 3JPSA 1NJWA 4PH5A 3T5HA 4DLEA 1NKCA 4TUQA 5IIKA 1TVAA 2NRZA 1NK6A 7ICKA 4QWAA 1QLNA 4TQRA 3JPQA 5J2IA 4BXOA 3EWAA 1T4GA 4DOCA 4F91B 2XGQA 4KLTA 8ICKA 1Z00A 3RH5A 7ICOA 4QZDA 2FLPA 4TUPA 4DQSA 5KFIA 4F3OA 1S77D 1UT8A 3GFKB 4J9LA 5DGAA 4O9MA 1SZPA 2IHMA 4RQ4A 4ZH4A 4RQ6A 5KFBA 5KFRA 5IIMA 3MR2A 1SL2A 9ICEA 1QSLA 4IRDA 2R8JA 5KG5A 1KSPA 4R64A 2KZZA 2BDPA 5KFHA 8ICBA 5CR0A 4F5OA 1TK0A 7ICPA 3MR6A 1MSWD 1BGXT 4YG2A 4I2DA 1KRPA 3B0XA 4DSFA 1N56A 1ZYQA 4FBUA 3FDSA 7ICLA 4RQ0A 4GLXA 2A1JB 3QE9Y 1SKSA 1N48A 2HVIA 5F9LA 4B9MA
chains in the Genus database with same CATH superfamily
5KG0A 3MR3A 9ICNA 4Q43A 4F5QA 5AIAA 3AQEA 5J0WA 3QX7A 3V6HA 4UARA 4XQ8A 1S5LU 1S9FA 1IXRA 3UM9A 4Z6EA 1U4BA 4OJOA 4F5NA 5BOMA 5DB7A 4LJXA 2YB1A 2ZTEA 3QZ7A 4BWMA 2K4EA 2KJ8A 3C5GA 3RR8A 4C8KA 1U49A 3N28A 2WF5A 4ECSA 9ICSA 4Q44A 4J9OA 3KKAA 2HHTA 2HSZA 5AM5A 5AKLA 1QQ6A 3TQ1A 5HR6A 1ZQTA 4MF2A 2XC9A 4PHDA 3PSFA 3VCBA 1NI3A 5KT6A 1ZQGA 4Z6FA 2H5XA 2FLNA 1ECWA 1ZQ1C 2W9AA 4QZAA 2HBJA 3MC1A 2WB1C 2R8GA 2NYVA 5CJ7A 2YX8A 3ORYA 3TARA 4OCZA 1UT5A 2EDUA 4O5CA 3V6KA 1Q8KA 4RQ8A 4C7ZA 2WAQC 1KQQA 3L3FX 9ICRA 3BZKA 2G06A 1U48A 9ICIA 2HHUA 2XICA 2UVUA 5CWRA 1TAQA 3KHGA 4UB5A 9ICKA 4IQWA 2HMXA 5DKWA 4IR9A 7ICMA 4E0DA 5ALTA 1IV8A 1WG8A 4YXMA 5KFSA 1TKDA 2Y0SF 4NXZA 3ZD9A 2ES6A 1D8YA 2XY6A 5J2DA 3M6ZA 3Q8RB 2G5IB 5KFTA 4Y2UA 5KT3A 3RR7A 2K8BB 3MFHA 1N61A 4J9SA 3H4DA 3F5AA 2I5HA 1DOQA 4KITB 3F5EA 2VA3A 2BDUA 3C1ZA 2E1EA 5F9NA 4BXOB 5DG9A 2WF8A 5KT7A 4UB3A 4F4ZA 1QH9A 5J0OA 1ZRMA 1XS9D 1QQ7A 3SYZA 1PVPA 3ZDCA 2I1QA 3FC4A 4RQMA 2ZIVB 3JPPA 3GIJA 2HCFA 2F1JA 2BPFA 9ICBA 2BZFA 4QWCA 3GV7B 3T5JA 2BQUA 1X9SA 2A1JA 5AK4A 4ECVA 5T14A 3RH6A 4RNNA 2I9GA 2G09A 2I6XA 5ALJA 3K4GA 3B9JA 2R8KA 5L1LA 3KTQA 5KG1A 2IHNA 3IV6A 4Y2TA 2KP7A 2XY7A 2IMWP 3TANA 5ALVA 7ICIA 5AI4A 5J2AA 1DXSA 4KLFA 4QWBA 2RHFA 3EPIA 5D46A 4ED7A 2W9BB 5AKIA 2F77X 3NVWA 5L1MA 2LKYA 3T5LA 2KSOB 3F2BA 5J2GA 4GXJA 4I2HA 3H8SA 3V7LA 1L7OA 2ZUBA 3PW7A 4KLMA 3EPGA 5J0XA 2ISOA 3KKAC 3J81j 1A77A 2WTFA 1PZNA 1KDHA 2FPLA 1KFDA 5AM0A 2E3TA 4FS1A 3BQ2A 3KD3A 2YTUA 2MAXA 1ZJNA 4ECYA 4GIBA 3QU4A 2W04A 5KT5A 8ICCA 5EE0A 2W9CB 3MDAA 1C20A 2FJ6A 4R63A 2KVSA 5AM3A 4QZFA 4DQIA 3THVA 4F50A 4M04A 3MFIA 5J0UA 3E58A 4ECUA 1RM6C 1C7YA 2EZZA 2MA1A 4J9RA 1YZ7A 3SAFA 3H0LB 3WKDA 4M9HA 4P0PA 3ZDAA 2KZ3A 3K75D 1UPHA 3RJJA 1ZQBA 3N97B 3BS7A 4DFPA 1Z00B 3WK4A 4UB6U 2NRVA 5J2JA 4J9QA 1QTMA 1TK5A 1ED1A 4YR3A 4NL9A 4PGYA 3TACB 3OSNA 4B9TA 5C5JA 1L3SA 2KV2A 4YMOA 3KZXA 2P6RA 1VJ5A 4CNQA 3M7DA 2ATLA 2PMZC 2H3IA 5ALSA 4UB1A 4DFKA 4B9NA 3UMGA 1S0OA 1X66A 1NKBA 2PFNA 5KT2A 3SV3A 3RBDA 5J8YA 3GIIA 4UQGA 2BPGA 3BQ7A 5JU5A 2YN4A 3PX6A 5AI5A 9ICTA 2K4PA 3HKZC 3ISBA 5KFNA 2KG5A 5EWFA 3MDCA 3CYMA 1T7PA 2ASLA 1H38A 5AKYA 2Y1JA 1ZQUA 1WCNA 4YQWA 4Y2PA 3PVXA 9ICHA 2RP5A 3QZ8A 3R9KA 3GQCA 3RRGA 1NK7A 3ED5A 1SWWA 2MRLA 3UQ0A 2VJ5A 4WJ3B 1PVQA 1RXVA 2QKQA 3H7IA 5J0YA 4O3PA 2XVTA 1QCKA 5AIBA 1DK3A 3NUQA 4KTQA 2C28A 4NLNA 4UASA 4TUSA 4J03A 1RYUA 1CRXA 3JPSA 4DLEA 1TVAA 2JH1A 3JPQA 8ICKA 2G0AA 2WF7A 4TUPA 4DQSA 1UT8A 4O9MA 4ZH4A 4RQ4A 1SL2A 5KG5A 3N7RC 4R64A 4F5OA 1MSWD 2WAQF 4YG2A 4I2DA 1KW4A 4UW9A 2DGZA 3FDSA 2A1JB 5F9LA 4B9MA 5DBAA 2FMQA 2E8NA 4CF5A 1A76A 1NJXA 4PL2A 2KIVA 2FPKA 1JMSA 2HBKA 5ALQA 4M6WB 4QW8A 5AI6A 2Q4TA 3TADC 5DBBA 4OO1J 5KFZA 2R8IA 3NVVA 3HP6A 2IOFK 3H0RB 2ZUCA 3NTUA 4M47A 1XO1A 2ASDA 1LV5A 4DF4A 2DUYA 2F3NA 2ESEA 1ZQXA 4NY8A 2BHNA 1Z4OA 1Z4NA 3C1YA 3AM9A 1RDFA 4QWEA 1D9FA 5AK5A 4ELTA 2ZJAA 3UXNA 5CA7A 1SXEA 5AICA 4RNMA 3IDWA 5DDMA 3HT3A 3LYSA 4RT2A 3DV9A 3A0BU 3AUOA 2ZG6A 3SMVA 3AU2A 3PW4A 3QUCA 1ZD5A 3G6XA 4IL6U 2JV3A 2CRXA 4KX3A 4F5PA 4J9NA 4DSIA 5J0TA 1K1QA 2F76X 2Y9TA 4FZNA 1KBUA 4CCHA 5AM2A 8ICSA 3OPXA 2OXOA 1SV0A 4C80A 5G5GA 3OJSA 2H3ZA 4Y2SA 5AKJA 3PO5A 4JK1A 5EOZA 2GOLA 3ZI4A 3UQ2A 4KN7A 4F4KA 9ICAA 8ICLA 1HUOA 4C0ZA 5AI0A 2ISPA 2RLTA 4NLCA 4YR2A 1Z3EB 3EYZA 2LM1A 3HWTA 5KFKA 3T5KA 1HUZA 4I28A 2W9MA 2C22A 3RB4A 4LVSA 2W03A 4ECQA 2HHSA 4DLGA 3EW9A 1ZQKA 1L3VA 2V9WA 2K4IA 2FDRA 3FYHA 5L1IA 1Z1BA 3V6JA 1ZOLA 2NRXA 4RUCA 3PZPA 2PFOA 3NASA 5KL8B 1D9DA 3D6JA 3QUBA 3IN5A 5J0QA 3RJEA 5KFPA 3QUQA 1SL1A 2BCRA 2VJ4A 2JXJA 4XUSA 4CDGA 8ICUA 1O03A 7ICJA 5KG3A 2W3SA 3LDAA 2IOHA 1V97A 4P4MA 5ALKA 4KX5A 2HBLA 4OJ6A 3PMLA 4PGXA 2JZBB 3OSPA 3WK7A 1NK9A 1ZQIA 3WU2U 3WK8A 2W54A 3M8RA 3NRZA 3WKAA 5J0RA 4EENA 1KEJA 5DBCA 1FFVA 4FBTA 1J2MA 4JWMA 2KTQA 1RQNA 4EBEA 1TAMA 4I2GA 2P35A 1XSLA 4O0IA 3PSTA 4QZEA 2F1IA 2Y1IA 2ZXIA 1DRGA 1SZHA 2DPIA 3RJGA 1BVSA 5IILA 1CI4A 2JRZA 4PZOA 2XGPA 8ICTA 2VA8A 3AMZA 4M9JA 3NRWA 4I29A 4O3OA 4AP9A 9ICUA 3C29A 4RQNA 3M1YA 4O3SA 3TADA 5ALMA 2JEGA 3SENA 3RBEA 4US9A 2W7PA 2PXIA 3GZFA 5J2FA 5GTHU 4X5VA 1UHUA 4QZGA 2MSNA 2BCSA 1PVRA 3IM1A 3V7JA 2QB1A 2JZBA 4YVZA 4UAWA 1XSNA 1B4FA 3CP8A 3ETRA 2F44A 1COKA 1X9XA 5D49A 3WK9A 5KT4A 5KFXA 2HOIA 4RU9A 2IOFA 3GIKA 2H3FA 5B5EU 9ICOA 2VIXA 5DQGA 4QW9A 1BPXA 4P0QB 3I28A 2AQ4A 4RQ3A 2JHDA 4C8NA 3SV4A 1BPBA 3GILA 3TKAA 5J2EA 1ZD4A 3UMBA 2C2EA 3ZDEA 4HAIA 1TK8A 3MGHA 1SL0A 1WCLA 1B22A 1JROA 4ED2A 4B6JA 3HPOA 4M9GA 4UAZA 4I27A 5L1KA 4I2IA 4GC7A 3HW8A 4IQTA 1Q3VA 4Y2VA 3NVYA 5EE9A 4R65A 1PUZA 4O3MA 3GIMA 2V4RA 4DOAA 4IS7A 5KFGA 2WF6A 4NM2A 4R8UA 1ZRNA 4G9BA 4AYBC 2QLTA 4EBCA 4C4TA 1MA7A 3JPNA 1UA1A 4ECWA 4GFJA 3AU6A 2W3RA 2P6UA 3BQ1A 5EE1A 4DFDA 2G07A 2EZXA 3GU3A 1JXEA 2E8MA 3GV5B 1X9MA 5CP2A 1K1SA 3F2DA 1CUKA 1JXLA 5FP0A 4PHEA 5G5HA 2KFZA 3ZDBA 1J97A 3BS5A 2OWOA 4JUZA 4YP3A 4YXJA 1FFUA 5AKXA 2O6KA 2QB0A 2KNJA 4QZBA 3M9MB 1N62A 4ICAA 1V85A 5KFLA 1WUDA 9ICCA 2PFQA 5KTQA 1K5OA 2BR0A 8ICJA 3KZIU 3RF9A 3KHHA 2M9NA 1FO4A 1B0XA 2HOFA 4BWJA 3PW0A 1NOMA 9ICMA 3CNHA 2WB1F 4F4WA 4RT3A 4ECXA 2RDJA 4UB8U 1IG6A 3ETLA 2M0NA 8ICEA 1URJA 4CE6A 4DL6A 5BPCA 3OGUA 3AL0B 5KFOA 5KFJA 9ICPA 1U9LA 1HEKA 4PL1A 5KFAA 4F93B 1N2XA 4DEZA 3EZ5A 9ICQA 4K4IA 4F2SA 1NJWA 3T5HA 1NK6A 5IIKA 7ICKA 1S8OA 1F0MA 1Q46A 1T4GA 4F91B 4KLTA 5ALWA 5KAFU 2YMLA 5KFIA 3GFKB 2IHMA 5KFRA 5IIMA 3MR2A 4IRDA 1BNPA 3A0HU 1KSPA 2KZZA 2BDPA 8ICBA 5CR0A 1BGXT 4DSFA 4EX7A 1SKSA 1N48A 3D2NA 1J2NA 2J6UA 4DF8A 1ZQYA 4Z6DA 5KFUA 4Q45A 1HIWA 2AGOA 1L7NA 2NV3A 4G3IA 2W7OA 4M2YA 1UQVA 3HKZF 2XCPA 1T94A 3LK9A 4P2HA 3IG8A 5ALPA 4B9SA 2H3VA 5F3XB 3H4BA 4NM1A 2LM4A 7ICUA 2XY5A 3QXGA 3ONNA 4DQRA 4KLOA 2Y9UA 2FLLA 4DL2A 2EAMA 4KLEA 2ZIVA 2LPEA 1FEZA 3H40A 4PPXA 3MGIA 5ALGA 5J2HA 4QZ9A 4ED1A 4M9LA 4DFJA 8ICZA 4MFCA 3D2SA 2KN7A 5HMLA 1ZQAA 3I76A 5ALHA 1XU4A 4EEYA 4EYIB 8ICQA 1SKWA 4R66A 1KFSA 9ICXA 3K1RB 4KMOB 2K89A 2OYYA 1MN8A 2YMQA 1JIHA 2GO7A 5AKEA 1NJZA 4J9MA 3KFUF 2E8OA 4Q8FA 4K4HA 2LYHA 2EAPA 1L7MA 4J9PA 4RQ1A 3UXPA 1L3TA 4UAUA 1CEZA 2BPCA 2LHTA 5L1JA 3RRHA 4DCCA 2HHQA 2K8AA 4US8A 2ZJ5A 3PSIA 2JGAA 3H0MB 4C8LA 4DSKA 4Y2RA 4MF8A 1DGSA 2RDIA 1U45A 2ZUDA 3RTVA 9ICFA 3N7PD 1ZD2P 1X40A 1RYRA 3RJFA 4NL9C 3FAHA 2WF9A 5AK6A 5GTIU 1QSSA 2H3QA 7ICVA 3PR4A 4QZHA 2IA6A 2ALZA 1COOA 4DQQA 2NRTA 2KSOA 3Q8SB 5DB9A 1WYGA 1Y88A 3QU5A 2F8KA 1IM4A 4PHAA 2PKEA 2ZIUB 4EX6A 2MUTA 1SKRA 4FZLA 2UVRA 2FMPA 2EQYA 4NWIA 4NLGA 1L5UA 3AEVA 2J6TA 2Y0SC 5DDYA 4EELA 3ZDDA 4QJFB 3WK6A 5KFWA 5DB6A 3BJYA 2V4QA 1DGJA 4YR0A 4JV1A 2KVCA 4DL3A 4B9LA 3MBYA 1XWLA 4GXKA 5J2CA 1QSYA 3S6JA 2E1FA 4KMUA 5ALRA 3BDPA 1X6IA 4PZNA 3RJHA 2F2AB 5AHXA 8ICFA 4NJ8A 4NLKA 2ZTCA 8ICIA 4F92B 5KAIU 1Q3UA 2KKPA 5JTIA 9ICLA 5ALLA 3OHAA 2JEFA 3RAXA 4YD1A 3SI8A 2HI0A 3BS5B 5IIIA 3LWLA 1ZQJA 4RUAA 4Y2YA 2C2RA 1D8BA 4C8OA 1RZTA 2HOQA 4EZ6A 5CEHA 2KFNA 4I2EA 1LKYA 1S0MA 8ICAA 3NGDA 4DWIA 1S97A 3PY8A 4C7YA 4O3RA 3L5KA 1ZJMA 8ICGA 2A19A 5KFQA 3L4PA 1PK3A 4MFAA 3PMNA 1ZETA 2BQRA 2ZIUA 4ED0A 3OHBA 1NK5A 5J2KA 1JUDA 3QNMA 4YCXA 2W8LA 5EE3A 1S10A 1PK1A 2PMZF 4DQPA 2EANA 1S76D 4CF3A 4DS4A 2FMSA 4I2AA 4O5EA 3U26A 2CXYA 4UBBA 4M0AA 4DS5A 4QIWC 1AROP 3PSPA 5JUMA 4O3QA 4KLLA 4DL5A 3Q8PB 4ED8A 5K4LA 1NKEA 8ICNA 3C23A 1O08A 1L7PA 2W43A 3TFRA 3NVZA 1XC9A 4ECTA 1ZQRA 1ZQHA 3PV8A 1ZQVA 4CRXA 1KLNA 4IQVA 3OTQA 4QZ8A 4GC6A 4CF4A 1T3QA 5ALXA 1WWUA 4UB2A 2JEJA 3H8WA 4JV2A 2XO7A 2AJQA 1S0VA 2MU2A 1VDVA 2QB0B 1MQ3A 3WKCA 4PJ0U 4FO6A 4F5RA 4I2JA 2YQEA 2KEYA 2Q0ZX 2W9CA 4I2CA 2ZTDA 9ICGA 8ICMA 2AHOB 5TZVA 2W8KA 3AN1A 4MHVA 4DL7A 4B9UA 5J8YC 1JI7A 1ZD3A 4TQSA 1MC8A 2KICA 4DFMA 4ELVA 5KFEA 4DSLA 3Q8LA 1X6JA 2N1RA 1F44A 4YN4A 1FIQA 1ZQQA 2EH9A 4R8UB 3WKBA 4F2RA 1SV4A 2L5YA 3B0YA 1ZQCA 1TV9A 2ZXHA 8ICHA 4YFKA 2R18A 4PHPA 5ALZA 3F53A 1BPEA 4KLSA 8ICXA 5J0PA 3C2LA 2XIDA 5KFYA 3N7SC 5KG7A 4C8MA 3OJUA 2YB4A 4EZ9A 5ALDA 5IIJA 4MEXA 2BCQA 4O5KA 2HHWA 2PI5A 4RQ2A 1IIPA 2VKQA 2VANA 1S0NA 2LBOA 5DG7A 2IBKA 3E2EA 3FM9A 2MUTB 3EUB2 4QWAA 4BXOA 3QU7A 4QZDA 5AKGA 4F72A 4J9LA 1SZPA 2WFAA 3M6KA 9ICEA 1QSLA 1TK0A 7ICPA 3ICXA 1TE2A 3K1ZA 3B0XA 1N56A 1ZYQA 4FBUA 4RQ0A 3QE9Y 2WHEA 3NS1A 1ZQPA 2JMGA 5KG2A 1ZQLA 1TFRA 2JR5A 2KHQA 4I2BA 2HHVA 5DGBA 2E5SA 2OEHA 3LWMA 4RZRA 2ODGA 3Q8KA 1X9WA 1ZQNA 1RXWA 3PX0A 2FPMA 2LI6A 4RQ7A 3RJKA 3RB6A 9ICWA 7ICGA 3QEBZ 4KLUA 4GXIA 4NLBA 1ZQOA 3JPTA 3IHQB 2KE7A 2HBMA 4BDPA 1KN5A 4BX9C 4EEKA 3RFAA 5ALNA 2LYBA 4RQ5A 8ICVA 1A0PA 5J29A 4O3NA 5HHHA 3C5FA 4ECZA 5AKZA 1Z19A 4BJQA 3PNCA 3N4MB 2A3VA 1ZQSA 2KJ9A 5D4BA 2HDOA 1L8LA 4EYHB 2R8HA 1MQ2A 1JRPA 1QQ5A 5ALEA 3UMCA 5HHIA 5IINA 4FS2A 1AQ6A 3ISDA 2KZMA 2D8CA 4M9NA 1VLBA 4BUGA 4C4RA 2PFPA 3O0FA 1M6YA 2XI9A 1RPLA 1N5XA 5ALIA 2FE9A 2NRWA 1B43A 3I1YA 1SB3C 3RB0A 3C28A 1JN3A 4JB3A 5EWGA 2DL0A 4IRCA 1JALA 4ZOHC 5EWEA 5HR7A 4M6WA 3T3FA 4UB4A 2UVWA 2UVVA 3V7KA 1UA0A 4PGQA 2VA2A 5KFMA 5BOLA 3JPRA 4UBCA 3SZ2A 1ZQEA 2DKZA 3WKEA 1L8OA 1RYSA 1BNOA 2KOBA 4B9VA 1NZPA 3PO4A 3ALRA 5J2BA 4BGDA 4JMUA 2F1HA 1BPYA 1P7DA 1SWVA 1LVHA 2B21A 5ALYA 2C2DA 3T79A 1YT3A 3UPQA 2LMRA 4KLDA 5AKKA 4Q8EA 3H8MA 2BCUA 4KLIA 4F4YA 4KLQA 7ICEA 2QARA 2Z7JA 5L9XA 2ZIWA 1V9PA 4J9KA 1KL9A 7ICRA 1V38A 4IQUA 2F8LA 3SQIA 2LYAA 4I2FA 2AXTU 4ED6A 1SGGA 2EAOA 3HILA 2KD1A 2HVHA 4F71A 4QWDA 2KHVA 5HMMA 3TI0A 1NZBA 3HX0A 4RPXA 2DWQA 1KTQA 2D3DA 2KIWA 1YZ6A 5KL1B 3UXOA 3ISCA 3GV8B 1ZQFA 2EZYA 2DBYA 3BQTA 3IRUA 1U47A 1T8EA 7ICFA 3TAQA 4KN4A 4FE3A 4P0QA 3C2KA 1TAUA 3SD7A 2XCAA 4XA5A 4QIWF 1LB2B 4OD0A 4KLGA 3LVVA 5AI8A 4YMMA 2GLEA 8ICRA 4XRHA 3BZCA 1KKXA 4U6PA 1NK4A 5KFCA 1BPZA 2JH7A 2AQ0A 4DO9A 3CRXA 2A1AA 1ZXIA 4MFFA 3TFSA 4DSEA 2KMDA 2CPRA 4JWNA 3PX4A 1KFTA 1HJPA 4ED3A 3QEAZ 5KG6A 2AGPA 1ZQMA 1NJYA 4YMNA 3CW2C 4NV0A 1RG6A 2RRDA 1UCVA 5H2FU 4QZCA 2W9BA 3SEIA 9ICVA 1L6NA 1ZQDA 1XSPA 4TURA 2W55A 3C2MA 7ICSA 2OH2A 5AM1A 2OM6A 2ASJA 5A0LA 4UAYA 5HP4A 3QYPA 3KOOA 4USAA 4DOBA 4JV0A 1NK8A 2AGQA 1N60A 5KNIA 2P66A 4EBDA 2DF4B 5E79U 1JX4A 1LKYB 4P4PA 2B6GA 3Q8MA 2ZIXB 4LZGA 5DQIA 4QZIA 3SAGA 3G6YA 3RJIA 5B66U 4FZMA 2AU0A 3G6VA 2KK0A 8ICYA 3QU2A 3BQ0A 1XNSA 4ECRA 2DFLA 4RPYA 3F2CA 5AI9A 3RAQA 4IR1A 5ALFA 4QNLA 2KJ5A 3LVWA 4RNOA 4RPZA 4OJ5A 3TAPA 1L3UA 1SV0C 2BKEA 5DB8A 4P4OA 3M9OB 7ICTA 5AKHA 5J0SA 8ICPA 2E8PA 5DLGA 3IP4B 1T3NA 4YD2A 3HJEA 1OUQA 4HYKA 3ZD8A 4K4GA 2KKVA 5ALUA 1EXNA 4FFDA 4CGZA 2HHXA 2ZIXA 3DEEA 3M8SA 4Y2QA 3SR6A 2G5HB 3JPOA 4MEYA 4UATA 4LZDA 1N5WA 3WK5A 1NNLA 4F8RA 1SIJA 5KFDA 2BCVA 2AH5A 4KLJA 2K4HA 4P0PB 2FI1A 5DG8A 5KFVA 5CB1A 2JEIA 5KFFA 5KG4A 4IC9A 8ICOA 2DPJA 4A8EA 4OJLA 3QU9A 2BGWA 3KHRA 3E0FA 2PI4A 3H8JA 7ICNA 4ELUA 2G08A 2QARB 4U7CA 1BPDA 4F4XA 5CRXA 5DQHA 5HNKA 1ZQZA 4AYBF 3PR5B 1DK2A 2CN1A 4ACOA 7ICHA 3PW5A 2HW3A 1Z1VA 2K8CB 2BQ3A 1RQLA 3RH4A 3GDXA 2D6FC 1N63A 5DLFA 4NLZA 9ICJA 3KHLA 3M9NB 1WWVA 3Q8QB 3C21A 4DSJA 3PW2A 4KLHA 4UAVA 2OCEA 4DL4A 5TISU 3D2QA 4Y2JA 3KBBA 5C0YA 2NO5A 3SAHA 2J6SA 5JRTA 7ICQA 1SXDA 1XO0A 4Z6CA 2ZJ8A 8ICWA 1X42A 4IRKA 2YMPA 3IG5A 4OJPA 3MR5A 1D8LA 5AK3A 1GO3F 5CHGA 1NK0A 2B0CA 3RB3A 3MABA 2GWSA 3V72A 2GH1A 3VC8A 1F5SA 2DQNB 5IIOA 3HRDD 1OW5A 1X2IA 1ZQWA 4PH5A 1NKCA 4TUQA 3MGVA 2NRZA 1QLNA 4TQRA 5J2IA 3EWAA 4DOCA 2XGQA 1Z00A 3RH5A 7ICOA 2FLPA 5ALOA 1OXJA 2NO4A 4F3OA 1S77D 3DDHA 5DGAA 2DKXA 2ZIWB 4RQ6A 5KFBA 4C4SA 2YY6A 2R8JA 4Y2XA 5KFHA 1PK1B 2K60A 2W11A 2OHFA 3MR6A 3QUTA 2RQ5A 1A6SA 1KRPA 7ICLA 3AQFA 2YMMA 4GLXA 2HVIA 5AM4A
chains in the Genus database with same CATH topology
5DBAA 1ZQPA 5KG0A 2FMQA 5KG2A 2J6UA 3MR3A 1ZQLA 4Q43A 9ICNA 4DF8A 1TFRA 4F5QA 1A76A 1ZQYA 4Z6DA 5KFUA 1NJXA 5J0WA 4I2BA 2HHVA 3V6HA 5DGBA 4XQ8A 4Q45A 2FPKA 1JMSA 3LWMA 4RZRA 2AGOA 3Q8KA 1X9WA 4G3IA 1ZQNA 4M2YA 4M6WB 1S9FA 4QW8A 1IXRA 1RXWA 4Z6EA 1U4BA 5DBBA 2XCPA 3PX0A 5KFZA 4F5NA 2R8IA 5BOMA 3LK9A 3HP6A 5DB7A 2FPMA 4P2HA 4RQ7A 3RJKA 3RB6A 9ICWA 2ZUCA 7ICGA 3NTUA 3QEBZ 4B9SA 2ZTEA 4KLUA 3QZ7A 4BWMA 4M47A 3H4BA 4NM1A 4GXIA 1XO1A 3C5GA 2XY5A 2ASDA 4DF4A 1LV5A 7ICUA 4DQRA 3RR8A 4KLOA 4C8KA 1U49A 1ZQOA 1ZQXA 3JPTA 3IHQB 4BDPA 2FLLA 4ECSA 4DL2A 9ICSA 4KLEA 4Q44A 2BHNA 4J9OA 4NY8A 4RQ5A 8ICVA 5J29A 4O3NA 5HHHA 2HHTA 4PPXA 3H40A 3MGIA 3C5FA 3C1YA 4ECZA 3TQ1A 1ZQTA 4MF2A 4QWEA 2XC9A 5J2HA 1D9FA 4PHDA 4QZ9A 4ED1A 4ELTA 4M9LA 4DFJA 2ZJAA 3UXNA 5CA7A 5KT6A 3PNCA 3N4MB 8ICZA 4MFCA 1ZQGA 1ZQSA 4Z6FA 2H5XA 5HMLA 2KN7A 5D4BA 4RNMA 5DDMA 3HT3A 1ZQAA 2FLNA 1XU4A 4EYHB 2R8HA 4EEYA 1MQ2A 4RT2A 2W9AA 4EYIB 4QZAA 8ICQA 1SKWA 4R66A 1KFSA 5HHIA 5IINA 2R8GA 3AUOA 4FS2A 3ISDA 9ICXA 2KZMA 5CJ7A 4M9NA 3AU2A 3PW4A 3ORYA 3TARA 2PFPA 1UT5A 1RPLA 3G6XA 4O5CA 1JIHA 4RQ8A 4J9NA 4F5PA 3V6KA 1NJZA 5J0TA 4J9MA 4DSIA 1K1QA 2NRWA 1B43A 3RB0A 4Q8FA 4K4HA 1JN3A 4CCHA 9ICRA 2LYHA 5EWGA 8ICSA 4IRCA 4J9PA 1U48A 9ICIA 4RQ1A 5EWEA 2HHUA 3OJSA 3PO5A 2UVUA 4M6WA 3UXPA 4JK1A 3T3FA 1L3TA 5CWRA 4UB4A 2UVWA 2UVVA 1CEZA 1TAQA 5EOZA 3V7KA 4PGQA 1UA0A 2BPCA 3KHGA 5L1JA 3RRHA 2VA2A 5KFMA 3UQ2A 5BOLA 2HHQA 4KN7A 4UB5A 4F4KA 9ICKA 3JPRA 4UBCA 2ZJ5A 3SZ2A 1ZQEA 4IQWA 5DKWA 1RYSA 4IR9A 7ICMA 4C8LA 4E0DA 9ICAA 8ICLA 4DSKA 1HUOA 4B9VA 3PO4A 4YXMA 5KFSA 5J2BA 4BGDA 2F1HA 1TKDA 4NXZA 1BPYA 3ZD9A 4MF8A 2ISPA 1DGSA 2RDIA 2B21A 2C2DA 2ZUDA 4YR2A 3RTVA 1Z3EB 1U45A 1D8YA 3EYZA 3HWTA 2XY6A 9ICFA 5KFKA 5J2DA 3UPQA 3T5KA 1HUZA 3Q8RB 1RYRA 5KFTA 3RJFA 4KLDA 4I28A 2W9MA 2C22A 3RB4A 4Q8EA 4LVSA 2BCUA 5KT3A 1QSSA 4F4YA 3RR7A 4KLIA 4KLQA 7ICEA 4ECQA 2HHSA 7ICVA 4DLGA 3PR4A 4QZHA 2IA6A 3EW9A 3MFHA 1COOA 4J9SA 2ALZA 5L9XA 4DQQA 3H4DA 1L3VA 1ZQKA 2NRTA 2V9WA 1DOQA 1V9PA 3Q8SB 3FYHA 4KITB 5DB9A 5L1IA 4J9KA 7ICRA 1Y88A 4IQUA 3V6JA 2NRXA 2PFOA 4RUCA 1IM4A 2VA3A 4PHAA 4I2FA 3C1ZA 5F9NA 4BXOB 2MUTA 4ED6A 1D9DA 5DG9A 5KT7A 4UB3A 4F4ZA 1SKRA 2UVRA 5J0OA 2FMPA 1XS9D 3SYZA 1L5UA 4NLGA 3ZDCA 2I1QA 2HVHA 2J6TA 5J0QA 5DDYA 5KFPA 4QWDA 3RJEA 3JPPA 3GIJA 5HMMA 1SL1A 3ZDDA 2BCRA 3TI0A 5KFWA 4XUSA 5DB6A 3HX0A 4RPXA 3BJYA 1KTQA 8ICUA 7ICJA 5KG3A 3UXOA 3ISCA 2F1JA 3LDAA 2V4QA 4P4MA 2BPFA 3GV8B 9ICBA 1ZQFA 4YR0A 4QWCA 3GV7B 4JV1A 3T5JA 3BQTA 3PMLA 1U47A 1T8EA 4PGXA 4DL3A 2JZBB 2BQUA 2A1JA 1X9SA 3OSPA 4B9LA 3MBYA 4ECVA 3TAQA 7ICFA 4KN4A 1NK9A 1ZQIA 1XWLA 4GXKA 5J2CA 3M8RA 3C2KA 3RH6A 1QSYA 4RNNA 2I9GA 1TAUA 5J0RA 2XCAA 4KMUA 1KEJA 4XA5A 3BDPA 1LB2B 5DBCA 3RJHA 4FBTA 4KLGA 3K4GA 4JWMA 2KTQA 4YMMA 4EBEA 4I2GA 4XRHA 8ICRA 8ICFA 2R8KA 1XSLA 5L1LA 2ZTCA 4NLKA 4O0IA 8ICIA 4F92B 3KTQA 4QZEA 2F1IA 1NK4A 2Y1IA 5KG1A 2IHNA 5KFCA 1BPZA 2DPIA 2AQ0A 3RJGA 1BVSA 9ICLA 4DO9A 5IILA 3OHAA 2XY7A 2JEFA 4MFFA 3RAXA 3TANA 2IMWP 4YD1A 2XGPA 3TFSA 2VA8A 4M9JA 7ICIA 3SI8A 2P66A 4DSEA 8ICTA 4JWNA 5J2AA 4I29A 4O3OA 3PX4A 9ICUA 5IIIA 1KFTA 3LWLA 4KLFA 1HJPA 1ZQJA 4QWBA 4ED3A 4RUAA 3EPIA 5D46A 3QEAZ 5KG6A 4O3SA 2C2RA 4C8OA 2AGPA 1ZQMA 2JEGA 1RZTA 4ED7A 1NJYA 2W9BB 4YMNA 3RBEA 4EZ6A 2KFNA 4QZCA 2PXIA 2W9BA 9ICVA 4I2EA 5J2FA 3T5LA 1ZQDA 1S0MA 5J2GA 4GXJA 1XSPA 4TURA 4X5VA 4I2HA 3C2MA 3H8SA 8ICAA 7ICSA 3NGDA 3V7LA 4QZGA 2ASJA 4DWIA 1S97A 2BCSA 4UAYA 3PY8A 5HP4A 2ZUBA 3IM1A 4DOBA 3PW7A 4KLMA 3EPGA 5J0XA 2ISOA 1ZJMA 4O3RA 4JV0A 1NK8A 8ICGA 2AGQA 3V7JA 2JZBA 5KFQA 4YVZA 4UAWA 4MFAA 3PMNA 1A77A 1ZETA 4EBDA 2WTFA 2BQRA 4ED0A 1XSNA 1PZNA 3OHBA 1NK5A 1KDHA 5J2KA 2FPLA 1KFDA 1JX4A 4FS1A 5D49A 3BQ2A 4P4PA 5KT4A 5KFXA 3Q8MA 4LZGA 4YCXA 4RU9A 2MAXA 5DQIA 4QZIA 3GIKA 3G6YA 2W8LA 4ECYA 3RJIA 1ZJNA 1S10A 9ICOA 4DQPA 2AU0A 3G6VA 8ICYA 5DQGA 4QW9A 5KT5A 1S76D 8ICCA 2W9CB 3BQ0A 3MDAA 1BPXA 4DS4A 2FMSA 4I2AA 4O5EA 4R63A 4ECRA 2AQ4A 2DFLA 4UBBA 4M0AA 4RQ3A 4DS5A 1AROP 4QZFA 5JUMA 4RPYA 4DQIA 4O3QA 3THVA 3RAQA 4F50A 4IR1A 4KLLA 4DL5A 4M04A 3MFIA 5J0UA 4RNOA 4RPZA 4C8NA 4ECUA 1C7YA 3SV4A 3TAPA 1BPBA 3Q8PB 4ED8A 1L3UA 2BKEA 5DB8A 1NKEA 8ICNA 3C23A 4P4OA 3M9OB 4J9RA 7ICTA 3GILA 5J0SA 8ICPA 5J2EA 3TFRA 4M9HA 1XC9A 5DLGA 4ECTA 2C2EA 1ZQRA 1ZQHA 3ZDEA 3PV8A 1TK8A 1ZQVA 3MGHA 1T3NA 1SL0A 4YD2A 2KZ3A 1KLNA 3ZDAA 4HYKA 1WCLA 3ZD8A 1B22A 4IQVA 3K75D 4K4GA 4QZ8A 4GC6A 4ED2A 3HPOA 3RJJA 4M9GA 1ZQBA 3N97B 1EXNA 4UAZA 4UB2A 2JEJA 2HHXA 3H8WA 4JV2A 4DFPA 2XO7A 2AJQA 1Z00B 3M8SA 4I27A 4I2IA 2NRVA 5J2JA 4IQTA 3HW8A 5L1KA 4J9QA 4GC7A 1QTMA 1S0VA 3JPOA 1MQ3A 4FO6A 4MEYA 4F5RA 4LZDA 4I2JA 4R65A 3GIMA 2Q0ZX 1TK5A 2W9CA 4F8RA 5KFDA 2V4RA 2ZTDA 2BCVA 4I2CA 4KLJA 8ICMA 9ICGA 4YR3A 4PGYA 4DOAA 5KFGA 3OSNA 4NM2A 4R8UA 5KFVA 5DG8A 4B9TA 5TZVA 5C5JA 2W8KA 5CB1A 1L3SA 4DL7A 2JEIA 5KFFA 5KG4A 4B9UA 4EBCA 8ICOA 4TQSA 2DPJA 4YMOA 1MC8A 4DFMA 2P6RA 4ELVA 3JPNA 2BGWA 5KFEA 4ECWA 1UA1A 4DSLA 3KHRA 3AU6A 3Q8LA 2P6UA 3BQ1A 2PI4A 3H8JA 7ICNA 2ATLA 4ELUA 4UB1A 4DFKA 4B9NA 4YN4A 1JXEA 1BPDA 4F4XA 5DQHA 5HNKA 3GV5B 5CP2A 1K1SA 1ZQZA 4R8UB 1X9MA 1ZQQA 1S0OA 1CUKA 3PR5B 1NKBA 1JXLA 4F2RA 4PHEA 2PFNA 2KFZA 5KT2A 3ZDBA 3B0YA 3SV3A 7ICHA 3RBDA 1ZQCA 2OWOA 4JUZA 3PW5A 4YP3A 2HW3A 3GIIA 4UQGA 1TV9A 2BPGA 8ICHA 4YXJA 3PX6A 9ICTA 4YFKA 4QZBA 3M9MB 3ISBA 5KFNA 5EWFA 4PHPA 3MDCA 5KFLA 1BPEA 2BQ3A 3RH4A 4KLSA 3GDXA 1T7PA 2ASLA 2PFQA 9ICCA 5KTQA 8ICXA 5DLFA 4NLZA 9ICJA 2BR0A 5J0PA 3KHLA 3M9NB 3C2LA 1H38A 8ICJA 3Q8QB 3KHHA 2M9NA 3C21A 2Y1JA 5KFYA 1ZQUA 1WCNA 4BWJA 4DSJA 3PW2A 3PW0A 1NOMA 9ICMA 4YQWA 4KLHA 3PVXA 4DL4A 5KG7A 9ICHA 4C8MA 3QZ8A 3GQCA 3RRGA 4F4WA 3OJUA 1NK7A 2J6SA 4RT3A 4ECXA 2RDJA 7ICQA 4EZ9A 3UQ0A 4Z6CA 3ETLA 2ZJ8A 8ICEA 5IIJA 1RXVA 4MEXA 2BCQA 8ICWA 4DL6A 4IRKA 4O5KA 5BPCA 3OGUA 2HHWA 3H7IA 5KFOA 3MR5A 2PI5A 5KFJA 4RQ2A 9ICPA 1D8LA 1U9LA 5CHGA 1NK0A 2VANA 3MABA 4O3PA 5J0YA 3RB3A 5KFAA 3V72A 1S0NA 2GWSA 4F93B 5DG7A 4DEZA 3EZ5A 4KTQA 9ICQA 2IBKA 2C28A 4NLNA 5IIOA 4K4IA 4TUSA 3E2EA 2MUTB 4F2SA 1X2IA 1ZQWA 3JPSA 1NJWA 4PH5A 3T5HA 4DLEA 1NKCA 4TUQA 5IIKA 1TVAA 2NRZA 1NK6A 7ICKA 4QWAA 1QLNA 4TQRA 3JPQA 5J2IA 4BXOA 3EWAA 1T4GA 4DOCA 4F91B 2XGQA 4KLTA 8ICKA 1Z00A 3RH5A 7ICOA 4QZDA 2FLPA 4TUPA 4DQSA 5KFIA 4F3OA 1S77D 1UT8A 3GFKB 4J9LA 5DGAA 4O9MA 1SZPA 2IHMA 4RQ4A 4ZH4A 4RQ6A 5KFBA 5KFRA 5IIMA 3MR2A 1SL2A 9ICEA 1QSLA 4IRDA 2R8JA 5KG5A 1KSPA 4R64A 2KZZA 2BDPA 5KFHA 8ICBA 5CR0A 4F5OA 1TK0A 7ICPA 3MR6A 1MSWD 1BGXT 4YG2A 4I2DA 1KRPA 3B0XA 4DSFA 1N56A 1ZYQA 4FBUA 3FDSA 7ICLA 4RQ0A 4GLXA 2A1JB 3QE9Y 1SKSA 1N48A 2HVIA 5F9LA 4B9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBA A;  1ZQP A;  5KG0 A;  2FMQ A;  5KG2 A;  2J6U A;  3MR3 A;  1ZQL A;  4Q43 A;  9ICN A;  4DF8 A;  1TFR A;  4F5Q A;  1A76 A;  1ZQY A;  4Z6D A;  5KFU A;  1NJX A;  5J0W A;  4I2B A;  2HHV A;  3V6H A;  5DGB A;  4XQ8 A;  4Q45 A;  2FPK A;  1JMS A;  3LWM A;  4RZR A;  2AGO A;  3Q8K A;  1X9W A;  4G3I A;  1ZQN A;  4M2Y A;  4M6W B;  1S9F A;  4QW8 A;  1IXR A;  1RXW A;  4Z6E A;  1U4B A;  5DBB A;  2XCP A;  3PX0 A;  5KFZ A;  4F5N A;  2R8I A;  5BOM A;  3LK9 A;  3HP6 A;  5DB7 A;  2FPM A;  4P2H A;  4RQ7 A;  3RJK A;  3RB6 A;  9ICW A;  2ZUC A;  7ICG A;  3NTU A;  3QEB Z;  4B9S A;  2ZTE A;  4KLU A;  3QZ7 A;  4BWM A;  4M47 A;  3H4B A;  4NM1 A;  4GXI A;  1XO1 A;  3C5G A;  2XY5 A;  2ASD A;  4DF4 A;  1LV5 A;  7ICU A;  4DQR A;  3RR8 A;  4KLO A;  4C8K A;  1U49 A;  1ZQO A;  1ZQX A;  3JPT A;  3IHQ B;  4BDP A;  2FLL A;  4ECS A;  4DL2 A;  9ICS A;  4KLE A;  4Q44 A;  2BHN A;  4J9O A;  4NY8 A;  4RQ5 A;  8ICV A;  5J29 A;  4O3N A;  5HHH A;  2HHT A;  4PPX A;  3H40 A;  3MGI A;  3C5F A;  3C1Y A;  4ECZ A;  3TQ1 A;  1ZQT A;  4MF2 A;  4QWE A;  2XC9 A;  5J2H A;  1D9F A;  4PHD A;  4QZ9 A;  4ED1 A;  4ELT A;  4M9L A;  4DFJ A;  2ZJA A;  3UXN A;  5CA7 A;  5KT6 A;  3PNC A;  3N4M B;  8ICZ A;  4MFC A;  1ZQG A;  1ZQS A;  4Z6F A;  2H5X A;  5HML A;  2KN7 A;  5D4B A;  4RNM A;  5DDM A;  3HT3 A;  1ZQA A;  2FLN A;  1XU4 A;  4EYH B;  2R8H A;  4EEY A;  1MQ2 A;  4RT2 A;  2W9A A;  4EYI B;  4QZA A;  8ICQ A;  1SKW A;  4R66 A;  1KFS A;  5HHI A;  5IIN A;  2R8G A;  3AUO A;  4FS2 A;  3ISD A;  9ICX A;  2KZM A;  5CJ7 A;  4M9N A;  3AU2 A;  3PW4 A;  3ORY A;  3TAR A;  2PFP A;  1UT5 A;  1RPL A;  3G6X A;  4O5C A;  1JIH A;  4RQ8 A;  4J9N A;  4F5P A;  3V6K A;  1NJZ A;  5J0T A;  4J9M A;  4DSI A;  1K1Q A;  2NRW A;  1B43 A;  3RB0 A;  4Q8F A;  4K4H A;  1JN3 A;  4CCH A;  9ICR A;  2LYH A;  5EWG A;  8ICS A;  4IRC A;  4J9P A;  1U48 A;  9ICI A;  4RQ1 A;  5EWE A;  2HHU A;  3OJS A;  3PO5 A;  2UVU A;  4M6W A;  3UXP A;  4JK1 A;  3T3F A;  1L3T A;  5CWR A;  4UB4 A;  2UVW A;  2UVV A;  1CEZ A;  1TAQ A;  5EOZ A;  3V7K A;  4PGQ A;  1UA0 A;  2BPC A;  3KHG A;  5L1J A;  3RRH A;  2VA2 A;  5KFM A;  3UQ2 A;  5BOL A;  2HHQ A;  4KN7 A;  4UB5 A;  4F4K A;  9ICK A;  3JPR A;  4UBC A;  2ZJ5 A;  3SZ2 A;  1ZQE A;  4IQW A;  5DKW A;  1RYS A;  4IR9 A;  7ICM A;  4C8L A;  4E0D A;  9ICA A;  8ICL A;  4DSK A;  1HUO A;  4B9V A;  3PO4 A;  4YXM A;  5KFS A;  5J2B A;  4BGD A;  2F1H A;  1TKD A;  4NXZ A;  1BPY A;  3ZD9 A;  4MF8 A;  2ISP A;  1DGS A;  2RDI A;  2B21 A;  2C2D A;  2ZUD A;  4YR2 A;  3RTV A;  1Z3E B;  1U45 A;  1D8Y A;  3EYZ A;  3HWT A;  2XY6 A;  9ICF A;  5KFK A;  5J2D A;  3UPQ A;  3T5K A;  1HUZ A;  3Q8R B;  1RYR A;  5KFT A;  3RJF A;  4KLD A;  4I28 A;  2W9M A;  2C22 A;  3RB4 A;  4Q8E A;  4LVS A;  2BCU A;  5KT3 A;  1QSS A;  4F4Y A;  3RR7 A;  4KLI A;  4KLQ A;  7ICE A;  4ECQ A;  2HHS A;  7ICV A;  4DLG A;  3PR4 A;  4QZH A;  2IA6 A;  3EW9 A;  3MFH A;  1COO A;  4J9S A;  2ALZ A;  5L9X A;  4DQQ A;  3H4D A;  1L3V A;  1ZQK A;  2NRT A;  2V9W A;  1DOQ A;  1V9P A;  3Q8S B;  3FYH A;  4KIT B;  5DB9 A;  5L1I A;  4J9K A;  7ICR A;  1Y88 A;  4IQU A;  3V6J A;  2NRX A;  2PFO A;  4RUC A;  1IM4 A;  2VA3 A;  4PHA A;  4I2F A;  3C1Z A;  5F9N A;  4BXO B;  2MUT A;  4ED6 A;  1D9D A;  5DG9 A;  5KT7 A;  4UB3 A;  4F4Z A;  1SKR A;  2UVR A;  5J0O A;  2FMP A;  1XS9 D;  3SYZ A;  1L5U A;  4NLG A;  3ZDC A;  2I1Q A;  2HVH A;  2J6T A;  5J0Q A;  5DDY A;  5KFP A;  4QWD A;  3RJE A;  3JPP A;  3GIJ A;  5HMM A;  1SL1 A;  3ZDD A;  2BCR A;  3TI0 A;  5KFW A;  4XUS A;  5DB6 A;  3HX0 A;  4RPX A;  3BJY A;  1KTQ A;  8ICU A;  7ICJ A;  5KG3 A;  3UXO A;  3ISC A;  2F1J A;  3LDA A;  2V4Q A;  4P4M A;  2BPF A;  3GV8 B;  9ICB A;  1ZQF A;  4YR0 A;  4QWC A;  3GV7 B;  4JV1 A;  3T5J A;  3BQT A;  3PML A;  1U47 A;  1T8E A;  4PGX A;  4DL3 A;  2JZB B;  2BQU A;  2A1J A;  1X9S A;  3OSP A;  4B9L A;  3MBY A;  4ECV A;  3TAQ A;  7ICF A;  4KN4 A;  1NK9 A;  1ZQI A;  1XWL A;  4GXK A;  5J2C A;  3M8R A;  3C2K A;  3RH6 A;  1QSY A;  4RNN A;  2I9G A;  1TAU A;  5J0R A;  2XCA A;  4KMU A;  1KEJ A;  4XA5 A;  3BDP A;  1LB2 B;  5DBC A;  3RJH A;  4FBT A;  4KLG A;  3K4G A;  4JWM A;  2KTQ A;  4YMM A;  4EBE A;  4I2G A;  4XRH A;  8ICR A;  8ICF A;  2R8K A;  1XSL A;  5L1L A;  2ZTC A;  4NLK A;  4O0I A;  8ICI A;  4F92 B;  3KTQ A;  4QZE A;  2F1I A;  1NK4 A;  2Y1I A;  5KG1 A;  2IHN A;  5KFC A;  1BPZ A;  2DPI A;  2AQ0 A;  3RJG A;  1BVS A;  9ICL A;  4DO9 A;  5IIL A;  3OHA A;  2XY7 A;  2JEF A;  4MFF A;  3RAX A;  3TAN A;  2IMW P;  4YD1 A;  2XGP A;  3TFS A;  2VA8 A;  4M9J A;  7ICI A;  3SI8 A;  2P66 A;  4DSE A;  8ICT A;  4JWN A;  5J2A A;  4I29 A;  4O3O A;  3PX4 A;  9ICU A;  5III A;  1KFT A;  3LWL A;  4KLF A;  1HJP A;  1ZQJ A;  4QWB A;  4ED3 A;  4RUA A;  3EPI A;  5D46 A;  3QEA Z;  5KG6 A;  4O3S A;  2C2R A;  4C8O A;  2AGP A;  1ZQM A;  2JEG A;  1RZT A;  4ED7 A;  1NJY A;  2W9B B;  4YMN A;  3RBE A;  4EZ6 A;  2KFN A;  4QZC A;  2PXI A;  2W9B A;  9ICV A;  4I2E A;  5J2F A;  3T5L A;  1ZQD A;  1S0M A;  5J2G A;  4GXJ A;  1XSP A;  4TUR A;  4X5V A;  4I2H A;  3C2M A;  3H8S A;  8ICA A;  7ICS A;  3NGD A;  3V7L A;  4QZG A;  2ASJ A;  4DWI A;  1S97 A;  2BCS A;  4UAY A;  3PY8 A;  5HP4 A;  2ZUB A;  3IM1 A;  4DOB A;  3PW7 A;  4KLM A;  3EPG A;  5J0X A;  2ISO A;  1ZJM A;  4O3R A;  4JV0 A;  1NK8 A;  8ICG A;  2AGQ A;  3V7J A;  2JZB A;  5KFQ A;  4YVZ A;  4UAW A;  4MFA A;  3PMN A;  1A77 A;  1ZET A;  4EBD A;  2WTF A;  2BQR A;  4ED0 A;  1XSN A;  1PZN A;  3OHB A;  1NK5 A;  1KDH A;  5J2K A;  2FPL A;  1KFD A;  1JX4 A;  4FS1 A;  5D49 A;  3BQ2 A;  4P4P A;  5KT4 A;  5KFX A;  3Q8M A;  4LZG A;  4YCX A;  4RU9 A;  2MAX A;  5DQI A;  4QZI A;  3GIK A;  3G6Y A;  2W8L A;  4ECY A;  3RJI A;  1ZJN A;  1S10 A;  9ICO A;  4DQP A;  2AU0 A;  3G6V A;  8ICY A;  5DQG A;  4QW9 A;  5KT5 A;  1S76 D;  8ICC A;  2W9C B;  3BQ0 A;  3MDA A;  1BPX A;  4DS4 A;  2FMS A;  4I2A A;  4O5E A;  4R63 A;  4ECR A;  2AQ4 A;  2DFL A;  4UBB A;  4M0A A;  4RQ3 A;  4DS5 A;  1ARO P;  4QZF A;  5JUM A;  4RPY A;  4DQI A;  4O3Q A;  3THV A;  3RAQ A;  4F50 A;  4IR1 A;  4KLL A;  4DL5 A;  4M04 A;  3MFI A;  5J0U A;  4RNO A;  4RPZ A;  4C8N A;  4ECU A;  1C7Y A;  3SV4 A;  3TAP A;  1BPB A;  3Q8P B;  4ED8 A;  1L3U A;  2BKE A;  5DB8 A;  1NKE A;  8ICN A;  3C23 A;  4P4O A;  3M9O B;  4J9R A;  7ICT A;  3GIL A;  5J0S A;  8ICP A;  5J2E A;  3TFR A;  4M9H A;  1XC9 A;  5DLG A;  4ECT A;  2C2E A;  1ZQR A;  1ZQH A;  3ZDE A;  3PV8 A;  1TK8 A;  1ZQV A;  3MGH A;  1T3N A;  1SL0 A;  4YD2 A;  2KZ3 A;  1KLN A;  3ZDA A;  4HYK A;  1WCL A;  3ZD8 A;  1B22 A;  4IQV A;  3K75 D;  4K4G A;  4QZ8 A;  4GC6 A;  4ED2 A;  3HPO A;  3RJJ A;  4M9G A;  1ZQB A;  3N97 B;  1EXN A;  4UAZ A;  4UB2 A;  2JEJ A;  2HHX A;  3H8W A;  4JV2 A;  4DFP A;  2XO7 A;  2AJQ A;  1Z00 B;  3M8S A;  4I27 A;  4I2I A;  2NRV A;  5J2J A;  4IQT A;  3HW8 A;  5L1K A;  4J9Q A;  4GC7 A;  1QTM A;  1S0V A;  3JPO A;  1MQ3 A;  4FO6 A;  4MEY A;  4F5R A;  4LZD A;  4I2J A;  4R65 A;  3GIM A;  2Q0Z X;  1TK5 A;  2W9C A;  4F8R A;  5KFD A;  2V4R A;  2ZTD A;  2BCV A;  4I2C A;  4KLJ A;  8ICM A;  9ICG A;  4YR3 A;  4PGY A;  4DOA A;  5KFG A;  3OSN A;  4NM2 A;  4R8U A;  5KFV A;  5DG8 A;  4B9T A;  5TZV A;  5C5J A;  2W8K A;  5CB1 A;  1L3S A;  4DL7 A;  2JEI A;  5KFF A;  5KG4 A;  4B9U A;  4EBC A;  8ICO A;  4TQS A;  2DPJ A;  4YMO A;  1MC8 A;  4DFM A;  2P6R A;  4ELV A;  3JPN A;  2BGW A;  5KFE A;  4ECW A;  1UA1 A;  4DSL A;  3KHR A;  3AU6 A;  3Q8L A;  2P6U A;  3BQ1 A;  2PI4 A;  3H8J A;  7ICN A;  2ATL A;  4ELU A;  4UB1 A;  4DFK A;  4B9N A;  4YN4 A;  1JXE A;  1BPD A;  4F4X A;  5DQH A;  5HNK A;  3GV5 B;  5CP2 A;  1K1S A;  1ZQZ A;  4R8U B;  1X9M A;  1ZQQ A;  1S0O A;  1CUK A;  3PR5 B;  1NKB A;  1JXL A;  4F2R A;  4PHE A;  2PFN A;  2KFZ A;  5KT2 A;  3ZDB A;  3B0Y A;  3SV3 A;  7ICH A;  3RBD A;  1ZQC A;  2OWO A;  4JUZ A;  3PW5 A;  4YP3 A;  2HW3 A;  3GII A;  4UQG A;  1TV9 A;  2BPG A;  8ICH A;  4YXJ A;  3PX6 A;  9ICT A;  4YFK A;  4QZB A;  3M9M B;  3ISB A;  5KFN A;  5EWF A;  4PHP A;  3MDC A;  5KFL A;  1BPE A;  2BQ3 A;  3RH4 A;  4KLS A;  3GDX A;  1T7P A;  2ASL A;  2PFQ A;  9ICC A;  5KTQ A;  8ICX A;  5DLF A;  4NLZ A;  9ICJ A;  2BR0 A;  5J0P A;  3KHL A;  3M9N B;  3C2L A;  1H38 A;  8ICJ A;  3Q8Q B;  3KHH A;  2M9N A;  3C21 A;  2Y1J A;  5KFY A;  1ZQU A;  1WCN A;  4BWJ A;  4DSJ A;  3PW2 A;  3PW0 A;  1NOM A;  9ICM A;  4YQW A;  4KLH A;  3PVX A;  4DL4 A;  5KG7 A;  9ICH A;  4C8M A;  3QZ8 A;  3GQC A;  3RRG A;  4F4W A;  3OJU A;  1NK7 A;  2J6S A;  4RT3 A;  4ECX A;  2RDJ A;  7ICQ A;  4EZ9 A;  3UQ0 A;  4Z6C A;  3ETL A;  2ZJ8 A;  8ICE A;  5IIJ A;  1RXV A;  4MEX A;  2BCQ A;  8ICW A;  4DL6 A;  4IRK A;  4O5K A;  5BPC A;  3OGU A;  2HHW A;  3H7I A;  5KFO A;  3MR5 A;  2PI5 A;  5KFJ A;  4RQ2 A;  9ICP A;  1D8L A;  1U9L A;  5CHG A;  1NK0 A;  2VAN A;  3MAB A;  4O3P A;  5J0Y A;  3RB3 A;  5KFA A;  3V72 A;  1S0N A;  2GWS A;  4F93 B;  5DG7 A;  4DEZ A;  3EZ5 A;  4KTQ A;  9ICQ A;  2IBK A;  2C28 A;  4NLN A;  5IIO A;  4K4I A;  4TUS A;  3E2E A;  2MUT B;  4F2S A;  1X2I A;  1ZQW A;  3JPS A;  1NJW A;  4PH5 A;  3T5H A;  4DLE A;  1NKC A;  4TUQ A;  5IIK A;  1TVA A;  2NRZ A;  1NK6 A;  7ICK A;  4QWA A;  1QLN A;  4TQR A;  3JPQ A;  5J2I A;  4BXO A;  3EWA A;  1T4G A;  4DOC A;  4F91 B;  2XGQ A;  4KLT A;  8ICK A;  1Z00 A;  3RH5 A;  7ICO A;  4QZD A;  2FLP A;  4TUP A;  4DQS A;  5KFI A;  4F3O A;  1S77 D;  1UT8 A;  3GFK B;  4J9L A;  5DGA A;  4O9M A;  1SZP A;  2IHM A;  4RQ4 A;  4ZH4 A;  4RQ6 A;  5KFB A;  5KFR A;  5IIM A;  3MR2 A;  1SL2 A;  9ICE A;  1QSL A;  4IRD A;  2R8J A;  5KG5 A;  1KSP A;  4R64 A;  2KZZ A;  2BDP A;  5KFH A;  8ICB A;  5CR0 A;  4F5O A;  1TK0 A;  7ICP A;  3MR6 A;  1MSW D;  1BGX T;  4YG2 A;  4I2D A;  1KRP A;  3B0X A;  4DSF A;  1N56 A;  1ZYQ A;  4FBU A;  3FDS A;  7ICL A;  4RQ0 A;  4GLX A;  2A1J B;  3QE9 Y;  1SKS A;  1N48 A;  2HVI A;  5F9L A;  4B9M A; 
#chains in the Genus database with same CATH topology
 5KG0 A;  3MR3 A;  9ICN A;  4Q43 A;  4F5Q A;  5AIA A;  3AQE A;  5J0W A;  3QX7 A;  3V6H A;  4UAR A;  4XQ8 A;  1S5L U;  1S9F A;  1IXR A;  3UM9 A;  4Z6E A;  1U4B A;  4OJO A;  4F5N A;  5BOM A;  5DB7 A;  4LJX A;  2YB1 A;  2ZTE A;  3QZ7 A;  4BWM A;  2K4E A;  2KJ8 A;  3C5G A;  3RR8 A;  4C8K A;  1U49 A;  3N28 A;  2WF5 A;  4ECS A;  9ICS A;  4Q44 A;  4J9O A;  3KKA A;  2HHT A;  2HSZ A;  5AM5 A;  5AKL A;  1QQ6 A;  3TQ1 A;  5HR6 A;  1ZQT A;  4MF2 A;  2XC9 A;  4PHD A;  3PSF A;  3VCB A;  1NI3 A;  5KT6 A;  1ZQG A;  4Z6F A;  2H5X A;  2FLN A;  1ECW A;  1ZQ1 C;  2W9A A;  4QZA A;  2HBJ A;  3MC1 A;  2WB1 C;  2R8G A;  2NYV A;  5CJ7 A;  2YX8 A;  3ORY A;  3TAR A;  4OCZ A;  1UT5 A;  2EDU A;  4O5C A;  3V6K A;  1Q8K A;  4RQ8 A;  4C7Z A;  2WAQ C;  1KQQ A;  3L3F X;  9ICR A;  3BZK A;  2G06 A;  1U48 A;  9ICI A;  2HHU A;  2XIC A;  2UVU A;  5CWR A;  1TAQ A;  3KHG A;  4UB5 A;  9ICK A;  4IQW A;  2HMX A;  5DKW A;  4IR9 A;  7ICM A;  4E0D A;  5ALT A;  1IV8 A;  1WG8 A;  4YXM A;  5KFS A;  1TKD A;  2Y0S F;  4NXZ A;  3ZD9 A;  2ES6 A;  1D8Y A;  2XY6 A;  5J2D A;  3M6Z A;  3Q8R B;  2G5I B;  5KFT A;  4Y2U A;  5KT3 A;  3RR7 A;  2K8B B;  3MFH A;  1N61 A;  4J9S A;  3H4D A;  3F5A A;  2I5H A;  1DOQ A;  4KIT B;  3F5E A;  2VA3 A;  2BDU A;  3C1Z A;  2E1E A;  5F9N A;  4BXO B;  5DG9 A;  2WF8 A;  5KT7 A;  4UB3 A;  4F4Z A;  1QH9 A;  5J0O A;  1ZRM A;  1XS9 D;  1QQ7 A;  3SYZ A;  1PVP A;  3ZDC A;  2I1Q A;  3FC4 A;  4RQM A;  2ZIV B;  3JPP A;  3GIJ A;  2HCF A;  2F1J A;  2BPF A;  9ICB A;  2BZF A;  4QWC A;  3GV7 B;  3T5J A;  2BQU A;  1X9S A;  2A1J A;  5AK4 A;  4ECV A;  5T14 A;  3RH6 A;  4RNN A;  2I9G A;  2G09 A;  2I6X A;  5ALJ A;  3K4G A;  3B9J A;  2R8K A;  5L1L A;  3KTQ A;  5KG1 A;  2IHN A;  3IV6 A;  4Y2T A;  2KP7 A;  2XY7 A;  2IMW P;  3TAN A;  5ALV A;  7ICI A;  5AI4 A;  5J2A A;  1DXS A;  4KLF A;  4QWB A;  2RHF A;  3EPI A;  5D46 A;  4ED7 A;  2W9B B;  5AKI A;  2F77 X;  3NVW A;  5L1M A;  2LKY A;  3T5L A;  2KSO B;  3F2B A;  5J2G A;  4GXJ A;  4I2H A;  3H8S A;  3V7L A;  1L7O A;  2ZUB A;  3PW7 A;  4KLM A;  3EPG A;  5J0X A;  2ISO A;  3KKA C;  3J81 j;  1A77 A;  2WTF A;  1PZN A;  1KDH A;  2FPL A;  1KFD A;  5AM0 A;  2E3T A;  4FS1 A;  3BQ2 A;  3KD3 A;  2YTU A;  2MAX A;  1ZJN A;  4ECY A;  4GIB A;  3QU4 A;  2W04 A;  5KT5 A;  8ICC A;  5EE0 A;  2W9C B;  3MDA A;  1C20 A;  2FJ6 A;  4R63 A;  2KVS A;  5AM3 A;  4QZF A;  4DQI A;  3THV A;  4F50 A;  4M04 A;  3MFI A;  5J0U A;  3E58 A;  4ECU A;  1RM6 C;  1C7Y A;  2EZZ A;  2MA1 A;  4J9R A;  1YZ7 A;  3SAF A;  3H0L B;  3WKD A;  4M9H A;  4P0P A;  3ZDA A;  2KZ3 A;  3K75 D;  1UPH A;  3RJJ A;  1ZQB A;  3N97 B;  3BS7 A;  4DFP A;  1Z00 B;  3WK4 A;  4UB6 U;  2NRV A;  5J2J A;  4J9Q A;  1QTM A;  1TK5 A;  1ED1 A;  4YR3 A;  4NL9 A;  4PGY A;  3TAC B;  3OSN A;  4B9T A;  5C5J A;  1L3S A;  2KV2 A;  4YMO A;  3KZX A;  2P6R A;  1VJ5 A;  4CNQ A;  3M7D A;  2ATL A;  2PMZ C;  2H3I A;  5ALS A;  4UB1 A;  4DFK A;  4B9N A;  3UMG A;  1S0O A;  1X66 A;  1NKB A;  2PFN A;  5KT2 A;  3SV3 A;  3RBD A;  5J8Y A;  3GII A;  4UQG A;  2BPG A;  3BQ7 A;  5JU5 A;  2YN4 A;  3PX6 A;  5AI5 A;  9ICT A;  2K4P A;  3HKZ C;  3ISB A;  5KFN A;  2KG5 A;  5EWF A;  3MDC A;  3CYM A;  1T7P A;  2ASL A;  1H38 A;  5AKY A;  2Y1J A;  1ZQU A;  1WCN A;  4YQW A;  4Y2P A;  3PVX A;  9ICH A;  2RP5 A;  3QZ8 A;  3R9K A;  3GQC A;  3RRG A;  1NK7 A;  3ED5 A;  1SWW A;  2MRL A;  3UQ0 A;  2VJ5 A;  4WJ3 B;  1PVQ A;  1RXV A;  2QKQ A;  3H7I A;  5J0Y A;  4O3P A;  2XVT A;  1QCK A;  5AIB A;  1DK3 A;  3NUQ A;  4KTQ A;  2C28 A;  4NLN A;  4UAS A;  4TUS A;  4J03 A;  1RYU A;  1CRX A;  3JPS A;  4DLE A;  1TVA A;  2JH1 A;  3JPQ A;  8ICK A;  2G0A A;  2WF7 A;  4TUP A;  4DQS A;  1UT8 A;  4O9M A;  4ZH4 A;  4RQ4 A;  1SL2 A;  5KG5 A;  3N7R C;  4R64 A;  4F5O A;  1MSW D;  2WAQ F;  4YG2 A;  4I2D A;  1KW4 A;  4UW9 A;  2DGZ A;  3FDS A;  2A1J B;  5F9L A;  4B9M A;  5DBA A;  2FMQ A;  2E8N A;  4CF5 A;  1A76 A;  1NJX A;  4PL2 A;  2KIV A;  2FPK A;  1JMS A;  2HBK A;  5ALQ A;  4M6W B;  4QW8 A;  5AI6 A;  2Q4T A;  3TAD C;  5DBB A;  4OO1 J;  5KFZ A;  2R8I A;  3NVV A;  3HP6 A;  2IOF K;  3H0R B;  2ZUC A;  3NTU A;  4M47 A;  1XO1 A;  2ASD A;  1LV5 A;  4DF4 A;  2DUY A;  2F3N A;  2ESE A;  1ZQX A;  4NY8 A;  2BHN A;  1Z4O A;  1Z4N A;  3C1Y A;  3AM9 A;  1RDF A;  4QWE A;  1D9F A;  5AK5 A;  4ELT A;  2ZJA A;  3UXN A;  5CA7 A;  1SXE A;  5AIC A;  4RNM A;  3IDW A;  5DDM A;  3HT3 A;  3LYS A;  4RT2 A;  3DV9 A;  3A0B U;  3AUO A;  2ZG6 A;  3SMV A;  3AU2 A;  3PW4 A;  3QUC A;  1ZD5 A;  3G6X A;  4IL6 U;  2JV3 A;  2CRX A;  4KX3 A;  4F5P A;  4J9N A;  4DSI A;  5J0T A;  1K1Q A;  2F76 X;  2Y9T A;  4FZN A;  1KBU A;  4CCH A;  5AM2 A;  8ICS A;  3OPX A;  2OXO A;  1SV0 A;  4C80 A;  5G5G A;  3OJS A;  2H3Z A;  4Y2S A;  5AKJ A;  3PO5 A;  4JK1 A;  5EOZ A;  2GOL A;  3ZI4 A;  3UQ2 A;  4KN7 A;  4F4K A;  9ICA A;  8ICL A;  1HUO A;  4C0Z A;  5AI0 A;  2ISP A;  2RLT A;  4NLC A;  4YR2 A;  1Z3E B;  3EYZ A;  2LM1 A;  3HWT A;  5KFK A;  3T5K A;  1HUZ A;  4I28 A;  2W9M A;  2C22 A;  3RB4 A;  4LVS A;  2W03 A;  4ECQ A;  2HHS A;  4DLG A;  3EW9 A;  1ZQK A;  1L3V A;  2V9W A;  2K4I A;  2FDR A;  3FYH A;  5L1I A;  1Z1B A;  3V6J A;  1ZOL A;  2NRX A;  4RUC A;  3PZP A;  2PFO A;  3NAS A;  5KL8 B;  1D9D A;  3D6J A;  3QUB A;  3IN5 A;  5J0Q A;  3RJE A;  5KFP A;  3QUQ A;  1SL1 A;  2BCR A;  2VJ4 A;  2JXJ A;  4XUS A;  4CDG A;  8ICU A;  1O03 A;  7ICJ A;  5KG3 A;  2W3S A;  3LDA A;  2IOH A;  1V97 A;  4P4M A;  5ALK A;  4KX5 A;  2HBL A;  4OJ6 A;  3PML A;  4PGX A;  2JZB B;  3OSP A;  3WK7 A;  1NK9 A;  1ZQI A;  3WU2 U;  3WK8 A;  2W54 A;  3M8R A;  3NRZ A;  3WKA A;  5J0R A;  4EEN A;  1KEJ A;  5DBC A;  1FFV A;  4FBT A;  1J2M A;  4JWM A;  2KTQ A;  1RQN A;  4EBE A;  1TAM A;  4I2G A;  2P35 A;  1XSL A;  4O0I A;  3PST A;  4QZE A;  2F1I A;  2Y1I A;  2ZXI A;  1DRG A;  1SZH A;  2DPI A;  3RJG A;  1BVS A;  5IIL A;  1CI4 A;  2JRZ A;  4PZO A;  2XGP A;  8ICT A;  2VA8 A;  3AMZ A;  4M9J A;  3NRW A;  4I29 A;  4O3O A;  4AP9 A;  9ICU A;  3C29 A;  4RQN A;  3M1Y A;  4O3S A;  3TAD A;  5ALM A;  2JEG A;  3SEN A;  3RBE A;  4US9 A;  2W7P A;  2PXI A;  3GZF A;  5J2F A;  5GTH U;  4X5V A;  1UHU A;  4QZG A;  2MSN A;  2BCS A;  1PVR A;  3IM1 A;  3V7J A;  2QB1 A;  2JZB A;  4YVZ A;  4UAW A;  1XSN A;  1B4F A;  3CP8 A;  3ETR A;  2F44 A;  1COK A;  1X9X A;  5D49 A;  3WK9 A;  5KT4 A;  5KFX A;  2HOI A;  4RU9 A;  2IOF A;  3GIK A;  2H3F A;  5B5E U;  9ICO A;  2VIX A;  5DQG A;  4QW9 A;  1BPX A;  4P0Q B;  3I28 A;  2AQ4 A;  4RQ3 A;  2JHD A;  4C8N A;  3SV4 A;  1BPB A;  3GIL A;  3TKA A;  5J2E A;  1ZD4 A;  3UMB A;  2C2E A;  3ZDE A;  4HAI A;  1TK8 A;  3MGH A;  1SL0 A;  1WCL A;  1B22 A;  1JRO A;  4ED2 A;  4B6J A;  3HPO A;  4M9G A;  4UAZ A;  4I27 A;  5L1K A;  4I2I A;  4GC7 A;  3HW8 A;  4IQT A;  1Q3V A;  4Y2V A;  3NVY A;  5EE9 A;  4R65 A;  1PUZ A;  4O3M A;  3GIM A;  2V4R A;  4DOA A;  4IS7 A;  5KFG A;  2WF6 A;  4NM2 A;  4R8U A;  1ZRN A;  4G9B A;  4AYB C;  2QLT A;  4EBC A;  4C4T A;  1MA7 A;  3JPN A;  1UA1 A;  4ECW A;  4GFJ A;  3AU6 A;  2W3R A;  2P6U A;  3BQ1 A;  5EE1 A;  4DFD A;  2G07 A;  2EZX A;  3GU3 A;  1JXE A;  2E8M A;  3GV5 B;  1X9M A;  5CP2 A;  1K1S A;  3F2D A;  1CUK A;  1JXL A;  5FP0 A;  4PHE A;  5G5H A;  2KFZ A;  3ZDB A;  1J97 A;  3BS5 A;  2OWO A;  4JUZ A;  4YP3 A;  4YXJ A;  1FFU A;  5AKX A;  2O6K A;  2QB0 A;  2KNJ A;  4QZB A;  3M9M B;  1N62 A;  4ICA A;  1V85 A;  5KFL A;  1WUD A;  9ICC A;  2PFQ A;  5KTQ A;  1K5O A;  2BR0 A;  8ICJ A;  3KZI U;  3RF9 A;  3KHH A;  2M9N A;  1FO4 A;  1B0X A;  2HOF A;  4BWJ A;  3PW0 A;  1NOM A;  9ICM A;  3CNH A;  2WB1 F;  4F4W A;  4RT3 A;  4ECX A;  2RDJ A;  4UB8 U;  1IG6 A;  3ETL A;  2M0N A;  8ICE A;  1URJ A;  4CE6 A;  4DL6 A;  5BPC A;  3OGU A;  3AL0 B;  5KFO A;  5KFJ A;  9ICP A;  1U9L A;  1HEK A;  4PL1 A;  5KFA A;  4F93 B;  1N2X A;  4DEZ A;  3EZ5 A;  9ICQ A;  4K4I A;  4F2S A;  1NJW A;  3T5H A;  1NK6 A;  5IIK A;  7ICK A;  1S8O A;  1F0M A;  1Q46 A;  1T4G A;  4F91 B;  4KLT A;  5ALW A;  5KAF U;  2YML A;  5KFI A;  3GFK B;  2IHM A;  5KFR A;  5IIM A;  3MR2 A;  4IRD A;  1BNP A;  3A0H U;  1KSP A;  2KZZ A;  2BDP A;  8ICB A;  5CR0 A;  1BGX T;  4DSF A;  4EX7 A;  1SKS A;  1N48 A;  3D2N A;  1J2N A;  2J6U A;  4DF8 A;  1ZQY A;  4Z6D A;  5KFU A;  4Q45 A;  1HIW A;  2AGO A;  1L7N A;  2NV3 A;  4G3I A;  2W7O A;  4M2Y A;  1UQV A;  3HKZ F;  2XCP A;  1T94 A;  3LK9 A;  4P2H A;  3IG8 A;  5ALP A;  4B9S A;  2H3V A;  5F3X B;  3H4B A;  4NM1 A;  2LM4 A;  7ICU A;  2XY5 A;  3QXG A;  3ONN A;  4DQR A;  4KLO A;  2Y9U A;  2FLL A;  4DL2 A;  2EAM A;  4KLE A;  2ZIV A;  2LPE A;  1FEZ A;  3H40 A;  4PPX A;  3MGI A;  5ALG A;  5J2H A;  4QZ9 A;  4ED1 A;  4M9L A;  4DFJ A;  8ICZ A;  4MFC A;  3D2S A;  2KN7 A;  5HML A;  1ZQA A;  3I76 A;  5ALH A;  1XU4 A;  4EEY A;  4EYI B;  8ICQ A;  1SKW A;  4R66 A;  1KFS A;  9ICX A;  3K1R B;  4KMO B;  2K89 A;  2OYY A;  1MN8 A;  2YMQ A;  1JIH A;  2GO7 A;  5AKE A;  1NJZ A;  4J9M A;  3KFU F;  2E8O A;  4Q8F A;  4K4H A;  2LYH A;  2EAP A;  1L7M A;  4J9P A;  4RQ1 A;  3UXP A;  1L3T A;  4UAU A;  1CEZ A;  2BPC A;  2LHT A;  5L1J A;  3RRH A;  4DCC A;  2HHQ A;  2K8A A;  4US8 A;  2ZJ5 A;  3PSI A;  2JGA A;  3H0M B;  4C8L A;  4DSK A;  4Y2R A;  4MF8 A;  1DGS A;  2RDI A;  1U45 A;  2ZUD A;  3RTV A;  9ICF A;  3N7P D;  1ZD2 P;  1X40 A;  1RYR A;  3RJF A;  4NL9 C;  3FAH A;  2WF9 A;  5AK6 A;  5GTI U;  1QSS A;  2H3Q A;  7ICV A;  3PR4 A;  4QZH A;  2IA6 A;  2ALZ A;  1COO A;  4DQQ A;  2NRT A;  2KSO A;  3Q8S B;  5DB9 A;  1WYG A;  1Y88 A;  3QU5 A;  2F8K A;  1IM4 A;  4PHA A;  2PKE A;  2ZIU B;  4EX6 A;  2MUT A;  1SKR A;  4FZL A;  2UVR A;  2FMP A;  2EQY A;  4NWI A;  4NLG A;  1L5U A;  3AEV A;  2J6T A;  2Y0S C;  5DDY A;  4EEL A;  3ZDD A;  4QJF B;  3WK6 A;  5KFW A;  5DB6 A;  3BJY A;  2V4Q A;  1DGJ A;  4YR0 A;  4JV1 A;  2KVC A;  4DL3 A;  4B9L A;  3MBY A;  1XWL A;  4GXK A;  5J2C A;  1QSY A;  3S6J A;  2E1F A;  4KMU A;  5ALR A;  3BDP A;  1X6I A;  4PZN A;  3RJH A;  2F2A B;  5AHX A;  8ICF A;  4NJ8 A;  4NLK A;  2ZTC A;  8ICI A;  4F92 B;  5KAI U;  1Q3U A;  2KKP A;  5JTI A;  9ICL A;  5ALL A;  3OHA A;  2JEF A;  3RAX A;  4YD1 A;  3SI8 A;  2HI0 A;  3BS5 B;  5III A;  3LWL A;  1ZQJ A;  4RUA A;  4Y2Y A;  2C2R A;  1D8B A;  4C8O A;  1RZT A;  2HOQ A;  4EZ6 A;  5CEH A;  2KFN A;  4I2E A;  1LKY A;  1S0M A;  8ICA A;  3NGD A;  4DWI A;  1S97 A;  3PY8 A;  4C7Y A;  4O3R A;  3L5K A;  1ZJM A;  8ICG A;  2A19 A;  5KFQ A;  3L4P A;  1PK3 A;  4MFA A;  3PMN A;  1ZET A;  2BQR A;  2ZIU A;  4ED0 A;  3OHB A;  1NK5 A;  5J2K A;  1JUD A;  3QNM A;  4YCX A;  2W8L A;  5EE3 A;  1S10 A;  1PK1 A;  2PMZ F;  4DQP A;  2EAN A;  1S76 D;  4CF3 A;  4DS4 A;  2FMS A;  4I2A A;  4O5E A;  3U26 A;  2CXY A;  4UBB A;  4M0A A;  4DS5 A;  4QIW C;  1ARO P;  3PSP A;  5JUM A;  4O3Q A;  4KLL A;  4DL5 A;  3Q8P B;  4ED8 A;  5K4L A;  1NKE A;  8ICN A;  3C23 A;  1O08 A;  1L7P A;  2W43 A;  3TFR A;  3NVZ A;  1XC9 A;  4ECT A;  1ZQR A;  1ZQH A;  3PV8 A;  1ZQV A;  4CRX A;  1KLN A;  4IQV A;  3OTQ A;  4QZ8 A;  4GC6 A;  4CF4 A;  1T3Q A;  5ALX A;  1WWU A;  4UB2 A;  2JEJ A;  3H8W A;  4JV2 A;  2XO7 A;  2AJQ A;  1S0V A;  2MU2 A;  1VDV A;  2QB0 B;  1MQ3 A;  3WKC A;  4PJ0 U;  4FO6 A;  4F5R A;  4I2J A;  2YQE A;  2KEY A;  2Q0Z X;  2W9C A;  4I2C A;  2ZTD A;  9ICG A;  8ICM A;  2AHO B;  5TZV A;  2W8K A;  3AN1 A;  4MHV A;  4DL7 A;  4B9U A;  5J8Y C;  1JI7 A;  1ZD3 A;  4TQS A;  1MC8 A;  2KIC A;  4DFM A;  4ELV A;  5KFE A;  4DSL A;  3Q8L A;  1X6J A;  2N1R A;  1F44 A;  4YN4 A;  1FIQ A;  1ZQQ A;  2EH9 A;  4R8U B;  3WKB A;  4F2R A;  1SV4 A;  2L5Y A;  3B0Y A;  1ZQC A;  1TV9 A;  2ZXH A;  8ICH A;  4YFK A;  2R18 A;  4PHP A;  5ALZ A;  3F53 A;  1BPE A;  4KLS A;  8ICX A;  5J0P A;  3C2L A;  2XID A;  5KFY A;  3N7S C;  5KG7 A;  4C8M A;  3OJU A;  2YB4 A;  4EZ9 A;  5ALD A;  5IIJ A;  4MEX A;  2BCQ A;  4O5K A;  2HHW A;  2PI5 A;  4RQ2 A;  1IIP A;  2VKQ A;  2VAN A;  1S0N A;  2LBO A;  5DG7 A;  2IBK A;  3E2E A;  3FM9 A;  2MUT B;  3EUB 2;  4QWA A;  4BXO A;  3QU7 A;  4QZD A;  5AKG A;  4F72 A;  4J9L A;  1SZP A;  2WFA A;  3M6K A;  9ICE A;  1QSL A;  1TK0 A;  7ICP A;  3ICX A;  1TE2 A;  3K1Z A;  3B0X A;  1N56 A;  1ZYQ A;  4FBU A;  4RQ0 A;  3QE9 Y;  2WHE A;  3NS1 A;  1ZQP A;  2JMG A;  5KG2 A;  1ZQL A;  1TFR A;  2JR5 A;  2KHQ A;  4I2B A;  2HHV A;  5DGB A;  2E5S A;  2OEH A;  3LWM A;  4RZR A;  2ODG A;  3Q8K A;  1X9W A;  1ZQN A;  1RXW A;  3PX0 A;  2FPM A;  2LI6 A;  4RQ7 A;  3RJK A;  3RB6 A;  9ICW A;  7ICG A;  3QEB Z;  4KLU A;  4GXI A;  4NLB A;  1ZQO A;  3JPT A;  3IHQ B;  2KE7 A;  2HBM A;  4BDP A;  1KN5 A;  4BX9 C;  4EEK A;  3RFA A;  5ALN A;  2LYB A;  4RQ5 A;  8ICV A;  1A0P A;  5J29 A;  4O3N A;  5HHH A;  3C5F A;  4ECZ A;  5AKZ A;  1Z19 A;  4BJQ A;  3PNC A;  3N4M B;  2A3V A;  1ZQS A;  2KJ9 A;  5D4B A;  2HDO A;  1L8L A;  4EYH B;  2R8H A;  1MQ2 A;  1JRP A;  1QQ5 A;  5ALE A;  3UMC A;  5HHI A;  5IIN A;  4FS2 A;  1AQ6 A;  3ISD A;  2KZM A;  2D8C A;  4M9N A;  1VLB A;  4BUG A;  4C4R A;  2PFP A;  3O0F A;  1M6Y A;  2XI9 A;  1RPL A;  1N5X A;  5ALI A;  2FE9 A;  2NRW A;  1B43 A;  3I1Y A;  1SB3 C;  3RB0 A;  3C28 A;  1JN3 A;  4JB3 A;  5EWG A;  2DL0 A;  4IRC A;  1JAL A;  4ZOH C;  5EWE A;  5HR7 A;  4M6W A;  3T3F A;  4UB4 A;  2UVW A;  2UVV A;  3V7K A;  1UA0 A;  4PGQ A;  2VA2 A;  5KFM A;  5BOL A;  3JPR A;  4UBC A;  3SZ2 A;  1ZQE A;  2DKZ A;  3WKE A;  1L8O A;  1RYS A;  1BNO A;  2KOB A;  4B9V A;  1NZP A;  3PO4 A;  3ALR A;  5J2B A;  4BGD A;  4JMU A;  2F1H A;  1BPY A;  1P7D A;  1SWV A;  1LVH A;  2B21 A;  5ALY A;  2C2D A;  3T79 A;  1YT3 A;  3UPQ A;  2LMR A;  4KLD A;  5AKK A;  4Q8E A;  3H8M A;  2BCU A;  4KLI A;  4F4Y A;  4KLQ A;  7ICE A;  2QAR A;  2Z7J A;  5L9X A;  2ZIW A;  1V9P A;  4J9K A;  1KL9 A;  7ICR A;  1V38 A;  4IQU A;  2F8L A;  3SQI A;  2LYA A;  4I2F A;  2AXT U;  4ED6 A;  1SGG A;  2EAO A;  3HIL A;  2KD1 A;  2HVH A;  4F71 A;  4QWD A;  2KHV A;  5HMM A;  3TI0 A;  1NZB A;  3HX0 A;  4RPX A;  2DWQ A;  1KTQ A;  2D3D A;  2KIW A;  1YZ6 A;  5KL1 B;  3UXO A;  3ISC A;  3GV8 B;  1ZQF A;  2EZY A;  2DBY A;  3BQT A;  3IRU A;  1U47 A;  1T8E A;  7ICF A;  3TAQ A;  4KN4 A;  4FE3 A;  4P0Q A;  3C2K A;  1TAU A;  3SD7 A;  2XCA A;  4XA5 A;  4QIW F;  1LB2 B;  4OD0 A;  4KLG A;  3LVV A;  5AI8 A;  4YMM A;  2GLE A;  8ICR A;  4XRH A;  3BZC A;  1KKX A;  4U6P A;  1NK4 A;  5KFC A;  1BPZ A;  2JH7 A;  2AQ0 A;  4DO9 A;  3CRX A;  2A1A A;  1ZXI A;  4MFF A;  3TFS A;  4DSE A;  2KMD A;  2CPR A;  4JWN A;  3PX4 A;  1KFT A;  1HJP A;  4ED3 A;  3QEA Z;  5KG6 A;  2AGP A;  1ZQM A;  1NJY A;  4YMN A;  3CW2 C;  4NV0 A;  1RG6 A;  2RRD A;  1UCV A;  5H2F U;  4QZC A;  2W9B A;  3SEI A;  9ICV A;  1L6N A;  1ZQD A;  1XSP A;  4TUR A;  2W55 A;  3C2M A;  7ICS A;  2OH2 A;  5AM1 A;  2OM6 A;  2ASJ A;  5A0L A;  4UAY A;  5HP4 A;  3QYP A;  3KOO A;  4USA A;  4DOB A;  4JV0 A;  1NK8 A;  2AGQ A;  1N60 A;  5KNI A;  2P66 A;  4EBD A;  2DF4 B;  5E79 U;  1JX4 A;  1LKY B;  4P4P A;  2B6G A;  3Q8M A;  2ZIX B;  4LZG A;  5DQI A;  4QZI A;  3SAG A;  3G6Y A;  3RJI A;  5B66 U;  4FZM A;  2AU0 A;  3G6V A;  2KK0 A;  8ICY A;  3QU2 A;  3BQ0 A;  1XNS A;  4ECR A;  2DFL A;  4RPY A;  3F2C A;  5AI9 A;  3RAQ A;  4IR1 A;  5ALF A;  4QNL A;  2KJ5 A;  3LVW A;  4RNO A;  4RPZ A;  4OJ5 A;  3TAP A;  1L3U A;  1SV0 C;  2BKE A;  5DB8 A;  4P4O A;  3M9O B;  7ICT A;  5AKH A;  5J0S A;  8ICP A;  2E8P A;  5DLG A;  3IP4 B;  1T3N A;  4YD2 A;  3HJE A;  1OUQ A;  4HYK A;  3ZD8 A;  4K4G A;  2KKV A;  5ALU A;  1EXN A;  4FFD A;  4CGZ A;  2HHX A;  2ZIX A;  3DEE A;  3M8S A;  4Y2Q A;  3SR6 A;  2G5H B;  3JPO A;  4MEY A;  4UAT A;  4LZD A;  1N5W A;  3WK5 A;  1NNL A;  4F8R A;  1SIJ A;  5KFD A;  2BCV A;  2AH5 A;  4KLJ A;  2K4H A;  4P0P B;  2FI1 A;  5DG8 A;  5KFV A;  5CB1 A;  2JEI A;  5KFF A;  5KG4 A;  4IC9 A;  8ICO A;  2DPJ A;  4A8E A;  4OJL A;  3QU9 A;  2BGW A;  3KHR A;  3E0F A;  2PI4 A;  3H8J A;  7ICN A;  4ELU A;  2G08 A;  2QAR B;  4U7C A;  1BPD A;  4F4X A;  5CRX A;  5DQH A;  5HNK A;  1ZQZ A;  4AYB F;  3PR5 B;  1DK2 A;  2CN1 A;  4ACO A;  7ICH A;  3PW5 A;  2HW3 A;  1Z1V A;  2K8C B;  2BQ3 A;  1RQL A;  3RH4 A;  3GDX A;  2D6F C;  1N63 A;  5DLF A;  4NLZ A;  9ICJ A;  3KHL A;  3M9N B;  1WWV A;  3Q8Q B;  3C21 A;  4DSJ A;  3PW2 A;  4KLH A;  4UAV A;  2OCE A;  4DL4 A;  5TIS U;  3D2Q A;  4Y2J A;  3KBB A;  5C0Y A;  2NO5 A;  3SAH A;  2J6S A;  5JRT A;  7ICQ A;  1SXD A;  1XO0 A;  4Z6C A;  2ZJ8 A;  8ICW A;  1X42 A;  4IRK A;  2YMP A;  3IG5 A;  4OJP A;  3MR5 A;  1D8L A;  5AK3 A;  1GO3 F;  5CHG A;  1NK0 A;  2B0C A;  3RB3 A;  3MAB A;  2GWS A;  3V72 A;  2GH1 A;  3VC8 A;  1F5S A;  2DQN B;  5IIO A;  3HRD D;  1OW5 A;  1X2I A;  1ZQW A;  4PH5 A;  1NKC A;  4TUQ A;  3MGV A;  2NRZ A;  1QLN A;  4TQR A;  5J2I A;  3EWA A;  4DOC A;  2XGQ A;  1Z00 A;  3RH5 A;  7ICO A;  2FLP A;  5ALO A;  1OXJ A;  2NO4 A;  4F3O A;  1S77 D;  3DDH A;  5DGA A;  2DKX A;  2ZIW B;  4RQ6 A;  5KFB A;  4C4S A;  2YY6 A;  2R8J A;  4Y2X A;  5KFH A;  1PK1 B;  2K60 A;  2W11 A;  2OHF A;  3MR6 A;  3QUT A;  2RQ5 A;  1A6S A;  1KRP A;  7ICL A;  3AQF A;  2YMM A;  4GLX A;  2HVI A;  5AM4 A; 
#chains in the Genus database with same CATH homology
 5DBA A;  1ZQP A;  5KG0 A;  2FMQ A;  5KG2 A;  2J6U A;  3MR3 A;  1ZQL A;  4Q43 A;  9ICN A;  4DF8 A;  1TFR A;  4F5Q A;  1A76 A;  1ZQY A;  4Z6D A;  5KFU A;  1NJX A;  5J0W A;  4I2B A;  2HHV A;  3V6H A;  5DGB A;  4XQ8 A;  4Q45 A;  2FPK A;  1JMS A;  3LWM A;  4RZR A;  2AGO A;  3Q8K A;  1X9W A;  4G3I A;  1ZQN A;  4M2Y A;  4M6W B;  1S9F A;  4QW8 A;  1IXR A;  1RXW A;  4Z6E A;  1U4B A;  5DBB A;  2XCP A;  3PX0 A;  5KFZ A;  4F5N A;  2R8I A;  5BOM A;  3LK9 A;  3HP6 A;  5DB7 A;  2FPM A;  4P2H A;  4RQ7 A;  3RJK A;  3RB6 A;  9ICW A;  2ZUC A;  7ICG A;  3NTU A;  3QEB Z;  4B9S A;  2ZTE A;  4KLU A;  3QZ7 A;  4BWM A;  4M47 A;  3H4B A;  4NM1 A;  4GXI A;  1XO1 A;  3C5G A;  2XY5 A;  2ASD A;  4DF4 A;  1LV5 A;  7ICU A;  4DQR A;  3RR8 A;  4KLO A;  4C8K A;  1U49 A;  1ZQO A;  1ZQX A;  3JPT A;  3IHQ B;  4BDP A;  2FLL A;  4ECS A;  4DL2 A;  9ICS A;  4KLE A;  4Q44 A;  2BHN A;  4J9O A;  4NY8 A;  4RQ5 A;  8ICV A;  5J29 A;  4O3N A;  5HHH A;  2HHT A;  4PPX A;  3H40 A;  3MGI A;  3C5F A;  3C1Y A;  4ECZ A;  3TQ1 A;  1ZQT A;  4MF2 A;  4QWE A;  2XC9 A;  5J2H A;  1D9F A;  4PHD A;  4QZ9 A;  4ED1 A;  4ELT A;  4M9L A;  4DFJ A;  2ZJA A;  3UXN A;  5CA7 A;  5KT6 A;  3PNC A;  3N4M B;  8ICZ A;  4MFC A;  1ZQG A;  1ZQS A;  4Z6F A;  2H5X A;  5HML A;  2KN7 A;  5D4B A;  4RNM A;  5DDM A;  3HT3 A;  1ZQA A;  2FLN A;  1XU4 A;  4EYH B;  2R8H A;  4EEY A;  1MQ2 A;  4RT2 A;  2W9A A;  4EYI B;  4QZA A;  8ICQ A;  1SKW A;  4R66 A;  1KFS A;  5HHI A;  5IIN A;  2R8G A;  3AUO A;  4FS2 A;  3ISD A;  9ICX A;  2KZM A;  5CJ7 A;  4M9N A;  3AU2 A;  3PW4 A;  3ORY A;  3TAR A;  2PFP A;  1UT5 A;  1RPL A;  3G6X A;  4O5C A;  1JIH A;  4RQ8 A;  4J9N A;  4F5P A;  3V6K A;  1NJZ A;  5J0T A;  4J9M A;  4DSI A;  1K1Q A;  2NRW A;  1B43 A;  3RB0 A;  4Q8F A;  4K4H A;  1JN3 A;  4CCH A;  9ICR A;  2LYH A;  5EWG A;  8ICS A;  4IRC A;  4J9P A;  1U48 A;  9ICI A;  4RQ1 A;  5EWE A;  2HHU A;  3OJS A;  3PO5 A;  2UVU A;  4M6W A;  3UXP A;  4JK1 A;  3T3F A;  1L3T A;  5CWR A;  4UB4 A;  2UVW A;  2UVV A;  1CEZ A;  1TAQ A;  5EOZ A;  3V7K A;  4PGQ A;  1UA0 A;  2BPC A;  3KHG A;  5L1J A;  3RRH A;  2VA2 A;  5KFM A;  3UQ2 A;  5BOL A;  2HHQ A;  4KN7 A;  4UB5 A;  4F4K A;  9ICK A;  3JPR A;  4UBC A;  2ZJ5 A;  3SZ2 A;  1ZQE A;  4IQW A;  5DKW A;  1RYS A;  4IR9 A;  7ICM A;  4C8L A;  4E0D A;  9ICA A;  8ICL A;  4DSK A;  1HUO A;  4B9V A;  3PO4 A;  4YXM A;  5KFS A;  5J2B A;  4BGD A;  2F1H A;  1TKD A;  4NXZ A;  1BPY A;  3ZD9 A;  4MF8 A;  2ISP A;  1DGS A;  2RDI A;  2B21 A;  2C2D A;  2ZUD A;  4YR2 A;  3RTV A;  1Z3E B;  1U45 A;  1D8Y A;  3EYZ A;  3HWT A;  2XY6 A;  9ICF A;  5KFK A;  5J2D A;  3UPQ A;  3T5K A;  1HUZ A;  3Q8R B;  1RYR A;  5KFT A;  3RJF A;  4KLD A;  4I28 A;  2W9M A;  2C22 A;  3RB4 A;  4Q8E A;  4LVS A;  2BCU A;  5KT3 A;  1QSS A;  4F4Y A;  3RR7 A;  4KLI A;  4KLQ A;  7ICE A;  4ECQ A;  2HHS A;  7ICV A;  4DLG A;  3PR4 A;  4QZH A;  2IA6 A;  3EW9 A;  3MFH A;  1COO A;  4J9S A;  2ALZ A;  5L9X A;  4DQQ A;  3H4D A;  1L3V A;  1ZQK A;  2NRT A;  2V9W A;  1DOQ A;  1V9P A;  3Q8S B;  3FYH A;  4KIT B;  5DB9 A;  5L1I A;  4J9K A;  7ICR A;  1Y88 A;  4IQU A;  3V6J A;  2NRX A;  2PFO A;  4RUC A;  1IM4 A;  2VA3 A;  4PHA A;  4I2F A;  3C1Z A;  5F9N A;  4BXO B;  2MUT A;  4ED6 A;  1D9D A;  5DG9 A;  5KT7 A;  4UB3 A;  4F4Z A;  1SKR A;  2UVR A;  5J0O A;  2FMP A;  1XS9 D;  3SYZ A;  1L5U A;  4NLG A;  3ZDC A;  2I1Q A;  2HVH A;  2J6T A;  5J0Q A;  5DDY A;  5KFP A;  4QWD A;  3RJE A;  3JPP A;  3GIJ A;  5HMM A;  1SL1 A;  3ZDD A;  2BCR A;  3TI0 A;  5KFW A;  4XUS A;  5DB6 A;  3HX0 A;  4RPX A;  3BJY A;  1KTQ A;  8ICU A;  7ICJ A;  5KG3 A;  3UXO A;  3ISC A;  2F1J A;  3LDA A;  2V4Q A;  4P4M A;  2BPF A;  3GV8 B;  9ICB A;  1ZQF A;  4YR0 A;  4QWC A;  3GV7 B;  4JV1 A;  3T5J A;  3BQT A;  3PML A;  1U47 A;  1T8E A;  4PGX A;  4DL3 A;  2JZB B;  2BQU A;  2A1J A;  1X9S A;  3OSP A;  4B9L A;  3MBY A;  4ECV A;  3TAQ A;  7ICF A;  4KN4 A;  1NK9 A;  1ZQI A;  1XWL A;  4GXK A;  5J2C A;  3M8R A;  3C2K A;  3RH6 A;  1QSY A;  4RNN A;  2I9G A;  1TAU A;  5J0R A;  2XCA A;  4KMU A;  1KEJ A;  4XA5 A;  3BDP A;  1LB2 B;  5DBC A;  3RJH A;  4FBT A;  4KLG A;  3K4G A;  4JWM A;  2KTQ A;  4YMM A;  4EBE A;  4I2G A;  4XRH A;  8ICR A;  8ICF A;  2R8K A;  1XSL A;  5L1L A;  2ZTC A;  4NLK A;  4O0I A;  8ICI A;  4F92 B;  3KTQ A;  4QZE A;  2F1I A;  1NK4 A;  2Y1I A;  5KG1 A;  2IHN A;  5KFC A;  1BPZ A;  2DPI A;  2AQ0 A;  3RJG A;  1BVS A;  9ICL A;  4DO9 A;  5IIL A;  3OHA A;  2XY7 A;  2JEF A;  4MFF A;  3RAX A;  3TAN A;  2IMW P;  4YD1 A;  2XGP A;  3TFS A;  2VA8 A;  4M9J A;  7ICI A;  3SI8 A;  2P66 A;  4DSE A;  8ICT A;  4JWN A;  5J2A A;  4I29 A;  4O3O A;  3PX4 A;  9ICU A;  5III A;  1KFT A;  3LWL A;  4KLF A;  1HJP A;  1ZQJ A;  4QWB A;  4ED3 A;  4RUA A;  3EPI A;  5D46 A;  3QEA Z;  5KG6 A;  4O3S A;  2C2R A;  4C8O A;  2AGP A;  1ZQM A;  2JEG A;  1RZT A;  4ED7 A;  1NJY A;  2W9B B;  4YMN A;  3RBE A;  4EZ6 A;  2KFN A;  4QZC A;  2PXI A;  2W9B A;  9ICV A;  4I2E A;  5J2F A;  3T5L A;  1ZQD A;  1S0M A;  5J2G A;  4GXJ A;  1XSP A;  4TUR A;  4X5V A;  4I2H A;  3C2M A;  3H8S A;  8ICA A;  7ICS A;  3NGD A;  3V7L A;  4QZG A;  2ASJ A;  4DWI A;  1S97 A;  2BCS A;  4UAY A;  3PY8 A;  5HP4 A;  2ZUB A;  3IM1 A;  4DOB A;  3PW7 A;  4KLM A;  3EPG A;  5J0X A;  2ISO A;  1ZJM A;  4O3R A;  4JV0 A;  1NK8 A;  8ICG A;  2AGQ A;  3V7J A;  2JZB A;  5KFQ A;  4YVZ A;  4UAW A;  4MFA A;  3PMN A;  1A77 A;  1ZET A;  4EBD A;  2WTF A;  2BQR A;  4ED0 A;  1XSN A;  1PZN A;  3OHB A;  1NK5 A;  1KDH A;  5J2K A;  2FPL A;  1KFD A;  1JX4 A;  4FS1 A;  5D49 A;  3BQ2 A;  4P4P A;  5KT4 A;  5KFX A;  3Q8M A;  4LZG A;  4YCX A;  4RU9 A;  2MAX A;  5DQI A;  4QZI A;  3GIK A;  3G6Y A;  2W8L A;  4ECY A;  3RJI A;  1ZJN A;  1S10 A;  9ICO A;  4DQP A;  2AU0 A;  3G6V A;  8ICY A;  5DQG A;  4QW9 A;  5KT5 A;  1S76 D;  8ICC A;  2W9C B;  3BQ0 A;  3MDA A;  1BPX A;  4DS4 A;  2FMS A;  4I2A A;  4O5E A;  4R63 A;  4ECR A;  2AQ4 A;  2DFL A;  4UBB A;  4M0A A;  4RQ3 A;  4DS5 A;  1ARO P;  4QZF A;  5JUM A;  4RPY A;  4DQI A;  4O3Q A;  3THV A;  3RAQ A;  4F50 A;  4IR1 A;  4KLL A;  4DL5 A;  4M04 A;  3MFI A;  5J0U A;  4RNO A;  4RPZ A;  4C8N A;  4ECU A;  1C7Y A;  3SV4 A;  3TAP A;  1BPB A;  3Q8P B;  4ED8 A;  1L3U A;  2BKE A;  5DB8 A;  1NKE A;  8ICN A;  3C23 A;  4P4O A;  3M9O B;  4J9R A;  7ICT A;  3GIL A;  5J0S A;  8ICP A;  5J2E A;  3TFR A;  4M9H A;  1XC9 A;  5DLG A;  4ECT A;  2C2E A;  1ZQR A;  1ZQH A;  3ZDE A;  3PV8 A;  1TK8 A;  1ZQV A;  3MGH A;  1T3N A;  1SL0 A;  4YD2 A;  2KZ3 A;  1KLN A;  3ZDA A;  4HYK A;  1WCL A;  3ZD8 A;  1B22 A;  4IQV A;  3K75 D;  4K4G A;  4QZ8 A;  4GC6 A;  4ED2 A;  3HPO A;  3RJJ A;  4M9G A;  1ZQB A;  3N97 B;  1EXN A;  4UAZ A;  4UB2 A;  2JEJ A;  2HHX A;  3H8W A;  4JV2 A;  4DFP A;  2XO7 A;  2AJQ A;  1Z00 B;  3M8S A;  4I27 A;  4I2I A;  2NRV A;  5J2J A;  4IQT A;  3HW8 A;  5L1K A;  4J9Q A;  4GC7 A;  1QTM A;  1S0V A;  3JPO A;  1MQ3 A;  4FO6 A;  4MEY A;  4F5R A;  4LZD A;  4I2J A;  4R65 A;  3GIM A;  2Q0Z X;  1TK5 A;  2W9C A;  4F8R A;  5KFD A;  2V4R A;  2ZTD A;  2BCV A;  4I2C A;  4KLJ A;  8ICM A;  9ICG A;  4YR3 A;  4PGY A;  4DOA A;  5KFG A;  3OSN A;  4NM2 A;  4R8U A;  5KFV A;  5DG8 A;  4B9T A;  5TZV A;  5C5J A;  2W8K A;  5CB1 A;  1L3S A;  4DL7 A;  2JEI A;  5KFF A;  5KG4 A;  4B9U A;  4EBC A;  8ICO A;  4TQS A;  2DPJ A;  4YMO A;  1MC8 A;  4DFM A;  2P6R A;  4ELV A;  3JPN A;  2BGW A;  5KFE A;  4ECW A;  1UA1 A;  4DSL A;  3KHR A;  3AU6 A;  3Q8L A;  2P6U A;  3BQ1 A;  2PI4 A;  3H8J A;  7ICN A;  2ATL A;  4ELU A;  4UB1 A;  4DFK A;  4B9N A;  4YN4 A;  1JXE A;  1BPD A;  4F4X A;  5DQH A;  5HNK A;  3GV5 B;  5CP2 A;  1K1S A;  1ZQZ A;  4R8U B;  1X9M A;  1ZQQ A;  1S0O A;  1CUK A;  3PR5 B;  1NKB A;  1JXL A;  4F2R A;  4PHE A;  2PFN A;  2KFZ A;  5KT2 A;  3ZDB A;  3B0Y A;  3SV3 A;  7ICH A;  3RBD A;  1ZQC A;  2OWO A;  4JUZ A;  3PW5 A;  4YP3 A;  2HW3 A;  3GII A;  4UQG A;  1TV9 A;  2BPG A;  8ICH A;  4YXJ A;  3PX6 A;  9ICT A;  4YFK A;  4QZB A;  3M9M B;  3ISB A;  5KFN A;  5EWF A;  4PHP A;  3MDC A;  5KFL A;  1BPE A;  2BQ3 A;  3RH4 A;  4KLS A;  3GDX A;  1T7P A;  2ASL A;  2PFQ A;  9ICC A;  5KTQ A;  8ICX A;  5DLF A;  4NLZ A;  9ICJ A;  2BR0 A;  5J0P A;  3KHL A;  3M9N B;  3C2L A;  1H38 A;  8ICJ A;  3Q8Q B;  3KHH A;  2M9N A;  3C21 A;  2Y1J A;  5KFY A;  1ZQU A;  1WCN A;  4BWJ A;  4DSJ A;  3PW2 A;  3PW0 A;  1NOM A;  9ICM A;  4YQW A;  4KLH A;  3PVX A;  4DL4 A;  5KG7 A;  9ICH A;  4C8M A;  3QZ8 A;  3GQC A;  3RRG A;  4F4W A;  3OJU A;  1NK7 A;  2J6S A;  4RT3 A;  4ECX A;  2RDJ A;  7ICQ A;  4EZ9 A;  3UQ0 A;  4Z6C A;  3ETL A;  2ZJ8 A;  8ICE A;  5IIJ A;  1RXV A;  4MEX A;  2BCQ A;  8ICW A;  4DL6 A;  4IRK A;  4O5K A;  5BPC A;  3OGU A;  2HHW A;  3H7I A;  5KFO A;  3MR5 A;  2PI5 A;  5KFJ A;  4RQ2 A;  9ICP A;  1D8L A;  1U9L A;  5CHG A;  1NK0 A;  2VAN A;  3MAB A;  4O3P A;  5J0Y A;  3RB3 A;  5KFA A;  3V72 A;  1S0N A;  2GWS A;  4F93 B;  5DG7 A;  4DEZ A;  3EZ5 A;  4KTQ A;  9ICQ A;  2IBK A;  2C28 A;  4NLN A;  5IIO A;  4K4I A;  4TUS A;  3E2E A;  2MUT B;  4F2S A;  1X2I A;  1ZQW A;  3JPS A;  1NJW A;  4PH5 A;  3T5H A;  4DLE A;  1NKC A;  4TUQ A;  5IIK A;  1TVA A;  2NRZ A;  1NK6 A;  7ICK A;  4QWA A;  1QLN A;  4TQR A;  3JPQ A;  5J2I A;  4BXO A;  3EWA A;  1T4G A;  4DOC A;  4F91 B;  2XGQ A;  4KLT A;  8ICK A;  1Z00 A;  3RH5 A;  7ICO A;  4QZD A;  2FLP A;  4TUP A;  4DQS A;  5KFI A;  4F3O A;  1S77 D;  1UT8 A;  3GFK B;  4J9L A;  5DGA A;  4O9M A;  1SZP A;  2IHM A;  4RQ4 A;  4ZH4 A;  4RQ6 A;  5KFB A;  5KFR A;  5IIM A;  3MR2 A;  1SL2 A;  9ICE A;  1QSL A;  4IRD A;  2R8J A;  5KG5 A;  1KSP A;  4R64 A;  2KZZ A;  2BDP A;  5KFH A;  8ICB A;  5CR0 A;  4F5O A;  1TK0 A;  7ICP A;  3MR6 A;  1MSW D;  1BGX T;  4YG2 A;  4I2D A;  1KRP A;  3B0X A;  4DSF A;  1N56 A;  1ZYQ A;  4FBU A;  3FDS A;  7ICL A;  4RQ0 A;  4GLX A;  2A1J B;  3QE9 Y;  1SKS A;  1N48 A;  2HVI A;  5F9L A;  4B9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...