1Z00A

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00A01
5DBBA 4M9LA 2W8KA 1ZQFA 4R8UB 5KFLA 4R8UA 5DBCA 2PXIA 1XWLA 3M8SA 1TVAA 7ICIA 2ASLA 5KG1A 1ZQEA 4G3IA 4QZGA 5KFPA 7ICGA 1JIHA 1IM4A 2KZZA 4DL7A 5IILA 4DQPA 5C5JA 3IM1A 4FS2A 4PH5A 5CWRA 5EOZA 3BQ2A 3RAQA 8ICIA 2NRZA 4YVZA 5KFBA 2AGOA 1BPXA 3T5KA 5J0WA 3H4DA 5JUMA 5J0TA 5J0XA 4RNNA 4R64A 5CP2A 1TK5A 4KLLA 5KT7A 3HW8A 4B9UA 1IXRA 4F5OA 3GIJA 2MUTB 4F4WA 2ASDA 5KFYA 4ECTA 3SI8A 1ZQDA 2XCPA 4KLHA 4HYKA 4RT3A 4RU9A 3JPNA 8ICNA 4ECUA 3G6VA 4YMNA 4DF8A 1T3NA 8ICMA 4XUSA 2R8GA 2AQ4A 2ZJ8A 4TUQA 2BR0A 4RZRA 4J9QA 1RYSA 3T5JA 2WTFA 1JMSA 5KFRA 5HNKA 4DOBA 5CJ7A 2DPJA 4ECWA 1X2IA 8ICVA 2KZ3A 1S97A 3GQCA 4QZ8A 5KFFA 3PVXA 1L3VA 4O0IA 3QZ8A 1L3TA 2ZUBA 1BPBA 2JEIA 3UQ2A 2UVVA 1ZQPA 3M9OB 4DL2A 1AROP 2Y1IA 3AU2A 4BDPA 4I2CA 2J6TA 2W9CB 4JV0A 2W9CA 3TQ1A 4EBDA 4QZ9A 4J9RA 2BCSA 4DS4A 1S76D 4PGYA 9ICNA 9ICOA 2C28A 4FO6A 3AUOA 4J9NA 3H4BA 5DB6A 4TUSA 5KG0A 3MABA 2R8IA 2PI5A 2M9NA 3OHAA 7ICQA 4UBCA 9ICFA 4C8MA 4MEXA 1UA1A 3PW5A 2PFNA 5KT5A 4IR9A 4NLZA 4RQ7A 5J2KA 1ZJNA 4RPXA 2AJQA 3Q8SB 1WCLA 4DWIA 8ICCA 3PMNA 4I2HA 2BPFA 3OSNA 3MDAA 5EWEA 4RUCA 5DB7A 4DQQA 1WCNA 1NKEA 1UT8A 4MFAA 3Q8QB 4DSLA 3JPSA 4DLGA 1JXEA 1NJXA 5KFCA 4BXOB 2XCAA 4QW8A 2I9GA 4BXOA 4F8RA 1ZQKA 9ICJA 2VA8A 3PW0A 4ED8A 5CHGA 4GXKA 5J0PA 4M9HA 1NK9A 4DFPA 4UQGA 2R8HA 1S0NA 5KFWA 1UT5A 4KLOA 2VA3A 3RAXA 4NXZA 5L1JA 5L9XA 5IIOA 3JPRA 3RBDA 4YQWA 2ZJ5A 3SZ2A 4F92B 4F5RA 1ZQSA 2FMSA 4EYHB 4J9OA 3TARA 2HW3A 3ZDEA 4LVSA 1U48A 2W9MA 2FPMA 1BGXT 5EWFA 4IRCA 4I2FA 4I2BA 4O5KA 4RNOA 3TAQA 4QZEA 1NOMA 1KLNA 3B0XA 1ZQHA 4PGQA 4JK1A 4MF8A 4DOAA 4I2EA 5KT3A 4FS1A 3Q8PB 5KFGA 4YN4A 4J9MA 4BWMA 4GXIA 1NK4A 3LDAA 4I2GA 5KFHA 5KFDA 1SL2A 4O3NA 3T5HA 1MSWD 2VANA 1NKCA 1KTQA 4RPYA 1SKWA 4LZGA 5KG3A 3MGHA 1D9DA 5KFQA 4DQIA 4QZDA 1CUKA 1BPEA 1KFTA 3C5FA 1NK6A 3RJIA 3V6HA 2FPKA 4RQ4A 1ZQZA 2F1IA 1MQ2A 4FBTA 7ICVA 4F3OA 1ZQGA 1U49A 1RXWA 2C2RA 3GIKA 4ECZA 4DSJA 4KLJA 3EWAA 7ICFA 1ZQJA 2HVHA 9ICIA 1K1QA 3MR2A 3OJSA 5L1KA 4DEZA 4F5NA 7ICKA 1X9SA 4YXJA 4P4PA 4TURA 2A1JB 5J2IA 1L3SA 2BPGA 3RJEA 4IQVA 4PHDA 3RJJA 5KFXA 2HHUA 1ZQMA 2VA2A 3PY8A 3V6JA 3HP6A 5KFTA 2JEJA 2PFPA 8ICAA 4ED2A 1ZQLA 4ECSA 2ZUCA 5DQHA 4DF4A 5DQIA 2BCVA 5J0UA 3V6KA 5D46A 3RJGA 1XSPA 5CB1A 2RDIA 3K75D 4QZBA 3RB6A 3UXOA 1QSLA 2R8KA 1CEZA 1NJYA 1EXNA 4F5PA 3QEBZ 1XC9A 2BCUA 3NTUA 4K4GA 4DSEA 7ICEA 4YCXA 3TI0A 3TFRA 5J0RA 4B9VA 7ICPA 5KFKA 2UVRA 2BGWA 3PR5B 8ICOA 1HUZA 5TZVA 5DB9A 1XU4A 4ED3A 2XY5A 4M2YA 4KLTA 4I2JA 3RRHA 4C8LA 4EBEA 1ZQXA 4RQ0A 2AQ0A 1A76A 3LWLA 4DSIA 4O5CA 4M9NA 4UB5A 2V4RA 5DB8A 2LYHA 9ICAA 4DQSA 4X5VA 2P6RA 4I2AA 4KN7A 4Z6FA 3PX4A 2I1QA 3EW9A 3ORYA 3PV8A 3UXPA 3C2LA 3SV3A 4Z6CA 3PW4A 3SV4A 3ISBA 5IINA 4B9LA 4YMMA 2Y1JA 1ZQOA 1Y88A 5DDYA 4C8NA 2XY6A 2BKEA 2JEFA 5BOMA 4UAZA 2IBKA 4DSKA 4O9MA 4XQ8A 5J2GA 5J2CA 3HX0A 4DSFA 4QWEA 4EEYA 4R66A 4Q43A 4NY8A 4YR2A 7ICUA 1NJWA 5HHHA 4C8KA 4UAWA 4ECRA 4KLDA 5KG4A 2HHSA 2KFZA 4MFFA 3LWMA 9ICTA 4J9LA 5BPCA 4R65A 2AU0A 5DLFA 3LK9A 1XSNA 2UVUA 2HHWA 5IIKA 4XRHA 2MAXA 2RDJA 9ICVA 3PO5A 4R63A 4RT2A 4UB1A 4B9MA 2BQRA 3Q8KA 3RH6A 4F93B 4KLEA 3EYZA 3MBYA 3H7IA 1RXVA 4F4ZA 1U47A 2ZTCA 3BJYA 4B9NA 4ECQA 3KHRA 5J2DA 4J9KA 8ICXA 2IA6A 2OWOA 4Z6DA 1TKDA 5KFOA 2C2EA 5KFMA 3SYZA 5KT2A 3RJHA 4KN4A 4YFKA 5HHIA 4QWAA 3Q8LA 3H40A 3TFSA 1LV5A 1TK0A 2F1HA 4UB4A 4ECVA 3K4GA 1L3UA 3C2KA 4PHEA 2BCQA 1ZQTA 3HPOA 3HWTA 4O3RA 4GC7A 3RJFA 8ICRA 4ECXA 4DL6A 1NKBA 3PO4A 9ICBA 3E2EA 5KFAA 3MR3A 1TV9A 4O3OA 5F9NA 3JPTA 4F5QA 5J2JA 3RR7A 4MEYA 4QW9A 1NK0A 4DOCA 4PGXA 4IR1A 4F2SA 3BQ1A 4M47A 8ICJA 5KG2A 4ED1A 3V7KA 9ICCA 1SZPA 3H8JA 1S77D 5KFIA 2FLLA 2H5XA 4XA5A 3OSPA 1JXLA 4C8OA 4JWNA 3FYHA 3UQ0A 8ICWA 2NRWA 2XC9A 3C1YA 1ZQNA 3B0YA 2FMQA 2ISPA 7ICNA 8ICYA 4BGDA 3PX0A 9ICWA 4DL3A 4K4IA 7ICJA 8ICHA 4GC6A 8ICPA 3Q8RB 3V72A 1V9PA 4JV1A 4GLXA 2ZJAA 4NM2A 3ZD8A 2FPLA 3BQTA 3ISDA 5J0OA 4CCHA 2C22A 4O3QA 3MDCA 3RB4A 3NGDA 4DS5A 4ED0A 4M6WB 4DFMA 1BPZA 4M6WA 4UB3A 1KDHA 4RQ6A 3G6YA 3PX6A 5J2HA 5J2FA 4KLFA 3H8WA 3ZD9A 3Q8MA 2P66A 4YR3A 4QZHA 2PI4A 3RR8A 4ELUA 4DFKA 3C1ZA 4PHAA 5J0QA 5CR0A 3RB0A 1NK7A 3ZDBA 4KLUA 2KTQA 1N48A 2BQ3A 1XSLA 3MGIA 1L5UA 2HVIA 4QZIA 3ZDAA 8ICTA 1QTMA 1HUOA 2C2DA 4NM1A 3C5GA 3ZDCA 3EZ5A 2DFLA 4I2IA 8ICQA 2ZUDA 3MFHA 4PPXA 5DG8A 3M9NB 3RB3A 2PFOA 1ZQWA 5J2EA 1K1SA 3ZDDA 5HMMA 1ZQCA 1ZQRA 5KFUA 5DG9A 5IIMA 1QSYA 2F1JA 5DBAA 4IQWA 4M04A 4QWDA 4I27A 4NLGA 1S9FA 5KFSA 2KFNA 1TAUA 3RTVA 1SL0A 5DG7A 3PR4A 4I28A 4IRDA 4UAYA 1X9WA 1NJZA 5F9LA 3MFIA 3HT3A 4DO9A 1ZQIA 1ZJMA 4FBUA 4EZ9A 5D49A 5L1IA 2KN7A 4DFJA 3PW2A 9ICKA 4KLSA 2Q0ZX 2DPIA 4KMUA 4J9SA 2J6SA 2V9WA 3PW7A 2XO7A 1U45A 4M9GA 2HHQA 3T3FA 4RQ3A 4RQ1A 8ICUA 1ZQAA 2IHNA 1KRPA 2BDPA 5CA7A 3AU6A 4ECYA 1HJPA 1LB2B 4F2RA 4O5EA 1JN3A 1PZNA 2MUTA 1UA0A 4I29A 9ICMA 1ZQQA 7ICLA 5KT6A 1KFDA 3IHQB 3G6XA 3TAPA 3GILA 5D4BA 2JEGA 9ICLA 1SKSA 4YD1A 3RJKA 1ZQUA 5EWGA 9ICEA 4IQTA 5IIJA 3N97B 4IRKA 3M8RA 1MQ3A 9ICGA 1U9LA 4DQRA 3GFKB 9ICQA 2BHNA 5DDMA 4J9PA 8ICKA 8ICEA 5KG7A 3C23A 4ED7A 2IHMA 5DGAA 1MC8A 3GV7B 4DL5A 3QEAZ 3GIIA 2AGPA 4Q8EA 1ZYQA 4KLQA 4KITB 4ELTA 4QWCA 3GV5B 2FLPA 3KHLA 1NK5A 9ICXA 3KHGA 1D9FA 4KLGA 7ICTA 3N4MB 1BPDA 5J2AA 3QE9Y 3OGUA 2HHTA 4F91B 5DKWA 3RRGA 1A77A 1T4GA 4QZFA 1B43A 5BOLA 4RQ8A 4TQSA 3UPQA 2NRXA 1KFSA 4YXMA 5DGBA 2BCRA 5HMLA 4QWBA 5KFVA 3H8SA 3GIMA 2W9BB 4BWJA 2W9BA 3RH5A 4RNMA 5KFZA 4YMOA 5J2BA 3GDXA 1N56A 1BPYA 7ICHA 4UBBA 4EYIB 1RYRA 4M9JA 4MF2A 4EBCA 4Q45A 4MFCA 4JUZA 4KLIA 1KEJA 4TUPA 4LZDA 1DGSA 1RZTA 4YP3A 2R8JA 2HHXA 8ICFA 2KZMA 4YR0A 1T8EA 1T7PA 3FDSA 1D8YA 2XY7A 4RPZA 4NLNA 1DOQA 4E0DA 3JPOA 2FLNA 1QLNA 5KTQA 5KFNA 2NRVA 4UB2A 2J6UA 2AGQA 9ICSA 1B22A 1S0VA 4RQ2A 2JZBB 1ZQVA 4QZCA 3BQ0A 2JZBA 1H38A 1BVSA 8ICLA 1S10A 4F4XA 1TK8A 4O3PA 4Z6EA 5KG6A 8ICZA 3V7LA 3RH4A 1RPLA 3OHBA 1TFRA 9ICHA 3V7JA 1Z00B 1ZQYA 5IIIA 3PNCA 1Z00A 4TQRA 3OJUA 1NK8A 3QZ7A 3KTQA 4I2DA 3GV8B 2W8LA 3UXNA 3EPIA 4F4YA 3MR6A 4F50A 2IMWP 4M0AA 7ICMA 2W9AA 1U4BA 5DQGA 4JWMA 2FMPA 2BQUA 5KFJA 5HP4A 2ZTEA 2NRTA 3T5LA 3JPPA 3C2MA 4O3SA 1C7YA 1TAQA 4Q44A 1Z3EB 2ALZA 1S0MA 1SKRA 2HHVA 1ZETA 9ICUA 5J29A 3MR5A 3C21A 4DL4A 2ATLA 7ICOA 3ISCA 4B9SA 2ZTDA 4ED6A 2UVWA 9ICPA 4Q8FA 3PMLA 5KT4A 4KLMA 4PHPA 2GWSA 2BPCA 5KG5A 4K4HA 5DLGA 4YD2A 4ELVA 4KTQA 9ICRA 1SL1A 1COOA 3M9MB 4DLEA 2XGQA 8ICSA 2XGPA 4P4MA 4IQUA 4NLKA 3BDPA 5L1LA 1JX4A 1ZQBA 4QZAA 1X9MA 8ICBA 8ICGA 2PFQA 2P6UA 3EPGA 4GXJA 1XO1A 1S0OA 1KSPA 4ZH4A 7ICSA 2V4QA 1D8LA 5J0SA 4P2HA 1XS9D 4F4KA 4JV2A 3ETLA 7ICRA 3RBEA 2B21A 5J0YA 3KHHA 3TANA 5KFEA 4P4OA 4RQ5A 3JPQA 2ISOA 4B9TA 2A1JA 4YG2A 4EZ6A 4RUAA 3THVA 1QSSA 2ASJA
chains in the Genus database with same CATH superfamily
4C4RA 2WAQF 2W8KA 5KFLA 3M8SA 7ICIA 2Q4TA 2ZIXB 1ZQEA 2ZIXA 3NVVA 3I76A 4DQPA 1J2MA 3WK6A 3BQ2A 3RF9A 3RAQA 1YZ7A 2NRZA 3UMBA 1BPXA 5J0WA 5CP2A 5CEHA 4C0ZA 2MUTB 5ALFA 3TKAA 4F4WA 2ASDA 3ONNA 1YZ6A 3SI8A 4RU9A 4YMNA 2D8CA 1ECWA 1IG6A 4TUQA 3T5JA 2WTFA 5HNKA 5KL8B 1AQ6A 2ZUBA 1UCVA 2OCEA 3UQ2A 3BZCA 1RG6A 2DGZA 2GH1A 3M9OB 3L3FX 3AU2A 2LYBA 4BDPA 4JV0A 1S76D 4QJFB 4FO6A 1Z1BA 3MABA 4F71A 3KOOA 2DWQA 1ZXIA 4C8MA 4MEXA 4NLZA 5AKGA 4CF5A 1ZJNA 1SIJA 3WKBA 2AJQA 2RLTA 4DQQA 5DB7A 2KHVA 3Q8QB 2LM4A 1L8OA 2JR5A 2JHDA 1ZQKA 2VA8A 2DF4B 4ED8A 4M9HA 1S0NA 3RAXA 3QXGA 4AP9A 1ZOLA 4NXZA 2IOFK 3JPRA 5AM3A 4F5RA 4EYHB 4J9OA 4AYBC 4LVSA 1BGXT 2ODGA 4RNOA 3TAQA 4QZEA 1C20A 1KLNA 5KFGA 5CRXA 1ZQ1C 4NLBA 2W7OA 2BZFA 3LDAA 1SL2A 4O3NA 4RPYA 1SKWA 3HJEA 5AKLA 4LZGA 3M1YA 5KFQA 1N63A 5AM5A 5EE0A 3RJIA 4RQ4A 1ZQZA 7ICVA 4F3OA 1ZQGA 5AM0A 3FAHA 1K1QA 3MR2A 5L1KA 4F5NA 4P4PA 4TURA 2BPGA 4PHDA 5KFXA 5AKJA 2F44A 3PY8A 3HP6A 5KFTA 1PVQA 1ZQLA 2ZUCA 4DF4A 3PSTA 1CEZA 3RB6A 1NJYA 1T94A 3QEBZ 3WKEA 3U26A 1Z1VA 2UVRA 2KJ8A 3GU3A 3QU5A 2Y9TA 3RRHA 2KE7A 1A76A 2YQEA 3LWLA 2LMRA 5AICA 4DSIA 9ICAA 4Z6FA 3PX4A 2RQ5A 3UXPA 5KNIA 5IINA 4J03A 4UB8U 4UAZA 4XQ8A 2AHOB 4EEYA 4R66A 5AIBA 4YR2A 7ICUA 2KFZA 2HHSA 5ALVA 4UAWA 4ECRA 2Y9UA 9ICTA 2YY6A 3SAFA 5BPCA 4ICAA 2HHWA 5IIKA 5ALOA 9ICVA 2VIXA 3WK7A 2OEHA 1CRXA 3MGVA 4KX5A 3EYZA 4F4ZA 1URJA 4Y2XA 3KHRA 1B0XA 1ED1A 2IA6A 4Z6DA 3MC1A 2PMZC 3RJHA 5KT2A 4QWAA 4EX6A 5AKXA 3TFSA 4BUGA 4C7YA 2I6XA 4EELA 4UB4A 3CW2C 3K4GA 3C2KA 2BCQA 1TV9A 4F5QA 3JPTA 3F53A 5J2JA 4MEYA 4QW9A 1NK0A 4DOCA 3IDWA 4PGXA 2GOLA 1FIQA 1JUDA 3H8JA 4C4SA 2H5XA 4RQNA 4XA5A 3OSPA 4C8OA 4JWNA 1X42A 3QUQA 2XC9A 2FMQA 3B0YA 4BGDA 3PX0A 9ICWA 2OXOA 3V72A 4GLXA 4NM2A 3BQTA 1T3QA 5ALXA 2KIVA 3RB4A 1COKA 4ED0A 4FZMA 1KDHA 4RQ6A 3ZD9A 2PI4A 3RR8A 2CRXA 4DFKA 3RB0A 5CR0A 1NK7A 2BQ3A 1L5UA 1HUOA 2C2DA 3N7SC 4I2IA 2LHTA 3RB3A 5AI5A 4NLGA 3HKZC 4QWDA 4I27A 1FFUA 4GIBA 3PR4A 2XVTA 4UAYA 1N5XA 5J8YA 4DO9A 5T14A 1ZD3A 4EZ9A 5L1IA 3PW2A 2G08A 2OYYA 4KLSA 2V9WA 3PW7A 3T3FA 4RQ1A 1ZQAA 2IHNA 1RM6C 3AU6A 2JV3A 4I29A 2H3FA 2QKQA 2WAQC 7ICLA 3VC8A 1L8LA 5KT6A 3G6XA 3GILA 9ICLA 5IIJA 3M8RA 3I1YA 1MQ3A 1U9LA 9ICGA 5HR7A 3GFKB 5DDMA 5KG7A 4OD0A 2A3VA 5DGAA 3ED5A 2B0CA 2K4PA 2FLPA 3GV5B 9ICXA 2KSOB 3N4MB 1BPDA 2ZIUB 2FE9A 2K8AA 5BOLA 1DK2A 2G5HB 2CN1A 2W9BB 2W9BA 4YMOA 5ALEA 2NO4A 1RYRA 4MF2A 4JUZA 1KEJA 4LZDA 3VCBA 3WK9A 4PJ0U 2KZMA 1UPHA 2HBJA 4CF3A 4BX9C 9ICSA 3AM9A 1SZHA 2KOBA 1S10A 2GLEA 1TK8A 4CDGA 3PNCA 1ZQYA 2WF6A 4PL2A 4I2DA 2W8LA 2YMLA 3EPIA 4F50A 1S5LU 2W9AA 4JWMA 2ZTEA 1TAQA 4Q44A 2ALZA 2HHVA 2LBOA 9ICUA 3SENA 2ATLA 3ISCA 4B9SA 2UVWA 5AKIA 1UQVA 2WF8A 4KLMA 2BPCA 4KTQA 8ICSA 2DKXA 3QYPA 1JX4A 3F5EA 1X9MA 8ICBA 2PFQA 3EPGA 4GXJA 1XO1A 7ICSA 1XS9D 4F4KA 7ICRA 3ETLA 3RBEA 5J0YA 2WF9A 3KHHA 4B9TA 4NWIA 2ASJA 4PZOA 3KZIU 5DBCA 2GO7A 1HIWA 1SWWA 2YMPA 5KG1A 4OCZA 2KZZA 3PSIA 5EOZA 1SWVA 1MN8A 8ICIA 4YVZA 4RNNA 4B9UA 1F0MA 4F5OA 1RQLA 5KFYA 1GO3F 8ICNA 2KP7A 2KKPA 3HILA 2LYAA 2NV3A 8ICMA 2R8GA 2ZJ8A 4FFDA 3QU2A 4NJ8A 4RZRA 4J9QA 2KKVA 4DOBA 4Y2QA 3GZFA 1L3VA 2RRDA 3BS7A 2K4IA 4UAVA 2UVVA 5ALDA 3OPXA 4DL2A 2Y1IA 3M7DA 9ICNA 4PGYA 3EUB2 4J9NA 1LKYA 1N61A 5AKHA 5DB6A 2R8IA 2M9NA 4UBCA 1L7OA 1UA1A 1L6NA 3Q8SB 1WCLA 4FE3A 2P35A 5EWEA 2R18A 3JPSA 4DLGA 1P7DA 3DDHA 1BNPA 2QLTA 4BXOB 2I9GA 4BXOA 9ICJA 5ALHA 3PW0A 5ALGA 5J0PA 1NK9A 2VA3A 5L9XA 5IIOA 3RBDA 4YQWA 2ZJ5A 3SZ2A 2OHFA 1TAMA 4ACOA 2D6FC 1FFVA 2HW3A 3ZDEA 4IRCA 2YMMA 4I2BA 1NOMA 1ZQHA 4DOAA 5KT3A 4J9MA 5EE1A 4I2GA 5KFHA 5KFDA 1NI3A 4NL9A 1UHUA 1CUKA 1BPEA 1KFTA 3C5FA 2EZYA 3QNMA 1MQ2A 5EE9A 1U49A 4KLJA 5ALMA 3EWAA 2HVHA 2JMGA 5AI9A 1X9SA 3IN5A 2A1JB 4NL9C 2VA2A 8ICAA 1KN5A 5GTIU 4ECSA 2ESEA 1N2XA 2BCVA 5J0UA 2R8KA 3K75D 4F5PA 1XC9A 4YCXA 4B9VA 3NVYA 5KFKA 2BGWA 2W54A 1XU4A 2QARB 3D6JA 2QARA 2XY5A 1QH9A 4M2YA 1M6YA 2HOFA 1N5WA 2ZIVB 2ZIVA 2LYHA 4DQSA 3T79A 3EW9A 3ORYA 3SV4A 4B9LA 4YMMA 2Y1JA 4C8NA 2XY6A 2JEFA 2BKEA 4O9MA 5J2CA 1OUQA 3HX0A 4DSFA 1X40A 4C8KA 4KLDA 2LKYA 4J9LA 2O6KA 2YMQA 4R65A 5DLFA 1XSNA 1JRPA 4XRHA 2MAXA 2XICA 4RT2A 4EX7A 3RH6A 3MBYA 2KVSA 4ECQA 4J9KA 8ICXA 1TKDA 5KFOA 2C2EA 4KN4A 2DKZA 4YFKA 1JALA 1LV5A 3UM9A 1TK0A 3SD7A 5AI8A 4LJXA 3HPOA 3HWTA 4O3RA 3KFUF 3RJFA 8ICRA 9ICBA 4O3OA 3UMGA 2YTUA 2WF5A 4F2SA 1L7NA 4M47A 1DGJA 5KG2A 2W7PA 1S77D 5KFIA 3UQ0A 3C1YA 8ICYA 3BZKA 4K4IA 4FZNA 4GC6A 5L1MA 1NZPA 3ISDA 3AMZA 1N60A 4CCHA 2C22A 4O3QA 3MDCA 2QB0A 3QUCA 3G6YA 5J2HA 5AKZA 5J2FA 3Q8MA 2NYVA 2N1RA 4YR3A 4ELUA 3C1ZA 4PHAA 3ETRA 1N48A 3MGIA 2HVIA 4QZIA 8ICQA 1QQ7A 3MFHA 5DG8A 3ZDDA 2HSZA 1QSYA 1VJ5A 5KFUA 5DG9A 2AXTU 1RQNA 5FP0A 3RTVA 4IRDA 5G5GA 1X9WA 3NRWA 1ZQIA 4FBUA 3AQEA 4B6JA 5B66U 2K8BB 2K4HA 2XO7A 4M9GA 3LVWA 2OM6A 1KRPA 2E1EA 1HJPA 4F2RA 4O5EA 5D4BA 2JEGA 3RJKA 4IRKA 3N97B 1BNOA 1ZD4A 5EE3A 2A19A 5GTHU 8ICKA 5ALRA 3M6KA 1MC8A 2AH5A 3QEAZ 4Q8EA 3GIIA 3D2SA 1ZYQA 4UARA 1J97A 3KHLA 5J2AA 3QE9Y 5DKWA 2JXJA 1NZBA 4YXMA 2BCRA 4QWBA 2G0AA 1XNSA 3GIMA 5J2BA 1N56A 1L7PA 1F5SA 4UBBA 2KMDA 5KL1B 4Q45A 1RZTA 4TUPA 1DGSA 2R8JA 4YP3A 2NO5A 1T7PA 2Y0SC 3QU7A 1D8YA 4CE6A 4NLNA 1HEKA 2FLNA 2EZZA 5KTQA 1B22A 2ZG6A 2JRZA 4F4XA 8ICZA 3RH4A 1TFRA 3V7JA 5IIIA 4TQRA 4OJOA 3QZ7A 2KVCA 3UXNA 2WB1F 2IMWP 3IRUA 7ICMA 1SXEA 1KW4A 5HP4A 4O3SA 3T5LA 3C2MA 2PKEA 1Z3EB 2XIDA 1ZETA 3CNHA 2KJ5A 5J29A 4DL4A 7ICOA 2L5YA 2ZTDA 4ED6A 2GWSA 2CPRA 4K4HA 5DLGA 1COOA 3M9MB 2YN4A 3ZI4A 4IQUA 3BDPA 5L1LA 1ZQBA 3NRZA 4QZAA 1DK3A 2P6UA 1KSPA 4ZH4A 2V4QA 3C28A 3O0FA 1SGGA 4U7CA 1QQ5A 3TANA 4P4OA 3JPQA 4YG2A 4EZ6A 5B5EU 4RUAA 3K1RB 1Q3VA 1QSSA 4R8UB 4R8UA 2PXIA 3IV6A 3D2QA 2ASLA 1D8BA 4G3IA 4DL7A 5IILA 2FDRA 5C5JA 3IM1A 3F2BA 2W11A 5CWRA 5KFBA 2AGOA 3N7PD 3IG5A 4R64A 4KLLA 3HW8A 4RT3A 3JPNA 3G6VA 1DRGA 1L7MA 3KD3A 4DF8A 1T3NA 4XUSA 2AQ4A 5J8YC 3BS5B 3BS5A 1RYSA 5KFRA 2DPJA 4ECWA 1X2IA 8ICVA 2KZ3A 1S97A 3PVXA 5KFFA 2HBMA 3KKAA 4HAIA 1L3TA 4P0PB 5ALJA 4P0PA 2EAMA 1OXJA 4I2CA 2KV2A 2W9CB 2W9CA 3TQ1A 4QZ9A 2BCSA 4DS4A 9ICOA 1JI7A 4QNLA 3H4BA 2PI5A 3OHAA 2EAOA 9ICFA 3C29A 1SXDA 2PFNA 3H0MB 4RQ7A 5J2KA 4DWIA 3KKAC 2BPFA 3OSNA 3LVVA 2KG5A 4QW8A 4F8RA 1WWVA 5CHGA 2R8HA 1UT5A 4CNQA 5HR6A 2DL0A 1LVHA 1Z4OA 4F92B 2FMSA 3TARA 1VDVA 1PUZA 1WYGA 1U48A 4I2FA 4CF4A 5AHXA 5ALPA 2W3SA 3H8MA 4JK1A 1RYUA 4QIWF 3D2NA 4YN4A 3PZPA 3T5HA 3NVWA 2VJ4A 1NKCA 1KTQA 4WJ3B 2HBLA 2FI1A 1FO4A 5KG3A 3MGHA 2DQNB 5A0LA 2EDUA 4QZDA 4C4TA 1RDFA 2F1IA 3QUTA 5ALYA 4FBTA 1B4FA 3PSPA 4ECZA 7ICFA 4Y2YA 4DEZA 2HI0A 5AK4A 4YXJA 3RJEA 4IQVA 2HHUA 1ZQMA 3WK4A 3V6JA 5ALTA 2PFPA 5JTIA 5DQIA 3V6KA 3RJGA 1XSPA 5CB1A 2RDIA 1QSLA 3UXOA 5ALQA 1N62A 2BCUA 4K4GA 4DSEA 3PR5B 8ICOA 5DB9A 2KJ9A 2W3RA 2HDOA 3L4PA 4KLTA 2IOHA 4C8LA 4EBEA 4RQ0A 2AQ0A 5AM2A 4UB5A 2V4RA 5AI6A 2ZXHA 4I2AA 4KN7A 4USAA 1FEZA 3PV8A 3SV3A 3OTQA 4Z6CA 3PW4A 4KMOB 1Y88A 5DDYA 2IBKA 5BOMA 4DSKA 5TISU 4CRXA 1KKXA 2E8PA 4OJ5A 1LKYB 3H0LB 5KG4A 2KD1A 4MFFA 3FM9A 1MA7A 2UVUA 2RDJA 2RHFA 3PO5A 3F2CA 4UB1A 3Q8KA 4KLEA 2H3IA 3H7IA 1U47A 5ALSA 3BJYA 4B9NA 5J2DA 2OWOA 5KFMA 3SYZA 3TACB 3H40A 5AK3A 3Q8LA 2F1HA 4UAUA 1ZQTA 4ECXA 1NKBA 1OW5A 3E2EA 1PK1A 3IP4B 5F9NA 4IR1A 1NNLA 3BQ1A 4ED1A 2KHQA 3V7KA 9ICCA 1SZPA 2WF7A 2FLLA 3FYHA 8ICWA 1ZQNA 2ISPA 4DL3A 8ICHA 4PL1A 8ICPA 2E8MA 3Q8RB 4JV1A 2ZJAA 3IG8A 3ZD8A 5ALLA 1WG8A 2EAPA 4ZOHC 5C0YA 3DV9A 4M6WB 1BPZA 4M6WA 4UB3A 4OJPA 3PX6A 4KLFA 3HKZF 4QZHA 2WB1C 5J0QA 2KTQA 4KLUA 4Y2PA 1X66A 1O03A 2YX8A 3AQFA 2F76X 3A0HU 3ZDAA 8ICTA 4NM1A 5ALUA 3C5GA 3EZ5A 2DFLA 2ZUDA 4IC9A 1SV0A 3TADA 1ZQWA 5J2EA 5HMMA 1ZQRA 3QU9A 4M04A 2F1JA 5DBAA 3AN1A 5KFSA 1S9FA 2KFNA 3SAHA 1S8OA 5DG7A 4I28A 3WKCA 5F9LA 3MFIA 1ZJMA 5D49A 5AI4A 3AL0B 4DFJA 3H0RB 2Q0ZX 2DPIA 2J6SA 5JRTA 1U45A 5AK5A 2W43A 8ICUA 3AEVA 1SV0C 5CA7A 4ECYA 1LB2B 3TADC 1JN3A 1PZNA 2MUTA 1UA0A 3SAGA 1ZQQA 1KFDA 1CI4A 4YD1A 2K60A 5EWGA 9ICEA 1PVRA 4DQRA 9ICQA 2BHNA 8ICEA 3C23A 2MU2A 4ED7A 2IHMA 4DL5A 4EENA 4QWCA 2HMXA 2M0NA 3KHGA 7ICTA 1A0PA 3OGUA 1V38A 4F91B 3RRGA 3UPQA 1PK3A 4QZFA 1B43A 4RQ8A 4TQSA 2NRXA 2W03A 4A8EA 5HMLA 1V85A 4RNMA 5KFZA 3GDXA 1VLBA 7ICHA 2MRLA 4M9JA 5AM4A 4EBCA 4MFCA 8ICFA 1T8EA 2XY7A 1DOQA 3JPOA 2G06A 1QLNA 2J6UA 1JROA 4UB2A 2MA1A 2F8KA 4RQ2A 3BQ0A 1ZQVA 4C80A 4QZCA 3N28A 1H38A 2Z7JA 8ICLA 9ICHA 3OHBA 1NK8A 4F4YA 3MR6A 4M0AA 4JMUA 1U4BA 3B9JA 5KFJA 2NRTA 1SKRA 2KIWA 2QB0B 2IOFA 3S6JA 2E8OA 3MR5A 3C21A 9ICPA 4Q8FA 3PMLA 2EANA 5KT4A 2LPEA 5KG5A 4CGZA 1ZRMA 3ICXA 2DBYA 4QIWC 8ICGA 1TE2A 5J0SA 5KFEA 3NUQA 3THVA 1KL9A 5DBBA 3WKDA 4M9LA 1ZQFA 4PZNA 1XWLA 1V97A 1TVAA 2G07A 4QZGA 5KFPA 5ALZA 1JIHA 1IM4A 7ICGA 1Z19A 4FS2A 4PH5A 3T5KA 3H4DA 5JUMA 5J0TA 5J0XA 1TK5A 5KT7A 1IXRA 2DUYA 3GIJA 4NV0A 2G5IB 4ECTA 2F2AB 1ZQDA 2XCPA 4KLHA 4HYKA 2B6GA 2W04A 4ECUA 2RP5A 2HCFA 2OH2A 2BR0A 2K4EA 1KBUA 1JMSA 5CJ7A 4UW9A 3QUBA 3GQCA 4QZ8A 1YT3A 3A0BU 4O0IA 3SEIA 3QZ8A 4UASA 1BPBA 2JEIA 1QCKA 3UMCA 1ZQPA 1AROP 4Y2UA 2J6TA 4EBDA 4J9RA 1Q8KA 2C28A 3AUOA 4TUSA 5KG0A 7ICQA 3PW5A 5KT5A 4IR9A 4RPXA 2HBKA 3QU4A 4F72A 8ICCA 3PMNA 4I2HA 3MDAA 4GFJA 4RUCA 1WCNA 1NKEA 4OJLA 1UT8A 4MFAA 4DSLA 5ALIA 5AM1A 4UATA 3L5KA 1K5OA 1JXEA 1NJXA 5KFCA 2XCAA 1J2NA 4Y2VA 4GXKA 4KLOA 4DFPA 4UQGA 2H3VA 5KFWA 4Y2RA 5L1JA 2HOQA 1QQ6A 1ZQSA 2W9MA 2FPMA 5EWFA 4O5KA 2KEYA 5JU5A 1XO0A 3B0XA 4PGQA 4MF8A 4I2EA 4FS1A 3Q8PB 2EZXA 4BWMA 4GXIA 1NK4A 5K4LA 1KQQA 5AK6A 1MSWD 2VANA 5ALNA 1ZD2P 3N7RC 1D9DA 2K89A 4DQIA 1SV4A 2KK0A 1PVPA 1NK6A 3V6HA 2FPKA 1RXWA 4DSJA 2C2RA 3GIKA 2A1AA 2FJ6A 1ZQJA 9ICIA 4RQMA 3OJSA 3ALRA 3NS1A 7ICKA 1F44A 5J2IA 1L3SA 3SR6A 3RJJA 3F2DA 3KZXA 4BJQA 2JEJA 2H3QA 4P0QB 4ED2A 4P0QA 5DQHA 5D46A 2HOIA 4QZBA 1EXNA 2E1FA 3NTUA 7ICEA 3TI0A 3TFRA 5J0RA 7ICPA 1HUZA 3E58A 5TZVA 2E8NA 2ZXIA 4ED3A 4I2JA 2I5HA 2MSNA 1ZQXA 2G09A 2ES6A 4O5CA 2WFAA 2JH7A 4UB6U 4M9NA 5DB8A 4X5VA 2P6RA 2I1QA 3C2LA 3R9KA 3ISBA 1ZQOA 3DEEA 2F3NA 5J2GA 3BQ7A 4QWEA 1DXSA 4Q43A 5ALKA 4NY8A 2JGAA 1NJWA 5HHHA 3LWMA 1IV8A 3NVZA 2AU0A 2YB4A 3LK9A 5AIAA 4R63A 5G5HA 2D3DA 2KSOA 4B9MA 2BQRA 4AYBF 4F93B 1RXVA 2ZIUA 2ZTCA 3NASA 3J81j 5KAFU 1IIPA 5HHIA 3QX7A 4ECVA 1L3UA 4PHEA 4Y2SA 4GC7A 4DL6A 3PO4A 5KFAA 3MR3A 4G9BA 2ZIWB 2ZIWA 3K1ZA 3RR7A 2W55A 4KX3A 4Y2JA 2LM1A 8ICJA 2F8LA 2BDUA 3SMVA 2VJ5A 4O3MA 1JXLA 1WUDA 2NRWA 7ICNA 5AI0A 2KICA 3WKAA 7ICJA 2EQYA 1V9PA 2FPLA 1WWUA 5J0OA 3NGDA 4DS5A 2XI9A 4DFMA 1A6SA 3PSFA 3H8WA 2P66A 4Y2TA 3ZDBA 5KAIU 3KBBA 4U6PA 1XSLA 1QTMA 3ZDCA 1X9XA 4PPXA 3M9NB 4EEKA 2PFOA 1K1SA 1ZQCA 3E0FA 5IIMA 4IQWA 1TAUA 2WHEA 1SL0A 1NJZA 3HT3A 3CYMA 2KN7A 9ICKA 4C7ZA 2F77X 4KMUA 4J9SA 2HHQA 5AKKA 4RQ3A 2BDPA 1ZRNA 4IL6U 9ICMA 2QB1A 3IHQB 3TAPA 1SKSA 4DCCA 1ZQUA 4IQTA 4NLCA 4J9PA 2PMZF 3GV7B 2AGPA 3FC4A 2K8CB 4KLQA 4KITB 4ELTA 4FZLA 3I28A 3WK5A 1NK5A 1D9FA 4KLGA 2E5SA 3RFAA 2E3TA 5AKYA 4MHVA 2HHTA 3LYSA 2Y0SF 1Q3UA 1A77A 1T4GA 1KFSA 5DGBA 5KFVA 3H8SA 4BWJA 3RH5A 5E79U 3WK8A 3WU2U 1X6IA 1BPYA 4EYIB 5H2FU 9ICRA 4KLIA 2HHXA 2YB1A 4YR0A 4OO1J 3FDSA 1PK1B 1SB3C 4RPZA 2JH1A 4JB3A 5KFNA 2NRVA 2AGQA 1S0VA 2JZBB 2JZBA 5ALWA 1BVSA 2EH9A 4O3PA 4Z6EA 5KG6A 3V7LA 1RPLA 2VKQA 5F3XB 1Z00B 1Z00A 3OJUA 4US9A 3KTQA 3GV8B 4IS7A 2CXYA 1Z4NA 5DQGA 3CRXA 1Q46A 2FMPA 2BQUA 3JPPA 1C7YA 1S0MA 3M6ZA 2LI6A 4PHPA 4DFDA 4ELVA 4YD2A 1SL1A 4DLEA 2XGQA 5AKEA 2XGPA 4P4MA 3SQIA 4NLKA 1X6JA 3F5AA 2H3ZA 1S0OA 4US8A 1ZD5A 1D8LA 4P2HA 4OJ6A 4JV2A 3CP8A 2B21A 2KNJA 4RQ5A 2ISOA 2A1JA 3HRDD 1O08A 4E0DA
chains in the Genus database with same CATH topology
5DBBA 4M9LA 2W8KA 1ZQFA 4R8UB 5KFLA 4R8UA 5DBCA 2PXIA 1XWLA 3M8SA 1TVAA 7ICIA 2ASLA 5KG1A 1ZQEA 4G3IA 4QZGA 5KFPA 7ICGA 1JIHA 1IM4A 2KZZA 4DL7A 5IILA 4DQPA 5C5JA 3IM1A 4FS2A 4PH5A 5CWRA 5EOZA 3BQ2A 3RAQA 8ICIA 2NRZA 4YVZA 5KFBA 2AGOA 1BPXA 3T5KA 5J0WA 3H4DA 5JUMA 5J0TA 5J0XA 4RNNA 4R64A 5CP2A 1TK5A 4KLLA 5KT7A 3HW8A 4B9UA 1IXRA 4F5OA 3GIJA 2MUTB 4F4WA 2ASDA 5KFYA 4ECTA 3SI8A 1ZQDA 2XCPA 4KLHA 4HYKA 4RT3A 4RU9A 3JPNA 8ICNA 4ECUA 3G6VA 4YMNA 4DF8A 1T3NA 8ICMA 4XUSA 2R8GA 2AQ4A 2ZJ8A 4TUQA 2BR0A 4RZRA 4J9QA 1RYSA 3T5JA 2WTFA 1JMSA 5KFRA 5HNKA 4DOBA 5CJ7A 2DPJA 4ECWA 1X2IA 8ICVA 2KZ3A 1S97A 3GQCA 4QZ8A 5KFFA 3PVXA 1L3VA 4O0IA 3QZ8A 1L3TA 2ZUBA 1BPBA 2JEIA 3UQ2A 2UVVA 1ZQPA 3M9OB 4DL2A 1AROP 2Y1IA 3AU2A 4BDPA 4I2CA 2J6TA 2W9CB 4JV0A 2W9CA 3TQ1A 4EBDA 4QZ9A 4J9RA 2BCSA 4DS4A 1S76D 4PGYA 9ICNA 9ICOA 2C28A 4FO6A 3AUOA 4J9NA 3H4BA 5DB6A 4TUSA 5KG0A 3MABA 2R8IA 2PI5A 2M9NA 3OHAA 7ICQA 4UBCA 9ICFA 4C8MA 4MEXA 1UA1A 3PW5A 2PFNA 5KT5A 4IR9A 4NLZA 4RQ7A 5J2KA 1ZJNA 4RPXA 2AJQA 3Q8SB 1WCLA 4DWIA 8ICCA 3PMNA 4I2HA 2BPFA 3OSNA 3MDAA 5EWEA 4RUCA 5DB7A 4DQQA 1WCNA 1NKEA 1UT8A 4MFAA 3Q8QB 4DSLA 3JPSA 4DLGA 1JXEA 1NJXA 5KFCA 4BXOB 2XCAA 4QW8A 2I9GA 4BXOA 4F8RA 1ZQKA 9ICJA 2VA8A 3PW0A 4ED8A 5CHGA 4GXKA 5J0PA 4M9HA 1NK9A 4DFPA 4UQGA 2R8HA 1S0NA 5KFWA 1UT5A 4KLOA 2VA3A 3RAXA 4NXZA 5L1JA 5L9XA 5IIOA 3JPRA 3RBDA 4YQWA 2ZJ5A 3SZ2A 4F92B 4F5RA 1ZQSA 2FMSA 4EYHB 4J9OA 3TARA 2HW3A 3ZDEA 4LVSA 1U48A 2W9MA 2FPMA 1BGXT 5EWFA 4IRCA 4I2FA 4I2BA 4O5KA 4RNOA 3TAQA 4QZEA 1NOMA 1KLNA 3B0XA 1ZQHA 4PGQA 4JK1A 4MF8A 4DOAA 4I2EA 5KT3A 4FS1A 3Q8PB 5KFGA 4YN4A 4J9MA 4BWMA 4GXIA 1NK4A 3LDAA 4I2GA 5KFHA 5KFDA 1SL2A 4O3NA 3T5HA 1MSWD 2VANA 1NKCA 1KTQA 4RPYA 1SKWA 4LZGA 5KG3A 3MGHA 1D9DA 5KFQA 4DQIA 4QZDA 1CUKA 1BPEA 1KFTA 3C5FA 1NK6A 3RJIA 3V6HA 2FPKA 4RQ4A 1ZQZA 2F1IA 1MQ2A 4FBTA 7ICVA 4F3OA 1ZQGA 1U49A 1RXWA 2C2RA 3GIKA 4ECZA 4DSJA 4KLJA 3EWAA 7ICFA 1ZQJA 2HVHA 9ICIA 1K1QA 3MR2A 3OJSA 5L1KA 4DEZA 4F5NA 7ICKA 1X9SA 4YXJA 4P4PA 4TURA 2A1JB 5J2IA 1L3SA 2BPGA 3RJEA 4IQVA 4PHDA 3RJJA 5KFXA 2HHUA 1ZQMA 2VA2A 3PY8A 3V6JA 3HP6A 5KFTA 2JEJA 2PFPA 8ICAA 4ED2A 1ZQLA 4ECSA 2ZUCA 5DQHA 4DF4A 5DQIA 2BCVA 5J0UA 3V6KA 5D46A 3RJGA 1XSPA 5CB1A 2RDIA 3K75D 4QZBA 3RB6A 3UXOA 1QSLA 2R8KA 1CEZA 1NJYA 1EXNA 4F5PA 3QEBZ 1XC9A 2BCUA 3NTUA 4K4GA 4DSEA 7ICEA 4YCXA 3TI0A 3TFRA 5J0RA 4B9VA 7ICPA 5KFKA 2UVRA 2BGWA 3PR5B 8ICOA 1HUZA 5TZVA 5DB9A 1XU4A 4ED3A 2XY5A 4M2YA 4KLTA 4I2JA 3RRHA 4C8LA 4EBEA 1ZQXA 4RQ0A 2AQ0A 1A76A 3LWLA 4DSIA 4O5CA 4M9NA 4UB5A 2V4RA 5DB8A 2LYHA 9ICAA 4DQSA 4X5VA 2P6RA 4I2AA 4KN7A 4Z6FA 3PX4A 2I1QA 3EW9A 3ORYA 3PV8A 3UXPA 3C2LA 3SV3A 4Z6CA 3PW4A 3SV4A 3ISBA 5IINA 4B9LA 4YMMA 2Y1JA 1ZQOA 1Y88A 5DDYA 4C8NA 2XY6A 2BKEA 2JEFA 5BOMA 4UAZA 2IBKA 4DSKA 4O9MA 4XQ8A 5J2GA 5J2CA 3HX0A 4DSFA 4QWEA 4EEYA 4R66A 4Q43A 4NY8A 4YR2A 7ICUA 1NJWA 5HHHA 4C8KA 4UAWA 4ECRA 4KLDA 5KG4A 2HHSA 2KFZA 4MFFA 3LWMA 9ICTA 4J9LA 5BPCA 4R65A 2AU0A 5DLFA 3LK9A 1XSNA 2UVUA 2HHWA 5IIKA 4XRHA 2MAXA 2RDJA 9ICVA 3PO5A 4R63A 4RT2A 4UB1A 4B9MA 2BQRA 3Q8KA 3RH6A 4F93B 4KLEA 3EYZA 3MBYA 3H7IA 1RXVA 4F4ZA 1U47A 2ZTCA 3BJYA 4B9NA 4ECQA 3KHRA 5J2DA 4J9KA 8ICXA 2IA6A 2OWOA 4Z6DA 1TKDA 5KFOA 2C2EA 5KFMA 3SYZA 5KT2A 3RJHA 4KN4A 4YFKA 5HHIA 4QWAA 3Q8LA 3H40A 3TFSA 1LV5A 1TK0A 2F1HA 4UB4A 4ECVA 3K4GA 1L3UA 3C2KA 4PHEA 2BCQA 1ZQTA 3HPOA 3HWTA 4O3RA 4GC7A 3RJFA 8ICRA 4ECXA 4DL6A 1NKBA 3PO4A 9ICBA 3E2EA 5KFAA 3MR3A 1TV9A 4O3OA 5F9NA 3JPTA 4F5QA 5J2JA 3RR7A 4MEYA 4QW9A 1NK0A 4DOCA 4PGXA 4IR1A 4F2SA 3BQ1A 4M47A 8ICJA 5KG2A 4ED1A 3V7KA 9ICCA 1SZPA 3H8JA 1S77D 5KFIA 2FLLA 2H5XA 4XA5A 3OSPA 1JXLA 4C8OA 4JWNA 3FYHA 3UQ0A 8ICWA 2NRWA 2XC9A 3C1YA 1ZQNA 3B0YA 2FMQA 2ISPA 7ICNA 8ICYA 4BGDA 3PX0A 9ICWA 4DL3A 4K4IA 7ICJA 8ICHA 4GC6A 8ICPA 3Q8RB 3V72A 1V9PA 4JV1A 4GLXA 2ZJAA 4NM2A 3ZD8A 2FPLA 3BQTA 3ISDA 5J0OA 4CCHA 2C22A 4O3QA 3MDCA 3RB4A 3NGDA 4DS5A 4ED0A 4M6WB 4DFMA 1BPZA 4M6WA 4UB3A 1KDHA 4RQ6A 3G6YA 3PX6A 5J2HA 5J2FA 4KLFA 3H8WA 3ZD9A 3Q8MA 2P66A 4YR3A 4QZHA 2PI4A 3RR8A 4ELUA 4DFKA 3C1ZA 4PHAA 5J0QA 5CR0A 3RB0A 1NK7A 3ZDBA 4KLUA 2KTQA 1N48A 2BQ3A 1XSLA 3MGIA 1L5UA 2HVIA 4QZIA 3ZDAA 8ICTA 1QTMA 1HUOA 2C2DA 4NM1A 3C5GA 3ZDCA 3EZ5A 2DFLA 4I2IA 8ICQA 2ZUDA 3MFHA 4PPXA 5DG8A 3M9NB 3RB3A 2PFOA 1ZQWA 5J2EA 1K1SA 3ZDDA 5HMMA 1ZQCA 1ZQRA 5KFUA 5DG9A 5IIMA 1QSYA 2F1JA 5DBAA 4IQWA 4M04A 4QWDA 4I27A 4NLGA 1S9FA 5KFSA 2KFNA 1TAUA 3RTVA 1SL0A 5DG7A 3PR4A 4I28A 4IRDA 4UAYA 1X9WA 1NJZA 5F9LA 3MFIA 3HT3A 4DO9A 1ZQIA 1ZJMA 4FBUA 4EZ9A 5D49A 5L1IA 2KN7A 4DFJA 3PW2A 9ICKA 4KLSA 2Q0ZX 2DPIA 4KMUA 4J9SA 2J6SA 2V9WA 3PW7A 2XO7A 1U45A 4M9GA 2HHQA 3T3FA 4RQ3A 4RQ1A 8ICUA 1ZQAA 2IHNA 1KRPA 2BDPA 5CA7A 3AU6A 4ECYA 1HJPA 1LB2B 4F2RA 4O5EA 1JN3A 1PZNA 2MUTA 1UA0A 4I29A 9ICMA 1ZQQA 7ICLA 5KT6A 1KFDA 3IHQB 3G6XA 3TAPA 3GILA 5D4BA 2JEGA 9ICLA 1SKSA 4YD1A 3RJKA 1ZQUA 5EWGA 9ICEA 4IQTA 5IIJA 3N97B 4IRKA 3M8RA 1MQ3A 9ICGA 1U9LA 4DQRA 3GFKB 9ICQA 2BHNA 5DDMA 4J9PA 8ICKA 8ICEA 5KG7A 3C23A 4ED7A 2IHMA 5DGAA 1MC8A 3GV7B 4DL5A 3QEAZ 3GIIA 2AGPA 4Q8EA 1ZYQA 4KLQA 4KITB 4ELTA 4QWCA 3GV5B 2FLPA 3KHLA 1NK5A 9ICXA 3KHGA 1D9FA 4KLGA 7ICTA 3N4MB 1BPDA 5J2AA 3QE9Y 3OGUA 2HHTA 4F91B 5DKWA 3RRGA 1A77A 1T4GA 4QZFA 1B43A 5BOLA 4RQ8A 4TQSA 3UPQA 2NRXA 1KFSA 4YXMA 5DGBA 2BCRA 5HMLA 4QWBA 5KFVA 3H8SA 3GIMA 2W9BB 4BWJA 2W9BA 3RH5A 4RNMA 5KFZA 4YMOA 5J2BA 3GDXA 1N56A 1BPYA 7ICHA 4UBBA 4EYIB 1RYRA 4M9JA 4MF2A 4EBCA 4Q45A 4MFCA 4JUZA 4KLIA 1KEJA 4TUPA 4LZDA 1DGSA 1RZTA 4YP3A 2R8JA 2HHXA 8ICFA 2KZMA 4YR0A 1T8EA 1T7PA 3FDSA 1D8YA 2XY7A 4RPZA 4NLNA 1DOQA 4E0DA 3JPOA 2FLNA 1QLNA 5KTQA 5KFNA 2NRVA 4UB2A 2J6UA 2AGQA 9ICSA 1B22A 1S0VA 4RQ2A 2JZBB 1ZQVA 4QZCA 3BQ0A 2JZBA 1H38A 1BVSA 8ICLA 1S10A 4F4XA 1TK8A 4O3PA 4Z6EA 5KG6A 8ICZA 3V7LA 3RH4A 1RPLA 3OHBA 1TFRA 9ICHA 3V7JA 1Z00B 1ZQYA 5IIIA 3PNCA 1Z00A 4TQRA 3OJUA 1NK8A 3QZ7A 3KTQA 4I2DA 3GV8B 2W8LA 3UXNA 3EPIA 4F4YA 3MR6A 4F50A 2IMWP 4M0AA 7ICMA 2W9AA 1U4BA 5DQGA 4JWMA 2FMPA 2BQUA 5KFJA 5HP4A 2ZTEA 2NRTA 3T5LA 3JPPA 3C2MA 4O3SA 1C7YA 1TAQA 4Q44A 1Z3EB 2ALZA 1S0MA 1SKRA 2HHVA 1ZETA 9ICUA 5J29A 3MR5A 3C21A 4DL4A 2ATLA 7ICOA 3ISCA 4B9SA 2ZTDA 4ED6A 2UVWA 9ICPA 4Q8FA 3PMLA 5KT4A 4KLMA 4PHPA 2GWSA 2BPCA 5KG5A 4K4HA 5DLGA 4YD2A 4ELVA 4KTQA 9ICRA 1SL1A 1COOA 3M9MB 4DLEA 2XGQA 8ICSA 2XGPA 4P4MA 4IQUA 4NLKA 3BDPA 5L1LA 1JX4A 1ZQBA 4QZAA 1X9MA 8ICBA 8ICGA 2PFQA 2P6UA 3EPGA 4GXJA 1XO1A 1S0OA 1KSPA 4ZH4A 7ICSA 2V4QA 1D8LA 5J0SA 4P2HA 1XS9D 4F4KA 4JV2A 3ETLA 7ICRA 3RBEA 2B21A 5J0YA 3KHHA 3TANA 5KFEA 4P4OA 4RQ5A 3JPQA 2ISOA 4B9TA 2A1JA 4YG2A 4EZ6A 4RUAA 3THVA 1QSSA 2ASJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBB A;  4M9L A;  2W8K A;  1ZQF A;  4R8U B;  5KFL A;  4R8U A;  5DBC A;  2PXI A;  1XWL A;  3M8S A;  1TVA A;  7ICI A;  2ASL A;  5KG1 A;  1ZQE A;  4G3I A;  4QZG A;  5KFP A;  7ICG A;  1JIH A;  1IM4 A;  2KZZ A;  4DL7 A;  5IIL A;  4DQP A;  5C5J A;  3IM1 A;  4FS2 A;  4PH5 A;  5CWR A;  5EOZ A;  3BQ2 A;  3RAQ A;  8ICI A;  2NRZ A;  4YVZ A;  5KFB A;  2AGO A;  1BPX A;  3T5K A;  5J0W A;  3H4D A;  5JUM A;  5J0T A;  5J0X A;  4RNN A;  4R64 A;  5CP2 A;  1TK5 A;  4KLL A;  5KT7 A;  3HW8 A;  4B9U A;  1IXR A;  4F5O A;  3GIJ A;  2MUT B;  4F4W A;  2ASD A;  5KFY A;  4ECT A;  3SI8 A;  1ZQD A;  2XCP A;  4KLH A;  4HYK A;  4RT3 A;  4RU9 A;  3JPN A;  8ICN A;  4ECU A;  3G6V A;  4YMN A;  4DF8 A;  1T3N A;  8ICM A;  4XUS A;  2R8G A;  2AQ4 A;  2ZJ8 A;  4TUQ A;  2BR0 A;  4RZR A;  4J9Q A;  1RYS A;  3T5J A;  2WTF A;  1JMS A;  5KFR A;  5HNK A;  4DOB A;  5CJ7 A;  2DPJ A;  4ECW A;  1X2I A;  8ICV A;  2KZ3 A;  1S97 A;  3GQC A;  4QZ8 A;  5KFF A;  3PVX A;  1L3V A;  4O0I A;  3QZ8 A;  1L3T A;  2ZUB A;  1BPB A;  2JEI A;  3UQ2 A;  2UVV A;  1ZQP A;  3M9O B;  4DL2 A;  1ARO P;  2Y1I A;  3AU2 A;  4BDP A;  4I2C A;  2J6T A;  2W9C B;  4JV0 A;  2W9C A;  3TQ1 A;  4EBD A;  4QZ9 A;  4J9R A;  2BCS A;  4DS4 A;  1S76 D;  4PGY A;  9ICN A;  9ICO A;  2C28 A;  4FO6 A;  3AUO A;  4J9N A;  3H4B A;  5DB6 A;  4TUS A;  5KG0 A;  3MAB A;  2R8I A;  2PI5 A;  2M9N A;  3OHA A;  7ICQ A;  4UBC A;  9ICF A;  4C8M A;  4MEX A;  1UA1 A;  3PW5 A;  2PFN A;  5KT5 A;  4IR9 A;  4NLZ A;  4RQ7 A;  5J2K A;  1ZJN A;  4RPX A;  2AJQ A;  3Q8S B;  1WCL A;  4DWI A;  8ICC A;  3PMN A;  4I2H A;  2BPF A;  3OSN A;  3MDA A;  5EWE A;  4RUC A;  5DB7 A;  4DQQ A;  1WCN A;  1NKE A;  1UT8 A;  4MFA A;  3Q8Q B;  4DSL A;  3JPS A;  4DLG A;  1JXE A;  1NJX A;  5KFC A;  4BXO B;  2XCA A;  4QW8 A;  2I9G A;  4BXO A;  4F8R A;  1ZQK A;  9ICJ A;  2VA8 A;  3PW0 A;  4ED8 A;  5CHG A;  4GXK A;  5J0P A;  4M9H A;  1NK9 A;  4DFP A;  4UQG A;  2R8H A;  1S0N A;  5KFW A;  1UT5 A;  4KLO A;  2VA3 A;  3RAX A;  4NXZ A;  5L1J A;  5L9X A;  5IIO A;  3JPR A;  3RBD A;  4YQW A;  2ZJ5 A;  3SZ2 A;  4F92 B;  4F5R A;  1ZQS A;  2FMS A;  4EYH B;  4J9O A;  3TAR A;  2HW3 A;  3ZDE A;  4LVS A;  1U48 A;  2W9M A;  2FPM A;  1BGX T;  5EWF A;  4IRC A;  4I2F A;  4I2B A;  4O5K A;  4RNO A;  3TAQ A;  4QZE A;  1NOM A;  1KLN A;  3B0X A;  1ZQH A;  4PGQ A;  4JK1 A;  4MF8 A;  4DOA A;  4I2E A;  5KT3 A;  4FS1 A;  3Q8P B;  5KFG A;  4YN4 A;  4J9M A;  4BWM A;  4GXI A;  1NK4 A;  3LDA A;  4I2G A;  5KFH A;  5KFD A;  1SL2 A;  4O3N A;  3T5H A;  1MSW D;  2VAN A;  1NKC A;  1KTQ A;  4RPY A;  1SKW A;  4LZG A;  5KG3 A;  3MGH A;  1D9D A;  5KFQ A;  4DQI A;  4QZD A;  1CUK A;  1BPE A;  1KFT A;  3C5F A;  1NK6 A;  3RJI A;  3V6H A;  2FPK A;  4RQ4 A;  1ZQZ A;  2F1I A;  1MQ2 A;  4FBT A;  7ICV A;  4F3O A;  1ZQG A;  1U49 A;  1RXW A;  2C2R A;  3GIK A;  4ECZ A;  4DSJ A;  4KLJ A;  3EWA A;  7ICF A;  1ZQJ A;  2HVH A;  9ICI A;  1K1Q A;  3MR2 A;  3OJS A;  5L1K A;  4DEZ A;  4F5N A;  7ICK A;  1X9S A;  4YXJ A;  4P4P A;  4TUR A;  2A1J B;  5J2I A;  1L3S A;  2BPG A;  3RJE A;  4IQV A;  4PHD A;  3RJJ A;  5KFX A;  2HHU A;  1ZQM A;  2VA2 A;  3PY8 A;  3V6J A;  3HP6 A;  5KFT A;  2JEJ A;  2PFP A;  8ICA A;  4ED2 A;  1ZQL A;  4ECS A;  2ZUC A;  5DQH A;  4DF4 A;  5DQI A;  2BCV A;  5J0U A;  3V6K A;  5D46 A;  3RJG A;  1XSP A;  5CB1 A;  2RDI A;  3K75 D;  4QZB A;  3RB6 A;  3UXO A;  1QSL A;  2R8K A;  1CEZ A;  1NJY A;  1EXN A;  4F5P A;  3QEB Z;  1XC9 A;  2BCU A;  3NTU A;  4K4G A;  4DSE A;  7ICE A;  4YCX A;  3TI0 A;  3TFR A;  5J0R A;  4B9V A;  7ICP A;  5KFK A;  2UVR A;  2BGW A;  3PR5 B;  8ICO A;  1HUZ A;  5TZV A;  5DB9 A;  1XU4 A;  4ED3 A;  2XY5 A;  4M2Y A;  4KLT A;  4I2J A;  3RRH A;  4C8L A;  4EBE A;  1ZQX A;  4RQ0 A;  2AQ0 A;  1A76 A;  3LWL A;  4DSI A;  4O5C A;  4M9N A;  4UB5 A;  2V4R A;  5DB8 A;  2LYH A;  9ICA A;  4DQS A;  4X5V A;  2P6R A;  4I2A A;  4KN7 A;  4Z6F A;  3PX4 A;  2I1Q A;  3EW9 A;  3ORY A;  3PV8 A;  3UXP A;  3C2L A;  3SV3 A;  4Z6C A;  3PW4 A;  3SV4 A;  3ISB A;  5IIN A;  4B9L A;  4YMM A;  2Y1J A;  1ZQO A;  1Y88 A;  5DDY A;  4C8N A;  2XY6 A;  2BKE A;  2JEF A;  5BOM A;  4UAZ A;  2IBK A;  4DSK A;  4O9M A;  4XQ8 A;  5J2G A;  5J2C A;  3HX0 A;  4DSF A;  4QWE A;  4EEY A;  4R66 A;  4Q43 A;  4NY8 A;  4YR2 A;  7ICU A;  1NJW A;  5HHH A;  4C8K A;  4UAW A;  4ECR A;  4KLD A;  5KG4 A;  2HHS A;  2KFZ A;  4MFF A;  3LWM A;  9ICT A;  4J9L A;  5BPC A;  4R65 A;  2AU0 A;  5DLF A;  3LK9 A;  1XSN A;  2UVU A;  2HHW A;  5IIK A;  4XRH A;  2MAX A;  2RDJ A;  9ICV A;  3PO5 A;  4R63 A;  4RT2 A;  4UB1 A;  4B9M A;  2BQR A;  3Q8K A;  3RH6 A;  4F93 B;  4KLE A;  3EYZ A;  3MBY A;  3H7I A;  1RXV A;  4F4Z A;  1U47 A;  2ZTC A;  3BJY A;  4B9N A;  4ECQ A;  3KHR A;  5J2D A;  4J9K A;  8ICX A;  2IA6 A;  2OWO A;  4Z6D A;  1TKD A;  5KFO A;  2C2E A;  5KFM A;  3SYZ A;  5KT2 A;  3RJH A;  4KN4 A;  4YFK A;  5HHI A;  4QWA A;  3Q8L A;  3H40 A;  3TFS A;  1LV5 A;  1TK0 A;  2F1H A;  4UB4 A;  4ECV A;  3K4G A;  1L3U A;  3C2K A;  4PHE A;  2BCQ A;  1ZQT A;  3HPO A;  3HWT A;  4O3R A;  4GC7 A;  3RJF A;  8ICR A;  4ECX A;  4DL6 A;  1NKB A;  3PO4 A;  9ICB A;  3E2E A;  5KFA A;  3MR3 A;  1TV9 A;  4O3O A;  5F9N A;  3JPT A;  4F5Q A;  5J2J A;  3RR7 A;  4MEY A;  4QW9 A;  1NK0 A;  4DOC A;  4PGX A;  4IR1 A;  4F2S A;  3BQ1 A;  4M47 A;  8ICJ A;  5KG2 A;  4ED1 A;  3V7K A;  9ICC A;  1SZP A;  3H8J A;  1S77 D;  5KFI A;  2FLL A;  2H5X A;  4XA5 A;  3OSP A;  1JXL A;  4C8O A;  4JWN A;  3FYH A;  3UQ0 A;  8ICW A;  2NRW A;  2XC9 A;  3C1Y A;  1ZQN A;  3B0Y A;  2FMQ A;  2ISP A;  7ICN A;  8ICY A;  4BGD A;  3PX0 A;  9ICW A;  4DL3 A;  4K4I A;  7ICJ A;  8ICH A;  4GC6 A;  8ICP A;  3Q8R B;  3V72 A;  1V9P A;  4JV1 A;  4GLX A;  2ZJA A;  4NM2 A;  3ZD8 A;  2FPL A;  3BQT A;  3ISD A;  5J0O A;  4CCH A;  2C22 A;  4O3Q A;  3MDC A;  3RB4 A;  3NGD A;  4DS5 A;  4ED0 A;  4M6W B;  4DFM A;  1BPZ A;  4M6W A;  4UB3 A;  1KDH A;  4RQ6 A;  3G6Y A;  3PX6 A;  5J2H A;  5J2F A;  4KLF A;  3H8W A;  3ZD9 A;  3Q8M A;  2P66 A;  4YR3 A;  4QZH A;  2PI4 A;  3RR8 A;  4ELU A;  4DFK A;  3C1Z A;  4PHA A;  5J0Q A;  5CR0 A;  3RB0 A;  1NK7 A;  3ZDB A;  4KLU A;  2KTQ A;  1N48 A;  2BQ3 A;  1XSL A;  3MGI A;  1L5U A;  2HVI A;  4QZI A;  3ZDA A;  8ICT A;  1QTM A;  1HUO A;  2C2D A;  4NM1 A;  3C5G A;  3ZDC A;  3EZ5 A;  2DFL A;  4I2I A;  8ICQ A;  2ZUD A;  3MFH A;  4PPX A;  5DG8 A;  3M9N B;  3RB3 A;  2PFO A;  1ZQW A;  5J2E A;  1K1S A;  3ZDD A;  5HMM A;  1ZQC A;  1ZQR A;  5KFU A;  5DG9 A;  5IIM A;  1QSY A;  2F1J A;  5DBA A;  4IQW A;  4M04 A;  4QWD A;  4I27 A;  4NLG A;  1S9F A;  5KFS A;  2KFN A;  1TAU A;  3RTV A;  1SL0 A;  5DG7 A;  3PR4 A;  4I28 A;  4IRD A;  4UAY A;  1X9W A;  1NJZ A;  5F9L A;  3MFI A;  3HT3 A;  4DO9 A;  1ZQI A;  1ZJM A;  4FBU A;  4EZ9 A;  5D49 A;  5L1I A;  2KN7 A;  4DFJ A;  3PW2 A;  9ICK A;  4KLS A;  2Q0Z X;  2DPI A;  4KMU A;  4J9S A;  2J6S A;  2V9W A;  3PW7 A;  2XO7 A;  1U45 A;  4M9G A;  2HHQ A;  3T3F A;  4RQ3 A;  4RQ1 A;  8ICU A;  1ZQA A;  2IHN A;  1KRP A;  2BDP A;  5CA7 A;  3AU6 A;  4ECY A;  1HJP A;  1LB2 B;  4F2R A;  4O5E A;  1JN3 A;  1PZN A;  2MUT A;  1UA0 A;  4I29 A;  9ICM A;  1ZQQ A;  7ICL A;  5KT6 A;  1KFD A;  3IHQ B;  3G6X A;  3TAP A;  3GIL A;  5D4B A;  2JEG A;  9ICL A;  1SKS A;  4YD1 A;  3RJK A;  1ZQU A;  5EWG A;  9ICE A;  4IQT A;  5IIJ A;  3N97 B;  4IRK A;  3M8R A;  1MQ3 A;  9ICG A;  1U9L A;  4DQR A;  3GFK B;  9ICQ A;  2BHN A;  5DDM A;  4J9P A;  8ICK A;  8ICE A;  5KG7 A;  3C23 A;  4ED7 A;  2IHM A;  5DGA A;  1MC8 A;  3GV7 B;  4DL5 A;  3QEA Z;  3GII A;  2AGP A;  4Q8E A;  1ZYQ A;  4KLQ A;  4KIT B;  4ELT A;  4QWC A;  3GV5 B;  2FLP A;  3KHL A;  1NK5 A;  9ICX A;  3KHG A;  1D9F A;  4KLG A;  7ICT A;  3N4M B;  1BPD A;  5J2A A;  3QE9 Y;  3OGU A;  2HHT A;  4F91 B;  5DKW A;  3RRG A;  1A77 A;  1T4G A;  4QZF A;  1B43 A;  5BOL A;  4RQ8 A;  4TQS A;  3UPQ A;  2NRX A;  1KFS A;  4YXM A;  5DGB A;  2BCR A;  5HML A;  4QWB A;  5KFV A;  3H8S A;  3GIM A;  2W9B B;  4BWJ A;  2W9B A;  3RH5 A;  4RNM A;  5KFZ A;  4YMO A;  5J2B A;  3GDX A;  1N56 A;  1BPY A;  7ICH A;  4UBB A;  4EYI B;  1RYR A;  4M9J A;  4MF2 A;  4EBC A;  4Q45 A;  4MFC A;  4JUZ A;  4KLI A;  1KEJ A;  4TUP A;  4LZD A;  1DGS A;  1RZT A;  4YP3 A;  2R8J A;  2HHX A;  8ICF A;  2KZM A;  4YR0 A;  1T8E A;  1T7P A;  3FDS A;  1D8Y A;  2XY7 A;  4RPZ A;  4NLN A;  1DOQ A;  4E0D A;  3JPO A;  2FLN A;  1QLN A;  5KTQ A;  5KFN A;  2NRV A;  4UB2 A;  2J6U A;  2AGQ A;  9ICS A;  1B22 A;  1S0V A;  4RQ2 A;  2JZB B;  1ZQV A;  4QZC A;  3BQ0 A;  2JZB A;  1H38 A;  1BVS A;  8ICL A;  1S10 A;  4F4X A;  1TK8 A;  4O3P A;  4Z6E A;  5KG6 A;  8ICZ A;  3V7L A;  3RH4 A;  1RPL A;  3OHB A;  1TFR A;  9ICH A;  3V7J A;  1Z00 B;  1ZQY A;  5III A;  3PNC A;  1Z00 A;  4TQR A;  3OJU A;  1NK8 A;  3QZ7 A;  3KTQ A;  4I2D A;  3GV8 B;  2W8L A;  3UXN A;  3EPI A;  4F4Y A;  3MR6 A;  4F50 A;  2IMW P;  4M0A A;  7ICM A;  2W9A A;  1U4B A;  5DQG A;  4JWM A;  2FMP A;  2BQU A;  5KFJ A;  5HP4 A;  2ZTE A;  2NRT A;  3T5L A;  3JPP A;  3C2M A;  4O3S A;  1C7Y A;  1TAQ A;  4Q44 A;  1Z3E B;  2ALZ A;  1S0M A;  1SKR A;  2HHV A;  1ZET A;  9ICU A;  5J29 A;  3MR5 A;  3C21 A;  4DL4 A;  2ATL A;  7ICO A;  3ISC A;  4B9S A;  2ZTD A;  4ED6 A;  2UVW A;  9ICP A;  4Q8F A;  3PML A;  5KT4 A;  4KLM A;  4PHP A;  2GWS A;  2BPC A;  5KG5 A;  4K4H A;  5DLG A;  4YD2 A;  4ELV A;  4KTQ A;  9ICR A;  1SL1 A;  1COO A;  3M9M B;  4DLE A;  2XGQ A;  8ICS A;  2XGP A;  4P4M A;  4IQU A;  4NLK A;  3BDP A;  5L1L A;  1JX4 A;  1ZQB A;  4QZA A;  1X9M A;  8ICB A;  8ICG A;  2PFQ A;  2P6U A;  3EPG A;  4GXJ A;  1XO1 A;  1S0O A;  1KSP A;  4ZH4 A;  7ICS A;  2V4Q A;  1D8L A;  5J0S A;  4P2H A;  1XS9 D;  4F4K A;  4JV2 A;  3ETL A;  7ICR A;  3RBE A;  2B21 A;  5J0Y A;  3KHH A;  3TAN A;  5KFE A;  4P4O A;  4RQ5 A;  3JPQ A;  2ISO A;  4B9T A;  2A1J A;  4YG2 A;  4EZ6 A;  4RUA A;  3THV A;  1QSS A;  2ASJ A; 
#chains in the Genus database with same CATH topology
 4C4R A;  2WAQ F;  2W8K A;  5KFL A;  3M8S A;  7ICI A;  2Q4T A;  2ZIX B;  1ZQE A;  2ZIX A;  3NVV A;  3I76 A;  4DQP A;  1J2M A;  3WK6 A;  3BQ2 A;  3RF9 A;  3RAQ A;  1YZ7 A;  2NRZ A;  3UMB A;  1BPX A;  5J0W A;  5CP2 A;  5CEH A;  4C0Z A;  2MUT B;  5ALF A;  3TKA A;  4F4W A;  2ASD A;  3ONN A;  1YZ6 A;  3SI8 A;  4RU9 A;  4YMN A;  2D8C A;  1ECW A;  1IG6 A;  4TUQ A;  3T5J A;  2WTF A;  5HNK A;  5KL8 B;  1AQ6 A;  2ZUB A;  1UCV A;  2OCE A;  3UQ2 A;  3BZC A;  1RG6 A;  2DGZ A;  2GH1 A;  3M9O B;  3L3F X;  3AU2 A;  2LYB A;  4BDP A;  4JV0 A;  1S76 D;  4QJF B;  4FO6 A;  1Z1B A;  3MAB A;  4F71 A;  3KOO A;  2DWQ A;  1ZXI A;  4C8M A;  4MEX A;  4NLZ A;  5AKG A;  4CF5 A;  1ZJN A;  1SIJ A;  3WKB A;  2AJQ A;  2RLT A;  4DQQ A;  5DB7 A;  2KHV A;  3Q8Q B;  2LM4 A;  1L8O A;  2JR5 A;  2JHD A;  1ZQK A;  2VA8 A;  2DF4 B;  4ED8 A;  4M9H A;  1S0N A;  3RAX A;  3QXG A;  4AP9 A;  1ZOL A;  4NXZ A;  2IOF K;  3JPR A;  5AM3 A;  4F5R A;  4EYH B;  4J9O A;  4AYB C;  4LVS A;  1BGX T;  2ODG A;  4RNO A;  3TAQ A;  4QZE A;  1C20 A;  1KLN A;  5KFG A;  5CRX A;  1ZQ1 C;  4NLB A;  2W7O A;  2BZF A;  3LDA A;  1SL2 A;  4O3N A;  4RPY A;  1SKW A;  3HJE A;  5AKL A;  4LZG A;  3M1Y A;  5KFQ A;  1N63 A;  5AM5 A;  5EE0 A;  3RJI A;  4RQ4 A;  1ZQZ A;  7ICV A;  4F3O A;  1ZQG A;  5AM0 A;  3FAH A;  1K1Q A;  3MR2 A;  5L1K A;  4F5N A;  4P4P A;  4TUR A;  2BPG A;  4PHD A;  5KFX A;  5AKJ A;  2F44 A;  3PY8 A;  3HP6 A;  5KFT A;  1PVQ A;  1ZQL A;  2ZUC A;  4DF4 A;  3PST A;  1CEZ A;  3RB6 A;  1NJY A;  1T94 A;  3QEB Z;  3WKE A;  3U26 A;  1Z1V A;  2UVR A;  2KJ8 A;  3GU3 A;  3QU5 A;  2Y9T A;  3RRH A;  2KE7 A;  1A76 A;  2YQE A;  3LWL A;  2LMR A;  5AIC A;  4DSI A;  9ICA A;  4Z6F A;  3PX4 A;  2RQ5 A;  3UXP A;  5KNI A;  5IIN A;  4J03 A;  4UB8 U;  4UAZ A;  4XQ8 A;  2AHO B;  4EEY A;  4R66 A;  5AIB A;  4YR2 A;  7ICU A;  2KFZ A;  2HHS A;  5ALV A;  4UAW A;  4ECR A;  2Y9U A;  9ICT A;  2YY6 A;  3SAF A;  5BPC A;  4ICA A;  2HHW A;  5IIK A;  5ALO A;  9ICV A;  2VIX A;  3WK7 A;  2OEH A;  1CRX A;  3MGV A;  4KX5 A;  3EYZ A;  4F4Z A;  1URJ A;  4Y2X A;  3KHR A;  1B0X A;  1ED1 A;  2IA6 A;  4Z6D A;  3MC1 A;  2PMZ C;  3RJH A;  5KT2 A;  4QWA A;  4EX6 A;  5AKX A;  3TFS A;  4BUG A;  4C7Y A;  2I6X A;  4EEL A;  4UB4 A;  3CW2 C;  3K4G A;  3C2K A;  2BCQ A;  1TV9 A;  4F5Q A;  3JPT A;  3F53 A;  5J2J A;  4MEY A;  4QW9 A;  1NK0 A;  4DOC A;  3IDW A;  4PGX A;  2GOL A;  1FIQ A;  1JUD A;  3H8J A;  4C4S A;  2H5X A;  4RQN A;  4XA5 A;  3OSP A;  4C8O A;  4JWN A;  1X42 A;  3QUQ A;  2XC9 A;  2FMQ A;  3B0Y A;  4BGD A;  3PX0 A;  9ICW A;  2OXO A;  3V72 A;  4GLX A;  4NM2 A;  3BQT A;  1T3Q A;  5ALX A;  2KIV A;  3RB4 A;  1COK A;  4ED0 A;  4FZM A;  1KDH A;  4RQ6 A;  3ZD9 A;  2PI4 A;  3RR8 A;  2CRX A;  4DFK A;  3RB0 A;  5CR0 A;  1NK7 A;  2BQ3 A;  1L5U A;  1HUO A;  2C2D A;  3N7S C;  4I2I A;  2LHT A;  3RB3 A;  5AI5 A;  4NLG A;  3HKZ C;  4QWD A;  4I27 A;  1FFU A;  4GIB A;  3PR4 A;  2XVT A;  4UAY A;  1N5X A;  5J8Y A;  4DO9 A;  5T14 A;  1ZD3 A;  4EZ9 A;  5L1I A;  3PW2 A;  2G08 A;  2OYY A;  4KLS A;  2V9W A;  3PW7 A;  3T3F A;  4RQ1 A;  1ZQA A;  2IHN A;  1RM6 C;  3AU6 A;  2JV3 A;  4I29 A;  2H3F A;  2QKQ A;  2WAQ C;  7ICL A;  3VC8 A;  1L8L A;  5KT6 A;  3G6X A;  3GIL A;  9ICL A;  5IIJ A;  3M8R A;  3I1Y A;  1MQ3 A;  1U9L A;  9ICG A;  5HR7 A;  3GFK B;  5DDM A;  5KG7 A;  4OD0 A;  2A3V A;  5DGA A;  3ED5 A;  2B0C A;  2K4P A;  2FLP A;  3GV5 B;  9ICX A;  2KSO B;  3N4M B;  1BPD A;  2ZIU B;  2FE9 A;  2K8A A;  5BOL A;  1DK2 A;  2G5H B;  2CN1 A;  2W9B B;  2W9B A;  4YMO A;  5ALE A;  2NO4 A;  1RYR A;  4MF2 A;  4JUZ A;  1KEJ A;  4LZD A;  3VCB A;  3WK9 A;  4PJ0 U;  2KZM A;  1UPH A;  2HBJ A;  4CF3 A;  4BX9 C;  9ICS A;  3AM9 A;  1SZH A;  2KOB A;  1S10 A;  2GLE A;  1TK8 A;  4CDG A;  3PNC A;  1ZQY A;  2WF6 A;  4PL2 A;  4I2D A;  2W8L A;  2YML A;  3EPI A;  4F50 A;  1S5L U;  2W9A A;  4JWM A;  2ZTE A;  1TAQ A;  4Q44 A;  2ALZ A;  2HHV A;  2LBO A;  9ICU A;  3SEN A;  2ATL A;  3ISC A;  4B9S A;  2UVW A;  5AKI A;  1UQV A;  2WF8 A;  4KLM A;  2BPC A;  4KTQ A;  8ICS A;  2DKX A;  3QYP A;  1JX4 A;  3F5E A;  1X9M A;  8ICB A;  2PFQ A;  3EPG A;  4GXJ A;  1XO1 A;  7ICS A;  1XS9 D;  4F4K A;  7ICR A;  3ETL A;  3RBE A;  5J0Y A;  2WF9 A;  3KHH A;  4B9T A;  4NWI A;  2ASJ A;  4PZO A;  3KZI U;  5DBC A;  2GO7 A;  1HIW A;  1SWW A;  2YMP A;  5KG1 A;  4OCZ A;  2KZZ A;  3PSI A;  5EOZ A;  1SWV A;  1MN8 A;  8ICI A;  4YVZ A;  4RNN A;  4B9U A;  1F0M A;  4F5O A;  1RQL A;  5KFY A;  1GO3 F;  8ICN A;  2KP7 A;  2KKP A;  3HIL A;  2LYA A;  2NV3 A;  8ICM A;  2R8G A;  2ZJ8 A;  4FFD A;  3QU2 A;  4NJ8 A;  4RZR A;  4J9Q A;  2KKV A;  4DOB A;  4Y2Q A;  3GZF A;  1L3V A;  2RRD A;  3BS7 A;  2K4I A;  4UAV A;  2UVV A;  5ALD A;  3OPX A;  4DL2 A;  2Y1I A;  3M7D A;  9ICN A;  4PGY A;  3EUB 2;  4J9N A;  1LKY A;  1N61 A;  5AKH A;  5DB6 A;  2R8I A;  2M9N A;  4UBC A;  1L7O A;  1UA1 A;  1L6N A;  3Q8S B;  1WCL A;  4FE3 A;  2P35 A;  5EWE A;  2R18 A;  3JPS A;  4DLG A;  1P7D A;  3DDH A;  1BNP A;  2QLT A;  4BXO B;  2I9G A;  4BXO A;  9ICJ A;  5ALH A;  3PW0 A;  5ALG A;  5J0P A;  1NK9 A;  2VA3 A;  5L9X A;  5IIO A;  3RBD A;  4YQW A;  2ZJ5 A;  3SZ2 A;  2OHF A;  1TAM A;  4ACO A;  2D6F C;  1FFV A;  2HW3 A;  3ZDE A;  4IRC A;  2YMM A;  4I2B A;  1NOM A;  1ZQH A;  4DOA A;  5KT3 A;  4J9M A;  5EE1 A;  4I2G A;  5KFH A;  5KFD A;  1NI3 A;  4NL9 A;  1UHU A;  1CUK A;  1BPE A;  1KFT A;  3C5F A;  2EZY A;  3QNM A;  1MQ2 A;  5EE9 A;  1U49 A;  4KLJ A;  5ALM A;  3EWA A;  2HVH A;  2JMG A;  5AI9 A;  1X9S A;  3IN5 A;  2A1J B;  4NL9 C;  2VA2 A;  8ICA A;  1KN5 A;  5GTI U;  4ECS A;  2ESE A;  1N2X A;  2BCV A;  5J0U A;  2R8K A;  3K75 D;  4F5P A;  1XC9 A;  4YCX A;  4B9V A;  3NVY A;  5KFK A;  2BGW A;  2W54 A;  1XU4 A;  2QAR B;  3D6J A;  2QAR A;  2XY5 A;  1QH9 A;  4M2Y A;  1M6Y A;  2HOF A;  1N5W A;  2ZIV B;  2ZIV A;  2LYH A;  4DQS A;  3T79 A;  3EW9 A;  3ORY A;  3SV4 A;  4B9L A;  4YMM A;  2Y1J A;  4C8N A;  2XY6 A;  2JEF A;  2BKE A;  4O9M A;  5J2C A;  1OUQ A;  3HX0 A;  4DSF A;  1X40 A;  4C8K A;  4KLD A;  2LKY A;  4J9L A;  2O6K A;  2YMQ A;  4R65 A;  5DLF A;  1XSN A;  1JRP A;  4XRH A;  2MAX A;  2XIC A;  4RT2 A;  4EX7 A;  3RH6 A;  3MBY A;  2KVS A;  4ECQ A;  4J9K A;  8ICX A;  1TKD A;  5KFO A;  2C2E A;  4KN4 A;  2DKZ A;  4YFK A;  1JAL A;  1LV5 A;  3UM9 A;  1TK0 A;  3SD7 A;  5AI8 A;  4LJX A;  3HPO A;  3HWT A;  4O3R A;  3KFU F;  3RJF A;  8ICR A;  9ICB A;  4O3O A;  3UMG A;  2YTU A;  2WF5 A;  4F2S A;  1L7N A;  4M47 A;  1DGJ A;  5KG2 A;  2W7P A;  1S77 D;  5KFI A;  3UQ0 A;  3C1Y A;  8ICY A;  3BZK A;  4K4I A;  4FZN A;  4GC6 A;  5L1M A;  1NZP A;  3ISD A;  3AMZ A;  1N60 A;  4CCH A;  2C22 A;  4O3Q A;  3MDC A;  2QB0 A;  3QUC A;  3G6Y A;  5J2H A;  5AKZ A;  5J2F A;  3Q8M A;  2NYV A;  2N1R A;  4YR3 A;  4ELU A;  3C1Z A;  4PHA A;  3ETR A;  1N48 A;  3MGI A;  2HVI A;  4QZI A;  8ICQ A;  1QQ7 A;  3MFH A;  5DG8 A;  3ZDD A;  2HSZ A;  1QSY A;  1VJ5 A;  5KFU A;  5DG9 A;  2AXT U;  1RQN A;  5FP0 A;  3RTV A;  4IRD A;  5G5G A;  1X9W A;  3NRW A;  1ZQI A;  4FBU A;  3AQE A;  4B6J A;  5B66 U;  2K8B B;  2K4H A;  2XO7 A;  4M9G A;  3LVW A;  2OM6 A;  1KRP A;  2E1E A;  1HJP A;  4F2R A;  4O5E A;  5D4B A;  2JEG A;  3RJK A;  4IRK A;  3N97 B;  1BNO A;  1ZD4 A;  5EE3 A;  2A19 A;  5GTH U;  8ICK A;  5ALR A;  3M6K A;  1MC8 A;  2AH5 A;  3QEA Z;  4Q8E A;  3GII A;  3D2S A;  1ZYQ A;  4UAR A;  1J97 A;  3KHL A;  5J2A A;  3QE9 Y;  5DKW A;  2JXJ A;  1NZB A;  4YXM A;  2BCR A;  4QWB A;  2G0A A;  1XNS A;  3GIM A;  5J2B A;  1N56 A;  1L7P A;  1F5S A;  4UBB A;  2KMD A;  5KL1 B;  4Q45 A;  1RZT A;  4TUP A;  1DGS A;  2R8J A;  4YP3 A;  2NO5 A;  1T7P A;  2Y0S C;  3QU7 A;  1D8Y A;  4CE6 A;  4NLN A;  1HEK A;  2FLN A;  2EZZ A;  5KTQ A;  1B22 A;  2ZG6 A;  2JRZ A;  4F4X A;  8ICZ A;  3RH4 A;  1TFR A;  3V7J A;  5III A;  4TQR A;  4OJO A;  3QZ7 A;  2KVC A;  3UXN A;  2WB1 F;  2IMW P;  3IRU A;  7ICM A;  1SXE A;  1KW4 A;  5HP4 A;  4O3S A;  3T5L A;  3C2M A;  2PKE A;  1Z3E B;  2XID A;  1ZET A;  3CNH A;  2KJ5 A;  5J29 A;  4DL4 A;  7ICO A;  2L5Y A;  2ZTD A;  4ED6 A;  2GWS A;  2CPR A;  4K4H A;  5DLG A;  1COO A;  3M9M B;  2YN4 A;  3ZI4 A;  4IQU A;  3BDP A;  5L1L A;  1ZQB A;  3NRZ A;  4QZA A;  1DK3 A;  2P6U A;  1KSP A;  4ZH4 A;  2V4Q A;  3C28 A;  3O0F A;  1SGG A;  4U7C A;  1QQ5 A;  3TAN A;  4P4O A;  3JPQ A;  4YG2 A;  4EZ6 A;  5B5E U;  4RUA A;  3K1R B;  1Q3V A;  1QSS A;  4R8U B;  4R8U A;  2PXI A;  3IV6 A;  3D2Q A;  2ASL A;  1D8B A;  4G3I A;  4DL7 A;  5IIL A;  2FDR A;  5C5J A;  3IM1 A;  3F2B A;  2W11 A;  5CWR A;  5KFB A;  2AGO A;  3N7P D;  3IG5 A;  4R64 A;  4KLL A;  3HW8 A;  4RT3 A;  3JPN A;  3G6V A;  1DRG A;  1L7M A;  3KD3 A;  4DF8 A;  1T3N A;  4XUS A;  2AQ4 A;  5J8Y C;  3BS5 B;  3BS5 A;  1RYS A;  5KFR A;  2DPJ A;  4ECW A;  1X2I A;  8ICV A;  2KZ3 A;  1S97 A;  3PVX A;  5KFF A;  2HBM A;  3KKA A;  4HAI A;  1L3T A;  4P0P B;  5ALJ A;  4P0P A;  2EAM A;  1OXJ A;  4I2C A;  2KV2 A;  2W9C B;  2W9C A;  3TQ1 A;  4QZ9 A;  2BCS A;  4DS4 A;  9ICO A;  1JI7 A;  4QNL A;  3H4B A;  2PI5 A;  3OHA A;  2EAO A;  9ICF A;  3C29 A;  1SXD A;  2PFN A;  3H0M B;  4RQ7 A;  5J2K A;  4DWI A;  3KKA C;  2BPF A;  3OSN A;  3LVV A;  2KG5 A;  4QW8 A;  4F8R A;  1WWV A;  5CHG A;  2R8H A;  1UT5 A;  4CNQ A;  5HR6 A;  2DL0 A;  1LVH A;  1Z4O A;  4F92 B;  2FMS A;  3TAR A;  1VDV A;  1PUZ A;  1WYG A;  1U48 A;  4I2F A;  4CF4 A;  5AHX A;  5ALP A;  2W3S A;  3H8M A;  4JK1 A;  1RYU A;  4QIW F;  3D2N A;  4YN4 A;  3PZP A;  3T5H A;  3NVW A;  2VJ4 A;  1NKC A;  1KTQ A;  4WJ3 B;  2HBL A;  2FI1 A;  1FO4 A;  5KG3 A;  3MGH A;  2DQN B;  5A0L A;  2EDU A;  4QZD A;  4C4T A;  1RDF A;  2F1I A;  3QUT A;  5ALY A;  4FBT A;  1B4F A;  3PSP A;  4ECZ A;  7ICF A;  4Y2Y A;  4DEZ A;  2HI0 A;  5AK4 A;  4YXJ A;  3RJE A;  4IQV A;  2HHU A;  1ZQM A;  3WK4 A;  3V6J A;  5ALT A;  2PFP A;  5JTI A;  5DQI A;  3V6K A;  3RJG A;  1XSP A;  5CB1 A;  2RDI A;  1QSL A;  3UXO A;  5ALQ A;  1N62 A;  2BCU A;  4K4G A;  4DSE A;  3PR5 B;  8ICO A;  5DB9 A;  2KJ9 A;  2W3R A;  2HDO A;  3L4P A;  4KLT A;  2IOH A;  4C8L A;  4EBE A;  4RQ0 A;  2AQ0 A;  5AM2 A;  4UB5 A;  2V4R A;  5AI6 A;  2ZXH A;  4I2A A;  4KN7 A;  4USA A;  1FEZ A;  3PV8 A;  3SV3 A;  3OTQ A;  4Z6C A;  3PW4 A;  4KMO B;  1Y88 A;  5DDY A;  2IBK A;  5BOM A;  4DSK A;  5TIS U;  4CRX A;  1KKX A;  2E8P A;  4OJ5 A;  1LKY B;  3H0L B;  5KG4 A;  2KD1 A;  4MFF A;  3FM9 A;  1MA7 A;  2UVU A;  2RDJ A;  2RHF A;  3PO5 A;  3F2C A;  4UB1 A;  3Q8K A;  4KLE A;  2H3I A;  3H7I A;  1U47 A;  5ALS A;  3BJY A;  4B9N A;  5J2D A;  2OWO A;  5KFM A;  3SYZ A;  3TAC B;  3H40 A;  5AK3 A;  3Q8L A;  2F1H A;  4UAU A;  1ZQT A;  4ECX A;  1NKB A;  1OW5 A;  3E2E A;  1PK1 A;  3IP4 B;  5F9N A;  4IR1 A;  1NNL A;  3BQ1 A;  4ED1 A;  2KHQ A;  3V7K A;  9ICC A;  1SZP A;  2WF7 A;  2FLL A;  3FYH A;  8ICW A;  1ZQN A;  2ISP A;  4DL3 A;  8ICH A;  4PL1 A;  8ICP A;  2E8M A;  3Q8R B;  4JV1 A;  2ZJA A;  3IG8 A;  3ZD8 A;  5ALL A;  1WG8 A;  2EAP A;  4ZOH C;  5C0Y A;  3DV9 A;  4M6W B;  1BPZ A;  4M6W A;  4UB3 A;  4OJP A;  3PX6 A;  4KLF A;  3HKZ F;  4QZH A;  2WB1 C;  5J0Q A;  2KTQ A;  4KLU A;  4Y2P A;  1X66 A;  1O03 A;  2YX8 A;  3AQF A;  2F76 X;  3A0H U;  3ZDA A;  8ICT A;  4NM1 A;  5ALU A;  3C5G A;  3EZ5 A;  2DFL A;  2ZUD A;  4IC9 A;  1SV0 A;  3TAD A;  1ZQW A;  5J2E A;  5HMM A;  1ZQR A;  3QU9 A;  4M04 A;  2F1J A;  5DBA A;  3AN1 A;  5KFS A;  1S9F A;  2KFN A;  3SAH A;  1S8O A;  5DG7 A;  4I28 A;  3WKC A;  5F9L A;  3MFI A;  1ZJM A;  5D49 A;  5AI4 A;  3AL0 B;  4DFJ A;  3H0R B;  2Q0Z X;  2DPI A;  2J6S A;  5JRT A;  1U45 A;  5AK5 A;  2W43 A;  8ICU A;  3AEV A;  1SV0 C;  5CA7 A;  4ECY A;  1LB2 B;  3TAD C;  1JN3 A;  1PZN A;  2MUT A;  1UA0 A;  3SAG A;  1ZQQ A;  1KFD A;  1CI4 A;  4YD1 A;  2K60 A;  5EWG A;  9ICE A;  1PVR A;  4DQR A;  9ICQ A;  2BHN A;  8ICE A;  3C23 A;  2MU2 A;  4ED7 A;  2IHM A;  4DL5 A;  4EEN A;  4QWC A;  2HMX A;  2M0N A;  3KHG A;  7ICT A;  1A0P A;  3OGU A;  1V38 A;  4F91 B;  3RRG A;  3UPQ A;  1PK3 A;  4QZF A;  1B43 A;  4RQ8 A;  4TQS A;  2NRX A;  2W03 A;  4A8E A;  5HML A;  1V85 A;  4RNM A;  5KFZ A;  3GDX A;  1VLB A;  7ICH A;  2MRL A;  4M9J A;  5AM4 A;  4EBC A;  4MFC A;  8ICF A;  1T8E A;  2XY7 A;  1DOQ A;  3JPO A;  2G06 A;  1QLN A;  2J6U A;  1JRO A;  4UB2 A;  2MA1 A;  2F8K A;  4RQ2 A;  3BQ0 A;  1ZQV A;  4C80 A;  4QZC A;  3N28 A;  1H38 A;  2Z7J A;  8ICL A;  9ICH A;  3OHB A;  1NK8 A;  4F4Y A;  3MR6 A;  4M0A A;  4JMU A;  1U4B A;  3B9J A;  5KFJ A;  2NRT A;  1SKR A;  2KIW A;  2QB0 B;  2IOF A;  3S6J A;  2E8O A;  3MR5 A;  3C21 A;  9ICP A;  4Q8F A;  3PML A;  2EAN A;  5KT4 A;  2LPE A;  5KG5 A;  4CGZ A;  1ZRM A;  3ICX A;  2DBY A;  4QIW C;  8ICG A;  1TE2 A;  5J0S A;  5KFE A;  3NUQ A;  3THV A;  1KL9 A;  5DBB A;  3WKD A;  4M9L A;  1ZQF A;  4PZN A;  1XWL A;  1V97 A;  1TVA A;  2G07 A;  4QZG A;  5KFP A;  5ALZ A;  1JIH A;  1IM4 A;  7ICG A;  1Z19 A;  4FS2 A;  4PH5 A;  3T5K A;  3H4D A;  5JUM A;  5J0T A;  5J0X A;  1TK5 A;  5KT7 A;  1IXR A;  2DUY A;  3GIJ A;  4NV0 A;  2G5I B;  4ECT A;  2F2A B;  1ZQD A;  2XCP A;  4KLH A;  4HYK A;  2B6G A;  2W04 A;  4ECU A;  2RP5 A;  2HCF A;  2OH2 A;  2BR0 A;  2K4E A;  1KBU A;  1JMS A;  5CJ7 A;  4UW9 A;  3QUB A;  3GQC A;  4QZ8 A;  1YT3 A;  3A0B U;  4O0I A;  3SEI A;  3QZ8 A;  4UAS A;  1BPB A;  2JEI A;  1QCK A;  3UMC A;  1ZQP A;  1ARO P;  4Y2U A;  2J6T A;  4EBD A;  4J9R A;  1Q8K A;  2C28 A;  3AUO A;  4TUS A;  5KG0 A;  7ICQ A;  3PW5 A;  5KT5 A;  4IR9 A;  4RPX A;  2HBK A;  3QU4 A;  4F72 A;  8ICC A;  3PMN A;  4I2H A;  3MDA A;  4GFJ A;  4RUC A;  1WCN A;  1NKE A;  4OJL A;  1UT8 A;  4MFA A;  4DSL A;  5ALI A;  5AM1 A;  4UAT A;  3L5K A;  1K5O A;  1JXE A;  1NJX A;  5KFC A;  2XCA A;  1J2N A;  4Y2V A;  4GXK A;  4KLO A;  4DFP A;  4UQG A;  2H3V A;  5KFW A;  4Y2R A;  5L1J A;  2HOQ A;  1QQ6 A;  1ZQS A;  2W9M A;  2FPM A;  5EWF A;  4O5K A;  2KEY A;  5JU5 A;  1XO0 A;  3B0X A;  4PGQ A;  4MF8 A;  4I2E A;  4FS1 A;  3Q8P B;  2EZX A;  4BWM A;  4GXI A;  1NK4 A;  5K4L A;  1KQQ A;  5AK6 A;  1MSW D;  2VAN A;  5ALN A;  1ZD2 P;  3N7R C;  1D9D A;  2K89 A;  4DQI A;  1SV4 A;  2KK0 A;  1PVP A;  1NK6 A;  3V6H A;  2FPK A;  1RXW A;  4DSJ A;  2C2R A;  3GIK A;  2A1A A;  2FJ6 A;  1ZQJ A;  9ICI A;  4RQM A;  3OJS A;  3ALR A;  3NS1 A;  7ICK A;  1F44 A;  5J2I A;  1L3S A;  3SR6 A;  3RJJ A;  3F2D A;  3KZX A;  4BJQ A;  2JEJ A;  2H3Q A;  4P0Q B;  4ED2 A;  4P0Q A;  5DQH A;  5D46 A;  2HOI A;  4QZB A;  1EXN A;  2E1F A;  3NTU A;  7ICE A;  3TI0 A;  3TFR A;  5J0R A;  7ICP A;  1HUZ A;  3E58 A;  5TZV A;  2E8N A;  2ZXI A;  4ED3 A;  4I2J A;  2I5H A;  2MSN A;  1ZQX A;  2G09 A;  2ES6 A;  4O5C A;  2WFA A;  2JH7 A;  4UB6 U;  4M9N A;  5DB8 A;  4X5V A;  2P6R A;  2I1Q A;  3C2L A;  3R9K A;  3ISB A;  1ZQO A;  3DEE A;  2F3N A;  5J2G A;  3BQ7 A;  4QWE A;  1DXS A;  4Q43 A;  5ALK A;  4NY8 A;  2JGA A;  1NJW A;  5HHH A;  3LWM A;  1IV8 A;  3NVZ A;  2AU0 A;  2YB4 A;  3LK9 A;  5AIA A;  4R63 A;  5G5H A;  2D3D A;  2KSO A;  4B9M A;  2BQR A;  4AYB F;  4F93 B;  1RXV A;  2ZIU A;  2ZTC A;  3NAS A;  3J81 j;  5KAF U;  1IIP A;  5HHI A;  3QX7 A;  4ECV A;  1L3U A;  4PHE A;  4Y2S A;  4GC7 A;  4DL6 A;  3PO4 A;  5KFA A;  3MR3 A;  4G9B A;  2ZIW B;  2ZIW A;  3K1Z A;  3RR7 A;  2W55 A;  4KX3 A;  4Y2J A;  2LM1 A;  8ICJ A;  2F8L A;  2BDU A;  3SMV A;  2VJ5 A;  4O3M A;  1JXL A;  1WUD A;  2NRW A;  7ICN A;  5AI0 A;  2KIC A;  3WKA A;  7ICJ A;  2EQY A;  1V9P A;  2FPL A;  1WWU A;  5J0O A;  3NGD A;  4DS5 A;  2XI9 A;  4DFM A;  1A6S A;  3PSF A;  3H8W A;  2P66 A;  4Y2T A;  3ZDB A;  5KAI U;  3KBB A;  4U6P A;  1XSL A;  1QTM A;  3ZDC A;  1X9X A;  4PPX A;  3M9N B;  4EEK A;  2PFO A;  1K1S A;  1ZQC A;  3E0F A;  5IIM A;  4IQW A;  1TAU A;  2WHE A;  1SL0 A;  1NJZ A;  3HT3 A;  3CYM A;  2KN7 A;  9ICK A;  4C7Z A;  2F77 X;  4KMU A;  4J9S A;  2HHQ A;  5AKK A;  4RQ3 A;  2BDP A;  1ZRN A;  4IL6 U;  9ICM A;  2QB1 A;  3IHQ B;  3TAP A;  1SKS A;  4DCC A;  1ZQU A;  4IQT A;  4NLC A;  4J9P A;  2PMZ F;  3GV7 B;  2AGP A;  3FC4 A;  2K8C B;  4KLQ A;  4KIT B;  4ELT A;  4FZL A;  3I28 A;  3WK5 A;  1NK5 A;  1D9F A;  4KLG A;  2E5S A;  3RFA A;  2E3T A;  5AKY A;  4MHV A;  2HHT A;  3LYS A;  2Y0S F;  1Q3U A;  1A77 A;  1T4G A;  1KFS A;  5DGB A;  5KFV A;  3H8S A;  4BWJ A;  3RH5 A;  5E79 U;  3WK8 A;  3WU2 U;  1X6I A;  1BPY A;  4EYI B;  5H2F U;  9ICR A;  4KLI A;  2HHX A;  2YB1 A;  4YR0 A;  4OO1 J;  3FDS A;  1PK1 B;  1SB3 C;  4RPZ A;  2JH1 A;  4JB3 A;  5KFN A;  2NRV A;  2AGQ A;  1S0V A;  2JZB B;  2JZB A;  5ALW A;  1BVS A;  2EH9 A;  4O3P A;  4Z6E A;  5KG6 A;  3V7L A;  1RPL A;  2VKQ A;  5F3X B;  1Z00 B;  1Z00 A;  3OJU A;  4US9 A;  3KTQ A;  3GV8 B;  4IS7 A;  2CXY A;  1Z4N A;  5DQG A;  3CRX A;  1Q46 A;  2FMP A;  2BQU A;  3JPP A;  1C7Y A;  1S0M A;  3M6Z A;  2LI6 A;  4PHP A;  4DFD A;  4ELV A;  4YD2 A;  1SL1 A;  4DLE A;  2XGQ A;  5AKE A;  2XGP A;  4P4M A;  3SQI A;  4NLK A;  1X6J A;  3F5A A;  2H3Z A;  1S0O A;  4US8 A;  1ZD5 A;  1D8L A;  4P2H A;  4OJ6 A;  4JV2 A;  3CP8 A;  2B21 A;  2KNJ A;  4RQ5 A;  2ISO A;  2A1J A;  3HRD D;  1O08 A;  4E0D A; 
#chains in the Genus database with same CATH homology
 5DBB A;  4M9L A;  2W8K A;  1ZQF A;  4R8U B;  5KFL A;  4R8U A;  5DBC A;  2PXI A;  1XWL A;  3M8S A;  1TVA A;  7ICI A;  2ASL A;  5KG1 A;  1ZQE A;  4G3I A;  4QZG A;  5KFP A;  7ICG A;  1JIH A;  1IM4 A;  2KZZ A;  4DL7 A;  5IIL A;  4DQP A;  5C5J A;  3IM1 A;  4FS2 A;  4PH5 A;  5CWR A;  5EOZ A;  3BQ2 A;  3RAQ A;  8ICI A;  2NRZ A;  4YVZ A;  5KFB A;  2AGO A;  1BPX A;  3T5K A;  5J0W A;  3H4D A;  5JUM A;  5J0T A;  5J0X A;  4RNN A;  4R64 A;  5CP2 A;  1TK5 A;  4KLL A;  5KT7 A;  3HW8 A;  4B9U A;  1IXR A;  4F5O A;  3GIJ A;  2MUT B;  4F4W A;  2ASD A;  5KFY A;  4ECT A;  3SI8 A;  1ZQD A;  2XCP A;  4KLH A;  4HYK A;  4RT3 A;  4RU9 A;  3JPN A;  8ICN A;  4ECU A;  3G6V A;  4YMN A;  4DF8 A;  1T3N A;  8ICM A;  4XUS A;  2R8G A;  2AQ4 A;  2ZJ8 A;  4TUQ A;  2BR0 A;  4RZR A;  4J9Q A;  1RYS A;  3T5J A;  2WTF A;  1JMS A;  5KFR A;  5HNK A;  4DOB A;  5CJ7 A;  2DPJ A;  4ECW A;  1X2I A;  8ICV A;  2KZ3 A;  1S97 A;  3GQC A;  4QZ8 A;  5KFF A;  3PVX A;  1L3V A;  4O0I A;  3QZ8 A;  1L3T A;  2ZUB A;  1BPB A;  2JEI A;  3UQ2 A;  2UVV A;  1ZQP A;  3M9O B;  4DL2 A;  1ARO P;  2Y1I A;  3AU2 A;  4BDP A;  4I2C A;  2J6T A;  2W9C B;  4JV0 A;  2W9C A;  3TQ1 A;  4EBD A;  4QZ9 A;  4J9R A;  2BCS A;  4DS4 A;  1S76 D;  4PGY A;  9ICN A;  9ICO A;  2C28 A;  4FO6 A;  3AUO A;  4J9N A;  3H4B A;  5DB6 A;  4TUS A;  5KG0 A;  3MAB A;  2R8I A;  2PI5 A;  2M9N A;  3OHA A;  7ICQ A;  4UBC A;  9ICF A;  4C8M A;  4MEX A;  1UA1 A;  3PW5 A;  2PFN A;  5KT5 A;  4IR9 A;  4NLZ A;  4RQ7 A;  5J2K A;  1ZJN A;  4RPX A;  2AJQ A;  3Q8S B;  1WCL A;  4DWI A;  8ICC A;  3PMN A;  4I2H A;  2BPF A;  3OSN A;  3MDA A;  5EWE A;  4RUC A;  5DB7 A;  4DQQ A;  1WCN A;  1NKE A;  1UT8 A;  4MFA A;  3Q8Q B;  4DSL A;  3JPS A;  4DLG A;  1JXE A;  1NJX A;  5KFC A;  4BXO B;  2XCA A;  4QW8 A;  2I9G A;  4BXO A;  4F8R A;  1ZQK A;  9ICJ A;  2VA8 A;  3PW0 A;  4ED8 A;  5CHG A;  4GXK A;  5J0P A;  4M9H A;  1NK9 A;  4DFP A;  4UQG A;  2R8H A;  1S0N A;  5KFW A;  1UT5 A;  4KLO A;  2VA3 A;  3RAX A;  4NXZ A;  5L1J A;  5L9X A;  5IIO A;  3JPR A;  3RBD A;  4YQW A;  2ZJ5 A;  3SZ2 A;  4F92 B;  4F5R A;  1ZQS A;  2FMS A;  4EYH B;  4J9O A;  3TAR A;  2HW3 A;  3ZDE A;  4LVS A;  1U48 A;  2W9M A;  2FPM A;  1BGX T;  5EWF A;  4IRC A;  4I2F A;  4I2B A;  4O5K A;  4RNO A;  3TAQ A;  4QZE A;  1NOM A;  1KLN A;  3B0X A;  1ZQH A;  4PGQ A;  4JK1 A;  4MF8 A;  4DOA A;  4I2E A;  5KT3 A;  4FS1 A;  3Q8P B;  5KFG A;  4YN4 A;  4J9M A;  4BWM A;  4GXI A;  1NK4 A;  3LDA A;  4I2G A;  5KFH A;  5KFD A;  1SL2 A;  4O3N A;  3T5H A;  1MSW D;  2VAN A;  1NKC A;  1KTQ A;  4RPY A;  1SKW A;  4LZG A;  5KG3 A;  3MGH A;  1D9D A;  5KFQ A;  4DQI A;  4QZD A;  1CUK A;  1BPE A;  1KFT A;  3C5F A;  1NK6 A;  3RJI A;  3V6H A;  2FPK A;  4RQ4 A;  1ZQZ A;  2F1I A;  1MQ2 A;  4FBT A;  7ICV A;  4F3O A;  1ZQG A;  1U49 A;  1RXW A;  2C2R A;  3GIK A;  4ECZ A;  4DSJ A;  4KLJ A;  3EWA A;  7ICF A;  1ZQJ A;  2HVH A;  9ICI A;  1K1Q A;  3MR2 A;  3OJS A;  5L1K A;  4DEZ A;  4F5N A;  7ICK A;  1X9S A;  4YXJ A;  4P4P A;  4TUR A;  2A1J B;  5J2I A;  1L3S A;  2BPG A;  3RJE A;  4IQV A;  4PHD A;  3RJJ A;  5KFX A;  2HHU A;  1ZQM A;  2VA2 A;  3PY8 A;  3V6J A;  3HP6 A;  5KFT A;  2JEJ A;  2PFP A;  8ICA A;  4ED2 A;  1ZQL A;  4ECS A;  2ZUC A;  5DQH A;  4DF4 A;  5DQI A;  2BCV A;  5J0U A;  3V6K A;  5D46 A;  3RJG A;  1XSP A;  5CB1 A;  2RDI A;  3K75 D;  4QZB A;  3RB6 A;  3UXO A;  1QSL A;  2R8K A;  1CEZ A;  1NJY A;  1EXN A;  4F5P A;  3QEB Z;  1XC9 A;  2BCU A;  3NTU A;  4K4G A;  4DSE A;  7ICE A;  4YCX A;  3TI0 A;  3TFR A;  5J0R A;  4B9V A;  7ICP A;  5KFK A;  2UVR A;  2BGW A;  3PR5 B;  8ICO A;  1HUZ A;  5TZV A;  5DB9 A;  1XU4 A;  4ED3 A;  2XY5 A;  4M2Y A;  4KLT A;  4I2J A;  3RRH A;  4C8L A;  4EBE A;  1ZQX A;  4RQ0 A;  2AQ0 A;  1A76 A;  3LWL A;  4DSI A;  4O5C A;  4M9N A;  4UB5 A;  2V4R A;  5DB8 A;  2LYH A;  9ICA A;  4DQS A;  4X5V A;  2P6R A;  4I2A A;  4KN7 A;  4Z6F A;  3PX4 A;  2I1Q A;  3EW9 A;  3ORY A;  3PV8 A;  3UXP A;  3C2L A;  3SV3 A;  4Z6C A;  3PW4 A;  3SV4 A;  3ISB A;  5IIN A;  4B9L A;  4YMM A;  2Y1J A;  1ZQO A;  1Y88 A;  5DDY A;  4C8N A;  2XY6 A;  2BKE A;  2JEF A;  5BOM A;  4UAZ A;  2IBK A;  4DSK A;  4O9M A;  4XQ8 A;  5J2G A;  5J2C A;  3HX0 A;  4DSF A;  4QWE A;  4EEY A;  4R66 A;  4Q43 A;  4NY8 A;  4YR2 A;  7ICU A;  1NJW A;  5HHH A;  4C8K A;  4UAW A;  4ECR A;  4KLD A;  5KG4 A;  2HHS A;  2KFZ A;  4MFF A;  3LWM A;  9ICT A;  4J9L A;  5BPC A;  4R65 A;  2AU0 A;  5DLF A;  3LK9 A;  1XSN A;  2UVU A;  2HHW A;  5IIK A;  4XRH A;  2MAX A;  2RDJ A;  9ICV A;  3PO5 A;  4R63 A;  4RT2 A;  4UB1 A;  4B9M A;  2BQR A;  3Q8K A;  3RH6 A;  4F93 B;  4KLE A;  3EYZ A;  3MBY A;  3H7I A;  1RXV A;  4F4Z A;  1U47 A;  2ZTC A;  3BJY A;  4B9N A;  4ECQ A;  3KHR A;  5J2D A;  4J9K A;  8ICX A;  2IA6 A;  2OWO A;  4Z6D A;  1TKD A;  5KFO A;  2C2E A;  5KFM A;  3SYZ A;  5KT2 A;  3RJH A;  4KN4 A;  4YFK A;  5HHI A;  4QWA A;  3Q8L A;  3H40 A;  3TFS A;  1LV5 A;  1TK0 A;  2F1H A;  4UB4 A;  4ECV A;  3K4G A;  1L3U A;  3C2K A;  4PHE A;  2BCQ A;  1ZQT A;  3HPO A;  3HWT A;  4O3R A;  4GC7 A;  3RJF A;  8ICR A;  4ECX A;  4DL6 A;  1NKB A;  3PO4 A;  9ICB A;  3E2E A;  5KFA A;  3MR3 A;  1TV9 A;  4O3O A;  5F9N A;  3JPT A;  4F5Q A;  5J2J A;  3RR7 A;  4MEY A;  4QW9 A;  1NK0 A;  4DOC A;  4PGX A;  4IR1 A;  4F2S A;  3BQ1 A;  4M47 A;  8ICJ A;  5KG2 A;  4ED1 A;  3V7K A;  9ICC A;  1SZP A;  3H8J A;  1S77 D;  5KFI A;  2FLL A;  2H5X A;  4XA5 A;  3OSP A;  1JXL A;  4C8O A;  4JWN A;  3FYH A;  3UQ0 A;  8ICW A;  2NRW A;  2XC9 A;  3C1Y A;  1ZQN A;  3B0Y A;  2FMQ A;  2ISP A;  7ICN A;  8ICY A;  4BGD A;  3PX0 A;  9ICW A;  4DL3 A;  4K4I A;  7ICJ A;  8ICH A;  4GC6 A;  8ICP A;  3Q8R B;  3V72 A;  1V9P A;  4JV1 A;  4GLX A;  2ZJA A;  4NM2 A;  3ZD8 A;  2FPL A;  3BQT A;  3ISD A;  5J0O A;  4CCH A;  2C22 A;  4O3Q A;  3MDC A;  3RB4 A;  3NGD A;  4DS5 A;  4ED0 A;  4M6W B;  4DFM A;  1BPZ A;  4M6W A;  4UB3 A;  1KDH A;  4RQ6 A;  3G6Y A;  3PX6 A;  5J2H A;  5J2F A;  4KLF A;  3H8W A;  3ZD9 A;  3Q8M A;  2P66 A;  4YR3 A;  4QZH A;  2PI4 A;  3RR8 A;  4ELU A;  4DFK A;  3C1Z A;  4PHA A;  5J0Q A;  5CR0 A;  3RB0 A;  1NK7 A;  3ZDB A;  4KLU A;  2KTQ A;  1N48 A;  2BQ3 A;  1XSL A;  3MGI A;  1L5U A;  2HVI A;  4QZI A;  3ZDA A;  8ICT A;  1QTM A;  1HUO A;  2C2D A;  4NM1 A;  3C5G A;  3ZDC A;  3EZ5 A;  2DFL A;  4I2I A;  8ICQ A;  2ZUD A;  3MFH A;  4PPX A;  5DG8 A;  3M9N B;  3RB3 A;  2PFO A;  1ZQW A;  5J2E A;  1K1S A;  3ZDD A;  5HMM A;  1ZQC A;  1ZQR A;  5KFU A;  5DG9 A;  5IIM A;  1QSY A;  2F1J A;  5DBA A;  4IQW A;  4M04 A;  4QWD A;  4I27 A;  4NLG A;  1S9F A;  5KFS A;  2KFN A;  1TAU A;  3RTV A;  1SL0 A;  5DG7 A;  3PR4 A;  4I28 A;  4IRD A;  4UAY A;  1X9W A;  1NJZ A;  5F9L A;  3MFI A;  3HT3 A;  4DO9 A;  1ZQI A;  1ZJM A;  4FBU A;  4EZ9 A;  5D49 A;  5L1I A;  2KN7 A;  4DFJ A;  3PW2 A;  9ICK A;  4KLS A;  2Q0Z X;  2DPI A;  4KMU A;  4J9S A;  2J6S A;  2V9W A;  3PW7 A;  2XO7 A;  1U45 A;  4M9G A;  2HHQ A;  3T3F A;  4RQ3 A;  4RQ1 A;  8ICU A;  1ZQA A;  2IHN A;  1KRP A;  2BDP A;  5CA7 A;  3AU6 A;  4ECY A;  1HJP A;  1LB2 B;  4F2R A;  4O5E A;  1JN3 A;  1PZN A;  2MUT A;  1UA0 A;  4I29 A;  9ICM A;  1ZQQ A;  7ICL A;  5KT6 A;  1KFD A;  3IHQ B;  3G6X A;  3TAP A;  3GIL A;  5D4B A;  2JEG A;  9ICL A;  1SKS A;  4YD1 A;  3RJK A;  1ZQU A;  5EWG A;  9ICE A;  4IQT A;  5IIJ A;  3N97 B;  4IRK A;  3M8R A;  1MQ3 A;  9ICG A;  1U9L A;  4DQR A;  3GFK B;  9ICQ A;  2BHN A;  5DDM A;  4J9P A;  8ICK A;  8ICE A;  5KG7 A;  3C23 A;  4ED7 A;  2IHM A;  5DGA A;  1MC8 A;  3GV7 B;  4DL5 A;  3QEA Z;  3GII A;  2AGP A;  4Q8E A;  1ZYQ A;  4KLQ A;  4KIT B;  4ELT A;  4QWC A;  3GV5 B;  2FLP A;  3KHL A;  1NK5 A;  9ICX A;  3KHG A;  1D9F A;  4KLG A;  7ICT A;  3N4M B;  1BPD A;  5J2A A;  3QE9 Y;  3OGU A;  2HHT A;  4F91 B;  5DKW A;  3RRG A;  1A77 A;  1T4G A;  4QZF A;  1B43 A;  5BOL A;  4RQ8 A;  4TQS A;  3UPQ A;  2NRX A;  1KFS A;  4YXM A;  5DGB A;  2BCR A;  5HML A;  4QWB A;  5KFV A;  3H8S A;  3GIM A;  2W9B B;  4BWJ A;  2W9B A;  3RH5 A;  4RNM A;  5KFZ A;  4YMO A;  5J2B A;  3GDX A;  1N56 A;  1BPY A;  7ICH A;  4UBB A;  4EYI B;  1RYR A;  4M9J A;  4MF2 A;  4EBC A;  4Q45 A;  4MFC A;  4JUZ A;  4KLI A;  1KEJ A;  4TUP A;  4LZD A;  1DGS A;  1RZT A;  4YP3 A;  2R8J A;  2HHX A;  8ICF A;  2KZM A;  4YR0 A;  1T8E A;  1T7P A;  3FDS A;  1D8Y A;  2XY7 A;  4RPZ A;  4NLN A;  1DOQ A;  4E0D A;  3JPO A;  2FLN A;  1QLN A;  5KTQ A;  5KFN A;  2NRV A;  4UB2 A;  2J6U A;  2AGQ A;  9ICS A;  1B22 A;  1S0V A;  4RQ2 A;  2JZB B;  1ZQV A;  4QZC A;  3BQ0 A;  2JZB A;  1H38 A;  1BVS A;  8ICL A;  1S10 A;  4F4X A;  1TK8 A;  4O3P A;  4Z6E A;  5KG6 A;  8ICZ A;  3V7L A;  3RH4 A;  1RPL A;  3OHB A;  1TFR A;  9ICH A;  3V7J A;  1Z00 B;  1ZQY A;  5III A;  3PNC A;  1Z00 A;  4TQR A;  3OJU A;  1NK8 A;  3QZ7 A;  3KTQ A;  4I2D A;  3GV8 B;  2W8L A;  3UXN A;  3EPI A;  4F4Y A;  3MR6 A;  4F50 A;  2IMW P;  4M0A A;  7ICM A;  2W9A A;  1U4B A;  5DQG A;  4JWM A;  2FMP A;  2BQU A;  5KFJ A;  5HP4 A;  2ZTE A;  2NRT A;  3T5L A;  3JPP A;  3C2M A;  4O3S A;  1C7Y A;  1TAQ A;  4Q44 A;  1Z3E B;  2ALZ A;  1S0M A;  1SKR A;  2HHV A;  1ZET A;  9ICU A;  5J29 A;  3MR5 A;  3C21 A;  4DL4 A;  2ATL A;  7ICO A;  3ISC A;  4B9S A;  2ZTD A;  4ED6 A;  2UVW A;  9ICP A;  4Q8F A;  3PML A;  5KT4 A;  4KLM A;  4PHP A;  2GWS A;  2BPC A;  5KG5 A;  4K4H A;  5DLG A;  4YD2 A;  4ELV A;  4KTQ A;  9ICR A;  1SL1 A;  1COO A;  3M9M B;  4DLE A;  2XGQ A;  8ICS A;  2XGP A;  4P4M A;  4IQU A;  4NLK A;  3BDP A;  5L1L A;  1JX4 A;  1ZQB A;  4QZA A;  1X9M A;  8ICB A;  8ICG A;  2PFQ A;  2P6U A;  3EPG A;  4GXJ A;  1XO1 A;  1S0O A;  1KSP A;  4ZH4 A;  7ICS A;  2V4Q A;  1D8L A;  5J0S A;  4P2H A;  1XS9 D;  4F4K A;  4JV2 A;  3ETL A;  7ICR A;  3RBE A;  2B21 A;  5J0Y A;  3KHH A;  3TAN A;  5KFE A;  4P4O A;  4RQ5 A;  3JPQ A;  2ISO A;  4B9T A;  2A1J A;  4YG2 A;  4EZ6 A;  4RUA A;  3THV A;  1QSS A;  2ASJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...