1Z00A

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00A01
5HMMA 2A1JA 4ED2A 3ZDCA 4UB2A 3MFIA 3KHHA 4F91B 4YMMA 1LB2B 3V7JA 4J9MA 4P2HA 5J0UA 1U4BA 2HHXA 4RQ8A 3QEBZ 3TFSA 3Q8RB 5KFFA 3RBEA 4BXOA 9ICQA 5BOMA 3SI8A 2KN7A 1JX4A 4ZH4A 4O5EA 3RR8A 2ASLA 4DOCA 4DL4A 2R8KA 1NK6A 4QZDA 1A77A 5DKWA 5KFCA 1U9LA 4UAWA 3MGHA 3KHGA 5KFMA 1BPDA 3MR3A 7ICKA 3PY8A 1KSPA 5J0TA 3PO5A 4IR1A 5EWFA 2C2RA 2FMPA 2AGPA 2I1QA 5J0WA 4JUZA 1ZQNA 4ELVA 1S0MA 1BPBA 5KFKA 3MBYA 4Q8FA 2F1JA 2NRVA 3ZDBA 7ICVA 2R8HA 3PW7A 1N56A 2ZUCA 5DB8A 5IILA 4YG2A 1Z3EB 4EEYA 4F4ZA 4ECUA 8ICYA 4PHAA 4QZAA 2JEFA 4I2EA 4GXIA 4G3IA 4ECTA 9ICJA 5KG3A 3RB0A 4ED0A 4JWMA 4M9HA 2W9AA 3TANA 2IHMA 3GV7B 1ZQCA 4ECRA 3Q8LA 3OHAA 4BDPA 9ICPA 2BR0A 4DSIA 5DLGA 5KG0A 4HYKA 4J9LA 4ECXA 2Y1JA 4PPXA 4DL7A 1U45A 2MUTB 3JPRA 4TUPA 2BHNA 4KLTA 2FLNA 1T4GA 4RNOA 4R66A 5KFGA 1QSYA 5HNKA 4Z6FA 4B9TA 4Q44A 3JPPA 3ISDA 4DSEA 4K4GA 5J0OA 4DSJA 1U47A 4TUQA 2XY5A 4JWNA 1B22A 4KLSA 4DLGA 5L1JA 4UB4A 3FDSA 5KFOA 4J9NA 2VA3A 3THVA 3BQ2A 4RUCA 4DFJA 3ZD8A 2KZ3A 1CUKA 5J2FA 4DFMA 1NKCA 4C8OA 4O3SA 4X5VA 4KMUA 5J2CA 1S0OA 5J0RA 5KFSA 3M8SA 3T3FA 2PI5A 9ICFA 1ZQSA 8ICOA 4RPYA 2FPMA 2JEGA 4B9UA 5EWEA 2JZBB 2NRXA 7ICUA 3NTUA 3C2KA 2UVUA 4MF2A 4NLZA 5DG7A 4RQ4A 4I2IA 1NK8A 3GQCA 4Z6CA 5D49A 2V4RA 8ICHA 3ZDEA 9ICKA 3HX0A 2FMQA 2P66A 5DDMA 3RB3A 4DSLA 1TVAA 1TFRA 2FPKA 8ICRA 5J2HA 4B9SA 4O3OA 4NLKA 4I2DA 5KG2A 4QZFA 3PO4A 4GLXA 4EZ9A 3BQ0A 4NLGA 2V4QA 3NGDA 3AU6A 3ISBA 3H40A 4QZ9A 5DGBA 4ED8A 2IHNA 2FMSA 1S0VA 4PHEA 1ZQFA 1QTMA 3MGIA 5IIMA 1MC8A 4RQ0A 3BQTA 1SZPA 3UQ0A 2BPFA 4Q45A 4BWMA 3LK9A 2AGOA 3SYZA 8ICGA 1XO1A 3MDAA 4B9LA 1QSLA 3AUOA 2R8IA 1ZQAA 1U48A 4YXJA 8ICWA 3EYZA 1V9PA 1X9SA 4IRCA 2UVRA 3EWAA 4KLQA 9ICEA 4QWDA 3N4MB 3Q8KA 1NK5A 4MEXA 8ICCA 4I2AA 7ICPA 1B43A 5KFTA 4NM1A 1UT5A 1XSPA 2ZTEA 5KFWA 3PR5B 3QE9Y 1NKBA 4PGQA 7ICFA 2AJQA 4C8LA 2XO7A 4Q8EA 2ISPA 3PV8A 3RAXA 4F4WA 1TV9A 1RPLA 4YR3A 9ICRA 3BJYA 5TZVA 3PX6A 5KFPA 8ICEA 1ZQVA 4C8MA 4QZGA 4DS4A 4O3QA 4ECWA 3M9NB 1LV5A 4I2HA 2PI4A 4QWAA 1NJYA 1XWLA 5J2JA 4JK1A 3GDXA 5KFQA 5KFNA 1BPZA 2BCUA 4KLMA 4R64A 4NY8A 7ICHA 2PFOA 3JPTA 5KFIA 5C5JA 3QZ8A 3GIIA 4EBDA 5J2GA 3M8RA 9ICCA 8ICMA 4UBBA 4RQ3A 4XRHA 1U49A 3RB6A 2HHTA 1JXLA 5KT5A 1IM4A 3V6KA 1ZJMA 1RXVA 2KZZA 4QW9A 1QSSA 5KT3A 5KG6A 4QWCA 1Y88A 4RNNA 5KFXA 4NLNA 3H8SA 1ZQLA 2RDJA 1SL0A 4FBTA 4FO6A 1NK7A 4ELTA 4UBCA 4R8UA 4F92B 3ZDDA 3FYHA 5J0XA 2W9BB 3TFRA 3JPOA 4M9NA 4NXZA 1NJZA 4DOAA 2BDPA 3JPSA 2BPCA 4KLDA 4F4XA 1X9WA 2R8JA 1UA1A 5DG9A 1ZQTA 7ICRA 4O3NA 1TK8A 2FLPA 2C22A 4I2FA 5JUMA 3GV5B 1TK5A 3LWLA 5KFJA 4F50A 3M9MB 5IIJA 4YN4A 1L3UA 4RT3A 3GILA 2BQRA 4I28A 5HMLA 9ICNA 1Z00B 3RRHA 2KFNA 9ICUA 2WTFA 8ICIA 4F3OA 3G6YA 5HHHA 3RJIA 2P6RA 1BPYA 1K1QA 3LWMA 1BGXT 2NRWA 4YVZA 2JEIA 4JV1A 1D9DA 2DPIA 4DLEA 4FS1A 8ICPA 1N48A 4KN4A 2W8KA 5DLFA 5CA7A 7ICSA 2ZTDA 4YR2A 3PMLA 1ZQJA 2AQ0A 5EOZA 4ELUA 4IQVA 5CWRA 3PR4A 3UXNA 2W9CB 4DL2A 4ECQA 1ZQBA 4O5CA 3OJUA 3M9OB 1ZQMA 2H5XA 1L3TA 5J2KA 2XGPA 4I2BA 2HW3A 5KFYA 1DOQA 2NRZA 1ZQKA 1UT8A 2M9NA 3T5LA 1KRPA 1S77D 7ICJA 4DS5A 3HW8A 1NK0A 3MR2A 5CJ7A 4KLOA 1L3VA 4ED1A 4KLLA 5DB6A 4RPZA 2BQUA 3QZ7A 5KFHA 4DQSA 4F93B 4O3PA 4MF8A 1ZQUA 1ZETA 4TQRA 4P4MA 4DO9A 2KFZA 3UXPA 5L1LA 4MFFA 4RQ7A 4F4KA 4KN7A 4TURA 5IIIA 1EXNA 3HWTA 3QEAZ 2VA2A 3TAQA 3G6XA 3RJKA 4QZEA 5J2DA 5DB9A 2B21A 4KLHA 4J9KA 4UB1A 3IM1A 3Q8QB 1T8EA 4MEYA 2ZTCA 4F5QA 1TAUA 5DB7A 5J2EA 4IQWA 4ECSA 8ICAA 1HJPA 4YD2A 5KT2A 1ZQGA 3PW2A 4F8RA 9ICIA 2VA8A 2PXIA 3C2MA 4RZRA 3PVXA 1BVSA 1T7PA 2J6TA 5KFEA 3ORYA 2DFLA 3ZD9A 4I2GA 8ICTA 9ICBA 4NM2A 4ED7A 5D46A 1TAQA 5L1KA 4F2SA 2ASJA 4F5PA 1KFSA 2IMWP 4F2RA 1COOA 3Q8MA 5L9XA 4XUSA 1ZQPA 1D8YA 1IXRA 1ZQIA 3OSPA 3BQ1A 1XSLA 4M6WA 5L1IA 3C1ZA 3MR6A 4GC6A 4O3RA 7ICTA 3ZDAA 3UPQA 1TKDA 4J9PA 8ICLA 9ICMA 3GIKA 2XY7A 7ICIA 4MFCA 2ZJ5A 5DBBA 5F9NA 4DQPA 4M2YA 3V72A 5KFLA 4PH5A 1T3NA 1ZQZA 7ICNA 1NKEA 5J0YA 1KFDA 9ICSA 3C1YA 3H8JA 1ZQOA 3C5FA 3V6HA 4DSFA 4IR9A 4RQ1A 4J9QA 4XA5A 4I2JA 1CEZA 4QZBA 4DQIA 2VANA 4TQSA 4DOBA 2XCAA 4F5NA 7ICMA 4PGYA 1JXEA 4UB3A 1SKRA 4IRDA 2V9WA 4GXKA 3T5KA 3K4GA 9ICVA 1ZQDA 3H7IA 1X2IA 2HHUA 4QWBA 5DQGA 4F4YA 5DBCA 4C8NA 3OJSA 4PHDA 1SKWA 5J0PA 1ZQXA 4QWEA 4ECYA 8ICKA 4RNMA 9ICAA 1JMSA 4ECVA 2HHWA 2W8LA 4O9MA 1WCLA 4YXMA 2A1JB 2NRTA 4ED3A 3RB4A 3RJHA 3RTVA 3H8WA 3LDAA 3EW9A 5KT6A 3GIMA 1NOMA 3PMNA 4BXOB 4LZGA 2HHQA 3V7LA 2XGQA 2XC9A 4LZDA 2ZJ8A 1KTQA 2FPLA 4DL5A 5DGAA 3B0XA 1K1SA 1MSWD 3K75D 5KG7A 2HHVA 9ICTA 7ICOA 3IHQB 5CR0A 4R8UB 4I29A 1ZQRA 4KLEA 3MFHA 4PGXA 2KZMA 4B9MA 4DF8A 3ETLA 4DWIA 3RH4A 3N97B 1S9FA 3MABA 3SV4A 8ICVA 9ICGA 5KG4A 3HPOA 3C5GA 5HHIA 1ZQQA 3Q8SB 3HP6A 4BWJA 5HP4A 5KT7A 3RBDA 4EBCA 3C21A 4JV0A 2UVVA 4B9VA 1XS9D 3ISCA 3KHLA 1SKSA 3PNCA 2C2EA 2HHSA 1H38A 2KTQA 2AQ4A 8ICQA 3SV3A 2BQ3A 3T5JA 4ECZA 2AGQA 3RR7A 1S76D 5IINA 2J6UA 4DL6A 8ICBA 5KFZA 2P6UA 1A76A 4DFPA 4FBUA 4EYIB 3PW5A 5KG5A 4KLIA 4XQ8A 2LYHA 1AROP 4EZ6A 1D9FA 1L3SA 4B9NA 3EPIA 1SL2A 2AU0A 1KEJA 3UXOA 8ICSA 4UQGA 5F9LA 3GFKB 9ICHA 4YP3A 4O0IA 4M47A 8ICFA 4P4PA 2W9BA 4YCXA 2BCSA 1ZQYA 4Z6EA 4RPXA 2W9MA 5BPCA 4YFKA 5KTQA 3GIJA 1HUZA 4ED6A 1ZQHA 9ICWA 4QW8A 3G6VA 3TQ1A 2PFNA 4QZHA 3T5HA 5DQHA 4DF4A 2J6SA 4CCHA 3RH6A 5KFDA 4DQQA 4YR0A 4QZCA 1UA0A 1RYSA 1Z00A 4I27A 1QLNA 4RT2A 2JEJA 1RXWA 3TAPA 5J2IA 2Y1IA 3EPGA 4UAZA 4EBEA 1MQ3A 1PZNA 1NK9A 8ICXA 2ZJAA 4PHPA 3C23A 2ATLA 5J2AA 1S97A 1TK0A 2UVWA 1XC9A 3RRGA 5KFBA 3B0YA 2MAXA 5IIOA 5D4BA 2MUTA 3V6JA 3PX4A 5CB1A 4BGDA 4M0AA 2IBKA 3UQ2A 2C2DA 5J0SA 2W9CA 1WCNA 4EYHB 5KFVA 5KFRA 1RYRA 3H4BA 4YQWA 3RJJA 4M6WB 3RAQA 5DQIA 4GXJA 2I9GA 4E0DA 5KG1A 4YMNA 3AU2A 5J29A 4DEZA 1JN3A 2F1HA 4F5OA 3PW0A 4JV2A 5KFAA 2PFPA 1C7YA 4J9OA 4RUAA 5EWGA 4RQ5A 2JZBA 4R65A 4DFKA 2BGWA 4DSKA 3PX0A 3H4DA 2C28A 3RJFA 2ZUDA 1D8LA 4FS2A 5DDYA 4KITB 1S10A 4O5KA 4RQ2A 4Q43A 2PFQA 1NJWA 2ASDA 5DBAA 2BKEA 4KLGA 4KLJA 2GWSA 2F1IA 2Q0ZX 3OSNA 5BOLA 1XSNA 2BCQA 1KLNA 2OWOA 4DL3A 3E2EA 4IQTA 3OHBA 1XU4A 5IIKA 2ALZA 4Z6DA 3EZ5A 3JPQA 4LVSA 4KTQA 2BCVA 4QZ8A 3RJGA 8ICJA 2XCPA 5CHGA 3V7KA 3PW4A 1JIHA 8ICZA 1NJXA 3GV8B 4C8KA 1NK4A 2HVHA 2ZUBA 2RDIA 4M04A 1L5UA 4R63A 1S0NA 1ZJNA 2IA6A 3TARA 2DPJA 4IRKA 4UB5A 4M9GA 4IQUA 5CP2A 4GC7A 7ICLA 2R8GA 5KT4A 4RU9A 2XY6A 1RZTA 2BCRA 2HVIA 9ICOA 4P4OA 4QZIA 3KHRA 4UAYA 3C2LA 3SZ2A 1KFTA 7ICQA 4J9SA 4M9JA 1SL1A 3KTQA 1X9MA 1DGSA 4TUSA 9ICLA 3TI0A 3MR5A 4YD1A 1ZYQA 2ISOA 3MDCA 7ICEA 4RQ6A 4KLUA 3RJEA 3BDPA 4I2CA 2BPGA 3Q8PB 5J0QA 7ICGA 1BPEA 4K4IA 1MQ2A 1ZQWA 1BPXA 3HT3A 4KLFA 4F5RA 5J2BA 3RH5A 4K4HA 4M9LA 4DQRA 4YMOA 5DG8A 8ICUA 1ZQEA 4MFAA 1KDHA 5KFUA 1HUOA 2FLLA 8ICNA 3JPNA 3OGUA 4J9RA 9ICXA
chains in the Genus database with same CATH superfamily
5HMMA 4P0QB 3FM9A 4UB2A 3KHHA 3V7JA 1M6YA 3TFSA 5KAFU 1JX4A 2ASLA 4QZDA 4CF4A 1U9LA 1N5WA 5KFMA 1Z1BA 1KSPA 2ZIUB 5TISU 2ZIXA 3HKZC 3J81j 1ZQNA 1S0MA 4ELVA 3TKAA 2F1JA 1UCVA 2FI1A 2R8HA 3PW7A 1IV8A 2ZUCA 5IILA 1Z3EB 8ICYA 1RYUA 2RHFA 4ECTA 3I1YA 5KG3A 3RB0A 4ED0A 3TANA 3GV7B 1ZQCA 3Q8LA 3OHAA 4BDPA 3CP8A 4AYBF 1UQVA 2YB1A 4HYKA 2KJ9A 3MC1A 4FFDA 4ECXA 1U45A 2MUTB 4TUPA 2W55A 3OTQA 2VIXA 1TE2A 5JTIA 4K4GA 1U47A 4JWNA 3I28A 4DLGA 5AI9A 4J9NA 4QNLA 4RUCA 3QNMA 2KZ3A 4C8OA 1MN8A 4KMUA 1S0OA 2PI5A 5J0RA 3T3FA 2BZFA 1V97A 2FPMA 3LVWA 2NRXA 4RQ4A 4Z6CA 8ICHA 1AQ6A 1P7DA 4BJQA 2M0NA 1F5SA 2CRXA 1TFRA 4FZLA 3M6ZA 2I6XA 4NLKA 4I2DA 2E5SA 4QZFA 4NLGA 3BQ7A 2QKQA 3ISBA 3RFAA 3H40A 4RQ0A 1SZPA 2ZG6A 4B9LA 2MRLA 3AUOA 1KN5A 1U48A 4YXJA 4KLQA 9ICEA 3N4MB 1B43A 3ZI4A 4NM1A 3PR5B 3QE9Y 1PK1B 4Q8EA 4JMUA 1RPLA 3BJYA 3E0FA 2KK0A 4O3QA 3M9NB 1XWLA 5KFQA 5EE3A 5KFNA 3LVVA 4NY8A 1N5XA 4EBDA 3RF9A 4OJLA 5J2GA 1U49A 1JXLA 1ZJMA 4QW9A 5KT3A 1J2NA 4RNNA 4CDGA 2RDJA 3BS5B 4FO6A 1NK7A 4UBCA 2WF5A 3N7RC 3GZFA 4NXZA 3GU3A 2Y9UA 1LKYB 5ALRA 5DG9A 3VCBA 2FLPA 5JUMA 3GV5B 2KIWA 4OJOA 5ALFA 3M9MB 4YN4A 3GILA 2BQRA 4I28A 3RRHA 9ICUA 2P6RA 2VKQA 2JEIA 4YVZA 1D9DA 2CPRA 2W8KA 5DLFA 7ICSA 2ZTDA 3HILA 2E8PA 1ZQJA 4DCCA 1ZQBA 3OJUA 1ZQMA 2H5XA 5KFYA 2NRZA 1COKA 1KRPA 4DS5A 3HW8A 1NK0A 1ZD5A 3PSPA 5EE9A 3PSFA 2BQUA 5C0YA 1HEKA 2BDUA 4DQSA 4F93B 1X9XA 4DO9A 3UXPA 5L1LA 4RQ7A 4KN7A 2VA2A 3QU5A 4UB1A 4F71A 2RLTA 1SWWA 1UHUA 4IQWA 8ICAA 4RZRA 3ZD9A 1Q3VA 4F2SA 1KFSA 2H3VA 2JH1A 1COOA 2W11A 1O08A 3OSPA 1XSLA 2ES6A 3MR6A 1TKDA 9ICMA 7ICIA 4MFCA 5DBBA 4M2YA 1KFDA 3V6HA 5AIAA 4RQ1A 1DGJA 4I2JA 4BX9C 4DQIA 2VANA 7ICMA 1SKRA 4IRDA 1IIPA 9ICVA 3H7IA 4C8NA 4LJXA 3OJSA 4PHDA 5J0PA 2HBKA 4O9MA 1WCLA 4YXMA 3RB4A 2W3RA 1V38A 3H8WA 5KT6A 2KP7A 3GIMA 1NOMA 3PMNA 4BXOB 2HHQA 2XGQA 4DL5A 2FPLA 3B0XA 1K1SA 3SAGA 4C7ZA 4R8UB 3H0LB 4PGXA 4DWIA 2WF9A 1D8BA 4OJPA 3NS1A 3U26A 3SV4A 4EEKA 3C5GA 5HHIA 3RBDA 5KT7A 1JALA 2KG5A 3ISCA 3KHLA 1SKSA 4Y2RA 4ECZA 2ZXHA 2J6UA 3QUTA 3PW5A 5KG5A 3HRDD 1CRXA 2AU0A 3D2SA 2H3ZA 4Y2UA 4YP3A 4O0IA 8ICFA 3DV9A 4YCXA 2BCSA 2W9MA 5BPCA 5KTQA 1HUZA 3SAFA 3TQ1A 3T5HA 4QJFB 2JMGA 3RH6A 1Q46A 4RQMA 4QZCA 4RT2A 5ALUA 4EBEA 1MQ3A 3ED5A 2ZJAA 2PMZF 5EE1A 3C23A 4PHPA 5G5HA 5J2AA 1VLBA 5D4BA 2KKPA 4M0AA 1FO4A 4CF3A 1L7PA 1A6SA 1WCNA 5GTHU 5KFRA 1DXSA 1RYRA 3RJJA 4M6WB 1FFVA 4GXJA 2I9GA 5ALIA 2ZIVA 4YMNA 2F76X 5J29A 3AU2A 3PW0A 1JN3A 1SV0C 2IOFK 2PFPA 3SAHA 3PX0A 1V85A 1ZD3A 2ZUDA 4U7CA 1D8LA 3RJFA 3KOOA 2MSNA 1NJWA 1L8LA 2GWSA 1C20A 3OSNA 3QU2A 2OWOA 2E1FA 1KLNA 2LM4A 5AKLA 4IQTA 5IIKA 3EZ5A 1NNLA 4QZ8A 5CHGA 3PW4A 3CNHA 3D6JA 1ZJNA 3WKCA 2W7OA 5E79U 5KT4A 5ALXA 3KHRA 1UPHA 5ALOA 4J9SA 3TI0A 1Z4NA 2YX8A 7ICEA 5KAIU 5AKGA 4I2CA 2BPGA 3WKDA 7ICGA 2JRZA 4K4IA 4M9LA 5B66U 4QIWF 8ICUA 4MFAA 2FLLA 2OYYA 2PXIA 3OGUA 3JPNA 3F2BA 4UATA 2A1JA 4ED2A 3ZDCA 1U4BA 3F53A 3SI8A 3RR8A 2OCEA 2FE9A 4DL4A 2R8KA 5KFCA 2W54A 4UAWA 5J0TA 3PO5A 2C2RA 5J0WA 4JUZA 1BPBA 5KFKA 3MBYA 4Q8FA 7ICVA 1K5OA 4ACOA 5AM5A 5DB8A 4YG2A 4EEYA 4F4ZA 4QZAA 9ICJA 4GXIA 4JWMA 4Y2SA 4ECRA 2KJ5A 2KJ8A 3T79A 4DSIA 5KG0A 2A19A 3A0BU 4PPXA 4DL7A 1FIQA 3MGVA 5AICA 5KFGA 4Q44A 3JPPA 4DSEA 5J0OA 4TUQA 5ALMA 1T94A 1GO3F 4MHVA 5L1JA 5KFOA 3BQ2A 1SB3C 4DFMA 4O3SA 4X5VA 3M8SA 8ICOA 4PZOA 4RPYA 1X42A 3NTUA 3C2KA 2UVUA 5DG7A 3L5KA 2V4RA 9ICKA 2FMQA 2P66A 5DDMA 2F8KA 4UAVA 2ZIWB 5A0LA 4B9SA 4O3OA 4USAA 2DQNB 5KG2A 2OM6A 3NGDA 3AU6A 3QUBA 2A1AA 1XO0A 1N62A 2QARA 1S0VA 4PHEA 1ZQFA 4FE3A 5IIMA 1MC8A 3SMVA 2B6GA 2F3NA 4BWMA 2AGOA 3SYZA 5ALYA 5AI5A 1QSLA 2R8IA 1ZQAA 1Q3UA 2QLTA 2QB0B 5AM1A 4IRCA 2UVRA 3Q8KA 2PKEA 4MEXA 8ICCA 1XSPA 5KFWA 4PGQA 7ICFA 4C8LA 2MA1A 4YR3A 3QXGA 2W7PA 8ICEA 3S6JA 1ZQVA 4QZGA 3WK9A 3N28A 4QWAA 1PVRA 7ICHA 3JPTA 2W04A 5KFIA 1YZ7A 2F2AB 3RB6A 5KT5A 1IM4A 2WF6A 3V6KA 1RXVA 1QSSA 4QWCA 5KFXA 1JROA 4CF5A 1SL0A 4ELTA 4F92B 3C29A 2W9BB 5J0XA 4M9NA 1WWVA 1J2MA 1NZBA 1X9WA 3NVYA 2R8JA 1ZQTA 2C22A 1Z4OA 1ZD4A 5IIJA 1L3UA 4RT3A 1L7NA 4P0QA 5HMLA 1Z00B 2KFNA 2WTFA 3G6YA 1K1QA 3LWMA 4JV1A 4UW9A 3KZIU 4DLEA 4FS1A 5CA7A 1YT3A 5AKKA 1SXEA 1ZRMA 2AQ0A 2ZIUA 3UXNA 2W9CB 4O5CA 2K89A 2W43A 3M9OB 3WK7A 1X6IA 1L3TA 4A8EA 1KL9A 1S77D 7ICJA 4KLOA 3MR2A 5CJ7A 2WAQC 2K4EA 1RDFA 1L3VA 4ED1A 4RPZA 4CRXA 5KFHA 4NL9A 4O3PA 4MF8A 4P4MA 2KFZA 4MFFA 4F4KA 5IIIA 3QEAZ 3TAQA 4Y2JA 5DB9A 2DKXA 1T8EA 2HBMA 5KT2A 3C2MA 2EH9A 2J6TA 5KFEA 4I2GA 4ED7A 5D46A 1X66A 2EZZA 4F2RA 4XUSA 2OH2A 1ZQIA 5AM2A 8ICLA 2XY7A 3SENA 5KFLA 7ICNA 1ZQZA 3TADC 2HOQA 1NKEA 5J0YA 2EZXA 2R18A 9ICSA 2ESEA 1ZQOA 3C5FA 4DSFA 4UB6U 4IR9A 4QZBA 4KMOB 4TQSA 1J97A 2D8CA 1SV4A 3K4GA 2HCFA 2KKVA 5J8YC 5DQGA 1JI7A 4ZOHC 4CGZA 2HHWA 2NRTA 4ED3A 2DL0A 3EW9A 2K4HA 1KTQA 1MSWD 3K75D 1SXDA 2K8BB 9ICTA 3IHQB 4I29A 1PK1A 5ALSA 2H3FA 4B9MA 1L7OA 4RQNA 3MABA 3O0FA 1L7MA 2K8CB 1ZQQA 5HP4A 3C21A 4ICAA 2HHSA 3PNCA 2C2EA 2KTQA 1X6JA 8ICQA 3SV3A 2BQ3A 3T5JA 3NRWA 4US8A 5G5GA 2YMMA 4XQ8A 5ALHA 4EZ6A 1L3SA 3AQFA 1N61A 1WYGA 2CXYA 3UXOA 1PUZA 2VJ4A 1OW5A 3F2DA 4UQGA 1QQ5A 3BS5A 2E1EA 9ICHA 1RQLA 3WU2U 2XICA 3NASA 4Z6EA 1LKYA 4YFKA 3GIJA 3CRXA 3QUCA 4QW8A 3IRUA 2PFNA 2J6SA 5ALVA 5K4LA 2Y0SC 2Y1IA 4UAZA 1NK9A 3FC4A 5HR6A 2ATLA 4OD0A 5ALKA 5IIOA 2EAMA 3PX4A 1L8OA 2IBKA 4EYHB 1IG6A 3H4BA 4YQWA 4KX3A 3RAQA 3QYPA 2JXJA 2KVCA 4F5OA 2F1HA 2WB1C 1C7YA 2JZBA 5ALWA 2C28A 2K4PA 5DDYA 1S10A 4Q43A 2PFQA 3QU4A 1XSNA 5BOLA 4DL3A 3E2EA 1S5LU 3OHBA 1XU4A 4LVSA 2GLEA 8ICZA 1NJXA 3GV8B 1KW4A 2RDIA 1ECWA 2KHQA 3TARA 2EANA 3F5AA 4IRKA 5CP2A 2R8GA 1Q8KA 2F44A 7ICQA 3KTQA 1X9MA 5ALDA 4TUSA 9ICLA 3MR5A 4YD1A 2KOBA 2DWQA 3F5EA 1BPEA 1ZQ1C 2E8OA 5JRTA 1ZQWA 5AK6A 1BPXA 3ICXA 3D2NA 3RH5A 5DG8A 1KDHA 8ICNA 4C4RA 3PSTA 2EAOA 2GOLA 2G07A 3HJEA 5L1MA 4P2HA 2HHXA 3D2QA 4RQ8A 3Q8RB 5KFFA 4BXOA 9ICQA 5BOMA 2EZYA 2KN7A 4O5EA 1CI4A 2JH7A 4C0ZA 4DOCA 1NK6A 1A77A 5DKWA 2N1RA 3MGHA 3MR3A 3PY8A 5EWFA 2FMPA 1ZRNA 3ZDBA 4DFDA 2KD1A 4ECUA 2E8MA 3L4PA 3ETRA 9ICPA 2BR0A 5DLGA 2XIDA 3JPRA 2BHNA 4OO1J 2YB4A 1T4GA 3KD3A 4R66A 1QSYA 4Z6FA 1OXJA 5AKIA 3ISDA 3PSIA 1B22A 3IV6A 4OJ5A 4KX5A 2FJ6A 3THVA 3ZD8A 1NKCA 5J2CA 2KSOB 2LMRA 1NZPA 5ALJA 5EWEA 7ICUA 4MF2A 4NLZA 5D49A 2KICA 4C4SA 3HX0A 1VJ5A 4DSLA 1TVAA 5AHXA 5AKZA 1ZOLA 3PO4A 4GLXA 4EZ9A 2V4QA 5DGBA 4ED8A 2XI9A 2G09A 3KKAA 3SQIA 3MGIA 2QB1A 2E3TA 4Y2TA 2OEHA 4G9BA 3UQ0A 4Q45A 3LK9A 4GFJA 4Y2QA 8ICGA 8ICWA 3EYZA 4EX7A 3IG5A 3EWAA 2E8NA 4AYBC 4US9A 2HI0A 2D3DA 4QWDA 1UT5A 2ZTEA 5AI4A 3WKEA 2XO7A 2ISPA 2WF7A 3PV8A 3RAXA 2JGAA 3PX6A 1KQQA 4C8MA 4DS4A 1LV5A 4I2HA 1NJYA 1BPZA 2BCUA 4KLMA 4R64A 3QZ8A 2LI6A 2XVTA 3BZKA 8ICMA 4UBBA 4RQ3A 2HHTA 1RQNA 2KZZA 2H3IA 5KG6A 2Z7JA 2F8LA 3H8SA 1ZQLA 3TACB 3WK4A 3NUQA 2OHFA 3QU7A 4PL2A 3FYHA 3TFRA 3JPOA 3JPSA 2BPCA 4KLDA 1UA1A 2L5YA 1KBUA 4O3NA 4I2FA 1TK5A 1QCKA 2KV2A 3LWLA 4F50A 2W03A 9ICNA 1WWUA 8ICIA 2K4IA 4F3OA 3L3FX 5HHHA 1BPYA 1BGXT 2NRWA 1VDVA 1N48A 3OPXA 4EX6A 4YR2A 3CW2C 3PMLA 2HSZA 5EOZA 1F44A 4P0PB 5DB6A 2HOIA 1ZQUA 4F72A 2ODGA 4Y2YA 4TURA 4NV0A 3HWTA 3RJKA 4QZEA 5J2DA 1WUDA 2EQYA 4MEYA 4F5QA 5DB7A 4ECSA 5KNIA 1HJPA 4F8RA 2VA8A 5KL1B 1BVSA 1T7PA 4NWIA 9ICBA 5L1KA 2ASJA 2IMWP 3Q8MA 5L9XA 5AI6A 2EAPA 1ZQPA 1D8YA 3KBBA 5L1IA 7ICTA 4GC6A 3UPQA 4J9PA 5EE0A 5F9NA 4DQPA 3V72A 4PH5A 2ZIWA 3C1YA 1BNOA 4J9QA 4XA5A 1CEZA 3VC8A 3WK5A 4F5NA 4PGYA 4UB3A 3T5KA 2HHUA 1X2IA 4F4YA 1SKWA 4QWEA 9ICAA 1JMSA 1T3QA 4ECVA 2W8LA 3RJHA 4Y2VA 2B0CA 2KIVA 2QB0A 2XC9A 4LZDA 4UARA 2IOHA 4C80A 5KG7A 2RP5A 3EUB2 3MFHA 2KZMA 2AHOB 4O3MA 3AQEA 2FDRA 2ZIXB 3N97B 3K1ZA 1HIWA 2F77X 9ICGA 3BZCA 5KG4A 3AL0B 3HP6A 4BWJA 4EBCA 2AXTU 3KFUF 2AQ4A 3RR7A 1PVPA 8ICBA 2P6UA 1A76A 2D6FC 3FAHA 4EYIB 4HAIA 2LYHA 1AROP 4B9NA 3KZXA 3QX7A 3SD7A 1KEJA 8ICSA 3GFKB 1PK3A 4PZNA 5F3XB 2W9BA 1L6NA 5ALGA 1ZQYA 3LYSA 2GH1A 1ZQHA 4ED6A 3H0RB 9ICWA 3WK6A 5DQHA 5B5EU 4DF4A 4CCHA 1SIJA 5KFDA 4DQQA 4C4TA 1RYSA 1Z00A 2JEJA 3ONNA 3TAPA 1PZNA 1DRGA 1A0PA 1N63A 2A3VA 1S97A 2UVWA 1XC9A 5KFBA 3B0YA 2MUTA 3V6JA 5CB1A 4BGDA 3UQ2A 2W9CA 1XNSA 5KFVA 1B0XA 4E0DA 1JUDA 4C7YA 4DEZA 4JV2A 3WKAA 3H8MA 4J9OA 4RQ5A 4R65A 4DSKA 3H4DA 3QUQA 4KITB 4WJ3B 2P35A 4NLBA 2ASDA 2YY6A 2BKEA 3CYMA 4KLGA 2BCQA 1QH9A 3JPQA 1RG6A 2BCVA 2XCPA 4C8KA 4JB3A 1NK4A 2HVHA 2ZUBA 4M04A 4GIBA 2DPJA 4B6JA 4M9GA 4GC7A 2PMZC 4RU9A 2HVIA 5CEHA 4QZIA 3C2LA 4UAYA 1KFTA 3ALRA 4M9JA 1SL1A 1B4FA 1DGSA 2IOFA 3MDCA 4RQ6A 3BDPA 3Q8PB 4F5RA 2LYBA 3AN1A 4IS7A 4DQRA 4YMOA 5AIBA 1HUOA 2K8AA 4J9RA 9ICXA 3MFIA 4F91B 5AKYA 4YMMA 1LB2B 1URJA 4J9MA 5J0UA 4CE6A 3QEBZ 1QQ6A 2G08A 3RBEA 4ZH4A 2DUYA 2YMQA 3KHGA 1BPDA 3AMZA 7ICKA 4IR1A 2AGPA 2G5IB 2I1QA 3NRZA 2NRVA 5AK5A 1N56A 3DEEA 2YMLA 5AM0A 4PHAA 1ED1A 2JEFA 4I2EA 1FFUA 4G3IA 4M9HA 2I5HA 2W9AA 2HBJA 2IHMA 4J9LA 2Y1JA 4KLTA 2FLNA 4RNOA 5HNKA 4B9TA 1WG8A 3R9KA 4DSJA 2XY5A 2YTUA 5AM3A 2NV3A 4KLSA 4UB4A 3FDSA 2WF8A 2VA3A 4QIWC 4DFJA 1CUKA 5J2FA 5KFSA 9ICFA 1ZQSA 1SGGA 2JEGA 3DDHA 4B9UA 2LM1A 2JZBB 4NL9C 4I2IA 1NK8A 1SV0A 3GQCA 3ZDEA 3RB3A 2FPKA 8ICRA 5J2HA 2LBOA 5AM4A 2DKZA 3BQ0A 3WK8A 3B9JA 2LYAA 4QZ9A 3IG8A 2IHNA 2FMSA 4U6PA 1QTMA 3SEIA 3BQTA 2BPFA 2KMDA 3HKZF 3N7SC 1XO1A 3MDAA 3AEVA 2RRDA 1V9PA 1X9SA 3K1RB 4NJ8A 1NK5A 4I2AA 7ICPA 1S8OA 5KFTA 4AP9A 3C28A 1NKBA 1Z1VA 2AJQA 1TV9A 4F4WA 9ICRA 5TZVA 1DK2A 5KFPA 3NVZA 2NYVA 4ECWA 1N2XA 2PI4A 3QU9A 3IDWA 5J2JA 4JK1A 3GDXA 2PFOA 2WAQF 5C5JA 3GIIA 3UMGA 3M8RA 9ICCA 4XRHA 5AK4A 4FZNA 1Y88A 5HR7A 4NLNA 3H0MB 1RM6C 4UASA 3N7PD 1FEZA 4FBTA 4R8UA 3ZDDA 5GTIU 1LVHA 1NI3A 1O03A 4NLCA 1NJZA 4DOAA 2BDPA 4F4XA 5JU5A 7ICRA 1TK8A 5KFJA 4PJ0U 4IC9A 3A0HU 3RJIA 4BUGA 2DPIA 2RQ5A 8ICPA 4KN4A 4UB8U 1OUQA 5ALNA 4ELUA 4IQVA 5CWRA 3PR4A 3IN5A 4DL2A 4ECQA 4EELA 4UAUA 5J2KA 2XGPA 4I2BA 2KEYA 2HW3A 1DOQA 1ZQKA 1UT8A 2M9NA 3T5LA 3M7DA 1QQ7A 5AI0A 4KLLA 4PL1A 2ZIVB 1KKXA 3QZ7A 2NO4A 5CRXA 1ZETA 4TQRA 3IP4B 5ALPA 2JV3A 2G0AA 5AKJA 1EXNA 3G6XA 2DBYA 2B21A 4KLHA 4J9KA 5AKHA 3IM1A 3Q8QB 1TAUA 2ZTCA 5J2EA 4YD2A 1ZQGA 3PW2A 9ICIA 3PVXA 2LPEA 3ORYA 2DFLA 8ICTA 4NM2A 1TAQA 4F5PA 2KSOA 2YMPA 1IXRA 3BQ1A 4M6WA 3C1ZA 4O3RA 5H2FU 3ZDAA 3GIKA 2ZJ5A 1MA7A 2K60A 1BNPA 2WHEA 1T3NA 2H3QA 3H8JA 2KVSA 3SR6A 5T14A 4DOBA 2XCAA 2VJ5A 3UMCA 1JXEA 2V9WA 4GXKA 1ZQDA 4QWBA 5DBCA 1ZQXA 3PZPA 4ECYA 8ICKA 4RNMA 3AM9A 2A1JB 3RTVA 3LDAA 2JR5A 4LZGA 3V7LA 2Y0SF 2ZJ8A 5DGAA 2HHVA 7ICOA 5CR0A 1ZQRA 4KLEA 1DK3A 4DF8A 4OJ6A 2O6KA 3ETLA 3RH4A 1S9FA 8ICVA 4Y2PA 3HPOA 3Q8SB 4B9VA 4JV0A 2UVVA 1XS9D 1H38A 2OXOA 2AGQA 2HDOA 1S76D 5IINA 3E58A 4DL6A 1X40A 5KFZA 4DFPA 2DF4B 4FBUA 2WB1F 3NVVA 2KHVA 4KLIA 5AK3A 1D9FA 2DGZA 5KL8B 3EPIA 1SL2A 3M1YA 2YN4A 4Y2XA 2KE7A 4IL6U 5F9LA 3UMBA 4M47A 4P4PA 2G5HB 5ALLA 4RPXA 1F0MA 3G6VA 4QZHA 2LHTA 3I76A 3WKBA 4YR0A 1UA0A 2YQEA 4I27A 1QLNA 1RXWA 5J2IA 2HMXA 3EPGA 8ICXA 5FP0A 1TK0A 3RRGA 2MAXA 1Z19A 3F2CA 2QARB 1SZHA 2C2DA 5J0SA 5AKEA 5AKXA 4FZMA 3M6KA 5DQIA 5KG1A 4P0PA 2Q4TA 1TAMA 2AH5A 5KFAA 4RUAA 5EWGA 2MU2A 4DFKA 2BGWA 3UM9A 4FS2A 3TADA 4OCZA 4O5KA 2EDUA 4RQ2A 5AI8A 2GO7A 5DBAA 4KLJA 1ZXIA 2HOFA 2F1IA 2Q0ZX 5ALQA 2WFAA 3KKAC 5ALEA 4CNQA 4Z6DA 5J8YA 2ALZA 4KTQA 2LKYA 4J03A 3RJGA 8ICJA 3V7KA 2KNJA 1JIHA 1PVQA 1L5UA 4R63A 2NO5A 1S0NA 2IA6A 1YZ6A 4EENA 2Y9TA 2CN1A 1JRPA 2W3SA 4IQUA 4UB5A 7ICLA 2G06A 2XY6A 1RZTA 9ICOA 2BCRA 4P4OA 3SZ2A 5ALZA 1N60A 1ZYQA 5ALTA 2ISOA 3BS7A 4KLUA 3RJEA 5J0QA 2JHDA 1MQ2A 3NVWA 3HT3A 1SWVA 4KLFA 5J2BA 4K4HA 1ZD2P 2ZXIA 1ZQEA 2HBLA 5KFUA
chains in the Genus database with same CATH topology
5HMMA 2A1JA 4ED2A 3ZDCA 4UB2A 3MFIA 3KHHA 4F91B 4YMMA 1LB2B 3V7JA 4J9MA 4P2HA 5J0UA 1U4BA 2HHXA 4RQ8A 3QEBZ 3TFSA 3Q8RB 5KFFA 3RBEA 4BXOA 9ICQA 5BOMA 3SI8A 2KN7A 1JX4A 4ZH4A 4O5EA 3RR8A 2ASLA 4DOCA 4DL4A 2R8KA 1NK6A 4QZDA 1A77A 5DKWA 5KFCA 1U9LA 4UAWA 3MGHA 3KHGA 5KFMA 1BPDA 3MR3A 7ICKA 3PY8A 1KSPA 5J0TA 3PO5A 4IR1A 5EWFA 2C2RA 2FMPA 2AGPA 2I1QA 5J0WA 4JUZA 1ZQNA 4ELVA 1S0MA 1BPBA 5KFKA 3MBYA 4Q8FA 2F1JA 2NRVA 3ZDBA 7ICVA 2R8HA 3PW7A 1N56A 2ZUCA 5DB8A 5IILA 4YG2A 1Z3EB 4EEYA 4F4ZA 4ECUA 8ICYA 4PHAA 4QZAA 2JEFA 4I2EA 4GXIA 4G3IA 4ECTA 9ICJA 5KG3A 3RB0A 4ED0A 4JWMA 4M9HA 2W9AA 3TANA 2IHMA 3GV7B 1ZQCA 4ECRA 3Q8LA 3OHAA 4BDPA 9ICPA 2BR0A 4DSIA 5DLGA 5KG0A 4HYKA 4J9LA 4ECXA 2Y1JA 4PPXA 4DL7A 1U45A 2MUTB 3JPRA 4TUPA 2BHNA 4KLTA 2FLNA 1T4GA 4RNOA 4R66A 5KFGA 1QSYA 5HNKA 4Z6FA 4B9TA 4Q44A 3JPPA 3ISDA 4DSEA 4K4GA 5J0OA 4DSJA 1U47A 4TUQA 2XY5A 4JWNA 1B22A 4KLSA 4DLGA 5L1JA 4UB4A 3FDSA 5KFOA 4J9NA 2VA3A 3THVA 3BQ2A 4RUCA 4DFJA 3ZD8A 2KZ3A 1CUKA 5J2FA 4DFMA 1NKCA 4C8OA 4O3SA 4X5VA 4KMUA 5J2CA 1S0OA 5J0RA 5KFSA 3M8SA 3T3FA 2PI5A 9ICFA 1ZQSA 8ICOA 4RPYA 2FPMA 2JEGA 4B9UA 5EWEA 2JZBB 2NRXA 7ICUA 3NTUA 3C2KA 2UVUA 4MF2A 4NLZA 5DG7A 4RQ4A 4I2IA 1NK8A 3GQCA 4Z6CA 5D49A 2V4RA 8ICHA 3ZDEA 9ICKA 3HX0A 2FMQA 2P66A 5DDMA 3RB3A 4DSLA 1TVAA 1TFRA 2FPKA 8ICRA 5J2HA 4B9SA 4O3OA 4NLKA 4I2DA 5KG2A 4QZFA 3PO4A 4GLXA 4EZ9A 3BQ0A 4NLGA 2V4QA 3NGDA 3AU6A 3ISBA 3H40A 4QZ9A 5DGBA 4ED8A 2IHNA 2FMSA 1S0VA 4PHEA 1ZQFA 1QTMA 3MGIA 5IIMA 1MC8A 4RQ0A 3BQTA 1SZPA 3UQ0A 2BPFA 4Q45A 4BWMA 3LK9A 2AGOA 3SYZA 8ICGA 1XO1A 3MDAA 4B9LA 1QSLA 3AUOA 2R8IA 1ZQAA 1U48A 4YXJA 8ICWA 3EYZA 1V9PA 1X9SA 4IRCA 2UVRA 3EWAA 4KLQA 9ICEA 4QWDA 3N4MB 3Q8KA 1NK5A 4MEXA 8ICCA 4I2AA 7ICPA 1B43A 5KFTA 4NM1A 1UT5A 1XSPA 2ZTEA 5KFWA 3PR5B 3QE9Y 1NKBA 4PGQA 7ICFA 2AJQA 4C8LA 2XO7A 4Q8EA 2ISPA 3PV8A 3RAXA 4F4WA 1TV9A 1RPLA 4YR3A 9ICRA 3BJYA 5TZVA 3PX6A 5KFPA 8ICEA 1ZQVA 4C8MA 4QZGA 4DS4A 4O3QA 4ECWA 3M9NB 1LV5A 4I2HA 2PI4A 4QWAA 1NJYA 1XWLA 5J2JA 4JK1A 3GDXA 5KFQA 5KFNA 1BPZA 2BCUA 4KLMA 4R64A 4NY8A 7ICHA 2PFOA 3JPTA 5KFIA 5C5JA 3QZ8A 3GIIA 4EBDA 5J2GA 3M8RA 9ICCA 8ICMA 4UBBA 4RQ3A 4XRHA 1U49A 3RB6A 2HHTA 1JXLA 5KT5A 1IM4A 3V6KA 1ZJMA 1RXVA 2KZZA 4QW9A 1QSSA 5KT3A 5KG6A 4QWCA 1Y88A 4RNNA 5KFXA 4NLNA 3H8SA 1ZQLA 2RDJA 1SL0A 4FBTA 4FO6A 1NK7A 4ELTA 4UBCA 4R8UA 4F92B 3ZDDA 3FYHA 5J0XA 2W9BB 3TFRA 3JPOA 4M9NA 4NXZA 1NJZA 4DOAA 2BDPA 3JPSA 2BPCA 4KLDA 4F4XA 1X9WA 2R8JA 1UA1A 5DG9A 1ZQTA 7ICRA 4O3NA 1TK8A 2FLPA 2C22A 4I2FA 5JUMA 3GV5B 1TK5A 3LWLA 5KFJA 4F50A 3M9MB 5IIJA 4YN4A 1L3UA 4RT3A 3GILA 2BQRA 4I28A 5HMLA 9ICNA 1Z00B 3RRHA 2KFNA 9ICUA 2WTFA 8ICIA 4F3OA 3G6YA 5HHHA 3RJIA 2P6RA 1BPYA 1K1QA 3LWMA 1BGXT 2NRWA 4YVZA 2JEIA 4JV1A 1D9DA 2DPIA 4DLEA 4FS1A 8ICPA 1N48A 4KN4A 2W8KA 5DLFA 5CA7A 7ICSA 2ZTDA 4YR2A 3PMLA 1ZQJA 2AQ0A 5EOZA 4ELUA 4IQVA 5CWRA 3PR4A 3UXNA 2W9CB 4DL2A 4ECQA 1ZQBA 4O5CA 3OJUA 3M9OB 1ZQMA 2H5XA 1L3TA 5J2KA 2XGPA 4I2BA 2HW3A 5KFYA 1DOQA 2NRZA 1ZQKA 1UT8A 2M9NA 3T5LA 1KRPA 1S77D 7ICJA 4DS5A 3HW8A 1NK0A 3MR2A 5CJ7A 4KLOA 1L3VA 4ED1A 4KLLA 5DB6A 4RPZA 2BQUA 3QZ7A 5KFHA 4DQSA 4F93B 4O3PA 4MF8A 1ZQUA 1ZETA 4TQRA 4P4MA 4DO9A 2KFZA 3UXPA 5L1LA 4MFFA 4RQ7A 4F4KA 4KN7A 4TURA 5IIIA 1EXNA 3HWTA 3QEAZ 2VA2A 3TAQA 3G6XA 3RJKA 4QZEA 5J2DA 5DB9A 2B21A 4KLHA 4J9KA 4UB1A 3IM1A 3Q8QB 1T8EA 4MEYA 2ZTCA 4F5QA 1TAUA 5DB7A 5J2EA 4IQWA 4ECSA 8ICAA 1HJPA 4YD2A 5KT2A 1ZQGA 3PW2A 4F8RA 9ICIA 2VA8A 2PXIA 3C2MA 4RZRA 3PVXA 1BVSA 1T7PA 2J6TA 5KFEA 3ORYA 2DFLA 3ZD9A 4I2GA 8ICTA 9ICBA 4NM2A 4ED7A 5D46A 1TAQA 5L1KA 4F2SA 2ASJA 4F5PA 1KFSA 2IMWP 4F2RA 1COOA 3Q8MA 5L9XA 4XUSA 1ZQPA 1D8YA 1IXRA 1ZQIA 3OSPA 3BQ1A 1XSLA 4M6WA 5L1IA 3C1ZA 3MR6A 4GC6A 4O3RA 7ICTA 3ZDAA 3UPQA 1TKDA 4J9PA 8ICLA 9ICMA 3GIKA 2XY7A 7ICIA 4MFCA 2ZJ5A 5DBBA 5F9NA 4DQPA 4M2YA 3V72A 5KFLA 4PH5A 1T3NA 1ZQZA 7ICNA 1NKEA 5J0YA 1KFDA 9ICSA 3C1YA 3H8JA 1ZQOA 3C5FA 3V6HA 4DSFA 4IR9A 4RQ1A 4J9QA 4XA5A 4I2JA 1CEZA 4QZBA 4DQIA 2VANA 4TQSA 4DOBA 2XCAA 4F5NA 7ICMA 4PGYA 1JXEA 4UB3A 1SKRA 4IRDA 2V9WA 4GXKA 3T5KA 3K4GA 9ICVA 1ZQDA 3H7IA 1X2IA 2HHUA 4QWBA 5DQGA 4F4YA 5DBCA 4C8NA 3OJSA 4PHDA 1SKWA 5J0PA 1ZQXA 4QWEA 4ECYA 8ICKA 4RNMA 9ICAA 1JMSA 4ECVA 2HHWA 2W8LA 4O9MA 1WCLA 4YXMA 2A1JB 2NRTA 4ED3A 3RB4A 3RJHA 3RTVA 3H8WA 3LDAA 3EW9A 5KT6A 3GIMA 1NOMA 3PMNA 4BXOB 4LZGA 2HHQA 3V7LA 2XGQA 2XC9A 4LZDA 2ZJ8A 1KTQA 2FPLA 4DL5A 5DGAA 3B0XA 1K1SA 1MSWD 3K75D 5KG7A 2HHVA 9ICTA 7ICOA 3IHQB 5CR0A 4R8UB 4I29A 1ZQRA 4KLEA 3MFHA 4PGXA 2KZMA 4B9MA 4DF8A 3ETLA 4DWIA 3RH4A 3N97B 1S9FA 3MABA 3SV4A 8ICVA 9ICGA 5KG4A 3HPOA 3C5GA 5HHIA 1ZQQA 3Q8SB 3HP6A 4BWJA 5HP4A 5KT7A 3RBDA 4EBCA 3C21A 4JV0A 2UVVA 4B9VA 1XS9D 3ISCA 3KHLA 1SKSA 3PNCA 2C2EA 2HHSA 1H38A 2KTQA 2AQ4A 8ICQA 3SV3A 2BQ3A 3T5JA 4ECZA 2AGQA 3RR7A 1S76D 5IINA 2J6UA 4DL6A 8ICBA 5KFZA 2P6UA 1A76A 4DFPA 4FBUA 4EYIB 3PW5A 5KG5A 4KLIA 4XQ8A 2LYHA 1AROP 4EZ6A 1D9FA 1L3SA 4B9NA 3EPIA 1SL2A 2AU0A 1KEJA 3UXOA 8ICSA 4UQGA 5F9LA 3GFKB 9ICHA 4YP3A 4O0IA 4M47A 8ICFA 4P4PA 2W9BA 4YCXA 2BCSA 1ZQYA 4Z6EA 4RPXA 2W9MA 5BPCA 4YFKA 5KTQA 3GIJA 1HUZA 4ED6A 1ZQHA 9ICWA 4QW8A 3G6VA 3TQ1A 2PFNA 4QZHA 3T5HA 5DQHA 4DF4A 2J6SA 4CCHA 3RH6A 5KFDA 4DQQA 4YR0A 4QZCA 1UA0A 1RYSA 1Z00A 4I27A 1QLNA 4RT2A 2JEJA 1RXWA 3TAPA 5J2IA 2Y1IA 3EPGA 4UAZA 4EBEA 1MQ3A 1PZNA 1NK9A 8ICXA 2ZJAA 4PHPA 3C23A 2ATLA 5J2AA 1S97A 1TK0A 2UVWA 1XC9A 3RRGA 5KFBA 3B0YA 2MAXA 5IIOA 5D4BA 2MUTA 3V6JA 3PX4A 5CB1A 4BGDA 4M0AA 2IBKA 3UQ2A 2C2DA 5J0SA 2W9CA 1WCNA 4EYHB 5KFVA 5KFRA 1RYRA 3H4BA 4YQWA 3RJJA 4M6WB 3RAQA 5DQIA 4GXJA 2I9GA 4E0DA 5KG1A 4YMNA 3AU2A 5J29A 4DEZA 1JN3A 2F1HA 4F5OA 3PW0A 4JV2A 5KFAA 2PFPA 1C7YA 4J9OA 4RUAA 5EWGA 4RQ5A 2JZBA 4R65A 4DFKA 2BGWA 4DSKA 3PX0A 3H4DA 2C28A 3RJFA 2ZUDA 1D8LA 4FS2A 5DDYA 4KITB 1S10A 4O5KA 4RQ2A 4Q43A 2PFQA 1NJWA 2ASDA 5DBAA 2BKEA 4KLGA 4KLJA 2GWSA 2F1IA 2Q0ZX 3OSNA 5BOLA 1XSNA 2BCQA 1KLNA 2OWOA 4DL3A 3E2EA 4IQTA 3OHBA 1XU4A 5IIKA 2ALZA 4Z6DA 3EZ5A 3JPQA 4LVSA 4KTQA 2BCVA 4QZ8A 3RJGA 8ICJA 2XCPA 5CHGA 3V7KA 3PW4A 1JIHA 8ICZA 1NJXA 3GV8B 4C8KA 1NK4A 2HVHA 2ZUBA 2RDIA 4M04A 1L5UA 4R63A 1S0NA 1ZJNA 2IA6A 3TARA 2DPJA 4IRKA 4UB5A 4M9GA 4IQUA 5CP2A 4GC7A 7ICLA 2R8GA 5KT4A 4RU9A 2XY6A 1RZTA 2BCRA 2HVIA 9ICOA 4P4OA 4QZIA 3KHRA 4UAYA 3C2LA 3SZ2A 1KFTA 7ICQA 4J9SA 4M9JA 1SL1A 3KTQA 1X9MA 1DGSA 4TUSA 9ICLA 3TI0A 3MR5A 4YD1A 1ZYQA 2ISOA 3MDCA 7ICEA 4RQ6A 4KLUA 3RJEA 3BDPA 4I2CA 2BPGA 3Q8PB 5J0QA 7ICGA 1BPEA 4K4IA 1MQ2A 1ZQWA 1BPXA 3HT3A 4KLFA 4F5RA 5J2BA 3RH5A 4K4HA 4M9LA 4DQRA 4YMOA 5DG8A 8ICUA 1ZQEA 4MFAA 1KDHA 5KFUA 1HUOA 2FLLA 8ICNA 3JPNA 3OGUA 4J9RA 9ICXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HMM A;  2A1J A;  4ED2 A;  3ZDC A;  4UB2 A;  3MFI A;  3KHH A;  4F91 B;  4YMM A;  1LB2 B;  3V7J A;  4J9M A;  4P2H A;  5J0U A;  1U4B A;  2HHX A;  4RQ8 A;  3QEB Z;  3TFS A;  3Q8R B;  5KFF A;  3RBE A;  4BXO A;  9ICQ A;  5BOM A;  3SI8 A;  2KN7 A;  1JX4 A;  4ZH4 A;  4O5E A;  3RR8 A;  2ASL A;  4DOC A;  4DL4 A;  2R8K A;  1NK6 A;  4QZD A;  1A77 A;  5DKW A;  5KFC A;  1U9L A;  4UAW A;  3MGH A;  3KHG A;  5KFM A;  1BPD A;  3MR3 A;  7ICK A;  3PY8 A;  1KSP A;  5J0T A;  3PO5 A;  4IR1 A;  5EWF A;  2C2R A;  2FMP A;  2AGP A;  2I1Q A;  5J0W A;  4JUZ A;  1ZQN A;  4ELV A;  1S0M A;  1BPB A;  5KFK A;  3MBY A;  4Q8F A;  2F1J A;  2NRV A;  3ZDB A;  7ICV A;  2R8H A;  3PW7 A;  1N56 A;  2ZUC A;  5DB8 A;  5IIL A;  4YG2 A;  1Z3E B;  4EEY A;  4F4Z A;  4ECU A;  8ICY A;  4PHA A;  4QZA A;  2JEF A;  4I2E A;  4GXI A;  4G3I A;  4ECT A;  9ICJ A;  5KG3 A;  3RB0 A;  4ED0 A;  4JWM A;  4M9H A;  2W9A A;  3TAN A;  2IHM A;  3GV7 B;  1ZQC A;  4ECR A;  3Q8L A;  3OHA A;  4BDP A;  9ICP A;  2BR0 A;  4DSI A;  5DLG A;  5KG0 A;  4HYK A;  4J9L A;  4ECX A;  2Y1J A;  4PPX A;  4DL7 A;  1U45 A;  2MUT B;  3JPR A;  4TUP A;  2BHN A;  4KLT A;  2FLN A;  1T4G A;  4RNO A;  4R66 A;  5KFG A;  1QSY A;  5HNK A;  4Z6F A;  4B9T A;  4Q44 A;  3JPP A;  3ISD A;  4DSE A;  4K4G A;  5J0O A;  4DSJ A;  1U47 A;  4TUQ A;  2XY5 A;  4JWN A;  1B22 A;  4KLS A;  4DLG A;  5L1J A;  4UB4 A;  3FDS A;  5KFO A;  4J9N A;  2VA3 A;  3THV A;  3BQ2 A;  4RUC A;  4DFJ A;  3ZD8 A;  2KZ3 A;  1CUK A;  5J2F A;  4DFM A;  1NKC A;  4C8O A;  4O3S A;  4X5V A;  4KMU A;  5J2C A;  1S0O A;  5J0R A;  5KFS A;  3M8S A;  3T3F A;  2PI5 A;  9ICF A;  1ZQS A;  8ICO A;  4RPY A;  2FPM A;  2JEG A;  4B9U A;  5EWE A;  2JZB B;  2NRX A;  7ICU A;  3NTU A;  3C2K A;  2UVU A;  4MF2 A;  4NLZ A;  5DG7 A;  4RQ4 A;  4I2I A;  1NK8 A;  3GQC A;  4Z6C A;  5D49 A;  2V4R A;  8ICH A;  3ZDE A;  9ICK A;  3HX0 A;  2FMQ A;  2P66 A;  5DDM A;  3RB3 A;  4DSL A;  1TVA A;  1TFR A;  2FPK A;  8ICR A;  5J2H A;  4B9S A;  4O3O A;  4NLK A;  4I2D A;  5KG2 A;  4QZF A;  3PO4 A;  4GLX A;  4EZ9 A;  3BQ0 A;  4NLG A;  2V4Q A;  3NGD A;  3AU6 A;  3ISB A;  3H40 A;  4QZ9 A;  5DGB A;  4ED8 A;  2IHN A;  2FMS A;  1S0V A;  4PHE A;  1ZQF A;  1QTM A;  3MGI A;  5IIM A;  1MC8 A;  4RQ0 A;  3BQT A;  1SZP A;  3UQ0 A;  2BPF A;  4Q45 A;  4BWM A;  3LK9 A;  2AGO A;  3SYZ A;  8ICG A;  1XO1 A;  3MDA A;  4B9L A;  1QSL A;  3AUO A;  2R8I A;  1ZQA A;  1U48 A;  4YXJ A;  8ICW A;  3EYZ A;  1V9P A;  1X9S A;  4IRC A;  2UVR A;  3EWA A;  4KLQ A;  9ICE A;  4QWD A;  3N4M B;  3Q8K A;  1NK5 A;  4MEX A;  8ICC A;  4I2A A;  7ICP A;  1B43 A;  5KFT A;  4NM1 A;  1UT5 A;  1XSP A;  2ZTE A;  5KFW A;  3PR5 B;  3QE9 Y;  1NKB A;  4PGQ A;  7ICF A;  2AJQ A;  4C8L A;  2XO7 A;  4Q8E A;  2ISP A;  3PV8 A;  3RAX A;  4F4W A;  1TV9 A;  1RPL A;  4YR3 A;  9ICR A;  3BJY A;  5TZV A;  3PX6 A;  5KFP A;  8ICE A;  1ZQV A;  4C8M A;  4QZG A;  4DS4 A;  4O3Q A;  4ECW A;  3M9N B;  1LV5 A;  4I2H A;  2PI4 A;  4QWA A;  1NJY A;  1XWL A;  5J2J A;  4JK1 A;  3GDX A;  5KFQ A;  5KFN A;  1BPZ A;  2BCU A;  4KLM A;  4R64 A;  4NY8 A;  7ICH A;  2PFO A;  3JPT A;  5KFI A;  5C5J A;  3QZ8 A;  3GII A;  4EBD A;  5J2G A;  3M8R A;  9ICC A;  8ICM A;  4UBB A;  4RQ3 A;  4XRH A;  1U49 A;  3RB6 A;  2HHT A;  1JXL A;  5KT5 A;  1IM4 A;  3V6K A;  1ZJM A;  1RXV A;  2KZZ A;  4QW9 A;  1QSS A;  5KT3 A;  5KG6 A;  4QWC A;  1Y88 A;  4RNN A;  5KFX A;  4NLN A;  3H8S A;  1ZQL A;  2RDJ A;  1SL0 A;  4FBT A;  4FO6 A;  1NK7 A;  4ELT A;  4UBC A;  4R8U A;  4F92 B;  3ZDD A;  3FYH A;  5J0X A;  2W9B B;  3TFR A;  3JPO A;  4M9N A;  4NXZ A;  1NJZ A;  4DOA A;  2BDP A;  3JPS A;  2BPC A;  4KLD A;  4F4X A;  1X9W A;  2R8J A;  1UA1 A;  5DG9 A;  1ZQT A;  7ICR A;  4O3N A;  1TK8 A;  2FLP A;  2C22 A;  4I2F A;  5JUM A;  3GV5 B;  1TK5 A;  3LWL A;  5KFJ A;  4F50 A;  3M9M B;  5IIJ A;  4YN4 A;  1L3U A;  4RT3 A;  3GIL A;  2BQR A;  4I28 A;  5HML A;  9ICN A;  1Z00 B;  3RRH A;  2KFN A;  9ICU A;  2WTF A;  8ICI A;  4F3O A;  3G6Y A;  5HHH A;  3RJI A;  2P6R A;  1BPY A;  1K1Q A;  3LWM A;  1BGX T;  2NRW A;  4YVZ A;  2JEI A;  4JV1 A;  1D9D A;  2DPI A;  4DLE A;  4FS1 A;  8ICP A;  1N48 A;  4KN4 A;  2W8K A;  5DLF A;  5CA7 A;  7ICS A;  2ZTD A;  4YR2 A;  3PML A;  1ZQJ A;  2AQ0 A;  5EOZ A;  4ELU A;  4IQV A;  5CWR A;  3PR4 A;  3UXN A;  2W9C B;  4DL2 A;  4ECQ A;  1ZQB A;  4O5C A;  3OJU A;  3M9O B;  1ZQM A;  2H5X A;  1L3T A;  5J2K A;  2XGP A;  4I2B A;  2HW3 A;  5KFY A;  1DOQ A;  2NRZ A;  1ZQK A;  1UT8 A;  2M9N A;  3T5L A;  1KRP A;  1S77 D;  7ICJ A;  4DS5 A;  3HW8 A;  1NK0 A;  3MR2 A;  5CJ7 A;  4KLO A;  1L3V A;  4ED1 A;  4KLL A;  5DB6 A;  4RPZ A;  2BQU A;  3QZ7 A;  5KFH A;  4DQS A;  4F93 B;  4O3P A;  4MF8 A;  1ZQU A;  1ZET A;  4TQR A;  4P4M A;  4DO9 A;  2KFZ A;  3UXP A;  5L1L A;  4MFF A;  4RQ7 A;  4F4K A;  4KN7 A;  4TUR A;  5III A;  1EXN A;  3HWT A;  3QEA Z;  2VA2 A;  3TAQ A;  3G6X A;  3RJK A;  4QZE A;  5J2D A;  5DB9 A;  2B21 A;  4KLH A;  4J9K A;  4UB1 A;  3IM1 A;  3Q8Q B;  1T8E A;  4MEY A;  2ZTC A;  4F5Q A;  1TAU A;  5DB7 A;  5J2E A;  4IQW A;  4ECS A;  8ICA A;  1HJP A;  4YD2 A;  5KT2 A;  1ZQG A;  3PW2 A;  4F8R A;  9ICI A;  2VA8 A;  2PXI A;  3C2M A;  4RZR A;  3PVX A;  1BVS A;  1T7P A;  2J6T A;  5KFE A;  3ORY A;  2DFL A;  3ZD9 A;  4I2G A;  8ICT A;  9ICB A;  4NM2 A;  4ED7 A;  5D46 A;  1TAQ A;  5L1K A;  4F2S A;  2ASJ A;  4F5P A;  1KFS A;  2IMW P;  4F2R A;  1COO A;  3Q8M A;  5L9X A;  4XUS A;  1ZQP A;  1D8Y A;  1IXR A;  1ZQI A;  3OSP A;  3BQ1 A;  1XSL A;  4M6W A;  5L1I A;  3C1Z A;  3MR6 A;  4GC6 A;  4O3R A;  7ICT A;  3ZDA A;  3UPQ A;  1TKD A;  4J9P A;  8ICL A;  9ICM A;  3GIK A;  2XY7 A;  7ICI A;  4MFC A;  2ZJ5 A;  5DBB A;  5F9N A;  4DQP A;  4M2Y A;  3V72 A;  5KFL A;  4PH5 A;  1T3N A;  1ZQZ A;  7ICN A;  1NKE A;  5J0Y A;  1KFD A;  9ICS A;  3C1Y A;  3H8J A;  1ZQO A;  3C5F A;  3V6H A;  4DSF A;  4IR9 A;  4RQ1 A;  4J9Q A;  4XA5 A;  4I2J A;  1CEZ A;  4QZB A;  4DQI A;  2VAN A;  4TQS A;  4DOB A;  2XCA A;  4F5N A;  7ICM A;  4PGY A;  1JXE A;  4UB3 A;  1SKR A;  4IRD A;  2V9W A;  4GXK A;  3T5K A;  3K4G A;  9ICV A;  1ZQD A;  3H7I A;  1X2I A;  2HHU A;  4QWB A;  5DQG A;  4F4Y A;  5DBC A;  4C8N A;  3OJS A;  4PHD A;  1SKW A;  5J0P A;  1ZQX A;  4QWE A;  4ECY A;  8ICK A;  4RNM A;  9ICA A;  1JMS A;  4ECV A;  2HHW A;  2W8L A;  4O9M A;  1WCL A;  4YXM A;  2A1J B;  2NRT A;  4ED3 A;  3RB4 A;  3RJH A;  3RTV A;  3H8W A;  3LDA A;  3EW9 A;  5KT6 A;  3GIM A;  1NOM A;  3PMN A;  4BXO B;  4LZG A;  2HHQ A;  3V7L A;  2XGQ A;  2XC9 A;  4LZD A;  2ZJ8 A;  1KTQ A;  2FPL A;  4DL5 A;  5DGA A;  3B0X A;  1K1S A;  1MSW D;  3K75 D;  5KG7 A;  2HHV A;  9ICT A;  7ICO A;  3IHQ B;  5CR0 A;  4R8U B;  4I29 A;  1ZQR A;  4KLE A;  3MFH A;  4PGX A;  2KZM A;  4B9M A;  4DF8 A;  3ETL A;  4DWI A;  3RH4 A;  3N97 B;  1S9F A;  3MAB A;  3SV4 A;  8ICV A;  9ICG A;  5KG4 A;  3HPO A;  3C5G A;  5HHI A;  1ZQQ A;  3Q8S B;  3HP6 A;  4BWJ A;  5HP4 A;  5KT7 A;  3RBD A;  4EBC A;  3C21 A;  4JV0 A;  2UVV A;  4B9V A;  1XS9 D;  3ISC A;  3KHL A;  1SKS A;  3PNC A;  2C2E A;  2HHS A;  1H38 A;  2KTQ A;  2AQ4 A;  8ICQ A;  3SV3 A;  2BQ3 A;  3T5J A;  4ECZ A;  2AGQ A;  3RR7 A;  1S76 D;  5IIN A;  2J6U A;  4DL6 A;  8ICB A;  5KFZ A;  2P6U A;  1A76 A;  4DFP A;  4FBU A;  4EYI B;  3PW5 A;  5KG5 A;  4KLI A;  4XQ8 A;  2LYH A;  1ARO P;  4EZ6 A;  1D9F A;  1L3S A;  4B9N A;  3EPI A;  1SL2 A;  2AU0 A;  1KEJ A;  3UXO A;  8ICS A;  4UQG A;  5F9L A;  3GFK B;  9ICH A;  4YP3 A;  4O0I A;  4M47 A;  8ICF A;  4P4P A;  2W9B A;  4YCX A;  2BCS A;  1ZQY A;  4Z6E A;  4RPX A;  2W9M A;  5BPC A;  4YFK A;  5KTQ A;  3GIJ A;  1HUZ A;  4ED6 A;  1ZQH A;  9ICW A;  4QW8 A;  3G6V A;  3TQ1 A;  2PFN A;  4QZH A;  3T5H A;  5DQH A;  4DF4 A;  2J6S A;  4CCH A;  3RH6 A;  5KFD A;  4DQQ A;  4YR0 A;  4QZC A;  1UA0 A;  1RYS A;  1Z00 A;  4I27 A;  1QLN A;  4RT2 A;  2JEJ A;  1RXW A;  3TAP A;  5J2I A;  2Y1I A;  3EPG A;  4UAZ A;  4EBE A;  1MQ3 A;  1PZN A;  1NK9 A;  8ICX A;  2ZJA A;  4PHP A;  3C23 A;  2ATL A;  5J2A A;  1S97 A;  1TK0 A;  2UVW A;  1XC9 A;  3RRG A;  5KFB A;  3B0Y A;  2MAX A;  5IIO A;  5D4B A;  2MUT A;  3V6J A;  3PX4 A;  5CB1 A;  4BGD A;  4M0A A;  2IBK A;  3UQ2 A;  2C2D A;  5J0S A;  2W9C A;  1WCN A;  4EYH B;  5KFV A;  5KFR A;  1RYR A;  3H4B A;  4YQW A;  3RJJ A;  4M6W B;  3RAQ A;  5DQI A;  4GXJ A;  2I9G A;  4E0D A;  5KG1 A;  4YMN A;  3AU2 A;  5J29 A;  4DEZ A;  1JN3 A;  2F1H A;  4F5O A;  3PW0 A;  4JV2 A;  5KFA A;  2PFP A;  1C7Y A;  4J9O A;  4RUA A;  5EWG A;  4RQ5 A;  2JZB A;  4R65 A;  4DFK A;  2BGW A;  4DSK A;  3PX0 A;  3H4D A;  2C28 A;  3RJF A;  2ZUD A;  1D8L A;  4FS2 A;  5DDY A;  4KIT B;  1S10 A;  4O5K A;  4RQ2 A;  4Q43 A;  2PFQ A;  1NJW A;  2ASD A;  5DBA A;  2BKE A;  4KLG A;  4KLJ A;  2GWS A;  2F1I A;  2Q0Z X;  3OSN A;  5BOL A;  1XSN A;  2BCQ A;  1KLN A;  2OWO A;  4DL3 A;  3E2E A;  4IQT A;  3OHB A;  1XU4 A;  5IIK A;  2ALZ A;  4Z6D A;  3EZ5 A;  3JPQ A;  4LVS A;  4KTQ A;  2BCV A;  4QZ8 A;  3RJG A;  8ICJ A;  2XCP A;  5CHG A;  3V7K A;  3PW4 A;  1JIH A;  8ICZ A;  1NJX A;  3GV8 B;  4C8K A;  1NK4 A;  2HVH A;  2ZUB A;  2RDI A;  4M04 A;  1L5U A;  4R63 A;  1S0N A;  1ZJN A;  2IA6 A;  3TAR A;  2DPJ A;  4IRK A;  4UB5 A;  4M9G A;  4IQU A;  5CP2 A;  4GC7 A;  7ICL A;  2R8G A;  5KT4 A;  4RU9 A;  2XY6 A;  1RZT A;  2BCR A;  2HVI A;  9ICO A;  4P4O A;  4QZI A;  3KHR A;  4UAY A;  3C2L A;  3SZ2 A;  1KFT A;  7ICQ A;  4J9S A;  4M9J A;  1SL1 A;  3KTQ A;  1X9M A;  1DGS A;  4TUS A;  9ICL A;  3TI0 A;  3MR5 A;  4YD1 A;  1ZYQ A;  2ISO A;  3MDC A;  7ICE A;  4RQ6 A;  4KLU A;  3RJE A;  3BDP A;  4I2C A;  2BPG A;  3Q8P B;  5J0Q A;  7ICG A;  1BPE A;  4K4I A;  1MQ2 A;  1ZQW A;  1BPX A;  3HT3 A;  4KLF A;  4F5R A;  5J2B A;  3RH5 A;  4K4H A;  4M9L A;  4DQR A;  4YMO A;  5DG8 A;  8ICU A;  1ZQE A;  4MFA A;  1KDH A;  5KFU A;  1HUO A;  2FLL A;  8ICN A;  3JPN A;  3OGU A;  4J9R A;  9ICX A; 
#chains in the Genus database with same CATH topology
 5HMM A;  4P0Q B;  3FM9 A;  4UB2 A;  3KHH A;  3V7J A;  1M6Y A;  3TFS A;  5KAF U;  1JX4 A;  2ASL A;  4QZD A;  4CF4 A;  1U9L A;  1N5W A;  5KFM A;  1Z1B A;  1KSP A;  2ZIU B;  5TIS U;  2ZIX A;  3HKZ C;  3J81 j;  1ZQN A;  1S0M A;  4ELV A;  3TKA A;  2F1J A;  1UCV A;  2FI1 A;  2R8H A;  3PW7 A;  1IV8 A;  2ZUC A;  5IIL A;  1Z3E B;  8ICY A;  1RYU A;  2RHF A;  4ECT A;  3I1Y A;  5KG3 A;  3RB0 A;  4ED0 A;  3TAN A;  3GV7 B;  1ZQC A;  3Q8L A;  3OHA A;  4BDP A;  3CP8 A;  4AYB F;  1UQV A;  2YB1 A;  4HYK A;  2KJ9 A;  3MC1 A;  4FFD A;  4ECX A;  1U45 A;  2MUT B;  4TUP A;  2W55 A;  3OTQ A;  2VIX A;  1TE2 A;  5JTI A;  4K4G A;  1U47 A;  4JWN A;  3I28 A;  4DLG A;  5AI9 A;  4J9N A;  4QNL A;  4RUC A;  3QNM A;  2KZ3 A;  4C8O A;  1MN8 A;  4KMU A;  1S0O A;  2PI5 A;  5J0R A;  3T3F A;  2BZF A;  1V97 A;  2FPM A;  3LVW A;  2NRX A;  4RQ4 A;  4Z6C A;  8ICH A;  1AQ6 A;  1P7D A;  4BJQ A;  2M0N A;  1F5S A;  2CRX A;  1TFR A;  4FZL A;  3M6Z A;  2I6X A;  4NLK A;  4I2D A;  2E5S A;  4QZF A;  4NLG A;  3BQ7 A;  2QKQ A;  3ISB A;  3RFA A;  3H40 A;  4RQ0 A;  1SZP A;  2ZG6 A;  4B9L A;  2MRL A;  3AUO A;  1KN5 A;  1U48 A;  4YXJ A;  4KLQ A;  9ICE A;  3N4M B;  1B43 A;  3ZI4 A;  4NM1 A;  3PR5 B;  3QE9 Y;  1PK1 B;  4Q8E A;  4JMU A;  1RPL A;  3BJY A;  3E0F A;  2KK0 A;  4O3Q A;  3M9N B;  1XWL A;  5KFQ A;  5EE3 A;  5KFN A;  3LVV A;  4NY8 A;  1N5X A;  4EBD A;  3RF9 A;  4OJL A;  5J2G A;  1U49 A;  1JXL A;  1ZJM A;  4QW9 A;  5KT3 A;  1J2N A;  4RNN A;  4CDG A;  2RDJ A;  3BS5 B;  4FO6 A;  1NK7 A;  4UBC A;  2WF5 A;  3N7R C;  3GZF A;  4NXZ A;  3GU3 A;  2Y9U A;  1LKY B;  5ALR A;  5DG9 A;  3VCB A;  2FLP A;  5JUM A;  3GV5 B;  2KIW A;  4OJO A;  5ALF A;  3M9M B;  4YN4 A;  3GIL A;  2BQR A;  4I28 A;  3RRH A;  9ICU A;  2P6R A;  2VKQ A;  2JEI A;  4YVZ A;  1D9D A;  2CPR A;  2W8K A;  5DLF A;  7ICS A;  2ZTD A;  3HIL A;  2E8P A;  1ZQJ A;  4DCC A;  1ZQB A;  3OJU A;  1ZQM A;  2H5X A;  5KFY A;  2NRZ A;  1COK A;  1KRP A;  4DS5 A;  3HW8 A;  1NK0 A;  1ZD5 A;  3PSP A;  5EE9 A;  3PSF A;  2BQU A;  5C0Y A;  1HEK A;  2BDU A;  4DQS A;  4F93 B;  1X9X A;  4DO9 A;  3UXP A;  5L1L A;  4RQ7 A;  4KN7 A;  2VA2 A;  3QU5 A;  4UB1 A;  4F71 A;  2RLT A;  1SWW A;  1UHU A;  4IQW A;  8ICA A;  4RZR A;  3ZD9 A;  1Q3V A;  4F2S A;  1KFS A;  2H3V A;  2JH1 A;  1COO A;  2W11 A;  1O08 A;  3OSP A;  1XSL A;  2ES6 A;  3MR6 A;  1TKD A;  9ICM A;  7ICI A;  4MFC A;  5DBB A;  4M2Y A;  1KFD A;  3V6H A;  5AIA A;  4RQ1 A;  1DGJ A;  4I2J A;  4BX9 C;  4DQI A;  2VAN A;  7ICM A;  1SKR A;  4IRD A;  1IIP A;  9ICV A;  3H7I A;  4C8N A;  4LJX A;  3OJS A;  4PHD A;  5J0P A;  2HBK A;  4O9M A;  1WCL A;  4YXM A;  3RB4 A;  2W3R A;  1V38 A;  3H8W A;  5KT6 A;  2KP7 A;  3GIM A;  1NOM A;  3PMN A;  4BXO B;  2HHQ A;  2XGQ A;  4DL5 A;  2FPL A;  3B0X A;  1K1S A;  3SAG A;  4C7Z A;  4R8U B;  3H0L B;  4PGX A;  4DWI A;  2WF9 A;  1D8B A;  4OJP A;  3NS1 A;  3U26 A;  3SV4 A;  4EEK A;  3C5G A;  5HHI A;  3RBD A;  5KT7 A;  1JAL A;  2KG5 A;  3ISC A;  3KHL A;  1SKS A;  4Y2R A;  4ECZ A;  2ZXH A;  2J6U A;  3QUT A;  3PW5 A;  5KG5 A;  3HRD D;  1CRX A;  2AU0 A;  3D2S A;  2H3Z A;  4Y2U A;  4YP3 A;  4O0I A;  8ICF A;  3DV9 A;  4YCX A;  2BCS A;  2W9M A;  5BPC A;  5KTQ A;  1HUZ A;  3SAF A;  3TQ1 A;  3T5H A;  4QJF B;  2JMG A;  3RH6 A;  1Q46 A;  4RQM A;  4QZC A;  4RT2 A;  5ALU A;  4EBE A;  1MQ3 A;  3ED5 A;  2ZJA A;  2PMZ F;  5EE1 A;  3C23 A;  4PHP A;  5G5H A;  5J2A A;  1VLB A;  5D4B A;  2KKP A;  4M0A A;  1FO4 A;  4CF3 A;  1L7P A;  1A6S A;  1WCN A;  5GTH U;  5KFR A;  1DXS A;  1RYR A;  3RJJ A;  4M6W B;  1FFV A;  4GXJ A;  2I9G A;  5ALI A;  2ZIV A;  4YMN A;  2F76 X;  5J29 A;  3AU2 A;  3PW0 A;  1JN3 A;  1SV0 C;  2IOF K;  2PFP A;  3SAH A;  3PX0 A;  1V85 A;  1ZD3 A;  2ZUD A;  4U7C A;  1D8L A;  3RJF A;  3KOO A;  2MSN A;  1NJW A;  1L8L A;  2GWS A;  1C20 A;  3OSN A;  3QU2 A;  2OWO A;  2E1F A;  1KLN A;  2LM4 A;  5AKL A;  4IQT A;  5IIK A;  3EZ5 A;  1NNL A;  4QZ8 A;  5CHG A;  3PW4 A;  3CNH A;  3D6J A;  1ZJN A;  3WKC A;  2W7O A;  5E79 U;  5KT4 A;  5ALX A;  3KHR A;  1UPH A;  5ALO A;  4J9S A;  3TI0 A;  1Z4N A;  2YX8 A;  7ICE A;  5KAI U;  5AKG A;  4I2C A;  2BPG A;  3WKD A;  7ICG A;  2JRZ A;  4K4I A;  4M9L A;  5B66 U;  4QIW F;  8ICU A;  4MFA A;  2FLL A;  2OYY A;  2PXI A;  3OGU A;  3JPN A;  3F2B A;  4UAT A;  2A1J A;  4ED2 A;  3ZDC A;  1U4B A;  3F53 A;  3SI8 A;  3RR8 A;  2OCE A;  2FE9 A;  4DL4 A;  2R8K A;  5KFC A;  2W54 A;  4UAW A;  5J0T A;  3PO5 A;  2C2R A;  5J0W A;  4JUZ A;  1BPB A;  5KFK A;  3MBY A;  4Q8F A;  7ICV A;  1K5O A;  4ACO A;  5AM5 A;  5DB8 A;  4YG2 A;  4EEY A;  4F4Z A;  4QZA A;  9ICJ A;  4GXI A;  4JWM A;  4Y2S A;  4ECR A;  2KJ5 A;  2KJ8 A;  3T79 A;  4DSI A;  5KG0 A;  2A19 A;  3A0B U;  4PPX A;  4DL7 A;  1FIQ A;  3MGV A;  5AIC A;  5KFG A;  4Q44 A;  3JPP A;  4DSE A;  5J0O A;  4TUQ A;  5ALM A;  1T94 A;  1GO3 F;  4MHV A;  5L1J A;  5KFO A;  3BQ2 A;  1SB3 C;  4DFM A;  4O3S A;  4X5V A;  3M8S A;  8ICO A;  4PZO A;  4RPY A;  1X42 A;  3NTU A;  3C2K A;  2UVU A;  5DG7 A;  3L5K A;  2V4R A;  9ICK A;  2FMQ A;  2P66 A;  5DDM A;  2F8K A;  4UAV A;  2ZIW B;  5A0L A;  4B9S A;  4O3O A;  4USA A;  2DQN B;  5KG2 A;  2OM6 A;  3NGD A;  3AU6 A;  3QUB A;  2A1A A;  1XO0 A;  1N62 A;  2QAR A;  1S0V A;  4PHE A;  1ZQF A;  4FE3 A;  5IIM A;  1MC8 A;  3SMV A;  2B6G A;  2F3N A;  4BWM A;  2AGO A;  3SYZ A;  5ALY A;  5AI5 A;  1QSL A;  2R8I A;  1ZQA A;  1Q3U A;  2QLT A;  2QB0 B;  5AM1 A;  4IRC A;  2UVR A;  3Q8K A;  2PKE A;  4MEX A;  8ICC A;  1XSP A;  5KFW A;  4PGQ A;  7ICF A;  4C8L A;  2MA1 A;  4YR3 A;  3QXG A;  2W7P A;  8ICE A;  3S6J A;  1ZQV A;  4QZG A;  3WK9 A;  3N28 A;  4QWA A;  1PVR A;  7ICH A;  3JPT A;  2W04 A;  5KFI A;  1YZ7 A;  2F2A B;  3RB6 A;  5KT5 A;  1IM4 A;  2WF6 A;  3V6K A;  1RXV A;  1QSS A;  4QWC A;  5KFX A;  1JRO A;  4CF5 A;  1SL0 A;  4ELT A;  4F92 B;  3C29 A;  2W9B B;  5J0X A;  4M9N A;  1WWV A;  1J2M A;  1NZB A;  1X9W A;  3NVY A;  2R8J A;  1ZQT A;  2C22 A;  1Z4O A;  1ZD4 A;  5IIJ A;  1L3U A;  4RT3 A;  1L7N A;  4P0Q A;  5HML A;  1Z00 B;  2KFN A;  2WTF A;  3G6Y A;  1K1Q A;  3LWM A;  4JV1 A;  4UW9 A;  3KZI U;  4DLE A;  4FS1 A;  5CA7 A;  1YT3 A;  5AKK A;  1SXE A;  1ZRM A;  2AQ0 A;  2ZIU A;  3UXN A;  2W9C B;  4O5C A;  2K89 A;  2W43 A;  3M9O B;  3WK7 A;  1X6I A;  1L3T A;  4A8E A;  1KL9 A;  1S77 D;  7ICJ A;  4KLO A;  3MR2 A;  5CJ7 A;  2WAQ C;  2K4E A;  1RDF A;  1L3V A;  4ED1 A;  4RPZ A;  4CRX A;  5KFH A;  4NL9 A;  4O3P A;  4MF8 A;  4P4M A;  2KFZ A;  4MFF A;  4F4K A;  5III A;  3QEA Z;  3TAQ A;  4Y2J A;  5DB9 A;  2DKX A;  1T8E A;  2HBM A;  5KT2 A;  3C2M A;  2EH9 A;  2J6T A;  5KFE A;  4I2G A;  4ED7 A;  5D46 A;  1X66 A;  2EZZ A;  4F2R A;  4XUS A;  2OH2 A;  1ZQI A;  5AM2 A;  8ICL A;  2XY7 A;  3SEN A;  5KFL A;  7ICN A;  1ZQZ A;  3TAD C;  2HOQ A;  1NKE A;  5J0Y A;  2EZX A;  2R18 A;  9ICS A;  2ESE A;  1ZQO A;  3C5F A;  4DSF A;  4UB6 U;  4IR9 A;  4QZB A;  4KMO B;  4TQS A;  1J97 A;  2D8C A;  1SV4 A;  3K4G A;  2HCF A;  2KKV A;  5J8Y C;  5DQG A;  1JI7 A;  4ZOH C;  4CGZ A;  2HHW A;  2NRT A;  4ED3 A;  2DL0 A;  3EW9 A;  2K4H A;  1KTQ A;  1MSW D;  3K75 D;  1SXD A;  2K8B B;  9ICT A;  3IHQ B;  4I29 A;  1PK1 A;  5ALS A;  2H3F A;  4B9M A;  1L7O A;  4RQN A;  3MAB A;  3O0F A;  1L7M A;  2K8C B;  1ZQQ A;  5HP4 A;  3C21 A;  4ICA A;  2HHS A;  3PNC A;  2C2E A;  2KTQ A;  1X6J A;  8ICQ A;  3SV3 A;  2BQ3 A;  3T5J A;  3NRW A;  4US8 A;  5G5G A;  2YMM A;  4XQ8 A;  5ALH A;  4EZ6 A;  1L3S A;  3AQF A;  1N61 A;  1WYG A;  2CXY A;  3UXO A;  1PUZ A;  2VJ4 A;  1OW5 A;  3F2D A;  4UQG A;  1QQ5 A;  3BS5 A;  2E1E A;  9ICH A;  1RQL A;  3WU2 U;  2XIC A;  3NAS A;  4Z6E A;  1LKY A;  4YFK A;  3GIJ A;  3CRX A;  3QUC A;  4QW8 A;  3IRU A;  2PFN A;  2J6S A;  5ALV A;  5K4L A;  2Y0S C;  2Y1I A;  4UAZ A;  1NK9 A;  3FC4 A;  5HR6 A;  2ATL A;  4OD0 A;  5ALK A;  5IIO A;  2EAM A;  3PX4 A;  1L8O A;  2IBK A;  4EYH B;  1IG6 A;  3H4B A;  4YQW A;  4KX3 A;  3RAQ A;  3QYP A;  2JXJ A;  2KVC A;  4F5O A;  2F1H A;  2WB1 C;  1C7Y A;  2JZB A;  5ALW A;  2C28 A;  2K4P A;  5DDY A;  1S10 A;  4Q43 A;  2PFQ A;  3QU4 A;  1XSN A;  5BOL A;  4DL3 A;  3E2E A;  1S5L U;  3OHB A;  1XU4 A;  4LVS A;  2GLE A;  8ICZ A;  1NJX A;  3GV8 B;  1KW4 A;  2RDI A;  1ECW A;  2KHQ A;  3TAR A;  2EAN A;  3F5A A;  4IRK A;  5CP2 A;  2R8G A;  1Q8K A;  2F44 A;  7ICQ A;  3KTQ A;  1X9M A;  5ALD A;  4TUS A;  9ICL A;  3MR5 A;  4YD1 A;  2KOB A;  2DWQ A;  3F5E A;  1BPE A;  1ZQ1 C;  2E8O A;  5JRT A;  1ZQW A;  5AK6 A;  1BPX A;  3ICX A;  3D2N A;  3RH5 A;  5DG8 A;  1KDH A;  8ICN A;  4C4R A;  3PST A;  2EAO A;  2GOL A;  2G07 A;  3HJE A;  5L1M A;  4P2H A;  2HHX A;  3D2Q A;  4RQ8 A;  3Q8R B;  5KFF A;  4BXO A;  9ICQ A;  5BOM A;  2EZY A;  2KN7 A;  4O5E A;  1CI4 A;  2JH7 A;  4C0Z A;  4DOC A;  1NK6 A;  1A77 A;  5DKW A;  2N1R A;  3MGH A;  3MR3 A;  3PY8 A;  5EWF A;  2FMP A;  1ZRN A;  3ZDB A;  4DFD A;  2KD1 A;  4ECU A;  2E8M A;  3L4P A;  3ETR A;  9ICP A;  2BR0 A;  5DLG A;  2XID A;  3JPR A;  2BHN A;  4OO1 J;  2YB4 A;  1T4G A;  3KD3 A;  4R66 A;  1QSY A;  4Z6F A;  1OXJ A;  5AKI A;  3ISD A;  3PSI A;  1B22 A;  3IV6 A;  4OJ5 A;  4KX5 A;  2FJ6 A;  3THV A;  3ZD8 A;  1NKC A;  5J2C A;  2KSO B;  2LMR A;  1NZP A;  5ALJ A;  5EWE A;  7ICU A;  4MF2 A;  4NLZ A;  5D49 A;  2KIC A;  4C4S A;  3HX0 A;  1VJ5 A;  4DSL A;  1TVA A;  5AHX A;  5AKZ A;  1ZOL A;  3PO4 A;  4GLX A;  4EZ9 A;  2V4Q A;  5DGB A;  4ED8 A;  2XI9 A;  2G09 A;  3KKA A;  3SQI A;  3MGI A;  2QB1 A;  2E3T A;  4Y2T A;  2OEH A;  4G9B A;  3UQ0 A;  4Q45 A;  3LK9 A;  4GFJ A;  4Y2Q A;  8ICG A;  8ICW A;  3EYZ A;  4EX7 A;  3IG5 A;  3EWA A;  2E8N A;  4AYB C;  4US9 A;  2HI0 A;  2D3D A;  4QWD A;  1UT5 A;  2ZTE A;  5AI4 A;  3WKE A;  2XO7 A;  2ISP A;  2WF7 A;  3PV8 A;  3RAX A;  2JGA A;  3PX6 A;  1KQQ A;  4C8M A;  4DS4 A;  1LV5 A;  4I2H A;  1NJY A;  1BPZ A;  2BCU A;  4KLM A;  4R64 A;  3QZ8 A;  2LI6 A;  2XVT A;  3BZK A;  8ICM A;  4UBB A;  4RQ3 A;  2HHT A;  1RQN A;  2KZZ A;  2H3I A;  5KG6 A;  2Z7J A;  2F8L A;  3H8S A;  1ZQL A;  3TAC B;  3WK4 A;  3NUQ A;  2OHF A;  3QU7 A;  4PL2 A;  3FYH A;  3TFR A;  3JPO A;  3JPS A;  2BPC A;  4KLD A;  1UA1 A;  2L5Y A;  1KBU A;  4O3N A;  4I2F A;  1TK5 A;  1QCK A;  2KV2 A;  3LWL A;  4F50 A;  2W03 A;  9ICN A;  1WWU A;  8ICI A;  2K4I A;  4F3O A;  3L3F X;  5HHH A;  1BPY A;  1BGX T;  2NRW A;  1VDV A;  1N48 A;  3OPX A;  4EX6 A;  4YR2 A;  3CW2 C;  3PML A;  2HSZ A;  5EOZ A;  1F44 A;  4P0P B;  5DB6 A;  2HOI A;  1ZQU A;  4F72 A;  2ODG A;  4Y2Y A;  4TUR A;  4NV0 A;  3HWT A;  3RJK A;  4QZE A;  5J2D A;  1WUD A;  2EQY A;  4MEY A;  4F5Q A;  5DB7 A;  4ECS A;  5KNI A;  1HJP A;  4F8R A;  2VA8 A;  5KL1 B;  1BVS A;  1T7P A;  4NWI A;  9ICB A;  5L1K A;  2ASJ A;  2IMW P;  3Q8M A;  5L9X A;  5AI6 A;  2EAP A;  1ZQP A;  1D8Y A;  3KBB A;  5L1I A;  7ICT A;  4GC6 A;  3UPQ A;  4J9P A;  5EE0 A;  5F9N A;  4DQP A;  3V72 A;  4PH5 A;  2ZIW A;  3C1Y A;  1BNO A;  4J9Q A;  4XA5 A;  1CEZ A;  3VC8 A;  3WK5 A;  4F5N A;  4PGY A;  4UB3 A;  3T5K A;  2HHU A;  1X2I A;  4F4Y A;  1SKW A;  4QWE A;  9ICA A;  1JMS A;  1T3Q A;  4ECV A;  2W8L A;  3RJH A;  4Y2V A;  2B0C A;  2KIV A;  2QB0 A;  2XC9 A;  4LZD A;  4UAR A;  2IOH A;  4C80 A;  5KG7 A;  2RP5 A;  3EUB 2;  3MFH A;  2KZM A;  2AHO B;  4O3M A;  3AQE A;  2FDR A;  2ZIX B;  3N97 B;  3K1Z A;  1HIW A;  2F77 X;  9ICG A;  3BZC A;  5KG4 A;  3AL0 B;  3HP6 A;  4BWJ A;  4EBC A;  2AXT U;  3KFU F;  2AQ4 A;  3RR7 A;  1PVP A;  8ICB A;  2P6U A;  1A76 A;  2D6F C;  3FAH A;  4EYI B;  4HAI A;  2LYH A;  1ARO P;  4B9N A;  3KZX A;  3QX7 A;  3SD7 A;  1KEJ A;  8ICS A;  3GFK B;  1PK3 A;  4PZN A;  5F3X B;  2W9B A;  1L6N A;  5ALG A;  1ZQY A;  3LYS A;  2GH1 A;  1ZQH A;  4ED6 A;  3H0R B;  9ICW A;  3WK6 A;  5DQH A;  5B5E U;  4DF4 A;  4CCH A;  1SIJ A;  5KFD A;  4DQQ A;  4C4T A;  1RYS A;  1Z00 A;  2JEJ A;  3ONN A;  3TAP A;  1PZN A;  1DRG A;  1A0P A;  1N63 A;  2A3V A;  1S97 A;  2UVW A;  1XC9 A;  5KFB A;  3B0Y A;  2MUT A;  3V6J A;  5CB1 A;  4BGD A;  3UQ2 A;  2W9C A;  1XNS A;  5KFV A;  1B0X A;  4E0D A;  1JUD A;  4C7Y A;  4DEZ A;  4JV2 A;  3WKA A;  3H8M A;  4J9O A;  4RQ5 A;  4R65 A;  4DSK A;  3H4D A;  3QUQ A;  4KIT B;  4WJ3 B;  2P35 A;  4NLB A;  2ASD A;  2YY6 A;  2BKE A;  3CYM A;  4KLG A;  2BCQ A;  1QH9 A;  3JPQ A;  1RG6 A;  2BCV A;  2XCP A;  4C8K A;  4JB3 A;  1NK4 A;  2HVH A;  2ZUB A;  4M04 A;  4GIB A;  2DPJ A;  4B6J A;  4M9G A;  4GC7 A;  2PMZ C;  4RU9 A;  2HVI A;  5CEH A;  4QZI A;  3C2L A;  4UAY A;  1KFT A;  3ALR A;  4M9J A;  1SL1 A;  1B4F A;  1DGS A;  2IOF A;  3MDC A;  4RQ6 A;  3BDP A;  3Q8P B;  4F5R A;  2LYB A;  3AN1 A;  4IS7 A;  4DQR A;  4YMO A;  5AIB A;  1HUO A;  2K8A A;  4J9R A;  9ICX A;  3MFI A;  4F91 B;  5AKY A;  4YMM A;  1LB2 B;  1URJ A;  4J9M A;  5J0U A;  4CE6 A;  3QEB Z;  1QQ6 A;  2G08 A;  3RBE A;  4ZH4 A;  2DUY A;  2YMQ A;  3KHG A;  1BPD A;  3AMZ A;  7ICK A;  4IR1 A;  2AGP A;  2G5I B;  2I1Q A;  3NRZ A;  2NRV A;  5AK5 A;  1N56 A;  3DEE A;  2YML A;  5AM0 A;  4PHA A;  1ED1 A;  2JEF A;  4I2E A;  1FFU A;  4G3I A;  4M9H A;  2I5H A;  2W9A A;  2HBJ A;  2IHM A;  4J9L A;  2Y1J A;  4KLT A;  2FLN A;  4RNO A;  5HNK A;  4B9T A;  1WG8 A;  3R9K A;  4DSJ A;  2XY5 A;  2YTU A;  5AM3 A;  2NV3 A;  4KLS A;  4UB4 A;  3FDS A;  2WF8 A;  2VA3 A;  4QIW C;  4DFJ A;  1CUK A;  5J2F A;  5KFS A;  9ICF A;  1ZQS A;  1SGG A;  2JEG A;  3DDH A;  4B9U A;  2LM1 A;  2JZB B;  4NL9 C;  4I2I A;  1NK8 A;  1SV0 A;  3GQC A;  3ZDE A;  3RB3 A;  2FPK A;  8ICR A;  5J2H A;  2LBO A;  5AM4 A;  2DKZ A;  3BQ0 A;  3WK8 A;  3B9J A;  2LYA A;  4QZ9 A;  3IG8 A;  2IHN A;  2FMS A;  4U6P A;  1QTM A;  3SEI A;  3BQT A;  2BPF A;  2KMD A;  3HKZ F;  3N7S C;  1XO1 A;  3MDA A;  3AEV A;  2RRD A;  1V9P A;  1X9S A;  3K1R B;  4NJ8 A;  1NK5 A;  4I2A A;  7ICP A;  1S8O A;  5KFT A;  4AP9 A;  3C28 A;  1NKB A;  1Z1V A;  2AJQ A;  1TV9 A;  4F4W A;  9ICR A;  5TZV A;  1DK2 A;  5KFP A;  3NVZ A;  2NYV A;  4ECW A;  1N2X A;  2PI4 A;  3QU9 A;  3IDW A;  5J2J A;  4JK1 A;  3GDX A;  2PFO A;  2WAQ F;  5C5J A;  3GII A;  3UMG A;  3M8R A;  9ICC A;  4XRH A;  5AK4 A;  4FZN A;  1Y88 A;  5HR7 A;  4NLN A;  3H0M B;  1RM6 C;  4UAS A;  3N7P D;  1FEZ A;  4FBT A;  4R8U A;  3ZDD A;  5GTI U;  1LVH A;  1NI3 A;  1O03 A;  4NLC A;  1NJZ A;  4DOA A;  2BDP A;  4F4X A;  5JU5 A;  7ICR A;  1TK8 A;  5KFJ A;  4PJ0 U;  4IC9 A;  3A0H U;  3RJI A;  4BUG A;  2DPI A;  2RQ5 A;  8ICP A;  4KN4 A;  4UB8 U;  1OUQ A;  5ALN A;  4ELU A;  4IQV A;  5CWR A;  3PR4 A;  3IN5 A;  4DL2 A;  4ECQ A;  4EEL A;  4UAU A;  5J2K A;  2XGP A;  4I2B A;  2KEY A;  2HW3 A;  1DOQ A;  1ZQK A;  1UT8 A;  2M9N A;  3T5L A;  3M7D A;  1QQ7 A;  5AI0 A;  4KLL A;  4PL1 A;  2ZIV B;  1KKX A;  3QZ7 A;  2NO4 A;  5CRX A;  1ZET A;  4TQR A;  3IP4 B;  5ALP A;  2JV3 A;  2G0A A;  5AKJ A;  1EXN A;  3G6X A;  2DBY A;  2B21 A;  4KLH A;  4J9K A;  5AKH A;  3IM1 A;  3Q8Q B;  1TAU A;  2ZTC A;  5J2E A;  4YD2 A;  1ZQG A;  3PW2 A;  9ICI A;  3PVX A;  2LPE A;  3ORY A;  2DFL A;  8ICT A;  4NM2 A;  1TAQ A;  4F5P A;  2KSO A;  2YMP A;  1IXR A;  3BQ1 A;  4M6W A;  3C1Z A;  4O3R A;  5H2F U;  3ZDA A;  3GIK A;  2ZJ5 A;  1MA7 A;  2K60 A;  1BNP A;  2WHE A;  1T3N A;  2H3Q A;  3H8J A;  2KVS A;  3SR6 A;  5T14 A;  4DOB A;  2XCA A;  2VJ5 A;  3UMC A;  1JXE A;  2V9W A;  4GXK A;  1ZQD A;  4QWB A;  5DBC A;  1ZQX A;  3PZP A;  4ECY A;  8ICK A;  4RNM A;  3AM9 A;  2A1J B;  3RTV A;  3LDA A;  2JR5 A;  4LZG A;  3V7L A;  2Y0S F;  2ZJ8 A;  5DGA A;  2HHV A;  7ICO A;  5CR0 A;  1ZQR A;  4KLE A;  1DK3 A;  4DF8 A;  4OJ6 A;  2O6K A;  3ETL A;  3RH4 A;  1S9F A;  8ICV A;  4Y2P A;  3HPO A;  3Q8S B;  4B9V A;  4JV0 A;  2UVV A;  1XS9 D;  1H38 A;  2OXO A;  2AGQ A;  2HDO A;  1S76 D;  5IIN A;  3E58 A;  4DL6 A;  1X40 A;  5KFZ A;  4DFP A;  2DF4 B;  4FBU A;  2WB1 F;  3NVV A;  2KHV A;  4KLI A;  5AK3 A;  1D9F A;  2DGZ A;  5KL8 B;  3EPI A;  1SL2 A;  3M1Y A;  2YN4 A;  4Y2X A;  2KE7 A;  4IL6 U;  5F9L A;  3UMB A;  4M47 A;  4P4P A;  2G5H B;  5ALL A;  4RPX A;  1F0M A;  3G6V A;  4QZH A;  2LHT A;  3I76 A;  3WKB A;  4YR0 A;  1UA0 A;  2YQE A;  4I27 A;  1QLN A;  1RXW A;  5J2I A;  2HMX A;  3EPG A;  8ICX A;  5FP0 A;  1TK0 A;  3RRG A;  2MAX A;  1Z19 A;  3F2C A;  2QAR B;  1SZH A;  2C2D A;  5J0S A;  5AKE A;  5AKX A;  4FZM A;  3M6K A;  5DQI A;  5KG1 A;  4P0P A;  2Q4T A;  1TAM A;  2AH5 A;  5KFA A;  4RUA A;  5EWG A;  2MU2 A;  4DFK A;  2BGW A;  3UM9 A;  4FS2 A;  3TAD A;  4OCZ A;  4O5K A;  2EDU A;  4RQ2 A;  5AI8 A;  2GO7 A;  5DBA A;  4KLJ A;  1ZXI A;  2HOF A;  2F1I A;  2Q0Z X;  5ALQ A;  2WFA A;  3KKA C;  5ALE A;  4CNQ A;  4Z6D A;  5J8Y A;  2ALZ A;  4KTQ A;  2LKY A;  4J03 A;  3RJG A;  8ICJ A;  3V7K A;  2KNJ A;  1JIH A;  1PVQ A;  1L5U A;  4R63 A;  2NO5 A;  1S0N A;  2IA6 A;  1YZ6 A;  4EEN A;  2Y9T A;  2CN1 A;  1JRP A;  2W3S A;  4IQU A;  4UB5 A;  7ICL A;  2G06 A;  2XY6 A;  1RZT A;  9ICO A;  2BCR A;  4P4O A;  3SZ2 A;  5ALZ A;  1N60 A;  1ZYQ A;  5ALT A;  2ISO A;  3BS7 A;  4KLU A;  3RJE A;  5J0Q A;  2JHD A;  1MQ2 A;  3NVW A;  3HT3 A;  1SWV A;  4KLF A;  5J2B A;  4K4H A;  1ZD2 P;  2ZXI A;  1ZQE A;  2HBL A;  5KFU A; 
#chains in the Genus database with same CATH homology
 5HMM A;  2A1J A;  4ED2 A;  3ZDC A;  4UB2 A;  3MFI A;  3KHH A;  4F91 B;  4YMM A;  1LB2 B;  3V7J A;  4J9M A;  4P2H A;  5J0U A;  1U4B A;  2HHX A;  4RQ8 A;  3QEB Z;  3TFS A;  3Q8R B;  5KFF A;  3RBE A;  4BXO A;  9ICQ A;  5BOM A;  3SI8 A;  2KN7 A;  1JX4 A;  4ZH4 A;  4O5E A;  3RR8 A;  2ASL A;  4DOC A;  4DL4 A;  2R8K A;  1NK6 A;  4QZD A;  1A77 A;  5DKW A;  5KFC A;  1U9L A;  4UAW A;  3MGH A;  3KHG A;  5KFM A;  1BPD A;  3MR3 A;  7ICK A;  3PY8 A;  1KSP A;  5J0T A;  3PO5 A;  4IR1 A;  5EWF A;  2C2R A;  2FMP A;  2AGP A;  2I1Q A;  5J0W A;  4JUZ A;  1ZQN A;  4ELV A;  1S0M A;  1BPB A;  5KFK A;  3MBY A;  4Q8F A;  2F1J A;  2NRV A;  3ZDB A;  7ICV A;  2R8H A;  3PW7 A;  1N56 A;  2ZUC A;  5DB8 A;  5IIL A;  4YG2 A;  1Z3E B;  4EEY A;  4F4Z A;  4ECU A;  8ICY A;  4PHA A;  4QZA A;  2JEF A;  4I2E A;  4GXI A;  4G3I A;  4ECT A;  9ICJ A;  5KG3 A;  3RB0 A;  4ED0 A;  4JWM A;  4M9H A;  2W9A A;  3TAN A;  2IHM A;  3GV7 B;  1ZQC A;  4ECR A;  3Q8L A;  3OHA A;  4BDP A;  9ICP A;  2BR0 A;  4DSI A;  5DLG A;  5KG0 A;  4HYK A;  4J9L A;  4ECX A;  2Y1J A;  4PPX A;  4DL7 A;  1U45 A;  2MUT B;  3JPR A;  4TUP A;  2BHN A;  4KLT A;  2FLN A;  1T4G A;  4RNO A;  4R66 A;  5KFG A;  1QSY A;  5HNK A;  4Z6F A;  4B9T A;  4Q44 A;  3JPP A;  3ISD A;  4DSE A;  4K4G A;  5J0O A;  4DSJ A;  1U47 A;  4TUQ A;  2XY5 A;  4JWN A;  1B22 A;  4KLS A;  4DLG A;  5L1J A;  4UB4 A;  3FDS A;  5KFO A;  4J9N A;  2VA3 A;  3THV A;  3BQ2 A;  4RUC A;  4DFJ A;  3ZD8 A;  2KZ3 A;  1CUK A;  5J2F A;  4DFM A;  1NKC A;  4C8O A;  4O3S A;  4X5V A;  4KMU A;  5J2C A;  1S0O A;  5J0R A;  5KFS A;  3M8S A;  3T3F A;  2PI5 A;  9ICF A;  1ZQS A;  8ICO A;  4RPY A;  2FPM A;  2JEG A;  4B9U A;  5EWE A;  2JZB B;  2NRX A;  7ICU A;  3NTU A;  3C2K A;  2UVU A;  4MF2 A;  4NLZ A;  5DG7 A;  4RQ4 A;  4I2I A;  1NK8 A;  3GQC A;  4Z6C A;  5D49 A;  2V4R A;  8ICH A;  3ZDE A;  9ICK A;  3HX0 A;  2FMQ A;  2P66 A;  5DDM A;  3RB3 A;  4DSL A;  1TVA A;  1TFR A;  2FPK A;  8ICR A;  5J2H A;  4B9S A;  4O3O A;  4NLK A;  4I2D A;  5KG2 A;  4QZF A;  3PO4 A;  4GLX A;  4EZ9 A;  3BQ0 A;  4NLG A;  2V4Q A;  3NGD A;  3AU6 A;  3ISB A;  3H40 A;  4QZ9 A;  5DGB A;  4ED8 A;  2IHN A;  2FMS A;  1S0V A;  4PHE A;  1ZQF A;  1QTM A;  3MGI A;  5IIM A;  1MC8 A;  4RQ0 A;  3BQT A;  1SZP A;  3UQ0 A;  2BPF A;  4Q45 A;  4BWM A;  3LK9 A;  2AGO A;  3SYZ A;  8ICG A;  1XO1 A;  3MDA A;  4B9L A;  1QSL A;  3AUO A;  2R8I A;  1ZQA A;  1U48 A;  4YXJ A;  8ICW A;  3EYZ A;  1V9P A;  1X9S A;  4IRC A;  2UVR A;  3EWA A;  4KLQ A;  9ICE A;  4QWD A;  3N4M B;  3Q8K A;  1NK5 A;  4MEX A;  8ICC A;  4I2A A;  7ICP A;  1B43 A;  5KFT A;  4NM1 A;  1UT5 A;  1XSP A;  2ZTE A;  5KFW A;  3PR5 B;  3QE9 Y;  1NKB A;  4PGQ A;  7ICF A;  2AJQ A;  4C8L A;  2XO7 A;  4Q8E A;  2ISP A;  3PV8 A;  3RAX A;  4F4W A;  1TV9 A;  1RPL A;  4YR3 A;  9ICR A;  3BJY A;  5TZV A;  3PX6 A;  5KFP A;  8ICE A;  1ZQV A;  4C8M A;  4QZG A;  4DS4 A;  4O3Q A;  4ECW A;  3M9N B;  1LV5 A;  4I2H A;  2PI4 A;  4QWA A;  1NJY A;  1XWL A;  5J2J A;  4JK1 A;  3GDX A;  5KFQ A;  5KFN A;  1BPZ A;  2BCU A;  4KLM A;  4R64 A;  4NY8 A;  7ICH A;  2PFO A;  3JPT A;  5KFI A;  5C5J A;  3QZ8 A;  3GII A;  4EBD A;  5J2G A;  3M8R A;  9ICC A;  8ICM A;  4UBB A;  4RQ3 A;  4XRH A;  1U49 A;  3RB6 A;  2HHT A;  1JXL A;  5KT5 A;  1IM4 A;  3V6K A;  1ZJM A;  1RXV A;  2KZZ A;  4QW9 A;  1QSS A;  5KT3 A;  5KG6 A;  4QWC A;  1Y88 A;  4RNN A;  5KFX A;  4NLN A;  3H8S A;  1ZQL A;  2RDJ A;  1SL0 A;  4FBT A;  4FO6 A;  1NK7 A;  4ELT A;  4UBC A;  4R8U A;  4F92 B;  3ZDD A;  3FYH A;  5J0X A;  2W9B B;  3TFR A;  3JPO A;  4M9N A;  4NXZ A;  1NJZ A;  4DOA A;  2BDP A;  3JPS A;  2BPC A;  4KLD A;  4F4X A;  1X9W A;  2R8J A;  1UA1 A;  5DG9 A;  1ZQT A;  7ICR A;  4O3N A;  1TK8 A;  2FLP A;  2C22 A;  4I2F A;  5JUM A;  3GV5 B;  1TK5 A;  3LWL A;  5KFJ A;  4F50 A;  3M9M B;  5IIJ A;  4YN4 A;  1L3U A;  4RT3 A;  3GIL A;  2BQR A;  4I28 A;  5HML A;  9ICN A;  1Z00 B;  3RRH A;  2KFN A;  9ICU A;  2WTF A;  8ICI A;  4F3O A;  3G6Y A;  5HHH A;  3RJI A;  2P6R A;  1BPY A;  1K1Q A;  3LWM A;  1BGX T;  2NRW A;  4YVZ A;  2JEI A;  4JV1 A;  1D9D A;  2DPI A;  4DLE A;  4FS1 A;  8ICP A;  1N48 A;  4KN4 A;  2W8K A;  5DLF A;  5CA7 A;  7ICS A;  2ZTD A;  4YR2 A;  3PML A;  1ZQJ A;  2AQ0 A;  5EOZ A;  4ELU A;  4IQV A;  5CWR A;  3PR4 A;  3UXN A;  2W9C B;  4DL2 A;  4ECQ A;  1ZQB A;  4O5C A;  3OJU A;  3M9O B;  1ZQM A;  2H5X A;  1L3T A;  5J2K A;  2XGP A;  4I2B A;  2HW3 A;  5KFY A;  1DOQ A;  2NRZ A;  1ZQK A;  1UT8 A;  2M9N A;  3T5L A;  1KRP A;  1S77 D;  7ICJ A;  4DS5 A;  3HW8 A;  1NK0 A;  3MR2 A;  5CJ7 A;  4KLO A;  1L3V A;  4ED1 A;  4KLL A;  5DB6 A;  4RPZ A;  2BQU A;  3QZ7 A;  5KFH A;  4DQS A;  4F93 B;  4O3P A;  4MF8 A;  1ZQU A;  1ZET A;  4TQR A;  4P4M A;  4DO9 A;  2KFZ A;  3UXP A;  5L1L A;  4MFF A;  4RQ7 A;  4F4K A;  4KN7 A;  4TUR A;  5III A;  1EXN A;  3HWT A;  3QEA Z;  2VA2 A;  3TAQ A;  3G6X A;  3RJK A;  4QZE A;  5J2D A;  5DB9 A;  2B21 A;  4KLH A;  4J9K A;  4UB1 A;  3IM1 A;  3Q8Q B;  1T8E A;  4MEY A;  2ZTC A;  4F5Q A;  1TAU A;  5DB7 A;  5J2E A;  4IQW A;  4ECS A;  8ICA A;  1HJP A;  4YD2 A;  5KT2 A;  1ZQG A;  3PW2 A;  4F8R A;  9ICI A;  2VA8 A;  2PXI A;  3C2M A;  4RZR A;  3PVX A;  1BVS A;  1T7P A;  2J6T A;  5KFE A;  3ORY A;  2DFL A;  3ZD9 A;  4I2G A;  8ICT A;  9ICB A;  4NM2 A;  4ED7 A;  5D46 A;  1TAQ A;  5L1K A;  4F2S A;  2ASJ A;  4F5P A;  1KFS A;  2IMW P;  4F2R A;  1COO A;  3Q8M A;  5L9X A;  4XUS A;  1ZQP A;  1D8Y A;  1IXR A;  1ZQI A;  3OSP A;  3BQ1 A;  1XSL A;  4M6W A;  5L1I A;  3C1Z A;  3MR6 A;  4GC6 A;  4O3R A;  7ICT A;  3ZDA A;  3UPQ A;  1TKD A;  4J9P A;  8ICL A;  9ICM A;  3GIK A;  2XY7 A;  7ICI A;  4MFC A;  2ZJ5 A;  5DBB A;  5F9N A;  4DQP A;  4M2Y A;  3V72 A;  5KFL A;  4PH5 A;  1T3N A;  1ZQZ A;  7ICN A;  1NKE A;  5J0Y A;  1KFD A;  9ICS A;  3C1Y A;  3H8J A;  1ZQO A;  3C5F A;  3V6H A;  4DSF A;  4IR9 A;  4RQ1 A;  4J9Q A;  4XA5 A;  4I2J A;  1CEZ A;  4QZB A;  4DQI A;  2VAN A;  4TQS A;  4DOB A;  2XCA A;  4F5N A;  7ICM A;  4PGY A;  1JXE A;  4UB3 A;  1SKR A;  4IRD A;  2V9W A;  4GXK A;  3T5K A;  3K4G A;  9ICV A;  1ZQD A;  3H7I A;  1X2I A;  2HHU A;  4QWB A;  5DQG A;  4F4Y A;  5DBC A;  4C8N A;  3OJS A;  4PHD A;  1SKW A;  5J0P A;  1ZQX A;  4QWE A;  4ECY A;  8ICK A;  4RNM A;  9ICA A;  1JMS A;  4ECV A;  2HHW A;  2W8L A;  4O9M A;  1WCL A;  4YXM A;  2A1J B;  2NRT A;  4ED3 A;  3RB4 A;  3RJH A;  3RTV A;  3H8W A;  3LDA A;  3EW9 A;  5KT6 A;  3GIM A;  1NOM A;  3PMN A;  4BXO B;  4LZG A;  2HHQ A;  3V7L A;  2XGQ A;  2XC9 A;  4LZD A;  2ZJ8 A;  1KTQ A;  2FPL A;  4DL5 A;  5DGA A;  3B0X A;  1K1S A;  1MSW D;  3K75 D;  5KG7 A;  2HHV A;  9ICT A;  7ICO A;  3IHQ B;  5CR0 A;  4R8U B;  4I29 A;  1ZQR A;  4KLE A;  3MFH A;  4PGX A;  2KZM A;  4B9M A;  4DF8 A;  3ETL A;  4DWI A;  3RH4 A;  3N97 B;  1S9F A;  3MAB A;  3SV4 A;  8ICV A;  9ICG A;  5KG4 A;  3HPO A;  3C5G A;  5HHI A;  1ZQQ A;  3Q8S B;  3HP6 A;  4BWJ A;  5HP4 A;  5KT7 A;  3RBD A;  4EBC A;  3C21 A;  4JV0 A;  2UVV A;  4B9V A;  1XS9 D;  3ISC A;  3KHL A;  1SKS A;  3PNC A;  2C2E A;  2HHS A;  1H38 A;  2KTQ A;  2AQ4 A;  8ICQ A;  3SV3 A;  2BQ3 A;  3T5J A;  4ECZ A;  2AGQ A;  3RR7 A;  1S76 D;  5IIN A;  2J6U A;  4DL6 A;  8ICB A;  5KFZ A;  2P6U A;  1A76 A;  4DFP A;  4FBU A;  4EYI B;  3PW5 A;  5KG5 A;  4KLI A;  4XQ8 A;  2LYH A;  1ARO P;  4EZ6 A;  1D9F A;  1L3S A;  4B9N A;  3EPI A;  1SL2 A;  2AU0 A;  1KEJ A;  3UXO A;  8ICS A;  4UQG A;  5F9L A;  3GFK B;  9ICH A;  4YP3 A;  4O0I A;  4M47 A;  8ICF A;  4P4P A;  2W9B A;  4YCX A;  2BCS A;  1ZQY A;  4Z6E A;  4RPX A;  2W9M A;  5BPC A;  4YFK A;  5KTQ A;  3GIJ A;  1HUZ A;  4ED6 A;  1ZQH A;  9ICW A;  4QW8 A;  3G6V A;  3TQ1 A;  2PFN A;  4QZH A;  3T5H A;  5DQH A;  4DF4 A;  2J6S A;  4CCH A;  3RH6 A;  5KFD A;  4DQQ A;  4YR0 A;  4QZC A;  1UA0 A;  1RYS A;  1Z00 A;  4I27 A;  1QLN A;  4RT2 A;  2JEJ A;  1RXW A;  3TAP A;  5J2I A;  2Y1I A;  3EPG A;  4UAZ A;  4EBE A;  1MQ3 A;  1PZN A;  1NK9 A;  8ICX A;  2ZJA A;  4PHP A;  3C23 A;  2ATL A;  5J2A A;  1S97 A;  1TK0 A;  2UVW A;  1XC9 A;  3RRG A;  5KFB A;  3B0Y A;  2MAX A;  5IIO A;  5D4B A;  2MUT A;  3V6J A;  3PX4 A;  5CB1 A;  4BGD A;  4M0A A;  2IBK A;  3UQ2 A;  2C2D A;  5J0S A;  2W9C A;  1WCN A;  4EYH B;  5KFV A;  5KFR A;  1RYR A;  3H4B A;  4YQW A;  3RJJ A;  4M6W B;  3RAQ A;  5DQI A;  4GXJ A;  2I9G A;  4E0D A;  5KG1 A;  4YMN A;  3AU2 A;  5J29 A;  4DEZ A;  1JN3 A;  2F1H A;  4F5O A;  3PW0 A;  4JV2 A;  5KFA A;  2PFP A;  1C7Y A;  4J9O A;  4RUA A;  5EWG A;  4RQ5 A;  2JZB A;  4R65 A;  4DFK A;  2BGW A;  4DSK A;  3PX0 A;  3H4D A;  2C28 A;  3RJF A;  2ZUD A;  1D8L A;  4FS2 A;  5DDY A;  4KIT B;  1S10 A;  4O5K A;  4RQ2 A;  4Q43 A;  2PFQ A;  1NJW A;  2ASD A;  5DBA A;  2BKE A;  4KLG A;  4KLJ A;  2GWS A;  2F1I A;  2Q0Z X;  3OSN A;  5BOL A;  1XSN A;  2BCQ A;  1KLN A;  2OWO A;  4DL3 A;  3E2E A;  4IQT A;  3OHB A;  1XU4 A;  5IIK A;  2ALZ A;  4Z6D A;  3EZ5 A;  3JPQ A;  4LVS A;  4KTQ A;  2BCV A;  4QZ8 A;  3RJG A;  8ICJ A;  2XCP A;  5CHG A;  3V7K A;  3PW4 A;  1JIH A;  8ICZ A;  1NJX A;  3GV8 B;  4C8K A;  1NK4 A;  2HVH A;  2ZUB A;  2RDI A;  4M04 A;  1L5U A;  4R63 A;  1S0N A;  1ZJN A;  2IA6 A;  3TAR A;  2DPJ A;  4IRK A;  4UB5 A;  4M9G A;  4IQU A;  5CP2 A;  4GC7 A;  7ICL A;  2R8G A;  5KT4 A;  4RU9 A;  2XY6 A;  1RZT A;  2BCR A;  2HVI A;  9ICO A;  4P4O A;  4QZI A;  3KHR A;  4UAY A;  3C2L A;  3SZ2 A;  1KFT A;  7ICQ A;  4J9S A;  4M9J A;  1SL1 A;  3KTQ A;  1X9M A;  1DGS A;  4TUS A;  9ICL A;  3TI0 A;  3MR5 A;  4YD1 A;  1ZYQ A;  2ISO A;  3MDC A;  7ICE A;  4RQ6 A;  4KLU A;  3RJE A;  3BDP A;  4I2C A;  2BPG A;  3Q8P B;  5J0Q A;  7ICG A;  1BPE A;  4K4I A;  1MQ2 A;  1ZQW A;  1BPX A;  3HT3 A;  4KLF A;  4F5R A;  5J2B A;  3RH5 A;  4K4H A;  4M9L A;  4DQR A;  4YMO A;  5DG8 A;  8ICU A;  1ZQE A;  4MFA A;  1KDH A;  5KFU A;  1HUO A;  2FLL A;  8ICN A;  3JPN A;  3OGU A;  4J9R A;  9ICX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...