3HKZF

The x-ray crystal structure of rna polymerase from archaea
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
b'MSSVYIVEEHYIPYSVAKKLLTDVIRSGGSSNLLQRTYDYLNSVEKCDAESAQKVIEELSNIVSREDVRAILASICPTTSDEVRSILVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
total genus 19
structure length 89
sequence length 89
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3hkzF02
2Y0SF 2WAQF 3HKZF 4AYBF 2WB1F 2PMZF
chains in the Genus database with same CATH superfamily
4P4MA 2BCUA 3GILA 2XGQA 4YR3A 2H5XA 2DPIA 4QZAA 1Z00A 2AGOA 3TAPA 4CDGA 1MC8A 2HHQA 1U49A 3MGIA 4U7CA 4EYHB 7ICFA 4DQQA 1Z3EB 1PUZA 3M9NB 4PZOA 5KFLA 1IV8A 4MF8A 4JMUA 4C7ZA 3T5JA 4DF4A 1U48A 3RH6A 3K1RB 5E79U 5CJ7A 2LM1A 2LI6A 1N61A 2BQUA 3GQCA 5AI8A 2VJ5A 4IC9A 4Y2RA 8ICEA 5CP2A 5KT5A 3RJGA 4UQGA 1LB2B 4EELA 2KN7A 1SZHA 1YT3A 2HMXA 3WK9A 5DQHA 4TUPA 3PO4A 1O08A 3H8WA 4G3IA 5CB1A 3BQ2A 3UPQA 1ZRMA 4DQIA 4CRXA 3NVVA 1ZD3A 4Q43A 5KT6A 2W9CA 1WUDA 3FYHA 4QW8A 4P4OA 1RXWA 4G9BA 4UBCA 3MABA 4Q44A 5KFVA 1TAMA 4J9RA 2F76X 3L3FX 1QCKA 4UAUA 8ICGA 4YXMA 4ECTA 5J0WA 2KMDA 3IDWA 4LZDA 1ZQLA 2H3VA 1FIQA 5ALHA 1JN3A 2HOQA 4I28A 4NL9C 5ALMA 2BDUA 1URJA 1Q3UA 1HIWA 2EZYA 4I2CA 3C2KA 2EZXA 4P0QB 3AN1A 5DKWA 5AICA 2VA3A 2UVUA 2JEGA 4I2HA 4PHPA 1F5SA 2VANA 3HKZC 3C23A 2XIDA 3PY8A 3H8SA 5IIIA 4Q8FA 1S77D 2FLPA 1HUZA 1ZQEA 3EWAA 2BPCA 5ALZA 1ZETA 3BS7A 4Y2SA 2GH1A 5J2AA 1ZQTA 2JMGA 4RT2A 5HP4A 4BDPA 4YD1A 3RF9A 4ECYA 4TURA 4C80A 4F3OA 2E8PA 4F5RA 5C0YA 8ICFA 4QZCA 2R8HA 1SL0A 2Y1IA 3C29A 1LKYB 5KFJA 3AUOA 3ISCA 5ALNA 4QIWC 1AQ6A 4MEXA 4DSLA 1U47A 5AKXA 2JEIA 2MAXA 2HBJA 2JZBA 2KSOB 3PR4A 2C22A 2AQ0A 2HVHA 4LZGA 4O3SA 2I5HA 5L1KA 2ZIXA 2J6UA 3NS1A 5J0XA 4ECUA 2V9WA 3GV7B 3CRXA 5DBBA 4J9KA 1Z1VA 1DRGA 3RTVA 3Q8LA 3KHGA 1ZQZA 1N56A 1QSYA 3UMCA 4KX3A 2P35A 5AIBA 5AM0A 1S76D 3M7DA 4KLSA 1ZQVA 4ED8A 3KHLA 2DUYA 1RYUA 7ICMA 3GV5B 2E5SA 3HW8A 1ZD4A 2HW3A 5T14A 2YN4A 2HSZA 2V4QA 1S0NA 4KMUA 4I2BA 3M9MB 5J2JA 5CWRA 2K8BB 5J2EA 5KFTA 1X9MA 3BZKA 5BOLA 1L7MA 1RZTA 2HBLA 2K60A 4O3PA 4DQRA 2W9AA 1Y88A 3EUB2 1SIJA 8ICMA 2BZFA 2A1JA 7ICEA 5F9LA 1UPHA 4DLGA 4QZFA 5KFAA 4QJFB 2HHVA 2YY6A 4QWAA 3C1ZA 3AMZA 2ASDA 3KHRA 4US9A 3RB6A 4F4YA 2DF4B 3TADA 3SAHA 1ZQHA 5J0YA 5EWFA 4FFDA 4PL2A 3T3FA 3NASA 2PMZF 1L7PA 3NTUA 5KG5A 1ZQDA 2D3DA 1L3TA 3GFKB 1TVAA 1S10A 5JUMA 3G6VA 3SMVA 2JR5A 4QZEA 3I76A 3GIJA 1RM6C 2WAQC 1ZQQA 3C5FA 1ZJMA 5KFUA 4C7YA 4I2GA 1O03A 2ZTEA 4RQ3A 3PW7A 1L8LA 1HEKA 1X9SA 5J0RA 3V7LA 3O0FA 8ICYA 5ALSA 4NV0A 2ATLA 4IRCA 2E1EA 5KFYA 3QNMA 3NUQA 1NK6A 4CGZA 1NKEA 3A0BU 1NKCA 3PSFA 3UMBA 1JROA 4C8OA 4F5PA 2LPEA 3PX0A 1FFUA 3QU9A 4UATA 4USAA 5GTHU 9ICIA 4UBBA 4C8NA 2YX8A 1P7DA 2W54A 4BWMA 3V7KA 5KFDA 4OJPA 2ZIVA 4QZDA 1KEJA 4ED7A 4ICAA 4RPZA 5CRXA 4Z6CA 1ZQAA 5D49A 5ALTA 2QB0B 1L7NA 2MRLA 3B0XA 1XSLA 4NLZA 1WG8A 1ECWA 1KN5A 2BQ3A 1XO1A 1EXNA 3SQIA 9ICAA 8ICQA 3ONNA 4EBCA 5ALGA 9ICMA 4J9SA 2IHMA 2QARA 1XU4A 1LVHA 5L1JA 3KTQA 2OCEA 1SXEA 5J2GA 4Y2PA 4RQMA 2W9BA 3WKEA 4C4TA 5IINA 4DFDA 2LHTA 2NYVA 3GU3A 2LYBA 5BOMA 3K75D 4B9NA 9ICGA 3QUQA 4MFCA 4F8RA 4CF3A 3NVWA 3F2DA 3WKDA 4PJ0U 3VC8A 3D2SA 4ED1A 3E58A 3PSPA 5AI0A 2FLLA 2KIVA 2IOFA 2JXJA 4OJLA 5CHGA 5ALVA 4DS4A 5AKLA 2BDPA 8ICZA 3NVYA 3MFHA 4EENA 3SYZA 2BCVA 1RQLA 1UT5A 3UMGA 4ECQA 4DL3A 1T3NA 4K4GA 1B22A 2K4EA 2C2EA 1BPYA 1BPDA 2RDJA 9ICFA 3Q8RB 3JPQA 5DB7A 3ICXA 4JWMA 1KBUA 5AM3A 4F5NA 1DK3A 2HBMA 3MGVA 3BZCA 4IQVA 3RAXA 4R8UB 5HHHA 4NJ8A 2R8IA 4GXJA 4KTQA 4J03A 1BPXA 2JEFA 2NRZA 2NO4A 4J9MA 2VJ4A 4J9QA 1PK1A 1ZD5A 2LMRA 5AM4A 5EE3A 5AHXA 3F5EA 7ICRA 1AROP 2ISPA 2D8CA 3RB4A 2VKQA 1L3SA 4B9UA 2ZTDA 4BGDA 2BCQA 5J2KA 4F5QA 3AU2A 1ZQMA 1RG6A 1X9WA 5KFRA 5TZVA 2YTUA 4C8KA 2YB1A 3TARA 2WF9A 3UXOA 1N5XA 3UXPA 2BCSA 5ALLA 1NK8A 2KV2A 5JRTA 5KFGA 1X42A 4F72A 4IL6U 1L3UA 9ICSA 5DBCA 8ICLA 2LM4A 1RPLA 2OM6A 2XI9A 9ICNA 8ICXA 3CW2C 2QB1A 3RJEA 4UB3A 4YN4A 1T8EA 5J8YA 3HP6A 4GXKA 2YMPA 1T94A 4FZLA 1XWLA 4KLEA 3OHAA 4UASA 2BGWA 1U4BA 1L5UA 4GXIA 1NJYA 3GIMA 2W7PA 5KFWA 2H3IA 3SAGA 3WK8A 1Z19A 3AU6A 2AGQA 2HHXA 4UAWA 2KD1A 5J2BA 5A0LA 1WWUA 1JMSA 4DS5A 4KLTA 1IIPA 2KVCA 1IG6A 3HJEA 2YB4A 1NJWA 9ICOA 1K5OA 2AH5A 2ZXIA 3PX6A 4NXZA 3ZDEA 2E8OA 3E2EA 5KFHA 4NLGA 4NLBA 4KLIA 5J0UA 2KFNA 1IXRA 1SWVA 3THVA 3WKBA 3OSPA 4EZ6A 3UM9A 3N7RC 3ALRA 3JPRA 5DB6A 1TFRA 5AIAA 2DKXA 3FC4A 2CPRA 2I1QA 1B4FA 3PW2A 4B9VA 1SL2A 3EPGA 1B0XA 1C7YA 4YG2A 3J81j 4P2HA 2F77X 3TQ1A 1ZQXA 3AEVA 1NZPA 4Y2VA 3OPXA 4B9MA 4M9HA 3MFIA 3MC1A 4I2AA 2G07A 1BPBA 5J2IA 2J6TA 2FMQA 1H38A 5C5JA 2KP7A 1X40A 1NK5A 4M6WA 3I1YA 4J9PA 3JPPA 3N28A 3RB0A 1NNLA 1S0MA 4OD0A 4DCCA 2ODGA 3OHBA 1COOA 4I27A 2EQYA 4YVZA 3PVXA 2HHWA 3RJIA 5KNIA 1SV0A 5EWEA 3MR2A 4QZBA 2HHUA 4I29A 4IQWA 4RPYA 2KZ3A 5J2FA 2ES6A 4F92B 2W8LA 4C8LA 4DQPA 4DSIA 3BQTA 2MA1A 3T5LA 5ALUA 3ORYA 2K89A 1F44A 9ICQA 2FPMA 4FS2A 2WF6A 2F1IA 4PL1A 4JV2A 1MSWD 2C28A 4BXOB 1A76A 3MR5A 2W8KA 1VJ5A 1VDVA 4KX5A 3M6ZA 3T5KA 4ECWA 3L4PA 2IOHA 3KBBA 2Q0ZX 3EPIA 1ZQJA 3C2LA 3LWLA 4PHEA 2K4HA 2PFNA 4QNLA 4IR1A 3HRDD 1FO4A 4M9GA 1QH9A 1ED1A 3Q8KA 1QSLA 8ICVA 2Y0SF 4XQ8A 3SZ2A 2ZIWA 4CCHA 4DFJA 5ALJA 8ICJA 1XSNA 2K8CB 1MA7A 5KFIA 1WCLA 3SV3A 4LJXA 2NRTA 1VLBA 4IRKA 3LDAA 3IHQB 3RRGA 3IP4B 4AYBF 2F2AB 4C4SA 5HHIA 2WTFA 2LYAA 5J0TA 3V6KA 1V97A 2KG5A 4ED6A 3MR6A 2OH2A 3RB3A 7ICQA 3PSTA 1X6IA 2E3TA 1TAUA 5IIJA 4Q45A 1N48A 3MBYA 1MQ3A 8ICSA 2FPLA 4ACOA 4RQ4A 1T4GA 5ALEA 2XY7A 2WFAA 4Y2QA 2DBYA 3I28A 1RQNA 4O3QA 3TADC 4PHAA 4CE6A 2KZZA 4OCZA 4GFJA 2IA6A 4KLQA 4QWDA 2OYYA 2WB1F 1KKXA 2KNJA 4J9NA 3ZDAA 5ALFA 2HBKA 4US8A 4QZIA 2I6XA 3G6YA 2Y1JA 2KZMA 2JV3A 4DL5A 1D8BA 2I9GA 2EDUA 4C8MA 1RYRA 1X6JA 3UXNA 4QWCA 3WKCA 2VA2A 3QEBZ 1ZQKA 4P0PA 4CF5A 4I2DA 2HOIA 2K4PA 1COKA 5G5HA 4CNQA 1L7OA 8ICOA 1MN8A 3H4DA 5AM5A 2GLEA 4MEYA 4YR0A 4ECZA 2ZUDA 2W7OA 4ED3A 2EZZA 1ZQGA 3UQ2A 2BPGA 8ICNA 2DL0A 2AJQA 1BPEA 1J2MA 3ETLA 2YMMA 3VCBA 1QTMA 2RP5A 2ZIUB 4DF8A 2KFZA 1MQ2A 3DDHA 1DXSA 3TI0A 1SGGA 2IOFK 4BJQA 4EX7A 3QE9Y 1PVRA 4O9MA 4DL2A 4TQSA 5J0PA 7ICUA 4UB5A 2OXOA 4M9NA 2FMSA 3V72A 1Z4OA 1PVQA 5EOZA 3BS5B 1ZQSA 2UVWA 3IN5A 4RNOA 5KG2A 4FS1A 2YMQA 3QXGA 1QLNA 4F4XA 4EEKA 3AQEA 2Q4TA 3SR6A 2G5IB 5D46A 5DB8A 3B9JA 5DQIA 2FDRA 1JRPA 2G5HB 3AQFA 1FFVA 3BDPA 9ICXA 3RAQA 2HI0A 1S97A 3S6JA 3HT3A 2JRZA 3ZD9A 1FEZA 3M6KA 4F2RA 4F91B 4TUSA 5ALKA 2CRXA 9ICPA 7ICTA 3TAQA 2F44A 4IRDA 3TACB 3H0RB 1NKBA 4O5KA 3TKAA 4HAIA 2C2DA 2E8MA 4KLGA 2KJ5A 2IBKA 3PW5A 3RRHA 7ICKA 2KHVA 3Q8QB 3RFAA 2EAOA 4QZ9A 2KK0A 3PZPA 5ALYA 4P0QA 5B66U 2M9NA 1HJPA 3ZD8A 4DFPA 7ICJA 5KT3A 1RYSA 5J0OA 4HYKA 3QX7A 4Z6FA 5DGAA 4PGXA 2G09A 3BJYA 1Z00B 1Q3VA 3F5AA 2P6RA 1D8YA 9ICKA 1QQ7A 7ICPA 2XICA 4Y2TA 5DLGA 4F2SA 2KIWA 3E0FA 5J2DA 4RU9A 3N7SC 4GIBA 2M0NA 5D4BA 1LKYA 1A0PA 1S0VA 2PFQA 1JXEA 4DFMA 2WHEA 3BQ1A 2OWOA 5DGBA 4QZGA 2BHNA 2KSOA 1T7PA 4UW9A 1SKRA 4GC7A 4EZ9A 5DDYA 2K8AA 2JHDA 4ECXA 4UARA 4JUZA 4F71A 4NM1A 2HCFA 4UB4A 1K1QA 2PMZC 5CR0A 5DG8A 5J2HA 1BPZA 4E0DA 1JIHA 3N97B 3D2NA 3CNHA 2RHFA 4JB3A 5ALRA 1TV9A 1TAQA 4F4ZA 1QQ6A 3GIIA 2H3QA 3KZXA 4J9LA 3MGHA 4DOAA 4KLHA 8ICAA 5EE0A 4F93B 5AI6A 4X5VA 1JXLA 2W9CB 4Z6EA 3RH4A 5J8YC 4IQTA 1TK5A 4QZ8A 1V85A 3T79A 3H7IA 2KEYA 4NLNA 1LV5A 3OSNA 1DGSA 1ZQ1C 4RUAA 3EYZA 3PW4A 2OHFA 2JH1A 3NGDA 4DFKA 3H4BA 4ED0A 4I2IA 1V38A 3IG5A 3QUBA 2BKEA 1ZJNA 1SB3C 5KT4A 4I2FA 1KFTA 1YZ7A 2FLNA 2ESEA 4ECSA 8ICPA 3KZIU 4KLJA 2XO7A 4C4RA 4UB2A 3QU7A 4JV1A 1UA1A 5KL8B 4U6PA 3H0MB 3QZ8A 4DOCA 4ELUA 7ICSA 4WJ3B 2XCAA 3FDSA 4RNMA 3RBDA 1TE2A 3KKAA 1CEZA 5J29A 4OO1J 3C28A 3GIKA 4Y2YA 1ZOLA 4O3NA 2HHTA 4GC6A 3QUTA 2JZBB 3M8RA 3V6HA 4DQSA 3HX0A 4KN4A 5AKKA 2GO7A 3SV4A 5CEHA 2W43A 4M0AA 4AP9A 1XSPA 2EAPA 3IV6A 4UB6U 2H3FA 5ALPA 3ZI4A 4JV0A 1ZQYA 1NK7A 2HDOA 4NM2A 3IM1A 1SV0C 2W04A 3TFRA 2XY6A 5L1LA 3ZDCA 3K1ZA 7ICHA 4O5EA 4R63A 2KJ9A 4YQWA 3WU2U 4YD2A 4RQ5A 3CYMA 2F1JA 4EBDA 5ALIA 5IILA 1C20A 4DSFA 1U9LA 1L6NA 8ICKA 2B0CA 3C1YA 1IM4A 2QB0A 3SI8A 2R8KA 4KLUA 5AM1A 3OJSA 5ALXA 4UAVA 9ICEA 3WK6A 4ZH4A 3RR7A 5DQGA 4Z6DA 3IRUA 1Q8KA 2B21A 5J0SA 4M2YA 2ZJAA 1NI3A 2CN1A 4DOBA 3QU5A 3SD7A 5GTIU 1JALA 2IHNA 1KLNA 3RJFA 4K4IA 1WWVA 4J9OA 2MSNA 1ZQRA 2A1JB 4OJOA 5KL1B 5AKEA 5KFEA 1XO0A 2OEHA 4QIWF 2R18A 1S0OA 4PGYA 5G5GA 4RQ7A 9ICTA 3QYPA 1D9FA 1SL1A 5BPCA 2NV3A 4Y2XA 2RRDA 2JGAA 4EBEA 2FI1A 5HMLA 8ICHA 2J6SA 4M47A 2RDIA 2XVTA 4KITB 2ASJA 1ZQOA 1BVSA 2W3SA 8ICUA 1SV4A 2W9MA 5KAIU 4RZRA 4UAYA 2N1RA 2LYHA 4KLOA 4QW9A 1PVPA 4DLEA 1ZQUA 7ICNA 1UT8A 2PKEA 2KJ8A 2MUTB 4MHVA 4YMNA 3QU2A 4NLCA 2RQ5A 1KL9A 5ALQA 1A77A 2KKPA 5AKIA 8ICCA 3F2BA 3C21A 5JTIA 2UVRA 3ISDA 4RQ0A 4EYIB 4JK1A 5KG4A 4ECVA 1ZQWA 1KDHA 7ICGA 1XNSA 1L3VA 4QWEA 4R8UA 3KHHA 5AI4A 3QUCA 3QZ7A 2V4RA 4KLMA 3A0HU 1WCNA 5K4LA 1N62A 3WK7A 2ZUBA 5KG1A 1NOMA 5KG3A 5KAFU 4B9TA 3SEIA 8ICTA 5AKYA 1X9XA 1X2IA 3LYSA 3ED5A 2ZIVB 3M9OB 4UAZA 4P4PA 4DL4A 5ALOA 4B9SA 5HR6A 3EW9A 2BQRA 4ECRA 7ICVA 5IIKA 3PSIA 4RQ6A 4YXJA 5KG0A 1KFDA 5KFFA 4UB1A 3PW0A 4ELVA 4LVSA 3H0LB 1S5LU 5IIOA 2L5YA 1K1SA 1Z4NA 3ETRA 4F50A 1N5WA 3HWTA 4O5CA 4O3RA 2QARB 4RQ2A 3LVWA 1N63A 5EE9A 3V6JA 2F8LA 2WAQF 4R64A 2W9BB 2PXIA 3FM9A 2VIXA 4TQRA 1T3QA 4K4HA 4YR2A 4RQNA 5KFQA 7ICOA 2F1HA 4ELTA 2G0AA 3SAFA 1BNOA 2Z7JA 3N4MB 2DQNB 5L9XA 2P6UA 5EWGA 1CI4A 3OJUA 4FBTA 1A6SA 4I2EA 4RPXA 2AQ4A 1OXJA 3KOOA 4NL9A 5KFNA 4FZNA 4DO9A 4PZNA 1ZQIA 4B9LA 3Q8MA 3MDAA 2R8JA 4EX6A 4IS7A 4YMOA 4A8EA 1QQ5A 5AK6A 4M9LA 3FAHA 2RLTA 3B0YA 1RDFA 1KSPA 1PK3A 3RJJA 9ICLA 1NK0A 2XC9A 3ZDDA 2AXTU 5HR7A 5DG7A 1JUDA 1Z1BA 2W03A 3LK9A 1SXDA 4RQ1A 4M9JA 5AM2A 2HVIA 1V9PA 9ICRA 9ICUA 5ALDA 5F9NA 5DG9A 5KFCA 3SENA 1CRXA 2LKYA 2PFOA 9ICJA 3HPOA 1NK4A 4R66A 1PK1B 3NRZA 3C5GA 3F53A 3QEAZ 2Y0SC 4RUCA 1KW4A 1DK2A 1KQQA 2PFPA 4KLDA 4OJ6A 5KG6A 1ZYQA 3DEEA 2FE9A 2ZXHA 3K4GA 2AGPA 4CF4A 4YP3A 4DL7A 1JX4A 2VA8A 3PX4A 1QSSA 2XGPA 1UA0A 4NWIA 2KHQA 5KFSA 2MU2A 4AYBC 2DWQA 1ZQPA 4MFAA 5KFXA 5HMMA 5KFZA 4YCXA 3L5KA 1KFSA 8ICRA 1U45A 2GWSA 1CUKA 2JH7A 3D6JA 3WK4A 1YZ6A 2FMPA 2BCRA 4RT3A 3T5HA 1HUOA 4KMOB 4QZHA 4BX9C 2MUTA 4QWBA 1B43A 4BXOA 3WK5A 3H40A 1J2NA 3TFSA 1KRPA 4Q8EA 2EANA 5KT7A 1M6YA 4GLXA 2G08A 2WB1C 5KFBA 2E8NA 3JPOA 4DSJA 4O3MA 5AI9A 1WYGA 3PV8A 5AKHA 2PI4A 3D2QA 9ICCA 5DBAA 2ZJ8A 4JWNA 2K4IA 9ICBA 1XS9D 1UCVA 5KFOA 2DGZA 4F4KA 2O6KA 4BUGA 3F2CA 2AHOB 3TANA 4KN7A 4ED2A 3RH5A 8ICIA 1OUQA 5TISU 2ZTCA 2KE7A 2XCPA 1NZBA 2G06A 1DGJA 3MDCA 2B6GA 4Y2UA 4PGQA 3MR3A 3C2MA 2H3ZA 5L1IA 1ZD2P 3EZ5A 4PH5A 2GOLA 2ZJ5A 4RQ8A 5J0QA 2A3VA 2KTQA 5AKJA 1RXVA 4F5OA 3RR8A 3NRWA 3JPTA 1ZRNA 2BPFA 2IMWP 3WKAA 3QU4A 1N2XA 1S8OA 1D8LA 1SKSA 9ICVA 3Q8SB 4M04A 3RBEA 2DPJA 4M6WB 3JPNA 3R9KA 3OTQA 1GO3F 2KICA 3OGUA 3H8JA 2W11A 4RNNA 2A1AA 2JEJA 5JU5A 4YFKA 2QKQA 1ZQNA 5AK5A 3GZFA 3PR5B 8ICWA 4B6JA 4PHDA 2E1FA 3AL0B 5KT2A 5AKZA 2ISOA 2A19A 2D6FC 1JI7A 2F3NA 1XC9A 2FJ6A 3GV8B 3RJHA 1OW5A 2YQEA 3Q8PB 5KFPA 3PMLA 1KTQA 9ICHA 1UQVA 3PO5A 2BR0A 1NJZA 3LVVA 4XA5A 4FO6A 4XRHA 1UHUA 4O3OA 4MF2A 1DOQA 2LBOA 4YMMA 4Y2JA 2HHSA 3KKAC 4PPXA 3ISBA 2W55A 1TK8A 4FZMA 2NRWA 5KG7A 1ZQBA 3UQ0A 2WF5A 3PNCA 3GDXA 1NK9A 3V7JA 2DFLA 4R65A 3KFUF 3M1YA 3CP8A 3NVZA 1F0MA 5EE1A 5J2CA 2AU0A 5AKGA 2KOBA 4DEZA 4DL6A 2NRVA 1BGXT 4OJ5A 4TUQA 2WF8A 5H2FU 2KKVA 1N60A 2ALZA 2EH9A 1PZNA 2ZIUA 4FBUA 2ZIWB 4UB8U 4IQUA 4FE3A 4IR9A 4KLFA 5DDMA 2HOFA 2Y9TA 1L8OA 3PMNA 3N7PD 4DWIA 3JPSA 3M8SA 5B5EU 3BQ0A 3BS5A 5HNKA 3IG8A 1ZQFA 2P66A 1Q46A 2QLTA 1NJXA 1TKDA 2UVVA 4KLLA 3G6XA 8ICBA 5F3XB 2ZG6A 4BWJA 5AK4A 3U26A 2XY5A 4XUSA 4F4WA 2W3RA 2ASLA 9ICWA 2ZUCA 2DKZA 3ZDBA 4ZOHC 2Y9UA 2F8KA 2NO5A 1S9FA 5CA7A 3KD3A 5KFMA 7ICIA 5DB9A 7ICLA 2KVSA 1TK0A 2WF7A 2PI5A 2ZIXB 1J97A 4EEYA 4I2JA 3BQ7A 3H8MA 1SZPA 4DSEA 4C0ZA 3RJKA 5AI5A 5AK3A 1BNPA 4MFFA 3HILA 1D9DA 1SKWA 5KTQA 5ALWA 4DSKA 3DV9A 2NRXA 2YMLA 2CXYA 2EAMA 2R8GA 1X66A 3AM9A 4O0IA 5DLFA 2FPKA 5KFKA 1ZQCA 1ZXIA 1SWWA 3LWMA 5IIMA 5FP0A 2C2RA 3HKZF 5L1MA 4NY8A 4NLKA 4P0PB
chains in the Genus database with same CATH topology
4OJ5A 1XO0A 4QIWF 2K8AA 3AQEA 3M7DA 2JHDA 2Q4TA 2GOLA 2H3VA 5KL8B 2HOQA 2KKVA 2R18A 2G5IB 2MA1A 2A3VA 4U6PA 4OJ6A 2KD1A 2K89A 1F44A 2BDUA 3H0MB 3DEEA 2ZIUA 2YX8A 5A0LA 4CDGA 1P7DA 2K4EA 1URJA 2G5HB 1HIWA 2E5SA 2PMZC 3AQFA 4GFJA 1Q3UA 2ZIWB 4WJ3B 2NV3A 1IIPA 2OYYA 2WB1F 2KVCA 2RRDA 3LVWA 2JGAA 2ZXHA 3NRWA 4FE3A 4PL1A 5T14A 2YB4A 2KNJA 3D2NA 2F8LA 2WAQF 3ICXA 2HOFA 4P0QB 2RHFA 2ZXIA 4OO1J 1KBUA 3C28A 4OJPA 2ZIVA 4U7CA 2XVTA 4ICAA 2VIXA 3N7PD 2HBKA 2HBMA 2K8BB 4KX5A 3MGVA 5CRXA 3M6KA 2H3QA 3KZXA 3HKZC 3M6ZA 2KHQA 4NLBA 4NWIA 2XIDA 1D8BA 2G0AA 4AYBC 3SAFA 2HBLA 1GO3F 3IG8A 2CRXA 2KICA 2MRLA 2VJ4A 1ECWA 4JMUA 2N1RA 2Y0SC 2Z7JA 2GH1A 3ALRA 3H0RB 3N7RC 2DQNB 3F5EA 2JMGA 1PVPA 3SQIA 3RF9A 2K4HA 2H3FA 1UPHA 2VKQA 2JH7A 3ONNA 4QNLA 4P0PA 2HOIA 2KJ8A 3GZFA 4QJFB 2ZG6A 1A6SA 1ED1A 2CPRA 4NLCA 2E1FA 2KJ5A 3AL0B 2W04A 5C0YA 2Y0SF 4FZNA 2KKPA 3T79A 2DF4B 2KHVA 2VJ5A 2ZIWA 4IC9A 4KMOB 3RFAA 3C29A 3F2BA 2D6FC 2F77X 3SAHA 4BX9C 3PZPA 2KEYA 4PL2A 3K1ZA 4P0QA 3OPXA 4QIWC 2PMZF 2YB1A 2KJ9A 2K8CB 1MA7A 1SZHA 2W7OA 1XNSA 3CYMA 2G07A 2HBJA 1YT3A 2LHTA 2HMXA 3GU3A 1ZQ1C 2LYBA 4A8EA 2KV2A 3LVVA 1L6NA 3SMVA 2ZIXB 2G08A 2G09A 2WB1C 4O3MA 2JH1A 3VCBA 1Q3VA 2OM6A 2RP5A 2WAQC 2XI9A 2ZIUB 3F5AA 2LBOA 4CRXA 2XICA 3D2QA 5HR7A 3IP4B 4AYBF 1Z1BA 2W03A 3IG5A 4FZMA 4C0ZA 2ZIXA 2F2AB 2K4IA 2KIWA 3F2DA 1HEKA 4BJQA 2LYAA 1WUDA 3E0FA 3LYSA 3VC8A 2DGZA 2ZIVB 3O0FA 1PVRA 3D2SA 3N7SC 3PSPA 4BUGA 2OXOA 4NV0A 3F2CA 2OH2A 2M0NA 3KFUF 2CN1A 2E1EA 5HR6A 3CRXA 1A0PA 1T94A 4FZLA 3NUQA 4OJLA 3PSTA 1PVQA 3CP8A 1CRXA 4CGZA 2LKYA 1TAMA 1OUQA 1DRGA 3PSIA 3PSFA 2F76X 1NZBA 3L3FX 2G06A 3IN5A 2W7PA 2H3IA 3SAGA 2KOBA 4ACOA 3F53A 3HKZF 4OJOA 5KL1B 2H3ZA 4KX3A 3H0LB 1Z19A 4P0PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S F;  2WAQ F;  3HKZ F;  4AYB F;  2WB1 F;  2PMZ F; 
#chains in the Genus database with same CATH topology
 4P4M A;  2BCU A;  3GIL A;  2XGQ A;  4YR3 A;  2H5X A;  2DPI A;  4QZA A;  1Z00 A;  2AGO A;  3TAP A;  4CDG A;  1MC8 A;  2HHQ A;  1U49 A;  3MGI A;  4U7C A;  4EYH B;  7ICF A;  4DQQ A;  1Z3E B;  1PUZ A;  3M9N B;  4PZO A;  5KFL A;  1IV8 A;  4MF8 A;  4JMU A;  4C7Z A;  3T5J A;  4DF4 A;  1U48 A;  3RH6 A;  3K1R B;  5E79 U;  5CJ7 A;  2LM1 A;  2LI6 A;  1N61 A;  2BQU A;  3GQC A;  5AI8 A;  2VJ5 A;  4IC9 A;  4Y2R A;  8ICE A;  5CP2 A;  5KT5 A;  3RJG A;  4UQG A;  1LB2 B;  4EEL A;  2KN7 A;  1SZH A;  1YT3 A;  2HMX A;  3WK9 A;  5DQH A;  4TUP A;  3PO4 A;  1O08 A;  3H8W A;  4G3I A;  5CB1 A;  3BQ2 A;  3UPQ A;  1ZRM A;  4DQI A;  4CRX A;  3NVV A;  1ZD3 A;  4Q43 A;  5KT6 A;  2W9C A;  1WUD A;  3FYH A;  4QW8 A;  4P4O A;  1RXW A;  4G9B A;  4UBC A;  3MAB A;  4Q44 A;  5KFV A;  1TAM A;  4J9R A;  2F76 X;  3L3F X;  1QCK A;  4UAU A;  8ICG A;  4YXM A;  4ECT A;  5J0W A;  2KMD A;  3IDW A;  4LZD A;  1ZQL A;  2H3V A;  1FIQ A;  5ALH A;  1JN3 A;  2HOQ A;  4I28 A;  4NL9 C;  5ALM A;  2BDU A;  1URJ A;  1Q3U A;  1HIW A;  2EZY A;  4I2C A;  3C2K A;  2EZX A;  4P0Q B;  3AN1 A;  5DKW A;  5AIC A;  2VA3 A;  2UVU A;  2JEG A;  4I2H A;  4PHP A;  1F5S A;  2VAN A;  3HKZ C;  3C23 A;  2XID A;  3PY8 A;  3H8S A;  5III A;  4Q8F A;  1S77 D;  2FLP A;  1HUZ A;  1ZQE A;  3EWA A;  2BPC A;  5ALZ A;  1ZET A;  3BS7 A;  4Y2S A;  2GH1 A;  5J2A A;  1ZQT A;  2JMG A;  4RT2 A;  5HP4 A;  4BDP A;  4YD1 A;  3RF9 A;  4ECY A;  4TUR A;  4C80 A;  4F3O A;  2E8P A;  4F5R A;  5C0Y A;  8ICF A;  4QZC A;  2R8H A;  1SL0 A;  2Y1I A;  3C29 A;  1LKY B;  5KFJ A;  3AUO A;  3ISC A;  5ALN A;  4QIW C;  1AQ6 A;  4MEX A;  4DSL A;  1U47 A;  5AKX A;  2JEI A;  2MAX A;  2HBJ A;  2JZB A;  2KSO B;  3PR4 A;  2C22 A;  2AQ0 A;  2HVH A;  4LZG A;  4O3S A;  2I5H A;  5L1K A;  2ZIX A;  2J6U A;  3NS1 A;  5J0X A;  4ECU A;  2V9W A;  3GV7 B;  3CRX A;  5DBB A;  4J9K A;  1Z1V A;  1DRG A;  3RTV A;  3Q8L A;  3KHG A;  1ZQZ A;  1N56 A;  1QSY A;  3UMC A;  4KX3 A;  2P35 A;  5AIB A;  5AM0 A;  1S76 D;  3M7D A;  4KLS A;  1ZQV A;  4ED8 A;  3KHL A;  2DUY A;  1RYU A;  7ICM A;  3GV5 B;  2E5S A;  3HW8 A;  1ZD4 A;  2HW3 A;  5T14 A;  2YN4 A;  2HSZ A;  2V4Q A;  1S0N A;  4KMU A;  4I2B A;  3M9M B;  5J2J A;  5CWR A;  2K8B B;  5J2E A;  5KFT A;  1X9M A;  3BZK A;  5BOL A;  1L7M A;  1RZT A;  2HBL A;  2K60 A;  4O3P A;  4DQR A;  2W9A A;  1Y88 A;  3EUB 2;  1SIJ A;  8ICM A;  2BZF A;  2A1J A;  7ICE A;  5F9L A;  1UPH A;  4DLG A;  4QZF A;  5KFA A;  4QJF B;  2HHV A;  2YY6 A;  4QWA A;  3C1Z A;  3AMZ A;  2ASD A;  3KHR A;  4US9 A;  3RB6 A;  4F4Y A;  2DF4 B;  3TAD A;  3SAH A;  1ZQH A;  5J0Y A;  5EWF A;  4FFD A;  4PL2 A;  3T3F A;  3NAS A;  2PMZ F;  1L7P A;  3NTU A;  5KG5 A;  1ZQD A;  2D3D A;  1L3T A;  3GFK B;  1TVA A;  1S10 A;  5JUM A;  3G6V A;  3SMV A;  2JR5 A;  4QZE A;  3I76 A;  3GIJ A;  1RM6 C;  2WAQ C;  1ZQQ A;  3C5F A;  1ZJM A;  5KFU A;  4C7Y A;  4I2G A;  1O03 A;  2ZTE A;  4RQ3 A;  3PW7 A;  1L8L A;  1HEK A;  1X9S A;  5J0R A;  3V7L A;  3O0F A;  8ICY A;  5ALS A;  4NV0 A;  2ATL A;  4IRC A;  2E1E A;  5KFY A;  3QNM A;  3NUQ A;  1NK6 A;  4CGZ A;  1NKE A;  3A0B U;  1NKC A;  3PSF A;  3UMB A;  1JRO A;  4C8O A;  4F5P A;  2LPE A;  3PX0 A;  1FFU A;  3QU9 A;  4UAT A;  4USA A;  5GTH U;  9ICI A;  4UBB A;  4C8N A;  2YX8 A;  1P7D A;  2W54 A;  4BWM A;  3V7K A;  5KFD A;  4OJP A;  2ZIV A;  4QZD A;  1KEJ A;  4ED7 A;  4ICA A;  4RPZ A;  5CRX A;  4Z6C A;  1ZQA A;  5D49 A;  5ALT A;  2QB0 B;  1L7N A;  2MRL A;  3B0X A;  1XSL A;  4NLZ A;  1WG8 A;  1ECW A;  1KN5 A;  2BQ3 A;  1XO1 A;  1EXN A;  3SQI A;  9ICA A;  8ICQ A;  3ONN A;  4EBC A;  5ALG A;  9ICM A;  4J9S A;  2IHM A;  2QAR A;  1XU4 A;  1LVH A;  5L1J A;  3KTQ A;  2OCE A;  1SXE A;  5J2G A;  4Y2P A;  4RQM A;  2W9B A;  3WKE A;  4C4T A;  5IIN A;  4DFD A;  2LHT A;  2NYV A;  3GU3 A;  2LYB A;  5BOM A;  3K75 D;  4B9N A;  9ICG A;  3QUQ A;  4MFC A;  4F8R A;  4CF3 A;  3NVW A;  3F2D A;  3WKD A;  4PJ0 U;  3VC8 A;  3D2S A;  4ED1 A;  3E58 A;  3PSP A;  5AI0 A;  2FLL A;  2KIV A;  2IOF A;  2JXJ A;  4OJL A;  5CHG A;  5ALV A;  4DS4 A;  5AKL A;  2BDP A;  8ICZ A;  3NVY A;  3MFH A;  4EEN A;  3SYZ A;  2BCV A;  1RQL A;  1UT5 A;  3UMG A;  4ECQ A;  4DL3 A;  1T3N A;  4K4G A;  1B22 A;  2K4E A;  2C2E A;  1BPY A;  1BPD A;  2RDJ A;  9ICF A;  3Q8R B;  3JPQ A;  5DB7 A;  3ICX A;  4JWM A;  1KBU A;  5AM3 A;  4F5N A;  1DK3 A;  2HBM A;  3MGV A;  3BZC A;  4IQV A;  3RAX A;  4R8U B;  5HHH A;  4NJ8 A;  2R8I A;  4GXJ A;  4KTQ A;  4J03 A;  1BPX A;  2JEF A;  2NRZ A;  2NO4 A;  4J9M A;  2VJ4 A;  4J9Q A;  1PK1 A;  1ZD5 A;  2LMR A;  5AM4 A;  5EE3 A;  5AHX A;  3F5E A;  7ICR A;  1ARO P;  2ISP A;  2D8C A;  3RB4 A;  2VKQ A;  1L3S A;  4B9U A;  2ZTD A;  4BGD A;  2BCQ A;  5J2K A;  4F5Q A;  3AU2 A;  1ZQM A;  1RG6 A;  1X9W A;  5KFR A;  5TZV A;  2YTU A;  4C8K A;  2YB1 A;  3TAR A;  2WF9 A;  3UXO A;  1N5X A;  3UXP A;  2BCS A;  5ALL A;  1NK8 A;  2KV2 A;  5JRT A;  5KFG A;  1X42 A;  4F72 A;  4IL6 U;  1L3U A;  9ICS A;  5DBC A;  8ICL A;  2LM4 A;  1RPL A;  2OM6 A;  2XI9 A;  9ICN A;  8ICX A;  3CW2 C;  2QB1 A;  3RJE A;  4UB3 A;  4YN4 A;  1T8E A;  5J8Y A;  3HP6 A;  4GXK A;  2YMP A;  1T94 A;  4FZL A;  1XWL A;  4KLE A;  3OHA A;  4UAS A;  2BGW A;  1U4B A;  1L5U A;  4GXI A;  1NJY A;  3GIM A;  2W7P A;  5KFW A;  2H3I A;  3SAG A;  3WK8 A;  1Z19 A;  3AU6 A;  2AGQ A;  2HHX A;  4UAW A;  2KD1 A;  5J2B A;  5A0L A;  1WWU A;  1JMS A;  4DS5 A;  4KLT A;  1IIP A;  2KVC A;  1IG6 A;  3HJE A;  2YB4 A;  1NJW A;  9ICO A;  1K5O A;  2AH5 A;  2ZXI A;  3PX6 A;  4NXZ A;  3ZDE A;  2E8O A;  3E2E A;  5KFH A;  4NLG A;  4NLB A;  4KLI A;  5J0U A;  2KFN A;  1IXR A;  1SWV A;  3THV A;  3WKB A;  3OSP A;  4EZ6 A;  3UM9 A;  3N7R C;  3ALR A;  3JPR A;  5DB6 A;  1TFR A;  5AIA A;  2DKX A;  3FC4 A;  2CPR A;  2I1Q A;  1B4F A;  3PW2 A;  4B9V A;  1SL2 A;  3EPG A;  1B0X A;  1C7Y A;  4YG2 A;  3J81 j;  4P2H A;  2F77 X;  3TQ1 A;  1ZQX A;  3AEV A;  1NZP A;  4Y2V A;  3OPX A;  4B9M A;  4M9H A;  3MFI A;  3MC1 A;  4I2A A;  2G07 A;  1BPB A;  5J2I A;  2J6T A;  2FMQ A;  1H38 A;  5C5J A;  2KP7 A;  1X40 A;  1NK5 A;  4M6W A;  3I1Y A;  4J9P A;  3JPP A;  3N28 A;  3RB0 A;  1NNL A;  1S0M A;  4OD0 A;  4DCC A;  2ODG A;  3OHB A;  1COO A;  4I27 A;  2EQY A;  4YVZ A;  3PVX A;  2HHW A;  3RJI A;  5KNI A;  1SV0 A;  5EWE A;  3MR2 A;  4QZB A;  2HHU A;  4I29 A;  4IQW A;  4RPY A;  2KZ3 A;  5J2F A;  2ES6 A;  4F92 B;  2W8L A;  4C8L A;  4DQP A;  4DSI A;  3BQT A;  2MA1 A;  3T5L A;  5ALU A;  3ORY A;  2K89 A;  1F44 A;  9ICQ A;  2FPM A;  4FS2 A;  2WF6 A;  2F1I A;  4PL1 A;  4JV2 A;  1MSW D;  2C28 A;  4BXO B;  1A76 A;  3MR5 A;  2W8K A;  1VJ5 A;  1VDV A;  4KX5 A;  3M6Z A;  3T5K A;  4ECW A;  3L4P A;  2IOH A;  3KBB A;  2Q0Z X;  3EPI A;  1ZQJ A;  3C2L A;  3LWL A;  4PHE A;  2K4H A;  2PFN A;  4QNL A;  4IR1 A;  3HRD D;  1FO4 A;  4M9G A;  1QH9 A;  1ED1 A;  3Q8K A;  1QSL A;  8ICV A;  2Y0S F;  4XQ8 A;  3SZ2 A;  2ZIW A;  4CCH A;  4DFJ A;  5ALJ A;  8ICJ A;  1XSN A;  2K8C B;  1MA7 A;  5KFI A;  1WCL A;  3SV3 A;  4LJX A;  2NRT A;  1VLB A;  4IRK A;  3LDA A;  3IHQ B;  3RRG A;  3IP4 B;  4AYB F;  2F2A B;  4C4S A;  5HHI A;  2WTF A;  2LYA A;  5J0T A;  3V6K A;  1V97 A;  2KG5 A;  4ED6 A;  3MR6 A;  2OH2 A;  3RB3 A;  7ICQ A;  3PST A;  1X6I A;  2E3T A;  1TAU A;  5IIJ A;  4Q45 A;  1N48 A;  3MBY A;  1MQ3 A;  8ICS A;  2FPL A;  4ACO A;  4RQ4 A;  1T4G A;  5ALE A;  2XY7 A;  2WFA A;  4Y2Q A;  2DBY A;  3I28 A;  1RQN A;  4O3Q A;  3TAD C;  4PHA A;  4CE6 A;  2KZZ A;  4OCZ A;  4GFJ A;  2IA6 A;  4KLQ A;  4QWD A;  2OYY A;  2WB1 F;  1KKX A;  2KNJ A;  4J9N A;  3ZDA A;  5ALF A;  2HBK A;  4US8 A;  4QZI A;  2I6X A;  3G6Y A;  2Y1J A;  2KZM A;  2JV3 A;  4DL5 A;  1D8B A;  2I9G A;  2EDU A;  4C8M A;  1RYR A;  1X6J A;  3UXN A;  4QWC A;  3WKC A;  2VA2 A;  3QEB Z;  1ZQK A;  4P0P A;  4CF5 A;  4I2D A;  2HOI A;  2K4P A;  1COK A;  5G5H A;  4CNQ A;  1L7O A;  8ICO A;  1MN8 A;  3H4D A;  5AM5 A;  2GLE A;  4MEY A;  4YR0 A;  4ECZ A;  2ZUD A;  2W7O A;  4ED3 A;  2EZZ A;  1ZQG A;  3UQ2 A;  2BPG A;  8ICN A;  2DL0 A;  2AJQ A;  1BPE A;  1J2M A;  3ETL A;  2YMM A;  3VCB A;  1QTM A;  2RP5 A;  2ZIU B;  4DF8 A;  2KFZ A;  1MQ2 A;  3DDH A;  1DXS A;  3TI0 A;  1SGG A;  2IOF K;  4BJQ A;  4EX7 A;  3QE9 Y;  1PVR A;  4O9M A;  4DL2 A;  4TQS A;  5J0P A;  7ICU A;  4UB5 A;  2OXO A;  4M9N A;  2FMS A;  3V72 A;  1Z4O A;  1PVQ A;  5EOZ A;  3BS5 B;  1ZQS A;  2UVW A;  3IN5 A;  4RNO A;  5KG2 A;  4FS1 A;  2YMQ A;  3QXG A;  1QLN A;  4F4X A;  4EEK A;  3AQE A;  2Q4T A;  3SR6 A;  2G5I B;  5D46 A;  5DB8 A;  3B9J A;  5DQI A;  2FDR A;  1JRP A;  2G5H B;  3AQF A;  1FFV A;  3BDP A;  9ICX A;  3RAQ A;  2HI0 A;  1S97 A;  3S6J A;  3HT3 A;  2JRZ A;  3ZD9 A;  1FEZ A;  3M6K A;  4F2R A;  4F91 B;  4TUS A;  5ALK A;  2CRX A;  9ICP A;  7ICT A;  3TAQ A;  2F44 A;  4IRD A;  3TAC B;  3H0R B;  1NKB A;  4O5K A;  3TKA A;  4HAI A;  2C2D A;  2E8M A;  4KLG A;  2KJ5 A;  2IBK A;  3PW5 A;  3RRH A;  7ICK A;  2KHV A;  3Q8Q B;  3RFA A;  2EAO A;  4QZ9 A;  2KK0 A;  3PZP A;  5ALY A;  4P0Q A;  5B66 U;  2M9N A;  1HJP A;  3ZD8 A;  4DFP A;  7ICJ A;  5KT3 A;  1RYS A;  5J0O A;  4HYK A;  3QX7 A;  4Z6F A;  5DGA A;  4PGX A;  2G09 A;  3BJY A;  1Z00 B;  1Q3V A;  3F5A A;  2P6R A;  1D8Y A;  9ICK A;  1QQ7 A;  7ICP A;  2XIC A;  4Y2T A;  5DLG A;  4F2S A;  2KIW A;  3E0F A;  5J2D A;  4RU9 A;  3N7S C;  4GIB A;  2M0N A;  5D4B A;  1LKY A;  1A0P A;  1S0V A;  2PFQ A;  1JXE A;  4DFM A;  2WHE A;  3BQ1 A;  2OWO A;  5DGB A;  4QZG A;  2BHN A;  2KSO A;  1T7P A;  4UW9 A;  1SKR A;  4GC7 A;  4EZ9 A;  5DDY A;  2K8A A;  2JHD A;  4ECX A;  4UAR A;  4JUZ A;  4F71 A;  4NM1 A;  2HCF A;  4UB4 A;  1K1Q A;  2PMZ C;  5CR0 A;  5DG8 A;  5J2H A;  1BPZ A;  4E0D A;  1JIH A;  3N97 B;  3D2N A;  3CNH A;  2RHF A;  4JB3 A;  5ALR A;  1TV9 A;  1TAQ A;  4F4Z A;  1QQ6 A;  3GII A;  2H3Q A;  3KZX A;  4J9L A;  3MGH A;  4DOA A;  4KLH A;  8ICA A;  5EE0 A;  4F93 B;  5AI6 A;  4X5V A;  1JXL A;  2W9C B;  4Z6E A;  3RH4 A;  5J8Y C;  4IQT A;  1TK5 A;  4QZ8 A;  1V85 A;  3T79 A;  3H7I A;  2KEY A;  4NLN A;  1LV5 A;  3OSN A;  1DGS A;  1ZQ1 C;  4RUA A;  3EYZ A;  3PW4 A;  2OHF A;  2JH1 A;  3NGD A;  4DFK A;  3H4B A;  4ED0 A;  4I2I A;  1V38 A;  3IG5 A;  3QUB A;  2BKE A;  1ZJN A;  1SB3 C;  5KT4 A;  4I2F A;  1KFT A;  1YZ7 A;  2FLN A;  2ESE A;  4ECS A;  8ICP A;  3KZI U;  4KLJ A;  2XO7 A;  4C4R A;  4UB2 A;  3QU7 A;  4JV1 A;  1UA1 A;  5KL8 B;  4U6P A;  3H0M B;  3QZ8 A;  4DOC A;  4ELU A;  7ICS A;  4WJ3 B;  2XCA A;  3FDS A;  4RNM A;  3RBD A;  1TE2 A;  3KKA A;  1CEZ A;  5J29 A;  4OO1 J;  3C28 A;  3GIK A;  4Y2Y A;  1ZOL A;  4O3N A;  2HHT A;  4GC6 A;  3QUT A;  2JZB B;  3M8R A;  3V6H A;  4DQS A;  3HX0 A;  4KN4 A;  5AKK A;  2GO7 A;  3SV4 A;  5CEH A;  2W43 A;  4M0A A;  4AP9 A;  1XSP A;  2EAP A;  3IV6 A;  4UB6 U;  2H3F A;  5ALP A;  3ZI4 A;  4JV0 A;  1ZQY A;  1NK7 A;  2HDO A;  4NM2 A;  3IM1 A;  1SV0 C;  2W04 A;  3TFR A;  2XY6 A;  5L1L A;  3ZDC A;  3K1Z A;  7ICH A;  4O5E A;  4R63 A;  2KJ9 A;  4YQW A;  3WU2 U;  4YD2 A;  4RQ5 A;  3CYM A;  2F1J A;  4EBD A;  5ALI A;  5IIL A;  1C20 A;  4DSF A;  1U9L A;  1L6N A;  8ICK A;  2B0C A;  3C1Y A;  1IM4 A;  2QB0 A;  3SI8 A;  2R8K A;  4KLU A;  5AM1 A;  3OJS A;  5ALX A;  4UAV A;  9ICE A;  3WK6 A;  4ZH4 A;  3RR7 A;  5DQG A;  4Z6D A;  3IRU A;  1Q8K A;  2B21 A;  5J0S A;  4M2Y A;  2ZJA A;  1NI3 A;  2CN1 A;  4DOB A;  3QU5 A;  3SD7 A;  5GTI U;  1JAL A;  2IHN A;  1KLN A;  3RJF A;  4K4I A;  1WWV A;  4J9O A;  2MSN A;  1ZQR A;  2A1J B;  4OJO A;  5KL1 B;  5AKE A;  5KFE A;  1XO0 A;  2OEH A;  4QIW F;  2R18 A;  1S0O A;  4PGY A;  5G5G A;  4RQ7 A;  9ICT A;  3QYP A;  1D9F A;  1SL1 A;  5BPC A;  2NV3 A;  4Y2X A;  2RRD A;  2JGA A;  4EBE A;  2FI1 A;  5HML A;  8ICH A;  2J6S A;  4M47 A;  2RDI A;  2XVT A;  4KIT B;  2ASJ A;  1ZQO A;  1BVS A;  2W3S A;  8ICU A;  1SV4 A;  2W9M A;  5KAI U;  4RZR A;  4UAY A;  2N1R A;  2LYH A;  4KLO A;  4QW9 A;  1PVP A;  4DLE A;  1ZQU A;  7ICN A;  1UT8 A;  2PKE A;  2KJ8 A;  2MUT B;  4MHV A;  4YMN A;  3QU2 A;  4NLC A;  2RQ5 A;  1KL9 A;  5ALQ A;  1A77 A;  2KKP A;  5AKI A;  8ICC A;  3F2B A;  3C21 A;  5JTI A;  2UVR A;  3ISD A;  4RQ0 A;  4EYI B;  4JK1 A;  5KG4 A;  4ECV A;  1ZQW A;  1KDH A;  7ICG A;  1XNS A;  1L3V A;  4QWE A;  4R8U A;  3KHH A;  5AI4 A;  3QUC A;  3QZ7 A;  2V4R A;  4KLM A;  3A0H U;  1WCN A;  5K4L A;  1N62 A;  3WK7 A;  2ZUB A;  5KG1 A;  1NOM A;  5KG3 A;  5KAF U;  4B9T A;  3SEI A;  8ICT A;  5AKY A;  1X9X A;  1X2I A;  3LYS A;  3ED5 A;  2ZIV B;  3M9O B;  4UAZ A;  4P4P A;  4DL4 A;  5ALO A;  4B9S A;  5HR6 A;  3EW9 A;  2BQR A;  4ECR A;  7ICV A;  5IIK A;  3PSI A;  4RQ6 A;  4YXJ A;  5KG0 A;  1KFD A;  5KFF A;  4UB1 A;  3PW0 A;  4ELV A;  4LVS A;  3H0L B;  1S5L U;  5IIO A;  2L5Y A;  1K1S A;  1Z4N A;  3ETR A;  4F50 A;  1N5W A;  3HWT A;  4O5C A;  4O3R A;  2QAR B;  4RQ2 A;  3LVW A;  1N63 A;  5EE9 A;  3V6J A;  2F8L A;  2WAQ F;  4R64 A;  2W9B B;  2PXI A;  3FM9 A;  2VIX A;  4TQR A;  1T3Q A;  4K4H A;  4YR2 A;  4RQN A;  5KFQ A;  7ICO A;  2F1H A;  4ELT A;  2G0A A;  3SAF A;  1BNO A;  2Z7J A;  3N4M B;  2DQN B;  5L9X A;  2P6U A;  5EWG A;  1CI4 A;  3OJU A;  4FBT A;  1A6S A;  4I2E A;  4RPX A;  2AQ4 A;  1OXJ A;  3KOO A;  4NL9 A;  5KFN A;  4FZN A;  4DO9 A;  4PZN A;  1ZQI A;  4B9L A;  3Q8M A;  3MDA A;  2R8J A;  4EX6 A;  4IS7 A;  4YMO A;  4A8E A;  1QQ5 A;  5AK6 A;  4M9L A;  3FAH A;  2RLT A;  3B0Y A;  1RDF A;  1KSP A;  1PK3 A;  3RJJ A;  9ICL A;  1NK0 A;  2XC9 A;  3ZDD A;  2AXT U;  5HR7 A;  5DG7 A;  1JUD A;  1Z1B A;  2W03 A;  3LK9 A;  1SXD A;  4RQ1 A;  4M9J A;  5AM2 A;  2HVI A;  1V9P A;  9ICR A;  9ICU A;  5ALD A;  5F9N A;  5DG9 A;  5KFC A;  3SEN A;  1CRX A;  2LKY A;  2PFO A;  9ICJ A;  3HPO A;  1NK4 A;  4R66 A;  1PK1 B;  3NRZ A;  3C5G A;  3F53 A;  3QEA Z;  2Y0S C;  4RUC A;  1KW4 A;  1DK2 A;  1KQQ A;  2PFP A;  4KLD A;  4OJ6 A;  5KG6 A;  1ZYQ A;  3DEE A;  2FE9 A;  2ZXH A;  3K4G A;  2AGP A;  4CF4 A;  4YP3 A;  4DL7 A;  1JX4 A;  2VA8 A;  3PX4 A;  1QSS A;  2XGP A;  1UA0 A;  4NWI A;  2KHQ A;  5KFS A;  2MU2 A;  4AYB C;  2DWQ A;  1ZQP A;  4MFA A;  5KFX A;  5HMM A;  5KFZ A;  4YCX A;  3L5K A;  1KFS A;  8ICR A;  1U45 A;  2GWS A;  1CUK A;  2JH7 A;  3D6J A;  3WK4 A;  1YZ6 A;  2FMP A;  2BCR A;  4RT3 A;  3T5H A;  1HUO A;  4KMO B;  4QZH A;  4BX9 C;  2MUT A;  4QWB A;  1B43 A;  4BXO A;  3WK5 A;  3H40 A;  1J2N A;  3TFS A;  1KRP A;  4Q8E A;  2EAN A;  5KT7 A;  1M6Y A;  4GLX A;  2G08 A;  2WB1 C;  5KFB A;  2E8N A;  3JPO A;  4DSJ A;  4O3M A;  5AI9 A;  1WYG A;  3PV8 A;  5AKH A;  2PI4 A;  3D2Q A;  9ICC A;  5DBA A;  2ZJ8 A;  4JWN A;  2K4I A;  9ICB A;  1XS9 D;  1UCV A;  5KFO A;  2DGZ A;  4F4K A;  2O6K A;  4BUG A;  3F2C A;  2AHO B;  3TAN A;  4KN7 A;  4ED2 A;  3RH5 A;  8ICI A;  1OUQ A;  5TIS U;  2ZTC A;  2KE7 A;  2XCP A;  1NZB A;  2G06 A;  1DGJ A;  3MDC A;  2B6G A;  4Y2U A;  4PGQ A;  3MR3 A;  3C2M A;  2H3Z A;  5L1I A;  1ZD2 P;  3EZ5 A;  4PH5 A;  2GOL A;  2ZJ5 A;  4RQ8 A;  5J0Q A;  2A3V A;  2KTQ A;  5AKJ A;  1RXV A;  4F5O A;  3RR8 A;  3NRW A;  3JPT A;  1ZRN A;  2BPF A;  2IMW P;  3WKA A;  3QU4 A;  1N2X A;  1S8O A;  1D8L A;  1SKS A;  9ICV A;  3Q8S B;  4M04 A;  3RBE A;  2DPJ A;  4M6W B;  3JPN A;  3R9K A;  3OTQ A;  1GO3 F;  2KIC A;  3OGU A;  3H8J A;  2W11 A;  4RNN A;  2A1A A;  2JEJ A;  5JU5 A;  4YFK A;  2QKQ A;  1ZQN A;  5AK5 A;  3GZF A;  3PR5 B;  8ICW A;  4B6J A;  4PHD A;  2E1F A;  3AL0 B;  5KT2 A;  5AKZ A;  2ISO A;  2A19 A;  2D6F C;  1JI7 A;  2F3N A;  1XC9 A;  2FJ6 A;  3GV8 B;  3RJH A;  1OW5 A;  2YQE A;  3Q8P B;  5KFP A;  3PML A;  1KTQ A;  9ICH A;  1UQV A;  3PO5 A;  2BR0 A;  1NJZ A;  3LVV A;  4XA5 A;  4FO6 A;  4XRH A;  1UHU A;  4O3O A;  4MF2 A;  1DOQ A;  2LBO A;  4YMM A;  4Y2J A;  2HHS A;  3KKA C;  4PPX A;  3ISB A;  2W55 A;  1TK8 A;  4FZM A;  2NRW A;  5KG7 A;  1ZQB A;  3UQ0 A;  2WF5 A;  3PNC A;  3GDX A;  1NK9 A;  3V7J A;  2DFL A;  4R65 A;  3KFU F;  3M1Y A;  3CP8 A;  3NVZ A;  1F0M A;  5EE1 A;  5J2C A;  2AU0 A;  5AKG A;  2KOB A;  4DEZ A;  4DL6 A;  2NRV A;  1BGX T;  4OJ5 A;  4TUQ A;  2WF8 A;  5H2F U;  2KKV A;  1N60 A;  2ALZ A;  2EH9 A;  1PZN A;  2ZIU A;  4FBU A;  2ZIW B;  4UB8 U;  4IQU A;  4FE3 A;  4IR9 A;  4KLF A;  5DDM A;  2HOF A;  2Y9T A;  1L8O A;  3PMN A;  3N7P D;  4DWI A;  3JPS A;  3M8S A;  5B5E U;  3BQ0 A;  3BS5 A;  5HNK A;  3IG8 A;  1ZQF A;  2P66 A;  1Q46 A;  2QLT A;  1NJX A;  1TKD A;  2UVV A;  4KLL A;  3G6X A;  8ICB A;  5F3X B;  2ZG6 A;  4BWJ A;  5AK4 A;  3U26 A;  2XY5 A;  4XUS A;  4F4W A;  2W3R A;  2ASL A;  9ICW A;  2ZUC A;  2DKZ A;  3ZDB A;  4ZOH C;  2Y9U A;  2F8K A;  2NO5 A;  1S9F A;  5CA7 A;  3KD3 A;  5KFM A;  7ICI A;  5DB9 A;  7ICL A;  2KVS A;  1TK0 A;  2WF7 A;  2PI5 A;  2ZIX B;  1J97 A;  4EEY A;  4I2J A;  3BQ7 A;  3H8M A;  1SZP A;  4DSE A;  4C0Z A;  3RJK A;  5AI5 A;  5AK3 A;  1BNP A;  4MFF A;  3HIL A;  1D9D A;  1SKW A;  5KTQ A;  5ALW A;  4DSK A;  3DV9 A;  2NRX A;  2YML A;  2CXY A;  2EAM A;  2R8G A;  1X66 A;  3AM9 A;  4O0I A;  5DLF A;  2FPK A;  5KFK A;  1ZQC A;  1ZXI A;  1SWW A;  3LWM A;  5IIM A;  5FP0 A;  2C2R A;  3HKZ F;  5L1M A;  4NY8 A;  4NLK A;  4P0P B; 
#chains in the Genus database with same CATH homology
 4OJ5 A;  1XO0 A;  4QIW F;  2K8A A;  3AQE A;  3M7D A;  2JHD A;  2Q4T A;  2GOL A;  2H3V A;  5KL8 B;  2HOQ A;  2KKV A;  2R18 A;  2G5I B;  2MA1 A;  2A3V A;  4U6P A;  4OJ6 A;  2KD1 A;  2K89 A;  1F44 A;  2BDU A;  3H0M B;  3DEE A;  2ZIU A;  2YX8 A;  5A0L A;  4CDG A;  1P7D A;  2K4E A;  1URJ A;  2G5H B;  1HIW A;  2E5S A;  2PMZ C;  3AQF A;  4GFJ A;  1Q3U A;  2ZIW B;  4WJ3 B;  2NV3 A;  1IIP A;  2OYY A;  2WB1 F;  2KVC A;  2RRD A;  3LVW A;  2JGA A;  2ZXH A;  3NRW A;  4FE3 A;  4PL1 A;  5T14 A;  2YB4 A;  2KNJ A;  3D2N A;  2F8L A;  2WAQ F;  3ICX A;  2HOF A;  4P0Q B;  2RHF A;  2ZXI A;  4OO1 J;  1KBU A;  3C28 A;  4OJP A;  2ZIV A;  4U7C A;  2XVT A;  4ICA A;  2VIX A;  3N7P D;  2HBK A;  2HBM A;  2K8B B;  4KX5 A;  3MGV A;  5CRX A;  3M6K A;  2H3Q A;  3KZX A;  3HKZ C;  3M6Z A;  2KHQ A;  4NLB A;  4NWI A;  2XID A;  1D8B A;  2G0A A;  4AYB C;  3SAF A;  2HBL A;  1GO3 F;  3IG8 A;  2CRX A;  2KIC A;  2MRL A;  2VJ4 A;  1ECW A;  4JMU A;  2N1R A;  2Y0S C;  2Z7J A;  2GH1 A;  3ALR A;  3H0R B;  3N7R C;  2DQN B;  3F5E A;  2JMG A;  1PVP A;  3SQI A;  3RF9 A;  2K4H A;  2H3F A;  1UPH A;  2VKQ A;  2JH7 A;  3ONN A;  4QNL A;  4P0P A;  2HOI A;  2KJ8 A;  3GZF A;  4QJF B;  2ZG6 A;  1A6S A;  1ED1 A;  2CPR A;  4NLC A;  2E1F A;  2KJ5 A;  3AL0 B;  2W04 A;  5C0Y A;  2Y0S F;  4FZN A;  2KKP A;  3T79 A;  2DF4 B;  2KHV A;  2VJ5 A;  2ZIW A;  4IC9 A;  4KMO B;  3RFA A;  3C29 A;  3F2B A;  2D6F C;  2F77 X;  3SAH A;  4BX9 C;  3PZP A;  2KEY A;  4PL2 A;  3K1Z A;  4P0Q A;  3OPX A;  4QIW C;  2PMZ F;  2YB1 A;  2KJ9 A;  2K8C B;  1MA7 A;  1SZH A;  2W7O A;  1XNS A;  3CYM A;  2G07 A;  2HBJ A;  1YT3 A;  2LHT A;  2HMX A;  3GU3 A;  1ZQ1 C;  2LYB A;  4A8E A;  2KV2 A;  3LVV A;  1L6N A;  3SMV A;  2ZIX B;  2G08 A;  2G09 A;  2WB1 C;  4O3M A;  2JH1 A;  3VCB A;  1Q3V A;  2OM6 A;  2RP5 A;  2WAQ C;  2XI9 A;  2ZIU B;  3F5A A;  2LBO A;  4CRX A;  2XIC A;  3D2Q A;  5HR7 A;  3IP4 B;  4AYB F;  1Z1B A;  2W03 A;  3IG5 A;  4FZM A;  4C0Z A;  2ZIX A;  2F2A B;  2K4I A;  2KIW A;  3F2D A;  1HEK A;  4BJQ A;  2LYA A;  1WUD A;  3E0F A;  3LYS A;  3VC8 A;  2DGZ A;  2ZIV B;  3O0F A;  1PVR A;  3D2S A;  3N7S C;  3PSP A;  4BUG A;  2OXO A;  4NV0 A;  3F2C A;  2OH2 A;  2M0N A;  3KFU F;  2CN1 A;  2E1E A;  5HR6 A;  3CRX A;  1A0P A;  1T94 A;  4FZL A;  3NUQ A;  4OJL A;  3PST A;  1PVQ A;  3CP8 A;  1CRX A;  4CGZ A;  2LKY A;  1TAM A;  1OUQ A;  1DRG A;  3PSI A;  3PSF A;  2F76 X;  1NZB A;  3L3F X;  2G06 A;  3IN5 A;  2W7P A;  2H3I A;  3SAG A;  2KOB A;  4ACO A;  3F53 A;  3HKZ F;  4OJO A;  5KL1 B;  2H3Z A;  4KX3 A;  3H0L B;  1Z19 A;  4P0P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...