3HKZF

The x-ray crystal structure of rna polymerase from archaea
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MSSVYIVEEHYIPYSVAKKLLTDVIRSGGSSNLLQRTYDYLNSVEKCDAESAQKVIEELSNIVSREDVRAILASICPTTSDEVRSILVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
total genus 19
structure length 89
sequence length 89
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3hkzF02
3HKZF 4AYBF 2WB1F 2WAQF 2Y0SF 2PMZF
chains in the Genus database with same CATH superfamily
2YQEA 3G6VA 2BDUA 4QZHA 4OD0A 5IILA 4JMUA 1Z3EB 2R18A 5IIJA 2QKQA 3RJEA 5DG8A 5IINA 2HW3A 2A1AA 4XQ8A 3MR6A 5DBBA 5KAFU 2BQUA 3SYZA 1D8BA 1U47A 3NGDA 3MGIA 3PW5A 3MDCA 4EYIB 1V38A 2HHWA 3RH4A 9ICIA 4DWIA 2ZIXB 4DEZA 3MFIA 1L7OA 2LKYA 1NK7A 2KHQA 1QQ6A 2ODGA 4O0IA 5CR0A 4RUAA 3HILA 2ZG6A 2MUTB 4KX5A 1JMSA 2GH1A 4Y2RA 2WAQC 3C1YA 1ZQKA 1SXDA 5HNKA 2NRZA 3GILA 1XC9A 7ICRA 1NJWA 9ICCA 8ICLA 5KFLA 1SKRA 4I2CA 2AJQA 8ICHA 2B6GA 2D3DA 3SD7A 1ZQWA 3KHRA 2F77X 1KFTA 5J2DA 4YP3A 3F5EA 1LKYA 3JPOA 4J9SA 3RB3A 9ICEA 2EAOA 1S76D 4B9VA 2M9NA 4RQ7A 3ED5A 2KKVA 2N1RA 2OCEA 4UAZA 3WK9A 2ATLA 1JXLA 4PL2A 1Z1BA 1URJA 4NY8A 3KFUF 2EANA 1BNPA 4M9LA 2KIWA 3A0HU 3IP4B 4DL4A 2KZMA 4QZIA 4EX6A 3PZPA 1N48A 2KNJA 4E0DA 4C8LA 5J2HA 5ALFA 1L6NA 1N5XA 4DFPA 1ECWA 1YT3A 4IL6U 1UHUA 5ALIA 4O3NA 1TK5A 3N97B 2OYYA 3SR6A 5J2CA 2K4PA 1PVPA 3PSTA 2PXIA 1VDVA 2Y1IA 2KZZA 4DFMA 1EXNA 1SIJA 2MSNA 3GIJA 3JPSA 4UAVA 4Q44A 7ICPA 2OXOA 2AU0A 2FJ6A 2H3QA 3GIIA 3N7SC 1RXVA 1S77D 3UMGA 1UCVA 5KFPA 3WK5A 1TE2A 4QZGA 5J0QA 8ICBA 2Y0SC 2KSOA 1RQNA 2A19A 4DL6A 5J0OA 5J8YA 3BDPA 2F2AB 5KT5A 3PSPA 4ECRA 5DGAA 1LV5A 4RQ0A 9ICKA 1NKCA 3E58A 4QZAA 1FFUA 4US9A 5CEHA 4NXZA 1PK1B 4C8OA 3TI0A 2HBJA 3QE9Y 4I2BA 5J2FA 5AKKA 4EZ9A 4DOBA 5DQGA 2LI6A 2XCAA 5L1MA 2YMMA 2QARB 2IHMA 2W9BA 1RQLA 1F0MA 3WK7A 2G07A 3F2BA 4KLSA 1XWLA 8ICWA 2HHTA 3D2QA 4QZCA 3HKZC 3C2LA 4QWEA 1PUZA 1XNSA 3QUTA 3PO4A 4F8RA 2CN1A 2AHOB 1BPXA 2A3VA 5JTIA 4QZ9A 1NK0A 3FDSA 4M9GA 3V7JA 3UMBA 2FLNA 1TAQA 5C5JA 2LHTA 3V7KA 4JWNA 2RHFA 2FLLA 5KT2A 3EUB2 1O03A 5IIIA 1COKA 3TADA 5HP4A 4Y2XA 4KMUA 4CDGA 2GO7A 9ICLA 5L1KA 1ZQ1C 2ZJAA 3QUCA 4P4MA 2K4IA 3GFKB 5ALXA 2W54A 3H4BA 1ZQUA 2IOHA 4QZEA 3IV6A 3HT3A 4DF4A 4Y2SA 3Q8KA 4NLKA 4DCCA 4AP9A 2ZIWB 5ALSA 1CEZA 2WB1F 3RAXA 2R8GA 1TFRA 2KJ8A 4F92B 1NK4A 1NK5A 2IOFA 1JRPA 4PZOA 2WF5A 2LPEA 3OJUA 3HKZF 5J0SA 4F4WA 3GQCA 4GXIA 5AKZA 1ZQEA 3MBYA 2E5SA 1MSWD 1SWWA 2DFLA 4PGYA 1L7MA 4IR9A 4RPXA 4ECUA 5KG5A 1L8LA 2ZIXA 5DGBA 1S0VA 3GZFA 1IXRA 3KD3A 1D8YA 1U9LA 4B9MA 1ZRMA 3CRXA 3H0LB 4I2HA 4DL5A 1TKDA 4B6JA 4US8A 3TQ1A 4I2DA 2H3ZA 4QZ8A 4I2EA 4JV0A 3QZ7A 2K4EA 1RDFA 3GU3A 4ED0A 4O3OA 3KHGA 8ICZA 4B9TA 3TKAA 2YX8A 1ZQTA 3OHAA 3V6KA 2W9CA 4AYBF 4O5EA 1H38A 5AKXA 1AQ6A 3MC1A 4B9LA 1NK9A 4ED7A 4HYKA 2MA1A 3TARA 4RQ2A 3MR5A 9ICMA 5DG7A 4RPYA 5AKEA 4FZMA 3ALRA 1V85A 5CB1A 4UB3A 1B4FA 2VIXA 1ZJNA 4O5KA 3M6ZA 1L3VA 2F8KA 1YZ6A 1ZQOA 1A0PA 4NLCA 1T4GA 1IV8A 3FYHA 1S0MA 4TQSA 4UB8U 4ECWA 4EZ6A 3B0XA 3M9MB 3KZXA 4Q8FA 7ICHA 3GV5B 7ICUA 2BHNA 1HEKA 3RFAA 2BGWA 1SKWA 4EELA 2VA3A 3HX0A 5FP0A 2KK0A 2W3RA 4NLGA 4YVZA 2JHDA 5AM4A 4DSJA 2IBKA 1BPDA 2ZIVA 4TURA 2E8MA 3MFHA 2G5HB 3PX0A 1SB3C 4RT2A 1V9PA 4ECVA 1UT5A 3M7DA 4C8NA 3PX4A 8ICVA 1SZHA 2BKEA 7ICGA 4ZH4A 2PKEA 4LZDA 1ZQQA 5KFVA 3Q8PB 2PFNA 2BQRA 5DB7A 3UPQA 3B0YA 3RBEA 3SEIA 5KT3A 1VLBA 1HJPA 1QH9A 3E2EA 2JXJA 3ZD9A 4O3RA 1ZD4A 2BR0A 3AMZA 4J9KA 4OJ6A 1DRGA 1PK1A 1KFSA 9ICGA 9ICVA 5F3XB 5J0YA 4IQWA 2LM4A 4QWDA 1MQ3A 2BPCA 4DSLA 4RNOA 1MQ2A 4UARA 4I29A 9ICQA 1NKBA 4DQQA 4R66A 2KKPA 4YMNA 2K8CB 2JR5A 3NS1A 2RDJA 4FS1A 3PW7A 7ICMA 1X6IA 4Z6CA 2BCVA 5CP2A 3NUQA 4P4PA 1JX4A 4KMOB 3SI8A 2DQNB 3SAFA 2OWOA 2MRLA 3Q8LA 1M6YA 4NLBA 4F4YA 7ICEA 1F5SA 2R8HA 3TANA 1ZQIA 2E3TA 4DLGA 4FZLA 5AM2A 4C80A 4YCXA 2KE7A 1SZPA 1N62A 2OH2A 3WKBA 5KFEA 1X9MA 3JPPA 4PZNA 1SKSA 2JEJA 1U4BA 4CGZA 4F50A 2FPLA 4F4XA 3F2CA 1TVAA 1S0OA 2BCRA 2IMWP 3Q8SB 1X40A 2YB1A 3LVVA 2YN4A 4ED2A 1IG6A 4PH5A 9ICNA 4Z6DA 2W3SA 3LK9A 4EBEA 4KLLA 3TADC 2ZIWA 2AGQA 3N7RC 3I28A 2D8CA 8ICCA 4P0PA 4P0QB 5DDYA 4BUGA 3CW2C 1BNOA 2ZXHA 1ZD2P 3MDAA 3LDAA 3TFRA 3MR2A 1Z00B 3GV8B 2NRVA 4F3OA 2XI9A 2BZFA 5GTHU 4QZDA 1NJYA 3T79A 3CYMA 4BDPA 1Z19A 3H40A 2EZZA 4Z6FA 4QZBA 3C1ZA 3UMCA 5L1IA 2JEIA 2Q0ZX 1XS9D 3GV7B 3RBDA 1X42A 4RQMA 1NOMA 4MEYA 9ICBA 3H4DA 4YMOA 4DF8A 3LYSA 9ICWA 1QTMA 2AXTU 2GWSA 1JROA 1SV0A 2HVIA 5KFBA 1KRPA 4DQPA 3MR3A 4R64A 2UVRA 4QW9A 2DKZA 4ECYA 3ZDAA 5KFNA 4DL7A 1SGGA 2P6UA 4IR1A 2KP7A 8ICXA 1X9SA 4Q43A 4ELUA 5CJ7A 1J2NA 4MHVA 8ICGA 4MEXA 4X5VA 4JWMA 1TAUA 4ELVA 5D49A 2RDIA 2VJ4A 3SV4A 2K4HA 4CNQA 3L3FX 4OJPA 5KFDA 3KBBA 3SV3A 1Z1VA 1AROP 5J0TA 4M47A 2ZJ8A 4CE6A 3JPRA 1K1QA 2GOLA 5D46A 4DSEA 2G0AA 2R8JA 4YR0A 3HW8A 5KFRA 2NRXA 3WKDA 7ICIA 1C20A 3M1YA 2Y1JA 1QSLA 1S97A 4EBDA 4UATA 8ICRA 5J0PA 3M9OB 1X66A 3WK8A 1ZQCA 4C4TA 3B9JA 2C2DA 2EAMA 1XO1A 4DOAA 3ZDBA 2PFPA 1D9DA 2K89A 4KLHA 4F2RA 4Q8EA 5ALTA 4CF4A 5C0YA 3JPTA 5KFWA 4PHPA 2XY6A 2OHFA 4BWJA 8ICEA 7ICQA 4IQTA 4RQ4A 3OJSA 4ECSA 1ED1A 5AI5A 3T5JA 3WKAA 8ICQA 2WAQF 4PHAA 4M2YA 1OW5A 4NL9C 5IIKA 3WK4A 1ZQZA 2A1JA 3TACB 4YXJA 1A77A 2RLTA 2ZIUB 1QSSA 3PO5A 3RB0A 1L5UA 5AI6A 1NJZA 3BQ2A 3SMVA 3PW2A 3Q8MA 2LMRA 1MC8A 4XUSA 3V72A 4RT3A 4DSFA 2F1HA 4HAIA 5KFTA 3UQ2A 7ICKA 3OSNA 4ECZA 2HMXA 4F72A 5AK4A 8ICJA 3WKCA 1L7PA 2UVUA 1YZ7A 3KHLA 4GXKA 1TK8A 4OJ5A 5KG0A 1NK6A 3BS7A 2PMZC 1KDHA 1ZQPA 5DBAA 4JK1A 4M0AA 4Y2PA 3EW9A 5ALWA 2YMQA 2JMGA 3G6YA 1L7NA 4KN7A 2ZJ5A 4I2IA 2W9MA 3QEAZ 4OO1J 2QB0B 4LZGA 4KLIA 3WKEA 2H5XA 4PGQA 2E1EA 3UM9A 1KEJA 2FE9A 4F93B 3GIKA 4NM1A 1Y88A 3IG8A 2F76X 3WU2U 4O3PA 4ED1A 4GXJA 4IRDA 2ZTDA 5DKWA 3M8RA 4BWMA 2HHXA 4IS7A 3OTQA 4P2HA 3RTVA 2EAPA 3D2NA 2WFAA 9ICFA 2Y0SF 4YFKA 3TFSA 4PHDA 3N4MB 3C2KA 2VANA 2KZ3A 1HIWA 3PR5B 1GO3F 5KFCA 5KG3A 1T7PA 3PNCA 4MFFA 3LVWA 4DL3A 1KSPA 2F8LA 4I2GA 4KLEA 5AM3A 5KFXA 2ISOA 4FFDA 4DL2A 2W43A 1CI4A 3HWTA 2MAXA 1KL9A 4I27A 3WK6A 3KOOA 5KAIU 3I76A 1QQ5A 3MGHA 3EPGA 4IRKA 2OEHA 7ICLA 2BPGA 5KFKA 4EBCA 1BPBA 4U6PA 1ZD3A 1X6JA 1Q3VA 2KJ5A 4ECXA 3RR7A 5AI9A 3F5AA 1RPLA 5ALEA 4I28A 4RQ1A 9ICUA 2V9WA 1DGJA 1KBUA 2DUYA 3ONNA 1U49A 5J0WA 4R63A 4TUPA 1KW4A 2AGOA 3UXNA 1JI7A 3T5KA 1ZQHA 5KT4A 1TK0A 3ISBA 1C7YA 2KD1A 4EEKA 2K8BB 1ZQRA 3BZCA 4C7YA 2JZBB 1N61A 4RPZA 2J6UA 4KLQA 3PSFA 4NV0A 8ICTA 2MUTA 3RH6A 5E79U 9ICHA 1UT8A 1SV0C 3PR4A 2JV3A 1BVSA 3GDXA 4DFDA 2O6KA 1NNLA 4M6WB 1V97A 4DS5A 3NTUA 7ICFA 4PHEA 4J9NA 9ICTA 2LBOA 3DEEA 2KG5A 3ETRA 4TUQA 2H3FA 4IRCA 1U45A 1KKXA 3SAHA 4PJ0U 2DL0A 2D6FC 2JGAA 4EENA 3ICXA 4FO6A 4XRHA 4O3MA 1O08A 2KFZA 4QIWC 3RAQA 4NLZA 3D6JA 2J6TA 7ICOA 4YR2A 2LYHA 1SL0A 1ZRNA 2WHEA 4GFJA 2C28A 4F5NA 3BS5B 1P7DA 2P66A 8ICFA 2JRZA 8ICOA 2BDPA 2CXYA 1ZJMA 3H8JA 3NVVA 5EOZA 2AGPA 2HI0A 5CWRA 3BQ0A 2LYBA 2BPFA 4UAWA 1ZQXA 1PZNA 4FBTA 2Y9TA 4NWIA 3C5FA 2C2EA 2Z7JA 5J0RA 5KL8B 3DDHA 2VA8A 3T5LA 4FE3A 2HHVA 3RRHA 4G3IA 2ZIUA 2K60A 2HOIA 8ICPA 4DOCA 3L4PA 3LWMA 5AKLA 3RB6A 2EDUA 3QU2A 2H3VA 2HHUA 4QWCA 4KLFA 1X9WA 5HR6A 4EYHB 3N28A 4KTQA 2FMSA 2IHNA 1DK3A 4MFCA 1COOA 5J0UA 3THVA 5H2FU 2DF4B 4O3SA 4FS2A 2Y9UA 5EE0A 4LJXA 4DO9A 4WJ3B 5DQIA 4C8MA 5ALYA 3H8MA 3V6JA 5AI8A 3QX7A 2F3NA 4F5RA 4F4ZA 1JN3A 3QEBZ 5JRTA 3RJGA 1T94A 3H0MB 3QNMA 1RG6A 1QLNA 1ZQSA 1KFDA 3RJFA 2QARA 3RJHA 3IHQB 3O0FA 2XGQA 2KEYA 5CRXA 5KFQA 4DFKA 3T5HA 5J8YC 3ISDA 1RYRA 4CCHA 3FM9A 4KN4A 5ALUA 1RXWA 8ICYA 1UPHA 4RNMA 5DLFA 4YXMA 4UBBA 4I2JA 4ECTA 1ZQAA 3K4GA 3OGUA 1BPZA 4UAUA 4EEYA 2K8AA 4Y2UA 5ALOA 5AKYA 4M9JA 2V4RA 3U26A 2KOBA 4GLXA 4ICAA 2XICA 4F71A 2KICA 1HUOA 4QJFB 3JPNA 2AQ0A 4P4OA 1UQVA 4KLMA 1DOQA 4F4KA 5GTIU 5B66U 4TUSA 2W55A 1PK3A 3F2DA 4C0ZA 3I1YA 4Y2QA 4R8UB 4J9PA 4KX3A 5AK5A 2ISPA 5HMLA 2HCFA 4UAYA 2FI1A 1WG8A 1CRXA 4QNLA 3RJIA 3TAQA 1IM4A 2AH5A 2C2RA 1NKEA 1Z4OA 3EWAA 4QZFA 4Q45A 3NRZA 2HDOA 1ZQDA 5KNIA 5KFOA 3ZDDA 4JUZA 2HHSA 3LWLA 4PL1A 1NZPA 2NYVA 3DV9A 3QU4A 2QB1A 2IA6A 1OXJA 8ICKA 3ZDCA 2JH7A 1KLNA 3VC8A 2E1FA 2P6RA 1DGSA 8ICMA 4UB1A 1DK2A 2W8LA 2ESEA 4JV2A 3SAGA 2JZBA 5T14A 5ALDA 1X9XA 3SQIA 5KFFA 2KTQA 4CRXA 1JXEA 4IC9A 5J2KA 3QXGA 4F91B 4CF3A 1QQ7A 4DLEA 1WCLA 2GLEA 3IM1A 3K1RB 2EQYA 2FPKA 2WF7A 5AKGA 1SL2A 2KV2A 4UASA 1U48A 4M6WA 4KLGA 2ZUDA 5ALZA 8ICUA 3SZ2A 4YMMA 4GIBA 5AK3A 4UW9A 1Q46A 1JIHA 3IDWA 2UVWA 1SV4A 2EZYA 4U7CA 2W03A 4K4GA 4LVSA 1N5WA 4R65A 5DDMA 1B0XA 4RQ6A 3EZ5A 4BXOB 3TAPA 4KLOA 3ZD8A 2KVSA 3UXPA 4M9HA 2NO5A 3H0RB 3BS5A 2DBYA 4QWAA 7ICTA 1CUKA 1KTQA 2LYAA 5J2GA 2W04A 2YTUA 4KLTA 4USAA 4J9RA 1TAMA 9ICOA 4J9LA 1OUQA 1LB2B 5DG9A 2OM6A 4YD1A 5F9LA 3RJKA 4C4SA 3HRDD 5ALHA 4J9OA 2YY6A 3PVXA 5IIMA 3RJJA 3ISCA 3M8SA 2W9CB 3KTQA 4Y2VA 3AQEA 5ALNA 2CRXA 5A0LA 3HJEA 2KHVA 2KN7A 4YD2A 1PVQA 4B9SA 2R8KA 1N2XA 1WCNA 5BPCA 5CA7A 2JH1A 2ASLA 4J9QA 2ASDA 1ZQMA 2LM1A 1IIPA 4RQ5A 2HSZA 3Q8QB 4DQIA 2NRWA 1WUDA 5D4BA 5KT6A 3C5GA 5L9XA 4O3QA 4YQWA 5AM1A 5IIOA 4DQRA 2ES6A 3NASA 1T3QA 3UQ0A 3AL0B 3AQFA 2W7OA 2DPJA 3K75D 2Q4TA 3AU2A 2KFNA 2V4QA 2PFQA 4B9NA 1K5OA 2JEGA 2HBKA 3C28A 5KFSA 1XO0A 4O9MA 2P35A 2ZIVB 1ZQLA 2UVVA 3C23A 3R9KA 2W11A 3F53A 3KKAA 2E8OA 4RQNA 3NVWA 5KL1B 5AKIA 2W8KA 4JV1A 5TISU 1SWVA 2ZTCA 2G06A 4DS4A 4MF2A 3CP8A 4GC6A 3QUQA 4GC7A 4C7ZA 5KFIA 4K4HA 2F44A 2I5HA 1SXEA 2R8IA 8ICIA 2IOFK 2VKQA 2H3IA 1WWUA 5KG7A 1MN8A 5KFHA 2CPRA 4R8UA 4KITB 3AUOA 2PI4A 4NM2A 2AQ4A 2WB1C 1N60A 3S6JA 4DQSA 2PFOA 9ICPA 4IQVA 1FEZA 2FMPA 1Q3UA 5AM0A 2XGPA 1WYGA 1FO4A 7ICSA 5EWGA 8ICSA 3AU6A 1ZETA 3V7LA 5HHHA 2BCSA 4RU9A 3AN1A 4P0QA 2J6SA 1ZQYA 5F9NA 3ZDEA 4F5OA 4B9UA 5J2EA 3C29A 2I6XA 5EWEA 1JALA 5KG6A 1Z00A 1Q8KA 3BZKA 2RRDA 5ALPA 5L1JA 3MABA 4XA5A 5G5HA 4J9MA 2PMZF 2B0CA 3OHBA 4ZOHC 4DSIA 4YR3A 4I2FA 4BX9C 5KG1A 4TQRA 1ZQGA 2G08A 3NVYA 5EE1A 9ICXA 4FZNA 1Z4NA 1NJXA 1XU4A 1ZXIA 5AHXA 2DGZA 5DB6A 3M9NB 3G6XA 3A0BU 3QZ8A 4F2SA 1L3TA 2HBMA 4Y2YA 4A8EA 1X2IA 3QU7A 1BPYA 4AYBC 2FMQA 4CF5A 4P0PB 5AK6A 1ZQFA 5BOMA 5J0XA 1FIQA 3GIMA 3QU5A 2BCUA 5B5EU 4RQ3A 2RQ5A 1PVRA 4IQUA 4ELTA 3QU9A 5EE9A 1TV9A 4C8KA 3C21A 5J29A 2XO7A 1S9FA 5ALQA 2WF9A 4YG2A 5G5GA 5HHIA 3HPOA 9ICAA 1S0NA 2W7PA 5EWFA 4BXOA 1NK8A 1S8OA 5ALLA 4NLNA 5ALKA 3PV8A 2I1QA 2ZUCA 1BPEA 2WF8A 5J2JA 1S10A 5BOLA 5AIBA 2DWQA 2HOFA 2XY7A 2YB4A 2F1IA 1UA1A 2ZTEA 4RQ8A 2KJ9A 2I9GA 3CNHA 9ICRA 4Y2JA 1D9FA 3PY8A 3FAHA 3PMLA 1T3NA 2FDRA 5J2AA 5KT7A 2FLPA 4JB3A 4UB5A 2VJ5A 2JEFA 5L1LA 9ICJA 1NI3A 5KFAA 2NRTA 4PGXA 3J81j 3PW0A 3IRUA 5KFUA 1KQQA 3BQ1A 5EE3A 1RM6C 2XIDA 1T8EA 1BGXT 3IN5A 2ZXIA 4I2AA 7ICNA 2WF6A 2KMDA 3JPQA 2XY5A 3VCBA 3OSPA 5ALMA 3SENA 4QWBA 5J2BA 1D8LA 5AM5A 3D2SA 1A6SA 3KHHA 5ALGA 3PX6A 1ZQVA 3QYPA 3RH5A 1LKYB 2EZXA 4QW8A 4UQGA 2EH9A 2VA2A 4ED3A 1N63A 4Y2TA 4MFAA 3Q8RB 4K4IA 1ZQJA 4PPXA 4UB4A 1QCKA 3C2MA 3NVZA 4RUCA 5AKJA 4DFJA 5ALRA 5JU5A 4NL9A 2PI5A 3E0FA 4RNNA 2W9AA 4QIWF 2RP5A 1DXSA 5AIAA 1N56A 7ICVA 4OCZA 1VJ5A 3OPXA 5CHGA 1XSNA 5AI0A 2HBLA 5KFGA 2XC9A 1FFVA 1JUDA 1HUZA 3T3FA 5KFJA 1F44A 4BGDA 5DBCA 4C4RA 2A1JB 1B43A 4RZRA 1QSYA 2KVCA 3ETLA 1NZBA 2QLTA 3KKAC 2QB0A 1ZD5A 1J97A 2YMLA 3M6KA 5DB8A 1L3UA 3IG5A 2BCQA 7ICJA 1S5LU 3BQ7A 3RR8A 2KSOB 8ICAA 2KIVA 2ASJA 2MU2A 4F5PA 4NJ8A 2G5IB 9ICSA 5ALVA 4Z6EA 4F5QA 2DKXA 4G9BA 2BQ3A 1ZOLA 4UBCA 2XCPA 3AEVA 5DB9A 3N7PD 4EX7A 1MA7A 5DQHA 1RYUA 3FC4A 1XSPA 1A76A 4KLUA 2E8NA 4J03A 4OJLA 3UXOA 1L3SA 3RRGA 4KLJA 2HVHA 1ZYQA 4ED6A 3PW4A 1SL1A 5AKHA 5HR7A 2W9BB 1UA0A 1L8OA 5KG2A 5ALJA 3K1ZA 4UB2A 2M0NA 2HHQA 5AI4A 1J2MA 2ZUBA 2ALZA 2YMPA 4MF8A 5KFMA 1WWVA 3PMNA 5K4LA 4YN4A 2C22A 2FPMA 1XSLA 4ECQA 2NO4A 3NRWA 4FBUA 4UB6U 5TZVA 5KTQA 4KLDA 1K1SA 1RYSA 3PSIA 3V6HA 1LVHA 2L5YA 2XVTA 1KN5A 3EYZA 8ICNA 3KZIU 3H8WA 2F1JA 3QUBA 5DLGA 1B22A 2NV3A 2DPIA 4O5CA 3BJYA 2B21A 3ZI4A 4ED8A 3BQTA 2E8PA 1ZQNA 4DSKA 1ZQBA 4BJQA 4M04A 2WTFA 5JUMA 3EPIA 1RZTA 3L5KA 3MGVA 3H8SA 5AICA 5KFZA 5KG4A 3ORYA 4ACOA 2G09A 3HP6A 3RF9A 5HMMA 2HOQA 3AM9A 5J2IA 4M9NA 3RB4A 4OJOA 5KFYA 3H7IA
chains in the Genus database with same CATH topology
1CRXA 2DGZA 4QNLA 3GU3A 3VCBA 3F53A 3CYMA 3T79A 1L6NA 2BDUA 2H3VA 4OJ6A 1Z19A 4JMUA 1DRGA 1YT3A 1ECWA 2R18A 1KBUA 2YX8A 4OO1J 2HBMA 3H0RB 3N7PD 3PSFA 5KL1B 4NV0A 4A8EA 4AYBF 4CDGA 2E1EA 2OYYA 1MA7A 1ZQ1C 3IG8A 3D2SA 1D8BA 1A6SA 3AL0B 2LYAA 2K4IA 1PVPA 4AYBC 2F76X 2W04A 4P0PB 2DF4B 3PSTA 4OJLA 5HR6A 1TAMA 2MA1A 2G06A 4PL1A 1OUQA 3CP8A 2K89A 4WJ3B 5HR7A 2OXOA 4FZMA 2OM6A 3ALRA 1PVRA 2H3QA 2ZIXB 3K1ZA 5C0YA 2M0NA 3N7SC 2KKPA 2LKYA 2LBOA 2VIXA 3DEEA 2K8CB 3D2NA 2KHQA 3LYSA 3M6ZA 1XNSA 2VKQA 1A0PA 2H3IA 3KFUF 4NLCA 2Y0SF 2JH7A 2ZG6A 2ZIWB 2CPRA 1T94A 2H3FA 1ED1A 3H0MB 3AQEA 4KX5A 2CRXA 1HIWA 2Y0SC 2WAQF 2E1FA 2WB1F 3NUQA 3VC8A 5A0LA 2GH1A 1GO3F 4KMOB 2DQNB 2KJ8A 3SAFA 2W7PA 2MRLA 2KHVA 3NRWA 2KEYA 3O0FA 3SAHA 5CRXA 3LVWA 2WAQC 2WB1C 3E0FA 2D6FC 1PVQA 2JGAA 2F8LA 4QIWF 2RP5A 2F2AB 2ZIUB 3ICXA 4NLBA 3PSPA 3HKZF 3SAGA 4O3MA 2JH1A 3KZXA 3PSIA 1Q3UA 5T14A 4QIWC 1HEKA 4FZLA 3OPXA 3RFAA 2XVTA 3SMVA 2HOFA 3SQIA 2HBLA 2YB4A 2E5SA 4GFJA 2OH2A 4CRXA 4IC9A 1IIPA 1UPHA 2KJ9A 2HBJA 1P7DA 4P0QA 2NV3A 2F77X 4CGZA 2JHDA 2KV2A 3F5EA 1F44A 1WUDA 3F2CA 2K8AA 3C29A 2YB1A 3LVVA 2ZIVA 2RRDA 2G5HB 2HMXA 2ZIXA 2VJ4A 4BJQA 3GZFA 2G07A 2KKVA 2N1RA 2KOBA 3F2BA 2KVCA 2K4HA 3L3FX 4ICAA 2XICA 2KICA 2LYBA 2VJ5A 4OJPA 4U6PA 3D2QA 4QJFB 1NZBA 1Q3VA 2KJ5A 2PMZF 3M7DA 1SZHA 3M6KA 3MGVA 3HKZC 3CRXA 3F5AA 2ZIWA 4OJ5A 4PL2A 4U7CA 4NWIA 3H0LB 2W03A 2GOLA 3N7RC 3IG5A 1URJA 2PMZC 1Z1BA 2Z7JA 3AQFA 2CN1A 2G0AA 3ONNA 5KL8B 4BX9C 2W7OA 4ACOA 3F2DA 2A3VA 4P0PA 2G09A 4P0QB 4C0ZA 2KIWA 2Q4TA 2XIDA 2G08A 4BUGA 4FE3A 3IN5A 2ZXHA 3IP4B 2ZXIA 3RF9A 2HOQA 4FZNA 2HBKA 2H3ZA 4KX3A 3C28A 2JMGA 2LHTA 2ZIUA 2G5IB 3PZPA 1XO0A 2KD1A 2RHFA 2ZIVB 4OJOA 2HOIA 2K8BB 2KNJA 2K4EA 2XI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ F;  4AYB F;  2WB1 F;  2WAQ F;  2Y0S F;  2PMZ F; 
#chains in the Genus database with same CATH topology
 2YQE A;  3G6V A;  2BDU A;  4QZH A;  4OD0 A;  5IIL A;  4JMU A;  1Z3E B;  2R18 A;  5IIJ A;  2QKQ A;  3RJE A;  5DG8 A;  5IIN A;  2HW3 A;  2A1A A;  4XQ8 A;  3MR6 A;  5DBB A;  5KAF U;  2BQU A;  3SYZ A;  1D8B A;  1U47 A;  3NGD A;  3MGI A;  3PW5 A;  3MDC A;  4EYI B;  1V38 A;  2HHW A;  3RH4 A;  9ICI A;  4DWI A;  2ZIX B;  4DEZ A;  3MFI A;  1L7O A;  2LKY A;  1NK7 A;  2KHQ A;  1QQ6 A;  2ODG A;  4O0I A;  5CR0 A;  4RUA A;  3HIL A;  2ZG6 A;  2MUT B;  4KX5 A;  1JMS A;  2GH1 A;  4Y2R A;  2WAQ C;  3C1Y A;  1ZQK A;  1SXD A;  5HNK A;  2NRZ A;  3GIL A;  1XC9 A;  7ICR A;  1NJW A;  9ICC A;  8ICL A;  5KFL A;  1SKR A;  4I2C A;  2AJQ A;  8ICH A;  2B6G A;  2D3D A;  3SD7 A;  1ZQW A;  3KHR A;  2F77 X;  1KFT A;  5J2D A;  4YP3 A;  3F5E A;  1LKY A;  3JPO A;  4J9S A;  3RB3 A;  9ICE A;  2EAO A;  1S76 D;  4B9V A;  2M9N A;  4RQ7 A;  3ED5 A;  2KKV A;  2N1R A;  2OCE A;  4UAZ A;  3WK9 A;  2ATL A;  1JXL A;  4PL2 A;  1Z1B A;  1URJ A;  4NY8 A;  3KFU F;  2EAN A;  1BNP A;  4M9L A;  2KIW A;  3A0H U;  3IP4 B;  4DL4 A;  2KZM A;  4QZI A;  4EX6 A;  3PZP A;  1N48 A;  2KNJ A;  4E0D A;  4C8L A;  5J2H A;  5ALF A;  1L6N A;  1N5X A;  4DFP A;  1ECW A;  1YT3 A;  4IL6 U;  1UHU A;  5ALI A;  4O3N A;  1TK5 A;  3N97 B;  2OYY A;  3SR6 A;  5J2C A;  2K4P A;  1PVP A;  3PST A;  2PXI A;  1VDV A;  2Y1I A;  2KZZ A;  4DFM A;  1EXN A;  1SIJ A;  2MSN A;  3GIJ A;  3JPS A;  4UAV A;  4Q44 A;  7ICP A;  2OXO A;  2AU0 A;  2FJ6 A;  2H3Q A;  3GII A;  3N7S C;  1RXV A;  1S77 D;  3UMG A;  1UCV A;  5KFP A;  3WK5 A;  1TE2 A;  4QZG A;  5J0Q A;  8ICB A;  2Y0S C;  2KSO A;  1RQN A;  2A19 A;  4DL6 A;  5J0O A;  5J8Y A;  3BDP A;  2F2A B;  5KT5 A;  3PSP A;  4ECR A;  5DGA A;  1LV5 A;  4RQ0 A;  9ICK A;  1NKC A;  3E58 A;  4QZA A;  1FFU A;  4US9 A;  5CEH A;  4NXZ A;  1PK1 B;  4C8O A;  3TI0 A;  2HBJ A;  3QE9 Y;  4I2B A;  5J2F A;  5AKK A;  4EZ9 A;  4DOB A;  5DQG A;  2LI6 A;  2XCA A;  5L1M A;  2YMM A;  2QAR B;  2IHM A;  2W9B A;  1RQL A;  1F0M A;  3WK7 A;  2G07 A;  3F2B A;  4KLS A;  1XWL A;  8ICW A;  2HHT A;  3D2Q A;  4QZC A;  3HKZ C;  3C2L A;  4QWE A;  1PUZ A;  1XNS A;  3QUT A;  3PO4 A;  4F8R A;  2CN1 A;  2AHO B;  1BPX A;  2A3V A;  5JTI A;  4QZ9 A;  1NK0 A;  3FDS A;  4M9G A;  3V7J A;  3UMB A;  2FLN A;  1TAQ A;  5C5J A;  2LHT A;  3V7K A;  4JWN A;  2RHF A;  2FLL A;  5KT2 A;  3EUB 2;  1O03 A;  5III A;  1COK A;  3TAD A;  5HP4 A;  4Y2X A;  4KMU A;  4CDG A;  2GO7 A;  9ICL A;  5L1K A;  1ZQ1 C;  2ZJA A;  3QUC A;  4P4M A;  2K4I A;  3GFK B;  5ALX A;  2W54 A;  3H4B A;  1ZQU A;  2IOH A;  4QZE A;  3IV6 A;  3HT3 A;  4DF4 A;  4Y2S A;  3Q8K A;  4NLK A;  4DCC A;  4AP9 A;  2ZIW B;  5ALS A;  1CEZ A;  2WB1 F;  3RAX A;  2R8G A;  1TFR A;  2KJ8 A;  4F92 B;  1NK4 A;  1NK5 A;  2IOF A;  1JRP A;  4PZO A;  2WF5 A;  2LPE A;  3OJU A;  3HKZ F;  5J0S A;  4F4W A;  3GQC A;  4GXI A;  5AKZ A;  1ZQE A;  3MBY A;  2E5S A;  1MSW D;  1SWW A;  2DFL A;  4PGY A;  1L7M A;  4IR9 A;  4RPX A;  4ECU A;  5KG5 A;  1L8L A;  2ZIX A;  5DGB A;  1S0V A;  3GZF A;  1IXR A;  3KD3 A;  1D8Y A;  1U9L A;  4B9M A;  1ZRM A;  3CRX A;  3H0L B;  4I2H A;  4DL5 A;  1TKD A;  4B6J A;  4US8 A;  3TQ1 A;  4I2D A;  2H3Z A;  4QZ8 A;  4I2E A;  4JV0 A;  3QZ7 A;  2K4E A;  1RDF A;  3GU3 A;  4ED0 A;  4O3O A;  3KHG A;  8ICZ A;  4B9T A;  3TKA A;  2YX8 A;  1ZQT A;  3OHA A;  3V6K A;  2W9C A;  4AYB F;  4O5E A;  1H38 A;  5AKX A;  1AQ6 A;  3MC1 A;  4B9L A;  1NK9 A;  4ED7 A;  4HYK A;  2MA1 A;  3TAR A;  4RQ2 A;  3MR5 A;  9ICM A;  5DG7 A;  4RPY A;  5AKE A;  4FZM A;  3ALR A;  1V85 A;  5CB1 A;  4UB3 A;  1B4F A;  2VIX A;  1ZJN A;  4O5K A;  3M6Z A;  1L3V A;  2F8K A;  1YZ6 A;  1ZQO A;  1A0P A;  4NLC A;  1T4G A;  1IV8 A;  3FYH A;  1S0M A;  4TQS A;  4UB8 U;  4ECW A;  4EZ6 A;  3B0X A;  3M9M B;  3KZX A;  4Q8F A;  7ICH A;  3GV5 B;  7ICU A;  2BHN A;  1HEK A;  3RFA A;  2BGW A;  1SKW A;  4EEL A;  2VA3 A;  3HX0 A;  5FP0 A;  2KK0 A;  2W3R A;  4NLG A;  4YVZ A;  2JHD A;  5AM4 A;  4DSJ A;  2IBK A;  1BPD A;  2ZIV A;  4TUR A;  2E8M A;  3MFH A;  2G5H B;  3PX0 A;  1SB3 C;  4RT2 A;  1V9P A;  4ECV A;  1UT5 A;  3M7D A;  4C8N A;  3PX4 A;  8ICV A;  1SZH A;  2BKE A;  7ICG A;  4ZH4 A;  2PKE A;  4LZD A;  1ZQQ A;  5KFV A;  3Q8P B;  2PFN A;  2BQR A;  5DB7 A;  3UPQ A;  3B0Y A;  3RBE A;  3SEI A;  5KT3 A;  1VLB A;  1HJP A;  1QH9 A;  3E2E A;  2JXJ A;  3ZD9 A;  4O3R A;  1ZD4 A;  2BR0 A;  3AMZ A;  4J9K A;  4OJ6 A;  1DRG A;  1PK1 A;  1KFS A;  9ICG A;  9ICV A;  5F3X B;  5J0Y A;  4IQW A;  2LM4 A;  4QWD A;  1MQ3 A;  2BPC A;  4DSL A;  4RNO A;  1MQ2 A;  4UAR A;  4I29 A;  9ICQ A;  1NKB A;  4DQQ A;  4R66 A;  2KKP A;  4YMN A;  2K8C B;  2JR5 A;  3NS1 A;  2RDJ A;  4FS1 A;  3PW7 A;  7ICM A;  1X6I A;  4Z6C A;  2BCV A;  5CP2 A;  3NUQ A;  4P4P A;  1JX4 A;  4KMO B;  3SI8 A;  2DQN B;  3SAF A;  2OWO A;  2MRL A;  3Q8L A;  1M6Y A;  4NLB A;  4F4Y A;  7ICE A;  1F5S A;  2R8H A;  3TAN A;  1ZQI A;  2E3T A;  4DLG A;  4FZL A;  5AM2 A;  4C80 A;  4YCX A;  2KE7 A;  1SZP A;  1N62 A;  2OH2 A;  3WKB A;  5KFE A;  1X9M A;  3JPP A;  4PZN A;  1SKS A;  2JEJ A;  1U4B A;  4CGZ A;  4F50 A;  2FPL A;  4F4X A;  3F2C A;  1TVA A;  1S0O A;  2BCR A;  2IMW P;  3Q8S B;  1X40 A;  2YB1 A;  3LVV A;  2YN4 A;  4ED2 A;  1IG6 A;  4PH5 A;  9ICN A;  4Z6D A;  2W3S A;  3LK9 A;  4EBE A;  4KLL A;  3TAD C;  2ZIW A;  2AGQ A;  3N7R C;  3I28 A;  2D8C A;  8ICC A;  4P0P A;  4P0Q B;  5DDY A;  4BUG A;  3CW2 C;  1BNO A;  2ZXH A;  1ZD2 P;  3MDA A;  3LDA A;  3TFR A;  3MR2 A;  1Z00 B;  3GV8 B;  2NRV A;  4F3O A;  2XI9 A;  2BZF A;  5GTH U;  4QZD A;  1NJY A;  3T79 A;  3CYM A;  4BDP A;  1Z19 A;  3H40 A;  2EZZ A;  4Z6F A;  4QZB A;  3C1Z A;  3UMC A;  5L1I A;  2JEI A;  2Q0Z X;  1XS9 D;  3GV7 B;  3RBD A;  1X42 A;  4RQM A;  1NOM A;  4MEY A;  9ICB A;  3H4D A;  4YMO A;  4DF8 A;  3LYS A;  9ICW A;  1QTM A;  2AXT U;  2GWS A;  1JRO A;  1SV0 A;  2HVI A;  5KFB A;  1KRP A;  4DQP A;  3MR3 A;  4R64 A;  2UVR A;  4QW9 A;  2DKZ A;  4ECY A;  3ZDA A;  5KFN A;  4DL7 A;  1SGG A;  2P6U A;  4IR1 A;  2KP7 A;  8ICX A;  1X9S A;  4Q43 A;  4ELU A;  5CJ7 A;  1J2N A;  4MHV A;  8ICG A;  4MEX A;  4X5V A;  4JWM A;  1TAU A;  4ELV A;  5D49 A;  2RDI A;  2VJ4 A;  3SV4 A;  2K4H A;  4CNQ A;  3L3F X;  4OJP A;  5KFD A;  3KBB A;  3SV3 A;  1Z1V A;  1ARO P;  5J0T A;  4M47 A;  2ZJ8 A;  4CE6 A;  3JPR A;  1K1Q A;  2GOL A;  5D46 A;  4DSE A;  2G0A A;  2R8J A;  4YR0 A;  3HW8 A;  5KFR A;  2NRX A;  3WKD A;  7ICI A;  1C20 A;  3M1Y A;  2Y1J A;  1QSL A;  1S97 A;  4EBD A;  4UAT A;  8ICR A;  5J0P A;  3M9O B;  1X66 A;  3WK8 A;  1ZQC A;  4C4T A;  3B9J A;  2C2D A;  2EAM A;  1XO1 A;  4DOA A;  3ZDB A;  2PFP A;  1D9D A;  2K89 A;  4KLH A;  4F2R A;  4Q8E A;  5ALT A;  4CF4 A;  5C0Y A;  3JPT A;  5KFW A;  4PHP A;  2XY6 A;  2OHF A;  4BWJ A;  8ICE A;  7ICQ A;  4IQT A;  4RQ4 A;  3OJS A;  4ECS A;  1ED1 A;  5AI5 A;  3T5J A;  3WKA A;  8ICQ A;  2WAQ F;  4PHA A;  4M2Y A;  1OW5 A;  4NL9 C;  5IIK A;  3WK4 A;  1ZQZ A;  2A1J A;  3TAC B;  4YXJ A;  1A77 A;  2RLT A;  2ZIU B;  1QSS A;  3PO5 A;  3RB0 A;  1L5U A;  5AI6 A;  1NJZ A;  3BQ2 A;  3SMV A;  3PW2 A;  3Q8M A;  2LMR A;  1MC8 A;  4XUS A;  3V72 A;  4RT3 A;  4DSF A;  2F1H A;  4HAI A;  5KFT A;  3UQ2 A;  7ICK A;  3OSN A;  4ECZ A;  2HMX A;  4F72 A;  5AK4 A;  8ICJ A;  3WKC A;  1L7P A;  2UVU A;  1YZ7 A;  3KHL A;  4GXK A;  1TK8 A;  4OJ5 A;  5KG0 A;  1NK6 A;  3BS7 A;  2PMZ C;  1KDH A;  1ZQP A;  5DBA A;  4JK1 A;  4M0A A;  4Y2P A;  3EW9 A;  5ALW A;  2YMQ A;  2JMG A;  3G6Y A;  1L7N A;  4KN7 A;  2ZJ5 A;  4I2I A;  2W9M A;  3QEA Z;  4OO1 J;  2QB0 B;  4LZG A;  4KLI A;  3WKE A;  2H5X A;  4PGQ A;  2E1E A;  3UM9 A;  1KEJ A;  2FE9 A;  4F93 B;  3GIK A;  4NM1 A;  1Y88 A;  3IG8 A;  2F76 X;  3WU2 U;  4O3P A;  4ED1 A;  4GXJ A;  4IRD A;  2ZTD A;  5DKW A;  3M8R A;  4BWM A;  2HHX A;  4IS7 A;  3OTQ A;  4P2H A;  3RTV A;  2EAP A;  3D2N A;  2WFA A;  9ICF A;  2Y0S F;  4YFK A;  3TFS A;  4PHD A;  3N4M B;  3C2K A;  2VAN A;  2KZ3 A;  1HIW A;  3PR5 B;  1GO3 F;  5KFC A;  5KG3 A;  1T7P A;  3PNC A;  4MFF A;  3LVW A;  4DL3 A;  1KSP A;  2F8L A;  4I2G A;  4KLE A;  5AM3 A;  5KFX A;  2ISO A;  4FFD A;  4DL2 A;  2W43 A;  1CI4 A;  3HWT A;  2MAX A;  1KL9 A;  4I27 A;  3WK6 A;  3KOO A;  5KAI U;  3I76 A;  1QQ5 A;  3MGH A;  3EPG A;  4IRK A;  2OEH A;  7ICL A;  2BPG A;  5KFK A;  4EBC A;  1BPB A;  4U6P A;  1ZD3 A;  1X6J A;  1Q3V A;  2KJ5 A;  4ECX A;  3RR7 A;  5AI9 A;  3F5A A;  1RPL A;  5ALE A;  4I28 A;  4RQ1 A;  9ICU A;  2V9W A;  1DGJ A;  1KBU A;  2DUY A;  3ONN A;  1U49 A;  5J0W A;  4R63 A;  4TUP A;  1KW4 A;  2AGO A;  3UXN A;  1JI7 A;  3T5K A;  1ZQH A;  5KT4 A;  1TK0 A;  3ISB A;  1C7Y A;  2KD1 A;  4EEK A;  2K8B B;  1ZQR A;  3BZC A;  4C7Y A;  2JZB B;  1N61 A;  4RPZ A;  2J6U A;  4KLQ A;  3PSF A;  4NV0 A;  8ICT A;  2MUT A;  3RH6 A;  5E79 U;  9ICH A;  1UT8 A;  1SV0 C;  3PR4 A;  2JV3 A;  1BVS A;  3GDX A;  4DFD A;  2O6K A;  1NNL A;  4M6W B;  1V97 A;  4DS5 A;  3NTU A;  7ICF A;  4PHE A;  4J9N A;  9ICT A;  2LBO A;  3DEE A;  2KG5 A;  3ETR A;  4TUQ A;  2H3F A;  4IRC A;  1U45 A;  1KKX A;  3SAH A;  4PJ0 U;  2DL0 A;  2D6F C;  2JGA A;  4EEN A;  3ICX A;  4FO6 A;  4XRH A;  4O3M A;  1O08 A;  2KFZ A;  4QIW C;  3RAQ A;  4NLZ A;  3D6J A;  2J6T A;  7ICO A;  4YR2 A;  2LYH A;  1SL0 A;  1ZRN A;  2WHE A;  4GFJ A;  2C28 A;  4F5N A;  3BS5 B;  1P7D A;  2P66 A;  8ICF A;  2JRZ A;  8ICO A;  2BDP A;  2CXY A;  1ZJM A;  3H8J A;  3NVV A;  5EOZ A;  2AGP A;  2HI0 A;  5CWR A;  3BQ0 A;  2LYB A;  2BPF A;  4UAW A;  1ZQX A;  1PZN A;  4FBT A;  2Y9T A;  4NWI A;  3C5F A;  2C2E A;  2Z7J A;  5J0R A;  5KL8 B;  3DDH A;  2VA8 A;  3T5L A;  4FE3 A;  2HHV A;  3RRH A;  4G3I A;  2ZIU A;  2K60 A;  2HOI A;  8ICP A;  4DOC A;  3L4P A;  3LWM A;  5AKL A;  3RB6 A;  2EDU A;  3QU2 A;  2H3V A;  2HHU A;  4QWC A;  4KLF A;  1X9W A;  5HR6 A;  4EYH B;  3N28 A;  4KTQ A;  2FMS A;  2IHN A;  1DK3 A;  4MFC A;  1COO A;  5J0U A;  3THV A;  5H2F U;  2DF4 B;  4O3S A;  4FS2 A;  2Y9U A;  5EE0 A;  4LJX A;  4DO9 A;  4WJ3 B;  5DQI A;  4C8M A;  5ALY A;  3H8M A;  3V6J A;  5AI8 A;  3QX7 A;  2F3N A;  4F5R A;  4F4Z A;  1JN3 A;  3QEB Z;  5JRT A;  3RJG A;  1T94 A;  3H0M B;  3QNM A;  1RG6 A;  1QLN A;  1ZQS A;  1KFD A;  3RJF A;  2QAR A;  3RJH A;  3IHQ B;  3O0F A;  2XGQ A;  2KEY A;  5CRX A;  5KFQ A;  4DFK A;  3T5H A;  5J8Y C;  3ISD A;  1RYR A;  4CCH A;  3FM9 A;  4KN4 A;  5ALU A;  1RXW A;  8ICY A;  1UPH A;  4RNM A;  5DLF A;  4YXM A;  4UBB A;  4I2J A;  4ECT A;  1ZQA A;  3K4G A;  3OGU A;  1BPZ A;  4UAU A;  4EEY A;  2K8A A;  4Y2U A;  5ALO A;  5AKY A;  4M9J A;  2V4R A;  3U26 A;  2KOB A;  4GLX A;  4ICA A;  2XIC A;  4F71 A;  2KIC A;  1HUO A;  4QJF B;  3JPN A;  2AQ0 A;  4P4O A;  1UQV A;  4KLM A;  1DOQ A;  4F4K A;  5GTI U;  5B66 U;  4TUS A;  2W55 A;  1PK3 A;  3F2D A;  4C0Z A;  3I1Y A;  4Y2Q A;  4R8U B;  4J9P A;  4KX3 A;  5AK5 A;  2ISP A;  5HML A;  2HCF A;  4UAY A;  2FI1 A;  1WG8 A;  1CRX A;  4QNL A;  3RJI A;  3TAQ A;  1IM4 A;  2AH5 A;  2C2R A;  1NKE A;  1Z4O A;  3EWA A;  4QZF A;  4Q45 A;  3NRZ A;  2HDO A;  1ZQD A;  5KNI A;  5KFO A;  3ZDD A;  4JUZ A;  2HHS A;  3LWL A;  4PL1 A;  1NZP A;  2NYV A;  3DV9 A;  3QU4 A;  2QB1 A;  2IA6 A;  1OXJ A;  8ICK A;  3ZDC A;  2JH7 A;  1KLN A;  3VC8 A;  2E1F A;  2P6R A;  1DGS A;  8ICM A;  4UB1 A;  1DK2 A;  2W8L A;  2ESE A;  4JV2 A;  3SAG A;  2JZB A;  5T14 A;  5ALD A;  1X9X A;  3SQI A;  5KFF A;  2KTQ A;  4CRX A;  1JXE A;  4IC9 A;  5J2K A;  3QXG A;  4F91 B;  4CF3 A;  1QQ7 A;  4DLE A;  1WCL A;  2GLE A;  3IM1 A;  3K1R B;  2EQY A;  2FPK A;  2WF7 A;  5AKG A;  1SL2 A;  2KV2 A;  4UAS A;  1U48 A;  4M6W A;  4KLG A;  2ZUD A;  5ALZ A;  8ICU A;  3SZ2 A;  4YMM A;  4GIB A;  5AK3 A;  4UW9 A;  1Q46 A;  1JIH A;  3IDW A;  2UVW A;  1SV4 A;  2EZY A;  4U7C A;  2W03 A;  4K4G A;  4LVS A;  1N5W A;  4R65 A;  5DDM A;  1B0X A;  4RQ6 A;  3EZ5 A;  4BXO B;  3TAP A;  4KLO A;  3ZD8 A;  2KVS A;  3UXP A;  4M9H A;  2NO5 A;  3H0R B;  3BS5 A;  2DBY A;  4QWA A;  7ICT A;  1CUK A;  1KTQ A;  2LYA A;  5J2G A;  2W04 A;  2YTU A;  4KLT A;  4USA A;  4J9R A;  1TAM A;  9ICO A;  4J9L A;  1OUQ A;  1LB2 B;  5DG9 A;  2OM6 A;  4YD1 A;  5F9L A;  3RJK A;  4C4S A;  3HRD D;  5ALH A;  4J9O A;  2YY6 A;  3PVX A;  5IIM A;  3RJJ A;  3ISC A;  3M8S A;  2W9C B;  3KTQ A;  4Y2V A;  3AQE A;  5ALN A;  2CRX A;  5A0L A;  3HJE A;  2KHV A;  2KN7 A;  4YD2 A;  1PVQ A;  4B9S A;  2R8K A;  1N2X A;  1WCN A;  5BPC A;  5CA7 A;  2JH1 A;  2ASL A;  4J9Q A;  2ASD A;  1ZQM A;  2LM1 A;  1IIP A;  4RQ5 A;  2HSZ A;  3Q8Q B;  4DQI A;  2NRW A;  1WUD A;  5D4B A;  5KT6 A;  3C5G A;  5L9X A;  4O3Q A;  4YQW A;  5AM1 A;  5IIO A;  4DQR A;  2ES6 A;  3NAS A;  1T3Q A;  3UQ0 A;  3AL0 B;  3AQF A;  2W7O A;  2DPJ A;  3K75 D;  2Q4T A;  3AU2 A;  2KFN A;  2V4Q A;  2PFQ A;  4B9N A;  1K5O A;  2JEG A;  2HBK A;  3C28 A;  5KFS A;  1XO0 A;  4O9M A;  2P35 A;  2ZIV B;  1ZQL A;  2UVV A;  3C23 A;  3R9K A;  2W11 A;  3F53 A;  3KKA A;  2E8O A;  4RQN A;  3NVW A;  5KL1 B;  5AKI A;  2W8K A;  4JV1 A;  5TIS U;  1SWV A;  2ZTC A;  2G06 A;  4DS4 A;  4MF2 A;  3CP8 A;  4GC6 A;  3QUQ A;  4GC7 A;  4C7Z A;  5KFI A;  4K4H A;  2F44 A;  2I5H A;  1SXE A;  2R8I A;  8ICI A;  2IOF K;  2VKQ A;  2H3I A;  1WWU A;  5KG7 A;  1MN8 A;  5KFH A;  2CPR A;  4R8U A;  4KIT B;  3AUO A;  2PI4 A;  4NM2 A;  2AQ4 A;  2WB1 C;  1N60 A;  3S6J A;  4DQS A;  2PFO A;  9ICP A;  4IQV A;  1FEZ A;  2FMP A;  1Q3U A;  5AM0 A;  2XGP A;  1WYG A;  1FO4 A;  7ICS A;  5EWG A;  8ICS A;  3AU6 A;  1ZET A;  3V7L A;  5HHH A;  2BCS A;  4RU9 A;  3AN1 A;  4P0Q A;  2J6S A;  1ZQY A;  5F9N A;  3ZDE A;  4F5O A;  4B9U A;  5J2E A;  3C29 A;  2I6X A;  5EWE A;  1JAL A;  5KG6 A;  1Z00 A;  1Q8K A;  3BZK A;  2RRD A;  5ALP A;  5L1J A;  3MAB A;  4XA5 A;  5G5H A;  4J9M A;  2PMZ F;  2B0C A;  3OHB A;  4ZOH C;  4DSI A;  4YR3 A;  4I2F A;  4BX9 C;  5KG1 A;  4TQR A;  1ZQG A;  2G08 A;  3NVY A;  5EE1 A;  9ICX A;  4FZN A;  1Z4N A;  1NJX A;  1XU4 A;  1ZXI A;  5AHX A;  2DGZ A;  5DB6 A;  3M9N B;  3G6X A;  3A0B U;  3QZ8 A;  4F2S A;  1L3T A;  2HBM A;  4Y2Y A;  4A8E A;  1X2I A;  3QU7 A;  1BPY A;  4AYB C;  2FMQ A;  4CF5 A;  4P0P B;  5AK6 A;  1ZQF A;  5BOM A;  5J0X A;  1FIQ A;  3GIM A;  3QU5 A;  2BCU A;  5B5E U;  4RQ3 A;  2RQ5 A;  1PVR A;  4IQU A;  4ELT A;  3QU9 A;  5EE9 A;  1TV9 A;  4C8K A;  3C21 A;  5J29 A;  2XO7 A;  1S9F A;  5ALQ A;  2WF9 A;  4YG2 A;  5G5G A;  5HHI A;  3HPO A;  9ICA A;  1S0N A;  2W7P A;  5EWF A;  4BXO A;  1NK8 A;  1S8O A;  5ALL A;  4NLN A;  5ALK A;  3PV8 A;  2I1Q A;  2ZUC A;  1BPE A;  2WF8 A;  5J2J A;  1S10 A;  5BOL A;  5AIB A;  2DWQ A;  2HOF A;  2XY7 A;  2YB4 A;  2F1I A;  1UA1 A;  2ZTE A;  4RQ8 A;  2KJ9 A;  2I9G A;  3CNH A;  9ICR A;  4Y2J A;  1D9F A;  3PY8 A;  3FAH A;  3PML A;  1T3N A;  2FDR A;  5J2A A;  5KT7 A;  2FLP A;  4JB3 A;  4UB5 A;  2VJ5 A;  2JEF A;  5L1L A;  9ICJ A;  1NI3 A;  5KFA A;  2NRT A;  4PGX A;  3J81 j;  3PW0 A;  3IRU A;  5KFU A;  1KQQ A;  3BQ1 A;  5EE3 A;  1RM6 C;  2XID A;  1T8E A;  1BGX T;  3IN5 A;  2ZXI A;  4I2A A;  7ICN A;  2WF6 A;  2KMD A;  3JPQ A;  2XY5 A;  3VCB A;  3OSP A;  5ALM A;  3SEN A;  4QWB A;  5J2B A;  1D8L A;  5AM5 A;  3D2S A;  1A6S A;  3KHH A;  5ALG A;  3PX6 A;  1ZQV A;  3QYP A;  3RH5 A;  1LKY B;  2EZX A;  4QW8 A;  4UQG A;  2EH9 A;  2VA2 A;  4ED3 A;  1N63 A;  4Y2T A;  4MFA A;  3Q8R B;  4K4I A;  1ZQJ A;  4PPX A;  4UB4 A;  1QCK A;  3C2M A;  3NVZ A;  4RUC A;  5AKJ A;  4DFJ A;  5ALR A;  5JU5 A;  4NL9 A;  2PI5 A;  3E0F A;  4RNN A;  2W9A A;  4QIW F;  2RP5 A;  1DXS A;  5AIA A;  1N56 A;  7ICV A;  4OCZ A;  1VJ5 A;  3OPX A;  5CHG A;  1XSN A;  5AI0 A;  2HBL A;  5KFG A;  2XC9 A;  1FFV A;  1JUD A;  1HUZ A;  3T3F A;  5KFJ A;  1F44 A;  4BGD A;  5DBC A;  4C4R A;  2A1J B;  1B43 A;  4RZR A;  1QSY A;  2KVC A;  3ETL A;  1NZB A;  2QLT A;  3KKA C;  2QB0 A;  1ZD5 A;  1J97 A;  2YML A;  3M6K A;  5DB8 A;  1L3U A;  3IG5 A;  2BCQ A;  7ICJ A;  1S5L U;  3BQ7 A;  3RR8 A;  2KSO B;  8ICA A;  2KIV A;  2ASJ A;  2MU2 A;  4F5P A;  4NJ8 A;  2G5I B;  9ICS A;  5ALV A;  4Z6E A;  4F5Q A;  2DKX A;  4G9B A;  2BQ3 A;  1ZOL A;  4UBC A;  2XCP A;  3AEV A;  5DB9 A;  3N7P D;  4EX7 A;  1MA7 A;  5DQH A;  1RYU A;  3FC4 A;  1XSP A;  1A76 A;  4KLU A;  2E8N A;  4J03 A;  4OJL A;  3UXO A;  1L3S A;  3RRG A;  4KLJ A;  2HVH A;  1ZYQ A;  4ED6 A;  3PW4 A;  1SL1 A;  5AKH A;  5HR7 A;  2W9B B;  1UA0 A;  1L8O A;  5KG2 A;  5ALJ A;  3K1Z A;  4UB2 A;  2M0N A;  2HHQ A;  5AI4 A;  1J2M A;  2ZUB A;  2ALZ A;  2YMP A;  4MF8 A;  5KFM A;  1WWV A;  3PMN A;  5K4L A;  4YN4 A;  2C22 A;  2FPM A;  1XSL A;  4ECQ A;  2NO4 A;  3NRW A;  4FBU A;  4UB6 U;  5TZV A;  5KTQ A;  4KLD A;  1K1S A;  1RYS A;  3PSI A;  3V6H A;  1LVH A;  2L5Y A;  2XVT A;  1KN5 A;  3EYZ A;  8ICN A;  3KZI U;  3H8W A;  2F1J A;  3QUB A;  5DLG A;  1B22 A;  2NV3 A;  2DPI A;  4O5C A;  3BJY A;  2B21 A;  3ZI4 A;  4ED8 A;  3BQT A;  2E8P A;  1ZQN A;  4DSK A;  1ZQB A;  4BJQ A;  4M04 A;  2WTF A;  5JUM A;  3EPI A;  1RZT A;  3L5K A;  3MGV A;  3H8S A;  5AIC A;  5KFZ A;  5KG4 A;  3ORY A;  4ACO A;  2G09 A;  3HP6 A;  3RF9 A;  5HMM A;  2HOQ A;  3AM9 A;  5J2I A;  4M9N A;  3RB4 A;  4OJO A;  5KFY A;  3H7I A; 
#chains in the Genus database with same CATH homology
 1CRX A;  2DGZ A;  4QNL A;  3GU3 A;  3VCB A;  3F53 A;  3CYM A;  3T79 A;  1L6N A;  2BDU A;  2H3V A;  4OJ6 A;  1Z19 A;  4JMU A;  1DRG A;  1YT3 A;  1ECW A;  2R18 A;  1KBU A;  2YX8 A;  4OO1 J;  2HBM A;  3H0R B;  3N7P D;  3PSF A;  5KL1 B;  4NV0 A;  4A8E A;  4AYB F;  4CDG A;  2E1E A;  2OYY A;  1MA7 A;  1ZQ1 C;  3IG8 A;  3D2S A;  1D8B A;  1A6S A;  3AL0 B;  2LYA A;  2K4I A;  1PVP A;  4AYB C;  2F76 X;  2W04 A;  4P0P B;  2DF4 B;  3PST A;  4OJL A;  5HR6 A;  1TAM A;  2MA1 A;  2G06 A;  4PL1 A;  1OUQ A;  3CP8 A;  2K89 A;  4WJ3 B;  5HR7 A;  2OXO A;  4FZM A;  2OM6 A;  3ALR A;  1PVR A;  2H3Q A;  2ZIX B;  3K1Z A;  5C0Y A;  2M0N A;  3N7S C;  2KKP A;  2LKY A;  2LBO A;  2VIX A;  3DEE A;  2K8C B;  3D2N A;  2KHQ A;  3LYS A;  3M6Z A;  1XNS A;  2VKQ A;  1A0P A;  2H3I A;  3KFU F;  4NLC A;  2Y0S F;  2JH7 A;  2ZG6 A;  2ZIW B;  2CPR A;  1T94 A;  2H3F A;  1ED1 A;  3H0M B;  3AQE A;  4KX5 A;  2CRX A;  1HIW A;  2Y0S C;  2WAQ F;  2E1F A;  2WB1 F;  3NUQ A;  3VC8 A;  5A0L A;  2GH1 A;  1GO3 F;  4KMO B;  2DQN B;  2KJ8 A;  3SAF A;  2W7P A;  2MRL A;  2KHV A;  3NRW A;  2KEY A;  3O0F A;  3SAH A;  5CRX A;  3LVW A;  2WAQ C;  2WB1 C;  3E0F A;  2D6F C;  1PVQ A;  2JGA A;  2F8L A;  4QIW F;  2RP5 A;  2F2A B;  2ZIU B;  3ICX A;  4NLB A;  3PSP A;  3HKZ F;  3SAG A;  4O3M A;  2JH1 A;  3KZX A;  3PSI A;  1Q3U A;  5T14 A;  4QIW C;  1HEK A;  4FZL A;  3OPX A;  3RFA A;  2XVT A;  3SMV A;  2HOF A;  3SQI A;  2HBL A;  2YB4 A;  2E5S A;  4GFJ A;  2OH2 A;  4CRX A;  4IC9 A;  1IIP A;  1UPH A;  2KJ9 A;  2HBJ A;  1P7D A;  4P0Q A;  2NV3 A;  2F77 X;  4CGZ A;  2JHD A;  2KV2 A;  3F5E A;  1F44 A;  1WUD A;  3F2C A;  2K8A A;  3C29 A;  2YB1 A;  3LVV A;  2ZIV A;  2RRD A;  2G5H B;  2HMX A;  2ZIX A;  2VJ4 A;  4BJQ A;  3GZF A;  2G07 A;  2KKV A;  2N1R A;  2KOB A;  3F2B A;  2KVC A;  2K4H A;  3L3F X;  4ICA A;  2XIC A;  2KIC A;  2LYB A;  2VJ5 A;  4OJP A;  4U6P A;  3D2Q A;  4QJF B;  1NZB A;  1Q3V A;  2KJ5 A;  2PMZ F;  3M7D A;  1SZH A;  3M6K A;  3MGV A;  3HKZ C;  3CRX A;  3F5A A;  2ZIW A;  4OJ5 A;  4PL2 A;  4U7C A;  4NWI A;  3H0L B;  2W03 A;  2GOL A;  3N7R C;  3IG5 A;  1URJ A;  2PMZ C;  1Z1B A;  2Z7J A;  3AQF A;  2CN1 A;  2G0A A;  3ONN A;  5KL8 B;  4BX9 C;  2W7O A;  4ACO A;  3F2D A;  2A3V A;  4P0P A;  2G09 A;  4P0Q B;  4C0Z A;  2KIW A;  2Q4T A;  2XID A;  2G08 A;  4BUG A;  4FE3 A;  3IN5 A;  2ZXH A;  3IP4 B;  2ZXI A;  3RF9 A;  2HOQ A;  4FZN A;  2HBK A;  2H3Z A;  4KX3 A;  3C28 A;  2JMG A;  2LHT A;  2ZIU A;  2G5I B;  3PZP A;  1XO0 A;  2KD1 A;  2RHF A;  2ZIV B;  4OJO A;  2HOI A;  2K8B B;  2KNJ A;  2K4E A;  2XI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...