3HKZF

The x-ray crystal structure of rna polymerase from archaea
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MSSVYIVEEHYIPYSVAKKLLTDVIRSGGSSNLLQRTYDYLNSVEKCDAESAQKVIEELSNIVSREDVRAILASICPTTSDEVRSILVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
total genus 19
structure length 89
sequence length 89
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF03874 RNA_pol_Rpb4 RNA polymerase Rpb4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.820 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3hkzF02
4AYBF 2Y0SF 2WAQF 3HKZF 2PMZF 2WB1F
chains in the Genus database with same CATH superfamily
4UAWA 4Q44A 2K60A 2AH5A 3MFIA 1XS9D 1IG6A 1UHUA 2FLPA 3C1ZA 4XRHA 1V97A 1P7DA 5ALWA 3I1YA 1NJWA 1XSLA 3IRUA 1BPBA 4J9RA 1KDHA 3EZ5A 3QUTA 4UATA 4ECRA 4O3SA 4F5RA 2EQYA 2QLTA 9ICFA 5DDMA 2DKXA 4RPZA 3MGVA 3WK4A 4KTQA 4F4XA 3QX7A 3KZXA 4F71A 4TQRA 2E1FA 5DDYA 1U48A 2BPGA 2OEHA 2VJ5A 2H3VA 2UVUA 3GQCA 1ZOLA 7ICPA 3H0MB 3MDCA 3C23A 5J0RA 3TACB 4BXOA 4RU9A 2FLLA 3ALRA 5J2BA 1ZQCA 1PVPA 3C2KA 2RRDA 3PSIA 2VA8A 3DDHA 1RPLA 1T4GA 1ZQTA 4NM2A 4QW8A 1B4FA 1WWVA 5ALDA 5DQGA 4NXZA 1ZQDA 1S0VA 1QCKA 4B9MA 4UW9A 1XSNA 1VLBA 2C28A 1S0OA 2W9BA 5AI9A 3HKZF 3RBDA 2WF9A 1ZETA 1D9DA 5AHXA 1S9FA 5J0OA 3BJYA 1DGJA 1UQVA 2EDUA 2F76X 5IIIA 4KLFA 1SL2A 1X66A 5AM2A 4IS7A 5TISU 3RJKA 5CP2A 2JGAA 5IIJA 1S8OA 1PK1A 5L1IA 1ZQGA 3LWMA 2KE7A 2B0CA 3IG5A 1YZ7A 1Z00B 3MR5A 2VA2A 1ZQQA 5KFGA 1S97A 2JH1A 2EH9A 3F2DA 4DF4A 3PMLA 3B0YA 2J6TA 2H3ZA 2P35A 2FJ6A 5ALRA 2FMSA 1XNSA 2IOFK 1MQ2A 4FE3A 1S76D 2R8JA 8ICNA 1NI3A 1N5XA 2G06A 3H4BA 1Q3VA 4Y2VA 3E0FA 2EZYA 5AI5A 1Q8KA 4Z6DA 2KHQA 5TZVA 2AU0A 1NOMA 5FP0A 4YVZA 5ALGA 3PSFA 2KZ3A 5KFUA 5J0QA 2Y0SC 1NKEA 1PK1B 2BZFA 3T5JA 1JXEA 3QU4A 3OGUA 4ECVA 4KLSA 5AIAA 4DOCA 2YX8A 3BQ1A 2KNJA 2YN4A 2FI1A 1BPYA 5DB9A 4RQ4A 2BQUA 2FDRA 1JRPA 4YQWA 3PZPA 9ICJA 2LYBA 2K4IA 4TUPA 2KVSA 4AYBC 4Q43A 4UB1A 1FFUA 1SGGA 1WYGA 5ALUA 2BPCA 1TAMA 4YD1A 1TAUA 1WUDA 4F93B 2NO4A 2G0AA 5ALEA 3C5FA 4QIWC 8ICYA 2KVCA 7ICQA 2Y0SF 3A0BU 3ORYA 1URJA 1RXVA 1A6SA 4C8OA 4R63A 4QWAA 1V38A 3NVZA 4M2YA 2LI6A 3H0RB 4JV1A 4EZ6A 4CF4A 4MEYA 4BDPA 1XSPA 1MC8A 5EOZA 5KFNA 2JHDA 4DS5A 2WF7A 2KHVA 4XUSA 1N56A 4RT2A 2IHNA 5A0LA 2H5XA 2CPRA 1L3SA 3VCBA 5KFFA 2ZTDA 4KLDA 4DL6A 4Y2TA 5AK6A 2ISPA 3GV8B 2ZIVA 4P4PA 5KG6A 3CRXA 1JN3A 5AM3A 1TKDA 3U26A 4ECTA 1NK6A 4B9NA 1U9LA 4NLNA 5J8YA 2MU2A 2FPLA 3C28A 4R8UA 8ICIA 4FS1A 4O5EA 1B43A 3A0HU 3PW4A 4K4HA 3ISDA 5ALOA 3M6KA 1UA0A 3CNHA 2E8PA 3EPIA 3V7KA 4MFCA 2E8MA 3UXOA 2I1QA 4P4OA 3KZIU 5CJ7A 3TQ1A 4DF8A 2JR5A 1RYRA 2ZXHA 2XGPA 5AKXA 2FPMA 2KSOB 3TFSA 4EX7A 4JUZA 3GU3A 1OUQA 4DO9A 2E1EA 3C5GA 2JXJA 5DB6A 5GTIU 4ELVA 2E8NA 4RUCA 2XY7A 1S5LU 2B6GA 9ICGA 4ELTA 4J9QA 3M9OB 3UPQA 3SV3A 1X9XA 3D2NA 2ZIVB 3UMCA 4DFMA 2IMWP 1X6IA 5HP4A 5ALYA 3JPTA 2M9NA 2PMZC 4R8UB 5AKHA 4ECSA 2ESEA 5KFJA 3F5EA 1RQLA 4BX9C 4C8KA 1JX4A 3T5LA 4KLHA 5AM1A 3RH4A 2A3VA 4KX5A 5ALXA 2BKEA 2R8GA 2Q4TA 3FAHA 2KV2A 3ZI4A 2WHEA 4EZ9A 5L9XA 2AGPA 4RT3A 4C8NA 1YT3A 2R8IA 4NV0A 4IQTA 1NK9A 9ICLA 2KIVA 5DQIA 3RB4A 1KFSA 3LWLA 2HBKA 2K8AA 3ISBA 3QE9Y 3JPNA 4KLQA 1BPDA 3H40A 9ICKA 2V4RA 2HOFA 4FBTA 3K1RB 5AI4A 1ZD4A 2W9CA 2GWSA 4RQ7A 4C4RA 2QARA 5ALZA 2NRVA 4YMMA 5KFRA 1D9FA 1HUOA 5KFAA 4UB4A 8ICBA 1TAQA 5IILA 4TURA 1SL1A 3TANA 3OSNA 2H3FA 1D8BA 3ETLA 3QYPA 5AKZA 4TUSA 3QU9A 3RB3A 4DLGA 4DFKA 4ED7A 3Q8MA 3QUQA 4IC9A 5AKYA 3EYZA 4EBEA 5ALIA 1L7MA 2PI4A 4RQ6A 4J9SA 2HHTA 5AI6A 3M9MB 2JEIA 1K1QA 5DG7A 3WK5A 5D49A 2XY5A 4RQMA 4UBBA 5KG4A 3K4GA 3FYHA 1LB2B 2W9CB 9ICEA 3PO5A 1J97A 2QARB 1ZQHA 1U47A 5KT3A 3TADA 3MR3A 8ICMA 4F4ZA 3C2MA 9ICUA 5ALNA 4MF8A 1SIJA 1M6YA 3HT3A 2CN1A 1B0XA 3RJHA 5J8YC 1PUZA 1SKSA 1H38A 9ICMA 8ICWA 3QU7A 3LDAA 4QZDA 4Y2RA 4R64A 1ZYQA 1LVHA 3FDSA 1JI7A 4HYKA 1NZPA 3G6YA 5KT6A 3UQ2A 5CEHA 1U45A 3UXNA 3OPXA 4EYHB 1IXRA 3PVXA 4YP3A 5BPCA 3H7IA 2AXTU 1B22A 4BGDA 1KEJA 2AQ4A 4YN4A 4FS2A 4PGQA 5J0SA 5CA7A 5KFKA 3RH5A 4IL6U 3G6XA 2A1JA 1L7OA 2DWQA 3V6HA 4AP9A 4DQPA 4I2CA 3BQ0A 2NRXA 4CRXA 2HW3A 5J2HA 2F1HA 1MA7A 5AK3A 4QZ9A 1HUZA 1FO4A 3SAGA 1NJXA 4KLEA 3LYSA 1QSYA 2G07A 4RQ5A 4YR3A 2VANA 3IHQB 4DLEA 4DSEA 3PW5A 5EWGA 8ICFA 3TAPA 4OD0A 4CGZA 5EE9A 4C8LA 4F4YA 2BPFA 4JV0A 1SL0A 2P66A 1F5SA 3LVVA 1Q3UA 5HHHA 3TI0A 4I2FA 4RQ1A 8ICUA 3N28A 2KN7A 3EWAA 3HPOA 2HCFA 4XQ8A 8ICZA 5T14A 2A1JB 2LBOA 2OWOA 3GV7B 4IRDA 4FBUA 3PX6A 3HKZC 3QZ8A 5DB7A 2JMGA 5J29A 4OJ6A 3AL0B 3RJIA 4F5QA 4J9OA 3ETRA 3V6KA 4BWMA 2RDIA 2E3TA 1GO3F 3WKDA 3PSPA 4YCXA 2FE9A 8ICSA 4QJFB 1Y88A 2K8CB 3H8JA 3H8MA 4LZDA 3MGHA 3SV4A 4I2GA 1YZ6A 1PZNA 2Y9TA 5IIOA 4M9GA 5KT4A 4PGYA 4I2EA 4Z6EA 4RZRA 4US9A 4O5KA 4RPYA 3ISCA 1K1SA 2KZMA 3CW2C 3NVYA 1IV8A 2KOBA 2JEJA 2ZIXA 5JTIA 4JMUA 3T5HA 4I27A 2IOFA 1KFTA 1KBUA 4BXOB 5J2DA 4Z6FA 3E2EA 2HI0A 4PH5A 4MEXA 8ICTA 2F8LA 5CRXA 1JUDA 3OTQA 2NYVA 4PL1A 3WK9A 4M0AA 4Y2JA 2W3SA 1EXNA 3GILA 3M6ZA 5DBCA 7ICRA 4QZBA 2Y1IA 3PW2A 4Q8FA 1WCLA 4TQSA 4I28A 1DXSA 5CWRA 3KHLA 3RRGA 4PZOA 4O3RA 3I28A 5KFIA 3HW8A 5G5GA 5KFPA 4F5NA 3KD3A 3BS7A 2I6XA 3BS5A 2W9BB 1T94A 1UA1A 4FZLA 4US8A 4R66A 2RHFA 2ASLA 3C29A 2ZIXB 3KKAA 2HHUA 4B9TA 2I5HA 8ICHA 4MFAA 1L3TA 3KHHA 4GLXA 4P0PA 1DOQA 2W03A 4DFJA 3JPPA 2HHXA 2R18A 2HHWA 4I2DA 4DSIA 2DFLA 2ALZA 3RF9A 7ICKA 3GIMA 2F44A 2GH1A 1Z4NA 3MBYA 1ZQKA 4JV2A 4CCHA 4NLZA 1ZQRA 9ICVA 2MSNA 4YG2A 3PO4A 4DL2A 3UM9A 4G9BA 4DQQA 5DGAA 2EAOA 1XO1A 2GOLA 2JH7A 5ALFA 2ZG6A 3G6VA 3H0LB 1JMSA 1ED1A 1UPHA 5KAIU 1TFRA 2KIWA 3BS5B 1U49A 3HRDD 4C4SA 5DG8A 3MDAA 2IA6A 4F8RA 3GV5B 2E8OA 5CR0A 3KHGA 4B9VA 1J2MA 4KN4A 1D8LA 1MN8A 5BOLA 2WTFA 3M8RA 2NO5A 2XY6A 3UMGA 1NKCA 3BZCA 2W11A 4P0QA 1ZQOA 4B6JA 4P0PB 4JWMA 2HDOA 5DKWA 4UBCA 2VIXA 2RQ5A 1KLNA 3GZFA 3WKAA 2BR0A 4NLBA 9ICQA 5L1LA 1RG6A 2LHTA 2XO7A 5DBBA 1X42A 5L1KA 2G08A 2C2RA 3C2LA 1KSPA 1KKXA 1COKA 3MGIA 4LJXA 4UASA 7ICGA 4NL9A 4EENA 1A77A 2K4HA 3NS1A 4IQUA 9ICNA 1NKBA 1RYSA 1SB3C 3O0FA 4J9MA 2W55A 5KFXA 9ICTA 5K4LA 4J9LA 2HHVA 3SD7A 1ZQZA 5B5EU 2HMXA 1RXWA 1BPZA 5ALTA 4KLTA 1MSWD 7ICJA 4F5PA 1C7YA 1QQ5A 8ICQA 3WKBA 4DQRA 2D3DA 4CNQA 2YTUA 5J2AA 1FFVA 2BCSA 1CUKA 2LMRA 5IINA 3IP4B 5KFZA 4U7CA 4PGXA 2AJQA 4DOAA 5CB1A 5EE1A 3PR5B 2E5SA 1L8LA 2KJ8A 1JXLA 1L8OA 2DGZA 3RB0A 1LV5A 5KG5A 4J9KA 3AM9A 2YMQA 4QZHA 5KFDA 5F3XB 2OCEA 3SAFA 2QB1A 5J2IA 1RQNA 3OSPA 2WF5A 2EAMA 1HIWA 2ZUCA 3IDWA 2A1AA 1WWUA 3SENA 4M47A 5ALMA 1SWWA 4KMOB 5L1JA 3UQ0A 1Z1VA 2ODGA 1X9MA 2HHQA 4ED2A 1N61A 1N48A 3ZDBA 4UAUA 1SKRA 1ZQUA 3VC8A 4ECUA 4ED0A 4QWCA 5ALSA 1XU4A 3AQFA 3N97B 4DL7A 8ICVA 5JRTA 5B66U 4YXJA 2BCVA 4I29A 3KKAC 2B21A 1QSSA 4O5CA 2XCAA 4K4GA 4F50A 1T7PA 4ACOA 3PY8A 3RR7A 1DGSA 1F44A 1ZQLA 3ZDCA 4RQ8A 5KFSA 1UCVA 4E0DA 3GIKA 4P2HA 4UAYA 3V7JA 4IR1A 4J9NA 4FO6A 3F2BA 3V6JA 1KFDA 4M9HA 2DQNB 4EEKA 2DPJA 9ICIA 1UT8A 2KKPA 5AKEA 4UB3A 3AU2A 1A76A 4YD2A 4O3OA 3OJUA 4KLLA 1OW5A 2XVTA 1N62A 2KEYA 3SAHA 9ICAA 4NM1A 4ECXA 2F77X 1D8YA 1L7NA 2BQ3A 5KG1A 4F72A 1ZQJA 3MC1A 2DKZA 2KZZA 7ICSA 2VKQA 4EELA 5DGBA 2KFNA 2AQ0A 1NJZA 5HR7A 2HBLA 1VJ5A 2ZUBA 4JWNA 4RQ0A 2VA3A 1ZRNA 3K1ZA 3L5KA 4DL4A 3RJEA 4RQNA 3E58A 5J0WA 3NRWA 1WG8A 3GFKB 1SKWA 4Y2PA 3PR4A 7ICEA 3TKAA 2NRZA 4KMUA 1ZQAA 1C20A 1F0MA 3GIJA 1A0PA 4R65A 1NK7A 5EWFA 2KJ5A 2DL0A 4O9MA 4I2AA 4DWIA 1SXEA 4IR9A 2PXIA 3RJGA 5AK4A 4M9NA 4KLOA 4F2RA 5KFOA 3PV8A 3RAXA 1U4BA 5KTQA 3QEBZ 4DQIA 4IRKA 3SEIA 4B9SA 3H8WA 1BVSA 4DS4A 3AMZA 3RAQA 4EX6A 5J0YA 1ECWA 1KQQA 2LPEA 3PMNA 2K4PA 4K4IA 2AGQA 4RQ3A 3C1YA 5AI0A 5EE3A 5ALKA 4ZOHC 3NVVA 4QZIA 4YMOA 3LK9A 5J2FA 3Q8SB 2BCQA 4ED1A 5HMMA 1NK0A 1ZQBA 3THVA 2Z7JA 9ICSA 4DSLA 5CHGA 2ASDA 4C0ZA 1ZQFA 2XCPA 5KFYA 1NK4A 3SYZA 1CI4A 4GC6A 4NY8A 3PX0A 3JPOA 2KMDA 1AROP 2NRTA 2YMPA 2EZXA 1COOA 1FIQA 1LKYA 4O3NA 5KFWA 4QZGA 9ICRA 3FC4A 8ICCA 4HAIA 1ZRMA 2P6UA 3CYMA 3FM9A 4C7ZA 4QWEA 2XI9A 1ZJMA 3ICXA 4C80A 3IM1A 5J0UA 4QZFA 2IOHA 4FZNA 3J81j 1AQ6A 3QXGA 5KG7A 3RH6A 2YB4A 3HP6A 3M1YA 3T79A 2FMQA 3UXPA 3B9JA 1ZD5A 3RTVA 2W04A 1JIHA 3IN5A 4QZCA 3PX4A 1CEZA 2FPKA 1L5UA 1KTQA 3I76A 4O3MA 2GO7A 3QNMA 3PW0A 3WK6A 3Q8LA 4DSKA 2BCUA 1NJYA 2UVVA 2WB1F 4MHVA 4PJ0U 1NK5A 2I9GA 5J2GA 2K4EA 1PK3A 1RYUA 4DL5A 8ICKA 3RFAA 8ICRA 4OO1J 3V7LA 2UVRA 3BQ7A 3M8SA 1ZQXA 4F4KA 1LKYB 1BPXA 8ICAA 2C22A 3V72A 4DCCA 4UB5A 1NNLA 2RLTA 1S0NA 4OJPA 3EW9A 4KLGA 1TK5A 3Q8QB 2DPIA 1QH9A 1QLNA 5BOMA 4CE6A 4QWDA 1TVAA 9ICWA 3T3FA 3OHAA 4NLKA 4I2IA 4UARA 4FZMA 3N7SC 1ZQWA 4GFJA 3SMVA 1TK8A 2R8HA 5GTHU 1Z00A 5KFVA 4A8EA 4YMNA 2VJ4A 1S77D 1ZQ1C 4X5VA 7ICTA 2W7OA 4Y2YA 3PW7A 2IHMA 4U6PA 2HVIA 4Y2SA 5ALQA 5J2JA 7ICOA 5AKIA 1ZQPA 3ED5A 1Z4OA 5JU5A 2ZUDA 3JPRA 3LVWA 5L1MA 1QTMA 4OCZA 1SZHA 3Q8RB 1S0MA 2UVWA 9ICPA 5AM4A 7ICUA 3NVWA 3KHRA 5DLFA 2PFPA 3ZDDA 4F92B 2ATLA 2OXOA 3BQTA 2W8LA 3TADC 4DSJA 4QZ8A 3QU5A 1KRPA 1SV4A 3N4MB 2F1JA 2XGQA 5HR6A 2W43A 2ZJ5A 1RM6C 5DLGA 5KAFU 3ZD8A 4RPXA 5KT2A 4ECQA 3KTQA 1SZPA 2IBKA 2K89A 4PL2A 1NZBA 4PHAA 3BDPA 4Z6CA 1X40A 2BQRA 1O08A 5EE0A 5KG2A 4MF2A 1Q46A 2OYYA 2XC9A 2WF8A 5IIMA 3F2CA 5KFHA 1XWLA 2D8CA 2HBMA 3CP8A 4KX3A 8ICPA 1L6NA 4ED6A 2OM6A 4KLJA 4WJ3B 1K5OA 5AKKA 2C2DA 2W9MA 3S6JA 4DFPA 1X6JA 1XO0A 1CRXA 3OHBA 2MUTA 5KL1B 3F53A 1ZQVA 1VDVA 5AM0A 1SXDA 3SQIA 2YQEA 4Y2XA 2QB0A 4I2JA 2DUYA 1N2XA 3BQ2A 2F2AB 2M0NA 2AHOB 4BUGA 4ECZA 1RZTA 1DK2A 2PFQA 4ICAA 4KITB 5KL8B 5ALVA 4FFDA 4O0IA 3Q8PB 8ICGA 3NGDA 5ALPA 5D4BA 4NLCA 1V9PA 4RNOA 2G5IB 4UB6U 2W3RA 5KG3A 3RBEA 3OJSA 1TK0A 4EBCA 4EYIB 2KFZA 4OJLA 2LYAA 4YR2A 3TAQA 1PVQA 3RJJA 1Z1BA 2KD1A 5KNIA 1X2IA 3Q8KA 4GXKA 5KFTA 2RDJA 4CF5A 5KFEA 8ICOA 3QEAZ 5DG9A 4J9PA 3MR2A 4Q8EA 3AU6A 2DF4B 4M04A 4EBDA 5ALJA 2XICA 2EZZA 2MUTB 4Y2UA 1HJPA 4QZEA 2ES6A 3PSTA 5F9LA 3QU2A 4MFFA 2F1IA 2QB0B 3R9KA 2A19A 5EWEA 1SV0A 1T8EA 3QZ7A 4KLMA 2WF6A 3RR8A 4RUAA 4M9JA 2BGWA 4DOBA 3T5KA 2KICA 3ONNA 8ICLA 1N60A 4F3OA 3AQEA 2WAQC 4AYBF 1OXJA 4B9LA 3AN1A 2KSOA 1QQ7A 5HMLA 1KW4A 2LKYA 3MFHA 1ZJNA 5DBAA 4DSFA 2PFNA 2F8KA 4DQSA 4QIWF 3N7PD 2FLNA 4P0QB 1L3UA 2JEFA 2Q0ZX 4PHPA 2HOQA 2Y1JA 3B0XA 2BCRA 3MABA 3SI8A 2CRXA 4OJOA 2LM1A 2W8KA 3L4PA 4O3QA 5AKGA 3JPSA 2JRZA 4BJQA 3ZDAA 4ED8A 4NJ8A 4F5OA 7ICHA 1BPEA 4UB8U 7ICLA 4Y2QA 4C8MA 3SR6A 5E79U 3NASA 5C5JA 3TARA 4JB3A 1HEKA 5KT5A 3WK8A 4UQGA 9ICXA 5J2EA 4QW9A 3F5AA 2PKEA 2WAQF 3H4DA 1X9SA 2R8KA 5HNKA 3RB6A 1V85A 4G3IA 2KP7A 2WFAA 1BNOA 5J0PA 3MR6A 4P4MA 4DFDA 1TE2A 4M6WA 3AUOA 3H8SA 2H3IA 1ZD2P 4GXJA 2BDPA 2XIDA 2V4QA 8ICXA 2ZXIA 4DEZA 5KFCA 2OH2A 2L5YA 2J6SA 2BHNA 5DQHA 1DRGA 5C0YA 3NTUA 4J03A 3HILA 4C7YA 5DB8A 2F3NA 4F2SA 2G5HB 5KFLA 1QSLA 1ZQEA 1KN5A 1S10A 2KJ9A 4LVSA 5H2FU 2D6FC 4LZGA 3EPGA 9ICBA 3L3FX 3SZ2A 1N5WA 4GXIA 2HBJA 2KG5A 2NRWA 1UT5A 2ZIWA 5J2KA 1ZQMA 2RP5A 3KOOA 4OJ5A 4M6WB 4NLGA 3WKCA 4ZH4A 4I2BA 1T3QA 2FMPA 4KLIA 1BNPA 1ZQNA 1IM4A 4C4TA 4BWJA 4QZAA 5JUMA 5KFMA 1O03A 2EANA 2KK0A 5AK5A 2JEGA 2PMZF 3K75D 1JALA 2V9WA 4KLUA 3N7RC 5J2CA 2AGOA 1TV9A 1X9WA 5J0TA 1XC9A 2HHSA 4QNLA 4B9UA 2CXYA 2ZIUA 3RJFA 4EEYA 2EAPA 7ICIA 4IRCA 4NWIA 1JROA 3IV6A 2PFOA 2LM4A 3IG8A 5ALHA 1BGXT 1ZD3A 1N63A 5AIBA 1PVRA 2YMMA 3ZDEA 4ED3A 4UAVA 7ICMA 4QWBA 4PHEA 4Q45A 1ZQSA 8ICEA 9ICHA 1KL9A 2W7PA 3RRHA 2HSZA 5F9NA 1ZQYA 1SV0C 1L7PA 2ZIWB 1QQ6A 9ICOA 4PPXA 4NL9C 4ELUA 2Y9UA 1Z19A 4F91B 3NRZA 3ZD9A 3HJEA 1DK3A 4XA5A 1NK8A 2OHFA 1FEZA 4ECWA 2KKVA 7ICFA 2JZBA 1WCNA 2W54A 3WU2U 2N1RA 2ZJ8A 1SWVA 3GIIA 2HVHA 5AICA 5ALLA 1Z3EB 4YXMA 3BZKA 5AKLA 2K8BB 2ZIUB 1J2NA 2DBYA 5KG0A 1MQ3A 4I2HA 2MAXA 4UAZA 1ZQIA 3TFRA 5D46A 1IIPA 2G09A 4F4WA 4ECYA 5IIKA 2C2EA 4RQ2A 4PHDA 4YR0A 4JK1A 2LYHA 5AI8A 4O3PA 2P6RA 2JV3A 7ICVA 4CF3A 3DV9A 5J0XA 4M9LA 2MRLA 2QKQA 3KFUF 3PNCA 2YY6A 2PI5A 2ISOA 5KT7A 2KTQA 3QUBA 3KBBA 2BDUA 8ICJA 5G5HA 3C21A 3D2QA 4IQVA 2NV3A 1RDFA 1ZXIA 5AM5A 1T3NA 3WKEA 2WB1C 4KN7A 3M7DA 4DL3A 4RNMA 3GDXA 4RNNA 3AEVA 3NUQA 4UB2A 3UMBA 2JZBB 4CDGA 2ASJA 2ZJAA 2O6KA 5HHIA 2YMLA 2YB1A 2GLEA 2H3QA 3HWTA 3D2SA 2W9AA 2ZTCA 2MA1A 2J6UA 3DEEA 5KFQA 3WK7A 4YFKA 2HOIA 5KFBA 3EUB2 2ZTEA 3JPQA 4TUQA 4IQWA 3QUCA 7ICNA 4PZNA 4GIBA 9ICCA 5AKJA 4GC7A 3M9NB 3D6JA 3HX0A 1L3VA 4USAA
chains in the Genus database with same CATH topology
2K8CB 1MA7A 1TAMA 2G5HB 1WUDA 2ZXHA 1D8BA 2H3FA 2G0AA 2F76X 2OYYA 3RF9A 4QIWC 1ECWA 3F2CA 3GU3A 2KKVA 3IP4B 2HBMA 4U7CA 2KJ9A 1OUQA 2GH1A 1P7DA 3F2BA 2N1RA 2E1EA 3CP8A 2JGAA 4KX3A 2E5SA 4OJPA 2KICA 1L6NA 3ONNA 2KVCA 2OM6A 2KJ8A 2DQNB 2D6FC 2DGZA 4WJ3B 3AQEA 3IG5A 2WAQC 2KKPA 4IC9A 4AYBF 2Y0SF 1URJA 3L3FX 1A6SA 4CRXA 2K8BB 2ZIUB 3D2NA 2ZIVB 2HBJA 2KOBA 2Z7JA 2LKYA 2XVTA 2GOLA 2JH7A 4FZMA 2JH1A 2KEYA 2ZG6A 3MGVA 3N7SC 3SAHA 1CRXA 3H0LB 4C0ZA 3F2DA 1IIPA 2F77X 1ED1A 1UPHA 2G09A 3F53A 3H0RB 5KL1B 2ZIXA 4QIWF 4GFJA 3SMVA 3KZXA 3SQIA 3N7PD 3SAGA 2PMZC 2H3ZA 2KIWA 3SAFA 4P0QB 2ZIWA 3LYSA 1HIWA 2G07A 4JMUA 1XNSA 5C0YA 2HOQA 4A8EA 2RP5A 2E1FA 3F5EA 2VJ4A 1ZQ1C 2VKQA 2VJ5A 4OJ5A 2W7OA 2MRLA 2CRXA 2H3VA 4FE3A 4OJOA 4BX9C 1KBUA 2F2AB 3KFUF 4KMOB 2JHDA 4U6PA 2M0NA 4CGZA 4BUGA 3CYMA 4BJQA 2F8LA 2HBLA 2KHVA 2BDUA 2XI9A 5HR7A 3ICXA 2A3VA 4P0QA 5CRXA 4ICAA 2G06A 3H0MB 4KX5A 3LVVA 5KL8B 3K1ZA 3D2QA 1Q3UA 4P0PB 4FZNA 2NV3A 4PL1A 5A0LA 1Q3VA 2CPRA 3VC8A 2VIXA 2Q4TA 2YB4A 3LVWA 3E0FA 4NLCA 2PMZF 3GZFA 3VCBA 2KHQA 2KV2A 3N7RC 3T79A 2G5IB 2WB1C 3NRWA 1SZHA 3ALRA 4NLBA 3M7DA 3M6ZA 4QNLA 5T14A 1YT3A 1HEKA 2CN1A 2W04A 2LHTA 3PSFA 3AQFA 3IN5A 3NUQA 2ZIUA 2LYAA 4OJLA 2RRDA 2LBOA 1PVPA 4NV0A 2ZIVA 3PSIA 1PVQA 2Y0SC 4CDGA 4NWIA 2G08A 3F5AA 1Z1BA 3CRXA 2WAQF 2KD1A 1XO0A 2OXOA 2YB1A 3HKZC 2H3QA 2JMGA 1A0PA 3IG8A 4O3MA 3D2SA 2KJ5A 2MA1A 2HBKA 3C28A 2K8AA 1T94A 3DEEA 1PVRA 2HOIA 4OJ6A 2YX8A 4FZLA 3AL0B 2DF4B 2KNJA 5HR6A 2K4HA 2XICA 2RHFA 2WB1F 2W7PA 3C29A 2H3IA 3O0FA 2ZIXB 3PZPA 3M6KA 4ACOA 2HOFA 2LYBA 2XIDA 3PSTA 1Z19A 2K89A 2ZIWB 2K4IA 2ZXIA 4PL2A 1NZBA 1GO3F 2HMXA 1F44A 3PSPA 4AYBC 2K4EA 2OH2A 3OPXA 4P0PA 2W03A 3RFAA 4OO1J 1DRGA 3HKZF 2R18A 4QJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB F;  2Y0S F;  2WAQ F;  3HKZ F;  2PMZ F;  2WB1 F; 
#chains in the Genus database with same CATH topology
 4UAW A;  4Q44 A;  2K60 A;  2AH5 A;  3MFI A;  1XS9 D;  1IG6 A;  1UHU A;  2FLP A;  3C1Z A;  4XRH A;  1V97 A;  1P7D A;  5ALW A;  3I1Y A;  1NJW A;  1XSL A;  3IRU A;  1BPB A;  4J9R A;  1KDH A;  3EZ5 A;  3QUT A;  4UAT A;  4ECR A;  4O3S A;  4F5R A;  2EQY A;  2QLT A;  9ICF A;  5DDM A;  2DKX A;  4RPZ A;  3MGV A;  3WK4 A;  4KTQ A;  4F4X A;  3QX7 A;  3KZX A;  4F71 A;  4TQR A;  2E1F A;  5DDY A;  1U48 A;  2BPG A;  2OEH A;  2VJ5 A;  2H3V A;  2UVU A;  3GQC A;  1ZOL A;  7ICP A;  3H0M B;  3MDC A;  3C23 A;  5J0R A;  3TAC B;  4BXO A;  4RU9 A;  2FLL A;  3ALR A;  5J2B A;  1ZQC A;  1PVP A;  3C2K A;  2RRD A;  3PSI A;  2VA8 A;  3DDH A;  1RPL A;  1T4G A;  1ZQT A;  4NM2 A;  4QW8 A;  1B4F A;  1WWV A;  5ALD A;  5DQG A;  4NXZ A;  1ZQD A;  1S0V A;  1QCK A;  4B9M A;  4UW9 A;  1XSN A;  1VLB A;  2C28 A;  1S0O A;  2W9B A;  5AI9 A;  3HKZ F;  3RBD A;  2WF9 A;  1ZET A;  1D9D A;  5AHX A;  1S9F A;  5J0O A;  3BJY A;  1DGJ A;  1UQV A;  2EDU A;  2F76 X;  5III A;  4KLF A;  1SL2 A;  1X66 A;  5AM2 A;  4IS7 A;  5TIS U;  3RJK A;  5CP2 A;  2JGA A;  5IIJ A;  1S8O A;  1PK1 A;  5L1I A;  1ZQG A;  3LWM A;  2KE7 A;  2B0C A;  3IG5 A;  1YZ7 A;  1Z00 B;  3MR5 A;  2VA2 A;  1ZQQ A;  5KFG A;  1S97 A;  2JH1 A;  2EH9 A;  3F2D A;  4DF4 A;  3PML A;  3B0Y A;  2J6T A;  2H3Z A;  2P35 A;  2FJ6 A;  5ALR A;  2FMS A;  1XNS A;  2IOF K;  1MQ2 A;  4FE3 A;  1S76 D;  2R8J A;  8ICN A;  1NI3 A;  1N5X A;  2G06 A;  3H4B A;  1Q3V A;  4Y2V A;  3E0F A;  2EZY A;  5AI5 A;  1Q8K A;  4Z6D A;  2KHQ A;  5TZV A;  2AU0 A;  1NOM A;  5FP0 A;  4YVZ A;  5ALG A;  3PSF A;  2KZ3 A;  5KFU A;  5J0Q A;  2Y0S C;  1NKE A;  1PK1 B;  2BZF A;  3T5J A;  1JXE A;  3QU4 A;  3OGU A;  4ECV A;  4KLS A;  5AIA A;  4DOC A;  2YX8 A;  3BQ1 A;  2KNJ A;  2YN4 A;  2FI1 A;  1BPY A;  5DB9 A;  4RQ4 A;  2BQU A;  2FDR A;  1JRP A;  4YQW A;  3PZP A;  9ICJ A;  2LYB A;  2K4I A;  4TUP A;  2KVS A;  4AYB C;  4Q43 A;  4UB1 A;  1FFU A;  1SGG A;  1WYG A;  5ALU A;  2BPC A;  1TAM A;  4YD1 A;  1TAU A;  1WUD A;  4F93 B;  2NO4 A;  2G0A A;  5ALE A;  3C5F A;  4QIW C;  8ICY A;  2KVC A;  7ICQ A;  2Y0S F;  3A0B U;  3ORY A;  1URJ A;  1RXV A;  1A6S A;  4C8O A;  4R63 A;  4QWA A;  1V38 A;  3NVZ A;  4M2Y A;  2LI6 A;  3H0R B;  4JV1 A;  4EZ6 A;  4CF4 A;  4MEY A;  4BDP A;  1XSP A;  1MC8 A;  5EOZ A;  5KFN A;  2JHD A;  4DS5 A;  2WF7 A;  2KHV A;  4XUS A;  1N56 A;  4RT2 A;  2IHN A;  5A0L A;  2H5X A;  2CPR A;  1L3S A;  3VCB A;  5KFF A;  2ZTD A;  4KLD A;  4DL6 A;  4Y2T A;  5AK6 A;  2ISP A;  3GV8 B;  2ZIV A;  4P4P A;  5KG6 A;  3CRX A;  1JN3 A;  5AM3 A;  1TKD A;  3U26 A;  4ECT A;  1NK6 A;  4B9N A;  1U9L A;  4NLN A;  5J8Y A;  2MU2 A;  2FPL A;  3C28 A;  4R8U A;  8ICI A;  4FS1 A;  4O5E A;  1B43 A;  3A0H U;  3PW4 A;  4K4H A;  3ISD A;  5ALO A;  3M6K A;  1UA0 A;  3CNH A;  2E8P A;  3EPI A;  3V7K A;  4MFC A;  2E8M A;  3UXO A;  2I1Q A;  4P4O A;  3KZI U;  5CJ7 A;  3TQ1 A;  4DF8 A;  2JR5 A;  1RYR A;  2ZXH A;  2XGP A;  5AKX A;  2FPM A;  2KSO B;  3TFS A;  4EX7 A;  4JUZ A;  3GU3 A;  1OUQ A;  4DO9 A;  2E1E A;  3C5G A;  2JXJ A;  5DB6 A;  5GTI U;  4ELV A;  2E8N A;  4RUC A;  2XY7 A;  1S5L U;  2B6G A;  9ICG A;  4ELT A;  4J9Q A;  3M9O B;  3UPQ A;  3SV3 A;  1X9X A;  3D2N A;  2ZIV B;  3UMC A;  4DFM A;  2IMW P;  1X6I A;  5HP4 A;  5ALY A;  3JPT A;  2M9N A;  2PMZ C;  4R8U B;  5AKH A;  4ECS A;  2ESE A;  5KFJ A;  3F5E A;  1RQL A;  4BX9 C;  4C8K A;  1JX4 A;  3T5L A;  4KLH A;  5AM1 A;  3RH4 A;  2A3V A;  4KX5 A;  5ALX A;  2BKE A;  2R8G A;  2Q4T A;  3FAH A;  2KV2 A;  3ZI4 A;  2WHE A;  4EZ9 A;  5L9X A;  2AGP A;  4RT3 A;  4C8N A;  1YT3 A;  2R8I A;  4NV0 A;  4IQT A;  1NK9 A;  9ICL A;  2KIV A;  5DQI A;  3RB4 A;  1KFS A;  3LWL A;  2HBK A;  2K8A A;  3ISB A;  3QE9 Y;  3JPN A;  4KLQ A;  1BPD A;  3H40 A;  9ICK A;  2V4R A;  2HOF A;  4FBT A;  3K1R B;  5AI4 A;  1ZD4 A;  2W9C A;  2GWS A;  4RQ7 A;  4C4R A;  2QAR A;  5ALZ A;  2NRV A;  4YMM A;  5KFR A;  1D9F A;  1HUO A;  5KFA A;  4UB4 A;  8ICB A;  1TAQ A;  5IIL A;  4TUR A;  1SL1 A;  3TAN A;  3OSN A;  2H3F A;  1D8B A;  3ETL A;  3QYP A;  5AKZ A;  4TUS A;  3QU9 A;  3RB3 A;  4DLG A;  4DFK A;  4ED7 A;  3Q8M A;  3QUQ A;  4IC9 A;  5AKY A;  3EYZ A;  4EBE A;  5ALI A;  1L7M A;  2PI4 A;  4RQ6 A;  4J9S A;  2HHT A;  5AI6 A;  3M9M B;  2JEI A;  1K1Q A;  5DG7 A;  3WK5 A;  5D49 A;  2XY5 A;  4RQM A;  4UBB A;  5KG4 A;  3K4G A;  3FYH A;  1LB2 B;  2W9C B;  9ICE A;  3PO5 A;  1J97 A;  2QAR B;  1ZQH A;  1U47 A;  5KT3 A;  3TAD A;  3MR3 A;  8ICM A;  4F4Z A;  3C2M A;  9ICU A;  5ALN A;  4MF8 A;  1SIJ A;  1M6Y A;  3HT3 A;  2CN1 A;  1B0X A;  3RJH A;  5J8Y C;  1PUZ A;  1SKS A;  1H38 A;  9ICM A;  8ICW A;  3QU7 A;  3LDA A;  4QZD A;  4Y2R A;  4R64 A;  1ZYQ A;  1LVH A;  3FDS A;  1JI7 A;  4HYK A;  1NZP A;  3G6Y A;  5KT6 A;  3UQ2 A;  5CEH A;  1U45 A;  3UXN A;  3OPX A;  4EYH B;  1IXR A;  3PVX A;  4YP3 A;  5BPC A;  3H7I A;  2AXT U;  1B22 A;  4BGD A;  1KEJ A;  2AQ4 A;  4YN4 A;  4FS2 A;  4PGQ A;  5J0S A;  5CA7 A;  5KFK A;  3RH5 A;  4IL6 U;  3G6X A;  2A1J A;  1L7O A;  2DWQ A;  3V6H A;  4AP9 A;  4DQP A;  4I2C A;  3BQ0 A;  2NRX A;  4CRX A;  2HW3 A;  5J2H A;  2F1H A;  1MA7 A;  5AK3 A;  4QZ9 A;  1HUZ A;  1FO4 A;  3SAG A;  1NJX A;  4KLE A;  3LYS A;  1QSY A;  2G07 A;  4RQ5 A;  4YR3 A;  2VAN A;  3IHQ B;  4DLE A;  4DSE A;  3PW5 A;  5EWG A;  8ICF A;  3TAP A;  4OD0 A;  4CGZ A;  5EE9 A;  4C8L A;  4F4Y A;  2BPF A;  4JV0 A;  1SL0 A;  2P66 A;  1F5S A;  3LVV A;  1Q3U A;  5HHH A;  3TI0 A;  4I2F A;  4RQ1 A;  8ICU A;  3N28 A;  2KN7 A;  3EWA A;  3HPO A;  2HCF A;  4XQ8 A;  8ICZ A;  5T14 A;  2A1J B;  2LBO A;  2OWO A;  3GV7 B;  4IRD A;  4FBU A;  3PX6 A;  3HKZ C;  3QZ8 A;  5DB7 A;  2JMG A;  5J29 A;  4OJ6 A;  3AL0 B;  3RJI A;  4F5Q A;  4J9O A;  3ETR A;  3V6K A;  4BWM A;  2RDI A;  2E3T A;  1GO3 F;  3WKD A;  3PSP A;  4YCX A;  2FE9 A;  8ICS A;  4QJF B;  1Y88 A;  2K8C B;  3H8J A;  3H8M A;  4LZD A;  3MGH A;  3SV4 A;  4I2G A;  1YZ6 A;  1PZN A;  2Y9T A;  5IIO A;  4M9G A;  5KT4 A;  4PGY A;  4I2E A;  4Z6E A;  4RZR A;  4US9 A;  4O5K A;  4RPY A;  3ISC A;  1K1S A;  2KZM A;  3CW2 C;  3NVY A;  1IV8 A;  2KOB A;  2JEJ A;  2ZIX A;  5JTI A;  4JMU A;  3T5H A;  4I27 A;  2IOF A;  1KFT A;  1KBU A;  4BXO B;  5J2D A;  4Z6F A;  3E2E A;  2HI0 A;  4PH5 A;  4MEX A;  8ICT A;  2F8L A;  5CRX A;  1JUD A;  3OTQ A;  2NYV A;  4PL1 A;  3WK9 A;  4M0A A;  4Y2J A;  2W3S A;  1EXN A;  3GIL A;  3M6Z A;  5DBC A;  7ICR A;  4QZB A;  2Y1I A;  3PW2 A;  4Q8F A;  1WCL A;  4TQS A;  4I28 A;  1DXS A;  5CWR A;  3KHL A;  3RRG A;  4PZO A;  4O3R A;  3I28 A;  5KFI A;  3HW8 A;  5G5G A;  5KFP A;  4F5N A;  3KD3 A;  3BS7 A;  2I6X A;  3BS5 A;  2W9B B;  1T94 A;  1UA1 A;  4FZL A;  4US8 A;  4R66 A;  2RHF A;  2ASL A;  3C29 A;  2ZIX B;  3KKA A;  2HHU A;  4B9T A;  2I5H A;  8ICH A;  4MFA A;  1L3T A;  3KHH A;  4GLX A;  4P0P A;  1DOQ A;  2W03 A;  4DFJ A;  3JPP A;  2HHX A;  2R18 A;  2HHW A;  4I2D A;  4DSI A;  2DFL A;  2ALZ A;  3RF9 A;  7ICK A;  3GIM A;  2F44 A;  2GH1 A;  1Z4N A;  3MBY A;  1ZQK A;  4JV2 A;  4CCH A;  4NLZ A;  1ZQR A;  9ICV A;  2MSN A;  4YG2 A;  3PO4 A;  4DL2 A;  3UM9 A;  4G9B A;  4DQQ A;  5DGA A;  2EAO A;  1XO1 A;  2GOL A;  2JH7 A;  5ALF A;  2ZG6 A;  3G6V A;  3H0L B;  1JMS A;  1ED1 A;  1UPH A;  5KAI U;  1TFR A;  2KIW A;  3BS5 B;  1U49 A;  3HRD D;  4C4S A;  5DG8 A;  3MDA A;  2IA6 A;  4F8R A;  3GV5 B;  2E8O A;  5CR0 A;  3KHG A;  4B9V A;  1J2M A;  4KN4 A;  1D8L A;  1MN8 A;  5BOL A;  2WTF A;  3M8R A;  2NO5 A;  2XY6 A;  3UMG A;  1NKC A;  3BZC A;  2W11 A;  4P0Q A;  1ZQO A;  4B6J A;  4P0P B;  4JWM A;  2HDO A;  5DKW A;  4UBC A;  2VIX A;  2RQ5 A;  1KLN A;  3GZF A;  3WKA A;  2BR0 A;  4NLB A;  9ICQ A;  5L1L A;  1RG6 A;  2LHT A;  2XO7 A;  5DBB A;  1X42 A;  5L1K A;  2G08 A;  2C2R A;  3C2L A;  1KSP A;  1KKX A;  1COK A;  3MGI A;  4LJX A;  4UAS A;  7ICG A;  4NL9 A;  4EEN A;  1A77 A;  2K4H A;  3NS1 A;  4IQU A;  9ICN A;  1NKB A;  1RYS A;  1SB3 C;  3O0F A;  4J9M A;  2W55 A;  5KFX A;  9ICT A;  5K4L A;  4J9L A;  2HHV A;  3SD7 A;  1ZQZ A;  5B5E U;  2HMX A;  1RXW A;  1BPZ A;  5ALT A;  4KLT A;  1MSW D;  7ICJ A;  4F5P A;  1C7Y A;  1QQ5 A;  8ICQ A;  3WKB A;  4DQR A;  2D3D A;  4CNQ A;  2YTU A;  5J2A A;  1FFV A;  2BCS A;  1CUK A;  2LMR A;  5IIN A;  3IP4 B;  5KFZ A;  4U7C A;  4PGX A;  2AJQ A;  4DOA A;  5CB1 A;  5EE1 A;  3PR5 B;  2E5S A;  1L8L A;  2KJ8 A;  1JXL A;  1L8O A;  2DGZ A;  3RB0 A;  1LV5 A;  5KG5 A;  4J9K A;  3AM9 A;  2YMQ A;  4QZH A;  5KFD A;  5F3X B;  2OCE A;  3SAF A;  2QB1 A;  5J2I A;  1RQN A;  3OSP A;  2WF5 A;  2EAM A;  1HIW A;  2ZUC A;  3IDW A;  2A1A A;  1WWU A;  3SEN A;  4M47 A;  5ALM A;  1SWW A;  4KMO B;  5L1J A;  3UQ0 A;  1Z1V A;  2ODG A;  1X9M A;  2HHQ A;  4ED2 A;  1N61 A;  1N48 A;  3ZDB A;  4UAU A;  1SKR A;  1ZQU A;  3VC8 A;  4ECU A;  4ED0 A;  4QWC A;  5ALS A;  1XU4 A;  3AQF A;  3N97 B;  4DL7 A;  8ICV A;  5JRT A;  5B66 U;  4YXJ A;  2BCV A;  4I29 A;  3KKA C;  2B21 A;  1QSS A;  4O5C A;  2XCA A;  4K4G A;  4F50 A;  1T7P A;  4ACO A;  3PY8 A;  3RR7 A;  1DGS A;  1F44 A;  1ZQL A;  3ZDC A;  4RQ8 A;  5KFS A;  1UCV A;  4E0D A;  3GIK A;  4P2H A;  4UAY A;  3V7J A;  4IR1 A;  4J9N A;  4FO6 A;  3F2B A;  3V6J A;  1KFD A;  4M9H A;  2DQN B;  4EEK A;  2DPJ A;  9ICI A;  1UT8 A;  2KKP A;  5AKE A;  4UB3 A;  3AU2 A;  1A76 A;  4YD2 A;  4O3O A;  3OJU A;  4KLL A;  1OW5 A;  2XVT A;  1N62 A;  2KEY A;  3SAH A;  9ICA A;  4NM1 A;  4ECX A;  2F77 X;  1D8Y A;  1L7N A;  2BQ3 A;  5KG1 A;  4F72 A;  1ZQJ A;  3MC1 A;  2DKZ A;  2KZZ A;  7ICS A;  2VKQ A;  4EEL A;  5DGB A;  2KFN A;  2AQ0 A;  1NJZ A;  5HR7 A;  2HBL A;  1VJ5 A;  2ZUB A;  4JWN A;  4RQ0 A;  2VA3 A;  1ZRN A;  3K1Z A;  3L5K A;  4DL4 A;  3RJE A;  4RQN A;  3E58 A;  5J0W A;  3NRW A;  1WG8 A;  3GFK B;  1SKW A;  4Y2P A;  3PR4 A;  7ICE A;  3TKA A;  2NRZ A;  4KMU A;  1ZQA A;  1C20 A;  1F0M A;  3GIJ A;  1A0P A;  4R65 A;  1NK7 A;  5EWF A;  2KJ5 A;  2DL0 A;  4O9M A;  4I2A A;  4DWI A;  1SXE A;  4IR9 A;  2PXI A;  3RJG A;  5AK4 A;  4M9N A;  4KLO A;  4F2R A;  5KFO A;  3PV8 A;  3RAX A;  1U4B A;  5KTQ A;  3QEB Z;  4DQI A;  4IRK A;  3SEI A;  4B9S A;  3H8W A;  1BVS A;  4DS4 A;  3AMZ A;  3RAQ A;  4EX6 A;  5J0Y A;  1ECW A;  1KQQ A;  2LPE A;  3PMN A;  2K4P A;  4K4I A;  2AGQ A;  4RQ3 A;  3C1Y A;  5AI0 A;  5EE3 A;  5ALK A;  4ZOH C;  3NVV A;  4QZI A;  4YMO A;  3LK9 A;  5J2F A;  3Q8S B;  2BCQ A;  4ED1 A;  5HMM A;  1NK0 A;  1ZQB A;  3THV A;  2Z7J A;  9ICS A;  4DSL A;  5CHG A;  2ASD A;  4C0Z A;  1ZQF A;  2XCP A;  5KFY A;  1NK4 A;  3SYZ A;  1CI4 A;  4GC6 A;  4NY8 A;  3PX0 A;  3JPO A;  2KMD A;  1ARO P;  2NRT A;  2YMP A;  2EZX A;  1COO A;  1FIQ A;  1LKY A;  4O3N A;  5KFW A;  4QZG A;  9ICR A;  3FC4 A;  8ICC A;  4HAI A;  1ZRM A;  2P6U A;  3CYM A;  3FM9 A;  4C7Z A;  4QWE A;  2XI9 A;  1ZJM A;  3ICX A;  4C80 A;  3IM1 A;  5J0U A;  4QZF A;  2IOH A;  4FZN A;  3J81 j;  1AQ6 A;  3QXG A;  5KG7 A;  3RH6 A;  2YB4 A;  3HP6 A;  3M1Y A;  3T79 A;  2FMQ A;  3UXP A;  3B9J A;  1ZD5 A;  3RTV A;  2W04 A;  1JIH A;  3IN5 A;  4QZC A;  3PX4 A;  1CEZ A;  2FPK A;  1L5U A;  1KTQ A;  3I76 A;  4O3M A;  2GO7 A;  3QNM A;  3PW0 A;  3WK6 A;  3Q8L A;  4DSK A;  2BCU A;  1NJY A;  2UVV A;  2WB1 F;  4MHV A;  4PJ0 U;  1NK5 A;  2I9G A;  5J2G A;  2K4E A;  1PK3 A;  1RYU A;  4DL5 A;  8ICK A;  3RFA A;  8ICR A;  4OO1 J;  3V7L A;  2UVR A;  3BQ7 A;  3M8S A;  1ZQX A;  4F4K A;  1LKY B;  1BPX A;  8ICA A;  2C22 A;  3V72 A;  4DCC A;  4UB5 A;  1NNL A;  2RLT A;  1S0N A;  4OJP A;  3EW9 A;  4KLG A;  1TK5 A;  3Q8Q B;  2DPI A;  1QH9 A;  1QLN A;  5BOM A;  4CE6 A;  4QWD A;  1TVA A;  9ICW A;  3T3F A;  3OHA A;  4NLK A;  4I2I A;  4UAR A;  4FZM A;  3N7S C;  1ZQW A;  4GFJ A;  3SMV A;  1TK8 A;  2R8H A;  5GTH U;  1Z00 A;  5KFV A;  4A8E A;  4YMN A;  2VJ4 A;  1S77 D;  1ZQ1 C;  4X5V A;  7ICT A;  2W7O A;  4Y2Y A;  3PW7 A;  2IHM A;  4U6P A;  2HVI A;  4Y2S A;  5ALQ A;  5J2J A;  7ICO A;  5AKI A;  1ZQP A;  3ED5 A;  1Z4O A;  5JU5 A;  2ZUD A;  3JPR A;  3LVW A;  5L1M A;  1QTM A;  4OCZ A;  1SZH A;  3Q8R B;  1S0M A;  2UVW A;  9ICP A;  5AM4 A;  7ICU A;  3NVW A;  3KHR A;  5DLF A;  2PFP A;  3ZDD A;  4F92 B;  2ATL A;  2OXO A;  3BQT A;  2W8L A;  3TAD C;  4DSJ A;  4QZ8 A;  3QU5 A;  1KRP A;  1SV4 A;  3N4M B;  2F1J A;  2XGQ A;  5HR6 A;  2W43 A;  2ZJ5 A;  1RM6 C;  5DLG A;  5KAF U;  3ZD8 A;  4RPX A;  5KT2 A;  4ECQ A;  3KTQ A;  1SZP A;  2IBK A;  2K89 A;  4PL2 A;  1NZB A;  4PHA A;  3BDP A;  4Z6C A;  1X40 A;  2BQR A;  1O08 A;  5EE0 A;  5KG2 A;  4MF2 A;  1Q46 A;  2OYY A;  2XC9 A;  2WF8 A;  5IIM A;  3F2C A;  5KFH A;  1XWL A;  2D8C A;  2HBM A;  3CP8 A;  4KX3 A;  8ICP A;  1L6N A;  4ED6 A;  2OM6 A;  4KLJ A;  4WJ3 B;  1K5O A;  5AKK A;  2C2D A;  2W9M A;  3S6J A;  4DFP A;  1X6J A;  1XO0 A;  1CRX A;  3OHB A;  2MUT A;  5KL1 B;  3F53 A;  1ZQV A;  1VDV A;  5AM0 A;  1SXD A;  3SQI A;  2YQE A;  4Y2X A;  2QB0 A;  4I2J A;  2DUY A;  1N2X A;  3BQ2 A;  2F2A B;  2M0N A;  2AHO B;  4BUG A;  4ECZ A;  1RZT A;  1DK2 A;  2PFQ A;  4ICA A;  4KIT B;  5KL8 B;  5ALV A;  4FFD A;  4O0I A;  3Q8P B;  8ICG A;  3NGD A;  5ALP A;  5D4B A;  4NLC A;  1V9P A;  4RNO A;  2G5I B;  4UB6 U;  2W3R A;  5KG3 A;  3RBE A;  3OJS A;  1TK0 A;  4EBC A;  4EYI B;  2KFZ A;  4OJL A;  2LYA A;  4YR2 A;  3TAQ A;  1PVQ A;  3RJJ A;  1Z1B A;  2KD1 A;  5KNI A;  1X2I A;  3Q8K A;  4GXK A;  5KFT A;  2RDJ A;  4CF5 A;  5KFE A;  8ICO A;  3QEA Z;  5DG9 A;  4J9P A;  3MR2 A;  4Q8E A;  3AU6 A;  2DF4 B;  4M04 A;  4EBD A;  5ALJ A;  2XIC A;  2EZZ A;  2MUT B;  4Y2U A;  1HJP A;  4QZE A;  2ES6 A;  3PST A;  5F9L A;  3QU2 A;  4MFF A;  2F1I A;  2QB0 B;  3R9K A;  2A19 A;  5EWE A;  1SV0 A;  1T8E A;  3QZ7 A;  4KLM A;  2WF6 A;  3RR8 A;  4RUA A;  4M9J A;  2BGW A;  4DOB A;  3T5K A;  2KIC A;  3ONN A;  8ICL A;  1N60 A;  4F3O A;  3AQE A;  2WAQ C;  4AYB F;  1OXJ A;  4B9L A;  3AN1 A;  2KSO A;  1QQ7 A;  5HML A;  1KW4 A;  2LKY A;  3MFH A;  1ZJN A;  5DBA A;  4DSF A;  2PFN A;  2F8K A;  4DQS A;  4QIW F;  3N7P D;  2FLN A;  4P0Q B;  1L3U A;  2JEF A;  2Q0Z X;  4PHP A;  2HOQ A;  2Y1J A;  3B0X A;  2BCR A;  3MAB A;  3SI8 A;  2CRX A;  4OJO A;  2LM1 A;  2W8K A;  3L4P A;  4O3Q A;  5AKG A;  3JPS A;  2JRZ A;  4BJQ A;  3ZDA A;  4ED8 A;  4NJ8 A;  4F5O A;  7ICH A;  1BPE A;  4UB8 U;  7ICL A;  4Y2Q A;  4C8M A;  3SR6 A;  5E79 U;  3NAS A;  5C5J A;  3TAR A;  4JB3 A;  1HEK A;  5KT5 A;  3WK8 A;  4UQG A;  9ICX A;  5J2E A;  4QW9 A;  3F5A A;  2PKE A;  2WAQ F;  3H4D A;  1X9S A;  2R8K A;  5HNK A;  3RB6 A;  1V85 A;  4G3I A;  2KP7 A;  2WFA A;  1BNO A;  5J0P A;  3MR6 A;  4P4M A;  4DFD A;  1TE2 A;  4M6W A;  3AUO A;  3H8S A;  2H3I A;  1ZD2 P;  4GXJ A;  2BDP A;  2XID A;  2V4Q A;  8ICX A;  2ZXI A;  4DEZ A;  5KFC A;  2OH2 A;  2L5Y A;  2J6S A;  2BHN A;  5DQH A;  1DRG A;  5C0Y A;  3NTU A;  4J03 A;  3HIL A;  4C7Y A;  5DB8 A;  2F3N A;  4F2S A;  2G5H B;  5KFL A;  1QSL A;  1ZQE A;  1KN5 A;  1S10 A;  2KJ9 A;  4LVS A;  5H2F U;  2D6F C;  4LZG A;  3EPG A;  9ICB A;  3L3F X;  3SZ2 A;  1N5W A;  4GXI A;  2HBJ A;  2KG5 A;  2NRW A;  1UT5 A;  2ZIW A;  5J2K A;  1ZQM A;  2RP5 A;  3KOO A;  4OJ5 A;  4M6W B;  4NLG A;  3WKC A;  4ZH4 A;  4I2B A;  1T3Q A;  2FMP A;  4KLI A;  1BNP A;  1ZQN A;  1IM4 A;  4C4T A;  4BWJ A;  4QZA A;  5JUM A;  5KFM A;  1O03 A;  2EAN A;  2KK0 A;  5AK5 A;  2JEG A;  2PMZ F;  3K75 D;  1JAL A;  2V9W A;  4KLU A;  3N7R C;  5J2C A;  2AGO A;  1TV9 A;  1X9W A;  5J0T A;  1XC9 A;  2HHS A;  4QNL A;  4B9U A;  2CXY A;  2ZIU A;  3RJF A;  4EEY A;  2EAP A;  7ICI A;  4IRC A;  4NWI A;  1JRO A;  3IV6 A;  2PFO A;  2LM4 A;  3IG8 A;  5ALH A;  1BGX T;  1ZD3 A;  1N63 A;  5AIB A;  1PVR A;  2YMM A;  3ZDE A;  4ED3 A;  4UAV A;  7ICM A;  4QWB A;  4PHE A;  4Q45 A;  1ZQS A;  8ICE A;  9ICH A;  1KL9 A;  2W7P A;  3RRH A;  2HSZ A;  5F9N A;  1ZQY A;  1SV0 C;  1L7P A;  2ZIW B;  1QQ6 A;  9ICO A;  4PPX A;  4NL9 C;  4ELU A;  2Y9U A;  1Z19 A;  4F91 B;  3NRZ A;  3ZD9 A;  3HJE A;  1DK3 A;  4XA5 A;  1NK8 A;  2OHF A;  1FEZ A;  4ECW A;  2KKV A;  7ICF A;  2JZB A;  1WCN A;  2W54 A;  3WU2 U;  2N1R A;  2ZJ8 A;  1SWV A;  3GII A;  2HVH A;  5AIC A;  5ALL A;  1Z3E B;  4YXM A;  3BZK A;  5AKL A;  2K8B B;  2ZIU B;  1J2N A;  2DBY A;  5KG0 A;  1MQ3 A;  4I2H A;  2MAX A;  4UAZ A;  1ZQI A;  3TFR A;  5D46 A;  1IIP A;  2G09 A;  4F4W A;  4ECY A;  5IIK A;  2C2E A;  4RQ2 A;  4PHD A;  4YR0 A;  4JK1 A;  2LYH A;  5AI8 A;  4O3P A;  2P6R A;  2JV3 A;  7ICV A;  4CF3 A;  3DV9 A;  5J0X A;  4M9L A;  2MRL A;  2QKQ A;  3KFU F;  3PNC A;  2YY6 A;  2PI5 A;  2ISO A;  5KT7 A;  2KTQ A;  3QUB A;  3KBB A;  2BDU A;  8ICJ A;  5G5H A;  3C21 A;  3D2Q A;  4IQV A;  2NV3 A;  1RDF A;  1ZXI A;  5AM5 A;  1T3N A;  3WKE A;  2WB1 C;  4KN7 A;  3M7D A;  4DL3 A;  4RNM A;  3GDX A;  4RNN A;  3AEV A;  3NUQ A;  4UB2 A;  3UMB A;  2JZB B;  4CDG A;  2ASJ A;  2ZJA A;  2O6K A;  5HHI A;  2YML A;  2YB1 A;  2GLE A;  2H3Q A;  3HWT A;  3D2S A;  2W9A A;  2ZTC A;  2MA1 A;  2J6U A;  3DEE A;  5KFQ A;  3WK7 A;  4YFK A;  2HOI A;  5KFB A;  3EUB 2;  2ZTE A;  3JPQ A;  4TUQ A;  4IQW A;  3QUC A;  7ICN A;  4PZN A;  4GIB A;  9ICC A;  5AKJ A;  4GC7 A;  3M9N B;  3D6J A;  3HX0 A;  1L3V A;  4USA A; 
#chains in the Genus database with same CATH homology
 2K8C B;  1MA7 A;  1TAM A;  2G5H B;  1WUD A;  2ZXH A;  1D8B A;  2H3F A;  2G0A A;  2F76 X;  2OYY A;  3RF9 A;  4QIW C;  1ECW A;  3F2C A;  3GU3 A;  2KKV A;  3IP4 B;  2HBM A;  4U7C A;  2KJ9 A;  1OUQ A;  2GH1 A;  1P7D A;  3F2B A;  2N1R A;  2E1E A;  3CP8 A;  2JGA A;  4KX3 A;  2E5S A;  4OJP A;  2KIC A;  1L6N A;  3ONN A;  2KVC A;  2OM6 A;  2KJ8 A;  2DQN B;  2D6F C;  2DGZ A;  4WJ3 B;  3AQE A;  3IG5 A;  2WAQ C;  2KKP A;  4IC9 A;  4AYB F;  2Y0S F;  1URJ A;  3L3F X;  1A6S A;  4CRX A;  2K8B B;  2ZIU B;  3D2N A;  2ZIV B;  2HBJ A;  2KOB A;  2Z7J A;  2LKY A;  2XVT A;  2GOL A;  2JH7 A;  4FZM A;  2JH1 A;  2KEY A;  2ZG6 A;  3MGV A;  3N7S C;  3SAH A;  1CRX A;  3H0L B;  4C0Z A;  3F2D A;  1IIP A;  2F77 X;  1ED1 A;  1UPH A;  2G09 A;  3F53 A;  3H0R B;  5KL1 B;  2ZIX A;  4QIW F;  4GFJ A;  3SMV A;  3KZX A;  3SQI A;  3N7P D;  3SAG A;  2PMZ C;  2H3Z A;  2KIW A;  3SAF A;  4P0Q B;  2ZIW A;  3LYS A;  1HIW A;  2G07 A;  4JMU A;  1XNS A;  5C0Y A;  2HOQ A;  4A8E A;  2RP5 A;  2E1F A;  3F5E A;  2VJ4 A;  1ZQ1 C;  2VKQ A;  2VJ5 A;  4OJ5 A;  2W7O A;  2MRL A;  2CRX A;  2H3V A;  4FE3 A;  4OJO A;  4BX9 C;  1KBU A;  2F2A B;  3KFU F;  4KMO B;  2JHD A;  4U6P A;  2M0N A;  4CGZ A;  4BUG A;  3CYM A;  4BJQ A;  2F8L A;  2HBL A;  2KHV A;  2BDU A;  2XI9 A;  5HR7 A;  3ICX A;  2A3V A;  4P0Q A;  5CRX A;  4ICA A;  2G06 A;  3H0M B;  4KX5 A;  3LVV A;  5KL8 B;  3K1Z A;  3D2Q A;  1Q3U A;  4P0P B;  4FZN A;  2NV3 A;  4PL1 A;  5A0L A;  1Q3V A;  2CPR A;  3VC8 A;  2VIX A;  2Q4T A;  2YB4 A;  3LVW A;  3E0F A;  4NLC A;  2PMZ F;  3GZF A;  3VCB A;  2KHQ A;  2KV2 A;  3N7R C;  3T79 A;  2G5I B;  2WB1 C;  3NRW A;  1SZH A;  3ALR A;  4NLB A;  3M7D A;  3M6Z A;  4QNL A;  5T14 A;  1YT3 A;  1HEK A;  2CN1 A;  2W04 A;  2LHT A;  3PSF A;  3AQF A;  3IN5 A;  3NUQ A;  2ZIU A;  2LYA A;  4OJL A;  2RRD A;  2LBO A;  1PVP A;  4NV0 A;  2ZIV A;  3PSI A;  1PVQ A;  2Y0S C;  4CDG A;  4NWI A;  2G08 A;  3F5A A;  1Z1B A;  3CRX A;  2WAQ F;  2KD1 A;  1XO0 A;  2OXO A;  2YB1 A;  3HKZ C;  2H3Q A;  2JMG A;  1A0P A;  3IG8 A;  4O3M A;  3D2S A;  2KJ5 A;  2MA1 A;  2HBK A;  3C28 A;  2K8A A;  1T94 A;  3DEE A;  1PVR A;  2HOI A;  4OJ6 A;  2YX8 A;  4FZL A;  3AL0 B;  2DF4 B;  2KNJ A;  5HR6 A;  2K4H A;  2XIC A;  2RHF A;  2WB1 F;  2W7P A;  3C29 A;  2H3I A;  3O0F A;  2ZIX B;  3PZP A;  3M6K A;  4ACO A;  2HOF A;  2LYB A;  2XID A;  3PST A;  1Z19 A;  2K89 A;  2ZIW B;  2K4I A;  2ZXI A;  4PL2 A;  1NZB A;  1GO3 F;  2HMX A;  1F44 A;  3PSP A;  4AYB C;  2K4E A;  2OH2 A;  3OPX A;  4P0P A;  2W03 A;  3RFA A;  4OO1 J;  1DRG A;  3HKZ F;  2R18 A;  4QJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...